3HUGB

Crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
HHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA polymerase sigma factor
publication title Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/membrane protein
total genus 21
structure length 62
sequence length 62
chains with identical sequence D, F, H, J, L, N, P, R, T
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13490 zf-HC2 Putative zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hugB00
4NQWB 2Q1ZB 2Z2SB 3HUGB
chains in the Genus database with same CATH superfamily
5DDGA 4BQQA 3RKYA 1ZGJA 2K5CA 3RIRA 3OYLA 3DKYA 1SFEA 1TT0A 4Q47A 2R7ZJ 1W5CC 3M07A 2W57A 3S2HJ 3H0GJ 1UG0A 4CCMA 4B44A 2QZ8A 2M45A 4BACA 3PSIA 1N25A 1ZG5A 3U2RA 2HVSA 2L4MA 4S0HB 2JN6A 1SVMA 3ABUA 4BJTA 1LE8B 2G9WA 1USTA 2CQ7A 2OBPA 4YIIA 4KITB 4DW6A 5HLHA 2JA7J 2NVTJ 4C2UA 4DJAA 3DCFA 3FK6A 5B66C 1I1SA 3QU6A 2FJ1A 2V9PA 3FKIJ 3HRMA 2UXNA 5HVQC 5K5OA 4UNOA 3S15J 5HLGA 1AWCA 2K9SA 4KIGA 4XR6A 3G4SI 1TWFJ 4IQ4A 3TDZC 2R7QA 3K4JA 1V3FA 2KFDA 3K4LA 2FQ3A 2WAFA 1VQ8I 3C3WA 5JHUA 1FTTA 3GWZA 3WG9A 4W97A 4V2FA 2NNNA 2XAFA 2KHMA 2AXLA 2B0LA 1PVEA 1QZEA 1C0WA 3OWTA 5IP7J 3B6AA 1H89C 2A07F 1ITYA 4ITVA 5HNFA 2CG4A 3I55I 1F4KA 2LTPA 4D5CA 2CQNA 2NXNB 1P7IA 4MEYF 4ZZDA 2M87A 1WJEA 2VC0A 3NRVA 1V5EA 5D5UB 3H5RA 1TBXA 4PSXA 3LSGA 4JX6A 3O8GA 3I4PA 4KIBA 3DBHB 3G1LA 3UR3C 1ODDA 3GZNB 1LE8A 3DU5A 2XVCA 3GZ5A 4R1HA 2F5VA 3VYTB 4IZZA 1KYZA 4B43A 5EF6A 4QPOA 4BU2A 4D1QA 4BDYA 1HCRA 2P81A 3LSRA 2L02A 1AA7A 1VNDA 1Z21A 1XSVA 3EQLF 3IP4B 3ONQA 1W7PB 2TDXA 2BW3B 3PQKA 5L3EA 2Y0SA 2JQ7A 3BG9A 4OAZA 1YRNA 1LB2A 3S8PA 2G7UA 1JUPA 2E2IJ 4OIQF 5HS8A 5E1XA 3V7RA 2D5VA 3KPHA 1S7AA 1RKTA 5D5VB 3J81Z 1IRZA 1GVDA 3CJTB 4R79A 5LBQA 5J47A 1QPMA 2KRCA 5ILVA 1G2HA 1F5TA 4PDKA 4I09A 1OCCH 2JPCA 2FUG2 4CGZA 2XUBA 1ETVA 3ZR8X 3O3KA 4B3XA 3DWLE 3HM5A 3W6KB 3F23A 2A6TA 2O6GE 1Y0UA 1MMDA 2EA2A 1KU3A 1HKTA 3JR9A 2UV1A 4KA4A 1JGGA 2IXSA 4G6QA 1SFKA 2VL8A 2E71A 1VQNI 4QLCU 1WWXA 1K79A 3IH2A 5LHGA 1X58A 1SAUA 2IS6A 1HDDC 1MMGA 1CQTA 3PFYA 3O2PE 1YITI 1LDKB 3B02A 2VJ4A 4A3EJ 1B9NA 4M73A 3OYGA 4KFCA 1S29A 3KFWX 3K7AJ 4BKXA 2CW7A 3Q9SA 2DMNA 4RB3C 2CV1A 1BJAA 4L9TA 3CF2A 2JT1A 1ZTRA 1BBYA 3VWBA 2DK8A 3P9CA 1N78A 4HV5A 2R7RA 1GXPA 4M6XA 3D5RC 3H92A 1DP3A 2KIMA 4RB1A 2L4AA 4OIRF 3CCQI 1R1TA 4KN4X 1XD7A 1TLHB 5LEJA 1IDZA 4N9HA 4S05A 1R1VA 1SVOA 2XAGA 3FXKA 1R36A 4A3MJ 2VKVA 2EA4A 2EFNA 3PJRA 1DPUA 4U0VA 5D8KB 1A6QA 5D6FA 1MSEC 1Y8RB 3K4NA 4BGDA 2Y9ZA 2B63J 4HZFA 4DBRA 5FKNA 3Q0WA 4XSXF 3F22A 2ZJRF 1LVAA 1MH3A 3OMYA 3ISPA 2LKSA 1W4MA 3H0DA 3OIPA 4PCQA 4AM3A 2HI3A 2DO7A 2P7CB 2PFBA 4FX4A 5KVRA 4ZC3A 2X6WA 4PJMA 4CUGA 1YO5C 2K86A 3NWSA 3IRRA 1SD7A 5EGOA 3QYFA 1XCBA 1UHSA 2EPFA 2CH0A 4IRGA 2EBIA 1A6IA 4V19K 5LGUA 3FMRA 5F0FA 2LFBA 2RQQA 3QP6A 4YIFA 3R4KA 3FXMA 1R1UA 4G6DA 4QPQA 3H3VK 3N05A 2BXZA 3ABTA 1IUYA 2GA1A 1K6OA 3ULQB 2LD5A 4BS9A 3J80K 2HS5A 1JTXA 1VQ9I 5DCMB 1STZA 3M1CA 2R7WA 2KZGA 2XAHA 2VKHA 3TO9A 2LK2A 4XMYA 1REPC 1FX7A 4G7HF 5BOXA 2M4GA 3F9KA 3IWFA 3CCLI 2H8WA 1JKQC 4O3MA 1R49A 2V79A 2P8TA 4HLYA 2DDBA 3V8LA 4L0ZB 2A68F 4CYCB 2FMLA 4W1UA 3T8TA 1U8BA 4C2TA 1NG6A 2IPQX 5FD6A 4A0XA 1OJLA 1Z6TA 1A35A 2IRFG 2YU9J 2DPDA 2LSOA 2DQRA 2HQAA 2WV1A 1HLVA 2DN0A 5EJCA 1V5GA 2VC1A 3KE2A 4GDFA 1DU0A 5E1WA 5JI6A 4ZH4F 3GTGJ 2KPMA 2XKOA 3ZMTA 2Y69H 2HOTA 2VOPA 2WAQN 4WK8F 1YS6A 2ZMEC 3AG3H 4LLGF 5HNHA 2QKLB 5AONA 1E2XA 3Q3SA 3VDXA 4Z6YA 2X1CA 2BGCA 2RAEA 4HNVA 1PUEE 2H27A 2OJED 2WA0A 3P9IA 3NEUA 4X6AJ 2E60A 2AXTC 1IW7F 5DCMA 4GYGA 4AIKA 5HDGA 2Y0MA 5IYCJ 1K4SA 3PNVA 4UVCA 3SZGA 2EFWA 3MZYA 2XF7A 5GTIC 4LG0A 4C2MJ 3TKYA 2QSHX 2L9SA 3J80Z 2XPUA 1O3RA 2IA2A 5E17F 3KYDB 2MD0A 3A4CA 3AAFA 4PJJA 3E5UA 3SQNA 1BW6A 2F48A 4CYCA 3F3XA 1Y0NA 3FXUA 3CCEI 2KJBA 3KEOA 3WGIA 4TV7A 3S2DJ 4I0AA 1K7AA 1P7JA 5E8GA 1VQ6I 1YJ9I 3FMQA 4AC0A 4DYQA 3G1OA 3BJ6A 3TO6A 2L5QA 5IOYA 3KZYA 4O6JA 4HNTA 1D0YA 1WCMJ 3TBIA 3OYDA 3L2CA 1K4TA 4GGGA 2RQPA 2BY1A 1KA8A 3HSRA 1FPQA 2RN7A 5FKOA 4J19A 2AO9A 2ZXJA 4BJ6C 2BV6A 3K0LA 5BS6A 1OR7A 3DBLB 3WGHA 2EJRA 4A69C 2Y75A 4FQGA 3ZP5A 1XMKA 4UUSB 4PJLA 4G6TB 2CV0A 4U88A 4YFNF 1BR4A 3BWGA 4IHVA 4RDUA 2BOLA 2O8XA 3ABMH 5HODA 2ZXWH 1T98A 3CO6C 1D1AA 1E0EA 2K9QA 3BG7A 1FZPB 1FC3A 2L3DA 3LL7A 2P4WA 3MAJA 2PMHA 4RGXA 1IAWA 2IS1A 2MA3A 2Y31A 1IO2A 3U1DA 2O61A 2ID6A 4ENJA 4LLNA 2E19A 3FWEA 2J5PA 3S1QJ 1ACIA 1P4XA 2A5YB 3WTUC 3JRAA 4I01A 4CSWA 3CC7I 1TQPA 1A31A 4H0EA 4UUTA 3SFIA 1W36C 4F93B 2MSYA 1XB4A 3WU1B 2HKOA 2K9NA 3F8MA 5TRDA 3JRDA 3FKJA 3DKXA 1WRJA 1DGRM 3QQAA 4ZYHA 5D4RA 1ZH5A 1XN7A 1YW7A 4BE1A 2EWNA 2VE8A 1L0OC 4F7ZA 3GX4X 3GFMA 3EETA 1MNMC 3OR1C 5F27A 1VQ7I 4NBQA 5B5EC 2VOOA 3WTWC 3BROA 2R5ZB 2QYOA 3P9KA 2ZKZA 3KP3A 1QBJA 2OA4A 2WTEA 1YLFA 2BEOA 2EZLA 1JT6A 4LK1F 1D1BA 4Q48A 4CCJA 4IRHA 4UUSA 3QOPA 3CCVI 5BPIA 2LYCA 2VJIA 3CZ6A 5B3SH 2C6YA 2IJLA 3DP7A 4HX4A 2R0QC 1VQPI 3LA2A 2CUZA 4PK4A 1PJRA 1ZAOA 1RETA 1QGPA 2LP0A 1ETWA 3OIOA 3LSHA 5L3FA 5CKTA 3WTXC 1ETYA 1O7LA 1WKMA 9ANTA 5F08A 2MC3A 5AIQA 4XOPA 3DKWA 4A3IJ 4F91B 1JJ6C 2V9KA 3HIFA 4G7OF 1LUJB 2Y48A 2DTRA 3M7GA 1V54H 4JK1X 2E36A 2HTSA 2IBDA 2LRDA 2XAUA 1GVJA 2W48A 3BTLA 1TWCJ 4D7MA 4I7HA 3QYEA 1YI2I 2HDDA 1HA8A 2LREA 3H5NA 1FP2A 1I1GA 5TGTA 1SAXA 2NS8A 3CQZJ 2ZNYA 4HDVA 2R93J 1Z7UA 2H8RA 2WC2A 2DJNA 2XGXA 4IRIA 2E1OA 4WCGA 2QVOA 2XAJA 2F5EA 3GXOA 2IGKA 3V8JA 4B48A 2R5ZA 2XHKA 4M9XA 4B09A 5HS7A 1EKEA 2NS7A 2WB1A 3DF8A 3KX2A 5JLWA 4MTEA 2MLGA 1KQ8A 5L3GA 4EEFG 1H9GA 2HKXA 1W36D 3H36A 3F8NA 2XKPA 2WB1N 3CLQA 1K61A 3I4NJ 2X6OA 2CS3A 4KNYA 1KQ0A 1BA5A 4EMSA 2L9NA 3LA7A 2ISYA 1FOKA 2WADA 3AG1H 1HOMA 2L7FP 2RNGA 2OZ6A 4U7BA 4XLNF 2OD5A 1LDJA 2RREA 3I71A 3W6VA 3BG6A 5ICFA 5JVTA 3CDHA 4KYWA 2NYXA 3HPHA 3E3VA 4LMYA 3E6BA 3DTEA 4B4CA 1DDNA 1R7JA 1IGNA 4XNFA 2LBFB 1PP8F 3B73A 2HFHA 3LA3A 1IJWC 2Q1ZB 4L9VA 3TQNA 1EF4A 1D0XA 2OAZA 4B1RA 4E7KA 3GFIA 4I6ZA 1FLIA 3UKGA 3T0YA 1KONA 5FD5A 3TEDA 1SFXA 2IVMA 3IHUA 3ZCOA 3U21A 1S72I 4CH7A 4MIMA 4OAYA 3RPUD 3OS2A 1I6XA 2HXIA 2XPVA 2DU9A 4DZJA 4KDPA 4OMYA 1Q1HA 4RS8A 1Z3XA 4F3QA 5FFZA 1B72A 5F1JA 1J0RA 5LGNA 2FNAA 3I5UA 4U0WA 4BQOA 1T39A 3A2KA 1DQUA 4HV6A 4MQ9F 5K5QA 2ZJPF 1DGWY 3QRFF 3S3NA 3I4MJ 1FSHA 1ZR2A 1MW7A 5EZGA 4M3EA 3MCZA 4EM2A 1IV6A 2FE3A 1XS9A 2F5FA 3F0CA 2FBHA 5JLXA 1IXCA 3HRUA 5FJ8J 3ECOA 1MBFA 1JJ8C 4NB5A 1MKMA 4LFUA 4I02A 2JMWA 4K2EA 2A5WA 2MLKA 4UXNA 4BBRJ 2L2OA 1EA3A 2L7MP 3AG4H 3R61A 3S3MA 1PDNC 1ETXA 2Z1DA 2Z33A 5L3DA 1Z3YA 1BM9A 5IYBJ 3JRGA 1XDSA 4L0YB 2OPTA 4BEHB 5C3EJ 2LBFA 2NAZA 5JR3A 1JTYA 2DA1A 4N0BA 2YSRA 2EFQA 3RPQA 3FBNB 4NC6A 3C2HA 4HA8A 3ZMDA 2HVQA 1GDTA 5FRMA 4HLXA 2OZUA 2E5ZA 2WBMA 2GZWA 1OYWA 4Y17A 1AKHB 3CP8A 3HSFA 1QHGA 4XRSA 4A0ZA 2NNYA 2HQ5A 2W7NA 2DOEA 5DTDA 1Y6IA 3ECHA 3HRTA 1BI2A 1WJBA 5D6EA 2FBKA 1Z7LA 3CUQA 1T95A 3HGGA 2XB5A 4A6EA 5KNLA 4HAMA 3S93A 1BI0A 5FKMA 4C3HJ 1S7OA 4LOCA 1MBKA 2QBYB 1K6YA 3I59A 1A36A 1IN4A 1FYLA 2QQ9A 1WSUA 3A0HC 4IEJA 1U2WA 2MGQA 4U87A 1R22A 2H6CA 5F64A 3RQ4A 4F55A 1MBHA 2ESNA 3DQVC 4MFEA 2E34A 5FFXA 1LJ9A 4FE7A 2HQRA 4Q4ZF 1EH6A 4BEHA 3JSPA 3QPTA 3BR5A 3RSNA 3VYSB 3OYAA 5IPAA 2XF6A 3SXYA 5GAHJ 4P9UA 1MH4A 2XRLA 5DUKA 4ZDPA 2VB6A 3RKWA 2FEZA 2CUFA 3ERED 5BQTA 4FX0A 2V26A 2BXYA 5M5XJ 2IT0A 3PIPF 2N8GA 3IKTA 1AKHA 4KJZA 1GHCA 4G12A 1I50J 1J9IA 4BL0B 3J81K 4XKWA 2B9SA 1B1BA 3DXJF 3CUQC 1FOWA 3AL0B 3HJEA 1ZGAA 3HHGA 3GTLJ 4OIOF 4O5VA 4BE2A 5A2QK 3QODA 