1NG7A

The solution structure of the soluble domain of poliovirus 3a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Towards an understanding of the poliovirus replication complex: the solution structure of the soluble domain of the poliovirus 3A protein.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein
molecule keywords Genome polyprotein [Core protein P3A]
total genus 6
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08727 P3A Poliovirus 3A protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.870 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng7A00
1NG7A
chains in the Genus database with same CATH superfamily
4S05A 2R7ZJ 3HEFA 2JN6A 5LHIA 3JSPA 4ZJZA 4LB5A 1W5CC 1TWAJ 5LD2C 1SC7A 1TTYA 2DA5A 1WPKA 5J6XA 4EGZA 2E34A 2Y75A 2R4GA 2M0CA 1LEBA 3K2AA 1IDYA 4F92B 1QA6A 2IXSA 3MVPA 1EH8A 3QYBA 3KZYA 3ELKA 5GTIC 1WCMJ 1MJBA 2R5YA 3VOEA 1RR8C 2ZXHA 1MBKA 2DYSH 3OIQA 2KT0A 2IS2A 1A6IA 2HOTA 4L5JA 1ZTRA 1B72B 2FD5A 5D8LB 2KHMA 2DA2A 5FRMA 2K27A 3PM1A 3R6SA 2CQ7A 2BY1A 5ILVA 3IHUA 5JVGF 4GO1A 3OYBA 1VQNI 3WE2A 2DOEA 1SAXA 2FBIA 3DWLE 3RYPA 1YX5A 3EYIA 2PMHA 1H88C 2PI0A 1MJAA 4JOMA 5KCMA 3IWFA 2K3PA 3OYAA 2YS9A 2Z33A 1APLC 2KQRA 1LEAA 3PO2J 4JP0A 1P9QC 2HFHA 2DI3A 3TGNA 4CO8A 2PQ8A 5J1RA 5KVRA 3RIRA 1RETA 2VKEA 2XF7A 1A6QA 1OYWA 4UB8C 1DP7P 2HQAA 2DAOA 1D5YA 4LG3A 2C6YA 1MNDA 4RAGA 3FM5A 5EG0A 5TRDA 3C3WA 3OIPA 1FNNA 4XORA 3VPRA 1ZQ3P 3ECHA 1SD6A 1YYVA 1IN5A 3R0AA 1R00A 3BJ6A 2B0LA 1XMKA 2DCEA 5FD6A 2W1OA 3E1SA 1SFEA 5CVRA 2COBA 2MD0A 3EUHA 2BW3B 2F6CA 1KYWA 2UXNA 2XHKA 4HDVA 3PNTA 4PGGA 2YR2A 4OOIA 2O8KA 4AD9A 2XF5A 4NQWA 1ZR2A 1LFBA 3WGIA 4G6DA 4A3GJ 1MMDA 3BQYA 2DMPA 2RKHA 5D6FA 2JA6J 1XX5A 1OISA 2L3DA 3MZYA 1I1SA 4C2MJ 3B73A 4A3BJ 2ECBA 2LG4A 2ZJPF 3O8HA 2Z16A 2NVXJ 1S29A 2A6TA 3DU6A 2V7FA 2E1MB 1RPWA 2PMZA 4IQ4A 1HW2A 3LSHA 1V54H 1T39A 3QYEA 4PSWA 4M6XA 4U0WA 2TCTA 1LDDA 3AG3H 2HXIA 3CCEI 4BJTA 2HU9A 3OYFA 5FLVA 5JR3A 4G6TB 2HR3A 4F93B 2HPMA 3HOUJ 3MKLA 1SVMA 4NHJA 4OIRF 2BGCA 2ELJA 5K5QA 5EZGA 2HEOA 4KMUX 3UNGC 2KZVA 1N25A 3F3XA 3VSLA 1SEUA 4MIMA 3AKZA 3P9KA 2BHYA 5ILUA 2BHZA 1EA3A 2WA0A 1IGNA 1IG7A 5M3MJ 2EV5A 3OYJA 1XPXA 2Y69H 5JHFA 3N4MA 1XC5A 3R60A 3QQAA 2R7SA 2PJPA 3MKYB 1ON2A 3TDUC 2A6EF 5LEJA 3CZ6A 3AG1H 3SFIA 4XQFA 2XSDC 4V19K 1AKHB 3CESA 1RR7A 2DPDA 2VQHA 4HX7A 5E17F 2E7WA 3HTSB 5GADJ 2XF6A 1QGPA 4GCVA 2M45A 3S8PA 1YLFA 3V7RA 3E6BA 2QUFA 2VI6A 1X1BA 4KT5C 5JVTA 1BL0A 2HWVA 3BQZA 3LOCA 4LK0F 3I59A 3C2HA 1X2NA 2EIMH 3VYSB 5C3EJ 5FD5A 1YJNI 4A3CJ 3BTJA 3F6OA 2GOXB 2E7XA 2V9PA 2X6YA 2W57A 3SQNA 4G6QA 4BNCA 2Q0OA 3KCCA 1XD7A 5J3LA 2JA7J 1ZG1A 2V6EA 3K9TA 1Z3XA 5E8IA 1SANA 2EILH 5FKOA 1QNTA 2CQNA 3DKWA 2V1XA 2E2HJ 3KX2A 4A93J 3DCFA 3GYHX 2IGKA 2JTVA 2IBDA 4XBFA 3QODA 5HLIA 2BY0A 3HUGA 4RM2A 3TO7A 2IP2A 2MW8A 5LEKA 3OV8A 1OQYA 2CUJA 2R7VA 4ENMA 2E36A 4MFEA 3CJQB 1BJZA 3TMOA 4A3JJ 1BA5A 1SAUA 3CDLA 5HS7A 4EM1A 1B9MA 3ZQLA 1KQ0A 3DLLF 2QSFX 2OQGA 3OR1C 5F6FA 1U5TC 1MH3A 1Y56A 2HQ5A 5IYBJ 4DIQA 3M8EA 2R7FA 3G73A 3MQ0A 4B1RA 3QPTA 2IS4A 3LA2A 1F9NA 1CF7A 2F5DA 4J01A 2HDDA 2KFDA 5CKTA 3G1LA 5TGTA 2QWWA 2ZB9A 3T1BA 2HPIA 5L3EA 4I2OA 2BVLA 1VQ6I 4U7DA 2Y48A 4BAYA 3EUKL 1MIJA 1H0MA 3QWLA 2HZTA 3LSGA 2R7XA 4RGXA 2OQRA 1ZELA 2VJ5A 2O0YA 4IX7A 1J59A 2M3AA 3ZQ7A 1MBJA 3MEXA 3T5XA 2KPMA 3DEUA 2FMLA 2DFFA 2VJIA 3ECOA 1DGWY 3A0HC 2P81A 4BQQA 1T08B 1TW2A 2OUMA 3W2WA 2X6WA 3HGGA 1PJRA 2LH9A 2R7OA 4B3XA 2R7DA 3FHZA 1I6XA 5DM6F 5IYDJ 4A6DA 2OU2A 2OV7A 2JA5J 2WAEA 4A0YA 4PJNA 1B9NA 1EKEA 3KZZA 4F91B 1FY7A 1YW9A 4GGGA 5EZHA 1QQIA 1Z6TA 3KEOA 1X3WB 2QQAA 2FNPA 4U87A 4HAMA 3I55I 1QO0D 4YIIA 2GM4A 2ZKZA 4NBQA 4Q5SF 3OYDA 3BG9A 2LYCA 4LITA 2F48A 1T38A 3Q9SA 2UXXA 4BHBA 3DF8A 2DN0A 2XIGA 4L0YB 5DUKA 2PFBA 1JUPA 2KZGA 4HF2A 2IJLA 3ZXSA 3S1MJ 4KIGA 4AUXA 3M4OJ 4QTRA 4M3GA 2Y9ZA 2WBMA 2A05A 5EEAA 1FZPB 5E1WA 3CCYA 1AKHA 3D5SC 4I0AA 1CGPA 4L18B 1A5JA 2YX7A 1MBFA 1YJWI 5DV5A 3GCMA 2UV1A 4NB5A 2IPQX 2CV1A 3ZQHA 1FBSA 2NVYJ 1QZEA 4M73A 3TBIA 3H92A 4Y13A 1YFHA 2VOOA 3BG5A 1JT6A 2M7AA 3TDZC 2R3SA 3FBIB 3K6GA 3HPGA 5EYRA 4XKBA 3R0JA 1T95A 1FOYA 3MKZA 3GFMA 5EGOB 4CZZA 5M3FJ 4BU2A 2ZMEB 4XSXF 3H5AA 2WY7Q 1TWHJ 1X3UA 5B1AH 4ENJA 4A0ZA 4BE2A 4RAYA 1JJ6C 3BG7A 3O3KA 1RUNA 1DPRA 5HS9A 1HF0A 4RB3C 2DA6A 3RDIA 5ICFA 2IA0A 2KRCA 3KEQA 1W7PB 2XRNA 3IRQA 3S3NA 1O3TA 5GPAA 5IT9Z 4YEJA 4I02A 2CH0A 1ZGWA 1WFXA 2QSHX 5B5EC 2K85A 2CFOA 1F4KA 4KUMA 2EPFA 5E18F 1YITI 3LSPA 3LSIA 4PZJA 4KJZA 4XL9A 1BW5A 3R4KA 3R61A 1S8NA 2DDAA 2M2EA 2Y2ZA 5E3LA 4WCGA 2RN7A 1I6HJ 3HKZA 1J2XA 2WB1N 5BMZA 1O3QA 2GXBA 4NC7A 2ZJQF 1TQIA 4UVAA 2EFOA 2O8XA 2X48A 5J47A 1EH7A 2K5CA 2GXAA 5AONA 2D5VA 3F23A 3I3LA 5J8CA 3CUQC 3AL0C 1TZLA 1XDSA 2A61A 2ZXJA 5A2QZ 3GZ6A 4XRFA 4HF1A 3GLLA 4CCKA 3L9FA 1FYMA 4O6JA 2M4GA 3MD2A 3TOBA 3J81Z 1O3SA 3I4PA 3J80K 1VQPI 2W84A 3OSFA 2Z5UA 1FOKA 2ZC2A 2NVTJ 4LLLA 2Q1ZB 1X2MA 5LGNA 4AC0A 4QIWN 2E1MC 1Y8RB 3JCUC 4YFNF 2LREA 5F0FA 3JRFA 1K78A 3LQRA 1IW7F 1RC9A 2MG4A 1R58A 3D1NI 3HSFA 4IXAA 3RCOA 2VJJA 2YU3A 1YS7A 4JX4A 3HDDA 1DUXC 1MMAA 2JUGA 4RA2A 4XLHA 1DDNA 1G6NA 5J40A 1FPQA 3RSNA 3F8CA 1BR2A 5D4SA 3A4CA 1YHQI 2E5ZA 2VODA 4CUGA 2HYGD 3DP7A 2LRDA 3ABKH 5F27A 3I9V2 3BP8A 1K6YA 2QCOA 4CCLA 1MNMC 5BPDA 1IAWA 5BOXA 1IN4A 3K0LA 2GLOA 4CICA 1BI0A 2OAZA 3FDYA 2ZO4A 3NRVA 3WU0A 4D9JA 3SDBA 4OIQF 3J7AY 4IEJA 1GV5A 3QYFA 3MFKA 1GV2A 3PSFA 3KZIC 1XSVA 1SMTA 3CQZJ 3FX3A 2LTPA 2XKOA 4HQEA 2EV0A 2ISYA 3NWSA 2JQ7A 2DOFA 1XG1A 3CJTB 3H3VK 3IP4B 1WI3A 2EFNA 3DLAA 4FE4A 1UMQA 2DW4A 2VL8A 4LJZF 2ZFUA 1Y6IA 4EGYA 3OSGA 3J81K 5DS9A 4I98B 3K70C 4MTDA 3E6DA 4UXNA 3S2DJ 1O7FA 2OD5A 3LAJA 1KU9A 2VBZA 3M3YJ 1TQMA 2Z3YA 3PL8A 1F36A 4KA4A 4A12A 3OIOA 2IS6A 1G3WA 1D0ZA 4FETA 3MAJA 3VYUB 4FX0A 1NK3P 4BHPA 4E7ZA 4G94A 2D45A 2W00A 3L00A 2EINH 4IQJA 4Q47A 4PSXA 4XLCA 3FK7A 1EJ9A 3CCRI 4BL0B 3PIOF 1F5TA 3EPZA 3U2RA 1B1BA 2HTJA 3ISPA 5EG0B 2DTZA 1VQ4I 1TP4A 3VB2A 2EJRA 4XLEA 1FYKA 2G9WA 4R8HA 3DEWA 2X51A 3LAPA 4P1WA 3H9QA 2OC6A 5KAFC 1JTXA 4AIHA 3HXLA 2COMA 2RVCA 3CCVI 3SZGA 4D5CA 2HYJA 5L3GA 3CMYA 3ABTA 4GYGA 3GEZA 2PBIA 2DTRA 4BUPA 2FSWA 2HGCA 1I3AA 4IF4A 1ERDA 1D1CA 1D8JA 1ETYA 5LRSA 1Q1VA 2QBYA 4B44A 1G3SA 1Y8QB 4PCQA 3WODF 4EM2A 3KETA 2CQXA 3L2QA 2VASA 4HYEA 2IAIA 2BZTA 2CW0F 2XASA 1T8IA 2KDOA 1TQPA 5HLHA 2ECCA 3KPHA 5K7ZA 3OYKA 2R92J 1FSHA 2XSJC 4IHXA 4B09A 1B72A 3ML6A 3G6EI 5CJ9A 3ZGKA 3ZMVA 5HDGA 2NXNB 4F7ZA 4KITB 1OYIA 1OCTC 4WK8F 3M9AA 3E5XA 1TC3C 2BY3A 2D1VA 1WJCA 4RB1A 1MDMB 1S3JA 5E3NA 4RGRA 4XN3A 3TW6A 4AYBN 1OKRA 4UHTA 4F55A 4UVBA 2G7UA 2ZFWA 4WX9A 4XKVA 1IRFA 3U1DA 1R6RA 4AWXB 2DFHA 5H20A 2K9LA 3L2CA 1HKTA 1P4AA 3S14J 3FXUA 5C4JJ 1JJ8C 4DGWB 3DBLB 2I5UA 2AQEA 1X1DA 1QPMA 1TL8A 1P2FA 3G1OA 3W6JB 2STWA 1BOBA 3EQLF 3NARA 4DBQA 3ZPLA 2W82A 3GTKJ 3JAMZ 3K70D 3HM5A 2EZHA 3F8NA 2LKXA 3H0GJ 4DJAA 1VQKI 5LHHA 3BT9A 3ZQIA 4FT8A 4LIVA 1AHDP 2F5VA 2M5WA 1WRJA 1E17A 2DJIA 4M6YA 3IAS2 4HX4A 1K4TA 2WV1A 4J19A 3ZMZA 4JX6A 2E1CA 1H9TA 5D5WB 2Y0SN 5DCMB 3NWTA 1JXSA 1N77A 2GIVA 1XCBA 2H09A 3SZTA 2MH9A 1GDTA 3J7AO 2QYOA 4NNJA 4B48A 4UUSB 4M3EA 5EJCA 3WE3A 2WV0A 2E5NA 2W48A 5D8KB 4UNOA 3IL2A 2X4HA 2FOKA 4A6EA 3IRRA 2QLZA 1NG6A 1HOMA 1MSFC 5IT3A 4B8XA 3G71I 3S2HJ 5KAIC 3RZOJ 2DK8A 4HSTA 2EZIA 3E6MA 3KLOA 1ZG3A 4CCJA 3DBRB 4CYDA 4WF2A 3FXJA 1X1PA 1V5FA 1BN5A 2HDWA 4IL6C 4UUSA 1UG2A 2ELHA 3ROUA 4A5NA 1S72I 2Z9OA 4RB0A 4LFUA 1IV6A 3IAM2 2DMUA 3BR0A 2L0KA 4OAZA 4IPAA 