1BBYA

Dna-binding domain from human rap30, nmr, minimized average
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bbyA00
1YW9A 3GUDA 4R79A 2DLLA 2QENA 2PLYA 3RYRA 2LKPA 2VBZA 1T2KA 4I0AA 2LSOA 1W7PB 3E5UA 3V7CA 2VE9A 4B09A 3ECOA 4ZYEA 2YR2A 1JGSA 1WKMA 2VT3A 2PG4A 2R7FA 1R1TA 5E20A 1R5GA 1TQMA 3GF2A 1ZARA 2K7LA 4CZZA 5DD8A 3REOA 2V9VA 2OQRA 2AS5F 3J7AO 2VN2A 3Q5FA 4KYWA 1UCRA 4EJVA 1ZN2A 3NQOA 2EFWA 4ZH4F 2DW4A 3QOPA 3I59B 1I1SA 3M9AA 1F9NA 4G8XA 4ESFA 4M9SA 1WI9A 4AIJA 5IT3A 3ABTA 5ILSA 4TV7A 4KIBA 3HSEA 1W7PD 3ISPA 3E97A 5J8CA 5D5XB 2EWNA 3R61A 4QWQA 4ZZLA 1O3SA 1TNTA 4AVPA 1B1BA 1G3YA 4OMYA 5FB2A 1UHMA 1KU3A 3K1MA 3FM5A 1T98A 3K9TA 1YS6A 3QU6A 1U2WA 2F5DA 4KNYA 5LBQA 4OIQF 3I58A 3QU3A 2G7HA 5J6XA 1HBXG 1HSTA 2G7UA 2R7DA 5CVJA 4EGZA 3I0TA 1HXDA 2IA1A 1KQ9A 2EFPA 4PZJA 3O2PE 5TJJA 4KIFA 1ZRFA 4R1HA 1ZGAA 2FBIA 1OR7A 2IT0A 2GA2A 2ETHA 4LJZF 5E1ZB 3WTYC 3FF5A 2P8TA 4M6XA 4U0VA 1GHCA 1F5TA 4HQMA 4I0BA 3KP5A 2DQRA 4NHJA 3CTAA 5CVUA 1GXPA 4KUMA 3QPTA 3GVAA 1YIOA 4I2OA 3DPLC 1H9GA 2QQAA 4UV8A 3IRRA 4M6YA 1BN5A 1O7LA 2B0LA 4LD5A 2Z5UA 4MEYF 2D45A 1FOKA 2MD5A 5A2QK 3T0YA 4WF2A 2Z99A 4B8XA 1OYIA 3QP6A 3QAHA 2JPCA 4LK0F 3HIFA 1IN8A 2UZKA 1L0OC 4EVIA 4S04A 1Z1DA 2KIMA 4BHBA 2HGCA 4CGZA 4HDVA 2F5CA 3LA3A 4FX4A 1SFUA 1BC7C 3ZPLA 3JSPA 5FO5A 2ZKZA 4CDGA 2H6BA 4RGRA 3R4KA 5FD5A 3K0LA 4UVAA 3MCZA 2Z33A 2FNAA 4YIIA 2IA2A 2GIVA 2NRAC 5DYMA 2Z9OA 5D5VB 2QQ9A 2K4JA 2VE8A 1QGPA 1KQ0A 2HZTA 1YQAA 3V8JA 4RAYA 3V4GA 2W25A 2OD5A 5LHGA 3ABUA 5HDGA 4MGRA 3FXUA 1XSDA 1XDUA 1AWCA 4U7DA 4A0YA 4BAYA 5KVRA 5K1YA 2BE5F 2VBYA 5ICGA 3KP7A 1BOAA 3HUGA 3GX4X 2ZO4A 5L3DA 2A6HF 4IVNA 1EH6A 2WV0A 4GXOA 5ILUA 4ZYGA 2W24A 4UHTA 2MA3A 2QLZA 3WU1B 2YU3A 1B9NA 3ZMTA 1ZREA 1KQ8A 1B59A 1ZAOA 5H6QA 3T5XA 1HKTA 1TW3A 3R6SA 2VOOA 4I7HA 4ENJA 3WODF 2RDPA 3KE2A 5DD4A 1WQ2A 1IN6A 4KA4A 2JRTA 3U9GA 3NRVA 4ESJA 4O3MA 2P5LC 4HF2A 4UVBA 3O6BB 2ESNA 2F2EA 3FM3A 4L18B 4RGSA 3VB2A 1LDJA 4XSZF 5DUIA 2V6CA 4ENKA 3BJOA 3DF8A 2Y0MA 4JBAA 3IL2A 5CJ9A 1LEAA 1QZZA 5L3GA 4CXFA 2QVOA 1T39A 1C0WA 2FMYA 3W6JB 1V3FA 2MLKA 2CWEA 4XSXF 3LAJA 3E5XA 4GGGA 3IC7A 1QNTA 3WE3A 3C18A 1BM9A 3WTWC 2STTA 3ZN0A 4DQ2A 1U6GA 1R00A 5DCMB 4PDKA 2FU4A 2ZNZA 2K02A 2PEXA 5EEGA 5ICFA 4A5MA 1TNSA 4HBLA 1SFXA 2BEOA 3BP8A 3CUQC 4Q47A 1T6SA 2JTVA 4HLYA 2XIGA 3ZN1A 3WG9A 3WTSC 1R36A 2X0LA 2PFBA 3VFZA 2P4WA 2L54A 2DO7A 2J5OA 2LDUA 3B73A 1XGOA 4L5IA 2XAGA 1L3LA 3VODA 4EM2A 5L3CA 2FSWA 4S05A 4P96A 4ZYHA 4ZYDA 3BPVA 4G9YA 2P7CB 3EYIA 3JAMZ 1P2FA 4LLNA 2FE3A 2RVCA 2XKOA 4HAMA 3FXQA 3R0JA 3J81K 1DPRA 2P6TA 1AOYA 6PAXA 2ZJ2A 1YO5C 4BHPA 1RUNA 2FXAA 1KU7A 2XAHA 2OZUA 1U5TA 4DNCA 3RTRA 4OU0A 5JR3A 1O3RA 1MDMB 1FBQA 4OMZA 2K4BA 3P9KA 5IT9Z 1IRFA 1QZYA 3V7RA 3L9FA 1USTA 1XSVA 1HKSA 4RB3C 3J80Z 2P5VA 1U78A 1OYYA 4ETSA 3BJAA 2HFHA 2PN6A 1F1ZA 2Q0OA 1PUEE 3AAFA 2CO5A 4P9UA 2PQ8A 4HQEA 1ZRCA 2FA5A 1ON1A 2BV6A 5FFZA 2FEZA 1P4XA 1TQIA 3GZ6A 2VBXA 1XGSA 1O3QA 4LG0B 2LF8A 2COMA 3FZVA 3LAPA 2DQLA 3TKYA 1GXQA 3ELKA 1T0FA 4JQFA 4LMYA 3F23A 4F7ZA 4LGWA 1HW5A 1Q1HA 1GVJA 1BI1A 4AD9A 3GLXA 4HV5A 4Y15A 4RAZA 2RGVA 4RGUA 2QBYB 1MDMA 3KP4A 5HOOA 2DAOA 2HWVA 5AIQA 3WTUC 2DK8A 2XV4S 3L09A 5E8GA 2EB7A 4RGXA 4OIRF 4G6DA 4BQAA 1V4RA 2L4AA 1R58A 3L7WA 2NNYA 1PP8F 1QBJA 3WTTC 3K2ZA 3U1DA 2HR3A 4Q5SF 1OMIA 3ERED 1E2XA 2CFXA 4PGGA 3CO7C 4OIOF 2GZWA 3F8NA 5CYVA 1J2XA 3DEUA 3MEXA 2H27A 2EA4A 1FYKA 3LFKA 4Y13A 4NB5A 2XROA 5LEJA 2EFOA 3SZTA 3FXRA 4MTEA 1FNNA 3GFIA 1W7PA 5HDKA 3EUHA 3M8EA 4HF0A 3TDZC 2OAZA 1EH8A 1IAWA 1FT9A 3GXOA 2IPQX 1HKQA 5H20A 4HX4A 2DFIA 3BZ6A 1B9MA 1IXRC 1Z9CA 1REPC 2K86A 4EQQA 1KU9A 4WCGA 1SD7A 5CVRA 4IHTA 1XMAA 3MZHA 2QBYA 4L9NA 1IRGA 2X4HA 4KMFA 4FX0A 1R7JA 3TO9A 1ZRDA 1G3TA 4N9HA 1I6XA 1LB2A 2XUBA 3KP6A 5TRDA 3I59A 4IRHA 1ZHFA 4I01A 1TQPA 3B02A 2P6SA 4BNCA 2W57A 3KZZA 1FLIA 3BOQA 3Q9SA 3KEOA 3QP5A 4UUVA 3FMSA 3DQVC 1XDSA 2A68F 2A5YB 2NS0A 3D0SA 4CO8A 4M74A 2K27A 4IF4A 2HYFA 1MZBA 3GFLA 4L5JA 2KJCA 3HHHA 4BXUA 4GYGA 2DPDA 4EJTA 2YX4A 3PFIA 1D3YA 3K1PA 1ZGJA 4WXDA 2AXLA 3V7SA 1DP7P 1CGPA 2IA0A 3KLOA 3GW2A 3IWFA 1FC3A 4HLXA 4OOIA 2D2WA 5KK1A 1LDKB 3RPQA 2NNNA 1BI2A 5DDGA 4EMSA 5DV5A 4UVCA 3TO6A 4K2EA 1IW7F 3ZMDA 4LK1F 2VOPA 5AIPA 1RZ4A 2KIUA 3FMRA 3LA7A 3KCCA 1LQ1A 4CHUA 3T1BA 4M73A 1S29A 4XBFA 2F5EA 5LEKA 1IXCA 1HQCA 4EM0B 2O6GE 2DT5A 2QM3A 1SD6A 4D0PA 4CYDA 3BPXA 3F6VA 2EV5A 4N9IA 4KDPA 5E1XA 4NQWA 2L3DA 5A2QZ 5DEQA 1R22A 2EV6A 4WK8F 4A0XA 2MC3A 3H92A 2QUFA 3SHFA 2H6CA 1UB9A 3KP3A 3E6DA 2DBBA 1QQIA 4HOBA 3BJ6A 2V1XA 3LA2A 3GWZA 3TGNA 5E18F 5CVIA 3HSRA 2GQQA 3FHZA 3HOTA 4ASNA 1KU2A 3BY6A 5LHHA 4KIGA 3MZYA 1SD5A 1UFMA 4A6EA 1R23A 4XLNF 1MD0A 2PI0A 2KIFA 3MQ0A 2PMHA 3HHGA 2NAZA 1KA8A 3HRMA 1PP7U 1TTYA 1D8JA 1LEBA 3EYYA 1S7OA 1ZLJA 3I71A 4HA8A 3L2CA 4IRIA 2M87A 4L9VA 3V8KA 1RUOA 2RC4A 3QPHA 2DU9A 1UHWA 4BHCA 3FMQA 1FYLA 3E5QA 1TBXA 3GO5A 4EM1A 5K5QA 3N4MA 1G6NA 3JTHA 2VT2A 1XCVA 1J9IA 1H9TA 4ON0A 4WXHA 2D1HA 3CUQB 4KFCA 2FRHA 4KT5C 4EJWA 1FWZA 3BROA 3GZ5A 1FBSA 2EFNA 4RB1A 4I98B 3HRUA 2O61A 5HS8A 4YG2F 3DP7A 2YPRA 1XMKA 4G7OF 3WTVC 3IHUA 3RYPA 4WXCA 3F8BA 5FLXZ 1Y0UA 1HW1A 3CDHA 3JSOA 2EV0A 2XGXA 1B4AA 5JHUA 3F8CA 2M30A 5HS9A 1STZA 3Q9VA 2CSOA 2OU2A 4G7HF 1KGSA 3NEUA 1LJ9A 5D6FA 1WRJA 4FT8A 4LB5A 3H3ZA 2FQ3A 1F4KA 1U8RA 2QQBA 2RV8A 3JTGA 3FWEA 2O0YA 1J5YA 3ZMUA 4KN7X 3CUQA 5BPIA 3DPTA 5F64A 2DPUA 2Y48A 3GFMA 5D5WB 4BYYA 2STWA 1A04A 1FSEA 2M5WA 4A2UA 2EJRA 5LRRA 4L0ZB 5D5UB 4QLCU 3WGGA 3MAJA 3M1EA 2IP2A 5K5RA 2A69F 4GO1A 1ZG1A 4ZZDA 5IT9K 3I4PA 3ML6A 2M8EA 5DCMA 2WTEA 3V8LA 1P92A 4KMUX 4P9FA 2L02A 2VC1A 2A6EF 4ESBA 2E1CA 1BBYA 2QZ8A 2WWYA 5EEHA 1YS7A 5D8KB 1XSXA 3RKWA 5LGUA 3R0AA 4YFNF 1JXSA 4HX8A 1K6OA 3I64A 4GCVA 3BDDA 2XVCA 1G4DA 2KRFA 3RPUA 2UWMA 4RB0A 1LDDA 2IW5A 2BBYA 3T8TA 3KETA 2R3SA 4CICA 3LWFA 4PGHA 4MEXF 3DXJF 4YFXF 5HDNA 3VEPA 2O3FA 1FBUA 3ZP5A 3ECHA 2ELHA 1JHFA 5D6EA 2ZCWA 3KP2A 2HDCA 2YSRA 1SAXA 1FSHA 2E1NA 4XRFA 2XAQA 3SFZA 4OINF 3JW4A 1FP2A 2HYGD 1MJBA 3J81Z 3IWZA 2HEOA 3P9CA 1ODDA 2O03A 2JT1A 1BIBA 2OA4A 1K78B 2HKXA 4U88A 1J59A 3RIRA 3HTUA 4HZFA 2QWWA 1MJAA 4PCQA 1Z7UA 1D5VA 5JFRA 3I53A 5ICEA 2GXGA 1YG2A 2CG4A 4IRGA 5D4RA 5JVTA 3PQKA 1J0RA 3SXYA 3W6KB 2IRFG 5J8FA 3ZMSA 4IJAA 2MH9A 4M9XA 3TO7A 1LVAA 1FPQA 2GWRA 5HLHA 3IKVA 4U7BA 4H0EA 1J7KA 1W5SA 4M71A 2VBWA 1IUYA 1OPCA 3ZMZA 5LLQA 4MNUA 4O5VA 2EK5A 1MJ9A 2OQGA 5BPDA 4G6QA 1XB4A 3K1NA 5L3BA 3COAC 2FBHA 2CGPA 5F1RA 1BI0A 1IZ1A 4A5NA 5HLIA 1Z05A 1ON2A 3M8FA 4E70A 4U0YA 2ZFWA 1HW2A 2Y75A 5LGNA 1TLHB 1W5TA 2VODA 2LF7A 3LQRA 5ED4A 4U0WA 3WGIA 4R8HA 2ZNYA 4O6JA 4UV9A 1K78A 3E6BA 4LG0A 1BJAA 2BGCA 3E6MA 2XKPA 1IN7A 2MBFA 1FX7A 3TOAA 3DV8A 2FBKA 1R5HA 4EJOA 2CYYA 4LFUA 2G9WA 1XGNA 5JI6A 5E1WA 1G3WA 1QPMA 5CVVA 2IJLA 3P9IA 4MQVA 5L3EA 1VTNC 2A07F 3TDUC 1FYMA 4N0BA 5ILVA 3KEQA 2UXNA 5DCFA 4EGYA 3F3XA 3WGHA 5BS6A 2HTJA 2RQPA 2ZXJA 5HVQC 4P55A 2HQNA 4L0YB 5F6FA 4IPAA 5AONA 2OBPA 2FOKA 2JSCA 4UNOA 4A12A 1ULYA 3F72A 2M45A 5FGMA 3F6OA 1MGTA 3WE2A 5L3FA 1I5ZA 5H6RA 1ONVA 4RB2C 1J75A 1FP1D 4I09A 3RDIA 5K5OA 2CW0F 3GFJA 3WTZA 2P5KA 3C7JA 2PJPA 2PBIA 2KKOA 4AIHA 1ZG5A 1P4AA 3SQNA 1IN5A 3OV8A 3CO6C 2P7VB 1JHHA 3U2RA 4G94A 3OOPA 4FHTA 1BI3A 5HS7A 2E7WA 4BH9A 1RI7A 1SMYF 2XASA 3HSFA 3BWGA 2W85A 4KN4X 1IN4A 3K69A 3ZQ7A 4HW0A 1DDNA 4Q4ZF 1SD4A 2O8XA 2EFQA 4WWCA 1ZG3A 4MQ9F 1T38A 3CLOA 2KJBA 3E6CC 2XAFA 3HRTA 3MWMA 1QO0D 1WSUA 1XGMA 2M1BA 3G3ZA 3N97A 2RKHA 2A61A 3I5UA 1K79A 2BYVE 4A6DA 2WC2A 1CF7B 3F21A 2ACJA 4YFKF 2GAUA 4Q48A 2TDXA 3P7NA 1PDNC 3F8FA 1P6RA 2L01A 2MH2A 4M9ZA 2HOEA 1KYZA 2MLGA 4MTDA 1XCBA 2ESHA 2JPBA 1EV7A 1HSJA 5E17F 1FY7A 1G3SA 3ZMVA 2HKOA 3SZPA 3WTXC 4MHGA 2CQKA 4I02A 2FNPA 1IXSB 5E8IA 5BQTA 5FD6A 2GA1A 2VXZA 2Q2EA 2L4MA 2NYXA 2XRNA 3RJPA 2HTSA 3E3VA 2ZMEB 4JK1X 3ULQB 1Z6RA 1B6AA 1XD7A 3M7GA 1E17A 1CF7A 1IF1A 1Z91A 2HQRA 2FMLA 4M72A 2QYOA 3TOBA 1USSA 3C1DA 3DFGA 5FLXK 2ISYA 1RNLA 1SMTA 3F8MA 2ISZA 4LLLA 3RKYA 4WX9A 3HTSB 2VONA 3FX3A 1OYWA 2FF4A 4EJUA 3CJNA 5DUKA 1DPUA 2E7XA 1KYWA 2V1DA 3EQLF 2ADUA 5LGTA 5BOXA 4UXNA 5FFXA 3GEZA 4KICA 3WU0A 1BC8C 3O3KA 1R1UA 4HF1A 3DKWA 2LNBA 2V1UA 2UXXA 1DUXC 3QRFF 1O7FA 4GYIA 3EETA 4RS8A 2OZ6A 1I27A 1S8NA 5HLGA 5LRSA 2PMUA 1BIAA 3F22A 2ZMEA 4LLGF 3IKTA 3S2WA 2RN7A 1O57A 4Y17A 4EV0A 3MFKA 3HYIA 3GYHX 4OIPF 1D8KA 4A0ZA 5LHIA 4Z2YA 4YIFA 1S6LA 1S7AA 4HYEA 1XN7A 1TW2A 2DK5A 3HOSA 4ENNA 3JAMK 3D5LA 2C6YA 5D8LB 1H0MA 3IRQA 1U5TB 3L00A 1I1GA 1WWXA 1YW8A 3TQNA 1YFHA 4XLPF 1R1VA 3RI4A 1YW7A 2YX7A 2ZBKA 5ICCA 5ERIA 3KZYA 1OKRA 3HRSA 1JE8A 4G7ZF 4L9TA 2V79A 2D1VA 2DI3A 1YTYA 2RNJA 1SFEA 4ENMA 3CUOA 1S3JA 4IXAA 3J80K 3T8RA 1FZPB 1O3TA 1EH7A 4AWXB 1RIOH 1Z6TA 3RKXA 4P5OA 4AIKA 2VC0A 1U3EM 2W84A 1ZLKA 1W4MA 2DTRA 1U5TC 2HS5A 4HDUA 4IHSA 1X3UA 3C3WA 2IVMA 3KLNA 1YLFA 3R60A 1NHAA 1ZH5A 2JZYA 1K7AA 2Z3YA 3KFWX 2F5FA 4L9JA 2Q8KA 1P4WA 3H3UA 3I54A 3LQQA 2H09A 2H94A 3G73A 1LNWA 3ROUA 1ZYRF 4LB6B 2GXBA 1YYVA 5CLSA 3EDPA 2J5PA 4HX7A 2XAJA 2XHKA 3VOEA 4HV6A 3LSTA 2EA2A 5D4SA 2A3SA 3PQJA 5BMZA 1MKMA
chains in the Genus database with same CATH superfamily
2MYSA 1YW9A 3GUDA 4XLFA 1X4OA 1JI8A 3KZIC 1GLNA 4YELA 2DLLA 4R79A 3CCSI 1RESA 4S0HB 2QENA 2PLYA 3RYRA 1MMSA 2LKPA 2VBZA 1T2KA 2LTPA 4I0AA 4PJ0C 4DGWB 2LSOA 3KX2A 1T0FC 1W7PB 1T33A 2EQRA 2W00A 3E5UA 3AL0C 3V7CA 2VE9A 4B09A 3ECOA 3K7AJ 4ZYEA 1H8AC 2YR2A 1RPWA 3CESA 1JGSA 4NC8A 1WKMA 5CQGA 2VT3A 2CUZA 4FCYA 2PG4A 4BE2A 3LL7A 2R7FA 1R1TA 5E20A 3ZQGA 1GUUA 1R5GA 3FKJA 3FBNB 1TQMA 2AQEA 1D0YA 3GF2A 1ZARA 2K7LA 4CZZA 5DD8A 3REOA 2V9VA 2OQRA 3CJQB 1R6RA 1IUFA 2Z1DA 2TRTA 2AS5F 3J7AO 2VN2A 1WJ5A 3Q5FA 4KYWA 4G6TB 3H5RA 2QSHX 4BE1A 3MVPA 3CMMA 2LLKA 2WY8Q 1A35A 4ITVA 1ETKA 1UCRA 4EJVA 3I3LA 4D1QA 1ZN2A 2HNHA 2JVHA 4XL9A 3NQOA 2EFWA 4ZTFA 3LSPA 3HL2A 4ZH4F 1Q1VA 4BY7J 1W36C 2AXTC 2DW4A 3QOPA 3I59B 1I1SA 3VYRB 3M9AA 3AG3H 1F9NA 2DT6A 2JVGA 3LSGA 4G8XA 2BW3A 3S3NA 2VJIA 4ESFA 3HDDA 4M9SA 1A6IA 1WI9A 5GAEJ 3HB9A 5J1RA 4AIJA 1ACIA 3CCEI 3NWTA 3QPSA 5IT3A 3ABTA 5ILSA 4TV7A 3K2AA 2FQ4A 3AFHA 3HSEA 4KIBA 4I99C 3ASOH 1W7PD 3EUHC 3ISPA 3E97A 5J8CA 4CA0A 2R5ZA 5D5XB 2V26A 2JA6J 2EWNA 2X1EA 3R61A 3ZR8X 2EBIA 4MFDA 4QWQA 4ZZLA 1O3SA 1TNTA 4AVPA 2GM4A 1B1BA 1G3YA 4OMYA 5FB2A 1UHMA 1YE9A 3AG4H 3FK7A 1KU3A 1CQTA 1HDPA 3K1MA 3FM5A 1T98A 3K9TA 1YS6A 3QU6A 1U2WA 2F5DA 4KNYA 1VQ6I 5LBQA 2DA7A 2BY3A 3FXJA 4OIQF 3I58A 3SFIA 3K4NA 4BQQA 3QU3A 2G7HA 1Z0XA 5J6XA 1HBXG 3QYEA 3OYAA 1HSTA 2G7UA 5IP7J 2R7DA 5EJCA 3KYLA 1TWGJ 5CVJA 4EGZA 2F4IA 1LPQA 3M4OJ 3W6VA 2NS8A 3I0TA 3LFUA 2X85A 4A69C 4BJTA 2R7QA 5GPAA 1HXDA 2IA1A 3Q3SA 4AU7A 4BE0A 1KQ9A 2EFPA 1APLC 3KEYA 4II3A 2HQAA 3BC8A 4PZJA 2K5CA 3O2PE 2JK3A 3QPLA 5TJJA 1BW5A 3BR0A 4KIFA 1ZRFA 4R1HA 1ZGAA 2FBIA 1PUFB 3VWBA 3S15J 5M5WJ 1OR7A 1IJWC 5DM7F 3A01A 3HOVJ 1YJNI 2X6WA 3DBLB 2IT0A 2CW7A 2GA2A 3ZOBA 1KZHA 2ETHA 4PJLA 4XICA 3ESWB 2K9SA 4LJZF 5E1ZB 3WTYC 2E1MC 2DDAA 1D0XA 3K6GA 3FF5A 1AKHA 3GTMJ 2P8TA 4C3JJ 2VXDA 3OL3A 2CW8A 4M6XA 2MG4A 2DOAA 2VKDA 4U0VA 1GHCA 3H3VK 1K6YA 1F5TA 4HQMA 2NS7A 4I0BA 1TZLA 3KP5A 2DQRA 2O8KA 4NHJA 3CTAA 5CVUA 4QPQA 1GXPA 5EG0A 1ZGWA 1AU7A 3GTQJ 3SYTA 1U9OA 1MBHA 4KUMA 3QPTA 3GVAA 4PUSA 1YIOA 4I2OA 3G1OA 3DPLC 1H9GA 1LFPA 2QQAA 1RR7A 4UV8A 5F27A 3IRRA 2R0QC 3K4LA 4M6YA 1BN5A 1O7LA 2B0LA 3A0HC 3HEFA 4LD5A 4NDLA 3CMEI 2Z5UA 4MEYF 2D45A 1FOKA 3VSLA 2MD5A 3ERMA 3T0YA 5A2QK 4WF2A 3J7AY 2Z99A 3BTCA 1QVUA 4B8XA 1OYIA 1ZTRA 4BGDA 3QP6A 4AC0A 3RQ4A 3HUGB 3DTEA 3QAHA 4HNTA 2JPCA 4DBQA 1Y6IA 4AM3A 3H0GJ 4LK0F 2XSDC 3HIFA 4XKCA 1IN8A 4RAFA 2UZKA 3KPHA 3GLLA 1L0OC 4EVIA 4S04A 2BHYA 1Z1DA 2KIMA 2X51A 