3HSEA

Crystal structure of staphylococcus aureus protein sarz in reduced form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
116
Chain Sequence
b'GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDENIKKLGERVFLDSGTLTPLLKKLKDYTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator sarZ
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
total genus 40
structure length 116
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hseA00
3RJPA 1TQPA 4MHGA 4I7HA 4PGGA 3MCZA 1JXSA 1QZZA 4GCVA 1YFHA 5F6FA 4KYWA 5HS9A 5AIPA 5ILVA 2WWYA 1CGPA 1WKMA 5J8FA 3BJAA 4OOIA 1W7PD 4PGHA 4HDUA 1FP1D 4U88A 1FBQA 1R5HA 1T98A 2P7CB 3QOPA 3L9FA 3P9KA 4LJZF 1IRGA 2H6CA 4OIQF 3F8BA 2A6EF 4RAYA 3VOEA 4O3MA 2FOKA 4U0VA 3TOBA 3DKWA 4UV9A 3RDIA 2F2EA 3SHFA 4N9HA 5BS6A 5FFXA 1UHMA 2DO7A 2JPBA 2FMYA 2ZNYA 4A0XA 2A61A 4L9NA 2R7FA 2AXLA 4M74A 3QU3A 1EV7A 2ZXJA 3R4KA 4WK8F 2E1CA 5K1YA 5IT9Z 2NAZA 5L3GA 4K2EA 1YLFA 3ABUA 1MJAA 2G9WA 2K4BA 2IW5A 2PEXA 3ZMUA 1I6XA 4MEYF 5KVRA 3DV8A 3K1MA 3KZZA 3VFZA 1G3YA 3I54A 4KN7X 2FSWA 2D45A 3BZ6A 5CVIA 3R60A 4G7ZF 5HVQC 5L3BA 3H92A 4CO8A 2YR2A 1IRFA 1QBJA 3TO7A 2F5FA 2CQKA 3K0LA 1B9MA 4G94A 1J9IA 3RYPA 1XGSA 1YS6A 3QAHA 1V4RA 1ONVA 2XVCA 3CUOA 3WU1B 1HXDA 4HV5A 4AIJA 1HKTA 3L00A 3I4PA 2EJRA 1W5SA 2Q2EA 2ZKZA 2ZO4A 1ZRFA 3HTSB 1LNWA 3JAMK 2HWVA 3ZN1A 3ML6A 2UXNA 1ZYRF 2XAQA 4HX7A 5FLXZ 5DYMA 4WXDA 2P5KA 3QP6A 1I5ZA 2D1VA 1J5YA 4XLPF 1IW7F 1S6LA 1FYMA 2UZKA 1F4KA 3P7NA 5DDGA 1B4AA 2ESNA 3ROUA 4OMZA 3N4MA 4XSXF 1IN7A 2BYVE 3W6JB 3L2CA 2Q8KA 5HLHA 1B59A 4L5JA 1D8KA 2WV0A 5F64A 1DP7P 1T2KA 3H3ZA 2Q0OA 5A2QK 1O7LA 1FBUA 3BP8A 3J80K 3PQKA 3KLOA 3I5UA 2DI3A 5LGNA 4ESJA 1BIBA 3QU6A 2LSOA 1XN7A 3GFIA 4UV8A 3CUQC 1U78A 4XLNF 3CO6C 5LHIA 1P4WA 3E6MA 5DUKA 2QLZA 2HDCA 3DFGA 5H6QA 4ENJA 3F6VA 4OIPF 1IUYA 2CGPA 3N97A 4Q48A 2CW0F 4IRHA 2WTEA 5LHHA 4HF0A 1TNTA 4Q5SF 3RKYA 2YSRA 4LD5A 5AIQA 3CDHA 4N9IA 1EH8A 1FOKA 1IAWA 3GWZA 2JRTA 2OZ6A 3EYIA 1P4AA 5CLSA 2EV5A 4I98B 4UHTA 2A07F 2FF4A 4KT5C 2CYYA 1PP8F 3LQRA 2O0YA 5J8CA 2XAHA 4IHTA 1RUOA 2DK8A 3ELKA 3DP7A 2P6TA 2OBPA 3QP5A 4RAZA 3KP4A 4OMYA 5ERIA 2YPRA 3J81K 4MEXF 3LA2A 5D5XB 1CF7B 3DPTA 1O3SA 5LGTA 4MTEA 3C1DA 3F8FA 3HUGA 1LB2A 3VODA 2MH2A 5JFRA 3MEXA 3K1NA 4LLGF 5FD5A 1S8NA 1GXPA 3DEUA 3V4GA 5DCMA 1KU2A 3HSRA 5JI6A 1F5TA 1UCRA 4I0AA 4R1HA 2M30A 2PFBA 3F72A 4WWCA 2ZMEB 2K7LA 5E8IA 3Q9SA 4M73A 4RGSA 4MQVA 3EYYA 2HZTA 2L54A 4O5VA 2ACJA 5ED4A 3I58A 1LEAA 2L01A 4HF1A 4KN4X 1JGSA 2HKOA 4M6XA 4YFKF 2A69F 1ON2A 2KRFA 5BQTA 1YG2A 2O61A 5HS8A 2ZFWA 1ZGAA 4KUMA 4DQ2A 3CUQB 1Z1DA 4G6QA 2M1BA 4ASNA 1U5TB 2EWNA 2GAUA 2HYGD 3ZMZA 5TJJA 2EB7A 4LG0A 3KEQA 4HV6A 1USTA 4U0WA 1U3EM 1QZYA 1FP2A 1MKMA 1R23A 3O2PE 3OOPA 1O7FA 2GIVA 2FBHA 1B9NA 1IF1A 3LAPA 2UXXA 1SFXA 1ZREA 1NHAA 3GO5A 1W7PB 3P9IA 3ULQB 4I2OA 3B02A 4UVCA 1IXSB 1KGSA 5LRRA 5E20A 2QYOA 1JHHA 3RI4A 3MFKA 2EFWA 3D0SA 1KQ8A 1D5VA 4HBLA 1HSTA 2IRFG 4WCGA 4EV0A 1B1BA 3SXYA 3KEOA 3QPTA 3EUHA 1IZ1A 3BJ6A 3O3KA 3C7JA 1SD5A 3K2ZA 2YX4A 2VOPA 1KU9A 2RVCA 4G9YA 1ZGJA 4WXCA 3FMQA 4A6EA 3CLOA 4OIOF 5HLIA 3KP6A 3LAJA 2OQGA 3TGNA 1ZH5A 2M87A 1HSJA 5F1RA 2HTSA 3NEUA 1I27A 4R8HA 1BC8C 3VEPA 4JK1X 1YW7A 1G3WA 2NRAC 3IKTA 1X3UA 2VN2A 2M5WA 3ZMVA 4L9TA 4ENNA 4JBAA 4ZYDA 2PBIA 1J75A 1KQ0A 2OZUA 4RB0A 4NQWA 5BPDA 2M8EA 2PLYA 3E5UA 2QVOA 4KIBA 2DPUA 2HEOA 2VXZA 1AWCA 3DPLC 3TDZC 3M7GA 2P5LC 4ENMA 5HDKA 2JSCA 5E8GA 3E6BA 3NRVA 1P92A 2FA5A 4H0EA 5LBQA 1TTYA 1FY7A 3JTGA 1ZG5A 1TW3A 4EQQA 1KU7A 3IWZA 2ELHA 2XV4S 1ZARA 2F5EA 3KZYA 2QBYB 3O6BB 2A3SA 2L3DA 4PCQA 3FM5A 4KIFA 4EM0B 4U7BA 4KICA 2STTA 3ZPLA 2OD5A 2VC0A 4ZYHA 3R61A 4RS8A 5H20A 3QPHA 5LGUA 5E17F 3AAFA 4BAYA 1D3YA 1RUNA 5D8KB 4HX8A 4NHJA 1BJAA 1W4MA 3JAMZ 2IT0A 2M45A 4HQEA 4P5OA 1BI2A 4CYDA 3ZP5A 2HTJA 2GZWA 3WGGA 1IN4A 2OQRA 4XBFA 2GXBA 1G3SA 1Z7UA 3I64A 5HOOA 1TBXA 2RV8A 5L3CA 4EMSA 2XKPA 3IC7A 1O3TA 5CVUA 2PI0A 4P55A 2DBBA 2FNPA 2G7UA 3BOQA 2YX7A 3ECHA 3R6SA 4ESBA 5D8LB 3P9CA 2KIUA 4AIHA 4I01A 3R0AA 5A2QZ 1KA8A 2DW4A 2G7HA 2GXGA 5KK1A 3ECOA 5D4SA 2DQRA 1FWZA 4I02A 1LDKB 1R7JA 3T1BA 1F1ZA 4Q47A 4G7HF 4UUVA 4HAMA 3LSTA 5ICFA 4MGRA 2FMLA 4HZFA 2YU3A 4JQFA 3WGHA 1XD7A 1BBYA 3FX3A 1KU3A 2AS5F 2HYFA 3K1PA 3WU0A 1XSDA 1QQIA 3KFWX 2EV6A 3SFZA 1MJBA 3K69A 4BQAA 1BM9A 1O3RA 4KFCA 1LDJA 5DEQA 3B73A 3F22A 1HW5A 5L3EA 1FX7A 4LB5A 3KP7A 1K7AA 3V8LA 4S04A 4LB6B 2L4AA 5D5UB 3E97A 3K9TA 3L7WA 2NS0A 2FEZA 1KYZA 2XHKA 1UB9A 4Y15A 2TDXA 4IVNA 3WTVC 3FMRA 1JE8A 3FF5A 1REPC 1B6AA 4ZYGA 1R36A 2J5PA 2PJPA 2LKPA 2XASA 1FNNA 2VBZA 3T8RA 1XGOA 4UVBA 4BXUA 5J6XA 1L3LA 4EGYA 3G3ZA 2OU2A 5LLQA 3WTYC 2ZJ2A 4IHSA 1U5TC 2L4MA 3F8CA 2NNYA 4HLXA 4YIFA 4ZZDA 1XCBA 1OMIA 1U8RA 2E7WA 2GQQA 3I53A 2ADUA 1LQ1A 2V1DA 2HOEA 4HLYA 5CVJA 3I0TA 2KIMA 3PQJA 2D2WA 3U9GA 5FO5A 4HOBA 3E5QA 2Y48A 4LFUA 1XGNA 1IXCA 2ETHA 3GF2A 4D0PA 4DNCA 3V8KA 2P7VB 4M9ZA 1XMKA 5TRDA 1R1UA 3IRQA 3GYHX 1S7AA 5EEGA 4R79A 2FBIA 4OIRF 4IRIA 2IA0A 2QQAA 5ILUA 4GXOA 1R00A 4YFNF 1T39A 4BNCA 6PAXA 4MQ9F 2EA2A 2CO5A 5LRSA 4TV7A 4EM1A 5D5WB 4BHCA 3KE2A 3JTHA 2ISZA 4P96A 2HGCA 2V6CA 1Z6RA 1S29A 3F8NA 3G73A 2STWA 4CDGA 5D6FA 1KQ9A 3HSFA 2EK5A 3MZHA 3TQNA 1T6SA 3FZVA 2VONA 2P8TA 1FZPB 5DV5A 3KLNA 1U2WA 3SZTA 3TDUC 4ON0A 5IT3A 4YFXF 3WTWC 4LGWA 3QRFF 2EA4A 4LK0F 4F7ZA 1ZAOA 4L18B 1QO0D 1OPCA 4HW0A 1XDUA 3V8JA 2Z99A 1T38A 1BN5A 3GZ5A 2QZ8A 1BOAA 4LG0B 3KP3A 3GX4X 4EJWA 1O3QA 1XB4A 2VBWA 2PQ8A 3GFLA 3GXOA 2DTRA 2D1HA 4UNOA 5FB2A 2WC2A 1YYVA 1FSEA 3ISPA 1LJ9A 2HQNA 1T0FA 5LEJA 2H27A 3Q9VA 3MQ0A 5K5RA 4P9UA 3HSEA 1MD0A 1YIOA 2NYXA 4G6DA 4P9FA 4L5IA 4LLLA 2IVMA 2V1XA 1K79A 5E18F 4A0YA 2L02A 2CSOA 1BI1A 2XAFA 1H9TA 2LDUA 3TO6A 1P6RA 3GLXA 3F8MA 3FHZA 3ZMDA 3WTTC 3WG9A 3RYRA 2OA4A 4YG2F 3GEZA 3I59A 5DUIA 3IWFA 4B8XA 1F9NA 3V7CA 1OYIA 2H94A 3HHHA 4M9SA 1YW9A 5D5VB 2P6SA 5ICGA 1ULYA 1PP7U 2CFXA 3D5LA 1J2XA 4S05A 4PDKA 2MH9A 2O6GE 3CUQA 3KETA 2XAJA 3LA3A 3V7RA 1GHCA 3WTXC 2RNJA 2EFNA 4BHBA 1GXQA 2J5OA 5HDGA 1H9GA 3RKWA 1WI9A 1RIOH 2IJLA 1XCVA 3MZYA 2IA1A 1LEBA 4IXAA 3DQVC 1FBSA 1D8JA 4LLNA 1EH6A 4KMFA 2VT3A 5FFZA 4BYYA 1SMYF 3WE2A 2H6BA 1I1SA 4XRFA 2XROA 3E6CC 4L0ZB 1STZA 1ZRDA 2EFPA 1W7PA 2DLLA 3TO9A 4WX9A 1K78A 1E2XA 4LK1F 1MDMA 2HQRA 4Q4ZF 5ICEA 4MNUA 2VODA 2KJCA 1XDSA 5H6RA 3VB2A 2P5VA 4AVPA 1HKSA 2O03A 5FGMA 3CTAA 4HDVA 4XSZF 3C3WA 2FE3A 1TQMA 3M9AA 5FD6A 1R5GA 1MJ9A 1ON1A 4Y17A 5HLGA 4ZZLA 1R1VA 3U2RA 4OINF 5E1WA 3HRUA 2EFOA 1DDNA 4ZYEA 3ZMSA 5JR3A 3MWMA 1QPMA 1S3JA 3COAC 4EGZA 4KMUX 2MLGA 2EFQA 2A68F 3TOAA 5K5QA 2BBYA 1R1TA 2Z9OA 4RGRA 1YS7A 1USSA 3C18A 4HA8A 3KCCA 1FT9A 4RB2C 1P2FA 2V9VA 3DXJF 3JSPA 2HR3A 3WE3A 4L9JA 1ZG3A 1G4DA 1BI3A 4EJTA 3R0JA 2RN7A 1H0MA 2R7DA 4O6JA 4KDPA 1AOYA 2DT5A 3HOTA 4QWQA 1ZHFA 1FPQA 2VOOA 3BROA 3F23A 3M8FA 2K86A 4FX4A 3BY6A 4UVAA 2QBYA 2W84A 4RGUA 1ZLKA 3KP5A 4EJVA 1YO5C 5LHGA 1TNSA 1LDDA 4KA4A 5DD8A 3WTUC 3BJOA 4IPAA 2E7XA 1HW1A 3HRMA 3BWGA 2A5YB 1E17A 1J59A 2XGXA 4Y13A 4UXNA 1PDNC 3TKYA 3IRRA 3HYIA 2F5CA 2W57A 2DPDA 1XSVA 2MLKA 4EM2A 2XAGA 3J80Z 5E1XA 4I0BA 1SD6A 3LA7A 2ZBKA 3E3VA 5L3DA 1Z6TA 5BPIA 4E70A 2QWWA 2JZYA 3FWEA 4FHTA 1SFUA 1ODDA 3LWFA 2MC3A 5CVVA 1WSUA 4FT8A 2XUBA 5EEHA 4L0YB 2A6HF 5CVRA 1FSHA 2XRNA 1MGTA 3ZMTA 3BPXA 1Q1HA 1A04A 1FYLA 2PG4A 3FXUA 4KIGA 4M6YA 2FU4A 2C6YA 2DU9A 1HQCA 2HS5A 3DF8A 4WXHA 4RB1A 5BOXA 1K6OA 1XGMA 2QQBA 3MAJA 5IT9K 2DQLA 2KKOA 5D4RA 3F6OA 1KYWA 4Z2YA 2HKXA 2DAOA 2JT1A 2Y75A 1OYYA 1HKQA 4A5NA 3J7AO 5JVTA 1Z91A 1TLHB 1IN5A 1HW2A 2VBXA 1J7KA 1TQIA 2PMHA 4HQMA 2KIFA 3GZ6A 1Y0UA 3I71A 1JHFA 3T8TA 5HDNA 3J81Z 1LVAA 2O8XA 2VBYA 1J0RA 3IL2A 4U7DA 1SMTA 3W6KB 3ZQ7A 1R58A 4HX4A 2GWRA 3E5XA 3HRTA 3RPUA 5LEKA 2KJBA 2NNNA 3L09A 2RC4A 1RI7A 2VE9A 2BE5F 3LFKA 1Z05A 5AONA 5L3FA 2QM3A 3RKXA 2Z33A 5FLXK 3H3UA 1UHWA 2ISYA 4CZZA 1FYKA 3HTUA 3RIRA 3T5XA 4ZH4F 3ABTA 3HHGA 3RTRA 3KP2A 1RNLA 3PFIA 1IN6A 1IXRC 4CGZA 2JTVA 2CG4A 2F5DA 4A6DA 4MTDA 4QLCU 5DCMB 5ILSA 4EJOA 1VTNC 2LNBA 2VE8A 2MBFA 3GUDA 1SD4A 2FBKA 3FM3A 5HS7A 2UWMA 3WTSC 4ETSA 1MZBA 1ZN2A 3OV8A 1WWXA 1TW2A 4GYIA 4CHUA 1SD7A 3IHUA 1Z9CA 3JW4A 4NB5A 3HIFA 2H09A 1PUEE 3GW2A 3SQNA 2B0LA 3JSOA 2PN6A 3ERED 2ZNZA 1P4XA 3IKVA 1ZRCA 4IF4A 1OYWA 4N0BA 4WF2A 3EETA 3WTZA 5DCFA 4AD9A 3S2WA 2ESHA 1WRJA 4CICA 2DK5A 2RQPA 4A12A 2EV0A 2QUFA 2QQ9A 2LF7A 2V1UA 5JHUA 4CXFA 2LF8A 2BV6A 3FXRA 2W85A 1G3TA 2X4HA 2JPCA 1HBXG 4BHPA 4RB3C 3I59B 1CF7A 1ZLJA 4B09A 3M8EA 2PMUA 4GGGA 5ICCA 1W5TA 2GA2A 4EVIA 2Y0MA 3GFJA 3WODF 2P4WA 2BEOA 2IP2A 1S7OA 4KNYA 1ZG1A 2FXAA 3T0YA 3NQOA 1YQAA 1DUXC 2Z5UA 4M9XA 4PZJA 4A5MA 1UFMA 4YIIA 2ZMEA 4ESFA 1DPUA 1OKRA 5E1ZB 3WGIA 1RZ4A 4A2UA 3BDDA 2OAZA 3GVAA 1QGPA 1I1GA 2R3SA 2XIGA 2MD5A 2W25A 3SZPA 3EDPA 4HF2A 1QNTA 4IRGA 4OU0A 1XMAA 3GFMA 3U1DA 1DPRA 2COMA 5K5OA 5CYVA 1EH7A 4ENKA 3F3XA 3FXQA 1GVJA 1G6NA 1U6GA 4GO1A 3EQLF 3REOA 1BIAA 1BI0A 3V7SA 2XKOA 3M1EA 2MA3A 4AIKA 1U5TA 3FMSA 2E1NA 1FLIA 4I09A 2FNAA 1K78B 4IJAA 4BH9A 3CJNA 1MDMB 2K02A 1R22A 1OR7A 2HFHA 1V3FA 2DFIA 2QENA 2ZCWA 5DD4A 4FX0A 3Q5FA 4U0YA 1FC3A 2BGCA 1IN8A 2V79A 3ZN0A 4M72A 1C0WA 4EJUA 4L9VA 1O57A 2CWEA 4LMYA 1XSXA 2O3FA 2IA2A 2RGVA 2RDPA 1SFEA 5D6EA 3BPVA 5CJ9A 4GYGA 1YW8A 2FQ3A 2X0LA 2K4JA 2VC1A 3LQQA 2GA1A 3F21A 3CO7C 2IPQX 1WQ2A 2VT2A 3RPQA 2Z3YA 1BC7C 3E6DA 4A0ZA 1L0OC 3HRSA 2K27A 1YTYA 4G8XA 4AWXB 4G7OF 3HOSA 1SAXA 2W24A 5BMZA 2RKHA 4RGXA 4M71A 2FRHA 4HYEA
chains in the Genus database with same CATH superfamily
3RJPA 2JA7J 3DU6A 4UUSB 1TQPA 3JRGA 3OL3A 4MHGA 4I7HA 4PGGA 3MCZA 1BR2A 1JKQC 1JXSA 1UMQA 3D1NI 1QZZA 4PK4A 4GCVA 1YFHA 5F6FA 2E2IJ 2EZHA 4KYWA 5HS9A 5EG0A 5AIPA 5ILVA 3OY9A 2R4GA 2WWYA 1CGPA 4MLOA 1WJBA 1AA7A 3CMEI 1WKMA 2MD0A 1S72I 5J8FA 3LL7A 3BJAA 4OOIA 2NS8A 2F5VA 1W7PD 4PGHA 3W2AA 1UELB 4NNJA 4HDUA 1FP1D 4U88A 1K4SA 4GFBA 5M5WJ 4RBOA 3CCSI 1OCPA 4C30A 1FBQA 1R5HA 2DA2A 1T98A 5EJCA 2P7CB 3QOPA 1JJ8C 5TISC 2NOJB 1TZLA 1A6IA 3KX2A 3L9FA 3P9KA 1Z0XA 4LJZF 1IRGA 2H6CA 4OIQF 3F8BA 2H1LA 1I50J 2A6EF 4RAYA 1X1BA 3VOEA 5B1BH 2I8DA 4BDZA 4O3MA 3H3VK 2FOKA 4U0VA 3TOBA 4CH7A 4IOAF 3FKJA 3DKWA 4UV9A 4RAFA 3RDIA 2F2EA 3SHFA 4XLAA 1T95A 3CQZJ 4N9HA 5FFXA 5BS6A 3OYIA 1UHMA 3CP8A 1GUUA 5KHDA 2LBFA 2DO7A 1LE8B 2BVLA 1ETYA 1IDZA 1ZTRA 2JPBA 1TT0A 2FMYA 4XLCA 2ZNYA 4A0XA 2A61A 4L9NA 1Y0NA 2KZGA 3SZGA 2R7FA 3HOUJ 2LC2A 3BCBA 5CQEA 3JR9A 2AXLA 4G12A 4LITA 3CC7I 3OR1C 4M74A 3H0DA 4X6AJ 3L2QA 3QU3A 1SVLA 1EV7A 2ZXJA 3R4KA 4WK8F 2E1CA 4KISA 5K1YA 5IT9Z 2NAZA 5L3GA 3KPHA 4K2EA 3EPZA 4NC8A 4D9JA 1YLFA 3ABUA 1MJAA 2G9WA 2K4BA 3AL0B 2IW5A 2PEXA 2RREA 1LFBA 1ETVA 2CUEA 2QSHX 3ZMUA 1I6XA 1VQ5I 4E6KG 3KYLA 4MEYF 3S14J 2AQEA 2Y9YA 5KVRA 1JKOC 1BJZA 4DIQA 3DV8A 3K1MA 1RR7A 3KZZA 2LYCA 3G4SI 3VFZA 1VZ0A 2V6EA 3ABLH 2JUCA 3ASOH 1G3YA 3I54A 2BY0A 4KN7X 4AU7A 2FSWA 2D45A 3BZ6A 5CVIA 4ZDLA 3R60A 4G7ZF 1Z7LA 5HVQC 5L3BA 3H92A 1ETKA 2JMWA 3ERMA 2AXTC 1ETOA 1ZR4A 4CO8A 4DYCA 2YR2A 3PO2J 2KDOA 1IRFA 3PL8A 1QBJA 4JX6A 3TO7A 2F5FA 2CQKA 3K0LA 1JGGA 1B9MA 4G94A 9ANTA 1J9IA 3RYPA 1XGSA 1YS6A 2BHYA 3QAHA 1HCRA 3PO3J 1DU0A 3RZDJ 3W2VA 3OYKA 1V4RA 3RCOA 4A3IJ 1ONVA 2XVCA 3CUOA 3WU1B 1HXDA 1Z77A 4HV5A 4AIJA 1VQMI 3CCQI 4B44A 4ANJA 2B9SA 1HKTA 3L00A 1YI2I 3I4PA 1ETXA 2CRGA 2EJRA 2VLAA 2HPIA 1W5SA 2Q2EA 2ZKZA 2ZO4A 2K9MA 1V5FA 2CU7A 1ZRFA 3HTSB 2JSPA 4BJTA 1LNWA 2VQGA 3JAMK 2Y0SA 3AFHA 1FIAA 2HWVA 3FDYA 3ZN1A 4Y52J 1TWGJ 3ML6A 2UXNA 4LG3A 3C2GA 1HOMA 1ZYRF 2R7QA 2XAQA 4HX7A 5FLXZ 5DYMA 4MFDA 4BQOA 4PJLA 4WXDA 2P5KA 4ZDOA 3W2WA 1JT0A 3QP6A 1I5ZA 1T0FC 2ZXWH 2D1VA 1J5YA 1FTZA 2IS6A 3K4BA 4XLPF 5CQGA 5IYCJ 4BXXJ 5EGOB 3IUOA 1IW7F 1S6LA 1FYMA 4ZC3A 5F0HA 3S3MA 4BGDA 1H88C 1VQNI 2UZKA 1F4KA 3P7NA 5DDGA 