1BBYA

Dna-binding domain from human rap30, nmr, minimized average
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords RAP30
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bbyA00
2XASA 3HTSB 2M87A 2QENA 1B4AA 2QLZA 3BPXA 3SZTA 5LGNA 1FBQA 2BV6A 2NS0A 4LLNA 4LLLA 2AS5F 1G4DA 3V4GA 5D8KB 1YW9A 1ZGAA 1R22A 2CO5A 1DPRA 1MJ9A 3BDDA 1PDNC 3WE3A 2EFOA 1BC7C 1SD4A 4IJAA 3QP6A 1TTYA 3GW2A 1H0MA 2G7UA 3SZPA 1RZ4A 3RJPA 1ULYA 3C18A 2UXNA 1T38A 5CYVA 3VEPA 2KJBA 2Q0OA 3MZYA 3O6BB 3BJ6A 4ZYDA 3TGNA 3K2ZA 2LF7A 1Q1HA 1K79A 2BYVE 2K02A 4G94A 2EFNA 1U8RA 3HHGA 1AWCA 2Q8KA 1QZZA 4IHTA 5LEKA 4ESFA 1RUOA 1BIAA 2YX4A 2QVOA 2CWEA 1KU3A 2JZYA 1GXQA 1FWZA 2VODA 3FM3A 4I98B 5DEQA 3EETA 1FOKA 1I27A 1P2FA 1R7JA 2D1HA 4P55A 3I58A 5E17F 4ENKA 1FZPB 2JPCA 2JSCA 5AIQA 2VE8A 4ENNA 2FA5A 4BYYA 3VODA 2FRHA 1G3YA 1B6AA 1I1GA 4A2UA 3KETA 3DPLC 3L2CA 2HYFA 4B09A 1G3TA 4EJUA 1YS6A 3F6VA 4XLNF 3RIRA 3HRTA 3HSFA 4YIIA 5A2QZ 3HYIA 1NHAA 1T39A 3SHFA 4O5VA 4OMZA 1UHMA 2ADUA 4KIBA 1K78B 1U5TA 4LB5A 2ISZA 4HW0A 2HDCA 3GFLA 1W4MA 2HTJA 1XDUA 4U7BA 1SFUA 2X0LA 3KP3A 1O3TA 1BI2A 3HSEA 1MDMB 1DPUA 4WXCA 1OR7A 5L3DA 2XRNA 1ONVA 3RDIA 1KYWA 4KN7X 1D8JA 3V8LA 5HS7A 1FBSA 2IP2A 4HOBA 4OOIA 4L5IA 3GZ6A 4ZZDA 1VTNC 2M5WA 4WCGA 4N9IA 1B1BA 1GHCA 3ABTA 1B9NA 1IN8A 4OIPF 2ZXJA 2Y75A 3D5LA 1T2KA 2PJPA 4LG0B 4G7OF 3U2RA 3KFWX 2LKPA 1IXRC 4QWQA 4U88A 3OOPA 1OYYA 1U78A 2IT0A 4O6JA 1IRFA 1SFXA 4MTEA 3CO7C 2EWNA 2XUBA 3GVAA 5DCMB 1TBXA 1TLHB 2WWYA 3K1PA 3R60A 1DUXC 2BEOA 5D4RA 3KLOA 2DI3A 1R5GA 2D45A 3BOQA 3ERED 1QBJA 1H9TA 4PGGA 1FYLA 1LDKB 4G6QA 4EQQA 1J9IA 1KU7A 4GXOA 2EK5A 3MZHA 4RAYA 1MJAA 4MEYF 1F9NA 1XMKA 4A5NA 4Y15A 2LNBA 1K6OA 5CVJA 4FX4A 3FMRA 1IF1A 1IW7F 3ZP5A 4KN4X 3QU3A 3HRSA 2O0YA 4HBLA 2WTEA 4XSZF 2FBKA 4KDPA 1ZAOA 3TKYA 1YTYA 1HSTA 4P9FA 2F5DA 4CXFA 4R79A 2GIVA 1IN6A 5IT9Z 1FT9A 3N97A 3DXJF 3GFJA 3JTGA 1HSJA 1YS7A 2GWRA 4LG0A 3BY6A 3K69A 1P4WA 5D5XB 2STTA 3J80Z 5ICFA 4HV5A 1Z91A 3J7AO 1P92A 1X3UA 1IAWA 4Z2YA 1I5ZA 5D5VB 4IRIA 2KIFA 4UVBA 1B9MA 1OMIA 1Z9CA 2EA4A 5EEHA 1MGTA 4MHGA 3JSPA 1FYKA 5K5OA 4JBAA 1ZLKA 1R23A 3B73A 5FFZA 3CUQA 4RGRA 3FXUA 4QLCU 2Y48A 1RNLA 5BOXA 1XB4A 3E6DA 2CFXA 1YW7A 1W5SA 1K7AA 2DQRA 1FP1D 2PFBA 2O8XA 1XGMA 1W7PD 4BAYA 2COMA 3AAFA 1LJ9A 1WQ2A 2DAOA 2B0LA 3Q9SA 2V6CA 2P7CB 3E3VA 4I0BA 3H3ZA 5H6QA 2OZ6A 2DFIA 3H92A 4LGWA 5K5QA 2W25A 2HZTA 4F7ZA 1USSA 1J7KA 4AWXB 3LQRA 4MQVA 3I5UA 4PZJA 2VONA 5LHIA 5ED4A 4U7DA 4ZYHA 4E70A 2ZJ2A 5EEGA 2GZWA 1W7PA 3DP7A 2E7WA 2P5KA 2NNNA 4HYEA 3DKWA 2BGCA 4EV0A 4YIFA 2PMUA 3HTUA 1OYIA 2OU2A 2BE5F 2STWA 4KMUX 3IWZA 3EUHA 3IRRA 2VXZA 2A5YB 3F8FA 1O7LA 4G7ZF 4UHTA 2VT3A 3GUDA 1YO5C 2QBYA 3LAPA 1ON2A 2K4BA 3GLXA 1FSHA 5LBQA 2W85A 2FMYA 4B8XA 2CYYA 1SMYF 2Z33A 3ZPLA 1R58A 3COAC 4Q48A 4GO1A 3JAMZ 1ZRDA 2P7VB 3FWEA 1GXPA 4EM0B 1BIBA 4ZYEA 3O2PE 4GGGA 2GQQA 3WU1B 2FE3A 2V1DA 3QPHA 3F6OA 3QOPA 3G73A 4XRFA 2HQNA 2FBHA 3C1DA 3HOTA 4UV9A 4G9YA 3QP5A 5JR3A 2DTRA 1MD0A 3LA7A 1SD5A 2DU9A 2DBBA 3ZMDA 4RAZA 3KP7A 2OD5A 3E5UA 2F5FA 2KRFA 1F5TA 4HX7A 2IA0A 3K1NA 4KICA 2E1CA 3IC7A 3M8FA 1RUNA 1LDDA 3V7RA 1Y0UA 4IRGA 5L3EA 5DCMA 5HDGA 1S7OA 1XGNA 2WC2A 2O3FA 3KP5A 3ECHA 1XGOA 2DW4A 1IUYA 3VB2A 4LFUA 1Z1DA 4YG2F 2VE9A 2HFHA 5LGUA 3F8NA 2V79A 2V1UA 1WSUA 4I2OA 1BI0A 1YLFA 1BI1A 5FO5A 1O7FA 2QBYB 4PCQA 1JHFA 2OZUA 5FB2A 1B59A 1ON1A 3TDUC 1V4RA 2BBYA 3QRFF 4HF0A 3FHZA 2PI0A 2CGPA 5LHHA 2M8EA 3ZMTA 4P5OA 4M72A 1QQIA 1E2XA 4EJTA 2IW5A 1MZBA 1R36A 3F23A 1H9GA 5H20A 1KA8A 5FD5A 3HRMA 4A0ZA 3I59A 4ESJA 2OQRA 1LEAA 4EM2A 2W24A 3CTAA 3DPTA 3IL2A 3W6KB 4CHUA 4TV7A 3J81K 4ETSA 1BM9A 2IRFG 3T0YA 4KT5C 1BC8C 3T5XA 3J80K 2GA2A 1CF7A 3MEXA 3KLNA 4PDKA 3RI4A 4RB0A 1EH7A 5LEJA 4AVPA 3WTSC 2ESNA 1XGSA 2UXXA 1TQPA 4ON0A 2GA1A 3MQ0A 4YFXF 2EFPA 1ZH5A 4RGSA 1WKMA 3KEOA 3TOBA 3KP2A 4OU0A 1KQ0A 2PMHA 3KE2A 1YIOA 4EMSA 5DD4A 2JTVA 1UFMA 3WTWC 2FMLA 3BROA 3FXRA 5ICGA 3MAJA 4G8XA 2M45A 1O3QA 3RKWA 4S05A 2ZNZA 1IN7A 2GXBA 2HKOA 3SXYA 2XAQA 4XLPF 3ABUA 5L3CA 3H3UA 1CF7B 3LSTA 1CGPA 1XSVA 1FP2A 1R5HA 3ECOA 3HRUA 4Q5SF 4LK0F 1A04A 5DV5A 2DT5A 2ETHA 4H0EA 4Q4ZF 1QZYA 3FF5A 3MWMA 2A6HF 1HKQA 1F1ZA 1MJBA 1MDMA 2TDXA 2H09A 3E6CC 4HX4A 5LRRA 1G3SA 4R8HA 1R1TA 3HHHA 1SMTA 2RV8A 1HXDA 3KCCA 4KUMA 4AIJA 1DDNA 2MH9A 2LSOA 1BJAA 5CVVA 1P6RA 3I53A 4LMYA 1UHWA 5JFRA 1D5VA 5FLXK 4BHPA 5LGTA 2KKOA 2YSRA 3REOA 3I64A 2NAZA 3KP4A 4M6XA 1LVAA 3P7NA 2IVMA 1KGSA 1R1VA 5ICEA 4XSXF 2NRAC 2VBXA 4FX0A 2E7XA 5CVRA 4KYWA 4M6YA 4UNOA 1FC3A 4HQEA 3JW4A 3KEQA 2P6TA 2K7LA 1ZRCA 2MC3A 4ASNA 4L0YB 2F2EA 3LAJA 3GFIA 5H6RA 5E1XA 1G6NA 3ZN1A 4N0BA 4UXNA 4MNUA 2P5LC 4HQMA 5HOOA 4HF1A 3TO9A 3R61A 5FLXZ 1FPQA 2IA2A 2K86A 4MQ9F 3F72A 3FX3A 3IHUA 2AXLA 5BPIA 3F8CA 4HF2A 4P96A 4CYDA 4UVCA 4WK8F 3EDPA 4EGYA 3RPQA 4M9XA 2XROA 4Y17A 3EYYA 4S04A 2KJCA 2HQRA 1YW8A 3NRVA 4P9UA 3M7GA 2NNYA 2WV0A 5CLSA 1HBXG 4KA4A 2VC1A 2UWMA 3L7WA 4M9ZA 3M1EA 3GFMA 1D3YA 4EJOA 3WG9A 5KK1A 4DNCA 1HKSA 3WTYC 2EJRA 1K78A 2PQ8A 2CG4A 1PP8F 3SQNA 1HW1A 2EV6A 4D0PA 2QQAA 4HV6A 4MGRA 3WTXC 4EM1A 3GWZA 1UB9A 1QNTA 3R0JA 1T6SA 4N9HA 2P4WA 5TJJA 5BPDA 3K9TA 3HUGA 2L4AA 2PEXA 1ZG5A 2K4JA 3HIFA 3ROUA 4XBFA 3JAMK 1OYWA 1W7PB 3ZMUA 1S3JA 2ZFWA 3L9FA 2VOPA 3EYIA 5HDNA 2HR3A 3IWFA 1Z6TA 2VT2A 3G3ZA 3ULQB 2OBPA 5A2QK 5D6EA 4HDVA 5J8FA 4A12A 3CUQB 1LNWA 3WTVC 2FF4A 3S2WA 5HDKA 3KP6A 4ZZLA 4Y13A 3I54A 4A5MA 3QAHA 2PLYA 2L02A 4U0YA 3T8RA 3CO6C 3ZMSA 3KZYA 2Z9OA 3K0LA 3WTUC 2QYOA 3L09A 2R7FA 3TQNA 2FEZA 1AOYA 3N4MA 3E6BA 5ICCA 5LRSA 4ESBA 4ZH4F 4M9SA 2RKHA 2V1XA 2K27A 1V3FA 3I0TA 5AIPA 2DO7A 3DEUA 3GO5A 2P5VA 2JT1A 2D1VA 2H6CA 4FHTA 1ZLJA 5HVQC 5D6FA 1XCBA 1ZGJA 5ERIA 5CVUA 3GYHX 2RGVA 2DPUA 5BS6A 4IHSA 2QM3A 5L3FA 2ISYA 2YX7A 4HA8A 3TOAA 1FY7A 2DK8A 2P8TA 2ZNYA 5K5RA 2MD5A 4I09A 3CJNA 1U5TC 2EA2A 2JRTA 3RTRA 4CGZA 4FT8A 2YPRA 4KMFA 5ILVA 4RGUA 3WU0A 2HOEA 4EVIA 1OPCA 2W57A 4BH9A 4KFCA 1L3LA 3BPVA 1JE8A 3IKVA 4JQFA 4LB6B 3WGIA 4HX8A 1QO0D 3F8MA 2RVCA 1J59A 1S7AA 2E1NA 3C3WA 1PUEE 4UV8A 4AD9A 2YR2A 2VN2A 1XDSA 3U9GA 2F5CA 2GXGA 5HS8A 5K1YA 4HAMA 3WE2A 2A68F 1IN4A 2XAGA 1XCVA 2EFQA 5AONA 6PAXA 4BHCA 3ZQ7A 1KQ9A 3I59B 2ZMEB 3LFKA 2M30A 4CO8A 3T8TA 5E1ZB 2L4MA 4L9NA 1U3EM 5DUIA 1LEBA 3W6JB 4GCVA 2YU3A 4KIFA 1FBUA 5HLHA 2HTSA 4G7HF 2KIMA 4LK1F 2XGXA 1QGPA 4CZZA 2FOKA 3CDHA 3DV8A 1W5TA 2D2WA 2HEOA 2XHKA 1U5TB 2NYXA 3WTTC 3U1DA 4MEXF 2ZKZA 5KVRA 1BN5A 1KU9A 2RQPA 2QUFA 2HKXA 2FU4A 3ZN0A 4RGXA 3T1BA 4HDUA 3TO7A 4Q47A 4L9TA 4WXDA 2H6BA 1WRJA 1J0RA 1ODDA 5E8IA 3FMQA 1Z05A 1ZG1A 3E6MA 5D5WB 4IRHA 4A0XA 2HS5A 2R3SA 3DF8A 5DYMA 1TW2A 2RDPA 1IZ1A 1OKRA 1O3RA 3PQKA 3PFIA 2XAHA 4K2EA 5HLIA 4M74A 3V7SA 2XAFA 1LQ1A 5D4SA 2X4HA 1WWXA 2L54A 2QQ9A 3BJOA 5D8LB 2XAJA 2OAZA 1KYZA 2G7HA 1XD7A 1P4XA 4RB1A 5FD6A 3P9IA 5D5UB 3WODF 3HSRA 1DP7P 2Z99A 2XVCA 2MA3A 4ENMA 4WXHA 4M73A 2OA4A 2W84A 3CUQC 2P6SA 1SD6A 1FNNA 2EV0A 3CUOA 4I7HA 3Q9VA 3L00A 1EH6A 4YFKF 1J75A 2XV4S 4JK1X 3E5QA 3RKXA 4IPAA 2QQBA 3GEZA 1XN7A 1EV7A 5J8CA 2J5OA 3RYPA 3WGHA 1QPMA 1LDJA 1KU2A 2Q2EA 1BI3A 2VBZA 2HWVA 3F3XA 2CQKA 1FSEA 3P9KA 3TO6A 2V9VA 2IPQX 2L01A 3RPUA 5ILUA 4O3MA 1HKTA 3D0SA 4YFNF 1ZG3A 4OMYA 5F1RA 5DDGA 4KIGA 3MCZA 2PBIA 4RS8A 5LLQA 3FZVA 4EJWA 2PG4A 5JI6A 3NQOA 4IF4A 1SD7A 1TQMA 3E5XA 1ZN2A 2MBFA 3R6SA 3ISPA 4WF2A 1ZRFA 1U2WA 3WTZA 3DQVC 4NQWA 3RYRA 4RB2C 2HGCA 4IVNA 2A61A 4U0WA 1XSDA 2GAUA 4UUVA 1PP7U 2ZMEA 4DQ2A 3RKYA 1D8KA 3R4KA 1BBYA 4L9JA 2ZCWA 3E97A 3I71A 2FNPA 3ELKA 1Z6RA 5IT3A 1S6LA 3V8JA 2MLKA 4CDGA 2IA1A 4G6DA 2JPBA 3BWGA 2RC4A 1JGSA 5CVIA 2Y0MA 3WGGA 1R1UA 1L0OC 5JHUA 3V8KA 3LQQA 2LDUA 2XIGA 3O3KA 4ZYGA 2VBWA 4EJVA 2A6EF 3JSOA 1SAXA 1ZHFA 3Q5FA 4AIKA 3CLOA 1T98A 4GYGA 3EQLF 5ILSA 3P9CA 3M9AA 3BZ6A 3BP8A 1I1SA 2HYGD 2H94A 5DD8A 1YG2A 2QZ8A 5DCFA 4A0YA 3GX4X 2VC0A 5F64A 1TW3A 1HW5A 4LJZF 2ACJA 1RI7A 4BXUA 4EGZA 3OV8A 4L18B 2ZBKA 1HW2A 3VFZA 2XKPA 1LB2A 5E20A 2H27A 2F5EA 5FGMA 2R7DA 3QU6A 2QWWA 4I0AA 2XKOA 4BHBA 4PGHA 5L3BA 4A6EA 1S29A 1JHHA 1WI9A 3KZZA 4BNCA 3J81Z 2O61A 1RIOH 1IN5A 4MTDA 4OIQF 4I01A 1GVJA 1IXCA 1R00A 3VOEA 3M8EA 1J2XA 2ELHA 4A6DA 3IRQA 1ZREA 5BMZA 1USTA 1TQIA 4M71A 4HLYA 4OIOF 3R0AA 1SFEA 1TNTA 2FBIA 4CICA 4NB5A 2EB7A 1U6GA 2MLGA 5DUKA 3GF2A 3LA2A 5HLGA 1F4KA 3ZMZA 1J5YA 2EV5A 2FNAA 3HOSA 3NEUA 1HQCA 1IXSB 1T0FA 3IKTA 5TRDA 1KQ8A 3ML6A 4L0ZB 5LHGA 3DFGA 3QPTA 2KIUA 1FLIA 1BOAA 4UVAA 2ZO4A 3FM5A 3V7CA 1O57A 4AIHA 2IJLA 3BJAA 5FFXA 5HS9A 1FX7A 1XSXA 1YFHA 1I6XA 2CW0F 1C0WA 4WWCA 1YQAA 2DK5A 2RNJA 1XMAA 2RN7A 4BQAA 2J5PA 3TDZC 4HZFA 1P4AA 3PQJA 2FSWA 2Z3YA 5JVTA 2VOOA 2CSOA 5F6FA 1TNSA 3B02A 5BQTA 2A07F 1FYMA 2G9WA 3LA3A 3F21A 2UZKA 4R1HA 1ZYRF 4L5JA 5J6XA 2Z5UA 2MH2A 1REPC 4OIRF 1G3WA 3FXQA 4OINF 2VBYA 2A3SA 5E18F 2O03A 1ZARA 4LLGF 4WX9A 5L3GA 2PN6A 2FQ3A 2O6GE 3I4PA 4I02A 3GZ5A 4RB3C 3JTHA 3F8BA 4HLXA 2M1BA 1UCRA 2FXAA 4GYIA 2EFWA 1EH8A 3MFKA 1IRGA 5CJ9A 2C6YA 1O3SA 1STZA 2LF8A 3FMSA 3K1MA 3C7JA 2OQGA 1YYVA 4L9VA 1E17A 1MKMA 2DLLA 2DPDA 3F22A 2DQLA 4IXAA 5IT9K 3LWFA 4LD5A 2A69F 2L3DA 4U0VA 2ESHA 4NHJA 1S8NA 3SFZA 3ZMVA 5E8GA 3GXOA 4ENJA 1JXSA 1Z7UA 4KNYA 5E1WA
chains in the Genus database with same CATH superfamily
4NBQA 2XASA 4RAGA 3HTSB 2M87A 2QENA 4PJJA 3HDDA 1B4AA 1D0ZA 2EQRA 2QLZA 1SVOA 3BPXA 1A35A 1I3QJ 3OYMA 1MMNA 3SZTA 3OWTA 2DJIA 1QHGA 3HB9A 3SYTA 3ZQGA 4E7JA 5LGNA 4XLAA 1JJ8C 1FBQA 2BV6A 2NS0A 2QSGX 4LLNA 4LLLA 3C2GA 3L2WA 1WI3A 2AS5F 2OCEA 1G4DA 3PNVA 1B8IA 3V4GA 5D8KB 1IDZA 1YW9A 1ZGAA 1R22A 2CO5A 4RM2A 4XLCA 2HVSA 1DPRA 4KISA 1MJ9A 3BDDA 2R4GA 1FEXA 1PDNC 3WE3A 3OYKA 1R6RA 3HZJA 2DMTA 1X1BA 2EFOA 1POGA 1QVUA 1UJ8A 2V1NA 1BC7C 1SD4A 1MMSA 3A0BC 3QP6A 4IJAA 1TTYA 4FTHA 3GW2A 1H0MA 1XPXA 1JUSA 2G7UA 3SZPA 1RZ4A 3RJPA 1WJEA 1ULYA 2E71A 1NK3P 2R92J 4GFBA 3CC2I 1S5LC 3MKLA 5FLVA 3C18A 1X2MA 4IO9F 1Y6IA 2UXNA 3OIQA 2NVYJ 1YIJI 1T38A 1TC3C 5CYVA 1IGNA 3TW6A 3VEPA 2KJBA 2IGKA 3BTJA 2CS3A 2DMUA 2Q0OA 5B5EC 5C4XJ 3MZYA 3O6BB 3BJ6A 5IY5H 4ZYDA 2JA7J 3TGNA 2D5VA 3K2ZA 2LF7A 1T33A 3BTIA 1Q1HA 1VQKI 2RNGA 1K79A 2BYVE 2LYCA 2K02A 4G94A 2EFNA 2LP0A 1LKXA 1U8RA 3HHGA 1AWCA 5EDNA 4XR6A 2Q8KA 1QZZA 4IHTA 4BE1A 5LEKA 4ESFA 1RUOA 1BIAA 2YX4A 3S15J 2QVOA 1IUFA 1VI0A 1W0UA 3MD2A 1AKHB 2CWEA 1ZKGA 1LE8A 1BR2A 1KU3A 2JZYA 5GAGJ 1GXQA 2F4IA 1WJDA 1FWZA 2VODA 3FM3A 1KZHA 4I98B 5DEQA 1BOBA 3EETA 3HL2A 2E2HJ 4A3CJ 1FOKA 1I27A 1P2FA 2FQ4A 3K4KA 1R7JA 2D1HA 3Q3SA 4P55A 3I58A 2VJ4A 5E17F 4ENKA 4J00A 3SEZA 1FZPB 1OR7C 1X4OA 2A05A 2JPCA 1FTTA 3S14J 2JSCA 1Z7LA 5AIQA 2BVMA 5IOZA 2VE8A 4ENNA 3FXMA 2FA5A 3EPZA 4BYYA 3VODA 1OLTA 2XRLA 2QEXI 2FRHA 1G3YA 2A6TA 2WB1N 3S32A 1B6AA 1D0XA 1I1GA 4A3IJ 2CV1A 3DBRB 4A2UA 3KETA 3DPLC 2GBYA 2HYFA 3L2CA 2P0WA 4B09A 1G3TA 4A93J 4EJUA 1YS6A 2XPWA 3F6VA 3FDYA 5TISC 4XLNF 3RIRA 2F48A 2EBIA 4ZDPA 3HRTA 4BL0B 4DYCA 4DYRA 3HSFA 4YIIA 5A2QZ 3HYIA 4A3KJ 1NHAA 1XX5A 2M34A 1T39A 1BL0A 1HA8A 3H3VK 1RKWA 3SHFA 4O5VA 5FKLA 2Y9ZA 4OMZA 4JOMA 1R9TJ 1UHMA 4E7IA 3DEEA 2ADUA 2IGOA 3AKZA 4BJTA 4KIBA 2LBFA 1K78B 1U5TA 2PJRA 4LB5A 2ISZA 2DDAA 2KL4A 1NK2P 4HW0A 2HDCA 3GFLA 2MG4A 1JT0A 5F04A 1W4MA 2HTJA 1XDUA 2CQXA 4U7BA 1SFUA 3O8HA 3DLAA 4A3JJ 4MFEA 1JTYA 2X0LA 2E36A 3KP3A 3I9V2 1Z3YA 2R5YB 1O3TA 1FJLA 1IRXA 4NNJA 1BI2A 1RESA 3K4BA 3HSEA 2ZJQF 1MDMB 1LFPA 1DPUA 4L5EA 4WXCA 5JHFA 3FIWA 1OR7A 1VQMI 3H9JA 1H8AC 3AG4H 4RM3A 3ERMA 3CF5F 5KNLA 5L3DA 4XRSG 2R7RA 3ZQCA 2XRNA 1ONVA 1HDDC 3RDIA 2LY9A 2KDZA 1KYWA 5F27A 1OFCX 4KN7X 1O4XA 1D8JA 2BW3B 2LR8A 5J47A 3V8LA 5HS7A 1FBSA 2IP2A 4HOBA 4OOIA 4L5IA 3GZ6A 2GXAA 4ZZDA 3ZQHA 5KHDA 1VTNC 4D1QA 4XLFA 2O5RA 2M5WA 4WCGA 4AUXA 3IH4A 1PUFA 4N9IA 1B1BA 1VF9A 