3HSEA

Crystal structure of staphylococcus aureus protein sarz in reduced form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
116
Chain Sequence
GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDENIKKLGERVFLDSGTLTPLLKKLKDYTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator sarZ
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 40
structure length 116
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hseA00
3CUQB 2IA0A 2FE3A 2P5LC 3O6BB 5DEQA 1TQIA 1D3YA 4P9FA 1QO0D 1YW9A 1FSHA 3DFGA 3GUDA 2DPDA 4HX7A 5LEKA 1HKTA 3BOQA 2K7LA 3MCZA 4HF2A 1D5VA 2RNJA 5ICGA 5L3CA 4EM1A 2GZWA 3LAPA 2HQRA 5DCMA 4WXHA 2TDXA 2YX4A 5D4SA 4Q47A 3I71A 5FB2A 2Z9OA 3CUQA 2XAGA 3PQKA 3ZMDA 2VBYA 3PFIA 5LGUA 3LQQA 2FRHA 2PI0A 2P8TA 5H6RA 4ENKA 1ZREA 5BMZA 2GA2A 4R1HA 2W85A 4M6XA 1USTA 5CVVA 4WXDA 4UV8A 2J5OA 3B73A 1IAWA 3TOAA 4A2UA 1XGMA 1YLFA 4KMFA 1ZYRF 2VOOA 2FNPA 3HSFA 5CVIA 1ONVA 2B0LA 2NS0A 4XLPF 2OAZA 1SD6A 2ZKZA 1HW2A 1LDDA 2JRTA 2P4WA 3DQVC 1TQPA 2VBWA 2V1DA 1LDKB 2CW0F 2O8XA 4LB5A 3KP6A 1ZLKA 3D0SA 2XIGA 3F23A 1Z1DA 2PJPA 1FOKA 1ZG5A 2E1CA 1GXQA 5BPDA 3RTRA 3R6SA 4A5NA 3RDIA 4FX4A 1IXRC 3K69A 1UHWA 3PQJA 1DUXC 2FBKA 5FLXZ 1SFEA 3VODA 4L9JA 5L3BA 4LLGF 3ECHA 1MJ9A 2R7FA 3GYHX 2HGCA 1T6SA 3RKYA 5ICCA 1W4MA 4IF4A 4RAZA 2V1UA 3IL2A 5HS8A 3BWGA 3M8FA 2K27A 1D8KA 1LNWA 3J81Z 5AIPA 4A0ZA 4FT8A 4G7ZF 3GF2A 1YIOA 3E5QA 2LF7A 3EETA 2J5PA 4CICA 4LG0B 2DLLA 2YU3A 5CVUA 4O3MA 3T8TA 1W5TA 4I09A 4Y13A 1FP2A 3QOPA 1LVAA 1HXDA 2OZUA 1RUOA 1XB4A 1S29A 1U5TA 5HLGA 4DNCA 3NEUA 4LJZF 4RGUA 2CQKA 1F1ZA 2YR2A 4KIBA 3T8RA 2QZ8A 4WWCA 2LNBA 2IRFG 4HQEA 2D2WA 2V9VA 2CG4A 2OD5A 1QBJA 4LG0A 2OQGA 3I54A 2DQRA 3SFZA 3HTUA 1RZ4A 2YPRA 1G3YA 4ON0A 2Q0OA 1K6OA 3DXJF 2BGCA 1TNTA 3WTWC 4UUVA 3MZYA 1F4KA 2IT0A 1HW1A 1QNTA 2EV6A 5ICEA 4RB3C 2M87A 2A61A 3HHHA 3WODF 1O3TA 5FGMA 5K5OA 3ZPLA 3FX3A 3WE3A 5EEHA 2CYYA 5E8IA 2HTSA 2FSWA 2QQAA 2LSOA 5HDKA 1V4RA 3EYYA 3FXRA 4S05A 2QLZA 3CTAA 1FX7A 4L0ZB 1RI7A 1JHHA 4Z2YA 3KLNA 3F72A 4P96A 4CO8A 2XROA 4HDVA 5JVTA 4HQMA 3CUQC 5LHHA 1H0MA 2OA4A 3WU0A 5D5XB 3LA2A 3O2PE 4EGYA 2MLKA 4Q5SF 4IXAA 3WTSC 2WC2A 3BZ6A 4BYYA 1OR7A 1UCRA 2K02A 4U7DA 2ZXJA 2HQNA 2A68F 2VT2A 3P9KA 1FZPB 2DK8A 4L5IA 4F7ZA 1R23A 3L09A 4IRIA 3J80K 1Z6RA 2FA5A 2K86A 2DW4A 2XKPA 4HBLA 3TKYA 2Y75A 1HSJA 3BDDA 2JPBA 1P4WA 1O3QA 1JE8A 3I59A 3QPHA 3SZPA 3QU6A 2FBIA 1P4XA 3K2ZA 4A6DA 1R1TA 1J5YA 4FHTA 1XCBA 3QRFF 2NNNA 4AIHA 4ENJA 4XSZF 2D1VA 3HYIA 2UXNA 3JSOA 1EV7A 4ENMA 2DU9A 4Q48A 3ML6A 4CYDA 4EMSA 4ZZLA 3MEXA 2QYOA 3FM5A 3BROA 3R4KA 2IP2A 3E3VA 3ABUA 4KIGA 3FWEA 1UHMA 1P4AA 2CWEA 4YFKF 1FBSA 1OPCA 3G3ZA 2FMYA 5LEJA 2A6HF 4NQWA 2VBZA 3V8KA 1SD7A 2HOEA 4LB6B 1FBQA 1YS7A 2PEXA 1AWCA 3GXOA 5JFRA 1B59A 1QZYA 1ZLJA 2NNYA 3Q9VA 3GFLA 1P6RA 2DPUA 4P55A 1IXCA 2P5VA 2Q8KA 5F1RA 4L5JA 2Z33A 3RKWA 4B8XA 4KUMA 1YO5C 1DPUA 4CXFA 2HS5A 4EGZA 3HTSB 2F5CA 3TGNA 3U1DA 4UVCA 4RGRA 4IHSA 2P6SA 1IUYA 1YYVA 1LQ1A 2KIMA 1A04A 3GX4X 4UNOA 3LQRA 5LLQA 5EEGA 5FO5A 3Q5FA 3WTZA 3TQNA 3N4MA 1MDMB 4YFXF 1HSTA 3WGIA 1ZGJA 2G9WA 1HQCA 4CDGA 1JHFA 1B9MA 5DCFA 1IZ1A 5E1XA 4RAYA 4AWXB 5L3FA 4HX8A 3R60A 3HIFA 3ZMUA 5LHGA 4MHGA 3N97A 1DP7P 3HRMA 1LEAA 2Y0MA 4KN4X 4BHBA 3M1EA 3KEOA 1MDMA 1K7AA 1GVJA 2QWWA 4HV6A 1UFMA 3GW2A 5D5WB 3K0LA 2G7HA 3R0AA 1LDJA 3L2CA 1E17A 4I2OA 3IKVA 1OMIA 4KA4A 3ELKA 2VC0A 5D6FA 4FX0A 3ZN0A 2X0LA 3F22A 1R1UA 3WTXC 5IT9Z 1FP1D 5FD5A 1ZHFA 1RUNA 3DEUA 1IRGA 5ILVA 1EH7A 1W5SA 4L0YB 4LD5A 4GGGA 2DAOA 2ZBKA 3TOBA 5TRDA 3C3WA 4EJOA 5BPIA 4OIPF 2P5KA 5CVJA 3GFJA 5TJJA 2FXAA 2BV6A 1ZRCA 3KZYA 3QP6A 3V8LA 4I98B 4HDUA 2ZJ2A 2L4MA 2A6EF 1TW3A 2FOKA 4L9VA 2NYXA 2ZMEB 3OV8A 4P9UA 4BH9A 2UZKA 1S8NA 4U0VA 2PQ8A 4MQ9F 1OKRA 3HHGA 4EM0B 1Q1HA 4PZJA 3V7RA 1L0OC 1YQAA 4N9HA 2L4AA 2RDPA 1WWXA 1I1SA 5F64A 2MBFA 2H27A 3KFWX 4NHJA 3GFIA 1G3WA 1R1VA 2HDCA 1O57A 2VE9A 4UVBA 4MTDA 3HOTA 1PDNC 1R5GA 1BI3A 3Q9SA 1Y0UA 1XSXA 4NB5A 2XHKA 2HKOA 1Z05A 1Z6TA 2ZMEA 4YIFA 2QVOA 5HS7A 1J75A 2P7CB 3EQLF 2DBBA 1ZGAA 1IN4A 3TO9A 1OYWA 2QM3A 3VEPA 3BP8A 5E1ZB 2MLGA 2ISZA 4LK0F 5E1WA 3ZP5A 1EH6A 1O7LA 3E5UA 3ZMSA 4YFNF 4LLLA 3JTHA 1YW8A 1Z91A 4KFCA 1SMTA 2UWMA 2GXGA 2BBYA 3E5XA 3R61A 5LRSA 5JR3A 3KP7A 2JZYA 2C6YA 2VODA 4MQVA 1S3JA 3COAC 2H09A 1KQ9A 2COMA 1IN8A 3AAFA 2W25A 1U78A 1K78B 5FFXA 2EV0A 1REPC 4OOIA 4OMYA 2GIVA 2W57A 5L3EA 1RIOH 2ADUA 4CZZA 2XGXA 4PDKA 4HW0A 2KJBA 2STTA 1I1GA 1R7JA 1USSA 4YIIA 4UV9A 1HW5A 5FD6A 2GWRA 3IC7A 1XGOA 3S2WA 2RN7A 3LA7A 1FBUA 5HLIA 2RVCA 4MNUA 2V1XA 1Z9CA 3FM3A 1K78A 3FMSA 4BHPA 3VOEA 4KICA 3GZ6A 4O6JA 3TDUC 3P9CA 2V79A 2O0YA 2NRAC 2X4HA 2EFQA 4MEYF 1DDNA 3I5UA 4UXNA 1XGSA 4K2EA 4M71A 3FMRA 2EK5A 3WTVC 4ESBA 1IXSB 4BHCA 2CO5A 3F8BA 5FLXK 3KP2A 1R5HA 1EH8A 1MJAA 3MQ0A 1QZZA 2BYVE 4LMYA 2EFWA 1SAXA 2WTEA 1I27A 3B02A 3LAJA 1BBYA 5HVQC 2JSCA 1P92A 5HOOA 5ED4A 4HA8A 3V8JA 4HV5A 3K9TA 5BS6A 3F8MA 1ZN2A 2O61A 4XRFA 2HTJA 3GVAA 2FBHA 5E17F 3MZHA 3IHUA 3DV8A 4RGSA 1YS6A 3J81K 1PP8F 3WE2A 1XCVA 3DKWA 3ROUA 3DF8A 2MA3A 2MD5A 5A2QZ 2GAUA 3MAJA 4GO1A 5L3DA 2UXXA 5CLSA 2JT1A 2WV0A 4ZYEA 2XAQA 4G8XA 3T5XA 4G7HF 1SFXA 2F5EA 3V4GA 1U2WA 4IHTA 3RIRA 4M9SA 1R36A 1SFUA 5AONA 2F2EA 4AVPA 3LFKA 4WK8F 1FT9A 4PCQA 3HRTA 4UHTA 5DYMA 3SXYA 4U7BA 3ZN1A 4QLCU 3JTGA 4G6QA 2GA1A 4KDPA 4HLYA 4WF2A 2PMHA 2ETHA 1FYLA 3V7CA 1J2XA 1T98A 2O6GE 1S7OA 4H0EA 4IVNA 1HKSA 4A5MA 2IVMA 2KKOA 4ZH4F 4EQQA 2OQRA 5BQTA 4M9ZA 1OYIA 2CSOA 4EJTA 1TTYA 2FNAA 3RI4A 2PN6A 3HOSA 1B4AA 3QPTA 4RB2C 1XSDA 2GXBA 1C0WA 1XSVA 5D8KB 1S7AA 4TV7A 2IW5A 5CJ9A 1R22A 3JAMZ 5H6QA 3WTTC 3E6BA 3WGHA 3ERED 4KNYA 1G3TA 2M45A 4OINF 4O5VA 2XVCA 2A07F 1D8JA 3SQNA 1B6AA 4I7HA 4JK1X 2ESHA 1PUEE 4G6DA 3L9FA 3WG9A 4ESJA 4GYGA 3ULQB 2L02A 4ENNA 1BN5A 2QENA 2WWYA 2EB7A 5HDGA 2VE8A 3FHZA 4YG2F 4ZYGA 2H6CA 3GLXA 1ON2A 4A0XA 4U88A 2RV8A 2W24A 3ABTA 3BY6A 4OIQF 1ZRDA 5ILSA 4EJWA 2R3SA 1PP7U 4BXUA 4Y15A 5ICFA 2STWA 2M8EA 2K4BA 2DT5A 4RGXA 2DTRA 4ETSA 3H3ZA 1TLHB 2RGVA 5ILUA 2A3SA 1FWZA 1ZG3A 1J0RA 1BIBA 1BI0A 2A5YB 1XN7A 4N9IA 2H6BA 4RB1A 1J59A 5DD4A 1BC7C 3WU1B 3CO6C 2EV5A 1WKMA 2HFHA 3M9AA 1FPQA 2V6CA 3E97A 4RS8A 4OU0A 2R7DA 1MD0A 3NRVA 4LFUA 3F8NA 1KGSA 3RPQA 1CGPA 1F5TA 1UB9A 5HS9A 1KU9A 4U0WA 1XMKA 5D6EA 2Z3YA 3K1NA 2DFIA 3W6KB 1IF1A 4BQAA 2XV4S 2EA4A 2EA2A 4L9NA 1HBXG 2XASA 3JSPA 2ISYA 5K1YA 3IKTA 4ASNA 3V7SA 1GHCA 2Q2EA 5DCMB 1WQ2A 3E6DA 5K5RA 3RKXA 3J7AO 2RQPA 2K4JA 3P7NA 4GCVA 4OIRF 3VFZA 1BOAA 2CGPA 2ZNYA 5LGNA 3FZVA 1T38A 1J7KA 2PFBA 3SZTA 2GQQA 2ZNZA 3TDZC 3KETA 2O3FA 1L3LA 2M5WA 5D4RA 5DD8A 2G7UA 3I53A 4G9YA 2XAHA 1T0FA 1VTNC 1KU2A 4A0YA 2ESNA 2DK5A 3LSTA 4I0BA 1NHAA 2LDUA 4ZYHA 2Z5UA 4MGRA 4MTEA 3C18A 2P6TA 3F8CA 3TO6A 1MZBA 4I01A 1JGSA 1I5ZA 1KYZA 5JI6A 4G94A 1YTYA 1KU7A 2OBPA 2E7WA 3RYRA 2LF8A 2EFPA 5D5UB 1CF7B 3I58A 1G6NA 5D8LB 3VB2A 3REOA 4D0PA 1FY7A 1BJAA 4Q4ZF 4HYEA 2P7VB 1TBXA 2D1HA 1O3RA 5IT9K 1BIAA 5AIQA 1WSUA 2L54A 3MWMA 4P5OA 5DUIA 4XBFA 2XKOA 1ZARA 1KQ8A 1KA8A 3GFMA 1QQIA 1MKMA 3W6JB 1XDUA 4U0YA 5L3GA 1RNLA 5D5VB 1FYMA 3M7GA 4B09A 4IPAA 1CF7A 3NQOA 4GXOA 1JXSA 1XGNA 4R79A 1FLIA 2DI3A 5BOXA 3FXUA 3RYPA 1IRFA 4L9TA 2BE5F 5J8FA 3IRQA 3QAHA 5J6XA 3EDPA 3BPVA 2OU2A 2HR3A 2VXZA 3GWZA 4CGZA 3K1MA 3RPUA 4AIJA 2HYFA 2BEOA 5JHUA 1SD5A 3HRSA 3F21A 5LGTA 1BI1A 1S6LA 3KE2A 3C1DA 3QU3A 3LA3A 3FMQA 1QPMA 4M9XA 2F5DA 1U5TB 3I0TA 4WCGA 3HRUA 2PLYA 3E6MA 3HSRA 1IN7A 1F9NA 1FSEA 5CVRA 1MJBA 3KZZA 5E8GA 2CFXA 4LK1F 3BJ6A 2XAFA 1IN5A 3I64A 5ERIA 2JTVA 1WRJA 4A6EA 3CO7C 3BJOA 4GYIA 4EV0A 4KYWA 3T0YA 1FC3A 2MH9A 2HKXA 2DO7A 4BNCA 3U2RA 2MH2A 4JQFA 3WTUC 1W7PB 1YG2A 1ULYA 2HZTA 1V3FA 4PGGA 2KIUA 1P2FA 1IW7F 1H9GA 4ZYDA 2AS5F 3ZMZA 2ACJA 2L01A 4JBAA 3J80Z 1ZRFA 2QBYB 2VN2A 2PBIA 1E2XA 3JW4A 2QUFA 2H94A 4EVIA 3ZQ7A 4KIFA 3EUHA 4PGHA 1YFHA 1KU3A 2VONA 4IRHA 1SMYF 1BC8C 2DQLA 3BJAA 4KMUX 3E6CC 5E18F 2M30A 1W7PA 4M72A 1IN6A 3HUGA 3L7WA 4OIOF 2AXLA 4CHUA 2A69F 2YX7A 4XLNF 2ZO4A 3I4PA 3ECOA 2VBXA 2QBYA 4WXCA 4E70A 2EJRA 3KP5A 4G7OF 4UVAA 3TO7A 3SHFA 3KP4A 3IWFA 3CJNA 5IT3A 3WTYC 1TQMA 2EFOA 3CDHA 2HEOA 2IA2A 4R8HA 1ON1A 1XDSA 1ODDA 1WI9A 1HKQA 2O03A 2W84A 1W7PD 3D5LA 4AD9A 4BAYA 5E20A 4LGWA 4LLNA 3I59B 2OZ6A 4ZZDA 3O3KA 3MFKA 1GXPA 3M8EA 2YSRA 2KRFA 2KJCA 4HLXA 1ZG1A 5F6FA 5H20A 1STZA 1OYYA 2Y48A 5DV5A 2F5FA 3FXQA 1I6XA 3CLOA 3R0JA 4QWQA 2XUBA 4HOBA 5HLHA 4AIKA 2VOPA 2PG4A 2ZCWA 5HDNA 2HYGD 3HSEA 1O7FA 3KP3A 3C7JA 3L00A 3H3UA 2LKPA 2PMUA 2FEZA 3DPLC 3QP5A 5A2QK 1U6GA 5DUKA 1J9IA 3IWZA 2M1BA 1K79A 1YW7A 3DP7A 4A12A 3F8FA 3RJPA 3LWFA 4IRGA 6PAXA 3ZMTA 2FQ3A 2NAZA 3CUOA 4EM2A 2IJLA 1B1BA 3WGGA 1FNNA 3KLOA 2D45A 2RC4A 4HF0A 4HAMA 5DDGA 2XAJA 2EFNA 2L3DA 2JPCA 4WX9A 5LRRA 1SD4A 2FF4A 3K1PA 1X3UA 1LEBA 4S04A 2XRNA 5FFZA 3KCCA 1U8RA 1KQ0A 2E1NA 1XD7A 1KYWA 2E7XA 3DPTA 3BPXA 5LBQA 1LJ9A 2RKHA 1O3SA 1Z7UA 1BM9A 2IA1A 4M6YA 4EJUA 4L18B 1R58A 1U3EM 4IJAA 1ZAOA 3GZ5A 1DPRA 2VC1A 2KIFA 3F6VA 1ZH5A 4ESFA 4HF1A 1T39A 1R00A 3ISPA 4OMZA 3F6OA 1B9NA 1U5TC 1T2KA 1AOYA 4EJVA 4Y17A 2VT3A 5KVRA 4DQ2A 4M74A 3FF5A 3GO5A 5CYVA 2MC3A 1FYKA 1G3SA 2IPQX 1XMAA 3IRRA 4XSXF 3JAMK 4KT5C 2Z99A 5J8CA 1QGPA 3G73A 2ELHA 4I02A 4N0BA 1LB2A 2QQ9A 5K5QA 2HWVA 3F3XA 2FU4A 1BI2A 3H92A 3P9IA 1TNSA 2FMLA 4HX4A 3T1BA 4I0AA 3U9GA 4M73A 4KN7X 4RB0A 3KEQA 3GEZA 2ZFWA 1MGTA 1TW2A 1G4DA 3EYIA 1H9TA 5LHIA 4HZFA 2EWNA 5KK1A 4MEXF 2QQBA 3OOPA 3ZMVA
chains in the Genus database with same CATH superfamily
4XLFA 2RREA 3CUQB 2IA0A 2MG4A 2DN0A 2FE3A 2P5LC 2JA2A 3PUBA 3O6BB 5DEQA 1TQIA 2ECCA 2VASA 3LSGA 4I76A 1MH4A 1D3YA 4AIDA 4E7LA 4P9FA 1QO0D 1YW9A 1SVMA 1FSHA 3GMEA 3DFGA 1HDPA 3GUDA 4M3DA 2DPDA 5FLMJ 4IHWA 4HX7A 5LEKA 4CUGA 3BTCA 5GADJ 1ETWA 1YX3A 1HKTA 3BOQA 2K7LA 4BBRJ 3MCZA 4HF2A 1D5VA 3K6GA 4PFOA 5DM6F 2RNJA 4QPQA 4ZJZA 5ICGA 4XIDA 4B4CA 4IO9F 2K3PA 5L3CA 5J1RA 2KISA 4EM1A 2GZWA 3LAPA 4UUSB 2QSFX 2HQRA 3K4LA 2WB1N 3OMYA 3DEEA 5DCMA 4D7NA 4WXHA 2TDXA 4XLHA 2E2HJ 2YX4A 1JTXA 1WVRA 4LITA 1XMXA 5EG0B 5D4SA 4Q47A 3I71A 5FB2A 2Z9OA 2FQ4A 1WCMJ 2XAGA 3CUQA 3PQKA 3ZMDA 5IY5H 1X1BA 4XOPA 3HOUJ 4PSWA 2VBYA 3S3NA 2IXSA 3PFIA 1K6YA 1SAUA 2WAEA 3LQQA 5LGUA 3LSPA 1LKXA 3DU5A 2FRHA 2PI0A 2A6TA 2P8TA 1WJ5A 3BTIA 5H6RA 4W97A 4ENKA 1ZREA 4XK4A 5BMZA 2GA2A 4N4NB 4RAGA 3CCLI 2LMDA 4R1HA 3UKGA 2R7SA 1X3ZB 3GLLA 2W85A 2W82A 4BE1A 4M6XA 1USTA 9ANTA 2VLAA 1OCPA 3BG3A 1U0JA 1IO2A 3BR2A 5CVVA 3FK7A 4AUXA 4A69C 2KPMA 4WXDA 3S1NJ 4UV8A 2J5OA 4UUSA 3CCEI 3B73A 4XKWA 1IAWA 3TOAA 4A2UA 5IP9J 1XGMA 4A3IJ 2KZGA 3MD2A 1YLFA 4KMFA 1ZYRF 5EG0A 3SJMA 2VOOA 2FNPA 2HNHA 3QPSA 3M3YJ 3HSFA 5CVIA 1ONVA 2B0LA 2NS0A 2NVUB 2OAZA 4ANJA 4XLPF 4ZDLA 1SD6A 2ZKZA 1HW2A 1LDDA 4L5EA 2JRTA 2P4WA 2KT0A 3DQVC 1UG2A 5M3FJ 1TQPA 4JX4A 3I4NJ 2VBWA 2V1DA 4X0GA 1LDKB 2CW0F 2O8XA 5B3SH 2GBYA 4LB5A 3KP6A 2LREA 1ZLKA 3CLQA 1FJLA 3D0SA 1X1CA 3S3MA 2XIGA 3F23A 4IZZA 1VQ9I 1Z1DA 2PJPA 5M5YJ 1FOKA 1Y8QB 3HZJA 1ZG5A 1YJNI 2XDVA 4Z6YA 3CJQB 3HC7A 2E1CA 1GXQA 5C3EJ 5BPDA 2LY9A 3RTRA 3I9V2 4XRSA 2I5UA 3R6SA 2IS6A 2O7OA 4A5NA 3VPRA 1QVUA 3RDIA 4FX4A 2BY0A 1IXRC 3K69A 4YELA 1MNDA 1UHWA 3PQJA 1DUXC 1IDZA 4BL0B 2FBKA 2BZTA 1SFEA 2JSPA 5TISC 3VODA 5FLXZ 2O5RA 4L9JA 5L3BA 4LLGF 1JJ6C 3ECHA 1VQOI 1MJ9A 2R7FA 1FIPA 1GVDA 2WA0A 1GV2A 2CQNA 3LSKA 4BQQA 3OS1A 3GYHX 3GTQJ 3H0DA 2L0KA 2HGCA 1T6SA 3CJRB 4M3EA 5FKLA 3CDIA 3NWTA 2VJIA 3RKYA 5ICCA 2VQLA 1W4MA 4IF4A 3G1MA 2NS8A 5JVGF 5FRMA 4RAZA 4HRIA 5EGOB 2V1UA 3IL2A 5HS8A 3S1QJ 4A3GJ 3L1PA 5GAHJ 3S93A 4X6AJ 2OCCH 3BWGA 3DKXA 3M8FA 3OYEA 2R7UA 2BW3B 2K27A 1D8KA 1LNWA 2XPWA 3SDGA 4DBQA 3J81Z 5AIPA 3ZQHA 1S5LC 4IOAF 4A0ZA 4FT8A 4BE0A 3CCQI 4G7ZF 2JA7J 3GF2A 1YIOA 4MIMA 1QZEA 3E5QA 1T56A 3TBIA 3IAM2 