1BBYA

Dna-binding domain from human rap30, nmr, minimized average
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation
molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bbyA00
2XASA 1SD6A 2VOOA 1G3SA 1G6NA 2FEZA 4JBAA 4MQVA 2FXAA 2P6TA 4AIHA 2ACJA 3R6SA 5KVRA 3CO6C 4LB5A 3TOBA 4OIOF 2GXBA 1KU9A 5JVTA 3RPQA 4LG0A 4LG0B 1Q1HA 1KYWA 4BXUA 3GX4X 4KUMA 3BJAA 3QRFF 2OBPA 5BPDA 2HZTA 4G8XA 3LA2A 3Q9VA 2KRFA 5F1RA 1FBSA 5HLGA 1R36A 2J5PA 1O3TA 1BBYA 4YFXF 3F22A 3PQKA 5DDGA 2EFOA 3HUGA 4Y17A 4BQAA 4KFCA 1IN8A 3DKWA 3E97A 1KYZA 4G7HF 5EEGA 1LEBA 1W5SA 4B09A 4O5VA 3HRMA 1TW2A 4M6XA 4ENKA 4KIFA 3KETA 1L3LA 2MC3A 2EFPA 5IT3A 1J2XA 3ML6A 5IT9Z 2STTA 4RB0A 4GCVA 2Y75A 3RPUA 3O6BB 2FE3A 1IN4A 3COAC 2HQNA 4S04A 1USTA 2QM3A 3BWGA 3LQRA 3LAJA 1XDUA 1RUNA 1IXSB 1LJ9A 1TBXA 1U5TB 5FD5A 2JSCA 1PP7U 2O6GE 4UNOA 3RKWA 1S7AA 3E6DA 4BYYA 2C6YA 1JXSA 1FLIA 2FMLA 1BIBA 4ESJA 2XAQA 1J75A 1TQMA 3BROA 1F5TA 5HLHA 2B0LA 4UVBA 4HV5A 4I2OA 2DW4A 1Z91A 1Y0UA 2QQBA 1K78A 1K78B 1YIOA 1MZBA 2XHKA 1FPQA 3QU3A 3B02A 1ZG1A 4I09A 5CLSA 2W85A 3CJNA 4HYEA 3KP6A 3ELKA 1K6OA 1U78A 2M45A 1KQ8A 3HSEA 4IPAA 4L18B 4G6DA 2MH2A 3SXYA 3MZHA 1UCRA 1BN5A 4P96A 4EQQA 3PQJA 4OINF 4YIFA 3GFLA 1YW8A 3WTXC 4UVCA 3R0JA 1JE8A 4WK8F 1IN6A 2FBKA 3M8EA 3K9TA 5CVVA 1CGPA 4I0AA 1FSHA 1K79A 3DF8A 1D8JA 4HLXA 2Z9OA 4S05A 4KMFA 3HRSA 1YW7A 3DQVC 1ZG3A 4LJZF 3DEUA 4M9XA 4LLLA 1SAXA 1IN5A 2ETHA 2ZKZA 3BDDA 1TTYA 3OV8A 3LFKA 3BJOA 4EM0B 1ZG5A 2RGVA 1O7LA 1YQAA 1FSEA 2A69F 1EH8A 1LDKB 1G3TA 4A5NA 3R60A 5A2QK 4Q4ZF 4RB3C 4UV9A 2HEOA 4NB5A 1EV7A 5HDKA 2FNAA 2Q8KA 2LDUA 3E5UA 2EJRA 2EFWA 4GYIA 4M72A 1SFUA 1DPRA 2BE5F 1B6AA 4IJAA 1TQIA 3GF2A 4CXFA 2K7LA 1YW9A 2PI0A 3ISPA 4BHCA 4EJOA 5DEQA 3VODA 3ZMZA 2GAUA 2WWYA 4HX4A 3LA3A 2RVCA 3VB2A 1XSVA 3TOAA 4WXHA 5D4SA 2CO5A 1ZRFA 1J9IA 4ENMA 4G7OF 3F8NA 3HYIA 3V7CA 2IRFG 3V7RA 1FYLA 2ZNZA 1H0MA 4IXAA 1P92A 1ZARA 4P5OA 2EFQA 5E1ZB 4ZH4F 5HS9A 5AIPA 3HRUA 3GFIA 2ESHA 1YFHA 3J81K 3KLNA 5F64A 3WTZA 2IA2A 1XN7A 1BM9A 4ZYEA 5LGTA 4KYWA 4CICA 2PMHA 4HX8A 1YTYA 2ZMEA 1TQPA 2ZMEB 3QP5A 3LQQA 4PZJA 2RQPA 2P5LC 4HX7A 4AD9A 2E7WA 3ZN0A 3WGIA 2O0YA 3FM3A 3BPVA 2K27A 3HTUA 2XVCA 1I5ZA 4OIPF 3C3WA 3NQOA 2VBYA 1P2FA 3GLXA 5ICEA 1R7JA 2ELHA 1FY7A 2E1CA 3HSRA 1WSUA 3KP7A 3Q9SA 3DFGA 4R79A 3ROUA 5LHHA 1IN7A 2F5CA 4BAYA 4BNCA 1SD4A 4MTDA 3GVAA 4FHTA 4N0BA 4KDPA 5D6FA 5A2QZ 1U2WA 3OOPA 4N9IA 3F23A 2QYOA 2RN7A 2EV5A 2W84A 5E20A 3VOEA 3F8FA 2XKOA 2ZCWA 3SHFA 1J0RA 1XGMA 3IC7A 2A68F 4LD5A 3BY6A 5LRRA 5D5WB 2DAOA 3DP7A 3IL2A 2EV6A 4RB2C 1QZZA 3JW4A 2V1UA 4HA8A 4HQMA 3V4GA 4HV6A 1SD5A 2VOPA 2OZUA 4Y13A 1NHAA 3LSTA 5DYMA 4L5JA 5CVIA 4ZYDA 3AAFA 2CYYA 5D4RA 2STWA 1BIAA 2KIUA 4G7ZF 3SQNA 1YS6A 1G4DA 2ESNA 5LEKA 4EV0A 1MD0A 3JTHA 3CUQA 1FYMA 3CUQB 4E70A 4U7DA 1HW5A 2YX7A 1OPCA 4Q48A 3W6KB 3BZ6A 2M8EA 1WQ2A 4H0EA 2Q2EA 2XAJA 1SMYF 4A2UA 2GA1A 2X0LA 5FGMA 1IF1A 3L9FA 3EETA 5DUKA 4KA4A 1MJAA 3J81Z 3FXUA 3KLOA 1MGTA 4D0PA 3GO5A 3DV8A 3MCZA 1JHFA 1O3RA 1T39A 3I71A 4PGGA 4PGHA 4UVAA 4ZZDA 4HBLA 2P5VA 4U7BA 1P6RA 1FBUA 2DK5A 3RIRA 4UXNA 3GWZA 3EDPA 3SFZA 5E8GA 1LDDA 4EJUA 1IAWA 3GFMA 3GYHX 2MLKA 1FC3A 2XIGA 2HOEA 3HRTA 2ZJ2A 5HLIA 1ZGJA 4M74A 1ZLKA 1DP7P 2LF8A 4I02A 2KJBA 4ON0A 1ULYA 5J8CA 1D8KA 3JSPA 1ODDA 2V79A 3L00A 1YO5C 4MNUA 4UUVA 1E2XA 1LEAA 4ZYHA 2NAZA 4I7HA 1XSXA 2E1NA 2UXXA 1FP2A 3LAPA 2K4BA 2OU2A 1G3YA 4M6YA 2FBIA 3CO7C 3SZPA 2A3SA 4LK0F 1B9MA 1T2KA 3CTAA 4QLCU 2MD5A 3T5XA 5FFZA 1QGPA 4XBFA 2F5FA 2R7DA 3I0TA 5ILSA 3FXQA 2HFHA 4GXOA 4A6EA 4G9YA 3RKXA 3TQNA 2P4WA 2HYGD 3WTUC 2YSRA 2VBWA 3ECHA 4AIJA 3WTWC 1XSDA 1RI7A 4HZFA 1ZHFA 2FRHA 2L4MA 2DLLA 5BQTA 3JAMK 2A61A 1XGNA 1BI3A 4A6DA 3HOTA 2KIFA 3O2PE 2KIMA 3WGGA 4HF0A 2Q0OA 2IT0A 2DU9A 1BC8C 2L4AA 5DUIA 1R00A 5EEHA 5HDGA 1XD7A 2HTJA 3TO6A 2MLGA 2K02A 4KIBA 3IRQA 1E17A 4Q5SF 1HBXG 2DPDA 2M1BA 5FFXA 1YLFA 2PQ8A 5AONA 3QOPA 5ICGA 1T98A 2EV0A 2HKXA 2VBZA 2AS5F 4CHUA 2QUFA 3L09A 2OD5A 1LQ1A 1HXDA 1KQ9A 1B1BA 2WC2A 1K7AA 3TDUC 4P55A 2JTVA 2GA2A 1PP8F 3WE2A 4GO1A 3T1BA 2O03A 4OMZA 1REPC 4FX4A 2OA4A 1EH7A 2QVOA 2VT2A 4O6JA 1O3SA 3EQLF 4MTEA 4G6QA 2UXNA 3IRRA 1B4AA 1O3QA 2VC0A 3NEUA 2RKHA 4NQWA 5BPIA 1F9NA 4L9NA 2EWNA 3GZ6A 1U8RA 1HKQA 4MHGA 2Y48A 1SFXA 4CZZA 1FOKA 4NHJA 5LHGA 1GHCA 1C0WA 2PN6A 1KU2A 1J5YA 3MWMA 3RKYA 2Z33A 2ZXJA 5D5UB 2JPCA 2L02A 2NYXA 3I59A 5D6EA 5LGUA 3I59B 6PAXA 4O3MA 3CDHA 3E5XA 2L3DA 2BYVE 1P4WA 2L01A 1S6LA 2VN2A 4HF2A 4BHBA 3KP4A 3NRVA 2K4JA 3F6OA 4R1HA 3WU0A 1R1UA 5CYVA 2RDPA 4FT8A 5JFRA 2VODA 2V1XA 1IW7F 2ISZA 3EYIA 2MH9A 2XAFA 3U9GA 3JSOA 2A5YB 3O3KA 4JK1X 2JRTA 3MEXA 2EA4A 4OOIA 2CSOA 1B9NA 2D1HA 3E5QA 3C7JA 3L7WA 2DBBA 1KQ0A 5ILUA 3JAMZ 2EA2A 1LB2A 5ILVA 4WF2A 4U0VA 1V4RA 1AOYA 2CW0F 2P7VB 1WRJA 5JHUA 4CO8A 3V7SA 4IF4A 3MQ0A 3R61A 1WKMA 3IWZA 1ZREA 5D8LB 2IA1A 3BPXA 3KP2A 3TDZC 4MQ9F 2OQRA 4AWXB 5E17F 1STZA 1GXQA 3HOSA 1FZPB 4L5IA 5H20A 1IXRC 1IRFA 1BI2A 4WWCA 4UV8A 5ERIA 5HS7A 1T38A 3F21A 2W25A 2DK8A 5K5OA 4CGZA 4LLGF 3VFZA 2D1VA 1ZGAA 1D3YA 2H09A 1T6SA 2YX4A 5HS8A 3ZMSA 4G94A 3HHGA 4XLPF 3RJPA 2BEOA 3GFJA 3HIFA 1ZRDA 4AVPA 1GXPA 2A6HF 1BJAA 5FD6A 2M87A 1FT9A 3BP8A 4RAYA 3MFKA 1MDMA 3V8JA 1MDMB 1Z05A 4OU0A 2QZ8A 1D5VA 4YFNF 2NNNA 3P9KA 2XKPA 2VE9A 3WTYC 1LVAA 3RI4A 2L54A 5FLXK 1AWCA 3V8KA 1R5GA 3TO9A 2ADUA 1BOAA 1IZ1A 3R0AA 4EM2A 2A07F 2XGXA 2UZKA 1FNNA 1H9GA 2V6CA 1R1VA 3F6VA 5BOXA 3QPHA 1ON2A 3MZYA 1G3WA 3LA7A 3Q5FA 3IKTA 5FO5A 3J7AO 1HW2A 4OMYA 4YG2F 4XSXF 1I1SA 4L9JA 3E3VA 3FF5A 3EYYA 2PFBA 2D45A 1BI1A 1TNTA 4ETSA 2H27A 3TO7A 4HW0A 3M1EA 3HTSB 2W24A 4KN4X 5FB2A 4I0BA 1HSTA 5D8KB 5CJ9A 4ZZLA 4U88A 1LNWA 2CWEA 3N97A 4KICA 4RGRA 5CVRA 2AXLA 2Z5UA 1HKTA 4Z2YA 2YU3A 2LNBA 2KJCA 4CDGA 1Z7UA 3P9IA 2IJLA 4U0WA 4P9FA 4ESBA 2NNYA 4EMSA 2Z99A 2F2EA 1OR7A 4K2EA 4HLYA 2JZYA 1MJBA 1FX7A 4IVNA 3WGHA 2P6SA 1Z6TA 1GVJA 3K1MA 2VT3A 4TV7A 4WXDA 2P8TA 2VXZA 3FMRA 5H6RA 1I6XA 2H94A 2Z3YA 1SFEA 1F4KA 2XV4S 3KP5A 3ABUA 2O3FA 2MBFA 2XAGA 1CF7A 1QPMA 1CF7B 1R58A 2FQ3A 4GGGA 1QBJA 1O7FA 4DNCA 5FLXZ 5L3BA 1RNLA 2FOKA 2EK5A 2P7CB 2LF7A 2COMA 3GXOA 1OYWA 4M71A 4WXCA 1P4AA 2G7UA 4XSZF 4F7ZA 1RZ4A 2DI3A 3P7NA 5J8FA 4A0YA 2E7XA 1S8NA 3GW2A 3KE2A 4KT5C 2LKPA 3TGNA 2HWVA 1DDNA 2QBYA 2QBYB 2QQ9A 1S29A 1ZN2A 2DFIA 2HDCA 4EGYA 1W7PA 4LB6B 1W7PB 3QU6A 1PDNC 1R22A 1OYIA 4B8XA 4A5MA 1ON1A 1R1TA 1BC7C 3QPTA 4IHSA 4PCQA 5DD8A 2A6EF 1W7PD 1RIOH 1UHMA 5LHIA 4ZYGA 2VC1A 1JGSA 4OIQF 2UWMA 3M7GA 2PLYA 2ZNYA 5L3EA 2DT5A 3RYPA 2ZFWA 2V1DA 4ASNA 2RC4A 2GIVA 4EVIA 4KNYA 2PG4A 3E6BA 3SZTA 1HQCA 4Y15A 5H6QA 4Q47A 2QLZA 3D5LA 1U5TC 3R4KA 2K86A 2BGCA 1SMTA 5LEJA 5LLQA 2HR3A 1U5TA 2CGPA 5L3CA 3B73A 4M73A 2GQQA 2PMUA 4FX0A 2O61A 2BV6A 3K2ZA 1FBQA 2J5OA 3WE3A 5K1YA 4L9TA 1OMIA 1Z9CA 1IRGA 2GXGA 3ZMUA 4HQEA 1KU3A 4LLNA 1L0OC 5D5XB 5TJJA 3KEOA 1ZRCA 5K5QA 5HVQC 3QP6A 2PJPA 1TW3A 3H3ZA 5L3GA 1KA8A 3ERED 3HHHA 3LWFA 1R5HA 2M5WA 3K69A 4RGXA 4P9UA 5KK1A 3L2CA 1OYYA 2XRNA 3EUHA 1O57A 4HOBA 1XB4A 3PFIA 2VONA 4IHTA 1XCBA 1YS7A 2FSWA 2FF4A 4L0YB 2KKOA 1XMKA 3WG9A 2YPRA 1IUYA 1F1ZA 1J7KA 3CUOA 2CG4A 1RUOA 3FXRA 3GEZA 3RYRA 3F8MA 1MJ9A 1R23A 1BI0A 3KEQA 4XLNF 5L3DA 3BOQA 1I27A 3JTGA 2W57A 5BS6A 3N4MA 4KMUX 3FX3A 2O8XA 1V3FA 3DPLC 4U0YA 1B59A 1FYKA 5LRSA 4RGUA 3HSFA 4WCGA 4LGWA 5LBQA 1XGOA 4IRGA 1UB9A 5ICFA 3K0LA 3ZMTA 1YYVA 2IA0A 5BMZA 2OQGA 5ED4A 2D2WA 1PUEE 2R3SA 3U2RA 5DV5A 4HF1A 5CVJA 2DO7A 3J80K 3DXJF 4LK1F 4N9HA 4MEXF 2MA3A 3G3ZA 2FNPA 4WX9A 2X4HA 1P4XA 5JR3A 1OKRA 3K1PA 2XROA 2PBIA 1A04A 4HDUA 3G73A 3WTVC 1XMAA 2TDXA 1KU7A 3I53A 3DPTA 4CYDA 2ZBKA 3F72A 4OIRF 1HKSA 2FA5A 4JQFA 2ZO4A 2QWWA 1YG2A 3F8BA 2RV8A 3KZZA 3KP3A 3KZYA 4L9VA 4MEYF 2P5KA 3E6CC 4GYGA 5DD4A 1HSJA 4L0ZB 3U1DA 3KCCA 1IXCA 2GWRA 3ZN1A 1FWZA 1TLHB 4I01A 4RS8A 5LGNA 1SD7A 3IHUA 3WU1B 4M9ZA 2DTRA 1U6GA 4ENJA 4HDVA 3IWFA 3FMQA 3F3XA 4IRIA 4AIKA 3MAJA 1JHHA 1XDSA 1ONVA 3C1DA 3ZQ7A 3T8TA 3REOA 3GZ5A 4EJVA 2Y0MA 1UHWA 2CQKA 3VEPA 3I5UA 2BBYA 4RGSA 5J6XA 1ZYRF 5D5VB 4EJTA 2CFXA 2R7FA 4I98B 4A0ZA 4ENNA 3P9CA 2HS5A 2HKOA 1QZYA 2XAHA 1ZLJA 5E1XA 1USSA 1J59A 2F5DA 4MGRA 3CLOA 2HYFA 4PDKA 2IVMA 4QWQA 1XCVA 3I54A 1TNSA 5HOOA 4UHTA 2VE8A 4IRHA 1VTNC 5K5RA 2GZWA 5AIQA 4EJWA 1FP1D 2RNJA 5E8IA 2OZ6A 4EGZA 2IW5A 1WI9A 1DPUA 1U3EM 1H9TA 1DUXC 1Z6RA 2G9WA 1WWXA 4M9SA 3C18A 5HDNA 4KIGA 1QO0D 4LFUA 3H3UA 3ZPLA 3FMSA 3WTTC 3V8LA 2OAZA 2XUBA 3ECOA 3K1NA 3ZMVA 2QQAA 5JI6A 3J80Z 4A0XA 1S3JA 2DQLA 2HTSA 2NS0A 3T0YA 1UFMA 4RB1A 3KFWX 3ZP5A 3I58A 5DCMA 2DQRA 3E6MA 5DCMB 3GUDA 1QQIA 3FWEA 2JT1A 4EM1A 2H6CA 1T0FA 1KGSA 5E18F 3T8RA 3TKYA 2WTEA 3M9AA 2VBXA 4A12A 4BH9A 5TRDA 5F6FA 5L3FA 3H92A 2FMYA 3ABTA 2ISYA 1Z1DA 1I1GA 2HGCA 3I4PA 3M8FA 2F5EA 5IT9K 4ESFA 4XRFA 2JPBA 4R8HA 2H6BA 3D0SA 3FHZA 5E1WA 2NRAC 1QNTA 1XGSA 5ICCA 3W6JB 3WODF 2V9VA 1W4MA 2QENA 2HQRA 4HAMA 3FZVA 1LDJA 4LMYA 4YFKF 2DPUA 3FM5A 3IKVA 3F8CA 2G7HA 1ZH5A 3BJ6A 3CUQC 1HW1A 1X3UA 4KN7X 4BHPA 2LSOA 1W5TA 2EB7A 3RTRA 2FBHA 3ZMDA 2YR2A 3S2WA 5DCFA 4YIIA 3RDIA 3I64A 1S7OA 2WV0A 1EH6A 4DQ2A 1ZAOA 4RAZA 1MKMA 3ULQB 3QAHA 2IPQX 2IP2A 2EFNA 3WTSC 2PEXA 2M30A 2FU4A 5CVUA
chains in the Genus database with same CATH superfamily
1Q1VA 2XASA 1SD6A 3ABLH 4UB6C 2VOOA 1G3SA 1G6NA 3CD6I 3E7LA 2FEZA 3TW6A 1MNEA 4C9YA 2JK3A 1Z0XA 4JBAA 2EH3A 4MQVA 2FXAA 2P6TA 1NK2P 4S0HB 4AIHA 2ACJA 3R6SA 1Y1WJ 1LFBA 1ETKA 1IC8A 5KVRA 3CO6C 4LB5A 3TOBA 2PX9A 2E2IJ 4OIOF 2F4IA 1X3ZB 2GXBA 4A3CJ 1KU9A 5JVTA 3RPQA 4ZTJA 4LG0A 1U8BA 4LG0B 1Q1HA 4EATA 1FOYA 1KYWA 4BXUA 3GX4X 1X4PA 1JKPC 2Y30A 2Y0SA 4KUMA 5F1JA 3BJAA 3A01A 3QRFF 3A01B 5J1RA 2BZTA 2OBPA 5BPDA 1H89C 2HZTA 4G8XA 2OTJI 2LC2A 2GOMA 3LA2A 2LP0A 3NWTA 5FKLA 4XLHA 3Q9VA 2KRFA 5F1RA 3DWLE 1FBSA 1MH4A 5HLGA 1R36A 2R7TA 2FX0A 2X9DA 2J5PA 3OL4A 1O3TA 1BBYA 4PJNA 4YFXF 3F22A 1YIJI 3PQKA 5DDGA 3FISA 2YU9J 2EFOA 2ZJQF 3ERMA 3HUGA 4Y17A 2XRLA 3HUGB 2L7MP 4BQAA 3Q3SA 4J01A 3OYEA 4KFCA 1IN8A 1OCTC 3DKWA 4RM3A 4D5FA 3E97A 1KYZA 4G7HF 2HVSA 5EEGA 1LEBA 2K3PA 1W5SA 3EUKL 4I99C 2DA3A 5JLWA 4B09A 4E7SA 2E19A 2DFHA 4FE4A 4O5VA 3ZQGA 5JHFA 5EG0A 2DN0A 3S1QJ 2HZDA 3HRMA 5EG0B 1TW2A 4M6XA 4ENKA 1GLNA 2M2EA 4KIFA 3KETA 4XOPA 4GRIA 3CMEI 1AKHA 3K4CA 5JLXA 3ABKH 1L3LA 1AKHB 2MC3A 2EFPA 5IT3A 1J2XA 2EIJH 3ML6A 5IT9Z 2STTA 3A03A 2ZB9A 2VJIA 4RB0A 3X2QH 2LREA 4GCVA 3JRCA 5FLMJ 2BY1A 2Y75A 3RPUA 3O6BB 1BW5A 2FQ4A 3OYHA 2FE3A 4HEA2 1IN4A 3U1KA 3COAC 5F04A 2HQNA 3IH4A 1XX5A 4CCMA 1X4OA 4S04A 1USTA 1R9TJ 1W36C 1S9HA 2QM3A 3BWGA 4NUBA 3TBIA 3RPUD 3LQRA 1WH5A 3OIQA 4XKWA 3FBIB 3ZR8X 3LAJA 1XDUA 4XLFA 1RUNA 1IXSB 1LJ9A 4DBRA 1TBXA 1ZK8A 1U5TB 2W4SA 5FD5A 4M3EA 2JSCA 1PP7U 2O6GE 1OFCX 4UNOA 3BR2A 3RKWA 4C3IJ 1S7AA 2HPIA 1WHUA 4YRVA 3S32A 1FJLA 3E6DA 4BGDA 3CF5F 1I6HJ 4BYYA 2AO9A 2IGNA 2C6YA 3TW7A 2QKMB 1FLIA 1JXSA 2FMLA 1BIBA 3W3CA 4BEHA 5FROA 4BEHB 4ESJA 3DTKA 2X1DA 2XAQA 4BE2A 1J75A 1TQMA 3BROA 1F5TA 5HLHA 2B0LA 3LSRA 2ELKA 4A3JJ 2JJ7A 2DYSH 3FXOA 4HV5A 4UVBA 4I2OA 2DW4A 4ZDPA 2CV0A 1WVRA 2L7ZA 1VQLI 3JRFA 1Z91A 3LSGA 1Y0UA 4CSWA 2QQBA 3W2VA 1R49A 4V2GA 4E7JA 1K78A 1K78B 1YIOA 3CJTB 4N4NB 1MZBA 1V5EA 5LFAA 2XHKA 1FPQA 4MFEA 3GMEA 2L2OA 3QU3A 3B02A 1ZG1A 4Y7NJ 4I09A 1X19A 2W85A 3CJNA 5CLSA 4HYEA 3KP6A 2Y9ZA 3ELKA 1K6OA 1U78A 2VQLA 2RREA 2CFOA 1LUJB 2M45A 5DM6F 1JJ8C 1KQ8A 3HSEA 4IPAA 4Y3OA 4L18B 4G6DA 2MH2A 1TWHJ 3IV5A 3NARA 3SXYA 2V9KA 3A02A 3KZIC 3MZHA 1JT0A 1N78A 1UCRA 5TISC 1BN5A 1RC9A 2L9NA 2IGMA 2VPLA 2DYRH 4PJMA 3QQAA 4P96A 4EQQA 3PQJA 1OCCH 3MKLA 4OINF 1YE9A 4YIFA 3GFLA 3OS2A 4Y52J 1N77A 2BY2A 2VKHA 4XKBA 1VQ4I 2X51A 1V5GA 2BXZA 1YW8A 3BG9A 2ZJRF 3K4KA 3WTXC 3R0JA 3MZ8A 4UVCA 2P7CB 1F36A 