1NG7A

The solution structure of the soluble domain of poliovirus 3a protein
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
60
structure length
60
Chain Sequence
MGPLQYKDLKIDIKTSPPPECINDLLQAVDSQEVRDYCEKKGWIVNITSQVQTERNINRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Genome polyprotein [Core protein P3A]
publication title Towards an understanding of the poliovirus replication complex: the solution structure of the soluble domain of the poliovirus 3A protein.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Viral protein
total genus 6
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08727 P3A Poliovirus 3A protein like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.870 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1ng7A00
1NG7A
chains in the Genus database with same CATH superfamily
4NQWA 4U0YA 2K86A 3GYHX 2XGCA 2A6HF 4KUMA 2L0KA 4JX4A 3SEQA 1S7OA 3SEZA 3CO6C 2CG4A 4W1UA 2ZXWH 4C2TA 4QPQA 4U7DA 1WCMJ 1P6RA 3LQQA 3ERED 2PJPA 3U1KA 4HSRA 2LY9A 3LMMA 3RCOA 1FBSA 3ZGKA 1X19A 1FTTA 1KU2A 4L9NA 2GIVA 1U8RA 4P1WA 1ZLJA 2JSCA 3P5JA 2HQAA 4EGZA 2HVQA 1ZR4A 4CXFA 2LTPA 2M4GA 5TISC 4A3BJ 2P6SA 1SVOA 2R5YA 1Z77A 2BOLA 2VKDA 3X2QH 2HOSA 2GXBA 4E70A 3ZPLA 2CUFA 5L3EA 2JRTA 4IF4A 2O3FA 3I64A 4PDKA 2FNAA 3FISA 3KX2A 2C6YA 2JVHA 5J8FA 1WHUA 3DKYA 2IGNA 3FMQA 2HOTA 2DPDA 2A05A 2A69F 4V2GA 3GTJJ 2O0YA 2FQ4A 1W7PA 4KYWA 2M1BA 2VT3A 1RI7A 2HFHA 1B9NA 1ONVA 2LKPA 1G2HA 1P2FA 5F1JA 3E97A 3K0LA 2B0LA 3P9IA 3O6BB 2H1KA 3H0GJ 2L9VA 3GEZA 3J81K 4BAYA 4N9IA 4OMYA 4BBSJ 1WI9A 1HQCA 2A68F 2F5VA 4HNUA 3JSOA 2AXLA 2OD5A 1R9TJ 3GZNB 3JAMZ 3SZGA 1VFCA 2PBIA 2QYOA 3HC7A 4M74A 3TO7A 2IBDA 1O3RA 3DV8A 3CDIA 2MFZA 5EEHA 3C2HA 2UV1A 1V4RA 2K7LA 4ESFA 1R5HA 3OL3A 4XSXF 2HXOA 4I0AA 1IUFA 3L2UA 2HKOA 3D0SA 2FSWA 3WTTC 4C3JJ 3EDPA 3HOSA 5AIQA 2EQRA 2JWTA 2KQRA 3BROA 4EJWA 2IPQX 1YJ9I 2FUG2 5A2QK 3F8CA 2PQ8A 2H8WA 5HS9A 3N4MA 2CUEA 1HA8A 3F23A 1D0XA 3GBGA 3TBIA 3HXLA 3GFMA 3ZMTA 3TGNA 3LAJA 2GA1A 4LLLA 2GZWA 1YIJI 5DM6F 5E3LA 1FYKA 1YRNB 2NVQJ 5C4XJ 4LB5A 2LMDA 3K2AA 1S29A 1IXSB 3E1SA 2B9SA 3F6VA 3G1MA 2ME6A 1T98A 3O8HA 4D5CA 5E18F 4KFCA 1OCZH 2XDVA 3M8EA 1XMXA 2XV4S 2X6WA 1ZKGA 2EIJH 4ZDLA 1XDSA 4RGUA 3IAM2 2EA2A 1IGNA 2LSOA 1FWZA 2PI0A 3PUBA 1Z05A 4LMYA 2ID6A 3BR0A 3VWBA 4NUBA 2E5NA 1Y0NA 3CMMA 2IS6A 1FJLA 2BW3A 4V2FA 2DFHA 1S5LC 3CCLI 1LE8A 2Y30A 2LFBA 1R71A 5F08A 1JUPA 2F4OB 1FLIA 3L2RA 4J01A 1FZPB 3A0BC 1WJEA 3CTAA 5H6QA 1RNLA 4XN3A 4P9UA 3CD6I 2ZMEB 3HBLA 1SD7A 1IC8A 3S2DJ 1JKQC 1ON2A 3R60A 2MW8A 3DEUA 4L0ZB 2XAHA 3K4CA 4AU7A 1FEXA 3S8PA 3CO7C 4QTRA 2PFBA 1PUFB 2Y31A 4UB8C 1MBGA 5J1YA 5JHUA 1IF1A 2VL8A 1IO2A 3MZYA 1FMVA 3OOPA 2NVXJ 2O8KA 4LGWA 1VNDA 1TP4A 2YSRA 3OSGA 1IUYA 3G2BA 1ZAOA 2XAQA 1Q1VA 4PFPA 4XR6A 1FBQA 1TQMA 2K27A 4A12A 2UWMA 3CUQC 2LC2A 2FF4A 3BOQA 1ZRDA 4WX9A 1BN5A 1UHMA 2KRFA 5TJJA 2ZJRF 2VJIA 3OYJA 2FD5A 1GVJA 5AONA 2J5OA 1U8BA 3QPSA 3Q0WA 3S16J 2ZBKA 1BA5A 3HTSB 2MLGA 3ASNH 1SC7A 2XAGA 3KLNA 3F8FA 4IRGA 2BVLA 1JUSA 1DQUA 2CH0A 2ZNYA 1UFMA 4AIJA 2HVRA 2NVTJ 3LA2A 1HW1A 5ICCA 1ACIA 2BHZA 5C4JJ 4U0VA 2F6CA 2X0LA 5D8LB 3BR5A 3V8LA 2DMNA 2CS3A 3FHNA 3OMYA 3ZMDA 9ANTA 2MD0A 3BG5A 3EQLF 1HDDC 1VQOI 4XK4A 3KIOA 3FM5A 1J7KA 3PM1A 4B4CA 1YFHA 3CC4I 1BR2A 3HPHA 5EDNA 1B72A 1W5CC 1FBUA 3I3LA 3LSTA 3MZHA 4R8HA 3TP3A 4WXDA 3GW2A 1OCCH 2VPLA 1T08B 1O57A 3BTIA 2QA4I 3HEFA 1LDJA 4I99C 4WXCA 1I1SA 1NHAA 1J2XA 1PVEA 4HA8A 2P8TA 2L7MP 2BXYA 4RAZA 4XOPA 3ZP5A 2K5CA 4XOTA 3OIOA 5KHDA 4GDFA 1OFCX 4MQVA 2HS5A 1U2WA 1H89C 2ELJA 5K7ZA 2IGOA 2LNBA 2PMZN 3H35A 1R5GA 3VYUB 3ZMUA 1HKTA 3COAC 2R7SA 1YW7A 2VODA 4BL0B 3KYCB 1X4OA 4L9TA 3ROUA 2OPTA 2ECBA 2P7VB 2HNHA 4G7OF 3DLLF 3ZMZA 3H5AA 2E1MB 2VJJA 2ZC2A 3HHGA 4CH7A 1PYVA 2X6YA 1YQAA 4G8XA 2FOKA 1Z9CA 2VBXA 3G3ZA 3SFIA 4C9YA 4XRMA 4CZZA 1ZRCA 3I59A 4LITA 3L2QA 5LFAA 4HSTA 3AG1H 4CO8A 5JLXA 3G71I 4NDLA 2CJJA 2IXSA 5M5XJ 4OIPF 2W25A 4MGRA 2R7ZJ 2Z2SB 1QZZA 1DUXC 2LD5A 1OJLA 2XGXA 3OYDA 1RR7A 2VLAA 4A3GJ 3E5XA 1VQ5I 3GFJA 4S04A 3B02A 3ZMVA 3IV5A 3HOVJ 4XONA 3EETA 1WJDA 4UUTA 4XNFA 2FBKA 5H2FC 5DUIA 2DTZA 1YX3A 4C30A 3D1NI 5J8CA 2HTSA 4QWQA 3BT9A 4UV9A 1ON1A 4C3IJ 2V6CA 5A2QZ 2R92J 2HTJA 1D5YA 3A03A 3FKJA 4BE0A 4ZC3A 1Z91A 1ZARA 4ZYGA 1A35A 2K4JA 3JRAA 4PUSA 1YJWI 5IT9K 2KT0A 4LK0F 5JFRA 2E2IJ 5H6RA 5ICEA 4NC8A 3RQIA 3F22A 1OR7A 1ZYRF 1TNSA 2OZ6A 3Q0VA 3RZOJ 1I6HJ 5M3FJ 3V7SA 2TRTA 2NXNB 3KP2A 2DQLA 5KK1A 3IH2A 4EM0B 2AXTC 2KIUA 2LDUA 2AQEA 3NARA 2KJCA 3KP6A 2D45A 5FKNA 2KRHA 2BW3B 1SFUA 3OR1C 2E71A 2L7KA 1OCTC 4GYGA 4HYEA 4JOMA 4Y33A 2RKHA 3GXOA 5C44J 1XCVA 5BPDA 3CC7I 3HUGB 2ECCA 2RQQA 4DBQA 1JKOC 2JA7J 2VASA 1H88C 5LGTA 5DD8A 4HOBA 4BYYA 1OR7C 2F5DA 2LF8A 4G12A 2IW5A 2DBBA 1KGSA 4AIHA 5FJ8J 2TCTA 5M3MJ 3A4CA 3RJPA 3PUFA 4HDUA 1OYIA 3RPUD 2CQQA 1ERDA 3AG3H 1MBFA 4UB6C 2DN0A 5F0FA 1I6XA 2KZGA 4D0PA 5J6XA 1EH6A 2QWWA 4F92B 3BP8A 4IHTA 1A04A 1BI2A 1ZREA 3ZXSA 1R1UA 2EILH 3VOEA 5D6EA 1Y1WJ 2HDCA 3UR3C 3V7RA 2X4HA 1R49A 3CP2A 5F1RA 1RKWA 2CWEA 4D7NA 3BCAA 4YIRX 2MH2A 3KZIC 2M0MA 4XRFA 3BTCA 1V54H 2D1VA 2DFFA 1RR8C 1F5TA 2QBYB 1USSA 1ZH5A 5C3EJ 1PJRA 3ABMH 2HZTA 1GXQA 3Q9VA 4A3KJ 2GOXB 2P5KA 1L0OC 4G9YA 3DFGA 5IYDJ 1YLFA 1K79A 3RYRA 3Q5FA 5EJCA 1G3WA 2OZUA 1IRZA 5D4SA 4PCQA 2QGUA 4XLFA 1T0FC 2FEZA 4EJOA 2UUZA 1AOYA 3E5UA 2DA1A 4O3MA 2XGDA 2DW4A 1PP8F 1MZBA 4DQ2A 1TZLA 1GXPA 2A5WA 2BBYA 3ABTA 3PNYA 4GCVA 2F4MB 3CUOA 2V9KA 3LA3A 2DT5A 3BR2A 2FMLA 1JTYA 4XSZF 1QNTA 2MA3A 5FLVA 3M1CA 4ABZA 4K2EA 2XF7A 1XSVA 2K40A 5EF6A 3T8TA 1SAXA 3KEQA 2CW8A 1DGRM 3KYLA 2TDXA 4KNYA 2RVCA 1GHCA 4Z6YA 3CCQI 2EZHA 3S93A 1JKRC 1WJCA 5K7HA 1DP7P 3IWFA 3QU6A 3RTRA 2W1OA 3KP7A 2E5ZA 3OYKA 2HYFA 1J59A 1MBHA 4NC7A 5FB2A 2A07F 2A3SA 2DT7B 2KIMA 4AIDA 1BI0A 2XGEA 1YYVA 5DD4A 1JT0A 2AO9A 3MKZA 3DCFA 2ME0A 3QYEA 1H9GA 4N9HA 4F91B 3CF5F 5KCMA 1I27A 3BR1A 1D1BA 3SXYA 3ZQQA 1FIPA 2P4WA 2CV1A 4D7MA 2RNJA 1MDMB 1QVTA 3OL4A 4HAMA 4AYBN 3OYAA 1D8KA 1E0EA 3JRGA 3HTUA 5B3SH 6PAXA 3D5LA 5LEKA 3BCBA 3KP4A 1LVKA 3I58A 4GXOA 4A3FJ 5DS9A 5TRDA 1KU9A 1YJNI 4UY8I 2NYXA 4NNJA 5CLSA 1QA6A 1XG1A 2I10A 3U9GA 3BR6A 2HVSA 2HYJA 2V1DA 5J47A 3K2ZA 1E2XA 3BTJA 3U1DA 4YELA 1LKXA 2JA8J 1I1GA 4HPQA 3V8JA 4OIOF 2NVYJ 3PNVA 3ELKA 2CYYA 3KETA 1MNDA 2WAQA 2QKMB 4FASD 4R79A 4BY1J 3SQNA 3DP7A 1O7FA 5IY5H 2E1NA 1G3TA 2VQHA 4CCOA 3C1DA 4E7ZA 4HV5A 3CJNA 1BW5A 1YRNA 3O8GA 1WJFA 1FYLA 1B59A 2DO7A 1HOMA 1SD4A 3W6VA 2ZCWA 3JCUC 3OOUA 2FOWA 2R7UA 2FNPA 3BZKA 3G1LA 3K4JA 3HOZJ 2ZXIA 3H9GA 5L3DA 2LP0A 2ZJ2A 1CGPA 2HQ5A 3OYLA 1D0YA 4BH9A 2A61A 5IT9Z 3BY6A 1WGXA 2JA6J 4RMNA 5LHGA 4BJTA 3VPRA 4ENKA 4RDUA 1L3LA 2XF5A 4HG2A 2X1CA 2FBIA 1R6RA 3AKZA 3EUAA 1WH5A 4ESJA 4ENMA 5F04A 3B6CA 4MFDA 4A3LJ 2K9SA 4N0BA 3K6GA 2R7RA 2FMYA 3LAPA 4UUSA 1BW6A 1VZ0A 3QPHA 1A5JA 2R7TA 3K70D 3CCRI 4BXXJ 4ANJA 3L1PA 3PNTA 3F0CA 2RDPA 4II2A 1QVUA 1UZCA 2ZMEA 2M0CA 3PIOF 1SVLA 3HSEA 1POGA 2ID3A 1TW2A 3WG9A 2HU9A 1U3EM 4V19K 3ZQGA 1EV7A 2V7FA 4YIFA 3CC2I 2JMWA 2LRDA 1ORKA 2PN6A 1PUFA 5EGOB 1IDYA 2EWNA 2JTVA 2XSDC 4WWCA 3ABLH 1S6LA 3E6BA 3ZMSA 4G7HF 5LD2C 4M73A 2VJ5A 1TLHB 4A3JJ 2KZVA 4R1HA 5BQTA 4JYKA 4DJAA 4HV6A 4HEA2 2CQNA 4PJMA 5D4RA 2WWYA 2OCEA 2KL4A 1SVMA 1X1BA 4BJ6C 3BPVA 1ETYA 1TW3A 2XAFA 4IZZA 2UXNA 2ZMEC 2ICWG 4RLFA 1E17A 3CJTB 2V1UA 1SMTA 3R4KA 1VQ8I 1BOBA 2MYSA 2A6TA 3QPTA 3WTZA 1NK2P 3I54A 2JA2A 4XORA 3D5SC 1FP1D 1U5TB 1SD5A 4HW0A 4EM1A 2HDDA 1Z3XA 5HNFA 1MKMA 2CV0A 2Y9ZA 2HKXA 1T33A 2V1XA 