1BBYA

Dna-binding domain from human rap30, nmr, minimized average
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
69
structure length
69
Chain Sequence
RARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYRHYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural homology between the Rap30 DNA-binding domain and linker histone H5: implications for preinitiation complex assembly.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulation
molecule keywords RAP30
total genus 13
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1998-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02270 TFIIF_beta TFIIF, beta subunit HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1bbyA00
5JVTA 3CJNA 2FE3A 2UXNA 5FLXK 3NRVA 3TO9A 2A69F 4Y13A 1LDKB 1JXSA 4RAYA 1IUYA 4BYYA 2BYVE 2GIVA 1U5TB 3LAPA 1JHHA 2QENA 5FFXA 4GCVA 2P5LC 3KEQA 4KA4A 4IF4A 2OQGA 3VEPA 2EK5A 2ESNA 1IF1A 3BPVA 4LLLA 4KT5C 3LQRA 3REOA 4B8XA 1YW7A 3EYYA 4ZYGA 1UHMA 2ISZA 2CG4A 4CYDA 2V79A 1ULYA 1ZN2A 3P7NA 1HW1A 1XDUA 5D4SA 4AIHA 5EEHA 1OPCA 1ZLKA 4IXAA 2K86A 1O3TA 1IXCA 4ON0A 3J80K 3FF5A 4LK1F 5FD6A 4U7DA 3O3KA 1UCRA 1U2WA 1XGMA 2HYFA 5E18F 2XKOA 2R7FA 1H9TA 4BAYA 4CICA 1OYYA 1JE8A 3KP2A 3P9KA 5BS6A 3WTYC 4HX7A 1IW7F 3GVAA 3QPTA 4G94A 2OQRA 4IJAA 2DFIA 3GFMA 2RN7A 1SD4A 1ZH5A 1RUNA 2UXXA 5EEGA 3H3UA 3SHFA 2DQRA 3WU1B 1K79A 1F5TA 4I09A 2L02A 1P6RA 4PZJA 1YFHA 2ZNYA 1G3YA 2RC4A 4OMZA 3C1DA 6PAXA 3PQKA 3EETA 1QO0D 1U3EM 3LQQA 1XSVA 3GUDA 1XCVA 3RYRA 1NHAA 4OIRF 5J6XA 3AAFA 3RJPA 3F8BA 5DCMA 2GAUA 3E5QA 3HRUA 5K5RA 4P5OA 3ML6A 1B4AA 2HFHA 1KU9A 1TNTA 4ETSA 1PP8F 3HRSA 5K5OA 3K69A 3LSTA 3WTZA 3E6BA 3CUQB 2DK8A 2DI3A 2DK5A 1LNWA 4RS8A 1XGNA 2A68F 2IA0A 3JTHA 2R7DA 1AWCA 5E17F 1TTYA 2YSRA 5FD5A 3VB2A 5E1XA 3F8CA 2EFNA 4A0XA 3IKTA 2FBHA 4A6EA 4L9VA 3BZ6A 3RIRA 3I58A 2J5PA 2VBYA 3CO6C 5A2QZ 2A07F 2L4AA 4IVNA 4ENNA 2IVMA 3L7WA 1R5GA 3O6BB 3FZVA 1S3JA 2H27A 2FNPA 1W7PA 4IRHA 1K78B 3I59A 4MGRA 1PP7U 4Z2YA 4EJVA 1ODDA 5CVVA 4S05A 2V1UA 3MWMA 2PBIA 2P4WA 3WTSC 1XSXA 5LEJA 3QP5A 5ERIA 1IXSB 4MTDA 3O2PE 4XRFA 1C0WA 1P4AA 2LDUA 2HR3A 3F22A 1ZG5A 4HQEA 5DD4A 1TNSA 4FHTA 4M6YA 3RYPA 3S2WA 4DNCA 3ZMSA 4JBAA 1MGTA 3KLNA 3ABTA 4A6DA 4UVCA 3J7AO 2FF4A 2X4HA 4IHSA 1UB9A 1LDJA 2GA2A 3I4PA 1FBUA 4JQFA 4L9TA 2XROA 1WWXA 2W57A 1BI3A 3TOAA 5BOXA 3BJAA 1IAWA 2W84A 1T6SA 2ISYA 4A0YA 1D8JA 2MLGA 1IRGA 1YYVA 1L3LA 2DT5A 2OD5A 2H09A 2E1CA 5JFRA 4EJWA 3K1PA 1UHWA 1S7OA 2VN2A 1I5ZA 5HDKA 3I0TA 3I64A 4P55A 1RNLA 2D2WA 2M5WA 3FMSA 3MAJA 4MEXF 2KJCA 2P7VB 2XAQA 4HA8A 2F5EA 2OA4A 3WE2A 2EJRA 3TDZC 1J75A 4WCGA 3ZN0A 5CVRA 4AIKA 3HRTA 5KVRA 2M45A 2IP2A 1H9GA 4EM2A 1FYKA 3E97A 2XAGA 4KIGA 5D8LB 5D6FA 5ICGA 3BDDA 4ESFA 3Q5FA 3ZN1A 2VT3A 3NQOA 2VT2A 2BEOA 5DDGA 1XGSA 1WI9A 4IHTA 2ZJ2A 4OU0A 2XUBA 2GZWA 4EJUA 1QZYA 4JK1X 1BC7C 2HGCA 4G7ZF 2X0LA 4LK0F 1B9MA 1HW2A 3GX4X 1MJAA 3QRFF 2FA5A 3H3ZA 3ZMVA 4LB5A 2A5YB 2ZBKA 5D4RA 1SMTA 2VOOA 3FM3A 4XBFA 1GVJA 2ETHA 2M8EA 2XVCA 2BV6A 3JSOA 3IKVA 2F5CA 2MH2A 3IWZA 4BQAA 5DUIA 1OYWA 1O3QA 3T8TA 1YTYA 3ROUA 2O03A 3ECHA 2VODA 4KN7X 2VC0A 3GZ5A 3HSEA 3KP7A 3WGIA 3V8JA 4YFXF 4OIOF 4L5JA 2ACJA 1KYWA 3WODF 1KQ8A 1LQ1A 1T98A 1LVAA 3OOPA 3T1BA 4RB0A 4WXCA 2QBYB 4L9JA 2ZFWA 4KIFA 3FWEA 2QQ9A 2HKXA 5D5VB 3KETA 2XGXA 3J81Z 3ZQ7A 5LBQA 3KP6A 4KUMA 2HOEA 4CGZA 2FBIA 2RV8A 4UV8A 1HKSA 4XSZF 3ERED 2STWA 2ZCWA 3R60A 3N97A 1R58A 3GF2A 2XIGA 4Y15A 3GFLA 3MZHA 1FBQA 1Z05A 3JSPA 1U6GA 3LA7A 5E20A 5DD8A 5J8FA 4I7HA 2FQ3A 2EFPA 3CLOA 1R22A 4WF2A 2KKOA 4UVAA 2VE9A 3R4KA 2V1XA 3I59B 4WXDA 2QBYA 1MKMA 2G9WA 2FMYA 5LHGA 4I02A 4AWXB 3GO5A 1YW8A 3SXYA 4O5VA 5TJJA 4PGHA 5F64A 3HUGA 4G9YA 4I01A 4GYIA 2GA1A 3QU6A 1ZAOA 1R00A 3BPXA 1WSUA 3I54A 3DEUA 2PI0A 1RUOA 5F6FA 2O6GE 3C18A 2YX4A 4BHCA 4RB1A 4LD5A 1J59A 3QPHA 5HS9A 2JPCA 4HF1A 4LG0A 1Z91A 1SFEA 1BIAA 4EM0B 3TO7A 3HSRA 3J81K 2DAOA 3KCCA 4E70A 1G4DA 1YW9A 1Z1DA 3V7RA 2FOKA 3BWGA 3C7JA 1DDNA 3KZYA 3NEUA 1MZBA 2E1NA 2VBXA 3ECOA 1R23A 2IJLA 3E5XA 2HZTA 3ZPLA 3GWZA 5F1RA 1HBXG 4HX8A 5H6RA 4Q5SF 2AS5F 3WTUC 5IT9K 3FXRA 4WWCA 4A0ZA 1F1ZA 1P4WA 1Z6TA 3GFJA 2P5KA 3G73A 5TRDA 3KP4A 1VTNC 5E1ZB 2GXBA 4HLYA 5LHHA 1F9NA 3K9TA 3CUQC 2V9VA 2O8XA 3OV8A 2QUFA 2WTEA 5DYMA 2VOPA 4IRIA 3L9FA 2WC2A 4RGRA 4EVIA 1FT9A 4UHTA 3R6SA 1XDSA 2HTJA 2MD5A 3M7GA 3IL2A 3EDPA 1USTA 4HF0A 3BY6A 1ZG3A 3IC7A 2NYXA 1TW3A 3WTWC 4BNCA 2QM3A 2HDCA 3M8EA 1S29A 2UWMA 3HSFA 2MBFA 1LEAA 2ZKZA 3HTUA 3WE3A 4KN4X 1ZARA 1DPRA 4YIIA 4HV6A 3WTVC 3BROA 2P6TA 3R61A 5HS8A 4HDUA 1FYMA 1U8RA 4NQWA 3SZPA 2FRHA 4AD9A 2KIUA 2P8TA 5D6EA 1HKQA 3QOPA 4O3MA 4M71A 3RTRA 2P6SA 2CFXA 1T39A 1KGSA 2JT1A 2IA1A 3E3VA 4S04A 4GO1A 2XV4S 3LFKA 2FBKA 4I98B 2FNAA 1X3UA 1MDMB 5L3BA 4RB3C 4XSXF 3IHUA 3E6DA 1G6NA 3DKWA 4PDKA 3V4GA 2V1DA 1R36A 4NB5A 4ZYDA 1JHFA 5E8IA 3CO7C 1SFXA 4L18B 4WXHA 3VFZA 1T38A 3K1NA 2HS5A 3F8MA 1ZHFA 1I6XA 4AIJA 4LLNA 1ZYRF 2JRTA 1REPC 5LGUA 2MH9A 1LJ9A 3DPLC 1G3TA 2RVCA 4U7BA 2CWEA 2QYOA 5FLXZ 4EJOA 4UUVA 4MEYF 2PJPA 2DW4A 2P5VA 3N4MA 2G7UA 1I1GA 1R1TA 5AONA 4B09A 4EGYA 3ZMZA 2Z33A 1F4KA 2UZKA 2A6HF 3D5LA 5LHIA 1BBYA 2DQLA 4MHGA 4OOIA 1SFUA 1FYLA 1L0OC 2H94A 1R7JA 2PN6A 1QBJA 5BPDA 2XAJA 4MNUA 5DCFA 2F5FA 2QZ8A 1FPQA 3COAC 4XLPF 3K0LA 1IXRC 2W25A 3JAMZ 5FB2A 2EV0A 3TGNA 4FX0A 4N0BA 1J0RA 5E1WA 1EH6A 4I0AA 4M73A 2W85A 3FXUA 4ESJA 1ZGJA 5H20A 3I53A 3ISPA 4CHUA 3K1MA 5HS7A 2DPDA 5ILUA 3PQJA 3Q9VA 5L3EA 3ZP5A 3GYHX 2CYYA 1HQCA 1FP1D 2G7HA 1GHCA 1CF7A 1HXDA 2E7XA 1SD7A 4K2EA 2F2EA 3DXJF 2XKPA 5ICEA 1J2XA 2QVOA 5BMZA 3DP7A 4CO8A 1T2KA 4M6XA 5D8KB 1Z9CA 1D8KA 2ESHA 2E7WA 4I0BA 5LEKA 1B9NA 1YS7A 3VOEA 5JI6A 3SFZA 3H92A 2EWNA 2AXLA 3WTTC 1XSDA 1O3SA 1YG2A 3ZMDA 2OAZA 2EFQA 4P9UA 1YQAA 1ZGAA 2XRNA 2Z9OA 5AIPA 5DEQA 4GXOA 1BI2A 2Q2EA 4HQMA 2O3FA 3FX3A 3HTSB 4Y17A 2CQKA 3QP6A 4PCQA 1BM9A 2FU4A 2VE8A 2V6CA 3M9AA 1UFMA 4OINF 2Z3YA 3HOSA 2H6CA 3RKXA 5K1YA 2K27A 4R1HA 2YU3A 3R0JA 2Y75A 1Q1HA 1I27A 3DF8A 3CUQA 4WX9A 3JAMK 3L2CA 2OU2A 2XHKA 4BXUA 2A61A 4KIBA 4ZZLA 4I2OA 2OZUA 3ZMUA 4HDVA 2GWRA 3R0AA 2RGVA 4BH9A 4YG2F 1FSEA 2W24A 2XAHA 3MEXA 1DPUA 4EGZA 2Z5UA 1LDDA 2ZNZA 3V7CA 2WWYA 4LFUA 1O7LA 1BI0A 1B1BA 5L3CA 1TW2A 2MC3A 2Z99A 2WV0A 3IRRA 1W7PB 2IPQX 3F6VA 5DUKA 2DPUA 2RNJA 2LKPA 3HYIA 1G3WA 1S7AA 2JSCA 2H6BA 4YFKF 3WGHA 1XD7A 3FMQA 3EYIA 2CGPA 2NNYA 1RIOH 3D0SA 1I1SA 4YIFA 2HQNA 4L0YB 3HOTA 3HHHA 3G3ZA 1ZLJA 5BPIA 4U88A 3L00A 1KYZA 4KNYA 3WGGA 2M1BA 4U0WA 3PFIA 2ZMEA 2IW5A 4D0PA 5LRRA 1QNTA 4CDGA 1OR7A 4Q4ZF 4N9IA 1IN5A 3CDHA 3EUHA 1RZ4A 4F7ZA 1OKRA 1W7PD 1K6OA 1B6AA 4R79A 4UVBA 4IRGA 5E8GA 2QLZA 2RQPA 1KU2A 4UNOA 1EV7A 4HAMA 3E5UA 4IPAA 1Y0UA 2PFBA 4A12A 3HRMA 2EV6A 4WK8F 3E6CC 2ADUA 2VBWA 3L09A 3TO6A 3J80Z 3CTAA 4ENMA 4GGGA 4G7OF 2JTVA 2OZ6A 4O6JA 2Y0MA 2B0LA 4BHBA 2K02A 4HLXA 5L3DA 1O3RA 4TV7A 2DBBA 1FLIA 2VXZA 3B02A 4MQVA 2XASA 1OMIA 5IT9Z 1PUEE 2IT0A 4QLCU 5LGNA 5DV5A 5HLHA 3KP5A 2BBYA 3F72A 2ZMEB 1H0MA 1KQ0A 2NS0A 2O0YA 3QAHA 2PLYA 4UXNA 4MQ9F 2L4MA 5CJ9A 5CLSA 4EV0A 4CZZA 3W6KB 1U78A 1EH7A 5CYVA 1XGOA 2FXAA 2KIMA 1BJAA 1HSTA 4L9NA 3LA3A 1E2XA 4KYWA 2P7CB 3RPQA 1CF7B 2YPRA 3MQ0A 1SD5A 3FXQA 4HF2A 2HTSA 4EQQA 1FP2A 2PMHA 1R1UA 5AIQA 1BOAA 2NNNA 1MJ9A 2D45A 2VBZA 2Y48A 