3HUGB

Crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
62
structure length
62
Chain Sequence
HHYAMWDAAYVLGALSAADRREFEAHLAGCPECRGAVTELCGVPALLSQLDRDEVAAISESA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/membrane protein
molecule keywords RNA polymerase sigma factor
publication title Structural and biochemical bases for the redox sensitivity of Mycobacterium tuberculosis RslA
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 21
structure length 62
sequence length 62
chains with identical sequence D, F, H, J, L, N, P, R, T
ec nomenclature
pdb deposition date 2009-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13490 zf-HC2 Putative zinc-finger
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1320 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hugB00
3HUGB 2Q1ZB 2Z2SB 4NQWB
chains in the Genus database with same CATH superfamily
3CMMA 4BBSJ 3QPLA 4I99C 4MFEA 1K6OA 1W7PD 2EZLA 2V79A 4HW0A 2RC4A 5CVIA 4YRVA 2KP6A 5EEHA 5M5XJ 1R1UA 2O5RA 2Q2EB 3C3WA 1GVJA 1Z21A 2OAZA 3CCYA 1YJ9I 3S2DJ 2STWA 2DMTA 3M7GA 3T8TA 4A93J 2JVGA 1SD7A 3ROUA 3B02A 1XGMA 2LH9A 3ZMVA 4A3BJ 1K4TA 1K7AA 2R7TA 2BV6A 3J80K 1BW5A 2G7HA 1IXSB 1Y8RB 2DOFA 2GOMA 1T39A 3AG2H 1BJAA 2I10A 1OCRH 1QQIA 2XGDA 4OMZA 2VBXA 2RDPA 4ZDPA 5BOXA 1EH6A 3VODA 5C44J 2L7ZA 4PJNA 1XS9A 2DA7A 4IHTA 3CJNA 3J81Z 1ZELA 5FKLA 4EGZA 5B66C 2F5EA 1SFXA 2X1EA 4LMYA 2E1CA 2ELJA 1AA7A 3SEQA 2EFNA 2IGNA 3BPXA 4JOMA 5E1ZB 1YW7A 2HGCA 4RDUA 3CO7C 1W36C 1SMTA 1Z1DA 4AM3A 2MC4A 3FK7A 2H09A 1IN4A 1ZYRF 3R0JA 3K4MA 2M8GX 4KN7X 3TP0A 1DPRA 1KZHA 1T0FA 3H3UA 4A0YA 2ADUA 3ZQQA 1YTYA 3PFIA 1FZPB 4KT5C 2XPUA 2K85A 1RRJA 2EV5A 4WXHA 1I3AA 3FHZA 4M74A 3V8KA 2KRFA 1P7JA 1BOBA 1KA8A 1X3UA 2FF4A 5HLTA 3F0CA 2K4BA 2M0CA 3UNGC 3C7JA 4NDLA 2LTPA 5LGTA 4IOCF 1IUYA 1H88C 3U1DA 3ONQA 3GF2A 3ZMDA 4BE1A 4L5EA 2R92J 1X1BA 4Q5SF 3J80Z 4XKWA 2JSPA 4IL6C 3FK6A 1ETYA 1ZGJA 3A1YA 2A6HF 2A3SA 2EPFA 4ZDOA 1IRGA 4M9SA 4EVIA 4YIFA 3O3KA 1O7FA 2VKHA 2NOJB 3D5RC 4IQ4A 1QPMA 2EBIA 2OUMA 3LFUA 4YEJA 4B3XA 2KIFA 1POGA 2R4GA 2K3FA 3CCRI 3IWZA 3GTJJ 1RR7A 3S17J 3TP3A 1I39A 1OPCA 5HLGA 3BZKA 3OL4A 5E1XA 2M5WA 5EYRA 4A6DA 3J7YJ 2KL4A 3TEDA 1FOYA 4XLCA 2E7WA 2COBA 2M30A 3BTIA 4G8XA 3DTIA 1MJ9A 4L9JA 2H1LA 4WX9A 4ENNA 1FT9A 1V5FA 2L54A 3DKWA 3K4LA 4WCGA 2NVUB 4Y7NJ 3QPHA 1AU7A 4TV7A 3OYCA 2E35A 1A36A 2DI3A 3DLAA 2CO5A 2M4GA 2A5WA 1RUOA 4M71A 2CH0A 3CZ6A 3L7WA 6PAXA 4IKFA 3I4MJ 3FF5A 1NK2P 2WAEA 4NUBA 3ABMH 1VQ5I 1XSDA 2EA4A 1DP3A 3I56I 3OR1C 2HOEA 4NQWA 2FRHA 2MABA 1VQLI 4PUSA 1N25A 1IF1A 1WJAA 4UHTA 3L2VA 1ZHFA 3KPHA 2EIKH 4BAYA 5IYCJ 4I01A 4RB3C 3H5NA 1P92A 3NWSA 2O6GE 2HNHA 3P9KA 3WODF 1CF7A 1D0ZA 2HVSA 1FP2A 2P5VA 2W82A 3KLOA 3FKIJ 1MGTA 5C4JJ 1IZ1A 1ZLJA 1BI2A 4RGSA 1P9QC 2QSFX 1IJWC 1UG0A 2H6CA 4NQWB 2IGMA 3DV8A 2PEXA 2V26A 5BMZA 2NAZA 3W6JB 2WC2A 1BC8C 4HF1A 3N05A 3DBHB 4G6TB 2L9SA 2XUBA 5H6QA 1CF7B 1UZCA 3F8FA 2DN0A 1VQOI 2KKOA 1SFKA 1T38A 2VQCA 2Y0MA 4E7ZA 1HA8A 4QSHA 3RZDJ 3LSJA 2IA0A 2ESHA 3U1KA 4EM2A 3BQZA 3ZQHA 2L9RA 3I71A 1STZA 2LC2A 2EV0A 3T1BA 4HOBA 2ISZA 4M72A 3OIOA 2DTZA 3DF8A 2ETHA 1VQKI 5DCMA 4PJMA 1HDPA 3D5LA 2LY9A 1FEXA 3KP5A 3KP2A 1EJ9A 1PUFA 1ITYA 3CC2I 3OYAA 2IS1A 2CFXA 4EATA 4BDZA 2B63J 3CF5F 2CGPA 1Z91A 3SDBA 4XLHA 1YIJI 2CMPA 2RGVA 1SFOJ 2P6TA 1LVAA 1A35A 3S3MA 1LB2A 3FMQA 2XHKA 4R79A 1S7OA 1I6XA 2QQ9A 5DCMB 2EK5A 2V4JC 4HF2A 1FP1D 4M3DA 5CJ9A 3REOA 4HYEA 2VXZA 5FKKA 4A3CJ 3X2QH 1U5TC 2X6OA 1WFXA 1PUFB 1E3PA 2FUG2 2K02A 1S29A 4M3FA 4NC7A 2XF6A 3R6SA 2RVCA 1T8IA 3BG6A 4MNUA 4AVZA 2DA1A 1X1DA 2CSOA 2CV1A 1TLHB 4KIBA 2ZXJA 3TMOA 3L2QA 1HDDC 2NXNB 2QKLB 4EJTA 4JX5A 4XN0A 1ZARA 2DTRA 1JE8A 2VQLA 4XONA 3DFGA 4DBQA 1MD0A 4AIDA 3KETA 3JRHA 5E3NA 2KPMA 2NS7A 3BROA 3I59A 1FOWA 4LGWA 1DQUA 3KIOA 2CV0A 3QP6A 4GYIA 1IDZA 4J01A 3GTMJ 2DYSH 2ZFWA 2XPWA 2VB6A 1HLVA 3Q9SA 1UHMA 4RA2A 1IGNA 4KA4A 3KEOA 1AKHA 1HKSA 4DOZA 3FMSA 5ERIA 2W7NA 4MO7A 2JWTA 4XM3A 2IGOA 4HPQA 4ZZLA 1FSHA 3L09A 4FE7A 2STTA 5D6FA 2WY7Q 1X1CA 2PN6A 3ASOH 1H89C 2DDBA 3DXJF 4Y33A 4LFUA 4C30A 2KT0A 1G2HA 1IV8A 4L9VA 3I59B 2MC3A 5J6XA 1YITI 1LPQA 3G1LA 4IHVA 1DU6A 2E1NA 3IAS2 3CO6C 1WPKA 4A6EA 1LNWA 2HFHA 1VQPI 4LITA 2Y0SN 4M73A 4BJTA 3GLXA 3CTAA 3H3VK 3O6BB 2OD5A 2NVQJ 1AKHB 2RAEA 1EF4A 1D0XA 2Q8KA 4CO8A 3GZNB 4UNOA 2RQQA 5HODA 4RAGA 2Y0SA 4HX8A 3G3ZA 4HQMA 1QRYA 3G1OA 3E1SA 2WAQN 2RKHA 2I8DA 2WA0A 3CMEI 1WJBA 3WU2C 2EV6A 4BH9A 3BR1A 3V8LA 3PJRA 2W4SA 1U5TA 5FKNA 2GXAA 4HDVA 4I09A 2ZC2A 1JI8A 4DYCA 3F22A 1TT5B 2K5CA 2W57A 2ZJQF 2WAQA 1O4XA 2P7VB 4ANJA 4EV0A 4MEXF 1JT6A 3MVPA 2IP2A 2DODA 4EQQA 5CKTA 1QZZA 3S15J 2K40A 3ZR8X 2OA4A 5DD8A 4CH7A 1WHUA 1CGPA 2YUSA 4Y17A 2UV1A 5E17F 2EB7A 2OQGA 3VYUB 3CC4I 1ZRFA 1O3RA 4D1QA 1ZAOA 3JTHA 4RM3A 3IP4B 4KIGA 3VDXA 3OYDA 1U5TB 4N4OB 3CESA 3L2WA 3MKYB 3WGIA 1R00A 2L3DA 4DJAA 1ETXA 1GVDA 3BG9A 4UXNA 4BKXA 4GCVA 3HBLA 1V5GA 2HYJA 2UXNA 3L2RA 4YG2F 1KU7A 1V3FA 2OBPA 1QGPA 1MMSA 1FTTA 1FYKA 2XIGA 2LBFA 3K1NA 2CRGA 3F6OA 2LSOA 1VQ4I 3ZN1A 2R7VA 2KQRA 1W1WE 2Y9YA 2IAIA 3QWLA 4GXOA 4ENJA 2F6CA 2COMA 1O3QA 4B43A 1YHQI 1G3TA 2VE8A 3VYRB 1XSVA 2XPVA 5FFZA 4LG0A 3H9QA 3OSGA 5H20A 5E3MA 1FOXA 1HSTA 5EEGA 3M8FA 4MTDA 1HW2A 4MTEA 1T95A 2EA2A 2H8WA 3HSEA 2KIUA 1U2WA 3F8BA 1TC3C 3S8PA 2VT2A 1ETWA 5TGTA 1S3JA 2LBFB 4MFDA 4UVAA 1WJEA 3KP4A 2Z33A 3I5UA 1SVOA 4GO1A 2QQ8A 4BHBA 5L3GA 2HYGD 3DTKA 3FXQA 2PMHA 5KAIC 4BXXJ 1USTA 3FZVA 2F5FA 2V1XA 3EPZA 2IT0A 2VOOA 2DJNA 2GA1A 2WAFA 1Y0UA 3IWFA 4NB5A 1K6YA 3H9JA 2JA7J 4XLEA 2GZWA 4C3IJ 1QHHD 1HKTA 4HAMA 4XLFA 5LD2C 2RNGA 4HEA2 4M9ZA 2M7AA 5DUIA 5HNFA 1G4DA 5FKOA 4EJVA 1G6NA 4JBAA 1XCVA 4BHCA 4H4KC 4XOPA 1RNLA 3CMYA 2PBIA 2IA2A 5LLQA 1QZYA 1TQMA 3V8JA 5IP6A 1UHSA 2E60A 5L3EA 2O8XA 3SZPA 3VOEA 4ZYGA 1V55H 2V1NA 2XKPA 3Q3SA 3D1NI 3K0LA 3J7AO 2CS3A 3PO3J 4D5CA 2R7SA 2JPBA 1VQ7I 1WI3A 1MW7A 3OIPA 1FYMA 1W7PB 1Z67A 1Z77A 3OWTA 2R5YA 1VTNC 2BHYA 3HUGA 3I0TA 5C4XJ 2ZNZA 4DGWB 3HEFA 2JJ7A 1IXCA 4P9UA 3GVAA 3HB9A 2EFQA 2Z16A 4JYKA 3QU3A 3SZTA 2XROA 3QU6A 3SYTA 3L2CA 3BR3A 3BC8A 3P7NA 4Q48A 3MMYB 3WG7H 1UHWA 1KYZA 4CGZA 4IHXA 1YS6A 1BN5A 3QRFF 3R0AA 2HXIA 3ECOA 3WE3A 2HVRA 2Z5UA 3H0DA 2DO7A 1XB4A 5JLWA 3JRDA 1X2NA 4W97A 3GX4X 5A2QK 2QA4I 1TWCJ 1KQ0A 3ERMA 2R5YB 2BW3A 3HUGB 2LMDA 1SVLA 2YX7A 1IG7A 2M45A 2FOKA 4CUGA 5FRMA 3F3XA 3RDIA 2CUFA 2OQRA 1D5VA 3FBIB 1VQMI 3GTKJ 1RC9A 4AIHA 2DDAA 2OZ6A 4ZC3A 1JUMA 4BQOA 4M3GA 4XQFA 3G73A 1HW5A 2HOSA 3EQLF 3UKGA 2EQRA 2Y9ZA 5IP7J 1JT0A 3BP8A 3CLQA 5J1RA 4FCYA 3HRUA 3DWLE 2BW3B 3Q0UA 2D1HA 5J4VA 4KIFA 4YFXF 2O9LA 3KZIC 2X51A 1D1BA 2GAUA 2V1UA 4LIUA 1MBGA 2CFOA 5B5EC 4BDYA 2KMUA 2WTEA 3P9IA 4GRIA 4KISA 1MBEA 5EGOA 2BY2A 2W85A 2VLAA 1RPWA 4DYRA 2FQ3A 2ZMEC 4XK4A 2ECCA 1FJLA 1LDJA 3WGGA 5AIQA 4AU7A 3RKYA 1MDMA 4YFKF 1N77A 1JXSA 1Q1VA 1DGWY 3H3ZA 3DU5A 1CQTA 2DBBA 3MN2A 5JR3A 5IP9J 2JRMA 2O7OA 1KQ8A 2ZJ2A 4NC6A 1ETOA 2J5OA 2Y30A 4KT6A 5EGOB 4ZYHA 3S1MJ 3IRRA 5IOYA 1B1BA 5F0FA 5JLXA 3IKVA 3SZGA 5LEJA 2XVCA 4XMYA 2DMQA 1N75A 5L3CA 5HDNA 2OJED 1R49A 1BI0A 3E97A 3RKWA 1HCRA 1ZG1A 2VUMJ 2FBKA 3UR3C 4BGDA 4CYDA 1MDMB 2A07F 3DEEA 4U7BA 1PJRA 1WQ2A 1WH5A 1OCZH 4EEFG 1SFEA 2PJRA 2ESNA 1MNEA 1GV2A 2X6YA 1BJZA 3EUKL 5K7ZA 2VODA 4PGGA 1XDUA 5B3SH 2UUZA 2JZYA 5HS7A 2K9NA 3VFZA 3F8MA 5CVVA 5GPAA 1D5YA 1OR7C 2K9MA 4AWXB 2Z3YA 4WXCA 2P81A 4I0BA 3FDYA 4LB6B 2P5KA 3JRBA 1ZGWA 5FB2A 2W25A 4XIDA 3LA2A 5H6RA 3F23A 2QLZA 5EDNA 2PJRB 1ZR2A 2ZSIB 4PJ0C 5M5WJ 3BOQA 5F27A 2QQBA 