4BHBA 2HGCA 4CGZA 4HDVA 2F5CA 1LFBA 3GTOJ 2LMDA 2EPFA 3LA3A 4FX4A 1SFUA 1OCZH 1BC7C 4MFEA 3HOXJ 2XPUA 3OS0A 3ZPLA 3JSPA 5FO5A 2ZKZA 2LY9A 2ZXHA 4CDGA 2H6BA 4RGRA 2NVQJ 3R4KA 2DMUA 4BDYA 5FD5A 3K0LA 3FHNA 3MCZA 4UVAA 2FNAA 2Z33A 4YIIA 2IA2A 2QSGX 2GIVA 2NRAC 1XG1A 2KQRA 5FKLA 5DYMA 2LFBA 2Z9OA 5D5VB 2QQ9A 3UNGC 4AVZA 2K4JA 2X48A 3BQYA 4DYCA 2A5WA 2VE8A 3ASNH 5GPCA 1QGPA 1KQ0A 2HZTA 4IO9F 2PJRB 3CLQA 1YQAA 3V8JA 2DXIA 4RAYA 4E7KA 3V4GA 2W25A 2OD5A 5LHGA 3ABUA 5HDGA 3DTKA 4MGRA 3FXUA 1XSDA 1MBGA 1XDUA 4A3CJ 2IGNA 1AWCA 1X1BA 1TWHJ 5GADJ 2VQGA 4U7DA 4A0YA 1A6QA 2LD5A 1IG7A 4BAYA 5KVRA 5K1YA 2R7RA 2BE5F 2HYJA 2VBYA 2QA4I 5IYBJ 2M4KA 5EEAA 2MD0A 5ICGA 5J40A 1B8IB 5GTIC 3KP7A 1BOAA 3HUGA 4C2MJ 3GX4X 2ZO4A 5L3DA 2F5VA 2A6HF 4IVNA 1GV5A 1EH6A 2BZTA 2WV0A 3HGYA 4E7HA 4GXOA 3JREA 4FE7A 5ILUA 4ZYGA 2W24A 1UZCA 1TT5B 4UHTA 2MA3A 4XOPA 1W1WE 2QLZA 3BR2A 3WU1B 4HNVA 2LOOA 2LP0A 2HDWA 5DM6F 2YU3A 1B9NA 3ZMTA 1ZREA 1KQ8A 1B59A 1ZAOA 3OYNA 2DMNA 3FK6A 5IYDJ 3ABMH 3S1NJ 5H6QA 1RC9A 3PUBA 2XF6A 2YU9J 2CH0A 2VKHA 3BZKA 3T5XA 2R7SA 1YI2I 1HKTA 1TW3A 3R6SA 2VOOA 4I7HA 4ENJA 2E2HJ 1Y8RB 3WODF 1AHDP 4PJNA 4BKXA 1HCRA 2RDPA 5DTDA 3KE2A 1SANA 5DD4A 1BL0A 1IV8A 1YRNA 1Y1WJ 3LMMA 4YEJA 1WQ2A 1Y8QB 3QYBA 3CCRI 3JRCA 1IN6A 2DTZA 4KA4A 2JRTA 3U9GA 2A05A 3NRVA 4DJAA 4ESJA 4LITA 5IOYA 4O3MA 1ERDA 3EUAA 4BY1J 2P5LC 4HF2A 3K4CA 4UVBA 2ZXWH 3ZQHA 3FXKA 1Z21A 4A3GJ 4IHXA 3O6BB 5F1JA 2ESNA 2F2EA 2M8GX 3FM3A 5B1BH 4L18B 4RGSA 3VB2A 1LDJA 3GTPJ 4XSZF 5DUIA 2V6CA 3OYEA 4ENKA 3BJOA 2DMPA 3DF8A 1MBEA 2Y0MA 3C2BA 1FOXA 4JBAA 3V42A 3IL2A 5CJ9A 1LEAA 4ZTJA 2GXAA 1QZZA 5L3GA 4CXFA 2QVOA 1T39A 1N78A 1C0WA 3OYIA 1GDTA 1B8IA 3J7ZI 2FMYA 3W6JB 1RR8C 2DJIA 2L7MP 4XM3A 4E4HA 1V3FA 2HOSA 1Z77A 2MLKA 2CWEA 4XSXF 4DYRA 1ZELA 2UV1A 3HG9A 3JRGA 3LAJA 2CV1A 1MNMC 3M8JA 3SDGA 2HVQA 1MH4A 3E5XA 1KONA 4BQOA 4GGGA 1Y56A 3IC7A 3LSIA 1QNTA 1N25A 2E60A 3WE3A 3RZOJ 3C18A 1BM9A 2MW8A 2JRMA 3WTWC 3ONQA 2STTA 1YX5A 3ZN0A 5B1AH 2KLOA 4DQ2A 1U6GA 1X58A 2KDOA 2ECBA 1R00A 5DCMB 4PDKA 4XRSA 4C2TA 4E7IA 2FU4A 2LKSA 2ZNZA 2K02A 2PEXA 1T08B 2DFFA 3QYFA 4JX4A 5EEGA 5ICFA 2Z2SB 3OYFA 4A3JJ 3ZQFA 4A5MA 1TNSA 1SFXA 4HBLA 2BEOA 2IS1A 3BP8A 2CQQA 3CUQC 4Q47A 1VF9A 1T6SA 2IXSA 3CCUI 3BTIA 2X6OA 2JTVA 4HLYA 4XRMA 2VB6A 2XIGA 2WADA 3ZN1A 2IS4A 3WG9A 3WTSC 1R36A 1YITI 2LBFA 4II2A 2K9NA 2X0LA 2PFBA 4RM2A 1M1EB 4BXXJ 3VFZA 2P4WA 4DZPA 4BJ6C 4PFPA 1QU3A 2L54A 1I50J 2DO7A 2J5OA 1VQOI 2LDUA 3B73A 2ZSIB 4M3FA 2F4OB 2DMTA 1XGOA 4L5IA 3BCAA 4BQNA 2E5NA 2XAGA 4BBRJ 1L3LA 2I10A 1E3OC 3VODA 4HSTA 5F04A 2H1KA 1POGA 1S5LC 4DBRA 3JR9A 2HZDA 4EM2A 5L3CA 2FSWA 3ZQLA 4S05A 4HRIA 4P96A 2E34A 1RRJA 1ETOA 2F6CA 4ZYHA 2Y30A 4AYBA 4ZYDA 1WVRA 1UJ8A 2OPTA 3BPVA 3OOUA 4G9YA 3VYSB 2ID3A 2P7CB 4I6ZA 3EYIA 3IH2A 3UKGA 3JAMZ 1P2FA 4LLNA 5JHFA 5IY5H 1XMXA 2FE3A 2X6XA 2RVCA 3CJTB 2R5YB 1PVEA 1A5JA 2XKOA 4HAMA 4IZZA 1ETWA 3FXQA 3R0JA 4PSXA 3J81K 1E0EA 1DPRA 2P6TA 1AOYA 2XF5A 2ZJ2A 6PAXA 2DOEA 2CQ7A 3TL4X 1YO5C 4BHPA 3WHBA 4GFBA 1UMQA 1RUNA 2FXAA 3H36A 1DU0A 5C4JJ 1KU7A 2XAHA 1H88C 1EJ9A 3CC4I 3OL4A 2OZUA 1U5TA 4DNCA 3RTRA 4BXFA 4OU0A 5JR3A 3HPGA 3PSFA 1O3RA 3K4MA 1MDMB 1FBQA 2R7WA 4OMZA 1MBJA 1XX5A 2K4BA 3P9KA 2HVRA 5IT9Z 2R4GA 1UAAA 1IRFA 1QZYA 1MMDA 3W3CA 2COBA 4PFOA 3V7RA 3L9FA 3RSNA 1USTA 1XSVA 1HKSA 2XSJC 5CQEA 4FASD 4RB3C 4UUSB 3JRHA 3BG5A 3J80Z 2P5VA 1U78A 1OYYA 1IDYA 4ETSA 4ZJZA 1JJ6C 4FISA 3BJAA 2HFHA 3ZXSA 1LE8B 2PN6A 2BY0A 1TWCJ 4W97A 1F1ZA 2B7EA 3OYHA 1ZKGA 2Q0OA 1PUEE 3ZQIA 5FKOA 3IAS2 4XQFA 3AAFA 4HNUA 2CO5A 4P9UA 1R4NB 2I8DA 2PQ8A 4KT6A 5BNGA 3S14J 3S2HJ 4XORA 3IAM2 4HQEA 1ZRCA 4A93J 2FA5A 1ON1A 2BV6A 1EF4A 1JKQC 5FFZA 2KL4A 2XRLA 2FEZA 1P4XA 1LKXA 1TQIA 3GZ6A 1PYVA 2VBXA 1XGSA 4QSHA 1O3QA 2WA0A 4LG0B 1WI3A 4IEJA 4AIDA 1DQUA 1E3PA 2R5YA 3EPZA 1G8XA 2LF8A 2VJJA 1X3ZB 2COMA 3FZVA 4ZDLA 3LAPA 3S1QJ 2DQLA 3BG9A 3TKYA 2HDDA 1GXQA 4JYKA 3ELKA 1T0FA 4JQFA 4LMYA 3F23A 4F7ZA 3IH3A 2NVXJ 1MNEA 4LGWA 1HW5A 1ENHA 1Q1HA 1X19A 1GVJA 1BI1A 5JLWA 2EIMH 4AD9A 3GLXA 4FTHA 4HV5A 4Y15A 9ANTA 4RAZA 2RGVA 4RGUA 2QBYB 3S1MJ 1MDMA 2MFZA 3KP4A 4B47A 5HOOA 4MO7A 1GT0C 2VKVA 2PMZN 2DAOA 4OAZA 3PIPF 1DGRM 2HWVA 4CYCA 5AIQA 3WTUC 2VPRA 1J09A 2DK8A 3DPUA 2XV4S 1DU6A 3L09A 5E8GA 2XF7A 2EB7A 4RGXA 4OIRF 3CZ6A 4D5FA 4G6DA 4BQAA 1TT0A 5FLMJ 1W36D 1V4RA 3OR1C 1WPKA 2L4AA 1R49A 3HKZN 1R58A 4DYQA 3L7WA 4XKVA 3TW6A 2QSFX 2NNYA 4BUPA 1PP8F 1QBJA 3ZQQA 3K2ZA 3U1DA 3WTTC 2HR3A 4Q5SF 1OMIA 3ERED 1E2XA 2CFXA 4PGGA 2ECCA 1Z67A 3CO7C 4L5EA 3G6EI 3I56I 4OIOF 3MD2A 4JOMA 2GZWA 3F8NA 5CYVA 1J2XA 3DEUA 3MEXA 2H27A 4F92B 2EA4A 1QHHD 3CDLA 3BR3A 3A02A 1FYKA 3LFKA 1ZR4A 3FDYA 4Y13A 4IL6C 4NB5A 2ZB9A 1WHUA 2XROA 2W82A 5LEJA 2EFOA 5EF6A 2QF7A 2RREA 3SZTA 2E1MB 3FXRA 5TISC 1FNNA 4MTEA 3GFIA 1W7PA 3HOZJ 1RKTA 1OCOH 5HDKA 3EUHA 1WJEA 5FRNA 2Y69H 4PJMA 3M8EA 4HF0A 2FD5A 3BG6A 3TDZC 3LSJA 2OAZA 1EH8A 1IAWA 5HNHA 2V1NA 2R7ZJ 1FT9A 3GXOA 4HEA2 2IPQX 3E7LA 1HKQA 2DCEA 2CQNA 5H20A 4NC6A 2IS2A 4HX4A 4RMNA 2Y9ZA 2DFIA 3BZ6A 4B1RA 2MC4A 1A36A 4HPQA 3ZRGA 1B9MA 1IXRC 3CJRB 5FKMA 5J1UA 1Z9CA 1REPC 2K86A 4EQQA 1KU9A 4WCGA 3U1KA 1SD7A 5CVRA 4IHTA 4YIRX 1XMAA 3MZHA 2QBYA 2X1DA 4L9NA 1IRGA 2X4HA 4X6AJ 3G4SI 4KMFA 4FX0A 1R7JA 3TO9A 1RETA 1ZRDA 1G3TA 5B3SH 4N9HA 1VQKI 3HOYJ 3PO3J 1I6XA 4M3BA 1MBKA 2W4SA 1LB2A 3BTJA 1HLVA 2XUBA 3KP6A 5TRDA 3I59A 4JX5A 3ABLH 1FIAA 4IRHA 3GZNB 2CRGA 2P81A 1ZHFA 4I01A 2VPLA 1TQPA 3B02A 2JA8J 2XAUA 2P6SA 1IV6A 1G59A 3S16J 3MKWB 4BNCA 5DS9A 2W57A 2XB5A 5K7FA 4M6VA 4RAGA 3KZZA 1FLIA 3BOQA 3VYTB 2ZC2A 3Q9SA 3SJMA 2F48A 3HPHA 1YJ9I 3KEOA 2Y31A 3QP5A 4A3MJ 4UUVA 3FMSA 4X1EA 3DQVC 4C3HJ 4DIQA 5C3EJ 4BBSJ 4HSRA 3EUKL 1R5ID 5B66C 1XDSA 2A68F 2A5YB 2NS0A 4XLAA 3D0SA 4CO8A 4M74A 2K27A 4IF4A 5FLVA 3BLYA 3UR3C 1FJLA 3HJEA 3O8GA 2HYFA 3K4BA 1WJBA 2V7FA 1MZBA 3GFLA 4L5JA 2KJCA 3HHHA 3FISA 4CCJA 4NQWB 4BXUA 2LG4A 4GYGA 2R93J 2DPDA 4EJTA 2YX4A 3PFIA 1NH3A 2JMWA 1NG7A 1D3YA 3KYCB 3A1YA 3G2BA 3K1PA 2WV1A 2FUG2 1V55H 3BG7A 1ZGJA 4WXDA 2AXLA 1QZEA 3V7SA 1DP7P 1CGPA 2IA0A 3KLOA 3GW2A 3IWFA 3QODA 1FC3A 4DW6A 4HLXA 4OOIA 2D2WA 5KK1A 1LDKB 1R71A 3K4JA 5KCMA 1SAUA 2NNNA 3RPQA 1OFCX 1BI2A 2HU9A 2V9PA 5DDGA 1IRZA 3IUOA 1P7JA 2EILH 3HBLA 4EMSA 1LVKA 5DV5A 2QCOA 2Y0SA 4UVCA 1EKEA 1D1BA 2L9SA 1IC8A 3JRBA 3TO6A 2XPWA 4K2EA 1IW7F 3DWLE 5F0HA 5HLTA 1RKWA 3Q0VA 2V4JC 2JSPA 4LK1F 3ZMDA 5GAHJ 4D7NA 2VOPA 5HNFA 1PUFA 5AIPA 1RZ4A 2KIUA 3FMRA 3L2VA 3LA7A 4BL0B 2HVSA 2Q1ZB 3KCCA 1I3QJ 2ME6A 1LQ1A 4B43A 1IRXA 4CHUA 3T1BA 4M73A 1S29A 3GTJJ 3G1MA 1DGWY 3FXMA 2L9RA 4XBFA 2Q2EB 3OYCA 3DU6A 3H9GA 4UB6C 2F5EA 2E5ZA 5LEKA 4QIWN 1IXCA 1HQCA 3PJRA 1OJLA 3TP0A 3MZ8A 3PFYA 1T56A 4EM0B 2Y0SN 3CCLI 2O6GE 1IO2A 3L1PA 3I4NJ 2DT5A 2QM3A 1SD6A 4CZCA 4D0PA 3DLLF 4CYDA 4BJ5C 3BPXA 2FX0A 3F6VA 4QTRA 4ZDOA 2KMUA 2EV5A 3DBRB 5EGOB 1JKOC 4N9IA 4KDPA 2OF7A 5E1XA 2CUEA 1MMNA 1W0UA 4NQWA 2CV0A 4RLQA 2L3DA 5KAIC 3J7YJ 5A2QZ 5DEQA 1R22A 5M3FJ 2W1OA 2EV6A 4WK8F 2JQ7A 2DA2A 2MSYA 1MMGA 3MKLA 2LH9A 1N75A 2MC3A 3H92A 1X2NA 4A0XA 4JP0A 2QUFA 4KISA 3SHFA 2H6CA 1UB9A 2HI3A 3KP3A 3E6DA 2DBBA 1QQIA 5CKTA 1WJDA 3DBHB 4EEFG 3BQZA 3OR2C 4HOBA 3BJ6A 2V1XA 3LA2A 3GWZA 4B3AA 2L7KA 2WBMA 3JRFA 4J19A 1P9QC 4MIMA 3TGNA 5E18F 5CVIA 3HSRA 2GQQA 3FHZA 1NTCA 5FKNA 3HOTA 2KRCA 4ASNA 2M9HA 3E0JB 1KU2A 3MN2A 3BY6A 5LHHA 2OC6A 2HPMA 4KIGA 3MZYA 1SD5A 1B72B 1OCPA 1UFMA 2K3FA 4A6EA 5J4VA 4D9JA 1R23A 4XLNF 3CF5F 1MD0A 1SVMA 2PI0A 2KIFA 4J00A 3MQ0A 2VUMJ 1K61A 2PMHA 3BR1A 3HHGA 2NAZA 1KA8A 3HRMA 1PP7U 1TTYA 1D8JA 1YOVB 1LEBA 3EYYA 3JRDA 4XMYA 1S7OA 1ZLJA 3I71A 2M7AA 4HA8A 1WFXA 3W2WA 3L2CA 3OY9A 4IRIA 2M87A 4L9VA 2MGQA 3TP3A 3V8KA 1RUOA 1VQ9I 3D5SC 2RC4A 3QPHA 1H89C 2DU9A 1V5GA 3PSIA 1WZ2A 1UHWA 1K4TA 1LFUP 4BHCA 1BA5A 1JTYA 3FMQA 1FYLA 2M3AA 3OS2A 2PJRA 3E5QA 1TBXA 3GO5A 3FIWA 5IOZA 4EM1A 5K5QA 4E7ZA 2H8RA 3LSHA 3N4MA 1G6NA 3JTHA 4ZYAA 3CD6I 1P7IA 2VT2A 1XCVA 2DDBA 2L5QA 2E2IJ 1J9IA 1H9TA 3BTLA 1BOBA 2E71A 4ON0A 4FETA 2IGMA 4WXHA 2D1HA 3H9JA 3S32A 1VFCA 3CUQB 4KFCA 2FRHA 1SVOA 3OWTA 4KT5C 4EJWA 2LK2A 3K70C 3GMEA 2KDZA 1FWZA 3K70D 1FEXA 3L2WA 2KZGA 3BROA 3GZ5A 1FBSA 2EFNA 3A2KA 4RB1A 3W2VA 4NUBA 3RKQA 3TMOA 4C2UA 4I98B 3HRUA 2EZLA 2O61A 5HS8A 4YG2F 3L2UA 2V9KA 1Z7LA 3DP7A 2DFHA 2YPRA 1XMKA 4G7OF 2CJJA 3WTVC 2M0CA 3IHUA 3RYPA 3DKYA 2ZMEC 4CH7A 2LREA 4WXCA 3FKIJ 5EYRA 1QPIA 3F8BA 5FLXZ 4U87A 4XOTA 4A3EJ 1Y0UA 4MLOA 1HW1A 3ZCOA 5M3MJ 3CDHA 1UG2A 3JSOA 2EV0A 2XGXA 2VQCA 1B4AA 2DA3A 1U9NA 2BY1A 4XRSG 2L0KA 2DA1A 4XONA 4V19K 5JHUA 2F4MB 5M5YJ 3F8CA 2M30A 1BW6A 1QVTA 4B3XA 2QKMB 5HS9A 1STZA 3S17J 4X0GA 3Q9VA 5E3MA 2CSOA 2OU2A 3H5NA 4G7HF 1KGSA 2N8GA 4BS9A 3NEUA 2MABA 3PO2J 1IDZA 1LJ9A 5D6FA 4CCNA 1NK2P 1WRJA 2WY7Q 2KIQA 4FT8A 4LB5A 1GVDA 3MMYB 3PM1A 5EDNA 2WAFA 3H3ZA 5GAGJ 2EH3A 2HOTA 2VL8A 2FQ3A 1F4KA 1U8RA 2JWTA 2QQBA 3S8PA 2RV8A 2AQFA 1VI0A 3JTGA 3FWEA 2KPMA 2O0YA 1JKRC 1J5YA 3ZMUA 2X6YA 4BEHB 4KN7X 3CUQA 5BPIA 3D5RC 4A3DJ 3DPTA 1HOMA 5F64A 2YS9A 2DPUA 5LFAA 1A31A 2WAQN 2Y48A 1SC7A 4Y3OA 3GFMA 5KAFC 5D5WB 1E3HA 2CV2A 2BVMA 4ZC3A 2LY1A 1X1DA 2HQ5A 4BYYA 1ETVA 1WJAA 3ABKH 2STWA 3PNVA 1A04A 1FSEA 2M5WA 3DLAA 4A2UA 2EJRA 5LRRA 4L0ZB 3PIOF 1OCTC 2ZFUA 5D5UB 1VQPI 2JA2A 4QLCU 3CDIA 3WGGA 3MAJA 3M1EA 3E1SA 1EA3A 2IP2A 5K5RA 2HXIA 2A69F 4IX7A 4GO1A 5E79C 2IAIA 1ZG1A 4ZZDA 2AO9A 2JUGA 5IT9K 3I4PA 1SFKA 3TBIA 1N77A 3ML6A 1U0JA 2KZVA 5K7HA 2M8EA 3O8HA 2XB0X 1SFOJ 4NNJA 5DCMA 4IKFA 2WTEA 2H1LA 3V8LA 4N4OB 1P92A 4KMUX 3X2QH 2E19A 4P9FA 5KNLA 2L02A 2VC1A 4C3IJ 3KIOA 3NAUA 1JGGA 1F43A 2A6EF 1X1PA 4ESBA 2E1CA 1BBYA 2DYRH 2QZ8A 2WWYA 3RPUD 2Z16A 5EEHA 2WB1N 1YS7A 5D8KB 1XSXA 3AG2H 3RKWA 2BXZA 5LGUA 3R0AA 4YFNF 1JXSA 4HX8A 4B48A 1K6OA 3I64A 4D5CA 4A3IJ 2GBYA 4GCVA 3BDDA 2NVTJ 2XVCA 1G4DA 2KRFA 4XN3A 3RPUA 2UWMA 4RB0A 1LDDA 3CCJI 2IW5A 2BBYA 4BEHA 3T8TA 3KETA 4Z6YA 1JJ8C 2R3SA 4B44A 4CICA 1VQNI 2R7TA 3LWFA 4PGHA 4LG3A 4F93B 2L7FP 4XR6A 2KISA 4MEXF 3DXJF 1TWAJ 2LVSA 4YFXF 4BACA 1K83J 5HDNA 3GTGJ 1UELB 4XK4A 3GCMA 2FJ1A 3CCQI 3VEPA 3CCVI 2L9NA 2O3FA 1FBUA 3GBGA 3ZP5A 1YIJI 3ECHA 4F3QA 4H4KC 2ELHA 1JHFA 5D6EA 2ZCWA 3KP2A 2HDCA 2YSRA 2YUSA 4ABZA 1SAXA 1VQ7I 2XC7A 1FSHA 2E1NA 4XRFA 2XAQA 3SFZA 4OINF 3JW4A 1FP2A 2HYGD 1MJBA 2VI6A 3J81Z 3IWZA 2HEOA 3P9CA 3S93A 1ODDA 2O03A 5C44J 2JT1A 1BIBA 2OA4A 2L7ZA 2PMZA 1K78B 2HKXA 4U88A 1V54H 4PK4A 4F91B 1J59A 3RIRA 3HTUA 3SZGA 4HZFA 2QWWA 2R5ZB 1MJAA 4PCQA 3P5JA 1Z7UA 3W2AA 1D5VA 2E35A 3HKZA 3I53A 5ICEA 5JFRA 4DZJA 1I3AA 3LSRA 2GXGA 2JA7J 4V2FA 1YG2A 2CG4A 3CP8A 4IRGA 5JVTA 5D4RA 3PQKA 1J0RA 3SXYA 3W6KB 3VYUB 2IRFG 2DA6A 3DTIA 5J8FA 3ZMSA 4IJAA 2MH9A 1VQLI 1MSEC 4M9XA 3TO7A 2IBDA 1LVAA 2NXNB 3G1LA 1FPQA 4M3GA 1R4MB 2GWRA 3SEQA 3QWLA 5HLHA 3IKVA 4U7BA 2WAEA 4H0EA 1J7KA 1W5SA 2XGEA 4M71A 4C9YA 2VBWA 1IUYA 1OPCA 3ZMZA 5LLQA 4MNUA 4O5VA 1WGXA 5FROA 2EK5A 4RA2A 4UUSA 3OYDA 1VQ5I 1JUSA 3CCYA 1ETQA 2B63J 1MJ9A 2OQGA 5BPDA 4G6QA 1XB4A 3K1NA 3CMAI 2ME0A 5L3BA 4NBQA 1LE8A 3L2RA 2JJ7A 3COAC 2FBHA 2CGPA 5F1RA 1HDDC 1BI0A 1IZ1A 2R7VA 3OYGA 3DKXA 4A5NA 5HLIA 1Z05A 1ON2A 3M8FA 4JX6A 1WCMJ 2XGCA 4E70A 3SEZA 4U0YA 2ZFWA 1HW2A 1ORKA 2CQXA 2Y75A 3DEWA 4BU2A 2DOFA 5LGNA 3A01B 1FOWA 2KHMA 4IQ4A 1S9HA 1TLHB 3A03A 1W5TA 4N4NB 2VODA 2HOAA 2LF7A 3LQRA 2DMQA 1X3WB 5ED4A 4U0WA 3WGIA 2O7OA 1JTXA 4R8HA 1OLTA 1FIPA 2ZNYA 4O6JA 1ZQ3P 4UV9A 1K78A 2EIJH 3CQZJ 4UUTA 3E6BA 4CSWA 3VDXA 1AKHB 4LG0A 3ZQCA 1BJAA 4UB8C 2KP6A 2BGCA 3E6MA 1BR4A 2ELKA 2XKPA 3LNQA 1IN7A 2MBFA 1FX7A 3TOAA 3DV8A 4LOCA 4W1UA 3ZGKA 3OYBA 2FBKA 1R5HA 4EJOA 1I39A 2CYYA 4GDFA 4LFUA 1R9TJ 2K9QA 3OYKA 2G9WA 1XGNA 5JI6A 4D7MA 1LUJB 5E1WA 