4UV9A 1MD0A 2VONA 2MLKA 2TDXA 3VODA 2BE5F 2O61A 3BJ6A 3JTGA 1LB2A 2F5DA 2DTRA 5LLQA 4LJZF 2C6YA 1RI7A 2JZYA 3W6JB 1D5VA 1W5TA 4EM1A 4OMYA 1FBSA 3Q9SA 3U1DA 4MTEA 4L0ZB 2FEZA 1BIBA 1FNNA 1S8NA 1JGSA 1ZRCA 4ZZDA 5CVIA 2JPBA 2YX7A 4P9FA 3K2ZA 4RGSA 1WQ2A 4R8HA 2KRFA 2RDPA 3KP3A 1P92A 1J5YA 1IRFA 3SZTA 2RKHA 1J9IA 4KFCA 1YO5C 3ELKA 2XAFA 4A5MA 1ZG1A 3F3XA 1XB4A 2EA2A 4A5NA 4BHPA 3RDIA 5CVUA 2GXGA 4AVPA 1SAXA 2CO5A 2EB7A 3GXOA 1FOKA 1D3YA 2LF7A 2IRFG 4EJTA 1DUXC 2EFOA 1P2FA 2L3DA 3ULQB 1EH8A 2FSWA 4YFNF 4LMYA 2DU9A 3M8FA 1FY7A 1QZZA 3F21A 3GFIA 3DFGA 2ZO4A 2OBPA 1KU3A 1WRJA 1FX7A 4DQ2A 2MA3A 2K4JA 2HYGD 2CSOA 3I5UA 2DO7A 2PG4A 2LF8A 3U2RA 5ICFA 1U5TC 5D5XB 5ILSA 1XMAA 4RAZA 3WG9A 3DV8A 2J5OA 5JR3A 1KA8A 4G6QA 1MDMA 3F23A 5BQTA 3BP8A 3BJOA 3E6MA 5CVJA 3MZYA 5HVQC 2KIFA 3FM5A 2IA2A 2HEOA 2HKOA 5IT3A 2HWVA 4RGXA 4HYEA 4PGGA 1WKMA 1KU7A 3I71A 4HOBA 3FHZA 4G8XA 1TQPA 2QQBA 2L54A 3F8FA 2LSOA 3KEOA 1R1VA 2L01A 4HX4A 1FWZA 1STZA 3T0YA 1ON2A 2PQ8A 3KE2A 3KLOA 4L5IA 1LEBA 5LGTA 1O57A 5HDGA 2NAZA 2CW0F 1TQMA 1YLFA 1G3SA 5A2QK 1ZRFA 3RKYA 5K5QA 4HV5A 1TBXA 4EMSA 1S6LA 1TLHB 3DPTA 1O7FA 2EA4A 5HOOA 2R3SA 5JHUA 5J8CA 3TKYA 1OYIA 3ABUA 4G6DA 2PEXA 3QU3A 3V8KA 1QPMA 1ON1A 1YIOA 4FT8A 2Q8KA 1BI1A 1QGPA 1GXQA 1XMKA 4M9SA 2ELHA 3GW2A 4KDPA 4LGWA 2YR2A 2Q0OA 3RPUA 1FZPB 2K7LA 3DQVC 3LWFA 2FMLA 4OIPF 4HBLA 4KMUX 3F6OA 2BGCA 1PDNC 3P9CA 2QWWA 3RKWA 5LRSA 1T0FA 1R5HA 3T8RA 2QQAA 1CGPA 3ZMTA 1ZREA 4QWQA 4M74A 4ZYHA 5ICCA 2COMA 2EV5A 1IN6A 1A04A 5KK1A 4M9ZA 4U0YA 1V3FA 4XLNF 5FFZA 2K4BA 2LNBA 3GLXA 1YS6A 5HDNA 3B73A 1KQ9A 3P9IA 3LAJA 1IN4A 3TDUC 5FGMA 5H6QA 2ZXJA 4ASNA 5DCMB 5D5UB 2VC1A 3LA2A 1HKTA 3IWFA 3HIFA 1MJBA 2DLLA 4Q48A 1ONVA 1HW5A 3MCZA 2PMUA 3C3WA 3F8NA 3V7SA 1SD6A 2M87A 4KMFA 3V8LA 5HLIA 3FMRA 3TOBA 1AOYA 1GXPA 3GZ6A 3GEZA 1HSJA 2EFWA 5FO5A 1W4MA 5L3GA 3BOQA 3KFWX 4FX4A 1Z6RA 4ZH4F 1FC3A 3M1EA 4CXFA 3SQNA 1E17A 1DP7P 3EQLF 1IN7A 4RB2C 1K78A 4LG0B 1TQIA 1QQIA 5HLGA 5L3FA 2GQQA 4ENJA 3T5XA 4P96A 4ZYEA 2A3SA 4KICA 4ENKA 1XCBA 4N9HA 4H0EA 4HZFA 1Z7UA 3HHGA 5D5WB 1J7KA 1K7AA 3U9GA 3WU0A 1P4XA 4Q47A 1USSA 4NHJA 2STTA 4RGUA 1W5SA 3JW4A 1U5TA 3TQNA 1V4RA 3WTXC 5ILVA 1IZ1A 3CUOA 4OIQF 1XN7A 2D1HA 5ED4A 4HW0A 1BC8C 4M72A 1SMYF 2A6EF 1ZRDA 4G7HF 2HQRA 4U0VA 4A2UA 3KZZA 2KJBA 3MFKA 2NRAC 1B59A 4LB6B 3RI4A 4GYGA 2D1VA 4LLGF 4M9XA 1BN5A 1IN8A 1FSHA 2M30A 3IRQA 4ESBA
chains in the Genus database with same CATH superfamily
5JVTA 4HPQA 3CJNA 2FE3A 4FTHA 2UXNA 3G6EI 5FLXK 2W1OA 3NRVA 2CH0A 2Y69H 3CCRI 3KEYA 2ID6A 3TO9A 1WVRA 2A69F 3MD2A 4Y13A 2X6XA 1LDKB 1JXSA 4RAYA 5H2FC 1IUYA 5B66C 3ASNH 4BYYA 2LTPA 2F5VA 2BYVE 2GIVA 2KT0A 1U5TB 3LAPA 1JHHA 3X2QH 2QENA 4IHWA 5FFXA 4MFDA 4E6KG 4GCVA 2P5LC 2KRCA 2HPMA 3KEQA 4KA4A 4IF4A 3RQ4A 4B44A 4IOCF 2LKXA 2L7KA 2OQGA 3VEPA 2EK5A 2KP6A 2GOMA 2ESNA 1S72I 1IF1A 3BPVA 3MN2A 4LLLA 2HNHA 5GAGJ 1IDYA 4KT5C 2VUMJ 3LQRA 3REOA 1IGNA 4B8XA 1YW7A 3EYYA 4ZYGA 5EG0A 1UHMA 2ISZA 2CG4A 4CYDA 4A3EJ 2V79A 4XKCA 1ULYA 2ZSIB 4RM3A 1ZN2A 3P7NA 1HW1A 4MIMA 1XDUA 3H9GA 3VSLA 2EILH 5FKLA 2FUG2 5D4SA 2PX9A 4AIHA 4F55A 5EEHA 2X1DA 3G1MA 1YITI 1OPCA 1ZLKA 2VB6A 3OYKA 4IXAA 1JUPA 2K86A 3AL0B 1IXCA 4ON0A 1O3TA 3J80K 3FF5A 3S8PA 4LK1F 5F04A 5FD6A 4U7DA 2AXTC 4FQGA 3S15J 3BTIA 2GLOA 1WJDA 3O3KA 1LFUP 1UCRA 4BQNA 1U2WA 1XGMA 2HYFA 5E18F 3TP0A 1NG7A 1RC9A 2XKOA 2R7FA 1H9TA 4BAYA 4CICA 3K4JA 1OYYA 2KIQA 1JE8A 3KP2A 1Z3YA 1HOMA 1M1EB 2HQ5A 4F52A 2R7ZJ 2X6OA 3P9KA 1LFPA 4Y3OA 3ZQLA 3HDDA 3DEWA 5BS6A 1WJEA 3WTYC 5K7FA 5E3LA 3ZQIA 4HX7A 2Y2ZA 3SJMA 1IW7F 3GVAA 3QPTA 4AYBN 4D7NA 4G94A 2OQRA 4IJAA 2DDAA 2DFIA 3GFMA 5HLTA 4A3IJ 5M3MJ 1HA8A 2RN7A 4U87A 4ZDLA 1SD4A 1ZH5A 1RUNA 1Z21A 2R7TA 2UXXA 2XPWA 2VQCA 5EEGA 2R7QA 3OYEA 3H3UA 2ZFUA 2CW7A 1YX3A 2DQRA 3SHFA 3WU1B 1NK2P 1K79A 2CS3A 1F5TA 4I09A 4B48A 2L02A 1P6RA 2EPFA 4PZJA 3P5JA 4IHXA 1YFHA 2ZNYA 1G3YA 2RC4A 2JA5J 3PNYA 2V6EA 3LSGA 4OMZA 3O8GA 2WB1N 2VL8A 1S5LC 2K9MA 3C1DA 6PAXA 3PQKA 4XLEA 3EETA 1QO0D 1U3EM 3IAM2 1PUFB 3LQQA 4F92B 4IZZA 1XSVA 3GUDA 1XCVA 4IQ4A 3RYRA 1I6HJ 1NHAA 4OIRF 1WGXA 5J6XA 3OYGA 3S32A 2CUZA 3AAFA 4BBSJ 2JA6J 3RJPA 4QSHA 3F8BA 1X1AA 2XGDA 5DCMA 2CRGA 1JKPC 4DJAA 2GAUA 1FMWA 3DBRB 2RREA 3E5QA 3HRUA 1DP3A 1ETYA 2PJRB 5K5RA 4LIUA 3FXLA 4PUSA 4P5OA 3ML6A 4M3BA 1B4AA 2HFHA 1KU9A 1TNTA 4ETSA 5FKKA 3RZOJ 1PP8F 3HRSA 5K5OA 1AU7A 2ZXWH 3K69A 3LSTA 3PM1A 1WPKA 3WTZA 3SDGA 3E6BA 1TP4A 3CUQB 2DK8A 2EH3A 3LSPA 2DI3A 1HDPA 2DK5A 5EJCA 1LNWA 4RS8A 4HSTA 1XGNA 1OJLA 1WCMJ 2A68F 2IA0A 3JTHA 2R7DA 1AWCA 2VI6A 3V42A 5E17F 2HI3A 2IBDA 3FBNB 1OCTC 1R49A 1TTYA 2YSRA 5FD5A 2JK3A 3VB2A 2HVSA 3ZOBA 5E1XA 3F8CA 2EFNA 4PJLA 4A0XA 3IKTA 3G2BA 2FBHA 4XL9A 4A6EA 3FHNA 4L9VA 3BZ6A 3RIRA 3I58A 2J5PA 2VBYA 3CO6C 1TZLA 3HOXJ 3CCUI 5A2QZ 2A07F 3SZGA 2CQNA 2X48A 1BOBA 2L4AA 5JVGF 4YRVA 4IVNA 4ENNA 2I8DA 1ZKGA 2IVMA 3L7WA 1SEUA 1R5GA 1TT0A 3O6BB 2LY2A 3FZVA 2K3FA 1S3JA 4UUSA 2H27A 4BEHA 2KMUA 2FNPA 3DU6A 4XLHA 5IP9J 2DT6A 1W7PA 4IRHA 5B1BH 3GLLA 2BVMA 1K78B 1OCPA 3I59A 2XSJC 2BOLA 5J1RA 4MGRA 1WJBA 1PP7U 3G1LA 1IUFA 4Z2YA 4EJVA 2R5YB 1ODDA 5CVVA 3B6AA 4S05A 2V1UA 3MWMA 2DN0A 2PBIA 3DBHB 4FISA 2WBMA 2P4WA 3WTSC 1XSXA 1AKHB 5LEJA 1QVTA 3BR2A 1DQUA 1ENHA 2HOTA 3QP5A 5F0FA 4HRIA 4DBQA 1JUSA 5ERIA 1IXSB 2ICWG 3LL7A 4MTDA 3HGYA 1ERDA 3HKZN 1NK3P 2LG4A 3O2PE 3MMYB 3DLLF 4XRFA 4LG3A 2LREA 1C0WA 1P4AA 3S1QJ 3BG7A 3UNGC 4LIVA 2LDUA 2E1MC 3ZQHA 3LSHA 2HR3A 2NVQJ 3F22A 1EF4A 4BDYA 1ZG5A 5KHDA 2FQ4A 2H8WA 2WY8Q 2X1EA 5DD4A 5IYBJ 4HQEA 1TNSA 2EBIA 4FHTA 4M6YA 5DS9A 2RQQA 2FD5A 3RYPA 1OCCH 4RM2A 2XF7A 2F4OB 1DGWY 3ZCOA 2F4MB 3S2WA 4PK4A 3OIQA 1Z3XA 4DNCA 3OYIA 3S2DJ 2IS2A 3ZMSA 4JBAA 1MGTA 3KLNA 2DA1A 3ABTA 1WJAA 4A6DA 1ETWA 2KQRA 4UVCA 3J7AO 1JT6A 2FF4A 3PSFA 2X4HA 2NVXJ 4IHSA 4IO9F 1UB9A 1LDJA 2M8GX 2KFDA 2GA2A 3I4PA 1FBUA 4JQFA 4L9TA 2XROA 2E60A 2CUEA 2V9KA 1WWXA 2W57A 4BKXA 1BI3A 3TOAA 3HZJA 5BOXA 4NQWB 4DYCA 1R71A 1Z0XA 5C3EJ 4UUTA 3BJAA 4I99C 1IAWA 2W84A 3I9V2 1JKQC 3F9KA 2HQAA 4QPOA 1T6SA 4BJ6C 3KYLA 2ISYA 4A0YA 4IKFA 1P7IA 1D8JA 4V2FA 2MLGA 1IRGA 1YYVA 1L3LA 4QIWN 2DT5A 4AVZA 2XDVA 1S7EA 1Y6IA 2OD5A 2H09A 4DW6A 3AG3H 5CQEA 3ZQQA 2DA7A 2ELJA 2E1CA 2EIJH 4EJWA 5JFRA 2LVSA 4GRIA 4KJZA 2Z2SB 1MH4A 3PUBA 3ONQA 3K1PA 1AHDP 1UHWA 1S7OA 2VN2A 3OS0A 1I5ZA 4J01A 5F1JA 5HDKA 3I0TA 3AG1H 1R4MB 1A6QA 2HXIA 3I64A 5EZGA 3PUFA 4P55A 1RNLA 3FMSA 1U0JA 2D2WA 2M5WA 3PJRA 3MKLA 3MAJA 2IGNA 4KITB 4MEXF 2KJCA 2P7VB 2XAQA 2KHMA 1X4PA 3D5SC 3IUOA 4HA8A 2JQ7A 1GUUA 2F5EA 2WAQA 3K4NA 4XN3A 2DMQA 2R7XA 2OA4A 2QQ8A 2XSDC 1X58A 4ZC3A 3FKIJ 4CA0A 3WE2A 4XM3A 2EJRA 3TDZC 1J75A 1IDZA 4WCGA 2DMNA 2R7VA 3G1OA 3ZN0A 5CVRA 4AIKA 5C44J 3HRTA 3CMAI 2KL4A 2V9PA 3RZDJ 4JX5A 5KVRA 2M45A 4CCMA 5BNGA 2IP2A 1H9GA 3H5AA 2V4JC 4DIQA 3M1CA 4EM2A 3DTIA 1FYKA 1A36A 3E97A 2XAGA 1RETA 4KIGA 2DMUA 1JI8A 5D8LB 4LITA 5D6FA 4V2GA 2WY7Q 1UELB 5ICGA 4E7KA 1N77A 2PJRA 3BDDA 5EGOB 4ESFA 4E7LA 3Q5FA 4HNTA 5FLMJ 1OISA 1S9HA 4XLCA 3ZR8X 3ZN1A 4AU7A 2XGEA 4DZPA 1NG6A 2VT3A 2O9LA 3NQOA 2VT2A 2BEOA 5DDGA 1XGSA 1WI9A 4IHTA 2ZJ2A 4OU0A 2K9SA 2XUBA 2GZWA 2HVQA 4EJUA 1W5CC 2WV1A 4E7JA 5KAIC 1MMGA 1QZYA 4JK1X 1LUJB 1BC7C 2HGCA 1OFCX 5GAEJ 1D5YA 3OOUA 4G7ZF 2X0LA 4LK0F 1B9MA 