3HUGB

Crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
HHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transcription/membrane protein
molecule keywords RNA polymerase sigma factor
total genus 21
structure length 62
sequence length 62
chains with identical sequence D, F, H, J, L, N, P, R, T
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13490 zf-HC2 Putative zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hugB00
3HUGB 2Z2SB 4NQWB 2Q1ZB
chains in the Genus database with same CATH superfamily
2ZKZA 2BW3A 1SEUA 1WJCA 5J4VA 2BXZA 3OYCA 1V4RA 3IH4A 1Y1VJ 3HSRA 1ZRCA 1RNLA 4KICA 5H20A 4E7JA 2O8KA 1E0EA 2BY1A 3TP0A 3WTZA 2D2WA 3LSGA 4F93B 3C3WA 4N9HA 2ZJRF 4EJWA 1GUUA 1ZYRF 3PM1A 4RMNA 1ONVA 1RUNA 2AS5F 2XGEA 5K5RA 4AYBA 2Z3YA 4EGZA 5C4XJ 3AG2H 2ETHA 1WJBA 4ZTFA 2P6SA 4AIKA 4QTRA 2ELHA 1EH6A 3HSFA 1GHCA 3LSTA 5IT3A 2DJIA 1LJ9A 3GW2A 4I99C 2K4JA 2KJCA 1RR8C 5A2QZ 2HZDA 2KISA 1RC9A 2P7CB 4XNFA 3PQKA 1W5SA 4ENJA 1VQPI 4M6XA 3K9TA 4OIRF 3ZQCA 1FOYA 3I53A 5DV5A 1T95A 2VI6A 4BJTA 3JRGA 3BQYA 2XAUA 4KNYA 4LFUA 1S8NA 1JKQC 3GTOJ 2VB6A 3LQRA 5F08A 9ANTA 2RV8A 2J5OA 3TL4X 2XPVA 4ZYGA 4UUTA 3PIPF 4DYRA 3GFJA 2ZSIB 4XLNF 3KLNA 2VE9A 1AWCA 3HOWJ 4KT5C 2DAOA 3DEEA 1BJAA 5DCMB 1D8KA 1SVMA 2F4OB 3WGHA 5IYDJ 5HLGA 1FNNA 2BZTA 3HC7A 2JA7J 5IP7J 1HSTA 1W7PB 4PJ0C 5GTHC 5HNFA 1S29A 1R4NB 2QLZA 3CC2I 2DMPA 3G6EI 3S3MA 5DTDA 4BEHA 2WBMA 3WHCA 5TJJA 2PQ8A 4II2A 2A69F 2HXIA 5CVUA 3RKXA 2OTJI 1EA3A 1V54H 1V5EA 2XV4S 4M72A 3BDDA 1Y8QB 1MNMC 1QO0D 3PO2J 4BACA 3LSMA 2OBPA 3NARA 3V8LA 4QWQA 3HTSB 1JXSA 4XLEA 1UZCA 3DLAA 3J7AY 1DUXC 4OIQF 3RKQA 1VQ5I 2KRCA 3DP7A 3BR5A 5C44J 1I27A 1TT5B 2CW0F 2ZMEC 3BR6A 2JSPA 1R6RA 4B09A 4M71A 3H3ZA 3GYHX 4RS8A 2W85A 1G2HA 3OL4A 4DZJA 4IRHA 4XBFA 5TISC 1R58A 4C3IJ 2RREA 3RYRA 3CESA 3LSRA 4BBSJ 2E1NA 1GVJA 1BJZA 1BOAA 1FT9A 1AOYA 1XMKA 5GP9A 2FQ3A 4K2EA 4EQQA 2IJLA 4BHCA 1ZREA 2M3AA 1R5HA 2V26A 5FLVA 3J7AO 2L02A 2Y30A 2DU9A 2RKHA 4CHUA 4A3KJ 2V6CA 2WAFA 2CV0A 1JJ6C 2DFHA 1B72A 2DODA 4LG3A 2R7TA 5LEJA 1QNTA 1Z6RA 4BQAA 3V8JA 3LFUA 5HVQC 4XONA 3T5XA 1WI3A 2L9VA 2DFFA 3P5JA 4D9JA 3BR2A 3H5AA 3K4JA 4PDKA 4DIQA 2ZSHB 5JHFA 4EJVA 2D5VA 4HOBA 1EJ9A 5FD6A 3L2QA 4A3MJ 1FIAA 5L3CA 2F6CA 3CCVI 2NVTJ 2Q1ZB 1LE8B 1U6GA 2E1MC 5CQEA 2CMPA 2UV1A 4XSZF 3M8JA 1VZ0A 3CJQB 4ESBA 1BI3A 1E2XA 2R7RA 2JTVA 1U78A 3ZMDA 2WB1N 1Z7UA 4HA8A 2GLOA 3AKZA 2A5YB 3C1DA 3OR2C 4G7ZF 1WVRA 4UUSB 3F23A 4P9FA 1JI8A 1Z77A 3OYHA 2F5VA 4XN0A 4ZDLA 3HZJA 3DF8A 4BQQA 3G1MA 2FMLA 3M8FA 4XMYA 1LKXA 4N9IA 3J81Z 5H6QA 1ZARA 4JP0A 1VQOI 1K78B 3BCAA 4N4NB 3S1NJ 1RR7A 2X6OA 1QVUA 4CXFA 5J1RA 1T38A 1J9IA 5DEQA 2A6HF 4MIMA 5DD4A 1DPRA 1XX5A 1NK3P 1H9GA 3GTPJ 1SD6A 5D5XB 3AG3H 2GOXB 4B43A 1MDMA 4YIRX 5E1ZB 1R5ID 3K4NA 2LF7A 2FA5A 2LTPA 1OYYA 1IN7A 2Z99A 4XRMA 3H3VK 4EJUA 2KDZA 1B1BA 2VKVA 2XKOA 1K61A 3KZIC 1X1BA 3CO6C 1A31A 4HNUA 4XOPA 2XGCA 3BROA 4UVAA 2R5ZA 3HUGA 1I3QJ 1I3AA 2VKHA 1IW7F 4U87A 3S8PA 4ZJZA 1TLHB 2IPQX 4FQGA 2FBIA 3K4BA 2PG4A 3X2QH 5K7HA 1KU2A 4XM3A 5D6FA 4H0EA 1XC5A 2LLKA 3QOEA 1TC3C 4KMFA 4HF2A 3GLXA 1IUFA 4I6ZA 2IGKA 3M1EA 3HOSA 2CV2A 4OWRB 2ME6A 3MFKA 1ZR2A 3GZNB 3G73A 4DOZA 5L3EA 1ZTRA 4CA0A 4LMYA 1W7PA 2BHYA 1QZYA 1OCPA 3E7LA 5BS6A 1TWFJ 3CJNA 4LB6B 1MKMA 1Z05A 1MBFA 1YYVA 3HOXJ 1MMSA 2OZ6A 1TBXA 4Y4RA 2UUZA 3KPHA 2H1LA 3H9JA 1ETYA 3BT9A 3OYEA 2MABA 2HGCA 2HVRA 1UMQA 1ZGAA 3LSIA 1X3UA 3F8CA 3I64A 5F6FA 3LOCA 1O3RA 1HF0A 1YS7A 3Q0WA 1A04A 3VOEA 3OYFA 1KA8A 2XGDA 3F9KA 2YX7A 4RDUA 4R1HA 5FB2A 5AIPA 3DCFA 1DDNA 3EETA 1FBQA 2K9QA 2BVMA 1W4MA 3WTVC 3MZYA 1BR4A 1XTAA 3WTUC 5EYRA 2HU9A 2DQRA 2KIUA 4NB5A 1MJAA 3PSFA 1KU9A 4JBAA 2NAZA 2KPMA 1SFOJ 2L7FP 2WV0A 3ASOH 5CVRA 1VQMI 4Q5SF 4HV5A 2Z16A 4E4HA 1U8RA 4ZYHA 4HPQA 2IGOA 2G0EA 2DXIA 5JR3A 2MH9A 4X6AJ 5D6EA 1A5JA 1IDZA 4ZYDA 1U9NA 4FE7A 2F4IA 2VT2A 1FOKA 2IP2A 2DN0A 4I01A 3DLLF 4A5NA 5E1WA 3JR9A 2HYJA 2AQEA 5FLXZ 2MBFA 2FXAA 4AIJA 2X1DA 4YG2F 1S7OA 3U9GA 1XDSA 4ABZA 4LIUA 3BR0A 4FT8A 4L18B 3QWLA 2BY0A 3ZPLA 3I5UA 2R7VA 1A6QA 3CDIA 2VXDA 2K9SA 3LWFA 1ZK8A 4BBRJ 4MEXF 4UNOA 3E5XA 4JX5A 3LFKA 1LDJA 3T8TA 5DUKA 4S04A 3IWZA 4G7OF 1NTCA 2JRTA 3ZMSA 4ZYEA 3MEXA 1IN6A 2ZFWA 3HSEA 4PFPA 1OCRH 1U5TB 4A12A 2K40A 2KIQA 1QPIA 4Y7NJ 2E1MB 2CQQA 2L9RA 3GMEA 2XSDC 2R7SA 2V1DA 1BN5A 1G8XA 4A3FJ 3W2VA 4RB3C 4GGGA 2DK5A 3AG1H 5ILVA 4ENKA 4CCNA 5A2QK 2LY1A 5L3GA 1IXSB 2BEOA 2BE5F 4LLLA 1FJLA 3FXJA 1WRJA 2KP6A 1QQIA 3BJ6A 2WA0A 6PAXA 1DGWY 1TTYA 2QSFX 4PSWA 1RKTA 4BNCA 2L0KA 3GVAA 3WG9A 2QUFA 4P9UA 4BJ5C 3P9CA 3HGYA 5FO5A 3FF5A 4M9SA 2QA4I 1JE8A 1FTTA 4LG0A 3TBIA 4NC7A 3H9QA 1XG1A 2CJJA 1P4AA 1F43A 1TL8A 1ENHA 1BI1A 3ERMA 1ON2A 5DM6F 3DPLC 4C9YA 5CVJA 2EIMH 1DPUA 1YS6A 3DPTA 2EIKH 2L54A 4Y3OA 2GZWA 2M0MA 3BZKA 5GAHJ 3VYRB 1HW2A 2WAQN 3FMSA 4MQ9F 1TZLA 3JRDA 1NG7A 1W36C 3JSOA 3BLYA 3U21A 3KP5A 1JT0A 1F9NA 1X4OA 5M3FJ 5DM7F 2YR2A 4I0AA 2M0CA 5FFXA 2AQFA 4KIBA 4XL9A 3Q3SA 2E35A 5HLIA 2GXGA 4CZCA 1LVAA 2RN7A 3S17J 1KYWA 2XKPA 4PCQA 2DA7A 2ZO4A 1HLVA 4IRIA 1PJRA 1ZQ3P 4WXDA 2X1CA 3K10A 4OU0A 4W97A 2D45A 3OS1A 1H9TA 1K7AA 2LG4A 5E3LA 1IN4A 1FWZA 3RCOA 4B48A 3S3NA 2XRNA 2LKSA 1ZG1A 3KLOA 2KJBA 2D1VA 2HNHA 2NS8A 5DCMA 3L2WA 1FYLA 4V19K 2H6CA 3FBNB 5HDGA 4KITB 4MEYF 3D5RC 1P9QC 3H0GJ 2ELKA 5FFZA 3OR1C 3ROUA 1D1BA 3DKXA 2IBDA 4HNTA 2DYRH 4OAYA 4HDVA 2FSWA 1YW8A 1NG6A 1S5LC 1YJ9I 1R49A 4OAZA 3ZMVA 3HOTA 1T8IA 2Q0OA 2A05A 4BKXA 1DU0A 4FASD 4LGWA 4EEFG 1B72B 1FP2A 4CZZA 1XGOA 1YW7A 3F8FA 5KVRA 2BGCA 2J5PA 1B59A 4YEJA 3PQJA 1MMDA 4F52A 5HS8A 2ZJPF 5FLMJ 1TQIA 3IHUA 4MTEA 3T8RA 1BR2A 5D8LB 5LGUA 4DZPA 1J59A 1BC8C 1YX3A 5LFAA 5E18F 2KRHA 4UXNA 2P5VA 1VQ7I 2CQXA 1SMYF 2NVUB 3J7YJ 2K3PA 3FMQA 4X1EA 4EM0B 3VEPA 4UB6C 3L2VA 2DA4A 2K85A 2JA6J 2IEKA 2MLKA 4PGGA 2DTRA 2IAIA 2F5DA 4MO7A 5ILUA 1X2MA 1P4WA 3LA2A 4ZYAA 3BJAA 1FTZA 1K78A 4KMUX 2CUEA 3LA7A 1W5TA 1O3QA 1MJ9A 1OLTA 4HYEA 4ITVA 3I9V2 1DP3A 2OCCH 4XICA 1UHWA 3KFWX 2ECCA 4N4OB 4A93J 1MDMB 2LP0A 1S7EA 4DBRA 3JRFA 4L0ZB 2LDUA 2WC2A 2GBYA 3IH2A 2DT6A 3JTHA 3Q0UA 1B8IA 3JSPA 4WK8F 3BP8A 1D1CA 4WXCA 4RGSA 1ZRFA 5HNHA 1USTA 2ESNA 2M8EA 3IUOA 2X6XA 3FXLA 4BDYA 1VFCA 3RKYA 1Y8RB 2OUMA 1D0ZA 3UKGA 1LUJB 3CZ6A 1S72I 2AXTC 2F5EA 3T0YA 2GAUA 2V1UA 4BE1A 4YFXF 3L09A 2CSOA 1RI7A 2H8WA 2LREA 5IT9K 1R23A 2EFQA 3K0LA 4PJLA 3RKWA 4WWCA 2OTLI 1IRXA 3S1QJ 1JT6A 4Y17A 4Q47A 1H8AC 3M8EA 1D5VA 2XF5A 4FX4A 3HOZJ 3TOAA 4IKFA 1TWGJ 4M73A 1RKWA 3CCMI 3EYIA 2COBA 3G3ZA 4HF1A 4I0BA 1D5YA 3HKZN 4JK1X 4IZZA 5FD5A 1G59A 4NQWB 5HDNA 5IYCJ 1VQNI 2L2OA 2X4HA 2KMUA 1E17A 3F3XA 3ERED 2O03A 3FWEA 3GXOA 1MBKA 2AO9A 1YIJI 3L2UA 5IY5H 3I59B 3IC7A 2R5YB 4XLAA 3BR3A 1R7JA 1U5TA 4PJNA 2TCTA 1K4SA 2CS3A 2M87A 5D4SA 2R7WA 3W6KB 5LLQA 3GZ6A 5EG0B 1MIJA 2L4AA 3OYGA 3S15J 1P7IA 1TQPA 2KIFA 2ZMEA 3HRSA 4E7IA 1DP7P 1YG2A 1UG0A 1UCRA 2Y48A 3OS2A 3GTKJ 4IJAA 4L9JA 1A6IA 3W6VA 4FE4A 3S32A 2RGVA 4LB5A 3B6CA 1AKHB 4E7KA 2R7OA 3ELKA 2OAZA 3G1LA 1HQCA 4I02A 1ZH5A 4LD5A 4Q48A 2E60A 3PSIA 3MKWB 4BE0A 2JQ7A 5JVGF 2A68F 2LR8A 4ZH4F 3A2KA 2DMTA 3K4KA 4I7HA 2HR3A 3ZQIA 4ENNA 2HTSA 2PX9A 2BOLA 3K1MA 3JAMK 4UUVA 1ETKA 2FBHA 2F4MB 2L9SA 2WTEA 2ZBKA 2LBFB 1T39A 3AG4H 2HVQA 4TV7A 1FX7A 1Z91A 2BHZA 3DEWA 3RQ4A 5J8CA 1U9OA 1LDKB 1KU3A 1DQUA 5EJCA 3C7JA 1AHDP 2NOJB 1F36A 1OCOH 1ZAOA 1XCBA 1R1TA 3ZGKA 2QQ8A 4F55A 2VJ4A 2EIJH 1ZG5A 4MNUA 1BI2A 2E71A 1HKSA 2EILH 4G12A 4O3MA 1U5TC 1V5GA 3F0CA 4IHXA 2ZJQF 4A3DJ 4ZTJA 