2LF7A 4V2GA 3JRGA 3EETA 2J5PA 4CICA 4LG0B 4BXFA 2DLLA 2L7MP 2R7TA 3Q0UA 2YU3A 5CVUA 1V54H 1LFUP 3S16J 2BY1A 4O3MA 3BG5A 1TWFJ 1U9OA 5BNGA 4XLEA 4LIVA 4E7JA 3T8TA 3OY9A 3S1MJ 2BY2A 3KYDB 4B44A 1W5TA 3CQZJ 4I09A 4Y13A 1FP2A 3QOPA 1LVAA 1HXDA 2MC4A 1MMSA 2OZUA 5EZHA 1RUOA 5EGOA 1XB4A 2E35A 1HLVA 1S29A 1U5TA 1UELB 2YUSA 5HLGA 4DNCA 1YX5A 3NEUA 2X1CA 4LJZF 2EZIA 1ERDA 4RGUA 2EILH 1VQ5I 2CQKA 2VXDA 4A3BJ 2JA6J 3QYEA 1F1ZA 1FOXA 2OV7A 3OYCA 2YR2A 1SVOA 4KIBA 3HG9A 2QZ8A 3T8RA 4WWCA 2LNBA 4PK4A 2IRFG 1MSEC 2EZHA 1A35A 4HQEA 2D2WA 2V9VA 4HPQA 2CG4A 2OD5A 2WY7Q 3IH3A 2KZVA 1QBJA 3H9GA 2VKHA 4LG0A 4E7HA 3GCMA 3ZQCA 2CU7A 3S3OA 2A05A 2OQGA 2X1DA 3I54A 4UY8I 2DQRA 3SFZA 3BR6A 1RZ4A 3HTUA 2YPRA 1G3YA 1ORKA 4ON0A 2Q0OA 3JRIA 3DXJF 1K6OA 2M0MA 2BGCA 3OIOA 1TNTA 1T8IA 3WTWC 3PIPF 4UUVA 4XOTA 3MZYA 2WAFA 2FUG2 1F4KA 1HW1A 2IT0A 1QHHD 1X58A 1QNTA 1D1CA 2EV6A 2R5YB 1AA7A 3WHCA 4BXXJ 5ICEA 4RB3C 2COBA 2M87A 3O8HA 4ZYAA 2A61A 3HHHA 3WODF 1O3TA 5FGMA 4F93B 5K5OA 3ZPLA 3ZQGA 1W0UA 2L7FP 3FX3A 3WE3A 4FTHA 2CUZA 3N05A 5EEHA 2CW7A 1N77A 3BZKA 5IYCJ 2CYYA 5E8IA 5B1AH 5B66C 1N75A 2HTSA 2FSWA 2QQAA 2LSOA 5HDKA 4S0HB 1V4RA 3EYYA 3FXRA 2LTPA 4S05A 2QLZA 3GZNB 3CTAA 2IS2A 2JWTA 1FX7A 4U87A 4L0ZB 1MBJA 1RI7A 3DBRB 1JHHA 3MMYB 3OYBA 4DGWB 4Z2YA 3KLNA 1ACIA 3F72A 4P96A 4CO8A 2QKLB 2V1NA 4AC0A 2XROA 2R7WA 2E2JJ 4HDVA 3JRBA 1I50J 5JVTA 4HQMA 3CUQC 5LHHA 2M0CA 1H0MA 2OA4A 3FKIJ 1IRZA 3WU0A 1G2HA 5D5XB 2R5YA 2DMNA 3G6EI 3LA2A 3O2PE 1VNDA 4EGYA 2MLKA 3DEWA 4Q5SF 1MNEA 3KIOA 4IXAA 4NC7A 3OYAA 1OQYA 3WTSC 2WC2A 2DJNA 2ZB9A 3DCFA 3BZ6A 4BYYA 1OR7A 1UCRA 2K02A 1QU3A 4U7DA 3L2VA 2DFEA 1WJFA 3A0BC 2HQNA 2ZXJA 2A68F 2VT2A 1OCCH 3P9KA 1FZPB 2DK8A 3OR1C 4L5IA 4F7ZA 1WPKA 1R23A 3L09A 1TZLA 4IRIA 2X6XA 2DT6A 3J80K 2JUCA 3HEFA 1Z6RA 5E3MA 2XGDA 3DBHB 3PNYA 2FA5A 2K86A 2R7XA 2BXYA 2DW4A 2XKPA 2OTLI 4HBLA 3TKYA 2Y75A 3K10A 1FOWA 1HSJA 2F4IA 2VJ5A 3BDDA 1E0EA 2JPBA 1P4WA 3MKLA 2VPLA 4II3A 3OIQA 4BJ5C 1O3QA 3U21A 2EINH 3TL4X 1JE8A 4EATA 3I59A 3QPHA 1DQUA 3SZPA 1MBGA 3QU6A 2FBIA 1P4XA 3EUAA 1YJ9I 3G1OA 2HOAA 1JUSA 3WHBA 3K2ZA 2MABA 4A6DA 1R1TA 2XAUA 1J5YA 4FHTA 1XCBA 1YHQI 3QRFF 2NNNA 4LG3A 4AIHA 4ENJA 1Y1VJ 4XSZF 3GTGJ 3VWBA 2D1VA 3HYIA 2UXNA 2RQQA 2WAQN 4F92B 2EBIA 2EZLA 3JSOA 4FCYA 1EV7A 4ENMA 2DU9A 4Q48A 4AU7A 2HDDA 1QHGA 3UNGC 4AYBN 4DW6A 3ML6A 4NDLA 3S32A 4CYDA 4EMSA 4E7ZA 2HZDA 4ZZLA 3MEXA 2QCOA 2QYOA 3FM5A 1WZ2A 3BQYA 4AYBA 3VYUB 3BROA 3R4KA 3ZCOA 2PJRB 2QSGX 1J09A 2IP2A 3ABUA 3E3VA 4KIGA 3FWEA 3BR5A 3RQIA 1UHMA 1P4AA 2DOFA 2CWEA 2JJ7A 1DU6A 4YFKF 5C4JJ 1FBSA 2ZSHB 3EUKL 1OPCA 2K9SA 1IJWC 3G1LA 3G3ZA 3HKZN 4NC6A 2FMYA 2LH9A 4RDUA 5LEJA 2LK2A 4I6ZA 1LFPA 2A6HF 2VQHA 4NQWA 2VBZA 3V8KA 4BBSJ 4XICA 1SD7A 1ZQ3P 2E34A 4H4KC 1H8AC 2Y31A 1P9QC 2HOEA 3A4CA 4LB6B 1FBQA 1YS7A 2PEXA 4DZPA 1AWCA 3GXOA 1UMQA 2DMUA 5JFRA 3X2QH 1B59A 1QZYA 2DA3A 1ZLJA 4HEA2 4BY7J 2NNYA 3Q9VA 1YRNB 1I39A 3GFLA 1P6RA 3OL3A 3CCMI 2CQXA 2DPUA 4P55A 5EDNA 1IXCA 3KZIC 3D5RC 2P5VA 2Q8KA 5E3NA 2RAEA 5F1RA 5KNLA 4F52A 4L5JA 3FKJA 2Z33A 3RKWA 1IDYA 3DLLF 1VF9A 4B8XA 1VQPI 4KUMA 3BTJA 3F9KA 1YO5C 4CXFA 1DPUA 1W0TA 5FKKA 2HS5A 4EGZA 3HTSB 1B72B 3HXLA 2F5CA 3TGNA 2DDAA 3U1DA 3LSIA 4UVCA 4RGRA 2Y0SN 1Z3XA 4IHSA 2P6SA 3OYGA 2E71A 4E7KA 1IUYA 1X3WB 1YYVA 3ASOH 2CQQA 1LQ1A 2X85A 2Y0SA 3J7YJ 1VFCA 2QGUA 2KIMA 1A04A 3GX4X 1VQ7I 4UNOA 3LQRA 2XGEA 1YRNA 5LLQA 3MKZA 2DDBA 5EEGA 3MVPA 2BXZA 5FO5A 3Q5FA 4ZC3A 1N25A 3WTZA 1LPQA 3OYJA 2CV2A 3TQNA 3N4MA 4E4HA 2XB0X 2AHQA 2LBFB 1MDMB 4YFXF 4M3GA 5EEAA 1HSTA 3WGIA 1JI8A 1X4OA 1TL8A 1DGWY 1FOYA 1F43A 2L9SA 1A5JA 1ZGJA 2V26A 2G9WA 1HQCA 4CDGA 3ZXSA 2HI3A 2JUGA 1JHFA 3I55I 1B9MA 1D1BA 3L2UA 5DCFA 1IZ1A 5E1XA 3OOUA 3CCVI 4RAYA 4AWXB 4E7SA 2DXIA 5L3FA 4HX8A 3FBNB 2R5ZB 3R60A 4BGDA 1ETOA 3HIFA 1VQMI 3ZOBA 3M1CA 2OJED 2DTZA 2Y69H 4M6VA 3ZMUA 5LHGA 3ONQA 4MHGA 4A3KJ 3N97A 1DP7P 3HRMA 1LEAA 1Y1WJ 2Y0MA 4KN4X 1X2NA 3D5SC 2Q2EB 2DYRH 4BHBA 1G8XA 3FK6A 3M1EA 3KEOA 2LBFA 3BCAA 4XRMA 1MDMA 1K7AA 2H8WA 3C2HA 4ITVA 1GVJA 2E19A 2QWWA 4HV6A 1ZR4A 1UFMA 5LD2C 4Y52J 2WY8Q 3GW2A 2PMZN 2HPIA 1A36A 5D5WB 2MGQA 3K0LA 1RR8C 2G7HA 3R0AA 1LDJA 1ZELA 4N4OB 2DJIA 3E0JB 2XGCA 3L2CA 2PMZA 2GIZA 1E17A 1TT0A 3FDYA 3OYLA 4I2OA 4RLFA 3IKVA 4PUSA 3BR0A 2L9NA 2R5ZA 1OMIA 4KA4A 4A3EJ 2I8DA 4FE7A 3ELKA 3OYMA 2GOXB 2VC0A 5D6FA 3SYTA 3FBIB 3AG2H 4Y3OA 4FX0A 4ABZA 3Q0VA 3ZN0A 2X0LA 3F22A 1MBKA 2H1KA 1R1UA 4XN3A 3ABLH 2HVSA 3DWLE 3WTXC 5IT9Z 1FP1D 3A0HC 5FD5A 1ZHFA 2EZKA 3CZ6A 3WG7H 4MLOA 4NC8A 2Y30A 1RUNA 2GM4A 4XKBA 3H3VK 1OR7C 3C2GA 1R49A 4I99C 3DEUA 1IRGA 2M3AA 5ILVA 1EH7A 2R7VA 4BKXA 1W5SA 4L0YB 4LD5A 3W2WA 3F0CA 2AQEA 4RMNA 3E1SA 4GGGA 4JX6A 5DTDA 2DAOA 3TEDA 2ZBKA 3TOBA 3SEZA 1P7IA 5TRDA 3C3WA 4EJOA 5BPIA 4OIPF 2IGOA 2P5KA 3CD6I 5CVJA 3GFJA 5TJJA 2WB1A 3AL0B 2FXAA 2BV6A 1ZRCA 3KZYA 3LMMA 3QP6A 3AFHA 3V8LA 2DA7A 5HNHA 3OSFA 4I98B 2IEKA 4HDUA 2ZJ2A 2L4MA 4F3QA 2A6EF 1T08B 3JREA 1TW3A 4CYCB 2FOKA 4L9VA 2NYXA 2ZMEB 2W7NA 2L2OA 4NBQA 3OV8A 4P9UA 3VYTB 2L9VA 4IKFA 4BH9A 3OR2C 2UZKA 2A5WA 1S8NA 4U0VA 2PQ8A 4MQ9F 2F5VA 1OKRA 3HHGA 1FTZA 4EM0B 2LG4A 3RZOJ 1UG0A 1Q1HA 2V6EA 4PZJA 3V7RA 2JMWA 4BU2A 1L0OC 2HQ5A 2AQFA 2VL8A 1YQAA 4N9HA 3VDXA 5JHFA 3B6AA 2L4AA 2BOLA 2RDPA 2CUFA 1WWXA 4HG2A 1I1SA 5F64A 2NOGA 1Y56A 1IGNA 2MBFA 5LFAA 4QSHA 5J4VA 2H27A 3KFWX 4NHJA 3GFIA 1G3WA 2XSDC 2XC7A 1R1VA 2HDCA 1O57A 2VE9A 4UVBA 4MTDA 3HOTA 2V7FA 1PDNC 1R5GA 2ELKA 1BI3A 5IPAA 3Q9SA 4QTRA 1Y0UA 1XSXA 1ZGWA 5F08A 4NB5A 2XHKA 3K4KA 3MKYB 4BY1J 2HKOA 4DYRA 4CYCA 1Z05A 1Z6TA 2ZMEA 4C3IJ 1X1PA 4YIFA 1WJBA 2QVOA 3W3CA 1W1WE 1O4XA 5HS7A 5EF6A 3A2KA 3RKQA 2D5VA 1J75A 1K83J 3PM1A 2P7CB 2DMPA 3EQLF 2DBBA 1R9TJ 1ZGAA 1IN4A 3TO9A 1MBHA 1OYWA 3CF5F 2QM3A 3FXMA 1MMNA 2YS9A 2IAIA 3ZR8X 3HBLA 3I56I 3VEPA 3BP8A 3BCBA 5E1ZB 2TCTA 2MLGA 2ISZA 3BC8A 4LK0F 4HNTA 5E1WA 2NOJB 3ZP5A 3H0GJ 3OIPA 1EH6A 1O7LA 4G12A 4B1RA 5GTHC 1DP3A 3E5UA 3ZMSA 2ZSIB 2H8RA 1QRYA 4YFNF 4LLLA 1WJEA 4GDFA 3JTHA 1YW8A 2KHMA 5IP6A 4GFBA 1Z91A 2Z16A 4KFCA 1SMTA 2UWMA 5DS9A 3HJEA 2GXGA 2BBYA 3E5XA 3R61A 3OYIA 1TP4A 2QKMB 5LRSA 4V19K 3HOVJ 3S2DJ 4PJNA 5JR3A 4OWRB 3KP7A 2JZYA 4YRVA 5J47A 2QEXI 2C6YA 2VODA 4MQVA 2B9SA 1NK2P 1S3JA 3COAC 3AKZA 1PJRA 2MFZA 2H09A 2ID3A 1KQ9A 2COMA 1IN8A 5CQEA 2MW8A 1NTCA 2W25A 3AAFA 1U78A 1K78B 1X1DA 5FFXA 1WJCA 2EV0A 1LUJB 1REPC 4OOIA 1V5GA 3DPUA 4OMYA 2GIVA 3M8JA 1IG7A 2W57A 5L3EA 1RIOH 2ADUA 3EPZA 4CZZA 4JX5A 1VI0A 3KPHA 2XGXA 4PDKA 4HW0A 2KJBA 4G6TB 1R4MB 1Y6IA 4JP0A 1I1GA 4EEFG 2STTA 5B1BH 1BW5A 1W36D 1K4TA 2IGMA 2F4OB 1R7JA 2Q1ZB 2W48A 1USSA 4YIIA 4UV9A 3UR3C 5FKOA 1HW5A 5IP7J 2VUMJ 3IP4B 5FD6A 4QIWN 2GWRA 3IC7A 1XGOA 2XF5A 2E1MB 3S2WA 2MD0A 2RN7A 3LA7A 3HOXJ 1FBUA 5HLIA 2LYCA 4F55A 2RVCA 4MNUA 1PUFB 4UUTA 2V9KA 4CCJA 2V1XA 1Z9CA 3FM3A 1K78A 2BVMA 3FMSA 2VPRA 4ZDPA 4BHPA 3W2AA 3VOEA 2DFFA 2K9NA 3G2BA 4KICA 4O6JA 3GZ6A 3TDUC 1RESA 2BW3A 3PSFA 4MFDA 1YIJI 2VI6A 3P9CA 2V79A 2W00A 2WADA 2O0YA 2NRAC 2X4HA 2EFQA 4MEYF 4J01A 4BDZA 2E36A 1DDNA 2M7AA 1SFOJ 3I5UA 4UXNA 1XGSA 4K2EA 4YEJA 5F0CA 2GXAA 4M71A 3FMRA 3K4CA 2EK5A 3WTVC 4PJLA 4ESBA 1IXSB 4BHCA 2CO5A 3M07A 1HA8A 3CCUI 3F8BA 3BTLA 3I3LA 1GT0C 2ZJRF 3PJRA 5FLXK 4XL9A 4RBOA 3KP2A 3PNTA 2X6YA 5KAIC 1R5HA 1EH8A 1MJAA 3DU6A 3MQ0A 1QZZA 1PUFA 1UZCA 3PNVA 2BYVE 4LMYA 2JRMA 2EFWA 1SAXA 2XF6A 2WTEA 1I27A 3B02A 3LAJA 1BBYA 3LOCA 5HVQC 3HOZJ 2JSCA 1P92A 5HOOA 5ED4A 4HA8A 3V8JA 4HV5A 3FIWA 1RETA 3ZQQA 3H9QA 2E60A 3K9TA 3W2VA 5BS6A 5KAFC 3F8MA 5F27A 3BZCA 2ID6A 1ZN2A 3NWSA 2HPMA 2O61A 4XRFA 2HTJA 3GVAA 2DA5A 2FBHA 3MZHA 4E7IA 5E17F 2AO9A 2HYJA 3IHUA 5IOYA 3DV8A 4RGSA 1YS6A 3DKYA 3J81K 3OYDA 1PP8F 3WE2A 1D0YA 1GDTA 1T33A 1XCVA 2EIJH 3DKWA 3ROUA 3DF8A 2MA3A 2MD5A 5A2QZ 3CESA 4XLAA 2GAUA 3MAJA 1TC3C 1Z7LA 4GO1A 5L3DA 2L9RA 1Y8RB 1MBFA 2UXXA 3DTKA 2LD5A 5CLSA 1TWAJ 1VQKI 2CUJA 2JT1A 2WV0A 4ZYEA 4XQFA 2XAQA 5HODA 1S72I 1JT0A 4G8XA 3T5XA 4G7HF 1SFXA 2F5EA 3V4GA 4KISA 4II2A 2XB5A 1U2WA 2VKVA 4IHTA 3HPGA 4BQNA 2R7QA 3RIRA 3SFIA 4M9SA 1R36A 4Y4RA 1SFUA 5AONA 2HDWA 1OCOH 1TWCJ 5C4XJ 2F2EA 4MO7A 4AVPA 3LFKA 1ETQA 3QOEA 4WK8F 1FT9A 4Y33A 4PCQA 2M34A 5J4YA 3HRTA 4UHTA 5DYMA 1JTYA 3SXYA 4U7BA 3AL0C 5KHDA 1M1EB 1Y0NA 3ZN1A 4QLCU 1ETVA 3JTGA 4G6QA 3CCSI 2GA1A 3OYHA 2KP6A 4M3BA 3BT9A 4KDPA 2QQ8A 3I4MJ 4HLYA 2E1OA 4WF2A 5FROA 4A3MJ 2PMHA 2ZMEC 2ETHA 1FYLA 2ELJA 3RSNA 3V7CA 3S15J 1J2XA 1JKPC 3QODA 2IGKA 1SFKA 1U8BA 1T98A 2HU9A 2CV0A 2O6GE 1E3PA 1S7OA 2JK3A 1ENHA 2P81A 2X9DA 4M3FA 1LVKA 4H0EA 4IVNA 1HKSA 4A5MA 2IVMA 2KKOA 1EA3A 2WAQA 4ZH4F 1ETYA 4EQQA 1SVLA 1HF0A 2BHZA 3L2QA 2OQRA 4YIRX 3MKWB 1LFBA 3HM5A 5BQTA 1E3OC 4M9ZA 1WHUA 3H5RA 2NVQJ 1OYIA 5CKTA 4PSXA 2CSOA 3QYFA 3WU2C 4EJTA 1TTYA 2FNAA 5EZGA 2P0WA 3RI4A 2E5NA 3JRCA 2PN6A 3HOSA 1B4AA 3QPTA 3ABKH 4RB2C 1JUMA 1XSDA 1W36C 2B63J 2GXBA 2R4GA 5F1JA 1XSVA 1C0WA 3FXJA 5D8KB 1R71A 3JRDA 1S7AA 4TV7A 4ZTJA 2LRDA 2IW5A 5CJ9A 1R22A 2KMUA 3HKZA 5E3OA 5GPAA 3CMEI 3JAMZ 5H6QA 3WTTC 2KRHA 3S17J 3RZDJ 1JKQC 3E6BA 5H2FC 1IC8A 3WGHA 3ERED 4KNYA 1G3TA 1VQLI 2L7KA 2M45A 4KJZA 4OINF 5GPCA 4O5VA 1VQ8I 3VSLA 2XVCA 3SDBA 5M5XJ 2A07F 2R92J 1D8JA 3SQNA 4FASD 1B6AA 4I7HA 2QSHX 4JK1X 2ESHA 2PJRA 2DA2A 1PUEE 4G6DA 1MH3A 3S2HJ 4PFPA 1FIAA 3IH4A 3L9FA 3WG9A 3CMYA 4ESJA 4GYGA 4ZTFA 2Y2ZA 1RR7A 3ULQB 2L5QA 2L02A 4ENNA 3RCOA 2I10A 1XX5A 1BN5A 1IUFA 2QENA 2UUZA 2WWYA 4A3JJ 2EB7A 1BA5A 3NARA 5HDGA 3GTMJ 2VE8A 3FHZA 1GV5A 4XONA 3DLAA 4YG2F 4ZYGA 2H6CA 3OSGA 3GLXA 2E2IJ 1ON2A 1OISA 4A0XA 3LSHA 3BR3A 4U88A 1AKHB 2RV8A 2W24A 2VKDA 3HOWJ 3ABTA 3BY6A 1UAAA 4OIQF 1ZRDA 2LY1A 5ILSA 2ZC2A 4EJWA 1JGGA 2R3SA 1PP7U 3OS0A 4BXUA 4JOMA 4Y15A 2CJJA 5ICFA 2STWA 2M8EA 1VQ6I 3TP3A 4D1QA 2K4BA 1H89C 3PSIA 5F04A 2DT5A 2K9QA 4BE2A 4IHXA 4RGXA 5J1YA 2CRGA 1RKTA 3CF2A 2DTRA 4ETSA 3H3ZA 3HOYJ 1TLHB 5K7FA 1Q1VA 3CC2I 2G0EA 3GTOJ 1B72A 2CW8A 2RGVA 3CDLA 5ILUA 1FWZA 1W5CC 1J0RA 1BI0A 1BIBA 1IRXA 1ZG3A 2A3SA 2E1MC 4XMYA 5IYDJ 3LSJA 1NG6A 4GRIA 2A5YB 2IS4A 2QA4I 1XN7A 4N9IA 2JQ7A 2H6BA 4RB1A 4RAFA 3ERMA 1J59A 4HSRA 5DD4A 1BC7C 4RM3A 3WU1B 3CO6C 2EV5A 2CMPA 3EUHC 4D9JA 1WKMA 2HFHA 2KRCA 2VB6A 3M9AA 1FPQA 2V6CA 3E97A 4RS8A 2R7DA 1MD0A 3NRVA 4LFUA 4OU0A 1TT5B 1GLNA 3F8NA 1KGSA 1I6HJ 2GOMA 3RPQA 1CGPA 2M4KA 1F5TA 5J3LA 1KONA 1UB9A 3GTKJ 3HDDA 1YITI 5JLWA 3FISA 3BG7A 3JR9A 4C3JJ 3ZGKA 2M4GA 5HS9A 1MNMC 2VJJA 4XM3A 1KU9A 4U0WA 3ASNH 2RNGA 1WI3A 1XMKA 4OAYA 3CMAI 4BACA 5D6EA 1VQ4I 2Z3YA 3K1NA 2DA6A 2DFIA 2JVGA 2X6WA 3W6KB 1IF1A 2KDZA 1EJ9A 4BQAA 3U1KA 3OYNA 2XV4S 4IQ4A 3V42A 2EA4A 1Z67A 2EA2A 1UJ8A 4X1EA 4L9NA 3ABMH 4Y7NJ 1HBXG 2XASA 3JSPA 2ISYA 5K1YA 3AG1H 2KIQA 4A3DJ 3IKTA 4ASNA 3BG6A 3V7SA 1GHCA 1GUUA 5E3LA 2Q2EA 5DCMB 4XN0A 1WQ2A 3L2RA 3K2AA 1AHDP 3W6VA 3E6DA 2LOOA 2OUMA 5K5RA 2R7ZJ 3QWLA 3RKXA 3J7AO 2RQPA 3FHNA 2K4JA 3P7NA 2EH3A 4GCVA 4OIRF 3VFZA 1BOAA 2DMTA 3LNQA 2CGPA 4J00A 2ZNYA 5E79C 5HNFA 4A3LJ 5LGNA 3FZVA 2DT7B 1T38A 3CC4I 2PX9A 2ZXIA 2V4JC 5FLVA 5FRNA 1YE9A 1MBEA 5FKNA 1J7KA 2PFBA 3SZTA 4BJTA 2GQQA 2ZNZA 5GAEJ 3TDZC 3KETA 2ZJQF 1VQNI 2O3FA 1L3LA 1XTAA 2M5WA 2IBDA 3PL8A 5D4RA 5DD8A 3LSMA 2G7UA 1MIJA 3I53A 1HC8A 2XPUA 1ZR2A 4G9YA 1D0XA 2XAHA 1T0FA 1VTNC 1KU2A 4A0YA 4IHVA 2ESNA 2DK5A 1YJWI 3LSTA 2OPTA 4I0BA 2LKXA 1NHAA 2LDUA 4ZYHA 1MW7A 2Z5UA 4MGRA 4MTEA 3C18A 1APLC 2P6TA 3CP2A 1D5YA 2H1LA 3F8CA 3TO6A 1MZBA 4I01A 1JGSA 2DODA 1RC9A 1I5ZA 4CCMA 4E6KG 1BR4A 3CCYA 3AG4H 4C3HJ 1KYZA 5JI6A 4G94A 1YTYA 1SC7A 1KU7A 1RRJA 1XG1A 4B43A 1UHSA 2KFDA 3QPLA 2OBPA 2E7WA 2R0QC 4F91B 3RYRA 2LKSA 2LF8A 2EFPA 4FQGA 5D5UB 2HOTA 1R6RA 1XPXA 1CF7B 3I58A 2FJ1A 1G59A 1G6NA 4ZDOA 5D8LB 3VB2A 3REOA 3OS2A 1U9NA 4D0PA 1FY7A 2Z1DA 1BJAA 