3GX4X 1YX5A 1HW2A 1MJAA 3QRFF 2FA5A 3H3ZA 5DTDA 3ZMVA 2MFZA 2JA2A 4LB5A 2A5YB 1I3AA 3CCJI 2ZBKA 5FROA 3CF2A 5D4RA 1SMTA 3G71I 2BY1A 3DLAA 2KDZA 1X3WB 2VOOA 3VPRA 3FM3A 2MABA 4XBFA 1ZK8A 1GVJA 3DCFA 2VJJA 2ETHA 2M8EA 3OR1C 4XQFA 2XVCA 2BV6A 3JSOA 1K4SA 3IKVA 2F5CA 2MH2A 2QSHX 1MNEA 2CV0A 2L5QA 3IWZA 1Y1WJ 4BQAA 5DUIA 1OYWA 1O3QA 2N8GA 1D0YA 4HEA2 3T8TA 4BGDA 3CLQA 1YTYA 3ROUA 3A01A 2O03A 3ECHA 2VODA 4KN7X 2VC0A 3GZ5A 3HSEA 1PUFA 3KP7A 3OYLA 3WGIA 3V8JA 4YFXF 3L2WA 4L5JA 4A3JJ 2ACJA 1WFXA 1WJCA 1WH7A 4OIOF 1KYWA 4A93J 3WODF 4BU2A 3K7AJ 1KQ8A 2XRLA 2CFOA 3CCEI 5LFAA 1LQ1A 2E35A 1Y39A 1T98A 1LVAA 3OOPA 3T1BA 1R5ID 4RB0A 4WXCA 1T56A 1R6RA 3ZXSA 2IGKA 2QBYB 1PVEA 4L9JA 2ZFWA 4KIFA 1Y8QB 2BVLA 3FWEA 5FRNA 1Z67A 2QQ9A 2LKSA 2HKXA 2X6YA 5D5VB 3KETA 2XGXA 2ME6A 5GAHJ 3J81Z 3ZQ7A 1RKTA 2XAUA 2CMPA 1ACIA 1SC7A 1IV6A 4XKBA 3BQYA 5LBQA 3KP6A 4KUMA 2DXIA 2HOEA 2IS6A 2YUSA 4XKVA 1RR8C 4CGZA 2FBIA 2ZJQF 3OYHA 2RV8A 4UV8A 2RAEA 1HKSA 4RAGA 4XSZF 3ERED 4IOAF 2BHZA 2L9SA 4XNFA 1FIAA 3TMOA 3BCAA 2STWA 2ZCWA 3CMYA 2VQHA 1V5GA 3ABMH 2BW3B 4XRSG 3W3CA 1E3PA 1VF9A 1Y1VJ 1MBJA 1IC8A 3R60A 3N97A 2CV1A 1YRNB 2K85A 1R58A 2XF6A 3GF2A 3Q0VA 4XOPA 4DYRA 2XIGA 4Y15A 3GFLA 2DDBA 2DA6A 2ID3A 3BCBA 4AUXA 5FKNA 3MZHA 1FBQA 1A6IA 5JHFA 1Z05A 3JSPA 2NVYJ 4M3FA 1A5JA 1U6GA 2LOOA 3LA7A 1X1DA 5E20A 2VPRA 1GDTA 3D5RC 5DD8A 5J8FA 1W36C 4I7HA 2FQ3A 2EFPA 3BZCA 3CLOA 3VYUB 3ABLH 1R22A 2EINH 2E19A 4WF2A 2KKOA 4UVAA 1XS9A 2VE9A 3R4KA 1A35A 1DGRM 2V1XA 3H36A 3I59B 4WXDA 4RDUA 4IX7A 2QBYA 3JRCA 3EUHC 1MKMA 2G9WA 2FMYA 2M3AA 3DKYA 5LHGA 3W6VA 1VQ6I 4I02A 4AWXB 5KAFC 3GO5A 1YW8A 3SXYA 4O5VA 3GTJJ 2XC7A 1ZTRA 4E7IA 5TJJA 2VQGA 4PGHA 2G0EA 1MSFC 5F64A 4BXFA 3HUGA 3QPSA 4G9YA 4I01A 4B4CA 4ZTJA 4GYIA 4N4NB 4ITVA 4JX4A 3FKJA 4IHVA 3BR3A 2JMWA 1R9TJ 4BDZA 2GA1A 3QU6A 1ZAOA 1R00A 3BPXA 3VYRB 1WSUA 3HL2A 4XORA 2CV2A 3I54A 3CCYA 4OAYA 4A3GJ 2E2JJ 3DEUA 3Q0UA 3AG2H 2PI0A 5EDNA 2BY2A 1OQYA 1RUOA 5F6FA 2O6GE 2I5UA 3C18A 2YX4A 4BHCA 4C3HJ 4RB1A 4LD5A 1J59A 2VKEA 1FEXA 1V54H 3QPHA 3K4KA 3I56I 1T0FC 3JRFA 2Z16A 5HS9A 3GBGA 2JPCA 3C2GA 4HF1A 4LG0A 1Z91A 1SFEA 2DODA 2ECCA 4C30A 4KISA 1BIAA 4EM0B 3TO7A 3HSRA 2DYSH 2NVUB 3J7YJ 3S2HJ 3J81K 5K7ZA 1B8IB 2QCOA 3K4CA 2DAOA 4L5EA 3KCCA 2OCEA 2IEKA 4PJ0C 4E70A 1SVOA 1SFKA 1G4DA 1YW9A 1Z1DA 3V7RA 2FOKA 3BWGA 2LK2A 4M3EA 3FBIB 1X4OA 3DTKA 2L7FP 1VI0A 2XF5A 3H3VK 2LP0A 4ANJA 1LPQA 1H88C 3C7JA 3CJTB 3S3MA 1DDNA 4CSWA 3KZYA 3OL4A 5EG0B 3NEUA 3L1PA 3BR5A 1K6YA 1ZR4A 2L0KA 1MZBA 2E1NA 3K4LA 3IH4A 2VBXA 3L2VA 2R5ZB 3K2AA 2HZDA 2JWTA 3ECOA 2LBFB 1R23A 2DA4A 2IJLA 3E5XA 3L2RA 4XKWA 2HZTA 3HOUJ 3ZPLA 3GWZA 3A0BC 5F1RA 3CC7I 4PJJA 1HBXG 4HX8A 1VFCA 5H6RA 4Q5SF 1MMSA 3I4MJ 3OS2A 2AS5F 3CZ6A 3WTUC 5IT9K 3FXRA 2Y30A 3ZQCA 1F43A 4WWCA 4D1QA 4FCYA 3HPHA 3BC8A 4A0ZA 1F1ZA 1P4WA 2GIZA 4UB8C 2BXYA 1Z6TA 1N25A 3GFJA 4FE4A 1OCOH 2P5KA 3G73A 5TRDA 3KP4A 1VTNC 3RCOA 3A02A 5E1ZB 5C4JJ 4HLYA 1QVUA 1DU0A 2GXBA 5LHHA 4NBQA 1F9NA 3PO2J 3A1YA 2LY1A 2P81A 3K9TA 3CUQC 2V9VA 2O8XA 3OV8A 2QUFA 5GTHC 1TWCJ 2WTEA 5DYMA 4C3IJ 1E3HA 2DOFA 2VOPA 4IRIA 3L9FA 2WC2A 2R7RA 5EGOA 1VQLI 4RGRA 4EVIA 1FT9A 4UHTA 3R6SA 3D1NI 1XDSA 2HTJA 2L9VA 4NUBA 2MD5A 3E7LA 3CDIA 1FMVA 3M7GA 3IL2A 2QEXI 1JKOC 1PJRA 3EDPA 1USTA 4HF0A 2VXDA 3BY6A 4Y33A 2R7UA 1ZG3A 3OR2C 3VDXA 2L9NA 3IC7A 4W1UA 2NYXA 1TW3A 1CQTA 3AL0C 3LNQA 3WTWC 2F48A 2ZC2A 3PO3J 3K6GA 4CCLA 4BNCA 1VQMI 3JR9A 2QM3A 2HDCA 3M8EA 4D5FA 2DFFA 4MLOA 1S29A 1BW5A 1TL8A 2UWMA 4KT6A 2HU9A 3HSFA 2MBFA 1LEAA 2LD5A 2EIKH 3GTOJ 2ZKZA 3DWLE 3HTUA 3WE3A 2DT7B 4KN4X 1ZARA 5HNFA 1Y0NA 1DPRA 4YIIA 4HV6A 3M8JA 3WTVC 3OYJA 3BROA 1MBKA 1OLTA 2P6TA 3R61A 1Y8RB 5HS8A 5GTIC 5E3MA 4HDUA 1FYMA 1U8RA 4NQWA 1QU3A 2A05A 3SZPA 3M3YJ 2FRHA 4AD9A 2KIUA 2P8TA 4IQJA 5D6EA 1HKQA 3QOPA 1ETXA 2MYSA 1K61A 2E1MB 2Y0SA 3C2BA 4O3MA 4M71A 3RTRA 4XRSA 4I76A 2P6SA 4B47A 2V7FA 2CFXA 2JA8J 4Y7NJ 1T39A 1KGSA 3VSKA 2WAFA 4CCKA 1P9QC 2JT1A 2IA1A 3E3VA 1UG0A 2LC2A 3I3LA 4S04A 4GO1A 2XV4S 2R4GA 3CCQI 3LFKA 5J4VA 2GXAA 4B3XA 2FBKA 2X9DA 4I98B 3S3OA 1VQPI 3CC2I 2FNAA 1X3UA 2M34A 3LSMA 3LOCA 1MDMB 5L3BA 4RB3C 2K40A 4XSXF 3IHUA 3E6DA 1G6NA 3DKWA 3RSNA 2KRHA 3PNTA 1LFBA 1VZ0A 4ABZA 4PDKA 3V4GA 1WH5A 1SFOJ 2W48A 5J1YA 2V1DA 2MD0A 2M9HA 1FIPA 2FJ1A 1TWGJ 1R36A 4NB5A 2BW3A 4ZYDA 1K4TA 2NS7A 1JHFA 5E8IA 3CO7C 1SFXA 4WXHA 3VFZA 1T38A 4L18B 3K1NA 1K83J 2DMPA 2HS5A 4A69C 4NC7A 1T33A 4BE0A 2MC4A 3F8MA 1ETOA 1VQ9I 2JSPA 2DA3A 1ZHFA 2JUGA 1I6XA 4AIJA 1FOYA 3IH2A 4LLNA 1ZYRF 2JRTA 1REPC 3PSIA 5LGUA 3U21A 4F3QA 5J4YA 2OJED 2W4SA 3CDLA 2OF7A 1JTYA 1LJ9A 2MH9A 3DPLC 1G3TA 1MNDA 2NXNB 2RVCA 4U7BA 2CWEA 1QRYA 2QYOA 3DBLB 5FLXZ 4EJOA 4UUVA 4MEYF 4W97A 3OY9A 2PJPA 2DW4A 2EIMH 2P5VA 2G7UA 3N4MA 1QHGA 1ETKA 1I1GA 1R1TA 5AONA 3KZIC 3LSRA 4B09A 4OWRB 1W0UA 4EGYA 3ZMZA 2Z33A 1F4KA 2UZKA 4CUGA 2A6HF 2VJ5A 3D5LA 5LHIA 1BBYA 2R5ZA 2DQLA 4MHGA 4OOIA 2WADA 1SFUA 1FYLA 1L0OC 2H94A 1R7JA 2QKMB 5M5WJ 2PN6A 3Q0WA 1MBFA 1XTAA 1QBJA 5BPDA 2XAJA 1ETVA 4MNUA 5DCFA 5M5YJ 2F5FA 2QZ8A 4GFBA 1FPQA 2RNGA 3COAC 2NS8A 3WG7H 3K0LA 4XLPF 1FJLA 1RRJA 1IXRC 2W25A 3JAMZ 2I10A 4II3A 2A6TA 4BS9A 5FB2A 1V55H 3FXOA 2EV0A 1BR4A 1JKRC 4CH7A 3S1NJ 3TL4X 3CD6I 1QZEA 3CJQB 4FX0A 3TGNA 3DU5A 1SAUA 4N0BA 2E71A 3JCUC 2AQFA 1D1BA 2EZIA 3WHCA 2W00A 1J0RA 4FETA 5E1WA 1EH6A 4I0AA 4NC6A 4BQOA 4M73A 2W85A 2ZB9A 3FXUA 2HDWA 3A01B 4ESJA 1ZGJA 5H20A 3I53A 3ISPA 4CHUA 3K1MA 3U1KA 5HS7A 3RKQA 5ILUA 1ZR2A 3PQJA 2BXZA 4DYQA 3MKWB 2DPDA 1UHSA 2Q2EB 2VJ4A 3Q9VA 5L3EA 3ZP5A 3GYHX 1V5EA 2CYYA 3ZGKA 4ZJZA 1HQCA 2L9RA 1FP1D 1B8IA 1GVDA 2AHQA 2G7HA 1GHCA 1CF7A 4JYKA 2JA7J 1HXDA 2E7XA 2E5ZA 3JRGA 3F0CA 2DJNA 3C2HA 4B3AA 1SD7A 4H4KC 4K2EA 2F2EA 3DXJF 2XKPA 3J7AY 2OV7A 5ICEA 1J2XA 2QVOA 5BMZA 5JLWA 3DP7A 4CO8A 1T2KA 4M6XA 4CYCA 3BT9A 4C2TA 5D8KB 2CQ7A 1Z9CA 1D8KA 2ESHA 2E7WA 1W1WE 4I0BA 4J00A 5LEKA 1AKHA 1WHUA 3BTLA 3MZ8A 4CCJA 1B9NA 1YS7A 3VOEA 5JI6A 3SFZA 5FRMA 4LOCA 3H92A 3OL3A 3OYMA 2O8KA 3HEFA 3H5RA 1GT0C 3FDYA 1XC5A 2EWNA 4BE2A 2E34A 4XIDA 1J09A 2AXLA 3WTTC 1XSDA 1O3SA 1YG2A 3ZMDA 2OAZA 2EFQA 1XG1A 3CC4I 4G6TB 4P9UA 1JTXA 1LE8A 2A5WA 2LBFA 4RLFA 1YQAA 1ZGAA 1TT5B 2EQRA 1VNDA 3HM5A 2XRNA 2Z9OA 1POGA 5AIPA 5IP7J 4EATA 2KDOA 5DEQA 1B72A 4GXOA 2Q1ZB 1BI2A 2CW8A 2Q2EA 1GV5A 4HQMA 2O3FA 3FX3A 3HTSB 4Y17A 2K5CA 5J47A 2CQKA 3QP6A 2B9SA 4Y52J 4PCQA 1BM9A 1HCRA 1YI2I 2FU4A 2VE8A 2XGCA 1D0XA 5DM7F 2ECBA 2V6CA 3TW6A 3M9AA 1UFMA 2BZTA 4OINF 2Z3YA 1UMQA 3HOSA 2H6CA 2OTLI 3RKXA 5K1YA 2K27A 3HC7A 4R1HA 3KPHA 2YU3A 5F0HA 3R0JA 5GP9A 2Y75A 4C9YA 1Q1HA 1I27A 3DF8A 3CUQA 4WX9A 3JAMK 1UZCA 2CJJA 2F4IA 4PJMA 3L2CA 2OU2A 2VIXA 2OUMA 2XHKA 5F27A 4BXUA 4D7MA 2EZHA 1BL0A 2L7ZA 3FXKA 2A61A 4FASD 4CYCB 4KIBA 4BQQA 4ZZLA 1I50J 4I2OA 2OZUA 2DJIA 3ZMUA 2GWRA 4HDVA 3S17J 1W36D 3RPUD 3FISA 3R0AA 3PNVA 1ZELA 3E0JB 1JGGA 4DOZA 2O7OA 1V5FA 2HVRA 2RGVA 1FOXA 3HKZA 1FSEA 2BY3A 3QYBA 2W24A 2XAHA 3ZQGA 3MEXA 4BH9A 4YG2F 1RPWA 1DPUA 4P1WA 1U8BA 3ZQFA 4EGZA 4II2A 2Z5UA 2MGQA 1LDDA 2ZNZA 3V7CA 2WWYA 3ZRGA 4LFUA 1O7LA 1BR2A 1BI0A 1B1BA 3DKXA 3BR0A 3O8HA 5L3CA 1TW2A 4HSRA 2MC3A 2Z99A 2WV0A 2X51A 2IXSA 3FK7A 1W7PB 3IRRA 2IPQX 3F6VA 3LSIA 4ZYAA 5IY5H 1X1PA 5DUKA 2DPUA 2RNJA 1FTZA 2LKPA 3HYIA 1G3WA 