1BBYA

Dna-binding domain from human rap30, nmr, minimized average
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RAP30
publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bbyA00
1O3RA 1XD7A 1YYVA 1HSJA 3C1DA 4HQEA 4CHUA 1D5VA 1DPRA 4EM1A 3HRSA 3JAMK 3GZ5A 2DW4A 4G9YA 1V3FA 3RPQA 4BYYA 1I6XA 2W84A 2BBYA 2G7HA 3MFKA 5IT9Z 2STWA 5KK1A 3NQOA 2HWVA 3ABTA 2QQ9A 1HW1A 4ZZLA 2O6GE 2NYXA 5JHUA 4KNYA 2YU3A 3DFGA 1TNSA 4IRGA 3SZPA 1USSA 5DYMA 3HTSB 1RI7A 5JVTA 2Z99A 2C6YA 3V8JA 2PLYA 3BDDA 3LWFA 2YSRA 4CXFA 5K5RA 1TLHB 4OIOF 1ZH5A 1LVAA 4KUMA 2FNPA 1ON1A 1BN5A 4WWCA 3RYPA 4M74A 2HEOA 2FEZA 2EFWA 2L4AA 1RUNA 2HTJA 2O03A 4BQAA 1J7KA 4LK0F 4BAYA 3WE2A 2HYFA 1ZRCA 3DV8A 4UV8A 3F8NA 3S2WA 1OR7A 2CYYA 1SD7A 3Q9SA 2RVCA 4YFNF 1IN6A 1QZYA 4ZH4F 4IJAA 1I5ZA 3O2PE 3KEOA 2OU2A 5HDKA 4MTDA 1E17A 2H6BA 2M5WA 2P6TA 4MQ9F 4O5VA 1O7FA 3T8RA 4ETSA 1YW9A 4KMFA 3K69A 5LGTA 3C7JA 3E5XA 5ED4A 4BHCA 1J5YA 1U5TC 2XAGA 1W7PD 2HR3A 3ZMZA 2CWEA 1FPQA 4KYWA 3E6DA 3KP3A 2A69F 2PJPA 2PQ8A 1SMTA 2O0YA 1FY7A 1MGTA 2ZFWA 4G6QA 2VBXA 3WG9A 2QLZA 2H94A 3GZ6A 1HW2A 4L5JA 3TO6A 1R36A 2K4JA 4R1HA 1QBJA 3ECOA 1STZA 3JW4A 3KZYA 2BGCA 2O8XA 2YX7A 5CVVA 1XSDA 1S6LA 3EUHA 2XROA 2HYGD 2YX4A 4LG0B 4R79A 3IKVA 4OIRF 4EVIA 3VODA 3E6BA 1W7PB 4LD5A 4L9JA 4M9SA 2AXLA 1ZHFA 4G8XA 1FLIA 5FFZA 2L02A 5AIPA 4KIGA 4F7ZA 3E3VA 1SD5A 2LNBA 3HRUA 2RGVA 5HOOA 4WX9A 1KQ8A 3J81Z 1FYMA 1Y0UA 2F5DA 2Q8KA 4A0YA 1AWCA 1REPC 3P9KA 5L3CA 2EB7A 5D4RA 3GW2A 3M8EA 1F9NA 1P4XA 4KN7X 2NS0A 3I0TA 2XUBA 2EK5A 4B8XA 4I09A 1AOYA 3ERED 1E2XA 4G94A 1S3JA 3TO7A 2JSCA 1IN8A 4QLCU 4KN4X 4RAZA 1ZN2A 3ZQ7A 3F72A 4KMUX 4A5MA 4A6DA 5JI6A 1F1ZA 2NRAC 2HZTA 4MEYF 3ZPLA 1XMKA 2DK5A 1JXSA 2FQ3A 2ZKZA 3FXUA 1O3TA 4FX0A 1B59A 3TDZC 3C3WA 2JPCA 3H3ZA 2W57A 2K7LA 1FP2A 3BROA 5LLQA 3WODF 1IXRC 2ISYA 2MD5A 1ZGAA 3LA2A 4WXHA 4YIIA 4AIHA 1BJAA 3CTAA 4BH9A 2HQNA 3FF5A 1Q1HA 3QP5A 4AVPA 2ZNYA 1FSEA 4M71A 1XCVA 5LRRA 4KIFA 3G3ZA 4I2OA 2VODA 2HOEA 3LSTA 2ZMEA 4ASNA 3EQLF 1LEAA 2GA2A 2COMA 2XVCA 1KU9A 5LGUA 4MNUA 4EJOA 2HGCA 3M8FA 1R58A 4WCGA 5D6FA 2IVMA 3GX4X 4HA8A 2GXBA 5K5OA 3LA7A 1ZARA 3BJAA 4PCQA 5J8FA 1UHWA 2PMUA 1XB4A 4HYEA 2A68F 1SFXA 1UFMA 4HLXA 5DCFA 2VE9A 2DLLA 1FBQA 1ZG1A 1JGSA 1XN7A 3TOBA 2V79A 3DPTA 3WGGA 2VN2A 1K7AA 5DUKA 3WTVC 1L3LA 4HV6A 3MZHA 1R1UA 1UHMA 4DQ2A 3I5UA 1YW7A 1S29A 5BPDA 4MHGA 5HLHA 2OBPA 3IWFA 4ON0A 4CGZA 1BI1A 2VBWA 3VB2A 2IA0A 2FMLA 2RKHA 3WTTC 3JAMZ 2F5EA 5LEJA 2K02A 3ML6A 3RI4A 4DNCA 3WE3A 2EV0A 2ZO4A 2PFBA 4M73A 1XGNA 2DQLA 2ESHA 2K27A 4M6XA 3QU6A 4EGZA 1Z1DA 5L3BA 2A6EF 2DU9A 5A2QK 2UWMA 2FSWA 5E1ZB 1I1GA 3QPTA 2OAZA 4JK1X 1U8RA 4CO8A 4UUVA 4L9NA 2ADUA 2ZXJA 2XKOA 1Z05A 1QGPA 2V6CA 2X0LA 3JTHA 2IP2A 4A0XA 4A12A 4OIQF 5D5VB 2DQRA 2MLGA 2CGPA 1R1TA 3HSFA 1J75A 2EWNA 1RNLA 4LK1F 3DKWA 3LQQA 1IUYA 4BHBA 3DP7A 2VC1A 2WC2A 2QQBA 5BS6A 4OMZA 5HS7A 4L18B 4U88A 5HDNA 3CDHA 3KP6A 2DK8A 3TOAA 1VTNC 4LMYA 4XLPF 4IXAA 5E17F 3LQRA 1U5TA 3GFLA 1TQPA 4GYIA 1ZGJA 4RS8A 2EV6A 4HX7A 1LDDA 3SQNA 1HKQA 1V4RA 1B9NA 4HDUA 2L54A 2LDUA 4FX4A 5LHIA 1DUXC 4EM0B 2W25A 3ULQB 1PDNC 3I59A 3JSOA 1PUEE 4HQMA 3RJPA 3J7AO 2JTVA 3I4PA 2JRTA 2ELHA 4Y13A 3HRMA 1ZLJA 4M9ZA 2EFNA 2HQRA 2FNAA 1K78B 1FYLA 3EYYA 2VT3A 1R5GA 4EM2A 2QM3A 1G6NA 2ZCWA 2RQPA 2STTA 2BYVE 2WTEA 3ZMTA 4AD9A 2DO7A 4M9XA 2PN6A 3F23A 2YR2A 3T5XA 2L4MA 5DCMB 4ZYGA 4JBAA 5CJ9A 2DAOA 2J5PA 1P4WA 1T38A 1B4AA 1IN4A 1SFEA 2ZNZA 1BIAA 3VFZA 3HTUA 4UVCA 3JTGA 3FXQA 4HDVA 2XHKA 3BP8A 1D3YA 1MDMB 2WV0A 2NNNA 2K86A 4YG2F 4G7OF 2M1BA 3IHUA 2O61A 3ISPA 1HKTA 4R8HA 4ZYDA 1MJ9A 4Q47A 2FBHA 4GGGA 1TBXA 3O3KA 4CICA 2DFIA 3GUDA 5HDGA 5F6FA 1GHCA 2RNJA 4P5OA 5FFXA 5DD4A 2P7CB 1H9GA 2LF7A 1ULYA 5ILVA 3RYRA 2QWWA 3ZMUA 3ZN1A 3ZN0A 1A04A 2PI0A 3RDIA 3WU1B 2ZJ2A 4YFXF 1DDNA 5FD5A 3FMSA 3KP4A 2KRFA 5E8IA 5HLGA 4H0EA 2M8EA 2PG4A 3Q5FA 2E7XA 1TTYA 2HKXA 2XAHA 5LHHA 1IRGA 4EJVA 3WTSC 5D5XB 4RGUA 3GLXA 3BZ6A 3KP5A 4EV0A 2YPRA 3KLNA 2EV5A 2KIUA 1BOAA 1R22A 3WTUC 4AIKA 4EMSA 1ZRFA 5LBQA 3COAC 4U0YA 1YW8A 3HOTA 1S8NA 5EEHA 4G6DA 1G3WA 3M1EA 3FM3A 1F5TA 3ZP5A 2K4BA 1FC3A 5CVIA 1P6RA 3E6CC 5HS8A 5BMZA 1XDSA 2F2EA 4PDKA 2P6SA 1CF7A 3E5QA 2CO5A 2A3SA 1FBUA 2HKOA 2H6CA 4AWXB 1XMAA 1ZLKA 4HW0A 1OMIA 1IZ1A 5K1YA 3Q9VA 4GYGA 1SMYF 4I98B 2IW5A 3QAHA 4XSXF 2QBYA 2A61A 3E5UA 1YTYA 2AS5F 4OMYA 2IA1A 2DBBA 1YQAA 1PP7U 4ZYEA 4RB1A 2VOPA 4CYDA 3GWZA 3I71A 4OIPF 1YIOA 4OINF 5CVUA 5L3DA 1LDKB 2F5FA 2D2WA 3KP7A 4N9IA 2Q0OA 4Q5SF 1KGSA 3CUQC 2ESNA 4OU0A 3GFIA 2P5LC 2RC4A 2WWYA 2ISZA 5IT9K 1XGSA 3GXOA 3DXJF 3LFKA 4P9FA 5D8LB 1HBXG 2QZ8A 2IA2A 1I27A 2H09A 2VBZA 1HW5A 1R7JA 4EQQA 3IRQA 5HLIA 4IHTA 3MEXA 1WWXA 1D8KA 1XGOA 4ENNA 3V7RA 4O3MA 5L3FA 5LRSA 3HHGA 4HOBA 4I7HA 3CLOA 2KJBA 1D8JA 1T6SA 3C18A 3REOA 5D8KB 3M9AA 3N4MA 4PZJA 4PGHA 3WTYC 4IRIA 1IXCA 2L3DA 2UXXA 1FSHA 2GWRA 2VONA 3L7WA 3TQNA 4G7ZF 2IRFG 2QUFA 1B1BA 1FP1D 2LF8A 2FBKA 3VEPA 5BPIA 3GYHX 2RDPA 2KJCA 1BI3A 4KIBA 2GQQA 4L5IA 2XRNA 2X4HA 1UCRA 5FB2A 3F8MA 4FT8A 2O3FA 1XSXA 1T39A 3L00A 4LB6B 2Z33A 2VC0A 1R5HA 4A5NA 4XSZF 5ILUA 4IHSA 3KLOA 2XAQA 1BI0A 2FXAA 4ESBA 4HF2A 1Z6TA 5TJJA 4S05A 4ESFA 1F4KA 4RB3C 2P5VA 3T1BA 4EGYA 1EH8A 1EV7A 2D1VA 1NHAA 2XKPA 1O57A 4WXDA 5JFRA 4K2EA 4UNOA 1J59A 2JPBA 4KFCA 4FHTA 5J6XA 4L9VA 4HF0A 1JHHA 4ZZDA 5FLXZ 1FBSA 3K2ZA 1H9TA 2Y48A 1ONVA 2P5KA 3DPLC 4M72A 3TKYA 5DEQA 4NHJA 3RIRA 3H92A 2FA5A 2EFOA 2R7FA 1HSTA 2M30A 1ZRDA 1IF1A 2PMHA 2EA2A 3F6OA 2BV6A 1YS6A 3RKWA 2FMYA 5HVQC 3O6BB 4LG0A 3GO5A 1YLFA 5H6QA 1ZG3A 1U6GA 1W7PA 3T0YA 2LSOA 2JZYA 1GVJA 5E20A 1CGPA 4HZFA 3NEUA 4YIFA 4RGSA 4HLYA 4I02A 3R0AA 4Y15A 3F3XA 3ELKA 4P96A 4OOIA 3KE2A 3FM5A 2NAZA 3BPVA 1TW2A 3TGNA 4UV9A 3JSPA 4U7BA 3M7GA 2VE8A 3B73A 3BY6A 3K1PA 4UVBA 3J81K 5BQTA 2KKOA 3R4KA 2M87A 3QP6A 2P4WA 1Z6RA 1DPUA 5D6EA 1OPCA 3QPHA 2XAFA 4WXCA 1P4AA 1G3TA 3EDPA 4MGRA 1BC7C 1KU3A 1LDJA 1IN5A 2VT2A 1YG2A 2M45A 2OQGA 2IJLA 5CYVA 2XIGA 3WTWC 1MJAA 4ENMA 1T2KA 4IVNA 4YFKF 3RTRA 3R61A 1TQMA 3J80K 5ERIA 1USTA 1S7OA 5D5UB 3ABUA 2OA4A 5ILSA 5FO5A 3KETA 2VOOA 3F8FA 3ZMVA 3KEQA 2OZUA 4Y17A 5D5WB 3MCZA 1S7AA 2XV4S 3IC7A 2FE3A 2E7WA 3NRVA 3WGHA 3F8BA 3FMQA 5ICCA 2MC3A 1U2WA 1J2XA 4ESJA 6PAXA 3FZVA 4GCVA 4I01A 1PP8F 3P9IA 1YO5C 3SXYA 3BJ6A 4L0YB 2XASA 1Z91A 3ROUA 4EJUA 1QQIA 3R6SA 1H0MA 5LGNA 1CF7B 5JR3A 2CG4A 3K0LA 3RKXA 3U9GA 2H27A 2A07F 2EFQA 3HOSA 1HKSA 3T8TA 1SD6A 1MZBA 1MD0A 1SD4A 1LEBA 2HTSA 2MA3A 1P92A 3ZMSA 3RKYA 3CUQA 2V1UA 3TO9A 3K1MA 4EJWA 2MH9A 1FWZA 5TRDA 1K79A 1FZPB 2R7DA 2R3SA 1J0RA 4QWQA 1FYKA 2QQAA 5ICGA 4CZZA 1B6AA 1KU7A 3I54A 2FOKA 3P7NA 4N0BA 3FXRA 2GIVA 1RZ4A 4XBFA 3V7SA 2KIFA 1U78A 1T98A 3KP2A 1R23A 4S04A 1OKRA 3OOPA 2P8TA 2UXNA 3K1NA 3FX3A 1UB9A 5E18F 3HHHA 2E1NA 4EJTA 2J5OA 1Z9CA 1BM9A 4KA4A 2D1HA 3WU0A 3BOQA 1ZYRF 1XGMA 5ICFA 2FF4A 4LLGF 5E8GA 1XSVA 4U7DA 2DTRA 4MQVA 1ZAOA 2Y75A 5DDGA 3F22A 1KYWA 2ZBKA 1L0OC 4U0WA 3IWZA 1WI9A 5E1XA 4Z2YA 5BOXA 1BC8C 2G7UA 5L3EA 1O7LA 3HRTA 3ECHA 3DF8A 1SAXA 4LB5A 3W6JB 3WTXC 2ZMEB 1ODDA 3LAPA 4XRFA 1I1SA 1KQ9A 2IPQX 1JHFA 5F1RA 4LJZF 2VXZA 3HSEA 4TV7A 4UHTA 2NNYA 5F64A 3I64A 1JE8A 3BPXA 2Z3YA 3IRRA 2ETHA 2EFPA 3I58A 1K6OA 1K78A 3GFJA 4WK8F 3SZTA 3AAFA 2QENA 1R1VA 2CFXA 4Q4ZF 5DV5A 5DUIA 2CW0F 3IL2A 4IRHA 3V7CA 3MZYA 1GXPA 1OYYA 2A6HF 3MQ0A 2CQKA 1YS7A 1LJ9A 3E97A 5H6RA 5DCMA 3EYIA 3F21A 2PEXA 2P7VB 1FOKA 2DI3A 4HX8A 3MAJA 4RB2C 1G3YA 2V9VA 1HXDA 5E1WA 3U1DA 4I0BA 3MWMA 1C0WA 2V1DA 5CLSA 4M6YA 1QO0D 3CJNA 1XDUA 1QPMA 1MDMA 2BEOA 3P9CA 3SFZA 1ZG5A 1TW3A 1XCBA 5A2QZ 4ZYHA 1J9IA 3R60A 3CUOA 4XLNF 5CVJA 1KU2A 2RV8A 1EH6A 4N9HA 3QRFF 3HUGA 4GXOA 2E1CA 2V1XA 1OYWA 3IKTA 1FX7A 2FU4A 4KDPA 2XGXA 3TDUC 5LHGA 4HF1A 3D5LA 1T0FA 5KVRA 4BHPA 4KT5C 2B0LA 3KZZA 1QNTA 5H20A 2HFHA 2L01A 4MTEA 1ON2A 3GEZA 1U5TB 5D4SA 3CO7C 1LNWA 2W24A 3LAJA 3F6VA 3J80Z 4KICA 4CDGA 2OQRA 3FWEA 2A5YB 4NQWA 4ENJA 2D45A 3KCCA 1WRJA 4GO1A 1MKMA 2GXGA 2LKPA 1SFUA 4G7HF 4L9TA 1KYZA 1QZZA 1OYIA 3I59B 4HAMA 2DT5A 3E6MA 2Y0MA 4UXNA 4HBLA 1RIOH 3DEUA 5LEKA 4JQFA 4Q48A 2Z5UA 4WF2A 2EA4A 2TDXA 3LA3A 3QU3A 4BXUA 3V4GA 2MLKA 3EETA 3HIFA 2GZWA 1G4DA 2OZ6A 5K5QA 2Q2EA 3DQVC 1WQ2A 3PFIA 4A0ZA 4LLLA 2F5CA 3HYIA 1KQ0A 3V8KA 5L3GA 5IT3A 3CO6C 4RB0A 5AIQA 1BIBA 2FRHA 4E70A 2KIMA 3GVAA 2FBIA 3CUQB 2DPDA 5AONA 1O3QA 3FMRA 1GXQA 3K9TA 1W5TA 2HDCA 1FT9A 1RUOA 3WGIA 1X3UA 1WSUA 4MEXF 3G73A 2MBFA 1W5SA 4HV5A 1EH7A 3HSRA 1DP7P 4A6EA 4L0ZB 3B02A 4P55A 3L9FA 2ACJA 1FNNA 4NB5A 2HS5A 3PQKA 2PBIA 1TNTA 2UZKA 4HX4A 1IW7F 4PGGA 1IAWA 3GFMA 2MH2A 4RGRA 3PQJA 1IXSB 1ZREA 3BJOA 2BE5F 3N97A 2VBYA 2RN7A 4AIJA 4UVAA 3VOEA 4A2UA 1U3EM 2OD5A 5ICEA 2IT0A 5FD6A 1IRFA 1W4MA 3L2CA 1Z7UA 5DD8A 2JT1A 2Z9OA 3D0SA 3OV8A 2GA1A 3I53A 4LFUA 5HS9A 3SHFA 3R0JA 2DPUA 4I0AA 3U2RA 4LLNA 2QYOA 1G3SA 4U0VA 1O3SA 1MJBA 3GF2A 4IPAA 1WKMA 3WTZA 5CVRA 1IN7A 4IF4A 4ENKA 3KFWX 3QOPA 3H3UA 4O6JA 2CSOA 4RGXA 1P2FA 3L09A 4LGWA 5FGMA 2EJRA 5EEGA 1TQIA 1BI2A 3ZMDA 3FHZA 2W85A 4BNCA 1R00A 1LB2A 1KA8A 1HQCA 1BBYA 4P9UA 4B09A 1YFHA 3BWGA 2QVOA 3RPUA 4D0PA 5J8CA 2G9WA 3V8LA 1LQ1A 2XAJA 4RAYA 3W6KB 1B9MA 5FLXK 2QBYB 3F8CA 2GAUA
chains in the Genus database with same CATH superfamily
3KX2A 2R7VA 3OYJA 4X6AJ 1O3RA 2QA4I 2QQ8A 1XD7A 3L2QA 1YYVA 5IYDJ 1WFXA 3HGGA 2R7XA 1TL8A 1HSJA 3C1DA 4HQEA 4CHUA 1D5VA 1DPRA 2VJ4A 3HRSA 4EM1A 3JAMK 3GZ5A 2DW4A 3IH4A 4G9YA 3OYIA 1V3FA 4V2GA 3RPQA 3QYBA 4A3EJ 4BYYA 1I6XA 2RREA 3J7ZI 4C2TA 2W84A 2BBYA 2G7HA 3MFKA 5IT9Z 1JKQC 2STWA 1MMNA 5KK1A 3F0CA 3NQOA 3H36A 1XC5A 2HWVA 1HA8A 3CJRB 3ABTA 2QQ9A 2A5WA 3LSIA 1HW1A 4IQJA 4KT6A 4ZZLA 2O6GE 1MSFC 2NYXA 5JHUA 4KNYA 2Y30A 2YU3A 5E3LA 5J4VA 3PO3J 3DFGA 1TNSA 4IRGA 3SZPA 1USSA 1Z67A 2X6YA 5DYMA 1R9TJ 1WH5A 3HTSB 3NARA 3SYTA 1RI7A 5JVTA 2Z99A 5GADJ 1JGGA 2C6YA 1QZEA 3V8JA 1BJZA 1FMVA 2V4JC 1HF0A 2PLYA 1WJBA 3C2HA 3GZNB 3I4NJ 3A03A 5KHDA 3BDDA 3LWFA 4E7JA 2LMDA 2YSRA 4CXFA 5K5RA 1TLHB 2QSGX 4OIOF 4IZZA 1ZH5A 2E5ZA 1LVAA 4KUMA 2FNPA 1ON1A 1BN5A 4WWCA 3RYPA 1UZCA 1RESA 4M74A 5K7FA 2HEOA 2FEZA 3ESWB 2EFWA 2KZVA 2BZTA 2HQ5A 2IGOA 5F0CA 2L4AA 2DFHA 3JRGA 3ZCOA 3CF5F 2EIJH 1RUNA 1I39A 2EZHA 2HTJA 2F4IA 2JA5J 2WY8Q 1IV8A 2O03A 4BQAA 1E3HA 2WBMA 1J7KA 2Y69H 4LK0F 1R49A 4BAYA 4AM3A 3WE2A 2HYFA 2LVSA 5JVGF 3L2WA 2OTLI 3FK6A 3DV8A 1OLTA 4UV8A 3F8NA 1ZRCA 2HU9A 3CCEI 3S2WA 1OR7A 2CYYA 2LKSA 1SD7A 2DDBA 1MBJA 2L5QA 3PM1A 3Q9SA 2RVCA 3AG2H 1FTZA 4YFNF 2HI3A 3BQZA 4RAGA 2MC4A 1IN6A 1QZYA 2NS8A 1JKRC 4ZH4F 4IJAA 1I5ZA 1TWAJ 3O2PE 2KP6A 3KEOA 4PJ0C 2OU2A 1QU3A 3S8PA 5HDKA 1WJFA 2CUJA 2MYSA 3SEZA 4MTDA 3AL0B 3RQIA 2GBYA 1E17A 2FD5A 1UELB 1D1AA 2H6BA 3OY9A 2M5WA 2P6TA 2B9SA 2KMUA 4MQ9F 2JN6A 4O5VA 2X1DA 2CQXA 2HQAA 1O7FA 1VFCA 3T8RA 1HDPA 2BVMA 2DDAA 1YW9A 2PX9A 3FISA 3K69A 4ETSA 5LGTA 3CC4I 4KMFA 2K3PA 1ZKGA 1WHUA 2EH3A 3C7JA 1R4MB 3E5XA 5ED4A 4BHCA 1J5YA 1MBKA 1U5TC 2XAGA 2KT0A 2TCTA 1FIAA 5EG0A 5F04A 3MZ8A 1W7PD 2HR3A 2K5CA 1MH3A 1XPXA 4B1RA 4BY7J 3ZMZA 2CWEA 4NBQA 3GCMA 1P7IA 1FPQA 4KYWA 3E6DA 3KP3A 2A69F 2PJPA 1Y39A 2YS9A 2W00A 2LC2A 2PQ8A 1SMTA 2YU9J 2O0YA 3LL7A 1FY7A 1MGTA 2ZFWA 4G6QA 5EGOA 4F3QA 1DU6A 3CCQI 2VBXA 1SC7A 3JRCA 4RM3A 3WG9A 2LBFA 2RAEA 5J4YA 2LR8A 3RKQA 2QLZA 4BEHA 3JRIA 3G71I 2H94A 2DA6A 3GZ6A 1HDDC 1HW2A 2CW8A 2NOJB 4L5JA 2L9VA 3TO6A 1R36A 3K7AJ 3SJMA 3N05A 3O8HA 2K4JA 2P81A 4R1HA 1QBJA 1IUFA 3ECOA 2L2OA 1STZA 3FBIB 4QIWN 5B5EC 3JW4A 1SVOA 4EATA 3KZYA 4L5EA 2BGCA 2O8XA 1QHGA 2MABA 2YX7A 5CVVA 1MSEC 2V6EA 2JUCA 4FISA 5IOZA 1XSDA 1S6LA 3EUHA 4B47A 1TT0A 2ZC2A 2XROA 1ZQ3P 5F0HA 2L7MP 2HYGD 5CKTA 1QA6A 2MSYA 2KDOA 2YX4A 2DOFA 4LG0B 4R79A 5GTIC 2F4MB 4DYQA 3CCUI 3IKVA 3HL2A 3GLLA 