2CUEA 1Y39A 4Q4ZF 3VYRB 1Z77A 4HYEA 2P7VB 3A02A 2R93J 1TBXA 4D5CA 3KYLA 1OLTA 2D1HA 1O3RA 5IT9K 1BIAA 5AIQA 1WSUA 2L54A 2JN6A 4HSTA 3MWMA 4P5OA 2IGNA 4CH7A 5DUIA 4XBFA 2KQRA 2XKOA 2VIXA 1ZARA 1KQ8A 1MMDA 1KA8A 3D1NI 2ZJPF 3GFMA 4J19A 1A6QA 1QQIA 5EYRA 1MKMA 3K4JA 1XDUA 3W6JB 5L3GA 4U0YA 1RNLA 3H1CA 5D5VB 4BS9A 1FYMA 3M7GA 3H35A 1KZHA 5C44J 1V5FA 4OAZA 2JA8J 2ME6A 4B09A 4IPAA 1CF7A 2R7OA 3NQOA 2K9LA 4GXOA 1JXSA 1XGNA 5F0FA 4R79A 3J7ZI 1FLIA 2M9HA 3JRHA 3GTJJ 2DI3A 5BOXA 4RM2A 4JYKA 3FXUA 3RYPA 1IRFA 1V5EA 4L9TA 2BE5F 4C30A 5J8FA 1ZTRA 3IRQA 1IV6A 3QAHA 1HDDC 2Y9YA 5J6XA 1A6IA 1XS9A 3EDPA 3BPVA 3TMOA 3K4MA 2OU2A 2HR3A 2VXZA 3TP0A 4LOCA 3GWZA 1ZKGA 4CGZA 3K1MA 3RPUA 4AIJA 1V55H 1WGXA 1OFCX 2HYFA 2MYSA 2BEOA 2LC2A 1POGA 5JLXA 5JHUA 1SD5A 3ZQLA 3HRSA 2HVRA 4IHYA 3F21A 1F36A 5LGTA 1BI1A 1S6LA 2X48A 1I3QJ 3KYCB 3KE2A 1LE8B 3C1DA 3QU3A 5F0HA 3LA3A 3MN2A 3G71I 3FMQA 1IV8A 1QPIA 1QPMA 4M9XA 2F5DA 1U5TB 1OCTC 1BW6A 3QQAA 3I0TA 4XKCA 4WCGA 3FXKA 4UB8C 3HRUA 2PLYA 3E6MA 3LFUA 3HSRA 1IN7A 1F9NA 3BLYA 4HNUA 1HCRA 4RLQA 1FSEA 4CA0A 5CVRA 1MJBA 3PO3J 3KZZA 1EF4A 5E8GA 2CFXA 4LK1F 1I3AA 3RPUD 3BJ6A 1MMGA 2XAFA 1IN5A 1YOVB 3HGYA 3I64A 2ECBA 5ERIA 3LSRA 2JTVA 1WRJA 4A6EA 1RKWA 1ZK8A 4XR6A 2F48A 3CO7C 3BJOA 4GYIA 2K5CA 4B3XA 1ETKA 3JRFA 4EV0A 3K7AJ 4KYWA 2WV1A 1N78A 3T0YA 2JA5J 1FC3A 4CCLA 1AU7A 4FETA 2OCEA 2MH9A 2ZXWH 1WH7A 1XC5A 2HKXA 1QVTA 2DO7A 1LE8A 1MMAA 1NG7A 3ZQIA 4BNCA 1OCRH 3U2RA 3E7LA 2MH2A 4JQFA 4UB6C 3WTUC 1W7PB 1YG2A 1ULYA 2HZTA 3HUGB 1V3FA 4PGGA 4BUPA 2KIUA 4MFEA 1P2FA 2OC6A 1IW7F 3KX2A 1H9GA 4ZYDA 2AS5F 3ZMZA 1DU0A 2ACJA 2L01A 3P5JA 4JBAA 1X2MA 3J80Z 3TW6A 1ZRFA 5FKMA 3CMMA 3K70D 2QBYB 1R4NB 2DA4A 2VN2A 2PBIA 1E2XA 1EKEA 3JW4A 1BJZA 2QUFA 2H94A 4EVIA 1CQTA 3ZQ7A 1E3HA 2KL4A 1PVEA 4KIFA 4BQOA 3EUHA 4PGHA 4D5FA 1Z21A 1YFHA 1KU3A 3L2WA 4KITB 2DOEA 2VONA 1VZ0A 2EIKH 1OCZH 4IRHA 4CSWA 2B7EA 1SMYF 1BC8C 2LLKA 4V2FA 2JVHA 2VQCA 1FMWA 2DQLA 3BJAA 5GP9A 4KMUX 4XRSG 3E6CC 5E18F 2M30A 4B3AA 1W7PA 4M72A 2IS1A 1IN6A 2QF7A 3HUGA 4QPOA 2UV1A 5K7HA 3PFYA 3L7WA 4OIOF 2AXLA 4CHUA 2A69F 2NXNB 2YX7A 4XLNF 2ZO4A 3I4PA 3ECOA 2VBXA 5J1UA 3H5NA 2QBYA 1Z0XA 4WXCA 4B48A 4E70A 2EJRA 1SEUA 1BL0A 1MSFC 3KP5A 4G7OF 4UVAA 3TO7A 2K40A 3SHFA 1T0FC 3JCUC 1OJLA 5EJCA 1T95A 2XF7A 3KP4A 3PO2J 4DJAA 1WH5A 3IWFA 3CJNA 5IT3A 4KT6A 3WTYC 1TQMA 3OL4A 1WJDA 2OTJI 3HL2A 2EFOA 3CDHA 2HEOA 2IA2A 3BR1A 4R8HA 1ON1A 1XDSA 1ODDA 1H88C 1FMVA 1WI9A 1HKQA 2V9PA 4A3CJ 2O03A 4C2MJ 2W84A 4XNFA 1JJ8C 1W7PD 3D5LA 4AD9A 4BAYA 1NK3P 2KLOA 3BG9A 4LGWA 5E20A 4BDYA 4LLNA 3I59B 2Z2SB 4HNVA 2OZ6A 4NNJA 4ZZDA 1BR2A 2X6OA 3O3KA 3MFKA 4DYQA 1GXPA 3CCJI 2NVTJ 3M8EA 5FJ8J 2XSJC 5HLTA 3A03A 2YSRA 4CCNA 2KRFA 5CPRB 2DYSH 3HGGA 3M4OJ 4XKVA 2KJCA 3HPHA 2LR8A 4HLXA 4PJMA 1ZG1A 4NUBA 5F6FA 2NS7A 1JKOC 2K85A 5H20A 1STZA 5GAGJ 1OYYA 2CFOA 1B8IB 3A1YA 2Y48A 5DV5A 2DMQA 2F5FA 2DFHA 2VKEA 2OF7A 1WFXA 1I6XA 3FXQA 3VYSB 3IUOA 5IOZA 3CLOA 3R0JA 4QWQA 1JT6A 3TW7A 2XUBA 4HOBA 5HLHA 4AIKA 3NAUA 2VOPA 2PG4A 2CQ7A 2ZCWA 2X51A 3QYBA 3K4BA 1P7JA 1WJAA 5HDNA 2HYGD 3HSEA 4P1WA 5M3MJ 3BQZA 1O7FA 3KP3A 3C7JA 3C2BA 4NQWB 3SEQA 3L00A 3H3UA 2LKPA 2PMUA 2FOWA 2FX0A 2BVLA 2FEZA 3DPLC 3QP5A 4IOCF 3CJTB 2Y9ZA 5A2QK 1RPWA 2DA1A 1U6GA 4DZJA 5DUKA 1J9IA 3IWZA 5CQGA 2M1BA 2K9MA 2HVQA 2BHYA 2M7BA 3ESWB 2ICWG 4IQJA 1K79A 1BR1A 2ZXHA 1YW7A 3GBGA 5DM7F 1HOMA 2XPVA 3DP7A 3HB9A 4A12A 5K7ZA 1B8IA 3F8FA 2HOSA 4DBRA 3J7AY 3RJPA 3DTEA 3LWFA 3IH2A 2NVXJ 2VQGA 4IRGA 6PAXA 5KCMA 3ZMTA 2FQ3A 2NAZA 3LL7A 3CUOA 4EM2A 2DOAA 1SANA 3OYKA 2IJLA 1B1BA 3WGGA 1FNNA 3KEYA 3KLOA 2TRTA 2D45A 2M2EA 2RC4A 3B6CA 4HF0A 4HAMA 5DDGA 2WBMA 2XAJA 3S14J 2EFNA 3K4NA 2L3DA 4PJJA 1FEXA 2JPCA 4IL6C 4WX9A 2LFBA 5LRRA 2K3FA 4DYCA 1SD4A 2FF4A 2XRLA 2VJ4A 3K1PA 2M8GX 2HQAA 1X3UA 1D1AA 1S7EA 4D7MA 4S04A 1LEBA 2XRNA 5FFZA 3KCCA 1TWHJ 1K61A 5J40A 3IV5A 1U8RA 2X1EA 2F6CA 4W1UA 4B47A 1KQ0A 2E1NA 1XD7A 1KYWA 2E7XA 4AM3A 3DPTA 3BPXA 3VSKA 2GLOA 5LBQA 2EPFA 1LJ9A 2LVSA 3OYFA 2RKHA 4C2UA 1O3SA 1NH3A 1X4PA 1BM9A 1Z7UA 2IA1A 4M6YA 4EJUA 4L18B 3K70C 5M5WJ 3H9JA 1JKRC 2CV1A 2YU9J 2NVYJ 4CCOA 1R58A 1U3EM 1JUPA 1Z3YA 3Q0WA 3JRAA 4IJAA 1ZAOA 1ETXA 2HXOA 3GZ5A 1DPRA 2VC1A 2ZFUA 2KIFA 5IYBJ 2DCEA 3F6VA 4FISA 1ZH5A 4ESFA 4HF1A 2CH0A 4A93J 2FD5A 2O9LA 1T39A 4IEJA 3GTPJ 1R00A 3ISPA 4OMZA 3F6OA 1B9NA 1U5TC 1T2KA 4DIQA 2O8KA 4C2TA 3AG3H 1D0ZA 1AOYA 4EJVA 2LY2A 4BEHB 3A01B 4CZCA 4Y17A 3OWTA 2VT3A 5KVRA 3O8GA 1PYVA 4DQ2A 4M74A 1X19A 3FF5A 3GO5A 5CYVA 1YI2I 1A31A 1DGRM 4A3FJ 2MC3A 2CS3A 4CCKA 3CCRI 1FYKA 1AKHA 2E5ZA 1G3SA 1TWGJ 2IPQX 1S9HA 1XMAA 4XSXF 3IRRA 2W1OA 3JAMK 1R5ID 4KT5C 2Z99A 4IX7A 5TGTA 5J8CA 1QGPA 3PUFA 3G73A 3DTIA 1BOBA 2HXIA 3SZGA 4C9YA 2R7RA 2ELHA 3ZRGA 1QA6A 2EIMH 4BJ6C 3S8PA 2N8GA 2ME0A 4I02A 3H36A 4N0BA 5GTIC 1LB2A 3IAS2 4DOZA 2QQ9A 4PJ0C 3CP8A 3GTLJ 2AXTC 1ITYA 5K5QA 2HWVA 3F3XA 2BY3A 3G4SI 2FU4A 1BI2A 3H92A 4BEHA 3A01A 1X1AA 3P9IA 1TNSA 2FMLA 3CC7I 4HX4A 3T1BA 4I0AA 3H5AA 3U9GA 2W4SA 4LIUA 2F4MB 1K4SA 4XLCA 4M73A 3FXOA 4RA2A 3S1RJ 4KN7X 4RB0A 3KEQA 2EQRA 3GEZA 2ZFWA 4XORA 2L7ZA 1MGTA 1TW2A 1G4DA 3Q3SA 3EYIA 5B5EC 2LP0A 3MZ8A 4AVZA 3PIOF 1H9TA 3FXLA 5LHIA 4HZFA 2EWNA 2MSYA 4FE4A 2KDOA 3RQ4A 5KK1A 4MEXF 1FTTA 2QQBA 3DBLB 3ZQFA 3OOPA 3ZMVA
chains in the Genus database with same CATH topology
3CUQB 2IA0A 2FE3A 2P5LC 3O6BB 5DEQA 1TQIA 1D3YA 4P9FA 1QO0D 1YW9A 1FSHA 3DFGA 3GUDA 2DPDA 4HX7A 5LEKA 1HKTA 3BOQA 2K7LA 3MCZA 4HF2A 1D5VA 2RNJA 5ICGA 5L3CA 4EM1A 2GZWA 3LAPA 2HQRA 5DCMA 4WXHA 2TDXA 2YX4A 5D4SA 4Q47A 3I71A 5FB2A 2Z9OA 3CUQA 2XAGA 3PQKA 3ZMDA 2VBYA 3PFIA 5LGUA 3LQQA 2FRHA 2PI0A 2P8TA 5H6RA 4ENKA 1ZREA 5BMZA 2GA2A 4R1HA 2W85A 4M6XA 1USTA 5CVVA 4WXDA 4UV8A 2J5OA 3B73A 1IAWA 3TOAA 4A2UA 1XGMA 1YLFA 4KMFA 1ZYRF 2VOOA 2FNPA 3HSFA 5CVIA 1ONVA 2B0LA 2NS0A 4XLPF 2OAZA 1SD6A 2ZKZA 1HW2A 1LDDA 2JRTA 2P4WA 3DQVC 1TQPA 2VBWA 2V1DA 1LDKB 2CW0F 2O8XA 4LB5A 3KP6A 1ZLKA 3D0SA 2XIGA 3F23A 1Z1DA 2PJPA 1FOKA 1ZG5A 2E1CA 1GXQA 5BPDA 3RTRA 3R6SA 4A5NA 3RDIA 4FX4A 1IXRC 3K69A 1UHWA 3PQJA 1DUXC 2FBKA 5FLXZ 1SFEA 3VODA 4L9JA 5L3BA 4LLGF 3ECHA 1MJ9A 2R7FA 3GYHX 2HGCA 1T6SA 3RKYA 5ICCA 1W4MA 4IF4A 4RAZA 2V1UA 3IL2A 5HS8A 3BWGA 3M8FA 2K27A 1D8KA 1LNWA 3J81Z 5AIPA 4A0ZA 4FT8A 4G7ZF 3GF2A 1YIOA 3E5QA 2LF7A 3EETA 2J5PA 4CICA 4LG0B 2DLLA 2YU3A 5CVUA 4O3MA 3T8TA 1W5TA 4I09A 4Y13A 1FP2A 3QOPA 1LVAA 1HXDA 2OZUA 1RUOA 1XB4A 1S29A 1U5TA 5HLGA 4DNCA 3NEUA 4LJZF 4RGUA 2CQKA 1F1ZA 2YR2A 4KIBA 3T8RA 2QZ8A 4WWCA 2LNBA 2IRFG 4HQEA 2D2WA 2V9VA 2CG4A 2OD5A 1QBJA 4LG0A 2OQGA 3I54A 2DQRA 3SFZA 3HTUA 1RZ4A 2YPRA 1G3YA 4ON0A 2Q0OA 1K6OA 3DXJF 2BGCA 1TNTA 3WTWC 4UUVA 3MZYA 1F4KA 2IT0A 1HW1A 1QNTA 2EV6A 5ICEA 4RB3C 2M87A 2A61A 3HHHA 3WODF 1O3TA 5FGMA 5K5OA 3ZPLA 3FX3A 3WE3A 5EEHA 2CYYA 5E8IA 2HTSA 2FSWA 2QQAA 2LSOA 5HDKA 1V4RA 3EYYA 3FXRA 4S05A 2QLZA 3CTAA 1FX7A 4L0ZB 1RI7A 1JHHA 4Z2YA 3KLNA 3F72A 4P96A 4CO8A 2XROA 4HDVA 5JVTA 4HQMA 3CUQC 5LHHA 1H0MA 2OA4A 3WU0A 5D5XB 3LA2A 3O2PE 4EGYA 2MLKA 4Q5SF 4IXAA 3WTSC 2WC2A 3BZ6A 4BYYA 1OR7A 1UCRA 2K02A 4U7DA 2ZXJA 2HQNA 2A68F 2VT2A 3P9KA 1FZPB 2DK8A 4L5IA 4F7ZA 1R23A 3L09A 4IRIA 3J80K 1Z6RA 2FA5A 2K86A 2DW4A 2XKPA 4HBLA 3TKYA 2Y75A 1HSJA 3BDDA 2JPBA 1P4WA 1O3QA 1JE8A 3I59A 3QPHA 3SZPA 3QU6A 2FBIA 1P4XA 3K2ZA 4A6DA 1R1TA 1J5YA 4FHTA 1XCBA 3QRFF 2NNNA 4AIHA 4ENJA 4XSZF 2D1VA 3HYIA 2UXNA 3JSOA 1EV7A 4ENMA 2DU9A 4Q48A 3ML6A 4CYDA 4EMSA 4ZZLA 3MEXA 2QYOA 3FM5A 3BROA 3R4KA 2IP2A 3E3VA 3ABUA 4KIGA 3FWEA 1UHMA 1P4AA 2CWEA 4YFKF 1FBSA 1OPCA 3G3ZA 2FMYA 5LEJA 2A6HF 4NQWA 2VBZA 3V8KA 1SD7A 2HOEA 4LB6B 1FBQA 1YS7A 2PEXA 1AWCA 3GXOA 5JFRA 1B59A 1QZYA 1ZLJA 2NNYA 3Q9VA 3GFLA 1P6RA 2DPUA 4P55A 1IXCA 2P5VA 2Q8KA 5F1RA 4L5JA 2Z33A 3RKWA 4B8XA 4KUMA 1YO5C 1DPUA 4CXFA 2HS5A 4EGZA 3HTSB 2F5CA 3TGNA 3U1DA 4UVCA 4RGRA 4IHSA 2P6SA 1IUYA 1YYVA 1LQ1A 2KIMA 1A04A 3GX4X 4UNOA 3LQRA 5LLQA 5EEGA 5FO5A 3Q5FA 3WTZA 3TQNA 3N4MA 1MDMB 4YFXF 1HSTA 3WGIA 1ZGJA 2G9WA 1HQCA 4CDGA 1JHFA 1B9MA 5DCFA 1IZ1A 5E1XA 4RAYA 4AWXB 5L3FA 4HX8A 3R60A 3HIFA 3ZMUA 5LHGA 4MHGA 3N97A 1DP7P 3HRMA 1LEAA 2Y0MA 4KN4X 4BHBA 3M1EA 3KEOA 1MDMA 1K7AA 1GVJA 2QWWA 4HV6A 1UFMA 3GW2A 5D5WB 3K0LA 2G7HA 3R0AA 1LDJA 3L2CA 1E17A 4I2OA 3IKVA 1OMIA 4KA4A 3ELKA 2VC0A 5D6FA 4FX0A 3ZN0A 2X0LA 3F22A 1R1UA 3WTXC 5IT9Z 1FP1D 5FD5A 1ZHFA 1RUNA 3DEUA 1IRGA 5ILVA 1EH7A 1W5SA 4L0YB 4LD5A 4GGGA 2DAOA 2ZBKA 3TOBA 5TRDA 3C3WA 4EJOA 5BPIA 4OIPF 2P5KA 5CVJA 3GFJA 5TJJA 2FXAA 2BV6A 1ZRCA 3KZYA 3QP6A 3V8LA 4I98B 4HDUA 2ZJ2A 2L4MA 2A6EF 1TW3A 2FOKA 4L9VA 2NYXA 2ZMEB 3OV8A 4P9UA 4BH9A 2UZKA 1S8NA 4U0VA 2PQ8A 4MQ9F 1OKRA 3HHGA 4EM0B 1Q1HA 4PZJA 3V7RA 1L0OC 1YQAA 4N9HA 2L4AA 2RDPA 1WWXA 1I1SA 5F64A 2MBFA 2H27A 3KFWX 4NHJA 3GFIA 1G3WA 1R1VA 2HDCA 1O57A 2VE9A 4UVBA 4MTDA 3HOTA 1PDNC 1R5GA 1BI3A 3Q9SA 1Y0UA 1XSXA 4NB5A 2XHKA 2HKOA 1Z05A 1Z6TA 2ZMEA 4YIFA 2QVOA 5HS7A 1J75A 2P7CB 3EQLF 2DBBA 1ZGAA 1IN4A 3TO9A 1OYWA 2QM3A 3VEPA 3BP8A 5E1ZB 2MLGA 2ISZA 4LK0F 5E1WA 3ZP5A 1EH6A 1O7LA 3E5UA 3ZMSA 4YFNF 4LLLA 3JTHA 1YW8A 1Z91A 4KFCA 1SMTA 2UWMA 2GXGA 2BBYA 3E5XA 3R61A 5LRSA 5JR3A 3KP7A 2JZYA 2C6YA 2VODA 4MQVA 1S3JA 3COAC 2H09A 1KQ9A 2COMA 1IN8A 3AAFA 2W25A 1U78A 1K78B 5FFXA 2EV0A 1REPC 4OOIA 4OMYA 2GIVA 2W57A 5L3EA 1RIOH 2ADUA 4CZZA 2XGXA 4PDKA 4HW0A 2KJBA 2STTA 1I1GA 1R7JA 1USSA 4YIIA 4UV9A 1HW5A 5FD6A 2GWRA 3IC7A 1XGOA 3S2WA 2RN7A 3LA7A 1FBUA 5HLIA 2RVCA 4MNUA 2V1XA 1Z9CA 3FM3A 1K78A 3FMSA 4BHPA 3VOEA 4KICA 3GZ6A 4O6JA 3TDUC 3P9CA 2V79A 2O0YA 2NRAC 2X4HA 2EFQA 4MEYF 1DDNA 3I5UA 4UXNA 1XGSA 4K2EA 4M71A 3FMRA 2EK5A 3WTVC 4ESBA 1IXSB 4BHCA 2CO5A 3F8BA 5FLXK 3KP2A 1R5HA 1EH8A 1MJAA 3MQ0A 1QZZA 2BYVE 4LMYA 2EFWA 1SAXA 2WTEA 1I27A 3B02A 3LAJA 1BBYA 5HVQC 2JSCA 1P92A 5HOOA 5ED4A 4HA8A 3V8JA 4HV5A 3K9TA 5BS6A 3F8MA 1ZN2A 2O61A 4XRFA 2HTJA 3GVAA 2FBHA 5E17F 3MZHA 3IHUA 3DV8A 4RGSA 1YS6A 3J81K 1PP8F 3WE2A 1XCVA 3DKWA 3ROUA 3DF8A 2MA3A 2MD5A 5A2QZ 2GAUA 3MAJA 4GO1A 5L3DA 2UXXA 5CLSA 2JT1A 2WV0A 4ZYEA 2XAQA 4G8XA 3T5XA 4G7HF 1SFXA 2F5EA 3V4GA 1U2WA 4IHTA 3RIRA 4M9SA 1R36A 1SFUA 5AONA 2F2EA 4AVPA 3LFKA 4WK8F 1FT9A 4PCQA 3HRTA 4UHTA 5DYMA 3SXYA 4U7BA 3ZN1A 4QLCU 3JTGA 4G6QA 2GA1A 4KDPA 4HLYA 4WF2A 2PMHA 2ETHA 1FYLA 3V7CA 1J2XA 1T98A 2O6GE 1S7OA 4H0EA 4IVNA 1HKSA 4A5MA 2IVMA 2KKOA 4ZH4F 4EQQA 2OQRA 5BQTA 4M9ZA 1OYIA 2CSOA 4EJTA 1TTYA 2FNAA 3RI4A 2PN6A 3HOSA 1B4AA 3QPTA 4RB2C 1XSDA 2GXBA 1C0WA 1XSVA 5D8KB 1S7AA 4TV7A 2IW5A 5CJ9A 1R22A 3JAMZ 5H6QA 3WTTC 3E6BA 3WGHA 3ERED 4KNYA 1G3TA 2M45A 4OINF 4O5VA 2XVCA 2A07F 1D8JA 3SQNA 1B6AA 4I7HA 4JK1X 2ESHA 1PUEE 4G6DA 3L9FA 3WG9A 4ESJA 4GYGA 3ULQB 2L02A 4ENNA 1BN5A 2QENA 2WWYA 2EB7A 5HDGA 2VE8A 3FHZA 4YG2F 4ZYGA 2H6CA 3GLXA 1ON2A 4A0XA 4U88A 2RV8A 2W24A 3ABTA 3BY6A 4OIQF 1ZRDA 5ILSA 4EJWA 2R3SA 1PP7U 4BXUA 4Y15A 5ICFA 2STWA 2M8EA 2K4BA 2DT5A 4RGXA 2DTRA 4ETSA 3H3ZA 1TLHB 2RGVA 5ILUA 2A3SA 1FWZA 1ZG3A 1J0RA 1BIBA 1BI0A 2A5YB 1XN7A 4N9IA 2H6BA 4RB1A 1J59A 5DD4A 1BC7C 3WU1B 3CO6C 2EV5A 1WKMA 2HFHA 3M9AA 1FPQA 2V6CA 3E97A 4RS8A 4OU0A 2R7DA 1MD0A 3NRVA 4LFUA 3F8NA 1KGSA 3RPQA 1CGPA 1F5TA 1UB9A 5HS9A 1KU9A 4U0WA 1XMKA 5D6EA 2Z3YA 3K1NA 2DFIA 3W6KB 1IF1A 4BQAA 2XV4S 2EA4A 2EA2A 4L9NA 1HBXG 2XASA 3JSPA 2ISYA 5K1YA 3IKTA 4ASNA 3V7SA 1GHCA 2Q2EA 5DCMB 1WQ2A 3E6DA 5K5RA 3RKXA 3J7AO 2RQPA 2K4JA 3P7NA 4GCVA 4OIRF 3VFZA 1BOAA 2CGPA 2ZNYA 5LGNA 3FZVA 1T38A 1J7KA 2PFBA 3SZTA 2GQQA 2ZNZA 3TDZC 3KETA 2O3FA 1L3LA 2M5WA 5D4RA 5DD8A 2G7UA 3I53A 4G9YA 2XAHA 1T0FA 1VTNC 1KU2A 4A0YA 2ESNA 2DK5A 3LSTA 4I0BA 1NHAA 2LDUA 4ZYHA 2Z5UA 4MGRA 4MTEA 3C18A 2P6TA 3F8CA 3TO6A 1MZBA 4I01A 1JGSA 1I5ZA 1KYZA 5JI6A 4G94A 1YTYA 1KU7A 2OBPA 2E7WA 3RYRA 