1S7AA 3SDBA 2JSCA 1I39A 2Y9YA 3FXJA 2H6BA 4YFKF 1SVLA 3HOYJ 1ZGWA 2JUCA 3WGHA 4AC0A 2LYCA 3W2WA 1XD7A 3FMQA 2H8RA 1QHHD 2IS1A 3EYIA 2CGPA 3CESA 1GV2A 3LSKA 2NNYA 1P7JA 3H0DA 3S1RJ 4C2UA 1RIOH 3D0SA 2DOEA 2B7EA 3H0GJ 4YIFA 1I1SA 2KPMA 5M3FJ 3HG9A 2HQNA 2JJ7A 4L0YB 3OYFA 2JVGA 2W82A 3HOTA 3JRDA 5FLVA 3B6CA 3HHHA 4E7HA 3G3ZA 1ZLJA 2VASA 3S14J 5IP6A 3WHBA 5BPIA 1YRNA 4U88A 3GTQJ 5J3LA 3HXLA 2Y31A 3L00A 1GLNA 4F93B 2ME0A 3JRBA 1KYZA 4A3CJ 4KNYA 2LLKA 3WGGA 1D1CA 1Z7LA 2M1BA 4U0WA 3PFIA 2ELKA 5B3SH 2ZMEA 2IW5A 2M0MA 2DYRH 4M3GA 4D0PA 4E7SA 5LRRA 1QNTA 4CCOA 4CDGA 3BG3A 3OYCA 1OR7A 2YU9J 4Q4ZF 1X1BA 4N9IA 1MNMC 3JRHA 2CUJA 3A4CA 1IN5A 3CDHA 3EUHA 3AKZA 1RZ4A 4F7ZA 3CMMA 3J7ZI 1OKRA 1W7PD 1VQOI 1WJ5A 4PSXA 2LY9A 2X6WA 3TP3A 1B6AA 1K6OA 4R79A 1TWAJ 2DOAA 4UVBA 4IRGA 3QYFA 5E8GA 1SVMA 4X6AJ 2QLZA 2P0WA 2ZXIA 3BG9A 2O5RA 2RQPA 3L2QA 1BJZA 1KU2A 5DM6F 3GTLJ 4UNOA 1EV7A 4HAMA 3E5UA 4IPAA 1Y0UA 2PFBA 4A12A 3HRMA 2EV6A 2WB1A 4WK8F 3N05A 3E6CC 2ADUA 2VBWA 3L09A 3QOEA 3TO6A 3J80Z 1T95A 3CTAA 4ENMA 4GGGA 1G8XA 2K9NA 1RKWA 3NARA 4G7OF 1WJFA 2JTVA 2OZ6A 4X0GA 4HNVA 3FIWA 4IL6C 4O6JA 1X19A 3OIPA 3A2KA 3DPUA 4E7ZA 2Y9ZA 2PMZA 2Y0MA 2B0LA 4BHBA 2K02A 2M2EA 4HLXA 4JOMA 5L3DA 3GCMA 3LSJA 1O3RA 2ZMEC 3GMEA 3K70C 4TV7A 2DBBA 3WU2C 1XX5A 3BZKA 2H1LA 1FLIA 2VXZA 1VQ4I 1IO2A 3B02A 4MQVA 2XASA 2ZXHA 1OMIA 3HJEA 3CQZJ 5IT9Z 1PUEE 2IT0A 1MH3A 4QLCU 5LGNA 5DV5A 5HLHA 2MSYA 3KP5A 4S0HB 2BBYA 2TRTA 2LR8A 3DTEA 3F72A 2ZMEB 1H0MA 1KQ0A 4UY8I 2VKHA 4XONA 2NS0A 2O0YA 3QAHA 4YEJA 2PLYA 4UXNA 1TC3C 4MQ9F 5KCMA 2L4MA 5HNHA 2GOXB 5CJ9A 5CLSA 3NAUA 3H35A 3W2AA 3BG5A 4DBRA 4N4OB 4EV0A 1ORKA 4CZZA 3W6KB 1U78A 4IEJA 1EH7A 1MBEA 5CYVA 1XGOA 2FXAA 1WI3A 2KIMA 1BJAA 1HSTA 3CF5F 4L9NA 4BUPA 1IV8A 3LA3A 4JP0A 3PL8A 1E2XA 1BA5A 4KYWA 2WAEA 4EEFG 2P7CB 3RPQA 1CF7B 2YPRA 5TGTA 3MQ0A 1LKXA 1SD5A 4Z6YA 2ZSHB 2YS9A 3FXQA 5CQGA 4HF2A 2HTSA 4EQQA 3LMMA 1FP2A 5J40A 4Y4RA 2PMHA 1R1UA 2HDDA 5AIQA 1BOAA 2R7WA 2NNNA 1MJ9A 2D45A 2VBZA 2R92J 2Y48A 4BJ5C 2Y0SN 1MD0A 4RLQA 4UV9A 2MLKA 2VONA 1NTCA 2TDXA 3SFIA 3VODA 2B63J 1U9OA 4X1EA 1YJ9I 2BE5F 2R0QC 2O61A 3OWTA 3BR6A 2FX0A 2LFBA 4MFEA 3BJ6A 3JTGA 1LB2A 1G59A 2DA2A 5EEAA 2F5DA 3L2UA 1KZHA 4C3JJ 1QPIA 2DTRA 1E0EA 3BLYA 4A3MJ 1Z77A 3BTCA 5LLQA 4LJZF 2OC6A 3BG6A 2DFHA 1RI7A 1F36A 2C6YA 2JZYA 3DEEA 3W6JB 3OIOA 1YIJI 2ZJPF 1D5VA 1UJ8A 1W5TA 3HB9A 4EM1A 4OMYA 1SANA 4XRMA 1FBSA 3Q9SA 3U1DA 2OPTA 4MTEA 4HNUA 4L0ZB 2LMDA 5GADJ 2FEZA 1BIBA 1FNNA 1UG2A 1S8NA 2V1NA 1JGSA 4ZTFA 3CP8A 1ZRCA 4ZZDA 5CVIA 2JPBA 2YX7A 4XOTA 1B72B 3M07A 4P9FA 3K2ZA 4RGSA 3ERMA 1WQ2A 3HOWJ 4R8HA 2KRFA 2RDPA 5K7HA 4UUSB 3KP3A 1P92A 1J5YA 1IRFA 3SZTA 2RKHA 2XB0X 4JX6A 4NC8A 1J9IA 4KFCA 1YO5C 3ELKA 2XAFA 3OSFA 4A5MA 1ZG1A 3F3XA 2AQEA 3IV5A 1XB4A 2X85A 2EA2A 3UR3C 4BXXJ 4A5NA 4BHPA 3RDIA 1HC8A 1WZ2A 1G2HA 5CVUA 2GXGA 4AVPA 1SAXA 2CO5A 2EB7A 1MMAA 3GXOA 1FOKA 4NNJA 2IS4A 2JN6A 1D3YA 3PIOF 2LF7A 2QKLB 2IRFG 1O4XA 4EJTA 2E36A 4YELA 1AA7A 1DUXC 2E2IJ 3TEDA 1APLC 5IYDJ 2EFOA 1OR7C 1P2FA 2L3DA 3ULQB 1EH8A 4RBOA 1MBHA 2FSWA 4YFNF 1MBGA 4LMYA 3GTPJ 1JUMA 2DU9A 5IYCJ 1ETQA 1N75A 3M8FA 1FY7A 1QZZA 2OCCH 2DCEA 3F21A 3GFIA 1D0ZA 4PSWA 3DFGA 2ZO4A 1VQNI 4AYBA 2QSFX 2OBPA 2NVTJ 1KU3A 1YOVB 2R7SA 1WRJA 4CCNA 1FX7A 4DQ2A 2HYJA 2MA3A 1HLVA 3GTGJ 1R4NB 1X1CA 3KYCB 2K4JA 2HYGD 1EKEA 2CSOA 1UAAA 2UUZA 3I5UA 3ESWB 2DO7A 1FOWA 2PG4A 1BW6A 2LF8A 3U2RA 2CUFA 5FJ8J 5ICFA 3S16J 3H9JA 1U5TC 4FE7A 5D5XB 3OYAA 5LD2C 3H9QA 5GPAA 3S3NA 5ILSA 1XMAA 4RAZA 3WG9A 2K3PA 3DV8A 2J5OA 3K4BA 5JR3A 2F6CA 2QSGX 1KA8A 4G6QA 1MDMA 1VQ5I 3F23A 4PFOA 3G4SI 5BQTA 3BP8A 1MSEC 3BJOA 2VPLA 2EZLA 3E6MA 2X1CA 5CVJA 3MZYA 3EUAA 5HVQC 2KIFA 3FM5A 2IA2A 3CCSI 2HKOA 2HEOA 5IT3A 2HWVA 2XPUA 4RGXA 4HYEA 1JT0A 9ANTA 4PGGA 3FK6A 1WKMA 1KU7A 3I71A 5EYRA 4HOBA 2M0CA 3FHZA 2E1OA 3AG4H 4G8XA 1EA3A 1TQPA 2QQBA 2UV1A 1X2MA 2L54A 3F8FA 3I55I 2LSOA 3KEOA 1R1VA 2L01A 4CZCA 4HX4A 5FKOA 1FWZA 4A3FJ 1HF0A 1STZA 3T0YA 1ON2A 2PQ8A 3KE2A 3BTJA 3KLOA 2MG4A 4L5IA 1LEBA 5LGTA 1O57A 5HDGA 1XMXA 2NAZA 3KX2A 1X2NA 3EUKL 4ZDOA 4A3LJ 2CW0F 1FTTA 3OYNA 1TQMA 1YLFA 1G3SA 5A2QK 2HOAA 1ZRFA 1ITYA 1IRZA 3RKYA 1YJWI 4BL0B 5K5QA 3SYTA 4QPQA 4V19K 4HV5A 1TBXA 3JRIA 1YHQI 4UB6C 4EMSA 1S6LA 5E3NA 1TLHB 3DPTA 3HOZJ 1O7FA 5E79C 2EA4A 5HOOA 3JRAA 4RA2A 2R5YA 2R3SA 5JHUA 5J8CA 3CMEI 2COBA 1MMNA 3TKYA 1OYIA 3ABUA 4G6DA 1VQKI 2HOSA 2VLAA 2XPVA 2PEXA 1MMDA 4I6ZA 3QWLA 3QU3A 4C2MJ 1OCRH 3V8KA 2D5VA 1QPMA 2QF7A 1ON1A 1YIOA 4FT8A 2Q8KA 1RESA 1H8AC 3OSGA 1BI1A 1QGPA 1GXQA 1XMKA 4J19A 4M9SA 1BR1A 2VKVA 5F08A 2ELHA 2M7BA 3GW2A 4KDPA 3GTKJ 4LGWA 2YR2A 2Q0OA 1XPXA 3RPUA 5F0CA 3ASOH 5EZHA 2PMZN 5IOZA 2GBYA 3HPGA 1FZPB 2K7LA 2M4KA 2R7OA 3DQVC 3I4NJ 5IOYA 3LWFA 2FMLA 3JREA 4OIPF 2TCTA 4HBLA 4XK4A 4KMUX 3E1SA 3F6OA 4A3KJ 2BGCA 2KISA 2KZGA 4D5CA 5KNLA 2LH9A 3MKYB 4M6VA 1PDNC 3S1MJ 3P9CA 2QWWA 4GDFA 3RKWA 3NWSA 4A3BJ 5C4XJ 1NH3A 5LRSA 1T0FA 1R5HA 4BE1A 3VYTB 4B43A 3T8RA 2QQAA 4BY7J 4B1RA 1JJ8C 2VKDA 1CGPA 1IRXA 1LVKA 3H5NA 3ZMTA 1ZREA 4QWQA 4M74A 4ZYHA 5ICCA 2COMA 2EV5A 1IN6A 1A04A 3IAS2 5KK1A 4M9ZA 3LFUA 2KLOA 1I3QJ 3CJRB 2HXOA 4U0YA 1V3FA 4XLNF 5FFZA 2K4BA 3PIPF 2LNBA 3GLXA 1YS6A 5HDNA 1D1AA 3B73A 1KQ9A 2HPIA 2DTZA 3P9IA 5TISC 3LAJA 1IN4A 2QA4I 1H89C 3TDUC 5FGMA 5H6QA 3FXMA 5GPCA 2ZXJA 4ASNA 2BY0A 3IP4B 3S93A 5IPAA 4RAFA 2L2OA 5DCMB 3TW7A 5FKMA 2EZKA 5D5UB 4XMYA 3HBLA 2VC1A 3LA2A 4BY1J 1HKTA 3IWFA 3HIFA 1MJBA 2DLLA 4Q48A 1ONVA 1HW5A 3CP2A 3MCZA 1EJ9A 2DA5A 4RMNA 3SEZA 3VWBA 2PMUA 3C3WA 2ZJRF 3CCVI 3M4OJ 2DMTA 4OAZA 3F8NA 3V7SA 3OYBA 2KZVA 3UKGA 1SD6A 2M87A 3MVPA 3V8LA 1RR7A 4KMFA 5HLIA 2M4GA 3FMRA 3VYSB 3TOBA 2E2HJ 1AOYA 2JVHA 5JLXA 1GXPA 1VQ8I 3GZ6A 3GEZA 5M5XJ 1HSJA 1KONA 4XLFA 2EFWA 2K9LA 5FO5A 1W4MA 5L3GA 3BOQA 3KFWX 4FX4A 1Z6RA 4ZH4F 2GM4A 1FC3A 3AFHA 3M1EA 1LE8B 4CXFA 1OCZH 3SQNA 3SEQA 1E17A 1DP7P 2MW8A 3EQLF 1IN7A 2QGUA 4RB2C 1K78A 4AM3A 4LG0B 1TQIA 1MW7A 3BQZA 2CQXA 1QQIA 4XLAA 5B1AH 5HLGA 5L3FA 2JRMA 3W2VA 2GQQA 3RQIA 4ENJA 2DFEA 3T5XA 1E3OC 4BEHB 4P96A 4M3DA 2A3SA 4ZYEA 4KICA 4ENKA 1XCBA 1MIJA 4N9HA 4H0EA 5CKTA 1X3ZB 4G12A 4ZDPA 2IAIA 3K10A 1Y56A 2IGMA 1PYVA 1Q1VA 1HDDC 3BR1A 4HZFA 4D9JA 1IG7A 3QODA 1Z7UA 3HHGA 4A3DJ 1TWHJ 3A0HC 2E5NA 3OYDA 4DGWB 3OMYA 4BBRJ 5D5WB 3CCMI 2CQQA 4IHYA 2OTJI 3MKZA 1ZQ3P 5CPRB 3OS1A 1QA6A 3QQAA 5B5EC 3KIOA 1JJ6C 3Q3SA 1J7KA 3EPZA 2M7AA 1K7AA 3HOVJ 3U9GA 3WU0A 4AIDA 3GZNB 1W0TA 1P4XA 3H1CA 4Q47A 2CU7A 5EF6A 5HODA 2R93J 1USSA 4DZJA 2NOGA 2Z1DA 4NHJA 2NOJB 2STTA 2W7NA 1T8IA 4RGUA 1A31A 1W5SA 3QYEA 2XB5A 2V26A 3JW4A 3PFYA 4NDLA 1U5TA 3TQNA 1YE9A 1V4RA 3WTXC 2K9QA 5ILVA 5E3OA 2FOWA 3TBIA 2AO9A 1IZ1A 3CUOA 4XR6A 4OIQF 2IGOA 3KYDB 2LRDA 1XN7A 4YIRX 1IJWC 2D1HA 5ED4A 4HW0A 1BC8C 2VJIA 3GTMJ 4M72A 1SMYF 3HUGB 1N78A 3QPLA 2A6EF 2VQLA 3IH3A 3K70D 1ZRDA 3K4MA 4MO7A 2HQRA 4U0VA 4G7HF 4A2UA 3CCLI 3KZZA 2KJBA 3MFKA 4BACA 1YJNI 2NRAC 4BJTA 2BHYA 1B59A 2WAQN 4LB6B 4GYGA 2D1VA 5J1UA 3RI4A 4LLGF 4XICA 4E4HA 1U9NA 4XN0A 1DU6A 4PJNA 3A03A 4M9XA 2L7MP 4QTRA 2WA0A 3NWTA 4HG2A 1VQ7I 1BN5A 1IN8A 1FSHA 4F91B 3HGGA 1TWFJ 2M30A 1T08B 2H1KA 3IRQA 3ABKH 4PFPA 4ESBA
chains in the Genus database with same CATH topology