2PMHA 2I8DA 1BA5A 2GXBA 4OIPF 2UXXA 2IGMA 1IRFA 2EFWA 2IS2A 3GWZA 3JW4A 4EATA 1RZ4A 1UJ8A 1D8JA 3ZN0A 4XRSA 2WAQA 3OYLA 2EJRA 2KL4A 3CCSI 4XKWA 3CUQB 1I1GA 2P6TA 1JHFA 2FJ1A 2YUSA 4E7LA 3FXMA 2VQGA 1FSEA 4XORA 3QU6A 2KDOA 2EZLA 1HC8A 2X9DA 5LBQA 1BC7C 1XDUA 4B44A 2WY7Q 3E3VA 3HRUA 2VLAA 4IO9F 1Z21A 3S2HJ 2P81A 3PFIA 3ZMZA 2VQHA 4XR6A 2EZKA 2FF4A 2KZVA 4GCVA 2D1HA 4L5IA 1O7LA 5ICGA 4RB0A 2H6BA 1X4PA 2LH9A 1BR1A 4YFNF 3H36A 3QRFF 3OYNA 1CF7A 3PUBA 2HS5A 4V2FA 3RZDJ 2DO7A 2MG4A 3SJMA 4BY7J 3RZOJ 5C4JJ 1VQKI 3OSGA 2B63J 4M3GA 3V7CA 5B1AH 4HX7A 5M5XJ 3HG9A 4GO1A 3PFYA 2IS6A 3FXRA 4C3HJ 2OPTA 1FP1D 1TW3A 2YU3A 2ZXIA 3MWMA 1RRJA 1UHSA 2PJPA 1OCCH 2LOOA 2E34A 5ICEA 1FYMA 2M1BA 3HIFA 4HLYA 5LD2C 1ZN2A 5ICFA 5BQTA 2QBYA 1F1ZA 1REPC 3QYFA 1FBSA 3G2BA 2MH2A 2IRFG 2P4WA 4B3AA 3HPGA 3I71A 4DNCA 1FYKA 4IHSA 1XGSA 4XLHA 1J09A 3F21A 5B5EC 2EV6A 3KYCB 1RIOH 2JK3A 3K70C 4B1RA 3BOQA 1E3HA 2DBBA 3D5LA 1PDNC 3MKLA 1TWHJ 4G7HF 3GLLA 4M3BA 3BG5A 1Z1DA 2LKPA 1IV8A 2Y31A 4HSTA 3ABKH 4IPAA 1ZRDA 5FRNA 2Y0SN 3D1NI 4I76A 4HG2A 3RI4A 1YJWI 3TGNA 2AHQA 4QPQA 1X1AA 3G71I 3Q5FA 4XKCA 1XSXA 1IZ1A 5CVIA 4AVZA 2AXLA 2CUFA 3O8HA 4G6QA 2BXYA 3P7NA 2M4GA 5HLHA 4WX9A 4R8HA 2VJIA 4U0WA 5EGOA 3E6DA 3R4KA 2M8GX 4CO8A 4KISA 2QGUA 5DDGA 2ZXHA 4FCYA 2XDVA 3CUQA 2CGPA 5KK1A 2FU4A 2R3SA 3HKZA 1W36D 4JYKA 4MQVA 2HWVA 3V7RA 2L01A 5K7FA 1LFUP 2V79A 2VQLA 1UFMA 3IH3A 2ZFUA 1X3ZB 1LEAA 2GQQA 2P7VB 1K4TA 2STTA 2IW5A 1ULYA 2ECBA 2R92J 2GOMA 1MNDA 2HOAA 1HBXG 3ZQFA 3S1MJ 1XMXA 3J80Z 3H5NA 3RPQA 4DYQA 5LRRA 4A0XA 3BG3A 2FQ4A 2FOKA 3R61A 1KONA 1WHUA 2KKOA 4LK1F 1P6RA 2VBXA 1SFEA 1OYWA 2NYXA 1JHHA 4PK4A 1KYZA 4DGWB 3JRBA 5EEGA 1QBJA 1IAWA 1U0JA 2BVLA 2LSOA 1FLIA 1A36A 2IVMA 2Y2ZA 4MHGA 3C18A 2A5WA 3DTEA 2PBIA 3GUDA 1YFHA 3GEZA 5KNLA 5J40A 4PGHA 3C2HA 2CYYA 2HOTA 2V9PA 4MTDA 4X0GA 2VJ5A 2HQRA 3H35A 3K70D 2YSRA 4C2TA 3ZRGA 4UB8C 2XF7A 2FX0A 1YITI 5EG0A 1YRNB 4ENMA 5FKKA 3W6JB 2V6EA 2QZ8A 2JUCA 3S1RJ 5LEKA 3FHZA 2DMNA 3BG6A 1MBGA 2E36A 1B4AA 1F5TA 3CQZJ 2NS7A 2XAGA 3BZCA 1QHGA 3GZ5A 1SAXA 3DBLB 3SXYA 2XAHA 2V1XA 1S3JA 1VNDA 3NWSA 4FETA 4GXOA 1KGSA 2HQ5A 3BZ6A 2HI3A 3SZTA 1Z9CA 5TGTA 1M1EB 2XIGA 5JLXA 2YS9A 4A3GJ 4A0YA 3Q9SA 4O6JA 4KA4A 2MSYA 5B3SH 5EEAA 3FXUA 2DFEA 2UWMA 4G6DA 1VI0A 2BBYA 3G4SI 4WF2A 2MLGA 3BC8A 5CJ9A 1FZPB 4CCLA 1YHQI 2TDXA 2Y9YA 1VQ4I 2P5LC 1HSJA 1OPCA 3VB2A 3CC4I 5HS7A 3K4LA 3F22A 2LY9A 3LQQA 3OIQA 2KRFA 4GRIA 3LL7A 4F3QA 4LLNA 4IOAF 1LFBA 1E3PA 4A5MA 3E97A 4HW0A 2A3SA 1I6HJ 3OOUA 2VC0A 1X58A 3P9KA 1TWCJ 3JRHA 3N05A 2B7EA 3FZVA 3PUFA 1SFUA 4WXHA 1MNEA 2OZUA 1L0OC 4A3BJ 2VOOA 2Q2EA 2VBYA 1QPMA 3EUAA 3QYBA 4L9NA 1OQYA 3ZP5A 5F27A 1D1AA 2EH3A 4OOIA 2WV1A 4J19A 2IA0A 4XRSG 1MGTA 4JX4A 3CCRI 4UHTA 4HQEA 2KZGA 1UG2A 3BJOA 2HYGD 3BPXA 1SAUA 3SQNA 5BNGA 3OYDA 2L3DA 3CCLI 2VOPA 5FKMA 4XKBA 1DGRM 3B6AA 3QQAA 1AKHA 2PFBA 2K3FA 1FSHA 5ICCA 3QPLA 4A3LJ 3BTIA 3FM3A 3ML6A 3VSKA 4FTHA 3CMYA 2Z5UA 3OIOA 1FC3A 4ON0A 1WPKA 2NVXJ 1OCZH 4RGUA 3ECOA 3VODA 3ABMH 1SFXA 3S16J 3RYPA 3A0HC 2HKXA 3S2WA 1JUPA 3WGGA 4R79A 1OR7C 1LFPA 3BG7A 2DT5A 2M2EA 2ZJ2A 2E1CA 2PEXA 1O7FA 2COMA 4XSXF 3SFIA 2CFXA 2E7WA 2ZNZA 4RAZA 5KAFC 4H4KC 1BL0A 4YFKF 1SANA 3QYEA 1R71A 2K5CA 1SMTA 3OYJA 3D5SC 3FX3A 4J01A 3HOVJ 2O7OA 2EFNA 2P8TA 1JKOC 1B8IB 1MSEC 3OYAA 1GXQA 3F72A 1WI9A 3L1PA 2YU9J 1MSFC 3SHFA 1O3SA 3R60A 2CFOA 4LLGF 4BJ6C 2E2IJ 3VYUB 2VBZA 4NC8A 3IAS2 1KQ8A 3M9AA 1ZHFA 1EV7A 2IT0A 5E3NA 1BI0A 2R7QA 1MBHA 2X1EA 1TNSA 2DOAA 3TOBA 2QCOA 1PVEA 4RM2A 3M3YJ 3LMMA 4D1QA 3L2RA 1SVLA 2E19A 4C30A 1WH5A 4BXUA 2YPRA 3QP5A 4A2UA 4NC6A 2KIMA 3VFZA 2DYSH 4BUPA 1O57A 2JZYA 3PIOF 1WWXA 2GIZA 2NXNB 2E5NA 3ZQGA 4L0YB 1BW5A 5FGMA 5AONA 2L4MA 4W1UA 3A03A 3WGIA 3WTXC 1WSUA 1ETVA 3BG9A 3AAFA 2R93J 5HS9A 2XF6A 1OJLA 5H2FC 3CO7C 3FDYA 3QPHA 4BXXJ 3PNVA 3DU6A 1AA7A 1SD4A 3ZMTA 3WTYC 2RQQA 2PJRB 3HM5A 4BHPA 3K69A 4BHBA 4D7NA 1W0UA 1FOXA 5KAIC 3CCYA 4XRFA 4U7BA 2LNBA 4KDPA 3FBIB 3OS0A 1W5CC 1LQ1A 2UZKA 2R5ZB 1WJAA 2LVSA 3LNQA 1MH4A 5CPRB 4B3XA 2DJNA 2LF8A 2HZTA 2HXOA 5B1BH 1I5ZA 3K4MA 1IC8A 2ZB9A 1IO2A 5LHGA 1B6AA 4HX4A 5IOYA 3S14J 1YLFA 3KE2A 4EVIA 1ITYA 2G9WA 3DTIA 3I59A 4CDGA 2HQAA 3ZMUA 2F5CA 4ZZDA 4RAYA 3A02A 2RAEA 3VSLA 4L9TA 1WKMA 3KZYA 4E7HA 4CUGA 4BH9A 3CF5F 4A3CJ 1EKEA 4D5FA 2HPMA 3CCJI 4NNJA 4ASNA 1XS9A 5JHUA 1ERDA 3WG7H 2G7UA 2LKXA 2CU7A 1X2NA 1FY7A 4KFCA 2F48A 4AM3A 2IA1A 1ETXA 2PMUA 3KCCA 4KUMA 3MVPA 1SC7A 3PO3J 2HTJA 1LDDA 1GXPA 1HW1A 3I58A 3M7GA 4HQMA 1IDYA 1OKRA 3TO9A 2NS0A 1QZEA 3JRAA 3AL0B 3KEYA 4LITA 4UUSA 2XC7A 3CCQI 2DA6A 1KQ0A 2FNPA 3CUOA 3EUKL 2CUJA 3MQ0A 3AFHA 1G6NA 1WFXA 4F92B 1IG7A 1T98A 2LBFA 2Z33A 1O4XA 4LJZF 1ZELA 2JWTA 3KEQA 1HDDC 2W00A 3EQLF 1RESA 2PMZA 2OCEA 3S3OA 4BDZA 5CQGA 1Q1HA 2L9NA 3KP3A 4BE2A 4NUBA 5CKTA 3SEZA 1ZGWA 2JUGA 1FIPA 4CH7A 3GTMJ 3KEOA 2NVYJ 1HOMA 2MC4A 4IVNA 4GDFA 1P2FA 1X3WB 3K2AA 2XROA 2LC2A 3KYLA 3Q9VA 2W48A 3DQVC 1GVDA 1Y56A 2MC3A 4FISA 5IT9Z 2L7KA 5FLXK 2HVSA 3ZN1A 3ASNH 2ISYA 1HKQA 3KX2A 4BYYA 3CP2A 2W82A 2DA3A 1WJDA 4A6EA 1W1WE 4ZDOA 5LHHA 3HHHA 4HNVA 2E5ZA 3TMOA 3ECHA 2X6YA 4JQFA 5F0FA 4RGXA 3WHBA 3WU1B 1FBUA 1FOWA 2WWYA 5D8KB 1MD0A 3LSKA 1IF1A 2MA3A 2B9SA 3O3KA 3VDXA 3NRVA 4DJAA 3HEFA 3MZ8A 2RNGA 4FX0A 3BPVA 4QPOA 3EYYA 1Z0XA 2FUG2 4OMYA 3F8MA 5J8FA 4PJMA 1STZA 2L5QA 1S9HA 3MD2A 2DTZA 5D5WB 3WTSC 4RB2C 5DS9A 2ICWG 2MD5A 2CQNA 2DA2A 2XAFA 3H5RA 3J80K 3JCUC 4Y13A 2QQAA 2XRLA 1FEXA 1I1SA 3U2RA 1S6LA 2V9VA 3BCBA 4F7ZA 2WY8Q 1K79A 2K02A 3I4PA 2IS4A 4HSRA 2DLLA 4UV8A 2VPLA 3BQZA 2UXNA 4UV9A 3OYKA 5M5YJ 2IXSA 4RM3A 2XVCA 2Y0MA 1H88C 1YX5A 1XSVA 3NQOA 4P55A 3ESWB 2I10A 3TKYA 2PLYA 4IHYA 4KIFA 3REOA 3F8BA 2DCEA 2O3FA 3WE3A 3W2AA 1RETA 4XN3A 3TDUC 1K83J 5GAGJ 3HL2A 1JGSA 4M6VA 1QHHD 1NHAA 1Y0UA 4Z2YA 2W57A 1F4KA 4IX7A 2DT7B 3IAM2 5EEHA 1MH3A 3RPUA 2HPIA 2EPFA 3LSHA 3ZQQA 1USSA 3CP8A 3JRIA 1TW2A 3GF2A 2QF7A 4I09A 4GFBA 1YOVB 2W84A 4M74A 2QENA 2Y9ZA 5F1RA 2X51A 2ID6A 2NOGA 5BPDA 1XB4A 1X1CA 1FPQA 3HPHA 1N77A 2FNAA 3H3UA 1J5YA 4P96A 4BQNA 2JA5J 2DOEA 1QZZA 4KN4X 2XAQA 1YTYA 2R7XA 1MJBA 2DK8A 2GA1A 3MN2A 3F8NA 2OD5A 1QU3A 2XASA 1SFKA 4HF0A 1VQ8I 1P92A 1OR7A 1MW7A 4FHTA 3CDLA 5DUIA 3IV5A 2N8GA 2HKOA 5LRSA 3JREA 3HB9A 2ZCWA 2DW4A 3RPUD 2EZHA 1S7AA 2LRDA 2RC4A 3HOYJ 3NEUA 4PFOA 3BWGA 2OC6A 4D0PA 3I4MJ 3LSPA 2X0LA 2PI0A 4DYCA 1BOBA 4HBLA 2WAEA 3O8GA 2W7NA 1T08B 3GFIA 1EH7A 5EF6A 3E6MA 5GADJ 2PJRA 2VPRA 2H94A 5EZGA 2RNJA 2CW8A 1XGNA 2QKLB 3R0JA 3E5QA 3CLQA 3SFZA 3DXJF 1TP4A 4PJJA 3HOUJ 3B02A 1T6SA 3ZOBA 5JVTA 2NNYA 4RLFA 2HOSA 2XPUA 2A61A 2FMYA 3GTQJ 3K2ZA 4XLPF 2K9LA 3IP4B 1UHMA 2JPCA 4XOTA 4OINF 1H0MA 3SDGA 5KHDA 3O6BB 3I4NJ 4A6DA 1MBJA 3QAHA 1PP8F 1W7PD 2K4BA 2RVCA 3A4CA 4ETSA 5J4YA 2CQ7A 2DPUA 2X48A 4QLCU 1WCMJ 3KIOA 4GYIA 3FXOA 5K5OA 3HHGA 3U1DA 3C2GA 2CV1A 2EBIA 1HW5A 3CTAA 2O61A 3PNYA 4ZDPA 2VODA 4M3FA 1KZHA 4CICA 4G6TB 3A1YA 3Q0VA 2VQCA 1G3TA 2ADUA 3CF2A 4N0BA 5GPAA 4AYBN 4Y52J 2R4GA 2R7ZJ 3K4CA 3E0JB 2DA5A 1T0FA 1YIOA 1SD5A 1J0RA 4ANJA 1X1DA 1BIAA 3L9FA 4DQ2A 4YRVA 4LK0F 2VONA 4C2UA 4AUXA 2QQBA 1KU7A 3CUQC 4L9VA 4CCMA 1IRGA 5F04A 4EGYA 2LFBA 3ABTA 3S93A 2W25A 5J1YA 1D0XA 3OOPA 5HOOA 4HDUA 2JMWA 2GA2A 2STWA 1EF4A 5K7ZA 2K9NA 3FM5A 3SYTA 3I3LA 3DU5A 3TDZC 2ISZA 4M9XA 2EFOA 4YIIA 1KQ9A 5D5VB 4CCOA 5BMZA 1JKRC 1T2KA 2M7BA 3TEDA 2HYFA 2DQLA 3KYDB 3GO5A 3PNTA 4Z6YA 2FBKA 1C0WA 4IL6C 5FKLA 1PYVA 3E5UA 5E3OA 2PMZN 1Q1VA 3DBHB 4BY1J 4G8XA 2M9HA 4XIDA 1GT0C 