2Y2ZA 3QAHA 4BACA 2XROA 1NG6A 1TTYA 1TWGJ 3RYPA 3GFLA 2P5VA 3C18A 4YFXF 4S05A 1FOWA 1VI0A 1P92A 1XC5A 2GA2A 4M9ZA 4EATA 4LLGF 3K10A 1P4WA 1NH3A 1UHSA 3K7AJ 2W57A 3CMEI 1QGPA 3S14J 1S8NA 3K9TA 1FMWA 4FE7A 1I50J 1A36A 3IHUA 3W6KB 2X1EA 4Q4ZF 5DTDA 4CCLA 4XRSG 1MBEA 1BOAA 2DA6A 3BTLA 2X9DA 3B73A 4A0ZA 1W36D 4LG3A 1FOKA 3RKWA 4ZYDA 2JK3A 2L7FP 1TNTA 3CJRB 5F27A 2FRHA 3SDBA 1K6YA 3EUHA 1WKMA 5TGTA 2G9WA 1U6GA 4X1EA 1I5ZA 4DNCA 2ACJA 4OIRF 1VQLI 3BWGA 2VKEA 3W2WA 4HQEA 1IW7F 2EV0A 5HNHA 4LFUA 2L3DA 2XSJC 1FYMA 2BVMA 5CKTA 4QPOA 4M3BA 3BG9A 4WF2A 4GYIA 3WGIA 4HF0A 2VPRA 2HOEA 1FTZA 1X4PA 3S32A 2OTJI 3CCMI 3VODA 1F1ZA 3PIPF 4PJ0C 4L5IA 4N4NB 5CVVA 3H1CA 3ZQFA 5FRNA 2R93J 4G6QA 3EUHC 1ETQA 2QKLB 3FDYA 4YG2F 3VYRB 1W4MA 4A0XA 1S7EA 4BHCA 4FCYA 3HGGA 1R36A 3ABKH 1WVRA 1J0RA 3KYDB 3SFZA 1Y39A 1EA3A 2LH9A 2OAZA 5GPCA 2E1MC 3IAS2 3KEOA 3J7AY 3FXMA 2M5WA 3HKZA 2PJRB 2DDBA 3DTKA 4I98B 2VONA 2ISYA 4RLQA 4NBQA 5DCFA 5D6FA 3WG7H 3HOYJ 1KONA 3ZQLA 3ZRGA 2KDOA 2WB1A 1WZ2A 2G7HA 3TMOA 1KU7A 4F93B 3BJOA 2DFIA 3L00A 2XKOA 5DUKA 1ZHFA 3C2GA 4B3AA 1HW5A 3Q0UA 1IRXA 2PX9A 1JHFA 1VQNI 3SZPA 4E4HA 3ECHA 4EM2A 2XPUA 1O4XA 2R7FA 4Y7NJ 1R58A 2X6XA 4U88A 3WTXC 4BY7J 5HOOA 1BIAA 3GMEA 3TP0A 1FOYA 1MGTA 4A2UA 3HUGA 5B66C 5E3NA 4UUSB 2Y9YA 1VQPI 3I53A 1GV5A 1BIBA 2K9LA 3MQ0A 2GLOA 3GZ5A 3AL0B 2QSFX 1XN7A 3K4KA 2KDZA 2VOOA 3DBLB 3LQRA 5E17F 1SFEA 2NAZA 1IDZA 2NS0A 3HYIA 3H92A 5E1WA 2NNYA 4IOCF 1LJ9A 3BG3A 3QQAA 3F6OA 5M5WJ 1HW2A 2LR8A 1JT6A 3VFZA 3F3XA 1SANA 2X48A 2DYSH 4HQMA 3ML6A 1XD7A 1MMDA 1ZGWA 3HL2A 4C2UA 2XRLA 3V4GA 5LRRA 3ZQIA 3LA7A 5D5UB 5EG0B 4KN7X 5J4VA 5L3CA 4F52A 2E7XA 2H27A 1Z0XA 3H3UA 3PQJA 3W3CA 2QBYA 1LB2A 4IPAA 4KIBA 5F64A 4RGRA 4CYDA 3LSKA 2OTLI 1DDNA 2VBYA 3JRIA 3HM5A 2LBFB 1R7JA 3DEEA 1D1AA 3CCVI 4OAYA 1P4AA 3IC7A 3P9CA 2R7OA 2EIKH 2JVGA 2KISA 1ZELA 4RS8A 2G0EA 2VE9A 2YU9J 3OS1A 2K9QA 4IJAA 4XRSA 2NRAC 2MH9A 2RNGA 3V7CA 3MKLA 3FXLA 2HI3A 3RPUA 1YIOA 3AG2H 3CF2A 1EF4A 5D5XB 1U0JA 1UHWA 2DA7A 3WTWC 1DP3A 2YS9A 3QYFA 1V5FA 3FIWA 5HS8A 1LFPA 4BQOA 4LK1F 1V5GA 3ZR8X 2XHKA 3JRDA 3S1QJ 2CFXA 2JPCA 5HLHA 3P9KA 2RAEA 1X1DA 1XX5A 2D2WA 2L9RA 4RAFA 4XKVA 3AFHA 5ERIA 1ZG1A 2OUMA 5DDGA 2K9NA 2WV0A 2DA3A 4I76A 4KT5C 4WXHA 1I39A 3KCCA 2MC4A 2IS4A 1X3UA 4L9JA 2YPRA 3OYCA 1KQ9A 3OSFA 2HR3A 2CQXA 3HZJA 4A3DJ 3I0TA 5J4YA 1IN6A 4JP0A 2O7OA 4GGGA 3W2AA 1LFBA 2L5QA 2LVSA 3GF2A 2HZDA 4XIDA 1IJWC 2GM4A 3FBIB 2COMA 2QQAA 3I4NJ 1J9IA 2QEXI 1O7LA 3S3OA 3BLYA 5HVQC 3I5UA 2R7QA 1P7JA 3ZQCA 1MDMA 2DT6A 1YO5C 4ETSA 3J81Z 4CCMA 1TWCJ 3B6AA 2K9MA 3LSMA 2PMHA 2QQ8A 5J1UA 4Y15A 1PUEE 1U9OA 3ASOH 4FT8A 1GLNA 2EJRA 5FLMJ 2NOJB 5GAGJ 2DMUA 2Y0SN 2WY7Q 5D5VB 1MW7A 1G3YA 4HDVA 1W5SA 3FX3A 1T2KA 1CF7B 2F5FA 1D8JA 5JVGF 2CU7A 4M9SA 1D0ZA 3GTQJ 1V5EA 4BJ5C 3OS2A 4YIIA 3MD2A 2RC4A 2YX4A 1XTAA 4KIGA 1TWFJ 3OYEA 1YITI 5FGMA 5GP9A 5IYCJ 3EYYA 1GDTA 4A0YA 2HQRA 1BC8C 3V42A 3K1PA 1OKRA 2D1HA 2F5CA 2XKPA 3RPQA 3ABUA 2LG4A 3LSHA 1NG7A 3NEUA 4O6JA 3BC8A 1FPQA 3VEPA 4B48A 4B3XA 5GTHC 1J09A 4M6YA 3TDZC 1BR1A 4L0YB 1XGOA 2HXIA 4W97A 1XDUA 4HRIA 4XLCA 4CCKA 1QRYA 1N78A 1Z67A 5AIPA 4XM3A 1W5TA 5FROA 3UKGA 4OOIA 3L2CA 5B1AH 4II3A 1Y8QB 3HG9A 2A6EF 4I01A 2P81A 3O3KA 1QPMA 1Z7UA 3HRSA 2V26A 3KLOA 4IHSA 3HRMA 4B09A 1SD6A 2BY3A 3G6EI 3C7JA 3L7WA 4ZZDA 1N77A 1F4KA 4BQAA 4EV0A 2Z33A 3AAFA 4BS9A 2BGCA 4PGHA 3HOUJ 2F4IA 3G73A 4XBFA 2Y75A 1AA7A 2DQRA 1XGSA 2YX7A 2XAUA 4ZJZA 1RRJA 1LEBA 3E5QA 3M9AA 3WTYC 1G6NA 1K78A 4A3CJ 4ZDPA 2Y48A 1HF0A 1AU7A 3OYNA 3J7AO 3IH3A 1X3ZB 3LSRA 1RIOH 4M3DA 2O03A 2Q2EB 4Q48A 4ZZLA 3DU6A 4ZYEA 4PGGA 2ZO4A 1GV2A 4DIQA 1W1WE 5EGOA 2XRNA 2P7CB 1JI8A 1OCPA 1QHHD 2GAUA 3GLLA 4MIMA 3K4MA 2FE3A 4EMSA 2VUMJ 2VC1A 1LEAA 3RDIA 1MMNA 4IRHA 2GXAA 2BY2A 2GWRA 4PFOA 3QYBA 2VN2A 3F8NA 4ENNA 4BNCA 4A3EJ 2XUBA 1YG2A 3E0JB 3RSNA 4M72A 4HX7A 2R7VA 5IOYA 4AD9A 4RAGA 2BXZA 4M9XA 4EJUA 5EZHA 4CCJA 3CUQB 4GFBA 1IN7A 5E79C 1IN8A 2VXDA 2BY1A 5E20A 1X1AA 3ZN1A 2K02A 1G3SA 2QQBA 3OYGA 2EFWA 4H0EA 1MNEA 3J80K 3PSFA 4JX6A 3EYIA 5CVRA 4PZJA 3IP4B 1ETVA 1MMGA 2OBPA 3DF8A 5JI6A 4MHGA 2IT0A 1YW9A 3TQNA 4A5NA 4KICA 4YFNF 1JKPC 4I6ZA 1S7AA 4O5VA 4M3EA 5LGNA 4IHXA 1U5TA 1VQ4I 2R7XA 2RV8A 3JR9A 3FF5A 2VQLA 4CCNA 1H9TA 2EZIA 1IV6A 1O3TA 4BUPA 2ZKZA 2EV6A 2JJ7A 3RKQA 3GX4X 2WA0A 3E6DA 1ZGAA 3FKIJ 1XGMA 4FE4A 2Z3YA 2UZKA 4LD5A 1S9HA 3SJMA 2KHMA 4FHTA 3QPLA 2CQKA 5BS6A 3WTVC 2ELHA 4Y4RA 2IA0A 3Q3SA 4PJNA 4B44A 3DPTA 3SHFA 1FSHA 4EVIA 2DA5A 1LFUP 3JSPA 2JZYA 1UG0A 4LJZF 1QZEA 2WB1N 2WAFA 2M8EA 2QCOA 3NRVA 1LPQA 1G4DA 2L4MA 3DPUA 4HNVA 2FQ3A 2VBWA 4RGXA 2HPMA 1WJ5A 4WK8F 1K61A 5FRMA 4BEHB 1UAAA 3WGHA 1U9NA 3JRCA 4HNTA 4CSWA 5KNLA 2PLYA 2FA5A 3FMSA 1MBJA 4ON0A 3GLXA 3VYSB 1F36A 4P9FA 3LFUA 4CZCA 3NQOA 1UJ8A 4MQ9F 4FTHA 1Z1DA 1YS6A 2ESHA 2MGQA 2X1DA 4P5OA 3WU2C 1JUMA 5FKOA 4UUVA 4F55A 1JJ8C 5M5YJ 2L7ZA 5DCMA 2M4KA 3QRFF 3PFIA 5K5QA 3BJAA 5GADJ 4MFEA 3IKVA 4CDGA 1K4SA 2VB6A 3HSRA 4X6AJ 5K7FA 2WTEA 3OV8A 1LVAA 1KA8A 2W7NA 4CHUA 2DOEA 4ESBA 1RETA 3A02A 1BJZA 1PP7U 3GTLJ 1QU3A 4MEXF 2M7AA 2WAEA 4IHWA 1IRGA 2A5YB 1T6SA 3CCYA 3MKYB 2PMUA 2L02A 2M3AA 1V3FA 3PO3J 1MNMC 3RKXA 4FX0A 1YHQI 2KKOA 3G1OA 1RESA 1WH7A 3IUOA 3L2WA 2W84A 1XMKA 1E3PA 1JTXA 2I5UA 2MG4A 5ILSA 3SYTA 2PJRA 4NHJA 1ETXA 4J19A 1FSEA 1VQ9I 3WGGA 2ZB9A 2MLKA 2MABA 2R4GA 4EGYA 1K7AA 1IRFA 2JA5J 2DODA 2JUGA 4RB2C 1TT5B 5CPRB 1F9NA 3NAUA 1ZG5A 3A01A 2F5EA 1SFOJ 2B7EA 1P9QC 2DXIA 3L09A 4JQFA 3CCJI 3GCMA 1ODDA 4HF2A 4M3FA 3MEXA 3RIRA 3FXRA 2EBIA 3A0HC 3Q9SA 4M3GA 5KVRA 1X58A 1QO0D 2ADUA 3CLQA 2QENA 3H3VK 2XPVA 2GBYA 3U21A 5DM7F 1B6AA 4P55A 3VYTB 1K83J 3FHZA 4RGSA 1ZQ3P 3CMAI 1YX5A 2G7UA 1XCBA 4RA2A 1MH3A 3KP3A 1RUNA 4CICA 2XAJA 2EV5A 3GUDA 1SFXA 2EA4A 1XPXA 1A6QA 2DJNA 1FX7A 4JX5A 2M8GX 3ZN0A 2PMZA 1ZK8A 3H36A 2R0QC 1H8AC 2Z9OA 2YUSA 3FXJA 2JRMA 1NK3P 1K78B 4E7LA 4UVAA 5IPAA 1LQ1A 5LLQA 1KQ0A 3WTSC 2DDAA 3M1EA 3E3VA 3OR2C 4LIUA 3DU5A 3GTOJ 2EH3A 4QSHA 4HLYA 2QQ9A 4YEJA 2DYRH 2E2HJ 3M07A 4OAZA 1APLC 3JW4A 2LLKA 4PK4A 4E7SA 3EUKL 2M87A 1BBYA 3K69A 2ZSHB 2V6EA 2EFPA 1JXSA 1WRJA 3MZ8A 1TWHJ 4JK1X 3QOEA 4Q5SF 5HLIA 3D5RC 1GVDA 1S3JA 2KMUA 3C3WA 5EG0A 1VQKI 1KYWA 4BHBA 2O6GE 2B63J 1SMYF 4J00A 5K1YA 5ILVA 1USTA 2VKVA 1XSXA 4IEJA 4M71A 5E3MA 4PSWA 1MSEC 1STZA 3OS0A 1DU6A 4NB5A 5F0HA 3IKTA 2R7DA 1MD0A 3HOTA 5HLGA 2HQNA 2LBFA 3HOWJ 3BG6A 3QU3A 3TL4X 1UG2A 2UXXA 4F7ZA 3TEDA 3HGYA 4BKXA 2ZFUA 3LSGA 3HHHA 3DWLE 2DOAA 2VKHA 3H5NA 1MH4A 3OYHA 1O3QA 1GUUA 3CCEI 4HLXA 5GTIC 3J80Z 1X2MA 1WQ2A 5BNGA 3L9FA 4EQQA 3JREA 2VBZA 3S1MJ 1EJ9A 3CLOA 1HBXG 2MD5A 4KITB 5LEJA 5FLXK 1EKEA 2E19A 3N97A 3E6CC 5HS7A 3WU1B 1ITYA 4CA0A 1HSTA 4P96A 1SFKA 4D5FA 2FX0A 2ZXHA 4Y3OA 1X1PA 1RC9A 1RZ4A 1ENHA 5LGUA 4U87A 1B8IB 2CW7A 3S17J 2L01A 2QM3A 1G59A 5GPAA 3I71A 3R61A 4G6TB 3LSIA 4IX7A 2WBMA 1F43A 3OYMA 3OYIA 3S1RJ 3LWFA 2MBFA 1XMAA 5BMZA 1JGGA 2L54A 2Z5UA 3WE2A 2L4AA 2Z99A 3CESA 2F2EA 2ZJPF 4IQJA 3DXJF 2Q0OA 4L18B 4A5MA 3GTGJ 1TC3C 4XKCA 3I4PA 1WSUA 2L2OA 2W4SA 3ULQB 2FXAA 2EFOA 3V8KA 1A31A 5CQEA 1TT0A 2KJBA 3GFIA 4I09A 1VQ6I 1ZR2A 1XS9A 3BDDA 5DCMB 2GQQA 2R5ZB 2DA4A 5IOZA 3DLAA 3GTMJ 3TO6A 2L9NA 3MMYB 2IGMA 3FXUA 2QVOA 2VQGA 2W85A 1FNNA 5DYMA 4ZYHA 1U78A 1CF7A 2AHQA 3PJRA 1MMSA 2O61A 2AQFA 2CW0F 4RM2A 1W0TA 1KQ8A 2EZKA 2GXGA 1VQMI 3MCZA 1V55H 4MEYF 2IAIA 2D5VA 5J1RA 3IH4A 2DI3A 3RQ4A 4EJTA 2VE8A 1LDDA 1X3WB 1QHGA 2DTRA 2LREA 3S3MA 4KA4A 3GTPJ 3LFKA 1WPKA 3N05A 1R00A 4I02A 3O2PE 5FFZA 4EJVA 3GTKJ 2XB0X 1I3AA 