2MFZA 1BN5A 5J40A 5GPAA 4HF0A 1XPXA 2DFIA 4I0BA 1QZZA 3DBRB 2JA5J 4UUVA 4HSRA 1RR7A 2FA5A 5GP9A 2CV2A 1BJZA 2VQCA 3BP8A 1FP1D 3HPGA 1OISA 4MQVA 2RVCA 3MMYB 3ZN1A 1MNEA 2QBYA 3BG5A 3MQ0A 4RAYA 3VODA 1M1EB 2K9LA 4JYKA 4AIJA 2QM3A 2OQRA 3WTYC 3PO3J 2BHZA 1USSA 5FLVA 2HOEA 4HG2A 2ZO4A 3OL3A 1B8IB 2DA6A 2PX9A 2VONA 2Z3YA 3A03A 4BXXJ 3EDPA 2KL4A 1S6LA 3LSJA 1DP7P 2UWMA 3DV8A 4RGUA 4QWQA 4GYIA 2CQKA 1VTNC 2JWTA 1KYWA 1FOYA 5KCMA 5K5RA 2R5YB 2EZKA 2DCEA 3GCMA 2F5DA 3BLYA 3HEFA 4M72A 3ZOBA 1WJDA 4CCNA 1HKSA 4RA2A 2BY0A 1RNLA 1ZRCA 4R8HA 3FISA 3C7JA 4XQFA 3GEZA 3FK7A 4YFKF 2D2WA 1JI8A 1HW5A 2A3SA 2QENA 2FXAA 3RDIA 5A2QZ 2VQLA 5E3LA 5J8CA 1D8JA 3L1PA 4WX9A 3LAPA 5GADJ 2LF7A 1WI9A 5KHDA 2R7VA 2JSCA 3A02A 4RAFA 4A3GJ 1UELB 1LFBA 4JOMA 4XL9A 1OCZH 4HF2A 1QVUA 3MZ8A 3G71I 3BDDA 1FBQA 2FRHA 1BW5A 4OIPF 4M3FA 2KKOA 4KMUX 3VOEA 4N4NB 4EJUA 2YU3A 1N77A 3J7YJ 1XSXA 4V2GA 4HQMA 2HYGD 4II3A 4ESFA 1D3YA 3DLAA 4GXOA 3ZXSA 4KT5C 3H3UA 5HOOA 2ACJA 1WI3A 1Z9CA 3IV5A 2DOFA 3KP5A 2EV0A 5HLIA 4LJZF 1W7PA 3I0TA 2BW3A 5HLTA 3DFGA 1YJNI 2R5YA 2H6BA 1HF0A 3KZZA 1OLTA 4L5IA 3BTIA 2AS5F 2VKEA 3BJAA 3JCUC 2MC4A 3TW7A 5LEKA 2EIKH 4AD9A 2KRHA 1Y8QB 1XGSA 2BVMA 3M8FA 1Z1DA 2MABA 4E7SA 2M7AA 3BCAA 2BY2A 2RV8A 3E5QA 3QPHA 1A04A 1UCRA 3WE2A 4XKCA 2DMQA 2QKMB 3LSTA 3LSKA 2PI0A 4HX7A 2PJPA 2ELKA 3LSMA 4UVAA 2COMA 4ETSA 4E70A 5KAIC 3BZ6A 4XLHA 3U9GA 1MBJA 2O03A 4I98B 5DV5A 4BAYA 3ZQCA 4G8XA 3HC7A 3KP4A 2VLAA 4E7IA 1FYKA 4HDUA 4II2A 3M8EA 4BQNA 2JSPA 2LY1A 4CA0A 3LNQA 2D45A 2NVXJ 2ZCWA 1UHWA 3ABKH 1SC7A 1MBEA 1D5YA 1ZRDA 3MEXA 1ZYRF 3C1DA 3CUOA 4XLFA 1IN8A 3E1SA 3EUHA 3V4GA 4EM1A 4U0YA 2XROA 4GCVA 1VQ4I 1PYVA 2KJCA 2M4KA 3KZIC 2CUEA 2GOMA 4L9NA 1QZYA 3M1EA 1T38A 5C4XJ 1VQ5I 3H35A 3WE3A 2K02A 4LB5A 5ICGA 4G7ZF 3S14J 1ZG3A 1MJ9A 2EFOA 4FISA 4NUBA 5C4JJ 1SFOJ 4Q5SF 1Z77A 3ZGKA 1ERDA 3OYHA 1BR1A 5L3CA 2R7UA 2DMUA 3OYKA 1G3WA 4EGYA 3CJNA 3WG7H 3WODF 4ZYAA 2K4JA 4NC8A 3MZHA 1R9TJ 3HOVJ 1Z0XA 2DFFA 2RNJA 3H9QA 4FHTA 1KU9A 4WF2A 3BT9A 2HTJA 4XSZF 4FT8A 5CJ9A 4XIDA 2DA5A 4IHSA 2R7SA 3HDDA 4BYYA 1ORKA 1IZ1A 2CJJA 1ZGWA 3AKZA 4IJAA 2HYFA 2ZSIB 4XRFA 1JKOC 1U5TB 3LOCA 2VASA 4IKFA 2VPLA 1RRJA 2LC2A 3OR2C 4A3BJ 2W4SA 2H09A 5BNGA 4BY7J 3MN2A 5DD8A 2HGCA 1BC8C 1LEAA 2WAQA 1JUSA 5IT3A 1MBGA 2CW8A 3FXQA 2X0LA 3EYIA 2UUZA 5D8LB 3K10A 3TMOA 3BCBA 1P2FA 3CTAA 1X2MA 2H1LA 1IG7A 1UFMA 5CPRB 5FKKA 2G0EA 1IRGA 1HDPA 3C2GA 3EUKL 4P1WA 1F9NA 3BQYA 2EK5A 2K3PA 1H0MA 4OINF 3GVAA 2XIGA 1VQOI 2D1HA 2EZIA 4MEXF 2IGMA 2HEOA 4DZPA 1SANA 3K2ZA 1W7PD 1LNWA 1R4NB 1XCVA 5ILUA 3KEYA 5E18F 2DMPA 2G7HA 5DCFA 1S3JA 3F8CA 5HDNA 2JA8J 5GAEJ 4KIFA 4IL6C 1AHDP 3RKQA 2R7TA 2P5KA 4RB2C 2VQHA 4L5EA 3VSKA 2ZB9A 2FOWA 1MIJA 3GLLA 3PQJA 1BOAA 1ETQA 3R0JA 2DFEA 5TJJA 2X9DA 1OPCA 2E5NA 1B6AA 2M3AA 1FIAA 5E20A 3CCUI 4EJWA 3PNYA 4WWCA 3SHFA 4CYDA 4KISA 5M5YJ 3KLNA 4JQFA 1GT0C 4YG2F 5M3FJ 3QP5A 1CGPA 4I76A 5B1AH 1SMTA 3IAM2 2DI3A 3I53A 3WHBA 4C3IJ 5EZHA 5J3LA 3PFIA 2CFXA 2CGPA 2ZFWA 2XPWA 5F0HA 1BOBA 2CU7A 3E97A 1TWGJ 1MMAA 3K1NA 1QPIA 3FM5A 1R00A 2ECBA 3HZJA 5F6FA 1PUFB 3HOZJ 1T2KA 2MD5A 2X6XA 4FCYA 3HG9A 3D0SA 2KIUA 2O9LA 3OYNA 4OOIA 3KP2A 3NARA 3JAMK 4E7HA 1OQYA 3DEUA 2VBWA 1ZARA 4E7LA 3MKWB 3F8FA 1YX5A 2K3FA 3CCMI 4A3LJ 1Z05A 5ICCA 3HUGB 1ZN2A 2BHYA 4G9YA 1R4MB 4IHYA 3ROUA 2KDZA 3GYHX 3FBIB 2BYVE 2X51A 2RGVA 2O8KA 4FETA 2LOOA 3RYRA 1WJFA 2EQRA 4P55A 1O7FA 2A05A 1FNNA 1YQAA 4RAZA 3J7AO 3CDLA 2E7XA 2E7WA 3WTSC 1VQMI 2R7OA 1OFCX 1CF7B 1FTZA 4XBFA 1RUOA 4GFBA 2VUMJ 4P5OA 3BPXA 1ZR4A 4OU0A 1T33A 2V1UA 3UNGC 5FLMJ 3OOUA 2NOGA 1S7EA 3TL4X 4X0GA 4KMFA 2F6CA 2X1DA 1OR7C 4MLOA 3ZQIA 2F4MB 1W0TA 3CMEI 3K4BA 2IS4A 3QWLA 1BI1A 1UMQA 2PEXA 4ENMA 1MJAA 4KT6A 1G3YA 5GAGJ 1MDMB 1PUFA 5LGTA 3W2WA 3FX3A 2VT3A 3T1BA 4IPAA 3KLOA 1IV8A 1SMYF 1SVLA 4FE4A 4NC7A 1KZHA 2E2HJ 2TCTA 2YS9A 5H6QA 6PAXA 4ZDLA 1VF9A 3A01B 2PMZN 3WU2C 1FJLA 3I9V2 4A3FJ 3L2UA 3CC2I 1D5VA 2ME0A 4LD5A 3JAMZ 3GMEA 4ZTFA 2PBIA 2NOJB 2A6EF 3BJOA 1HKQA 3OV8A 1TZLA 1BIAA 4J01A 5CYVA 1O57A 1OCPA 3ERMA 5M3MJ 1NK3P 3H9JA 3V42A 1GLNA 1CF7A 2VXDA 2Q8KA 1MZBA 1VQLI 1UAAA 3O8HA 1LKXA 4XM3A 2EIMH 2K85A 2KLOA 5LRRA 1UZCA 3GLXA 2WV0A 1QVTA 3IAS2 3LFUA 2P0WA 2OUMA 2V6CA 1WJ5A 1D0ZA 3VB2A 2IS2A 3S16J 1I27A 4B47A 3JRIA 2E1MC 3K1MA 2K27A 5BPDA 1Z67A 1NK2P 3Q0UA 1U0JA 5CVJA 2QWWA 3ESWB 3FXOA 4XLEA 2LY9A 4B8XA 1YW9A 2P5LC 3E6DA 1FYMA 3TDUC 4IOAF 3IL2A 1OCTC 4YELA 5DUIA 2W1OA 2YX7A 2EIJH 2I5UA 3GTOJ 4XK4A 2LLKA 1O3SA 4D0PA 2O3FA 3A01A 3S1NJ 3K1PA 5DYMA 2HDCA 1XMXA 1JHHA 2KIQA 4M9ZA 1FIPA 2GIZA 3FXJA 4KICA 5M5WJ 3LAJA 1O4XA 3E5XA 3KIOA 5FROA 4IHTA 1LFPA 2V7FA 4CDGA 3WTVC 2XF5A 2XSDC 1TQMA 1ZLJA 3IH4A 2HZTA 5H2FC 3L2QA 4A3DJ 1KQ9A 2FQ4A 2CWEA 4JX5A 1V5FA 3G73A 2KRFA 2DT7B 1R5HA 3FM3A 4PGGA 4XN3A 1MSFC 3BR1A 4CXFA 1G59A 2OTJI 2HPIA 2H94A 5EG0B 4CICA 2OCCH 4Y13A 3H1CA 2GLOA 1HC8A 2E1NA 1MJBA 2EFPA 4XLAA 1ZREA 5EDNA 1Y1WJ 1V55H 3D1NI 1ZG1A 3C18A 4MO7A 1Z91A 4ENKA 1P6RA 2K4BA 4ZYGA 1U8RA 1E3OC 2X6YA 1O3TA 3DEWA 1R23A 4M6VA 4AYBN 3G2BA 4ABZA 4C9YA 3GBGA 1LVKA 3BOQA 3FF5A 1XMAA 2M7BA 3K6GA 3R60A 2LDUA 2B7EA 5LLQA 4P96A 2KP6A 2Q2EB 4EGZA 1A5JA 5IOZA 4E7ZA 1XG1A 2MYSA 2ZNZA 4L5JA 3RYPA 2XASA 3MFKA 1ZHFA 2YUSA 3BTJA 3JREA 2NRAC 1X4PA 4AIDA 1LFUP 1JUMA 4ESJA 1WPKA 2GAUA 3PM1A 2CRGA 3S1RJ 3R0AA 5E79C 3HOUJ 1P92A 1P4AA 4A2UA 3BR3A 1KGSA 3SDBA 1WH5A 3QAHA 3FHNA 3GTKJ 4EQQA 1ETKA 4E7JA 1ULYA 3HSEA 4XRMA 3ZQHA 3AFHA 3RQIA 4A5NA 3COAC 2VJ5A 2PJRB 3HOYJ 3OS0A 5E3MA 1MD0A 2JUGA 1FMWA 1YYVA 4M74A 3H3ZA 1G4DA 2ZSHB 3SFZA 4GRIA 4M6YA 4XICA 3KP7A 2EZHA 1ZKGA 4WXDA 3RZOJ 1I6HJ 1HBXG 4ZYDA 5GTHC 1OCRH 3OYFA 1F36A 1Y56A 4IF4A 1X2NA 1X3UA 1W5TA 3DU6A 4YRVA 1TC3C 4CHUA 2JRTA 3J7AY 1I3AA 2QSFX 4JP0A 2HDWA 2PN6A 4PFPA 4BHBA 2FSWA 1X1BA 5L3BA 3PL8A 3BC8A 5FO5A 3FHZA 2L0KA 1D1CA 2O0YA 3HGYA 1MMSA 2R7XA 3DTKA 2XDVA 1WZ2A 3K9TA 2L01A 3HOXJ 3SDGA 3JRFA 4Y4RA 1VQKI 1J75A 3E6MA 3ZQ7A 2AQEA 2ZXHA 3J7ZI 4HF1A 2BE5F 1IRFA 4EVIA 2GXGA 2LKXA 3BG3A 2DLLA 2CFOA 4XLPF 4NDLA 3S1MJ 5EEHA 2VBXA 2L7ZA 4M9SA 2ID3A 1GV5A 3LWFA 1APLC 4LIUA 4ASNA 4EV0A 2PJRA 3BZCA 2LVSA 2M9HA 2YX4A 3ELKA 3K4KA 1G3SA 3GFLA 3ZRGA 2A69F 4RMNA 1D8KA 1TNSA 4MGRA 1HSJA 3BTCA 1H88C 2VODA 3DPTA 4UHTA 1FSEA 1YOVB 1W1WE 3REOA 3ZQQA 3T5XA 1RESA 3HOSA 1EH8A 3TP0A 3D5LA 3RJPA 1EJ9A 1TWHJ 4XN0A 1XGNA 5FKLA 1J59A 5D5WB 2CSOA 3IKVA 3ZQGA 4PZJA 4BXFA 2ZC2A 3PUFA 3DLLF 3DTIA 3WHCA 3JSOA 3CJRB 2QCOA 1JGSA 2GWRA 5LRSA 1O3QA 1TL8A 5EEGA 2ECCA 3HYIA 2JJ7A 4PJ0C 3PO2J 3K69A 4Y15A 2XAQA 4MFDA 3S17J 5DD4A 3RTRA 2JA2A 3HRSA 1YRNB 4A0YA 3F72A 2NVUB 2R3SA 2XV4S 4I2OA 1FY7A 5IT9K 2I8DA 4BUPA 3OYEA 3E0JB 3KP6A 3F6VA 2HQNA 2IA0A 2VI6A 1WJAA 3VYUB 3CMAI 3ZMSA 3HTSB 1QNTA 3VFZA 1RPWA 2L54A 3KCCA 3CO7C 2EH3A 3GTMJ 3SJMA 1FT9A 3CESA 4DOZA 3L00A 2KMUA 2JA6J 2NVQJ 5ERIA 4LLLA 2E1CA 3TOAA 2Z16A 5FGMA 4DYRA 5LHHA 2FX0A 2TRTA 2XGEA 5CVUA 2XC7A 1L3LA 2DXIA 1S8NA 2VQGA 2ZBKA 3JRBA 2W82A 2XSJC 1E3HA 1R58A 1Q1VA 4EJTA 5F04A 3I56I 3SEQA 1IN7A 1BR2A 5ED4A 2V9VA 5E1ZB 5K7ZA 2DT5A 3S2WA 4IQJA 1WH7A 1QA6A 2P5VA 4A5MA 1U78A 5K7HA 3L2VA 2CO5A 1AU7A 1OCOH 1YIOA 3L2WA 4UY8I 1T6SA 2J5OA 2X85A 3JTHA 1U9NA 2HU9A 3SZTA 3TP3A 4PJNA 2CQXA 2OF7A 2Y9YA 4A93J 4E6KG 2QUFA 2L7KA 4HBLA 5FB2A 1XDUA 2Y0SN 3MD2A 4MHGA 1B9MA 2EV5A 5KAFC 4P9FA 2WWYA 4UVBA 2V1NA 2DT6A 1B8IA 2DOAA 2QGUA 2Z99A 1XSDA 3HTUA 5E8IA 1PP7U 5IT9Z 2PLYA 1HXDA 3N4MA 4AU7A 5LHIA 3HL2A 3M9AA 3MWMA 2VE9A 3AL0C 3EYYA 5J1UA 3K70C 4CCLA 