1Y6IA 1J75A 3FMRA 5E8IA 3VYTB 3LSJA 2EV0A 2H09A 5CYVA 1YO5C 2OF7A 4V2GA 3W2WA 4BL0B 3FKIJ 3K6GA 1R36A 2NRAC 2Q2EB 2H8RA 2CUZA 4PZJA 3I55I 2K9MA 1B9NA 3JAMZ 2M34A 3QOPA 2M5WA 1U2WA 3CD6I 5EGOB 3R6SA 2JN6A 3DKYA 4UVBA 3ABUA 3GFMA 2R0QC 3FK7A 1OMIA 1QRYA 3IWFA 1IUYA 5E3MA 1OYIA 3M1CA 4NHJA 3VWBA 2E2JJ 1BW6A 1VQLI 4Y15A 1R4MB 3OWTA 5E1XA 2W1OA 4JOMA 3MKZA 1J2XA 1ZGJA 3TW7A 2K86A 3IKVA 1GLNA 5HDKA 5KCMA 4S05A 1MMAA 3CDHA 5IYBJ 4AD9A 3CJTB 4Y33A 3FK6A 1PUEE 1ACIA 3FXQA 2VASA 1XCVA 2MW8A 5JLWA 2QM3A 4IHTA 5IPAA 3IL2A 3OL3A 3RJPA 4A3IJ 2ELJA 1IXRC 2VKEA 4LG0B 2OA4A 2R5YA 3RTRA 3OV8A 2Y69H 2OQGA 3A0BC 2RDPA 1NK2P 4BXFA 2VKDA 1JUSA 2I5UA 2FOWA 2XSJC 3HJEA 4IXAA 4IQ4A 1Z6TA 3H92A 3RQIA 3SZGA 1U8BA 2R7FA 3EUHA 1LPQA 1PUFA 2O5RA 4XKVA 3GTJJ 3GBGA 2JPBA 2A6EF 1R9TJ 4BAYA 5F0CA 4B8XA 1APLC 2X85A 1R22A 1XN7A 1D3YA 3F6VA 3UR3C 2QYOA 3SZPA 3TP3A 2HOEA 2VJJA 4S0HB 4WCGA 3CMEI 1MMNA 1IGNA 2DFIA 3E6BA 3FISA 5M5WJ 4A3EJ 5LHIA 4ZC3A 4I2OA 2XB5A 4F91B 2NNNA 3L7WA 4E7SA 3CLOA 3LA3A 1JTYA 3V8KA 3IRRA 3QPSA 3DWLE 1L3LA 5D5UB 1ON1A 4RAFA 2ACJA 2KQRA 4BEHB 2XAJA 1HDPA 4A0ZA 2QKMB 5GTIC 4P5OA 5IP9J 3KP4A 3HRTA 3DTKA 2QQ9A 5IP6A 2EWNA 2C6YA 2DMUA 5AIQA 3H0DA 2GM4A 2QSGX 5B66C 2W4SA 3KP7A 4NBQA 2DPDA 4BGDA 1MMGA 5E20A 5JI6A 1LVKA 3M07A 4DW6A 1V5FA 5BOXA 2V7FA 4ZZLA 1H89C 1JJ8C 1JGGA 4J00A 3PJRA 1WZ2A 2ZNYA 2DI3A 4QIWN 4AC0A 4CGZA 3DEUA 2JA8J 3TO7A 1K6OA 3J81K 2V9KA 2O9LA 1BM9A 1XD7A 1BIBA 1Z3YA 4IOCF 1A35A 2H1KA 2IGNA 2M45A 3K1NA 3FXKA 1XPXA 1TT0A 3MZHA 1BBYA 1VF9A 4MLOA 4XQFA 3EDPA 4HX8A 3ZQLA 3QODA 5E8GA 1D0YA 5LGTA 4U0VA 1IN5A 4AU7A 2P5KA 1QGPA 3VPRA 1Z67A 1K6YA 3E1SA 1JUMA 1ZLKA 2CWEA 4CYDA 3S2DJ 4CCKA 2VIXA 4D5CA 5HLTA 2DMQA 3L00A 3K7AJ 4BS9A 4OIOF 2FD5A 2XHKA 3VYSB 1Z7LA 4EMSA 3UNGC 1I39A 2W24A 4E7ZA 2DDAA 2LY2A 1IJWC 2QVOA 2QWWA 4PUSA 3IRQA 2L7MP 3D0SA 3TW6A 5L3BA 1GV2A 3LAPA 5LGNA 2CO5A 3NWTA 2E7XA 4ESFA 2OV7A 3NAUA 1GDTA 2CRGA 1N25A 4D7MA 1IXCA 1NH3A 2CQKA 3TQNA 1HA8A 1R5GA 2CG4A 4HEA2 3IKTA 4P1WA 1XSDA 3LAJA 5J3LA 4AIHA 1TWAJ 3DKWA 3CMAI 3OYMA 3I56I 1EH8A 2K27A 2LMDA 3AL0C 4M3EA 1ZLJA 2OU2A 2DOFA 5E79C 3M4OJ 1YI2I 4EV0A 1X1PA 3QP6A 4ESJA 3DFGA 3MKYB 4YELA 2PN6A 1LE8A 4E70A 1WGXA 3HBLA 2VL8A 2G7HA 3RDIA 4G9YA 4I98B 1N75A 1E3OC 4B4CA 1FMWA 3A01A 5TRDA 5J47A 5D4RA 1T56A 4RLQA 1LB2A 2HQNA 2EA2A 2LD5A 2L7ZA 2A07F 1OFCX 2WADA 5J6XA 5JFRA 2EA4A 2XB0X 1AU7A 3HXLA 2RQPA 4EJTA 5DYMA 2E1OA 3ULQB 3HRMA 1WH7A 1G3YA 2EQRA 1ZR4A 1WJEA 1POGA 3OSFA 4A3JJ 1VQ9I 2QBYB 4C2MJ 2O8XA 1G3WA 4EM1A 2CH0A 2FRHA 2KFDA 1N78A 1JTXA 2F2EA 2NVQJ 1X19A 2O0YA 4C3JJ 3KETA 3CJRB 2JSCA 1R1VA 1ETOA 3ABLH 3GFLA 1IRZA 2CW7A 4CCJA 3FHNA 3OYBA 4GYGA 4LOCA 2H27A 4NQWA 1MBEA 4IQJA 2KHMA 2HDCA 3WU2C 3WTTC 4HRIA 4HV6A 4U7DA 3MCZA 1IN8A 4M3DA 4IRGA 1HXDA 2ME0A 2VXZA 3KP6A 3GTGJ 3HDDA 1WJ5A 5F64A 3OMYA 4B47A 4CYCA 2Z2SB 4BU2A 3MAJA 1G3SA 4U88A 4MFDA 3C2BA 4DBQA 1T33A 2HDWA 5DCFA 2HDDA 3H9GA 5F0HA 4IHWA 2QEXI 3B73A 2XPWA 5J1UA 1P7JA 3GX4X 1RUOA 1O3TA 3OYIA 3N97A 1CQTA 5C3EJ 2ZXWH 2F5FA 2BYVE 2IA2A 1V55H 3KZZA 3EUHC 3ZQ7A 2OQRA 2Z1DA 3DV8A 5L3DA 1U3EM 3BR1A 3DPUA 4OMZA 3JTGA 5ED4A 5FRMA 2O6GE 1TQMA 4JX6A 4KT6A 5CVVA 3RSNA 3BTCA 5EZHA 1HKTA 1P4XA 3J7ZI 2FE3A 1YW9A 5FKNA 4E6KG 1UELB 2EFPA 4XLFA 4RA2A 3E6CC 2ZC2A 1V3FA 4EJOA 1G4DA 1VQ6I 3QU3A 3HTUA 2LK2A 4KYWA 1SD7A 4MGRA 5H6RA 3EPZA 2M7AA 5EDNA 2Z9OA 4AWXB 3I0TA 3MMYB 1PP7U 2GIVA 3OY9A 3W3CA 4CSWA 2R7UA 2K7LA 3CCUI 1UAAA 2VUMJ 2P0WA 2B0LA 3SEQA 1Y39A 3DBRB 1YQAA 1R00A 1OCTC 1YRNA 1ZG3A 5FJ8J 1YJNI 4M9ZA 3K1PA 2DDBA 1JKPC 1T0FC 5ERIA 2JVGA 2R7DA 1ETQA 4HZFA 2OJED 2Q8KA 4NDLA 4L5EA 1OISA 2MFZA 3T1BA 2VE8A 2KT0A 2VBWA 5GAEJ 5E17F 2HEOA 1WQ2A 4CYCB 1HCRA 1Z3XA 1TNTA 1ZKGA 3V7SA 4KN7X 2EZIA 3ZCOA 4M6YA 5M3MJ 2KLOA 4BQOA 2EINH 2V4JC 2Y75A 1I6XA 3WE2A 2EB7A 5L3FA 1CF7B 3BTJA 5HODA 4AIDA 2FEZA 2JT1A 4Q4ZF 5BPIA 2M30A 2QSHX 1LNWA 2BW3B 3H1CA 4UY8I 2JA2A 2BY2A 2MYSA 3A01B 2E2HJ 2JJ7A 4II3A 2BY3A 1IV6A 2Y0SA 4RBOA 3RIRA 4RB1A 1PUFB 3WTWC 3V42A 2EK5A 2JVHA 2DA1A 3BY6A 5K1YA 2TRTA 2V1NA 4IHVA 3HUGB 3L2CA 2ZMEB 1QA6A 2VT3A 4QSHA 2MD0A 3CMMA 5F1JA 1XMAA 5FROA 3CC7I 3SDBA 2X6WA 4XLCA 5ILSA 1LEBA 1WJFA 2ESHA 2WB1A 1QVTA 5CLSA 1ODDA 4HLXA 3TO6A 1XGMA 4MFEA 1ETWA 1R1UA 4O5VA 1J7KA 2ID3A 1ORKA 3QPTA 2GXAA 3F6OA 3P9IA 2EV5A 2M4KA 4EM2A 3GTLJ 1B9MA 2MGQA 3JRCA 3BTLA 3HGGA 4IEJA 1W0TA 3V4GA 4RGRA 3O2PE 4XK4A 3CCEI 3N4MA 3ZR8X 2ZXJA 4KJZA 4U0YA 3G1OA 3OIPA 4G94A 3WU0A 5K5QA 4L5JA 4A69C 2VN2A 1I50J 5GPCA 1MZBA 2JRMA 4YIFA 5IOZA 4KIGA 3WODF 4HAMA 3COAC 3U1KA 3HYIA 3ZQHA 1FMVA 1DU6A 3PL8A 1GV5A 5FKOA 2YX4A 3ONQA 3ZXSA 3ISPA 3I54A 1Y1WJ 1SVOA 2LYCA 4AVPA 4IF4A 3FIWA 1UB9A 1YE9A 1VTNC 2A6TA 2XGXA 2XUBA 3FKJA 4RAGA 2BV6A 5DD8A 1Y0NA 2GWRA 2VC1A 1CGPA 3GCMA 2IS1A 1RPWA 2HFHA 4UVCA 4PSXA 4LIVA 3KP2A 3R0AA
chains in the Genus database with same CATH topology
2K9MA 1SAUA 3OYDA 2BW3A 2HNHA 3L2WA 1WJCA 4XKBA 3FBNB 1DGRM 3OYCA 4KITB 3D5RC 1P9QC 3DKYA 3OR1C 1D1BA 3DKXA 3VSKA 4HNTA 4E7JA 4OAYA 3M1CA 3VWBA 1NG6A 1E0EA 4OAZA 3OWTA 3HOTA 2W1OA 3LSGA 4JOMA 4F93B 3MKZA 4FASD 1GLNA 5KCMA 1MMAA 4R79A 4Y33A 1OR7C 1LFPA 3BG7A 4RMNA 4YEJA 2VASA 1MMDA 4F52A 4AYBA 1WJBA 4ZTFA 1BR2A 1YX3A 3OL3A 5LFAA 2DJIA 2KRHA 2ELJA 4H4KC 2K3PA 3RTRA 3QYEA 2HZDA 2K5CA 3OYJA 3D5SC 4BXFA 4XNFA 2VKDA 3L2VA 4J01A 3OYAA 2XSJC 1T95A 4IQ4A 3SZGA 4BJTA 4ZYAA 2XAUA 2O5RA 4XKVA 2CFOA 2VB6A 4BJ6C 3GBGA 3VYUB 4ITVA 1OLTA 4NC8A 3I9V2 3IAS2 1DP3A 2X85A 3TL4X 2R7QA 2X1EA 4N4OB 2DOAA 3UR3C 4DBRA 2VJJA 4RM2A 1MMNA 2ZSIB 2DT6A 3LMMA 4D1QA 3L2RA 4ZC3A 4C30A 1D1CA 4F91B 4E7SA 3DEEA 4BUPA 3DWLE 5HNHA 2E5NA 2KQRA 3IUOA 4BEHB 2X6XA 4BDYA 3HC7A 2QKMB 2OUMA 4P5OA 1D0ZA 3DTKA 5HNFA 3CZ6A 2XF6A 3S3MA 3H0DA 4BEHA 3FDYA 4BE1A 2WBMA 3PNVA 2W4SA 3DU6A 1AA7A 1MMGA 2LREA 4II2A 4BGDA 1EA3A 1LVKA 1V5EA 1V5FA 2RQQA 2V7FA 4PJLA 2PJRB 4BACA 4J00A 3PJRA 3LSMA 4XLEA 1IRXA 4U7BA 3DLAA 3FBIB 3J7AY 3OS0A 2V9KA 1Z3YA 1WJAA 2IGNA 2KRCA 2XF5A 5CPRB 4B3XA 4IKFA 1TT0A 2JSPA 1R6RA 3K4MA 4MLOA 4IZZA 4XQFA 1G59A 4NQWB 3OL4A 3QODA 3DTIA 1D0YA 2L2OA 2HQAA 2KMUA 4AU7A 1K6YA 3E1SA 2RREA 3VSLA 3CESA 4CCKA 3L2UA 2VIXA 4E7HA 5HLTA 4XLAA 4BS9A 4CUGA 4PJNA 3VYSB 1Z7LA 2CS3A 3UNGC 2HPMA 2R7WA 4NNJA 2M3AA 4E7ZA 3OYGA 4E7IA 1ERDA 2LY2A 1UG0A 2V26A 4PUSA 3OS2A 2WAFA 2CV0A 4LG3A 3S32A 2R7TA 3NWTA 4E7KA 2OV7A 2R7OA 3LFUA 5HVQC 4XONA 2E60A 3PSIA 3MKWB 4BE0A 3AL0B 3KEYA 4D9JA 4LITA 2XC7A 1HA8A 3H5AA 3K4JA 4DIQA 4HEA2 3EUKL 2ZSHB 3A2KA 5JHFA 3K4KA 2CUJA 4P1WA 3AFHA 1WFXA 4F92B 2LBFA 3L2QA 2BOLA 3OYMA 1ZELA 2F6CA 3AL0C 2L9SA 2Q1ZB 2E1MC 2W00A 2PMZA 5CQEA 2CMPA 2LBFB 2UV1A 5CQGA 4BDZA 2L9NA 4BE2A 3S3OA 2HVQA 3RQ4A 3M8JA 1VZ0A 4NUBA 5CKTA 3CJQB 3SEZA 3MKYB 1LDKB 2JUGA 4YELA 1DQUA 2R7RA 2NOJB 4CH7A 2VL8A 2MC4A 3ZGKA 1N75A 4F55A 3KYLA 1FMWA 2LC2A 2VJ4A 3AKZA 3OR2C 3DQVC 1Y56A 2L7KA 1JI8A 4RLQA 2F5VA 4XN0A 1V5GA 3OYHA 2HVSA 4ZDLA 4BQQA 4ZTJA 3KX2A 2I8DA 2WADA 3CP2A 2W82A 4XMYA 1LKXA 1WJDA 2IGMA 2IS2A 4EATA 4ZDOA 3HXLA 3BCAA 4N4NB 2E5ZA 3TMOA 2WAQA 2X6YA 3OYLA 4JQFA 2KL4A 4XKWA 3LSKA 3VDXA 4E7LA 4DJAA 1WJEA 2GOXB 4B43A 2VQGA 2RNGA 4XORA 3K4NA 4QPOA 2FUG2 2KDOA 2CH0A 1N78A 4PJMA 1X19A 2L5QA 1S9HA 3MD2A 4B44A 1X1BA 2WY7Q 2VLAA 3CJRB 4HNUA 1Z21A 4XOPA 3H5RA 2VQHA 2CW7A 4XR6A 2VKHA 3FHNA 4CCJA 4U87A 2KZVA 3S8PA 4ZJZA 3OYBA 2LH9A 1X4PA 3K4BA 3BCBA 1BR1A 2WY8Q 4IQJA 2KHMA 3OYNA 4XM3A 3PUBA 2IS4A 4HSRA 4HRIA 3QOEA 2VPLA 3OYKA 2IXSA 4RM3A 3HG9A 1YX5A 2IGKA 