1M1EB 2X1CA 1B4AA 3LSIA 2E35A 2ESNA 1X1CA 3ROUA 2L5QA 4OMZA 3N4MA 4XSXF 1IN7A 2BYVE 4PFOA 3BZCA 3H36A 4BACA 5FKOA 3W6JB 3ASNH 3HEFA 1Y39A 1FOYA 3L2CA 1I3QJ 2Q8KA 5HLHA 1B59A 1PUFA 4L5JA 1X1PA 3BR1A 3MVPA 1D8KA 3MMYB 2WV0A 5F64A 5GTHC 1DP7P 3VPRA 3N05A 4C2UA 1BOBA 1DQUA 3BR2A 3CC2I 1SAUA 3DBHB 1T2KA 3H3ZA 4J01A 3L2RA 2Q0OA 5A2QK 4IX7A 2ELJA 3H9GA 1NK3P 1O7LA 1FBUA 3BP8A 4II2A 3J80K 3PQKA 4XKVA 5FKKA 3KLOA 4GRIA 3I5UA 2DI3A 5LGNA 4NUBA 1S9HA 2ID6A 5JVGF 4ESJA 1BIBA 3QU6A 4BJ5C 2LSOA 1XN7A 3GFIA 4UV8A 4QIWN 2DOEA 3CUQC 3CC4I 1RKTA 4G6TB 1U78A 4XLNF 4B43A 3CMAI 3HOZJ 2XDVA 3CO6C 5LHIA 1P4WA 2W4SA 3E6MA 2RNGA 5DUKA 2QLZA 2HDCA 1RETA 4BU2A 3DFGA 5H6QA 2DA6A 4ENJA 4M3FA 4F93B 3F6VA 2OCEA 4OIPF 1IUYA 2CGPA 3N97A 2OV7A 2VKHA 5B3SH 2ZJQF 2QQ8A 3CCYA 2XF5A 2IGMA 4Q48A 2DDBA 2R5YA 2CW0F 4IRHA 2Y9ZA 2M7BA 1DGWY 4DYQA 3K4JA 2WTEA 5LHHA 4HF0A 2O7OA 3IV5A 2EBIA 4CCLA 3KYCB 1TNTA 1MBKA 3S8PA 4Q5SF 2PJRA 4IHXA 4CA0A 2UUZA 4NDLA 4CCNA 3HDDA 3RKYA 5F04A 2YSRA 4LD5A 5AIQA 3CDHA 4N9IA 1EH8A 1W0TA 1FOKA 2E5NA 1IAWA 3G6EI 3GWZA 3D5RC 2WB1A 3KEYA 2JRTA 2OZ6A 3EYIA 4AYBA 3QPSA 2F4OB 4HNVA 1P4AA 5CLSA 4HPQA 2EV5A 3IAS2 1WI3A 3UKGA 2O8KA 4I98B 5FJ8J 1BL0A 1W5CC 1FIPA 4UHTA 4Y7NJ 3OIOA 2E36A 2A07F 4PFPA 2FF4A 1OCRH 1GLNA 4KT5C 2LP0A 2CYYA 1KZHA 1PP8F 3LQRA 2O0YA 5J8CA 1YJ9I 2XAHA 2WAEA 4IHTA 2L9SA 2KIQA 1RUOA 2DK8A 2M4KA 3ELKA 1UZCA 2LTPA 3DP7A 2P6TA 1NG6A 2OBPA 2X1DA 2X6OA 3DLAA 3QP5A 4RAZA 3RZOJ 3DKYA 3KP4A 4N4OB 4OMYA 1H8AC 5ERIA 1MMGA 2V7FA 3A01B 1A36A 1I6HJ 2YPRA 3EUAA 1Z3XA 3J81K 4MEXF 3LA2A 5D5XB 1CF7B 1D5YA 1VF9A 3DPTA 5LGTA 3S1RJ 4MTEA 4ZTJA 1O3SA 3C1DA 2JA5J 2H8WA 3BQZA 3F8FA 1ZK8A 3HUGA 3ZCOA 5GAEJ 5K7HA 5EYRA 1LB2A 3VODA 3A4CA 2R0QC 1VQ7I 1OLTA 1Z3YA 2HQ5A 2MH2A 3MEXA 5JFRA 3K1NA 4DZPA 4LLGF 5FD5A 2K40A 1S5LC 1S8NA 1GXPA 3DEUA 2WB1N 3V4GA 3HJEA 4AYBN 5DCMA 1KU2A 3HSRA 5JI6A 4E7LA 1F5TA 1UCRA 4I0AA 4R1HA 2M30A 2PFBA 3F72A 3OSGA 4Z6YA 4WWCA 2ZMEB 2K7LA 5E8IA 3Q9SA 4IQJA 4M73A 1E3PA 1MBHA 1QHHD 4RGSA 4MQVA 3EYYA 3OYFA 3LSHA 2HZTA 2L54A 3GTPJ 4O5VA 2ACJA 5CPRB 1Y6IA 4E4HA 1TP4A 3RQ4A 5IPAA 1MBFA 5ED4A 3I58A 1LEAA 2L01A 4HF1A 5IOYA 2KFDA 4IQ4A 4KN4X 4I99C 3JRIA 1X4OA 1XX5A 4MFEA 1JGSA 2HKOA 4M6XA 5EEAA 4BL0B 2B63J 2HU9A 3ZGKA 3OR2C 4YFKF 2A69F 2LH9A 2HDWA 1ON2A 1WJDA 2KRFA 1B8IB 3AG1H 2DJNA 1YIJI 2X51A 4JOMA 3K4CA 4BEHA 5BQTA 5J4VA 1YG2A 2O61A 5HS8A 1OJLA 2ZFWA 1ZGAA 4KUMA 4DQ2A 3CUQB 1FJLA 1Z1DA 4G6QA 2M1BA 3B6AA 4ASNA 2ZXHA 1U5TB 2LOOA 2EWNA 2GAUA 2HYGD 3CZ6A 2XSDC 2DA5A 4U87A 1FMWA 2CMPA 3ZMZA 1K6YA 2GXAA 5TJJA 4C3HJ 5EZHA 1ZGWA 2EB7A 1UHSA 3HOVJ 1QVUA 4LG0A 1HC8A 3KEQA 1XC5A 4HV6A 3BT9A 5KCMA 1OQYA 1USTA 1JTXA 3S32A 2AQFA 2CUFA 2M0CA 4U0WA 4XLFA 4A3FJ 1U3EM 1QZYA 1FP2A 4W97A 3BZKA 1LKXA 1MKMA 1R23A 3O2PE 3MKZA 4FQGA 1WH7A 3H35A 3OOPA 1MNMC 2L7ZA 1O7FA 3H5NA 2GIVA 1SVMA 2FBHA 1B9NA 3SDBA 4FE7A 2K3PA 3OS1A 1IF1A 3LAPA 2UXXA 2KDZA 1SFXA 5K7ZA 1D1CA 2PX9A 1ZREA 1NHAA 3JRCA 3GLLA 3GO5A 5FLMJ 5FKMA 3S16J 1BA5A 1W7PB 3P9IA 3ULQB 4I2OA 3B02A 1FEXA 3PUBA 4UVCA 1IXSB 4BE1A 1KGSA 3FK7A 5LRRA 3HC7A 5E20A 2QYOA 1JHHA 3RI4A 3MFKA 3GMEA 2EFWA 1MBGA 3D0SA 1SFKA 1KQ8A 1D5VA 4HBLA 4KJZA 1HSTA 2IRFG 4WCGA 4EV0A 2W48A 1B1BA 2WAQN 3SEZA 3SXYA 2ELKA 3G1OA 3KEOA 3QPTA 3EUHA 1IZ1A 1B72A 3BJ6A 3O3KA 4FCYA 2OC6A 3C7JA 3AL0C 1MW7A 1SD5A 1RPWA 3CCEI 2JUGA 4X0GA 3K2ZA 1T56A 2L0KA 2YX4A 1YITI 2VOPA 3FBNB 1KU9A 2E1OA 2RVCA 3CESA 4G9YA 3C2HA 1ZGJA 3BTJA 4WXCA 1YRNA 2IGOA 2JQ7A 3FMQA 4A6EA 3K70D 1ZKGA 2W7NA 3CMMA 3CLOA 5GPAA 4BKXA 4OIOF 2E19A 5FRNA 5B1AH 5HLIA 3KP6A 3LAJA 1HLVA 3DPUA 2OQGA 3TGNA 1ZH5A 2M87A 1VNDA 1ACIA 1HSJA 3H9JA 1XPXA 4M6VA 5F1RA 2HXOA 2HTSA 3NEUA 1I27A 2A05A 4R8HA 2CQXA 1BC8C 3VEPA 4M3DA 4JK1X 1TWHJ 1YW7A 3I3LA 1G3WA 2NRAC 3JRFA 1VQKI 2IS4A 3IKTA 1X3UA 2VN2A 3ZOBA 2M5WA 3ZMVA 4L9TA 2JN6A 4ENNA 4JBAA 4PJ0C 4ZYDA 2E5ZA 2PBIA 2NVYJ 2W1OA 1J75A 1KQ0A 2OZUA 4RB0A 4NQWA 5BPDA 1RC9A 2M8EA 2EQRA 2PLYA 3E5UA 2QVOA 3M3YJ 1RR8C 1AU7A 4D5CA 4KIBA 2DPUA 4EATA 2HEOA 2VXZA 5B5EC 1AWCA 3DPLC 3TDZC 3M7GA 2DMQA 4E7IA 2Y31A 3CDIA 3JRDA 2CQ7A 2P5LC 4ENMA 1WH5A 5HDKA 2JSCA 5E8GA 3E6BA 3NRVA 2CV1A 1P92A 2FA5A 3SEQA 4H0EA 1MH4A 2LLKA 5LBQA 1TTYA 1FY7A 2K3FA 2UV1A 2L2OA 3JTGA 3FXLA 3MKLA 4IEJA 4AIDA 3PJRA 1ZG5A 2I10A 3IH2A 4RM2A 3L2VA 1QA6A 2LKXA 1TW3A 4EQQA 1KU7A 1UAAA 3IWZA 2LBFB 3HOXJ 2ELHA 2XV4S 1WJEA 1ZARA 4PSWA 2F5EA 2XPUA 3GTLJ 3KZYA 4DOZA 2QBYB 5GP9A 3VYUB 1IUFA 3O6BB 2BY1A 3PSFA 1V54H 1R5ID 2XF6A 2A3SA 2L3DA 4PCQA 4XMYA 3FM5A 1R4NB 4KIFA 4EM0B 4U7BA 4RA2A 4KICA 3ZQCA 5DM6F 2STTA 3ZPLA 2OD5A 4XRMA 1AHDP 3LOCA 2VC0A 4C3JJ 4ZYHA 3R61A 4RS8A 5JLXA 3TEDA 5H20A 3QPHA 5LGUA 4IHWA 1WJCA 5BNGA 5E17F 3AAFA 4BAYA 1ERDA 1D3YA 1RUNA 5EF6A 5D8KB 4HX8A 4NHJA 3RSNA 1BJAA 2CV2A 1DU6A 1W4MA 3JAMZ 3CJQB 2IT0A 2M45A 2LY9A 5J47A 4HQEA 4P5OA 1BI2A 4CYDA 2ZC2A 3ZP5A 4H4KC 2HTJA 3PFYA 5GPCA 2GZWA 5IY5H 3S15J 3WGGA 1IN4A 1UG2A 2OQRA 3D5SC 4XBFA 2GXBA 1G3SA 2P81A 1Z7UA 3CCJI 2BY2A 1R49A 1EF4A 1ETQA 3I64A 5HOOA 1TBXA 2RV8A 1S7EA 4PSXA 1RESA 5L3CA 3AG4H 2XKPA 3IC7A 4EMSA 1O3TA 5CVUA 2PI0A 3CJRB 3TW7A 2IAIA 2LY2A 4P55A 2X48A 2DBBA 2FNPA 1X1DA 2G7UA 4UB6C 3OYCA 5E3OA 2D5VA 4A3MJ 3ZQLA 3BOQA 2LKSA 2YX7A 3ECHA 3R6SA 4ESBA 5D8LB 1R6RA 3P9CA 3E0JB 3QPLA 3JRHA 2DODA 3BR3A 2DYSH 2KIUA 4AIHA 3B6CA 4I01A 3R0AA 3CD6I 4F55A 5A2QZ 2P0WA 1KA8A 2DW4A 2G7HA 2YS9A 3OMYA 2DMNA 4JP0A 4C2TA 2GXGA 1Q1VA 5KK1A 2CQNA 5KAFC 3ECOA 3OYDA 3V42A 3J7YJ 2JRMA 5D4SA 2M7AA 2ZXIA 2DQRA 1FWZA 1BW6A 4NC7A 4I02A 1LDKB 1R7JA 2XSJC 4DGWB 2DDAA 4I76A 3T1BA 4W1UA 1F1ZA 3LSMA 4PUSA 4Q47A 3IP4B 4G7HF 4IKFA 4UUVA 2CQQA 4N4NB 4HAMA 3LSTA 5ICFA 2DXIA 4MGRA 2FMLA 4HZFA 4FETA 2YU3A 3G71I 4JQFA 3WGHA 1GVDA 1XD7A 1BBYA 3FX3A 1KU3A 5J1UA 2AS5F 1PUFB 2HYFA 3K1PA 3WU0A 1XSDA 4UUTA 2FUG2 2CUZA 3X2QH 1QQIA 3KFWX 2R92J 2EV6A 3SFZA 1MJBA 2H8RA 1K61A 3K69A 4BQAA 1BM9A 5GAHJ 4XM3A 3GTQJ 1O3RA 3I55I 2FOWA 5B66C 4KFCA 1LDJA 5DEQA 3B73A 3HKZA 3BTLA 3F22A 1X1AA 1HW5A 1Z67A 1VQ4I 5L3EA 1FX7A 3S93A 1IGNA 4LB5A 2R7XA 1ENHA 3KP7A 1K7AA 1LFUP 1MNEA 3A2KA 3V8LA 1Y1WJ 2OJED 4S04A 4LB6B 2L4AA 5D5UB 3E97A 3K9TA 2ZMEC 3L7WA 3MD2A 2NS0A 3ONQA 2FEZA 5IYDJ 1KYZA 2XHKA 1UB9A 4Y15A 2TDXA 4A3DJ 4IVNA 3WTVC 3OYAA 3FMRA 1JE8A 4BUPA 3FF5A 4OWRB 3ZQQA 1REPC 2K5CA 1MBJA 3K70C 1PYVA 1NK2P 1VQLI 3LSKA 3ZQFA 1Y1VJ 1B6AA 4ZYGA 1R36A 2Y0SN 4BY7J 5J1RA 2MW8A 1DGRM 3CCVI 2J5PA 3J7ZI 2PJPA 2CS3A 2LKPA 2XASA 2XB5A 3OS2A 2NVXJ 1N78A 2A5WA 1FTTA 3W3CA 1IV6A 4AUXA 1FNNA 3TBIA 4CSWA 5LFAA 2VBZA 2BXZA 5C44J 2VKVA 3T8RA 1XGOA 4UVBA 4BXUA 5J6XA 1R4MB 1L3LA 4EGYA 3G3ZA 4CCKA 2WY8Q 5JLWA 2PMZA 2OU2A 2R5ZA 5LLQA 2PJRB 3KIOA 3WTYC 2ZJ2A 2O9LA 4HRIA 1BW5A 4IHSA 2WA0A 2CH0A 1U5TC 2L4MA 3F8CA 2L7FP 2NXNB 2NNYA 5EGOA 4HLXA 1EKEA 4YIFA 1MH3A 4ZZDA 1XCBA 1TWCJ 3H5RA 1OMIA 1U8RA 2VB6A 5GADJ 1V55H 3FISA 3J7AY 2XGEA 5M5XJ 2E7WA 2GQQA 1QRYA 1OR7C 4XIDA 3I53A 2ADUA 1LQ1A 3HZJA 2V1DA 2HOEA 4HLYA 5CVJA 2VQLA 5M3MJ 2LMDA 3I0TA 3QYEA 5DTDA 5FROA 3PNTA 3VYTB 3H0GJ 2KIMA 3PQJA 2D2WA 5F0CA 4XKWA 3U9GA 5FO5A 4HOBA 3E5QA 4IL6C 3GTKJ 3FBIB 5M3FJ 2Y48A 4LFUA 1XGNA 1IXCA 2ETHA 3GF2A 2R7VA 4D0PA 2DT6A 4DNCA 3V8KA 1JI8A 3M8JA 2P7VB 4M9ZA 2L9NA 5IYBJ 3NWSA 1XMKA 3K4KA 5TRDA 3VYSB 1HDDC 1R1UA 4YRVA 3IRQA 3BTIA 3ESWB 2PMZN 2ECCA 3SFIA 1S7AA 3GYHX 5KAIC 5EEGA 4R79A 2FBIA 4OIRF 4IRIA 2IA0A 2QQAA 1IDYA 2LR8A 5ILUA 5M5YJ 1O4XA 4HNUA 3E7LA 4GXOA 2ZJPF 4A3JJ 1R00A 4YFNF 1T39A 4UY8I 2VKEA 4BNCA 4MQ9F 2MGQA 3QOEA 6PAXA 1QZEA 2EA2A 2V4JC 4M3BA 2CO5A 1ORKA 5LRSA 4JYKA 4TV7A 2FQ4A 2VJIA 4NC6A 4V2FA 3K6GA 2EPFA 2KRCA 4EM1A 5D5WB 4BHCA 2MSYA 3KE2A 1ZQ3P 2LVSA 3JTHA 2X85A 2ISZA 2BW3B 4P96A 3RPUD 3GCMA 3HXLA 5E3MA 4BQQA 4Y4RA 2HGCA 3LSPA 1E0EA 1UJ8A 2V6CA 3OYLA 1Z6RA 3K2AA 1S29A 2F6CA 3F8NA 5DM7F 3AKZA 3G73A 2STWA 4CDGA 5D6FA 1Y56A 3L2UA 1KQ9A 4LOCA 3CF2A 3HSFA 2EK5A 3MZHA 3TQNA 1T6SA 3FZVA 2VONA 1P9QC 3I4MJ 2IEKA 2P8TA 1FZPB 2Z16A 5DV5A 3KLNA 1U2WA 3SZTA 3TDUC 4CYCB 4ON0A 2HYJA 1PVEA 3DU5A 2QSGX 1X3WB 5IT3A 3O8HA 4YFXF 4B47A 4BEHB 3WTWC 4LGWA 3QRFF 2EA4A 2NS7A 3SJMA 4LK0F 3CJTB 1OCTC 4F7ZA 4CCOA 2BZTA 3BQYA 3DBLB 4XK4A 1ZAOA 4L18B 1QO0D 2JVGA 1OPCA 4HW0A 1XDUA 2MC4A 1U0JA 1SC7A 3V8JA 2Z99A 1T38A 2KISA 5FLVA 3GTOJ 1QHGA 1BN5A 2K9LA 1D0XA 2WY7Q 3GZ5A 2QZ8A 1BOAA 4LG0B 3VDXA 1MSEC 2DOAA 3SDGA 3KP3A 3GX4X 2H1KA 4XNFA 4L5EA 4EJWA 2Y30A 3FKIJ 1O3QA 1XB4A 2VBWA 2PQ8A 3GFLA 1JJ6C 2X6YA 3GXOA 4LIUA 2DTRA 2D1HA 4UNOA 5FB2A 3A01A 2WC2A 1YYVA 1FSEA 3ISPA 1W0UA 1AKHA 2EIMH 2KMUA 4XRSA 2FX0A 2HOSA 1LJ9A 2HQNA 1T0FA 5LEJA 2H27A 5C4JJ 3PM1A 3Q9VA 3MQ0A 5K5RA 4P9UA 3HSEA 1T08B 2GIZA 1MD0A 1YIOA 3BG5A 2NYXA 4G6DA 4P9FA 3K4NA 3K4MA 4L5IA 4LLLA 3HBLA 2IVMA 4XICA 2Y69H 2V1XA 4A93J 1F43A 1QVTA 3PUFA 3OOUA 1R71A 1K79A 2VXDA 5E18F 3VSKA 3PNVA 1BR1A 5EZGA 4A0YA 2L02A 3DKXA 2CSOA 4XKCA 1BI1A 4C3IJ 2XAFA 1H9TA 2LDUA 1WGXA 2VL8A 3TO6A 1P6RA 2M3AA 1PJRA 3GLXA 3F8MA 2AO9A 3FHZA 1B72B 4B3XA 3BR0A 3LNQA 2DJIA 2HI3A 3ZMDA 3WTTC 3WG9A 1KONA 1WCMJ 3RYRA 1VQ9I 2OA4A 4YG2F 3GEZA 3I59A 5DUIA 3IWFA 1OCOH 4B8XA 5LD2C 1F9NA 2QSFX 3V7CA 4A3BJ 1W36D 1OYIA 5KNLA 2H94A 1MMDA 1V5EA 3HHHA 2NVUB 4M9SA 4F3QA 1YW9A 5D5VB 3TL4X 2P6SA 5FKNA 1YRNB 5ICGA 1ULYA 1PP7U 5K7FA 2CFXA 3D5LA 1NH3A 1J2XA 3Q0WA 4S05A 4PDKA 4E7SA 2MH9A 2O6GE 4Y33A 3CUQA 1YJWI 3KETA 2XAJA 2HZDA 3LA3A 3I9V2 3V7RA 3WG7H 1SANA 1GHCA 1A5JA 1UG0A 3Q0UA 3WTXC 2GLOA 2RNJA 4YIRX 3ABKH 2M34A 2CW8A 1G59A 3GTJJ 2EFNA 4BHBA 1GXQA 2J5OA 3DWLE 2R7RA 3LSJA 5IP6A 5FKLA 4LIVA 5HDGA 1GV5A 2E1MB 3GBGA 3OYHA 1Y8QB 1H9GA 2R7WA 3RKWA 4NQWB 1RIOH 2IJLA 1XCVA 2KZVA 3MZYA 3Q3SA 3OYNA 1WZ2A 2IA1A 1LEBA 4IXAA 3DQVC 1FBSA 4F92B 1D8JA 4GDFA 4LLNA 2VQCA 1EH6A 4KMFA 2VT3A 2YU9J 5FFZA 4BYYA 4RAGA 3VSLA 1SMYF 1LPQA 3WE2A 2H6BA 1I1SA 4XRFA 2XROA 3E6CC 4L0ZB 2E71A 1U9NA 3GTGJ 2M2EA 1STZA 1NTCA 3OWTA 1IJWC 2X6XA 1ZRDA 4FASD 2EFPA 2VI6A 2ICWG 1W7PA 2DLLA 3TO9A 4WX9A 1K78A 3OYBA 1E2XA 2W82A 1X19A 4LK1F 5EG0B 3HL2A 1MDMA 2EIKH 2HQRA 4Q4ZF 5ICEA 3CCMI 2R7SA 4MNUA 2QKMB 2VODA 4A3EJ 3WHCA 3OSFA 2KJCA 1XDSA 5H6RA 1EA3A 2P5VA 3VB2A 4AVPA 3GZNB 1HKSA 2O03A 4HNTA 3S3NA 5FGMA 3CTAA 4ZYAA 4CUGA 3HOYJ 4HDVA 4XSZF 3BCAA 3C3WA 1G2HA 2FE3A 5JHFA 1N25A 1TQMA 2VIXA 4DZJA 5TGTA 3M9AA 5FD6A 2X6WA 1R5GA 2OTJI 1MJ9A 1IRZA 1X4PA 1ON1A 4Y17A 3C2BA 4D7NA 4ZZLA 5HLGA 2R7OA 2DA3A 1R1VA 3U2RA 5E3NA 4DW6A 5GAGJ 2ZFUA 4FE4A 4OINF 3S3OA 2HPMA 5E1WA 3HRUA 2EFOA 1DDNA 4ZYEA 4QSHA 3ZMSA 4B3AA 2M9HA 5HLTA 1QPIA 5JR3A 3OYGA 2GBYA 3MWMA 1QPMA 1S3JA 2FJ1A 4S0HB 4J19A 1X2MA 3ZQIA 3COAC 5H2FC 3ZQHA 4EGZA 4KMUX 4DYRA 2MLGA 4XONA 2XF7A 1E3OC 2EFQA 3F9KA 3ZRGA 2LRDA 3O8GA 2OPTA 2K9QA 2A68F 3TOAA 1G8XA 5K5QA 2BBYA 1R1TA 1LFPA 2Z9OA 1A31A 4RGRA 4QPOA 1YS7A 1EJ9A 1USSA 4XKBA 3C18A 3HPGA 4HA8A 3KCCA 1FT9A 4RB2C 1P2FA 2DOFA 2V9VA 3DXJF 5F0FA 4RLQA 3JSPA 2HR3A 2E2HJ 3QYBA 1IC8A 1TT5B 2ECBA 2DFFA 4BXFA 4IZZA 3DLLF 3DEEA 4UB8C 1BR4A 4JX5A 3WE3A 4ZTFA 2V1NA 4L9JA 4UUSA 3QYFA 3CLQA 2B7EA 1ZG3A 2HVRA 1G4DA 2VUMJ 1BI3A 3FXJA 4EJTA 3R0JA 2O5RA 4E7ZA 2RN7A 1H0MA 4AVZA 2R7DA 4O6JA 4B48A 4CCJA 4KDPA 1AOYA 2DT5A 2QF7A 3HOTA 3M07A 4QWQA 1ZHFA 3OYEA 2W00A 1FPQA 4PJMA 2BY3A 3BROA 2VOOA 4V19K 1MMSA 3BG7A 3K4LA 3TP3A 3UNGC 3M4OJ 3F23A 2CFOA 2XB0X 2K86A 3M8FA 2AHQA 3CCRI 4KITB 4DBRA 1D0YA 4NBQA 2R7ZJ 2ME6A 4FX4A 3BY6A 3BLYA 5IP9J 4UVAA 3S1MJ 5C3EJ 1YX5A 2QBYA 2HOTA 4IHYA 2W84A 4RGUA 1XMXA 1D1BA 1ZLKA 3KP5A 4EJVA 1YO5C 5LHGA 1TNSA 1LDDA 3NWTA 4X1EA 5DD8A 3WTUC 4KA4A 3BJOA 3ZR8X 4IPAA 2E7XA 3I4NJ 1K83J 3DBRB 2K9SA 1HW1A 2Q2EB 3A0BC 3HRMA 2KL4A 3BWGA 3QQAA 2A5YB 1E17A 1J59A 2XGXA 4Y13A 3S2HJ 4PJNA 2E60A 5J40A 4UXNA 5E79C 5F1JA 3HGGA 1PDNC 3TKYA 3IRRA 1LE8A 2HVQA 4HSTA 