3HSEA

Crystal structure of staphylococcus aureus protein sarz in reduced form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
116
Chain Sequence
GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDENIKKLGERVFLDSGTLTPLLKKLKDYTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator sarZ
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
total genus 40
structure length 116
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hseA00
2PMUA 1H0MA 3K1PA 2KJCA 3O6BB 5D4RA 3GWZA 4OOIA 4M9ZA 2HQRA 3R0JA 4QWQA 1HW5A 2IW5A 2R7DA 5TRDA 3ML6A 3PQJA 1TLHB 2DAOA 4A6EA 1FC3A 3GLXA 3WGIA 3F72A 5D5XB 5J8FA 4P55A 1IXSB 2QENA 3NRVA 3I53A 2GXBA 4LGWA 5AONA 3B02A 2A07F 2L01A 1K79A 1XN7A 3FXQA 1IN7A 1XGNA 1BIAA 1HQCA 4BYYA 2JPCA 4UNOA 1WQ2A 4WXDA 1U8RA 4XLPF 1RNLA 4OMZA 3DEUA 4GYGA 1IXRC 2QUFA 2L4AA 2QM3A 1ZARA 3M8FA 3WODF 4RB0A 5FLXK 4KIGA 2JPBA 3HOTA 4Z2YA 2IA0A 1R1VA 2UZKA 1U5TB 1J9IA 2VONA 3GF2A 3LA7A 5DCMB 4L0ZB 1OKRA 2VN2A 1RI7A 1ZRCA 1S6LA 2MLKA 3LAPA 3Q9SA 4B09A 3HYIA 3W6KB 2PN6A 5D5WB 1UFMA 4EJVA 2V9VA 3OOPA 1BIBA 5FO5A 2ESNA 4P96A 3KZYA 3SFZA 3F21A 2V79A 2KKOA 3JSOA 1P4AA 4KIFA 1F4KA 4MTEA 4ZZLA 1CF7B 1R36A 1A04A 1ZLJA 1FWZA 2NS0A 3K1MA 2PLYA 4R1HA 3RJPA 2X0LA 1IXCA 5E1WA 1XDSA 3PQKA 2F5CA 4I02A 2D2WA 1O7LA 1YTYA 3IKVA 4YFNF 2LNBA 4ZYEA 5H20A 4XBFA 3LA3A 3CUQB 5HS9A 2HOEA 2VODA 2RVCA 4Q47A 5L3EA 1E17A 3ZMZA 3DFGA 2STWA 4ESJA 2XIGA 4KN4X 1Y0UA 3F8NA 1S29A 2EFOA 1SD5A 3L00A 2Y0MA 3HUGA 2E7WA 4EGYA 1XDUA 3VOEA 5FLXZ 5CJ9A 2OAZA 5TJJA 4ZH4F 4HV6A 2CO5A 4I7HA 2GZWA 1GVJA 5K5QA 2BV6A 4DQ2A 2PI0A 3KFWX 1IUYA 1YW8A 4YFXF 1PP8F 1FBSA 2DT5A 4LLGF 4BHBA 2GQQA 3F6OA 1XCBA 5D5VB 3J81K 2JRTA 4DNCA 4GO1A 4KDPA 1MJBA 1W7PA 2H6BA 5LHGA 1QGPA 2ZXJA 3LQQA 3WTXC 2FMYA 4CO8A 1XGMA 3BJ6A 5DUKA 3ZMDA 2XHKA 4L0YB 2NNNA 2W85A 2OQGA 3FMQA 2A3SA 4PGGA 2KRFA 3K9TA 4PGHA 2VC1A 1G4DA 2QQBA 2OQRA 1SMTA 3HIFA 3NEUA 1RIOH 4QLCU 3IKTA 5CVJA 1S7OA 5FD5A 4LG0B 1D3YA 4UVCA 3E6CC 1JE8A 1F5TA 5F1RA 2FE3A 5LEKA 4ZYHA 3WTTC 3EETA 5ERIA 4N9IA 3F8BA 1QO0D 3GVAA 2YPRA 2ZNYA 2EFQA 3WU0A 5E8IA 2VT3A 1FT9A 1WI9A 2PBIA 2QVOA 4PCQA 3JW4A 4LD5A 4EMSA 1U78A 2AS5F 2ZMEA 2FMLA 2GXGA 3T8RA 4RAYA 1ON1A 1AWCA 2HEOA 2QZ8A 3OV8A 4KA4A 1GXQA 1S7AA 3RDIA 4G7OF 4LFUA 1FBUA 1VTNC 2CGPA 2LKPA 2F2EA 2QQAA 3C18A 3BPXA 2MD5A 4OU0A 2W24A 5D5UB 1I6XA 4AVPA 4CICA 2IA1A 2NNYA 5HLGA 4HOBA 3I71A 1J5YA 3U2RA 2RN7A 3RKWA 2CQKA 5HDKA 1TQIA 3DV8A 3MAJA 3EUHA 2H94A 1OYYA 3J81Z 2JT1A 1SFXA 4I2OA 2FOKA 2XKPA 4H0EA 1MDMA 4JK1X 5FGMA 1JXSA 3BP8A 4YFKF 5CVVA 4ESBA 1XGSA 3E5QA 1BI3A 3LFKA 3I54A 3QP6A 4CXFA 4M6YA 2O8XA 2AXLA 2P5VA 1HW2A 3W6JB 1STZA 4AWXB 3RYPA 2EA4A 1PP7U 3LQRA 3H92A 2K02A 3T1BA 2VBZA 1EH7A 3FXUA 4A2UA 1P6RA 4LLLA 5BMZA 2R7FA 2XRNA 2A6HF 3U1DA 5D4SA 4S04A 3F23A 1TW2A 1Z6TA 2JZYA 5E8GA 4LK1F 3R60A 1T2KA 4KMUX 2QWWA 4IPAA 1FYLA 1O57A 4ASNA 3IRRA 1V3FA 1MJ9A 5ICFA 3K69A 5LRSA 1Z9CA 1FP2A 3P7NA 5CVIA 3IWFA 1FSHA 4LB6B 2O61A 3REOA 1IAWA 3I59A 3PFIA 1YG2A 2O0YA 4N0BA 3FMRA 2OA4A 1D8JA 1KQ0A 4YIFA 2XAHA 1XGOA 4U0WA 4IXAA 4A5MA 4ON0A 4FX4A 1U5TC 2P7CB 2FSWA 4M71A 4CHUA 1R23A 2K4JA 3JTHA 4M9SA 3GFMA 3DF8A 2VT2A 4WK8F 3FZVA 5DUIA 3E5UA 2XAQA 4BH9A 4HF1A 3V8KA 2F5FA 4HAMA 1J75A 2CFXA 3RPQA 4BHCA 3B73A 3RTRA 3V7SA 3HTSB 3KP4A 2Z33A 1YS6A 3BZ6A 2KIUA 1LDDA 3HSRA 4I98B 1O3QA 2GA1A 2M45A 3I58A 4UVBA 4AD9A 4RGRA 2HDCA 1YIOA 4PZJA 5BQTA 2NAZA 2HZTA 2Z5UA 5HOOA 5FFZA 2M5WA 1J0RA 4KT5C 5D6EA 4XSZF 3I4PA 1YYVA 3VB2A 3MZYA 4U0YA 5LEJA 5D8KB 2E7XA 5E1ZB 2ETHA 1SD7A 2HKXA 3TO9A 2P8TA 1NHAA 2TDXA 1JGSA 1QNTA 1G3WA 1SD6A 3T8TA 6PAXA 4NQWA 3O2PE 3EQLF 2VOOA 4M73A 4IHTA 1XSDA 1XMAA 3WTWC 1P92A 1LB2A 4MEXF 1K6OA 3ZQ7A 4EM0B 1R1UA 3CUQC 1KU2A 4JQFA 4YG2F 2P6SA 5ICCA 2DK5A 4L9NA 2PFBA 1YFHA 3GEZA 4HX7A 1G6NA 5JFRA 1KU9A 1BM9A 1HBXG 2OZUA 4CGZA 2EV6A 4R8HA 3NQOA 4ZYGA 3EYIA 3P9IA 1B6AA 1B1BA 1W5SA 4OIOF 2K27A 4FT8A 5ICGA 2FBIA 1DUXC 2P7VB 1PDNC 3WGHA 3C7JA 2XV4S 1U5TA 3K1NA 5DCFA 3ZMUA 4HYEA 2DFIA 3TKYA 3S2WA 2RV8A 5DCMA 4ENJA 5E18F 2L4MA 2ZFWA 3O3KA 3KE2A 5HDGA 1D8KA 1ZN2A 1FSEA 3HRMA 3CJNA 2EFNA 4B8XA 1AOYA 3T5XA 2E1NA 3KP7A 4S05A 5LRRA 3ZN1A 1ZG1A 4ENNA 4NHJA 3IC7A 2CG4A 2FF4A 1Q1HA 2EV5A 3MEXA 4ZZDA 3J7AO 4G94A 4WWCA 4WXHA 3IRQA 4HQEA 3TDUC 4LLNA 3ZMVA 1Z05A 1IN6A 1FYKA 2HQNA 2HFHA 2M8EA 4M74A 4A12A 5ILSA 1IN4A 2M87A 5EEGA 3VEPA 3MQ0A 3HHGA 2HTSA 5BPDA 2KJBA 1CF7A 3KP3A 5BOXA 4CZZA 3U9GA 2G7UA 1R7JA 4M9XA 3DP7A 2MA3A 1Z91A 1B9MA 1WSUA 1MGTA 2EFWA 4MQVA 3SXYA 2GWRA 2EB7A 3C1DA 2K4BA 2A6EF 3M8EA 2Z3YA 3ROUA 1LDJA 2ACJA 5CVUA 4IVNA 3TOAA 2LSOA 3KP5A 3R61A 2H6CA 4EJWA 4HA8A 3CUQA 3SZTA 1CGPA 3GFLA 2J5OA 3KETA 2ISZA 3V8JA 1I1SA 3K0LA 4AIJA 3ABTA 2KIMA 1KU3A 1P4XA 3E6MA 4BHPA 4R79A 3WE3A 3M7GA 4UV9A 4KICA 3ELKA 1F9NA 3K2ZA 1KYWA 1ZG5A 1RZ4A 1R1TA 4OMYA 4ESFA 1FZPB 4LMYA 2CW0F 2P4WA 1K78B 5DEQA 2FBKA 2HGCA 2PEXA 2XKOA 3J80K 1T39A 2F5DA 4GGGA 1J2XA 2A5YB 2HYFA 3KLOA 4XLNF 2QBYB 3GUDA 3E3VA 1BC8C 5D6FA 3GFJA 1TQMA 3BPVA 5LLQA 2DK8A 2O3FA 3BROA 1FYMA 1G3SA 4IRGA 3N97A 1WRJA 3LWFA 1KGSA 1MD0A 3KLNA 3CTAA 2O03A 3GXOA 1IF1A 2QQ9A 1P2FA 2DQLA 1EV7A 1IRGA 2ESHA 1YW7A 5KVRA 1O7FA 1UHWA 3FXRA 2M1BA 3QOPA 3SQNA 2XUBA 1ZGJA 2L54A 1B9NA 4L9JA 3KP2A 3CO6C 4NB5A 3ABUA 4HX8A 1O3RA 3FHZA 2HKOA 2DQRA 1O3TA 1ZREA 4CDGA 5DDGA 3M1EA 3V8LA 1YQAA 1FP1D 3DKWA 1OR7A 3F8FA 5HS8A 1W5TA 3ZMSA 1SMYF 4LG0A 4OIPF 2DPUA 5LGNA 1UCRA 1W4MA 3VODA 5JVTA 3I5UA 4P5OA 3JSPA 4EM1A 5AIQA 3TO7A 1HXDA 3RYRA 5KK1A 5BPIA 1BBYA 1K7AA 3RPUA 2YX4A 3GZ5A 3F3XA 2V1UA 2ADUA 1IW7F 3E6DA 1LDKB 3FWEA 3L2CA 3FX3A 2DBBA 1R58A 1BI1A 3JTGA 2WC2A 5K1YA 2Y75A 2OD5A 1KU7A 4IRIA 4ETSA 3J80Z 4G6DA 2NRAC 3LA2A 4N9HA 4IF4A 4Y15A 2XASA 3BY6A 3FM5A 4LK0F 1I5ZA 2MH2A 3E5XA 2HR3A 2XROA 1B59A 3I0TA 4EV0A 2DU9A 2ZBKA 4L5JA 3HOSA 2WWYA 3HHHA 2KIFA 4RAZA 5BS6A 5HDNA 3WE2A 2M30A 5DD8A 4OIRF 4RGSA 2V6CA 3RKYA 2IJLA 4I0BA 4G6QA 4HLXA 1ZAOA 5JI6A 3F8CA 3KCCA 3QAHA 4HV5A 3L7WA 3GX4X 4Q4ZF 1IRFA 2VE9A 2MC3A 5L3BA 3G3ZA 1LQ1A 2E1CA 3MFKA 5CVRA 2K7LA 1IN8A 4EJOA 3GFIA 3TDZC 1XMKA 2QYOA 1UB9A 4HDUA 1EH6A 1IN5A 1BOAA 3P9KA 2CYYA 2DTRA 2V1XA 1ZG3A 3DQVC 1G3YA 3ZPLA 2FBHA 3BJAA 4OIQF 2V1DA 1Z1DA 1T38A 3WTZA 3GO5A 1ODDA 1H9TA 1FNNA 2R3SA 1DPUA 1ZHFA 4EGZA 2LF8A 4KIBA 1QBJA 3HSEA 1C0WA 1LVAA 2NYXA 4P9UA 5FFXA 3I64A 3CLOA 1X3UA 2XVCA 4MQ9F 3V7RA 5ILUA 3KZZA 2OZ6A 2RQPA 4FHTA 2VBXA 5DD4A 3R4KA 1HKSA 1QZZA 3WG9A 4KYWA 3SZPA 3WU1B 5DV5A 3ZN0A 2FEZA 1BC7C 4RB1A 1MJAA 4EJTA 5H6QA 1OMIA 4L9TA 5E17F 5L3FA 4L18B 1HKTA 2IVMA 5HLIA 4UV8A 1DP7P 4BAYA 1I27A 3BJOA 2BEOA 2HWVA 4A0XA 3QU6A 1W7PD 1BN5A 5E1XA 4G9YA 2FU4A 4Q5SF 3SHFA 2CWEA 2XAFA 2L02A 2PQ8A 1FPQA 2HYGD 1XB4A 2A61A 2MLGA 2Y48A 4O5VA 3QPHA 4IRHA 5ILVA 2DI3A 1YW9A 2CSOA 4HF0A 3WTUC 2DO7A 1BI2A 2ZCWA 1KA8A 1L0OC 2DPDA 5HVQC 4UVAA 1G3TA 2IT0A 2BE5F 1TW3A 1YO5C 3E97A 5K5RA 5F6FA 3CDHA 2VBYA 4KN7X 4U7BA 2P6TA 4G7ZF 2PMHA 5FB2A 1LJ9A 2D1VA 4RGXA 5DYMA 2Q8KA 3RIRA 5IT9K 3RI4A 4A0ZA 1R22A 3KP6A 2RC4A 4BXUA 5L3CA 4G8XA 5ED4A 1D5VA 1OYIA 3MWMA 2FNAA 1OYWA 2XAGA 2Q2EA 2DLLA 1OPCA 2FA5A 4GYIA 4KUMA 4U88A 4EVIA 4HLYA 3EYYA 1ZLKA 1RUNA 1ZH5A 4I0AA 1DDNA 4I09A 2IP2A 4WX9A 4G7HF 4O3MA 2Z9OA 3BOQA 4Y13A 4L9VA 1IZ1A 2FQ3A 3GW2A 2O6GE 3P9CA 1R5HA 4KFCA 2D45A 4HBLA 3HRUA 1Z7UA 3HTUA 1FX7A 2RGVA 1R5GA 3D0SA 3GZ6A 2JTVA 2EWNA 3KEQA 3WTSC 4KNYA 5IT3A 4K2EA 3DXJF 3F22A 1LNWA 1ONVA 5JR3A 3M9AA 4ZYDA 1J59A 1XSVA 1R00A 1PUEE 4RB3C 4OINF 2FRHA 5LHHA 3H3ZA 1KYZA 2COMA 3MZHA 1FBQA 1FLIA 1L3LA 1F1ZA 1HSJA 2J5PA 2P5LC 4MEYF 2EFPA 4UXNA 3TGNA 1XD7A 4BNCA 2FXAA 1YS7A 3DPTA 4XSXF 4UHTA 3BWGA 1FOKA 2ZNZA 5IT9Z 3QPTA 3Q9VA 2EK5A 1T6SA 4WCGA 4RB2C 5A2QK 4WF2A 2YSRA 2G7HA 4EM2A 2C6YA 4HF2A 3ECHA 1QPMA 5L3DA 2UXNA 4JBAA 5J8CA 1W7PB 3FMSA 5H6RA 5L3GA 1SFUA 2VC0A 4HDVA 1HW1A 4CYDA 3HSFA 2W25A 3ISPA 4ENMA 3HRTA 1U2WA 5HS7A 2W57A 1E2XA 2ELHA 2EV0A 3WTVC 1SFEA 3G73A 3ECOA 1I1GA 4IHSA 3BDDA 5LGTA 3ZP5A 5AIPA 1K78A 2H09A 4UUVA 1XCVA 3H3UA 2LF7A 4F7ZA 2QBYA 1MKMA 3IWZA 4HX4A 4EQQA 2QLZA 1XSXA 2UWMA 1ON2A 1WWXA 2XAJA 3CUOA 4AIKA 4FX0A 2MH9A 1RUOA 1LEAA 1ZRFA 1USTA 3LSTA 2EA2A 3T0YA 5J6XA 2A69F 4EJUA 1LEBA 3JAMK 3TO6A 4U0VA 2YR2A 3IL2A 4TV7A 2G9WA 3TQNA 4E70A 5E20A 1TNTA 1TNSA 2ZKZA 1JHHA 1Z6RA 3EDPA 2H27A 1TQPA 3ZMTA 1V4RA 1T98A 4KMFA 2XGXA 1U6GA 3MCZA 2PG4A 2ZMEB 1MZBA 2VXZA 4AIHA 2JSCA 4I01A 5FD6A 3QU3A 1ULYA 4RS8A 1YLFA 4WXCA 1GXPA 3COAC 1BI0A 1KQ9A 2X4HA 2RDPA 2UXXA 3N4MA 5D8LB 3IHUA 4M72A 5A2QZ 4A6DA 4D0PA 2Z99A 1T0FA 2DW4A 3R0AA 1U3EM 2P5KA 4MNUA 1QQIA 4MGRA 5CYVA 2BYVE 1MDMB 5LBQA 2ISYA 1USSA 5HLHA 2RKHA 4IJAA 3V4GA 1P4WA 1TBXA 4HZFA 4A5NA 5JHUA 1SAXA 2LDUA 3D5LA 5ICEA 2B0LA 1O3SA 2EJRA 2VBWA 4LB5A 1GHCA 3VFZA 1TTYA 4RGUA 4GXOA 2IRFG 1H9GA 4ENKA 3WTYC 3ULQB 1ZYRF 2YU3A 3V7CA 3E6BA 5K5OA 4Q48A 4GCVA 3ERED 3GYHX 1REPC 2W84A 1FY7A 3LAJA 1WKMA 3HRSA 1UHMA 2OU2A 3JAMZ 1B4AA 4P9FA 1SD4A 1EH8A 2VOPA 1ZRDA 2YX7A 3Q5FA 3L09A 1JHFA 4XRFA 2STTA 1J7KA 2VE8A 3C3WA 3TOBA 4YIIA 2PJPA 4PDKA 3I59B 2L3DA 2GIVA 1HSTA 4HQMA 4MHGA 1KQ8A 2WV0A 4MTDA 3CO7C 4O6JA 5F64A 3QRFF 2GAUA 2A68F 3AAFA 5LHIA 3DPLC 3F8MA 2K86A 4LJZF 2WTEA 3F6VA 2IPQX 4HW0A 2F5EA 4A0YA 1ZGAA 1HKQA 3L9FA 1QZYA 3R6SA 2HTJA 2IA2A 2GA2A 2OBPA 2FNPA 2MBFA 3RKXA 1DPRA 4BQAA 3FF5A 5CLSA 4M6XA 5EEHA 4L5IA 5LGUA 1S8NA 3WGGA 4Y17A 2HS5A 2ZO4A 1BJAA 3KEOA 4U7DA 2BGCA 2D1HA 3FM3A 2Q0OA 2BBYA 2ZJ2A 1S3JA 2RNJA 3QP5A
chains in the Genus database with same CATH superfamily
2PMUA 1H0MA 3K1PA 4FCYA 4A3MJ 2KJCA 2ZSHB 3O6BB 5D4RA 3AFHA 3GWZA 3EUAA 4OOIA 1O4XA 3PL8A 4M9ZA 2HQRA 2ZXHA 1DP3A 3NWSA 2NVXJ 2JK3A 3R0JA 2WB1N 4QWQA 4A3FJ 5KHDA 2VUMJ 1HW5A 2IW5A 3SEZA 3CC2I 2JA7J 2M4KA 4XN0A 2R7DA 5TRDA 3ML6A 3JRHA 4DYQA 2DFFA 3VPRA 3VSLA 1GVDA 2AXTC 2Y30A 1NG7A 3PQJA 4B47A 1TLHB 2DAOA 4A6EA 3HOWJ 1FC3A 3GLXA 2L9RA 1ZR2A 3WGIA 3F72A 1R9TJ 4UUSB 2XGEA 3BLYA 3OS2A 3OYLA 4A3CJ 5D5XB 5J8FA 5DM6F 4P55A 1IXSB 4I76A 1JKPC 4NQWB 2NS8A 2QENA 3NRVA 3I53A 2GXBA 2ZB9A 5GP9A 3UNGC 4LGWA 5AONA 3B02A 2BW3A 3G4SI 1QA6A 1WI3A 2I10A 2A07F 2L01A 2MW8A 3KYLA 2KHMA 3IV5A 1K79A 1XN7A 3L2QA 3L1PA 3FXQA 1IN7A 1XGNA 1BIAA 1HQCA 2HZDA 3BC8A 4BYYA 2JPCA 2MSYA 4Y7NJ 4XKWA 4UNOA 1WQ2A 4WXDA 4BQQA 1U8RA 2JN6A 1X2NA 4XLPF 1WJFA 1RNLA 3FKJA 4OMZA 3DEUA 5FKNA 3KIOA 4GYGA 4DZPA 1IXRC 2ID3A 1ETXA 2QUFA 3HOUJ 2L4AA 4E7LA 2QM3A 3M8JA 1HA8A 1ZARA 1AKHB 3M8FA 2L9NA 3WODF 3JRAA 4RB0A 5FLXK 4KIGA 4CYCB 5JHFA 2JPBA 2ECCA 1N25A 2VB6A 3HOTA 4Z2YA 4Z6YA 1ETKA 2MYSA 2IA0A 4ZDPA 1R1VA 2JRMA 2UZKA 1U5TB 1V5EA 4LOCA 1J9IA 2VJJA 4DZJA 3BR2A 2VONA 1G59A 1GV2A 4Y3OA 3GF2A 1OJLA 3LA7A 2CQ7A 5DCMB 2KL4A 3CP8A 3VSKA 4L0ZB 1OKRA 2R7QA 3S1RJ 1ETYA 2VN2A 1AU7A 1RI7A 5IYBJ 2M2EA 1ZRCA 3DPUA 1S6LA 2MLKA 1UZCA 4BEHA 1OCPA 4BBSJ 3LAPA 5F0FA 3JRBA 3Q9SA 1MNEA 2DJIA 2OUMA 3NAUA 1WGXA 4B09A 2V26A 4UY8I 3GTQJ 3RPUD 1K4TA 3HYIA 3W6KB 2PN6A 1TZLA 5D5WB 2HOTA 1UFMA 1VQNI 4EJVA 1QU3A 2V9VA 2DMPA 4LIUA 3OOPA 1BIBA 1OISA 2L7KA 3Q3SA 5FO5A 1QHHD 4PFPA 3A2KA 4AU7A 3S1NJ 2DTZA 2ESNA 4P96A 2NOGA 3KZYA 4RDUA 2Z1DA 3SFZA 3F21A 2V79A 5LFAA 3VYUB 3ZR8X 2KKOA 3JSOA 2TCTA 1P4AA 4KIFA 2HDWA 1F4KA 1R5ID 4MTEA 4ZZLA 1CF7B 1R36A 2JQ7A 1A04A 1ZLJA 1FWZA 2NS0A 3K1MA 3OWTA 2PLYA 4D7NA 4R1HA 3X2QH 3TEDA 1JT6A 3RJPA 2X0LA 1IXCA 5E1WA 1XDSA 2LREA 2R4GA 4DBQA 3PQKA 2F5CA 3DTIA 4I02A 2D2WA 1O7LA 1YTYA 1D5YA 2M0MA 4UUTA 4ZJZA 4IX7A 5FRMA 2A5WA 4BJ6C 3IKVA 1IDYA 2FOWA 1W0TA 4XN3A 4YFNF 3Q0UA 2LNBA 4ZYEA 5H20A 4XBFA 4PK4A 1HDDC 4A3BJ 2JWTA 3MD2A 4M3GA 3BR0A 3CMMA 2DA7A 3LA3A 2LTPA 1U8BA 4HNUA 2R0QC 1IC8A 1B72A 3KX2A 1Z3YA 3CUQB 5HS9A 2HOEA 2VODA 2ME6A 2RVCA 2X6WA 3CZ6A 2HYJA 4Q47A 5L3EA 1E17A 3ZMZA 3DFGA 2STWA 1D1CA 5J4YA 2UUZA 