1GHCA 3ABTA 5JLWA 4I76A 1B9NA 5E1WA 2UV1A 1IN8A 2ZXJA 2Y75A 3D5LA 4XKCA 1T2KA 4OIPF 4EATA 4F93B 2PJPA 2K40A 5FKNA 3DBLB 2X1DA 3TP0A 1DU0A 4LG0B 4G7OF 2L9VA 3BG6A 1JT6A 2NVTJ 1LPQA 3U2RA 4XLEA 3PO3J 1ETKA 4JX4A 3KFWX 2LKPA 1IXRC 4QWQA 4BACA 4U88A 4E7SA 3OOPA 2DA2A 1OYYA 1U78A 3K70C 3FBNB 4O6JA 1IV8A 2H8WA 2IT0A 3I4MJ 1IRFA 3CF2A 4IHXA 1GLNA 1MNEA 1SFXA 2O7OA 3BR1A 3J7ZI 3E1SA 4MTEA 3CO7C 2EWNA 3OYJA 2XUBA 3GVAA 4BXFA 5DCMB 1TBXA 1TLHB 2WWYA 2M0CA 4NUBA 3K1PA 4YELA 3R60A 1S9HA 3LSKA 1DUXC 2BEOA 5D4RA 3KLOA 2X6OA 4PJMA 2DN0A 4N4OB 2JK3A 1TWAJ 2DI3A 1R5GA 4D5FA 2D45A 4BDZA 3HJEA 3BOQA 2HPMA 1U0JA 3CCQI 3NWSA 3F0CA 3ERED 5LD2C 5EF6A 3QYBA 1QBJA 2DA5A 1H9TA 4LITA 4PGGA 1FYLA 1LDKB 4G6QA 4EQQA 1J9IA 3JCUC 1KU7A 3FXOA 4HG2A 4DZJA 4GXOA 2EK5A 3MZHA 4RAYA 1MJAA 1YRNB 4MEYF 1F9NA 1XMKA 3OOUA 4DZPA 1ERDA 4A5NA 3WG7H 4Y15A 2LNBA 2XPVA 3RCOA 4BXXJ 1K6OA 5CVJA 1SFKA 2CW8A 5KCMA 1QU3A 3HOYJ 3P5JA 2BW3A 2VPRA 1HF0A 4B47A 4FX4A 3FMRA 4E7HA 1IF1A 1IW7F 2IGMA 4KN4X 3ZP5A 5HNHA 3QU3A 1ETVA 3HRSA 2O0YA 4HBLA 2WTEA 4ZYAA 3PUBA 4UB6C 4XSZF 2FBKA 4KDPA 1ZAOA 3TKYA 4B3XA 5IP9J 1HSTA 4P9FA 1YTYA 2UUZA 2F5DA 4CXFA 4R79A 2GIVA 1IN6A 5IT9Z 4XLHA 1SC7A 3ZQFA 1FT9A 3N97A 3DXJF 3S1NJ 3M8JA 5DTDA 3E0JB 3WU2C 1VQ8I 3MKYB 2WAEA 1MMAA 4G12A 2VKVA 3GFJA 3JTGA 3CCMI 1HSJA 2DODA 3H5AA 2XF6A 1YS7A 2K9NA 2K9LA 1U9NA 2GWRA 3LSMA 4LG0A 2ECBA 3BY6A 3K69A 2CQQA 3C2BA 2KISA 1P4WA 5D5XB 3OL3A 2STTA 3J80Z 5ICFA 2R7QA 4HV5A 1Z91A 3J7AO 1P92A 1X3UA 3HGYA 2V4JC 3AFHA 4C30A 1IAWA 2XC7A 4Z2YA 1I5ZA 1PJRA 5D5VB 4IRIA 2KIFA 4UVBA 1B9MA 3S3NA 1OMIA 2Q2EB 1Z9CA 2EA4A 5EEHA 1W0TA 2DXIA 4RA2A 4UB8C 2HVQA 1MGTA 4ZC3A 4C3JJ 3BR2A 5GAHJ 4J19A 4NC8A 4B48A 2XAUA 1OJLA 4MHGA 5E79C 2K9SA 3JSPA 1FYKA 2R7XA 5K5OA 4JBAA 1QA6A 3F9KA 1ZLKA 3CC7I 1R23A 3CD6I 3B73A 3OYHA 3H0GJ 1APLC 5FFZA 2MSYA 3CUQA 4RGRA 3FXUA 1VZ0A 4X1EA 4QLCU 5K7HA 4BQQA 3S16J 2Y48A 1RNLA 3K10A 2K3PA 2K9MA 2R5YA 5BOXA 1XB4A 3E6DA 3SDBA 2CFXA 1YW7A 1VQ5I 1W5SA 1K7AA 1J09A 2DQRA 2GM4A 1FP1D 2PFBA 2O8XA 2LD5A 2CV0A 1XGMA 3BG3A 3KEYA 4OAZA 4XMYA 1W7PD 1LVKA 4ANJA 2HPIA 4BAYA 2COMA 5EEAA 3AAFA 2EH3A 4HSRA 1LJ9A 1WQ2A 3VYSB 1GVDA 4JYKA 2VUMJ 2DAOA 4DIQA 3HGGA 2B0LA 2PMZN 3Q9SA 5CKTA 2KHMA 2V6CA 2P7CB 4PSXA 1D0YA 2TCTA 3E3VA 4I0BA 4OAYA 3H3ZA 5H6QA 5C4JJ 2EPFA 4Y3OA 2OZ6A 4I99C 2DFIA 1GV2A 2QKLB 3H92A 4DYQA 4LGWA 3FISA 4E7ZA 5K5QA 5EG0B 1SFOJ 2W25A 3OYNA 2XPUA 2HZTA 4F7ZA 1USSA 1J7KA 2OJED 4AWXB 4XORA 3LQRA 4MQVA 3I5UA 4PZJA 3V42A 1Y8RB 2VONA 5LHIA 1IJWC 5ED4A 4U7DA 4ZYHA 1Z77A 4E70A 1ETQA 2ZJ2A 2X85A 3RQ4A 3GCMA 5EEGA 1P7JA 2GZWA 4ZJZA 1E0EA 1W7PA 3DP7A 2E7WA 2P5KA 2NNNA 2WV1A 3S8PA 2KFDA 2X51A 4HYEA 4XN3A 4KITB 3DKWA 1ETYA 3DEWA 3HG9A 3S2HJ 2BGCA 4BU2A 1JUPA 1PVEA 4EV0A 4YIFA 2LVSA 2PMUA 2X48A 3RQIA 3HTUA 1OYIA 2X6XA 1JUMA 2OU2A 2BE5F 1D1CA 2STWA 1MMGA 3CCJI 4KMUX 1JTXA 3IWZA 2ZXWH 4XN0A 3VSKA 1TT0A 2VLAA 3EUHA 3UNGC 1YX5A 3OY9A 3IRRA 2VXZA 2DYRH 1UMQA 1GV5A 2A5YB 1YI2I 2LRDA 1O7LA 2DMQA 3F8FA 4G7ZF 2EINH 4CH7A 1GT0C 4UHTA 5EGOB 2VT3A 3GUDA 2R7UA 1YO5C 2QBYA 3LAPA 1ZQ3P 2HU9A 1ON2A 2K4BA 2YUSA 3GLXA 4LG3A 5LBQA 1FSHA 2W85A 2FMYA 3PSFA 4B8XA 3LSPA 1HLVA 2CYYA 1SMYF 4HPQA 2JSPA 2Z33A 3BQYA 3ZPLA 1R58A 1R4NB 3COAC 4Q48A 2LKSA 4XONA 3DTKA 5GAEJ 2KRCA 4GO1A 3JAMZ 1ZRDA 2P7VB 3OSFA 3FWEA 1GXPA 4EM0B 1SVLA 1BIBA 1MSEC 2B7EA 4ZYEA 3O2PE 4RBOA 4HNUA 1Y1WJ 4GGGA 2GQQA 3WU1B 1YE9A 4NDLA 4FASD 2FE3A 3G1OA 3HOUJ 2IAIA 1RRJA 2V1DA 3FBIB 3F6OA 3QPHA 3QOPA 4ZTFA 2NVQJ 5EG0A 3ZGKA 3G73A 1EKEA 2ZSIB 4XRFA 3OS0A 2HQNA 4MLOA 2FBHA 3C1DA 3HOTA 4UV9A 2VQCA 3LL7A 2WBMA 2Y69H 4G9YA 2VKDA 2H1LA 3QP5A 3DTEA 1RETA 5JR3A 2DTRA 2NVUB 2CH0A 5IYCJ 1MD0A 3LA7A 1X2NA 3K2AA 1DP3A 1SD5A 3A01A 2DU9A 2DBBA 3W6VA 1FMVA 4F91B 3ZMDA 4RAZA 3KP7A 2OD5A 4RLQA 1ZELA 3E5UA 2F5FA 2KRFA 3OL4A 4HX7A 2ME6A 1F5TA 2IA0A 2L2OA 3K1NA 1ZTRA 4KICA 4IX7A 5GPCA 3NWTA 3SJMA 3TEDA 4HEA2 4RMNA 2E1CA 5HODA 2R7TA 5IT9K 3IC7A 3ZQQA 1I3AA 3LSGA 3M8FA 3K4JA 1RUNA 1R4MB 1LDDA 2ELKA 4NC6A 3V7RA 1A31A 3HKZN 1W36D 1Y0UA 1WJCA 4IRGA 5L3EA 2HVRA 1RR7A 4CCMA 5DCMA 2NOJB 3NAUA 5HDGA 1S7OA 1XGNA 1A6IA 2WC2A 2O3FA 2Y30A 2ZC2A 3KP5A 2CUFA 1D5YA 2L7KA 3W3CA 1OISA 3ECHA 3M07A 3HOXJ 2YU9J 1Q1VA 1XGOA 2DW4A 1IUYA 4HRIA 2DA6A 3VB2A 2HZDA 4LFUA 1Z1DA 3W2AA 4KNYA 4YG2F 2VE9A 2EZLA 2HFHA 5LGUA 2L9SA 2CUEA 4C2UA 3F8NA 2V79A 3IH3A 2R5ZB 2LY1A 3JRCA 2V1UA 1WSUA 4CYCB 4I2OA 4BJ5C 1BI0A 2BY1A 3VYTB 1YLFA 1BI1A 3OYFA 3MKZA 2E1OA 4B1RA 1HC8A 2QSFX 5FO5A 1UZCA 3KPHA 1O7FA 1UAAA 2QBYB 4PCQA 1W5CC 4BE0A 5GTIC 3BQZA 1JHFA 2OZUA 2DA1A 4CCLA 1FOWA 4PJLA 5FB2A 3AL0C 1NG6A 1B59A 2HNHA 5GTHC 5KAFC 1ON1A 2Z1DA 3TDUC 1V4RA 2BBYA 4YIRX 3QRFF 4M3EA 4HF0A 1X1PA 3S3MA 3FHZA 2PI0A 2CGPA 2E5NA 1ZK8A 5LHHA 1EF4A 4V2FA 4B4CA 3IUOA 1WHUA 2R7WA 3QWLA 2E34A 2M8EA 1U9OA 3ZMTA 4P5OA 4M72A 3JRAA 1WPKA 2Y9YA 2ZSHB 1QQIA 1E2XA 3MZ8A 2BY0A 2CRGA 4EJTA 4AYBN 2IW5A 1ETOA 1MZBA 3OYLA 1R36A 1H88C 1X3WB 1TWCJ 3BG5A 3F23A 3OIPA 3GTJJ 1H9GA 5H20A 3VDXA 1KA8A 5FD5A 1UELB 3HRMA 1FTZA 4A0ZA 1UG0A 3I59A 2HOSA 3CESA 4ESJA 2V9KA 2OQRA 1LEAA 4EM2A 3A2KA 1YRNA 2W24A 3CTAA 3DPTA 1R5ID 3L1PA 3IL2A 3W6KB 4CHUA 4TV7A 5CPRB 3J81K 4ETSA 1BM9A 2IRFG 3T0YA 4KT5C 3GTLJ 3DU6A 3OMYA 2AQEA 1BC8C 3T5XA 3J80K 2GA2A 3B6AA 3OR1C 1CF7A 3VYRB 3MEXA 5GADJ 3OYIA 3KLNA 4PDKA 3RI4A 3DWLE 5JLXA 4RB0A 1EH7A 5LEJA 3HKZA 4AVPA 3WTSC 5CQGA 2ESNA 1XGSA 2UXXA 1TQPA 4ON0A 2KDOA 2GA1A 3MQ0A 4YFXF 2EFPA 1ZH5A 3BTLA 2W00A 4RGSA 1WKMA 4V19K 2HQ5A 3KEOA 3FXKA 1Y8QB 3TOBA 3KP2A 4OU0A 1KQ0A 2PMHA 3KE2A 1YIOA 4EMSA 2VQGA 1EA3A 2JJ7A 5DD4A 2JTVA 1UFMA 3WTWC 3ABMH 1VQ6I 2R7VA 1WJAA 3GZNB 2FMLA 3BROA 4LOCA 2MABA 2CU7A 2K3FA 3FXRA 5ICGA 3MAJA 2V9PA 2LBFB 4G8XA 2M45A 1O3QA 4BQOA 5EZHA 3RKWA 2DFFA 4S05A 2ZNZA 2LG4A 1IN7A 2ZFUA 2GXBA 3IAS2 4PFPA 2WADA 3VPRA 3HOVJ 1MBFA 2HKOA 3ESWB 4BY7J 3SXYA 1PUFB 4HSTA 2XAQA 1F43A 4XLPF 3J7YJ 4E7LA 3ABUA 3L2UA 5L3CA 2KZGA 3H3UA 1QRYA 2E1MC 2M3AA 1CF7B 3LSTA 4AU7A 1ZR4A 1CGPA 1XSVA 2QQ8A 1FP2A 1R5HA 5EYRA 3ECOA 3HRUA 1MNMC 2CMPA 4Q5SF 4LK0F 3CJQB 2ELJA 1A04A 5DV5A 2CQ7A 2DT5A 2ETHA 2Q1ZB 4H0EA 4Q4ZF 1QZYA 3FF5A 3MWMA 1Z0XA 4JP0A 2A6HF 1HKQA 2X6WA 1F1ZA 4CYCA 3I56I 1MJBA 2TDXA 3E6CC 2H09A 1DGRM 1MDMA 2Y0SA 1TZLA 4HX4A 4D5CA 3N05A 5LRRA 1H89C 2XB0X 2F5VA 1G3SA 2KP6A 4R8HA 2LK2A 1R1TA 3HHHA 1SMTA 2MW8A 1ETWA 3PNYA 2RV8A 1UHSA 4B3AA 1HXDA 2K5CA 3KCCA 4KUMA 3CCYA 4AIJA 1DDNA 1N78A 2MH9A 2LSOA 1BJAA 2L9NA 5CVVA 1F36A 1P6RA 3I53A 5DM6F 3G4SI 2JA6J 3OR2C 5H2FC 3G1MA 1Z67A 2WA0A 4LMYA 1UHWA 5JFRA 1D5VA 2M7AA 2DOEA 2BY3A 1MBJA 4BHPA 4E6KG 5LGTA 1B8IB 5FLXK 2KKOA 1AHDP 2YSRA 3D5SC 3REOA 4J01A 3I64A 2E19A 2NAZA 3KP4A 4M6XA 1Y0NA 1LVAA 3P7NA 2IVMA 1KGSA 1R1VA 1BA5A 3ONQA 5ICEA 3S2DJ 4XSXF 3TP3A 2VBXA 1GDTA 2NRAC 4FX0A 3VYUB 3ZOBA 1OCRH 2E7XA 4MO7A 5CVRA 2DMNA 2H1KA 4KYWA 2P81A 1YHQI 1FIPA 4M6YA 2VB6A 4UNOA 1FC3A 2JQ7A 3BG9A 4DW6A 1V5FA 3PFYA 2H8RA 4HQEA 4JX5A 3JW4A 1IV6A 3KEQA 2VPLA 2OCCH 3SEQA 4H4KC 2ME0A 2P6TA 3M1CA 1FOYA 2K7LA 1ZRCA 2MC3A 4ASNA 4L0YB 2F2EA 3LAJA 3GFIA 3GTGJ 5H6RA 2WAQA 1G6NA 5E1XA 4PJNA 2CJJA 2V26A 3ZN1A 4N0BA 4XIDA 2QGUA 4UXNA 4MNUA 3A1YA 2GIZA 4HQMA 5HOOA 5FLMJ 5EZGA 3RZOJ 4HF1A 3R61A 3TO9A 3CP8A 4YRVA 1MIJA 5FLXZ 1FPQA 1Y56A 2IA2A 2K86A 4MQ9F 3F72A 3FX3A 3FHNA 5JVGF 3IHUA 2AXLA 1NG7A 1QZEA 2RREA 3CQZJ 5BPIA 4FETA 4C2TA 1JJ6C 3BG7A 3JRGA 3F8CA 3BC8A 4HF2A 4P96A 4CYDA 1K4SA 4UVCA 3DU5A 1IO2A 4WK8F 3EDPA 4EGYA 3RPQA 2NS8A 4M9XA 3FXJA 4XNFA 1AU7A 2XROA 4Y17A 3EYYA 4S04A 3TW7A 2KJCA 4C2MJ 2HQRA 4S0HB 2BXZA 1YW8A 2WY8Q 2LREA 3NRVA 2KLOA 3QYFA 4P9UA 3M7GA 3OYEA 2NNYA 2WV0A 5CLSA 1OCCH 3CDLA 1HBXG 3H5NA 1WGXA 3MKWB 2VJJA 1YJWI 4KA4A 4GDFA 2VC1A 2UWMA 3L7WA 4M9ZA 2LC2A 2WAFA 3G2BA 4FE7A 3M1EA 3OYGA 3GFMA 1D3YA 4IQ4A 4DGWB 3KYLA 4EJOA 3D1NI 3QYEA 4XOPA 3WG9A 5KK1A 4BDYA 1N75A 9ANTA 2M8GX 4DNCA 1HKSA 2X9DA 2M9HA 3H5RA 4A3DJ 3WTYC 1Z21A 2EJRA 2JWTA 1K78A 2PQ8A 2CG4A 1PP8F 3SQNA 1HW1A 3GLLA 4PK4A 2EV6A 2FD5A 4D0PA 3CCRI 2QQAA 2B9SA 4HV6A 2X1EA 4MGRA 3WTXC 2IS1A 4EM1A 1S72I 4BKXA 3O8GA 3ZXSA 1NTCA 3GWZA 1UB9A 1QNTA 1WVRA 3R0JA 2L7FP 4D7MA 3BR5A 1K83J 3CJRB 1T6SA 4N9HA 2P4WA 5TJJA 2ZXHA 4GRIA 3SDGA 1TP4A 5BPDA 1CQTA 3K9TA 3PL8A 3GTKJ 3HUGA 2L4AA 5BNGA 2XF7A 2PEXA 1ZG5A 1K61A 2K4JA 3JREA 2I5UA 3HIFA 5J1UA 1WJFA 3ROUA 4XBFA 3JAMK 1OYWA 1XTAA 3L2RA 3S1QJ 4BGDA 1W7PB 2XGCA 4KT6A 3ZMUA 1S3JA 4OWRB 3J7AY 3BR0A 3KYDB 2ZFWA 1B72A 2JA5J 3L9FA 2VOPA 1I6HJ 3EYIA 5HDNA 2HR3A 3IWFA 1Z6TA 5F0HA 2VT2A 3G3ZA 2KRHA 3ULQB 3FKJA 1MBGA 2OBPA 5A2QK 5D6EA 4HDVA 5J8FA 1GUUA 2EILH 3CUQB 4A12A 1LNWA 3WTVC 2FF4A 2ZMEC 2CFOA 3S2WA 3H0DA 4IOAF 3HUGB 4RLFA 2MYSA 3AG3H 5HDKA 3KP6A 1MNDA 4ZZLA 4Y13A 2W82A 4IHVA 3I54A 3HPHA 1MBHA 2BVLA 4A5MA 2E2JJ 3QAHA 2PLYA 2L02A 4U0YA 1QVTA 3I4NJ 1BW6A 3BZCA 3T8RA 5KAIC 2R7ZJ 2QF7A 3CO6C 3ZMSA 3DLLF 3KZYA 3VWBA 2Z9OA 3K0LA 4XRMA 3WTUC 2QYOA 1TT5B 5K7FA 2DTZA 3L09A 3CDIA 2BOLA 4Y4RA 2R7FA 1DU6A 3UR3C 2DA3A 4HNVA 3W2VA 5E3OA 2DMPA 3TQNA 2V6EA 3FK6A 1X58A 1JKPC 3JRIA 2FEZA 1AOYA 3N4MA 4ABZA 3HOZJ 3E6BA 4QTRA 5ICCA 5LRSA 4ESBA 4ZH4F 3IH2A 4M9SA 2RKHA 3BCAA 1N77A 3G6EI 5F0CA 3ASOH 5M5WJ 2V1XA 4AM3A 2K27A 1V3FA 3I0TA 5AIPA 2NOGA 2DO7A 3DEUA 3LFUA 3GO5A 2P5VA 2HDWA 4AC0A 2JT1A 2VKHA 2D1VA 5FRMA 2H6CA 4FHTA 1LUJB 1ZLJA 4XRSA 1JKOC 5HVQC 5D6FA 1A36A 1XCBA 2NS7A 1ZGJA 1D1AA 2E35A 2IS6A 4IOCF 5ERIA 4BE2A 2R0QC 5CVUA 3BT9A 2GOMA 2LH9A 2X1CA 1ENHA 2RGVA 3GYHX 2DPUA 5BS6A 4IHSA 2EZHA 1X19A 1VQPI 2E1MB 3RPUD 1VNDA 3ABLH 1SAUA 2QM3A 5K7ZA 5L3FA 3EUHC 2ISYA 2LLKA 3SFIA 3S17J 2YX7A 4HA8A 3HBLA 2L0KA 2EZKA 3PM1A 3TOAA 1FY7A 2DK8A 2P8TA 2ZNYA 4BBSJ 5K5RA 2MD5A 3HXLA 4I09A 3CJNA 1U5TC 4BUPA 2EA2A 2JRTA 1V55H 1OQYA 3RTRA 4CGZA 4FT8A 2COBA 3QOEA 2YPRA 2VASA 4KMFA 5ILVA 1VQNI 2DCEA 2CUZA 1B72B 5J3LA 4RGUA 3DBHB 3WHBA 3WU0A 3ZRGA 2HOEA 3B6CA 1OPCA 2W57A 3DPUA 4BH9A 4EVIA 4KFCA 3KZIC 4HNTA 1L3LA 3BPVA 5M5XJ 1JE8A 3OS2A 1YJ9I 2NXNB 4A3FJ 3IKVA 4JQFA 4LB6B 3WGIA 4HX8A 3JR9A 1P7IA 1QO0D 3F8MA 3D5RC 2RVCA 4IHWA 1A6QA 2XGDA 1J59A 1S7AA 2L7MP 4JX6A 3TMOA 4XQFA 1QPIA 4B44A 1T56A 5FKKA 3GTOJ 2E1NA 3C3WA 4BJ6C 4UV8A 1RKTA 1PUEE 3KX2A 2HOAA 1WCMJ 2YR2A 4AD9A 2AHQA 4IQJA 2VN2A 1XDSA 2CV2A 3S1MJ 2M2EA 4A3EJ 3U9GA 2F5CA 2GXGA 5HS8A 5K1YA 3FXLA 4HAMA 3WE2A 2LMDA 2A68F 2PMZA 2ZJRF 3JRFA 2GLOA 3FK7A 1IN4A 2XAGA 1XCVA 1E3PA 1TWFJ 1X3ZB 2EFQA 4BEHA 5J1YA 5AONA 6PAXA 3DCFA 3ZQ7A 4BHCA 1KQ9A 3I59B 2DT6A 2ZMEB 3LFKA 2M30A 2B63J 2KIQA 2KZVA 3ABKH 4CO8A 3T8TA 1AA7A 2TRTA 5E1ZB 1MW7A 2L4MA 4L9NA 3CP2A 1U3EM 5DUIA 1LEBA 2JUGA 1Y1VJ 4GCVA 3W6JB 2YU3A 4KIFA 1HCRA 2DA4A 3AG2H 2VQLA 1FBUA 2DYSH 4DBRA 5HLHA 4IEJA 2HTSA 2VXDA 3C2HA 3BR3A 4G7HF 4F92B 3MVPA 1OCPA 2KQRA 2KIMA 4LK1F 2XGXA 2VJ5A 1QGPA 4CZZA 2FOKA 3CDHA 3DV8A 4II3A 1D1BA 2X6YA 1SANA 1W5TA 2D2WA 3PO2J 2HEOA 2XHKA 1U5TB 2NYXA 2VI6A 3LSJA 2BY2A 3WTTC 3KIOA 2WB1A 3M4OJ 3U1DA 4BEHB 2BZTA 2R7SA 1YITI 5J4YA 2HDDA 1QHHD 4MEXF 2ZKZA 5KVRA 4QIWN 2RQPA 1BN5A 1KU9A 2DOFA 2ECCA 2HKXA 2QUFA 4MFDA 3GTQJ 2FU4A 3ZN0A 3QQAA 4RGXA 2OTLI 2PX9A 2QSHX 3T1BA 4HDUA 2QKMB 3TO7A 2CW7A 4Q47A 4AIDA 2I8DA 3CZ6A 4L9TA 4WXDA 4G6TB 4FE4A 2H6BA 1WRJA 1J0RA 4FISA 1ODDA 3QODA 5E8IA 2VL8A 4IZZA 3FMQA 3MMYB 5IP6A 4QPOA 2LY2A 3ASNH 4UUSA 1Z05A 1ZG1A 3E6MA 3GBGA 2F4MB 5FROA 2IGNA 4BY1J 5D5WB 4IRHA 4BQNA 2JRMA 4A0XA 3RSNA 2HS5A 1OCZH 2HQAA 2R3SA 3DF8A 4NQWB 4QPQA 5C3EJ 3K4LA 3LSIA 2DFEA 5DYMA 2OC6A 3LSRA 1TW2A 2RDPA 2FJ1A 1WH7A 1IZ1A 1OKRA 2IS4A 3HPGA 1O3RA 5M3MJ 3PNTA 3PQKA 1R49A 3PFIA 4NC7A 2DOAA 2XAHA 4BS9A 4F55A 4K2EA 5HLIA 4XKBA 1I39A 4M74A 3V7SA 5J1RA 2ID3A 2XAFA 4A3GJ 4F52A 2EZIA 2W7NA 2L5QA 1LQ1A 5D4SA 2W4SA 2X4HA 