5E3LA 3HYIA 2VPLA 2F5CA 2W57A 2DPDA 1XSVA 2MLKA 4EM2A 2IGKA 2XAGA 4B1RA 3J80Z 4A3KJ 3M1CA 5E1XA 1JKRC 1Z21A 4I0BA 3HOWJ 1MNDA 1SD6A 4A3LJ 3A1YA 4M3EA 4XORA 3TP0A 5IOZA 2MYSA 2DMUA 1FOXA 3LA7A 2ZBKA 3E3VA 5L3DA 4D5FA 1Z6TA 5BPIA 4E70A 4DBQA 2QWWA 1YE9A 2JZYA 2ZB9A 3FWEA 4FHTA 1SFUA 1ODDA 3LWFA 2MC3A 2XPVA 5CVVA 3PIPF 2F48A 4FT8A 1MMNA 3PIOF 1WSUA 2XUBA 4E7JA 5EEHA 3BR6A 4L0YB 2A6HF 2JK3A 2L7MP 2JA8J 5CVRA 4QPQA 1W36C 3PSIA 1FSHA 2JJ7A 2CW7A 3S17J 3HG9A 2XRNA 4BQNA 2M4GA 1MGTA 3ZMTA 2E2JJ 3BPXA 1Q1HA 4F91B 3CCUI 1A04A 2M8GX 1FYLA 2PG4A 2WADA 3FXUA 4KIGA 4M6YA 2FU4A 4HSRA 2C6YA 2DU9A 2TCTA 1VQ8I 3WHBA 1HQCA 2A6TA 2HS5A 2V9PA 1V5GA 1WJFA 3NAUA 3P5JA 3DF8A 1I39A 2BHZA 4WXHA 2EH3A 3AG3H 3MKWB 5HNFA 4RB1A 5BOXA 1K6OA 5HODA 1XGMA 2QQBA 1IRXA 2R5ZB 1T33A 3MAJA 4CZCA 4BE0A 2DQLA 1GDTA 5IT9K 2KKOA 4FISA 3W6VA 2EZLA 5D4RA 5HNHA 1P7JA 4A3GJ 2DA7A 1WHUA 3F6OA 1KYWA 4Z2YA 1WVRA 2HKXA 2DAOA 1IV8A 1RKWA 1OYYA 1HKQA 2HOAA 2JT1A 2Y75A 4A5NA 2R7UA 1VI0A 2E34A 2NVQJ 3J7AO 2GM4A 2MG4A 5JVTA 3MN2A 2V9KA 1Z91A 3QWLA 3JREA 2LG4A 2R5YB 1TLHB 1IN5A 1HW2A 2VBXA 5GTIC 1J7KA 2XAUA 3CDLA 1TQIA 2PMHA 4HQMA 2KIFA 3OL4A 3GZ6A 4XQFA 3HKZN 2Z1DA 1Y0UA 3I71A 3KYDB 5DS9A 1JHFA 1VQ6I 1K4TA 2JVHA 3T8TA 5HDNA 3J81Z 2R93J 1LVAA 2O8XA 2VBYA 1J0RA 4HG2A 3DTEA 3IL2A 4HEA2 4U7DA 1XS9A 3HM5A 2EZKA 1R9TJ 5CKTA 2K85A 1SMTA 4EEFG 2IS2A 3W6KB 3ZQ7A 1R58A 2VPRA 4HX4A 4MO7A 2GWRA 3E5XA 3Q0VA 1E3HA 3HRTA 4C2MJ 2ZSIB 3GTMJ 2ID3A 2L9VA 3H5AA 4XLEA 3RPUA 2OTLI 3HPHA 5LEKA 2OCCH 2KJBA 3ZXSA 1GV2A 3MZ8A 1YOVB 3S2DJ 3S1QJ 2NNNA 3L09A 2EINH 3CF5F 1DP3A 3EUHC 2RC4A 1RI7A 3JRAA 3VYRB 2VE9A 2BE5F 3LFKA 3BTCA 1Z05A 5AONA 5L3FA 2QM3A 3RKXA 2Z33A 3IH3A 5FLXK 3H3UA 2IBDA 3FK6A 4XLHA 1UHWA 2ISYA 1U9OA 1JT6A 4XOPA 4CZZA 1RRJA 1XG1A 2BXYA 1FYKA 3HTUA 4KT6A 4BDYA 3NARA 3RIRA 3T5XA 3ABTA 3HHGA 4ZH4F 3RTRA 5J1YA 2CUJA 4YELA 1A6QA 3KP2A 1RNLA 3HUGB 4XRSG 3RKQA 1XTAA 3PFIA 2DFEA 2NOGA 1IN6A 2DMPA 4IO9F 2Y2ZA 1IXRC 4HYEA 4CGZA 2JTVA 4XL9A 2CG4A 1NG7A 2F5DA 1P7IA 4A6DA 4MTDA 2ZSHB 4QLCU 5DCMB 4OAZA 4IHVA 5ILSA 2RQQA 4EJOA 2KT0A 4QTRA 1D0ZA 1VTNC 2LNBA 2VE8A 2MBFA 3GUDA 1SD4A 1TL8A 1TWAJ 4BS9A 2FBKA 2E1MC 3FM3A 5HS7A 2QGUA 3K7AJ 2UWMA 3WTSC 3DTKA 2LREA 4YEJA 4ETSA 1MZBA 2HQAA 1ZN2A 4Y3OA 3OV8A 1WWXA 2HVSA 1D1AA 1TW2A 2VQHA 4GYIA 1CQTA 4AC0A 4RDUA 4DJAA 2EIJH 2QEXI 1ETWA 2Q1ZB 4CHUA 1SD7A 3DEWA 3IHUA 1Z9CA 2XGCA 3JW4A 4NB5A 1QU3A 4XR6A 3HIFA 2H09A 1PUEE 3GW2A 2M0MA 3SQNA 2NVTJ 3FXKA 3UR3C 1JUMA 2B0LA 2IGNA 3JSOA 2PN6A 1H89C 4AM3A 3ERED 2ZNZA 1P4XA 3LSRA 4BY1J 3AG2H 1TC3C 1VQOI 3IKVA 4ZDPA 4BBRJ 1HDPA 2VJ4A 1AKHB 1ITYA 1LUJB 4RM3A 3OIQA 1ZRCA 3CMYA 2GOMA 4IF4A 2F4IA 2YUSA 1OYWA 4N0BA 4WF2A 3EETA 1JUSA 3WTZA 5DCFA 1N77A 1ZELA 1YJNI 4AD9A 3BG6A 2OF7A 2DN0A 2WAFA 3QODA 1WFXA 2KLOA 3S2WA 2KRHA 1HF0A 2ESHA 2XGDA 3CP2A 1WRJA 3WU2C 2VKDA 3F0CA 4MIMA 4CICA 4IOCF 2DK5A 2RQPA 3RQIA 4A12A 2EV0A 1GT0C 5J3LA 2EILH 2BW3A 2QUFA 3OYMA 2QQ9A 2LF7A 2V1UA 5JHUA 2TRTA 4RMNA 3I56I 4CXFA 2ME0A 2LF8A 2BV6A 1SEUA 3FXRA 2W85A 1G3TA 2X4HA 4II3A 1APLC 2IS1A 2HDDA 2JPCA 2X9DA 3FIWA 2MABA 1HBXG 4CCMA 2HNHA 4BHPA 2LK2A 4RB3C 1WJAA 2MFZA 1OFCX 4A69C 3I59B 1CF7A 1ZLJA 4P1WA 4B09A 3M8EA 3E1SA 3VWBA 2PMUA 4GGGA 5ICCA 1W5TA 2JA6J 1IG7A 2GA2A 3BR5A 2Y0MA 3GFJA 3WODF 4EVIA 2P4WA 2LFBA 2BEOA 1ZR2A 2IP2A 1S7OA 3ZQGA 4CYCA 2DT7B 4KNYA 3OS0A 2BVMA 4D7MA 2FXAA 3T0YA 1ZG1A 2WBMA 3FXMA 3NQOA 1YQAA 1DUXC 2Z5UA 3A02A 3FXOA 4M9XA 3A0HC 2COBA 4PZJA 3U1KA 4A5MA 1VQPI 3H1CA 1UFMA 4YIIA 1F36A 3H9QA 2ZMEA 4ESFA 1N75A 1DPUA 4RLFA 1OKRA 1MIJA 5E1ZB 3WGIA 3LMMA 1RZ4A 2QA4I 4A2UA 3BDDA 2OAZA 1WJ5A 3GVAA 1QGPA 2HXIA 4ZJZA 1VFCA 1I1GA 1YHQI 2R3SA 1MBEA 3U21A 4F52A 4PJJA 4J00A 2JA2A 2XIGA 2WAQA 2MD5A 2W25A 2XRLA 2XC7A 4BBSJ 1OCZH 3FHNA 4XN0A 3SZPA 2ZJRF 3EDPA 4HF2A 1QNTA 4BE2A 1JUPA 3LSGA 4IRGA 1SFOJ 3S1NJ 4OU0A 2L9RA 1XMAA 3GFMA 3U1DA 3TW6A 1DPRA 2COMA 2DMTA 5K5OA 1SVOA 2V26A 5CYVA 2VJJA 3JCUC 2JWTA 1B8IA 3KZIC 1EH7A 2DYRH 4ENKA 3F3XA 3FXQA 3G1MA 1MMAA 1GVJA 1G6NA 1Y8RB 1U6GA 4GO1A 1OCCH 3EQLF 3REOA 3EUKL 4E7HA 1BIAA 1BI0A 3V7SA 2XKOA 3M1EA 1MSFC 3OIPA 2MA3A 4AIKA 3L2WA 4I6ZA 1U5TA 3FMSA 3CCLI 2E1NA 1FLIA 3G2BA 4I09A 1WPKA 2FNAA 2R7TA 1K78B 2LD5A 1U8BA 4IJAA 2DA4A 4BH9A 4ITVA 2G0EA 3CJNA 4OAYA 1MDMB 1POGA 2K02A 1R22A 2BOLA 5FRMA 3DCFA 4JX4A 1OR7A 2DFHA 2HFHA 1V3FA 2DFIA 2FD5A 5F08A 2QENA 2ZCWA 5DD4A 4A3CJ 4XOTA 3SYTA 4FX0A 3Q5FA 3K10A 4U0YA 1FC3A 2BGCA 3BG3A 3LFUA 3PNYA 1IN8A 5IP7J 2V79A 3ZN0A 4M72A 4D1QA 2IXSA 1C0WA 4V2GA 4EJUA 4BJ6C 4L9VA 3L1PA 2EZIA 5F27A 2QCOA 1T8IA 1O57A 2CWEA 4LMYA 2N8GA 1XSXA 2O3FA 4ABZA 2XPWA 1LVKA 2IA2A 2RGVA 2RDPA 5EDNA 4E7KA 1FMVA 1SFEA 5D6EA 1FOWA 3IH4A 3BPVA 3IAM2 3TMOA 1X58A 1OISA 5CJ9A 3JRBA 2GOXB 1IO2A 2LY1A 4GYGA 4FTHA 2CJJA 3A03A 2DA1A 2Z2SB 2X0LA 1YW8A 2FQ3A 2K4JA 3MKYB 1A35A 2VC1A 2VJ5A 5J4YA 3LQQA 2GA1A 3F21A 3G1LA 1HA8A 3CO7C 2IPQX 2K9NA 2WV1A 1JKPC 1WQ2A 2DTZA 2KQRA 2VT2A 2QKLB 3RPQA 3ABMH 3OYJA 3BC8A 2Z3YA 1BC7C 3E6DA 4A0ZA 1L0OC 3HGYA 1X3ZB 3HRSA 2K27A 2DCEA 4XN3A 2I5UA 3HB9A 4C9YA 5C4XJ 1YTYA 4G8XA 2X1EA 2OUMA 3DTIA 1TWFJ 4M3GA 4AWXB 1W1WE 2KPMA 3BG9A 4G7OF 1X2NA 1YX3A 4B4CA 2KHMA 3HOSA 2CV0A 1J09A 1JTYA 2VASA 1I3AA 2L7KA 1SAXA 2W24A 2RAEA 5BMZA 2F4MB 2RKHA 4RGXA 4M71A 2KP6A 2FRHA 1WI9A
chains in the Genus database with same CATH topology
3RJPA 1TQPA 4MHGA 4I7HA 4PGGA 3MCZA 1JXSA 1QZZA 4GCVA 1YFHA 5F6FA 4KYWA 5HS9A 5AIPA 5ILVA 2WWYA 1CGPA 1WKMA 5J8FA 3BJAA 4OOIA 1W7PD 4PGHA 4HDUA 1FP1D 4U88A 1FBQA 1R5HA 1T98A 2P7CB 3QOPA 3L9FA 3P9KA 4LJZF 1IRGA 2H6CA 4OIQF 3F8BA 2A6EF 4RAYA 3VOEA 4O3MA 2FOKA 4U0VA 3TOBA 3DKWA 4UV9A 3RDIA 2F2EA 3SHFA 4N9HA 5BS6A 5FFXA 1UHMA 2DO7A 2JPBA 2FMYA 2ZNYA 4A0XA 2A61A 4L9NA 2R7FA 2AXLA 4M74A 3QU3A 1EV7A 2ZXJA 3R4KA 4WK8F 2E1CA 5K1YA 5IT9Z 2NAZA 5L3GA 4K2EA 1YLFA 3ABUA 1MJAA 2G9WA 2K4BA 2IW5A 2PEXA 3ZMUA 1I6XA 4MEYF 5KVRA 3DV8A 3K1MA 3KZZA 3VFZA 1G3YA 3I54A 4KN7X 2FSWA 2D45A 3BZ6A 5CVIA 3R60A 4G7ZF 5HVQC 5L3BA 3H92A 4CO8A 2YR2A 1IRFA 1QBJA 3TO7A 2F5FA 2CQKA 3K0LA 1B9MA 4G94A 1J9IA 3RYPA 1XGSA 1YS6A 3QAHA 1V4RA 1ONVA 2XVCA 3CUOA 3WU1B 1HXDA 4HV5A 4AIJA 1HKTA 3L00A 3I4PA 2EJRA 1W5SA 2Q2EA 2ZKZA 2ZO4A 1ZRFA 3HTSB 1LNWA 3JAMK 2HWVA 3ZN1A 3ML6A 2UXNA 1ZYRF 2XAQA 4HX7A 5FLXZ 5DYMA 4WXDA 2P5KA 3QP6A 1I5ZA 2D1VA 1J5YA 4XLPF 1IW7F 1S6LA 1FYMA 2UZKA 1F4KA 3P7NA 5DDGA 1B4AA 2ESNA 3ROUA 4OMZA 3N4MA 4XSXF 1IN7A 2BYVE 3W6JB 3L2CA 2Q8KA 5HLHA 1B59A 4L5JA 1D8KA 2WV0A 5F64A 1DP7P 1T2KA 3H3ZA 2Q0OA 5A2QK 1O7LA 1FBUA 3BP8A 3J80K 3PQKA 3KLOA 3I5UA 2DI3A 5LGNA 4ESJA 1BIBA 3QU6A 2LSOA 1XN7A 3GFIA 4UV8A 3CUQC 1U78A 4XLNF 3CO6C 5LHIA 1P4WA 3E6MA 5DUKA 2QLZA 2HDCA 3DFGA 5H6QA 4ENJA 3F6VA 4OIPF 1IUYA 2CGPA 3N97A 4Q48A 2CW0F 4IRHA 2WTEA 5LHHA 4HF0A 1TNTA 4Q5SF 3RKYA 2YSRA 4LD5A 5AIQA 3CDHA 4N9IA 1EH8A 1FOKA 1IAWA 3GWZA 2JRTA 2OZ6A 3EYIA 1P4AA 5CLSA 2EV5A 4I98B 4UHTA 2A07F 2FF4A 4KT5C 2CYYA 1PP8F 3LQRA 2O0YA 5J8CA 2XAHA 4IHTA 1RUOA 2DK8A 3ELKA 3DP7A 2P6TA 2OBPA 3QP5A 4RAZA 3KP4A 4OMYA 5ERIA 2YPRA 3J81K 4MEXF 3LA2A 5D5XB 1CF7B 3DPTA 1O3SA 5LGTA 4MTEA 3C1DA 3F8FA 3HUGA 1LB2A 3VODA 2MH2A 5JFRA 3MEXA 3K1NA 4LLGF 5FD5A 1S8NA 1GXPA 3DEUA 3V4GA 5DCMA 1KU2A 3HSRA 5JI6A 1F5TA 1UCRA 4I0AA 4R1HA 2M30A 2PFBA 3F72A 4WWCA 2ZMEB 2K7LA 5E8IA 3Q9SA 4M73A 4RGSA 4MQVA 3EYYA 2HZTA 2L54A 4O5VA 2ACJA 5ED4A 3I58A 1LEAA 2L01A 4HF1A 4KN4X 1JGSA 2HKOA 4M6XA 4YFKF 2A69F 1ON2A 2KRFA 5BQTA 1YG2A 2O61A 5HS8A 2ZFWA 1ZGAA 4KUMA 4DQ2A 3CUQB 1Z1DA 4G6QA 2M1BA 4ASNA 1U5TB 2EWNA 2GAUA 2HYGD 3ZMZA 5TJJA 2EB7A 4LG0A 3KEQA 4HV6A 1USTA 4U0WA 1U3EM 1QZYA 1FP2A 1MKMA 1R23A 3O2PE 3OOPA 1O7FA 2GIVA 2FBHA 1B9NA 1IF1A 3LAPA 2UXXA 1SFXA 1ZREA 1NHAA 3GO5A 1W7PB 3P9IA 3ULQB 4I2OA 3B02A 4UVCA 1IXSB 1KGSA 5LRRA 5E20A 2QYOA 1JHHA 3RI4A 3MFKA 2EFWA 3D0SA 1KQ8A 1D5VA 4HBLA 1HSTA 2IRFG 4WCGA 4EV0A 1B1BA 3SXYA 3KEOA 3QPTA 3EUHA 1IZ1A 3BJ6A 3O3KA 3C7JA 1SD5A 3K2ZA 2YX4A 2VOPA 1KU9A 2RVCA 4G9YA 1ZGJA 4WXCA 3FMQA 4A6EA 3CLOA 4OIOF 5HLIA 3KP6A 3LAJA 2OQGA 3TGNA 1ZH5A 2M87A 1HSJA 5F1RA 2HTSA 3NEUA 1I27A 4R8HA 1BC8C 3VEPA 4JK1X 1YW7A 1G3WA 2NRAC 3IKTA 1X3UA 2VN2A 2M5WA 3ZMVA 4L9TA 4ENNA 4JBAA 4ZYDA 2PBIA 1J75A 1KQ0A 2OZUA 4RB0A 4NQWA 5BPDA 2M8EA 2PLYA 3E5UA 2QVOA 4KIBA 2DPUA 2HEOA 2VXZA 1AWCA 3DPLC 3TDZC 3M7GA 2P5LC 4ENMA 5HDKA 2JSCA 5E8GA 3E6BA 3NRVA 1P92A 2FA5A 4H0EA 5LBQA 1TTYA 1FY7A 3JTGA 1ZG5A 1TW3A 4EQQA 1KU7A 3IWZA 2ELHA 2XV4S 1ZARA 2F5EA 3KZYA 2QBYB 3O6BB 2A3SA 2L3DA 4PCQA 3FM5A 4KIFA 4EM0B 4U7BA 4KICA 2STTA 3ZPLA 2OD5A 2VC0A 4ZYHA 3R61A 4RS8A 5H20A 3QPHA 5LGUA 5E17F 3AAFA 4BAYA 1D3YA 1RUNA 5D8KB 4HX8A 4NHJA 1BJAA 1W4MA 3JAMZ 2IT0A 2M45A 4HQEA 4P5OA 1BI2A 4CYDA 3ZP5A 2HTJA 2GZWA 3WGGA 1IN4A 2OQRA 4XBFA 2GXBA 1G3SA 1Z7UA 3I64A 5HOOA 1TBXA 2RV8A 5L3CA 4EMSA 2XKPA 3IC7A 1O3TA 5CVUA 2PI0A 4P55A 2DBBA 2FNPA 2G7UA 3BOQA 2YX7A 3ECHA 3R6SA 4ESBA 5D8LB 3P9CA 2KIUA 4AIHA 4I01A 3R0AA 5A2QZ 1KA8A 2DW4A 2G7HA 2GXGA 5KK1A 3ECOA 5D4SA 2DQRA 1FWZA 4I02A 1LDKB 1R7JA 3T1BA 1F1ZA 4Q47A 4G7HF 4UUVA 4HAMA 3LSTA 5ICFA 4MGRA 2FMLA 4HZFA 2YU3A 4JQFA 3WGHA 1XD7A 1BBYA 3FX3A 1KU3A 2AS5F 2HYFA 3K1PA 3WU0A 1XSDA 1QQIA 3KFWX 2EV6A 3SFZA 1MJBA 3K69A 4BQAA 1BM9A 1O3RA 4KFCA 1LDJA 5DEQA 3B73A 3F22A 1HW5A 5L3EA 1FX7A 4LB5A 3KP7A 1K7AA 3V8LA 4S04A 4LB6B 2L4AA 5D5UB 3E97A 3K9TA 3L7WA 2NS0A 2FEZA 1KYZA 2XHKA 1UB9A 4Y15A 2TDXA 4IVNA 3WTVC 3FMRA 1JE8A 3FF5A 1REPC 1B6AA 4ZYGA 1R36A 2J5PA 2PJPA 2LKPA 2XASA 1FNNA 2VBZA 3T8RA 1XGOA 4UVBA 4BXUA 5J6XA 1L3LA 4EGYA 3G3ZA 2OU2A 5LLQA 3WTYC 2ZJ2A 4IHSA 1U5TC 2L4MA 3F8CA 2NNYA 4HLXA 4YIFA 4ZZDA 1XCBA 1OMIA 1U8RA 2E7WA 2GQQA 3I53A 2ADUA 1LQ1A 2V1DA 2HOEA 4HLYA 5CVJA 3I0TA 2KIMA 3PQJA 2D2WA 3U9GA 5FO5A 4HOBA 3E5QA 2Y48A 4LFUA 1XGNA 1IXCA 2ETHA 3GF2A 4D0PA 4DNCA 3V8KA 2P7VB 4M9ZA 1XMKA 5TRDA 1R1UA 3IRQA 3GYHX 1S7AA 5EEGA 4R79A 2FBIA 4OIRF 4IRIA 2IA0A 2QQAA 5ILUA 4GXOA 1R00A 4YFNF 1T39A 4BNCA 6PAXA 4MQ9F 2EA2A 2CO5A 5LRSA 4TV7A 4EM1A 5D5WB 4BHCA 3KE2A 3JTHA 2ISZA 4P96A 2HGCA 2V6CA 1Z6RA 1S29A 3F8NA 3G73A 2STWA 4CDGA 5D6FA 1KQ9A 3HSFA 2EK5A 3MZHA 3TQNA 1T6SA 3FZVA 2VONA 2P8TA 1FZPB 5DV5A 3KLNA 1U2WA 3SZTA 3TDUC 4ON0A 5IT3A 4YFXF 3WTWC 4LGWA 3QRFF 2EA4A 4LK0F 4F7ZA 1ZAOA 4L18B 1QO0D 1OPCA 4HW0A 1XDUA 3V8JA 2Z99A 1T38A 1BN5A 3GZ5A 2QZ8A 1BOAA 4LG0B 3KP3A 3GX4X 4EJWA 1O3QA 1XB4A 2VBWA 2PQ8A 3GFLA 3GXOA 2DTRA 2D1HA 4UNOA 5FB2A 2WC2A 1YYVA 1FSEA 3ISPA 1LJ9A 2HQNA 1T0FA 5LEJA 2H27A 3Q9VA 3MQ0A 5K5RA 4P9UA 3HSEA 1MD0A 1YIOA 2NYXA 4G6DA 4P9FA 4L5IA 4LLLA 2IVMA 2V1XA 1K79A 5E18F 4A0YA 2L02A 2CSOA 1BI1A 2XAFA 1H9TA 2LDUA 3TO6A 1P6RA 3GLXA 3F8MA 3FHZA 3ZMDA 3WTTC 3WG9A 3RYRA 2OA4A 4YG2F 3GEZA 3I59A 5DUIA 3IWFA 4B8XA 1F9NA 3V7CA 1OYIA 2H94A 3HHHA 4M9SA 1YW9A 5D5VB 2P6SA 5ICGA 1ULYA 1PP7U 2CFXA 3D5LA 1J2XA 4S05A 4PDKA 2MH9A 2O6GE 3CUQA 3KETA 2XAJA 3LA3A 3V7RA 1GHCA 3WTXC 2RNJA 2EFNA 4BHBA 1GXQA 2J5OA 5HDGA 1H9GA 3RKWA 1WI9A 1RIOH 2IJLA 1XCVA 3MZYA 2IA1A 1LEBA 4IXAA 3DQVC 1FBSA 1D8JA 4LLNA 1EH6A 4KMFA 2VT3A 5FFZA 4BYYA 1SMYF 3WE2A 2H6BA 1I1SA 4XRFA 2XROA 3E6CC 4L0ZB 1STZA 1ZRDA 2EFPA 1W7PA 2DLLA 3TO9A 4WX9A 1K78A 1E2XA 4LK1F 1MDMA 2HQRA 4Q4ZF 5ICEA 4MNUA 2VODA 2KJCA 1XDSA 5H6RA 3VB2A 2P5VA 4AVPA 1HKSA 2O03A 5FGMA 3CTAA 4HDVA 4XSZF 3C3WA 2FE3A 1TQMA 3M9AA 5FD6A 1R5GA 1MJ9A 1ON1A 4Y17A 5HLGA 4ZZLA 1R1VA 3U2RA 4OINF 5E1WA 3HRUA 2EFOA 1DDNA 4ZYEA 3ZMSA 5JR3A 3MWMA 1QPMA 1S3JA 3COAC 4EGZA 4KMUX 2MLGA 2EFQA 2A68F 3TOAA 5K5QA 2BBYA 1R1TA 2Z9OA 4RGRA 1YS7A 1USSA 3C18A 4HA8A 3KCCA 1FT9A 4RB2C 1P2FA 2V9VA 3DXJF 3JSPA 2HR3A 3WE3A 4L9JA 1ZG3A 1G4DA 1BI3A 4EJTA 3R0JA 2RN7A 1H0MA 2R7DA 4O6JA 4KDPA 1AOYA 2DT5A 3HOTA 4QWQA 1ZHFA 1FPQA 2VOOA 3BROA 3F23A 3M8FA 