2UV1A 1JE8A 1SANA 3ESWB 2QSFX 4WK8F 2VASA 2WAEA 1LVKA 1IN6A 2FBKA 3W2AA 2O9LA 2OC6A 3CCMI 3M8EA 2X6XA 3K9TA 5CVVA 1CGPA 2QSGX 4I0AA 3DBRB 1DQUA 1FTTA 1IUFA 3ZQQA 2M4GA 1FSHA 1K79A 1T95A 3OYFA 3L2VA 2Y31A 2KDOA 3DF8A 1D8JA 4HLXA 3HPHA 2Z9OA 2KISA 1MMDA 4S05A 4KMFA 4BJTA 3HRSA 1YW7A 3DQVC 2KDZA 1HF0A 1WGXA 1XG1A 4RDUA 2JN6A 1ZG3A 3DKXA 2IXSA 3DEUA 4LJZF 2CUZA 2OF7A 4ANJA 4M9XA 4LLLA 1SAXA 1Z3YA 1IV6A 1WJBA 2WAQN 1IN5A 2DJIA 4XICA 2ETHA 3AL0B 2ZKZA 2P81A 3BDDA 1TTYA 2QA4I 3OV8A 2B63J 3LFKA 3A0HC 3BJOA 3DLAA 1S5LC 4EM0B 3LSPA 1ZG5A 2RGVA 1O7LA 2QEXI 4BDZA 4FISA 3CCLI 3CZ6A 1YQAA 4A3EJ 1FSEA 2A69F 1EH8A 1LDKB 1G3TA 2EPFA 4A5NA 3IAM2 3BR0A 3R60A 5FRMA 5B66C 2F4OB 3O8GA 4CH7A 3K70D 5A2QK 4Q4ZF 2JA8J 4RB3C 4UV9A 2HEOA 2Q1ZB 4NB5A 2DCEA 1EV7A 5HDKA 1MMGA 2FNAA 2Q8KA 3KX2A 2VUMJ 2LDUA 3S3NA 1UG0A 2EJRA 3E5UA 3LOCA 2EFWA 2KHMA 4GYIA 3G2BA 1H8AC 4M72A 1SFUA 3HEFA 4XRSG 1DPRA 2LR8A 3OYGA 3H9QA 1U9OA 2BE5F 1B6AA 1IO2A 2DA4A 3JREA 2HI3A 4IJAA 3CC7I 1TQIA 2K9SA 3GF2A 4CXFA 3H3VK 4IO9F 2K7LA 1YW9A 1FOWA 2PI0A 3HOXJ 3ISPA 1MMSA 2XGDA 3UNGC 4BHCA 4EJOA 4KT6A 3VYSB 5DEQA 3HXLA 3VODA 3ZMZA 2GAUA 4B44A 4PSXA 3JRDA 2R7RA 2WWYA 4HX4A 1T33A 2X1EA 2HXIA 1BR4A 3LA3A 2RVCA 1RR7A 3ZQIA 3VB2A 1XSVA 3TOAA 5CQGA 4WXHA 3WHCA 5D4SA 3O8HA 2CO5A 5EGOA 1ZRFA 3FHNA 1J9IA 5EGOB 2XAUA 5M5XJ 3AFHA 4ENMA 3VSKA 4G7OF 2DA2A 1VNDA 3F8NA 3HYIA 3RCOA 3V7CA 4I76A 3F9KA 3V7RA 1FYLA 2IRFG 2TRTA 4IQJA 2ZNZA 1H0MA 4IXAA 2Y0SN 1P92A 5IYBJ 5K7FA 1JKRC 3WHBA 5GPAA 1ZARA 4P5OA 3K7AJ 2EFQA 2ZC2A 3L1PA 5E1ZB 2DOEA 4BS9A 3PNVA 4ZH4F 3OYJA 3PFYA 1IDYA 5HS9A 5AIPA 1K4SA 3HRUA 3GFIA 2ESHA 1MMAA 3G1OA 4E4HA 1YFHA 3J81K 1POGA 2BVMA 3KLNA 1IDZA 3DEEA 5F64A 3WTZA 2IA2A 4BY7J 1XN7A 2VQGA 2L5QA 2R7ZJ 1BM9A 1G8XA 4ZYEA 1YJWI 5LD2C 1E3HA 2E2JJ 5LGTA 2W00A 1WFXA 4KYWA 3DTIA 4A69C 4CICA 5HNHA 4AM3A 2PMHA 3CDIA 4HX8A 1YTYA 2XF5A 3DPUA 2JUGA 3S14J 4CUGA 4U87A 2ZMEA 1FOXA 1TQPA 2M7BA 2ZMEB 2KQRA 1I39A 3LQQA 3QP5A 4XKVA 4PZJA 4BU2A 2RQPA 2P5LC 1FIPA 4HX7A 4XK4A 4AD9A 2MW8A 3SJMA 2E7WA 9ANTA 3ZN0A 3WGIA 1DU0A 3CQZJ 2XSDC 2O0YA 2AHQA 1VQ9I 4JX6A 3FM3A 2KRCA 3BPVA 2K27A 3HTUA 3ZRGA 4F3QA 2E1MB 4M3GA 2XVCA 1I5ZA 4OIPF 3C3WA 3NQOA 2VBYA 1P2FA 1S7EA 3GLXA 2R93J 2LKSA 4IL6C 1OLTA 2ME0A 3H9JA 4OAZA 4KISA 5ICEA 1R7JA 4EEFG 1V54H 2ELHA 3L2WA 1FY7A 2IS4A 3KEYA 2E1CA 3HSRA 2M9HA 3S8PA 1WSUA 1OQYA 1D1BA 1R6RA 2CS3A 3KP7A 1ZELA 3Q9SA 3DCFA 3BG7A 3DFGA 1D1AA 3FK6A 4R79A 2E34A 3ROUA 5LHHA 1IN7A 3ABMH 1DGRM 3PNTA 4F93B 3SYTA 2F5CA 4BAYA 3GTMJ 4BNCA 5F0FA 1SD4A 1OCZH 4MTDA 3GVAA 4FHTA 4N0BA 2X6WA 3OYLA 4KDPA 2NVUB 5D6FA 5A2QZ 1ZTRA 1G2HA 1KONA 1U2WA 1TWAJ 5B1AH 1VZ0A 3OOPA 4N9IA 3F23A 3OS0A 2QYOA 5KNLA 2RN7A 2EV5A 2W84A 1WCMJ 1QA6A 1MBJA 5E20A 2JSPA 3VOEA 3F8FA 2DJNA 3SEQA 2XKOA 2ZCWA 3SHFA 4L5EA 1J0RA 1SC7A 1XGMA 3IC7A 4BXXJ 2JWTA 3AG3H 2A68F 4NC8A 4LD5A 3BY6A 5LRRA 1TP4A 2DAOA 5D5WB 3DP7A 3OYKA 3IL2A 3M4OJ 2EV6A 1RPWA 1QZZA 3JW4A 3W2WA 4AU7A 4RB2C 2V1UA 1WPKA 5KAFC 3ZQCA 2PJRA 2PJRB 5EDNA 1JUSA 4HA8A 3B6CA 4NC6A 4HQMA 3V4GA 4HV6A 1SD5A 1YRNA 4XR6A 2M0MA 2EZHA 2IGKA 4LG3A 1YRNB 3K4LA 2VOPA 1SAUA 2OZUA 4Y13A 1NHAA 3LSTA 4Z6YA 5DYMA 4L5JA 1Z67A 4XM3A 5CVIA 4ZYDA 3AAFA 4IHYA 2CYYA 5J1YA 1QHGA 1HOMA 4E7KA 2CQ7A 3BCAA 5D4RA 2STWA 4BQQA 3C2HA 3VPRA 5HNFA 3NWSA 1WJCA 4MLOA 1BIAA 3PUBA 2KIUA 3G4SI 4G7ZF 1Y0NA 2NVXJ 4B43A 3SQNA 3K10A 1LFPA 3ZQFA 2H8RA 1YS6A 1X58A 1G4DA 3C2BA 1NG7A 4GDFA 2JMWA 2ESNA 2QQ8A 5LEKA 3QYFA 4EV0A 2LBFA 1MD0A 3JTHA 2LBFB 3IAS2 3CUQA 2O5RA 3DKYA 3CUQB 1FYMA 2LRDA 3MKWB 4E70A 4D7MA 2WAFA 4U7DA 1OISA 1OR7C 1HW5A 2Z2SB 5F0HA 2YX7A 1OPCA 2MG4A 4Q48A 3W6KB 2EZIA 3E0JB 1R4MB 2O7OA 3BZ6A 3H5RA 3SDBA 3LNQA 5GPCA 2M8EA 1WQ2A 2K9QA 1NH3A 4H0EA 2H1KA 2Q2EA 2XAJA 1SMYF 2Q2EB 4A2UA 4BACA 1EA3A 2GA1A 2R5ZA 2CRGA 2TCTA 2X0LA 5FGMA 2R5ZB 1IF1A 3L9FA 1G59A 3QODA 3EETA 2DDAA 5DUKA 4KA4A 1MJAA 3J81Z 3FXUA 3KLOA 1MGTA 4D0PA 1U9NA 3GO5A 1HDPA 3DEWA 3DV8A 3MCZA 3GTJJ 1OCOH 1JHFA 3FXKA 4OAYA 4XQFA 1O3RA 5B1BH 2VJ5A 1T39A 4G6TB 3I71A 2BHYA 2KPMA 3BTLA 4PGGA 1JKOC 3PIPF 2EBIA 4PGHA 4UVAA 3U21A 4ZZDA 2R0QC 4HBLA 2K85A 3MD2A 3CCRI 2Z1DA 2P5VA 1YITI 4U7BA 1P6RA 1FBUA 2DK5A 2MABA 1WJAA 4XIDA 2FUG2 3RIRA 4UXNA 3GWZA 3OIPA 4B4CA 3CMAI 3EDPA 4RLQA 3SFZA 1APLC 5E8GA 5JVGF 1LDDA 4XKCA 4EJUA 1IV8A 1IAWA 3GFMA 3GYHX 2MLKA 1FC3A 2XIGA 2HOEA 3HRTA 2ZJ2A 3HM5A 2K40A 5HLIA 3S1MJ 1ZGJA 4M74A 1ZLKA 1DP7P 2LF8A 3N05A 4I02A 4M3DA 2KJBA 4ON0A 1ULYA 5J8CA 1D8KA 4XLCA 3JSPA 1JGGA 1ODDA 3HB9A 3M07A 4ZC3A 1MH3A 2V79A 3L00A 5IPAA 1YO5C 4MNUA 5FJ8J 4UUVA 3H36A 3D5SC 1E2XA 1LEAA 1D0XA 3H5AA 2MD0A 4ZYHA 4ABZA 2NAZA 1ETVA 4RMNA 4I7HA 3BZCA 1XSXA 4NBQA 2E1NA 2VKVA 3AG2H 1BJZA 4XRMA 2K3FA 2UXXA 1FP2A 3CLQA 1SEUA 4E6KG 3LAPA 4HNUA 2K4BA 2IAIA 2VKDA 2OU2A 1G3YA 4M6YA 2FBIA 4A93J 3CO7C 3SZPA 2A3SA 4LK0F 4D1QA 1B9MA 1T2KA 1K61A 3CTAA 2HOTA 4QLCU 4DZPA 1Y8RB 1D1CA 2DA7A 4D9JA 2MD5A 3T5XA 3CCJI 4RA2A 5FFZA 1ZGWA 1YJ9I 3RZDJ 1QGPA 2CMPA 3CMYA 4XBFA 2F5FA 1V55H 2R7DA 4AVZA 3I0TA 5ILSA 2D5VA 1W1WE 1TWCJ 1MBKA 3FXQA 3CMMA 4C30A 3LMMA 2HFHA 3RQ4A 4GXOA 4A6EA 3M3YJ 4G9YA 3RKXA 3TQNA 1NG6A 2P4WA 3K4BA 2HYGD 3WTUC 2G0EA 2YSRA 4DYCA 1SFKA 2VBWA 3Q0UA 4E7ZA 2KP6A 3ECHA 1D0ZA 4AIJA 1ZKGA 1UELB 3CDLA 5IOZA 1VF9A 3WTWC 1XSDA 1X2NA 3K6GA 1RI7A 2DOFA 4B47A 3OY9A 4IQ4A 4HZFA 1ZHFA 5FKOA 2FRHA 2L4MA 1VQNI 3HGGA 3PUFA 2WY7Q 2DLLA 2V6EA 5BQTA 3JAMK 1MSFC 2NVYJ 2A61A 2DMNA 2Z16A 1XGNA 2AQEA 4QIWN 1BI3A 3J7AY 3A4CA 3O2PE 2KIFA 3OR2C 3WGGA 2KIMA 4A6DA 3HOTA 2B9SA 1W36D 4NDLA 4HF0A 4BJ6C 2CUFA 2Q0OA 2IT0A 2DU9A 2AQFA 3HL2A 1WJ5A 2NOJB 1BC8C 1AHDP 2LYCA 4Y33A 2L4AA 5DUIA 1R00A 5EEHA 5HDGA 2KZVA 1XD7A 1K83J 3JRBA 3AKZA 2HTJA 3TO6A 2MLGA 5KCMA 2K02A 4KIBA 3IRQA 1E17A 2NS8A 3GZNB 5J4YA 4Q5SF 1HBXG 4BBRJ 2EIKH 2DPDA 2M1BA 5FFXA 2PQ8A 1YLFA 1MBGA 1RETA 5AONA 3QOPA 4KITB 5ICGA 1T98A 1XTAA 4QTRA 1QPIA 2EV0A 5C44J 2HKXA 2VBZA 2AS5F 4CHUA 3BCBA 1RRJA 1QVUA 2QUFA 3L09A 1LFUP 3A1YA 2OD5A 1QU3A 1LQ1A 1HXDA 4AC0A 4XMYA 1KQ9A 2CV2A 1B1BA 2WC2A 3OYMA 3RZOJ 1VQ7I 3EUHC 3MVPA 2JA2A 1K7AA 3A2KA 3TDUC 4P55A 2L9SA 4XORA 2JTVA 2GA2A 2NXNB 2ZSIB 1PP8F 3WE2A 4GO1A 4JOMA 3T1BA 2DMUA 2O03A 3CCVI 4OMZA 1REPC 1OCPA 2LMDA 2LY2A 3GTLJ 4FX4A 2OA4A 1EH7A 2QVOA 2VT2A 2VB6A 3BR1A 5IYDJ 4O6JA 2CU7A 1JTYA 3EQLF 2PMZN 1LKXA 1O3SA 2CQQA 4MTEA 2I8DA 4G12A 4G6QA 3IP4B 2UXNA 2RNGA 3CCYA 3K4NA 3IRRA 1B4AA 1JJ6C 1O3QA 4UY8I 2VC0A 3NEUA 2RKHA 4NQWA 1TT0A 1D5YA 4NQWB 4BY1J 1JT6A 5BPIA 3SFIA 1F9NA 3KPHA 1ITYA 2KFDA 4L9NA 2EWNA 5F0CA 3GZ6A 1U8RA 3CC2I 1QVTA 5C4XJ 1WZ2A 1HKQA 4MHGA 2A5WA 3GTQJ 2Y48A 3FK7A 1SFXA 1OCRH 4CZZA 1FOKA 5LHGA 4NHJA 3JCUC 1YOVB 1R71A 5GAHJ 4XRSA 3DU5A 3KYLA 2IS6A 1GHCA 1C0WA 4F92B 1X1PA 2PN6A 1KU2A 1J5YA 3MWMA 3PM1A 2DXIA 3RKYA 2R92J 4DOZA 4X6AJ 2Z33A 1P7IA 2ZXJA 5D5UB 2JPCA 4I6ZA 2L02A 2NYXA 3I59A 5D6EA 5LGUA 3I59B 2JVHA 3HJEA 6PAXA 4O3MA 2MYSA 3CDHA 2R7SA 3E5XA 2L3DA 2BYVE 4FETA 2E36A 1P4WA 2QGUA 2L01A 3FBNB 5K7ZA 2HQAA 1S6LA 2F48A 2VN2A 4HF2A 4BHBA 3CJQB 3KP4A 3JRIA 2BOLA 3NRVA 2WY8Q 3VYRB 2K4JA 3F6OA 4R1HA 2ME6A 3GTKJ 3WU0A 1R1UA 3LSKA 3WG7H 5CYVA 3QPLA 2RDPA 4FT8A 5JFRA 1HLVA 2VODA 3PO3J 1QHHD 2V1XA 1IW7F 2IEKA 1X2MA 3QPSA 2ISZA 3EYIA 1FIAA 2MH9A 2XAFA 3U9GA 2OCCH 3JSOA 4IEJA 2NVTJ 2A5YB 3O3KA 2R7XA 1P9QC 5TGTA 4BKXA 5B5EC 2R7QA 4JK1X 1ETYA 2COBA 2JRTA 3MEXA 4UUSA 2EA4A 3PIOF 4UUSB 1VFCA 4OOIA 1VQKI 2FJ1A 2CSOA 2E35A 2CUJA 1B9NA 2D1HA 2WB1N 3E5QA 3C7JA 2YS9A 1Z77A 3L7WA 4HNVA 2DBBA 1SVMA 2OV7A 1HA8A 1KQ0A 5ILUA 2DFFA 3JAMZ 2EA2A 5GTHC 4IHWA 2L9VA 1LB2A 1A36A 1PVEA 5ILVA 2LKXA 2X48A 4WF2A 4U0VA 1V4RA 2VQHA 1AOYA 5HLTA 2CW0F 2P7VB 1WRJA 1MBFA 5JHUA 4CO8A 3HOVJ 5FKNA 1AA7A 4A3GJ 2VL8A 2JA5J 3V7SA 4IF4A 5K7HA 1IRZA 3MQ0A 3R61A 4ZTFA 1WKMA 3H0GJ 4PSWA 3IWZA 4BL0B 1ZREA 1WJDA 1TWFJ 5CKTA 5D8LB 1YJNI 5GP9A 2IA1A 3HOZJ 4JX5A 3BPXA 3KP2A 3TDZC 4MQ9F 3HOYJ 3I55I 2OQRA 1ZR4A 4V19K 4AWXB 5E17F 1GV5A 1STZA 3DLLF 1GXQA 5E3MA 3HOSA 3SZGA 1FZPB 3HG9A 3A0BC 3GBGA 4L5IA 5H20A 1IXRC 4F91B 3EUAA 1MIJA 1IRFA 1BI2A 4A3KJ 4WWCA 4UV8A 5ERIA 5HS7A 1T38A 5GAGJ 2N8GA 2XGEA 3F21A 2W25A 5M5WJ 3BQYA 3VYTB 2IS1A 1D0YA 1JUMA 1Y1VJ 2DK8A 5K5OA 4CGZA 5FLVA 4LLGF 3JRAA 1A5JA 2WV1A 3VFZA 2D1VA 1ZGAA 1J09A 1UHSA 1WJFA 2A6TA 1D3YA 4HG2A 2H09A 2M8GX 1T6SA 2YX4A 5HS8A 3QYEA 2QCOA 3EPZA 1EF4A 3ZMSA 1IG7A 4G94A 3HHGA 3BR5A 2MFZA 3I3LA 4XLPF 1DU6A 1A31A 3ZXSA 3RJPA 2BEOA 3GFJA 2GBYA 3HIFA 3S3MA 4C3JJ 3S3OA 2M4KA 1ZRDA 4AVPA 4RAFA 1JTXA 1GXPA 1PJRA 3OYNA 2A6HF 4LIUA 2WADA 2DT6A 2LLKA 3VDXA 2VPRA 1BJAA 5J3LA 2FD5A 5FD6A 3OIOA 4RLFA 3VYUB 2DA6A 2JA7J 5FKMA 2M87A 2M0CA 3OYBA 1OJLA 1FT9A 3BP8A 4RAYA 3MFKA 3ASOH 1MDMA 3V8JA 3JR9A 1MDMB 1Z05A 1VQMI 2Y69H 4OU0A 2QZ8A 1KZHA 3FXJA 1D5VA 5IOYA 4YFNF 2NNNA 3P9KA 2XKPA 5C3EJ 1DP3A 1BR2A 2VE9A 2KRHA 3WTYC 1LVAA 1JUPA 3L2RA 3RI4A 2L54A 2GOXB 5FLXK 4MFDA 4M3BA 1AWCA 2EIMH 3V8KA 4HRIA 1R5GA 2V4JC 2M3AA 4OWRB 1TWGJ 4V2FA 3CJRB 3TO9A 4KJZA 2HU9A 2ADUA 2R7WA 1BOAA 3HKZN 1IZ1A 4QPOA 1W0UA 3R0AA 3FXLA 2PMZA 4EM2A 2A07F 1FMVA 2XGXA 3KYDB 2VI6A 2UZKA 4AIDA 1FNNA 1H9GA 3PSFA 2V6CA 1R1VA 4E7HA 2P0WA 3F6VA 1WI3A 2L9RA 1Z3XA 4CCLA 5BOXA 3QPHA 2BY0A 1ON2A 3MZYA 1G3WA 3DBLB 3LA7A 3IKTA 5FO5A 3Q5FA 2JQ7A 1T0FC 3J7AO 1HW2A 4OMYA 4YG2F 5EJCA 2HQ5A 4JX4A 4XSXF 1P7JA 2LFBA 3CCSI 1ETOA 1I1SA 3QYBA 2BW3A 1I3QJ 2BW3B 2K9MA 4L9JA 3E3VA 2R7UA 3S15J 3FF5A 5EYRA 3EYYA 2DTZA 2LD5A 2PFBA 3CCEI 2D45A 1BI1A 2GLOA 1TNTA 4ETSA 3H5NA 2H27A 4A3BJ 3GTPJ 3TO7A 3OWTA 2CH0A 4HW0A 4NNJA 3M1EA 1X1DA 1VQ6I 1F43A 5BNGA 3HTSB 1NK3P 2W24A 2NOGA 2R7OA 4KN4X 2KMUA 5DM7F 5FB2A 4YIRX 4I0BA 2XGCA 1HSTA 5D8KB 5CJ9A 4BQOA 2BVLA 4ZZLA 3I4MJ 3LSHA 4U88A 1LNWA 2CWEA 3N97A 4KICA 3PJRA 4RGRA 5CVRA 5FRNA 1WH7A 2H1LA 4YEJA 1BL0A 2AXLA 2Z5UA 1HKTA 1XS9A 4Z2YA 2YU3A 4DBQA 2HYJA 1RESA 2LNBA 2KJCA 4CDGA 3QOEA 5GTIC 1Z7UA 3P9IA 1GVDA 2LY1A 5IYCJ 1K6YA 2NVQJ 2IJLA 4A3LJ 1I50J 4U0WA 4P9FA 2XPWA 4HNTA 3S2DJ 4LOCA 3RSNA 4ESBA 2NNYA 3G71I 1PUFA 1MNDA 3UKGA 3BG5A 1PUFB 5J40A 3OYCA 1QZEA 2WB1A 3TP3A 4EMSA 2Z99A 2F2EA 1OR7A 4K2EA 4HLYA 2OPTA 3S1NJ 2JZYA 3FXMA 1MJBA 4DZJA 2M34A 2L0KA 1FX7A 4IVNA 3WGHA 2W7NA 4DGWB 2P6SA 1FTZA 3PO2J 1Z6TA 1GVJA 5HODA 1FEXA 2EINH 3K1MA 1H88C 3AG1H 1R5ID 4CZCA 2ICWG 5DTDA 1MNMC 1WJEA 3L2QA 1RR8C 4J00A 2VT3A 5F27A 2JA6J 2WBMA 4TV7A 4WXDA 2L7FP 2P8TA 2VXZA 3FMRA 3OL3A 5H6RA 2YUSA 3HC7A 3G1MA 1I6XA 1R4NB 1VQPI 2H94A 2Z3YA 2VJ4A 1SFEA 4MIMA 4BE0A 4UB8C 1F4KA 4FCYA 2XV4S 4J19A 3KP5A 3IUOA 2V26A 3ABUA 1Z7LA 1LE8A 2O3FA 2MBFA 3GCMA 1LE8B 2Y9YA 2XAGA 2QKLB 1QPMA 1CF7A 1CF7B 1R58A 2FQ3A 1TL8A 3HBLA 1U0JA 4GGGA 1B72A 1QBJA 1O7FA 4DNCA 1B72B 5FLXZ 3Q0WA 2ECCA 2CW7A 1RNLA 2FOKA 2EK5A 3K4MA 2V1NA 5L3BA 5DS9A 2DT7B 2LF7A 3OSFA 3RQIA 2COMA 3GXOA 1OYWA 2X6YA 4M71A 4WXCA 2E5NA 3HOUJ 2HNHA 1P4AA 2KL4A 2G7UA 4XSZF 4F7ZA 1RZ4A 1Y6IA 2DI3A 2V9PA 2XPUA 3P7NA 4B3AA 5J8FA 4A0YA 3OR1C 1Y56A 2E7XA 4UUTA 1S8NA 4C2TA 3GW2A 4B1RA 3KE2A 2F4MB 3B6AA 1B8IA 1B8IB 5H2FC 2CQNA 2V7FA 4KT5C 2RAEA 2K9LA 2ZJPF 1ZQ3P 2HOAA 2X85A 2LKPA 3TGNA 2HWVA 1RKTA 2M7AA 1DDNA 2CW8A 2QBYA 1FMWA 3J7ZI 2R5YA 2QBYB 2R5YB 2QQ9A 1MBEA 1X1BA 1S29A 1ZN2A 3CC4I 4C2UA 2DFIA 2HDCA 1VQ5I 4EGYA 1W7PA 4LB6B 1W7PB 1I3AA 3QU6A 1PDNC 1R22A 1OYIA 4B8XA 5GAEJ 2A05A 4A5MA 1ON1A 1R1TA 1BC7C 3QPTA 4IHSA 1IJWC 4PCQA 5DD8A 1XMXA 2A6EF 1LPQA 1W7PD 1ETXA 1YX5A 1RIOH 1UHMA 5LHIA 4ZYGA 2VC1A 3SDGA 1JGSA 1HCRA 4OIQF 2UWMA 3GLLA 3M7GA 2PLYA 2ZNYA 5L3EA 2DT5A 3RYPA 4D5CA 2ZXIA 2XB0X 2ZFWA 1VQ8I 2V1DA 4ASNA 2RC4A 3J7YJ 2GIVA 4EVIA 1GDTA 4DYRA 4KNYA 3HKZA 1MMNA 2EQRA 2PG4A 4IHVA 1E3OC 2BXYA 3CP2A 3E6BA 4FTHA 1GUUA 3SZTA 4A3DJ 1HQCA 4H4KC 4Y15A 1GT0C 4FQGA 