2M30A 2KT0A 3F21A 1SFUA 2DW4A 1MNDA 2L9RA 2M2EA 2GBYA 4B3AA 3N97A 2EV6A 1P9QC 2K9MA 3U1KA 3ML6A 5D5XB 1FWZA 3CCSI 5EGOB 4LK0F 5EYRA 4IX7A 2LF8A 4ON0A 1NHAA 3CLOA 1DUXC 1DPRA 1T8IA 5AIPA 1NG7A 2HZDA 3S3OA 4AUXA 1VI0A 3HKZA 3G3ZA 3OYJA 2ESHA 2QSGX 2HXOA 3BR0A 4EJOA 2FD5A 1J5YA 2F2EA 4QTRA 3PSFA 1GUUA 1OYYA 3HKZN 2GXBA 2RC4A 1X3ZB 4YIRX 3K2AA 1YIJI 2ZMEB 2CW0F 2HR3A 2DAOA 4Y3OA 1HQCA 3LFKA 1E17A 2CMPA 2VBYA 3CC4I 4CZCA 2VXZA 2KISA 2Q0OA 3RI4A 2R7DA 2BY3A 3LSPA 2STWA 4GO1A 1JKPC 4JBAA 1JE8A 2DA2A 1QHHD 3I58A 3EUAA 4DIQA 4Y33A 2OV7A 5F0CA 1SD4A 1S5LC 3LSIA 1HW2A 3HHHA 3ZMVA 3LMMA 3GUDA 4Z2YA 3WTTC 2O7OA 3M3YJ 1R6RA 4CZZA 2L9VA 1I39A 1TW3A 1I3QJ 3OIQA 1IC8A 1N75A 3M8JA 4J00A 2X48A 3L7WA 3VSLA 1FMVA 2M34A 4XLCA 4XOTA 4XRSG 3L09A 4WXCA 2V1XA 3ZQFA 4ZYEA 4RBOA 3K70D 5E3OA 2QQAA 3ZMUA 3T8RA 3P5JA 1X1AA 2DTZA 2ZMEA 3KETA 1VZ0A 1WGXA 3R6SA 2M8GX 3MKYB 3FXLA 2GXAA 1NTCA 2V1DA 4EJVA 2FU4A 3B6CA 1BIBA 1ETOA 1X3WB 2JVGA 1LDDA 3AG2H 2Z9OA 4AIHA 3EUHC 2BBYA 1SD6A 1F43A 3GTQJ 1FEXA 4F52A 1Y39A 4LG0B 4OWRB 4A6DA 3Q9VA 2DFHA 4YEJA 2P6SA 3BR6A 5IYDJ 5J6XA 4A3CJ 3BY6A 1WFXA 2CUJA 4DBQA 1B59A 2DYRH 1FBUA 2IP2A 4PFOA 1P4WA 2WY8Q 5CQEA 4AVZA 2IA1A 1T56A 2GM4A 4IHXA 4HRIA 3HB9A 2H1KA 4FASD 3GFJA 3FMSA 4M3DA 2GQQA 5ICEA 2AHQA 3V7CA 4BBSJ 1ZQ3P 3VYRB 5JFRA 1LQ1A 1B4AA 1JKRC 1KU7A 2EILH 4F92B 2VN2A 2CYYA 1JHFA 3JTGA 3SYTA 1YS7A 1ON1A 2CQQA 2LH9A 4RM2A 1IN5A 4C3JJ 4YFXF 5DS9A 2DPUA 4RGRA 4BHCA 3HOWJ 3L9FA 4H4KC 3EPZA 3TW6A 4E4HA 1IXRC 3OY9A 2R4GA 3SZPA 1W0UA 1X1PA 2F4IA 1BC7C 1E3PA 2DQLA 3K4CA 1U5TA 2V6EA 4EATA 5TISC 4S04A 5H20A 5CVVA 1OKRA 3RKXA 4D5FA 3HOTA 1S9HA 4DGWB 2DK5A 1IXSB 3A0BC 4KUMA 4UV8A 4ESBA 2MBFA 3QU3A 1X19A 2VBZA 4BDZA 3G1MA 1W5SA 5J4YA 3LQQA 2GA2A 4BY1J 1KU2A 2ETHA 3CCYA 2DDAA 1WVRA 5CVRA 1RZ4A 3CJQB 5J4VA 2EINH 2DODA 2MG4A 3W3CA 1IUFA 2IGNA 1UHMA 2W00A 2DA7A 2PQ8A 5E3NA 1QO0D 2ADUA 1EV7A 3M4OJ 2OC6A 2JK3A 2HOAA 2F4OB 2HNHA 3OYBA 1ZK8A 1LPQA 3QPLA 1X4OA 3GW2A 1X1DA 4PUSA 4LG3A 3W2VA 4BH9A 2NS0A 4HQEA 4NHJA 3QYBA 2STTA 1DU6A 4U7DA 1Y1VJ 2JZYA 3O6BB 4HYEA 5HS9A 3ZQLA 2IGOA 2M0CA 4RAGA 4A3JJ 3JW4A 4XKVA 4XONA 2FOKA 3FIWA 2OU2A 3GO5A 4UB6C 3OYMA 1ZELA 4BNCA 1U5TC 4JX4A 4IO9F 2RDPA 1AOYA 5H6RA 3V7SA 2QQBA 5CLSA 3X2QH 2R92J 4XKBA 2E1MB 5KK1A 3CCJI 1UJ8A 1QRYA 2A61A 2ZJ2A 2VT2A 2PMUA 2IEKA 1U3EM 3OSFA 2E2JJ 5K1YA 2MW8A 5J1YA 2HYJA 2W84A 2QEXI 1ZRFA 2JVHA 1T0FA 2ICWG 4DQ2A 2A6HF 3E7LA 2P7VB 3OYCA 2COBA 3KEQA 4HEA2 2QQ8A 4M71A 2X1EA 2QLZA 3FZVA 3RPUA 2KIFA 4CCOA 3IC7A 4A12A 3OOPA 4BE0A 2O5RA 4ZJZA 4N4OB 4RB0A 2LMDA 2R7FA 3V8KA 1R5GA 1SEUA 3TO7A 3G6EI 1VFCA 2LKPA 2LNBA 1RIOH 3CP2A 2OQGA 1WHUA 1U6GA 3E6CC 1FOXA 4UV9A 1WJCA 2DJIA 3PNTA 1U9OA 2PMZA 2X4HA 1OYIA 1SD5A 2KDOA 1WQ2A 4ZTJA 1I5ZA 4ENNA 1XGOA 3ZMZA 2FF4A 5CQGA 2Z2SB 3HUGA 2GIVA 3H5AA 1RUNA 4BHPA 3CCRI 1TNTA 1YJWI 2LR8A 3W6JB 1X1CA 4RLQA 3KYCB 4CCKA 1TWAJ 4A3KJ 3BR2A 3MKZA 3CF5F 4N9IA 3VEPA 4RGSA 1XC5A 5JHFA 2DYSH 3GTJJ 1T0FC 5C44J 3CDIA 2XGDA 3MKLA 1T08B 3NQOA 2FBIA 1ON2A 5LFAA 2YPRA 3Q5FA 1J09A 1TT5B 2D1VA 1OMIA 2M1BA 2JTVA 4BJ5C 4C30A 4L18B 5FLXK 2VJJA 3TGNA 5EEAA 1YG2A 3L2RA 4X1EA 5GPCA 2KQRA 2MH2A 1K78B 1IN6A 3F6OA 3WGGA 2PG4A 3GTPJ 4IHWA 4RM3A 5HDKA 4IXAA 3FXRA 1MDMA 4HX8A 5B1BH 2Z5UA 3OSGA 5DM7F 2AQFA 4HW0A 4QSHA 4HPQA 1V4RA 2LY2A 1J7KA 2M5WA 5FRNA 2GOXB 2IAIA 4HOBA 2M0MA 1YW8A 3NWTA 4HSTA 2W85A 2JUCA 1XGMA 1POGA 2Y2ZA 3QPSA 3QOEA 2RKHA 4IOCF 1B72B 4PGHA 3I64A 5JVGF 3WU0A 4LGWA 3IUOA 3OYIA 3S32A 3JRHA 1LEBA 3VPRA 3ABLH 1ONVA 1YE9A 3KYLA 5IY5H 1RC9A 4DNCA 2HOSA 3H9GA 5D4SA 4M3GA 4D7NA 1G8XA 3GF2A 2BVLA 1UG2A 2K40A 1YHQI 5DM6F 2UZKA 3CMMA 3ZPLA 2NVYJ 2W24A 4KN7X 3W2AA 3BQZA 1G6NA 1H8AC 2W25A 2HPMA 3A1YA 3HBLA 3ASOH 4LITA 1K83J 3P7NA 2JRMA 1GV2A 3DPLC 4AYBA 2QA4I 3BPVA 1K78A 1F1ZA 2M8EA 5FLXZ 2E35A 2VIXA 1TW2A 4EM0B 1RR8C 4QIWN 1XX5A 3HXLA 2LG4A 1GXQA 4L9JA 5BMZA 3RCOA 4LIVA 4M3BA 1EH7A 5K7FA 3WTZA 1TTYA 3GZ6A 4D9JA 1ZLKA 2XGCA 4NQWB 4AVPA 2ELJA 5IP6A 1YX3A 2OCEA 2ZXIA 3C2BA 3CMYA 3RZDJ 3DEEA 3TOBA 3IRQA 1BI3A 2WY7Q 4HNUA 1IRXA 4OMZA 1QU3A 2IW5A 2KZVA 4WXHA 1BL0A 1R71A 3I3LA 4MTDA 2WAEA 1Z6RA 1HW1A 1MGTA 1RKWA 4DYCA 4LB6B 3K4MA 2P6TA 5ILSA 3CUQB 1QQIA 1FBSA 4G94A 4ZDOA 2VKDA 1TP4A 3F8BA 2F5CA 2XRNA 4RLFA 2DBBA 2MH9A 3IWZA 2BZTA 3I59B 5EG0A 1R5ID 4MNUA 2XB0X 5CVIA 3JRCA 4IVNA 4NNJA 1IDYA 1ENHA 2HVRA 4BXUA 5J1RA 4ANJA 3PUBA 2K7LA 4PSWA 4AWXB 2FMYA 3Q0VA 3OS1A 2ME6A 4UB8C 3ZN0A 2HWVA 2DA3A 3DPUA 3D5SC 3NAUA 1TQIA 1IF1A 1XTAA 2ZFUA 2VPRA 3I54A 1JXSA 4CO8A 4FTHA 3PIOF 2ZJQF 3LQRA 1H9TA 2Q2EA 1NH3A 4ZZLA 1YFHA 4NQWA 5IP9J 4BQAA 1MMNA 3MVPA 2OTLI 2FNPA 1G3TA 2ELHA 1J2XA 2YR2A 2I10A 2EB7A 5J8FA 1JT0A 2ISZA 3OL4A 5F1RA 2Y30A 2V4JC 2DA4A 3BZKA 1YTYA 3CD6I 3ASNH 3SEZA 4Y7NJ 3FDYA 1HSTA 3IH3A 2UXXA 5DEQA 2JPBA 5LD2C 1RI7A 4I99C 2QF7A 2DMTA 4Y52J 4XORA 1UB9A
chains in the Genus database with same CATH topology
4BQQA 2E5NA 2M3AA 2K5CA 3OYLA 4IX7A 3DKYA 2IGKA 4B48A 1TT0A 3PNYA 1NG7A 2HZDA 2WB1A 4KISA 3S3OA 3HKZA 3KX2A 3OYJA 4JQFA 1UG0A 4CCMA 4B44A 1W36D 4BACA 3PSIA 3IAM2 3PSFA 2HVSA 2CS3A 1BOBA 4BJTA 4Y3OA 2L9NA 4KITB 2CMPA 2WADA 2RNGA 1MMAA 4CZCA 4U7BA 2VXZA 4C2UA 4DJAA 2RREA 3BG6A 2X6XA 3HG9A 5HVQC 3OYNA 3HPHA 1QHHD 4E7HA 3DTEA 4XR6A 4IQ4A 2R7QA 3EUAA 3K4JA 4XNFA 4DIQA 2LBFB 4E7LA 3MKWB 3K4LA 2OV7A 4Y33A 1YX5A 2WAFA 2Q1ZB 3LSIA 1D0XA 3HUGB 4E7KA 1KONA 2KHMA 3LMMA 3ZCOA 3U21A 3FBIB 3OWTA 4CH7A 2X51A 4OAYA 3RPUD 3OS2A 4FETA 2LOOA 4ITVA 1WJFA 1R6RA 5HNFA 1Z3XA 4F3QA 2R7OA 3OIQA 1WJEA 1N75A 2IS6A 4BQOA 3M8JA 4J00A 1DQUA 4P5OA 3A2KA 1V5EA 3VSLA 1FMVA 3H5RA 4XLCA 1DGWY 3S3NA 4PSXA 4XOTA 3UNGC 1MW7A 3LSGA 3OOUA 3TL4X 3K70D 4X0GA 1X1AA 2F6CA 3UR3C 2X1DA 1OR7C 4MLOA 1VZ0A 3DU5A 4IZZA 2F5VA 2A5WA 3K4BA 3VYTB 2IS4A 4B43A 3MKYB 2L2OA 1EA3A 4QPOA 4KT6A 4BU2A 4D1QA 4BDYA 3S3MA 1AA7A 3W2WA 2JVGA 1Z21A 3EUHC 2Z1DA 3IP4B 1Z3YA 3ONQA 4F52A 2BW3B 4OWRB 2Y0SA 4NC7A 4YEJA 4OAZA 4BEHB 3S8PA 2LBFA 1WFXA 2CUJA 4DBQA 4ZDLA 3FBNB 3C2HA 3I9V2 4R79A 3L2UA 4PFOA 2HVQA 2WY8Q 5FRMA 5CQEA 4AVZA 2KRCA 4ZTFA 2E5ZA 2WBMA 2NOJB 2FUG2 4B3XA 3ZR8X 3CP8A 4HRIA 1QHGA 3DWLE 4FASD 1TZLA 4J01A 2A6TA 2W7NA 3H9JA 1MMDA 1GLNA 3V42A 1Y6IA 2VXDA 3VYRB 1WJBA 1UAAA 2UV1A 1LKXA 4XM3A 4F92B 2KLOA 2IXSA 1SFKA 1Z7LA 2VL8A 1T95A 3SYTA 2LH9A 4RM2A 3IAS2 1SAUA 3EPZA 3LFUA 4H4KC 1MMGA 3S93A 2P0WA 4E4HA 5KNLA 3OY9A 2OUMA 2R4GA 3PFYA 1WJ5A 1D0ZA 1K6YA 1LDKB 2F4IA 2IS2A 3K4CA 4B47A 2V6EA 2E1MC 2VJ4A 4EATA 3OYGA 4U87A 1U0JA 3HOTA 2CW7A 4XLEA 2CV1A 1S9HA 4DGWB 3RQ4A 4F55A 3DQVC 3CF2A 1X19A 4BDZA 3VWBA 4BEHA 1N78A 3RSNA 3VYSB 2R7RA 3OYAA 2XF6A 4YELA 2W1OA 3D5RC 3CJQB 1DP3A 4ZDPA 2VB6A 3W3CA 2IGNA 2W00A 2V26A 5FROA 1LFPA 2OC6A 4KJZA 2V7FA 3PJRA 2XF5A 2HNHA 4BL0B 3OYBA 4XKWA 1X4OA 3L2QA 3K4NA 1X1DA 4BGDA 4PUSA 4LG3A 3W2VA 4DBRA 3AL0B 1V5FA 3QYBA 2DT7B 4XN3A 3OMYA 4BE2A 2IGOA 3QODA 3H0DA 2MFZA 3OIPA 2HPIA 1G59A 4XKVA 4XONA 4XLAA 3OYMA 1ZELA 4HSRA 2CV2A 2VQCA 2X6WA 3HPGA 4ZC3A 3MMYB 1MNEA 2E1MB 4PJMA 4XKBA 4CUGA 3NWSA 2K9LA 2X6YA 3QYFA 2CH0A 3G2BA 4C9YA 3GBGA 1LVKA 2RQQA 2M7BA 2JVHA 3K6GA 4HG2A 3OYCA 4HEA2 3OL3A 2KP6A 2Q2EB 4QPQA 3N05A 4E7ZA 2MYSA 2X1EA 4BS9A 2KL4A 4CCOA 1X4PA 2UWMA 4BE0A 2O5RA 3M1CA 4ZJZA 2R7WA 4N4OB 2VKHA 4XMYA 3CP2A 5KCMA 2M4GA 3F9KA 2DCEA 1WJCA 2DJIA 3PNTA 3BLYA 2PMZA 3SDBA 2KDOA 3FHNA 4ZTJA 1WJDA 4E7JA 4CCNA 5CQGA 3AFHA 2Z2SB 4C2TA 1NG6A 2VJ5A 2PJRB 3H5AA 3OS0A 4XQFA 2JUGA 1FMWA 1X1CA 4RLQA 2ZSHB 4CCKA 1JI8A 2HQAA 