2K86A 4FX4A 3BY6A 4UVAA 2QBYA 2W84A 4RGUA 1ZLKA 3KP5A 4EJVA 1YO5C 5LHGA 1TNSA 1LDDA 4KA4A 5DD8A 3WTUC 3BJOA 4IPAA 2E7XA 1HW1A 3HRMA 3BWGA 2A5YB 1E17A 1J59A 2XGXA 4Y13A 4UXNA 1PDNC 3TKYA 3IRRA 3HYIA 2F5CA 2W57A 2DPDA 1XSVA 2MLKA 4EM2A 2XAGA 3J80Z 5E1XA 4I0BA 1SD6A 3LA7A 2ZBKA 3E3VA 5L3DA 1Z6TA 5BPIA 4E70A 2QWWA 2JZYA 3FWEA 4FHTA 1SFUA 1ODDA 3LWFA 2MC3A 5CVVA 1WSUA 4FT8A 2XUBA 5EEHA 4L0YB 2A6HF 5CVRA 1FSHA 2XRNA 1MGTA 3ZMTA 3BPXA 1Q1HA 1A04A 1FYLA 2PG4A 3FXUA 4KIGA 4M6YA 2FU4A 2C6YA 2DU9A 1HQCA 2HS5A 3DF8A 4WXHA 4RB1A 5BOXA 1K6OA 1XGMA 2QQBA 3MAJA 5IT9K 2DQLA 2KKOA 5D4RA 3F6OA 1KYWA 4Z2YA 2HKXA 2DAOA 2JT1A 2Y75A 1OYYA 1HKQA 4A5NA 3J7AO 5JVTA 1Z91A 1TLHB 1IN5A 1HW2A 2VBXA 1J7KA 1TQIA 2PMHA 4HQMA 2KIFA 3GZ6A 1Y0UA 3I71A 1JHFA 3T8TA 5HDNA 3J81Z 1LVAA 2O8XA 2VBYA 1J0RA 3IL2A 4U7DA 1SMTA 3W6KB 3ZQ7A 1R58A 4HX4A 2GWRA 3E5XA 3HRTA 3RPUA 5LEKA 2KJBA 2NNNA 3L09A 2RC4A 1RI7A 2VE9A 2BE5F 3LFKA 1Z05A 5AONA 5L3FA 2QM3A 3RKXA 2Z33A 5FLXK 3H3UA 1UHWA 2ISYA 4CZZA 1FYKA 3HTUA 3RIRA 3T5XA 4ZH4F 3ABTA 3HHGA 3RTRA 3KP2A 1RNLA 3PFIA 1IN6A 1IXRC 4CGZA 2JTVA 2CG4A 2F5DA 4A6DA 4MTDA 4QLCU 5DCMB 5ILSA 4EJOA 1VTNC 2LNBA 2VE8A 2MBFA 3GUDA 1SD4A 2FBKA 3FM3A 5HS7A 2UWMA 3WTSC 4ETSA 1MZBA 1ZN2A 3OV8A 1WWXA 1TW2A 4GYIA 4CHUA 1SD7A 3IHUA 1Z9CA 3JW4A 4NB5A 3HIFA 2H09A 1PUEE 3GW2A 3SQNA 2B0LA 3JSOA 2PN6A 3ERED 2ZNZA 1P4XA 3IKVA 1ZRCA 4IF4A 1OYWA 4N0BA 4WF2A 3EETA 3WTZA 5DCFA 4AD9A 3S2WA 2ESHA 1WRJA 4CICA 2DK5A 2RQPA 4A12A 2EV0A 2QUFA 2QQ9A 2LF7A 2V1UA 5JHUA 4CXFA 2LF8A 2BV6A 3FXRA 2W85A 1G3TA 2X4HA 2JPCA 1HBXG 4BHPA 4RB3C 3I59B 1CF7A 1ZLJA 4B09A 3M8EA 2PMUA 4GGGA 5ICCA 1W5TA 2GA2A 4EVIA 2Y0MA 3GFJA 3WODF 2P4WA 2BEOA 2IP2A 1S7OA 4KNYA 1ZG1A 2FXAA 3T0YA 3NQOA 1YQAA 1DUXC 2Z5UA 4M9XA 4PZJA 4A5MA 1UFMA 4YIIA 2ZMEA 4ESFA 1DPUA 1OKRA 5E1ZB 3WGIA 1RZ4A 4A2UA 3BDDA 2OAZA 3GVAA 1QGPA 1I1GA 2R3SA 2XIGA 2MD5A 2W25A 3SZPA 3EDPA 4HF2A 1QNTA 4IRGA 4OU0A 1XMAA 3GFMA 3U1DA 1DPRA 2COMA 5K5OA 5CYVA 1EH7A 4ENKA 3F3XA 3FXQA 1GVJA 1G6NA 1U6GA 4GO1A 3EQLF 3REOA 1BIAA 1BI0A 3V7SA 2XKOA 3M1EA 2MA3A 4AIKA 1U5TA 3FMSA 2E1NA 1FLIA 4I09A 2FNAA 1K78B 4IJAA 4BH9A 3CJNA 1MDMB 2K02A 1R22A 1OR7A 2HFHA 1V3FA 2DFIA 2QENA 2ZCWA 5DD4A 4FX0A 3Q5FA 4U0YA 1FC3A 2BGCA 1IN8A 2V79A 3ZN0A 4M72A 1C0WA 4EJUA 4L9VA 1O57A 2CWEA 4LMYA 1XSXA 2O3FA 2IA2A 2RGVA 2RDPA 1SFEA 5D6EA 3BPVA 5CJ9A 4GYGA 1YW8A 2FQ3A 2X0LA 2K4JA 2VC1A 3LQQA 2GA1A 3F21A 3CO7C 2IPQX 1WQ2A 2VT2A 3RPQA 2Z3YA 1BC7C 3E6DA 4A0ZA 1L0OC 3HRSA 2K27A 1YTYA 4G8XA 4AWXB 4G7OF 3HOSA 1SAXA 2W24A 5BMZA 2RKHA 4RGXA 4M71A 2FRHA 4HYEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RJP A;  1TQP A;  4MHG A;  4I7H A;  4PGG A;  3MCZ A;  1JXS A;  1QZZ A;  4GCV A;  1YFH A;  5F6F A;  4KYW A;  5HS9 A;  5AIP A;  5ILV A;  2WWY A;  1CGP A;  1WKM A;  5J8F A;  3BJA A;  4OOI A;  1W7P D;  4PGH A;  4HDU A;  1FP1 D;  4U88 A;  1FBQ A;  1R5H A;  1T98 A;  2P7C B;  3QOP A;  3L9F A;  3P9K A;  4LJZ F;  1IRG A;  2H6C A;  4OIQ F;  3F8B A;  2A6E F;  4RAY A;  3VOE A;  4O3M A;  2FOK A;  4U0V A;  3TOB A;  3DKW A;  4UV9 A;  3RDI A;  2F2E A;  3SHF A;  4N9H A;  5BS6 A;  5FFX A;  1UHM A;  2DO7 A;  2JPB A;  2FMY A;  2ZNY A;  4A0X A;  2A61 A;  4L9N A;  2R7F A;  2AXL A;  4M74 A;  3QU3 A;  1EV7 A;  2ZXJ A;  3R4K A;  4WK8 F;  2E1C A;  5K1Y A;  5IT9 Z;  2NAZ A;  5L3G A;  4K2E A;  1YLF A;  3ABU A;  1MJA A;  2G9W A;  2K4B A;  2IW5 A;  2PEX A;  3ZMU A;  1I6X A;  4MEY F;  5KVR A;  3DV8 A;  3K1M A;  3KZZ A;  3VFZ A;  1G3Y A;  3I54 A;  4KN7 X;  2FSW A;  2D45 A;  3BZ6 A;  5CVI A;  3R60 A;  4G7Z F;  5HVQ C;  5L3B A;  3H92 A;  4CO8 A;  2YR2 A;  1IRF A;  1QBJ A;  3TO7 A;  2F5F A;  2CQK A;  3K0L A;  1B9M A;  4G94 A;  1J9I A;  3RYP A;  1XGS A;  1YS6 A;  3QAH A;  1V4R A;  1ONV A;  2XVC A;  3CUO A;  3WU1 B;  1HXD A;  4HV5 A;  4AIJ A;  1HKT A;  3L00 A;  3I4P A;  2EJR A;  1W5S A;  2Q2E A;  2ZKZ A;  2ZO4 A;  1ZRF A;  3HTS B;  1LNW A;  3JAM K;  2HWV A;  3ZN1 A;  3ML6 A;  2UXN A;  1ZYR F;  2XAQ A;  4HX7 A;  5FLX Z;  5DYM A;  4WXD A;  2P5K A;  3QP6 A;  1I5Z A;  2D1V A;  1J5Y A;  4XLP F;  1IW7 F;  1S6L A;  1FYM A;  2UZK A;  1F4K A;  3P7N A;  5DDG A;  1B4A A;  2ESN A;  3ROU A;  4OMZ A;  3N4M A;  4XSX F;  1IN7 A;  2BYV E;  3W6J B;  3L2C A;  2Q8K A;  5HLH A;  1B59 A;  4L5J A;  1D8K A;  2WV0 A;  5F64 A;  1DP7 P;  1T2K A;  3H3Z A;  2Q0O A;  5A2Q K;  1O7L A;  1FBU A;  3BP8 A;  3J80 K;  3PQK A;  3KLO A;  3I5U A;  2DI3 A;  5LGN A;  4ESJ A;  1BIB A;  3QU6 A;  2LSO A;  1XN7 A;  3GFI A;  4UV8 A;  3CUQ C;  1U78 A;  4XLN F;  3CO6 C;  5LHI A;  1P4W A;  3E6M A;  5DUK A;  2QLZ A;  2HDC A;  3DFG A;  5H6Q A;  4ENJ A;  3F6V A;  4OIP F;  1IUY A;  2CGP A;  3N97 A;  4Q48 A;  2CW0 F;  4IRH A;  2WTE A;  5LHH A;  4HF0 A;  1TNT A;  4Q5S F;  3RKY A;  2YSR A;  4LD5 A;  5AIQ A;  3CDH A;  4N9I A;  1EH8 A;  1FOK A;  1IAW A;  3GWZ A;  2JRT A;  2OZ6 A;  3EYI A;  1P4A A;  5CLS A;  2EV5 A;  4I98 B;  4UHT A;  2A07 F;  2FF4 A;  4KT5 C;  2CYY A;  1PP8 F;  3LQR A;  2O0Y A;  5J8C A;  2XAH A;  4IHT A;  1RUO A;  2DK8 A;  3ELK A;  3DP7 A;  2P6T A;  2OBP A;  3QP5 A;  4RAZ A;  3KP4 A;  4OMY A;  5ERI A;  2YPR A;  3J81 K;  4MEX F;  3LA2 A;  5D5X B;  1CF7 B;  3DPT A;  1O3S A;  5LGT A;  4MTE A;  3C1D A;  3F8F A;  3HUG A;  1LB2 A;  3VOD A;  2MH2 A;  5JFR A;  3MEX A;  3K1N A;  4LLG F;  5FD5 A;  1S8N A;  1GXP A;  3DEU A;  3V4G A;  5DCM A;  1KU2 A;  3HSR A;  5JI6 A;  1F5T A;  1UCR A;  4I0A A;  4R1H A;  2M30 A;  2PFB A;  3F72 A;  4WWC A;  2ZME B;  2K7L A;  5E8I A;  3Q9S A;  4M73 A;  4RGS A;  4MQV A;  3EYY A;  2HZT A;  2L54 A;  4O5V A;  2ACJ A;  5ED4 A;  3I58 A;  1LEA A;  2L01 A;  4HF1 A;  4KN4 X;  1JGS A;  2HKO A;  4M6X A;  4YFK F;  2A69 F;  1ON2 A;  2KRF A;  5BQT A;  1YG2 A;  2O61 A;  5HS8 A;  2ZFW A;  1ZGA A;  4KUM A;  4DQ2 A;  3CUQ B;  1Z1D A;  4G6Q A;  2M1B A;  4ASN A;  1U5T B;  2EWN A;  2GAU A;  2HYG D;  3ZMZ A;  5TJJ A;  2EB7 A;  4LG0 A;  3KEQ A;  4HV6 A;  1UST A;  4U0W A;  1U3E M;  1QZY A;  1FP2 A;  1MKM A;  1R23 A;  3O2P E;  3OOP A;  1O7F A;  2GIV A;  2FBH A;  1B9N A;  1IF1 A;  3LAP A;  2UXX A;  1SFX A;  1ZRE A;  1NHA A;  3GO5 A;  1W7P B;  3P9I A;  3ULQ B;  4I2O A;  3B02 A;  4UVC A;  1IXS B;  1KGS A;  5LRR A;  5E20 A;  2QYO A;  1JHH A;  3RI4 A;  3MFK A;  2EFW A;  3D0S A;  1KQ8 A;  1D5V A;  4HBL A;  1HST A;  2IRF G;  4WCG A;  4EV0 A;  1B1B A;  3SXY A;  3KEO A;  3QPT A;  3EUH A;  1IZ1 A;  3BJ6 A;  3O3K A;  3C7J A;  1SD5 A;  3K2Z A;  2YX4 A;  2VOP A;  1KU9 A;  2RVC A;  4G9Y A;  1ZGJ A;  4WXC A;  3FMQ A;  4A6E A;  3CLO A;  4OIO F;  5HLI A;  3KP6 A;  3LAJ A;  2OQG A;  3TGN A;  1ZH5 A;  2M87 A;  1HSJ A;  5F1R A;  2HTS A;  3NEU A;  1I27 A;  4R8H A;  1BC8 C;  3VEP A;  4JK1 X;  1YW7 A;  1G3W A;  2NRA C;  3IKT A;  1X3U A;  2VN2 A;  2M5W A;  3ZMV A;  4L9T A;  4ENN A;  4JBA A;  4ZYD A;  2PBI A;  1J75 A;  1KQ0 A;  2OZU A;  4RB0 A;  4NQW A;  5BPD A;  2M8E A;  2PLY A;  3E5U A;  2QVO A;  4KIB A;  2DPU A;  2HEO A;  2VXZ A;  1AWC A;  3DPL C;  3TDZ C;  3M7G A;  2P5L C;  4ENM A;  5HDK A;  2JSC A;  5E8G A;  3E6B A;  3NRV A;  1P92 A;  2FA5 A;  4H0E A;  5LBQ A;  1TTY A;  1FY7 A;  3JTG A;  1ZG5 A;  1TW3 A;  4EQQ A;  1KU7 A;  3IWZ A;  2ELH A;  2XV4 S;  1ZAR A;  2F5E A;  3KZY A;  2QBY B;  3O6B B;  2A3S A;  2L3D A;  4PCQ A;  3FM5 A;  4KIF A;  4EM0 B;  4U7B A;  4KIC A;  2STT A;  3ZPL A;  2OD5 A;  2VC0 A;  4ZYH A;  3R61 A;  4RS8 A;  5H20 A;  3QPH A;  5LGU A;  5E17 F;  3AAF A;  4BAY A;  1D3Y A;  1RUN A;  5D8K B;  4HX8 A;  4NHJ A;  1BJA A;  1W4M A;  3JAM Z;  2IT0 A;  2M45 A;  4HQE A;  4P5O A;  1BI2 A;  4CYD A;  3ZP5 A;  2HTJ A;  2GZW A;  3WGG A;  1IN4 A;  2OQR A;  4XBF A;  2GXB A;  1G3S A;  1Z7U A;  3I64 A;  5HOO A;  1TBX A;  2RV8 A;  5L3C A;  4EMS A;  2XKP A;  3IC7 A;  1O3T A;  5CVU A;  2PI0 A;  4P55 A;  2DBB A;  2FNP A;  2G7U A;  3BOQ A;  2YX7 A;  3ECH A;  3R6S A;  4ESB A;  5D8L B;  3P9C A;  2KIU A;  4AIH A;  4I01 A;  3R0A A;  5A2Q Z;  1KA8 A;  2DW4 A;  2G7H A;  2GXG A;  5KK1 A;  3ECO A;  5D4S A;  2DQR A;  1FWZ A;  4I02 A;  1LDK B;  1R7J A;  3T1B A;  1F1Z A;  4Q47 A;  4G7H F;  4UUV A;  4HAM A;  3LST A;  5ICF A;  4MGR A;  2FML A;  4HZF A;  2YU3 A;  4JQF A;  3WGH A;  1XD7 A;  1BBY A;  3FX3 A;  1KU3 A;  2AS5 F;  2HYF A;  3K1P A;  3WU0 A;  1XSD A;  1QQI A;  3KFW X;  2EV6 A;  3SFZ A;  1MJB A;  3K69 A;  4BQA A;  1BM9 A;  1O3R A;  4KFC A;  1LDJ A;  5DEQ A;  3B73 A;  3F22 A;  1HW5 A;  5L3E A;  1FX7 A;  4LB5 A;  3KP7 A;  1K7A A;  3V8L A;  4S04 A;  4LB6 B;  2L4A A;  5D5U B;  3E97 A;  3K9T A;  3L7W A;  2NS0 A;  2FEZ A;  1KYZ A;  2XHK A;  1UB9 A;  4Y15 A;  2TDX A;  4IVN A;  3WTV C;  3FMR A;  1JE8 A;  3FF5 A;  1REP C;  1B6A A;  4ZYG A;  1R36 A;  2J5P A;  2PJP A;  2LKP A;  2XAS A;  1FNN A;  2VBZ A;  3T8R A;  1XGO A;  4UVB A;  4BXU A;  5J6X A;  1L3L A;  4EGY A;  3G3Z A;  2OU2 A;  5LLQ A;  3WTY C;  2ZJ2 A;  4IHS A;  1U5T C;  2L4M A;  3F8C A;  2NNY A;  4HLX A;  4YIF A;  4ZZD A;  1XCB A;  1OMI A;  1U8R A;  2E7W A;  2GQQ A;  3I53 A;  2ADU A;  1LQ1 A;  2V1D A;  2HOE A;  4HLY A;  5CVJ A;  3I0T A;  2KIM A;  3PQJ A;  2D2W A;  3U9G A;  5FO5 A;  4HOB A;  3E5Q A;  2Y48 A;  4LFU A;  1XGN A;  1IXC A;  2ETH A;  3GF2 A;  4D0P A;  4DNC A;  3V8K A;  2P7V B;  4M9Z A;  1XMK A;  5TRD A;  1R1U A;  3IRQ A;  3GYH X;  1S7A A;  5EEG A;  4R79 A;  2FBI A;  4OIR F;  4IRI A;  2IA0 A;  2QQA A;  5ILU A;  4GXO A;  1R00 A;  4YFN F;  1T39 A;  4BNC A;  6PAX A;  4MQ9 F;  2EA2 A;  2CO5 A;  5LRS A;  4TV7 A;  4EM1 A;  5D5W B;  4BHC A;  3KE2 A;  3JTH A;  2ISZ A;  4P96 A;  2HGC A;  2V6C A;  1Z6R A;  1S29 A;  3F8N A;  3G73 A;  2STW A;  4CDG A;  5D6F A;  1KQ9 A;  3HSF A;  2EK5 A;  3MZH A;  3TQN A;  1T6S A;  3FZV A;  2VON A;  2P8T A;  1FZP B;  5DV5 A;  3KLN A;  1U2W A;  3SZT A;  3TDU C;  4ON0 A;  5IT3 A;  4YFX F;  3WTW C;  4LGW A;  3QRF F;  2EA4 A;  4LK0 F;  4F7Z A;  1ZAO A;  4L18 B;  1QO0 D;  1OPC A;  4HW0 A;  1XDU A;  3V8J A;  2Z99 A;  1T38 A;  1BN5 A;  3GZ5 A;  2QZ8 A;  1BOA A;  4LG0 B;  3KP3 A;  3GX4 X;  4EJW A;  1O3Q A;  1XB4 A;  2VBW A;  2PQ8 A;  3GFL A;  3GXO A;  2DTR A;  2D1H A;  4UNO A;  5FB2 A;  2WC2 A;  1YYV A;  1FSE A;  3ISP A;  1LJ9 A;  2HQN A;  1T0F A;  5LEJ A;  2H27 A;  3Q9V A;  3MQ0 A;  5K5R A;  4P9U A;  3HSE A;  1MD0 A;  1YIO A;  2NYX A;  4G6D A;  4P9F A;  4L5I A;  4LLL A;  2IVM A;  2V1X A;  1K79 A;  5E18 F;  4A0Y A;  2L02 A;  2CSO A;  1BI1 A;  2XAF A;  1H9T A;  2LDU A;  3TO6 A;  1P6R A;  3GLX A;  3F8M A;  3FHZ A;  3ZMD A;  3WTT C;  3WG9 A;  3RYR A;  2OA4 A;  4YG2 F;  3GEZ A;  3I59 A;  5DUI A;  3IWF A;  4B8X A;  1F9N A;  3V7C A;  1OYI A;  2H94 A;  3HHH A;  4M9S A;  1YW9 A;  5D5V B;  2P6S A;  5ICG A;  1ULY A;  1PP7 U;  2CFX A;  3D5L A;  1J2X A;  4S05 A;  4PDK A;  2MH9 A;  2O6G E;  3CUQ A;  3KET A;  2XAJ A;  3LA3 A;  3V7R A;  1GHC A;  3WTX C;  2RNJ A;  2EFN A;  4BHB A;  1GXQ A;  2J5O A;  5HDG A;  1H9G A;  3RKW A;  1WI9 A;  1RIO H;  2IJL A;  1XCV A;  3MZY A;  2IA1 A;  1LEB A;  4IXA A;  3DQV C;  1FBS A;  1D8J A;  4LLN A;  1EH6 A;  4KMF A;  2VT3 A;  5FFZ A;  4BYY A;  1SMY F;  3WE2 A;  2H6B A;  1I1S A;  4XRF A;  2XRO A;  3E6C C;  4L0Z B;  1STZ A;  1ZRD A;  2EFP A;  1W7P A;  2DLL A;  3TO9 A;  4WX9 A;  1K78 A;  1E2X A;  4LK1 F;  1MDM A;  2HQR A;  4Q4Z F;  5ICE A;  4MNU A;  2VOD A;  2KJC A;  1XDS A;  5H6R A;  3VB2 A;  2P5V A;  4AVP A;  1HKS A;  2O03 A;  5FGM A;  3CTA A;  4HDV A;  4XSZ F;  3C3W A;  2FE3 A;  1TQM A;  3M9A A;  5FD6 A;  1R5G A;  1MJ9 A;  1ON1 A;  4Y17 A;  5HLG A;  4ZZL A;  1R1V A;  3U2R A;  4OIN F;  5E1W A;  3HRU A;  2EFO A;  1DDN A;  4ZYE A;  3ZMS A;  5JR3 A;  3MWM A;  