1MBHA 2CV2A 1ZR4A 2QSGX 1U2WA 3KYDB 2PEXA 4EQQA 2H1KA 2XAQA 1WJDA 4MTEA 5F0CA 2IGNA 4AVPA 1UFMA 3JAMK 1WJBA 1T0FC 2DA3A 2K9MA 4U88A 4C3JJ 1Z77A 3HPHA 1LE8B 3WG9A 1UJ8A 3V42A 2MA3A 3GBGA 2LBFB 2KDZA 1WJEA 2IGMA 3IC7A 3BJAA 1FTZA 1JT0A 3ABMH 3LFKA 3T8TA 3FZVA 1DGRM 4JYKA 5J4YA 4Y52J 2E2IJ 2PLYA 1R5ID 3HRMA 3RKYA 3M1CA 3BC8A 2FU4A 1FSEA 1Y1WJ 3I64A 1V4RA 2LDUA 1VQLI 3COAC 1D0YA 5F0HA 2EZLA 1ULYA 3ZN1A 5BS6A 4EMSA 3HRUA 1MMSA 4ESFA 2OBPA 5M5YJ 2HOEA 1WGXA 1CQTA 2L9VA 1BC8C 1A04A 4CYCA 2XB5A 1WWXA 2QF7A 3IKVA 2UZKA 2WADA 1HSTA 1Y0NA 5IOZA 1RUOA 2VT2A 3ABUA 3BZKA 5CQGA 1R5GA 3GTPJ 1V3FA 4MNUA 5ICCA 3RPUD 1EF4A 2TDXA 3W6KB 2DDBA 2ICWG 1QBJA 3QP6A 1WQ2A 3OL3A 2DLLA 3WGGA 2E1OA 2HQRA 2QQ9A 2K9SA 4IHTA 3SYTA 3D0SA 4GDFA 4II2A 2ZCWA 4L0ZB 1JHHA 1VQ8I 2JVGA 2M0MA 3FKJA 1U0JA 4C30A 4C9YA 5DYMA 5IP6A 2EK5A 5EEHA 3CCLI 1JI8A 1Z7UA 5E8GA 2ZMEC 5ED4A 4LB6B 5GAHJ 3ZN0A 1LDKB 1N75A 4FISA 5DM7F 3PNVA 3H5RA 1E0EA 4C3HJ 3ZQFA 2VKVA 1QVUA 1YOVB 1K83J 3CLQA 1ZKGA 4CCNA 3GVAA 1IO2A 2F4IA 2YX4A 4BH9A 1R5HA 3SJMA 1EH6A 3BOQA 4KICA 1ZG5A 1Z7LA 1HCRA 5EEGA 1S7EA 3JTHA 2V1NA 3B02A 5L3CA 1PUFA 2AHQA 2VQGA 2STTA 3OS0A 4AIDA 1W5SA 4PFPA 1JGSA 2QKMB 3IKTA 4KN7X 2R5ZA 1KYZA 3BPXA 4AU7A 4ANJA 1ZHFA 1GLNA 4HSRA 3LSMA 2KKOA 3OL4A 3QPSA 4QLCU 2RGVA 2K4BA 2JA8J 4NDLA 1WH5A 2M9HA 2DT6A 2BW3A 3H9GA 4S0HB 1IF1A 2QEXI 4Q48A 2IEKA 1R49A 2M87A 1X4OA 2ADUA 3IUOA 3F22A 4R1HA 1ZN2A 4BJ6C 3L2WA 3OYLA 2LKSA 3K10A 4N4OB 4AM3A 1OR7C 3HJEA 1FX7A 1A31A 1T6SA 1W0TA 3D5LA 4DQ2A 1F1ZA 3PO3J 3M8JA 1B4AA 5LHGA 3CCUI 2IT0A 2P7VB 2HNHA 3OWTA 1S5LC 2P4WA 3B6AA 2DFIA 2JRTA 1ONVA 4M9SA 3BG6A 1POGA 2GWRA 1P92A 3GTLJ 2KIUA 3F8MA 3ERMA 2M30A 1W1WE 4G12A 4KNYA 3PFIA 4HNUA 4IRGA 1SD5A 3DPTA 2NRAC 2BE5F 2XGCA 3CJNA 4A0XA 3OYCA 1W0UA 5FO5A 2CRGA 1UAAA 2JPBA 1G8XA 3ZQQA 2X1EA 4ZYAA 1LFPA 1XGSA 1DQUA 1ZREA 3OMYA 4I99C 5DD4A 4ESJA 1VI0A 4L9JA 4DOZA 2D1HA 4A3DJ 3HYIA 4A5MA 3OR2C 2LF7A 1DP3A 3K7AJ 3RZDJ 1YRNB 3AG2H 3LWFA 4C3IJ 3L2UA 2ZBKA 2W7NA 4HF0A 4ZYGA 2EFQA 4L9VA 3CF2A 2VPRA 4AIJA 4I7HA 3ZOBA 1MSEC 2CQQA 2M7BA 3GLXA 2H94A 2V1DA 1E3OC 3WHBA 2IGOA 1PYVA 4I01A 3HOXJ 1ZRFA 1FBUA 3DXJF 3CCQI 2HOAA 2NAZA 2XKPA 2N8GA 2KISA 4RGSA 3H3UA 2L7ZA 4UV8A 4EATA 4GRIA 2FJ1A 2W4SA 3VYRB 3REOA 3VFZA 1I5ZA 2KRFA 4EJTA 4A3KJ 5IP9J 3O8GA 3PUFA 1KU3A 3I71A 4P55A 1QZYA 2ZXIA 3KFWX 4L5IA 1X3ZB 3HOYJ 3S1QJ 3I53A 1MDMA 1D5VA 3BJOA 2OA4A 3WTTC 4N0BA 2I10A 1I3QJ 3GFIA 4NQWB 2DT5A 3TO6A 4IO9F 1RKWA 3HOZJ 3AAFA 2AQFA 2NNYA 4EJOA 3F9KA 1YW7A 2Q2EB 2GAUA 2B63J 1FYLA 1NK2P 1X4PA 4MFDA 1U3EM 4Y3OA 1LQ1A 1OLTA 3I56I 4A3EJ 1PUFB 1YO5C 4XOPA 1BM9A 4OMYA 1K61A 2JSCA 4HEA2 5FKMA 1PP8F 3CF5F 2FX0A 4XOTA 2MABA 4E7JA 1SFXA 3P5JA 4MLOA 4UV9A 1UHSA 1E2XA 4I0BA 3K69A 4DYQA 2ID3A 2LC2A 3AG4H 3QOPA 2F5CA 1RKTA 4A2UA 2VQCA 3BCAA 4KFCA 2WTEA 3KYLA 5IP7J 3HGYA 5HLGA 3CCSI 5HNFA 1YI2I 1TW3A 1L0OC 4C2TA 4IVNA 4IHYA 2DT7B 2E35A 1VF9A 1FOWA 1H89C 2EH3A 1U5TA 2GA1A 2L9NA 2A5YB 4K2EA 5H6RA 1QVTA 4HBLA 5CQEA 1ETKA 4CGZA 3MZHA 1WHUA 3SFZA 3LA7A 1GT0C 1VQ7I 1BOAA 1ETQA 4RM3A 1UHMA 1MKMA 1HSJA 2GQQA 4G7ZF 3X2QH 1QHHD 4BE1A 4FHTA 5KNLA 4G8XA 2JK3A 2J5PA 2A68F 5K1YA 3HOSA 4M9ZA 3JRGA 5HS8A 1DU0A 4P9UA 1SMYF 2OF7A 3S32A 1VNDA 2JA2A 3I54A 1W4MA 4HLXA 5HDKA 4CCOA 1K7AA 1R71A 2Y9YA 4PJMA 4HDUA 3K1PA 2DXIA 5B3SH 4PJLA 5B66C 3DEEA 2FUG2 4TV7A 3V7SA 4XMYA 1E3HA 1GUUA 3FXKA 4PDKA 2TRTA 1TNTA 4Z6YA 4HQMA 1TT5B 4ZC3A 3A2KA 2IRFG 4BDYA 3NAUA 1ETVA 2L02A 4YG2F 3BZ6A 1U8BA 4IHVA 3P9CA 2ME6A 1BR1A 2LY1A 3U21A 2Z99A 3V8KA 2W85A 3JREA 1FJLA 2R7UA 2O5RA 4KT6A 5F1RA 2M1BA 3BLYA 1XS9A 2BXZA 4MGRA 5D4RA 2DYRH 3HG9A 5IYCJ 4BQAA 3FISA 4LG0A 3HL2A 5LRRA 3RI4A 5FLXZ 2D2WA 1ZARA 2LOOA 2DQLA 3S2WA 3ZQCA 4M3FA 1S7OA 4QPOA 5CVVA 3FBNB 1Z6RA 2VKDA 5BPIA 3A1YA 3QU3A 2OZ6A 4RBOA 2V9VA 2K86A 1U8RA 2ISZA 2R93J 1BI3A 3OS2A 4MO7A 1BR4A 3LFUA 1LJ9A 2VB6A 3JRBA 3FM3A 1O57A 2KIMA 1YW8A 3LQQA 4L5EA 1U5TB 2RAEA 3CCJI 2EWNA 4E7KA 4ENNA 1XTAA 4HW0A 1EV7A 2H1LA 3LL7A 1LPQA 4FQGA 2P5VA 1MD0A 2H6CA 3M1EA 1OR7A 1VQ5I 4GFBA 1W7PA 2MBFA 3I5UA 3DPLC 4BKXA 3CD6I 2IW5A 3EUHC 3WTYC 1U9OA 3FXLA 2O3FA 1LKXA 3JW4A 4IHWA 1NH3A 3BY6A 4BEHB 1S7AA 3PIPF 3LSKA 2VBXA 1JKPC 4D1QA 5F64A 3FK6A 4Y15A 3HKZN 2QA4I 3C2BA 4BBRJ 1IDZA 4U7BA 5KK1A 2JT1A 2R0QC 3I4NJ 3QPHA 5FLXK 2XAHA 3H35A 5EF6A 3V7CA 4D7NA 1STZA 1V5EA 1T98A 1J0RA 2HKOA 3FXQA 3BZCA 3WU2C 1VQMI 1O4XA 2CV0A 2VC1A 2FE3A 1FOXA 1LVKA 2LNBA 3H1CA 2L4MA 3OOPA 5ILSA 3RPQA 1REPC 1ON1A 2VN2A 3ZP5A 2I8DA 5LLQA 4RLQA 1V55H 4KN4X 1QHGA 1MW7A 1USTA 2FA5A 1ZYRF 1XGNA 3BDDA 3O2PE 5E1XA 2DMTA 3BWGA 5BQTA 3RQ4A 1XMXA 2JSPA 3PNYA 1ITYA 2HVQA 4IRIA 1MJ9A 3K4LA 3K1NA 3KP7A 1UZCA 3LSJA 3SEQA 4XRSA 2E2JJ 3CP8A 5E20A 4HA8A 3NEUA 2KRHA 4PJJA 4AVZA 1BI2A 1ZK8A 1BJAA 4XLAA 4A3MJ 4RLFA 3VODA 1I39A 2LLKA 2HTSA 4M74A 3BR2A 2WAQA 5J1UA 3GTQJ 5IOYA 4E4HA 4ZDOA 4YIRX 1X1CA 3F72A 3WTUC 2EA2A 1XSDA 3K4CA 1W5TA 2W25A 1KZHA 4ZZDA 2QVOA 2X6OA 4W97A 5LGTA 4E7IA 3TP0A 2FXAA 4HNVA 1GXQA 3FXRA 2Q8KA 3MKWB 1H9GA 2IA1A 2ZMEA 2MFZA 4BY1J 2KIQA 1IC8A 4RAFA 2Z2SB 2GBYA 1HKSA 4ETSA 3BR5A 3NQOA 2DBBA 3G2BA 5DD8A 2BV6A 2CG4A 1OFCX 5FB2A 3HOVJ 3J7YJ 3E5UA 1UG0A 4NC8A 1N78A 2OTJI 4MHGA 1R1TA 4XLPF 5K5OA 1LDJA 2LR8A 4LMYA 1FP2A 2F5EA 1RIOH 1TLHB 4XM3A 4LOCA 1ZH5A 2L54A 4EJVA 2R7RA 2CUFA 3OY9A 2PJRA 1TWGJ 3P7NA 1Q1HA 1R4MB 2DK5A 2K7LA 2HS5A 3VDXA 1QU3A 2XAGA 1XN7A 2Y30A 4CXFA 3HB9A 2F5FA 1D3YA 4A3LJ 1R4NB 5JI6A 1B6AA 3C18A 2LF8A 2NNNA 4ABZA 1VQOI 2X1DA 4KMFA 4IOCF 4HNTA 1ACIA 3JR9A 1HW1A 1FT9A 3WTZA 3OS1A 4LD5A 1I50J 1YS6A 3ULQB 4A3IJ 1Z67A 3OOUA 1OCPA 4IKFA 5E79C 1BIBA 2FRHA 2HDCA 1Z1DA 5F08A 1AOYA 2JMWA 2VT3A 1ZRDA 2DMQA 3H0DA 2HXOA 4OINF 3MMYB 2VONA 5IT9K 2M8GX 1I27A 5EGOA 2WAFA 2O03A 2CJJA 1H8AC 4GXOA 4OWRB 2F2EA 3ABLH 4Q4ZF 4CYCB 2WWYA 2KJCA 2Y31A 4MQ9F 2A6HF 5LGUA 3K4BA 3QOEA 1BW6A 3FF5A 4OAYA 2QQBA 3GFJA 1SFUA 4XKWA 5DDGA 2K9NA 1XB4A 4HZFA 2QBYB 3C7JA 3H3ZA 4E6KG 1WZ2A 5DUIA 1KQ8A 1JUSA 4ESBA 3W6VA 3TP3A 4PJ0C 1HQCA 1IXRC 5HODA 5FJ8J 1AU7A 3Q3SA 4WXHA 2NVQJ 4D7MA 2IS1A 4BDZA 1NHAA 5K7FA 3CJRB 5F1JA 1J5YA 4G7OF 5GAGJ 4V2FA 1OCOH 3G4SI 4I76A 5C44J 3L2RA 1W36C 5M5WJ 2YUSA 3K2ZA 3L7WA 2V9KA 1KU7A 5CVJA 1G3TA 3Q9VA 3J80Z 2HVRA 4ZYEA 3C1DA 3HBLA 1ORKA 3GZNB 1BI1A 3QRFF 5GAEJ 2LMDA 3UR3C 3TOAA 2PMZN 5D6EA 4PUSA 1HA8A 4B47A 1PUEE 4XSZF 1HW5A 2E1NA 2VE9A 4O5VA 2ZNYA 3WG7H 1HKQA 1WSUA 5F04A 1S9HA 1YIOA 5FLMJ 5ICGA 4FASD 1USSA 1R7JA 3I58A 1KONA 3KYCB 4BJ5C 4PFOA 3S15J 1F43A 3KP5A 3DTIA 3RQIA 2ESNA 2BEOA 3ZMSA 3K4MA 3L2VA 4LLGF 2G7HA 3WTVC 2DMNA 3QPLA 5KHDA 3TL4X 1J09A 3PSIA 1FP1D 4ZDLA 3A0BC 2EB7A 4CSWA 2JJ7A 1YG2A 2BY2A 4WXDA 3K4JA 3JRDA 2CU7A 2Y0SA 2DO7A 1W36D 5TISC 4LGWA 3KIOA 2CS3A 2CMPA 1XDUA 2FNAA 4BXFA 3JRAA 6PAXA 4H4KC 1R22A 2ZXWH 4F3QA 3ERED 3HTUA 2XAFA 2Y0MA 1MMGA 3FKIJ 2WAQN 3N05A 2XRLA 2XGXA 3WGHA 4E7SA 2X1CA 3CUQB 3CUOA 2CO5A 2H8WA 1M1EB 1RI7A 3GZ5A 2B7EA 5GTHC 2MC4A 4RGUA 1B8IB 4XK4A 3CMEI 2DU9A 2PJRB 2A07F 4YRVA 3IWZA 1R23A 4FE7A 2FQ3A 4D5FA 4UVCA 2YPRA 4HV5A 3HHHA 3BR1A 4BY7J 3K4KA 1TT0A 4ZZLA 1PDNC 1A35A 3DPUA 2KLOA 1SFKA 1UB9A 5FFXA 2X9DA 2P0WA 1P4XA 1K79A 5E3MA 3E7LA 1TWFJ 1SD4A 2VQLA 3QP5A 1D1BA 3CCMI 3QU6A 1RRJA 3ESWB 4IJAA 4X6AJ 4EJUA 4Z2YA 4DYRA 1YE9A 3LA3A 1UELB 3DBHB 2VLAA 1XGOA 4WWCA 2FF4A 1MGTA 4EVIA 1Y39A 4LIUA 2HOSA 2VKHA 4M3DA 2ZSIB 3Q5FA 1XSXA 5HVQC 2OJED 3E0JB 1G2HA 2GOMA 3KLNA 1LFUP 4RAZA 2OCEA 2XPUA 2R5ZB 1SVLA 4CDGA 2L2OA 1J75A 2JWTA 1I1GA 5IY5H 2FBHA 2XGEA 