3PFYA 2VXZA 2IS6A 1WJ5A 3HOSA 3OMYA 4OWRB 4B47A 2CV2A 2ZXIA 4DOZA 2DCEA 2Z2SB 4BU2A 4CA0A 3W2AA 2LOOA 4DBQA 4XN3A 3HL2A 2HDWA 5LD2C 1QHHD 3H9GA 4IX7A 2DT7B 3IAM2 4Y4RA 2UUZA 2HPIA 3H9JA 3G2BA 3LSHA 3QYFA 3OYEA 2MABA 3ZQQA 3CP8A 3OYIA 2HVRA 3LSIA 3HPGA 4XLHA 1J09A 3EUHC 3OYFA 3K70C 2X51A 2Z1DA 3F9KA 3DPUA 1X1CA 3HPHA 1N77A 2BVMA 5FRMA 3D5LA 1BR4A 4KT6A 2HU9A 3RSNA 4BQNA 4E6KG 1UELB 4HSTA 3PSFA 4XLFA 2KPMA 2R7XA 5FRNA 4HG2A 2Z16A 4E4HA 1QU3A 1SFKA 4QPQA 1MW7A 3EPZA 1X1AA 2M7AA 4HPQA 2IGOA 4XKCA 2DXIA 4AVZA 3RPUD 3MMYB 2M4GA 2LRDA 2VJIA 3OY9A 3W3CA 4PFOA 4KISA 4CSWA 2OC6A 2R7UA 2F4IA 2ZXHA 1UAAA 2XDVA 2P0WA 3SEQA 2AQEA 3HKZA 1W36D 1BOBA 2WAEA 2W7NA 2X1DA 2VQLA 4LIUA 2ZFUA 1T0FC 2PJRA 2JVGA 2GOMA 2CW8A 1MNDA 2R7VA 2QKLB 2VXDA 3H5NA 4PJJA 2MFZA 4RLFA 1KONA 1Z3XA 4PK4A 2K9LA 4DGWB 3ZCOA 3IP4B 4XOTA 4PFPA 2KLOA 1U0JA 2BVLA 4BQOA 2V4JC 5KHDA 2A5WA 3DTEA 3A4CA 2E1MB 5KNLA 2BW3B 3C2GA 3C2HA 2CV1A 2JA2A 2MYSA 4X0GA 2R7SA 4II3A 2VJ5A 1G8XA 3H35A 2Y0SA 3K70D 3PNYA 3W2VA 4C2TA 3ZRGA 4ZDPA 2XF7A 4G6TB 3A1YA 4CCNA 2LY1A 2VQCA 3CF2A 3V42A 2JVHA 2R4GA 2V6EA 3K4CA 3E0JB 2V1NA 3BG6A 3HUGB 4ANJA 1X1DA 2KP6A 2WA0A 2MD0A 1QHGA 3CMMA 4YRVA 5FROA 3NWSA 4FETA 4C2UA 1DGWY 3SDBA 4PSWA 2X6WA 4XLCA 1WJFA 5TGTA 4BJ5C 2WB1A 4CCMA 3TBIA 4NC7A 3H9QA 3S93A 1D0XA 2UWMA 5HOOA 2M4KA 3BC8A 3DPLC 4C9YA 4CCLA 3DPTA 4Y3OA 3SYTA 3I3LA 3DU5A 2M0MA 3VYRB 4KJZA 3K4LA 3ZR8X 4CCOA 3OIPA 3OIQA 1TZLA 2M7BA 4GRIA 3LL7A 4F3QA 1NG7A 1W36C 3BLYA 3U21A 1X4OA 3PNTA 3OOUA 1PYVA 3N05A 1FMVA 2AQFA 3PL8A 4XL9A 1MNEA 3ONQA 3ZXSA 4CZCA 1Y6IA 2LYCA 3EUAA 3QYBA 1YE9A 3VYTB 1PJRA 2A6TA 2X1CA 3K10A 1D1AA 3FKJA 3OS1A 2LG4A 3W2WA 4BL0B 3K6GA 2IS1A 3S3NA 3RCOA 4B48A 4PSXA 2Q2EB 4LIVA 2CUZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUG B;  2Z2S B;  4NQW B;  2Q1Z B; 
#chains in the Genus database with same CATH topology
 2ZKZ A;  2BW3 A;  1SEU A;  1WJC A;  5J4V A;  2BXZ A;  3OYC A;  1V4R A;  3IH4 A;  1Y1V J;  3HSR A;  1ZRC A;  1RNL A;  4KIC A;  5H20 A;  4E7J A;  2O8K A;  1E0E A;  2BY1 A;  3TP0 A;  3WTZ A;  2D2W A;  3LSG A;  4F93 B;  3C3W A;  4N9H A;  2ZJR F;  4EJW A;  1GUU A;  1ZYR F;  3PM1 A;  4RMN A;  1ONV A;  1RUN A;  2AS5 F;  2XGE A;  5K5R A;  4AYB A;  2Z3Y A;  4EGZ A;  5C4X J;  3AG2 H;  2ETH A;  1WJB A;  4ZTF A;  2P6S A;  4AIK A;  4QTR A;  2ELH A;  1EH6 A;  3HSF A;  1GHC A;  3LST A;  5IT3 A;  2DJI A;  1LJ9 A;  3GW2 A;  4I99 C;  2K4J A;  2KJC A;  1RR8 C;  5A2Q Z;  2HZD A;  2KIS A;  1RC9 A;  2P7C B;  4XNF A;  3PQK A;  1W5S A;  4ENJ A;  1VQP I;  4M6X A;  3K9T A;  4OIR F;  3ZQC A;  1FOY A;  3I53 A;  5DV5 A;  1T95 A;  2VI6 A;  4BJT A;  3JRG A;  3BQY A;  2XAU A;  4KNY A;  4LFU A;  1S8N A;  1JKQ C;  3GTO J;  2VB6 A;  3LQR A;  5F08 A;  9ANT A;  2RV8 A;  2J5O A;  3TL4 X;  2XPV A;  4ZYG A;  4UUT A;  3PIP F;  4DYR A;  3GFJ A;  2ZSI B;  4XLN F;  3KLN A;  2VE9 A;  1AWC A;  3HOW J;  4KT5 C;  2DAO A;  3DEE A;  1BJA A;  5DCM B;  1D8K A;  1SVM A;  2F4O B;  3WGH A;  5IYD J;  5HLG A;  1FNN A;  2BZT A;  3HC7 A;  2JA7 J;  5IP7 J;  1HST A;  1W7P B;  4PJ0 C;  5GTH C;  5HNF A;  1S29 A;  1R4N B;  2QLZ A;  3CC2 I;  2DMP A;  3G6E I;  3S3M A;  5DTD A;  4BEH A;  2WBM A;  3WHC A;  5TJJ A;  2PQ8 A;  4II2 A;  2A69 F;  2HXI A;  5CVU A;  3RKX A;  2OTJ I;  1EA3 A;  1V54 H;  1V5E A;  2XV4 S;  4M72 A;  3BDD A;  1Y8Q B;  1MNM C;  1QO0 D;  3PO2 J;  4BAC A;  3LSM A;  2OBP A;  3NAR A;  3V8L A;  4QWQ A;  3HTS B;  1JXS A;  4XLE A;  1UZC A;  3DLA A;  3J7A Y;  1DUX C;  4OIQ F;  3RKQ A;  1VQ5 I;  2KRC A;  3DP7 A;  3BR5 A;  5C44 J;  1I27 A;  1TT5 B;  2CW0 F;  2ZME C;  3BR6 A;  2JSP A;  1R6R A;  4B09 A;  4M71 A;  3H3Z A;  3GYH X;  4RS8 A;  2W85 A;  1G2H A;  3OL4 A;  4DZJ A;  4IRH A;  4XBF A;  5TIS C;  1R58 A;  4C3I J;  2RRE A;  3RYR A;  3CES A;  3LSR A;  4BBS J;  2E1N A;  1GVJ A;  1BJZ A;  1BOA A;  1FT9 A;  1AOY A;  1XMK A;  5GP9 A;  2FQ3 A;  4K2E A;  4EQQ A;  2IJL A;  4BHC A;  1ZRE A;  2M3A A;  1R5H A;  2V26 A;  5FLV A;  3J7A O;  2L02 A;  2Y30 A;  2DU9 A;  2RKH A;  4CHU A;  4A3K J;  2V6C A;  2WAF A;  2CV0 A;  1JJ6 C;  2DFH A;  1B72 A;  2DOD A;  4LG3 A;  2R7T A;  5LEJ A;  1QNT A;  1Z6R A;  4BQA A;  3V8J A;  3LFU A;  5HVQ C;  4XON A;  3T5X A;  1WI3 A;  2L9V A;  2DFF A;  3P5J A;  4D9J A;  3BR2 A;  3H5A A;  3K4J A;  4PDK A;  4DIQ A;  2ZSH B;  5JHF A;  4EJV A;  2D5V A;  4HOB A;  1EJ9 A;  5FD6 A;  3L2Q A;  4A3M J;  1FIA A;  5L3C A;  2F6C A;  3CCV I;  2NVT J;  2Q1Z B;  1LE8 B;  1U6G A;  2E1M C;  5CQE A;  2CMP A;  2UV1 A;  4XSZ F;  3M8J A;  1VZ0 A;  3CJQ B;  4ESB A;  1BI3 A;  1E2X A;  2R7R A;  2JTV A;  1U78 A;  3ZMD A;  2WB1 N;  1Z7U A;  4HA8 A;  2GLO A;  3AKZ A;  2A5Y B;  3C1D A;  3OR2 C;  4G7Z F;  1WVR A;  4UUS B;  3F23 A;  4P9F A;  1JI8 A;  1Z77 A;  3OYH A;  2F5V A;  4XN0 A;  4ZDL A;  3HZJ A;  3DF8 A;  4BQQ A;  3G1M A;  2FML A;  3M8F A;  4XMY A;  1LKX A;  4N9I A;  3J81 Z;  5H6Q A;  1ZAR A;  4JP0 A;  1VQO I;  1K78 B;  3BCA A;  4N4N B;  3S1N J;  1RR7 A;  2X6O A;  1QVU A;  4CXF A;  5J1R A;  1T38 A;  1J9I A;  5DEQ A;  2A6H F;  4MIM A;  5DD4 A;  1DPR A;  1XX5 A;  1NK3 P;  1H9G A;  3GTP J;  1SD6 A;  5D5X B;  3AG3 H;  2GOX B;  4B43 A;  1MDM A;  4YIR X;  5E1Z B;  1R5I D;  3K4N A;  2LF7 A;  2FA5 A;  2LTP A;  1OYY A;  1IN7 A;  2Z99 A;  4XRM A;  3H3V K;  4EJU A;  2KDZ A;  1B1B A;  2VKV A;  2XKO A;  1K61 A;  3KZI C;  1X1B A;  3CO6 C;  1A31 A;  4HNU A;  4XOP A;  2XGC A;  3BRO A;  4UVA A;  2R5Z A;  3HUG A;  1I3Q J;  1I3A A;  2VKH A;  1IW7 F;  4U87 A;  3S8P A;  4ZJZ A;  1TLH B;  2IPQ X;  4FQG A;  2FBI A;  3K4B A;  2PG4 A;  3X2Q H;  5K7H A;  1KU2 A;  4XM3 A;  5D6F A;  4H0E A;  1XC5 A;  2LLK A;  3QOE A;  1TC3 C;  4KMF A;  4HF2 A;  3GLX A;  1IUF A;  4I6Z A;  2IGK A;  3M1E A;  3HOS A;  2CV2 A;  4OWR B;  2ME6 A;  3MFK A;  1ZR2 A;  3GZN B;  3G73 A;  4DOZ A;  5L3E A;  1ZTR A;  4CA0 A;  4LMY A;  1W7P A;  2BHY A;  1QZY A;  1OCP A;  3E7L A;  5BS6 A;  1TWF J;  3CJN A;  4LB6 B;  1MKM A;  1Z05 A;  1MBF A;  1YYV A;  3HOX J;  1MMS A;  2OZ6 A;  1TBX A;  4Y4R A;  2UUZ A;  3KPH A;  2H1L A;  3H9J A;  1ETY A;  3BT9 A;  3OYE A;  2MAB A;  2HGC A;  2HVR A;  1UMQ A;  1ZGA A;  3LSI A;  1X3U A;  3F8C A;  3I64 A;  5F6F A;  3LOC A;  1O3R A;  1HF0 A;  1YS7 A;  3Q0W A;  1A04 A;  3VOE A;  3OYF A;  1KA8 A;  2XGD A;  3F9K A;  2YX7 A;  4RDU A;  4R1H A;  5FB2 A;  5AIP A;  3DCF A;  1DDN A;  3EET A;  1FBQ A;  2K9Q A;  2BVM A;  1W4M A;  3WTV C;  3MZY A;  1BR4 A;  1XTA A;  3WTU C;  5EYR A;  2HU9 A;  2DQR A;  2KIU A;  4NB5 A;  1MJA A;  3PSF A;  1KU9 A;  4JBA A;  2NAZ A;  2KPM A;  1SFO J;  2L7F P;  2WV0 A;  3ASO H;  5CVR A;  1VQM I;  4Q5S F;  4HV5 A;  2Z16 A;  4E4H A;  1U8R A;  4ZYH A;  4HPQ A;  2IGO A;  2G0E A;  2DXI A;  5JR3 A;  2MH9 A;  4X6A J;  5D6E A;  1A5J A;  1IDZ A;  4ZYD A;  1U9N A;  4FE7 A;  2F4I A;  2VT2 A;  1FOK A;  2IP2 A;  2DN0 A;  4I01 A;  3DLL F;  4A5N A;  5E1W A;  3JR9 A;  2HYJ A;  2AQE A;  5FLX Z;  2MBF A;  2FXA A;  4AIJ A;  2X1D A;  4YG2 F;  1S7O A;  3U9G A;  1XDS A;  4ABZ A;  4LIU A;  3BR0 A;  4FT8 A;  4L18 B;  3QWL A;  2BY0 A;  3ZPL A;  3I5U A;  2R7V A;  1A6Q A;  3CDI A;  2VXD A;  2K9S A;  3LWF A;  1ZK8 A;  4BBR J;  4MEX F;  4UNO A;  3E5X A;  4JX5 A;  3LFK A;  1LDJ A;  3T8T A;  5DUK A;  4S04 A;  3IWZ A;  4G7O F;  1NTC A;  2JRT A;  3ZMS A;  4ZYE A;  3MEX A;  1IN6 A;  2ZFW A;  3HSE A;  4PFP A;  1OCR H;  1U5T B;  4A12 A;  2K40 A;  