4UB6C 3RSNA 4L9TA 3DU6A 2TRTA 3S1NJ 3K4KA 4RS8A 3EUHA 1I6HJ 2AS5F 3J7ZI 1XSXA 3I4PA 3TO7A 2ZMEA 2CJJA 2KJCA 3S1RJ 1LEAA 1DDNA 1B9NA 1YIOA 2KFDA 1HXDA 2K3PA 2VJIA 1ONVA 4I7HA 4BE2A 5FROA 1VQNI 4P5OA 3WTWC 3L00A 3BJOA 1REPC 1S7AA 1WRJA 1H0MA 3AG4H 2DXIA 3CDIA 1ZG3A 4JX4A 1OCCH 3EYYA 1PYVA 1XMXA 4RB2C 2NS0A 3TOBA 2IS6A 2VPLA 2XGEA 3SHFA 3TKYA 1XGNA 1R5ID 2LKXA 2ZMEB 1GHCA 3BJAA 2MLGA 2E2HJ 5D5XB 5EJCA 5J8CA 1ZG5A 4MQVA 3OYIA 4ON0A 3GTPJ 1JKOC 2O3FA 4K2EA 5EZHA 1A6QA 4UVCA 5FJ8J 1PP7U 4I2OA 3DBLB 4F52A 5F1JA 2XRLA 3I4NJ 1Y6IA 2CG4A 1OQYA 4A2UA 4ZDLA 5CVRA 2QVOA 2M2EA 4EJUA 1F4KA 1K83J 2L7KA 2XGCA 3K2AA 4LJZF 2XF5A 3F72A 4M6VA 2AHQA 3M1CA 2XSJC 5K5QA 3L2UA 4ENMA 3LNQA 1UFMA 3GTOJ 4XORA 2HQNA 3BLYA 1G59A 1WJ5A 3HOZJ 3K7AJ 4A5MA 4YFNF 3MEXA 5D8KB 5HLHA 1OR7A 1W4MA 2YX4A 4PFPA 4M9XA 2HKXA 3GXOA 2D5VA 2X85A 1A5JA 5IYBJ 4EM0B 2FNPA 3IC7A 3TW7A 2LLKA 2Q0OA 3QYBA 1BL0A 1A04A 1O57A 4L5IA 3DCFA 4WF2A 4II3A 2ZJRF 2FQ4A 3SFZA 3HPGA 3ISPA 5GPCA 4QWQA 2Z2SB 2KRCA 3ML6A 3RTRA 3TDUC 1JUSA 2E1OA 4XBFA 4P55A 2EILH 2VL8A 3BCAA 4Y13A 4V2FA 1MBFA 2IVMA 1SEUA 5CVUA 1ERDA 3OL3A 4PGHA 4A69C 2KRHA 5KVRA 1U78A 1M1EB 1O3TA 4KDPA 3GBGA 1DUXC 4L5JA 1ZGAA 3HHHA 4IRHA 2EIJH 4YELA 1B4AA 3G4SI 2Y31A 1FC3A 2MBFA 3NEUA 4OAZA 1TP4A 1IUFA 2DU9A 5FD6A 2F48A 2P0WA 2O03A 3N4MA 2CW7A 3MZYA 2RN7A 4BL0B 2FMYA 3BR0A 1IN8A 2QZ8A 4LK1F 2DFHA 5ICFA 2R7WA 2BYVE 2MD5A 1WH7A 1USSA 2VC1A 4IO9F 2LKSA 3S3OA 1J5YA 2XAFA 3S16J 3I55I 5IT9K 4KFCA 2LVSA 2W1OA 3KP6A 3HRSA 3M07A 3IH4A 3M8JA 2DLLA 2WV1A 3DPTA 5LEKA 5EEAA 3U9GA 1S5LC 3S93A 4OOIA 3WGHA 1B59A 4BXFA 3WTTC 1XMAA 4EJOA 2P5LC 1NTCA 2HI3A 2EZIA 4HG2A 2Q1ZB 5HDGA 1HQCA 4BUPA 4HNVA 1RKWA 2IRFG 1LQ1A 1U8RA 4N0BA 4D7NA 3CDLA 2D1VA 2R7OA 2BBYA 1D8JA 3WHCA 2L7MP 4HV6A 1SANA 2FA5A 3IAM2 2ME6A 1FTZA 4I02A 2PQ8A 5ILUA 2LG4A 1GXPA 4G94A 3G1MA 1I27A 1U3EM 3AG3H 2QQAA 3FX3A 4BQQA 5JI6A 2X6XA 1TNTA 3COAC 4RLQA 1R5HA 1KGSA 2AQEA 2HOAA 4KUMA 2X1DA 5EF6A 1E3HA 1LJ9A 1DPUA 4Y3OA 3OYHA 2HR3A 4QIWN 4HSRA 5L3BA 2B7EA 3DTEA 4A3IJ 2R93J 2EZKA 1KONA 2FOWA 3LQRA 3CDHA 3VEPA 1R1TA 1E2XA 2E1MC 4CA0A 5E18F 3TOAA 3OYBA 3CCQI 2R7DA 3LAPA 5GAEJ 3ZN0A 2G9WA 2L4AA 1F1ZA 2QCOA 2IS4A 2R3SA 4B1RA 3V7CA 5IT9Z 2M87A 1H8AC 3HOYJ 3DKYA 2MGQA 5E3LA 4IOAF 2ZXHA 3JSPA 5L3DA 1FYLA 2P7CB 1SD6A 2X1CA 4ZYDA 4KITB 1RETA 3PUBA 3CF2A 1X3ZB 1GLNA 1ON2A 3BTJA 5JHFA 5DD4A 1YW9A 5D5UB 4PFOA 3W6VA 2HZDA 5BS6A 3ZP5A 2XF7A 4G6QA 2LNBA 3BDDA 3E0JB 3LSHA 4BHPA 4J19A 1FBQA 2RREA 2DFIA 3GUDA 3HGYA 1R1VA 3N97A 2WWYA 2A68F 4GYGA 1LUJB 3J7AY 2CWEA 3WTVC 2ME0A 2LF7A 1ZQ3P 1ULYA 4RGUA 2F4IA 2YSRA 2M7BA 3L9FA 2ICWG 3TO6A 3KFWX 4BJ6C 1BR2A 5HLIA 4ZZDA 4OU0A 1EH7A 2EFWA 2MLKA 2ZXIA 2OTLI 5D5VB 3BZ6A 2F2EA 3P5JA 2L01A 4FISA 2NVXJ 1R6RA 4E6KG 1JTYA 4IEJA 4E7JA 2ZCWA 4C3HJ 1OYYA 1GDTA 1D3YA 1J75A 2YR2A 2JN6A 5HNHA 3LFKA 4J00A 4D0PA 1LFUP 4IJAA 2KZVA 2FXAA 4XL9A 5DM7F 5J47A 2DYRH 3WG9A 1LVKA 3V7SA 5HDKA 2DMUA 3FIWA 2OU2A 1TW3A 4I0AA 3I53A 3IH3A 1I1GA 2VN2A 4IVNA 4MGRA 3G71I 2VI6A 2IJLA 2MFZA 3PQJA 1P4XA 1T2KA 4M3BA 4PZJA 5B1BH 5LGNA 2UZKA 3LQQA 3O2PE 1MSFC 1JGSA 3B6AA 3PNTA 4ABZA 4IRIA 4IHWA 4HZFA 5KCMA 1BC7C 2GIVA 1GV5A 1J0RA 3CCEI 2N8GA 1X1AA 1R36A 4M6XA 3ZQIA 5B1AH 3OYGA 4A3MJ 1RUNA 2FD5A 3OYLA 3K1MA 2F5VA 4WK8F 4R8HA 1R4MB 2E1MB 1OCPA 3LSMA 4PCQA 1OKRA 3T0YA 2F5DA 1X2MA 2BVLA 1PVEA 2HDCA 4A3DJ 1N78A 1S9HA 4U7DA 1JHHA 4NHJA 2UWMA 3A4CA 2NVYJ 2ZB9A 2DPUA 1W0UA 1ON1A 1TZLA 5IT3A 2R7XA 2ZSHB 4XRFA 1IV6A 2GIZA 4OIPF 4UV9A 3KP7A 1XG1A 4MHGA 1OJLA 2M1BA 3HC7A 3RI4A 4XR6A 3GFMA 5HVQC 1MJBA 4P9FA 4U87A 5ICGA 1H9GA 3VB2A 4C2TA 2O0YA 1BM9A 4I76A 3LSRA 2Y48A 2PMZN 4RAFA 5IOZA 3S1QJ 4HX4A 4IX7A 2M0MA 1PUEE 2JMWA 1ZR4A 3P9CA 3QOEA 4XOTA 3GZ6A 3OR2C 2DAOA 4II2A 5GTHC 2QSGX 2ID3A 1WJDA 1EV7A 2PMZA 3S14J 2M4KA 1TWFJ 1VNDA 1MIJA 5F0HA 3WTXC 3I64A 1Y1VJ 1FPQA 2H1KA 3S3NA 4HF0A 1X3WB 1U8BA 4BS9A 5DS9A 3PL8A 5LHGA 1IO2A 2FBHA 5FLVA 3D0SA 4MIMA 1JKRC 3BY6A 4CDGA 4OINF 2EINH 4IXAA 4UUTA 5E8GA 2L9VA 1LKXA 1E17A 3JAMK 4P96A 1VQ9I 2VBYA 3K69A 1TQPA 3QPSA 3R61A 4A3LJ 5F04A 2E5ZA 2P8TA 1Z05A 3KP3A 2PJPA 2HWVA 1YRNA 3JW4A 4ZJZA 4XLNF 3WTSC 2BGCA 1TNSA 3HOSA 3AG1H 4E4HA 3HJEA 4BBRJ 2QKMB 1MMAA 3TW6A 3PNVA 1S72I 3FWEA 4LG0B 4CCNA 3SFIA 1ZRCA 2M8EA 3RYRA 2NRAC 1GT0C 2Y75A 1X19A 2H27A 3PIOF 3HSRA 3CD6I 5E1WA 1E3OC 1XGSA 2VBZA 2V9VA 2LRDA 3K9TA 4B4CA 1XMKA 3NAUA 1ACIA 2PFBA 4HLXA 1IN6A 3FXMA 1X1PA 1YRNB 1XCBA 1QO0D 2E5NA 4RMNA 3GTGJ 4PJJA 1BR1A 4FX4A 2Y2ZA 3Q0WA 1JKPC 1BW6A 5FO5A 2R0QC 3H0GJ 4PK4A 3ZQCA 1TWGJ 1X58A 1Y1WJ 2HDWA 4OMYA 1DGRM 2Z99A 3W3CA 1JTXA 1MH4A 2JSCA 2L7FP 3GWZA 2WBMA 1BOAA 5CYVA 1P6RA 4RAZA 3OOPA 3V7RA 3A01A 3TGNA 2KISA 3K4JA 2ACJA 4HBLA 1K4SA 4XRSG 1W5CC 2EIMH 1NK3P 3MFKA 4UUSA 1W5TA 2XAQA 4HSTA 3DEWA 1JHFA 1FMWA 3E5UA 4HDUA 3JRCA 4A3FJ 3ZQFA 1FNNA 1FIAA 4N9IA 3IRQA 4P1WA 3JAMZ 1MNDA 3VYSB 5GP9A 2DJIA 1YI2I 2MH2A 2VJJA 3TO9A 4XRMA 1OYIA 3V4GA 1MMNA 4UV8A 4F92B 2CW8A 2NNNA 2XAUA 3QOPA 4LD5A 3A01B 3KZYA 5E3OA 2AXTC 2QM3A 3K4CA 2VT3A 3RIRA 4N9HA 1FMVA 2DCEA 3HZJA 5HOOA 5TRDA 2HU9A 4Y52J 3CMAI 5CLSA 5J40A 4UUSB 2DK5A 1WVRA 2A61A 1RI7A 3KZZA 5K1YA 3RZOJ 2ZNYA 3C18A 1MSEC 2KIQA 3BR5A 3CLOA 4V2GA 4EMSA 1NH3A 3KE2A 4KMUX 2YU9J 5GAGJ 3FXRA 1P2FA 1F9NA 2X6WA 4HQEA 1TWHJ 4XICA 1FBUA 2DA3A 2PMUA 3OV8A 1S8NA 3NRVA 4OIQF 3GFLA 4LLNA 1YFHA 3ZQLA 4ESJA 1OLTA 2VPRA 3OYKA 4G7OF 1TQIA 5E8IA 2TCTA 3OOUA 4XKCA 4A0XA 2IBDA 1HW1A 2O8KA 3EUHC 2HTJA 5K7FA 3ZGKA 5K5OA 4IQJA 3FM5A 4O3MA 1ORKA 5FD5A 3ECHA 4HNTA 5J4YA 3RJPA 2EWNA 3IV5A 2ID6A 1QHGA 2OCEA 1ENHA 2IXSA 3WHBA 3GEZA 2GLOA 1YX5A 1E0EA 2K9LA 2VKEA 3WE2A 4ZH4F 3BJ6A 5IPAA 2QBYA 1W5SA 2IGKA 2OPTA 1LFBA 1ZTRA 2QWWA 4FE4A 2I5UA 1QPIA 4X6AJ 1WGXA 2XASA 2ZO4A 4M6YA 2ZJPF 3HOWJ 5A2QZ 3CCLI 1FBSA 3QYFA 2PG4A 3LSKA 1EH8A 1U9NA 3FISA 2JTVA 2E2JJ 1QVTA 1T6SA 4LB5A 5ICCA 1B72A 5EZGA 2KJBA 2BHZA 3CQZJ 3MAJA 4BACA 3ZMTA 3Q5FA 3D5SC 5KNLA 2QBYB 3GYHX 1MMDA 3RYPA 4IPAA 1WSUA 4NNJA 2M34A 2MYSA 4PSXA 3F21A 2BY0A 1VI0A 2DMNA 4ETSA 5FLXK 1J09A 4AVPA 1I50J 3GW2A 3HRTA 1Z6TA 3OS1A 3H5AA 5ICEA 3HM5A 5C3EJ 1HSJA 2DOAA 5DEQA 2L5QA 2XAHA 5DM6F 3WU1B 3NWTA 1X4OA 4LLLA 1Z0XA 3K4NA 3QODA 3RQIA 1WJCA 1SAXA 2DPDA 1B72B 3W2WA 2AO9A 3BG3A 3Q0VA 2DA6A 1YOVB 3I58A 4BY1J 1OISA 2BOLA 3PSIA 5F1RA 2LY2A 2W48A 2IEKA 1J7KA 2IPQX 3FMRA 2C6YA 2ELKA 1R22A 2MD0A 2GXGA 3HRMA 4L0YB 3H35A 3BG7A 3IH2A 1U6GA 3JRGA 1FY7A 2E2IJ 2VXDA 3EUAA 3HGGA 2W24A 3CCVI 2ISYA 3CJTB 3DPUA 3HSFA 4S0HB 4A0ZA 1V4RA 1YLFA 2KDOA 3LL7A 1WI9A 4HV5A 4DIQA 2CQQA 2QGUA 4AIKA 1P4AA 2EZHA 5DDGA 2E71A 2ECBA 2D2WA 2FEZA 1KQ9A 3ZQ7A 3E5XA 4Q47A 1IRXA 2A5YB 4AC0A 2R7ZJ 1BBYA 1QA6A 3CCJI 4YIRX 4BXUA 4ZTJA 1WWXA 1Z7LA 4XNFA 5DV5A 2JT1A 1FWZA 3MQ0A 4IRGA 2VKVA 3EYIA 3B6CA 2IW5A 1OCOH 2IS2A 1ETKA 5FLXZ 1LE8A 3K6GA 1LDDA 2E34A 9ANTA 2BXZA 3KX2A 4KN4X 2CUEA 1T56A 2VOPA 3CP8A 3VSKA 1P4WA 4XRSA 2KDZA 1BA5A 2X9DA 2V6EA 5F08A 3V42A 1SMYF 5HS8A 1PP8F 1XGOA 4RBOA 2FSWA 3HIFA 3MZ8A 1UMQA 3W2AA 4FASD 2LOOA 2BE5F 3GLLA 1ZKGA 4AIJA 4RB0A 1B8IA 1K61A 3GMEA 1LE8B 1UJ8A 4CCOA 1YX3A 3F8CA 1GUUA 4KJZA 3IL2A 3LSGA 2XKOA 1A31A 3HXLA 2H8RA 1QZEA 4FX0A 4CCJA 4L0ZB 2DFFA 1R4NB 3KYCB 1VFCA 3K70C 3WTZA 1XDSA 5CQGA 1JJ8C 1A6IA 2LF8A 2R7FA 2XB5A 2GQQA 1D8KA 4I98B 3A03A 4ITVA 1ETQA 2DQLA 3WTUC 3MZHA 3HOTA 4U0VA 4E70A 2QEXI 3RKQA 2DA4A 1B8IB 1D1AA 3HKZN 2VASA 4QPQA 3VYTB 2FMLA 1B9MA 4ENKA 4JK1X 1ZRDA 2DK8A 1Y0NA 3HKZA 2QF7A 4B48A 1TT0A 5M3FJ 1PDNC 2OZUA 1HC8A 4M3EA 3GFIA 4C2UA 2JA6J 3H92A 3G6EI 