4RMNA 5ICEA 3DV8A 1RNLA 3BTLA 3OYEA 2CFXA 1W7PD 5C4XJ 3E5QA 3CO7C 5DCFA 5FKKA 5A2QK 2K3FA 5GPCA 3RKQA 1OYYA 3TKYA 1MNEA 2EFWA 1XCVA 1K6OA 4HX8A 1RESA 1QPIA 4BQOA 2P5KA 3GUDA 4BQNA 4N4NB 4E7HA 1YTYA 1WKMA 2DA7A 1T33A 2FBKA 3L09A 2DA1A 2MSYA 3WTSC 2DA4A 2WY8Q 3GF2A 4JBAA 1A36A 3W2AA 2KIFA 4RDUA 5BNGA 3PFYA 2EIKH 2ZNZA 3P9IA 1IZ1A 1SD7A 5DEQA 3Q0UA 2CQKA 1ZAOA 2H8RA 3K4NA 2VUMJ 1MH4A 1JHFA 3KE2A 5CLSA 4F52A 3TO9A 2GZWA 1IRGA 4XNFA 2O6GE 1AWCA 2RC4A 4E70A 2WB1A 5FGMA 5LFAA 3JRHA 3CMMA 5JLXA 2R7TA 3F6VA 4JX5A 1YIJI 5FKNA 3RTRA 4UUVA 1HDDC 2XAUA 2BVMA 1D1AA 3S17J 3PQKA 1X58A 3IH2A 4Y33A 1Z21A 2RNGA 2JVHA 2ESHA 5FFZA 1IRXA 5ERIA 2DQRA 2OZUA 3N97A 3E97A 5M5XJ 2R7QA 5E1ZB 1GVDA 1MMNA 1P7JA 1WJFA 3OYHA 3SDGA 4A3FJ 4DZPA 3H36A 3A01A 2V1UA 3LSTA 1LE8A 4FX4A 1QRYA 4LK1F 4O3MA 2NYXA 4N9HA 3FXMA 2H6BA 4XRSG 1LNWA 3Q0VA 2KP6A 3MCZA 3BCBA 2MD5A 3VSKA 2DFEA 1LVAA 2PMUA 3CMAI 2E60A 1QZZA 4XLFA 1ZLKA 1J9IA 3GWZA 4ON0A 2RDPA 1OPCA 2M8EA 1IN7A 4KIBA 1KU2A 1HBXG 1DPUA 4BGDA 3HOWJ 1TBXA 4OIOF 1G4DA 2JZYA 2LK2A 1NG7A 5CVUA 2EFPA 5JLWA 1C0WA 3C2GA 1UCRA 4XRMA 2VXZA 4BS9A 2W24A 2LKPA 3F0CA 5L3DA 3CC2I 1IN8A 1FIPA 3M7GA 2CSOA 3GXOA 3F8BA 3H9JA 5H6QA 3RPUA 4YFXF 2RV8A 4GYIA 5J1YA 2HI3A 2VIXA 2L5QA 3V8JA 2GIZA 1P4WA 1J7KA 4M3BA 3CUQA 3HHGA 4LLNA 2X0LA 2GXGA 2L7MP 4ZH4F 4ZTJA 3EYYA 2CYYA 2NOGA 3AL0B 4ZYDA 1OMIA 4S04A 3KP3A 3G1MA 4M71A 2L7FP 1WJAA 3GTOJ 3I0TA 2NOJB 3ASNH 4EM0B 2DJNA 5D5XB 5AIPA 3GMEA 1JKQC 3S1NJ 1S6LA 4Y17A 3IH4A 3DQVC 1WVRA 2X85A 3K1MA 3ZMDA 4BBSJ 2WC2A 5DCMA 1FTTA 1XGMA 2M34A 2IA2A 5IPAA 2LY2A 1FMWA 3CLOA 4U0VA 4QPQA 4ZYHA 3S1RJ 2CGPA 1VZ0A 1X19A 2XVCA 3GW2A 3GTGJ 4G9YA 1RZ4A 2V6CA 3BR6A 1ZGAA 4M72A 4H0EA 2J5OA 1IV8A 5K5RA 5HOOA 3ZRGA 5CYVA 2MLGA 2UUZA 2EA4A 2PG4A 2JRMA 4HV6A 3CO6C 1T56A 1WJ5A 2PX9A 3HRSA 3DKYA 1YJ9I 2HQNA 5EDNA 2ME0A 2P6TA 2P7CB 2MGQA 4PK4A 1E3PA 1FBQA 3ZQGA 3DTKA 5CPRB 1O7LA 3I59B 3DFGA 4JQFA 3E3VA 1HLVA 1L3LA 4DZJA 2VBYA 2EV6A 4XKCA 3OYGA 1VTNC 2FOWA 1JE8A 3FHNA 2GA2A 1JTYA 2DODA 3KEYA 4CHUA 4XR6A 1ETOA 2P8TA 3KP2A 1PP7U 3VEPA 3OYMA 2FQ4A 3CC7I 1R1UA 4HLYA 4L9TA 4X0GA 4P5OA 3F21A 4OIPF 3RKWA 2LBFA 2NS0A 3CDIA 1D0XA 4FTHA 1OJLA 3WTXC 2VE8A 3CC4I 1BC7C 1U9NA 2MLKA 2XUBA 3HUGB 2Z1DA 2LY9A 2ZJ2A 1MBGA 1Z0XA 1LB2A 5AIQA 4UUTA 3DKXA 2ID6A 3ZCOA 4G7HF 3W2VA 3JSOA 3PUBA 2PN6A 2XGDA 2NVUB 4XN0A 2LP0A 3CDHA 3MN2A 4KYWA 3RYRA 2BBYA 2QZ8A 4DYCA 3D5RC 5JHUA 3GTJJ 1U78A 1Y1VJ 3A03A 1JGGA 2AXTC 3JRCA 2FEZA 2BYVE 4EEFG 5L3BA 4U0YA 2DOAA 2E71A 3DU5A 3BPVA 5LBQA 4OMZA 2VC0A 2XDVA 2HYFA 1KGSA 2V79A 1ETXA 1Z3YA 1MBEA 1ZGJA 1G59A 2YU9J 4KDPA 4AYBA 4XLNF 4BE0A 4LG0B 3W3CA 4KISA 1CF7B 3GX4X 4MEXF 3JRIA 2O7OA 3T0YA 2XC7A 2ACJA 4BACA 1YRNA 4X1EA 2QM3A 3OYNA 1R36A 3RJPA 2F4OB 3MZ8A 3S16J 1JUMA 5D5UB 4ENKA 5FRNA 1ODDA 1B8IA 3EUAA 4HG2A 1TNSA 2CW7A 3M8FA 2RQQA 4CZCA 4NUBA 2K40A 4IZZA 2UWMA 2RNJA 2A5WA 3ONQA 3PQJA 1IJWC 2P5LC 1VFCA 2CUEA 3FMQA 4EJWA 2RREA 2FMYA 2OPTA 2MC3A 4B3AA 2AO9A 3WTWC 1P6RA 4EV0A 1BIAA 3U1KA 1TWCJ 1O3RA 2K9QA 1WI9A 5CVIA 1YQAA 4E7LA 3HIFA 1GVJA 2IVMA 3EDPA 1KQ9A 3FMRA 2X6XA 2O9LA 1ETWA 1NTCA 4PGHA 2M4KA 4J00A 2L9SA 4IHSA 3KP4A 3S3MA 3BTCA 3O6BB 3HOTA 2QKLB 2F4MB 3HZJA 1GXPA 4RB2C 3CP2A 4D0PA 2HVSA 1UHWA 3EETA 1HXDA 2EQRA 1X1AA 1HDPA 3WHCA 2VXDA 3FXOA 1R1VA 3HRTA 4UY8I 1FC3A 2KMUA 4FCYA 5HNHA 2KJBA 3HSEA 1WH7A 3BROA 3J7ZI 2R5YB 2L9RA 2QQ8A 4ITVA 1OCCH 2VBWA 2BOLA 1HC8A 4M6VA 2ZJRF 1Z9CA 3V4GA 1AA7A 4B4CA 5JFRA 3IH3A 4P96A 1FIAA 4M9XA 4CA0A 3SZPA 4YELA 2K02A 4XONA 2LVSA 1IXSB 3BG3A 1MZBA 1ZLJA 3FMSA 3A01B 3DTEA 4CH7A 3KP6A 3S93A 4YFKF 2XPVA 4XICA 2LFBA 3TEDA 4DNCA 2XAJA 2XPWA 4IRHA 1GHCA 3ASOH 3FWEA 2MYSA 5HDNA 2H27A 4CCMA 3SHFA 4ZDPA 5J4VA 1IN6A 2MH2A 2L7KA 2L01A 2QGUA 2P6SA 3ZR8X 1BBYA 3BTIA 3M07A 2YSRA 3S3OA 2AS5F 3HC7A 5FKLA 1DU6A 4V2GA 1Y0UA 3GO5A 2CW8A 2QENA 4MEYF 3IV5A 4A69C 4BHCA 1R9TJ 1K78B 4L9NA 4HPQA 1YX3A 2E19A 4MQVA 3WU1B 3GFLA 5D5VB 2VOPA 4B43A 3LSRA 2ELKA 4HOBA 3GTMJ 3CTAA 1V5GA 1XMAA 1VQ9I 2CUZA 1ZRCA 4BEHA 4I09A 2KL4A 5E3OA 2XROA 4I6ZA 4QSHA 2AXLA 2EIJH 2EBIA 5H2FC 3TQNA 2VPLA 4YIFA 4JK1X 1LUJB 2VJ4A 2A69F 5DTDA 2OTLI 5J8FA 5TJJA 1D8KA 2R7WA 1K4SA 2K4JA 2L4AA 2Q2EA 2BXYA 4WXCA 2G0EA 1FWZA 9ANTA 1FLIA 1B59A 4II3A 2NS8A 3F8FA 3B6CA 4UB6C 1T2KA 3ZMUA 4W1UA 2XB0X 4ZTFA 3U9GA 2DPUA 1Z05A 5FROA 2V26A 3V8LA 1SFOJ 2RQPA 1OCRH 3LNQA 1T0FA 1JKRC 4QWQA 4RS8A 3QAHA 3T8RA 1IXCA 1IUYA 1G3YA 4DW6A 3TW7A 1PVEA 1FEXA 4Y4RA 3SXYA 4P9FA 4XIDA 3VWBA 3ZMTA 2O61A 1P7IA 2ETHA 3OYIA 3A02A 1SVOA 1FMVA 4HRIA 2JPCA 1U6GA 4BYYA 4IOAF 2HZDA 2ZSHB 1IRZA 1JKOC 3PJRA 4DBRA 4N9IA 3Q0WA 5K7HA 5L3FA 3UKGA 2OCCH 2CWEA 3RKXA 1OCZH 3LMMA 4NC6A 2NS7A 3H5NA 3I4MJ 2LSOA 3JTGA 3VYTB 2HKXA 5HLTA 4AIKA 5B1BH 4C2UA 3L1PA 5GP9A 2XV4S 1ENHA 3AFHA 3HSRA 2V4JC 4BXUA 4KIFA 4OU0A 4ASNA 3MWMA 3E6CC 4BXXJ 2JUCA 3SEZA 2A3SA 1KA8A 4R79A 2B9SA 2LD5A 2EZKA 1Z91A 4Y7NJ 1IUFA 3FIWA 3G3ZA 3BR3A
chains in the Genus database with same CATH topology
3QYFA 4XOTA 2MABA 4RMNA 4E7JA 3PSFA 4ZJZA 4MLOA 3OYEA 5LD2C 3NWSA 3IP4B 3DLAA 2LC2A 2R4GA 1MNEA 2VL8A 4F92B 2ZFUA 1Y6IA 4BQOA 2VQCA 2IXSA 3BCAA 3QYBA 3KYLA 3K70C 4BQNA 4N4NB 4E7HA 5HNFA 2ZXHA 4C2TA 3OIQA 2IS2A 2DT7B 3PL8A 2IS6A 1D0ZA 4FETA 2WY8Q 3W2AA 3VYUB 2L9NA 2KHMA 3PFYA 4E7ZA 5FRMA 2W00A 5CQEA 3OYBA 4IQJA 4PSXA 4XLCA 3K4NA 4BL0B 4RM3A 3DWLE 4F52A 1YX5A 3EPZA 4XNFA 1QHHD 4BE1A 2WB1A 4JOMA 5KCMA 5LFAA 5KNLA 2K3PA 3CMMA 2R7TA 3HOSA 3OYAA 4XLEA 3RTRA 2KQRA 1P9QC 3S32A 2X51A 2XAUA 2BVMA 2JA2A 4P1WA 3H9QA 1D1AA 2OC6A 3HXLA 4CCOA 2XF7A 4Y33A 2HQAA 4PJMA 2DXIA 3SZGA 1Z21A 4LG3A 4PJLA 2RNGA 3DEEA 2FUG2 1MNDA 4XMYA 2JVHA 4BUPA 1IRXA 4ZC3A 3A2KA 3OIPA 1ERDA 1D1CA 4BDYA 2R7QA 4XORA 1MMNA 3OYHA 1WJFA 4B44A 3U21A 1BR1A 2LY1A 3L2QA 2VASA 2R7UA 2O5RA 4KT6A 2DCEA 2KDOA 2W1OA 3OYKA 3E1SA 3BLYA 2XSJC 2MD0A 2BW3B 2F6CA 3HG9A 2KP6A 3BCBA 3HL2A 3PNTA 3ZGKA 4KITB 2LOOA 2XF5A 3VSKA 4QPOA 2E60A 1WJCA 1MMDA 3FBNB 4XLFA 2VKDA 3A1YA 4XN3A 4BGDA 4F55A 3OS2A 1BR4A 3LFUA 2VB6A 4XKVA 1NG7A 2LG4A 3C2GA 1R6RA 2Z16A 2K9LA 2VXZA 2A6TA 3DU6A 2V7FA 2E1MB 2PMZA 4IQ4A 4BS9A 4DGWB 4E7KA 3LSHA 2AQEA 3LL7A 3QYEA 4PSWA 1X1DA 3H9JA 1BOBA 2VIXA 2HU9A 4BJTA 3OYFA 4DBQA 2W82A 4G6TB 2L5QA 3K70D 4F93B 2HPMA 3DPLC 2ELJA 3EUHC 4ZTJA 4DJAA 3UNGC 2KZVA 4LIVA 3VSLA 3AL0B 1LKXA 3AKZA 2F5VA 2DJIA 4BEHB 3IAS2 1EA3A 2WA0A 3LSKA 3OYJA 1WJAA 4D1QA 3NWTA 1N77A 5JHFA 2NOJB 2R7SA 4U7BA 4NNJA 3MKYB 4B48A 3CZ6A 3DQVC 2X85A 2E5NA 4XQFA 3H35A 3CESA 2LY2A 1FMWA 4QPQA 1NG6A 1V5EA 1VZ0A 2VQHA 1X19A 2XF6A 4HSTA 2CV0A 3S8PA 4CCJA 1LVKA 1X1BA 5HOOA 2I8DA 3ZRGA 4RLQA 2UUZA 1V5FA 2HDWA 1QHGA 1MW7A 1WJ5A 3IAM2 4OAZA 2CV2A 3C2HA 3DKYA 3RQ4A 2JSPA 3PNYA 3VYSB 2HVQA 2GOXB 4PK4A 3K4LA 3DTKA 1WJDA 2X6YA 5CPRB 3SEQA 4JQFA 2IGNA 1WJBA 3CP8A 1T0FC 4PJJA 2KRHA 2K9MA 4XKCA 3OYGA 4AVZA 3HPHA 4XLAA 3V42A 3FHNA 3GBGA 4RLFA 2V6EA 1Z3XA 3KEYA 2LBFB 1WJEA 2IGMA 4XR6A 2WAQA 4E4HA 4ZDOA 3OYMA 1DGRM 1X1CA 3KX2A 4X0GA 4P5OA 2IGKA 3K4CA 3QODA 4RM2A 3M1CA 3BC8A 2LBFA 4E7IA 2CUJA 1D0XA 2R7VA 3MKWB 3CJQB 3TMOA 1D0YA 2MFZA 3HUGB 2Z1DA 1SAUA 2Z2SB 3DKXA 3ZCOA 3W2VA 3PUBA 3OR1C 4XN0A 3G2BA 3D5RC 1Y56A 3J7AY 4DIQA 1UG0A 4NC8A 1N78A 2WADA 2IS4A 2DOAA 3DU5A 5CQGA 2XDVA 4J01A 5CKTA 1Z3YA 4XM3A 5TGTA 3RPUD 2R7RA 1G59A 2HPIA 4AYBA 2PJRA 3OY9A 4BE0A 2BVLA 3W3CA 3VDXA 3OL3A 4KISA 1QU3A 3EUKL 3SYTA 4II2A 3LSGA 2XC7A 2R7XA 2JVGA 4BACA 1ZELA 2M0MA 2VJ5A 3FKJA 1U0JA 4IX7A 4C30A 2M3AA 4C9YA 2X1DA 3OYNA 2KPMA 