2LF8A 2EFPA 5D5UB 1CF7B 3I58A 1G6NA 5D8LB 3VB2A 3REOA 4D0PA 1FY7A 1BJAA 4Q4ZF 4HYEA 2P7VB 1TBXA 2D1HA 1O3RA 5IT9K 1BIAA 5AIQA 1WSUA 2L54A 3MWMA 4P5OA 5DUIA 4XBFA 2XKOA 1ZARA 1KQ8A 1KA8A 3GFMA 1QQIA 1MKMA 3W6JB 1XDUA 4U0YA 5L3GA 1RNLA 5D5VB 1FYMA 3M7GA 4B09A 4IPAA 1CF7A 3NQOA 4GXOA 1JXSA 1XGNA 4R79A 1FLIA 2DI3A 5BOXA 3FXUA 3RYPA 1IRFA 4L9TA 2BE5F 5J8FA 3IRQA 3QAHA 5J6XA 3EDPA 3BPVA 2OU2A 2HR3A 2VXZA 3GWZA 4CGZA 3K1MA 3RPUA 4AIJA 2HYFA 2BEOA 5JHUA 1SD5A 3HRSA 3F21A 5LGTA 1BI1A 1S6LA 3KE2A 3C1DA 3QU3A 3LA3A 3FMQA 1QPMA 4M9XA 2F5DA 1U5TB 3I0TA 4WCGA 3HRUA 2PLYA 3E6MA 3HSRA 1IN7A 1F9NA 1FSEA 5CVRA 1MJBA 3KZZA 5E8GA 2CFXA 4LK1F 3BJ6A 2XAFA 1IN5A 3I64A 5ERIA 2JTVA 1WRJA 4A6EA 3CO7C 3BJOA 4GYIA 4EV0A 4KYWA 3T0YA 1FC3A 2MH9A 2HKXA 2DO7A 4BNCA 3U2RA 2MH2A 4JQFA 3WTUC 1W7PB 1YG2A 1ULYA 2HZTA 1V3FA 4PGGA 2KIUA 1P2FA 1IW7F 1H9GA 4ZYDA 2AS5F 3ZMZA 2ACJA 2L01A 4JBAA 3J80Z 1ZRFA 2QBYB 2VN2A 2PBIA 1E2XA 3JW4A 2QUFA 2H94A 4EVIA 3ZQ7A 4KIFA 3EUHA 4PGHA 1YFHA 1KU3A 2VONA 4IRHA 1SMYF 1BC8C 2DQLA 3BJAA 4KMUX 3E6CC 5E18F 2M30A 1W7PA 4M72A 1IN6A 3HUGA 3L7WA 4OIOF 2AXLA 4CHUA 2A69F 2YX7A 4XLNF 2ZO4A 3I4PA 3ECOA 2VBXA 2QBYA 4WXCA 4E70A 2EJRA 3KP5A 4G7OF 4UVAA 3TO7A 3SHFA 3KP4A 3IWFA 3CJNA 5IT3A 3WTYC 1TQMA 2EFOA 3CDHA 2HEOA 2IA2A 4R8HA 1ON1A 1XDSA 1ODDA 1WI9A 1HKQA 2O03A 2W84A 1W7PD 3D5LA 4AD9A 4BAYA 5E20A 4LGWA 4LLNA 3I59B 2OZ6A 4ZZDA 3O3KA 3MFKA 1GXPA 3M8EA 2YSRA 2KRFA 2KJCA 4HLXA 1ZG1A 5F6FA 5H20A 1STZA 1OYYA 2Y48A 5DV5A 2F5FA 3FXQA 1I6XA 3CLOA 3R0JA 4QWQA 2XUBA 4HOBA 5HLHA 4AIKA 2VOPA 2PG4A 2ZCWA 5HDNA 2HYGD 3HSEA 1O7FA 3KP3A 3C7JA 3L00A 3H3UA 2LKPA 2PMUA 2FEZA 3DPLC 3QP5A 5A2QK 1U6GA 5DUKA 1J9IA 3IWZA 2M1BA 1K79A 1YW7A 3DP7A 4A12A 3F8FA 3RJPA 3LWFA 4IRGA 6PAXA 3ZMTA 2FQ3A 2NAZA 3CUOA 4EM2A 2IJLA 1B1BA 3WGGA 1FNNA 3KLOA 2D45A 2RC4A 4HF0A 4HAMA 5DDGA 2XAJA 2EFNA 2L3DA 2JPCA 4WX9A 5LRRA 1SD4A 2FF4A 3K1PA 1X3UA 1LEBA 4S04A 2XRNA 5FFZA 3KCCA 1U8RA 1KQ0A 2E1NA 1XD7A 1KYWA 2E7XA 3DPTA 3BPXA 5LBQA 1LJ9A 2RKHA 1O3SA 1Z7UA 1BM9A 2IA1A 4M6YA 4EJUA 4L18B 1R58A 1U3EM 4IJAA 1ZAOA 3GZ5A 1DPRA 2VC1A 2KIFA 3F6VA 1ZH5A 4ESFA 4HF1A 1T39A 1R00A 3ISPA 4OMZA 3F6OA 1B9NA 1U5TC 1T2KA 1AOYA 4EJVA 4Y17A 2VT3A 5KVRA 4DQ2A 4M74A 3FF5A 3GO5A 5CYVA 2MC3A 1FYKA 1G3SA 2IPQX 1XMAA 3IRRA 4XSXF 3JAMK 4KT5C 2Z99A 5J8CA 1QGPA 3G73A 2ELHA 4I02A 4N0BA 1LB2A 2QQ9A 5K5QA 2HWVA 3F3XA 2FU4A 1BI2A 3H92A 3P9IA 1TNSA 2FMLA 4HX4A 3T1BA 4I0AA 3U9GA 4M73A 4KN7X 4RB0A 3KEQA 3GEZA 2ZFWA 1MGTA 1TW2A 1G4DA 3EYIA 1H9TA 5LHIA 4HZFA 2EWNA 5KK1A 4MEXF 2QQBA 3OOPA 3ZMVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CUQ B;  2IA0 A;  2FE3 A;  2P5L C;  3O6B B;  5DEQ A;  1TQI A;  1D3Y A;  4P9F A;  1QO0 D;  1YW9 A;  1FSH A;  3DFG A;  3GUD A;  2DPD A;  4HX7 A;  5LEK A;  1HKT A;  3BOQ A;  2K7L A;  3MCZ A;  4HF2 A;  1D5V A;  2RNJ A;  5ICG A;  5L3C A;  4EM1 A;  2GZW A;  3LAP A;  2HQR A;  5DCM A;  4WXH A;  2TDX A;  2YX4 A;  5D4S A;  4Q47 A;  3I71 A;  5FB2 A;  2Z9O A;  3CUQ A;  2XAG A;  3PQK A;  3ZMD A;  2VBY A;  3PFI A;  5LGU A;  3LQQ A;  2FRH A;  2PI0 A;  2P8T A;  5H6R A;  4ENK A;  1ZRE A;  5BMZ A;  2GA2 A;  4R1H A;  2W85 A;  4M6X A;  1UST A;  5CVV A;  4WXD A;  4UV8 A;  2J5O A;  3B73 A;  1IAW A;  3TOA A;  4A2U A;  1XGM A;  1YLF A;  4KMF A;  1ZYR F;  2VOO A;  2FNP A;  3HSF A;  5CVI A;  1ONV A;  2B0L A;  2NS0 A;  4XLP F;  2OAZ A;  1SD6 A;  2ZKZ A;  1HW2 A;  1LDD A;  2JRT A;  2P4W A;  3DQV C;  1TQP A;  2VBW A;  2V1D A;  1LDK B;  2CW0 F;  2O8X A;  4LB5 A;  3KP6 A;  1ZLK A;  3D0S A;  2XIG A;  3F23 A;  1Z1D A;  2PJP A;  1FOK A;  1ZG5 A;  2E1C A;  1GXQ A;  5BPD A;  3RTR A;  3R6S A;  4A5N A;  3RDI A;  4FX4 A;  1IXR C;  3K69 A;  1UHW A;  3PQJ A;  1DUX C;  2FBK A;  5FLX Z;  1SFE A;  3VOD A;  4L9J A;  5L3B A;  4LLG F;  3ECH A;  1MJ9 A;  2R7F A;  3GYH X;  2HGC A;  1T6S A;  3RKY A;  5ICC A;  1W4M A;  4IF4 A;  4RAZ A;  2V1U A;  3IL2 A;  5HS8 A;  3BWG A;  3M8F A;  2K27 A;  1D8K A;  1LNW A;  3J81 Z;  5AIP A;  4A0Z A;  4FT8 A;  4G7Z F;  3GF2 A;  1YIO A;  3E5Q A;  2LF7 A;  3EET A;  2J5P A;  4CIC A;  4LG0 B;  2DLL A;  2YU3 A;  5CVU A;  4O3M A;  3T8T A;  1W5T A;  4I09 A;  4Y13 A;  1FP2 A;  3QOP A;  1LVA A;  1HXD A;  2OZU A;  1RUO A;  1XB4 A;  1S29 A;  1U5T A;  5HLG A;  4DNC A;  3NEU A;  4LJZ F;  4RGU A;  2CQK A;  1F1Z A;  2YR2 A;  4KIB A;  3T8R A;  2QZ8 A;  4WWC A;  2LNB A;  2IRF G;  4HQE A;  2D2W A;  2V9V A;  2CG4 A;  2OD5 A;  1QBJ A;  4LG0 A;  2OQG A;  3I54 A;  2DQR A;  3SFZ A;  3HTU A;  1RZ4 A;  2YPR A;  1G3Y A;  4ON0 A;  2Q0O A;  1K6O A;  3DXJ F;  2BGC A;  1TNT A;  3WTW C;  4UUV A;  3MZY A;  1F4K A;  2IT0 A;  1HW1 A;  1QNT A;  2EV6 A;  5ICE A;  4RB3 C;  2M87 A;  2A61 A;  3HHH A;  3WOD F;  1O3T A;  5FGM A;  5K5O A;  3ZPL A;  3FX3 A;  3WE3 A;  5EEH A;  2CYY A;  5E8I A;  2HTS A;  2FSW A;  2QQA A;  2LSO A;  5HDK A;  1V4R A;  3EYY A;  3FXR A;  4S05 A;  2QLZ A;  3CTA A;  1FX7 A;  4L0Z B;  1RI7 A;  1JHH A;  4Z2Y A;  3KLN A;  3F72 A;  4P96 A;  4CO8 A;  2XRO A;  4HDV A;  5JVT A;  4HQM A;  3CUQ C;  5LHH A;  1H0M A;  2OA4 A;  3WU0 A;  5D5X B;  3LA2 A;  3O2P E;  4EGY A;  2MLK A;  4Q5S F;  4IXA A;  3WTS C;  2WC2 A;  3BZ6 A;  4BYY A;  1OR7 A;  1UCR A;  2K02 A;  4U7D A;  2ZXJ A;  2HQN A;  2A68 F;  2VT2 A;  3P9K A;  1FZP B;  2DK8 A;  4L5I A;  4F7Z A;  1R23 A;  3L09 A;  4IRI A;  3J80 K;  1Z6R A;  2FA5 A;  2K86 A;  2DW4 A;  2XKP A;  4HBL A;  3TKY A;  2Y75 A;  1HSJ A;  3BDD A;  2JPB A;  1P4W A;  1O3Q A;  1JE8 A;  3I59 A;  3QPH A;  3SZP A;  3QU6 A;  2FBI A;  1P4X A;  3K2Z A;  4A6D A;  1R1T A;  1J5Y A;  4FHT A;  1XCB A;  3QRF F;  2NNN A;  4AIH A;  4ENJ A;  4XSZ F;  2D1V A;  3HYI A;  2UXN A;  3JSO A;  1EV7 A;  4ENM A;  2DU9 A;  4Q48 A;  3ML6 A;  4CYD A;  4EMS A;  4ZZL A;  3MEX A;  2QYO A;  3FM5 A;  3BRO A;  3R4K A;  2IP2 A;  3E3V A;  3ABU A;  4KIG A;  3FWE A;  1UHM A;  1P4A A;  2CWE A;  4YFK F;  1FBS A;  1OPC A;  3G3Z A;  2FMY A;  5LEJ A;  2A6H F;  4NQW A;  2VBZ A;  3V8K A;  1SD7 A;  2HOE A;  4LB6 B;  1FBQ A;  1YS7 A;  2PEX A;  1AWC A;  3GXO A;  5JFR A;  1B59 A;  1QZY A;  1ZLJ A;  2NNY A;  3Q9V A;  3GFL A;  1P6R A;  2DPU A;  4P55 A;  1IXC A;  2P5V A;  2Q8K A;  5F1R A;  4L5J A;  2Z33 A;  3RKW A;  4B8X A;  4KUM A;  1YO5 C;  1DPU A;  4CXF A;  2HS5 A;  4EGZ A;  3HTS B;  2F5C A;  3TGN A;  3U1D A;  4UVC A;  4RGR A;  4IHS A;  2P6S A;  1IUY A;  1YYV A;  1LQ1 A;  2KIM A;  1A04 A;  3GX4 X;  4UNO A;  3LQR A;  5LLQ A;  5EEG A;  5FO5 A;  3Q5F A;  3WTZ A;  3TQN A;  3N4M A;  1MDM B;  4YFX F;  1HST A;  3WGI A;  1ZGJ A;  2G9W A;  1HQC A;  4CDG A;  1JHF A;  1B9M A;  5DCF A;  1IZ1 A;  5E1X A;  4RAY A;  4AWX B;  5L3F A;  4HX8 A;  3R60 A;  3HIF A;  3ZMU A;  5LHG A;  4MHG A;  3N97 A;  1DP7 P;  3HRM A;  1LEA A;  2Y0M A;  4KN4 X;  4BHB A;  3M1E A;  3KEO A;  1MDM A;  1K7A A;  1GVJ A;  2QWW A;  4HV6 A;  1UFM A;  3GW2 A;  5D5W B;  3K0L A;  2G7H A;  3R0A A;  1LDJ A;  3L2C A;  1E17 A;  4I2O A;  3IKV A;  1OMI A;  4KA4 A;  3ELK A;  2VC0 A;  5D6F A;  4FX0 A;  3ZN0 A;  2X0L A;  3F22 A;  1R1U A;  3WTX C;  5IT9 Z;  1FP1 D;  5FD5 A;  1ZHF A;  1RUN A;  3DEU A;  1IRG A;  5ILV A;  1EH7 A;  1W5S A;  4L0Y B;  4LD5 A;  4GGG A;  2DAO A;  2ZBK A;  3TOB A;  5TRD A;  3C3W A;  4EJO A;  5BPI A;  4OIP F;  2P5K A;  5CVJ A;  3GFJ A;  5TJJ A;  2FXA A;  2BV6 A;  1ZRC A;  3KZY A;  3QP6 A;  3V8L A;  4I98 B;  4HDU A;  2ZJ2 A;  2L4M A;  2A6E F;  1TW3 A;  2FOK A;  4L9V A;  2NYX A;  2ZME B;  3OV8 A;  4P9U A;  4BH9 A;  2UZK A;  1S8N A;  4U0V A;  2PQ8 A;  4MQ9 F;  1OKR A;  3HHG A;  4EM0 B;  1Q1H A;  4PZJ A;  3V7R A;  1L0O C;  1YQA A;  4N9H A;  2L4A A;  2RDP A;  1WWX A;  1I1S A;  5F64 A;  2MBF A;  2H27 A;  3KFW X;  4NHJ A;  3GFI A;  1G3W A;  1R1V A;  2HDC A;  1O57 A;  2VE9 A;  4UVB A;  4MTD A;  3HOT A;  1PDN C;  1R5G A;  1BI3 A;  3Q9S A;  1Y0U A;  1XSX A;  4NB5 A;  2XHK A;  2HKO A;  1Z05 A;  1Z6T A;  2ZME A;  4YIF A;  2QVO A;  5HS7 A;  1J75 A;  2P7C B;  3EQL F;  2DBB A;  1ZGA A;  1IN4 A;  3TO9 A;  1OYW A;  2QM3 A;  3VEP A;  3BP8 A;  5E1Z B;  2MLG A;  2ISZ A;  4LK0 F;  5E1W A;  3ZP5 A;  1EH6 A;  1O7L A;  3E5U A;  3ZMS A;  4YFN F;  4LLL A;  3JTH A;  1YW8 A;  1Z91 A;  4KFC A;  1SMT A;  2UWM A;  2GXG A;  2BBY A;  3E5X A;  3R61 A;  5LRS A;  5JR3 A;  3KP7 A;  2JZY A;  2C6Y A;  2VOD A;  4MQV A;  1S3J A;  3COA C;  2H09 A;  1KQ9 A;  2COM A;  1IN8 A;  3AAF A;  2W25 A;  1U78 A;  1K78 B;  5FFX A;  2EV0 A;  1REP C;  4OOI A;  4OMY A;  2GIV A;  2W57 A;  5L3E A;  1RIO H;  2ADU A;  4CZZ A;  2XGX A;  4PDK A;  4HW0 A;  2KJB A;  2STT A;  1I1G A;  1R7J A;  1USS A;  4YII A;  4UV9 A;  1HW5 A;  5FD6 A;  2GWR A;  3IC7 A;  1XGO A;  3S2W A;  2RN7 A;  3LA7 A;  1FBU A;  5HLI A;  2RVC A;  4MNU A;  2V1X A;  1Z9C A;  3FM3 A;  1K78 A;  3FMS A;  4BHP A;  3VOE A;  4KIC A;  3GZ6 A;  4O6J A;  3TDU C;  3P9C A;  2V79 A;  2O0Y A;  2NRA C;  2X4H A;  2EFQ A;  4MEY F;  1DDN A;  3I5U A;  4UXN A;  1XGS A;  4K2E A;  4M71 A;  3FMR A;  2EK5 A;  3WTV C;  4ESB A;  1IXS B;  4BHC A;  2CO5 A;  3F8B A;  5FLX K;  3KP2 A;  1R5H A;  1EH8 A;  1MJA A;  3MQ0 A;  1QZZ A;  2BYV E;  4LMY A;  2EFW A;  1SAX A;  2WTE A;  1I27 A;  3B02 A;  3LAJ A;  1BBY A;  5HVQ C;  2JSC A;  1P92 A;  5HOO A;  5ED4 A;  4HA8 A;  3V8J A;  4HV5 A;  3K9T A;  5BS6 A;  3F8M A;  1ZN2 A;  2O61 A;  4XRF A;  2HTJ A;  3GVA A;  2FBH A;  5E17 F;  3MZH A;  3IHU A;  3DV8 A;  4RGS A;  1YS6 A;  3J81 K;  1PP8 F;  3WE2 A;  1XCV A;  3DKW A;  3ROU A;  3DF8 A;  2MA3 A;  2MD5 A;  5A2Q Z;  2GAU A;  3MAJ A;  4GO1 A;  5L3D A;  2UXX A;  5CLS A;  2JT1 A;  2WV0 A;  4ZYE A;  2XAQ A;  4G8X A;  3T5X A;  4G7H F;  1SFX A;  2F5E A;  3V4G A;  1U2W A;  4IHT A;  3RIR A;  4M9S A;  1R36 A;  1SFU A;  5AON A;  2F2E A;  4AVP A;  3LFK A;  4WK8 F;  1FT9 A;  4PCQ A;  3HRT A;  4UHT A;  5DYM A;  3SXY A;  4U7B A;  3ZN1 A;  4QLC U;  3JTG A;  4G6Q A;  2GA1 A;  4KDP A;  4HLY A;  4WF2 A;  2PMH A;  2ETH A;  1FYL A;  3V7C A;  1J2X A;  1T98 A;  2O6G E;  1S7O A;  4H0E A;  4IVN A;  1HKS A;  4A5M A;  2IVM A;  2KKO A;  4ZH4 F;  4EQQ A;  2OQR A;  5BQT A;  4M9Z A;  1OYI A;  2CSO A;  4EJT A;  1TTY A;  2FNA A;  3RI4 A;  2PN6 A;  3HOS A;  1B4A A;  3QPT A;  4RB2 C;  1XSD A;  2GXB A;  1C0W A;  1XSV A;  5D8K B;  1S7A A;  4TV7 A;  2IW5 A;  5CJ9 A;  1R22 A;  3JAM Z;  5H6Q A;  3WTT C;  3E6B A;  3WGH A;  3ERE D;  4KNY A;  1G3T A;  2M45 A;  4OIN F;  4O5V A;  2XVC A;  2A07 F;  1D8J A;  3SQN A;  1B6A A;  4I7H A;  4JK1 X;  2ESH A;  1PUE E;  4G6D A;  3L9F A;  3WG9 A;  4ESJ A;  4GYG A;  3ULQ B;  2L02 A;  4ENN A;  1BN5 A;  2QEN A;  2WWY A;  2EB7 A;  5HDG A;  2VE8 A;  3FHZ A;  4YG2 F;  4ZYG A;  2H6C A;  3GLX A;  1ON2 A;  4A0X A;  4U88 A;  2RV8 A;  2W24 A;  3ABT A;  3BY6 A;  4OIQ F;  1ZRD A;  5ILS A;  4EJW A;  2R3S A;  1PP7 U;  4BXU A;  4Y15 A;  5ICF A;  2STW A;  2M8E A;  2K4B A;  2DT5 A;  4RGX A;  2DTR A;  4ETS A;  3H3Z A;  1TLH B;  2RGV A;  5ILU A;  2A3S A;  1FWZ A;  1ZG3 A;  1J0R A;  1BIB A;  1BI0 A;  2A5Y B;  1XN7 A;  4N9I A;  2H6B A;  4RB1 A;  1J59 A;  5DD4 A;  1BC7 C;  3WU1 B;  3CO6 C;  2EV5 A;  1WKM A;  2HFH A;  3M9A A;  1FPQ A;  2V6C A;  3E97 A;  4RS8 A;  4OU0 A;  2R7D A;  1MD0 A;  3NRV A;  4LFU A;  3F8N A;  1KGS A;  3RPQ A;  1CGP A;  1F5T A;  1UB9 A;  5HS9 A;  1KU9 A;  4U0W A;  1XMK A;  5D6E A;  2Z3Y A;  3K1N A;  2DFI A;  3W6K B;  1IF1 A;  4BQA A;  2XV4 S;  2EA4 A;  2EA2 A;  4L9N A;  1HBX G;  2XAS A;  3JSP A;  2ISY A;  5K1Y A;  3IKT A;  4ASN A;  3V7S A;  1GHC A;  2Q2E A;  5DCM B;  1WQ2 A;  3E6D A;  5K5R A;  3RKX A;  3J7A O;  2RQP A;  2K4J A;  3P7N A;  4GCV A;  4OIR F;  3VFZ A;  1BOA A;  2CGP A;  2ZNY