4X0GA 4E7SA 1OFCX 2XRNA 4HRIA 3A0HC 1LFPA 3BR6A 1P7IA 1XN7A 4G6DA 4JQFA 2KZGA 3LOCA 2VE9A 5AONA 3I54A 4JP0A 4A3GJ 3LSPA 3U2RA 3HOVJ 2VJ4A 1U9OA 1SD4A 4ESBA 3FHNA 1ZREA 1YYVA 2Y69H 4NC8A 2WADA 2OV7A 5D6EA 4MEYF 3OYEA 1Z3YA 2EFPA 3OYMA 1R58A 2KHMA 2NS8A 3IHUA 1S7EA 3C2BA 4UVBA 2EH3A 4CZCA 1NG7A 1ZN2A 3FKJA 3C1DA 4ESFA 4GDFA 1MBHA 4WXDA 4U0YA 4A3KJ 2KIMA 2D45A 4MQ9F 2RV8A 4CZZA 2R7RA 4N4NB 4AUXA 3MWMA 3OMYA 4QLCU 3RPUD 3HDDA 2VIXA 3H5RA 5LRSA 2DQRA 3H9GA 3HTUA 1WKMA 5BPIA 1SD5A 1AWCA 3TDZC 4IHSA 4G12A 2OF7A 2QYOA 4OWRB 5FRNA 4AYBN 4UY8I 1APLC 1B6AA 5GTIC 2MA3A 1JUPA 4WWCA 2G0EA 3DKXA 3HL2A 1OMIA 5GAHJ 4BQAA 2FU4A 1I3QJ 3WTYC 3BWGA 4EM1A 5LHHA 4KICA 2FNAA 4AYBA 4IZZA 3CP2A 1ODDA 3VPRA 2JA8J 3KYLA 3ZMSA 1J59A 2XV4S 2VQGA 4QTRA 5JVTA 1JJ6C 1YJWI 1JGGA 4E7LA 2Z9OA 4BY7J 2L2OA 4ASNA 2HKOA 1NG6A 4KNYA 2VQHA 3QQAA 1EA3A 4OAYA 2K27A 1TTYA 3DBRB 3NARA 1T98A 4W1UA 3H1CA 2GWRA 4F7ZA 2NYXA 1IRZA 2L9NA 1NHAA 4L18B 3HOUJ 4BEHA 2HEOA 3A0BC 4XKVA 2L0KA 2J5PA 2BEOA 3BCBA 5M3MJ 3JSOA 2R5ZA 3JRFA 4O6JA 3A2KA 2O61A 3MKZA 1DU0A 2XDVA 3TL4X 3SXYA 3I3LA 1GXQA 2HZTA 2HS5A 3ABUA 5FGMA 1QVUA 1ZK8A 2CUZA 5LHIA 4H0EA 4GFBA 4CSWA 3G2BA 4BYYA 3JREA 1TL8A 5D4RA 2ELHA 3JR9A 5DCFA 2BXYA 3C2GA 1UELB 2DW4A 4RGRA 5DUKA 1FLIA 3HHGA 1YQAA 2VONA 3AAFA 2BVMA 3IUOA 1XTAA 5D8LB 4BEHB 2HTSA 5KHDA 4I6ZA 1YJNI 3TQNA 2R5ZB 3E3VA 4CXFA 4ZTFA 5LFAA 1LEBA 2DT7B 4NBQA 1R71A 1R23A 1UAAA 1SAUA 3KLNA 1Y56A 3SQNA 3FM3A 1SC7A 3BG5A 5EG0A 4FT8A 2JA2A 4HNUA 1IRFA 1Q1HA 1J2XA 2QUFA 3VSLA 1R9TJ 3DP7A 2CQNA 3W2VA 5FKMA 4DNCA 5ILVA 1ETVA 2B0LA 1XC5A 2NNYA 4PDKA 1KU3A 1FOKA 2BY1A 3GTLJ 5FLMJ 2CQXA 5BPDA 3DPLC 3BPVA 4X1EA 3OYJA 2JA5J 3CUQC 1OCTC 1F43A 3QPTA 3BQYA 3E7LA 2JVHA 2HQRA 4KYWA 1YO5C 1T08B 3K1PA 1XD7A 2FE3A 1Y8QB 1TBXA 4B44A 5J3LA 4RLFA 3JTGA 3PO2J 4Y4RA 3ZQGA 1O7LA 2DT6A 3FXUA 2AQFA 3KEYA 3MKLA 3W6KB 5E79C 4E7IA 2E7XA 5CPRB 5EG0B 4G9YA 3ABTA 1MH3A 4C2MJ 3S2WA 1S6LA 3ZMZA 4RM2A 4MLOA 1Z7UA 1JKQC 3ESWB 2FX0A 2PI0A 1I5ZA 1VZ0A 5LBQA 3RKXA 2DT5A 2WV0A 5IY5H 3ABLH 2DOEA 3M4OJ 1VQ6I 2X48A 1UG2A 3GFJA 5HS9A 4S05A 2V6CA 2RQPA 4A3JJ 1YW8A 2AXLA 2LDUA 2LK2A 4UUVA 3RCOA 3O8HA 3PUFA 2CV2A 5D5WB 1QNTA 2NOGA 3ZCOA 3ERED 1XPXA 2K7LA 4BU2A 4FHTA 2L02A 1W36D 2LKPA 2VKDA 4A12A 1AHDP 4HA8A 4FQGA 4PSWA 2XSDC 3ELKA 1BIBA 2OCCH 1F5TA 4B09A 1IC8A 2LFBA 2H6BA 4KMFA 1HOMA 1IXRC 4C9YA 4XLPF 5F0CA 1V5EA 3BTCA 2JUGA 2VBWA 3OSFA 5LRRA 5CVJA 1MNMC 3MCZA 2CYYA 3PFYA 3AL0C 1MKMA 1HF0A 1G3SA 1RIOH 3TBIA 3K70D 4DBRA 2GA2A 2VJ5A 3IKTA 2HOTA 2JRTA 4XSZF 4JX6A 1FIPA 1RZ4A 1F36A 1G8XA 2EFOA 3H36A 3S32A 2UXXA 1HBXG 2CU7A 4B8XA 3OIQA 2H94A 2V1DA 3CUQA 1WCMJ 2LY1A 3QP5A 3E6BA 4FTHA 5JHUA 2R7QA 2ZBKA 4HLYA 3OY9A 4OIOF 3CC7I 3FXKA 2HPMA 2OC6A 1KU2A 2MH9A 1RESA 2LR8A 3E6CC 5K7HA 2HQ5A 3EDPA 2HQAA 3E5QA 2CQKA 4L9NA 3MKWB 2IA1A 4PJLA 1R7JA 3LWFA 4CICA 3PIPF 4F93B 4F55A 3PSFA 3RPQA 3CUQB 1K79A 4C3JJ 2A6TA 5ED4A 1UCRA 3BT9A 3CUOA 2YU3A 3JRAA 2YS9A 2P4WA 1DP7P 3QYEA 4CCKA 3ZPLA 1MMGA 1WZ2A 1WJFA 1D0YA 3ZXSA 3F8NA 3WU0A 1IDYA 3Q9VA 2ZFUA 4FETA 2GOXB 1KYWA 3F6VA 4LOCA 2QENA 1D1CA 5F64A 2HVQA 5BQTA 5KAFC 4QPOA 2GBYA 5E20A 4RGXA 3GTQJ 2M3AA 1YS7A 3OS0A 4XSXF 5IYDJ 2F4MB 3ZMUA 2VC0A 2DA5A 3RQ4A 2HYFA 2RNJA 3M3YJ 2XAJA 3HPHA 5DYMA 3AKZA 2HPIA 2F5CA 3T8RA 1TW2A 1LDKB 2NVTJ 4DYQA 4IHYA 3GO5A 3B73A 5J1UA 3M9AA 3QAHA 2W00A 3OS2A 3LAJA 2G7UA 3HTSB 2Z1DA 1IAWA 1Z3XA 2DFEA 1QU3A 2L4MA 1MZBA 5KK1A 3PNYA 1W7PA 2K86A 2F4OB 4Q4ZF 2DA2A 3SEZA 1W0TA 2XAGA 2B9SA 3BZCA 3S2HJ 2R7UA 5TJJA 2MW8A 2EJRA 1MBKA 3E6MA 1Y39A 1J9IA 2V9PA 4B47A 3M8EA 4XLAA 4E7HA 3AL0B 4ZYEA 1BR4A 3T5XA 4B3AA 4CCLA 2JUCA 2PLYA 2YPRA 3PM1A 4LLGF 1O3SA 1OYWA 2HDDA 3M1EA 3LMMA 5LGUA 4S04A 1VF9A 5BNGA 2ZKZA 1K78A 3L1PA 2X4HA 4DZJA 4CCMA 5D4SA 4BNCA 1BI1A 1G3YA 2V9KA 3CJQB 2CW0F 3FBNB 2K9QA 3DEUA 3FXJA 3SJMA 3MD2A 4IF4A 4XN3A 4LG3A 5FFXA 4DZPA 3ZRGA 2XGXA 5JVGF 4O5VA 1EKEA 2BZTA 4CHUA 4U88A 3FXOA 2A6EF 1K78B 1SFUA 2MSYA 5H2FC 3OYNA 3NQOA 4AD9A 2TDXA 1IN5A 3OYFA 4RB1A 2K4JA 2JQ7A 1L3LA 4E7KA 4D7MA 2DMPA 3KYDB 1H9TA 2E19A 1BI3A 2HXOA 3O8GA 1FX7A 2ZXWH 2LREA 4GGGA 4BJ5C 4DQ2A 2WB1N 5K5RA 1ZLKA 3LA7A 2W84A 4LIVA 5J1YA 4CYCA 4G7ZF 3I9V2 1SVMA 3C2HA 3DQVC 3LSTA 3U21A 5M5YJ 5ILSA 1YG2A 3R4KA 1IN7A 3JRIA 3R60A 4G7HF 2WB1A 1X4PA 4EJWA 3HOXJ 4UB8C 2PX9A 3CJRB 4A5NA 3VWBA 4YIIA 2KLOA 4Y15A 2P6SA 2CUJA 2X0LA 2WY8Q 1RR8C 5F6FA 3GZ5A 3ULQB 1G3WA 3FXLA 3GCMA 4V19K 4Z6YA 4OIRF 1IW7F 4D9JA 4CYCB 3BTLA 2V7FA 2LD5A 3CCSI 2GXBA 1I1SA 4R1HA 3A02A 1R5GA 4F3QA 1RKTA 1KU9A 2M9HA 1AOYA 3KEQA 3EETA 3LA3A 3SDGA 4BE0A 3AFHA 3PQKA 1Z6RA 3F9KA 1TWAJ 4EGYA 3JCUC 1ZH5A 1U0JA 3K2ZA 1MBJA 3HG9A 5TISC 3ABKH 2CQ7A 5JFRA 4D5FA 2JPCA 2LP0A 3J81K 1T33A 1QBJA 2FBIA 4BQNA 1MJAA 4Z2YA 1L0OC 1YE9A 5CQEA 3BR2A 5DTDA 1C0WA 1VQ8I 1Z9CA 1XX5A 4RAYA 2A69F 2MG4A 4F91B 3CCMI 3E6DA 4ZYAA 3K4BA 5J8FA 2FJ1A 4LK0F 4DW6A 1T0FC 3LSIA 2Q2EA 5L3FA 1BIAA 2XB0X 2LYCA 4XKBA 3CCUI 2K9SA 3ZOBA 2GM4A 1UB9A 2JK3A 4A3EJ 3RPUA 3HYIA 5AIPA 1V54H 2XC7A 2QSHX 3K10A 3KCCA 4HX7A 1FSEA 1HKQA 2OTJI 3ASNH 5GADJ 2BY3A 3DLLF 2A05A 2E36A 4U0WA
chains in the Genus database with same CATH topology
2KHMA 3CMMA 4CZCA 2CS3A 2R7SA 1NG7A 3FKJA 1MW7A 3OIPA 4YRVA 2KP6A 2R7RA 4N4NB 2MFZA 2O5RA 2Q2EB 3OWTA 1Z21A 4DGWB 3OMYA 3RPUD 3PNTA 2VIXA 3H5RA 2Z16A 5KCMA 2JVGA 3H9GA 2LH9A 1X1AA 4OWRB 3SYTA 5FRNA 3BC8A 2R7TA 3OYGA 3MMYB 3OYLA 2GOMA 2F5VA 2HVRA 3DKXA 3HL2A 3H0DA 2E1MB 3LSMA 4ZDPA 2BVLA 1N78A 4AYBA 4IZZA 1S9HA 3CP2A 4PJNA 3KYLA 3A4CA 1ZELA 2BW3A 3HUGB 2UWMA 2X1EA 2VQGA 1TZLA 2R7XA 2ZSHB 4CUGA 5FRMA 2ELJA 1AA7A 3SEQA 4E7LA 3FBIB 2IGNA 3HC7A 2L2OA 4JOMA 1NG6A 4XR6A 5HVQC 2VQHA 1EA3A 4ZC3A 4BQOA 4OAYA 4U87A 1W36C 4XQFA 4C2TA 2MC4A 3K4MA 2L9NA 4IX7A 2M0MA 4BEHA 4XKVA 3BCBA 3DWLE 2BW3B 3QOEA 4XOTA 3A2KA 3MKZA 3ZQQA 2XDVA 3TL4X 3OR2C 4II2A 2X51A 1D1BA 1WJDA 2PMZA 3I3LA 4LIUA 2CFOA 2M4KA 2CUZA 4BDYA 2KMUA 3G2BA 4GRIA 4CSWA 4KISA 3S3NA 1BOBA 5HLTA 2VLAA 4BS9A 3C2GA 1UELB 3PL8A 3UNGC 2BVMA 3IUOA 4BE1A 3ONQA 4BEHB 5KHDA 4AU7A 4ZTFA 1LKXA 5LFAA 1X1BA 1N77A 1DGWY 2DT7B 1UAAA 3DU5A 2JSPA 1SAUA 4XKWA 2E5ZA 1Y56A 3A1YA 4ZDOA 2JA2A 4HNUA 4ZJZA 4KT6A 3VSLA 3W2VA 2VKHA 2NOJB 3D5RC 4IQ4A 2OUMA 4YEJA 3LFUA 4B3XA 4E4HA 3HOSA 2QKMB 1MMAA 2R4GA 3PNVA 3SZGA 4XMYA 1N75A 4CCNA 3DPLC 3OL4A 1X19A 3OYJA 2KL4A 3UR3C 4XLCA 4BGDA 2JVHA 3DEEA 4U7BA 1PJRA 3DTIA 2LRDA 4B44A 4RLFA 2PJRA 1V5FA 3K4LA 4Y4RA 2DT6A 4E7IA 2AQFA 3KEYA 2E5NA 1MNEA 4RMNA 2X6YA 4PJJA 1BR1A 3EUKL 5CPRB 3OYCA 4PK4A 4RM2A 2UUZA 3DLAA 4MLOA 2M4GA 2A5WA 1VZ0A 2HDWA 2CH0A 3CZ6A 4IKFA 1DGRM 2WAEA 4NUBA 1OR7C 2K9MA 3W3CA 1DP3A 3FDYA 3OR1C 2WBMA 2MABA 3RCOA 4PUSA 1WJAA 3L2VA 2CV2A 2PJRB 2ZSIB 3K4JA 3RSNA 3ZCOA 3DU6A 3H5NA 3NWSA 4BU2A 2HNHA 1W36D 4HSTA 3K4KA 2VKDA 1FMWA 1D0ZA 2HVSA 4PSWA 2W82A 4P1WA 1MNDA 3VYSB 2DJIA 2VJJA 2K3PA 2VJIA 1P9QC 4C9YA 1UG0A 4BE2A 4NQWB 2IGMA 5FROA 1V5EA 4P5OA 1MMNA 4F92B 2JUGA 2CW8A 2XAUA 3K4CA 2V26A 2DXIA 1FMVA 2DCEA 3PFYA 5HOOA 1PYVA 3AL0C 3N05A 2HU9A 4G6TB 3TBIA 2IS6A 2L9SA 3K70D 2VPLA 4DBRA 2VJ5A 1SFKA 2VQCA 4E7ZA 1HA8A 1G8XA 2X6WA 3S32A 3OIQA 3OYIA 2LY1A 2LC2A 4F52A 1Y6IA 2R7QA 1OLTA 4PJMA 3OY9A 3OYKA 4ZDLA 3D5LA 2HPMA 3OOUA 4XKCA 2OC6A 2L7KA 2XF5A 3EUHC 2HQAA 3M1CA 3ZGKA 2XSJC 4EATA 3OYAA 4BDZA 4IQJA 2IS1A 3L2UA 3MKWB 4PJLA 4HNTA 4XORA 3BLYA 1G59A 1WJ5A 3SDBA 4XLHA 2CMPA 4PFPA 4F55A 4F93B 1QHGA 3PSFA 2IXSA 1YX5A 2X85A 1E0EA 2K9LA 2A6TA 3S3MA 3QYBA 4R79A 2V4JC 2IGKA 3QYEA 4CCKA 2VXZA 4II3A 1MMGA 1WJFA 1D0YA 3ZXSA 