1QPM A;  1S3J A;  3COA C;  4EGZ A;  4KMU X;  2MLG A;  2EFQ A;  2A68 F;  3TOA A;  5K5Q A;  2BBY A;  1R1T A;  2Z9O A;  4RGR A;  1YS7 A;  1USS A;  3C18 A;  4HA8 A;  3KCC A;  1FT9 A;  4RB2 C;  1P2F A;  2V9V A;  3DXJ F;  3JSP A;  2HR3 A;  3WE3 A;  4L9J A;  1ZG3 A;  1G4D A;  1BI3 A;  4EJT A;  3R0J A;  2RN7 A;  1H0M A;  2R7D A;  4O6J A;  4KDP A;  1AOY A;  2DT5 A;  3HOT A;  4QWQ A;  1ZHF A;  1FPQ A;  2VOO A;  3BRO A;  3F23 A;  3M8F A;  2K86 A;  4FX4 A;  3BY6 A;  4UVA A;  2QBY A;  2W84 A;  4RGU A;  1ZLK A;  3KP5 A;  4EJV A;  1YO5 C;  5LHG A;  1TNS A;  1LDD A;  4KA4 A;  5DD8 A;  3WTU C;  3BJO A;  4IPA A;  2E7X A;  1HW1 A;  3HRM A;  3BWG A;  2A5Y B;  1E17 A;  1J59 A;  2XGX A;  4Y13 A;  4UXN A;  1PDN C;  3TKY A;  3IRR A;  3HYI A;  2F5C A;  2W57 A;  2DPD A;  1XSV A;  2MLK A;  4EM2 A;  2XAG A;  3J80 Z;  5E1X A;  4I0B A;  1SD6 A;  3LA7 A;  2ZBK A;  3E3V A;  5L3D A;  1Z6T A;  5BPI A;  4E70 A;  2QWW A;  2JZY A;  3FWE A;  4FHT A;  1SFU A;  1ODD A;  3LWF A;  2MC3 A;  5CVV A;  1WSU A;  4FT8 A;  2XUB A;  5EEH A;  4L0Y B;  2A6H F;  5CVR A;  1FSH A;  2XRN A;  1MGT A;  3ZMT A;  3BPX A;  1Q1H A;  1A04 A;  1FYL A;  2PG4 A;  3FXU A;  4KIG A;  4M6Y A;  2FU4 A;  2C6Y A;  2DU9 A;  1HQC A;  2HS5 A;  3DF8 A;  4WXH A;  4RB1 A;  5BOX A;  1K6O A;  1XGM A;  2QQB A;  3MAJ A;  5IT9 K;  2DQL A;  2KKO A;  5D4R A;  3F6O A;  1KYW A;  4Z2Y A;  2HKX A;  2DAO A;  2JT1 A;  2Y75 A;  1OYY A;  1HKQ A;  4A5N A;  3J7A O;  5JVT A;  1Z91 A;  1TLH B;  1IN5 A;  1HW2 A;  2VBX A;  1J7K A;  1TQI A;  2PMH A;  4HQM A;  2KIF A;  3GZ6 A;  1Y0U A;  3I71 A;  1JHF A;  3T8T A;  5HDN A;  3J81 Z;  1LVA A;  2O8X A;  2VBY A;  1J0R A;  3IL2 A;  4U7D A;  1SMT A;  3W6K B;  3ZQ7 A;  1R58 A;  4HX4 A;  2GWR A;  3E5X A;  3HRT A;  3RPU A;  5LEK A;  2KJB A;  2NNN A;  3L09 A;  2RC4 A;  1RI7 A;  2VE9 A;  2BE5 F;  3LFK A;  1Z05 A;  5AON A;  5L3F A;  2QM3 A;  3RKX A;  2Z33 A;  5FLX K;  3H3U A;  1UHW A;  2ISY A;  4CZZ A;  1FYK A;  3HTU A;  3RIR A;  3T5X A;  4ZH4 F;  3ABT A;  3HHG A;  3RTR A;  3KP2 A;  1RNL A;  3PFI A;  1IN6 A;  1IXR C;  4CGZ A;  2JTV A;  2CG4 A;  2F5D A;  4A6D A;  4MTD A;  4QLC U;  5DCM B;  5ILS A;  4EJO A;  1VTN C;  2LNB A;  2VE8 A;  2MBF A;  3GUD A;  1SD4 A;  2FBK A;  3FM3 A;  5HS7 A;  2UWM A;  3WTS C;  4ETS A;  1MZB A;  1ZN2 A;  3OV8 A;  1WWX A;  1TW2 A;  4GYI A;  4CHU A;  1SD7 A;  3IHU A;  1Z9C A;  3JW4 A;  4NB5 A;  3HIF A;  2H09 A;  1PUE E;  3GW2 A;  3SQN A;  2B0L A;  3JSO A;  2PN6 A;  3ERE D;  2ZNZ A;  1P4X A;  3IKV A;  1ZRC A;  4IF4 A;  1OYW A;  4N0B A;  4WF2 A;  3EET A;  3WTZ A;  5DCF A;  4AD9 A;  3S2W A;  2ESH A;  1WRJ A;  4CIC A;  2DK5 A;  2RQP A;  4A12 A;  2EV0 A;  2QUF A;  2QQ9 A;  2LF7 A;  2V1U A;  5JHU A;  4CXF A;  2LF8 A;  2BV6 A;  3FXR A;  2W85 A;  1G3T A;  2X4H A;  2JPC A;  1HBX G;  4BHP A;  4RB3 C;  3I59 B;  1CF7 A;  1ZLJ A;  4B09 A;  3M8E A;  2PMU A;  4GGG A;  5ICC A;  1W5T A;  2GA2 A;  4EVI A;  2Y0M A;  3GFJ A;  3WOD F;  2P4W A;  2BEO A;  2IP2 A;  1S7O A;  4KNY A;  1ZG1 A;  2FXA A;  3T0Y A;  3NQO A;  1YQA A;  1DUX C;  2Z5U A;  4M9X A;  4PZJ A;  4A5M A;  1UFM A;  4YII A;  2ZME A;  4ESF A;  1DPU A;  1OKR A;  5E1Z B;  3WGI A;  1RZ4 A;  4A2U A;  3BDD A;  2OAZ A;  3GVA A;  1QGP A;  1I1G A;  2R3S A;  2XIG A;  2MD5 A;  2W25 A;  3SZP A;  3EDP A;  4HF2 A;  1QNT A;  4IRG A;  4OU0 A;  1XMA A;  3GFM A;  3U1D A;  1DPR A;  2COM A;  5K5O A;  5CYV A;  1EH7 A;  4ENK A;  3F3X A;  3FXQ A;  1GVJ A;  1G6N A;  1U6G A;  4GO1 A;  3EQL F;  3REO A;  1BIA A;  1BI0 A;  3V7S A;  2XKO A;  3M1E A;  2MA3 A;  4AIK A;  1U5T A;  3FMS A;  2E1N A;  1FLI A;  4I09 A;  2FNA A;  1K78 B;  4IJA A;  4BH9 A;  3CJN A;  1MDM B;  2K02 A;  1R22 A;  1OR7 A;  2HFH A;  1V3F A;  2DFI A;  2QEN A;  2ZCW A;  5DD4 A;  4FX0 A;  3Q5F A;  4U0Y A;  1FC3 A;  2BGC A;  1IN8 A;  2V79 A;  3ZN0 A;  4M72 A;  1C0W A;  4EJU A;  4L9V A;  1O57 A;  2CWE A;  4LMY A;  1XSX A;  2O3F A;  2IA2 A;  2RGV A;  2RDP A;  1SFE A;  5D6E A;  3BPV A;  5CJ9 A;  4GYG A;  1YW8 A;  2FQ3 A;  2X0L A;  2K4J A;  2VC1 A;  3LQQ A;  2GA1 A;  3F21 A;  3CO7 C;  2IPQ X;  1WQ2 A;  2VT2 A;  3RPQ A;  2Z3Y A;  1BC7 C;  3E6D A;  4A0Z A;  1L0O C;  3HRS A;  2K27 A;  1YTY A;  4G8X A;  4AWX B;  4G7O F;  3HOS A;  1SAX A;  2W24 A;  5BMZ A;  2RKH A;  4RGX A;  4M71 A;  2FRH A;  4HYE A; 
#chains in the Genus database with same CATH topology
 3RJP A;  2JA7 J;  3DU6 A;  4UUS B;  1TQP A;  3JRG A;  3OL3 A;  4MHG A;  4I7H A;  4PGG A;  3MCZ A;  1BR2 A;  1JKQ C;  1JXS A;  1UMQ A;  3D1N I;  1QZZ A;  4PK4 A;  4GCV A;  1YFH A;  5F6F A;  2E2I J;  2EZH A;  4KYW A;  5HS9 A;  5EG0 A;  5AIP A;  5ILV A;  3OY9 A;  2R4G A;  2WWY A;  1CGP A;  4MLO A;  1WJB A;  1AA7 A;  3CME I;  1WKM A;  2MD0 A;  1S72 I;  5J8F A;  3LL7 A;  3BJA A;  4OOI A;  2NS8 A;  2F5V A;  1W7P D;  4PGH A;  3W2A A;  1UEL B;  4NNJ A;  4HDU A;  1FP1 D;  4U88 A;  1K4S A;  4GFB A;  5M5W J;  4RBO A;  3CCS I;  1OCP A;  4C30 A;  1FBQ A;  1R5H A;  2DA2 A;  1T98 A;  5EJC A;  2P7C B;  3QOP A;  1JJ8 C;  5TIS C;  2NOJ B;  1TZL A;  1A6I A;  3KX2 A;  3L9F A;  3P9K A;  1Z0X A;  4LJZ F;  1IRG A;  2H6C A;  4OIQ F;  3F8B A;  2H1L A;  1I50 J;  2A6E F;  4RAY A;  1X1B A;  3VOE A;  5B1B H;  2I8D A;  4BDZ A;  4O3M A;  3H3V K;  2FOK A;  4U0V A;  3TOB A;  4CH7 A;  4IOA F;  3FKJ A;  3DKW A;  4UV9 A;  4RAF A;  3RDI A;  2F2E A;  3SHF A;  4XLA A;  1T95 A;  3CQZ J;  4N9H A;  5FFX A;  5BS6 A;  3OYI A;  1UHM A;  3CP8 A;  1GUU A;  5KHD A;  2LBF A;  2DO7 A;  1LE8 B;  2BVL A;  1ETY A;  1IDZ A;  1ZTR A;  2JPB A;  1TT0 A;  2FMY A;  4XLC A;  2ZNY A;  4A0X A;  2A61 A;  4L9N A;  1Y0N A;  2KZG A;  3SZG A;  2R7F A;  3HOU J;  2LC2 A;  3BCB A;  5CQE A;  3JR9 A;  2AXL A;  4G12 A;  4LIT A;  3CC7 I;  3OR1 C;  4M74 A;  3H0D A;  4X6A J;  3L2Q A;  3QU3 A;  1SVL A;  1EV7 A;  2ZXJ A;  3R4K A;  4WK8 F;  2E1C A;  4KIS A;  5K1Y A;  5IT9 Z;  2NAZ A;  5L3G A;  3KPH A;  4K2E A;  3EPZ A;  4NC8 A;  4D9J A;  1YLF A;  3ABU A;  1MJA A;  2G9W A;  2K4B A;  3AL0 B;  2IW5 A;  2PEX A;  2RRE A;  1LFB A;  1ETV A;  2CUE A;  2QSH X;  3ZMU A;  1I6X A;  1VQ5 I;  4E6K G;  3KYL A;  4MEY F;  3S14 J;  2AQE A;  2Y9Y A;  5KVR A;  1JKO C;  1BJZ A;  4DIQ A;  3DV8 A;  3K1M A;  1RR7 A;  3KZZ A;  2LYC A;  3G4S I;  3VFZ A;  1VZ0 A;  2V6E A;  3ABL H;  2JUC A;  3ASO H;  1G3Y A;  3I54 A;  2BY0 A;  4KN7 X;  4AU7 A;  2FSW A;  2D45 A;  3BZ6 A;  5CVI A;  4ZDL A;  3R60 A;  4G7Z F;  1Z7L A;  5HVQ C;  5L3B A;  3H92 A;  1ETK A;  2JMW A;  3ERM A;  2AXT C;  1ETO A;  1ZR4 A;  4CO8 A;  4DYC A;  2YR2 A;  3PO2 J;  2KDO A;  1IRF A;  3PL8 A;  1QBJ A;  4JX6 A;  3TO7 A;  2F5F A;  2CQK A;  3K0L A;  1JGG A;  1B9M A;  4G94 A;  9ANT A;  1J9I A;  3RYP A;  1XGS A;  1YS6 A;  2BHY A;  3QAH A;  1HCR A;  3PO3 J;  1DU0 A;  3RZD J;  3W2V A;  3OYK A;  1V4R A;  3RCO A;  4A3I J;  1ONV A;  2XVC A;  3CUO A;  3WU1 B;  1HXD A;  1Z77 A;  4HV5 A;  4AIJ A;  1VQM I;  3CCQ I;  4B44 A;  4ANJ A;  2B9S A;  1HKT A;  3L00 A;  1YI2 I;  3I4P A;  1ETX A;  2CRG A;  2EJR A;  2VLA A;  2HPI A;  1W5S A;  2Q2E A;  2ZKZ A;  2ZO4 A;  2K9M A;  1V5F A;  2CU7 A;  1ZRF A;  3HTS B;  2JSP A;  4BJT A;  1LNW A;  2VQG A;  3JAM K;  2Y0S A;  3AFH A;  1FIA A;  2HWV A;  3FDY A;  3ZN1 A;  4Y52 J;  1TWG J;  3ML6 A;  2UXN A;  4LG3 A;  3C2G A;  1HOM A;  1ZYR F;  2R7Q A;  2XAQ A;  4HX7 A;  5FLX Z;  5DYM A;  4MFD A;  4BQO A;  4PJL A;  4WXD A;  2P5K A;  4ZDO A;  3W2W A;  1JT0 A;  3QP6 A;  1I5Z A;  1T0F C;  2ZXW H;  2D1V A;  1J5Y A;  1FTZ A;  2IS6 A;  3K4B A;  4XLP F;  5CQG A;  5IYC J;  4BXX J;  5EGO B;  3IUO A;  1IW7 F;  1S6L A;  1FYM A;  4ZC3 A;  5F0H A;  3S3M A;  4BGD A;  1H88 C;  1VQN I;  2UZK A;  1F4K A;  3P7N A;  5DDG A;  1M1E B;  2X1C A;  1B4A A;  3LSI A;  2E35 A;  2ESN A;  1X1C A;  3ROU A;  2L5Q A;  4OMZ A;  3N4M A;  4XSX F;  1IN7 A;  2BYV E;  4PFO A;  3BZC A;  3H36 A;  4BAC A;  5FKO A;  3W6J B;  3ASN H;  3HEF A;  1Y39 A;  1FOY A;  3L2C A;  1I3Q J;  2Q8K A;  5HLH A;  1B59 A;  1PUF A;  4L5J A;  1X1P A;  3BR1 A;  3MVP A;  1D8K A;  3MMY B;  2WV0 A;  5F64 A;  5GTH C;  1DP7 P;  3VPR A;  3N05 A;  4C2U A;  1BOB A;  1DQU A;  3BR2 A;  3CC2 I;  1SAU A;  3DBH B;  1T2K A;  3H3Z A;  4J01 A;  3L2R A;  2Q0O A;  5A2Q K;  4IX7 A;  2ELJ A;  3H9G A;  1NK3 P;  1O7L A;  1FBU A;  3BP8 A;  4II2 A;  3J80 K;  3PQK A;  4XKV A;  5FKK A;  3KLO A;  4GRI A;  3I5U A;  2DI3 A;  5LGN A;  4NUB A;  1S9H A;  2ID6 A;  5JVG F;  4ESJ A;  1BIB A;  3QU6 A;  4BJ5 C;  2LSO A;  1XN7 A;  3GFI A;  4UV8 A;  4QIW N;  2DOE A;  3CUQ C;  3CC4 I;  1RKT A;  4G6T B;  1U78 A;  4XLN F;  4B43 A;  3CMA I;  3HOZ J;  2XDV A;  3CO6 C;  5LHI A;  1P4W A;  2W4S A;  3E6M A;  2RNG A;  5DUK A;  2QLZ A;  2HDC A;  1RET A;  4BU2 A;  3DFG A;  5H6Q A;  2DA6 A;  4ENJ A;  4M3F A;  4F93 B;  3F6V A;  2OCE A;  4OIP F;  1IUY A;  2CGP A;  3N97 A;  2OV7 A;  2VKH A;  5B3S H;  2ZJQ F;  2QQ8 A;  3CCY A;  2XF5 A;  2IGM A;  4Q48 A;  2DDB A;  2R5Y A;  2CW0 F;  4IRH A;  2Y9Z A;  2M7B A;  1DGW Y;  4DYQ A;  3K4J A;  2WTE A;  5LHH A;  4HF0 A;  2O7O A;  3IV5 A;  2EBI A;  4CCL A;  3KYC B;  1TNT A;  1MBK A;  3S8P A;  4Q5S F;  2PJR A;  4IHX A;  4CA0 A;  2UUZ A;  4NDL A;  4CCN A;  3HDD A;  3RKY A;  5F04 A;  2YSR A;  4LD5 A;  5AIQ A;  3CDH A;  4N9I A;  1EH8 A;  1W0T A;  1FOK A;  2E5N A;  1IAW A;  3G6E I;  3GWZ A;  3D5R C;  2WB1 A;  3KEY A;  2JRT A;  2OZ6 A;  3EYI A;  4AYB A;  3QPS A;  2F4O B;  4HNV A;  1P4A A;  5CLS A;  4HPQ A;  2EV5 A;  3IAS 2;  1WI3 A;  3UKG A;  2O8K A;  4I98 B;  5FJ8 J;  1BL0 A;  1W5C C;  1FIP A;  4UHT A;  4Y7N J;  3OIO A;  2E36 A;  2A07 F;  4PFP A;  2FF4 A;  1OCR H;  1GLN A;  4KT5 C;  2LP0 A;  2CYY A;  1KZH A;  1PP8 F;  3LQR A;  2O0Y A;  5J8C A;  1YJ9 I;  2XAH A;  2WAE A;  4IHT A;  2L9S A;  2KIQ A;  1RUO A;  2DK8 A;  2M4K A;  3ELK A;  1UZC A;  2LTP A;  3DP7 A;  2P6T A;  1NG6 A;  2OBP A;  2X1D A;  2X6O A;  3DLA A;  3QP5 A;  4RAZ A;  3RZO J;  3DKY A;  3KP4 A;  4N4O B;  4OMY A;  1H8A C;  5ERI A;  1MMG A;  2V7F A;  3A01 B;  1A36 A;  1I6H J;  2YPR A;  3EUA A;  1Z3X A;  3J81 K;  4MEX F;  3LA2 A;  5D5X B;  1CF7 B;  1D5Y A;  1VF9 A;  3DPT A;  5LGT A;  3S1R J;  4MTE A;  4ZTJ A;  1O3S A;  3C1D A;  2JA5 J;  2H8W A;  3BQZ A;  3F8F A;  1ZK8 A;  3HUG A;  3ZCO A;  5GAE J;  5K7H A;  5EYR A;  1LB2 A;  3VOD A;  3A4C A;  2R0Q C;  1VQ7 I;  1OLT A;  1Z3Y A;  2HQ5 A;  2MH2 A;  3MEX A;  5JFR A;  3K1N A;  4DZP A;  4LLG F;  5FD5 A;  2K40 A;  1S5L C;  1S8N A;  1GXP A;  3DEU A;  2WB1 N;  3V4G A;  3HJE A;  4AYB N;  5DCM A;  1KU2 A;  3HSR A;  5JI6 A;  4E7L A;  1F5T A;  1UCR A;  4I0A A;  4R1H A;  2M30 A;  2PFB A;  3F72 A;  3OSG A;  4Z6Y A;  4WWC A;  2ZME B;  2K7L A;  5E8I A;  3Q9S A;  4IQJ A;  4M73 A;  1E3P A;  1MBH A;  1QHH D;  4RGS A;  4MQV A;  3EYY A;  3OYF A;  3LSH A;  2HZT A;  2L54 A;  3GTP J;  4O5V A;  2ACJ A;  5CPR B;  1Y6I A;  4E4H A;  1TP4 A;  3RQ4 A;  5IPA A;  1MBF A;  5ED4 A;  3I58 A;  1LEA A;  2L01 A;  4HF1 A;  5IOY A;  2KFD A;  4IQ4 A;  4KN4 X;  4I99 C;  3JRI A;  1X4O A;  1XX5 A;  4MFE A;  1JGS A;  2HKO A;  4M6X A;  5EEA A;  4BL0 B;  2B63 J;  2HU9 A;  3ZGK A;  3OR2 C;  4YFK F;  2A69 F;  2LH9 A;  2HDW A;  1ON2 A;  1WJD A;  2KRF A;  1B8I B;  3AG1 H;  2DJN A;  1YIJ I;  2X51 A;  4JOM A;  3K4C A;  4BEH A;  5BQT A;  5J4V A;  1YG2 A;  2O61 A;  5HS8 A;  1OJL A;  2ZFW A;  1ZGA A;  4KUM A;  4DQ2 A;  3CUQ B;  1FJL A;  1Z1D A;  4G6Q A;  2M1B A;  3B6A A;  4ASN A;  2ZXH A;  1U5T B;  2LOO A;  2EWN A;  2GAU A;  2HYG D;  3CZ6 A;  2XSD C;  2DA5 A;  4U87 A;  1FMW A;  2CMP A;  3ZMZ A;  1K6Y A;  2GXA A;  5TJJ A;  4C3H J;  5EZH A;  1ZGW A;  2EB7 A;  1UHS