A;  5LGN A;  3FZV A;  1T38 A;  1J7K A;  2PFB A;  3SZT A;  2GQQ A;  2ZNZ A;  3TDZ C;  3KET A;  2O3F A;  1L3L A;  2M5W A;  5D4R A;  5DD8 A;  2G7U A;  3I53 A;  4G9Y A;  2XAH A;  1T0F A;  1VTN C;  1KU2 A;  4A0Y A;  2ESN A;  2DK5 A;  3LST A;  4I0B A;  1NHA A;  2LDU A;  4ZYH A;  2Z5U A;  4MGR A;  4MTE A;  3C18 A;  2P6T A;  3F8C A;  3TO6 A;  1MZB A;  4I01 A;  1JGS A;  1I5Z A;  1KYZ A;  5JI6 A;  4G94 A;  1YTY A;  1KU7 A;  2OBP A;  2E7W A;  3RYR A;  2LF8 A;  2EFP A;  5D5U B;  1CF7 B;  3I58 A;  1G6N A;  5D8L B;  3VB2 A;  3REO A;  4D0P A;  1FY7 A;  1BJA A;  4Q4Z F;  4HYE A;  2P7V B;  1TBX A;  2D1H A;  1O3R A;  5IT9 K;  1BIA A;  5AIQ A;  1WSU A;  2L54 A;  3MWM A;  4P5O A;  5DUI A;  4XBF A;  2XKO A;  1ZAR A;  1KQ8 A;  1KA8 A;  3GFM A;  1QQI A;  1MKM A;  3W6J B;  1XDU A;  4U0Y A;  5L3G A;  1RNL A;  5D5V B;  1FYM A;  3M7G A;  4B09 A;  4IPA A;  1CF7 A;  3NQO A;  4GXO A;  1JXS A;  1XGN A;  4R79 A;  1FLI A;  2DI3 A;  5BOX A;  3FXU A;  3RYP A;  1IRF A;  4L9T A;  2BE5 F;  5J8F A;  3IRQ A;  3QAH A;  5J6X A;  3EDP A;  3BPV A;  2OU2 A;  2HR3 A;  2VXZ A;  3GWZ A;  4CGZ A;  3K1M A;  3RPU A;  4AIJ A;  2HYF A;  2BEO A;  5JHU A;  1SD5 A;  3HRS A;  3F21 A;  5LGT A;  1BI1 A;  1S6L A;  3KE2 A;  3C1D A;  3QU3 A;  3LA3 A;  3FMQ A;  1QPM A;  4M9X A;  2F5D A;  1U5T B;  3I0T A;  4WCG A;  3HRU A;  2PLY A;  3E6M A;  3HSR A;  1IN7 A;  1F9N A;  1FSE A;  5CVR A;  1MJB A;  3KZZ A;  5E8G A;  2CFX A;  4LK1 F;  3BJ6 A;  2XAF A;  1IN5 A;  3I64 A;  5ERI A;  2JTV A;  1WRJ A;  4A6E A;  3CO7 C;  3BJO A;  4GYI A;  4EV0 A;  4KYW A;  3T0Y A;  1FC3 A;  2MH9 A;  2HKX A;  2DO7 A;  4BNC A;  3U2R A;  2MH2 A;  4JQF A;  3WTU C;  1W7P B;  1YG2 A;  1ULY A;  2HZT A;  1V3F A;  4PGG A;  2KIU A;  1P2F A;  1IW7 F;  1H9G A;  4ZYD A;  2AS5 F;  3ZMZ A;  2ACJ A;  2L01 A;  4JBA A;  3J80 Z;  1ZRF A;  2QBY B;  2VN2 A;  2PBI A;  1E2X A;  3JW4 A;  2QUF A;  2H94 A;  4EVI A;  3ZQ7 A;  4KIF A;  3EUH A;  4PGH A;  1YFH A;  1KU3 A;  2VON A;  4IRH A;  1SMY F;  1BC8 C;  2DQL A;  3BJA A;  4KMU X;  3E6C C;  5E18 F;  2M30 A;  1W7P A;  4M72 A;  1IN6 A;  3HUG A;  3L7W A;  4OIO F;  2AXL A;  4CHU A;  2A69 F;  2YX7 A;  4XLN F;  2ZO4 A;  3I4P A;  3ECO A;  2VBX A;  2QBY A;  4WXC A;  4E70 A;  2EJR A;  3KP5 A;  4G7O F;  4UVA A;  3TO7 A;  3SHF A;  3KP4 A;  3IWF A;  3CJN A;  5IT3 A;  3WTY C;  1TQM A;  2EFO A;  3CDH A;  2HEO A;  2IA2 A;  4R8H A;  1ON1 A;  1XDS A;  1ODD A;  1WI9 A;  1HKQ A;  2O03 A;  2W84 A;  1W7P D;  3D5L A;  4AD9 A;  4BAY A;  5E20 A;  4LGW A;  4LLN A;  3I59 B;  2OZ6 A;  4ZZD A;  3O3K A;  3MFK A;  1GXP A;  3M8E A;  2YSR A;  2KRF A;  2KJC A;  4HLX A;  1ZG1 A;  5F6F A;  5H20 A;  1STZ A;  1OYY A;  2Y48 A;  5DV5 A;  2F5F A;  3FXQ A;  1I6X A;  3CLO A;  3R0J A;  4QWQ A;  2XUB A;  4HOB A;  5HLH A;  4AIK A;  2VOP A;  2PG4 A;  2ZCW A;  5HDN A;  2HYG D;  3HSE A;  1O7F A;  3KP3 A;  3C7J A;  3L00 A;  3H3U A;  2LKP A;  2PMU A;  2FEZ A;  3DPL C;  3QP5 A;  5A2Q K;  1U6G A;  5DUK A;  1J9I A;  3IWZ A;  2M1B A;  1K79 A;  1YW7 A;  3DP7 A;  4A12 A;  3F8F A;  3RJP A;  3LWF A;  4IRG A;  6PAX A;  3ZMT A;  2FQ3 A;  2NAZ A;  3CUO A;  4EM2 A;  2IJL A;  1B1B A;  3WGG A;  1FNN A;  3KLO A;  2D45 A;  2RC4 A;  4HF0 A;  4HAM A;  5DDG A;  2XAJ A;  2EFN A;  2L3D A;  2JPC A;  4WX9 A;  5LRR A;  1SD4 A;  2FF4 A;  3K1P A;  1X3U A;  1LEB A;  4S04 A;  2XRN A;  5FFZ A;  3KCC A;  1U8R A;  1KQ0 A;  2E1N A;  1XD7 A;  1KYW A;  2E7X A;  3DPT A;  3BPX A;  5LBQ A;  1LJ9 A;  2RKH A;  1O3S A;  1Z7U A;  1BM9 A;  2IA1 A;  4M6Y A;  4EJU A;  4L18 B;  1R58 A;  1U3E M;  4IJA A;  1ZAO A;  3GZ5 A;  1DPR A;  2VC1 A;  2KIF A;  3F6V A;  1ZH5 A;  4ESF A;  4HF1 A;  1T39 A;  1R00 A;  3ISP A;  4OMZ A;  3F6O A;  1B9N A;  1U5T C;  1T2K A;  1AOY A;  4EJV A;  4Y17 A;  2VT3 A;  5KVR A;  4DQ2 A;  4M74 A;  3FF5 A;  3GO5 A;  5CYV A;  2MC3 A;  1FYK A;  1G3S A;  2IPQ X;  1XMA A;  3IRR A;  4XSX F;  3JAM K;  4KT5 C;  2Z99 A;  5J8C A;  1QGP A;  3G73 A;  2ELH A;  4I02 A;  4N0B A;  1LB2 A;  2QQ9 A;  5K5Q A;  2HWV A;  3F3X A;  2FU4 A;  1BI2 A;  3H92 A;  3P9I A;  1TNS A;  2FML A;  4HX4 A;  3T1B A;  4I0A A;  3U9G A;  4M73 A;  4KN7 X;  4RB0 A;  3KEQ A;  3GEZ A;  2ZFW A;  1MGT A;  1TW2 A;  1G4D A;  3EYI A;  1H9T A;  5LHI A;  4HZF A;  2EWN A;  5KK1 A;  4MEX F;  2QQB A;  3OOP A;  3ZMV A; 
#chains in the Genus database with same CATH topology
 4XLF A;  2RRE A;  3CUQ B;  2IA0 A;  2MG4 A;  2DN0 A;  2FE3 A;  2P5L C;  2JA2 A;  3PUB A;  3O6B B;  5DEQ A;  1TQI A;  2ECC A;  2VAS A;  3LSG A;  4I76 A;  1MH4 A;  1D3Y A;  4AID A;  4E7L A;  4P9F A;  1QO0 D;  1YW9 A;  1SVM A;  1FSH A;  3GME A;  3DFG A;  1HDP A;  3GUD A;  4M3D A;  2DPD A;  5FLM J;  4IHW A;  4HX7 A;  5LEK A;  4CUG A;  3BTC A;  5GAD J;  1ETW A;  1YX3 A;  1HKT A;  3BOQ A;  2K7L A;  4BBR J;  3MCZ A;  4HF2 A;  1D5V A;  3K6G A;  4PFO A;  5DM6 F;  2RNJ A;  4QPQ A;  4ZJZ A;  5ICG A;  4XID A;  4B4C A;  4IO9 F;  2K3P A;  5L3C A;  5J1R A;  2KIS A;  4EM1 A;  2GZW A;  3LAP A;  4UUS B;  2QSF X;  2HQR A;  3K4L A;  2WB1 N;  3OMY A;  3DEE A;  5DCM A;  4D7N A;  4WXH A;  2TDX A;  4XLH A;  2E2H J;  2YX4 A;  1JTX A;  1WVR A;  4LIT A;  1XMX A;  5EG0 B;  5D4S A;  4Q47 A;  3I71 A;  5FB2 A;  2Z9O A;  2FQ4 A;  1WCM J;  2XAG A;  3CUQ A;  3PQK A;  3ZMD A;  5IY5 H;  1X1B A;  4XOP A;  3HOU J;  4PSW A;  2VBY A;  3S3N A;  2IXS A;  3PFI A;  1K6Y A;  1SAU A;  2WAE A;  3LQQ A;  5LGU A;  3LSP A;  1LKX A;  3DU5 A;  2FRH A;  2PI0 A;  2A6T A;  2P8T A;  1WJ5 A;  3BTI A;  5H6R A;  4W97 A;  4ENK A;  1ZRE A;  4XK4 A;  5BMZ A;  2GA2 A;  4N4N B;  4RAG A;  3CCL I;  2LMD A;  4R1H A;  3UKG A;  2R7S A;  1X3Z B;  3GLL A;  2W85 A;  2W82 A;  4BE1 A;  4M6X A;  1UST A;  9ANT A;  2VLA A;  1OCP A;  3BG3 A;  1U0J A;  1IO2 A;  3BR2 A;  5CVV A;  3FK7 A;  4AUX A;  4A69 C;  2KPM A;  4WXD A;  3S1N J;  4UV8 A;  2J5O A;  4UUS A;  3CCE I;  3B73 A;  4XKW A;  1IAW A;  3TOA A;  4A2U A;  5IP9 J;  1XGM A;  4A3I J;  2KZG A;  3MD2 A;  1YLF A;  4KMF A;  1ZYR F;  5EG0 A;  3SJM A;  2VOO A;  2FNP A;  2HNH A;  3QPS A;  3M3Y J;  3HSF A;  5CVI A;  1ONV A;  2B0L A;  2NS0 A;  2NVU B;  2OAZ A;  4ANJ A;  4XLP F;  4ZDL A;  1SD6 A;  2ZKZ A;  1HW2 A;  1LDD A;  4L5E A;  2JRT A;  2P4W A;  2KT0 A;  3DQV C;  1UG2 A;  5M3F J;  1TQP A;  4JX4 A;  3I4N J;  2VBW A;  2V1D A;  4X0G A;  1LDK B;  2CW0 F;  2O8X A;  5B3S H;  2GBY A;  4LB5 A;  3KP6 A;  2LRE A;  1ZLK A;  3CLQ A;  1FJL A;  3D0S A;  1X1C A;  3S3M A;  2XIG A;  3F23 A;  4IZZ A;  1VQ9 I;  1Z1D A;  2PJP A;  5M5Y J;  1FOK A;  1Y8Q B;  3HZJ A;  1ZG5 A;  1YJN I;  2XDV A;  4Z6Y A;  3CJQ B;  3HC7 A;  2E1C A;  1GXQ A;  5C3E J;  5BPD A;  2LY9 A;  3RTR A;  3I9V 2;  4XRS A;  2I5U A;  3R6S A;  2IS6 A;  2O7O A;  4A5N A;  3VPR A;  1QVU A;  3RDI A;  4FX4 A;  2BY0 A;  1IXR C;  3K69 A;  4YEL A;  1MND A;  1UHW A;  3PQJ A;  1DUX C;  1IDZ A;  4BL0 B;  2FBK A;  2BZT A;  1SFE A;  2JSP A;  5TIS C;  3VOD A;  5FLX Z;  2O5R A;  4L9J A;  5L3B A;  4LLG F;  1JJ6 C;  3ECH A;  1VQO I;  1MJ9 A;  2R7F A;  1FIP A;  1GVD A;  2WA0 A;  1GV2 A;  2CQN A;  3LSK A;  4BQQ A;  3OS1 A;  3GYH X;  3GTQ J;  3H0D A;  2L0K A;  2HGC A;  1T6S A;  3CJR B;  4M3E A;  5FKL A;  3CDI A;  3NWT A;  2VJI A;  3RKY A;  5ICC A;  2VQL A;  1W4M A;  4IF4 A;  3G1M A;  2NS8 A;  5JVG F;  5FRM A;  4RAZ A;  4HRI A;  5EGO B;  2V1U A;  3IL2 A;  5HS8 A;  3S1Q J;  4A3G J;  3L1P A;  5GAH J;  3S93 A;  4X6A J;  2OCC H;  3BWG A;  3DKX A;  3M8F A;  3OYE A;  2R7U A;  2BW3 B;  2K27 A;  1D8K A;  1LNW A;  2XPW A;  3SDG A;  4DBQ A;  3J81 Z;  5AIP A;  3ZQH A;  1S5L C;  4IOA F;  4A0Z A;  4FT8 A;  4BE0 A;  3CCQ I;  4G7Z F;  2JA7 J;  3GF2 A;  1YIO A;  4MIM A;  1QZE A;  3E5Q A;  1T56 A;  3TBI A;  3IAM 2;  2LF7 A;  4V2G A;  3JRG A;  3EET A;  2J5P A;  4CIC A;  4LG0 B;  4BXF A;  2DLL A;  2L7M P;  2R7T A;  3Q0U A;  2YU3 A;  5CVU A;  1V54 H;  1LFU P;  3S16 J;  2BY1 A;  4O3M A;  3BG5 A;  1TWF J;  1U9O A;  5BNG A;  4XLE A;  4LIV A;  4E7J A;  3T8T A;  3OY9 A;  3S1M J;  2BY2 A;  3KYD B;  4B44 A;  1W5T A;  3CQZ J;  4I09 A;  4Y13 A;  1FP2 A;  3QOP A;  1LVA A;  1HXD A;  2MC4 A;  1MMS A;  2OZU A;  5EZH A;  1RUO A;  5EGO A;  1XB4 A;  2E35 A;  1HLV A;  1S29 A;  1U5T A;  1UEL B;  2YUS A;  5HLG A;  4DNC A;  1YX5 A;  3NEU A;  2X1C A;  4LJZ F;  2EZI A;  1ERD A;  4RGU A;  2EIL H;  1VQ5 I;  2CQK A;  2VXD A;  4A3B J;  2JA6 J;  3QYE A;  1F1Z A;  1FOX A;  2OV7 A;  3OYC A;  2YR2 A;  1SVO A;  4KIB A;  3HG9 A;  2QZ8 A;  3T8R A;  4WWC A;  2LNB A;  4PK4 A;  2IRF G;  1MSE C;  2EZH A;  1A35 A;  4HQE A;  2D2W A;  2V9V A;  4HPQ A;  2CG4 A;  2OD5 A;  2WY7 Q;  3IH3 A;  2KZV A;  1QBJ A;  3H9G A;  2VKH A;  4LG0 A;  4E7H A;  3GCM A;  3ZQC A;  2CU7 A;  3S3O A;  2A05 A;  2OQG A;  2X1D A;  3I54 A;  4UY8 I;  2DQR A;  3SFZ A;  3BR6 A;  1RZ4 A;  3HTU A;  2YPR A;  1G3Y A;  1ORK A;  4ON0 A;  2Q0O A;  3JRI A;  3DXJ F;  1K6O A;  2M0M A;  2BGC A;  3OIO A;  1TNT A;  1T8I A;  3WTW C;  3PIP F;  4UUV A;  4XOT A;  3MZY A;  2WAF A;  2FUG 2;  1F4K A;  1HW1 A;  2IT0 A;  1QHH D;  1X58 A;  1QNT A;  1D1C A;  2EV6 A;  2R5Y B;  1AA7 A;  3WHC A;  4BXX J;  5ICE A;  4RB3 C;  2COB A;  2M87 A;  3O8H A;  4ZYA A;  2A61 A;  3HHH A;  3WOD F;  1O3T A;  5FGM A;  4F93 B;  5K5O A;  3ZPL A;  3ZQG A;  1W0U A;  2L7F P;  3FX3 A;  3WE3 A;  4FTH A;  2CUZ A;  3N05 A;  5EEH A;  2CW7 A;  1N77 A;  3BZK A;  5IYC J;  2CYY A;  5E8I A;  5B1A H;  5B66 C;  1N75 A;  2HTS A;  2FSW A;  2QQA A;  2LSO A;  5HDK A;  4S0H B;  1V4R A;  3EYY A;  3FXR A;  2LTP A;  4S05 A;  2QLZ A;  3GZN B;  3CTA A;  2IS2 A;  2JWT A;  1FX7 A;  4U87 A;  4L0Z B;  1MBJ A;  1RI7 A;  3DBR B;  1JHH A;  3MMY B;  3OYB A;  4DGW B;  4Z2Y A;  3KLN A;  1ACI A;  3F72 A;  4P96 A;  4CO8 A;  2QKL B;  2V1N A;  4AC0 A;  2XRO A;  2R7W A;  2E2J J;  4HDV A;  3JRB A;  1I50 J;  5JVT A;  4HQM A;  3CUQ C;  5LHH A;  2M0C A;  1H0M A;  2OA4 A;  3FKI J;  1IRZ A;  3WU0 A;  1G2H A;  5D5X B;  2R5Y A;  2DMN A;  3G6E I;  3LA2 A;  3O2P E;  1VND A;  4EGY A;  2MLK A;  3DEW A;  4Q5S F;  1MNE A;  3KIO A;  4IXA A;  4NC7 A;  3OYA A;  1OQY A;  3WTS C;  2WC2 A;  2DJN A;  2ZB9 A;  3DCF A;  3BZ6 A;  4BYY A;  1OR7 A;  1UCR A;  2K02 A;  1QU3 A;  4U7D A;  3L2V A;  2DFE A;  1WJF A;  3A0B C;  2HQN A;  2ZXJ A;  2A68 F;  2VT2 A;  1OCC H;  3P9K A;  1FZP B;  2DK8 A;  3OR1 C;  4L5I A;  4F7Z A;  1WPK A;  1R23 A;  3L09 A;  1TZL A;  4IRI A;  2X6X A;  2DT6 A;  3J80 K;  2JUC A;  3HEF A;  1Z6R A;  5E3M A;  2XGD A;  3DBH B;  3PNY A;  2FA5 A;  2K86 A;  2R7X A;  2BXY A;  2DW4 A;  2XKP A;  2OTL I;  4HBL A;  3TKY A;  2Y75 A;  3K10 A;  1FOW A;  1HSJ A;  2F4I A;  2VJ5 A;  3BDD A;  1E0E A;  2JPB A;  1P4W A;  3MKL A;  2VPL A;  4II3 A;  3OIQ A;  4BJ5 C;  1O3Q A;  3U21 A;  2EIN H;  3TL4 X;  1JE8 A;  4EAT A;  3I59 A;  3QPH A;  1DQU A;  3SZP A;  1MBG A;  3QU6 A;  2FBI A;  1P4X A;  3EUA A;  1YJ9 I;  3G1O A;  2HOA A;  1JUS A;  3WHB A;  3K2Z A;  2MAB A;  4A6D A;  1R1T A;  2XAU A;  1J5Y A;  4FHT A;  1XCB A;  1YHQ I;  3QRF F;  2NNN A;  4LG3 A;  4AIH A;  4ENJ A;  1Y1V J;  4XSZ F;  3GTG J;  3VWB A;  2D1V A;  3HYI A;  2UXN A;  2RQQ A;  2WAQ N;  4F92 B;  2EBI A;  2EZL A;  3JSO A;  4FCY A;  1EV7 A;  4ENM A;  2DU9 A;  4Q48 A;  4AU7 A;  2HDD A;  1QHG A;  3UNG C;  4AYB N;  4DW6 A;  3ML6 A;  4NDL A;  3S32 A;  4CYD A;  4EMS A;  4E7Z A;  2HZD A;  4ZZL A;  3MEX A;  2QCO A;  2QYO A;  3FM5 A;  1WZ2 A;  3BQY A;  4AYB A;  3VYU B;  3BRO A;  3R4K A;  3ZCO A;  2PJR B;  2QSG X;  1J09 A;  2IP2 A;  3ABU A;  3E3V A;  4KIG A;  3FWE A;  3BR5 A;  3RQI A;  1UHM A;  1P4A A;  2DOF A;  2CWE A;  2JJ7 A;  1DU6 A;  4YFK F;  5C4J J;  1FBS A;  