1NG7A

The solution structure of the soluble domain of poliovirus 3a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Genome polyprotein [Core protein P3A]
publication title Towards an understanding of the poliovirus replication complex: the solution structure of the soluble domain of the poliovirus 3A protein.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 6
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08727 P3A Poliovirus 3A protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.870 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng7A00
1NG7A
chains in the Genus database with same CATH superfamily
3ERMA 2KZGA 1BN5A 2HXIA 2C6YA 3J7AO 1W7PD 1XMAA 2EZHA 2OD5A 1J2XA 3HUGA 2FE3A 3ZQCA 2YU9J 1ETVA 4XN3A 1IRGA 3M1CA 1YOVB 1O3QA 4LB5A 5B1AH 1DU6A 3L09A 1ZRFA 3C3WA 1XSVA 1Z0XA 2UZKA 2R7FA 2W1OA 4L18B 2KT0A 4M73A 3ZMSA 5DD4A 2ZJPF 4BS9A 5H2FC 4KA4A 1MMGA 3IAS2 4F92B 2XGEA 4HDVA 3TO9A 2KLOA 2IGMA 2OZ6A 3HPGA 4KIFA 4P1WA 3MCZA 4MHGA 1K7AA 2GZWA 2VONA 1W4MA 4FCYA 1ZG1A 4IHXA 5GAGJ 5LEJA 2YPRA 1O4XA 3TDUC 1ETXA 4HPQA 2HDDA 3KCCA 2K27A 2E1OA 4Y3OA 1HC8A 2M9HA 1QNTA 2MBFA 2P81A 2PQ8A 2D45A 4QSHA 1YFHA 2HDWA 3M8JA 3RQIA 1P4AA 1YJWI 2HYJA 1QQIA 4LD5A 1TNSA 2DA6A 2AXTC 3GLXA 1JT0A 4ZTJA 2XDVA 1MH4A 1IO2A 4JX5A 2Y31A 3UR3C 2BV6A 2QBYB 3CJQB 4BXXJ 3QRFF 1Z7UA 3DFGA 1HXDA 4LITA 4D7NA 2RQQA 2IA0A 2IS4A 3OYAA 5DUIA 3DU5A 3HGYA 5H6QA 2GWRA 2X48A 1HW5A 4MTDA 3DEEA 1SD7A 3G4SI 5H6RA 3WGHA 1AA7A 1U2WA 5GADJ 2Q2EA 3AKZA 4LGWA 2F4IA 3HL2A 3CMEI 1YLFA 2EPFA 3OSGA 1J9IA 5B3SH 2LOOA 3OV8A 2VE9A 1WQ2A 4D0PA 2H6CA 1X1PA 2OUMA 5IP6A 2NOJB 4HRIA 1O7FA 1QO0D 5LD2C 1Y0UA 3CQZJ 4KIBA 1X3ZB 4JX4A 3COAC 1BR2A 1KGSA 1U6GA 1VQLI 3OYDA 3H3ZA 1MNEA 1A35A 4DQ2A 2WAEA 3LA2A 4LJZF 4DBRA 1R6RA 4YG2F 2DLLA 4BHBA 2VQGA 3DKXA 3S17J 5FLXK 3RQ4A 2MGQA 3A03A 4BJ5C 3ABKH 3S15J 3JAMK 4EJWA 2RN7A 1IJWC 4EM0B 1ZRCA 5J4VA 1W0UA 2HKXA 4BQAA 2RVCA 2TDXA 4MFEA 3G1OA 1LVAA 5E18F 1S7OA 3G3ZA 4E7JA 5E3NA 1FZPB 2QKMB 3FZVA 5JR3A 1WRJA 4N9IA 1ITYA 3BT9A 2OF7A 2N8GA 2Y9ZA 5JVGF 1P9QC 4FE4A 1T8IA 3HRSA 4XORA 2VOPA 1YW9A 4L9TA 5LHIA 2EQRA 1DQUA 2O0YA 2HYGD 3H35A 4Y4RA 3WODF 4U0YA 2CV0A 1IDZA 1TZLA 5KNLA 2MD5A 1XMKA 2R7VA 3K0LA 1PUFA 1WJBA 1Y0NA 5F0FA 1T98A 1Y1WJ 3EETA 3GBGA 3LSHA 4JYKA 1F9NA 2EA4A 1YQAA 5CVRA 3CO7C 3L2WA 1VQKI 3ZMZA 3KYDB 4M6XA 2QQBA 2ZMEB 1ETQA 2V9VA 5E1ZB 4EM2A 3CO6C 4P9UA 2EBIA 2L4MA 1TQMA 2L9RA 1TL8A 3H9GA 3OYHA 4BEHB 3JRHA 3E6DA 3RDIA 3QYEA 2H27A 2VODA 3GZNB 3DKWA 2HU9A 1ZTRA 3PIOF 3LSPA 2OZUA 4TV7A 2IGOA 5EEHA 4S05A 2PJRA 1DGWY 1YO5C 4AC0A 3V42A 3CZ6A 3CCVI 1IC8A 4CYDA 3VODA 5BPDA 3RTRA 1JKQC 2P6TA 3F22A 1Y6IA 2G0EA 3P9KA 4LLLA 1LE8A 4NQWB 2QKLB 2RC4A 3SZTA 4U7BA 3HGGA 3O3KA 5HODA 4OOIA 2O9LA 2JA7J 3FXOA 3SEZA 1W36C 3R6SA 4R1HA 3GF2A 3VYTB 1G59A 2ZXWH 3G73A 2UXNA 3PNTA 1FMWA 1L0OC 1JKOC 1W5TA 2DT6A 5HDKA 3IL2A 1S9HA 3OS0A 2FF4A 2GA2A 2VI6A 3O8HA 2OC6A 4KDPA 1I39A 3CJRB 1SFKA 2X9DA 1S29A 4A3GJ 3FXRA 3LAJA 2JN6A 3GCMA 2HOAA 1R22A 2M0MA 4XIDA 4Y17A 4XOPA 1HDDC 5KCMA 3F8FA 3HDDA 3ECHA 2VC0A 1WH5A 5DCFA 2HTJA 1N25A 4XLNF 1AKHA 3CJNA 3V8JA 1X1BA 4S0HB 1TQPA 4RAYA 4CYCA 4PZJA 1T08B 2L7ZA 5D6FA 4G12A 1GXQA 4O3MA 4C9YA 1J0RA 2NVQJ 3KEOA 1ULYA 1E3HA 2A61A 1YRNA 1B4AA 2BW3B 2M87A 3TP3A 5K5QA 3A0HC 4AIHA 3IWFA 3CCYA 2G7UA 2ZSHB 3HOZJ 1QRYA 1WFXA 4KNYA 2BY1A 3W3CA 2JA8J 1ZLJA 3BR3A 1KYZA 4DOZA 1LFBA 3FISA 4F93B 2VLAA 1ERDA 2MABA 4HLYA 2W57A 4C2MJ 2DMTA 1RNLA 3DBLB 1R5ID 4M9XA 3QOEA 4O5VA 2CGPA 4LK0F 3U1KA 1ZKGA 2NVTJ 1B59A 1D5VA 2P4WA 3GVAA 4PFOA 3K70D 1BI0A 1TWHJ 1WI3A 4OWRB 3JRFA 4WXCA 3JTGA 2QSGX 3CC4I 4HF2A 2A07F 4C3HJ 2DMUA 5D8LB 5HS9A 1YJ9I 2W25A 1K83J 2O8KA 3C18A 5FKNA 4V19K 1YW8A 4HV5A 1FOXA 1ETYA 4ESBA 1FOWA 1VQ9I 2LKPA 3KZIC 1XPXA 2CU7A 3VYUB 2Q0OA 2P8TA 2R3SA 2V9KA 2OBPA 4UUSB 4G6DA 2XF7A 2K3FA 3JREA 3BCBA 4RS8A 4HEA2 2L9NA 3T1BA 2KIQA 3I4MJ 2G9WA 2LVSA 3G1LA 4CZCA 4AUXA 1X3UA 3HSFA 3GTJJ 1JUPA 5E20A 1IDYA 1U5TC 1QGPA 2LD5A 4I02A 4BXFA 4M3DA 1SFUA 3ZQ7A 3KP4A 1SEUA 2GM4A 3OOUA 4PSXA 1L3LA 3NARA 2V4JC 2GXAA 1KQ8A 1LDKB 5D4RA 4BUPA 3P9CA 1BC8C 5HNFA 1Y1VJ 1J5YA 5CYVA 3CDIA 1FX7A 2BZTA 3L2QA 1K6OA 3PFIA 3RIRA 3SQNA 3EQLF 2PMHA 1Q1VA 2D1VA 1IF1A 2Q8KA 4L5IA 5L3CA 4RBOA 4IPAA 2JMWA 4UB6C 2DYSH 2JQ7A 2L7FP 4HX8A 5ILSA 3BJ6A 1IZ1A 2XKPA 3IP4B 3FBNB 1X2MA 3MKYB 3LSTA 2A6HF 3AL0B 5TGTA 3IV5A 2VN2A 2HTSA 2JRTA 4D1QA 3VDXA 4D5FA 1G3YA 2JVGA 4RAZA 1MNMC 3CCEI 2IEKA 2G7HA 2HZDA 2L5QA 1MZBA 1JJ6C 5JLWA 1PDNC 4EATA 3J81K 2Z9OA 3DWLE 2ZNYA 2DI3A 2YX4A 4I0BA 2MLGA 5DV5A 1K4TA 2VPRA 1IUFA 2H8RA 4DBQA 1XGMA 1F43A 2WAFA 3BOQA 5FLXZ 2GQQA 1YI2I 1TWFJ 4QWQA 1VQMI 1FPQA 4UY8I 4XMYA 4PFPA 5GPAA 1ZQ3P 2JSCA 3LAPA 3JAMZ 1ZH5A 3ELKA 1RIOH 3GMEA 3MZHA 2M8GX 4BQOA 2IVMA 3A4CA 2LDUA 1R5HA 1WJAA 3KFWX 4D5CA 1BM9A 4NB5A 4DW6A 4M9SA 3FHZA 2FX0A 4A0ZA 1P92A 1WCMJ 2BEOA 3NRVA 4N9HA 4HSRA 2Z1DA 1T0FA 1LNWA 2NXNB 4XSXF 1U8RA 4LG0A 2FNPA 2CUJA 1ZR4A 3JW4A 3G2BA 1NTCA 4CICA 2PLYA 1T33A 2DFHA 3MAJA 4E7HA 3QP5A 2MLKA 4RAFA 5JHFA 3OYGA 2V1UA 2CW0F 2E7XA 1LDJA 2DU9A 2VT3A 2IXSA 3BG3A 1B8IB 1Z6TA 1FBUA 5IYBJ 2MSYA 4FQGA 1G4DA 1LDDA 1ZG5A 3HSRA 1EJ9A 1D0YA 5FO5A 3BG6A 3R4KA 2BXYA 1BIBA 1ZK8A 2JWTA 4UXNA 2VC1A 3WE3A 3ULQB 4A2UA 2CWEA 3TP0A 2E1NA 2QGUA 1DP3A 3F8NA 5ICEA 1MJ9A 4BBRJ 3HRUA 1T56A 5CVUA 2HXOA 4IXAA 1D0ZA 3HUGB 2XAHA 2QYOA 4LOCA 2DOEA 3CLOA 2VIXA 2WAQN 1D1CA 4ZZDA 3H92A 1SD5A 4HAMA 2AS5F 1WKMA 1BI3A 3F72A 2ZXIA 1I5ZA 4GCVA 4G94A 2ZXHA 5HLTA 3MN2A 3IAM2 3LFUA 2K9LA 3KIOA 1DDNA 3WHBA 3OYFA 3EUKL 3AG4H 5GAHJ 2LREA 3KP3A 3Q0VA 4HZFA 3L2UA 1T95A 2EZLA 5LGNA 1QHGA 3B6CA 2QWWA 5C3EJ 3VPRA 1FMVA 3BR2A 3ZQLA 1FBSA 2QCOA 4CGZA 4FTHA 3R61A 1ZHFA 5H20A 3OYNA 3KEQA 1P6RA 2QEXI 3K70C 1ZLKA 4M3EA 4OU0A 3VOEA 3B02A 1Z3XA 3BY6A 4WWCA 2ESNA 2BHYA 4UHTA 3GFLA 4HSTA 1ZREA 3AAFA 1I6XA 1MMAA 3HBLA 1LJ9A 4P9FA 4Q4ZF 1USTA 3SJMA 1P4WA 1XGNA 2VT2A 5A2QK 2Q2EB 3D5SC 4CO8A 5IPAA 3GTOJ 2OTLI 5ILUA 2J5PA 2PG4A 4A3MJ 5EZGA 5HNHA 4BYYA 3IRRA 2R5YA 3RI4A 3F8BA 3GZ6A 1QVUA 1HDPA 3ZXSA 1OCTC 2ICWG 1MKMA 2EK5A 3GEZA 1OR7A 3M7GA 4R79A 4ENJA 1JHFA 2QSFX 3CESA 3RKWA 2GXGA 2A68F 2BY3A 3GO5A 2IW5A 1OR7C 5FB2A 3RSNA 4EQQA 4HDUA 1R1TA 1FJLA 3EDPA 4EJUA 4ESJA 2XROA 4RDUA 4GYIA 2Z16A 2ZFWA 5F64A 6PAXA 4I76A 4DYQA 4AWXB 5CLSA 4XN0A 3QQAA 3V7CA 3WG9A 2GOMA 1X2NA 4ITVA 1WJDA 4B44A 4ZDPA 3ZPLA 5F1RA 2CO5A 5CQEA 2LR8A 3HOYJ 1IXSB 1EA3A 2GOXB 2EFNA 3HOXJ 2KFDA 2JJ7A 3FDYA 3EPZA 1BOAA 2IA1A 3RPQA 3S2WA 3LQRA 2OV7A 5LBQA 3PIPF 4GXOA 3HM5A 4BE2A 5ILVA 3U9GA 1YYVA 2IBDA 2W84A 3HTUA 4DYRA 3R0AA 1RESA 1Z9CA 1PUFB 4G6TB 4AVPA 3WTXC 2VKVA 1BL0A 5B1BH 1HLVA 5J1RA 3RCOA 1FBQA 3PUBA 1MGTA 2LK2A 3IC7A 4Q5SF 2JA2A 2R7WA 3GTGJ 1DGRM 4M9ZA 5LGTA 2EZIA 1V4RA 3E3VA 2XAUA 2R5ZA 2FU4A 4Y15A 2DODA 1FWZA 4IQJA 3WU2C 3Q3SA 2FOKA 3ZGKA 4H0EA 4EJVA 2ELHA 2XAQA 3A02A 2AO9A 2XRLA 2IS2A 4NC6A 1B1BA 2RNGA 4RLQA 3T8RA 2PJRB 4XRMA 2UWMA 2KKOA 2F5DA 3PNYA 2HKOA 3ZOBA 4BHPA 4U87A 2W7NA 1RR8C 1UZCA 2LH9A 1XGSA 3GXOA 4B4CA 1MDMA 3BPXA 3K2AA 3PNVA 3MKZA 3LSKA 2KDOA 1BJAA 1KU7A 2DW4A 2VBYA 1E2XA 3F23A 4XL9A 4IJAA 4MLOA 4AYBN 3T0YA 2VBWA 2ZCWA 3RKQA 4LLNA 5C4XJ 3D5LA 3ZMVA 3BR1A 2K85A 1S8NA 3SXYA 3RZOJ 1FTZA 2WADA 1BOBA 3GTMJ 3LSIA 2LTPA 3GTPJ 3J81Z 2MA3A 5IOYA 3FK7A 4YIRX 2ELKA 1CF7A 9ANTA 2DA4A 2A5WA 4NNJA 3WGIA 1HCRA 3W6KB 2DAOA 4A5MA 3BG7A 5LGUA 4IO9F 1MMDA 1W7PB 3TO7A 4BKXA 5KVRA 2L9SA 2XV4S 3FM5A 2HVRA 4Y33A 5EYRA 3S8PA 2H8WA 2F5VA 