4ESJA 3S1MJ 3S32A 2XIGA 4KN4X 2E71A 1Y0UA 4RA2A 3RZDJ 3F8NA 2R7VA 1S29A 4PJJA 2EFOA 1SD5A 3L00A 2Y0MA 4J01A 3HB9A 3HUGA 2GXAA 2L7MP 4IEJA 2E7WA 4EGYA 3J7AY 1XDUA 3VOEA 5FLXZ 2DA2A 2OAZA 5CJ9A 5TJJA 4ZH4F 1IUFA 2ZMEC 4HV6A 4M3FA 4RM2A 1F36A 3FXKA 4I99C 2CO5A 4I7HA 2GZWA 3LSHA 4XONA 4N4NB 3W2AA 2NOJB 2ZXIA 4DBRA 1G2HA 1GVJA 1IDZA 3GCMA 5DM7F 5K5QA 3CMYA 2BV6A 4DQ2A 2BOLA 2PI0A 3KFWX 1IUYA 1YW8A 4YFXF 1PP8F 4F3QA 5IP7J 3S3MA 1FBSA 2DT5A 3HOVJ 1DU0A 2KDOA 3GTOJ 4LLGF 4MO7A 2W4SA 4BHBA 2DYRH 2GQQA 3F6OA 5KCMA 1XCBA 5D5VB 3J81K 3J7YJ 2JRTA 3GLLA 4DNCA 3S8PA 3DEEA 4GO1A 3EUHC 3WHCA 3ZCOA 4KDPA 1MJBA 1W7PA 2H6BA 3CCYA 3S1QJ 5LHGA 3S3NA 4RAFA 1QGPA 2ZXJA 3LQQA 3WTXC 2FMYA 3CCJI 4CO8A 3CCMI 1A36A 1XGMA 4M3DA 3MZ8A 4IHVA 3BJ6A 2OCCH 3BR6A 5DUKA 3ZMDA 2XHKA 2XF5A 2DT6A 1WJAA 3OYGA 1MBEA 1XPXA 1RPWA 1X1DA 3H9GA 4L0YB 2NNNA 2W85A 4B44A 2OQGA 3FMQA 3TP0A 3CCEI 2A3SA 4PGGA 1SVOA 1I39A 2KRFA 2RQQA 3K9TA 3OYFA 2HXIA 4PGHA 2DFHA 2VC1A 1H89C 2LOOA 1W36C 1G4DA 1DU6A 2QQBA 2R92J 2OQRA 1SMTA 2LC2A 3HIFA 3NEUA 4IHXA 1BR1A 3K4CA 1RIOH 3SJMA 3G1OA 4FETA 4QLCU 3IKTA 5CVJA 2DMTA 3ZGKA 3TP3A 1S7OA 4XIDA 4ITVA 3HC7A 5FD5A 1GLNA 1S7EA 4L5EA 4LG0B 1D3YA 4BUPA 3OYJA 4C3JJ 4UVCA 3E6CC 5J3LA 5EGOB 1JE8A 2VQHA 2ELKA 2X9DA 1F5TA 5F1RA 2FE3A 1Y0NA 3FBIB 1JTYA 3AKZA 5LEKA 4ZYHA 3M1CA 3WTTC 3PIPF 3EETA 2VL8A 4HSRA 1A31A 3ABMH 5J4VA 5ERIA 1NK3P 4N9IA 3FBNB 4C2MJ 3F8BA 1QO0D 1ETWA 3GVAA 2YPRA 4S0HB 2COBA 3GBGA 3PIOF 2ZNYA 4H4KC 2EFQA 3WU0A 3ZQFA 5E8IA 3I55I 3LSPA 1FIAA 3RQIA 3I56I 2VT3A 4E7IA 1FT9A 1WI9A 2PBIA 2QVOA 4PCQA 4BE1A 2ZFUA 3VYTB 3JW4A 2HDDA 4LD5A 3LOCA 2IGNA 4EMSA 1U78A 2AS5F 1KZHA 3SEQA 2ZMEA 2FMLA 3BZCA 2GXGA 3T8RA 1SVMA 1W1WE 2WY7Q 5TGTA 4RAYA 4DYCA 3HGGA 1ON1A 1AWCA 2HEOA 1UG0A 2QZ8A 3OV8A 1N78A 4KA4A 1GXQA 1S7AA 2ZJRF 1X1PA 3RDIA 4G7OF 2DOFA 4LFUA 1FBUA 2HOAA 1VTNC 2R7ZJ 3S3OA 1ENHA 3IH4A 2DA3A 2LKPA 2CGPA 2F2EA 1HC8A 2QQAA 3C18A 3BPXA 2GM4A 2JA5J 2MD5A 4OU0A 2W24A 1OCZH 1ZKGA 5D5UB 2D5VA 1I6XA 2LG4A 4AVPA 4CICA 2IA1A 5K7ZA 2NNYA 3H9QA 5HLGA 2YS9A 4HOBA 3I71A 3C2BA 3DEWA 3OR1C 1J5YA 3U2RA 1OCRH 2RN7A 3RKWA 2CQKA 5HDKA 2X1CA 1TQIA 3ZQCA 4IOCF 3DV8A 3MAJA 3EUHA 1LVKA 2H94A 1OYYA 3J81Z 2JT1A 1SFXA 4I2OA 4ANJA 1NH3A 2FOKA 1MH4A 1HLVA 2XKPA 4H0EA 1MDMA 2L0KA 2R5YA 4JK1X 1ZELA 5FGMA 3BP8A 1JXSA 4YFKF 5CVVA 4X1EA 4ESBA 1XGSA 3E5QA 4PJ0C 1BI3A 3LFKA 3I54A 3QP6A 3OOUA 4DGWB 4CXFA 4M6YA 2O8XA 2AXLA 3ZQIA 1ZK8A 2Y0SA 4XKCA 4DW6A 2DCEA 2P5VA 1HW2A 3W6JB 3IH3A 5FKKA 1STZA 4AWXB 4JX4A 3RYPA 1MBHA 2EA4A 1PP7U 3IH2A 2CW7A 3LQRA 2R5ZA 2FUG2 3H92A 2K02A 3T1BA 2VBZA 2M9HA 1EH7A 3FXUA 2IEKA 4A2UA 1P6RA 1MNMC 3LSJA 3DLAA 4XL9A 4LLLA 5BMZA 3CC7I 2R7FA 5J1YA 2XRNA 5IOZA 2A6HF 1Y6IA 3OIOA 3U1DA 2MGQA 2EH3A 5D4SA 1PUFB 1FMVA 2F6CA 3PNTA 3OYIA 4S04A 3F23A 3A1YA 1TW2A 3TW6A 2LD5A 1Z6TA 2K9LA 3I4NJ 2JZYA 1SC7A 1HF0A 1OQYA 5E8GA 4LK1F 3D5RC 4ZDLA 3R60A 1WFXA 2Y31A 2B63J 2RNGA 2M4GA 1E0EA 4F52A 1T2KA 4KMUX 2QWWA 4IPAA 1FYLA 1O57A 5HODA 2JA6J 3VDXA 4ASNA 3IRRA 4BL0B 2XC7A 1TWCJ 1V3FA 3B6AA 1MJ9A 3Q0VA 1ACIA 5ICFA 4ZTJA 3K69A 5LRSA 1Z9CA 4ZYAA 4YRVA 1FP2A 3P7NA 2K9SA 1IJWC 5CVIA 1E3PA 5IP6A 3IWFA 1GUUA 1FSHA 2XGCA 1UAAA 4LB6B 4M6VA 3CCUI 2LBFB 2O61A 4YIRX 3REOA 1IAWA 3I59A 3PFIA 1YG2A 2O0YA 2HU9A 3NARA 4QIWN 4N0BA 3FMRA 2OA4A 2HOSA 1D8JA 2BVLA 3H1CA 1KQ0A 4YIFA 2XAHA 1XGOA 4U0WA 4D9JA 4IXAA 4A5MA 4CUGA 2CJJA 4ON0A 3OL3A 4FX4A 4X6AJ 3AG2H 3OR2C 1U5TC 2GOXB 2P7CB 2FSWA 4M71A 4CHUA 2P0WA 1R23A 1XTAA 2K4JA 3JTHA 3SZGA 2PMZA 4M9SA 3OSFA 2IAIA 3GFMA 3MKYB 3DF8A 1WJBA 2VT2A 1X19A 2KLOA 4WK8F 3FZVA 4DJAA 5DUIA 4II3A 3E5UA 4E7JA 1EKEA 5DTDA 1YRNA 4CCNA 4NDLA 2XAQA 4BH9A 4HF1A 3V8KA 2F5FA 2VKHA 3D5SC 2VPLA 4HAMA 1J75A 2CFXA 2E2HJ 3RPQA 2JMWA 1FTTA 4BHCA 2FD5A 3B73A 3RTRA 2Z2SB 2CUZA 2A6TA 2EBIA 3V7SA 1EJ9A 3HTSB 3KP4A 2V4JC 3HKZN 4MFEA 2Z33A 1YS6A 3BZ6A 2KIUA 1LDDA 3HSRA 4RM3A 1VQ9I 5F04A 1FOXA 4I98B 5C44J 2GA1A 1O3QA 5JVGF 2M45A 2R7WA 1MMNA 1ERDA 3I58A 4UVBA 4AD9A 5CQGA 5FLVA 2H1LA 4RGRA 2HDCA 3JR9A 1YIOA 5BNGA 2ZJPF 4PZJA 3WU2C 2DYSH 4AYBN 5BQTA 2NAZA 2ECBA 2HZTA 2Z5UA 5HOOA 2QCOA 3ABLH 4A3JJ 1WZ2A 3GTPJ 5FFZA 2M5WA 2Y0SN 1B8IB 5H2FC 2PX9A 2X1DA 1J0RA 4KT5C 5D6EA 4XSZF 3I4PA 1YYVA 3VB2A 3MZYA 4C9YA 1TT5B 3PNYA 4U0YA 5LEJA 1JTXA 5D8KB 2E7XA 3EPZA 4YEJA 1X1BA 3PNVA 5E1ZB 3H0DA 2ETHA 1SD7A 2HKXA 3TO9A 4CA0A 2P8TA 1Z3XA 2XPWA 2DFEA 1NHAA 2TDXA 2JJ7A 2X48A 1JGSA 2E1OA 4UUSA 1QNTA 1G3WA 3DCFA 3VYRB 1SD6A 3T8TA 6PAXA 3G1LA 4NQWA 4XRMA 4AM3A 2DMQA 3O2PE 4OAYA 3EQLF 4BACA 2VOOA 2WBMA 3DBLB 4GDFA 2M3AA 4M73A 4II2A 4IHTA 1U0JA 1XSDA 1XMAA 1WJCA 3K4JA 3WTWC 1P92A 2M7AA 3H9JA 1LB2A 4MEXF 1K6OA 2HXOA 2Q2EB 3ZQ7A 4EM0B 1R1UA 3CUQC 1KU2A 4JQFA 4YG2F 2P6SA 5ICCA 2DK5A 4L9NA 2VIXA 3JRGA 1LE8B 1E3OC 4M3BA 4DYRA 2PFBA 2IS6A 1YFHA 1YHQI 3GEZA 3KPHA 1JI8A 4HX7A 1G6NA 5JFRA 1KU9A 1BM9A 1HBXG 1P7IA 2OZUA 4CGZA 2EV6A 2HVSA 4R8HA 3NQOA 4ZYGA 4XK4A 3EYIA 3JCUC 1A5JA 1NK2P 3P9IA 5GAHJ 1B6AA 1B1BA 2F4IA 3HJEA 1AKHA 1VQ6I 1W5SA 3JRDA 4E7HA 4OIOF 2A05A 1WVRA 4CYCA 3CC4I 3ESWB 2K27A 2Y69H 2E5ZA 4FT8A 4BKXA 5ICGA 3OYNA 1FOWA 2FBIA 1DUXC 2P7VB 1PDNC 3WGHA 5E79C 3C7JA 2XV4S 4NNJA 1U5TA 5CPRB 3K1NA 4XORA 3DLLF 5DCFA 1I3AA 2QGUA 4IQ4A 2MG4A 3PSFA 3ZMUA 4HYEA 2DFIA 4D1QA 3TKYA 2NVTJ 3RZOJ 3S2WA 2RV8A 5DCMA 4ENJA 5E18F 2L4MA 2ZFWA 3GTMJ 2XDVA 4J00A 5EEAA 3O3KA 1VNDA 3KE2A 5HDGA 3PFYA 1D8KA 2CS3A 1ZN2A 1FSEA 1XC5A 3HRMA 3CJNA 1VZ0A 2EFNA 1MMGA 1MBKA 4B8XA 1AOYA 2HVQA 3T5XA 1POGA 5JLWA 5E3MA 2E1NA 2CQNA 2O8KA 3KP7A 5C3EJ 2NXNB 4S05A 3MKLA 5LRRA 3ZN1A 1ZG1A 2OCEA 2E2JJ 1WJEA 4ENNA 4NHJA 3IC7A 4OAZA 2CG4A 2FF4A 1LFPA 3S14J 2LH9A 1Q1HA 3K4BA 2EV5A 1OCCH 3MEXA 4ZZDA 3J7AO 4G94A 5GADJ 1X3ZB 2L5QA 4WWCA 2R93J 3W2WA 3QYFA 4WXHA 3IRQA 4HQEA 1T8IA 5LD2C 2Y2ZA 3TDUC 4E7ZA 4LLNA 3K4LA 3ZMVA 1VI0A 1Z05A 1IN6A 1N77A 2DJNA 1FYKA 3G6EI 1T08B 1VFCA 2HQNA 2HFHA 2M8EA 4M74A 1NG6A 4HPQA 4A12A 2K9QA 5ILSA 1IN4A 2BY3A 2M87A 5EEGA 4BQNA 2IXSA 4BU2A 3A0BC 3VEPA 2MD0A 3BCAA 1E3HA 3HHGA 3MQ0A 2HTSA 5BPDA 2KJBA 3WHBA 4BQOA 1D0ZA 3H5AA 3OSGA 1CF7A 3KP3A 5BOXA 2WY8Q 4CZZA 1BJZA 3A01B 1MBFA 2CUJA 2BHZA 1N75A 3U9GA 2G7UA 1R7JA 2ICWG 1IV8A 4XQFA 2F48A 1YE9A 4M9XA 3DP7A 2MA3A 4P1WA 1Z91A 1B9MA 1SVLA 1WSUA 1MGTA 2EFWA 3O8HA 4MQVA 3SXYA 1I3QJ 2I5UA 3H36A 2GWRA 5F1JA 2EQRA 3QPSA 2EB7A 3C1DA 2K4BA 3ZQGA 2A6EF 3M8EA 2Z3YA 5F27A 3ROUA 4F55A 4YELA 4E6KG 5KAIC 1W36D 2CU7A 1LDJA 2XAUA 2ACJA 5CVUA 4IVNA 1WHUA 3U21A 5B1AH 3GTKJ 3TOAA 1OR7C 2LSOA 3BR5A 3KP5A 4IKFA 3QPLA 4XKVA 3DU5A 2AHQA 4C2TA 3R61A 2DODA 1SEUA 2H6CA 3ASNH 4HA8A 4EJWA 3CUQA 2LK2A 1AHDP 3SZTA 1IG7A 1CGPA 3GFLA 2H8RA 2J5OA 3KETA 2ISZA 3V8JA 2OC6A 1I1SA 3K0LA 2JA2A 5K7HA 4JX5A 3VYSB 3ABTA 4AIJA 2KIMA 3CMEI 3K4NA 1KU3A 3G1MA 1P4XA 3E6MA 4HG2A 5M5YJ 4XR6A 4BHPA 5EG0B 4R79A 4C2UA 2IGKA 2MABA 2E35A 3RCOA 4XMYA 3WE3A 2CV1A 9ANTA 3PUFA 3M7GA 1VQ5I 4JYKA 4RAGA 4UV9A 3OYEA 4KICA 2VJ5A 3ELKA 1F9NA 1OCOH 2V9PA 3K2ZA 1KYWA 1ZG5A 1T56A 1RZ4A 1Y1VJ 1R1TA 4OMYA 2MC4A 2XSDC 4ESFA 1FZPB 2NS7A 4LMYA 2CW0F 2P4WA 2CUEA 1K78B 5DEQA 2FBKA 2HGCA 3ABKH 2PEXA 2XKOA 4HNTA 3J80K 1T39A 3TMOA 2F5DA 4GGGA 2HPMA 3PO3J 1J2XA 2A5YB 2HYFA 3KLOA 3HDDA 4XLNF 2QBYB 2EIKH 3GUDA 4I6ZA 2L9VA 2X6XA 4B3AA 4MIMA 1D0YA 3QYBA 3E3VA 2ZJQF 1LKXA 1BC8C 5D6FA 1FEXA 3GFJA 1TQMA 1ORKA 3BPVA 5LLQA 5EF6A 3TL4X 2DK8A 2O3FA 2CFOA 3HPHA 3BROA 1FYMA 1G3SA 3W3CA 1H8AC 2K9MA 2QA4I 3H5NA 4IRGA 4BDYA 3JRIA 3N97A 4W1UA 4Y52J 4JX6A 1WRJA 3LWFA 4XKBA 2JA8J 1KGSA 2QEXI 1MD0A 1RR7A 3KLNA 2WADA 5FRNA 4XRSG 3BQYA 5J1RA 2DOEA 3CTAA 4CH7A 2O03A 3GXOA 2W00A 1IF1A 3S2DJ 2QQ9A 1Y8RB 1D0XA 1P2FA 2DQLA 1EV7A 1IRGA 3SDGA 1GDTA 2ESHA 1WJ5A 1YW7A 5KVRA 5J40A 2OF7A 2EPFA 1O7FA 3K70D 3BG3A 5J47A 1UHWA 3FXRA 1MSFC 1XS9A 3OMYA 2M1BA 2BXZA 2VI6A 3QOPA 3SQNA 2XUBA 3ONQA 5HNFA 5E3NA 1ZGJA 2L54A 3BTIA 4QPOA 1R6RA 2KRCA 3HOYJ 3CDIA 1D1AA 1B9NA 4L9JA 3OS0A 4V2GA 3KP2A 3CO6C 3G71I 4NB5A 3ABUA 4HX8A 1O3RA 3FHZA 2HKOA 2DQRA 3JRCA 3IP4B 2OPTA 4AC0A 5C4XJ 1SFOJ 1O3TA 1ZREA 4CDGA 2BXYA 5DDGA 3M1EA 3CD6I 3V8LA 4NBQA 3H5RA 1YQAA 1FP1D 2LMDA 4IO9F 3P5JA 4HRIA 4RBOA 3DKWA 4XOTA 4B3XA 3HXLA 1OR7A 3F8FA 2TRTA 3JRFA 5HS8A 2V7FA 1RKWA 1W5TA 3OYMA 3TBIA 2X6YA 3ZMSA 2OTJI 1SMYF 2AQFA 3HBLA 4LG0A 4OIPF 2DPUA 2BY2A 5LGNA 1UCRA 1W4MA 3VODA 5JVTA 5EGOA 3I5UA 3FXJA 4P5OA 3JSPA 4A69C 2GLOA 4EM1A 2R7XA 5AIQA 3TO7A 3E1SA 3PM1A 1HXDA 3RYRA 2KZVA 1BR4A 1S5LC 4CCMA 4BY1J 1ETOA 2NVYJ 5KK1A 5BPIA 1BBYA 3NWTA 1RESA 2VASA 2B7EA 1K7AA 5GPCA 3RPUA 3PJRA 3FXLA 1UMQA 1APLC 2YX4A 3GZ5A 3F3XA 3CQZJ 3DKXA 3KZIC 2R7TA 2V1UA 2BVMA 2ADUA 5KAFC 4XICA 3CMAI 2EILH 1IW7F 3E6DA 4CCOA 1QPIA 3OY9A 1LDKB 3FWEA 3L2CA 3FX3A 2O7OA 2K85A 3ZQHA 2DBBA 1R58A 1WPKA 4F92B 3K10A 1OFCX 2KZGA 1BI1A 3JTGA 2WC2A 2VKDA 5K1YA 2Y75A 1OLTA 2OD5A 5K7FA 1R71A 2EZIA 1KU7A 4IRIA 1ETVA 4ETSA 3J80Z 4G6DA 2NRAC 3LA2A 1FIPA 4N9HA 2K9NA 4IF4A 2RAEA 1DQUA 3DTEA 4Y15A 3FXOA 2XASA 3FDYA 3BY6A 2IS2A 3C2GA 1X4OA 3FM5A 3OYAA 4LK0F 1I5ZA 2MH2A 3OYBA 3E5XA 2HR3A 3CP2A 3HOXJ 1VQMI 1JKQC 2XROA 2Y9ZA 1JT0A 1B59A 1K4SA 3I0TA 4EV0A 1UJ8A 2DU9A 2ZBKA 4L5JA 4E7SA 4B43A 3HOSA 5GAGJ 2WWYA 3HHHA 4V2FA 2KIFA 4RAZA 1A6QA 5BS6A 5HDNA 3WE2A 1VQOI 2M30A 5DD8A 1VQ4I 2CQQA 2FJ1A 4OIRF 4RGSA 1FJLA 2KRHA 2Z16A 2V6CA 3RKYA 2HI3A 1JUSA 2IJLA 1IO2A 3PSIA 2JSPA 4I0BA 4G6QA 3ASOH 3RSNA 4W97A 4HLXA 1ZAOA 2QKMB 5JI6A 3F8CA 3KCCA 3QAHA 1Z77A 4HV5A 1MBJA 3L7WA 5GTHC 3GX4X 3BTLA 4Q4ZF 1IRFA 5E3OA 2VE9A 2AQEA 1JUMA 4ABZA 2MC3A 5L3BA 1TWGJ 3G3ZA 1LQ1A 2VJIA 3JREA 2E1CA 4RLFA 3MFKA 5CVRA 3A02A 2KMUA 3FISA 2K7LA 1IN8A 2BY0A 4EJOA 3GTGJ 2EIMH 3CJRB 3GFIA 1YJNI 1VQ7I 1TC3C 3TDZC 2H8WA 4BE2A 1R4NB 5IY5H 4XOPA 4A3LJ 2E19A 1XMKA 2QYOA 1UB9A 3QQAA 3ERMA 5FJ8J 4IL6C 4XLFA 4AUXA 4QTRA 5KNLA 4HDUA 1EH6A 1IN5A 1BOAA 3P9KA 3BZKA 2IGOA 2CYYA 4BS9A 1PUFA 2DTRA 3W2VA 4BE0A 5FKMA 2V1XA 1GV5A 1ZG3A 3DQVC 5EJCA 1G3YA 3ZPLA 2FBHA 3BJAA 4E4HA 5EZHA 4OIQF 2V1DA 1Z1DA 2F4OB 1T38A 3WTZA 1V5GA 3GO5A 2LY9A 4IOAF 2XB0X 2XPUA 3OIPA 3VWBA 1ODDA 3BQZA 3AG1H 4E7KA 1DGRM 3GMEA 3LFUA 1H9TA 4U87A 1ZR4A 4FISA 1FNNA 4RMNA 3H35A 2R3SA 1DPUA 1ZHFA 4EGZA 2LF8A 4KIBA 2CQXA 1QBJA 3HSEA 3CCQI 4KJZA 1C0WA 1LVAA 2NYXA 4P9UA 2CMPA 5FFXA 1U9OA 3I64A 4EATA 2QF7A 3S2HJ 5EDNA 4BJ5C 3CLOA 3W6VA 2E1MB 1TWHJ 1X3UA 2QSFX 2EINH 2XVCA 2E36A 2LBFA 2R7SA 1Q1VA 4MQ9F 3V7RA 1JJ6C 3WG7H 5ILUA 2PJRB 3KZZA 2CRGA 1K83J 2OZ6A 2RQPA 5HNHA 2GBYA 3QYEA 4FHTA 2VBXA 5DD4A 3R4KA 4HSTA 3UKGA 3I9V2 1QRYA 3N05A 1HKSA 1QZZA 4OWRB 3WG9A 4KYWA 3SZPA 3WU1B 4LIVA 4NUBA 1MNDA 4XLHA 3FK7A 5DS9A 5DV5A 3ZN0A 4BXXJ 2FEZA 1BC7C 4RB1A 3E7LA 2AO9A 2R7RA 5B1BH 3K4KA 4Y33A 4ZC3A 1MJAA 4EJTA 4PFOA 1UELB 2O5RA 5B66C 2K3FA 5H6QA 1OMIA 3L2VA 1S72I 4L9TA 2JUCA 5E17F 4CZCA 3M07A 2DA6A 1P7JA 5L3FA 4FE7A 4L18B 1HKTA 2IVMA 2LYCA 5HLIA 4UV8A 1DP7P 4BAYA 2BW3B 2LP0A 4A3KJ 1I27A 1U9NA 3BJOA 2BEOA 2NVQJ 1XX5A 2HWVA 4A0XA 3QU6A 1W7PD 1BN5A 4KT6A 1UG2A 3C2HA 5E1XA 4IZZA 4G6TB 2FU4A 4G9YA 2WA0A 4Q5SF 3SHFA 2CWEA 2XAFA 1Z7LA 1Z21A 3LSMA 1D1BA 4FTHA 2L02A 2PQ8A 4FASD 1YI2I 1GT0C 4LG3A 1FPQA 2HYGD 1XB4A 3DU6A 4IHWA 2ZXWH 2VJ4A 2A61A 2XGDA 2MLGA 2ELJA 2Y48A 4O5VA 3QPHA 4IRHA 2YU9J 5ILVA 2DI3A 4XNFA 1YW9A 2CSOA 4HF0A 3WTUC 3OYHA 3BG6A 2BHYA 1LFUP 2DO7A 1BI2A 2ZCWA 2L7ZA 3HZJA 4GFBA 1B8IA 1RETA 4MFDA 2DMUA 1KA8A 1L0OC 2DPDA 5HVQC 3ZOBA 4UVAA 2OTLI 1G3TA 2IT0A 2OJED 2BE5F 1YX5A 1BA5A 1TW3A 1YO5C 3E97A 1Y56A 5K5RA 5F6FA 3CDHA 2VBYA 3BT9A 4KN7X 1V54H 3I3LA 4U7BA 3OS1A 2P6TA 2VQCA 4G7ZF 2PMHA 5FB2A 1LJ9A 2D1VA 1W5CC 3HG9A 4RGXA 1BL0A 1YX3A 5DYMA 2Q8KA 3RIRA 1IRZA 5IT9K 1M1EB 3RI4A 4A0ZA 2LRDA 1R22A 2N8GA 4G12A 3ZQQA 1QVTA 3KP6A 2OV7A 2RC4A 4M3EA 4BXUA 5FLMJ 3CDLA 