2ZSH B;  3EUK L;  1OPC A;  2K9S A;  1IJW C;  3G1L A;  3G3Z A;  3HKZ N;  4NC6 A;  2FMY A;  2LH9 A;  4RDU A;  5LEJ A;  2LK2 A;  4I6Z A;  1LFP A;  2A6H F;  2VQH A;  4NQW A;  2VBZ A;  3V8K A;  4BBS J;  4XIC A;  1SD7 A;  1ZQ3 P;  2E34 A;  4H4K C;  1H8A C;  2Y31 A;  1P9Q C;  2HOE A;  3A4C A;  4LB6 B;  1FBQ A;  1YS7 A;  2PEX A;  4DZP A;  1AWC A;  3GXO A;  1UMQ A;  2DMU A;  5JFR A;  3X2Q H;  1B59 A;  1QZY A;  2DA3 A;  1ZLJ A;  4HEA 2;  4BY7 J;  2NNY A;  3Q9V A;  1YRN B;  1I39 A;  3GFL A;  1P6R A;  3OL3 A;  3CCM I;  2CQX A;  2DPU A;  4P55 A;  5EDN A;  1IXC A;  3KZI C;  3D5R C;  2P5V A;  2Q8K A;  5E3N A;  2RAE A;  5F1R A;  5KNL A;  4F52 A;  4L5J A;  3FKJ A;  2Z33 A;  3RKW A;  1IDY A;  3DLL F;  1VF9 A;  4B8X A;  1VQP I;  4KUM A;  3BTJ A;  3F9K A;  1YO5 C;  4CXF A;  1DPU A;  1W0T A;  5FKK A;  2HS5 A;  4EGZ A;  3HTS B;  1B72 B;  3HXL A;  2F5C A;  3TGN A;  2DDA A;  3U1D A;  3LSI A;  4UVC A;  4RGR A;  2Y0S N;  1Z3X A;  4IHS A;  2P6S A;  3OYG A;  2E71 A;  4E7K A;  1IUY A;  1X3W B;  1YYV A;  3ASO H;  2CQQ A;  1LQ1 A;  2X85 A;  2Y0S A;  3J7Y J;  1VFC A;  2QGU A;  2KIM A;  1A04 A;  3GX4 X;  1VQ7 I;  4UNO A;  3LQR A;  2XGE A;  1YRN A;  5LLQ A;  3MKZ A;  2DDB A;  5EEG A;  3MVP A;  2BXZ A;  5FO5 A;  3Q5F A;  4ZC3 A;  1N25 A;  3WTZ A;  1LPQ A;  3OYJ A;  2CV2 A;  3TQN A;  3N4M A;  4E4H A;  2XB0 X;  2AHQ A;  2LBF B;  1MDM B;  4YFX F;  4M3G A;  5EEA A;  1HST A;  3WGI A;  1JI8 A;  1X4O A;  1TL8 A;  1DGW Y;  1FOY A;  1F43 A;  2L9S A;  1A5J A;  1ZGJ A;  2V26 A;  2G9W A;  1HQC A;  4CDG A;  3ZXS A;  2HI3 A;  2JUG A;  1JHF A;  3I55 I;  1B9M A;  1D1B A;  3L2U A;  5DCF A;  1IZ1 A;  5E1X A;  3OOU A;  3CCV I;  4RAY A;  4AWX B;  4E7S A;  2DXI A;  5L3F A;  4HX8 A;  3FBN B;  2R5Z B;  3R60 A;  4BGD A;  1ETO A;  3HIF A;  1VQM I;  3ZOB A;  3M1C A;  2OJE D;  2DTZ A;  2Y69 H;  4M6V A;  3ZMU A;  5LHG A;  3ONQ A;  4MHG A;  4A3K J;  3N97 A;  1DP7 P;  3HRM A;  1LEA A;  1Y1W J;  2Y0M A;  4KN4 X;  1X2N A;  3D5S C;  2Q2E B;  2DYR H;  4BHB A;  1G8X A;  3FK6 A;  3M1E A;  3KEO A;  2LBF A;  3BCA A;  4XRM A;  1MDM A;  1K7A A;  2H8W A;  3C2H A;  4ITV A;  1GVJ A;  2E19 A;  2QWW A;  4HV6 A;  1ZR4 A;  1UFM A;  5LD2 C;  4Y52 J;  2WY8 Q;  3GW2 A;  2PMZ N;  2HPI A;  1A36 A;  5D5W B;  2MGQ A;  3K0L A;  1RR8 C;  2G7H A;  3R0A A;  1LDJ A;  1ZEL A;  4N4O B;  2DJI A;  3E0J B;  2XGC A;  3L2C A;  2PMZ A;  2GIZ A;  1E17 A;  1TT0 A;  3FDY A;  3OYL A;  4I2O A;  4RLF A;  3IKV A;  4PUS A;  3BR0 A;  2L9N A;  2R5Z A;  1OMI A;  4KA4 A;  4A3E J;  2I8D A;  4FE7 A;  3ELK A;  3OYM A;  2GOX B;  2VC0 A;  5D6F A;  3SYT A;  3FBI B;  3AG2 H;  4Y3O A;  4FX0 A;  4ABZ A;  3Q0V A;  3ZN0 A;  2X0L A;  3F22 A;  1MBK A;  2H1K A;  1R1U A;  4XN3 A;  3ABL H;  2HVS A;  3DWL E;  3WTX C;  5IT9 Z;  1FP1 D;  3A0H C;  5FD5 A;  1ZHF A;  2EZK A;  3CZ6 A;  3WG7 H;  4MLO A;  4NC8 A;  2Y30 A;  1RUN A;  2GM4 A;  4XKB A;  3H3V K;  1OR7 C;  3C2G A;  1R49 A;  4I99 C;  3DEU A;  1IRG A;  2M3A A;  5ILV A;  1EH7 A;  2R7V A;  4BKX A;  1W5S A;  4L0Y B;  4LD5 A;  3W2W A;  3F0C A;  2AQE A;  4RMN A;  3E1S A;  4GGG A;  4JX6 A;  5DTD A;  2DAO A;  3TED A;  2ZBK A;  3TOB A;  3SEZ A;  1P7I A;  5TRD A;  3C3W A;  4EJO A;  5BPI A;  4OIP F;  2IGO A;  2P5K A;  3CD6 I;  5CVJ A;  3GFJ A;  5TJJ A;  2WB1 A;  3AL0 B;  2FXA A;  2BV6 A;  1ZRC A;  3KZY A;  3LMM A;  3QP6 A;  3AFH A;  3V8L A;  2DA7 A;  5HNH A;  3OSF A;  4I98 B;  2IEK A;  4HDU A;  2ZJ2 A;  2L4M A;  4F3Q A;  2A6E F;  1T08 B;  3JRE A;  1TW3 A;  4CYC B;  2FOK A;  4L9V A;  2NYX A;  2ZME B;  2W7N A;  2L2O A;  4NBQ A;  3OV8 A;  4P9U A;  3VYT B;  2L9V A;  4IKF A;  4BH9 A;  3OR2 C;  2UZK A;  2A5W A;  1S8N A;  4U0V A;  2PQ8 A;  4MQ9 F;  2F5V A;  1OKR A;  3HHG A;  1FTZ A;  4EM0 B;  2LG4 A;  3RZO J;  1UG0 A;  1Q1H A;  2V6E A;  4PZJ A;  3V7R A;  2JMW A;  4BU2 A;  1L0O C;  2HQ5 A;  2AQF A;  2VL8 A;  1YQA A;  4N9H A;  3VDX A;  5JHF A;  3B6A A;  2L4A A;  2BOL A;  2RDP A;  2CUF A;  1WWX A;  4HG2 A;  1I1S A;  5F64 A;  2NOG A;  1Y56 A;  1IGN A;  2MBF A;  5LFA A;  4QSH A;  5J4V A;  2H27 A;  3KFW X;  4NHJ A;  3GFI A;  1G3W A;  2XSD C;  2XC7 A;  1R1V A;  2HDC A;  1O57 A;  2VE9 A;  4UVB A;  4MTD A;  3HOT A;  2V7F A;  1PDN C;  1R5G A;  2ELK A;  1BI3 A;  5IPA A;  3Q9S A;  4QTR A;  1Y0U A;  1XSX A;  1ZGW A;  5F08 A;  4NB5 A;  2XHK A;  3K4K A;  3MKY B;  4BY1 J;  2HKO A;  4DYR A;  4CYC A;  1Z05 A;  1Z6T A;  2ZME A;  4C3I J;  1X1P A;  4YIF A;  1WJB A;  2QVO A;  3W3C A;  1W1W E;  1O4X A;  5HS7 A;  5EF6 A;  3A2K A;  3RKQ A;  2D5V A;  1J75 A;  1K83 J;  3PM1 A;  2P7C B;  2DMP A;  3EQL F;  2DBB A;  1R9T J;  1ZGA A;  1IN4 A;  3TO9 A;  1MBH A;  1OYW A;  3CF5 F;  2QM3 A;  3FXM A;  1MMN A;  2YS9 A;  2IAI A;  3ZR8 X;  3HBL A;  3I56 I;  3VEP A;  3BP8 A;  3BCB A;  5E1Z B;  2TCT A;  2MLG A;  2ISZ A;  3BC8 A;  4LK0 F;  4HNT A;  5E1W A;  2NOJ B;  3ZP5 A;  3H0G J;  3OIP A;  1EH6 A;  1O7L A;  4G12 A;  4B1R A;  5GTH C;  1DP3 A;  3E5U A;  3ZMS A;  2ZSI B;  2H8R A;  1QRY A;  4YFN F;  4LLL A;  1WJE A;  4GDF A;  3JTH A;  1YW8 A;  2KHM A;  5IP6 A;  4GFB A;  1Z91 A;  2Z16 A;  4KFC A;  1SMT A;  2UWM A;  5DS9 A;  3HJE A;  2GXG A;  2BBY A;  3E5X A;  3R61 A;  3OYI A;  1TP4 A;  2QKM B;  5LRS A;  4V19 K;  3HOV J;  3S2D J;  4PJN A;  5JR3 A;  4OWR B;  3KP7 A;  2JZY A;  4YRV A;  5J47 A;  2QEX I;  2C6Y A;  2VOD A;  4MQV A;  2B9S A;  1NK2 P;  1S3J A;  3COA C;  3AKZ A;  1PJR A;  2MFZ A;  2H09 A;  2ID3 A;  1KQ9 A;  2COM A;  1IN8 A;  5CQE A;  2MW8 A;  1NTC A;  2W25 A;  3AAF A;  1U78 A;  1K78 B;  1X1D A;  5FFX A;  1WJC A;  2EV0 A;  1LUJ B;  1REP C;  4OOI A;  1V5G A;  3DPU A;  4OMY A;  2GIV A;  3M8J A;  1IG7 A;  2W57 A;  5L3E A;  1RIO H;  2ADU A;  3EPZ A;  4CZZ A;  4JX5 A;  1VI0 A;  3KPH A;  2XGX A;  4PDK A;  4HW0 A;  2KJB A;  4G6T B;  1R4M B;  1Y6I A;  4JP0 A;  1I1G A;  4EEF G;  2STT A;  5B1B H;  1BW5 A;  1W36 D;  1K4T A;  2IGM A;  2F4O B;  1R7J A;  2Q1Z B;  2W48 A;  1USS A;  4YII A;  4UV9 A;  3UR3 C;  5FKO A;  1HW5 A;  5IP7 J;  2VUM J;  3IP4 B;  5FD6 A;  4QIW N;  2GWR A;  3IC7 A;  1XGO A;  2XF5 A;  2E1M B;  3S2W A;  2MD0 A;  2RN7 A;  3LA7 A;  3HOX J;  1FBU A;  5HLI A;  2LYC A;  4F55 A;  2RVC A;  4MNU A;  1PUF B;  4UUT A;  2V9K A;  4CCJ A;  2V1X A;  1Z9C A;  3FM3 A;  1K78 A;  2BVM A;  3FMS A;  2VPR A;  4ZDP A;  4BHP A;  3W2A A;  3VOE A;  2DFF A;  2K9N A;  3G2B A;  4KIC A;  4O6J A;  3GZ6 A;  3TDU C;  1RES A;  2BW3 A;  3PSF A;  4MFD A;  1YIJ I;  2VI6 A;  3P9C A;  2V79 A;  2W00 A;  2WAD A;  2O0Y A;  2NRA C;  2X4H A;  2EFQ A;  4MEY F;  4J01 A;  4BDZ A;  2E36 A;  1DDN A;  2M7A A;  1SFO J;  3I5U A;  4UXN A;  1XGS A;  4K2E A;  4YEJ A;  5F0C A;  2GXA A;  4M71 A;  3FMR A;  3K4C A;  2EK5 A;  3WTV C;  4PJL A;  4ESB A;  1IXS B;  4BHC A;  2CO5 A;  3M07 A;  1HA8 A;  3CCU I;  3F8B A;  3BTL A;  3I3L A;  1GT0 C;  2ZJR F;  3PJR A;  5FLX K;  4XL9 A;  4RBO A;  3KP2 A;  3PNT A;  2X6Y A;  5KAI C;  1R5H A;  1EH8 A;  1MJA A;  3DU6 A;  3MQ0 A;  1QZZ A;  1PUF A;  1UZC A;  3PNV A;  2BYV E;  4LMY A;  2JRM A;  2EFW A;  1SAX A;  2XF6 A;  2WTE A;  1I27 A;  3B02 A;  3LAJ A;  1BBY A;  3LOC A;  5HVQ C;  3HOZ J;  2JSC A;  1P92 A;  5HOO A;  5ED4 A;  4HA8 A;  3V8J A;  4HV5 A;  3FIW A;  1RET A;  3ZQQ A;  3H9Q A;  2E60 A;  3K9T A;  3W2V A;  5BS6 A;  5KAF C;  3F8M A;  5F27 A;  3BZC A;  2ID6 A;  1ZN2 A;  3NWS A;  2HPM A;  2O61 A;  4XRF A;  2HTJ A;  3GVA A;  2DA5 A;  2FBH A;  3MZH A;  4E7I A;  5E17 F;  2AO9 A;  2HYJ A;  3IHU A;  5IOY A;  3DV8 A;  4RGS A;  1YS6 A;  3DKY A;  3J81 K;  3OYD A;  1PP8 F;  3WE2 A;  1D0Y A;  1GDT A;  1T33 A;  1XCV A;  2EIJ H;  3DKW A;  3ROU A;  3DF8 A;  2MA3 A;  2MD5 A;  5A2Q Z;  3CES A;  4XLA A;  2GAU A;  3MAJ A;  1TC3 C;  1Z7L A;  4GO1 A;  5L3D A;  2L9R A;  1Y8R B;  1MBF A;  2UXX A;  3DTK A;  2LD5 A;  5CLS A;  1TWA J;  1VQK I;  2CUJ A;  2JT1 A;  2WV0 A;  4ZYE A;  4XQF A;  2XAQ A;  5HOD A;  1S72 I;  1JT0 A;  4G8X A;  3T5X A;  4G7H F;  1SFX A;  2F5E A;  3V4G A;  4KIS A;  4II2 A;  2XB5 A;  1U2W A;  2VKV A;  4IHT A;  3HPG A;  4BQN A;  2R7Q A;  3RIR A;  3SFI A;  4M9S A;  1R36 A;  4Y4R A;  1SFU A;  5AON A;  2HDW A;  1OCO H;  1TWC J;  5C4X J;  2F2E A;  4MO7 A;  4AVP A;  3LFK A;  1ETQ A;  3QOE A;  4WK8 F;  1FT9 A;  4Y33 A;  4PCQ A;  2M34 A;  5J4Y A;  3HRT A;  4UHT A;  5DYM A;  1JTY A;  3SXY A;  4U7B A;  3AL0 C;  5KHD A;  1M1E B;  1Y0N A;  3ZN1 A;  4QLC U;  1ETV A;  3JTG A;  4G6Q A;  3CCS I;  2GA1 A;  3OYH A;  2KP6 A;  4M3B A;  3BT9 A;  4KDP A;  2QQ8 A;  3I4M J;  4HLY A;  2E1O A;  4WF2 A;  5FRO A;  4A3M J;  2PMH A;  2ZME C;  2ETH A;  1FYL A;  2ELJ A;  3RSN A;  3V7C A;  3S15 J;  1J2X A;  1JKP C;  3QOD A;  2IGK A;  1SFK A;  1U8B A;  1T98 A;  2HU9 A;  2CV0 A;  2O6G E;  1E3P A;  1S7O A;  2JK3 A;  1ENH A;  2P81 A;  2X9D A;  4M3F A;  1LVK A;  4H0E A;  4IVN A;  1HKS A;  4A5M A;  2IVM A;  2KKO A;  1EA3 A;  2WAQ A;  4ZH4 F;  1ETY A;  4EQQ A;  1SVL A;  1HF0 A;  2BHZ A;  3L2Q A;  2OQR A;  4YIR X;  3MKW B;  1LFB A;  3HM5 A;  5BQT A;  1E3O C;  4M9Z A;  1WHU A;  3H5R A;  2NVQ J;  1OYI A;  5CKT A;  4PSX A;  2CSO A;  3QYF A;  3WU2 C;  4EJT A;  1TTY A;  2FNA A;  5EZG A;  2P0W A;  3RI4 A;  2E5N A;  3JRC A;  2PN6 A;  3HOS A;  1B4A A;  3QPT A;  3ABK H;  4RB2 C;  1JUM A;  1XSD A;  1W36 C;  2B63 J;  2GXB A;  2R4G A;  5F1J A;  1XSV A;  1C0W A;  3FXJ A;  5D8K B;  1R71 A;  3JRD A;  1S7A A;  4TV7 A;  4ZTJ A;  2LRD A;  2IW5 A;  5CJ9 A;  1R22 A;  2KMU A;  3HKZ A;  5E3O A;  5GPA A;  3CME I;  3JAM Z;  5H6Q A;  3WTT C;  2KRH A;  3S17 J;  3RZD J;  1JKQ C;  3E6B A;  5H2F C;  1IC8 A;  3WGH A;  3ERE D;  4KNY A;  1G3T A;  1VQL I;  2L7K A;  2M45 A;  4KJZ A;  4OIN F;  5GPC A;  4O5V A;  1VQ8 I;  3VSL A;  2XVC A;  3SDB A;  5M5X J;  2A07 F;  2R92 J;  1D8J A;  3SQN A;  4FAS D;  1B6A A;  4I7H A;  2QSH X;  4JK1 X;  2ESH A;  2PJR A;  2DA2 A;  1PUE E;  4G6D A;  1MH3 A;  3S2H J;  4PFP A;  1FIA A;  3IH4 A;  3L9F A;  3WG9 A;  3CMY A;  4ESJ A;  4GYG A;  4ZTF A;  2Y2Z A;  1RR7 A;  3ULQ B;  2L5Q A;  2L02 A;  4ENN A;  3RCO A;  2I10 A;  1XX5 A;  1BN5 A;  1IUF A;  2QEN A;  2UUZ A;  2WWY A;  4A3J J;  2EB7 A;  1BA5 A;  3NAR A;  5HDG A;  3GTM J;  2VE8 A;  3FHZ A;  1GV5 A;  4XON A;  3DLA A;  4YG2 F;  4ZYG A;  2H6C A;  3OSG A;  3GLX A;  2E2I J;  1ON2 A;  1OIS A;  4A0X A;  3LSH A;  3BR3 A;  4U88 A;  1AKH B;  2RV8 A;  2W24 A;  2VKD A;  3HOW J;  3ABT A;  3BY6 A;  1UAA A;  4OIQ F;  1ZRD A;  2LY1 A;  5ILS A;  2ZC2 A;  4EJW A;  1JGG A;  2R3S A;  1PP7 U;  3OS0 A;  4BXU A;  4JOM A;  4Y15 A;  2CJJ A;  5ICF A;  2STW A;  2M8E A;  1VQ6 I;  3TP3 A;  4D1Q A;  2K4B A;  1H89 C;  3PSI A;  5F04 A;  2DT5 A;  2K9Q A;  4BE2 A;  4IHX A;  4RGX A;  5J1Y A;  2CRG A;  1RKT A;  3CF2 A;  2DTR A;  4ETS A;  3H3Z A;  3HOY J;  1TLH B;  5K7F A;  1Q1V A;  3CC2 I;  2G0E A;  3GTO J;  1B72 A;  2CW8 A;  2RGV A;  3CDL A;  5ILU A;  1FWZ A;  1W5C C;  1J0R A;  1BI0 A;  1BIB A;  1IRX A;  1ZG3 A;  2A3S A;  2E1M C;  4XMY A;  5IYD J;  3LSJ A;  1NG6 A;  4GRI A;  2A5Y B;  2IS4 A;  2QA4 I;  1XN7 A;  4N9I A;  2JQ7 A;  2H6B A;  4RB1 A;  4RAF A;  3ERM A;  1J59 A;  4HSR A;  5DD4 A;  1BC7 C;  4RM3 A;  3WU1 B;  3CO6 C;  2EV5 A;  2CMP A;  3EUH C;  4D9J A;  1WKM A;  2HFH A;  2KRC A;  2VB6 A;  3M9A A;  1FPQ A;  2V6C A;  3E97 A;  4RS8 A;  2R7D A;  1MD0 A;  3NRV A;  4LFU A;  4OU0 A;  1TT5 B;  1GLN A;  3F8N A;  1KGS A;  1I6H J;  2GOM A;  3RPQ A;  1CGP A;  2M4K A;  1F5T A;  5J3L A;  1KON A;  1UB9 A;  3GTK J;  3HDD A;  1YIT I;  5JLW A;  3FIS A;  3BG7 A;  3JR9 A;  4C3J J;  3ZGK A;  2M4G A;  5HS9 A;  1MNM C;  2VJJ A;  4XM3 A;  1KU9 A;  4U0W A;  3ASN H;  