3HUGB

Crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
HHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/membrane protein
molecule keywords RNA polymerase sigma factor
total genus 21
structure length 62
sequence length 62
chains with identical sequence D, F, H, J, L, N, P, R, T
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13490 zf-HC2 Putative zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hugB00
3HUGB 2Z2SB 4NQWB 2Q1ZB
chains in the Genus database with same CATH superfamily
1V5FA 2YX4A 5HDGA 2Q2EA 3DBLB 3RSNA 4UUVA 4IOAF 1Z91A 4XORA 5E8GA 3IL2A 3NARA 3HOYJ 1ZG1A 2ADUA 3C2GA 4EATA 4D9JA 1QVTA 2VKVA 4RGSA 1KU7A 2LY2A 1AHDP 1IRGA 3OYDA 2KL4A 3FISA 2JWTA 3BG7A 1WRJA 4P5OA 3FXKA 2Y69H 3HRSA 1XMKA 4DOZA 2HWVA 3DFGA 1BIBA 2DT7B 1QZZA 2DFHA 3ERMA 2CQXA 1IJWC 3E97A 2FRHA 4DIQA 3GF2A 4OAZA 2VIXA 3DEWA 5HOOA 3L9FA 4DYCA 2CH0A 1ZG5A 5GTHC 1V55H 2R7QA 5CJ9A 4IX7A 3O8GA 4JX4A 2XUBA 3FHZA 3WGGA 3H1CA 1D0ZA 2DOEA 5F27A 1T08B 3E0JB 3FXJA 1W4MA 5FLMJ 2HZTA 3A03A 2DA3A 3OYLA 3HKZA 3FMSA 2NS7A 1FTTA 4ZYEA 1RETA 1YJ9I 3CC4I 4HF2A 2ZXHA 3BG5A 1XDSA 3RPQA 1XGOA 1HKTA 1GDTA 1T38A 3BPVA 2HPMA 4BHBA 4ZC3A 3RI4A 1MDMB 1XSDA 1KGSA 2MH2A 4V2FA 1QBJA 1QHHD 3FF5A 3WTXC 3JRCA 1PP7U 2ZJPF 5KAIC 1X3ZB 3TL4X 2K5CA 2KHMA 4B47A 3ZQIA 4KITB 3F3XA 5J1UA 2JMWA 3ASNH 4OWRB 3WTYC 5EGOB 1W0TA 4F93B 3CD6I 1B6AA 1BC7C 2MFZA 5FROA 1D8KA 3LSMA 4L9TA 5D5WB 2H8WA 2E5ZA 3FHNA 4KIBA 1QPIA 4N9HA 1TQPA 3NQOA 1ZQ3P 2LY1A 2ISYA 2QCOA 4HX8A 1WI9A 3G71I 1IUFA 1PUFB 3N97A 1K61A 2O7OA 2IA1A 3S8PA 1UHWA 5LGNA 1RI7A 4QPQA 3AAFA 2W25A 1AU7A 4B48A 4HRIA 2VC0A 1ZREA 3B6CA 1GV2A 5CYVA 4RB1A 3A01A 3SJMA 2V1NA 3PQKA 4AUXA 3GEZA 2QF7A 3V8JA 3O6BB 4IO9F 3QYBA 2W4SA 2F5CA 4D5FA 3EYYA 1J5YA 3F6OA 5L3FA 4GO1A 3IWFA 4ZH4F 2DA6A 4OAYA 2RNGA 2LTPA 3H0GJ 4M9ZA 4BE0A 1VQ4I 1SFKA 4D0PA 5J1RA 2OBPA 3V8KA 2HQRA 4I01A 4Q47A 3A02A 2K27A 3PSIA 3H3UA 3PO3J 2VL8A 3BJAA 4C3JJ 3L2UA 1VQ9I 1WJ5A 2XAQA 5H6RA 2MGQA 1YTYA 1X58A 2XB0X 4Y7NJ 3P7NA 5EF6A 1K4TA 1FOKA 5K5RA 3KLOA 3JRAA 1RKTA 1BJAA 3HL2A 1XX5A 2LMDA 2E1MB 2W85A 5EGOA 1UJ8A 1USSA 2DJIA 2XAHA 5FLVA 3S2HJ 1X2NA 2JPCA 4RAYA 3JRHA 3S3NA 3CCRI 4ANJA 4XLCA 5HS7A 5JFRA 4NQWB 4BQOA 4MIMA 3P9IA 4UB6C 2CUJA 2ZJ2A 3IC7A 4PFOA 3HOUJ 2IBDA 3LOCA 2ZXJA 3WODF 2FD5A 4KJZA 2IA2A 4LK1F 4JX6A 2JRTA 2EH3A 4HA8A 2EFNA 1AOYA 4A2UA 4YFKF 2LC2A 4KIGA 3HSEA 4NQWA 2O9LA 1T39A 2I10A 2WY7Q 2P81A 4G7HF 2FNAA 3AG1H 3CUQA 1FY7A 1WJDA 2V1DA 2R7ZJ 3KYDB 1U9NA 1LFUP 3LSIA 3HB9A 2R7RA 2IP2A 1Z1DA 1IN8A 2K3PA 2XROA 2MH9A 4BQQA 5F1JA 2UXXA 2EA2A 4ZYAA 3KPHA 3ZOBA 2I5UA 2M7AA 2VXDA 1OCCH 1OCRH 2WV1A 5DCMB 3CC7I 4BHPA 4AYBA 3DEUA 1AKHB 1I1SA 2M1BA 2JVHA 5E1ZB 3VYUB 4XKCA 5F64A 2NNYA 3GTQJ 2AHQA 1ZHFA 2KPMA 2LKPA 2R7WA 3I4MJ 2F6CA 2MLKA 2YUSA 1Y1WJ 2GIVA 2VODA 1ZN2A 1S7EA 4UVAA 2F5VA 2M87A 4XLAA 2MD0A 3I5UA 1SD4A 1S9HA 2Y75A 4NDLA 3TEDA 1XDUA 2BE5F 3CF5F 2IT0A 2DOAA 1Y56A 2KDZA 4EM1A 2H27A 1PUEE 2XAGA 5J47A 5J3LA 5CKTA 3M7GA 2HKXA 2G7UA 2B0LA 2A6TA 2FEZA 4LITA 2KKOA 2R93J 1XGSA 4IXAA 3U1KA 3MWMA 1FOXA 1YW7A 1O7FA 1ZRDA 4WWCA 3OYFA 2XAUA 3CCMI 2F4IA 2LVSA 2XGCA 2KMUA 2FUG2 2HOTA 1V54H 2V6EA 1XS9A 3BZCA 1UCRA 1TWAJ 5IP7J 1X1PA 2OQGA 4Z6YA 3JRFA 2J5PA 1ZH5A 2CQQA 2IVMA 5ILUA 2K02A 3REOA 4PDKA 1ONVA 4W1UA 3LSRA 2GM4A 2VOPA 3PO2J 3FXMA 2PBIA 2HOSA 1IN6A 1E2XA 3BTJA 5DD4A 3L1PA 4CYCA 3HSRA 4RBOA 4GFBA 4BXUA 2E19A 4JYKA 3SDGA 2R7UA 3H5RA 2K9SA 4NC8A 3ZQCA 2VJ5A 4E7SA 3M9AA 1ACIA 3WHCA 3WTSC 2EB7A 5LGUA 2L3DA 5LLQA 4BS9A 4E4HA 2QM3A 1MJAA 2DQLA 3FKJA 1W7PD 3GMEA 4L5IA 3L2VA 1BI3A 1HCRA 4MHGA 2GXBA 1ETWA 4U0WA 4A3BJ 1E3HA 4O5VA 1Z67A 5IOYA 1K6YA 2V1XA 3QAHA 2JA2A 1W36D 4C2UA 1RZ4A 2QSGX 4PSXA 1MDMA 1KYWA 1VQ7I 2NRAC 1JI8A 1X3WB 4PUSA 2HVRA 2HNHA 4ETSA 1A6QA 4RA2A 4HBLA 2VOOA 1WH5A 2XKOA 1WH7A 5F04A 1FMVA 3ZQLA 2E1CA 1I6HJ 5GPAA 3CJNA 3W3CA 4E70A 3GWZA 4MO7A 5FKLA 2RQPA 2JA6J 1KU9A 4FT8A 1OKRA 3BZKA 4A3CJ 1VI0A 5F0FA 4BQAA 3GBGA 1LEAA 2C6YA 5C4JJ 1PYVA 4A3DJ 1U5TA 3ZMZA 4QSHA 2WB1A 4A6DA 2UZKA 1MNDA 3M8EA 3HSFA 2JZYA 2L7ZA 5K7ZA 1I5ZA 3V7RA 4M6VA 3R60A 1GVJA 4KMUX 3HGYA 1XMXA 4DNCA 4U7DA 4MQ9F 2RNJA 3E6MA 3HRTA 4OIPF 5H2FC 3BCAA 3GCMA 1S7AA 5FD6A 3HBLA 1JGSA 1Z0XA 3JREA 2VE8A 5TJJA 4II3A 2FU4A 2DDAA 3R4KA 2P5VA 4I09A 4A69C 4FX0A 2IS2A 1B4AA 1Z77A 2QZ8A 2X6XA 1JJ6C 1T0FC 4JX5A 1I27A 4ZYDA 1G4DA 5EZHA 4E7LA 3B02A 4XM3A 1REPC 3H5NA 3QYFA 4OINF 4F55A 1QO0D 2KLOA 5B1BH 5M5WJ 2QQBA 4C3IJ 3I64A 1Y6IA 3OYKA 1MBJA 1HSJA 2QSHX 3H36A 4EEFG 5CQGA 4YFNF 1OYIA 3LFKA 1G2HA 4MEYF 2X51A 5HS9A 5JR3A 4IRIA 1PDNC 5HDKA 4J01A 5IY5H 1YW9A 2EBIA 1C0WA 2Y48A 2ME6A 1O7LA 4KISA 4G7ZF 1JKRC 4D5CA 2F5DA 3U1DA 4HLXA 2V4JC 2Z3YA 1P2FA 3G1LA 3P5JA 1J59A 3MVPA 1BBYA 5F1RA 1R1UA 4IEJA 3C3WA 1VF9A 4I99C 4N0BA 4A93J 4EJUA 2IA0A 2YS9A 2ID6A 2JUGA 4PGHA 1R23A 3TO9A 3JTHA 4QIWN 3FM3A 4BACA 3F72A 1MBFA 3U9GA 1IXSB 1WJCA 2IGKA 1FP2A 4UVCA 5H6QA 4UB8C 4PCQA 4FE4A 2W7NA 3I3LA 2DAOA 2KFDA 2Y0SA 1TW2A 3FXLA 1N77A 3OR2C 2WB1N 1F1ZA 4KUMA 2KP6A 1NHAA 4RS8A 3LAJA 3ONQA 1NK3P 3PIOF 4A0ZA 3KEYA 3HTSB 3WGIA 4CCMA 2KISA 3S2DJ 3S1MJ 1BI0A 3S3MA 3VWBA 3P9CA 3DV8A 2OCEA 1SVLA 1I39A 1X1AA 3BTLA 2STTA 2FOWA 2QENA 1W36C 2E71A 5HS8A 1P7JA 4HSRA 4BL0B 3S2WA 3A2KA 2HTSA 2VBZA 2V9PA 4IHTA 4S05A 4X6AJ 1NTCA 2F48A 4XRMA 4BJ5C 3W2AA 1A5JA 2EFOA 1W7PB 3CDLA 4RB2C 1T33A 4HLYA 2KIFA 2CGPA 1T95A 5TGTA 2XHKA 4P9UA 1EH8A 3C7JA 1CGPA 3KP4A 1LB2A 3OYHA 4F92B 3LA2A 2MBFA 1TC3C 1JKQC 1G3YA 2CWEA 4BU2A 2XF7A 2LBFB 4CHUA 4XIDA 2WWYA 2TCTA 4NB5A 4MEXF 5IP6A 2DT5A 2W48A 3EYIA 4XKBA 3BG6A 3U21A 4AIKA 2VKEA 1O3TA 4EJOA 3MKZA 4HQEA 2OU2A 4A0XA 4P1WA 4M9SA 4LOCA 3J81Z 2M30A 1OJLA 3JRIA 4HX4A 1RUOA 3OMYA 3HG9A 5EEGA 1XD7A 2XC7A 4HV5A 1UZCA 2BXYA 2DK5A 3DTKA 2GAUA 3VEPA 4CH7A 1MBGA 4I6ZA 3KIOA 4BH9A 1R9TJ 2O5RA 3LA7A 4M3EA 1ETOA 1YX5A 4XK4A 3RJPA 1MIJA 2L7MP 4CZCA 2GA1A 2CS3A 3K1MA 3MZYA 1I50J 4HDUA 3T5XA 4ZJZA 1R4MB 3C1DA 3BTCA 1ETVA 1IDYA 2MC4A 5GTIC 3OS2A 4DZPA 3AG3H 2NVXJ 2EZLA 2FMLA 4A3IJ 1QVUA 3LQQA 4A3JJ 3G6EI 1OYWA 1HC8A 3MD2A 3ZMSA 3BOQA 1U0JA 1GLNA 4CO8A 1WJAA 1IN7A 3KYCB 2XDVA 3S14J 1K83J 2GIZA 2R3SA 5KAFC 3MMYB 3SXYA 2VBXA 1YJWI 1IW7F 1FBUA 4ON0A 2L9RA 5DEQA 2BXZA 4Y3OA 4XBFA 3GZ6A 2Z1DA 3AFHA 4B8XA 1I3QJ 2CG4A 1QRYA 1YW8A 5AONA 2ZFWA 1SC7A 3HJEA 5FKNA 1O3RA 2AXLA 4BE2A 1TWHJ 5GAGJ 1TLHB 3QPLA 3S32A 1KU2A 2WAQN 3ABMH 3IRRA 3LMMA 2ZBKA 1W1WE 4RAZA 3PFIA 1FYLA 3CZ6A 3V7CA 2VC1A 2ECBA 4V19K 3QYEA 2JA5J 2EQRA 2Y0SN 3H3ZA 5EG0B 3ULQB 2HDDA 1U9OA 3COAC 4NC6A 3UKGA 1GXPA 4CCNA 3IWZA 2O3FA 4JK1X 1SMYF 1FPQA 3RDIA 4I0BA 1HSTA 1TWFJ 3K9TA 3UNGC 3CO6C 1MMSA 1QNTA 3B73A 2W57A 2A07F 2P7VB 3G3ZA 1FBQA 5C44J 1UB9A 1XCVA 2LSOA 2L9SA 3ZQHA 1YIOA 2VPRA 1HKSA 4A3MJ 2F5FA 5ICGA 4IOCF 3I71A 3GLLA 3DPUA 3GYHX 3TDUC 3ERED 1FBSA 2PFBA 3P9KA 4NC7A 4BNCA 2E2JJ 1W0UA 3CF2A 5GADJ 2NVTJ 4DJAA 4U0YA 1G8XA 5L3CA 3FX3A 4UUTA 2X6YA 4P55A 2STWA 5BS6A 1LVKA 3LSPA 5D5UB 3GX4X 3OYIA 2L4AA 2CQKA 2NYXA 3BPXA 2DMQA 2EPFA 4IL6C 2W24A 3ZN1A 5ICFA 5J4YA 2DJNA 3KX2A 5FJ8J 4A3GJ 1SFXA 5M5XJ 1JE8A 1WHUA 5DDGA 2HGCA 2E1NA 3OWTA 4PSWA 3H35A 2YPRA 4GYGA 2PG4A 1LKXA 1IDZA 3AG4H 3DKXA 4KNYA 1EV7A 5E20A 1VQNI 2IS1A 3TOBA 1ZKGA 1IO2A 5LHIA 3K70D 5HLTA 3QP6A 3BR0A 4P96A 5CVRA 5BPDA 3D5RC 3SDBA 2E2IJ 3GTOJ 1QA6A 3J7AY 3KZIC 1FWZA 1JHHA 2JK3A 2Q1ZB 3DWLE 1K6OA 2OTLI 5FGMA 4MGRA 1F4KA 2EZKA 1R00A 4PJNA 3SZGA 2E35A 3DCFA 1E0EA 1DU0A 1MBHA 5C3EJ 2DFIA 2JSCA 1H88C 