1WWXA 2L54A 5B3SH 1AKHA 4A3LJ 2IEKA 2QQ9A 3BJOA 2OTJI 2VJIA 5D8LB 2XAJA 2OAZA 1KYZA 2G7HA 1XD7A 4XKWA 1P4XA 5IYDJ 2AQFA 4RB1A 5FD6A 3P9IA 4ZDOA 3CMYA 5D5UB 4A69C 3WODF 1OCTC 3CC4I 1VQ4I 1XG1A 2IXSA 3BR6A 3HSRA 5DM7F 1DP7P 1N25A 2Z99A 2XVCA 3BTCA 4C3IJ 2MA3A 4D7NA 1MMDA 3K6GA 4ENMA 3KYCB 1BJZA 4WXHA 4M73A 1NH3A 2VQHA 3LSHA 3U1KA 5FKOA 2OA4A 2W84A 4LIUA 1LFUP 2L9RA 3CUQC 2P6SA 1SD6A 5B1AH 2AO9A 5CQEA 1ACIA 4P1WA 1FNNA 2JA8J 2EV0A 3CUOA 4I7HA 3Q9VA 3JRDA 3L00A 1EH6A 1FIAA 4CCNA 4YFKF 1J75A 2XV4S 2YS9A 1JI8A 4CUGA 2HXOA 4JK1X 3E5QA 2O9LA 3RKXA 4W1UA 3OYAA 4IPAA 2QQBA 1BR1A 3GEZA 4N4NB 2OPTA 1XN7A 1EV7A 5J8CA 1LE8B 2J5OA 4DBQA 3RYPA 1SVMA 3JRBA 3WGHA 1QPMA 1LDJA 1KU2A 2Q2EA 1BI3A 2VBZA 2HWVA 3F3XA 2CQKA 1X1AA 1FSEA 3HM5A 4CSWA 3P9KA 3TO6A 5M5YJ 3UKGA 5GP9A 2V9VA 2IPQX 2L01A 3RPUA 5ILUA 4O3MA 3PSIA 1HKTA 3IAM2 3D0SA 4YFNF 2Y2ZA 1ZG3A 4OMYA 5F1RA 2E60A 1FMWA 3K4MA 5DDGA 4KIGA 3MCZA 2KT0A 2PBIA 3OIOA 4RS8A 5LLQA 3FZVA 1LFBA 3EUAA 4EJWA 2PG4A 5E3MA 4U87A 4M3FA 5JI6A 3NQOA 2ZXIA 4IF4A 2DT7B 4E7KA 2W1OA 3ZQLA 4A3MJ 3OYCA 4C9YA 1SD7A 1TQMA 2DA7A 3H9QA 4CCJA 2XF5A 3CCLI 3E5XA 1Y39A 3HOWJ 3CLQA 2G0EA 2F6CA 3H9GA 1ZN2A 3H36A 1TWHJ 2MBFA 3R6SA 3E7LA 5E3NA 4QSHA 3ISPA 4WF2A 1ZRFA 1U2WA 4MIMA 3WTZA 3DQVC 4NQWA 3RYRA 4RB2C 2HGCA 1MH3A 4IVNA 1JKRC 3PIPF 2BHZA 2A61A 4U0WA 1BW5A 1ETXA 1XSDA 1HOMA 2ID6A 1TWGJ 2GAUA 2W48A 4CA0A 4UUVA 5IOYA 3A02A 5GPAA 1IDYA 1PP7U 2ZMEA 4DQ2A 3RKYA 4X0GA 2IS2A 1D8KA 4X6AJ 2LOOA 3R4KA 2EIJH 1BBYA 1MBEA 4L9JA 3AL0B 1IG7A 2KPMA 2ZCWA 3E97A 3I71A 2FNPA 3ELKA 1Z6RA 5FKMA 3OSGA 5IT3A 1S6LA 3V8JA 2CQNA 2MLKA 3BCBA 4CDGA 4YEJA 2IA1A 1V54H 2JPBA 4G6DA 2R7OA 3BWGA 5J40A 1EJ9A 2RC4A 1JGSA 5CVIA 3OYBA 1Z3XA 1G8XA 5B1BH 2Y0MA 2LTPA 2Y0SN 3WGGA 1R1UA 4Z6YA 2MFZA 4PJ0C 1T08B 1L0OC 4M3BA 4CZCA 5JHUA 3V8KA 3LQQA 2LDUA 2XIGA 2QCOA 2Z2SB 3O3KA 4ZYGA 4XICA 2VBWA 3K4NA 1HDPA 3VSLA 3NARA 4EJVA 5E3LA 2A6EF 1V5GA 3JSOA 1SAXA 1ZHFA 3Q5FA 3OYDA 4AIKA 1VQ7I 2IBDA 3CLOA 1T98A 4GYGA 3ZQIA 2HXIA 1P9QC 3EQLF 5DS9A 4AVZA 5ILSA 2BXYA 3P9CA 4Y33A 2F4OB 4BBRJ 4CCKA 5C44J 5J4VA 3M9AA 3BZ6A 1X1DA 3GTPJ 3BP8A 1I1SA 2M4KA 2HYGD 3LOCA 1UG2A 2H94A 1DGWY 5DD8A 2HOTA 2JVGA 1YG2A 2QZ8A 3IV5A 5DCFA 2XDVA 3MN2A 3X2QH 4A0YA 3GX4X 1W1WE 2VC0A 1YJNI 5EJCA 4EEFG 5F64A 1TW3A 1HW5A 4LJZF 2ACJA 1RI7A 4PUSA 4BXUA 1M1EB 2DFHA 4EGZA 3OV8A 4L18B 3OS1A 2ZBKA 5EGOA 1HW2A 3VFZA 1I50J 2XKPA 1LB2A 5E20A 2H27A 4FQGA 2R5ZA 2F5EA 5FGMA 1E3HA 4XK4A 1XMXA 2R7DA 3GTMJ 2XSDC 1T95A 2JMWA 2NVXJ 3QU6A 2QWWA 2XB5A 4I0AA 2XKOA 3Q0WA 4BHBA 1KONA 4E4HA 4PGHA 4XOTA 5L3BA 2DJNA 4A6EA 3SZGA 1S29A 4M3GA 2CUJA 2OV7A 4V2GA 1K4TA 1JHHA 1WI9A 2JVHA 3KZZA 4BNCA 3J81Z 3LMMA 2O61A 1RIOH 1IN5A 3EUKL 4MTDA 5IPAA 3HC7A 4OIQF 4M6VA 1OCOH 2JN6A 3Q0UA 3BZKA 4I01A 1GVJA 1WH5A 4PSWA 1IXCA 3G1LA 1R00A 3VOEA 3M8EA 1JGGA 1J2XA 2ELHA 4A6DA 2K85A 4II2A 3IRQA 1ZREA 3PUFA 5BMZA 1USTA 1TQIA 4M71A 5IP7J 2WY7Q 3U21A 1K6YA 4HLYA 4OIOF 3R0AA 1MSFC 2KMUA 4Y7NJ 1SFEA 1TNTA 3A0HC 3G71I 4RDUA 2K9QA 4ITVA 3DKYA 1RC9A 2FBIA 4CICA 4NB5A 3A01B 2EB7A 1U6GA 1VQOI 1WJ5A 2MLGA 5DUKA 2M4GA 3GF2A 3LA2A 5HLGA 5TGTA 1F4KA 3DKXA 3PIOF 3ZMZA 4B43A 1WFXA 1J5YA 2EV5A 2A5WA 2OF7A 2FNAA 3HOSA 3NEUA 1HQCA 1IXSB 3S1RJ 1T0FA 4D9JA 3CCVI 3IKTA 5TRDA 1YOVB 4IHYA 1KQ8A 2L7ZA 3IP4B 5B66C 3ZR8X 2M7BA 3TBIA 1G2HA 1MH4A 3ML6A 2ZB9A 4L0ZB 5F1JA 2ZJPF 1X4PA 5LHGA 3DFGA 3QPTA 4ZTJA 3CCEI 2KIUA 1FLIA 3I3LA 2FUG2 1BOAA 2MD0A 5HLTA 4UVAA 2LFBA 2ZO4A 3L2QA 3FM5A 3V7CA 3CCSI 1O57A 4AIHA 3M3YJ 1ZR2A 2IJLA 2WAQN 1DQUA 3BJAA 2HYJA 3GMEA 4ZDLA 5FFXA 5HS9A 1FX7A 3JRHA 1XSXA 1YFHA 1I6XA 2CW0F 2I10A 1C0WA 4IL6C 4WWCA 1YQAA 2DK5A 2RNJA 1XMAA 2EIMH 2RN7A 4BQAA 1A5JA 5F08A 2J5PA 3TDZC 3RZDJ 3QPSA 3W2WA 2AXTC 5F0FA 3TL4X 4HZFA 1P4AA 3A03A 1X1CA 3PQJA 1SEUA 2FSWA 3K7AJ 4IKFA 2Z3YA 5JVTA 2VOOA 1FOXA 2VIXA 3FKIJ 1TL8A 4W97A 2CSOA 2XSJC 4UUTA 5F6FA 2M0MA 3K70D 1T8IA 1TNSA 1PYVA 3B02A 1RPWA 5BQTA 2A07F 1FYMA 2G9WA 3LA3A 3F21A 2UZKA 4I6ZA 4R1HA 1ZYRF 3S3OA 2JUCA 2MGQA 1IC8A 1BR4A 3WHCA 1T0FC 3DTIA 4L5JA 5J6XA 1XS9A 2XGEA 2JA2A 2O8KA 2Z5UA 2MH2A 1RR8C 1REPC 4OIRF 3CCUI 2BHYA 4RAFA 2E5ZA 2PJRB 4XKVA 1G3WA 4A3BJ 3CJTB 2RAEA 2DDBA 1IRZA 2MC4A 1ZGWA 1R71A 3FXQA 4OINF 2VBYA 2EIKH 1WJBA 3QPLA 5LFAA 5FJ8J 2A3SA 1YX3A 5E18F 2O03A 1ZARA 4LLGF 3H35A 4WX9A 2VKEA 1VQ9I 5L3GA 1W36C 3ZCOA 2GOXB 3RKQA 5M3FJ 2OUMA 2PN6A 2FQ3A 3PJRA 2O6GE 3AG1H 3I4PA 4DOZA 4I02A 1G59A 2Z16A 2QA4I 2FOWA 2HI3A 3GZ5A 4DJAA 3CMMA 1S7EA 4RB3C 4Y52J 2RQQA 2Y31A 3JTHA 3F8BA 3Q0VA 3H1CA 4HLXA 2N8GA 4CCOA 3BLYA 2M1BA 4M3DA 5IYBJ 2FX0A 1UCRA 1U8BA 2V7FA 2FXAA 4GYIA 2EFWA 1EH8A 3MFKA 1IRGA 1ORKA 2R93J 3HEFA 5CJ9A 2C6YA 1O3SA 1STZA 2LF8A 2E2IJ 3LNQA 3FMSA 1WZ2A 3K1MA 3C7JA 2OQGA 1YYVA 4PFOA 4L9VA 1E17A 4C3HJ 4LIVA 1MKMA 2DLLA 4UUSB 2DPDA 3F22A 2DQLA 3A4CA 4IXAA 4AYBA 3CMAI 3LWFA 4XL9A 1JKQC 4XM3A 1VQLI 4UY8I 1VFCA 1V5EA 3S93A 4FCYA 3L2VA 4LD5A 2A69F 3CMEI 2L3DA 4U0VA 2ESHA 1E3OC 2ICWG 5FRNA 4NHJA 1S8NA 3SFZA 3K4CA 3ZMVA 4F3QA 5HNFA 3I55I 5E8GA 3GXOA 1ITYA 4KJZA 4ENJA 1JXSA 1Z7UA 1MBKA 2P5LC 2LKXA 1XC5A
chains in the Genus database with same CATH topology
2XASA 3HTSB 2M87A 2QENA 1B4AA 2QLZA 3BPXA 3SZTA 5LGNA 1FBQA 2BV6A 2NS0A 4LLNA 4LLLA 2AS5F 1G4DA 3V4GA 5D8KB 1YW9A 1ZGAA 1R22A 2CO5A 1DPRA 1MJ9A 3BDDA 1PDNC 3WE3A 2EFOA 1BC7C 1SD4A 4IJAA 3QP6A 1TTYA 3GW2A 1H0MA 2G7UA 3SZPA 1RZ4A 3RJPA 1ULYA 3C18A 2UXNA 1T38A 5CYVA 3VEPA 2KJBA 2Q0OA 3MZYA 3O6BB 3BJ6A 4ZYDA 3TGNA 3K2ZA 2LF7A 1Q1HA 1K79A 2BYVE 2K02A 4G94A 2EFNA 1U8RA 3HHGA 1AWCA 2Q8KA 1QZZA 4IHTA 5LEKA 4ESFA 1RUOA 1BIAA 2YX4A 2QVOA 2CWEA 1KU3A 2JZYA 1GXQA 1FWZA 2VODA 3FM3A 4I98B 5DEQA 3EETA 1FOKA 1I27A 1P2FA 1R7JA 2D1HA 4P55A 3I58A 5E17F 4ENKA 1FZPB 2JPCA 2JSCA 5AIQA 2VE8A 4ENNA 2FA5A 4BYYA 3VODA 2FRHA 1G3YA 1B6AA 1I1GA 4A2UA 3KETA 3DPLC 3L2CA 2HYFA 4B09A 1G3TA 4EJUA 1YS6A 3F6VA 4XLNF 3RIRA 3HRTA 3HSFA 4YIIA 5A2QZ 3HYIA 1NHAA 1T39A 3SHFA 4O5VA 4OMZA 1UHMA 2ADUA 4KIBA 1K78B 1U5TA 4LB5A 2ISZA 4HW0A 2HDCA 3GFLA 1W4MA 2HTJA 1XDUA 4U7BA 1SFUA 2X0LA 3KP3A 1O3TA 1BI2A 3HSEA 1MDMB 1DPUA 4WXCA 1OR7A 5L3DA 2XRNA 1ONVA 3RDIA 1KYWA 4KN7X 1D8JA 3V8LA 5HS7A 1FBSA 2IP2A 4HOBA 4OOIA 4L5IA 3GZ6A 4ZZDA 1VTNC 2M5WA 4WCGA 4N9IA 1B1BA 1GHCA 3ABTA 1B9NA 1IN8A 4OIPF 2ZXJA 2Y75A 3D5LA 1T2KA 2PJPA 4LG0B 4G7OF 3U2RA 3KFWX 2LKPA 1IXRC 4QWQA 4U88A 3OOPA 1OYYA 1U78A 2IT0A 4O6JA 1IRFA 1SFXA 4MTEA 3CO7C 2EWNA 2XUBA 3GVAA 5DCMB 1TBXA 1TLHB 2WWYA 3K1PA 3R60A 1DUXC 2BEOA 5D4RA 3KLOA 2DI3A 1R5GA 2D45A 3BOQA 3ERED 1QBJA 1H9TA 4PGGA 1FYLA 1LDKB 4G6QA 4EQQA 1J9IA 1KU7A 4GXOA 2EK5A 3MZHA 4RAYA 1MJAA 4MEYF 1F9NA 1XMKA 4A5NA 4Y15A 2LNBA 1K6OA 5CVJA 4FX4A 3FMRA 1IF1A 1IW7F 3ZP5A 4KN4X 3QU3A 3HRSA 2O0YA 4HBLA 2WTEA 4XSZF 2FBKA 4KDPA 1ZAOA 3TKYA 1YTYA 1HSTA 4P9FA 2F5DA 4CXFA 4R79A 2GIVA 1IN6A 5IT9Z 1FT9A 3N97A 3DXJF 3GFJA 3JTGA 1HSJA 1YS7A 2GWRA 4LG0A 3BY6A 3K69A 1P4WA 5D5XB 2STTA 3J80Z 5ICFA 4HV5A 1Z91A 3J7AO 1P92A 1X3UA 1IAWA 4Z2YA 1I5ZA 5D5VB 4IRIA 2KIFA 4UVBA 1B9MA 1OMIA 1Z9CA 2EA4A 5EEHA 1MGTA 4MHGA 3JSPA 1FYKA 5K5OA 4JBAA 1ZLKA 1R23A 3B73A 5FFZA 3CUQA 4RGRA 3FXUA 4QLCU 2Y48A 1RNLA 5BOXA 1XB4A 3E6DA 2CFXA 1YW7A 1W5SA 1K7AA 2DQRA 1FP1D 2PFBA 2O8XA 1XGMA 1W7PD 4BAYA 2COMA 3AAFA 1LJ9A 1WQ2A 2DAOA 2B0LA 3Q9SA 2V6CA 2P7CB 3E3VA 4I0BA 3H3ZA 5H6QA 2OZ6A 2DFIA 3H92A 4LGWA 5K5QA 2W25A 2HZTA 4F7ZA 1USSA 1J7KA 4AWXB 3LQRA 4MQVA 3I5UA 4PZJA 2VONA 5LHIA 5ED4A 4U7DA 4ZYHA 4E70A 2ZJ2A 5EEGA 2GZWA 1W7PA 3DP7A 2E7WA 2P5KA 2NNNA 4HYEA 3DKWA 2BGCA 4EV0A 4YIFA 2PMUA 3HTUA 1OYIA 2OU2A 2BE5F 2STWA 4KMUX 3IWZA 3EUHA 3IRRA 2VXZA 2A5YB 3F8FA 1O7LA 4G7ZF 4UHTA 2VT3A 3GUDA 1YO5C 2QBYA 3LAPA 1ON2A 2K4BA 3GLXA 1FSHA 5LBQA 2W85A 2FMYA 4B8XA 2CYYA 1SMYF 2Z33A 3ZPLA 1R58A 3COAC 4Q48A 4GO1A 3JAMZ 1ZRDA 2P7VB 3FWEA 1GXPA 4EM0B 1BIBA 4ZYEA 3O2PE 4GGGA 2GQQA 3WU1B 2FE3A 2V1DA 3QPHA 3F6OA 3QOPA 3G73A 4XRFA 2HQNA 2FBHA 3C1DA 3HOTA 4UV9A 4G9YA 3QP5A 5JR3A 2DTRA 1MD0A 3LA7A 1SD5A 2DU9A 2DBBA 3ZMDA 4RAZA 3KP7A 2OD5A 3E5UA 2F5FA 2KRFA 1F5TA 4HX7A 2IA0A 3K1NA 4KICA 2E1CA 3IC7A 3M8FA 1RUNA 1LDDA 3V7RA 1Y0UA 4IRGA 5L3EA 5DCMA 5HDGA 1S7OA 1XGNA 2WC2A 2O3FA 3KP5A 3ECHA 1XGOA 2DW4A 1IUYA 3VB2A 4LFUA 1Z1DA 4YG2F 2VE9A 2HFHA 5LGUA 3F8NA 2V79A 2V1UA 1WSUA 4I2OA 1BI0A 1YLFA 1BI1A 5FO5A 1O7FA 2QBYB 4PCQA 1JHFA 2OZUA 5FB2A 1B59A 1ON1A 3TDUC 1V4RA 2BBYA 3QRFF 4HF0A 3FHZA 2PI0A 2CGPA 5LHHA 2M8EA 3ZMTA 4P5OA 4M72A 1QQIA 1E2XA 4EJTA 2IW5A 1MZBA 1R36A 3F23A 1H9GA 5H20A 1KA8A 5FD5A 3HRMA 4A0ZA 3I59A 4ESJA 2OQRA 1LEAA 4EM2A 2W24A 3CTAA 3DPTA 3IL2A 3W6KB 4CHUA 4TV7A 3J81K 4ETSA 1BM9A 2IRFG 3T0YA 4KT5C 1BC8C 3T5XA 3J80K 2GA2A 1CF7A 3MEXA 3KLNA 4PDKA 3RI4A 4RB0A 1EH7A 5LEJA 4AVPA 3WTSC 2ESNA 1XGSA 2UXXA 1TQPA 4ON0A 2GA1A 3MQ0A 4YFXF 2EFPA 1ZH5A 4RGSA 1WKMA 3KEOA 3TOBA 3KP2A 4OU0A 1KQ0A 2PMHA 3KE2A 1YIOA 4EMSA 5DD4A 2JTVA 1UFMA 3WTWC 2FMLA 3BROA 3FXRA 5ICGA 3MAJA 4G8XA 2M45A 1O3QA 3RKWA 4S05A 2ZNZA 1IN7A 2GXBA 2HKOA 3SXYA 2XAQA 4XLPF 3ABUA 5L3CA 3H3UA 1CF7B 3LSTA 1CGPA 1XSVA 1FP2A 1R5HA 3ECOA 3HRUA 4Q5SF 4LK0F 1A04A 5DV5A 2DT5A 2ETHA 4H0EA 4Q4ZF 1QZYA 3FF5A 3MWMA 2A6HF 1HKQA 1F1ZA 1MJBA 1MDMA 2TDXA 2H09A 3E6CC 4HX4A 5LRRA 1G3SA 4R8HA 1R1TA 3HHHA 1SMTA 2RV8A 1HXDA 3KCCA 4KUMA 4AIJA 1DDNA 2MH9A 2LSOA 1BJAA 5CVVA 1P6RA 3I53A 4LMYA 1UHWA 5JFRA 1D5VA 5FLXK 4BHPA 5LGTA 2KKOA 2YSRA 3REOA 3I64A 2NAZA 3KP4A 4M6XA 1LVAA 3P7NA 2IVMA 1KGSA 1R1VA 5ICEA 4XSXF 2NRAC 2VBXA 4FX0A 2E7XA 5CVRA 4KYWA 4M6YA 4UNOA 1FC3A 4HQEA 3JW4A 3KEQA 2P6TA 2K7LA 1ZRCA 2MC3A 4ASNA 4L0YB 2F2EA 3LAJA 3GFIA 5H6RA 5E1XA 1G6NA 3ZN1A 4N0BA 4UXNA 4MNUA 2P5LC 4HQMA 5HOOA 4HF1A 3TO9A 3R61A 5FLXZ 1FPQA 2IA2A 2K86A 4MQ9F 3F72A 3FX3A 3IHUA 2AXLA 5BPIA 3F8CA 4HF2A 4P96A 4CYDA 4UVCA 4WK8F 3EDPA 4EGYA 3RPQA 4M9XA 2XROA 4Y17A 3EYYA 4S04A 2KJCA 2HQRA 1YW8A 3NRVA 4P9UA 3M7GA 2NNYA 2WV0A 5CLSA 1HBXG 4KA4A 2VC1A 2UWMA 3L7WA 4M9ZA 3M1EA 3GFMA 1D3YA 4EJOA 3WG9A 5KK1A 4DNCA 1HKSA 3WTYC 2EJRA 1K78A 2PQ8A 2CG4A 1PP8F 3SQNA 1HW1A 2EV6A 4D0PA 2QQAA 4HV6A 4MGRA 3WTXC 4EM1A 3GWZA 1UB9A 1QNTA 3R0JA 1T6SA 4N9HA 2P4WA 5TJJA 5BPDA 3K9TA 3HUGA 2L4AA 2PEXA 1ZG5A 2K4JA 3HIFA 3ROUA 4XBFA 3JAMK 1OYWA 1W7PB 3ZMUA 1S3JA 2ZFWA 3L9FA 2VOPA 3EYIA 5HDNA 2HR3A 3IWFA 1Z6TA 2VT2A 3G3ZA 3ULQB 2OBPA 5A2QK 5D6EA 4HDVA 5J8FA 4A12A 3CUQB 1LNWA 3WTVC 2FF4A 3S2WA 5HDKA 3KP6A 4ZZLA 4Y13A 3I54A 4A5MA 3QAHA 2PLYA 2L02A 4U0YA 3T8RA 3CO6C 3ZMSA 3KZYA 2Z9OA 3K0LA 3WTUC 2QYOA 3L09A 2R7FA 3TQNA 2FEZA 1AOYA 3N4MA 3E6BA 5ICCA 5LRSA 4ESBA 4ZH4F 4M9SA 2RKHA 2V1XA 2K27A 1V3FA 3I0TA 5AIPA 2DO7A 3DEUA 3GO5A 2P5VA 2JT1A 2D1VA 2H6CA 4FHTA 1ZLJA 5HVQC 5D6FA 1XCBA 1ZGJA 5ERIA 5CVUA 3GYHX 2RGVA 2DPUA 5BS6A 4IHSA 2QM3A 5L3FA 2ISYA 2YX7A 4HA8A 3TOAA 1FY7A 2DK8A 2P8TA 2ZNYA 5K5RA 2MD5A 4I09A 3CJNA 1U5TC 2EA2A 2JRTA 3RTRA 4CGZA 4FT8A 2YPRA 4KMFA 5ILVA 4RGUA 3WU0A 2HOEA 4EVIA 1OPCA 2W57A 4BH9A 4KFCA 1L3LA 3BPVA 1JE8A 3IKVA 4JQFA 4LB6B 3WGIA 4HX8A 1QO0D 3F8MA 2RVCA 1J59A 1S7AA 2E1NA 3C3WA 1PUEE 4UV8A 4AD9A 2YR2A 2VN2A 1XDSA 3U9GA 2F5CA 2GXGA 5HS8A 5K1YA 4HAMA 3WE2A 2A68F 1IN4A 2XAGA 1XCVA 2EFQA 5AONA 6PAXA 4BHCA 3ZQ7A 1KQ9A 3I59B 2ZMEB 3LFKA 2M30A 4CO8A 3T8TA 5E1ZB 2L4MA 4L9NA 1U3EM 5DUIA 1LEBA 3W6JB 4GCVA 2YU3A 4KIFA 1FBUA 5HLHA 2HTSA 4G7HF 2KIMA 4LK1F 2XGXA 1QGPA 4CZZA 2FOKA 3CDHA 3DV8A 1W5TA 2D2WA 2HEOA 2XHKA 1U5TB 2NYXA 3WTTC 3U1DA 4MEXF 2ZKZA 5KVRA 1BN5A 1KU9A 2RQPA 2QUFA 2HKXA 2FU4A 3ZN0A 4RGXA 3T1BA 4HDUA 3TO7A 4Q47A 4L9TA 4WXDA 2H6BA 1WRJA 1J0RA 1ODDA 5E8IA 3FMQA 1Z05A 1ZG1A 3E6MA 5D5WB 4IRHA 4A0XA 2HS5A 2R3SA 3DF8A 5DYMA 1TW2A 2RDPA 1IZ1A 1OKRA 1O3RA 3PQKA 3PFIA 2XAHA 4K2EA 5HLIA 4M74A 3V7SA 2XAFA 1LQ1A 