1WFXA 3HPGA 2Z2SB 2FUG2 2KRCA 2ZFUA 4FETA 2GOXB 2XF6A 4NC7A 1D1CA 3QYFA 2HVQA 3RTRA 3LSKA 3BG6A 4QPOA 2VL8A 4AVZA 1X1DA 3BCAA 2M3AA 2CV1A 3OS0A 1ERDA 3TMOA 3L2QA 3OL3A 2QKLB 4XN0A 3RQ4A 4BACA 2KRHA 2VQLA 3D5SC 5KNLA 4XONA 1MMDA 3HPHA 4DBQA 3GBGA 3AKZA 2HPIA 4NNJA 2MYSA 2KPMA 4PSXA 1LDKB 1DQUA 2CV0A 4YELA 4J01A 1J09A 3OS1A 3H5AA 2VB6A 2W00A 3OS2A 4OAZA 2DOAA 2L5QA 2Z1DA 3NWTA 1X4OA 1Z3XA 2P0WA 3K4NA 2CW7A 3QODA 4DOZA 1QU3A 2W7NA 3PNYA 1WJCA 4XM3A 2IGOA 4BL0B 4HPQA 3SEZA 3W2WA 2WY7Q 1X1CA 2R7UA 4Y33A 2R7WA 4C30A 3S3OA 2BOLA 3PSIA 2LY2A 4B47A 4XLAA 4E7HA 3AL0B 1BR4A 3IAS2 4LITA 2W1OA 2MD0A 3M8JA 3H35A 3BG7A 4CCLA 4BJTA 3DPTA 2VXDA 3EUAA 3S93A 4BXFA 1D0XA 3LMMA 3DPUA 4HG2A 2Q1ZB 4BUPA 2RQQA 2KDOA 2Y0SA 4CCMA 3LL7A 4DIQA 2R7OA 2V9KA 3E1SA 3CJQB 2I8DA 2WA0A 1WJBA 3FBNB 3IAM2 3MD2A 3PJRA 2W4SA 4XN3A 4LG3A 1IRXA 2LG4A 1JI8A 3ZRGA 2K5CA 2WAQA 4ANJA 4BQQA 5CKTA 2X6XA 4ZTJA 3ZR8X 4RLQA 4CH7A 1Z7LA 4XNFA 2AQEA 3OYNA 3OYFA 2UV1A 2X1DA 2IS2A 3VYUB 4E7KA 3K6GA 4Y3OA 3OYHA 3KX2A 4D1QA 4HSRA 3CP8A 3VSKA 2LREA 4RM3A 4BJ5C 3IP4B 3VDXA 2V6EA 3V42A 3OYDA 4N4OB 3CESA 3DTEA 3MKYB 3L2WA 4LIVA 1KONA 3C2HA 3I9V2 3DQVC 3U21A 4DJAA 2E1MC 4CA0A 3W2AA 4FASD 1V5GA 3OYBA 2WB1A 1X4PA 2LOOA 3L2RA 3CJRB 2IS4A 3VWBA 2KLOA 2LBFA 2CUJA 4CCOA 1YX3A 2WY8Q 4KJZA 3DKYA 3LSGA 2R7VA 2ZXHA 2KQRA 3HXLA 2X1CA 4CCJA 2F6CA 4KITB 3PUBA 4B43A 3CF2A 4D9JA 2V7FA 3K70C 1GLNA 3VYRB 5CQGA 5JHFA 4PFOA 3H9QA 2HZDA 4F3QA 4ITVA 2XF7A 3E0JB 1T95A 3HOTA 1D1AA 3LSHA 2VASA 2RREA 4QPQA 3VYTB 3S8PA 5TGTA 4BE0A 2LBFB 3AFHA 1WJEA 3F9KA 1U0JA 3HG9A 3J7AY 3HKZA 4B48A 1TT0A 3DTKA 4BQNA 1YE9A 2F4IA 5CQEA 2M7BA 3EPZA 4C2UA 4BJ6C 4X0GA 1BR2A 2WAFA 4F91B 4E7SA 1K6YA 3H9JA 4ZYAA 4XLEA 3K4BA 1QHHD 2ZXIA 4HRIA 1LFPA 4XLFA 5LD2C 1T0FC 2RNGA 4HEA2 5HNFA 2M7AA 3LSIA 4JQFA 1R6RA 4E6KG 2LYCA 4E7JA 4H4KC 4XKBA 4XOPA 5HNHA 2VJ4A 4J00A 3FHNA 2XC7A 4NC8A 2WADA 2OV7A 3K10A 2E60A 2KZVA 4XL9A 1LVKA 3OYEA 1Z3YA 3OYMA 2V1NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HUG B;  2Q1Z B;  2Z2S B;  4NQW B; 
#chains in the Genus database with same CATH topology
 3CMM A;  4BBS J;  3QPL A;  4I99 C;  4MFE A;  1K6O A;  1W7P D;  2EZL A;  2V79 A;  4HW0 A;  2RC4 A;  5CVI A;  4YRV A;  2KP6 A;  5EEH A;  5M5X J;  1R1U A;  2O5R A;  2Q2E B;  3C3W A;  1GVJ A;  1Z21 A;  2OAZ A;  3CCY A;  1YJ9 I;  3S2D J;  2STW A;  2DMT A;  3M7G A;  3T8T A;  4A93 J;  2JVG A;  1SD7 A;  3ROU A;  3B02 A;  1XGM A;  2LH9 A;  3ZMV A;  4A3B J;  1K4T A;  1K7A A;  2R7T A;  2BV6 A;  3J80 K;  1BW5 A;  2G7H A;  1IXS B;  1Y8R B;  2DOF A;  2GOM A;  1T39 A;  3AG2 H;  1BJA A;  2I10 A;  1OCR H;  1QQI A;  2XGD A;  4OMZ A;  2VBX A;  2RDP A;  4ZDP A;  5BOX A;  1EH6 A;  3VOD A;  5C44 J;  2L7Z A;  4PJN A;  1XS9 A;  2DA7 A;  4IHT A;  3CJN A;  3J81 Z;  1ZEL A;  5FKL A;  4EGZ A;  5B66 C;  2F5E A;  1SFX A;  2X1E A;  4LMY A;  2E1C A;  2ELJ A;  1AA7 A;  3SEQ A;  2EFN A;  2IGN A;  3BPX A;  4JOM A;  5E1Z B;  1YW7 A;  2HGC A;  4RDU A;  3CO7 C;  1W36 C;  1SMT A;  1Z1D A;  4AM3 A;  2MC4 A;  3FK7 A;  2H09 A;  1IN4 A;  1ZYR F;  3R0J A;  3K4M A;  2M8G X;  4KN7 X;  3TP0 A;  1DPR A;  1KZH A;  1T0F A;  3H3U A;  4A0Y A;  2ADU A;  3ZQQ A;  1YTY A;  3PFI A;  1FZP B;  4KT5 C;  2XPU A;  2K85 A;  1RRJ A;  2EV5 A;  4WXH A;  1I3A A;  3FHZ A;  4M74 A;  3V8K A;  2KRF A;  1P7J A;  1BOB A;  1KA8 A;  1X3U A;  2FF4 A;  5HLT A;  3F0C A;  2K4B A;  2M0C A;  3UNG C;  3C7J A;  4NDL A;  2LTP A;  5LGT A;  4IOC F;  1IUY A;  1H88 C;  3U1D A;  3ONQ A;  3GF2 A;  3ZMD A;  4BE1 A;  4L5E A;  2R92 J;  1X1B A;  4Q5S F;  3J80 Z;  4XKW A;  2JSP A;  4IL6 C;  3FK6 A;  1ETY A;  1ZGJ A;  3A1Y A;  2A6H F;  2A3S A;  2EPF A;  4ZDO A;  1IRG A;  4M9S A;  4EVI A;  4YIF A;  3O3K A;  1O7F A;  2VKH A;  2NOJ B;  3D5R C;  4IQ4 A;  1QPM A;  2EBI A;  2OUM A;  3LFU A;  4YEJ A;  4B3X A;  2KIF A;  1POG A;  2R4G A;  2K3F A;  3CCR I;  3IWZ A;  3GTJ J;  1RR7 A;  3S17 J;  3TP3 A;  1I39 A;  1OPC A;  5HLG A;  3BZK A;  3OL4 A;  5E1X A;  2M5W A;  5EYR A;  4A6D A;  3J7Y J;  2KL4 A;  3TED A;  1FOY A;  4XLC A;  2E7W A;  2COB A;  2M30 A;  3BTI A;  4G8X A;  3DTI A;  1MJ9 A;  4L9J A;  2H1L A;  4WX9 A;  4ENN A;  1FT9 A;  1V5F A;  2L54 A;  3DKW A;  3K4L A;  4WCG A;  2NVU B;  4Y7N J;  3QPH A;  1AU7 A;  4TV7 A;  3OYC A;  2E35 A;  1A36 A;  2DI3 A;  3DLA A;  2CO5 A;  2M4G A;  2A5W A;  1RUO A;  4M71 A;  2CH0 A;  3CZ6 A;  3L7W A;  6PAX A;  4IKF A;  3I4M J;  3FF5 A;  1NK2 P;  2WAE A;  4NUB A;  3ABM H;  1VQ5 I;  1XSD A;  2EA4 A;  1DP3 A;  3I56 I;  3OR1 C;  2HOE A;  4NQW A;  2FRH A;  2MAB A;  1VQL I;  4PUS A;  1N25 A;  1IF1 A;  1WJA A;  4UHT A;  3L2V A;  1ZHF A;  3KPH A;  2EIK H;  4BAY A;  5IYC J;  4I01 A;  4RB3 C;  3H5N A;  1P92 A;  3NWS A;  2O6G E;  2HNH A;  3P9K A;  3WOD F;  1CF7 A;  1D0Z A;  2HVS A;  1FP2 A;  2P5V A;  2W82 A;  3KLO A;  3FKI J;  1MGT A;  5C4J J;  1IZ1 A;  1ZLJ A;  1BI2 A;  4RGS A;  1P9Q C;  2QSF X;  1IJW C;  1UG0 A;  2H6C A;  4NQW B;  2IGM A;  3DV8 A;  2PEX A;  2V26 A;  5BMZ A;  2NAZ A;  3W6J B;  2WC2 A;  1BC8 C;  4HF1 A;  3N05 A;  3DBH B;  4G6T B;  2L9S A;  2XUB A;  5H6Q A;  1CF7 B;  1UZC A;  3F8F A;  2DN0 A;  1VQO I;  2KKO A;  1SFK A;  1T38 A;  2VQC A;  2Y0M A;  4E7Z A;  1HA8 A;  4QSH A;  3RZD J;  3LSJ A;  2IA0 A;  2ESH A;  3U1K A;  4EM2 A;  3BQZ A;  3ZQH A;  2L9R A;  3I71 A;  1STZ A;  2LC2 A;  2EV0 A;  3T1B A;  4HOB A;  2ISZ A;  4M72 A;  3OIO A;  2DTZ A;  3DF8 A;  2ETH A;  1VQK I;  5DCM A;  4PJM A;  1HDP A;  3D5L A;  2LY9 A;  1FEX A;  3KP5 A;  3KP2 A;  1EJ9 A;  1PUF A;  1ITY A;  3CC2 I;  3OYA A;  2IS1 A;  2CFX A;  4EAT A;  4BDZ A;  2B63 J;  3CF5 F;  2CGP A;  1Z91 A;  3SDB A;  4XLH A;  1YIJ I;  2CMP A;  2RGV A;  1SFO J;  2P6T A;  1LVA A;  1A35 A;  3S3M A;  1LB2 A;  3FMQ A;  2XHK A;  4R79 A;  1S7O A;  1I6X A;  2QQ9 A;  5DCM B;  2EK5 A;  2V4J C;  4HF2 A;  1FP1 D;  4M3D A;  5CJ9 A;  3REO A;  4HYE A;  2VXZ A;  5FKK A;  4A3C J;  3X2Q H;  1U5T C;  2X6O A;  1WFX A;  1PUF B;  1E3P A;  2FUG 2;  2K02 A;  1S29 A;  4M3F A;  4NC7 A;  2XF6 A;  3R6S A;  2RVC A;  1T8I A;  3BG6 A;  4MNU A;  4AVZ A;  2DA1 A;  1X1D A;  2CSO A;  2CV1 A;  1TLH B;  4KIB A;  2ZXJ A;  3TMO A;  3L2Q A;  1HDD C;  2NXN B;  2QKL B;  4EJT A;  4JX5 A;  4XN0 A;  1ZAR A;  2DTR A;  1JE8 A;  2VQL A;  4XON A;  3DFG A;  4DBQ A;  1MD0 A;  4AID A;  3KET A;  3JRH A;  5E3N A;  2KPM A;  2NS7 A;  3BRO A;  3I59 A;  1FOW A;  4LGW A;  1DQU A;  3KIO A;  2CV0 A;  3QP6 A;  4GYI A;  1IDZ A;  4J01 A;  3GTM J;  2DYS H;  2ZFW A;  2XPW A;  2VB6 A;  1HLV A;  3Q9S A;  1UHM A;  4RA2 A;  1IGN A;  4KA4 A;  3KEO A;  1AKH A;  1HKS A;  4DOZ A;  3FMS A;  5ERI A;  2W7N A;  4MO7 A;  2JWT A;  4XM3 A;  2IGO A;  4HPQ A;  4ZZL A;  1FSH A;  3L09 A;  4FE7 A;  2STT A;  5D6F A;  2WY7 Q;  1X1C A;  2PN6 A;  3ASO H;  1H89 C;  2DDB A;  3DXJ F;  4Y33 A;  4LFU A;  4C30 A;  2KT0 A;  1G2H A;  1IV8 A;  4L9V A;  3I59 B;  2MC3 A;  5J6X A;  1YIT I;  1LPQ A;  3G1L A;  4IHV A;  1DU6 A;  2E1N A;  3IAS 2;  3CO6 C;  1WPK A;  4A6E A;  1LNW A;  2HFH A;  1VQP I;  4LIT A;  2Y0S N;  4M73 A;  4BJT A;  3GLX A;  3CTA A;  3H3V K;  3O6B B;  2OD5 A;  2NVQ J;  1AKH B;  2RAE A;  1EF4 A;  1D0X A;  2Q8K A;  4CO8 A;  3GZN B;  4UNO A;  2RQQ A;  5HOD A;  4RAG A;  2Y0S A;  4HX8 A;  3G3Z A;  4HQM A;  1QRY A;  3G1O A;  3E1S A;  2WAQ N;  2RKH A;  2I8D A;  2WA0 A;  3CME I;  1WJB A;  3WU2 C;  2EV6 A;  4BH9 A;  3BR1 A;  3V8L A;  3PJR A;  2W4S A;  1U5T A;  5FKN A;  2GXA