3KZYA 3FWEA 4RAGA 3WTZA 1GVDA 1X1BA 4IZZA 5LD2C 2EFPA 2AXTC 3D1NI 2UV1A 2PMZA 3G2BA 4XONA 5FO5A 3LSTA 1WVRA 3E3VA 2EINH 1STZA 4LG0B 4CA0A 1Y8QB 4JOMA 2EZHA 2KJCA 2BVLA 2ZXIA 2HVSA 1E3OC 4D7MA 2I8DA 3LAPA 1R58A 4WCGA 1IAWA 5LGTA 1P4XA 3VYTB 1WSUA 4ENJA 3GVAA 2ESHA 3LSGA 3LNQA 1J09A 5JHUA 4XN0A 3TKYA 3WG9A 3FK7A 1CF7A 3CMMA 3IAS2 4C3HJ 2KJBA 2MSYA 3OYNA 4HSTA 4ENNA 2ELJA 2ICWG 3S1QJ 2RC4A 3DTIA 2FXAA 1FT9A 3IHUA 1VQ6I 2IXSA 3T8RA 2L9NA 1CF7B 3JAMK 4ESJA 1ZGWA 5IPAA 4LLLA 1OR7A 5K7HA 2M5WA 5CQEA 1YRNA 1WFXA 4B1RA 3M3YJ 3OYGA 4LB6B 1TBXA 2CU7A 3K0LA 1VQ5I 2HS5A 1R6RA 1PVEA 3J7YJ 1LQ1A 5ICEA 4UV8A 3LQRA 4LIUA 3IH2A 3JRBA 4Y4RA 2DODA 2XAFA 1CQTA 1BC8C 4U88A 2KIUA 3KEQA 2M8EA 1K79A 2XGDA 4Y15A 2OAZA 4M3DA 2WA0A 3HPHA 1YX3A 2DTRA 3DXJF 3HOZJ 2WTEA 3BWGA 2EV5A 3C2BA 5LRRA 2CO5A 1YE9A 4I98B 3CDHA 2IGNA 5B1AH 3CCQI 2ZJRF 3K4BA 2DYRH 3FZVA 3DU6A 5JVTA 3RCOA 4X0GA 3E7LA 2QQAA 2LF7A 5F0HA 2QWWA 2M2EA 3GW2A 3GZNB 4V2GA 1WWXA 2IAIA 3BG9A 2HPIA 5TISC 2V79A 4EMSA 4XNFA 1T56A 2A69F 5KVRA 3K10A 3BG3A 2VONA 2D1VA 3MZ8A 3CCSI 5EEHA 1EKEA 4IHVA 3ZN0A 4M74A 4IHSA 2CRGA 4P9FA 2NNNA 2VBWA 1RR7A 1T98A 4FHTA 3L2WA 2VB6A 3DLAA 1YIJI 2DPUA 5FRMA 1D1AA 4FETA 4IHYA 3R0JA 1ZYRF 3PNYA 1BR2A 2V6CA 1G3SA 1LPQA 1DP7P 1OCTC 3SFZA 5FRNA 2BY1A 1F43A 2CUFA 1QU3A 2YSRA 1POGA 2LR8A 1F9NA 2PJRA 3VYSB 3MFKA 2M34A 2DA7A 4N9IA 1FSHA 2DOFA 2L5QA 2DA1A 2QEXI 1DP3A 2DCEA 5CVIA 5K5OA 2JA7J 1L3LA 4A5NA 1R1TA 2M3AA 5JVGF 5E3MA 2X48A 3D5LA 4DQ2A 2LKXA 1VQMI 5J40A 3IH3A 1FLIA 2WC2A 1QZYA 3M8FA 3J7AO 4ZYGA 3ZMVA 4IHWA 1LJ9A 3GXOA 3D5SC 3M1EA 3JTGA 3TP3A 4LB5A 4CCJA 2QA4I 2G0EA 2M0MA 1V5GA 5D8KB 2XVCA 3IV5A 4EM0B 1D5YA 4KN4X 1BR1A 1EH6A 3MKWB 2L0KA 2OCCH 1TP4A 3QQAA 1WCMJ 4L0YB 1W5SA 3RKQA 1ZG3A 3T1BA 1B8IB 2JTVA 2EV0A 2BHZA 3WTWC 1ZRCA 2HDCA 2P7CB 3VYRB 1A04A 2XF6A 2HOEA 4IQJA 4HG2A 1HQCA 1A35A 1ITYA 2VQCA 4R8HA 2RKHA 2VQHA 3QWLA 1K78B 4BXFA 1X1CA 5AIPA 4JBAA 1YI2I 3KP6A 1S3JA 2BW3B 1BW6A 1UHMA 3OIPA 4YELA 3JRGA 3EPZA 3PM1A 5CVJA 1ZTRA 2DFFA 5F0CA 3GTPJ 1RPWA 2JVGA 3KFWX 4C2MJ 2UWMA 2E34A 4XOPA 4XN3A 1SFUA 2HXOA 2O6GE 3FKIJ 1D1BA 1X4OA 2V26A 1OR7C 3SEQA 3W2VA 1HF0A 3SHFA 4HF1A 1HW5A 1B59A 1VQ8I 2Z33A 2IJLA 1FZPB 3RYPA 2DI3A 2WAFA 2K9NA 1QGPA 2BYVE 3Q3SA 3LSHA 2Q8KA 1S5LC 3ZRGA 3CO7C 4E7HA 1IXCA 3AL0B 2A6EF 4RLFA 1FX7A 2P6SA 3K69A 4WXHA 4M9XA 3MAJA 2L2OA 4BBRJ 4G6DA 4RAFA 4L18B 3H3VK 1WZ2A 1FIAA 3ECOA 2VN2A 1JXSA 1BJZA 4ZDLA 5L3GA 4AU7A 4B09A 4IRHA 3VOEA 5B3SH 1MGTA 4OOIA 5D6EA 3F8MA 2CFXA 1RNLA 3J80K 4KFCA 2L7FP 2KZVA 4RM3A 2DMNA 3BT9A 2R0QC 2XSJC 2R5YA 2EZIA 4XLPF 1ZR4A 3F8FA 4G94A 3W6VA 1RUNA 2MA3A 3CJTB 3WE3A 4Y17A 1H8AC 3KLNA 3TO6A 1G3TA 3KP3A 5AIQA 1R49A 5B5EC 2OPTA 2LH9A 2GOMA 1W7PA 2FNPA 1K4SA 2DDBA 1JUMA 3H5AA 2X85A 3E6CC 4LFUA 2VPLA 3FMQA 1ZELA 2D2WA 4LGWA 1MSFC 2O03A 1D0YA 4ENKA 3T0YA 5LBQA 2J5OA 2ZSHB 5KNLA 3G73A 1KYZA 2VKDA 1XB4A 4DZJA 3ESWB 3DF8A 1JKOC 3IAM2 4IVNA 3E5QA 3HRUA 3M8JA 5F08A 1YQAA 2JT1A 2BHYA 2VQLA 2CQNA 3ELKA 2PJPA 1UAAA 5KK1A 5DS9A 3DBRB 2FE3A 5DUKA 5IYDJ 5DYMA 1TT0A 4GDFA 5JHFA 5E1XA 1XGNA 3V8LA 3EQLF 2OZ6A 1HKQA 3Q9VA 4M6XA 1S72I 5E17F 1IV8A 3RZOJ 4RGXA 2NOJB 2WY8Q 2A3SA 1Q1HA 5M5YJ 4RLQA 4EM2A 5GAHJ 3ZR8X 2NS8A 2WAEA 5J8FA 5JLWA 2Q0OA 4HNVA 2H09A 3K4KA 3Q0VA 1YITI 3F21A 2MLGA 1RR8C 4DW6A 3HOSA 2RQQA 2DMTA 4G6QA 2DO7A 2BY2A 3DLLF 1MBKA 3K6GA 4M3BA 2E5NA 2Z2SB 4IQ4A 5BPIA 3PL8A 2EFQA 3ROUA 1XSVA 2TRTA 3FDYA 4RB3C 5CVUA 4A12A 5D6FA 2ZNYA 5L3EA 1ULYA 3OY9A 1LDJA 1Z6RA 4OIQF 4A6EA 1M1EB 2R5ZA 4EJWA 4DYQA 2Q2EB 3L7WA 4G7OF 2JRMA 4LMYA 2F4MB 2ZB9A 1IRXA 4DBQA 3F22A 3QU3A 1HA8A 3R6SA 4XLFA 3L2CA 3HUGB 3WG7H 1ZLJA 1R71A 3HOXJ 3F8BA 4XICA 3ZCOA 3VSLA 4I02A 2RV8A 1V3FA 4XL9A 2QSFX 5L3BA 2ZO4A 3BZ6A 1FNNA 4M3FA 3OS1A 2KQRA 1TWCJ 1P4WA 4HPQA 4CYCB 3HGGA 3TOAA 2FX0A 3VODA 4BHCA 4L9JA 4A5MA 1O4XA 5CVVA 1GV5A 1SANA 1RRJA 3GFJA 4KIFA 2QUFA 2JA8J 4CCLA 3J81K 2GBYA 4KYWA 1B72A 2CUEA 4BGDA 3BC8A 4LG3A 3KETA 3LSKA 4XQFA 4XKWA 3I59A 1OMIA 3CDIA 2DW4A 2NS0A 4MLOA 3JW4A 2D45A 2ETHA 5L3DA 1Z05A 1DU6A 5D4RA 1TQMA 4UUSB 4Y13A 4YFXF 1DDNA 1H9TA 1MSEC 5A2QZ 2GOXB 2VJIA 2VASA 1H89C 1IF1A 1A31A 1ORKA 2A68F 1R5HA 3H9QA 5IYCJ 2FA5A 4GYIA 2MD5A 5HLIA 3OV8A 4CSWA 2Y2ZA 3OOPA 3I4NJ 2R5ZB 5A2QK 2PLYA 1IRFA 1S29A 4PFPA 4A3KJ 4AVPA 1LE8A 2P6TA 5IP9J 1MJBA 2K4BA 2DYSH 4FX4A 5C4XJ 2H8RA 2BVMA 3N05A 1EF4A 4Y52J 1BI1A 2QYOA 4MTDA 3L2RA 3QP5A 1MBEA 2MYSA 1FSEA 4BDYA 1JHFA 5D8LB 3ABTA 1SVOA 5GPCA 2XRLA 2ZMEB 2KIMA 1JT6A 1W5CC 1A36A 2LP0A 2QQ9A 2ECCA 1U2WA 1TZLA 3ZQQA 1OISA 3WTUC 3EUKL 3I55I 1A6IA 1VFCA 2V9KA 3DU5A 5DTDA 1I1GA 3KP5A 2GXAA 3WTVC 4LJZF 1LVAA 4LK0F 3CCLI 4WF2A 1R5ID 2LKSA 3DP7A 2EK5A 4BQNA 3S3OA 4AM3A 2XGEA 2PJRB 2XPVA 1B72B 4IKFA 3SYTA 4E6KG 1S8NA 2DA2A 2MG4A 4I7HA 4OMZA 2A05A 4WXDA 2R7XA 2V9VA 3NEUA 1D3YA 3BCBA 3I54A 4MQVA 3KCCA 4UUSA 3U2RA 2JSPA 1LNWA 4EVIA 2MC3A 5J6XA 4YRVA 4B4CA 2L02A 1XGMA 1RIOH 5CLSA 1YOVB 2ZSIB 1DGWY 4D1QA 1R4NB 2XV4S 1ETKA 2PMZN 1I3AA 3FMRA 5JLXA 3AG2H 3OSFA 2LRDA 3V4GA 4E7JA 2V1UA 5HDNA 2EJRA 4PGGA 3S16J 4HZFA 3TBIA 2W82A 4W97A 4XLNF 3E6BA 1Z3YA 2P5KA 4EJVA 3BR2A 1HW2A 2HYGD 4PK4A 3O8HA 4U0VA 2ELHA 3F0CA 1KA8A 3S93A 2FOKA 4CUGA 1T6SA 2E1MC 2DTZA 1TWGJ 3H9JA 1WI3A 1H0MA 4G12A 1R7JA 1WKMA 2YR2A 4Q48A 4XRSG 4XOTA 2FF4A 3GFLA 4X1EA 4FASD 2DN0A 3CUQB 1IN5A 2BEOA 1LDKB 3DTEA 2VJJA 1QPMA 4ESFA 1ETXA 1DQUA 3QRFF 2X0LA 3MQ0A 4IHXA 3IP4B 2IW5A 3FXQA 3IKVA 2X6WA 2CW8A 3DBHB 4ESBA 1JJ8C 2IRFG 1Z9CA 1JT0A 3R61A 4UVBA 3W6JB 1MNEA 1MD0A 3G1OA 5DCMA 2JQ7A 3BLYA 1VZ0A 2FQ3A 1J75A 1FP1D 2OZUA 2KRHA 1P92A 3I59B 1YFHA 4I76A 3PNTA 5E1WA 3JCUC 2VUMJ 1FTZA 2OUMA 2PQ8A 3GUDA 3RPUD 4LD5A 4XLEA 2HEOA 3CTAA 3JSOA 1FJLA 1DUXC 2DU9A 1NG6A 4PJLA 2PX9A 3SZPA 2R7DA 5FKMA 2Z5UA 2LD5A 5FKKA 1OPCA 2IPQX 3BR6A 2LDUA 2NAZA 2RVCA 2A5YB 2EA4A 4R79A 2HQNA 2VQGA 2ZKZA 2DPDA 4B44A 3I58A 3HPGA 2FQ4A 2GQQA 1V5EA 5LFAA 2IGOA 4KA4A 1BR4A 2XRNA 3HXLA 3K70C 2DMUA 2OC6A 2RGVA 5HODA 2X1CA 3TDZC 2YU9J 1WGXA 4RGUA 1ETYA 3TP0A 2DA4A 5FLXK 3FM5A 3BQZA 1HOMA 3TW6A 4WK8F 2K86A 1S7OA 1UMQA 2P0WA 3OOUA 4G8XA 1ZLKA 2Y31A 1G6NA 2EIMH 1ZRFA 4F52A 3KP2A 1OLTA 3RKYA 1YS6A 1Y1VJ 1SD7A 3MKLA 2QQ8A 3VB2A 1MMDA 4ZDOA 4NUBA 5J4VA 2E60A 3WU2C 2L9VA 3NWTA 1MH4A 1TT5B 2FBHA 3I53A 5H20A 1FMWA 3HDDA 1LFBA 3R0AA 4BAYA 2H6CA 2K9LA 4MFDA 4HEA2 3BDDA 1WQ2A 2HDWA 4HX7A 5BOXA 2JUCA 2L7KA 2HFHA 2IS4A 3CCYA 3L2QA 4E7KA 4ABZA 2R7TA 3D0SA 4XMYA 4CICA 2LBFA 3MEXA 3WE2A 5LEKA 5IOZA 3NWSA 2VI6A 4BEHA 1XTAA 3HHHA 4UV9A 2BZTA 5EYRA 3VDXA 5E18F 2DMPA 2K9QA 2X9DA 3RIRA 1BOBA 3T8TA 3K4LA 2DXIA 2UXNA 3I56I 3OYEA 3BJ6A 2R7OA 1SFOJ 2EV6A 4F91B 2R5YB 5E79C 3SEZA 2X1EA 2PN6A 1JKPC 9ANTA 4JP0A 1J2XA 5EJCA 4C30A 1FYKA 2NVQJ 5DV5A 3JR9A 1XC5A 1BW5A 4BE1A 2CV0A 5J1YA 1NH3A 4B43A 3OS0A 1O3SA 1WPKA 1RESA 2QKLB 1USTA 4A3EJ 3HRMA 5D4SA 3BQYA 3BY6A 1JTXA 2VXZA 3PFYA 2DK8A 2UUZA 3NRVA 2EILH 2LF8A 2NVYJ 1YYVA 3W2WA 4DBRA 3S17J 3HOVJ 1R22A 1PJRA 1MJ9A 3A4CA 2E2HJ 5LHHA 3E5XA 4A3LJ 4YIIA 3K4JA 3PUBA 1Z7LA 4K2EA 4IRGA 2CV1A 2M0CA 3FXUA 3H92A 4HV6A 3HHGA 4Z2YA 3CMEI 1KQ9A 2CSOA 2D1HA 3OSGA 1K78A 4LLGF 3TW7A 3BTIA 4GRIA 4BJ6C 5M3FJ 1D1CA 4OIRF 3BJOA 3CJRB 2HYJA 3X2QH 1SEUA 2F5EA 2M4KA 4YG2F 1E17A 2H6BA 2MW8A 3EDPA 4F3QA 3PNVA 1X2MA 3VPRA 3OYJA 3QPTA 3A0BC 5ED4A 3EUHA 3I9V2 3E6DA 4FCYA 2JPBA 5FFZA 5BMZA 4BYYA 2E7WA 3QPHA 2GLOA 2L01A 2ZC2A 1HDPA 1EA3A 2KRCA 2NVUB 3IRQA 5LHGA 4ZZDA 3ABKH 4MNUA 1OCZH 1BI2A 3CJQB 3OIQA 4OU0A 