4A3LJ 1IRZA 2HQNA 2GBYA 2X51A 4CYCB 3OMYA 4IF4A 5D4SA 3QWLA 4I01A 4BBSJ 3IKTA 4G7OF 2QQ8A 1LFUP 2O6GE 5EEGA 2E60A 2HPIA 4DJAA 1YRNB 2XB0X 3OSFA 1OQYA 4C2TA 2DA7A 4PJLA 1V55H 4JX6A 3E5XA 1U3EM 3A0BC 3ESWB 2KDZA 1C0WA 2OAZA 4N4OB 2YUSA 2W4SA 2JRMA 1TWAJ 4IHSA 1FSHA 2XC7A 3K1NA 1AHDP 3S3OA 2DN0A 3HXLA 5D5UB 1GT0C 4NC7A 1ETKA 3ZQGA 2HEOA 3K9TA 5IP9J 1ZGJA 2KRFA 2WB1N 1KA8A 1OPCA 2DDAA 2K4BA 2WA0A 3K4LA 1E3PA 4IOCF 2M2EA 2L4AA 2X6OA 3ZMDA 3E6BA 4CH7A 4RLFA 5LEKA 4DIQA 1BR4A 2L2OA 4B1RA 4C30A 2EV0A 4LIUA 5EF6A 1A6QA 2ID3A 2GIZA 3FHNA 5KAIC 2DA2A 3ASOH 3BLYA 4YIIA 2E1MC 2H1LA 1APLC 4BL0B 4A0XA 3I64A 3EUHA 2CV1A 2E34A 4M6YA 3S32A 2XASA 3B73A 1LVKA 1U5TB 3EUHC 1GLNA 3LQQA 4PSWA 4P5OA 1WGXA 4XLHA 3C7JA 3FWEA 5DCMA 2IPQX 3KP6A 4RB0A 3DTIA 2H94A 1HSTA 3IH4A 3Q9SA 2XUBA 1MIJA 2X4HA 3J80K 2DQLA 5CJ9A 5ERIA 4XKVA 4XONA 1R9TJ 2GIVA 2YR2A 3I59A 2R7UA 1EKEA 1X1DA 3M4OJ 3VSKA 3HC7A 2LYCA 1ZAOA 2AHQA 4I98B 2NVUB 3NAUA 2XSJC 5K1YA 3FMRA 4PCQA 1X4PA 4PJMA 2R7TA 3CF5F 3KLOA 1BI2A 3PUFA 2Z3YA 3K10A 1YS7A 2JTVA 3JRCA 3CP8A 5A2QZ 5K5RA 4B3AA 1UG0A 3WTUC 2OJED 3MZYA 2V9PA 5E3LA 3MQ0A 3J7YJ 5EG0A 3L7WA 4RMNA 5CVVA 3ZRGA 1K61A 2JPBA 2AQFA 5IOZA 1HF0A 3ZN0A 3M3YJ 2H09A 3CCSI 3CCUI 1AOYA 1GHCA 4GRIA 4KT5C 1XG1A 3DEUA 1HSJA 5GP9A 1F4KA 1IXRC 2ISYA 2M45A 3FXMA 4HOBA 3W6JB 4ENNA 3D5RC 3L1PA 1SAXA 4OIOF 4MIMA 1V3FA 4HNVA 3FIWA 4XLFA 5FLVA 4F7ZA 3MZ8A 2ZJQF 3CCQI 5HVQC 1OYWA 2AXLA 3M07A 2BYVE 4L9JA 2FBIA 2VJ5A 4W1UA 1V54H 1BIAA 5BS6A 2HVSA 4BE1A 2BY0A 5E1XA 1FYLA 2HI3A 2UUZA 1M1EB 2OQGA 5AIPA 5C44J 1VQ6I 1NH3A 1ZGAA 3TQNA 3K4JA 3CCJI 1PUEE 5FRMA 4E7SA 1RUOA 2CQXA 3QYFA 1SD6A 1U9NA 4EJOA 3A01A 2FD5A 2PMZA 1FIAA 4UVCA 3I71A 5E3MA 4BDYA 5M5WJ 3HZJA 1Y39A 3DLLF 2M0CA 2A05A 3QU6A 4L5EA 4F3QA 3LA3A 1ETOA 3T8TA 2YX7A 2XGDA 3DPLC 2R7XA 1RRJA 2F5FA 4BAYA 2FXAA 1TC3C 5KK1A 1X3WB 1KQ0A 3HOSA 5M5XJ 1TQIA 2ZFUA 5FFZA 5B66C 2NS7A 2KL4A 3ROUA 3QPTA 1TWGJ 5DDGA 1G3WA 3QYBA 2HOEA 2F5CA 1OJLA 4P55A 3OOPA 2X1EA 1V5FA 4LIVA 2B0LA 2CUFA 1Z67A 3K1PA 3K2ZA 2Y9YA 1HKSA 2NAZA 4L5JA 3ZQHA 1VQ4I 1JUSA 3LA7A 3SEQA 2EV5A 2V1NA 1B9MA 1I3AA 2TCTA 4PK4A 1O3TA 1IV8A 1BW6A 1ON2A 2DO7A 2XRNA 2HPMA 1GVDA 2X1CA 2ME6A 2KISA 2VOOA 3LSMA 3SDBA 4UNOA 2NVXJ 4BJTA 2O61A 2ZJ2A 3HKZN 5C4JJ 1UCRA 4A5NA 1R23A 3OYBA 4I0AA 1O3SA 2IAIA 1F1ZA 3CUQA 3AFHA 1VQOI 1J59A 4HF1A 4DNCA 4II3A 4KICA 2L54A 5LFAA 5IT9K 3FXJA 1Y56A 2RQPA 2WY8Q 3CUQC 3FF5A 2CMPA 4WK8F 1T38A 5LHHA 4A3IJ 4G6QA 2CSOA 2A3SA 1GDTA 4AYBA 2DMQA 1SFOJ 2XSDC 4KT6A 2Y0SN 4U88A 4V2GA 4M3GA 2CQQA 2DA3A 3H5RA 3OYMA 1WI9A 2DMPA 2DTZA 1MH3A 1EH6A 3ASNH 1TT5B 1OCOH 2NYXA 4BHCA 4NHJA 2LFBA 3DXJF 2H6BA 2ZJRF 4EGYA 1RKTA 4IVNA 2IGKA 4C2UA 1STZA 4XK4A 3LSRA 3H0DA 3IKVA 2D2WA 2L01A 2PX9A 4HW0A 5J6XA 1MMNA 2R7DA 4MFDA 1QZEA 2WBMA 1SMTA 4YELA 3RKYA 5J1UA 2O8XA 2ECBA 2CH0A 2JT1A 4O6JA 3F6VA 3PFYA 3KE2A 3PSIA 1FP2A 1QPMA 2Y75A 3BQYA 2E7WA 5D6EA 4D7MA 1LEBA 3BTIA 4AM3A 5IT3A 1AU7A 2CFXA 5IP7J 3DKYA 2ZMEA 3S1RJ 2CUZA 3VYSB 2GA1A 5L3GA 2M4KA 2CJJA 2MD0A 4LB6B 2B63J 1YIJI 1E17A 2QENA 3KYLA 1XTAA 2PI0A 1UB9A 2FRHA 4M3FA 5IY5H 4WCGA 3S2HJ 3K1MA 2XKOA 2DT7B 4RAGA 1XGOA 2XB5A 1MBGA 3QP6A 4YFKF 2A6EF 2WC2A 1XSDA 3H0GJ 3DTEA 2FQ3A 3N97A 1GV2A 4E7IA 1A31A 4MEYF 3ABTA 1U78A 4RM2A 1QBJA 4GO1A 2MFZA 5L3BA 2V1DA 2LRDA 4LG3A 2LF7A 3EYYA 4WF2A 2Y2ZA 1JJ8C 3KX2A 4XLPF 5GTHC 2K5CA 3BG5A 2LBFA 1G3SA 3TMOA 1FIPA 3WTWC 5E1WA 4IOAF 2OCEA 2KRCA 3BZ6A 3PM1A 4CCKA 4M6VA 3WTSC 3BPVA 5F04A 2F4MB 1USSA 1NG7A 4RGXA 5DUKA 1MBEA 5E3OA 1J09A 1D1AA 2XIGA 4CCNA 2W48A 1K79A 2E5ZA 2VXZA 1T0FC 2HQAA 4K2EA 1VQPI 2O03A 3FXLA 1NK2P 3MMYB 2WWYA 2R5ZB 4JBAA 3OS1A 1RKWA 2DOFA 2ELJA 5BQTA 4XQFA 3J80Z 2VQLA 4OAYA 1RPWA 2VL8A 3CCLI 2KIMA 2MC3A 4LMYA 4IRGA 2DYRH 1HBXG 5LRRA 3VB2A 2ZC2A 1CGPA 2D5VA 3I5UA 3OR1C 2COMA 3CTAA 3J7ZI 3OYEA 2FJ1A 1ZELA 3ISPA 3TBIA 1REPC 4XR6A 3P7NA 1JT6A 1R4NB 4HG2A 4BY1J 5F27A 4A0YA 2GAUA 4B8XA 4LFUA 2VQHA 1NK3P 1XB4A 2KJCA 2RV8A 2DFEA 1HKQA 3TOAA 1MBHA 2ZNZA 2PEXA 3GW2A 2BW3A 1T39A 3CC7I 3KP2A 5JFRA 3OYIA 4Y7NJ 1TBXA 4XLEA 2OTJI 2LY1A 4ZC3A 2R7RA 4HA8A 3BR5A 1BJZA 2Z99A 4B48A 3GTQJ 2VXDA 3S16J 3RKXA 3BJOA 2ZO4A 2LC2A 3PSFA 4Z2YA 5FFXA 3OS2A 2FBHA 3CCMI 3HRTA 3ZMTA 3F0CA 5J4YA 1D1BA 2L7MP 4AIJA 2EILH 3DPTA 1XS9A 5KHDA 2DFIA 3K4KA 1UJ8A 3FM3A 4KUMA 1IRXA 3BZKA 2CQNA 1R00A 1IUYA 3TW7A 1FOYA 2LY2A 4KIGA 2QQ9A 1RR7A 4CCLA 4U0WA 4CCJA 4I6ZA 1TLHB 3IWZA 3JRDA 2YU3A 4QPOA 4E7LA 3VWBA 2IJLA 5FKMA 5DTDA 1UAAA 1RZ4A 5BNGA 1F5TA 2MYSA 4HNUA 2LMDA 2B7EA 2P0WA 2XAGA 4KISA 3PQKA 2I10A 2X1DA 3E5QA 2CW7A 2KIUA 2LY9A 5DEQA 3V7RA 2BVLA 3JSOA 1YTYA 3WU1B 1BC7C 1IN6A 1G3TA 1XCBA 2XGCA 1PP8F 3M1EA 3IH3A 2R0QC 4BGDA 4HLXA 1IRFA 1R58A 4II2A 4UB8C 3FX3A 2CS3A 3CC2I 4NBQA 1JHHA 1S7AA 1E3OC 2CQKA 4YRVA 3SFIA 2LLKA 2EIKH 2P5KA 1SANA 5CVIA 4EEFG 5ED4A 3BG9A 1K78A 2KIFA 4Y52J 5HLGA 2MW8A 4F91B 5TJJA 1N78A 4QTRA 1R4MB 3ZMUA 2QVOA 1MBFA 3MEXA 3HG9A 2Y30A 4B3XA 2DT5A 4J01A 1NHAA 3I4PA 3RPUA 1JKRC 1YITI 4PJJA 4AU7A 3K69A 4LK1F 4XSZF 4ZH4F 2W82A 4BQNA 1QZYA 2K9QA 2X0LA 4M72A 3HRMA 2CW8A 3DBHB 1D8KA 5K7ZA 1FYMA 3HOTA 3V8KA 1QZZA 1HA8A 2E1MB 2P6SA 4XKWA 1TWCJ 3V7SA 2V6EA 5DYMA 5IT9Z 3ERED 5CQGA 3GZ5A 2R4GA 3S2DJ 3MKLA 3K7AJ 4KJZA 4EM1A 2VQCA 2FA5A 1X1CA 4HV6A 1SC7A 3CJTB 2CG4A 2P5VA 4C3JJ 4CCOA 1WH7A 2K86A 1OLTA 2EFOA 3PO3J 4ABZA 4GFBA 1OISA 4EV0A 1ENHA 3CD6I 4MQ9F 1J75A 2VPLA 3WU0A 5DCMB 5E8GA 5GPCA 2EA2A 3DTKA 4WXDA 3X2QH 1ORKA 4S04A 2X6WA 4HF0A 3I54A 4V2FA 3VYRB 4FHTA 5EEAA 1IN5A 5AIQA 1SD4A 3F8CA 4J19A 4CHUA 3H5NA 3I59B 3H3VK 3H9QA 4PJNA 2QM3A 2CQ7A 2STTA 1KYWA 4OIQF 5L3FA 4G7ZF 2R7QA 1FOKA 2COBA 1Z6RA 5HS7A 3SYTA 1KONA 2X85A 3FKJA 5BOXA 1PYVA 4ZTFA 2K02A 2BY2A 1XCVA 1KU3A 5HOOA 4HQEA 2VUMJ 1R5GA 3JRAA 1FLIA 2L0KA 1HQCA 4KMUX 1Z77A 2HOSA 1N75A 4PUSA 3H9JA 5EG0B 1I1SA 2F2EA 1RUNA 3JR9A 4JOMA 3LWFA 3JTHA 2M5WA 4HBLA 2EWNA 2XAJA 1WVRA 4FETA 3JRBA 2IS6A 2XF5A 4AD9A 3GWZA 3RZDJ 5M3FJ 1SVMA 5FKLA 3S93A 2VASA 2ZXJA 3K4MA 1SFXA 3BTJA 2EIJH 4FT8A 1LE8B 1B8IA 1LPQA 4DZJA 4E7KA 3OL3A 3FK6A 1MW7A 5FRNA 1KQ9A 2HYFA 3WE2A 1U9OA 1VF9A 3U1DA 4OMYA 2Z33A 1HKTA 1EV7A 1JTYA 2BHZA 5EGOA 2J5OA 1HW2A 4I7HA 2FMYA 3H1CA 3E7LA 2TRTA 3LL7A 1LKXA 3R60A 2GXBA 3S1MJ 1V5GA 3BTLA 1YX5A 2M34A 1Y8RB 4ZDOA 3A01B 1ACIA 3K4CA 2FNAA 4AIKA 2CV2A 1YE9A 4IQ4A 2BBYA 4CDGA 3WTYC 2JPCA 2K9SA 2BE5F 4ESFA 2EJRA 2B9SA 1SAUA 1XC5A 4A3DJ 1OFCX 1KU9A 3I56I 1W1WE 2WV0A 3CCRI 3KP7A 5LHGA 2V6CA 3FMQA 3LFKA 3MFKA 3DQVC 3V8LA 1DP7P 5ICGA 1AKHB 1IG7A 3R0JA 2XAFA 1GV5A 3I58A 1QU3A 1J7KA 2GLOA 3G6EI 2HNHA 3I53A 2EB7A 3I0TA 4AVZA 1IN8A 2ZKZA 4HYEA 1IV6A 1FYKA 1EF4A 4RB3C 1VQ7I 5F0HA 2L02A 1N77A 5E79C 1T2KA 2H1KA 1TW2A 3AG1H 2HS5A 2BXZA 5M3MJ 4P96A 3W2AA 4XOTA 4JQFA 3CMYA 1UHWA 2I5UA 3ZN1A 5AONA 3C1DA 2ESHA 1UHMA 2XGXA 2O7OA 1JI8A 3TL4X 1B72A 3MVPA 4HNTA 2Z2SB 2HGCA 2FBKA 4LLGF 1GUUA 3I55I 5JI6A 2HQRA 3CUQB 4ZDLA 4ZYAA 4PDKA 4YFXF 3CMMA 1IW7F 2LG4A 3TGNA 3MWMA 2JK3A 1R36A 2LKSA 3KZYA 4XNFA 3ZCOA 5B5EC 1XDUA 4B09A 2A5YB 2V26A 3F9KA 1FC3A 2M7BA 3BQZA 3WHCA 3OIOA 2WTEA 4EMSA 4XKBA 1DPUA 2E71A 1P7IA 2K9NA 4CA0A 5J47A 4QPQA 4IHTA 1U0JA 4IL6C 2RKHA 4YEJA 1MBJA 2LF8A 2WAQA 1BR1A 3J7AY 2L3DA 2E2HJ 2X6XA 2E2IJ 1Z05A 2M3AA 2NOGA 4ZZLA 5FJ8J 1WSUA 1H88C 1JGGA 4E6KG 4BY7J 1FEXA 2HZTA 3FXUA 2YS9A 3HYIA 1TP4A 1Z21A 4XLAA 5K7FA 5M5YJ 1O57A 5L3DA 3HHHA 3LNQA 2E2JJ 3N05A 3C2GA 3M8EA 1ZG3A 4RGUA 1DU0A 1XX5A 1TW3A 4X0GA 4OIPF 4ZYEA 2M7AA 3KP5A 1QHHD 1SFEA 1FP1D 1GVJA 