2KIQ A;  1QPI A;  4Y7N J;  2E1M B;  2CQQ A;  2L9R A;  3GME A;  2XSD C;  2R7S A;  2V1D A;  1BN5 A;  1G8X A;  4A3F J;  3W2V A;  4RB3 C;  4GGG A;  2DK5 A;  3AG1 H;  5ILV A;  4ENK A;  4CCN A;  5A2Q K;  2LY1 A;  5L3G A;  1IXS B;  2BEO A;  2BE5 F;  4LLL A;  1FJL A;  3FXJ A;  1WRJ A;  2KP6 A;  1QQI A;  3BJ6 A;  2WA0 A;  6PAX A;  1DGW Y;  1TTY A;  2QSF X;  4PSW A;  1RKT A;  4BNC A;  2L0K A;  3GVA A;  3WG9 A;  2QUF A;  4P9U A;  4BJ5 C;  3P9C A;  3HGY A;  5FO5 A;  3FF5 A;  4M9S A;  2QA4 I;  1JE8 A;  1FTT A;  4LG0 A;  3TBI A;  4NC7 A;  3H9Q A;  1XG1 A;  2CJJ A;  1P4A A;  1F43 A;  1TL8 A;  1ENH A;  1BI1 A;  3ERM A;  1ON2 A;  5DM6 F;  3DPL C;  4C9Y A;  5CVJ A;  2EIM H;  1DPU A;  1YS6 A;  3DPT A;  2EIK H;  2L54 A;  4Y3O A;  2GZW A;  2M0M A;  3BZK A;  5GAH J;  3VYR B;  1HW2 A;  2WAQ N;  3FMS A;  4MQ9 F;  1TZL A;  3JRD A;  1NG7 A;  1W36 C;  3JSO A;  3BLY A;  3U21 A;  3KP5 A;  1JT0 A;  1F9N A;  1X4O A;  5M3F J;  5DM7 F;  2YR2 A;  4I0A A;  2M0C A;  5FFX A;  2AQF A;  4KIB A;  4XL9 A;  3Q3S A;  2E35 A;  5HLI A;  2GXG A;  4CZC A;  1LVA A;  2RN7 A;  3S17 J;  1KYW A;  2XKP A;  4PCQ A;  2DA7 A;  2ZO4 A;  1HLV A;  4IRI A;  1PJR A;  1ZQ3 P;  4WXD A;  2X1C A;  3K10 A;  4OU0 A;  4W97 A;  2D45 A;  3OS1 A;  1H9T A;  1K7A A;  2LG4 A;  5E3L A;  1IN4 A;  1FWZ A;  3RCO A;  4B48 A;  3S3N A;  2XRN A;  2LKS A;  1ZG1 A;  3KLO A;  2KJB A;  2D1V A;  2HNH A;  2NS8 A;  5DCM A;  3L2W A;  1FYL A;  4V19 K;  2H6C A;  3FBN B;  5HDG A;  4KIT B;  4MEY F;  3D5R C;  1P9Q C;  3H0G J;  2ELK A;  5FFZ A;  3OR1 C;  3ROU A;  1D1B A;  3DKX A;  2IBD A;  4HNT A;  2DYR H;  4OAY A;  4HDV A;  2FSW A;  1YW8 A;  1NG6 A;  1S5L C;  1YJ9 I;  1R49 A;  4OAZ A;  3ZMV A;  3HOT A;  1T8I A;  2Q0O A;  2A05 A;  4BKX A;  1DU0 A;  4FAS D;  4LGW A;  4EEF G;  1B72 B;  1FP2 A;  4CZZ A;  1XGO A;  1YW7 A;  3F8F A;  5KVR A;  2BGC A;  2J5P A;  1B59 A;  4YEJ A;  3PQJ A;  1MMD A;  4F52 A;  5HS8 A;  2ZJP F;  5FLM J;  1TQI A;  3IHU A;  4MTE A;  3T8R A;  1BR2 A;  5D8L B;  5LGU A;  4DZP A;  1J59 A;  1BC8 C;  1YX3 A;  5LFA A;  5E18 F;  2KRH A;  4UXN A;  2P5V A;  1VQ7 I;  2CQX A;  1SMY F;  2NVU B;  3J7Y J;  2K3P A;  3FMQ A;  4X1E A;  4EM0 B;  3VEP A;  4UB6 C;  3L2V A;  2DA4 A;  2K85 A;  2JA6 J;  2IEK A;  2MLK A;  4PGG A;  2DTR A;  2IAI A;  2F5D A;  4MO7 A;  5ILU A;  1X2M A;  1P4W A;  3LA2 A;  4ZYA A;  3BJA A;  1FTZ A;  1K78 A;  4KMU X;  2CUE A;  3LA7 A;  1W5T A;  1O3Q A;  1MJ9 A;  1OLT A;  4HYE A;  4ITV A;  3I9V 2;  1DP3 A;  2OCC H;  4XIC A;  1UHW A;  3KFW X;  2ECC A;  4N4O B;  4A93 J;  1MDM B;  2LP0 A;  1S7E A;  4DBR A;  3JRF A;  4L0Z B;  2LDU A;  2WC2 A;  2GBY A;  3IH2 A;  2DT6 A;  3JTH A;  3Q0U A;  1B8I A;  3JSP A;  4WK8 F;  3BP8 A;  1D1C A;  4WXC A;  4RGS A;  1ZRF A;  5HNH A;  1UST A;  2ESN A;  2M8E A;  3IUO A;  2X6X A;  3FXL A;  4BDY A;  1VFC A;  3RKY A;  1Y8R B;  2OUM A;  1D0Z A;  3UKG A;  1LUJ B;  3CZ6 A;  1S72 I;  2AXT C;  2F5E A;  3T0Y A;  2GAU A;  2V1U A;  4BE1 A;  4YFX F;  3L09 A;  2CSO A;  1RI7 A;  2H8W A;  2LRE A;  5IT9 K;  1R23 A;  2EFQ A;  3K0L A;  4PJL A;  3RKW A;  4WWC A;  2OTL I;  1IRX A;  3S1Q J;  1JT6 A;  4Y17 A;  4Q47 A;  1H8A C;  3M8E A;  1D5V A;  2XF5 A;  4FX4 A;  3HOZ J;  3TOA A;  4IKF A;  1TWG J;  4M73 A;  1RKW A;  3CCM I;  3EYI A;  2COB A;  3G3Z A;  4HF1 A;  4I0B A;  1D5Y A;  3HKZ N;  4JK1 X;  4IZZ A;  5FD5 A;  1G59 A;  4NQW B;  5HDN A;  5IYC J;  1VQN I;  2L2O A;  2X4H A;  2KMU A;  1E17 A;  3F3X A;  3ERE D;  2O03 A;  3FWE A;  3GXO A;  1MBK A;  2AO9 A;  1YIJ I;  3L2U A;  5IY5 H;  3I59 B;  3IC7 A;  2R5Y B;  4XLA A;  3BR3 A;  1R7J A;  1U5T A;  4PJN A;  2TCT A;  1K4S A;  2CS3 A;  2M87 A;  5D4S A;  2R7W A;  3W6K B;  5LLQ A;  3GZ6 A;  5EG0 B;  1MIJ A;  2L4A A;  3OYG A;  3S15 J;  1P7I A;  1TQP A;  2KIF A;  2ZME A;  3HRS A;  4E7I A;  1DP7 P;  1YG2 A;  1UG0 A;  1UCR A;  2Y48 A;  3OS2 A;  3GTK J;  4IJA A;  4L9J A;  1A6I A;  3W6V A;  4FE4 A;  3S32 A;  2RGV A;  4LB5 A;  3B6C A;  1AKH B;  4E7K A;  2R7O A;  3ELK A;  2OAZ A;  3G1L A;  1HQC A;  4I02 A;  1ZH5 A;  4LD5 A;  4Q48 A;  2E60 A;  3PSI A;  3MKW B;  4BE0 A;  2JQ7 A;  5JVG F;  2A68 F;  2LR8 A;  4ZH4 F;  3A2K A;  2DMT A;  3K4K A;  4I7H A;  2HR3 A;  3ZQI A;  4ENN A;  2HTS A;  2PX9 A;  2BOL A;  3K1M A;  3JAM K;  4UUV A;  1ETK A;  2FBH A;  2F4M B;  2L9S A;  2WTE A;  2ZBK A;  2LBF B;  1T39 A;  3AG4 H;  2HVQ A;  4TV7 A;  1FX7 A;  1Z91 A;  2BHZ A;  3DEW A;  3RQ4 A;  5J8C A;  1U9O A;  1LDK B;  1KU3 A;  1DQU A;  5EJC A;  3C7J A;  1AHD P;  2NOJ B;  1F36 A;  1OCO H;  1ZAO A;  1XCB A;  1R1T A;  3ZGK A;  2QQ8 A;  4F55 A;  2VJ4 A;  2EIJ H;  1ZG5 A;  4MNU A;  1BI2 A;  2E71 A;  1HKS A;  2EIL H;  4G12 A;  4O3M A;  1U5T C;  1V5G A;  3F0C A;  4IHX A;  2ZJQ F;  4A3D J;  4ZTJ A;  2PMH A;  2I8D A;  1BA5 A;  2GXB A;  4OIP F;  2UXX A;  2IGM A;  1IRF A;  2EFW A;  2IS2 A;  3GWZ A;  3JW4 A;  4EAT A;  1RZ4 A;  1UJ8 A;  1D8J A;  3ZN0 A;  4XRS A;  2WAQ A;  3OYL A;  2EJR A;  2KL4 A;  3CCS I;  4XKW A;  3CUQ B;  1I1G A;  2P6T A;  1JHF A;  2FJ1 A;  2YUS A;  4E7L A;  3FXM A;  2VQG A;  1FSE A;  4XOR A;  3QU6 A;  2KDO A;  2EZL A;  1HC8 A;  2X9D A;  5LBQ A;  1BC7 C;  1XDU A;  4B44 A;  2WY7 Q;  3E3V A;  3HRU A;  2VLA A;  4IO9 F;  1Z21 A;  3S2H J;  2P81 A;  3PFI A;  3ZMZ A;  2VQH A;  4XR6 A;  2EZK A;  2FF4 A;  2KZV A;  4GCV A;  2D1H A;  4L5I A;  1O7L A;  5ICG A;  4RB0 A;  2H6B A;  1X4P A;  2LH9 A;  1BR1 A;  4YFN F;  3H36 A;  3QRF F;  3OYN A;  1CF7 A;  3PUB A;  2HS5 A;  4V2F A;  3RZD J;  2DO7 A;  2MG4 A;  3SJM A;  4BY7 J;  3RZO J;  5C4J J;  1VQK I;  3OSG A;  2B63 J;  4M3G A;  3V7C A;  5B1A H;  4HX7 A;  5M5X J;  3HG9 A;  4GO1 A;  3PFY A;  2IS6 A;  3FXR A;  4C3H J;  2OPT A;  1FP1 D;  1TW3 A;  2YU3 A;  2ZXI A;  3MWM A;  1RRJ A;  1UHS A;  2PJP A;  1OCC H;  2LOO A;  2E34 A;  5ICE A;  1FYM A;  2M1B A;  3HIF A;  4HLY A;  5LD2 C;  1ZN2 A;  5ICF A;  5BQT A;  2QBY A;  1F1Z A;  1REP C;  3QYF A;  1FBS A;  3G2B A;  2MH2 A;  2IRF G;  2P4W A;  4B3A A;  3HPG A;  3I71 A;  4DNC A;  1FYK A;  4IHS A;  1XGS A;  4XLH A;  1J09 A;  3F21 A;  5B5E C;  2EV6 A;  3KYC B;  1RIO H;  2JK3 A;  3K70 C;  4B1R A;  3BOQ A;  1E3H A;  2DBB A;  3D5L A;  1PDN C;  3MKL A;  1TWH J;  4G7H F;  3GLL A;  4M3B A;  3BG5 A;  1Z1D A;  2LKP A;  1IV8 A;  2Y31 A;  4HST A;  3ABK H;  4IPA A;  1ZRD A;  5FRN A;  2Y0S N;  3D1N I;  4I76 A;  4HG2 A;  3RI4 A;  1YJW I;  3TGN A;  2AHQ A;  4QPQ A;  1X1A A;  3G71 I;  3Q5F A;  4XKC A;  1XSX A;  1IZ1 A;  5CVI A;  4AVZ A;  2AXL A;  2CUF A;  3O8H A;  4G6Q A;  2BXY A;  3P7N A;  2M4G A;  5HLH A;  4WX9 A;  4R8H A;  2VJI A;  4U0W A;  5EGO A;  3E6D A;  3R4K A;  2M8G X;  4CO8 A;  4KIS A;  2QGU A;  5DDG A;  2ZXH A;  4FCY A;  2XDV A;  3CUQ A;  2CGP A;  5KK1 A;  2FU4 A;  2R3S A;  3HKZ A;  1W36 D;  4JYK A;  4MQV A;  2HWV A;  3V7R A;  2L01 A;  5K7F A;  1LFU P;  2V79 A;  2VQL A;  1UFM A;  3IH3 A;  2ZFU A;  1X3Z B;  1LEA A;  2GQQ A;  2P7V B;  1K4T A;  2STT A;  2IW5 A;  1ULY A;  2ECB A;  2R92 J;  2GOM A;  1MND A;  2HOA A;  1HBX G;  3ZQF A;  3S1M J;  1XMX A;  3J80 Z;  3H5N A;  3RPQ A;  4DYQ A;  5LRR A;  4A0X A;  3BG3 A;  2FQ4 A;  2FOK A;  3R61 A;  1KON A;  1WHU A;  2KKO A;  4LK1 F;  1P6R A;  2VBX A;  1SFE A;  1OYW A;  2NYX A;  1JHH A;  4PK4 A;  1KYZ A;  4DGW B;  3JRB A;  5EEG A;  1QBJ A;  1IAW A;  1U0J A;  2BVL A;  2LSO A;  1FLI A;  1A36 A;  2IVM A;  2Y2Z A;  4MHG A;  3C18 A;  2A5W A;  