4HNTA 1JI8A 2VJIA 1DGWY 5FRNA 3OS1A 1LDKB 3EUAA 1N75A 4HG2A 4BQQA 2CW7A 3OOUA 2OUMA 2RQQA 3PNVA 3H5RA 2X6WA 4NUBA 3W2WA 4CZCA 1PJRA 2LH9A 1E0EA 2R7OA 4IZZA 4IKFA 4B3XA 2UWMA 2A5WA 3ONQA 4CCNA 2F4IA 2OV7A 3H0DA 2RREA 2WAEA 3MMYB 1Z7LA 4PJNA 2WAFA 4F91B 4OWRB 2V1NA 4E7LA 4U87A 2X6XA 3K4BA 2VQGA 3QOEA 4OAYA 3OS0A 2M4KA 4PFPA 4J00A 2L9SA 2QKMB 4XKWA 3S3MA 3OYDA 3HOTA 4AU7A 2QKLB 4ANJA 2LYCA 4E6KG 4LITA 1GLNA 4HSRA 3CP2A 2HVSA 3LSMA 1X1AA 3OL4A 2VXDA 3ZXSA 2DT6A 2BW3A 3H9GA 2KMUA 2WBMA 5HNHA 2IS1A 4BDZA 1X4OA 3IUOA 3D5SC 4BJ6C 3L2WA 3CJRB 4ITVA 3OYLA 3K10A 4N4OB 2BOLA 1OR7C 1AA7A 2UV1A 2CV1A 3L2RA 1W36C 3D5LA 2V9KA 4CA0A 4YELA 4XONA 3TBIA 2HVRA 3M8JA 2M7AA 3FBIB 3K6GA 3HPGA 3DTEA 4XKBA 4CH7A 3S93A 2HNHA 1T95A 3OWTA 3MKZA 3UR3C 4BU2A 4PUSA 3H5AA 2MYSA 1HA8A 3BG6A 4B47A 4CCMA 2WY7Q 4ZDPA 2L7KA 3ZR8X 3S3OA 4BE2A 3HC7A 3BG7A 1S9HA 2CW8A 4HNUA 4FASD 2KRCA 4HPQA 3DPTA 1YX3A 3S3NA 1KONA 4YEJA 4BJ5C 2CH0A 1WFXA 4B43A 4PFOA 3OYCA 2CFOA 3DTIA 1UAAA 1G8XA 3ZQQA 2X1EA 3K4MA 4ZYAA 3LSIA 3L2VA 1V5GA 4KJZA 1LFPA 4XL9A 1DQUA 3OMYA 2CUZA 5KHDA 3TL4X 4BEHA 1J09A 3PSIA 2KL4A 4ZDLA 4DOZA 3HKZA 3OR2C 4CSWA 1DP3A 3K4JA 4NC7A 2VPLA 2Y0SA 3L2UA 1W36D 2W7NA 2VJ4A 2K5CA 2CS3A 2CMPA 4BXFA 4H4KC 3I3LA 2R7WA 4F3QA 3CF2A 3AL0C 1MMGA 1TZLA 3N05A 2M7BA 2X1CA 4E7SA 4II3A 2IGOA 4CCKA 1PYVA 2MC4A 2M4GA 4ZTFA 3MD2A 2V26A 5FROA 2PJRB 4YRVA 2Q1ZB 2E1MC 4EATA 4GRIA 2LREA 2W4SA 3VYRB 3K4KA 1TT0A 4Y4RA 3DPUA 3VWBA 2KLOA 1SFKA 3RCOA 2VJJA 3OYIA 2P0WA 1MMAA 2JUGA 2ZXIA 1FMVA 4HRIA 4XLHA 2HZDA 2ZSHB 3PJRA 3RSNA 4DBRA 1BR2A 2VQLA 3A4CA 2E5ZA 4NQWB 1D1BA 4CUGA 3LMMA 2AQFA 3H5NA 1YE9A 2LRDA 3VYTB 1UELB 5HLTA 3F9KA 3I9V2 2VLAA 4C2UA 2Q2EB 1K6YA 4LIUA 4CCLA 2VKHA 3AFHA 2V4JC 1X4PA 2ZSIB 4Y3OA 3SEZA 4R79A 5HVQC 1OLTA 3E0JB 2GOMA 4XOPA 3FDYA 4D9JA 4HEA2 3SDBA 2L2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG7 A; 
#chains in the Genus database with same CATH topology
 4S05 A;  2R7Z J;  3HEF A;  2JN6 A;  5LHI A;  3JSP A;  4ZJZ A;  4LB5 A;  1W5C C;  1TWA J;  5LD2 C;  1SC7 A;  1TTY A;  2DA5 A;  1WPK A;  5J6X A;  4EGZ A;  2E34 A;  2Y75 A;  2R4G A;  2M0C A;  1LEB A;  3K2A A;  1IDY A;  4F92 B;  1QA6 A;  2IXS A;  3MVP A;  1EH8 A;  3QYB A;  3KZY A;  3ELK A;  5GTI C;  1WCM J;  1MJB A;  2R5Y A;  3VOE A;  1RR8 C;  2ZXH A;  1MBK A;  2DYS H;  3OIQ A;  2KT0 A;  2IS2 A;  1A6I A;  2HOT A;  4L5J A;  1ZTR A;  1B72 B;  2FD5 A;  5D8L B;  2KHM A;  2DA2 A;  5FRM A;  2K27 A;  3PM1 A;  3R6S A;  2CQ7 A;  2BY1 A;  5ILV A;  3IHU A;  5JVG F;  4GO1 A;  3OYB A;  1VQN I;  3WE2 A;  2DOE A;  1SAX A;  2FBI A;  3DWL E;  3RYP A;  1YX5 A;  3EYI A;  2PMH A;  1H88 C;  2PI0 A;  1MJA A;  4JOM A;  5KCM A;  3IWF A;  2K3P A;  3OYA A;  2YS9 A;  2Z33 A;  1APL C;  2KQR A;  1LEA A;  3PO2 J;  4JP0 A;  1P9Q C;  2HFH A;  2DI3 A;  3TGN A;  4CO8 A;  2PQ8 A;  5J1R A;  5KVR A;  3RIR A;  1RET A;  2VKE A;  2XF7 A;  1A6Q A;  1OYW A;  4UB8 C;  1DP7 P;  2HQA A;  2DAO A;  1D5Y A;  4LG3 A;  2C6Y A;  1MND A;  4RAG A;  3FM5 A;  5EG0 A;  5TRD A;  3C3W A;  3OIP A;  1FNN A;  4XOR A;  3VPR A;  1ZQ3 P;  3ECH A;  1SD6 A;  1YYV A;  1IN5 A;  3R0A A;  1R00 A;  3BJ6 A;  2B0L A;  1XMK A;  2DCE A;  5FD6 A;  2W1O A;  3E1S A;  1SFE A;  5CVR A;  2COB A;  2MD0 A;  3EUH A;  2BW3 B;  2F6C A;  1KYW A;  2UXN A;  2XHK A;  4HDV A;  3PNT A;  4PGG A;  2YR2 A;  4OOI A;  2O8K A;  4AD9 A;  2XF5 A;  4NQW A;  1ZR2 A;  1LFB A;  3WGI A;  4G6D A;  4A3G J;  1MMD A;  3BQY A;  2DMP A;  2RKH A;  5D6F A;  2JA6 J;  1XX5 A;  1OIS A;  2L3D A;  3MZY A;  1I1S A;  4C2M J;  3B73 A;  4A3B J;  2ECB A;  2LG4 A;  2ZJP F;  3O8H A;  2Z16 A;  2NVX J;  1S29 A;  2A6T A;  3DU6 A;  2V7F A;  2E1M B;  1RPW A;  2PMZ A;  4IQ4 A;  1HW2 A;  3LSH A;  1V54 H;  1T39 A;  3QYE A;  4PSW A;  4M6X A;  4U0W A;  2TCT A;  1LDD A;  3AG3 H;  2HXI A;  3CCE I;  4BJT A;  2HU9 A;  3OYF A;  5FLV A;  5JR3 A;  4G6T B;  2HR3 A;  4F93 B;  2HPM A;  3HOU J;  3MKL A;  1SVM A;  4NHJ A;  4OIR F;  2BGC A;  2ELJ A;  5K5Q A;  5EZG A;  2HEO A;  4KMU X;  3UNG C;  2KZV A;  1N25 A;  3F3X A;  3VSL A;  1SEU A;  4MIM A;  3AKZ A;  3P9K A;  2BHY A;  5ILU A;  2BHZ A;  1EA3 A;  2WA0 A;  1IGN A;  1IG7 A;  5M3M J;  2EV5 A;  3OYJ A;  1XPX A;  2Y69 H;  5JHF A;  3N4M A;  1XC5 A;  3R60 A;  3QQA A;  2R7S A;  2PJP A;  3MKY B;  1ON2 A;  3TDU C;  2A6E F;  5LEJ A;  3CZ6 A;  3AG1 H;  3SFI A;  4XQF A;  2XSD C;  4V19 K;  1AKH B;  3CES A;  1RR7 A;  2DPD A;  2VQH A;  4HX7 A;  5E17 F;  2E7W A;  3HTS B;  5GAD J;  2XF6 A;  1QGP A;  4GCV A;  2M45 A;  3S8P A;  1YLF A;  3V7R A;  3E6B A;  2QUF A;  2VI6 A;  1X1B A;  4KT5 C;  5JVT A;  1BL0 A;  2HWV A;  3BQZ A;  3LOC A;  4LK0 F;  3I59 A;  3C2H A;  1X2N A;  2EIM H;  3VYS B;  5C3E J;  5FD5 A;  1YJN I;  4A3C J;  3BTJ A;  3F6O A;  2GOX B;  2E7X A;  2V9P A;  2X6Y A;  2W57 A;  3SQN A;  4G6Q A;  4BNC A;  2Q0O A;  3KCC A;  1XD7 A;  5J3L A;  2JA7 J;  1ZG1 A;  2V6E A;  3K9T A;  1Z3X A;  5E8I A;  1SAN A;  2EIL H;  5FKO A;  1QNT A;  2CQN A;  3DKW A;  2V1X A;  2E2H J;  3KX2 A;  4A93 J;  3DCF A;  3GYH X;  2IGK A;  2JTV A;  2IBD A;  4XBF A;  3QOD A;  5HLI A;  2BY0 A;  3HUG A;  4RM2 A;  3TO7 A;  2IP2 A;  2MW8 A;  5LEK A;  3OV8 A;  1OQY A;  2CUJ A;  2R7V A;  4ENM A;  2E36 A;  4MFE A;  3CJQ B;  1BJZ A;  3TMO A;  4A3J J;  1BA5 A;  1SAU A;  3CDL A;  5HS7 A;  4EM1 A;  1B9M A;  3ZQL A;  1KQ0 A;  3DLL F;  2QSF X;  2OQG A;  3OR1 C;  5F6F A;  1U5T C;  1MH3 A;  1Y56 A;  2HQ5 A;  5IYB J;  4DIQ A;  3M8E A;  2R7F A;  3G73 A;  3MQ0 A;  4B1R A;  3QPT A;  2IS4 A;  3LA2 A;  1F9N A;  1CF7 A;  2F5D A;  4J01 A;  2HDD A;  2KFD A;  5CKT A;  3G1L A;  5TGT A;  2QWW A;  2ZB9 A;  3T1B A;  2HPI A;  5L3E A;  4I2O A;  2BVL A;  1VQ6 I;  4U7D A;  2Y48 A;  4BAY A;  3EUK L;  1MIJ A;  1H0M A;  3QWL A;  2HZT A;  3LSG A;  2R7X A;  4RGX A;  2OQR A;  1ZEL A;  2VJ5 A;  2O0Y A;  4IX7 A;  1J59 A;  2M3A A;  3ZQ7 A;  1MBJ A;  3MEX A;  3T5X A;  2KPM A;  3DEU A;  2FML A;  2DFF A;  2VJI A;  3ECO A;  1DGW Y;  3A0H C;  2P81 A;  4BQQ A;  1T08 B;  1TW2 A;  2OUM A;  3W2W A;  2X6W A;  3HGG A;  1PJR A;  2LH9 A;  2R7O A;  4B3X A;  2R7D A;  3FHZ A;  1I6X A;  5DM6 F;  5IYD J;  4A6D A;  2OU2 A;  2OV7 A;  2JA5 J;  2WAE A;  4A0Y A;  4PJN A;  1B9N A;  1EKE A;  3KZZ A;  4F91 B;  1FY7 A;  1YW9 A;  4GGG A;  5EZH A;  1QQI A;  1Z6T A;  3KEO A;  1X3W B;  2QQA A;  2FNP A;  4U87 A;  4HAM A;  3I55 I;  1QO0 D;  4YII A;  2GM4 A;  2ZKZ A;  4NBQ A;  4Q5S F;  3OYD A;  3BG9 A;  2LYC A;  4LIT A;  2F48 A;  1T38 A;  3Q9S A;  2UXX A;  4BHB A;  3DF8 A;  2DN0 A;  2XIG A;  4L0Y B;  5DUK A;  2PFB A;  1JUP A;  2KZG A;  4HF2 A;  2IJL A;  3ZXS A;  3S1M J;  4KIG A;  4AUX A;  3M4O J;  4QTR A;  4M3G A;  2Y9Z A;  2WBM A;  2A05 A;  5EEA A;  1FZP B;  5E1W A;  3CCY A;  1AKH A;  3D5S C;  4I0A A;  1CGP A;  4L18 B;  1A5J A;  2YX7 A;  1MBF A;  1YJW I;  5DV5 A;  3GCM A;  2UV1 A;  4NB5 A;  2IPQ X;  2CV1 A;  3ZQH A;  1FBS A;  2NVY J;  1QZE A;  4M73 A;  3TBI A;  3H92 A;  4Y13 A;  1YFH A;  2VOO A;  3BG5 A;  1JT6 A;  2M7A A;  3TDZ C;  2R3S A;  3FBI B;  3K6G A;  3HPG A;  5EYR A;  4XKB A;  3R0J A;  1T95 A;  1FOY A;  3MKZ A;  3GFM A;  5EGO B;  4CZZ A;  5M3F J;  4BU2 A;  2ZME B;  4XSX F;  3H5A A;  2WY7 Q;  1TWH J;  1X3U A;  5B1A H;  4ENJ A;  4A0Z A;  4BE2 A;  4RAY A;  1JJ6 C;  3BG7 A;  3O3K A;  1RUN A;  1DPR A;  5HS9 A;  1HF0 A;  4RB3 C;  2DA6 A;  3RDI A;  5ICF A;  2IA0 A;  2KRC A;  3KEQ A;  1W7P B;  2XRN