4OIRF 4EVIA 1X58A 2H8WA 3VODA 3E6BA 2CRGA 4KJZA 4F52A 5FKKA 1W7PB 4LD5A 1R6RA 1VZ0A 2VUMJ 2L0KA 1MBFA 1F43A 4L9JA 4M9SA 2AXLA 1RRJA 4AU7A 5E3NA 3AG1H 1ZHFA 4UY8I 4G8XA 1FLIA 5FFZA 2L02A 4NC6A 5AIPA 2JA2A 1PVEA 1A36A 4KIGA 4F7ZA 2QEXI 3E3VA 2VIXA 1SD5A 1U9NA 1YX5A 4PSXA 1OQYA 2LNBA 3HRUA 2RGVA 5HOOA 3OS1A 3L1PA 2IS6A 4WX9A 2Y0SN 2ZSHB 4CUGA 5M5YJ 3CJTB 3VWBA 4UUTA 1ETYA 1KQ8A 2Y31A 4YELA 2E1MB 3J81Z 1Y0UA 2F5DA 4H4KC 4LG3A 2Q8KA 4A0YA 1FYMA 1AWCA 3HOXJ 3P9KA 5L3CA 1REPC 5IP9J 2OUMA 2EB7A 5D4RA 3ABMH 4IEJA 4M3DA 2BOLA 3GW2A 3M8EA 2XB0X 2AQFA 1F9NA 1P4XA 4KN7X 2NS0A 5EYRA 5EF6A 1X3ZB 3I0TA 1W0TA 4BQNA 2XUBA 2X51A 2EK5A 4B8XA 1UG2A 1XX5A 4I09A 4PJJA 2DYRH 1AOYA 2L7KA 2E1OA 3PIPF 3ERED 3GBGA 4Y4RA 1E2XA 4G94A 3BC8A 1BOBA 2QKLB 3FXOA 2NVTJ 2LH9A 1S3JA 3TO7A 2JSCA 1IN8A 4QLCU 4KN4X 3G1MA 3QPSA 4RAZA 4X0GA 1ZN2A 2NVQJ 1SFKA 4HSRA 3ZQ7A 3F72A 4KMUX 4A5MA 3FKJA 4A6DA 5JI6A 3KZIC 5FKNA 2X6XA 2NOGA 4BJ5C 4HPQA 1AKHA 1F1ZA 1R5ID 2NRAC 2HZTA 4MEYF 3ZPLA 3OYHA 3CC7I 1XMKA 4AC0A 4A93J 2DK5A 1JXSA 1QVUA 2FQ3A 2ZKZA 3FXUA 1O3TA 4FX0A 1B59A 3TDZC 2KHMA 3C3WA 2JPCA 2K9QA 1QPIA 3H3ZA 1A31A 2W57A 2K7LA 2JA8J 1FP2A 1NK3P 1JKPC 3OS2A 3E0JB 3BROA 5LLQA 3WODF 4XQFA 3LSGA 1IXRC 4XOPA 2ISYA 2MD5A 1ZGAA 3TW7A 3LA2A 4WXHA 1WJCA 2M7AA 4YIIA 4D5FA 4AIHA 1BJAA 2F6CA 3CTAA 4BH9A 2HQNA 4MIMA 4MLOA 3FF5A 1Q1HA 3QP5A 4AVPA 3CP2A 2V9KA 2ZNYA 1FSEA 4M71A 1XCVA 5LRRA 4KIFA 1XTAA 3G3ZA 3S16J 2ID3A 4I2OA 2VODA 2HOEA 3LSTA 2ZMEA 4ASNA 1MIJA 3EQLF 1LEAA 3JRBA 2GA2A 2COMA 2XVCA 1KU9A 5LGUA 2F5VA 4MNUA 4ZYAA 4EJOA 2LY9A 1I3QJ 1YOVB 2HGCA 4BE1A 1A6IA 2VB6A 1O4XA 4NUBA 4HG2A 4GRIA 2ZXHA 4XMYA 3M8FA 1R58A 4WCGA 4A3KJ 3QYFA 1PJRA 5D6FA 2IVMA 5C4XJ 3GX4X 1UMQA 4HA8A 2GXBA 5K5OA 2WAFA 1Y1VJ 2WY7Q 3LA7A 3IAS2 1ZARA 3VSLA 2Y0SA 3BJAA 4PCQA 5J8FA 1UHWA 2IGKA 4A69C 2PMUA 2K3FA 1XB4A 4BDYA 4ITVA 4HYEA 2A68F 1VQ9I 1ENHA 1SFXA 1UFMA 4HLXA 5DCFA 1X1AA 3CJQB 2LD5A 2VE9A 2LLKA 2DA2A 1RC9A 3UKGA 2DLLA 1FBQA 4ZC3A 1ZG1A 3BR1A 1YRNA 1JGSA 2V7FA 1XN7A 4C3IJ 3S3MA 3TOBA 2V79A 4PUSA 3DPTA 3WGGA 3DBHB 2VN2A 1K7AA 2PJRA 3MKYB 3ERMA 2HPMA 5DUKA 1EKEA 4HNTA 3WTVC 1L3LA 4HV6A 3MZHA 2Z1DA 4BQQA 3BZCA 3U1KA 2BW3A 1R1UA 1UHMA 4DQ2A 3I5UA 1YW7A 3DTEA 1S29A 5BPDA 4MHGA 3SFIA 2DA3A 5HLHA 2OBPA 3HXLA 3IWFA 4ON0A 3TW6A 3OYDA 1BI1A 4CGZA 3S1NJ 2VBWA 2R7SA 3VB2A 2ELJA 2A05A 2IA0A 3VSKA 1VQMI 2FMLA 2RKHA 3WTTC 3EUHC 3JAMZ 2F5EA 3ASNH 5LEJA 2K02A 3ML6A 2KISA 3RI4A 3IV5A 1N78A 5FRNA 4DNCA 3OIPA 2HVSA 3WE3A 1NTCA 2EV0A 3BG7A 3KIOA 3OYBA 2ZO4A 2PFBA 3DBRB 4F91B 4M73A 1GV5A 1XGNA 4PSWA 2DQLA 2ESHA 2HNHA 2K27A 3PFYA 4M6XA 4AYBN 3QU6A 1X3WB 4EGZA 1Z1DA 2L9SA 1W36D 5L3BA 3G6EI 2A6EF 2DU9A 5A2QK 3Q0UA 5HNFA 4XOTA 2UWMA 2E5NA 2FSWA 5E1ZB 1I1GA 3QPTA 2FUG2 1N75A 3IP4B 3K70C 2OAZA 4JK1X 2V26A 1YE9A 1U8RA 4CO8A 4UUVA 4L9NA 2ADUA 2ZXJA 2L7ZA 4B44A 2XKOA 1Z05A 1QGPA 4IHYA 2V6CA 2X0LA 3JTHA 2IP2A 4A0XA 1JT6A 4A12A 4OIQF 4DGWB 5D5VB 2DQRA 5KAFC 4RM2A 3ZXSA 2MLGA 3DKXA 2CGPA 1R1TA 3HSFA 2VJ5A 4M3GA 1J75A 2LKXA 4RA2A 5IYBJ 1VQKI 2EWNA 1OCOH 3IAM2 3TL4X 3TMOA 1RNLA 4LK1F 3DKWA 3LQQA 5TGTA 1IUYA 4BHBA 1GVDA 3DP7A 2ME6A 3A4CA 2VC1A 3M1CA 1QVTA 2DMTA 2QQBA 2WC2A 4OMZA 5HS7A 5BS6A 4U88A 4L18B 5HDNA 4IL6C 3BZKA 3CDHA 2CFOA 1MNEA 3KP6A 2DK8A 3M3YJ 3TOAA 4D7NA 1D5YA 1VTNC 4JX4A 3G1OA 4BS9A 4LMYA 4XLPF 4IXAA 5E17F 3JR9A 1LPQA 3LQRA 1U5TA 3GFLA 1TQPA 1YJ9I 2M4GA 1CQTA 1LVKA 2LTPA 4GYIA 1ZGJA 4A3LJ 1T56A 4RS8A 5CPRB 2EV6A 3WU2C 4HX7A 1LDDA 3SQNA 2VJIA 2XGEA 1HKQA 5GTHC 2JUGA 1UHSA 1V4RA 2NS7A 1B9NA 4HDUA 4JX6A 2L54A 2LDUA 5JLXA 1TC3C 4FX4A 4HNUA 5LHIA 5E3OA 1DUXC 1D0ZA 4EM0B 2W25A 3P5JA 1JT0A 1U8BA 3ULQB 1LFPA 1PDNC 3I59A 2DMUA 3JSOA 3FKIJ 1B8IB 1PUEE 1VQ6I 4HQMA 3RJPA 4XNFA 1WJAA 3PNTA 3J7AO 2I5UA 2JTVA 3I4PA 2JRTA 3D1NI 4Z6YA 2DA4A 2ELHA 4Y13A 1OCZH 5FLMJ 3HRMA 1ZLJA 2MGQA 4M9ZA 4AYBA 4IHXA 3PJRA 2DA1A 2EFNA 2HQRA 2FNAA 2QCOA 1K78B 1FYLA 4BEHB 3EYYA 2VT3A 2HVQA 1R5GA 2HZDA 4EM2A 5IPAA 2QM3A 2LP0A 3D5SC 1G6NA 2ZCWA 2RQPA 2STTA 2ECCA 2BYVE 2WTEA 3ZMTA 4AD9A 2DO7A 2M9HA 4M9XA 1MNMC 3OYEA 4BDZA 2PN6A 3F23A 1HOMA 3WHBA 2YR2A 3T5XA 3TBIA 2L4MA 3Q0WA 5DCMB 4ZYGA 4JBAA 3BCBA 1IG7A 5CJ9A 2DAOA 3OYCA 2J5PA 3OYNA 1P4WA 1T38A 1B4AA 1IN4A 4NDLA 3B6AA 1SFEA 2OPTA 3ZQCA 4LIUA 2Z16A 2ZNZA 4V2FA 2M3AA 2MFZA 3S2DJ 3FK7A 4E7IA 4U87A 1BIAA 3VFZA 4BE2A 3CCVI 1GLNA 2CV0A 1N25A 3HTUA 4UVCA 5IOYA 5J1UA 3JTGA 3FXQA 1JKOC 3PL8A 1ETKA 4FASD 5HNHA 1H88C 5F1JA 4W1UA 4PJMA 4HDVA 2XHKA 3BP8A 1KZHA 1D3YA 1MDMB 2WV0A 2NNNA 2K86A 4YG2F 4G7OF 2M1BA 2EZLA 3IHUA 2O61A 3DTIA 2ZJPF 3ISPA 1HKTA 4R8HA 3SZGA 4ZYDA 2VI6A 3S1MJ 1Y6IA 5B1AH 1MJ9A 4Q47A 2DCEA 2FBHA 4BU2A 3E1SA 3K4NA 4GGGA 2DJNA 1TBXA 3O3KA 5F08A 4CICA 5GPAA 4A3IJ 3GTQJ 2DFIA 3GUDA 3OOUA 5HDGA 5F6FA 1GHCA 2RNJA 2Z2SB 3GMEA 3HUGB 4JP0A 4P5OA 4RLQA 5FFXA 4BUPA 5DD4A 1POGA 4E4HA 4IOAF 5JLWA 2R93J 2P7CB 1H9GA 3E7LA 1TT5B 1ETXA 2LF7A 4A3MJ 2ELKA 1JJ6C 1SVMA 1ULYA 2TRTA 2R7UA 5ILVA 2KPMA 3RYRA 2QWWA 3OS0A 2JQ7A 3ZMUA 2FOWA 3ZN1A 1M1EB 3ZN0A 1A04A 4XKVA 3OIOA 2PI0A 3RDIA 2E1MC 1S9HA 4XRMA 3WU1B 2ZJ2A 4YFXF 1S72I 5FD5A 1HLVA 1DDNA 4A3DJ 3FMSA 3KP4A 5DTDA 1K61A 2LOOA 1V5EA 3A01B 2L7FP 1TP4A 4IHVA 1A6QA 2LG4A 2KRFA 4MFDA 1A5JA 5E8IA 5E79C 5HLGA 3G1LA 5KCMA 2OF7A 4DYRA 3M8JA 4H0EA 2M8EA 2PG4A 3M07A 4IOCF 5HODA 3Q5FA 1T95A 4XKBA 3HB9A 3PUFA 4NQWB 2E7XA 1TTYA 2HKXA 2XAHA 5LHHA 3GTGJ 4FQGA 4GDFA 1IRGA 4CH7A 1RPWA 4EJVA 3QODA 1R71A 4B3XA 1VQ4I 4MO7A 3WTSC 1E3PA 4RGUA 5D5XB 3GLXA 2B63J 3BZ6A 2EILH 2K9SA 1AHDP 3KP5A 4EV0A 3VYRB 4M3BA 1ETOA 3DLLF 2CV2A 2MG4A 2YPRA 2OJED 1V5FA 3KLNA 2EV5A 2KIUA 1BOAA 1R22A 3WTUC 5FROA 4ABZA 4AIKA 5J40A 1OCCH 2QSFX 1Z3XA 4EMSA 1ZRFA 5LBQA 4RBOA 3COAC 3FXKA 4U0YA 1YW8A 3HOTA 1S8NA 5EEHA 2BXYA 4G6DA 4XK4A 4EEFG 2DT7B 1W1WE 2LK2A 3K4LA 4CCKA 1G3WA 3M1EA 3FM3A 1F5TA 3ZP5A 4Y7NJ 4N4OB 3U21A 2K4BA 3CC2I 1K4TA 1FC3A 5CVIA 3LMMA 4CYCA 1P6RA 4E7KA 2Q2EB 2HXOA 3E6CC 5HS8A 5BMZA 1UAAA 1XDSA 2F2EA 4PDKA 4XRSG 2P6SA 3KYLA 1CF7A 3DTKA 3E5QA 4UUSB 2CO5A 2A3SA 2W82A 1FBUA 2HKOA 2H6CA 4PFPA 4AWXB 1XMAA 1ZLKA 4HW0A 1OMIA 1IZ1A 4KITB 5K1YA 4IQ4A 4D5CA 3Q9VA 2MW8A 2QSHX 3HOUJ 4GYGA 4E7LA 1SMYF 4I98B 2PJRB 2IW5A 2UV1A 3QAHA 2L9NA 5FKOA 4JYKA 4XSXF 2QBYA 1NG6A 2A61A 3E5UA 1SAUA 1YTYA 2AS5F 4OMYA 2IA1A 2DBBA 1YQAA 2N8GA 2O5RA 3KPHA 4ZYEA 1PP7U 4RB1A 1LE8B 2VOPA 2JWTA 4CYDA 4QSHA 2WAQN 3GWZA 3ABLH 3I71A 4OIPF 1YIOA 4OINF 5CVUA 5L3DA 1LDKB 2F5FA 2D2WA 2Q1ZB 3KP7A 1WI3A 4N9IA 3RZOJ 2Q0OA 4NC7A 4Q5SF 1MNDA 4IHWA 1KGSA 3CUQC 2ESNA 4FE4A 4OU0A 5K7ZA 3GFIA 3I4MJ 2P5LC 3CMMA 2RC4A 2WWYA 2ISZA 5IT9K 4XIDA 2FJ1A 1ORKA 2W48A 1XGSA 3PNYA 3GXOA 3FXJA 3DXJF 3LFKA 4P9FA 2CUZA 5D8LB 2LRDA 1HBXG 2QZ8A 3BTJA 2IA2A 1UJ8A 3HOZJ 1I27A 4XLEA 5EJCA 1X1BA 2QKMB 2VQGA 4QPQA 2VKHA 1VQ7I 2H09A 2VBZA 3CMAI 3LSRA 4CSWA 2E60A 3BR3A 1UG0A 1HW5A 3CCJI 4Y3OA 4XONA 3GTPJ 5J1RA 1R7JA 4EQQA 5GAHJ 1XS9A 4BXFA 1RR8C 3TEDA 4B43A 3IRQA 1G2HA 5HLIA 4IHTA 3MEXA 2QGUA 1WWXA 1DGRM 3FDYA 1D8KA 4FTHA 1V54H 1XGOA 4G6TB 4ENNA 3W2VA 3V7RA 4O3MA 1X1DA 5L3FA 3HHGA 5LRSA 3GTLJ 3DU5A 4HOBA 4I7HA 3CLOA 2KJBA 2M4KA 1D8JA 1T6SA 2OTJI 3LSKA 3C18A 3REOA 3JRHA 1LKXA 5D8KB 3M9AA 2WA0A 3N4MA 4PZJA 4PGHA 5IY5H 5C3EJ 3WTYC 4IRIA 1IXCA 3ZR8X 2L3DA 3RPUD 4BL0B 5LFAA 4GFBA 3GTJJ 2UXXA 3CCMI 1FSHA 2GWRA 2VONA 1U9OA 2AO9A 2X9DA 5GPCA 4M3FA 2L9RA 3L7WA 3TQNA 4G7ZF 2IRFG 2QUFA 5DS9A 1B1BA 1FP1D 2VPLA 3A2KA 1OJLA 2LF8A 3S14J 2FBKA 3VEPA 2HOSA 1E0EA 4XORA 3RSNA 4A3GJ 5GAGJ 5BPIA 3GYHX 3BTLA 4II2A 3ONQA 2RDPA 2KJCA 1BI3A 2R5YB 1MMSA 4KIBA 1FIPA 1X4OA 2GQQA 4E7SA 4A3CJ 4L5IA 2XRNA 2BY3A 5JHFA 2X4HA 1UCRA 5FB2A 3F8MA 5E3MA 1H8AC 4FT8A 2O3FA 1XSXA 5FLVA 1WGXA 1JTYA 2WAQA 3BG3A 3L00A 4S0HB 1T39A 4LOCA 3OYGA 2XSJC 3HOYJ 4LB6B 2Z33A 2VC0A 1N77A 1R5HA 4A5NA 4DJAA 3OYAA 1B72B 2R7TA 4XSZF 4I99C 3JRFA 3BR5A 5ILUA 4IHSA 3FBNB 3KLOA 4IO9F 2XAQA 1BI0A 2FXAA 2VASA 4ESBA 4HF2A 1Z6TA 5TJJA 3VYUB 4S05A 4ESFA 1LUJB 3MVPA 1F4KA 1FOXA 3MKLA 4RB3C 1VQNI 2P5VA 1Z7LA 3T1BA 2R5ZB 4EGYA 1EH8A 2XPWA 1EV7A 2XF7A 2D1VA 1QHHD 1NHAA 2O7OA 2XKPA 1O57A 2CJJA 2XAUA 2HVRA 2NXNB 3BG5A 5J1YA 4WXDA 5JFRA 4K2EA 3HM5A 3GTOJ 4IKFA 3A0HC 1BW6A 4UNOA 1J59A 1VQLI 2JPBA 3TP3A 4KFCA 4FHTA 3BR0A 5J6XA 4L9VA 3LSHA 4HF0A 1JHHA 2DT6A 1GV2A 4V19K 2K9NA 3LSJA 3JRAA 4J19A 4ZZDA 3MMYB 5FLXZ 1FBSA 3K2ZA 1H9TA 1BL0A 1J09A 2DJIA 2ZJQF 2JSPA 2Y48A 1FMWA 1ONVA 2P5KA 3DPLC 4M72A 5CQGA 5DEQA 3TKYA 1FOYA 4CCJA 4NHJA 3RIRA 2LY2A 4UB8C 1ETVA 5C4JJ 3H92A 2FA5A 5M5WJ 2DYSH 2DN0A 2EFOA 2R7FA 1HSTA 4FETA 2M30A 1ZRDA 2E2HJ 1IF1A 3KYCB 2PMHA 2EA2A 4OAYA 3F6OA 2BV6A 1PUFA 1YS6A 2EIKH 2FMYA 3RKWA 3X2QH 5HVQC 3O6BB 4LG0A 3GO5A 4D9JA 1YJWI 1EA3A 1YLFA 2KZGA 5H6QA 1ZG3A 1U6GA 1VQPI 2E34A 4HEA2 1IDYA 3OR2C 3QYEA 1W7PA 3MD2A 1I6HJ 3T0YA 2LSOA 4DZPA 3VPRA 1T08B 2JZYA 1GVJA 5E20A 1CGPA 2WB1N 3HGYA 3CCRI 3SEQA 4HZFA 3NEUA 4YIFA 4RGSA 4HLYA 4I02A 3CESA 3R0AA 4Y15A 4Y52J 5FJ8J 3F3XA 3EPZA 3RQ4A 3ELKA 4P96A 4OOIA 4IX7A 3KE2A 3FIWA 2D5VA 3FM5A 1X19A 1ZR4A 2NAZA 3BPVA 1TW2A 2IEKA 3TGNA 4UV9A 3PIOF 3JSPA 4U7BA 1BR1A 3M7GA 2VE8A 3B73A 3BY6A 3K1PA 2VXDA 4UVBA 3CCSI 1VI0A 3J81K 3CP8A 1ITYA 5BQTA 3G4SI 2KKOA 3R4KA 1P9QC 2M87A 3QP6A 2P4WA 1Z6RA 3OYLA 1DPUA 5D6EA 2CQNA 1OPCA 2E35A 2JVHA 1RR7A 3IH2A 2I8DA 3QPHA 2XAFA 2AQEA 1WJ5A 1IDZA 4WXCA 3K2AA 2IS1A 1MBHA 1P4AA 1G3TA 3EDPA 4MGRA 3ZQHA 4C3HJ 1BC7C 1KU3A 1LDJA 3AG3H 3G2BA 5EZHA 1IN5A 2VT2A 1YG2A 4A3JJ 4DIQA 2M45A 4BE0A 1YIJI 2OQGA 4ZTJA 2CU7A 2IJLA 5CYVA 2XIGA 3WTWC 2IXSA 1MJAA 4ENMA 3PSIA 1T2KA 2E19A 3BCAA 4IVNA 4YFKF 4Y33A 3RTRA 4W97A 3R61A 1T0FC 1QRYA 4II3A 1TQMA 1EF4A 3J80K 1E3OC 5ERIA 5H2FC 1U0JA 1USTA 1S7OA 3ASOH 5D5UB 3ABUA 2OA4A 5ILSA 1IRXA 4I76A 5FO5A 3KETA 4D7MA 2VOOA 1TWCJ 3F8FA 3HOVJ 3ZMVA 2K40A 3KEQA 2OZUA 2ID6A 4Y17A 5IP7J 3A02A 3DWLE 3H5NA 4PJNA 5D5WB 4ZDOA 4DOZA 4A3FJ 3MCZA 1TWGJ 1S7AA 2XV4S 2X48A 3IC7A 3W3CA 5EEAA 2FE3A 2KFDA 2E7WA 3Q3SA 2BHZA 3NRVA 5EG0B 3AL0C 3WGHA 3OSGA 1WVRA 3F8BA 2DMPA 3FMQA 2EBIA 2OCEA 5ICCA 1MMAA 2WB1A 2MC3A 1U2WA 5EZGA 5J3LA 5EGOB 1J2XA 1MBEA 4ESJA 2EPFA 6PAXA 3S3NA 3FZVA 4GCVA 1D0YA 4I01A 2JVGA 1PP8F 3P9IA 2LBFB 1YO5C 3SXYA 3BJ6A 4L0YB 2XASA 1Z91A 1A35A 3ROUA 3HC7A 4EJUA 1D1BA 3BT9A 1QQIA 3R6SA 1H0MA 5LGNA 1CF7B 5JR3A 2CG4A 2NVUB 4PFOA 3K0LA 2CQ7A 5C44J 3RKXA 3U9GA 3EUAA 1IJWC 3KEYA 2H27A 2A07F 3HBLA 2EFQA 4DW6A 3HOSA 1HKSA 1OCPA 3T8TA 5LD2C 1SD6A 3MKWB 5IP6A 1K6YA 3CDIA 2XC7A 1MZBA 1MD0A 1SD4A 4RAFA 3M4OJ 4CCLA 1LEBA 2HYJA 2HTSA 2M7BA 2MA3A 1P92A 3ZMSA 3RKYA 3CUQA 2V1UA 3S93A 4BXXJ 3FXMA 3F9KA 4ZDLA 3TO9A 4E6KG 3K1MA 1X1PA 4EJWA 2MH9A 1FWZA 5TRDA 2JJ7A 1K79A 1FZPB 3H9QA 2R7DA 2R3SA 3ZQQA 1J0RA 4QWQA 1FYKA 5B66C 2QQAA 5ICGA 2M0CA 4CZZA 4YRVA 1Y0NA 1B6AA 2H8RA 3GTKJ 2K9LA 2HPIA 2VLAA 1KU7A 1MMGA 3I54A 2FOKA 2KIQA 3P7NA 1SANA 4N0BA 3FXRA 2GIVA 3DKYA 3CD6I 1RZ4A 4XBFA 3V7SA 3HKZN 2KIFA 3Q0VA 1U78A 1T98A 3KP2A 1G59A 2GLOA 1R23A 3UNGC 4S04A 1OKRA 2KQRA 3OOPA 4BKXA 2P8TA 3TP0A 2UXNA 1ZTRA 3I9V2 3K1NA 3PNVA 3FX3A 1ERDA 4XLAA 3V42A 1UB9A 3ZQLA 3CMYA 1WJEA 5E18F 4B48A 1Z3YA 2EQRA 3HHHA 4KISA 2E1NA 4EJTA 3CF2A 4D1QA 3H0GJ 1XG1A 1NH3A 2J5OA 1F36A 1Z9CA 2NVXJ 1BM9A 4QPOA 4KA4A 2D1HA 1X1CA 3LFUA 4YEJA 4CCNA 3WU0A 3ZQIA 2M0MA 3BOQA 4XR6A 4C2MJ 1ZYRF 4AVZA 1X2NA 1ETWA 1XGMA 2QF7A 5ICFA 3VDXA 2FF4A 4LLGF 2DXIA 5E8GA 1Z0XA 3K4BA 3I3LA 1XSVA 2F4OB 4U7DA 2DTRA 1AKHB 4MQVA 1ZAOA 3J7AY 2ZB9A 1IC8A 2Y75A 3I55I 3JCUC 1D1CA 5DDGA 3F22A 3MKZA 2B7EA 1KYWA 3PSFA 5F0FA 2ZBKA 1L0OC 4U0WA 1FTTA 3IWZA 1WI9A 1FOWA 5BNGA 5E1XA 1VF9A 3QPLA 3S32A 4Z2YA 5BOXA 3CZ6A 1NG7A 1BW5A 4LITA 3DLAA 1BC8C 2G7UA 2R7WA 5L3EA 2VKVA 3S3OA 1O7LA 3HRTA 4JOMA 2KLOA 