4GRIA 3MKZA 1V5GA 2VQLA 5JHFA 1T0FC 5KHDA 2R7VA 3OYFA 1Y56A 3DU6A 1UELB 4YRVA 2KPMA 4JOMA 4XL9A 5LFAA 3J7AY 1J09A 4BJ5C 4C30A 2HDWA 2VJJA 4PFPA 5HNHA 2QKLB 1X1BA 4N4NB 3PL8A 3BC8A 1N77A 3L2RA 3VDXA 2X1CA 1D1CA 4II3A 2KQRA 2WA0A 3DLAA 3ZXSA 2R7XA 3DTKA 2E60A 2XDVA 5HOOA 4RM3A 4Y4RA 2AQEA 2ZXHA 3PNVA 3SZGA 2XF7A 2AQFA 5HLTA 2BW3A 4HPQA 2L9SA 2LY2A 2CFOA 1OLTA 5FRNA 2MD0A 3A4CA 2GOXB 2MC4A 4PJJA 4LIUA 2M0MA 2PJRA 3NWTA 4HSTA 2KRHA 2BVMA 3K4KA 3QOEA 3ZRGA 2MABA 4RMNA 4E7SA 2M7AA 3BCAA 3DPTA 3IUOA 4XKCA 3OYIA 3S32A 2L5QA 2QKMB 3LSKA 3ZQQA 3HOSA 4HNTA 1YE9A 3LSMA 3KYLA 3D5LA 1D0YA 3H9GA 4XN0A 3TBIA 1G8XA 3OYDA 4XLHA 2BVLA 4BXFA 3CMMA 4BJ6C 3DTIA 3HC7A 2VLAA 4E7IA 3W2AA 3CJRB 2HPMA 4II2A 4BQNA 3A1YA 2JSPA 2LY1A 4CA0A 4LITA 3DPLC 4AYBA 4PJLA 4G6TB 2CV0A 4XLFA 1BR4A 2VIXA 3RTRA 2BOLA 2JA2A 3E1SA 1E0EA 1D1AA 1PYVA 2M4KA 2GOMA 3BG7A 2LG4A 3HXLA 2I8DA 4BUPA 3OYEA 3RCOA 3E0JB 3LL7A 4LIVA 3H35A 2IS1A 4NUBA 1WJAA 3ZGKA 3VYUB 4D9JA 1ERDA 4NQWB 2ELJA 3OYHA 1YX3A 2ZXIA 1BR1A 2R7UA 3DEEA 3OYKA 2WY7Q 4HNUA 1IRXA 4ZYAA 1QU3A 4NC8A 4CSWA 2KZVA 3CESA 4DOZA 3I3LA 2KMUA 1W36C 4F93B 3H9QA 2WAEA 3K4MA 2Z16A 4ZDOA 2VKDA 2R7SA 3FKJA 3DKXA 1DGRM 4RLFA 2XC7A 2DXIA 4BE1A 2VQGA 2W82A 2XSJC 3AKZA 3SEQA 3OR1C 1BR2A 2ZSIB 4NNJA 4IQJA 2VASA 2HVRA 4IKFA 2VPLA 3L2VA 4ANJA 3PUBA 4PSWA 2LC2A 3OR2C 2W4SA 4CCJA 3L2WA 1D1BA 2X85A 2HU9A 2LYCA 4PJNA 3OS1A 2VJIA 2WAQA 3CZ6A 3DPUA 2CW8A 3D5SC 2L7KA 4E6KG 2UUZA 2ZFUA 3K10A 2CUZA 4PK4A 3MD2A 1PJRA 3TMOA 3BCBA 5CPRB 3LSHA 2V1NA 2DT6A 2DOAA 5CKTA 3C2GA 3EUKL 4P1WA 4XOPA 1MMNA 4F91B 2K3PA 2V9KA 4AU7A 2IGMA 3OL4A 3HL2A 3KEYA 2V4JC 3AL0C 2LRDA 2XAUA 3K70C 3SEZA 3FDYA 4CCLA 5LD2C 3QYEA 1HA8A 1MNDA 2R7TA 2LREA 3H5NA 2VQHA 5TGTA 4XORA 3VSKA 1P9QC 2K9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQW B;  2Q1Z B;  2Z2S B;  3HUG B; 
#chains in the Genus database with same CATH topology
 5DDG A;  4BQQ A;  3RKY A;  1ZGJ A;  2K5C A;  3RIR A;  3OYL A;  3DKY A;  1SFE A;  1TT0 A;  4Q47 A;  2R7Z J;  1W5C C;  3M07 A;  2W57 A;  3S2H J;  3H0G J;  1UG0 A;  4CCM A;  4B44 A;  2QZ8 A;  2M45 A;  4BAC A;  3PSI A;  1N25 A;  1ZG5 A;  3U2R A;  2HVS A;  2L4M A;  4S0H B;  2JN6 A;  1SVM A;  3ABU A;  4BJT A;  1LE8 B;  2G9W A;  1UST A;  2CQ7 A;  2OBP A;  4YII A;  4KIT B;  4DW6 A;  5HLH A;  2JA7 J;  2NVT J;  4C2U A;  4DJA A;  3DCF A;  3FK6 A;  5B66 C;  1I1S A;  3QU6 A;  2FJ1 A;  2V9P A;  3FKI J;  3HRM A;  2UXN A;  5HVQ C;  5K5O A;  4UNO A;  3S15 J;  5HLG A;  1AWC A;  2K9S A;  4KIG A;  4XR6 A;  3G4S I;  1TWF J;  4IQ4 A;  3TDZ C;  2R7Q A;  3K4J A;  1V3F A;  2KFD A;  3K4L A;  2FQ3 A;  2WAF A;  1VQ8 I;  3C3W A;  5JHU A;  1FTT A;  3GWZ A;  3WG9 A;  4W97 A;  4V2F A;  2NNN A;  2XAF A;  2KHM A;  2AXL A;  2B0L A;  1PVE A;  1QZE A;  1C0W A;  3OWT A;  5IP7 J;  3B6A A;  1H89 C;  2A07 F;  1ITY A;  4ITV A;  5HNF A;  2CG4 A;  3I55 I;  1F4K A;  2LTP A;  4D5C A;  2CQN A;  2NXN B;  1P7I A;  4MEY F;  4ZZD A;  2M87 A;  1WJE A;  2VC0 A;  3NRV A;  1V5E A;  5D5U B;  3H5R A;  1TBX A;  4PSX A;  3LSG A;  4JX6 A;  3O8G A;  3I4P A;  4KIB A;  3DBH B;  3G1L A;  3UR3 C;  1ODD A;  3GZN B;  1LE8 A;  3DU5 A;  2XVC A;  3GZ5 A;  4R1H A;  2F5V A;  3VYT B;  4IZZ A;  1KYZ A;  4B43 A;  5EF6 A;  4QPO A;  4BU2 A;  4D1Q A;  4BDY A;  1HCR A;  2P81 A;  3LSR A;  2L02 A;  1AA7 A;  1VND A;  1Z21 A;  1XSV A;  3EQL F;  3IP4 B;  3ONQ A;  1W7P B;  2TDX A;  2BW3 B;  3PQK A;  5L3E A;  2Y0S A;  2JQ7 A;  3BG9 A;  4OAZ A;  1YRN A;  1LB2 A;  3S8P A;  2G7U A;  1JUP A;  2E2I J;  4OIQ F;  5HS8 A;  5E1X A;  3V7R A;  2D5V A;  3KPH A;  1S7A A;  1RKT A;  5D5V B;  3J81 Z;  1IRZ A;  1GVD A;  3CJT B;  4R79 A;  5LBQ A;  5J47 A;  1QPM A;  2KRC A;  5ILV A;  1G2H A;  1F5T A;  4PDK A;  4I09 A;  1OCC H;  2JPC A;  2FUG 2;  4CGZ A;  2XUB A;  1ETV A;  3ZR8 X;  3O3K A;  4B3X A;  3DWL E;  3HM5 A;  3W6K B;  3F23 A;  2A6T A;  2O6G E;  1Y0U A;  1MMD A;  2EA2 A;  1KU3 A;  1HKT A;  3JR9 A;  2UV1 A;  4KA4 A;  1JGG A;  2IXS A;  4G6Q A;  1SFK A;  2VL8 A;  2E71 A;  1VQN I;  4QLC U;  1WWX A;  1K79 A;  3IH2 A;  5LHG A;  1X58 A;  1SAU A;  2IS6 A;  1HDD C;  1MMG A;  1CQT A;  3PFY A;  3O2P E;  1YIT I;  1LDK B;  3B02 A;  2VJ4 A;  4A3E J;  1B9N A;  4M73 A;  3OYG A;  4KFC A;  1S29 A;  3KFW X;  3K7A J;  4BKX A;  2CW7 A;  3Q9S A;  2DMN A;  4RB3 C;  2CV1 A;  1BJA A;  4L9T A;  3CF2 A;  2JT1 A;  1ZTR A;  1BBY A;  3VWB A;  2DK8 A;  3P9C A;  1N78 A;  4HV5 A;  2R7R A;  1GXP A;  4M6X A;  3D5R C;  3H92 A;  1DP3 A;  2KIM A;  4RB1 A;  2L4A A;  4OIR F;  3CCQ I;  1R1T A;  4KN4 X;  1XD7 A;  1TLH B;  5LEJ A;  1IDZ A;  4N9H A;  4S05 A;  1R1V A;  1SVO A;  2XAG A;  3FXK A;  1R36 A;  4A3M J;  2VKV A;  2EA4 A;  2EFN A;  3PJR A;  1DPU A;  4U0V A;  5D8K B;  1A6Q A;  5D6F A;  1MSE C;  1Y8R B;  3K4N A;  4BGD A;  2Y9Z A;  2B63 J;  4HZF A;  4DBR A;  5FKN A;  3Q0W A;  4XSX F;  3F22 A;  2ZJR F;  1LVA A;  1MH3 A;  3OMY A;  3ISP A;  2LKS A;  1W4M A;  3H0D A;  3OIP A;  4PCQ A;  4AM3 A;  2HI3 A;  2DO7 A;  2P7C B;  2PFB A;  4FX4 A;  5KVR A;  4ZC3 A;  2X6W A;  4PJM A;  4CUG A;  1YO5 C;  2K86 A;  3NWS A;  3IRR A;  1SD7 A;  5EGO A;  3QYF A;  1XCB A;  1UHS A;  2EPF A;  2CH0 A;  4IRG A;  2EBI A;  1A6I A;  4V19 K;  5LGU A;  3FMR A;  5F0F A;  2LFB A;  2RQQ A;  3QP6 A;  4YIF A;  3R4K A;  3FXM A;  1R1U A;  4G6D A;  4QPQ A;  3H3V K;  3N05 A;  2BXZ A;  3ABT A;  1IUY A;  2GA1 A;  1K6O A;  3ULQ B;  2LD5 A;  4BS9 A;  3J80 K;  2HS5 A;  1JTX A;  1VQ9 I;  5DCM B;  1STZ A;  3M1C A;  2R7W A;  2KZG A;  2XAH A;  2VKH A;  3TO9 A;  2LK2 A;  4XMY A;  1REP C;  1FX7 A;  4G7H F;  5BOX A;  2M4G A;  3F9K A;  3IWF A;  3CCL I;  2H8W A;  1JKQ C;  4O3M A;  1R49 A;  2V79 A;  2P8T A;  4HLY A;  2DDB A;  3V8L A;  4L0Z B;  2A68 F;  4CYC B;  2FML A;  4W1U A;  3T8T A;  1U8B A;  4C2T A;  1NG6 A;  2IPQ X;  5FD6 A;  4A0X A;  1OJL A;  1Z6T A;  1A35 A;  2IRF G;  2YU9 J;  2DPD A;  2LSO A;  2DQR A;  2HQA A;  2WV1 A;  1HLV A;  2DN0 A;  5EJC A;  1V5G A;  2VC1 A;  3KE2 A;  4GDF A;  1DU0 A;  5E1W A;  5JI6 A;  4ZH4 F;  3GTG J;  2KPM A;  2XKO A;  3ZMT A;  2Y69 H;  2HOT A;  2VOP A;  2WAQ N;  4WK8 F;  1YS6 A;  2ZME C;  3AG3 H;  4LLG F;  5HNH A;  2QKL B;  5AON A;  1E2X A;  3Q3S A;  3VDX A;  4Z6Y A;  2X1C A;  2BGC A;  2RAE A;  4HNV A;  1PUE E;  2H27 A;  2OJE D;  2WA0 A;  3P9I A;  3NEU A;  4X6A J;  2E60 A;  2AXT C;  1IW7 F;  5DCM A;  4GYG A;  4AIK A;  5HDG A;  2Y0M A;  5IYC J;  1K4S A;  3PNV A;  4UVC A;  3SZG A;  2EFW A;  3MZY A;  2XF7 A;  5GTI C;  4LG0 A;  4C2M J;  3TKY A;  2QSH X;  2L9S A;  3J80 Z;  2XPU A;  1O3R A;  2IA2 A;  5E17 F;  3KYD B;  2MD0 A;  3A4C A;  3AAF A;  4PJJ A;  3E5U A;  3SQN A;  1BW6 A;  2F48 A;  4CYC A;  3F3X A;  1Y0N A;  3FXU A;  3CCE I;  2KJB A;  3KEO A;  3WGI A;  4TV7 A;  3S2D J;  4I0A A;  1K7A A;  1P7J A;  5E8G A;  1VQ6 I;  1YJ9 I;  3FMQ A;  4AC0 A;  4DYQ A;  3G1O A;  3BJ6 A;  3TO6 A;  2L5Q A;  5IOY A;  3KZY A;  4O6J A;  4HNT A;  1D0Y A;  1WCM J;  3TBI A;  3OYD A;  3L2C A;  1K4T A;  4GGG A;  2RQP A;  2BY1 A;  1KA8 A;  3HSR A;  1FPQ A;  2RN7 A;  5FKO A;  4J19 A;  2AO9 A;  2ZXJ A;  4BJ6 C;  2BV6 A;  3K0L A;  5BS6 A;  1OR7 A;  3DBL B;  3WGH A;  2EJR A;  4A69 C;  2Y75 A;  4FQG A;  3ZP5 A;  1XMK A;  4UUS B;  4PJL A;  4G6T B;  2CV0 A;  4U88 A;  4YFN F;  1BR4 A;  3BWG A;  4IHV A;  4RDU A;  2BOL A;  2O8X A;  3ABM H;  5HOD A;  2ZXW H;  1T98 A;  3CO6 C;  1D1A A;  1E0E A;  2K9Q A;  3BG7 A;  