A;  3IRQ A;  3S3N A;  1O3T A;  5GPA A;  5IT9 Z;  4YEJ A;  4I02 A;  2CH0 A;  1ZGW A;  1WFX A;  2QSH X;  5B5E C;  2K85 A;  2CFO A;  1F4K A;  4KUM A;  2EPF A;  5E18 F;  1YIT I;  3LSP A;  3LSI A;  4PZJ A;  4KJZ A;  4XL9 A;  1BW5 A;  3R4K A;  3R61 A;  1S8N A;  2DDA A;  2M2E A;  2Y2Z A;  5E3L A;  4WCG A;  2RN7 A;  1I6H J;  3HKZ A;  1J2X A;  2WB1 N;  5BMZ A;  1O3Q A;  2GXB A;  4NC7 A;  2ZJQ F;  1TQI A;  4UVA A;  2EFO A;  2O8X A;  2X48 A;  5J47 A;  1EH7 A;  2K5C A;  2GXA A;  5AON A;  2D5V A;  3F23 A;  3I3L A;  5J8C A;  3CUQ C;  3AL0 C;  1TZL A;  1XDS A;  2A61 A;  2ZXJ A;  5A2Q Z;  3GZ6 A;  4XRF A;  4HF1 A;  3GLL A;  4CCK A;  3L9F A;  1FYM A;  4O6J A;  2M4G A;  3MD2 A;  3TOB A;  3J81 Z;  1O3S A;  3I4P A;  3J80 K;  1VQP I;  2W84 A;  3OSF A;  2Z5U A;  1FOK A;  2ZC2 A;  2NVT J;  4LLL A;  2Q1Z B;  1X2M A;  5LGN A;  4AC0 A;  4QIW N;  2E1M C;  1Y8R B;  3JCU C;  4YFN F;  2LRE A;  5F0F A;  3JRF A;  1K78 A;  3LQR A;  1IW7 F;  1RC9 A;  2MG4 A;  1R58 A;  3D1N I;  3HSF A;  4IXA A;  3RCO A;  2VJJ A;  2YU3 A;  1YS7 A;  4JX4 A;  3HDD A;  1DUX C;  1MMA A;  2JUG A;  4RA2 A;  4XLH A;  1DDN A;  1G6N A;  5J40 A;  1FPQ A;  3RSN A;  3F8C A;  1BR2 A;  5D4S A;  3A4C A;  1YHQ I;  2E5Z A;  2VOD A;  4CUG A;  2HYG D;  3DP7 A;  2LRD A;  3ABK H;  5F27 A;  3I9V 2;  3BP8 A;  1K6Y A;  2QCO A;  4CCL A;  1MNM C;  5BPD A;  1IAW A;  5BOX A;  1IN4 A;  3K0L A;  2GLO A;  4CIC A;  1BI0 A;  2OAZ A;  3FDY A;  2ZO4 A;  3NRV A;  3WU0 A;  4D9J A;  3SDB A;  4OIQ F;  3J7A Y;  4IEJ A;  1GV5 A;  3QYF A;  3MFK A;  1GV2 A;  3PSF A;  3KZI C;  1XSV A;  1SMT A;  3CQZ J;  3FX3 A;  2LTP A;  2XKO A;  4HQE A;  2EV0 A;  2ISY A;  3NWS A;  2JQ7 A;  2DOF A;  1XG1 A;  3CJT B;  3H3V K;  3IP4 B;  1WI3 A;  2EFN A;  3DLA A;  4FE4 A;  1UMQ A;  2DW4 A;  2VL8 A;  4LJZ F;  2ZFU A;  1Y6I A;  4EGY A;  3OSG A;  3J81 K;  5DS9 A;  4I98 B;  3K70 C;  4MTD A;  3E6D A;  4UXN A;  3S2D J;  1O7F A;  2OD5 A;  3LAJ A;  1KU9 A;  2VBZ A;  3M3Y J;  1TQM A;  2Z3Y A;  3PL8 A;  1F36 A;  4KA4 A;  4A12 A;  3OIO A;  2IS6 A;  1G3W A;  1D0Z A;  4FET A;  3MAJ A;  3VYU B;  4FX0 A;  1NK3 P;  4BHP A;  4E7Z A;  4G94 A;  2D45 A;  2W00 A;  3L00 A;  2EIN H;  4IQJ A;  4Q47 A;  4PSX A;  4XLC A;  3FK7 A;  1EJ9 A;  3CCR I;  4BL0 B;  3PIO F;  1F5T A;  3EPZ A;  3U2R A;  1B1B A;  2HTJ A;  3ISP A;  5EG0 B;  2DTZ A;  1VQ4 I;  1TP4 A;  3VB2 A;  2EJR A;  4XLE A;  1FYK A;  2G9W A;  4R8H A;  3DEW A;  2X51 A;  3LAP A;  4P1W A;  3H9Q A;  2OC6 A;  5KAF C;  1JTX A;  4AIH A;  3HXL A;  2COM A;  2RVC A;  3CCV I;  3SZG A;  4D5C A;  2HYJ A;  5L3G A;  3CMY A;  3ABT A;  4GYG A;  3GEZ A;  2PBI A;  2DTR A;  4BUP A;  2FSW A;  2HGC A;  1I3A A;  4IF4 A;  1ERD A;  1D1C A;  1D8J A;  1ETY A;  5LRS A;  1Q1V A;  2QBY A;  4B44 A;  1G3S A;  1Y8Q B;  4PCQ A;  3WOD F;  4EM2 A;  3KET A;  2CQX A;  3L2Q A;  2VAS A;  4HYE A;  2IAI A;  2BZT A;  2CW0 F;  2XAS A;  1T8I A;  2KDO A;  1TQP A;  5HLH A;  2ECC A;  3KPH A;  5K7Z A;  3OYK A;  2R92 J;  1FSH A;  2XSJ C;  4IHX A;  4B09 A;  1B72 A;  3ML6 A;  3G6E I;  5CJ9 A;  3ZGK A;  3ZMV A;  5HDG A;  2NXN B;  4F7Z A;  4KIT B;  1OYI A;  1OCT C;  4WK8 F;  3M9A A;  3E5X A;  1TC3 C;  2BY3 A;  2D1V A;  1WJC A;  4RB1 A;  1MDM B;  1S3J A;  5E3N A;  4RGR A;  4XN3 A;  3TW6 A;  4AYB N;  1OKR A;  4UHT A;  4F55 A;  4UVB A;  2G7U A;  2ZFW A;  4WX9 A;  4XKV A;  1IRF A;  3U1D A;  1R6R A;  4AWX B;  2DFH A;  5H20 A;  2K9L A;  3L2C A;  1HKT A;  1P4A A;  3S14 J;  3FXU A;  5C4J J;  1JJ8 C;  4DGW B;  3DBL B;  2I5U A;  2AQE A;  1X1D A;  1QPM A;  1TL8 A;  1P2F A;  3G1O A;  3W6J B;  2STW A;  1BOB A;  3EQL F;  3NAR A;  4DBQ A;  3ZPL A;  2W82 A;  3GTK J;  3JAM Z;  3K70 D;  3HM5 A;  2EZH A;  3F8N A;  2LKX A;  3H0G J;  4DJA A;  1VQK I;  5LHH A;  3BT9 A;  3ZQI A;  4FT8 A;  4LIV A;  1AHD P;  2F5V A;  2M5W A;  1WRJ A;  1E17 A;  2DJI A;  4M6Y A;  3IAS 2;  4HX4 A;  1K4T A;  2WV1 A;  4J19 A;  3ZMZ A;  4JX6 A;  2E1C A;  1H9T A;  5D5W B;  2Y0S N;  5DCM B;  3NWT A;  1JXS A;  1N77 A;  2GIV A;  1XCB A;  2H09 A;  3SZT A;  2MH9 A;  1GDT A;  3J7A O;  2QYO A;  4NNJ A;  4B48 A;  4UUS B;  4M3E A;  5EJC A;  3WE3 A;  2WV0 A;  2E5N A;  2W48 A;  5D8K B;  4UNO A;  3IL2 A;  2X4H A;  2FOK A;  4A6E A;  3IRR A;  2QLZ A;  1NG6 A;  1HOM A;  1MSF C;  5IT3 A;  4B8X A;  3G71 I;  3S2H J;  5KAI C;  3RZO J;  2DK8 A;  4HST A;  2EZI A;  3E6M A;  3KLO A;  1ZG3 A;  4CCJ A;  3DBR B;  4CYD A;  4WF2 A;  3FXJ A;  1X1P A;  1V5F A;  1BN5 A;  2HDW A;  4IL6 C;  4UUS A;  1UG2 A;  2ELH A;  3ROU A;  4A5N A;  1S72 I;  2Z9O A;  4RB0 A;  4LFU A;  1IV6 A;  3IAM 2;  2DMU A;  3BR0 A;  2L0K A;  4OAZ A;  4IPA A;  1MBH A;  2CV2 A;  1ZR4 A;  2QSG X;  1U2W A;  3KYD B;  2PEX A;  4EQQ A;  2H1K A;  2XAQ A;  1WJD A;  4MTE A;  5F0C A;  2IGN A;  4AVP A;  1UFM A;  3JAM K;  1WJB A;  1T0F C;  2DA3 A;  2K9M A;  4U88 A;  4C3J J;  1Z77 A;  3HPH A;  1LE8 B;  3WG9 A;  1UJ8 A;  3V42 A;  2MA3 A;  3GBG A;  2LBF B;  2KDZ A;  1WJE A;  2IGM A;  3IC7 A;  3BJA A;  1FTZ A;  1JT0 A;  3ABM H;  3LFK A;  3T8T A;  3FZV A;  1DGR M;  4JYK A;  5J4Y A;  4Y52 J;  2E2I J;  2PLY A;  1R5I D;  3HRM A;  3RKY A;  3M1C A;  3BC8 A;  2FU4 A;  1FSE A;  1Y1W J;  3I64 A;  1V4R A;  2LDU A;  1VQL I;  3COA C;  1D0Y A;  5F0H A;  2EZL A;  1ULY A;  3ZN1 A;  5BS6 A;  4EMS A;  3HRU A;  1MMS A;  4ESF A;  2OBP A;  5M5Y J;  2HOE A;  1WGX A;  1CQT A;  2L9V A;  1BC8 C;  1A04 A;  4CYC A;  2XB5 A;  1WWX A;  2QF7 A;  3IKV A;  2UZK A;  2WAD A;  1HST A;  1Y0N A;  5IOZ A;  1RUO A;  2VT2 A;  3ABU A;  3BZK A;  5CQG A;  1R5G A;  3GTP J;  1V3F A;  4MNU A;  5ICC A;  3RPU D;  1EF4 A;  2TDX A;  3W6K B;  2DDB A;  2ICW G;  1QBJ A;  3QP6 A;  1WQ2 A;  3OL3 A;  2DLL A;  3WGG A;  2E1O A;  2HQR A;  2QQ9 A;  2K9S A;  4IHT A;  3SYT A;  3D0S A;  4GDF A;  4II2 A;  2ZCW A;  4L0Z B;  1JHH A;  1VQ8 I;  2JVG A;  2M0M A;  3FKJ A;  1U0J A;  4C30 A;  4C9Y A;  5DYM A;  5IP6 A;  2EK5 A;  5EEH A;  3CCL I;  1JI8 A;  1Z7U A;  5E8G A;  2ZME C;  5ED4 A;  4LB6 B;  5GAH J;  3ZN0 A;  1LDK B;  1N75 A;  4FIS A;  5DM7 F;  3PNV A;  3H5R A;  1E0E A;  4C3H J;  3ZQF A;  2VKV A;  1QVU A;  1YOV B;  1K83 J;  3CLQ A;  1ZKG A;  4CCN A;  3GVA A;  1IO2 A;  2F4I A;  2YX4 A;  4BH9 A;  1R5H A;  3SJM A;  1EH6 A;  3BOQ A;  4KIC A;  1ZG5 A;  1Z7L A;  1HCR A;  5EEG A;  1S7E A;  3JTH A;  2V1N A;  3B02 A;  5L3C A;  1PUF A;  2AHQ A;  2VQG A;  2STT A;  3OS0 A;  4AID A;  1W5S A;  4PFP A;  1JGS A;  2QKM B;  3IKT A;  4KN7 X;  2R5Z A;  1KYZ A;  3BPX A;  4AU7 A;  4ANJ A;  1ZHF A;  1GLN A;  4HSR A;  3LSM A;  2KKO A;  3OL4 A;  3QPS A;  4QLC U;  2RGV A;  2K4B A;  2JA8 J;  4NDL A;  1WH5 A;  2M9H A;  2DT6 A;  2BW3 A;  3H9G A;  4S0H B;  1IF1 A;  2QEX I;  4Q48 A;  2IEK A;  1R49 A;  2M87 A;  1X4O A;  2ADU A;  3IUO A;  3F22 A;  4R1H A;  1ZN2 A;  4BJ6 C;  3L2W A;  3OYL A;  2LKS A;  3K10 A;  4N4O B;  4AM3 A;  1OR7 C;  3HJE A;  1FX7 A;  1A31 A;  1T6S A;  1W0T A;  3D5L A;  4DQ2 A;  1F1Z A;  3PO3 J;  3M8J A;  1B4A A;  5LHG A;  3CCU I;  2IT0 A;  2P7V B;  2HNH A;  3OWT A;  1S5L C;  2P4W A;  3B6A A;  2DFI A;  2JRT A;  1ONV A;  4M9S A;  3BG6 A;  1POG A;  2GWR A;  1P92 A;  3GTL J;  2KIU A;  3F8M A;  3ERM A;  2M30 A;  1W1W E;  4G12 A;  4KNY A;  3PFI A;  4HNU A;  4IRG A;  1SD5 A;  3DPT A;  2NRA C;  2BE5 F;  2XGC A;  3CJN A;  4A0X A;  3OYC A;  1W0U A;  5FO5 A;  2CRG A;  1UAA A;  2JPB A;  1G8X A;  3ZQQ A;  2X1E A;  4ZYA A;  1LFP A;  1XGS A;  1DQU A;  