2M8GX 3ZQGA 4B4CA 3S2HJ 1ZELA 1JUSA 2JMWA 3DF8A 3ECHA 4XL9A 1SAXA 3W6JB 4HNVA 4G12A 4HRIA 4LB5A 2DMQA 3WTXC 2ZMEB 2K85A 1ODDA 2RNGA 3LAPA 4XRFA 1I1SA 1S7EA 1KQ9A 4M3EA 2KRHA 2IPQX 1JHFA 2XF6A 3D5RC 3HZJA 5F1RA 4LJZF 3H0DA 2VXZA 2CQQA 2BY1A 3HSEA 3LSMA 4TV7A 4UHTA 2NNYA 1NK2P 5F64A 2V1NA 4BQOA 3WHCA 3DBLB 1IV6A 3OMYA 1B8IA 3OL4A 3HKZA 3I64A 1VQOI 1JE8A 2CS3A 3BPXA 2XF5A 2Z3YA 1ETQA 4CA0A 3A0BC 1WPKA 3BTCA 3OWTA 3C2BA 1JI8A 4RDUA 3IRRA 2ETHA 2CH0A 3BG6A 3QOEA 4YIRX 2PMZN 2EFPA 1LFBA 2ZXIA 3I58A 3L2RA 4J01A 2UUZA 1K6OA 1K78A 1YRNB 1JUPA 3GFJA 2HDWA 4WK8F 3SZTA 3AAFA 2R7OA 3OSFA 4RLFA 2QENA 2O9LA 4BJ6C 1R1VA 1Y8QB 2CFXA 2GXAA 2LYCA 4Q4ZF 5DV5A 2XSDC 5DUIA 3H5RA 3C2GA 3MN2A 2CW0F 4XN3A 3IL2A 2E36A 4IRHA 3PUBA 3MZYA 3V7CA 1GXPA 1OYYA 2IGMA 3DEEA 3HG9A 2A6HF 9ANTA 3MQ0A 2CQKA 3AFHA 2BW3B 1YS7A 1LJ9A 3E97A 4LIVA 2H1LA 5H6RA 5DCMA 4F55A 4XN0A 2COBA 3EYIA 2LY1A 3HEFA 4C3JJ 1DP3A 1IO2A 2ZXWH 3F21A 1PUFB 2CV1A 2PEXA 1VQ8I 2P7VB 1FOKA 2VKDA 2DI3A 4HX8A 3MAJA 4DBQA 4RB2C 1G3YA 2V9VA 2X85A 2P0WA 4F93B 1HXDA 2GM4A 1FEXA 5E1WA 2JK3A 3U1DA 2IGNA 1AA7A 3AKZA 2ECBA 5K7HA 2YUSA 4UB6C 2A6TA 4I0BA 4OWRB 3MWMA 1C0WA 2XRLA 4XM3A 2V1DA 5CLSA 4BBRJ 4M6YA 1QO0D 2BY2A 3CJNA 4JX5A 1XDUA 1JUMA 1QPMA 3FHNA 2O8KA 1MDMA 2BEOA 2WV1A 2R7RA 3HJEA 1P7JA 3P9CA 1VQ5I 4ANJA 3SFZA 1ZG5A 1TW3A 1XCBA 5A2QZ 3IH3A 2HOAA 3OIQA 4DZJA 4ZYHA 5GP9A 1FJLA 3B6CA 3J7YJ 3NWSA 1J9IA 3OL3A 2AXTC 2CW7A 2BY0A 3R60A 3CUOA 4XLNF 5CVJA 4AUXA 1KU2A 2RV8A 1EH6A 4N9HA 2LREA 3QRFF 3HUGA 4GXOA 2E1CA 2V1XA 1OYWA 1RETA 2NVYJ 2BVLA 1X4PA 3IKTA 4CCMA 3GTMJ 3OYFA 1FX7A 3BLYA 2FU4A 3OYKA 1TWHJ 4KDPA 2XGXA 3TDUC 2G0EA 5LHGA 4AIDA 4HF1A 2EINH 3D5LA 5F27A 1XMXA 1T0FA 2DFEA 2FQ4A 5KVRA 3PO2J 1W0UA 2PMZA 2MD0A 4BHPA 2R4GA 1GT0C 1S5LC 1H89C 2E2JJ 4KT5C 2B0LA 2DODA 3KZZA 4J00A 2DMNA 2VKEA 3A01A 1QNTA 5H20A 5TISC 2VPRA 1EJ9A 4I6ZA 2HFHA 2L01A 2ME0A 4MTEA 1ON2A 2XPUA 1MH4A 3GEZA 5J47A 1TZLA 4PJLA 1I50J 3K10A 1U5TB 1MMDA 5D4SA 3H9JA 3L2VA 3CO7C 3BQYA 1LNWA 2W24A 3LAJA 3F6VA 3J80Z 2IS2A 4KICA 2DTZA 4CDGA 2OQRA 2DA5A 3FWEA 2A5YB 4NQWA 4ENJA 2D45A 1OCRH 3KCCA 3DPUA 1WRJA 3RZDJ 3I56I 1OR7C 4ZJZA 4BACA 4GO1A 1MKMA 2GXGA 2LKPA 1SFUA 2M2EA 5M3FJ 1IRZA 4G7HF 4XKCA 3DEWA 4L9TA 1KYZA 1QZZA 3JREA 1OYIA 2OC6A 3I59B 4HAMA 2DT5A 3ZOBA 1WZ2A 3E6MA 1OFCX 2Y0MA 4UXNA 4HBLA 1Y1WJ 2VQLA 4MFEA 2XB5A 1RIOH 2CMPA 3DEUA 4ZDPA 5LEKA 1W36C 4JQFA 4Q48A 2Z5UA 4WF2A 2EA4A 1W5CC 2TDXA 1T33A 3BTIA 5DM7F 5B3SH 2R7ZJ 2M34A 2DOAA 3LA3A 3QU3A 1V55H 1G8XA 3LOCA 2KDZA 4BXUA 4C30A 1MW7A 3V4GA 3S1QJ 3VYTB 2MLKA 2ICWG 3EETA 3BR6A 3HIFA 4B3AA 2GZWA 2CUEA 3LNQA 1WJDA 3H5AA 1G4DA 4ZTFA 1HC8A 1I3AA 1DU0A 4M6VA 2OZ6A 3W2WA 3ZGKA 5K5QA 1SVLA 3S15J 2W4SA 2Q2EA 3DQVC 1WQ2A 3PFIA 4A0ZA 1DQUA 2VJJA 4LLLA 2F5CA 2CUFA 3HYIA 1KQ0A 4UUSA 2R7QA 3V8KA 4BJTA 5L3GA 4FE7A 2HOTA 1Z21A 5IT3A 3CO6C 3H35A 3L2UA 1DGWY 4RB0A 5AIQA 1BIBA 5HLTA 3OR1C 4PK4A 1YITI 2VQCA 2FRHA 5FKLA 3QWLA 1GUUA 2KL4A 4E70A 2KIMA 1V5GA 3CMEI 2GOXB 1IGNA 3GVAA 2FBIA 3IUOA 2R92J 2EIMH 2K9MA 3H9GA 3CUQB 4CCOA 1OISA 2DPDA 3CQZJ 5AONA 1O3QA 3FMRA 1GXQA 3JRDA 4P1WA 3QQAA 3WG7H 2ZFUA 1LE8A 3HDDA 2XGCA 4N4NB 3K9TA 3RCOA 1BA5A 1W5TA 2HDCA 4XLFA 5IYCJ 3H1CA 1FT9A 5FKMA 1RUOA 3WGIA 1X3UA 2DFFA 1WSUA 4MEXF 3DCFA 3G73A 2MBFA 1W5SA 4HV5A 1TWFJ 1EH7A 2W1OA 5M3MJ 3W2AA 3HOWJ 1D0XA 2GOMA 4FCYA 3HSRA 1DP7P 4A6EA 2X6OA 1RKWA 3NWTA 4L0ZB 3B02A 2F48A 2W7NA 1KONA 2X1EA 4P55A 2H1KA 1JJ8C 5B1BH 2DOEA 3BR2A 4XLCA 3L9FA 4BBSJ 2ACJA 3H3VK 4E7HA 2EZIA 1FNNA 4NB5A 2HDDA 2OCCH 2ZSIB 2HS5A 1JTXA 3VYSB 1MBGA 3FXLA 2PBIA 3PQKA 1TNTA 5M5XJ 2UZKA 4HX4A 5KAIC 1IW7F 4A3BJ 4PGGA 1IAWA 2E2IJ 3GFMA 2MH2A 4RGRA 3PQJA 1GDTA 3A1YA 1SFOJ 1IXSB 2AHQA 1ZREA 4XRSA 2Y9YA 3BJOA 4QTRA 1ZR2A 2BE5F 1WH7A 2HXIA 2XDVA 3N97A 3NAUA 3HPHA 2VBYA 4HSTA 1YJNI 1SEUA 2RN7A 4AIJA 1K4SA 4UVAA 3VOEA 4A2UA 1U3EM 2OD5A 1BR2A 3ABKH 5ICEA 4X1EA 5CQEA 2IT0A 1R4NB 5FD6A 1HCRA 1IRFA 1W4MA 2V9PA 3L2CA 1LFUP 1Z7UA 2X1CA 5DD8A 1ZK8A 2EZKA 2JT1A 3W6VA 2Z9OA 3D0SA 3OV8A 2GA1A 1YX3A 3I53A 4LFUA 5FRMA 2IBDA 5HS9A 3SHFA 2KRCA 1BR4A 3K4CA 2DA7A 2JA7J 1Z77A 3R0JA 3CDLA 4F92B 4E7ZA 4XLHA 4I0AA 2DPUA 3U2RA 1WCMJ 5KNLA 3ZRGA 4LLNA 1PYVA 2QYOA 1G3SA 2BHYA 3DU6A 3K6GA 2R5YA 3ZQFA 1Q1VA 4U0VA 1O3SA 2VQHA 1MJBA 3GF2A 4IPAA 1WKMA 3WTZA 1AU7A 4BY1J 4NC8A 4C9YA 5CVRA 1IN7A 4IF4A 2JA6J 3CCYA 4ENKA 3KFWX 3QOPA 3H3UA 4O6JA 2WADA 2CSOA 3CCLI 3K4JA 4RGXA 1P2FA 2FX0A 3L09A 1APLC 4LGWA 1Y56A 4NNJA 5FGMA 2EJRA 3S17J 5EEGA 1TQIA 1BI2A 4XKWA 3ZMDA 3FHZA 1B72A 2WAEA 2E71A 2OV7A 2XGDA 3CLQA 1RKTA 3HPGA 3SDBA 1ZGWA 2W85A 5GAEJ 3S1RJ 2JRMA 4DBRA 3UR3C 4XICA 3SDGA 4BNCA 3K4MA 3O8GA 1R00A 1LB2A 3K70D 1KA8A 4RMNA 1HQCA 3EUKL 4CYCB 1BBYA 2ZMEC 3LSPA 3K4KA 4OAZA 2LFBA 2X6WA 4P9UA 1VNDA 2XPVA 4B09A 3KYDB 5DM6F 2Y2ZA 2R5ZA 2Y9ZA 4BGDA 1YFHA 1OCTC 3BWGA 3BG9A 1T8IA 2QVOA 3RPUA 4D0PA 1ACIA 5J8CA 2G9WA 3V8LA 1Y8RB 3OYMA 2IAIA 4C2UA 1LQ1A 2VL8A 2XAJA 4RAYA 3W6KB 2GIZA 1B9MA 3AG4H 2ZJRF 5FLXK 2I10A 4DYCA 5EDNA 1YI2I 4CZCA 2QBYB 2IS4A 1K83J 2BXZA 2RQQA 3F8CA 2GAUA 2R0QC 1YHQI 1X2MA
chains in the Genus database with same CATH topology
1O3RA 1XD7A 1YYVA 1HSJA 3C1DA 4HQEA 4CHUA 1D5VA 1DPRA 4EM1A 3HRSA 3JAMK 3GZ5A 2DW4A 4G9YA 1V3FA 3RPQA 4BYYA 1I6XA 2W84A 2BBYA 2G7HA 3MFKA 5IT9Z 2STWA 5KK1A 3NQOA 2HWVA 3ABTA 2QQ9A 1HW1A 4ZZLA 2O6GE 2NYXA 5JHUA 4KNYA 2YU3A 3DFGA 1TNSA 4IRGA 3SZPA 1USSA 5DYMA 3HTSB 1RI7A 5JVTA 2Z99A 2C6YA 3V8JA 2PLYA 3BDDA 3LWFA 2YSRA 4CXFA 5K5RA 1TLHB 4OIOF 1ZH5A 1LVAA 4KUMA 2FNPA 1ON1A 1BN5A 4WWCA 3RYPA 4M74A 2HEOA 2FEZA 2EFWA 2L4AA 1RUNA 2HTJA 2O03A 4BQAA 1J7KA 4LK0F 4BAYA 3WE2A 2HYFA 1ZRCA 3DV8A 4UV8A 3F8NA 3S2WA 1OR7A 2CYYA 1SD7A 3Q9SA 2RVCA 4YFNF 1IN6A 1QZYA 4ZH4F 4IJAA 1I5ZA 3O2PE 3KEOA 2OU2A 5HDKA 4MTDA 1E17A 2H6BA 2M5WA 2P6TA 4MQ9F 4O5VA 1O7FA 3T8RA 4ETSA 1YW9A 4KMFA 3K69A 5LGTA 3C7JA 3E5XA 5ED4A 4BHCA 1J5YA 1U5TC 2XAGA 1W7PD 2HR3A 3ZMZA 2CWEA 1FPQA 4KYWA 3E6DA 3KP3A 2A69F 2PJPA 2PQ8A 1SMTA 2O0YA 1FY7A 1MGTA 2ZFWA 4G6QA 2VBXA 3WG9A 2QLZA 2H94A 3GZ6A 1HW2A 4L5JA 3TO6A 1R36A 2K4JA 4R1HA 1QBJA 3ECOA 1STZA 3JW4A 3KZYA 2BGCA 2O8XA 2YX7A 5CVVA 1XSDA 1S6LA 3EUHA 2XROA 2HYGD 2YX4A 4LG0B 4R79A 3IKVA 4OIRF 4EVIA 3VODA 3E6BA 1W7PB 4LD5A 4L9JA 4M9SA 2AXLA 1ZHFA 4G8XA 1FLIA 5FFZA 2L02A 5AIPA 4KIGA 4F7ZA 3E3VA 1SD5A 2LNBA 3HRUA 2RGVA 5HOOA 4WX9A 1KQ8A 3J81Z 1FYMA 1Y0UA 2F5DA 2Q8KA 4A0YA 1AWCA 1REPC 3P9KA 5L3CA 2EB7A 5D4RA 3GW2A 3M8EA 1F9NA 1P4XA 4KN7X 2NS0A 3I0TA 2XUBA 2EK5A 4B8XA 4I09A 1AOYA 3ERED 1E2XA 4G94A 1S3JA 3TO7A 2JSCA 1IN8A 4QLCU 4KN4X 4RAZA 1ZN2A 3ZQ7A 3F72A 4KMUX 4A5MA 4A6DA 5JI6A 1F1ZA 2NRAC 2HZTA 4MEYF 3ZPLA 1XMKA 2DK5A 1JXSA 2FQ3A 2ZKZA 3FXUA 1O3TA 4FX0A 1B59A 3TDZC 3C3WA 2JPCA 3H3ZA 2W57A 2K7LA 1FP2A 3BROA 5LLQA 3WODF 1IXRC 2ISYA 2MD5A 1ZGAA 3LA2A 4WXHA 4YIIA 4AIHA 1BJAA 3CTAA 4BH9A 2HQNA 3FF5A 1Q1HA 3QP5A 4AVPA 2ZNYA 1FSEA 4M71A 1XCVA 5LRRA 4KIFA 3G3ZA 4I2OA 2VODA 2HOEA 3LSTA 2ZMEA 4ASNA 3EQLF 1LEAA 2GA2A 2COMA 2XVCA 1KU9A 5LGUA 4MNUA 4EJOA 2HGCA 3M8FA 1R58A 4WCGA 5D6FA 2IVMA 3GX4X 4HA8A 2GXBA 5K5OA 3LA7A 1ZARA 3BJAA 4PCQA 5J8FA 1UHWA 2PMUA 1XB4A 4HYEA 2A68F 1SFXA 1UFMA 4HLXA 5DCFA 2VE9A 2DLLA 1FBQA 1ZG1A 1JGSA 1XN7A 3TOBA 2V79A 3DPTA 3WGGA 2VN2A 1K7AA 5DUKA 3WTVC 1L3LA 4HV6A 3MZHA 1R1UA 1UHMA 4DQ2A 3I5UA 1YW7A 1S29A 5BPDA 4MHGA 5HLHA 2OBPA 3IWFA 4ON0A 4CGZA 1BI1A 2VBWA 3VB2A 2IA0A 2FMLA 2RKHA 3WTTC 3JAMZ 2F5EA 5LEJA 2K02A 3ML6A 3RI4A 4DNCA 3WE3A 2EV0A 2ZO4A 2PFBA 4M73A 1XGNA 2DQLA 2ESHA 2K27A 4M6XA 3QU6A 4EGZA 1Z1DA 5L3BA 2A6EF 2DU9A 5A2QK 2UWMA 2FSWA 5E1ZB 1I1GA 3QPTA 2OAZA 4JK1X 1U8RA 4CO8A 4UUVA 4L9NA 2ADUA 2ZXJA 2XKOA 1Z05A 1QGPA 2V6CA 2X0LA 3JTHA 2IP2A 4A0XA 4A12A 4OIQF 5D5VB 2DQRA 2MLGA 2CGPA 1R1TA 3HSFA 1J75A 2EWNA 1RNLA 4LK1F 3DKWA 3LQQA 1IUYA 4BHBA 3DP7A 2VC1A 2WC2A 2QQBA 5BS6A 4OMZA 5HS7A 4L18B 4U88A 5HDNA 3CDHA 3KP6A 2DK8A 3TOAA 1VTNC 4LMYA 4XLPF 4IXAA 5E17F 3LQRA 1U5TA 3GFLA 1TQPA 4GYIA 1ZGJA 4RS8A 2EV6A 4HX7A 1LDDA 3SQNA 1HKQA 1V4RA 1B9NA 4HDUA 2L54A 2LDUA 4FX4A 5LHIA 1DUXC 4EM0B 2W25A 3ULQB 1PDNC 3I59A 3JSOA 1PUEE 4HQMA 3RJPA 3J7AO 2JTVA 3I4PA 2JRTA 2ELHA 4Y13A 3HRMA 1ZLJA 4M9ZA 2EFNA 2HQRA 2FNAA 1K78B 1FYLA 3EYYA 2VT3A 1R5GA 4EM2A 2QM3A 1G6NA 2ZCWA 2RQPA 2STTA 2BYVE 2WTEA 3ZMTA 4AD9A 2DO7A 4M9XA 2PN6A 3F23A 2YR2A 3T5XA 2L4MA 5DCMB 4ZYGA 4JBAA 5CJ9A 2DAOA 2J5PA 1P4WA 1T38A 1B4AA 1IN4A 1SFEA 2ZNZA 1BIAA 3VFZA 3HTUA 4UVCA 3JTGA 3FXQA 4HDVA 2XHKA 3BP8A 1D3YA 1MDMB 2WV0A 2NNNA 2K86A 4YG2F 4G7OF 2M1BA 3IHUA 2O61A 3ISPA 1HKTA 4R8HA 4ZYDA 1MJ9A 4Q47A 2FBHA 4GGGA 1TBXA 3O3KA 4CICA 2DFIA 3GUDA 5HDGA 5F6FA 1GHCA 2RNJA 4P5OA 5FFXA 5DD4A 2P7CB 1H9GA 2LF7A 1ULYA 5ILVA 3RYRA 2QWWA 3ZMUA 3ZN1A 3ZN0A 1A04A 2PI0A 3RDIA 3WU1B 2ZJ2A 4YFXF 1DDNA 5FD5A 3FMSA 3KP4A 2KRFA 5E8IA 5HLGA 4H0EA 2M8EA 2PG4A 3Q5FA 2E7XA 1TTYA 2HKXA 2XAHA 5LHHA 1IRGA 4EJVA 3WTSC 5D5XB 4RGUA 3GLXA 3BZ6A 3KP5A 4EV0A 2YPRA 3KLNA 2EV5A 2KIUA 1BOAA 1R22A 3WTUC 4AIKA 4EMSA 1ZRFA 5LBQA 3COAC 4U0YA 1YW8A 3HOTA 1S8NA 5EEHA 4G6DA 1G3WA 3M1EA 3FM3A 1F5TA 3ZP5A 2K4BA 1FC3A 5CVIA 1P6RA 3E6CC 5HS8A 5BMZA 1XDSA 2F2EA 4PDKA 2P6SA 1CF7A 3E5QA 2CO5A 2A3SA 1FBUA 2HKOA 2H6CA 4AWXB 1XMAA 1ZLKA 4HW0A 1OMIA 1IZ1A 5K1YA 3Q9VA 4GYGA 1SMYF 4I98B 2IW5A 3QAHA 4XSXF 2QBYA 2A61A 3E5UA 1YTYA 2AS5F 4OMYA 2IA1A 2DBBA 1YQAA 1PP7U 4ZYEA 4RB1A 2VOPA 4CYDA 3GWZA 3I71A 4OIPF 1YIOA 4OINF 5CVUA 5L3DA 1LDKB 2F5FA 2D2WA 3KP7A 4N9IA 2Q0OA 4Q5SF 1KGSA 3CUQC 2ESNA 4OU0A 3GFIA 2P5LC 2RC4A 2WWYA 2ISZA 5IT9K 1XGSA 3GXOA 3DXJF 3LFKA 4P9FA 5D8LB 1HBXG 2QZ8A 2IA2A 1I27A 2H09A 2VBZA 1HW5A 1R7JA 4EQQA 3IRQA 5HLIA 4IHTA 3MEXA 1WWXA 1D8KA 1XGOA 4ENNA 3V7RA 4O3MA 5L3FA 5LRSA 3HHGA 4HOBA 4I7HA 3CLOA 2KJBA 1D8JA 1T6SA 3C18A 3REOA 5D8KB 3M9AA 3N4MA 4PZJA 4PGHA 3WTYC 4IRIA 1IXCA 2L3DA 2UXXA 1FSHA 2GWRA 2VONA 3L7WA 3TQNA 4G7ZF 2IRFG 2QUFA 1B1BA 1FP1D 2LF8A 2FBKA 3VEPA 5BPIA 3GYHX 2RDPA 2KJCA 1BI3A 4KIBA 2GQQA 4L5IA 2XRNA 2X4HA 1UCRA 5FB2A 3F8MA 4FT8A 2O3FA 1XSXA 1T39A 3L00A 4LB6B 2Z33A 2VC0A 1R5HA 4A5NA 4XSZF 5ILUA 4IHSA 3KLOA 2XAQA 1BI0A 2FXAA 4ESBA 4HF2A 1Z6TA 5TJJA 4S05A 4ESFA 1F4KA 4RB3C 2P5VA 3T1BA 4EGYA 1EH8A 1EV7A 2D1VA 1NHAA 2XKPA 1O57A 4WXDA 5JFRA 4K2EA 4UNOA 1J59A 2JPBA 4KFCA 4FHTA 5J6XA 4L9VA 4HF0A 1JHHA 4ZZDA 5FLXZ 1FBSA 3K2ZA 1H9TA 2Y48A 1ONVA 2P5KA 3DPLC 4M72A 3TKYA 5DEQA 4NHJA 3RIRA 3H92A 2FA5A 2EFOA 2R7FA 1HSTA 2M30A 1ZRDA 1IF1A 2PMHA 2EA2A 3F6OA 2BV6A 1YS6A 3RKWA 2FMYA 5HVQC 3O6BB 4LG0A 3GO5A 1YLFA 5H6QA 1ZG3A 1U6GA 1W7PA 3T0YA 2LSOA 2JZYA 1GVJA 5E20A 1CGPA 4HZFA 3NEUA 4YIFA 4RGSA 4HLYA 4I02A 3R0AA 4Y15A 3F3XA 3ELKA 4P96A 4OOIA 3KE2A 3FM5A 2NAZA 3BPVA 1TW2A 3TGNA 4UV9A 3JSPA 4U7BA 3M7GA 2VE8A 3B73A 3BY6A 3K1PA 4UVBA 3J81K 5BQTA 2KKOA 3R4KA 2M87A 3QP6A 2P4WA 1Z6RA 1DPUA 5D6EA 1OPCA 3QPHA 2XAFA 4WXCA 1P4AA 1G3TA 3EDPA 4MGRA 1BC7C 1KU3A 1LDJA 1IN5A 2VT2A 1YG2A 2M45A 2OQGA 2IJLA 5CYVA 2XIGA 3WTWC 1MJAA 4ENMA 1T2KA 4IVNA 4YFKF 3RTRA 3R61A 1TQMA 3J80K 5ERIA 1USTA 1S7OA 5D5UB 3ABUA 2OA4A 5ILSA 5FO5A 3KETA 2VOOA 3F8FA 3ZMVA 3KEQA 2OZUA 4Y17A 5D5WB 3MCZA 1S7AA 2XV4S 3IC7A 2FE3A 2E7WA 3NRVA 3WGHA 3F8BA 3FMQA 5ICCA 2MC3A 1U2WA 1J2XA 4ESJA 6PAXA 3FZVA 4GCVA 4I01A 1PP8F 3P9IA 1YO5C 3SXYA 3BJ6A 4L0YB 2XASA 1Z91A 3ROUA 4EJUA 1QQIA 3R6SA 1H0MA 5LGNA 1CF7B 5JR3A 2CG4A 3K0LA 3RKXA 3U9GA 2H27A 2A07F 2EFQA 3HOSA 1HKSA 3T8TA 1SD6A 1MZBA 1MD0A 1SD4A 1LEBA 2HTSA 2MA3A 1P92A 3ZMSA 3RKYA 3CUQA 2V1UA 3TO9A 3K1MA 4EJWA 2MH9A 1FWZA 5TRDA 1K79A 1FZPB 2R7DA 2R3SA 1J0RA 4QWQA 1FYKA 2QQAA 5ICGA 4CZZA 1B6AA 1KU7A 3I54A 2FOKA 3P7NA 4N0BA 3FXRA 2GIVA 1RZ4A 4XBFA 3V7SA 2KIFA 1U78A 1T98A 3KP2A 1R23A 4S04A 1OKRA 