2ELJA 5EG0B 1G3WA 1QPMA 5CVVA 2IJLA 4CCLA 4CCKA 1UHSA 3OS1A 2A6TA 3FBIB 3P9IA 1WH5A 4MQVA 5J3LA 5L3EA 3DCFA 1TC3C 1VTNC 4GRIA 2A07F 3QOEA 2O9LA 2R92J 5IP6A 3TDUC 4I76A 3JRIA 1FYMA 2EZKA 3OYJA 4N0BA 2DYSH 5ILVA 3PUFA 3KEQA 4P1WA 2UXNA 5DCFA 4EGYA 3F3XA 3WGHA 5BS6A 3K4KA 2W7NA 2HTJA 3FXOA 1BR1A 4E7LA 1XC5A 2RQPA 2ZXJA 5HVQC 1OR7C 5JVGF 4P55A 1MNDA 4ZDPA 2HQNA 4L0YB 3JRAA 3CCMI 3QQAA 5F6FA 4IPAA 5AONA 1GV2A 2OBPA 3Q0WA 2FOKA 2JSCA 2CS3A 2QGUA 4UNOA 1MBFA 3MKZA 1ETYA 4XKBA 4A12A 1MH3A 1ULYA 1Z3XA 1SVLA 2KFDA 3K10A 3AG1H 5H2FC 3F72A 5KHDA 2M45A 5FGMA 1T95A 2ZXIA 3F6OA 1MGTA 1JUMA 3WE2A 5L3FA 4A3FJ 1I5ZA 3H9QA 2K3PA 3S3OA 5H6RA 4YRVA 2OTLI 1ONVA 4RB2C 3A0BC 1J75A 3LSKA 2M7BA 1FP1D 3H5AA 2JUCA 4I09A 3RDIA 5K5OA 2VJ4A 3BG3A 3S2DJ 1MIJA 2OJED 3AKZA 2CW0F 3IP4B 3GTKJ 3GFJA 1XPXA 3WTZA 2P5KA 3C7JA 2PJPA 2PBIA 5FJ8J 2IEKA 2KKOA 2W48A 4PJJA 5E3LA 1O4XA 1HA8A 4AIHA 2VQHA 3OSGA 1YHQI 1ZG5A 1P4AA 4F52A 4LIVA 3SQNA 3MKYB 2NOJB 1IN5A 3OV8A 3CO6C 3NARA 2P7VB 1JHHA 3HOUJ 3U2RA 3KYDB 4Y4RA 2RQQA 4G94A 3OOPA 2QKLB 5E3NA 4FHTA 1UG0A 1BI3A 3TEDA 5HS7A 1FMWA 2M4GA 4M3EA 2E7WA 2BOLA 3JCUC 4BH9A 3TW7A 2VKEA 1RI7A 1SMYF 2XASA 3BCBA 3HSFA 2E2JJ 1OCRH 3BWGA 1FMVA 4B4CA 2W85A 2NVYJ 4KN4X 1IN4A 3K69A 3ZQ7A 1TL8A 3OMYA 2HPIA 4HW0A 1BJZA 1S72I 3OSFA 1DDNA 1Y1VJ 4Q4ZF 1SD4A 3WG7H 2K85A 2NOGA 2O8XA 2EFQA 4WWCA 3H0DA 1ZG3A 4MQ9F 1T38A 3CLOA 2L9VA 2KJBA 2RNGA 4M3DA 3E6CC 2XAFA 3BR5A 3HRTA 2DA5A 3MWMA 1QO0D 1WJFA 5EZHA 3RZDJ 1WSUA 1XGMA 2M1BA 3I55I 3G3ZA 5IP9J 1XS9A 3N97A 1X4PA 2A61A 2RKHA 1Y0NA 2GLOA 1X2MA 2LYCA 2DFEA 3I5UA 3CP2A 1XTAA 1K79A 5GTHC 1QA6A 2BYVE 4A6DA 2WC2A 2CUFA 4QPOA 1CF7B 1JT6A 2QQ8A 3F21A 5IYCJ 2VJ5A 1YX3A 2ACJA 3PL8A 3H1CA 4CCMA 3LOCA 4YFKF 1YRNB 1JT0A 2GAUA 2R7OA 4Q48A 2TDXA 2TCTA 4A3BJ 3PNYA 3OIQA 3P7NA 1PDNC 4J01A 3F8FA 5J47A 2VLAA 1P6RA 2L01A 3I4MJ 2MH2A 4M9ZA 2HOEA 2ZSHB 1KYZA 3WU2C 5IPAA 4IHVA 2VASA 3OIPA 2MLGA 3RQIA 4MTDA 1XCBA 2ESHA 2M0MA 2H8WA 2K40A 1AA7A 3HGGA 2JPBA 1EV7A 4RBOA 1D5YA 1G2HA 1HSJA 5E17F 1FY7A 1F36A 1G3SA 3OIOA 3ZMVA 4LIUA 4XNFA 2OCCH 1D1CA 3CF2A 2V6EA 1D1AA 2HKOA 3SZPA 2ZJQF 3DEEA 3I9V2 3BT9A 3WTXC 3IH4A 4MHGA 2CQKA 4I02A 2FNPA 1MMAA 1IXSB 5E8IA 5BQTA 2BY2A 2GA1A 5FD6A 3HOWJ 2VXZA 2Q2EA 2L4MA 2NYXA 2XRNA 1VQ4I 3RJPA 2M34A 4KITB 2HTSA 3E3VA 2ZMEB 2DODA 2HXOA 4RDUA 5CPRB 4JK1X 2GOXB 3HZJA 2ZJPF 3ULQB 1TWFJ 2BHZA 5EGOA 1U8BA 1Z6RA 4XLCA 1B6AA 3HXLA 1XD7A 4IHWA 4XLHA 3M7GA 5F0CA 2QEXI 1MSFC 4AUXA 1E17A 2LC2A 1D0ZA 4CUGA 1CF7A 1IF1A 1Z91A 2HQRA 1W5CC 2FMLA 3M07A 4RLFA 4M72A 3M1CA 3OYLA 2E36A 2QYOA 3TOBA 1USSA 1MW7A 3C1DA 3DFGA 5FLXK 2ISYA 1RNLA 1SMTA 1BR2A 3F8MA 3U21A 4IHYA 2LRDA 2K9MA 2OV7A 3OYMA 5B5EC 2ISZA 4LLLA 3PNTA 3B6CA 3RKYA 4WX9A 5GP9A 3FXLA 1YJWI 3FX3A 3HTSB 2VONA 5FRMA 1OYWA 2CU7A 2FF4A 4EJUA 2VIXA 3CJNA 5E3OA 5DUKA 2BVLA 1DPUA 2E7XA 1ETXA 2XGDA 2LBFB 1KYWA 2V1DA 4FQGA 3EQLF 2ADUA 5LGTA 5BOXA 3C2GA 4UXNA 5FFXA 1JKPC 3GEZA 4KICA 3WU0A 4RM3A 1BC8C 1QHGA 3O3KA 3BR6A 1X1CA 1B72A 1R1UA 4HF1A 1S7EA 3DKWA 2LNBA 2IS6A 2V1UA 1Z3YA 2UXXA 1DUXC 3QRFF 3H35A 1O7FA 4GYIA 3EETA 4RS8A 4DOZA 2OZ6A 3A4CA 4E7JA 1I27A 1FOYA 1S8NA 5HLGA 1WJCA 5LRSA 2RAEA 4A3LJ 1HC8A 2PMUA 1BIAA 1JUPA 3RCOA 1K4SA 3IV5A 5J4YA 3F22A 4A3KJ 2ZMEA 1OISA 2E1OA 2WAQA 4LLGF 3IKTA 4IQJA 1X1AA 2UUZA 2GIZA 3S2WA 2RN7A 1O57A 5J1YA 4Y17A 2XPVA 5K7ZA 1DP3A 4HG2A 4EV0A 3MFKA 5JLXA 3HYIA 2PX9A 2R7XA 1V5FA 3GYHX 2LKXA 4OIPF 2OTJI 1D8KA 2ICWG 2DJNA 2KRHA 4A0ZA 4UY8I 3B6AA 5LHIA 2KT0A 3L2QA 1IGNA 4Z2YA 4YIFA 1S6LA 1S7AA 2P0WA 1HF0A 4HYEA 2OCEA 3HM5A 1XN7A 5F08A 5TGTA 1TW2A 3D1NI 3VSKA 2DK5A 2L2OA 3HOSA 4ENNA 3G71I 3NWSA 3SDBA 1NG6A 3JAMK 3D5LA 2C6YA 5D8LB 5HODA 1H0MA 4EATA 1VNDA 3IRQA 1U5TB 3L00A 1FTTA 1I1GA 2EZHA 1WWXA 1YW8A 3S1RJ 4XKWA 1OCCH 4PSWA 2ID6A 3TQNA 4XIDA 2B9SA 5LD2C 1YFHA 3Q0UA 4XLPF 1R1VA 3M3YJ 1VZ0A 2CFOA 2G0EA 2D5VA 3RI4A 1YW7A 2WB1A 2YX7A 2ZBKA 5ICCA 2X1CA 3BZCA 3KZYA 5ERIA 1OKRA 2ZJRF 3LSMA 3GTLJ 2JA5J 3HRSA 4CCOA 2GOMA 3VPRA 1JE8A 3F9KA 2Y9YA 1T8IA 4G7ZF 4L9TA 2V79A 1WH7A 2CUJA 2D1VA 2EINH 4E6KG 2DI3A 1FTZA 1YTYA 2RNJA 1SFEA 3DU5A 1ITYA 4ENMA 2EZIA 3CUOA 4E7SA 1TP4A 1PJRA 1S3JA 4G12A 4IOAF 4NC7A 4IXAA 4V2GA 3J80K 3T8RA 1FZPB 2LY2A 2NVUB 1VQMI 1O3TA 1EH7A 4AWXB 1V5EA 1RIOH 4KJZA 1Z6TA 2VQLA 3RKXA 4P5OA 4AIKA 1SEUA 2VC0A 3CC2I 1U3EM 4FE4A 2W84A 4XLEA 4F55A 3N05A 1W4MA 1ZLKA 2DTRA 4OAYA 5EZGA 1U5TC 2HS5A 4HDUA 1ZR2A 5M5XJ 4IHSA 3CMYA 1X3UA 2M2EA 3C3WA 2IVMA 3WHCA 3KLNA 1YLFA 2O5RA 3R60A 4C30A 1I6HJ 4Y52J 1NHAA 1NK3P 1ZH5A 1OQYA 2Y2ZA 2JZYA 2OUMA 1K7AA 2X9DA 3HC7A 2Z3YA 1ZK8A 3KFWX 4IOCF 2DA4A 2F5FA 4L9JA 4BDZA 3AL0B 2Q8KA 2I5UA 2K9LA 4AYBN 4Y33A 1P4WA 1Y39A 2FOWA 3H3UA 4XN0A 3I54A 2CMPA 3LQQA 2H09A 5F0FA 2IGOA 2H94A 4Y7NJ 4CYCB 3G73A 1LNWA 3ROUA 1ZYRF 5C4XJ 5FKKA 4LB6B 2GXBA 1YYVA 2BXYA 5CLSA 3C2HA 2R7UA 2DT7B 3EDPA 2IGKA 3CC7I 1QRYA 2AHQA 2J5PA 1VQ8I 2BW3B 2DN0A 2EIKH 4HX7A 2LR8A 2XAJA 2JN6A 1W0TA 2XHKA 4ANJA 3VOEA 4HV6A 3S3MA 2XDVA 4OWRB 3LSTA 2EA2A 5D4SA 2A3SA 3F0CA 3PQJA 5BMZA 1MKMA
chains in the Genus database with same CATH topology
1YW9A 3GUDA 4R79A 2DLLA 2QENA 2PLYA 3RYRA 2LKPA 2VBZA 1T2KA 4I0AA 2LSOA 1W7PB 3E5UA 3V7CA 2VE9A 4B09A 3ECOA 4ZYEA 2YR2A 1JGSA 1WKMA 2VT3A 2PG4A 2R7FA 1R1TA 5E20A 1R5GA 1TQMA 3GF2A 1ZARA 2K7LA 4CZZA 5DD8A 3REOA 2V9VA 2OQRA 2AS5F 3J7AO 2VN2A 3Q5FA 4KYWA 1UCRA 4EJVA 1ZN2A 3NQOA 2EFWA 4ZH4F 2DW4A 3QOPA 3I59B 1I1SA 3M9AA 1F9NA 4G8XA 4ESFA 4M9SA 1WI9A 4AIJA 5IT3A 3ABTA 5ILSA 4TV7A 4KIBA 3HSEA 1W7PD 3ISPA 3E97A 5J8CA 5D5XB 2EWNA 3R61A 4QWQA 4ZZLA 1O3SA 1TNTA 4AVPA 1B1BA 1G3YA 4OMYA 5FB2A 1UHMA 1KU3A 3K1MA 3FM5A 1T98A 3K9TA 1YS6A 3QU6A 1U2WA 2F5DA 4KNYA 5LBQA 4OIQF 3I58A 3QU3A 2G7HA 5J6XA 1HBXG 1HSTA 2G7UA 2R7DA 5CVJA 4EGZA 3I0TA 1HXDA 2IA1A 1KQ9A 2EFPA 4PZJA 3O2PE 5TJJA 4KIFA 1ZRFA 4R1HA 1ZGAA 2FBIA 1OR7A 2IT0A 2GA2A 2ETHA 4LJZF 5E1ZB 3WTYC 3FF5A 2P8TA 4M6XA 4U0VA 1GHCA 1F5TA 4HQMA 4I0BA 3KP5A 2DQRA 4NHJA 3CTAA 5CVUA 1GXPA 4KUMA 3QPTA 3GVAA 1YIOA 4I2OA 3DPLC 1H9GA 2QQAA 4UV8A 3IRRA 4M6YA 1BN5A 1O7LA 2B0LA 4LD5A 2Z5UA 4MEYF 2D45A 1FOKA 2MD5A 5A2QK 3T0YA 4WF2A 2Z99A 4B8XA 1OYIA 3QP6A 3QAHA 2JPCA 4LK0F 3HIFA 1IN8A 2UZKA 1L0OC 4EVIA 4S04A 1Z1DA 2KIMA 4BHBA 2HGCA 4CGZA 4HDVA 2F5CA 3LA3A 4FX4A 1SFUA 1BC7C 3ZPLA 3JSPA 5FO5A 2ZKZA 4CDGA 2H6BA 4RGRA 3R4KA 5FD5A 3K0LA 4UVAA 3MCZA 2Z33A 2FNAA 4YIIA 2IA2A 2GIVA 2NRAC 5DYMA 2Z9OA 5D5VB 2QQ9A 2K4JA 2VE8A 1QGPA 1KQ0A 2HZTA 1YQAA 3V8JA 4RAYA 3V4GA 2W25A 2OD5A 5LHGA 3ABUA 5HDGA 4MGRA 3FXUA 1XSDA 1XDUA 1AWCA 4U7DA 4A0YA 4BAYA 5KVRA 5K1YA 2BE5F 2VBYA 5ICGA 3KP7A 1BOAA 3HUGA 3GX4X 2ZO4A 5L3DA 2A6HF 4IVNA 1EH6A 2WV0A 4GXOA 5ILUA 4ZYGA 2W24A 4UHTA 2MA3A 2QLZA 3WU1B 2YU3A 1B9NA 3ZMTA 1ZREA 1KQ8A 1B59A 1ZAOA 5H6QA 3T5XA 1HKTA 1TW3A 3R6SA 2VOOA 4I7HA 4ENJA 3WODF 2RDPA 3KE2A 5DD4A 1WQ2A 1IN6A 4KA4A 2JRTA 3U9GA 3NRVA 4ESJA 4O3MA 2P5LC 4HF2A 4UVBA 3O6BB 2ESNA 2F2EA 3FM3A 4L18B 4RGSA 3VB2A 1LDJA 4XSZF 5DUIA 2V6CA 4ENKA 3BJOA 3DF8A 2Y0MA 4JBAA 3IL2A 5CJ9A 1LEAA 1QZZA 5L3GA 4CXFA 2QVOA 1T39A 1C0WA 2FMYA 3W6JB 1V3FA 2MLKA 2CWEA 4XSXF 3LAJA 3E5XA 4GGGA 3IC7A 1QNTA 3WE3A 3C18A 1BM9A 3WTWC 2STTA 3ZN0A 4DQ2A 1U6GA 1R00A 5DCMB 4PDKA 2FU4A 2ZNZA 2K02A 2PEXA 5EEGA 5ICFA 4A5MA 1TNSA 4HBLA 1SFXA 2BEOA 3BP8A 3CUQC 4Q47A 1T6SA 2JTVA 4HLYA 2XIGA 3ZN1A 3WG9A 3WTSC 1R36A 2X0LA 2PFBA 3VFZA 2P4WA 2L54A 2DO7A 2J5OA 2LDUA 3B73A 1XGOA 4L5IA 2XAGA 1L3LA 3VODA 4EM2A 5L3CA 2FSWA 4S05A 4P96A 4ZYHA 4ZYDA 3BPVA 4G9YA 2P7CB 3EYIA 3JAMZ 1P2FA 4LLNA 2FE3A 2RVCA 2XKOA 4HAMA 3FXQA 3R0JA 3J81K 1DPRA 2P6TA 1AOYA 6PAXA 2ZJ2A 1YO5C 4BHPA 1RUNA 2FXAA 1KU7A 2XAHA 2OZUA 1U5TA 4DNCA 3RTRA 4OU0A 5JR3A 1O3RA 1MDMB 1FBQA 4OMZA 2K4BA 3P9KA 5IT9Z 1IRFA 1QZYA 3V7RA 3L9FA 1USTA 1XSVA 1HKSA 4RB3C 3J80Z 2P5VA 1U78A 1OYYA 4ETSA 3BJAA 2HFHA 2PN6A 1F1ZA 2Q0OA 1PUEE 3AAFA 2CO5A 4P9UA 2PQ8A 4HQEA 1ZRCA 2FA5A 1ON1A 2BV6A 5FFZA 2FEZA 1P4XA 1TQIA 3GZ6A 2VBXA 1XGSA 1O3QA 4LG0B 2LF8A 2COMA 3FZVA 3LAPA 2DQLA 3TKYA 1GXQA 3ELKA 1T0FA 4JQFA 4LMYA 3F23A 4F7ZA 4LGWA 1HW5A 1Q1HA 1GVJA 1BI1A 4AD9A 3GLXA 4HV5A 4Y15A 4RAZA 2RGVA 4RGUA 2QBYB 1MDMA 3KP4A 5HOOA 2DAOA 2HWVA 5AIQA 3WTUC 2DK8A 2XV4S 3L09A 5E8GA 2EB7A 4RGXA 4OIRF 4G6DA 4BQAA 1V4RA 2L4AA 1R58A 3L7WA 2NNYA 1PP8F 1QBJA 3WTTC 3K2ZA 3U1DA 2HR3A 4Q5SF 1OMIA 3ERED 1E2XA 2CFXA 4PGGA 3CO7C 4OIOF 2GZWA 3F8NA 5CYVA 1J2XA 3DEUA 3MEXA 2H27A 2EA4A 1FYKA 3LFKA 4Y13A 4NB5A 2XROA 5LEJA 2EFOA 3SZTA 3FXRA 4MTEA 1FNNA 3GFIA 1W7PA 5HDKA 3EUHA 3M8EA 4HF0A 3TDZC 2OAZA 1EH8A 1IAWA 1FT9A 3GXOA 2IPQX 1HKQA 5H20A 4HX4A 2DFIA 3BZ6A 1B9MA 1IXRC 1Z9CA 1REPC 2K86A 4EQQA 1KU9A 4WCGA 1SD7A 5CVRA 4IHTA 1XMAA 3MZHA 2QBYA 4L9NA 1IRGA 2X4HA 4KMFA 4FX0A 1R7JA 3TO9A 1ZRDA 1G3TA 4N9HA 1I6XA 1LB2A 2XUBA 3KP6A 5TRDA 3I59A 4IRHA 1ZHFA 4I01A 1TQPA 3B02A 2P6SA 4BNCA 2W57A 3KZZA 1FLIA 3BOQA 3Q9SA 3KEOA 3QP5A 4UUVA 3FMSA 3DQVC 1XDSA 2A68F 2A5YB 2NS0A 3D0SA 4CO8A 4M74A 2K27A 4IF4A 2HYFA 1MZBA 3GFLA 4L5JA 2KJCA 3HHHA 4BXUA 4GYGA 2DPDA 4EJTA 2YX4A 3PFIA 1D3YA 3K1PA 1ZGJA 4WXDA 2AXLA 3V7SA 1DP7P 1CGPA 2IA0A 3KLOA 3GW2A 3IWFA 1FC3A 4HLXA 4OOIA 2D2WA 5KK1A 1LDKB 3RPQA 2NNNA 1BI2A 5DDGA 4EMSA 5DV5A 4UVCA 3TO6A 4K2EA 1IW7F 3ZMDA 4LK1F 2VOPA 5AIPA 1RZ4A 2KIUA 3FMRA 3LA7A 3KCCA 1LQ1A 4CHUA 3T1BA 4M73A 1S29A 4XBFA 2F5EA 5LEKA 1IXCA 1HQCA 4EM0B 2O6GE 2DT5A 2QM3A 1SD6A 4D0PA 4CYDA 3BPXA 3F6VA 2EV5A 4N9IA 4KDPA 5E1XA 4NQWA 2L3DA 5A2QZ 5DEQA 1R22A 2EV6A 4WK8F 4A0XA 2MC3A 3H92A 2QUFA 3SHFA 2H6CA 1UB9A 3KP3A 3E6DA 2DBBA 1QQIA 4HOBA 3BJ6A 2V1XA 3LA2A 3GWZA 3TGNA 5E18F 5CVIA 3HSRA 2GQQA 3FHZA 3HOTA 4ASNA 1KU2A 3BY6A 5LHHA 4KIGA 3MZYA 1SD5A 1UFMA 4A6EA 1R23A 4XLNF 1MD0A 2PI0A 2KIFA 3MQ0A 2PMHA 3HHGA 2NAZA 1KA8A 3HRMA 1PP7U 1TTYA 1D8JA 1LEBA 3EYYA 1S7OA 1ZLJA 3I71A 4HA8A 3L2CA 4IRIA 2M87A 4L9VA 3V8KA 1RUOA 2RC4A 3QPHA 2DU9A 1UHWA 4BHCA 3FMQA 1FYLA 3E5QA 1TBXA 3GO5A 4EM1A 5K5QA 3N4MA 1G6NA 3JTHA 2VT2A 1XCVA 1J9IA 1H9TA 4ON0A 4WXHA 2D1HA 3CUQB 4KFCA 2FRHA 4KT5C 4EJWA 1FWZA 3BROA 3GZ5A 1FBSA 2EFNA 4RB1A 4I98B 3HRUA 2O61A 5HS8A 4YG2F 3DP7A 2YPRA 1XMKA 4G7OF 3WTVC 3IHUA 3RYPA 4WXCA 3F8BA 5FLXZ 1Y0UA 1HW1A 3CDHA 3JSOA 2EV0A 2XGXA 1B4AA 5JHUA 3F8CA 2M30A 5HS9A 1STZA 3Q9VA 2CSOA 2OU2A 4G7HF 1KGSA 3NEUA 1LJ9A 5D6FA 1WRJA 4FT8A 4LB5A 3H3ZA 2FQ3A 1F4KA 1U8RA 2QQBA 2RV8A 3JTGA 3FWEA 2O0YA 1J5YA 3ZMUA 4KN7X 3CUQA 5BPIA 3DPTA 5F64A 2DPUA 2Y48A 3GFMA 5D5WB 4BYYA 2STWA 1A04A 1FSEA 2M5WA 4A2UA 2EJRA 5LRRA 4L0ZB 5D5UB 4QLCU 3WGGA 3MAJA 3M1EA 2IP2A 5K5RA 2A69F 4GO1A 1ZG1A 4ZZDA 5IT9K 3I4PA 3ML6A 2M8EA 5DCMA 2WTEA 3V8LA 1P92A 4KMUX 4P9FA 2L02A 2VC1A 2A6EF 4ESBA 2E1CA 1BBYA 2QZ8A 2WWYA 5EEHA 1YS7A 5D8KB 1XSXA 3RKWA 5LGUA 3R0AA 4YFNF 1JXSA 4HX8A 1K6OA 3I64A 4GCVA 3BDDA 2XVCA 1G4DA 2KRFA 3RPUA 2UWMA 4RB0A 1LDDA 2IW5A 2BBYA 3T8TA 3KETA 2R3SA 4CICA 3LWFA 4PGHA 4MEXF 3DXJF 4YFXF 5HDNA 3VEPA 2O3FA 1FBUA 3ZP5A 3ECHA 2ELHA 1JHFA 5D6EA 2ZCWA 3KP2A 2HDCA 2YSRA 1SAXA 1FSHA 2E1NA 4XRFA 2XAQA 3SFZA 4OINF 3JW4A 1FP2A 2HYGD 1MJBA 3J81Z 3IWZA 2HEOA 3P9CA 1ODDA 2O03A 2JT1A 1BIBA 2OA4A 1K78B 2HKXA 4U88A 1J59A 3RIRA 3HTUA 4HZFA 2QWWA 1MJAA 4PCQA 1Z7UA 1D5VA 5JFRA 3I53A 5ICEA 2GXGA 1YG2A 2CG4A 4IRGA 5D4RA 5JVTA 3PQKA 1J0RA 3SXYA 3W6KB 2IRFG 5J8FA 3ZMSA 4IJAA 2MH9A 4M9XA 3TO7A 1LVAA 1FPQA 2GWRA 5HLHA 3IKVA 4U7BA 4H0EA 1J7KA 1W5SA 4M71A 2VBWA 1IUYA 1OPCA 3ZMZA 5LLQA 4MNUA 4O5VA 2EK5A 1MJ9A 2OQGA 5BPDA 4G6QA 1XB4A 3K1NA 5L3BA 3COAC 2FBHA 2CGPA 5F1RA 1BI0A 1IZ1A 4A5NA 5HLIA 1Z05A 1ON2A 3M8FA 4E70A 4U0YA 2ZFWA 1HW2A 2Y75A 5LGNA 1TLHB 1W5TA 2VODA 2LF7A 3LQRA 5ED4A 4U0WA 3WGIA 4R8HA 2ZNYA 4O6JA 4UV9A 1K78A 3E6BA 4LG0A 1BJAA 2BGCA 3E6MA 2XKPA 