1ZRE A;  3OMY A;  4I99 C;  5DD4 A;  4ESJ A;  1VI0 A;  4L9J A;  4DOZ A;  2D1H A;  4A3D J;  3HYI A;  4A5M A;  3OR2 C;  2LF7 A;  1DP3 A;  3K7A J;  3RZD J;  1YRN B;  3AG2 H;  3LWF A;  4C3I J;  3L2U A;  2ZBK A;  2W7N A;  4HF0 A;  4ZYG A;  2EFQ A;  4L9V A;  3CF2 A;  2VPR A;  4AIJ A;  4I7H A;  3ZOB A;  1MSE C;  2CQQ A;  2M7B A;  3GLX A;  2H94 A;  2V1D A;  1E3O C;  3WHB A;  2IGO A;  1PYV A;  4I01 A;  3HOX J;  1ZRF A;  1FBU A;  3DXJ F;  3CCQ I;  2HOA A;  2NAZ A;  2XKP A;  2N8G A;  2KIS A;  4RGS A;  3H3U A;  2L7Z A;  4UV8 A;  4EAT A;  4GRI A;  2FJ1 A;  2W4S A;  3VYR B;  3REO A;  3VFZ A;  1I5Z A;  2KRF A;  4EJT A;  4A3K J;  5IP9 J;  3O8G A;  3PUF A;  1KU3 A;  3I71 A;  4P55 A;  1QZY A;  2ZXI A;  3KFW X;  4L5I A;  1X3Z B;  3HOY J;  3S1Q J;  3I53 A;  1MDM A;  1D5V A;  3BJO A;  2OA4 A;  3WTT C;  4N0B A;  2I10 A;  1I3Q J;  3GFI A;  4NQW B;  2DT5 A;  3TO6 A;  4IO9 F;  1RKW A;  3HOZ J;  3AAF A;  2AQF A;  2NNY A;  4EJO A;  3F9K A;  1YW7 A;  2Q2E B;  2GAU A;  2B63 J;  1FYL A;  1NK2 P;  1X4P A;  4MFD A;  1U3E M;  4Y3O A;  1LQ1 A;  1OLT A;  3I56 I;  4A3E J;  1PUF B;  1YO5 C;  4XOP A;  1BM9 A;  4OMY A;  1K61 A;  2JSC A;  4HEA 2;  5FKM A;  1PP8 F;  3CF5 F;  2FX0 A;  4XOT A;  2MAB A;  4E7J A;  1SFX A;  3P5J A;  4MLO A;  4UV9 A;  1UHS A;  1E2X A;  4I0B A;  3K69 A;  4DYQ A;  2ID3 A;  2LC2 A;  3AG4 H;  3QOP A;  2F5C A;  1RKT A;  4A2U A;  2VQC A;  3BCA A;  4KFC A;  2WTE A;  3KYL A;  5IP7 J;  3HGY A;  5HLG A;  3CCS I;  5HNF A;  1YI2 I;  1TW3 A;  1L0O C;  4C2T A;  4IVN A;  4IHY A;  2DT7 B;  2E35 A;  1VF9 A;  1FOW A;  1H89 C;  2EH3 A;  1U5T A;  2GA1 A;  2L9N A;  2A5Y B;  4K2E A;  5H6R A;  1QVT A;  4HBL A;  5CQE A;  1ETK A;  4CGZ A;  3MZH A;  1WHU A;  3SFZ A;  3LA7 A;  1GT0 C;  1VQ7 I;  1BOA A;  1ETQ A;  4RM3 A;  1UHM A;  1MKM A;  1HSJ A;  2GQQ A;  4G7Z F;  3X2Q H;  1QHH D;  4BE1 A;  4FHT A;  5KNL A;  4G8X A;  2JK3 A;  2J5P A;  2A68 F;  5K1Y A;  3HOS A;  4M9Z A;  3JRG A;  5HS8 A;  1DU0 A;  4P9U A;  1SMY F;  2OF7 A;  3S32 A;  1VND A;  2JA2 A;  3I54 A;  1W4M A;  4HLX A;  5HDK A;  4CCO A;  1K7A A;  1R71 A;  2Y9Y A;  4PJM A;  4HDU A;  3K1P A;  2DXI A;  5B3S H;  4PJL A;  5B66 C;  3DEE A;  2FUG 2;  4TV7 A;  3V7S A;  4XMY A;  1E3H A;  1GUU A;  3FXK A;  4PDK A;  2TRT A;  1TNT A;  4Z6Y A;  4HQM A;  1TT5 B;  4ZC3 A;  3A2K A;  2IRF G;  4BDY A;  3NAU A;  1ETV A;  2L02 A;  4YG2 F;  3BZ6 A;  1U8B A;  4IHV A;  3P9C A;  2ME6 A;  1BR1 A;  2LY1 A;  3U21 A;  2Z99 A;  3V8K A;  2W85 A;  3JRE A;  1FJL A;  2R7U A;  2O5R A;  4KT6 A;  5F1R A;  2M1B A;  3BLY A;  1XS9 A;  2BXZ A;  4MGR A;  5D4R A;  2DYR H;  3HG9 A;  5IYC J;  4BQA A;  3FIS A;  4LG0 A;  3HL2 A;  5LRR A;  3RI4 A;  5FLX Z;  2D2W A;  1ZAR A;  2LOO A;  2DQL A;  3S2W A;  3ZQC A;  4M3F A;  1S7O A;  4QPO A;  5CVV A;  3FBN B;  1Z6R A;  2VKD A;  5BPI A;  3A1Y A;  3QU3 A;  2OZ6 A;  4RBO A;  2V9V A;  2K86 A;  1U8R A;  2ISZ A;  2R93 J;  1BI3 A;  3OS2 A;  4MO7 A;  1BR4 A;  3LFU A;  1LJ9 A;  2VB6 A;  3JRB A;  3FM3 A;  1O57 A;  2KIM A;  1YW8 A;  3LQQ A;  4L5E A;  1U5T B;  2RAE A;  3CCJ I;  2EWN A;  4E7K A;  4ENN A;  1XTA A;  4HW0 A;  1EV7 A;  2H1L A;  3LL7 A;  1LPQ A;  4FQG A;  2P5V A;  1MD0 A;  2H6C A;  3M1E A;  1OR7 A;  1VQ5 I;  4GFB A;  1W7P A;  2MBF A;  3I5U A;  3DPL C;  4BKX A;  3CD6 I;  2IW5 A;  3EUH C;  3WTY C;  1U9O A;  3FXL A;  2O3F A;  1LKX A;  3JW4 A;  4IHW A;  1NH3 A;  3BY6 A;  4BEH B;  1S7A A;  3PIP F;  3LSK A;  2VBX A;  1JKP C;  4D1Q A;  5F64 A;  3FK6 A;  4Y15 A;  3HKZ N;  2QA4 I;  3C2B A;  4BBR J;  1IDZ A;  4U7B A;  5KK1 A;  2JT1 A;  2R0Q C;  3I4N J;  3QPH A;  5FLX K;  2XAH A;  3H35 A;  5EF6 A;  3V7C A;  4D7N A;  1STZ A;  1V5E A;  1T98 A;  1J0R A;  2HKO A;  3FXQ A;  3BZC A;  3WU2 C;  1VQM I;  1O4X A;  2CV0 A;  2VC1 A;  2FE3 A;  1FOX A;  1LVK A;  2LNB A;  3H1C A;  2L4M A;  3OOP A;  5ILS A;  3RPQ A;  1REP C;  1ON1 A;  2VN2 A;  3ZP5 A;  2I8D A;  5LLQ A;  4RLQ A;  1V55 H;  4KN4 X;  1QHG A;  1MW7 A;  1UST A;  2FA5 A;  1ZYR F;  1XGN A;  3BDD A;  3O2P E;  5E1X A;  2DMT A;  3BWG A;  5BQT A;  3RQ4 A;  1XMX A;  2JSP A;  3PNY A;  1ITY A;  2HVQ A;  4IRI A;  1MJ9 A;  3K4L A;  3K1N A;  3KP7 A;  1UZC A;  3LSJ A;  3SEQ A;  4XRS A;  2E2J J;  3CP8 A;  5E20 A;  4HA8 A;  3NEU A;  2KRH A;  4PJJ A;  4AVZ A;  1BI2 A;  1ZK8 A;  1BJA A;  4XLA A;  4A3M J;  4RLF A;  3VOD A;  1I39 A;  2LLK A;  2HTS A;  4M74 A;  3BR2 A;  2WAQ A;  5J1U A;  3GTQ J;  5IOY A;  4E4H A;  4ZDO A;  4YIR X;  1X1C A;  3F72 A;  3WTU C;  2EA2 A;  1XSD A;  3K4C A;  1W5T A;  2W25 A;  1KZH A;  4ZZD A;  2QVO A;  2X6O A;  4W97 A;  5LGT A;  4E7I A;  3TP0 A;  2FXA A;  4HNV A;  1GXQ A;  3FXR A;  2Q8K A;  3MKW B;  1H9G A;  2IA1 A;  2ZME A;  2MFZ A;  4BY1 J;  2KIQ A;  1IC8 A;  4RAF A;  2Z2S B;  2GBY A;  1HKS A;  4ETS A;  3BR5 A;  3NQO A;  2DBB A;  3G2B A;  5DD8 A;  2BV6 A;  2CG4 A;  1OFC X;  5FB2 A;  3HOV J;  3J7Y J;  3E5U A;  1UG0 A;  4NC8 A;  1N78 A;  2OTJ I;  4MHG A;  1R1T A;  4XLP F;  5K5O A;  1LDJ A;  2LR8 A;  4LMY A;  1FP2 A;  2F5E A;  1RIO H;  1TLH B;  4XM3 A;  4LOC A;  1ZH5 A;  2L54 A;  4EJV A;  2R7R A;  2CUF A;  3OY9 A;  2PJR A;  1TWG J;  3P7N A;  1Q1H A;  1R4M B;  2DK5 A;  2K7L A;  2HS5 A;  3VDX A;  1QU3 A;  2XAG A;  1XN7 A;  2Y30 A;  4CXF A;  3HB9 A;  2F5F A;  1D3Y A;  4A3L J;  1R4N B;  5JI6 A;  1B6A A;  3C18 A;  2LF8 A;  2NNN A;  4ABZ A;  1VQO I;  2X1D A;  4KMF A;  4IOC F;  4HNT A;  1ACI A;  3JR9 A;  1HW1 A;  1FT9 A;  3WTZ A;  3OS1 A;  4LD5 A;  1I50 J;  1YS6 A;  3ULQ B;  4A3I J;  1Z67 A;  3OOU A;  1OCP A;  4IKF A;  5E79 C;  1BIB A;  2FRH A;  2HDC A;  1Z1D A;  5F08 A;  1AOY A;  2JMW A;  2VT3 A;  1ZRD A;  2DMQ A;  3H0D A;  2HXO A;  4OIN F;  3MMY B;  2VON A;  5IT9 K;  2M8G X;  1I27 A;  5EGO A;  2WAF A;  2O03 A;  2CJJ A;  1H8A C;  4GXO A;  4OWR B;  2F2E A;  3ABL H;  4Q4Z F;  4CYC B;  2WWY A;  2KJC A;  2Y31 A;  4MQ9 F;  2A6H F;  5LGU A;  3K4B A;  3QOE A;  1BW6 A;  3FF5 A;  4OAY A;  2QQB A;  3GFJ A;  1SFU A;  4XKW A;  5DDG A;  2K9N A;  1XB4 A;  4HZF A;  2QBY B;  3C7J A;  3H3Z A;  4E6K G;  1WZ2 A;  5DUI A;  1KQ8 A;  1JUS A;  4ESB A;  3W6V A;  3TP3 A;  4PJ0 C;  1HQC A;  1IXR C;  5HOD A;  5FJ8 J;  1AU7 A;  3Q3S A;  4WXH A;  2NVQ J;  4D7M A;  2IS1 A;  4BDZ A;  1NHA A;  5K7F A;  3CJR B;  5F1J A;  1J5Y A;  4G7O F;  5GAG J;  4V2F A;  1OCO H;  3G4S I;  4I76 A;  5C44 J;  3L2R A;  1W36 C;  5M5W J;  2YUS A;  3K2Z A;  3L7W A;  2V9K A;  1KU7 A;  5CVJ A;  1G3T A;  3Q9V A;  3J80 Z;  2HVR A;  4ZYE A;  3C1D A;  3HBL A;  1ORK A;  3GZN B;  1BI1 A;  3QRF F;  5GAE J;  2LMD A;  3UR3 C;  3TOA A;  2PMZ N;  5D6E A;  4PUS A;  1HA8 A;  4B47 A;  1PUE E;  4XSZ F;  1HW5 A;  2E1N A;  2VE9 A;  4O5V A;  2ZNY A;  3WG7 H;  1HKQ A;  1WSU A;  5F04 A;  1S9H A;  1YIO A;  5FLM J;  5ICG A;  4FAS D;  1USS A;  1R7J A;  3I58 A;  1KON A;  3KYC B;  4BJ5 C;  4PFO A;  3S15 J;  1F43 A;  3KP5 A;  3DTI A;  3RQI A;  2ESN A;  2BEO A;  3ZMS A;  3K4M A;  3L2V A;  4LLG F;  2G7H A;  3WTV C;  2DMN A;  3QPL A;  5KHD A;  3TL4 X;  1J09 A;  3PSI A;  1FP1 D;  4ZDL A;  3A0B C;  2EB7 A;  4CSW A;  2JJ7 A;  1YG2 A;  2BY2 A;  4WXD A;  3K4J A;  3JRD A;  2CU7 A;  2Y0S A;  2DO7 A;  1W36 D;  5TIS C;  4LGW A;  3KIO A;  2CS3 A;  2CMP A;  1XDU A;  2FNA A;  4BXF A;  3JRA A;  6PAX A;  4H4K C;  1R22 A;  2ZXW H;  4F3Q A;  3ERE D;  3HTU A;  2XAF A;  2Y0M A;  1MMG A;  3FKI J;  2WAQ N;  3N05 A;  2XRL A;  2XGX A;  3WGH A;  4E7S A;  