3OOPA 2P8TA 2UXNA 3K1NA 3FX3A 1UB9A 5E18F 3HHHA 2E1NA 4EJTA 2J5OA 1Z9CA 1BM9A 4KA4A 2D1HA 3WU0A 3BOQA 1ZYRF 1XGMA 5ICFA 2FF4A 4LLGF 5E8GA 1XSVA 4U7DA 2DTRA 4MQVA 1ZAOA 2Y75A 5DDGA 3F22A 1KYWA 2ZBKA 1L0OC 4U0WA 3IWZA 1WI9A 5E1XA 4Z2YA 5BOXA 1BC8C 2G7UA 5L3EA 1O7LA 3HRTA 3ECHA 3DF8A 1SAXA 4LB5A 3W6JB 3WTXC 2ZMEB 1ODDA 3LAPA 4XRFA 1I1SA 1KQ9A 2IPQX 1JHFA 5F1RA 4LJZF 2VXZA 3HSEA 4TV7A 4UHTA 2NNYA 5F64A 3I64A 1JE8A 3BPXA 2Z3YA 3IRRA 2ETHA 2EFPA 3I58A 1K6OA 1K78A 3GFJA 4WK8F 3SZTA 3AAFA 2QENA 1R1VA 2CFXA 4Q4ZF 5DV5A 5DUIA 2CW0F 3IL2A 4IRHA 3V7CA 3MZYA 1GXPA 1OYYA 2A6HF 3MQ0A 2CQKA 1YS7A 1LJ9A 3E97A 5H6RA 5DCMA 3EYIA 3F21A 2PEXA 2P7VB 1FOKA 2DI3A 4HX8A 3MAJA 4RB2C 1G3YA 2V9VA 1HXDA 5E1WA 3U1DA 4I0BA 3MWMA 1C0WA 2V1DA 5CLSA 4M6YA 1QO0D 3CJNA 1XDUA 1QPMA 1MDMA 2BEOA 3P9CA 3SFZA 1ZG5A 1TW3A 1XCBA 5A2QZ 4ZYHA 1J9IA 3R60A 3CUOA 4XLNF 5CVJA 1KU2A 2RV8A 1EH6A 4N9HA 3QRFF 3HUGA 4GXOA 2E1CA 2V1XA 1OYWA 3IKTA 1FX7A 2FU4A 4KDPA 2XGXA 3TDUC 5LHGA 4HF1A 3D5LA 1T0FA 5KVRA 4BHPA 4KT5C 2B0LA 3KZZA 1QNTA 5H20A 2HFHA 2L01A 4MTEA 1ON2A 3GEZA 1U5TB 5D4SA 3CO7C 1LNWA 2W24A 3LAJA 3F6VA 3J80Z 4KICA 4CDGA 2OQRA 3FWEA 2A5YB 4NQWA 4ENJA 2D45A 3KCCA 1WRJA 4GO1A 1MKMA 2GXGA 2LKPA 1SFUA 4G7HF 4L9TA 1KYZA 1QZZA 1OYIA 3I59B 4HAMA 2DT5A 3E6MA 2Y0MA 4UXNA 4HBLA 1RIOH 3DEUA 5LEKA 4JQFA 4Q48A 2Z5UA 4WF2A 2EA4A 2TDXA 3LA3A 3QU3A 4BXUA 3V4GA 2MLKA 3EETA 3HIFA 2GZWA 1G4DA 2OZ6A 5K5QA 2Q2EA 3DQVC 1WQ2A 3PFIA 4A0ZA 4LLLA 2F5CA 3HYIA 1KQ0A 3V8KA 5L3GA 5IT3A 3CO6C 4RB0A 5AIQA 1BIBA 2FRHA 4E70A 2KIMA 3GVAA 2FBIA 3CUQB 2DPDA 5AONA 1O3QA 3FMRA 1GXQA 3K9TA 1W5TA 2HDCA 1FT9A 1RUOA 3WGIA 1X3UA 1WSUA 4MEXF 3G73A 2MBFA 1W5SA 4HV5A 1EH7A 3HSRA 1DP7P 4A6EA 4L0ZB 3B02A 4P55A 3L9FA 2ACJA 1FNNA 4NB5A 2HS5A 3PQKA 2PBIA 1TNTA 2UZKA 4HX4A 1IW7F 4PGGA 1IAWA 3GFMA 2MH2A 4RGRA 3PQJA 1IXSB 1ZREA 3BJOA 2BE5F 3N97A 2VBYA 2RN7A 4AIJA 4UVAA 3VOEA 4A2UA 1U3EM 2OD5A 5ICEA 2IT0A 5FD6A 1IRFA 1W4MA 3L2CA 1Z7UA 5DD8A 2JT1A 2Z9OA 3D0SA 3OV8A 2GA1A 3I53A 4LFUA 5HS9A 3SHFA 3R0JA 2DPUA 4I0AA 3U2RA 4LLNA 2QYOA 1G3SA 4U0VA 1O3SA 1MJBA 3GF2A 4IPAA 1WKMA 3WTZA 5CVRA 1IN7A 4IF4A 4ENKA 3KFWX 3QOPA 3H3UA 4O6JA 2CSOA 4RGXA 1P2FA 3L09A 4LGWA 5FGMA 2EJRA 5EEGA 1TQIA 1BI2A 3ZMDA 3FHZA 2W85A 4BNCA 1R00A 1LB2A 1KA8A 1HQCA 1BBYA 4P9UA 4B09A 1YFHA 3BWGA 2QVOA 3RPUA 4D0PA 5J8CA 2G9WA 3V8LA 1LQ1A 2XAJA 4RAYA 3W6KB 1B9MA 5FLXK 2QBYB 3F8CA 2GAUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O3R A;  1XD7 A;  1YYV A;  1HSJ A;  3C1D A;  4HQE A;  4CHU A;  1D5V A;  1DPR A;  4EM1 A;  3HRS A;  3JAM K;  3GZ5 A;  2DW4 A;  4G9Y A;  1V3F A;  3RPQ A;  4BYY A;  1I6X A;  2W84 A;  2BBY A;  2G7H A;  3MFK A;  5IT9 Z;  2STW A;  5KK1 A;  3NQO A;  2HWV A;  3ABT A;  2QQ9 A;  1HW1 A;  4ZZL A;  2O6G E;  2NYX A;  5JHU A;  4KNY A;  2YU3 A;  3DFG A;  1TNS A;  4IRG A;  3SZP A;  1USS A;  5DYM A;  3HTS B;  1RI7 A;  5JVT A;  2Z99 A;  2C6Y A;  3V8J A;  2PLY A;  3BDD A;  3LWF A;  2YSR A;  4CXF A;  5K5R A;  1TLH B;  4OIO F;  1ZH5 A;  1LVA A;  4KUM A;  2FNP A;  1ON1 A;  1BN5 A;  4WWC A;  3RYP A;  4M74 A;  2HEO A;  2FEZ A;  2EFW A;  2L4A A;  1RUN A;  2HTJ A;  2O03 A;  4BQA A;  1J7K A;  4LK0 F;  4BAY A;  3WE2 A;  2HYF A;  1ZRC A;  3DV8 A;  4UV8 A;  3F8N A;  3S2W A;  1OR7 A;  2CYY A;  1SD7 A;  3Q9S A;  2RVC A;  4YFN F;  1IN6 A;  1QZY A;  4ZH4 F;  4IJA A;  1I5Z A;  3O2P E;  3KEO A;  2OU2 A;  5HDK A;  4MTD A;  1E17 A;  2H6B A;  2M5W A;  2P6T A;  4MQ9 F;  4O5V A;  1O7F A;  3T8R A;  4ETS A;  1YW9 A;  4KMF A;  3K69 A;  5LGT A;  3C7J A;  3E5X A;  5ED4 A;  4BHC A;  1J5Y A;  1U5T C;  2XAG A;  1W7P D;  2HR3 A;  3ZMZ A;  2CWE A;  1FPQ A;  4KYW A;  3E6D A;  3KP3 A;  2A69 F;  2PJP A;  2PQ8 A;  1SMT A;  2O0Y A;  1FY7 A;  1MGT A;  2ZFW A;  4G6Q A;  2VBX A;  3WG9 A;  2QLZ A;  2H94 A;  3GZ6 A;  1HW2 A;  4L5J A;  3TO6 A;  1R36 A;  2K4J A;  4R1H A;  1QBJ A;  3ECO A;  1STZ A;  3JW4 A;  3KZY A;  2BGC A;  2O8X A;  2YX7 A;  5CVV A;  1XSD A;  1S6L A;  3EUH A;  2XRO A;  2HYG D;  2YX4 A;  4LG0 B;  4R79 A;  3IKV A;  4OIR F;  4EVI A;  3VOD A;  3E6B A;  1W7P B;  4LD5 A;  4L9J A;  4M9S A;  2AXL A;  1ZHF A;  4G8X A;  1FLI A;  5FFZ A;  2L02 A;  5AIP A;  4KIG A;  4F7Z A;  3E3V A;  1SD5 A;  2LNB A;  3HRU A;  2RGV A;  5HOO A;  4WX9 A;  1KQ8 A;  3J81 Z;  1FYM A;  1Y0U A;  2F5D A;  2Q8K A;  4A0Y A;  1AWC A;  1REP C;  3P9K A;  5L3C A;  2EB7 A;  5D4R A;  3GW2 A;  3M8E A;  1F9N A;  1P4X A;  4KN7 X;  2NS0 A;  3I0T A;  2XUB A;  2EK5 A;  4B8X A;  4I09 A;  1AOY A;  3ERE D;  1E2X A;  4G94 A;  1S3J A;  3TO7 A;  2JSC A;  1IN8 A;  4QLC U;  4KN4 X;  4RAZ A;  1ZN2 A;  3ZQ7 A;  3F72 A;  4KMU X;  4A5M A;  4A6D A;  5JI6 A;  1F1Z A;  2NRA C;  2HZT A;  4MEY F;  3ZPL A;  1XMK A;  2DK5 A;  1JXS A;  2FQ3 A;  2ZKZ A;  3FXU A;  1O3T A;  4FX0 A;  1B59 A;  3TDZ C;  3C3W A;  2JPC A;  3H3Z A;  2W57 A;  2K7L A;  1FP2 A;  3BRO A;  5LLQ A;  3WOD F;  1IXR C;  2ISY A;  2MD5 A;  1ZGA A;  3LA2 A;  4WXH A;  4YII A;  4AIH A;  1BJA A;  3CTA A;  4BH9 A;  2HQN A;  3FF5 A;  1Q1H A;  3QP5 A;  4AVP A;  2ZNY A;  1FSE A;  4M71 A;  1XCV A;  5LRR A;  4KIF A;  3G3Z A;  4I2O A;  2VOD A;  2HOE A;  3LST A;  2ZME A;  4ASN A;  3EQL F;  1LEA A;  2GA2 A;  2COM A;  2XVC A;  1KU9 A;  5LGU A;  4MNU A;  4EJO A;  2HGC A;  3M8F A;  1R58 A;  4WCG A;  5D6F A;  2IVM A;  3GX4 X;  4HA8 A;  2GXB A;  5K5O A;  3LA7 A;  1ZAR A;  3BJA A;  4PCQ A;  5J8F A;  1UHW A;  2PMU A;  1XB4 A;  4HYE A;  2A68 F;  1SFX A;  1UFM A;  4HLX A;  5DCF A;  2VE9 A;  2DLL A;  1FBQ A;  1ZG1 A;  1JGS A;  1XN7 A;  3TOB A;  2V79 A;  3DPT A;  3WGG A;  2VN2 A;  1K7A A;  5DUK A;  3WTV C;  1L3L A;  4HV6 A;  3MZH A;  1R1U A;  1UHM A;  4DQ2 A;  3I5U A;  1YW7 A;  1S29 A;  5BPD A;  4MHG A;  5HLH A;  2OBP A;  3IWF A;  4ON0 A;  4CGZ A;  1BI1 A;  2VBW A;  3VB2 A;  2IA0 A;  2FML A;  2RKH A;  3WTT C;  3JAM Z;  2F5E A;  5LEJ A;  2K02 A;  3ML6 A;  3RI4 A;  4DNC A;  3WE3 A;  2EV0 A;  2ZO4 A;  2PFB A;  4M73 A;  1XGN A;  2DQL A;  2ESH A;  2K27 A;  4M6X A;  3QU6 A;  4EGZ A;  1Z1D A;  5L3B A;  2A6E F;  2DU9 A;  5A2Q K;  2UWM A;  2FSW A;  5E1Z B;  1I1G A;  3QPT A;  2OAZ A;  4JK1 X;  1U8R A;  4CO8 A;  4UUV A;  4L9N A;  2ADU A;  2ZXJ A;  2XKO A;  1Z05 A;  1QGP A;  2V6C A;  2X0L A;  3JTH A;  2IP2 A;  4A0X A;  4A12 A;  4OIQ F;  5D5V B;  2DQR A;  2MLG A;  2CGP A;  1R1T A;  3HSF A;  1J75 A;  2EWN A;  1RNL A;  4LK1 F;  3DKW A;  3LQQ A;  1IUY A;  4BHB A;  3DP7 A;  2VC1 A;  2WC2 A;  2QQB A;  5BS6 A;  4OMZ A;  5HS7 A;  4L18 B;  4U88 A;  5HDN A;  3CDH A;  3KP6 A;  2DK8 A;  3TOA A;  1VTN C;  4LMY A;  4XLP F;  4IXA A;  5E17 F;  3LQR A;  1U5T A;  3GFL A;  1TQP A;  4GYI A;  1ZGJ A;  4RS8 A;  2EV6 A;  4HX7 A;  1LDD A;  3SQN A;  1HKQ A;  1V4R A;  1B9N A;  4HDU A;  2L54 A;  2LDU A;  4FX4 A;  5LHI A;  1DUX C;  4EM0 B;  2W25 A;  3ULQ B;  1PDN C;  3I59 A;  3JSO A;  1PUE E;  4HQM A;  3RJP A;  3J7A O;  2JTV A;  3I4P A;  2JRT A;  2ELH A;  4Y13 A;  3HRM A;  1ZLJ A;  4M9Z A;  2EFN A;  2HQR A;  2FNA A;  1K78 B;  1FYL A;  3EYY A;  2VT3 A;  1R5G A;  4EM2 A;  2QM3 A;  1G6N A;  2ZCW A;  2RQP A;  2STT A;  2BYV E;  2WTE A;  3ZMT A;  4AD9 A;  2DO7 A;  4M9X A;  2PN6 A;  3F23 A;  2YR2 A;  3T5X A;  2L4M A;  5DCM B;  4ZYG A;  4JBA A;  5CJ9 A;  2DAO A;  2J5P A;  1P4W A;  1T38 A;  1B4A A;  1IN4 A;  1SFE A;  2ZNZ A;  1BIA A;  3VFZ A;  3HTU A;  4UVC A;  3JTG A;  3FXQ A;  4HDV A;  2XHK A;  3BP8 A;  1D3Y A;  1MDM B;  2WV0 A;  2NNN A;  2K86 A;  4YG2 F;  4G7O F;  2M1B A;  3IHU A;  2O61 A;  3ISP A;  1HKT A;  4R8H A;  4ZYD A;  1MJ9 A;  4Q47 A;  2FBH A;  4GGG A;  1TBX A;  3O3K A;  4CIC A;  2DFI A;  3GUD A;  5HDG A;  5F6F A;  1GHC A;  2RNJ A;  4P5O A;  5FFX A;  5DD4 A;  2P7C B;  1H9G A;  2LF7 A;  1ULY A;  5ILV A;  3RYR A;  2QWW A;  3ZMU A;  3ZN1 A;  3ZN0 A;  1A04 A;  2PI0 A;  3RDI A;  3WU1 B;  2ZJ2 A;  4YFX F;  1DDN A;  5FD5 A;  3FMS A;  3KP4 A;  2KRF A;  5E8I A;  5HLG A;  4H0E A;  2M8E A;  2PG4 A;  3Q5F A;  2E7X A;  1TTY A;  2HKX A;  2XAH A;  5LHH A;  1IRG A;  4EJV A;  3WTS C;  5D5X B;  4RGU A;  3GLX A;  3BZ6 A;  3KP5 A;  4EV0 A;  2YPR A;  3KLN A;  2EV5 A;  2KIU A;  1BOA A;  1R22 A;  3WTU C;  4AIK A;  4EMS A;  1ZRF A;  5LBQ A;  3COA C;  4U0Y A;  1YW8 A;  3HOT A;  1S8N A;  5EEH A;  4G6D A;  1G3W A;  3M1E A;  3FM3 A;  1F5T A;  3ZP5 A;  2K4B A;  1FC3 A;  5CVI A;  1P6R A;  3E6C C;  5HS8 A;  5BMZ A;  1XDS A;  2F2E A;  4PDK A;  2P6S A;  1CF7 A;  3E5Q A;  2CO5 A;  2A3S A;  1FBU A;  2HKO A;  2H6C A;  4AWX B;  1XMA A;  1ZLK A;  4HW0 A;  1OMI A;  1IZ1 A;  5K1Y A;  3Q9V A;  4GYG A;  1SMY F;  4I98 B;  2IW5 A;  3QAH A;  4XSX F;  2QBY A;  2A61 A;  3E5U A;  1YTY A;  2AS5 F;  4OMY A;  2IA1 A;  2DBB A;  1YQA A;  1PP7 U;  4ZYE A;  4RB1 A;  2VOP A;  4CYD A;  3GWZ A;  3I71 A;  4OIP F;  1YIO A;  4OIN F;  5CVU A;  5L3D A;  1LDK B;  2F5F A;  2D2W A;  3KP7 A;  4N9I A;  2Q0O A;  4Q5S F;  1KGS A;  3CUQ C;  2ESN A;  4OU0 A;  3GFI A;  2P5L C;  2RC4 A;  2WWY A;  2ISZ A;  5IT9 K;  1XGS A;  3GXO A;  3DXJ F;  3LFK A;  4P9F A;  5D8L B;  1HBX G;  2QZ8 A;  2IA2 A;  1I27 A;  2H09 A;  2VBZ A;  1HW5 A;  1R7J A;  4EQQ A;  3IRQ A;  5HLI A;  4IHT A;  3MEX A;  1WWX A;  1D8K A;  1XGO A;  4ENN A;  3V7R A;  4O3M A;  5L3F A;  5LRS A;  3HHG A;  4HOB A;  4I7H A;  3CLO A;  2KJB A;  1D8J A;  1T6S A;  3C18 A;  3REO A;  5D8K B;  3M9A A;  3N4M A;  4PZJ A;  4PGH A;  3WTY C;  4IRI A;  1IXC A;  2L3D A;  2UXX A;  1FSH A;  2GWR A;  2VON A;  3L7W A;  3TQN A;  4G7Z F;  2IRF G;  2QUF A;  1B1B A;  1FP1 D;  2LF8 A;  2FBK A;  3VEP A;  5BPI A;  3GYH X;  2RDP A;  2KJC A;  1BI3 A;  4KIB A;  2GQQ A;  4L5I A;  2XRN A;  2X4H A;  1UCR A;  5FB2 A;  3F8M A;  4FT8 A;  2O3F A;  1XSX A;  1T39 A;  3L00 A;  4LB6 B;  2Z33 A;  2VC0 A;  1R5H A;  4A5N A;  4XSZ F;  5ILU A;  4IHS A;  3KLO A;  2XAQ A;  1BI0 A;  2FXA A;  4ESB A;  4HF2 A;  1Z6T A;  5TJJ A;  4S05 A;  4ESF A;  1F4K A;  4RB3 C;  2P5V A;  3T1B A;  4EGY A;  1EH8 A;  1EV7 A;  2D1V A;  1NHA A;  2XKP A;  1O57 A;  4WXD A;  5JFR A;  4K2E A;  4UNO A;  1J59 A;  2JPB A;  4KFC A;  4FHT A;  5J6X A;  4L9V A;  4HF0 A;  1JHH A;  4ZZD A;  5FLX Z;  1FBS A;  3K2Z A;  1H9T A;  2Y48 A;  1ONV A;  2P5K A;  3DPL C;  4M72 A;  3TKY A;  5DEQ A;  4NHJ A;  3RIR A;  3H92 A;  2FA5 A;  2EFO A;  2R7F A;  1HST A;  2M30 A;  1ZRD A;  1IF1 A;  2PMH A;  2EA2 A;  3F6O A;  2BV6 A;  1YS6 A;  3RKW A;  2FMY A;  5HVQ C;  3O6B B;  4LG0 A;  3GO5 A;  1YLF A;  5H6Q A;  1ZG3 A;  1U6G A;  1W7P A;  3T0Y A;  2LSO A;  2JZY A;  1GVJ A;  5E20 A;  1CGP A;  4HZF A;  3NEU A;  4YIF A;  4RGS A;  4HLY A;  4I02 A;  3R0A A;  4Y15 A;  3F3X A;  3ELK A;  4P96 A;  4OOI A;  3KE2 A;  3FM5 A;  2NAZ A;  3BPV A;  1TW2 A;  3TGN A;  4UV9 A;  3JSP A;  4U7B A;  3M7G A;  2VE8 A;  3B73 A;  3BY6 A;  3K1P A;  4UVB A;  3J81 K;  5BQT A;  2KKO A;  3R4K A;  2M87 A;  3QP6 A;  2P4W A;  1Z6R A;  1DPU A;  5D6E A;  1OPC A;  3QPH A;  2XAF A;  4WXC A;  1P4A A;  1G3T A;  3EDP A;  4MGR A;  1BC7 C;  1KU3 A;  1LDJ A;  1IN5 A;  2VT2 A;  1YG2 A;  2M45 A;  2OQG A;  2IJL A;  5CYV A;  2XIG A;  3WTW C;  1MJA A;  4ENM A;  1T2K A;  4IVN A;  4YFK F;  3RTR A;  3R61 A;  1TQM A;  3J80 K;  5ERI A;  1UST A;  1S7O A;  5D5U B;  3ABU A;  2OA4 A;  5ILS A;  5FO5 A;  3KET A;  2VOO A;  3F8F A;  3ZMV A;  3KEQ A;  2OZU A;  4Y17 A;  5D5W B;  3MCZ A;  1S7A A;  2XV4 S;  3IC7 A;  2FE3 A;  2E7W A;  3NRV A;  3WGH A;  3F8B A;  3FMQ A;  5ICC A;  2MC3 A;  1U2W A;  1J2X A;  4ESJ A;  6PAX A;  3FZV A;  4GCV A;  4I01 A;  1PP8 F;  3P9I A;  1YO5 C;  3SXY A;  3BJ6 A;  4L0Y B;  2XAS A;  1Z91 A;  3ROU A;  4EJU A;  1QQI A;  3R6S