2RNG A;  1WI3 A;  1XMK A;  4OAY A;  3CMA I;  4BAC A;  5D6E A;  1VQ4 I;  2Z3Y A;  3K1N A;  2DA6 A;  2DFI A;  2JVG A;  2X6W A;  3W6K B;  1IF1 A;  2KDZ A;  1EJ9 A;  4BQA A;  3U1K A;  3OYN A;  2XV4 S;  4IQ4 A;  3V42 A;  2EA4 A;  1Z67 A;  2EA2 A;  1UJ8 A;  4X1E A;  4L9N A;  3ABM H;  4Y7N J;  1HBX G;  2XAS A;  3JSP A;  2ISY A;  5K1Y A;  3AG1 H;  2KIQ A;  4A3D J;  3IKT A;  4ASN A;  3BG6 A;  3V7S A;  1GHC A;  1GUU A;  5E3L A;  2Q2E A;  5DCM B;  4XN0 A;  1WQ2 A;  3L2R A;  3K2A A;  1AHD P;  3W6V A;  3E6D A;  2LOO A;  2OUM A;  5K5R A;  2R7Z J;  3QWL A;  3RKX A;  3J7A O;  2RQP A;  3FHN A;  2K4J A;  3P7N A;  2EH3 A;  4GCV A;  4OIR F;  3VFZ A;  1BOA A;  2DMT A;  3LNQ A;  2CGP A;  4J00 A;  2ZNY A;  5E79 C;  5HNF A;  4A3L J;  5LGN A;  3FZV A;  2DT7 B;  1T38 A;  3CC4 I;  2PX9 A;  2ZXI A;  2V4J C;  5FLV A;  5FRN A;  1YE9 A;  1MBE A;  5FKN A;  1J7K A;  2PFB A;  3SZT A;  4BJT A;  2GQQ A;  2ZNZ A;  5GAE J;  3TDZ C;  3KET A;  2ZJQ F;  1VQN I;  2O3F A;  1L3L A;  1XTA A;  2M5W A;  2IBD A;  3PL8 A;  5D4R A;  5DD8 A;  3LSM A;  2G7U A;  1MIJ A;  3I53 A;  1HC8 A;  2XPU A;  1ZR2 A;  4G9Y A;  1D0X A;  2XAH A;  1T0F A;  1VTN C;  1KU2 A;  4A0Y A;  4IHV A;  2ESN A;  2DK5 A;  1YJW I;  3LST A;  2OPT A;  4I0B A;  2LKX A;  1NHA A;  2LDU A;  4ZYH A;  1MW7 A;  2Z5U A;  4MGR A;  4MTE A;  3C18 A;  1APL C;  2P6T A;  3CP2 A;  1D5Y A;  2H1L A;  3F8C A;  3TO6 A;  1MZB A;  4I01 A;  1JGS A;  2DOD A;  1RC9 A;  1I5Z A;  4CCM A;  4E6K G;  1BR4 A;  3CCY A;  3AG4 H;  4C3H J;  1KYZ A;  5JI6 A;  4G94 A;  1YTY A;  1SC7 A;  1KU7 A;  1RRJ A;  1XG1 A;  4B43 A;  1UHS A;  2KFD A;  3QPL A;  2OBP A;  2E7W A;  2R0Q C;  4F91 B;  3RYR A;  2LKS A;  2LF8 A;  2EFP A;  4FQG A;  5D5U B;  2HOT A;  1R6R A;  1XPX A;  1CF7 B;  3I58 A;  2FJ1 A;  1G59 A;  1G6N A;  4ZDO A;  5D8L B;  3VB2 A;  3REO A;  3OS2 A;  1U9N A;  4D0P A;  1FY7 A;  2Z1D A;  1BJA A;  2CUE A;  1Y39 A;  4Q4Z F;  3VYR B;  1Z77 A;  4HYE A;  2P7V B;  3A02 A;  2R93 J;  1TBX A;  4D5C A;  3KYL A;  1OLT A;  2D1H A;  1O3R A;  5IT9 K;  1BIA A;  5AIQ A;  1WSU A;  2L54 A;  2JN6 A;  4HST A;  3MWM A;  4P5O A;  2IGN A;  4CH7 A;  5DUI A;  4XBF A;  2KQR A;  2XKO A;  2VIX A;  1ZAR A;  1KQ8 A;  1MMD A;  1KA8 A;  3D1N I;  2ZJP F;  3GFM A;  4J19 A;  1A6Q A;  1QQI A;  5EYR A;  1MKM A;  3K4J A;  1XDU A;  3W6J B;  5L3G A;  4U0Y A;  1RNL A;  3H1C A;  5D5V B;  4BS9 A;  1FYM A;  3M7G A;  3H35 A;  1KZH A;  5C44 J;  1V5F A;  4OAZ A;  2JA8 J;  2ME6 A;  4B09 A;  4IPA A;  1CF7 A;  2R7O A;  3NQO A;  2K9L A;  4GXO A;  1JXS A;  1XGN A;  5F0F A;  4R79 A;  3J7Z I;  1FLI A;  2M9H A;  3JRH A;  3GTJ J;  2DI3 A;  5BOX A;  4RM2 A;  4JYK A;  3FXU A;  3RYP A;  1IRF A;  1V5E A;  4L9T A;  2BE5 F;  4C30 A;  5J8F A;  1ZTR A;  3IRQ A;  1IV6 A;  3QAH A;  1HDD C;  2Y9Y A;  5J6X A;  1A6I A;  1XS9 A;  3EDP A;  3BPV A;  3TMO A;  3K4M A;  2OU2 A;  2HR3 A;  2VXZ A;  3TP0 A;  4LOC A;  3GWZ A;  1ZKG A;  4CGZ A;  3K1M A;  3RPU A;  4AIJ A;  1V55 H;  1WGX A;  1OFC X;  2HYF A;  2MYS A;  2BEO A;  2LC2 A;  1POG A;  5JLX A;  5JHU A;  1SD5 A;  3ZQL A;  3HRS A;  2HVR A;  4IHY A;  3F21 A;  1F36 A;  5LGT A;  1BI1 A;  1S6L A;  2X48 A;  1I3Q J;  3KYC B;  3KE2 A;  1LE8 B;  3C1D A;  3QU3 A;  5F0H A;  3LA3 A;  3MN2 A;  3G71 I;  3FMQ A;  1IV8 A;  1QPI A;  1QPM A;  4M9X A;  2F5D A;  1U5T B;  1OCT C;  1BW6 A;  3QQA A;  3I0T A;  4XKC A;  4WCG A;  3FXK A;  4UB8 C;  3HRU A;  2PLY A;  3E6M A;  3LFU A;  3HSR A;  1IN7 A;  1F9N A;  3BLY A;  4HNU A;  1HCR A;  4RLQ A;  1FSE A;  4CA0 A;  5CVR A;  1MJB A;  3PO3 J;  3KZZ A;  1EF4 A;  5E8G A;  2CFX A;  4LK1 F;  1I3A A;  3RPU D;  3BJ6 A;  1MMG A;  2XAF A;  1IN5 A;  1YOV B;  3HGY A;  3I64 A;  2ECB A;  5ERI A;  3LSR A;  2JTV A;  1WRJ A;  4A6E A;  1RKW A;  1ZK8 A;  4XR6 A;  2F48 A;  3CO7 C;  3BJO A;  4GYI A;  2K5C A;  4B3X A;  1ETK A;  3JRF A;  4EV0 A;  3K7A J;  4KYW A;  2WV1 A;  1N78 A;  3T0Y A;  2JA5 J;  1FC3 A;  4CCL A;  1AU7 A;  4FET A;  2OCE A;  2MH9 A;  2ZXW H;  1WH7 A;  1XC5 A;  2HKX A;  1QVT A;  2DO7 A;  1LE8 A;  1MMA A;  1NG7 A;  3ZQI A;  4BNC A;  1OCR H;  3U2R A;  3E7L A;  2MH2 A;  4JQF A;  4UB6 C;  3WTU C;  1W7P B;  1YG2 A;  1ULY A;  2HZT A;  3HUG B;  1V3F A;  4PGG A;  4BUP A;  2KIU A;  4MFE A;  1P2F A;  2OC6 A;  1IW7 F;  3KX2 A;  1H9G A;  4ZYD A;  2AS5 F;  3ZMZ A;  1DU0 A;  2ACJ A;  2L01 A;  3P5J A;  4JBA A;  1X2M A;  3J80 Z;  3TW6 A;  1ZRF A;  5FKM A;  3CMM A;  3K70 D;  2QBY B;  1R4N B;  2DA4 A;  2VN2 A;  2PBI A;  1E2X A;  1EKE A;  3JW4 A;  1BJZ A;  2QUF A;  2H94 A;  4EVI A;  1CQT A;  3ZQ7 A;  1E3H A;  2KL4 A;  1PVE A;  4KIF A;  4BQO A;  3EUH A;  4PGH A;  4D5F A;  1Z21 A;  1YFH A;  1KU3 A;  3L2W A;  4KIT B;  2DOE A;  2VON A;  1VZ0 A;  2EIK H;  1OCZ H;  4IRH A;  4CSW A;  2B7E A;  1SMY F;  1BC8 C;  2LLK A;  4V2F A;  2JVH A;  2VQC A;  1FMW A;  2DQL A;  3BJA A;  5GP9 A;  4KMU X;  4XRS G;  3E6C C;  5E18 F;  2M30 A;  4B3A A;  1W7P A;  4M72 A;  2IS1 A;  1IN6 A;  2QF7 A;  3HUG A;  4QPO A;  2UV1 A;  5K7H A;  3PFY A;  3L7W A;  4OIO F;  2AXL A;  4CHU A;  2A69 F;  2NXN B;  2YX7 A;  4XLN F;  2ZO4 A;  3I4P A;  3ECO A;  2VBX A;  5J1U A;  3H5N A;  2QBY A;  1Z0X A;  4WXC A;  4B48 A;  4E70 A;  2EJR A;  1SEU A;  1BL0 A;  1MSF C;  3KP5 A;  4G7O F;  4UVA A;  3TO7 A;  2K40 A;  3SHF A;  1T0F C;  3JCU C;  1OJL A;  5EJC A;  1T95 A;  2XF7 A;  3KP4 A;  3PO2 J;  4DJA A;  1WH5 A;  3IWF A;  3CJN A;  5IT3 A;  4KT6 A;  3WTY C;  1TQM A;  3OL4 A;  1WJD A;  2OTJ I;  3HL2 A;  2EFO A;  3CDH A;  2HEO A;  2IA2 A;  3BR1 A;  4R8H A;  1ON1 A;  1XDS A;  1ODD A;  1H88 C;  1FMV A;  1WI9 A;  1HKQ A;  2V9P A;  4A3C J;  2O03 A;  4C2M J;  2W84 A;  4XNF A;  1JJ8 C;  1W7P D;  3D5L A;  4AD9 A;  4BAY A;  1NK3 P;  2KLO A;  3BG9 A;  4LGW A;  5E20 A;  4BDY A;  4LLN A;  3I59 B;  2Z2S B;  4HNV A;  2OZ6 A;  4NNJ A;  4ZZD A;  1BR2 A;  2X6O A;  3O3K A;  3MFK A;  4DYQ A;  1GXP A;  3CCJ I;  2NVT J;  3M8E A;  5FJ8 J;  2XSJ C;  5HLT A;  3A03 A;  2YSR A;  4CCN A;  2KRF A;  5CPR B;  2DYS H;  3HGG A;  3M4O J;  4XKV A;  2KJC A;  3HPH A;  2LR8 A;  4HLX A;  4PJM A;  1ZG1 A;  4NUB A;  5F6F A;  2NS7 A;  1JKO C;  2K85 A;  5H20 A;  1STZ A;  5GAG J;  1OYY A;  2CFO A;  1B8I B;  3A1Y A;  2Y48 A;  5DV5 A;  2DMQ A;  2F5F A;  2DFH A;  2VKE A;  2OF7 A;  1WFX A;  1I6X A;  3FXQ A;  3VYS B;  3IUO A;  5IOZ A;  3CLO A;  3R0J A;  4QWQ A;  1JT6 A;  3TW7 A;  2XUB A;  4HOB A;  5HLH A;  4AIK A;  3NAU A;  2VOP A;  2PG4 A;  2CQ7 A;  2ZCW A;  2X51 A;  3QYB A;  3K4B A;  1P7J A;  1WJA A;  5HDN A;  2HYG D;  3HSE A;  4P1W A;  5M3M J;  3BQZ A;  1O7F A;  3KP3 A;  3C7J A;  3C2B A;  4NQW B;  3SEQ A;  3L00 A;  3H3U A;  2LKP A;  2PMU A;  2FOW A;  2FX0 A;  2BVL A;  2FEZ A;  3DPL C;  3QP5 A;  4IOC F;  3CJT B;  2Y9Z A;  5A2Q K;  1RPW A;  2DA1 A;  1U6G A;  4DZJ A;  5DUK A;  1J9I A;  3IWZ A;  5CQG A;  2M1B A;  2K9M A;  2HVQ A;  2BHY A;  2M7B A;  3ESW B;  2ICW G;  4IQJ A;  1K79 A;  1BR1 A;  2ZXH A;  1YW7 A;  3GBG A;  5DM7 F;  1HOM A;  2XPV A;  3DP7 A;  3HB9 A;  4A12 A;  5K7Z A;  1B8I A;  3F8F A;  2HOS A;  4DBR A;  3J7A Y;  3RJP A;  3DTE A;  3LWF A;  3IH2 A;  2NVX J;  2VQG A;  4IRG A;  6PAX A;  5KCM A;  3ZMT A;  2FQ3 A;  2NAZ A;  3LL7 A;  3CUO A;  4EM2 A;  2DOA A;  1SAN A;  3OYK A;  2IJL A;  1B1B A;  3WGG A;  1FNN A;  3KEY A;  3KLO A;  2TRT A;  2D45 A;  2M2E A;  2RC4 A;  3B6C A;  4HF0 A;  4HAM A;  5DDG A;  2WBM A;  2XAJ A;  3S14 J;  2EFN A;  3K4N A;  2L3D A;  4PJJ A;  1FEX A;  2JPC A;  4IL6 C;  4WX9 A;  2LFB A;  5LRR A;  2K3F A;  4DYC A;  1SD4 A;  2FF4 A;  2XRL A;  2VJ4 A;  3K1P A;  2M8G X;  2HQA A;  1X3U A;  1D1A A;  1S7E A;  4D7M A;  4S04 A;  1LEB A;  2XRN A;  5FFZ A;  3KCC A;  1TWH J;  1K61 A;  5J40 A;  3IV5 A;  1U8R A;  2X1E A;  2F6C A;  4W1U A;  4B47 A;  1KQ0 A;  2E1N A;  1XD7 A;  1KYW A;  2E7X A;  4AM3 A;  3DPT A;  3BPX A;  3VSK A;  2GLO A;  5LBQ A;  2EPF A;  1LJ9 A;  2LVS A;  3OYF A;  2RKH A;  4C2U A;  1O3S A;  1NH3 A;  1X4P A;  1BM9 A;  1Z7U A;  2IA1 A;  4M6Y A;  4EJU A;  4L18 B;  3K70 C;  5M5W J;  3H9J A;  1JKR C;  2CV1 A;  2YU9 J;  2NVY J;  4CCO A;  1R58 A;  1U3E M;  1JUP A;  1Z3Y A;  3Q0W A;  3JRA A;  4IJA A;  1ZAO A;  1ETX A;  2HXO A;  3GZ5 A;  1DPR A;  2VC1 A;  2ZFU A;  2KIF A;  5IYB J;  2DCE A;  3F6V A;  4FIS A;  1ZH5 A;  4ESF A;  4HF1 A;  2CH0 A;  4A93 J;  2FD5 A;  2O9L A;  1T39 A;  4IEJ A;  3GTP J;  1R00 A;  3ISP A;  4OMZ A;  3F6O A;  1B9N A;  1U5T C;  1T2K A;  4DIQ A;  2O8K A;  4C2T A;  3AG3 H;  1D0Z A;  1AOY A;  4EJV A;  2LY2 A;  4BEH B;  3A01 B;  4CZC A;  4Y17 A;  3OWT A;  2VT3 A;  5KVR A;  3O8G A;  1PYV A;  4DQ2 A;  4M74 A;  1X19 A;  3FF5 A;  3GO5 A;  5CYV A;  1YI2 I;  1A31 A;  1DGR M;  4A3F J;  2MC3 A;  2CS3 A;  4CCK A;  3CCR I;  1FYK A;  1AKH A;  2E5Z A;  1G3S A;  1TWG J;  2IPQ X;  1S9H A;  1XMA A;  4XSX F;  3IRR A;  2W1O A;  3JAM K;  1R5I D;  4KT5 C;  2Z99 A;  4IX7 A;  5TGT A;  5J8C A;  1QGP A;  3PUF A;  3G73 A;  3DTI A;  1BOB A;  2HXI A;  3SZG A;  4C9Y A;  2R7R A;  2ELH A;  3ZRG A;  1QA6 A;  2EIM H;  4BJ6 C;  3S8P A;  2N8G A;  2ME0 A;  4I02 A;  3H36 A;  4N0B A;  5GTI C;  1LB2 A;  3IAS 2;  4DOZ A;  2QQ9 A;  4PJ0 C;  3CP8 A;  3GTL J;  2AXT C;  1ITY A;  5K5Q A;  2HWV A;  3F3X A;  2BY3 A;  3G4S I;  2FU4 A;  1BI2 A;  3H92 A;  4BEH A;  3A01 A;  1X1A A;  3P9I A;  1TNS A;  2FML A;  3CC7 I;  4HX4 A;  3T1B A;  4I0A A;  3H5A A;  3U9G A;  2W4S A;  4LIU A;  2F4M B;  1K4S A;  4XLC A;  4M73 A;  3FXO A;  4RA2 A;  3S1R J;  4KN7 X;  4RB0 A;  3KEQ A;  2EQR A;  3GEZ A;  2ZFW A;  4XOR A;  2L7Z A;  1MGT A;  1TW2 A;  1G4D A;  3Q3S A;  3EYI A;  5B5E C;  2LP0 A;  3MZ8 A;  4AVZ A;  3PIO F;  1H9T A;  3FXL A;  5LHI A;  4HZF A;  2EWN A;  2MSY A;  4FE4 A;  2KDO A;  3RQ4 A;  5KK1 A;  4MEX F;  1FTT A;  2QQB A;  3DBL B;  3ZQF A;  3OOP A;  3ZMV A; 
#chains in the Genus database with same CATH homology
 3CUQ B;  2IA0 A;  2FE3 A;  2P5L C;  3O6B B;  5DEQ A;  1TQI A;  1D3Y A;  4P9F A;  1QO0 D;  1YW9 A;  1FSH A;  3DFG A;  3GUD A;  2DPD A;  4HX7 A;  5LEK A;  1HKT A;  3BOQ A;  2K7L A;  3MCZ A;  4HF2 A;  1D5V A;  2RNJ A;  5ICG A;  5L3C A;  4EM1 A;  2GZW A;  3LAP A;  2HQR A;  5DCM A;  4WXH A;  2TDX A;  2YX4 A;  5D4S A;  4Q47 A;  3I71 A;  5FB2 A;  2Z9O A;  3CUQ A;  2XAG A;  3PQK A;  3ZMD A;  2VBY A;  3PFI A;  5LGU A;  3LQQ A;  2FRH A;  2PI0 A;  2P8T A;  5H6R A;  4ENK A;  1ZRE A;  5BMZ A;  2GA2 A;  4R1H A;  2W85 A;  4M6X A;  1UST A;  5CVV A;  4WXD A;  4UV8 A;  2J5O A;  3B73 A;  1IAW A;  3TOA A;  4A2U A;  1XGM A;  1YLF A;  4KMF A;  1ZYR F;  2VOO A;  2FNP A;  3HSF A;  5CVI A;  1ONV A;  2B0L A;  2NS0 A;  4XLP F;  2OAZ A;  1SD6 A;  2ZKZ A;  1HW2 A;  1LDD A;  2JRT A;  2P4W A;  3DQV C;  1TQP A;  2VBW A;  2V1D A;  1LDK B;  2CW0 F;  2O8X A;  4LB5 A;  3KP6 A;  1ZLK A;  3D0S A;  2XIG A;  3F23 A;  1Z1D A;  2PJP A;  1FOK A;  1ZG5 A;  2E1C A;  1GXQ A;  5BPD A;  3RTR A;  3R6S A;  4A5N A;  3RDI A;  4FX4 A;  1IXR C;  3K69 A;  1UHW A;  3PQJ A;  1DUX C;  2FBK A;  5FLX Z;  1SFE A;  3VOD A;  4L9J A;  5L3B A;  4LLG F;  3ECH A;  1MJ9 A;  2R7F A;  3GYH X;  2HGC A;  1T6S A;  3RKY A;  5ICC A;  1W4M A;  4IF4 A;  4RAZ A;  2V1U A;  3IL2 A;  5HS8 A;  3BWG A;  3M8F A;  2K27 A;  1D8K A;  1LNW A;  3J81 Z;  5AIP A;  4A0Z A;  4FT8 A;  4G7Z F;  3GF2 A;  1YIO A;  3E5Q A;  2LF7 A;  3EET A;  2J5P A;  4CIC A;  4LG0 B;  2DLL A;  2YU3 A;  5CVU A;  4O3M A;  3T8T A;  1W5T A;  4I09 A;  4Y13 A;  1FP2 A;  3QOP A;  1LVA A;  1HXD A;  2OZU A;  1RUO A;  1XB4 A;  1S29 A;  1U5T A;  5HLG A;  4DNC A;  3NEU A;  4LJZ F;  4RGU A;  2CQK A;  1F1Z A;  2YR2 A;  4KIB A;  3T8R A;  2QZ8 A;  4WWC A;  2LNB