2X1C A;  3CUQ B;  3CUO A;  2CO5 A;  2H8W A;  1M1E B;  1RI7 A;  3GZ5 A;  2B7E A;  5GTH C;  2MC4 A;  4RGU A;  1B8I B;  4XK4 A;  3CME I;  2DU9 A;  2PJR B;  2A07 F;  4YRV A;  3IWZ A;  1R23 A;  4FE7 A;  2FQ3 A;  4D5F A;  4UVC A;  2YPR A;  4HV5 A;  3HHH A;  3BR1 A;  4BY7 J;  3K4K A;  1TT0 A;  4ZZL A;  1PDN C;  1A35 A;  3DPU A;  2KLO A;  1SFK A;  1UB9 A;  5FFX A;  2X9D A;  2P0W A;  1P4X A;  1K79 A;  5E3M A;  3E7L A;  1TWF J;  1SD4 A;  2VQL A;  3QP5 A;  1D1B A;  3CCM I;  3QU6 A;  1RRJ A;  3ESW B;  4IJA A;  4X6A J;  4EJU A;  4Z2Y A;  4DYR A;  1YE9 A;  3LA3 A;  1UEL B;  3DBH B;  2VLA A;  1XGO A;  4WWC A;  2FF4 A;  1MGT A;  4EVI A;  1Y39 A;  4LIU A;  2HOS A;  2VKH A;  4M3D A;  2ZSI B;  3Q5F A;  1XSX A;  5HVQ C;  2OJE D;  3E0J B;  1G2H A;  2GOM A;  3KLN A;  1LFU P;  4RAZ A;  2OCE A;  2XPU A;  2R5Z B;  1SVL A;  4CDG A;  2L2O A;  1J75 A;  2JWT A;  1I1G A;  5IY5 H;  2FBH A;  2XGE A;  4RMN A;  5ICE A;  3DV8 A;  1RNL A;  3BTL A;  3OYE A;  2CFX A;  1W7P D;  5C4X J;  3E5Q A;  3CO7 C;  5DCF A;  5FKK A;  5A2Q K;  2K3F A;  5GPC A;  3RKQ A;  1OYY A;  3TKY A;  1MNE A;  2EFW A;  1XCV A;  1K6O A;  4HX8 A;  1RES A;  1QPI A;  4BQO A;  2P5K A;  3GUD A;  4BQN A;  4N4N B;  4E7H A;  1YTY A;  1WKM A;  2DA7 A;  1T33 A;  2FBK A;  3L09 A;  2DA1 A;  2MSY A;  3WTS C;  2DA4 A;  2WY8 Q;  3GF2 A;  4JBA A;  1A36 A;  3W2A A;  2KIF A;  4RDU A;  5BNG A;  3PFY A;  2EIK H;  2ZNZ A;  3P9I A;  1IZ1 A;  1SD7 A;  5DEQ A;  3Q0U A;  2CQK A;  1ZAO A;  2H8R A;  3K4N A;  2VUM J;  1MH4 A;  1JHF A;  3KE2 A;  5CLS A;  4F52 A;  3TO9 A;  2GZW A;  1IRG A;  4XNF A;  2O6G E;  1AWC A;  2RC4 A;  4E70 A;  2WB1 A;  5FGM A;  5LFA A;  3JRH A;  3CMM A;  5JLX A;  2R7T A;  3F6V A;  4JX5 A;  1YIJ I;  5FKN A;  3RTR A;  4UUV A;  1HDD C;  2XAU A;  2BVM A;  1D1A A;  3S17 J;  3PQK A;  1X58 A;  3IH2 A;  4Y33 A;  1Z21 A;  2RNG A;  2JVH A;  2ESH A;  5FFZ A;  1IRX A;  5ERI A;  2DQR A;  2OZU A;  3N97 A;  3E97 A;  5M5X J;  2R7Q A;  5E1Z B;  1GVD A;  1MMN A;  1P7J A;  1WJF A;  3OYH A;  3SDG A;  4A3F J;  4DZP A;  3H36 A;  3A01 A;  2V1U A;  3LST A;  1LE8 A;  4FX4 A;  1QRY A;  4LK1 F;  4O3M A;  2NYX A;  4N9H A;  3FXM A;  2H6B A;  4XRS G;  1LNW A;  3Q0V A;  2KP6 A;  3MCZ A;  3BCB A;  2MD5 A;  3VSK A;  2DFE A;  1LVA A;  2PMU A;  3CMA I;  2E60 A;  1QZZ A;  4XLF A;  1ZLK A;  1J9I A;  3GWZ A;  4ON0 A;  2RDP A;  1OPC A;  2M8E A;  1IN7 A;  4KIB A;  1KU2 A;  1HBX G;  1DPU A;  4BGD A;  3HOW J;  1TBX A;  4OIO F;  1G4D A;  2JZY A;  2LK2 A;  1NG7 A;  5CVU A;  2EFP A;  5JLW A;  1C0W A;  3C2G A;  1UCR A;  4XRM A;  2VXZ A;  4BS9 A;  2W24 A;  2LKP A;  3F0C A;  5L3D A;  3CC2 I;  1IN8 A;  1FIP A;  3M7G A;  2CSO A;  3GXO A;  3F8B A;  3H9J A;  5H6Q A;  3RPU A;  4YFX F;  2RV8 A;  4GYI A;  5J1Y A;  2HI3 A;  2VIX A;  2L5Q A;  3V8J A;  2GIZ A;  1P4W A;  1J7K A;  4M3B A;  3CUQ A;  3HHG A;  4LLN A;  2X0L A;  2GXG A;  2L7M P;  4ZH4 F;  4ZTJ A;  3EYY A;  2CYY A;  2NOG A;  3AL0 B;  4ZYD A;  1OMI A;  4S04 A;  3KP3 A;  3G1M A;  4M71 A;  2L7F P;  1WJA A;  3GTO J;  3I0T A;  2NOJ B;  3ASN H;  4EM0 B;  2DJN A;  5D5X B;  5AIP A;  3GME A;  1JKQ C;  3S1N J;  1S6L A;  4Y17 A;  3IH4 A;  3DQV C;  1WVR A;  2X85 A;  3K1M A;  3ZMD A;  4BBS J;  2WC2 A;  5DCM A;  1FTT A;  1XGM A;  2M34 A;  2IA2 A;  5IPA A;  2LY2 A;  1FMW A;  3CLO A;  4U0V A;  4QPQ A;  4ZYH A;  3S1R J;  2CGP A;  1VZ0 A;  1X19 A;  2XVC A;  3GW2 A;  3GTG J;  4G9Y A;  1RZ4 A;  2V6C A;  3BR6 A;  1ZGA A;  4M72 A;  4H0E A;  2J5O A;  1IV8 A;  5K5R A;  5HOO A;  3ZRG A;  5CYV A;  2MLG A;  2UUZ A;  2EA4 A;  2PG4 A;  2JRM A;  4HV6 A;  3CO6 C;  1T56 A;  1WJ5 A;  2PX9 A;  3HRS A;  3DKY A;  1YJ9 I;  2HQN A;  5EDN A;  2ME0 A;  2P6T A;  2P7C B;  2MGQ A;  4PK4 A;  1E3P A;  1FBQ A;  3ZQG A;  3DTK A;  5CPR B;  1O7L A;  3I59 B;  3DFG A;  4JQF A;  3E3V A;  1HLV A;  1L3L A;  4DZJ A;  2VBY A;  2EV6 A;  4XKC A;  3OYG A;  1VTN C;  2FOW A;  1JE8 A;  3FHN A;  2GA2 A;  1JTY A;  2DOD A;  3KEY A;  4CHU A;  4XR6 A;  1ETO A;  2P8T A;  3KP2 A;  1PP7 U;  3VEP A;  3OYM A;  2FQ4 A;  3CC7 I;  1R1U A;  4HLY A;  4L9T A;  4X0G A;  4P5O A;  3F21 A;  4OIP F;  3RKW A;  2LBF A;  2NS0 A;  3CDI A;  1D0X A;  4FTH A;  1OJL A;  3WTX C;  2VE8 A;  3CC4 I;  1BC7 C;  1U9N A;  2MLK A;  2XUB A;  3HUG B;  2Z1D A;  2LY9 A;  2ZJ2 A;  1MBG A;  1Z0X A;  1LB2 A;  5AIQ A;  4UUT A;  3DKX A;  2ID6 A;  3ZCO A;  4G7H F;  3W2V A;  3JSO A;  3PUB A;  2PN6 A;  2XGD A;  2NVU B;  4XN0 A;  2LP0 A;  3CDH A;  3MN2 A;  4KYW A;  3RYR A;  2BBY A;  2QZ8 A;  4DYC A;  3D5R C;  5JHU A;  3GTJ J;  1U78 A;  1Y1V J;  3A03 A;  1JGG A;  2AXT C;  3JRC A;  2FEZ A;  2BYV E;  4EEF G;  5L3B A;  4U0Y A;  2DOA A;  2E71 A;  3DU5 A;  3BPV A;  5LBQ A;  4OMZ A;  2VC0 A;  2XDV A;  2HYF A;  1KGS A;  2V79 A;  1ETX A;  1Z3Y A;  1MBE A;  1ZGJ A;  1G59 A;  2YU9 J;  4KDP A;  4AYB A;  4XLN F;  4BE0 A;  4LG0 B;  3W3C A;  4KIS A;  1CF7 B;  3GX4 X;  4MEX F;  3JRI A;  2O7O A;  3T0Y A;  2XC7 A;  2ACJ A;  4BAC A;  1YRN A;  4X1E A;  2QM3 A;  3OYN A;  1R36 A;  3RJP A;  2F4O B;  3MZ8 A;  3S16 J;  1JUM A;  5D5U B;  4ENK A;  5FRN A;  1ODD A;  1B8I A;  3EUA A;  4HG2 A;  1TNS A;  2CW7 A;  3M8F A;  2RQQ A;  4CZC A;  4NUB A;  2K40 A;  4IZZ A;  2UWM A;  2RNJ A;  2A5W A;  3ONQ A;  3PQJ A;  1IJW C;  2P5L C;  1VFC A;  2CUE A;  3FMQ A;  4EJW A;  2RRE A;  2FMY A;  2OPT A;  2MC3 A;  4B3A A;  2AO9 A;  3WTW C;  1P6R A;  4EV0 A;  1BIA A;  3U1K A;  1TWC J;  1O3R A;  2K9Q A;  1WI9 A;  5CVI A;  1YQA A;  4E7L A;  3HIF A;  1GVJ A;  2IVM A;  3EDP A;  1KQ9 A;  3FMR A;  2X6X A;  2O9L A;  1ETW A;  1NTC A;  4PGH A;  2M4K A;  4J00 A;  2L9S A;  4IHS A;  3KP4 A;  3S3M A;  3BTC A;  3O6B B;  3HOT A;  2QKL B;  2F4M B;  3HZJ A;  1GXP A;  4RB2 C;  3CP2 A;  4D0P A;  2HVS A;  1UHW A;  3EET A;  1HXD A;  2EQR A;  1X1A A;  1HDP A;  3WHC A;  2VXD A;  3FXO A;  1R1V A;  3HRT A;  4UY8 I;  1FC3 A;  2KMU A;  4FCY A;  5HNH A;  2KJB A;  3HSE A;  1WH7 A;  3BRO A;  3J7Z I;  2R5Y B;  2L9R A;  2QQ8 A;  4ITV A;  1OCC H;  2VBW A;  2BOL A;  1HC8 A;  4M6V A;  2ZJR F;  1Z9C A;  3V4G A;  1AA7 A;  4B4C A;  5JFR A;  3IH3 A;  4P96 A;  1FIA A;  4M9X A;  4CA0 A;  3SZP A;  4YEL A;  2K02 A;  4XON A;  2LVS A;  1IXS B;  3BG3 A;  1MZB A;  1ZLJ A;  3FMS A;  3A01 B;  3DTE A;  4CH7 A;  3KP6 A;  3S93 A;  4YFK F;  2XPV A;  4XIC A;  2LFB A;  3TED A;  4DNC A;  2XAJ A;  2XPW A;  4IRH A;  1GHC A;  3ASO H;  3FWE A;  2MYS A;  5HDN A;  2H27 A;  4CCM A;  3SHF A;  4ZDP A;  5J4V A;  1IN6 A;  2MH2 A;  2L7K A;  2L01 A;  2QGU A;  2P6S A;  3ZR8 X;  1BBY A;  3BTI A;  3M07 A;  2YSR A;  3S3O A;  2AS5 F;  3HC7 A;  5FKL A;  1DU6 A;  4V2G A;  1Y0U A;  3GO5 A;  2CW8 A;  2QEN A;  4MEY F;  3IV5 A;  4A69 C;  4BHC A;  1R9T J;  1K78 B;  4L9N A;  4HPQ A;  1YX3 A;  2E19 A;  4MQV A;  3WU1 B;  3GFL A;  5D5V B;  2VOP A;  4B43 A;  3LSR A;  2ELK A;  4HOB A;  3GTM J;  3CTA A;  1V5G A;  1XMA A;  1VQ9 I;  2CUZ A;  1ZRC A;  4BEH A;  4I09 A;  2KL4 A;  5E3O A;  2XRO A;  4I6Z A;  4QSH A;  2AXL A;  2EIJ H;  2EBI A;  5H2F C;  3TQN A;  2VPL A;  4YIF A;  4JK1 X;  1LUJ B;  2VJ4 A;  2A69 F;  5DTD A;  2OTL I;  5J8F A;  5TJJ A;  1D8K A;  2R7W A;  1K4S A;  2K4J A;  2L4A A;  2Q2E A;  2BXY A;  4WXC A;  2G0E A;  1FWZ A;  9ANT A;  1FLI A;  1B59 A;  4II3 A;  2NS8 A;  3F8F A;  3B6C A;  4UB6 C;  1T2K A;  3ZMU A;  4W1U A;  2XB0 X;  4ZTF A;  3U9G A;  2DPU A;  1Z05 A;  5FRO A;  2V26 A;  3V8L A;  1SFO J;  2RQP A;  1OCR H;  3LNQ A;  1T0F A;  1JKR C;  4QWQ A;  4RS8 A;  3QAH A;  3T8R A;  1IXC A;  1IUY A;  1G3Y A;  4DW6 A;  3TW7 A;  1PVE A;  1FEX A;  4Y4R A;  3SXY A;  4P9F A;  4XID A;  3VWB A;  3ZMT A;  2O61 A;  1P7I A;  2ETH A;  3OYI A;  3A02 A;  1SVO A;  1FMV A;  4HRI A;  2JPC A;  1U6G A;  4BYY A;  4IOA F;  2HZD A;  2ZSH B;  1IRZ A;  1JKO C;  3PJR A;  4DBR A;  4N9I A;  3Q0W A;  5K7H A;  5L3F A;  3UKG A;  2OCC H;  2CWE A;  3RKX A;  1OCZ H;  3LMM A;  4NC6 A;  2NS7 A;  3H5N A;  3I4M J;  2LSO A;  3JTG A;  3VYT B;  2HKX A;  5HLT A;  4AIK A;  5B1B H;  4C2U A;  3L1P A;  5GP9 A;  2XV4 S;  1ENH A;  3AFH A;  3HSR A;  2V4J C;  4BXU A;  4KIF A;  4OU0 A;  4ASN A;  3MWM A;  3E6C C;  4BXX J;  2JUC A;  3SEZ A;  2A3S A;  1KA8 A;  4R79 A;  2B9S A;  2LD5 A;  2EZK A;  1Z91 A;  4Y7N J;  1IUF A;  3FIW A;  3G3Z A;  3BR3 A; 