A;  1H0M A;  5LGN A;  1CF7 B;  5JR3 A;  2CG4 A;  3K0L A;  3RKX A;  3U9G A;  2H27 A;  2A07 F;  2EFQ A;  3HOS A;  1HKS A;  3T8T A;  1SD6 A;  1MZB A;  1MD0 A;  1SD4 A;  1LEB A;  2HTS A;  2MA3 A;  1P92 A;  3ZMS A;  3RKY A;  3CUQ A;  2V1U A;  3TO9 A;  3K1M A;  4EJW A;  2MH9 A;  1FWZ A;  5TRD A;  1K79 A;  1FZP B;  2R7D A;  2R3S A;  1J0R A;  4QWQ A;  1FYK A;  2QQA A;  5ICG A;  4CZZ A;  1B6A A;  1KU7 A;  3I54 A;  2FOK A;  3P7N A;  4N0B A;  3FXR A;  2GIV A;  1RZ4 A;  4XBF A;  3V7S A;  2KIF A;  1U78 A;  1T98 A;  3KP2 A;  1R23 A;  4S04 A;  1OKR A;  3OOP A;  2P8T A;  2UXN A;  3K1N A;  3FX3 A;  1UB9 A;  5E18 F;  3HHH A;  2E1N A;  4EJT A;  2J5O A;  1Z9C A;  1BM9 A;  4KA4 A;  2D1H A;  3WU0 A;  3BOQ A;  1ZYR F;  1XGM A;  5ICF A;  2FF4 A;  4LLG F;  5E8G A;  1XSV A;  4U7D A;  2DTR A;  4MQV A;  1ZAO A;  2Y75 A;  5DDG A;  3F22 A;  1KYW A;  2ZBK A;  1L0O C;  4U0W A;  3IWZ A;  1WI9 A;  5E1X A;  4Z2Y A;  5BOX A;  1BC8 C;  2G7U A;  5L3E A;  1O7L A;  3HRT A;  3ECH A;  3DF8 A;  1SAX A;  4LB5 A;  3W6J B;  3WTX C;  2ZME B;  1ODD A;  3LAP A;  4XRF A;  1I1S A;  1KQ9 A;  2IPQ X;  1JHF A;  5F1R A;  4LJZ F;  2VXZ A;  3HSE A;  4TV7 A;  4UHT A;  2NNY A;  5F64 A;  3I64 A;  1JE8 A;  3BPX A;  2Z3Y A;  3IRR A;  2ETH A;  2EFP A;  3I58 A;  1K6O A;  1K78 A;  3GFJ A;  4WK8 F;  3SZT A;  3AAF A;  2QEN A;  1R1V A;  2CFX A;  4Q4Z F;  5DV5 A;  5DUI A;  2CW0 F;  3IL2 A;  4IRH A;  3V7C A;  3MZY A;  1GXP A;  1OYY A;  2A6H F;  3MQ0 A;  2CQK A;  1YS7 A;  1LJ9 A;  3E97 A;  5H6R A;  5DCM A;  3EYI A;  3F21 A;  2PEX A;  2P7V B;  1FOK A;  2DI3 A;  4HX8 A;  3MAJ A;  4RB2 C;  1G3Y A;  2V9V A;  1HXD A;  5E1W A;  3U1D A;  4I0B A;  3MWM A;  1C0W A;  2V1D A;  5CLS A;  4M6Y A;  1QO0 D;  3CJN A;  1XDU A;  1QPM A;  1MDM A;  2BEO A;  3P9C A;  3SFZ A;  1ZG5 A;  1TW3 A;  1XCB A;  5A2Q Z;  4ZYH A;  1J9I A;  3R60 A;  3CUO A;  4XLN F;  5CVJ A;  1KU2 A;  2RV8 A;  1EH6 A;  4N9H A;  3QRF F;  3HUG A;  4GXO A;  2E1C A;  2V1X A;  1OYW A;  3IKT A;  1FX7 A;  2FU4 A;  4KDP A;  2XGX A;  3TDU C;  5LHG A;  4HF1 A;  3D5L A;  1T0F A;  5KVR A;  4BHP A;  4KT5 C;  2B0L A;  3KZZ A;  1QNT A;  5H20 A;  2HFH A;  2L01 A;  4MTE A;  1ON2 A;  3GEZ A;  1U5T B;  5D4S A;  3CO7 C;  1LNW A;  2W24 A;  3LAJ A;  3F6V A;  3J80 Z;  4KIC A;  4CDG A;  2OQR A;  3FWE A;  2A5Y B;  4NQW A;  4ENJ A;  2D45 A;  3KCC A;  1WRJ A;  4GO1 A;  1MKM A;  2GXG A;  2LKP A;  1SFU A;  4G7H F;  4L9T A;  1KYZ A;  1QZZ A;  1OYI A;  3I59 B;  4HAM A;  2DT5 A;  3E6M A;  2Y0M A;  4UXN A;  4HBL A;  1RIO H;  3DEU A;  5LEK A;  4JQF A;  4Q48 A;  2Z5U A;  4WF2 A;  2EA4 A;  2TDX A;  3LA3 A;  3QU3 A;  4BXU A;  3V4G A;  2MLK A;  3EET A;  3HIF A;  2GZW A;  1G4D A;  2OZ6 A;  5K5Q A;  2Q2E A;  3DQV C;  1WQ2 A;  3PFI A;  4A0Z A;  4LLL A;  2F5C A;  3HYI A;  1KQ0 A;  3V8K A;  5L3G A;  5IT3 A;  3CO6 C;  4RB0 A;  5AIQ A;  1BIB A;  2FRH A;  4E70 A;  2KIM A;  3GVA A;  2FBI A;  3CUQ B;  2DPD A;  5AON A;  1O3Q A;  3FMR A;  1GXQ A;  3K9T A;  1W5T A;  2HDC A;  1FT9 A;  1RUO A;  3WGI A;  1X3U A;  1WSU A;  4MEX F;  3G73 A;  2MBF A;  1W5S A;  4HV5 A;  1EH7 A;  3HSR A;  1DP7 P;  4A6E A;  4L0Z B;  3B02 A;  4P55 A;  3L9F A;  2ACJ A;  1FNN A;  4NB5 A;  2HS5 A;  3PQK A;  2PBI A;  1TNT A;  2UZK A;  4HX4 A;  1IW7 F;  4PGG A;  1IAW A;  3GFM A;  2MH2 A;  4RGR A;  3PQJ A;  1IXS B;  1ZRE A;  3BJO A;  2BE5 F;  3N97 A;  2VBY A;  2RN7 A;  4AIJ A;  4UVA A;  3VOE A;  4A2U A;  1U3E M;  2OD5 A;  5ICE A;  2IT0 A;  5FD6 A;  1IRF A;  1W4M A;  3L2C A;  1Z7U A;  5DD8 A;  2JT1 A;  2Z9O A;  3D0S A;  3OV8 A;  2GA1 A;  3I53 A;  4LFU A;  5HS9 A;  3SHF A;  3R0J A;  2DPU A;  4I0A A;  3U2R A;  4LLN A;  2QYO A;  1G3S A;  4U0V A;  1O3S A;  1MJB A;  3GF2 A;  4IPA A;  1WKM A;  3WTZ A;  5CVR A;  1IN7 A;  4IF4 A;  4ENK A;  3KFW X;  3QOP A;  3H3U A;  4O6J A;  2CSO A;  4RGX A;  1P2F A;  3L09 A;  4LGW A;  5FGM A;  2EJR A;  5EEG A;  1TQI A;  1BI2 A;  3ZMD A;  3FHZ A;  2W85 A;  4BNC A;  1R00 A;  1LB2 A;  1KA8 A;  1HQC A;  1BBY A;  4P9U A;  4B09 A;  1YFH A;  3BWG A;  2QVO A;  3RPU A;  4D0P A;  5J8C A;  2G9W A;  3V8L A;  1LQ1 A;  2XAJ A;  4RAY A;  3W6K B;  1B9M A;  5FLX K;  2QBY B;  3F8C A;  2GAU A; 
#chains in the Genus database with same CATH topology
 3KX2 A;  2R7V A;  3OYJ A;  4X6A J;  1O3R A;  2QA4 I;  2QQ8 A;  1XD7 A;  3L2Q A;  1YYV A;  5IYD J;  1WFX A;  3HGG A;  2R7X A;  1TL8 A;  1HSJ A;  3C1D A;  4HQE A;  4CHU A;  1D5V A;  1DPR A;  2VJ4 A;  3HRS A;  4EM1 A;  3JAM K;  3GZ5 A;  2DW4 A;  3IH4 A;  4G9Y A;  3OYI A;  1V3F A;  4V2G A;  3RPQ A;  3QYB A;  4A3E J;  4BYY A;  1I6X A;  2RRE A;  3J7Z I;  4C2T A;  2W84 A;  2BBY A;  2G7H A;  3MFK A;  5IT9 Z;  1JKQ C;  2STW A;  1MMN A;  5KK1 A;  3F0C A;  3NQO A;  3H36 A;  1XC5 A;  2HWV A;  1HA8 A;  3CJR B;  3ABT A;  2QQ9 A;  2A5W A;  3LSI A;  1HW1 A;  4IQJ A;  4KT6 A;  4ZZL A;  2O6G E;  1MSF C;  2NYX A;  5JHU A;  4KNY A;  2Y30 A;  2YU3 A;  5E3L A;  5J4V A;  3PO3 J;  3DFG A;  1TNS A;  4IRG A;  3SZP A;  1USS A;  1Z67 A;  2X6Y A;  5DYM A;  1R9T J;  1WH5 A;  3HTS B;  3NAR A;  3SYT A;  1RI7 A;  5JVT A;  2Z99 A;  5GAD J;  1JGG A;  2C6Y A;  1QZE A;  3V8J A;  1BJZ A;  1FMV A;  2V4J C;  1HF0 A;  2PLY A;  1WJB A;  3C2H A;  3GZN B;  3I4N J;  3A03 A;  5KHD A;  3BDD A;  3LWF A;  4E7J A;  2LMD A;  2YSR A;  4CXF A;  5K5R A;  1TLH B;  2QSG X;  4OIO F;  4IZZ A;  1ZH5 A;  2E5Z A;  1LVA A;  4KUM A;  2FNP A;  1ON1 A;  1BN5 A;  4WWC A;  3RYP A;  1UZC A;  1RES A;  4M74 A;  5K7F A;  2HEO A;  2FEZ A;  3ESW B;  2EFW A;  2KZV A;  2BZT A;  2HQ5 A;  2IGO A;  5F0C A;  2L4A A;  2DFH A;  3JRG A;  3ZCO A;  3CF5 F;  2EIJ H;  1RUN A;  1I39 A;  2EZH A;  2HTJ A;  2F4I A;  2JA5 J;  2WY8 Q;  1IV8 A;  2O03 A;  4BQA A;  1E3H A;  2WBM A;  1J7K A;  2Y69 H;  4LK0 F;  1R49 A;  4BAY A;  4AM3 A;  3WE2 A;  2HYF A;  2LVS A;  5JVG F;  3L2W A;  2OTL I;  3FK6 A;  3DV8 A;  1OLT A;  4UV8 A;  3F8N A;  1ZRC A;  2HU9 A;  3CCE I;  3S2W A;  1OR7 A;  2CYY A;  2LKS A;  1SD7 A;  2DDB A;  1MBJ A;  2L5Q A;  3PM1 A;  3Q9S A;  2RVC A;  3AG2 H;  1FTZ A;  4YFN F;  2HI3 A;  3BQZ A;  4RAG A;  2MC4 A;  1IN6 A;  1QZY A;  2NS8 A;  1JKR C;  4ZH4 F;  4IJA A;  1I5Z A;  1TWA J;  3O2P E;  2KP6 A;  3KEO A;  4PJ0 C;  2OU2 A;  1QU3 A;  3S8P A;  5HDK A;  1WJF A;  2CUJ A;  2MYS A;  3SEZ A;  4MTD A;  3AL0 B;  3RQI A;  2GBY A;  1E17 A;  2FD5 A;  1UEL B;  1D1A A;  2H6B A;  3OY9 A;  2M5W A;  2P6T A;  2B9S A;  2KMU A;  4MQ9 F;  2JN6 A;  4O5V A;  2X1D A;  2CQX A;  2HQA A;  1O7F A;  1VFC A;  3T8R A;  1HDP A;  2BVM A;  2DDA A;  1YW9 A;  2PX9 A;  3FIS A;  3K69 A;  4ETS A;  5LGT A;  3CC4 I;  4KMF A;  2K3P A;  1ZKG A;  1WHU A;  2EH3 A;  3C7J A;  1R4M B;  3E5X A;  5ED4 A;  4BHC A;  1J5Y A;  1MBK A;  1U5T C;  2XAG A;  2KT0 A;  2TCT A;  1FIA A;  5EG0 A;  5F04 A;  3MZ8 A;  1W7P D;  2HR3 A;  2K5C A;  1MH3 A;  1XPX A;  4B1R A;  4BY7 J;  3ZMZ A;  2CWE A;  4NBQ A;  3GCM A;  1P7I A;  1FPQ A;  4KYW A;  3E6D A;  3KP3 A;  2A69 F;  2PJP A;  1Y39 A;  2YS9 A;  2W00 A;  2LC2 A;  2PQ8 A;  1SMT A;  2YU9 J;  2O0Y A;  3LL7 A;  1FY7 A;  1MGT A;  2ZFW A;  4G6Q A;  5EGO A;  4F3Q A;  1DU6 A;  3CCQ I;  2VBX A;  1SC7 A;  3JRC A;  4RM3 A;  3WG9 A;  2LBF A;  2RAE A;  5J4Y A;  2LR8 A;  3RKQ A;  2QLZ A;  4BEH A;  3JRI A;  3G71 I;  2H94 A;  2DA6 A;  3GZ6 A;  1HDD C;  1HW2 A;  2CW8 A;  2NOJ B;  4L5J A;  2L9V A;  3TO6 A;  1R36 A;  3K7A J;  3SJM A;  3N05 A;  3O8H A;  2K4J A;  2P81 A;  4R1H A;  1QBJ A;  1IUF A;  3ECO A;  2L2O A;  1STZ A;  3FBI B;  4QIW N;  5B5E C;  3JW4 A;  1SVO A;  4EAT A;  3KZY A;  4L5E A;  2BGC A;  2O8X A;  1QHG A;  2MAB A;  2YX7 A;  5CVV A;  1MSE C;  2V6E A;  2JUC A;  4FIS A;  5IOZ A;  1XSD A;  1S6L A;  3EUH A;  4B47 A;  1TT0 A;  2ZC2 A;  2XRO A;  1ZQ3 P;  5F0H A;  2L7M P;  2HYG D;  5CKT A;  1QA6 A;  2MSY A;  2KDO A;  2YX4 A;  2DOF A;  4LG0 B;  4R79 A;  5GTI C;  2F4M B;  4DYQ A;  3CCU I;  3IKV A;  3HL2 A;  3GLL A;  4OIR F;  4EVI A;  1X58 A;  2H8W A;  3VOD A;  3E6B A;  2CRG A;  4KJZ A;  4F52 A;  5FKK A;  1W7P B;  4LD5 A;  1R6R A;  1VZ0 A;  2VUM J;  2L0K A;  1MBF A;  1F43 A;  4L9J A;  4M9S A;  2AXL A;  1RRJ A;  4AU7 A;  5E3N A;  3AG1 H;  1ZHF A;  4UY8 I;  4G8X A;  1FLI A;  5FFZ A;  2L02 A;  4NC6 A;  5AIP A;  2JA2 A;  1PVE A;  1A36 A;  4KIG A;  4F7Z A;  2QEX I;  3E3V A;  2VIX A;  1SD5 A;  1U9N A;  1YX5 A;  4PSX A;  1OQY A;  2LNB A;  3HRU A;  2RGV A;  5HOO A;  3OS1 A;  3L1P A;  2IS6 A;  4WX9 A;  2Y0S N;  2ZSH B;  4CUG A;  5M5Y J;  3CJT B;  3VWB A;  4UUT A;  1ETY A;  1KQ8 A;  2Y31 A;  4YEL A;  2E1M B;  3J81 Z;  1Y0U A;  2F5D A;  4H4K C;  4LG3 A;  2Q8K A;  4A0Y A;  1FYM A;  1AWC A;  3HOX J;  3P9K A;  5L3C A;  1REP C;  5IP9 J;  2OUM A;  2EB7 A;  5D4R A;  3ABM H;  4IEJ A;  4M3D A;  2BOL A;  3GW2 A;  3M8E A;  2XB0 X;  2AQF A;  1F9N A;  1P4X A;  4KN7 X;  2NS0 A;  5EYR A;  5EF6 A;  1X3Z B;  3I0T A;  1W0T A;  4BQN A;  2XUB A;  2X51 A;  2EK5 A;  4B8X A;  1UG2 A;  1XX5 A;  4I09 A;  4PJJ A;  2DYR H;  1AOY A;  2L7K A;  2E1O A;  3PIP F;  3ERE D;  3GBG A;  4Y4R A;  1E2X A;  4G94 A;  3BC8 A;  1BOB A;  2QKL B;  3FXO A;  2NVT J;  2LH9 A;  1S3J A;  3TO7 A;  2JSC A;  1IN8 A;  4QLC U;  4KN4 X;  3G1M A;  3QPS A;  4RAZ A;  4X0G A;  1ZN2 A;  2NVQ J;  1SFK A;  4HSR A;  3ZQ7 A;  3F72 A;  4KMU X;  4A5M A;  3FKJ A;  4A6D A;  5JI6 A;  3KZI C;  5FKN A;  2X6X A;  2NOG A;  4BJ5 C;  4HPQ A;  1AKH A;  1F1Z A;  1R5I D;  2NRA C;  2HZT A;  4MEY F;  3ZPL A;  3OYH A;  3CC7 I;  1XMK A;  4AC0 A;  4A93 J;  2DK5 A;  1JXS A;  1QVU A;  2FQ3 A;  2ZKZ A;  3FXU A;  1O3T A;  4FX0 A;  1B59 A;  3TDZ C;  2KHM A;  3C3W A;  2JPC A;  2K9Q A;  1QPI A;  3H3Z A;  1A31 A;  2W57 A;  2K7L A;  2JA8 J;  1FP2 A;  1NK3 P;  1JKP C;  3OS2 A;  3E0J B;  3BRO A;  5LLQ A;  3WOD F;  4XQF A;  3LSG A;  1IXR C;  4XOP A;  2ISY A;  2MD5 A;  1ZGA A;  3TW7 A;  3LA2 A;  4WXH A;  1WJC A;  2M7A A;  4YII A;  4D5F A;  4AIH A;  1BJA A;  2F6C A;  3CTA A;  4BH9 A;  2HQN A;  4MIM A;  4MLO A;  3FF5 A;  1Q1H A;  3QP5 A;  4AVP A;  3CP2 A;  2V9K A;  2ZNY A;  1FSE A;  4M71 A;  1XCV A;  5LRR A;  4KIF A;  1XTA A;  3G3Z A;  3S16 J;  2ID3 A;  4I2O A;  2VOD A;  2HOE A;  3LST A;  2ZME A;  4ASN A;  1MIJ A;  3EQL F;  1LEA A;  3JRB A;  2GA2 A;  2COM A;  2XVC A;  1KU9 A;  5LGU A;  2F5V A;  4MNU A;  4ZYA A;  4EJO A;  2LY9 A;  1I3Q J;  1YOV B;  2HGC A;  4BE1 A;  1A6I A;  2VB6 A;  1O4X A;  4NUB A;  4HG2 A;  4GRI A;  2ZXH A;  4XMY A;  3M8F A;  1R58 A;  4WCG A;  4A3K J;  3QYF A;  1PJR A;  5D6F A;  2IVM A;  5C4X J;  3GX4 X;  1UMQ A;  4HA8 A;  2GXB A;  5K5O A;  2WAF A;  1Y1V J;  2WY7 Q;  3LA7 A;  3IAS 2;  1ZAR A;  3VSL A;  2Y0S A;  3BJA A;  4PCQ A;  5J8F A;  1UHW A;  2IGK A;  4A69 C;  2PMU A;  2K3F A;  1XB4 A;  4BDY A;  4ITV A;  4HYE A;  2A68 F;  1VQ9 I;  1ENH A;  1SFX A;  1UFM A;  4HLX A;  5DCF A;  1X1A A;  3CJQ B;  2LD5 A;  2VE9 A;  2LLK A;  2DA2 A;  1RC9 A;  3UKG A;  2DLL A;  1FBQ A;  4ZC3 A;  1ZG1 A;  3BR1 A;  1YRN A;  1JGS A;  2V7F A;  1XN7 A;  4C3I J;  3S3M A;  3TOB A;  2V79 A;  4PUS A;  3DPT A;  3WGG A;  3DBH B;  2VN2 A;  1K7A A;  2PJR A;  3MKY B;  3ERM A;  2HPM A;  5DUK A;  1EKE A;  4HNT A;  3WTV C;  1L3L A;  4HV6 A;  3MZH A;  2Z1D A;  4BQQ A;  3BZC A;  3U1K A;  2BW3 A;  1R1U A;  1UHM A;  4DQ2 A;  3I5U A;  1YW7 A;  3DTE A;  1S29 A;  5BPD A;  4MHG A;  3SFI A;  2DA3 A;  5HLH A;  2OBP A;  3HXL A;  3IWF A;  4ON0 A;  3TW6 A;  3OYD A;  1BI1 A;  4CGZ A;  3S1N J;  2VBW A;  2R7S A;  3VB2 A;  2ELJ A;  2A05 A;  2IA0 A;  3VSK A;  1VQM I;  2FML A;  2RKH A;  3WTT C;  3EUH C;  3JAM Z;  2F5E A;  3ASN H;  5LEJ A;  2K02 A;  