3DTE A;  2PBI A;  3GUD A;  1YFH A;  3GEZ A;  5KNL A;  5J40 A;  4PGH A;  3C2H A;  2CYY A;  2HOT A;  2V9P A;  4MTD A;  4X0G A;  2VJ5 A;  2HQR A;  3H35 A;  3K70 D;  2YSR A;  4C2T A;  3ZRG A;  4UB8 C;  2XF7 A;  2FX0 A;  1YIT I;  5EG0 A;  1YRN B;  4ENM A;  5FKK A;  3W6J B;  2V6E A;  2QZ8 A;  2JUC A;  3S1R J;  5LEK A;  3FHZ A;  2DMN A;  3BG6 A;  1MBG A;  2E36 A;  1B4A A;  1F5T A;  3CQZ J;  2NS7 A;  2XAG A;  3BZC A;  1QHG A;  3GZ5 A;  1SAX A;  3DBL B;  3SXY A;  2XAH A;  2V1X A;  1S3J A;  1VND A;  3NWS A;  4FET A;  4GXO A;  1KGS A;  2HQ5 A;  3BZ6 A;  2HI3 A;  3SZT A;  1Z9C A;  5TGT A;  1M1E B;  2XIG A;  5JLX A;  2YS9 A;  4A3G J;  4A0Y A;  3Q9S A;  4O6J A;  4KA4 A;  2MSY A;  5B3S H;  5EEA A;  3FXU A;  2DFE A;  2UWM A;  4G6D A;  1VI0 A;  2BBY A;  3G4S I;  4WF2 A;  2MLG A;  3BC8 A;  5CJ9 A;  1FZP B;  4CCL A;  1YHQ I;  2TDX A;  2Y9Y A;  1VQ4 I;  2P5L C;  1HSJ A;  1OPC A;  3VB2 A;  3CC4 I;  5HS7 A;  3K4L A;  3F22 A;  2LY9 A;  3LQQ A;  3OIQ A;  2KRF A;  4GRI A;  3LL7 A;  4F3Q A;  4LLN A;  4IOA F;  1LFB A;  1E3P A;  4A5M A;  3E97 A;  4HW0 A;  2A3S A;  1I6H J;  3OOU A;  2VC0 A;  1X58 A;  3P9K A;  1TWC J;  3JRH A;  3N05 A;  2B7E A;  3FZV A;  3PUF A;  1SFU A;  4WXH A;  1MNE A;  2OZU A;  1L0O C;  4A3B J;  2VOO A;  2Q2E A;  2VBY A;  1QPM A;  3EUA A;  3QYB A;  4L9N A;  1OQY A;  3ZP5 A;  5F27 A;  1D1A A;  2EH3 A;  4OOI A;  2WV1 A;  4J19 A;  2IA0 A;  4XRS G;  1MGT A;  4JX4 A;  3CCR I;  4UHT A;  4HQE A;  2KZG A;  1UG2 A;  3BJO A;  2HYG D;  3BPX A;  1SAU A;  3SQN A;  5BNG A;  3OYD A;  2L3D A;  3CCL I;  2VOP A;  5FKM A;  4XKB A;  1DGR M;  3B6A A;  3QQA A;  1AKH A;  2PFB A;  2K3F A;  1FSH A;  5ICC A;  3QPL A;  4A3L J;  3BTI A;  3FM3 A;  3ML6 A;  3VSK A;  4FTH A;  3CMY A;  2Z5U A;  3OIO A;  1FC3 A;  4ON0 A;  1WPK A;  2NVX J;  1OCZ H;  4RGU A;  3ECO A;  3VOD A;  3ABM H;  1SFX A;  3S16 J;  3RYP A;  3A0H C;  2HKX A;  3S2W A;  1JUP A;  3WGG A;  4R79 A;  1OR7 C;  1LFP A;  3BG7 A;  2DT5 A;  2M2E A;  2ZJ2 A;  2E1C A;  2PEX A;  1O7F A;  2COM A;  4XSX F;  3SFI A;  2CFX A;  2E7W A;  2ZNZ A;  4RAZ A;  5KAF C;  4H4K C;  1BL0 A;  4YFK F;  1SAN A;  3QYE A;  1R71 A;  2K5C A;  1SMT A;  3OYJ A;  3D5S C;  3FX3 A;  4J01 A;  3HOV J;  2O7O A;  2EFN A;  2P8T A;  1JKO C;  1B8I B;  1MSE C;  3OYA A;  1GXQ A;  3F72 A;  1WI9 A;  3L1P A;  2YU9 J;  1MSF C;  3SHF A;  1O3S A;  3R60 A;  2CFO A;  4LLG F;  4BJ6 C;  2E2I J;  3VYU B;  2VBZ A;  4NC8 A;  3IAS 2;  1KQ8 A;  3M9A A;  1ZHF A;  1EV7 A;  2IT0 A;  5E3N A;  1BI0 A;  2R7Q A;  1MBH A;  2X1E A;  1TNS A;  2DOA A;  3TOB A;  2QCO A;  1PVE A;  4RM2 A;  3M3Y J;  3LMM A;  4D1Q A;  3L2R A;  1SVL A;  2E19 A;  4C30 A;  1WH5 A;  4BXU A;  2YPR A;  3QP5 A;  4A2U A;  4NC6 A;  2KIM A;  3VFZ A;  2DYS H;  4BUP A;  1O57 A;  2JZY A;  3PIO F;  1WWX A;  2GIZ A;  2NXN B;  2E5N A;  3ZQG A;  4L0Y B;  1BW5 A;  5FGM A;  5AON A;  2L4M A;  4W1U A;  3A03 A;  3WGI A;  3WTX C;  1WSU A;  1ETV A;  3BG9 A;  3AAF A;  2R93 J;  5HS9 A;  2XF6 A;  1OJL A;  5H2F C;  3CO7 C;  3FDY A;  3QPH A;  4BXX J;  3PNV A;  3DU6 A;  1AA7 A;  1SD4 A;  3ZMT A;  3WTY C;  2RQQ A;  2PJR B;  3HM5 A;  4BHP A;  3K69 A;  4BHB A;  4D7N A;  1W0U A;  1FOX A;  5KAI C;  3CCY A;  4XRF A;  4U7B A;  2LNB A;  4KDP A;  3FBI B;  3OS0 A;  1W5C C;  1LQ1 A;  2UZK A;  2R5Z B;  1WJA A;  2LVS A;  3LNQ A;  1MH4 A;  5CPR B;  4B3X A;  2DJN A;  2LF8 A;  2HZT A;  2HXO A;  5B1B H;  1I5Z A;  3K4M A;  1IC8 A;  2ZB9 A;  1IO2 A;  5LHG A;  1B6A A;  4HX4 A;  5IOY A;  3S14 J;  1YLF A;  3KE2 A;  4EVI A;  1ITY A;  2G9W A;  3DTI A;  3I59 A;  4CDG A;  2HQA A;  3ZMU A;  2F5C A;  4ZZD A;  4RAY A;  3A02 A;  2RAE A;  3VSL A;  4L9T A;  1WKM A;  3KZY A;  4E7H A;  4CUG A;  4BH9 A;  3CF5 F;  4A3C J;  1EKE A;  4D5F A;  2HPM A;  3CCJ I;  4NNJ A;  4ASN A;  1XS9 A;  5JHU A;  1ERD A;  3WG7 H;  2G7U A;  2LKX A;  2CU7 A;  1X2N A;  1FY7 A;  4KFC A;  2F48 A;  4AM3 A;  2IA1 A;  1ETX A;  2PMU A;  3KCC A;  4KUM A;  3MVP A;  1SC7 A;  3PO3 J;  2HTJ A;  1LDD A;  1GXP A;  1HW1 A;  3I58 A;  3M7G A;  4HQM A;  1IDY A;  1OKR A;  3TO9 A;  2NS0 A;  1QZE A;  3JRA A;  3AL0 B;  3KEY A;  4LIT A;  4UUS A;  2XC7 A;  3CCQ I;  2DA6 A;  1KQ0 A;  2FNP A;  3CUO A;  3EUK L;  2CUJ A;  3MQ0 A;  3AFH A;  1G6N A;  1WFX A;  4F92 B;  1IG7 A;  1T98 A;  2LBF A;  2Z33 A;  1O4X A;  4LJZ F;  1ZEL A;  2JWT A;  3KEQ A;  1HDD C;  2W00 A;  3EQL F;  1RES A;  2PMZ A;  2OCE A;  3S3O A;  4BDZ A;  5CQG A;  1Q1H A;  2L9N A;  3KP3 A;  4BE2 A;  4NUB A;  5CKT A;  3SEZ A;  1ZGW A;  2JUG A;  1FIP A;  4CH7 A;  3GTM J;  3KEO A;  2NVY J;  1HOM A;  2MC4 A;  4IVN A;  4GDF A;  1P2F A;  1X3W B;  3K2A A;  2XRO A;  2LC2 A;  3KYL A;  3Q9V A;  2W48 A;  3DQV C;  1GVD A;  1Y56 A;  2MC3 A;  4FIS A;  5IT9 Z;  2L7K A;  5FLX K;  2HVS A;  3ZN1 A;  3ASN H;  2ISY A;  1HKQ A;  3KX2 A;  4BYY A;  3CP2 A;  2W82 A;  2DA3 A;  1WJD A;  4A6E A;  1W1W E;  4ZDO A;  5LHH A;  3HHH A;  4HNV A;  2E5Z A;  3TMO A;  3ECH A;  2X6Y A;  4JQF A;  5F0F A;  4RGX A;  3WHB A;  3WU1 B;  1FBU A;  1FOW A;  2WWY A;  5D8K B;  1MD0 A;  3LSK A;  1IF1 A;  2MA3 A;  2B9S A;  3O3K A;  3VDX A;  3NRV A;  4DJA A;  3HEF A;  3MZ8 A;  2RNG A;  4FX0 A;  3BPV A;  4QPO A;  3EYY A;  1Z0X A;  2FUG 2;  4OMY A;  3F8M A;  5J8F A;  4PJM A;  1STZ A;  2L5Q A;  1S9H A;  3MD2 A;  2DTZ A;  5D5W B;  3WTS C;  4RB2 C;  5DS9 A;  2ICW G;  2MD5 A;  2CQN A;  2DA2 A;  2XAF A;  3H5R A;  3J80 K;  3JCU C;  4Y13 A;  2QQA A;  2XRL A;  1FEX A;  1I1S A;  3U2R A;  1S6L A;  2V9V A;  3BCB A;  4F7Z A;  2WY8 Q;  1K79 A;  2K02 A;  3I4P A;  2IS4 A;  4HSR A;  2DLL A;  4UV8 A;  2VPL A;  3BQZ A;  2UXN A;  4UV9 A;  3OYK A;  5M5Y J;  2IXS A;  4RM3 A;  2XVC A;  2Y0M A;  1H88 C;  1YX5 A;  1XSV A;  3NQO A;  4P55 A;  3ESW B;  2I10 A;  3TKY A;  2PLY A;  4IHY A;  4KIF A;  3REO A;  3F8B A;  2DCE A;  2O3F A;  3WE3 A;  3W2A A;  1RET A;  4XN3 A;  3TDU C;  1K83 J;  5GAG J;  3HL2 A;  1JGS A;  4M6V A;  1QHH D;  1NHA A;  1Y0U A;  4Z2Y A;  2W57 A;  1F4K A;  4IX7 A;  2DT7 B;  3IAM 2;  5EEH A;  1MH3 A;  3RPU A;  2HPI A;  2EPF A;  3LSH A;  3ZQQ A;  1USS A;  3CP8 A;  3JRI A;  1TW2 A;  3GF2 A;  2QF7 A;  4I09 A;  4GFB A;  1YOV B;  2W84 A;  4M74 A;  2QEN A;  2Y9Z A;  5F1R A;  2X51 A;  2ID6 A;  2NOG A;  5BPD A;  1XB4 A;  1X1C A;  1FPQ A;  3HPH A;  1N77 A;  2FNA A;  3H3U A;  1J5Y A;  4P96 A;  4BQN A;  2JA5 J;  2DOE A;  1QZZ A;  4KN4 X;  2XAQ A;  1YTY A;  2R7X A;  1MJB A;  2DK8 A;  2GA1 A;  3MN2 A;  3F8N A;  2OD5 A;  1QU3 A;  2XAS A;  1SFK A;  4HF0 A;  1VQ8 I;  1P92 A;  1OR7 A;  1MW7 A;  4FHT A;  3CDL A;  5DUI A;  3IV5 A;  2N8G A;  2HKO A;  5LRS A;  3JRE A;  3HB9 A;  2ZCW A;  2DW4 A;  3RPU D;  2EZH A;  1S7A A;  2LRD A;  2RC4 A;  3HOY J;  3NEU A;  4PFO A;  3BWG A;  2OC6 A;  4D0P A;  3I4M J;  3LSP A;  2X0L A;  2PI0 A;  4DYC A;  1BOB A;  4HBL A;  2WAE A;  3O8G A;  2W7N A;  1T08 B;  3GFI A;  1EH7 A;  5EF6 A;  3E6M A;  5GAD J;  2PJR A;  2VPR A;  2H94 A;  5EZG A;  2RNJ A;  2CW8 A;  1XGN A;  2QKL B;  3R0J A;  3E5Q A;  3CLQ A;  3SFZ A;  3DXJ F;  1TP4 A;  4PJJ A;  3HOU J;  3B02 A;  1T6S A;  3ZOB A;  5JVT A;  2NNY A;  4RLF A;  2HOS A;  2XPU A;  2A61 A;  2FMY A;  3GTQ J;  3K2Z A;  4XLP F;  2K9L A;  3IP4 B;  1UHM A;  2JPC A;  4XOT A;  4OIN F;  1H0M A;  3SDG A;  5KHD A;  3O6B B;  3I4N J;  4A6D A;  1MBJ A;  3QAH A;  1PP8 F;  1W7P D;  2K4B A;  2RVC A;  3A4C A;  4ETS A;  5J4Y A;  2CQ7 A;  2DPU A;  