A;  4HDV A;  4I09 A;  2ZC2 A;  1JI8 A;  4DYC A;  3F22 A;  1TT5 B;  2K5C A;  2W57 A;  2ZJQ F;  2WAQ A;  1O4X A;  2P7V B;  4ANJ A;  4EV0 A;  4MEX F;  1JT6 A;  3MVP A;  2IP2 A;  2DOD A;  4EQQ A;  5CKT A;  1QZZ A;  3S15 J;  2K40 A;  3ZR8 X;  2OA4 A;  5DD8 A;  4CH7 A;  1WHU A;  1CGP A;  2YUS A;  4Y17 A;  2UV1 A;  5E17 F;  2EB7 A;  2OQG A;  3VYU B;  3CC4 I;  1ZRF A;  1O3R A;  4D1Q A;  1ZAO A;  3JTH A;  4RM3 A;  3IP4 B;  4KIG A;  3VDX A;  3OYD A;  1U5T B;  4N4O B;  3CES A;  3L2W A;  3MKY B;  3WGI A;  1R00 A;  2L3D A;  4DJA A;  1ETX A;  1GVD A;  3BG9 A;  4UXN A;  4BKX A;  4GCV A;  3HBL A;  1V5G A;  2HYJ A;  2UXN A;  3L2R A;  4YG2 F;  1KU7 A;  1V3F A;  2OBP A;  1QGP A;  1MMS A;  1FTT A;  1FYK A;  2XIG A;  2LBF A;  3K1N A;  2CRG A;  3F6O A;  2LSO A;  1VQ4 I;  3ZN1 A;  2R7V A;  2KQR A;  1W1W E;  2Y9Y A;  2IAI A;  3QWL A;  4GXO A;  4ENJ A;  2F6C A;  2COM A;  1O3Q A;  4B43 A;  1YHQ I;  1G3T A;  2VE8 A;  3VYR B;  1XSV A;  2XPV A;  5FFZ A;  4LG0 A;  3H9Q A;  3OSG A;  5H20 A;  5E3M A;  1FOX A;  1HST A;  5EEG A;  3M8F A;  4MTD A;  1HW2 A;  4MTE A;  1T95 A;  2EA2 A;  2H8W A;  3HSE A;  2KIU A;  1U2W A;  3F8B A;  1TC3 C;  3S8P A;  2VT2 A;  1ETW A;  5TGT A;  1S3J A;  2LBF B;  4MFD A;  4UVA A;  1WJE A;  3KP4 A;  2Z33 A;  3I5U A;  1SVO A;  4GO1 A;  2QQ8 A;  4BHB A;  5L3G A;  2HYG D;  3DTK A;  3FXQ A;  2PMH A;  5KAI C;  4BXX J;  1UST A;  3FZV A;  2F5F A;  2V1X A;  3EPZ A;  2IT0 A;  2VOO A;  2DJN A;  2GA1 A;  2WAF A;  1Y0U A;  3IWF A;  4NB5 A;  1K6Y A;  3H9J A;  2JA7 J;  4XLE A;  2GZW A;  4C3I J;  1QHH D;  1HKT A;  4HAM A;  4XLF A;  5LD2 C;  2RNG A;  4HEA 2;  4M9Z A;  2M7A A;  5DUI A;  5HNF A;  1G4D A;  5FKO A;  4EJV A;  1G6N A;  4JBA A;  1XCV A;  4BHC A;  4H4K C;  4XOP A;  1RNL A;  3CMY A;  2PBI A;  2IA2 A;  5LLQ A;  1QZY A;  1TQM A;  3V8J A;  5IP6 A;  1UHS A;  2E60 A;  5L3E A;  2O8X A;  3SZP A;  3VOE A;  4ZYG A;  1V55 H;  2V1N A;  2XKP A;  3Q3S A;  3D1N I;  3K0L A;  3J7A O;  2CS3 A;  3PO3 J;  4D5C A;  2R7S A;  2JPB A;  1VQ7 I;  1WI3 A;  1MW7 A;  3OIP A;  1FYM A;  1W7P B;  1Z67 A;  1Z77 A;  3OWT A;  2R5Y A;  1VTN C;  2BHY A;  3HUG A;  3I0T A;  5C4X J;  2ZNZ A;  4DGW B;  3HEF A;  2JJ7 A;  1IXC A;  4P9U A;  3GVA A;  3HB9 A;  2EFQ A;  2Z16 A;  4JYK A;  3QU3 A;  3SZT A;  2XRO A;  3QU6 A;  3SYT A;  3L2C A;  3BR3 A;  3BC8 A;  3P7N A;  4Q48 A;  3MMY B;  3WG7 H;  1UHW A;  1KYZ A;  4CGZ A;  4IHX A;  1YS6 A;  1BN5 A;  3QRF F;  3R0A A;  2HXI A;  3ECO A;  3WE3 A;  2HVR A;  2Z5U A;  3H0D A;  2DO7 A;  1XB4 A;  5JLW A;  3JRD A;  1X2N A;  4W97 A;  3GX4 X;  5A2Q K;  2QA4 I;  1TWC J;  1KQ0 A;  3ERM A;  2R5Y B;  2BW3 A;  3HUG B;  2LMD A;  1SVL A;  2YX7 A;  1IG7 A;  2M45 A;  2FOK A;  4CUG A;  5FRM A;  3F3X A;  3RDI A;  2CUF A;  2OQR A;  1D5V A;  3FBI B;  1VQM I;  3GTK J;  1RC9 A;  4AIH A;  2DDA A;  2OZ6 A;  4ZC3 A;  1JUM A;  4BQO A;  4M3G A;  4XQF A;  3G73 A;  1HW5 A;  2HOS A;  3EQL F;  3UKG A;  2EQR A;  2Y9Z A;  5IP7 J;  1JT0 A;  3BP8 A;  3CLQ A;  5J1R A;  4FCY A;  3HRU A;  3DWL E;  2BW3 B;  3Q0U A;  2D1H A;  5J4V A;  4KIF A;  4YFX F;  2O9L A;  3KZI C;  2X51 A;  1D1B A;  2GAU A;  2V1U A;  4LIU A;  1MBG A;  2CFO A;  5B5E C;  4BDY A;  2KMU A;  2WTE A;  3P9I A;  4GRI A;  4KIS A;  1MBE A;  5EGO A;  2BY2 A;  2W85 A;  2VLA A;  1RPW A;  4DYR A;  2FQ3 A;  2ZME C;  4XK4 A;  2ECC A;  1FJL A;  1LDJ A;  3WGG A;  5AIQ A;  4AU7 A;  3RKY A;  1MDM A;  4YFK F;  1N77 A;  1JXS A;  1Q1V A;  1DGW Y;  3H3Z A;  3DU5 A;  1CQT A;  2DBB A;  3MN2 A;  5JR3 A;  5IP9 J;  2JRM A;  2O7O A;  1KQ8 A;  2ZJ2 A;  4NC6 A;  1ETO A;  2J5O A;  2Y30 A;  4KT6 A;  5EGO B;  4ZYH A;  3S1M J;  3IRR A;  5IOY A;  1B1B A;  5F0F A;  5JLX A;  3IKV A;  3SZG A;  5LEJ A;  2XVC A;  4XMY A;  2DMQ A;  1N75 A;  5L3C A;  5HDN A;  2OJE D;  1R49 A;  1BI0 A;  3E97 A;  3RKW A;  1HCR A;  1ZG1 A;  2VUM J;  2FBK A;  3UR3 C;  4BGD A;  4CYD A;  1MDM B;  2A07 F;  3DEE A;  4U7B A;  1PJR A;  1WQ2 A;  1WH5 A;  1OCZ H;  4EEF G;  1SFE A;  2PJR A;  2ESN A;  1MNE A;  1GV2 A;  2X6Y A;  1BJZ A;  3EUK L;  5K7Z A;  2VOD A;  4PGG A;  1XDU A;  5B3S H;  2UUZ A;  2JZY A;  5HS7 A;  2K9N A;  3VFZ A;  3F8M A;  5CVV A;  5GPA A;  1D5Y A;  1OR7 C;  2K9M A;  4AWX B;  2Z3Y A;  4WXC A;  2P81 A;  4I0B A;  3FDY A;  4LB6 B;  2P5K A;  3JRB A;  1ZGW A;  5FB2 A;  2W25 A;  4XID A;  3LA2 A;  5H6R A;  3F23 A;  2QLZ A;  5EDN A;  2PJR B;  1ZR2 A;  2ZSI B;  4PJ0 C;  5M5W J;  3BOQ A;  5F27 A;  2QQB A;  4UB6 C;  3RSN A;  4L9T A;  3DU6 A;  2TRT A;  3S1N J;  3K4K A;  4RS8 A;  3EUH A;  1I6H J;  2AS5 F;  3J7Z I;  1XSX A;  3I4P A;  3TO7 A;  2ZME A;  2CJJ A;  2KJC A;  3S1R J;  1LEA A;  1DDN A;  1B9N A;  1YIO A;  2KFD A;  1HXD A;  2K3P A;  2VJI A;  1ONV A;  4I7H A;  4BE2 A;  5FRO A;  1VQN I;  4P5O A;  3WTW C;  3L00 A;  3BJO A;  1REP C;  1S7A A;  1WRJ A;  1H0M A;  3AG4 H;  2DXI A;  3CDI A;  1ZG3 A;  4JX4 A;  1OCC H;  3EYY A;  1PYV A;  1XMX A;  4RB2 C;  2NS0 A;  3TOB A;  2IS6 A;  2VPL A;  2XGE A;  3SHF A;  3TKY A;  1XGN A;  1R5I D;  2LKX A;  2ZME B;  1GHC A;  3BJA A;  2MLG A;  2E2H J;  5D5X B;  5EJC A;  5J8C A;  1ZG5 A;  4MQV A;  3OYI A;  4ON0 A;  3GTP J;  1JKO C;  2O3F A;  4K2E A;  5EZH A;  1A6Q A;  4UVC A;  5FJ8 J;  1PP7 U;  4I2O A;  3DBL B;  4F52 A;  5F1J A;  2XRL A;  3I4N J;  1Y6I A;  2CG4 A;  1OQY A;  4A2U A;  4ZDL A;  5CVR A;  2QVO A;  2M2E A;  4EJU A;  1F4K A;  1K83 J;  2L7K A;  2XGC A;  3K2A A;  4LJZ F;  2XF5 A;  3F72 A;  4M6V A;  2AHQ A;  3M1C A;  2XSJ C;  5K5Q A;  3L2U A;  4ENM A;  3LNQ A;  1UFM A;  3GTO J;  4XOR A;  2HQN A;  3BLY A;  1G59 A;  1WJ5 A;  3HOZ J;  3K7A J;  4A5M A;  4YFN F;  3MEX A;  5D8K B;  5HLH A;  1OR7 A;  1W4M A;  2YX4 A;  4PFP A;  4M9X A;  2HKX A;  3GXO A;  2D5V A;  2X85 A;  1A5J A;  5IYB J;  4EM0 B;  2FNP A;  3IC7 A;  3TW7 A;  2LLK A;  2Q0O A;  3QYB A;  1BL0 A;  1A04 A;  1O57 A;  4L5I A;  3DCF A;  4WF2 A;  4II3 A;  2ZJR F;  2FQ4 A;  3SFZ A;  3HPG A;  3ISP A;  5GPC A;  4QWQ A;  2Z2S B;  2KRC A;  3ML6 A;  3RTR A;  3TDU C;  1JUS A;  2E1O A;  4XBF A;  4P55 A;  2EIL H;  2VL8 A;  3BCA A;  4Y13 A;  4V2F A;  1MBF A;  2IVM A;  1SEU A;  5CVU A;  1ERD A;  3OL3 A;  4PGH A;  4A69 C;  2KRH A;  5KVR A;  1U78 A;  1M1E B;  1O3T A;  4KDP A;  3GBG A;  1DUX C;  4L5J A;  1ZGA A;  3HHH A;  4IRH A;  2EIJ H;  4YEL A;  1B4A A;  3G4S I;  2Y31 A;  1FC3 A;  2MBF A;  3NEU A;  4OAZ A;  1TP4 A;  1IUF A;  2DU9 A;  5FD6 A;  2F48 A;  2P0W A;  2O03 A;  3N4M A;  2CW7 A;  3MZY A;  2RN7 A;  4BL0 B;  2FMY A;  3BR0 A;  1IN8 A;  2QZ8 A;  4LK1 F;  2DFH A;  5ICF A;  2R7W A;  2BYV E;  2MD5 A;  1WH7 A;  1USS A;  2VC1 A;  4IO9 F;  2LKS A;  3S3O A;  1J5Y A;  2XAF A;  3S16 J;  3I55 I;  5IT9 K;  4KFC A;  2LVS A;  2W1O A;  3KP6 A;  3HRS A;  3M07 A;  3IH4 A;  3M8J A;  2DLL A;  2WV1 A;  3DPT A;  5LEK A;  5EEA A;  3U9G A;  1S5L C;  3S93 A;  4OOI A;  3WGH A;  1B59 A;  4BXF A;  3WTT C;  1XMA A;  4EJO A;  2P5L C;  1NTC A;  2HI3 A;  2EZI A;  4HG2 A;  2Q1Z B;  5HDG A;  1HQC A;  4BUP A;  4HNV A;  1RKW A;  2IRF G;  1LQ1 A;  1U8R A;  4N0B A;  4D7N A;  3CDL A;  2D1V A;  2R7O A;  2BBY A;  1D8J A;  3WHC A;  2L7M P;  4HV6 A;  1SAN A;  2FA5 A;  3IAM 2;  2ME6 A;  1FTZ A;  4I02 A;  2PQ8 A;  5ILU A;  2LG4 A;  1GXP A;  4G94 A;  3G1M A;  1I27 A;  1U3E M;  3AG3 H;  2QQA A;  3FX3 A;  4BQQ A;  5JI6 A;  2X6X A;  1TNT A;  3COA C;  4RLQ A;  1R5H A;  1KGS A;  2AQE A;  2HOA A;  4KUM A;  2X1D A;  5EF6 A;  1E3H A;  1LJ9 A;  1DPU A;  4Y3O A;  3OYH A;  2HR3 A;  4QIW N;  4HSR A;  5L3B A;  2B7E A;  3DTE A;  4A3I J;  2R93 J;  2EZK A;  1KON A;  2FOW A;  3LQR A;  3CDH A;  3VEP A;  1R1T A;  1E2X A;  2E1M C;  4CA0 A;  5E18 F;  3TOA A;  3OYB A;  3CCQ I;  2R7D A;  3LAP A;  5GAE J;  3ZN0 A;  2G9W A;  2L4A A;  1F1Z A;  2QCO A;  2IS4 A;  2R3S A;  4B1R A;  3V7C A;  5IT9 Z;  2M87 A;  1H8A C;  3HOY J;  3DKY A;  2MGQ A;  5E3L A;  4IOA F;  2ZXH A;  3JSP A;  5L3D A;  1FYL A;  2P7C B;  1SD6 A;  2X1C A;  4ZYD A;  4KIT B;  1RET A;  3PUB A;  3CF2 A;  1X3Z B;  1GLN A;  1ON2 A;  3BTJ A;  5JHF A;  5DD4 A;  1YW9 A;  5D5U B;  4PFO A;  3W6V A;  2HZD A;  5BS6 A;  3ZP5 A;  2XF7 A;  4G6Q A;  2LNB A;  3BDD A;  3E0J B;  3LSH A;  4BHP A;  4J19 A;  1FBQ A;  2RRE A;  2DFI A;  3GUD A;  3HGY A;  1R1V A;  3N97 A;  2WWY A;  2A68 F;  4GYG A;  1LUJ B;  3J7A Y;  2CWE A;  3WTV C;  2ME0 A;  2LF7 A;  1ZQ3 P;  1ULY A;  4RGU A;  2F4I A;  2YSR A;  2M7B A;  3L9F A;  2ICW G;  3TO6 A;  3KFW X;  4BJ6 C;  1BR2 A;  5HLI A;  4ZZD A;  4OU0 A;  1EH7 A;  2EFW A;  2MLK A;  2ZXI A;  2OTL I;  5D5V B;  3BZ6 A;  2F2E A;  3P5J A;  2L01 A;  4FIS A;  2NVX J;  1R6R A;  4E6K G;  1JTY A;  4IEJ A;  4E7J A;  2ZCW A;  4C3H J;  1OYY A;  1GDT A;  1D3Y A;  1J75 A;  2YR2 A;  2JN6 A;  5HNH A;  3LFK A;  4J00 A;  4D0P A;  1LFU P;  4IJA A;  2KZV A;  2FXA A;  4XL9 A;  5DM7 F;  5J47 A;  2DYR H;  3WG9 A;  1LVK A;  3V7S A;  5HDK A;  2DMU A;  3FIW A;  2OU2 A;  1TW3 A;  4I0A A;  3I53 A;  3IH3 A;  1I1G A;  2VN2 A;  4IVN A;  4MGR A;  3G71 I;  2VI6 A;  2IJL A;  2MFZ A;  3PQJ A;  1P4X A;  1T2K A;  4M3B A;  4PZJ A;  5B1B H;  5LGN A;  2UZK A;  3LQQ A;  3O2P E;  1MSF C;  1JGS A;  3B6A A;  3PNT A;  4ABZ A;  4IRI A;  4IHW A;  4HZF A;  5KCM A;  1BC7 C;  2GIV A;  1GV5 A;  1J0R A;  3CCE I;  2N8G A;  1X1A A;  1R36 A;  4M6X A;  3ZQI A;  5B1A H;  3OYG A;  4A3M J;  1RUN A;  2FD5 A;  3OYL A;  3K1M A;  2F5V A;  4WK8 F;  4R8H A;  1R4M B;  2E1M B;  1OCP A;  3LSM A;  4PCQ A;  1OKR A;  3T0Y A;  2F5D A;  1X2M A;  2BVL A;  1PVE A;  2HDC A;  4A3D J;  1N78 A;  1S9H A;  4U7D A;  1JHH A;  4NHJ A;  2UWM A;  3A4C A;  2NVY J;  2ZB9 A;  2DPU A;  1W0U A;  1ON1 A;  1TZL A;  5IT3 A;  2R7X A;  2ZSH B;  4XRF A;  1IV6 A;  2GIZ A;  4OIP F;  4UV9 A;  3KP7 A;  1XG1 A;  4MHG A;  1OJL A;  2M1B A;  3HC7 A;  3RI4 A;  4XR6 A;  3GFM A;  5HVQ C;  1MJB A;  4P9F A;  4U87 A;  5ICG A;  1H9G A;  3VB2 A;  4C2T A;  2O0Y A;  1BM9 A;  4I76 A;  3LSR A;  2Y48 A;  2PMZ N;  4RAF A;  5IOZ A;  3S1Q J;  4HX4 A;  4IX7 A;  2M0M A;  1PUE E;  2JMW A;  1ZR4 A;  3P9C A;  3QOE A;  4XOT A;  3GZ6 A;  3OR2 C;  2DAO A;  4II2 A;  5GTH C;  2QSG X;  2ID3 A;  1WJD A;  1EV7 A;  2PMZ A;  3S14 J;  2M4K A;  1TWF J;  1VND A;  1MIJ A;  5F0H A;  3WTX C;  3I64 A;  1Y1V J;  1FPQ A;  2H1K A;  3S3N A;  4HF0 A;  1X3W B;  1U8B A;  4BS9 A;  5DS9 A;  3PL8 A;  5LHG A;  1IO2 A;  2FBH A;  5FLV A;  3D0S A;  4MIM A;  1JKR C;  3BY6 A;  4CDG A;  4OIN F;  2EIN H;  4IXA A;  4UUT A;  5E8G A;  2L9V A;  1LKX A;  1E17 A;  3JAM K;  4P96 A;  1VQ9 I;  2VBY A;  3K69 A;  1TQP A;  3QPS A;  3R61 A;  4A3L J;  5F04 A;  2E5Z A;  2P8T A;  1Z05 A;  3KP3 A;  2PJP A;  2HWV A;  1YRN A;  3JW4 A;  4ZJZ A;  4XLN F;  3WTS C;  2BGC A;  1TNS A;  3HOS A;  3AG1 H;  4E4H A;  3HJE A;  4BBR J;  2QKM B;  1MMA A;  3TW6 A;  3PNV A;  1S72 I;  3FWE A;  4LG0 B;  4CCN A;  3SFI A;  1ZRC A;  2M8E A;  3RYR A;  2NRA C;  1GT0 C;  2Y75 A;  1X19 A;  2H27 A;  3PIO F;  3HSR A;  3CD6 I;  5E1W A;  1E3O C;  1XGS A;  2VBZ A;  2V9V A;  2LRD A;  3K9T A;  4B4C A;  1XMK A;  3NAU A;  1ACI A;  2PFB A;  4HLX A;  1IN6 A;  3FXM A;  1X1P A;  1YRN B;  1XCB A;  1QO0 D;  2E5N A;  4RMN A;  3GTG J;  4PJJ A;  1BR1 A;  4FX4 A;  2Y2Z A;  3Q0W A;  1JKP C;  1BW6 A;  5FO5 A;  2R0Q C;  3H0G J;  4PK4 A;  3ZQC A;  1TWG J;  1X58 A;  1Y1W J;  2HDW A;  4OMY A;  1DGR M;  2Z99 A;  3W3C A;  1JTX A;  1MH4 A;  2JSC A;  2L7F P;  3GWZ A;  2WBM A;  1BOA A;  5CYV A;  1P6R A;  4RAZ A;  3OOP A;  3V7R A;  3A01 A;  3TGN A;  2KIS A;  3K4J A;  2ACJ A;  4HBL A;  1K4S A;  4XRS G;  1W5C C;  2EIM H;  1NK3 P;  3MFK A;  4UUS A;  1W5T A;  2XAQ A;  4HST A;  3DEW A;  1JHF A;  1FMW A;  3E5U A;  4HDU A;  3JRC A;  4A3F J;  3ZQF A;  1FNN A;  1FIA A;  4N9I A;  3IRQ A;  4P1W A;  3JAM Z;  1MND A;  3VYS B;  5GP9 A;  2DJI A;  1YI2 I;  2MH2 A;  2VJJ A;  3TO9 A;  4XRM A;  1OYI A;  3V4G A;  1MMN A;  4UV8 A;  4F92 B;  2CW8 A;  2NNN A;  2XAU A;  3QOP A;  4LD5 A;  3A01 B;  3KZY A;  5E3O A;  2AXT C;  2QM3 A;  3K4C A;  2VT3 A;  3RIR A;  4N9H A;  1FMV A;  2DCE A;  3HZJ A;  5HOO A;  5TRD A;  2HU9 A;  4Y52 J;  3CMA I;  5CLS A;  5J40 A;  4UUS B;  2DK5 A;  1WVR A;  2A61 A;  1RI7 A;  3KZZ A;  5K1Y A;  3RZO J;  2ZNY A;  3C18 A;  1MSE C;  2KIQ A;  3BR5 A;  3CLO A;  4V2G A;  4EMS A;  1NH3 A;  3KE2 A;  4KMU X;  2YU9 J;  5GAG J;  3FXR A;  1P2F A;  1F9N A;  2X6W A;  4HQE A;  1TWH J;  4XIC A;  1FBU A;  2DA3 A;  2PMU A;  3OV8 A;  1S8N A;  3NRV A;  4OIQ F;  3GFL A;  4LLN A;  1YFH A;  3ZQL A;  4ESJ A;  1OLT A;  2VPR A;  3OYK A;  4G7O F;  1TQI A;  5E8I A;  2TCT A;  3OOU A;  4XKC A;  4A0X A;  2IBD A;  1HW1 A;  2O8K A;  3EUH C;  2HTJ A;  5K7F A;  3ZGK A;  5K5O A;  4IQJ A;  3FM5 A;  4O3M A;  1ORK A;  5FD5 A;  3ECH A;  4HNT A;  5J4Y A;  3RJP A;  2EWN A;  3IV5 A;  2ID6 A;  1QHG A;  2OCE A;  1ENH A;  2IXS A;  3WHB A;  3GEZ A;  2GLO A;  1YX5 A;  1E0E A;  2K9L A;  2VKE A;  3WE2 A;  4ZH4 F;  3BJ6 A;  5IPA A;  2QBY A;  1W5S A;  2IGK A;  2OPT A;  1LFB A;  1ZTR A;  2QWW A;  4FE4 A;  2I5U A;  1QPI A;  4X6A J;  1WGX A;  2XAS A;  2ZO4 A;  4M6Y A;  2ZJP F;  3HOW J;  5A2Q Z;  3CCL I;  1FBS A;  3QYF A;  2PG4 A;  3LSK A;  1EH8 A;  1U9N A;  3FIS A;  2JTV A;  2E2J J;  1QVT A;  1T6S A;  4LB5 A;  5ICC A;  1B72 A;  5EZG A;  2KJB A;  2BHZ A;  3CQZ J;  3MAJ A;  4BAC A;  3ZMT A;  3Q5F A;  3D5S C;  5KNL A;  2QBY B;  3GYH X;  1MMD A;  3RYP A;  4IPA A;  1WSU A;  4NNJ A;  2M34 A;  2MYS A;  4PSX A;  3F21 A;  2BY0 A;  1VI0 A;  2DMN A;  4ETS A;  5FLX K;  1J09 A;  4AVP A;  1I50 J;  3GW2 A;  3HRT A;  1Z6T A;  3OS1 A;  3H5A A;  5ICE A;  3HM5 A;  5C3E J;  1HSJ A;  2DOA A;  5DEQ A;  2L5Q A;  2XAH A;  5DM6 F;  3WU1 B;  3NWT A;  1X4O A;  4LLL A;  1Z0X A;  3K4N A;  3QOD A;  3RQI A;  1WJC A;  1SAX A;  2DPD A;  1B72 B;  3W2W A;  2AO9 A;  3BG3 A;  3Q0V A;  2DA6 A;  1YOV B;  3I58 A;  4BY1 J;  1OIS A;  2BOL A;  3PSI A;  5F1R A;  2LY2 A;  2W48 A;  2IEK A;  1J7K A;  2IPQ X;  3FMR A;  2C6Y A;  2ELK A;  1R22 A;  2MD0 A;  2GXG A;  3HRM A;  4L0Y B;  3H35 A;  3BG7 A;  3IH2 A;  1U6G A;  3JRG A;  1FY7 A;  2E2I J;  2VXD A;  3EUA A;  3HGG A;  2W24 A;  3CCV I;  2ISY A;  3CJT B;  3DPU A;  3HSF A;  4S0H B;  4A0Z A;  1V4R A;  1YLF A;  2KDO A;  3LL7 A;  1WI9 A;  4HV5 A;  4DIQ A;  2CQQ A;  2QGU A;  4AIK A;  1P4A A;  2EZH A;  5DDG A;  2E71 A;  2ECB A;  2D2W A;  2FEZ A;  1KQ9 A;  3ZQ7 A;  3E5X A;  4Q47 A;  1IRX A;  2A5Y B;  4AC0 A;  2R7Z J;  1BBY A;  1QA6 A;  3CCJ I;  4YIR X;  4BXU A;  4ZTJ A;  1WWX A;  1Z7L A;  4XNF A;  5DV5 A;  2JT1 A;  1FWZ A;  3MQ0 A;  4IRG A;  2VKV A;  3EYI A;  3B6C A;  2IW5 A;  1OCO H;  2IS2 A;  1ETK A;  5FLX Z;  1LE8 A;  3K6G A;  1LDD A;  2E34 A;  9ANT A;  2BXZ A;  3KX2 A;  4KN4 X;  2CUE A;  1T56 A;  2VOP A;  3CP8 A;  3VSK A;  1P4W A;  4XRS A;  2KDZ A;  1BA5 A;  2X9D A;  2V6E A;  5F08 A;  3V42 A;  1SMY F;  5HS8 A;  1PP8 F;  1XGO A;  4RBO A;  2FSW A;  3HIF A;  3MZ8 A;  1UMQ A;  3W2A A;  4FAS D;  2LOO A;  2BE5 F;  3GLL A;  