3HSEA

Crystal structure of staphylococcus aureus protein sarz in reduced form
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
116
Chain Sequence
GSHMYLSKQLCFLFYVSSKEIIKKYTNYLKEYDLTYTGYIVLMAIENDENIKKLGERVFLDSGTLTPLLKKLKDYTEQGKAIKSPLAEISVKVFNEFNISEREASDIINNLRNFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structures of the reduced, sulfenic acid, and mixed disulfide forms of SarZ, a redox active global regulator in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Transcription regulator
molecule keywords HTH-type transcriptional regulator sarZ
total genus 40
structure length 116
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3hseA00
4EJUA 3NRVA 3ZMTA 5DUIA 1I1SA 2FQ3A 4EMSA 1FWZA 3NQOA 4HF2A 2GQQA 1YW7A 3C18A 1UHWA 5CLSA 3PFIA 1LJ9A 1IF1A 1FYLA 1SD5A 4MGRA 4JBAA 3EQLF 3HSEA 3BY6A 2HEOA 1OKRA 3MEXA 4P55A 5LHHA 4LMYA 2HQNA 5LGUA 3F8CA 1I1GA 2CGPA 5FFZA 2OQGA 3E5UA 4WWCA 4A12A 4UUVA 1T98A 1PP7U 4ZH4F 2FU4A 3RTRA 2IVMA 3M8EA 3IKVA 3BWGA 5D5XB 1OPCA 4HA8A 5F64A 2P4WA 3BJOA 2MLGA 3TO6A 2XKOA 3F23A 3G3ZA 4MNUA 3M9AA 2RVCA 3ULQB 3R4KA 3DPTA 3WE3A 2LSOA 2HTSA 4N0BA 5LGNA 4G6DA 3HRSA 5JR3A 2CSOA 2RNJA 5E1XA 2GIVA 3TQNA 2W25A 4YFXF 1CF7A 1SMTA 4I02A 2HOEA 4B09A 2P7VB 2ZKZA 4EVIA 3NEUA 3V8KA 4MQVA 1B1BA 2B0LA 4IRIA 1J2XA 4FT8A 2MBFA 2EA4A 1YS7A 2Z99A 3GUDA 2F5CA 1XDSA 1U78A 3WU1B 1J7KA 2Y75A 4UXNA 3J80Z 4EJOA 1W7PB 4CICA 3TOBA 1MKMA 1YW9A 3BOQA 5BQTA 1RZ4A 3VODA 2HR3A 2XVCA 4XBFA 5EEHA 1G6NA 3KP7A 1G4DA 4O3MA 4IF4A 3FWEA 3MAJA 3T5XA 4ENMA 2O6GE 2P6SA 4HF0A 2OBPA 2PG4A 1D8JA 1Z05A 5LHIA 2XUBA 2KJBA 5DCMB 4O5VA 1BI1A 2QVOA 4HQMA 4L0ZB 3D0SA 1FX7A 4A6EA 3TGNA 4UVBA 5HS7A 1TQIA 4UNOA 2CO5A 1KA8A 5TJJA 2QQBA 3F3XA 1P4XA 2ELHA 3FX3A 3WG9A 1NHAA 4G7ZF 1W7PD 3WGGA 2PMHA 3LA2A 2PN6A 3V7RA 1XGMA 2JRTA 4BH9A 3ISPA 1UHMA 2DQRA 5HDKA 3GX4X 2K4BA 3ECHA 2PMUA 3ERED 4FHTA 1O7FA 1FBUA 4UVAA 1DPUA 3N4MA 4YFKF 2HYFA 5FGMA 1T39A 2HTJA 3I58A 1SFUA 3GWZA 2VN2A 1EH7A 4RGUA 5HLGA 4PZJA 5E20A 1QQIA 4IPAA 1IN6A 1R36A 5HOOA 1AWCA 2JZYA 1BC7C 4UHTA 2Y0MA 4KIBA 3QPHA 5IT9K 2G9WA 3R0JA 3BJAA 2QBYB 2EA2A 4OIQF 2M87A 2ZBKA 4HV6A 1TTYA 4TV7A 3KP5A 2EV5A 2BV6A 1XMAA 2IA1A 4IVNA 5DYMA 2J5OA 3N97A 3LA7A 4S04A 2K27A 4BYYA 4L5IA 1D3YA 1S8NA 1STZA 4B8XA 5A2QZ 1LEAA 2NYXA 4KA4A 3CO7C 2LNBA 4ZYEA 1EH8A 2WWYA 2IA0A 2OZ6A 2L4MA 4AIKA 2NAZA 1BJAA 1YS6A 2ESNA 2QYOA 1QBJA 4OMZA 4JK1X 3RDIA 3DF8A 5DD4A 4E70A 1F1ZA 1CF7B 5D6EA 5DDGA 1QZYA 3QAHA 2OA4A 2YX7A 1BBYA 3MZYA 1ON2A 4G94A 4CYDA 4IRHA 4U0WA 2V9VA 1G3SA 5D5VB 2HZTA 1WI9A 4HW0A 2XROA 4BNCA 4A0ZA 1YTYA 3EYIA 2GZWA 3KP6A 2STWA 1XMKA 2PBIA 2JT1A 4IHSA 2BGCA 1LB2A 5H6RA 1TQPA 1MJ9A 2PFBA 1MDMA 1PP8F 3C7JA 2XASA 3R6SA 4L5JA 2KIFA 4XRFA 2Q0OA 1O3QA 1J59A 2DU9A 1IN7A 4OIOF 4EM1A 3E3VA 1ZLJA 1WRJA 2O8XA 4RGSA 4XSXF 3GZ5A 3GFMA 3QP5A 2M45A 1ZHFA 4HAMA 2VBXA 1S7OA 4PGGA 4CGZA 1I6XA 1XB4A 2R3SA 1YLFA 2H94A 4Z2YA 1XSXA 4HLYA 4M74A 1EV7A 2DPDA 4QWQA 1IXRC 1QPMA 1GVJA 4HV5A 1RIOH 3WE2A 2EWNA 4Y15A 4I0AA 1I5ZA 3LQRA 2ISZA 2UXNA 2ZNYA 4BXUA 2RV8A 2Z9OA 1BOAA 2XGXA 5LRRA 1JGSA 4Q47A 1H9TA 4AWXB 1FYKA 2RC4A 4WF2A 3P9CA 4M6XA 1B59A 2GXGA 5F6FA 2LF8A 4KYWA 3WTYC 1JE8A 2HDCA 5H20A 1HXDA 2DPUA 4L18B 2LF7A 2AS5F 4KMUX 4MEXF 2D1VA 1U3EM 4GCVA 1BC8C 1QO0D 1HW1A 3RKYA 1T38A 2PJPA 4KN4X 1E17A 1S7AA 3F6OA 3C3WA 4IHTA 4HBLA 3T1BA 1Z6TA 5ICCA 4R79A 2VE8A 1YFHA 1ZREA 2LDUA 2Q8KA 3TO7A 4EJWA 5ED4A 2ACJA 3V8JA 1KQ8A 3TDUC 4ETSA 4QLCU 1XN7A 4L9TA 5LEKA 2HFHA 4I01A 3SFZA 2MD5A 2VT3A 1XSDA 2G7HA 1ONVA 3F72A 4OU0A 1IZ1A 3KETA 2W24A 3H3ZA 2FBHA 4KUMA 1EH6A 2F5DA 1BI3A 4O6JA 1O3SA 4EQQA 5JFRA 4F7ZA 4U0YA 2JPBA 3F22A 4CZZA 5L3DA 4A5MA 2QM3A 3U2RA 3CUQB 3K1MA 2A07F 3B73A 3HOTA 3WTTC 1SAXA 3QRFF 4ZYDA 4HLXA 4HQEA 3HHGA 4OIPF 3V8LA 4HDUA 3QPTA 1C0WA 1IN4A 2IP2A 3IKTA 2ZJ2A 3WTUC 3M7GA 4R1HA 1DUXC 4UV8A 2VT2A 1OYWA 3CDHA 4BAYA 3LAJA 2HWVA 1K79A 4A5NA 3V7SA 4IJAA 3I64A 2IRFG 3T8TA 5AIQA 5BPDA 3V7CA 3Q9SA 1XCBA 3GYHX 1VTNC 2XAGA 2VE9A 4G7HF 3QP6A 4U7BA 1T2KA 5D6FA 4LK1F 1W4MA 3MQ0A 4M73A 5BMZA 1LDJA 4A6DA 2HYGD 3ZP5A 2KIUA 1K6OA 1USSA 1J9IA 2XAJA 3HIFA 2DFIA 3E6DA 5E8IA 2KRFA 4U7DA 2QZ8A 4BHBA 2P7CB 3OOPA 4ESJA 3RPQA 2A68F 5JVTA 3ELKA 4RS8A 4IRGA 3WODF 1RNLA 5IT9Z 1XGNA 3TKYA 2WC2A 3ABUA 1Z91A 2UWMA 3L7WA 2ZO4A 3KLOA 1R1VA 5AIPA 1S6LA 3IRQA 4OINF 1IRFA 4ASNA 5K5OA 1FT9A 2W57A 1IW7F 4NQWA 1P4AA 1F4KA 1YYVA 2VBZA 2DK5A 2QBYA 3JSOA 3PQKA 1G3YA 3KLNA 1QGPA 2Z5UA 2VBWA 4LK0F 3VOEA 2EFPA 5L3CA 4GO1A 2FF4A 2IJLA 3HSRA 4GGGA 4LJZF 1FSHA 2Z3YA 3L2CA 2VODA 4FX0A 2DT5A 4M71A 3WU0A 4PDKA 3WGIA 4WCGA 2JPCA 5DCMA 2FSWA 1UFMA 3ZN1A 4P9UA 4DQ2A 1U6GA 1XGOA 1FZPB 1BIBA 3LFKA 2CWEA 3LSTA 1XGSA 2RQPA 1T0FA 4L9JA 3RKXA 3BP8A 3O6BB 1O57A 5LLQA 5ERIA 2GAUA 1T6SA 5D5UB 1U2WA 1X3UA 2Q2EA 4Q4ZF 2OAZA 3I0TA 2CYYA 4WX9A 2X0LA 4OOIA 1A04A 1KQ9A 1S29A 3F8MA 1LVAA 4K2EA 2XKPA 1PDNC 3JW4A 4HZFA 5FO5A 2YU3A 4HOBA 3F8BA 4YIIA 1ZGAA 1XDUA 1U5TA 2ETHA 5CVJA 3IWZA 1B6AA 1D8KA 1TW3A 4KMFA 1ZH5A 3WTZA 1LNWA 4L9VA 4MQ9F 3O3KA 4N9HA 3PQJA 1AOYA 4P96A 2H09A 4A0XA 2XRNA 3FF5A 1P2FA 2KJCA 2W84A 2LKPA 3RPUA 5D5WB 3G73A 1Z6RA 2C6YA 3CO6C 2M5WA 1IRGA 5EEGA 2EFQA 4AIHA 2ZFWA 4EV0A 5J8FA 3RKWA 2MH2A 1Y0UA 4I09A 4M6YA 2K02A 2JSCA 2O3FA 4OIRF 4CXFA 5ICFA 2L02A 4RB3C 3GFLA 2F5FA 4U0VA 1KU7A 1J0RA 1PUEE 3LA3A 2XHKA 2PI0A 3B02A 1RI7A 5L3GA 1J5YA 2K86A 1XSVA 5AONA 4XLPF 5ILUA 1TNSA 3DQVC 4I0BA 4GXOA 5LHGA 2YSRA 2H27A 1MJBA 4S05A 5TRDA 5D8KB 3L09A 2K4JA 4EJTA 2GXBA 1L3LA 1BN5A 1HBXG 4I2OA 4NHJA 4ESBA 2VONA 2RDPA 4Q5SF 1IXSB 3WTWC 1GHCA 3GXOA 3CJNA 3TDZC 5CVIA 2NS0A 2MC3A 4YFNF 5LRSA 1ZG1A 1ZAOA 4MTEA 3F21A 3FXQA 3MFKA 1G3TA 3VFZA 4GYGA 4XSZF 2DO7A 4A0YA 1DDNA 3Q5FA 5CVVA 5E17F 2DI3A 3I54A 1QNTA 2QUFA 3T8RA 1RUNA 2IT0A 3FM5A 3K0LA 4P5OA 1ZARA 2Z33A 3KZYA 4AIJA 3HYIA 3KE2A 4KICA 3E6CC 4LFUA 5KVRA 3ZMZA 4BHCA 4ENJA 3L00A 3LWFA 3ZN0A 4AD9A 2JTVA 1R5GA 3FMQA 5JI6A 3BDDA 1ULYA 3JSPA 3CUQC 2E7XA 4D0PA 4NB5A 2OQRA 3MWMA 4G9YA 1DPRA 4M72A 3FMSA 1B9NA 3E6BA 3C1DA 1FP2A 2EK5A 4R8HA 5J8CA 5DD8A 1ZG5A 3H3UA 1SMYF 2BEOA 3IL2A 5FLXZ 3U9GA 3SXYA 3DEUA 2EV6A 4BQAA 4LLGF 3GFIA 2A6EF 4GYIA 1GXQA 1Q1HA 5FD6A 4YG2F 1E2XA 1OYIA 4WXDA 1R1UA 1YG2A 5K5QA 2AXLA 3KP4A 3I53A 5L3BA 1K78B 3E6MA 1OYYA 2IA2A 5IT3A 3FXUA 2A69F 4G8XA 2R7FA 2D45A 1P4WA 2XIGA 2HGCA 1W5TA 1TLHB 1TQMA 2XAFA 3RYPA 2MH9A 3S2WA 4LGWA 5BS6A 3JTGA 1SD6A 2EV0A 2H6CA 4H0EA 2VC1A 3HRMA 3J7AO 1B4AA 2MA3A 4HYEA 3GEZA 2RN7A 3ZMSA 2L54A 1G3WA 4JQFA 2V1UA 3GZ6A 4HDVA 1SD4A 2ADUA 4LLLA 3J81K 3KEQA 1ZYRF 1FBQA 1QZZA 2EFWA 5E1WA 4MEYF 2QQAA 1TW2A 3VEPA 2BBYA 2VOPA 1SFXA 5BOXA 3IRRA 3BZ6A 3DFGA 4P9FA 4Y13A 5LEJA 4KIFA 1KGSA 1IXCA 1O7LA 2DBBA 1L0OC 1FYMA 6PAXA 4CHUA 1GXPA 2M30A 5L3FA 2FA5A 2G7UA 2DAOA 1B9MA 1HKTA 2DK8A 1MJAA 1HQCA 3EDPA 5HDGA 1FBSA 3REOA 5KK1A 3SQNA 4CO8A 1FNNA 2NNNA 1U8RA 4EGYA 1I27A 3QU3A 4EJVA 3ZMUA 1W7PA 2TDXA 2J5PA 1HSTA 4AVPA 5D4RA 5H6QA 2O0YA 3E5QA 1FLIA 2GA2A 2QENA 3BJ6A 4WXCA 3ZMVA 1R7JA 1KQ0A 1SD7A 4LB5A 1R00A 2EFNA 2GWRA 1LEBA 1HW5A 1K7AA 2FBKA 2A6HF 3FXRA 3HRTA 3Q9VA 3J80K 5CYVA 2FMYA 1JXSA 1ZN2A 3IWFA 1ZRFA 1ON1A 4M9XA 3QU6A 3K69A 1IUYA 5FLXK 2D1HA 3GO5A 1U5TB 4YIFA 1P92A 2UXXA 1KYZA 2PQ8A 2QLZA 3ML6A 3JAMZ 3P9IA 4BHPA 2OD5A 2K7LA 4ENNA 3HRUA 2V79A 5E1ZB 4U88A 2COMA 2L01A 3DKWA 3LQQA 1WWXA 1ODDA 3V4GA 4RGXA 5HDNA 4IXAA 1LDKB 2F5EA 3R60A 1DP7P 3F8FA 2FXAA 4UV9A 3KFWX 1H9GA 2XAQA 2W85A 4ZYHA 1J75A 2L3DA 4HX4A 5E8GA 4RGRA 3WTXC 1H0MA 3CUOA 3FZVA 5F1RA 1XD7A 4PCQA 2FE3A 3KP2A 2FBIA 5LBQA 5FB2A 5ICEA 4PGHA 1U5TC 4EM0B 4ZZDA 4ENKA 5ICGA 1HKSA 4KT5C 1IN5A 2F2EA 2VC0A 2ZMEB 2QWWA 2IW5A 2BE5F 2EB7A 3EYYA 5K5RA 3WTSC 4Y17A 2DLLA 5CVUA 2P5KA 2P5VA 3HTUA 1BM9A 2QQ9A 2O61A 1S3JA 3W6KB 1MDMB 2V6CA 4I98B 5D4SA 2ESHA 2E1NA 5DUKA 2YR2A 3CUQA 2HKXA 1BI0A 2STTA 3RIRA 3DV8A 1O3TA 2PEXA 3COAC 3FMRA 2RKHA 2FNAA 3R0AA 4DNCA 2UZKA 2V1DA 1BIAA 2OZUA 1LDDA 3KZZA 2EJRA 1V3FA 5HLHA 3D5LA 2YPRA 1R1TA 3JTHA 2V1XA 3RJPA 4FX4A 3ZPLA 3K2ZA 1W5SA 2XAHA 2E7WA 2YX4A 3J81Z 2H6BA 4L9NA 4RB0A 2WTEA 4A2UA 1F9NA 2R7DA 3JAMK 3E97A 3ZQ7A 1R23A 2O03A 1FSEA 1R58A 3GF2A 5DEQA 2FNPA 3IHUA 1ZGJA 2Y48A 4KFCA 3WGHA 2XV4S 3I4PA 5D8LB 4MHGA 3F8NA 5K1YA 1O3RA 4UVCA 2P6TA 1XCVA 5FFXA 2CW0F 1SFEA 2CFXA 3HTSB 5E18F 1YIOA 3P9KA 2DW4A 2A3SA 3KCCA 1FPQA 1YO5C 5A2QK 3I5UA 1CGPA 3I59A 4LG0A 1MGTA 1K78A 3ECOA 2NNYA 4RAZA 3GW2A 1OR7A 2ZMEA 4EM2A 5L3EA 3I59B 4LG0B 1R5HA 1WKMA 1UB9A 1HW2A 1UCRA 2DQLA 4CDGA 3HHHA 1MD0A 3KEOA 1KU3A 5ILSA 3I71A 3H92A 3K1PA 2M8EA 1KU9A 3GFJA 3WTVC 2DTRA 3SZTA 1ZRCA 1IAWA 3K1NA 1FY7A 3DP7A 5HLIA 2CG4A 2WV0A 2KKOA 3MCZA 1KYWA 2FOKA 3E5XA 2FEZA 2D2WA 3TO9A 3RI4A 4ESFA 2MLKA 4M9ZA 3SZPA 1FC3A 2PLYA 2KIMA 5DV5A 2VXZA 3HUGA 2P5LC 4WXHA 2ZNZA 1Z9CA 4ZYGA 3AAFA 1V4RA 3ABTA 1WQ2A 3BROA 2CQKA 2HKOA 4L0YB 1D5VA 1USTA 1FOKA 4RB1A 5FD5A 2HS5A 4RB2C 3CTAA 4HX7A 3CLOA 5HS9A 3BPVA 4KDPA 3VB2A 3T0YA 1YW8A 1LQ1A 4HF1A 4KIGA 4WK8F 1RUOA 3GLXA 1JHHA 4EGZA 1FP1D 3M1EA 3QOPA 5DCFA 3GVAA 3IC7A 3RYRA 4LLNA 5CVRA 3L9FA 2ZXJA 3ROUA 3HSFA 1F5TA 1ZRDA 4Q48A 3O2PE 4LD5A 2FMLA 2X4HA 4HX8A 2GA1A 1Z1DA 1R22A 4N9IA 5ILVA 2BYVE 1YQAA 1JHFA 5LGTA 3HOSA 5CJ9A 1IN8A 3MZHA 1WSUA 5HS8A 3FM3A 3LAPA 4KNYA 2P8TA 3M8FA 1P6RA 3R61A 3OV8A 1ZG3A 2NRAC 2VBYA 3W6JB 2VOOA 3KP3A 4M9SA 4XLNF 3P7NA 5BPIA 4G7OF 3SHFA 2L4AA 4G6QA 5J6XA 4KN7X 1REPC 3U1DA 2ISYA 3K9TA 1ZLKA 2HQRA 3EUHA 1HKQA 2M1BA 2IPQX 4OMYA 2OU2A 2EFOA 4MTDA 1TNTA 5JHUA 5HVQC 4ZZLA 1TBXA 1HSJA 3BPXA 2A5YB 2A61A 3F6VA 1MZBA 2E1CA 4ON0A 3TOAA 2ZCWA 3DXJF 2RGVA 4LB6B 2FRHA 1Z7UA 1KU2A 3DPLC 3FHZA 1OMIA 1BI2A 4I7HA 3ZMDA 3EETA 4RAYA
chains in the Genus database with same CATH superfamily
4XKCA 4C2MJ 4EJUA 1ETQA 3NRVA 3ZMTA 5DUIA 1I1SA 1ETVA 3CF5F 2FQ3A 4EMSA 1FWZA 3NQOA 2VIXA 2CJJA 3CMYA 5GAHJ 4BJ6C 3VYUB 2GQQA 4HF2A 3BT9A 3CCYA 3JREA 1YW7A 3C18A 2ICWG 1UHWA 4JOMA 5CLSA 1Y8QB 3PFIA 1LJ9A 2IBDA 3C2HA 1IF1A 2KDZA 1ETWA 1FYLA 2LK2A 4NBQA 1SD5A 4MGRA 3OYAA 4JBAA 3EQLF 3HSEA 3QPLA 2BVLA 2LG4A 3BY6A 2HEOA 1OKRA 4JX6A 1RKWA 2Y0SN 4NNJA 3MEXA 4P55A 5LHHA 4LMYA 2HQNA 3OWTA 5LGUA 3F8CA 1I1GA 2CGPA 3I9V2 5FFZA 2OQGA 5J47A 1MMAA 3E5UA 4E7IA 2L9NA 1V5GA 5K7HA 2Y2ZA 2VJJA 5M5YJ 3EUAA 4WWCA 2R7SA 1YRNB 2DA7A 4A12A 3I4NJ 4UUVA 1DGWY 1T98A 1PP7U 2GBYA 3BTJA 4ZH4F 3JRHA 2FU4A 5FKNA 3OIQA 1OISA 3RTRA 2IVMA 3M8EA 1I39A 2EIKH 3IKVA 4OAZA 3BWGA 2VKVA 5D5XB 2D5VA 2R5ZA 3JRDA 1OPCA 4HA8A 3CC2I 5F64A 2P4WA 3BJOA 4II2A 1JKRC 2MLGA 3TO6A 2XKOA 1OCTC 1FTTA 3AFHA 5EG0B 5J40A 3GBGA 2E1MC 3F23A 5GPCA 3G3ZA 4PFOA 4MNUA 3M9AA 1K6YA 1IDYA 2GM4A 2OF7A 2RVCA 2WV1A 3ULQB 3JRCA 4AM3A 2ME6A 5J1YA 4CUGA 2HQAA 3R4KA 4AU7A 3DPTA 2XPVA 4A3BJ 3WE3A 2LSOA 2HTSA 2MFZA 3KX2A 4N0BA 1BR1A 5FRMA 3KIOA 1G2HA 5LGNA 4G6DA 3HRSA 5JR3A 2CSOA 2RNJA 5E1XA 2GIVA 2DFHA 3TQNA 2W25A 4YFXF 1K61A 2JA5J 3I56I 1CF7A 1SMTA 4I02A 2HOEA 4B09A 2P7VB 1X2MA 2ZKZA 3MD2A 1HA8A 1MBKA 4EVIA 3JRIA 3NEUA 3V8KA 2WB1N 1B1BA 4MQVA 1O4XA 2B0LA 2CS3A 4IRIA 1J2XA 4FT8A 1JJ6C 2MBFA 1FTZA 2EA4A 2EZHA 3H9JA 2GIZA 1E3PA 3S14J 5JLWA 4HSRA 2E2IJ 2WB1A 5HLTA 1YS7A 2F4IA 1Z67A 2R93J 1POGA 3MN2A 3D5SC 1AA7A 2Z99A 1FOYA 3GUDA 1N25A 2F5CA 4IHXA 1XDSA 3JCUC 2XGCA 3M07A 3WU1B 1U78A 2R7WA 3TL4X 5FJ8J 1J7KA 1ZELA 2Y75A 4UXNA 1RC9A 3FHNA 4D5FA 3J80Z 4EJOA 1W7PB 1WJEA 4CICA 4X6AJ 1LKXA 1IRXA 4IL6C 1LFUP 2EINH 4A3KJ 1X1PA 2CH0A 3TOBA 1MKMA 1YW9A 3BOQA 5BQTA 2ELJA 2OV7A 1ZQ3P 2IS2A 1RZ4A 3VODA 2HR3A 1D1AA 2XGDA 2XVCA 3UR3C 2O9LA 5GAGJ 2HNHA 4XBFA 1ACIA 5EEHA 1G6NA 3KP7A 3AG1H 4C30A 1G4DA 2N8GA 4O3MA 5H2FC 2NS7A 4B47A 4IF4A 4XIDA 3FWEA 3MAJA 1XTAA 2X1CA 3T5XA 4ENMA 2O6GE 2P6SA 4Y33A 1OCZH 4HF0A 2OBPA 2PG4A 1D8JA 2CV0A 2L7MP 2Z1DA 1ETOA 1Z05A 1QVTA 