5F0CA 5D5XB 3I4NJ 2E19A 2RNJA 1SVOA 1YS6A 4BJ6C 4XRFA 2KPMA 3FXQA 2DK8A 5TISC 4ENKA 3ABUA 3S3NA 2R93J 4RGSA 1X1AA 1YW7A 2KZVA 3OY9A 2CYYA 3N4MA 4OAZA 2ECCA 4CXFA 1QPIA 1S5LC 2V79A 3A2KA 1HOMA 4IKFA 4CUGA 5ICCA 3WGGA 3FBIB 2XF6A 3QOPA 3DP7A 4XLCA 3M9AA 2ETHA 5K5OA 1BBYA 1VZ0A 2ADUA 4F55A 3BJAA 2Y48A 3U2RA 4ASNA 4Q47A 4E4HA 4M3BA 4XICA 3QODA 3F6OA 2LNBA 2DA5A 4A3JJ 2IRFG 4ETSA 4KMFA 3E1SA 1JGSA 3HIFA 1OCZH 3I3LA 4A12A 3G71I 2V7FA 4BNCA 4A3CJ 4G9YA 2VBZA 2VJ4A 3LMMA 3E6CC 4UVAA 3L2RA 2E35A 4UVBA 5F08A 2DXIA 2LKXA 1OKRA 2NNNA 2NNYA 3BTCA 1A6IA 2JZYA 1JTXA 4QLCU 4EVIA 5EDNA 3JRGA 2CRGA 1A36A 4BU2A 5BPIA 2MC4A 1I27A 3QU3A 3T5XA 2LBFB 3BCAA 2EH3A 3SZGA 3QPHA 1VI0A 1R1VA 1I6HJ 3CDHA 4NDLA 2KMUA 4FX0A 4A93J 3Q5FA 5E17F 2F6CA 1F36A 2MG4A 5FKOA 2XPWA 4WXHA 3MD2A 2QA4I 2IT0A 3BZCA 5JVTA 4LG0B 5DD8A 5K7HA 1R7JA 3VSLA 4ANJA 4L9NA 3ZQQA 2EFPA 4BDZA 1H8AC 2A6TA 3DV8A 4MNUA 5FKKA 2PJPA 5J3LA 2OPTA 3E97A 4CSWA 1I1GA 1MJAA 1W7PA 1G2HA 2O3FA 4R8HA 3TKYA 2EINH 2XPUA 1CQTA 4ZYGA 1BA5A 4X6AJ 1YX3A 3PQJA 4M74A 3K4NA 5HLIA 1KU2A 2QBYA 1W5CC 2DTRA 4GGGA 3BDDA 4WX9A 3FKIJ 2RGVA 3P9IA 3ZP5A 4GYGA 4RB2C 3Q0UA 1FY7A 2DOAA 5HS8A 1LB2A 2OQRA 1Z91A 1XDSA 2KRHA 3OR2C 2QUFA 2EFWA 1Z3YA 2NRAC 5EZHA 3F21A 2D1HA 1OYIA 4ON0A 5J8FA 3E0JB 4FASD 3IUOA 4UV9A 3DBRB 3GLLA 4F52A 2OCCH 4N4NB 3OIPA 1GXPA 1YG2A 1MNDA 5GTIC 2DA1A 3U21A 2IP2A 4EGZA 5HDNA 1VTNC 3TW6A 2EFQA 1A5JA 2L9VA 3KLNA 5CVJA 1XSXA 3F8MA 5CKTA 4MTEA 4ZYHA 1VQ5I 2P7VB 2HQ5A 3L2CA 1HW1A 2O5RA 4G8XA 4BQQA 4IX7A 4Y13A 2FMLA 2A69F 2M4GA 2VKDA 4Z6YA 4YFNF 2ISZA 4HX7A 1YJNI 4OMZA 3B6AA 1LEAA 3C2HA 5F6FA 4C3IJ 2VKHA 3PJRA 1Z1DA 1P4XA 3CUOA 4IRHA 3KEYA 3TO6A 4X1EA 2CFOA 3RPUD 4BACA 2P7CB 3HOVJ 3HOUJ 2R7OA 3E6MA 1FT9A 1U5TA 2IGNA 5JLXA 1W5SA 4G7HF 4XM3A 1X4OA 2R5YB 3HJEA 4A6DA 1WJFA 1S7EA 2X6YA 3QPSA 4XRSA 1K78B 1MMSA 5LRSA 2AQEA 3VFZA 1SMYF 3QPLA 3NWTA 1DPRA 2F48A 1O3RA 4DGWB 1I50J 3TEDA 1ZARA 2HR3A 4UUTA 2L7KA 3NEUA 4FISA 2IS1A 3CDLA 1JE8A 3HPHA 1RC9A 2W24A 4YIFA 3S1NJ 2EIMH 3BP8A 3KZZA 2BGCA 2ZMEC 1WPKA 2BOLA 3H36A 4NUBA 3ZR8X 3AG3H 3ONQA 3WTTC 1OCCH 4BEHA 2M1BA 1EH8A 4A3EJ 1W0TA 2QQAA 1IN4A 3IH2A 2WB1A 3K4BA 1VQNI 2DQRA 2JA5J 3GFMA 3LOCA 2DPUA 3G1MA 5TRDA 3ECOA 1KZHA 4IRIA 2NVYJ 2VKEA 3ZQIA 3OL4A 2DFFA 3DEWA 2RDPA 3O8GA 1MSFC 2EV6A 5KAFC 3K6GA 1VQ8I 2QSHX 4XKCA 4PGHA 1JXSA 1UMQA 2FOWA 4KFCA 3WG7H 1RETA 3W6VA 4A3BJ 2DMNA 4NQWA 2UXXA 2K7LA 5GAEJ 2PMUA 3KYCB 1Z7LA 4L0ZB 1IXCA 3REOA 4IZZA 2QLZA 2DBBA 4A6EA 1ON1A 3OYCA 3RYRA 5L3EA 2ZSIB 4RA2A 3KPHA 2LP0A 3UNGC 2DCEA 1MJBA 1LFPA 1ETWA 2EZKA 4MGRA 3EYIA 3SFZA 4A69C 2OU2A 2FUG2 3O2PE 2YSRA 1UFMA 3CP2A 3H5AA 2Y69H 2WV1A 3F3XA 5FLMJ 1A04A 2ZBKA 1B9NA 1XN7A 1T6SA 4HX4A 3H3UA 1H9TA 1WWXA 1IGNA 3GUDA 3P5JA 3WTZA 2K3PA 4BE0A 2F5EA 2K4JA 1TT0A 4W97A 1JKPC 3S14J 2ACJA 2R7SA 3IRQA 1R1UA 2IA2A 2XHKA 1LQ1A 2HVQA 4NC8A 2M30A 3GX4X 1UG2A 1G8XA 5DM6F 2PN6A 4OINF 1MDMB 4KITB 3TOBA 1H0MA 4GDFA 2V1XA 3Q9VA 5D5VB 2JSPA 5CPRB 3HTSB 1B6AA 5IYCJ 2P5LC 1IN7A 4A3KJ 3BR6A 2W85A 2FEZA 5EGOB 2KP6A 3OIQA 1ODDA 3MKWB 1ZRDA 1VNDA 2JA6J 1OCPA 4L9VA 2F4OB 2PBIA 1MD0A 4XRSG 3HB9A 1AWCA 2DPDA 1CF7B 3JCUC 2RREA 1FTTA 2W00A 3DLAA 4B43A 2LSOA 1RI7A 1POGA 4FE7A 4MQVA 3OYKA 5BMZA 4IHYA 3W2VA 4E7ZA 3HEFA 1UELB 1UHSA 4U7DA 3HSEA 5F1JA 1MSEC 3O6BB 5FROA 4PGGA 3ABLH 3PL8A 3UKGA 2JUCA 4MEXF 2PFBA 4UV8A 2UV1A 5JHUA 1BI1A 1I3QJ 2ME0A 2RAEA 3BROA 1YIOA 2MH2A 3CLQA 4RM3A 1X19A 5LLQA 5J40A 3WTVC 1X58A 4U0VA 4PJ0C 3GFIA 4MO7A 1PP7U 3OYLA 3L2VA 1S6LA 1D8JA 4UUSA 5J1YA 2HDCA 1E0EA 4DYCA 1QVTA 5D8KB 1WHUA 4B47A 3GFJA 1H9GA 1VFCA 1PJRA 3QAHA 4AIDA 3RYPA 2OA4A 2NS0A 3E5UA 2VB6A 1ZR2A 4JK1X 1P7JA 2XPVA 3W2WA 3D0SA 1WZ2A 1OYYA 2MH9A 1R71A 1WJEA 3CMAI 4J00A 5DS9A 3DCFA 2R92J 3BC8A 1B72B 3GTLJ 1H89C 3LSGA 1FSEA 1MBKA 2R7ZJ 1EH7A 3L9FA 1XMXA 4FX4A 2QZ8A 4N0BA 1ONVA 3TDZC 4DZPA 2KHMA 4I09A 1U8BA 4CZZA 3BWGA 3DPUA 4D9JA 3KETA 2NS8A 2HFHA 3JRIA 3HKZA 3GYHX 3D1NI 1LUJB 4Q48A 2Y0MA 3SHFA 1YHQI 1G6NA 4RB1A 1R49A 2ZB9A 5IYDJ 1WJ5A 3S1QJ 4EJTA 1OMIA 4CCMA 2JVHA 4IHVA 4ZJZA 1NG6A 2CUEA 3ML6A 4JP0A 3RJPA 3OYJA 5HLHA 3AG2H 1ZN2A 3DU6A 3OWTA 3AL0C 1WJCA 1D5YA 2VE8A 4I99C 1IAWA 3SZPA 5FGMA 3NWSA 4KYWA 2E36A 2JUGA 4KN7X 2Y0SA 4M71A 1SVLA 2I8DA 2Z5UA 3NQOA 5DM7F 2PMZN 3DF8A 1D3YA 3ZQFA 4XBFA 5FD5A 5J8CA 1OCRH 2XVCA 2VJJA 1D0XA 2DJIA 4H4KC 3FXKA 5EJCA 2ID6A 4IEJA 4E70A 3VEPA 1K4SA 2FQ4A 1P2FA 4OIRF 2HOTA 4A3FJ 1S3JA 2M8EA 1K6YA 2WY7Q 2E1CA 2K40A 3V4GA 1XD7A 1Q1HA 2QF7A 3HOWJ 3FMSA 2VJIA 3L00A 3ABMH 3PO2J 4QIWN 3CF2A 1TNTA 2DDBA 3Q0WA 4IHWA 3EUAA 4ENMA 1BW5A 2HWVA 1Y8QB 2BVMA 2DK5A 2K9MA 2KJBA 4HQMA 4ZYDA 2DJNA 3I9V2 1O7LA 3S3MA 1V5EA 5E8IA 3C2BA 3LSJA 1JUMA 3HHGA 3JSPA 2STWA 3A1YA 5FD6A 1TTYA 4BXUA 1W36D 1ZGWA 4KN4X 3IHUA 1FNNA 2KQRA 4BH9A 5D5WB 1DUXC 4I2OA 4UUVA 3GTKJ 1S72I 3SDGA 3BR0A 4L0YB 1PVEA 2VBXA 5HDGA 5ICFA 3M8FA 4RGRA 1ZYRF 2E5NA 1QA6A 2Q1ZB 2FSWA
chains in the Genus database with same CATH topology
1VZ0A 3OYFA 3EUKL 4F55A 2LREA 3H0DA 4E4HA 1T95A 3L2UA 1MMNA 1QHGA 3QODA 2WBMA 4YELA 3E1SA 1FMVA 3I3LA 4XN3A 2V7FA 3M1CA 2CH0A 2VJ4A 3LMMA 3PFYA 3OYNA 2W1OA 3L2RA 3PSIA 3K70C 2DXIA 4BS9A 1MMGA 1Z3XA 3IAS2 4F92B 2KLOA 2IGMA 3HPGA 4P1WA 3DKYA 4HSTA 2CUZA 1MMAA 4HPQA 4BU2A 4Y3OA 3VYSB 2M4KA 2MD0A 2MC4A 2Q2EB 3D5SC 2LBFB 3KYLA 3BCAA 2HDWA 3M8JA 3SZGA 5HNHA 2KMUA 2DT7B 4ZTJA 2XDVA 2F6CA 3UR3C 3ZXSA 3MD2A 3CJQB 3DTEA 4LITA 2IS4A 2RQQA 4R79A 3OYAA 3CESA 3DU5A 4E7IA 3VSLA 4ANJA 4RM2A 3ZQQA 4BDZA 3DEEA 1OR7C 2MFZA 2A6TA 3RSNA 2LRDA 4LG3A 1AA7A 4CSWA 3KX2A 2K5CA 2LBFA 3AKZA 2F4IA 3TMOA 3HL2A 2Z16A 2LOOA 2KRCA 4CCKA 4XN0A 1YX3A 2OUMA 2NOJB 4HRIA 2GOMA 1NG7A 3K4NA 4ITVA 1WJDA 1J09A 1D1AA 4B44A 4CCNA 2E5ZA 2VXZA 1T0FC 2HQAA 4ZDPA 5CQEA 5LD2C 3MMYB 1EA3A 2GOXB 3OS1A 2DOAA 2ELJA 1BR2A 4XQFA 2VQLA 4OAYA 2VL8A 3OYDA 3FDYA 3EPZA 2KRHA 1MNEA 2OV7A 3OR2C 2WAEA 1Z3YA 4BE2A 4DBRA 1R6RA 2VQGA 3DKXA 3OR1C 4G6TB 3RQ4A 3OYEA 1ZELA 3TBIA 4BJ5C 4XR6A 3RCOA 3PUBA 3E0JB 4FASD 4HG2A 2JA2A 2R7WA 3IUOA 4E7JA 1DGRM 4F52A 2QKMB 2VQHA 4N4NB 3OIPA 2XAUA 1MNDA 3U21A 1P9QC 2BW3A 4XORA 4IQJA 4Y4RA 1DQUA 3OYIA 3H35A 2CV0A 3ZGKA 5CKTA 4XLEA 2LY1A 4ZC3A 2R7RA 1TZLA 5KNLA 2IS2A 2R7VA 2O5RA 4B48A 4BQQA 4IX7A 2M4GA 2VXDA 1WJBA 2VKDA 2RNGA 2LC2A 3GBGA 3LSHA 3PSFA 4RLQA 3OS2A 2PJRB 2UWMA 1D1BA 3C2HA 3PNYA 3L2WA 2VKHA 3DPTA 3PJRA 5KHDA 4U87A 3K4KA 2W7NA 3KEYA 1IRXA 2CFOA 2LH9A 3RPUD 4BACA 2R7OA 2LY2A 3PNVA 3MKZA 3LSKA 2KDOA 2IGNA 4CCLA 4XM3A 3H9GA 4CCJA 4BEHB 1X4OA 3OYHA 3VWBA 3QYEA 4QPOA 4XL9A 4E7LA 4MLOA 2HU9A 1WJFA 3D5LA 1UAAA 2X6YA 2AQEA 2WADA 2MYSA 3NWTA 1BOBA 4HNUA 4DGWB 2IGOA 3LSIA 2P0WA 2PJRA 1DGWY 4KISA 2L7KA 2IS1A 3V42A 2X1DA 2A5WA 2CW7A 4NNJA 3CZ6A 2BVLA 3HPHA 3BG7A 4BGDA 1MMDA 3RTRA 1Y6IA 2L9SA 2BOLA 4II2A 4NUBA 3ZR8X 2CS3A 4NQWB 3ONQA 2HVRA 4Y33A 4BEHA 3S8PA 2QKLB 2F5VA 4U7BA 4YRVA 3K4BA 2WB1A 2X51A 3SEZA 3OMYA 1W36C 4F91B 1N78A 3VYTB 1G59A 2E60A 3PNTA 3HG9A 3OL4A 4B3XA 1FMWA 2HPIA 4DJAA 2DT6A 4J01A 4C2TA 1S9HA 3OS0A 4PJLA 3K6GA 4XKCA 2OC6A 4PJJA 4AU7A 3CJRB 1SFKA 2W82A 4N4OB 4BQNA 2W4SA 2M0MA 2CW8A 2XC7A 1Z7LA 4XOPA 3HOTA 5KCMA 1HA8A 4IZZA 2E1MB 2V6EA 4XKWA 1X1BA 5CQGA 3HXLA 3OYCA 3S3OA 2ZSIB 2R4GA 4NC7A 4KJZA 3UNGC 2VQCA 2DCEA 1LFPA 1X1CA 4C9YA 4CCOA 1OLTA 2BW3B 2FUG2 2WA0A 3K4LA 4CH7A 4RLFA 3CP2A 3H5AA 4DIQA 1BR4A 2ZSHB 2L2OA 2VPLA 1WFXA 4C30A 3DTKA 4LIUA 2X6WA 3W3CA 3FHNA 2K3PA 3VYRB 4BE0A 4DOZA 1TT0A 4F93B 2VLAA 3H5NA 2R7SA 2MABA 3BLYA 1ERDA 