5D4SA 2X4HA 1WWXA 2L54A 2QQ9A 3BJOA 5D8LB 2XAJA 2OAZA 1KYZA 2G7HA 1XD7A 1P4XA 4RB1A 5FD6A 3P9IA 5D5UB 3WODF 3HSRA 1DP7P 2Z99A 2XVCA 2MA3A 4ENMA 4WXHA 4M73A 2OA4A 2W84A 3CUQC 2P6SA 1SD6A 1FNNA 2EV0A 3CUOA 4I7HA 3Q9VA 3L00A 1EH6A 4YFKF 1J75A 2XV4S 4JK1X 3E5QA 3RKXA 4IPAA 2QQBA 3GEZA 1XN7A 1EV7A 5J8CA 2J5OA 3RYPA 3WGHA 1QPMA 1LDJA 1KU2A 2Q2EA 1BI3A 2VBZA 2HWVA 3F3XA 2CQKA 1FSEA 3P9KA 3TO6A 2V9VA 2IPQX 2L01A 3RPUA 5ILUA 4O3MA 1HKTA 3D0SA 4YFNF 1ZG3A 4OMYA 5F1RA 5DDGA 4KIGA 3MCZA 2PBIA 4RS8A 5LLQA 3FZVA 4EJWA 2PG4A 5JI6A 3NQOA 4IF4A 1SD7A 1TQMA 3E5XA 1ZN2A 2MBFA 3R6SA 3ISPA 4WF2A 1ZRFA 1U2WA 3WTZA 3DQVC 4NQWA 3RYRA 4RB2C 2HGCA 4IVNA 2A61A 4U0WA 1XSDA 2GAUA 4UUVA 1PP7U 2ZMEA 4DQ2A 3RKYA 1D8KA 3R4KA 1BBYA 4L9JA 2ZCWA 3E97A 3I71A 2FNPA 3ELKA 1Z6RA 5IT3A 1S6LA 3V8JA 2MLKA 4CDGA 2IA1A 4G6DA 2JPBA 3BWGA 2RC4A 1JGSA 5CVIA 2Y0MA 3WGGA 1R1UA 1L0OC 5JHUA 3V8KA 3LQQA 2LDUA 2XIGA 3O3KA 4ZYGA 2VBWA 4EJVA 2A6EF 3JSOA 1SAXA 1ZHFA 3Q5FA 4AIKA 3CLOA 1T98A 4GYGA 3EQLF 5ILSA 3P9CA 3M9AA 3BZ6A 3BP8A 1I1SA 2HYGD 2H94A 5DD8A 1YG2A 2QZ8A 5DCFA 4A0YA 3GX4X 2VC0A 5F64A 1TW3A 1HW5A 4LJZF 2ACJA 1RI7A 4BXUA 4EGZA 3OV8A 4L18B 2ZBKA 1HW2A 3VFZA 2XKPA 1LB2A 5E20A 2H27A 2F5EA 5FGMA 2R7DA 3QU6A 2QWWA 4I0AA 2XKOA 4BHBA 4PGHA 5L3BA 4A6EA 1S29A 1JHHA 1WI9A 3KZZA 4BNCA 3J81Z 2O61A 1RIOH 1IN5A 4MTDA 4OIQF 4I01A 1GVJA 1IXCA 1R00A 3VOEA 3M8EA 1J2XA 2ELHA 4A6DA 3IRQA 1ZREA 5BMZA 1USTA 1TQIA 4M71A 4HLYA 4OIOF 3R0AA 1SFEA 1TNTA 2FBIA 4CICA 4NB5A 2EB7A 1U6GA 2MLGA 5DUKA 3GF2A 3LA2A 5HLGA 1F4KA 3ZMZA 1J5YA 2EV5A 2FNAA 3HOSA 3NEUA 1HQCA 1IXSB 1T0FA 3IKTA 5TRDA 1KQ8A 3ML6A 4L0ZB 5LHGA 3DFGA 3QPTA 2KIUA 1FLIA 1BOAA 4UVAA 2ZO4A 3FM5A 3V7CA 1O57A 4AIHA 2IJLA 3BJAA 5FFXA 5HS9A 1FX7A 1XSXA 1YFHA 1I6XA 2CW0F 1C0WA 4WWCA 1YQAA 2DK5A 2RNJA 1XMAA 2RN7A 4BQAA 2J5PA 3TDZC 4HZFA 1P4AA 3PQJA 2FSWA 2Z3YA 5JVTA 2VOOA 2CSOA 5F6FA 1TNSA 3B02A 5BQTA 2A07F 1FYMA 2G9WA 3LA3A 3F21A 2UZKA 4R1HA 1ZYRF 4L5JA 5J6XA 2Z5UA 2MH2A 1REPC 4OIRF 1G3WA 3FXQA 4OINF 2VBYA 2A3SA 5E18F 2O03A 1ZARA 4LLGF 4WX9A 5L3GA 2PN6A 2FQ3A 2O6GE 3I4PA 4I02A 3GZ5A 4RB3C 3JTHA 3F8BA 4HLXA 2M1BA 1UCRA 2FXAA 4GYIA 2EFWA 1EH8A 3MFKA 1IRGA 5CJ9A 2C6YA 1O3SA 1STZA 2LF8A 3FMSA 3K1MA 3C7JA 2OQGA 1YYVA 4L9VA 1E17A 1MKMA 2DLLA 2DPDA 3F22A 2DQLA 4IXAA 5IT9K 3LWFA 4LD5A 2A69F 2L3DA 4U0VA 2ESHA 4NHJA 1S8NA 3SFZA 3ZMVA 5E8GA 3GXOA 4ENJA 1JXSA 1Z7UA 4KNYA 5E1WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAS A;  3HTS B;  2M87 A;  2QEN A;  1B4A A;  2QLZ A;  3BPX A;  3SZT A;  5LGN A;  1FBQ A;  2BV6 A;  2NS0 A;  4LLN A;  4LLL A;  2AS5 F;  1G4D A;  3V4G A;  5D8K B;  1YW9 A;  1ZGA A;  1R22 A;  2CO5 A;  1DPR A;  1MJ9 A;  3BDD A;  1PDN C;  3WE3 A;  2EFO A;  1BC7 C;  1SD4 A;  4IJA A;  3QP6 A;  1TTY A;  3GW2 A;  1H0M A;  2G7U A;  3SZP A;  1RZ4 A;  3RJP A;  1ULY A;  3C18 A;  2UXN A;  1T38 A;  5CYV A;  3VEP A;  2KJB A;  2Q0O A;  3MZY A;  3O6B B;  3BJ6 A;  4ZYD A;  3TGN A;  3K2Z A;  2LF7 A;  1Q1H A;  1K79 A;  2BYV E;  2K02 A;  4G94 A;  2EFN A;  1U8R A;  3HHG A;  1AWC A;  2Q8K A;  1QZZ A;  4IHT A;  5LEK A;  4ESF A;  1RUO A;  1BIA A;  2YX4 A;  2QVO A;  2CWE A;  1KU3 A;  2JZY A;  1GXQ A;  1FWZ A;  2VOD A;  3FM3 A;  4I98 B;  5DEQ A;  3EET A;  1FOK A;  1I27 A;  1P2F A;  1R7J A;  2D1H A;  4P55 A;  3I58 A;  5E17 F;  4ENK A;  1FZP B;  2JPC A;  2JSC A;  5AIQ A;  2VE8 A;  4ENN A;  2FA5 A;  4BYY A;  3VOD A;  2FRH A;  1G3Y A;  1B6A A;  1I1G A;  4A2U A;  3KET A;  3DPL C;  3L2C A;  2HYF A;  4B09 A;  1G3T A;  4EJU A;  1YS6 A;  3F6V A;  4XLN F;  3RIR A;  3HRT A;  3HSF A;  4YII A;  5A2Q Z;  3HYI A;  1NHA A;  1T39 A;  3SHF A;  4O5V A;  4OMZ A;  1UHM A;  2ADU A;  4KIB A;  1K78 B;  1U5T A;  4LB5 A;  2ISZ A;  4HW0 A;  2HDC A;  3GFL A;  1W4M A;  2HTJ A;  1XDU A;  4U7B A;  1SFU A;  2X0L A;  3KP3 A;  1O3T A;  1BI2 A;  3HSE A;  1MDM B;  1DPU A;  4WXC A;  1OR7 A;  5L3D A;  2XRN A;  1ONV A;  3RDI A;  1KYW A;  4KN7 X;  1D8J A;  3V8L A;  5HS7 A;  1FBS A;  2IP2 A;  4HOB A;  4OOI A;  4L5I A;  3GZ6 A;  4ZZD A;  1VTN C;  2M5W A;  4WCG A;  4N9I A;  1B1B A;  1GHC A;  3ABT A;  1B9N A;  1IN8 A;  4OIP F;  2ZXJ A;  2Y75 A;  3D5L A;  1T2K A;  2PJP A;  4LG0 B;  4G7O F;  3U2R A;  3KFW X;  2LKP A;  1IXR C;  4QWQ A;  4U88 A;  3OOP A;  1OYY A;  1U78 A;  2IT0 A;  4O6J A;  1IRF A;  1SFX A;  4MTE A;  3CO7 C;  2EWN A;  2XUB A;  3GVA A;  5DCM B;  1TBX A;  1TLH B;  2WWY A;  3K1P A;  3R60 A;  1DUX C;  2BEO A;  5D4R A;  3KLO A;  2DI3 A;  1R5G A;  2D45 A;  3BOQ A;  3ERE D;  1QBJ A;  1H9T A;  4PGG A;  1FYL A;  1LDK B;  4G6Q A;  4EQQ A;  1J9I A;  1KU7 A;  4GXO A;  2EK5 A;  3MZH A;  4RAY A;  1MJA A;  4MEY F;  1F9N A;  1XMK A;  4A5N A;  4Y15 A;  2LNB A;  1K6O A;  5CVJ A;  4FX4 A;  3FMR A;  1IF1 A;  1IW7 F;  3ZP5 A;  4KN4 X;  3QU3 A;  3HRS A;  2O0Y A;  4HBL A;  2WTE A;  4XSZ F;  2FBK A;  4KDP A;  1ZAO A;  3TKY A;  1YTY A;  1HST A;  4P9F A;  2F5D A;  4CXF A;  4R79 A;  2GIV A;  1IN6 A;  5IT9 Z;  1FT9 A;  3N97 A;  3DXJ F;  3GFJ A;  3JTG A;  1HSJ A;  1YS7 A;  2GWR A;  4LG0 A;  3BY6 A;  3K69 A;  1P4W A;  5D5X B;  2STT A;  3J80 Z;  5ICF A;  4HV5 A;  1Z91 A;  3J7A O;  1P92 A;  1X3U A;  1IAW A;  4Z2Y A;  1I5Z A;  5D5V B;  4IRI A;  2KIF A;  4UVB A;  1B9M A;  1OMI A;  1Z9C A;  2EA4 A;  5EEH A;  1MGT A;  4MHG A;  3JSP A;  1FYK A;  5K5O A;  4JBA A;  1ZLK A;  1R23 A;  3B73 A;  5FFZ A;  3CUQ A;  4RGR A;  3FXU A;  4QLC U;  2Y48 A;  1RNL A;  5BOX A;  1XB4 A;  3E6D A;  2CFX A;  1YW7 A;  1W5S A;  1K7A A;  2DQR A;  1FP1 D;  2PFB A;  2O8X A;  1XGM A;  1W7P D;  4BAY A;  2COM A;  3AAF A;  1LJ9 A;  1WQ2 A;  2DAO A;  2B0L A;  3Q9S A;  2V6C A;  2P7C B;  3E3V A;  4I0B A;  3H3Z A;  5H6Q A;  2OZ6 A;  2DFI A;  3H92 A;  4LGW A;  5K5Q A;  2W25 A;  2HZT A;  4F7Z A;  1USS A;  1J7K A;  4AWX B;  3LQR A;  4MQV A;  3I5U A;  4PZJ A;  2VON A;  5LHI A;  5ED4 A;  4U7D A;  4ZYH A;  4E70 A;  2ZJ2 A;  5EEG A;  2GZW A;  1W7P A;  3DP7 A;  2E7W A;  2P5K A;  2NNN A;  4HYE A;  3DKW A;  2BGC A;  4EV0 A;  4YIF A;  2PMU A;  3HTU A;  1OYI A;  2OU2 A;  2BE5 F;  2STW A;  4KMU X;  3IWZ A;  3EUH A;  3IRR A;  2VXZ A;  2A5Y B;  3F8F A;  1O7L A;  4G7Z F;  4UHT A;  2VT3 A;  3GUD A;  1YO5 C;  2QBY A;  3LAP A;  1ON2 A;  2K4B A;  3GLX A;  1FSH A;  5LBQ A;  2W85 A;  2FMY A;  4B8X A;  2CYY A;  1SMY F;  2Z33 A;  3ZPL A;  1R58 A;  3COA C;  4Q48 A;  4GO1 A;  3JAM Z;  1ZRD A;  2P7V B;  3FWE A;  1GXP A;  4EM0 B;  1BIB A;  4ZYE A;  3O2P E;  4GGG A;  2GQQ A;  3WU1 B;  2FE3 A;  2V1D A;  3QPH A;  3F6O A;  3QOP A;  3G73 A;  4XRF A;  2HQN A;  2FBH A;  3C1D A;  3HOT A;  4UV9 A;  4G9Y A;  3QP5 A;  5JR3 A;  2DTR A;  1MD0 A;  3LA7 A;  1SD5 A;  2DU9 A;  2DBB A;  3ZMD A;  4RAZ A;  3KP7 A;  2OD5 A;  3E5U A;  2F5F A;  2KRF A;  1F5T A;  4HX7 A;  2IA0 A;  3K1N A;  4KIC A;  2E1C A;  3IC7 A;  3M8F A;  1RUN A;  1LDD A;  3V7R A;  1Y0U A;  4IRG A;  5L3E A;  5DCM A;  5HDG A;  1S7O A;  1XGN A;  2WC2 A;  2O3F A;  3KP5 A;  3ECH A;  1XGO A;  2DW4 A;  1IUY A;  3VB2 A;  4LFU A;  1Z1D A;  4YG2 F;  2VE9 A;  2HFH A;  5LGU A;  3F8N A;  2V79 A;  2V1U A;  1WSU A;  4I2O A;  1BI0 A;  1YLF A;  1BI1 A;  5FO5 A;  1O7F A;  2QBY B;  4PCQ A;  1JHF A;  2OZU A;  5FB2 A;  1B59 A;  1ON1 A;  3TDU C;  1V4R A;  2BBY A;  3QRF F;  4HF0 A;  3FHZ A;  2PI0 A;  2CGP A;  5LHH A;  2M8E A;  3ZMT A;  4P5O A;  4M72 A;  1QQI A;  1E2X A;  4EJT A;  2IW5 A;  1MZB A;  1R36 A;  3F23 A;  1H9G A;  5H20 A;  1KA8 A;  5FD5 A;  3HRM A;  4A0Z A;  3I59 A;  4ESJ A;  2OQR A;  1LEA A;  4EM2 A;  2W24 A;  3CTA A;  3DPT A;  3IL2 A;  3W6K B;  4CHU A;  4TV7 A;  3J81 K;  4ETS A;  1BM9 A;  2IRF G;  3T0Y A;  4KT5 C;  1BC8 C;  3T5X A;  3J80 K;  2GA2 A;  1CF7 A;  3MEX A;  3KLN A;  4PDK A;  3RI4 A;  4RB0 A;  1EH7 A;  5LEJ A;  4AVP A;  3WTS C;  2ESN A;  1XGS A;  2UXX A;  1TQP A;  4ON0 A;  2GA1 A;  3MQ0 A;  4YFX F;  2EFP A;  1ZH5 A;  4RGS A;  1WKM A;  3KEO A;  3TOB A;  3KP2 A;  4OU0 A;  1KQ0 A;  2PMH A;  3KE2 A;  1YIO A;  4EMS A;  5DD4 A;  2JTV A;  1UFM A;  3WTW C;  2FML A;  3BRO A;  3FXR A;  5ICG A;  3MAJ A;  4G8X A;  2M45 A;  1O3Q A;  3RKW A;  4S05 A;  2ZNZ A;  1IN7 A;  2GXB A;  2HKO A;  3SXY A;  2XAQ A;  4XLP F;  3ABU A;  5L3C A;  3H3U A;  1CF7 B;  3LST A;  1CGP A;  1XSV A;  1FP2 A;  1R5H A;  3ECO A;  3HRU A;  4Q5S F;  4LK0 F;  1A04 A;  5DV5 A;  2DT5 A;  2ETH A;  4H0E A;  4Q4Z F;  1QZY A;  3FF5 A;  3MWM A;  2A6H F;  1HKQ A;  1F1Z A;  1MJB A;  1MDM A;  2TDX A;  2H09 A;  3E6C C;  4HX4 A;  5LRR A;  1G3S A;  4R8H A;  1R1T A;  3HHH A;  1SMT A;  2RV8 A;  1HXD A;  3KCC A;  4KUM A;  4AIJ A;  1DDN A;  2MH9 A;  2LSO A;  1BJA A;  5CVV A;  1P6R A;  3I53 A;  4LMY A;  1UHW A;  5JFR A;  1D5V A;  5FLX K;  4BHP A;  5LGT A;  2KKO A;  2YSR A;  3REO A;  3I64 A;  2NAZ A;  3KP4 A;  4M6X A;  1LVA A;  3P7N A;  2IVM A;  1KGS A;  1R1V A;  5ICE A;  4XSX F;  2NRA C;  2VBX A;  4FX0 A;  2E7X A;  5CVR A;  4KYW A;  4M6Y A;  4UNO A;  1FC3 A;  4HQE A;  3JW4 A;  3KEQ A;  2P6T A;  2K7L A;  1ZRC A;  2MC3 A;  4ASN A;  4L0Y B;  2F2E A;  3LAJ A;  3GFI A;  5H6R A;  5E1X A;  1G6N A;  3ZN1 A;  4N0B A;  4UXN A;  4MNU A;  2P5L C;  4HQM A;  5HOO A;  4HF1 A;  3TO9 A;  3R61 A;  5FLX Z;  1FPQ A;  2IA2 A;  2K86 A;  4MQ9 F;  3F72 A;  3FX3 A;  3IHU A;  2AXL A;  5BPI A;  3F8C A;  4HF2 A;  4P96 A;  4CYD A;  4UVC A;  4WK8 F;  3EDP A;  4EGY A;  3RPQ A;  4M9X A;  2XRO A;  4Y17 A;  3EYY A;  4S04 A;  2KJC A;  2HQR A;  1YW8 A;  3NRV A;  4P9U A;  3M7G A;  2NNY A;  2WV0 A;  5CLS A;  1HBX G;  4KA4 A;  2VC1 A;  2UWM A;  3L7W A;  4M9Z A;  3M1E A;  3GFM A;  1D3Y A;  4EJO A;  3WG9 A;  5KK1 A;  4DNC A;  1HKS A;  3WTY C;  2EJR A;  1K78 A;  2PQ8 A;  2CG4 A;  1PP8 F;  3SQN A;  1HW1 A;  2EV6 A;  4D0P A;  2QQA A;  4HV6 A;  4MGR A;  3WTX C;  4EM1 A;  3GWZ A;  1UB9 A;  1QNT A;  3R0J A;  1T6S A;  4N9H A;  2P4W A;  5TJJ A;  5BPD A;  3K9T A;  3HUG A;  2L4A A;  2PEX A;  1ZG5 A;  2K4J A;  3HIF A;  3ROU A;  4XBF A;  3JAM K;  1OYW A;  1W7P B;  3ZMU A;  1S3J A;  2ZFW A;  3L9F A;  2VOP A;  3EYI A;  5HDN A;  2HR3 A;  3IWF A;  1Z6T A;  2VT2 A;  3G3Z A;  3ULQ B;  2OBP A;  5A2Q K;  5D6E A;  4HDV A;  5J8F A;  4A12 A;  3CUQ B;  1LNW A;  3WTV C;  2FF4 A;  3S2W A;  5HDK A;  3KP6 A;  4ZZL A;  4Y13 A;  3I54 A;  4A5M A;  3QAH A;  2PLY A;  2L02 A;  4U0Y A;  3T8R A;  3CO6 C;  3ZMS A;  3KZY A;  2Z9O A;  3K0L A;  3WTU C;  2QYO A;  3L09 A;  2R7F A;  3TQN A;  2FEZ A;  1AOY A;  3N4M A;  3E6B A;  5ICC A;  5LRS A;  4ESB A;  4ZH4 F;  4M9S A;  2RKH A;  2V1X A;  2K27 A;  1V3F A;  3I0T A;  5AIP A;  2DO7 A;  3DEU A;  3GO5 A;  2P5V A;  2JT1 A;  2D1V A;  2H6C A;  4FHT A;  1ZLJ A;  5HVQ C;  5D6F A;  1XCB A;  1ZGJ A;  5ERI A;  5CVU A;  3GYH X;  2RGV A;  2DPU A;  5BS6 A;  4IHS A;  2QM3 A;  5L3F A;  2ISY A;  2YX7 A;  4HA8 A;  3TOA A;  1FY7 A;  2DK8 A;  2P8T A;  2ZNY A;  5K5R A;  2MD5 A;  4I09 A;  3CJN A;  1U5T C;  2EA2 A;  2JRT A;  3RTR A;  4CGZ A;  4FT8 A;  2YPR A;  4KMF A;  5ILV A;  4RGU A;  3WU0 A;  2HOE A;  4EVI A;  1OPC A;  2W57 A;  4BH9 A;  4KFC A;  1L3L A;  3BPV A;  1JE8 A;  3IKV A;  4JQF A;  4LB6 B;  3WGI A;  4HX8 A;  1QO0 D;  3F8M A;  2RVC A;  1J59 A;  1S7A A;  2E1N A;  3C3W A;  1PUE E;  4UV8 A;  4AD9 A;  2YR2 A;  2VN2 A;  1XDS A;  3U9G A;  2F5C A;  2GXG A;  5HS8 A;  5K1Y A;  4HAM A;  3WE2 A;  2A68 F;  1IN4 A;  2XAG A;  1XCV A;  2EFQ A;  5AON A;  6PAX A;  4BHC A;  3ZQ7 A;  1KQ9 A;  3I59 B;  2ZME B;  3LFK A;  2M30 A;  4CO8 A;  3T8T A;  5E1Z B;  2L4M A;  4L9N A;  1U3E M;  5DUI A;  1LEB A;  3W6J B;  4GCV A;  2YU3 A;  4KIF A;  1FBU A;  5HLH A;  2HTS A;  4G7H F;  2KIM A;  4LK1 F;  2XGX