5LHIA 2XUBA 2EZLA 2KJBA 3ZCOA 4M3DA 5DCMB 1OCPA 1JUPA 1BI1A 4O5VA 2QVOA 3CJQB 4HQMA 4L0ZB 3D0SA 3L2RA 1FX7A 1Y56A 2HYJA 1VNDA 2K9NA 4A6EA 3TGNA 4UVBA 5GP9A 1H88C 1A6QA 3JR9A 4BQOA 1IV6A 5HS7A 1TQIA 4UNOA 3DEEA 2CO5A 3BR2A 1KA8A 4J00A 5TJJA 1CQTA 5K7FA 2VASA 4X0GA 2F4OB 2QQBA 3F3XA 1P4XA 2ELHA 2JJ7A 3FX3A 3WG9A 1OQYA 4BQQA 1VQKI 3GTKJ 4KT6A 1NHAA 2W1OA 4HSTA 5KCMA 4XRMA 4G7ZF 1W7PD 1T08B 3WGGA 2PMHA 3LA2A 3OS0A 2MD0A 2PN6A 4M3FA 3V7RA 2WAQN 1XGMA 1ETYA 2JRTA 4BH9A 4JYKA 2VXDA 3ISPA 1UHMA 2DQRA 4XORA 2VPRA 1Z7LA 3ABLH 5HDKA 2I8DA 3PJRA 1RPWA 5TGTA 2HXIA 4E6KG 3GX4X 3IUOA 3ZXSA 2TCTA 1LPQA 2K4BA 3ECHA 4IHWA 2PMUA 1WJDA 3ERED 4FHTA 1O7FA 4NQWB 1FBUA 4RMNA 4UVAA 3HOZJ 3S1MJ 1DPUA 2DTZA 3N4MA 3KEYA 4RLFA 4YFKF 4BJ5C 2HYFA 5FGMA 1T39A 3CCRI 2HTJA 3I58A 3LSKA 1SFUA 2VL8A 2NVYJ 2Y30A 3GWZA 1I3QJ 2VN2A 1EH7A 2YS9A 4RGUA 4IOAF 2L0KA 3Q3SA 5HLGA 1NG6A 2HQ5A 4PZJA 5E20A 2BY1A 4BGDA 2XB5A 1QQIA 4IPAA 1IN6A 3BCAA 2BOLA 1VQ4I 3BR5A 4W1UA 3F9KA 1R36A 1TZLA 5HOOA 2W4SA 1IGNA 3HXLA 3OYIA 2EIJH 1AWCA 2JZYA 3CMMA 3QOEA 1BC7C 4UUTA 1BW6A 4LIVA 4UHTA 3TEDA 2LFBA 2Y0MA 2B63J 3A02A 4KIBA 3CDIA 3QPHA 2BHZA 4GDFA 2CMPA 3DTEA 3FKIJ 3WG7H 2DT7B 5IT9K 2G9WA 3R0JA 2JA7J 3BJAA 4FISA 2QBYB 2EA2A 4C3IJ 3OYLA 2L7FP 2M87A 4OIQF 4KJZA 2CUEA 2ZBKA 2X6YA 1TTYA 4HV6A 4TV7A 3LSPA 3L2UA 3KP5A 2QSHX 2LD5A 2EV5A 2AXTC 2BV6A 1XMAA 2CUJA 2IA1A 4IVNA 5F0FA 5DYMA 2F5VA 2J5OA 4RM3A 3AG2H 2DYSH 4L5EA 1TWGJ 2AO9A 2E36A 3K10A 3LA7A 4S04A 3N97A 1A36A 2K27A 4IZZA 4BYYA 4L5IA 2M7AA 3FXMA 3FXOA 1D3YA 2XRLA 5EYRA 1S8NA 1B8IA 2X1DA 2ECCA 2R7UA 1IRZA 1STZA 4E7SA 4B8XA 5A2QZ 3V42A 2KHMA 1LEAA 4B3AA 1E3HA 1Y1VJ 2QEXI 1YIJI 2CQQA 2NYXA 4I99C 5EZHA 3H36A 4PJJA 4KA4A 3CO7C 2LNBA 4ZYEA 3W6VA 1EH8A 3DU5A 2WWYA 2IA0A 4CCLA 2OZ6A 2L4MA 4AIKA 2HOAA 2NAZA 1BJAA 1YS6A 2ESNA 2QYOA 4XLCA 1AKHB 1QBJA 4OMZA 4JK1X 4PSWA 3RDIA 2KQRA 3DF8A 4PUSA 4BL0B 5DD4A 4E70A 3BG7A 3RQIA 2V1NA 2H8WA 1F1ZA 1MNDA 1E3OC 5D6EA 1CF7B 5DDGA 2DXIA 2DMQA 1S9HA 1QZYA 1X1AA 2OA4A 2YX7A 1BBYA 3MZYA 1ON2A 3QAHA 4HNTA 1MBEA 3CC4I 1IDZA 4G94A 4CYDA 4IRHA 3OSFA 4U0WA 2V9VA 1G3SA 5D5VB 1W36C 5IYBJ 2HZTA 5EDNA 1DU0A 3GCMA 5HNFA 1HOMA 1VQ5I 1WI9A 4HW0A 3CESA 3HGYA 2XROA 4BNCA 4A0ZA 1FOXA 3QODA 4CYCB 1YTYA 3EYIA 1F43A 2GZWA 3KP6A 2STWA 1XMKA 2XDVA 2XF7A 2PBIA 1WJ5A 2JT1A 4IHSA 3RZDJ 2AQFA 2BGCA 1LB2A 1Z3YA 5H6RA 5J1UA 1TQPA 1MJ9A 2Y9ZA 2DA2A 1WJCA 2R0QC 1YJWI 2PFBA 1MDMA 1PP8F 3O8GA 3C7JA 2KT0A 2XASA 1ZR2A 3R6SA 3RSNA 4L5JA 2KIFA 4XRFA 2Q0OA 1WGXA 1O3QA 3I3LA 5F27A 1J59A 3HBLA 2DU9A 1IN7A 1N77A 4OIOF 1SC7A 4HRIA 2PX9A 4EM1A 2A6TA 1BOBA 1ZLJA 2OCEA 2ZXHA 3E3VA 2HOSA 1WRJA 1NTCA 4A69C 1GV5A 1YX5A 2O8XA 3OR1C 4RGSA 2WAEA 3IH4A 4XSXF 3GZ5A 3GFMA 4BY1J 2E34A 3QP5A 2M45A 3CP2A 3S93A 1MNMC 1ZHFA 4BEHA 4HAMA 2VBXA 2MGQA 4RAYA 4LITA 1YITI 1S7OA 4PGGA 4CGZA 1WVRA 2K3FA 1I6XA 2KRCA 3BG5A 3ABKH 3ASOH 3HOVJ 3J7AY 2RREA 4BKXA 2M34A 1XB4A 2R3SA 1YLFA 1R49A 2LKXA 3CF2A 2H94A 2E5ZA 3DU6A 2PJRB 4Z2YA 1D1BA 3Q0WA 1XSXA 3HZJA 4HLYA 4M74A 4BS9A 1EV7A 2DPDA 3A0BC 2DA6A 4UUSA 4QWQA 1Y39A 1IXRC 1QPMA 1W5CC 2OPTA 1MSFC 1GVJA 4HV5A 4ZC3A 4N4OB 2OC6A 1RIOH 3WE2A 1XPXA 2EWNA 4Y15A 4I0AA 1I5ZA 3LQRA 5M5XJ 2ISZA 4ZDOA 2DA4A 2UXNA 2ZNYA 4BXUA 2RV8A 2Z9OA 1N75A 5FLVA 1BOAA 2XGXA 3A4CA 5LRRA 3S15J 1JGSA 3E0JB 2ID6A 3A2KA 4ABZA 1OCCH 3IH3A 4Q47A 1H9TA 4AWXB 1FYKA 1M1EB 2RC4A 4WF2A 3P9CA 4M6XA 4E7LA 1B59A 2GXGA 2QF7A 5F6FA 2LF8A 1ZGWA 2ZC2A 4KYWA 3WTYC 2QKLB 1JE8A 3RCOA 1MBJA 3ZQQA 2HDCA 2QSGX 5H20A 4LIUA 4D1QA 1HXDA 4FE4A 2DPUA 4L18B 2LF7A 2AS5F 4KMUX 4MEXF 2R7TA 2CU7A 1P7JA 4N4NB 2DN0A 2HDDA 1V55H 3AL0C 2D1VA 2E1MB 4II3A 1U3EM 2R7XA 4GCVA 1BC8C 1QO0D 3HL2A 3FBNB 1ETKA 1JKQC 1HW1A 3RKYA 2IGKA 1LFBA 4F52A 1T38A 2PJPA 3S1NJ 4A3CJ 4KN4X 1E17A 1S7AA 1V5EA 2ZB9A 3F6OA 3OIOA 2H1LA 4BXXJ 2M9HA 3C3WA 4IHTA 4HBLA 3T1BA 1Z6TA 4BQNA 5ICCA 4R79A 2VE8A 1JTXA 1YFHA 3PIPF 5IY5H 1ZREA 2LDUA 2Q8KA 3Q0VA 3TO7A 3OL3A 4EJWA 4XMYA 3IP4B 5ED4A 2ACJA 1VQ9I 3V8JA 3SFIA 3TDUC 1KQ8A 4ETSA 4OWRB 1XN7A 4L9TA 4QLCU 1X1DA 5LEKA 3S17J 1E0EA 5CPRB 2HFHA 4I01A 3KPHA 1FIPA 3SFZA 2TRTA 3ZQFA 1YI2I 1VQ6I 2MD5A 2VT3A 1FIAA 1XSDA 2G7HA 1ONVA 3F72A 4OU0A 1D5YA 1IZ1A 1A5JA 3KETA 2W24A 2JA2A 3H3ZA 4A3GJ 4AVZA 3HGGA 2R4GA 2FBHA 4KUMA 1EH6A 2F5DA 1BI3A 4O6JA 1O3SA 4EQQA 5JFRA 4F7ZA 1KONA 4FCYA 4U0YA 2JPBA 2NVUB 3F22A 4CZZA 1RETA 3VWBA 5L3DA 4A5MA 2QM3A 3U2RA 1HC8A 3CUQB 3LL7A 3BC8A 3ZGKA 3K1MA 4B48A 1D0ZA 2A07F 3B73A 1UZCA 5IP7J 1QHGA 2CQNA 2VJ4A 3HOTA 1HLVA 3WTTC 3IAM2 2O5RA 1SAXA 4M3GA 3QRFF 2ZJRF 4ZYDA 4HLXA 4HQEA 3W2WA 4A3FJ 4RAFA 1TWHJ 3HHGA 5B3SH 1GT0C 4OIPF 3V8LA 3PSFA 2V7FA 3QPTA 4HDUA 4BE2A 2XB0X 4XOTA 1C0WA 1IN4A 2IP2A 3IKTA 1WJAA 2ZJ2A 3WTUC 3M7GA 4R1HA 1DUXC 4UV8A 3ESWB 2VT2A 1OYWA 3CDHA 4BAYA 3BG9A 4CSWA 4HNVA 5IP9J 3LAJA 1PJRA 3DPUA 2HWVA 1K79A 3K6GA 4A5NA 5J4VA 3V7SA 3VPRA 4IJAA 3I64A 2IRFG 2CFOA 3T8TA 5AIQA 1TT5B 3V7CA 5BPDA 3Q9SA 1GDTA 1FMWA 3K4MA 2L9RA 1XCBA 3GYHX 1UJ8A 1VTNC 2XAGA 2VE9A 4G7HF 3QP6A 3GTMJ 4U7BA 2HXOA 3S3NA 3CCEI 3OYJA 5D6FA 1T2KA 1K4TA 3ZOBA 1T56A 4LK1F 4XLHA 3H0DA 1W4MA 2Y69H 4I6ZA 1ORKA 3CP8A 3MQ0A 3GMEA 4M73A 5BMZA 1LDJA 3FBIB 3KYDB 4A6DA 2HYGD 4HG2A 3ZP5A 4A3MJ 2KIUA 2LYCA 3EUKL 1USSA 1K6OA 3F0CA 1J9IA 2XAJA 3HIFA 2DFIA 4D7NA 3E6DA 5E8IA 2BZTA 2KRFA 3LSHA 2GOXB 2QZ8A 4U7DA 5EZGA 1X19A 2E2JJ 4BHBA 2H1KA 1YOVB 2I10A 1MH3A 2OJED 2V4JC 3MKLA 4CCMA 2P7CB 3OOPA 4ESJA 3RPQA 5F08A 1T95A 3L2QA 2A68F 5JVTA 3ELKA 2M3AA 4RS8A 4IRGA 2R7OA 4PJMA 3WODF 1RNLA 5IT9Z 1XGNA 3K4JA 4D7MA 3TKYA 2HVRA 2WC2A 3ABUA 1Z91A 2ELKA 3PNVA 1UHSA 3LSGA 3GTPJ 3H5RA 2UWMA 3D5RC 1BR4A 3E1SA 3ZQIA 3L7WA 4BACA 4YELA 2IAIA 2ZO4A 3L2VA 1GVDA 2HZDA 1UG0A 5E3OA 3KLOA 1R1VA 3M3YJ 2L7KA 1FOWA 5AIPA 3TP3A 1S6LA 3IRQA 4OINF 1IRFA 4ASNA 5K5OA 1H8AC 4YEJA 5EGOB 4AIDA 3G1LA 2VKHA 1N78A 1FT9A 2W57A 4ANJA 1VI0A 1IW7F 4NQWA 1P4AA 3HG9A 5KAIC 1F4KA 1YYVA 1QVUA 1R4NB 2VBZA 3ZRGA 4CZCA 2Z2SB 2DK5A 2DDAA 2HU9A 2QBYA 3JSOA 3PQKA 1G3YA 1WHUA 3HKZN 2JSPA 4C2UA 3FXLA 3KLNA 1W1WE 1QGPA 2Z5UA 1VFCA 2VBWA 5GAEJ 4LK0F 3VOEA 2EFPA 5L3CA 4GO1A 2A05A 2FF4A 1D0XA 2IJLA 3JRAA 3HSRA 1NG7A 4GGGA 1WI3A 1HF0A 3BG6A 3ONQA 4LOCA 4LJZF 2FOWA 1JTYA 1FSHA 2KL4A 2Z3YA 3L2CA 4BY7J 2VODA 4AYBN 2E5NA 4FX0A 2DT5A 1LFPA 2V9KA 2OUMA 4M71A 3WU0A 1WFXA 4M6VA 1VF9A 4PDKA 5F1JA 3WGIA 1XMXA 5C3EJ 4WCGA 4XRSG 4AYBA 2JPCA 3K4KA 2ZSHB 3LMMA 2FSWA 5DCMA 4XQFA 1X4OA 3GTLJ 1UFMA 2DOAA 3ZN1A 4P9UA 2X48A 4DQ2A 4IO9F 1U6GA 4HNUA 1T0FC 4CCKA 3ZQGA 1XGOA 1X2NA 2BY2A 1SAUA 1FZPB 1BIBA 1OCOH 3LFKA 2WA0A 2CWEA 3LSTA 1XGSA 1IG7A 4I76A 2RQPA 5F04A 2CW7A 1T0FA 2IS1A 4L9JA 3B6CA 4KISA 3RKXA 3BP8A 3O6BB 2CW8A 1T8IA 1Z3XA 1O57A 2KZGA 3BTLA 5LLQA 3UNGC 1VQ8I 2E71A 1RKTA 2BW3B 2OTLI 2Y9YA 4J01A 5ERIA 1DU6A 2XSJC 3OIPA 4H4KC 2GAUA 3W3CA 1T6SA 5D5UB 3OYFA 1U2WA 1B72A 4XKWA 1X3UA 2CV2A 3SEQA 2Q2EA 4Q4ZF 2OAZA 5K7ZA 3I0TA 1BA5A 2CYYA 1GLNA 4WX9A 4W97A 3K2AA 2X0LA 1TWAJ 3Q0UA 4OOIA 1A04A 1KQ9A 1S29A 3F8MA 1BR2A 1LVAA 4K2EA 2XKPA 1PDNC 2CQXA 3JW4A 4HZFA 3GTJJ 1VQNI 2QGUA 5FO5A 2VPLA 2YU3A 4HOBA 4RDUA 3F8BA 4YIIA 3OS1A 1ZGAA 1A31A 1YRNA 3CD6I 1XDUA 3ABMH 3PM1A 3SDGA 2K9LA 1U5TA 3BZCA 2ETHA 2JN6A 2Z16A 3IWZA 5CVJA 1B6AA 1D8KA 1MMNA 1S7EA 2WY7Q 2LBFB 1TW3A 4KMFA 1V5FA 3I55I 1ZH5A 2VKDA 3WTZA 3G6EI 2XF5A 1LNWA 3M1CA 4GRIA 3OSGA 4L9VA 1QZEA 4MQ9F 1TWCJ 2BY3A 1X3ZB 1SVOA 2KPMA 1JJ8C 3O3KA 4N9HA 3PQJA 1AOYA 4P96A 2H09A 2X6XA 4A0XA 2QA4I 2XRNA 3A03A 3FF5A 1P2FA 2KJCA 5E3MA 3MKZA 2W84A 1DGRM 2LKPA 5LD2C 2R7RA 3RPUA 5D5WB 4QIWN 3G73A 5FROA 1Z6RA 2C6YA 3CO6C 2M5WA 2DA5A 1IRGA 5EEGA 3A0HC 1H89C 2DYRH 3NAUA 2EFQA 4AIHA 2ZFWA 3BR0A 4EV0A 1A35A 5J8FA 3RKWA 4A3DJ 2R7ZJ 2R5ZB 3PO2J 2DCEA 2MH2A 3PUFA 3QPSA 2R7QA 1Y0UA 4I09A 4M6YA 5DTDA 2K02A 2FX0A 2JSCA 2O3FA 3BG3A 4OIRF 4ZTFA 5ICFA 4CXFA 2L02A 4RB3C 3GFLA 3ZQHA 2F5FA 4U0VA 4E7JA 3LFUA 2VB6A 5J1RA 2VQGA 4XNFA 3TBIA 1KU7A 1J0RA 2DMPA 2BVMA 4CCNA 1PUEE 3LA3A 4ZDLA 1RR7A 2IS4A 1JUSA 2XHKA 2PI0A 3OR2C 2K9SA 2HVQA 2R92J 2B9SA 3B02A 3VDXA 1RI7A 1XC5A 4F92B 5L3GA 2JA6J 1RESA 3ASNH 1J5YA 3VYRB 2K86A 3DWLE 2K40A 1XSVA 5AONA 4XLPF 1U9NA 5ILUA 4NC8A 2LY2A 1TNSA 1JT0A 4ZTJA 3DQVC 4I0BA 3CCLI 4GXOA 5LHGA 1YJNI 1U0JA 2YSRA 2DOEA 3MMYB 3RQ4A 1MJBA 4XLFA 4S05A 3CCUI 2H27A 5TRDA 5D8KB 3L09A 2ZXWH 3W2VA 4DW6A 4RM2A 3K70D 4XR6A 1R9TJ 1MBFA 2K4JA 4XONA 5DM6F 5E3LA 4EJTA 2GXBA 2JVHA 1IC8A 4ZDPA 1L3LA 1LE8A 1BN5A 1HBXG 2BXYA 4I2OA 4NHJA 4ESBA 4NC6A 3CCMI 1HCRA 2LKSA 2VONA 2RDPA 3S2HJ 3B6AA 2E35A 2F48A 4Q5SF 1IXSB 3WTWC 1GHCA 2GOMA 3GXOA 2CV1A 3H0GJ 2H8RA 1XX5A 5KNLA 1I3AA 3CJNA 3JRFA 3TDZC 4IQ4A 3G1MA 2NS0A 2MC3A 5CVIA 2JWTA 4YFNF 1WCMJ 5LRSA 1ZG1A 2XC7A 1S72I 1ZAOA 1VQMI 3FIWA 4MTEA 3K7AJ 3F21A 3FXQA 3MFKA 1G3TA 3VFZA 3QYBA 1IJWC 3OMYA 4GYGA 4XSZF 2DO7A 4A0YA 1DDNA 3Q5FA 2DMTA 5CVVA 5E17F 2LY9A 2DI3A 3I54A 1QNTA 3L2WA 2QUFA 3T8RA 1Y0NA 1RUNA 1VQLI 2IT0A 2FJ1A 3FM5A 3EPZA 3K0LA 2R5YA 4MIMA 4P5OA 4IOCF 2LMDA 4C3HJ 1ZARA 2Z33A 3HOUJ 3KZYA 4CCOA 4G6TB 4AIJA 1PUFA 3HYIA 3KE2A 4KICA 4NDLA 3E6CC 4LFUA 5KVRA 3ZMZA 4ZJZA 1MH4A 4BHCA 3FXJA 3CC7I 5GADJ 4ENJA 3L00A 2ZMEC 3LWFA 4F55A 3ZN0A 4AD9A 4CH7A 2JTVA 1R5GA 3FMQA 5JI6A 3BDDA 1ULYA 3JSPA 3CUQC 2IGOA 1X1BA 4V2FA 5JHFA 2E7XA 4XICA 3SJMA 4D0PA 3CZ6A 4NB5A 2OQRA 3MWMA 5IOZA 3GZNB 4G9YA 1DPRA 1X58A 4M72A 3FMSA 5EF6A 2E60A 1B9NA 3E6BA 1W0TA 3C1DA 1FP2A 3A01B 2EK5A 4R8HA 5J8CA 5GPAA 1I50J 5DD8A 1ZG5A 2P81A 3H3UA 4AUXA 1SMYF 4S0HB 2BEOA 4FASD 3IL2A 2OCCH 3U9GA 5FLXZ 3GTOJ 1OFCX 2VJ5A 3SXYA 3DEUA 2EV6A 4BQAA 4LLGF 3GFIA 2A6EF 1AHDP 2KLOA 4GYIA 1GXQA 1Q1HA 1JKPC 4V19K 1UELB 2W7NA 1EF4A 5FD6A 1AU7A 1ITYA 2DA1A 5B1AH 4YG2F 2EH3A 3JRBA 5FLMJ 2EIMH 3AG3H 1E2XA 1OYIA 2DDBA 4Y4RA 2JMWA 4WXDA 1R1UA 1YG2A 2M0CA 5K5QA 2AXLA 1JT6A 3KP4A 2LP0A 3I53A 3PUBA 5L3BA 2DMNA 1K78B 3E6MA 4E7KA 1OYYA 3TMOA 3CMEI 4XN0A 3J7ZI 2IA2A 5IT3A 3FXUA 4A3LJ 2A69F 2VI6A 4G8XA 2KFDA 2R7FA 1X3WB 2JRMA 2HPMA 2L5QA 3LNQA 2D45A 1P4WA 1IUFA 4DOZA 2XIGA 5FKLA 2HGCA 1PVEA 1W5TA 1VQPI 1TLHB 1TQMA 4F91B 2XAFA 2VUMJ 3RYPA 2MH9A 3S2WA 4LGWA 5IYDJ 5BS6A 3JTGA 1SD6A 2EV0A 4MFDA 2H6CA 4H0EA 2VC1A 1OCRH 4UB8C 3HRMA 1DP3A 3J7AO 4Y7NJ 1B4AA 3HUGB 2MA3A 1W0UA 4HYEA 1MIJA 2CUZA 2RN7A 3GEZA 3ZMSA 3OYEA 2ID3A 4XLEA 2L54A 1G3WA 3EUHC 4JQFA 4DYCA 3VYTB 2V1UA 3K4LA 3HC7A 2DFFA 5FKKA 3GZ6A 3FISA 3GTGJ 5CQEA 1WZ2A 3DEWA 2YU9J 3TW7A 4HDVA 1SD4A 5CKTA 1Z0XA 2ADUA 1ZKGA 4LLLA 4F3QA 1QU3A 1MMDA 3TP0A 5B1BH 3J81K 3KEQA 1ZYRF 1FBQA 2K5CA 5E79C 1QZZA 2CQ7A 2O7OA 1WH5A 2EFWA 5E1WA 4MEYF 4FE7A 2QQAA 1TW2A 3VEPA 3L1PA 3OYNA 1I6HJ 3S1QJ 1R6RA 4QTRA 2K3PA 2BBYA 3DBLB 5IP6A 4V2GA 2KRHA 1Y1WJ 3BQYA 2VOPA 2MG4A 1G59A 1SFXA 5BOXA 2L7ZA 3OS2A 1APLC 3IRRA 3H9QA 3BZ6A 3DFGA 3BR1A 2XPUA 2BXZA 1TC3C 4P9FA 1EJ9A 4IKFA 4BJTA 4Y13A 5LEJA 4XRSA 4HEA2 4KIFA 1KGSA 1IXCA 1O7LA 2DBBA 5GTIC 4LG3A 1L0OC 1MSEC 1FEXA 2MSYA 1FYMA 2KDOA 6PAXA 4CHUA 1GXPA 2M30A 5L3FA 2FA5A 2G7UA 2YUSA 2LC2A 5HODA 4M3BA 4YRVA 2DAOA 2WBMA 1B9MA 3PFYA 1HKTA 2DK8A 3H1CA 3FKJA 1MJAA 2W82A 1R71A 2DODA 1HQCA 3EDPA 4UB6C 5HDGA 1WPKA 1FBSA 3REOA 2VQLA 5HNHA 5KK1A 1P9QC 2EILH 3SQNA 1QPIA 4CO8A 1FNNA 5M3MJ 2NNNA 1MBGA 4PSXA 1U8RA 3BZKA 4EGYA 1I27A 2KMUA 3QU3A 4EJVA 3HKZA 1SFKA 3ZMUA 1W7PA 4J19A 2TDXA 5J3LA 5IYCJ 3CCSI 2J5PA 1HSTA 2M7BA 4CYCA 4AVPA 3H3VK 1XG1A 2F4MB 4X1EA 5D4RA 5H6QA 4B3XA 2BHYA 2M4KA 2O0YA 3E5QA 4PFPA 1IO2A 4EATA 3D1NI 2QQ8A 1FLIA 1ZR4A 2GA2A 4BE1A 4DGWB 2XPWA 4G12A 2UUZA 3A1YA 2JK3A 1X4PA 2QENA 3BJ6A 1WJBA 4WXCA 2V26A 2W48A 3ZMVA 2L9SA 3OYKA 1R7JA 1KQ0A 4BUPA 4A3JJ 1SD7A 4LB5A 3CDLA 2EZIA 1R00A 3CCJI 2EFNA 1B8IB 2GWRA 2E1OA 1LEBA 1HW5A 1K7AA 2CUFA 2FBKA 4XKVA 3NWTA 4M3EA 3UKGA 1ZTRA 2A6HF 3FXRA 2XSDC 3AKZA 2NXNB 3HRTA 1AKHA 