3H9QA 4PJNA 2E1MC 4BL0B 2HVQA 3QOEA 4NC8A 1G8XA 2CV1A 2R7QA 3S32A 3SYTA 1KONA 2X85A 3FKJA 4PFOA 1PYVA 4KITB 3K70D 1LVKA 4OWRB 3EUHC 2JSPA 5CPRB 1GLNA 4ZTFA 4PSWA 5HOOA 4P5OA 4XLHA 1N75A 2KP6A 3OIQA 3DTIA 3H9JA 4PUSA 3MKWB 2Q1ZB 4JOMA 4XKVA 3VYUB 4XONA 2RREA 2V9KA 2R7UA 2W00A 1X1DA 4FETA 2IS6A 3DLAA 3VSKA 2XF7A 2XF5A 4B43A 3HC7A 2LYCA 3BCBA 3OYKA 3S93A 3W2VA 4HEA2 2L9NA 4E7ZA 2VASA 2XSJC 1UELB 3K4MA 4CZCA 1X4PA 4PJMA 2R7TA 5FROA 3PL8A 4E7KA 3OL3A 3K10A 1MW7A 5FRNA 3CP8A 2UV1A 1UG0A 4BXFA 4RM3A 1X19A 4RMNA 3OOUA 4PSXA 3ZRGA 3LL7A 1LKXA 2V4JC 2AQFA 1V5GA 1LDKB 1YX5A 3OYLA 4BUPA 4ZDOA 3L2VA 4GRIA 3K4CA 5HNFA 2CV2A 1YE9A 4IQ4A 1E0EA 3L2QA 3D5RC 4XLFA 4B47A 1PJRA 1SAUA 5HVQC 2VB6A 2VJ5A 3IP4B 4BE1A 2HVSA 3W2WA 3FBNB 1WJEA 3DQVC 4J00A 2UUZA 3MKYB 3BC8A 3LSGA 3AL0B 3K4JA 5FRMA 1QU3A 5TGTA 4E7SA 2HNHA 4D1QA 4AVZA 3QYFA 3VDXA 2PMZA 4BDYA 2JVGA 2HZDA 2KHMA 2L5QA 1N77A 3DPUA 4D9JA 4F3QA 4EATA 3HKZA 2R7XA 3DPLC 3W2AA 3DWLE 4XOTA 4JQFA 3HOSA 1WJ5A 4DBQA 2WAFA 2ZFUA 1JI8A 3TL4X 2KL4A 4CCMA 2JVHA 4HNTA 4ZJZA 1NG6A 3OYJA 4XMYA 4PFPA 2Z2SB 3DU6A 3OWTA 3QYBA 3AL0C 1WJCA 4BQOA 2X1EA 1V5FA 4LIVA 4ZDLA 4ZYAA 3A4CA 3CMMA 2LG4A 1WJAA 3NWSA 4XNFA 3ZCOA 2JUGA 2Y0SA 3SEQA 2I8DA 2V1NA 4PK4A 3F9KA 2V26A 2M7BA 4HSRA 2Z1DA 2HPMA 4XKBA 4CA0A 2CUJA 2X1CA 4QPQA 1U0JA 3G2BA 3LSMA 2VJJA 4YEJA 2WAQA 3SDBA 1BR1A 4BJTA 1D0XA 2DJIA 4H4KC 4E7HA 3J7AY 2X6XA 2M3AA 5JHFA 4E6KG 3OYGA 3OYBA 3AFHA 1K6YA 2IXSA 2WY7Q 4II3A 1Z21A 5LFAA 4XLAA 1Y56A 2VJIA 2WY8Q 1D0YA 3N05A 3BG6A 3C2GA 2CMPA 3CF2A 4X0GA 2M7AA 1QHHD 3EUAA 4AYBA 4C2UA 2BVMA 4KT6A 1DP3A 2K9MA 4BJ6C 3I9V2 3S3MA 2KPMA 1D0ZA 1V5EA 3HUGB 3H5RA 3OYMA 3S3NA 3A1YA 1X1AA 2VIXA 2KZVA 1W36D 1D1CA 3OY9A 2KQRA 4OAZA 2ZXIA 3A2KA 4IKFA 4CUGA 2ZXHA 3FBIB 5HLTA 2XF6A 4XLCA 3IAM2 3LFUA 2E5NA 2IGKA 2K9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG7 A; 
#chains in the Genus database with same CATH topology
 3ERM A;  2KZG A;  1BN5 A;  2HXI A;  2C6Y A;  3J7A O;  1W7P D;  1XMA A;  2EZH A;  2OD5 A;  1J2X A;  3HUG A;  2FE3 A;  3ZQC A;  2YU9 J;  1ETV A;  4XN3 A;  1IRG A;  3M1C A;  1YOV B;  1O3Q A;  4LB5 A;  5B1A H;  1DU6 A;  3L09 A;  1ZRF A;  3C3W A;  1XSV A;  1Z0X A;  2UZK A;  2R7F A;  2W1O A;  4L18 B;  2KT0 A;  4M73 A;  3ZMS A;  5DD4 A;  2ZJP F;  4BS9 A;  5H2F C;  4KA4 A;  1MMG A;  3IAS 2;  4F92 B;  2XGE A;  4HDV A;  3TO9 A;  2KLO A;  2IGM A;  2OZ6 A;  3HPG A;  4KIF A;  4P1W A;  3MCZ A;  4MHG A;  1K7A A;  2GZW A;  2VON A;  1W4M A;  4FCY A;  1ZG1 A;  4IHX A;  5GAG J;  5LEJ A;  2YPR A;  1O4X A;  3TDU C;  1ETX A;  4HPQ A;  2HDD A;  3KCC A;  2K27 A;  2E1O A;  4Y3O A;  1HC8 A;  2M9H A;  1QNT A;  2MBF A;  2P81 A;  2PQ8 A;  2D45 A;  4QSH A;  1YFH A;  2HDW A;  3M8J A;  3RQI A;  1P4A A;  1YJW I;  2HYJ A;  1QQI A;  4LD5 A;  1TNS A;  2DA6 A;  2AXT C;  3GLX A;  1JT0 A;  4ZTJ A;  2XDV A;  1MH4 A;  1IO2 A;  4JX5 A;  2Y31 A;  3UR3 C;  2BV6 A;  2QBY B;  3CJQ B;  4BXX J;  3QRF F;  1Z7U A;  3DFG A;  1HXD A;  4LIT A;  4D7N A;  2RQQ A;  2IA0 A;  2IS4 A;  3OYA A;  5DUI A;  3DU5 A;  3HGY A;  5H6Q A;  2GWR A;  2X48 A;  1HW5 A;  4MTD A;  3DEE A;  1SD7 A;  3G4S I;  5H6R A;  3WGH A;  1AA7 A;  1U2W A;  5GAD J;  2Q2E A;  3AKZ A;  4LGW A;  2F4I A;  3HL2 A;  3CME I;  1YLF A;  2EPF A;  3OSG A;  1J9I A;  5B3S H;  2LOO A;  3OV8 A;  2VE9 A;  1WQ2 A;  4D0P A;  2H6C A;  1X1P A;  2OUM A;  5IP6 A;  2NOJ B;  4HRI A;  1O7F A;  1QO0 D;  5LD2 C;  1Y0U A;  3CQZ J;  4KIB A;  1X3Z B;  4JX4 A;  3COA C;  1BR2 A;  1KGS A;  1U6G A;  1VQL I;  3OYD A;  3H3Z A;  1MNE A;  1A35 A;  4DQ2 A;  2WAE A;  3LA2 A;  4LJZ F;  4DBR A;  1R6R A;  4YG2 F;  2DLL A;  4BHB A;  2VQG A;  3DKX A;  3S17 J;  5FLX K;  3RQ4 A;  2MGQ A;  3A03 A;  4BJ5 C;  3ABK H;  3S15 J;  3JAM K;  4EJW A;  2RN7 A;  1IJW C;  4EM0 B;  1ZRC A;  5J4V A;  1W0U A;  2HKX A;  4BQA A;  2RVC A;  2TDX A;  4MFE A;  3G1O A;  1LVA A;  5E18 F;  1S7O A;  3G3Z A;  4E7J A;  5E3N A;  1FZP B;  2QKM B;  3FZV A;  5JR3 A;  1WRJ A;  4N9I A;  1ITY A;  3BT9 A;  2OF7 A;  2N8G A;  2Y9Z A;  5JVG F;  1P9Q C;  4FE4 A;  1T8I A;  3HRS A;  4XOR A;  2VOP A;  1YW9 A;  4L9T A;  5LHI A;  2EQR A;  1DQU A;  2O0Y A;  2HYG D;  3H35 A;  4Y4R A;  3WOD F;  4U0Y A;  2CV0 A;  1IDZ A;  1TZL A;  5KNL A;  2MD5 A;  1XMK A;  2R7V A;  3K0L A;  1PUF A;  1WJB A;  1Y0N A;  5F0F A;  1T98 A;  1Y1W J;  3EET A;  3GBG A;  3LSH A;  4JYK A;  1F9N A;  2EA4 A;  1YQA A;  5CVR A;  3CO7 C;  3L2W A;  1VQK I;  3ZMZ A;  3KYD B;  4M6X A;  2QQB A;  2ZME B;  1ETQ A;  2V9V A;  5E1Z B;  4EM2 A;  3CO6 C;  4P9U A;  2EBI A;  2L4M A;  1TQM A;  2L9R A;  1TL8 A;  3H9G A;  3OYH A;  4BEH B;  3JRH A;  3E6D A;  3RDI A;  3QYE A;  2H27 A;  2VOD A;  3GZN B;  3DKW A;  2HU9 A;  1ZTR A;  3PIO F;  3LSP A;  2OZU A;  4TV7 A;  2IGO A;  5EEH A;  4S05 A;  2PJR A;  1DGW Y;  1YO5 C;  4AC0 A;  3V42 A;  3CZ6 A;  3CCV I;  1IC8 A;  4CYD A;  3VOD A;  5BPD A;  3RTR A;  1JKQ C;  2P6T A;  3F22 A;  1Y6I A;  2G0E A;  3P9K A;  4LLL A;  1LE8 A;  4NQW B;  2QKL B;  2RC4 A;  3SZT A;  4U7B A;  3HGG A;  3O3K A;  5HOD A;  4OOI A;  2O9L A;  2JA7 J;  3FXO A;  3SEZ A;  1W36 C;  3R6S A;  4R1H A;  3GF2 A;  3VYT B;  1G59 A;  2ZXW H;  3G73 A;  2UXN A;  3PNT A;  1FMW A;  1L0O C;  1JKO C;  1W5T A;  2DT6 A;  5HDK A;  3IL2 A;  1S9H A;  3OS0 A;  2FF4 A;  2GA2 A;  2VI6 A;  3O8H A;  2OC6 A;  4KDP A;  1I39 A;  3CJR B;  1SFK A;  2X9D A;  1S29 A;  4A3G J;  3FXR A;  3LAJ A;  2JN6 A;  3GCM A;  2HOA A;  1R22 A;  2M0M A;  4XID A;  4Y17 A;  4XOP A;  1HDD C;  5KCM A;  3F8F A;  3HDD A;  3ECH A;  2VC0 A;  1WH5 A;  5DCF A;  2HTJ A;  1N25 A;  4XLN F;  1AKH A;  3CJN A;  3V8J A;  1X1B A;  4S0H B;  1TQP A;  4RAY A;  4CYC A;  4PZJ A;  1T08 B;  2L7Z A;  5D6F A;  4G12 A;  1GXQ A;  4O3M A;  4C9Y A;  1J0R A;  2NVQ J;  3KEO A;  1ULY A;  1E3H A;  2A61 A;  1YRN A;  1B4A A;  2BW3 B;  2M87 A;  3TP3 A;  5K5Q A;  3A0H C;  4AIH A;  3IWF A;  3CCY A;  2G7U A;  2ZSH B;  3HOZ J;  1QRY A;  1WFX A;  4KNY A;  2BY1 A;  3W3C A;  2JA8 J;  1ZLJ A;  3BR3 A;  1KYZ A;  4DOZ A;  1LFB A;  3FIS A;  4F93 B;  2VLA A;  1ERD A;  2MAB A;  4HLY A;  2W57 A;  4C2M J;  2DMT A;  1RNL A;  3DBL B;  1R5I D;  4M9X A;  3QOE A;  4O5V A;  2CGP A;  4LK0 F;  3U1K A;  1ZKG A;  2NVT J;  1B59 A;  1D5V A;  2P4W A;  3GVA A;  4PFO A;  3K70 D;  1BI0 A;  1TWH J;  1WI3 A;  4OWR B;  3JRF A;  4WXC A;  3JTG A;  2QSG X;  3CC4 I;  4HF2 A;  2A07 F;  4C3H J;  2DMU A;  5D8L B;  5HS9 A;  1YJ9 I;  2W25 A;  1K83 J;  2O8K A;  3C18 A;  5FKN A;  4V19 K;  1YW8 A;  4HV5 A;  1FOX A;  1ETY A;  4ESB A;  1FOW A;  1VQ9 I;  2LKP A;  3KZI C;  1XPX A;  2CU7 A;  3VYU B;  2Q0O A;  2P8T A;  2R3S A;  2V9K A;  2OBP A;  4UUS B;  4G6D A;  2XF7 A;  2K3F A;  3JRE A;  3BCB A;  4RS8 A;  4HEA 2;  2L9N A;  3T1B A;  2KIQ A;  3I4M J;  2G9W A;  2LVS A;  3G1L A;  4CZC A;  4AUX A;  1X3U A;  3HSF A;  3GTJ J;  1JUP A;  5E20 A;  1IDY A;  1U5T C;  1QGP A;  2LD5 A;  4I02 A;  4BXF A;  4M3D A;  1SFU A;  3ZQ7 A;  3KP4 A;  1SEU A;  2GM4 A;  3OOU A;  4PSX A;  1L3L A;  3NAR A;  2V4J C;  2GXA A;  1KQ8 A;  1LDK B;  5D4R A;  4BUP A;  3P9C A;  1BC8 C;  5HNF A;  1Y1V J;  1J5Y A;  5CYV A;  3CDI A;  1FX7 A;  2BZT A;  3L2Q A;  1K6O A;  3PFI A;  3RIR A;  3SQN A;  3EQL F;  2PMH A;  1Q1V A;  2D1V A;  1IF1 A;  2Q8K A;  4L5I A;  5L3C A;  4RBO A;  4IPA A;  2JMW A;  4UB6 C;  2DYS H;  2JQ7 A;  2L7F P;  4HX8 A;  5ILS A;  3BJ6 A;  1IZ1 A;  2XKP A;  3IP4 B;  3FBN