5ILSA 5GP9A 4UY8I 1WJBA 3E1SA 2COMA 2QKMB 2LK2A 3RZDJ 1BN5A 2CYYA 3KEOA 4GXOA 1WJFA 2DBBA 3WU1B 1VQLI 1JUSA 4C9YA 1X3UA 3K2ZA 3UR3C 1Y8RB 4XRFA 2MABA 3ML6A 3GFMA 2PEXA 3G1MA 2OF7A 3VSKA 1FOYA 1YG2A 4XKVA 2LYCA 2CMPA 4BXXJ 3JAMZ 2OTJI 1OCOH 3I4PA 3OL4A 5LEJA 1RC9A 1T8IA 1W5TA 4A0YA 2OJED 5IYBJ 2ZJQF 4XSXF 1JUPA 4YEJA 1UELB 1XN7A 5E3LA 3GTKJ 1FC3A 2G9WA 3V42A 5D5XB 4H0EA 4C2TA 5BNGA 1B9NA 3Q0WA 5IT9K 1FEXA 4EQQA 4EV0A 1KU3A 5HNHA 4ITVA 2KZGA 4R1HA 2M45A 2LLKA 2VLAA 1T2KA 3NAUA 5TRDA 1BM9A 1N78A 1U8RA 3DQVC 2K4JA 1B9MA 3BR5A 2OA4A 5EZGA 5E3OA 1IZ1A 2RREA 3GTMJ 5E8IA 2DQRA 4N4NB 1IXRC 3QODA 2NXNB 4QTRA 1PUFA 3GTGJ 4NNJA 2KT0A 1Q1VA 4BUPA 3FXOA 2K85A 4U87A 1SAUA 2FSWA 2HYFA 2LG4A 3WU0A 5HNFA 2B9SA 3TMOA 4FE7A 1IGNA 3C2HA 3GLXA 4GCVA 2H1KA 3CC2I 1SFEA 2PMUA 4M72A 4I0AA 1Y39A 2M4GA 4AC0A 3QPSA 5BQTA 5FKOA 1P9QC 3ZPLA 1R5GA 1IUYA 2R4GA 1LDDA 2B63J 4L0ZB 2ZFUA 4S04A 5LRSA 3E5UA 1YRNB 1O57A 3DEEA 5JI6A 1VTNC 3JRDA 1FOWA 1X4PA 2K3FA 1BOAA 1Y0UA 3OIOA 3CUQC 4F7ZA 2QBYB 4WX9A 4E7ZA 1AA7A 4XLHA 2L54A 2BW3A 1ENHA 5FFXA 1D0XA 2EWNA 4KICA 2M9HA 3PJRA 1U78A 2VE9A 3L09A 3BROA 2X4HA 2ISZA 1ERDA 3BR3A 1UFMA 4D7NA 3ASOH 5HLGA 2K40A 3H0DA 1YO5C 4WXCA 1R1VA 5FLXZ 2G7HA 4ENMA 2DT6A 3TQNA 3OYMA 2L4MA 4KDPA 1P4AA 2BGCA 4YIRX 1U5TB 1P6RA 1NG7A 3ZMDA 4BKXA 3F9KA 4HF0A 1B8IA 3BP8A 2ME0A 1IG7A 1KONA 2HVQA 2ZNZA 3DPTA 1AKHA 2H94A 1TW3A 5J8CA 2P8TA 3PSFA 4Y33A 4HQMA 4S0HB 4LIVA 1AWCA 1GT0C 2R7VA 3MCZA 3MN2A 2HKOA 4FTHA 2GA2A 4ZZLA 1SD5A 4L5EA 4CDGA 2XAJA 1P7IA 3H9GA 3IUOA 5K5QA 5IT9Z 1ON2A 3HZJA 1PP8F 2WV0A 3GO5A 1QZEA 5D5VB 2XSDC 4A3FJ 1DGRM 2XASA 2KDOA 2N8GA 4CXFA 3LWFA 3CESA 3RQ4A 3TO7A 2ZMEC 1KQ8A 1XCBA 2VT3A 3M1CA 5CPRB 3SZTA 5ICCA 3HOWJ 3PQJA 2E1OA 4HW0A 2GZWA 2W1OA 3CMAI 1ZGAA 3ZXSA 4BDZA 2FJ1A 3CLOA 1J9IA 2CFOA 2CQ7A 4UNOA 2FBIA 4O3MA 3GFIA 2VKHA 2W00A 2K9MA 3A01B 1G59A 3DPLC 3QU6A 1LEBA 3OL3A 3M07A 1TNTA 1LFPA 3MZHA 1RKWA 5HLHA 1OYYA 4OMYA 4ASNA 1N25A 1Y0NA 2A61A 2LREA 5KCMA 1HLVA 1U3EM 3HUGA 3ZQ7A 4TV7A 4UHTA 2HTJA 1JGGA 2Y30A 4FISA 1HW1A 4J00A 1TL8A 3F8CA 1D5VA 3GTJJ 1MMAA 2XPWA 2HR3A 1XMAA 2M7BA 2X1DA 2PMHA 3SQNA 3W6KB 2AS5F 4PZJA 3FK6A 1BA5A 4N4OB 3PUFA 4QWQA 3M4OJ 2CW7A 3RKXA 2AQEA 2GWRA 4LG0A 4DYRA 2IS6A 5IT3A 2W84A 2XB5A 3OYBA 3ZP5A 4H4KC 2O8XA 3EUAA 5B66C 4RGRA 2CJJA 1NK2P 3ECHA 1MZBA 2B7EA 2LY9A 1EH7A 3JSPA 4RM2A 2AO9A 4BEHB 2R7FA 1BIAA 2DA5A 2ELKA 2YU3A 2ZCWA 3G4SI 1WJEA 3GZ5A 5DCFA 2RDPA 4CCKA 1U5TC 3K4NA 3HM5A 4BJTA 3L00A 1DPRA 2Z9OA 3O3KA 1H9GA 3I0TA 4KT6A 4MFEA 1GHCA 3AKZA 3Q0UA 2R7SA 1KQ0A 2BV6A 1MMGA 2GXGA 1ODDA 1ZGJA 4BY7J 1J7KA 2VJ4A 5E3NA 1MMNA 1Z3XA 3QOPA 2VBYA 5FD5A 4PJJA 3S1RJ 1X1DA 1E3PA 2Z99A 5M3MJ 2P4WA 1XSXA 2H1LA 4J19A 3Q5FA 1VQKI 2V7FA 4M3GA 5DM6F 1OCPA 1HXDA 2QGUA 2Y9YA 1YLFA 5DD8A 3RYRA 2LOOA 4AIDA 4ZTJA 1VQPI 3HC7A 2OQRA 2BBYA 3K1NA 1QHGA 1MW7A 1Z21A 1J0RA 3S1NJ 1QQIA 4XR6A 1L0OC 4EGZA 3LL7A 3ABLH 2D5VA 2ACJA 3ZGKA 1ZARA 3CCJI 4KMFA 2HU9A 2A5WA 2DFEA 2O0YA 4IPAA 1ON1A 3GTLJ 2XIGA 4L9NA 1DPUA 1TNSA 2XF5A 4HAMA 4KT5C 4CZZA 4E7IA 3C18A 1D8JA 4HYEA 4QLCU 3HYIA 2P5LC 4UXNA 4EGYA 2TDXA 2HXIA 2F4OB 4HNUA 2BOLA 1S6LA 3F6VA 2IEKA 5EG0A 3KYLA 1LUJB 4B3XA 2FMYA 4ZTFA 4JQFA 3A0HC 3CUOA 2WAQA 4IJAA 2ZMEA 4AVZA 2R92J 3K2AA 1EJ9A 2KRFA 2OV7A 2JN6A 1ZAOA 1XG1A 3VFZA 1X19A 4AIHA 1KZHA 3K7AJ 5HVQC 3K4CA 2A6HF 2PI0A 4O6JA 2COBA 3F23A 1U8BA 4NBQA 1OFCX 1LE8B 1SD6A 1MH3A 2XKPA 3HOTA 4BBSJ 4CGZA 2EFWA 2QVOA 3AL0C 4CYDA 2BY0A 2VT2A 1ZK8A 3ABUA 2QLZA 4XRSA 4B3AA 1VQOI 2HQAA 4AWXB 1SVMA 3EETA 3HTUA 2JJ7A 4U7BA 1ZR2A 2LFBA 1UG0A 1F36A 3RKWA 1IRZA 2LNBA 3V7SA 3CCUI 1F5TA 3EUHC 3RPUA 2OD5A 2WBMA 2CW0F 2AQFA 1Z7UA 2HZDA 2M8GX 3O2PE 5ERIA 4AD9A 3J7ZI 2Y9ZA 3N4MA 3CQZJ 1SMTA 2F2EA 4HOBA 4XSZF 1IV6A 3LSJA 3K1PA 1N75A 3CP2A 4MTEA 1FYMA 2XGXA 3TGNA 2Z16A 3OYAA 4PJ0C 1IN4A 3CLQA 4RMNA 2IGMA 2O61A 1IC8A 3LA3A 4AIJA 1JTYA 1Z6TA 4M73A 2E36A 4I2OA 3F8NA 4G6TB 3SFIA 4ZDPA 2KIQA 6PAXA 3OYCA 3ZQGA 1SAXA 2ESNA 3K4MA 5KHDA 5F6FA 5ILVA 4L5JA 1TTYA 2ZXWH 2RN7A 5DUIA 3IKTA 2CV2A 3OR1C 3FBIB 4EJTA 1FIPA 1ETQA 2K7LA 3HEFA 4BY1J 2E7XA 3DKWA 1V4RA 3KE2A 4Q4ZF 1TQIA 2RAEA 4HDVA 3PIPF 1UG2A 4QPOA 3HIFA 3S15J 2CUZA 3KP7A 1YHQI 1GXQA 2ID3A 3HKZN 2HOAA 3ISPA 4IF4A 4DGWB 2BY3A 2QBYA 4YIFA 4RDUA 2EIJH 3ZMUA 2FBKA 4G9YA 1OQYA 3J80Z 3WHBA 4OIOF 3LFUA 3Q9SA 1BL0A 2NOGA 2YX7A 1UHSA 3FBNB 3B6AA 1U6GA 2HI3A 2HQ5A 4NHJA 5EDNA 3CP8A 2O8KA 5K1YA 3KZZA 1APLC 5GAEJ 4AYBN 1I6XA 1YS7A 3WGHA 4Q5SF 1B1BA 1O3QA 1XPXA 3CCEI 1VNDA 3WTTC 3CMYA 3ZMTA 3RTRA 5DM7F 5EEAA 3A1YA 1HDDC 4CCOA 2WADA 5FB2A 4FQGA 4LLNA 1K7AA 3FIWA 3QOEA 4M6YA 4II2A 1MKMA 3DKYA 1T0FA 2X6OA 1G3WA 1HBXG 4RB0A 2DLLA 4GGGA 3FXRA 2XPUA 4ZYHA 4PJMA 2EIKH 3IH4A 1MNMC 4M71A 3MKYB 1R36A 3CCVI 4KN7X 1YJNI 5K7FA 3RQIA 1GUUA 3ZQFA 4HNTA 4L9VA 2Y0MA 3BR1A
chains in the Genus database with same CATH topology
1V5FA 4C9YA 3RSNA 3UR3C 3IAM2 4XORA 2MABA 4XKBA 3BG6A 3M8JA 3U21A 3VSKA 3MKZA 3C2GA 2VQLA 4EATA 4XKVA 4P1WA 4D9JA 2LYCA 2CMPA 1UAAA 3OL4A 2LY2A 3OMYA 3OYDA 3HG9A 2KL4A 3BG7A 1TT0A 4P5OA 2XC7A 4DOZA 5JHFA 3DTKA 2DT7B 4CH7A 4YEJA 1UELB 4C2TA 3V42A 2O5RA 4DIQA 4OAZA 2VIXA 1YX5A 5HOOA 2NOJB 2WY8Q 4CZCA 2CH0A 5HNHA 2R7QA 4IX7A 2CS3A 4ITVA 4RLQA 4ZJZA 1D0ZA 3ZR8X 2WAEA 3E0JB 2VLAA 2MC4A 3OS2A 3OYLA 3K4KA 3HKZA 1N78A 3DQVC 3HOSA 2RQQA 2ZXHA 2RREA 3K6GA 4N4NB 3MD2A 2E5NA 2Z2SB 3QODA 2HPMA 1U0JA 1GLNA 4IQ4A 1WJAA 4NNJA 4ZC3A 4BUPA 2XDVA 3PL8A 4U87A 1SAUA 1QHHD 2LG4A 5HNFA 3TMOA 3FDYA 3MMYB 3C2HA 3OY9A 3TL4X 2K5CA 2KHMA 4B47A 4KITB 2M4GA 4Y3OA 4OWRB 1P9QC 2Q2EB 2Z1DA 3AFHA 2R4GA 2ZFUA 4F93B 3DEEA 1IRXA 2MFZA 5FROA 4DBQA 3LSMA 1HA8A 4BE2A 2E5ZA 1X4PA 3FHNA 4XLFA 3HUGB 3S32A 2LY1A 4E7ZA 1AA7A 4XLHA 3ZCOA 3VSLA 3LMMA 2BW3A 4XL9A 1D0XA 3PJRA 3CZ6A 3S8PA 4QPQA 3OS1A 3QYEA 2KQRA 4B48A 1ERDA 4HRIA 4HPQA 3H0DA 4CCNA 2DT6A 3OYMA 2V1NA 3UNGC 1NG7A 3F9KA 3QYBA 2W4SA 1KONA 2HVQA 3DPTA 4CCLA 2L9SA 4BGDA 3BC8A 4LG3A 3PSFA 3LSKA 4OAYA 2RNGA 4XKWA 4Y33A 4XQFA 4BE0A 1SFKA 4LIVA 3DPUA 4MLOA 2R7VA 3PSIA 4NC7A 3CF2A 4DJAA 2VL8A 1G8XA 3H9GA 2X6YA 3L2UA 1LVKA 1WJ5A 3IUOA 3OYIA 2GOXB 2VJIA 2VASA 1DGRM 3KX2A 3H9QA 2KDOA 3HL2A 3OWTA 3CESA 3RQ4A 4CSWA 4PSWA 5CPRB 2E1MB 3M1CA 3H35A 2DJIA 4PFPA 1LKXA 2W1OA 3DKXA 3ZXSA 3S3NA 4BDZA 4ANJA 2IS1A 4XLCA 2BVMA 3N05A 3K70D 4NQWB 2CFOA 4BQOA 5HLTA 2CUJA 2VKHA 2W00A 2K9MA 3D5RC 4PFOA 3SDBA 3L2RA 1G59A 2MYSA 3J7AY 3DPLC 4KJZA 4BDYA 3OL3A 2Q1ZB 3DWLE 1LFPA 2LC2A 2LREA 1TZLA 4PJNA 5KCMA 3ZQQA 3SZGA 2WY7Q 3EUKL 1E0EA 2V9KA 3DU5A 1WJDA 4J00A 3S3OA 1X1BA 4BQNA 4IZZA 5LD2C 3LSIA 2UV1A 2PMZA 2R7RA 2PJRB 3G2BA 4XONA 2K3PA 1MMAA 4IKFA 3SYTA 4BQQA 2X1DA 2M7BA 4E6KG 4ZYAA 4CA0A 4JOMA 2R7XA 2M7AA 2VXDA 3BCBA 2BVLA 2ZXIA 2HVSA 4N4OB 2I8DA 2JSPA 4AYBA 2CW7A 2JVHA 3VYUB 2AQEA 3VYTB 4XKCA 4YRVA 2KPMA 2ZSIB 2R7WA 1DGWY 2IS6A 4D1QA 2F6CA 3OYBA 3LSGA 4H4KC 3EUAA 1J09A 4XN0A 2F5VA 4XLAA 2LRDA 3CMMA 3IAS2 2MD0A 4E7JA 1S9HA 3OYNA 4HSTA 2DOAA 1Y56A 2ELJA 4RM2A 3TBIA 4BEHB 2W82A 3DTIA 5CKTA 1Z3YA 1WJEA 2IXSA 4PK4A 2A6TA 4LITA 2L9NA 4CCKA 3K4NA 4BJTA 3S93A 3OYFA 2XAUA 2F4IA 4CUGA 2E1MC 2KMUA 5CQEA 2FUG2 1WFXA 4KT6A 3OYGA 3AKZA 2V6EA 3H9JA 2R7SA 1MMGA 2LBFB 2VJ4A 1MMNA 1R6RA 1Z3XA 4XOTA 4PJJA 1X1DA 4FASD 4LIUA 1LDKB 3DTEA 2VJJA 1DQUA 2V7FA 4Y4RA 4ZTJA 3IP4B 2LOOA 3HC7A 2X6WA 2CW8A 2R7UA 3H5RA 4NC8A 2VJ5A 4E7SA 2WA0A 1QHGA 1MW7A 1Z21A 3HPHA 1YX3A 1MNEA 4XR6A 3LL7A 1WJFA 3BLYA 1VZ0A 3ZGKA 4BS9A 1YE9A 4E4HA 2HU9A 2KRHA 