A;  3HOV J;  1QVU A;  4LG0 A;  1HC8 A;  3KEQ A;  1XC5 A;  4HV6 A;  3BT9 A;  5KCM A;  1OQY A;  1UST A;  1JTX A;  3S32 A;  2AQF A;  2CUF A;  2M0C A;  4U0W A;  4XLF A;  4A3F J;  1U3E M;  1QZY A;  1FP2 A;  4W97 A;  3BZK A;  1LKX A;  1MKM A;  1R23 A;  3O2P E;  3MKZ A;  4FQG A;  1WH7 A;  3H35 A;  3OOP A;  1MNM C;  2L7Z A;  1O7F A;  3H5N A;  2GIV A;  1SVM A;  2FBH A;  1B9N A;  3SDB A;  4FE7 A;  2K3P A;  3OS1 A;  1IF1 A;  3LAP A;  2UXX A;  2KDZ A;  1SFX A;  5K7Z A;  1D1C A;  2PX9 A;  1ZRE A;  1NHA A;  3JRC A;  3GLL A;  3GO5 A;  5FLM J;  5FKM A;  3S16 J;  1BA5 A;  1W7P B;  3P9I A;  3ULQ B;  4I2O A;  3B02 A;  1FEX A;  3PUB A;  4UVC A;  1IXS B;  4BE1 A;  1KGS A;  3FK7 A;  5LRR A;  3HC7 A;  5E20 A;  2QYO A;  1JHH A;  3RI4 A;  3MFK A;  3GME A;  2EFW A;  1MBG A;  3D0S A;  1SFK A;  1KQ8 A;  1D5V A;  4HBL A;  4KJZ A;  1HST A;  2IRF G;  4WCG A;  4EV0 A;  2W48 A;  1B1B A;  2WAQ N;  3SEZ A;  3SXY A;  2ELK A;  3G1O A;  3KEO A;  3QPT A;  3EUH A;  1IZ1 A;  1B72 A;  3BJ6 A;  3O3K A;  4FCY A;  2OC6 A;  3C7J A;  3AL0 C;  1MW7 A;  1SD5 A;  1RPW A;  3CCE I;  2JUG A;  4X0G A;  3K2Z A;  1T56 A;  2L0K A;  2YX4 A;  1YIT I;  2VOP A;  3FBN B;  1KU9 A;  2E1O A;  2RVC A;  3CES A;  4G9Y A;  3C2H A;  1ZGJ A;  3BTJ A;  4WXC A;  1YRN A;  2IGO A;  2JQ7 A;  3FMQ A;  4A6E A;  3K70 D;  1ZKG A;  2W7N A;  3CMM A;  3CLO A;  5GPA A;  4BKX A;  4OIO F;  2E19 A;  5FRN A;  5B1A H;  5HLI A;  3KP6 A;  3LAJ A;  1HLV A;  3DPU A;  2OQG A;  3TGN A;  1ZH5 A;  2M87 A;  1VND A;  1ACI A;  1HSJ A;  3H9J A;  1XPX A;  4M6V A;  5F1R A;  2HXO A;  2HTS A;  3NEU A;  1I27 A;  2A05 A;  4R8H A;  2CQX A;  1BC8 C;  3VEP A;  4M3D A;  4JK1 X;  1TWH J;  1YW7 A;  3I3L A;  1G3W A;  2NRA C;  3JRF A;  1VQK I;  2IS4 A;  3IKT A;  1X3U A;  2VN2 A;  3ZOB A;  2M5W A;  3ZMV A;  4L9T A;  2JN6 A;  4ENN A;  4JBA A;  4PJ0 C;  4ZYD A;  2E5Z A;  2PBI A;  2NVY J;  2W1O A;  1J75 A;  1KQ0 A;  2OZU A;  4RB0 A;  4NQW A;  5BPD A;  1RC9 A;  2M8E A;  2EQR A;  2PLY A;  3E5U A;  2QVO A;  3M3Y J;  1RR8 C;  1AU7 A;  4D5C A;  4KIB A;  2DPU A;  4EAT A;  2HEO A;  2VXZ A;  5B5E C;  1AWC A;  3DPL C;  3TDZ C;  3M7G A;  2DMQ A;  4E7I A;  2Y31 A;  3CDI A;  3JRD A;  2CQ7 A;  2P5L C;  4ENM A;  1WH5 A;  5HDK A;  2JSC A;  5E8G A;  3E6B A;  3NRV A;  2CV1 A;  1P92 A;  2FA5 A;  3SEQ A;  4H0E A;  1MH4 A;  2LLK A;  5LBQ A;  1TTY A;  1FY7 A;  2K3F A;  2UV1 A;  2L2O A;  3JTG A;  3FXL A;  3MKL A;  4IEJ A;  4AID A;  3PJR A;  1ZG5 A;  2I10 A;  3IH2 A;  4RM2 A;  3L2V A;  1QA6 A;  2LKX A;  1TW3 A;  4EQQ A;  1KU7 A;  1UAA A;  3IWZ A;  2LBF B;  3HOX J;  2ELH A;  2XV4 S;  1WJE A;  1ZAR A;  4PSW A;  2F5E A;  2XPU A;  3GTL J;  3KZY A;  4DOZ A;  2QBY B;  5GP9 A;  3VYU B;  1IUF A;  3O6B B;  2BY1 A;  3PSF A;  1V54 H;  1R5I D;  2XF6 A;  2A3S A;  2L3D A;  4PCQ A;  4XMY A;  3FM5 A;  1R4N B;  4KIF A;  4EM0 B;  4U7B A;  4RA2 A;  4KIC A;  3ZQC A;  5DM6 F;  2STT A;  3ZPL A;  2OD5 A;  4XRM A;  1AHD P;  3LOC A;  2VC0 A;  4C3J J;  4ZYH A;  3R61 A;  4RS8 A;  5JLX A;  3TED A;  5H20 A;  3QPH A;  5LGU A;  4IHW A;  1WJC A;  5BNG A;  5E17 F;  3AAF A;  4BAY A;  1ERD A;  1D3Y A;  1RUN A;  5EF6 A;  5D8K B;  4HX8 A;  4NHJ A;  3RSN A;  1BJA A;  2CV2 A;  1DU6 A;  1W4M A;  3JAM Z;  3CJQ B;  2IT0 A;  2M45 A;  2LY9 A;  5J47 A;  4HQE A;  4P5O A;  1BI2 A;  4CYD A;  2ZC2 A;  3ZP5 A;  4H4K C;  2HTJ A;  3PFY A;  5GPC A;  2GZW A;  5IY5 H;  3S15 J;  3WGG A;  1IN4 A;  1UG2 A;  2OQR A;  3D5S C;  4XBF A;  2GXB A;  1G3S A;  2P81 A;  1Z7U A;  3CCJ I;  2BY2 A;  1R49 A;  1EF4 A;  1ETQ A;  3I64 A;  5HOO A;  1TBX A;  2RV8 A;  1S7E A;  4PSX A;  1RES A;  5L3C A;  3AG4 H;  2XKP A;  3IC7 A;  4EMS A;  1O3T A;  5CVU A;  2PI0 A;  3CJR B;  3TW7 A;  2IAI A;  2LY2 A;  4P55 A;  2X48 A;  2DBB A;  2FNP A;  1X1D A;  2G7U A;  4UB6 C;  3OYC A;  5E3O A;  2D5V A;  4A3M J;  3ZQL A;  3BOQ A;  2LKS A;  2YX7 A;  3ECH A;  3R6S A;  4ESB A;  5D8L B;  1R6R A;  3P9C A;  3E0J B;  3QPL A;  3JRH A;  2DOD A;  3BR3 A;  2DYS H;  2KIU A;  4AIH A;  3B6C A;  4I01 A;  3R0A A;  3CD6 I;  4F55 A;  5A2Q Z;  2P0W A;  1KA8 A;  2DW4 A;  2G7H A;  2YS9 A;  3OMY A;  2DMN A;  4JP0 A;  4C2T A;  2GXG A;  1Q1V A;  5KK1 A;  2CQN A;  5KAF C;  3ECO A;  3OYD A;  3V42 A;  3J7Y J;  2JRM A;  5D4S A;  2M7A A;  2ZXI A;  2DQR A;  1FWZ A;  1BW6 A;  4NC7 A;  4I02 A;  1LDK B;  1R7J A;  2XSJ C;  4DGW B;  2DDA A;  4I76 A;  3T1B A;  4W1U A;  1F1Z A;  3LSM A;  4PUS A;  4Q47 A;  3IP4 B;  4G7H F;  4IKF A;  4UUV A;  2CQQ A;  4N4N B;  4HAM A;  3LST A;  5ICF A;  2DXI A;  4MGR A;  2FML A;  4HZF A;  4FET A;  2YU3 A;  3G71 I;  4JQF A;  3WGH A;  1GVD A;  1XD7 A;  1BBY A;  3FX3 A;  1KU3 A;  5J1U A;  2AS5 F;  1PUF B;  2HYF A;  3K1P A;  3WU0 A;  1XSD A;  4UUT A;  2FUG 2;  2CUZ A;  3X2Q H;  1QQI A;  3KFW X;  2R92 J;  2EV6 A;  3SFZ A;  1MJB A;  2H8R A;  1K61 A;  3K69 A;  4BQA A;  1BM9 A;  5GAH J;  4XM3 A;  3GTQ J;  1O3R A;  3I55 I;  2FOW A;  5B66 C;  4KFC A;  1LDJ A;  5DEQ A;  3B73 A;  3HKZ A;  3BTL A;  3F22 A;  1X1A A;  1HW5 A;  1Z67 A;  1VQ4 I;  5L3E A;  1FX7 A;  3S93 A;  1IGN A;  4LB5 A;  2R7X A;  1ENH A;  3KP7 A;  1K7A A;  1LFU P;  1MNE A;  3A2K A;  3V8L A;  1Y1W J;  2OJE D;  4S04 A;  4LB6 B;  2L4A A;  5D5U B;  3E97 A;  3K9T A;  2ZME C;  3L7W A;  3MD2 A;  2NS0 A;  3ONQ A;  2FEZ A;  5IYD J;  1KYZ A;  2XHK A;  1UB9 A;  4Y15 A;  2TDX A;  4A3D J;  4IVN A;  3WTV C;  3OYA A;  3FMR A;  1JE8 A;  4BUP A;  3FF5 A;  4OWR B;  3ZQQ A;  1REP C;  2K5C A;  1MBJ A;  3K70 C;  1PYV A;  1NK2 P;  1VQL I;  3LSK A;  3ZQF A;  1Y1V J;  1B6A A;  4ZYG A;  1R36 A;  2Y0S N;  4BY7 J;  5J1R A;  2MW8 A;  1DGR M;  3CCV I;  2J5P A;  3J7Z I;  2PJP A;  2CS3 A;  2LKP A;  2XAS A;  2XB5 A;  3OS2 A;  2NVX J;  1N78 A;  2A5W A;  1FTT A;  3W3C A;  1IV6 A;  4AUX A;  1FNN A;  3TBI A;  4CSW A;  5LFA A;  2VBZ A;  2BXZ A;  5C44 J;  2VKV A;  3T8R A;  1XGO A;  4UVB A;  4BXU A;  5J6X A;  1R4M B;  1L3L A;  4EGY A;  3G3Z A;  4CCK A;  2WY8 Q;  5JLW A;  2PMZ A;  2OU2 A;  2R5Z A;  5LLQ A;  2PJR B;  3KIO A;  3WTY C;  2ZJ2 A;  2O9L A;  4HRI A;  1BW5 A;  4IHS A;  2WA0 A;  2CH0 A;  1U5T C;  2L4M A;  3F8C A;  2L7F P;  2NXN B;  2NNY A;  5EGO A;  4HLX A;  1EKE A;  4YIF A;  1MH3 A;  4ZZD A;  1XCB A;  1TWC J;  3H5R A;  1OMI A;  1U8R A;  2VB6 A;  5GAD J;  1V55 H;  3FIS A;  3J7A Y;  2XGE A;  5M5X J;  2E7W A;  2GQQ A;  1QRY A;  1OR7 C;  4XID A;  3I53 A;  2ADU A;  1LQ1 A;  3HZJ A;  2V1D A;  2HOE A;  4HLY A;  5CVJ A;  2VQL A;  5M3M J;  2LMD A;  3I0T A;  3QYE A;  5DTD A;  5FRO A;  3PNT A;  3VYT B;  3H0G J;  2KIM A;  3PQJ A;  2D2W A;  5F0C A;  4XKW A;  3U9G A;  5FO5 A;  4HOB A;  3E5Q A;  4IL6 C;  3GTK J;  3FBI B;  5M3F J;  2Y48 A;  4LFU A;  1XGN A;  1IXC A;  2ETH A;  3GF2 A;  2R7V A;  4D0P A;  2DT6 A;  4DNC A;  3V8K A;  1JI8 A;  3M8J A;  2P7V B;  4M9Z A;  2L9N A;  5IYB J;  3NWS A;  1XMK A;  3K4K A;  5TRD A;  3VYS B;  1HDD C;  1R1U A;  4YRV A;  3IRQ A;  3BTI A;  3ESW B;  2PMZ N;  2ECC A;  3SFI A;  1S7A A;  3GYH X;  5KAI C;  5EEG A;  4R79 A;  2FBI A;  4OIR F;  4IRI A;  2IA0 A;  2QQA A;  1IDY A;  2LR8 A;  5ILU A;  5M5Y J;  1O4X A;  4HNU A;  3E7L A;  4GXO A;  2ZJP F;  4A3J J;  1R00 A;  4YFN F;  1T39 A;  4UY8 I;  2VKE A;  4BNC A;  4MQ9 F;  2MGQ A;  3QOE A;  6PAX A;  1QZE A;  2EA2 A;  2V4J C;  4M3B A;  2CO5 A;  1ORK A;  5LRS A;  4JYK A;  4TV7 A;  2FQ4 A;  2VJI A;  4NC6 A;  4V2F A;  3K6G A;  2EPF A;  2KRC A;  4EM1 A;  5D5W B;  4BHC A;  2MSY A;  3KE2 A;  1ZQ3 P;  2LVS A;  3JTH A;  2X85 A;  2ISZ A;  2BW3 B;  4P96 A;  3RPU D;  3GCM A;  3HXL A;  5E3M A;  4BQQ A;  4Y4R A;  2HGC A;  3LSP A;  1E0E A;  1UJ8 A;  2V6C A;  3OYL A;  1Z6R A;  3K2A A;  1S29 A;  2F6C A;  3F8N A;  5DM7 F;  3AKZ A;  3G73 A;  2STW A;  4CDG A;  5D6F A;  1Y56 A;  3L2U A;  1KQ9 A;  4LOC A;  3CF2 A;  3HSF A;  2EK5 A;  3MZH A;  3TQN A;  1T6S A;  3FZV A;  2VON A;  1P9Q C;  3I4M J;  2IEK A;  2P8T A;  1FZP B;  2Z16 A;  5DV5 A;  3KLN A;  1U2W A;  3SZT A;  3TDU C;  4CYC B;  4ON0 A;  2HYJ A;  1PVE A;  3DU5 A;  2QSG X;  1X3W B;  5IT3 A;  3O8H A;  4YFX F;  4B47 A;  4BEH B;  3WTW C;  4LGW A;  3QRF F;  2EA4 A;  2NS7 A;  3SJM A;  4LK0 F;  3CJT B;  1OCT C;  4F7Z A;  4CCO A;  2BZT A;  3BQY A;  3DBL B;  4XK4 A;  1ZAO A;  4L18 B;  1QO0 D;  2JVG A;  1OPC A;  4HW0 A;  1XDU A;  2MC4 A;  1U0J A;  1SC7 A;  3V8J A;  2Z99 A;  1T38 A;  2KIS A;  5FLV A;  3GTO J;  1QHG A;  1BN5 A;  2K9L A;  1D0X A;  2WY7 Q;  3GZ5 A;  2QZ8 A;  1BOA A;  4LG0 B;  3VDX A;  1MSE C;  2DOA A;  3SDG A;  3KP3 A;  3GX4 X;  2H1K A;  4XNF A;  4L5E A;  4EJW A;  2Y30 A;  3FKI J;  1O3Q A;  1XB4 A;  2VBW A;  2PQ8 A;  3GFL A;  1JJ6 C;  2X6Y A;  3GXO A;  4LIU A;  2DTR A;  2D1H A;  4UNO A;  5FB2 A;  3A01 A;  2WC2 A;  1YYV A;  1FSE A;  3ISP A;  1W0U A;  1AKH A;  2EIM H;  2KMU A;  4XRS A;  2FX0 A;  2HOS A;  1LJ9 A;  2HQN A;  1T0F A;  5LEJ A;  2H27 A;  5C4J J;  3PM1 A;  3Q9V A;  3MQ0 A;  5K5R A;  4P9U A;  3HSE A;  1T08 B;  2GIZ A;  1MD0 A;  1YIO A;  3BG5 A;  2NYX A;  4G6D A;  4P9F A;  3K4N A;  3K4M A;  4L5I A;  4LLL A;  3HBL A;  2IVM A;  4XIC A;  2Y69 H;  2V1X A;  4A93 J;  1F43 A;  1QVT A;  3PUF A;  3OOU A;  1R71 A;  1K79 A;  2VXD A;  5E18 F;  3VSK A;  3PNV A;  1BR1 A;  5EZG A;  4A0Y A;  2L02 A;  3DKX A;  2CSO A;  4XKC A;  1BI1 A;  4C3I J;  2XAF A;  1H9T A;  2LDU A;  1WGX A;  2VL8 A;  3TO6 A;  1P6R A;  2M3A A;  1PJR A;  3GLX A;  3F8M A;  2AO9 A;  3FHZ A;  1B72 B;  4B3X A;  3BR0 A;  3LNQ A;  2DJI A;  2HI3 A;  3ZMD A;  3WTT C;  3WG9 A;  1KON A;  1WCM J;  3RYR A;  1VQ9 I;  2OA4 A;  4YG2 F;  3GEZ A;  3I59 A;  5DUI A;  3IWF A;  1OCO H;  4B8X A;  5LD2 C;  1F9N A;  2QSF X;  3V7C A;  4A3B J;  1W36 D;  1OYI A;  5KNL A;  2H94 A;  1MMD A;  1V5E A;  3HHH A;  2NVU B;  4M9S A;  4F3Q A;  1YW9 A;  5D5V B;  3TL4 X;  2P6S A;  5FKN A;  1YRN B;  5ICG A;  1ULY A;  1PP7 U;  5K7F A;  2CFX A;  3D5L A;  1NH3 A;  1J2X A;  3Q0W A;  4S05 A;  4PDK A;  4E7S A;  2MH9 A;  2O6G E;  4Y33 A;  3CUQ A;  1YJW I;  3KET A;  2XAJ A;  2HZD A;  3LA3 A;  3I9V 2;  3V7R A;  3WG7 H;  1SAN A;  1GHC A;  1A5J A;  1UG0 A;  3Q0U A;  3WTX C;  2GLO A;  2RNJ A;  4YIR X;  3ABK H;  2M34 A;  2CW8 A;  1G59 A;  3GTJ J;  2EFN A;  4BHB A;  1GXQ A;  2J5O A;  3DWL E;  2R7R A;  3LSJ A;  5IP6 A;  5FKL A;  4LIV A;  5HDG A;  1GV5 A;  2E1M B;  3GBG A;  3OYH A;  1Y8Q B;  1H9G A;  2R7W A;  3RKW A;  4NQW B;  1RIO H;  2IJL A;  1XCV A;  2KZV A;  3MZY A;  3Q3S A;  3OYN A;  1WZ2 A;  2IA1 A;  1LEB A;  4IXA A;  3DQV C;  1FBS A;  4F92 B;  1D8J A;  4GDF A;  4LLN A;  2VQC A;  1EH6 A;  4KMF A;  2VT3 A;  2YU9 J;  5FFZ A;  4BYY A;  4RAG A;  3VSL A;  1SMY F;  1LPQ A;  3WE2 A;  2H6B A;  1I1S A;  4XRF A;  2XRO A;  3E6C C;  4L0Z B;  2E71 A;  1U9N A;  3GTG J;  2M2E A;  1STZ A;  1NTC A;  3OWT A;  1IJW C;  2X6X A;  1ZRD A;  4FAS D;  2EFP A;  2VI6 A;  2ICW G;  1W7P A;  2DLL A;  3TO9 A;  4WX9 A;  1K78 A;  3OYB A;  1E2X A;  2W82 A;  1X19 A;  4LK1 F;  5EG0 B;  3HL2 A;  1MDM A;  2EIK H;  2HQR A;  4Q4Z F;  5ICE A;  3CCM I;  2R7S A;  4MNU A;  2QKM B;  2VOD A;  4A3E J;  3WHC A;  3OSF A;  2KJC A;  1XDS A;  5H6R A;  1EA3 A;  2P5V A;  3VB2 A;  4AVP A;  3GZN B;  1HKS A;  2O03 A;  4HNT A;  3S3N A;  5FGM A;  3CTA A;  4ZYA A;  4CUG A;  3HOY J;  4HDV A;  4XSZ F;  3BCA A;  3C3W A;  1G2H A;  2FE3 A;  5JHF A;  1N25 A;  1TQM A;  2VIX A;  4DZJ A;  5TGT A;  3M9A A;  5FD6 A;  2X6W A;  1R5G A;  2OTJ I;  1MJ9 A;  1IRZ A;  1X4P A;  1ON1 A;  4Y17 A;  3C2B A;  4D7N A;  4ZZL A;  5HLG A;  2R7O A;  2DA3 A;  1R1V A;  3U2R A;  5E3N A;  4DW6 A;  5GAG J;  2ZFU A;  4FE4 A;  4OIN F;  3S3O A;  2HPM A;  5E1W A;  3HRU A;  2EFO A;  