2X48 A;  4QLC U;  1WCM J;  3KIO A;  4GYI A;  3FXO A;  5K5O A;  3HHG A;  3U1D A;  3C2G A;  2CV1 A;  2EBI A;  1HW5 A;  3CTA A;  2O61 A;  3PNY A;  4ZDP A;  2VOD A;  4M3F A;  1KZH A;  4CIC A;  4G6T B;  3A1Y A;  3Q0V A;  2VQC A;  1G3T A;  2ADU A;  3CF2 A;  4N0B A;  5GPA A;  4AYB N;  4Y52 J;  2R4G A;  2R7Z J;  3K4C A;  3E0J B;  2DA5 A;  1T0F A;  1YIO A;  1SD5 A;  1J0R A;  4ANJ A;  1X1D A;  1BIA A;  3L9F A;  4DQ2 A;  4YRV A;  4LK0 F;  2VON A;  4C2U A;  4AUX A;  2QQB A;  1KU7 A;  3CUQ C;  4L9V A;  4CCM A;  1IRG A;  5F04 A;  4EGY A;  2LFB A;  3ABT A;  3S93 A;  2W25 A;  5J1Y A;  1D0X A;  3OOP A;  5HOO A;  4HDU A;  2JMW A;  2GA2 A;  2STW A;  1EF4 A;  5K7Z A;  2K9N A;  3FM5 A;  3SYT A;  3I3L A;  3DU5 A;  3TDZ C;  2ISZ A;  4M9X A;  2EFO A;  4YII A;  1KQ9 A;  5D5V B;  4CCO A;  5BMZ A;  1JKR C;  1T2K A;  2M7B A;  3TED A;  2HYF A;  2DQL A;  3KYD B;  3GO5 A;  3PNT A;  4Z6Y A;  2FBK A;  1C0W A;  4IL6 C;  5FKL A;  1PYV A;  3E5U A;  5E3O A;  2PMZ N;  1Q1V A;  3DBH B;  4BY1 J;  4G8X A;  2M9H A;  4XID A;  1GT0 C;  1Y6I A;  1J75 A;  3FMR A;  5E8I A;  3VYT B;  3LSJ A;  2EV0 A;  2H09 A;  5CYV A;  1YO5 C;  2OF7 A;  4V2G A;  3W2W A;  4BL0 B;  3FKI J;  3K6G A;  1R36 A;  2NRA C;  2Q2E B;  2H8R A;  2CUZ A;  4PZJ A;  3I55 I;  2K9M A;  1B9N A;  3JAM Z;  2M34 A;  3QOP A;  2M5W A;  1U2W A;  3CD6 I;  5EGO B;  3R6S A;  2JN6 A;  3DKY A;  4UVB A;  3ABU A;  3GFM A;  2R0Q C;  3FK7 A;  1OMI A;  1QRY A;  3IWF A;  1IUY A;  5E3M A;  1OYI A;  3M1C A;  4NHJ A;  3VWB A;  2E2J J;  1BW6 A;  1VQL I;  4Y15 A;  1R4M B;  3OWT A;  5E1X A;  2W1O A;  4JOM A;  3MKZ A;  1J2X A;  1ZGJ A;  3TW7 A;  2K86 A;  3IKV A;  1GLN A;  5HDK A;  5KCM A;  4S05 A;  1MMA A;  3CDH A;  5IYB J;  4AD9 A;  3CJT B;  4Y33 A;  3FK6 A;  1PUE E;  1ACI A;  3FXQ A;  2VAS A;  1XCV A;  2MW8 A;  5JLW A;  2QM3 A;  4IHT A;  5IPA A;  3IL2 A;  3OL3 A;  3RJP A;  4A3I J;  2ELJ A;  1IXR C;  2VKE A;  4LG0 B;  2OA4 A;  2R5Y A;  3RTR A;  3OV8 A;  2Y69 H;  2OQG A;  3A0B C;  2RDP A;  1NK2 P;  4BXF A;  2VKD A;  1JUS A;  2I5U A;  2FOW A;  2XSJ C;  3HJE A;  4IXA A;  4IQ4 A;  1Z6T A;  3H92 A;  3RQI A;  3SZG A;  1U8B A;  2R7F A;  3EUH A;  1LPQ A;  1PUF A;  2O5R A;  4XKV A;  3GTJ J;  3GBG A;  2JPB A;  2A6E F;  1R9T J;  4BAY A;  5F0C A;  4B8X A;  1APL C;  2X85 A;  1R22 A;  1XN7 A;  1D3Y A;  3F6V A;  3UR3 C;  2QYO A;  3SZP A;  3TP3 A;  2HOE A;  2VJJ A;  4S0H B;  4WCG A;  3CME I;  1MMN A;  1IGN A;  2DFI A;  3E6B A;  3FIS A;  5M5W J;  4A3E J;  5LHI A;  4ZC3 A;  4I2O A;  2XB5 A;  4F91 B;  2NNN A;  3L7W A;  4E7S A;  3CLO A;  3LA3 A;  1JTY A;  3V8K A;  3IRR A;  3QPS A;  3DWL E;  1L3L A;  5D5U B;  1ON1 A;  4RAF A;  2ACJ A;  2KQR A;  4BEH B;  2XAJ A;  1HDP A;  4A0Z A;  2QKM B;  5GTI C;  4P5O A;  5IP9 J;  3KP4 A;  3HRT A;  3DTK A;  2QQ9 A;  5IP6 A;  2EWN A;  2C6Y A;  2DMU A;  5AIQ A;  3H0D A;  2GM4 A;  2QSG X;  5B66 C;  2W4S A;  3KP7 A;  4NBQ A;  2DPD A;  4BGD A;  1MMG A;  5E20 A;  5JI6 A;  1LVK A;  3M07 A;  4DW6 A;  1V5F A;  5BOX A;  2V7F A;  4ZZL A;  1H89 C;  1JJ8 C;  1JGG A;  4J00 A;  3PJR A;  1WZ2 A;  2ZNY A;  2DI3 A;  4QIW N;  4AC0 A;  4CGZ A;  3DEU A;  2JA8 J;  3TO7 A;  1K6O A;  3J81 K;  2V9K A;  2O9L A;  1BM9 A;  1XD7 A;  1BIB A;  1Z3Y A;  4IOC F;  1A35 A;  2H1K A;  2IGN A;  2M45 A;  3K1N A;  3FXK A;  1XPX A;  1TT0 A;  3MZH A;  1BBY A;  1VF9 A;  4MLO A;  4XQF A;  3EDP A;  4HX8 A;  3ZQL A;  3QOD A;  5E8G A;  1D0Y A;  5LGT A;  4U0V A;  1IN5 A;  4AU7 A;  2P5K A;  1QGP A;  3VPR A;  1Z67 A;  1K6Y A;  3E1S A;  1JUM A;  1ZLK A;  2CWE A;  4CYD A;  3S2D J;  4CCK A;  2VIX A;  4D5C A;  5HLT A;  2DMQ A;  3L00 A;  3K7A J;  4BS9 A;  4OIO F;  2FD5 A;  2XHK A;  3VYS B;  1Z7L A;  4EMS A;  3UNG C;  1I39 A;  2W24 A;  4E7Z A;  2DDA A;  2LY2 A;  1IJW C;  2QVO A;  2QWW A;  4PUS A;  3IRQ A;  2L7M P;  3D0S A;  3TW6 A;  5L3B A;  1GV2 A;  3LAP A;  5LGN A;  2CO5 A;  3NWT A;  2E7X A;  4ESF A;  2OV7 A;  3NAU A;  1GDT A;  2CRG A;  1N25 A;  4D7M A;  1IXC A;  1NH3 A;  2CQK A;  3TQN A;  1HA8 A;  1R5G A;  2CG4 A;  4HEA 2;  3IKT A;  4P1W A;  1XSD A;  3LAJ A;  5J3L A;  4AIH A;  1TWA J;  3DKW A;  3CMA I;  3OYM A;  3I56 I;  1EH8 A;  2K27 A;  2LMD A;  3AL0 C;  4M3E A;  1ZLJ A;  2OU2 A;  2DOF A;  5E79 C;  3M4O J;  1YI2 I;  4EV0 A;  1X1P A;  3QP6 A;  4ESJ A;  3DFG A;  3MKY B;  4YEL A;  2PN6 A;  1LE8 A;  4E70 A;  1WGX A;  3HBL A;  2VL8 A;  2G7H A;  3RDI A;  4G9Y A;  4I98 B;  1N75 A;  1E3O C;  4B4C A;  1FMW A;  3A01 A;  5TRD A;  5J47 A;  5D4R A;  1T56 A;  4RLQ A;  1LB2 A;  2HQN A;  2EA2 A;  2LD5 A;  2L7Z A;  2A07 F;  1OFC X;  2WAD A;  5J6X A;  5JFR A;  2EA4 A;  2XB0 X;  1AU7 A;  3HXL A;  2RQP A;  4EJT A;  5DYM A;  2E1O A;  3ULQ B;  3HRM A;  1WH7 A;  1G3Y A;  2EQR A;  1ZR4 A;  1WJE A;  1POG A;  3OSF A;  4A3J J;  1VQ9 I;  2QBY B;  4C2M J;  2O8X A;  1G3W A;  4EM1 A;  2CH0 A;  2FRH A;  2KFD A;  1N78 A;  1JTX A;  2F2E A;  2NVQ J;  1X19 A;  2O0Y A;  4C3J J;  3KET A;  3CJR B;  2JSC A;  1R1V A;  1ETO A;  3ABL H;  3GFL A;  1IRZ A;  2CW7 A;  4CCJ A;  3FHN A;  3OYB A;  4GYG A;  4LOC A;  2H27 A;  4NQW A;  1MBE A;  4IQJ A;  2KHM A;  2HDC A;  3WU2 C;  3WTT C;  4HRI A;  4HV6 A;  4U7D A;  3MCZ A;  1IN8 A;  4M3D A;  4IRG A;  1HXD A;  2ME0 A;  2VXZ A;  3KP6 A;  3GTG J;  3HDD A;  1WJ5 A;  5F64 A;  3OMY A;  4B47 A;  4CYC A;  2Z2S B;  4BU2 A;  3MAJ A;  1G3S A;  4U88 A;  4MFD A;  3C2B A;  4DBQ A;  1T33 A;  2HDW A;  5DCF A;  2HDD A;  3H9G A;  5F0H A;  4IHW A;  2QEX I;  3B73 A;  2XPW A;  5J1U A;  1P7J A;  3GX4 X;  1RUO A;  1O3T A;  3OYI A;  3N97 A;  1CQT A;  5C3E J;  2ZXW H;  2F5F A;  2BYV E;  2IA2 A;  1V55 H;  3KZZ A;  3EUH C;  3ZQ7 A;  2OQR A;  2Z1D A;  3DV8 A;  5L3D A;  1U3E M;  3BR1 A;  3DPU A;  4OMZ A;  3JTG A;  5ED4 A;  5FRM A;  2O6G E;  1TQM A;  4JX6 A;  4KT6 A;  5CVV A;  3RSN A;  3BTC A;  5EZH A;  1HKT A;  1P4X A;  3J7Z I;  2FE3 A;  1YW9 A;  5FKN A;  4E6K G;  1UEL B;  2EFP A;  4XLF A;  4RA2 A;  3E6C C;  2ZC2 A;  1V3F A;  4EJO A;  1G4D A;  1VQ6 I;  3QU3 A;  3HTU A;  2LK2 A;  4KYW A;  1SD7 A;  4MGR A;  5H6R A;  3EPZ A;  2M7A A;  5EDN A;  2Z9O A;  4AWX B;  3I0T A;  3MMY B;  1PP7 U;  2GIV A;  3OY9 A;  3W3C A;  4CSW A;  2R7U A;  2K7L A;  3CCU I;  1UAA A;  2VUM J;  2P0W A;  2B0L A;  3SEQ A;  1Y39 A;  3DBR B;  1YQA A;  1R00 A;  1OCT C;  1YRN A;  1ZG3 A;  5FJ8 J;  1YJN I;  4M9Z A;  3K1P A;  2DDB A;  1JKP C;  1T0F C;  5ERI A;  2JVG A;  2R7D A;  1ETQ A;  4HZF A;  2OJE D;  2Q8K A;  4NDL A;  4L5E A;  1OIS A;  2MFZ A;  3T1B A;  2VE8 A;  2KT0 A;  2VBW A;  5GAE J;  5E17 F;  2HEO A;  1WQ2 A;  4CYC B;  1HCR A;  1Z3X A;  1TNT A;  1ZKG A;  3V7S A;  4KN7 X;  2EZI A;  3ZCO A;  4M6Y A;  5M3M J;  2KLO A;  4BQO A;  2EIN H;  2V4J C;  2Y75 A;  1I6X A;  3WE2 A;  2EB7 A;  5L3F A;  1CF7 B;  3BTJ A;  5HOD A;  4AID A;  2FEZ A;  2JT1 A;  4Q4Z F;  5BPI A;  2M30 A;  2QSH X;  1LNW A;  2BW3 B;  3H1C A;  4UY8 I;  2JA2 A;  2BY2 A;  2MYS A;  3A01 B;  2E2H J;  2JJ7 A;  4II3 A;  2BY3 A;  1IV6 A;  2Y0S A;  4RBO A;  3RIR A;  4RB1 A;  1PUF B;  3WTW C;  3V42 A;  2EK5 A;  2JVH A;  2DA1 A;  3BY6 A;  5K1Y A;  2TRT A;  2V1N A;  4IHV A;  3HUG B;  3L2C A;  2ZME B;  1QA6 A;  2VT3 A;  4QSH A;  2MD0 A;  3CMM A;  5F1J A;  1XMA A;  5FRO A;  3CC7 I;  3SDB A;  2X6W A;  4XLC A;  5ILS A;  1LEB A;  1WJF A;  2ESH A;  2WB1 A;  1QVT A;  5CLS A;  1ODD A;  4HLX A;  3TO6 A;  1XGM A;  4MFE A;  1ETW A;  1R1U A;  4O5V A;  1J7K A;  2ID3 A;  1ORK A;  3QPT A;  2GXA A;  3F6O A;  3P9I A;  2EV5 A;  2M4K A;  4EM2 A;  3GTL J;  1B9M A;  2MGQ A;  3JRC A;  3BTL A;  3HGG A;  4IEJ A;  1W0T A;  3V4G A;  4RGR A;  3O2P E;  4XK4 A;  3CCE I;  3N4M A;  3ZR8 X;  2ZXJ A;  4KJZ A;  4U0Y A;  3G1O A;  3OIP A;  4G94 A;  3WU0 A;  5K5Q A;  4L5J A;  4A69 C;  2VN2 A;  1I50 J;  5GPC A;  1MZB A;  2JRM A;  4YIF A;  5IOZ A;  4KIG A;  3WOD F;  4HAM A;  3COA C;  3U1K A;  3HYI A;  3ZQH A;  1FMV A;  1DU6 A;  3PL8 A;  1GV5 A;  5FKO A;  2YX4 A;  3ONQ A;  3ZXS A;  3ISP A;  3I54 A;  1Y1W J;  1SVO A;  2LYC A;  4AVP A;  4IF4 A;  3FIW A;  1UB9 A;  1YE9 A;  1VTN C;  2A6T A;  2XGX A;  2XUB A;  3FKJ A;  4RAG A;  2BV6 A;  5DD8 A;  1Y0N A;  2GWR A;  2VC1 A;  1CGP A;  3GCM A;  2IS1 A;  1RPW A;  2HFH A;  4UVC A;  4PSX A;  4LIV A;  3KP2 A;  3R0A A; 