5JVTA 3CJNA 2FE3A 2UXNA 5FLXK 3NRVA 3TO9A 2A69F 4Y13A 1LDKB 1JXSA 4RAYA 1IUYA 4BYYA 2BYVE 2GIVA 1U5TB 3LAPA 1JHHA 2QENA 5FFXA 4GCVA 2P5LC 3KEQA 4KA4A 4IF4A 2OQGA 3VEPA 2EK5A 2ESNA 1IF1A 3BPVA 4LLLA 4KT5C 3LQRA 3REOA 4B8XA 1YW7A 3EYYA 4ZYGA 1UHMA 2ISZA 2CG4A 4CYDA 2V79A 1ULYA 1ZN2A 3P7NA 1HW1A 1XDUA 5D4SA 4AIHA 5EEHA 1OPCA 1ZLKA 4IXAA 2K86A 1O3TA 1IXCA 4ON0A 3J80K 3FF5A 4LK1F 5FD6A 4U7DA 3O3KA 1UCRA 1U2WA 1XGMA 2HYFA 5E18F 2XKOA 2R7FA 1H9TA 4BAYA 4CICA 1OYYA 1JE8A 3KP2A 3P9KA 5BS6A 3WTYC 4HX7A 1IW7F 3GVAA 3QPTA 4G94A 2OQRA 4IJAA 2DFIA 3GFMA 2RN7A 1SD4A 1ZH5A 1RUNA 2UXXA 5EEGA 3H3UA 3SHFA 2DQRA 3WU1B 1K79A 1F5TA 4I09A 2L02A 1P6RA 4PZJA 1YFHA 2ZNYA 1G3YA 2RC4A 4OMZA 3C1DA 6PAXA 3PQKA 3EETA 1QO0D 1U3EM 3LQQA 1XSVA 3GUDA 1XCVA 3RYRA 1NHAA 4OIRF 5J6XA 3AAFA 3RJPA 3F8BA 5DCMA 2GAUA 3E5QA 3HRUA 5K5RA 4P5OA 3ML6A 1B4AA 2HFHA 1KU9A 1TNTA 4ETSA 1PP8F 3HRSA 5K5OA 3K69A 3LSTA 3WTZA 3E6BA 3CUQB 2DK8A 2DI3A 2DK5A 1LNWA 4RS8A 1XGNA 2A68F 2IA0A 3JTHA 2R7DA 1AWCA 5E17F 1TTYA 2YSRA 5FD5A 3VB2A 5E1XA 3F8CA 2EFNA 4A0XA 3IKTA 2FBHA 4A6EA 4L9VA 3BZ6A 3RIRA 3I58A 2J5PA 2VBYA 3CO6C 5A2QZ 2A07F 2L4AA 4IVNA 4ENNA 2IVMA 3L7WA 1R5GA 3O6BB 3FZVA 1S3JA 2H27A 2FNPA 1W7PA 4IRHA 1K78B 3I59A 4MGRA 1PP7U 4Z2YA 4EJVA 1ODDA 5CVVA 4S05A 2V1UA 3MWMA 2PBIA 2P4WA 3WTSC 1XSXA 5LEJA 3QP5A 5ERIA 1IXSB 4MTDA 3O2PE 4XRFA 1C0WA 1P4AA 2LDUA 2HR3A 3F22A 1ZG5A 4HQEA 5DD4A 1TNSA 4FHTA 4M6YA 3RYPA 3S2WA 4DNCA 3ZMSA 4JBAA 1MGTA 3KLNA 3ABTA 4A6DA 4UVCA 3J7AO 2FF4A 2X4HA 4IHSA 1UB9A 1LDJA 2GA2A 3I4PA 1FBUA 4JQFA 4L9TA 2XROA 1WWXA 2W57A 1BI3A 3TOAA 5BOXA 3BJAA 1IAWA 2W84A 1T6SA 2ISYA 4A0YA 1D8JA 2MLGA 1IRGA 1YYVA 1L3LA 2DT5A 2OD5A 2H09A 2E1CA 5JFRA 4EJWA 3K1PA 1UHWA 1S7OA 2VN2A 1I5ZA 5HDKA 3I0TA 3I64A 4P55A 1RNLA 2D2WA 2M5WA 3FMSA 3MAJA 4MEXF 2KJCA 2P7VB 2XAQA 4HA8A 2F5EA 2OA4A 3WE2A 2EJRA 3TDZC 1J75A 4WCGA 3ZN0A 5CVRA 4AIKA 3HRTA 5KVRA 2M45A 2IP2A 1H9GA 4EM2A 1FYKA 3E97A 2XAGA 4KIGA 5D8LB 5D6FA 5ICGA 3BDDA 4ESFA 3Q5FA 3ZN1A 2VT3A 3NQOA 2VT2A 2BEOA 5DDGA 1XGSA 1WI9A 4IHTA 2ZJ2A 4OU0A 2XUBA 2GZWA 4EJUA 1QZYA 4JK1X 1BC7C 2HGCA 4G7ZF 2X0LA 4LK0F 1B9MA 1HW2A 3GX4X 1MJAA 3QRFF 2FA5A 3H3ZA 3ZMVA 4LB5A 2A5YB 2ZBKA 5D4RA 1SMTA 2VOOA 3FM3A 4XBFA 1GVJA 2ETHA 2M8EA 2XVCA 2BV6A 3JSOA 3IKVA 2F5CA 2MH2A 3IWZA 4BQAA 5DUIA 1OYWA 1O3QA 3T8TA 1YTYA 3ROUA 2O03A 3ECHA 2VODA 4KN7X 2VC0A 3GZ5A 3HSEA 3KP7A 3WGIA 3V8JA 4YFXF 4OIOF 4L5JA 2ACJA 1KYWA 3WODF 1KQ8A 1LQ1A 1T98A 1LVAA 3OOPA 3T1BA 4RB0A 4WXCA 2QBYB 4L9JA 2ZFWA 4KIFA 3FWEA 2QQ9A 2HKXA 5D5VB 3KETA 2XGXA 3J81Z 3ZQ7A 5LBQA 3KP6A 4KUMA 2HOEA 4CGZA 2FBIA 2RV8A 4UV8A 1HKSA 4XSZF 3ERED 2STWA 2ZCWA 3R60A 3N97A 1R58A 3GF2A 2XIGA 4Y15A 3GFLA 3MZHA 1FBQA 1Z05A 3JSPA 1U6GA 3LA7A 5E20A 5DD8A 5J8FA 4I7HA 2FQ3A 2EFPA 3CLOA 1R22A 4WF2A 2KKOA 4UVAA 2VE9A 3R4KA 2V1XA 3I59B 4WXDA 2QBYA 1MKMA 2G9WA 2FMYA 5LHGA 4I02A 4AWXB 3GO5A 1YW8A 3SXYA 4O5VA 5TJJA 4PGHA 5F64A 3HUGA 4G9YA 4I01A 4GYIA 2GA1A 3QU6A 1ZAOA 1R00A 3BPXA 1WSUA 3I54A 3DEUA 2PI0A 1RUOA 5F6FA 2O6GE 3C18A 2YX4A 4BHCA 4RB1A 4LD5A 1J59A 3QPHA 5HS9A 2JPCA 4HF1A 4LG0A 1Z91A 1SFEA 1BIAA 4EM0B 3TO7A 3HSRA 3J81K 2DAOA 3KCCA 4E70A 1G4DA 1YW9A 1Z1DA 3V7RA 2FOKA 3BWGA 3C7JA 1DDNA 3KZYA 3NEUA 1MZBA 2E1NA 2VBXA 3ECOA 1R23A 2IJLA 3E5XA 2HZTA 3ZPLA 3GWZA 5F1RA 1HBXG 4HX8A 5H6RA 4Q5SF 2AS5F 3WTUC 5IT9K 3FXRA 4WWCA 4A0ZA 1F1ZA 1P4WA 1Z6TA 3GFJA 2P5KA 3G73A 5TRDA 3KP4A 1VTNC 5E1ZB 2GXBA 4HLYA 5LHHA 1F9NA 3K9TA 3CUQC 2V9VA 2O8XA 3OV8A 2QUFA 2WTEA 5DYMA 2VOPA 4IRIA 3L9FA 2WC2A 4RGRA 4EVIA 1FT9A 4UHTA 3R6SA 1XDSA 2HTJA 2MD5A 3M7GA 3IL2A 3EDPA 1USTA 4HF0A 3BY6A 1ZG3A 3IC7A 2NYXA 1TW3A 3WTWC 4BNCA 2QM3A 2HDCA 3M8EA 1S29A 2UWMA 3HSFA 2MBFA 1LEAA 2ZKZA 3HTUA 3WE3A 4KN4X 1ZARA 1DPRA 4YIIA 4HV6A 3WTVC 3BROA 2P6TA 3R61A 5HS8A 4HDUA 1FYMA 1U8RA 4NQWA 3SZPA 2FRHA 4AD9A 2KIUA 2P8TA 5D6EA 1HKQA 3QOPA 4O3MA 4M71A 3RTRA 2P6SA 2CFXA 1T39A 1KGSA 2JT1A 2IA1A 3E3VA 4S04A 4GO1A 2XV4S 3LFKA 2FBKA 4I98B 2FNAA 1X3UA 1MDMB 5L3BA 4RB3C 4XSXF 3IHUA 3E6DA 1G6NA 3DKWA 4PDKA 3V4GA 2V1DA 1R36A 4NB5A 4ZYDA 1JHFA 5E8IA 3CO7C 1SFXA 4L18B 4WXHA 3VFZA 1T38A 3K1NA 2HS5A 3F8MA 1ZHFA 1I6XA 4AIJA 4LLNA 1ZYRF 2JRTA 1REPC 5LGUA 2MH9A 1LJ9A 3DPLC 1G3TA 2RVCA 4U7BA 2CWEA 2QYOA 5FLXZ 4EJOA 4UUVA 4MEYF 2PJPA 2DW4A 2P5VA 3N4MA 2G7UA 1I1GA 1R1TA 5AONA 4B09A 4EGYA 3ZMZA 2Z33A 1F4KA 2UZKA 2A6HF 3D5LA 5LHIA 1BBYA 2DQLA 4MHGA 4OOIA 1SFUA 1FYLA 1L0OC 2H94A 1R7JA 2PN6A 1QBJA 5BPDA 2XAJA 4MNUA 5DCFA 2F5FA 2QZ8A 1FPQA 3COAC 4XLPF 3K0LA 1IXRC 2W25A 3JAMZ 5FB2A 2EV0A 3TGNA 4FX0A 4N0BA 1J0RA 5E1WA 1EH6A 4I0AA 4M73A 2W85A 3FXUA 4ESJA 1ZGJA 5H20A 3I53A 3ISPA 4CHUA 3K1MA 5HS7A 2DPDA 5ILUA 3PQJA 3Q9VA 5L3EA 3ZP5A 3GYHX 2CYYA 1HQCA 1FP1D 2G7HA 1GHCA 1CF7A 1HXDA 2E7XA 1SD7A 4K2EA 2F2EA 3DXJF 2XKPA 5ICEA 1J2XA 2QVOA 5BMZA 3DP7A 4CO8A 1T2KA 4M6XA 5D8KB 1Z9CA 1D8KA 2ESHA 2E7WA 4I0BA 5LEKA 1B9NA 1YS7A 3VOEA 5JI6A 3SFZA 3H92A 2EWNA 2AXLA 3WTTC 1XSDA 1O3SA 1YG2A 3ZMDA 2OAZA 2EFQA 4P9UA 1YQAA 1ZGAA 2XRNA 2Z9OA 5AIPA 5DEQA 4GXOA 1BI2A 2Q2EA 4HQMA 2O3FA 3FX3A 3HTSB 4Y17A 2CQKA 3QP6A 4PCQA 1BM9A 2FU4A 2VE8A 2V6CA 3M9AA 1UFMA 4OINF 2Z3YA 3HOSA 2H6CA 3RKXA 5K1YA 2K27A 4R1HA 2YU3A 3R0JA 2Y75A 1Q1HA 1I27A 3DF8A 3CUQA 4WX9A 3JAMK 3L2CA 2OU2A 2XHKA 4BXUA 2A61A 4KIBA 4ZZLA 4I2OA 2OZUA 3ZMUA 4HDVA 2GWRA 3R0AA 2RGVA 4BH9A 4YG2F 1FSEA 2W24A 2XAHA 3MEXA 1DPUA 4EGZA 2Z5UA 1LDDA 2ZNZA 3V7CA 2WWYA 4LFUA 1O7LA 1BI0A 1B1BA 5L3CA 1TW2A 2MC3A 2Z99A 2WV0A 3IRRA 1W7PB 2IPQX 3F6VA 5DUKA 2DPUA 2RNJA 2LKPA 3HYIA 1G3WA 1S7AA 2JSCA 2H6BA 4YFKF 3WGHA 1XD7A 3FMQA 3EYIA 2CGPA 2NNYA 1RIOH 3D0SA 1I1SA 4YIFA 2HQNA 4L0YB 3HOTA 3HHHA 3G3ZA 1ZLJA 5BPIA 4U88A 3L00A 1KYZA 4KNYA 3WGGA 2M1BA 4U0WA 3PFIA 2ZMEA 2IW5A 4D0PA 5LRRA 1QNTA 4CDGA 1OR7A 4Q4ZF 4N9IA 1IN5A 3CDHA 3EUHA 1RZ4A 4F7ZA 1OKRA 1W7PD 1K6OA 1B6AA 4R79A 4UVBA 4IRGA 5E8GA 2QLZA 2RQPA 1KU2A 4UNOA 1EV7A 4HAMA 3E5UA 4IPAA 1Y0UA 2PFBA 4A12A 3HRMA 2EV6A 4WK8F 3E6CC 2ADUA 2VBWA 3L09A 3TO6A 3J80Z 3CTAA 4ENMA 4GGGA 4G7OF 2JTVA 2OZ6A 4O6JA 2Y0MA 2B0LA 4BHBA 2K02A 4HLXA 5L3DA 1O3RA 4TV7A 2DBBA 1FLIA 2VXZA 3B02A 4MQVA 2XASA 1OMIA 5IT9Z 1PUEE 2IT0A 4QLCU 5LGNA 5DV5A 5HLHA 3KP5A 2BBYA 3F72A 2ZMEB 1H0MA 1KQ0A 2NS0A 2O0YA 3QAHA 2PLYA 4UXNA 4MQ9F 2L4MA 5CJ9A 5CLSA 4EV0A 4CZZA 3W6KB 1U78A 1EH7A 5CYVA 1XGOA 2FXAA 2KIMA 1BJAA 1HSTA 4L9NA 3LA3A 1E2XA 4KYWA 2P7CB 3RPQA 1CF7B 2YPRA 3MQ0A 1SD5A 3FXQA 4HF2A 2HTSA 4EQQA 1FP2A 2PMHA 1R1UA 5AIQA 1BOAA 2NNNA 1MJ9A 2D45A 2VBZA 2Y48A 4UV9A 1MD0A 2VONA 2MLKA 2TDXA 3VODA 2BE5F 2O61A 3BJ6A 3JTGA 1LB2A 2F5DA 2DTRA 5LLQA 4LJZF 2C6YA 1RI7A 2JZYA 3W6JB 1D5VA 1W5TA 4EM1A 4OMYA 1FBSA 3Q9SA 3U1DA 4MTEA 4L0ZB 2FEZA 1BIBA 1FNNA 1S8NA 1JGSA 1ZRCA 4ZZDA 5CVIA 2JPBA 2YX7A 4P9FA 3K2ZA 4RGSA 1WQ2A 4R8HA 2KRFA 2RDPA 3KP3A 1P92A 1J5YA 1IRFA 3SZTA 2RKHA 1J9IA 4KFCA 1YO5C 3ELKA 2XAFA 4A5MA 1ZG1A 3F3XA 1XB4A 2EA2A 4A5NA 4BHPA 3RDIA 5CVUA 2GXGA 4AVPA 1SAXA 2CO5A 2EB7A 3GXOA 1FOKA 1D3YA 2LF7A 2IRFG 4EJTA 1DUXC 2EFOA 1P2FA 2L3DA 3ULQB 1EH8A 2FSWA 4YFNF 4LMYA 2DU9A 3M8FA 1FY7A 1QZZA 3F21A 3GFIA 3DFGA 2ZO4A 2OBPA 1KU3A 1WRJA 1FX7A 4DQ2A 2MA3A 2K4JA 2HYGD 2CSOA 3I5UA 2DO7A 2PG4A 2LF8A 3U2RA 5ICFA 1U5TC 5D5XB 5ILSA 1XMAA 4RAZA 3WG9A 3DV8A 2J5OA 5JR3A 1KA8A 4G6QA 1MDMA 3F23A 5BQTA 3BP8A 3BJOA 