1IN7A 2MBFA 1FX7A 3TOAA 3DV8A 2FBKA 1R5HA 4EJOA 2CYYA 4LFUA 2G9WA 1XGNA 5JI6A 5E1WA 1G3WA 1QPMA 5CVVA 2IJLA 3P9IA 4MQVA 5L3EA 1VTNC 2A07F 3TDUC 1FYMA 4N0BA 5ILVA 3KEQA 2UXNA 5DCFA 4EGYA 3F3XA 3WGHA 5BS6A 2HTJA 2RQPA 2ZXJA 5HVQC 4P55A 2HQNA 4L0YB 5F6FA 4IPAA 5AONA 2OBPA 2FOKA 2JSCA 4UNOA 4A12A 1ULYA 3F72A 2M45A 5FGMA 3F6OA 1MGTA 3WE2A 5L3FA 1I5ZA 5H6RA 1ONVA 4RB2C 1J75A 1FP1D 4I09A 3RDIA 5K5OA 2CW0F 3GFJA 3WTZA 2P5KA 3C7JA 2PJPA 2PBIA 2KKOA 4AIHA 1ZG5A 1P4AA 3SQNA 1IN5A 3OV8A 3CO6C 2P7VB 1JHHA 3U2RA 4G94A 3OOPA 4FHTA 1BI3A 5HS7A 2E7WA 4BH9A 1RI7A 1SMYF 2XASA 3HSFA 3BWGA 2W85A 4KN4X 1IN4A 3K69A 3ZQ7A 4HW0A 1DDNA 4Q4ZF 1SD4A 2O8XA 2EFQA 4WWCA 1ZG3A 4MQ9F 1T38A 3CLOA 2KJBA 3E6CC 2XAFA 3HRTA 3MWMA 1QO0D 1WSUA 1XGMA 2M1BA 3G3ZA 3N97A 2RKHA 2A61A 3I5UA 1K79A 2BYVE 4A6DA 2WC2A 1CF7B 3F21A 2ACJA 4YFKF 2GAUA 4Q48A 2TDXA 3P7NA 1PDNC 3F8FA 1P6RA 2L01A 2MH2A 4M9ZA 2HOEA 1KYZA 2MLGA 4MTDA 1XCBA 2ESHA 2JPBA 1EV7A 1HSJA 5E17F 1FY7A 1G3SA 3ZMVA 2HKOA 3SZPA 3WTXC 4MHGA 2CQKA 4I02A 2FNPA 1IXSB 5E8IA 5BQTA 5FD6A 2GA1A 2VXZA 2Q2EA 2L4MA 2NYXA 2XRNA 3RJPA 2HTSA 3E3VA 2ZMEB 4JK1X 3ULQB 1Z6RA 1B6AA 1XD7A 3M7GA 1E17A 1CF7A 1IF1A 1Z91A 2HQRA 2FMLA 4M72A 2QYOA 3TOBA 1USSA 3C1DA 3DFGA 5FLXK 2ISYA 1RNLA 1SMTA 3F8MA 2ISZA 4LLLA 3RKYA 4WX9A 3HTSB 2VONA 3FX3A 1OYWA 2FF4A 4EJUA 3CJNA 5DUKA 1DPUA 2E7XA 1KYWA 2V1DA 3EQLF 2ADUA 5LGTA 5BOXA 4UXNA 5FFXA 3GEZA 4KICA 3WU0A 1BC8C 3O3KA 1R1UA 4HF1A 3DKWA 2LNBA 2V1UA 2UXXA 1DUXC 3QRFF 1O7FA 4GYIA 3EETA 4RS8A 2OZ6A 1I27A 1S8NA 5HLGA 5LRSA 2PMUA 1BIAA 3F22A 2ZMEA 4LLGF 3IKTA 3S2WA 2RN7A 1O57A 4Y17A 4EV0A 3MFKA 3HYIA 3GYHX 4OIPF 1D8KA 4A0ZA 5LHIA 4Z2YA 4YIFA 1S6LA 1S7AA 4HYEA 1XN7A 1TW2A 2DK5A 3HOSA 4ENNA 3JAMK 3D5LA 2C6YA 5D8LB 1H0MA 3IRQA 1U5TB 3L00A 1I1GA 1WWXA 1YW8A 3TQNA 1YFHA 4XLPF 1R1VA 3RI4A 1YW7A 2YX7A 2ZBKA 5ICCA 5ERIA 3KZYA 1OKRA 3HRSA 1JE8A 4G7ZF 4L9TA 2V79A 2D1VA 2DI3A 1YTYA 2RNJA 1SFEA 4ENMA 3CUOA 1S3JA 4IXAA 3J80K 3T8RA 1FZPB 1O3TA 1EH7A 4AWXB 1RIOH 1Z6TA 3RKXA 4P5OA 4AIKA 2VC0A 1U3EM 2W84A 1ZLKA 1W4MA 2DTRA 1U5TC 2HS5A 4HDUA 4IHSA 1X3UA 3C3WA 2IVMA 3KLNA 1YLFA 3R60A 1NHAA 1ZH5A 2JZYA 1K7AA 2Z3YA 3KFWX 2F5FA 4L9JA 2Q8KA 1P4WA 3H3UA 3I54A 3LQQA 2H09A 2H94A 3G73A 1LNWA 3ROUA 1ZYRF 4LB6B 2GXBA 1YYVA 5CLSA 3EDPA 2J5PA 4HX7A 2XAJA 2XHKA 3VOEA 4HV6A 3LSTA 2EA2A 5D4SA 2A3SA 3PQJA 5BMZA 1MKMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW9 A;  3GUD A;  4R79 A;  2DLL A;  2QEN A;  2PLY A;  3RYR A;  2LKP A;  2VBZ A;  1T2K A;  4I0A A;  2LSO A;  1W7P B;  3E5U A;  3V7C A;  2VE9 A;  4B09 A;  3ECO A;  4ZYE A;  2YR2 A;  1JGS A;  1WKM A;  2VT3 A;  2PG4 A;  2R7F A;  1R1T A;  5E20 A;  1R5G A;  1TQM A;  3GF2 A;  1ZAR A;  2K7L A;  4CZZ A;  5DD8 A;  3REO A;  2V9V A;  2OQR A;  2AS5 F;  3J7A O;  2VN2 A;  3Q5F A;  4KYW A;  1UCR A;  4EJV A;  1ZN2 A;  3NQO A;  2EFW A;  4ZH4 F;  2DW4 A;  3QOP A;  3I59 B;  1I1S A;  3M9A A;  1F9N A;  4G8X A;  4ESF A;  4M9S A;  1WI9 A;  4AIJ A;  5IT3 A;  3ABT A;  5ILS A;  4TV7 A;  4KIB A;  3HSE A;  1W7P D;  3ISP A;  3E97 A;  5J8C A;  5D5X B;  2EWN A;  3R61 A;  4QWQ A;  4ZZL A;  1O3S A;  1TNT A;  4AVP A;  1B1B A;  1G3Y A;  4OMY A;  5FB2 A;  1UHM A;  1KU3 A;  3K1M A;  3FM5 A;  1T98 A;  3K9T A;  1YS6 A;  3QU6 A;  1U2W A;  2F5D A;  4KNY A;  5LBQ A;  4OIQ F;  3I58 A;  3QU3 A;  2G7H A;  5J6X A;  1HBX G;  1HST A;  2G7U A;  2R7D A;  5CVJ A;  4EGZ A;  3I0T A;  1HXD A;  2IA1 A;  1KQ9 A;  2EFP A;  4PZJ A;  3O2P E;  5TJJ A;  4KIF A;  1ZRF A;  4R1H A;  1ZGA A;  2FBI A;  1OR7 A;  2IT0 A;  2GA2 A;  2ETH A;  4LJZ F;  5E1Z B;  3WTY C;  3FF5 A;  2P8T A;  4M6X A;  4U0V A;  1GHC A;  1F5T A;  4HQM A;  4I0B A;  3KP5 A;  2DQR A;  4NHJ A;  3CTA A;  5CVU A;  1GXP A;  4KUM A;  3QPT A;  3GVA A;  1YIO A;  4I2O A;  3DPL C;  1H9G A;  2QQA A;  4UV8 A;  3IRR A;  4M6Y A;  1BN5 A;  1O7L A;  2B0L A;  4LD5 A;  2Z5U A;  4MEY F;  2D45 A;  1FOK A;  2MD5 A;  5A2Q K;  3T0Y A;  4WF2 A;  2Z99 A;  4B8X A;  1OYI A;  3QP6 A;  3QAH A;  2JPC A;  4LK0 F;  3HIF A;  1IN8 A;  2UZK A;  1L0O C;  4EVI A;  4S04 A;  1Z1D A;  2KIM A;  4BHB A;  2HGC A;  4CGZ A;  4HDV A;  2F5C A;  3LA3 A;  4FX4 A;  1SFU A;  1BC7 C;  3ZPL A;  3JSP A;  5FO5 A;  2ZKZ A;  4CDG A;  2H6B A;  4RGR A;  3R4K A;  5FD5 A;  3K0L A;  4UVA A;  3MCZ A;  2Z33 A;  2FNA A;  4YII A;  2IA2 A;  2GIV A;  2NRA C;  5DYM A;  2Z9O A;  5D5V B;  2QQ9 A;  2K4J A;  2VE8 A;  1QGP A;  1KQ0 A;  2HZT A;  1YQA A;  3V8J A;  4RAY A;  3V4G A;  2W25 A;  2OD5 A;  5LHG A;  3ABU A;  5HDG A;  4MGR A;  3FXU A;  1XSD A;  1XDU A;  1AWC A;  4U7D A;  4A0Y A;  4BAY A;  5KVR A;  5K1Y A;  2BE5 F;  2VBY A;  5ICG A;  3KP7 A;  1BOA A;  3HUG A;  3GX4 X;  2ZO4 A;  5L3D A;  2A6H F;  4IVN A;  1EH6 A;  2WV0 A;  4GXO A;  5ILU A;  4ZYG A;  2W24 A;  4UHT A;  2MA3 A;  2QLZ A;  3WU1 B;  2YU3 A;  1B9N A;  3ZMT A;  1ZRE A;  1KQ8 A;  1B59 A;  1ZAO A;  5H6Q A;  3T5X A;  1HKT A;  1TW3 A;  3R6S A;  2VOO A;  4I7H A;  4ENJ A;  3WOD F;  2RDP A;  3KE2 A;  5DD4 A;  1WQ2 A;  1IN6 A;  4KA4 A;  2JRT A;  3U9G A;  3NRV A;  4ESJ A;  4O3M A;  2P5L C;  4HF2 A;  4UVB A;  3O6B B;  2ESN A;  2F2E A;  3FM3 A;  4L18 B;  4RGS A;  3VB2 A;  1LDJ A;  4XSZ F;  5DUI A;  2V6C A;  4ENK A;  3BJO A;  3DF8 A;  2Y0M A;  4JBA A;  3IL2 A;  5CJ9 A;  1LEA A;  1QZZ A;  5L3G A;  4CXF A;  2QVO A;  1T39 A;  1C0W A;  2FMY A;  3W6J B;  1V3F A;  2MLK A;  2CWE A;  4XSX F;  3LAJ A;  3E5X A;  4GGG A;  3IC7 A;  1QNT A;  3WE3 A;  3C18 A;  1BM9 A;  3WTW C;  2STT A;  3ZN0 A;  4DQ2 A;  1U6G A;  1R00 A;  5DCM B;  4PDK A;  2FU4 A;  2ZNZ A;  2K02 A;  2PEX A;  5EEG A;  5ICF A;  4A5M A;  1TNS A;  4HBL A;  1SFX A;  2BEO A;  3BP8 A;  3CUQ C;  4Q47 A;  1T6S A;  2JTV A;  4HLY A;  2XIG A;  3ZN1 A;  3WG9 A;  3WTS C;  1R36 A;  2X0L A;  2PFB A;  3VFZ A;  2P4W A;  2L54 A;  2DO7 A;  2J5O A;  2LDU A;  3B73 A;  1XGO A;  4L5I A;  2XAG A;  1L3L A;  3VOD A;  4EM2 A;  5L3C A;  2FSW A;  4S05 A;  4P96 A;  4ZYH A;  4ZYD A;  3BPV A;  4G9Y A;  2P7C B;  3EYI A;  3JAM Z;  1P2F A;  4LLN A;  2FE3 A;  2RVC A;  2XKO A;  4HAM A;  3FXQ A;  3R0J A;  3J81 K;  1DPR A;  2P6T A;  1AOY A;  6PAX A;  2ZJ2 A;  1YO5 C;  4BHP A;  1RUN A;  2FXA A;  1KU7 A;  2XAH A;  2OZU A;  1U5T A;  4DNC A;  3RTR A;  4OU0 A;  5JR3 A;  1O3R A;  1MDM B;  1FBQ A;  4OMZ A;  2K4B A;  3P9K A;  5IT9 Z;  1IRF A;  1QZY A;  3V7R A;  3L9F A;  1UST A;  1XSV A;  1HKS A;  4RB3 C;  3J80 Z;  2P5V A;  1U78 A;  1OYY A;  4ETS A;  3BJA A;  2HFH A;  2PN6 A;  1F1Z A;  2Q0O A;  1PUE E;  3AAF A;  2CO5 A;  4P9U A;  2PQ8 A;  4HQE A;  1ZRC A;  2FA5 A;  1ON1 A;  2BV6 A;  5FFZ A;  2FEZ A;  1P4X A;  1TQI A;  3GZ6 A;  2VBX A;  1XGS A;  1O3Q A;  4LG0 B;  2LF8 A;  2COM A;  3FZV A;  3LAP A;  2DQL A;  3TKY A;  1GXQ A;  3ELK A;  1T0F A;  4JQF A;  4LMY A;  3F23 A;  4F7Z A;  4LGW A;  1HW5 A;  1Q1H A;  1GVJ A;  1BI1 A;  4AD9 A;  3GLX A;  4HV5 A;  4Y15 A;  4RAZ A;  2RGV A;  4RGU A;  2QBY B;  1MDM A;  3KP4 A;  5HOO A;  2DAO A;  2HWV A;  5AIQ A;  3WTU C;  2DK8 A;  2XV4 S;  3L09 A;  5E8G A;  2EB7 A;  4RGX A;  4OIR F;  4G6D A;  4BQA A;  1V4R A;  2L4A A;  1R58 A;  3L7W A;  2NNY A;  1PP8 F;  1QBJ A;  3WTT C;  3K2Z A;  3U1D A;  2HR3 A;  4Q5S F;  1OMI A;  3ERE D;  1E2X A;  2CFX A;  4PGG A;  3CO7 C;  4OIO F;  2GZW A;  3F8N A;  5CYV A;  1J2X A;  3DEU A;  3MEX A;  2H27 A;  2EA4 A;  1FYK A;  3LFK A;  4Y13 A;  4NB5 A;  2XRO A;  5LEJ A;  2EFO A;  3SZT A;  3FXR A;  4MTE A;  1FNN A;  3GFI A;  1W7P A;  5HDK A;  3EUH A;  3M8E A;  4HF0 A;  3TDZ C;  2OAZ A;  1EH8 A;  1IAW A;  1FT9 A;  3GXO A;  2IPQ X;  1HKQ A;  5H20 A;  4HX4 A;  2DFI A;  3BZ6 A;  1B9M A;  1IXR C;  1Z9C A;  1REP C;  2K86 A;  4EQQ A;  1KU9 A;  4WCG A;  1SD7 A;  5CVR A;  4IHT A;  1XMA A;  3MZH A;  2QBY A;  4L9N A;  1IRG A;  2X4H A;  4KMF A;  4FX0 A;  1R7J A;  3TO9 A;  1ZRD A;  1G3T A;  4N9H A;  1I6X A;  1LB2 A;  2XUB A;  3KP6 A;  5TRD A;  3I59 A;  4IRH A;  1ZHF A;  4I01 A;  1TQP A;  3B02 A;  2P6S A;  4BNC A;  2W57 A;  3KZZ A;  1FLI A;  3BOQ A;  3Q9S A;  3KEO A;  3QP5 A;  4UUV A;  3FMS A;  3DQV C;  1XDS A;  2A68 F;  2A5Y B;  2NS0 A;  3D0S A;  4CO8 A;  4M74 A;  2K27 A;  4IF4 A;  2HYF A;  1MZB A;  3GFL A;  4L5J A;  2KJC A;  3HHH A;  4BXU A;  4GYG A;  2DPD A;  4EJT A;  2YX4 A;  3PFI A;  1D3Y A;  3K1P A;  1ZGJ A;  4WXD A;  2AXL A;  3V7S A;  1DP7 P;  1CGP A;  2IA0 A;  3KLO A;  3GW2 A;  3IWF A;  1FC3 A;  4HLX A;  4OOI A;  2D2W A;  5KK1 A;  1LDK B;  3RPQ A;  2NNN A;  1BI2 A;  5DDG A;  4EMS A;  5DV5 A;  4UVC A;  3TO6 A;  4K2E A;  1IW7 F;  3ZMD A;  4LK1 F;  2VOP A;  5AIP A;  1RZ4 A;  2KIU A;  3FMR A;  3LA7 A;  3KCC A;  1LQ1 A;  4CHU A;  3T1B A;  4M73 A;  1S29 A;  4XBF A;  2F5E A;  5LEK A;  1IXC A;  1HQC A;  4EM0 B;  2O6G E;  2DT5 A;  2QM3 A;  1SD6 A;  4D0P A;  4CYD A;  3BPX A;  3F6V A;  2EV5 A;  4N9I A;  4KDP A;  5E1X A;  4NQW A;  2L3D A;  5A2Q Z;  5DEQ A;  1R22 A;  2EV6 A;  4WK8 F;  4A0X A;  2MC3 A;  3H92 A;  2QUF A;  3SHF A;  2H6C A;  1UB9 A;  3KP3 A;  3E6D A;  2DBB A;  1QQI A;  4HOB A;  3BJ6 A;  2V1X A;  3LA2 A;  3GWZ A;  3TGN A;  5E18 F;  5CVI A;  3HSR A;  2GQQ A;  3FHZ A;  3HOT A;  4ASN A;  1KU2 A;  3BY6 A;  5LHH A;  4KIG A;  3MZY A;  1SD5 A;  1UFM A;  4A6E A;  1R23 A;  4XLN F;  1MD0 A;  2PI0 A;  2KIF A;  3MQ0 A;  2PMH A;  3HHG A;  2NAZ A;  1KA8 A;  3HRM A;  1PP7 U;  1TTY A;  1D8J A;  1LEB A;  3EYY A;  1S7O A;  1ZLJ A;  3I71 A;  4HA8 A;  3L2C A;  4IRI A;  2M87 A;  4L9V A;  3V8K A;  1RUO A;  2RC4 A;  3QPH A;  2DU9 A;  1UHW A;  4BHC A;  3FMQ A;  1FYL A;  3E5Q A;  1TBX A;  3GO5 A;  4EM1 A;  5K5Q A;  3N4M A;  1G6N A;  3JTH A;  2VT2 A;  1XCV A;  1J9I A;  1H9T A;  4ON0 A;  4WXH A;  2D1H A;  3CUQ B;  4KFC A;  2FRH A;  4KT5 C;  4EJW A;  1FWZ A;  3BRO A;  3GZ5 A;  1FBS A;  2EFN A;  4RB1 A;  4I98 B;  3HRU A;  2O61 A;  5HS8 A;  4YG2 F;  3DP7 A;  2YPR A;  1XMK A;  4G7O F;  3WTV C;  3IHU A;  3RYP A;  4WXC A;  3F8B A;  5FLX Z;  1Y0U A;  1HW1 A;  3CDH A;  3JSO A;  2EV0 A;  2XGX A;  1B4A A;  5JHU A;  3F8C A;  2M30 A;  5HS9 A;  1STZ A;  3Q9V A;  2CSO A;  2OU2 A;  4G7H F;  1KGS A;  3NEU A;  1LJ9 A;  5D6F A;  1WRJ A;  4FT8 A;  4LB5 A;  3H3Z A;  2FQ3 A;  1F4K A;  1U8R A;  2QQB A;  2RV8 A;  3JTG A;  3FWE A;  2O0Y A;  1J5Y A;  3ZMU A;  4KN7 X;  3CUQ A;  5BPI A;  3DPT A;  5F64 A;  2DPU A;  2Y48 A;  3GFM A;  5D5W B;  4BYY A;  2STW A;  1A04 A;  1FSE A;  2M5W A;  4A2U A;  2EJR A;  5LRR A;  4L0Z B;  5D5U B;  4QLC U;  3WGG A;  3MAJ A;  3M1E A;  2IP2 A;  5K5R A;  2A69 F;  4GO1 A;  1ZG1 A;  4ZZD A;  5IT9 K;  3I4P A;  3ML6 A;  2M8E A;  5DCM A;  2WTE A;  3V8L A;  1P92 A;  4KMU X;  4P9F A;  2L02 A;  2VC1 A;  2A6E F;  4ESB A;  2E1C A;  1BBY A;  2QZ8 A;  2WWY A;  5EEH A;  1YS7 A;  5D8K B;  1XSX A;  3RKW A;  5LGU A;  3R0A A;  4YFN F;  1JXS A;  4HX8 A;  1K6O A;  3I64 A;  4GCV A;  3BDD A;  2XVC A;  1G4D A;  2KRF A;  3RPU A;  2UWM A;  4RB0 A;  1LDD A;  2IW5 A;  2BBY A;  3T8T A;  3KET A;  2R3S A;  4CIC A;  3LWF A;  4PGH A;  4MEX F;  3DXJ F;  4YFX F;  5HDN A;  3VEP A;  2O3F A;  1FBU A;  3ZP5 A;  3ECH A;  2ELH A;  1JHF A;  5D6E A;  2ZCW A;  3KP2 A;  2HDC A;  2YSR A;  1SAX A;  1FSH A;  2E1N A;  4XRF A;  2XAQ A;  3SFZ A;  4OIN F;  3JW4 A;  1FP2 A;  2HYG D;  1MJB A;  3J81 Z;  3IWZ A;  2HEO A;  3P9C A;  1ODD A;  2O03 A;  2JT1 A;  1BIB A;  2OA4 A;  1K78 B;  2HKX A;  4U88 A;  1J59 A;  3RIR A;  3HTU A;  4HZF A;  2QWW A;  1MJA A;  4PCQ A;  1Z7U A;  1D5V A;  5JFR A;  3I53 A;  5ICE A;  2GXG A;  1YG2 A;  2CG4 A;  4IRG A;  5D4R A;  5JVT A;  3PQK A;  1J0R A;  3SXY A;  3W6K B;  2IRF G;  5J8F A;  3ZMS A;  4IJA A;  