B;  1X2M A;  3MKY B;  3LST A;  2A6H F;  3AL0 B;  5TGT A;  3IV5 A;  2VN2 A;  2HTS A;  2JRT A;  4D1Q A;  3VDX A;  4D5F A;  1G3Y A;  2JVG A;  4RAZ A;  1MNM C;  3CCE I;  2IEK A;  2G7H A;  2HZD A;  2L5Q A;  1MZB A;  1JJ6 C;  5JLW A;  1PDN C;  4EAT A;  3J81 K;  2Z9O A;  3DWL E;  2ZNY A;  2DI3 A;  2YX4 A;  4I0B A;  2MLG A;  5DV5 A;  1K4T A;  2VPR A;  1IUF A;  2H8R A;  4DBQ A;  1XGM A;  1F43 A;  2WAF A;  3BOQ A;  5FLX Z;  2GQQ A;  1YI2 I;  1TWF J;  4QWQ A;  1VQM I;  1FPQ A;  4UY8 I;  4XMY A;  4PFP A;  5GPA A;  1ZQ3 P;  2JSC A;  3LAP A;  3JAM Z;  1ZH5 A;  3ELK A;  1RIO H;  3GME A;  3MZH A;  2M8G X;  4BQO A;  2IVM A;  3A4C A;  2LDU A;  1R5H A;  1WJA A;  3KFW X;  4D5C A;  1BM9 A;  4NB5 A;  4DW6 A;  4M9S A;  3FHZ A;  2FX0 A;  4A0Z A;  1P92 A;  1WCM J;  2BEO A;  3NRV A;  4N9H A;  4HSR A;  2Z1D A;  1T0F A;  1LNW A;  2NXN B;  4XSX F;  1U8R A;  4LG0 A;  2FNP A;  2CUJ A;  1ZR4 A;  3JW4 A;  3G2B A;  1NTC A;  4CIC A;  2PLY A;  1T33 A;  2DFH A;  3MAJ A;  4E7H A;  3QP5 A;  2MLK A;  4RAF A;  5JHF A;  3OYG A;  2V1U A;  2CW0 F;  2E7X A;  1LDJ A;  2DU9 A;  2VT3 A;  2IXS A;  3BG3 A;  1B8I B;  1Z6T A;  1FBU A;  5IYB J;  2MSY A;  4FQG A;  1G4D A;  1LDD A;  1ZG5 A;  3HSR A;  1EJ9 A;  1D0Y A;  5FO5 A;  3BG6 A;  3R4K A;  2BXY A;  1BIB A;  1ZK8 A;  2JWT A;  4UXN A;  2VC1 A;  3WE3 A;  3ULQ B;  4A2U A;  2CWE A;  3TP0 A;  2E1N A;  2QGU A;  1DP3 A;  3F8N A;  5ICE A;  1MJ9 A;  4BBR J;  3HRU A;  1T56 A;  5CVU A;  2HXO A;  4IXA A;  1D0Z A;  3HUG B;  2XAH A;  2QYO A;  4LOC A;  2DOE A;  3CLO A;  2VIX A;  2WAQ N;  1D1C A;  4ZZD A;  3H92 A;  1SD5 A;  4HAM A;  2AS5 F;  1WKM A;  1BI3 A;  3F72 A;  2ZXI A;  1I5Z A;  4GCV A;  4G94 A;  2ZXH A;  5HLT A;  3MN2 A;  3IAM 2;  3LFU A;  2K9L A;  3KIO A;  1DDN A;  3WHB A;  3OYF A;  3EUK L;  3AG4 H;  5GAH J;  2LRE A;  3KP3 A;  3Q0V A;  4HZF A;  3L2U A;  1T95 A;  2EZL A;  5LGN A;  1QHG A;  3B6C A;  2QWW A;  5C3E J;  3VPR A;  1FMV A;  3BR2 A;  3ZQL A;  1FBS A;  2QCO A;  4CGZ A;  4FTH A;  3R61 A;  1ZHF A;  5H20 A;  3OYN A;  3KEQ A;  1P6R A;  2QEX I;  3K70 C;  1ZLK A;  4M3E A;  4OU0 A;  3VOE A;  3B02 A;  1Z3X A;  3BY6 A;  4WWC A;  2ESN A;  2BHY A;  4UHT A;  3GFL A;  4HST A;  1ZRE A;  3AAF A;  1I6X A;  1MMA A;  3HBL A;  1LJ9 A;  4P9F A;  4Q4Z F;  1UST A;  3SJM A;  1P4W A;  1XGN A;  2VT2 A;  5A2Q K;  2Q2E B;  3D5S C;  4CO8 A;  5IPA A;  3GTO J;  2OTL I;  5ILU A;  2J5P A;  2PG4 A;  4A3M J;  5EZG A;  5HNH A;  4BYY A;  3IRR A;  2R5Y A;  3RI4 A;  3F8B A;  3GZ6 A;  1QVU A;  1HDP A;  3ZXS A;  1OCT C;  2ICW G;  1MKM A;  2EK5 A;  3GEZ A;  1OR7 A;  3M7G A;  4R79 A;  4ENJ A;  1JHF A;  2QSF X;  3CES A;  3RKW A;  2GXG A;  2A68 F;  2BY3 A;  3GO5 A;  2IW5 A;  1OR7 C;  5FB2 A;  3RSN A;  4EQQ A;  4HDU A;  1R1T A;  1FJL A;  3EDP A;  4EJU A;  4ESJ A;  2XRO A;  4RDU A;  4GYI A;  2Z16 A;  2ZFW A;  5F64 A;  6PAX A;  4I76 A;  4DYQ A;  4AWX B;  5CLS A;  4XN0 A;  3QQA A;  3V7C A;  3WG9 A;  2GOM A;  1X2N A;  4ITV A;  1WJD A;  4B44 A;  4ZDP A;  3ZPL A;  5F1R A;  2CO5 A;  5CQE A;  2LR8 A;  3HOY J;  1IXS B;  1EA3 A;  2GOX B;  2EFN A;  3HOX J;  2KFD A;  2JJ7 A;  3FDY A;  3EPZ A;  1BOA A;  2IA1 A;  3RPQ A;  3S2W A;  3LQR A;  2OV7 A;  5LBQ A;  3PIP F;  4GXO A;  3HM5 A;  4BE2 A;  5ILV A;  3U9G A;  1YYV A;  2IBD A;  2W84 A;  3HTU A;  4DYR A;  3R0A A;  1RES A;  1Z9C A;  1PUF B;  4G6T B;  4AVP A;  3WTX C;  2VKV A;  1BL0 A;  5B1B H;  1HLV A;  5J1R A;  3RCO A;  1FBQ A;  3PUB A;  1MGT A;  2LK2 A;  3IC7 A;  4Q5S F;  2JA2 A;  2R7W A;  3GTG J;  1DGR M;  4M9Z A;  5LGT A;  2EZI A;  1V4R A;  3E3V A;  2XAU A;  2R5Z A;  2FU4 A;  4Y15 A;  2DOD A;  1FWZ A;  4IQJ A;  3WU2 C;  3Q3S A;  2FOK A;  3ZGK A;  4H0E A;  4EJV A;  2ELH A;  2XAQ A;  3A02 A;  2AO9 A;  2XRL A;  2IS2 A;  4NC6 A;  1B1B A;  2RNG A;  4RLQ A;  3T8R A;  2PJR B;  4XRM A;  2UWM A;  2KKO A;  2F5D A;  3PNY A;  2HKO A;  3ZOB A;  4BHP A;  4U87 A;  2W7N A;  1RR8 C;  1UZC A;  2LH9 A;  1XGS A;  3GXO A;  4B4C A;  1MDM A;  3BPX A;  3K2A A;  3PNV A;  3MKZ A;  3LSK A;  2KDO A;  1BJA A;  1KU7 A;  2DW4 A;  2VBY A;  1E2X A;  3F23 A;  4XL9 A;  4IJA A;  4MLO A;  4AYB N;  3T0Y A;  2VBW A;  2ZCW A;  3RKQ A;  4LLN A;  5C4X J;  3D5L A;  3ZMV A;  3BR1 A;  2K85 A;  1S8N A;  3SXY A;  3RZO J;  1FTZ A;  2WAD A;  1BOB A;  3GTM J;  3LSI A;  2LTP A;  3GTP J;  3J81 Z;  2MA3 A;  5IOY A;  3FK7 A;  4YIR X;  2ELK A;  1CF7 A;  9ANT A;  2DA4 A;  2A5W A;  4NNJ A;  3WGI A;  1HCR A;  3W6K B;  2DAO A;  4A5M A;  3BG7 A;  5LGU A;  4IO9 F;  1MMD A;  1W7P B;  3TO7 A;  4BKX A;  5KVR A;  2L9S A;  2XV4 S;  3FM5 A;  2HVR A;  4Y33 A;  5EYR A;  3S8P A;  2H8W A;  2F5V A;  4A3L J;  1IRZ A;  2HQN A;  2GBY A;  2X51 A;  4CYC B;  3OMY A;  4IF4 A;  5D4S A;  3QWL A;  4I01 A;  4BBS J;  3IKT A;  4G7O F;  2QQ8 A;  1LFU P;  2O6G E;  5EEG A;  2E60 A;  2HPI A;  4DJA A;  1YRN B;  2XB0 X;  3OSF A;  1OQY A;  4C2T A;  2DA7 A;  4PJL A;  1V55 H;  4JX6 A;  3E5X A;  1U3E M;  3A0B C;  3ESW B;  2KDZ A;  1C0W A;  2OAZ A;  4N4O B;  2YUS A;  2W4S A;  2JRM A;  1TWA J;  4IHS A;  1FSH A;  2XC7 A;  3K1N A;  1AHD P;  3S3O A;  2DN0 A;  3HXL A;  5D5U B;  1GT0 C;  4NC7 A;  1ETK A;  3ZQG A;  2HEO A;  3K9T A;  5IP9 J;  1ZGJ A;  2KRF A;  2WB1 N;  1KA8 A;  1OPC A;  2DDA A;  2K4B A;  2WA0 A;  3K4L A;  1E3P A;  4IOC F;  2M2E A;  2L4A A;  2X6O A;  3ZMD A;  3E6B A;  4CH7 A;  4RLF A;  5LEK A;  4DIQ A;  1BR4 A;  2L2O A;  4B1R A;  4C30 A;  2EV0 A;  4LIU A;  5EF6 A;  1A6Q A;  2ID3 A;  2GIZ A;  3FHN A;  5KAI C;  2DA2 A;  3ASO H;  3BLY A;  4YII A;  2E1M C;  2H1L A;  1APL C;  4BL0 B;  4A0X A;  3I64 A;  3EUH A;  2CV1 A;  2E34 A;  4M6Y A;  3S32 A;  2XAS A;  3B73 A;  1LVK A;  1U5T B;  3EUH C;  1GLN A;  3LQQ A;  4PSW A;  4P5O A;  1WGX A;  4XLH A;  3C7J A;  3FWE A;  5DCM A;  2IPQ X;  3KP6 A;  4RB0 A;  3DTI A;  2H94 A;  1HST A;  3IH4 A;  3Q9S A;  2XUB A;  1MIJ A;  2X4H A;  3J80 K;  2DQL A;  5CJ9 A;  5ERI A;  4XKV A;  4XON A;  1R9T J;  2GIV A;  2YR2 A;  3I59 A;  2R7U A;  1EKE A;  1X1D A;  3M4O J;  3VSK A;  3HC7 A;  2LYC A;  1ZAO A;  2AHQ A;  4I98 B;  2NVU B;  3NAU A;  2XSJ C;  5K1Y A;  3FMR A;  4PCQ A;  1X4P A;  4PJM A;  2R7T A;  3CF5 F;  3KLO A;  1BI2 A;  3PUF A;  2Z3Y A;  3K10 A;  1YS7 A;  2JTV A;  3JRC A;  3CP8 A;  5A2Q Z;  5K5R A;  4B3A A;  1UG0 A;  3WTU C;  2OJE D;  3MZY A;  2V9P A;  5E3L A;  3MQ0 A;  3J7Y J;  5EG0 A;  3L7W A;  4RMN A;  5CVV A;  3ZRG A;  1K61 A;  2JPB A;  2AQF A;  5IOZ A;  1HF0 A;  3ZN0 A;  3M3Y J;  2H09 A;  3CCS I;  3CCU I;  1AOY A;  1GHC A;  4GRI A;  4KT5 C;  1XG1 A;  3DEU A;  1HSJ A;  5GP9 A;  1F4K A;  1IXR C;  2ISY A;  2M45 A;  3FXM A;  4HOB A;  3W6J B;  4ENN A;  3D5R C;  3L1P A;  1SAX A;  4OIO F;  4MIM A;  1V3F A;  4HNV A;  3FIW A;  4XLF A;  5FLV A;  4F7Z A;  3MZ8 A;  2ZJQ F;  3CCQ I;  5HVQ C;  1OYW A;  2AXL A;  3M07 A;  2BYV E;  4L9J A;  2FBI A;  2VJ5 A;  4W1U A;  1V54 H;  1BIA A;  5BS6 A;  2HVS A;  4BE1 A;  2BY0 A;  5E1X A;  1FYL A;  2HI3 A;  2UUZ A;  1M1E B;  2OQG A;  5AIP A;  5C44 J;  1VQ6 I;  1NH3 A;  1ZGA A;  3TQN A;  3K4J A;  3CCJ I;  1PUE E;  5FRM A;  4E7S A;  1RUO A;  2CQX A;  3QYF A;  1SD6 A;  1U9N A;  4EJO A;  3A01 A;  2FD5 A;  2PMZ A;  1FIA A;  4UVC A;  3I71 A;  5E3M A;  4BDY A;  5M5W J;  3HZJ A;  1Y39 A;  3DLL F;  2M0C A;  2A05 A;  3QU6 A;  4L5E A;  4F3Q A;  3LA3 A;  1ETO A;  3T8T A;  2YX7 A;  2XGD A;  3DPL C;  2R7X A;  1RRJ A;  2F5F A;  4BAY A;  2FXA A;  1TC3 