2K4BA 1FC3A 4B43A 3TO9A 2IEKA 2E60A 3M8JA 3FK6A 2FU4A 5CVJA 2DAOA 1IZ1A 2E2JJ 3A01B 4ZTJA 5K5OA 2Z1DA 2BY0A 3NWTA 2BHYA 1Z21A 4AWXB 2IA2A 2CGPA 2IS1A 3MVPA 1YTYA 2VOPA 4RB0A 2DMPA 2LKXA 1Y56A 3BZ6A 1E3HA 2COBA 4G6DA 1OCOH 2DJIA 1EH8A 1VTNC 4DYQA 3FK7A 3DTIA 2H6CA 4JBAA 5J3LA 4KMFA 2QLZA 2VC0A 3HPGA 3M7GA 3TDUC 2O5RA 5DV5A 5ILUA 3S15J 2EIMH 5H20A 1JHHA 1UB9A 4GO1A 4UNOA 2XC7A 5GAEJ 4OMZA 4AVZA 1AHDP 2KPMA 1HXDA 2DMTA 1QZYA 2OC6A 3KPHA 3FZVA 2E36A 3TOAA 1REPC 1G8XA 3E7LA 4LOCA 4AYBA 1M1EB 1IAWA 1ZGJA 4YFKF 1AKHB 4H4KC 2STWA 4QLCU 3PO2J 2LYCA 2Q2EA 4WCGA 4LG0B 5E1ZB 2W24A 1Y8RB 1OISA 3DKWA 5IP6A 1LUJB 5E8IA 1VQ7I 1HKSA 1MJBA 3FXOA 3WTUC 3BR3A 1IN4A 2M2EA 3S2WA 4UXNA 4XLEA 4D1QA 5FD5A 3T1BA 3VSLA 3BG7A 1ZTRA 2IVMA 2EFQA 4E6KG 4E7JA 2E35A 5E1XA 2OF7A 2IRFG 3FWEA 3CUQA 3LOCA 2KFDA 2K3FA 3WHCA 2M30A 3ZCOA 4XKWA 4DW6A 1FT9A 2STTA 4NQWB 4IO9F 4DGWB 1KU3A 1UELB 1W7PD 2PEXA 2NVUB 1TWAJ 4S0HB 4RB3C 3KP5A 3SDGA 4OU0A 2JSPA 2HWVA 5HDGA 2YU3A 2VQCA 3BPXA 3CZ6A 4IKFA 3BJ6A 4U0WA 2Y69H 4A6EA 2EPFA 3LSPA 3PSIA 1BC7C 2JT1A 2OQGA 1OCRH 2W82A 2YR2A 2M7BA 4Q47A 4A6DA 1X2NA 5E8GA 3FXKA 3T8RA 1SEUA 3T5XA 1A6IA 1Z7LA 3J7ZI 4IHVA 3HDDA 2F48A 2IA1A 3FMRA 4CYCA 5EEGA 4G7ZF 3HB9A 4B8XA 2LF7A 2VT2A 4Z2YA 4A93J 4NC6A 3ESWB 1IN5A 5JHFA 3H3ZA 5L3BA 2XB5A 5IP9J 2WAQN 1RPWA 1KYZA 4RBOA 3S1NJ 1Y6IA 1OPCA 1XB4A 2R5YB 4KT6A 4MTEA 3P7NA 3BZCA 3CDLA 1J75A 3C2BA 5F0CA 1R1TA 3F72A 5FLXZ 1ULYA 3M3YJ 4RM3A 1DPRA 4E7IA 2CQ7A 4KN4X 1ZRFA 2H6BA 4LIVA 1OYYA 1MIJA 3W6JB 4BXFA 3BQZA 4KIFA 4E7HA 4B47A 2MC3A 2XPWA 2ZNZA 1IXRC 4M6VA 1R1VA 3CCSI 4IRIA 2LY1A 4AUXA 3WE3A 4BEHA 4FX4A 2OV7A 1W7PB 2X85A 2M9HA 1YI2I 1CQTA 3QP5A 1ETOA 2JPBA 4IQ4A 3HSFA 2CRGA 3GO5A 1EH7A 5HDKA 3H0DA 3OIQA 5KAFC 2Y0MA 1HC8A 3RKYA 4EEFG 3F9KA 4HBLA 4ASNA 5CQGA 4X0GA 1I3QJ 2L9SA 5ICFA 5IT3A 3GWZA 1FIAA 3WU0A 3L2VA 3K4NA 5BOXA 4XLPF 3T0YA 4XLAA 1Q1HA 1WJAA 2DA2A 3MAJA 4DZJA 4RB1A 4D9JA 1YS7A 1WFXA 3IRQA 2HPIA 3CMYA 1Z3YA 2DLLA 1OLTA 2JQ7A 1HKQA 4HF1A 2LOOA 3JTHA 4PJJA 4F3QA 2IGKA 2KLOA 1XSDA 2DPUA 3HRTA 3H9JA 2JUCA 4XLNF 4XKBA 2KIFA 5K5RA 1JGSA 2RN7A 2HDWA 2QZ8A 5CYVA 3VB2A 1QQIA 1R22A 2M34A 2Q8KA 2CUZA 1R5ID 2RREA 5DEQA 1PDNC 2BE5F 1RUOA 1R4NB 2MSYA 1IXCA 2V1NA 4I7HA 1YOVB 3DQVC 2K85A 2IJLA 5IYBJ 2CSOA 3R0AA 1HDPA 2E1CA 4M6XA 4HZFA 2CV2A 3A2KA 2HEOA 3RI4A 3ERMA 3UNGC 1ZLKA 3J7YJ 2GIZA 3ZOBA 3K1NA 4ZYAA 1B4AA 2O9LA 3MKWB 3FXQA 1UMQA 3U2RA 5L3GA 1Z6TA 1OQYA 2LKSA 2RQPA 4FISA 1QBJA 4XLHA 4YRVA 1B1BA 1FP2A 2R3SA 2XF6A 4BGDA 3S2HJ 1D3YA 4A69C 2CFOA 4PJLA 5D5WB 1WI3A 3FBNB 2CMPA 3TOBA 3TW7A 3HJEA 2PG4A 3S3NA 2X51A 2ETHA 2BZTA 5KAIC 2X6OA 3JRHA 3HOXJ 2I8DA 2N8GA 4Y17A 3IRRA 5ED4A 4UHTA 3R6SA 3I4MJ 4BHPA 3VSKA 3CJQB 3F8MA 1LE8B 4I2OA 5CJ9A 3H9QA 4ENJA 3GZ6A 3M8FA 4PSXA 4XN0A 1BM9A 1IV8A 4AVPA 1K6OA 1WJBA 1T8IA 4DBRA 2W48A 1MBKA 1D5VA 2XVCA 2DK5A 3HIFA 1R4MB 2H1LA 4U7BA 4I0BA 2H09A 2VI6A 3MFKA 3MN2A 2IP2A 4BDZA 4MTDA 2WADA 3HRUA 2NNNA 5GAHJ 2OQRA 1N75A 5HDNA 3KFWX 5HODA 4AM3A 3BQYA 4C2MJ 2ZFWA 4Y13A 4BE2A 3WHBA 2ZSIB 2M45A 3EPZA 3R0JA 2E7WA 3CP8A 4KISA 1Y1VJ 1JJ6C 5CVUA 3VDXA 4DOZA 5IP7J 3OIPA 3IWZA 5B1BH 4TV7A 1P4XA 1T0FA 2BV6A 1ETKA 1J5YA 2E1OA 3I9V2 4QIWN 5JVTA 3TW6A 2GOMA 4FQGA 4B1RA 5LHHA 5E3OA 2WY8Q 3I56I 3PQKA 4HX4A 5BPIA 1RKTA 4A3IJ 2HOAA 2LK2A 4BE1A 3G4SI 2R7WA 3ECOA 2WC2A 4CYCB 1VF9A 4BBRJ 3OYFA 1DU0A 3F8BA 3FM3A 2NS7A 2J5PA 3NWSA 4ZH4F 1KZHA 3A1YA 5B5EC 1P7IA 2XASA 5FFXA 4IXAA 1Z6RA 3REOA 3ONQA 4CGZA 1T56A 2BEOA 2V9VA 4IVNA 3E6MA 1Y0UA 2OCCH 4C3HJ 1OMIA 1B8IA 1JE8A 3HKZN 1U5TC 1BJAA 3DBHB 4IOAF 4UV8A 1UCRA 1TQPA 2IS2A 3K70C 2V79A 1X1CA 1DPUA 3OY9A 1FY7A 1WWXA 4XMYA 2DCEA 2EINH 4LLNA 4KMUX 3QWLA 1N25A 5CVIA 4IHYA 5FKMA 2H94A 3K4BA 4XQFA 1ETWA 2EB7A 3DKXA 1YW8A 2QF7A 4MO7A 1B72B 2ELKA 2HYGD 4GRIA 2ZXJA 2P0WA 4AC0A 5J40A 4DYCA 3JAMK 4UVBA 3ZQHA 1LNWA 1T39A 4L9VA 3CCUI 4MLOA 5FO5A 3SZTA 3KZYA 2OJED 3GVAA 2R5ZA 1FOXA 3K4LA 2NOGA 1MSFC 4L5JA 3F21A 3PFYA 3DPLC 4BQQA 4OINF 2KRCA 1E3OC 4KJZA 4CUGA 3QODA 4BDYA 1XGNA 4IL6C 1MJAA 2AS5F 4UVCA 1ZN2A 4ITVA 3WODF 1R23A 2Q1ZB 2VIXA 1S72I 4DYRA 5FD6A 4FETA 1AWCA 2FJ1A 4N4OB 1ZG3A 2O8XA 3I55I 3JTGA 4DZPA 2LY2A 2EZLA 1BL0A 4Y52J 1TBXA 3I59B 4XICA 1NTCA 4KDPA 4E7KA 2JN6A 1C0WA 2CUJA 2QUFA 3LSJA 4ZTFA 3H5RA 1IG7A 4BXUA 4BU2A 2ZJQF 4OWRB 1DGWY 3AG4H 3KZZA 3W2VA 4A3MJ 1HSJA 2QSHX 2Z16A 3LNQA 5HLTA 2H8RA 3DEWA 2V4JC 4ZDOA 2VXZA 2KP6A 1MJ9A 2DMQA 4BQNA 2BYVE 3JRFA 1B9MA 3K1MA 5ICGA 4RAYA 2FBHA 1W36C 2E34A 4OIQF 3JRBA 1O3SA 3ZQ7A 1H0MA 3KEYA 2CO5A 2EFNA 1T95A 3KE2A 2V9PA 2EK5A 1OYWA 2DU9A 3MWMA 2QSGX 3QP6A 5JR3A 5JLWA 1GT0C 1MMAA 4HX8A 2DFEA 3DBRB 2DOFA 5L3FA 1SAUA 3IL2A 1LDKB 1BI1A 1T38A 2ESNA 4XL9A 5EYRA 4LB6B 2VJ4A 2DK8A 1TQIA 1W0UA 3RZDJ 5LRSA 3PL8A 1BI3A 1AKHA 2K3PA 5FKKA 3QOPA 4G94A 2P6TA 4LG0A 3M4OJ 3OWTA 5EEAA 2OA4A 4AIKA 2Y0SA 2P5LC 2W00A 1D1CA 1QPIA 3OYBA 4L5EA 1HLVA 2KIQA 3ISPA 1BR4A 3DTEA 1K4TA 5EZGA 3TKYA 2NS8A 2OU2A 2WV1A 3LL7A 1HCRA 5D8KB 3AL0C 5F6FA 5FKLA 3CDHA 4MNUA 5LBQA 5LHIA 2HGCA 2XIGA 1YE9A 1TL8A 2ISZA 3CQZJ 2RGVA
chains in the Genus database with same CATH topology
1D0ZA 2CW8A 1DGRM 3KYLA 1V5EA 4BJ5C 3SEQA 3OS2A 2XC7A 3SEZA 3S93A 1WJCA 3MD2A 4AVZA 2KPMA 3RTRA 3OYEA 2W1OA 4C2TA 4QPQA 2E5ZA 2OC6A 3OYKA 3V42A 1G8XA 4NC7A 4AYBA 2LG4A 3LSHA 1NG7A 4B48A 3BC8A 4HSRA 2DT7B 3LMMA 4B3XA 3RCOA 1J09A 4H4KC 1BR1A 3ZGKA 1X19A 2LYCA 4HRIA 4XLCA 4CCKA 1N78A 4P1WA 3MKZA 4XM3A 2HQAA 3QYEA 5FROA 4F91B 2HVQA 5KCMA 1D1BA 4II3A 3HG9A 2M4GA 3ZQQA 2CV1A 2BOLA 2VKDA 3OL4A 4XLEA 4D1QA 3OYAA 2V26A 3BG7A 3VSLA 1E0EA 4E6KG 4E7JA 3D5LA 3BCBA 3KX2A 1LVKA 2JVHA 4NNJA 1N77A 3DKYA 2IGNA 3ZCOA 4XKWA 4NQWB 4DGWB 1UELB 4BS9A 2F4IA 2HVSA 2JSPA 1AA7A 4YELA 1LKXA 2VQCA 3CZ6A 4HPQA 4IKFA 2XAUA 4ZJZA 3PNVA 3PSIA 2WAQA 1MNDA 2QKMB 4FASD 4R79A 2W82A 2M7BA 4CCOA 2VQHA 1Z7LA 4E7ZA 4ZDPA 3OYNA 2Q2EB 3DU6A 1WJFA 2F5VA 4HNUA 5JHFA 4DIQA 3SZGA 1JI8A 1QHHD 3OOUA 3HC7A 3K4MA 2R7UA 1Y6IA 1MMNA 3K4JA 2ZXIA 4KT6A 3H9GA 4PFOA 3QYBA 2MFZA 3E0JB 4RM3A 3C2HA 3RSNA 4E7IA 3OYLA 2R7VA 1D0YA 2UV1A 4LIVA 4CCJA 3OL3A 4BXFA 2VXDA 3L2UA 1X1AA 4E7HA 4B47A 4RMNA 4BJTA 3OYGA 2XF5A 3HOSA 2LY1A 1MNEA 4HG2A 2KQRA 2X1CA 4BEHA 3PSFA 1R6RA 2OV7A 2X85A 2FUG2 3EUAA 3AKZA 3IP4B 1MMGA 4IQ4A 3K6GA 2R7RA 3H0DA 3OIQA 1HA8A 1VZ0A 1D0XA 2R7TA 3GBGA 3K70D 3F9KA 2R7XA 3TBIA 4ANJA 3PNTA 2VQLA 3HXLA 4CCNA 5CQGA 4X0GA 4II2A 4BUPA 2L9SA 2HU9A 2WA0A 2V7FA 3L2VA 3K4NA 2LRDA 1S9HA 2KHMA 4XLAA 1WJAA 3E1SA 4D9JA 1WFXA 4Y4RA 2HPIA 2XDVA 1Z3YA 5LD2C 1OLTA 2X6WA 2VJ5A 3DPTA 4PJNA 4B44A 2LOOA 4ZDLA 2KZVA 4DJAA 4PJJA 3IAM2 1UG0A 4HEA2 4PJMA 4F3QA 3PUBA 2IGKA 2KLOA 2KL4A 1X1BA 3H9JA 4BJ6C 4IZZA 3VWBA 4NUBA 2E5NA 4XKBA 2WAFA 3CMMA 2HDWA 3DPUA 4RLFA 2IS6A 2BW3A 2CUZA 2HPMA 1WJ5A 5FRMA 2RREA 4BEHB 1UAAA 4HNTA 4CSWA 5KNLA 1BOBA 2MYSA 2A6TA 2JA2A 2V1NA 4XORA 3D5SC 3VYSB 3L2RA 1Z3XA 3DQVC 3LFUA 4CZCA 5HNFA 2CV0A 4J01A 1WJEA 4XN3A 2X1DA 4P5OA 4BACA 1NG6A 4F55A 2CV2A 3A2KA 2M4KA 3UNGC 2VB6A 3K4CA 4AU7A 3S8PA 4ZYAA 2W7NA 3MKWB 4EATA 3K10A 2VL8A 1QU3A 4XLHA 4YRVA 1FMVA 2XF6A 4BGDA 2M7AA 2WAEA 1FMWA 2CFOA 4PJLA 3FBNB 2CMPA 3MKYB 3G2BA 2M3AA 3S3NA 2X1EA 4CCLA 2X51A 4PFPA 4XR6A 1W36D 2I8DA 3IUOA 4LG3A 3L2WA 3SYTA 2UWMA 2PJRA 3CJRB 2LC2A 3SDBA 1K6YA 2VJIA 5TGTA 3VSKA 3OYJA 2MABA 3CJQB 2R4GA 2JUGA 5CPRB 3H9QA 4PSXA 4XN0A 3W2WA 5HNHA 1P9QC 2DXIA 2XSJC 2BVMA 4JQFA 5CKTA 1WJBA 4QPOA 2BVLA 4DBRA 1DQUA 2CH0A 4U7BA 2HVRA 1X4PA 3S32A 3U21A 4BDZA 2WADA 2F6CA 3VYTB 4N4NB 