3FKJA 2A5WA 2IGNA 3PNTA 3L2VA 3K4BA 2OUMA 3DU6A 3RPUD 2XF5A 4XLEA 3RCOA 4X0GA 1K6YA 1NG6A 4E7IA 4PJLA 2JA2A 1W36D 4C2UA 2HPIA 4PSXA 4HNUA 4XNFA 2BOLA 1JI8A 3KYLA 4PUSA 3K10A 2HVRA 2HNHA 4B3XA 4R79A 2VQGA 4ZTFA 1FMVA 4JQFA 4B44A 3HPGA 2WAQA 1V5EA 4AVZA 5LFAA 2IGOA 3W3CA 3L2WA 2VB6A 3DLAA 1BR4A 5FRMA 3HXLA 2OV7A 3K70C 2OC6A 1D1AA 2X1CA 4FETA 1X19A 3PNYA 1BR2A 5HVQC 3K4CA 3GBGA 5FRNA 1QU3A 1PYVA 2WB1A 3HOTA 2P0WA 3OOUA 2PJRA 3VYSB 1MNDA 3AL0C 2L5QA 1DP3A 2DCEA 4F52A 1OLTA 2M3AA 3D5LA 2HQAA 1MMDA 4ZDOA 4NUBA 4U7BA 2E60A 3BCAA 1UG0A 3NWTA 3D5SC 3EUHC 4II3A 2WBMA 1FMWA 2AQFA 2HZDA 4CCJA 2IS2A 2K9LA 2X6XA 4HEA2 2M0MA 1T0FC 1V5GA 2HDWA 1BR1A 3MKWB 4E7LA 2L7KA 2IS4A 3L2QA 4E7KA 2R7TA 4XMYA 4XM3A 2LBFA 3H5NA 3QYFA 4F55A 2KLOA 3NWSA 3VYRB 2XF6A 1N75A 3CP2A 4IQJA 4BEHA 4HG2A 1Y6IA 3OYKA 2Z16A 3OYAA 3VDXA 2VQCA 4RMNA 2IGMA 1BOBA 2VQHA 5CQGA 3K4LA 2DXIA 4BXFA 3OYEA 2X51A 1X1CA 2R7OA 4J01A 4G6TB 4ZDPA 3OIPA 2BW3B 4YELA 4F91B 3OYCA 3SEZA 2X1EA 3K4MA 4KISA 5KHDA 3EPZA 4C30A 2JVGA 2V4JC 4BE1A 2UWMA 2CV2A 3OR1C 3FBIB 4XOPA 2CV0A 4XN3A 4B43A 3OS0A 2QKLB 1D1BA 1X4OA 2V26A 1OR7C 3SEQA 3W2VA 2VXZA 3PFYA 4QPOA 2JUGA 2UUZA 4BACA 2CUZA 3W2WA 4DBRA 1PJRA 2WAFA 1WJCA 4DGWB 2IGKA 3A4CA 3LSHA 3ZRGA 2W7NA 3I3LA 4E7HA 3AL0B 4RLFA 2Y0SA 3LFUA 1N77A 3K4JA 3OR2C 2L2OA 3PUBA 1Z7LA 2KP6A 3FBNB 3ONQA 2CV1A 4ZDLA 3CP8A 4AU7A 3KEYA 4CCMA 4BJ6C 4GRIA 1D1CA 3CJRB 3S3MA 3VWBA 2M4KA 2KZVA 4RM3A 1X1AA 3RTRA 3A1YA 1W36C 4CCOA 4F3QA 2XSJC 2WADA 3PNVA 3OYJA 4HSRA 4BL0B 3A2KA 3I9V2 3QOEA 3W2AA 4BJ5C 4II2A 3DKYA 2LH9A 2GOMA 1EA3A 2KRCA 3H5AA 2X85A 1T95A 2VPLA 5TGTA 4PJMA 1ZELA 1D0YA 3OYHA 3CJQB 3OIQA 4F92B 3MKYB 1WJBA 3E1SA 2ZSHB 5KNLA 2QKMB 4HNTA 2VKDA 4BU2A 2XF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUG B;  2Z2S B;  4NQW B;  2Q1Z B; 
#chains in the Genus database with same CATH topology
 1V5F A;  2YX4 A;  5HDG A;  2Q2E A;  3DBL B;  3RSN A;  4UUV A;  4IOA F;  1Z91 A;  4XOR A;  5E8G A;  3IL2 A;  3NAR A;  3HOY J;  1ZG1 A;  2ADU A;  3C2G A;  4EAT A;  4D9J A;  1QVT A;  2VKV A;  4RGS A;  1KU7 A;  2LY2 A;  1AHD P;  1IRG A;  3OYD A;  2KL4 A;  3FIS A;  2JWT A;  3BG7 A;  1WRJ A;  4P5O A;  3FXK A;  2Y69 H;  3HRS A;  1XMK A;  4DOZ A;  2HWV A;  3DFG A;  1BIB A;  2DT7 B;  1QZZ A;  2DFH A;  3ERM A;  2CQX A;  1IJW C;  3E97 A;  2FRH A;  4DIQ A;  3GF2 A;  4OAZ A;  2VIX A;  3DEW A;  5HOO A;  3L9F A;  4DYC A;  2CH0 A;  1ZG5 A;  5GTH C;  1V55 H;  2R7Q A;  5CJ9 A;  4IX7 A;  3O8G A;  4JX4 A;  2XUB A;  3FHZ A;  3WGG A;  3H1C A;  1D0Z A;  2DOE A;  5F27 A;  1T08 B;  3E0J B;  3FXJ A;  1W4M A;  5FLM J;  2HZT A;  3A03 A;  2DA3 A;  3OYL A;  3HKZ A;  3FMS A;  2NS7 A;  1FTT A;  4ZYE A;  1RET A;  1YJ9 I;  3CC4 I;  4HF2 A;  2ZXH A;  3BG5 A;  1XDS A;  3RPQ A;  1XGO A;  1HKT A;  1GDT A;  1T38 A;  3BPV A;  2HPM A;  4BHB A;  4ZC3 A;  3RI4 A;  1MDM B;  1XSD A;  1KGS A;  2MH2 A;  4V2F A;  1QBJ A;  1QHH D;  3FF5 A;  3WTX C;  3JRC A;  1PP7 U;  2ZJP F;  5KAI C;  1X3Z B;  3TL4 X;  2K5C A;  2KHM A;  4B47 A;  3ZQI A;  4KIT B;  3F3X A;  5J1U A;  2JMW A;  3ASN H;  4OWR B;  3WTY C;  5EGO B;  1W0T A;  4F93 B;  3CD6 I;  1B6A A;  1BC7 C;  2MFZ A;  5FRO A;  1D8K A;  3LSM A;  4L9T A;  5D5W B;  2H8W A;  2E5Z A;  3FHN A;  4KIB A;  1QPI A;  4N9H A;  1TQP A;  3NQO A;  1ZQ3 P;  2LY1 A;  2ISY A;  2QCO A;  4HX8 A;  1WI9 A;  3G71 I;  1IUF A;  1PUF B;  3N97 A;  1K61 A;  2O7O A;  2IA1 A;  3S8P A;  1UHW A;  5LGN A;  1RI7 A;  4QPQ A;  3AAF A;  2W25 A;  1AU7 A;  4B48 A;  4HRI A;  2VC0 A;  1ZRE A;  3B6C A;  1GV2 A;  5CYV A;  4RB1 A;  3A01 A;  3SJM A;  2V1N A;  3PQK A;  4AUX A;  3GEZ A;  2QF7 A;  3V8J A;  3O6B B;  4IO9 F;  3QYB A;  2W4S A;  2F5C A;  4D5F A;  3EYY A;  1J5Y A;  3F6O A;  5L3F A;  4GO1 A;  3IWF A;  4ZH4 F;  2DA6 A;  4OAY A;  2RNG A;  2LTP A;  3H0G J;  4M9Z A;  4BE0 A;  1VQ4 I;  1SFK A;  4D0P A;  5J1R A;  2OBP A;  3V8K A;  2HQR A;  4I01 A;  4Q47 A;  3A02 A;  2K27 A;  3PSI A;  3H3U A;  3PO3 J;  2VL8 A;  3BJA A;  4C3J J;  3L2U A;  1VQ9 I;  1WJ5 A;  2XAQ A;  5H6R A;  2MGQ A;  1YTY A;  1X58 A;  2XB0 X;  4Y7N J;  3P7N A;  5EF6 A;  1K4T A;  1FOK A;  5K5R A;  3KLO A;  3JRA A;  1RKT A;  1BJA A;  3HL2 A;  1XX5 A;  2LMD A;  2E1M B;  2W85 A;  5EGO A;  1UJ8 A;  1USS A;  2DJI A;  2XAH A;  5FLV A;  3S2H J;  1X2N A;  2JPC A;  4RAY A;  3JRH A;  3S3N A;  3CCR I;  4ANJ A;  4XLC A;  5HS7 A;  5JFR A;  4NQW B;  4BQO A;  4MIM A;  3P9I A;  4UB6 C;  2CUJ A;  2ZJ2 A;  3IC7 A;  4PFO A;  3HOU J;  2IBD A;  3LOC A;  2ZXJ A;  3WOD F;  2FD5 A;  4KJZ A;  2IA2 A;  4LK1 F;  4JX6 A;  2JRT A;  2EH3 A;  4HA8 A;  2EFN A;  1AOY A;  4A2U A;  4YFK F;  2LC2 A;  4KIG A;  3HSE A;  4NQW A;  2O9L A;  1T39 A;  2I10 A;  2WY7 Q;  2P81 A;  4G7H F;  2FNA A;  3AG1 H;  3CUQ A;  1FY7 A;  1WJD A;  2V1D A;  2R7Z J;  3KYD B;  1U9N A;  1LFU P;  3LSI A;  3HB9 A;  2R7R A;  2IP2 A;  1Z1D A;  1IN8 A;  2K3P A;  2XRO A;  2MH9 A;  4BQQ A;  5F1J A;  2UXX A;  2EA2 A;  4ZYA A;  3KPH A;  3ZOB A;  2I5U A;  2M7A A;  2VXD A;  1OCC H;  1OCR H;  2WV1 A;  5DCM B;  3CC7 I;  4BHP A;  4AYB A;  3DEU A;  1AKH B;  1I1S A;  2M1B A;  2JVH A;  5E1Z B;  3VYU B;  4XKC A;  5F64 A;  2NNY A;  3GTQ J;  2AHQ A;  1ZHF A;  2KPM A;  2LKP A;  2R7W A;  3I4M J;  2F6C A;  2MLK A;  2YUS A;  1Y1W J;  2GIV A;  2VOD A;  1ZN2 A;  1S7E A;  4UVA A;  2F5V A;  2M87 A;  4XLA A;  2MD0 A;  3I5U A;  1SD4 A;  1S9H A;  2Y75 A;  4NDL A;  3TED A;  1XDU A;  2BE5 F;  3CF5 F;  2IT0 A;  2DOA A;  1Y56 A;  2KDZ A;  4EM1 A;  2H27 A;  1PUE E;  2XAG A;  5J47 A;  5J3L A;  5CKT A;  3M7G A;  2HKX A;  2G7U A;  2B0L A;  2A6T A;  2FEZ A;  4LIT A;  2KKO A;  2R93 J;  1XGS A;  4IXA A;  3U1K A;  3MWM A;  1FOX A;  1YW7 A;  1O7F A;  1ZRD A;  4WWC A;  3OYF A;  2XAU A;  3CCM I;  2F4I A;  2LVS A;  2XGC A;  2KMU A;  2FUG 2;  2HOT A;  1V54 H;  2V6E A;  1XS9 A;  3BZC A;  1UCR A;  1TWA J;  5IP7 J;  1X1P A;  2OQG A;  4Z6Y A;  3JRF A;  2J5P A;  1ZH5 A;  2CQQ A;  2IVM A;  5ILU A;  2K02 A;  3REO A;  4PDK A;  1ONV A;  4W1U A;  3LSR A;  2GM4 A;  2VOP A;  3PO2 J;  3FXM A;  2PBI A;  2HOS A;  1IN6 A;  1E2X A;  3BTJ A;  5DD4 A;  3L1P A;  4CYC A;  3HSR A;  4RBO A;  4GFB A;  4BXU A;  2E19 A;  4JYK A;  3SDG A;  2R7U A;  3H5R A;  2K9S A;  4NC8 A;  3ZQC A;  2VJ5 A;  4E7S A;  3M9A A;  1ACI A;  3WHC A;  3WTS C;  2EB7 A;  5LGU A;  2L3D A;  5LLQ A;  4BS9 A;  4E4H A;  2QM3 A;  1MJA A;  2DQL A;  3FKJ A;  1W7P D;  3GME A;  4L5I A;  3L2V A;  1BI3 A;  1HCR A;  4MHG A;  2GXB A;  1ETW A;  4U0W A;  4A3B J;  1E3H A;  4O5V A;  1Z67 A;  5IOY A;  1K6Y A;  2V1X A;  3QAH A;  2JA2 A;  1W36 D;  4C2U A;  1RZ4 A;  2QSG X;  4PSX A;  1MDM A;  1KYW A;  1VQ7 I;  2NRA C;  1JI8 A;  1X3W B;  4PUS A;  2HVR A;  2HNH A;  4ETS A;  1A6Q A;  4RA2 A;  4HBL A;  2VOO A;  1WH5 A;  2XKO A;  1WH7 A;  5F04 A;  1FMV A;  3ZQL A;  2E1C A;  1I6H J;  5GPA A;  3CJN A;  3W3C A;  4E70 A;  3GWZ A;  4MO7 A;  5FKL A;  2RQP A;  2JA6 J;  1KU9 A;  4FT8 A;  1OKR A;  3BZK A;  4A3C J;  1VI0 A;  5F0F A;  4BQA A;  3GBG A;  1LEA A;  2C6Y A;  5C4J J;  1PYV A;  4A3D J;  1U5T A;  3ZMZ A;  4QSH A;  2WB1 A;  4A6D A;  2UZK A;  1MND A;  3M8E A;  3HSF A;  2JZY A;  2L7Z A;  5K7Z A;  1I5Z A;  3V7R A;  4M6V A;  3R60 A;  1GVJ A;  4KMU X;  3HGY A;  1XMX A;  4DNC A;  4U7D A;  4MQ9 F;  2RNJ A;  3E6M A;  3HRT A;  4OIP F;  5H2F C;  3BCA A;  3GCM A;  1S7A A;  5FD6 A;  3HBL A;  1JGS A;  1Z0X A;  3JRE A;  2VE8 