1FZP B;  1FC3 A;  2L3D A;  3LL7 A;  2P4W A;  3MAJ A;  2PMH A;  4RGX A;  1IAW A;  2IS1 A;  2MA3 A;  2Y31 A;  1IO2 A;  3U1D A;  2O61 A;  2ID6 A;  4ENJ A;  4LLN A;  2E19 A;  3FWE A;  2J5P A;  3S1Q J;  1ACI A;  1P4X A;  2A5Y B;  3WTU C;  3JRA A;  4I01 A;  4CSW A;  3CC7 I;  1TQP A;  1A31 A;  4H0E A;  4UUT A;  3SFI A;  1W36 C;  4F93 B;  2MSY A;  1XB4 A;  3WU1 B;  2HKO A;  2K9N A;  3F8M A;  5TRD A;  3JRD A;  3FKJ A;  3DKX A;  1WRJ A;  1DGR M;  3QQA A;  4ZYH A;  5D4R A;  1ZH5 A;  1XN7 A;  1YW7 A;  4BE1 A;  2EWN A;  2VE8 A;  1L0O C;  4F7Z A;  3GX4 X;  3GFM A;  3EET A;  1MNM C;  3OR1 C;  5F27 A;  1VQ7 I;  4NBQ A;  5B5E C;  2VOO A;  3WTW C;  3BRO A;  2R5Z B;  2QYO A;  3P9K A;  2ZKZ A;  3KP3 A;  1QBJ A;  2OA4 A;  2WTE A;  1YLF A;  2BEO A;  2EZL A;  1JT6 A;  4LK1 F;  1D1B A;  4Q48 A;  4CCJ A;  4IRH A;  4UUS A;  3QOP A;  3CCV I;  5BPI A;  2LYC A;  2VJI A;  3CZ6 A;  5B3S H;  2C6Y A;  2IJL A;  3DP7 A;  4HX4 A;  2R0Q C;  1VQP I;  3LA2 A;  2CUZ A;  4PK4 A;  1PJR A;  1ZAO A;  1RET A;  1QGP A;  2LP0 A;  1ETW A;  3OIO A;  3LSH A;  5L3F A;  5CKT A;  3WTX C;  1ETY A;  1O7L A;  1WKM A;  9ANT A;  5F08 A;  2MC3 A;  5AIQ A;  4XOP A;  3DKW A;  4A3I J;  4F91 B;  1JJ6 C;  2V9K A;  3HIF A;  4G7O F;  1LUJ B;  2Y48 A;  2DTR A;  3M7G A;  1V54 H;  4JK1 X;  2E36 A;  2HTS A;  2IBD A;  2LRD A;  2XAU A;  1GVJ A;  2W48 A;  3BTL A;  1TWC J;  4D7M A;  4I7H A;  3QYE A;  1YI2 I;  2HDD A;  1HA8 A;  2LRE A;  3H5N A;  1FP2 A;  1I1G A;  5TGT A;  1SAX A;  2NS8 A;  3CQZ J;  2ZNY A;  4HDV A;  2R93 J;  1Z7U A;  2H8R A;  2WC2 A;  2DJN A;  2XGX A;  4IRI A;  2E1O A;  4WCG A;  2QVO A;  2XAJ A;  2F5E A;  3GXO A;  2IGK A;  3V8J A;  4B48 A;  2R5Z A;  2XHK A;  4M9X A;  4B09 A;  5HS7 A;  1EKE A;  2NS7 A;  2WB1 A;  3DF8 A;  3KX2 A;  5JLW A;  4MTE A;  2MLG A;  1KQ8 A;  5L3G A;  4EEF G;  1H9G A;  2HKX A;  1W36 D;  3H36 A;  3F8N A;  2XKP A;  2WB1 N;  3CLQ A;  1K61 A;  3I4N J;  2X6O A;  2CS3 A;  4KNY A;  1KQ0 A;  1BA5 A;  4EMS A;  2L9N A;  3LA7 A;  2ISY A;  1FOK A;  2WAD A;  3AG1 H;  1HOM A;  2L7F P;  2RNG A;  2OZ6 A;  4U7B A;  4XLN F;  2OD5 A;  1LDJ A;  2RRE A;  3I71 A;  3W6V A;  3BG6 A;  5ICF A;  5JVT A;  3CDH A;  4KYW A;  2NYX A;  3HPH A;  3E3V A;  4LMY A;  3E6B A;  3DTE A;  4B4C A;  1DDN A;  1R7J A;  1IGN A;  4XNF A;  2LBF B;  1PP8 F;  3B73 A;  2HFH A;  3LA3 A;  1IJW C;  2Q1Z B;  4L9V A;  3TQN A;  1EF4 A;  1D0X A;  2OAZ A;  4B1R A;  4E7K A;  3GFI A;  4I6Z A;  1FLI A;  3UKG A;  3T0Y A;  1KON A;  5FD5 A;  3TED A;  1SFX A;  2IVM A;  3IHU A;  3ZCO A;  3U21 A;  1S72 I;  4CH7 A;  4MIM A;  4OAY A;  3RPU D;  3OS2 A;  1I6X A;  2HXI A;  2XPV A;  2DU9 A;  4DZJ A;  4KDP A;  4OMY A;  1Q1H A;  4RS8 A;  1Z3X A;  4F3Q A;  5FFZ A;  1B72 A;  5F1J A;  1J0R A;  5LGN A;  2FNA A;  3I5U A;  4U0W A;  4BQO A;  1T39 A;  3A2K A;  1DQU A;  4HV6 A;  4MQ9 F;  5K5Q A;  2ZJP F;  1DGW Y;  3QRF F;  3S3N A;  3I4M J;  1FSH A;  1ZR2 A;  1MW7 A;  5EZG A;  4M3E A;  3MCZ A;  4EM2 A;  1IV6 A;  2FE3 A;  1XS9 A;  2F5F A;  3F0C A;  2FBH A;  5JLX A;  1IXC A;  3HRU A;  5FJ8 J;  3ECO A;  1MBF A;  1JJ8 C;  4NB5 A;  1MKM A;  4LFU A;  4I02 A;  2JMW A;  4K2E A;  2A5W A;  2MLK A;  4UXN A;  4BBR J;  2L2O A;  1EA3 A;  2L7M P;  3AG4 H;  3R61 A;  3S3M A;  1PDN C;  1ETX A;  2Z1D A;  2Z33 A;  5L3D A;  1Z3Y A;  1BM9 A;  5IYB J;  3JRG A;  1XDS A;  4L0Y B;  2OPT A;  4BEH B;  5C3E J;  2LBF A;  2NAZ A;  5JR3 A;  1JTY A;  2DA1 A;  4N0B A;  2YSR A;  2EFQ A;  3RPQ A;  3FBN B;  4NC6 A;  3C2H A;  4HA8 A;  3ZMD A;  2HVQ A;  1GDT A;  5FRM A;  4HLX A;  2OZU A;  2E5Z A;  2WBM A;  2GZW A;  1OYW A;  4Y17 A;  1AKH B;  3CP8 A;  3HSF A;  1QHG A;  4XRS A;  4A0Z A;  2NNY A;  2HQ5 A;  2W7N A;  2DOE A;  5DTD A;  1Y6I A;  3ECH A;  3HRT A;  1BI2 A;  1WJB A;  5D6E A;  2FBK A;  1Z7L A;  3CUQ A;  1T95 A;  3HGG A;  2XB5 A;  4A6E A;  5KNL A;  4HAM A;  3S93 A;  1BI0 A;  5FKM A;  4C3H J;  1S7O A;  4LOC A;  1MBK A;  2QBY B;  1K6Y A;  3I59 A;  1A36 A;  1IN4 A;  1FYL A;  2QQ9 A;  1WSU A;  3A0H C;  4IEJ A;  1U2W A;  2MGQ A;  4U87 A;  1R22 A;  2H6C A;  5F64 A;  3RQ4 A;  4F55 A;  1MBH A;  2ESN A;  3DQV C;  4MFE A;  2E34 A;  5FFX A;  1LJ9 A;  4FE7 A;  2HQR A;  4Q4Z F;  1EH6 A;  4BEH A;  3JSP A;  3QPT A;  3BR5 A;  3RSN A;  3VYS B;  3OYA A;  5IPA A;  2XF6 A;  3SXY A;  5GAH J;  4P9U A;  1MH4 A;  2XRL A;  5DUK A;  4ZDP A;  2VB6 A;  3RKW A;  2FEZ A;  2CUF A;  3ERE D;  5BQT A;  4FX0 A;  2V26 A;  2BXY A;  5M5X J;  2IT0 A;  3PIP F;  2N8G A;  3IKT A;  1AKH A;  4KJZ A;  1GHC A;  4G12 A;  1I50 J;  1J9I A;  4BL0 B;  3J81 K;  4XKW A;  2B9S A;  1B1B A;  3DXJ F;  3CUQ C;  1FOW A;  3AL0 B;  3HJE A;  1ZGA A;  3HHG A;  3GTL J;  4OIO F;  4O5V A;  4BE2 A;  5A2Q K;  3QOD A;  2MFZ A;  1BN5 A;  5J40 A;  5GPA A;  4HF0 A;  1XPX A;  2DFI A;  4I0B A;  1QZZ A;  3DBR B;  2JA5 J;  4UUV A;  4HSR A;  1RR7 A;  2FA5 A;  5GP9 A;  2CV2 A;  1BJZ A;  2VQC A;  3BP8 A;  1FP1 D;  3HPG A;  1OIS A;  4MQV A;  2RVC A;  3MMY B;  3ZN1 A;  1MNE A;  2QBY A;  3BG5 A;  3MQ0 A;  4RAY A;  3VOD A;  1M1E B;  2K9L A;  4JYK A;  4AIJ A;  2QM3 A;  2OQR A;  3WTY C;  3PO3 J;  2BHZ A;  1USS A;  5FLV A;  2HOE A;  4HG2 A;  2ZO4 A;  3OL3 A;  1B8I B;  2DA6 A;  2PX9 A;  2VON A;  2Z3Y A;  3A03 A;  4BXX J;  3EDP A;  2KL4 A;  1S6L A;  3LSJ A;  1DP7 P;  2UWM A;  3DV8 A;  4RGU A;  4QWQ A;  4GYI A;  2CQK A;  1VTN C;  2JWT A;  1KYW A;  1FOY A;  5KCM A;  5K5R A;  2R5Y B;  2EZK A;  2DCE A;  3GCM A;  2F5D A;  3BLY A;  3HEF A;  4M72 A;  3ZOB A;  1WJD A;  4CCN A;  1HKS A;  4RA2 A;  2BY0 A;  1RNL A;  1ZRC A;  4R8H A;  3FIS A;  3C7J A;  4XQF A;  3GEZ A;  3FK7 A;  4YFK F;  2D2W A;  1JI8 A;  1HW5 A;  2A3S A;  2QEN A;  2FXA A;  3RDI A;  5A2Q Z;  2VQL A;  5E3L A;  5J8C A;  1D8J A;  3L1P A;  4WX9 A;  3LAP A;  5GAD J;  2LF7 A;  1WI9 A;  5KHD A;  2R7V A;  2JSC A;  3A02 A;  4RAF A;  4A3G J;  1UEL B;  1LFB A;  4JOM A;  4XL9 A;  1OCZ H;  4HF2 A;  1QVU A;  3MZ8 A;  3G71 I;  3BDD A;  1FBQ A;  2FRH A;  1BW5 A;  4OIP F;  4M3F A;  2KKO A;  4KMU X;  3VOE A;  4N4N B;  4EJU A;  2YU3 A;  1N77 A;  3J7Y J;  1XSX A;  4V2G A;  4HQM A;  2HYG D;  4II3 A;  4ESF A;  1D3Y A;  3DLA A;  4GXO A;  3ZXS A;  4KT5 C;  3H3U A;  5HOO A;  2ACJ A;  1WI3 A;  1Z9C A;  3IV5 A;  2DOF A;  3KP5 A;  2EV0 A;  5HLI A;  4LJZ F;  1W7P A;  3I0T A;  2BW3 A;  5HLT A;  3DFG A;  1YJN I;  2R5Y A;  2H6B A;  1HF0 A;  3KZZ A;  1OLT A;  4L5I A;  3BTI A;  2AS5 F;  2VKE A;  3BJA A;  3JCU C;  2MC4 A;  3TW7 A;  5LEK A;  2EIK H;  4AD9 A;  2KRH A;  1Y8Q B;  1XGS A;  2BVM A;  3M8F A;  1Z1D A;  2MAB A;  4E7S A;  2M7A A;  3BCA A;  2BY2 A;  2RV8 A;  3E5Q A;  3QPH A;  1A04 A;  1UCR A;  3WE2 A;  4XKC A;  2DMQ A;  2QKM B;  3LST A;  3LSK A;  2PI0 A;  4HX7 A;  2PJP A;  2ELK A;  3LSM A;  4UVA A;  2COM A;  4ETS A;  4E70 A;  5KAI C;  3BZ6 A;  4XLH A;  3U9G A;  1MBJ A;  2O03 A;  4I98 B;  5DV5 A;  4BAY A;  3ZQC A;  4G8X A;  3HC7 A;  3KP4 A;  2VLA A;  4E7I A;  1FYK A;  4HDU A;  4II2 A;  3M8E A;  4BQN A;  2JSP A;  2LY1 A;  4CA0 A;  3LNQ A;  2D45 A;  2NVX J;  2ZCW A;  1UHW A;  3ABK H;  1SC7 A;  1MBE A;  1D5Y A;  1ZRD A;  3MEX A;  1ZYR F;  3C1D A;  3CUO A;  4XLF A;  1IN8 A;  3E1S A;  3EUH A;  3V4G A;  4EM1 A;  4U0Y A;  2XRO A;  4GCV A;  1VQ4 I;  1PYV A;  2KJC A;  2M4K A;  3KZI C;  2CUE A;  2GOM A;  4L9N A;  1QZY A;  3M1E A;  1T38 A;  5C4X J;  1VQ5 I;  3H35 A;  3WE3 A;  2K02 A;  4LB5 A;  5ICG A;  4G7Z F;  3S14 