C;  5KK1 A;  1X3W B;  1KQ0 A;  3HOS A;  5M5X J;  1TQI A;  2ZFU A;  5FFZ A;  5B66 C;  2NS7 A;  2KL4 A;  3ROU A;  3QPT A;  1TWG J;  5DDG A;  1G3W A;  3QYB A;  2HOE A;  2F5C A;  1OJL A;  4P55 A;  3OOP A;  2X1E A;  1V5F A;  4LIV A;  2B0L A;  2CUF A;  1Z67 A;  3K1P A;  3K2Z A;  2Y9Y A;  1HKS A;  2NAZ A;  4L5J A;  3ZQH A;  1VQ4 I;  1JUS A;  3LA7 A;  3SEQ A;  2EV5 A;  2V1N A;  1B9M A;  1I3A A;  2TCT A;  4PK4 A;  1O3T A;  1IV8 A;  1BW6 A;  1ON2 A;  2DO7 A;  2XRN A;  2HPM A;  1GVD A;  2X1C A;  2ME6 A;  2KIS A;  2VOO A;  3LSM A;  3SDB A;  4UNO A;  2NVX J;  4BJT A;  2O61 A;  2ZJ2 A;  3HKZ N;  5C4J J;  1UCR A;  4A5N A;  1R23 A;  3OYB A;  4I0A A;  1O3S A;  2IAI A;  1F1Z A;  3CUQ A;  3AFH A;  1VQO I;  1J59 A;  4HF1 A;  4DNC A;  4II3 A;  4KIC A;  2L54 A;  5LFA A;  5IT9 K;  3FXJ A;  1Y56 A;  2RQP A;  2WY8 Q;  3CUQ C;  3FF5 A;  2CMP A;  4WK8 F;  1T38 A;  5LHH A;  4A3I J;  4G6Q A;  2CSO A;  2A3S A;  1GDT A;  4AYB A;  2DMQ A;  1SFO J;  2XSD C;  4KT6 A;  2Y0S N;  4U88 A;  4V2G A;  4M3G A;  2CQQ A;  2DA3 A;  3H5R A;  3OYM A;  1WI9 A;  2DMP A;  2DTZ A;  1MH3 A;  1EH6 A;  3ASN H;  1TT5 B;  1OCO H;  2NYX A;  4BHC A;  4NHJ A;  2LFB A;  3DXJ F;  2H6B A;  2ZJR F;  4EGY A;  1RKT A;  4IVN A;  2IGK A;  4C2U A;  1STZ A;  4XK4 A;  3LSR A;  3H0D A;  3IKV A;  2D2W A;  2L01 A;  2PX9 A;  4HW0 A;  5J6X A;  1MMN A;  2R7D A;  4MFD A;  1QZE A;  2WBM A;  1SMT A;  4YEL A;  3RKY A;  5J1U A;  2O8X A;  2ECB A;  2CH0 A;  2JT1 A;  4O6J A;  3F6V A;  3PFY A;  3KE2 A;  3PSI A;  1FP2 A;  1QPM A;  2Y75 A;  3BQY A;  2E7W A;  5D6E A;  4D7M A;  1LEB A;  3BTI A;  4AM3 A;  5IT3 A;  1AU7 A;  2CFX A;  5IP7 J;  3DKY A;  2ZME A;  3S1R J;  2CUZ A;  3VYS B;  2GA1 A;  5L3G A;  2M4K A;  2CJJ A;  2MD0 A;  4LB6 B;  2B63 J;  1YIJ I;  1E17 A;  2QEN A;  3KYL A;  1XTA A;  2PI0 A;  1UB9 A;  2FRH A;  4M3F A;  5IY5 H;  4WCG A;  3S2H J;  3K1M A;  2XKO A;  2DT7 B;  4RAG A;  1XGO A;  2XB5 A;  1MBG A;  3QP6 A;  4YFK F;  2A6E F;  2WC2 A;  1XSD A;  3H0G J;  3DTE A;  2FQ3 A;  3N97 A;  1GV2 A;  4E7I A;  1A31 A;  4MEY F;  3ABT A;  1U78 A;  4RM2 A;  1QBJ A;  4GO1 A;  2MFZ A;  5L3B A;  2V1D A;  2LRD A;  4LG3 A;  2LF7 A;  3EYY A;  4WF2 A;  2Y2Z A;  1JJ8 C;  3KX2 A;  4XLP F;  5GTH C;  2K5C A;  3BG5 A;  2LBF A;  1G3S A;  3TMO A;  1FIP A;  3WTW C;  5E1W A;  4IOA F;  2OCE A;  2KRC A;  3BZ6 A;  3PM1 A;  4CCK A;  4M6V A;  3WTS C;  3BPV A;  5F04 A;  2F4M B;  1USS A;  1NG7 A;  4RGX A;  5DUK A;  1MBE A;  5E3O A;  1J09 A;  1D1A A;  2XIG A;  4CCN A;  2W48 A;  1K79 A;  2E5Z A;  2VXZ A;  1T0F C;  2HQA A;  4K2E A;  1VQP I;  2O03 A;  3FXL A;  1NK2 P;  3MMY B;  2WWY A;  2R5Z B;  4JBA A;  3OS1 A;  1RKW A;  2DOF A;  2ELJ A;  5BQT A;  4XQF A;  3J80 Z;  2VQL A;  4OAY A;  1RPW A;  2VL8 A;  3CCL I;  2KIM A;  2MC3 A;  4LMY A;  4IRG A;  2DYR H;  1HBX G;  5LRR A;  3VB2 A;  2ZC2 A;  1CGP A;  2D5V A;  3I5U A;  3OR1 C;  2COM A;  3CTA A;  3J7Z I;  3OYE A;  2FJ1 A;  1ZEL A;  3ISP A;  3TBI A;  1REP C;  4XR6 A;  3P7N A;  1JT6 A;  1R4N B;  4HG2 A;  4BY1 J;  5F27 A;  4A0Y A;  2GAU A;  4B8X A;  4LFU A;  2VQH A;  1NK3 P;  1XB4 A;  2KJC A;  2RV8 A;  2DFE A;  1HKQ A;  3TOA A;  1MBH A;  2ZNZ A;  2PEX A;  3GW2 A;  2BW3 A;  1T39 A;  3CC7 I;  3KP2 A;  5JFR A;  3OYI A;  4Y7N J;  1TBX A;  4XLE A;  2OTJ I;  2LY1 A;  4ZC3 A;  2R7R A;  4HA8 A;  3BR5 A;  1BJZ A;  2Z99 A;  4B48 A;  3GTQ J;  2VXD A;  3S16 J;  3RKX A;  3BJO A;  2ZO4 A;  2LC2 A;  3PSF A;  4Z2Y A;  5FFX A;  3OS2 A;  2FBH A;  3CCM I;  3HRT A;  3ZMT A;  3F0C A;  5J4Y A;  1D1B A;  2L7M P;  4AIJ A;  2EIL H;  3DPT A;  1XS9 A;  5KHD A;  2DFI A;  3K4K A;  1UJ8 A;  3FM3 A;  4KUM A;  1IRX A;  3BZK A;  2CQN A;  1R00 A;  1IUY A;  3TW7 A;  1FOY A;  2LY2 A;  4KIG A;  2QQ9 A;  1RR7 A;  4CCL A;  4U0W A;  4CCJ A;  4I6Z A;  1TLH B;  3IWZ A;  3JRD A;  2YU3 A;  4QPO A;  4E7L A;  3VWB A;  2IJL A;  5FKM A;  5DTD A;  1UAA A;  1RZ4 A;  5BNG A;  1F5T A;  2MYS A;  4HNU A;  2LMD A;  2B7E A;  2P0W A;  2XAG A;  4KIS A;  3PQK A;  2I10 A;  2X1D A;  3E5Q A;  2CW7 A;  2KIU A;  2LY9 A;  5DEQ A;  3V7R A;  2BVL A;  3JSO A;  1YTY A;  3WU1 B;  1BC7 C;  1IN6 A;  1G3T A;  1XCB A;  2XGC A;  1PP8 F;  3M1E A;  3IH3 A;  2R0Q C;  4BGD A;  4HLX A;  1IRF A;  1R58 A;  4II2 A;  4UB8 C;  3FX3 A;  2CS3 A;  3CC2 I;  4NBQ A;  1JHH A;  1S7A A;  1E3O C;  2CQK A;  4YRV A;  3SFI A;  2LLK A;  2EIK H;  2P5K A;  1SAN A;  5CVI A;  4EEF G;  5ED4 A;  3BG9 A;  1K78 A;  2KIF A;  4Y52 J;  5HLG A;  2MW8 A;  4F91 B;  5TJJ A;  1N78 A;  4QTR A;  1R4M B;  3ZMU A;  2QVO A;  1MBF A;  3MEX A;  3HG9 A;  2Y30 A;  4B3X A;  2DT5 A;  4J01 A;  1NHA A;  3I4P A;  3RPU A;  1JKR C;  1YIT I;  4PJJ A;  4AU7 A;  3K69 A;  4LK1 F;  4XSZ F;  4ZH4 F;  2W82 A;  4BQN A;  1QZY A;  2K9Q A;  2X0L A;  4M72 A;  3HRM A;  2CW8 A;  3DBH B;  1D8K A;  5K7Z A;  1FYM A;  3HOT A;  3V8K A;  1QZZ A;  1HA8 A;  2E1M B;  2P6S A;  4XKW A;  1TWC J;  3V7S A;  2V6E A;  5DYM A;  5IT9 Z;  3ERE D;  5CQG A;  3GZ5 A;  2R4G A;  3S2D J;  3MKL A;  3K7A J;  4KJZ A;  4EM1 A;  2VQC A;  2FA5 A;  1X1C A;  4HV6 A;  1SC7 A;  3CJT B;  2CG4 A;  2P5V A;  4C3J J;  4CCO A;  1WH7 A;  2K86 A;  1OLT A;  2EFO A;  3PO3 J;  4ABZ A;  4GFB A;  1OIS A;  4EV0 A;  1ENH A;  3CD6 I;  4MQ9 F;  1J75 A;  2VPL A;  3WU0 A;  5DCM B;  5E8G A;  5GPC A;  2EA2 A;  3DTK A;  4WXD A;  3X2Q H;  1ORK A;  4S04 A;  2X6W A;  4HF0 A;  3I54 A;  4V2F A;  3VYR B;  4FHT A;  5EEA A;  1IN5 A;  5AIQ A;  1SD4 A;  3F8C A;  4J19 A;  4CHU A;  3H5N A;  3I59 B;  3H3V K;  3H9Q A;  4PJN A;  2QM3 A;  2CQ7 A;  2STT A;  1KYW A;  4OIQ F;  5L3F A;  4G7Z F;  2R7Q A;  1FOK A;  2COB A;  1Z6R A;  5HS7 A;  3SYT A;  1KON A;  2X85 A;  3FKJ A;  5BOX A;  1PYV A;  4ZTF A;  2K02 A;  2BY2 A;  1XCV A;  1KU3 A;  5HOO A;  4HQE A;  2VUM J;  1R5G A;  3JRA A;  1FLI A;  2L0K A;  1HQC A;  4KMU X;  1Z77 A;  2HOS A;  1N75 A;  4PUS A;  3H9J A;  5EG0 B;  1I1S A;  2F2E A;  1RUN A;  3JR9 A;  4JOM A;  3LWF A;  3JTH A;  2M5W A;  4HBL A;  2EWN A;  2XAJ A;  1WVR A;  4FET A;  3JRB A;  2IS6 A;  2XF5 A;  4AD9 A;  3GWZ A;  3RZD J;  5M3F J;  1SVM A;  5FKL A;  3S93 A;  2VAS A;  2ZXJ A;  3K4M A;  1SFX A;  3BTJ A;  2EIJ H;  4FT8 A;  1LE8 B;  1B8I A;  1LPQ A;  4DZJ A;  4E7K A;  3OL3 A;  3FK6 A;  1MW7 A;  5FRN A;  1KQ9 A;  2HYF A;  3WE2 A;  1U9O A;  1VF9 A;  3U1D A;  4OMY A;  2Z33 A;  1HKT A;  1EV7 A;  1JTY A;  2BHZ A;  5EGO A;  2J5O A;  1HW2 A;  4I7H A;  2FMY A;  3H1C A;  3E7L A;  2TRT A;  3LL7 A;  1LKX A;  3R60 A;  2GXB A;  3S1M J;  1V5G A;  3BTL A;  1YX5 A;  2M34 A;  1Y8R B;  4ZDO A;  3A01 B;  1ACI A;  3K4C A;  2FNA A;  4AIK A;  2CV2 A;  1YE9 A;  4IQ4 A;  2BBY A;  4CDG A;  3WTY C;  2JPC A;  2K9S A;  2BE5 F;  4ESF A;  2EJR A;  2B9S A;  1SAU A;  1XC5 A;  4A3D J;  1OFC X;  1KU9 A;  3I56 I;  1W1W E;  2WV0 A;  3CCR I;  3KP7 A;  5LHG A;  2V6C A;  3FMQ A;  3LFK A;  3MFK A;  3DQV C;  3V8L A;  1DP7 P;  5ICG A;  1AKH B;  1IG7 A;  3R0J A;  2XAF A;  1GV5 A;  3I58 A;  1QU3 A;  1J7K A;  2GLO A;  3G6E I;  2HNH A;  3I53 A;  2EB7 A;  3I0T A;  4AVZ A;  1IN8 A;  2ZKZ A;  4HYE A;  1IV6 A;  1FYK A;  1EF4 A;  4RB3 C;  1VQ7 I;  5F0H A;  2L02 A;  1N77 A;  5E79 C;  1T2K A;  2H1K A;  1TW2 A;  3AG1 H;  2HS5 A;  2BXZ A;  5M3M J;  4P96 A;  3W2A A;  4XOT A;  4JQF A;  3CMY A;  1UHW A;  2I5U A;  3ZN1 A;  5AON A;  3C1D A;  2ESH A;  1UHM A;  2XGX A;  2O7O A;  1JI8 A;  3TL4 X;  1B72 A;  3MVP A;  4HNT A;  2Z2S B;  2HGC