A;  5TJJ A;  4II3 A;  2FU4 A;  2DDA A;  3R4K A;  2P5V A;  4I09 A;  4A69 C;  4FX0 A;  2IS2 A;  1B4A A;  1Z77 A;  2QZ8 A;  2X6X A;  1JJ6 C;  1T0F C;  4JX5 A;  1I27 A;  4ZYD A;  1G4D A;  5EZH A;  4E7L A;  3B02 A;  4XM3 A;  1REP C;  3H5N A;  3QYF A;  4OIN F;  4F55 A;  1QO0 D;  2KLO A;  5B1B H;  5M5W J;  2QQB A;  4C3I J;  3I64 A;  1Y6I A;  3OYK A;  1MBJ A;  1HSJ A;  2QSH X;  3H36 A;  4EEF G;  5CQG A;  4YFN F;  1OYI A;  3LFK A;  1G2H A;  4MEY F;  2X51 A;  5HS9 A;  5JR3 A;  4IRI A;  1PDN C;  5HDK A;  4J01 A;  5IY5 H;  1YW9 A;  2EBI A;  1C0W A;  2Y48 A;  2ME6 A;  1O7L A;  4KIS A;  4G7Z F;  1JKR C;  4D5C A;  2F5D A;  3U1D A;  4HLX A;  2V4J C;  2Z3Y A;  1P2F A;  3G1L A;  3P5J A;  1J59 A;  3MVP A;  1BBY A;  5F1R A;  1R1U A;  4IEJ A;  3C3W A;  1VF9 A;  4I99 C;  4N0B A;  4A93 J;  4EJU A;  2IA0 A;  2YS9 A;  2ID6 A;  2JUG A;  4PGH A;  1R23 A;  3TO9 A;  3JTH A;  4QIW N;  3FM3 A;  4BAC A;  3F72 A;  1MBF A;  3U9G A;  1IXS B;  1WJC A;  2IGK A;  1FP2 A;  4UVC A;  5H6Q A;  4UB8 C;  4PCQ A;  4FE4 A;  2W7N A;  3I3L A;  2DAO A;  2KFD A;  2Y0S A;  1TW2 A;  3FXL A;  1N77 A;  3OR2 C;  2WB1 N;  1F1Z A;  4KUM A;  2KP6 A;  1NHA A;  4RS8 A;  3LAJ A;  3ONQ A;  1NK3 P;  3PIO F;  4A0Z A;  3KEY A;  3HTS B;  3WGI A;  4CCM A;  2KIS A;  3S2D J;  3S1M J;  1BI0 A;  3S3M A;  3VWB A;  3P9C A;  3DV8 A;  2OCE A;  1SVL A;  1I39 A;  1X1A A;  3BTL A;  2STT A;  2FOW A;  2QEN A;  1W36 C;  2E71 A;  5HS8 A;  1P7J A;  4HSR A;  4BL0 B;  3S2W A;  3A2K A;  2HTS A;  2VBZ A;  2V9P A;  4IHT A;  4S05 A;  4X6A J;  1NTC A;  2F48 A;  4XRM A;  4BJ5 C;  3W2A A;  1A5J A;  2EFO A;  1W7P B;  3CDL A;  4RB2 C;  1T33 A;  4HLY A;  2KIF A;  2CGP A;  1T95 A;  5TGT A;  2XHK A;  4P9U A;  1EH8 A;  3C7J A;  1CGP A;  3KP4 A;  1LB2 A;  3OYH A;  4F92 B;  3LA2 A;  2MBF A;  1TC3 C;  1JKQ C;  1G3Y A;  2CWE A;  4BU2 A;  2XF7 A;  2LBF B;  4CHU A;  4XID A;  2WWY A;  2TCT A;  4NB5 A;  4MEX F;  5IP6 A;  2DT5 A;  2W48 A;  3EYI A;  4XKB A;  3BG6 A;  3U21 A;  4AIK A;  2VKE A;  1O3T A;  4EJO A;  3MKZ A;  4HQE A;  2OU2 A;  4A0X A;  4P1W A;  4M9S A;  4LOC A;  3J81 Z;  2M30 A;  1OJL A;  3JRI A;  4HX4 A;  1RUO A;  3OMY A;  3HG9 A;  5EEG A;  1XD7 A;  2XC7 A;  4HV5 A;  1UZC A;  2BXY A;  2DK5 A;  3DTK A;  2GAU A;  3VEP A;  4CH7 A;  1MBG A;  4I6Z A;  3KIO A;  4BH9 A;  1R9T J;  2O5R A;  3LA7 A;  4M3E A;  1ETO A;  1YX5 A;  4XK4 A;  3RJP A;  1MIJ A;  2L7M P;  4CZC A;  2GA1 A;  2CS3 A;  3K1M A;  3MZY A;  1I50 J;  4HDU A;  3T5X A;  4ZJZ A;  1R4M B;  3C1D A;  3BTC A;  1ETV A;  1IDY A;  2MC4 A;  5GTI C;  3OS2 A;  4DZP A;  3AG3 H;  2NVX J;  2EZL A;  2FML A;  4A3I J;  1QVU A;  3LQQ A;  4A3J J;  3G6E I;  1OYW A;  1HC8 A;  3MD2 A;  3ZMS A;  3BOQ A;  1U0J A;  1GLN A;  4CO8 A;  1WJA A;  1IN7 A;  3KYC B;  2XDV A;  3S14 J;  1K83 J;  2GIZ A;  2R3S A;  5KAF C;  3MMY B;  3SXY A;  2VBX A;  1YJW I;  1IW7 F;  1FBU A;  4ON0 A;  2L9R A;  5DEQ A;  2BXZ A;  4Y3O A;  4XBF A;  3GZ6 A;  2Z1D A;  3AFH A;  4B8X A;  1I3Q J;  2CG4 A;  1QRY A;  1YW8 A;  5AON A;  2ZFW A;  1SC7 A;  3HJE A;  5FKN A;  1O3R A;  2AXL A;  4BE2 A;  1TWH J;  5GAG J;  1TLH B;  3QPL A;  3S32 A;  1KU2 A;  2WAQ N;  3ABM H;  3IRR A;  3LMM A;  2ZBK A;  1W1W E;  4RAZ A;  3PFI A;  1FYL A;  3CZ6 A;  3V7C A;  2VC1 A;  2ECB A;  4V19 K;  3QYE A;  2JA5 J;  2EQR A;  2Y0S N;  3H3Z A;  5EG0 B;  3ULQ B;  2HDD A;  1U9O A;  3COA C;  4NC6 A;  3UKG A;  1GXP A;  4CCN A;  3IWZ A;  2O3F A;  4JK1 X;  1SMY F;  1FPQ A;  3RDI A;  4I0B A;  1HST A;  1TWF J;  3K9T A;  3UNG C;  3CO6 C;  1MMS A;  1QNT A;  3B73 A;  2W57 A;  2A07 F;  2P7V B;  3G3Z A;  1FBQ A;  5C44 J;  1UB9 A;  1XCV A;  2LSO A;  2L9S A;  3ZQH A;  1YIO A;  2VPR A;  1HKS A;  4A3M J;  2F5F A;  5ICG A;  4IOC F;  3I71 A;  3GLL A;  3DPU A;  3GYH X;  3TDU C;  3ERE D;  1FBS A;  2PFB A;  3P9K A;  4NC7 A;  4BNC A;  2E2J J;  1W0U A;  3CF2 A;  5GAD J;  2NVT J;  4DJA A;  4U0Y A;  1G8X A;  5L3C A;  3FX3 A;  4UUT A;  2X6Y A;  4P55 A;  2STW A;  5BS6 A;  1LVK A;  3LSP A;  5D5U B;  3GX4 X;  3OYI A;  2L4A A;  2CQK A;  2NYX A;  3BPX A;  2DMQ A;  2EPF A;  4IL6 C;  2W24 A;  3ZN1 A;  5ICF A;  5J4Y A;  2DJN A;  3KX2 A;  5FJ8 J;  4A3G J;  1SFX A;  5M5X J;  1JE8 A;  1WHU A;  5DDG A;  2HGC A;  2E1N A;  3OWT A;  4PSW A;  3H35 A;  2YPR A;  4GYG A;  2PG4 A;  1LKX A;  1IDZ A;  3AG4 H;  3DKX A;  4KNY A;  1EV7 A;  5E20 A;  1VQN I;  2IS1 A;  3TOB A;  1ZKG A;  1IO2 A;  5LHI A;  3K70 D;  5HLT A;  3QP6 A;  3BR0 A;  4P96 A;  5CVR A;  5BPD A;  3D5R C;  3SDB A;  2E2I J;  3GTO J;  1QA6 A;  3J7A Y;  3KZI C;  1FWZ A;  1JHH A;  2JK3 A;  2Q1Z B;  3DWL E;  1K6O A;  2OTL I;  5FGM A;  4MGR A;  1F4K A;  2EZK A;  1R00 A;  4PJN A;  3SZG A;  2E35 A;  3DCF A;  1E0E A;  1DU0 A;  1MBH A;  5C3E J;  2DFI A;  2JSC A;  1H88 C;  3KZY A;  3FWE A;  4RAG A;  3WTZ A;  1GVD A;  1X1B A;  4IZZ A;  5LD2 C;  2EFP A;  2AXT C;  3D1N I;  2UV1 A;  2PMZ A;  3G2B A;  4XON A;  5FO5 A;  3LST A;  1WVR A;  3E3V A;  2EIN H;  1STZ A;  4LG0 B;  4CA0 A;  1Y8Q B;  4JOM A;  2EZH A;  2KJC A;  2BVL A;  2ZXI A;  2HVS A;  1E3O C;  4D7M A;  2I8D A;  3LAP A;  1R58 A;  4WCG A;  1IAW A;  5LGT A;  1P4X A;  3VYT B;  1WSU A;  4ENJ A;  3GVA A;  2ESH A;  3LSG A;  3LNQ A;  1J09 A;  5JHU A;  4XN0 A;  3TKY A;  3WG9 A;  3FK7 A;  1CF7 A;  3CMM A;  3IAS 2;  4C3H J;  2KJB A;  2MSY A;  3OYN A;  4HST A;  4ENN A;  2ELJ A;  2ICW G;  3S1Q J;  2RC4 A;  3DTI A;  2FXA A;  1FT9 A;  3IHU A;  1VQ6 I;  2IXS A;  3T8R A;  2L9N A;  1CF7 B;  3JAM K;  4ESJ A;  1ZGW A;  5IPA A;  4LLL A;  1OR7 A;  5K7H A;  2M5W A;  5CQE A;  1YRN A;  1WFX A;  4B1R A;  3M3Y J;  3OYG A;  4LB6 B;  1TBX A;  2CU7 A;  3K0L A;  1VQ5 I;  2HS5 A;  1R6R A;  1PVE A;  3J7Y J;  1LQ1 A;  5ICE A;  4UV8 A;  3LQR A;  4LIU A;  3IH2 A;  3JRB A;  4Y4R A;  2DOD A;  2XAF A;  1CQT A;  1BC8 C;  4U88 A;  2KIU A;  3KEQ A;  2M8E A;  1K79 A;  2XGD A;  4Y15 A;  2OAZ A;  4M3D A;  2WA0 A;  3HPH A;  1YX3 A;  2DTR A;  3DXJ F;  3HOZ J;  2WTE A;  3BWG A;  2EV5 A;  3C2B A;  5LRR A;  2CO5 A;  1YE9 A;  4I98 B;  3CDH A;  2IGN A;  5B1A H;  3CCQ I;  2ZJR F;  3K4B A;  2DYR H;  3FZV A;  3DU6 A;  5JVT A;  3RCO A;  4X0G A;  3E7L A;  2QQA A;  2LF7 A;  5F0H A;  2QWW A;  2M2E A;  3GW2 A;  3GZN B;  4V2G A;  1WWX A;  2IAI A;  3BG9 A;  2HPI A;  5TIS C;  2V79 A;  4EMS A;  4XNF A;  1T56 A;  2A69 F;  5KVR A;  3K10 A;  3BG3 A;  2VON A;  2D1V A;  3MZ8 A;  3CCS I;  5EEH A;  1EKE A;  4IHV A;  3ZN0 A;  4M74 A;  4IHS A;  2CRG A;  4P9F A;  2NNN A;  2VBW A;  1RR7 A;  1T98 A;  4FHT A;  3L2W A;  2VB6 A;  3DLA A;  1YIJ I;  2DPU A;  5FRM A;  1D1A A;  4FET A;  4IHY A;  3R0J A;  1ZYR F;  3PNY A;  1BR2 A;  2V6C A;  1G3S A;  1LPQ A;  1DP7 P;  1OCT C;  3SFZ A;  5FRN A;  2BY1 A;  1F43 A;  2CUF A;  1QU3 A;  2YSR A;  1POG A;  2LR8 A;  1F9N A;  2PJR A;  3VYS B;  3MFK A;  2M34 A;  2DA7 A;  4N9I A;  1FSH A;  2DOF A;  2L5Q A;  2DA1 A;  2QEX I;  1DP3 A;  2DCE A;  5CVI A;  5K5O A;  2JA7 J;  1L3L A;  4A5N A;  1R1T A;  2M3A A;  5JVG F;  5E3M A;  2X48 A;  3D5L A;  4DQ2 A;  2LKX A;  1VQM I;  5J40 A;  3IH3 A;  1FLI A;  2WC2 A;  1QZY A;  3M8F A;  3J7A O;  4ZYG A;  3ZMV A;  4IHW A;  1LJ9 A;  3GXO A;  3D5S C;  3M1E A;  3JTG A;  3TP3 A;  4LB5 A;  4CCJ A;  2QA4 I;  2G0E A;  2M0M A;  1V5G A;  5D8K B;  2XVC A;  3IV5 A;  4EM0 B;  1D5Y A;  4KN4 X;  1BR1 A;  1EH6 A;  3MKW B;  2L0K A;  2OCC H;  1TP4 A;  3QQA A;  1WCM J;  4L0Y B;  1W5S A;  3RKQ A;  1ZG3 A;  3T1B A;  1B8I B;  2JTV A;  2EV0 A;  2BHZ A;  3WTW C;  1ZRC A;  2HDC A;  2P7C B;  3VYR B;  1A04 A;  2XF6 A;  2HOE A;  4IQJ A;  4HG2 A;  1HQC A;  1A35 A;  1ITY A;  2VQC A;  4R8H A;  2RKH A;  2VQH A;  3QWL A;  1K78 B;  4BXF A;  1X1C A;  5AIP A;  4JBA A;  1YI2 I;  3KP6 A;  1S3J A;  2BW3 B;  1BW6 A;  1UHM A;  3OIP A;  4YEL A;  3JRG A;  3EPZ A;  3PM1 A;  5CVJ A;  1ZTR A;  2DFF A;  5F0C A;  3GTP J;  1RPW A;  2JVG A;  3KFW X;  4C2M J;  2UWM A;  2E34 A;  4XOP A;  4XN3 A;  1SFU A;  2HXO A;  2O6G E;  3FKI J;  1D1B A;  1X4O A;  2V26 A;  1OR7 C;  3SEQ A;  3W2V A;  1HF0 A;  3SHF A;  4HF1 A;  1HW5 A;  1B59 A;  1VQ8 I;  2Z33 A;  2IJL A;  1FZP B;  3RYP A;  2DI3 A;  2WAF A;  2K9N A;  1QGP A;  2BYV E;  3Q3S A;  3LSH A;  2Q8K A;  1S5L C;  3ZRG A;  3CO7 C;  4E7H A;  1IXC A;  3AL0 B;  2A6E F;  4RLF A;  1FX7 A;  2P6S A;  3K69 A;  4WXH A;  4M9X A;  3MAJ A;  2L2O A;  4BBR J;  4G6D A;  4RAF A;  4L18 B;  3H3V K;  1WZ2 A;  1FIA A;  3ECO A;  2VN2 A;  1JXS A;  1BJZ A;  4ZDL A;  5L3G A;  4AU7 A;  4B09 A;  4IRH A;  3VOE A;  5B3S H;  1MGT A;  4OOI A;  5D6E A;  3F8M A;  2CFX A;  1RNL A;  3J80 K;  4KFC A;  2L7F P;  2KZV A;  4RM3 A;  2DMN A;  3BT9 A;  2R0Q C;  2XSJ C;  2R5Y A;  2EZI A;  4XLP F;  1ZR4 A;  3F8F A;  4G94 A;  3W6V A;  1RUN A;  2MA3 A;  3CJT B;  3WE3 A;  4Y17 A;  1H8A C;  3KLN A;  3TO6 A;  1G3T A;  3KP3 A;  5AIQ A;  1R49 A;  5B5E C;  2OPT A;  2LH9 A;  2GOM A;  1W7P A;  2FNP A;  1K4S A;  2DDB A;  1JUM A;  3H5A A;  2X85 A;  3E6C C;  4LFU A;  2VPL A;  3FMQ A;  1ZEL A;  2D2W A;  4LGW A;  1MSF C;  2O03 A;  1D0Y A;  4ENK A;  3T0Y A;  5LBQ A;  2J5O A;  2ZSH B;  5KNL A;  3G73 A;  1KYZ A;  2VKD A;  1XB4 A;  4DZJ A;  3ESW B;  3DF8 A;  1JKO C;  3IAM 2;  4IVN A;  3E5Q A;  3HRU A;  3M8J A;  5F08 A;  1YQA A;  2JT1 A;  2BHY A;  2VQL A;  2CQN A;  3ELK A;  2PJP A;  1UAA A;  5KK1 A;  5DS9 A;  3DBR B;  2FE3 A;  5DUK A;  5IYD J;  5DYM A;  1TT0 A;  4GDF A;  5JHF A;  5E1X A;  1XGN A;  3V8L A;  3EQL F;  2OZ6 A;  1HKQ A;  3Q9V A;  4M6X A;  1S72 I;  5E17 F;  1IV8 A;  3RZO J;  4RGX A;  2NOJ B;  2WY8 Q;  2A3S A;  1Q1H A;  5M5Y J;  4RLQ A;  4EM2 A;  5GAH J;  3ZR8 X;  2NS8 A;  2WAE A;  5J8F A;  5JLW A;  2Q0O A;  4HNV A;  2H09 A;  3K4K A;  3Q0V A;  1YIT I;  3F21 A;  2MLG A;  1RR8 C;  4DW6 A;  3HOS A;  2RQQ A;  2DMT A;  4G6Q A;  2DO7 A;  2BY2 A;  3DLL F;  1MBK A;  3K6G A;  4M3B A;  2E5N A;  2Z2S B;  4IQ4 A;  5BPI A;  3PL8 A;  2EFQ A;  3ROU A;  1XSV A;  2TRT A;  3FDY A;  4RB3 C;  5CVU A;  4A12 A;  5D6F A;  2ZNY A;  5L3E A;  1ULY A;  3OY9 A;  1LDJ A;  1Z6R A;  4OIQ F;  4A6E A;  1M1E B;  2R5Z A;  4EJW A;  4DYQ A;  2Q2E B;  3L7W A;  4G7O F;  2JRM A;  4LMY A;  2F4M B;  2ZB9 A;  1IRX A;  4DBQ A;  3F22 A;  3QU3 A;  1HA8 A;  3R6S A;  4XLF A;  3L2C A;  3HUG B;  3WG7 H;  1ZLJ A;  1R71 A;  3HOX J;  3F8B A;  4XIC A;  3ZCO A;  3VSL A;  4I02 A;  2RV8 A;  1V3F A;  4XL9 A;  2QSF X;  5L3B A;  2ZO4 A;  3BZ6 A;  1FNN A;  4M3F A;  3OS1 A;  2KQR A;  1TWC J;  1P4W A;  4HPQ A;  4CYC B;  3HGG A;  3TOA A;  2FX0 A;  3VOD A;  4BHC A;  4L9J A;  4A5M A;  1O4X A;  5CVV A;  1GV5 A;  1SAN A;  1RRJ A;  3GFJ A;  4KIF A;  2QUF A;  2JA8 J;  4CCL A;  3J81 K;  2GBY A;  4KYW A;  1B72 A;  2CUE A;  4BGD A;  3BC8 A;  4LG3 A;  3KET A;  3LSK A;  4XQF A;  4XKW A;  3I59 A;  1OMI A;  3CDI A;  2DW4 A;  2NS0 A;  4MLO A;  3JW4 A;  2D45 A;  2ETH A;  5L3D A;  1Z05 A;  1DU6 A;  5D4R A;  1TQM A;  4UUS B;  4Y13 A;  4YFX F;  1DDN A;  1H9T A;  1MSE C;  5A2Q Z;  2GOX B;  2VJI A;  2VAS A;  1H89 C;  1IF1 A;  1A31 A;  1ORK A;  2A68 F;  1R5H A;  3H9Q A;  5IYC J;  2FA5 A;  4GYI A;  2MD5 A;  5HLI A;  3OV8 A;  4CSW A;  2Y2Z A;  3OOP A;  3I4N J;  2R5Z B;  5A2Q K;  2PLY A;  1IRF A;  1S29 A;  4PFP A;  4A3K J;  4AVP A;  1LE8 A;  2P6T A;  5IP9 J;  1MJB A;  2K4B A;  2DYS H;  4FX4 A;  5C4X J;  2H8R A;  2BVM A;  3N05 A;  1EF4 A;  4Y52 J;  1BI1 A;  2QYO A;  4MTD A;  3L2R A;  3QP5 A;  1MBE A;  2MYS A;  1FSE A;  4BDY A;  1JHF A;  5D8L B;  3ABT A;  1SVO A;  5GPC A;  2XRL A;  2ZME B;  2KIM A;  1JT6 A;  1W5C C;  1A36 A;  2LP0 A;  2QQ9 A;  2ECC A;  1U2W A;  1TZL A;  3ZQQ A;  1OIS A;  3WTU C;  3EUK L;  3I55 I;  1A6I A;  1VFC A;  2V9K A;  3DU5 A;  5DTD A;  1I1G A;  3KP5 A;  2GXA A;  3WTV C;  4LJZ F;  1LVA A;  4LK0 F;  3CCL I;  4WF2 A;  1R5I D;  2LKS A;  3DP7 A;  2EK5 A;  4BQN A;  3S3O A;  4AM3 A;  2XGE A;  2PJR B;  2XPV A;  1B72 B;  4IKF A;  3SYT A;  4E6K G;  1S8N A;  2DA2 A;  2MG4 A;  4I7H A;  4OMZ A;  2A05 A;  4WXD A;  2R7X A;  2V9V A;  3NEU A;  1D3Y A;  3BCB A;  3I54 A;  4MQV A;  3KCC A;  4UUS A;  3U2R A;  2JSP A;  1LNW A;  4EVI A;  2MC3 A;  5J6X A;  4YRV A;  4B4C A;  2L02 A;  1XGM A;  1RIO H;  5CLS A;  1YOV B;  2ZSI B;  1DGW Y;  4D1Q A;  1R4N B;  2XV4 S;  1ETK A;  2PMZ N;  1I3A A;  3FMR A;  5JLX A;  3AG2 H;  3OSF A;  2LRD A;  3V4G A;  4E7J A;  2V1U A;  5HDN A;  2EJR A;  4PGG A;  3S16 J;  4HZF A;  3TBI A;  2W82 A;  4W97 A;  4XLN F;  3E6B A;  1Z3Y A;  2P5K A;  4EJV A;  3BR2 A;  1HW2 A;  2HYG D;  4PK4 A;  3O8H A;  4U0V A;  2ELH A;  3F0C A;  1KA8 A;  3S93 A;  2FOK A;  4CUG A;  1T6S A;  2E1M C;  2DTZ A;  1TWG J;  3H9J A;  1WI3 A;  1H0M A;  4G12 A;  1R7J A;  1WKM A;  2YR2 A;  4Q48 A;  4XRS G;  4XOT A;  2FF4 A;  3GFL A;  4X1E A;  4FAS D;  2DN0 A;  3CUQ B;  1IN5 A;  2BEO A;  1LDK B;  3DTE A;  2VJJ A;  1QPM A;  4ESF A;  1ETX A;  1DQU A;  3QRF F;  2X0L A;  3MQ0 A;  4IHX A;  3IP4 B;  2IW5 A;  3FXQ A;  3IKV A;  2X6W A;  2CW8 A;  3DBH B;  4ESB A;  1JJ8 C;  2IRF G;  1Z9C A;  1JT0 A;  3R61 A;  4UVB A;  3W6J B;  1MNE A;  1MD0 A;  3G1O A;  5DCM A;  2JQ7 A;  3BLY A;  1VZ0 A;  2FQ3 A;  1J75 A;  1FP1 D;  2OZU A;  2KRH A;  1P92 A;  3I59 B;  1YFH A;  4I76 A;  3PNT A;  5E1W A;  3JCU C;  2VUM J;  1FTZ A;  2OUM A;  2PQ8 A;  3GUD A;  3RPU D;  4LD5 A;  4XLE A;  2HEO A;  3CTA A;  3JSO A;  1FJL A;  1DUX C;  2DU9 A;  1NG6 A;  4PJL A;  2PX9 A;  3SZP A;  2R7D A;  5FKM A;  2Z5U A;  2LD5 A;  5FKK A;  1OPC A;  2IPQ X;  3BR6 A;  2LDU A;  2NAZ A;  2RVC A;  2A5Y B;  2EA4 A;  4R79 A;  2HQN A;  2VQG A;  2ZKZ A;  2DPD A;  4B44 A;  3I58 A;  3HPG A;  2FQ4 A;  2GQQ A;  1V5E A;  5LFA A;  2IGO A;  4KA4 A;  1BR4 A;  2XRN A;  3HXL A;  3K70 C;  2DMU A;  2OC6 A;  2RGV A;  5HOD A;  2X1C A;  3TDZ C;  2YU9 J;  1WGX A;  4RGU A;  1ETY A;  3TP0 A;  2DA4 A;  5FLX K;  3FM5 A;  3BQZ A;  1HOM A;  3TW6 A;  4WK8 F;  2K86 A;  1S7O A;  1UMQ A;  2P0W A;  3OOU A;  4G8X A;  1ZLK A;  2Y31 A;  1G6N A;  2EIM H;  1ZRF A;  4F52 A;  3KP2 A;  1OLT A;  3RKY A;  1YS6 A;  1Y1V J;  1SD7 A;  3MKL A;  2QQ8 A;  3VB2 A;  1MMD A;  4ZDO A;  4NUB A;  5J4V A;  2E60 A;  3WU2 C;  2L9V A;  3NWT A;  1MH4 A;  1TT5 B;  2FBH A;  3I53 A;  5H20 A;  1FMW A;  3HDD A;  1LFB A;  3R0A A;  4BAY A;  2H6C A;  2K9L A;  4MFD A;  4HEA 2;  3BDD A;  1WQ2 A;  2HDW A;  4HX7 A;  5BOX A;  2JUC A;  2L7K A;  2HFH A;  2IS4 A;  3CCY A;  3L2Q A;  4E7K A;  4ABZ A;  2R7T A;  3D0S A;  4XMY A;  4CIC A;  2LBF A;  3MEX A;  3WE2 A;  5LEK A;  5IOZ A;  3NWS A;  2VI6 A;  4BEH A;  1XTA A;  3HHH A;  4UV9 A;  2BZT A;  5EYR A;  3VDX A;  5E18 F;  2DMP A;  2K9Q A;  2X9D A;  3RIR A;  1BOB A;  3T8T A;  3K4L A;  2DXI A;  2UXN A;  3I56 I;  3OYE A;  3BJ6 A;  2R7O A;  1SFO J;  2EV6 A;  4F91 B;  2R5Y B;  5E79 C;  3SEZ A;  2X1E A;  2PN6 A;  1JKP C;  9ANT A;  4JP0 A;  1J2X A;  5EJC A;  4C30 A;  1FYK A;  2NVQ J;  5DV5 A;  3JR9 A;  1XC5 A;  