#chains in the Genus database with same CATH homology
 2K9M A;  1SAU A;  3OYD A;  2BW3 A;  2HNH A;  3L2W A;  1WJC A;  4XKB A;  3FBN B;  1DGR M;  3OYC A;  4KIT B;  3D5R C;  1P9Q C;  3DKY A;  3OR1 C;  1D1B A;  3DKX A;  3VSK A;  4HNT A;  4E7J A;  4OAY A;  3M1C A;  3VWB A;  1NG6 A;  1E0E A;  4OAZ A;  3OWT A;  3HOT A;  2W1O A;  3LSG A;  4JOM A;  4F93 B;  3MKZ A;  4FAS D;  1GLN A;  5KCM A;  1MMA A;  4R79 A;  4Y33 A;  1OR7 C;  1LFP A;  3BG7 A;  4RMN A;  4YEJ A;  2VAS A;  1MMD A;  4F52 A;  4AYB A;  1WJB A;  4ZTF A;  1BR2 A;  1YX3 A;  3OL3 A;  5LFA A;  2DJI A;  2KRH A;  2ELJ A;  4H4K C;  2K3P A;  3RTR A;  3QYE A;  2HZD A;  2K5C A;  3OYJ A;  3D5S C;  4BXF A;  4XNF A;  2VKD A;  3L2V A;  4J01 A;  3OYA A;  2XSJ C;  1T95 A;  4IQ4 A;  3SZG A;  4BJT A;  4ZYA A;  2XAU A;  2O5R A;  4XKV A;  2CFO A;  2VB6 A;  4BJ6 C;  3GBG A;  3VYU B;  4ITV A;  1OLT A;  4NC8 A;  3I9V 2;  3IAS 2;  1DP3 A;  2X85 A;  3TL4 X;  2R7Q A;  2X1E A;  4N4O B;  2DOA A;  3UR3 C;  4DBR A;  2VJJ A;  4RM2 A;  1MMN A;  2ZSI B;  2DT6 A;  3LMM A;  4D1Q A;  3L2R A;  4ZC3 A;  4C30 A;  1D1C A;  4F91 B;  4E7S A;  3DEE A;  4BUP A;  3DWL E;  5HNH A;  2E5N A;  2KQR A;  3IUO A;  4BEH B;  2X6X A;  4BDY A;  3HC7 A;  2QKM B;  2OUM A;  4P5O A;  1D0Z A;  3DTK A;  5HNF A;  3CZ6 A;  2XF6 A;  3S3M A;  3H0D A;  4BEH A;  3FDY A;  4BE1 A;  2WBM A;  3PNV A;  2W4S A;  3DU6 A;  1AA7 A;  1MMG A;  2LRE A;  4II2 A;  4BGD A;  1EA3 A;  1LVK A;  1V5E A;  1V5F A;  2RQQ A;  2V7F A;  4PJL A;  2PJR B;  4BAC A;  4J00 A;  3PJR A;  3LSM A;  4XLE A;  1IRX A;  4U7B A;  3DLA A;  3FBI B;  3J7A Y;  3OS0 A;  2V9K A;  1Z3Y A;  1WJA A;  2IGN A;  2KRC A;  2XF5 A;  5CPR B;  4B3X A;  4IKF A;  1TT0 A;  2JSP A;  1R6R A;  3K4M A;  4MLO A;  4IZZ A;  4XQF A;  1G59 A;  4NQW B;  3OL4 A;  3QOD A;  3DTI A;  1D0Y A;  2L2O A;  2HQA A;  2KMU A;  4AU7 A;  1K6Y A;  3E1S A;  2RRE A;  3VSL A;  3CES A;  4CCK A;  3L2U A;  2VIX A;  4E7H A;  5HLT A;  4XLA A;  4BS9 A;  4CUG A;  4PJN A;  3VYS B;  1Z7L A;  2CS3 A;  3UNG C;  2HPM A;  2R7W A;  4NNJ A;  2M3A A;  4E7Z A;  3OYG A;  4E7I A;  1ERD A;  2LY2 A;  1UG0 A;  2V26 A;  4PUS A;  3OS2 A;  2WAF A;  2CV0 A;  4LG3 A;  3S32 A;  2R7T A;  3NWT A;  4E7K A;  2OV7 A;  2R7O A;  3LFU A;  5HVQ C;  4XON A;  2E60 A;  3PSI A;  3MKW B;  4BE0 A;  3AL0 B;  3KEY A;  4D9J A;  4LIT A;  2XC7 A;  1HA8 A;  3H5A A;  3K4J A;  4DIQ A;  4HEA 2;  3EUK L;  2ZSH B;  3A2K A;  5JHF A;  3K4K A;  2CUJ A;  4P1W A;  3AFH A;  1WFX A;  4F92 B;  2LBF A;  3L2Q A;  2BOL A;  3OYM A;  1ZEL A;  2F6C A;  3AL0 C;  2L9S A;  2Q1Z B;  2E1M C;  2W00 A;  2PMZ A;  5CQE A;  2CMP A;  2LBF B;  2UV1 A;  5CQG A;  4BDZ A;  2L9N A;  4BE2 A;  3S3O A;  2HVQ A;  3RQ4 A;  3M8J A;  1VZ0 A;  4NUB A;  5CKT A;  3CJQ B;  3SEZ A;  3MKY B;  1LDK B;  2JUG A;  4YEL A;  1DQU A;  2R7R A;  2NOJ B;  4CH7 A;  2VL8 A;  2MC4 A;  3ZGK A;  1N75 A;  4F55 A;  3KYL A;  1FMW A;  2LC2 A;  2VJ4 A;  3AKZ A;  3OR2 C;  3DQV C;  1Y56 A;  2L7K A;  1JI8 A;  4RLQ A;  2F5V A;  4XN0 A;  1V5G A;  3OYH A;  2HVS A;  4ZDL A;  4BQQ A;  4ZTJ A;  3KX2 A;  2I8D A;  2WAD A;  3CP2 A;  2W82 A;  4XMY A;  1LKX A;  1WJD A;  2IGM A;  2IS2 A;  4EAT A;  4ZDO A;  3HXL A;  3BCA A;  4N4N B;  2E5Z A;  3TMO A;  2WAQ A;  2X6Y A;  3OYL A;  4JQF A;  2KL4 A;  4XKW A;  3LSK A;  3VDX A;  4E7L A;  4DJA A;  1WJE A;  2GOX B;  4B43 A;  2VQG A;  2RNG A;  4XOR A;  3K4N A;  4QPO A;  2FUG 2;  2KDO A;  2CH0 A;  1N78 A;  4PJM A;  1X19 A;  2L5Q A;  1S9H A;  3MD2 A;  4B44 A;  1X1B A;  2WY7 Q;  2VLA A;  3CJR B;  4HNU A;  1Z21 A;  4XOP A;  3H5R A;  2VQH A;  2CW7 A;  4XR6 A;  2VKH A;  3FHN A;  4CCJ A;  4U87 A;  2KZV A;  3S8P A;  4ZJZ A;  3OYB A;  2LH9 A;  1X4P A;  3K4B A;  3BCB A;  1BR1 A;  2WY8 Q;  4IQJ A;  2KHM A;  3OYN A;  4XM3 A;  3PUB A;  2IS4 A;  4HSR A;  4HRI A;  3QOE A;  2VPL A;  3OYK A;  2IXS A;  4RM3 A;  3HG9 A;  1YX5 A;  2IGK A;  3PFY A;  2VXZ A;  2IS6 A;  1WJ5 A;  3HOS A;  3OMY A;  4OWR B;  4B47 A;  2CV2 A;  2ZXI A;  4DOZ A;  2DCE A;  2Z2S B;  4BU2 A;  4CA0 A;  3W2A A;  2LOO A;  4DBQ A;  4XN3 A;  3HL2 A;  2HDW A;  5LD2 C;  1QHH D;  3H9G A;  4IX7 A;  2DT7 B;  3IAM 2;  4Y4R A;  2UUZ A;  2HPI A;  3H9J A;  3G2B A;  3LSH A;  3QYF A;  3OYE A;  2MAB A;  3ZQQ A;  3CP8 A;  3OYI A;  2HVR A;  3LSI A;  3HPG A;  4XLH A;  1J09 A;  3EUH C;  3OYF A;  3K70 C;  2X51 A;  2Z1D A;  3F9K A;  3DPU A;  1X1C A;  3HPH A;  1N77 A;  2BVM A;  5FRM A;  3D5L A;  1BR4 A;  4KT6 A;  2HU9 A;  3RSN A;  4BQN A;  4E6K G;  1UEL B;  4HST A;  3PSF A;  4XLF A;  2KPM A;  2R7X A;  5FRN A;  4HG2 A;  2Z16 A;  4E4H A;  1QU3 A;  1SFK A;  4QPQ A;  1MW7 A;  3EPZ A;  1X1A A;  2M7A A;  4HPQ A;  2IGO A;  4XKC A;  2DXI A;  4AVZ A;  3RPU D;  3MMY B;  2M4G A;  2LRD A;  2VJI A;  3OY9 A;  3W3C A;  4PFO A;  4KIS A;  4CSW A;  2OC6 A;  2R7U A;  2F4I A;  2ZXH A;  1UAA A;  2XDV A;  2P0W A;  3SEQ A;  2AQE A;  3HKZ A;  1W36 D;  1BOB A;  2WAE A;  2W7N A;  2X1D A;  2VQL A;  4LIU A;  2ZFU A;  1T0F C;  2PJR A;  2JVG A;  2GOM A;  2CW8 A;  1MND A;  2R7V A;  2QKL B;  2VXD A;  3H5N A;  4PJJ A;  2MFZ A;  4RLF A;  1KON A;  1Z3X A;  4PK4 A;  2K9L A;  4DGW B;  3ZCO A;  3IP4 B;  4XOT A;  4PFP A;  2KLO A;  1U0J A;  2BVL A;  4BQO A;  2V4J C;  5KHD A;  2A5W A;  3DTE A;  3A4C A;  2E1M B;  5KNL A;  2BW3 B;  3C2G A;  3C2H A;  2CV1 A;  2JA2 A;  2MYS A;  4X0G A;  2R7S A;  4II3 A;  2VJ5 A;  1G8X A;  3H35 A;  2Y0S A;  3K70 D;  3PNY A;  3W2V A;  4C2T A;  3ZRG A;  4ZDP A;  2XF7 A;  4G6T B;  3A1Y A;  4CCN A;  2LY1 A;  2VQC A;  3CF2 A;  3V42 A;  2JVH A;  2R4G A;  2V6E A;  3K4C A;  3E0J B;  2V1N A;  3BG6 A;  3HUG B;  4ANJ A;  1X1D A;  2KP6 A;  2WA0 A;  2MD0 A;  1QHG A;  3CMM A;  4YRV A;  5FRO A;  3NWS A;  4FET A;  4C2U A;  1DGW Y;  3SDB A;  4PSW A;  2X6W A;  4XLC A;  1WJF A;  5TGT A;  4BJ5 C;  2WB1 A;  4CCM A;  3TBI A;  4NC7 A;  3H9Q A;  3S93 A;  1D0X A;  2UWM A;  5HOO A;  2M4K A;  3BC8 A;  3DPL C;  4C9Y A;  4CCL A;  3DPT A;  4Y3O A;  3SYT A;  3I3L A;  3DU5 A;  2M0M A;  3VYR B;  4KJZ A;  3K4L A;  3ZR8 X;  4CCO A;  3OIP A;  3OIQ A;  1TZL A;  2M7B A;  4GRI A;  3LL7 A;  4F3Q A;  1NG7 A;  1W36 C;  3BLY A;  3U21 A;  1X4O A;  3PNT A;  3OOU A;  1PYV A;  3N05 A;  1FMV A;  2AQF A;  3PL8 A;  4XL9 A;  1MNE A;  3ONQ A;  3ZXS A;  4CZC A;  1Y6I A;  2LYC A;  3EUA A;  3QYB A;  1YE9 A;  3VYT B;  1PJR A;  2A6T A;  2X1C A;  3K10 A;  1D1A A;  3FKJ A;  3OS1 A;  2LG4 A;  3W2W A;  4BL0 B;  3K6G A;  2IS1 A;  3S3N A;  3RCO A;  4B48 A;  4PSX A;  2Q2E B;  4LIV A;  2CUZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...