1DDN A;  4ZYE A;  4QSH A;  3ZMS A;  4B3A A;  2M9H A;  5HLT A;  1QPI A;  5JR3 A;  3OYG A;  2GBY A;  3MWM A;  1QPM A;  1S3J A;  2FJ1 A;  4S0H B;  4J19 A;  1X2M A;  3ZQI A;  3COA C;  5H2F C;  3ZQH A;  4EGZ A;  4KMU X;  4DYR A;  2MLG A;  4XON A;  2XF7 A;  1E3O C;  2EFQ A;  3F9K A;  3ZRG A;  2LRD A;  3O8G A;  2OPT A;  2K9Q A;  2A68 F;  3TOA A;  1G8X A;  5K5Q A;  2BBY A;  1R1T A;  1LFP A;  2Z9O A;  1A31 A;  4RGR A;  4QPO A;  1YS7 A;  1EJ9 A;  1USS A;  4XKB A;  3C18 A;  3HPG A;  4HA8 A;  3KCC A;  1FT9 A;  4RB2 C;  1P2F A;  2DOF A;  2V9V A;  3DXJ F;  5F0F A;  4RLQ A;  3JSP A;  2HR3 A;  2E2H J;  3QYB A;  1IC8 A;  1TT5 B;  2ECB A;  2DFF A;  4BXF A;  4IZZ A;  3DLL F;  3DEE A;  4UB8 C;  1BR4 A;  4JX5 A;  3WE3 A;  4ZTF A;  2V1N A;  4L9J A;  4UUS A;  3QYF A;  3CLQ A;  2B7E A;  1ZG3 A;  2HVR A;  1G4D A;  2VUM J;  1BI3 A;  3FXJ A;  4EJT A;  3R0J A;  2O5R A;  4E7Z A;  2RN7 A;  1H0M A;  4AVZ A;  2R7D A;  4O6J A;  4B48 A;  4CCJ A;  4KDP A;  1AOY A;  2DT5 A;  2QF7 A;  3HOT A;  3M07 A;  4QWQ A;  1ZHF A;  3OYE A;  2W00 A;  1FPQ A;  4PJM A;  2BY3 A;  3BRO A;  2VOO A;  4V19 K;  1MMS A;  3BG7 A;  3K4L A;  3TP3 A;  3UNG C;  3M4O J;  3F23 A;  2CFO A;  2XB0 X;  2K86 A;  3M8F A;  2AHQ A;  3CCR I;  4KIT B;  4DBR A;  1D0Y A;  4NBQ A;  2R7Z J;  2ME6 A;  4FX4 A;  3BY6 A;  3BLY A;  5IP9 J;  4UVA A;  3S1M J;  5C3E J;  1YX5 A;  2QBY A;  2HOT A;  4IHY A;  2W84 A;  4RGU A;  1XMX A;  1D1B A;  1ZLK A;  3KP5 A;  4EJV A;  1YO5 C;  5LHG A;  1TNS A;  1LDD A;  3NWT A;  4X1E A;  5DD8 A;  3WTU C;  4KA4 A;  3BJO A;  3ZR8 X;  4IPA A;  2E7X A;  3I4N J;  1K83 J;  3DBR B;  2K9S A;  1HW1 A;  2Q2E B;  3A0B C;  3HRM A;  2KL4 A;  3BWG A;  3QQA A;  2A5Y B;  1E17 A;  1J59 A;  2XGX A;  4Y13 A;  3S2H J;  4PJN A;  2E60 A;  5J40 A;  4UXN A;  5E79 C;  5F1J A;  3HGG A;  1PDN C;  3TKY A;  3IRR A;  1LE8 A;  2HVQ A;  4HST A;  5E3L A;  3HYI A;  2VPL A;  2F5C A;  2W57 A;  2DPD A;  1XSV A;  2MLK A;  4EM2 A;  2IGK A;  2XAG A;  4B1R A;  3J80 Z;  4A3K J;  3M1C A;  5E1X A;  1JKR C;  1Z21 A;  4I0B A;  3HOW J;  1MND A;  1SD6 A;  4A3L J;  3A1Y A;  4M3E A;  4XOR A;  3TP0 A;  5IOZ A;  2MYS A;  2DMU A;  1FOX A;  3LA7 A;  2ZBK A;  3E3V A;  5L3D A;  4D5F A;  1Z6T A;  5BPI A;  4E70 A;  4DBQ A;  2QWW A;  1YE9 A;  2JZY A;  2ZB9 A;  3FWE A;  4FHT A;  1SFU A;  1ODD A;  3LWF A;  2MC3 A;  2XPV A;  5CVV A;  3PIP F;  2F48 A;  4FT8 A;  1MMN A;  3PIO F;  1WSU A;  2XUB A;  4E7J A;  5EEH A;  3BR6 A;  4L0Y B;  2A6H F;  2JK3 A;  2L7M P;  2JA8 J;  5CVR A;  4QPQ A;  1W36 C;  3PSI A;  1FSH A;  2JJ7 A;  2CW7 A;  3S17 J;  3HG9 A;  2XRN A;  4BQN A;  2M4G A;  1MGT A;  3ZMT A;  2E2J J;  3BPX A;  1Q1H A;  4F91 B;  3CCU I;  1A04 A;  2M8G X;  1FYL A;  2PG4 A;  2WAD A;  3FXU A;  4KIG A;  4M6Y A;  2FU4 A;  4HSR A;  2C6Y A;  2DU9 A;  2TCT A;  1VQ8 I;  3WHB A;  1HQC A;  2A6T A;  2HS5 A;  2V9P A;  1V5G A;  1WJF A;  3NAU A;  3P5J A;  3DF8 A;  1I39 A;  2BHZ A;  4WXH A;  2EH3 A;  3AG3 H;  3MKW B;  5HNF A;  4RB1 A;  5BOX A;  1K6O A;  5HOD A;  1XGM A;  2QQB A;  1IRX A;  2R5Z B;  1T33 A;  3MAJ A;  4CZC A;  4BE0 A;  2DQL A;  1GDT A;  5IT9 K;  2KKO A;  4FIS A;  3W6V A;  2EZL A;  5D4R A;  5HNH A;  1P7J A;  4A3G J;  2DA7 A;  1WHU A;  3F6O A;  1KYW A;  4Z2Y A;  1WVR A;  2HKX A;  2DAO A;  1IV8 A;  1RKW A;  1OYY A;  1HKQ A;  2HOA A;  2JT1 A;  2Y75 A;  4A5N A;  2R7U A;  1VI0 A;  2E34 A;  2NVQ J;  3J7A O;  2GM4 A;  2MG4 A;  5JVT A;  3MN2 A;  2V9K A;  1Z91 A;  3QWL A;  3JRE A;  2LG4 A;  2R5Y B;  1TLH B;  1IN5 A;  1HW2 A;  2VBX A;  5GTI C;  1J7K A;  2XAU A;  3CDL A;  1TQI A;  2PMH A;  4HQM A;  2KIF A;  3OL4 A;  3GZ6 A;  4XQF A;  3HKZ N;  2Z1D A;  1Y0U A;  3I71 A;  3KYD B;  5DS9 A;  1JHF A;  1VQ6 I;  1K4T A;  2JVH A;  3T8T A;  5HDN A;  3J81 Z;  2R93 J;  1LVA A;  2O8X A;  2VBY A;  1J0R A;  4HG2 A;  3DTE A;  3IL2 A;  4HEA 2;  4U7D A;  1XS9 A;  3HM5 A;  2EZK A;  1R9T J;  5CKT A;  2K85 A;  1SMT A;  4EEF G;  2IS2 A;  3W6K B;  3ZQ7 A;  1R58 A;  2VPR A;  4HX4 A;  4MO7 A;  2GWR A;  3E5X A;  3Q0V A;  1E3H A;  3HRT A;  4C2M J;  2ZSI B;  3GTM J;  2ID3 A;  2L9V A;  3H5A A;  4XLE A;  3RPU A;  2OTL I;  3HPH A;  5LEK A;  2OCC H;  2KJB A;  3ZXS A;  1GV2 A;  3MZ8 A;  1YOV B;  3S2D J;  3S1Q J;  2NNN A;  3L09 A;  2EIN H;  3CF5 F;  1DP3 A;  3EUH C;  2RC4 A;  1RI7 A;  3JRA A;  3VYR B;  2VE9 A;  2BE5 F;  3LFK A;  3BTC A;  1Z05 A;  5AON A;  5L3F A;  2QM3 A;  3RKX A;  2Z33 A;  3IH3 A;  5FLX K;  3H3U A;  2IBD A;  3FK6 A;  4XLH A;  1UHW A;  2ISY A;  1U9O A;  1JT6 A;  4XOP A;  4CZZ A;  1RRJ A;  1XG1 A;  2BXY A;  1FYK A;  3HTU A;  4KT6 A;  4BDY A;  3NAR A;  3RIR A;  3T5X A;  3ABT A;  3HHG A;  4ZH4 F;  3RTR A;  5J1Y A;  2CUJ A;  4YEL A;  1A6Q A;  3KP2 A;  1RNL A;  3HUG B;  4XRS G;  3RKQ A;  1XTA A;  3PFI A;  2DFE A;  2NOG A;  1IN6 A;  2DMP A;  4IO9 F;  2Y2Z A;  1IXR C;  4HYE A;  4CGZ A;  2JTV A;  4XL9 A;  2CG4 A;  1NG7 A;  2F5D A;  1P7I A;  4A6D A;  4MTD A;  2ZSH B;  4QLC U;  5DCM B;  4OAZ A;  4IHV A;  5ILS A;  2RQQ A;  4EJO A;  2KT0 A;  4QTR A;  1D0Z A;  1VTN C;  2LNB A;  2VE8 A;  2MBF A;  3GUD A;  1SD4 A;  1TL8 A;  1TWA J;  4BS9 A;  2FBK A;  2E1M C;  3FM3 A;  5HS7 A;  2QGU A;  3K7A J;  2UWM A;  3WTS C;  3DTK A;  2LRE A;  4YEJ A;  4ETS A;  1MZB A;  2HQA A;  1ZN2 A;  4Y3O A;  3OV8 A;  1WWX A;  2HVS A;  1D1A A;  1TW2 A;  2VQH A;  4GYI A;  1CQT A;  4AC0 A;  4RDU A;  4DJA A;  2EIJ H;  2QEX I;  1ETW A;  2Q1Z B;  4CHU A;  1SD7 A;  3DEW A;  3IHU A;  1Z9C A;  2XGC A;  3JW4 A;  4NB5 A;  1QU3 A;  4XR6 A;  3HIF A;  2H09 A;  1PUE E;  3GW2 A;  2M0M A;  3SQN A;  2NVT J;  3FXK A;  3UR3 C;  1JUM A;  2B0L A;  2IGN A;  3JSO A;  2PN6 A;  1H89 C;  4AM3 A;  3ERE D;  2ZNZ A;  1P4X A;  3LSR A;  4BY1 J;  3AG2 H;  1TC3 C;  1VQO I;  3IKV A;  4ZDP A;  4BBR J;  1HDP A;  2VJ4 A;  1AKH B;  1ITY A;  1LUJ B;  4RM3 A;  3OIQ A;  1ZRC A;  3CMY A;  2GOM A;  4IF4 A;  2F4I A;  2YUS A;  1OYW A;  4N0B A;  4WF2 A;  3EET A;  1JUS A;  3WTZ A;  5DCF A;  1N77 A;  1ZEL A;  1YJN I;  4AD9 A;  3BG6 A;  2OF7 A;  2DN0 A;  2WAF A;  3QOD A;  1WFX A;  2KLO A;  3S2W A;  2KRH A;  1HF0 A;  2ESH A;  2XGD A;  3CP2 A;  1WRJ A;  3WU2 C;  2VKD A;  3F0C A;  4MIM A;  4CIC A;  4IOC F;  2DK5 A;  2RQP A;  3RQI A;  4A12 A;  2EV0 A;  1GT0 C;  5J3L A;  2EIL H;  2BW3 A;  2QUF A;  3OYM A;  2QQ9 A;  2LF7 A;  2V1U A;  5JHU A;  2TRT A;  4RMN A;  3I56 I;  4CXF A;  2ME0 A;  2LF8 A;  2BV6 A;  1SEU A;  3FXR A;  2W85 A;  1G3T A;  2X4H A;  4II3 A;  1APL C;  2IS1 A;  2HDD A;  2JPC A;  2X9D A;  3FIW A;  2MAB A;  1HBX G;  4CCM A;  2HNH A;  4BHP A;  2LK2 A;  4RB3 C;  1WJA A;  2MFZ A;  1OFC X;  4A69 C;  3I59 B;  1CF7 A;  1ZLJ A;  4P1W A;  4B09 A;  3M8E A;  3E1S A;  3VWB A;  2PMU A;  4GGG A;  5ICC A;  1W5T A;  2JA6 J;  1IG7 A;  2GA2 A;  3BR5 A;  2Y0M A;  3GFJ A;  3WOD F;  4EVI A;  2P4W A;  2LFB A;  2BEO A;  1ZR2 A;  2IP2 A;  1S7O A;  3ZQG A;  4CYC A;  2DT7 B;  4KNY A;  3OS0 A;  2BVM A;  4D7M A;  2FXA A;  3T0Y A;  1ZG1 A;  2WBM A;  3FXM A;  3NQO A;  1YQA A;  1DUX C;  2Z5U A;  3A02 A;  3FXO A;  4M9X A;  3A0H C;  2COB A;  4PZJ A;  3U1K A;  4A5M A;  1VQP I;  3H1C A;  1UFM A;  4YII A;  1F36 A;  3H9Q A;  2ZME A;  4ESF A;  1N75 A;  1DPU A;  4RLF A;  1OKR A;  1MIJ A;  5E1Z B;  3WGI A;  3LMM A;  1RZ4 A;  2QA4 I;  4A2U A;  3BDD A;  2OAZ A;  1WJ5 A;  3GVA A;  1QGP A;  2HXI A;  4ZJZ A;  1VFC A;  1I1G A;  1YHQ I;  2R3S A;  1MBE A;  3U21 A;  4F52 A;  4PJJ A;  4J00 A;  2JA2 A;  2XIG A;  2WAQ A;  2MD5 A;  2W25 A;  2XRL A;  2XC7 A;  4BBS J;  1OCZ H;  3FHN A;  4XN0 A;  3SZP A;  2ZJR F;  3EDP A;  4HF2 A;  1QNT A;  4BE2 A;  1JUP A;  3LSG A;  4IRG A;  1SFO J;  3S1N J;  4OU0 A;  2L9R A;  1XMA A;  3GFM A;  3U1D A;  3TW6 A;  1DPR A;  2COM A;  2DMT A;  5K5O A;  1SVO A;  2V26 A;  5CYV A;  2VJJ A;  3JCU C;  2JWT A;  1B8I A;  3KZI C;  1EH7 A;  2DYR H;  4ENK A;  3F3X A;  3FXQ A;  3G1M A;  1MMA A;  1GVJ A;  1G6N A;  1Y8R B;  1U6G A;  4GO1 A;  1OCC H;  3EQL F;  3REO A;  3EUK L;  4E7H A;  1BIA A;  1BI0 A;  3V7S A;  2XKO A;  3M1E A;  1MSF C;  3OIP A;  2MA3 A;  4AIK A;  3L2W A;  4I6Z A;  1U5T A;  3FMS A;  3CCL I;  2E1N A;  1FLI A;  3G2B A;  4I09 A;  1WPK A;  2FNA A;  2R7T A;  1K78 B;  2LD5 A;  1U8B A;  4IJA A;  2DA4 A;  4BH9 A;  4ITV A;  2G0E A;  3CJN A;  4OAY A;  1MDM B;  1POG A;  2K02 A;  1R22 A;  2BOL A;  5FRM A;  3DCF A;  4JX4 A;  1OR7 A;  2DFH A;  2HFH A;  1V3F A;  2DFI A;  2FD5 A;  5F08 A;  2QEN A;  2ZCW A;  5DD4 A;  4A3C J;  4XOT A;  3SYT A;  4FX0 A;  3Q5F A;  3K10 A;  4U0Y A;  1FC3 A;  2BGC A;  3BG3 A;  3LFU A;  3PNY A;  1IN8 A;  5IP7 J;  2V79 A;  3ZN0 A;  4M72 A;  4D1Q A;  2IXS A;  1C0W A;  4V2G A;  4EJU A;  4BJ6 C;  4L9V A;  3L1P A;  2EZI A;  5F27 A;  2QCO A;  1T8I A;  1O57 A;  2CWE A;  4LMY A;  2N8G A;  1XSX A;  2O3F A;  4ABZ A;  2XPW A;  1LVK A;  2IA2 A;  2RGV A;  2RDP A;  5EDN A;  4E7K A;  1FMV A;  1SFE A;  5D6E A;  1FOW A;  3IH4 A;  3BPV A;  3IAM 2;  3TMO A;  1X58 A;  1OIS A;  5CJ9 A;  3JRB A;  2GOX B;  1IO2 A;  2LY1 A;  4GYG A;  4FTH A;  2CJJ A;  3A03 A;  2DA1 A;  2Z2S B;  2X0L A;  1YW8 A;  2FQ3 A;  2K4J A;  3MKY B;  1A35 A;  2VC1 A;  2VJ5 A;  5J4Y A;  3LQQ A;  2GA1 A;  3F21 A;  3G1L A;  1HA8 A;  3CO7 C;  2IPQ X;  2K9N A;  2WV1 A;  1JKP C;  1WQ2 A;  2DTZ A;  2KQR A;  2VT2 A;  2QKL B;  3RPQ A;  3ABM H;  3OYJ A;  3BC8 A;  2Z3Y A;  1BC7 C;  3E6D A;  4A0Z A;  1L0O C;  3HGY A;  1X3Z B;  3HRS A;  2K27 A;  2DCE A;  4XN3 A;  2I5U A;  3HB9 A;  4C9Y A;  5C4X J;  1YTY A;  4G8X A;  2X1E A;  2OUM A;  3DTI A;  1TWF J;  4M3G A;  4AWX B;  1W1W E;  2KPM A;  3BG9 A;  4G7O F;  1X2N A;  1YX3 A;  4B4C A;  2KHM A;  3HOS A;  2CV0 A;  1J09 A;  1JTY A;  2VAS A;  1I3A A;  2L7K A;  1SAX A;  2W24 A;  2RAE A;  5BMZ A;  2F4M B;  2RKH A;  4RGX A;  4M71 A;  2KP6 A;  2FRH A;  1WI9 A; 
#chains in the Genus database with same CATH homology
 3RJP A;  1TQP A;  4MHG A;  4I7H A;  4PGG A;  3MCZ A;  1JXS A;  1QZZ A;  4GCV A;  1YFH A;  5F6F A;  4KYW A;  5HS9 A;  5AIP A;  5ILV A;  2WWY A;  1CGP A;  1WKM A;  5J8F A;  3BJA A;  4OOI A;  1W7P D;  4PGH A;  4HDU A;  1FP1 D;  4U88 A;  1FBQ A;  1R5H A;  1T98 A;  2P7C B;  3QOP A;  3L9F A;  3P9K A;  4LJZ F;  1IRG A;  2H6C A;  4OIQ F;  3F8B A;  2A6E F;  4RAY A;  3VOE A;  4O3M A;  2FOK A;  4U0V A;  3TOB A;  3DKW A;  4UV9 A;  3RDI A;  2F2E A;  3SHF A;  4N9H A;  5BS6 A;  5FFX A;  1UHM A;  2DO7 A;  2JPB A;  2FMY A;  2ZNY A;  4A0X A;  2A61 A;  4L9N A;  2R7F A;  2AXL A;  4M74 A;  3QU3 A;  1EV7 A;  2ZXJ A;  3R4K A;  4WK8 F;  2E1C A;  5K1Y A;  5IT9 Z;  2NAZ A;  5L3G A;  4K2E A;  1YLF A;  3ABU A;  1MJA A;  2G9W A;  2K4B A;  2IW5 A;  2PEX A;  3ZMU A;  1I6X A;  4MEY F;  5KVR A;  3DV8 A;  3K1M A;  3KZZ A;  3VFZ A;  1G3Y A;  3I54 A;  4KN7 X;  2FSW A;  2D45 A;  3BZ6 A;  5CVI A;  3R60 A;  4G7Z F;  5HVQ C;  5L3B A;  3H92 A;  4CO8 A;  2YR2 A;  1IRF A;  1QBJ A;  3TO7 A;  2F5F A;  2CQK A;  3K0L A;  1B9M A;  4G94 A;  1J9I A;  3RYP A;  1XGS A;  1YS6 A;  3QAH A;  1V4R A;  1ONV A;  2XVC A;  3CUO A;  3WU1 B;  1HXD A;  4HV5 A;  4AIJ A;  1HKT A;  3L00 A;  3I4P A;  2EJR A;  1W5S A;  2Q2E A;  2ZKZ A;  2ZO4 A;  1ZRF A;  3HTS B;  1LNW A;  3JAM K;  2HWV A;  3ZN1 A;  3ML6 A;  2UXN A;  1ZYR F;  2XAQ A;  4HX7 A;  5FLX Z;  5DYM A;  4WXD A;  2P5K A;  3QP6 A;  1I5Z A;  2D1V A;  1J5Y A;  4XLP F;  1IW7 F;  1S6L A;  1FYM A;  2UZK A;  1F4K A;  3P7N A;  5DDG A;  1B4A A;  2ESN A;  3ROU A;  4OMZ A;  3N4M A;  4XSX F;  1IN7 A;  2BYV E;  3W6J B;  3L2C A;  2Q8K A;  5HLH A;  1B59 A;  4L5J A;  1D8K A;  2WV0 A;  5F64 A;  1DP7 P;  1T2K A;  3H3Z A;  2Q0O A;  5A2Q K;  1O7L A;  1FBU A;  