3ML6 A;  2KIS A;  3RI4 A;  3IV5 A;  1N78 A;  5FRN A;  4DNC A;  3OIP A;  2HVS A;  3WE3 A;  1NTC A;  2EV0 A;  3BG7 A;  3KIO A;  3OYB A;  2ZO4 A;  2PFB A;  3DBR B;  4F91 B;  4M73 A;  1GV5 A;  1XGN A;  4PSW A;  2DQL A;  2ESH A;  2HNH A;  2K27 A;  3PFY A;  4M6X A;  4AYB N;  3QU6 A;  1X3W B;  4EGZ A;  1Z1D A;  2L9S A;  1W36 D;  5L3B A;  3G6E I;  2A6E F;  2DU9 A;  5A2Q K;  3Q0U A;  5HNF A;  4XOT A;  2UWM A;  2E5N A;  2FSW A;  5E1Z B;  1I1G A;  3QPT A;  2FUG 2;  1N75 A;  3IP4 B;  3K70 C;  2OAZ A;  4JK1 X;  2V26 A;  1YE9 A;  1U8R A;  4CO8 A;  4UUV A;  4L9N A;  2ADU A;  2ZXJ A;  2L7Z A;  4B44 A;  2XKO A;  1Z05 A;  1QGP A;  4IHY A;  2V6C A;  2X0L A;  3JTH A;  2IP2 A;  4A0X A;  1JT6 A;  4A12 A;  4OIQ F;  4DGW B;  5D5V B;  2DQR A;  5KAF C;  4RM2 A;  3ZXS A;  2MLG A;  3DKX A;  2CGP A;  1R1T A;  3HSF A;  2VJ5 A;  4M3G A;  1J75 A;  2LKX A;  4RA2 A;  5IYB J;  1VQK I;  2EWN A;  1OCO H;  3IAM 2;  3TL4 X;  3TMO A;  1RNL A;  4LK1 F;  3DKW A;  3LQQ A;  5TGT A;  1IUY A;  4BHB A;  1GVD A;  3DP7 A;  2ME6 A;  3A4C A;  2VC1 A;  3M1C A;  1QVT A;  2DMT A;  2QQB A;  2WC2 A;  4OMZ A;  5HS7 A;  5BS6 A;  4U88 A;  4L18 B;  5HDN A;  4IL6 C;  3BZK A;  3CDH A;  2CFO A;  1MNE A;  3KP6 A;  2DK8 A;  3M3Y J;  3TOA A;  4D7N A;  1D5Y A;  1VTN C;  4JX4 A;  3G1O A;  4BS9 A;  4LMY A;  4XLP F;  4IXA A;  5E17 F;  3JR9 A;  1LPQ A;  3LQR A;  1U5T A;  3GFL A;  1TQP A;  1YJ9 I;  2M4G A;  1CQT A;  1LVK A;  2LTP A;  4GYI A;  1ZGJ A;  4A3L J;  1T56 A;  4RS8 A;  5CPR B;  2EV6 A;  3WU2 C;  4HX7 A;  1LDD A;  3SQN A;  2VJI A;  2XGE A;  1HKQ A;  5GTH C;  2JUG A;  1UHS A;  1V4R A;  2NS7 A;  1B9N A;  4HDU A;  4JX6 A;  2L54 A;  2LDU A;  5JLX A;  1TC3 C;  4FX4 A;  4HNU A;  5LHI A;  5E3O A;  1DUX C;  1D0Z A;  4EM0 B;  2W25 A;  3P5J A;  1JT0 A;  1U8B A;  3ULQ B;  1LFP A;  1PDN C;  3I59 A;  2DMU A;  3JSO A;  3FKI J;  1B8I B;  1PUE E;  1VQ6 I;  4HQM A;  3RJP A;  4XNF A;  1WJA A;  3PNT A;  3J7A O;  2I5U A;  2JTV A;  3I4P A;  2JRT A;  3D1N I;  4Z6Y A;  2DA4 A;  2ELH A;  4Y13 A;  1OCZ H;  5FLM J;  3HRM A;  1ZLJ A;  2MGQ A;  4M9Z A;  4AYB A;  4IHX A;  3PJR A;  2DA1 A;  2EFN A;  2HQR A;  2FNA A;  2QCO A;  1K78 B;  1FYL A;  4BEH B;  3EYY A;  2VT3 A;  2HVQ A;  1R5G A;  2HZD A;  4EM2 A;  5IPA A;  2QM3 A;  2LP0 A;  3D5S C;  1G6N A;  2ZCW A;  2RQP A;  2STT A;  2ECC A;  2BYV E;  2WTE A;  3ZMT A;  4AD9 A;  2DO7 A;  2M9H A;  4M9X A;  1MNM C;  3OYE A;  4BDZ A;  2PN6 A;  3F23 A;  1HOM A;  3WHB A;  2YR2 A;  3T5X A;  3TBI A;  2L4M A;  3Q0W A;  5DCM B;  4ZYG A;  4JBA A;  3BCB A;  1IG7 A;  5CJ9 A;  2DAO A;  3OYC A;  2J5P A;  3OYN A;  1P4W A;  1T38 A;  1B4A A;  1IN4 A;  4NDL A;  3B6A A;  1SFE A;  2OPT A;  3ZQC A;  4LIU A;  2Z16 A;  2ZNZ A;  4V2F A;  2M3A A;  2MFZ A;  3S2D J;  3FK7 A;  4E7I A;  4U87 A;  1BIA A;  3VFZ A;  4BE2 A;  3CCV I;  1GLN A;  2CV0 A;  1N25 A;  3HTU A;  4UVC A;  5IOY A;  5J1U A;  3JTG A;  3FXQ A;  1JKO C;  3PL8 A;  1ETK A;  4FAS D;  5HNH A;  1H88 C;  5F1J A;  4W1U A;  4PJM A;  4HDV A;  2XHK A;  3BP8 A;  1KZH A;  1D3Y A;  1MDM B;  2WV0 A;  2NNN A;  2K86 A;  4YG2 F;  4G7O F;  2M1B A;  2EZL A;  3IHU A;  2O61 A;  3DTI A;  2ZJP F;  3ISP A;  1HKT A;  4R8H A;  3SZG A;  4ZYD A;  2VI6 A;  3S1M J;  1Y6I A;  5B1A H;  1MJ9 A;  4Q47 A;  2DCE A;  2FBH A;  4BU2 A;  3E1S A;  3K4N A;  4GGG A;  2DJN A;  1TBX A;  3O3K A;  5F08 A;  4CIC A;  5GPA A;  4A3I J;  3GTQ J;  2DFI A;  3GUD A;  3OOU A;  5HDG A;  5F6F A;  1GHC A;  2RNJ A;  2Z2S B;  3GME A;  3HUG B;  4JP0 A;  4P5O A;  4RLQ A;  5FFX A;  4BUP A;  5DD4 A;  1POG A;  4E4H A;  4IOA F;  5JLW A;  2R93 J;  2P7C B;  1H9G A;  3E7L A;  1TT5 B;  1ETX A;  2LF7 A;  4A3M J;  2ELK A;  1JJ6 C;  1SVM A;  1ULY A;  2TRT A;  2R7U A;  5ILV A;  2KPM A;  3RYR A;  2QWW A;  3OS0 A;  2JQ7 A;  3ZMU A;  2FOW A;  3ZN1 A;  1M1E B;  3ZN0 A;  1A04 A;  4XKV A;  3OIO A;  2PI0 A;  3RDI A;  2E1M C;  1S9H A;  4XRM A;  3WU1 B;  2ZJ2 A;  4YFX F;  1S72 I;  5FD5 A;  1HLV A;  1DDN A;  4A3D J;  3FMS A;  3KP4 A;  5DTD A;  1K61 A;  2LOO A;  1V5E A;  3A01 B;  2L7F P;  1TP4 A;  4IHV A;  1A6Q A;  2LG4 A;  2KRF A;  4MFD A;  1A5J A;  5E8I A;  5E79 C;  5HLG A;  3G1L A;  5KCM A;  2OF7 A;  4DYR A;  3M8J A;  4H0E A;  2M8E A;  2PG4 A;  3M07 A;  4IOC F;  5HOD A;  3Q5F A;  1T95 A;  4XKB A;  3HB9 A;  3PUF A;  4NQW B;  2E7X A;  1TTY A;  2HKX A;  2XAH A;  5LHH A;  3GTG J;  4FQG A;  4GDF A;  1IRG A;  4CH7 A;  1RPW A;  4EJV A;  3QOD A;  1R71 A;  4B3X A;  1VQ4 I;  4MO7 A;  3WTS C;  1E3P A;  4RGU A;  5D5X B;  3GLX A;  2B63 J;  3BZ6 A;  2EIL H;  2K9S A;  1AHD P;  3KP5 A;  4EV0 A;  3VYR B;  4M3B A;  1ETO A;  3DLL F;  2CV2 A;  2MG4 A;  2YPR A;  2OJE D;  1V5F A;  3KLN A;  2EV5 A;  2KIU A;  1BOA A;  1R22 A;  3WTU C;  5FRO A;  4ABZ A;  4AIK A;  5J40 A;  1OCC H;  2QSF X;  1Z3X A;  4EMS A;  1ZRF A;  5LBQ A;  4RBO A;  3COA C;  3FXK A;  4U0Y A;  1YW8 A;  3HOT A;  1S8N A;  5EEH A;  2BXY A;  4G6D A;  4XK4 A;  4EEF G;  2DT7 B;  1W1W E;  2LK2 A;  3K4L A;  4CCK A;  1G3W A;  3M1E A;  3FM3 A;  1F5T A;  3ZP5 A;  4Y7N J;  4N4O B;  3U21 A;  2K4B A;  3CC2 I;  1K4T A;  1FC3 A;  5CVI A;  3LMM A;  4CYC A;  1P6R A;  4E7K A;  2Q2E B;  2HXO A;  3E6C C;  5HS8 A;  5BMZ A;  1UAA A;  1XDS A;  2F2E A;  4PDK A;  4XRS G;  2P6S A;  3KYL A;  1CF7 A;  3DTK A;  3E5Q A;  4UUS B;  2CO5 A;  2A3S A;  2W82 A;  1FBU A;  2HKO A;  2H6C A;  4PFP A;  4AWX B;  1XMA A;  1ZLK A;  4HW0 A;  1OMI A;  1IZ1 A;  4KIT B;  5K1Y A;  4IQ4 A;  4D5C A;  3Q9V A;  2MW8 A;  2QSH X;  3HOU J;  4GYG A;  4E7L A;  1SMY F;  4I98 B;  2PJR B;  2IW5 A;  2UV1 A;  3QAH A;  2L9N A;  5FKO A;  4JYK A;  4XSX F;  2QBY A;  1NG6 A;  2A61 A;  3E5U A;  1SAU A;  1YTY A;  2AS5 F;  4OMY A;  2IA1 A;  2DBB A;  1YQA A;  2N8G A;  2O5R A;  3KPH A;  4ZYE A;  1PP7 U;  4RB1 A;  1LE8 B;  2VOP A;  2JWT A;  4CYD A;  4QSH A;  2WAQ N;  3GWZ A;  3ABL H;  3I71 A;  4OIP F;  1YIO A;  4OIN F;  5CVU A;  5L3D A;  1LDK B;  2F5F A;  2D2W A;  2Q1Z B;  3KP7 A;  1WI3 A;  4N9I A;  3RZO J;  2Q0O A;  4NC7 A;  4Q5S F;  1MND A;  4IHW A;  1KGS A;  3CUQ C;  2ESN A;  4FE4 A;  4OU0 A;  5K7Z A;  3GFI A;  3I4M J;  2P5L C;  3CMM A;  2RC4 A;  2WWY A;  2ISZ A;  5IT9 K;  4XID A;  2FJ1 A;  1ORK A;  2W48 A;  1XGS A;  3PNY A;  3GXO A;  3FXJ A;  3DXJ F;  3LFK A;  4P9F A;  2CUZ A;  5D8L B;  2LRD A;  1HBX G;  2QZ8 A;  3BTJ A;  2IA2 A;  1UJ8 A;  3HOZ J;  1I27 A;  4XLE A;  5EJC A;  1X1B A;  2QKM B;  2VQG A;  4QPQ A;  2VKH A;  1VQ7 I;  2H09 A;  2VBZ A;  3CMA I;  3LSR A;  4CSW A;  2E60 A;  3BR3 A;  1UG0 A;  1HW5 A;  3CCJ I;  4Y3O A;  4XON A;  3GTP J;  5J1R A;  1R7J A;  4EQQ A;  5GAH J;  1XS9 A;  4BXF A;  1RR8 C;  3TED A;  4B43 A;  3IRQ A;  1G2H A;  5HLI A;  4IHT A;  3MEX A;  2QGU A;  1WWX A;  1DGR M;  3FDY A;  1D8K A;  4FTH A;  1V54 H;  1XGO A;  4G6T B;  4ENN A;  3W2V A;  3V7R A;  4O3M A;  1X1D A;  5L3F A;  3HHG A;  5LRS A;  3GTL J;  3DU5 A;  4HOB A;  4I7H A;  3CLO A;  2KJB A;  2M4K A;  1D8J A;  1T6S A;  2OTJ I;  3LSK A;  3C18 A;  3REO A;  3JRH A;  1LKX A;  5D8K B;  3M9A A;  2WA0 A;  3N4M A;  4PZJ A;  4PGH A;  5IY5 H;  5C3E J;  3WTY C;  4IRI A;  1IXC A;  3ZR8 X;  2L3D A;  3RPU D;  4BL0 B;  5LFA A;  4GFB A;  3GTJ J;  2UXX A;  3CCM I;  1FSH A;  2GWR A;  2VON A;  1U9O A;  2AO9 A;  2X9D A;  5GPC A;  4M3F A;  2L9R A;  3L7W A;  3TQN A;  4G7Z F;  2IRF G;  2QUF A;  5DS9 A;  1B1B A;  1FP1 D;  2VPL A;  3A2K A;  1OJL A;  2LF8 A;  3S14 J;  2FBK A;  3VEP A;  2HOS A;  1E0E A;  4XOR A;  3RSN A;  4A3G J;  5GAG J;  5BPI A;  3GYH X;  3BTL A;  4II2 A;  3ONQ A;  2RDP A;  2KJC A;  1BI3 A;  2R5Y B;  1MMS A;  4KIB A;  1FIP A;  1X4O A;  2GQQ A;  4E7S A;  4A3C J;  4L5I A;  2XRN A;  2BY3 A;  5JHF A;  2X4H A;  1UCR A;  5FB2 A;  3F8M A;  5E3M A;  1H8A C;  4FT8 A;  2O3F A;  1XSX A;  5FLV A;  1WGX A;  1JTY A;  2WAQ A;  3BG3 A;  3L00 A;  4S0H B;  1T39 A;  4LOC A;  3OYG A;  2XSJ C;  3HOY J;  4LB6 B;  2Z33 A;  2VC0 A;  1N77 A;  1R5H A;  4A5N A;  4DJA A;  3OYA A;  1B72 B;  2R7T A;  4XSZ F;  4I99 C;  3JRF A;  3BR5 A;  5ILU A;  4IHS A;  3FBN B;  3KLO A;  4IO9 F;  2XAQ A;  1BI0 A;  2FXA A;  2VAS A;  4ESB A;  4HF2 A;  1Z6T A;  5TJJ A;  3VYU B;  4S05 A;  4ESF A;  1LUJ B;  3MVP A;  1F4K A;  1FOX A;  3MKL A;  4RB3 C;  1VQN I;  2P5V A;  1Z7L A;  3T1B A;  2R5Z B;  4EGY A;  1EH8 A;  2XPW A;  1EV7 A;  2XF7 A;  2D1V A;  1QHH D;  1NHA A;  2O7O A;  2XKP A;  1O57 A;  2CJJ A;  2XAU A;  2HVR A;  2NXN B;  3BG5 A;  5J1Y A;  4WXD A;  5JFR A;  4K2E A;  3HM5 A;  3GTO J;  4IKF A;  3A0H C;  1BW6 A;  4UNO A;  1J59 A;  1VQL I;  2JPB A;  3TP3 A;  4KFC A;  4FHT A;  3BR0 A;  5J6X A;  4L9V A;  3LSH A;  4HF0 A;  1JHH A;  2DT6 A;  1GV2 A;  4V19 K;  2K9N A;  3LSJ A;  3JRA A;  4J19 A;  4ZZD A;  3MMY B;  5FLX Z;  1FBS A;  3K2Z A;  1H9T A;  1BL0 A;  1J09 A;  2DJI A;  2ZJQ F;  2JSP A;  2Y48 A;  1FMW A;  1ONV A;  2P5K A;  3DPL C;  4M72 A;  5CQG A;  5DEQ A;  3TKY A;  1FOY A;  4CCJ A;  4NHJ A;  3RIR A;  2LY2 A;  4UB8 C;  1ETV A;  5C4J J;  3H92 A;  2FA5 A;  5M5W J;  2DYS H;  2DN0 A;  2EFO A;  2R7F A;  1HST A;  4FET A;  2M30 A;  1ZRD A;  2E2H J;  1IF1 A;  3KYC B;  2PMH A;  2EA2 A;  4OAY A;  3F6O A;  2BV6 A;  1PUF A;  1YS6 A;  2EIK H;  2FMY A;  3RKW A;  3X2Q H;  5HVQ C;  3O6B B;  4LG0 A;  3GO5 A;  4D9J A;  1YJW I;  1EA3 A;  1YLF A;  2KZG A;  5H6Q A;  1ZG3 A;  1U6G A;  1VQP I;  2E34 A;  4HEA 2;  1IDY A;  3OR2 C;  3QYE A;  1W7P A;  3MD2 A;  1I6H J;  3T0Y A;  2LSO A;  4DZP A;  3VPR A;  1T08 B;  2JZY A;  1GVJ A;  5E20 A;  1CGP A;  2WB1 N;  3HGY A;  3CCR I;  3SEQ A;  4HZF A;  3NEU A;  4YIF A;  4RGS A;  4HLY A;  4I02 A;  3CES A;  3R0A A;  4Y15 A;  4Y52 J;  5FJ8 J;  3F3X A;  3EPZ A;  3RQ4 A;  3ELK A;  4P96 A;  4OOI A;  4IX7 A;  3KE2 A;  3FIW A;  2D5V A;  3FM5 A;  1X19 A;  1ZR4 A;  2NAZ A;  3BPV A;  1TW2 A;  2IEK A;  3TGN A;  4UV9 A;  3PIO F;  3JSP A;  4U7B A;  1BR1 A;  3M7G A;  2VE8 A;  3B73 A;  3BY6 A;  3K1P A;  2VXD A;  4UVB A;  3CCS I;  1VI0 A;  3J81 K;  3CP8 A;  1ITY A;  5BQT A;  3G4S I;  2KKO A;  3R4K A;  1P9Q C;  2M87 A;  3QP6 A;  2P4W A;  1Z6R A;  3OYL A;  1DPU A;  5D6E A;  2CQN A;  1OPC A;  2E35 A;  2JVH A;  1RR7 A;  3IH2 A;  2I8D A;  3QPH A;  2XAF A;  2AQE A;  1WJ5 A;  1IDZ A;  4WXC A;  3K2A A;  2IS1 A;  1MBH A;  1P4A A;  1G3T A;  3EDP A;  4MGR A;  3ZQH A;  4C3H J;  1BC7 C;  1KU3 A;  1LDJ A;  3AG3 H;  3G2B A;  5EZH A;  1IN5 A;  2VT2 A;  1YG2 A;  4A3J J;  4DIQ A;  2M45 A;  4BE0 A;  1YIJ I;  2OQG A;  4ZTJ A;  2CU7 A;  2IJL A;  5CYV A;  2XIG A;  3WTW C;  2IXS A;  1MJA A;  4ENM A;  3PSI A;  1T2K A;  2E19 A;  3BCA A;  4IVN A;  4YFK F;  4Y33 A;  3RTR A;  4W97 A;  3R61 A;  1T0F C;  1QRY A;  4II3 A;  1TQM A;  1EF4 A;  3J80 K;  1E3O C;  5ERI A;  5H2F C;  1U0J A;  1UST A;  1S7O A;  3ASO H;  5D5U B;  3ABU A;  2OA4 A;  5ILS A;  1IRX A;  4I76 A;  5FO5 A;  3KET A;  4D7M A;  2VOO A;  1TWC J;  3F8F A;  3HOV J;  3ZMV A;  2K40 A;  3KEQ A;  2OZU A;  2ID6 A;  4Y17 A;  5IP7 J;  3A02 A;  3DWL E;  3H5N A;  4PJN A;  5D5W B;  4ZDO A;  4DOZ A;  4A3F J;  3MCZ A;  1TWG J;  1S7A A;  2XV4 S;  2X48 A;  3IC7 A;  3W3C A;  5EEA A;  2FE3 A;  2KFD A;  2E7W A;  3Q3S A;  2BHZ A;  3NRV A;  5EG0 B;  3AL0 C;  3WGH A;  3OSG A;  1WVR A;  3F8B A;  2DMP A;  3FMQ A;  2EBI A;  2OCE A;  5ICC A;  1MMA A;  2WB1 A;  2MC3 A;  1U2W A;  5EZG A;  5J3L A;  5EGO B;  1J2X A;  1MBE A;  4ESJ A;  2EPF A;  6PAX A;  3S3N A;  3FZV A;  4GCV A;  1D0Y A;  4I01 A;  2JVG A;  1PP8 F;  3P9I A;  2LBF B;  1YO5 C;  3SXY A;  3BJ6 A;  4L0Y B;  2XAS A;  1Z91 A;  1A35 A;  3ROU A;  3HC7 A;  4EJU A;  1D1B A;  3BT9 A;  1QQI A;  