#chains in the Genus database with same CATH homology
 3QYF A;  4XOT A;  2MAB A;  4RMN A;  4E7J A;  3PSF A;  4ZJZ A;  4MLO A;  3OYE A;  5LD2 C;  3NWS A;  3IP4 B;  3DLA A;  2LC2 A;  2R4G A;  1MNE A;  2VL8 A;  4F92 B;  2ZFU A;  1Y6I A;  4BQO A;  2VQC A;  2IXS A;  3BCA A;  3QYB A;  3KYL A;  3K70 C;  4BQN A;  4N4N B;  4E7H A;  5HNF A;  2ZXH A;  4C2T A;  3OIQ A;  2IS2 A;  2DT7 B;  3PL8 A;  2IS6 A;  1D0Z A;  4FET A;  2WY8 Q;  3W2A A;  3VYU B;  2L9N A;  2KHM A;  3PFY A;  4E7Z A;  5FRM A;  2W00 A;  5CQE A;  3OYB A;  4IQJ A;  4PSX A;  4XLC A;  3K4N A;  4BL0 B;  4RM3 A;  3DWL E;  4F52 A;  1YX5 A;  3EPZ A;  4XNF A;  1QHH D;  4BE1 A;  2WB1 A;  4JOM A;  5KCM A;  5LFA A;  5KNL A;  2K3P A;  3CMM A;  2R7T A;  3HOS A;  3OYA A;  4XLE A;  3RTR A;  2KQR A;  1P9Q C;  3S32 A;  2X51 A;  2XAU A;  2BVM A;  2JA2 A;  4P1W A;  3H9Q A;  1D1A A;  2OC6 A;  3HXL A;  4CCO A;  2XF7 A;  4Y33 A;  2HQA A;  4PJM A;  2DXI A;  3SZG A;  1Z21 A;  4LG3 A;  4PJL A;  2RNG A;  3DEE A;  2FUG 2;  1MND A;  4XMY A;  2JVH A;  4BUP A;  1IRX A;  4ZC3 A;  3A2K A;  3OIP A;  1ERD A;  1D1C A;  4BDY A;  2R7Q A;  4XOR A;  1MMN A;  3OYH A;  1WJF A;  4B44 A;  3U21 A;  1BR1 A;  2LY1 A;  3L2Q A;  2VAS A;  2R7U A;  2O5R A;  4KT6 A;  2DCE A;  2KDO A;  2W1O A;  3OYK A;  3E1S A;  3BLY A;  2XSJ C;  2MD0 A;  2BW3 B;  2F6C A;  3HG9 A;  2KP6 A;  3BCB A;  3HL2 A;  3PNT A;  3ZGK A;  4KIT B;  2LOO A;  2XF5 A;  3VSK A;  4QPO A;  2E60 A;  1WJC A;  1MMD A;  3FBN B;  4XLF A;  2VKD A;  3A1Y A;  4XN3 A;  4BGD A;  4F55 A;  3OS2 A;  1BR4 A;  3LFU A;  2VB6 A;  4XKV A;  1NG7 A;  2LG4 A;  3C2G A;  1R6R A;  2Z16 A;  2K9L A;  2VXZ A;  2A6T A;  3DU6 A;  2V7F A;  2E1M B;  2PMZ A;  4IQ4 A;  4BS9 A;  4DGW B;  4E7K A;  3LSH A;  2AQE A;  3LL7 A;  3QYE A;  4PSW A;  1X1D A;  3H9J A;  1BOB A;  2VIX A;  2HU9 A;  4BJT A;  3OYF A;  4DBQ A;  2W82 A;  4G6T B;  2L5Q A;  3K70 D;  4F93 B;  2HPM A;  3DPL C;  2ELJ A;  3EUH C;  4ZTJ A;  4DJA A;  3UNG C;  2KZV A;  4LIV A;  3VSL A;  3AL0 B;  1LKX A;  3AKZ A;  2F5V A;  2DJI A;  4BEH B;  3IAS 2;  1EA3 A;  2WA0 A;  3LSK A;  3OYJ A;  1WJA A;  4D1Q A;  3NWT A;  1N77 A;  5JHF A;  2NOJ B;  2R7S A;  4U7B A;  4NNJ A;  3MKY B;  4B48 A;  3CZ6 A;  3DQV C;  2X85 A;  2E5N A;  4XQF A;  3H35 A;  3CES A;  2LY2 A;  1FMW A;  4QPQ A;  1NG6 A;  1V5E A;  1VZ0 A;  2VQH A;  1X19 A;  2XF6 A;  4HST A;  2CV0 A;  3S8P A;  4CCJ A;  1LVK A;  1X1B A;  5HOO A;  2I8D A;  3ZRG A;  4RLQ A;  2UUZ A;  1V5F A;  2HDW A;  1QHG A;  1MW7 A;  1WJ5 A;  3IAM 2;  4OAZ A;  2CV2 A;  3C2H A;  3DKY A;  3RQ4 A;  2JSP A;  3PNY A;  3VYS B;  2HVQ A;  2GOX B;  4PK4 A;  3K4L A;  3DTK A;  1WJD A;  2X6Y A;  5CPR B;  3SEQ A;  4JQF A;  2IGN A;  1WJB A;  3CP8 A;  1T0F C;  4PJJ A;  2KRH A;  2K9M A;  4XKC A;  3OYG A;  4AVZ A;  3HPH A;  4XLA A;  3V42 A;  3FHN A;  3GBG A;  4RLF A;  2V6E A;  1Z3X A;  3KEY A;  2LBF B;  1WJE A;  2IGM A;  4XR6 A;  2WAQ A;  4E4H A;  4ZDO A;  3OYM A;  1DGR M;  1X1C A;  3KX2 A;  4X0G A;  4P5O A;  2IGK A;  3K4C A;  3QOD A;  4RM2 A;  3M1C A;  3BC8 A;  2LBF A;  4E7I A;  2CUJ A;  1D0X A;  2R7V A;  3MKW B;  3CJQ B;  3TMO A;  1D0Y A;  2MFZ A;  3HUG B;  2Z1D A;  1SAU A;  2Z2S B;  3DKX A;  3ZCO A;  3W2V A;  3PUB A;  3OR1 C;  4XN0 A;  3G2B A;  3D5R C;  1Y56 A;  3J7A Y;  4DIQ A;  1UG0 A;  4NC8 A;  1N78 A;  2WAD A;  2IS4 A;  2DOA A;  3DU5 A;  5CQG A;  2XDV A;  4J01 A;  5CKT A;  1Z3Y A;  4XM3 A;  5TGT A;  3RPU D;  2R7R A;  1G59 A;  2HPI A;  4AYB A;  2PJR A;  3OY9 A;  4BE0 A;  2BVL A;  3W3C A;  3VDX A;  3OL3 A;  4KIS A;  1QU3 A;  3EUK L;  3SYT A;  4II2 A;  3LSG A;  2XC7 A;  2R7X A;  2JVG A;  4BAC A;  1ZEL A;  2M0M A;  2VJ5 A;  3FKJ A;  1U0J A;  4IX7 A;  4C30 A;  2M3A A;  4C9Y A;  2X1D A;  3OYN A;  2KPM A;  4HNT A;  1JI8 A;  2VJI A;  1DGW Y;  5FRN A;  3OS1 A;  1LDK B;  3EUA A;  1N75 A;  4HG2 A;  4BQQ A;  2CW7 A;  3OOU A;  2OUM A;  2RQQ A;  3PNV A;  3H5R A;  2X6W A;  4NUB A;  3W2W A;  4CZC A;  1PJR A;  2LH9 A;  1E0E A;  2R7O A;  4IZZ A;  4IKF A;  4B3X A;  2UWM A;  2A5W A;  3ONQ A;  4CCN A;  2F4I A;  2OV7 A;  3H0D A;  2RRE A;  2WAE A;  3MMY B;  1Z7L A;  4PJN A;  2WAF A;  4F91 B;  4OWR B;  2V1N A;  4E7L A;  4U87 A;  2X6X A;  3K4B A;  2VQG A;  3QOE A;  4OAY A;  3OS0 A;  2M4K A;  4PFP A;  4J00 A;  2L9S A;  2QKM B;  4XKW A;  3S3M A;  3OYD A;  3HOT A;  4AU7 A;  2QKL B;  4ANJ A;  2LYC A;  4E6K G;  4LIT A;  1GLN A;  4HSR A;  3CP2 A;  2HVS A;  3LSM A;  1X1A A;  3OL4 A;  2VXD A;  3ZXS A;  2DT6 A;  2BW3 A;  3H9G A;  2KMU A;  2WBM A;  5HNH A;  2IS1 A;  4BDZ A;  1X4O A;  3IUO A;  3D5S C;  4BJ6 C;  3L2W A;  3CJR B;  4ITV A;  3OYL A;  3K10 A;  4N4O B;  2BOL A;  1OR7 C;  1AA7 A;  2UV1 A;  2CV1 A;  3L2R A;  1W36 C;  3D5L A;  2V9K A;  4CA0 A;  4YEL A;  4XON A;  3TBI A;  2HVR A;  3M8J A;  2M7A A;  3FBI B;  3K6G A;  3HPG A;  3DTE A;  4XKB A;  4CH7 A;  3S93 A;  2HNH A;  1T95 A;  3OWT A;  3MKZ A;  3UR3 C;  4BU2 A;  4PUS A;  3H5A A;  2MYS A;  1HA8 A;  3BG6 A;  4B47 A;  4CCM A;  2WY7 Q;  4ZDP A;  2L7K A;  3ZR8 X;  3S3O A;  4BE2 A;  3HC7 A;  3BG7 A;  1S9H A;  2CW8 A;  4HNU A;  4FAS D;  2KRC A;  4HPQ A;  3DPT A;  1YX3 A;  3S3N A;  1KON A;  4YEJ A;  4BJ5 C;  2CH0 A;  1WFX A;  4B43 A;  4PFO A;  3OYC A;  2CFO A;  3DTI A;  1UAA A;  1G8X A;  3ZQQ A;  2X1E A;  3K4M A;  4ZYA A;  3LSI A;  3L2V A;  1V5G A;  4KJZ A;  1LFP A;  4XL9 A;  1DQU A;  3OMY A;  2CUZ A;  5KHD A;  3TL4 X;  4BEH A;  1J09 A;  3PSI A;  2KL4 A;  4ZDL A;  4DOZ A;  3HKZ A;  3OR2 C;  4CSW A;  1DP3 A;  3K4J A;  4NC7 A;  2VPL A;  2Y0S A;  3L2U A;  1W36 D;  2W7N A;  2VJ4 A;  2K5C A;  2CS3 A;  2CMP A;  4BXF A;  4H4K C;  3I3L A;  2R7W A;  4F3Q A;  3CF2 A;  3AL0 C;  1MMG A;  1TZL A;  3N05 A;  2M7B A;  2X1C A;  4E7S A;  4II3 A;  2IGO A;  4CCK A;  1PYV A;  2MC4 A;  2M4G A;  4ZTF A;  3MD2 A;  2V26 A;  5FRO A;  2PJR B;  4YRV A;  2Q1Z B;  2E1M C;  4EAT A;  4GRI A;  2LRE A;  2W4S A;  3VYR B;  3K4K A;  1TT0 A;  4Y4R A;  3DPU A;  3VWB A;  2KLO A;  1SFK A;  3RCO A;  2VJJ A;  3OYI A;  2P0W A;  1MMA A;  2JUG A;  2ZXI A;  1FMV A;  4HRI A;  4XLH A;  2HZD A;  2ZSH B;  3PJR A;  3RSN A;  4DBR A;  1BR2 A;  2VQL A;  3A4C A;  2E5Z A;  4NQW B;  1D1B A;  4CUG A;  3LMM A;  2AQF A;  3H5N A;  1YE9 A;  2LRD A;  3VYT B;  1UEL B;  5HLT A;  3F9K A;  3I9V 2;  2VLA A;  4C2U A;  2Q2E B;  1K6Y A;  4LIU A;  4CCL A;  2VKH A;  3AFH A;  2V4J C;  1X4P A;  2ZSI B;  4Y3O A;  3SEZ A;  4R79 A;  5HVQ C;  1OLT A;  3E0J B;  2GOM A;  4XOP A;  3FDY A;  4D9J A;  4HEA 2;  3SDB A;  2L2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...