A;  2FBK A;  4LLG F;  1GUU A;  3I55 I;  5JI6 A;  2HQR A;  3CUQ B;  4ZDL A;  4ZYA A;  4PDK A;  4YFX F;  3CMM A;  1IW7 F;  2LG4 A;  3TGN A;  3MWM A;  2JK3 A;  1R36 A;  2LKS A;  3KZY A;  4XNF A;  3ZCO A;  5B5E C;  1XDU A;  4B09 A;  2A5Y B;  2V26 A;  3F9K A;  1FC3 A;  2M7B A;  3BQZ A;  3WHC A;  3OIO A;  2WTE A;  4EMS A;  4XKB A;  1DPU A;  2E71 A;  1P7I A;  2K9N A;  4CA0 A;  5J47 A;  4QPQ A;  4IHT A;  1U0J A;  4IL6 C;  2RKH A;  4YEJ A;  1MBJ A;  2LF8 A;  2WAQ A;  1BR1 A;  3J7A Y;  2L3D A;  2E2H J;  2X6X A;  2E2I J;  1Z05 A;  2M3A A;  2NOG A;  4ZZL A;  5FJ8 J;  1WSU A;  1H88 C;  1JGG A;  4E6K G;  4BY7 J;  1FEX A;  2HZT A;  3FXU A;  2YS9 A;  3HYI A;  1TP4 A;  1Z21 A;  4XLA A;  5K7F A;  5M5Y J;  1O57 A;  5L3D A;  3HHH A;  3LNQ A;  2E2J J;  3N05 A;  3C2G A;  3M8E A;  1ZG3 A;  4RGU A;  1DU0 A;  1XX5 A;  1TW3 A;  4X0G A;  4OIP F;  4ZYE A;  2M7A A;  3KP5 A;  1QHH D;  1SFE A;  1FP1 D;  1GVJ A;  5F0C A;  5D5X B;  3I4N J;  2E19 A;  2RNJ A;  1SVO A;  1YS6 A;  4BJ6 C;  4XRF A;  2KPM A;  3FXQ A;  2DK8 A;  5TIS C;  4ENK A;  3ABU A;  3S3N A;  2R93 J;  4RGS A;  1X1A A;  1YW7 A;  2KZV A;  3OY9 A;  2CYY A;  3N4M A;  4OAZ A;  2ECC A;  4CXF A;  1QPI A;  1S5L C;  2V79 A;  3A2K A;  1HOM A;  4IKF A;  4CUG A;  5ICC A;  3WGG A;  3FBI B;  2XF6 A;  3QOP A;  3DP7 A;  4XLC A;  3M9A A;  2ETH A;  5K5O A;  1BBY A;  1VZ0 A;  2ADU A;  4F55 A;  3BJA A;  2Y48 A;  3U2R A;  4ASN A;  4Q47 A;  4E4H A;  4M3B A;  4XIC A;  3QOD A;  3F6O A;  2LNB A;  2DA5 A;  4A3J J;  2IRF G;  4ETS A;  4KMF A;  3E1S A;  1JGS A;  3HIF A;  1OCZ H;  3I3L A;  4A12 A;  3G71 I;  2V7F A;  4BNC A;  4A3C J;  4G9Y A;  2VBZ A;  2VJ4 A;  3LMM A;  3E6C C;  4UVA A;  3L2R A;  2E35 A;  4UVB A;  5F08 A;  2DXI A;  2LKX A;  1OKR A;  2NNN A;  2NNY A;  3BTC A;  1A6I A;  2JZY A;  1JTX A;  4QLC U;  4EVI A;  5EDN A;  3JRG A;  2CRG A;  1A36 A;  4BU2 A;  5BPI A;  2MC4 A;  1I27 A;  3QU3 A;  3T5X A;  2LBF B;  3BCA A;  2EH3 A;  3SZG A;  3QPH A;  1VI0 A;  1R1V A;  1I6H J;  3CDH A;  4NDL A;  2KMU A;  4FX0 A;  4A93 J;  3Q5F A;  5E17 F;  2F6C A;  1F36 A;  2MG4 A;  5FKO A;  2XPW A;  4WXH A;  3MD2 A;  2QA4 I;  2IT0 A;  3BZC A;  5JVT A;  4LG0 B;  5DD8 A;  5K7H A;  1R7J A;  3VSL A;  4ANJ A;  4L9N A;  3ZQQ A;  2EFP A;  4BDZ A;  1H8A C;  2A6T A;  3DV8 A;  4MNU A;  5FKK A;  2PJP A;  5J3L A;  2OPT A;  3E97 A;  4CSW A;  1I1G A;  1MJA A;  1W7P A;  1G2H A;  2O3F A;  4R8H A;  3TKY A;  2EIN H;  2XPU A;  1CQT A;  4ZYG A;  1BA5 A;  4X6A J;  1YX3 A;  3PQJ A;  4M74 A;  3K4N A;  5HLI A;  1KU2 A;  2QBY A;  1W5C C;  2DTR A;  4GGG A;  3BDD A;  4WX9 A;  3FKI J;  2RGV A;  3P9I A;  3ZP5 A;  4GYG A;  4RB2 C;  3Q0U A;  1FY7 A;  2DOA A;  5HS8 A;  1LB2 A;  2OQR A;  1Z91 A;  1XDS A;  2KRH A;  3OR2 C;  2QUF A;  2EFW A;  1Z3Y A;  2NRA C;  5EZH A;  3F21 A;  2D1H A;  1OYI A;  4ON0 A;  5J8F A;  3E0J B;  4FAS D;  3IUO A;  4UV9 A;  3DBR B;  3GLL A;  4F52 A;  2OCC H;  4N4N B;  3OIP A;  1GXP A;  1YG2 A;  1MND A;  5GTI C;  2DA1 A;  3U21 A;  2IP2 A;  4EGZ A;  5HDN A;  1VTN C;  3TW6 A;  2EFQ A;  1A5J A;  2L9V A;  3KLN A;  5CVJ A;  1XSX A;  3F8M A;  5CKT A;  4MTE A;  4ZYH A;  1VQ5 I;  2P7V B;  2HQ5 A;  3L2C A;  1HW1 A;  2O5R A;  4G8X A;  4BQQ A;  4IX7 A;  4Y13 A;  2FML A;  2A69 F;  2M4G A;  2VKD A;  4Z6Y A;  4YFN F;  2ISZ A;  4HX7 A;  1YJN I;  4OMZ A;  3B6A A;  1LEA A;  3C2H A;  5F6F A;  4C3I J;  2VKH A;  3PJR A;  1Z1D A;  1P4X A;  3CUO A;  4IRH A;  3KEY A;  3TO6 A;  4X1E A;  2CFO A;  3RPU D;  4BAC A;  2P7C B;  3HOV J;  3HOU J;  2R7O A;  3E6M A;  1FT9 A;  1U5T A;  2IGN A;  5JLX A;  1W5S A;  4G7H F;  4XM3 A;  1X4O A;  2R5Y B;  3HJE A;  4A6D A;  1WJF A;  1S7E A;  2X6Y A;  3QPS A;  4XRS A;  1K78 B;  1MMS A;  5LRS A;  2AQE A;  3VFZ A;  1SMY F;  3QPL A;  3NWT A;  1DPR A;  2F48 A;  1O3R A;  4DGW B;  1I50 J;  3TED A;  1ZAR A;  2HR3 A;  4UUT A;  2L7K A;  3NEU A;  4FIS A;  2IS1 A;  3CDL A;  1JE8 A;  3HPH A;  1RC9 A;  2W24 A;  4YIF A;  3S1N J;  2EIM H;  3BP8 A;  3KZZ A;  2BGC A;  2ZME C;  1WPK A;  2BOL A;  3H36 A;  4NUB A;  3ZR8 X;  3AG3 H;  3ONQ A;  3WTT C;  1OCC H;  4BEH A;  2M1B A;  1EH8 A;  4A3E J;  1W0T A;  2QQA A;  1IN4 A;  3IH2 A;  2WB1 A;  3K4B A;  1VQN I;  2DQR A;  2JA5 J;  3GFM A;  3LOC A;  2DPU A;  3G1M A;  5TRD A;  3ECO A;  1KZH A;  4IRI A;  2NVY J;  2VKE A;  3ZQI A;  3OL4 A;  2DFF A;  3DEW A;  2RDP A;  3O8G A;  1MSF C;  2EV6 A;  5KAF C;  3K6G A;  1VQ8 I;  2QSH X;  4XKC A;  4PGH A;  1JXS A;  1UMQ A;  2FOW A;  4KFC A;  3WG7 H;  1RET A;  3W6V A;  4A3B J;  2DMN A;  4NQW A;  2UXX A;  2K7L A;  5GAE J;  2PMU A;  3KYC B;  1Z7L A;  4L0Z B;  1IXC A;  3REO A;  4IZZ A;  2QLZ A;  2DBB A;  4A6E A;  1ON1 A;  3OYC A;  3RYR A;  5L3E A;  2ZSI B;  4RA2 A;  3KPH A;  2LP0 A;  3UNG C;  2DCE A;  1MJB A;  1LFP A;  1ETW A;  2EZK A;  4MGR A;  3EYI A;  3SFZ A;  4A69 C;  2OU2 A;  2FUG 2;  3O2P E;  2YSR A;  1UFM A;  3CP2 A;  3H5A A;  2Y69 H;  2WV1 A;  3F3X A;  5FLM J;  1A04 A;  2ZBK A;  1B9N A;  1XN7 A;  1T6S A;  4HX4 A;  3H3U A;  1H9T A;  1WWX A;  1IGN A;  3GUD A;  3P5J A;  3WTZ A;  2K3P A;  4BE0 A;  2F5E A;  2K4J A;  1TT0 A;  4W97 A;  1JKP C;  3S14 J;  2ACJ A;  2R7S A;  3IRQ A;  1R1U A;  2IA2 A;  2XHK A;  1LQ1 A;  2HVQ A;  4NC8 A;  2M30 A;  3GX4 X;  1UG2 A;  1G8X A;  5DM6 F;  2PN6 A;  4OIN F;  1MDM B;  4KIT B;  3TOB A;  1H0M A;  4GDF A;  2V1X A;  3Q9V A;  5D5V B;  2JSP A;  5CPR B;  3HTS B;  1B6A A;  5IYC J;  2P5L C;  1IN7 A;  4A3K J;  3BR6 A;  2W85 A;  2FEZ A;  5EGO B;  2KP6 A;  3OIQ A;  1ODD A;  3MKW B;  1ZRD A;  1VND A;  2JA6 J;  1OCP A;  4L9V A;  2F4O B;  2PBI A;  1MD0 A;  4XRS G;  3HB9 A;  1AWC A;  2DPD A;  1CF7 B;  3JCU C;  2RRE A;  1FTT A;  2W00 A;  3DLA A;  4B43 A;  2LSO A;  1RI7 A;  1POG A;  4FE7 A;  4MQV A;  3OYK A;  5BMZ A;  4IHY A;  3W2V A;  4E7Z A;  3HEF A;  1UEL B;  1UHS A;  4U7D A;  3HSE A;  5F1J A;  1MSE C;  3O6B B;  5FRO A;  4PGG A;  3ABL H;  3PL8 A;  3UKG A;  2JUC A;  4MEX F;  2PFB A;  4UV8 A;  2UV1 A;  5JHU A;  1BI1 A;  1I3Q J;  2ME0 A;  2RAE A;  3BRO A;  1YIO A;  2MH2 A;  3CLQ A;  4RM3 A;  1X19 A;  5LLQ A;  5J40 A;  3WTV C;  1X58 A;  4U0V A;  4PJ0 C;  3GFI A;  4MO7 A;  1PP7 U;  3OYL A;  3L2V A;  1S6L A;  1D8J A;  4UUS A;  5J1Y A;  2HDC A;  1E0E A;  4DYC A;  1QVT A;  5D8K B;  1WHU A;  4B47 A;  3GFJ A;  1H9G A;  1VFC A;  1PJR A;  3QAH A;  4AID A;  3RYP A;  2OA4 A;  2NS0 A;  3E5U A;  2VB6 A;  1ZR2 A;  4JK1 X;  1P7J A;  2XPV A;  3W2W A;  3D0S A;  1WZ2 A;  1OYY A;  2MH9 A;  1R71 A;  1WJE A;  3CMA I;  4J00 A;  5DS9 A;  3DCF A;  2R92 J;  3BC8 A;  1B72 B;  3GTL J;  1H89 C;  3LSG A;  1FSE A;  1MBK A;  2R7Z J;  1EH7 A;  3L9F A;  1XMX A;  4FX4 A;  2QZ8 A;  4N0B A;  1ONV A;  3TDZ C;  4DZP A;  2KHM A;  4I09 A;  1U8B A;  4CZZ A;  3BWG A;  3DPU A;  4D9J A;  3KET A;  2NS8 A;  2HFH A;  3JRI A;  3HKZ A;  3GYH X;  3D1N I;  1LUJ B;  4Q48 A;  2Y0M A;  3SHF A;  1YHQ I;  1G6N A;  4RB1 A;  1R49 A;  2ZB9 A;  5IYD J;  1WJ5 A;  3S1Q J;  4EJT A;  1OMI A;  4CCM A;  2JVH A;  4IHV A;  4ZJZ A;  1NG6 A;  2CUE A;  3ML6 A;  4JP0 A;  3RJP A;  3OYJ A;  5HLH A;  3AG2 H;  1ZN2 A;  3DU6 A;  3OWT A;  3AL0 C;  1WJC A;  1D5Y A;  2VE8 A;  4I99 C;  1IAW A;  3SZP A;  5FGM A;  3NWS A;  4KYW A;  2E36 A;  2JUG A;  4KN7 X;  2Y0S A;  4M71 A;  1SVL A;  2I8D A;  2Z5U A;  3NQO A;  5DM7 F;  2PMZ N;  3DF8 A;  1D3Y A;  3ZQF A;  4XBF A;  5FD5 A;  5J8C A;  1OCR H;  2XVC A;  2VJJ A;  1D0X A;  2DJI A;  4H4K C;  3FXK A;  5EJC A;  2ID6 A;  4IEJ A;  4E70 A;  3VEP A;  1K4S A;  2FQ4 A;  1P2F A;  4OIR F;  2HOT A;  4A3F J;  1S3J A;  2M8E A;  1K6Y A;  2WY7 Q;  2E1C A;  2K40 A;  3V4G A;  1XD7 A;  1Q1H A;  2QF7 A;  3HOW J;  3FMS A;  2VJI A;  3L00 A;  3ABM H;  3PO2 J;  4QIW N;  3CF2 A;  1TNT A;  2DDB A;  3Q0W A;  4IHW A;  3EUA A;  4ENM A;  1BW5 A;  2HWV A;  1Y8Q B;  2BVM A;  2DK5 A;  2K9M A;  2KJB A;  4HQM A;  4ZYD A;  2DJN A;  3I9V 2;  1O7L A;  3S3M A;  1V5E A;  5E8I A;  3C2B A;  3LSJ A;  1JUM A;  3HHG A;  3JSP A;  2STW A;  3A1Y A;  5FD6 A;  1TTY A;  4BXU A;  1W36 D;  1ZGW A;  4KN4 X;  3IHU A;  1FNN A;  2KQR A;  4BH9 A;  5D5W B;  1DUX C;  4I2O A;  4UUV A;  3GTK J;  1S72 I;  3SDG A;  3BR0 A;  4L0Y B;  1PVE A;  2VBX A;  5HDG A;  5ICF A;  3M8F A;  4RGR A;  1ZYR F;  2E5N A;  1QA6 A;  2Q1Z B;  2FSW A; 