2CS3A 3FHNA 5FRNA 1N75A 1YX5A 3OMYA 3EUHC 4BE2A 2MD0A 2QKLB 3FDYA 2ZSIB 3VYRB 3EPZA 3CP8A 4KISA 3VDXA 4DOZA 3OIPA 1BR2A 3HPHA 2PMZA 3I3LA 3I9V2 2GOMA 4E7LA 2VPLA 1EA3A 2LH9A 2WY8Q 2E1MC 3IAS2 3OR2C 4LIUA 3DU5A 4BE1A 2R7WA 3J7AY 3HKZA 2PJRB 3DTKA 4RLQA 4YEJA 4XOPA 2K5CA 4XOTA 3OYFA 5KHDA 4OAZA 1KONA 3ZRGA 3NWSA 4PK4A 4E7SA 2ELJA 3EUKL 2IGOA 3VYUB 3H35A 2KDOA 2WB1A 3A1YA 2ZSHB 2V6EA 2R7SA 3TMOA 3ONQA 4BL0B 1X4OA 3QOEA 4F93B 3C2GA 3D5RC 2HNHA 2XF7A 1IRXA 2KMUA 2E1MB 3H5AA 2VJJA 4E4HA 4CH7A 1PYVA 2IS2A 3K70C 2X6YA 1X1CA 4J00A 4C9YA 4LITA 3OY9A 3L2QA 4PSWA 5LFAA 4HSTA 2X6XA 3OS0A 4XMYA 2IXSA 2DCEA 5HOOA 3HOTA 2LBFA 2Z2SB 3BG6A 3K4BA 4XQFA 3OYDA 3DKXA 3TL4X 2VLAA 4GRIA 4XONA 2P0WA 1WJDA 2ZFUA 4XNFA 3LSGA 1YX3A 2DOAA 3DWLE 2VKHA 2K9LA 3H5NA 4C30A 3OYHA 3AL0B 3K4KA 4MLOA 3FKJA 3K4LA 4BE0A 4ZC3A 4KITB 3PFYA 3DPLC 4BQQA 4CA0A 4PUSA 1SFKA 2KRCA 4KJZA 4CUGA 3QODA 4BDYA 4NC8A 2ZXHA 4Y3OA 1MMDA 3HL2A 4ITVA 4C2UA 2Q1ZB 4U87A 2VIXA 2CW7A 4FETA 1G59A 4N4OB 4G6TB 4IX7A 3LSIA 2WBMA 4F52A 3OYMA 3OYIA 2AQEA 2LY2A 3W3CA 4E7KA 2CUJA 2KRHA 2BW3B 3OR1C 3LSKA 2L7KA 4Y33A 4JOMA 3CESA 3H5RA 4ZTFA 4IQJA 2LBFB 3DEEA 4BU2A 1D1AA 4OWRB 1DGWY 4OAYA 3HUGB 2RQQA 4XKCA 4DBQA 3W2VA 2VASA 2Z16A 2R7OA 2JVGA 5HLTA 2V4JC 4ZDOA 1OR7C 2L2OA 2W4SA 2VXZA 1ZELA 2KP6A 5CQEA 3OS1A 1TT0A 4BQNA 2RNGA 3A4CA 3RPUD 1ERDA 3CF2A 3DLAA 2L9NA 3MMYB 1U0JA 1W36C 2IGMA 2VQGA 1DP3A 4F92B 3PJRA 2AQFA 3KEYA 3QYFA 1T95A 1V5FA 3ZXSA 4RM2A 1LFPA 4BQOA 1V5GA 3ZR8X 3UR3C 3CP2A 1MMAA 1X1DA 3RQ4A 3BCAA 4XKVA 3AFHA 1SAUA 2M0MA 1LDKB 2OUMA 4XL9A 1QHGA 2LREA 3S3MA 2MC4A 2IS4A 2VJ4A 3N05A 1PJRA 3OYCA 2GOXB 3PL8A 2K3PA 3W2AA 4B43A 2E60A 2L5QA 3M8JA 3OWTA 2HZDA 2Y0SA 3FBIB 2W00A 4ZTJA 1D1CA 3OYBA 2Z1DA 3NWTA 3BLYA 4XLFA 5HVQC 3S3OA 2R7QA 1Z21A 2IS1A 1BR4A 2DT6A 1T0FC 3DTEA 2UUZA 4CCMA 1Y56A 2K9MA 3LL7A 3LSMA 1TZLA 2DJIA 2A5WA 3PNYA 1GLNA 3AL0C 2NOJB 2V9KA 2WY7Q 3DTIA 1MW7A 3M1CA 1YE9A 3HPGA 2O5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NG7 A; 
#chains in the Genus database with same CATH topology
 4NQW A;  4U0Y A;  2K86 A;  3GYH X;  2XGC A;  2A6H F;  4KUM A;  2L0K A;  4JX4 A;  3SEQ A;  1S7O A;  3SEZ A;  3CO6 C;  2CG4 A;  4W1U A;  2ZXW H;  4C2T A;  4QPQ A;  4U7D A;  1WCM J;  1P6R A;  3LQQ A;  3ERE D;  2PJP A;  3U1K A;  4HSR A;  2LY9 A;  3LMM A;  3RCO A;  1FBS A;  3ZGK A;  1X19 A;  1FTT A;  1KU2 A;  4L9N A;  2GIV A;  1U8R A;  4P1W A;  1ZLJ A;  2JSC A;  3P5J A;  2HQA A;  4EGZ A;  2HVQ A;  1ZR4 A;  4CXF A;  2LTP A;  2M4G A;  5TIS C;  4A3B J;  2P6S A;  1SVO A;  2R5Y A;  1Z77 A;  2BOL A;  2VKD A;  3X2Q H;  2HOS A;  2GXB A;  4E70 A;  3ZPL A;  2CUF A;  5L3E A;  2JRT A;  4IF4 A;  2O3F A;  3I64 A;  4PDK A;  2FNA A;  3FIS A;  3KX2 A;  2C6Y A;  2JVH A;  5J8F A;  1WHU A;  3DKY A;  2IGN A;  3FMQ A;  2HOT A;  2DPD A;  2A05 A;  2A69 F;  4V2G A;  3GTJ J;  2O0Y A;  2FQ4 A;  1W7P A;  4KYW A;  2M1B A;  2VT3 A;  1RI7 A;  2HFH A;  1B9N A;  1ONV A;  2LKP A;  1G2H A;  1P2F A;  5F1J A;  3E97 A;  3K0L A;  2B0L A;  3P9I A;  3O6B B;  2H1K A;  3H0G J;  2L9V A;  3GEZ A;  3J81 K;  4BAY A;  4N9I A;  4OMY A;  4BBS J;  1WI9 A;  1HQC A;  2A68 F;  2F5V A;  4HNU A;  3JSO A;  2AXL A;  2OD5 A;  1R9T J;  3GZN B;  3JAM Z;  3SZG A;  1VFC A;  2PBI A;  2QYO A;  3HC7 A;  4M74 A;  3TO7 A;  2IBD A;  1O3R A;  3DV8 A;  3CDI A;  2MFZ A;  5EEH A;  3C2H A;  2UV1 A;  1V4R A;  2K7L A;  4ESF A;  1R5H A;  3OL3 A;  4XSX F;  2HXO A;  4I0A A;  1IUF A;  3L2U A;  2HKO A;  3D0S A;  2FSW A;  3WTT C;  4C3J J;  3EDP A;  3HOS A;  5AIQ A;  2EQR A;  2JWT A;  2KQR A;  3BRO A;  4EJW A;  2IPQ X;  1YJ9 I;  2FUG 2;  5A2Q K;  3F8C A;  2PQ8 A;  2H8W A;  5HS9 A;  3N4M A;  2CUE A;  1HA8 A;  3F23 A;  1D0X A;  3GBG A;  3TBI A;  3HXL A;  3GFM A;  3ZMT A;  3TGN A;  3LAJ A;  2GA1 A;  4LLL A;  2GZW A;  1YIJ I;  5DM6 F;  5E3L A;  1FYK A;  1YRN B;  2NVQ J;  5C4X J;  4LB5 A;  2LMD A;  3K2A A;  1S29 A;  1IXS B;  3E1S A;  2B9S A;  3F6V A;  3G1M A;  2ME6 A;  1T98 A;  3O8H A;  4D5C A;  5E18 F;  4KFC A;  1OCZ H;  2XDV A;  3M8E A;  1XMX A;  2XV4 S;  2X6W A;  1ZKG A;  2EIJ H;  4ZDL A;  1XDS A;  4RGU A;  3IAM 2;  2EA2 A;  1IGN A;  2LSO A;  1FWZ A;  2PI0 A;  3PUB A;  1Z05 A;  4LMY A;  2ID6 A;  3BR0 A;  3VWB A;  4NUB A;  2E5N A;  1Y0N A;  3CMM A;  2IS6 A;  1FJL A;  2BW3 A;  4V2F A;  2DFH A;  1S5L C;  3CCL I;  1LE8 A;  2Y30 A;  2LFB A;  1R71 A;  5F08 A;  1JUP A;  2F4O B;  1FLI A;  3L2R A;  4J01 A;  1FZP B;  3A0B C;  1WJE A;  3CTA A;  5H6Q A;  1RNL A;  4XN3 A;  4P9U A;  3CD6 I;  2ZME B;  3HBL A;  1SD7 A;  1IC8 A;  3S2D J;  1JKQ C;  1ON2 A;  3R60 A;  2MW8 A;  3DEU A;  4L0Z B;  2XAH A;  3K4C A;  4AU7 A;  1FEX A;  3S8P A;  3CO7 C;  4QTR A;  2PFB A;  1PUF B;  2Y31 A;  4UB8 C;  1MBG A;  5J1Y A;  5JHU A;  1IF1 A;  2VL8 A;  1IO2 A;  3MZY A;  1FMV A;  3OOP A;  2NVX J;  2O8K A;  4LGW A;  1VND A;  1TP4 A;  2YSR A;  3OSG A;  1IUY A;  3G2B A;  1ZAO A;  2XAQ A;  1Q1V A;  4PFP A;  4XR6 A;  1FBQ A;  1TQM A;  2K27 A;  4A12 A;  2UWM A;  3CUQ C;  2LC2 A;  2FF4 A;  3BOQ A;  1ZRD A;  4WX9 A;  1BN5 A;  1UHM A;  2KRF A;  5TJJ A;  2ZJR F;  2VJI A;  3OYJ A;  2FD5 A;  1GVJ A;  5AON A;  2J5O A;  1U8B A;  3QPS A;  3Q0W A;  3S16 J;  2ZBK A;  1BA5 A;  3HTS B;  2MLG A;  3ASN H;  1SC7 A;  2XAG A;  3KLN A;  3F8F A;  4IRG A;  2BVL A;  1JUS A;  1DQU A;  2CH0 A;  2ZNY A;  1UFM A;  4AIJ A;  2HVR A;  2NVT J;  3LA2 A;  1HW1 A;  5ICC A;  1ACI A;  2BHZ A;  5C4J J;  4U0V A;  2F6C A;  2X0L A;  5D8L B;  3BR5 A;  3V8L A;  2DMN A;  2CS3 A;  3FHN A;  3OMY A;  3ZMD A;  9ANT A;  2MD0 A;  3BG5 A;  3EQL F;  1HDD C;  1VQO I;  4XK4 A;  3KIO A;  3FM5 A;  1J7K A;  3PM1 A;  4B4C A;  1YFH A;  3CC4 I;  1BR2 A;  3HPH A;  5EDN A;  1B72 A;  1W5C C;  1FBU A;  3I3L A;  3LST A;  3MZH A;  4R8H A;  3TP3 A;  4WXD A;  3GW2 A;  1OCC H;  2VPL A;  1T08 B;  1O57 A;  3BTI A;  2QA4 I;  3HEF A;  1LDJ A;  4I99 C;  4WXC A;  1I1S A;  1NHA A;  1J2X A;  1PVE A;  4HA8 A;  2P8T A;  2L7M P;  2BXY A;  4RAZ A;  4XOP A;  3ZP5 A;  2K5C A;  4XOT A;  3OIO A;  5KHD A;  4GDF A;  1OFC X;  4MQV A;  2HS5 A;  1U2W A;  1H89 C;  2ELJ A;  5K7Z A;  2IGO A;  2LNB A;  2PMZ N;  3H35 A;  1R5G A;  3VYU B;  3ZMU A;  1HKT A;  3COA C;  2R7S A;  1YW7 A;  2VOD A;  4BL0 B;  3KYC B;  1X4O A;  4L9T A;  3ROU A;  2OPT A;  2ECB A;  2P7V B;  2HNH A;  4G7O F;  3DLL F;  3ZMZ A;  3H5A A;  2E1M B;  2VJJ A;  2ZC2 A;  3HHG A;  4CH7 A;  1PYV A;  2X6Y A;  1YQA A;  4G8X A;  2FOK A;  1Z9C A;  2VBX A;  3G3Z A;  3SFI A;  4C9Y A;  4XRM A;  4CZZ A;  1ZRC A;  3I59 A;  4LIT A;  3L2Q A;  5LFA A;  4HST A;  3AG1 H;  4CO8 A;  5JLX A;  3G71 I;  4NDL A;  2CJJ A;  2IXS A;  5M5X J;  4OIP F;  2W25 A;  4MGR A;  2R7Z J;  2Z2S B;  1QZZ A;  1DUX C;  2LD5 A;  1OJL A;  2XGX A;  3OYD A;  1RR7 A;  2VLA A;  4A3G J;  3E5X A;  1VQ5 I;  3GFJ A;  4S04 A;  3B02 A;  3ZMV A;  3IV5 A;  3HOV J;  4XON A;  3EET A;  1WJD A;  4UUT A;  4XNF A;  2FBK A;  5H2F C;  5DUI A;  2DTZ A;  1YX3 A;  4C30 A;  3D1N I;  5J8C A;  2HTS A;  4QWQ A;  3BT9 A;  4UV9 A;  1ON1 A;  4C3I J;  2V6C A;  5A2Q Z;  2R92 J;  2HTJ A;  1D5Y A;  3A03 A;  3FKJ A;  4BE0 A;  4ZC3 A;  1Z91 A;  1ZAR A;  4ZYG A;  1A35 A;  2K4J A;  3JRA A;  4PUS A;  1YJW I;  5IT9 K;  2KT0 A;  4LK0 F;  5JFR A;  2E2I J;  5H6R A;  5ICE A;  4NC8 A;  3RQI A;  3F22 A;  1OR7 A;  1ZYR F;  1TNS A;  2OZ6 A;  3Q0V A;  3RZO J;  1I6H J;  5M3F J;  3V7S A;  2TRT A;  2NXN B;  3KP2 A;  2DQL A;  5KK1 A;  3IH2 A;  4EM0 