A;  1QGP A;  4CZZ A;  2FOK A;  3CDH A;  3DV8 A;  1W5T A;  2D2W A;  2HEO A;  2XHK A;  1U5T B;  2NYX A;  3WTT C;  3U1D A;  4MEX F;  2ZKZ A;  5KVR A;  1BN5 A;  1KU9 A;  2RQP A;  2QUF A;  2HKX A;  2FU4 A;  3ZN0 A;  4RGX A;  3T1B A;  4HDU A;  3TO7 A;  4Q47 A;  4L9T A;  4WXD A;  2H6B A;  1WRJ A;  1J0R A;  1ODD A;  5E8I A;  3FMQ A;  1Z05 A;  1ZG1 A;  3E6M A;  5D5W B;  4IRH A;  4A0X A;  2HS5 A;  2R3S A;  3DF8 A;  5DYM A;  1TW2 A;  2RDP A;  1IZ1 A;  1OKR A;  1O3R A;  3PQK A;  3PFI A;  2XAH A;  4K2E A;  5HLI A;  4M74 A;  3V7S A;  2XAF A;  1LQ1 A;  5D4S A;  2X4H A;  1WWX A;  2L54 A;  2QQ9 A;  3BJO A;  5D8L B;  2XAJ A;  2OAZ A;  1KYZ A;  2G7H A;  1XD7 A;  1P4X A;  4RB1 A;  5FD6 A;  3P9I A;  5D5U B;  3WOD F;  3HSR A;  1DP7 P;  2Z99 A;  2XVC A;  2MA3 A;  4ENM A;  4WXH A;  4M73 A;  2OA4 A;  2W84 A;  3CUQ C;  2P6S A;  1SD6 A;  1FNN A;  2EV0 A;  3CUO A;  4I7H A;  3Q9V A;  3L00 A;  1EH6 A;  4YFK F;  1J75 A;  2XV4 S;  4JK1 X;  3E5Q A;  3RKX A;  4IPA A;  2QQB A;  3GEZ A;  1XN7 A;  1EV7 A;  5J8C A;  2J5O A;  3RYP A;  3WGH A;  1QPM A;  1LDJ A;  1KU2 A;  2Q2E A;  1BI3 A;  2VBZ A;  2HWV A;  3F3X A;  2CQK A;  1FSE A;  3P9K A;  3TO6 A;  2V9V A;  2IPQ X;  2L01 A;  3RPU A;  5ILU A;  4O3M A;  1HKT A;  3D0S A;  4YFN F;  1ZG3 A;  4OMY A;  5F1R A;  5DDG A;  4KIG A;  3MCZ A;  2PBI A;  4RS8 A;  5LLQ A;  3FZV A;  4EJW A;  2PG4 A;  5JI6 A;  3NQO A;  4IF4 A;  1SD7 A;  1TQM A;  3E5X A;  1ZN2 A;  2MBF A;  3R6S A;  3ISP A;  4WF2 A;  1ZRF A;  1U2W A;  3WTZ A;  3DQV C;  4NQW A;  3RYR A;  4RB2 C;  2HGC A;  4IVN A;  2A61 A;  4U0W A;  1XSD A;  2GAU A;  4UUV A;  1PP7 U;  2ZME A;  4DQ2 A;  3RKY A;  1D8K A;  3R4K A;  1BBY A;  4L9J A;  2ZCW A;  3E97 A;  3I71 A;  2FNP A;  3ELK A;  1Z6R A;  5IT3 A;  1S6L A;  3V8J A;  2MLK A;  4CDG A;  2IA1 A;  4G6D A;  2JPB A;  3BWG A;  2RC4 A;  1JGS A;  5CVI A;  2Y0M A;  3WGG A;  1R1U A;  1L0O C;  5JHU A;  3V8K A;  3LQQ A;  2LDU A;  2XIG A;  3O3K A;  4ZYG A;  2VBW A;  4EJV A;  2A6E F;  3JSO A;  1SAX A;  1ZHF A;  3Q5F A;  4AIK A;  3CLO A;  1T98 A;  4GYG A;  3EQL F;  5ILS A;  3P9C A;  3M9A A;  3BZ6 A;  3BP8 A;  1I1S A;  2HYG D;  2H94 A;  5DD8 A;  1YG2 A;  2QZ8 A;  5DCF A;  4A0Y A;  3GX4 X;  2VC0 A;  5F64 A;  1TW3 A;  1HW5 A;  4LJZ F;  2ACJ A;  1RI7 A;  4BXU A;  4EGZ A;  3OV8 A;  4L18 B;  2ZBK A;  1HW2 A;  3VFZ A;  2XKP A;  1LB2 A;  5E20 A;  2H27 A;  2F5E A;  5FGM A;  2R7D A;  3QU6 A;  2QWW A;  4I0A A;  2XKO A;  4BHB A;  4PGH A;  5L3B A;  4A6E A;  1S29 A;  1JHH A;  1WI9 A;  3KZZ A;  4BNC A;  3J81 Z;  2O61 A;  1RIO H;  1IN5 A;  4MTD A;  4OIQ F;  4I01 A;  1GVJ A;  1IXC A;  1R00 A;  3VOE A;  3M8E A;  1J2X A;  2ELH A;  4A6D A;  3IRQ A;  1ZRE A;  5BMZ A;  1UST A;  1TQI A;  4M71 A;  4HLY A;  4OIO F;  3R0A A;  1SFE A;  1TNT A;  2FBI A;  4CIC A;  4NB5 A;  2EB7 A;  1U6G A;  2MLG A;  5DUK A;  3GF2 A;  3LA2 A;  5HLG A;  1F4K A;  3ZMZ A;  1J5Y A;  2EV5 A;  2FNA A;  3HOS A;  3NEU A;  1HQC A;  1IXS B;  1T0F A;  3IKT A;  5TRD A;  1KQ8 A;  3ML6 A;  4L0Z B;  5LHG A;  3DFG A;  3QPT A;  2KIU A;  1FLI A;  1BOA A;  4UVA A;  2ZO4 A;  3FM5 A;  3V7C A;  1O57 A;  4AIH A;  2IJL A;  3BJA A;  5FFX A;  5HS9 A;  1FX7 A;  1XSX A;  1YFH A;  1I6X A;  2CW0 F;  1C0W A;  4WWC A;  1YQA A;  2DK5 A;  2RNJ A;  1XMA A;  2RN7 A;  4BQA A;  2J5P A;  3TDZ C;  4HZF A;  1P4A A;  3PQJ A;  2FSW A;  2Z3Y A;  5JVT A;  2VOO A;  2CSO A;  5F6F A;  1TNS A;  3B02 A;  5BQT A;  2A07 F;  1FYM A;  2G9W A;  3LA3 A;  3F21 A;  2UZK A;  4R1H A;  1ZYR F;  4L5J A;  5J6X A;  2Z5U A;  2MH2 A;  1REP C;  4OIR F;  1G3W A;  3FXQ A;  4OIN F;  2VBY A;  2A3S A;  5E18 F;  2O03 A;  1ZAR A;  4LLG F;  4WX9 A;  5L3G A;  2PN6 A;  2FQ3 A;  2O6G E;  3I4P A;  4I02 A;  3GZ5 A;  4RB3 C;  3JTH A;  3F8B A;  4HLX A;  2M1B A;  1UCR A;  2FXA A;  4GYI A;  2EFW A;  1EH8 A;  3MFK A;  1IRG A;  5CJ9 A;  2C6Y A;  1O3S A;  1STZ A;  2LF8 A;  3FMS A;  3K1M A;  3C7J A;  2OQG A;  1YYV A;  4L9V A;  1E17 A;  1MKM A;  2DLL A;  2DPD A;  3F22 A;  2DQL A;  4IXA A;  5IT9 K;  3LWF A;  4LD5 A;  2A69 F;  2L3D A;  4U0V A;  2ESH A;  4NHJ A;  1S8N A;  3SFZ A;  3ZMV A;  5E8G A;  3GXO A;  4ENJ A;  1JXS A;  1Z7U A;  4KNY A;  5E1W A; 
#chains in the Genus database with same CATH topology
 4NBQ A;  2XAS A;  4RAG A;  3HTS B;  2M87 A;  2QEN A;  4PJJ A;  3HDD A;  1B4A A;  1D0Z A;  2EQR A;  2QLZ A;  1SVO A;  3BPX A;  1A35 A;  1I3Q J;  3OYM A;  1MMN A;  3SZT A;  3OWT A;  2DJI A;  1QHG A;  3HB9 A;  3SYT A;  3ZQG A;  4E7J A;  5LGN A;  4XLA A;  1JJ8 C;  1FBQ A;  2BV6 A;  2NS0 A;  2QSG X;  4LLN A;  4LLL A;  3C2G A;  3L2W A;  1WI3 A;  2AS5 F;  2OCE A;  1G4D A;  3PNV A;  1B8I A;  3V4G A;  5D8K B;  1IDZ A;  1YW9 A;  1ZGA A;  1R22 A;  2CO5 A;  4RM2 A;  4XLC A;  2HVS A;  1DPR A;  4KIS A;  1MJ9 A;  3BDD A;  2R4G A;  1FEX A;  1PDN C;  3WE3 A;  3OYK A;  1R6R A;  3HZJ A;  2DMT A;  1X1B A;  2EFO A;  1POG A;  1QVU A;  1UJ8 A;  2V1N A;  1BC7 C;  1SD4 A;  1MMS A;  3A0B C;  3QP6 A;  4IJA A;  1TTY A;  4FTH A;  3GW2 A;  1H0M A;  1XPX A;  1JUS A;  2G7U A;  3SZP A;  1RZ4 A;  3RJP A;  1WJE A;  1ULY A;  2E71 A;  1NK3 P;  2R92 J;  4GFB A;  3CC2 I;  1S5L C;  3MKL A;  5FLV A;  3C18 A;  1X2M A;  4IO9 F;  1Y6I A;  2UXN A;  3OIQ A;  2NVY J;  1YIJ I;  1T38 A;  1TC3 C;  5CYV A;  1IGN A;  3TW6 A;  3VEP A;  2KJB A;  2IGK A;  3BTJ A;  2CS3 A;  2DMU A;  2Q0O A;  5B5E C;  5C4X J;  3MZY A;  3O6B B;  3BJ6 A;  5IY5 H;  4ZYD A;  2JA7 J;  3TGN A;  2D5V A;  3K2Z A;  2LF7 A;  1T33 A;  3BTI A;  1Q1H A;  1VQK I;  2RNG A;  1K79 A;  2BYV E;  2LYC A;  2K02 A;  4G94 A;  2EFN A;  2LP0 A;  1LKX A;  1U8R A;  3HHG A;  1AWC A;  5EDN A;  4XR6 A;  2Q8K A;  1QZZ A;  4IHT A;  4BE1 A;  5LEK A;  4ESF A;  1RUO A;  1BIA A;  2YX4 A;  3S15 J;  2QVO A;  1IUF A;  1VI0 A;  1W0U A;  3MD2 A;  1AKH B;  2CWE A;  1ZKG A;  1LE8 A;  1BR2 A;  1KU3 A;  2JZY A;  5GAG J;  1GXQ A;  2F4I A;  1WJD A;  1FWZ A;  2VOD A;  3FM3 A;  1KZH A;  4I98 B;  5DEQ A;  1BOB A;  3EET A;  3HL2 A;  2E2H J;  4A3C J;  1FOK A;  1I27 A;  1P2F A;  2FQ4 A;  3K4K A;  1R7J A;  2D1H A;  3Q3S A;  4P55 A;  3I58 A;  2VJ4 A;  5E17 F;  4ENK A;  4J00 A;  3SEZ A;  1FZP B;  1OR7 C;  1X4O A;  2A05 A;  2JPC A;  1FTT A;  3S14 J;  2JSC A;  1Z7L A;  5AIQ A;  2BVM A;  5IOZ A;  2VE8 A;  4ENN A;  3FXM A;  2FA5 A;  3EPZ A;  4BYY A;  3VOD A;  1OLT A;  2XRL A;  2QEX I;  2FRH A;  1G3Y A;  2A6T A;  2WB1 N;  3S32 A;  1B6A A;  1D0X A;  1I1G A;  4A3I J;  2CV1 A;  3DBR B;  4A2U A;  3KET A;  3DPL C;  2GBY A;  2HYF A;  3L2C A;  2P0W A;  4B09 A;  1G3T A;  4A93 J;  4EJU A;  1YS6 A;  2XPW A;  3F6V A;  3FDY A;  5TIS C;  4XLN F;  3RIR A;  2F48 A;  2EBI A;  4ZDP A;  3HRT A;  4BL0 B;  4DYC A;  4DYR A;  3HSF A;  4YII A;  5A2Q Z;  3HYI A;  4A3K J;  1NHA A;  1XX5 A;  2M34 A;  1T39 A;  1BL0 A;  1HA8 A;  3H3V K;  1RKW A;  3SHF A;  4O5V A;  5FKL A;  2Y9Z A;  4OMZ A;  4JOM A;  1R9T J;  1UHM A;  4E7I A;  3DEE A;  2ADU A;  2IGO A;  3AKZ A;  4BJT A;  4KIB A;  2LBF A;  1K78 B;  1U5T A;  2PJR A;  4LB5 A;  2ISZ A;  2DDA A;  2KL4 A;  1NK2 P;  4HW0 A;  2HDC A;  3GFL A;  2MG4 A;  1JT0 A;  5F04 A;  1W4M A;  2HTJ A;  1XDU A;  2CQX A;  4U7B A;  1SFU A;  3O8H A;  3DLA A;  4A3J J;  4MFE A;  1JTY A;  2X0L A;  2E36 A;  3KP3 A;  3I9V 2;  1Z3Y A;  2R5Y B;  1O3T A;  1FJL A;  1IRX A;  4NNJ A;  1BI2 A;  1RES A;  3K4B A;  3HSE A;  2ZJQ F;  1MDM B;  1LFP A;  1DPU A;  4L5E A;  4WXC A;  5JHF A;  3FIW A;  1OR7 A;  1VQM I;  3H9J A;  1H8A C;  3AG4 H;  4RM3 A;  3ERM A;  3CF5 F;  5KNL A;  5L3D A;  4XRS G;  2R7R A;  3ZQC A;  2XRN A;  1ONV A;  1HDD C;  3RDI A;  2LY9 A;  2KDZ A;  1KYW A;  5F27 A;  1OFC X;  4KN7 X;  1O4X A;  1D8J A;  2BW3 B;  2LR8 A;  5J47 A;  3V8L A;  5HS7 A;  1FBS A;  2IP2 A;  4HOB A;  4OOI A;  4L5I A;  3GZ6 A;  2GXA A;  4ZZD A;  3ZQH A;  5KHD A;  1VTN C;  4D1Q A;  4XLF A;  2O5R A;  2M5W A;  4WCG A;  4AUX A;  3IH4 A;  1PUF A;  4N9I A;  1B1B A;  1VF9 A;  1GHC A;  3ABT A;  5JLW A;  4I76 A;  1B9N A;  5E1W A;  2UV1 A;  1IN8 A;  2ZXJ A;  2Y75 A;  3D5L A;  4XKC A;  1T2K A;  4OIP F;  4EAT A;  4F93 B;  2PJP A;  2K40 A;  5FKN A;  3DBL B;  2X1D A;  3TP0 A;  1DU0 A;  4LG0 B;  4G7O F;  2L9V A;  3BG6 A;  1JT6 A;  2NVT J;  1LPQ A;  3U2R A;  4XLE A;  3PO3 J;  1ETK A;  4JX4 A;  3KFW X;  2LKP A;  1IXR C;  4QWQ A;  4BAC A;  4U88 A;  4E7S A;  3OOP A;  2DA2 A;  1OYY A;  1U78 A;  3K70 C;  3FBN B;  4O6J A;  1IV8 A;  2H8W A;  2IT0 A;  3I4M J;  1IRF A;  3CF2 A;  4IHX A;  1GLN A;  1MNE A;  1SFX A;  2O7O A;  3BR1 A;  3J7Z I;  3E1S A;  4MTE A;  3CO7 C;  2EWN A;  3OYJ A;  2XUB A;  3GVA A;  4BXF A;  5DCM B;  1TBX A;  1TLH B;  2WWY A;  2M0C A;  4NUB A;  3K1P A;  4YEL A;  3R60 A;  1S9H A;  3LSK A;  1DUX C;  2BEO A;  5D4R A;  3KLO A;  2X6O A;  4PJM A;  2DN0 A;  4N4O B;  2JK3 A;  1TWA J;  2DI3 A;  1R5G A;  4D5F A;  2D45 A;  4BDZ A;  3HJE A;  3BOQ A;  2HPM A;  1U0J A;  3CCQ I;  3NWS A;  3F0C A;  3ERE D;  5LD2 C;  5EF6 A;  3QYB A;  1QBJ A;  2DA5 A;  1H9T A;  4LIT A;  4PGG A;  1FYL A;  1LDK B;  4G6Q A;  4EQQ A;  1J9I A;  3JCU C;  1KU7 A;  3FXO A;  4HG2 A;  4DZJ A;  4GXO A;  2EK5 A;  3MZH A;  4RAY A;  1MJA A;  1YRN B;  4MEY F;  1F9N A;  1XMK A;  3OOU A;  4DZP A;  1ERD A;  4A5N A;  3WG7 H;  4Y15 A;  2LNB A;  2XPV A;  3RCO A;  4BXX J;  1K6O A;  5CVJ A;  1SFK A;  2CW8 A;  5KCM A;  1QU3 A;  3HOY J;  3P5J A;  2BW3 A;  2VPR A;  1HF0 A;  4B47 A;  4FX4 A;  3FMR A;  4E7H A;  1IF1 A;  1IW7 F;  2IGM A;  4KN4 X;  3ZP5 A;  5HNH A;  3QU3 A;  1ETV A;  3HRS A;  2O0Y A;  4HBL A;  2WTE A;  4ZYA A;  3PUB A;  4UB6 C;  4XSZ F;  2FBK A;  4KDP A;  1ZAO A;  3TKY A;  4B3X A;  5IP9 J;  1HST A;  4P9F A;  1YTY A;  2UUZ A;  2F5D A;  4CXF A;  4R79 A;  2GIV A;  1IN6 A;  5IT9 Z;  4XLH A;  1SC7 A;  3ZQF A;  1FT9 A;  3N97 A;  3DXJ F;  3S1N J;  3M8J A;  5DTD A;  3E0J B;  3WU2 C;  1VQ8 I;  3MKY B;  2WAE A;  1MMA A;  4G12 A;  2VKV A;  3GFJ A;  3JTG A;  3CCM I;  1HSJ A;  2DOD A;  3H5A A;  2XF6 A;  1YS7 A;  2K9N A;  2K9L A;  1U9N A;  2GWR A;  3LSM A;  4LG0 A;  2ECB A;  3BY6 A;  3K69 A;  2CQQ A;  3C2B A;  2KIS A;  1P4W A;  5D5X B;  3OL3 A;  2STT A;  3J80 Z;  5ICF A;  2R7Q A;  4HV5 A;  1Z91 A;  3J7A O;  1P92 A;  1X3U A;  3HGY A;  2V4J C;  3AFH A;  4C30 A;  1IAW A;  2XC7 A;  4Z2Y A;  1I5Z A;  1PJR A;  5D5V B;  4IRI A;  2KIF A;  4UVB A;  1B9M A;  3S3N A;  1OMI A;  2Q2E B;  1Z9C A;  2EA4 A;  5EEH A;  1W0T A;  2DXI A;  4RA2 A;  4UB8 C;  2HVQ A;  1MGT A;  4ZC3 A;  4C3J J;  3BR2 A;  5GAH J;  4J19 A;  4NC8 A;  4B48 A;  2XAU A;  1OJL A;  4MHG A;  5E79 C;  2K9S A;  3JSP A;  1FYK A;  2R7X A;  5K5O A;  4JBA A;  1QA6 A;  3F9K A;  1ZLK A;  3CC7 I;  1R23 A;  3CD6 I;  3B73 A;  3OYH A;  3H0G J;  1APL C;  5FFZ A;  2MSY A;  3CUQ A;  4RGR A;  3FXU A;  1VZ0 A;  4X1E A;  4QLC U;  5K7H A;  4BQQ A;  3S16 J;  2Y48 A;  1RNL A;  3K10 A;  2K3P A;  2K9M A;  2R5Y A;  5BOX A;  1XB4 A;  3E6D A;  3SDB A;  2CFX A;  1YW7 A;  1VQ5 I;  1W5S A;  1K7A A;  1J09 A;  2DQR A;  2GM4 A;  1FP1 D;  2PFB A;  2O8X A;  2LD5 A;  2CV0 A;  1XGM A;  3BG3 A;  3KEY A;  4OAZ A;  4XMY A;  1W7P D;  1LVK A;  4ANJ A;  2HPI A;  4BAY A;  2COM A;  5EEA A;  3AAF A;  2EH3 A;  4HSR A;  1LJ9 A;  1WQ2 A;  3VYS B;  1GVD A;  4JYK A;  2VUM J;  2DAO A;  4DIQ A;  3HGG A;  2B0L A;  2PMZ N;  3Q9S A;  5CKT A;  2KHM A;  2V6C A;  2P7C B;  4PSX A;  1D0Y A;  2TCT A;  3E3V A;  4I0B A;  4OAY A;  3H3Z A;  5H6Q A;  5C4J J;  2EPF A;  4Y3O A;  2OZ6 A;  4I99 C;  2DFI A;  1GV2 A;  2QKL B;  3H92 A;  4DYQ A;  4LGW A;  3FIS A;  4E7Z A;  5K5Q A;  5EG0 B;  1SFO J;  2W25 A;  3OYN A;  2XPU A;  2HZT A;  4F7Z A;  