3R6S A;  1H0M A;  5LGN A;  1CF7 B;  5JR3 A;  2CG4 A;  2NVU B;  4PFO A;  3K0L A;  2CQ7 A;  5C44 J;  3RKX A;  3U9G A;  3EUA A;  1IJW C;  3KEY A;  2H27 A;  2A07 F;  3HBL A;  2EFQ A;  4DW6 A;  3HOS A;  1HKS A;  1OCP A;  3T8T A;  5LD2 C;  1SD6 A;  3MKW B;  5IP6 A;  1K6Y A;  3CDI A;  2XC7 A;  1MZB A;  1MD0 A;  1SD4 A;  4RAF A;  3M4O J;  4CCL A;  1LEB A;  2HYJ A;  2HTS A;  2M7B A;  2MA3 A;  1P92 A;  3ZMS A;  3RKY A;  3CUQ A;  2V1U A;  3S93 A;  4BXX J;  3FXM A;  3F9K A;  4ZDL A;  3TO9 A;  4E6K G;  3K1M A;  1X1P A;  4EJW A;  2MH9 A;  1FWZ A;  5TRD A;  2JJ7 A;  1K79 A;  1FZP B;  3H9Q A;  2R7D A;  2R3S A;  3ZQQ A;  1J0R A;  4QWQ A;  1FYK A;  5B66 C;  2QQA A;  5ICG A;  2M0C A;  4CZZ A;  4YRV A;  1Y0N A;  1B6A A;  2H8R A;  3GTK J;  2K9L A;  2HPI A;  2VLA A;  1KU7 A;  1MMG A;  3I54 A;  2FOK A;  2KIQ A;  3P7N A;  1SAN A;  4N0B A;  3FXR A;  2GIV A;  3DKY A;  3CD6 I;  1RZ4 A;  4XBF A;  3V7S A;  3HKZ N;  2KIF A;  3Q0V A;  1U78 A;  1T98 A;  3KP2 A;  1G59 A;  2GLO A;  1R23 A;  3UNG C;  4S04 A;  1OKR A;  2KQR A;  3OOP A;  4BKX A;  2P8T A;  3TP0 A;  2UXN A;  1ZTR A;  3I9V 2;  3K1N A;  3PNV A;  3FX3 A;  1ERD A;  4XLA A;  3V42 A;  1UB9 A;  3ZQL A;  3CMY A;  1WJE A;  5E18 F;  4B48 A;  1Z3Y A;  2EQR A;  3HHH A;  4KIS A;  2E1N A;  4EJT A;  3CF2 A;  4D1Q A;  3H0G J;  1XG1 A;  1NH3 A;  2J5O A;  1F36 A;  1Z9C A;  2NVX J;  1BM9 A;  4QPO A;  4KA4 A;  2D1H A;  1X1C A;  3LFU A;  4YEJ A;  4CCN A;  3WU0 A;  3ZQI A;  2M0M A;  3BOQ A;  4XR6 A;  4C2M J;  1ZYR F;  4AVZ A;  1X2N A;  1ETW A;  1XGM A;  2QF7 A;  5ICF A;  3VDX A;  2FF4 A;  4LLG F;  2DXI A;  5E8G A;  1Z0X A;  3K4B A;  3I3L A;  1XSV A;  2F4O B;  4U7D A;  2DTR A;  1AKH B;  4MQV A;  1ZAO A;  3J7A Y;  2ZB9 A;  1IC8 A;  2Y75 A;  3I55 I;  3JCU C;  1D1C A;  5DDG A;  3F22 A;  3MKZ A;  2B7E A;  1KYW A;  3PSF A;  5F0F A;  2ZBK A;  1L0O C;  4U0W A;  1FTT A;  3IWZ A;  1WI9 A;  1FOW A;  5BNG A;  5E1X A;  1VF9 A;  3QPL A;  3S32 A;  4Z2Y A;  5BOX A;  3CZ6 A;  1NG7 A;  1BW5 A;  4LIT A;  3DLA A;  1BC8 C;  2G7U A;  2R7W A;  5L3E A;  2VKV A;  3S3O A;  1O7L A;  3HRT A;  4JOM A;  2KLO A;  2M8G X;  3ZQG A;  4B4C A;  3S2H J;  1ZEL A;  1JUS A;  2JMW A;  3DF8 A;  3ECH A;  4XL9 A;  1SAX A;  3W6J B;  4HNV A;  4G12 A;  4HRI A;  4LB5 A;  2DMQ A;  3WTX C;  2ZME B;  2K85 A;  1ODD A;  2RNG A;  3LAP A;  4XRF A;  1I1S A;  1S7E A;  1KQ9 A;  4M3E A;  2KRH A;  2IPQ X;  1JHF A;  2XF6 A;  3D5R C;  3HZJ A;  5F1R A;  4LJZ F;  3H0D A;  2VXZ A;  2CQQ A;  2BY1 A;  3HSE A;  3LSM A;  4TV7 A;  4UHT A;  2NNY A;  1NK2 P;  5F64 A;  2V1N A;  4BQO A;  3WHC A;  3DBL B;  1IV6 A;  3OMY A;  1B8I A;  3OL4 A;  3HKZ A;  3I64 A;  1VQO I;  1JE8 A;  2CS3 A;  3BPX A;  2XF5 A;  2Z3Y A;  1ETQ A;  4CA0 A;  3A0B C;  1WPK A;  3BTC A;  3OWT A;  3C2B A;  1JI8 A;  4RDU A;  3IRR A;  2ETH A;  2CH0 A;  3BG6 A;  3QOE A;  4YIR X;  2PMZ N;  2EFP A;  1LFB A;  2ZXI A;  3I58 A;  3L2R A;  4J01 A;  2UUZ A;  1K6O A;  1K78 A;  1YRN B;  1JUP A;  3GFJ A;  2HDW A;  4WK8 F;  3SZT A;  3AAF A;  2R7O A;  3OSF A;  4RLF A;  2QEN A;  2O9L A;  4BJ6 C;  1R1V A;  1Y8Q B;  2CFX A;  2GXA A;  2LYC A;  4Q4Z F;  5DV5 A;  2XSD C;  5DUI A;  3H5R A;  3C2G A;  3MN2 A;  2CW0 F;  4XN3 A;  3IL2 A;  2E36 A;  4IRH A;  3PUB A;  3MZY A;  3V7C A;  1GXP A;  1OYY A;  2IGM A;  3DEE A;  3HG9 A;  2A6H F;  9ANT A;  3MQ0 A;  2CQK A;  3AFH A;  2BW3 B;  1YS7 A;  1LJ9 A;  3E97 A;  4LIV A;  2H1L A;  5H6R A;  5DCM A;  4F55 A;  4XN0 A;  2COB A;  3EYI A;  2LY1 A;  3HEF A;  4C3J J;  1DP3 A;  1IO2 A;  2ZXW H;  3F21 A;  1PUF B;  2CV1 A;  2PEX A;  1VQ8 I;  2P7V B;  1FOK A;  2VKD A;  2DI3 A;  4HX8 A;  3MAJ A;  4DBQ A;  4RB2 C;  1G3Y A;  2V9V A;  2X85 A;  2P0W A;  4F93 B;  1HXD A;  2GM4 A;  1FEX A;  5E1W A;  2JK3 A;  3U1D A;  2IGN A;  1AA7 A;  3AKZ A;  2ECB A;  5K7H A;  2YUS A;  4UB6 C;  2A6T A;  4I0B A;  4OWR B;  3MWM A;  1C0W A;  2XRL A;  4XM3 A;  2V1D A;  5CLS A;  4BBR J;  4M6Y A;  1QO0 D;  2BY2 A;  3CJN A;  4JX5 A;  1XDU A;  1JUM A;  1QPM A;  3FHN A;  2O8K A;  1MDM A;  2BEO A;  2WV1 A;  2R7R A;  3HJE A;  1P7J A;  3P9C A;  1VQ5 I;  4ANJ A;  3SFZ A;  1ZG5 A;  1TW3 A;  1XCB A;  5A2Q Z;  3IH3 A;  2HOA A;  3OIQ A;  4DZJ A;  4ZYH A;  5GP9 A;  1FJL A;  3B6C A;  3J7Y J;  3NWS A;  1J9I A;  3OL3 A;  2AXT C;  2CW7 A;  2BY0 A;  3R60 A;  3CUO A;  4XLN F;  5CVJ A;  4AUX A;  1KU2 A;  2RV8 A;  1EH6 A;  4N9H A;  2LRE A;  3QRF F;  3HUG A;  4GXO A;  2E1C A;  2V1X A;  1OYW A;  1RET A;  2NVY J;  2BVL A;  1X4P A;  3IKT A;  4CCM A;  3GTM J;  3OYF A;  1FX7 A;  3BLY A;  2FU4 A;  3OYK A;  1TWH J;  4KDP A;  2XGX A;  3TDU C;  2G0E A;  5LHG A;  4AID A;  4HF1 A;  2EIN H;  3D5L A;  5F27 A;  1XMX A;  1T0F A;  2DFE A;  2FQ4 A;  5KVR A;  3PO2 J;  1W0U A;  2PMZ A;  2MD0 A;  4BHP A;  2R4G A;  1GT0 C;  1S5L C;  1H89 C;  2E2J J;  4KT5 C;  2B0L A;  2DOD A;  3KZZ A;  4J00 A;  2DMN A;  2VKE A;  3A01 A;  1QNT A;  5H20 A;  5TIS C;  2VPR A;  1EJ9 A;  4I6Z A;  2HFH A;  2L01 A;  2ME0 A;  4MTE A;  1ON2 A;  2XPU A;  1MH4 A;  3GEZ A;  5J47 A;  1TZL A;  4PJL A;  1I50 J;  3K10 A;  1U5T B;  1MMD A;  5D4S A;  3H9J A;  3L2V A;  3CO7 C;  3BQY A;  1LNW A;  2W24 A;  3LAJ A;  3F6V A;  3J80 Z;  2IS2 A;  4KIC A;  2DTZ A;  4CDG A;  2OQR A;  2DA5 A;  3FWE A;  2A5Y B;  4NQW A;  4ENJ A;  2D45 A;  1OCR H;  3KCC A;  3DPU A;  1WRJ A;  3RZD J;  3I56 I;  1OR7 C;  4ZJZ A;  4BAC A;  4GO1 A;  1MKM A;  2GXG A;  2LKP A;  1SFU A;  2M2E A;  5M3F J;  1IRZ A;  4G7H F;  4XKC A;  3DEW A;  4L9T A;  1KYZ A;  1QZZ A;  3JRE A;  1OYI A;  2OC6 A;  3I59 B;  4HAM A;  2DT5 A;  3ZOB A;  1WZ2 A;  3E6M A;  1OFC X;  2Y0M A;  4UXN A;  4HBL A;  1Y1W J;  2VQL A;  4MFE A;  2XB5 A;  1RIO H;  2CMP A;  3DEU A;  4ZDP A;  5LEK A;  1W36 C;  4JQF A;  4Q48 A;  2Z5U A;  4WF2 A;  2EA4 A;  1W5C C;  2TDX A;  1T33 A;  3BTI A;  5DM7 F;  5B3S H;  2R7Z J;  2M34 A;  2DOA A;  3LA3 A;  3QU3 A;  1V55 H;  1G8X A;  3LOC A;  2KDZ A;  4BXU A;  4C30 A;  1MW7 A;  3V4G A;  3S1Q J;  3VYT B;  2MLK A;  2ICW G;  3EET A;  3BR6 A;  3HIF A;  4B3A A;  2GZW A;  2CUE A;  3LNQ A;  1WJD A;  3H5A A;  1G4D A;  4ZTF A;  1HC8 A;  1I3A A;  1DU0 A;  4M6V A;  2OZ6 A;  3W2W A;  3ZGK A;  5K5Q A;  1SVL A;  3S15 J;  2W4S A;  2Q2E A;  3DQV C;  1WQ2 A;  3PFI A;  4A0Z A;  1DQU A;  2VJJ A;  4LLL A;  2F5C A;  2CUF A;  3HYI A;  1KQ0 A;  4UUS A;  2R7Q A;  3V8K A;  4BJT A;  5L3G A;  4FE7 A;  2HOT A;  1Z21 A;  5IT3 A;  3CO6 C;  3H35 A;  3L2U A;  1DGW Y;  4RB0 A;  5AIQ A;  1BIB A;  5HLT A;  3OR1 C;  4PK4 A;  1YIT I;  2VQC A;  2FRH A;  5FKL A;  3QWL A;  1GUU A;  2KL4 A;  4E70 A;  2KIM A;  1V5G A;  3CME I;  2GOX B;  1IGN A;  3GVA A;  2FBI A;  3IUO A;  2R92 J;  2EIM H;  2K9M A;  3H9G A;  3CUQ B;  4CCO A;  1OIS A;  2DPD A;  3CQZ J;  5AON A;  1O3Q A;  3FMR A;  1GXQ A;  3JRD A;  4P1W A;  3QQA A;  3WG7 H;  2ZFU A;  1LE8 A;  3HDD A;  2XGC A;  4N4N B;  3K9T A;  3RCO A;  1BA5 A;  1W5T A;  2HDC A;  4XLF A;  5IYC J;  3H1C A;  1FT9 A;  5FKM A;  1RUO A;  3WGI A;  1X3U A;  2DFF A;  1WSU A;  4MEX F;  3DCF A;  3G73 A;  2MBF A;  1W5S A;  4HV5 A;  1TWF J;  1EH7 A;  2W1O A;  5M3M J;  3W2A A;  3HOW J;  1D0X A;  2GOM A;  4FCY A;  3HSR A;  1DP7 P;  4A6E A;  2X6O A;  1RKW A;  3NWT A;  4L0Z B;  3B02 A;  2F48 A;  2W7N A;  1KON A;  2X1E A;  4P55 A;  2H1K A;  1JJ8 C;  5B1B H;  2DOE A;  3BR2 A;  4XLC A;  3L9F A;  4BBS J;  2ACJ A;  3H3V K;  4E7H A;  2EZI A;  1FNN A;  4NB5 A;  2HDD A;  2OCC H;  2ZSI B;  2HS5 A;  1JTX A;  3VYS B;  1MBG A;  3FXL A;  2PBI A;  3PQK A;  1TNT A;  5M5X J;  2UZK A;  4HX4 A;  5KAI C;  1IW7 F;  4A3B J;  4PGG A;  1IAW A;  2E2I J;  3GFM A;  2MH2 A;  4RGR A;  3PQJ A;  1GDT A;  3A1Y A;  1SFO J;  1IXS B;  2AHQ A;  1ZRE A;  4XRS A;  2Y9Y A;  3BJO A;  4QTR A;  1ZR2 A;  2BE5 F;  1WH7 A;  2HXI A;  2XDV A;  3N97 A;  3NAU A;  3HPH A;  2VBY A;  4HST A;  1YJN I;  1SEU A;  2RN7 A;  4AIJ A;  1K4S A;  4UVA A;  3VOE A;  4A2U A;  1U3E M;  2OD5 A;  1BR2 A;  3ABK H;  5ICE A;  4X1E A;  5CQE A;  2IT0 A;  1R4N B;  5FD6 A;  1HCR A;  1IRF A;  1W4M A;  2V9P A;  3L2C A;  1LFU P;  1Z7U A;  2X1C A;  5DD8 A;  1ZK8 A;  2EZK A;  2JT1 A;  3W6V A;  2Z9O A;  3D0S A;  3OV8 A;  2GA1 A;  1YX3 A;  3I53 A;  4LFU A;  5FRM A;  2IBD A;  5HS9 A;  3SHF A;  2KRC A;  1BR4 A;  3K4C A;  2DA7 A;  2JA7 J;  1Z77 A;  3R0J A;  3CDL A;  4F92 B;  4E7Z A;  4XLH A;  4I0A A;  2DPU A;  3U2R A;  1WCM J;  5KNL A;  3ZRG A;  4LLN A;  1PYV A;  2QYO A;  1G3S A;  2BHY A;  3DU6 A;  3K6G A;  2R5Y A;  3ZQF A;  1Q1V A;  4U0V A;  1O3S A;  2VQH A;  1MJB A;  3GF2 A;  4IPA A;  1WKM A;  3WTZ A;  1AU7 A;  4BY1 J;  4NC8 A;  4C9Y A;  5CVR A;  1IN7 A;  4IF4 A;  2JA6 J;  3CCY A;  4ENK A;  3KFW X;  3QOP A;  3H3U A;  4O6J A;  2WAD A;  2CSO A;  3CCL I;  3K4J A;  4RGX A;  1P2F A;  2FX0 A;  3L09 A;  1APL C;  4LGW A;  1Y56 A;  4NNJ A;  5FGM A;  2EJR A;  3S17 J;  5EEG A;  1TQI A;  1BI2 A;  4XKW A;  3ZMD A;  3FHZ A;  1B72 A;  2WAE A;  2E71 A;  2OV7 A;  2XGD A;  3CLQ A;  1RKT A;  3HPG A;  3SDB A;  1ZGW A;  2W85 A;  5GAE J;  3S1R J;  2JRM A;  4DBR A;  3UR3 C;  4XIC A;  3SDG A;  4BNC A;  3K4M A;  3O8G A;  1R00 A;  1LB2 A;  3K70 D;  1KA8 A;  4RMN A;  1HQC A;  3EUK L;  4CYC B;  1BBY A;  2ZME C;  3LSP A;  3K4K A;  4OAZ A;  2LFB A;  2X6W A;  4P9U A;  1VND A;  2XPV A;  4B09 A;  3KYD B;  5DM6 F;  2Y2Z A;  2R5Z A;  2Y9Z A;  4BGD A;  1YFH A;  1OCT C;  3BWG A;  3BG9 A;  1T8I A;  2QVO A;  3RPU A;  4D0P A;  1ACI A;  5J8C A;  2G9W A;  3V8L A;  1Y8R B;  3OYM A;  2IAI A;  4C2U A;  1LQ1 A;  2VL8 A;  2XAJ A;  4RAY A;  3W6K B;  2GIZ A;  1B9M A;  3AG4 H;  2ZJR F;  5FLX K;  2I10 A;  4DYC A;  5EDN A;  1YI2 I;  4CZC A;  2QBY B;  2IS4 A;  1K83 J;  2BXZ A;  2RQQ A;  3F8C A;  2GAU A;  2R0Q C;  1YHQ I;  1X2M A; 
#chains in the Genus database with same CATH homology
 1O3R A;  1XD7 A;  1YYV A;  1HSJ A;  3C1D A;  4HQE A;  4CHU A;  1D5V A;  1DPR A;  4EM1 A;  3HRS A;  3JAM K;  3GZ5 A;  2DW4 A;  4G9Y A;  1V3F A;  3RPQ A;  4BYY A;  1I6X A;  2W84 A;  2BBY A;  2G7H A;  3MFK A;  5IT9 Z;  2STW A;  5KK1 A;  3NQO A;  2HWV A;  3ABT A;  2QQ9 A;  1HW1 A;  4ZZL A;  2O6G E;  2NYX A;  5JHU A;  4KNY A;  2YU3 A;  3DFG A;  1TNS A;  4IRG A;  3SZP A;  1USS A;  5DYM A;  3HTS B;  1RI7 A;  5JVT A;  2Z99 A;  2C6Y A;  3V8J A;  2PLY A;  3BDD A;  3LWF A;  2YSR A;  4CXF A;  5K5R A;  1TLH B;  4OIO F;  1ZH5 A;  1LVA A;  4KUM A;  2FNP A;  1ON1 A;  1BN5 A;  4WWC A;  3RYP A;  4M74 A;  2HEO A;  2FEZ A;  2EFW A;  2L4A A;  1RUN A;  2HTJ A;  2O03 A;  4BQA A;  1J7K A;  4LK0 F;  4BAY A;  3WE2 A;  2HYF A;  1ZRC A;  3DV8 A;  4UV8 A;  3F8N A;  3S2W A;  1OR7 A;  2CYY A;  1SD7 A;  3Q9S A;  2RVC A;  4YFN F;  1IN6 A;  1QZY A;  4ZH4 F;  4IJA A;  1I5Z A;  3O2P E;  3KEO A;  2OU2 A;  5HDK A;  4MTD A;  1E17 A;  2H6B A;  2M5W A;  2P6T A;  4MQ9 F;  4O5V A;  1O7F A;  3T8R A;  4ETS A;  1YW9 A;  4KMF A;  3K69 A;  5LGT A;  3C7J A;  3E5X A;  5ED4 A;  4BHC A;  1J5Y A;  1U5T C;  2XAG A;  1W7P D;  2HR3 A;  3ZMZ A;  2CWE A;  1FPQ A;  4KYW A;  3E6D A;  3KP3 A;  2A69 F;  2PJP A;  2PQ8 A;  1SMT A;  2O0Y A;  1FY7 A;  1MGT A;  2ZFW A;  4G6Q A;  2VBX A;  3WG9 A;  2QLZ A;  2H94 A;  3GZ6 A;  1HW2 A;  4L5J A;  3TO6 A;  1R36 A;  2K4J A;  4R1H A;  1QBJ A;  3ECO A;  1STZ A;  3JW4 A;  3KZY A;  2BGC A;  2O8X A;  2YX7 A;  5CVV A;  1XSD A;  1S6L A;  3EUH A;  2XRO A;  2HYG D;  2YX4 A;  4LG0 B;  4R79 A;  3IKV A;  4OIR F;  4EVI A;  3VOD A;  3E6B A;  1W7P B;  4LD5 A;  4L9J A;  4M9S A;  2AXL A;  1ZHF A;  4G8X A;  1FLI A;  5FFZ A;  2L02 A;  5AIP A;  4KIG A;  4F7Z A;  3E3V A;  1SD5 A;  2LNB A;  3HRU A;  2RGV A;  