B;  2AXT C;  2KIU A;  2LDU A;  2AQE A;  3NAR A;  2KJC A;  3KP6 A;  2D45 A;  5FKN A;  2KRH A;  2BW3 B;  1SFU A;  3OR1 C;  2E71 A;  2L7K A;  1OCT C;  4GYG A;  4HYE A;  4JOM A;  4Y33 A;  2RKH A;  3GXO A;  5C44 J;  1XCV A;  5BPD A;  3CC7 I;  3HUG B;  2ECC A;  2RQQ A;  4DBQ A;  1JKO C;  2JA7 J;  2VAS A;  1H88 C;  5LGT A;  5DD8 A;  4HOB A;  4BYY A;  1OR7 C;  2F5D A;  2LF8 A;  4G12 A;  2IW5 A;  2DBB A;  1KGS A;  4AIH A;  5FJ8 J;  2TCT A;  5M3M J;  3A4C A;  3RJP A;  3PUF A;  4HDU A;  1OYI A;  3RPU D;  2CQQ A;  1ERD A;  3AG3 H;  1MBF A;  4UB6 C;  2DN0 A;  5F0F A;  1I6X A;  2KZG A;  4D0P A;  5J6X A;  1EH6 A;  2QWW A;  4F92 B;  3BP8 A;  4IHT A;  1A04 A;  1BI2 A;  1ZRE A;  3ZXS A;  1R1U A;  2EIL H;  3VOE A;  5D6E A;  1Y1W J;  2HDC A;  3UR3 C;  3V7R A;  2X4H A;  1R49 A;  3CP2 A;  5F1R A;  1RKW A;  2CWE A;  4D7N A;  3BCA A;  4YIR X;  2MH2 A;  3KZI C;  2M0M A;  4XRF A;  3BTC A;  1V54 H;  2D1V A;  2DFF A;  1RR8 C;  1F5T A;  2QBY B;  1USS A;  1ZH5 A;  5C3E J;  1PJR A;  3ABM H;  2HZT A;  1GXQ A;  3Q9V A;  4A3K J;  2GOX B;  2P5K A;  1L0O C;  4G9Y A;  3DFG A;  5IYD J;  1YLF A;  1K79 A;  3RYR A;  3Q5F A;  5EJC A;  1G3W A;  2OZU A;  1IRZ A;  5D4S A;  4PCQ A;  2QGU A;  4XLF A;  1T0F C;  2FEZ A;  4EJO A;  2UUZ A;  1AOY A;  3E5U A;  2DA1 A;  4O3M A;  2XGD A;  2DW4 A;  1PP8 F;  1MZB A;  4DQ2 A;  1TZL A;  1GXP A;  2A5W A;  2BBY A;  3ABT A;  3PNY A;  4GCV A;  2F4M B;  3CUO A;  2V9K A;  3LA3 A;  2DT5 A;  3BR2 A;  2FML A;  1JTY A;  4XSZ F;  1QNT A;  2MA3 A;  5FLV A;  3M1C A;  4ABZ A;  4K2E A;  2XF7 A;  1XSV A;  2K40 A;  5EF6 A;  3T8T A;  1SAX A;  3KEQ A;  2CW8 A;  1DGR M;  3KYL A;  2TDX A;  4KNY A;  2RVC A;  1GHC A;  4Z6Y A;  3CCQ I;  2EZH A;  3S93 A;  1JKR C;  1WJC A;  5K7H A;  1DP7 P;  3IWF A;  3QU6 A;  3RTR A;  2W1O A;  3KP7 A;  2E5Z A;  3OYK A;  2HYF A;  1J59 A;  1MBH A;  4NC7 A;  5FB2 A;  2A07 F;  2A3S A;  2DT7 B;  2KIM A;  4AID A;  1BI0 A;  2XGE A;  1YYV A;  5DD4 A;  1JT0 A;  2AO9 A;  3MKZ A;  3DCF A;  2ME0 A;  3QYE A;  1H9G A;  4N9H A;  4F91 B;  3CF5 F;  5KCM A;  1I27 A;  3BR1 A;  1D1B A;  3SXY A;  3ZQQ A;  1FIP A;  2P4W A;  2CV1 A;  4D7M A;  2RNJ A;  1MDM B;  1QVT A;  3OL4 A;  4HAM A;  4AYB N;  3OYA A;  1D8K A;  1E0E A;  3JRG A;  3HTU A;  5B3S H;  6PAX A;  3D5L A;  5LEK A;  3BCB A;  3KP4 A;  1LVK A;  3I58 A;  4GXO A;  4A3F J;  5DS9 A;  5TRD A;  1KU9 A;  1YJN I;  4UY8 I;  2NYX A;  4NNJ A;  5CLS A;  1QA6 A;  1XG1 A;  2I10 A;  3U9G A;  3BR6 A;  2HVS A;  2HYJ A;  2V1D A;  5J47 A;  3K2Z A;  1E2X A;  3BTJ A;  3U1D A;  4YEL A;  1LKX A;  2JA8 J;  1I1G A;  4HPQ A;  3V8J A;  4OIO F;  2NVY J;  3PNV A;  3ELK A;  2CYY A;  3KET A;  1MND A;  2WAQ A;  2QKM B;  4FAS D;  4R79 A;  4BY1 J;  3SQN A;  3DP7 A;  1O7F A;  5IY5 H;  2E1N A;  1G3T A;  2VQH A;  4CCO A;  3C1D A;  4E7Z A;  4HV5 A;  3CJN A;  1BW5 A;  1YRN A;  3O8G A;  1WJF A;  1FYL A;  1B59 A;  2DO7 A;  1HOM A;  1SD4 A;  3W6V A;  2ZCW A;  3JCU C;  3OOU A;  2FOW A;  2R7U A;  2FNP A;  3BZK A;  3G1L A;  3K4J A;  3HOZ J;  2ZXI A;  3H9G A;  5L3D A;  2LP0 A;  2ZJ2 A;  1CGP A;  2HQ5 A;  3OYL A;  1D0Y A;  4BH9 A;  2A61 A;  5IT9 Z;  3BY6 A;  1WGX A;  2JA6 J;  4RMN A;  5LHG A;  4BJT A;  3VPR A;  4ENK A;  4RDU A;  1L3L A;  2XF5 A;  4HG2 A;  2X1C A;  2FBI A;  1R6R A;  3AKZ A;  3EUA A;  1WH5 A;  4ESJ A;  4ENM A;  5F04 A;  3B6C A;  4MFD A;  4A3L J;  2K9S A;  4N0B A;  3K6G A;  2R7R A;  2FMY A;  3LAP A;  4UUS A;  1BW6 A;  1VZ0 A;  3QPH A;  1A5J A;  2R7T A;  3K70 D;  3CCR I;  4BXX J;  4ANJ A;  3L1P A;  3PNT A;  3F0C A;  2RDP A;  4II2 A;  1QVU A;  1UZC A;  2ZME A;  2M0C A;  3PIO F;  1SVL A;  3HSE A;  1POG A;  2ID3 A;  1TW2 A;  3WG9 A;  2HU9 A;  1U3E M;  4V19 K;  3ZQG A;  1EV7 A;  2V7F A;  4YIF A;  3CC2 I;  2JMW A;  2LRD A;  1ORK A;  2PN6 A;  1PUF A;  5EGO B;  1IDY A;  2EWN A;  2JTV A;  2XSD C;  4WWC A;  3ABL H;  1S6L A;  3E6B A;  3ZMS A;  4G7H F;  5LD2 C;  4M73 A;  2VJ5 A;  1TLH B;  4A3J J;  2KZV A;  4R1H A;  5BQT A;  4JYK A;  4DJA A;  4HV6 A;  4HEA 2;  2CQN A;  4PJM A;  5D4R A;  2WWY A;  2OCE A;  2KL4 A;  1SVM A;  1X1B A;  4BJ6 C;  3BPV A;  1ETY A;  1TW3 A;  2XAF A;  4IZZ A;  2UXN A;  2ZME C;  2ICW G;  4RLF A;  1E17 A;  3CJT B;  2V1U A;  1SMT A;  3R4K A;  1VQ8 I;  1BOB A;  2MYS A;  2A6T A;  3QPT A;  3WTZ A;  1NK2 P;  3I54 A;  2JA2 A;  4XOR A;  3D5S C;  1FP1 D;  1U5T B;  1SD5 A;  4HW0 A;  4EM1 A;  2HDD A;  1Z3X A;  5HNF A;  1MKM A;  2CV0 A;  2Y9Z A;  2HKX A;  1T33 A;  2V1X A;  2Y2Z A;  3QAH A;  4BAC A;  2XRO A;  1NG6 A;  1TTY A;  1TWG J;  3RYP A;  3GFL A;  2P5V A;  3C18 A;  4YFX F;  4S05 A;  1FOW A;  1VI0 A;  1P92 A;  1XC5 A;  2GA2 A;  4M9Z A;  4EAT A;  4LLG F;  3K10 A;  1P4W A;  1NH3 A;  1UHS A;  3K7A J;  2W57 A;  3CME I;  1QGP A;  3S14 J;  1S8N A;  3K9T A;  1FMW A;  4FE7 A;  1I50 J;  1A36 A;  3IHU A;  3W6K B;  2X1E A;  4Q4Z F;  5DTD A;  4CCL A;  4XRS G;  1MBE A;  1BOA A;  2DA6 A;  3BTL A;  2X9D A;  3B73 A;  4A0Z A;  1W36 D;  4LG3 A;  1FOK A;  3RKW A;  4ZYD A;  2JK3 A;  2L7F P;  1TNT A;  3CJR B;  5F27 A;  2FRH A;  3SDB A;  1K6Y A;  3EUH A;  1WKM A;  5TGT A;  2G9W A;  1U6G A;  4X1E A;  1I5Z A;  4DNC A;  2ACJ A;  4OIR F;  1VQL I;  3BWG A;  2VKE A;  3W2W A;  4HQE A;  1IW7 F;  2EV0 A;  5HNH A;  4LFU A;  2L3D A;  2XSJ C;  1FYM A;  2BVM A;  5CKT A;  4QPO A;  4M3B A;  3BG9 A;  4WF2 A;  4GYI A;  3WGI A;  4HF0 A;  2VPR A;  2HOE A;  1FTZ A;  1X4P A;  3S32 A;  2OTJ I;  3CCM I;  3VOD A;  1F1Z A;  3PIP F;  4PJ0 C;  4L5I A;  4N4N B;  5CVV A;  3H1C A;  3ZQF A;  5FRN A;  2R93 J;  4G6Q A;  3EUH C;  1ETQ A;  2QKL B;  3FDY A;  4YG2 F;  3VYR B;  1W4M A;  4A0X A;  1S7E A;  4BHC A;  4FCY A;  3HGG A;  1R36 A;  3ABK H;  1WVR A;  1J0R A;  3KYD B;  3SFZ A;  1Y39 A;  1EA3 A;  2LH9 A;  2OAZ A;  5GPC A;  2E1M C;  3IAS 2;  3KEO A;  3J7A Y;  3FXM A;  2M5W A;  3HKZ A;  2PJR B;  2DDB A;  3DTK A;  4I98 B;  2VON A;  2ISY A;  4RLQ A;  4NBQ A;  5DCF A;  5D6F A;  3WG7 H;  3HOY J;  1KON A;  3ZQL A;  3ZRG A;  2KDO A;  2WB1 A;  1WZ2 A;  2G7H A;  3TMO A;  1KU7 A;  4F93 B;  3BJO A;  2DFI A;  3L00 A;  2XKO A;  5DUK A;  1ZHF A;  3C2G A;  4B3A A;  1HW5 A;  3Q0U A;  1IRX A;  2PX9 A;  1JHF A;  1VQN I;  3SZP A;  4E4H A;  3ECH A;  4EM2 A;  2XPU A;  1O4X A;  2R7F A;  4Y7N J;  1R58 A;  2X6X A;  4U88 A;  3WTX C;  4BY7 J;  5HOO A;  1BIA A;  3GME A;  3TP0 A;  1FOY A;  1MGT A;  4A2U A;  3HUG A;  5B66 C;  5E3N A;  4UUS B;  2Y9Y A;  1VQP I;  3I53 A;  1GV5 A;  1BIB A;  2K9L A;  3MQ0 A;  2GLO A;  3GZ5 A;  3AL0 B;  2QSF X;  1XN7 A;  3K4K A;  2KDZ A;  2VOO A;  3DBL B;  3LQR A;  5E17 F;  1SFE A;  2NAZ A;  1IDZ A;  2NS0 A;  3HYI A;  3H92 A;  5E1W A;  2NNY A;  4IOC F;  1LJ9 A;  3BG3 A;  3QQA A;  3F6O A;  5M5W J;  1HW2 A;  2LR8 A;  1JT6 A;  3VFZ A;  3F3X A;  1SAN A;  2X48 A;  2DYS H;  4HQM A;  3ML6 A;  1XD7 A;  1MMD A;  1ZGW A;  3HL2 A;  4C2U A;  2XRL A;  3V4G A;  5LRR A;  3ZQI A;  3LA7 A;  5D5U B;  5EG0 B;  4KN7 X;  5J4V A;  5L3C A;  4F52 A;  2E7X A;  2H27 A;  1Z0X A;  3H3U A;  3PQJ A;  3W3C A;  2QBY A;  1LB2 A;  4IPA A;  4KIB A;  5F64 A;  4RGR A;  4CYD A;  3LSK A;  2OTL I;  1DDN A;  2VBY A;  3JRI A;  3HM5 A;  2LBF B;  1R7J A;  3DEE A;  1D1A A;  3CCV I;  4OAY A;  1P4A A;  3IC7 A;  3P9C A;  2R7O A;  2EIK H;  2JVG A;  2KIS A;  1ZEL A;  4RS8 A;  2G0E A;  2VE9 A;  2YU9 J;  3OS1 A;  2K9Q A;  4IJA A;  4XRS A;  2NRA C;  2MH9 A;  2RNG A;  3V7C A;  3MKL A;  3FXL A;  2HI3 A;  3RPU A;  1YIO A;  3AG2 