1ZKG A;  4AIJ A;  4RB0 A;  1B8I A;  1K61 A;  3GME A;  1LE8 B;  1UJ8 A;  4CCO A;  1YX3 A;  3F8C A;  1GUU A;  4KJZ A;  3IL2 A;  3LSG A;  2XKO A;  1A31 A;  3HXL A;  2H8R A;  1QZE A;  4FX0 A;  4CCJ A;  4L0Z B;  2DFF A;  1R4N B;  3KYC B;  1VFC A;  3K70 C;  3WTZ A;  1XDS A;  5CQG A;  1JJ8 C;  1A6I A;  2LF8 A;  2R7F A;  2XB5 A;  2GQQ A;  1D8K A;  4I98 B;  3A03 A;  4ITV A;  1ETQ A;  2DQL A;  3WTU C;  3MZH A;  3HOT A;  4U0V A;  4E70 A;  2QEX I;  3RKQ A;  2DA4 A;  1B8I B;  1D1A A;  3HKZ N;  2VAS A;  4QPQ A;  3VYT B;  2FML A;  1B9M A;  4ENK A;  4JK1 X;  1ZRD A;  2DK8 A;  1Y0N A;  3HKZ A;  2QF7 A;  4B48 A;  1TT0 A;  5M3F J;  1PDN C;  2OZU A;  1HC8 A;  4M3E A;  3GFI A;  4C2U A;  2JA6 J;  3H92 A;  3G6E I;  4X0G A;  4E7S A;  1OFC X;  2XRN A;  4HRI A;  3A0H C;  1LFP A;  3BR6 A;  1P7I A;  1XN7 A;  4G6D A;  4JQF A;  2KZG A;  3LOC A;  2VE9 A;  5AON A;  3I54 A;  4JP0 A;  4A3G J;  3LSP A;  3U2R A;  3HOV J;  2VJ4 A;  1U9O A;  1SD4 A;  4ESB A;  3FHN A;  1ZRE A;  1YYV A;  2Y69 H;  4NC8 A;  2WAD A;  2OV7 A;  5D6E A;  4MEY F;  3OYE A;  1Z3Y A;  2EFP A;  3OYM A;  1R58 A;  2KHM A;  2NS8 A;  3IHU A;  1S7E A;  3C2B A;  4UVB A;  2EH3 A;  4CZC A;  1NG7 A;  1ZN2 A;  3FKJ A;  3C1D A;  4ESF A;  4GDF A;  1MBH A;  4WXD A;  4U0Y A;  4A3K J;  2KIM A;  2D45 A;  4MQ9 F;  2RV8 A;  4CZZ A;  2R7R A;  4N4N B;  4AUX A;  3MWM A;  3OMY A;  4QLC U;  3RPU D;  3HDD A;  2VIX A;  3H5R A;  5LRS A;  2DQR A;  3H9G A;  3HTU A;  1WKM A;  5BPI A;  1SD5 A;  1AWC A;  3TDZ C;  4IHS A;  4G12 A;  2OF7 A;  2QYO A;  4OWR B;  5FRN A;  4AYB N;  4UY8 I;  1APL C;  1B6A A;  5GTI C;  2MA3 A;  1JUP A;  4WWC A;  2G0E A;  3DKX A;  3HL2 A;  1OMI A;  5GAH J;  4BQA A;  2FU4 A;  1I3Q J;  3WTY C;  3BWG A;  4EM1 A;  5LHH A;  4KIC A;  2FNA A;  4AYB A;  4IZZ A;  3CP2 A;  1ODD A;  3VPR A;  2JA8 J;  3KYL A;  3ZMS A;  1J59 A;  2XV4 S;  2VQG A;  4QTR A;  5JVT A;  1JJ6 C;  1YJW I;  1JGG A;  4E7L A;  2Z9O A;  4BY7 J;  2L2O A;  4ASN A;  2HKO A;  1NG6 A;  4KNY A;  2VQH A;  3QQA A;  1EA3 A;  4OAY A;  2K27 A;  1TTY A;  3DBR B;  3NAR A;  1T98 A;  4W1U A;  3H1C A;  2GWR A;  4F7Z A;  2NYX A;  1IRZ A;  2L9N A;  1NHA A;  4L18 B;  3HOU J;  4BEH A;  2HEO A;  3A0B C;  4XKV A;  2L0K A;  2J5P A;  2BEO A;  3BCB A;  5M3M J;  3JSO A;  2R5Z A;  3JRF A;  4O6J A;  3A2K A;  2O61 A;  3MKZ A;  1DU0 A;  2XDV A;  3TL4 X;  3SXY A;  3I3L A;  1GXQ A;  2HZT A;  2HS5 A;  3ABU A;  5FGM A;  1QVU A;  1ZK8 A;  2CUZ A;  5LHI A;  4H0E A;  4GFB A;  4CSW A;  3G2B A;  4BYY A;  3JRE A;  1TL8 A;  5D4R A;  2ELH A;  3JR9 A;  5DCF A;  2BXY A;  3C2G A;  1UEL B;  2DW4 A;  4RGR A;  5DUK A;  1FLI A;  3HHG A;  1YQA A;  2VON A;  3AAF A;  2BVM A;  3IUO A;  1XTA A;  5D8L B;  4BEH B;  2HTS A;  5KHD A;  4I6Z A;  1YJN I;  3TQN A;  2R5Z B;  3E3V A;  4CXF A;  4ZTF A;  5LFA A;  1LEB A;  2DT7 B;  4NBQ A;  1R71 A;  1R23 A;  1UAA A;  1SAU A;  3KLN A;  1Y56 A;  3SQN A;  3FM3 A;  1SC7 A;  3BG5 A;  5EG0 A;  4FT8 A;  2JA2 A;  4HNU A;  1IRF A;  1Q1H A;  1J2X A;  2QUF A;  3VSL A;  1R9T J;  3DP7 A;  2CQN A;  3W2V A;  5FKM A;  4DNC A;  5ILV A;  1ETV A;  2B0L A;  1XC5 A;  2NNY A;  4PDK A;  1KU3 A;  1FOK A;  2BY1 A;  3GTL J;  5FLM J;  2CQX A;  5BPD A;  3DPL C;  3BPV A;  4X1E A;  3OYJ A;  2JA5 J;  3CUQ C;  1OCT C;  1F43 A;  3QPT A;  3BQY A;  3E7L A;  2JVH A;  2HQR A;  4KYW A;  1YO5 C;  1T08 B;  3K1P A;  1XD7 A;  2FE3 A;  1Y8Q B;  1TBX A;  4B44 A;  5J3L A;  4RLF A;  3JTG A;  3PO2 J;  4Y4R A;  3ZQG A;  1O7L A;  2DT6 A;  3FXU A;  2AQF A;  3KEY A;  3MKL A;  3W6K B;  5E79 C;  4E7I A;  2E7X A;  5CPR B;  5EG0 B;  4G9Y A;  3ABT A;  1MH3 A;  4C2M J;  3S2W A;  1S6L A;  3ZMZ A;  4RM2 A;  4MLO A;  1Z7U A;  1JKQ C;  3ESW B;  2FX0 A;  2PI0 A;  1I5Z A;  1VZ0 A;  5LBQ A;  3RKX A;  2DT5 A;  2WV0 A;  5IY5 H;  3ABL H;  2DOE A;  3M4O J;  1VQ6 I;  2X48 A;  1UG2 A;  3GFJ A;  5HS9 A;  4S05 A;  2V6C A;  2RQP A;  4A3J J;  1YW8 A;  2AXL A;  2LDU A;  2LK2 A;  4UUV A;  3RCO A;  3O8H A;  3PUF A;  2CV2 A;  5D5W B;  1QNT A;  2NOG A;  3ZCO A;  3ERE D;  1XPX A;  2K7L A;  4BU2 A;  4FHT A;  2L02 A;  1W36 D;  2LKP A;  2VKD A;  4A12 A;  1AHD P;  4HA8 A;  4FQG A;  4PSW A;  2XSD C;  3ELK A;  1BIB A;  2OCC H;  1F5T A;  4B09 A;  1IC8 A;  2LFB A;  2H6B A;  4KMF A;  1HOM A;  1IXR C;  4C9Y A;  4XLP F;  5F0C A;  1V5E A;  3BTC A;  2JUG A;  2VBW A;  3OSF A;  5LRR A;  5CVJ A;  1MNM C;  3MCZ A;  2CYY A;  3PFY A;  3AL0 C;  1MKM A;  1HF0 A;  1G3S A;  1RIO H;  3TBI A;  3K70 D;  4DBR A;  2GA2 A;  2VJ5 A;  3IKT A;  2HOT A;  2JRT A;  4XSZ F;  4JX6 A;  1FIP A;  1RZ4 A;  1F36 A;  1G8X A;  2EFO A;  3H36 A;  3S32 A;  2UXX A;  1HBX G;  2CU7 A;  4B8X A;  3OIQ A;  2H94 A;  2V1D A;  3CUQ A;  1WCM J;  2LY1 A;  3QP5 A;  3E6B A;  4FTH A;  5JHU A;  2R7Q A;  2ZBK A;  4HLY A;  3OY9 A;  4OIO F;  3CC7 I;  3FXK A;  2HPM A;  2OC6 A;  1KU2 A;  2MH9 A;  1RES A;  2LR8 A;  3E6C C;  5K7H A;  2HQ5 A;  3EDP A;  2HQA A;  3E5Q A;  2CQK A;  4L9N A;  3MKW B;  2IA1 A;  4PJL A;  1R7J A;  3LWF A;  4CIC A;  3PIP F;  4F93 B;  4F55 A;  3PSF A;  3RPQ A;  3CUQ B;  1K79 A;  4C3J J;  2A6T A;  5ED4 A;  1UCR A;  3BT9 A;  3CUO A;  2YU3 A;  3JRA A;  2YS9 A;  2P4W A;  1DP7 P;  3QYE A;  4CCK A;  3ZPL A;  1MMG A;  1WZ2 A;  1WJF A;  1D0Y A;  3ZXS A;  3F8N A;  3WU0 A;  1IDY A;  3Q9V A;  2ZFU A;  4FET A;  2GOX B;  1KYW A;  3F6V A;  4LOC A;  2QEN A;  1D1C A;  5F64 A;  2HVQ A;  5BQT A;  5KAF C;  4QPO A;  2GBY A;  5E20 A;  4RGX A;  3GTQ J;  2M3A A;  1YS7 A;  3OS0 A;  4XSX F;  5IYD J;  2F4M B;  3ZMU A;  2VC0 A;  2DA5 A;  3RQ4 A;  2HYF A;  2RNJ A;  3M3Y J;  2XAJ A;  3HPH A;  5DYM A;  3AKZ A;  2HPI A;  2F5C A;  3T8R A;  1TW2 A;  1LDK B;  2NVT J;  4DYQ A;  4IHY A;  3GO5 A;  3B73 A;  5J1U A;  3M9A A;  3QAH A;  2W00 A;  3OS2 A;  3LAJ A;  2G7U A;  3HTS B;  2Z1D A;  1IAW A;  1Z3X A;  2DFE A;  1QU3 A;  2L4M A;  1MZB A;  5KK1 A;  3PNY A;  1W7P A;  2K86 A;  2F4O B;  4Q4Z F;  2DA2 A;  3SEZ A;  1W0T A;  2XAG A;  2B9S A;  3BZC A;  3S2H J;  2R7U A;  5TJJ A;  2MW8 A;  2EJR A;  1MBK A;  3E6M A;  1Y39 A;  1J9I A;  2V9P A;  4B47 A;  3M8E A;  4XLA A;  4E7H A;  3AL0 B;  4ZYE A;  1BR4 A;  3T5X A;  4B3A A;  4CCL A;  2JUC A;  2PLY A;  2YPR A;  3PM1 A;  4LLG F;  1O3S A;  1OYW A;  2HDD A;  3M1E A;  3LMM A;  5LGU A;  4S04 A;  1VF9 A;  5BNG A;  2ZKZ A;  1K78 A;  3L1P A;  2X4H A;  4DZJ A;  4CCM A;  5D4S A;  4BNC A;  1BI1 A;  1G3Y A;  2V9K A;  3CJQ B;  2CW0 F;  3FBN B;  2K9Q A;  3DEU A;  3FXJ A;  3SJM A;  3MD2 A;  4IF4 A;  4XN3 A;  4LG3 A;  5FFX A;  4DZP A;  3ZRG A;  2XGX A;  5JVG F;  4O5V A;  1EKE A;  2BZT A;  4CHU A;  4U88 A;  3FXO A;  2A6E F;  1K78 B;  1SFU A;  2MSY A;  5H2F C;  3OYN A;  3NQO A;  4AD9 A;  2TDX A;  1IN5 A;  3OYF A;  4RB1 A;  2K4J A;  2JQ7 A;  1L3L A;  4E7K A;  4D7M A;  2DMP A;  3KYD B;  1H9T A;  2E19 A;  1BI3 A;  2HXO A;  3O8G A;  1FX7 A;  2ZXW H;  2LRE A;  4GGG A;  4BJ5 C;  4DQ2 A;  2WB1 N;  5K5R A;  1ZLK A;  3LA7 A;  2W84 A;  4LIV A;  5J1Y A;  4CYC A;  4G7Z F;  3I9V 2;  1SVM A;  3C2H A;  3DQV C;  3LST A;  3U21 A;  5M5Y J;  5ILS A;  1YG2 A;  3R4K A;  1IN7 A;  3JRI A;  3R60 A;  4G7H F;  2WB1 A;  1X4P A;  4EJW A;  3HOX J;  4UB8 C;  2PX9 A;  3CJR B;  4A5N A;  3VWB A;  4YII A;  2KLO A;  4Y15 A;  2P6S A;  2CUJ A;  2X0L A;  2WY8 Q;  1RR8 C;  5F6F A;  3GZ5 A;  3ULQ B;  1G3W A;  3FXL A;  3GCM A;  4V19 K;  4Z6Y A;  4OIR F;  1IW7 F;  4D9J A;  4CYC B;  3BTL A;  2V7F A;  2LD5 A;  3CCS I;  2GXB A;  1I1S A;  4R1H A;  3A02 A;  1R5G A;  4F3Q A;  1RKT A;  1KU9 A;  2M9H A;  1AOY A;  3KEQ A;  3EET A;  3LA3 A;  3SDG A;  4BE0 A;  3AFH A;  3PQK A;  1Z6R A;  3F9K A;  1TWA J;  4EGY A;  3JCU C;  1ZH5 A;  1U0J A;  3K2Z A;  1MBJ A;  3HG9 A;  5TIS C;  3ABK H;  2CQ7 A;  5JFR A;  4D5F A;  2JPC A;  2LP0 A;  3J81 K;  1T33 A;  1QBJ A;  2FBI A;  4BQN A;  1MJA A;  4Z2Y A;  1L0O C;  1YE9 A;  5CQE A;  3BR2 A;  5DTD A;  1C0W A;  1VQ8 I;  1Z9C A;  1XX5 A;  4RAY A;  2A69 F;  2MG4 A;  4F91 B;  3CCM I;  3E6D A;  4ZYA A;  3K4B A;  5J8F A;  2FJ1 A;  4LK0 F;  4DW6 A;  1T0F C;  3LSI A;  2Q2E A;  5L3F A;  1BIA A;  2XB0 X;  2LYC A;  4XKB A;  3CCU I;  2K9S A;  3ZOB A;  2GM4 A;  1UB9 A;  2JK3 A;  4A3E J;  3RPU A;  3HYI A;  5AIP A;  1V54 H;  2XC7 A;  2QSH X;  3K10 A;  3KCC A;  4HX7 A;  1FSE A;  1HKQ A;  2OTJ I;  3ASN H;  5GAD J;  2BY3 A;  3DLL F;  2A05 A;  2E36 A;  4U0W A; 