3Q9VA 2VLAA 3ZQCA 3J80K 3CCVI 3S3MA 3JRGA 4B4CA 5CYVA 2FMYA 1JXSA 1QRYA 1ZN2A 3IWFA 1ZRFA 1ON1A 4M9XA 3QU6A 4A3EJ 3HDDA 3K69A 1IUYA 5FLXK 2D1HA 1BW5A 3C2BA 3OYCA 2L9VA 3GO5A 3HPHA 1RR8C 2ZJQF 1U5TB 4YIFA 1P92A 2UXXA 1YJ9I 1KYZA 2PQ8A 2QLZA 3ML6A 3JAMZ 1KZHA 3P9IA 4BHPA 4E7HA 2OD5A 2K7LA 4ENNA 3HRUA 1K83J 1MBHA 2M8GX 1K4SA 2V79A 1MMSA 2HVSA 5E1ZB 4U88A 2COMA 2L01A 2EBIA 3DKWA 3LQQA 1WWXA 1ODDA 4BXFA 5B66C 3V4GA 1QA6A 4RGXA 5HDNA 4IXAA 1LDKB 2DA3A 2F5EA 3R60A 1DP7P 3F8FA 2G0EA 2FXAA 4UV9A 4DZJA 1TWFJ 3KFWX 4E7ZA 1YX3A 2DMUA 1H9GA 2XAQA 3PL8A 2DOFA 5DS9A 4QSHA 2W85A 2I5UA 4ZYHA 2L3DA 1J75A 3I4MJ 4HX4A 5EJCA 5E8GA 1UAAA 3DCFA 4RGRA 5CQGA 3WTXC 1H0MA 3VSKA 3RZOJ 3CUOA 1LVKA 4ITVA 1WH7A 2GXAA 3FZVA 3BLYA 3BR3A 3H5AA 1JUMA 5F1RA 1XD7A 4PCQA 2LOOA 2FE3A 4FQGA 1U9OA 5IPAA 3KP2A 2FBIA 3DTIA 1WJFA 5LBQA 2OTJI 5FB2A 5ICEA 3GTQJ 4PGHA 1GV2A 1U5TC 4EM0B 2HOTA 4ZZDA 1HDDC 3FK7A 4ENKA 2M0MA 3K4NA 4OAYA 2DJIA 5ICGA 1HKSA 4KT5C 1IN5A 4IX7A 2F2EA 2VC0A 2ZMEB 2K9QA 3WHCA 3OY9A 2LREA 1EA3A 2IW5A 2QWWA 1PUFB 2DJNA 3LOCA 2BE5F 2EB7A 2IXSA 3EYYA 5K5RA 3WTSC 3QYEA 4Y17A 1LE8B 1F36A 2DLLA 5CVUA 2P5KA 4UUSB 1R4MB 2EPFA 2P5VA 3HTUA 1BM9A 2QQ9A 2O61A 1S3JA 1Z21A 4XN3A 4B1RA 3DTKA 2JUGA 3W6KB 2X9DA 1MDMB 2V6CA 4I98B 1IV8A 5D4SA 2ESHA 5IOYA 2E1NA 5DUKA 3KYCB 2Y31A 3U1KA 2YR2A 2RAEA 3CUQA 2HKXA 1BI0A 5JVGF 3IAS2 2KISA 3BTIA 2STTA 1G8XA 4MFEA 3RIRA 3DV8A 3OYGA 3AL0B 2KZVA 1O3TA 5C4XJ 2NOJB 2PEXA 1HDPA 4DZPA 3COAC 3VSLA 4BBRJ 3FMRA 2RKHA 2FNAA 3R0AA 4DNCA 4C3JJ 2UZKA 2V1DA 1BIAA 5LFAA 1YHQI 2OZUA 4Y3OA 5B5EC 4C9YA 2ZJPF 1LDDA 3KZZA 1EKEA 2EJRA 4XL9A 1FJLA 1V3FA 4IHVA 5HLHA 2KP6A 3CJRB 3D5LA 2YPRA 1R1TA 3JTHA 2V1XA 3HB9A 3BTCA 4RAGA 3RJPA 4FX4A 3ZPLA 3K2ZA 1W5SA 2XAHA 3H9GA 2LTPA 4RLQA 2E7WA 1TL8A 4DBQA 3H5NA 2YX4A 3J81Z 2H6BA 1XS9A 4L9NA 2PMZA 3P5JA 4RB0A 3TW6A 2WTEA 5F0HA 3PSIA 4A2UA 3HM5A 4NC7A 1F9NA 1LUJB 1TP4A 1UMQA 2R7DA 3U21A 3JAMK 1UG2A 3AG4H 4NUBA 3E97A 3ZQ7A 2DFEA 2LH9A 1R23A 4IEJA 2O03A 1FSEA 1R58A 3GF2A 5DEQA 2FNPA 2K85A 4JX5A 3IHUA 2COBA 4QPQA 1ZGJA 2Y48A 3HOXJ 4KFCA 3WGHA 1OLTA 2XV4S 3I4PA 5KHDA 5D8LB 2R5YB 4MHGA 3F8NA 5K1YA 5F0CA 3C2GA 1O3RA 4UVCA 3RKQA 2P6TA 5C44J 1XCVA 3X2QH 2VQHA 5FFXA 2CW0F 1SFEA 2CFXA 4PJLA 3HTSB 5E18F 1T33A 2MYSA 4UY8I 4A93J 1BJZA 2Y0SA 1YIOA 2JVGA 2Q1ZB 3K4BA 4GFBA 3P9KA 2RNGA 2DW4A 2A3SA 3KCCA 4BDZA 3G2BA 3DBHB 1FPQA 2JA8J 1YO5C 4BDYA 1SVLA 3RPUD 5A2QK 2NS8A 3I5UA 3QWLA 1CGPA 3I59A 3BCBA 4LG0A 1MGTA 3MKWB 3KZIC 3A01A 2NVQJ 2WAQA 4C2TA 1K78A 3ECOA 1MW7A 2LY1A 3OYBA 4RAZA 2NNYA 3GW2A 1OR7A 2LRDA 1NH3A 1P7IA 2ZMEA 3DBRB 4EM2A 5L3EA 4JX4A 2X6OA 3I59B 4LG0B 5BNGA 1R5HA 2ME0A 1WKMA 3ZQLA 1UB9A 1SEUA 1HW2A 5TISC 2QCOA 1UCRA 2DQLA 1R5ID 3S8PA 1Z77A 2DT6A 1W36D 3NWSA 3LSRA 1JI8A 2XGEA 4CDGA 2JQ7A 4KITB 3HHHA 1MD0A 4XOPA 3KEOA 1KU3A 5M5WJ 5ILSA 3I71A 3PO3J 3GLLA 3H92A 5J4YA 3K1PA 2M8EA 1YE9A 1KU9A 3GFJA 2LR8A 1GUUA 3WTVC 2DTRA 3SZTA 1ZRCA 1IAWA 3K1NA 2XAUA 5E3NA 1JKOC 1FY7A 2IS6A 4BBSJ 4Z6YA 2M2EA 3DP7A 2WADA 5HLIA 2CG4A 2V9PA 5FRNA 3CLQA 2WV0A 4RBOA 2KKOA 3MCZA 1KYWA 2FOKA 4E4HA 3E5XA 2X85A 4XK4A 5KAFC 2R7VA 1SVMA 2NOGA 2FEZA 2D2WA 3O8HA 3TO9A 3RI4A 2HDWA 2IGNA 3OL4A 1ETXA 3K70C 4ESFA 2MLKA 4M9ZA 3LSIA 1Q1VA 1D0YA 3SZPA 1FC3A 1MNEA 1RRJA 2PLYA 3HOYJ 2KIMA 2IGMA 5DV5A 1ENHA 4D5CA 2VXZA 3HUGA 3QQAA 4B44A 1MMGA 4BU2A 5C4JJ 2PMZN 3G71I 1DQUA 4MLOA 3CQZJ 2P5LC 2V6EA 4WXHA 1TT0A 2HI3A 4FTHA 2ZNZA 3S3OA 4MO7A 1Y8RB 3CJTB 2IEKA 3FDYA 1Z9CA 1Y6IA 4U87A 1D1CA 4ZYGA 2K9MA 3AAFA 1V4RA 2BW3A 3HJEA 3DLLF 3ABTA 4DJAA 3S1RJ 3CMAI 3W2AA 3SYTA 1WQ2A 3BROA 3WU2C 2CQKA 1QHHD 2HKOA 2MABA 3HPGA 1U8BA 3OYMA 4L0YB 1D5VA 5EGOA 1USTA 1FOKA 4RB1A 1BL0A 2WAFA 5FD5A 2HS5A 4RB2C 4PK4A 2LLKA 4XM3A 2X51A 3CTAA 4HX7A 4D9JA 2LVSA 3CLOA 3MVPA 3PNYA 3VYSB 5HS9A 3BPVA 4KDPA 3VB2A 2FD5A 3HEFA 4BE0A 3T0YA 1YW8A 1LQ1A 4HF1A 4KIGA 2ZFUA 4WK8F 1SFOJ 1VQ7I 1RUOA 3GLXA 1JHHA 2VJIA 4EGZA 1JGGA 3HOWJ 2X1EA 3OYDA 1FP1D 3LSMA 3M1EA 3QOPA 5EEAA 5DCFA 3GVAA 1V54H 3IC7A 3DLAA 3RYRA 3PNTA 4LLNA 2AHQA 2FUG2 1ERDA 3G1OA 2HPIA 3KYLA 2GLOA 2QSFX 4DYQA 2E19A 2KIQA 2X6WA 2UV1A 3NARA 3G4SI 4P1WA 5CVRA 1PYVA 3L9FA 2ZXJA 3ROUA 3SDBA 3HSFA 3K4CA 3BR6A 1B72B 1F5TA 1ZRDA 2W00A 4Q48A 1SANA 2CRGA 2ECBA 2PJRA 3ZR8X 3O2PE 4LD5A 4F93B 4XLAA 1VZ0A 1FMVA 2FMLA 3IV5A 9ANTA 2X4HA 4HX8A 2GA1A 1X1CA 2LBFA 2ZSIB 1Z1DA 3N05A 4YIRX 1NK2P 2NVTJ 1R22A 2VQCA 2EZKA 2BY0A 4N9IA 5ILVA 2BYVE 2F6CA 1YQAA 4BEHB 1JHFA 5LGTA 3HOSA 5DM7F 4HPQA 5CJ9A 3SZGA 1IN8A 4IQJA 3MZHA 1WSUA 3DKYA 2FQ4A 2RQQA 5HS8A 3PIOF 3FM3A 2XF6A 4DIQA 3LAPA 2P8TA 3M8FA 3BQZA 4KNYA 1P6RA 4DYRA 3R61A 4PJNA 3CCQI 3M4OJ 3OV8A 3OYHA 1A6IA 1ZG3A 4CA0A 2NRAC 3OOUA 3ERMA 2VBYA 2M4GA 4ZYAA 2AQEA 3H35A 3S16J 4AC0A 5EG0A 3W6JB 2VOOA 3KP3A 4M9SA 2A5WA 4XLNF 3P7NA 5BPIA 3MKYB 4IHYA 4G7OF 3SHFA 3FXKA 2L4AA 4RA2A 2NVXJ 4G6QA 5J6XA 2B7EA 4KN7X 3WHBA 3U1DA 1REPC 3LSJA 2ISYA 3SEZA 5FKOA 4JP0A 4B43A 4XKBA 3K9TA 5FKMA 4Y52J 2MC4A 4EEFG 1ZLKA 2HQRA 5M3FJ 2Q2EB 3MZ8A 3EUHA 3S2DJ 1HKQA 1ZK8A 2QKMB 2M1BA 2IPQX 1VQOI 2MW8A 2O8KA 2L2OA 3J7YJ 2P0WA 4OMYA 2OU2A 3FK6A 2EFOA 2ZXIA 4MTDA 2VKEA 1J09A 1TNTA 2E2HJ 3E7LA 3S32A 4CCJA 5JHUA 5HVQC 4ZZLA 1TBXA 5JLXA 1NK3P 2JUCA 3BPXA 1HSJA 2A5YB 2A61A 3F6VA 1OR7C 4A3IJ 1MZBA 4DBRA 2E1CA 4FETA 4ON0A 5GTHC 3TOAA 2ZCWA 1S5LC 3DXJF 2RGVA 4LB6B 2FRHA 1Z7UA 4QPOA 2WY8Q 3QYFA 3DPLC 3FHZA 3DKXA 1OMIA 1BI2A 4I7HA 1OJLA 3ZMDA 2EQRA 3EETA 1KU2A 3M8JA 4PJ0C 3IH2A
chains in the Genus database with same CATH topology
4EJUA 3NRVA 3ZMTA 5DUIA 1I1SA 2FQ3A 4EMSA 1FWZA 3NQOA 4HF2A 2GQQA 1YW7A 3C18A 1UHWA 5CLSA 3PFIA 1LJ9A 1IF1A 1FYLA 1SD5A 4MGRA 4JBAA 3EQLF 3HSEA 3BY6A 2HEOA 1OKRA 3MEXA 4P55A 5LHHA 4LMYA 2HQNA 5LGUA 3F8CA 1I1GA 2CGPA 5FFZA 2OQGA 3E5UA 4WWCA 4A12A 4UUVA 1T98A 1PP7U 4ZH4F 2FU4A 3RTRA 2IVMA 3M8EA 3IKVA 3BWGA 5D5XB 1OPCA 4HA8A 5F64A 2P4WA 3BJOA 2MLGA 3TO6A 2XKOA 3F23A 3G3ZA 4MNUA 3M9AA 2RVCA 3ULQB 3R4KA 3DPTA 3WE3A 2LSOA 2HTSA 4N0BA 5LGNA 4G6DA 3HRSA 5JR3A 2CSOA 2RNJA 5E1XA 2GIVA 3TQNA 2W25A 4YFXF 1CF7A 1SMTA 4I02A 2HOEA 4B09A 2P7VB 2ZKZA 4EVIA 3NEUA 3V8KA 4MQVA 1B1BA 2B0LA 4IRIA 1J2XA 4FT8A 2MBFA 2EA4A 1YS7A 2Z99A 3GUDA 2F5CA 1XDSA 1U78A 3WU1B 1J7KA 2Y75A 4UXNA 3J80Z 4EJOA 1W7PB 4CICA 3TOBA 1MKMA 1YW9A 3BOQA 5BQTA 1RZ4A 3VODA 2HR3A 2XVCA 4XBFA 5EEHA 1G6NA 3KP7A 1G4DA 4O3MA 4IF4A 3FWEA 3MAJA 3T5XA 4ENMA 2O6GE 2P6SA 4HF0A 2OBPA 2PG4A 1D8JA 1Z05A 5LHIA 2XUBA 2KJBA 5DCMB 4O5VA 1BI1A 2QVOA 4HQMA 4L0ZB 3D0SA 1FX7A 4A6EA 3TGNA 4UVBA 5HS7A 1TQIA 4UNOA 2CO5A 1KA8A 5TJJA 2QQBA 3F3XA 1P4XA 2ELHA 3FX3A 3WG9A 1NHAA 4G7ZF 1W7PD 3WGGA 2PMHA 3LA2A 2PN6A 3V7RA 1XGMA 2JRTA 4BH9A 3ISPA 1UHMA 2DQRA 5HDKA 3GX4X 2K4BA 3ECHA 2PMUA 3ERED 4FHTA 1O7FA 1FBUA 4UVAA 1DPUA 3N4MA 4YFKF 2HYFA 5FGMA 1T39A 2HTJA 3I58A 1SFUA 3GWZA 2VN2A 1EH7A 4RGUA 5HLGA 4PZJA 5E20A 1QQIA 4IPAA 1IN6A 1R36A 5HOOA 1AWCA 2JZYA 1BC7C 4UHTA 2Y0MA 4KIBA 3QPHA 5IT9K 2G9WA 3R0JA 3BJAA 2QBYB 2EA2A 4OIQF 2M87A 2ZBKA 4HV6A 1TTYA 4TV7A 3KP5A 2EV5A 2BV6A 1XMAA 2IA1A 4IVNA 5DYMA 2J5OA 3N97A 3LA7A 4S04A 2K27A 4BYYA 4L5IA 1D3YA 1S8NA 1STZA 4B8XA 5A2QZ 1LEAA 2NYXA 4KA4A 3CO7C 2LNBA 4ZYEA 1EH8A 2WWYA 2IA0A 2OZ6A 2L4MA 4AIKA 2NAZA 1BJAA 1YS6A 2ESNA 2QYOA 1QBJA 4OMZA 4JK1X 3RDIA 3DF8A 5DD4A 4E70A 1F1ZA 1CF7B 5D6EA 5DDGA 1QZYA 3QAHA 2OA4A 2YX7A 1BBYA 3MZYA 1ON2A 4G94A 4CYDA 4IRHA 4U0WA 2V9VA 1G3SA 5D5VB 2HZTA 1WI9A 4HW0A 2XROA 4BNCA 4A0ZA 1YTYA 3EYIA 2GZWA 3KP6A 2STWA 1XMKA 2PBIA 2JT1A 4IHSA 2BGCA 1LB2A 5H6RA 1TQPA 1MJ9A 2PFBA 1MDMA 1PP8F 3C7JA 2XASA 3R6SA 4L5JA 2KIFA 4XRFA 2Q0OA 1O3QA 1J59A 2DU9A 1IN7A 4OIOF 4EM1A 3E3VA 1ZLJA 1WRJA 2O8XA 4RGSA 4XSXF 3GZ5A 3GFMA 3QP5A 2M45A 1ZHFA 4HAMA 2VBXA 1S7OA 4PGGA 4CGZA 1I6XA 1XB4A 2R3SA 1YLFA 2H94A 4Z2YA 1XSXA 4HLYA 4M74A 1EV7A 2DPDA 4QWQA 1IXRC 1QPMA 1GVJA 4HV5A 1RIOH 3WE2A 2EWNA 4Y15A 4I0AA 1I5ZA 3LQRA 2ISZA 2UXNA 2ZNYA 4BXUA 2RV8A 2Z9OA 1BOAA 2XGXA 5LRRA 1JGSA 4Q47A 1H9TA 4AWXB 1FYKA 2RC4A 4WF2A 3P9CA 4M6XA 1B59A 2GXGA 5F6FA 2LF8A 4KYWA 3WTYC 1JE8A 2HDCA 5H20A 1HXDA 2DPUA 4L18B 2LF7A 2AS5F 4KMUX 4MEXF 2D1VA 1U3EM 4GCVA 1BC8C 1QO0D 1HW1A 3RKYA 1T38A 2PJPA 4KN4X 1E17A 1S7AA 3F6OA 3C3WA 4IHTA 4HBLA 3T1BA 1Z6TA 5ICCA 4R79A 2VE8A 1YFHA 1ZREA 2LDUA 2Q8KA 3TO7A 4EJWA 5ED4A 2ACJA 3V8JA 1KQ8A 3TDUC 4ETSA 4QLCU 1XN7A 4L9TA 5LEKA 2HFHA 4I01A 3SFZA 2MD5A 2VT3A 1XSDA 2G7HA 1ONVA 3F72A 4OU0A 1IZ1A 3KETA 2W24A 3H3ZA 2FBHA 4KUMA 1EH6A 2F5DA 1BI3A 4O6JA 1O3SA 4EQQA 5JFRA 4F7ZA 4U0YA 2JPBA 3F22A 4CZZA 5L3DA 4A5MA 2QM3A 3U2RA 3CUQB 3K1MA 2A07F 3B73A 3HOTA 3WTTC 1SAXA 3QRFF 4ZYDA 4HLXA 4HQEA 3HHGA 4OIPF 3V8LA 4HDUA 3QPTA 1C0WA 1IN4A 2IP2A 3IKTA 2ZJ2A 3WTUC 3M7GA 4R1HA 1DUXC 4UV8A 2VT2A 1OYWA 3CDHA 4BAYA 3LAJA 2HWVA 1K79A 4A5NA 3V7SA 4IJAA 3I64A 2IRFG 3T8TA 5AIQA 5BPDA 3V7CA 3Q9SA 1XCBA 3GYHX 1VTNC 2XAGA 2VE9A 4G7HF 3QP6A 4U7BA 1T2KA 5D6FA 4LK1F 1W4MA 3MQ0A 4M73A 5BMZA 1LDJA 4A6DA 2HYGD 3ZP5A 2KIUA 1K6OA 1USSA 1J9IA 2XAJA 3HIFA 2DFIA 3E6DA 5E8IA 2KRFA 4U7DA 2QZ8A 4BHBA 2P7CB 3OOPA 4ESJA 3RPQA 2A68F 5JVTA 3ELKA 4RS8A 4IRGA 3WODF 1RNLA 5IT9Z 1XGNA 3TKYA 2WC2A 3ABUA 1Z91A 2UWMA 3L7WA 2ZO4A 3KLOA 1R1VA 5AIPA 1S6LA 3IRQA 4OINF 1IRFA 4ASNA 5K5OA 1FT9A 2W57A 1IW7F 4NQWA 1P4AA 1F4KA 1YYVA 2VBZA 2DK5A 2QBYA 3JSOA 3PQKA 1G3YA 3KLNA 1QGPA 2Z5UA 2VBWA 4LK0F 3VOEA 2EFPA 5L3CA 4GO1A 2FF4A 2IJLA 3HSRA 4GGGA 4LJZF 1FSHA 2Z3YA 3L2CA 2VODA 4FX0A 2DT5A 4M71A 3WU0A 4PDKA 3WGIA 4WCGA 2JPCA 5DCMA 2FSWA 1UFMA 3ZN1A 4P9UA 4DQ2A 1U6GA 1XGOA 1FZPB 1BIBA 3LFKA 2CWEA 3LSTA 1XGSA 2RQPA 1T0FA 4L9JA 3RKXA 3BP8A 3O6BB 1O57A 5LLQA 5ERIA 2GAUA 1T6SA 5D5UB 1U2WA 1X3UA 2Q2EA 4Q4ZF 2OAZA 3I0TA 2CYYA 4WX9A 2X0LA 4OOIA 1A04A 1KQ9A 1S29A 3F8MA 1LVAA 4K2EA 2XKPA 1PDNC 3JW4A 4HZFA 5FO5A 2YU3A 4HOBA 3F8BA 4YIIA 1ZGAA 1XDUA 1U5TA 2ETHA 5CVJA 3IWZA 1B6AA 1D8KA 1TW3A 4KMFA 1ZH5A 3WTZA 1LNWA 4L9VA 4MQ9F 3O3KA 4N9HA 3PQJA 1AOYA 4P96A 2H09A 4A0XA 2XRNA 3FF5A 1P2FA 2KJCA 2W84A 2LKPA 3RPUA 5D5WB 3G73A 1Z6RA 2C6YA 3CO6C 2M5WA 1IRGA 5EEGA 2EFQA 4AIHA 2ZFWA 4EV0A 5J8FA 3RKWA 2MH2A 1Y0UA 4I09A 4M6YA 2K02A 2JSCA 2O3FA 4OIRF 4CXFA 5ICFA 2L02A 4RB3C 3GFLA 2F5FA 4U0VA 1KU7A 1J0RA 1PUEE 3LA3A 2XHKA 2PI0A 3B02A 1RI7A 5L3GA 1J5YA 2K86A 1XSVA 5AONA 4XLPF 5ILUA 1TNSA 3DQVC 4I0BA 4GXOA 5LHGA 2YSRA 2H27A 1MJBA 4S05A 5TRDA 5D8KB 3L09A 2K4JA 4EJTA 2GXBA 1L3LA 1BN5A 1HBXG 4I2OA 4NHJA 4ESBA 2VONA 2RDPA 4Q5SF 1IXSB 3WTWC 1GHCA 3GXOA 3CJNA 3TDZC 5CVIA 2NS0A 2MC3A 4YFNF 5LRSA 1ZG1A 1ZAOA 4MTEA 3F21A 3FXQA 3MFKA 1G3TA 3VFZA 4GYGA 4XSZF 2DO7A 4A0YA 1DDNA 3Q5FA 5CVVA 5E17F 2DI3A 3I54A 1QNTA 2QUFA 3T8RA 1RUNA 2IT0A 3FM5A 3K0LA 4P5OA 1ZARA 2Z33A 3KZYA 4AIJA 3HYIA 3KE2A 4KICA 3E6CC 4LFUA 5KVRA 3ZMZA 4BHCA 4ENJA 3L00A 3LWFA 3ZN0A 4AD9A 2JTVA 1R5GA 3FMQA 5JI6A 3BDDA 1ULYA 3JSPA 3CUQC 2E7XA 4D0PA 4NB5A 2OQRA 3MWMA 4G9YA 1DPRA 4M72A 3FMSA 1B9NA 3E6BA 3C1DA 1FP2A 2EK5A 4R8HA 5J8CA 5DD8A 1ZG5A 3H3UA 1SMYF 2BEOA 3IL2A 5FLXZ 3U9GA 3SXYA 3DEUA 2EV6A 4BQAA 4LLGF 3GFIA 2A6EF 4GYIA 1GXQA 1Q1HA 5FD6A 4YG2F 1E2XA 1OYIA 4WXDA 1R1UA 1YG2A 5K5QA 2AXLA 3KP4A 3I53A 5L3BA 1K78B 3E6MA 1OYYA 2IA2A 5IT3A 3FXUA 2A69F 4G8XA 2R7FA 2D45A 1P4WA 2XIGA 2HGCA 1W5TA 1TLHB 1TQMA 2XAFA 3RYPA 2MH9A 3S2WA 4LGWA 5BS6A 3JTGA 1SD6A 2EV0A 2H6CA 4H0EA 2VC1A 3HRMA 3J7AO 1B4AA 2MA3A 4HYEA 3GEZA 2RN7A 3ZMSA 2L54A 1G3WA 4JQFA 2V1UA 3GZ6A 4HDVA 1SD4A 2ADUA 4LLLA 3J81K 3KEQA 1ZYRF 1FBQA 1QZZA 2EFWA 5E1WA 4MEYF 2QQAA 1TW2A 3VEPA 2BBYA 2VOPA 1SFXA 5BOXA 3IRRA 3BZ6A 3DFGA 4P9FA 4Y13A 5LEJA 4KIFA 1KGSA 1IXCA 1O7LA 2DBBA 1L0OC 1FYMA 6PAXA 4CHUA 1GXPA 2M30A 5L3FA 2FA5A 2G7UA 2DAOA 1B9MA 1HKTA 2DK8A 1MJAA 1HQCA 3EDPA 5HDGA 1FBSA 3REOA 5KK1A 3SQNA 4CO8A 1FNNA 2NNNA 1U8RA 4EGYA 1I27A 3QU3A 4EJVA 3ZMUA 1W7PA 2TDXA 2J5PA 1HSTA 4AVPA 5D4RA 5H6QA 2O0YA 3E5QA 1FLIA 2GA2A 2QENA 3BJ6A 4WXCA 3ZMVA 1R7JA 1KQ0A 1SD7A 4LB5A 1R00A 2EFNA 2GWRA 1LEBA 1HW5A 1K7AA 2FBKA 2A6HF 3FXRA 3HRTA 3Q9VA 3J80K 5CYVA 2FMYA 1JXSA 1ZN2A 3IWFA 1ZRFA 1ON1A 4M9XA 3QU6A 3K69A 1IUYA 5FLXK 2D1HA 3GO5A 1U5TB 4YIFA 1P92A 2UXXA 1KYZA 2PQ8A 2QLZA 3ML6A 3JAMZ 3P9IA 4BHPA 2OD5A 2K7LA 4ENNA 3HRUA 2V79A 5E1ZB 4U88A 2COMA 2L01A 3DKWA 3LQQA 1WWXA 1ODDA 3V4GA 4RGXA 5HDNA 4IXAA 1LDKB 2F5EA 3R60A 1DP7P 3F8FA 2FXAA 4UV9A 3KFWX 1H9GA 2XAQA 2W85A 4ZYHA 1J75A 2L3DA 4HX4A 5E8GA 4RGRA 3WTXC 1H0MA 3CUOA 3FZVA 5F1RA 1XD7A 4PCQA 2FE3A 3KP2A 2FBIA 5LBQA 5FB2A 5ICEA 4PGHA 1U5TC 4EM0B 4ZZDA 4ENKA 5ICGA 1HKSA 4KT5C 1IN5A 2F2EA 2VC0A 2ZMEB 2QWWA 2IW5A 2BE5F 2EB7A 3EYYA 5K5RA 3WTSC 4Y17A 2DLLA 5CVUA 2P5KA 2P5VA 3HTUA 1BM9A 2QQ9A 2O61A 1S3JA 3W6KB 1MDMB 2V6CA 4I98B 5D4SA 2ESHA 2E1NA 5DUKA 2YR2A 3CUQA 2HKXA 1BI0A 2STTA 3RIRA 3DV8A 1O3TA 2PEXA 3COAC 3FMRA 2RKHA 2FNAA 3R0AA 4DNCA 2UZKA 2V1DA 1BIAA 2OZUA 1LDDA 3KZZA 2EJRA 1V3FA 5HLHA 3D5LA 2YPRA 1R1TA 3JTHA 2V1XA 3RJPA 4FX4A 3ZPLA 3K2ZA 1W5SA 2XAHA 2E7WA 2YX4A 3J81Z 2H6BA 4L9NA 4RB0A 2WTEA 4A2UA 1F9NA 2R7DA 3JAMK 3E97A 3ZQ7A 1R23A 2O03A 1FSEA 1R58A 3GF2A 5DEQA 2FNPA 3IHUA 1ZGJA 2Y48A 4KFCA 3WGHA 2XV4S 3I4PA 5D8LB 4MHGA 3F8NA 5K1YA 1O3RA 4UVCA 2P6TA 1XCVA 5FFXA 2CW0F 1SFEA 2CFXA 3HTSB 5E18F 1YIOA 3P9KA 2DW4A 2A3SA 3KCCA 1FPQA 1YO5C 5A2QK 3I5UA 1CGPA 3I59A 4LG0A 1MGTA 1K78A 3ECOA 2NNYA 4RAZA 3GW2A 1OR7A 2ZMEA 4EM2A 5L3EA 3I59B 4LG0B 1R5HA 1WKMA 1UB9A 1HW2A 1UCRA 2DQLA 4CDGA 3HHHA 1MD0A 3KEOA 1KU3A 5ILSA 3I71A 3H92A 3K1PA 2M8EA 1KU9A 3GFJA 3WTVC 2DTRA 3SZTA 1ZRCA 1IAWA 3K1NA 1FY7A 3DP7A 5HLIA 2CG4A 2WV0A 2KKOA 3MCZA 1KYWA 2FOKA 3E5XA 2FEZA 2D2WA 3TO9A 3RI4A 4ESFA 2MLKA 4M9ZA 3SZPA 1FC3A 2PLYA 2KIMA 5DV5A 2VXZA 3HUGA 2P5LC 4WXHA 2ZNZA 1Z9CA 4ZYGA 3AAFA 1V4RA 3ABTA 1WQ2A 3BROA 2CQKA 2HKOA 4L0YB 1D5VA 1USTA 1FOKA 4RB1A 5FD5A 2HS5A 4RB2C 3CTAA 4HX7A 3CLOA 5HS9A 3BPVA 4KDPA 3VB2A 3T0YA 1YW8A 1LQ1A 4HF1A 4KIGA 4WK8F 1RUOA 3GLXA 1JHHA 4EGZA 1FP1D 3M1EA 3QOPA 5DCFA 3GVAA 3IC7A 3RYRA 4LLNA 5CVRA 3L9FA 2ZXJA 3ROUA 3HSFA 1F5TA 1ZRDA 4Q48A 3O2PE 4LD5A 2FMLA 2X4HA 4HX8A 2GA1A 1Z1DA 1R22A 4N9IA 5ILVA 2BYVE 1YQAA 1JHFA 5LGTA 3HOSA 5CJ9A 1IN8A 3MZHA 1WSUA 5HS8A 3FM3A 3LAPA 4KNYA 2P8TA 3M8FA 1P6RA 3R61A 3OV8A 1ZG3A 2NRAC 2VBYA 3W6JB 2VOOA 3KP3A 4M9SA 4XLNF 3P7NA 5BPIA 4G7OF 3SHFA 2L4AA 4G6QA 5J6XA 4KN7X 1REPC 3U1DA 2ISYA 3K9TA 1ZLKA 2HQRA 3EUHA 1HKQA 2M1BA 2IPQX 4OMYA 2OU2A 2EFOA 4MTDA 1TNTA 5JHUA 5HVQC 4ZZLA 1TBXA 1HSJA 3BPXA 2A5YB 2A61A 3F6VA 1MZBA 2E1CA 4ON0A 3TOAA 2ZCWA 3DXJF 2RGVA 4LB6B 2FRHA 1Z7UA 1KU2A 3DPLC 3FHZA 1OMIA 1BI2A 4I7HA 3ZMDA 3EETA 4RAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EJU A;  3NRV A;  3ZMT A;  5DUI A;  1I1S A;  2FQ3 A;  4EMS A;  1FWZ A;  3NQO A;  4HF2 A;  2GQQ A;  1YW7 A;  3C18 A;  1UHW A;  5CLS A;  3PFI A;  1LJ9 A;  1IF1 A;  1FYL A;  1SD5 A;  4MGR A;  4JBA A;  3EQL F;  3HSE A;  3BY6 A;  2HEO A;  1OKR A;  3MEX A;  4P55 A;  5LHH A;  4LMY A;  2HQN A;  5LGU A;  3F8C A;  1I1G A;  2CGP A;  5FFZ A;  2OQG A;  3E5U A;  4WWC A;  4A12 A;  4UUV A;  1T98 A;  1PP7 U;  4ZH4 F;  2FU4 A;  3RTR A;  2IVM A;  3M8E A;  3IKV A;  3BWG A;  5D5X B;  1OPC A;  4HA8 A;  5F64 A;  2P4W A;  3BJO A;  2MLG A;  3TO6 A;  2XKO A;  3F23 A;  3G3Z A;  4MNU A;  3M9A A;  2RVC A;  3ULQ B;  3R4K A;  3DPT A;  3WE3 A;  2LSO A;  2HTS A;  4N0B A;  5LGN A;  4G6D A;  3HRS A;  5JR3 A;  2CSO A;  2RNJ A;  5E1X A;  2GIV A;  3TQN A;  2W25 A;  4YFX F;  1CF7 A;  1SMT A;  4I02 A;  2HOE A;  4B09 A;  2P7V B;  2ZKZ A;  4EVI A;  3NEU A;  3V8K A;  4MQV A;  1B1B A;  2B0L A;  4IRI A;  1J2X A;  4FT8 A;  2MBF A;  2EA4 A;  1YS7 A;  2Z99 A;  3GUD A;  2F5C A;  1XDS A;  1U78 A;  3WU1 B;  1J7K A;  2Y75 A;  4UXN A;  3J80 Z;  4EJO A;  1W7P B;  4CIC A;  3TOB A;  1MKM A;  1YW9 A;  3BOQ A;  5BQT A;  1RZ4 A;  3VOD A;  2HR3 A;  2XVC A;  4XBF A;  5EEH A;  1G6N A;  3KP7 A;  1G4D A;  4O3M A;  4IF4 A;  3FWE A;  3MAJ A;  3T5X A;  4ENM A;  2O6G E;  2P6S A;  4HF0 A;  2OBP A;  2PG4 A;  1D8J A;  1Z05 A;  5LHI A;  2XUB A;  2KJB A;  5DCM B;  4O5V A;  1BI1 A;  2QVO A;  4HQM A;  4L0Z B;  3D0S A;  1FX7 A;  4A6E A;  3TGN A;  4UVB A;  5HS7 A;  1TQI A;  4UNO A;  2CO5 A;  1KA8 A;  5TJJ A;  2QQB A;  3F3X A;  1P4X A;  2ELH A;  3FX3 A;  3WG9 A;  1NHA A;  4G7Z F;  1W7P D;  3WGG A;  2PMH A;  3LA2 A;  2PN6 A;  3V7R A;  1XGM A;  2JRT A;  4BH9 A;  3ISP A;  1UHM A;  2DQR A;  5HDK A;  3GX4 X;  2K4B A;  3ECH A;  2PMU A;  3ERE D;  4FHT A;  1O7F A;  1FBU A;  4UVA A;  1DPU A;  3N4M A;  4YFK F;  2HYF A;  5FGM A;  1T39 A;  2HTJ A;  3I58 A;  1SFU A;  3GWZ A;  2VN2 A;  1EH7 A;  4RGU A;  5HLG A;  4PZJ A;  5E20 A;  1QQI A;  4IPA A;  1IN6 A;  1R36 A;  5HOO A;  1AWC A;  2JZY A;  1BC7 C;  4UHT A;  2Y0M A;  4KIB A;  3QPH A;  5IT9 K;  2G9W A;  3R0J A;  3BJA A;  2QBY B;  2EA2 A;  4OIQ F;  2M87 A;  2ZBK A;  4HV6 A;  1TTY A;  4TV7 A;  3KP5 A;  2EV5 A;  2BV6 A;  1XMA A;  2IA1 A;  4IVN A;  5DYM A;  2J5O A;  3N97 A;  3LA7 A;  4S04 A;  2K27 A;  4BYY A;  4L5I A;  1D3Y A;  1S8N A;  1STZ A;  4B8X A;  5A2Q Z;  1LEA A;  2NYX A;  4KA4 A;  3CO7 C;  2LNB A;  4ZYE A;  1EH8 A;  2WWY A;  2IA0 A;  2OZ6 A;  2L4M A;  4AIK A;  2NAZ A;  1BJA A;  1YS6 A;  2ESN A;  2QYO A;  1QBJ A;  4OMZ A;  4JK1 X;  3RDI A;  3DF8 A;  5DD4 A;  4E70 A;  1F1Z A;  1CF7 B;  5D6E A;  5DDG A;  1QZY A;  3QAH A;  2OA4 A;  2YX7 A;  1BBY A;  3MZY A;  1ON2 A;  4G94 A;  4CYD A;  4IRH A;  4U0W A;  2V9V A;  1G3S A;  5D5V B;  2HZT A;  1WI9 A;  4HW0 A;  2XRO A;  4BNC A;  4A0Z A;  1YTY A;  3EYI A;  2GZW A;  3KP6 A;  2STW A;  1XMK A;  2PBI A;  2JT1 A;  4IHS A;  2BGC A;  1LB2 A;  5H6R A;  1TQP A;  1MJ9 A;  2PFB A;  1MDM A;  1PP8 F;  3C7J A;  2XAS A;  3R6S A;  4L5J A;  2KIF A;  4XRF A;  2Q0O A;  1O3Q A;  1J59 A;  2DU9 A;  1IN7 A;  4OIO F;  4EM1 A;  3E3V A;  1ZLJ A;  1WRJ A;  2O8X A;  4RGS A;  4XSX F;  3GZ5 A;  3GFM A;  3QP5 A;  2M45 A;  1ZHF A;  4HAM A;  2VBX A;  1S7O A;  4PGG A;  4CGZ A;  1I6X A;  1XB4 A;  2R3S A;  1YLF A;  2H94 A;  4Z2Y A;  1XSX A;  4HLY A;  4M74 A;  1EV7 A;  2DPD A;  4QWQ A;  1IXR C;  1QPM A;  1GVJ A;  4HV5 A;  1RIO H;  3WE2 A;  2EWN A;  4Y15 A;  4I0A A;  1I5Z A;  3LQR A;  2ISZ A;  2UXN A;  2ZNY A;  4BXU A;  2RV8 A;  2Z9O A;  1BOA A;  2XGX A;  5LRR A;  1JGS A;  4Q47 A;  1H9T A;  4AWX B;  1FYK A;  2RC4 A;  4WF2 A;  3P9C A;  4M6X A;  1B59 A;  2GXG A;  5F6F A;  2LF8 A;  4KYW A;  3WTY C;  1JE8 A;  2HDC A;  5H20 A;  1HXD A;  2DPU A;  4L18 B;  2LF7 A;  2AS5 F;  4KMU X;  4MEX F;  2D1V A;  1U3E M;  4GCV A;  1BC8 C;  1QO0 D;  1HW1 A;  3RKY A;  1T38 A;  2PJP A;  4KN4 X;  1E17 A;  1S7A A;  3F6O A;  3C3W A;  4IHT A;  4HBL A;  3T1B A;  1Z6T A;  5ICC A;  4R79 A;  2VE8 A;  1YFH A;  1ZRE A;  2LDU A;  2Q8K A;  3TO7 A;  4EJW A;  5ED4 A;  2ACJ A;  3V8J A;  1KQ8 A;  3TDU C;  4ETS A;  4QLC U;  1XN7 A;  4L9T A;  5LEK A;  2HFH A;  4I01 A;  3SFZ A;  2MD5 A;  2VT3 A;  1XSD A;  2G7H A;  1ONV A;  3F72 A;  4OU0 A;  1IZ1 A;  3KET A;  2W24 A;  3H3Z A;  2FBH A;  4KUM A;  1EH6 A;  2F5D A;  1BI3 A;  4O6J A;  1O3S A;  4EQQ A;  5JFR A;  4F7Z A;  4U0Y A;  2JPB A;  3F22 A;  4CZZ A;  5L3D A;  4A5M A;  2QM3 A;  3U2R A;  3CUQ B;  3K1M A;  2A07 F;  3B73 A;  3HOT A;  3WTT C;  1SAX A;  3QRF F;  4ZYD A;  4HLX A;  4HQE A;  3HHG A;  4OIP F;  3V8L A;  4HDU A;  3QPT A;  1C0W A;  1IN4 A;  2IP2 A;  3IKT A;  2ZJ2 A;  3WTU C;  3M7G A;  4R1H A;  1DUX C;  4UV8 A;  2VT2 A;  1OYW A;  3CDH A;  4BAY A;  3LAJ A;  2HWV A;  1K79 A;  4A5N A;  3V7S A;  4IJA A;  3I64 A;  2IRF G;  3T8T A;  5AIQ A;  5BPD A;  3V7C A;  3Q9S A;  1XCB A;  3GYH X;  1VTN C;  2XAG A;  2VE9 A;  4G7H F;  3QP6 A;  4U7B A;  1T2K A;  5D6F A;  4LK1 F;  1W4M A;  3MQ0 A;  4M73 A;  5BMZ A;  1LDJ A;  4A6D A;  2HYG D;  3ZP5 A;  2KIU A;  1K6O A;  1USS A;  1J9I A;  2XAJ A;  3HIF A;  2DFI A;  3E6D A;  5E8I A;  2KRF A;  4U7D A;  2QZ8 A;  4BHB A;  2P7C B;  3OOP A;  4ESJ A;  3RPQ A;  2A68 F;  5JVT A;  3ELK A;  4RS8 A;  4IRG A;  3WOD F;  1RNL A;  5IT9 Z;  1XGN A;  3TKY A;  2WC2 A;  3ABU A;  1Z91 A;  2UWM A;  3L7W A;  2ZO4 A;  3KLO A;  1R1V A;  5AIP A;  1S6L A;  3IRQ A;  4OIN F;  1IRF A;  4ASN A;  5K5O A;  1FT9 A;  2W57 A;  1IW7 F;  4NQW A;  1P4A A;  1F4K A;  1YYV A;  2VBZ A;  2DK5 A;  2QBY A;  3JSO A;  3PQK A;  1G3Y A;  3KLN A;  1QGP A;  2Z5U A;  2VBW A;  4LK0 F;  3VOE A;  2EFP A;  5L3C A;  4GO1 A;  2FF4 A;  2IJL A;  3HSR A;  4GGG A;  4LJZ F;  1FSH A;  2Z3Y A;  3L2C A;  2VOD A;  4FX0 A;  2DT5 A;  4M71 A;  3WU0 A;  4PDK A;  3WGI A;  4WCG A;  2JPC A;  5DCM A;  2FSW A;  1UFM A;  3ZN1 A;  4P9U A;  4DQ2 A;  1U6G A;  1XGO A;  1FZP B;  1BIB A;  3LFK A;  2CWE A;  3LST A;  1XGS A;  2RQP A;  1T0F A;  4L9J A;  3RKX A;  3BP8 A;  3O6B B;  1O57 A;  5LLQ A;  5ERI A;  2GAU A;  1T6S A;  5D5U B;  1U2W A;  1X3U A;  2Q2E A;  4Q4Z F;  2OAZ A;  3I0T A;  2CYY A;  4WX9 A;  2X0L A;  4OOI A;  1A04 A;  1KQ9 A;  1S29 A;  3F8M A;  1LVA A;  4K2E A;  2XKP A;  1PDN C;  3JW4 A;  4HZF A;  5FO5 A;  2YU3 A;  4HOB A;  3F8B A;  4YII A;  1ZGA A;  1XDU A;  1U5T A;  2ETH A;  5CVJ A;  3IWZ A;  1B6A A;  1D8K A;  1TW3 A;  4KMF A;  1ZH5 A;  3WTZ A;  1LNW A;  4L9V A;  4MQ9 F;  3O3K A;  4N9H A;  3PQJ A;  1AOY A;  4P96 A;  2H09 A;  4A0X A;  2XRN A;  3FF5 A;  1P2F A;  2KJC A;  2W84 A;  2LKP A;  3RPU A;  5D5W B;  3G73 A;  1Z6R A;  2C6Y A;  3CO6 C;  2M5W A;  1IRG A;  5EEG A;  2EFQ A;  4AIH A;  2ZFW A;  4EV0 A;  5J8F A;  3RKW A;  2MH2 A;  1Y0U A;  4I09 A;  4M6Y A;  2K02 A;  2JSC A;  2O3F A;  4OIR F;  4CXF A;  5ICF A;  2L02 A;  4RB3 C;  3GFL A;  2F5F A;  4U0V A;  1KU7 A;  1J0R A;  1PUE E;  3LA3 A;  2XHK A;  2PI0 A;  3B02 A;  1RI7 A;  5L3G A;  1J5Y A;  2K86 A;  1XSV A;  5AON A;  4XLP F;  5ILU A;  1TNS A;  3DQV C;  4I0B A;  4GXO A;  5LHG A;  2YSR A;  2H27 A;  1MJB A;  4S05 A;  5TRD A;  5D8K B;  3L09 A;  2K4J A;  4EJT A;  2GXB A;  1L3L A;  1BN5 A;  1HBX G;  4I2O A;  4NHJ A;  4ESB A;  2VON A;  2RDP A;  4Q5S F;  1IXS B;  3WTW C;  1GHC A;  3GXO A;  3CJN A;  3TDZ C;  5CVI A;  2NS0 A;  2MC3 A;  4YFN F;  5LRS A;  1ZG1 A;  1ZAO A;  4MTE A;  3F21 A;  3FXQ A;  3MFK A;  1G3T A;  3VFZ A;  4GYG A;  4XSZ F;  2DO7 A;  4A0Y A;  1DDN A;  3Q5F A;  5CVV A;  5E17 F;  2DI3 A;  3I54 A;  1QNT A;  2QUF A;  3T8R A;  1RUN A;  2IT0 A;  3FM5 A;  3K0L A;  4P5O A;  1ZAR A;  2Z33 A;  3KZY A;  4AIJ A;  3HYI A;  3KE2 A;  4KIC A;  3E6C C;  4LFU A;  5KVR A;  3ZMZ A;  4BHC A;  4ENJ A;  3L00 A;  3LWF A;  3ZN0 A;  4AD9 A;  2JTV A;  1R5G A;  3FMQ A;  5JI6 A;  3BDD A;  1ULY A;  3JSP A;  3CUQ C;  2E7X A;  4D0P A;  4NB5 A;  2OQR A;  3MWM A;  4G9Y A;  1DPR A;  4M72 A;  3FMS A;  1B9N A;  3E6B A;  3C1D A;  1FP2 A;  2EK5 A;  4R8H A;  5J8C A;  5DD8 A;  1ZG5 A;  3H3U A;  1SMY F;  2BEO A;  3IL2 A;  5FLX Z;  3U9G A;  3SXY A;  3DEU A;  2EV6 A;  4BQA A;  4LLG F;  3GFI A;  2A6E F;  4GYI A;  1GXQ A;  1Q1H A;  5FD6 A;  4YG2 F;  1E2X A;  1OYI A;  4WXD A;  1R1U A;  1YG2 A;  5K5Q A;  2AXL A;  3KP4 A;  3I53 A;  5L3B A;  1K78 B;  3E6M A;  1OYY A;  2IA2 A;  5IT3 A;  3FXU A;  2A69 F;  4G8X A;  2R7F A;  2D45 A;  1P4W A;  2XIG A;  2HGC A;  1W5T A;  1TLH B;  1TQM A;  2XAF A;  3RYP A;  2MH9 A;  3S2W A;  4LGW A;  5BS6 A;  3JTG A;  1SD6 A;  2EV0 A;  2H6C A;  4H0E A;  2VC1 A;  3HRM A;  3J7A O;  1B4A A;  2MA3 A;  4HYE A;  3GEZ A;  2RN7 A;  3ZMS A;  2L54 A;  1G3W A;  4JQF A;  2V1U A;  3GZ6 A;  4HDV A;  1SD4 A;  2ADU A;  4LLL A;  3J81 K;  3KEQ A;  1ZYR F;  1FBQ A;  1QZZ A;  2EFW A;  5E1W A;  4MEY F;  2QQA A;  1TW2 A;  3VEP A;  2BBY A;  2VOP A;  1SFX A;  5BOX A;  3IRR A;  