4BEHB 4CSWA 5L3CA 1VQ8I 4G8XA 5B3SH 5ED4A 1D5VA 1OYIA 3Q0WA 4FE4A 1BR2A 1X58A 3MWMA 2FNAA 5EZGA 1OYWA 1TWAJ 4X0GA 2XAGA 2FX0A 2Q2EA 2DLLA 1OPCA 2FA5A 4GYIA 4KUMA 4U88A 4EVIA 3L2WA 4MLOA 4HLYA 1YITI 1HCRA 3EYYA 2HQAA 3ZXSA 1LE8A 1ZLKA 4IHYA 3E0JB 1X1CA 1RUNA 1ZH5A 3BR3A 4PUSA 4I0AA 5GAEJ 3AL0B 1DDNA 4Y4RA 3RQ4A 4I09A 2IP2A 2BY1A 4WX9A 4G7HF 4O3MA 2Z9OA 1X4PA 5M5XJ 1VQLI 3BOQA 2PMZN 3GTJJ 4Y13A 2XB5A 4L9VA 2DOAA 1IZ1A 3LSIA 2FQ3A 3GW2A 2ME0A 1R49A 2O6GE 2O9LA 2XF7A 3P9CA 1R5HA 4KFCA 4QPQA 1I50J 2BZTA 2D45A 1MMDA 4HBLA 3HRUA 2DN0A 3QOEA 1Z7UA 2I8DA 3HTUA 3IAM2 4XLEA 4PJNA 1FX7A 2RGVA 2VXDA 4A3IJ 2K40A 1R5GA 4HEA2 3D0SA 2QSGX 4HNVA 3GZ6A 2JTVA 1LUJB 2EWNA 3KEQA 3WTSC 4KNYA 3FK6A 2LKXA 3KYCB 4K2EA 3OIQA 5IT3A 3GZNB 3DKYA 2LR8A 4XLAA 4AIDA 4B48A 3KEYA 1RRJA 3DXJF 3F22A 1SFKA 4PJMA 1TL8A 4D5CA 1LNWA 1PYVA 3HPGA 1ONVA 3RKQA 5JR3A 3M9AA 4ZYDA 1J59A 1H88C 2Y9YA 3ZRGA 3MKWB 1HDPA 1XSVA 5JLXA 4XLCA 2DDAA 4D5FA 3OL4A 2W7NA 2KDZA 1B72B 1R00A 1PUEE 4RB3C 1CQTA 4OINF 2FRHA 1QHGA 1XG1A 1X1AA 4BY7J 5LHHA 4DIQA 3H3ZA 1S9HA 3IAS2 1KYZA 5B5EC 2X1EA 2COMA 3MZHA 3SDBA 1FBQA 1FLIA 1L3LA 1F1ZA 3PUBA 2E5NA 1V55H 1HSJA 2P81A 2J5PA 2P5LC 2ID6A 4MEYF 4RLQA 3CLQA 4CCJA 2VKEA 2WAFA 2EFPA 4UXNA 3HUGB 2DT7B 1WH5A 5FROA 4QSHA 3TGNA 1BW6A 1EF4A 1XD7A 3A01A 4PSXA 1V5FA 4BNCA 3HOZJ 2CUFA 2FXAA 4F93B 4V19K 1YS7A 3DPTA 2VKVA 4XSXF 3DBRB 4JOMA 4UHTA 3BWGA 5F0CA 1FOKA 3BG9A 3HM5A 2ZNZA 2FQ4A 1HOMA 2LKSA 3B6CA 2G0EA 5IT9Z 3QPTA 1X3WB 3Q9VA 2EK5A 3CF5F 2R7OA 1T6SA 3OYKA 3TW7A 4WCGA 4XRSA 3S17J 4RB2C 5A2QK 3M3YJ 4WF2A 2DDBA 2YSRA 2ZC2A 2G7HA 4EM2A 2VLAA 2C6YA 4HF2A 2R7UA 4BBRJ 1T0FC 1KONA 3ECHA 2W1OA 3CCVI 1QPMA 2L9SA 5L3DA 2UXNA 2M7BA 4JBAA 2MFZA 5J8CA 1Y1WJ 1W7PB 2WAEA 3FMSA 5H6RA 4XM3A 5L3GA 1SFUA 2VC0A 2JUGA 4HDVA 4B1RA 1HW1A 2E2IJ 4CYDA 1JJ8C 5EG0A 2KP6A 2QKLB 2KIQA 3BCBA 3HSFA 2W25A 3DTKA 1T33A 3ISPA 3S93A 4ENMA 2F5VA 3HRTA 1U2WA 5HS7A 2W57A 1E2XA 2ELHA 2EV0A 3WTVC 1JKOC 1SFEA 3G73A 2QSHX 1JUPA 2M34A 3ECOA 1I1GA 4IHSA 3BDDA 3QODA 5LGTA 3ZP5A 5AIPA 3A4CA 4JP0A 1YJ9I 1WH7A 1K78A 1A6IA 2H09A 4UUVA 1XCVA 2DA5A 2X6OA 2KT0A 2GOMA 3H3UA 3EUKL 2LF7A 4F7ZA 1BOBA 2HQ5A 2QBYA 1MKMA 4BXFA 5F08A 2V9KA 2E34A 3IWZA 4HX4A 3AG4H 4EQQA 2IS1A 4ZTFA 2XF6A 3FXMA 2QLZA 3OYDA 3LMMA 1XSXA 2UWMA 1ON2A 2HNHA 5EYRA 3LSGA 3H3VK 1WWXA 2XAJA 3CUOA 3HEFA 5FKLA 1OCTC 1PJRA 4AIKA 3J7ZI 4FX0A 2MH9A 1RUOA 1LEAA 2Q1ZB 5TISC 1ZRFA 4KISA 1USTA 2CH0A 3LSTA 3MN2A 4UB8C 4LITA 1MMAA 2EA2A 3T0YA 5J6XA 4BDZA 3QWLA 2A69F 4EJUA 1LEBA 3JAMK 3TO6A 2DA4A 2CW8A 1JGGA 4U0VA 4DOZA 5IPAA 2YR2A 3IL2A 1I6HJ 3DBHB 3CCSI 1IRXA 2JVHA 4NC8A 4TV7A 2G9WA 2WAQA 3TQNA 4E70A 5E20A 1TNTA 1TNSA 1UHSA 2LY1A 1ZQ3P 3FHNA 1K61A 2ZKZA 1JHHA 2HVRA 1Z6RA 2GIZA 3EDPA 3LL7A 2H27A 1Z0XA 4PJLA 1TQPA 3ZMTA 4A3GJ 1V4RA 2K5CA 1T98A 4KMFA 2XGXA 1U6GA 3IUOA 1MSEC 3MCZA 3CCRI 2PG4A 2ZMEB 3HL2A 4EEFG 1MZBA 2VXZA 1ITYA 1MH3A 1RR8C 4AIHA 4F91B 2JSCA 3PO2J 3HGYA 4I01A 5FD6A 3QU3A 1ULYA 4RS8A 1YLFA 4WXCA 1GXPA 3COAC 1BI0A 5F0HA 1KQ9A 1JKRC 2X4HA 2W82A 2RDPA 1WCMJ 2KQRA 2UXXA 4ZDOA 3N4MA 5D8LB 1FMWA 3IHUA 3AG3H 1R4MB 2NVUB 3L2RA 1FTZA 1RKTA 2XRLA 4GRIA 5IOYA 4M72A 5A2QZ 4A6DA 4D0PA 4J19A 2DXIA 2Z99A 1QZEA 1T0FA 2DW4A 2JVGA 2LFBA 3DWLE 3R0AA 3U1KA 1U3EM 3BR1A 1K6YA 2CV2A 1TP4A 2VQLA 4D7MA 2P5KA 3OYCA 3K6GA 4MNUA 1QQIA 1T95A 4MGRA 4CCKA 5M3FJ 5CYVA 4CCLA 5IYCJ 2BYVE 2IBDA 1MDMB 2R5YB 5LBQA 2EZKA 3G2BA 4C30A 2VQGA 1EA3A 2ISYA 1DGWY 1X2MA 3BTCA 1USSA 5HLHA 2RKHA 4A3EJ 2B9SA 2E1MC 2XSJC 4IJAA 3V4GA 1P4WA 1TBXA 4HZFA 1AA7A 1XMXA 2XPVA 1LFBA 2LVSA 4C3HJ 4A5NA 5JHUA 1RC9A 1SAXA 4BGDA 2LDUA 3D5LA 2EIJH 2WB1A 1YOVB 2VPRA 3HKZA 5ICEA 2B0LA 2M8GX 1VQPI 1O3SA 3K7AJ 3M4OJ 2EZLA 3K70C 2LLKA 3L2UA 4NC6A 2R5ZB 2EJRA 2VBWA 1NTCA 2M0CA 1Y39A 2KPMA 4LB5A 1MW7A 1ETQA 5CKTA 1QVUA 1GHCA 3F0CA 1ZTRA 5C4JJ 3VFZA 1BW5A 3MMYB 1TTYA 3KYDB 4RGUA 1ZGWA 4GXOA 4UB6C 1W0UA 1H9GA 1A35A 3FKIJ 2IRFG 5IYDJ 4AYBA 4ENKA 5FKOA 3WTYC 3CESA 3ULQB 3BG7A 1ZYRF 2YU3A 3V7CA 2LY2A 3SYTA 3LSKA 4NC7A 3E6BA 4AVZA 2W48A 3GTLJ 2F4MB 5K5OA 4Q48A 4GCVA 3ERED 1TT0A 3GYHX 1REPC 3D1NI 2W84A 1FY7A 3LAJA 5IP9J 3A0HC 1PVEA 1WKMA 3K4MA 3HRSA 5E3LA 1VF9A 1UHMA 2OU2A 3BG5A 3JAMZ 1B4AA 3FIWA 3UR3C 4P9FA 1SD4A 1J09A 1Y8QB 1EH8A 1MBGA 2VOPA 1P9QC 1YIJI 1ZRDA 2YX7A 3Q5FA 2RREA 3L09A 1JHFA 4N4OB 4A93J 3H0GJ 1MIJA 4XRFA 1MMSA 1F43A 2E60A 2WAQN 5GPAA 2STTA 1J7KA 1VQKI 2VE8A 3C3WA 3O8GA 2QQ8A 2H1KA 3MVPA 3TOBA 3CF2A 4YIIA 2PJPA 4PDKA 3I59B 2L3DA 2UV1A 4C3IJ 1IGNA 2GIVA 1SANA 1HSTA 1Z67A 2YUSA 3ZQLA 2V6EA 4HQMA 3V42A 4MHGA 3LSRA 1KQ8A 2L2OA 2ZSIB 2KFDA 2WV0A 5GTIC 2IGMA 4PSWA 4MTDA 3CO7C 4O6JA 2K3PA 5F64A 3I4MJ 2HPIA 3BTJA 3QRFF 2GAUA 2WV1A 2A68F 2DMNA 2X85A 3AAFA 2DA1A 4BJTA 5LHIA 3DPLC 3F8MA 2K86A 4LJZF 2WTEA 3F6VA 2IPQX 4HW0A 2F5EA 4FQGA 4A0YA 1ZGAA 2KISA 5CQEA 1HKQA 1FOYA 3L9FA 1YJWI 3S16J 1QZYA 3R6SA 3S15J 1G8XA 4A3DJ 2HTJA 2IA2A 2GA2A 1YRNB 3CCLI 1WJDA 3CJQB 2OBPA 2FNPA 3K2AA 2MBFA 3RKXA 1DPRA 4BQAA 3FF5A 2CV0A 5M3MJ 1LPQA 5J1UA 5CLSA 4M6XA 1IV6A 5EEHA 4KITB 3F9KA 2L7FP 4L5IA 2EZHA 5LGUA 3CJTB 1S8NA 2X51A 3LNQA 5M5WJ 3WGGA 4B4CA 4Y17A 3SFIA 2IS4A 2HS5A 2ZO4A 1BJAA 5HLTA 3KEOA 2V1NA 4U7DA 3A03A 2BGCA 2D1HA 3FM3A 2Q0OA 4IQJA 2BBYA 2ZJ2A 3AL0C 1S3JA 1SAUA 2PJRA 2RNJA 1TWFJ 3MKZA 3QP5A
chains in the Genus database with same CATH topology
2PMUA 1H0MA 3K1PA 2KJCA 3O6BB 5D4RA 3GWZA 4OOIA 4M9ZA 2HQRA 3R0JA 4QWQA 1HW5A 2IW5A 2R7DA 5TRDA 3ML6A 3PQJA 1TLHB 2DAOA 4A6EA 1FC3A 3GLXA 3WGIA 3F72A 5D5XB 5J8FA 4P55A 1IXSB 2QENA 3NRVA 3I53A 2GXBA 4LGWA 5AONA 3B02A 2A07F 2L01A 1K79A 1XN7A 3FXQA 1IN7A 1XGNA 1BIAA 1HQCA 4BYYA 2JPCA 4UNOA 1WQ2A 4WXDA 1U8RA 4XLPF 1RNLA 4OMZA 3DEUA 4GYGA 1IXRC 2QUFA 2L4AA 2QM3A 1ZARA 3M8FA 3WODF 4RB0A 5FLXK 4KIGA 2JPBA 3HOTA 4Z2YA 2IA0A 1R1VA 2UZKA 1U5TB 1J9IA 2VONA 3GF2A 3LA7A 5DCMB 4L0ZB 1OKRA 2VN2A 1RI7A 1ZRCA 1S6LA 2MLKA 3LAPA 3Q9SA 4B09A 3HYIA 3W6KB 2PN6A 5D5WB 1UFMA 4EJVA 2V9VA 3OOPA 1BIBA 5FO5A 2ESNA 4P96A 3KZYA 3SFZA 3F21A 2V79A 2KKOA 3JSOA 1P4AA 4KIFA 1F4KA 4MTEA 4ZZLA 1CF7B 1R36A 1A04A 1ZLJA 1FWZA 2NS0A 3K1MA 2PLYA 4R1HA 3RJPA 2X0LA 1IXCA 5E1WA 1XDSA 3PQKA 2F5CA 4I02A 2D2WA 1O7LA 1YTYA 3IKVA 4YFNF 2LNBA 4ZYEA 5H20A 4XBFA 3LA3A 3CUQB 5HS9A 2HOEA 2VODA 2RVCA 4Q47A 5L3EA 1E17A 3ZMZA 3DFGA 2STWA 4ESJA 2XIGA 4KN4X 1Y0UA 3F8NA 1S29A 2EFOA 1SD5A 3L00A 2Y0MA 3HUGA 2E7WA 4EGYA 1XDUA 3VOEA 5FLXZ 5CJ9A 2OAZA 5TJJA 4ZH4F 4HV6A 2CO5A 4I7HA 2GZWA 1GVJA 5K5QA 2BV6A 4DQ2A 2PI0A 3KFWX 1IUYA 1YW8A 4YFXF 1PP8F 1FBSA 2DT5A 4LLGF 4BHBA 2GQQA 3F6OA 1XCBA 5D5VB 3J81K 2JRTA 4DNCA 4GO1A 4KDPA 1MJBA 1W7PA 2H6BA 5LHGA 1QGPA 2ZXJA 3LQQA 3WTXC 2FMYA 4CO8A 1XGMA 3BJ6A 5DUKA 3ZMDA 2XHKA 4L0YB 2NNNA 2W85A 2OQGA 3FMQA 2A3SA 4PGGA 2KRFA 3K9TA 4PGHA 2VC1A 1G4DA 2QQBA 2OQRA 1SMTA 3HIFA 3NEUA 1RIOH 4QLCU 3IKTA 5CVJA 1S7OA 5FD5A 4LG0B 1D3YA 4UVCA 3E6CC 1JE8A 1F5TA 5F1RA 2FE3A 5LEKA 4ZYHA 3WTTC 3EETA 5ERIA 4N9IA 3F8BA 1QO0D 3GVAA 2YPRA 2ZNYA 2EFQA 3WU0A 5E8IA 2VT3A 1FT9A 1WI9A 2PBIA 2QVOA 4PCQA 3JW4A 4LD5A 4EMSA 1U78A 2AS5F 2ZMEA 2FMLA 2GXGA 3T8RA 4RAYA 1ON1A 1AWCA 2HEOA 2QZ8A 3OV8A 4KA4A 1GXQA 1S7AA 3RDIA 4G7OF 4LFUA 1FBUA 1VTNC 2CGPA 2LKPA 2F2EA 2QQAA 3C18A 3BPXA 2MD5A 4OU0A 2W24A 5D5UB 1I6XA 4AVPA 4CICA 2IA1A 2NNYA 5HLGA 4HOBA 3I71A 1J5YA 3U2RA 2RN7A 3RKWA 2CQKA 5HDKA 1TQIA 3DV8A 3MAJA 3EUHA 2H94A 1OYYA 3J81Z 2JT1A 1SFXA 4I2OA 2FOKA 2XKPA 4H0EA 1MDMA 4JK1X 5FGMA 1JXSA 3BP8A 4YFKF 5CVVA 4ESBA 1XGSA 3E5QA 1BI3A 3LFKA 3I54A 3QP6A 4CXFA 4M6YA 2O8XA 2AXLA 2P5VA 1HW2A 3W6JB 1STZA 4AWXB 3RYPA 2EA4A 1PP7U 3LQRA 3H92A 2K02A 3T1BA 2VBZA 1EH7A 3FXUA 4A2UA 1P6RA 4LLLA 5BMZA 2R7FA 2XRNA 2A6HF 3U1DA 5D4SA 4S04A 3F23A 1TW2A 1Z6TA 2JZYA 5E8GA 4LK1F 3R60A 1T2KA 4KMUX 2QWWA 4IPAA 1FYLA 1O57A 4ASNA 3IRRA 1V3FA 1MJ9A 5ICFA 3K69A 5LRSA 1Z9CA 1FP2A 3P7NA 5CVIA 3IWFA 1FSHA 4LB6B 2O61A 3REOA 1IAWA 3I59A 3PFIA 1YG2A 2O0YA 4N0BA 3FMRA 2OA4A 1D8JA 1KQ0A 4YIFA 2XAHA 1XGOA 4U0WA 4IXAA 4A5MA 4ON0A 4FX4A 1U5TC 2P7CB 2FSWA 4M71A 4CHUA 1R23A 2K4JA 3JTHA 4M9SA 3GFMA 3DF8A 2VT2A 4WK8F 3FZVA 5DUIA 3E5UA 2XAQA 4BH9A 4HF1A 3V8KA 2F5FA 4HAMA 1J75A 2CFXA 3RPQA 4BHCA 3B73A 3RTRA 3V7SA 3HTSB 3KP4A 2Z33A 1YS6A 3BZ6A 2KIUA 1LDDA 3HSRA 4I98B 1O3QA 2GA1A 2M45A 3I58A 4UVBA 4AD9A 4RGRA 2HDCA 1YIOA 4PZJA 5BQTA 2NAZA 2HZTA 2Z5UA 5HOOA 5FFZA 2M5WA 1J0RA 4KT5C 5D6EA 4XSZF 3I4PA 1YYVA 3VB2A 3MZYA 4U0YA 5LEJA 5D8KB 2E7XA 5E1ZB 2ETHA 1SD7A 2HKXA 3TO9A 2P8TA 1NHAA 2TDXA 1JGSA 1QNTA 1G3WA 1SD6A 3T8TA 6PAXA 4NQWA 3O2PE 3EQLF 2VOOA 4M73A 4IHTA 1XSDA 1XMAA 3WTWC 1P92A 1LB2A 4MEXF 1K6OA 3ZQ7A 4EM0B 1R1UA 3CUQC 1KU2A 4JQFA 4YG2F 2P6SA 5ICCA 2DK5A 4L9NA 2PFBA 1YFHA 3GEZA 4HX7A 1G6NA 5JFRA 1KU9A 1BM9A 1HBXG 2OZUA 4CGZA 2EV6A 4R8HA 3NQOA 4ZYGA 3EYIA 3P9IA 1B6AA 1B1BA 1W5SA 4OIOF 2K27A 4FT8A 5ICGA 2FBIA 1DUXC 2P7VB 1PDNC 3WGHA 3C7JA 2XV4S 1U5TA 3K1NA 5DCFA 3ZMUA 4HYEA 2DFIA 3TKYA 3S2WA 2RV8A 5DCMA 4ENJA 5E18F 2L4MA 2ZFWA 3O3KA 3KE2A 5HDGA 1D8KA 1ZN2A 1FSEA 3HRMA 3CJNA 2EFNA 4B8XA 1AOYA 3T5XA 2E1NA 3KP7A 4S05A 5LRRA 3ZN1A 1ZG1A 4ENNA 4NHJA 3IC7A 2CG4A 2FF4A 1Q1HA 2EV5A 3MEXA 4ZZDA 3J7AO 4G94A 4WWCA 4WXHA 3IRQA 4HQEA 3TDUC 4LLNA 3ZMVA 1Z05A 1IN6A 1FYKA 2HQNA 2HFHA 2M8EA 4M74A 4A12A 5ILSA 1IN4A 2M87A 5EEGA 3VEPA 3MQ0A 3HHGA 2HTSA 5BPDA 2KJBA 1CF7A 3KP3A 5BOXA 4CZZA 3U9GA 2G7UA 1R7JA 4M9XA 3DP7A 2MA3A 1Z91A 1B9MA 1WSUA 1MGTA 2EFWA 4MQVA 3SXYA 2GWRA 2EB7A 3C1DA 2K4BA 2A6EF 3M8EA 2Z3YA 3ROUA 1LDJA 2ACJA 5CVUA 4IVNA 3TOAA 2LSOA 3KP5A 3R61A 2H6CA 4EJWA 4HA8A 3CUQA 3SZTA 1CGPA 3GFLA 2J5OA 3KETA 2ISZA 3V8JA 1I1SA 3K0LA 4AIJA 3ABTA 2KIMA 1KU3A 1P4XA 3E6MA 4BHPA 4R79A 3WE3A 3M7GA 4UV9A 4KICA 3ELKA 1F9NA 3K2ZA 1KYWA 1ZG5A 1RZ4A 1R1TA 4OMYA 4ESFA 1FZPB 4LMYA 2CW0F 2P4WA 1K78B 5DEQA 2FBKA 2HGCA 2PEXA 2XKOA 3J80K 1T39A 2F5DA 4GGGA 1J2XA 2A5YB 2HYFA 3KLOA 4XLNF 2QBYB 3GUDA 3E3VA 1BC8C 5D6FA 3GFJA 1TQMA 3BPVA 5LLQA 2DK8A 2O3FA 3BROA 1FYMA 1G3SA 4IRGA 3N97A 1WRJA 3LWFA 1KGSA 1MD0A 3KLNA 3CTAA 2O03A 3GXOA 1IF1A 2QQ9A 1P2FA 2DQLA 1EV7A 1IRGA 2ESHA 1YW7A 5KVRA 1O7FA 1UHWA 3FXRA 2M1BA 3QOPA 3SQNA 2XUBA 1ZGJA 2L54A 1B9NA 4L9JA 3KP2A 3CO6C 4NB5A 3ABUA 4HX8A 1O3RA 3FHZA 2HKOA 2DQRA 1O3TA 1ZREA 4CDGA 5DDGA 3M1EA 3V8LA 1YQAA 1FP1D 3DKWA 1OR7A 3F8FA 5HS8A 1W5TA 3ZMSA 1SMYF 4LG0A 4OIPF 2DPUA 5LGNA 1UCRA 1W4MA 3VODA 5JVTA 3I5UA 4P5OA 3JSPA 4EM1A 5AIQA 3TO7A 1HXDA 3RYRA 5KK1A 5BPIA 1BBYA 1K7AA 3RPUA 2YX4A 3GZ5A 3F3XA 2V1UA 2ADUA 1IW7F 3E6DA 1LDKB 3FWEA 3L2CA 3FX3A 2DBBA 1R58A 1BI1A 3JTGA 2WC2A 5K1YA 2Y75A 2OD5A 1KU7A 4IRIA 4ETSA 3J80Z 4G6DA 2NRAC 3LA2A 4N9HA 4IF4A 4Y15A 2XASA 3BY6A 3FM5A 4LK0F 1I5ZA 2MH2A 3E5XA 2HR3A 2XROA 1B59A 3I0TA 4EV0A 2DU9A 2ZBKA 4L5JA 3HOSA 2WWYA 3HHHA 2KIFA 4RAZA 5BS6A 5HDNA 3WE2A 2M30A 5DD8A 4OIRF 4RGSA 2V6CA 3RKYA 2IJLA 4I0BA 4G6QA 4HLXA 1ZAOA 5JI6A 3F8CA 3KCCA 3QAHA 4HV5A 3L7WA 3GX4X 4Q4ZF 1IRFA 2VE9A 2MC3A 5L3BA 3G3ZA 1LQ1A 2E1CA 3MFKA 5CVRA 2K7LA 1IN8A 4EJOA 3GFIA 3TDZC 1XMKA 2QYOA 1UB9A 4HDUA 1EH6A 1IN5A 1BOAA 3P9KA 2CYYA 2DTRA 2V1XA 1ZG3A 3DQVC 1G3YA 3ZPLA 2FBHA 3BJAA 4OIQF 2V1DA 1Z1DA 1T38A 3WTZA 3GO5A 1ODDA 1H9TA 1FNNA 2R3SA 1DPUA 1ZHFA 4EGZA 2LF8A 4KIBA 1QBJA 3HSEA 1C0WA 1LVAA 2NYXA 4P9UA 5FFXA 3I64A 3CLOA 1X3UA 2XVCA 4MQ9F 3V7RA 5ILUA 3KZZA 2OZ6A 2RQPA 4FHTA 2VBXA 5DD4A 3R4KA 1HKSA 1QZZA 3WG9A 4KYWA 3SZPA 3WU1B 5DV5A 3ZN0A 2FEZA 1BC7C 4RB1A 1MJAA 4EJTA 5H6QA 1OMIA 4L9TA 5E17F 5L3FA 4L18B 1HKTA 2IVMA 5HLIA 4UV8A 1DP7P 4BAYA 1I27A 3BJOA 2BEOA 2HWVA 4A0XA 3QU6A 1W7PD 1BN5A 5E1XA 4G9YA 2FU4A 4Q5SF 3SHFA 2CWEA 2XAFA 2L02A 2PQ8A 1FPQA 2HYGD 1XB4A 2A61A 2MLGA 2Y48A 4O5VA 3QPHA 4IRHA 5ILVA 2DI3A 1YW9A 2CSOA 4HF0A 3WTUC 2DO7A 1BI2A 2ZCWA 1KA8A 1L0OC 