4X0GA 5CQEA 5H6QA 3ZOBA 4Q47A 2RQQA 3D5LA 2QLZA 5KAIC 2GIZA 1EKEA 3BZKA 1U5TC 1JKQC 3R4KA 1N25A 3IH2A 5C4JJ 2K86A 2KLOA 2BGCA 1SMTA 3ONQA 5IP7J 4XLAA 5LEJA 5LLQA 2DOAA 3F0CA 5E3OA 2HR3A 1U5TA 1N75A 2CGPA 5E3LA 3V42A 5L3CA 1SVLA 3B73A 3NAUA 4M73A 2GQQA 2PMUA 4FX0A 2O61A 2ZXWH 2BV6A 4C2MJ 3K2ZA 5EF6A 1FBQA 2J5OA 2ID3A 2VXDA 5FKKA 3WE3A 3S1RJ 2H8WA 1T56A 4L9TA 5K1YA 1NTCA 5EZGA 1OMIA 2VQCA 4X1EA 1Z9CA 1IRGA 2GXGA 3ZMUA 2DMTA 4QSHA 4HQEA 4NC7A 1KU3A 4LLNA 4ZYAA 4PJJA 1L0OC 4P1WA 2KZGA 3BTIA 4AUXA 5D5XB 5TJJA 3KEOA 1ZRCA 5K5QA 5J4VA 2IS2A 4FASD 5HVQC 2IGOA 3QP6A 2PJPA 2ZFUA 3HZJA 3SEZA 1TW3A 4FE7A 1ENHA 3KIOA 4XN3A 3H3ZA 5L3GA 1KA8A 3ERED 3HHHA 1YI2I 3TP0A 3LWFA 3ZGKA 2DA5A 1R5HA 2M5WA 2OCEA 3K69A 4RGXA 4P9UA 3HDDA 5KK1A 3TEDA 3L2CA 1OYYA 2XB5A 2XRNA 4PFPA 3S93A 2XPVA 3EUHA 1O57A 3QWLA 3OOUA 4HOBA 3UR3C 4BBSJ 4DYQA 1XB4A 3PFIA 2VONA 4A3FJ 4IHTA 1XCBA 1YS7A 2FSWA 2EZKA 1TT5B 4JYKA 2FF4A 4L0YB 5EEAA 3JRGA 2KKOA 1XMKA 3WG9A 2YPRA 1MSEC 1IUYA 4AYBN 1F1ZA 4XNFA 1J7KA 1QRYA 3CUOA 2CG4A 3OYDA 1HC8A 1RUOA 2QF7A 3FXRA 3BG3A 3GEZA 3LSIA 3RYRA 2GM4A 3F8MA 1MJ9A 2XF6A 1K4TA 1R23A 4IZZA 4D7NA 1BI0A 3KEQA 4CCJA 4XLNF 5L3DA 3ZQLA 3BOQA 2VIXA 1I27A 3JTGA 3S16J 2W57A 3AG4H 1ETWA 3BG6A 5BS6A 3N4MA 3M8JA 4KMUX 3FX3A 3K4JA 4QPQA 1M1EB 2LTPA 2O8XA 2HXOA 2XC7A 3H0DA 4GFBA 2OTLI 1V3FA 3DPLC 3DTEA 4U0YA 1B59A 3D5RC 1TC3C 1FYKA 5LRSA 4RGUA 3HSFA 3Q0VA 5M5YJ 4XL9A 4LGWA 2IBDA 4WCGA 5LBQA 2QSHX 1TZLA 4XONA 1XGOA 4IRGA 1UB9A 5ICFA 3K0LA 3ZMTA 1IGNA 2HDWA 1BW6A 1YYVA 2IA0A 5BMZA 2OQGA 1ETQA 5ED4A 2D2WA 1PUEE 5E79C 2R3SA 3U2RA 4IKFA 1Y8QB 2R7VA 5DV5A 3AL0C 4HPQA 2E2HJ 4HF1A 3HPGA 3TMOA 1EJ9A 1W5CC 5CVJA 2DO7A 1PYVA 1Z21A 3K70C 4PJLA 3TL4X 3J80K 1E3PA 1A6IA 3DXJF 4LK1F 4N9HA 4MEXF 2MA3A 3FKIJ 1A35A 3C2GA 2Y2ZA 3G3ZA 4PFOA 2FNPA 5KHDA 5E3NA 4WX9A 1VQOI 4ZDOA 1A6QA 2VKEA 4XOTA 2X4HA 3OYIA 1P4XA 5JR3A 3WU2C 1OKRA 3K1PA 2XROA 2PBIA 1ZR2A 1A04A 1ORKA 4HDUA 3G73A 3WTVC 1XMAA 2TDXA 1KU7A 3I53A 3DPTA 4CYDA 2B7EA 2GXAA 3ZQHA 2AXTC 2ZBKA 3F72A 4MO7A 5B3SH 2CUEA 2MSYA 4OIRF 2DODA 5J47A 1HKSA 2FA5A 4JQFA 4YELA 2K5CA 2ZO4A 2QWWA 1YG2A 3F8BA 2RV8A 4A3MJ 2K9NA 3KZZA 4RBOA 3KP3A 3KZYA 5EZHA 3OYAA 4L9VA 1Y39A 3VWBA 4IOAF 4MEYF 2P5KA 4DIQA 3L2UA 3E6CC 2UUZA 4GYGA 2VJJA 5DD4A 1HSJA 4L0ZB 2I5UA 3D1NI 2OJED 3MMYB 3BR3A 3U1DA 3KCCA 1ERDA 2E71A 4E7LA 1O4XA 1IXCA 3OMYA 2GWRA 3ZN1A 5M3MJ 5J1UA 1FWZA 4ITVA 2DMPA 1TLHB 2LH9A 1W0TA 4I01A 4RS8A 4CCKA 5LGNA 1SD7A 3IHUA 3PL8A 3LFUA 1E0EA 4CA0A 4B3XA 1BA5A 3WU1B 2ID6A 2W1OA 4M9ZA 2DTRA 1U6GA 4ENJA 4HDVA 3IWFA 3FMQA 5CPRB 3F3XA 4IRIA 4AIKA 1UAAA 2BHZA 4Y4RA 3MAJA 5IP6A 1JHHA 3KYCB 1XDSA 2JVGA 1YHQI 1ONVA 3C1DA 3ZQ7A 3T8TA 3REOA 3PNYA 2KT0A 3W6VA 5F08A 3GZ5A 1HDDC 4CCOA 2WA0A 4EJVA 1X1CA 2Y0MA 1UHWA 2CQKA 3VEPA 3I5UA 2BBYA 4RGSA 5J6XA 1ZYRF 5D5VB 4EJTA 1UMQA 2CFXA 3FKJA 4IHXA 3FIWA 3OS1A 2L7KA 2R7FA 2X1CA 4I98B 3BTJA 4A0ZA 3VSLA 4B48A 4ENNA 3P9CA 2F5VA 2HS5A 2I10A 2JUCA 2XF7A 2HKOA 4BXFA 1QZYA 2LK2A 4W97A 2XAHA 1ZLJA 4CCNA 5E1XA 2F6CA 1DGWY 4ZDLA 5M3FJ 1UG2A 4BDYA 1USSA 2EZLA 3CCQI 1J59A 2E1OA 2ECBA 2F5DA 2ZXHA 2HOSA 4MGRA 1X1AA 3CLOA 2ZMEC 2HYFA 4II2A 4PDKA 2IVMA 4PJ0C 4C3HJ 3HOWJ 2ELJA 4QWQA 1XCVA 3I54A 1TNSA 1YX3A 5HOOA 3CP8A 4UHTA 2VE8A 4IRHA 1VTNC 5K5RA 2DMQA 3CF2A 2GZWA 4ZJZA 5AIQA 4EJWA 1FP1D 2RNJA 3GTGJ 5E8IA 2OZ6A 4EGZA 2IW5A 3H35A 2XDVA 1WI9A 4A3IJ 1DPUA 1U3EM 1H9TA 1DUXC 1Z6RA 2E1MC 2G9WA 1WWXA 4M9SA 3C18A 1T08B 5HDNA 4N4OB 4KIGA 2X6OA 1QO0D 4LFUA 2MC4A 3I4NJ 2HDDA 4HSRA 3H3UA 3ZPLA 3FMSA 3DBHB 3MKYB 3GTOJ 3WTTC 3V8LA 2OAZA 2XUBA 3BC8A 4XLEA 2BY3A 1BR1A 2W82A 4F55A 3ECOA 3K1NA 3ZMVA 2QQAA 5JI6A 2LVSA 3J80Z 4A0XA 1S3JA 2DQLA 2HTSA 2NS0A 3T0YA 2VLAA 1UFMA 2EILH 4AYBA 2LY9A 4RB1A 3KFWX 1XC5A 3ZP5A 3I58A 5DCMA 2DQRA 3E6MA 3JRHA 3S2HJ 5DCMB 3GUDA 1QQIA 3FWEA 2JT1A 4EM1A 2H6CA 3IH3A 4BQNA 1T0FA 3K2AA 2ZSHB 3H1CA 4M6VA 1KGSA 5E18F 5IY5H 3T8RA 2WTEA 3M9AA 3TKYA 2R4GA 2VBXA 4F52A 4A12A 4BH9A 1MW7A 2FOWA 5TRDA 1S72I 4RM2A 3ASNH 5F6FA 4DW6A 5IP9J 1UJ8A 2LOOA 5L3FA 3H92A 3CCUI 4HSTA 2FMYA 3ABTA 2ISYA 2DFEA 4PK4A 4DJAA 1Z1DA 1I1GA 5GADJ 2CQXA 2HGCA 3HGYA 3I4PA 2DA1A 3M8FA 2F5EA 1VI0A 5IT9K 2CJJA 4ESFA 4XRFA 2JPBA 4R8HA 1T8IA 2E5ZA 2DDBA 2H6BA 3D0SA 2KIQA 3FHZA 4IOCF 5E1WA 2NRAC 3E1SA 1QNTA 1RKWA 1XGSA 1MBHA 3ZCOA 3LSJA 1CQTA 3I56I 5ICCA 3W6JB 3BTCA 2HPMA 3WODF 1JI8A 2V9VA 3G6EI 1XPXA 4BUPA 4II3A 2WAQA 1W4MA 2QENA 2HQRA 2JRMA 3FZVA 4HAMA 1LDJA 4JP0A 4LMYA 3MKZA 3BT9A 4YFKF 1SFOJ 2DPUA 3FM5A 3LL7A 3IKVA 2NS7A 4E7IA 1ACIA 3F8CA 1UZCA 2LG4A 2G7HA 3S17J 1SVOA 4M3FA 2HVRA 4IX7A 3MN2A 1ZH5A 3BLYA 3BJ6A 3CUQC 1HW1A 1X3UA 4W1UA 2CV1A 2XSJC 4BE1A 1X3WB 3DU6A 4KN7X 4BHPA 2HVQA 2LSOA 3CESA 1W5TA 2EB7A 4RAGA 3I9V2 3FDYA 1BOBA 2E60A 3RTRA 2FBHA 2OUMA 3ZMDA 4BJ5C 2YR2A 3S2WA 5DCFA 1IRXA 2W48A 4YIIA 4PUSA 3RDIA 3P5JA 1V5FA 4LITA 3I64A 2MGQA 4XN0A 3H9GA 1S7OA 2WV0A 1EH6A 4DQ2A 3RKQA 1ZAOA 4RAZA 3M1CA 1MKMA 1AU7A 1GV2A 3G1LA 3ULQB 4LIVA 3QAHA 3LSMA 2IPQX 2IP2A 3PSIA 2O8KA 2EFNA 4CYCA 3WTSC 2PEXA 3BQZA 3OSGA 4CYCB 3BR6A 2M30A 2FU4A 5CVUA
chains in the Genus database with same CATH topology
2XASA 1SD6A 2VOOA 1G3SA 1G6NA 2FEZA 4JBAA 4MQVA 2FXAA 2P6TA 4AIHA 2ACJA 3R6SA 5KVRA 3CO6C 4LB5A 3TOBA 4OIOF 2GXBA 1KU9A 5JVTA 3RPQA 4LG0A 4LG0B 1Q1HA 1KYWA 4BXUA 3GX4X 4KUMA 3BJAA 3QRFF 2OBPA 5BPDA 2HZTA 4G8XA 3LA2A 3Q9VA 2KRFA 5F1RA 1FBSA 5HLGA 1R36A 2J5PA 1O3TA 1BBYA 4YFXF 3F22A 3PQKA 5DDGA 2EFOA 3HUGA 4Y17A 4BQAA 4KFCA 1IN8A 3DKWA 3E97A 1KYZA 4G7HF 5EEGA 1LEBA 1W5SA 4B09A 4O5VA 3HRMA 1TW2A 4M6XA 4ENKA 4KIFA 3KETA 1L3LA 2MC3A 2EFPA 5IT3A 1J2XA 3ML6A 5IT9Z 2STTA 4RB0A 4GCVA 2Y75A 3RPUA 3O6BB 2FE3A 1IN4A 3COAC 2HQNA 4S04A 1USTA 2QM3A 3BWGA 3LQRA 3LAJA 1XDUA 1RUNA 1IXSB 1LJ9A 1TBXA 1U5TB 5FD5A 2JSCA 1PP7U 2O6GE 4UNOA 3RKWA 1S7AA 3E6DA 4BYYA 2C6YA 1JXSA 1FLIA 2FMLA 1BIBA 4ESJA 2XAQA 1J75A 1TQMA 3BROA 1F5TA 5HLHA 2B0LA 4UVBA 4HV5A 4I2OA 2DW4A 1Z91A 1Y0UA 2QQBA 1K78A 1K78B 1YIOA 1MZBA 2XHKA 1FPQA 3QU3A 3B02A 1ZG1A 4I09A 5CLSA 2W85A 3CJNA 4HYEA 3KP6A 3ELKA 1K6OA 1U78A 2M45A 1KQ8A 3HSEA 4IPAA 4L18B 4G6DA 2MH2A 3SXYA 3MZHA 1UCRA 1BN5A 4P96A 4EQQA 3PQJA 4OINF 4YIFA 3GFLA 1YW8A 3WTXC 4UVCA 3R0JA 1JE8A 4WK8F 1IN6A 2FBKA 3M8EA 3K9TA 5CVVA 1CGPA 4I0AA 1FSHA 1K79A 3DF8A 1D8JA 4HLXA 2Z9OA 4S05A 4KMFA 3HRSA 1YW7A 3DQVC 1ZG3A 4LJZF 3DEUA 4M9XA 4LLLA 1SAXA 1IN5A 2ETHA 2ZKZA 3BDDA 1TTYA 3OV8A 3LFKA 3BJOA 4EM0B 1ZG5A 2RGVA 1O7LA 1YQAA 1FSEA 2A69F 1EH8A 1LDKB 1G3TA 4A5NA 3R60A 5A2QK 4Q4ZF 4RB3C 4UV9A 2HEOA 4NB5A 1EV7A 5HDKA 2FNAA 2Q8KA 2LDUA 3E5UA 2EJRA 2EFWA 4GYIA 4M72A 1SFUA 1DPRA 2BE5F 1B6AA 4IJAA 1TQIA 3GF2A 4CXFA 2K7LA 1YW9A 2PI0A 3ISPA 4BHCA 4EJOA 5DEQA 3VODA 3ZMZA 2GAUA 2WWYA 4HX4A 3LA3A 2RVCA 3VB2A 1XSVA 3TOAA 4WXHA 5D4SA 2CO5A 1ZRFA 1J9IA 4ENMA 4G7OF 3F8NA 3HYIA 3V7CA 2IRFG 3V7RA 1FYLA 2ZNZA 1H0MA 4IXAA 1P92A 1ZARA 4P5OA 2EFQA 5E1ZB 4ZH4F 5HS9A 5AIPA 3HRUA 3GFIA 2ESHA 1YFHA 3J81K 3KLNA 5F64A 3WTZA 2IA2A 1XN7A 1BM9A 4ZYEA 5LGTA 4KYWA 4CICA 2PMHA 4HX8A 1YTYA 2ZMEA 1TQPA 2ZMEB 3QP5A 3LQQA 4PZJA 2RQPA 2P5LC 4HX7A 4AD9A 2E7WA 3ZN0A 3WGIA 2O0YA 3FM3A 3BPVA 2K27A 3HTUA 2XVCA 1I5ZA 4OIPF 3C3WA 3NQOA 2VBYA 1P2FA 3GLXA 5ICEA 1R7JA 2ELHA 1FY7A 2E1CA 3HSRA 1WSUA 3KP7A 3Q9SA 3DFGA 4R79A 3ROUA 5LHHA 1IN7A 2F5CA 4BAYA 4BNCA 1SD4A 4MTDA 3GVAA 4FHTA 4N0BA 4KDPA 5D6FA 5A2QZ 1U2WA 3OOPA 4N9IA 3F23A 2QYOA 2RN7A 2EV5A 2W84A 5E20A 3VOEA 3F8FA 2XKOA 2ZCWA 3SHFA 1J0RA 1XGMA 3IC7A 2A68F 4LD5A 3BY6A 5LRRA 5D5WB 2DAOA 3DP7A 3IL2A 2EV6A 4RB2C 1QZZA 3JW4A 2V1UA 4HA8A 4HQMA 3V4GA 4HV6A 1SD5A 2VOPA 2OZUA 4Y13A 1NHAA 3LSTA 5DYMA 4L5JA 5CVIA 4ZYDA 3AAFA 2CYYA 5D4RA 2STWA 1BIAA 2KIUA 4G7ZF 3SQNA 1YS6A 1G4DA 2ESNA 5LEKA 4EV0A 1MD0A 3JTHA 3CUQA 1FYMA 3CUQB 4E70A 4U7DA 1HW5A 2YX7A 1OPCA 4Q48A 3W6KB 3BZ6A 2M8EA 1WQ2A 4H0EA 2Q2EA 2XAJA 1SMYF 4A2UA 2GA1A 2X0LA 5FGMA 1IF1A 3L9FA 3EETA 5DUKA 4KA4A 1MJAA 3J81Z 3FXUA 3KLOA 1MGTA 4D0PA 3GO5A 3DV8A 3MCZA 1JHFA 1O3RA 1T39A 3I71A 4PGGA 4PGHA 4UVAA 4ZZDA 4HBLA 2P5VA 4U7BA 1P6RA 1FBUA 2DK5A 3RIRA 4UXNA 3GWZA 3EDPA 3SFZA 5E8GA 1LDDA 4EJUA 1IAWA 3GFMA 3GYHX 2MLKA 1FC3A 2XIGA 2HOEA 3HRTA 2ZJ2A 5HLIA 1ZGJA 4M74A 1ZLKA 1DP7P 2LF8A 4I02A 2KJBA 4ON0A 1ULYA 5J8CA 1D8KA 3JSPA 1ODDA 2V79A 3L00A 1YO5C 4MNUA 4UUVA 1E2XA 1LEAA 4ZYHA 2NAZA 4I7HA 1XSXA 2E1NA 2UXXA 1FP2A 3LAPA 2K4BA 2OU2A 1G3YA 4M6YA 2FBIA 3CO7C 3SZPA 2A3SA 4LK0F 1B9MA 1T2KA 3CTAA 4QLCU 2MD5A 3T5XA 5FFZA 1QGPA 4XBFA 2F5FA 2R7DA 3I0TA 5ILSA 3FXQA 2HFHA 4GXOA 4A6EA 4G9YA 3RKXA 3TQNA 2P4WA 2HYGD 3WTUC 2YSRA 2VBWA 3ECHA 4AIJA 3WTWC 1XSDA 1RI7A 4HZFA 1ZHFA 2FRHA 2L4MA 2DLLA 5BQTA 3JAMK 2A61A 1XGNA 1BI3A 4A6DA 3HOTA 2KIFA 3O2PE 2KIMA 3WGGA 4HF0A 2Q0OA 2IT0A 2DU9A 1BC8C 2L4AA 5DUIA 1R00A 5EEHA 5HDGA 1XD7A 2HTJA 3TO6A 2MLGA 2K02A 4KIBA 3IRQA 1E17A 4Q5SF 1HBXG 2DPDA 2M1BA 5FFXA 1YLFA 2PQ8A 5AONA 3QOPA 5ICGA 1T98A 2EV0A 2HKXA 2VBZA 2AS5F 4CHUA 2QUFA 3L09A 2OD5A 1LQ1A 1HXDA 1KQ9A 1B1BA 2WC2A 1K7AA 3TDUC 4P55A 2JTVA 2GA2A 1PP8F 3WE2A 4GO1A 3T1BA 2O03A 4OMZA 1REPC 4FX4A 2OA4A 1EH7A 2QVOA 2VT2A 4O6JA 1O3SA 3EQLF 4MTEA 4G6QA 2UXNA 3IRRA 1B4AA 1O3QA 2VC0A 3NEUA 2RKHA 4NQWA 5BPIA 1F9NA 4L9NA 2EWNA 3GZ6A 1U8RA 1HKQA 4MHGA 2Y48A 1SFXA 4CZZA 1FOKA 4NHJA 5LHGA 1GHCA 1C0WA 2PN6A 1KU2A 1J5YA 3MWMA 3RKYA 2Z33A 2ZXJA 5D5UB 2JPCA 2L02A 2NYXA 3I59A 5D6EA 5LGUA 3I59B 6PAXA 4O3MA 3CDHA 3E5XA 2L3DA 2BYVE 1P4WA 2L01A 1S6LA 2VN2A 4HF2A 4BHBA 3KP4A 3NRVA 2K4JA 3F6OA 4R1HA 3WU0A 1R1UA 5CYVA 2RDPA 4FT8A 5JFRA 2VODA 2V1XA 1IW7F 2ISZA 3EYIA 2MH9A 2XAFA 3U9GA 3JSOA 2A5YB 3O3KA 4JK1X 2JRTA 3MEXA 2EA4A 4OOIA 2CSOA 1B9NA 2D1HA 3E5QA 3C7JA 3L7WA 2DBBA 1KQ0A 5ILUA 3JAMZ 2EA2A 1LB2A 5ILVA 4WF2A 4U0VA 1V4RA 1AOYA 2CW0F 2P7VB 1WRJA 5JHUA 4CO8A 3V7SA 4IF4A 3MQ0A 3R61A 1WKMA 3IWZA 1ZREA 5D8LB 2IA1A 3BPXA 3KP2A 3TDZC 4MQ9F 2OQRA 4AWXB 5E17F 1STZA 1GXQA 3HOSA 1FZPB 4L5IA 5H20A 1IXRC 1IRFA 1BI2A 4WWCA 4UV8A 5ERIA 5HS7A 1T38A 3F21A 2W25A 2DK8A 5K5OA 4CGZA 4LLGF 3VFZA 2D1VA 1ZGAA 1D3YA 2H09A 1T6SA 2YX4A 5HS8A 3ZMSA 4G94A 3HHGA 4XLPF 3RJPA 2BEOA 3GFJA 3HIFA 1ZRDA 4AVPA 1GXPA 2A6HF 1BJAA 5FD6A 2M87A 1FT9A 3BP8A 4RAYA 3MFKA 1MDMA 3V8JA 1MDMB 1Z05A 4OU0A 2QZ8A 1D5VA 4YFNF 2NNNA 3P9KA 2XKPA 2VE9A 3WTYC 1LVAA 3RI4A 2L54A 5FLXK 1AWCA 3V8KA 1R5GA 3TO9A 2ADUA 1BOAA 1IZ1A 3R0AA 4EM2A 2A07F 2XGXA 2UZKA 1FNNA 1H9GA 2V6CA 1R1VA 3F6VA 5BOXA 3QPHA 1ON2A 3MZYA 1G3WA 3LA7A 3Q5FA 3IKTA 5FO5A 3J7AO 1HW2A 4OMYA 4YG2F 4XSXF 1I1SA 4L9JA 3E3VA 3FF5A 3EYYA 2PFBA 2D45A 1BI1A 1TNTA 4ETSA 2H27A 3TO7A 4HW0A 3M1EA 3HTSB 2W24A 4KN4X 5FB2A 4I0BA 1HSTA 5D8KB 5CJ9A 4ZZLA 4U88A 1LNWA 2CWEA 3N97A 4KICA 4RGRA 5CVRA 2AXLA 2Z5UA 1HKTA 4Z2YA 2YU3A 2LNBA 2KJCA 4CDGA 1Z7UA 3P9IA 2IJLA 4U0WA 4P9FA 4ESBA 2NNYA 4EMSA 2Z99A 2F2EA 1OR7A 4K2EA 4HLYA 2JZYA 1MJBA 1FX7A 4IVNA 3WGHA 2P6SA 1Z6TA 1GVJA 3K1MA 2VT3A 4TV7A 4WXDA 2P8TA 2VXZA 3FMRA 5H6RA 1I6XA 2H94A 2Z3YA 1SFEA 1F4KA 2XV4S 3KP5A 3ABUA 2O3FA 2MBFA 2XAGA 1CF7A 1QPMA 1CF7B 1R58A 2FQ3A 4GGGA 1QBJA 1O7FA 4DNCA 5FLXZ 5L3BA 1RNLA 2FOKA 2EK5A 2P7CB 2LF7A 2COMA 3GXOA 1OYWA 4M71A 4WXCA 1P4AA 2G7UA 4XSZF 4F7ZA 1RZ4A 2DI3A 3P7NA 5J8FA 4A0YA 2E7XA 1S8NA 3GW2A 3KE2A 4KT5C 2LKPA 3TGNA 2HWVA 1DDNA 2QBYA 2QBYB 2QQ9A 1S29A 1ZN2A 2DFIA 2HDCA 4EGYA 1W7PA 4LB6B 1W7PB 3QU6A 1PDNC 1R22A 1OYIA 4B8XA 4A5MA 1ON1A 1R1TA 1BC7C 3QPTA 4IHSA 4PCQA 5DD8A 2A6EF 1W7PD 1RIOH 1UHMA 5LHIA 4ZYGA 2VC1A 1JGSA 4OIQF 2UWMA 3M7GA 2PLYA 2ZNYA 5L3EA 2DT5A 3RYPA 2ZFWA 2V1DA 4ASNA 2RC4A 2GIVA 4EVIA 4KNYA 2PG4A 3E6BA 3SZTA 1HQCA 4Y15A 5H6QA 4Q47A 2QLZA 3D5LA 1U5TC 3R4KA 2K86A 2BGCA 1SMTA 5LEJA 5LLQA 2HR3A 1U5TA 2CGPA 5L3CA 3B73A 4M73A 2GQQA 