#chains in the Genus database with same CATH homology
 1VZ0 A;  3OYF A;  3EUK L;  4F55 A;  2LRE A;  3H0D A;  4E4H A;  1T95 A;  3L2U A;  1MMN A;  1QHG A;  3QOD A;  2WBM A;  4YEL A;  3E1S A;  1FMV A;  3I3L A;  4XN3 A;  2V7F A;  3M1C A;  2CH0 A;  2VJ4 A;  3LMM A;  3PFY A;  3OYN A;  2W1O A;  3L2R A;  3PSI A;  3K70 C;  2DXI A;  4BS9 A;  1MMG A;  1Z3X A;  3IAS 2;  4F92 B;  2KLO A;  2IGM A;  3HPG A;  4P1W A;  3DKY A;  4HST A;  2CUZ A;  1MMA A;  4HPQ A;  4BU2 A;  4Y3O A;  3VYS B;  2M4K A;  2MD0 A;  2MC4 A;  2Q2E B;  3D5S C;  2LBF B;  3KYL A;  3BCA A;  2HDW A;  3M8J A;  3SZG A;  5HNH A;  2KMU A;  2DT7 B;  4ZTJ A;  2XDV A;  2F6C A;  3UR3 C;  3ZXS A;  3MD2 A;  3CJQ B;  3DTE A;  4LIT A;  2IS4 A;  2RQQ A;  4R79 A;  3OYA A;  3CES A;  3DU5 A;  4E7I A;  3VSL A;  4ANJ A;  4RM2 A;  3ZQQ A;  4BDZ A;  3DEE A;  1OR7 C;  2MFZ A;  2A6T A;  3RSN A;  2LRD A;  4LG3 A;  1AA7 A;  4CSW A;  3KX2 A;  2K5C A;  2LBF A;  3AKZ A;  2F4I A;  3TMO A;  3HL2 A;  2Z16 A;  2LOO A;  2KRC A;  4CCK A;  4XN0 A;  1YX3 A;  2OUM A;  2NOJ B;  4HRI A;  2GOM A;  1NG7 A;  3K4N A;  4ITV A;  1WJD A;  1J09 A;  1D1A A;  4B44 A;  4CCN A;  2E5Z A;  2VXZ A;  1T0F C;  2HQA A;  4ZDP A;  5CQE A;  5LD2 C;  3MMY B;  1EA3 A;  2GOX B;  3OS1 A;  2DOA A;  2ELJ A;  1BR2 A;  4XQF A;  2VQL A;  4OAY A;  2VL8 A;  3OYD A;  3FDY A;  3EPZ A;  2KRH A;  1MNE A;  2OV7 A;  3OR2 C;  2WAE A;  1Z3Y A;  4BE2 A;  4DBR A;  1R6R A;  2VQG A;  3DKX A;  3OR1 C;  4G6T B;  3RQ4 A;  3OYE A;  1ZEL A;  3TBI A;  4BJ5 C;  4XR6 A;  3RCO A;  3PUB A;  3E0J B;  4FAS D;  4HG2 A;  2JA2 A;  2R7W A;  3IUO A;  4E7J A;  1DGR M;  4F52 A;  2QKM B;  2VQH A;  4N4N B;  3OIP A;  2XAU A;  1MND A;  3U21 A;  1P9Q C;  2BW3 A;  4XOR A;  4IQJ A;  4Y4R A;  1DQU A;  3OYI A;  3H35 A;  2CV0 A;  3ZGK A;  5CKT A;  4XLE A;  2LY1 A;  4ZC3 A;  2R7R A;  1TZL A;  5KNL A;  2IS2 A;  2R7V A;  2O5R A;  4B48 A;  4BQQ A;  4IX7 A;  2M4G A;  2VXD A;  1WJB A;  2VKD A;  2RNG A;  2LC2 A;  3GBG A;  3LSH A;  3PSF A;  4RLQ A;  3OS2 A;  2PJR B;  2UWM A;  1D1B A;  3C2H A;  3PNY A;  3L2W A;  2VKH A;  3DPT A;  3PJR A;  5KHD A;  4U87 A;  3K4K A;  2W7N A;  3KEY A;  1IRX A;  2CFO A;  2LH9 A;  3RPU D;  4BAC A;  2R7O A;  2LY2 A;  3PNV A;  3MKZ A;  3LSK A;  2KDO A;  2IGN A;  4CCL A;  4XM3 A;  3H9G A;  4CCJ A;  4BEH B;  1X4O A;  3OYH A;  3VWB A;  3QYE A;  4QPO A;  4XL9 A;  4E7L A;  4MLO A;  2HU9 A;  1WJF A;  3D5L A;  1UAA A;  2X6Y A;  2AQE A;  2WAD A;  2MYS A;  3NWT A;  1BOB A;  4HNU A;  4DGW B;  2IGO A;  3LSI A;  2P0W A;  2PJR A;  1DGW Y;  4KIS A;  2L7K A;  2IS1 A;  3V42 A;  2X1D A;  2A5W A;  2CW7 A;  4NNJ A;  3CZ6 A;  2BVL A;  3HPH A;  3BG7 A;  4BGD A;  1MMD A;  3RTR A;  1Y6I A;  2L9S A;  2BOL A;  4II2 A;  4NUB A;  3ZR8 X;  2CS3 A;  4NQW B;  3ONQ A;  2HVR A;  4Y33 A;  4BEH A;  3S8P A;  2QKL B;  2F5V A;  4U7B A;  4YRV A;  3K4B A;  2WB1 A;  2X51 A;  3SEZ A;  3OMY A;  1W36 C;  4F91 B;  1N78 A;  3VYT B;  1G59 A;  2E60 A;  3PNT A;  3HG9 A;  3OL4 A;  4B3X A;  1FMW A;  2HPI A;  4DJA A;  2DT6 A;  4J01 A;  4C2T A;  1S9H A;  3OS0 A;  4PJL A;  3K6G A;  4XKC A;  2OC6 A;  4PJJ A;  4AU7 A;  3CJR B;  1SFK A;  2W82 A;  4N4O B;  4BQN A;  2W4S A;  2M0M A;  2CW8 A;  2XC7 A;  1Z7L A;  4XOP A;  3HOT A;  5KCM A;  1HA8 A;  4IZZ A;  2E1M B;  2V6E A;  4XKW A;  1X1B A;  5CQG A;  3HXL A;  3OYC A;  3S3O A;  2ZSI B;  2R4G A;  4NC7 A;  4KJZ A;  3UNG C;  2VQC A;  2DCE A;  1LFP A;  1X1C A;  4C9Y A;  4CCO A;  1OLT A;  2BW3 B;  2FUG 2;  2WA0 A;  3K4L A;  4CH7 A;  4RLF A;  3CP2 A;  3H5A A;  4DIQ A;  1BR4 A;  2ZSH B;  2L2O A;  2VPL A;  1WFX A;  4C30 A;  3DTK A;  4LIU A;  2X6W A;  3W3C A;  3FHN A;  2K3P A;  3VYR B;  4BE0 A;  4DOZ A;  1TT0 A;  4F93 B;  2VLA A;  3H5N A;  2R7S A;  2MAB A;  3BLY A;  1ERD A;  3H9Q A;  4PJN A;  2E1M C;  4BL0 B;  2HVQ A;  3QOE A;  4NC8 A;  1G8X A;  2CV1 A;  2R7Q A;  3S32 A;  3SYT A;  1KON A;  2X85 A;  3FKJ A;  4PFO A;  1PYV A;  4KIT B;  3K70 D;  1LVK A;  4OWR B;  3EUH C;  2JSP A;  5CPR B;  1GLN A;  4ZTF A;  4PSW A;  5HOO A;  4P5O A;  4XLH A;  1N75 A;  2KP6 A;  3OIQ A;  3DTI A;  3H9J A;  4PUS A;  3MKW B;  2Q1Z B;  4JOM A;  4XKV A;  3VYU B;  4XON A;  2RRE A;  2V9K A;  2R7U A;  2W00 A;  1X1D A;  4FET A;  2IS6 A;  3DLA A;  3VSK A;  2XF7 A;  2XF5 A;  4B43 A;  3HC7 A;  2LYC A;  3BCB A;  3OYK A;  3S93 A;  3W2V A;  4HEA 2;  2L9N A;  4E7Z A;  2VAS A;  2XSJ C;  1UEL B;  3K4M A;  4CZC A;  1X4P A;  4PJM A;  2R7T A;  5FRO A;  3PL8 A;  4E7K A;  3OL3 A;  3K10 A;  1MW7 A;  5FRN A;  3CP8 A;  2UV1 A;  1UG0 A;  4BXF A;  4RM3 A;  1X19 A;  4RMN A;  3OOU A;  4PSX A;  3ZRG A;  3LL7 A;  1LKX A;  2V4J C;  2AQF A;  1V5G A;  1LDK B;  1YX5 A;  3OYL A;  4BUP A;  4ZDO A;  3L2V A;  4GRI A;  3K4C A;  5HNF A;  2CV2 A;  1YE9 A;  4IQ4 A;  1E0E A;  3L2Q A;  3D5R C;  4XLF A;  4B47 A;  1PJR A;  1SAU A;  5HVQ C;  2VB6 A;  2VJ5 A;  3IP4 B;  4BE1 A;  2HVS A;  3W2W A;  3FBN B;  1WJE A;  3DQV C;  4J00 A;  2UUZ A;  3MKY B;  3BC8 A;  3LSG A;  3AL0 B;  3K4J A;  5FRM A;  1QU3 A;  5TGT A;  4E7S A;  2HNH A;  4D1Q A;  4AVZ A;  3QYF A;  3VDX A;  2PMZ A;  4BDY A;  2JVG A;  2HZD A;  2KHM A;  2L5Q A;  1N77 A;  3DPU A;  4D9J A;  4F3Q A;  4EAT A;  3HKZ A;  2R7X A;  3DPL C;  3W2A A;  3DWL E;  4XOT A;  4JQF A;  3HOS A;  1WJ5 A;  4DBQ A;  2WAF A;  2ZFU A;  1JI8 A;  3TL4 X;  2KL4 A;  4CCM A;  2JVH A;  4HNT A;  4ZJZ A;  1NG6 A;  3OYJ A;  4XMY A;  4PFP A;  2Z2S B;  3DU6 A;  3OWT A;  3QYB A;  3AL0 C;  1WJC A;  4BQO A;  2X1E A;  1V5F A;  4LIV A;  4ZDL A;  4ZYA A;  3A4C A;  3CMM A;  2LG4 A;  1WJA A;  3NWS A;  4XNF A;  3ZCO A;  2JUG A;  2Y0S A;  3SEQ A;  2I8D A;  2V1N A;  4PK4 A;  3F9K A;  2V26 A;  2M7B A;  4HSR A;  2Z1D A;  2HPM A;  4XKB A;  4CA0 A;  2CUJ A;  2X1C A;  4QPQ A;  1U0J A;  3G2B A;  3LSM A;  2VJJ A;  4YEJ A;  2WAQ A;  3SDB A;  1BR1 A;  4BJT A;  1D0X A;  2DJI A;  4H4K C;  4E7H A;  3J7A Y;  2X6X A;  2M3A A;  5JHF A;  4E6K G;  3OYG A;  3OYB A;  3AFH A;  1K6Y A;  2IXS A;  2WY7 Q;  4II3 A;  1Z21 A;  5LFA A;  4XLA A;  1Y56 A;  2VJI A;  2WY8 Q;  1D0Y A;  3N05 A;  3BG6 A;  3C2G A;  2CMP A;  3CF2 A;  4X0G A;  2M7A A;  1QHH D;  3EUA A;  4AYB A;  4C2U A;  2BVM A;  4KT6 A;  1DP3 A;  2K9M A;  4BJ6 C;  3I9V 2;  3S3M A;  2KPM A;  1D0Z A;  1V5E A;  3HUG B;  3H5R A;  3OYM A;  3S3N A;  3A1Y A;  1X1A A;  2VIX A;  2KZV A;  1W36 D;  1D1C A;  3OY9 A;  2KQR A;  4OAZ A;  2ZXI A;  3A2K A;  4IKF A;  4CUG A;  2ZXH A;  3FBI B;  5HLT A;  2XF6 A;  4XLC A;  3IAM 2;  3LFU A;  2E5N A;  2IGK A;  2K9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...