2DPDA 5HVQC 4UVAA 1G3TA 2IT0A 2BE5F 1TW3A 1YO5C 3E97A 5K5RA 5F6FA 3CDHA 2VBYA 4KN7X 4U7BA 2P6TA 4G7ZF 2PMHA 5FB2A 1LJ9A 2D1VA 4RGXA 5DYMA 2Q8KA 3RIRA 5IT9K 3RI4A 4A0ZA 1R22A 3KP6A 2RC4A 4BXUA 5L3CA 4G8XA 5ED4A 1D5VA 1OYIA 3MWMA 2FNAA 1OYWA 2XAGA 2Q2EA 2DLLA 1OPCA 2FA5A 4GYIA 4KUMA 4U88A 4EVIA 4HLYA 3EYYA 1ZLKA 1RUNA 1ZH5A 4I0AA 1DDNA 4I09A 2IP2A 4WX9A 4G7HF 4O3MA 2Z9OA 3BOQA 4Y13A 4L9VA 1IZ1A 2FQ3A 3GW2A 2O6GE 3P9CA 1R5HA 4KFCA 2D45A 4HBLA 3HRUA 1Z7UA 3HTUA 1FX7A 2RGVA 1R5GA 3D0SA 3GZ6A 2JTVA 2EWNA 3KEQA 3WTSC 4KNYA 5IT3A 4K2EA 3DXJF 3F22A 1LNWA 1ONVA 5JR3A 3M9AA 4ZYDA 1J59A 1XSVA 1R00A 1PUEE 4RB3C 4OINF 2FRHA 5LHHA 3H3ZA 1KYZA 2COMA 3MZHA 1FBQA 1FLIA 1L3LA 1F1ZA 1HSJA 2J5PA 2P5LC 4MEYF 2EFPA 4UXNA 3TGNA 1XD7A 4BNCA 2FXAA 1YS7A 3DPTA 4XSXF 4UHTA 3BWGA 1FOKA 2ZNZA 5IT9Z 3QPTA 3Q9VA 2EK5A 1T6SA 4WCGA 4RB2C 5A2QK 4WF2A 2YSRA 2G7HA 4EM2A 2C6YA 4HF2A 3ECHA 1QPMA 5L3DA 2UXNA 4JBAA 5J8CA 1W7PB 3FMSA 5H6RA 5L3GA 1SFUA 2VC0A 4HDVA 1HW1A 4CYDA 3HSFA 2W25A 3ISPA 4ENMA 3HRTA 1U2WA 5HS7A 2W57A 1E2XA 2ELHA 2EV0A 3WTVC 1SFEA 3G73A 3ECOA 1I1GA 4IHSA 3BDDA 5LGTA 3ZP5A 5AIPA 1K78A 2H09A 4UUVA 1XCVA 3H3UA 2LF7A 4F7ZA 2QBYA 1MKMA 3IWZA 4HX4A 4EQQA 2QLZA 1XSXA 2UWMA 1ON2A 1WWXA 2XAJA 3CUOA 4AIKA 4FX0A 2MH9A 1RUOA 1LEAA 1ZRFA 1USTA 3LSTA 2EA2A 3T0YA 5J6XA 2A69F 4EJUA 1LEBA 3JAMK 3TO6A 4U0VA 2YR2A 3IL2A 4TV7A 2G9WA 3TQNA 4E70A 5E20A 1TNTA 1TNSA 2ZKZA 1JHHA 1Z6RA 3EDPA 2H27A 1TQPA 3ZMTA 1V4RA 1T98A 4KMFA 2XGXA 1U6GA 3MCZA 2PG4A 2ZMEB 1MZBA 2VXZA 4AIHA 2JSCA 4I01A 5FD6A 3QU3A 1ULYA 4RS8A 1YLFA 4WXCA 1GXPA 3COAC 1BI0A 1KQ9A 2X4HA 2RDPA 2UXXA 3N4MA 5D8LB 3IHUA 4M72A 5A2QZ 4A6DA 4D0PA 2Z99A 1T0FA 2DW4A 3R0AA 1U3EM 2P5KA 4MNUA 1QQIA 4MGRA 5CYVA 2BYVE 1MDMB 5LBQA 2ISYA 1USSA 5HLHA 2RKHA 4IJAA 3V4GA 1P4WA 1TBXA 4HZFA 4A5NA 5JHUA 1SAXA 2LDUA 3D5LA 5ICEA 2B0LA 1O3SA 2EJRA 2VBWA 4LB5A 1GHCA 3VFZA 1TTYA 4RGUA 4GXOA 2IRFG 1H9GA 4ENKA 3WTYC 3ULQB 1ZYRF 2YU3A 3V7CA 3E6BA 5K5OA 4Q48A 4GCVA 3ERED 3GYHX 1REPC 2W84A 1FY7A 3LAJA 1WKMA 3HRSA 1UHMA 2OU2A 3JAMZ 1B4AA 4P9FA 1SD4A 1EH8A 2VOPA 1ZRDA 2YX7A 3Q5FA 3L09A 1JHFA 4XRFA 2STTA 1J7KA 2VE8A 3C3WA 3TOBA 4YIIA 2PJPA 4PDKA 3I59B 2L3DA 2GIVA 1HSTA 4HQMA 4MHGA 1KQ8A 2WV0A 4MTDA 3CO7C 4O6JA 5F64A 3QRFF 2GAUA 2A68F 3AAFA 5LHIA 3DPLC 3F8MA 2K86A 4LJZF 2WTEA 3F6VA 2IPQX 4HW0A 2F5EA 4A0YA 1ZGAA 1HKQA 3L9FA 1QZYA 3R6SA 2HTJA 2IA2A 2GA2A 2OBPA 2FNPA 2MBFA 3RKXA 1DPRA 4BQAA 3FF5A 5CLSA 4M6XA 5EEHA 4L5IA 5LGUA 1S8NA 3WGGA 4Y17A 2HS5A 2ZO4A 1BJAA 3KEOA 4U7DA 2BGCA 2D1HA 3FM3A 2Q0OA 2BBYA 2ZJ2A 1S3JA 2RNJA 3QP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMU A;  1H0M A;  3K1P A;  2KJC A;  3O6B B;  5D4R A;  3GWZ A;  4OOI A;  4M9Z A;  2HQR A;  3R0J A;  4QWQ A;  1HW5 A;  2IW5 A;  2R7D A;  5TRD A;  3ML6 A;  3PQJ A;  1TLH B;  2DAO A;  4A6E A;  1FC3 A;  3GLX A;  3WGI A;  3F72 A;  5D5X B;  5J8F A;  4P55 A;  1IXS B;  2QEN A;  3NRV A;  3I53 A;  2GXB A;  4LGW A;  5AON A;  3B02 A;  2A07 F;  2L01 A;  1K79 A;  1XN7 A;  3FXQ A;  1IN7 A;  1XGN A;  1BIA A;  1HQC A;  4BYY A;  2JPC A;  4UNO A;  1WQ2 A;  4WXD A;  1U8R A;  4XLP F;  1RNL A;  4OMZ A;  3DEU A;  4GYG A;  1IXR C;  2QUF A;  2L4A A;  2QM3 A;  1ZAR A;  3M8F A;  3WOD F;  4RB0 A;  5FLX K;  4KIG A;  2JPB A;  3HOT A;  4Z2Y A;  2IA0 A;  1R1V A;  2UZK A;  1U5T B;  1J9I A;  2VON A;  3GF2 A;  3LA7 A;  5DCM B;  4L0Z B;  1OKR A;  2VN2 A;  1RI7 A;  1ZRC A;  1S6L A;  2MLK A;  3LAP A;  3Q9S A;  4B09 A;  3HYI A;  3W6K B;  2PN6 A;  5D5W B;  1UFM A;  4EJV A;  2V9V A;  3OOP A;  1BIB A;  5FO5 A;  2ESN A;  4P96 A;  3KZY A;  3SFZ A;  3F21 A;  2V79 A;  2KKO A;  3JSO A;  1P4A A;  4KIF A;  1F4K A;  4MTE A;  4ZZL A;  1CF7 B;  1R36 A;  1A04 A;  1ZLJ A;  1FWZ A;  2NS0 A;  3K1M A;  2PLY A;  4R1H A;  3RJP A;  2X0L A;  1IXC A;  5E1W A;  1XDS A;  3PQK A;  2F5C A;  4I02 A;  2D2W A;  1O7L A;  1YTY A;  3IKV A;  4YFN F;  2LNB A;  4ZYE A;  5H20 A;  4XBF A;  3LA3 A;  3CUQ B;  5HS9 A;  2HOE A;  2VOD A;  2RVC A;  4Q47 A;  5L3E A;  1E17 A;  3ZMZ A;  3DFG A;  2STW A;  4ESJ A;  2XIG A;  4KN4 X;  1Y0U A;  3F8N A;  1S29 A;  2EFO A;  1SD5 A;  3L00 A;  2Y0M A;  3HUG A;  2E7W A;  4EGY A;  1XDU A;  3VOE A;  5FLX Z;  5CJ9 A;  2OAZ A;  5TJJ A;  4ZH4 F;  4HV6 A;  2CO5 A;  4I7H A;  2GZW A;  1GVJ A;  5K5Q A;  2BV6 A;  4DQ2 A;  2PI0 A;  3KFW X;  1IUY A;  1YW8 A;  4YFX F;  1PP8 F;  1FBS A;  2DT5 A;  4LLG F;  4BHB A;  2GQQ A;  3F6O A;  1XCB A;  5D5V B;  3J81 K;  2JRT A;  4DNC A;  4GO1 A;  4KDP A;  1MJB A;  1W7P A;  2H6B A;  5LHG A;  1QGP A;  2ZXJ A;  3LQQ A;  3WTX C;  2FMY A;  4CO8 A;  1XGM A;  3BJ6 A;  5DUK A;  3ZMD A;  2XHK A;  4L0Y B;  2NNN A;  2W85 A;  2OQG A;  3FMQ A;  2A3S A;  4PGG A;  2KRF A;  3K9T A;  4PGH A;  2VC1 A;  1G4D A;  2QQB A;  2OQR A;  1SMT A;  3HIF A;  3NEU A;  1RIO H;  4QLC U;  3IKT A;  5CVJ A;  1S7O A;  5FD5 A;  4LG0 B;  1D3Y A;  4UVC A;  3E6C C;  1JE8 A;  1F5T A;  5F1R A;  2FE3 A;  5LEK A;  4ZYH A;  3WTT C;  3EET A;  5ERI A;  4N9I A;  3F8B A;  1QO0 D;  3GVA A;  2YPR A;  2ZNY A;  2EFQ A;  3WU0 A;  5E8I A;  2VT3 A;  1FT9 A;  1WI9 A;  2PBI A;  2QVO A;  4PCQ A;  3JW4 A;  4LD5 A;  4EMS A;  1U78 A;  2AS5 F;  2ZME A;  2FML A;  2GXG A;  3T8R A;  4RAY A;  1ON1 A;  1AWC A;  2HEO A;  2QZ8 A;  3OV8 A;  4KA4 A;  1GXQ A;  1S7A A;  3RDI A;  4G7O F;  4LFU A;  1FBU A;  1VTN C;  2CGP A;  2LKP A;  2F2E A;  2QQA A;  3C18 A;  3BPX A;  2MD5 A;  4OU0 A;  2W24 A;  5D5U B;  1I6X A;  4AVP A;  4CIC A;  2IA1 A;  2NNY A;  5HLG A;  4HOB A;  3I71 A;  1J5Y A;  3U2R A;  2RN7 A;  3RKW A;  2CQK A;  5HDK A;  1TQI A;  3DV8 A;  3MAJ A;  3EUH A;  2H94 A;  1OYY A;  3J81 Z;  2JT1 A;  1SFX A;  4I2O A;  2FOK A;  2XKP A;  4H0E A;  1MDM A;  4JK1 X;  5FGM A;  1JXS A;  3BP8 A;  4YFK F;  5CVV A;  4ESB A;  1XGS A;  3E5Q A;  1BI3 A;  3LFK A;  3I54 A;  3QP6 A;  4CXF A;  4M6Y A;  2O8X A;  2AXL A;  2P5V A;  1HW2 A;  3W6J B;  1STZ A;  4AWX B;  3RYP A;  2EA4 A;  1PP7 U;  3LQR A;  3H92 A;  2K02 A;  3T1B A;  2VBZ A;  1EH7 A;  3FXU A;  4A2U A;  1P6R A;  4LLL A;  5BMZ A;  2R7F A;  2XRN A;  2A6H F;  3U1D A;  5D4S A;  4S04 A;  3F23 A;  1TW2 A;  1Z6T A;  2JZY A;  5E8G A;  4LK1 F;  3R60 A;  1T2K A;  4KMU X;  2QWW A;  4IPA A;  1FYL A;  1O57 A;  4ASN A;  3IRR A;  1V3F A;  1MJ9 A;  5ICF A;  3K69 A;  5LRS A;  1Z9C A;  1FP2 A;  3P7N A;  5CVI A;  3IWF A;  1FSH A;  4LB6 B;  2O61 A;  3REO A;  1IAW A;  3I59 A;  3PFI A;  1YG2 A;  2O0Y A;  4N0B A;  3FMR A;  2OA4 A;  1D8J A;  1KQ0 A;  4YIF A;  2XAH A;  1XGO A;  4U0W A;  4IXA A;  4A5M A;  4ON0 A;  4FX4 A;  1U5T C;  2P7C B;  2FSW A;  4M71 A;  4CHU A;  1R23 A;  2K4J A;  3JTH A;  4M9S A;  3GFM A;  3DF8 A;  2VT2 A;  4WK8 F;  3FZV A;  5DUI A;  3E5U A;  2XAQ A;  4BH9 A;  4HF1 A;  3V8K A;  2F5F A;  4HAM A;  1J75 A;  2CFX A;  3RPQ A;  4BHC A;  3B73 A;  3RTR A;  3V7S A;  3HTS B;  3KP4 A;  2Z33 A;  1YS6 A;  3BZ6 A;  2KIU A;  1LDD A;  3HSR A;  4I98 B;  1O3Q A;  2GA1 A;  2M45 A;  3I58 A;  4UVB A;  4AD9 A;  4RGR A;  2HDC A;  1YIO A;  4PZJ A;  5BQT A;  2NAZ A;  2HZT A;  2Z5U A;  5HOO A;  5FFZ A;  2M5W A;  1J0R A;  4KT5 C;  5D6E A;  4XSZ F;  3I4P A;  1YYV A;  3VB2 A;  3MZY A;  4U0Y A;  5LEJ A;  5D8K B;  2E7X A;  5E1Z B;  2ETH A;  1SD7 A;  2HKX A;  3TO9 A;  2P8T A;  1NHA A;  2TDX A;  1JGS A;  1QNT A;  1G3W A;  1SD6 A;  3T8T A;  6PAX A;  4NQW A;  3O2P E;  3EQL F;  2VOO A;  4M73 A;  4IHT A;  1XSD A;  1XMA A;  3WTW C;  1P92 A;  1LB2 A;  4MEX F;  1K6O A;  3ZQ7 A;  4EM0 B;  1R1U A;  3CUQ C;  1KU2 A;  4JQF A;  4YG2 F;  2P6S A;  5ICC A;  2DK5 A;  4L9N A;  2PFB A;  1YFH A;  3GEZ A;  4HX7 A;  1G6N A;  5JFR A;  1KU9 A;  1BM9 A;  1HBX G;  2OZU A;  4CGZ A;  2EV6 A;  4R8H A;  3NQO A;  4ZYG A;  3EYI A;  3P9I A;  1B6A A;  1B1B A;  1W5S A;  4OIO F;  2K27 A;  4FT8 A;  5ICG A;  2FBI A;  1DUX C;  2P7V B;  1PDN C;  3WGH A;  3C7J A;  2XV4 S;  1U5T A;  3K1N A;  5DCF A;  3ZMU A;  4HYE A;  2DFI A;  3TKY A;  3S2W A;  2RV8 A;  5DCM A;  4ENJ A;  5E18 F;  2L4M A;  2ZFW A;  3O3K A;  3KE2 A;  5HDG A;  1D8K A;  1ZN2 A;  1FSE A;  3HRM A;  3CJN A;  2EFN A;  4B8X A;  1AOY A;  3T5X A;  2E1N A;  3KP7 A;  4S05 A;  5LRR A;  3ZN1 A;  1ZG1 A;  4ENN A;  4NHJ A;  3IC7 A;  2CG4 A;  2FF4 A;  1Q1H A;  2EV5 A;  3MEX A;  4ZZD A;  3J7A O;  4G94 A;  4WWC A;  4WXH A;  3IRQ A;  4HQE A;  3TDU C;  4LLN A;  3ZMV A;  1Z05 A;  1IN6 A;  1FYK A;  2HQN A;  2HFH A;  2M8E A;  4M74 A;  4A12 A;  5ILS A;  1IN4 A;  2M87 A;  5EEG A;  3VEP A;  3MQ0 A;  3HHG A;  2HTS A;  5BPD A;  2KJB A;  1CF7 A;  3KP3 A;  5BOX A;  4CZZ A;  3U9G A;  2G7U A;  1R7J A;  4M9X A;  3DP7 A;  2MA3 A;  1Z91 A;  1B9M A;  1WSU A;  1MGT A;  2EFW A;  4MQV A;  3SXY A;  2GWR A;  2EB7 A;  3C1D A;  2K4B A;  2A6E F;  3M8E A;  2Z3Y A;  3ROU A;  1LDJ A;  2ACJ A;  5CVU A;  4IVN A;  3TOA A;  2LSO A;  3KP5 A;  3R61 A;  2H6C A;  4EJW A;  4HA8 A;  3CUQ A;  3SZT A;  1CGP A;  3GFL A;  2J5O A;  3KET A;  2ISZ A;  3V8J A;  1I1S A;  3K0L A;  4AIJ A;  3ABT A;  2KIM A;  1KU3 A;  1P4X A;  3E6M A;  4BHP A;  4R79 A;  3WE3 A;  3M7G A;  4UV9 A;  4KIC A;  3ELK A;  1F9N A;  3K2Z A;  1KYW A;  1ZG5 A;  1RZ4 A;  1R1T A;  4OMY A;  4ESF A;  1FZP B;  4LMY A;  2CW0 F;  2P4W A;  1K78 B;  5DEQ A;  2FBK A;  2HGC A;  2PEX A;  2XKO A;  3J80 K;  1T39 A;  2F5D A;  4GGG A;  1J2X A;  2A5Y B;  2HYF A;  3KLO A;  4XLN F;  2QBY B;  3GUD A;  3E3V A;  1BC8 C;  5D6F A;  3GFJ A;  1TQM A;  3BPV A;  5LLQ A;  2DK8 A;  2O3F A;  3BRO A;  1FYM A;  1G3S A;  4IRG A;  3N97 A;  1WRJ A;  3LWF A;  1KGS A;  1MD0 A;  3KLN A;  3CTA A;  2O03 A;  3GXO A;  1IF1 A;  2QQ9 A;  1P2F A;  2DQL A;  1EV7 A;  1IRG A;  2ESH A;  1YW7 A;  5KVR A;  1O7F A;  1UHW A;  3FXR A;  2M1B A;  3QOP A;  3SQN A;  2XUB A;  1ZGJ A;  2L54 A;  1B9N A;  4L9J A;  3KP2 A;  3CO6 C;  4NB5 A;  3ABU A;  4HX8 A;  1O3R A;  3FHZ A;  2HKO A;  2DQR A;  1O3T A;  1ZRE A;  4CDG A;  5DDG A;  3M1E A;  3V8L A;  1YQA A;  1FP1 D;  3DKW A;  1OR7 A;  3F8F A;  5HS8 A;  1W5T A;  3ZMS A;  1SMY F;  4LG0 A;  4OIP F;  2DPU A;  5LGN A;  1UCR A;  1W4M A;  3VOD A;  5JVT A;  3I5U A;  4P5O A;  3JSP A;  4EM1 A;  5AIQ A;  3TO7 A;  1HXD A;  3RYR A;  5KK1 A;  5BPI A;  1BBY A;  1K7A A;  3RPU A;  2YX4 A;  3GZ5 A;  3F3X A;  2V1U A;  2ADU A;  1IW7 F;  3E6D A;  1LDK B;  3FWE A;  3L2C A;  3FX3 A;  2DBB A;  1R58 A;  1BI1 A;  3JTG A;  2WC2 A;  5K1Y A;  2Y75 A;  2OD5 A;  1KU7 A;  4IRI A;  4ETS A;  3J80 Z;  4G6D A;  2NRA C;  3LA2 A;  4N9H A;  4IF4 A;  4Y15 A;  2XAS A;  3BY6 A;  3FM5 A;  4LK0 F;  1I5Z A;  2MH2 A;  3E5X A;  2HR3 A;  2XRO A;  1B59 A;  3I0T A;  4EV0 A;  2DU9 A;  2ZBK A;  4L5J A;  3HOS A;  2WWY A;  3HHH A;  2KIF A;  4RAZ A;  5BS6 A;  5HDN A;  3WE2 A;  2M30 A;  5DD8 A;  4OIR F;  4RGS A;  2V6C A;  3RKY A;  2IJL A;  4I0B A;  4G6Q A;  4HLX A;  1ZAO A;  5JI6 A;  3F8C A;  3KCC A;  3QAH A;  4HV5 A;  3L7W A;  3GX4 X;  4Q4Z F;  1IRF A;  2VE9 A;  2MC3 A;  5L3B A;  3G3Z A;  1LQ1 A;  2E1C A;  3MFK A;  5CVR A;  2K7L A;  1IN8 A;  4EJO A;  3GFI A;  3TDZ C;  1XMK A;  2QYO A;  1UB9 A;  4HDU A;  1EH6 A;  1IN5 A;  1BOA A;  3P9K A;  2CYY A;  2DTR A;  2V1X A;  1ZG3 A;  3DQV C;  1G3Y A;  3ZPL A;  2FBH A;  3BJA A;  4OIQ F;  2V1D A;  1Z1D A;  1T38 A;  3WTZ A;  3GO5 A;  1ODD A;  1H9T A;  1FNN A;  2R3S A;  1DPU A;  1ZHF A;  4EGZ A;  2LF8 A;  4KIB A;  1QBJ A;  3HSE A;  1C0W A;  1LVA A;  2NYX A;  4P9U A;  5FFX A;  3I64 A;  3CLO A;  1X3U A;  2XVC A;  4MQ9 F;  3V7R A;  5ILU A;  3KZZ A;  2OZ6 A;  2RQP A;  4FHT A;  2VBX A;  5DD4 A;  3R4K A;  1HKS A;  1QZZ A;  3WG9 A;  4KYW A;  3SZP A;  3WU1 B;  5DV5 A;  3ZN0 A;  2FEZ A;  1BC7 C;  4RB1 A;  1MJA A;  4EJT A;  5H6Q A;  