2MH9 A;  4M9X A;  3TO7 A;  1LVA A;  1FPQ A;  2GWR A;  5HLH A;  3IKV A;  4U7B A;  4H0E A;  1J7K A;  1W5S A;  4M71 A;  2VBW A;  1IUY A;  1OPC A;  3ZMZ A;  5LLQ A;  4MNU A;  4O5V A;  2EK5 A;  1MJ9 A;  2OQG A;  5BPD A;  4G6Q A;  1XB4 A;  3K1N A;  5L3B A;  3COA C;  2FBH A;  2CGP A;  5F1R A;  1BI0 A;  1IZ1 A;  4A5N A;  5HLI A;  1Z05 A;  1ON2 A;  3M8F A;  4E70 A;  4U0Y A;  2ZFW A;  1HW2 A;  2Y75 A;  5LGN A;  1TLH B;  1W5T A;  2VOD A;  2LF7 A;  3LQR A;  5ED4 A;  4U0W A;  3WGI A;  4R8H A;  2ZNY A;  4O6J A;  4UV9 A;  1K78 A;  3E6B A;  4LG0 A;  1BJA A;  2BGC A;  3E6M A;  2XKP A;  1IN7 A;  2MBF A;  1FX7 A;  3TOA A;  3DV8 A;  2FBK A;  1R5H A;  4EJO A;  2CYY A;  4LFU A;  2G9W A;  1XGN A;  5JI6 A;  5E1W A;  1G3W A;  1QPM A;  5CVV A;  2IJL A;  3P9I A;  4MQV A;  5L3E A;  1VTN C;  2A07 F;  3TDU C;  1FYM A;  4N0B A;  5ILV A;  3KEQ A;  2UXN A;  5DCF A;  4EGY A;  3F3X A;  3WGH A;  5BS6 A;  2HTJ A;  2RQP A;  2ZXJ A;  5HVQ C;  4P55 A;  2HQN A;  4L0Y B;  5F6F A;  4IPA A;  5AON A;  2OBP A;  2FOK A;  2JSC A;  4UNO A;  4A12 A;  1ULY A;  3F72 A;  2M45 A;  5FGM A;  3F6O A;  1MGT A;  3WE2 A;  5L3F A;  1I5Z A;  5H6R A;  1ONV A;  4RB2 C;  1J75 A;  1FP1 D;  4I09 A;  3RDI A;  5K5O A;  2CW0 F;  3GFJ A;  3WTZ A;  2P5K A;  3C7J A;  2PJP A;  2PBI A;  2KKO A;  4AIH A;  1ZG5 A;  1P4A A;  3SQN A;  1IN5 A;  3OV8 A;  3CO6 C;  2P7V B;  1JHH A;  3U2R A;  4G94 A;  3OOP A;  4FHT A;  1BI3 A;  5HS7 A;  2E7W A;  4BH9 A;  1RI7 A;  1SMY F;  2XAS A;  3HSF A;  3BWG A;  2W85 A;  4KN4 X;  1IN4 A;  3K69 A;  3ZQ7 A;  4HW0 A;  1DDN A;  4Q4Z F;  1SD4 A;  2O8X A;  2EFQ A;  4WWC A;  1ZG3 A;  4MQ9 F;  1T38 A;  3CLO A;  2KJB A;  3E6C C;  2XAF A;  3HRT A;  3MWM A;  1QO0 D;  1WSU A;  1XGM A;  2M1B A;  3G3Z A;  3N97 A;  2RKH A;  2A61 A;  3I5U A;  1K79 A;  2BYV E;  4A6D A;  2WC2 A;  1CF7 B;  3F21 A;  2ACJ A;  4YFK F;  2GAU A;  4Q48 A;  2TDX A;  3P7N A;  1PDN C;  3F8F A;  1P6R A;  2L01 A;  2MH2 A;  4M9Z A;  2HOE A;  1KYZ A;  2MLG A;  4MTD A;  1XCB A;  2ESH A;  2JPB A;  1EV7 A;  1HSJ A;  5E17 F;  1FY7 A;  1G3S A;  3ZMV A;  2HKO A;  3SZP A;  3WTX C;  4MHG A;  2CQK A;  4I02 A;  2FNP A;  1IXS B;  5E8I A;  5BQT A;  5FD6 A;  2GA1 A;  2VXZ A;  2Q2E A;  2L4M A;  2NYX A;  2XRN A;  3RJP A;  2HTS A;  3E3V A;  2ZME B;  4JK1 X;  3ULQ B;  1Z6R A;  1B6A A;  1XD7 A;  3M7G A;  1E17 A;  1CF7 A;  1IF1 A;  1Z91 A;  2HQR A;  2FML A;  4M72 A;  2QYO A;  3TOB A;  1USS A;  3C1D A;  3DFG A;  5FLX K;  2ISY A;  1RNL A;  1SMT A;  3F8M A;  2ISZ A;  4LLL A;  3RKY A;  4WX9 A;  3HTS B;  2VON A;  3FX3 A;  1OYW A;  2FF4 A;  4EJU A;  3CJN A;  5DUK A;  1DPU A;  2E7X A;  1KYW A;  2V1D A;  3EQL F;  2ADU A;  5LGT A;  5BOX A;  4UXN A;  5FFX A;  3GEZ A;  4KIC A;  3WU0 A;  1BC8 C;  3O3K A;  1R1U A;  4HF1 A;  3DKW A;  2LNB A;  2V1U A;  2UXX A;  1DUX C;  3QRF F;  1O7F A;  4GYI A;  3EET A;  4RS8 A;  2OZ6 A;  1I27 A;  1S8N A;  5HLG A;  5LRS A;  2PMU A;  1BIA A;  3F22 A;  2ZME A;  4LLG F;  3IKT A;  3S2W A;  2RN7 A;  1O57 A;  4Y17 A;  4EV0 A;  3MFK A;  3HYI A;  3GYH X;  4OIP F;  1D8K A;  4A0Z A;  5LHI A;  4Z2Y A;  4YIF A;  1S6L A;  1S7A A;  4HYE A;  1XN7 A;  1TW2 A;  2DK5 A;  3HOS A;  4ENN A;  3JAM K;  3D5L A;  2C6Y A;  5D8L B;  1H0M A;  3IRQ A;  1U5T B;  3L00 A;  1I1G A;  1WWX A;  1YW8 A;  3TQN A;  1YFH A;  4XLP F;  1R1V A;  3RI4 A;  1YW7 A;  2YX7 A;  2ZBK A;  5ICC A;  5ERI A;  3KZY A;  1OKR A;  3HRS A;  1JE8 A;  4G7Z F;  4L9T A;  2V79 A;  2D1V A;  2DI3 A;  1YTY A;  2RNJ A;  1SFE A;  4ENM A;  3CUO A;  1S3J A;  4IXA A;  3J80 K;  3T8R A;  1FZP B;  1O3T A;  1EH7 A;  4AWX B;  1RIO H;  1Z6T A;  3RKX A;  4P5O A;  4AIK A;  2VC0 A;  1U3E M;  2W84 A;  1ZLK A;  1W4M A;  2DTR A;  1U5T C;  2HS5 A;  4HDU A;  4IHS A;  1X3U A;  3C3W A;  2IVM A;  3KLN A;  1YLF A;  3R60 A;  1NHA A;  1ZH5 A;  2JZY A;  1K7A A;  2Z3Y A;  3KFW X;  2F5F A;  4L9J A;  2Q8K A;  1P4W A;  3H3U A;  3I54 A;  3LQQ A;  2H09 A;  2H94 A;  3G73 A;  1LNW A;  3ROU A;  1ZYR F;  4LB6 B;  2GXB A;  1YYV A;  5CLS A;  3EDP A;  2J5P A;  4HX7 A;  2XAJ A;  2XHK A;  3VOE A;  4HV6 A;  3LST A;  2EA2 A;  5D4S A;  2A3S A;  3PQJ A;  5BMZ A;  1MKM A; 
#chains in the Genus database with same CATH topology
 2MYS A;  1YW9 A;  3GUD A;  4XLF A;  1X4O A;  1JI8 A;  3KZI C;  1GLN A;  4YEL A;  2DLL A;  4R79 A;  3CCS I;  1RES A;  4S0H B;  2QEN A;  2PLY A;  3RYR A;  1MMS A;  2LKP A;  2VBZ A;  1T2K A;  2LTP A;  4I0A A;  4PJ0 C;  4DGW B;  2LSO A;  3KX2 A;  1T0F C;  1W7P B;  1T33 A;  2EQR A;  2W00 A;  3E5U A;  3AL0 C;  3V7C A;  2VE9 A;  4B09 A;  3ECO A;  3K7A J;  4ZYE A;  1H8A C;  2YR2 A;  1RPW A;  3CES A;  1JGS A;  4NC8 A;  1WKM A;  5CQG A;  2VT3 A;  2CUZ A;  4FCY A;  2PG4 A;  4BE2 A;  3LL7 A;  2R7F A;  1R1T A;  5E20 A;  3ZQG A;  1GUU A;  1R5G A;  3FKJ A;  3FBN B;  1TQM A;  2AQE A;  1D0Y A;  3GF2 A;  1ZAR A;  2K7L A;  4CZZ A;  5DD8 A;  3REO A;  2V9V A;  2OQR A;  3CJQ B;  1R6R A;  1IUF A;  2Z1D A;  2TRT A;  2AS5 F;  3J7A O;  2VN2 A;  1WJ5 A;  3Q5F A;  4KYW A;  4G6T B;  3H5R A;  2QSH X;  4BE1 A;  3MVP A;  3CMM A;  2LLK A;  2WY8 Q;  1A35 A;  4ITV A;  1ETK A;  1UCR A;  4EJV A;  3I3L A;  4D1Q A;  1ZN2 A;  2HNH A;  2JVH A;  4XL9 A;  3NQO A;  2EFW A;  4ZTF A;  3LSP A;  3HL2 A;  4ZH4 F;  1Q1V A;  4BY7 J;  1W36 C;  2AXT C;  2DW4 A;  3QOP A;  3I59 B;  1I1S A;  3VYR B;  3M9A A;  3AG3 H;  1F9N A;  2DT6 A;  2JVG A;  3LSG A;  4G8X A;  2BW3 A;  3S3N A;  2VJI A;  4ESF A;  3HDD A;  4M9S A;  1A6I A;  1WI9 A;  5GAE J;  3HB9 A;  5J1R A;  4AIJ A;  1ACI A;  3CCE I;  3NWT A;  3QPS A;  5IT3 A;  3ABT A;  5ILS A;  4TV7 A;  3K2A A;  2FQ4 A;  3AFH A;  3HSE A;  4KIB A;  4I99 C;  3ASO H;  1W7P D;  3EUH C;  3ISP A;  3E97 A;  5J8C A;  4CA0 A;  2R5Z A;  5D5X B;  2V26 A;  2JA6 J;  2EWN A;  2X1E A;  3R61 A;  3ZR8 X;  2EBI A;  4MFD A;  4QWQ A;  4ZZL A;  1O3S A;  1TNT A;  4AVP A;  2GM4 A;  1B1B A;  1G3Y A;  4OMY A;  5FB2 A;  1UHM A;  1YE9 A;  3AG4 H;  3FK7 A;  1KU3 A;  1CQT A;  1HDP A;  3K1M A;  3FM5 A;  1T98 A;  3K9T A;  1YS6 A;  3QU6 A;  1U2W A;  2F5D A;  4KNY A;  1VQ6 I;  5LBQ A;  2DA7 A;  2BY3 A;  3FXJ A;  4OIQ F;  3I58 A;  3SFI A;  3K4N A;  4BQQ A;  3QU3 A;  2G7H A;  1Z0X A;  5J6X A;  1HBX G;  3QYE A;  3OYA A;  1HST A;  2G7U A;  5IP7 J;  2R7D A;  5EJC A;  3KYL A;  1TWG J;  5CVJ A;  4EGZ A;  2F4I A;  1LPQ A;  3M4O J;  3W6V A;  2NS8 A;  3I0T A;  3LFU A;  2X85 A;  4A69 C;  4BJT A;  2R7Q A;  5GPA A;  1HXD A;  2IA1 A;  3Q3S A;  4AU7 A;  4BE0 A;  1KQ9 A;  2EFP A;  1APL C;  3KEY A;  4II3 A;  2HQA A;  3BC8 A;  4PZJ A;  2K5C A;  3O2P E;  2JK3 A;  3QPL A;  5TJJ A;  1BW5 A;  3BR0 A;  4KIF A;  1ZRF A;  4R1H A;  1ZGA A;  2FBI A;  1PUF B;  3VWB A;  3S15 J;  5M5W J;  1OR7 A;  1IJW C;  5DM7 F;  3A01 A;  3HOV J;  1YJN I;  2X6W A;  3DBL B;  2IT0 A;  2CW7 A;  2GA2 A;  3ZOB A;  1KZH A;  2ETH A;  4PJL A;  4XIC A;  3ESW B;  2K9S A;  4LJZ F;  5E1Z B;  3WTY C;  2E1M C;  2DDA A;  1D0X A;  3K6G A;  3FF5 A;  1AKH A;  3GTM J;  2P8T A;  4C3J J;  2VXD A;  3OL3 A;  2CW8 A;  4M6X A;  2MG4 A;  2DOA A;  2VKD A;  4U0V A;  1GHC A;  3H3V K;  1K6Y A;  1F5T A;  4HQM A;  2NS7 A;  4I0B A;  1TZL A;  3KP5 A;  2DQR A;  2O8K A;  4NHJ A;  3CTA A;  5CVU A;  4QPQ A;  1GXP A;  5EG0 A;  1ZGW A;  1AU7 A;  3GTQ J;  3SYT A;  1U9O A;  1MBH A;  4KUM A;  3QPT A;  3GVA A;  4PUS A;  1YIO A;  4I2O A;  3G1O A;  3DPL C;  1H9G A;  1LFP A;  2QQA A;  1RR7 A;  4UV8 A;  5F27 A;  3IRR A;  2R0Q C;  3K4L A;  4M6Y A;  1BN5 A;  1O7L A;  2B0L A;  3A0H C;  3HEF A;  4LD5 A;  4NDL A;  3CME I;  2Z5U A;  4MEY F;  2D45 A;  1FOK A;  3VSL A;  2MD5 A;  3ERM A;  3T0Y A;  5A2Q K;  4WF2 A;  3J7A Y;  2Z99 A;  3BTC A;  1QVU A;  4B8X A;  1OYI A;  1ZTR A;  4BGD A;  3QP6 A;  4AC0 A;  3RQ4 A;  3HUG B;  3DTE A;  3QAH A;  4HNT A;  2JPC A;  4DBQ A;  1Y6I A;  4AM3 A;  3H0G J;  4LK0 F;  2XSD C;  3HIF A;  4XKC A;  1IN8 A;  4RAF A;  2UZK A;  3KPH A;  3GLL A;  1L0O C;  4EVI A;  4S04 A;  2BHY A;  1Z1D A;  2KIM A;  2X51 A;  4BHB A;  2HGC A;  4CGZ A;  4HDV A;  2F5C A;  1LFB A;  3GTO J;  2LMD A;  2EPF A;  3LA3 A;  4FX4 A;  1SFU A;  1OCZ H;  1BC7 C;  4MFE A;  3HOX J;  2XPU A;  3OS0 A;  3ZPL A;  3JSP A;  5FO5 A;  2ZKZ A;  2LY9 A;  2ZXH A;  4CDG A;  2H6B A;  4RGR A;  2NVQ J;  3R4K A;  2DMU A;  4BDY A;  5FD5 A;  3K0L A;  3FHN A;  3MCZ A;  4UVA A;  2FNA A;  2Z33 A;  4YII A;  2IA2 A;  2QSG X;  2GIV A;  2NRA C;  1XG1 A;  2KQR A;  5FKL A;  5DYM A;  2LFB A;  2Z9O A;  5D5V B;  2QQ9 A;  3UNG C;  4AVZ A;  2K4J A;  2X48 A;  3BQY A;  4DYC A;  2A5W A;  2VE8 A;  3ASN H;  5GPC A;  1QGP A;  1KQ0 A;  2HZT A;  4IO9 F;  2PJR B;  3CLQ A;  1YQA A;  3V8J A;  2DXI A;  4RAY A;  4E7K A;  3V4G A;  2W25 A;  2OD5 A;  5LHG A;  3ABU A;  5HDG A;  3DTK A;  4MGR A;  3FXU A;  1XSD A;  1MBG A;  1XDU A;  4A3C J;  2IGN A;  1AWC A;  1X1B A;  1TWH J;  5GAD J;  2VQG A;  4U7D A;  4A0Y A;  1A6Q A;  2LD5 A;  1IG7 A;  4BAY A;  5KVR A;  5K1Y A;  2R7R A;  2BE5 F;  2HYJ A;  2VBY A;  2QA4 I;  5IYB J;  2M4K A;  5EEA A;  2MD0 A;  5ICG A;  5J40 A;  1B8I B;  5GTI C;  3KP7 A;  1BOA A;  3HUG A;  4C2M J;  3GX4 X;  2ZO4 A;  5L3D A;  2F5V A;  2A6H F;  4IVN A;  1GV5 A;  1EH6 A;  2BZT A;  2WV0 A;  3HGY A;  4E7H A;  4GXO A;  3JRE A;  4FE7 A;  5ILU A;  4ZYG A;  2W24 A;  1UZC A;  1TT5 B;  4UHT A;  2MA3 A;  4XOP A;  1W1W E;  2QLZ A;  3BR2 A;  3WU1 B;  4HNV A;  2LOO A;  2LP0 A;  2HDW A;  5DM6 F;  2YU3 A;  1B9N A;  3ZMT A;  1ZRE A;  1KQ8 A;  1B59 A;  1ZAO A;  3OYN A;  2DMN A;  3FK6 A;  5IYD J;  3ABM H;  3S1N J;  5H6Q A;  1RC9 A;  3PUB A;  2XF6 A;  2YU9 J;  2CH0 A;  2VKH A;  3BZK A;  3T5X A;  2R7S A;  1YI2 I;  1HKT A;  1TW3 A;  3R6S A;  2VOO A;  4I7H A;  4ENJ A;  2E2H J;  1Y8R B;  3WOD F;  1AHD P;  4PJN A;  4BKX A;  1HCR A;  2RDP A;  5DTD A;  3KE2 A;  1SAN A;  5DD4 A;  1BL0 A;  1IV8 A;  1YRN A;  1Y1W J;  3LMM A;  4YEJ A;  1WQ2 A;  1Y8Q B;  3QYB A;  3CCR I;  3JRC A;  1IN6 A;  2DTZ A;  4KA4 A;  2JRT A;  3U9G A;  2A05 A;  3NRV A;  4DJA A;  4ESJ A;  4LIT A;  5IOY A;  4O3M A;  1ERD A;  3EUA A;  4BY1 J;  2P5L C;  4HF2 A;  3K4C A;  4UVB A;  2ZXW H;  3ZQH A;  3FXK A;  1Z21 A;  4A3G J;  4IHX A;  3O6B B;  5F1J A;  2ESN A;  2F2E A;  2M8G X;  3FM3 A;  5B1B H;  4L18 B;  4RGS A;  3VB2 A;  1LDJ A;  3GTP J;  4XSZ F;  5DUI A;  2V6C A;  3OYE A;  4ENK A;  3BJO A;  2DMP A;  3DF8 A;  1MBE A;  2Y0M A;  3C2B A;  1FOX A;  4JBA A;  3V42 A;  3IL2 A;  5CJ9 A;  1LEA A;  4ZTJ A;  2GXA A;  1QZZ A;  5L3G A;  4CXF A;  2QVO A;  1T39 A;  1N78 A;  1C0W A;  3OYI A;  1GDT A;  1B8I A;  3J7Z I;  2FMY A;  3W6J B;  1RR8 C;  2DJI A;  2L7M P;  4XM3 A;  4E4H A;  1V3F A;  2HOS A;  1Z77 A;  2MLK A;  2CWE A;  4XSX F;  4DYR A;  1ZEL A;  2UV1 A;  3HG9 A;  3JRG A;  3LAJ A;  2CV1 A;  1MNM C;  3M8J A;  3SDG A;  2HVQ A;  1MH4 A;  3E5X A;  1KON A;  4BQO A;  4GGG A;  1Y56 A;  3IC7 A;  3LSI A;  1QNT A;  1N25 A;  2E60 A;  3WE3 A;  3RZO J;  3C18 A;  1BM9 A;  2MW8 A;  2JRM A;  3WTW C;  3ONQ A;  2STT A;  1YX5 A;  3ZN0 A;  5B1A H;  2KLO A;  4DQ2 A;  1U6G A;  1X58 A;  2KDO A;  2ECB A;  1R00 A;  5DCM B;  4PDK A;  4XRS A;  4C2T A;  4E7I A;  2FU4 A;  2LKS A;  2ZNZ A;  2K02 A;  2PEX A;  1T08 B;  2DFF A;  3QYF A;  4JX4 A;  5EEG A;  5ICF A;  2Z2S B;  3OYF A;  4A3J J;  3ZQF A;  4A5M A;  1TNS A;  1SFX A;  4HBL A;  2BEO A;  2IS1 A;  3BP8 A;  2CQQ A;  3CUQ C;  4Q47 A;  1VF9 A;  1T6S A;  2IXS A;  3CCU I;  3BTI A;  2X6O A;  2JTV A;  4HLY A;  4XRM A;  2VB6 A;  2XIG A;  2WAD A;  3ZN1 A;  2IS4 A;  3WG9 A;  3WTS C;  1R36 A;  1YIT I;  2LBF A;  4II2 A;  2K9N A;  2X0L A;  2PFB A;  4RM2 A;  1M1E B;  4BXX J;  