1BW5 A;  4BE1 A;  2CV0 A;  5J1Y A;  1NH3 A;  4B43 A;  3OS0 A;  1O3S A;  1WPK A;  1RES A;  2QKL B;  1UST A;  4A3E J;  3HRM A;  5D4S A;  3BQY A;  3BY6 A;  1JTX A;  2VXZ A;  3PFY A;  2DK8 A;  2UUZ A;  3NRV A;  2EIL H;  2LF8 A;  2NVY J;  1YYV A;  3W2W A;  4DBR A;  3S17 J;  3HOV J;  1R22 A;  1PJR A;  1MJ9 A;  3A4C A;  2E2H J;  5LHH A;  3E5X A;  4A3L J;  4YII A;  3K4J A;  3PUB A;  1Z7L A;  4K2E A;  4IRG A;  2CV1 A;  2M0C A;  3FXU A;  3H92 A;  4HV6 A;  3HHG A;  4Z2Y A;  3CME I;  1KQ9 A;  2CSO A;  2D1H A;  3OSG A;  1K78 A;  4LLG F;  3TW7 A;  3BTI A;  4GRI A;  4BJ6 C;  5M3F J;  1D1C A;  4OIR F;  3BJO A;  3CJR B;  2HYJ A;  3X2Q H;  1SEU A;  2F5E A;  2M4K A;  4YG2 F;  1E17 A;  2H6B A;  2MW8 A;  3EDP A;  4F3Q A;  3PNV A;  1X2M A;  3VPR A;  3OYJ A;  3QPT A;  3A0B C;  5ED4 A;  3EUH A;  3I9V 2;  3E6D A;  4FCY A;  2JPB A;  5FFZ A;  5BMZ A;  4BYY A;  2E7W A;  3QPH A;  2GLO A;  2L01 A;  2ZC2 A;  1HDP A;  1EA3 A;  2KRC A;  2NVU B;  3IRQ A;  5LHG A;  4ZZD A;  3ABK H;  4MNU A;  1OCZ H;  1BI2 A;  3CJQ B;  3OIQ A;  4OU0 A;  5ILS A;  5GP9 A;  4UY8 I;  1WJB A;  3E1S A;  2COM A;  2QKM B;  2LK2 A;  3RZD J;  1BN5 A;  2CYY A;  3KEO A;  4GXO A;  1WJF A;  2DBB A;  3WU1 B;  1VQL I;  1JUS A;  4C9Y A;  1X3U A;  3K2Z A;  3UR3 C;  1Y8R B;  4XRF A;  2MAB A;  3ML6 A;  3GFM A;  2PEX A;  3G1M A;  2OF7 A;  3VSK A;  1FOY A;  1YG2 A;  4XKV A;  2LYC A;  2CMP A;  4BXX J;  3JAM Z;  2OTJ I;  1OCO H;  3I4P A;  3OL4 A;  5LEJ A;  1RC9 A;  1T8I A;  1W5T A;  4A0Y A;  2OJE D;  5IYB J;  2ZJQ F;  4XSX F;  1JUP A;  4YEJ A;  1UEL B;  1XN7 A;  5E3L A;  3GTK J;  1FC3 A;  2G9W A;  3V42 A;  5D5X B;  4H0E A;  4C2T A;  5BNG A;  1B9N A;  3Q0W A;  5IT9 K;  1FEX A;  4EQQ A;  4EV0 A;  1KU3 A;  5HNH A;  4ITV A;  2KZG A;  4R1H A;  2M45 A;  2LLK A;  2VLA A;  1T2K A;  3NAU A;  5TRD A;  1BM9 A;  1N78 A;  1U8R A;  3DQV C;  2K4J A;  1B9M A;  3BR5 A;  2OA4 A;  5EZG A;  5E3O A;  1IZ1 A;  2RRE A;  3GTM J;  5E8I A;  2DQR A;  4N4N B;  1IXR C;  3QOD A;  2NXN B;  4QTR A;  1PUF A;  3GTG J;  4NNJ A;  2KT0 A;  1Q1V A;  4BUP A;  3FXO A;  2K85 A;  4U87 A;  1SAU A;  2FSW A;  2HYF A;  2LG4 A;  3WU0 A;  5HNF A;  2B9S A;  3TMO A;  4FE7 A;  1IGN A;  3C2H A;  3GLX A;  4GCV A;  2H1K A;  3CC2 I;  1SFE A;  2PMU A;  4M72 A;  4I0A A;  1Y39 A;  2M4G A;  4AC0 A;  3QPS A;  5BQT A;  5FKO A;  1P9Q C;  3ZPL A;  1R5G A;  1IUY A;  2R4G A;  1LDD A;  2B63 J;  4L0Z B;  2ZFU A;  4S04 A;  5LRS A;  3E5U A;  1YRN B;  1O57 A;  3DEE A;  5JI6 A;  1VTN C;  3JRD A;  1FOW A;  1X4P A;  2K3F A;  1BOA A;  1Y0U A;  3OIO A;  3CUQ C;  4F7Z A;  2QBY B;  4WX9 A;  4E7Z A;  1AA7 A;  4XLH A;  2L54 A;  2BW3 A;  1ENH A;  5FFX A;  1D0X A;  2EWN A;  4KIC A;  2M9H A;  3PJR A;  1U78 A;  2VE9 A;  3L09 A;  3BRO A;  2X4H A;  2ISZ A;  1ERD A;  3BR3 A;  1UFM A;  4D7N A;  3ASO H;  5HLG A;  2K40 A;  3H0D A;  1YO5 C;  4WXC A;  1R1V A;  5FLX Z;  2G7H A;  4ENM A;  2DT6 A;  3TQN A;  3OYM A;  2L4M A;  4KDP A;  1P4A A;  2BGC A;  4YIR X;  1U5T B;  1P6R A;  1NG7 A;  3ZMD A;  4BKX A;  3F9K A;  4HF0 A;  1B8I A;  3BP8 A;  2ME0 A;  1IG7 A;  1KON A;  2HVQ A;  2ZNZ A;  3DPT A;  1AKH A;  2H94 A;  1TW3 A;  5J8C A;  2P8T A;  3PSF A;  4Y33 A;  4HQM A;  4S0H B;  4LIV A;  1AWC A;  1GT0 C;  2R7V A;  3MCZ A;  3MN2 A;  2HKO A;  4FTH A;  2GA2 A;  4ZZL A;  1SD5 A;  4L5E A;  4CDG A;  2XAJ A;  1P7I A;  3H9G A;  3IUO A;  5K5Q A;  5IT9 Z;  1ON2 A;  3HZJ A;  1PP8 F;  2WV0 A;  3GO5 A;  1QZE A;  5D5V B;  2XSD C;  4A3F J;  1DGR M;  2XAS A;  2KDO A;  2N8G A;  4CXF A;  3LWF A;  3CES A;  3RQ4 A;  3TO7 A;  2ZME C;  1KQ8 A;  1XCB A;  2VT3 A;  3M1C A;  5CPR B;  3SZT A;  5ICC A;  3HOW J;  3PQJ A;  2E1O A;  4HW0 A;  2GZW A;  2W1O A;  3CMA I;  1ZGA A;  3ZXS A;  4BDZ A;  2FJ1 A;  3CLO A;  1J9I A;  2CFO A;  2CQ7 A;  4UNO A;  2FBI A;  4O3M A;  3GFI A;  2VKH A;  2W00 A;  2K9M A;  3A01 B;  1G59 A;  3DPL C;  3QU6 A;  1LEB A;  3OL3 A;  3M07 A;  1TNT A;  1LFP A;  3MZH A;  1RKW A;  5HLH A;  1OYY A;  4OMY A;  4ASN A;  1N25 A;  1Y0N A;  2A61 A;  2LRE A;  5KCM A;  1HLV A;  1U3E M;  3HUG A;  3ZQ7 A;  4TV7 A;  4UHT A;  2HTJ A;  1JGG A;  2Y30 A;  4FIS A;  1HW1 A;  4J00 A;  1TL8 A;  3F8C A;  1D5V A;  3GTJ J;  1MMA A;  2XPW A;  2HR3 A;  1XMA A;  2M7B A;  2X1D A;  2PMH A;  3SQN A;  3W6K B;  2AS5 F;  4PZJ A;  3FK6 A;  1BA5 A;  4N4O B;  3PUF A;  4QWQ A;  3M4O J;  2CW7 A;  3RKX A;  2AQE A;  2GWR A;  4LG0 A;  4DYR A;  2IS6 A;  5IT3 A;  2W84 A;  2XB5 A;  3OYB A;  3ZP5 A;  4H4K C;  2O8X A;  3EUA A;  5B66 C;  4RGR A;  2CJJ A;  1NK2 P;  3ECH A;  1MZB A;  2B7E A;  2LY9 A;  1EH7 A;  3JSP A;  4RM2 A;  2AO9 A;  4BEH B;  2R7F A;  1BIA A;  2DA5 A;  2ELK A;  2YU3 A;  2ZCW A;  3G4S I;  1WJE A;  3GZ5 A;  5DCF A;  2RDP A;  4CCK A;  1U5T C;  3K4N A;  3HM5 A;  4BJT A;  3L00 A;  1DPR A;  2Z9O A;  3O3K A;  1H9G A;  3I0T A;  4KT6 A;  4MFE A;  1GHC A;  3AKZ A;  3Q0U A;  2R7S A;  1KQ0 A;  2BV6 A;  1MMG A;  2GXG A;  1ODD A;  1ZGJ A;  4BY7 J;  1J7K A;  2VJ4 A;  5E3N A;  1MMN A;  1Z3X A;  3QOP A;  2VBY A;  5FD5 A;  4PJJ A;  3S1R J;  1X1D A;  1E3P A;  2Z99 A;  5M3M J;  2P4W A;  1XSX A;  2H1L A;  4J19 A;  3Q5F A;  1VQK I;  2V7F A;  4M3G A;  5DM6 F;  1OCP A;  1HXD A;  2QGU A;  2Y9Y A;  1YLF A;  5DD8 A;  3RYR A;  2LOO A;  4AID A;  4ZTJ A;  1VQP I;  3HC7 A;  2OQR A;  2BBY A;  3K1N A;  1QHG A;  1MW7 A;  1Z21 A;  1J0R A;  3S1N J;  1QQI A;  4XR6 A;  1L0O C;  4EGZ A;  3LL7 A;  3ABL H;  2D5V A;  2ACJ A;  3ZGK A;  1ZAR A;  3CCJ I;  4KMF A;  2HU9 A;  2A5W A;  2DFE A;  2O0Y A;  4IPA A;  1ON1 A;  3GTL J;  2XIG A;  4L9N A;  1DPU A;  1TNS A;  2XF5 A;  4HAM A;  4KT5 C;  4CZZ A;  4E7I A;  3C18 A;  1D8J A;  4HYE A;  4QLC U;  3HYI A;  2P5L C;  4UXN A;  4EGY A;  2TDX A;  2HXI A;  2F4O B;  4HNU A;  2BOL A;  1S6L A;  3F6V A;  2IEK A;  5EG0 A;  3KYL A;  1LUJ B;  4B3X A;  2FMY A;  4ZTF A;  4JQF A;  3A0H C;  3CUO A;  2WAQ A;  4IJA A;  2ZME A;  4AVZ A;  2R92 J;  3K2A A;  1EJ9 A;  2KRF A;  2OV7 A;  2JN6 A;  1ZAO A;  1XG1 A;  3VFZ A;  1X19 A;  4AIH A;  1KZH A;  3K7A J;  5HVQ C;  3K4C A;  2A6H F;  2PI0 A;  4O6J A;  2COB A;  3F23 A;  1U8B A;  4NBQ A;  1OFC X;  1LE8 B;  1SD6 A;  1MH3 A;  2XKP A;  3HOT A;  4BBS J;  4CGZ A;  2EFW A;  2QVO A;  3AL0 C;  4CYD A;  2BY0 A;  2VT2 A;  1ZK8 A;  3ABU A;  2QLZ A;  4XRS A;  4B3A A;  1VQO I;  2HQA A;  4AWX B;  1SVM A;  3EET A;  3HTU A;  2JJ7 A;  4U7B A;  1ZR2 A;  2LFB A;  1UG0 A;  1F36 A;  3RKW A;  1IRZ A;  2LNB A;  3V7S A;  3CCU I;  1F5T A;  3EUH C;  3RPU A;  2OD5 A;  2WBM A;  2CW0 F;  2AQF A;  1Z7U A;  2HZD A;  2M8G X;  3O2P E;  5ERI A;  4AD9 A;  3J7Z I;  2Y9Z A;  3N4M A;  3CQZ J;  1SMT A;  2F2E A;  4HOB A;  4XSZ F;  1IV6 A;  3LSJ A;  3K1P A;  1N75 A;  3CP2 A;  4MTE A;  1FYM A;  2XGX A;  3TGN A;  2Z16 A;  3OYA A;  4PJ0 C;  1IN4 A;  3CLQ A;  4RMN A;  2IGM A;  2O61 A;  1IC8 A;  3LA3 A;  4AIJ A;  1JTY A;  1Z6T A;  4M73 A;  2E36 A;  4I2O A;  3F8N A;  4G6T B;  3SFI A;  4ZDP A;  2KIQ A;  6PAX A;  3OYC A;  3ZQG A;  1SAX A;  2ESN A;  3K4M A;  5KHD A;  5F6F A;  5ILV A;  4L5J A;  1TTY A;  2ZXW H;  2RN7 A;  5DUI A;  3IKT A;  2CV2 A;  3OR1 C;  3FBI B;  4EJT A;  1FIP A;  1ETQ A;  2K7L A;  3HEF A;  4BY1 J;  2E7X A;  3DKW A;  1V4R A;  3KE2 A;  4Q4Z F;  1TQI A;  2RAE A;  4HDV A;  3PIP F;  1UG2 A;  4QPO A;  3HIF A;  3S15 J;  2CUZ A;  3KP7 A;  1YHQ I;  1GXQ A;  2ID3 A;  3HKZ N;  2HOA A;  3ISP A;  4IF4 A;  4DGW B;  2BY3 A;  2QBY A;  4YIF A;  4RDU A;  2EIJ H;  3ZMU A;  2FBK A;  4G9Y A;  1OQY A;  3J80 Z;  3WHB A;  4OIO F;  3LFU A;  3Q9S A;  1BL0 A;  2NOG A;  2YX7 A;  1UHS A;  3FBN B;  3B6A A;  1U6G A;  2HI3 A;  2HQ5 A;  4NHJ A;  5EDN A;  3CP8 A;  2O8K A;  5K1Y A;  3KZZ A;  1APL C;  5GAE J;  4AYB N;  1I6X A;  1YS7 A;  3WGH A;  4Q5S F;  1B1B A;  1O3Q A;  1XPX A;  3CCE I;  1VND A;  3WTT C;  3CMY A;  3ZMT A;  3RTR A;  5DM7 F;  5EEA A;  3A1Y A;  1HDD C;  4CCO A;  2WAD A;  5FB2 A;  4FQG A;  4LLN A;  1K7A A;  3FIW A;  3QOE A;  4M6Y A;  4II2 A;  1MKM A;  3DKY A;  1T0F A;  2X6O A;  1G3W A;  1HBX G;  4RB0 A;  2DLL A;  4GGG A;  3FXR A;  2XPU A;  4ZYH A;  4PJM A;  2EIK H;  3IH4 A;  1MNM C;  4M71 A;  3MKY B;  1R36 A;  3CCV I;  4KN7 X;  1YJN I;  5K7F A;  3RQI A;  1GUU A;  3ZQF A;  4HNT A;  4L9V A;  2Y0M A;  3BR1 A; 