3E6MA 5CVJA 3MZYA 5HVQC 2KIFA 3FM5A 2IA2A 2HEOA 2HKOA 5IT3A 2HWVA 4RGXA 4HYEA 4PGGA 1WKMA 1KU7A 3I71A 4HOBA 3FHZA 4G8XA 1TQPA 2QQBA 2L54A 3F8FA 2LSOA 3KEOA 1R1VA 2L01A 4HX4A 1FWZA 1STZA 3T0YA 1ON2A 2PQ8A 3KE2A 3KLOA 4L5IA 1LEBA 5LGTA 1O57A 5HDGA 2NAZA 2CW0F 1TQMA 1YLFA 1G3SA 5A2QK 1ZRFA 3RKYA 5K5QA 4HV5A 1TBXA 4EMSA 1S6LA 1TLHB 3DPTA 1O7FA 2EA4A 5HOOA 2R3SA 5JHUA 5J8CA 3TKYA 1OYIA 3ABUA 4G6DA 2PEXA 3QU3A 3V8KA 1QPMA 1ON1A 1YIOA 4FT8A 2Q8KA 1BI1A 1QGPA 1GXQA 1XMKA 4M9SA 2ELHA 3GW2A 4KDPA 4LGWA 2YR2A 2Q0OA 3RPUA 1FZPB 2K7LA 3DQVC 3LWFA 2FMLA 4OIPF 4HBLA 4KMUX 3F6OA 2BGCA 1PDNC 3P9CA 2QWWA 3RKWA 5LRSA 1T0FA 1R5HA 3T8RA 2QQAA 1CGPA 3ZMTA 1ZREA 4QWQA 4M74A 4ZYHA 5ICCA 2COMA 2EV5A 1IN6A 1A04A 5KK1A 4M9ZA 4U0YA 1V3FA 4XLNF 5FFZA 2K4BA 2LNBA 3GLXA 1YS6A 5HDNA 3B73A 1KQ9A 3P9IA 3LAJA 1IN4A 3TDUC 5FGMA 5H6QA 2ZXJA 4ASNA 5DCMB 5D5UB 2VC1A 3LA2A 1HKTA 3IWFA 3HIFA 1MJBA 2DLLA 4Q48A 1ONVA 1HW5A 3MCZA 2PMUA 3C3WA 3F8NA 3V7SA 1SD6A 2M87A 4KMFA 3V8LA 5HLIA 3FMRA 3TOBA 1AOYA 1GXPA 3GZ6A 3GEZA 1HSJA 2EFWA 5FO5A 1W4MA 5L3GA 3BOQA 3KFWX 4FX4A 1Z6RA 4ZH4F 1FC3A 3M1EA 4CXFA 3SQNA 1E17A 1DP7P 3EQLF 1IN7A 4RB2C 1K78A 4LG0B 1TQIA 1QQIA 5HLGA 5L3FA 2GQQA 4ENJA 3T5XA 4P96A 4ZYEA 2A3SA 4KICA 4ENKA 1XCBA 4N9HA 4H0EA 4HZFA 1Z7UA 3HHGA 5D5WB 1J7KA 1K7AA 3U9GA 3WU0A 1P4XA 4Q47A 1USSA 4NHJA 2STTA 4RGUA 1W5SA 3JW4A 1U5TA 3TQNA 1V4RA 3WTXC 5ILVA 1IZ1A 3CUOA 4OIQF 1XN7A 2D1HA 5ED4A 4HW0A 1BC8C 4M72A 1SMYF 2A6EF 1ZRDA 4G7HF 2HQRA 4U0VA 4A2UA 3KZZA 2KJBA 3MFKA 2NRAC 1B59A 4LB6B 3RI4A 4GYGA 2D1VA 4LLGF 4M9XA 1BN5A 1IN8A 1FSHA 2M30A 3IRQA 4ESBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JVT A;  3CJN A;  2FE3 A;  2UXN A;  5FLX K;  3NRV A;  3TO9 A;  2A69 F;  4Y13 A;  1LDK B;  1JXS A;  4RAY A;  1IUY A;  4BYY A;  2BYV E;  2GIV A;  1U5T B;  3LAP A;  1JHH A;  2QEN A;  5FFX A;  4GCV A;  2P5L C;  3KEQ A;  4KA4 A;  4IF4 A;  2OQG A;  3VEP A;  2EK5 A;  2ESN A;  1IF1 A;  3BPV A;  4LLL A;  4KT5 C;  3LQR A;  3REO A;  4B8X A;  1YW7 A;  3EYY A;  4ZYG A;  1UHM A;  2ISZ A;  2CG4 A;  4CYD A;  2V79 A;  1ULY A;  1ZN2 A;  3P7N A;  1HW1 A;  1XDU A;  5D4S A;  4AIH A;  5EEH A;  1OPC A;  1ZLK A;  4IXA A;  2K86 A;  1O3T A;  1IXC A;  4ON0 A;  3J80 K;  3FF5 A;  4LK1 F;  5FD6 A;  4U7D A;  3O3K A;  1UCR A;  1U2W A;  1XGM A;  2HYF A;  5E18 F;  2XKO A;  2R7F A;  1H9T A;  4BAY A;  4CIC A;  1OYY A;  1JE8 A;  3KP2 A;  3P9K A;  5BS6 A;  3WTY C;  4HX7 A;  1IW7 F;  3GVA A;  3QPT A;  4G94 A;  2OQR A;  4IJA A;  2DFI A;  3GFM A;  2RN7 A;  1SD4 A;  1ZH5 A;  1RUN A;  2UXX A;  5EEG A;  3H3U A;  3SHF A;  2DQR A;  3WU1 B;  1K79 A;  1F5T A;  4I09 A;  2L02 A;  1P6R A;  4PZJ A;  1YFH A;  2ZNY A;  1G3Y A;  2RC4 A;  4OMZ A;  3C1D A;  6PAX A;  3PQK A;  3EET A;  1QO0 D;  1U3E M;  3LQQ A;  1XSV A;  3GUD A;  1XCV A;  3RYR A;  1NHA A;  4OIR F;  5J6X A;  3AAF A;  3RJP A;  3F8B A;  5DCM A;  2GAU A;  3E5Q A;  3HRU A;  5K5R A;  4P5O A;  3ML6 A;  1B4A A;  2HFH A;  1KU9 A;  1TNT A;  4ETS A;  1PP8 F;  3HRS A;  5K5O A;  3K69 A;  3LST A;  3WTZ A;  3E6B A;  3CUQ B;  2DK8 A;  2DI3 A;  2DK5 A;  1LNW A;  4RS8 A;  1XGN A;  2A68 F;  2IA0 A;  3JTH A;  2R7D A;  1AWC A;  5E17 F;  1TTY A;  2YSR A;  5FD5 A;  3VB2 A;  5E1X A;  3F8C A;  2EFN A;  4A0X A;  3IKT A;  2FBH A;  4A6E A;  4L9V A;  3BZ6 A;  3RIR A;  3I58 A;  2J5P A;  2VBY A;  3CO6 C;  5A2Q Z;  2A07 F;  2L4A A;  4IVN A;  4ENN A;  2IVM A;  3L7W A;  1R5G A;  3O6B B;  3FZV A;  1S3J A;  2H27 A;  2FNP A;  1W7P A;  4IRH A;  1K78 B;  3I59 A;  4MGR A;  1PP7 U;  4Z2Y A;  4EJV A;  1ODD A;  5CVV A;  4S05 A;  2V1U A;  3MWM A;  2PBI A;  2P4W A;  3WTS C;  1XSX A;  5LEJ A;  3QP5 A;  5ERI A;  1IXS B;  4MTD A;  3O2P E;  4XRF A;  1C0W A;  1P4A A;  2LDU A;  2HR3 A;  3F22 A;  1ZG5 A;  4HQE A;  5DD4 A;  1TNS A;  4FHT A;  4M6Y A;  3RYP A;  3S2W A;  4DNC A;  3ZMS A;  4JBA A;  1MGT A;  3KLN A;  3ABT A;  4A6D A;  4UVC A;  3J7A O;  2FF4 A;  2X4H A;  4IHS A;  1UB9 A;  1LDJ A;  2GA2 A;  3I4P A;  1FBU A;  4JQF A;  4L9T A;  2XRO A;  1WWX A;  2W57 A;  1BI3 A;  3TOA A;  5BOX A;  3BJA A;  1IAW A;  2W84 A;  1T6S A;  2ISY A;  4A0Y A;  1D8J A;  2MLG A;  1IRG A;  1YYV A;  1L3L A;  2DT5 A;  2OD5 A;  2H09 A;  2E1C A;  5JFR A;  4EJW A;  3K1P A;  1UHW A;  1S7O A;  2VN2 A;  1I5Z A;  5HDK A;  3I0T A;  3I64 A;  4P55 A;  1RNL A;  2D2W A;  2M5W A;  3FMS A;  3MAJ A;  4MEX F;  2KJC A;  2P7V B;  2XAQ A;  4HA8 A;  2F5E A;  2OA4 A;  3WE2 A;  2EJR A;  3TDZ C;  1J75 A;  4WCG A;  3ZN0 A;  5CVR A;  4AIK A;  3HRT A;  5KVR A;  2M45 A;  2IP2 A;  1H9G A;  4EM2 A;  1FYK A;  3E97 A;  2XAG A;  4KIG A;  5D8L B;  5D6F A;  5ICG A;  3BDD A;  4ESF A;  3Q5F A;  3ZN1 A;  2VT3 A;  3NQO A;  2VT2 A;  2BEO A;  5DDG A;  1XGS A;  1WI9 A;  4IHT A;  2ZJ2 A;  4OU0 A;  2XUB A;  2GZW A;  4EJU A;  1QZY A;  4JK1 X;  1BC7 C;  2HGC A;  4G7Z F;  2X0L A;  4LK0 F;  1B9M A;  1HW2 A;  3GX4 X;  1MJA A;  3QRF F;  2FA5 A;  3H3Z A;  3ZMV A;  4LB5 A;  2A5Y B;  2ZBK A;  5D4R A;  1SMT A;  2VOO A;  3FM3 A;  4XBF A;  1GVJ A;  2ETH A;  2M8E A;  2XVC A;  2BV6 A;  3JSO A;  3IKV A;  2F5C A;  2MH2 A;  3IWZ A;  4BQA A;  5DUI A;  1OYW A;  1O3Q A;  3T8T A;  1YTY A;  3ROU A;  2O03 A;  3ECH A;  2VOD A;  4KN7 X;  2VC0 A;  3GZ5 A;  3HSE A;  3KP7 A;  3WGI A;  3V8J A;  4YFX F;  4OIO F;  4L5J A;  2ACJ A;  1KYW A;  3WOD F;  1KQ8 A;  1LQ1 A;  1T98 A;  1LVA A;  3OOP A;  3T1B A;  4RB0 A;  4WXC A;  2QBY B;  4L9J A;  2ZFW A;  4KIF A;  3FWE A;  2QQ9 A;  2HKX A;  5D5V B;  3KET A;  2XGX A;  3J81 Z;  3ZQ7 A;  5LBQ A;  3KP6 A;  4KUM A;  2HOE A;  4CGZ A;  2FBI A;  2RV8 A;  4UV8 A;  1HKS A;  4XSZ F;  3ERE D;  2STW A;  2ZCW A;  3R60 A;  3N97 A;  1R58 A;  3GF2 A;  2XIG A;  4Y15 A;  3GFL A;  3MZH A;  1FBQ A;  1Z05 A;  3JSP A;  1U6G A;  3LA7 A;  5E20 A;  5DD8 A;  5J8F A;  4I7H A;  2FQ3 A;  2EFP A;  3CLO A;  1R22 A;  4WF2 A;  2KKO A;  4UVA A;  2VE9 A;  3R4K A;  2V1X A;  3I59 B;  4WXD A;  2QBY A;  1MKM A;  2G9W A;  2FMY A;  5LHG A;  4I02 A;  4AWX B;  3GO5 A;  1YW8 A;  3SXY A;  4O5V A;  5TJJ A;  4PGH A;  5F64 A;  3HUG A;  4G9Y A;  4I01 A;  4GYI A;  2GA1 A;  3QU6 A;  1ZAO A;  1R00 A;  3BPX A;  1WSU A;  3I54 A;  3DEU A;  2PI0 A;  1RUO A;  5F6F A;  2O6G E;  3C18 A;  2YX4 A;  4BHC A;  4RB1 A;  4LD5 A;  1J59 A;  3QPH A;  5HS9 A;  2JPC A;  4HF1 A;  4LG0 A;  1Z91 A;  1SFE A;  1BIA A;  4EM0 B;  3TO7 A;  3HSR A;  3J81 K;  2DAO A;  3KCC A;  4E70 A;  1G4D A;  1YW9 A;  1Z1D A;  3V7R A;  2FOK A;  3BWG A;  3C7J A;  1DDN A;  3KZY A;  3NEU A;  1MZB A;  2E1N A;  2VBX A;  3ECO A;  1R23 A;  2IJL A;  3E5X A;  2HZT A;  3ZPL A;  3GWZ A;  5F1R A;  1HBX G;  4HX8 A;  5H6R A;  4Q5S F;  2AS5 F;  3WTU C;  5IT9 K;  3FXR A;  4WWC A;  4A0Z A;  1F1Z A;  1P4W A;  1Z6T A;  3GFJ A;  2P5K A;  3G73 A;  5TRD A;  3KP4 A;  1VTN C;  5E1Z B;  2GXB A;  4HLY A;  5LHH A;  1F9N A;  3K9T A;  3CUQ C;  2V9V A;  2O8X A;  3OV8 A;  2QUF A;  2WTE A;  5DYM A;  2VOP A;  4IRI A;  3L9F A;  2WC2 A;  4RGR A;  4EVI A;  1FT9 A;  4UHT A;  3R6S A;  1XDS A;  2HTJ A;  2MD5 A;  3M7G A;  3IL2 A;  3EDP A;  1UST A;  4HF0 A;  3BY6 A;  1ZG3 A;  3IC7 A;  2NYX A;  1TW3 A;  3WTW C;  4BNC A;  2QM3 A;  2HDC A;  3M8E A;  1S29 A;  2UWM A;  3HSF A;  2MBF A;  