3VFZ A;  2P4W A;  4DZP A;  4BJ6 C;  4PFP A;  1QU3 A;  2L54 A;  1I50 J;  2DO7 A;  2J5O A;  1VQO I;  2LDU A;  3B73 A;  2ZSI B;  4M3F A;  2F4O B;  2DMT A;  1XGO A;  4L5I A;  3BCA A;  4BQN A;  2E5N A;  2XAG A;  4BBR J;  1L3L A;  2I10 A;  1E3O C;  3VOD A;  4HST A;  5F04 A;  2H1K A;  1POG A;  1S5L C;  4DBR A;  3JR9 A;  2HZD A;  4EM2 A;  5L3C A;  2FSW A;  3ZQL A;  4S05 A;  4HRI A;  4P96 A;  2E34 A;  1RRJ A;  1ETO A;  2F6C A;  4ZYH A;  2Y30 A;  4AYB A;  4ZYD A;  1WVR A;  1UJ8 A;  2OPT A;  3BPV A;  3OOU A;  4G9Y A;  3VYS B;  2ID3 A;  2P7C B;  4I6Z A;  3EYI A;  3IH2 A;  3UKG A;  3JAM Z;  1P2F A;  4LLN A;  5JHF A;  5IY5 H;  1XMX A;  2FE3 A;  2X6X A;  2RVC A;  3CJT B;  2R5Y B;  1PVE A;  1A5J A;  2XKO A;  4HAM A;  4IZZ A;  1ETW A;  3FXQ A;  3R0J A;  4PSX A;  3J81 K;  1E0E A;  1DPR A;  2P6T A;  1AOY A;  2XF5 A;  2ZJ2 A;  6PAX A;  2DOE A;  2CQ7 A;  3TL4 X;  1YO5 C;  4BHP A;  3WHB A;  4GFB A;  1UMQ A;  1RUN A;  2FXA A;  3H36 A;  1DU0 A;  5C4J J;  1KU7 A;  2XAH A;  1H88 C;  1EJ9 A;  3CC4 I;  3OL4 A;  2OZU A;  1U5T A;  4DNC A;  3RTR A;  4BXF A;  4OU0 A;  5JR3 A;  3HPG A;  3PSF A;  1O3R A;  3K4M A;  1MDM B;  1FBQ A;  2R7W A;  4OMZ A;  1MBJ A;  1XX5 A;  2K4B A;  3P9K A;  2HVR A;  5IT9 Z;  2R4G A;  1UAA A;  1IRF A;  1QZY A;  1MMD A;  3W3C A;  2COB A;  4PFO A;  3V7R A;  3L9F A;  3RSN A;  1UST A;  1XSV A;  1HKS A;  2XSJ C;  5CQE A;  4FAS D;  4RB3 C;  4UUS B;  3JRH A;  3BG5 A;  3J80 Z;  2P5V A;  1U78 A;  1OYY A;  1IDY A;  4ETS A;  4ZJZ A;  1JJ6 C;  4FIS A;  3BJA A;  2HFH A;  3ZXS A;  1LE8 B;  2PN6 A;  2BY0 A;  1TWC J;  4W97 A;  1F1Z A;  2B7E A;  3OYH A;  1ZKG A;  2Q0O A;  1PUE E;  3ZQI A;  5FKO A;  3IAS 2;  4XQF A;  3AAF A;  4HNU A;  2CO5 A;  4P9U A;  1R4N B;  2I8D A;  2PQ8 A;  4KT6 A;  5BNG A;  3S14 J;  3S2H J;  4XOR A;  3IAM 2;  4HQE A;  1ZRC A;  4A93 J;  2FA5 A;  1ON1 A;  2BV6 A;  1EF4 A;  1JKQ C;  5FFZ A;  2KL4 A;  2XRL A;  2FEZ A;  1P4X A;  1LKX A;  1TQI A;  3GZ6 A;  1PYV A;  2VBX A;  1XGS A;  4QSH A;  1O3Q A;  2WA0 A;  4LG0 B;  1WI3 A;  4IEJ A;  4AID A;  1DQU A;  1E3P A;  2R5Y A;  3EPZ A;  1G8X A;  2LF8 A;  2VJJ A;  1X3Z B;  2COM A;  3FZV A;  4ZDL A;  3LAP A;  3S1Q J;  2DQL A;  3BG9 A;  3TKY A;  2HDD A;  1GXQ A;  4JYK A;  3ELK A;  1T0F A;  4JQF A;  4LMY A;  3F23 A;  4F7Z A;  3IH3 A;  2NVX J;  1MNE A;  4LGW A;  1HW5 A;  1ENH A;  1Q1H A;  1X19 A;  1GVJ A;  1BI1 A;  5JLW A;  2EIM H;  4AD9 A;  3GLX A;  4FTH A;  4HV5 A;  4Y15 A;  9ANT A;  4RAZ A;  2RGV A;  4RGU A;  2QBY B;  3S1M J;  1MDM A;  2MFZ A;  3KP4 A;  4B47 A;  5HOO A;  4MO7 A;  1GT0 C;  2VKV A;  2PMZ N;  2DAO A;  4OAZ A;  3PIP F;  1DGR M;  2HWV A;  4CYC A;  5AIQ A;  3WTU C;  2VPR A;  1J09 A;  2DK8 A;  3DPU A;  2XV4 S;  1DU6 A;  3L09 A;  5E8G A;  2XF7 A;  2EB7 A;  4RGX A;  4OIR F;  3CZ6 A;  4D5F A;  4G6D A;  4BQA A;  1TT0 A;  5FLM J;  1W36 D;  1V4R A;  3OR1 C;  1WPK A;  2L4A A;  1R49 A;  3HKZ N;  1R58 A;  4DYQ A;  3L7W A;  4XKV A;  3TW6 A;  2QSF X;  2NNY A;  4BUP A;  1PP8 F;  1QBJ A;  3ZQQ A;  3K2Z A;  3U1D A;  3WTT C;  2HR3 A;  4Q5S F;  1OMI A;  3ERE D;  1E2X A;  2CFX A;  4PGG A;  2ECC A;  1Z67 A;  3CO7 C;  4L5E A;  3G6E I;  3I56 I;  4OIO F;  3MD2 A;  4JOM A;  2GZW A;  3F8N A;  5CYV A;  1J2X A;  3DEU A;  3MEX A;  2H27 A;  4F92 B;  2EA4 A;  1QHH D;  3CDL A;  3BR3 A;  3A02 A;  1FYK A;  3LFK A;  1ZR4 A;  3FDY A;  4Y13 A;  4IL6 C;  4NB5 A;  2ZB9 A;  1WHU A;  2XRO A;  2W82 A;  5LEJ A;  2EFO A;  5EF6 A;  2QF7 A;  2RRE A;  3SZT A;  2E1M B;  3FXR A;  5TIS C;  1FNN A;  4MTE A;  3GFI A;  1W7P A;  3HOZ J;  1RKT A;  1OCO H;  5HDK A;  3EUH A;  1WJE A;  5FRN A;  2Y69 H;  4PJM A;  3M8E A;  4HF0 A;  2FD5 A;  3BG6 A;  3TDZ C;  3LSJ A;  2OAZ A;  1EH8 A;  1IAW A;  5HNH A;  2V1N A;  2R7Z J;  1FT9 A;  3GXO A;  4HEA 2;  2IPQ X;  3E7L A;  1HKQ A;  2DCE A;  2CQN A;  5H20 A;  4NC6 A;  2IS2 A;  4HX4 A;  4RMN A;  2Y9Z A;  2DFI A;  3BZ6 A;  4B1R A;  2MC4 A;  1A36 A;  4HPQ A;  3ZRG A;  1B9M A;  1IXR C;  3CJR B;  5FKM A;  5J1U A;  1Z9C A;  1REP C;  2K86 A;  4EQQ A;  1KU9 A;  4WCG A;  3U1K A;  1SD7 A;  5CVR A;  4IHT A;  4YIR X;  1XMA A;  3MZH A;  2QBY A;  2X1D A;  4L9N A;  1IRG A;  2X4H A;  4X6A J;  3G4S I;  4KMF A;  4FX0 A;  1R7J A;  3TO9 A;  1RET A;  1ZRD A;  1G3T A;  5B3S H;  4N9H A;  1VQK I;  3HOY J;  3PO3 J;  1I6X A;  4M3B A;  1MBK A;  2W4S A;  1LB2 A;  3BTJ A;  1HLV A;  2XUB A;  3KP6 A;  5TRD A;  3I59 A;  4JX5 A;  3ABL H;  1FIA A;  4IRH A;  3GZN B;  2CRG A;  2P81 A;  1ZHF A;  4I01 A;  2VPL A;  1TQP A;  3B02 A;  2JA8 J;  2XAU A;  2P6S A;  1IV6 A;  1G59 A;  3S16 J;  3MKW B;  4BNC A;  5DS9 A;  2W57 A;  2XB5 A;  5K7F A;  4M6V A;  4RAG A;  3KZZ A;  1FLI A;  3BOQ A;  3VYT B;  2ZC2 A;  3Q9S A;  3SJM A;  2F48 A;  3HPH A;  1YJ9 I;  3KEO A;  2Y31 A;  3QP5 A;  4A3M J;  4UUV A;  3FMS A;  4X1E A;  3DQV C;  4C3H J;  4DIQ A;  5C3E J;  4BBS J;  4HSR A;  3EUK L;  1R5I D;  5B66 C;  1XDS A;  2A68 F;  2A5Y B;  2NS0 A;  4XLA A;  3D0S A;  4CO8 A;  4M74 A;  2K27 A;  4IF4 A;  5FLV A;  3BLY A;  3UR3 C;  1FJL A;  3HJE A;  3O8G A;  2HYF A;  3K4B A;  1WJB A;  2V7F A;  1MZB A;  3GFL A;  4L5J A;  2KJC A;  3HHH A;  3FIS A;  4CCJ A;  4NQW B;  4BXU A;  2LG4 A;  4GYG A;  2R93 J;  2DPD A;  4EJT A;  2YX4 A;  3PFI A;  1NH3 A;  2JMW A;  1NG7 A;  1D3Y A;  3KYC B;  3A1Y A;  3G2B A;  3K1P A;  2WV1 A;  2FUG 2;  1V55 H;  3BG7 A;  1ZGJ A;  4WXD A;  2AXL A;  1QZE A;  3V7S A;  1DP7 P;  1CGP A;  2IA0 A;  3KLO A;  3GW2 A;  3IWF A;  3QOD A;  1FC3 A;  4DW6 A;  4HLX A;  4OOI A;  2D2W A;  5KK1 A;  1LDK B;  1R71 A;  3K4J A;  5KCM A;  1SAU A;  2NNN A;  3RPQ A;  1OFC X;  1BI2 A;  2HU9 A;  2V9P A;  5DDG A;  1IRZ A;  3IUO A;  1P7J A;  2EIL H;  3HBL A;  4EMS A;  1LVK A;  5DV5 A;  2QCO A;  2Y0S A;  4UVC A;  1EKE A;  1D1B A;  2L9S A;  1IC8 A;  3JRB A;  3TO6 A;  2XPW A;  4K2E A;  1IW7 F;  3DWL E;  5F0H A;  5HLT A;  1RKW A;  3Q0V A;  2V4J C;  2JSP A;  4LK1 F;  3ZMD A;  5GAH J;  4D7N A;  2VOP A;  5HNF A;  1PUF A;  5AIP A;  1RZ4 A;  2KIU A;  3FMR A;  3L2V A;  3LA7 A;  4BL0 B;  2HVS A;  2Q1Z B;  3KCC A;  1I3Q J;  2ME6 A;  1LQ1 A;  4B43 A;  1IRX A;  4CHU A;  3T1B A;  4M73 A;  1S29 A;  3GTJ J;  3G1M A;  1DGW Y;  3FXM A;  2L9R A;  4XBF A;  2Q2E B;  3OYC A;  3DU6 A;  3H9G A;  4UB6 C;  2F5E A;  2E5Z A;  5LEK A;  4QIW N;  1IXC A;  1HQC A;  3PJR A;  1OJL A;  3TP0 A;  3MZ8 A;  3PFY A;  1T56 A;  4EM0 B;  2Y0S N;  3CCL I;  2O6G E;  1IO2 A;  3L1P A;  3I4N J;  2DT5 A;  2QM3 A;  1SD6 A;  4CZC A;  4D0P A;  3DLL F;  4CYD A;  4BJ5 C;  3BPX A;  2FX0 A;  3F6V A;  4QTR A;  4ZDO A;  2KMU A;  2EV5 A;  3DBR B;  5EGO B;  1JKO C;  4N9I A;  4KDP A;  2OF7 A;  5E1X A;  2CUE A;  1MMN A;  1W0U A;  4NQW A;  2CV0 A;  4RLQ A;  2L3D A;  5KAI C;  3J7Y J;  5A2Q Z;  5DEQ A;  1R22 A;  5M3F J;  2W1O A;  2EV6 A;  4WK8 F;  2JQ7 A;  2DA2 A;  2MSY A;  1MMG A;  3MKL A;  2LH9 A;  1N75 A;  2MC3 A;  3H92 A;  1X2N A;  4A0X A;  4JP0 A;  2QUF A;  4KIS A;  3SHF A;  2H6C A;  1UB9 A;  2HI3 A;  3KP3 A;  3E6D A;  2DBB A;  1QQI A;  5CKT A;  1WJD A;  3DBH B;  4EEF G;  3BQZ A;  3OR2 C;  4HOB A;  3BJ6 A;  2V1X A;  3LA2 A;  3GWZ A;  4B3A A;  2L7K A;  2WBM A;  3JRF A;  4J19 A;  1P9Q C;  4MIM A;  3TGN A;  5E18 F;  5CVI A;  3HSR A;  2GQQ A;  3FHZ A;  1NTC A;  5FKN A;  3HOT A;  2KRC A;  4ASN A;  2M9H A;  3E0J B;  1KU2 A;  3MN2 A;  3BY6 A;  5LHH A;  2OC6 A;  2HPM A;  4KIG A;  3MZY A;  1SD5 A;  1B72 B;  1OCP A;  1UFM A;  2K3F A;  4A6E A;  5J4V A;  4D9J A;  1R23 A;  4XLN F;  3CF5 F;  1MD0 A;  1SVM A;  2PI0 A;  2KIF A;  4J00 A;  3MQ0 A;  2VUM J;  1K61 A;  2PMH A;  3BR1 A;  3HHG A;  2NAZ A;  1KA8 A;  3HRM A;  1PP7 U;  1TTY A;  1D8J A;  1YOV B;  1LEB A;  3EYY A;  3JRD A;  4XMY A;  1S7O A;  1ZLJ A;  3I71 A;  2M7A A;  4HA8 A;  1WFX A;  3W2W A;  3L2C A;  3OY9 A;  4IRI A;  2M87 A;  4L9V A;  2MGQ A;  3TP3 A;  3V8K A;  1RUO A;  1VQ9 I;  3D5S C;  2RC4 A;  3QPH A;  1H89 C;  2DU9 A;  1V5G A;  3PSI A;  1WZ2 A;  1UHW A;  1K4T A;  1LFU P;  4BHC A;  1BA5 A;  1JTY A;  3FMQ A;  1FYL A;  2M3A A;  3OS2 A;  2PJR A;  3E5Q A;  1TBX A;  3GO5 A;  3FIW A;  5IOZ A;  4EM1 A;  5K5Q A;  4E7Z A;  2H8R A;  3LSH A;  3N4M A;  1G6N A;  3JTH A;  4ZYA A;  3CD6 I;  1P7I A;  2VT2 A;  1XCV A;  2DDB A;  2L5Q A;  2E2I J;  1J9I A;  1H9T A;  3BTL A;  1BOB A;  2E71 A;  4ON0 A;  4FET A;  2IGM A;  4WXH A;  2D1H A;  3H9J A;  3S32 A;  1VFC A;  3CUQ B;  4KFC A;  2FRH A;  1SVO A;  3OWT A;  4KT5 C;  4EJW A;  2LK2 A;  3K70 C;  3GME A;  2KDZ A;  1FWZ A;  3K70 D;  1FEX A;  3L2W A;  2KZG A;  3BRO A;  3GZ5 A;  1FBS A;  2EFN A;  3A2K A;  4RB1 A;  3W2V A;  4NUB A;  3RKQ A;  3TMO A;  4C2U A;  4I98 B;  3HRU A;  2EZL A;  2O61 A;  5HS8 A;  4YG2 F;  3L2U A;  2V9K A;  1Z7L A;  3DP7 A;  2DFH A;  2YPR A;  1XMK A;  4G7O F;  2CJJ A;  3WTV C;  2M0C A;  3IHU A;  3RYP A;  3DKY A;  2ZME C;  4CH7 A;  2LRE A;  4WXC A;  3FKI J;  5EYR A;  1QPI A;  3F8B A;  5FLX Z;  4U87 A;  4XOT A;  4A3E J;  1Y0U A;  4MLO A;  1HW1 A;  3ZCO A;  5M3M J;  3CDH A;  1UG2 A;  3JSO A;  2EV0 A;  2XGX A;  2VQC A;  1B4A A;  2DA3 A;  1U9N A;  2BY1 A;  4XRS G;  2L0K A;  2DA1 A;  4XON A;  4V19 K;  5JHU A;  2F4M B;  5M5Y J;  3F8C A;  2M30 A;  1BW6 A;  1QVT A;  4B3X A;  2QKM B;  5HS9 A;  1STZ A;  3S17 J;  4X0G A;  3Q9V A;  5E3M A;  2CSO A;  2OU2 A;  3H5N A;  4G7H F;  1KGS A;  2N8G A;  4BS9 A;  3NEU A;  2MAB A;  3PO2 J;  1IDZ A;  1LJ9 A;  5D6F A;  4CCN A;  1NK2 P;  1WRJ A;  2WY7 Q;  2KIQ A;  4FT8 A;  4LB5 A;  1GVD A;  3MMY B;  3PM1 A;  5EDN A;  2WAF A;  3H3Z A;  5GAG J;  2EH3 A;  2HOT A;  2VL8 A;  2FQ3 A;  1F4K A;  1U8R A;  2JWT A;  2QQB A;  3S8P A;  2RV8 A;  2AQF A;  1VI0 A;  3JTG A;  3FWE A;  2KPM A;  2O0Y A;  1JKR C;  1J5Y A;  3ZMU A;  2X6Y A;  4BEH B;  4KN7 X;  3CUQ A;  5BPI A;  3D5R C;  4A3D J;  3DPT A;  1HOM A;  5F64 A;  2YS9 A;  2DPU A;  5LFA A;  1A31 A;  2WAQ N;  2Y48 A;  1SC7 A;  4Y3O A;  3GFM A;  5KAF C;  5D5W B;  1E3H A;  2CV2 A;  2BVM A;  4ZC3 A;  2LY1 A;  1X1D A;  2HQ5 A;  4BYY A;  1ETV A;  1WJA A;  3ABK H;  2STW A;  3PNV A;  1A04 A;  1FSE A;  2M5W A;  3DLA A;  4A2U A;  2EJR A;  5LRR A;  4L0Z B;  3PIO F;  1OCT C;  2ZFU A;  5D5U B;  1VQP I;  2JA2 A;  4QLC U;  3CDI A;  3WGG A;  3MAJ A;  3M1E A;  3E1S A;  1EA3 A;  2IP2 A;  5K5R A;  2HXI A;  2A69 F;  4IX7 A;  4GO1 A;  5E79 C;  2IAI A;  1ZG1 A;  4ZZD A;  2AO9 A;  2JUG A;  5IT9 K;  3I4P A;  1SFK A;  3TBI A;  1N77 A;  3ML6 A;  1U0J A;  2KZV A;  5K7H A;  2M8E A;  3O8H A;  2XB0 X;  1SFO J;  4NNJ A;  5DCM A;  4IKF A;  2WTE A;  2H1L A;  3V8L A;  4N4O B;  1P92 A;  4KMU X;  3X2Q H;  2E19 A;  4P9F A;  5KNL A;  2L02 A;  2VC1 A;  4C3I J;  3KIO A;  3NAU A;  1JGG A;  1F43 A;  2A6E F;  1X1P A;  4ESB A;  2E1C A;  1BBY A;  2DYR H;  2QZ8 A;  2WWY A;  3RPU D;  2Z16 A;  5EEH A;  2WB1 N;  1YS7 A;  5D8K B;  1XSX A;  3AG2 H;  3RKW A;  2BXZ A;  5LGU A;  3R0A A;  4YFN F;  1JXS A;  4HX8 A;  4B48 A;  1K6O A;  3I64 A;  4D5C A;  4A3I J;  2GBY A;  4GCV A;  3BDD A;  2NVT J;  2XVC A;  1G4D A;  2KRF A;  4XN3 A;  3RPU A;  2UWM A;  4RB0 A;  1LDD A;  3CCJ I;  2IW5 A;  2BBY A;  4BEH A;  3T8T A;  3KET A;  4Z6Y A;  1JJ8 C;  2R3S A;  4B44 A;  4CIC A;  1VQN I;  2R7T A;  3LWF A;  4PGH A;  4LG3 A;  4F93 B;  2L7F P;  4XR6 A;  2KIS A;  4MEX F;  3DXJ F;  1TWA J;  2LVS A;  4YFX F;  4BAC A;  1K83 J;  5HDN A;  3GTG J;  1UEL B;  4XK4 A;  3GCM A;  2FJ1 A;  3CCQ I;  3VEP A;  3CCV I;  2L9N A;  2O3F A;  1FBU A;  3GBG A;  3ZP5 A;  1YIJ I;  3ECH A;  4F3Q A;  4H4K C;  2ELH A;  1JHF A;  5D6E A;  2ZCW A;  3KP2 A;  2HDC A;  2YSR A;  2YUS A;  4ABZ A;  1SAX A;  