3BZ6 A;  3DFG A;  4P9F A;  4Y13 A;  5LEJ A;  4KIF A;  1KGS A;  1IXC A;  1O7L A;  2DBB A;  1L0O C;  1FYM A;  6PAX A;  4CHU A;  1GXP A;  2M30 A;  5L3F A;  2FA5 A;  2G7U A;  2DAO A;  1B9M A;  1HKT A;  2DK8 A;  1MJA A;  1HQC A;  3EDP A;  5HDG A;  1FBS A;  3REO A;  5KK1 A;  3SQN A;  4CO8 A;  1FNN A;  2NNN A;  1U8R A;  4EGY A;  1I27 A;  3QU3 A;  4EJV A;  3ZMU A;  1W7P A;  2TDX A;  2J5P A;  1HST A;  4AVP A;  5D4R A;  5H6Q A;  2O0Y A;  3E5Q A;  1FLI A;  2GA2 A;  2QEN A;  3BJ6 A;  4WXC A;  3ZMV A;  1R7J A;  1KQ0 A;  1SD7 A;  4LB5 A;  1R00 A;  2EFN A;  2GWR A;  1LEB A;  1HW5 A;  1K7A A;  2FBK A;  2A6H F;  3FXR A;  3HRT A;  3Q9V A;  3J80 K;  5CYV A;  2FMY A;  1JXS A;  1ZN2 A;  3IWF A;  1ZRF A;  1ON1 A;  4M9X A;  3QU6 A;  3K69 A;  1IUY A;  5FLX K;  2D1H A;  3GO5 A;  1U5T B;  4YIF A;  1P92 A;  2UXX A;  1KYZ A;  2PQ8 A;  2QLZ A;  3ML6 A;  3JAM Z;  3P9I A;  4BHP A;  2OD5 A;  2K7L A;  4ENN A;  3HRU A;  2V79 A;  5E1Z B;  4U88 A;  2COM A;  2L01 A;  3DKW A;  3LQQ A;  1WWX A;  1ODD A;  3V4G A;  4RGX A;  5HDN A;  4IXA A;  1LDK B;  2F5E A;  3R60 A;  1DP7 P;  3F8F A;  2FXA A;  4UV9 A;  3KFW X;  1H9G A;  2XAQ A;  2W85 A;  4ZYH A;  1J75 A;  2L3D A;  4HX4 A;  5E8G A;  4RGR A;  3WTX C;  1H0M A;  3CUO A;  3FZV A;  5F1R A;  1XD7 A;  4PCQ A;  2FE3 A;  3KP2 A;  2FBI A;  5LBQ A;  5FB2 A;  5ICE A;  4PGH A;  1U5T C;  4EM0 B;  4ZZD A;  4ENK A;  5ICG A;  1HKS A;  4KT5 C;  1IN5 A;  2F2E A;  2VC0 A;  2ZME B;  2QWW A;  2IW5 A;  2BE5 F;  2EB7 A;  3EYY A;  5K5R A;  3WTS C;  4Y17 A;  2DLL A;  5CVU A;  2P5K A;  2P5V A;  3HTU A;  1BM9 A;  2QQ9 A;  2O61 A;  1S3J A;  3W6K B;  1MDM B;  2V6C A;  4I98 B;  5D4S A;  2ESH A;  2E1N A;  5DUK A;  2YR2 A;  3CUQ A;  2HKX A;  1BI0 A;  2STT A;  3RIR A;  3DV8 A;  1O3T A;  2PEX A;  3COA C;  3FMR A;  2RKH A;  2FNA A;  3R0A A;  4DNC A;  2UZK A;  2V1D A;  1BIA A;  2OZU A;  1LDD A;  3KZZ A;  2EJR A;  1V3F A;  5HLH A;  3D5L A;  2YPR A;  1R1T A;  3JTH A;  2V1X A;  3RJP A;  4FX4 A;  3ZPL A;  3K2Z A;  1W5S A;  2XAH A;  2E7W A;  2YX4 A;  3J81 Z;  2H6B A;  4L9N A;  4RB0 A;  2WTE A;  4A2U A;  1F9N A;  2R7D A;  3JAM K;  3E97 A;  3ZQ7 A;  1R23 A;  2O03 A;  1FSE A;  1R58 A;  3GF2 A;  5DEQ A;  2FNP A;  3IHU A;  1ZGJ A;  2Y48 A;  4KFC A;  3WGH A;  2XV4 S;  3I4P A;  5D8L B;  4MHG A;  3F8N A;  5K1Y A;  1O3R A;  4UVC A;  2P6T A;  1XCV A;  5FFX A;  2CW0 F;  1SFE A;  2CFX A;  3HTS B;  5E18 F;  1YIO A;  3P9K A;  2DW4 A;  2A3S A;  3KCC A;  1FPQ A;  1YO5 C;  5A2Q K;  3I5U A;  1CGP A;  3I59 A;  4LG0 A;  1MGT A;  1K78 A;  3ECO A;  2NNY A;  4RAZ A;  3GW2 A;  1OR7 A;  2ZME A;  4EM2 A;  5L3E A;  3I59 B;  4LG0 B;  1R5H A;  1WKM A;  1UB9 A;  1HW2 A;  1UCR A;  2DQL A;  4CDG A;  3HHH A;  1MD0 A;  3KEO A;  1KU3 A;  5ILS A;  3I71 A;  3H92 A;  3K1P A;  2M8E A;  1KU9 A;  3GFJ A;  3WTV C;  2DTR A;  3SZT A;  1ZRC A;  1IAW A;  3K1N A;  1FY7 A;  3DP7 A;  5HLI A;  2CG4 A;  2WV0 A;  2KKO A;  3MCZ A;  1KYW A;  2FOK A;  3E5X A;  2FEZ A;  2D2W A;  3TO9 A;  3RI4 A;  4ESF A;  2MLK A;  4M9Z A;  3SZP A;  1FC3 A;  2PLY A;  2KIM A;  5DV5 A;  2VXZ A;  3HUG A;  2P5L C;  4WXH A;  2ZNZ A;  1Z9C A;  4ZYG A;  3AAF A;  1V4R A;  3ABT A;  1WQ2 A;  3BRO A;  2CQK A;  2HKO A;  4L0Y B;  1D5V A;  1UST A;  1FOK A;  4RB1 A;  5FD5 A;  2HS5 A;  4RB2 C;  3CTA A;  4HX7 A;  3CLO A;  5HS9 A;  3BPV A;  4KDP A;  3VB2 A;  3T0Y A;  1YW8 A;  1LQ1 A;  4HF1 A;  4KIG A;  4WK8 F;  1RUO A;  3GLX A;  1JHH A;  4EGZ A;  1FP1 D;  3M1E A;  3QOP A;  5DCF A;  3GVA A;  3IC7 A;  3RYR A;  4LLN A;  5CVR A;  3L9F A;  2ZXJ A;  3ROU A;  3HSF A;  1F5T A;  1ZRD A;  4Q48 A;  3O2P E;  4LD5 A;  2FML A;  2X4H A;  4HX8 A;  2GA1 A;  1Z1D A;  1R22 A;  4N9I A;  5ILV A;  2BYV E;  1YQA A;  1JHF A;  5LGT A;  3HOS A;  5CJ9 A;  1IN8 A;  3MZH A;  1WSU A;  5HS8 A;  3FM3 A;  3LAP A;  4KNY A;  2P8T A;  3M8F A;  1P6R A;  3R61 A;  3OV8 A;  1ZG3 A;  2NRA C;  2VBY A;  3W6J B;  2VOO A;  3KP3 A;  4M9S A;  4XLN F;  3P7N A;  5BPI A;  4G7O F;  3SHF A;  2L4A A;  4G6Q A;  5J6X A;  4KN7 X;  1REP C;  3U1D A;  2ISY A;  3K9T A;  1ZLK A;  2HQR A;  3EUH A;  1HKQ A;  2M1B A;  2IPQ X;  4OMY A;  2OU2 A;  2EFO A;  4MTD A;  1TNT A;  5JHU A;  5HVQ C;  4ZZL A;  1TBX A;  1HSJ A;  3BPX A;  2A5Y B;  2A61 A;  3F6V A;  1MZB A;  2E1C A;  4ON0 A;  3TOA A;  2ZCW A;  3DXJ F;  2RGV A;  4LB6 B;  2FRH A;  1Z7U A;  1KU2 A;  3DPL C;  3FHZ A;  1OMI A;  1BI2 A;  4I7H A;  3ZMD A;  3EET A;  4RAY A; 
#chains in the Genus database with same CATH topology
 4XKC A;  4C2M J;  4EJU A;  1ETQ A;  3NRV A;  3ZMT A;  5DUI A;  1I1S A;  1ETV A;  3CF5 F;  2FQ3 A;  4EMS A;  1FWZ A;  3NQO A;  2VIX A;  2CJJ A;  3CMY A;  5GAH J;  4BJ6 C;  3VYU B;  2GQQ A;  4HF2 A;  3BT9 A;  3CCY A;  3JRE A;  1YW7 A;  3C18 A;  2ICW G;  1UHW A;  4JOM A;  5CLS A;  1Y8Q B;  3PFI A;  1LJ9 A;  2IBD A;  3C2H A;  1IF1 A;  2KDZ A;  1ETW A;  1FYL A;  2LK2 A;  4NBQ A;  1SD5 A;  4MGR A;  3OYA A;  4JBA A;  3EQL F;  3HSE A;  3QPL A;  2BVL A;  2LG4 A;  3BY6 A;  2HEO A;  1OKR A;  4JX6 A;  1RKW A;  2Y0S N;  4NNJ A;  3MEX A;  4P55 A;  5LHH A;  4LMY A;  2HQN A;  3OWT A;  5LGU A;  3F8C A;  1I1G A;  2CGP A;  3I9V 2;  5FFZ A;  2OQG A;  5J47 A;  1MMA A;  3E5U A;  4E7I A;  2L9N A;  1V5G A;  5K7H A;  2Y2Z A;  2VJJ A;  5M5Y J;  3EUA A;  4WWC A;  2R7S A;  1YRN B;  2DA7 A;  4A12 A;  3I4N J;  4UUV A;  1DGW Y;  1T98 A;  1PP7 U;  2GBY A;  3BTJ A;  4ZH4 F;  3JRH A;  2FU4 A;  5FKN A;  3OIQ A;  1OIS A;  3RTR A;  2IVM A;  3M8E A;  1I39 A;  2EIK H;  3IKV A;  4OAZ A;  3BWG A;  2VKV A;  5D5X B;  2D5V A;  2R5Z A;  3JRD A;  1OPC A;  4HA8 A;  3CC2 I;  5F64 A;  2P4W A;  3BJO A;  4II2 A;  1JKR C;  2MLG A;  3TO6 A;  2XKO A;  1OCT C;  1FTT A;  3AFH A;  5EG0 B;  5J40 A;  3GBG A;  2E1M C;  3F23 A;  5GPC A;  3G3Z A;  4PFO A;  4MNU A;  3M9A A;  1K6Y A;  1IDY A;  2GM4 A;  2OF7 A;  2RVC A;  2WV1 A;  3ULQ B;  3JRC A;  4AM3 A;  2ME6 A;  5J1Y A;  4CUG A;  2HQA A;  3R4K A;  4AU7 A;  3DPT A;  2XPV A;  4A3B J;  3WE3 A;  2LSO A;  2HTS A;  2MFZ A;  3KX2 A;  4N0B A;  1BR1 A;  5FRM A;  3KIO A;  1G2H A;  5LGN A;  4G6D A;  3HRS A;  5JR3 A;  2CSO A;  2RNJ A;  5E1X A;  2GIV A;  2DFH A;  3TQN A;  2W25 A;  4YFX F;  1K61 A;  2JA5 J;  3I56 I;  1CF7 A;  1SMT A;  4I02 A;  2HOE A;  4B09 A;  2P7V B;  1X2M A;  2ZKZ A;  3MD2 A;  1HA8 A;  1MBK A;  4EVI A;  3JRI A;  3NEU A;  3V8K A;  2WB1 N;  1B1B A;  4MQV A;  1O4X A;  2B0L A;  2CS3 A;  4IRI A;  1J2X A;  4FT8 A;  1JJ6 C;  2MBF A;  1FTZ A;  2EA4 A;  2EZH A;  3H9J A;  2GIZ A;  1E3P A;  3S14 J;  5JLW A;  4HSR A;  2E2I J;  2WB1 A;  5HLT A;  1YS7 A;  2F4I A;  1Z67 A;  2R93 J;  1POG A;  3MN2 A;  3D5S C;  1AA7 A;  2Z99 A;  1FOY A;  3GUD A;  1N25 A;  2F5C A;  4IHX A;  1XDS A;  3JCU C;  2XGC A;  3M07 A;  3WU1 B;  1U78 A;  2R7W A;  3TL4 X;  5FJ8 J;  1J7K A;  1ZEL A;  2Y75 A;  4UXN A;  1RC9 A;  3FHN A;  4D5F A;  3J80 Z;  4EJO A;  1W7P B;  1WJE A;  4CIC A;  4X6A J;  1LKX A;  1IRX A;  4IL6 C;  1LFU P;  2EIN H;  4A3K J;  1X1P A;  2CH0 A;  3TOB A;  1MKM A;  1YW9 A;  3BOQ A;  5BQT A;  2ELJ A;  2OV7 A;  1ZQ3 P;  2IS2 A;  1RZ4 A;  3VOD A;  2HR3 A;  1D1A A;  2XGD A;  2XVC A;  3UR3 C;  2O9L A;  5GAG J;  2HNH A;  4XBF A;  1ACI A;  5EEH A;  1G6N A;  3KP7 A;  3AG1 H;  4C30 A;  1G4D A;  2N8G A;  4O3M A;  5H2F C;  2NS7 A;  4B47 A;  4IF4 A;  4XID A;  3FWE A;  3MAJ A;  1XTA A;  2X1C A;  3T5X A;  4ENM A;  2O6G E;  2P6S A;  4Y33 A;  1OCZ H;  4HF0 A;  2OBP A;  2PG4 A;  1D8J A;  2CV0 A;  2L7M P;  2Z1D A;  1ETO A;  1Z05 A;  1QVT A;  5LHI A;  2XUB A;  2EZL A;  2KJB A;  3ZCO A;  4M3D A;  5DCM B;  1OCP A;  1JUP A;  1BI1 A;  4O5V A;  2QVO A;  3CJQ B;  4HQM A;  4L0Z B;  3D0S A;  3L2R A;  1FX7 A;  1Y56 A;  2HYJ A;  1VND A;  2K9N A;  4A6E A;  3TGN A;  4UVB A;  5GP9 A;  1H88 C;  1A6Q A;  3JR9 A;  4BQO A;  1IV6 A;  5HS7 A;  1TQI A;  4UNO A;  3DEE A;  2CO5 A;  3BR2 A;  1KA8 A;  4J00 A;  5TJJ A;  1CQT A;  5K7F A;  2VAS A;  4X0G A;  2F4O B;  2QQB A;  3F3X A;  1P4X A;  2ELH A;  2JJ7 A;  3FX3 A;  3WG9 A;  1OQY A;  4BQQ A;  1VQK I;  3GTK J;  4KT6 A;  1NHA A;  2W1O A;  4HST A;  5KCM A;  4XRM A;  4G7Z F;  1W7P D;  1T08 B;  3WGG A;  2PMH A;  3LA2 A;  3OS0 A;  2MD0 A;  2PN6 A;  4M3F A;  3V7R A;  2WAQ N;  1XGM A;  1ETY A;  2JRT A;  4BH9 A;  4JYK A;  2VXD A;  3ISP A;  1UHM A;  2DQR A;  4XOR A;  2VPR A;  1Z7L A;  3ABL H;  5HDK A;  2I8D A;  3PJR A;  1RPW A;  5TGT A;  2HXI A;  4E6K G;  3GX4 X;  3IUO A;  3ZXS A;  2TCT A;  1LPQ A;  2K4B A;  3ECH A;  4IHW A;  2PMU A;  1WJD A;  3ERE D;  4FHT A;  1O7F A;  4NQW B;  1FBU A;  4RMN A;  4UVA A;  3HOZ J;  3S1M J;  1DPU A;  2DTZ A;  3N4M A;  3KEY A;  4RLF A;  4YFK F;  4BJ5 C;  2HYF A;  5FGM A;  1T39 A;  3CCR I;  2HTJ A;  3I58 A;  3LSK A;  1SFU A;  2VL8 A;  2NVY J;  2Y30 A;  3GWZ A;  1I3Q J;  2VN2 A;  1EH7 A;  2YS9 A;  4RGU A;  4IOA F;  2L0K A;  3Q3S A;  5HLG A;  1NG6 A;  2HQ5 A;  4PZJ A;  5E20 A;  2BY1 A;  4BGD A;  2XB5 A;  1QQI A;  4IPA A;  1IN6 A;  3BCA A;  2BOL A;  1VQ4 I;  3BR5 A;  4W1U A;  3F9K A;  1R36 A;  1TZL A;  5HOO A;  2W4S A;  1IGN A;  3HXL A;  3OYI A;  2EIJ H;  1AWC A;  2JZY A;  3CMM A;  3QOE A;  1BC7 C;  4UUT A;  1BW6 A;  4LIV A;  4UHT A;  3TED A;  2LFB A;  2Y0M A;  2B63 J;  3A02 A;  4KIB A;  3CDI A;  3QPH A;  2BHZ A;  4GDF A;  2CMP A;  3DTE A;  3FKI J;  3WG7 H;  2DT7 B;  5IT9 K;  2G9W A;  3R0J A;  2JA7 J;  3BJA A;  4FIS A;  2QBY B;  2EA2 A;  4C3I J;  3OYL A;  2L7F P;  2M87 A;  4OIQ F;  4KJZ A;  2CUE A;  2ZBK A;  2X6Y A;  1TTY A;  4HV6 A;  4TV7 A;  3LSP A;  3L2U A;  3KP5 A;  2QSH X;  2LD5 A;  2EV5 A;  2AXT C;  2BV6 A;  1XMA A;  2CUJ A;  2IA1 A;  4IVN A;  5F0F A;  5DYM A;  2F5V A;  2J5O A;  4RM3 A;  3AG2 H;  2DYS H;  4L5E A;  1TWG J;  2AO9 A;  2E36 A;  3K10 A;  3LA7 A;  4S04 A;  3N97 A;  1A36 A;  2K27 A;  4IZZ A;  4BYY A;  4L5I A;  2M7A A;  3FXM A;  3FXO A;  1D3Y A;  2XRL A;  5EYR A;  1S8N A;  1B8I A;  2X1D A;  2ECC A;  2R7U A;  1IRZ A;  1STZ A;  4E7S A;  4B8X A;  5A2Q Z;  3V42 A;  2KHM A;  1LEA A;  4B3A A;  1E3H A;  1Y1V J;  2QEX I;  1YIJ I;  2CQQ A;  2NYX A;  4I99 C;  5EZH A;  3H36 A;  4PJJ A;  4KA4 A;  3CO7 C;  2LNB A;  4ZYE A;  3W6V A;  1EH8 A;  3DU5 A;  2WWY A;  2IA0 A;  4CCL A;  2OZ6 A;  2L4M A;  4AIK A;  2HOA A;  2NAZ A;  1BJA A;  1YS6 A;  2ESN A;  2QYO A;  4XLC A;  1AKH B;  1QBJ A;  4OMZ A;  4JK1 X;  4PSW A;  3RDI A;  2KQR A;  3DF8 A;  4PUS A;  4BL0 B;  5DD4 A;  4E70 A;  3BG7 A;  3RQI A;  2V1N A;  2H8W A;  1F1Z A;  1MND A;  1E3O C;  5D6E A;  1CF7 B;  5DDG A;  2DXI A;  2DMQ A;  1S9H A;  1QZY A;  1X1A A;  2OA4 A;  2YX7 A;  1BBY A;  3MZY A;  1ON2 A;  3QAH A;  4HNT A;  1MBE A;  3CC4 I;  1IDZ A;  4G94 A;  4CYD A;  4IRH A;  3OSF A;  4U0W A;  2V9V A;  1G3S A;  5D5V B;  1W36 C;  5IYB J;  2HZT A;  5EDN A;  1DU0 A;  3GCM A;  5HNF A;  1HOM A;  1VQ5 I;  1WI9 A;  4HW0 A;  3CES A;  3HGY A;  2XRO A;  4BNC A;  4A0Z A;  1FOX A;  3QOD A;  4CYC B;  1YTY A;  3EYI A;  1F43 A;  2GZW A;  3KP6 A;  2STW A;  1XMK A;  2XDV A;  2XF7 A;  2PBI A;  1WJ5 A;  2JT1 A;  4IHS A;  3RZD J;  2AQF A;  2BGC A;  1LB2 A;  1Z3Y A;  5H6R A;  5J1U A;  1TQP A;  1MJ9 A;  2Y9Z A;  2DA2 A;  1WJC A;  2R0Q C;  1YJW I;  2PFB A;  1MDM A;  1PP8 F;  3O8G A;  3C7J A;  2KT0 A;  2XAS A;  1ZR2 A;  3R6S A;  3RSN A;  4L5J A;  2KIF A;  4XRF A;  2Q0O A;  1WGX A;  1O3Q A;  3I3L A;  5F27 A;  1J59 A;  3HBL A;  2DU9 A;  1IN7 A;  1N77 A;  4OIO F;  1SC7 A;  4HRI A;  2PX9 A;  4EM1 A;  2A6T A;  1BOB A;  1ZLJ A;  2OCE A;  2ZXH A;  3E3V A;  2HOS A;  1WRJ A;  1NTC A;  4A69 C;  1GV5 A;  1YX5 A;  2O8X A;  3OR1 C;  4RGS A;  2WAE A;  3IH4 A;  4XSX F;  3GZ5 A;  3GFM A;  4BY1 J;  2E34 A;  3QP5 A;  2M45 