A;  2IRF G;  4HQE A;  2D2W A;  2V9V A;  2CG4 A;  2OD5 A;  1QBJ A;  4LG0 A;  2OQG A;  3I54 A;  2DQR A;  3SFZ A;  3HTU A;  1RZ4 A;  2YPR A;  1G3Y A;  4ON0 A;  2Q0O A;  1K6O A;  3DXJ F;  2BGC A;  1TNT A;  3WTW C;  4UUV A;  3MZY A;  1F4K A;  2IT0 A;  1HW1 A;  1QNT A;  2EV6 A;  5ICE A;  4RB3 C;  2M87 A;  2A61 A;  3HHH A;  3WOD F;  1O3T A;  5FGM A;  5K5O A;  3ZPL A;  3FX3 A;  3WE3 A;  5EEH A;  2CYY A;  5E8I A;  2HTS A;  2FSW A;  2QQA A;  2LSO A;  5HDK A;  1V4R A;  3EYY A;  3FXR A;  4S05 A;  2QLZ A;  3CTA A;  1FX7 A;  4L0Z B;  1RI7 A;  1JHH A;  4Z2Y A;  3KLN A;  3F72 A;  4P96 A;  4CO8 A;  2XRO A;  4HDV A;  5JVT A;  4HQM A;  3CUQ C;  5LHH A;  1H0M A;  2OA4 A;  3WU0 A;  5D5X B;  3LA2 A;  3O2P E;  4EGY A;  2MLK A;  4Q5S F;  4IXA A;  3WTS C;  2WC2 A;  3BZ6 A;  4BYY A;  1OR7 A;  1UCR A;  2K02 A;  4U7D A;  2ZXJ A;  2HQN A;  2A68 F;  2VT2 A;  3P9K A;  1FZP B;  2DK8 A;  4L5I A;  4F7Z A;  1R23 A;  3L09 A;  4IRI A;  3J80 K;  1Z6R A;  2FA5 A;  2K86 A;  2DW4 A;  2XKP A;  4HBL A;  3TKY A;  2Y75 A;  1HSJ A;  3BDD A;  2JPB A;  1P4W A;  1O3Q A;  1JE8 A;  3I59 A;  3QPH A;  3SZP A;  3QU6 A;  2FBI A;  1P4X A;  3K2Z A;  4A6D A;  1R1T A;  1J5Y A;  4FHT A;  1XCB A;  3QRF F;  2NNN A;  4AIH A;  4ENJ A;  4XSZ F;  2D1V A;  3HYI A;  2UXN A;  3JSO A;  1EV7 A;  4ENM A;  2DU9 A;  4Q48 A;  3ML6 A;  4CYD A;  4EMS A;  4ZZL A;  3MEX A;  2QYO A;  3FM5 A;  3BRO A;  3R4K A;  2IP2 A;  3E3V A;  3ABU A;  4KIG A;  3FWE A;  1UHM A;  1P4A A;  2CWE A;  4YFK F;  1FBS A;  1OPC A;  3G3Z A;  2FMY A;  5LEJ A;  2A6H F;  4NQW A;  2VBZ A;  3V8K A;  1SD7 A;  2HOE A;  4LB6 B;  1FBQ A;  1YS7 A;  2PEX A;  1AWC A;  3GXO A;  5JFR A;  1B59 A;  1QZY A;  1ZLJ A;  2NNY A;  3Q9V A;  3GFL A;  1P6R A;  2DPU A;  4P55 A;  1IXC A;  2P5V A;  2Q8K A;  5F1R A;  4L5J A;  2Z33 A;  3RKW A;  4B8X A;  4KUM A;  1YO5 C;  1DPU A;  4CXF A;  2HS5 A;  4EGZ A;  3HTS B;  2F5C A;  3TGN A;  3U1D A;  4UVC A;  4RGR A;  4IHS A;  2P6S A;  1IUY A;  1YYV A;  1LQ1 A;  2KIM A;  1A04 A;  3GX4 X;  4UNO A;  3LQR A;  5LLQ A;  5EEG A;  5FO5 A;  3Q5F A;  3WTZ A;  3TQN A;  3N4M A;  1MDM B;  4YFX F;  1HST A;  3WGI A;  1ZGJ A;  2G9W A;  1HQC A;  4CDG A;  1JHF A;  1B9M A;  5DCF A;  1IZ1 A;  5E1X A;  4RAY A;  4AWX B;  5L3F A;  4HX8 A;  3R60 A;  3HIF A;  3ZMU A;  5LHG A;  4MHG A;  3N97 A;  1DP7 P;  3HRM A;  1LEA A;  2Y0M A;  4KN4 X;  4BHB A;  3M1E A;  3KEO A;  1MDM A;  1K7A A;  1GVJ A;  2QWW A;  4HV6 A;  1UFM A;  3GW2 A;  5D5W B;  3K0L A;  2G7H A;  3R0A A;  1LDJ A;  3L2C A;  1E17 A;  4I2O A;  3IKV A;  1OMI A;  4KA4 A;  3ELK A;  2VC0 A;  5D6F A;  4FX0 A;  3ZN0 A;  2X0L A;  3F22 A;  1R1U A;  3WTX C;  5IT9 Z;  1FP1 D;  5FD5 A;  1ZHF A;  1RUN A;  3DEU A;  1IRG A;  5ILV A;  1EH7 A;  1W5S A;  4L0Y B;  4LD5 A;  4GGG A;  2DAO A;  2ZBK A;  3TOB A;  5TRD A;  3C3W A;  4EJO A;  5BPI A;  4OIP F;  2P5K A;  5CVJ A;  3GFJ A;  5TJJ A;  2FXA A;  2BV6 A;  1ZRC A;  3KZY A;  3QP6 A;  3V8L A;  4I98 B;  4HDU A;  2ZJ2 A;  2L4M A;  2A6E F;  1TW3 A;  2FOK A;  4L9V A;  2NYX A;  2ZME B;  3OV8 A;  4P9U A;  4BH9 A;  2UZK A;  1S8N A;  4U0V A;  2PQ8 A;  4MQ9 F;  1OKR A;  3HHG A;  4EM0 B;  1Q1H A;  4PZJ A;  3V7R A;  1L0O C;  1YQA A;  4N9H A;  2L4A A;  2RDP A;  1WWX A;  1I1S A;  5F64 A;  2MBF A;  2H27 A;  3KFW X;  4NHJ A;  3GFI A;  1G3W A;  1R1V A;  2HDC A;  1O57 A;  2VE9 A;  4UVB A;  4MTD A;  3HOT A;  1PDN C;  1R5G A;  1BI3 A;  3Q9S A;  1Y0U A;  1XSX A;  4NB5 A;  2XHK A;  2HKO A;  1Z05 A;  1Z6T A;  2ZME A;  4YIF A;  2QVO A;  5HS7 A;  1J75 A;  2P7C B;  3EQL F;  2DBB A;  1ZGA A;  1IN4 A;  3TO9 A;  1OYW A;  2QM3 A;  3VEP A;  3BP8 A;  5E1Z B;  2MLG A;  2ISZ A;  4LK0 F;  5E1W A;  3ZP5 A;  1EH6 A;  1O7L A;  3E5U A;  3ZMS A;  4YFN F;  4LLL A;  3JTH A;  1YW8 A;  1Z91 A;  4KFC A;  1SMT A;  2UWM A;  2GXG A;  2BBY A;  3E5X A;  3R61 A;  5LRS A;  5JR3 A;  3KP7 A;  2JZY A;  2C6Y A;  2VOD A;  4MQV A;  1S3J A;  3COA C;  2H09 A;  1KQ9 A;  2COM A;  1IN8 A;  3AAF A;  2W25 A;  1U78 A;  1K78 B;  5FFX A;  2EV0 A;  1REP C;  4OOI A;  4OMY A;  2GIV A;  2W57 A;  5L3E A;  1RIO H;  2ADU A;  4CZZ A;  2XGX A;  4PDK A;  4HW0 A;  2KJB A;  2STT A;  1I1G A;  1R7J A;  1USS A;  4YII A;  4UV9 A;  1HW5 A;  5FD6 A;  2GWR A;  3IC7 A;  1XGO A;  3S2W A;  2RN7 A;  3LA7 A;  1FBU A;  5HLI A;  2RVC A;  4MNU A;  2V1X A;  1Z9C A;  3FM3 A;  1K78 A;  3FMS A;  4BHP A;  3VOE A;  4KIC A;  3GZ6 A;  4O6J A;  3TDU C;  3P9C A;  2V79 A;  2O0Y A;  2NRA C;  2X4H A;  2EFQ A;  4MEY F;  1DDN A;  3I5U A;  4UXN A;  1XGS A;  4K2E A;  4M71 A;  3FMR A;  2EK5 A;  3WTV C;  4ESB A;  1IXS B;  4BHC A;  2CO5 A;  3F8B A;  5FLX K;  3KP2 A;  1R5H A;  1EH8 A;  1MJA A;  3MQ0 A;  1QZZ A;  2BYV E;  4LMY A;  2EFW A;  1SAX A;  2WTE A;  1I27 A;  3B02 A;  3LAJ A;  1BBY A;  5HVQ C;  2JSC A;  1P92 A;  5HOO A;  5ED4 A;  4HA8 A;  3V8J A;  4HV5 A;  3K9T A;  5BS6 A;  3F8M A;  1ZN2 A;  2O61 A;  4XRF A;  2HTJ A;  3GVA A;  2FBH A;  5E17 F;  3MZH A;  3IHU A;  3DV8 A;  4RGS A;  1YS6 A;  3J81 K;  1PP8 F;  3WE2 A;  1XCV A;  3DKW A;  3ROU A;  3DF8 A;  2MA3 A;  2MD5 A;  5A2Q Z;  2GAU A;  3MAJ A;  4GO1 A;  5L3D A;  2UXX A;  5CLS A;  2JT1 A;  2WV0 A;  4ZYE A;  2XAQ A;  4G8X A;  3T5X A;  4G7H F;  1SFX A;  2F5E A;  3V4G A;  1U2W A;  4IHT A;  3RIR A;  4M9S A;  1R36 A;  1SFU A;  5AON A;  2F2E A;  4AVP A;  3LFK A;  4WK8 F;  1FT9 A;  4PCQ A;  3HRT A;  4UHT A;  5DYM A;  3SXY A;  4U7B A;  3ZN1 A;  4QLC U;  3JTG A;  4G6Q A;  2GA1 A;  4KDP A;  4HLY A;  4WF2 A;  2PMH A;  2ETH A;  1FYL A;  3V7C A;  1J2X A;  1T98 A;  2O6G E;  1S7O A;  4H0E A;  4IVN A;  1HKS A;  4A5M A;  2IVM A;  2KKO A;  4ZH4 F;  4EQQ A;  2OQR A;  5BQT A;  4M9Z A;  1OYI A;  2CSO A;  4EJT A;  1TTY A;  2FNA A;  3RI4 A;  2PN6 A;  3HOS A;  1B4A A;  3QPT A;  4RB2 C;  1XSD A;  2GXB A;  1C0W A;  1XSV A;  5D8K B;  1S7A A;  4TV7 A;  2IW5 A;  5CJ9 A;  1R22 A;  3JAM Z;  5H6Q A;  3WTT C;  3E6B A;  3WGH A;  3ERE D;  4KNY A;  1G3T A;  2M45 A;  4OIN F;  4O5V A;  2XVC A;  2A07 F;  1D8J A;  3SQN A;  1B6A A;  4I7H A;  4JK1 X;  2ESH A;  1PUE E;  4G6D A;  3L9F A;  3WG9 A;  4ESJ A;  4GYG A;  3ULQ B;  2L02 A;  4ENN A;  1BN5 A;  2QEN A;  2WWY A;  2EB7 A;  5HDG A;  2VE8 A;  3FHZ A;  4YG2 F;  4ZYG A;  2H6C A;  3GLX A;  1ON2 A;  4A0X A;  4U88 A;  2RV8 A;  2W24 A;  3ABT A;  3BY6 A;  4OIQ F;  1ZRD A;  5ILS A;  4EJW A;  2R3S A;  1PP7 U;  4BXU A;  4Y15 A;  5ICF A;  2STW A;  2M8E A;  2K4B A;  2DT5 A;  4RGX A;  2DTR A;  4ETS A;  3H3Z A;  1TLH B;  2RGV A;  5ILU A;  2A3S A;  1FWZ A;  1ZG3 A;  1J0R A;  1BIB A;  1BI0 A;  2A5Y B;  1XN7 A;  4N9I A;  2H6B A;  4RB1 A;  1J59 A;  5DD4 A;  1BC7 C;  3WU1 B;  3CO6 C;  2EV5 A;  1WKM A;  2HFH A;  3M9A A;  1FPQ A;  2V6C A;  3E97 A;  4RS8 A;  4OU0 A;  2R7D A;  1MD0 A;  3NRV A;  4LFU A;  3F8N A;  1KGS A;  3RPQ A;  1CGP A;  1F5T A;  1UB9 A;  5HS9 A;  1KU9 A;  4U0W A;  1XMK A;  5D6E A;  2Z3Y A;  3K1N A;  2DFI A;  3W6K B;  1IF1 A;  4BQA A;  2XV4 S;  2EA4 A;  2EA2 A;  4L9N A;  1HBX G;  2XAS A;  3JSP A;  2ISY A;  5K1Y A;  3IKT A;  4ASN A;  3V7S A;  1GHC A;  2Q2E A;  5DCM B;  1WQ2 A;  3E6D A;  5K5R A;  3RKX A;  3J7A O;  2RQP A;  2K4J A;  3P7N A;  4GCV A;  4OIR F;  3VFZ A;  1BOA A;  2CGP A;  2ZNY A;  5LGN A;  3FZV A;  1T38 A;  1J7K A;  2PFB A;  3SZT A;  2GQQ A;  2ZNZ A;  3TDZ C;  3KET A;  2O3F A;  1L3L A;  2M5W A;  5D4R A;  5DD8 A;  2G7U A;  3I53 A;  4G9Y A;  2XAH A;  1T0F A;  1VTN C;  1KU2 A;  4A0Y A;  2ESN A;  2DK5 A;  3LST A;  4I0B A;  1NHA A;  2LDU A;  4ZYH A;  2Z5U A;  4MGR A;  4MTE A;  3C18 A;  2P6T A;  3F8C A;  3TO6 A;  1MZB A;  4I01 A;  1JGS A;  1I5Z A;  1KYZ A;  5JI6 A;  4G94 A;  1YTY A;  1KU7 A;  2OBP A;  2E7W A;  3RYR A;  2LF8 A;  2EFP A;  5D5U B;  1CF7 B;  3I58 A;  1G6N A;  5D8L B;  3VB2 A;  3REO A;  4D0P A;  1FY7 A;  1BJA A;  4Q4Z F;  4HYE A;  2P7V B;  1TBX A;  2D1H A;  1O3R A;  5IT9 K;  1BIA A;  5AIQ A;  1WSU A;  2L54 A;  3MWM A;  4P5O A;  5DUI A;  4XBF A;  2XKO A;  1ZAR A;  1KQ8 A;  1KA8 A;  3GFM A;  1QQI A;  1MKM A;  3W6J B;  1XDU A;  4U0Y A;  5L3G A;  1RNL A;  5D5V B;  1FYM A;  3M7G A;  4B09 A;  4IPA A;  1CF7 A;  3NQO A;  4GXO A;  1JXS A;  1XGN A;  4R79 A;  1FLI A;  2DI3 A;  5BOX A;  3FXU A;  3RYP A;  1IRF A;  4L9T A;  2BE5 F;  5J8F A;  3IRQ A;  3QAH A;  5J6X A;  3EDP A;  3BPV A;  2OU2 A;  2HR3 A;  2VXZ A;  3GWZ A;  4CGZ A;  3K1M A;  3RPU A;  4AIJ A;  2HYF A;  2BEO A;  5JHU A;  1SD5 A;  3HRS A;  3F21 A;  5LGT A;  1BI1 A;  1S6L A;  3KE2 A;  3C1D A;  3QU3 A;  3LA3 A;  3FMQ A;  1QPM A;  4M9X A;  2F5D A;  1U5T B;  3I0T A;  4WCG A;  3HRU A;  2PLY A;  3E6M A;  3HSR A;  1IN7 A;  1F9N A;  1FSE A;  5CVR A;  1MJB A;  3KZZ A;  5E8G A;  2CFX A;  4LK1 F;  3BJ6 A;  2XAF A;  1IN5 A;  3I64 A;  5ERI A;  2JTV A;  1WRJ A;  4A6E A;  3CO7 C;  3BJO A;  4GYI A;  4EV0 A;  4KYW A;  3T0Y A;  1FC3 A;  2MH9 A;  2HKX A;  2DO7 A;  4BNC A;  3U2R A;  2MH2 A;  4JQF A;  3WTU C;  1W7P B;  1YG2 A;  1ULY A;  2HZT A;  1V3F A;  4PGG A;  2KIU A;  1P2F A;  1IW7 F;  1H9G A;  4ZYD A;  2AS5 F;  3ZMZ A;  2ACJ A;  2L01 A;  4JBA A;  3J80 Z;  1ZRF A;  2QBY B;  2VN2 A;  2PBI A;  1E2X A;  3JW4 A;  2QUF A;  2H94 A;  4EVI A;  3ZQ7 A;  4KIF A;  3EUH A;  4PGH A;  1YFH A;  1KU3 A;  2VON A;  4IRH A;  1SMY F;  1BC8 C;  2DQL A;  3BJA A;  4KMU X;  3E6C C;  5E18 F;  2M30 A;  1W7P A;  4M72 A;  1IN6 A;  3HUG A;  3L7W A;  4OIO F;  2AXL A;  4CHU A;  2A69 F;  2YX7 A;  4XLN F;  2ZO4 A;  3I4P A;  3ECO A;  2VBX A;  2QBY A;  4WXC A;  4E70 A;  2EJR A;  3KP5 A;  4G7O F;  4UVA A;  3TO7 A;  3SHF A;  3KP4 A;  3IWF A;  3CJN A;  5IT3 A;  3WTY C;  1TQM A;  2EFO A;  3CDH A;  2HEO A;  2IA2 A;  4R8H A;  1ON1 A;  1XDS A;  1ODD A;  1WI9 A;  1HKQ A;  2O03 A;  2W84 A;  1W7P D;  3D5L A;  4AD9 A;  4BAY A;  5E20 A;  4LGW A;  4LLN A;  3I59 B;  2OZ6 A;  4ZZD A;  3O3K A;  3MFK A;  1GXP A;  3M8E A;  2YSR A;  2KRF A;  2KJC A;  4HLX A;  1ZG1 A;  5F6F A;  5H20 A;  1STZ A;  1OYY A;  2Y48 A;  5DV5 A;  2F5F A;  3FXQ A;  1I6X A;  3CLO A;  3R0J A;  4QWQ A;  2XUB A;  4HOB A;  5HLH A;  4AIK A;  2VOP A;  2PG4 A;  2ZCW A;  5HDN A;  2HYG D;  3HSE A;  1O7F A;  3KP3 A;  3C7J A;  3L00 A;  3H3U A;  2LKP A;  2PMU A;  2FEZ A;  3DPL C;  3QP5 A;  5A2Q K;  1U6G A;  5DUK A;  1J9I A;  3IWZ A;  2M1B A;  1K79 A;  1YW7 A;  3DP7 A;  4A12 A;  3F8F A;  3RJP A;  3LWF A;  4IRG A;  6PAX A;  3ZMT A;  2FQ3 A;  2NAZ A;  3CUO A;  4EM2 A;  2IJL A;  1B1B A;  3WGG A;  1FNN A;  3KLO A;  2D45 A;  2RC4 A;  4HF0 A;  4HAM A;  5DDG A;  2XAJ A;  2EFN A;  2L3D A;  2JPC A;  4WX9 A;  5LRR A;  1SD4 A;  2FF4 A;  3K1P A;  1X3U A;  1LEB A;  4S04 A;  2XRN A;  5FFZ A;  3KCC A;  1U8R A;  1KQ0 A;  2E1N A;  1XD7 A;  1KYW A;  2E7X A;  3DPT A;  3BPX A;  5LBQ A;  1LJ9 A;  2RKH A;  1O3S A;  1Z7U A;  1BM9 A;  2IA1 A;  4M6Y A;  4EJU A;  4L18 B;  1R58 A;  1U3E M;  4IJA A;  1ZAO A;  3GZ5 A;  1DPR A;  2VC1 A;  2KIF A;  3F6V A;  1ZH5 A;  4ESF A;  4HF1 A;  1T39 A;  1R00 A;  3ISP A;  4OMZ A;  3F6O A;  1B9N A;  1U5T C;  1T2K A;  1AOY A;  4EJV A;  4Y17 A;  2VT3 A;  5KVR A;  4DQ2 A;  4M74 A;  3FF5 A;  3GO5 A;  5CYV A;  2MC3 A;  1FYK A;  1G3S A;  2IPQ X;  1XMA A;  3IRR A;  4XSX F;  3JAM K;  4KT5 C;  2Z99 A;  5J8C A;  1QGP A;  3G73 A;  2ELH A;  4I02 A;  4N0B A;  1LB2 A;  2QQ9 A;  5K5Q A;  2HWV A;  3F3X A;  2FU4 A;  1BI2 A;  3H92 A;  3P9I A;  1TNS A;  2FML A;  4HX4 A;  3T1B A;  4I0A A;  3U9G A;  4M73 A;  4KN7 X;  4RB0 A;  3KEQ A;  3GEZ A;  2ZFW A;  1MGT A;  1TW2 A;  1G4D A;  3EYI A;  1H9T A;  5LHI A;  4HZF A;  2EWN A;  5KK1 A;  4MEX F;  2QQB A;  3OOP A;  3ZMV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...