1OMI A;  4L9T A;  5E17 F;  5L3F A;  4L18 B;  1HKT A;  2IVM A;  5HLI A;  4UV8 A;  1DP7 P;  4BAY A;  1I27 A;  3BJO A;  2BEO A;  2HWV A;  4A0X A;  3QU6 A;  1W7P D;  1BN5 A;  5E1X A;  4G9Y A;  2FU4 A;  4Q5S F;  3SHF A;  2CWE A;  2XAF A;  2L02 A;  2PQ8 A;  1FPQ A;  2HYG D;  1XB4 A;  2A61 A;  2MLG A;  2Y48 A;  4O5V A;  3QPH A;  4IRH A;  5ILV A;  2DI3 A;  1YW9 A;  2CSO A;  4HF0 A;  3WTU C;  2DO7 A;  1BI2 A;  2ZCW A;  1KA8 A;  1L0O C;  2DPD A;  5HVQ C;  4UVA A;  1G3T A;  2IT0 A;  2BE5 F;  1TW3 A;  1YO5 C;  3E97 A;  5K5R A;  5F6F A;  3CDH A;  2VBY A;  4KN7 X;  4U7B A;  2P6T A;  4G7Z F;  2PMH A;  5FB2 A;  1LJ9 A;  2D1V A;  4RGX A;  5DYM A;  2Q8K A;  3RIR A;  5IT9 K;  3RI4 A;  4A0Z A;  1R22 A;  3KP6 A;  2RC4 A;  4BXU A;  5L3C A;  4G8X A;  5ED4 A;  1D5V A;  1OYI A;  3MWM A;  2FNA A;  1OYW A;  2XAG A;  2Q2E A;  2DLL A;  1OPC A;  2FA5 A;  4GYI A;  4KUM A;  4U88 A;  4EVI A;  4HLY A;  3EYY A;  1ZLK A;  1RUN A;  1ZH5 A;  4I0A A;  1DDN A;  4I09 A;  2IP2 A;  4WX9 A;  4G7H F;  4O3M A;  2Z9O A;  3BOQ A;  4Y13 A;  4L9V A;  1IZ1 A;  2FQ3 A;  3GW2 A;  2O6G E;  3P9C A;  1R5H A;  4KFC A;  2D45 A;  4HBL A;  3HRU A;  1Z7U A;  3HTU A;  1FX7 A;  2RGV A;  1R5G A;  3D0S A;  3GZ6 A;  2JTV A;  2EWN A;  3KEQ A;  3WTS C;  4KNY A;  5IT3 A;  4K2E A;  3DXJ F;  3F22 A;  1LNW A;  1ONV A;  5JR3 A;  3M9A A;  4ZYD A;  1J59 A;  1XSV A;  1R00 A;  1PUE E;  4RB3 C;  4OIN F;  2FRH A;  5LHH A;  3H3Z A;  1KYZ A;  2COM A;  3MZH A;  1FBQ A;  1FLI A;  1L3L A;  1F1Z A;  1HSJ A;  2J5P A;  2P5L C;  4MEY F;  2EFP A;  4UXN A;  3TGN A;  1XD7 A;  4BNC A;  2FXA A;  1YS7 A;  3DPT A;  4XSX F;  4UHT A;  3BWG A;  1FOK A;  2ZNZ A;  5IT9 Z;  3QPT A;  3Q9V A;  2EK5 A;  1T6S A;  4WCG A;  4RB2 C;  5A2Q K;  4WF2 A;  2YSR A;  2G7H A;  4EM2 A;  2C6Y A;  4HF2 A;  3ECH A;  1QPM A;  5L3D A;  2UXN A;  4JBA A;  5J8C A;  1W7P B;  3FMS A;  5H6R A;  5L3G A;  1SFU A;  2VC0 A;  4HDV A;  1HW1 A;  4CYD A;  3HSF A;  2W25 A;  3ISP A;  4ENM A;  3HRT A;  1U2W A;  5HS7 A;  2W57 A;  1E2X A;  2ELH A;  2EV0 A;  3WTV C;  1SFE A;  3G73 A;  3ECO A;  1I1G A;  4IHS A;  3BDD A;  5LGT A;  3ZP5 A;  5AIP A;  1K78 A;  2H09 A;  4UUV A;  1XCV A;  3H3U A;  2LF7 A;  4F7Z A;  2QBY A;  1MKM A;  3IWZ A;  4HX4 A;  4EQQ A;  2QLZ A;  1XSX A;  2UWM A;  1ON2 A;  1WWX A;  2XAJ A;  3CUO A;  4AIK A;  4FX0 A;  2MH9 A;  1RUO A;  1LEA A;  1ZRF A;  1UST A;  3LST A;  2EA2 A;  3T0Y A;  5J6X A;  2A69 F;  4EJU A;  1LEB A;  3JAM K;  3TO6 A;  4U0V A;  2YR2 A;  3IL2 A;  4TV7 A;  2G9W A;  3TQN A;  4E70 A;  5E20 A;  1TNT A;  1TNS A;  2ZKZ A;  1JHH A;  1Z6R A;  3EDP A;  2H27 A;  1TQP A;  3ZMT A;  1V4R A;  1T98 A;  4KMF A;  2XGX A;  1U6G A;  3MCZ A;  2PG4 A;  2ZME B;  1MZB A;  2VXZ A;  4AIH A;  2JSC A;  4I01 A;  5FD6 A;  3QU3 A;  1ULY A;  4RS8 A;  1YLF A;  4WXC A;  1GXP A;  3COA C;  1BI0 A;  1KQ9 A;  2X4H A;  2RDP A;  2UXX A;  3N4M A;  5D8L B;  3IHU A;  4M72 A;  5A2Q Z;  4A6D A;  4D0P A;  2Z99 A;  1T0F A;  2DW4 A;  3R0A A;  1U3E M;  2P5K A;  4MNU A;  1QQI A;  4MGR A;  5CYV A;  2BYV E;  1MDM B;  5LBQ A;  2ISY A;  1USS A;  5HLH A;  2RKH A;  4IJA A;  3V4G A;  1P4W A;  1TBX A;  4HZF A;  4A5N A;  5JHU A;  1SAX A;  2LDU A;  3D5L A;  5ICE A;  2B0L A;  1O3S A;  2EJR A;  2VBW A;  4LB5 A;  1GHC A;  3VFZ A;  1TTY A;  4RGU A;  4GXO A;  2IRF G;  1H9G A;  4ENK A;  3WTY C;  3ULQ B;  1ZYR F;  2YU3 A;  3V7C A;  3E6B A;  5K5O A;  4Q48 A;  4GCV A;  3ERE D;  3GYH X;  1REP C;  2W84 A;  1FY7 A;  3LAJ A;  1WKM A;  3HRS A;  1UHM A;  2OU2 A;  3JAM Z;  1B4A A;  4P9F A;  1SD4 A;  1EH8 A;  2VOP A;  1ZRD A;  2YX7 A;  3Q5F A;  3L09 A;  1JHF A;  4XRF A;  2STT A;  1J7K A;  2VE8 A;  3C3W A;  3TOB A;  4YII A;  2PJP A;  4PDK A;  3I59 B;  2L3D A;  2GIV A;  1HST A;  4HQM A;  4MHG A;  1KQ8 A;  2WV0 A;  4MTD A;  3CO7 C;  4O6J A;  5F64 A;  3QRF F;  2GAU A;  2A68 F;  3AAF A;  5LHI A;  3DPL C;  3F8M A;  2K86 A;  4LJZ F;  2WTE A;  3F6V A;  2IPQ X;  4HW0 A;  2F5E A;  4A0Y A;  1ZGA A;  1HKQ A;  3L9F A;  1QZY A;  3R6S A;  2HTJ A;  2IA2 A;  2GA2 A;  2OBP A;  2FNP A;  2MBF A;  3RKX A;  1DPR A;  4BQA A;  3FF5 A;  5CLS A;  4M6X A;  5EEH A;  4L5I A;  5LGU A;  1S8N A;  3WGG A;  4Y17 A;  2HS5 A;  2ZO4 A;  1BJA A;  3KEO A;  4U7D A;  2BGC A;  2D1H A;  3FM3 A;  2Q0O A;  2BBY A;  2ZJ2 A;  1S3J A;  2RNJ A;  3QP5 A; 
#chains in the Genus database with same CATH topology
 2PMU A;  1H0M A;  3K1P A;  4FCY A;  4A3M J;  2KJC A;  2ZSH B;  3O6B B;  5D4R A;  3AFH A;  3GWZ A;  3EUA A;  4OOI A;  1O4X A;  3PL8 A;  4M9Z A;  2HQR A;  2ZXH A;  1DP3 A;  3NWS A;  2NVX J;  2JK3 A;  3R0J A;  2WB1 N;  4QWQ A;  4A3F J;  5KHD A;  2VUM J;  1HW5 A;  2IW5 A;  3SEZ A;  3CC2 I;  2JA7 J;  2M4K A;  4XN0 A;  2R7D A;  5TRD A;  3ML6 A;  3JRH A;  4DYQ A;  2DFF A;  3VPR A;  3VSL A;  1GVD A;  2AXT C;  2Y30 A;  1NG7 A;  3PQJ A;  4B47 A;  1TLH B;  2DAO A;  4A6E A;  3HOW J;  1FC3 A;  3GLX A;  2L9R A;  1ZR2 A;  3WGI A;  3F72 A;  1R9T J;  4UUS B;  2XGE A;  3BLY A;  3OS2 A;  3OYL A;  4A3C J;  5D5X B;  5J8F A;  5DM6 F;  4P55 A;  1IXS B;  4I76 A;  1JKP C;  4NQW B;  2NS8 A;  2QEN A;  3NRV A;  3I53 A;  2GXB A;  2ZB9 A;  5GP9 A;  3UNG C;  4LGW A;  5AON A;  3B02 A;  2BW3 A;  3G4S I;  1QA6 A;  1WI3 A;  2I10 A;  2A07 F;  2L01 A;  2MW8 A;  3KYL A;  2KHM A;  3IV5 A;  1K79 A;  1XN7 A;  3L2Q A;  3L1P A;  3FXQ A;  1IN7 A;  1XGN A;  1BIA A;  1HQC A;  2HZD A;  3BC8 A;  4BYY A;  2JPC A;  2MSY A;  4Y7N J;  4XKW A;  4UNO A;  1WQ2 A;  4WXD A;  4BQQ A;  1U8R A;  2JN6 A;  1X2N A;  4XLP F;  1WJF A;  1RNL A;  3FKJ A;  4OMZ A;  3DEU A;  5FKN A;  3KIO A;  4GYG A;  4DZP A;  1IXR C;  2ID3 A;  1ETX A;  2QUF A;  3HOU J;  2L4A A;  4E7L A;  2QM3 A;  3M8J A;  1HA8 A;  1ZAR A;  1AKH B;  3M8F A;  2L9N A;  3WOD F;  3JRA A;  4RB0 A;  5FLX K;  4KIG A;  4CYC B;  5JHF A;  2JPB A;  2ECC A;  1N25 A;  2VB6 A;  3HOT A;  4Z2Y A;  4Z6Y A;  1ETK A;  2MYS A;  2IA0 A;  4ZDP A;  1R1V A;  2JRM A;  2UZK A;  1U5T B;  1V5E A;  4LOC A;  1J9I A;  2VJJ A;  4DZJ A;  3BR2 A;  2VON A;  1G59 A;  1GV2 A;  4Y3O A;  3GF2 A;  1OJL A;  3LA7 A;  2CQ7 A;  5DCM B;  2KL4 A;  3CP8 A;  3VSK A;  4L0Z B;  1OKR A;  2R7Q A;  3S1R J;  1ETY A;  2VN2 A;  1AU7 A;  1RI7 A;  5IYB J;  2M2E A;  1ZRC A;  3DPU A;  1S6L A;  2MLK A;  1UZC A;  4BEH A;  1OCP A;  4BBS J;  3LAP A;  5F0F A;  3JRB A;  3Q9S A;  1MNE A;  2DJI A;  2OUM A;  3NAU A;  1WGX A;  4B09 A;  2V26 A;  4UY8 I;  3GTQ J;  3RPU D;  1K4T A;  3HYI A;  3W6K B;  2PN6 A;  1TZL A;  5D5W B;  2HOT A;  1UFM A;  1VQN I;  4EJV A;  1QU3 A;  2V9V A;  2DMP A;  4LIU A;  3OOP A;  1BIB A;  1OIS A;  2L7K A;  3Q3S A;  5FO5 A;  1QHH D;  4PFP A;  3A2K A;  4AU7 A;  3S1N J;  2DTZ A;  2ESN A;  4P96 A;  2NOG A;  3KZY A;  4RDU A;  2Z1D A;  3SFZ A;  3F21 A;  2V79 A;  5LFA A;  3VYU B;  3ZR8 X;  2KKO A;  3JSO A;  2TCT A;  1P4A A;  4KIF A;  2HDW A;  1F4K A;  1R5I D;  4MTE A;  4ZZL A;  1CF7 B;  1R36 A;  2JQ7 A;  1A04 A;  1ZLJ A;  1FWZ A;  2NS0 A;  3K1M A;  3OWT A;  2PLY A;  4D7N A;  4R1H A;  3X2Q H;  3TED A;  1JT6 A;  3RJP A;  2X0L A;  1IXC A;  5E1W A;  1XDS A;  2LRE A;  2R4G A;  4DBQ A;  3PQK A;  2F5C A;  3DTI A;  4I02 A;  2D2W A;  1O7L A;  1YTY A;  1D5Y A;  2M0M A;  4UUT A;  4ZJZ A;  4IX7 A;  5FRM A;  2A5W A;  4BJ6 C;  3IKV A;  1IDY A;  2FOW A;  1W0T A;  4XN3 A;  4YFN F;  3Q0U A;  2LNB A;  4ZYE A;  5H20 A;  4XBF A;  4PK4 A;  1HDD C;  4A3B J;  2JWT A;  3MD2 A;  4M3G A;  3BR0 A;  3CMM A;  2DA7 A;  3LA3 A;  2LTP A;  1U8B A;  4HNU A;  2R0Q C;  1IC8 A;  1B72 A;  3KX2 A;  1Z3Y A;  3CUQ B;  5HS9 A;  2HOE A;  2VOD A;  2ME6 A;  2RVC A;  2X6W A;  3CZ6 A;  2HYJ A;  4Q47 A;  5L3E A;  1E17 A;  3ZMZ A;  3DFG A;  2STW A;  1D1C A;  5J4Y A;  2UUZ A;  4ESJ A;  3S1M J;  3S32 A;  2XIG A;  4KN4 X;  2E71 A;  1Y0U A;  4RA2 A;  3RZD J;  3F8N A;  2R7V A;  1S29 A;  4PJJ A;  2EFO A;  1SD5 A;  3L00 A;  2Y0M A;  4J01 A;  3HB9 A;  3HUG A;  2GXA A;  2L7M P;  4IEJ A;  2E7W A;  4EGY A;  3J7A Y;  1XDU A;  3VOE A;  5FLX Z;  2DA2 A;  2OAZ A;  5CJ9 A;  5TJJ A;  4ZH4 F;  1IUF A;  2ZME C;  4HV6 A;  4M3F A;  4RM2 A;  1F36 A;  3FXK A;  4I99 C;  2CO5 A;  4I7H A;  2GZW A;  3LSH A;  4XON A;  4N4N B;  3W2A A;  2NOJ B;  2ZXI A;  4DBR A;  1G2H A;  1GVJ A;  1IDZ A;  3GCM A;  5DM7 F;  5K5Q A;  3CMY A;  2BV6 A;  4DQ2 A;  2BOL A;  2PI0 A;  3KFW X;  1IUY A;  1YW8 A;  4YFX F;  1PP8 F;  4F3Q A;  5IP7 J;  3S3M A;  1FBS A;  2DT5 A;  3HOV J;  1DU0 A;  2KDO A;  3GTO J;  4LLG F;  4MO7 A;  2W4S A;  4BHB A;  2DYR H;  2GQQ A;  3F6O A;  5KCM A;  1XCB A;  5D5V B;  3J81 K;  3J7Y J;  2JRT A;  3GLL A;  4DNC A;  3S8P A;  3DEE A;  4GO1 A;  3EUH C;  3WHC A;  3ZCO A;  4KDP A;  1MJB A;  1W7P A;  2H6B A;  3CCY A;  3S1Q J;  5LHG A;  3S3N A;  4RAF A;  1QGP A;  2ZXJ A;  3LQQ A;  3WTX C;  2FMY A;  3CCJ I;  4CO8 A;  3CCM I;  1A36 A;  1XGM A;  4M3D A;  3MZ8 A;  4IHV A;  3BJ6 A;  2OCC H;  3BR6 A;  5DUK A;  3ZMD A;  2XHK A;  2XF5 A;  2DT6 A;  1WJA A;  3OYG A;  1MBE A;  1XPX A;  1RPW A;  1X1D A;  3H9G A;  4L0Y B;  2NNN A;  2W85 A;  4B44 A;  2OQG A;  3FMQ A;  3TP0 A;  3CCE I;  2A3S A;  4PGG A;  1SVO A;  1I39 A;  2KRF A;  2RQQ A;  3K9T A;  3OYF A;  2HXI A;  4PGH A;  2DFH A;  2VC1 A;  1H89 C;  2LOO A;  1W36 C;  1G4D A;  1DU6 A;  2QQB A;  2R92 J;  2OQR A;  1SMT A;  2LC2 A;  3HIF A;  3NEU A;  4IHX A;  1BR1 A;  3K4C A;  1RIO H;  3SJM A;  3G1O A;  4FET A;  4QLC U;  3IKT A;  5CVJ A;  2DMT A;  3ZGK A;  3TP3 A;  1S7O A;  4XID A;  4ITV A;  3HC7 A;  5FD5 A;  1GLN A;  1S7E A;  4L5E A;  4LG0 B;  1D3Y A;  4BUP A;  3OYJ A;  4C3J J;  4UVC A;  3E6C C;  5J3L A;  5EGO B;  1JE8 A;  2VQH A;  2ELK A;  2X9D A;  1F5T A;  5F1R A;  2FE3 A;  1Y0N A;  3FBI B;  1JTY A;  3AKZ A;  5LEK A;  4ZYH A;  3M1C A;  3WTT C;  3PIP F;  3EET A;  2VL8 A;  4HSR A;  1A31 A;  3ABM H;  5J4V A;  5ERI A;  1NK3 P;  4N9I A;  3FBN B;  4C2M J;  3F8B A;  1QO0 D;  1ETW A;  3GVA A;  2YPR A;  4S0H B;  2COB A;  3GBG A;  3PIO F;  2ZNY A;  4H4K C;  2EFQ A;  3WU0 A;  3ZQF A;  5E8I A;  3I55 I;  3LSP A;  1FIA A;  3RQI A;  3I56 I;  2VT3 A;  4E7I A;  1FT9 A;  1WI9 A;  2PBI A;  2QVO A;  4PCQ A;  4BE1 A;  2ZFU A;  3VYT B;  3JW4 A;  2HDD A;  4LD5 A;  3LOC A;  2IGN A;  4EMS A;  1U78 A;  2AS5 F;  1KZH A;  3SEQ A;  2ZME A;  2FML A;  3BZC A;  2GXG A;  3T8R A;  1SVM A;  1W1W E;  2WY7 Q;  5TGT A;  4RAY A;  4DYC A;  3HGG A;  1ON1 A;  1AWC A;  2HEO A;  1UG0 A;  2QZ8 A;  3OV8 A;  1N78 A;  4KA4 A;  1GXQ A;  1S7A A;  2ZJR F;  1X1P A;  3RDI A;  4G7O F;  2DOF A;  4LFU A;  1FBU A;  2HOA A;  1VTN C;  2R7Z J;  3S3O A;  1ENH A;  3IH4 A;  2DA3 A;  2LKP A;  2CGP A;  2F2E A;  1HC8 A;  2QQA A;  3C18 A;  3BPX A;  2GM4 A;  2JA5 J;  2MD5 A;  4OU0 A;  2W24 A;  1OCZ H;  1ZKG A;  5D5U B;  2D5V A;  1I6X A;  2LG4 A;  4AVP A;  4CIC A;  2IA1 A;  5K7Z A;  2NNY A;  3H9Q A;  5HLG A;  2YS9 A;  4HOB A;  3I71 A;  3C2B A;  3DEW A;  3OR1 C;  1J5Y A;  3U2R A;  1OCR H;  2RN7 A;  3RKW A;  2CQK A;  5HDK A;  2X1C A;  1TQI A;  3ZQC A;  4IOC F;  3DV8 A;  3MAJ A;  3EUH A;  1LVK A;  2H94 A;  1OYY A;  3J81 Z;  2JT1 A;  1SFX A;  4I2O A;  4ANJ A;  1NH3 A;  2FOK A;  1MH4 A;  1HLV A;  2XKP A;  4H0E A;  1MDM A;  2L0K A;  2R5Y A;  4JK1 X;  1ZEL A;  5FGM A;  3BP8 A;  1JXS A;  4YFK F;  5CVV A;  4X1E A;  4ESB A;  1XGS A;  3E5Q A;  4PJ0 C;  1BI3 A;  3LFK A;  3I54 A;  3QP6 A;  3OOU A;  4DGW B;  4CXF A;  4M6Y A;  2O8X A;  2AXL A;  3ZQI A;  1ZK8 A;  2Y0S A;  4XKC A;  4DW6 A;  2DCE A;  2P5V A;  1HW2 A;  3W6J B;  3IH3 A;  5FKK A;  1STZ A;  4AWX B;  4JX4 A;  3RYP A;  1MBH A;  2EA4 A;  1PP7 U;  3IH2 A;  2CW7 A;  3LQR A;  2R5Z A;  2FUG 2;  3H92 A;  2K02 A;  3T1B A;  2VBZ A;  2M9H A;  1EH7 A;  3FXU A;  2IEK A;  4A2U A;  1P6R A;  1MNM C;  3LSJ A;  3DLA A;  4XL9 A;  4LLL A;  5BMZ A;  3CC7 I;  2R7F A;  5J1Y A;  2XRN A;  5IOZ A;  2A6H F;  1Y6I A;  3OIO A;  3U1D A;  2MGQ A;  2EH3 A;  5D4S A;  1PUF B;  1FMV A;  2F6C A;  3PNT A;  3OYI A;  4S04 A;  3F23 A;  3A1Y A;  1TW2 A;  3TW6 A;  2LD5 A;  1Z6T A;  2K9L A;  3I4N J;  2JZY A;  1SC7 A;  1HF0 A;  1OQY A;  5E8G A;  4LK1 F;  3D5R C;  4ZDL A;  3R60 A;  1WFX A;  2Y31 A;  2B63 J;  2RNG A;  2M4G A;  1E0E A;  4F52 A;  1T2K A;  4KMU X;  2QWW A;  4IPA A;  1FYL A;  1O57 A;  5HOD A;  2JA6 J;  3VDX A;  4ASN A;  3IRR A;  4BL0 B;  2XC7 A;  1TWC J;  1V3F A;  3B6A A;  1MJ9 A;  3Q0V A;  1ACI A;  5ICF A;  4ZTJ A;  3K69 A;  5LRS A;  1Z9C A;  4ZYA A;  4YRV A;  1FP2 A;  3P7N A;  2K9S A;  1IJW C;  5CVI A;  1E3P A;  5IP6 A;  3IWF A;  1GUU A;  1FSH A;  2XGC A;  1UAA A;  4LB6 B;  4M6V A;  3CCU I;  2LBF B;  2O61 A;  4YIR X;  3REO A;  1IAW A;  3I59 A;  3PFI A;  1YG2 A;  2O0Y A;  2HU9 A;  3NAR A;  4QIW N;  4N0B A;  3FMR A;  2OA4 A;  2HOS A;  1D8J A;  2BVL A;  3H1C A;  1KQ0 A;  4YIF A;  2XAH A;  1XGO A;  4U0W A;  4D9J A;  4IXA A;  4A5M A;  4CUG A;  2CJJ A;  4ON0 A;  3OL3 A;  4FX4 A;  4X6A J;  3AG2 H;  3OR2 C;  1U5T C;  2GOX B;  2P7C B;  2FSW A;  4M71 A;  4CHU A;  2P0W A;  1R23 A;  1XTA A;  2K4J A;  3JTH A;  3SZG A;  2PMZ A;  4M9S A;  3OSF A;  2IAI A;  3GFM A;  3MKY B;  3DF8 A;  1WJB A;  2VT2 A;  1X19 A;  2KLO A;  4WK8 F;  3FZV A;  4DJA A;  5DUI A;  4II3 A;  3E5U A;  4E7J A;  1EKE A;  5DTD A;  1YRN A;  4CCN A;  4NDL A;  2XAQ A;  4BH9 A;  4HF1 A;  3V8K A;  2F5F A;  2VKH A;  3D5S C;  2VPL A;  4HAM A;  1J75 A;  2CFX A;  2E2H J;  3RPQ A;  2JMW A;  1FTT A;  4BHC A;  2FD5 A;  3B73 A;  3RTR A;  2Z2S B;  2CUZ A;  2A6T A;  2EBI A;  3V7S A;  1EJ9 A;  3HTS B;  3KP4 A;  2V4J C;  3HKZ N;  4MFE A;  2Z33 A;  1YS6 A;  3BZ6 A;  2KIU A;  1LDD A;  3HSR A;  4RM3 A;  1VQ9 I;  5F04 A;  1FOX A;  4I98 B;  5C44 J;  2GA1 A;  1O3Q A;  5JVG F;  2M45 A;  2R7W A;  1MMN A;  1ERD A;  3I58 A;  4UVB A;  4AD9 A;  5CQG A;  5FLV A;  2H1L A;  4RGR A;  2HDC A;  3JR9 A;  1YIO A;  5BNG A;  2ZJP F;  4PZJ A;  3WU2 C;  2DYS H;  4AYB N;  5BQT A;  2NAZ A;  2ECB A;  2HZT A;  2Z5U A;  5HOO A;  2QCO A;  3ABL H;  4A3J J;  1WZ2 A;  3GTP J;  5FFZ A;  2M5W A;  2Y0S N;  1B8I B;  5H2F C;  2PX9 A;  2X1D A;  1J0R A;  4KT5 C;  5D6E A;  4XSZ F;  3I4P A;  1YYV A;  3VB2 A;  3MZY A;  4C9Y A;  1TT5 B;  3PNY A;  4U0Y A;  5LEJ A;  1JTX A;  5D8K B;  2E7X A;  3EPZ A;  4YEJ A;  1X1B A;  3PNV A;  5E1Z B;  3H0D A;  2ETH A;  1SD7 A;  2HKX A;  3TO9 A;  4CA0 A;  2P8T A;  1Z3X A;  2XPW A;  2DFE A;  1NHA A;  2TDX A;  2JJ7 A;  2X48 A;  1JGS A;  2E1O A;  4UUS A;  1QNT A;  1G3W A;  3DCF A;  3VYR B;  1SD6 A;  3T8T A;  6PAX A;  3G1L A;  4NQW A;  4XRM A;  4AM3 A;  2DMQ A;  3O2P E;  4OAY A;  3EQL F;  4BAC A;  2VOO A;  2WBM A;  3DBL B;  4GDF A;  2M3A A;  4M73 A;  4II2 A;  4IHT A;  1U0J A;  1XSD A;  1XMA A;  1WJC A;  3K4J A;  3WTW C;  1P92 A;  2M7A A;  3H9J A;  1LB2 A;  4MEX F;  1K6O A;  2HXO A;  2Q2E B;  3ZQ7 A;  4EM0 B;  1R1U A;  3CUQ C;  1KU2 A;  4JQF A;  4YG2 F;  2P6S A;  5ICC A;  2DK5 A;  4L9N A;  2VIX A;  3JRG A;  1LE8 B;  1E3O C;  4M3B A;  4DYR A;  2PFB A;  2IS6 A;  1YFH A;  1YHQ I;  3GEZ A;  3KPH A;  1JI8 A;  4HX7 A;  1G6N A;  5JFR A;  1KU9 A;  1BM9 A;  1HBX G;  1P7I A;  2OZU A;  4CGZ A;  2EV6 A;  2HVS A;  4R8H A;  3NQO A;  4ZYG A;  4XK4 A;  3EYI A;  3JCU C;  1A5J A;  1NK2 P;  3P9I A;  5GAH J;  1B6A A;  1B1B A;  2F4I A;  3HJE A;  1AKH A;  1VQ6 I;  1W5S A;  3JRD A;  4E7H A;  4OIO F;  2A05 A;  1WVR A;  4CYC A;  3CC4 I;  3ESW B;  2K27 A;  2Y69 H;  2E5Z A;  4FT8 A;  4BKX A;  5ICG A;  3OYN A;  1FOW A;  2FBI A;  1DUX C;  2P7V B;  1PDN C;  3WGH A;  5E79 C;  3C7J A;  2XV4 S;  4NNJ A;  1U5T A;  5CPR B;  3K1N A;  4XOR A;  3DLL F;  5DCF A;  1I3A A;  2QGU A;  4IQ4 A;  2MG4 A;  3PSF A;  3ZMU A;  4HYE A;  2DFI A;  4D1Q A;  3TKY A;  2NVT J;  3RZO J;  3S2W A;  2RV8 A;  5DCM A;  4ENJ A;  5E18 F;  2L4M A;  2ZFW A;  3GTM J;  2XDV A;  4J00 A;  5EEA A;  3O3K A;  1VND A;  3KE2 A;  5HDG A;  3PFY A;  1D8K A;  2CS3 A;  1ZN2 A;  1FSE A;  1XC5 A;  3HRM A;  3CJN A;  1VZ0 A;  2EFN A;  1MMG A;  1MBK A;  4B8X A;  1AOY A;  2HVQ A;  3T5X A;  1POG A;  5JLW A;  5E3M A;  2E1N A;  2CQN A;  2O8K A;  3KP7 A;  5C3E J;  2NXN B;  4S05 A;  3MKL A;  5LRR A;  3ZN1 A;  1ZG1 A;  2OCE A;  2E2J J;  1WJE A;  4ENN A;  4NHJ A;  3IC7 A;  4OAZ A;  2CG4 A;  2FF4 A;  1LFP A;  3S14 J;  2LH9 A;  1Q1H A;  3K4B A;  2EV5 A;  1OCC H;  3MEX A;  4ZZD A;  3J7A O;  4G94 A;  5GAD J;  1X3Z B;  2L5Q A;  4WWC A;  2R93 J;  3W2W A;  3QYF A;  4WXH A;  3IRQ A;  4HQE A;  1T8I A;  5LD2 C;  2Y2Z A;  3TDU C;  4E7Z A;  4LLN A;  3K4L A;  3ZMV A;  1VI0 A;  1Z05 A;  1IN6 A;  1N77 A;  2DJN A;  1FYK A;  3G6E I;  1T08 B;  1VFC A;  2HQN A;  2HFH A;  2M8E A;  4M74 A;  1NG6 A;  4HPQ A;  4A12 A;  2K9Q A;  5ILS A;  1IN4 A;  2BY3 A;  2M87 A;  5EEG A;  4BQN A;  2IXS A;  4BU2 A;  3A0B C;  3VEP A;  2MD0 A;  3BCA A;  1E3H A;  3HHG A;  3MQ0 A;  2HTS A;  5BPD A;  2KJB A;  3WHB A;  4BQO A;  1D0Z A;  3H5A A;  3OSG A;  1CF7 A;  3KP3 A;  5BOX A;  2WY8 Q;  4CZZ A;  1BJZ A;  3A01 B;  1MBF A;  2CUJ A;  2BHZ A;  1N75 A;  3U9G A;  2G7U A;  1R7J A;  2ICW G;  1IV8 A;  4XQF A;  2F48 A;  1YE9 A;  4M9X A;  3DP7 A;  2MA3 A;  4P1W A;  1Z91 A;  1B9M A;  1SVL A;  1WSU A;  1MGT A;  2EFW A;  3O8H A;  4MQV A;  3SXY A;  1I3Q J;  2I5U A;  3H36 A;  2GWR A;  5F1J A;  2EQR A;  3QPS A;  2EB7 A;  3C1D A;  2K4B A;  3ZQG A;  2A6E F;  3M8E A;  2Z3Y A;  5F27 A;  3ROU A;  4F55 A;  4YEL A;  4E6K G;  5KAI C;  1W36 D;  2CU7 A;  1LDJ A;  2XAU A;  2ACJ A;  5CVU A;  4IVN A;  1WHU A;  3U21 A;  5B1A H;  3GTK J;  3TOA A;  1OR7 C;  2LSO A;  3BR5 A;  3KP5 A;  4IKF A;  3QPL A;  4XKV A;  3DU5 A;  2AHQ A;  4C2T A;  3R61 A;  2DOD A;  1SEU A;  2H6C A;  3ASN H;  4HA8 A;  4EJW A;  3CUQ A;  2LK2 A;  1AHD P;  3SZT A;  1IG7 A;  1CGP A;  3GFL A;  2H8R A;  2J5O A;  3KET A;  2ISZ A;  3V8J A;  2OC6 A;  1I1S A;  3K0L A;  2JA2 A;  5K7H A;  4JX5 A;  3VYS B;  3ABT A;  4AIJ A;  2KIM A;  3CME I;  3K4N A;  1KU3 A;  3G1M A;  1P4X A;  3E6M A;  4HG2 A;  5M5Y J;  4XR6 A;  4BHP A;  5EG0 B;  4R79 A;  4C2U A;  2IGK A;  2MAB A;  2E35 A;  3RCO A;  4XMY A;  3WE3 A;  2CV1 A;  9ANT A;  3PUF A;  3M7G A;  1VQ5 I;  4JYK A;  4RAG A;  4UV9 A;  3OYE A;  4KIC A;  2VJ5 A;  3ELK A;  1F9N A;  1OCO H;  2V9P A;  3K2Z A;  1KYW A;  1ZG5 A;  1T56 A;  1RZ4 A;  1Y1V J;  1R1T A;  4OMY A;  2MC4 A;  2XSD C;  4ESF A;  1FZP B;  2NS7 A;  4LMY A;  2CW0 F;  2P4W A;  2CUE A;  1K78 B;  5DEQ A;  2FBK A;  2HGC A;  3ABK H;  2PEX A;  2XKO A;  4HNT A;  3J80 K;  1T39 A;  3TMO A;  2F5D A;  4GGG A;  2HPM A;  3PO3 J;  1J2X A;  2A5Y B;  2HYF A;  3KLO A;  3HDD A;  4XLN F;  2QBY B;  2EIK H;  3GUD A;  4I6Z A;  2L9V A;  2X6X A;  4B3A A;  4MIM A;  1D0Y A;  3QYB A;  3E3V A;  2ZJQ F;  1LKX A;  1BC8 C;  5D6F A;  1FEX A;  3GFJ A;  1TQM A;  1ORK A;  3BPV A;  5LLQ A;  5EF6 A;  3TL4 X;  2DK8 A;  2O3F A;  2CFO A;  3HPH A;  3BRO A;  1FYM A;  1G3S A;  3W3C A;  1H8A C;  2K9M A;  2QA4 I;  3H5N A;  4IRG A;  4BDY A;  3JRI A;  3N97 A;  4W1U A;  4Y52 J;  4JX6 A;  1WRJ A;  3LWF A;  4XKB A;  2JA8 J;  1KGS A;  2QEX I;  1MD0 A;  1RR7 A;  3KLN A;  2WAD A;  5FRN A;  4XRS G;  3BQY A;  5J1R A;  2DOE A;  3CTA A;  4CH7 A;  2O03 A;  3GXO A;  2W00 A;  1IF1 A;  3S2D J;  2QQ9 A;  1Y8R B;  1D0X A;  1P2F A;  2DQL A;  1EV7 A;  1IRG A;  3SDG A;  1GDT A;  2ESH A;  1WJ5 A;  1YW7 A;  5KVR A;  5J40 A;  2OF7 A;  2EPF A;  1O7F A;  3K70 D;  3BG3 A;  5J47 A;  1UHW A;  3FXR A;  1MSF C;  1XS9 A;  3OMY A;  2M1B A;  2BXZ A;  2VI6 A;  3QOP A;  3SQN A;  2XUB A;  3ONQ A;  5HNF A;  5E3N A;  1ZGJ A;  2L54 A;  3BTI A;  4QPO A;  1R6R A;  2KRC A;  3HOY J;  3CDI A;  1D1A A;  1B9N A;  4L9J A;  3OS0 A;  4V2G A;  3KP2 A;  3CO6 C;  3G71 I;  4NB5 A;  3ABU A;  4HX8 A;  1O3R A;  3FHZ A;  2HKO A;  2DQR A;  3JRC A;  3IP4 B;  2OPT A;  4AC0 A;  5C4X J;  1SFO J;  1O3T A;  1ZRE A;  4CDG A;  2BXY A;  5DDG A;  3M1E A;  3CD6 I;  3V8L A;  4NBQ A;  3H5R A;  1YQA A;  1FP1 D;  2LMD A;  4IO9 F;  3P5J A;  4HRI A;  4RBO A;  3DKW A;  4XOT A;  4B3X A;  3HXL A;  1OR7 A;  3F8F A;  2TRT A;  3JRF A;  5HS8 A;  2V7F A;  1RKW A;  1W5T A;  3OYM A;  3TBI A;  2X6Y A;  3ZMS A;  2OTJ I;  1SMY F;  2AQF A;  3HBL A;  4LG0 A;  4OIP F;  2DPU A;  2BY2 A;  5LGN A;  1UCR A;  1W4M A;  3VOD A;  5JVT A;  5EGO A;  3I5U A;  3FXJ A;  4P5O A;  3JSP A;  4A69 C;  2GLO A;  4EM1 A;  2R7X A;  5AIQ A;  3TO7 A;  3E1S A;  3PM1 A;  1HXD A;  3RYR A;  2KZV A;  1BR4 A;  1S5L C;  4CCM A;  4BY1 J;  1ETO A;  2NVY J;  5KK1 A;  5BPI A;  1BBY A;  3NWT A;  1RES A;  2VAS A;  2B7E A;  1K7A A;  5GPC A;  3RPU A;  3PJR A;  3FXL A;  1UMQ A;  1APL C;  2YX4 A;  3GZ5 A;  3F3X A;  3CQZ J;  3DKX A;  3KZI C;  2R7T A;  2V1U A;  2BVM A;  2ADU A;  5KAF C;  4XIC A;  3CMA I;  2EIL H;  1IW7 F;  3E6D A;  4CCO A;  1QPI A;  3OY9 A;  1LDK B;  3FWE A;  3L2C A;  3FX3 A;  2O7O A;  2K85 A;  3ZQH A;  2DBB A;  1R58 A;  1WPK A;  4F92 B;  3K10 A;  1OFC X;  2KZG A;  1BI1 A;  3JTG A;  2WC2 A;  2VKD A;  5K1Y A;  2Y75 A;  1OLT A;  2OD5 A;  5K7F A;  1R71 A;  2EZI A;  1KU7 A;  4IRI A;  1ETV A;  4ETS A;  3J80 Z;  4G6D A;  2NRA C;  3LA2 A;  1FIP A;  4N9H A;  2K9N A;  4IF4 A;  2RAE A;  1DQU A;  3DTE A;  4Y15 A;  3FXO A;  2XAS A;  3FDY A;  3BY6 A;  2IS2 A;  3C2G A;  1X4O A;  3FM5 A;  3OYA A;  4LK0 F;  1I5Z A;  2MH2 A;  3OYB A;  3E5X A;  2HR3 A;  3CP2 A;  3HOX J;  1VQM I;  1JKQ C;  2XRO A;  2Y9Z A;  1JT0 A;  1B59 A;  1K4S A;  3I0T A;  4EV0 A;  1UJ8 A;  2DU9 A;  2ZBK A;  4L5J A;  4E7S A;  4B43 A;  3HOS A;  5GAG J;  2WWY A;  3HHH A;  4V2F A;  2KIF A;  4RAZ A;  1A6Q A;  5BS6 A;  5HDN A;  3WE2 A;  1VQO I;  2M30 A;  5DD8 A;  1VQ4 I;  2CQQ A;  2FJ1 A;  4OIR F;  4RGS A;  1FJL A;  2KRH A;  2Z16 A;  2V6C A;  3RKY A;  2HI3 A;  1JUS A;  2IJL A;  1IO2 A;  3PSI A;  2JSP A;  4I0B A;  4G6Q A;  3ASO H;  3RSN A;  4W97 A;  4HLX A;  1ZAO A;  2QKM B;  5JI6 A;  3F8C A;  3KCC A;  3QAH A;  1Z77 A;  4HV5 A;  1MBJ A;  3L7W A;  5GTH C;  3GX4 X;  3BTL A;  4Q4Z F;  1IRF A;  5E3O A;  2VE9 A;  2AQE A;  1JUM A;  4ABZ A;  2MC3 A;  5L3B A;  1TWG J;  3G3Z A;  1LQ1 A;  2VJI A;  3JRE A;  2E1C A;  4RLF A;  3MFK A;  5CVR A;  3A02 A;  2KMU A;  3FIS A;  2K7L A;  1IN8 A;  2BY0 A;  4EJO A;  3GTG J;  2EIM H;  3CJR B;  3GFI A;  1YJN I;  1VQ7 I;  1TC3 C;  3TDZ C;  2H8W A;  4BE2 A;  1R4N B;  5IY5 H;  4XOP A;  4A3L J;  2E19 A;  1XMK A;  2QYO A;  1UB9 A;  3QQA A;  3ERM A;  5FJ8 J;  4IL6 C;  4XLF A;  4AUX A;  4QTR A;  5KNL A;  4HDU A;  1EH6 A;  1IN5 A;  1BOA A;  3P9K A;  3BZK A;  2IGO A;  2CYY A;  4BS9 A;  1PUF A;  2DTR A;  3W2V A;  4BE0 A;  5FKM A;  2V1X A;  1GV5 A;  1ZG3 A;  3DQV C;  5EJC A;  1G3Y A;  3ZPL A;  2FBH A;  3BJA A;  4E4H A;  5EZH A;  4OIQ F;  2V1D A;  1Z1D A;  2F4O B;  1T38 A;  3WTZ A;  1V5G A;  3GO5 A;  2LY9 A;  4IOA F;  2XB0 X;  2XPU A;  3OIP A;  3VWB A;  1ODD A;  3BQZ A;  3AG1 H;  4E7K A;  1DGR M;  3GME A;  3LFU A;  1H9T A;  4U87 A;  1ZR4 A;  4FIS A;  1FNN A;  4RMN A;  3H35 A;  2R3S A;  1DPU A;  1ZHF A;  4EGZ A;  2LF8 A;  4KIB A;  2CQX A;  1QBJ A;  3HSE A;  3CCQ I;  4KJZ A;  1C0W A;  1LVA A;  2NYX A;  4P9U A;  2CMP A;  5FFX A;  1U9O A;  3I64 A;  4EAT A;  2QF7 A;  3S2H J;  5EDN A;  4BJ5 C;  3CLO A;  3W6V A;  2E1M B;  1TWH J;  1X3U A;  2QSF X;  2EIN H;  2XVC A;  2E36 A;  2LBF A;  2R7S A;  1Q1V A;  4MQ9 F;  3V7R A;  1JJ6 C;  3WG7 H;  5ILU A;  2PJR B;  3KZZ A;  2CRG A;  1K83 J;  2OZ6 A;  2RQP A;  5HNH A;  2GBY A;  