A;  3CP2 A;  3S93 A;  1MNM C;  1ZHF A;  4BEH A;  4HAM A;  2VBX A;  2MGQ A;  4RAY A;  4LIT A;  1YIT I;  1S7O A;  4PGG A;  4CGZ A;  1WVR A;  2K3F A;  1I6X A;  2KRC A;  3BG5 A;  3ABK H;  3ASO H;  3HOV J;  3J7A Y;  2RRE A;  4BKX A;  2M34 A;  1XB4 A;  2R3S A;  1YLF A;  1R49 A;  2LKX A;  3CF2 A;  2H94 A;  2E5Z A;  3DU6 A;  2PJR B;  4Z2Y A;  1D1B A;  3Q0W A;  1XSX A;  3HZJ A;  4HLY A;  4M74 A;  4BS9 A;  1EV7 A;  2DPD A;  3A0B C;  2DA6 A;  4UUS A;  4QWQ A;  1Y39 A;  1IXR C;  1QPM A;  1W5C C;  2OPT A;  1MSF C;  1GVJ A;  4HV5 A;  4ZC3 A;  4N4O B;  2OC6 A;  1RIO H;  3WE2 A;  1XPX A;  2EWN A;  4Y15 A;  4I0A A;  1I5Z A;  3LQR A;  5M5X J;  2ISZ A;  4ZDO A;  2DA4 A;  2UXN A;  2ZNY A;  4BXU A;  2RV8 A;  2Z9O A;  1N75 A;  5FLV A;  1BOA A;  2XGX A;  3A4C A;  5LRR A;  3S15 J;  1JGS A;  3E0J B;  2ID6 A;  3A2K A;  4ABZ A;  1OCC H;  3IH3 A;  4Q47 A;  1H9T A;  4AWX B;  1FYK A;  1M1E B;  2RC4 A;  4WF2 A;  3P9C A;  4M6X A;  4E7L A;  1B59 A;  2GXG A;  2QF7 A;  5F6F A;  2LF8 A;  1ZGW A;  2ZC2 A;  4KYW A;  3WTY C;  2QKL B;  1JE8 A;  3RCO A;  1MBJ A;  3ZQQ A;  2HDC A;  2QSG X;  5H20 A;  4LIU A;  4D1Q A;  1HXD A;  4FE4 A;  2DPU A;  4L18 B;  2LF7 A;  2AS5 F;  4KMU X;  4MEX F;  2R7T A;  2CU7 A;  1P7J A;  4N4N B;  2DN0 A;  2HDD A;  1V55 H;  3AL0 C;  2D1V A;  2E1M B;  4II3 A;  1U3E M;  2R7X A;  4GCV A;  1BC8 C;  1QO0 D;  3HL2 A;  3FBN B;  1ETK A;  1JKQ C;  1HW1 A;  3RKY A;  2IGK A;  1LFB A;  4F52 A;  1T38 A;  2PJP A;  3S1N J;  4A3C J;  4KN4 X;  1E17 A;  1S7A A;  1V5E A;  2ZB9 A;  3F6O A;  3OIO A;  2H1L A;  4BXX J;  2M9H A;  3C3W A;  4IHT A;  4HBL A;  3T1B A;  1Z6T A;  4BQN A;  5ICC A;  4R79 A;  2VE8 A;  1JTX A;  1YFH A;  3PIP F;  5IY5 H;  1ZRE A;  2LDU A;  2Q8K A;  3Q0V A;  3TO7 A;  3OL3 A;  4EJW A;  4XMY A;  3IP4 B;  5ED4 A;  2ACJ A;  1VQ9 I;  3V8J A;  3SFI A;  3TDU C;  1KQ8 A;  4ETS A;  4OWR B;  1XN7 A;  4L9T A;  4QLC U;  1X1D A;  5LEK A;  3S17 J;  1E0E A;  5CPR B;  2HFH A;  4I01 A;  3KPH A;  1FIP A;  3SFZ A;  2TRT A;  3ZQF A;  1YI2 I;  1VQ6 I;  2MD5 A;  2VT3 A;  1FIA A;  1XSD A;  2G7H A;  1ONV A;  3F72 A;  4OU0 A;  1D5Y A;  1IZ1 A;  1A5J A;  3KET A;  2W24 A;  2JA2 A;  3H3Z A;  4A3G J;  4AVZ A;  3HGG A;  2R4G A;  2FBH A;  4KUM A;  1EH6 A;  2F5D A;  1BI3 A;  4O6J A;  1O3S A;  4EQQ A;  5JFR A;  4F7Z A;  1KON A;  4FCY A;  4U0Y A;  2JPB A;  2NVU B;  3F22 A;  4CZZ A;  1RET A;  3VWB A;  5L3D A;  4A5M A;  2QM3 A;  3U2R A;  1HC8 A;  3CUQ B;  3LL7 A;  3BC8 A;  3ZGK A;  3K1M A;  4B48 A;  1D0Z A;  2A07 F;  3B73 A;  1UZC A;  5IP7 J;  1QHG A;  2CQN A;  2VJ4 A;  3HOT A;  1HLV A;  3WTT C;  3IAM 2;  2O5R A;  1SAX A;  4M3G A;  3QRF F;  2ZJR F;  4ZYD A;  4HLX A;  4HQE A;  3W2W A;  4A3F J;  4RAF A;  1TWH J;  3HHG A;  5B3S H;  1GT0 C;  4OIP F;  3V8L A;  3PSF A;  2V7F A;  3QPT A;  4HDU A;  4BE2 A;  2XB0 X;  4XOT A;  1C0W A;  1IN4 A;  2IP2 A;  3IKT A;  1WJA A;  2ZJ2 A;  3WTU C;  3M7G A;  4R1H A;  1DUX C;  4UV8 A;  3ESW B;  2VT2 A;  1OYW A;  3CDH A;  4BAY A;  3BG9 A;  4CSW A;  4HNV A;  5IP9 J;  3LAJ A;  1PJR A;  3DPU A;  2HWV A;  1K79 A;  3K6G A;  4A5N A;  5J4V A;  3V7S A;  3VPR A;  4IJA A;  3I64 A;  2IRF G;  2CFO A;  3T8T A;  5AIQ A;  1TT5 B;  3V7C A;  5BPD A;  3Q9S A;  1GDT A;  1FMW A;  3K4M A;  2L9R A;  1XCB A;  3GYH X;  1UJ8 A;  1VTN C;  2XAG A;  2VE9 A;  4G7H F;  3QP6 A;  3GTM J;  4U7B A;  2HXO A;  3S3N A;  3CCE I;  3OYJ A;  5D6F A;  1T2K A;  1K4T A;  3ZOB A;  1T56 A;  4LK1 F;  4XLH A;  3H0D A;  1W4M A;  2Y69 H;  4I6Z A;  1ORK A;  3CP8 A;  3MQ0 A;  3GME A;  4M73 A;  5BMZ A;  1LDJ A;  3FBI B;  3KYD B;  4A6D A;  2HYG D;  4HG2 A;  3ZP5 A;  4A3M J;  2KIU A;  2LYC A;  3EUK L;  1USS A;  1K6O A;  3F0C A;  1J9I A;  2XAJ A;  3HIF A;  2DFI A;  4D7N A;  3E6D A;  5E8I A;  2BZT A;  2KRF A;  3LSH A;  2GOX B;  2QZ8 A;  4U7D A;  5EZG A;  1X19 A;  2E2J J;  4BHB A;  2H1K A;  1YOV B;  2I10 A;  1MH3 A;  2OJE D;  2V4J C;  3MKL A;  4CCM A;  2P7C B;  3OOP A;  4ESJ A;  3RPQ A;  5F08 A;  1T95 A;  3L2Q A;  2A68 F;  5JVT A;  3ELK A;  2M3A A;  4RS8 A;  4IRG A;  2R7O A;  4PJM A;  3WOD F;  1RNL A;  5IT9 Z;  1XGN A;  3K4J A;  4D7M A;  3TKY A;  2HVR A;  2WC2 A;  3ABU A;  1Z91 A;  2ELK A;  3PNV A;  1UHS A;  3LSG A;  3GTP J;  3H5R A;  2UWM A;  3D5R C;  1BR4 A;  3E1S A;  3ZQI A;  3L7W A;  4BAC A;  4YEL A;  2IAI A;  2ZO4 A;  3L2V A;  1GVD A;  2HZD A;  1UG0 A;  5E3O A;  3KLO A;  1R1V A;  3M3Y J;  2L7K A;  1FOW A;  5AIP A;  3TP3 A;  1S6L A;  3IRQ A;  4OIN F;  1IRF A;  4ASN A;  5K5O A;  1H8A C;  4YEJ A;  5EGO B;  4AID A;  3G1L A;  2VKH A;  1N78 A;  1FT9 A;  2W57 A;  4ANJ A;  1VI0 A;  1IW7 F;  4NQW A;  1P4A A;  3HG9 A;  5KAI C;  1F4K A;  1YYV A;  1QVU A;  1R4N B;  2VBZ A;  3ZRG A;  4CZC A;  2Z2S B;  2DK5 A;  2DDA A;  2HU9 A;  2QBY A;  3JSO A;  3PQK A;  1G3Y A;  1WHU A;  3HKZ N;  2JSP A;  4C2U A;  3FXL A;  3KLN A;  1W1W E;  1QGP A;  2Z5U A;  1VFC A;  2VBW A;  5GAE J;  4LK0 F;  3VOE A;  2EFP A;  5L3C A;  4GO1 A;  2A05 A;  2FF4 A;  1D0X A;  2IJL A;  3JRA A;  3HSR A;  1NG7 A;  4GGG A;  1WI3 A;  1HF0 A;  3BG6 A;  3ONQ A;  4LOC A;  4LJZ F;  2FOW A;  1JTY A;  1FSH A;  2KL4 A;  2Z3Y A;  3L2C A;  4BY7 J;  2VOD A;  4AYB N;  2E5N A;  4FX0 A;  2DT5 A;  1LFP A;  2V9K A;  2OUM A;  4M71 A;  3WU0 A;  1WFX A;  4M6V A;  1VF9 A;  4PDK A;  5F1J A;  3WGI A;  1XMX A;  5C3E J;  4WCG A;  4XRS G;  4AYB A;  2JPC A;  3K4K A;  2ZSH B;  3LMM A;  2FSW A;  5DCM A;  4XQF A;  1X4O A;  3GTL J;  1UFM A;  2DOA A;  3ZN1 A;  4P9U A;  2X48 A;  4DQ2 A;  4IO9 F;  1U6G A;  4HNU A;  1T0F C;  4CCK A;  3ZQG A;  1XGO A;  1X2N A;  2BY2 A;  1SAU A;  1FZP B;  1BIB A;  1OCO H;  3LFK A;  2WA0 A;  2CWE A;  3LST A;  1XGS A;  1IG7 A;  4I76 A;  2RQP A;  5F04 A;  2CW7 A;  1T0F A;  2IS1 A;  4L9J A;  3B6C A;  4KIS A;  3RKX A;  3BP8 A;  3O6B B;  2CW8 A;  1T8I A;  1Z3X A;  1O57 A;  2KZG A;  3BTL A;  5LLQ A;  3UNG C;  1VQ8 I;  2E71 A;  1RKT A;  2BW3 B;  2OTL I;  2Y9Y A;  4J01 A;  5ERI A;  1DU6 A;  2XSJ C;  3OIP A;  4H4K C;  2GAU A;  3W3C A;  1T6S A;  5D5U B;  3OYF A;  1U2W A;  1B72 A;  4XKW A;  1X3U A;  2CV2 A;  3SEQ A;  2Q2E A;  4Q4Z F;  2OAZ A;  5K7Z A;  3I0T A;  1BA5 A;  2CYY A;  1GLN A;  4WX9 A;  4W97 A;  3K2A A;  2X0L A;  1TWA J;  3Q0U A;  4OOI A;  1A04 A;  1KQ9 A;  1S29 A;  3F8M A;  1BR2 A;  1LVA A;  4K2E A;  2XKP A;  1PDN C;  2CQX A;  3JW4 A;  4HZF A;  3GTJ J;  1VQN I;  2QGU A;  5FO5 A;  2VPL A;  2YU3 A;  4HOB A;  4RDU A;  3F8B A;  4YII A;  3OS1 A;  1ZGA A;  1A31 A;  1YRN A;  3CD6 I;  1XDU A;  3ABM H;  3PM1 A;  3SDG A;  2K9L A;  1U5T A;  3BZC A;  2ETH A;  2JN6 A;  2Z16 A;  3IWZ A;  5CVJ A;  1B6A A;  1D8K A;  1MMN A;  1S7E A;  2WY7 Q;  2LBF B;  1TW3 A;  4KMF A;  1V5F A;  3I55 I;  1ZH5 A;  2VKD A;  3WTZ A;  3G6E I;  2XF5 A;  1LNW A;  3M1C A;  4GRI A;  3OSG A;  4L9V A;  1QZE A;  4MQ9 F;  1TWC J;  2BY3 A;  1X3Z B;  1SVO A;  2KPM A;  1JJ8 C;  3O3K A;  4N9H A;  3PQJ A;  1AOY A;  4P96 A;  2H09 A;  2X6X A;  4A0X A;  2QA4 I;  2XRN A;  3A03 A;  3FF5 A;  1P2F A;  2KJC A;  5E3M A;  3MKZ A;  2W84 A;  1DGR M;  2LKP A;  5LD2 C;  2R7R A;  3RPU A;  5D5W B;  4QIW N;  3G73 A;  5FRO A;  1Z6R A;  2C6Y A;  3CO6 C;  2M5W A;  2DA5 A;  1IRG A;  5EEG A;  3A0H C;  1H89 C;  2DYR H;  3NAU A;  2EFQ A;  4AIH A;  2ZFW A;  3BR0 A;  4EV0 A;  1A35 A;  5J8F A;  3RKW A;  4A3D J;  2R7Z J;  2R5Z B;  3PO2 J;  2DCE A;  2MH2 A;  3PUF A;  3QPS A;  2R7Q A;  1Y0U A;  4I09 A;  4M6Y A;  5DTD A;  2K02 A;  2FX0 A;  2JSC A;  2O3F A;  3BG3 A;  4OIR F;  4ZTF A;  5ICF A;  4CXF A;  2L02 A;  4RB3 C;  3GFL A;  3ZQH A;  2F5F A;  4U0V A;  4E7J A;  3LFU A;  2VB6 A;  5J1R A;  2VQG A;  4XNF A;  3TBI A;  1KU7 A;  1J0R A;  2DMP A;  2BVM A;  4CCN A;  1PUE E;  3LA3 A;  4ZDL A;  1RR7 A;  2IS4 A;  1JUS A;  2XHK A;  2PI0 A;  3OR2 C;  2K9S A;  2HVQ A;  2R92 J;  2B9S A;  3B02 A;  3VDX A;  1RI7 A;  1XC5 A;  4F92 B;  5L3G A;  2JA6 J;  1RES A;  3ASN H;  1J5Y A;  3VYR B;  2K86 A;  3DWL E;  2K40 A;  1XSV A;  5AON A;  4XLP F;  1U9N A;  5ILU A;  4NC8 A;  2LY2 A;  1TNS A;  1JT0 A;  4ZTJ A;  3DQV C;  4I0B A;  3CCL I;  4GXO A;  5LHG A;  1YJN I;  1U0J A;  2YSR A;  2DOE A;  3MMY B;  3RQ4 A;  1MJB A;  4XLF A;  4S05 A;  3CCU I;  2H27 A;  5TRD A;  5D8K B;  3L09 A;  2ZXW H;  3W2V A;  4DW6 A;  4RM2 A;  3K70 D;  4XR6 A;  1R9T J;  1MBF A;  2K4J A;  4XON A;  5DM6 F;  5E3L A;  4EJT A;  2GXB A;  2JVH A;  1IC8 A;  4ZDP A;  1L3L A;  1LE8 A;  1BN5 A;  1HBX G;  2BXY A;  4I2O A;  4NHJ A;  4ESB A;  4NC6 A;  3CCM I;  1HCR A;  2LKS A;  2VON A;  2RDP A;  3S2H J;  3B6A A;  2E35 A;  2F48 A;  4Q5S F;  1IXS B;  3WTW C;  1GHC A;  2GOM A;  3GXO A;  2CV1 A;  3H0G J;  2H8R A;  1XX5 A;  5KNL A;  1I3A A;  3CJN A;  3JRF A;  3TDZ C;  4IQ4 A;  3G1M A;  2NS0 A;  2MC3 A;  5CVI A;  2JWT A;  4YFN F;  1WCM J;  5LRS A;  1ZG1 A;  2XC7 A;  1S72 I;  1ZAO A;  1VQM I;  3FIW A;  4MTE A;  3K7A J;  3F21 A;  3FXQ A;  3MFK A;  1G3T A;  3VFZ A;  3QYB A;  1IJW C;  3OMY A;  4GYG A;  4XSZ F;  2DO7 A;  4A0Y A;  1DDN A;  3Q5F A;  2DMT A;  5CVV A;  5E17 F;  2LY9 A;  2DI3 A;  3I54 A;  1QNT A;  3L2W A;  2QUF A;  3T8R A;  1Y0N A;  1RUN A;  1VQL I;  2IT0 A;  2FJ1 A;  3FM5 A;  3EPZ A;  3K0L A;  2R5Y A;  4MIM A;  4P5O A;  4IOC F;  2LMD A;  4C3H J;  1ZAR A;  2Z33 A;  3HOU J;  3KZY A;  4CCO A;  4G6T B;  4AIJ A;  1PUF A;  3HYI A;  3KE2 A;  4KIC A;  4NDL A;  3E6C C;  4LFU A;  5KVR A;  3ZMZ A;  4ZJZ A;  1MH4 A;  4BHC A;  3FXJ A;  3CC7 I;  5GAD J;  4ENJ A;  3L00 A;  2ZME C;  3LWF A;  4F55 A;  3ZN0 A;  4AD9 A;  4CH7 A;  2JTV A;  1R5G A;  3FMQ A;  5JI6 A;  3BDD A;  1ULY A;  3JSP A;  3CUQ C;  2IGO A;  1X1B A;  4V2F A;  5JHF A;  2E7X A;  4XIC A;  3SJM A;  4D0P A;  3CZ6 A;  4NB5 A;  2OQR A;  3MWM A;  5IOZ A;  3GZN B;  4G9Y A;  1DPR A;  1X58 A;  4M72 A;  3FMS A;  5EF6 A;  2E60 A;  1B9N A;  3E6B A;  1W0T A;  3C1D A;  1FP2 A;  3A01 B;  2EK5 A;  4R8H A;  5J8C A;  5GPA A;  1I50 J;  5DD8 A;  1ZG5 A;  2P81 A;  3H3U A;  4AUX A;  1SMY F;  4S0H B;  2BEO A;  4FAS D;  3IL2 A;  2OCC H;  3U9G A;  5FLX Z;  3GTO J;  1OFC X;  2VJ5 A;  3SXY A;  3DEU A;  2EV6 A;  4BQA A;  4LLG F;  3GFI A;  2A6E F;  1AHD P;  2KLO A;  4GYI A;  1GXQ A;  1Q1H A;  1JKP C;  4V19 K;  1UEL B;  2W7N A;  1EF4 A;  5FD6 A;  1AU7 A;  1ITY A;  2DA1 A;  5B1A H;  4YG2 F;  2EH3 A;  3JRB A;  5FLM J;  2EIM H;  3AG3 H;  1E2X A;  1OYI A;  2DDB A;  4Y4R A;  2JMW A;  4WXD A;  1R1U A;  1YG2 A;  2M0C A;  5K5Q A;  2AXL A;  1JT6 A;  3KP4 A;  2LP0 A;  3I53 A;  3PUB A;  5L3B A;  2DMN A;  1K78 B;  3E6M A;  4E7K A;  1OYY A;  3TMO A;  3CME I;  4XN0 A;  3J7Z I;  2IA2 A;  5IT3 A;  3FXU A;  4A3L J;  2A69 F;  2VI6 A;  4G8X A;  2KFD A;  2R7F A;  1X3W B;  2JRM A;  2HPM A;  2L5Q A;  3LNQ A;  2D45 A;  1P4W A;  1IUF A;  4DOZ A;  2XIG A;  5FKL A;  2HGC A;  1PVE A;  1W5T A;  1VQP I;  1TLH B;  1TQM A;  4F91 B;  2XAF A;  2VUM J;  3RYP A;  2MH9 A;  3S2W A;  4LGW A;  5IYD J;  5BS6 A;  3JTG A;  1SD6 A;  2EV0 A;  4MFD A;  2H6C A;  4H0E A;  2VC1 A;  1OCR H;  4UB8 C;  3HRM A;  1DP3 A;  3J7A O;  4Y7N J;  1B4A A;  3HUG B;  2MA3 A;  1W0U A;  4HYE A;  1MIJ A;  2CUZ A;  2RN7 A;  3GEZ A;  3ZMS A;  3OYE A;  2ID3 A;  4XLE A;  2L54 A;  1G3W A;  3EUH C;  4JQF A;  4DYC A;  3VYT B;  2V1U A;  3K4L A;  3HC7 A;  2DFF A;  5FKK A;  3GZ6 A;  3FIS A;  3GTG J;  5CQE A;  1WZ2 A;  3DEW A;  2YU9 J;  3TW7 A;  4HDV A;  1SD4 A;  5CKT A;  1Z0X A;  2ADU A;  1ZKG A;  4LLL A;  4F3Q A;  1QU3 A;  1MMD A;  3TP0 A;  5B1B H;  3J81 K;  3KEQ A;  1ZYR F;  1FBQ A;  2K5C A;  5E79 C;  1QZZ A;  2CQ7 A;  2O7O A;  1WH5 A;  2EFW A;  5E1W A;  4MEY F;  4FE7 A;  2QQA A;  1TW2 A;  3VEP A;  3L1P A;  3OYN A;  1I6H J;  3S1Q J;  