#chains in the Genus database with same CATH homology
 2KHM A;  3CMM A;  4CZC A;  2CS3 A;  2R7S A;  1NG7 A;  3FKJ A;  1MW7 A;  3OIP A;  4YRV A;  2KP6 A;  2R7R A;  4N4N B;  2MFZ A;  2O5R A;  2Q2E B;  3OWT A;  1Z21 A;  4DGW B;  3OMY A;  3RPU D;  3PNT A;  2VIX A;  3H5R A;  2Z16 A;  5KCM A;  2JVG A;  3H9G A;  2LH9 A;  1X1A A;  4OWR B;  3SYT A;  5FRN A;  3BC8 A;  2R7T A;  3OYG A;  3MMY B;  3OYL A;  2GOM A;  2F5V A;  2HVR A;  3DKX A;  3HL2 A;  3H0D A;  2E1M B;  3LSM A;  4ZDP A;  2BVL A;  1N78 A;  4AYB A;  4IZZ A;  1S9H A;  3CP2 A;  4PJN A;  3KYL A;  3A4C A;  1ZEL A;  2BW3 A;  3HUG B;  2UWM A;  2X1E A;  2VQG A;  1TZL A;  2R7X A;  2ZSH B;  4CUG A;  5FRM A;  2ELJ A;  1AA7 A;  3SEQ A;  4E7L A;  3FBI B;  2IGN A;  3HC7 A;  2L2O A;  4JOM A;  1NG6 A;  4XR6 A;  5HVQ C;  2VQH A;  1EA3 A;  4ZC3 A;  4BQO A;  4OAY A;  4U87 A;  1W36 C;  4XQF A;  4C2T A;  2MC4 A;  3K4M A;  2L9N A;  4IX7 A;  2M0M A;  4BEH A;  4XKV A;  3BCB A;  3DWL E;  2BW3 B;  3QOE A;  4XOT A;  3A2K A;  3MKZ A;  3ZQQ A;  2XDV A;  3TL4 X;  3OR2 C;  4II2 A;  2X51 A;  1D1B A;  1WJD A;  2PMZ A;  3I3L A;  4LIU A;  2CFO A;  2M4K A;  2CUZ A;  4BDY A;  2KMU A;  3G2B A;  4GRI A;  4CSW A;  4KIS A;  3S3N A;  1BOB A;  5HLT A;  2VLA A;  4BS9 A;  3C2G A;  1UEL B;  3PL8 A;  3UNG C;  2BVM A;  3IUO A;  4BE1 A;  3ONQ A;  4BEH B;  5KHD A;  4AU7 A;  4ZTF A;  1LKX A;  5LFA A;  1X1B A;  1N77 A;  1DGW Y;  2DT7 B;  1UAA A;  3DU5 A;  2JSP A;  1SAU A;  4XKW A;  2E5Z A;  1Y56 A;  3A1Y A;  4ZDO A;  2JA2 A;  4HNU A;  4ZJZ A;  4KT6 A;  3VSL A;  3W2V A;  2VKH A;  2NOJ B;  3D5R C;  4IQ4 A;  2OUM A;  4YEJ A;  3LFU A;  4B3X A;  4E4H A;  3HOS A;  2QKM B;  1MMA A;  2R4G A;  3PNV A;  3SZG A;  4XMY A;  1N75 A;  4CCN A;  3DPL C;  3OL4 A;  1X19 A;  3OYJ A;  2KL4 A;  3UR3 C;  4XLC A;  4BGD A;  2JVH A;  3DEE A;  4U7B A;  1PJR A;  3DTI A;  2LRD A;  4B44 A;  4RLF A;  2PJR A;  1V5F A;  3K4L A;  4Y4R A;  2DT6 A;  4E7I A;  2AQF A;  3KEY A;  2E5N A;  1MNE A;  4RMN A;  2X6Y A;  4PJJ A;  1BR1 A;  3EUK L;  5CPR B;  3OYC A;  4PK4 A;  4RM2 A;  2UUZ A;  3DLA A;  4MLO A;  2M4G A;  2A5W A;  1VZ0 A;  2HDW A;  2CH0 A;  3CZ6 A;  4IKF A;  1DGR M;  2WAE A;  4NUB A;  1OR7 C;  2K9M A;  3W3C A;  1DP3 A;  3FDY A;  3OR1 C;  2WBM A;  2MAB A;  3RCO A;  4PUS A;  1WJA A;  3L2V A;  2CV2 A;  2PJR B;  2ZSI B;  3K4J A;  3RSN A;  3ZCO A;  3DU6 A;  3H5N A;  3NWS A;  4BU2 A;  2HNH A;  1W36 D;  4HST A;  3K4K A;  2VKD A;  1FMW A;  1D0Z A;  2HVS A;  4PSW A;  2W82 A;  4P1W A;  1MND A;  3VYS B;  2DJI A;  2VJJ A;  2K3P A;  2VJI A;  1P9Q C;  4C9Y A;  1UG0 A;  4BE2 A;  4NQW B;  2IGM A;  5FRO A;  1V5E A;  4P5O A;  1MMN A;  4F92 B;  2JUG A;  2CW8 A;  2XAU A;  3K4C A;  2V26 A;  2DXI A;  1FMV A;  2DCE A;  3PFY A;  5HOO A;  1PYV A;  3AL0 C;  3N05 A;  2HU9 A;  4G6T B;  3TBI A;  2IS6 A;  2L9S A;  3K70 D;  2VPL A;  4DBR A;  2VJ5 A;  1SFK A;  2VQC A;  4E7Z A;  1HA8 A;  1G8X A;  2X6W A;  3S32 A;  3OIQ A;  3OYI A;  2LY1 A;  2LC2 A;  4F52 A;  1Y6I A;  2R7Q A;  1OLT A;  4PJM A;  3OY9 A;  3OYK A;  4ZDL A;  3D5L A;  2HPM A;  3OOU A;  4XKC A;  2OC6 A;  2L7K A;  2XF5 A;  3EUH C;  2HQA A;  3M1C A;  3ZGK A;  2XSJ C;  4EAT A;  3OYA A;  4BDZ A;  4IQJ A;  2IS1 A;  3L2U A;  3MKW B;  4PJL A;  4HNT A;  4XOR A;  3BLY A;  1G59 A;  1WJ5 A;  3SDB A;  4XLH A;  2CMP A;  4PFP A;  4F55 A;  4F93 B;  1QHG A;  3PSF A;  2IXS A;  1YX5 A;  2X85 A;  1E0E A;  2K9L A;  2A6T A;  3S3M A;  3QYB A;  4R79 A;  2V4J C;  2IGK A;  3QYE A;  4CCK A;  2VXZ A;  4II3 A;  1MMG A;  1WJF A;  1D0Y A;  3ZXS A;  1WFX A;  3HPG A;  2Z2S B;  2FUG 2;  2KRC A;  2ZFU A;  4FET A;  2GOX B;  2XF6 A;  4NC7 A;  1D1C A;  3QYF A;  2HVQ A;  3RTR A;  3LSK A;  3BG6 A;  4QPO A;  2VL8 A;  4AVZ A;  1X1D A;  3BCA A;  2M3A A;  2CV1 A;  3OS0 A;  1ERD A;  3TMO A;  3L2Q A;  3OL3 A;  2QKL B;  4XN0 A;  3RQ4 A;  4BAC A;  2KRH A;  2VQL A;  3D5S C;  5KNL A;  4XON A;  1MMD A;  3HPH A;  4DBQ A;  3GBG A;  3AKZ A;  2HPI A;  4NNJ A;  2MYS A;  2KPM A;  4PSX A;  1LDK B;  1DQU A;  2CV0 A;  4YEL A;  4J01 A;  1J09 A;  3OS1 A;  3H5A A;  2VB6 A;  2W00 A;  3OS2 A;  4OAZ A;  2DOA A;  2L5Q A;  2Z1D A;  3NWT A;  1X4O A;  1Z3X A;  2P0W A;  3K4N A;  2CW7 A;  3QOD A;  4DOZ A;  1QU3 A;  2W7N A;  3PNY A;  1WJC A;  4XM3 A;  2IGO A;  4BL0 B;  4HPQ A;  3SEZ A;  3W2W A;  2WY7 Q;  1X1C A;  2R7U A;  4Y33 A;  2R7W A;  4C30 A;  3S3O A;  2BOL A;  3PSI A;  2LY2 A;  4B47 A;  4XLA A;  4E7H A;  3AL0 B;  1BR4 A;  3IAS 2;  4LIT A;  2W1O A;  2MD0 A;  3M8J A;  3H35 A;  3BG7 A;  4CCL A;  4BJT A;  3DPT A;  2VXD A;  3EUA A;  3S93 A;  4BXF A;  1D0X A;  3LMM A;  3DPU A;  4HG2 A;  2Q1Z B;  4BUP A;  2RQQ A;  2KDO A;  2Y0S A;  4CCM A;  3LL7 A;  4DIQ A;  2R7O A;  2V9K A;  3E1S A;  3CJQ B;  2I8D A;  2WA0 A;  1WJB A;  3FBN B;  3IAM 2;  3MD2 A;  3PJR A;  2W4S A;  4XN3 A;  4LG3 A;  1IRX A;  2LG4 A;  1JI8 A;  3ZRG A;  2K5C A;  2WAQ A;  4ANJ A;  4BQQ A;  5CKT A;  2X6X A;  4ZTJ A;  3ZR8 X;  4RLQ A;  4CH7 A;  1Z7L A;  4XNF A;  2AQE A;  3OYN A;  3OYF A;  2UV1 A;  2X1D A;  2IS2 A;  3VYU B;  4E7K A;  3K6G A;  4Y3O A;  3OYH A;  3KX2 A;  4D1Q A;  4HSR A;  3CP8 A;  3VSK A;  2LRE A;  4RM3 A;  4BJ5 C;  3IP4 B;  3VDX A;  2V6E A;  3V42 A;  3OYD A;  4N4O B;  3CES A;  3DTE A;  3MKY B;  3L2W A;  4LIV A;  1KON A;  3C2H A;  3I9V 2;  3DQV C;  3U21 A;  4DJA A;  2E1M C;  4CA0 A;  3W2A A;  4FAS D;  1V5G A;  3OYB A;  2WB1 A;  1X4P A;  2LOO A;  3L2R A;  3CJR B;  2IS4 A;  3VWB A;  2KLO A;  2LBF A;  2CUJ A;  4CCO A;  1YX3 A;  2WY8 Q;  4KJZ A;  3DKY A;  3LSG A;  2R7V A;  2ZXH A;  2KQR A;  3HXL A;  2X1C A;  4CCJ A;  2F6C A;  4KIT B;  3PUB A;  4B43 A;  3CF2 A;  4D9J A;  2V7F A;  3K70 C;  1GLN A;  3VYR B;  5CQG A;  5JHF A;  4PFO A;  3H9Q A;  2HZD A;  4F3Q A;  4ITV A;  2XF7 A;  3E0J B;  1T95 A;  3HOT A;  1D1A A;  3LSH A;  2VAS A;  2RRE A;  4QPQ A;  3VYT B;  3S8P A;  5TGT A;  4BE0 A;  2LBF B;  3AFH A;  1WJE A;  3F9K A;  1U0J A;  3HG9 A;  3J7A Y;  3HKZ A;  4B48 A;  1TT0 A;  3DTK A;  4BQN A;  1YE9 A;  2F4I A;  5CQE A;  2M7B A;  3EPZ A;  4C2U A;  4BJ6 C;  4X0G A;  1BR2 A;  2WAF A;  4F91 B;  4E7S A;  1K6Y A;  3H9J A;  4ZYA A;  4XLE A;  3K4B A;  1QHH D;  2ZXI A;  4HRI A;  1LFP A;  4XLF A;  5LD2 C;  1T0F C;  2RNG A;  4HEA 2;  5HNF A;  2M7A A;  3LSI A;  4JQF A;  1R6R A;  4E6K G;  2LYC A;  4E7J A;  4H4K C;  4XKB A;  4XOP A;  5HNH A;  2VJ4 A;  4J00 A;  3FHN A;  2XC7 A;  4NC8 A;  2WAD A;  2OV7 A;  3K10 A;  2E60 A;  2KZV A;  4XL9 A;  1LVK A;  3OYE A;  1Z3Y A;  3OYM A;  2V1N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...