3BP8 A;  3J80 K;  3PQK A;  3KLO A;  3I5U A;  2DI3 A;  5LGN A;  4ESJ A;  1BIB A;  3QU6 A;  2LSO A;  1XN7 A;  3GFI A;  4UV8 A;  3CUQ C;  1U78 A;  4XLN F;  3CO6 C;  5LHI A;  1P4W A;  3E6M A;  5DUK A;  2QLZ A;  2HDC A;  3DFG A;  5H6Q A;  4ENJ A;  3F6V A;  4OIP F;  1IUY A;  2CGP A;  3N97 A;  4Q48 A;  2CW0 F;  4IRH A;  2WTE A;  5LHH A;  4HF0 A;  1TNT A;  4Q5S F;  3RKY A;  2YSR A;  4LD5 A;  5AIQ A;  3CDH A;  4N9I A;  1EH8 A;  1FOK A;  1IAW A;  3GWZ A;  2JRT A;  2OZ6 A;  3EYI A;  1P4A A;  5CLS A;  2EV5 A;  4I98 B;  4UHT A;  2A07 F;  2FF4 A;  4KT5 C;  2CYY A;  1PP8 F;  3LQR A;  2O0Y A;  5J8C A;  2XAH A;  4IHT A;  1RUO A;  2DK8 A;  3ELK A;  3DP7 A;  2P6T A;  2OBP A;  3QP5 A;  4RAZ A;  3KP4 A;  4OMY A;  5ERI A;  2YPR A;  3J81 K;  4MEX F;  3LA2 A;  5D5X B;  1CF7 B;  3DPT A;  1O3S A;  5LGT A;  4MTE A;  3C1D A;  3F8F A;  3HUG A;  1LB2 A;  3VOD A;  2MH2 A;  5JFR A;  3MEX A;  3K1N A;  4LLG F;  5FD5 A;  1S8N A;  1GXP A;  3DEU A;  3V4G A;  5DCM A;  1KU2 A;  3HSR A;  5JI6 A;  1F5T A;  1UCR A;  4I0A A;  4R1H A;  2M30 A;  2PFB A;  3F72 A;  4WWC A;  2ZME B;  2K7L A;  5E8I A;  3Q9S A;  4M73 A;  4RGS A;  4MQV A;  3EYY A;  2HZT A;  2L54 A;  4O5V A;  2ACJ A;  5ED4 A;  3I58 A;  1LEA A;  2L01 A;  4HF1 A;  4KN4 X;  1JGS A;  2HKO A;  4M6X A;  4YFK F;  2A69 F;  1ON2 A;  2KRF A;  5BQT A;  1YG2 A;  2O61 A;  5HS8 A;  2ZFW A;  1ZGA A;  4KUM A;  4DQ2 A;  3CUQ B;  1Z1D A;  4G6Q A;  2M1B A;  4ASN A;  1U5T B;  2EWN A;  2GAU A;  2HYG D;  3ZMZ A;  5TJJ A;  2EB7 A;  4LG0 A;  3KEQ A;  4HV6 A;  1UST A;  4U0W A;  1U3E M;  1QZY A;  1FP2 A;  1MKM A;  1R23 A;  3O2P E;  3OOP A;  1O7F A;  2GIV A;  2FBH A;  1B9N A;  1IF1 A;  3LAP A;  2UXX A;  1SFX A;  1ZRE A;  1NHA A;  3GO5 A;  1W7P B;  3P9I A;  3ULQ B;  4I2O A;  3B02 A;  4UVC A;  1IXS B;  1KGS A;  5LRR A;  5E20 A;  2QYO A;  1JHH A;  3RI4 A;  3MFK A;  2EFW A;  3D0S A;  1KQ8 A;  1D5V A;  4HBL A;  1HST A;  2IRF G;  4WCG A;  4EV0 A;  1B1B A;  3SXY A;  3KEO A;  3QPT A;  3EUH A;  1IZ1 A;  3BJ6 A;  3O3K A;  3C7J A;  1SD5 A;  3K2Z A;  2YX4 A;  2VOP A;  1KU9 A;  2RVC A;  4G9Y A;  1ZGJ A;  4WXC A;  3FMQ A;  4A6E A;  3CLO A;  4OIO F;  5HLI A;  3KP6 A;  3LAJ A;  2OQG A;  3TGN A;  1ZH5 A;  2M87 A;  1HSJ A;  5F1R A;  2HTS A;  3NEU A;  1I27 A;  4R8H A;  1BC8 C;  3VEP A;  4JK1 X;  1YW7 A;  1G3W A;  2NRA C;  3IKT A;  1X3U A;  2VN2 A;  2M5W A;  3ZMV A;  4L9T A;  4ENN A;  4JBA A;  4ZYD A;  2PBI A;  1J75 A;  1KQ0 A;  2OZU A;  4RB0 A;  4NQW A;  5BPD A;  2M8E A;  2PLY A;  3E5U A;  2QVO A;  4KIB A;  2DPU A;  2HEO A;  2VXZ A;  1AWC A;  3DPL C;  3TDZ C;  3M7G A;  2P5L C;  4ENM A;  5HDK A;  2JSC A;  5E8G A;  3E6B A;  3NRV A;  1P92 A;  2FA5 A;  4H0E A;  5LBQ A;  1TTY A;  1FY7 A;  3JTG A;  1ZG5 A;  1TW3 A;  4EQQ A;  1KU7 A;  3IWZ A;  2ELH A;  2XV4 S;  1ZAR A;  2F5E A;  3KZY A;  2QBY B;  3O6B B;  2A3S A;  2L3D A;  4PCQ A;  3FM5 A;  4KIF A;  4EM0 B;  4U7B A;  4KIC A;  2STT A;  3ZPL A;  2OD5 A;  2VC0 A;  4ZYH A;  3R61 A;  4RS8 A;  5H20 A;  3QPH A;  5LGU A;  5E17 F;  3AAF A;  4BAY A;  1D3Y A;  1RUN A;  5D8K B;  4HX8 A;  4NHJ A;  1BJA A;  1W4M A;  3JAM Z;  2IT0 A;  2M45 A;  4HQE A;  4P5O A;  1BI2 A;  4CYD A;  3ZP5 A;  2HTJ A;  2GZW A;  3WGG A;  1IN4 A;  2OQR A;  4XBF A;  2GXB A;  1G3S A;  1Z7U A;  3I64 A;  5HOO A;  1TBX A;  2RV8 A;  5L3C A;  4EMS A;  2XKP A;  3IC7 A;  1O3T A;  5CVU A;  2PI0 A;  4P55 A;  2DBB A;  2FNP A;  2G7U A;  3BOQ A;  2YX7 A;  3ECH A;  3R6S A;  4ESB A;  5D8L B;  3P9C A;  2KIU A;  4AIH A;  4I01 A;  3R0A A;  5A2Q Z;  1KA8 A;  2DW4 A;  2G7H A;  2GXG A;  5KK1 A;  3ECO A;  5D4S A;  2DQR A;  1FWZ A;  4I02 A;  1LDK B;  1R7J A;  3T1B A;  1F1Z A;  4Q47 A;  4G7H F;  4UUV A;  4HAM A;  3LST A;  5ICF A;  4MGR A;  2FML A;  4HZF A;  2YU3 A;  4JQF A;  3WGH A;  1XD7 A;  1BBY A;  3FX3 A;  1KU3 A;  2AS5 F;  2HYF A;  3K1P A;  3WU0 A;  1XSD A;  1QQI A;  3KFW X;  2EV6 A;  3SFZ A;  1MJB A;  3K69 A;  4BQA A;  1BM9 A;  1O3R A;  4KFC A;  1LDJ A;  5DEQ A;  3B73 A;  3F22 A;  1HW5 A;  5L3E A;  1FX7 A;  4LB5 A;  3KP7 A;  1K7A A;  3V8L A;  4S04 A;  4LB6 B;  2L4A A;  5D5U B;  3E97 A;  3K9T A;  3L7W A;  2NS0 A;  2FEZ A;  1KYZ A;  2XHK A;  1UB9 A;  4Y15 A;  2TDX A;  4IVN A;  3WTV C;  3FMR A;  1JE8 A;  3FF5 A;  1REP C;  1B6A A;  4ZYG A;  1R36 A;  2J5P A;  2PJP A;  2LKP A;  2XAS A;  1FNN A;  2VBZ A;  3T8R A;  1XGO A;  4UVB A;  4BXU A;  5J6X A;  1L3L A;  4EGY A;  3G3Z A;  2OU2 A;  5LLQ A;  3WTY C;  2ZJ2 A;  4IHS A;  1U5T C;  2L4M A;  3F8C A;  2NNY A;  4HLX A;  4YIF A;  4ZZD A;  1XCB A;  1OMI A;  1U8R A;  2E7W A;  2GQQ A;  3I53 A;  2ADU A;  1LQ1 A;  2V1D A;  2HOE A;  4HLY A;  5CVJ A;  3I0T A;  2KIM A;  3PQJ A;  2D2W A;  3U9G A;  5FO5 A;  4HOB A;  3E5Q A;  2Y48 A;  4LFU A;  1XGN A;  1IXC A;  2ETH A;  3GF2 A;  4D0P A;  4DNC A;  3V8K A;  2P7V B;  4M9Z A;  1XMK A;  5TRD A;  1R1U A;  3IRQ A;  3GYH X;  1S7A A;  5EEG A;  4R79 A;  2FBI A;  4OIR F;  4IRI A;  2IA0 A;  2QQA A;  5ILU A;  4GXO A;  1R00 A;  4YFN F;  1T39 A;  4BNC A;  6PAX A;  4MQ9 F;  2EA2 A;  2CO5 A;  5LRS A;  4TV7 A;  4EM1 A;  5D5W B;  4BHC A;  3KE2 A;  3JTH A;  2ISZ A;  4P96 A;  2HGC A;  2V6C A;  1Z6R A;  1S29 A;  3F8N A;  3G73 A;  2STW A;  4CDG A;  5D6F A;  1KQ9 A;  3HSF A;  2EK5 A;  3MZH A;  3TQN A;  1T6S A;  3FZV A;  2VON A;  2P8T A;  1FZP B;  5DV5 A;  3KLN A;  1U2W A;  3SZT A;  3TDU C;  4ON0 A;  5IT3 A;  4YFX F;  3WTW C;  4LGW A;  3QRF F;  2EA4 A;  4LK0 F;  4F7Z A;  1ZAO A;  4L18 B;  1QO0 D;  1OPC A;  4HW0 A;  1XDU A;  3V8J A;  2Z99 A;  1T38 A;  1BN5 A;  3GZ5 A;  2QZ8 A;  1BOA A;  4LG0 B;  3KP3 A;  3GX4 X;  4EJW A;  1O3Q A;  1XB4 A;  2VBW A;  2PQ8 A;  3GFL A;  3GXO A;  2DTR A;  2D1H A;  4UNO A;  5FB2 A;  2WC2 A;  1YYV A;  1FSE A;  3ISP A;  1LJ9 A;  2HQN A;  1T0F A;  5LEJ A;  2H27 A;  3Q9V A;  3MQ0 A;  5K5R A;  4P9U A;  3HSE A;  1MD0 A;  1YIO A;  2NYX A;  4G6D A;  4P9F A;  4L5I A;  4LLL A;  2IVM A;  2V1X A;  1K79 A;  5E18 F;  4A0Y A;  2L02 A;  2CSO A;  1BI1 A;  2XAF A;  1H9T A;  2LDU A;  3TO6 A;  1P6R A;  3GLX A;  3F8M A;  3FHZ A;  3ZMD A;  3WTT C;  3WG9 A;  3RYR A;  2OA4 A;  4YG2 F;  3GEZ A;  3I59 A;  5DUI A;  3IWF A;  4B8X A;  1F9N A;  3V7C A;  1OYI A;  2H94 A;  3HHH A;  4M9S A;  1YW9 A;  5D5V B;  2P6S A;  5ICG A;  1ULY A;  1PP7 U;  2CFX A;  3D5L A;  1J2X A;  4S05 A;  4PDK A;  2MH9 A;  2O6G E;  3CUQ A;  3KET A;  2XAJ A;  3LA3 A;  3V7R A;  1GHC A;  3WTX C;  2RNJ A;  2EFN A;  4BHB A;  1GXQ A;  2J5O A;  5HDG A;  1H9G A;  3RKW A;  1WI9 A;  1RIO H;  2IJL A;  1XCV A;  3MZY A;  2IA1 A;  1LEB A;  4IXA A;  3DQV C;  1FBS A;  1D8J A;  4LLN A;  1EH6 A;  4KMF A;  2VT3 A;  5FFZ A;  4BYY A;  1SMY F;  3WE2 A;  2H6B A;  1I1S A;  4XRF A;  2XRO A;  3E6C C;  4L0Z B;  1STZ A;  1ZRD A;  2EFP A;  1W7P A;  2DLL A;  3TO9 A;  4WX9 A;  1K78 A;  1E2X A;  4LK1 F;  1MDM A;  2HQR A;  4Q4Z F;  5ICE A;  4MNU A;  2VOD A;  2KJC A;  1XDS A;  5H6R A;  3VB2 A;  2P5V A;  4AVP A;  1HKS A;  2O03 A;  5FGM A;  3CTA A;  4HDV A;  4XSZ F;  3C3W A;  2FE3 A;  1TQM A;  3M9A A;  5FD6 A;  1R5G A;  1MJ9 A;  1ON1 A;  4Y17 A;  5HLG A;  4ZZL A;  1R1V A;  3U2R A;  4OIN F;  5E1W A;  3HRU A;  2EFO A;  1DDN A;  4ZYE A;  3ZMS A;  5JR3 A;  3MWM A;  1QPM A;  1S3J A;  3COA C;  4EGZ A;  4KMU X;  2MLG A;  2EFQ A;  2A68 F;  3TOA A;  5K5Q A;  2BBY A;  1R1T A;  2Z9O A;  4RGR A;  1YS7 A;  1USS A;  3C18 A;  4HA8 A;  3KCC A;  1FT9 A;  4RB2 C;  1P2F A;  2V9V A;  3DXJ F;  3JSP A;  2HR3 A;  3WE3 A;  4L9J A;  1ZG3 A;  1G4D A;  1BI3 A;  4EJT A;  3R0J A;  2RN7 A;  1H0M A;  2R7D A;  4O6J A;  4KDP A;  1AOY A;  2DT5 A;  3HOT A;  4QWQ A;  1ZHF A;  1FPQ A;  2VOO A;  3BRO A;  3F23 A;  3M8F A;  2K86 A;  4FX4 A;  3BY6 A;  4UVA A;  2QBY A;  2W84 A;  4RGU A;  1ZLK A;  3KP5 A;  4EJV A;  1YO5 C;  5LHG A;  1TNS A;  1LDD A;  4KA4 A;  5DD8 A;  3WTU C;  3BJO A;  4IPA A;  2E7X A;  1HW1 A;  3HRM A;  3BWG A;  2A5Y B;  1E17 A;  1J59 A;  2XGX A;  4Y13 A;  4UXN A;  1PDN C;  3TKY A;  3IRR A;  3HYI A;  2F5C A;  2W57 A;  2DPD A;  1XSV A;  2MLK A;  4EM2 A;  2XAG A;  3J80 Z;  5E1X A;  4I0B A;  1SD6 A;  3LA7 A;  2ZBK A;  3E3V A;  5L3D A;  1Z6T A;  5BPI A;  4E70 A;  2QWW A;  2JZY A;  3FWE A;  4FHT A;  1SFU A;  1ODD A;  3LWF A;  2MC3 A;  5CVV A;  1WSU A;  4FT8 A;  2XUB A;  5EEH A;  4L0Y B;  2A6H F;  5CVR A;  1FSH A;  2XRN A;  1MGT A;  3ZMT A;  3BPX A;  1Q1H A;  1A04 A;  1FYL A;  2PG4 A;  3FXU A;  4KIG A;  4M6Y A;  2FU4 A;  2C6Y A;  2DU9 A;  1HQC A;  2HS5 A;  3DF8 A;  4WXH A;  4RB1 A;  5BOX A;  1K6O A;  1XGM A;  2QQB A;  3MAJ A;  5IT9 K;  2DQL A;  2KKO A;  5D4R A;  3F6O A;  1KYW A;  4Z2Y A;  2HKX A;  2DAO A;  2JT1 A;  2Y75 A;  1OYY A;  1HKQ A;  4A5N A;  3J7A O;  5JVT A;  1Z91 A;  1TLH B;  1IN5 A;  1HW2 A;  2VBX A;  1J7K A;  1TQI A;  2PMH A;  4HQM A;  2KIF A;  3GZ6 A;  1Y0U A;  3I71 A;  1JHF A;  3T8T A;  5HDN A;  3J81 Z;  1LVA A;  2O8X A;  2VBY A;  1J0R A;  3IL2 A;  4U7D A;  1SMT A;  3W6K B;  3ZQ7 A;  1R58 A;  4HX4 A;  2GWR A;  3E5X A;  3HRT A;  3RPU A;  5LEK A;  2KJB A;  2NNN A;  3L09 A;  2RC4 A;  1RI7 A;  2VE9 A;  2BE5 F;  3LFK A;  1Z05 A;  5AON A;  5L3F A;  2QM3 A;  3RKX A;  2Z33 A;  5FLX K;  3H3U A;  1UHW A;  2ISY A;  4CZZ A;  1FYK A;  3HTU A;  3RIR A;  3T5X A;  4ZH4 F;  3ABT A;  3HHG A;  3RTR A;  3KP2 A;  1RNL A;  3PFI A;  1IN6 A;  1IXR C;  4CGZ A;  2JTV A;  2CG4 A;  2F5D A;  4A6D A;  4MTD A;  4QLC U;  5DCM B;  5ILS A;  4EJO A;  1VTN C;  2LNB A;  2VE8 A;  2MBF A;  3GUD A;  1SD4 A;  2FBK A;  3FM3 A;  5HS7 A;  2UWM A;  3WTS C;  4ETS A;  1MZB A;  1ZN2 A;  3OV8 A;  1WWX A;  1TW2 A;  4GYI A;  4CHU A;  1SD7 A;  3IHU A;  1Z9C A;  3JW4 A;  4NB5 A;  3HIF A;  2H09 A;  1PUE E;  3GW2 A;  3SQN A;  2B0L A;  3JSO A;  2PN6 A;  3ERE D;  2ZNZ A;  1P4X A;  3IKV A;  1ZRC A;  4IF4 A;  1OYW A;  4N0B A;  4WF2 A;  3EET A;  3WTZ A;  5DCF A;  4AD9 A;  3S2W A;  2ESH A;  1WRJ A;  4CIC A;  2DK5 A;  2RQP A;  4A12 A;  2EV0 A;  2QUF A;  2QQ9 A;  2LF7 A;  2V1U A;  5JHU A;  4CXF A;  2LF8 A;  2BV6 A;  3FXR A;  2W85 A;  1G3T A;  2X4H A;  2JPC A;  1HBX G;  4BHP A;  4RB3 C;  3I59 B;  1CF7 A;  1ZLJ A;  4B09 A;  3M8E A;  2PMU A;  4GGG A;  5ICC A;  1W5T A;  2GA2 A;  4EVI A;  2Y0M A;  3GFJ A;  3WOD F;  2P4W A;  2BEO A;  2IP2 A;  1S7O A;  4KNY A;  1ZG1 A;  2FXA A;  3T0Y A;  3NQO A;  1YQA A;  1DUX C;  2Z5U A;  4M9X A;  4PZJ A;  4A5M A;  1UFM A;  4YII A;  2ZME A;  4ESF A;  1DPU A;  1OKR A;  5E1Z B;  3WGI A;  1RZ4 A;  4A2U A;  3BDD A;  2OAZ A;  3GVA A;  1QGP A;  1I1G A;  2R3S A;  2XIG A;  2MD5 A;  2W25 A;  3SZP A;  3EDP A;  4HF2 A;  1QNT A;  4IRG A;  4OU0 A;  1XMA A;  3GFM A;  3U1D A;  1DPR A;  2COM A;  5K5O A;  5CYV A;  1EH7 A;  4ENK A;  3F3X A;  3FXQ A;  1GVJ A;  1G6N A;  1U6G A;  4GO1 A;  3EQL F;  3REO A;  1BIA A;  1BI0 A;  3V7S A;  2XKO A;  3M1E A;  2MA3 A;  4AIK A;  1U5T A;  3FMS A;  2E1N A;  1FLI A;  4I09 A;  2FNA A;  1K78 B;  4IJA A;  4BH9 A;  3CJN A;  1MDM B;  2K02 A;  1R22 A;  1OR7 A;  2HFH A;  1V3F A;  2DFI A;  2QEN A;  2ZCW A;  5DD4 A;  4FX0 A;  3Q5F A;  4U0Y A;  1FC3 A;  2BGC A;  1IN8 A;  2V79 A;  3ZN0 A;  4M72 A;  1C0W A;  4EJU A;  4L9V A;  1O57 A;  2CWE A;  4LMY A;  1XSX A;  2O3F A;  2IA2 A;  2RGV A;  2RDP A;  1SFE A;  5D6E A;  3BPV A;  5CJ9 A;  4GYG A;  1YW8 A;  2FQ3 A;  2X0L A;  2K4J A;  2VC1 A;  3LQQ A;  2GA1 A;  3F21 A;  3CO7 C;  2IPQ X;  1WQ2 A;  2VT2 A;  3RPQ A;  2Z3Y A;  1BC7 C;  3E6D A;  4A0Z A;  1L0O C;  3HRS A;  2K27 A;  1YTY A;  4G8X A;  4AWX B;  4G7O F;  3HOS A;  1SAX A;  2W24 A;  5BMZ A;  2RKH A;  4RGX A;  4M71 A;  2FRH A;  4HYE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...