2PMUA 4FX0A 2O61A 2BV6A 3K2ZA 1FBQA 2J5OA 3WE3A 5K1YA 4L9TA 1OMIA 1Z9CA 1IRGA 2GXGA 3ZMUA 4HQEA 1KU3A 4LLNA 1L0OC 5D5XB 5TJJA 3KEOA 1ZRCA 5K5QA 5HVQC 3QP6A 2PJPA 1TW3A 3H3ZA 5L3GA 1KA8A 3ERED 3HHHA 3LWFA 1R5HA 2M5WA 3K69A 4RGXA 4P9UA 5KK1A 3L2CA 1OYYA 2XRNA 3EUHA 1O57A 4HOBA 1XB4A 3PFIA 2VONA 4IHTA 1XCBA 1YS7A 2FSWA 2FF4A 4L0YB 2KKOA 1XMKA 3WG9A 2YPRA 1IUYA 1F1ZA 1J7KA 3CUOA 2CG4A 1RUOA 3FXRA 3GEZA 3RYRA 3F8MA 1MJ9A 1R23A 1BI0A 3KEQA 4XLNF 5L3DA 3BOQA 1I27A 3JTGA 2W57A 5BS6A 3N4MA 4KMUX 3FX3A 2O8XA 1V3FA 3DPLC 4U0YA 1B59A 1FYKA 5LRSA 4RGUA 3HSFA 4WCGA 4LGWA 5LBQA 1XGOA 4IRGA 1UB9A 5ICFA 3K0LA 3ZMTA 1YYVA 2IA0A 5BMZA 2OQGA 5ED4A 2D2WA 1PUEE 2R3SA 3U2RA 5DV5A 4HF1A 5CVJA 2DO7A 3J80K 3DXJF 4LK1F 4N9HA 4MEXF 2MA3A 3G3ZA 2FNPA 4WX9A 2X4HA 1P4XA 5JR3A 1OKRA 3K1PA 2XROA 2PBIA 1A04A 4HDUA 3G73A 3WTVC 1XMAA 2TDXA 1KU7A 3I53A 3DPTA 4CYDA 2ZBKA 3F72A 4OIRF 1HKSA 2FA5A 4JQFA 2ZO4A 2QWWA 1YG2A 3F8BA 2RV8A 3KZZA 3KP3A 3KZYA 4L9VA 4MEYF 2P5KA 3E6CC 4GYGA 5DD4A 1HSJA 4L0ZB 3U1DA 3KCCA 1IXCA 2GWRA 3ZN1A 1FWZA 1TLHB 4I01A 4RS8A 5LGNA 1SD7A 3IHUA 3WU1B 4M9ZA 2DTRA 1U6GA 4ENJA 4HDVA 3IWFA 3FMQA 3F3XA 4IRIA 4AIKA 3MAJA 1JHHA 1XDSA 1ONVA 3C1DA 3ZQ7A 3T8TA 3REOA 3GZ5A 4EJVA 2Y0MA 1UHWA 2CQKA 3VEPA 3I5UA 2BBYA 4RGSA 5J6XA 1ZYRF 5D5VB 4EJTA 2CFXA 2R7FA 4I98B 4A0ZA 4ENNA 3P9CA 2HS5A 2HKOA 1QZYA 2XAHA 1ZLJA 5E1XA 1USSA 1J59A 2F5DA 4MGRA 3CLOA 2HYFA 4PDKA 2IVMA 4QWQA 1XCVA 3I54A 1TNSA 5HOOA 4UHTA 2VE8A 4IRHA 1VTNC 5K5RA 2GZWA 5AIQA 4EJWA 1FP1D 2RNJA 5E8IA 2OZ6A 4EGZA 2IW5A 1WI9A 1DPUA 1U3EM 1H9TA 1DUXC 1Z6RA 2G9WA 1WWXA 4M9SA 3C18A 5HDNA 4KIGA 1QO0D 4LFUA 3H3UA 3ZPLA 3FMSA 3WTTC 3V8LA 2OAZA 2XUBA 3ECOA 3K1NA 3ZMVA 2QQAA 5JI6A 3J80Z 4A0XA 1S3JA 2DQLA 2HTSA 2NS0A 3T0YA 1UFMA 4RB1A 3KFWX 3ZP5A 3I58A 5DCMA 2DQRA 3E6MA 5DCMB 3GUDA 1QQIA 3FWEA 2JT1A 4EM1A 2H6CA 1T0FA 1KGSA 5E18F 3T8RA 3TKYA 2WTEA 3M9AA 2VBXA 4A12A 4BH9A 5TRDA 5F6FA 5L3FA 3H92A 2FMYA 3ABTA 2ISYA 1Z1DA 1I1GA 2HGCA 3I4PA 3M8FA 2F5EA 5IT9K 4ESFA 4XRFA 2JPBA 4R8HA 2H6BA 3D0SA 3FHZA 5E1WA 2NRAC 1QNTA 1XGSA 5ICCA 3W6JB 3WODF 2V9VA 1W4MA 2QENA 2HQRA 4HAMA 3FZVA 1LDJA 4LMYA 4YFKF 2DPUA 3FM5A 3IKVA 3F8CA 2G7HA 1ZH5A 3BJ6A 3CUQC 1HW1A 1X3UA 4KN7X 4BHPA 2LSOA 1W5TA 2EB7A 3RTRA 2FBHA 3ZMDA 2YR2A 3S2WA 5DCFA 4YIIA 3RDIA 3I64A 1S7OA 2WV0A 1EH6A 4DQ2A 1ZAOA 4RAZA 1MKMA 3ULQB 3QAHA 2IPQX 2IP2A 2EFNA 3WTSC 2PEXA 2M30A 2FU4A 5CVUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAS A;  1SD6 A;  2VOO A;  1G3S A;  1G6N A;  2FEZ A;  4JBA A;  4MQV A;  2FXA A;  2P6T A;  4AIH A;  2ACJ A;  3R6S A;  5KVR A;  3CO6 C;  4LB5 A;  3TOB A;  4OIO F;  2GXB A;  1KU9 A;  5JVT A;  3RPQ A;  4LG0 A;  4LG0 B;  1Q1H A;  1KYW A;  4BXU A;  3GX4 X;  4KUM A;  3BJA A;  3QRF F;  2OBP A;  5BPD A;  2HZT A;  4G8X A;  3LA2 A;  3Q9V A;  2KRF A;  5F1R A;  1FBS A;  5HLG A;  1R36 A;  2J5P A;  1O3T A;  1BBY A;  4YFX F;  3F22 A;  3PQK A;  5DDG A;  2EFO A;  3HUG A;  4Y17 A;  4BQA A;  4KFC A;  1IN8 A;  3DKW A;  3E97 A;  1KYZ A;  4G7H F;  5EEG A;  1LEB A;  1W5S A;  4B09 A;  4O5V A;  3HRM A;  1TW2 A;  4M6X A;  4ENK A;  4KIF A;  3KET A;  1L3L A;  2MC3 A;  2EFP A;  5IT3 A;  1J2X A;  3ML6 A;  5IT9 Z;  2STT A;  4RB0 A;  4GCV A;  2Y75 A;  3RPU A;  3O6B B;  2FE3 A;  1IN4 A;  3COA C;  2HQN A;  4S04 A;  1UST A;  2QM3 A;  3BWG A;  3LQR A;  3LAJ A;  1XDU A;  1RUN A;  1IXS B;  1LJ9 A;  1TBX A;  1U5T B;  5FD5 A;  2JSC A;  1PP7 U;  2O6G E;  4UNO A;  3RKW A;  1S7A A;  3E6D A;  4BYY A;  2C6Y A;  1JXS A;  1FLI A;  2FML A;  1BIB A;  4ESJ A;  2XAQ A;  1J75 A;  1TQM A;  3BRO A;  1F5T A;  5HLH A;  2B0L A;  4UVB A;  4HV5 A;  4I2O A;  2DW4 A;  1Z91 A;  1Y0U A;  2QQB A;  1K78 A;  1K78 B;  1YIO A;  1MZB A;  2XHK A;  1FPQ A;  3QU3 A;  3B02 A;  1ZG1 A;  4I09 A;  5CLS A;  2W85 A;  3CJN A;  4HYE A;  3KP6 A;  3ELK A;  1K6O A;  1U78 A;  2M45 A;  1KQ8 A;  3HSE A;  4IPA A;  4L18 B;  4G6D A;  2MH2 A;  3SXY A;  3MZH A;  1UCR A;  1BN5 A;  4P96 A;  4EQQ A;  3PQJ A;  4OIN F;  4YIF A;  3GFL A;  1YW8 A;  3WTX C;  4UVC A;  3R0J A;  1JE8 A;  4WK8 F;  1IN6 A;  2FBK A;  3M8E A;  3K9T A;  5CVV A;  1CGP A;  4I0A A;  1FSH A;  1K79 A;  3DF8 A;  1D8J A;  4HLX A;  2Z9O A;  4S05 A;  4KMF A;  3HRS A;  1YW7 A;  3DQV C;  1ZG3 A;  4LJZ F;  3DEU A;  4M9X A;  4LLL A;  1SAX A;  1IN5 A;  2ETH A;  2ZKZ A;  3BDD A;  1TTY A;  3OV8 A;  3LFK A;  3BJO A;  4EM0 B;  1ZG5 A;  2RGV A;  1O7L A;  1YQA A;  1FSE A;  2A69 F;  1EH8 A;  1LDK B;  1G3T A;  4A5N A;  3R60 A;  5A2Q K;  4Q4Z F;  4RB3 C;  4UV9 A;  2HEO A;  4NB5 A;  1EV7 A;  5HDK A;  2FNA A;  2Q8K A;  2LDU A;  3E5U A;  2EJR A;  2EFW A;  4GYI A;  4M72 A;  1SFU A;  1DPR A;  2BE5 F;  1B6A A;  4IJA A;  1TQI A;  3GF2 A;  4CXF A;  2K7L A;  1YW9 A;  2PI0 A;  3ISP A;  4BHC A;  4EJO A;  5DEQ A;  3VOD A;  3ZMZ A;  2GAU A;  2WWY A;  4HX4 A;  3LA3 A;  2RVC A;  3VB2 A;  1XSV A;  3TOA A;  4WXH A;  5D4S A;  2CO5 A;  1ZRF A;  1J9I A;  4ENM A;  4G7O F;  3F8N A;  3HYI A;  3V7C A;  2IRF G;  3V7R A;  1FYL A;  2ZNZ A;  1H0M A;  4IXA A;  1P92 A;  1ZAR A;  4P5O A;  2EFQ A;  5E1Z B;  4ZH4 F;  5HS9 A;  5AIP A;  3HRU A;  3GFI A;  2ESH A;  1YFH A;  3J81 K;  3KLN A;  5F64 A;  3WTZ A;  2IA2 A;  1XN7 A;  1BM9 A;  4ZYE A;  5LGT A;  4KYW A;  4CIC A;  2PMH A;  4HX8 A;  1YTY A;  2ZME A;  1TQP A;  2ZME B;  3QP5 A;  3LQQ A;  4PZJ A;  2RQP A;  2P5L C;  4HX7 A;  4AD9 A;  2E7W A;  3ZN0 A;  3WGI A;  2O0Y A;  3FM3 A;  3BPV A;  2K27 A;  3HTU A;  2XVC A;  1I5Z A;  4OIP F;  3C3W A;  3NQO A;  2VBY A;  1P2F A;  3GLX A;  5ICE A;  1R7J A;  2ELH A;  1FY7 A;  2E1C A;  3HSR A;  1WSU A;  3KP7 A;  3Q9S A;  3DFG A;  4R79 A;  3ROU A;  5LHH A;  1IN7 A;  2F5C A;  4BAY A;  4BNC A;  1SD4 A;  4MTD A;  3GVA A;  4FHT A;  4N0B A;  4KDP A;  5D6F A;  5A2Q Z;  1U2W A;  3OOP A;  4N9I A;  3F23 A;  2QYO A;  2RN7 A;  2EV5 A;  2W84 A;  5E20 A;  3VOE A;  3F8F A;  2XKO A;  2ZCW A;  3SHF A;  1J0R A;  1XGM A;  3IC7 A;  2A68 F;  4LD5 A;  3BY6 A;  5LRR A;  5D5W B;  2DAO A;  3DP7 A;  3IL2 A;  2EV6 A;  4RB2 C;  1QZZ A;  3JW4 A;  2V1U A;  4HA8 A;  4HQM A;  3V4G A;  4HV6 A;  1SD5 A;  2VOP A;  2OZU A;  4Y13 A;  1NHA A;  3LST A;  5DYM A;  4L5J A;  5CVI A;  4ZYD A;  3AAF A;  2CYY A;  5D4R A;  2STW A;  1BIA A;  2KIU A;  4G7Z F;  3SQN A;  1YS6 A;  1G4D A;  2ESN A;  5LEK A;  4EV0 A;  1MD0 A;  3JTH A;  3CUQ A;  1FYM A;  3CUQ B;  4E70 A;  4U7D A;  1HW5 A;  2YX7 A;  1OPC A;  4Q48 A;  3W6K B;  3BZ6 A;  2M8E A;  1WQ2 A;  4H0E A;  2Q2E A;  2XAJ A;  1SMY F;  4A2U A;  2GA1 A;  2X0L A;  5FGM A;  1IF1 A;  3L9F A;  3EET A;  5DUK A;  4KA4 A;  1MJA A;  3J81 Z;  3FXU A;  3KLO A;  1MGT A;  4D0P A;  3GO5 A;  3DV8 A;  3MCZ A;  1JHF A;  1O3R A;  1T39 A;  3I71 A;  4PGG A;  4PGH A;  4UVA A;  4ZZD A;  4HBL A;  2P5V A;  4U7B A;  1P6R A;  1FBU A;  2DK5 A;  3RIR A;  4UXN A;  3GWZ A;  3EDP A;  3SFZ A;  5E8G A;  1LDD A;  4EJU A;  1IAW A;  3GFM A;  3GYH X;  2MLK A;  1FC3 A;  2XIG A;  2HOE A;  3HRT A;  2ZJ2 A;  5HLI A;  1ZGJ A;  4M74 A;  1ZLK A;  1DP7 P;  2LF8 A;  4I02 A;  2KJB A;  4ON0 A;  1ULY A;  5J8C A;  1D8K A;  3JSP A;  1ODD A;  2V79 A;  3L00 A;  1YO5 C;  4MNU A;  4UUV A;  1E2X A;  1LEA A;  4ZYH A;  2NAZ A;  4I7H A;  1XSX A;  2E1N A;  2UXX A;  1FP2 A;  3LAP A;  2K4B A;  2OU2 A;  1G3Y A;  4M6Y A;  2FBI A;  3CO7 C;  3SZP A;  2A3S A;  4LK0 F;  1B9M A;  1T2K A;  3CTA A;  4QLC U;  2MD5 A;  3T5X A;  5FFZ A;  1QGP A;  4XBF A;  2F5F A;  2R7D A;  3I0T A;  5ILS A;  3FXQ A;  2HFH A;  4GXO A;  4A6E A;  4G9Y A;  3RKX A;  3TQN A;  2P4W A;  2HYG D;  3WTU C;  2YSR A;  2VBW A;  3ECH A;  4AIJ A;  3WTW C;  1XSD A;  1RI7 A;  4HZF A;  1ZHF A;  2FRH A;  2L4M A;  2DLL A;  5BQT A;  3JAM K;  2A61 A;  1XGN A;  1BI3 A;  4A6D A;  3HOT A;  2KIF A;  3O2P E;  2KIM A;  3WGG A;  4HF0 A;  2Q0O A;  2IT0 A;  2DU9 A;  1BC8 C;  2L4A A;  5DUI A;  1R00 A;  5EEH A;  5HDG A;  1XD7 A;  2HTJ A;  3TO6 A;  2MLG A;  2K02 A;  4KIB A;  3IRQ A;  1E17 A;  4Q5S F;  1HBX G;  2DPD A;  2M1B A;  5FFX A;  1YLF A;  2PQ8 A;  5AON A;  3QOP A;  5ICG A;  1T98 A;  2EV0 A;  2HKX A;  2VBZ A;  2AS5 F;  4CHU A;  2QUF A;  3L09 A;  2OD5 A;  1LQ1 A;  1HXD A;  1KQ9 A;  1B1B A;  2WC2 A;  1K7A A;  3TDU C;  4P55 A;  2JTV A;  2GA2 A;  1PP8 F;  3WE2 A;  4GO1 A;  3T1B A;  2O03 A;  4OMZ A;  1REP C;  4FX4 A;  2OA4 A;  1EH7 A;  2QVO A;  2VT2 A;  4O6J A;  1O3S A;  3EQL F;  4MTE A;  4G6Q A;  2UXN A;  3IRR A;  1B4A A;  1O3Q A;  2VC0 A;  3NEU A;  2RKH A;  4NQW A;  5BPI A;  1F9N A;  4L9N A;  2EWN A;  3GZ6 A;  1U8R A;  1HKQ A;  4MHG A;  2Y48 A;  1SFX A;  4CZZ A;  1FOK A;  4NHJ A;  5LHG A;  1GHC A;  1C0W A;  2PN6 A;  1KU2 A;  1J5Y A;  3MWM A;  3RKY A;  2Z33 A;  2ZXJ A;  5D5U B;  2JPC A;  2L02 A;  2NYX A;  3I59 A;  5D6E A;  5LGU A;  3I59 B;  6PAX A;  4O3M A;  3CDH A;  3E5X A;  2L3D A;  2BYV E;  1P4W A;  2L01 A;  1S6L A;  2VN2 A;  4HF2 A;  4BHB A;  3KP4 A;  3NRV A;  2K4J A;  3F6O A;  4R1H A;  3WU0 A;  1R1U A;  5CYV A;  2RDP A;  4FT8 A;  5JFR A;  2VOD A;  2V1X A;  1IW7 F;  2ISZ A;  3EYI A;  2MH9 A;  2XAF A;  3U9G A;  3JSO A;  2A5Y B;  3O3K A;  4JK1 X;  2JRT A;  3MEX A;  2EA4 A;  4OOI A;  2CSO A;  1B9N A;  2D1H A;  3E5Q A;  3C7J A;  3L7W A;  2DBB A;  1KQ0 A;  5ILU A;  3JAM Z;  2EA2 A;  1LB2 A;  5ILV A;  4WF2 A;  4U0V A;  1V4R A;  1AOY A;  2CW0 F;  2P7V B;  1WRJ A;  5JHU A;  4CO8 A;  3V7S A;  4IF4 A;  3MQ0 A;  3R61 A;  1WKM A;  3IWZ A;  1ZRE A;  5D8L B;  2IA1 A;  3BPX A;  3KP2 A;  3TDZ C;  4MQ9 F;  2OQR A;  4AWX B;  5E17 F;  1STZ A;  1GXQ A;  3HOS A;  1FZP B;  4L5I A;  5H20 A;  1IXR C;  1IRF A;  1BI2 A;  4WWC A;  4UV8 A;  5ERI A;  5HS7 A;  1T38 A;  3F21 A;  2W25 A;  2DK8 A;  5K5O A;  4CGZ A;  4LLG F;  3VFZ A;  2D1V A;  1ZGA A;  1D3Y A;  2H09 A;  1T6S A;  2YX4 A;  5HS8 A;  3ZMS A;  4G94 A;  3HHG A;  4XLP F;  3RJP A;  2BEO A;  3GFJ A;  3HIF A;  1ZRD A;  4AVP A;  1GXP A;  2A6H F;  1BJA A;  5FD6 A;  2M87 A;  1FT9 A;  3BP8 A;  4RAY A;  3MFK A;  1MDM A;  3V8J A;  1MDM B;  1Z05 A;  4OU0 A;  2QZ8 A;  1D5V A;  4YFN F;  2NNN A;  3P9K A;  2XKP A;  2VE9 A;  3WTY C;  1LVA A;  3RI4 A;  2L54 A;  5FLX K;  1AWC A;  3V8K A;  1R5G A;  3TO9 A;  2ADU A;  1BOA A;  1IZ1 A;  3R0A A;  4EM2 A;  2A07 F;  2XGX A;  2UZK A;  1FNN A;  1H9G A;  2V6C A;  1R1V A;  3F6V A;  5BOX A;  3QPH A;  1ON2 A;  3MZY A;  1G3W A;  3LA7 A;  3Q5F A;  3IKT A;  5FO5 A;  3J7A O;  1HW2 A;  4OMY A;  4YG2 F;  4XSX F;  1I1S A;  4L9J A;  3E3V A;  3FF5 A;  3EYY A;  2PFB A;  2D45 A;  1BI1 A;  1TNT A;  4ETS A;  2H27 A;  3TO7 A;  4HW0 A;  3M1E A;  3HTS B;  2W24 A;  4KN4 X;  5FB2 A;  4I0B A;  1HST A;  5D8K B;  5CJ9 A;  4ZZL A;  4U88 A;  1LNW A;  2CWE A;  3N97 A;  4KIC A;  4RGR A;  5CVR A;  2AXL A;  2Z5U A;  1HKT A;  4Z2Y A;  2YU3 A;  2LNB A;  2KJC A;  4CDG A;  1Z7U A;  3P9I A;  2IJL A;  4U0W A;  4P9F A;  4ESB A;  2NNY A;  4EMS A;  2Z99 A;  2F2E A;  1OR7 A;  4K2E A;  4HLY A;  2JZY A;  1MJB A;  1FX7 A;  4IVN A;  3WGH A;  2P6S A;  1Z6T A;  1GVJ A;  3K1M A;  2VT3 A;  4TV7 A;  4WXD A;  2P8T A;  2VXZ A;  3FMR A;  5H6R A;  1I6X A;  2H94 A;  2Z3Y A;  1SFE A;  1F4K A;  2XV4 S;  3KP5 A;  3ABU A;  2O3F A;  2MBF A;  2XAG A;  1CF7 A;  1QPM A;  1CF7 B;  1R58 A;  2FQ3 A;  4GGG A;  1QBJ A;  1O7F A;  4DNC A;  5FLX Z;  5L3B A;  1RNL A;  2FOK A;  2EK5 A;  2P7C B;  2LF7 A;  2COM A;  3GXO A;  1OYW A;  4M71 A;  4WXC A;  1P4A A;  2G7U A;  4XSZ F;  4F7Z A;  1RZ4 A;  2DI3 A;  3P7N A;  5J8F A;  4A0Y A;  2E7X A;  1S8N A;  3GW2 A;  3KE2 A;  4KT5 C;  2LKP A;  3TGN A;  2HWV A;  1DDN A;  2QBY A;  2QBY B;  2QQ9 A;  1S29 A;  1ZN2 A;  2DFI A;  2HDC A;  4EGY A;  1W7P A;  4LB6 