H;  3CF2 A;  1EF4 A;  5D5X B;  1U0J A;  1UHW A;  2DA7 A;  3WTW C;  1DP3 A;  2YS9 A;  3QYF A;  1V5F A;  3FIW A;  5HS8 A;  1LFP A;  4BQO A;  4LK1 F;  1V5G A;  3ZR8 X;  2XHK A;  3JRD A;  3S1Q J;  2CFX A;  2JPC A;  5HLH A;  3P9K A;  2RAE A;  1X1D A;  1XX5 A;  2D2W A;  2L9R A;  4RAF A;  4XKV A;  3AFH A;  5ERI A;  1ZG1 A;  2OUM A;  5DDG A;  2K9N A;  2WV0 A;  2DA3 A;  4I76 A;  4KT5 C;  4WXH A;  1I39 A;  3KCC A;  2MC4 A;  2IS4 A;  1X3U A;  4L9J A;  2YPR A;  3OYC A;  1KQ9 A;  3OSF A;  2HR3 A;  2CQX A;  3HZJ A;  4A3D J;  3I0T A;  5J4Y A;  1IN6 A;  4JP0 A;  2O7O A;  4GGG A;  3W2A A;  1LFB A;  2L5Q A;  2LVS A;  3GF2 A;  2HZD A;  4XID A;  1IJW C;  2GM4 A;  3FBI B;  2COM A;  2QQA A;  3I4N J;  1J9I A;  2QEX I;  1O7L A;  3S3O A;  3BLY A;  5HVQ C;  3I5U A;  2R7Q A;  1P7J A;  3ZQC A;  1MDM A;  2DT6 A;  1YO5 C;  4ETS A;  3J81 Z;  4CCM A;  1TWC J;  3B6A A;  2K9M A;  3LSM A;  2PMH A;  2QQ8 A;  5J1U A;  4Y15 A;  1PUE E;  1U9O A;  3ASO H;  4FT8 A;  1GLN A;  2EJR A;  5FLM J;  2NOJ B;  5GAG J;  2DMU A;  2Y0S N;  2WY7 Q;  5D5V B;  1MW7 A;  1G3Y A;  4HDV A;  1W5S A;  3FX3 A;  1T2K A;  1CF7 B;  2F5F A;  1D8J A;  5JVG F;  2CU7 A;  4M9S A;  1D0Z A;  3GTQ J;  1V5E A;  4BJ5 C;  3OS2 A;  4YII A;  3MD2 A;  2RC4 A;  2YX4 A;  1XTA A;  4KIG A;  1TWF J;  3OYE A;  1YIT I;  5FGM A;  5GP9 A;  5IYC J;  3EYY A;  1GDT A;  4A0Y A;  2HQR A;  1BC8 C;  3V42 A;  3K1P A;  1OKR A;  2D1H A;  2F5C A;  2XKP A;  3RPQ A;  3ABU A;  2LG4 A;  3LSH A;  1NG7 A;  3NEU A;  4O6J A;  3BC8 A;  1FPQ A;  3VEP A;  4B48 A;  4B3X A;  5GTH C;  1J09 A;  4M6Y A;  3TDZ C;  1BR1 A;  4L0Y B;  1XGO A;  2HXI A;  4W97 A;  1XDU A;  4HRI A;  4XLC A;  4CCK A;  1QRY A;  1N78 A;  1Z67 A;  5AIP A;  4XM3 A;  1W5T A;  5FRO A;  3UKG A;  4OOI A;  3L2C A;  5B1A H;  4II3 A;  1Y8Q B;  3HG9 A;  2A6E F;  4I01 A;  2P81 A;  3O3K A;  1QPM A;  1Z7U A;  3HRS A;  2V26 A;  3KLO A;  4IHS A;  3HRM A;  4B09 A;  1SD6 A;  2BY3 A;  3G6E I;  3C7J A;  3L7W A;  4ZZD A;  1N77 A;  1F4K A;  4BQA A;  4EV0 A;  2Z33 A;  3AAF A;  4BS9 A;  2BGC A;  4PGH A;  3HOU J;  2F4I A;  3G73 A;  4XBF A;  2Y75 A;  1AA7 A;  2DQR A;  1XGS A;  2YX7 A;  2XAU A;  4ZJZ A;  1RRJ A;  1LEB A;  3E5Q A;  3M9A A;  3WTY C;  1G6N A;  1K78 A;  4A3C J;  4ZDP A;  2Y48 A;  1HF0 A;  1AU7 A;  3OYN A;  3J7A O;  3IH3 A;  1X3Z B;  3LSR A;  1RIO H;  4M3D A;  2O03 A;  2Q2E B;  4Q48 A;  4ZZL A;  3DU6 A;  4ZYE A;  4PGG A;  2ZO4 A;  1GV2 A;  4DIQ A;  1W1W E;  5EGO A;  2XRN A;  2P7C B;  1JI8 A;  1OCP A;  1QHH D;  2GAU A;  3GLL A;  4MIM A;  3K4M A;  2FE3 A;  4EMS A;  2VUM J;  2VC1 A;  1LEA A;  3RDI A;  1MMN A;  4IRH A;  2GXA A;  2BY2 A;  2GWR A;  4PFO A;  3QYB A;  2VN2 A;  3F8N A;  4ENN A;  4BNC A;  4A3E J;  2XUB A;  1YG2 A;  3E0J B;  3RSN A;  4M72 A;  4HX7 A;  2R7V A;  5IOY A;  4AD9 A;  4RAG A;  2BXZ A;  4M9X A;  4EJU A;  5EZH A;  4CCJ A;  3CUQ B;  4GFB A;  1IN7 A;  5E79 C;  1IN8 A;  2VXD A;  2BY1 A;  5E20 A;  1X1A A;  3ZN1 A;  2K02 A;  1G3S A;  2QQB A;  3OYG A;  2EFW A;  4H0E A;  1MNE A;  3J80 K;  3PSF A;  4JX6 A;  3EYI A;  5CVR A;  4PZJ A;  3IP4 B;  1ETV A;  1MMG A;  2OBP A;  3DF8 A;  5JI6 A;  4MHG A;  2IT0 A;  1YW9 A;  3TQN A;  4A5N A;  4KIC A;  4YFN F;  1JKP C;  4I6Z A;  1S7A A;  4O5V A;  4M3E A;  5LGN A;  4IHX A;  1U5T A;  1VQ4 I;  2R7X A;  2RV8 A;  3JR9 A;  3FF5 A;  2VQL A;  4CCN A;  1H9T A;  2EZI A;  1IV6 A;  1O3T A;  4BUP A;  2ZKZ A;  2EV6 A;  2JJ7 A;  3RKQ A;  3GX4 X;  2WA0 A;  3E6D A;  1ZGA A;  3FKI J;  1XGM A;  4FE4 A;  2Z3Y A;  2UZK A;  4LD5 A;  1S9H A;  3SJM A;  2KHM A;  4FHT A;  3QPL A;  2CQK A;  5BS6 A;  3WTV C;  2ELH A;  4Y4R A;  2IA0 A;  3Q3S A;  4PJN A;  4B44 A;  3DPT A;  3SHF A;  1FSH A;  4EVI A;  2DA5 A;  1LFU P;  3JSP A;  2JZY A;  1UG0 A;  4LJZ F;  1QZE A;  2WB1 N;  2WAF A;  2M8E A;  2QCO A;  3NRV A;  1LPQ A;  1G4D A;  2L4M A;  3DPU A;  4HNV A;  2FQ3 A;  2VBW A;  4RGX A;  2HPM A;  1WJ5 A;  4WK8 F;  1K61 A;  5FRM A;  4BEH B;  1UAA A;  3WGH A;  1U9N A;  3JRC A;  4HNT A;  4CSW A;  5KNL A;  2PLY A;  2FA5 A;  3FMS A;  1MBJ A;  4ON0 A;  3GLX A;  3VYS B;  1F36 A;  4P9F A;  3LFU A;  4CZC A;  3NQO A;  1UJ8 A;  4MQ9 F;  4FTH A;  1Z1D A;  1YS6 A;  2ESH A;  2MGQ A;  2X1D A;  4P5O A;  3WU2 C;  1JUM A;  5FKO A;  4UUV A;  4F55 A;  1JJ8 C;  5M5Y J;  2L7Z A;  5DCM A;  2M4K A;  3QRF F;  3PFI A;  5K5Q A;  3BJA A;  5GAD J;  4MFE A;  3IKV A;  4CDG A;  1K4S A;  2VB6 A;  3HSR A;  4X6A J;  5K7F A;  2WTE A;  3OV8 A;  1LVA A;  1KA8 A;  2W7N A;  4CHU A;  2DOE A;  4ESB A;  1RET A;  3A02 A;  1BJZ A;  1PP7 U;  3GTL J;  1QU3 A;  4MEX F;  2M7A A;  2WAE A;  4IHW A;  1IRG A;  2A5Y B;  1T6S A;  3CCY A;  3MKY B;  2PMU A;  2L02 A;  2M3A A;  1V3F A;  3PO3 J;  1MNM C;  3RKX A;  4FX0 A;  1YHQ I;  2KKO A;  3G1O A;  1RES A;  1WH7 A;  3IUO A;  3L2W A;  2W84 A;  1XMK A;  1E3P A;  1JTX A;  2I5U A;  2MG4 A;  5ILS A;  3SYT A;  2PJR A;  4NHJ A;  1ETX A;  4J19 A;  1FSE A;  1VQ9 I;  3WGG A;  2ZB9 A;  2MLK A;  2MAB A;  2R4G A;  4EGY A;  1K7A A;  1IRF A;  2JA5 J;  2DOD A;  2JUG A;  4RB2 C;  1TT5 B;  5CPR B;  1F9N A;  3NAU A;  1ZG5 A;  3A01 A;  2F5E A;  1SFO J;  2B7E A;  1P9Q C;  2DXI A;  3L09 A;  4JQF A;  3CCJ I;  3GCM A;  1ODD A;  4HF2 A;  4M3F A;  3MEX A;  3RIR A;  3FXR A;  2EBI A;  3A0H C;  3Q9S A;  4M3G A;  5KVR A;  1X58 A;  1QO0 D;  2ADU A;  3CLQ A;  2QEN A;  3H3V K;  2XPV A;  2GBY A;  3U21 A;  5DM7 F;  1B6A A;  4P55 A;  3VYT B;  1K83 J;  3FHZ A;  4RGS A;  1ZQ3 P;  3CMA I;  1YX5 A;  2G7U A;  1XCB A;  4RA2 A;  1MH3 A;  3KP3 A;  1RUN A;  4CIC A;  2XAJ A;  2EV5 A;  3GUD A;  1SFX A;  2EA4 A;  1XPX A;  1A6Q A;  2DJN A;  1FX7 A;  4JX5 A;  2M8G X;  3ZN0 A;  2PMZ A;  1ZK8 A;  3H36 A;  2R0Q C;  1H8A C;  2Z9O A;  2YUS A;  3FXJ A;  2JRM A;  1NK3 P;  1K78 B;  4E7L A;  4UVA A;  5IPA A;  1LQ1 A;  5LLQ A;  1KQ0 A;  3WTS C;  2DDA A;  3M1E A;  3E3V A;  3OR2 C;  4LIU A;  3DU5 A;  3GTO J;  2EH3 A;  4QSH A;  4HLY A;  2QQ9 A;  4YEJ A;  2DYR H;  2E2H J;  3M07 A;  4OAZ A;  1APL C;  3JW4 A;  2LLK A;  4PK4 A;  4E7S A;  3EUK L;  2M87 A;  1BBY A;  3K69 A;  2ZSH B;  2V6E A;  2EFP A;  1JXS A;  1WRJ A;  3MZ8 A;  1TWH J;  4JK1 X;  3QOE A;  4Q5S F;  5HLI A;  3D5R C;  1GVD A;  1S3J A;  2KMU A;  3C3W A;  5EG0 A;  1VQK I;  1KYW A;  4BHB A;  2O6G E;  2B63 J;  1SMY F;  4J00 A;  5K1Y A;  5ILV A;  1UST A;  2VKV A;  1XSX A;  4IEJ A;  4M71 A;  5E3M A;  4PSW A;  1MSE C;  1STZ A;  3OS0 A;  1DU6 A;  4NB5 A;  5F0H A;  3IKT A;  2R7D A;  1MD0 A;  3HOT A;  5HLG A;  2HQN A;  2LBF A;  3HOW J;  3BG6 A;  3QU3 A;  3TL4 X;  1UG2 A;  2UXX A;  4F7Z A;  3TED A;  3HGY A;  4BKX A;  2ZFU A;  3LSG A;  3HHH A;  3DWL E;  2DOA A;  2VKH A;  3H5N A;  1MH4 A;  3OYH A;  1O3Q A;  1GUU A;  3CCE I;  4HLX A;  5GTI C;  3J80 Z;  1X2M A;  1WQ2 A;  5BNG A;  3L9F A;  4EQQ A;  3JRE A;  2VBZ A;  3S1M J;  1EJ9 A;  3CLO A;  1HBX G;  2MD5 A;  4KIT B;  5LEJ A;  5FLX K;  1EKE A;  2E19 A;  3N97 A;  3E6C C;  5HS7 A;  3WU1 B;  1ITY A;  4CA0 A;  1HST A;  4P96 A;  1SFK A;  4D5F A;  2FX0 A;  2ZXH A;  4Y3O A;  1X1P A;  1RC9 A;  1RZ4 A;  1ENH A;  5LGU A;  4U87 A;  1B8I B;  2CW7 A;  3S17 J;  2L01 A;  2QM3 A;  1G59 A;  5GPA A;  3I71 A;  3R61 A;  4G6T B;  3LSI A;  4IX7 A;  2WBM A;  1F43 A;  3OYM A;  3OYI A;  3S1R J;  3LWF A;  2MBF A;  1XMA A;  5BMZ A;  1JGG A;  2L54 A;  2Z5U A;  3WE2 A;  2L4A A;  2Z99 A;  3CES A;  2F2E A;  2ZJP F;  4IQJ A;  3DXJ F;  2Q0O A;  4L18 B;  4A5M A;  3GTG J;  1TC3 C;  