3QYE A;  4FHT A;  2VBX A;  5DD4 A;  3R4K A;  4HST A;  3UKG A;  3I9V 2;  1QRY A;  3N05 A;  1HKS A;  1QZZ A;  4OWR B;  3WG9 A;  4KYW A;  3SZP A;  3WU1 B;  4LIV A;  4NUB A;  1MND A;  4XLH A;  3FK7 A;  5DS9 A;  5DV5 A;  3ZN0 A;  4BXX J;  2FEZ A;  1BC7 C;  4RB1 A;  3E7L A;  2AO9 A;  2R7R A;  5B1B H;  3K4K A;  4Y33 A;  4ZC3 A;  1MJA A;  4EJT A;  4PFO A;  1UEL B;  2O5R A;  5B66 C;  2K3F A;  5H6Q A;  1OMI A;  3L2V A;  1S72 I;  4L9T A;  2JUC A;  5E17 F;  4CZC A;  3M07 A;  2DA6 A;  1P7J A;  5L3F A;  4FE7 A;  4L18 B;  1HKT A;  2IVM A;  2LYC A;  5HLI A;  4UV8 A;  1DP7 P;  4BAY A;  2BW3 B;  2LP0 A;  4A3K J;  1I27 A;  1U9N A;  3BJO A;  2BEO A;  2NVQ J;  1XX5 A;  2HWV A;  4A0X A;  3QU6 A;  1W7P D;  1BN5 A;  4KT6 A;  1UG2 A;  3C2H A;  5E1X A;  4IZZ A;  4G6T B;  2FU4 A;  4G9Y A;  2WA0 A;  4Q5S F;  3SHF A;  2CWE A;  2XAF A;  1Z7L A;  1Z21 A;  3LSM A;  1D1B A;  4FTH A;  2L02 A;  2PQ8 A;  4FAS D;  1YI2 I;  1GT0 C;  4LG3 A;  1FPQ A;  2HYG D;  1XB4 A;  3DU6 A;  4IHW A;  2ZXW H;  2VJ4 A;  2A61 A;  2XGD A;  2MLG A;  2ELJ A;  2Y48 A;  4O5V A;  3QPH A;  4IRH A;  2YU9 J;  5ILV A;  2DI3 A;  4XNF A;  1YW9 A;  2CSO A;  4HF0 A;  3WTU C;  3OYH A;  3BG6 A;  2BHY A;  1LFU P;  2DO7 A;  1BI2 A;  2ZCW A;  2L7Z A;  3HZJ A;  4GFB A;  1B8I A;  1RET A;  4MFD A;  2DMU A;  1KA8 A;  1L0O C;  2DPD A;  5HVQ C;  3ZOB A;  4UVA A;  2OTL I;  1G3T A;  2IT0 A;  2OJE D;  2BE5 F;  1YX5 A;  1BA5 A;  1TW3 A;  1YO5 C;  3E97 A;  1Y56 A;  5K5R A;  5F6F A;  3CDH A;  2VBY A;  3BT9 A;  4KN7 X;  1V54 H;  3I3L A;  4U7B A;  3OS1 A;  2P6T A;  2VQC A;  4G7Z F;  2PMH A;  5FB2 A;  1LJ9 A;  2D1V A;  1W5C C;  3HG9 A;  4RGX A;  1BL0 A;  1YX3 A;  5DYM A;  2Q8K A;  3RIR A;  1IRZ A;  5IT9 K;  1M1E B;  3RI4 A;  4A0Z A;  2LRD A;  1R22 A;  2N8G A;  4G12 A;  3ZQQ A;  1QVT A;  3KP6 A;  2OV7 A;  2RC4 A;  4M3E A;  4BXU A;  5FLM J;  3CDL A;  4BEH B;  4CSW A;  5L3C A;  1VQ8 I;  4G8X A;  5B3S H;  5ED4 A;  1D5V A;  1OYI A;  3Q0W A;  4FE4 A;  1BR2 A;  1X58 A;  3MWM A;  2FNA A;  5EZG A;  1OYW A;  1TWA J;  4X0G A;  2XAG A;  2FX0 A;  2Q2E A;  2DLL A;  1OPC A;  2FA5 A;  4GYI A;  4KUM A;  4U88 A;  4EVI A;  3L2W A;  4MLO A;  4HLY A;  1YIT I;  1HCR A;  3EYY A;  2HQA A;  3ZXS A;  1LE8 A;  1ZLK A;  4IHY A;  3E0J B;  1X1C A;  1RUN A;  1ZH5 A;  3BR3 A;  4PUS A;  4I0A A;  5GAE J;  3AL0 B;  1DDN A;  4Y4R A;  3RQ4 A;  4I09 A;  2IP2 A;  2BY1 A;  4WX9 A;  4G7H F;  4O3M A;  2Z9O A;  1X4P A;  5M5X J;  1VQL I;  3BOQ A;  2PMZ N;  3GTJ J;  4Y13 A;  2XB5 A;  4L9V A;  2DOA A;  1IZ1 A;  3LSI A;  2FQ3 A;  3GW2 A;  2ME0 A;  1R49 A;  2O6G E;  2O9L A;  2XF7 A;  3P9C A;  1R5H A;  4KFC A;  4QPQ A;  1I50 J;  2BZT A;  2D45 A;  1MMD A;  4HBL A;  3HRU A;  2DN0 A;  3QOE A;  1Z7U A;  2I8D A;  3HTU A;  3IAM 2;  4XLE A;  4PJN A;  1FX7 A;  2RGV A;  2VXD A;  4A3I J;  2K40 A;  1R5G A;  4HEA 2;  3D0S A;  2QSG X;  4HNV A;  3GZ6 A;  2JTV A;  1LUJ B;  2EWN A;  3KEQ A;  3WTS C;  4KNY A;  3FK6 A;  2LKX A;  3KYC B;  4K2E A;  3OIQ A;  5IT3 A;  3GZN B;  3DKY A;  2LR8 A;  4XLA A;  4AID A;  4B48 A;  3KEY A;  1RRJ A;  3DXJ F;  3F22 A;  1SFK A;  4PJM A;  1TL8 A;  4D5C A;  1LNW A;  1PYV A;  3HPG A;  1ONV A;  3RKQ A;  5JR3 A;  3M9A A;  4ZYD A;  1J59 A;  1H88 C;  2Y9Y A;  3ZRG A;  3MKW B;  1HDP A;  1XSV A;  5JLX A;  4XLC A;  2DDA A;  4D5F A;  3OL4 A;  2W7N A;  2KDZ A;  1B72 B;  1R00 A;  1PUE E;  4RB3 C;  1CQT A;  4OIN F;  2FRH A;  1QHG A;  1XG1 A;  1X1A A;  4BY7 J;  5LHH A;  4DIQ A;  3H3Z A;  1S9H A;  3IAS 2;  1KYZ A;  5B5E C;  2X1E A;  2COM A;  3MZH A;  3SDB A;  1FBQ A;  1FLI A;  1L3L A;  1F1Z A;  3PUB A;  2E5N A;  1V55 H;  1HSJ A;  2P81 A;  2J5P A;  2P5L C;  2ID6 A;  4MEY F;  4RLQ A;  3CLQ A;  4CCJ A;  2VKE A;  2WAF A;  2EFP A;  4UXN A;  3HUG B;  2DT7 B;  1WH5 A;  5FRO A;  4QSH A;  3TGN A;  1BW6 A;  1EF4 A;  1XD7 A;  3A01 A;  4PSX A;  1V5F A;  4BNC A;  3HOZ J;  2CUF A;  2FXA A;  4F93 B;  4V19 K;  1YS7 A;  3DPT A;  2VKV A;  4XSX F;  3DBR B;  4JOM A;  4UHT A;  3BWG A;  5F0C A;  1FOK A;  3BG9 A;  3HM5 A;  2ZNZ A;  2FQ4 A;  1HOM A;  2LKS A;  3B6C A;  2G0E A;  5IT9 Z;  3QPT A;  1X3W B;  3Q9V A;  2EK5 A;  3CF5 F;  2R7O A;  1T6S A;  3OYK A;  3TW7 A;  4WCG A;  4XRS A;  3S17 J;  4RB2 C;  5A2Q K;  3M3Y J;  4WF2 A;  2DDB A;  2YSR A;  2ZC2 A;  2G7H A;  4EM2 A;  2VLA A;  2C6Y A;  4HF2 A;  2R7U A;  4BBR J;  1T0F C;  1KON A;  3ECH A;  2W1O A;  3CCV I;  1QPM A;  2L9S A;  5L3D A;  2UXN A;  2M7B A;  4JBA A;  2MFZ A;  5J8C A;  1Y1W J;  1W7P B;  2WAE A;  3FMS A;  5H6R A;  4XM3 A;  5L3G A;  1SFU A;  2VC0 A;  2JUG A;  4HDV A;  4B1R A;  1HW1 A;  2E2I J;  4CYD A;  1JJ8 C;  5EG0 A;  2KP6 A;  2QKL B;  2KIQ A;  3BCB A;  3HSF A;  2W25 A;  3DTK A;  1T33 A;  3ISP A;  3S93 A;  4ENM A;  2F5V A;  3HRT A;  1U2W A;  5HS7 A;  2W57 A;  1E2X A;  2ELH A;  2EV0 A;  3WTV C;  1JKO C;  1SFE A;  3G73 A;  2QSH X;  1JUP A;  2M34 A;  3ECO A;  1I1G A;  4IHS A;  3BDD A;  3QOD A;  5LGT A;  3ZP5 A;  5AIP A;  3A4C A;  4JP0 A;  1YJ9 I;  1WH7 A;  1K78 A;  1A6I A;  2H09 A;  4UUV A;  1XCV A;  2DA5 A;  2X6O A;  2KT0 A;  2GOM A;  3H3U A;  3EUK L;  2LF7 A;  4F7Z A;  1BOB A;  2HQ5 A;  2QBY A;  1MKM A;  4BXF A;  5F08 A;  2V9K A;  2E34 A;  3IWZ A;  4HX4 A;  3AG4 H;  4EQQ A;  2IS1 A;  4ZTF A;  2XF6 A;  3FXM A;  2QLZ A;  3OYD A;  3LMM A;  1XSX A;  2UWM A;  1ON2 A;  2HNH A;  5EYR A;  3LSG A;  3H3V K;  1WWX A;  2XAJ A;  3CUO A;  3HEF A;  5FKL A;  1OCT C;  1PJR A;  4AIK A;  3J7Z I;  4FX0 A;  2MH9 A;  1RUO A;  1LEA A;  2Q1Z B;  5TIS C;  1ZRF A;  4KIS A;  1UST A;  2CH0 A;  3LST A;  3MN2 A;  4UB8 C;  4LIT A;  1MMA A;  2EA2 A;  3T0Y A;  5J6X A;  4BDZ A;  3QWL A;  2A69 F;  4EJU A;  1LEB A;  3JAM K;  3TO6 A;  2DA4 A;  2CW8 A;  1JGG A;  4U0V A;  4DOZ A;  5IPA A;  2YR2 A;  3IL2 A;  1I6H J;  3DBH B;  3CCS I;  1IRX A;  2JVH A;  4NC8 A;  4TV7 A;  2G9W A;  2WAQ A;  3TQN A;  4E70 A;  5E20 A;  1TNT A;  1TNS A;  1UHS A;  2LY1 A;  1ZQ3 P;  3FHN A;  1K61 A;  2ZKZ A;  1JHH A;  2HVR A;  1Z6R A;  2GIZ A;  3EDP A;  3LL7 A;  2H27 A;  1Z0X A;  4PJL A;  1TQP A;  3ZMT A;  4A3G J;  1V4R A;  2K5C A;  1T98 A;  4KMF A;  2XGX A;  1U6G A;  3IUO A;  1MSE C;  3MCZ A;  3CCR I;  2PG4 A;  2ZME B;  3HL2 A;  4EEF G;  1MZB A;  2VXZ A;  1ITY A;  1MH3 A;  1RR8 C;  4AIH A;  4F91 B;  2JSC A;  3PO2 J;  3HGY A;  4I01 A;  5FD6 A;  3QU3 A;  1ULY A;  4RS8 A;  1YLF A;  4WXC A;  1GXP A;  3COA C;  1BI0 A;  5F0H A;  1KQ9 A;  1JKR C;  2X4H A;  2W82 A;  2RDP A;  1WCM J;  2KQR A;  2UXX A;  4ZDO A;  3N4M A;  5D8L B;  1FMW A;  3IHU A;  3AG3 H;  1R4M B;  2NVU B;  3L2R A;  1FTZ A;  1RKT A;  2XRL A;  4GRI A;  5IOY A;  4M72 A;  5A2Q Z;  4A6D A;  4D0P A;  4J19 A;  2DXI A;  2Z99 A;  1QZE A;  1T0F A;  2DW4 A;  2JVG A;  2LFB A;  3DWL E;  3R0A A;  3U1K A;  1U3E M;  3BR1 A;  1K6Y A;  2CV2 A;  1TP4 A;  2VQL A;  4D7M A;  2P5K A;  3OYC A;  3K6G A;  4MNU A;  1QQI A;  1T95 A;  4MGR A;  4CCK A;  5M3F J;  5CYV A;  4CCL A;  5IYC J;  2BYV E;  2IBD A;  1MDM B;  2R5Y B;  5LBQ A;  2EZK A;  3G2B A;  4C30 A;  2VQG A;  1EA3 A;  2ISY A;  1DGW Y;  1X2M A;  3BTC A;  1USS A;  5HLH A;  2RKH A;  4A3E J;  2B9S A;  2E1M C;  2XSJ C;  4IJA A;  3V4G A;  1P4W A;  1TBX A;  4HZF A;  1AA7 A;  1XMX A;  2XPV A;  1LFB A;  2LVS A;  4C3H J;  4A5N A;  5JHU A;  1RC9 A;  1SAX A;  4BGD A;  2LDU A;  3D5L A;  2EIJ H;  2WB1 A;  1YOV B;  2VPR A;  3HKZ A;  5ICE A;  2B0L A;  2M8G X;  1VQP I;  1O3S A;  3K7A J;  3M4O J;  2EZL A;  3K70 C;  2LLK A;  3L2U A;  4NC6 A;  2R5Z B;  2EJR A;  2VBW A;  1NTC A;  2M0C A;  1Y39 A;  2KPM A;  4LB5 A;  1MW7 A;  1ETQ A;  5CKT A;  1QVU A;  1GHC A;  3F0C A;  1ZTR A;  5C4J J;  3VFZ A;  1BW5 A;  3MMY B;  1TTY A;  3KYD B;  4RGU A;  1ZGW A;  4GXO A;  4UB6 C;  1W0U A;  1H9G A;  1A35 A;  3FKI J;  2IRF G;  5IYD J;  4AYB A;  4ENK A;  5FKO A;  3WTY C;  3CES A;  3ULQ B;  3BG7 A;  1ZYR F;  2YU3 A;  3V7C A;  2LY2 A;  3SYT A;  3LSK A;  4NC7 A;  3E6B A;  4AVZ A;  2W48 A;  3GTL J;  2F4M B;  5K5O A;  4Q48 A;  4GCV A;  3ERE D;  1TT0 A;  3GYH X;  1REP C;  3D1N I;  2W84 A;  1FY7 A;  3LAJ A;  5IP9 J;  3A0H C;  1PVE A;  1WKM A;  3K4M A;  3HRS A;  5E3L A;  1VF9 A;  1UHM A;  2OU2 A;  3BG5 A;  3JAM Z;  1B4A A;  3FIW A;  3UR3 C;  4P9F A;  1SD4 A;  1J09 A;  1Y8Q B;  1EH8 A;  1MBG A;  2VOP A;  1P9Q C;  1YIJ I;  1ZRD A;  2YX7 A;  3Q5F A;  2RRE A;  3L09 A;  1JHF A;  4N4O B;  4A93 J;  3H0G J;  1MIJ A;  4XRF A;  1MMS A;  1F43 A;  2E60 A;  2WAQ N;  5GPA A;  2STT A;  1J7K A;  1VQK I;  2VE8 A;  3C3W A;  3O8G A;  2QQ8 A;  2H1K A;  3MVP A;  3TOB A;  3CF2 A;  4YII A;  2PJP A;  4PDK A;  3I59 B;  2L3D A;  2UV1 A;  4C3I J;  1IGN A;  2GIV A;  1SAN A;  1HST A;  1Z67 A;  2YUS A;  3ZQL A;  2V6E A;  4HQM A;  3V42 A;  4MHG A;  3LSR A;  1KQ8 A;  2L2O A;  2ZSI B;  2KFD A;  2WV0 A;  5GTI C;  2IGM A;  4PSW A;  4MTD A;  3CO7 C;  4O6J A;  2K3P A;  5F64 A;  3I4M J;  2HPI A;  3BTJ A;  3QRF F;  2GAU A;  2WV1 A;  2A68 F;  2DMN A;  2X85 A;  3AAF A;  2DA1 A;  4BJT A;  5LHI A;  3DPL C;  3F8M A;  2K86 A;  4LJZ F;  2WTE A;  3F6V A;  2IPQ X;  4HW0 A;  2F5E A;  4FQG A;  4A0Y A;  1ZGA A;  2KIS A;  5CQE A;  1HKQ A;  1FOY A;  3L9F A;  1YJW I;  3S16 J;  1QZY A;  3R6S A;  3S15 J;  1G8X A;  4A3D J;  2HTJ A;  2IA2 A;  2GA2 A;  1YRN B;  3CCL I;  1WJD A;  3CJQ B;  2OBP A;  2FNP A;  3K2A A;  2MBF A;  3RKX A;  1DPR A;  4BQA A;  3FF5 A;  2CV0 A;  5M3M J;  1LPQ A;  5J1U A;  5CLS A;  4M6X A;  1IV6 A;  5EEH A;  4KIT B;  3F9K A;  2L7F P;  4L5I A;  2EZH A;  5LGU A;  3CJT B;  1S8N A;  2X51 A;  3LNQ A;  5M5W J;  3WGG A;  4B4C A;  4Y17 A;  3SFI A;  2IS4 A;  2HS5 A;  2ZO4 A;  1BJA A;  5HLT A;  3KEO A;  2V1N A;  4U7D A;  3A03 A;  2BGC A;  2D1H A;  3FM3 A;  2Q0O A;  4IQJ A;  2BBY A;  2ZJ2 A;  3AL0 C;  1S3J A;  1SAU A;  2PJR A;  2RNJ A;  1TWF J;  3MKZ A;  3QP5 A; 
#chains in the Genus database with same CATH homology
 2PMU A;  1H0M A;  3K1P A;  2KJC A;  3O6B B;  5D4R A;  3GWZ A;  4OOI A;  4M9Z A;  2HQR A;  3R0J A;  4QWQ A;  1HW5 A;  2IW5 A;  2R7D A;  5TRD A;  3ML6 A;  3PQJ A;  1TLH B;  2DAO A;  4A6E A;  1FC3 A;  3GLX A;  3WGI A;  3F72 A;  5D5X B;  5J8F A;  4P55 A;  1IXS B;  2QEN A;  3NRV A;  3I53 A;  2GXB A;  4LGW A;  5AON A;  3B02 A;  2A07 F;  2L01 A;  1K79 A;  1XN7 A;  3FXQ A;  1IN7 A;  1XGN A;  1BIA A;  1HQC A;  4BYY A;  2JPC A;  4UNO A;  1WQ2 A;  4WXD A;  1U8R A;  4XLP F;  1RNL A;  4OMZ A;  3DEU A;  4GYG A;  1IXR C;  2QUF A;  2L4A A;  2QM3 A;  1ZAR A;  3M8F A;  3WOD F;  4RB0 A;  5FLX K;  4KIG A;  2JPB A;  3HOT A;  4Z2Y A;  2IA0 A;  1R1V A;  2UZK A;  1U5T B;  1J9I A;  2VON A;  3GF2 A;  3LA7 A;  5DCM B;  4L0Z B;  1OKR A;  2VN2 A;  1RI7 A;  1ZRC A;  1S6L A;  2MLK A;  3LAP A;  3Q9S A;  4B09 A;  3HYI A;  3W6K B;  2PN6 A;  5D5W B;  1UFM A;  4EJV A;  2V9V A;  3OOP A;  1BIB A;  5FO5 A;  2ESN A;  4P96 A;  3KZY A;  3SFZ A;  3F21 A;  2V79 A;  2KKO A;  3JSO A;  1P4A A;  4KIF A;  1F4K A;  4MTE A;  4ZZL A;  1CF7 B;  1R36 A;  1A04 A;  1ZLJ A;  1FWZ A;  2NS0 A;  3K1M A;  2PLY A;  4R1H A;  3RJP A;  2X0L A;  1IXC A;  5E1W A;  1XDS A;  3PQK A;  2F5C A;  4I02 A;  2D2W A;  1O7L A;  1YTY A;  3IKV A;  4YFN F;  2LNB A;  4ZYE A;  5H20 A;  4XBF A;  3LA3 A;  3CUQ B;  5HS9 A;  2HOE A;  2VOD A;  2RVC A;  4Q47 A;  5L3E A;  1E17 A;  3ZMZ A;  3DFG A;  2STW A;  4ESJ A;  2XIG A;  4KN4 X;  1Y0U A;  3F8N A;  1S29 A;  2EFO A;  1SD5 A;  3L00 A;  2Y0M A;  3HUG A;  2E7W A;  4EGY A;  1XDU A;  3VOE A;  5FLX Z;  5CJ9 A;  2OAZ A;  5TJJ A;  4ZH4 F;  4HV6 A;  2CO5 A;  4I7H A;  2GZW A;  1GVJ A;  5K5Q A;  2BV6 A;  4DQ2 A;  2PI0 A;  3KFW X;  1IUY A;  1YW8 A;  4YFX F;  1PP8 F;  1FBS A;  