B;  1W7P B;  3QU6 A;  1PDN C;  1R22 A;  1OYI A;  4B8X A;  4A5M A;  1ON1 A;  1R1T A;  1BC7 C;  3QPT A;  4IHS A;  4PCQ A;  5DD8 A;  2A6E F;  1W7P D;  1RIO H;  1UHM A;  5LHI A;  4ZYG A;  2VC1 A;  1JGS A;  4OIQ F;  2UWM A;  3M7G A;  2PLY A;  2ZNY A;  5L3E A;  2DT5 A;  3RYP A;  2ZFW A;  2V1D A;  4ASN A;  2RC4 A;  2GIV A;  4EVI A;  4KNY A;  2PG4 A;  3E6B A;  3SZT A;  1HQC A;  4Y15 A;  5H6Q A;  4Q47 A;  2QLZ A;  3D5L A;  1U5T C;  3R4K A;  2K86 A;  2BGC A;  1SMT A;  5LEJ A;  5LLQ A;  2HR3 A;  1U5T A;  2CGP A;  5L3C A;  3B73 A;  4M73 A;  2GQQ A;  2PMU A;  4FX0 A;  2O61 A;  2BV6 A;  3K2Z A;  1FBQ A;  2J5O A;  3WE3 A;  5K1Y A;  4L9T A;  1OMI A;  1Z9C A;  1IRG A;  2GXG A;  3ZMU A;  4HQE A;  1KU3 A;  4LLN A;  1L0O C;  5D5X B;  5TJJ A;  3KEO A;  1ZRC A;  5K5Q A;  5HVQ C;  3QP6 A;  2PJP A;  1TW3 A;  3H3Z A;  5L3G A;  1KA8 A;  3ERE D;  3HHH A;  3LWF A;  1R5H A;  2M5W A;  3K69 A;  4RGX A;  4P9U A;  5KK1 A;  3L2C A;  1OYY A;  2XRN A;  3EUH A;  1O57 A;  4HOB A;  1XB4 A;  3PFI A;  2VON A;  4IHT A;  1XCB A;  1YS7 A;  2FSW A;  2FF4 A;  4L0Y B;  2KKO A;  1XMK A;  3WG9 A;  2YPR A;  1IUY A;  1F1Z A;  1J7K A;  3CUO A;  2CG4 A;  1RUO A;  3FXR A;  3GEZ A;  3RYR A;  3F8M A;  1MJ9 A;  1R23 A;  1BI0 A;  3KEQ A;  4XLN F;  5L3D A;  3BOQ A;  1I27 A;  3JTG A;  2W57 A;  5BS6 A;  3N4M A;  4KMU X;  3FX3 A;  2O8X A;  1V3F A;  3DPL C;  4U0Y A;  1B59 A;  1FYK A;  5LRS A;  4RGU A;  3HSF A;  4WCG A;  4LGW A;  5LBQ A;  1XGO A;  4IRG A;  1UB9 A;  5ICF A;  3K0L A;  3ZMT A;  1YYV A;  2IA0 A;  5BMZ A;  2OQG A;  5ED4 A;  2D2W A;  1PUE E;  2R3S A;  3U2R A;  5DV5 A;  4HF1 A;  5CVJ A;  2DO7 A;  3J80 K;  3DXJ F;  4LK1 F;  4N9H A;  4MEX F;  2MA3 A;  3G3Z A;  2FNP A;  4WX9 A;  2X4H A;  1P4X A;  5JR3 A;  1OKR A;  3K1P A;  2XRO A;  2PBI A;  1A04 A;  4HDU A;  3G73 A;  3WTV C;  1XMA A;  2TDX A;  1KU7 A;  3I53 A;  3DPT A;  4CYD A;  2ZBK A;  3F72 A;  4OIR F;  1HKS A;  2FA5 A;  4JQF A;  2ZO4 A;  2QWW A;  1YG2 A;  3F8B A;  2RV8 A;  3KZZ A;  3KP3 A;  3KZY A;  4L9V A;  4MEY F;  2P5K A;  3E6C C;  4GYG A;  5DD4 A;  1HSJ A;  4L0Z B;  3U1D A;  3KCC A;  1IXC A;  2GWR A;  3ZN1 A;  1FWZ A;  1TLH B;  4I01 A;  4RS8 A;  5LGN A;  1SD7 A;  3IHU A;  3WU1 B;  4M9Z A;  2DTR A;  1U6G A;  4ENJ A;  4HDV A;  3IWF A;  3FMQ A;  3F3X A;  4IRI A;  4AIK A;  3MAJ A;  1JHH A;  1XDS A;  1ONV A;  3C1D A;  3ZQ7 A;  3T8T A;  3REO A;  3GZ5 A;  4EJV A;  2Y0M A;  1UHW A;  2CQK A;  3VEP A;  3I5U A;  2BBY A;  4RGS A;  5J6X A;  1ZYR F;  5D5V B;  4EJT A;  2CFX A;  2R7F A;  4I98 B;  4A0Z A;  4ENN A;  3P9C A;  2HS5 A;  2HKO A;  1QZY A;  2XAH A;  1ZLJ A;  5E1X A;  1USS A;  1J59 A;  2F5D A;  4MGR A;  3CLO A;  2HYF A;  4PDK A;  2IVM A;  4QWQ A;  1XCV A;  3I54 A;  1TNS A;  5HOO A;  4UHT A;  2VE8 A;  4IRH A;  1VTN C;  5K5R A;  2GZW A;  5AIQ A;  4EJW A;  1FP1 D;  2RNJ A;  5E8I A;  2OZ6 A;  4EGZ A;  2IW5 A;  1WI9 A;  1DPU A;  1U3E M;  1H9T A;  1DUX C;  1Z6R A;  2G9W A;  1WWX A;  4M9S A;  3C18 A;  5HDN A;  4KIG A;  1QO0 D;  4LFU A;  3H3U A;  3ZPL A;  3FMS A;  3WTT C;  3V8L A;  2OAZ A;  2XUB A;  3ECO A;  3K1N A;  3ZMV A;  2QQA A;  5JI6 A;  3J80 Z;  4A0X A;  1S3J A;  2DQL A;  2HTS A;  2NS0 A;  3T0Y A;  1UFM A;  4RB1 A;  3KFW X;  3ZP5 A;  3I58 A;  5DCM A;  2DQR A;  3E6M A;  5DCM B;  3GUD A;  1QQI A;  3FWE A;  2JT1 A;  4EM1 A;  2H6C A;  1T0F A;  1KGS A;  5E18 F;  3T8R A;  3TKY A;  2WTE A;  3M9A A;  2VBX A;  4A12 A;  4BH9 A;  5TRD A;  5F6F A;  5L3F A;  3H92 A;  2FMY A;  3ABT A;  2ISY A;  1Z1D A;  1I1G A;  2HGC A;  3I4P A;  3M8F A;  2F5E A;  5IT9 K;  4ESF A;  4XRF A;  2JPB A;  4R8H A;  2H6B A;  3D0S A;  3FHZ A;  5E1W A;  2NRA C;  1QNT A;  1XGS A;  5ICC A;  3W6J B;  3WOD F;  2V9V A;  1W4M A;  2QEN A;  2HQR A;  4HAM A;  3FZV A;  1LDJ A;  4LMY A;  4YFK F;  2DPU A;  3FM5 A;  3IKV A;  3F8C A;  2G7H A;  1ZH5 A;  3BJ6 A;  3CUQ C;  1HW1 A;  1X3U A;  4KN7 X;  4BHP A;  2LSO A;  1W5T A;  2EB7 A;  3RTR A;  2FBH A;  3ZMD A;  2YR2 A;  3S2W A;  5DCF A;  4YII A;  3RDI A;  3I64 A;  1S7O A;  2WV0 A;  1EH6 A;  4DQ2 A;  1ZAO A;  4RAZ A;  1MKM A;  3ULQ B;  3QAH A;  2IPQ X;  2IP2 A;  2EFN A;  3WTS C;  2PEX A;  2M30 A;  2FU4 A;  5CVU A; 
#chains in the Genus database with same CATH topology
 1Q1V A;  2XAS A;  1SD6 A;  3ABL H;  4UB6 C;  2VOO A;  1G3S A;  1G6N A;  3CD6 I;  3E7L A;  2FEZ A;  3TW6 A;  1MNE A;  4C9Y A;  2JK3 A;  1Z0X A;  4JBA A;  2EH3 A;  4MQV A;  2FXA A;  2P6T A;  1NK2 P;  4S0H B;  4AIH A;  2ACJ A;  3R6S A;  1Y1W J;  1LFB A;  1ETK A;  1IC8 A;  5KVR A;  3CO6 C;  4LB5 A;  3TOB A;  2PX9 A;  2E2I J;  4OIO F;  2F4I A;  1X3Z B;  2GXB A;  4A3C J;  1KU9 A;  5JVT A;  3RPQ A;  4ZTJ A;  4LG0 A;  1U8B A;  4LG0 B;  1Q1H A;  4EAT A;  1FOY A;  1KYW A;  4BXU A;  3GX4 X;  1X4P A;  1JKP C;  2Y30 A;  2Y0S A;  4KUM A;  5F1J A;  3BJA A;  3A01 A;  3QRF F;  3A01 B;  5J1R A;  2BZT A;  2OBP A;  5BPD A;  1H89 C;  2HZT A;  4G8X A;  2OTJ I;  2LC2 A;  2GOM A;  3LA2 A;  2LP0 A;  3NWT A;  5FKL A;  4XLH A;  3Q9V A;  2KRF A;  5F1R A;  3DWL E;  1FBS A;  1MH4 A;  5HLG A;  1R36 A;  2R7T A;  2FX0 A;  2X9D A;  2J5P A;  3OL4 A;  1O3T A;  1BBY A;  4PJN A;  4YFX F;  3F22 A;  1YIJ I;  3PQK A;  5DDG A;  3FIS A;  2YU9 J;  2EFO A;  2ZJQ F;  3ERM A;  3HUG A;  4Y17 A;  2XRL A;  3HUG B;  2L7M P;  4BQA A;  3Q3S A;  4J01 A;  3OYE A;  4KFC A;  1IN8 A;  1OCT C;  3DKW A;  4RM3 A;  4D5F A;  3E97 A;  1KYZ A;  4G7H F;  2HVS A;  5EEG A;  1LEB A;  2K3P A;  1W5S A;  3EUK L;  4I99 C;  2DA3 A;  5JLW A;  4B09 A;  4E7S A;  2E19 A;  2DFH A;  4FE4 A;  4O5V A;  3ZQG A;  5JHF A;  5EG0 A;  2DN0 A;  3S1Q J;  2HZD A;  3HRM A;  5EG0 B;  1TW2 A;  4M6X A;  4ENK A;  1GLN A;  2M2E A;  4KIF A;  3KET A;  4XOP A;  4GRI A;  3CME I;  1AKH A;  3K4C A;  5JLX A;  3ABK H;  1L3L A;  1AKH B;  2MC3 A;  2EFP A;  5IT3 A;  1J2X A;  2EIJ H;  3ML6 A;  5IT9 Z;  2STT A;  3A03 A;  2ZB9 A;  2VJI A;  4RB0 A;  3X2Q H;  2LRE A;  4GCV A;  3JRC A;  5FLM J;  2BY1 A;  2Y75 A;  3RPU A;  3O6B B;  1BW5 A;  2FQ4 A;  3OYH A;  2FE3 A;  4HEA 2;  1IN4 A;  3U1K A;  3COA C;  5F04 A;  2HQN A;  3IH4 A;  1XX5 A;  4CCM A;  1X4O A;  4S04 A;  1UST A;  1R9T J;  1W36 C;  1S9H A;  2QM3 A;  3BWG A;  4NUB A;  3TBI A;  3RPU D;  3LQR A;  1WH5 A;  3OIQ A;  4XKW A;  3FBI B;  3ZR8 X;  3LAJ A;  1XDU A;  4XLF A;  1RUN A;  1IXS B;  1LJ9 A;  4DBR A;  1TBX A;  1ZK8 A;  1U5T B;  2W4S A;  5FD5 A;  4M3E A;  2JSC A;  1PP7 U;  2O6G E;  1OFC X;  4UNO A;  3BR2 A;  3RKW A;  4C3I J;  1S7A A;  2HPI A;  1WHU A;  4YRV A;  3S32 A;  1FJL A;  3E6D A;  4BGD A;  3CF5 F;  1I6H J;  4BYY A;  2AO9 A;  2IGN A;  2C6Y A;  3TW7 A;  2QKM B;  1FLI A;  1JXS A;  2FML A;  1BIB A;  3W3C A;  4BEH A;  5FRO A;  4BEH B;  4ESJ A;  3DTK A;  2X1D A;  2XAQ A;  4BE2 A;  1J75 A;  1TQM A;  3BRO A;  1F5T A;  5HLH A;  2B0L A;  3LSR A;  2ELK A;  4A3J J;  2JJ7 A;  2DYS H;  3FXO A;  4HV5 A;  4UVB A;  4I2O A;  2DW4 A;  4ZDP A;  2CV0 A;  1WVR A;  2L7Z A;  1VQL I;  3JRF A;  1Z91 A;  3LSG A;  1Y0U A;  4CSW A;  2QQB A;  3W2V A;  1R49 A;  4V2G A;  4E7J A;  1K78 A;  1K78 B;  1YIO A;  3CJT B;  4N4N B;  1MZB A;  1V5E A;  5LFA A;  2XHK A;  1FPQ A;  4MFE A;  3GME A;  2L2O A;  3QU3 A;  3B02 A;  1ZG1 A;  4Y7N J;  4I09 A;  1X19 A;  2W85 A;  3CJN A;  5CLS A;  4HYE A;  3KP6 A;  2Y9Z A;  3ELK A;  1K6O A;  1U78 A;  2VQL A;  2RRE A;  2CFO A;  1LUJ B;  2M45 A;  5DM6 F;  1JJ8 C;  1KQ8 A;  3HSE A;  4IPA A;  4Y3O A;  4L18 B;  4G6D A;  2MH2 A;  1TWH J;  3IV5 A;  3NAR A;  3SXY A;  2V9K A;  3A02 A;  3KZI C;  3MZH A;  1JT0 A;  1N78 A;  1UCR A;  5TIS C;  1BN5 A;  1RC9 A;  2L9N A;  2IGM A;  2VPL A;  2DYR H;  4PJM A;  3QQA A;  4P96 A;  4EQQ A;  3PQJ A;  1OCC H;  3MKL A;  4OIN F;  1YE9 A;  4YIF A;  3GFL A;  3OS2 A;  4Y52 J;  1N77 A;  2BY2 A;  2VKH A;  4XKB A;  1VQ4 I;  2X51 A;  1V5G A;  2BXZ A;  1YW8 A;  3BG9 A;  2ZJR F;  3K4K A;  3WTX C;  3R0J A;  3MZ8 A;  4UVC A;  2P7C B;  1F36 A;  2UV1 A;  1JE8 A;  1SAN A;  3ESW B;  2QSF X;  4WK8 F;  2VAS A;  2WAE A;  1LVK A;  1IN6 A;  2FBK A;  3W2A A;  2O9L A;  2OC6 A;  3CCM I;  3M8E A;  2X6X A;  3K9T A;  5CVV A;  1CGP A;  2QSG X;  4I0A A;  3DBR B;  1DQU A;  1FTT A;  1IUF A;  3ZQQ A;  2M4G A;  1FSH A;  1K79 A;  1T95 A;  3OYF A;  3L2V A;  2Y31 A;  2KDO A;  3DF8 A;  1D8J A;  4HLX A;  3HPH A;  2Z9O A;  2KIS A;  1MMD A;  4S05 A;  4KMF A;  4BJT A;  3HRS A;  1YW7 A;  3DQV C;  2KDZ A;  1HF0 A;  1WGX A;  1XG1 A;  4RDU A;  2JN6 A;  1ZG3 A;  3DKX A;  2IXS A;  3DEU A;  4LJZ F;  2CUZ A;  2OF7 A;  4ANJ A;  4M9X A;  4LLL A;  1SAX A;  1Z3Y A;  1IV6 A;  1WJB A;  2WAQ N;  1IN5 A;  2DJI A;  4XIC A;  2ETH A;  3AL0 B;  2ZKZ A;  2P81 A;  3BDD A;  1TTY A;  2QA4 I;  3OV8 A;  2B63 J;  3LFK A;  3A0H C;  3BJO A;  3DLA A;  1S5L C;  4EM0 B;  3LSP A;  1ZG5 A;  2RGV A;  1O7L A;  2QEX I;  4BDZ A;  4FIS A;  3CCL I;  3CZ6 A;  1YQA A;  4A3E J;  1FSE A;  2A69 F;  1EH8 A;  1LDK B;  1G3T A;  2EPF A;  4A5N A;  3IAM 2;  3BR0 A;  3R60 A;  5FRM A;  5B66 C;  2F4O B;  3O8G A;  4CH7 A;  3K70 D;  5A2Q K;  4Q4Z F;  2JA8 J;  4RB3 C;  4UV9 A;  2HEO A;  2Q1Z B;  4NB5 A;  2DCE A;  1EV7 A;  5HDK A;  1MMG A;  2FNA A;  2Q8K A;  3KX2 A;  2VUM J;  2LDU A;  3S3N A;  1UG0 A;  2EJR A;  3E5U A;  3LOC A;  2EFW A;  2KHM A;  4GYI A;  3G2B A;  1H8A C;  4M72 A;  1SFU A;  3HEF A;  4XRS G;  1DPR A;  2LR8 A;  3OYG A;  3H9Q A;  1U9O A;  2BE5 F;  1B6A A;  1IO2 A;  2DA4 A;  3JRE A;  2HI3 A;  4IJA A;  3CC7 I;  1TQI A;  2K9S A;  3GF2 A;  4CXF A;  3H3V K;  4IO9 F;  2K7L A;  1YW9 A;  1FOW A;  2PI0 A;  3HOX J;  3ISP A;  1MMS A;  2XGD A;  3UNG C;  4BHC A;  4EJO A;  4KT6 A;  3VYS B;  5DEQ A;  3HXL A;  3VOD A;  3ZMZ A;  2GAU A;  4B44 A;  4PSX A;  3JRD A;  2R7R A;  2WWY A;  4HX4 A;  1T33 A;  2X1E A;  2HXI A;  1BR4 A;  3LA3 A;  2RVC A;  1RR7 A;  3ZQI A;  3VB2 A;  1XSV A;  3TOA A;  5CQG A;  4WXH A;  3WHC A;  5D4S A;  3O8H A;  2CO5 A;  5EGO A;  1ZRF A;  3FHN A;  1J9I A;  5EGO B;  2XAU A;  5M5X J;  3AFH A;  4ENM A;  3VSK A;  4G7O F;  2DA2 A;  1VND A;  3F8N A;  3HYI A;  3RCO A;  3V7C A;  4I76 A;  3F9K A;  3V7R A;  1FYL A;  2IRF G;  2TRT A;  4IQJ A;  2ZNZ A;  1H0M A;  4IXA A;  2Y0S N;  1P92 A;  5IYB J;  5K7F A;  1JKR C;  3WHB A;  5GPA A;  1ZAR A;  4P5O A;  3K7A J;  2EFQ A;  2ZC2 A;  3L1P A;  5E1Z B;  2DOE A;  4BS9 A;  3PNV A;  4ZH4 F;  3OYJ A;  3PFY A;  1IDY A;  5HS9 A;  5AIP A;  1K4S A;  3HRU A;  3GFI A;  2ESH A;  1MMA A;  3G1O A;  4E4H A;  1YFH A;  3J81 K;  1POG A;  2BVM A;  3KLN A;  1IDZ A;  3DEE A;  5F64 A;  3WTZ A;  2IA2 A;  4BY7 J;  1XN7 A;  2VQG A;  2L5Q A;  2R7Z J;  1BM9 A;  1G8X A;  4ZYE A;  1YJW I;  5LD2 C;  1E3H A;  2E2J J;  5LGT A;  2W00 A;  1WFX A;  4KYW A;  3DTI A;  4A69 C;  4CIC A;  5HNH A;  4AM3 A;  2PMH A;  3CDI A;  4HX8 A;  1YTY A;  2XF5 A;  3DPU A;  2JUG A;  3S14 J;  4CUG A;  4U87 A;  2ZME A;  1FOX A;  1TQP A;  2M7B A;  2ZME B;  2KQR A;  1I39 A;  3LQQ A;  3QP5 A;  4XKV A;  4PZJ A;  4BU2 A;  2RQP A;  2P5L C;  1FIP A;  4HX7 A;  4XK4 A;  4AD9 A;  2MW8 A;  3SJM A;  2E7W A;  9ANT A;  3ZN0 A;  3WGI A;  1DU0 A;  3CQZ J;  2XSD C;  2O0Y A;  2AHQ A;  1VQ9 I;  4JX6 A;  3FM3 A;  2KRC A;  3BPV A;  2K27 A;  3HTU A;  3ZRG A;  4F3Q A;  2E1M B;  4M3G A;  2XVC A;  1I5Z A;  4OIP F;  3C3W A;  3NQO A;  2VBY A;  1P2F A;  1S7E A;  3GLX A;  2R93 J;  2LKS A;  4IL6 C;  1OLT A;  2ME0 A;  3H9J A;  4OAZ A;  4KIS A;  5ICE A;  1R7J A;  4EEF G;  1V54 H;  2ELH A;  3L2W A;  1FY7 A;  2IS4 A;  3KEY A;  2E1C A;  3HSR A;  2M9H A;  3S8P A;  1WSU A;  1OQY A;  1D1B A;  1R6R A;  2CS3 A;  3KP7 A;  1ZEL A;  3Q9S A;  3DCF A;  3BG7 A;  3DFG A;  