1R6R A;  4QTR A;  2K3P A;  2BBY A;  3DBL B;  5IP6 A;  4V2G A;  2KRH A;  1Y1W J;  3BQY A;  2VOP A;  2MG4 A;  1G59 A;  1SFX A;  5BOX A;  2L7Z A;  3OS2 A;  1APL C;  3IRR A;  3H9Q A;  3BZ6 A;  3DFG A;  3BR1 A;  2XPU A;  2BXZ A;  1TC3 C;  4P9F A;  1EJ9 A;  4IKF A;  4BJT A;  4Y13 A;  5LEJ A;  4XRS A;  4HEA 2;  4KIF A;  1KGS A;  1IXC A;  1O7L A;  2DBB A;  5GTI C;  4LG3 A;  1L0O C;  1MSE C;  1FEX A;  2MSY A;  1FYM A;  2KDO A;  6PAX A;  4CHU A;  1GXP A;  2M30 A;  5L3F A;  2FA5 A;  2G7U A;  2YUS A;  2LC2 A;  5HOD A;  4M3B A;  4YRV A;  2DAO A;  2WBM A;  1B9M A;  3PFY A;  1HKT A;  2DK8 A;  3H1C A;  3FKJ A;  1MJA A;  2W82 A;  1R71 A;  2DOD A;  1HQC A;  3EDP A;  4UB6 C;  5HDG A;  1WPK A;  1FBS A;  3REO A;  2VQL A;  5HNH A;  5KK1 A;  1P9Q C;  2EIL H;  3SQN A;  1QPI A;  4CO8 A;  1FNN A;  5M3M J;  2NNN A;  1MBG A;  4PSX A;  1U8R A;  3BZK A;  4EGY A;  1I27 A;  2KMU A;  3QU3 A;  4EJV A;  3HKZ A;  1SFK A;  3ZMU A;  1W7P A;  4J19 A;  2TDX A;  5J3L A;  5IYC J;  3CCS I;  2J5P A;  1HST A;  2M7B A;  4CYC A;  4AVP A;  3H3V K;  1XG1 A;  2F4M B;  4X1E A;  5D4R A;  5H6Q A;  4B3X A;  2BHY A;  2M4K A;  2O0Y A;  3E5Q A;  4PFP A;  1IO2 A;  4EAT A;  3D1N I;  2QQ8 A;  1FLI A;  1ZR4 A;  2GA2 A;  4BE1 A;  4DGW B;  2XPW A;  4G12 A;  2UUZ A;  3A1Y A;  2JK3 A;  1X4P A;  2QEN A;  3BJ6 A;  1WJB A;  4WXC A;  2V26 A;  2W48 A;  3ZMV A;  2L9S A;  3OYK A;  1R7J A;  1KQ0 A;  4BUP A;  4A3J J;  1SD7 A;  4LB5 A;  3CDL A;  2EZI A;  1R00 A;  3CCJ I;  2EFN A;  1B8I B;  2GWR A;  2E1O A;  1LEB A;  1HW5 A;  1K7A A;  2CUF A;  2FBK A;  4XKV A;  3NWT A;  4M3E A;  3UKG A;  1ZTR A;  2A6H F;  3FXR A;  2XSD C;  3AKZ A;  2NXN B;  3HRT A;  1AKH A;  3Q9V A;  2VLA A;  3ZQC A;  3J80 K;  3CCV I;  3S3M A;  3JRG A;  4B4C A;  5CYV A;  2FMY A;  1JXS A;  1QRY A;  1ZN2 A;  3IWF A;  1ZRF A;  1ON1 A;  4M9X A;  3QU6 A;  4A3E J;  3HDD A;  3K69 A;  1IUY A;  5FLX K;  2D1H A;  1BW5 A;  3C2B A;  3OYC A;  2L9V A;  3GO5 A;  3HPH A;  1RR8 C;  2ZJQ F;  1U5T B;  4YIF A;  1P92 A;  2UXX A;  1YJ9 I;  1KYZ A;  2PQ8 A;  2QLZ A;  3ML6 A;  3JAM Z;  1KZH A;  3P9I A;  4BHP A;  4E7H A;  2OD5 A;  2K7L A;  4ENN A;  3HRU A;  1K83 J;  1MBH A;  2M8G X;  1K4S A;  2V79 A;  1MMS A;  2HVS A;  5E1Z B;  4U88 A;  2COM A;  2L01 A;  2EBI A;  3DKW A;  3LQQ A;  1WWX A;  1ODD A;  4BXF A;  5B66 C;  3V4G A;  1QA6 A;  4RGX A;  5HDN A;  4IXA A;  1LDK B;  2DA3 A;  2F5E A;  3R60 A;  1DP7 P;  3F8F A;  2G0E A;  2FXA A;  4UV9 A;  4DZJ A;  1TWF J;  3KFW X;  4E7Z A;  1YX3 A;  2DMU A;  1H9G A;  2XAQ A;  3PL8 A;  2DOF A;  5DS9 A;  4QSH A;  2W85 A;  2I5U A;  4ZYH A;  2L3D A;  1J75 A;  3I4M J;  4HX4 A;  5EJC A;  5E8G A;  1UAA A;  3DCF A;  4RGR A;  5CQG A;  3WTX C;  1H0M A;  3VSK A;  3RZO J;  3CUO A;  1LVK A;  4ITV A;  1WH7 A;  2GXA A;  3FZV A;  3BLY A;  3BR3 A;  3H5A A;  1JUM A;  5F1R A;  1XD7 A;  4PCQ A;  2LOO A;  2FE3 A;  4FQG A;  1U9O A;  5IPA A;  3KP2 A;  2FBI A;  3DTI A;  1WJF A;  5LBQ A;  2OTJ I;  5FB2 A;  5ICE A;  3GTQ J;  4PGH A;  1GV2 A;  1U5T C;  4EM0 B;  2HOT A;  4ZZD A;  1HDD C;  3FK7 A;  4ENK A;  2M0M A;  3K4N A;  4OAY A;  2DJI A;  5ICG A;  1HKS A;  4KT5 C;  1IN5 A;  4IX7 A;  2F2E A;  2VC0 A;  2ZME B;  2K9Q A;  3WHC A;  3OY9 A;  2LRE A;  1EA3 A;  2IW5 A;  2QWW A;  1PUF B;  2DJN A;  3LOC A;  2BE5 F;  2EB7 A;  2IXS A;  3EYY A;  5K5R A;  3WTS C;  3QYE A;  4Y17 A;  1LE8 B;  1F36 A;  2DLL A;  5CVU A;  2P5K A;  4UUS B;  1R4M B;  2EPF A;  2P5V A;  3HTU A;  1BM9 A;  2QQ9 A;  2O61 A;  1S3J A;  1Z21 A;  4XN3 A;  4B1R A;  3DTK A;  2JUG A;  3W6K B;  2X9D A;  1MDM B;  2V6C A;  4I98 B;  1IV8 A;  5D4S A;  2ESH A;  5IOY A;  2E1N A;  5DUK A;  3KYC B;  2Y31 A;  3U1K A;  2YR2 A;  2RAE A;  3CUQ A;  2HKX A;  1BI0 A;  5JVG F;  3IAS 2;  2KIS A;  3BTI A;  2STT A;  1G8X A;  4MFE A;  3RIR A;  3DV8 A;  3OYG A;  3AL0 B;  2KZV A;  1O3T A;  5C4X J;  2NOJ B;  2PEX A;  1HDP A;  4DZP A;  3COA C;  3VSL A;  4BBR J;  3FMR A;  2RKH A;  2FNA A;  3R0A A;  4DNC A;  4C3J J;  2UZK A;  2V1D A;  1BIA A;  5LFA A;  1YHQ I;  2OZU A;  4Y3O A;  5B5E C;  4C9Y A;  2ZJP F;  1LDD A;  3KZZ A;  1EKE A;  2EJR A;  4XL9 A;  1FJL A;  1V3F A;  4IHV A;  5HLH A;  2KP6 A;  3CJR B;  3D5L A;  2YPR A;  1R1T A;  3JTH A;  2V1X A;  3HB9 A;  3BTC A;  4RAG A;  3RJP A;  4FX4 A;  3ZPL A;  3K2Z A;  1W5S A;  2XAH A;  3H9G A;  2LTP A;  4RLQ A;  2E7W A;  1TL8 A;  4DBQ A;  3H5N A;  2YX4 A;  3J81 Z;  2H6B A;  1XS9 A;  4L9N A;  2PMZ A;  3P5J A;  4RB0 A;  3TW6 A;  2WTE A;  5F0H A;  3PSI A;  4A2U A;  3HM5 A;  4NC7 A;  1F9N A;  1LUJ B;  1TP4 A;  1UMQ A;  2R7D A;  3U21 A;  3JAM K;  1UG2 A;  3AG4 H;  4NUB A;  3E97 A;  3ZQ7 A;  2DFE A;  2LH9 A;  1R23 A;  4IEJ A;  2O03 A;  1FSE A;  1R58 A;  3GF2 A;  5DEQ A;  2FNP A;  2K85 A;  4JX5 A;  3IHU A;  2COB A;  4QPQ A;  1ZGJ A;  2Y48 A;  3HOX J;  4KFC A;  3WGH A;  1OLT A;  2XV4 S;  3I4P A;  5KHD A;  5D8L B;  2R5Y B;  4MHG A;  3F8N A;  5K1Y A;  5F0C A;  3C2G A;  1O3R A;  4UVC A;  3RKQ A;  2P6T A;  5C44 J;  1XCV A;  3X2Q H;  2VQH A;  5FFX A;  2CW0 F;  1SFE A;  2CFX A;  4PJL A;  3HTS B;  5E18 F;  1T33 A;  2MYS A;  4UY8 I;  4A93 J;  1BJZ A;  2Y0S A;  1YIO A;  2JVG A;  2Q1Z B;  3K4B A;  4GFB A;  3P9K A;  2RNG A;  2DW4 A;  2A3S A;  3KCC A;  4BDZ A;  3G2B A;  3DBH B;  1FPQ A;  2JA8 J;  1YO5 C;  4BDY A;  1SVL A;  3RPU D;  5A2Q K;  2NS8 A;  3I5U A;  3QWL A;  1CGP A;  3I59 A;  3BCB A;  4LG0 A;  1MGT A;  3MKW B;  3KZI C;  3A01 A;  2NVQ J;  2WAQ A;  4C2T A;  1K78 A;  3ECO A;  1MW7 A;  2LY1 A;  3OYB A;  4RAZ A;  2NNY A;  3GW2 A;  1OR7 A;  2LRD A;  1NH3 A;  1P7I A;  2ZME A;  3DBR B;  4EM2 A;  5L3E A;  4JX4 A;  2X6O A;  3I59 B;  4LG0 B;  5BNG A;  1R5H A;  2ME0 A;  1WKM A;  3ZQL A;  1UB9 A;  1SEU A;  1HW2 A;  5TIS C;  2QCO A;  1UCR A;  2DQL A;  1R5I D;  3S8P A;  1Z77 A;  2DT6 A;  1W36 D;  3NWS A;  3LSR A;  1JI8 A;  2XGE A;  4CDG A;  2JQ7 A;  4KIT B;  3HHH A;  1MD0 A;  4XOP A;  3KEO A;  1KU3 A;  5M5W J;  5ILS A;  3I71 A;  3PO3 J;  3GLL A;  3H92 A;  5J4Y A;  3K1P A;  2M8E A;  1YE9 A;  1KU9 A;  3GFJ A;  2LR8 A;  1GUU A;  3WTV C;  2DTR A;  3SZT A;  1ZRC A;  1IAW A;  3K1N A;  2XAU A;  5E3N A;  1JKO C;  1FY7 A;  2IS6 A;  4BBS J;  4Z6Y A;  2M2E A;  3DP7 A;  2WAD A;  5HLI A;  2CG4 A;  2V9P A;  5FRN A;  3CLQ A;  2WV0 A;  4RBO A;  2KKO A;  3MCZ A;  1KYW A;  2FOK A;  4E4H A;  3E5X A;  2X85 A;  4XK4 A;  5KAF C;  2R7V A;  1SVM A;  2NOG A;  2FEZ A;  2D2W A;  3O8H A;  3TO9 A;  3RI4 A;  2HDW A;  2IGN A;  3OL4 A;  1ETX A;  3K70 C;  4ESF A;  2MLK A;  4M9Z A;  3LSI A;  1Q1V A;  1D0Y A;  3SZP A;  1FC3 A;  1MNE A;  1RRJ A;  2PLY A;  3HOY J;  2KIM A;  2IGM A;  5DV5 A;  1ENH A;  4D5C A;  2VXZ A;  3HUG A;  3QQA A;  4B44 A;  1MMG A;  4BU2 A;  5C4J J;  2PMZ N;  3G71 I;  1DQU A;  4MLO A;  3CQZ J;  2P5L C;  2V6E A;  4WXH A;  1TT0 A;  2HI3 A;  4FTH A;  2ZNZ A;  3S3O A;  4MO7 A;  1Y8R B;  3CJT B;  2IEK A;  3FDY A;  1Z9C A;  1Y6I A;  4U87 A;  1D1C A;  4ZYG A;  2K9M A;  3AAF A;  1V4R A;  2BW3 A;  3HJE A;  3DLL F;  3ABT A;  4DJA A;  3S1R J;  3CMA I;  3W2A A;  3SYT A;  1WQ2 A;  3BRO A;  3WU2 C;  2CQK A;  1QHH D;  2HKO A;  2MAB A;  3HPG A;  1U8B A;  3OYM A;  4L0Y B;  1D5V A;  5EGO A;  1UST A;  1FOK A;  4RB1 A;  1BL0 A;  2WAF A;  5FD5 A;  2HS5 A;  4RB2 C;  4PK4 A;  2LLK A;  4XM3 A;  2X51 A;  3CTA A;  4HX7 A;  4D9J A;  2LVS A;  3CLO A;  3MVP A;  3PNY A;  3VYS B;  5HS9 A;  3BPV A;  4KDP A;  3VB2 A;  2FD5 A;  3HEF A;  4BE0 A;  3T0Y A;  1YW8 A;  1LQ1 A;  4HF1 A;  4KIG A;  2ZFU A;  4WK8 F;  1SFO J;  1VQ7 I;  1RUO A;  3GLX A;  1JHH A;  2VJI A;  4EGZ A;  1JGG A;  3HOW J;  2X1E A;  3OYD A;  1FP1 D;  3LSM A;  3M1E A;  3QOP A;  5EEA A;  5DCF A;  3GVA A;  1V54 H;  3IC7 A;  3DLA A;  3RYR A;  3PNT A;  4LLN A;  2AHQ A;  2FUG 2;  1ERD A;  3G1O A;  2HPI A;  3KYL A;  2GLO A;  2QSF X;  4DYQ A;  2E19 A;  2KIQ A;  2X6W A;  2UV1 A;  3NAR A;  3G4S I;  4P1W A;  5CVR A;  1PYV A;  3L9F A;  2ZXJ A;  3ROU A;  3SDB A;  3HSF A;  3K4C A;  3BR6 A;  1B72 B;  1F5T A;  1ZRD A;  2W00 A;  4Q48 A;  1SAN A;  2CRG A;  2ECB A;  2PJR A;  3ZR8 X;  3O2P E;  4LD5 A;  4F93 B;  4XLA A;  1VZ0 A;  1FMV A;  2FML A;  3IV5 A;  9ANT A;  2X4H A;  4HX8 A;  2GA1 A;  1X1C A;  2LBF A;  2ZSI B;  1Z1D A;  3N05 A;  4YIR X;  1NK2 P;  2NVT J;  1R22 A;  2VQC A;  2EZK A;  2BY0 A;  4N9I A;  5ILV A;  2BYV E;  2F6C A;  1YQA A;  4BEH B;  1JHF A;  5LGT A;  3HOS A;  5DM7 F;  4HPQ A;  5CJ9 A;  3SZG A;  1IN8 A;  4IQJ A;  3MZH A;  1WSU A;  3DKY A;  2FQ4 A;  2RQQ A;  5HS8 A;  3PIO F;  3FM3 A;  2XF6 A;  4DIQ A;  3LAP A;  2P8T A;  3M8F A;  3BQZ A;  4KNY A;  1P6R A;  4DYR A;  3R61 A;  4PJN A;  3CCQ I;  3M4O J;  3OV8 A;  3OYH A;  1A6I A;  1ZG3 A;  4CA0 A;  2NRA C;  3OOU A;  3ERM A;  2VBY A;  2M4G A;  4ZYA A;  2AQE A;  3H35 A;  3S16 J;  4AC0 A;  5EG0 A;  3W6J B;  2VOO A;  3KP3 A;  4M9S A;  2A5W A;  4XLN F;  3P7N A;  5BPI A;  3MKY B;  4IHY A;  4G7O F;  3SHF A;  3FXK A;  2L4A A;  4RA2 A;  2NVX J;  4G6Q A;  5J6X A;  2B7E A;  4KN7 X;  3WHB A;  3U1D A;  1REP C;  3LSJ A;  2ISY A;  3SEZ A;  5FKO A;  4JP0 A;  4B43 A;  4XKB A;  3K9T A;  5FKM A;  4Y52 J;  2MC4 A;  4EEF G;  1ZLK A;  2HQR A;  5M3F J;  2Q2E B;  3MZ8 A;  3EUH A;  3S2D J;  1HKQ A;  1ZK8 A;  2QKM B;  2M1B A;  2IPQ X;  1VQO I;  2MW8 A;  2O8K A;  2L2O A;  3J7Y J;  2P0W A;  4OMY A;  2OU2 A;  3FK6 A;  2EFO A;  2ZXI A;  4MTD A;  2VKE A;  1J09 A;  1TNT A;  2E2H J;  3E7L A;  3S32 A;  4CCJ A;  5JHU A;  5HVQ C;  4ZZL A;  1TBX A;  5JLX A;  1NK3 P;  2JUC A;  3BPX A;  1HSJ A;  2A5Y B;  2A61 A;  3F6V A;  1OR7 C;  4A3I J;  1MZB A;  4DBR A;  2E1C A;  4FET A;  4ON0 A;  5GTH C;  3TOA A;  2ZCW A;  1S5L C;  3DXJ F;  2RGV A;  4LB6 B;  2FRH A;  1Z7U A;  4QPO A;  2WY8 Q;  3QYF A;  3DPL C;  3FHZ A;  3DKX A;  1OMI A;  1BI2 A;  4I7H A;  1OJL A;  3ZMD A;  2EQR A;  3EET A;  1KU2 A;  3M8J A;  4PJ0 C;  3IH2 A; 
#chains in the Genus database with same CATH homology