5HOO A;  4WX9 A;  1KQ8 A;  3J81 Z;  1FYM A;  1Y0U A;  2F5D A;  2Q8K A;  4A0Y A;  1AWC A;  1REP C;  3P9K A;  5L3C A;  2EB7 A;  5D4R A;  3GW2 A;  3M8E A;  1F9N A;  1P4X A;  4KN7 X;  2NS0 A;  3I0T A;  2XUB A;  2EK5 A;  4B8X A;  4I09 A;  1AOY A;  3ERE D;  1E2X A;  4G94 A;  1S3J A;  3TO7 A;  2JSC A;  1IN8 A;  4QLC U;  4KN4 X;  4RAZ A;  1ZN2 A;  3ZQ7 A;  3F72 A;  4KMU X;  4A5M A;  4A6D A;  5JI6 A;  1F1Z A;  2NRA C;  2HZT A;  4MEY F;  3ZPL A;  1XMK A;  2DK5 A;  1JXS A;  2FQ3 A;  2ZKZ A;  3FXU A;  1O3T A;  4FX0 A;  1B59 A;  3TDZ C;  3C3W A;  2JPC A;  3H3Z A;  2W57 A;  2K7L A;  1FP2 A;  3BRO A;  5LLQ A;  3WOD F;  1IXR C;  2ISY A;  2MD5 A;  1ZGA A;  3LA2 A;  4WXH A;  4YII A;  4AIH A;  1BJA A;  3CTA A;  4BH9 A;  2HQN A;  3FF5 A;  1Q1H A;  3QP5 A;  4AVP A;  2ZNY A;  1FSE A;  4M71 A;  1XCV A;  5LRR A;  4KIF A;  3G3Z A;  4I2O A;  2VOD A;  2HOE A;  3LST A;  2ZME A;  4ASN A;  3EQL F;  1LEA A;  2GA2 A;  2COM A;  2XVC A;  1KU9 A;  5LGU A;  4MNU A;  4EJO A;  2HGC A;  3M8F A;  1R58 A;  4WCG A;  5D6F A;  2IVM A;  3GX4 X;  4HA8 A;  2GXB A;  5K5O A;  3LA7 A;  1ZAR A;  3BJA A;  4PCQ A;  5J8F A;  1UHW A;  2PMU A;  1XB4 A;  4HYE A;  2A68 F;  1SFX A;  1UFM A;  4HLX A;  5DCF A;  2VE9 A;  2DLL A;  1FBQ A;  1ZG1 A;  1JGS A;  1XN7 A;  3TOB A;  2V79 A;  3DPT A;  3WGG A;  2VN2 A;  1K7A A;  5DUK A;  3WTV C;  1L3L A;  4HV6 A;  3MZH A;  1R1U A;  1UHM A;  4DQ2 A;  3I5U A;  1YW7 A;  1S29 A;  5BPD A;  4MHG A;  5HLH A;  2OBP A;  3IWF A;  4ON0 A;  4CGZ A;  1BI1 A;  2VBW A;  3VB2 A;  2IA0 A;  2FML A;  2RKH A;  3WTT C;  3JAM Z;  2F5E A;  5LEJ A;  2K02 A;  3ML6 A;  3RI4 A;  4DNC A;  3WE3 A;  2EV0 A;  2ZO4 A;  2PFB A;  4M73 A;  1XGN A;  2DQL A;  2ESH A;  2K27 A;  4M6X A;  3QU6 A;  4EGZ A;  1Z1D A;  5L3B A;  2A6E F;  2DU9 A;  5A2Q K;  2UWM A;  2FSW A;  5E1Z B;  1I1G A;  3QPT A;  2OAZ A;  4JK1 X;  1U8R A;  4CO8 A;  4UUV A;  4L9N A;  2ADU A;  2ZXJ A;  2XKO A;  1Z05 A;  1QGP A;  2V6C A;  2X0L A;  3JTH A;  2IP2 A;  4A0X A;  4A12 A;  4OIQ F;  5D5V B;  2DQR A;  2MLG A;  2CGP A;  1R1T A;  3HSF A;  1J75 A;  2EWN A;  1RNL A;  4LK1 F;  3DKW A;  3LQQ A;  1IUY A;  4BHB A;  3DP7 A;  2VC1 A;  2WC2 A;  2QQB A;  5BS6 A;  4OMZ A;  5HS7 A;  4L18 B;  4U88 A;  5HDN A;  3CDH A;  3KP6 A;  2DK8 A;  3TOA A;  1VTN C;  4LMY A;  4XLP F;  4IXA A;  5E17 F;  3LQR A;  1U5T A;  3GFL A;  1TQP A;  4GYI A;  1ZGJ A;  4RS8 A;  2EV6 A;  4HX7 A;  1LDD A;  3SQN A;  1HKQ A;  1V4R A;  1B9N A;  4HDU A;  2L54 A;  2LDU A;  4FX4 A;  5LHI A;  1DUX C;  4EM0 B;  2W25 A;  3ULQ B;  1PDN C;  3I59 A;  3JSO A;  1PUE E;  4HQM A;  3RJP A;  3J7A O;  2JTV A;  3I4P A;  2JRT A;  2ELH A;  4Y13 A;  3HRM A;  1ZLJ A;  4M9Z A;  2EFN A;  2HQR A;  2FNA A;  1K78 B;  1FYL A;  3EYY A;  2VT3 A;  1R5G A;  4EM2 A;  2QM3 A;  1G6N A;  2ZCW A;  2RQP A;  2STT A;  2BYV E;  2WTE A;  3ZMT A;  4AD9 A;  2DO7 A;  4M9X A;  2PN6 A;  3F23 A;  2YR2 A;  3T5X A;  2L4M A;  5DCM B;  4ZYG A;  4JBA A;  5CJ9 A;  2DAO A;  2J5P A;  1P4W A;  1T38 A;  1B4A A;  1IN4 A;  1SFE A;  2ZNZ A;  1BIA A;  3VFZ A;  3HTU A;  4UVC A;  3JTG A;  3FXQ A;  4HDV A;  2XHK A;  3BP8 A;  1D3Y A;  1MDM B;  2WV0 A;  2NNN A;  2K86 A;  4YG2 F;  4G7O F;  2M1B A;  3IHU A;  2O61 A;  3ISP A;  1HKT A;  4R8H A;  4ZYD A;  1MJ9 A;  4Q47 A;  2FBH A;  4GGG A;  1TBX A;  3O3K A;  4CIC A;  2DFI A;  3GUD A;  5HDG A;  5F6F A;  1GHC A;  2RNJ A;  4P5O A;  5FFX A;  5DD4 A;  2P7C B;  1H9G A;  2LF7 A;  1ULY A;  5ILV A;  3RYR A;  2QWW A;  3ZMU A;  3ZN1 A;  3ZN0 A;  1A04 A;  2PI0 A;  3RDI A;  3WU1 B;  2ZJ2 A;  4YFX F;  1DDN A;  5FD5 A;  3FMS A;  3KP4 A;  2KRF A;  5E8I A;  5HLG A;  4H0E A;  2M8E A;  2PG4 A;  3Q5F A;  2E7X A;  1TTY A;  2HKX A;  2XAH A;  5LHH A;  1IRG A;  4EJV A;  3WTS C;  5D5X B;  4RGU A;  3GLX A;  3BZ6 A;  3KP5 A;  4EV0 A;  2YPR A;  3KLN A;  2EV5 A;  2KIU A;  1BOA A;  1R22 A;  3WTU C;  4AIK A;  4EMS A;  1ZRF A;  5LBQ A;  3COA C;  4U0Y A;  1YW8 A;  3HOT A;  1S8N A;  5EEH A;  4G6D A;  1G3W A;  3M1E A;  3FM3 A;  1F5T A;  3ZP5 A;  2K4B A;  1FC3 A;  5CVI A;  1P6R A;  3E6C C;  5HS8 A;  5BMZ A;  1XDS A;  2F2E A;  4PDK A;  2P6S A;  1CF7 A;  3E5Q A;  2CO5 A;  2A3S A;  1FBU A;  2HKO A;  2H6C A;  4AWX B;  1XMA A;  1ZLK A;  4HW0 A;  1OMI A;  1IZ1 A;  5K1Y A;  3Q9V A;  4GYG A;  1SMY F;  4I98 B;  2IW5 A;  3QAH A;  4XSX F;  2QBY A;  2A61 A;  3E5U A;  1YTY A;  2AS5 F;  4OMY A;  2IA1 A;  2DBB A;  1YQA A;  1PP7 U;  4ZYE A;  4RB1 A;  2VOP A;  4CYD A;  3GWZ A;  3I71 A;  4OIP F;  1YIO A;  4OIN F;  5CVU A;  5L3D A;  1LDK B;  2F5F A;  2D2W A;  3KP7 A;  4N9I A;  2Q0O A;  4Q5S F;  1KGS A;  3CUQ C;  2ESN A;  4OU0 A;  3GFI A;  2P5L C;  2RC4 A;  2WWY A;  2ISZ A;  5IT9 K;  1XGS A;  3GXO A;  3DXJ F;  3LFK A;  4P9F A;  5D8L B;  1HBX G;  2QZ8 A;  2IA2 A;  1I27 A;  2H09 A;  2VBZ A;  1HW5 A;  1R7J A;  4EQQ A;  3IRQ A;  5HLI A;  4IHT A;  3MEX A;  1WWX A;  1D8K A;  1XGO A;  4ENN A;  3V7R A;  4O3M A;  5L3F A;  5LRS A;  3HHG A;  4HOB A;  4I7H A;  3CLO A;  2KJB A;  1D8J A;  1T6S A;  3C18 A;  3REO A;  5D8K B;  3M9A A;  3N4M A;  4PZJ A;  4PGH A;  3WTY C;  4IRI A;  1IXC A;  2L3D A;  2UXX A;  1FSH A;  2GWR A;  2VON A;  3L7W A;  3TQN A;  4G7Z F;  2IRF G;  2QUF A;  1B1B A;  1FP1 D;  2LF8 A;  2FBK A;  3VEP A;  5BPI A;  3GYH X;  2RDP A;  2KJC A;  1BI3 A;  4KIB A;  2GQQ A;  4L5I A;  2XRN A;  2X4H A;  1UCR A;  5FB2 A;  3F8M A;  4FT8 A;  2O3F A;  1XSX A;  1T39 A;  3L00 A;  4LB6 B;  2Z33 A;  2VC0 A;  1R5H A;  4A5N A;  4XSZ F;  5ILU A;  4IHS A;  3KLO A;  2XAQ A;  1BI0 A;  2FXA A;  4ESB A;  4HF2 A;  1Z6T A;  5TJJ A;  4S05 A;  4ESF A;  1F4K A;  4RB3 C;  2P5V A;  3T1B A;  4EGY A;  1EH8 A;  1EV7 A;  2D1V A;  1NHA A;  2XKP A;  1O57 A;  4WXD A;  5JFR A;  4K2E A;  4UNO A;  1J59 A;  2JPB A;  4KFC A;  4FHT A;  5J6X A;  4L9V A;  4HF0 A;  1JHH A;  4ZZD A;  5FLX Z;  1FBS A;  3K2Z A;  1H9T A;  2Y48 A;  1ONV A;  2P5K A;  3DPL C;  4M72 A;  3TKY A;  5DEQ A;  4NHJ A;  3RIR A;  3H92 A;  2FA5 A;  2EFO A;  2R7F A;  1HST A;  2M30 A;  1ZRD A;  1IF1 A;  2PMH A;  2EA2 A;  3F6O A;  2BV6 A;  1YS6 A;  3RKW A;  2FMY A;  5HVQ C;  3O6B B;  4LG0 A;  3GO5 A;  1YLF A;  5H6Q A;  1ZG3 A;  1U6G A;  1W7P A;  3T0Y A;  2LSO A;  2JZY A;  1GVJ A;  5E20 A;  1CGP A;  4HZF A;  3NEU A;  4YIF A;  4RGS A;  4HLY A;  4I02 A;  3R0A A;  4Y15 A;  3F3X A;  3ELK A;  4P96 A;  4OOI A;  3KE2 A;  3FM5 A;  2NAZ A;  3BPV A;  1TW2 A;  3TGN A;  4UV9 A;  3JSP A;  4U7B A;  3M7G A;  2VE8 A;  3B73 A;  3BY6 A;  3K1P A;  4UVB A;  3J81 K;  5BQT A;  2KKO A;  3R4K A;  2M87 A;  3QP6 A;  2P4W A;  1Z6R A;  1DPU A;  5D6E A;  1OPC A;  3QPH A;  2XAF A;  4WXC A;  1P4A A;  1G3T A;  3EDP A;  4MGR A;  1BC7 C;  1KU3 A;  1LDJ A;  1IN5 A;  2VT2 A;  1YG2 A;  2M45 A;  2OQG A;  2IJL A;  5CYV A;  2XIG A;  3WTW C;  1MJA A;  4ENM A;  1T2K A;  4IVN A;  4YFK F;  3RTR A;  3R61 A;  1TQM A;  3J80 K;  5ERI A;  1UST A;  1S7O A;  5D5U B;  3ABU A;  2OA4 A;  5ILS A;  5FO5 A;  3KET A;  2VOO A;  3F8F A;  3ZMV A;  3KEQ A;  2OZU A;  4Y17 A;  5D5W B;  3MCZ A;  1S7A A;  2XV4 S;  3IC7 A;  2FE3 A;  2E7W A;  3NRV A;  3WGH A;  3F8B A;  3FMQ A;  5ICC A;  2MC3 A;  1U2W A;  1J2X A;  4ESJ A;  6PAX A;  3FZV A;  4GCV A;  4I01 A;  1PP8 F;  3P9I A;  1YO5 C;  3SXY A;  3BJ6 A;  4L0Y B;  2XAS A;  1Z91 A;  3ROU A;  4EJU A;  1QQI A;  3R6S A;  1H0M A;  5LGN A;  1CF7 B;  5JR3 A;  2CG4 A;  3K0L A;  3RKX A;  3U9G A;  2H27 A;  2A07 F;  2EFQ A;  3HOS A;  1HKS A;  3T8T A;  1SD6 A;  1MZB A;  1MD0 A;  1SD4 A;  1LEB A;  2HTS A;  2MA3 A;  1P92 A;  3ZMS A;  3RKY A;  3CUQ A;  2V1U A;  3TO9 A;  3K1M A;  4EJW A;  2MH9 A;  1FWZ A;  5TRD A;  1K79 A;  1FZP B;  2R7D A;  2R3S A;  1J0R A;  4QWQ A;  1FYK A;  2QQA A;  5ICG A;  4CZZ A;  1B6A A;  1KU7 A;  3I54 A;  2FOK A;  3P7N A;  4N0B A;  3FXR A;  2GIV A;  1RZ4 A;  4XBF A;  3V7S A;  2KIF A;  1U78 A;  1T98 A;  3KP2 A;  1R23 A;  4S04 A;  1OKR A;  3OOP A;  2P8T A;  2UXN A;  3K1N A;  3FX3 A;  1UB9 A;  5E18 F;  3HHH A;  2E1N A;  4EJT A;  2J5O A;  1Z9C A;  1BM9 A;  4KA4 A;  2D1H A;  3WU0 A;  3BOQ A;  1ZYR F;  1XGM A;  5ICF A;  2FF4 A;  4LLG F;  5E8G A;  1XSV A;  4U7D A;  2DTR A;  4MQV A;  1ZAO A;  2Y75 A;  5DDG A;  3F22 A;  1KYW A;  2ZBK A;  1L0O C;  4U0W A;  3IWZ A;  1WI9 A;  5E1X A;  4Z2Y A;  5BOX A;  1BC8 C;  2G7U A;  5L3E A;  1O7L A;  3HRT A;  3ECH A;  3DF8 A;  1SAX A;  4LB5 A;  3W6J B;  3WTX C;  2ZME B;  1ODD A;  3LAP A;  4XRF A;  1I1S A;  1KQ9 A;  2IPQ X;  1JHF A;  5F1R A;  4LJZ F;  2VXZ A;  3HSE A;  4TV7 A;  4UHT A;  2NNY A;  5F64 A;  3I64 A;  1JE8 A;  3BPX A;  2Z3Y A;  3IRR A;  2ETH A;  2EFP A;  3I58 A;  1K6O A;  1K78 A;  3GFJ A;  4WK8 F;  3SZT A;  3AAF A;  2QEN A;  1R1V A;  2CFX A;  4Q4Z F;  5DV5 A;  5DUI A;  2CW0 F;  3IL2 A;  4IRH A;  3V7C A;  3MZY A;  1GXP A;  1OYY A;  2A6H F;  3MQ0 A;  2CQK A;  1YS7 A;  1LJ9 A;  3E97 A;  5H6R A;  5DCM A;  3EYI A;  3F21 A;  2PEX A;  2P7V B;  1FOK A;  2DI3 A;  4HX8 A;  3MAJ A;  4RB2 C;  1G3Y A;  2V9V A;  1HXD A;  5E1W A;  3U1D A;  4I0B A;  3MWM A;  1C0W A;  2V1D A;  5CLS A;  4M6Y A;  1QO0 D;  3CJN A;  1XDU A;  1QPM A;  1MDM A;  2BEO A;  3P9C A;  3SFZ A;  1ZG5 A;  1TW3 A;  1XCB A;  5A2Q Z;  4ZYH A;  1J9I A;  3R60 A;  3CUO A;  4XLN F;  5CVJ A;  1KU2 A;  2RV8 A;  1EH6 A;  4N9H A;  3QRF F;  3HUG A;  4GXO A;  2E1C A;  2V1X A;  1OYW A;  3IKT A;  1FX7 A;  2FU4 A;  4KDP A;  2XGX A;  3TDU C;  5LHG A;  4HF1 A;  3D5L A;  1T0F A;  5KVR A;  4BHP A;  4KT5 C;  2B0L A;  3KZZ A;  1QNT A;  5H20 A;  2HFH A;  2L01 A;  4MTE A;  1ON2 A;  3GEZ A;  1U5T B;  5D4S A;  3CO7 C;  1LNW A;  2W24 A;  3LAJ A;  3F6V A;  3J80 Z;  4KIC A;  4CDG A;  2OQR A;  3FWE A;  2A5Y B;  4NQW A;  4ENJ A;  2D45 A;  3KCC A;  1WRJ A;  4GO1 A;  1MKM A;  2GXG A;  2LKP A;  1SFU A;  4G7H F;  4L9T A;  1KYZ A;  1QZZ A;  1OYI A;  3I59 B;  4HAM A;  2DT5 A;  3E6M A;  2Y0M A;  4UXN A;  4HBL A;  1RIO H;  3DEU A;  5LEK A;  4JQF A;  4Q48 A;  2Z5U A;  4WF2 A;  2EA4 A;  2TDX A;  3LA3 A;  3QU3 A;  4BXU A;  3V4G A;  2MLK A;  3EET A;  3HIF A;  2GZW A;  1G4D A;  2OZ6 A;  5K5Q A;  2Q2E A;  3DQV C;  1WQ2 A;  3PFI A;  4A0Z A;  4LLL A;  2F5C A;  3HYI A;  1KQ0 A;  3V8K A;  5L3G A;  5IT3 A;  3CO6 C;  4RB0 A;  5AIQ A;  1BIB A;  2FRH A;  4E70 A;  2KIM A;  3GVA A;  2FBI A;  3CUQ B;  2DPD A;  5AON A;  1O3Q A;  3FMR A;  1GXQ A;  3K9T A;  1W5T A;  2HDC A;  1FT9 A;  1RUO A;  3WGI A;  1X3U A;  1WSU A;  4MEX F;  3G73 A;  2MBF A;  1W5S A;  4HV5 A;  1EH7 A;  3HSR A;  1DP7 P;  4A6E A;  4L0Z B;  3B02 A;  4P55 A;  3L9F A;  2ACJ A;  1FNN A;  4NB5 A;  2HS5 A;  3PQK A;  2PBI A;  1TNT A;  2UZK A;  4HX4 A;  1IW7 F;  4PGG A;  1IAW A;  3GFM A;  2MH2 A;  4RGR A;  3PQJ A;  1IXS B;  1ZRE A;  3BJO A;  2BE5 F;  3N97 A;  2VBY A;  2RN7 A;  4AIJ A;  4UVA A;  3VOE A;  4A2U A;  1U3E M;  2OD5 A;  5ICE A;  2IT0 A;  5FD6 A;  1IRF A;  1W4M A;  3L2C A;  1Z7U A;  5DD8 A;  2JT1 A;  2Z9O A;  3D0S A;  3OV8 A;  2GA1 A;  3I53 A;  4LFU A;  5HS9 A;  3SHF A;  3R0J A;  2DPU A;  4I0A A;  3U2R A;  4LLN A;  2QYO A;  1G3S A;  4U0V A;  1O3S A;  1MJB A;  3GF2 A;  4IPA A;  1WKM A;  3WTZ A;  5CVR A;  1IN7 A;  4IF4 A;  4ENK A;  3KFW X;  3QOP A;  3H3U A;  4O6J A;  2CSO A;  4RGX A;  1P2F A;  3L09 A;  4LGW A;  5FGM A;  2EJR A;  5EEG A;  1TQI A;  1BI2 A;  3ZMD A;  3FHZ A;  2W85 A;  4BNC A;  1R00 A;  1LB2 A;  1KA8 A;  1HQC A;  1BBY A;  4P9U A;  4B09 A;  1YFH A;  3BWG A;  2QVO A;  3RPU A;  4D0P A;  5J8C A;  2G9W A;  3V8L A;  1LQ1 A;  2XAJ A;  4RAY A;  3W6K B;  1B9M A;  5FLX K;  2QBY B;  3F8C A;  2GAU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...