J;  1ZG3 A;  1MJ9 A;  2EFO A;  4FIS A;  4NUB A;  5C4J J;  1SFO J;  4Q5S F;  1Z77 A;  3ZGK A;  1ERD A;  3OYH A;  1BR1 A;  5L3C A;  2R7U A;  2DMU A;  3OYK A;  1G3W A;  4EGY A;  3CJN A;  3WG7 H;  3WOD F;  4ZYA A;  2K4J A;  4NC8 A;  3MZH A;  1R9T J;  3HOV J;  1Z0X A;  2DFF A;  2RNJ A;  3H9Q A;  4FHT A;  1KU9 A;  4WF2 A;  3BT9 A;  2HTJ A;  4XSZ F;  4FT8 A;  5CJ9 A;  4XID A;  2DA5 A;  4IHS A;  2R7S A;  3HDD A;  4BYY A;  1ORK A;  1IZ1 A;  2CJJ A;  1ZGW A;  3AKZ A;  4IJA A;  2HYF A;  2ZSI B;  4XRF A;  1JKO C;  1U5T B;  3LOC A;  2VAS A;  4IKF A;  2VPL A;  1RRJ A;  2LC2 A;  3OR2 C;  4A3B J;  2W4S A;  2H09 A;  5BNG A;  4BY7 J;  3MN2 A;  5DD8 A;  2HGC A;  1BC8 C;  1LEA A;  2WAQ A;  1JUS A;  5IT3 A;  1MBG A;  2CW8 A;  3FXQ A;  2X0L A;  3EYI A;  2UUZ A;  5D8L B;  3K10 A;  3TMO A;  3BCB A;  1P2F A;  3CTA A;  1X2M A;  2H1L A;  1IG7 A;  1UFM A;  5CPR B;  5FKK A;  2G0E A;  1IRG A;  1HDP A;  3C2G A;  3EUK L;  4P1W A;  1F9N A;  3BQY A;  2EK5 A;  2K3P A;  1H0M A;  4OIN F;  3GVA A;  2XIG A;  1VQO I;  2D1H A;  2EZI A;  4MEX F;  2IGM A;  2HEO A;  4DZP A;  1SAN A;  3K2Z A;  1W7P D;  1LNW A;  1R4N B;  1XCV A;  5ILU A;  3KEY A;  5E18 F;  2DMP A;  2G7H A;  5DCF A;  1S3J A;  3F8C A;  5HDN A;  2JA8 J;  5GAE J;  4KIF A;  4IL6 C;  1AHD P;  3RKQ A;  2R7T A;  2P5K A;  4RB2 C;  2VQH A;  4L5E A;  3VSK A;  2ZB9 A;  2FOW A;  1MIJ A;  3GLL A;  3PQJ A;  1BOA A;  1ETQ A;  3R0J A;  2DFE A;  5TJJ A;  2X9D A;  1OPC A;  2E5N A;  1B6A A;  2M3A A;  1FIA A;  5E20 A;  3CCU I;  4EJW A;  3PNY A;  4WWC A;  3SHF A;  4CYD A;  4KIS A;  5M5Y J;  3KLN A;  4JQF A;  1GT0 C;  4YG2 F;  5M3F J;  3QP5 A;  1CGP A;  4I76 A;  5B1A H;  1SMT A;  3IAM 2;  2DI3 A;  3I53 A;  3WHB A;  4C3I J;  5EZH A;  5J3L A;  3PFI A;  2CFX A;  2CGP A;  2ZFW A;  2XPW A;  5F0H A;  1BOB A;  2CU7 A;  3E97 A;  1TWG J;  1MMA A;  3K1N A;  1QPI A;  3FM5 A;  1R00 A;  2ECB A;  3HZJ A;  5F6F A;  1PUF B;  3HOZ J;  1T2K A;  2MD5 A;  2X6X A;  4FCY A;  3HG9 A;  3D0S A;  2KIU A;  2O9L A;  3OYN A;  4OOI A;  3KP2 A;  3NAR A;  3JAM K;  4E7H A;  1OQY A;  3DEU A;  2VBW A;  1ZAR A;  4E7L A;  3MKW B;  3F8F A;  1YX5 A;  2K3F A;  3CCM I;  4A3L J;  1Z05 A;  5ICC A;  3HUG B;  1ZN2 A;  2BHY A;  4G9Y A;  1R4M B;  4IHY A;  3ROU A;  2KDZ A;  3GYH X;  3FBI B;  2BYV E;  2X51 A;  2RGV A;  2O8K A;  4FET A;  2LOO A;  3RYR A;  1WJF A;  2EQR A;  4P55 A;  1O7F A;  2A05 A;  1FNN A;  1YQA A;  4RAZ A;  3J7A O;  3CDL A;  2E7X A;  2E7W A;  3WTS C;  1VQM I;  2R7O A;  1OFC X;  1CF7 B;  1FTZ A;  4XBF A;  1RUO A;  4GFB A;  2VUM J;  4P5O A;  3BPX A;  1ZR4 A;  4OU0 A;  1T33 A;  2V1U A;  3UNG C;  5FLM J;  3OOU A;  2NOG A;  1S7E A;  3TL4 X;  4X0G A;  4KMF A;  2F6C A;  2X1D A;  1OR7 C;  4MLO A;  3ZQI A;  2F4M B;  1W0T A;  3CME I;  3K4B A;  2IS4 A;  3QWL A;  1BI1 A;  1UMQ A;  2PEX A;  4ENM A;  1MJA A;  4KT6 A;  1G3Y A;  5GAG J;  1MDM B;  1PUF A;  5LGT A;  3W2W A;  3FX3 A;  2VT3 A;  3T1B A;  4IPA A;  3KLO A;  1IV8 A;  1SMY F;  1SVL A;  4FE4 A;  4NC7 A;  1KZH A;  2E2H J;  2TCT A;  2YS9 A;  5H6Q A;  6PAX A;  4ZDL A;  1VF9 A;  3A01 B;  2PMZ N;  3WU2 C;  1FJL A;  3I9V 2;  4A3F J;  3L2U A;  3CC2 I;  1D5V A;  2ME0 A;  4LD5 A;  3JAM Z;  3GME A;  4ZTF A;  2PBI A;  2NOJ B;  2A6E F;  3BJO A;  1HKQ A;  3OV8 A;  1TZL A;  1BIA A;  4J01 A;  5CYV A;  1O57 A;  1OCP A;  3ERM A;  5M3M J;  1NK3 P;  3H9J A;  3V42 A;  1GLN A;  1CF7 A;  2VXD A;  2Q8K A;  1MZB A;  1VQL I;  1UAA A;  3O8H A;  1LKX A;  4XM3 A;  2EIM H;  2K85 A;  2KLO A;  5LRR A;  1UZC A;  3GLX A;  2WV0 A;  1QVT A;  3IAS 2;  3LFU A;  2P0W A;  2OUM A;  2V6C A;  1WJ5 A;  1D0Z A;  3VB2 A;  2IS2 A;  3S16 J;  1I27 A;  4B47 A;  3JRI A;  2E1M C;  3K1M A;  2K27 A;  5BPD A;  1Z67 A;  1NK2 P;  3Q0U A;  1U0J A;  5CVJ A;  2QWW A;  3ESW B;  3FXO A;  4XLE A;  2LY9 A;  4B8X A;  1YW9 A;  2P5L C;  3E6D A;  1FYM A;  3TDU C;  4IOA F;  3IL2 A;  1OCT C;  4YEL A;  5DUI A;  2W1O A;  2YX7 A;  2EIJ H;  2I5U A;  3GTO J;  4XK4 A;  2LLK A;  1O3S A;  4D0P A;  2O3F A;  3A01 A;  3S1N J;  3K1P A;  5DYM A;  2HDC A;  1XMX A;  1JHH A;  2KIQ A;  4M9Z A;  1FIP A;  2GIZ A;  3FXJ A;  4KIC A;  5M5W J;  3LAJ A;  1O4X A;  3E5X A;  3KIO A;  5FRO A;  4IHT A;  1LFP A;  2V7F A;  4CDG A;  3WTV C;  2XF5 A;  2XSD C;  1TQM A;  1ZLJ A;  3IH4 A;  2HZT A;  5H2F C;  3L2Q A;  4A3D J;  1KQ9 A;  2FQ4 A;  2CWE A;  4JX5 A;  1V5F A;  3G73 A;  2KRF A;  2DT7 B;  1R5H A;  3FM3 A;  4PGG A;  4XN3 A;  1MSF C;  3BR1 A;  4CXF A;  1G59 A;  2OTJ I;  2HPI A;  2H94 A;  5EG0 B;  4CIC A;  2OCC H;  4Y13 A;  3H1C A;  2GLO A;  1HC8 A;  2E1N A;  1MJB A;  2EFP A;  4XLA A;  1ZRE A;  5EDN A;  1Y1W J;  1V55 H;  3D1N I;  1ZG1 A;  3C18 A;  4MO7 A;  1Z91 A;  4ENK A;  1P6R A;  2K4B A;  4ZYG A;  1U8R A;  1E3O C;  2X6Y A;  1O3T A;  3DEW A;  1R23 A;  4M6V A;  4AYB N;  3G2B A;  4ABZ A;  4C9Y A;  3GBG A;  1LVK A;  3BOQ A;  3FF5 A;  1XMA A;  2M7B A;  3K6G A;  3R60 A;  2LDU A;  2B7E A;  5LLQ A;  4P96 A;  2KP6 A;  2Q2E B;  4EGZ A;  1A5J A;  5IOZ A;  4E7Z A;  1XG1 A;  2MYS A;  2ZNZ A;  4L5J A;  3RYP A;  2XAS A;  3MFK A;  1ZHF A;  2YUS A;  3BTJ A;  3JRE A;  2NRA C;  1X4P A;  4AID A;  1LFU P;  1JUM A;  4ESJ A;  1WPK A;  2GAU A;  3PM1 A;  2CRG A;  3S1R J;  3R0A A;  5E79 C;  3HOU J;  1P92 A;  1P4A A;  4A2U A;  3BR3 A;  1KGS A;  3SDB A;  1WH5 A;  3QAH A;  3FHN A;  3GTK J;  4EQQ A;  1ETK A;  4E7J A;  1ULY A;  3HSE A;  4XRM A;  3ZQH A;  3AFH A;  3RQI A;  4A5N A;  3COA C;  2VJ5 A;  2PJR B;  3HOY J;  3OS0 A;  5E3M A;  1MD0 A;  2JUG A;  1FMW A;  1YYV A;  4M74 A;  3H3Z A;  1G4D A;  2ZSH B;  3SFZ A;  4GRI A;  4M6Y A;  4XIC A;  3KP7 A;  2EZH A;  1ZKG A;  4WXD A;  3RZO J;  1I6H J;  1HBX G;  4ZYD A;  5GTH C;  1OCR H;  3OYF A;  1F36 A;  1Y56 A;  4IF4 A;  1X2N A;  1X3U A;  1W5T A;  3DU6 A;  4YRV A;  1TC3 C;  4CHU A;  2JRT A;  3J7A Y;  1I3A A;  2QSF X;  4JP0 A;  2HDW A;  2PN6 A;  4PFP A;  4BHB A;  2FSW A;  1X1B A;  5L3B A;  3PL8 A;  3BC8 A;  5FO5 A;  3FHZ A;  2L0K A;  1D1C A;  2O0Y A;  3HGY A;  1MMS A;  2R7X A;  3DTK A;  2XDV A;  1WZ2 A;  3K9T A;  2L01 A;  3HOX J;  3SDG A;  3JRF A;  4Y4R A;  1VQK I;  1J75 A;  3E6M A;  3ZQ7 A;  2AQE A;  2ZXH A;  3J7Z I;  4HF1 A;  2BE5 F;  1IRF A;  4EVI A;  2GXG A;  2LKX A;  3BG3 A;  2DLL A;  2CFO A;  4XLP F;  4NDL A;  3S1M J;  5EEH A;  2VBX A;  2L7Z A;  4M9S A;  2ID3 A;  1GV5 A;  3LWF A;  1APL C;  4LIU A;  4ASN A;  4EV0 A;  2PJR A;  3BZC A;  2LVS A;  2M9H A;  2YX4 A;  3ELK A;  3K4K A;  1G3S A;  3GFL A;  3ZRG A;  2A69 F;  4RMN A;  1D8K A;  1TNS A;  4MGR A;  1HSJ A;  3BTC A;  1H88 C;  2VOD A;  3DPT A;  4UHT A;  1FSE A;  1YOV B;  1W1W E;  3REO A;  3ZQQ A;  3T5X A;  1RES A;  3HOS A;  1EH8 A;  3TP0 A;  3D5L A;  3RJP A;  1EJ9 A;  1TWH J;  4XN0 A;  1XGN A;  5FKL A;  1J59 A;  5D5W B;  2CSO A;  3IKV A;  3ZQG A;  4PZJ A;  4BXF A;  2ZC2 A;  3PUF A;  3DLL F;  3DTI A;  3WHC A;  3JSO A;  3CJR B;  2QCO A;  1JGS A;  2GWR A;  5LRS A;  1O3Q A;  1TL8 A;  5EEG A;  2ECC A;  3HYI A;  2JJ7 A;  4PJ0 C;  3PO2 J;  3K69 A;  4Y15 A;  2XAQ A;  4MFD A;  3S17 J;  5DD4 A;  3RTR A;  2JA2 A;  3HRS A;  1YRN B;  4A0Y A;  3F72 A;  2NVU B;  2R3S A;  2XV4 S;  4I2O A;  1FY7 A;  5IT9 K;  2I8D A;  4BUP A;  3OYE A;  3E0J B;  3KP6 A;  3F6V A;  2HQN A;  2IA0 A;  2VI6 A;  1WJA A;  3VYU B;  3CMA I;  3ZMS A;  3HTS B;  1QNT A;  3VFZ A;  1RPW A;  2L54 A;  3KCC A;  3CO7 C;  2EH3 A;  3GTM J;  3SJM A;  1FT9 A;  3CES A;  