1USS A;  1J7K A;  2OJE D;  4AWX B;  4XOR A;  3LQR A;  4MQV A;  3I5U A;  4PZJ A;  3V42 A;  1Y8R B;  2VON A;  5LHI A;  1IJW C;  5ED4 A;  4U7D A;  4ZYH A;  1Z77 A;  4E70 A;  1ETQ A;  2ZJ2 A;  2X85 A;  3RQ4 A;  3GCM A;  5EEG A;  1P7J A;  2GZW A;  4ZJZ A;  1E0E A;  1W7P A;  3DP7 A;  2E7W A;  2P5K A;  2NNN A;  2WV1 A;  3S8P A;  2KFD A;  2X51 A;  4HYE A;  4XN3 A;  4KIT B;  3DKW A;  1ETY A;  3DEW A;  3HG9 A;  3S2H J;  2BGC A;  4BU2 A;  1JUP A;  1PVE A;  4EV0 A;  4YIF A;  2LVS A;  2PMU A;  2X48 A;  3RQI A;  3HTU A;  1OYI A;  2X6X A;  1JUM A;  2OU2 A;  2BE5 F;  1D1C A;  2STW A;  1MMG A;  3CCJ I;  4KMU X;  1JTX A;  3IWZ A;  2ZXW H;  4XN0 A;  3VSK A;  1TT0 A;  2VLA A;  3EUH A;  3UNG C;  1YX5 A;  3OY9 A;  3IRR A;  2VXZ A;  2DYR H;  1UMQ A;  1GV5 A;  2A5Y B;  1YI2 I;  2LRD A;  1O7L A;  2DMQ A;  3F8F A;  4G7Z F;  2EIN H;  4CH7 A;  1GT0 C;  4UHT A;  5EGO B;  2VT3 A;  3GUD A;  2R7U A;  1YO5 C;  2QBY A;  3LAP A;  1ZQ3 P;  2HU9 A;  1ON2 A;  2K4B A;  2YUS A;  3GLX A;  4LG3 A;  5LBQ A;  1FSH A;  2W85 A;  2FMY A;  3PSF A;  4B8X A;  3LSP A;  1HLV A;  2CYY A;  1SMY F;  4HPQ A;  2JSP A;  2Z33 A;  3BQY A;  3ZPL A;  1R58 A;  1R4N B;  3COA C;  4Q48 A;  2LKS A;  4XON A;  3DTK A;  5GAE J;  2KRC A;  4GO1 A;  3JAM Z;  1ZRD A;  2P7V B;  3OSF A;  3FWE A;  1GXP A;  4EM0 B;  1SVL A;  1BIB A;  1MSE C;  2B7E A;  4ZYE A;  3O2P E;  4RBO A;  4HNU A;  1Y1W J;  4GGG A;  2GQQ A;  3WU1 B;  1YE9 A;  4NDL A;  4FAS D;  2FE3 A;  3G1O A;  3HOU J;  2IAI A;  1RRJ A;  2V1D A;  3FBI B;  3F6O A;  3QPH A;  3QOP A;  4ZTF A;  2NVQ J;  5EG0 A;  3ZGK A;  3G73 A;  1EKE A;  2ZSI B;  4XRF A;  3OS0 A;  2HQN A;  4MLO A;  2FBH A;  3C1D A;  3HOT A;  4UV9 A;  2VQC A;  3LL7 A;  2WBM A;  2Y69 H;  4G9Y A;  2VKD A;  2H1L A;  3QP5 A;  3DTE A;  1RET A;  5JR3 A;  2DTR A;  2NVU B;  2CH0 A;  5IYC J;  1MD0 A;  3LA7 A;  1X2N A;  3K2A A;  1DP3 A;  1SD5 A;  3A01 A;  2DU9 A;  2DBB A;  3W6V A;  1FMV A;  4F91 B;  3ZMD A;  4RAZ A;  3KP7 A;  2OD5 A;  4RLQ A;  1ZEL A;  3E5U A;  2F5F A;  2KRF A;  3OL4 A;  4HX7 A;  2ME6 A;  1F5T A;  2IA0 A;  2L2O A;  3K1N A;  1ZTR A;  4KIC A;  4IX7 A;  5GPC A;  3NWT A;  3SJM A;  3TED A;  4HEA 2;  4RMN A;  2E1C A;  5HOD A;  2R7T A;  5IT9 K;  3IC7 A;  3ZQQ A;  1I3A A;  3LSG A;  3M8F A;  3K4J A;  1RUN A;  1R4M B;  1LDD A;  2ELK A;  4NC6 A;  3V7R A;  1A31 A;  3HKZ N;  1W36 D;  1Y0U A;  1WJC A;  4IRG A;  5L3E A;  2HVR A;  1RR7 A;  4CCM A;  5DCM A;  2NOJ B;  3NAU A;  5HDG A;  1S7O A;  1XGN A;  1A6I A;  2WC2 A;  2O3F A;  2Y30 A;  2ZC2 A;  3KP5 A;  2CUF A;  1D5Y A;  2L7K A;  3W3C A;  1OIS A;  3ECH A;  3M07 A;  3HOX J;  2YU9 J;  1Q1V A;  1XGO A;  2DW4 A;  1IUY A;  4HRI A;  2DA6 A;  3VB2 A;  2HZD A;  4LFU A;  1Z1D A;  3W2A A;  4KNY A;  4YG2 F;  2VE9 A;  2EZL A;  2HFH A;  5LGU A;  2L9S A;  2CUE A;  4C2U A;  3F8N A;  2V79 A;  3IH3 A;  2R5Z B;  2LY1 A;  3JRC A;  2V1U A;  1WSU A;  4CYC B;  4I2O A;  4BJ5 C;  1BI0 A;  2BY1 A;  3VYT B;  1YLF A;  1BI1 A;  3OYF A;  3MKZ A;  2E1O A;  4B1R A;  1HC8 A;  2QSF X;  5FO5 A;  1UZC A;  3KPH A;  1O7F A;  1UAA A;  2QBY B;  4PCQ A;  1W5C C;  4BE0 A;  5GTI C;  3BQZ A;  1JHF A;  2OZU A;  2DA1 A;  4CCL A;  1FOW A;  4PJL A;  5FB2 A;  3AL0 C;  1NG6 A;  1B59 A;  2HNH A;  5GTH C;  5KAF C;  1ON1 A;  2Z1D A;  3TDU C;  1V4R A;  2BBY A;  4YIR X;  3QRF F;  4M3E A;  4HF0 A;  1X1P A;  3S3M A;  3FHZ A;  2PI0 A;  2CGP A;  2E5N A;  1ZK8 A;  5LHH A;  1EF4 A;  4V2F A;  4B4C A;  3IUO A;  1WHU A;  2R7W A;  3QWL A;  2E34 A;  2M8E A;  1U9O A;  3ZMT A;  4P5O A;  4M72 A;  3JRA A;  1WPK A;  2Y9Y A;  2ZSH B;  1QQI A;  1E2X A;  3MZ8 A;  2BY0 A;  2CRG A;  4EJT A;  4AYB N;  2IW5 A;  1ETO A;  1MZB A;  3OYL A;  1R36 A;  1H88 C;  1X3W B;  1TWC J;  3BG5 A;  3F23 A;  3OIP A;  3GTJ J;  1H9G A;  5H20 A;  3VDX A;  1KA8 A;  5FD5 A;  1UEL B;  3HRM A;  1FTZ A;  4A0Z A;  1UG0 A;  3I59 A;  2HOS A;  3CES A;  4ESJ A;  2V9K A;  2OQR A;  1LEA A;  4EM2 A;  3A2K A;  1YRN A;  2W24 A;  3CTA A;  3DPT A;  1R5I D;  3L1P A;  3IL2 A;  3W6K B;  4CHU A;  4TV7 A;  5CPR B;  3J81 K;  4ETS A;  1BM9 A;  2IRF G;  3T0Y A;  4KT5 C;  3GTL J;  3DU6 A;  3OMY A;  2AQE A;  1BC8 C;  3T5X A;  3J80 K;  2GA2 A;  3B6A A;  3OR1 C;  1CF7 A;  3VYR B;  3MEX A;  5GAD J;  3OYI A;  3KLN A;  4PDK A;  3RI4 A;  3DWL E;  5JLX A;  4RB0 A;  1EH7 A;  5LEJ A;  3HKZ A;  4AVP A;  3WTS C;  5CQG A;  2ESN A;  1XGS A;  2UXX A;  1TQP A;  4ON0 A;  2KDO A;  2GA1 A;  3MQ0 A;  4YFX F;  2EFP A;  1ZH5 A;  3BTL A;  2W00 A;  4RGS A;  1WKM A;  4V19 K;  2HQ5 A;  3KEO A;  3FXK A;  1Y8Q B;  3TOB A;  3KP2 A;  4OU0 A;  1KQ0 A;  2PMH A;  3KE2 A;  1YIO A;  4EMS A;  2VQG A;  1EA3 A;  2JJ7 A;  5DD4 A;  2JTV A;  1UFM A;  3WTW C;  3ABM H;  1VQ6 I;  2R7V A;  1WJA A;  3GZN B;  2FML A;  3BRO A;  4LOC A;  2MAB A;  2CU7 A;  2K3F A;  3FXR A;  5ICG A;  3MAJ A;  2V9P A;  2LBF B;  4G8X A;  2M45 A;  1O3Q A;  4BQO A;  5EZH A;  3RKW A;  2DFF A;  4S05 A;  2ZNZ A;  2LG4 A;  1IN7 A;  2ZFU A;  2GXB A;  3IAS 2;  4PFP A;  2WAD A;  3VPR A;  3HOV J;  1MBF A;  2HKO A;  3ESW B;  4BY7 J;  3SXY A;  1PUF B;  4HST A;  2XAQ A;  1F43 A;  4XLP F;  3J7Y J;  4E7L A;  3ABU A;  3L2U A;  5L3C A;  2KZG A;  3H3U A;  1QRY A;  2E1M C;  2M3A A;  1CF7 B;  3LST A;  4AU7 A;  1ZR4 A;  1CGP A;  1XSV A;  2QQ8 A;  1FP2 A;  1R5H A;  5EYR A;  3ECO A;  3HRU A;  1MNM C;  2CMP A;  4Q5S F;  4LK0 F;  3CJQ B;  2ELJ A;  1A04 A;  5DV5 A;  2CQ7 A;  2DT5 A;  2ETH A;  2Q1Z B;  4H0E A;  4Q4Z F;  1QZY A;  3FF5 A;  3MWM A;  1Z0X A;  4JP0 A;  2A6H F;  1HKQ A;  2X6W A;  1F1Z A;  4CYC A;  3I56 I;  1MJB A;  2TDX A;  3E6C C;  2H09 A;  1DGR M;  1MDM A;  2Y0S A;  1TZL A;  4HX4 A;  4D5C A;  3N05 A;  5LRR A;  1H89 C;  2XB0 X;  2F5V A;  1G3S A;  2KP6 A;  4R8H A;  2LK2 A;  1R1T A;  3HHH A;  1SMT A;  2MW8 A;  1ETW A;  3PNY A;  2RV8 A;  1UHS A;  4B3A A;  1HXD A;  2K5C A;  3KCC A;  4KUM A;  3CCY A;  4AIJ A;  1DDN A;  1N78 A;  2MH9 A;  2LSO A;  1BJA A;  2L9N A;  5CVV A;  1F36 A;  1P6R A;  3I53 A;  5DM6 F;  3G4S I;  2JA6 J;  3OR2 C;  5H2F C;  3G1M A;  1Z67 A;  2WA0 A;  4LMY A;  1UHW A;  5JFR A;  1D5V A;  2M7A A;  2DOE A;  2BY3 A;  1MBJ A;  4BHP A;  4E6K G;  5LGT A;  1B8I B;  5FLX K;  2KKO A;  1AHD P;  2YSR A;  3D5S C;  3REO A;  4J01 A;  3I64 A;  2E19 A;  2NAZ A;  3KP4 A;  4M6X A;  1Y0N A;  1LVA A;  3P7N A;  2IVM A;  1KGS A;  1R1V A;  1BA5 A;  3ONQ A;  5ICE A;  3S2D J;  4XSX F;  3TP3 A;  2VBX A;  1GDT A;  2NRA C;  4FX0 A;  3VYU B;  3ZOB A;  1OCR H;  2E7X A;  4MO7 A;  5CVR A;  2DMN A;  2H1K A;  4KYW A;  2P81 A;  1YHQ I;  1FIP A;  4M6Y A;  2VB6 A;  4UNO A;  1FC3 A;  2JQ7 A;  3BG9 A;  4DW6 A;  1V5F A;  3PFY A;  2H8R A;  4HQE A;  4JX5 A;  3JW4 A;  1IV6 A;  3KEQ A;  2VPL A;  2OCC H;  3SEQ A;  4H4K C;  2ME0 A;  2P6T A;  3M1C A;  1FOY A;  2K7L A;  1ZRC A;  2MC3 A;  4ASN A;  4L0Y B;  2F2E A;  3LAJ A;  3GFI A;  3GTG J;  5H6R A;  2WAQ A;  1G6N A;  5E1X A;  4PJN A;  2CJJ A;  2V26 A;  3ZN1 A;  4N0B A;  4XID A;  2QGU A;  4UXN A;  4MNU A;  3A1Y A;  2GIZ A;  4HQM A;  5HOO A;  5FLM J;  5EZG A;  3RZO J;  4HF1 A;  3R61 A;  3TO9 A;  3CP8 A;  4YRV A;  1MIJ A;  5FLX Z;  1FPQ A;  1Y56 A;  2IA2 A;  2K86 A;  4MQ9 F;  3F72 A;  3FX3 A;  3FHN A;  5JVG F;  3IHU A;  2AXL A;  1NG7 A;  1QZE A;  2RRE A;  3CQZ J;  5BPI A;  4FET A;  4C2T A;  1JJ6 C;  3BG7 A;  3JRG A;  3F8C A;  3BC8 A;  4HF2 A;  4P96 A;  4CYD A;  1K4S A;  4UVC A;  3DU5 A;  1IO2 A;  4WK8 F;  3EDP A;  4EGY A;  3RPQ A;  2NS8 A;  4M9X A;  3FXJ A;  4XNF A;  1AU7 A;  2XRO A;  4Y17 A;  3EYY A;  4S04 A;  3TW7 A;  2KJC A;  4C2M J;  2HQR A;  4S0H B;  2BXZ A;  1YW8 A;  2WY8 Q;  2LRE A;  3NRV A;  2KLO A;  3QYF A;  4P9U A;  3M7G A;  3OYE A;  2NNY A;  2WV0 A;  5CLS A;  1OCC H;  3CDL A;  1HBX G;  3H5N A;  1WGX A;  3MKW B;  2VJJ A;  1YJW I;  4KA4 A;  4GDF A;  2VC1 A;  2UWM A;  3L7W A;  4M9Z A;  2LC2 A;  2WAF A;  3G2B A;  4FE7 A;  3M1E A;  3OYG A;  3GFM A;  1D3Y A;  4IQ4 A;  4DGW B;  3KYL A;  4EJO A;  3D1N I;  3QYE A;  4XOP A;  3WG9 A;  5KK1 A;  4BDY A;  1N75 A;  9ANT A;  2M8G X;  4DNC A;  1HKS A;  2X9D A;  2M9H A;  3H5R A;  4A3D J;  3WTY C;  1Z21 A;  2EJR A;  2JWT A;  1K78 A;  2PQ8 A;  2CG4 A;  1PP8 F;  3SQN A;  1HW1 A;  3GLL A;  4PK4 A;  2EV6 A;  2FD5 A;  4D0P A;  3CCR I;  2QQA A;  2B9S A;  4HV6 A;  2X1E A;  4MGR A;  3WTX C;  2IS1 A;  4EM1 A;  1S72 I;  4BKX A;  3O8G A;  3ZXS A;  1NTC A;  3GWZ A;  1UB9 A;  1QNT A;  1WVR A;  3R0J A;  2L7F P;  4D7M A;  3BR5 A;  1K83 J;  3CJR B;  1T6S A;  4N9H A;  2P4W A;  5TJJ A;  2ZXH A;  4GRI A;  3SDG A;  1TP4 A;  5BPD A;  1CQT A;  3K9T A;  3PL8 A;  3GTK J;  3HUG A;  2L4A A;  5BNG A;  2XF7 A;  2PEX A;  1ZG5 A;  1K61 A;  2K4J A;  3JRE A;  2I5U A;  3HIF A;  5J1U A;  1WJF A;  3ROU A;  4XBF A;  3JAM K;  1OYW A;  1XTA A;  3L2R A;  3S1Q J;  4BGD A;  1W7P B;  2XGC A;  4KT6 A;  3ZMU A;  1S3J A;  4OWR B;  3J7A Y;  3BR0 A;  3KYD B;  2ZFW A;  1B72 A;  2JA5 J;  3L9F A;  2VOP A;  1I6H J;  3EYI A;  5HDN A;  2HR3 A;  3IWF A;  1Z6T A;  5F0H A;  2VT2 A;  3G3Z A;  2KRH A;  3ULQ B;  3FKJ A;  1MBG A;  2OBP A;  5A2Q K;  5D6E A;  4HDV A;  5J8F A;  1GUU A;  2EIL H;  3CUQ B;  4A12 A;  1LNW A;  3WTV C;  2FF4 A;  2ZME C;  2CFO A;  3S2W A;  3H0D A;  4IOA F;  3HUG B;  4RLF A;  2MYS A;  3AG3 H;  5HDK A;  3KP6 A;  1MND A;  4ZZL A;  4Y13 A;  2W82 A;  4IHV A;  3I54 A;  3HPH A;  1MBH A;  2BVL A;  4A5M A;  2E2J J;  3QAH A;  2PLY A;  2L02 A;  4U0Y A;  1QVT A;  3I4N J;  1BW6 A;  3BZC A;  3T8R A;  5KAI C;  2R7Z J;  2QF7 A;  3CO6 C;  3ZMS A;  3DLL F;  3KZY A;  3VWB A;  2Z9O A;  3K0L A;  4XRM A;  3WTU C;  2QYO A;  1TT5 B;  5K7F A;  2DTZ A;  3L09 A;  3CDI A;  2BOL A;  4Y4R A;  2R7F A;  1DU6 A;  3UR3 C;  2DA3 A;  4HNV A;  3W2V A;  5E3O A;  2DMP A;  3TQN A;  2V6E A;  3FK6 A;  1X58 A;  1JKP C;  3JRI A;  2FEZ A;  1AOY A;  3N4M A;  4ABZ A;  3HOZ J;  3E6B A;  4QTR A;  5ICC A;  5LRS A;  4ESB A;  4ZH4 F;  3IH2 A;  4M9S A;  2RKH A;  3BCA A;  1N77 A;  3G6E I;  5F0C A;  3ASO H;  5M5W J;  2V1X A;  4AM3 A;  2K27 A;  1V3F A;  3I0T A;  5AIP A;  2NOG A;  2DO7 A;  3DEU A;  3LFU A;  3GO5 A;  2P5V A;  2HDW A;  4AC0 A;  2JT1 A;  2VKH A;  2D1V A;  5FRM A;  2H6C A;  4FHT A;  1LUJ B;  1ZLJ A;  4XRS A;  1JKO C;  5HVQ C;  5D6F A;  1A36 A;  1XCB A;  2NS7 A;  1ZGJ A;  1D1A A;  2E35 A;  2IS6 A;  4IOC F;  5ERI A;  4BE2 A;  2R0Q C;  5CVU A;  3BT9 A;  2GOM A;  2LH9 A;  2X1C A;  1ENH A;  2RGV A;  3GYH X;  2DPU A;  5BS6 A;  4IHS A;  2EZH A;  1X19 A;  1VQP I;  2E1M B;  3RPU D;  1VND A;  3ABL H;  1SAU A;  2QM3 A;  5K7Z A;  5L3F A;  3EUH C;  2ISY A;  2LLK A;  3SFI A;  3S17 J;  2YX7 A;  4HA8 A;  3HBL A;  2L0K A;  2EZK A;  3PM1 A;  3TOA A;  1FY7 A;  2DK8 A;  2P8T A;  2ZNY A;  4BBS J;  5K5R A;  2MD5 A;  3HXL A;  4I09 A;  3CJN A;  1U5T C;  4BUP A;  2EA2 A;  2JRT A;  1V55 H;  1OQY A;  3RTR A;  4CGZ A;  4FT8 A;  2COB A;  3QOE A;  2YPR A;  2VAS A;  4KMF A;  5ILV A;  1VQN I;  2DCE A;  2CUZ A;  1B72 B;  5J3L A;  4RGU A;  3DBH B;  3WHB A;  3WU0 A;  3ZRG A;  2HOE A;  3B6C A;  1OPC A;  2W57 A;  3DPU A;  4BH9 A;  4EVI A;  4KFC A;  3KZI C;  4HNT A;  1L3L A;  3BPV A;  5M5X J;  1JE8 A;  3OS2 A;  1YJ9 I;  2NXN B;  4A3F J;  3IKV A;  4JQF A;  4LB6 B;  3WGI A;  4HX8 A;  3JR9 A;  1P7I A;  1QO0 D;  3F8M A;  3D5R C;  2RVC A;  4IHW A;  1A6Q A;  2XGD A;  1J59 A;  1S7A A;  2L7M P;  4JX6 A;  3TMO A;  4XQF A;  1QPI A;  4B44 A;  1T56 A;  5FKK A;  3GTO J;  2E1N A;  3C3W A;  4BJ6 C;  4UV8 A;  1RKT A;  1PUE E;  3KX2 A;  2HOA A;  1WCM J;  2YR2 A;  4AD9 A;  2AHQ A;  4IQJ A;  2VN2 A;  1XDS A;  2CV2 A;  3S1M J;  2M2E A;  4A3E J;  