4XKC A;  3I4P A;  1WSU A;  2L2O A;  2W4S A;  3ULQ B;  2FXA A;  2EFO A;  3V8K A;  1A31 A;  5CQE A;  1TT0 A;  2KJB A;  3GFI A;  4I09 A;  1VQ6 I;  1ZR2 A;  1XS9 A;  3BDD A;  5DCM B;  2GQQ A;  2R5Z B;  2DA4 A;  5IOZ A;  3DLA A;  3GTM J;  3TO6 A;  2L9N A;  3MMY B;  2IGM A;  3FXU A;  2QVO A;  2VQG A;  2W85 A;  1FNN A;  5DYM A;  4ZYH A;  1U78 A;  1CF7 A;  2AHQ A;  3PJR A;  1MMS A;  2O61 A;  2AQF A;  2CW0 F;  4RM2 A;  1W0T A;  1KQ8 A;  2EZK A;  2GXG A;  1VQM I;  3MCZ A;  1V55 H;  4MEY F;  2IAI A;  2D5V A;  5J1R A;  3IH4 A;  2DI3 A;  3RQ4 A;  4EJT A;  2VE8 A;  1LDD A;  1X3W B;  1QHG A;  2DTR A;  2LRE A;  3S3M A;  4KA4 A;  3GTP J;  3LFK A;  1WPK A;  3N05 A;  1R00 A;  4I02 A;  3O2P E;  5FFZ A;  4EJV A;  3GTK J;  2XB0 X;  1I3A A;  2K4B A;  1FC3 A;  4B43 A;  3TO9 A;  2IEK A;  2E60 A;  3M8J A;  3FK6 A;  2FU4 A;  5CVJ A;  2DAO A;  1IZ1 A;  2E2J J;  3A01 B;  4ZTJ A;  5K5O A;  2Z1D A;  2BY0 A;  3NWT A;  2BHY A;  1Z21 A;  4AWX B;  2IA2 A;  2CGP A;  2IS1 A;  3MVP A;  1YTY A;  2VOP A;  4RB0 A;  2DMP A;  2LKX A;  1Y56 A;  3BZ6 A;  1E3H A;  2COB A;  4G6D A;  1OCO H;  2DJI A;  1EH8 A;  1VTN C;  4DYQ A;  3FK7 A;  3DTI A;  2H6C A;  4JBA A;  5J3L A;  4KMF A;  2QLZ A;  2VC0 A;  3HPG A;  3M7G A;  3TDU C;  2O5R A;  5DV5 A;  5ILU A;  3S15 J;  2EIM H;  5H20 A;  1JHH A;  1UB9 A;  4GO1 A;  4UNO A;  2XC7 A;  5GAE J;  4OMZ A;  4AVZ A;  1AHD P;  2KPM A;  1HXD A;  2DMT A;  1QZY A;  2OC6 A;  3KPH A;  3FZV A;  2E36 A;  3TOA A;  1REP C;  1G8X A;  3E7L A;  4LOC A;  4AYB A;  1M1E B;  1IAW A;  1ZGJ A;  4YFK F;  1AKH B;  4H4K C;  2STW A;  4QLC U;  3PO2 J;  2LYC A;  2Q2E A;  4WCG A;  4LG0 B;  5E1Z B;  2W24 A;  1Y8R B;  1OIS A;  3DKW A;  5IP6 A;  1LUJ B;  5E8I A;  1VQ7 I;  1HKS A;  1MJB A;  3FXO A;  3WTU C;  3BR3 A;  1IN4 A;  2M2E A;  3S2W A;  4UXN A;  4XLE A;  4D1Q A;  5FD5 A;  3T1B A;  3VSL A;  3BG7 A;  1ZTR A;  2IVM A;  2EFQ A;  4E6K G;  4E7J A;  2E35 A;  5E1X A;  2OF7 A;  2IRF G;  3FWE A;  3CUQ A;  3LOC A;  2KFD A;  2K3F A;  3WHC A;  2M30 A;  3ZCO A;  4XKW A;  4DW6 A;  1FT9 A;  2STT A;  4NQW B;  4IO9 F;  4DGW B;  1KU3 A;  1UEL B;  1W7P D;  2PEX A;  2NVU B;  1TWA J;  4S0H B;  4RB3 C;  3KP5 A;  3SDG A;  4OU0 A;  2JSP A;  2HWV A;  5HDG A;  2YU3 A;  2VQC A;  3BPX A;  3CZ6 A;  4IKF A;  3BJ6 A;  4U0W A;  2Y69 H;  4A6E A;  2EPF A;  3LSP A;  3PSI A;  1BC7 C;  2JT1 A;  2OQG A;  1OCR H;  2W82 A;  2YR2 A;  2M7B A;  4Q47 A;  4A6D A;  1X2N A;  5E8G A;  3FXK A;  3T8R A;  1SEU A;  3T5X A;  1A6I A;  1Z7L A;  3J7Z I;  4IHV A;  3HDD A;  2F48 A;  2IA1 A;  3FMR A;  4CYC A;  5EEG A;  4G7Z F;  3HB9 A;  4B8X A;  2LF7 A;  2VT2 A;  4Z2Y A;  4A93 J;  4NC6 A;  3ESW B;  1IN5 A;  5JHF A;  3H3Z A;  5L3B A;  2XB5 A;  5IP9 J;  2WAQ N;  1RPW A;  1KYZ A;  4RBO A;  3S1N J;  1Y6I A;  1OPC A;  1XB4 A;  2R5Y B;  4KT6 A;  4MTE A;  3P7N A;  3BZC A;  3CDL A;  1J75 A;  3C2B A;  5F0C A;  1R1T A;  3F72 A;  5FLX Z;  1ULY A;  3M3Y J;  4RM3 A;  1DPR A;  4E7I A;  2CQ7 A;  4KN4 X;  1ZRF A;  2H6B A;  4LIV A;  1OYY A;  1MIJ A;  3W6J B;  4BXF A;  3BQZ A;  4KIF A;  4E7H A;  4B47 A;  2MC3 A;  2XPW A;  2ZNZ A;  1IXR C;  4M6V A;  1R1V A;  3CCS I;  4IRI A;  2LY1 A;  4AUX A;  3WE3 A;  4BEH A;  4FX4 A;  2OV7 A;  1W7P B;  2X85 A;  2M9H A;  1YI2 I;  1CQT A;  3QP5 A;  1ETO A;  2JPB A;  4IQ4 A;  3HSF A;  2CRG A;  3GO5 A;  1EH7 A;  5HDK A;  3H0D A;  3OIQ A;  5KAF C;  2Y0M A;  1HC8 A;  3RKY A;  4EEF G;  3F9K A;  4HBL A;  4ASN A;  5CQG A;  4X0G A;  1I3Q J;  2L9S A;  5ICF A;  5IT3 A;  3GWZ A;  1FIA A;  3WU0 A;  3L2V A;  3K4N A;  5BOX A;  4XLP F;  3T0Y A;  4XLA A;  1Q1H A;  1WJA A;  2DA2 A;  3MAJ A;  4DZJ A;  4RB1 A;  4D9J A;  1YS7 A;  1WFX A;  3IRQ A;  2HPI A;  3CMY A;  1Z3Y A;  2DLL A;  1OLT A;  2JQ7 A;  1HKQ A;  4HF1 A;  2LOO A;  3JTH A;  4PJJ A;  4F3Q A;  2IGK A;  2KLO A;  1XSD A;  2DPU A;  3HRT A;  3H9J A;  2JUC A;  4XLN F;  4XKB A;  2KIF A;  5K5R A;  1JGS A;  2RN7 A;  2HDW A;  2QZ8 A;  5CYV A;  3VB2 A;  1QQI A;  1R22 A;  2M34 A;  2Q8K A;  2CUZ A;  1R5I D;  2RRE A;  5DEQ A;  1PDN C;  2BE5 F;  1RUO A;  1R4N B;  2MSY A;  1IXC A;  2V1N A;  4I7H A;  1YOV B;  3DQV C;  2K85 A;  2IJL A;  5IYB J;  2CSO A;  3R0A A;  1HDP A;  2E1C A;  4M6X A;  4HZF A;  2CV2 A;  3A2K A;  2HEO A;  3RI4 A;  3ERM A;  3UNG C;  1ZLK A;  3J7Y J;  2GIZ A;  3ZOB A;  3K1N A;  4ZYA A;  1B4A A;  2O9L A;  3MKW B;  3FXQ A;  1UMQ A;  3U2R A;  5L3G A;  1Z6T A;  1OQY A;  2LKS A;  2RQP A;  4FIS A;  1QBJ A;  4XLH A;  4YRV A;  1B1B A;  1FP2 A;  2R3S A;  2XF6 A;  4BGD A;  3S2H J;  1D3Y A;  4A69 C;  2CFO A;  4PJL A;  5D5W B;  1WI3 A;  3FBN B;  2CMP A;  3TOB A;  3TW7 A;  3HJE A;  2PG4 A;  3S3N A;  2X51 A;  2ETH A;  2BZT A;  5KAI C;  2X6O A;  3JRH A;  3HOX J;  2I8D A;  2N8G A;  4Y17 A;  3IRR A;  5ED4 A;  4UHT A;  3R6S A;  3I4M J;  4BHP A;  3VSK A;  3CJQ B;  3F8M A;  1LE8 B;  4I2O A;  5CJ9 A;  3H9Q A;  4ENJ A;  3GZ6 A;  3M8F A;  4PSX A;  4XN0 A;  1BM9 A;  1IV8 A;  4AVP A;  1K6O A;  1WJB A;  1T8I A;  4DBR A;  2W48 A;  1MBK A;  1D5V A;  2XVC A;  2DK5 A;  3HIF A;  1R4M B;  2H1L A;  4U7B A;  4I0B A;  2H09 A;  2VI6 A;  3MFK A;  3MN2 A;  2IP2 A;  4BDZ A;  4MTD A;  2WAD A;  3HRU A;  2NNN A;  5GAH J;  2OQR A;  1N75 A;  5HDN A;  3KFW X;  5HOD A;  4AM3 A;  3BQY A;  4C2M J;  2ZFW A;  4Y13 A;  4BE2 A;  3WHB A;  2ZSI B;  2M45 A;  3EPZ A;  3R0J A;  2E7W A;  3CP8 A;  4KIS A;  1Y1V J;  1JJ6 C;  5CVU A;  3VDX A;  4DOZ A;  5IP7 J;  3OIP A;  3IWZ A;  5B1B H;  4TV7 A;  1P4X A;  1T0F A;  2BV6 A;  1ETK A;  1J5Y A;  2E1O A;  3I9V 2;  4QIW N;  5JVT A;  3TW6 A;  2GOM A;  4FQG A;  4B1R A;  5LHH A;  5E3O A;  2WY8 Q;  3I56 I;  3PQK A;  4HX4 A;  5BPI A;  1RKT A;  4A3I J;  2HOA A;  2LK2 A;  4BE1 A;  3G4S I;  2R7W A;  3ECO A;  2WC2 A;  4CYC B;  1VF9 A;  4BBR J;  3OYF A;  1DU0 A;  3F8B A;  3FM3 A;  2NS7 A;  2J5P A;  3NWS A;  4ZH4 F;  1KZH A;  3A1Y A;  5B5E C;  1P7I A;  2XAS A;  5FFX A;  4IXA A;  1Z6R A;  3REO A;  3ONQ A;  4CGZ A;  1T56 A;  2BEO A;  2V9V A;  4IVN A;  3E6M A;  1Y0U A;  2OCC H;  4C3H J;  1OMI A;  1B8I A;  1JE8 A;  3HKZ N;  1U5T C;  1BJA A;  3DBH B;  4IOA F;  4UV8 A;  1UCR A;  1TQP A;  2IS2 A;  3K70 C;  2V79 A;  1X1C A;  1DPU A;  3OY9 A;  1FY7 A;  1WWX A;  4XMY A;  2DCE A;  2EIN H;  4LLN A;  4KMU X;  3QWL A;  1N25 A;  5CVI A;  4IHY A;  5FKM A;  2H94 A;  3K4B A;  4XQF A;  1ETW A;  2EB7 A;  3DKX A;  1YW8 A;  2QF7 A;  4MO7 A;  1B72 B;  2ELK A;  2HYG D;  4GRI A;  2ZXJ A;  2P0W A;  4AC0 A;  5J40 A;  4DYC A;  3JAM K;  4UVB A;  3ZQH A;  1LNW A;  1T39 A;  4L9V A;  3CCU I;  4MLO A;  5FO5 A;  3SZT A;  3KZY A;  2OJE D;  3GVA A;  2R5Z A;  1FOX A;  3K4L A;  2NOG A;  1MSF C;  4L5J A;  3F21 A;  3PFY A;  3DPL C;  4BQQ A;  4OIN F;  2KRC A;  1E3O C;  4KJZ A;  4CUG A;  3QOD A;  4BDY A;  1XGN A;  4IL6 C;  1MJA A;  2AS5 F;  4UVC A;  1ZN2 A;  4ITV A;  3WOD F;  1R23 A;  2Q1Z B;  2VIX A;  1S72 I;  4DYR A;  5FD6 A;  4FET A;  1AWC A;  2FJ1 A;  4N4O B;  1ZG3 A;  2O8X A;  3I55 I;  3JTG A;  4DZP A;  2LY2 A;  2EZL A;  1BL0 A;  4Y52 J;  1TBX A;  3I59 B;  4XIC A;  1NTC A;  4KDP A;  4E7K A;  2JN6 A;  1C0W A;  2CUJ A;  2QUF A;  3LSJ A;  4ZTF A;  3H5R A;  1IG7 A;  4BXU A;  4BU2 A;  2ZJQ F;  4OWR B;  1DGW Y;  3AG4 H;  3KZZ A;  3W2V A;  4A3M J;  1HSJ A;  2QSH X;  2Z16 A;  3LNQ A;  5HLT A;  2H8R A;  3DEW A;  2V4J C;  4ZDO A;  2VXZ A;  2KP6 A;  1MJ9 A;  2DMQ A;  4BQN A;  2BYV E;  3JRF A;  1B9M A;  3K1M A;  5ICG A;  4RAY A;  2FBH A;  1W36 C;  2E34 A;  4OIQ F;  3JRB A;  1O3S A;  3ZQ7 A;  1H0M A;  3KEY A;  2CO5 A;  2EFN A;  1T95 A;  3KE2 A;  2V9P A;  2EK5 A;  1OYW A;  2DU9 A;  3MWM A;  2QSG X;  3QP6 A;  5JR3 A;  5JLW A;  1GT0 C;  1MMA A;  4HX8 A;  2DFE A;  3DBR B;  2DOF A;  5L3F A;  1SAU A;  3IL2 A;  1LDK B;  1BI1 A;  1T38 A;  2ESN A;  4XL9 A;  5EYR A;  4LB6 B;  2VJ4 A;  2DK8 A;  1TQI A;  1W0U A;  3RZD J;  5LRS A;  3PL8 A;  1BI3 A;  1AKH A;  2K3P A;  5FKK A;  3QOP A;  4G94 A;  2P6T A;  4LG0 A;  3M4O J;  3OWT A;  5EEA A;  2OA4 A;  4AIK A;  2Y0S A;  2P5L C;  2W00 A;  1D1C A;  1QPI A;  3OYB A;  4L5E A;  1HLV A;  2KIQ A;  3ISP A;  1BR4 A;  3DTE A;  1K4T A;  5EZG A;  3TKY A;  2NS8 A;  2OU2 A;  2WV1 A;  3LL7 A;  1HCR A;  5D8K B;  3AL0 C;  5F6F A;  5FKL A;  3CDH A;  4MNU A;  5LBQ A;  5LHI A;  2HGC A;  2XIG A;  1YE9 A;  1TL8 A;  2ISZ A;  3CQZ J;  2RGV A; 