1LEA A;  2ZKZ A;  3HTU A;  3WE3 A;  4KN4 X;  1ZAR A;  1DPR A;  4YII A;  4HV6 A;  3WTV C;  3BRO A;  2P6T A;  3R61 A;  5HS8 A;  4HDU A;  1FYM A;  1U8R A;  4NQW A;  3SZP A;  2FRH A;  4AD9 A;  2KIU A;  2P8T A;  5D6E A;  1HKQ A;  3QOP A;  4O3M A;  4M71 A;  3RTR A;  2P6S A;  2CFX A;  1T39 A;  1KGS A;  2JT1 A;  2IA1 A;  3E3V A;  4S04 A;  4GO1 A;  2XV4 S;  3LFK A;  2FBK A;  4I98 B;  2FNA A;  1X3U A;  1MDM B;  5L3B A;  4RB3 C;  4XSX F;  3IHU A;  3E6D A;  1G6N A;  3DKW A;  4PDK A;  3V4G A;  2V1D A;  1R36 A;  4NB5 A;  4ZYD A;  1JHF A;  5E8I A;  3CO7 C;  1SFX A;  4L18 B;  4WXH A;  3VFZ A;  1T38 A;  3K1N A;  2HS5 A;  3F8M A;  1ZHF A;  1I6X A;  4AIJ A;  4LLN A;  1ZYR F;  2JRT A;  1REP C;  5LGU A;  2MH9 A;  1LJ9 A;  3DPL C;  1G3T A;  2RVC A;  4U7B A;  2CWE A;  2QYO A;  5FLX Z;  4EJO A;  4UUV A;  4MEY F;  2PJP A;  2DW4 A;  2P5V A;  3N4M A;  2G7U A;  1I1G A;  1R1T A;  5AON A;  4B09 A;  4EGY A;  3ZMZ A;  2Z33 A;  1F4K A;  2UZK A;  2A6H F;  3D5L A;  5LHI A;  1BBY A;  2DQL A;  4MHG A;  4OOI A;  1SFU A;  1FYL A;  1L0O C;  2H94 A;  1R7J A;  2PN6 A;  1QBJ A;  5BPD A;  2XAJ A;  4MNU A;  5DCF A;  2F5F A;  2QZ8 A;  1FPQ A;  3COA C;  4XLP F;  3K0L A;  1IXR C;  2W25 A;  3JAM Z;  5FB2 A;  2EV0 A;  3TGN A;  4FX0 A;  4N0B A;  1J0R A;  5E1W A;  1EH6 A;  4I0A A;  4M73 A;  2W85 A;  3FXU A;  4ESJ A;  1ZGJ A;  5H20 A;  3I53 A;  3ISP A;  4CHU A;  3K1M A;  5HS7 A;  2DPD A;  5ILU A;  3PQJ A;  3Q9V A;  5L3E A;  3ZP5 A;  3GYH X;  2CYY A;  1HQC A;  1FP1 D;  2G7H A;  1GHC A;  1CF7 A;  1HXD A;  2E7X A;  1SD7 A;  4K2E A;  2F2E A;  3DXJ F;  2XKP A;  5ICE A;  1J2X A;  2QVO A;  5BMZ A;  3DP7 A;  4CO8 A;  1T2K A;  4M6X A;  5D8K B;  1Z9C A;  1D8K A;  2ESH A;  2E7W A;  4I0B A;  5LEK A;  1B9N A;  1YS7 A;  3VOE A;  5JI6 A;  3SFZ A;  3H92 A;  2EWN A;  2AXL A;  3WTT C;  1XSD A;  1O3S A;  1YG2 A;  3ZMD A;  2OAZ A;  2EFQ A;  4P9U A;  1YQA A;  1ZGA A;  2XRN A;  2Z9O A;  5AIP A;  5DEQ A;  4GXO A;  1BI2 A;  2Q2E A;  4HQM A;  2O3F A;  3FX3 A;  3HTS B;  4Y17 A;  2CQK A;  3QP6 A;  4PCQ A;  1BM9 A;  2FU4 A;  2VE8 A;  2V6C A;  3M9A A;  1UFM A;  4OIN F;  2Z3Y A;  3HOS A;  2H6C A;  3RKX A;  5K1Y A;  2K27 A;  4R1H A;  2YU3 A;  3R0J A;  2Y75 A;  1Q1H A;  1I27 A;  3DF8 A;  3CUQ A;  4WX9 A;  3JAM K;  3L2C A;  2OU2 A;  2XHK A;  4BXU A;  2A61 A;  4KIB A;  4ZZL A;  4I2O A;  2OZU A;  3ZMU A;  4HDV A;  2GWR A;  3R0A A;  2RGV A;  4BH9 A;  4YG2 F;  1FSE A;  2W24 A;  2XAH A;  3MEX A;  1DPU A;  4EGZ A;  2Z5U A;  1LDD A;  2ZNZ A;  3V7C A;  2WWY A;  4LFU A;  1O7L A;  1BI0 A;  1B1B A;  5L3C A;  1TW2 A;  2MC3 A;  2Z99 A;  2WV0 A;  3IRR A;  1W7P B;  2IPQ X;  3F6V A;  5DUK A;  2DPU A;  2RNJ A;  2LKP A;  3HYI A;  1G3W A;  1S7A A;  2JSC A;  2H6B A;  4YFK F;  3WGH A;  1XD7 A;  3FMQ A;  3EYI A;  2CGP A;  2NNY A;  1RIO H;  3D0S A;  1I1S A;  4YIF A;  2HQN A;  4L0Y B;  3HOT A;  3HHH A;  3G3Z A;  1ZLJ A;  5BPI A;  4U88 A;  3L00 A;  1KYZ A;  4KNY A;  3WGG A;  2M1B A;  4U0W A;  3PFI A;  2ZME A;  2IW5 A;  4D0P A;  5LRR A;  1QNT A;  4CDG A;  1OR7 A;  4Q4Z F;  4N9I A;  1IN5 A;  3CDH A;  3EUH A;  1RZ4 A;  4F7Z A;  1OKR A;  1W7P D;  1K6O A;  1B6A A;  4R79 A;  4UVB A;  4IRG A;  5E8G A;  2QLZ A;  2RQP A;  1KU2 A;  4UNO A;  1EV7 A;  4HAM A;  3E5U A;  4IPA A;  1Y0U A;  2PFB A;  4A12 A;  3HRM A;  2EV6 A;  4WK8 F;  3E6C C;  2ADU A;  2VBW A;  3L09 A;  3TO6 A;  3J80 Z;  3CTA A;  4ENM A;  4GGG A;  4G7O F;  2JTV A;  2OZ6 A;  4O6J A;  2Y0M A;  2B0L A;  4BHB A;  2K02 A;  4HLX A;  5L3D A;  1O3R A;  4TV7 A;  2DBB A;  1FLI A;  2VXZ A;  3B02 A;  4MQV A;  2XAS A;  1OMI A;  5IT9 Z;  1PUE E;  2IT0 A;  4QLC U;  5LGN A;  5DV5 A;  5HLH A;  3KP5 A;  2BBY A;  3F72 A;  2ZME B;  1H0M A;  1KQ0 A;  2NS0 A;  2O0Y A;  3QAH A;  2PLY A;  4UXN A;  4MQ9 F;  2L4M A;  5CJ9 A;  5CLS A;  4EV0 A;  4CZZ A;  3W6K B;  1U78 A;  1EH7 A;  5CYV A;  1XGO A;  2FXA A;  2KIM A;  1BJA A;  1HST A;  4L9N A;  3LA3 A;  1E2X A;  4KYW A;  2P7C B;  3RPQ A;  1CF7 B;  2YPR A;  3MQ0 A;  1SD5 A;  3FXQ A;  4HF2 A;  2HTS A;  4EQQ A;  1FP2 A;  2PMH A;  1R1U A;  5AIQ A;  1BOA A;  2NNN A;  1MJ9 A;  2D45 A;  2VBZ A;  2Y48 A;  4UV9 A;  1MD0 A;  2VON A;  2MLK A;  2TDX A;  3VOD A;  2BE5 F;  2O61 A;  3BJ6 A;  3JTG A;  1LB2 A;  2F5D A;  2DTR A;  5LLQ A;  4LJZ F;  2C6Y A;  1RI7 A;  2JZY A;  3W6J B;  1D5V A;  1W5T A;  4EM1 A;  4OMY A;  1FBS A;  3Q9S A;  3U1D A;  4MTE A;  4L0Z B;  2FEZ A;  1BIB A;  1FNN A;  1S8N A;  1JGS A;  1ZRC A;  4ZZD A;  5CVI A;  2JPB A;  2YX7 A;  4P9F A;  3K2Z A;  4RGS A;  1WQ2 A;  4R8H A;  2KRF A;  2RDP A;  3KP3 A;  1P92 A;  1J5Y A;  1IRF A;  3SZT A;  2RKH A;  1J9I A;  4KFC A;  1YO5 C;  3ELK A;  2XAF A;  4A5M A;  1ZG1 A;  3F3X A;  1XB4 A;  2EA2 A;  4A5N A;  4BHP A;  3RDI A;  5CVU A;  2GXG A;  4AVP A;  1SAX A;  2CO5 A;  2EB7 A;  3GXO A;  1FOK A;  1D3Y A;  2LF7 A;  2IRF G;  4EJT A;  1DUX C;  2EFO A;  1P2F A;  2L3D A;  3ULQ B;  1EH8 A;  2FSW A;  4YFN F;  4LMY A;  2DU9 A;  3M8F A;  1FY7 A;  1QZZ A;  3F21 A;  3GFI A;  3DFG A;  2ZO4 A;  2OBP A;  1KU3 A;  1WRJ A;  1FX7 A;  4DQ2 A;  2MA3 A;  2K4J A;  2HYG D;  2CSO A;  3I5U A;  2DO7 A;  2PG4 A;  2LF8 A;  3U2R A;  5ICF A;  1U5T C;  5D5X B;  5ILS A;  1XMA A;  4RAZ A;  3WG9 A;  3DV8 A;  2J5O A;  5JR3 A;  1KA8 A;  4G6Q A;  1MDM A;  3F23 A;  5BQT A;  3BP8 A;  3BJO A;  3E6M A;  5CVJ A;  3MZY A;  5HVQ C;  2KIF A;  3FM5 A;  2IA2 A;  2HEO A;  2HKO A;  5IT3 A;  2HWV A;  4RGX A;  4HYE A;  4PGG A;  1WKM A;  1KU7 A;  3I71 A;  4HOB A;  3FHZ A;  4G8X A;  1TQP A;  2QQB A;  2L54 A;  3F8F A;  2LSO A;  3KEO A;  1R1V A;  2L01 A;  4HX4 A;  1FWZ A;  1STZ A;  3T0Y A;  1ON2 A;  2PQ8 A;  3KE2 A;  3KLO A;  4L5I A;  1LEB A;  5LGT A;  1O57 A;  5HDG A;  2NAZ A;  2CW0 F;  1TQM A;  1YLF A;  1G3S A;  5A2Q K;  1ZRF A;  3RKY A;  5K5Q A;  4HV5 A;  1TBX A;  4EMS A;  1S6L A;  1TLH B;  3DPT A;  1O7F A;  2EA4 A;  5HOO A;  2R3S A;  5JHU A;  5J8C A;  3TKY A;  1OYI A;  3ABU A;  4G6D A;  2PEX A;  3QU3 A;  3V8K A;  1QPM A;  1ON1 A;  1YIO A;  4FT8 A;  2Q8K A;  1BI1 A;  1QGP A;  1GXQ A;  1XMK A;  4M9S A;  2ELH A;  3GW2 A;  4KDP A;  4LGW A;  2YR2 A;  2Q0O A;  3RPU A;  1FZP B;  2K7L A;  3DQV C;  3LWF A;  2FML A;  4OIP F;  4HBL A;  4KMU X;  3F6O A;  2BGC A;  1PDN C;  3P9C A;  2QWW A;  3RKW A;  5LRS A;  1T0F A;  1R5H A;  3T8R A;  2QQA A;  1CGP A;  3ZMT A;  1ZRE A;  4QWQ A;  4M74 A;  4ZYH A;  5ICC A;  2COM A;  2EV5 A;  1IN6 A;  1A04 A;  5KK1 A;  4M9Z A;  4U0Y A;  1V3F A;  4XLN F;  5FFZ A;  2K4B A;  2LNB A;  3GLX A;  1YS6 A;  5HDN A;  3B73 A;  1KQ9 A;  3P9I A;  3LAJ A;  1IN4 A;  3TDU C;  5FGM A;  5H6Q A;  2ZXJ A;  4ASN A;  5DCM B;  5D5U B;  2VC1 A;  3LA2 A;  1HKT A;  3IWF A;  3HIF A;  1MJB A;  2DLL A;  4Q48 A;  1ONV A;  1HW5 A;  3MCZ A;  2PMU A;  3C3W A;  3F8N A;  3V7S A;  1SD6 A;  2M87 A;  4KMF A;  3V8L A;  5HLI A;  3FMR A;  3TOB A;  1AOY A;  1GXP A;  3GZ6 A;  3GEZ A;  1HSJ A;  2EFW A;  5FO5 A;  1W4M A;  5L3G A;  3BOQ A;  3KFW X;  4FX4 A;  1Z6R A;  4ZH4 F;  1FC3 A;  3M1E A;  4CXF A;  3SQN A;  1E17 A;  1DP7 P;  3EQL F;  1IN7 A;  4RB2 C;  1K78 A;  4LG0 B;  1TQI A;  1QQI A;  5HLG A;  5L3F A;  2GQQ A;  4ENJ A;  3T5X A;  4P96 A;  4ZYE A;  2A3S A;  4KIC A;  4ENK A;  1XCB A;  4N9H A;  4H0E A;  4HZF A;  1Z7U A;  3HHG A;  5D5W B;  1J7K A;  1K7A A;  3U9G A;  3WU0 A;  1P4X A;  4Q47 A;  1USS A;  4NHJ A;  2STT A;  4RGU A;  1W5S A;  3JW4 A;  1U5T A;  3TQN A;  1V4R A;  3WTX C;  5ILV A;  1IZ1 A;  3CUO A;  4OIQ F;  1XN7 A;  2D1H A;  5ED4 A;  4HW0 A;  1BC8 C;  4M72 A;  1SMY F;  2A6E F;  1ZRD A;  4G7H F;  2HQR A;  4U0V A;  4A2U A;  3KZZ A;  2KJB A;  3MFK A;  2NRA C;  1B59 A;  4LB6 B;  3RI4 A;  4GYG A;  2D1V A;  4LLG F;  4M9X A;  1BN5 A;  1IN8 A;  1FSH A;  2M30 A;  3IRQ A;  4ESB A; 