 4EJU A;  3NRV A;  3ZMT A;  5DUI A;  1I1S A;  2FQ3 A;  4EMS A;  1FWZ A;  3NQO A;  4HF2 A;  2GQQ A;  1YW7 A;  3C18 A;  1UHW A;  5CLS A;  3PFI A;  1LJ9 A;  1IF1 A;  1FYL A;  1SD5 A;  4MGR A;  4JBA A;  3EQL F;  3HSE A;  3BY6 A;  2HEO A;  1OKR A;  3MEX A;  4P55 A;  5LHH A;  4LMY A;  2HQN A;  5LGU A;  3F8C A;  1I1G A;  2CGP A;  5FFZ A;  2OQG A;  3E5U A;  4WWC A;  4A12 A;  4UUV A;  1T98 A;  1PP7 U;  4ZH4 F;  2FU4 A;  3RTR A;  2IVM A;  3M8E A;  3IKV A;  3BWG A;  5D5X B;  1OPC A;  4HA8 A;  5F64 A;  2P4W A;  3BJO A;  2MLG A;  3TO6 A;  2XKO A;  3F23 A;  3G3Z A;  4MNU A;  3M9A A;  2RVC A;  3ULQ B;  3R4K A;  3DPT A;  3WE3 A;  2LSO A;  2HTS A;  4N0B A;  5LGN A;  4G6D A;  3HRS A;  5JR3 A;  2CSO A;  2RNJ A;  5E1X A;  2GIV A;  3TQN A;  2W25 A;  4YFX F;  1CF7 A;  1SMT A;  4I02 A;  2HOE A;  4B09 A;  2P7V B;  2ZKZ A;  4EVI A;  3NEU A;  3V8K A;  4MQV A;  1B1B A;  2B0L A;  4IRI A;  1J2X A;  4FT8 A;  2MBF A;  2EA4 A;  1YS7 A;  2Z99 A;  3GUD A;  2F5C A;  1XDS A;  1U78 A;  3WU1 B;  1J7K A;  2Y75 A;  4UXN A;  3J80 Z;  4EJO A;  1W7P B;  4CIC A;  3TOB A;  1MKM A;  1YW9 A;  3BOQ A;  5BQT A;  1RZ4 A;  3VOD A;  2HR3 A;  2XVC A;  4XBF A;  5EEH A;  1G6N A;  3KP7 A;  1G4D A;  4O3M A;  4IF4 A;  3FWE A;  3MAJ A;  3T5X A;  4ENM A;  2O6G E;  2P6S A;  4HF0 A;  2OBP A;  2PG4 A;  1D8J A;  1Z05 A;  5LHI A;  2XUB A;  2KJB A;  5DCM B;  4O5V A;  1BI1 A;  2QVO A;  4HQM A;  4L0Z B;  3D0S A;  1FX7 A;  4A6E A;  3TGN A;  4UVB A;  5HS7 A;  1TQI A;  4UNO A;  2CO5 A;  1KA8 A;  5TJJ A;  2QQB A;  3F3X A;  1P4X A;  2ELH A;  3FX3 A;  3WG9 A;  1NHA A;  4G7Z F;  1W7P D;  3WGG A;  2PMH A;  3LA2 A;  2PN6 A;  3V7R A;  1XGM A;  2JRT A;  4BH9 A;  3ISP A;  1UHM A;  2DQR A;  5HDK A;  3GX4 X;  2K4B A;  3ECH A;  2PMU A;  3ERE D;  4FHT A;  1O7F A;  1FBU A;  4UVA A;  1DPU A;  3N4M A;  4YFK F;  2HYF A;  5FGM A;  1T39 A;  2HTJ A;  3I58 A;  1SFU A;  3GWZ A;  2VN2 A;  1EH7 A;  4RGU A;  5HLG A;  4PZJ A;  5E20 A;  1QQI A;  4IPA A;  1IN6 A;  1R36 A;  5HOO A;  1AWC A;  2JZY A;  1BC7 C;  4UHT A;  2Y0M A;  4KIB A;  3QPH A;  5IT9 K;  2G9W A;  3R0J A;  3BJA A;  2QBY B;  2EA2 A;  4OIQ F;  2M87 A;  2ZBK A;  4HV6 A;  1TTY A;  4TV7 A;  3KP5 A;  2EV5 A;  2BV6 A;  1XMA A;  2IA1 A;  4IVN A;  5DYM A;  2J5O A;  3N97 A;  3LA7 A;  4S04 A;  2K27 A;  4BYY A;  4L5I A;  1D3Y A;  1S8N A;  1STZ A;  4B8X A;  5A2Q Z;  1LEA A;  2NYX A;  4KA4 A;  3CO7 C;  2LNB A;  4ZYE A;  1EH8 A;  2WWY A;  2IA0 A;  2OZ6 A;  2L4M A;  4AIK A;  2NAZ A;  1BJA A;  1YS6 A;  2ESN A;  2QYO A;  1QBJ A;  4OMZ A;  4JK1 X;  3RDI A;  3DF8 A;  5DD4 A;  4E70 A;  1F1Z A;  1CF7 B;  5D6E A;  5DDG A;  1QZY A;  3QAH A;  2OA4 A;  2YX7 A;  1BBY A;  3MZY A;  1ON2 A;  4G94 A;  4CYD A;  4IRH A;  4U0W A;  2V9V A;  1G3S A;  5D5V B;  2HZT A;  1WI9 A;  4HW0 A;  2XRO A;  4BNC A;  4A0Z A;  1YTY A;  3EYI A;  2GZW A;  3KP6 A;  2STW A;  1XMK A;  2PBI A;  2JT1 A;  4IHS A;  2BGC A;  1LB2 A;  5H6R A;  1TQP A;  1MJ9 A;  2PFB A;  1MDM A;  1PP8 F;  3C7J A;  2XAS A;  3R6S A;  4L5J A;  2KIF A;  4XRF A;  2Q0O A;  1O3Q A;  1J59 A;  2DU9 A;  1IN7 A;  4OIO F;  4EM1 A;  3E3V A;  1ZLJ A;  1WRJ A;  2O8X A;  4RGS A;  4XSX F;  3GZ5 A;  3GFM A;  3QP5 A;  2M45 A;  1ZHF A;  4HAM A;  2VBX A;  1S7O A;  4PGG A;  4CGZ A;  1I6X A;  1XB4 A;  2R3S A;  1YLF A;  2H94 A;  4Z2Y A;  1XSX A;  4HLY A;  4M74 A;  1EV7 A;  2DPD A;  4QWQ A;  1IXR C;  1QPM A;  1GVJ A;  4HV5 A;  1RIO H;  3WE2 A;  2EWN A;  4Y15 A;  4I0A A;  1I5Z A;  3LQR A;  2ISZ A;  2UXN A;  2ZNY A;  4BXU A;  2RV8 A;  2Z9O A;  1BOA A;  2XGX A;  5LRR A;  1JGS A;  4Q47 A;  1H9T A;  4AWX B;  1FYK A;  2RC4 A;  4WF2 A;  3P9C A;  4M6X A;  1B59 A;  2GXG A;  5F6F A;  2LF8 A;  4KYW A;  3WTY C;  1JE8 A;  2HDC A;  5H20 A;  1HXD A;  2DPU A;  4L18 B;  2LF7 A;  2AS5 F;  4KMU X;  4MEX F;  2D1V A;  1U3E M;  4GCV A;  1BC8 C;  1QO0 D;  1HW1 A;  3RKY A;  1T38 A;  2PJP A;  4KN4 X;  1E17 A;  1S7A A;  3F6O A;  3C3W A;  4IHT A;  4HBL A;  3T1B A;  1Z6T A;  5ICC A;  4R79 A;  2VE8 A;  1YFH A;  1ZRE A;  2LDU A;  2Q8K A;  3TO7 A;  4EJW A;  5ED4 A;  2ACJ A;  3V8J A;  1KQ8 A;  3TDU C;  4ETS A;  4QLC U;  1XN7 A;  4L9T A;  5LEK A;  2HFH A;  4I01 A;  3SFZ A;  2MD5 A;  2VT3 A;  1XSD A;  2G7H A;  1ONV A;  3F72 A;  4OU0 A;  1IZ1 A;  3KET A;  2W24 A;  3H3Z A;  2FBH A;  4KUM A;  1EH6 A;  2F5D A;  1BI3 A;  4O6J A;  1O3S A;  4EQQ A;  5JFR A;  4F7Z A;  4U0Y A;  2JPB A;  3F22 A;  4CZZ A;  5L3D A;  4A5M A;  2QM3 A;  3U2R A;  3CUQ B;  3K1M A;  2A07 F;  3B73 A;  3HOT A;  3WTT C;  1SAX A;  3QRF F;  4ZYD A;  4HLX A;  4HQE A;  3HHG A;  4OIP F;  3V8L A;  4HDU A;  3QPT A;  1C0W A;  1IN4 A;  2IP2 A;  3IKT A;  2ZJ2 A;  3WTU C;  3M7G A;  4R1H A;  1DUX C;  4UV8 A;  2VT2 A;  1OYW A;  3CDH A;  4BAY A;  3LAJ A;  2HWV A;  1K79 A;  4A5N A;  3V7S A;  4IJA A;  3I64 A;  2IRF G;  3T8T A;  5AIQ A;  5BPD A;  3V7C A;  3Q9S A;  1XCB A;  3GYH X;  1VTN C;  2XAG A;  2VE9 A;  4G7H F;  3QP6 A;  4U7B A;  1T2K A;  5D6F A;  4LK1 F;  1W4M A;  3MQ0 A;  4M73 A;  5BMZ A;  1LDJ A;  4A6D A;  2HYG D;  3ZP5 A;  2KIU A;  1K6O A;  1USS A;  1J9I A;  2XAJ A;  3HIF A;  2DFI A;  3E6D A;  5E8I A;  2KRF A;  4U7D A;  2QZ8 A;  4BHB A;  2P7C B;  3OOP A;  4ESJ A;  3RPQ A;  2A68 F;  5JVT A;  3ELK A;  4RS8 A;  4IRG A;  3WOD F;  1RNL A;  5IT9 Z;  1XGN A;  3TKY A;  2WC2 A;  3ABU A;  1Z91 A;  2UWM A;  3L7W A;  2ZO4 A;  3KLO A;  1R1V A;  5AIP A;  1S6L A;  3IRQ A;  4OIN F;  1IRF A;  4ASN A;  5K5O A;  1FT9 A;  2W57 A;  1IW7 F;  4NQW A;  1P4A A;  1F4K A;  1YYV A;  2VBZ A;  2DK5 A;  2QBY A;  3JSO A;  3PQK A;  1G3Y A;  3KLN A;  1QGP A;  2Z5U A;  2VBW A;  4LK0 F;  3VOE A;  2EFP A;  5L3C A;  4GO1 A;  2FF4 A;  2IJL A;  3HSR A;  4GGG A;  4LJZ F;  1FSH A;  2Z3Y A;  3L2C A;  2VOD A;  4FX0 A;  2DT5 A;  4M71 A;  3WU0 A;  4PDK A;  3WGI A;  4WCG A;  2JPC A;  5DCM A;  2FSW A;  1UFM A;  3ZN1 A;  4P9U A;  4DQ2 A;  1U6G A;  1XGO A;  1FZP B;  1BIB A;  3LFK A;  2CWE A;  3LST A;  1XGS A;  2RQP A;  1T0F A;  4L9J A;  3RKX A;  3BP8 A;  3O6B B;  1O57 A;  5LLQ A;  5ERI A;  2GAU A;  1T6S A;  5D5U B;  1U2W A;  1X3U A;  2Q2E A;  4Q4Z F;  2OAZ A;  3I0T A;  2CYY A;  4WX9 A;  2X0L A;  4OOI A;  1A04 A;  1KQ9 A;  1S29 A;  3F8M A;  1LVA A;  4K2E A;  2XKP A;  1PDN C;  3JW4 A;  4HZF A;  5FO5 A;  2YU3 A;  4HOB A;  3F8B A;  4YII A;  1ZGA A;  1XDU A;  1U5T A;  2ETH A;  5CVJ A;  3IWZ A;  1B6A A;  1D8K A;  1TW3 A;  4KMF A;  1ZH5 A;  3WTZ A;  1LNW A;  4L9V A;  4MQ9 F;  3O3K A;  4N9H A;  3PQJ A;  1AOY A;  4P96 A;  2H09 A;  4A0X A;  2XRN A;  3FF5 A;  1P2F A;  2KJC A;  2W84 A;  2LKP A;  3RPU A;  5D5W B;  3G73 A;  1Z6R A;  2C6Y A;  3CO6 C;  2M5W A;  1IRG A;  5EEG A;  2EFQ A;  4AIH A;  2ZFW A;  4EV0 A;  5J8F A;  3RKW A;  2MH2 A;  1Y0U A;  4I09 A;  4M6Y A;  2K02 A;  2JSC A;  2O3F A;  4OIR F;  4CXF A;  5ICF A;  2L02 A;  4RB3 C;  3GFL A;  2F5F A;  4U0V A;  1KU7 A;  1J0R A;  1PUE E;  3LA3 A;  2XHK A;  2PI0 A;  3B02 A;  1RI7 A;  5L3G A;  1J5Y A;  2K86 A;  1XSV A;  5AON A;  4XLP F;  5ILU A;  1TNS A;  3DQV C;  4I0B A;  4GXO A;  5LHG A;  2YSR A;  2H27 A;  1MJB A;  4S05 A;  5TRD A;  5D8K B;  3L09 A;  2K4J A;  4EJT A;  2GXB A;  1L3L A;  1BN5 A;  1HBX G;  4I2O A;  4NHJ A;  4ESB A;  2VON A;  2RDP A;  4Q5S F;  1IXS B;  3WTW C;  1GHC A;  3GXO A;  3CJN A;  3TDZ C;  5CVI A;  2NS0 A;  2MC3 A;  4YFN F;  5LRS A;  1ZG1 A;  1ZAO A;  4MTE A;  3F21 A;  3FXQ A;  3MFK A;  1G3T A;  3VFZ A;  4GYG A;  4XSZ F;  2DO7 A;  4A0Y A;  1DDN A;  3Q5F A;  5CVV A;  5E17 F;  2DI3 A;  3I54 A;  1QNT A;  2QUF A;  3T8R A;  1RUN A;  2IT0 A;  3FM5 A;  3K0L A;  4P5O A;  1ZAR A;  2Z33 A;  3KZY A;  4AIJ A;  3HYI A;  3KE2 A;  4KIC A;  3E6C C;  4LFU A;  5KVR A;  3ZMZ A;  4BHC A;  4ENJ A;  3L00 A;  3LWF A;  3ZN0 A;  4AD9 A;  2JTV A;  1R5G A;  3FMQ A;  5JI6 A;  3BDD A;  1ULY A;  3JSP A;  3CUQ C;  2E7X A;  4D0P A;  4NB5 A;  2OQR A;  3MWM A;  4G9Y A;  1DPR A;  4M72 A;  3FMS A;  1B9N A;  3E6B A;  3C1D A;  1FP2 A;  2EK5 A;  4R8H A;  5J8C A;  5DD8 A;  1ZG5 A;  3H3U A;  1SMY F;  2BEO A;  3IL2 A;  5FLX Z;  3U9G A;  3SXY A;  3DEU A;  2EV6 A;  4BQA A;  4LLG F;  3GFI A;  2A6E F;  4GYI A;  1GXQ A;  1Q1H A;  5FD6 A;  4YG2 F;  1E2X A;  1OYI A;  4WXD A;  1R1U A;  1YG2 A;  5K5Q A;  2AXL A;  3KP4 A;  3I53 A;  5L3B A;  1K78 B;  3E6M A;  1OYY A;  2IA2 A;  5IT3 A;  3FXU A;  2A69 F;  4G8X A;  2R7F A;  2D45 A;  1P4W A;  2XIG A;  2HGC A;  1W5T A;  1TLH B;  1TQM A;  2XAF A;  3RYP A;  2MH9 A;  3S2W A;  4LGW A;  5BS6 A;  3JTG A;  1SD6 A;  2EV0 A;  2H6C A;  4H0E A;  2VC1 A;  3HRM A;  3J7A O;  1B4A A;  2MA3 A;  4HYE A;  3GEZ A;  2RN7 A;  3ZMS A;  2L54 A;  1G3W A;  4JQF A;  2V1U A;  3GZ6 A;  4HDV A;  1SD4 A;  2ADU A;  4LLL A;  3J81 K;  3KEQ A;  1ZYR F;  1FBQ A;  1QZZ A;  2EFW A;  5E1W A;  4MEY F;  2QQA A;  1TW2 A;  3VEP A;  2BBY A;  2VOP A;  1SFX A;  5BOX A;  3IRR A;  3BZ6 A;  3DFG A;  4P9F A;  4Y13 A;  5LEJ A;  4KIF A;  1KGS A;  1IXC A;  1O7L A;  2DBB A;  1L0O C;  1FYM A;  6PAX A;  4CHU A;  1GXP A;  2M30 A;  5L3F A;  2FA5 A;  2G7U A;  2DAO A;  1B9M A;  1HKT A;  2DK8 A;  1MJA A;  1HQC A;  3EDP A;  5HDG A;  1FBS A;  3REO A;  5KK1 A;  3SQN A;  4CO8 A;  1FNN A;  2NNN A;  1U8R A;  4EGY A;  1I27 A;  3QU3 A;  4EJV A;  3ZMU A;  1W7P A;  2TDX A;  2J5P A;  1HST A;  4AVP A;  5D4R A;  5H6Q A;  2O0Y A;  3E5Q A;  1FLI A;  2GA2 A;  2QEN A;  3BJ6 A;  4WXC A;  3ZMV A;  1R7J A;  1KQ0 A;  1SD7 A;  4LB5 A;  1R00 A;  2EFN A;  2GWR A;  1LEB A;  1HW5 A;  1K7A A;  2FBK A;  2A6H F;  3FXR A;  3HRT A;  3Q9V A;  3J80 K;  5CYV A;  2FMY A;  1JXS A;  1ZN2 A;  3IWF A;  1ZRF A;  1ON1 A;  4M9X A;  3QU6 A;  3K69 A;  1IUY A;  5FLX K;  2D1H A;  3GO5 A;  1U5T B;  4YIF A;  1P92 A;  2UXX A;  1KYZ A;  2PQ8 A;  2QLZ A;  3ML6 A;  3JAM Z;  3P9I A;  4BHP A;  2OD5 A;  2K7L A;  4ENN A;  3HRU A;  2V79 A;  5E1Z B;  4U88 A;  2COM A;  2L01 A;  3DKW A;  3LQQ A;  1WWX A;  1ODD A;  3V4G A;  4RGX A;  5HDN A;  4IXA A;  1LDK B;  2F5E A;  3R60 A;  1DP7 P;  3F8F A;  2FXA A;  4UV9 A;  3KFW X;  1H9G A;  2XAQ A;  2W85 A;  4ZYH A;  1J75 A;  2L3D A;  4HX4 A;  5E8G A;  4RGR A;  3WTX C;  1H0M A;  3CUO A;  3FZV A;  5F1R A;  1XD7 A;  4PCQ A;  2FE3 A;  3KP2 A;  2FBI A;  5LBQ A;  5FB2 A;  5ICE A;  4PGH A;  1U5T C;  4EM0 B;  4ZZD A;  4ENK A;  5ICG A;  1HKS A;  4KT5 C;  1IN5 A;  2F2E A;  2VC0 A;  2ZME B;  2QWW A;  2IW5 A;  2BE5 F;  2EB7 A;  3EYY A;  5K5R A;  3WTS C;  4Y17 A;  2DLL A;  5CVU A;  2P5K A;  2P5V A;  3HTU A;  1BM9 A;  2QQ9 A;  2O61 A;  1S3J A;  3W6K B;  1MDM B;  2V6C A;  4I98 B;  5D4S A;  2ESH A;  2E1N A;  5DUK A;  2YR2 A;  3CUQ A;  2HKX A;  1BI0 A;  2STT A;  3RIR A;  3DV8 A;  1O3T A;  2PEX A;  3COA C;  3FMR A;  2RKH A;  2FNA A;  3R0A A;  4DNC A;  2UZK A;  2V1D A;  1BIA A;  2OZU A;  1LDD A;  3KZZ A;  2EJR A;  1V3F A;  5HLH A;  3D5L A;  2YPR A;  1R1T A;  3JTH A;  2V1X A;  3RJP A;  4FX4 A;  3ZPL A;  3K2Z A;  1W5S A;  2XAH A;  2E7W A;  2YX4 A;  3J81 Z;  2H6B A;  4L9N A;  4RB0 A;  2WTE A;  4A2U A;  1F9N A;  2R7D A;  3JAM K;  3E97 A;  3ZQ7 A;  1R23 A;  2O03 A;  1FSE A;  1R58 A;  3GF2 A;  5DEQ A;  2FNP A;  3IHU A;  1ZGJ A;  2Y48 A;  4KFC A;  3WGH A;  2XV4 S;  3I4P A;  5D8L B;  4MHG A;  3F8N A;  5K1Y A;  1O3R A;  4UVC A;  2P6T A;  1XCV A;  5FFX A;  2CW0 F;  1SFE A;  2CFX A;  3HTS B;  5E18 F;  1YIO A;  3P9K A;  2DW4 A;  2A3S A;  3KCC A;  1FPQ A;  1YO5 C;  5A2Q K;  3I5U A;  1CGP A;  3I59 A;  4LG0 A;  1MGT A;  1K78 A;  3ECO A;  2NNY A;  4RAZ A;  3GW2 A;  1OR7 A;  2ZME A;  4EM2 A;  5L3E A;  3I59 B;  4LG0 B;  1R5H A;  1WKM A;  1UB9 A;  1HW2 A;  1UCR A;  2DQL A;  4CDG A;  3HHH A;  1MD0 A;  3KEO A;  1KU3 A;  5ILS A;  3I71 A;  3H92 A;  3K1P A;  2M8E A;  1KU9 A;  3GFJ A;  3WTV C;  2DTR A;  3SZT A;  1ZRC A;  1IAW A;  3K1N A;  1FY7 A;  3DP7 A;  5HLI A;  2CG4 A;  2WV0 A;  2KKO A;  3MCZ A;  1KYW A;  2FOK A;  3E5X A;  2FEZ A;  2D2W A;  3TO9 A;  3RI4 A;  4ESF A;  2MLK A;  4M9Z A;  3SZP A;  1FC3 A;  2PLY A;  2KIM A;  5DV5 A;  2VXZ A;  3HUG A;  2P5L C;  4WXH A;  2ZNZ A;  1Z9C A;  4ZYG A;  3AAF A;  1V4R A;  3ABT A;  1WQ2 A;  3BRO A;  2CQK A;  2HKO A;  4L0Y B;  1D5V A;  1UST A;  1FOK A;  4RB1 A;  5FD5 A;  2HS5 A;  4RB2 C;  3CTA A;  4HX7 A;  3CLO A;  5HS9 A;  3BPV A;  4KDP A;  3VB2 A;  3T0Y A;  1YW8 A;  1LQ1 A;  4HF1 A;  4KIG A;  4WK8 F;  1RUO A;  3GLX A;  1JHH A;  4EGZ A;  1FP1 D;  3M1E A;  3QOP A;  5DCF A;  3GVA A;  3IC7 A;  3RYR A;  4LLN A;  5CVR A;  3L9F A;  2ZXJ A;  3ROU A;  3HSF A;  1F5T A;  1ZRD A;  4Q48 A;  3O2P E;  4LD5 A;  2FML A;  2X4H A;  4HX8 A;  2GA1 A;  1Z1D A;  1R22 A;  4N9I A;  5ILV A;  2BYV E;  1YQA A;  1JHF A;  5LGT A;  3HOS A;  5CJ9 A;  1IN8 A;  3MZH A;  1WSU A;  5HS8 A;  3FM3 A;  3LAP A;  4KNY A;  2P8T A;  3M8F A;  1P6R A;  3R61 A;  3OV8 A;  1ZG3 A;  2NRA C;  2VBY A;  3W6J B;  2VOO A;  3KP3 A;  4M9S A;  4XLN F;  3P7N A;  5BPI A;  4G7O F;  3SHF A;  2L4A A;  4G6Q A;  5J6X A;  4KN7 X;  1REP C;  3U1D A;  2ISY A;  3K9T A;  1ZLK A;  2HQR A;  3EUH A;  1HKQ A;  2M1B A;  2IPQ X;  4OMY A;  2OU2 A;  2EFO A;  4MTD A;  1TNT A;  5JHU A;  5HVQ C;  4ZZL A;  1TBX A;  1HSJ A;  3BPX A;  2A5Y B;  2A61 A;  3F6V A;  1MZB A;  2E1C A;  4ON0 A;  3TOA A;  2ZCW A;  3DXJ F;  2RGV A;  4LB6 B;  2FRH A;  1Z7U A;  1KU2 A;  3DPL C;  3FHZ A;  1OMI A;  1BI2 A;  4I7H A;  3ZMD A;  3EET A;  4RAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...