#chains in the Genus database with same CATH homology
 1D0Z A;  2CW8 A;  1DGR M;  3KYL A;  1V5E A;  4BJ5 C;  3SEQ A;  3OS2 A;  2XC7 A;  3SEZ A;  3S93 A;  1WJC A;  3MD2 A;  4AVZ A;  2KPM A;  3RTR A;  3OYE A;  2W1O A;  4C2T A;  4QPQ A;  2E5Z A;  2OC6 A;  3OYK A;  3V42 A;  1G8X A;  4NC7 A;  4AYB A;  2LG4 A;  3LSH A;  1NG7 A;  4B48 A;  3BC8 A;  4HSR A;  2DT7 B;  3LMM A;  4B3X A;  3RCO A;  1J09 A;  4H4K C;  1BR1 A;  3ZGK A;  1X19 A;  2LYC A;  4HRI A;  4XLC A;  4CCK A;  1N78 A;  4P1W A;  3MKZ A;  4XM3 A;  2HQA A;  3QYE A;  5FRO A;  4F91 B;  2HVQ A;  5KCM A;  1D1B A;  4II3 A;  3HG9 A;  2M4G A;  3ZQQ A;  2CV1 A;  2BOL A;  2VKD A;  3OL4 A;  4XLE A;  4D1Q A;  3OYA A;  2V26 A;  3BG7 A;  3VSL A;  1E0E A;  4E6K G;  4E7J A;  3D5L A;  3BCB A;  3KX2 A;  1LVK A;  2JVH A;  4NNJ A;  1N77 A;  3DKY A;  2IGN A;  3ZCO A;  4XKW A;  4NQW B;  4DGW B;  1UEL B;  4BS9 A;  2F4I A;  2HVS A;  2JSP A;  1AA7 A;  4YEL A;  1LKX A;  2VQC A;  3CZ6 A;  4HPQ A;  4IKF A;  2XAU A;  4ZJZ A;  3PNV A;  3PSI A;  2WAQ A;  1MND A;  2QKM B;  4FAS D;  4R79 A;  2W82 A;  2M7B A;  4CCO A;  2VQH A;  1Z7L A;  4E7Z A;  4ZDP A;  3OYN A;  2Q2E B;  3DU6 A;  1WJF A;  2F5V A;  4HNU A;  5JHF A;  4DIQ A;  3SZG A;  1JI8 A;  1QHH D;  3OOU A;  3HC7 A;  3K4M A;  2R7U A;  1Y6I A;  1MMN A;  3K4J A;  2ZXI A;  4KT6 A;  3H9G A;  4PFO A;  3QYB A;  2MFZ A;  3E0J B;  4RM3 A;  3C2H A;  3RSN A;  4E7I A;  3OYL A;  2R7V A;  1D0Y A;  2UV1 A;  4LIV A;  4CCJ A;  3OL3 A;  4BXF A;  2VXD A;  3L2U A;  1X1A A;  4E7H A;  4B47 A;  4RMN A;  4BJT A;  3OYG A;  2XF5 A;  3HOS A;  2LY1 A;  1MNE A;  4HG2 A;  2KQR A;  2X1C A;  4BEH A;  3PSF A;  1R6R A;  2OV7 A;  2X85 A;  2FUG 2;  3EUA A;  3AKZ A;  3IP4 B;  1MMG A;  4IQ4 A;  3K6G A;  2R7R A;  3H0D A;  3OIQ A;  1HA8 A;  1VZ0 A;  1D0X A;  2R7T A;  3GBG A;  3K70 D;  3F9K A;  2R7X A;  3TBI A;  4ANJ A;  3PNT A;  2VQL A;  3HXL A;  4CCN A;  5CQG A;  4X0G A;  4II2 A;  4BUP A;  2L9S A;  2HU9 A;  2WA0 A;  2V7F A;  3L2V A;  3K4N A;  2LRD A;  1S9H A;  2KHM A;  4XLA A;  1WJA A;  3E1S A;  4D9J A;  1WFX A;  4Y4R A;  2HPI A;  2XDV A;  1Z3Y A;  5LD2 C;  1OLT A;  2X6W A;  2VJ5 A;  3DPT A;  4PJN A;  4B44 A;  2LOO A;  4ZDL A;  2KZV A;  4DJA A;  4PJJ A;  3IAM 2;  1UG0 A;  4HEA 2;  4PJM A;  4F3Q A;  3PUB A;  2IGK A;  2KLO A;  2KL4 A;  1X1B A;  3H9J A;  4BJ6 C;  4IZZ A;  3VWB A;  4NUB A;  2E5N A;  4XKB A;  2WAF A;  3CMM A;  2HDW A;  3DPU A;  4RLF A;  2IS6 A;  2BW3 A;  2CUZ A;  2HPM A;  1WJ5 A;  5FRM A;  2RRE A;  4BEH B;  1UAA A;  4HNT A;  4CSW A;  5KNL A;  1BOB A;  2MYS A;  2A6T A;  2JA2 A;  2V1N A;  4XOR A;  3D5S C;  3VYS B;  3L2R A;  1Z3X A;  3DQV C;  3LFU A;  4CZC A;  5HNF A;  2CV0 A;  4J01 A;  1WJE A;  4XN3 A;  2X1D A;  4P5O A;  4BAC A;  1NG6 A;  4F55 A;  2CV2 A;  3A2K A;  2M4K A;  3UNG C;  2VB6 A;  3K4C A;  4AU7 A;  3S8P A;  4ZYA A;  2W7N A;  3MKW B;  4EAT A;  3K10 A;  2VL8 A;  1QU3 A;  4XLH A;  4YRV A;  1FMV A;  2XF6 A;  4BGD A;  2M7A A;  2WAE A;  1FMW A;  2CFO A;  4PJL A;  3FBN B;  2CMP A;  3MKY B;  3G2B A;  2M3A A;  3S3N A;  2X1E A;  4CCL A;  2X51 A;  4PFP A;  4XR6 A;  1W36 D;  2I8D A;  3IUO A;  4LG3 A;  3L2W A;  3SYT A;  2UWM A;  2PJR A;  3CJR B;  2LC2 A;  3SDB A;  1K6Y A;  2VJI A;  5TGT A;  3VSK A;  3OYJ A;  2MAB A;  3CJQ B;  2R4G A;  2JUG A;  5CPR B;  3H9Q A;  4PSX A;  4XN0 A;  3W2W A;  5HNH A;  1P9Q C;  2DXI A;  2XSJ C;  2BVM A;  4JQF A;  5CKT A;  1WJB A;  4QPO A;  2BVL A;  4DBR A;  1DQU A;  2CH0 A;  4U7B A;  2HVR A;  1X4P A;  3S32 A;  3U21 A;  4BDZ A;  2WAD A;  2F6C A;  3VYT B;  4N4N B;  2CS3 A;  3FHN A;  5FRN A;  1N75 A;  1YX5 A;  3OMY A;  3EUH C;  4BE2 A;  2MD0 A;  2QKL B;  3FDY A;  2ZSI B;  3VYR B;  3EPZ A;  3CP8 A;  4KIS A;  3VDX A;  4DOZ A;  3OIP A;  1BR2 A;  3HPH A;  2PMZ A;  3I3L A;  3I9V 2;  2GOM A;  4E7L A;  2VPL A;  1EA3 A;  2LH9 A;  2WY8 Q;  2E1M C;  3IAS 2;  3OR2 C;  4LIU A;  3DU5 A;  4BE1 A;  2R7W A;  3J7A Y;  3HKZ A;  2PJR B;  3DTK A;  4RLQ A;  4YEJ A;  4XOP A;  2K5C A;  4XOT A;  3OYF A;  5KHD A;  4OAZ A;  1KON A;  3ZRG A;  3NWS A;  4PK4 A;  4E7S A;  2ELJ A;  3EUK L;  2IGO A;  3VYU B;  3H35 A;  2KDO A;  2WB1 A;  3A1Y A;  2ZSH B;  2V6E A;  2R7S A;  3TMO A;  3ONQ A;  4BL0 B;  1X4O A;  3QOE A;  4F93 B;  3C2G A;  3D5R C;  2HNH A;  2XF7 A;  1IRX A;  2KMU A;  2E1M B;  3H5A A;  2VJJ A;  4E4H A;  4CH7 A;  1PYV A;  2IS2 A;  3K70 C;  2X6Y A;  1X1C A;  4J00 A;  4C9Y A;  4LIT A;  3OY9 A;  3L2Q A;  4PSW A;  5LFA A;  4HST A;  2X6X A;  3OS0 A;  4XMY A;  2IXS A;  2DCE A;  5HOO A;  3HOT A;  2LBF A;  2Z2S B;  3BG6 A;  3K4B A;  4XQF A;  3OYD A;  3DKX A;  3TL4 X;  2VLA A;  4GRI A;  4XON A;  2P0W A;  1WJD A;  2ZFU A;  4XNF A;  3LSG A;  1YX3 A;  2DOA A;  3DWL E;  2VKH A;  2K9L A;  3H5N A;  4C30 A;  3OYH A;  3AL0 B;  3K4K A;  4MLO A;  3FKJ A;  3K4L A;  4BE0 A;  4ZC3 A;  4KIT B;  3PFY A;  3DPL C;  4BQQ A;  4CA0 A;  4PUS A;  1SFK A;  2KRC A;  4KJZ A;  4CUG A;  3QOD A;  4BDY A;  4NC8 A;  2ZXH A;  4Y3O A;  1MMD A;  3HL2 A;  4ITV A;  4C2U A;  2Q1Z B;  4U87 A;  2VIX A;  2CW7 A;  4FET A;  1G59 A;  4N4O B;  4G6T B;  4IX7 A;  3LSI A;  2WBM A;  4F52 A;  3OYM A;  3OYI A;  2AQE A;  2LY2 A;  3W3C A;  4E7K A;  2CUJ A;  2KRH A;  2BW3 B;  3OR1 C;  3LSK A;  2L7K A;  4Y33 A;  4JOM A;  3CES A;  3H5R A;  4ZTF A;  4IQJ A;  2LBF B;  3DEE A;  4BU2 A;  1D1A A;  4OWR B;  1DGW Y;  4OAY A;  3HUG B;  2RQQ A;  4XKC A;  4DBQ A;  3W2V A;  2VAS A;  2Z16 A;  2R7O A;  2JVG A;  5HLT A;  2V4J C;  4ZDO A;  1OR7 C;  2L2O A;  2W4S A;  2VXZ A;  1ZEL A;  2KP6 A;  5CQE A;  3OS1 A;  1TT0 A;  4BQN A;  2RNG A;  3A4C A;  3RPU D;  1ERD A;  3CF2 A;  3DLA A;  2L9N A;  3MMY B;  1U0J A;  1W36 C;  2IGM A;  2VQG A;  1DP3 A;  4F92 B;  3PJR A;  2AQF A;  3KEY A;  3QYF A;  1T95 A;  1V5F A;  3ZXS A;  4RM2 A;  1LFP A;  4BQO A;  1V5G A;  3ZR8 X;  3UR3 C;  3CP2 A;  1MMA A;  1X1D A;  3RQ4 A;  3BCA A;  4XKV A;  3AFH A;  1SAU A;  2M0M A;  1LDK B;  2OUM A;  4XL9 A;  1QHG A;  2LRE A;  3S3M A;  2MC4 A;  2IS4 A;  2VJ4 A;  3N05 A;  1PJR A;  3OYC A;  2GOX B;  3PL8 A;  2K3P A;  3W2A A;  4B43 A;  2E60 A;  2L5Q A;  3M8J A;  3OWT A;  2HZD A;  2Y0S A;  3FBI B;  2W00 A;  4ZTJ A;  1D1C A;  3OYB A;  2Z1D A;  3NWT A;  3BLY A;  4XLF A;  5HVQ C;  3S3O A;  2R7Q A;  1Z21 A;  2IS1 A;  1BR4 A;  2DT6 A;  1T0F C;  3DTE A;  2UUZ A;  4CCM A;  1Y56 A;  2K9M A;  3LL7 A;  3LSM A;  1TZL A;  2DJI A;  2A5W A;  3PNY A;  1GLN A;  3AL0 C;  2NOJ B;  2V9K A;  2WY7 Q;  3DTI A;  1MW7 A;  3M1C A;  1YE9 A;  3HPG A;  2O5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...