1D1A A;  3FK6 A;  4R79 A;  2E34 A;  3ROU A;  5LHH A;  1IN7 A;  3ABM H;  1DGR M;  3PNT A;  4F93 B;  3SYT A;  2F5C A;  4BAY A;  3GTM J;  4BNC A;  5F0F A;  1SD4 A;  1OCZ H;  4MTD A;  3GVA A;  4FHT A;  4N0B A;  2X6W A;  3OYL A;  4KDP A;  2NVU B;  5D6F A;  5A2Q Z;  1ZTR A;  1G2H A;  1KON A;  1U2W A;  1TWA J;  5B1A H;  1VZ0 A;  3OOP A;  4N9I A;  3F23 A;  3OS0 A;  2QYO A;  5KNL A;  2RN7 A;  2EV5 A;  2W84 A;  1WCM J;  1QA6 A;  1MBJ A;  5E20 A;  2JSP A;  3VOE A;  3F8F A;  2DJN A;  3SEQ A;  2XKO A;  2ZCW A;  3SHF A;  4L5E A;  1J0R A;  1SC7 A;  1XGM A;  3IC7 A;  4BXX J;  2JWT A;  3AG3 H;  2A68 F;  4NC8 A;  4LD5 A;  3BY6 A;  5LRR A;  1TP4 A;  2DAO A;  5D5W B;  3DP7 A;  3OYK A;  3IL2 A;  3M4O J;  2EV6 A;  1RPW A;  1QZZ A;  3JW4 A;  3W2W A;  4AU7 A;  4RB2 C;  2V1U A;  1WPK A;  5KAF C;  3ZQC A;  2PJR A;  2PJR B;  5EDN A;  1JUS A;  4HA8 A;  3B6C A;  4NC6 A;  4HQM A;  3V4G A;  4HV6 A;  1SD5 A;  1YRN A;  4XR6 A;  2M0M A;  2EZH A;  2IGK A;  4LG3 A;  1YRN B;  3K4L A;  2VOP A;  1SAU A;  2OZU A;  4Y13 A;  1NHA A;  3LST A;  4Z6Y A;  5DYM A;  4L5J A;  1Z67 A;  4XM3 A;  5CVI A;  4ZYD A;  3AAF A;  4IHY A;  2CYY A;  5J1Y A;  1QHG A;  1HOM A;  4E7K A;  2CQ7 A;  3BCA A;  5D4R A;  2STW A;  4BQQ A;  3C2H A;  3VPR A;  5HNF A;  3NWS A;  1WJC A;  4MLO A;  1BIA A;  3PUB A;  2KIU A;  3G4S I;  4G7Z F;  1Y0N A;  2NVX J;  4B43 A;  3SQN A;  3K10 A;  1LFP A;  3ZQF A;  2H8R A;  1YS6 A;  1X58 A;  1G4D A;  3C2B A;  1NG7 A;  4GDF A;  2JMW A;  2ESN A;  2QQ8 A;  5LEK A;  3QYF A;  4EV0 A;  2LBF A;  1MD0 A;  3JTH A;  2LBF B;  3IAS 2;  3CUQ A;  2O5R A;  3DKY A;  3CUQ B;  1FYM A;  2LRD A;  3MKW B;  4E70 A;  4D7M A;  2WAF A;  4U7D A;  1OIS A;  1OR7 C;  1HW5 A;  2Z2S B;  5F0H A;  2YX7 A;  1OPC A;  2MG4 A;  4Q48 A;  3W6K B;  2EZI A;  3E0J B;  1R4M B;  2O7O A;  3BZ6 A;  3H5R A;  3SDB A;  3LNQ A;  5GPC A;  2M8E A;  1WQ2 A;  2K9Q A;  1NH3 A;  4H0E A;  2H1K A;  2Q2E A;  2XAJ A;  1SMY F;  2Q2E B;  4A2U A;  4BAC A;  1EA3 A;  2GA1 A;  2R5Z A;  2CRG A;  2TCT A;  2X0L A;  5FGM A;  2R5Z B;  1IF1 A;  3L9F A;  1G59 A;  3QOD A;  3EET A;  2DDA A;  5DUK A;  4KA4 A;  1MJA A;  3J81 Z;  3FXU A;  3KLO A;  1MGT A;  4D0P A;  1U9N A;  3GO5 A;  1HDP A;  3DEW A;  3DV8 A;  3MCZ A;  3GTJ J;  1OCO H;  1JHF A;  3FXK A;  4OAY A;  4XQF A;  1O3R A;  5B1B H;  2VJ5 A;  1T39 A;  4G6T B;  3I71 A;  2BHY A;  2KPM A;  3BTL A;  4PGG A;  1JKO C;  3PIP F;  2EBI A;  4PGH A;  4UVA A;  3U21 A;  4ZZD A;  2R0Q C;  4HBL A;  2K85 A;  3MD2 A;  3CCR I;  2Z1D A;  2P5V A;  1YIT I;  4U7B A;  1P6R A;  1FBU A;  2DK5 A;  2MAB A;  1WJA A;  4XID A;  2FUG 2;  3RIR A;  4UXN A;  3GWZ A;  3OIP A;  4B4C A;  3CMA I;  3EDP A;  4RLQ A;  3SFZ A;  1APL C;  5E8G A;  5JVG F;  1LDD A;  4XKC A;  4EJU A;  1IV8 A;  1IAW A;  3GFM A;  3GYH X;  2MLK A;  1FC3 A;  2XIG A;  2HOE A;  3HRT A;  2ZJ2 A;  3HM5 A;  2K40 A;  5HLI A;  3S1M J;  1ZGJ A;  4M74 A;  1ZLK A;  1DP7 P;  2LF8 A;  3N05 A;  4I02 A;  4M3D A;  2KJB A;  4ON0 A;  1ULY A;  5J8C A;  1D8K A;  4XLC A;  3JSP A;  1JGG A;  1ODD A;  3HB9 A;  3M07 A;  4ZC3 A;  1MH3 A;  2V79 A;  3L00 A;  5IPA A;  1YO5 C;  4MNU A;  5FJ8 J;  4UUV A;  3H36 A;  3D5S C;  1E2X A;  1LEA A;  1D0X A;  3H5A A;  2MD0 A;  4ZYH A;  4ABZ A;  2NAZ A;  1ETV A;  4RMN A;  4I7H A;  3BZC A;  1XSX A;  4NBQ A;  2E1N A;  2VKV A;  3AG2 H;  1BJZ A;  4XRM A;  2K3F A;  2UXX A;  1FP2 A;  3CLQ A;  1SEU A;  4E6K G;  3LAP A;  4HNU A;  2K4B A;  2IAI A;  2VKD A;  2OU2 A;  1G3Y A;  4M6Y A;  2FBI A;  4A93 J;  3CO7 C;  3SZP A;  2A3S A;  4LK0 F;  4D1Q A;  1B9M A;  1T2K A;  1K61 A;  3CTA A;  2HOT A;  4QLC U;  4DZP A;  1Y8R B;  1D1C A;  2DA7 A;  4D9J A;  2MD5 A;  3T5X A;  3CCJ I;  4RA2 A;  5FFZ A;  1ZGW A;  1YJ9 I;  3RZD J;  1QGP A;  2CMP A;  3CMY A;  4XBF A;  2F5F A;  1V55 H;  2R7D A;  4AVZ A;  3I0T A;  5ILS A;  2D5V A;  1W1W E;  1TWC J;  1MBK A;  3FXQ A;  3CMM A;  4C30 A;  3LMM A;  2HFH A;  3RQ4 A;  4GXO A;  4A6E A;  3M3Y J;  4G9Y A;  3RKX A;  3TQN A;  1NG6 A;  2P4W A;  3K4B A;  2HYG D;  3WTU C;  2G0E A;  2YSR A;  4DYC A;  1SFK A;  2VBW A;  3Q0U A;  4E7Z A;  2KP6 A;  3ECH A;  1D0Z A;  4AIJ A;  1ZKG A;  1UEL B;  3CDL A;  5IOZ A;  1VF9 A;  3WTW C;  1XSD A;  1X2N A;  3K6G A;  1RI7 A;  2DOF A;  4B47 A;  3OY9 A;  4IQ4 A;  4HZF A;  1ZHF A;  5FKO A;  2FRH A;  2L4M A;  1VQN I;  3HGG A;  3PUF A;  2WY7 Q;  2DLL A;  2V6E A;  5BQT A;  3JAM K;  1MSF C;  2NVY J;  2A61 A;  2DMN A;  2Z16 A;  1XGN A;  2AQE A;  4QIW N;  1BI3 A;  3J7A Y;  3A4C A;  3O2P E;  2KIF A;  3OR2 C;  3WGG A;  2KIM A;  4A6D A;  3HOT A;  2B9S A;  1W36 D;  4NDL A;  4HF0 A;  4BJ6 C;  2CUF A;  2Q0O A;  2IT0 A;  2DU9 A;  2AQF A;  3HL2 A;  1WJ5 A;  2NOJ B;  1BC8 C;  1AHD P;  2LYC A;  4Y33 A;  2L4A A;  5DUI A;  1R00 A;  5EEH A;  5HDG A;  2KZV A;  1XD7 A;  1K83 J;  3JRB A;  3AKZ A;  2HTJ A;  3TO6 A;  2MLG A;  5KCM A;  2K02 A;  4KIB A;  3IRQ A;  1E17 A;  2NS8 A;  3GZN B;  5J4Y A;  4Q5S F;  1HBX G;  4BBR J;  2EIK H;  2DPD A;  2M1B A;  5FFX A;  2PQ8 A;  1YLF A;  1MBG A;  1RET A;  5AON A;  3QOP A;  4KIT B;  5ICG A;  1T98 A;  1XTA A;  4QTR A;  1QPI A;  2EV0 A;  5C44 J;  2HKX A;  2VBZ A;  2AS5 F;  4CHU A;  3BCB A;  1RRJ A;  1QVU A;  2QUF A;  3L09 A;  1LFU P;  3A1Y A;  2OD5 A;  1QU3 A;  1LQ1 A;  1HXD A;  4AC0 A;  4XMY A;  1KQ9 A;  2CV2 A;  1B1B A;  2WC2 A;  3OYM A;  3RZO J;  1VQ7 I;  3EUH C;  3MVP A;  2JA2 A;  1K7A A;  3A2K A;  3TDU C;  4P55 A;  2L9S A;  4XOR A;  2JTV A;  2GA2 A;  2NXN B;  2ZSI B;  1PP8 F;  3WE2 A;  4GO1 A;  4JOM A;  3T1B A;  2DMU A;  2O03 A;  3CCV I;  4OMZ A;  1REP C;  1OCP A;  2LMD A;  2LY2 A;  3GTL J;  4FX4 A;  2OA4 A;  1EH7 A;  2QVO A;  2VT2 A;  2VB6 A;  3BR1 A;  5IYD J;  4O6J A;  2CU7 A;  1JTY A;  3EQL F;  2PMZ N;  1LKX A;  1O3S A;  2CQQ A;  4MTE A;  2I8D A;  4G12 A;  4G6Q A;  3IP4 B;  2UXN A;  2RNG A;  3CCY A;  3K4N A;  3IRR A;  1B4A A;  1JJ6 C;  1O3Q A;  4UY8 I;  2VC0 A;  3NEU A;  2RKH A;  4NQW A;  1TT0 A;  1D5Y A;  4NQW B;  4BY1 J;  1JT6 A;  5BPI A;  3SFI A;  1F9N A;  3KPH A;  1ITY A;  2KFD A;  4L9N A;  2EWN A;  5F0C A;  3GZ6 A;  1U8R A;  3CC2 I;  1QVT A;  5C4X J;  1WZ2 A;  1HKQ A;  4MHG A;  2A5W A;  3GTQ J;  2Y48 A;  3FK7 A;  1SFX A;  1OCR H;  4CZZ A;  1FOK A;  5LHG A;  4NHJ A;  3JCU C;  1YOV B;  1R71 A;  5GAH J;  4XRS A;  3DU5 A;  3KYL A;  2IS6 A;  1GHC A;  1C0W A;  4F92 B;  1X1P A;  2PN6 A;  1KU2 A;  1J5Y A;  3MWM A;  3PM1 A;  2DXI A;  3RKY A;  2R92 J;  4DOZ A;  4X6A J;  2Z33 A;  1P7I A;  2ZXJ A;  5D5U B;  2JPC A;  4I6Z A;  2L02 A;  2NYX A;  3I59 A;  5D6E A;  5LGU A;  3I59 B;  2JVH A;  3HJE A;  6PAX A;  4O3M A;  2MYS A;  3CDH A;  2R7S A;  3E5X A;  2L3D A;  2BYV E;  4FET A;  2E36 A;  1P4W A;  2QGU A;  2L01 A;  3FBN B;  5K7Z A;  2HQA A;  1S6L A;  2F48 A;  2VN2 A;  4HF2 A;  4BHB A;  3CJQ B;  3KP4 A;  3JRI A;  2BOL A;  3NRV A;  2WY8 Q;  3VYR B;  2K4J A;  3F6O A;  4R1H A;  2ME6 A;  3GTK J;  3WU0 A;  1R1U A;  3LSK A;  3WG7 H;  5CYV A;  3QPL A;  2RDP A;  4FT8 A;  5JFR A;  1HLV A;  2VOD A;  3PO3 J;  1QHH D;  2V1X A;  1IW7 F;  2IEK A;  1X2M A;  3QPS A;  2ISZ A;  3EYI A;  1FIA A;  2MH9 A;  2XAF A;  3U9G A;  2OCC H;  3JSO A;  4IEJ A;  2NVT J;  2A5Y B;  3O3K A;  2R7X A;  1P9Q C;  5TGT A;  4BKX A;  5B5E C;  2R7Q A;  4JK1 X;  1ETY A;  2COB A;  2JRT A;  3MEX A;  4UUS A;  2EA4 A;  3PIO F;  4UUS B;  1VFC A;  4OOI A;  1VQK I;  2FJ1 A;  2CSO A;  2E35 A;  2CUJ A;  1B9N A;  2D1H A;  2WB1 N;  3E5Q A;  3C7J A;  2YS9 A;  1Z77 A;  3L7W A;  4HNV A;  2DBB A;  1SVM A;  2OV7 A;  1HA8 A;  1KQ0 A;  5ILU A;  2DFF A;  3JAM Z;  2EA2 A;  5GTH C;  4IHW A;  2L9V A;  1LB2 A;  1A36 A;  1PVE A;  5ILV A;  2LKX A;  2X48 A;  4WF2 A;  4U0V A;  1V4R A;  2VQH A;  1AOY A;  5HLT A;  2CW0 F;  2P7V B;  1WRJ A;  1MBF A;  5JHU A;  4CO8 A;  3HOV J;  5FKN A;  1AA7 A;  4A3G J;  2VL8 A;  2JA5 J;  3V7S A;  4IF4 A;  5K7H A;  1IRZ A;  3MQ0 A;  3R61 A;  4ZTF A;  1WKM A;  3H0G J;  4PSW A;  3IWZ A;  4BL0 B;  1ZRE A;  1WJD A;  1TWF J;  5CKT A;  5D8L B;  1YJN I;  5GP9 A;  2IA1 A;  3HOZ J;  4JX5 A;  3BPX A;  3KP2 A;  3TDZ C;  4MQ9 F;  3HOY J;  3I55 I;  2OQR A;  1ZR4 A;  4V19 K;  4AWX B;  5E17 F;  1GV5 A;  1STZ A;  3DLL F;  1GXQ A;  5E3M A;  3HOS A;  3SZG A;  1FZP B;  3HG9 A;  3A0B C;  3GBG A;  4L5I A;  5H20 A;  1IXR C;  4F91 B;  3EUA A;  1MIJ A;  1IRF A;  1BI2 A;  4A3K J;  4WWC A;  4UV8 A;  5ERI A;  5HS7 A;  1T38 A;  5GAG J;  2N8G A;  2XGE A;  3F21 A;  2W25 A;  5M5W J;  3BQY A;  3VYT B;  2IS1 A;  1D0Y A;  1JUM A;  1Y1V J;  2DK8 A;  5K5O A;  4CGZ A;  5FLV A;  4LLG F;  3JRA A;  1A5J A;  2WV1 A;  3VFZ A;  2D1V A;  1ZGA A;  1J09 A;  1UHS A;  1WJF A;  2A6T A;  1D3Y A;  4HG2 A;  2H09 A;  2M8G X;  1T6S A;  2YX4 A;  5HS8 A;  3QYE A;  2QCO A;  3EPZ A;  1EF4 A;  3ZMS A;  1IG7 A;  4G94 A;  3HHG A;  3BR5 A;  2MFZ A;  3I3L A;  4XLP F;  1DU6 A;  1A31 A;  3ZXS A;  3RJP A;  2BEO A;  3GFJ A;  2GBY A;  3HIF A;  3S3M A;  4C3J J;  3S3O A;  2M4K A;  1ZRD A;  4AVP A;  4RAF A;  1JTX A;  1GXP A;  1PJR A;  3OYN A;  2A6H F;  4LIU A;  2WAD A;  2DT6 A;  2LLK A;  3VDX A;  2VPR A;  1BJA A;  5J3L A;  2FD5 A;  5FD6 A;  3OIO A;  4RLF A;  3VYU B;  2DA6 A;  2JA7 J;  5FKM A;  2M87 A;  2M0C A;  3OYB A;  1OJL A;  1FT9 A;  3BP8 A;  4RAY A;  3MFK A;  3ASO H;  1MDM A;  3V8J A;  3JR9 A;  1MDM B;  1Z05 A;  1VQM I;  2Y69 H;  4OU0 A;  2QZ8 A;  1KZH A;  3FXJ A;  1D5V A;  5IOY A;  4YFN F;  2NNN A;  3P9K A;  2XKP A;  5C3E J;  1DP3 A;  1BR2 A;  2VE9 A;  2KRH A;  3WTY C;  1LVA A;  1JUP A;  3L2R A;  3RI4 A;  2L54 A;  2GOX B;  5FLX K;  4MFD A;  4M3B A;  1AWC A;  2EIM H;  3V8K A;  4HRI A;  1R5G A;  2V4J C;  2M3A A;  4OWR B;  1TWG J;  4V2F A;  3CJR B;  3TO9 A;  4KJZ A;  2HU9 A;  2ADU A;  2R7W A;  1BOA A;  3HKZ N;  1IZ1 A;  4QPO A;  1W0U A;  3R0A A;  3FXL A;  2PMZ A;  4EM2 A;  2A07 F;  1FMV A;  2XGX A;  3KYD B;  2VI6 A;  2UZK A;  4AID A;  1FNN A;  1H9G A;  3PSF A;  2V6C A;  1R1V A;  4E7H A;  2P0W A;  3F6V A;  1WI3 A;  2L9R A;  1Z3X A;  4CCL A;  5BOX A;  3QPH A;  2BY0 A;  1ON2 A;  3MZY A;  1G3W A;  3DBL B;  3LA7 A;  3IKT A;  5FO5 A;  3Q5F A;  2JQ7 A;  1T0F C;  3J7A O;  1HW2 A;  4OMY A;  4YG2 F;  5EJC A;  2HQ5 A;  4JX4 A;  4XSX F;  1P7J A;  2LFB A;  3CCS I;  1ETO A;  1I1S A;  3QYB A;  2BW3 A;  1I3Q J;  2BW3 B;  2K9M A;  4L9J A;  3E3V A;  2R7U A;  3S15 J;  3FF5 A;  5EYR A;  3EYY A;  2DTZ A;  2LD5 A;  2PFB A;  3CCE I;  2D45 A;  1BI1 A;  2GLO A;  1TNT A;  4ETS A;  3H5N A;  2H27 A;  4A3B J;  3GTP J;  3TO7 A;  3OWT A;  2CH0 A;  4HW0 A;  4NNJ A;  3M1E A;  1X1D A;  1VQ6 I;  1F43 A;  5BNG A;  3HTS B;  1NK3 P;  2W24 A;  2NOG A;  2R7O A;  4KN4 X;  2KMU A;  5DM7 F;  5FB2 A;  4YIR X;  4I0B A;  2XGC A;  1HST A;  5D8K B;  5CJ9 A;  4BQO A;  2BVL A;  4ZZL A;  3I4M J;  3LSH A;  4U88 A;  1LNW A;  2CWE A;  3N97 A;  4KIC A;  3PJR A;  4RGR A;  5CVR A;  5FRN A;  1WH7 A;  2H1L A;  4YEJ A;  1BL0 A;  2AXL A;  2Z5U A;  1HKT A;  1XS9 A;  4Z2Y A;  2YU3 A;  4DBQ A;  2HYJ A;  1RES A;  2LNB A;  2KJC A;  4CDG A;  3QOE A;  5GTI C;  1Z7U A;  3P9I A;  1GVD A;  2LY1 A;  5IYC J;  1K6Y A;  2NVQ J;  2IJL A;  4A3L J;  1I50 J;  4U0W A;  4P9F A;  2XPW A;  4HNT A;  3S2D J;  4LOC A;  3RSN A;  4ESB A;  2NNY A;  3G71 I;  1PUF A;  1MND A;  3UKG A;  3BG5 A;  1PUF B;  5J40 A;  3OYC A;  1QZE A;  2WB1 A;  3TP3 A;  4EMS A;  2Z99 A;  2F2E A;  1OR7 A;  4K2E A;  4HLY A;  2OPT A;  3S1N J;  2JZY A;  3FXM A;  1MJB A;  4DZJ A;  2M34 A;  2L0K A;  1FX7 A;  4IVN A;  3WGH A;  2W7N A;  4DGW B;  2P6S A;  1FTZ A;  3PO2 J;  1Z6T A;  1GVJ A;  5HOD A;  1FEX A;  2EIN H;  3K1M A;  1H88 C;  3AG1 H;  