4DOZ A;  3L00 A;  2KMU A;  2JA6 J;  2NVQ J;  5ERI A;  4LLL A;  2E1C A;  3TOA A;  2Z16 A;  5FGM A;  4DYR A;  5LHH A;  2FX0 A;  2TRT A;  2XGE A;  5CVU A;  2XC7 A;  1L3L A;  2DXI A;  1S8N A;  2VQG A;  2ZBK A;  3JRB A;  2W82 A;  2XSJ C;  1E3H A;  1R58 A;  1Q1V A;  4EJT A;  5F04 A;  3I56 I;  3SEQ A;  1IN7 A;  1BR2 A;  5ED4 A;  2V9V A;  5E1Z B;  5K7Z A;  2DT5 A;  3S2W A;  4IQJ A;  1WH7 A;  1QA6 A;  2P5V A;  4A5M A;  1U78 A;  5K7H A;  3L2V A;  2CO5 A;  1AU7 A;  1OCO H;  1YIO A;  3L2W A;  4UY8 I;  1T6S A;  2J5O A;  2X85 A;  3JTH A;  1U9N A;  2HU9 A;  3SZT A;  3TP3 A;  4PJN A;  2CQX A;  2OF7 A;  2Y9Y A;  4A93 J;  4E6K G;  2QUF A;  2L7K A;  4HBL A;  5FB2 A;  1XDU A;  2Y0S N;  3MD2 A;  4MHG A;  1B9M A;  2EV5 A;  5KAF C;  4P9F A;  2WWY A;  4UVB A;  2V1N A;  2DT6 A;  1B8I A;  2DOA A;  2QGU A;  2Z99 A;  1XSD A;  3HTU A;  5E8I A;  1PP7 U;  5IT9 Z;  2PLY A;  1HXD A;  3N4M A;  4AU7 A;  5LHI A;  3HL2 A;  3M9A A;  3MWM A;  2VE9 A;  3AL0 C;  3EYY A;  5J1U A;  3K70 C;  4CCL A;  2M30 A;  2KT0 A;  3F21 A;  1SFU A;  2DW4 A;  1MND A;  2L9R A;  2M2E A;  2GBY A;  4B3A A;  3N97 A;  2EV6 A;  1P9Q C;  2K9M A;  3U1K A;  3ML6 A;  5D5X B;  1FWZ A;  3CCS I;  5EGO B;  4LK0 F;  5EYR A;  4IX7 A;  2LF8 A;  4ON0 A;  1NHA A;  3CLO A;  1DUX C;  1DPR A;  1T8I A;  5AIP A;  1NG7 A;  2HZD A;  3S3O A;  4AUX A;  1VI0 A;  3HKZ A;  3G3Z A;  3OYJ A;  2ESH A;  2QSG X;  2HXO A;  3BR0 A;  4EJO A;  2FD5 A;  1J5Y A;  2F2E A;  4QTR A;  3PSF A;  1GUU A;  1OYY A;  3HKZ N;  2GXB A;  2RC4 A;  1X3Z B;  4YIR X;  3K2A A;  1YIJ I;  2ZME B;  2CW0 F;  2HR3 A;  2DAO A;  4Y3O A;  1HQC A;  3LFK A;  1E17 A;  2CMP A;  2VBY A;  3CC4 I;  4CZC A;  2VXZ A;  2KIS A;  2Q0O A;  3RI4 A;  2R7D A;  2BY3 A;  3LSP A;  2STW A;  4GO1 A;  1JKP C;  4JBA A;  1JE8 A;  2DA2 A;  1QHH D;  3I58 A;  3EUA A;  4DIQ A;  4Y33 A;  2OV7 A;  5F0C A;  1SD4 A;  1S5L C;  3LSI A;  1HW2 A;  3HHH A;  3ZMV A;  3LMM A;  3GUD A;  4Z2Y A;  3WTT C;  2O7O A;  3M3Y J;  1R6R A;  4CZZ A;  2L9V A;  1I39 A;  1TW3 A;  1I3Q J;  3OIQ A;  1IC8 A;  1N75 A;  3M8J A;  4J00 A;  2X48 A;  3L7W A;  3VSL A;  1FMV A;  2M34 A;  4XLC A;  4XOT A;  4XRS G;  3L09 A;  4WXC A;  2V1X A;  3ZQF A;  4ZYE A;  4RBO A;  3K70 D;  5E3O A;  2QQA A;  3ZMU A;  3T8R A;  3P5J A;  1X1A A;  2DTZ A;  2ZME A;  3KET A;  1VZ0 A;  1WGX A;  3R6S A;  2M8G X;  3MKY B;  3FXL A;  2GXA A;  1NTC A;  2V1D A;  4EJV A;  2FU4 A;  3B6C A;  1BIB A;  1ETO A;  1X3W B;  2JVG A;  1LDD A;  3AG2 H;  2Z9O A;  4AIH A;  3EUH C;  2BBY A;  1SD6 A;  1F43 A;  3GTQ J;  1FEX A;  4F52 A;  1Y39 A;  4LG0 B;  4OWR B;  4A6D A;  3Q9V A;  2DFH A;  4YEJ A;  2P6S A;  3BR6 A;  5IYD J;  5J6X A;  4A3C J;  3BY6 A;  1WFX A;  2CUJ A;  4DBQ A;  1B59 A;  2DYR H;  1FBU A;  2IP2 A;  4PFO A;  1P4W A;  2WY8 Q;  5CQE A;  4AVZ A;  2IA1 A;  1T56 A;  2GM4 A;  4IHX A;  4HRI A;  3HB9 A;  2H1K A;  4FAS D;  3GFJ A;  3FMS A;  4M3D A;  2GQQ A;  5ICE A;  2AHQ A;  3V7C A;  4BBS J;  1ZQ3 P;  3VYR B;  5JFR A;  1LQ1 A;  1B4A A;  1JKR C;  1KU7 A;  2EIL H;  4F92 B;  2VN2 A;  2CYY A;  1JHF A;  3JTG A;  3SYT A;  1YS7 A;  1ON1 A;  2CQQ A;  2LH9 A;  4RM2 A;  1IN5 A;  4C3J J;  4YFX F;  5DS9 A;  2DPU A;  4RGR A;  4BHC A;  3HOW J;  3L9F A;  4H4K C;  3EPZ A;  3TW6 A;  4E4H A;  1IXR C;  3OY9 A;  2R4G A;  3SZP A;  1W0U A;  1X1P A;  2F4I A;  1BC7 C;  1E3P A;  2DQL A;  3K4C A;  1U5T A;  2V6E A;  4EAT A;  5TIS C;  4S04 A;  5H20 A;  5CVV A;  1OKR A;  3RKX A;  4D5F A;  3HOT A;  1S9H A;  4DGW B;  2DK5 A;  1IXS B;  3A0B C;  4KUM A;  4UV8 A;  4ESB A;  2MBF A;  3QU3 A;  1X19 A;  2VBZ A;  4BDZ A;  3G1M A;  1W5S A;  5J4Y A;  3LQQ A;  2GA2 A;  4BY1 J;  1KU2 A;  2ETH A;  3CCY A;  2DDA A;  1WVR A;  5CVR A;  1RZ4 A;  3CJQ B;  5J4V A;  2EIN H;  2DOD A;  2MG4 A;  3W3C A;  1IUF A;  2IGN A;  1UHM A;  2W00 A;  2DA7 A;  2PQ8 A;  5E3N A;  1QO0 D;  2ADU A;  1EV7 A;  3M4O J;  2OC6 A;  2JK3 A;  2HOA A;  2F4O B;  2HNH A;  3OYB A;  1ZK8 A;  1LPQ A;  3QPL A;  1X4O A;  3GW2 A;  1X1D A;  4PUS A;  4LG3 A;  3W2V A;  4BH9 A;  2NS0 A;  4HQE A;  4NHJ A;  3QYB A;  2STT A;  1DU6 A;  4U7D A;  1Y1V J;  2JZY A;  3O6B B;  4HYE A;  5HS9 A;  3ZQL A;  2IGO A;  2M0C A;  4RAG A;  4A3J J;  3JW4 A;  4XKV A;  4XON A;  2FOK A;  3FIW A;  2OU2 A;  3GO5 A;  4UB6 C;  3OYM A;  1ZEL A;  4BNC A;  1U5T C;  4JX4 A;  4IO9 F;  2RDP A;  1AOY A;  5H6R A;  3V7S A;  2QQB A;  5CLS A;  3X2Q H;  2R92 J;  4XKB A;  2E1M B;  5KK1 A;  3CCJ I;  1UJ8 A;  1QRY A;  2A61 A;  2ZJ2 A;  2VT2 A;  2PMU A;  2IEK A;  1U3E M;  3OSF A;  2E2J J;  5K1Y A;  2MW8 A;  5J1Y A;  2HYJ A;  2W84 A;  2QEX I;  1ZRF A;  2JVH A;  1T0F A;  2ICW G;  4DQ2 A;  2A6H F;  3E7L A;  2P7V B;  3OYC A;  2COB A;  3KEQ A;  4HEA 2;  2QQ8 A;  4M71 A;  2X1E A;  2QLZ A;  3FZV A;  3RPU A;  2KIF A;  4CCO A;  3IC7 A;  4A12 A;  3OOP A;  4BE0 A;  2O5R A;  4ZJZ A;  4N4O B;  4RB0 A;  2LMD A;  2R7F A;  3V8K A;  1R5G A;  1SEU A;  3TO7 A;  3G6E I;  1VFC A;  2LKP A;  2LNB A;  1RIO H;  3CP2 A;  2OQG A;  1WHU A;  1U6G A;  3E6C C;  1FOX A;  4UV9 A;  1WJC A;  2DJI A;  3PNT A;  1U9O A;  2PMZ A;  2X4H A;  1OYI A;  1SD5 A;  2KDO A;  1WQ2 A;  4ZTJ A;  1I5Z A;  4ENN A;  1XGO A;  3ZMZ A;  2FF4 A;  5CQG A;  2Z2S B;  3HUG A;  2GIV A;  3H5A A;  1RUN A;  4BHP A;  3CCR I;  1TNT A;  1YJW I;  2LR8 A;  3W6J B;  1X1C A;  4RLQ A;  3KYC B;  4CCK A;  1TWA J;  4A3K J;  3BR2 A;  3MKZ A;  3CF5 F;  4N9I A;  3VEP A;  4RGS A;  1XC5 A;  5JHF A;  2DYS H;  3GTJ J;  1T0F C;  5C44 J;  3CDI A;  2XGD A;  3MKL A;  1T08 B;  3NQO A;  2FBI A;  1ON2 A;  5LFA A;  2YPR A;  3Q5F A;  1J09 A;  1TT5 B;  2D1V A;  1OMI A;  2M1B A;  2JTV A;  4BJ5 C;  4C30 A;  4L18 B;  5FLX K;  2VJJ A;  3TGN A;  5EEA A;  1YG2 A;  3L2R A;  4X1E A;  5GPC A;  2KQR A;  2MH2 A;  1K78 B;  1IN6 A;  3F6O A;  3WGG A;  2PG4 A;  3GTP J;  4IHW A;  4RM3 A;  5HDK A;  4IXA A;  3FXR A;  1MDM A;  4HX8 A;  5B1B H;  2Z5U A;  3OSG A;  5DM7 F;  2AQF A;  4HW0 A;  4QSH A;  4HPQ A;  1V4R A;  2LY2 A;  1J7K A;  2M5W A;  5FRN A;  2GOX B;  2IAI A;  4HOB A;  2M0M A;  1YW8 A;  3NWT A;  4HST A;  2W85 A;  2JUC A;  1XGM A;  1POG A;  2Y2Z A;  3QPS A;  3QOE A;  2RKH A;  4IOC F;  1B72 B;  4PGH A;  3I64 A;  5JVG F;  3WU0 A;  4LGW A;  3IUO A;  3OYI A;  3S32 A;  3JRH A;  1LEB A;  3VPR A;  3ABL H;  1ONV A;  1YE9 A;  3KYL A;  5IY5 H;  1RC9 A;  4DNC A;  2HOS A;  3H9G A;  5D4S A;  4M3G A;  4D7N A;  1G8X A;  3GF2 A;  2BVL A;  1UG2 A;  2K40 A;  1YHQ I;  5DM6 F;  2UZK A;  3CMM A;  3ZPL A;  2NVY J;  2W24 A;  4KN7 X;  3W2A A;  3BQZ A;  1G6N A;  1H8A C;  2W25 A;  2HPM A;  3A1Y A;  3HBL A;  3ASO H;  4LIT A;  1K83 J;  3P7N A;  2JRM A;  1GV2 A;  3DPL C;  4AYB A;  2QA4 I;  3BPV A;  1K78 A;  1F1Z A;  2M8E A;  5FLX Z;  2E35 A;  2VIX A;  1TW2 A;  4EM0 B;  1RR8 C;  4QIW N;  1XX5 A;  3HXL A;  2LG4 A;  1GXQ A;  4L9J A;  5BMZ A;  3RCO A;  4LIV A;  4M3B A;  1EH7 A;  5K7F A;  3WTZ A;  1TTY A;  3GZ6 A;  4D9J A;  1ZLK A;  2XGC A;  4NQW B;  4AVP A;  2ELJ A;  5IP6 A;  1YX3 A;  2OCE A;  2ZXI A;  3C2B A;  3CMY A;  3RZD J;  3DEE A;  3TOB A;  3IRQ A;  1BI3 A;  2WY7 Q;  4HNU A;  1IRX A;  4OMZ A;  1QU3 A;  2IW5 A;  2KZV A;  4WXH A;  1BL0 A;  1R71 A;  3I3L A;  4MTD A;  2WAE A;  1Z6R A;  1HW1 A;  1MGT A;  1RKW A;  4DYC A;  4LB6 B;  3K4M A;  2P6T A;  5ILS A;  3CUQ B;  1QQI A;  1FBS A;  4G94 A;  4ZDO A;  2VKD A;  1TP4 A;  3F8B A;  2F5C A;  2XRN A;  4RLF A;  2DBB A;  2MH9 A;  3IWZ A;  2BZT A;  3I59 B;  5EG0 A;  1R5I D;  4MNU A;  2XB0 X;  5CVI A;  3JRC A;  4IVN A;  4NNJ A;  1IDY A;  1ENH A;  2HVR A;  4BXU A;  5J1R A;  4ANJ A;  3PUB A;  2K7L A;  4PSW A;  4AWX B;  2FMY A;  3Q0V A;  3OS1 A;  2ME6 A;  4UB8 C;  3ZN0 A;  2HWV A;  2DA3 A;  3DPU A;  3D5S C;  3NAU A;  1TQI A;  1IF1 A;  1XTA A;  2ZFU A;  2VPR A;  3I54 A;  1JXS A;  4CO8 A;  4FTH A;  3PIO F;  2ZJQ F;  3LQR A;  1H9T A;  2Q2E A;  1NH3 A;  4ZZL A;  1YFH A;  4NQW A;  5IP9 J;  4BQA A;  1MMN A;  3MVP A;  2OTL I;  2FNP A;  1G3T A;  2ELH A;  1J2X A;  2YR2 A;  2I10 A;  2EB7 A;  5J8F A;  1JT0 A;  2ISZ A;  3OL4 A;  5F1R A;  2Y30 A;  2V4J C;  2DA4 A;  3BZK A;  1YTY A;  3CD6 I;  3ASN H;  3SEZ A;  4Y7N J;  3FDY A;  1HST A;  3IH3 A;  2UXX A;  5DEQ A;  2JPB A;  5LD2 C;  1RI7 A;  4I99 C;  2QF7 A;  2DMT A;  4Y52 J;  4XOR A;  1UB9 A; 
#chains in the Genus database with same CATH homology
 4BQQ A;  2E5N A;  2M3A A;  2K5C A;  3OYL A;  4IX7 A;  3DKY A;  2IGK A;  4B48 A;  1TT0 A;  3PNY A;  1NG7 A;  2HZD A;  2WB1 A;  4KIS A;  3S3O A;  3HKZ A;  3KX2 A;  3OYJ A;  4JQF A;  1UG0 A;  4CCM A;  4B44 A;  1W36 D;  4BAC A;  3PSI A;  3IAM 2;  3PSF A;  2HVS A;  2CS3 A;  1BOB A;  4BJT A;  4Y3O A;  2L9N A;  4KIT B;  2CMP A;  2WAD A;  2RNG A;  1MMA A;  4CZC A;  4U7B A;  2VXZ A;  4C2U A;  4DJA A;  2RRE A;  3BG6 A;  2X6X A;  3HG9 A;  5HVQ C;  3OYN A;  3HPH A;  1QHH D;  4E7H A;  3DTE A;  4XR6 A;  4IQ4 A;  2R7Q A;  3EUA A;  3K4J A;  4XNF A;  4DIQ A;  2LBF B;  4E7L A;  3MKW B;  3K4L A;  2OV7 A;  4Y33 A;  1YX5 A;  2WAF A;  2Q1Z B;  3LSI A;  1D0X A;  3HUG B;  4E7K A;  1KON A;  2KHM A;  3LMM A;  3ZCO A;  3U21 A;  3FBI B;  3OWT A;  4CH7 A;  2X51 A;  4OAY A;  3RPU D;  3OS2 A;  4FET A;  2LOO A;  4ITV A;  1WJF A;  1R6R A;  5HNF A;  1Z3X A;  4F3Q A;  2R7O A;  3OIQ A;  1WJE A;  1N75 A;  2IS6 A;  4BQO A;  3M8J A;  4J00 A;  1DQU A;  4P5O A;  3A2K A;  1V5E A;  3VSL A;  1FMV A;  3H5R A;  4XLC A;  1DGW Y;  3S3N A;  4PSX A;  4XOT A;  3UNG C;  1MW7 A;  3LSG A;  3OOU A;  3TL4 X;  3K70 D;  4X0G A;  1X1A A;  2F6C A;  3UR3 C;  2X1D A;  1OR7 C;  4MLO A;  1VZ0 A;  3DU5 A;  4IZZ A;  2F5V A;  2A5W A;  3K4B A;  3VYT B;  2IS4 A;  4B43 A;  3MKY B;  2L2O A;  1EA3 A;  4QPO A;  4KT6 A;  4BU2 A;  4D1Q A;  4BDY A;  3S3M A;  1AA7 A;  3W2W A;  2JVG A;  1Z21 A;  3EUH C;  2Z1D A;  3IP4 B;  1Z3Y A;  3ONQ A;  4F52 A;  2BW3 B;  4OWR B;  2Y0S A;  4NC7 A;  4YEJ A;  4OAZ A;  4BEH B;  3S8P A;  2LBF A;  1WFX A;  2CUJ A;  4DBQ A;  4ZDL A;  3FBN B;  3C2H A;  3I9V 2;  4R79 A;  3L2U A;  4PFO A;  2HVQ A;  2WY8 Q;  5FRM A;  5CQE A;  4AVZ A;  2KRC A;  4ZTF A;  2E5Z A;  2WBM A;  2NOJ B;  2FUG 2;  4B3X A;  3ZR8 X;  3CP8 A;  4HRI A;  1QHG A;  3DWL E;  4FAS D;  1TZL A;  4J01 A;  2A6T A;  2W7N A;  3H9J A;  1MMD A;  1GLN A;  3V42 A;  1Y6I A;  2VXD A;  3VYR B;  1WJB A;  1UAA A;  2UV1 A;  1LKX A;  4XM3 A;  4F92 B;  2KLO A;  2IXS A;  1SFK A;  1Z7L A;  2VL8 A;  1T95 A;  3SYT A;  2LH9 A;  4RM2 A;  3IAS 2;  1SAU A;  3EPZ A;  3LFU A;  4H4K C;  1MMG A;  3S93 A;  2P0W A;  4E4H A;  5KNL A;  3OY9 A;  2OUM A;  2R4G A;  3PFY A;  1WJ5 A;  1D0Z A;  1K6Y A;  1LDK B;  2F4I A;  2IS2 A;  3K4C A;  4B47 A;  2V6E A;  2E1M C;  2VJ4 A;  4EAT A;  3OYG A;  4U87 A;  1U0J A;  3HOT A;  2CW7 A;  4XLE A;  2CV1 A;  1S9H A;  4DGW B;  3RQ4 A;  4F55 A;  3DQV C;  3CF2 A;  1X19 A;  4BDZ A;  3VWB A;  4BEH A;  1N78 A;  3RSN A;  3VYS B;  2R7R A;  3OYA A;  2XF6 A;  4YEL A;  2W1O A;  3D5R C;  3CJQ B;  1DP3 A;  4ZDP A;  2VB6 A;  3W3C A;  2IGN A;  2W00 A;  2V26 A;  5FRO A;  1LFP A;  2OC6 A;  4KJZ A;  2V7F A;  3PJR A;  2XF5 A;  2HNH A;  4BL0 B;  3OYB A;  4XKW A;  1X4O A;  3L2Q A;  3K4N A;  1X1D A;  4BGD A;  4PUS A;  4LG3 A;  3W2V A;  4DBR A;  3AL0 B;  1V5F A;  3QYB A;  2DT7 B;  4XN3 A;  3OMY A;  4BE2 A;  2IGO A;  3QOD A;  3H0D A;  2MFZ A;  3OIP A;  2HPI A;  1G59 A;  4XKV A;  4XON A;  4XLA A;  3OYM A;  1ZEL A;  4HSR A;  2CV2 A;  2VQC A;  2X6W A;  3HPG A;  4ZC3 A;  3MMY B;  1MNE A;  2E1M B;  4PJM A;  4XKB A;  4CUG A;  3NWS A;  2K9L A;  2X6Y A;  3QYF A;  2CH0 A;  3G2B A;  4C9Y A;  3GBG A;  1LVK A;  2RQQ A;  2M7B A;  2JVH A;  3K6G A;  4HG2 A;  3OYC A;  4HEA 2;  3OL3 A;  2KP6 A;  2Q2E B;  4QPQ A;  3N05 A;  4E7Z A;  2MYS A;  2X1E A;  4BS9 A;  2KL4 A;  4CCO A;  1X4P A;  2UWM A;  4BE0 A;  2O5R A;  3M1C A;  4ZJZ A;  2R7W A;  4N4O B;  2VKH A;  4XMY A;  3CP2 A;  5KCM A;  2M4G A;  3F9K A;  2DCE A;  1WJC A;  2DJI A;  3PNT A;  3BLY A;  2PMZ A;  3SDB A;  2KDO A;  3FHN A;  4ZTJ A;  1WJD A;  4E7J A;  4CCN A;  5CQG A;  3AFH A;  2Z2S B;  4C2T A;  1NG6 A;  2VJ5 A;  2PJR B;  3H5A A;  3OS0 A;  4XQF A;  2JUG A;  1FMW A;  1X1C A;  4RLQ A;  2ZSH B;  4CCK A;  1JI8 A;  2HQA A;  4GRI A;  3MKZ A;  1V5G A;  2VQL A;  5JHF A;  1T0F C;  5KHD A;  2R7V A;  3OYF A;  1Y56 A;  3DU6 A;  1UEL B;  4YRV A;  2KPM A;  4JOM A;  4XL9 A;  5LFA A;  3J7A Y;  1J09 A;  4BJ5 C;  4C30 A;  2HDW A;  2VJJ A;  4PFP A;  5HNH A;  2QKL B;  1X1B A;  4N4N B;  3PL8 A;  3BC8 A;  1N77 A;  3L2R A;  3VDX A;  2X1C A;  1D1C A;  4II3 A;  2KQR A;  2WA0 A;  3DLA A;  3ZXS A;  2R7X A;  3DTK A;  2E60 A;  2XDV A;  5HOO A;  4RM3 A;  4Y4R A;  2AQE A;  2ZXH A;  3PNV A;  3SZG A;  2XF7 A;  2AQF A;  5HLT A;  2BW3 A;  4HPQ A;  2L9S A;  2LY2 A;  2CFO A;  1OLT A;  5FRN A;  2MD0 A;  3A4C A;  2GOX B;  2MC4 A;  4PJJ A;  4LIU A;  2M0M A;  2PJR A;  3NWT A;  4HST A;  2KRH A;  2BVM A;  3K4K A;  3QOE A;  3ZRG A;  2MAB A;  4RMN A;  4E7S A;  2M7A A;  3BCA A;  3DPT A;  3IUO A;  4XKC A;  3OYI A;  3S32 A;  2L5Q A;  2QKM B;  3LSK A;  3ZQQ A;  3HOS A;  4HNT A;  1YE9 A;  3LSM A;  3KYL A;  3D5L A;  1D0Y A;  3H9G A;  4XN0 A;  3TBI A;  1G8X A;  3OYD A;  4XLH A;  2BVL A;  4BXF A;  3CMM A;  4BJ6 C;  3DTI A;  3HC7 A;  2VLA A;  4E7I A;  3W2A A;  3CJR B;  2HPM A;  4II2 A;  4BQN A;  3A1Y A;  2JSP A;  2LY1 A;  4CA0 A;  4LIT A;  3DPL C;  4AYB A;  4PJL A;  4G6T B;  2CV0 A;  4XLF A;  1BR4 A;  2VIX A;  3RTR A;  2BOL A;  2JA2 A;  3E1S A;  1E0E A;  1D1A A;  1PYV A;  2M4K A;  2GOM A;  3BG7 A;  2LG4 A;  3HXL A;  2I8D A;  4BUP A;  3OYE A;  3RCO A;  3E0J B;  3LL7 A;  4LIV A;  3H35 A;  2IS1 A;  4NUB A;  1WJA A;  3ZGK A;  3VYU B;  4D9J A;  1ERD A;  4NQW B;  2ELJ A;  3OYH A;  1YX3 A;  2ZXI A;  1BR1 A;  2R7U A;  3DEE A;  3OYK A;  2WY7 Q;  4HNU A;  1IRX A;  4ZYA A;  1QU3 A;  4NC8 A;  4CSW A;  2KZV A;  3CES A;  4DOZ A;  3I3L A;  2KMU A;  1W36 C;  4F93 B;  3H9Q A;  2WAE A;  3K4M A;  2Z16 A;  4ZDO A;  2VKD A;  2R7S A;  3FKJ A;  3DKX A;  1DGR M;  4RLF A;  2XC7 A;  2DXI A;  4BE1 A;  2VQG A;  2W82 A;  2XSJ C;  3AKZ A;  3SEQ A;  3OR1 C;  1BR2 A;  2ZSI B;  4NNJ A;  4IQJ A;  2VAS A;  2HVR A;  4IKF A;  2VPL A;  3L2V A;  4ANJ A;  3PUB A;  4PSW A;  2LC2 A;  3OR2 C;  2W4S A;  4CCJ A;  3L2W A;  1D1B A;  2X85 A;  2HU9 A;  2LYC A;  4PJN A;  3OS1 A;  2VJI A;  2WAQ A;  3CZ6 A;  3DPU A;  2CW8 A;  3D5S C;  2L7K A;  4E6K G;  2UUZ A;  2ZFU A;  3K10 A;  2CUZ A;  4PK4 A;  3MD2 A;  1PJR A;  3TMO A;  3BCB A;  5CPR B;  3LSH A;  2V1N A;  2DT6 A;  2DOA A;  5CKT A;  3C2G A;  3EUK L;  4P1W A;  4XOP A;  1MMN A;  4F91 B;  2K3P A;  2V9K A;  4AU7 A;  2IGM A;  3OL4 A;  3HL2 A;  3KEY A;  2V4J C;  3AL0 C;  2LRD A;  2XAU A;  3K70 C;  3SEZ A;  3FDY A;  4CCL A;  5LD2 C;  3QYE A;  1HA8 A;  1MND A;  2R7T A;  2LRE A;  3H5N A;  2VQH A;  5TGT A;  4XOR A;  3VSK A;  1P9Q C;  2K9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...