3U9G A;  2F5C A;  2GXG A;  5HS8 A;  5K1Y A;  3FXL A;  4HAM A;  3WE2 A;  2LMD A;  2A68 F;  2PMZ A;  2ZJR F;  3JRF A;  2GLO A;  3FK7 A;  1IN4 A;  2XAG A;  1XCV A;  1E3P A;  1TWF J;  1X3Z B;  2EFQ A;  4BEH A;  5J1Y A;  5AON A;  6PAX A;  3DCF A;  3ZQ7 A;  4BHC A;  1KQ9 A;  3I59 B;  2DT6 A;  2ZME B;  3LFK A;  2M30 A;  2B63 J;  2KIQ A;  2KZV A;  3ABK H;  4CO8 A;  3T8T A;  1AA7 A;  2TRT A;  5E1Z B;  1MW7 A;  2L4M A;  4L9N A;  3CP2 A;  1U3E M;  5DUI A;  1LEB A;  2JUG A;  1Y1V J;  4GCV A;  3W6J B;  2YU3 A;  4KIF A;  1HCR A;  2DA4 A;  3AG2 H;  2VQL A;  1FBU A;  2DYS H;  4DBR A;  5HLH A;  4IEJ A;  2HTS A;  2VXD A;  3C2H A;  3BR3 A;  4G7H F;  4F92 B;  3MVP A;  1OCP A;  2KQR A;  2KIM A;  4LK1 F;  2XGX A;  2VJ5 A;  1QGP A;  4CZZ A;  2FOK A;  3CDH A;  3DV8 A;  4II3 A;  1D1B A;  2X6Y A;  1SAN A;  1W5T A;  2D2W A;  3PO2 J;  2HEO A;  2XHK A;  1U5T B;  2NYX A;  2VI6 A;  3LSJ A;  2BY2 A;  3WTT C;  3KIO A;  2WB1 A;  3M4O J;  3U1D A;  4BEH B;  2BZT A;  2R7S A;  1YIT I;  5J4Y A;  2HDD A;  1QHH D;  4MEX F;  2ZKZ A;  5KVR A;  4QIW N;  2RQP A;  1BN5 A;  1KU9 A;  2DOF A;  2ECC A;  2HKX A;  2QUF A;  4MFD A;  3GTQ J;  2FU4 A;  3ZN0 A;  3QQA A;  4RGX A;  2OTL I;  2PX9 A;  2QSH X;  3T1B A;  4HDU A;  2QKM B;  3TO7 A;  2CW7 A;  4Q47 A;  4AID A;  2I8D A;  3CZ6 A;  4L9T A;  4WXD A;  4G6T B;  4FE4 A;  2H6B A;  1WRJ A;  1J0R A;  4FIS A;  1ODD A;  3QOD A;  5E8I A;  2VL8 A;  4IZZ A;  3FMQ A;  3MMY B;  5IP6 A;  4QPO A;  2LY2 A;  3ASN H;  4UUS A;  1Z05 A;  1ZG1 A;  3E6M A;  3GBG A;  2F4M B;  5FRO A;  2IGN A;  4BY1 J;  5D5W B;  4IRH A;  4BQN A;  2JRM A;  4A0X A;  3RSN A;  2HS5 A;  1OCZ H;  2HQA A;  2R3S A;  3DF8 A;  4NQW B;  4QPQ A;  5C3E J;  3K4L A;  3LSI A;  2DFE A;  5DYM A;  2OC6 A;  3LSR A;  1TW2 A;  2RDP A;  2FJ1 A;  1WH7 A;  1IZ1 A;  1OKR A;  2IS4 A;  3HPG A;  1O3R A;  5M3M J;  3PNT A;  3PQK A;  1R49 A;  3PFI A;  4NC7 A;  2DOA A;  2XAH A;  4BS9 A;  4F55 A;  4K2E A;  5HLI A;  4XKB A;  1I39 A;  4M74 A;  3V7S A;  5J1R A;  2ID3 A;  2XAF A;  4A3G J;  4F52 A;  2EZI A;  2W7N A;  2L5Q A;  1LQ1 A;  5D4S A;  2W4S A;  2X4H A;  1WWX A;  2L54 A;  5B3S H;  1AKH A;  4A3L J;  2IEK A;  2QQ9 A;  3BJO A;  2OTJ I;  2VJI A;  5D8L B;  2XAJ A;  2OAZ A;  1KYZ A;  2G7H A;  1XD7 A;  4XKW A;  1P4X A;  5IYD J;  2AQF A;  4RB1 A;  5FD6 A;  3P9I A;  4ZDO A;  3CMY A;  5D5U B;  4A69 C;  3WOD F;  1OCT C;  3CC4 I;  1VQ4 I;  1XG1 A;  2IXS A;  3BR6 A;  3HSR A;  5DM7 F;  1DP7 P;  1N25 A;  2Z99 A;  2XVC A;  3BTC A;  4C3I J;  2MA3 A;  4D7N A;  1MMD A;  3K6G A;  4ENM A;  3KYC B;  1BJZ A;  4WXH A;  4M73 A;  1NH3 A;  2VQH A;  3LSH A;  3U1K A;  5FKO A;  2OA4 A;  2W84 A;  4LIU A;  1LFU P;  2L9R A;  3CUQ C;  2P6S A;  1SD6 A;  5B1A H;  2AO9 A;  5CQE A;  1ACI A;  4P1W A;  1FNN A;  2JA8 J;  2EV0 A;  3CUO A;  4I7H A;  3Q9V A;  3JRD A;  3L00 A;  1EH6 A;  1FIA A;  4CCN A;  4YFK F;  1J75 A;  2XV4 S;  2YS9 A;  1JI8 A;  4CUG A;  2HXO A;  4JK1 X;  3E5Q A;  2O9L A;  3RKX A;  4W1U A;  3OYA A;  4IPA A;  2QQB A;  1BR1 A;  3GEZ A;  4N4N B;  2OPT A;  1XN7 A;  1EV7 A;  5J8C A;  1LE8 B;  2J5O A;  4DBQ A;  3RYP A;  1SVM A;  3JRB A;  3WGH A;  1QPM A;  1LDJ A;  1KU2 A;  2Q2E A;  1BI3 A;  2VBZ A;  2HWV A;  3F3X A;  2CQK A;  1X1A A;  1FSE A;  3HM5 A;  4CSW A;  3P9K A;  3TO6 A;  5M5Y J;  3UKG A;  5GP9 A;  2V9V A;  2IPQ X;  2L01 A;  3RPU A;  5ILU A;  4O3M A;  3PSI A;  1HKT A;  3IAM 2;  3D0S A;  4YFN F;  2Y2Z A;  1ZG3 A;  4OMY A;  5F1R A;  2E60 A;  1FMW A;  3K4M A;  5DDG A;  4KIG A;  3MCZ A;  2KT0 A;  2PBI A;  3OIO A;  4RS8 A;  5LLQ A;  3FZV A;  1LFB A;  3EUA A;  4EJW A;  2PG4 A;  5E3M A;  4U87 A;  4M3F A;  5JI6 A;  3NQO A;  2ZXI A;  4IF4 A;  2DT7 B;  4E7K A;  2W1O A;  3ZQL A;  4A3M J;  3OYC A;  4C9Y A;  1SD7 A;  1TQM A;  2DA7 A;  3H9Q A;  4CCJ A;  2XF5 A;  3CCL I;  3E5X A;  1Y39 A;  3HOW J;  3CLQ A;  2G0E A;  2F6C A;  3H9G A;  1ZN2 A;  3H36 A;  1TWH J;  2MBF A;  3R6S A;  3E7L A;  5E3N A;  4QSH A;  3ISP A;  4WF2 A;  1ZRF A;  1U2W A;  4MIM A;  3WTZ A;  3DQV C;  4NQW A;  3RYR A;  4RB2 C;  2HGC A;  1MH3 A;  4IVN A;  1JKR C;  3PIP F;  2BHZ A;  2A61 A;  4U0W A;  1BW5 A;  1ETX A;  1XSD A;  1HOM A;  2ID6 A;  1TWG J;  2GAU A;  2W48 A;  4CA0 A;  4UUV A;  5IOY A;  3A02 A;  5GPA A;  1IDY A;  1PP7 U;  2ZME A;  4DQ2 A;  3RKY A;  4X0G A;  2IS2 A;  1D8K A;  4X6A J;  2LOO A;  3R4K A;  2EIJ H;  1BBY A;  1MBE A;  4L9J A;  3AL0 B;  1IG7 A;  2KPM A;  2ZCW A;  3E97 A;  3I71 A;  2FNP A;  3ELK A;  1Z6R A;  5FKM A;  3OSG A;  5IT3 A;  1S6L A;  3V8J A;  2CQN A;  2MLK A;  3BCB A;  4CDG A;  4YEJ A;  2IA1 A;  1V54 H;  2JPB A;  4G6D A;  2R7O A;  3BWG A;  5J40 A;  1EJ9 A;  2RC4 A;  1JGS A;  5CVI A;  3OYB A;  1Z3X A;  1G8X A;  5B1B H;  2Y0M A;  2LTP A;  2Y0S N;  3WGG A;  1R1U A;  4Z6Y A;  2MFZ A;  4PJ0 C;  1T08 B;  1L0O C;  4M3B A;  4CZC A;  5JHU A;  3V8K A;  3LQQ A;  2LDU A;  2XIG A;  2QCO A;  2Z2S B;  3O3K A;  4ZYG A;  4XIC A;  2VBW A;  3K4N A;  1HDP A;  3VSL A;  3NAR A;  4EJV A;  5E3L A;  2A6E F;  1V5G A;  3JSO A;  1SAX A;  1ZHF A;  3Q5F A;  3OYD A;  4AIK A;  1VQ7 I;  2IBD A;  3CLO A;  1T98 A;  4GYG A;  3ZQI A;  2HXI A;  1P9Q C;  3EQL F;  5DS9 A;  4AVZ A;  5ILS A;  2BXY A;  3P9C A;  4Y33 A;  2F4O B;  4BBR J;  4CCK A;  5C44 J;  5J4V A;  3M9A A;  3BZ6 A;  1X1D A;  3GTP J;  3BP8 A;  1I1S A;  2M4K A;  2HYG D;  3LOC A;  1UG2 A;  2H94 A;  1DGW Y;  5DD8 A;  2HOT A;  2JVG A;  1YG2 A;  2QZ8 A;  3IV5 A;  5DCF A;  2XDV A;  3MN2 A;  3X2Q H;  4A0Y A;  3GX4 X;  1W1W E;  2VC0 A;  1YJN I;  5EJC A;  4EEF G;  5F64 A;  1TW3 A;  1HW5 A;  4LJZ F;  2ACJ A;  1RI7 A;  4PUS A;  4BXU A;  1M1E B;  2DFH A;  4EGZ A;  3OV8 A;  4L18 B;  3OS1 A;  2ZBK A;  5EGO A;  1HW2 A;  3VFZ A;  1I50 J;  2XKP A;  1LB2 A;  5E20 A;  2H27 A;  4FQG A;  2R5Z A;  2F5E A;  5FGM A;  1E3H A;  4XK4 A;  1XMX A;  2R7D A;  3GTM J;  2XSD C;  1T95 A;  2JMW A;  2NVX J;  3QU6 A;  2QWW A;  2XB5 A;  4I0A A;  2XKO A;  3Q0W A;  4BHB A;  1KON A;  4E4H A;  4PGH A;  4XOT A;  5L3B A;  2DJN A;  4A6E A;  3SZG A;  1S29 A;  4M3G A;  2CUJ A;  2OV7 A;  4V2G A;  1K4T A;  1JHH A;  1WI9 A;  2JVH A;  3KZZ A;  4BNC A;  3J81 Z;  3LMM A;  2O61 A;  1RIO H;  1IN5 A;  3EUK L;  4MTD A;  5IPA A;  3HC7 A;  4OIQ F;  4M6V A;  1OCO H;  2JN6 A;  3Q0U A;  3BZK A;  4I01 A;  1GVJ A;  1WH5 A;  4PSW A;  1IXC A;  3G1L A;  1R00 A;  3VOE A;  3M8E A;  1JGG A;  1J2X A;  2ELH A;  4A6D A;  2K85 A;  4II2 A;  3IRQ A;  1ZRE A;  3PUF A;  5BMZ A;  1UST A;  1TQI A;  4M71 A;  5IP7 J;  2WY7 Q;  3U21 A;  1K6Y A;  4HLY A;  4OIO F;  3R0A A;  1MSF C;  2KMU A;  4Y7N J;  1SFE A;  1TNT A;  3A0H C;  3G71 I;  4RDU A;  2K9Q A;  4ITV A;  3DKY A;  1RC9 A;  2FBI A;  4CIC A;  4NB5 A;  3A01 B;  2EB7 A;  1U6G A;  1VQO I;  1WJ5 A;  2MLG A;  5DUK A;  2M4G A;  3GF2 A;  3LA2 A;  5HLG A;  5TGT A;  1F4K A;  3DKX A;  3PIO F;  3ZMZ A;  4B43 A;  1WFX A;  1J5Y A;  2EV5 A;  2A5W A;  2OF7 A;  2FNA A;  3HOS A;  3NEU A;  1HQC A;  1IXS B;  3S1R J;  1T0F A;  4D9J A;  3CCV I;  3IKT A;  5TRD A;  1YOV B;  4IHY A;  1KQ8 A;  2L7Z A;  3IP4 B;  5B66 C;  3ZR8 X;  2M7B A;  3TBI A;  1G2H A;  1MH4 A;  3ML6 A;  2ZB9 A;  4L0Z B;  5F1J A;  2ZJP F;  1X4P A;  5LHG A;  3DFG A;  3QPT A;  4ZTJ A;  3CCE I;  2KIU A;  1FLI A;  3I3L A;  2FUG 2;  1BOA A;  2MD0 A;  5HLT A;  4UVA A;  2LFB A;  2ZO4 A;  3L2Q A;  3FM5 A;  3V7C A;  3CCS I;  1O57 A;  4AIH A;  3M3Y J;  1ZR2 A;  2IJL A;  2WAQ N;  1DQU A;  3BJA A;  2HYJ A;  3GME A;  4ZDL A;  5FFX A;  5HS9 A;  1FX7 A;  3JRH A;  1XSX A;  1YFH A;  1I6X A;  2CW0 F;  2I10 A;  1C0W A;  4IL6 C;  4WWC A;  1YQA A;  2DK5 A;  2RNJ A;  1XMA A;  2EIM H;  2RN7 A;  4BQA A;  1A5J A;  5F08 A;  2J5P A;  3TDZ C;  3RZD J;  3QPS A;  3W2W A;  2AXT C;  5F0F A;  3TL4 X;  4HZF A;  1P4A A;  3A03 A;  1X1C A;  3PQJ A;  1SEU A;  2FSW A;  3K7A J;  4IKF A;  2Z3Y A;  5JVT A;  2VOO A;  1FOX A;  2VIX A;  3FKI J;  1TL8 A;  4W97 A;  2CSO A;  2XSJ C;  4UUT A;  5F6F A;  2M0M A;  3K70 D;  1T8I A;  1TNS A;  1PYV A;  3B02 A;  1RPW A;  5BQT A;  2A07 F;  1FYM A;  2G9W A;  3LA3 A;  3F21 A;  2UZK A;  4I6Z A;  4R1H A;  1ZYR F;  3S3O A;  2JUC A;  2MGQ A;  1IC8 A;  1BR4 A;  3WHC A;  1T0F C;  3DTI A;  4L5J A;  5J6X A;  1XS9 A;  2XGE A;  2JA2 A;  2O8K A;  2Z5U A;  2MH2 A;  1RR8 C;  1REP C;  4OIR F;  3CCU I;  2BHY A;  4RAF A;  2E5Z A;  2PJR B;  4XKV A;  1G3W A;  4A3B J;  3CJT B;  2RAE A;  2DDB A;  1IRZ A;  2MC4 A;  1ZGW A;  1R71 A;  3FXQ A;  4OIN F;  2VBY A;  2EIK H;  1WJB A;  3QPL A;  5LFA A;  5FJ8 J;  2A3S A;  1YX3 A;  5E18 F;  2O03 A;  1ZAR A;  4LLG F;  3H35 A;  4WX9 A;  2VKE A;  1VQ9 I;  5L3G A;  1W36 C;  3ZCO A;  2GOX B;  3RKQ A;  5M3F J;  2OUM A;  2PN6 A;  2FQ3 A;  3PJR A;  2O6G E;  3AG1 H;  3I4P A;  4DOZ A;  4I02 A;  1G59 A;  2Z16 A;  2QA4 I;  2FOW A;  2HI3 A;  3GZ5 A;  4DJA A;  3CMM A;  1S7E A;  4RB3 C;  4Y52 J;  2RQQ A;  2Y31 A;  3JTH A;  3F8B A;  3Q0V A;  3H1C A;  4HLX A;  2N8G A;  4CCO A;  3BLY A;  2M1B A;  4M3D A;  5IYB J;  2FX0 A;  1UCR A;  1U8B A;  2V7F A;  2FXA A;  4GYI A;  2EFW A;  1EH8 A;  3MFK A;  1IRG A;  1ORK A;  2R93 J;  3HEF A;  5CJ9 A;  2C6Y A;  1O3S A;  1STZ A;  2LF8 A;  2E2I J;  3LNQ A;  3FMS A;  1WZ2 A;  3K1M A;  3C7J A;  2OQG A;  1YYV A;  4PFO A;  4L9V A;  1E17 A;  4C3H J;  4LIV A;  1MKM A;  2DLL A;  4UUS B;  2DPD A;  3F22 A;  2DQL A;  3A4C A;  4IXA A;  4AYB A;  3CMA I;  3LWF A;  4XL9 A;  1JKQ C;  4XM3 A;  1VQL I;  4UY8 I;  1VFC A;  1V5E A;  3S93 A;  4FCY A;  3L2V A;  4LD5 A;  2A69 F;  3CME I;  2L3D A;  4U0V A;  2ESH A;  1E3O C;  2ICW G;  5FRN A;  4NHJ A;  1S8N A;  3SFZ A;  3K4C A;  3ZMV A;  4F3Q A;  5HNF A;  3I55 I;  5E8G A;  3GXO A;  1ITY A;  4KJZ A;  4ENJ A;  1JXS A;  1Z7U A;  1MBK A;  2P5L C;  2LKX A;  1XC5 A; 
#chains in the Genus database with same CATH homology
 2XAS A;  3HTS B;  2M87 A;  2QEN A;  1B4A A;  2QLZ A;  3BPX A;  3SZT A;  5LGN A;  1FBQ A;  2BV6 A;  2NS0 A;  4LLN A;  4LLL A;  2AS5 F;  1G4D A;  3V4G A;  5D8K B;  1YW9 A;  1ZGA A;  1R22 A;  2CO5 A;  1DPR A;  1MJ9 A;  3BDD A;  1PDN C;  3WE3 A;  2EFO A;  1BC7 C;  1SD4 A;  4IJA A;  3QP6 A;  1TTY A;  3GW2 A;  1H0M A;  2G7U A;  3SZP A;  1RZ4 A;  3RJP A;  1ULY A;  3C18 A;  2UXN A;  1T38 A;  5CYV A;  3VEP A;  2KJB A;  2Q0O A;  3MZY A;  3O6B B;  3BJ6 A;  4ZYD A;  3TGN A;  3K2Z A;  2LF7 A;  1Q1H A;  1K79 A;  2BYV E;  2K02 A;  4G94 A;  2EFN A;  1U8R A;  3HHG A;  1AWC A;  2Q8K A;  1QZZ A;  4IHT A;  5LEK A;  4ESF A;  1RUO A;  1BIA A;  2YX4 A;  2QVO A;  2CWE A;  1KU3 A;  2JZY A;  1GXQ A;  1FWZ A;  2VOD A;  3FM3 A;  4I98 B;  5DEQ A;  3EET A;  1FOK A;  1I27 A;  1P2F A;  1R7J A;  2D1H A;  4P55 A;  3I58 A;  5E17 F;  4ENK A;  1FZP B;  2JPC A;  2JSC A;  5AIQ A;  2VE8 A;  4ENN A;  2FA5 A;  4BYY A;  3VOD A;  2FRH A;  1G3Y A;  1B6A A;  1I1G A;  4A2U A;  3KET A;  3DPL C;  3L2C A;  2HYF A;  4B09 A;  1G3T A;  4EJU A;  1YS6 A;  3F6V A;  4XLN F;  3RIR A;  3HRT A;  3HSF A;  4YII A;  5A2Q Z;  3HYI A;  1NHA A;  1T39 A;  3SHF A;  4O5V A;  4OMZ A;  1UHM A;  2ADU A;  4KIB A;  1K78 B;  1U5T A;  4LB5 A;  2ISZ A;  4HW0 A;  2HDC A;  3GFL A;  1W4M A;  2HTJ A;  1XDU A;  4U7B A;  1SFU A;  2X0L A;  3KP3 A;  1O3T A;  1BI2 A;  3HSE A;  1MDM B;  1DPU A;  4WXC A;  1OR7 A;  5L3D A;  2XRN A;  1ONV A;  3RDI A;  1KYW A;  4KN7 X;  1D8J A;  3V8L A;  5HS7 A;  1FBS A;  2IP2 A;  4HOB A;  4OOI A;  4L5I A;  3GZ6 A;  4ZZD A;  1VTN C;  2M5W A;  4WCG A;  4N9I A;  1B1B A;  1GHC A;  3ABT A;  1B9N A;  1IN8 A;  4OIP F;  2ZXJ A;  2Y75 A;  3D5L A;  1T2K A;  2PJP A;  4LG0 B;  4G7O F;  3U2R A;  3KFW X;  2LKP A;  1IXR C;  4QWQ A;  