1R5I D;  4CZC A;  2ICW G;  5DTD A;  1MNM C;  1WJE A;  3L2Q A;  1RR8 C;  4J00 A;  2VT3 A;  5F27 A;  2JA6 J;  2WBM A;  4TV7 A;  4WXD A;  2L7F P;  2P8T A;  2VXZ A;  3FMR A;  3OL3 A;  5H6R A;  2YUS A;  3HC7 A;  3G1M A;  1I6X A;  1R4N B;  1VQP I;  2H94 A;  2Z3Y A;  2VJ4 A;  1SFE A;  4MIM A;  4BE0 A;  4UB8 C;  1F4K A;  4FCY A;  2XV4 S;  4J19 A;  3KP5 A;  3IUO A;  2V26 A;  3ABU A;  1Z7L A;  1LE8 A;  2O3F A;  2MBF A;  3GCM A;  1LE8 B;  2Y9Y A;  2XAG A;  2QKL B;  1QPM A;  1CF7 A;  1CF7 B;  1R58 A;  2FQ3 A;  1TL8 A;  3HBL A;  1U0J A;  4GGG A;  1B72 A;  1QBJ A;  1O7F A;  4DNC A;  1B72 B;  5FLX Z;  3Q0W A;  2ECC A;  2CW7 A;  1RNL A;  2FOK A;  2EK5 A;  3K4M A;  2V1N A;  5L3B A;  5DS9 A;  2DT7 B;  2LF7 A;  3OSF A;  3RQI A;  2COM A;  3GXO A;  1OYW A;  2X6Y A;  4M71 A;  4WXC A;  2E5N A;  3HOU J;  2HNH A;  1P4A A;  2KL4 A;  2G7U A;  4XSZ F;  4F7Z A;  1RZ4 A;  1Y6I A;  2DI3 A;  2V9P A;  2XPU A;  3P7N A;  4B3A A;  5J8F A;  4A0Y A;  3OR1 C;  1Y56 A;  2E7X A;  4UUT A;  1S8N A;  4C2T A;  3GW2 A;  4B1R A;  3KE2 A;  2F4M B;  3B6A A;  1B8I A;  1B8I B;  5H2F C;  2CQN A;  2V7F A;  4KT5 C;  2RAE A;  2K9L A;  2ZJP F;  1ZQ3 P;  2HOA A;  2X85 A;  2LKP A;  3TGN A;  2HWV A;  1RKT A;  2M7A A;  1DDN A;  2CW8 A;  2QBY A;  1FMW A;  3J7Z I;  2R5Y A;  2QBY B;  2R5Y B;  2QQ9 A;  1MBE A;  1X1B A;  1S29 A;  1ZN2 A;  3CC4 I;  4C2U A;  2DFI A;  2HDC A;  1VQ5 I;  4EGY A;  1W7P A;  4LB6 B;  1W7P B;  1I3A A;  3QU6 A;  1PDN C;  1R22 A;  1OYI A;  4B8X A;  5GAE J;  2A05 A;  4A5M A;  1ON1 A;  1R1T A;  1BC7 C;  3QPT A;  4IHS A;  1IJW C;  4PCQ A;  5DD8 A;  1XMX A;  2A6E F;  1LPQ A;  1W7P D;  1ETX A;  1YX5 A;  1RIO H;  1UHM A;  5LHI A;  4ZYG A;  2VC1 A;  3SDG A;  1JGS A;  1HCR A;  4OIQ F;  2UWM A;  3GLL A;  3M7G A;  2PLY A;  2ZNY A;  5L3E A;  2DT5 A;  3RYP A;  4D5C A;  2ZXI A;  2XB0 X;  2ZFW A;  1VQ8 I;  2V1D A;  4ASN A;  2RC4 A;  3J7Y J;  2GIV A;  4EVI A;  1GDT A;  4DYR A;  4KNY A;  3HKZ A;  1MMN A;  2EQR A;  2PG4 A;  4IHV A;  1E3O C;  2BXY A;  3CP2 A;  3E6B A;  4FTH A;  1GUU A;  3SZT A;  4A3D J;  1HQC A;  4H4K C;  4Y15 A;  1GT0 C;  4FQG A;  4X0G A;  5CQE A;  5H6Q A;  3ZOB A;  4Q47 A;  2RQQ A;  3D5L A;  2QLZ A;  5KAI C;  2GIZ A;  1EKE A;  3BZK A;  1U5T C;  1JKQ C;  3R4K A;  1N25 A;  3IH2 A;  5C4J J;  2K86 A;  2KLO A;  2BGC A;  1SMT A;  3ONQ A;  5IP7 J;  4XLA A;  5LEJ A;  5LLQ A;  2DOA A;  3F0C A;  5E3O A;  2HR3 A;  1U5T A;  1N75 A;  2CGP A;  5E3L A;  3V42 A;  5L3C A;  1SVL A;  3B73 A;  3NAU A;  4M73 A;  2GQQ A;  2PMU A;  4FX0 A;  2O61 A;  2ZXW H;  2BV6 A;  4C2M J;  3K2Z A;  5EF6 A;  1FBQ A;  2J5O A;  2ID3 A;  2VXD A;  5FKK A;  3WE3 A;  3S1R J;  2H8W A;  1T56 A;  4L9T A;  5K1Y A;  1NTC A;  5EZG A;  1OMI A;  2VQC A;  4X1E A;  1Z9C A;  1IRG A;  2GXG A;  3ZMU A;  2DMT A;  4QSH A;  4HQE A;  4NC7 A;  1KU3 A;  4LLN A;  4ZYA A;  4PJJ A;  1L0O C;  4P1W A;  2KZG A;  3BTI A;  4AUX A;  5D5X B;  5TJJ A;  3KEO A;  1ZRC A;  5K5Q A;  5J4V A;  2IS2 A;  4FAS D;  5HVQ C;  2IGO A;  3QP6 A;  2PJP A;  2ZFU A;  3HZJ A;  3SEZ A;  1TW3 A;  4FE7 A;  1ENH A;  3KIO A;  4XN3 A;  3H3Z A;  5L3G A;  1KA8 A;  3ERE D;  3HHH A;  1YI2 I;  3TP0 A;  3LWF A;  3ZGK A;  2DA5 A;  1R5H A;  2M5W A;  2OCE A;  3K69 A;  4RGX A;  4P9U A;  3HDD A;  5KK1 A;  3TED A;  3L2C A;  1OYY A;  2XB5 A;  2XRN A;  4PFP A;  3S93 A;  2XPV A;  3EUH A;  1O57 A;  3QWL A;  3OOU A;  4HOB A;  3UR3 C;  4BBS J;  4DYQ A;  1XB4 A;  3PFI A;  2VON A;  4A3F J;  4IHT A;  1XCB A;  1YS7 A;  2FSW A;  2EZK A;  1TT5 B;  4JYK A;  2FF4 A;  4L0Y B;  5EEA A;  3JRG A;  2KKO A;  1XMK A;  3WG9 A;  2YPR A;  1MSE C;  1IUY A;  4AYB N;  1F1Z A;  4XNF A;  1J7K A;  1QRY A;  3CUO A;  2CG4 A;  3OYD A;  1HC8 A;  1RUO A;  2QF7 A;  3FXR A;  3BG3 A;  3GEZ A;  3LSI A;  3RYR A;  2GM4 A;  3F8M A;  1MJ9 A;  2XF6 A;  1K4T A;  1R23 A;  4IZZ A;  4D7N A;  1BI0 A;  3KEQ A;  4CCJ A;  4XLN F;  5L3D A;  3ZQL A;  3BOQ A;  2VIX A;  1I27 A;  3JTG A;  3S16 J;  2W57 A;  3AG4 H;  1ETW A;  3BG6 A;  5BS6 A;  3N4M A;  3M8J A;  4KMU X;  3FX3 A;  3K4J A;  4QPQ A;  1M1E B;  2LTP A;  2O8X A;  2HXO A;  2XC7 A;  3H0D A;  4GFB A;  2OTL I;  1V3F A;  3DPL C;  3DTE A;  4U0Y A;  1B59 A;  3D5R C;  1TC3 C;  1FYK A;  5LRS A;  4RGU A;  3HSF A;  3Q0V A;  5M5Y J;  4XL9 A;  4LGW A;  2IBD A;  4WCG A;  5LBQ A;  2QSH X;  1TZL A;  4XON A;  1XGO A;  4IRG A;  1UB9 A;  5ICF A;  3K0L A;  3ZMT A;  1IGN A;  2HDW A;  1BW6 A;  1YYV A;  2IA0 A;  5BMZ A;  2OQG A;  1ETQ A;  5ED4 A;  2D2W A;  1PUE E;  5E79 C;  2R3S A;  3U2R A;  4IKF A;  1Y8Q B;  2R7V A;  5DV5 A;  3AL0 C;  4HPQ A;  2E2H J;  4HF1 A;  3HPG A;  3TMO A;  1EJ9 A;  1W5C C;  5CVJ A;  2DO7 A;  1PYV A;  1Z21 A;  3K70 C;  4PJL A;  3TL4 X;  3J80 K;  1E3P A;  1A6I A;  3DXJ F;  4LK1 F;  4N9H A;  4MEX F;  2MA3 A;  3FKI J;  1A35 A;  3C2G A;  2Y2Z A;  3G3Z A;  4PFO A;  2FNP A;  5KHD A;  5E3N A;  4WX9 A;  1VQO I;  4ZDO A;  1A6Q A;  2VKE A;  4XOT A;  2X4H A;  3OYI A;  1P4X A;  5JR3 A;  3WU2 C;  1OKR A;  3K1P A;  2XRO A;  2PBI A;  1ZR2 A;  1A04 A;  1ORK A;  4HDU A;  3G73 A;  3WTV C;  1XMA A;  2TDX A;  1KU7 A;  3I53 A;  3DPT A;  4CYD A;  2B7E A;  2GXA A;  3ZQH A;  2AXT C;  2ZBK A;  3F72 A;  4MO7 A;  5B3S H;  2CUE A;  2MSY A;  4OIR F;  2DOD A;  5J47 A;  1HKS A;  2FA5 A;  4JQF A;  4YEL A;  2K5C A;  2ZO4 A;  2QWW A;  1YG2 A;  3F8B A;  2RV8 A;  4A3M J;  2K9N A;  3KZZ A;  4RBO A;  3KP3 A;  3KZY A;  5EZH A;  3OYA A;  4L9V A;  1Y39 A;  3VWB A;  4IOA F;  4MEY F;  2P5K A;  4DIQ A;  3L2U A;  3E6C C;  2UUZ A;  4GYG A;  2VJJ A;  5DD4 A;  1HSJ A;  4L0Z B;  2I5U A;  3D1N I;  2OJE D;  3MMY B;  3BR3 A;  3U1D A;  3KCC A;  1ERD A;  2E71 A;  4E7L A;  1O4X A;  1IXC A;  3OMY A;  2GWR A;  3ZN1 A;  5M3M J;  5J1U A;  1FWZ A;  4ITV A;  2DMP A;  1TLH B;  2LH9 A;  1W0T A;  4I01 A;  4RS8 A;  4CCK A;  5LGN A;  1SD7 A;  3IHU A;  3PL8 A;  3LFU A;  1E0E A;  4CA0 A;  4B3X A;  1BA5 A;  3WU1 B;  2ID6 A;  2W1O A;  4M9Z A;  2DTR A;  1U6G A;  4ENJ A;  4HDV A;  3IWF A;  3FMQ A;  5CPR B;  3F3X A;  4IRI A;  4AIK A;  1UAA A;  2BHZ A;  4Y4R A;  3MAJ A;  5IP6 A;  1JHH A;  3KYC B;  1XDS A;  2JVG A;  1YHQ I;  1ONV A;  3C1D A;  3ZQ7 A;  3T8T A;  3REO A;  3PNY A;  2KT0 A;  3W6V A;  5F08 A;  3GZ5 A;  1HDD C;  4CCO A;  2WA0 A;  4EJV A;  1X1C A;  2Y0M A;  1UHW A;  2CQK A;  3VEP A;  3I5U A;  2BBY A;  4RGS A;  5J6X A;  1ZYR F;  5D5V B;  4EJT A;  1UMQ A;  2CFX A;  3FKJ A;  4IHX A;  3FIW A;  3OS1 A;  2L7K A;  2R7F A;  2X1C A;  4I98 B;  3BTJ A;  4A0Z A;  3VSL A;  4B48 A;  4ENN A;  3P9C A;  2F5V A;  2HS5 A;  2I10 A;  2JUC A;  2XF7 A;  2HKO A;  4BXF A;  1QZY A;  2LK2 A;  4W97 A;  2XAH A;  1ZLJ A;  4CCN A;  5E1X A;  2F6C A;  1DGW Y;  4ZDL A;  5M3F J;  1UG2 A;  4BDY A;  1USS A;  2EZL A;  3CCQ I;  1J59 A;  2E1O A;  2ECB A;  2F5D A;  2ZXH A;  2HOS A;  4MGR A;  1X1A A;  3CLO A;  2ZME C;  2HYF A;  4II2 A;  4PDK A;  2IVM A;  4PJ0 C;  4C3H J;  3HOW J;  2ELJ A;  4QWQ A;  1XCV A;  3I54 A;  1TNS A;  1YX3 A;  5HOO A;  3CP8 A;  4UHT A;  2VE8 A;  4IRH A;  1VTN C;  5K5R A;  2DMQ A;  3CF2 A;  2GZW A;  4ZJZ A;  5AIQ A;  4EJW A;  1FP1 D;  2RNJ A;  3GTG J;  5E8I A;  2OZ6 A;  4EGZ A;  2IW5 A;  3H35 A;  2XDV A;  1WI9 A;  4A3I J;  1DPU A;  1U3E M;  1H9T A;  1DUX C;  1Z6R A;  2E1M C;  2G9W A;  1WWX A;  4M9S A;  3C18 A;  1T08 B;  5HDN A;  4N4O B;  4KIG A;  2X6O A;  1QO0 D;  4LFU A;  2MC4 A;  3I4N J;  2HDD A;  4HSR A;  3H3U A;  3ZPL A;  3FMS A;  3DBH B;  3MKY B;  3GTO J;  3WTT C;  3V8L A;  2OAZ A;  2XUB A;  3BC8 A;  4XLE A;  2BY3 A;  1BR1 A;  2W82 A;  4F55 A;  3ECO A;  3K1N A;  3ZMV A;  2QQA A;  5JI6 A;  2LVS A;  3J80 Z;  4A0X A;  1S3J A;  2DQL A;  2HTS A;  2NS0 A;  3T0Y A;  2VLA A;  1UFM A;  2EIL H;  4AYB A;  2LY9 A;  4RB1 A;  3KFW X;  1XC5 A;  3ZP5 A;  3I58 A;  5DCM A;  2DQR A;  3E6M A;  3JRH A;  3S2H J;  5DCM B;  3GUD A;  1QQI A;  3FWE A;  2JT1 A;  4EM1 A;  2H6C A;  3IH3 A;  4BQN A;  1T0F A;  3K2A A;  2ZSH B;  3H1C A;  4M6V A;  1KGS A;  5E18 F;  5IY5 H;  3T8R A;  2WTE A;  3M9A A;  3TKY A;  2R4G A;  2VBX A;  4F52 A;  4A12 A;  4BH9 A;  1MW7 A;  2FOW A;  5TRD A;  1S72 I;  4RM2 A;  3ASN H;  5F6F A;  4DW6 A;  5IP9 J;  1UJ8 A;  2LOO A;  5L3F A;  3H92 A;  3CCU I;  4HST A;  2FMY A;  3ABT A;  2ISY A;  2DFE A;  4PK4 A;  4DJA A;  1Z1D A;  1I1G A;  5GAD J;  2CQX A;  2HGC A;  3HGY A;  3I4P A;  2DA1 A;  3M8F A;  2F5E A;  1VI0 A;  5IT9 K;  2CJJ A;  4ESF A;  4XRF A;  2JPB A;  4R8H A;  1T8I A;  2E5Z A;  2DDB A;  2H6B A;  3D0S A;  2KIQ A;  3FHZ A;  4IOC F;  5E1W A;  2NRA C;  3E1S A;  1QNT A;  1RKW A;  1XGS A;  1MBH A;  3ZCO A;  3LSJ A;  1CQT A;  3I56 I;  5ICC A;  3W6J B;  3BTC A;  2HPM A;  3WOD F;  1JI8 A;  2V9V A;  3G6E I;  1XPX A;  4BUP A;  4II3 A;  2WAQ A;  1W4M A;  2QEN A;  2HQR A;  2JRM A;  3FZV A;  4HAM A;  1LDJ A;  4JP0 A;  4LMY A;  3MKZ A;  3BT9 A;  4YFK F;  1SFO J;  2DPU A;  3FM5 A;  3LL7 A;  3IKV A;  2NS7 A;  4E7I A;  1ACI A;  3F8C A;  1UZC A;  2LG4 A;  2G7H A;  3S17 J;  1SVO A;  4M3F A;  2HVR A;  4IX7 A;  3MN2 A;  1ZH5 A;  3BLY A;  3BJ6 A;  3CUQ C;  1HW1 A;  1X3U A;  4W1U A;  2CV1 A;  2XSJ C;  4BE1 A;  1X3W B;  3DU6 A;  4KN7 X;  4BHP A;  2HVQ A;  2LSO A;  3CES A;  1W5T A;  2EB7 A;  4RAG A;  3I9V 2;  3FDY A;  1BOB A;  2E60 A;  3RTR A;  2FBH A;  2OUM A;  3ZMD A;  4BJ5 C;  2YR2 A;  3S2W A;  5DCF A;  1IRX A;  2W48 A;  4YII A;  4PUS A;  3RDI A;  3P5J A;  1V5F A;  4LIT A;  3I64 A;  2MGQ A;  4XN0 A;  3H9G A;  1S7O A;  2WV0 A;  1EH6 A;  4DQ2 A;  3RKQ A;  1ZAO A;  4RAZ A;  3M1C A;  1MKM A;  1AU7 A;  1GV2 A;  3G1L A;  3ULQ B;  4LIV A;  3QAH A;  3LSM A;  2IPQ X;  2IP2 A;  3PSI A;  2O8K A;  2EFN A;  4CYC A;  3WTS C;  2PEX A;  3BQZ A;  3OSG A;  4CYC B;  3BR6 A;  2M30 A;  2FU4 A;  5CVU A; 
#chains in the Genus database with same CATH homology
 2XAS A;  1SD6 A;  2VOO A;  1G3S A;  1G6N A;  2FEZ A;  4JBA A;  4MQV A;  2FXA A;  2P6T A;  4AIH A;  2ACJ A;  3R6S A;  5KVR A;  3CO6 C;  4LB5 A;  3TOB A;  4OIO F;  2GXB A;  1KU9 A;  5JVT A;  3RPQ A;  4LG0 A;  4LG0 B;  1Q1H A;  1KYW A;  4BXU A;  3GX4 X;  4KUM A;  3BJA A;  3QRF F;  2OBP A;  5BPD A;  2HZT A;  4G8X A;  3LA2 A;  3Q9V A;  2KRF A;  5F1R A;  1FBS A;  5HLG A;  1R36 A;  2J5P A;  1O3T A;  1BBY A;  4YFX F;  3F22 A;  3PQK A;  5DDG A;  2EFO A;  3HUG A;  4Y17 A;  4BQA A;  4KFC A;  1IN8 A;  3DKW A;  3E97 A;  1KYZ A;  4G7H F;  5EEG A;  1LEB A;  1W5S A;  4B09 A;  4O5V A;  3HRM A;  1TW2 A;  4M6X A;  4ENK A;  4KIF A;  3KET A;  1L3L A;  2MC3 A;  2EFP A;  5IT3 A;  1J2X A;  3ML6 A;  5IT9 Z;  2STT A;  4RB0 A;  4GCV A;  2Y75 A;  3RPU A;  3O6B B;  2FE3 A;  1IN4 A;  3COA C;  2HQN A;  4S04 A;  1UST A;  2QM3 A;  3BWG A;  3LQR A;  3LAJ A;  1XDU A;  1RUN A;  1IXS B;  1LJ9 A;  1TBX A;  1U5T B;  5FD5 A;  2JSC A;  1PP7 U;  2O6G E;  4UNO A;  3RKW A;  1S7A A;  3E6D A;  4BYY A;  2C6Y A;  1JXS A;  1FLI A;  2FML A;  1BIB A;  4ESJ A;  2XAQ A;  1J75 A;  1TQM A;  3BRO A;  1F5T A;  5HLH A;  2B0L A;  4UVB A;  4HV5 A;  4I2O A;  2DW4 A;  1Z91 A;  1Y0U A;  2QQB A;  1K78 A;  1K78 B;  1YIO A;  1MZB A;  2XHK A;  1FPQ A;  3QU3 A;  3B02 A;  1ZG1 A;  4I09 A;  5CLS A;  2W85 A;  3CJN A;  4HYE A;  3KP6 A;  3ELK A;  1K6O A;  1U78 A;  2M45 A;  1KQ8 A;  3HSE A;  4IPA A;  4L18 B;  4G6D A;  2MH2 A;  3SXY A;  3MZH A;  1UCR A;  1BN5 A;  4P96 A;  4EQQ A;  3PQJ A;  4OIN F;  4YIF A;  3GFL A;  1YW8 A;  3WTX C;  4UVC A;  3R0J A;  1JE8 A;  4WK8 F;  1IN6 A;  2FBK A;  3M8E A;  3K9T A;  5CVV A;  1CGP A;  4I0A A;  1FSH A;  1K79 A;  3DF8 A;  1D8J A;  4HLX A;  2Z9O A;  4S05 A;  4KMF A;  3HRS A;  1YW7 A;  3DQV C;  1ZG3 A;  