1VQ7 I;  2XC7 A;  1FSH A;  2E1N A;  4XRF A;  2XAQ A;  3SFZ A;  4OIN F;  3JW4 A;  1FP2 A;  2HYG D;  1MJB A;  2VI6 A;  3J81 Z;  3IWZ A;  2HEO A;  3P9C A;  3S93 A;  1ODD A;  2O03 A;  5C44 J;  2JT1 A;  1BIB A;  2OA4 A;  2L7Z A;  2PMZ A;  1K78 B;  2HKX A;  4U88 A;  1V54 H;  4PK4 A;  4F91 B;  1J59 A;  3RIR A;  3HTU A;  3SZG A;  4HZF A;  2QWW A;  2R5Z B;  1MJA A;  4PCQ A;  3P5J A;  1Z7U A;  3W2A A;  1D5V A;  2E35 A;  3HKZ A;  3I53 A;  5ICE A;  5JFR A;  4DZJ A;  1I3A A;  3LSR A;  2GXG A;  2JA7 J;  4V2F A;  1YG2 A;  2CG4 A;  3CP8 A;  4IRG A;  5JVT A;  5D4R A;  3PQK A;  1J0R A;  3SXY A;  3W6K B;  3VYU B;  2IRF G;  2DA6 A;  3DTI A;  5J8F A;  3ZMS A;  4IJA A;  2MH9 A;  1VQL I;  1MSE C;  4M9X A;  3TO7 A;  2IBD A;  1LVA A;  2NXN B;  3G1L A;  1FPQ A;  4M3G A;  1R4M B;  2GWR A;  3SEQ A;  3QWL A;  5HLH A;  3IKV A;  4U7B A;  2WAE A;  4H0E A;  1J7K A;  1W5S A;  2XGE A;  4M71 A;  4C9Y A;  2VBW A;  1IUY A;  1OPC A;  3ZMZ A;  5LLQ A;  4MNU A;  4O5V A;  1WGX A;  5FRO A;  2EK5 A;  4RA2 A;  4UUS A;  3OYD A;  1VQ5 I;  1JUS A;  3CCY A;  1ETQ A;  2B63 J;  1MJ9 A;  2OQG A;  5BPD A;  4G6Q A;  1XB4 A;  3K1N A;  3CMA I;  2ME0 A;  5L3B A;  4NBQ A;  1LE8 A;  3L2R A;  2JJ7 A;  3COA C;  2FBH A;  2CGP A;  5F1R A;  1HDD C;  1BI0 A;  1IZ1 A;  2R7V A;  3OYG A;  3DKX A;  4A5N A;  5HLI A;  1Z05 A;  1ON2 A;  3M8F A;  4JX6 A;  1WCM J;  2XGC A;  4E70 A;  3SEZ A;  4U0Y A;  2ZFW A;  1HW2 A;  1ORK A;  2CQX A;  2Y75 A;  3DEW A;  4BU2 A;  2DOF A;  5LGN A;  3A01 B;  1FOW A;  2KHM A;  4IQ4 A;  1S9H A;  1TLH B;  3A03 A;  1W5T A;  4N4N B;  2VOD A;  2HOA A;  2LF7 A;  3LQR A;  2DMQ A;  1X3W B;  5ED4 A;  4U0W A;  3WGI A;  2O7O A;  1JTX A;  4R8H A;  1OLT A;  1FIP A;  2ZNY A;  4O6J A;  1ZQ3 P;  4UV9 A;  1K78 A;  2EIJ H;  3CQZ J;  4UUT A;  3E6B A;  4CSW A;  3VDX A;  1AKH B;  4LG0 A;  3ZQC A;  1BJA A;  4UB8 C;  2KP6 A;  2BGC A;  3E6M A;  1BR4 A;  2ELK A;  2XKP A;  3LNQ A;  1IN7 A;  2MBF A;  1FX7 A;  3TOA A;  3DV8 A;  4LOC A;  4W1U A;  3ZGK A;  3OYB A;  2FBK A;  1R5H A;  4EJO A;  1I39 A;  2CYY A;  4GDF A;  4LFU A;  1R9T J;  2K9Q A;  3OYK A;  2G9W A;  1XGN A;  5JI6 A;  4D7M A;  1LUJ B;  5E1W A;  2ELJ A;  5EG0 B;  1G3W A;  1QPM A;  5CVV A;  2IJL A;  4CCL A;  4CCK A;  1UHS A;  3OS1 A;  2A6T A;  3FBI B;  3P9I A;  1WH5 A;  4MQV A;  5J3L A;  5L3E A;  3DCF A;  1TC3 C;  1VTN C;  4GRI A;  2A07 F;  3QOE A;  2O9L A;  2R92 J;  5IP6 A;  3TDU C;  4I76 A;  3JRI A;  1FYM A;  2EZK A;  3OYJ A;  4N0B A;  2DYS H;  5ILV A;  3PUF A;  3KEQ A;  4P1W A;  2UXN A;  5DCF A;  4EGY A;  3F3X A;  3WGH A;  5BS6 A;  3K4K A;  2W7N A;  2HTJ A;  3FXO A;  1BR1 A;  4E7L A;  1XC5 A;  2RQP A;  2ZXJ A;  5HVQ C;  1OR7 C;  5JVG F;  4P55 A;  1MND A;  4ZDP A;  2HQN A;  4L0Y B;  3JRA A;  3CCM I;  3QQA A;  5F6F A;  4IPA A;  5AON A;  1GV2 A;  2OBP A;  3Q0W A;  2FOK A;  2JSC A;  2CS3 A;  2QGU A;  4UNO A;  1MBF A;  3MKZ A;  1ETY A;  4XKB A;  4A12 A;  1MH3 A;  1ULY A;  1Z3X A;  1SVL A;  2KFD A;  3K10 A;  3AG1 H;  5H2F C;  3F72 A;  5KHD A;  2M45 A;  5FGM A;  1T95 A;  2ZXI A;  3F6O A;  1MGT A;  1JUM A;  3WE2 A;  5L3F A;  4A3F J;  1I5Z A;  3H9Q A;  2K3P A;  3S3O A;  5H6R A;  4YRV A;  2OTL I;  1ONV A;  4RB2 C;  3A0B C;  1J75 A;  3LSK A;  2M7B A;  1FP1 D;  3H5A A;  2JUC A;  4I09 A;  3RDI A;  5K5O A;  2VJ4 A;  3BG3 A;  3S2D J;  1MIJ A;  2OJE D;  3AKZ A;  2CW0 F;  3IP4 B;  3GTK J;  3GFJ A;  1XPX A;  3WTZ A;  2P5K A;  3C7J A;  2PJP A;  2PBI A;  5FJ8 J;  2IEK A;  2KKO A;  2W48 A;  4PJJ A;  5E3L A;  1O4X A;  1HA8 A;  4AIH A;  2VQH A;  3OSG A;  1YHQ I;  1ZG5 A;  1P4A A;  4F52 A;  4LIV A;  3SQN A;  3MKY B;  2NOJ B;  1IN5 A;  3OV8 A;  3CO6 C;  3NAR A;  2P7V B;  1JHH A;  3HOU J;  3U2R A;  3KYD B;  4Y4R A;  2RQQ A;  4G94 A;  3OOP A;  2QKL B;  5E3N A;  4FHT A;  1UG0 A;  1BI3 A;  3TED A;  5HS7 A;  1FMW A;  2M4G A;  4M3E A;  2E7W A;  2BOL A;  3JCU C;  4BH9 A;  3TW7 A;  2VKE A;  1RI7 A;  1SMY F;  2XAS A;  3BCB A;  3HSF A;  2E2J J;  1OCR H;  3BWG A;  1FMV A;  4B4C A;  2W85 A;  2NVY J;  4KN4 X;  1IN4 A;  3K69 A;  3ZQ7 A;  1TL8 A;  3OMY A;  2HPI A;  4HW0 A;  1BJZ A;  1S72 I;  3OSF A;  1DDN A;  1Y1V J;  4Q4Z F;  1SD4 A;  3WG7 H;  2K85 A;  2NOG A;  2O8X A;  2EFQ A;  4WWC A;  3H0D A;  1ZG3 A;  4MQ9 F;  1T38 A;  3CLO A;  2L9V A;  2KJB A;  2RNG A;  4M3D A;  3E6C C;  2XAF A;  3BR5 A;  3HRT A;  2DA5 A;  3MWM A;  1QO0 D;  1WJF A;  5EZH A;  3RZD J;  1WSU A;  1XGM A;  2M1B A;  3I55 I;  3G3Z A;  5IP9 J;  1XS9 A;  3N97 A;  1X4P A;  2A61 A;  2RKH A;  1Y0N A;  2GLO A;  1X2M A;  2LYC A;  2DFE A;  3I5U A;  3CP2 A;  1XTA A;  1K79 A;  5GTH C;  1QA6 A;  2BYV E;  4A6D A;  2WC2 A;  2CUF A;  4QPO A;  1CF7 B;  1JT6 A;  2QQ8 A;  3F21 A;  5IYC J;  2VJ5 A;  1YX3 A;  2ACJ A;  3PL8 A;  3H1C A;  4CCM A;  3LOC A;  4YFK F;  1YRN B;  1JT0 A;  2GAU A;  2R7O A;  4Q48 A;  2TDX A;  2TCT A;  4A3B J;  3PNY A;  3OIQ A;  3P7N A;  1PDN C;  4J01 A;  3F8F A;  5J47 A;  2VLA A;  1P6R A;  2L01 A;  3I4M J;  2MH2 A;  4M9Z A;  2HOE A;  2ZSH B;  1KYZ A;  3WU2 C;  5IPA A;  4IHV A;  2VAS A;  3OIP A;  2MLG A;  3RQI A;  4MTD A;  1XCB A;  2ESH A;  2M0M A;  2H8W A;  2K40 A;  1AA7 A;  3HGG A;  2JPB A;  1EV7 A;  4RBO A;  1D5Y A;  1G2H A;  1HSJ A;  5E17 F;  1FY7 A;  1F36 A;  1G3S A;  3OIO A;  3ZMV A;  4LIU A;  4XNF A;  2OCC H;  1D1C A;  3CF2 A;  2V6E A;  1D1A A;  2HKO A;  3SZP A;  2ZJQ F;  3DEE A;  3I9V 2;  3BT9 A;  3WTX C;  3IH4 A;  4MHG A;  2CQK A;  4I02 A;  2FNP A;  1MMA A;  1IXS B;  5E8I A;  5BQT A;  2BY2 A;  2GA1 A;  5FD6 A;  3HOW J;  2VXZ A;  2Q2E A;  2L4M A;  2NYX A;  2XRN A;  1VQ4 I;  3RJP A;  2M34 A;  4KIT B;  2HTS A;  3E3V A;  2ZME B;  2DOD A;  2HXO A;  4RDU A;  5CPR B;  4JK1 X;  2GOX B;  3HZJ A;  2ZJP F;  3ULQ B;  1TWF J;  2BHZ A;  5EGO A;  1U8B A;  1Z6R A;  4XLC A;  1B6A A;  3HXL A;  1XD7 A;  4IHW A;  4XLH A;  3M7G A;  5F0C A;  2QEX I;  1MSF C;  4AUX A;  1E17 A;  2LC2 A;  1D0Z A;  4CUG A;  1CF7 A;  1IF1 A;  1Z91 A;  2HQR A;  1W5C C;  2FML A;  3M07 A;  4RLF A;  4M72 A;  3M1C A;  3OYL A;  2E36 A;  2QYO A;  3TOB A;  1USS A;  1MW7 A;  3C1D A;  3DFG A;  5FLX K;  2ISY A;  1RNL A;  1SMT A;  1BR2 A;  3F8M A;  3U21 A;  4IHY A;  2LRD A;  2K9M A;  2OV7 A;  3OYM A;  5B5E C;  2ISZ A;  4LLL A;  3PNT A;  3B6C A;  3RKY A;  4WX9 A;  5GP9 A;  3FXL A;  1YJW I;  3FX3 A;  3HTS B;  2VON A;  5FRM A;  1OYW A;  2CU7 A;  2FF4 A;  4EJU A;  2VIX A;  3CJN A;  5E3O A;  5DUK A;  2BVL A;  1DPU A;  2E7X A;  1ETX A;  2XGD A;  2LBF B;  1KYW A;  2V1D A;  4FQG A;  3EQL F;  2ADU A;  5LGT A;  5BOX A;  3C2G A;  4UXN A;  5FFX A;  1JKP C;  3GEZ A;  4KIC A;  3WU0 A;  4RM3 A;  1BC8 C;  1QHG A;  3O3K A;  3BR6 A;  1X1C A;  1B72 A;  1R1U A;  4HF1 A;  1S7E A;  3DKW A;  2LNB A;  2IS6 A;  2V1U A;  1Z3Y A;  2UXX A;  1DUX C;  3QRF F;  3H35 A;  1O7F A;  4GYI A;  3EET A;  4RS8 A;  4DOZ A;  2OZ6 A;  3A4C A;  4E7J A;  1I27 A;  1FOY A;  1S8N A;  5HLG A;  1WJC A;  5LRS A;  2RAE A;  4A3L J;  1HC8 A;  2PMU A;  1BIA A;  1JUP A;  3RCO A;  1K4S A;  3IV5 A;  5J4Y A;  3F22 A;  4A3K J;  2ZME A;  1OIS A;  2E1O A;  2WAQ A;  4LLG F;  3IKT A;  4IQJ A;  1X1A A;  2UUZ A;  2GIZ A;  3S2W A;  2RN7 A;  1O57 A;  5J1Y A;  4Y17 A;  2XPV A;  5K7Z A;  1DP3 A;  4HG2 A;  4EV0 A;  3MFK A;  5JLX A;  3HYI A;  2PX9 A;  2R7X A;  1V5F A;  3GYH X;  2LKX A;  4OIP F;  2OTJ I;  1D8K A;  2ICW G;  2DJN A;  2KRH A;  4A0Z A;  4UY8 I;  3B6A A;  5LHI A;  2KT0 A;  3L2Q A;  1IGN A;  4Z2Y A;  4YIF A;  1S6L A;  1S7A A;  2P0W A;  1HF0 A;  4HYE A;  2OCE A;  3HM5 A;  1XN7 A;  5F08 A;  5TGT A;  1TW2 A;  3D1N I;  3VSK A;  2DK5 A;  2L2O A;  3HOS A;  4ENN A;  3G71 I;  3NWS A;  3SDB A;  1NG6 A;  3JAM K;  3D5L A;  2C6Y A;  5D8L B;  5HOD A;  1H0M A;  4EAT A;  1VND A;  3IRQ A;  1U5T B;  3L00 A;  1FTT A;  1I1G A;  2EZH A;  1WWX A;  1YW8 A;  3S1R J;  4XKW A;  1OCC H;  4PSW A;  2ID6 A;  3TQN A;  4XID A;  2B9S A;  5LD2 C;  1YFH A;  3Q0U A;  4XLP F;  1R1V A;  3M3Y J;  1VZ0 A;  2CFO A;  2G0E A;  2D5V A;  3RI4 A;  1YW7 A;  2WB1 A;  2YX7 A;  2ZBK A;  5ICC A;  2X1C A;  3BZC A;  3KZY A;  5ERI A;  1OKR A;  2ZJR F;  3LSM A;  3GTL J;  2JA5 J;  3HRS A;  4CCO A;  2GOM A;  3VPR A;  1JE8 A;  3F9K A;  2Y9Y A;  1T8I A;  4G7Z F;  4L9T A;  2V79 A;  1WH7 A;  2CUJ A;  2D1V A;  2EIN H;  4E6K G;  2DI3 A;  1FTZ A;  1YTY A;  2RNJ A;  1SFE A;  3DU5 A;  1ITY A;  4ENM A;  2EZI A;  3CUO A;  4E7S A;  1TP4 A;  1PJR A;  1S3J A;  4G12 A;  4IOA F;  4NC7 A;  4IXA A;  4V2G A;  3J80 K;  3T8R A;  1FZP B;  2LY2 A;  2NVU B;  1VQM I;  1O3T A;  1EH7 A;  4AWX B;  1V5E A;  1RIO H;  4KJZ A;  1Z6T A;  2VQL A;  3RKX A;  4P5O A;  4AIK A;  1SEU A;  2VC0 A;  3CC2 I;  1U3E M;  4FE4 A;  2W84 A;  4XLE A;  4F55 A;  3N05 A;  1W4M A;  1ZLK A;  2DTR A;  4OAY A;  5EZG A;  1U5T C;  2HS5 A;  4HDU A;  1ZR2 A;  5M5X J;  4IHS A;  3CMY A;  1X3U A;  2M2E A;  3C3W A;  2IVM A;  3WHC A;  3KLN A;  1YLF A;  2O5R A;  3R60 A;  4C30 A;  1I6H J;  4Y52 J;  1NHA A;  1NK3 P;  1ZH5 A;  1OQY A;  2Y2Z A;  2JZY A;  2OUM A;  1K7A A;  2X9D A;  3HC7 A;  2Z3Y A;  1ZK8 A;  3KFW X;  4IOC F;  2DA4 A;  2F5F A;  4L9J A;  4BDZ A;  3AL0 B;  2Q8K A;  2I5U A;  2K9L A;  4AYB N;  4Y33 A;  1P4W A;  1Y39 A;  2FOW A;  3H3U A;  4XN0 A;  3I54 A;  2CMP A;  3LQQ A;  2H09 A;  5F0F A;  2IGO A;  2H94 A;  4Y7N J;  4CYC B;  3G73 A;  1LNW A;  3ROU A;  1ZYR F;  5C4X J;  5FKK A;  4LB6 B;  2GXB A;  1YYV A;  2BXY A;  5CLS A;  3C2H A;  2R7U A;  2DT7 B;  3EDP A;  2IGK A;  3CC7 I;  1QRY A;  2AHQ A;  2J5P A;  1VQ8 I;  2BW3 B;  2DN0 A;  2EIK H;  4HX7 A;  2LR8 A;  2XAJ A;  2JN6 A;  1W0T A;  2XHK A;  4ANJ A;  3VOE A;  4HV6 A;  3S3M A;  2XDV A;  4OWR B;  3LST A;  2EA2 A;  5D4S A;  2A3S A;  3F0C A;  3PQJ A;  5BMZ A;  1MKM A; 
#chains in the Genus database with same CATH homology
 1YW9 A;  3GUD A;  4R79 A;  2DLL A;  2QEN A;  2PLY A;  3RYR A;  2LKP A;  2VBZ A;  1T2K A;  4I0A A;  2LSO A;  1W7P B;  3E5U A;  3V7C A;  2VE9 A;  4B09 A;  3ECO A;  4ZYE A;  2YR2 A;  1JGS A;  1WKM A;  2VT3 A;  2PG4 A;  2R7F A;  1R1T A;  5E20 A;  1R5G A;  1TQM A;  3GF2 A;  1ZAR A;  2K7L A;  4CZZ A;  5DD8 A;  3REO A;  2V9V A;  2OQR A;  2AS5 F;  3J7A O;  2VN2 A;  3Q5F A;  4KYW A;  1UCR A;  4EJV A;  1ZN2 A;  3NQO A;  2EFW A;  4ZH4 F;  2DW4 A;  3QOP A;  3I59 B;  1I1S A;  3M9A A;  1F9N A;  4G8X A;  4ESF A;  4M9S A;  1WI9 A;  4AIJ A;  5IT3 A;  3ABT A;  5ILS A;  4TV7 A;  4KIB A;  3HSE A;  1W7P D;  3ISP A;  3E97 A;  5J8C A;  5D5X B;  2EWN A;  3R61 A;  4QWQ A;  4ZZL A;  1O3S A;  1TNT A;  4AVP A;  1B1B A;  1G3Y A;  4OMY A;  5FB2 A;  1UHM A;  1KU3 A;  3K1M A;  3FM5 A;  1T98 A;  3K9T A;  1YS6 A;  3QU6 A;  1U2W A;  2F5D A;  4KNY A;  5LBQ A;  4OIQ F;  3I58 A;  3QU3 A;  2G7H A;  5J6X A;  1HBX G;  1HST A;  2G7U A;  2R7D A;  5CVJ A;  4EGZ A;  3I0T A;  1HXD A;  2IA1 A;  1KQ9 A;  2EFP A;  4PZJ A;  3O2P E;  5TJJ A;  4KIF A;  1ZRF A;  4R1H A;  1ZGA A;  2FBI A;  1OR7 A;  2IT0 A;  2GA2 A;  2ETH A;  4LJZ F;  5E1Z B;  3WTY C;  3FF5 A;  2P8T A;  4M6X A;  4U0V A;  1GHC A;  1F5T A;  4HQM A;  4I0B A;  3KP5 A;  2DQR A;  4NHJ A;  3CTA A;  5CVU A;  1GXP A;  4KUM A;  3QPT A;  3GVA A;  1YIO A;  4I2O A;  3DPL C;  1H9G A;  2QQA A;  4UV8 A;  3IRR A;  4M6Y A;  1BN5 A;  1O7L A;  2B0L A;  4LD5 A;  2Z5U A;  4MEY F;  2D45 A;  1FOK A;  2MD5 A;  5A2Q K;  3T0Y A;  4WF2 A;  2Z99 A;  4B8X A;  1OYI A;  3QP6 A;  3QAH A;  2JPC A;  4LK0 F;  3HIF A;  1IN8 A;  2UZK A;  1L0O C;  4EVI A;  4S04 A;  1Z1D A;  2KIM A;  4BHB A;  2HGC A;  4CGZ A;  4HDV A;  2F5C A;  3LA3 A;  4FX4 A;  1SFU A;  1BC7 C;  3ZPL A;  3JSP A;  5FO5 A;  2ZKZ A;  4CDG A;  2H6B A;  4RGR A;  3R4K A;  5FD5 A;  3K0L A;  4UVA A;  3MCZ A;  2Z33 A;  2FNA A;  4YII A;  2IA2 A;  2GIV A;  2NRA C;  5DYM A;  2Z9O A;  5D5V B;  2QQ9 A;  2K4J A;  2VE8 A;  1QGP A;  1KQ0 A;  2HZT A;  1YQA A;  3V8J A;  4RAY A;  3V4G A;  2W25 A;  2OD5 A;  5LHG A;  3ABU A;  5HDG A;  4MGR A;  3FXU A;  1XSD A;  1XDU A;  1AWC A;  4U7D A;  4A0Y A;  4BAY A;  5KVR A;  5K1Y A;  2BE5 F;  2VBY A;  5ICG A;  3KP7 A;  1BOA A;  3HUG A;  3GX4 X;  2ZO4 A;  5L3D A;  2A6H F;  4IVN A;  1EH6 A;  2WV0 A;  4GXO A;  5ILU A;  4ZYG A;  2W24 A;  4UHT A;  2MA3 A;  2QLZ A;  3WU1 B;  2YU3 A;  1B9N A;  3ZMT A;  1ZRE A;  1KQ8 A;  1B59 A;  1ZAO A;  5H6Q A;  3T5X A;  1HKT A;  1TW3 A;  3R6S A;  2VOO A;  4I7H A;  4ENJ A;  3WOD F;  2RDP A;  3KE2 A;  5DD4 A;  1WQ2 A;  1IN6 A;  4KA4 A;  2JRT A;  3U9G A;  3NRV A;  4ESJ A;  4O3M A;  2P5L C;  4HF2 A;  4UVB A;  3O6B B;  2ESN A;  2F2E A;  3FM3 A;  4L18 B;  4RGS A;  3VB2 A;  1LDJ A;  4XSZ F;  5DUI A;  2V6C A;  4ENK A;  3BJO A;  3DF8 A;  2Y0M A;  4JBA A;  3IL2 A;  5CJ9 A;  1LEA A;  1QZZ A;  5L3G A;  4CXF A;  2QVO A;  1T39 A;  1C0W A;  2FMY A;  3W6J B;  1V3F A;  2MLK A;  2CWE A;  4XSX F;  3LAJ A;  3E5X A;  4GGG A;  3IC7 A;  1QNT A;  3WE3 A;  3C18 A;  1BM9 A;  3WTW C;  2STT A;  3ZN0 A;  4DQ2 A;  1U6G A;  1R00 A;  5DCM B;  4PDK A;  2FU4 A;  2ZNZ A;  2K02 A;  2PEX A;  5EEG A;  5ICF A;  4A5M A;  1TNS A;  4HBL A;  1SFX A;  2BEO A;  3BP8 A;  3CUQ C;  4Q47 A;  1T6S A;  2JTV A;  4HLY A;  2XIG A;  3ZN1 A;  3WG9 A;  3WTS C;  1R36 A;  2X0L A;  2PFB A;  3VFZ A;  2P4W A;  2L54 A;  2DO7 A;  2J5O A;  2LDU A;  3B73 A;  1XGO A;  4L5I A;  2XAG A;  1L3L A;  3VOD A;  4EM2 A;  5L3C A;  2FSW A;  4S05 A;  4P96 A;  4ZYH A;  4ZYD A;  3BPV A;  4G9Y A;  2P7C B;  3EYI A;  3JAM Z;  1P2F A;  4LLN A;  2FE3 A;  2RVC A;  2XKO A;  4HAM A;  3FXQ A;  3R0J A;  3J81 K;  1DPR A;  2P6T A;  1AOY A;  6PAX A;  2ZJ2 A;  1YO5 C;  4BHP A;  1RUN A;  2FXA A;  1KU7 A;  2XAH A;  2OZU A;  1U5T A;  4DNC A;  3RTR A;  4OU0 A;  5JR3 A;  1O3R A;  1MDM B;  1FBQ A;  4OMZ A;  2K4B A;  3P9K A;  5IT9 Z;  1IRF A;  1QZY A;  3V7R A;  3L9F A;  1UST A;  1XSV A;  1HKS A;  4RB3 C;  3J80 Z;  2P5V A;  1U78 A;  1OYY A;  4ETS A;  3BJA A;  2HFH A;  2PN6 A;  1F1Z A;  2Q0O A;  1PUE E;  3AAF A;  2CO5 A;  4P9U A;  2PQ8 A;  4HQE A;  1ZRC A;  2FA5 A;  1ON1 A;  2BV6 A;  5FFZ A;  2FEZ A;  1P4X A;  1TQI A;  3GZ6 A;  2VBX A;  1XGS A;  1O3Q A;  4LG0 B;  2LF8 A;  2COM A;  3FZV A;  3LAP A;  2DQL A;  3TKY A;  1GXQ A;  3ELK A;  1T0F A;  4JQF A;  4LMY A;  3F23 A;  4F7Z A;  4LGW A;  1HW5 A;  1Q1H A;  1GVJ A;  1BI1 A;  4AD9 A;  3GLX A;  4HV5 A;  4Y15 A;  4RAZ A;  2RGV A;  4RGU A;  2QBY B;  1MDM A;  3KP4 A;  5HOO A;  2DAO A;  2HWV A;  5AIQ A;  3WTU C;  2DK8 A;  2XV4 S;  3L09 A;  5E8G A;  2EB7 A;  4RGX A;  4OIR F;  4G6D A;  4BQA A;  1V4R A;  2L4A A;  1R58 A;  3L7W A;  2NNY A;  1PP8 F;  1QBJ A;  3WTT C;  3K2Z A;  3U1D A;  2HR3 A;  4Q5S F;  1OMI A;  3ERE D;  1E2X A;  2CFX A;  4PGG A;  3CO7 C;  4OIO F;  2GZW A;  3F8N A;  5CYV A;  1J2X A;  3DEU A;  3MEX A;  2H27 A;  2EA4 A;  1FYK A;  3LFK A;  4Y13 A;  4NB5 A;  2XRO A;  5LEJ A;  2EFO A;  3SZT A;  3FXR A;  4MTE A;  1FNN A;  3GFI A;  1W7P A;  5HDK A;  3EUH A;  3M8E A;  4HF0 A;  3TDZ C;  2OAZ A;  1EH8 A;  1IAW A;  1FT9 A;  3GXO A;  2IPQ X;  1HKQ A;  5H20 A;  4HX4 A;  2DFI A;  3BZ6 A;  1B9M A;  1IXR C;  1Z9C A;  1REP C;  2K86 A;  4EQQ A;  1KU9 A;  4WCG A;  1SD7 A;  5CVR A;  4IHT A;  1XMA A;  3MZH A;  2QBY A;  4L9N A;  1IRG A;  2X4H A;  4KMF A;  4FX0 A;  1R7J A;  3TO9 A;  1ZRD A;  1G3T A;  4N9H A;  1I6X A;  1LB2 A;  2XUB A;  3KP6 A;  5TRD A;  3I59 A;  4IRH A;  1ZHF A;  4I01 A;  1TQP A;  3B02 A;  2P6S A;  4BNC A;  2W57 A;  3KZZ A;  1FLI A;  3BOQ A;  3Q9S A;  3KEO A;  3QP5 A;  4UUV A;  3FMS A;  3DQV C;  1XDS A;  2A68 F;  2A5Y B;  2NS0 A;  3D0S A;  4CO8 A;  4M74 A;  2K27 A;  4IF4 A;  2HYF A;  1MZB A;  3GFL A;  4L5J A;  2KJC A;  3HHH A;  4BXU A;  4GYG A;  2DPD A;  4EJT A;  2YX4 A;  3PFI A;  1D3Y A;  3K1P A;  1ZGJ A;  4WXD A;  2AXL A;  3V7S A;  1DP7 P;  1CGP A;  2IA0 A;  3KLO A;  3GW2 A;  3IWF A;  1FC3 A;  4HLX A;  4OOI A;  2D2W A;  5KK1 A;  1LDK B;  3RPQ A;  2NNN A;  1BI2 A;  5DDG A;  4EMS A;  5DV5 A;  4UVC A;  3TO6 A;  4K2E A;  1IW7 F;  3ZMD A;  4LK1 F;  2VOP A;  5AIP A;  1RZ4 A;  2KIU A;  3FMR A;  3LA7 A;  3KCC A;  1LQ1 A;  4CHU A;  3T1B A;  4M73 A;  1S29 A;  4XBF A;  2F5E A;  5LEK A;  1IXC A;  1HQC A;  4EM0 B;  2O6G E;  2DT5 A;  2QM3 A;  1SD6 A;  4D0P A;  4CYD A;  3BPX A;  3F6V A;  2EV5 A;  4N9I A;  4KDP A;  5E1X A;  4NQW A;  2L3D A;  5A2Q Z;  5DEQ A;  1R22 A;  2EV6 A;  4WK8 F;  4A0X A;  2MC3 A;  3H92 A;  2QUF A;  3SHF A;  2H6C A;  1UB9 A;  3KP3 A;  3E6D A;  2DBB A;  1QQI A;  4HOB A;  3BJ6 A;  2V1X A;  3LA2 A;  3GWZ A;  3TGN A;  5E18 F;  5CVI A;  3HSR A;  2GQQ A;  3FHZ A;  3HOT A;  4ASN A;  1KU2 A;  3BY6 A;  5LHH A;  4KIG A;  3MZY A;  1SD5 A;  1UFM A;  4A6E A;  1R23 A;  4XLN F;  1MD0 A;  2PI0 A;  2KIF A;  3MQ0 A;  2PMH A;  3HHG A;  2NAZ A;  1KA8 A;  3HRM A;  1PP7 U;  1TTY A;  1D8J A;  1LEB A;  3EYY A;  1S7O A;  1ZLJ A;  3I71 A;  4HA8 A;  3L2C A;  4IRI A;  2M87 A;  4L9V A;  3V8K A;  1RUO A;  2RC4 A;  3QPH A;  2DU9 A;  1UHW A;  4BHC A;  3FMQ A;  1FYL A;  3E5Q A;  1TBX A;  3GO5 A;  4EM1 A;  5K5Q A;  3N4M A;  1G6N A;  3JTH A;  2VT2 A;  1XCV A;  1J9I A;  1H9T A;  4ON0 A;  4WXH A;  2D1H A;  3CUQ B;  4KFC A;  2FRH A;  4KT5 C;  4EJW A;  1FWZ A;  3BRO A;  3GZ5 A;  1FBS A;  2EFN A;  4RB1 A;  4I98 B;  3HRU A;  2O61 A;  5HS8 A;  4YG2 F;  3DP7 A;  2YPR A;  1XMK A;  4G7O F;  3WTV C;  3IHU A;  3RYP A;  4WXC A;  3F8B A;  5FLX Z;  1Y0U A;  1HW1 A;  3CDH A;  3JSO A;  2EV0 A;  2XGX A;  1B4A A;  5JHU A;  3F8C A;  2M30 A;  5HS9 A;  1STZ A;  3Q9V A;  2CSO A;  2OU2 A;  4G7H F;  1KGS A;  3NEU A;  1LJ9 A;  5D6F A;  1WRJ A;  4FT8 A;  4LB5 A;  3H3Z A;  2FQ3 A;  1F4K A;  1U8R A;  2QQB A;  2RV8 A;  3JTG A;  3FWE A;  2O0Y A;  1J5Y A;  3ZMU A;  4KN7 X;  3CUQ A;  5BPI A;  3DPT A;  5F64 A;  2DPU A;  2Y48 A;  3GFM A;  5D5W B;  4BYY A;  2STW A;  1A04 A;  1FSE A;  2M5W A;  4A2U A;  2EJR A;  5LRR A;  4L0Z B;  5D5U B;  4QLC U;  3WGG A;  3MAJ A;  3M1E A;  2IP2 A;  5K5R A;  2A69 F;  4GO1 A;  1ZG1 A;  4ZZD A;  5IT9 K;  3I4P A;  3ML6 A;  2M8E A;  5DCM A;  2WTE A;  3V8L A;  1P92 A;  4KMU X;  4P9F A;  2L02 A;  2VC1 A;  2A6E F;  4ESB A;  2E1C A;  1BBY A;  2QZ8 A;  2WWY A;  5EEH A;  1YS7 A;  5D8K B;  1XSX A;  3RKW A;  5LGU A;  3R0A A;  4YFN F;  1JXS A;  4HX8 A;  1K6O A;  3I64 A;  4GCV A;  3BDD A;  2XVC A;  1G4D A;  2KRF A;  3RPU A;  2UWM A;  4RB0 A;  1LDD A;  2IW5 A;  2BBY A;  3T8T A;  3KET A;  2R3S A;  4CIC A;  3LWF A;  4PGH A;  4MEX F;  3DXJ F;  4YFX F;  5HDN A;  3VEP A;  2O3F A;  1FBU A;  3ZP5 A;  3ECH A;  2ELH A;  1JHF A;  5D6E A;  2ZCW A;  3KP2 A;  2HDC A;  2YSR A;  1SAX A;  1FSH A;  2E1N A;  4XRF A;  2XAQ A;  3SFZ A;  4OIN F;  3JW4 A;  1FP2 A;  2HYG D;  1MJB A;  3J81 Z;  3IWZ A;  2HEO A;  3P9C A;  1ODD A;  2O03 A;  2JT1 A;  1BIB A;  2OA4 A;  1K78 B;  2HKX A;  4U88 A;  1J59 A;  3RIR A;  3HTU A;  4HZF A;  2QWW A;  1MJA A;  4PCQ A;  1Z7U A;  1D5V A;  5JFR A;  3I53 A;  5ICE A;  2GXG A;  1YG2 A;  2CG4 A;  4IRG A;  5D4R A;  5JVT A;  3PQK A;  1J0R A;  3SXY A;  3W6K B;  2IRF G;  5J8F A;  3ZMS A;  4IJA A;  2MH9 A;  4M9X A;  3TO7 A;  1LVA A;  1FPQ A;  2GWR A;  5HLH A;  3IKV A;  4U7B A;  4H0E A;  1J7K A;  1W5S A;  4M71 A;  2VBW A;  1IUY A;  1OPC A;  3ZMZ A;  5LLQ A;  4MNU A;  4O5V A;  2EK5 A;  1MJ9 A;  2OQG A;  5BPD A;  4G6Q A;  1XB4 A;  3K1N A;  5L3B A;  3COA C;  2FBH A;  2CGP A;  5F1R A;  1BI0 A;  1IZ1 A;  4A5N A;  5HLI A;  1Z05 A;  1ON2 A;  3M8F A;  4E70 A;  4U0Y A;  2ZFW A;  1HW2 A;  2Y75 A;  5LGN A;  1TLH B;  1W5T A;  2VOD A;  2LF7 A;  3LQR A;  5ED4 A;  4U0W A;  3WGI A;  4R8H A;  2ZNY A;  4O6J A;  4UV9 A;  1K78 A;  3E6B A;  4LG0 A;  1BJA A;  2BGC A;  3E6M A;  2XKP A;  1IN7 A;  2MBF A;  1FX7 A;  3TOA A;  3DV8 A;  2FBK A;  1R5H A;  4EJO A;  2CYY A;  4LFU A;  2G9W A;  1XGN A;  5JI6 A;  5E1W A;  1G3W A;  1QPM A;  5CVV A;  2IJL A;  3P9I A;  4MQV A;  5L3E A;  1VTN C;  2A07 F;  3TDU C;  1FYM A;  4N0B A;  5ILV A;  3KEQ A;  2UXN A;  5DCF A;  4EGY A;  3F3X A;  3WGH A;  5BS6 A;  2HTJ A;  2RQP A;  2ZXJ A;  5HVQ C;  4P55 A;  2HQN A;  4L0Y B;  5F6F A;  4IPA A;  5AON A;  2OBP A;  2FOK A;  2JSC A;  4UNO A;  4A12 A;  1ULY A;  3F72 A;  2M45 A;  5FGM A;  3F6O A;  1MGT A;  3WE2 A;  5L3F A;  1I5Z A;  5H6R A;  1ONV A;  4RB2 C;  1J75 A;  1FP1 D;  4I09 A;  3RDI A;  5K5O A;  2CW0 F;  3GFJ A;  3WTZ A;  2P5K A;  3C7J A;  2PJP A;  2PBI A;  2KKO A;  4AIH A;  1ZG5 A;  1P4A A;  3SQN A;  1IN5 A;  3OV8 A;  3CO6 C;  2P7V B;  1JHH A;  3U2R A;  4G94 A;  3OOP A;  4FHT A;  1BI3 A;  5HS7 A;  2E7W A;  4BH9 A;  1RI7 A;  1SMY F;  2XAS A;  3HSF A;  3BWG A;  2W85 A;  4KN4 X;  1IN4 A;  3K69 A;  3ZQ7 A;  4HW0 A;  1DDN A;  4Q4Z F;  1SD4 A;  2O8X A;  2EFQ A;  4WWC A;  1ZG3 A;  4MQ9 F;  1T38 A;  3CLO A;  2KJB A;  3E6C C;  2XAF A;  3HRT A;  3MWM A;  1QO0 D;  1WSU A;  1XGM A;  2M1B A;  3G3Z A;  3N97 A;  2RKH A;  2A61 A;  3I5U A;  1K79 A;  2BYV E;  4A6D A;  2WC2 A;  1CF7 B;  3F21 A;  2ACJ A;  4YFK F;  2GAU A;  4Q48 A;  2TDX A;  3P7N A;  1PDN C;  3F8F A;  1P6R A;  2L01 A;  2MH2 A;  4M9Z A;  2HOE A;  1KYZ A;  2MLG A;  4MTD A;  1XCB A;  2ESH A;  2JPB A;  1EV7 A;  1HSJ A;  5E17 F;  1FY7 A;  1G3S A;  3ZMV A;  2HKO A;  3SZP A;  3WTX C;  4MHG A;  2CQK A;  4I02 A;  2FNP A;  1IXS B;  5E8I A;  5BQT A;  5FD6 A;  2GA1 A;  2VXZ A;  2Q2E A;  2L4M A;  2NYX A;  2XRN A;  3RJP A;  2HTS A;  3E3V A;  2ZME B;  4JK1 X;  3ULQ B;  1Z6R A;  1B6A A;  1XD7 A;  3M7G A;  1E17 A;  1CF7 A;  1IF1 A;  1Z91 A;  2HQR A;  2FML A;  4M72 A;  2QYO A;  3TOB A;  1USS A;  3C1D A;  3DFG A;  5FLX K;  2ISY A;  1RNL A;  1SMT A;  3F8M A;  2ISZ A;  4LLL A;  3RKY A;  4WX9 A;  3HTS B;  2VON A;  3FX3 A;  1OYW A;  2FF4 A;  4EJU A;  3CJN A;  5DUK A;  1DPU A;  2E7X A;  1KYW A;  2V1D A;  3EQL F;  2ADU A;  5LGT A;  5BOX A;  4UXN A;  5FFX A;  3GEZ A;  4KIC A;  3WU0 A;  1BC8 C;  3O3K A;  1R1U A;  4HF1 A;  3DKW A;  2LNB A;  2V1U A;  2UXX A;  1DUX C;  3QRF F;  1O7F A;  4GYI A;  3EET A;  4RS8 A;  2OZ6 A;  1I27 A;  1S8N A;  5HLG A;  5LRS A;  2PMU A;  1BIA A;  3F22 A;  2ZME A;  4LLG F;  3IKT A;  3S2W A;  2RN7 A;  1O57 A;  4Y17 A;  4EV0 A;  3MFK A;  3HYI A;  3GYH X;  4OIP F;  1D8K A;  4A0Z A;  5LHI A;  4Z2Y A;  4YIF A;  1S6L A;  1S7A A;  4HYE A;  1XN7 A;  1TW2 A;  2DK5 A;  3HOS A;  4ENN A;  3JAM K;  3D5L A;  2C6Y A;  5D8L B;  1H0M A;  3IRQ A;  1U5T B;  3L00 A;  1I1G A;  1WWX A;  1YW8 A;  3TQN A;  1YFH A;  4XLP F;  1R1V A;  3RI4 A;  1YW7 A;  2YX7 A;  2ZBK A;  5ICC A;  5ERI A;  3KZY A;  1OKR A;  3HRS A;  1JE8 A;  4G7Z F;  4L9T A;  2V79 A;  2D1V A;  2DI3 A;  1YTY A;  2RNJ A;  1SFE A;  4ENM A;  3CUO A;  1S3J A;  4IXA A;  3J80 K;  3T8R A;  1FZP B;  1O3T A;  1EH7 A;  4AWX B;  1RIO H;  1Z6T A;  3RKX A;  4P5O A;  4AIK A;  2VC0 A;  1U3E M;  2W84 A;  1ZLK A;  1W4M A;  2DTR A;  1U5T C;  2HS5 A;  4HDU A;  4IHS A;  1X3U A;  3C3W A;  2IVM A;  3KLN A;  1YLF A;  3R60 A;  1NHA A;  1ZH5 A;  2JZY A;  1K7A A;  2Z3Y A;  3KFW X;  2F5F A;  4L9J A;  2Q8K A;  1P4W A;  3H3U A;  3I54 A;  3LQQ A;  2H09 A;  2H94 A;  3G73 A;  1LNW A;  3ROU A;  1ZYR F;  4LB6 B;  2GXB A;  1YYV A;  5CLS A;  3EDP A;  2J5P A;  4HX7 A;  2XAJ A;  2XHK A;  3VOE A;  4HV6 A;  3LST A;  2EA2 A;  5D4S A;  2A3S A;  3PQJ A;  5BMZ A;  1MKM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...