#chains in the Genus database with same CATH homology
 1V5F A;  4C9Y A;  3RSN A;  3UR3 C;  3IAM 2;  4XOR A;  2MAB A;  4XKB A;  3BG6 A;  3M8J A;  3U21 A;  3VSK A;  3MKZ A;  3C2G A;  2VQL A;  4EAT A;  4XKV A;  4P1W A;  4D9J A;  2LYC A;  2CMP A;  1UAA A;  3OL4 A;  2LY2 A;  3OMY A;  3OYD A;  3HG9 A;  2KL4 A;  3BG7 A;  1TT0 A;  4P5O A;  2XC7 A;  4DOZ A;  5JHF A;  3DTK A;  2DT7 B;  4CH7 A;  4YEJ A;  1UEL B;  4C2T A;  3V42 A;  2O5R A;  4DIQ A;  4OAZ A;  2VIX A;  1YX5 A;  5HOO A;  2NOJ B;  2WY8 Q;  4CZC A;  2CH0 A;  5HNH A;  2R7Q A;  4IX7 A;  2CS3 A;  4ITV A;  4RLQ A;  4ZJZ A;  1D0Z A;  3ZR8 X;  2WAE A;  3E0J B;  2VLA A;  2MC4 A;  3OS2 A;  3OYL A;  3K4K A;  3HKZ A;  1N78 A;  3DQV C;  3HOS A;  2RQQ A;  2ZXH A;  2RRE A;  3K6G A;  4N4N B;  3MD2 A;  2E5N A;  2Z2S B;  3QOD A;  2HPM A;  1U0J A;  1GLN A;  4IQ4 A;  1WJA A;  4NNJ A;  4ZC3 A;  4BUP A;  2XDV A;  3PL8 A;  4U87 A;  1SAU A;  1QHH D;  2LG4 A;  5HNF A;  3TMO A;  3FDY A;  3MMY B;  3C2H A;  3OY9 A;  3TL4 X;  2K5C A;  2KHM A;  4B47 A;  4KIT B;  2M4G A;  4Y3O A;  4OWR B;  1P9Q C;  2Q2E B;  2Z1D A;  3AFH A;  2R4G A;  2ZFU A;  4F93 B;  3DEE A;  1IRX A;  2MFZ A;  5FRO A;  4DBQ A;  3LSM A;  1HA8 A;  4BE2 A;  2E5Z A;  1X4P A;  3FHN A;  4XLF A;  3HUG B;  3S32 A;  2LY1 A;  4E7Z A;  1AA7 A;  4XLH A;  3ZCO A;  3VSL A;  3LMM A;  2BW3 A;  4XL9 A;  1D0X A;  3PJR A;  3CZ6 A;  3S8P A;  4QPQ A;  3OS1 A;  3QYE A;  2KQR A;  4B48 A;  1ERD A;  4HRI A;  4HPQ A;  3H0D A;  4CCN A;  2DT6 A;  3OYM A;  2V1N A;  3UNG C;  1NG7 A;  3F9K A;  3QYB A;  2W4S A;  1KON A;  2HVQ A;  3DPT A;  4CCL A;  2L9S A;  4BGD A;  3BC8 A;  4LG3 A;  3PSF A;  3LSK A;  4OAY A;  2RNG A;  4XKW A;  4Y33 A;  4XQF A;  4BE0 A;  1SFK A;  4LIV A;  3DPU A;  4MLO A;  2R7V A;  3PSI A;  4NC7 A;  3CF2 A;  4DJA A;  2VL8 A;  1G8X A;  3H9G A;  2X6Y A;  3L2U A;  1LVK A;  1WJ5 A;  3IUO A;  3OYI A;  2GOX B;  2VJI A;  2VAS A;  1DGR M;  3KX2 A;  3H9Q A;  2KDO A;  3HL2 A;  3OWT A;  3CES A;  3RQ4 A;  4CSW A;  4PSW A;  5CPR B;  2E1M B;  3M1C A;  3H35 A;  2DJI A;  4PFP A;  1LKX A;  2W1O A;  3DKX A;  3ZXS A;  3S3N A;  4BDZ A;  4ANJ A;  2IS1 A;  4XLC A;  2BVM A;  3N05 A;  3K70 D;  4NQW B;  2CFO A;  4BQO A;  5HLT A;  2CUJ A;  2VKH A;  2W00 A;  2K9M A;  3D5R C;  4PFO A;  3SDB A;  3L2R A;  1G59 A;  2MYS A;  3J7A Y;  3DPL C;  4KJZ A;  4BDY A;  3OL3 A;  2Q1Z B;  3DWL E;  1LFP A;  2LC2 A;  2LRE A;  1TZL A;  4PJN A;  5KCM A;  3ZQQ A;  3SZG A;  2WY7 Q;  3EUK L;  1E0E A;  2V9K A;  3DU5 A;  1WJD A;  4J00 A;  3S3O A;  1X1B A;  4BQN A;  4IZZ A;  5LD2 C;  3LSI A;  2UV1 A;  2PMZ A;  2R7R A;  2PJR B;  3G2B A;  4XON A;  2K3P A;  1MMA A;  4IKF A;  3SYT A;  4BQQ A;  2X1D A;  2M7B A;  4E6K G;  4ZYA A;  4CA0 A;  4JOM A;  2R7X A;  2M7A A;  2VXD A;  3BCB A;  2BVL A;  2ZXI A;  2HVS A;  4N4O B;  2I8D A;  2JSP A;  4AYB A;  2CW7 A;  2JVH A;  3VYU B;  2AQE A;  3VYT B;  4XKC A;  4YRV A;  2KPM A;  2ZSI B;  2R7W A;  1DGW Y;  2IS6 A;  4D1Q A;  2F6C A;  3OYB A;  3LSG A;  4H4K C;  3EUA A;  1J09 A;  4XN0 A;  2F5V A;  4XLA A;  2LRD A;  3CMM A;  3IAS 2;  2MD0 A;  4E7J A;  1S9H A;  3OYN A;  4HST A;  2DOA A;  1Y56 A;  2ELJ A;  4RM2 A;  3TBI A;  4BEH B;  2W82 A;  3DTI A;  5CKT A;  1Z3Y A;  1WJE A;  2IXS A;  4PK4 A;  2A6T A;  4LIT A;  2L9N A;  4CCK A;  3K4N A;  4BJT A;  3S93 A;  3OYF A;  2XAU A;  2F4I A;  4CUG A;  2E1M C;  2KMU A;  5CQE A;  2FUG 2;  1WFX A;  4KT6 A;  3OYG A;  3AKZ A;  2V6E A;  3H9J A;  2R7S A;  1MMG A;  2LBF B;  2VJ4 A;  1MMN A;  1R6R A;  1Z3X A;  4XOT A;  4PJJ A;  1X1D A;  4FAS D;  4LIU A;  1LDK B;  3DTE A;  2VJJ A;  1DQU A;  2V7F A;  4Y4R A;  4ZTJ A;  3IP4 B;  2LOO A;  3HC7 A;  2X6W A;  2CW8 A;  2R7U A;  3H5R A;  4NC8 A;  2VJ5 A;  4E7S A;  2WA0 A;  1QHG A;  1MW7 A;  1Z21 A;  3HPH A;  1YX3 A;  1MNE A;  4XR6 A;  3LL7 A;  1WJF A;  3BLY A;  1VZ0 A;  3ZGK A;  4BS9 A;  1YE9 A;  4E4H A;  2HU9 A;  2KRH A;  3FKJ A;  2A5W A;  2IGN A;  3PNT A;  3L2V A;  3K4B A;  2OUM A;  3DU6 A;  3RPU D;  2XF5 A;  4XLE A;  3RCO A;  4X0G A;  1K6Y A;  1NG6 A;  4E7I A;  4PJL A;  2JA2 A;  1W36 D;  4C2U A;  2HPI A;  4PSX A;  4HNU A;  4XNF A;  2BOL A;  1JI8 A;  3KYL A;  4PUS A;  3K10 A;  2HVR A;  2HNH A;  4B3X A;  4R79 A;  2VQG A;  4ZTF A;  1FMV A;  4JQF A;  4B44 A;  3HPG A;  2WAQ A;  1V5E A;  4AVZ A;  5LFA A;  2IGO A;  3W3C A;  3L2W A;  2VB6 A;  3DLA A;  1BR4 A;  5FRM A;  3HXL A;  2OV7 A;  3K70 C;  2OC6 A;  1D1A A;  2X1C A;  4FET A;  1X19 A;  3PNY A;  1BR2 A;  5HVQ C;  3K4C A;  3GBG A;  5FRN A;  1QU3 A;  1PYV A;  2WB1 A;  3HOT A;  2P0W A;  3OOU A;  2PJR A;  3VYS B;  1MND A;  3AL0 C;  2L5Q A;  1DP3 A;  2DCE A;  4F52 A;  1OLT A;  2M3A A;  3D5L A;  2HQA A;  1MMD A;  4ZDO A;  4NUB A;  4U7B A;  2E60 A;  3BCA A;  1UG0 A;  3NWT A;  3D5S C;  3EUH C;  4II3 A;  2WBM A;  1FMW A;  2AQF A;  2HZD A;  4CCJ A;  2IS2 A;  2K9L A;  2X6X A;  4HEA 2;  2M0M A;  1T0F C;  1V5G A;  2HDW A;  1BR1 A;  3MKW B;  4E7L A;  2L7K A;  2IS4 A;  3L2Q A;  4E7K A;  2R7T A;  4XMY A;  4XM3 A;  2LBF A;  3H5N A;  3QYF A;  4F55 A;  2KLO A;  3NWS A;  3VYR B;  2XF6 A;  1N75 A;  3CP2 A;  4IQJ A;  4BEH A;  4HG2 A;  1Y6I A;  3OYK A;  2Z16 A;  3OYA A;  3VDX A;  2VQC A;  4RMN A;  2IGM A;  1BOB A;  2VQH A;  5CQG A;  3K4L A;  2DXI A;  4BXF A;  3OYE A;  2X51 A;  1X1C A;  2R7O A;  4J01 A;  4G6T B;  4ZDP A;  3OIP A;  2BW3 B;  4YEL A;  4F91 B;  3OYC A;  3SEZ A;  2X1E A;  3K4M A;  4KIS A;  5KHD A;  3EPZ A;  4C30 A;  2JVG A;  2V4J C;  4BE1 A;  2UWM A;  2CV2 A;  3OR1 C;  3FBI B;  4XOP A;  2CV0 A;  4XN3 A;  4B43 A;  3OS0 A;  2QKL B;  1D1B A;  1X4O A;  2V26 A;  1OR7 C;  3SEQ A;  3W2V A;  2VXZ A;  3PFY A;  4QPO A;  2JUG A;  2UUZ A;  4BAC A;  2CUZ A;  3W2W A;  4DBR A;  1PJR A;  2WAF A;  1WJC A;  4DGW B;  2IGK A;  3A4C A;  3LSH A;  3ZRG A;  2W7N A;  3I3L A;  4E7H A;  3AL0 B;  4RLF A;  2Y0S A;  3LFU A;  1N77 A;  3K4J A;  3OR2 C;  2L2O A;  3PUB A;  1Z7L A;  2KP6 A;  3FBN B;  3ONQ A;  2CV1 A;  4ZDL A;  3CP8 A;  4AU7 A;  3KEY A;  4CCM A;  4BJ6 C;  4GRI A;  1D1C A;  3CJR B;  3S3M A;  3VWB A;  2M4K A;  2KZV A;  4RM3 A;  1X1A A;  3RTR A;  3A1Y A;  1W36 C;  4CCO A;  4F3Q A;  2XSJ C;  2WAD A;  3PNV A;  3OYJ A;  4HSR A;  4BL0 B;  3A2K A;  3I9V 2;  3QOE A;  3W2A A;  4BJ5 C;  4II2 A;  3DKY A;  2LH9 A;  2GOM A;  1EA3 A;  2KRC A;  3H5A A;  2X85 A;  1T95 A;  2VPL A;  5TGT A;  4PJM A;  1ZEL A;  1D0Y A;  3OYH A;  3CJQ B;  3OIQ A;  4F92 B;  3MKY B;  1WJB A;  3E1S A;  2ZSH B;  5KNL A;  2QKM B;  4HNT A;  2VKD A;  4BU2 A;  2XF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...