4LJZ F;  3DEU A;  4M9X A;  4LLL A;  1SAX A;  1IN5 A;  2ETH A;  2ZKZ A;  3BDD A;  1TTY A;  3OV8 A;  3LFK A;  3BJO A;  4EM0 B;  1ZG5 A;  2RGV A;  1O7L A;  1YQA A;  1FSE A;  2A69 F;  1EH8 A;  1LDK B;  1G3T A;  4A5N A;  3R60 A;  5A2Q K;  4Q4Z F;  4RB3 C;  4UV9 A;  2HEO A;  4NB5 A;  1EV7 A;  5HDK A;  2FNA A;  2Q8K A;  2LDU A;  3E5U A;  2EJR A;  2EFW A;  4GYI A;  4M72 A;  1SFU A;  1DPR A;  2BE5 F;  1B6A A;  4IJA A;  1TQI A;  3GF2 A;  4CXF A;  2K7L A;  1YW9 A;  2PI0 A;  3ISP A;  4BHC A;  4EJO A;  5DEQ A;  3VOD A;  3ZMZ A;  2GAU A;  2WWY A;  4HX4 A;  3LA3 A;  2RVC A;  3VB2 A;  1XSV A;  3TOA A;  4WXH A;  5D4S A;  2CO5 A;  1ZRF A;  1J9I A;  4ENM A;  4G7O F;  3F8N A;  3HYI A;  3V7C A;  2IRF G;  3V7R A;  1FYL A;  2ZNZ A;  1H0M A;  4IXA A;  1P92 A;  1ZAR A;  4P5O A;  2EFQ A;  5E1Z B;  4ZH4 F;  5HS9 A;  5AIP A;  3HRU A;  3GFI A;  2ESH A;  1YFH A;  3J81 K;  3KLN A;  5F64 A;  3WTZ A;  2IA2 A;  1XN7 A;  1BM9 A;  4ZYE A;  5LGT A;  4KYW A;  4CIC A;  2PMH A;  4HX8 A;  1YTY A;  2ZME A;  1TQP A;  2ZME B;  3QP5 A;  3LQQ A;  4PZJ A;  2RQP A;  2P5L C;  4HX7 A;  4AD9 A;  2E7W A;  3ZN0 A;  3WGI A;  2O0Y A;  3FM3 A;  3BPV A;  2K27 A;  3HTU A;  2XVC A;  1I5Z A;  4OIP F;  3C3W A;  3NQO A;  2VBY A;  1P2F A;  3GLX A;  5ICE A;  1R7J A;  2ELH A;  1FY7 A;  2E1C A;  3HSR A;  1WSU A;  3KP7 A;  3Q9S A;  3DFG A;  4R79 A;  3ROU A;  5LHH A;  1IN7 A;  2F5C A;  4BAY A;  4BNC A;  1SD4 A;  4MTD A;  3GVA A;  4FHT A;  4N0B A;  4KDP A;  5D6F A;  5A2Q Z;  1U2W A;  3OOP A;  4N9I A;  3F23 A;  2QYO A;  2RN7 A;  2EV5 A;  2W84 A;  5E20 A;  3VOE A;  3F8F A;  2XKO A;  2ZCW A;  3SHF A;  1J0R A;  1XGM A;  3IC7 A;  2A68 F;  4LD5 A;  3BY6 A;  5LRR A;  5D5W B;  2DAO A;  3DP7 A;  3IL2 A;  2EV6 A;  4RB2 C;  1QZZ A;  3JW4 A;  2V1U A;  4HA8 A;  4HQM A;  3V4G A;  4HV6 A;  1SD5 A;  2VOP A;  2OZU A;  4Y13 A;  1NHA A;  3LST A;  5DYM A;  4L5J A;  5CVI A;  4ZYD A;  3AAF A;  2CYY A;  5D4R A;  2STW A;  1BIA A;  2KIU A;  4G7Z F;  3SQN A;  1YS6 A;  1G4D A;  2ESN A;  5LEK A;  4EV0 A;  1MD0 A;  3JTH A;  3CUQ A;  1FYM A;  3CUQ B;  4E70 A;  4U7D A;  1HW5 A;  2YX7 A;  1OPC A;  4Q48 A;  3W6K B;  3BZ6 A;  2M8E A;  1WQ2 A;  4H0E A;  2Q2E A;  2XAJ A;  1SMY F;  4A2U A;  2GA1 A;  2X0L A;  5FGM A;  1IF1 A;  3L9F A;  3EET A;  5DUK A;  4KA4 A;  1MJA A;  3J81 Z;  3FXU A;  3KLO A;  1MGT A;  4D0P A;  3GO5 A;  3DV8 A;  3MCZ A;  1JHF A;  1O3R A;  1T39 A;  3I71 A;  4PGG A;  4PGH A;  4UVA A;  4ZZD A;  4HBL A;  2P5V A;  4U7B A;  1P6R A;  1FBU A;  2DK5 A;  3RIR A;  4UXN A;  3GWZ A;  3EDP A;  3SFZ A;  5E8G A;  1LDD A;  4EJU A;  1IAW A;  3GFM A;  3GYH X;  2MLK A;  1FC3 A;  2XIG A;  2HOE A;  3HRT A;  2ZJ2 A;  5HLI A;  1ZGJ A;  4M74 A;  1ZLK A;  1DP7 P;  2LF8 A;  4I02 A;  2KJB A;  4ON0 A;  1ULY A;  5J8C A;  1D8K A;  3JSP A;  1ODD A;  2V79 A;  3L00 A;  1YO5 C;  4MNU A;  4UUV A;  1E2X A;  1LEA A;  4ZYH A;  2NAZ A;  4I7H A;  1XSX A;  2E1N A;  2UXX A;  1FP2 A;  3LAP A;  2K4B A;  2OU2 A;  1G3Y A;  4M6Y A;  2FBI A;  3CO7 C;  3SZP A;  2A3S A;  4LK0 F;  1B9M A;  1T2K A;  3CTA A;  4QLC U;  2MD5 A;  3T5X A;  5FFZ A;  1QGP A;  4XBF A;  2F5F A;  2R7D A;  3I0T A;  5ILS A;  3FXQ A;  2HFH A;  4GXO A;  4A6E A;  4G9Y A;  3RKX A;  3TQN A;  2P4W A;  2HYG D;  3WTU C;  2YSR A;  2VBW A;  3ECH A;  4AIJ A;  3WTW C;  1XSD A;  1RI7 A;  4HZF A;  1ZHF A;  2FRH A;  2L4M A;  2DLL A;  5BQT A;  3JAM K;  2A61 A;  1XGN A;  1BI3 A;  4A6D A;  3HOT A;  2KIF A;  3O2P E;  2KIM A;  3WGG A;  4HF0 A;  2Q0O A;  2IT0 A;  2DU9 A;  1BC8 C;  2L4A A;  5DUI A;  1R00 A;  5EEH A;  5HDG A;  1XD7 A;  2HTJ A;  3TO6 A;  2MLG A;  2K02 A;  4KIB A;  3IRQ A;  1E17 A;  4Q5S F;  1HBX G;  2DPD A;  2M1B A;  5FFX A;  1YLF A;  2PQ8 A;  5AON A;  3QOP A;  5ICG A;  1T98 A;  2EV0 A;  2HKX A;  2VBZ A;  2AS5 F;  4CHU A;  2QUF A;  3L09 A;  2OD5 A;  1LQ1 A;  1HXD A;  1KQ9 A;  1B1B A;  2WC2 A;  1K7A A;  3TDU C;  4P55 A;  2JTV A;  2GA2 A;  1PP8 F;  3WE2 A;  4GO1 A;  3T1B A;  2O03 A;  4OMZ A;  1REP C;  4FX4 A;  2OA4 A;  1EH7 A;  2QVO A;  2VT2 A;  4O6J A;  1O3S A;  3EQL F;  4MTE A;  4G6Q A;  2UXN A;  3IRR A;  1B4A A;  1O3Q A;  2VC0 A;  3NEU A;  2RKH A;  4NQW A;  5BPI A;  1F9N A;  4L9N A;  2EWN A;  3GZ6 A;  1U8R A;  1HKQ A;  4MHG A;  2Y48 A;  1SFX A;  4CZZ A;  1FOK A;  4NHJ A;  5LHG A;  1GHC A;  1C0W A;  2PN6 A;  1KU2 A;  1J5Y A;  3MWM A;  3RKY A;  2Z33 A;  2ZXJ A;  5D5U B;  2JPC A;  2L02 A;  2NYX A;  3I59 A;  5D6E A;  5LGU A;  3I59 B;  6PAX A;  4O3M A;  3CDH A;  3E5X A;  2L3D A;  2BYV E;  1P4W A;  2L01 A;  1S6L A;  2VN2 A;  4HF2 A;  4BHB A;  3KP4 A;  3NRV A;  2K4J A;  3F6O A;  4R1H A;  3WU0 A;  1R1U A;  5CYV A;  2RDP A;  4FT8 A;  5JFR A;  2VOD A;  2V1X A;  1IW7 F;  2ISZ A;  3EYI A;  2MH9 A;  2XAF A;  3U9G A;  3JSO A;  2A5Y B;  3O3K A;  4JK1 X;  2JRT A;  3MEX A;  2EA4 A;  4OOI A;  2CSO A;  1B9N A;  2D1H A;  3E5Q A;  3C7J A;  3L7W A;  2DBB A;  1KQ0 A;  5ILU A;  3JAM Z;  2EA2 A;  1LB2 A;  5ILV A;  4WF2 A;  4U0V A;  1V4R A;  1AOY A;  2CW0 F;  2P7V B;  1WRJ A;  5JHU A;  4CO8 A;  3V7S A;  4IF4 A;  3MQ0 A;  3R61 A;  1WKM A;  3IWZ A;  1ZRE A;  5D8L B;  2IA1 A;  3BPX A;  3KP2 A;  3TDZ C;  4MQ9 F;  2OQR A;  4AWX B;  5E17 F;  1STZ A;  1GXQ A;  3HOS A;  1FZP B;  4L5I A;  5H20 A;  1IXR C;  1IRF A;  1BI2 A;  4WWC A;  4UV8 A;  5ERI A;  5HS7 A;  1T38 A;  3F21 A;  2W25 A;  2DK8 A;  5K5O A;  4CGZ A;  4LLG F;  3VFZ A;  2D1V A;  1ZGA A;  1D3Y A;  2H09 A;  1T6S A;  2YX4 A;  5HS8 A;  3ZMS A;  4G94 A;  3HHG A;  4XLP F;  3RJP A;  2BEO A;  3GFJ A;  3HIF A;  1ZRD A;  4AVP A;  1GXP A;  2A6H F;  1BJA A;  5FD6 A;  2M87 A;  1FT9 A;  3BP8 A;  4RAY A;  3MFK A;  1MDM A;  3V8J A;  1MDM B;  1Z05 A;  4OU0 A;  2QZ8 A;  1D5V A;  4YFN F;  2NNN A;  3P9K A;  2XKP A;  2VE9 A;  3WTY C;  1LVA A;  3RI4 A;  2L54 A;  5FLX K;  1AWC A;  3V8K A;  1R5G A;  3TO9 A;  2ADU A;  1BOA A;  1IZ1 A;  3R0A A;  4EM2 A;  2A07 F;  2XGX A;  2UZK A;  1FNN A;  1H9G A;  2V6C A;  1R1V A;  3F6V A;  5BOX A;  3QPH A;  1ON2 A;  3MZY A;  1G3W A;  3LA7 A;  3Q5F A;  3IKT A;  5FO5 A;  3J7A O;  1HW2 A;  4OMY A;  4YG2 F;  4XSX F;  1I1S A;  4L9J A;  3E3V A;  3FF5 A;  3EYY A;  2PFB A;  2D45 A;  1BI1 A;  1TNT A;  4ETS A;  2H27 A;  3TO7 A;  4HW0 A;  3M1E A;  3HTS B;  2W24 A;  4KN4 X;  5FB2 A;  4I0B A;  1HST A;  5D8K B;  5CJ9 A;  4ZZL A;  4U88 A;  1LNW A;  2CWE A;  3N97 A;  4KIC A;  4RGR A;  5CVR A;  2AXL A;  2Z5U A;  1HKT A;  4Z2Y A;  2YU3 A;  2LNB A;  2KJC A;  4CDG A;  1Z7U A;  3P9I A;  2IJL A;  4U0W A;  4P9F A;  4ESB A;  2NNY A;  4EMS A;  2Z99 A;  2F2E A;  1OR7 A;  4K2E A;  4HLY A;  2JZY A;  1MJB A;  1FX7 A;  4IVN A;  3WGH A;  2P6S A;  1Z6T A;  1GVJ A;  3K1M A;  2VT3 A;  4TV7 A;  4WXD A;  2P8T A;  2VXZ A;  3FMR A;  5H6R A;  1I6X A;  2H94 A;  2Z3Y A;  1SFE A;  1F4K A;  2XV4 S;  3KP5 A;  3ABU A;  2O3F A;  2MBF A;  2XAG A;  1CF7 A;  1QPM A;  1CF7 B;  1R58 A;  2FQ3 A;  4GGG A;  1QBJ A;  1O7F A;  4DNC A;  5FLX Z;  5L3B A;  1RNL A;  2FOK A;  2EK5 A;  2P7C B;  2LF7 A;  2COM A;  3GXO A;  1OYW A;  4M71 A;  4WXC A;  1P4A A;  2G7U A;  4XSZ F;  4F7Z A;  1RZ4 A;  2DI3 A;  3P7N A;  5J8F A;  4A0Y A;  2E7X A;  1S8N A;  3GW2 A;  3KE2 A;  4KT5 C;  2LKP A;  3TGN A;  2HWV A;  1DDN A;  2QBY A;  2QBY B;  2QQ9 A;  1S29 A;  1ZN2 A;  2DFI A;  2HDC A;  4EGY A;  1W7P A;  4LB6 B;  1W7P B;  3QU6 A;  1PDN C;  1R22 A;  1OYI A;  4B8X A;  4A5M A;  1ON1 A;  1R1T A;  1BC7 C;  3QPT A;  4IHS A;  4PCQ A;  5DD8 A;  2A6E F;  1W7P D;  1RIO H;  1UHM A;  5LHI A;  4ZYG A;  2VC1 A;  1JGS A;  4OIQ F;  2UWM A;  3M7G A;  2PLY A;  2ZNY A;  5L3E A;  2DT5 A;  3RYP A;  2ZFW A;  2V1D A;  4ASN A;  2RC4 A;  2GIV A;  4EVI A;  4KNY A;  2PG4 A;  3E6B A;  3SZT A;  1HQC A;  4Y15 A;  5H6Q A;  4Q47 A;  2QLZ A;  3D5L A;  1U5T C;  3R4K A;  2K86 A;  2BGC A;  1SMT A;  5LEJ A;  5LLQ A;  2HR3 A;  1U5T A;  2CGP A;  5L3C A;  3B73 A;  4M73 A;  2GQQ A;  2PMU A;  4FX0 A;  2O61 A;  2BV6 A;  3K2Z A;  1FBQ A;  2J5O A;  3WE3 A;  5K1Y A;  4L9T A;  1OMI A;  1Z9C A;  1IRG A;  2GXG A;  3ZMU A;  4HQE A;  1KU3 A;  4LLN A;  1L0O C;  5D5X B;  5TJJ A;  3KEO A;  1ZRC A;  5K5Q A;  5HVQ C;  3QP6 A;  2PJP A;  1TW3 A;  3H3Z A;  5L3G A;  1KA8 A;  3ERE D;  3HHH A;  3LWF A;  1R5H A;  2M5W A;  3K69 A;  4RGX A;  4P9U A;  5KK1 A;  3L2C A;  1OYY A;  2XRN A;  3EUH A;  1O57 A;  4HOB A;  1XB4 A;  3PFI A;  2VON A;  4IHT A;  1XCB A;  1YS7 A;  2FSW A;  2FF4 A;  4L0Y B;  2KKO A;  1XMK A;  3WG9 A;  2YPR A;  1IUY A;  1F1Z A;  1J7K A;  3CUO A;  2CG4 A;  1RUO A;  3FXR A;  3GEZ A;  3RYR A;  3F8M A;  1MJ9 A;  1R23 A;  1BI0 A;  3KEQ A;  4XLN F;  5L3D A;  3BOQ A;  1I27 A;  3JTG A;  2W57 A;  5BS6 A;  3N4M A;  4KMU X;  3FX3 A;  2O8X A;  1V3F A;  3DPL C;  4U0Y A;  1B59 A;  1FYK A;  5LRS A;  4RGU A;  3HSF A;  4WCG A;  4LGW A;  5LBQ A;  1XGO A;  4IRG A;  1UB9 A;  5ICF A;  3K0L A;  3ZMT A;  1YYV A;  2IA0 A;  5BMZ A;  2OQG A;  5ED4 A;  2D2W A;  1PUE E;  2R3S A;  3U2R A;  5DV5 A;  4HF1 A;  5CVJ A;  2DO7 A;  3J80 K;  3DXJ F;  4LK1 F;  4N9H A;  4MEX F;  2MA3 A;  3G3Z A;  2FNP A;  4WX9 A;  2X4H A;  1P4X A;  5JR3 A;  1OKR A;  3K1P A;  2XRO A;  2PBI A;  1A04 A;  4HDU A;  3G73 A;  3WTV C;  1XMA A;  2TDX A;  1KU7 A;  3I53 A;  3DPT A;  4CYD A;  2ZBK A;  3F72 A;  4OIR F;  1HKS A;  2FA5 A;  4JQF A;  2ZO4 A;  2QWW A;  1YG2 A;  3F8B A;  2RV8 A;  3KZZ A;  3KP3 A;  3KZY A;  4L9V A;  4MEY F;  2P5K A;  3E6C C;  4GYG A;  5DD4 A;  1HSJ A;  4L0Z B;  3U1D A;  3KCC A;  1IXC A;  2GWR A;  3ZN1 A;  1FWZ A;  1TLH B;  4I01 A;  4RS8 A;  5LGN A;  1SD7 A;  3IHU A;  3WU1 B;  4M9Z A;  2DTR A;  1U6G A;  4ENJ A;  4HDV A;  3IWF A;  3FMQ A;  3F3X A;  4IRI A;  4AIK A;  3MAJ A;  1JHH A;  1XDS A;  1ONV A;  3C1D A;  3ZQ7 A;  3T8T A;  3REO A;  3GZ5 A;  4EJV A;  2Y0M A;  1UHW A;  2CQK A;  3VEP A;  3I5U A;  2BBY A;  4RGS A;  5J6X A;  1ZYR F;  5D5V B;  4EJT A;  2CFX A;  2R7F A;  4I98 B;  4A0Z A;  4ENN A;  3P9C A;  2HS5 A;  2HKO A;  1QZY A;  2XAH A;  1ZLJ A;  5E1X A;  1USS A;  1J59 A;  2F5D A;  4MGR A;  3CLO A;  2HYF A;  4PDK A;  2IVM A;  4QWQ A;  1XCV A;  3I54 A;  1TNS A;  5HOO A;  4UHT A;  2VE8 A;  4IRH A;  1VTN C;  5K5R A;  2GZW A;  5AIQ A;  4EJW A;  1FP1 D;  2RNJ A;  5E8I A;  2OZ6 A;  4EGZ A;  2IW5 A;  1WI9 A;  1DPU A;  1U3E M;  1H9T A;  1DUX C;  1Z6R A;  2G9W A;  1WWX A;  4M9S A;  3C18 A;  5HDN A;  4KIG A;  1QO0 D;  4LFU A;  3H3U A;  3ZPL A;  3FMS A;  3WTT C;  3V8L A;  2OAZ A;  2XUB A;  3ECO A;  3K1N A;  3ZMV A;  2QQA A;  5JI6 A;  3J80 Z;  4A0X A;  1S3J A;  2DQL A;  2HTS A;  2NS0 A;  3T0Y A;  1UFM A;  4RB1 A;  3KFW X;  3ZP5 A;  3I58 A;  5DCM A;  2DQR A;  3E6M A;  5DCM B;  3GUD A;  1QQI A;  3FWE A;  2JT1 A;  4EM1 A;  2H6C A;  1T0F A;  1KGS A;  5E18 F;  3T8R A;  3TKY A;  2WTE A;  3M9A A;  2VBX A;  4A12 A;  4BH9 A;  5TRD A;  5F6F A;  5L3F A;  3H92 A;  2FMY A;  3ABT A;  2ISY A;  1Z1D A;  1I1G A;  2HGC A;  3I4P A;  3M8F A;  2F5E A;  5IT9 K;  4ESF A;  4XRF A;  2JPB A;  4R8H A;  2H6B A;  3D0S A;  3FHZ A;  5E1W A;  2NRA C;  1QNT A;  1XGS A;  5ICC A;  3W6J B;  3WOD F;  2V9V A;  1W4M A;  2QEN A;  2HQR A;  4HAM A;  3FZV A;  1LDJ A;  4LMY A;  4YFK F;  2DPU A;  3FM5 A;  3IKV A;  3F8C A;  2G7H A;  1ZH5 A;  3BJ6 A;  3CUQ C;  1HW1 A;  1X3U A;  4KN7 X;  4BHP A;  2LSO A;  1W5T A;  2EB7 A;  3RTR A;  2FBH A;  3ZMD A;  2YR2 A;  3S2W A;  5DCF A;  4YII A;  3RDI A;  3I64 A;  1S7O A;  2WV0 A;  1EH6 A;  4DQ2 A;  1ZAO A;  4RAZ A;  1MKM A;  3ULQ B;  3QAH A;  2IPQ X;  2IP2 A;  2EFN A;  3WTS C;  2PEX A;  2M30 A;  2FU4 A;  5CVU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...