4U88 A;  3OOP A;  1OYY A;  1U78 A;  2IT0 A;  4O6J A;  1IRF A;  1SFX A;  4MTE A;  3CO7 C;  2EWN A;  2XUB A;  3GVA A;  5DCM B;  1TBX A;  1TLH B;  2WWY A;  3K1P A;  3R60 A;  1DUX C;  2BEO A;  5D4R A;  3KLO A;  2DI3 A;  1R5G A;  2D45 A;  3BOQ A;  3ERE D;  1QBJ A;  1H9T A;  4PGG A;  1FYL A;  1LDK B;  4G6Q A;  4EQQ A;  1J9I A;  1KU7 A;  4GXO A;  2EK5 A;  3MZH A;  4RAY A;  1MJA A;  4MEY F;  1F9N A;  1XMK A;  4A5N A;  4Y15 A;  2LNB A;  1K6O A;  5CVJ A;  4FX4 A;  3FMR A;  1IF1 A;  1IW7 F;  3ZP5 A;  4KN4 X;  3QU3 A;  3HRS A;  2O0Y A;  4HBL A;  2WTE A;  4XSZ F;  2FBK A;  4KDP A;  1ZAO A;  3TKY A;  1YTY A;  1HST A;  4P9F A;  2F5D A;  4CXF A;  4R79 A;  2GIV A;  1IN6 A;  5IT9 Z;  1FT9 A;  3N97 A;  3DXJ F;  3GFJ A;  3JTG A;  1HSJ A;  1YS7 A;  2GWR A;  4LG0 A;  3BY6 A;  3K69 A;  1P4W A;  5D5X B;  2STT A;  3J80 Z;  5ICF A;  4HV5 A;  1Z91 A;  3J7A O;  1P92 A;  1X3U A;  1IAW A;  4Z2Y A;  1I5Z A;  5D5V B;  4IRI A;  2KIF A;  4UVB A;  1B9M A;  1OMI A;  1Z9C A;  2EA4 A;  5EEH A;  1MGT A;  4MHG A;  3JSP A;  1FYK A;  5K5O A;  4JBA A;  1ZLK A;  1R23 A;  3B73 A;  5FFZ A;  3CUQ A;  4RGR A;  3FXU A;  4QLC U;  2Y48 A;  1RNL A;  5BOX A;  1XB4 A;  3E6D A;  2CFX A;  1YW7 A;  1W5S A;  1K7A A;  2DQR A;  1FP1 D;  2PFB A;  2O8X A;  1XGM A;  1W7P D;  4BAY A;  2COM A;  3AAF A;  1LJ9 A;  1WQ2 A;  2DAO A;  2B0L A;  3Q9S A;  2V6C A;  2P7C B;  3E3V A;  4I0B A;  3H3Z A;  5H6Q A;  2OZ6 A;  2DFI A;  3H92 A;  4LGW A;  5K5Q A;  2W25 A;  2HZT A;  4F7Z A;  1USS A;  1J7K A;  4AWX B;  3LQR A;  4MQV A;  3I5U A;  4PZJ A;  2VON A;  5LHI A;  5ED4 A;  4U7D A;  4ZYH A;  4E70 A;  2ZJ2 A;  5EEG A;  2GZW A;  1W7P A;  3DP7 A;  2E7W A;  2P5K A;  2NNN A;  4HYE A;  3DKW A;  2BGC A;  4EV0 A;  4YIF A;  2PMU A;  3HTU A;  1OYI A;  2OU2 A;  2BE5 F;  2STW A;  4KMU X;  3IWZ A;  3EUH A;  3IRR A;  2VXZ A;  2A5Y B;  3F8F A;  1O7L A;  4G7Z F;  4UHT A;  2VT3 A;  3GUD A;  1YO5 C;  2QBY A;  3LAP A;  1ON2 A;  2K4B A;  3GLX A;  1FSH A;  5LBQ A;  2W85 A;  2FMY A;  4B8X A;  2CYY A;  1SMY F;  2Z33 A;  3ZPL A;  1R58 A;  3COA C;  4Q48 A;  4GO1 A;  3JAM Z;  1ZRD A;  2P7V B;  3FWE A;  1GXP A;  4EM0 B;  1BIB A;  4ZYE A;  3O2P E;  4GGG A;  2GQQ A;  3WU1 B;  2FE3 A;  2V1D A;  3QPH A;  3F6O A;  3QOP A;  3G73 A;  4XRF A;  2HQN A;  2FBH A;  3C1D A;  3HOT A;  4UV9 A;  4G9Y A;  3QP5 A;  5JR3 A;  2DTR A;  1MD0 A;  3LA7 A;  1SD5 A;  2DU9 A;  2DBB A;  3ZMD A;  4RAZ A;  3KP7 A;  2OD5 A;  3E5U A;  2F5F A;  2KRF A;  1F5T A;  4HX7 A;  2IA0 A;  3K1N A;  4KIC A;  2E1C A;  3IC7 A;  3M8F A;  1RUN A;  1LDD A;  3V7R A;  1Y0U A;  4IRG A;  5L3E A;  5DCM A;  5HDG A;  1S7O A;  1XGN A;  2WC2 A;  2O3F A;  3KP5 A;  3ECH A;  1XGO A;  2DW4 A;  1IUY A;  3VB2 A;  4LFU A;  1Z1D A;  4YG2 F;  2VE9 A;  2HFH A;  5LGU A;  3F8N A;  2V79 A;  2V1U A;  1WSU A;  4I2O A;  1BI0 A;  1YLF A;  1BI1 A;  5FO5 A;  1O7F A;  2QBY B;  4PCQ A;  1JHF A;  2OZU A;  5FB2 A;  1B59 A;  1ON1 A;  3TDU C;  1V4R A;  2BBY A;  3QRF F;  4HF0 A;  3FHZ A;  2PI0 A;  2CGP A;  5LHH A;  2M8E A;  3ZMT A;  4P5O A;  4M72 A;  1QQI A;  1E2X A;  4EJT A;  2IW5 A;  1MZB A;  1R36 A;  3F23 A;  1H9G A;  5H20 A;  1KA8 A;  5FD5 A;  3HRM A;  4A0Z A;  3I59 A;  4ESJ A;  2OQR A;  1LEA A;  4EM2 A;  2W24 A;  3CTA A;  3DPT A;  3IL2 A;  3W6K B;  4CHU A;  4TV7 A;  3J81 K;  4ETS A;  1BM9 A;  2IRF G;  3T0Y A;  4KT5 C;  1BC8 C;  3T5X A;  3J80 K;  2GA2 A;  1CF7 A;  3MEX A;  3KLN A;  4PDK A;  3RI4 A;  4RB0 A;  1EH7 A;  5LEJ A;  4AVP A;  3WTS C;  2ESN A;  1XGS A;  2UXX A;  1TQP A;  4ON0 A;  2GA1 A;  3MQ0 A;  4YFX F;  2EFP A;  1ZH5 A;  4RGS A;  1WKM A;  3KEO A;  3TOB A;  3KP2 A;  4OU0 A;  1KQ0 A;  2PMH A;  3KE2 A;  1YIO A;  4EMS A;  5DD4 A;  2JTV A;  1UFM A;  3WTW C;  2FML A;  3BRO A;  3FXR A;  5ICG A;  3MAJ A;  4G8X A;  2M45 A;  1O3Q A;  3RKW A;  4S05 A;  2ZNZ A;  1IN7 A;  2GXB A;  2HKO A;  3SXY A;  2XAQ A;  4XLP F;  3ABU A;  5L3C A;  3H3U A;  1CF7 B;  3LST A;  1CGP A;  1XSV A;  1FP2 A;  1R5H A;  3ECO A;  3HRU A;  4Q5S F;  4LK0 F;  1A04 A;  5DV5 A;  2DT5 A;  2ETH A;  4H0E A;  4Q4Z F;  1QZY A;  3FF5 A;  3MWM A;  2A6H F;  1HKQ A;  1F1Z A;  1MJB A;  1MDM A;  2TDX A;  2H09 A;  3E6C C;  4HX4 A;  5LRR A;  1G3S A;  4R8H A;  1R1T A;  3HHH A;  1SMT A;  2RV8 A;  1HXD A;  3KCC A;  4KUM A;  4AIJ A;  1DDN A;  2MH9 A;  2LSO A;  1BJA A;  5CVV A;  1P6R A;  3I53 A;  4LMY A;  1UHW A;  5JFR A;  1D5V A;  5FLX K;  4BHP A;  5LGT A;  2KKO A;  2YSR A;  3REO A;  3I64 A;  2NAZ A;  3KP4 A;  4M6X A;  1LVA A;  3P7N A;  2IVM A;  1KGS A;  1R1V A;  5ICE A;  4XSX F;  2NRA C;  2VBX A;  4FX0 A;  2E7X A;  5CVR A;  4KYW A;  4M6Y A;  4UNO A;  1FC3 A;  4HQE A;  3JW4 A;  3KEQ A;  2P6T A;  2K7L A;  1ZRC A;  2MC3 A;  4ASN A;  4L0Y B;  2F2E A;  3LAJ A;  3GFI A;  5H6R A;  5E1X A;  1G6N A;  3ZN1 A;  4N0B A;  4UXN A;  4MNU A;  2P5L C;  4HQM A;  5HOO A;  4HF1 A;  3TO9 A;  3R61 A;  5FLX Z;  1FPQ A;  2IA2 A;  2K86 A;  4MQ9 F;  3F72 A;  3FX3 A;  3IHU A;  2AXL A;  5BPI A;  3F8C A;  4HF2 A;  4P96 A;  4CYD A;  4UVC A;  4WK8 F;  3EDP A;  4EGY A;  3RPQ A;  4M9X A;  2XRO A;  4Y17 A;  3EYY A;  4S04 A;  2KJC A;  2HQR A;  1YW8 A;  3NRV A;  4P9U A;  3M7G A;  2NNY A;  2WV0 A;  5CLS A;  1HBX G;  4KA4 A;  2VC1 A;  2UWM A;  3L7W A;  4M9Z A;  3M1E A;  3GFM A;  1D3Y A;  4EJO A;  3WG9 A;  5KK1 A;  4DNC A;  1HKS A;  3WTY C;  2EJR A;  1K78 A;  2PQ8 A;  2CG4 A;  1PP8 F;  3SQN A;  1HW1 A;  2EV6 A;  4D0P A;  2QQA A;  4HV6 A;  4MGR A;  3WTX C;  4EM1 A;  3GWZ A;  1UB9 A;  1QNT A;  3R0J A;  1T6S A;  4N9H A;  2P4W A;  5TJJ A;  5BPD A;  3K9T A;  3HUG A;  2L4A A;  2PEX A;  1ZG5 A;  2K4J A;  3HIF A;  3ROU A;  4XBF A;  3JAM K;  1OYW A;  1W7P B;  3ZMU A;  1S3J A;  2ZFW A;  3L9F A;  2VOP A;  3EYI A;  5HDN A;  2HR3 A;  3IWF A;  1Z6T A;  2VT2 A;  3G3Z A;  3ULQ B;  2OBP A;  5A2Q K;  5D6E A;  4HDV A;  5J8F A;  4A12 A;  3CUQ B;  1LNW A;  3WTV C;  2FF4 A;  3S2W A;  5HDK A;  3KP6 A;  4ZZL A;  4Y13 A;  3I54 A;  4A5M A;  3QAH A;  2PLY A;  2L02 A;  4U0Y A;  3T8R A;  3CO6 C;  3ZMS A;  3KZY A;  2Z9O A;  3K0L A;  3WTU C;  2QYO A;  3L09 A;  2R7F A;  3TQN A;  2FEZ A;  1AOY A;  3N4M A;  3E6B A;  5ICC A;  5LRS A;  4ESB A;  4ZH4 F;  4M9S A;  2RKH A;  2V1X A;  2K27 A;  1V3F A;  3I0T A;  5AIP A;  2DO7 A;  3DEU A;  3GO5 A;  2P5V A;  2JT1 A;  2D1V A;  2H6C A;  4FHT A;  1ZLJ A;  5HVQ C;  5D6F A;  1XCB A;  1ZGJ A;  5ERI A;  5CVU A;  3GYH X;  2RGV A;  2DPU A;  5BS6 A;  4IHS A;  2QM3 A;  5L3F A;  2ISY A;  2YX7 A;  4HA8 A;  3TOA A;  1FY7 A;  2DK8 A;  2P8T A;  2ZNY A;  5K5R A;  2MD5 A;  4I09 A;  3CJN A;  1U5T C;  2EA2 A;  2JRT A;  3RTR A;  4CGZ A;  4FT8 A;  2YPR A;  4KMF A;  5ILV A;  4RGU A;  3WU0 A;  2HOE A;  4EVI A;  1OPC A;  2W57 A;  4BH9 A;  4KFC A;  1L3L A;  3BPV A;  1JE8 A;  3IKV A;  4JQF A;  4LB6 B;  3WGI A;  4HX8 A;  1QO0 D;  3F8M A;  2RVC A;  1J59 A;  1S7A A;  2E1N A;  3C3W A;  1PUE E;  4UV8 A;  4AD9 A;  2YR2 A;  2VN2 A;  1XDS A;  3U9G A;  2F5C A;  2GXG A;  5HS8 A;  5K1Y A;  4HAM A;  3WE2 A;  2A68 F;  1IN4 A;  2XAG A;  1XCV A;  2EFQ A;  5AON A;  6PAX A;  4BHC A;  3ZQ7 A;  1KQ9 A;  3I59 B;  2ZME B;  3LFK A;  2M30 A;  4CO8 A;  3T8T A;  5E1Z B;  2L4M A;  4L9N A;  1U3E M;  5DUI A;  1LEB A;  3W6J B;  4GCV A;  2YU3 A;  4KIF A;  1FBU A;  5HLH A;  2HTS A;  4G7H F;  2KIM A;  4LK1 F;  2XGX A;  1QGP A;  4CZZ A;  2FOK A;  3CDH A;  3DV8 A;  1W5T A;  2D2W A;  2HEO A;  2XHK A;  1U5T B;  2NYX A;  3WTT C;  3U1D A;  4MEX F;  2ZKZ A;  5KVR A;  1BN5 A;  1KU9 A;  2RQP A;  2QUF A;  2HKX A;  2FU4 A;  3ZN0 A;  4RGX A;  3T1B A;  4HDU A;  3TO7 A;  4Q47 A;  4L9T A;  4WXD A;  2H6B A;  1WRJ A;  1J0R A;  1ODD A;  5E8I A;  3FMQ A;  1Z05 A;  1ZG1 A;  3E6M A;  5D5W B;  4IRH A;  4A0X A;  2HS5 A;  2R3S A;  3DF8 A;  5DYM A;  1TW2 A;  2RDP A;  1IZ1 A;  1OKR A;  1O3R A;  3PQK A;  3PFI A;  2XAH A;  4K2E A;  5HLI A;  4M74 A;  3V7S A;  2XAF A;  1LQ1 A;  5D4S A;  2X4H A;  1WWX A;  2L54 A;  2QQ9 A;  3BJO A;  5D8L B;  2XAJ A;  2OAZ A;  1KYZ A;  2G7H A;  1XD7 A;  1P4X A;  4RB1 A;  5FD6 A;  3P9I A;  5D5U B;  3WOD F;  3HSR A;  1DP7 P;  2Z99 A;  2XVC A;  2MA3 A;  4ENM A;  4WXH A;  4M73 A;  2OA4 A;  2W84 A;  3CUQ C;  2P6S A;  1SD6 A;  1FNN A;  2EV0 A;  3CUO A;  4I7H A;  3Q9V A;  3L00 A;  1EH6 A;  4YFK F;  1J75 A;  2XV4 S;  4JK1 X;  3E5Q A;  3RKX A;  4IPA A;  2QQB A;  3GEZ A;  1XN7 A;  1EV7 A;  5J8C A;  2J5O A;  3RYP A;  3WGH A;  1QPM A;  1LDJ A;  1KU2 A;  2Q2E A;  1BI3 A;  2VBZ A;  2HWV A;  3F3X A;  2CQK A;  1FSE A;  3P9K A;  3TO6 A;  2V9V A;  2IPQ X;  2L01 A;  3RPU A;  5ILU A;  4O3M A;  1HKT A;  3D0S A;  4YFN F;  1ZG3 A;  4OMY A;  5F1R A;  5DDG A;  4KIG A;  3MCZ A;  2PBI A;  4RS8 A;  5LLQ A;  3FZV A;  4EJW A;  2PG4 A;  5JI6 A;  3NQO A;  4IF4 A;  1SD7 A;  1TQM A;  3E5X A;  1ZN2 A;  2MBF A;  3R6S A;  3ISP A;  4WF2 A;  1ZRF A;  1U2W A;  3WTZ A;  3DQV C;  4NQW A;  3RYR A;  4RB2 C;  2HGC A;  4IVN A;  2A61 A;  4U0W A;  1XSD A;  2GAU A;  4UUV A;  1PP7 U;  2ZME A;  4DQ2 A;  3RKY A;  1D8K A;  3R4K A;  1BBY A;  4L9J A;  2ZCW A;  3E97 A;  3I71 A;  2FNP A;  3ELK A;  1Z6R A;  5IT3 A;  1S6L A;  3V8J A;  2MLK A;  4CDG A;  2IA1 A;  4G6D A;  2JPB A;  3BWG A;  2RC4 A;  1JGS A;  5CVI A;  2Y0M A;  3WGG A;  1R1U A;  1L0O C;  5JHU A;  3V8K A;  3LQQ A;  2LDU A;  2XIG A;  3O3K A;  4ZYG A;  2VBW A;  4EJV A;  2A6E F;  3JSO A;  1SAX A;  1ZHF A;  3Q5F A;  4AIK A;  3CLO A;  1T98 A;  4GYG A;  3EQL F;  5ILS A;  3P9C A;  3M9A A;  3BZ6 A;  3BP8 A;  1I1S A;  2HYG D;  2H94 A;  5DD8 A;  1YG2 A;  2QZ8 A;  5DCF A;  4A0Y A;  3GX4 X;  2VC0 A;  5F64 A;  1TW3 A;  1HW5 A;  4LJZ F;  2ACJ A;  1RI7 A;  4BXU A;  4EGZ A;  3OV8 A;  4L18 B;  2ZBK A;  1HW2 A;  3VFZ A;  2XKP A;  1LB2 A;  5E20 A;  2H27 A;  2F5E A;  5FGM A;  2R7D A;  3QU6 A;  2QWW A;  4I0A A;  2XKO A;  4BHB A;  4PGH A;  5L3B A;  4A6E A;  1S29 A;  1JHH A;  1WI9 A;  3KZZ A;  4BNC A;  3J81 Z;  2O61 A;  1RIO H;  1IN5 A;  4MTD A;  4OIQ F;  4I01 A;  1GVJ A;  1IXC A;  1R00 A;  3VOE A;  3M8E A;  1J2X A;  2ELH A;  4A6D A;  3IRQ A;  1ZRE A;  5BMZ A;  1UST A;  1TQI A;  4M71 A;  4HLY A;  4OIO F;  3R0A A;  1SFE A;  1TNT A;  2FBI A;  4CIC A;  4NB5 A;  2EB7 A;  1U6G A;  2MLG A;  5DUK A;  3GF2 A;  3LA2 A;  5HLG A;  1F4K A;  3ZMZ A;  1J5Y A;  2EV5 A;  2FNA A;  3HOS A;  3NEU A;  1HQC A;  1IXS B;  1T0F A;  3IKT A;  5TRD A;  1KQ8 A;  3ML6 A;  4L0Z B;  5LHG A;  3DFG A;  3QPT A;  2KIU A;  1FLI A;  1BOA A;  4UVA A;  2ZO4 A;  3FM5 A;  3V7C A;  1O57 A;  4AIH A;  2IJL A;  3BJA A;  5FFX A;  5HS9 A;  1FX7 A;  1XSX A;  1YFH A;  1I6X A;  2CW0 F;  1C0W A;  4WWC A;  1YQA A;  2DK5 A;  2RNJ A;  1XMA A;  2RN7 A;  4BQA A;  2J5P A;  3TDZ C;  4HZF A;  1P4A A;  3PQJ A;  2FSW A;  2Z3Y A;  5JVT A;  2VOO A;  2CSO A;  5F6F A;  1TNS A;  3B02 A;  5BQT A;  2A07 F;  1FYM A;  2G9W A;  3LA3 A;  3F21 A;  2UZK A;  4R1H A;  1ZYR F;  4L5J A;  5J6X A;  2Z5U A;  2MH2 A;  1REP C;  4OIR F;  1G3W A;  3FXQ A;  4OIN F;  2VBY A;  2A3S A;  5E18 F;  2O03 A;  1ZAR A;  4LLG F;  4WX9 A;  5L3G A;  2PN6 A;  2FQ3 A;  2O6G E;  3I4P A;  4I02 A;  3GZ5 A;  4RB3 C;  3JTH A;  3F8B A;  4HLX A;  2M1B A;  1UCR A;  2FXA A;  4GYI A;  2EFW A;  1EH8 A;  3MFK A;  1IRG A;  5CJ9 A;  2C6Y A;  1O3S A;  1STZ A;  2LF8 A;  3FMS A;  3K1M A;  3C7J A;  2OQG A;  1YYV A;  4L9V A;  1E17 A;  1MKM A;  2DLL A;  2DPD A;  3F22 A;  2DQL A;  4IXA A;  5IT9 K;  3LWF A;  4LD5 A;  2A69 F;  2L3D A;  4U0V A;  2ESH A;  4NHJ A;  1S8N A;  3SFZ A;  3ZMV A;  5E8G A;  3GXO A;  4ENJ A;  1JXS A;  1Z7U A;  4KNY A;  5E1W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...