2DT5 A;  4LLG F;  4BHB A;  2GQQ A;  3F6O A;  1XCB A;  5D5V B;  3J81 K;  2JRT A;  4DNC A;  4GO1 A;  4KDP A;  1MJB A;  1W7P A;  2H6B A;  5LHG A;  1QGP A;  2ZXJ A;  3LQQ A;  3WTX C;  2FMY A;  4CO8 A;  1XGM A;  3BJ6 A;  5DUK A;  3ZMD A;  2XHK A;  4L0Y B;  2NNN A;  2W85 A;  2OQG A;  3FMQ A;  2A3S A;  4PGG A;  2KRF A;  3K9T A;  4PGH A;  2VC1 A;  1G4D A;  2QQB A;  2OQR A;  1SMT A;  3HIF A;  3NEU A;  1RIO H;  4QLC U;  3IKT A;  5CVJ A;  1S7O A;  5FD5 A;  4LG0 B;  1D3Y A;  4UVC A;  3E6C C;  1JE8 A;  1F5T A;  5F1R A;  2FE3 A;  5LEK A;  4ZYH A;  3WTT C;  3EET A;  5ERI A;  4N9I A;  3F8B A;  1QO0 D;  3GVA A;  2YPR A;  2ZNY A;  2EFQ A;  3WU0 A;  5E8I A;  2VT3 A;  1FT9 A;  1WI9 A;  2PBI A;  2QVO A;  4PCQ A;  3JW4 A;  4LD5 A;  4EMS A;  1U78 A;  2AS5 F;  2ZME A;  2FML A;  2GXG A;  3T8R A;  4RAY A;  1ON1 A;  1AWC A;  2HEO A;  2QZ8 A;  3OV8 A;  4KA4 A;  1GXQ A;  1S7A A;  3RDI A;  4G7O F;  4LFU A;  1FBU A;  1VTN C;  2CGP A;  2LKP A;  2F2E A;  2QQA A;  3C18 A;  3BPX A;  2MD5 A;  4OU0 A;  2W24 A;  5D5U B;  1I6X A;  4AVP A;  4CIC A;  2IA1 A;  2NNY A;  5HLG A;  4HOB A;  3I71 A;  1J5Y A;  3U2R A;  2RN7 A;  3RKW A;  2CQK A;  5HDK A;  1TQI A;  3DV8 A;  3MAJ A;  3EUH A;  2H94 A;  1OYY A;  3J81 Z;  2JT1 A;  1SFX A;  4I2O A;  2FOK A;  2XKP A;  4H0E A;  1MDM A;  4JK1 X;  5FGM A;  1JXS A;  3BP8 A;  4YFK F;  5CVV A;  4ESB A;  1XGS A;  3E5Q A;  1BI3 A;  3LFK A;  3I54 A;  3QP6 A;  4CXF A;  4M6Y A;  2O8X A;  2AXL A;  2P5V A;  1HW2 A;  3W6J B;  1STZ A;  4AWX B;  3RYP A;  2EA4 A;  1PP7 U;  3LQR A;  3H92 A;  2K02 A;  3T1B A;  2VBZ A;  1EH7 A;  3FXU A;  4A2U A;  1P6R A;  4LLL A;  5BMZ A;  2R7F A;  2XRN A;  2A6H F;  3U1D A;  5D4S A;  4S04 A;  3F23 A;  1TW2 A;  1Z6T A;  2JZY A;  5E8G A;  4LK1 F;  3R60 A;  1T2K A;  4KMU X;  2QWW A;  4IPA A;  1FYL A;  1O57 A;  4ASN A;  3IRR A;  1V3F A;  1MJ9 A;  5ICF A;  3K69 A;  5LRS A;  1Z9C A;  1FP2 A;  3P7N A;  5CVI A;  3IWF A;  1FSH A;  4LB6 B;  2O61 A;  3REO A;  1IAW A;  3I59 A;  3PFI A;  1YG2 A;  2O0Y A;  4N0B A;  3FMR A;  2OA4 A;  1D8J A;  1KQ0 A;  4YIF A;  2XAH A;  1XGO A;  4U0W A;  4IXA A;  4A5M A;  4ON0 A;  4FX4 A;  1U5T C;  2P7C B;  2FSW A;  4M71 A;  4CHU A;  1R23 A;  2K4J A;  3JTH A;  4M9S A;  3GFM A;  3DF8 A;  2VT2 A;  4WK8 F;  3FZV A;  5DUI A;  3E5U A;  2XAQ A;  4BH9 A;  4HF1 A;  3V8K A;  2F5F A;  4HAM A;  1J75 A;  2CFX A;  3RPQ A;  4BHC A;  3B73 A;  3RTR A;  3V7S A;  3HTS B;  3KP4 A;  2Z33 A;  1YS6 A;  3BZ6 A;  2KIU A;  1LDD A;  3HSR A;  4I98 B;  1O3Q A;  2GA1 A;  2M45 A;  3I58 A;  4UVB A;  4AD9 A;  4RGR A;  2HDC A;  1YIO A;  4PZJ A;  5BQT A;  2NAZ A;  2HZT A;  2Z5U A;  5HOO A;  5FFZ A;  2M5W A;  1J0R A;  4KT5 C;  5D6E A;  4XSZ F;  3I4P A;  1YYV A;  3VB2 A;  3MZY A;  4U0Y A;  5LEJ A;  5D8K B;  2E7X A;  5E1Z B;  2ETH A;  1SD7 A;  2HKX A;  3TO9 A;  2P8T A;  1NHA A;  2TDX A;  1JGS A;  1QNT A;  1G3W A;  1SD6 A;  3T8T A;  6PAX A;  4NQW A;  3O2P E;  3EQL F;  2VOO A;  4M73 A;  4IHT A;  1XSD A;  1XMA A;  3WTW C;  1P92 A;  1LB2 A;  4MEX F;  1K6O A;  3ZQ7 A;  4EM0 B;  1R1U A;  3CUQ C;  1KU2 A;  4JQF A;  4YG2 F;  2P6S A;  5ICC A;  2DK5 A;  4L9N A;  2PFB A;  1YFH A;  3GEZ A;  4HX7 A;  1G6N A;  5JFR A;  1KU9 A;  1BM9 A;  1HBX G;  2OZU A;  4CGZ A;  2EV6 A;  4R8H A;  3NQO A;  4ZYG A;  3EYI A;  3P9I A;  1B6A A;  1B1B A;  1W5S A;  4OIO F;  2K27 A;  4FT8 A;  5ICG A;  2FBI A;  1DUX C;  2P7V B;  1PDN C;  3WGH A;  3C7J A;  2XV4 S;  1U5T A;  3K1N A;  5DCF A;  3ZMU A;  4HYE A;  2DFI A;  3TKY A;  3S2W A;  2RV8 A;  5DCM A;  4ENJ A;  5E18 F;  2L4M A;  2ZFW A;  3O3K A;  3KE2 A;  5HDG A;  1D8K A;  1ZN2 A;  1FSE A;  3HRM A;  3CJN A;  2EFN A;  4B8X A;  1AOY A;  3T5X A;  2E1N A;  3KP7 A;  4S05 A;  5LRR A;  3ZN1 A;  1ZG1 A;  4ENN A;  4NHJ A;  3IC7 A;  2CG4 A;  2FF4 A;  1Q1H A;  2EV5 A;  3MEX A;  4ZZD A;  3J7A O;  4G94 A;  4WWC A;  4WXH A;  3IRQ A;  4HQE A;  3TDU C;  4LLN A;  3ZMV A;  1Z05 A;  1IN6 A;  1FYK A;  2HQN A;  2HFH A;  2M8E A;  4M74 A;  4A12 A;  5ILS A;  1IN4 A;  2M87 A;  5EEG A;  3VEP A;  3MQ0 A;  3HHG A;  2HTS A;  5BPD A;  2KJB A;  1CF7 A;  3KP3 A;  5BOX A;  4CZZ A;  3U9G A;  2G7U A;  1R7J A;  4M9X A;  3DP7 A;  2MA3 A;  1Z91 A;  1B9M A;  1WSU A;  1MGT A;  2EFW A;  4MQV A;  3SXY A;  2GWR A;  2EB7 A;  3C1D A;  2K4B A;  2A6E F;  3M8E A;  2Z3Y A;  3ROU A;  1LDJ A;  2ACJ A;  5CVU A;  4IVN A;  3TOA A;  2LSO A;  3KP5 A;  3R61 A;  2H6C A;  4EJW A;  4HA8 A;  3CUQ A;  3SZT A;  1CGP A;  3GFL A;  2J5O A;  3KET A;  2ISZ A;  3V8J A;  1I1S A;  3K0L A;  4AIJ A;  3ABT A;  2KIM A;  1KU3 A;  1P4X A;  3E6M A;  4BHP A;  4R79 A;  3WE3 A;  3M7G A;  4UV9 A;  4KIC A;  3ELK A;  1F9N A;  3K2Z A;  1KYW A;  1ZG5 A;  1RZ4 A;  1R1T A;  4OMY A;  4ESF A;  1FZP B;  4LMY A;  2CW0 F;  2P4W A;  1K78 B;  5DEQ A;  2FBK A;  2HGC A;  2PEX A;  2XKO A;  3J80 K;  1T39 A;  2F5D A;  4GGG A;  1J2X A;  2A5Y B;  2HYF A;  3KLO A;  4XLN F;  2QBY B;  3GUD A;  3E3V A;  1BC8 C;  5D6F A;  3GFJ A;  1TQM A;  3BPV A;  5LLQ A;  2DK8 A;  2O3F A;  3BRO A;  1FYM A;  1G3S A;  4IRG A;  3N97 A;  1WRJ A;  3LWF A;  1KGS A;  1MD0 A;  3KLN A;  3CTA A;  2O03 A;  3GXO A;  1IF1 A;  2QQ9 A;  1P2F A;  2DQL A;  1EV7 A;  1IRG A;  2ESH A;  1YW7 A;  5KVR A;  1O7F A;  1UHW A;  3FXR A;  2M1B A;  3QOP A;  3SQN A;  2XUB A;  1ZGJ A;  2L54 A;  1B9N A;  4L9J A;  3KP2 A;  3CO6 C;  4NB5 A;  3ABU A;  4HX8 A;  1O3R A;  3FHZ A;  2HKO A;  2DQR A;  1O3T A;  1ZRE A;  4CDG A;  5DDG A;  3M1E A;  3V8L A;  1YQA A;  1FP1 D;  3DKW A;  1OR7 A;  3F8F A;  5HS8 A;  1W5T A;  3ZMS A;  1SMY F;  4LG0 A;  4OIP F;  2DPU A;  5LGN A;  1UCR A;  1W4M A;  3VOD A;  5JVT A;  3I5U A;  4P5O A;  3JSP A;  4EM1 A;  5AIQ A;  3TO7 A;  1HXD A;  3RYR A;  5KK1 A;  5BPI A;  1BBY A;  1K7A A;  3RPU A;  2YX4 A;  3GZ5 A;  3F3X A;  2V1U A;  2ADU A;  1IW7 F;  3E6D A;  1LDK B;  3FWE A;  3L2C A;  3FX3 A;  2DBB A;  1R58 A;  1BI1 A;  3JTG A;  2WC2 A;  5K1Y A;  2Y75 A;  2OD5 A;  1KU7 A;  4IRI A;  4ETS A;  3J80 Z;  4G6D A;  2NRA C;  3LA2 A;  4N9H A;  4IF4 A;  4Y15 A;  2XAS A;  3BY6 A;  3FM5 A;  4LK0 F;  1I5Z A;  2MH2 A;  3E5X A;  2HR3 A;  2XRO A;  1B59 A;  3I0T A;  4EV0 A;  2DU9 A;  2ZBK A;  4L5J A;  3HOS A;  2WWY A;  3HHH A;  2KIF A;  4RAZ A;  5BS6 A;  5HDN A;  3WE2 A;  2M30 A;  5DD8 A;  4OIR F;  4RGS A;  2V6C A;  3RKY A;  2IJL A;  4I0B A;  4G6Q A;  4HLX A;  1ZAO A;  5JI6 A;  3F8C A;  3KCC A;  3QAH A;  4HV5 A;  3L7W A;  3GX4 X;  4Q4Z F;  1IRF A;  2VE9 A;  2MC3 A;  5L3B A;  3G3Z A;  1LQ1 A;  2E1C A;  3MFK A;  5CVR A;  2K7L A;  1IN8 A;  4EJO A;  3GFI A;  3TDZ C;  1XMK A;  2QYO A;  1UB9 A;  4HDU A;  1EH6 A;  1IN5 A;  1BOA A;  3P9K A;  2CYY A;  2DTR A;  2V1X A;  1ZG3 A;  3DQV C;  1G3Y A;  3ZPL A;  2FBH A;  3BJA A;  4OIQ F;  2V1D A;  1Z1D A;  1T38 A;  3WTZ A;  3GO5 A;  1ODD A;  1H9T A;  1FNN A;  2R3S A;  1DPU A;  1ZHF A;  4EGZ A;  2LF8 A;  4KIB A;  1QBJ A;  3HSE A;  1C0W A;  1LVA A;  2NYX A;  4P9U A;  5FFX A;  3I64 A;  3CLO A;  1X3U A;  2XVC A;  4MQ9 F;  3V7R A;  5ILU A;  3KZZ A;  2OZ6 A;  2RQP A;  4FHT A;  2VBX A;  5DD4 A;  3R4K A;  1HKS A;  1QZZ A;  3WG9 A;  4KYW A;  3SZP A;  3WU1 B;  5DV5 A;  3ZN0 A;  2FEZ A;  1BC7 C;  4RB1 A;  1MJA A;  4EJT A;  5H6Q A;  1OMI A;  4L9T A;  5E17 F;  5L3F A;  4L18 B;  1HKT A;  2IVM A;  5HLI A;  4UV8 A;  1DP7 P;  4BAY A;  1I27 A;  3BJO A;  2BEO A;  2HWV A;  4A0X A;  3QU6 A;  1W7P D;  1BN5 A;  5E1X A;  4G9Y A;  2FU4 A;  4Q5S F;  3SHF A;  2CWE A;  2XAF A;  2L02 A;  2PQ8 A;  1FPQ A;  2HYG D;  1XB4 A;  2A61 A;  2MLG A;  2Y48 A;  4O5V A;  3QPH A;  4IRH A;  5ILV A;  2DI3 A;  1YW9 A;  2CSO A;  4HF0 A;  3WTU C;  2DO7 A;  1BI2 A;  2ZCW A;  1KA8 A;  1L0O C;  2DPD A;  5HVQ C;  4UVA A;  1G3T A;  2IT0 A;  2BE5 F;  1TW3 A;  1YO5 C;  3E97 A;  5K5R A;  5F6F A;  3CDH A;  2VBY A;  4KN7 X;  4U7B A;  2P6T A;  4G7Z F;  2PMH A;  5FB2 A;  1LJ9 A;  2D1V A;  4RGX A;  5DYM A;  2Q8K A;  3RIR A;  5IT9 K;  3RI4 A;  4A0Z A;  1R22 A;  3KP6 A;  2RC4 A;  4BXU A;  5L3C A;  4G8X A;  5ED4 A;  1D5V A;  1OYI A;  3MWM A;  2FNA A;  1OYW A;  2XAG A;  2Q2E A;  2DLL A;  1OPC A;  2FA5 A;  4GYI A;  4KUM A;  4U88 A;  4EVI A;  4HLY A;  3EYY A;  1ZLK A;  1RUN A;  1ZH5 A;  4I0A A;  1DDN A;  4I09 A;  2IP2 A;  4WX9 A;  4G7H F;  4O3M A;  2Z9O A;  3BOQ A;  4Y13 A;  4L9V A;  1IZ1 A;  2FQ3 A;  3GW2 A;  2O6G E;  3P9C A;  1R5H A;  4KFC A;  2D45 A;  4HBL A;  3HRU A;  1Z7U A;  3HTU A;  1FX7 A;  2RGV A;  1R5G A;  3D0S A;  3GZ6 A;  2JTV A;  2EWN A;  3KEQ A;  3WTS C;  4KNY A;  5IT3 A;  4K2E A;  3DXJ F;  3F22 A;  1LNW A;  1ONV A;  5JR3 A;  3M9A A;  4ZYD A;  1J59 A;  1XSV A;  1R00 A;  1PUE E;  4RB3 C;  4OIN F;  2FRH A;  5LHH A;  3H3Z A;  1KYZ A;  2COM A;  3MZH A;  1FBQ A;  1FLI A;  1L3L A;  1F1Z A;  1HSJ A;  2J5P A;  2P5L C;  4MEY F;  2EFP A;  4UXN A;  3TGN A;  1XD7 A;  4BNC A;  2FXA A;  1YS7 A;  3DPT A;  4XSX F;  4UHT A;  3BWG A;  1FOK A;  2ZNZ A;  5IT9 Z;  3QPT A;  3Q9V A;  2EK5 A;  1T6S A;  4WCG A;  4RB2 C;  5A2Q K;  4WF2 A;  2YSR A;  2G7H A;  4EM2 A;  2C6Y A;  4HF2 A;  3ECH A;  1QPM A;  5L3D A;  2UXN A;  4JBA A;  5J8C A;  1W7P B;  3FMS A;  5H6R A;  5L3G A;  1SFU A;  2VC0 A;  4HDV A;  1HW1 A;  4CYD A;  3HSF A;  2W25 A;  3ISP A;  4ENM A;  3HRT A;  1U2W A;  5HS7 A;  2W57 A;  1E2X A;  2ELH A;  2EV0 A;  3WTV C;  1SFE A;  3G73 A;  3ECO A;  1I1G A;  4IHS A;  3BDD A;  5LGT A;  3ZP5 A;  5AIP A;  1K78 A;  2H09 A;  4UUV A;  1XCV A;  3H3U A;  2LF7 A;  4F7Z A;  2QBY A;  1MKM A;  3IWZ A;  4HX4 A;  4EQQ A;  2QLZ A;  1XSX A;  2UWM A;  1ON2 A;  1WWX A;  2XAJ A;  3CUO A;  4AIK A;  4FX0 A;  2MH9 A;  1RUO A;  1LEA A;  1ZRF A;  1UST A;  3LST A;  2EA2 A;  3T0Y A;  5J6X A;  2A69 F;  4EJU A;  1LEB A;  3JAM K;  3TO6 A;  4U0V A;  2YR2 A;  3IL2 A;  4TV7 A;  2G9W A;  3TQN A;  4E70 A;  5E20 A;  1TNT A;  1TNS A;  2ZKZ A;  1JHH A;  1Z6R A;  3EDP A;  2H27 A;  1TQP A;  3ZMT A;  1V4R A;  1T98 A;  4KMF A;  2XGX A;  1U6G A;  3MCZ A;  2PG4 A;  2ZME B;  1MZB A;  2VXZ A;  4AIH A;  2JSC A;  4I01 A;  5FD6 A;  3QU3 A;  1ULY A;  4RS8 A;  1YLF A;  4WXC A;  1GXP A;  3COA C;  1BI0 A;  1KQ9 A;  2X4H A;  2RDP A;  2UXX A;  3N4M A;  5D8L B;  3IHU A;  4M72 A;  5A2Q Z;  4A6D A;  4D0P A;  2Z99 A;  1T0F A;  2DW4 A;  3R0A A;  1U3E M;  2P5K A;  4MNU A;  1QQI A;  4MGR A;  5CYV A;  2BYV E;  1MDM B;  5LBQ A;  2ISY A;  1USS A;  5HLH A;  2RKH A;  4IJA A;  3V4G A;  1P4W A;  1TBX A;  4HZF A;  4A5N A;  5JHU A;  1SAX A;  2LDU A;  3D5L A;  5ICE A;  2B0L A;  1O3S A;  2EJR A;  2VBW A;  4LB5 A;  1GHC A;  3VFZ A;  1TTY A;  4RGU A;  4GXO A;  2IRF G;  1H9G A;  4ENK A;  3WTY C;  3ULQ B;  1ZYR F;  2YU3 A;  3V7C A;  3E6B A;  5K5O A;  4Q48 A;  4GCV A;  3ERE D;  3GYH X;  1REP C;  2W84 A;  1FY7 A;  3LAJ A;  1WKM A;  3HRS A;  1UHM A;  2OU2 A;  3JAM Z;  1B4A A;  4P9F A;  1SD4 A;  1EH8 A;  2VOP A;  1ZRD A;  2YX7 A;  3Q5F A;  3L09 A;  1JHF A;  4XRF A;  2STT A;  1J7K A;  2VE8 A;  3C3W A;  3TOB A;  4YII A;  2PJP A;  4PDK A;  3I59 B;  2L3D A;  2GIV A;  1HST A;  4HQM A;  4MHG A;  1KQ8 A;  2WV0 A;  4MTD A;  3CO7 C;  4O6J A;  5F64 A;  3QRF F;  2GAU A;  2A68 F;  3AAF A;  5LHI A;  3DPL C;  3F8M A;  2K86 A;  4LJZ F;  2WTE A;  3F6V A;  2IPQ X;  4HW0 A;  2F5E A;  4A0Y A;  1ZGA A;  1HKQ A;  3L9F A;  1QZY A;  3R6S A;  2HTJ A;  2IA2 A;  2GA2 A;  2OBP A;  2FNP A;  2MBF A;  3RKX A;  1DPR A;  4BQA A;  3FF5 A;  5CLS A;  4M6X A;  5EEH A;  4L5I A;  5LGU A;  1S8N A;  3WGG A;  4Y17 A;  2HS5 A;  2ZO4 A;  1BJA A;  3KEO A;  4U7D A;  2BGC A;  2D1H A;  3FM3 A;  2Q0O A;  2BBY A;  2ZJ2 A;  1S3J A;  2RNJ A;  3QP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...