#chains in the Genus database with same CATH topology
 5JVT A;  4HPQ A;  3CJN A;  2FE3 A;  4FTH A;  2UXN A;  3G6E I;  5FLX K;  2W1O A;  3NRV A;  2CH0 A;  2Y69 H;  3CCR I;  3KEY A;  2ID6 A;  3TO9 A;  1WVR A;  2A69 F;  3MD2 A;  4Y13 A;  2X6X A;  1LDK B;  1JXS A;  4RAY A;  5H2F C;  1IUY A;  5B66 C;  3ASN H;  4BYY A;  2LTP A;  2F5V A;  2BYV E;  2GIV A;  2KT0 A;  1U5T B;  3LAP A;  1JHH A;  3X2Q H;  2QEN A;  4IHW A;  5FFX A;  4MFD A;  4E6K G;  4GCV A;  2P5L C;  2KRC A;  2HPM A;  3KEQ A;  4KA4 A;  4IF4 A;  3RQ4 A;  4B44 A;  4IOC F;  2LKX A;  2L7K A;  2OQG A;  3VEP A;  2EK5 A;  2KP6 A;  2GOM A;  2ESN A;  1S72 I;  1IF1 A;  3BPV A;  3MN2 A;  4LLL A;  2HNH A;  5GAG J;  1IDY A;  4KT5 C;  2VUM J;  3LQR A;  3REO A;  1IGN A;  4B8X A;  1YW7 A;  3EYY A;  4ZYG A;  5EG0 A;  1UHM A;  2ISZ A;  2CG4 A;  4CYD A;  4A3E J;  2V79 A;  4XKC A;  1ULY A;  2ZSI B;  4RM3 A;  1ZN2 A;  3P7N A;  1HW1 A;  4MIM A;  1XDU A;  3H9G A;  3VSL A;  2EIL H;  5FKL A;  2FUG 2;  5D4S A;  2PX9 A;  4AIH A;  4F55 A;  5EEH A;  2X1D A;  3G1M A;  1YIT I;  1OPC A;  1ZLK A;  2VB6 A;  3OYK A;  4IXA A;  1JUP A;  2K86 A;  3AL0 B;  1IXC A;  4ON0 A;  1O3T A;  3J80 K;  3FF5 A;  3S8P A;  4LK1 F;  5F04 A;  5FD6 A;  4U7D A;  2AXT C;  4FQG A;  3S15 J;  3BTI A;  2GLO A;  1WJD A;  3O3K A;  1LFU P;  1UCR A;  4BQN A;  1U2W A;  1XGM A;  2HYF A;  5E18 F;  3TP0 A;  1NG7 A;  1RC9 A;  2XKO A;  2R7F A;  1H9T A;  4BAY A;  4CIC A;  3K4J A;  1OYY A;  2KIQ A;  1JE8 A;  3KP2 A;  1Z3Y A;  1HOM A;  1M1E B;  2HQ5 A;  4F52 A;  2R7Z J;  2X6O A;  3P9K A;  1LFP A;  4Y3O A;  3ZQL A;  3HDD A;  3DEW A;  5BS6 A;  1WJE A;  3WTY C;  5K7F A;  5E3L A;  3ZQI A;  4HX7 A;  2Y2Z A;  3SJM A;  1IW7 F;  3GVA A;  3QPT A;  4AYB N;  4D7N A;  4G94 A;  2OQR A;  4IJA A;  2DDA A;  2DFI A;  3GFM A;  5HLT A;  4A3I J;  5M3M J;  1HA8 A;  2RN7 A;  4U87 A;  4ZDL A;  1SD4 A;  1ZH5 A;  1RUN A;  1Z21 A;  2R7T A;  2UXX A;  2XPW A;  2VQC A;  5EEG A;  2R7Q A;  3OYE A;  3H3U A;  2ZFU A;  2CW7 A;  1YX3 A;  2DQR A;  3SHF A;  3WU1 B;  1NK2 P;  1K79 A;  2CS3 A;  1F5T A;  4I09 A;  4B48 A;  2L02 A;  1P6R A;  2EPF A;  4PZJ A;  3P5J A;  4IHX A;  1YFH A;  2ZNY A;  1G3Y A;  2RC4 A;  2JA5 J;  3PNY A;  2V6E A;  3LSG A;  4OMZ A;  3O8G A;  2WB1 N;  2VL8 A;  1S5L C;  2K9M A;  3C1D A;  6PAX A;  3PQK A;  4XLE A;  3EET A;  1QO0 D;  1U3E M;  3IAM 2;  1PUF B;  3LQQ A;  4F92 B;  4IZZ A;  1XSV A;  3GUD A;  1XCV A;  4IQ4 A;  3RYR A;  1I6H J;  1NHA A;  4OIR F;  1WGX A;  5J6X A;  3OYG A;  3S32 A;  2CUZ A;  3AAF A;  4BBS J;  2JA6 J;  3RJP A;  4QSH A;  3F8B A;  1X1A A;  2XGD A;  5DCM A;  2CRG A;  1JKP C;  4DJA A;  2GAU A;  1FMW A;  3DBR B;  2RRE A;  3E5Q A;  3HRU A;  1DP3 A;  1ETY A;  2PJR B;  5K5R A;  4LIU A;  3FXL A;  4PUS A;  4P5O A;  3ML6 A;  4M3B A;  1B4A A;  2HFH A;  1KU9 A;  1TNT A;  4ETS A;  5FKK A;  3RZO J;  1PP8 F;  3HRS A;  5K5O A;  1AU7 A;  2ZXW H;  3K69 A;  3LST A;  3PM1 A;  1WPK A;  3WTZ A;  3SDG A;  3E6B A;  1TP4 A;  3CUQ B;  2DK8 A;  2EH3 A;  3LSP A;  2DI3 A;  1HDP A;  2DK5 A;  5EJC A;  1LNW A;  4RS8 A;  4HST A;  1XGN A;  1OJL A;  1WCM J;  2A68 F;  2IA0 A;  3JTH A;  2R7D A;  1AWC A;  2VI6 A;  3V42 A;  5E17 F;  2HI3 A;  2IBD A;  3FBN B;  1OCT C;  1R49 A;  1TTY A;  2YSR A;  5FD5 A;  2JK3 A;  3VB2 A;  2HVS A;  3ZOB A;  5E1X A;  3F8C A;  2EFN A;  4PJL A;  4A0X A;  3IKT A;  3G2B A;  2FBH A;  4XL9 A;  4A6E A;  3FHN A;  4L9V A;  3BZ6 A;  3RIR A;  3I58 A;  2J5P A;  2VBY A;  3CO6 C;  1TZL A;  3HOX J;  3CCU I;  5A2Q Z;  2A07 F;  3SZG A;  2CQN A;  2X48 A;  1BOB A;  2L4A A;  5JVG F;  4YRV A;  4IVN A;  4ENN A;  2I8D A;  1ZKG A;  2IVM A;  3L7W A;  1SEU A;  1R5G A;  1TT0 A;  3O6B B;  2LY2 A;  3FZV A;  2K3F A;  1S3J A;  4UUS A;  2H27 A;  4BEH A;  2KMU A;  2FNP A;  3DU6 A;  4XLH A;  5IP9 J;  2DT6 A;  1W7P A;  4IRH A;  5B1B H;  3GLL A;  2BVM A;  1K78 B;  1OCP A;  3I59 A;  2XSJ C;  2BOL A;  5J1R A;  4MGR A;  1WJB A;  1PP7 U;  3G1L A;  1IUF A;  4Z2Y A;  4EJV A;  2R5Y B;  1ODD A;  5CVV A;  3B6A A;  4S05 A;  2V1U A;  3MWM A;  2DN0 A;  2PBI A;  3DBH B;  4FIS A;  2WBM A;  2P4W A;  3WTS C;  1XSX A;  1AKH B;  5LEJ A;  1QVT A;  3BR2 A;  1DQU A;  1ENH A;  2HOT A;  3QP5 A;  5F0F A;  4HRI A;  4DBQ A;  1JUS A;  5ERI A;  1IXS B;  2ICW G;  3LL7 A;  4MTD A;  3HGY A;  1ERD A;  3HKZ N;  1NK3 P;  2LG4 A;  3O2P E;  3MMY B;  3DLL F;  4XRF A;  4LG3 A;  2LRE A;  1C0W A;  1P4A A;  3S1Q J;  3BG7 A;  3UNG C;  4LIV A;  2LDU A;  2E1M C;  3ZQH A;  3LSH A;  2HR3 A;  2NVQ J;  3F22 A;  1EF4 A;  4BDY A;  1ZG5 A;  5KHD A;  2FQ4 A;  2H8W A;  2WY8 Q;  2X1E A;  5DD4 A;  5IYB J;  4HQE A;  1TNS A;  2EBI A;  4FHT A;  4M6Y A;  5DS9 A;  2RQQ A;  2FD5 A;  3RYP A;  1OCC H;  4RM2 A;  2XF7 A;  2F4O B;  1DGW Y;  3ZCO A;  2F4M B;  3S2W A;  4PK4 A;  3OIQ A;  1Z3X A;  4DNC A;  3OYI A;  3S2D J;  2IS2 A;  3ZMS A;  4JBA A;  1MGT A;  3KLN A;  2DA1 A;  3ABT A;  1WJA A;  4A6D A;  1ETW A;  2KQR A;  4UVC A;  3J7A O;  1JT6 A;  2FF4 A;  3PSF A;  2X4H A;  2NVX J;  4IHS A;  4IO9 F;  1UB9 A;  1LDJ A;  2M8G X;  2KFD A;  2GA2 A;  3I4P A;  1FBU A;  4JQF A;  4L9T A;  2XRO A;  2E60 A;  2CUE A;  2V9K A;  1WWX A;  2W57 A;  4BKX A;  1BI3 A;  3TOA A;  3HZJ A;  5BOX A;  4NQW B;  4DYC A;  1R71 A;  1Z0X A;  5C3E J;  4UUT A;  3BJA A;  4I99 C;  1IAW A;  2W84 A;  3I9V 2;  1JKQ C;  3F9K A;  2HQA A;  4QPO A;  1T6S A;  4BJ6 C;  3KYL A;  2ISY A;  4A0Y A;  4IKF A;  1P7I A;  1D8J A;  4V2F A;  2MLG A;  1IRG A;  1YYV A;  1L3L A;  4QIW N;  2DT5 A;  4AVZ A;  2XDV A;  1S7E A;  1Y6I A;  2OD5 A;  2H09 A;  4DW6 A;  3AG3 H;  5CQE A;  3ZQQ A;  2DA7 A;  2ELJ A;  2E1C A;  2EIJ H;  4EJW A;  5JFR A;  2LVS A;  4GRI A;  4KJZ A;  2Z2S B;  1MH4 A;  3PUB A;  3ONQ A;  3K1P A;  1AHD P;  1UHW A;  1S7O A;  2VN2 A;  3OS0 A;  1I5Z A;  4J01 A;  5F1J A;  5HDK A;  3I0T A;  3AG1 H;  1R4M B;  1A6Q A;  2HXI A;  3I64 A;  5EZG A;  3PUF A;  4P55 A;  1RNL A;  3FMS A;  1U0J A;  2D2W A;  2M5W A;  3PJR A;  3MKL A;  3MAJ A;  2IGN A;  4KIT B;  4MEX F;  2KJC A;  2P7V B;  2XAQ A;  2KHM A;  1X4P A;  3D5S C;  3IUO A;  4HA8 A;  2JQ7 A;  1GUU A;  2F5E A;  2WAQ A;  3K4N A;  4XN3 A;  2DMQ A;  2R7X A;  2OA4 A;  2QQ8 A;  2XSD C;  1X58 A;  4ZC3 A;  3FKI J;  4CA0 A;  3WE2 A;  4XM3 A;  2EJR A;  3TDZ C;  1J75 A;  1IDZ A;  4WCG A;  2DMN A;  2R7V A;  3G1O A;  3ZN0 A;  5CVR A;  4AIK A;  5C44 J;  3HRT A;  3CMA I;  2KL4 A;  2V9P A;  3RZD J;  4JX5 A;  5KVR A;  2M45 A;  4CCM A;  5BNG A;  2IP2 A;  1H9G A;  3H5A A;  2V4J C;  4DIQ A;  3M1C A;  4EM2 A;  3DTI A;  1FYK A;  1A36 A;  3E97 A;  2XAG A;  1RET A;  4KIG A;  2DMU A;  1JI8 A;  5D8L B;  4LIT A;  5D6F A;  4V2G A;  2WY7 Q;  1UEL B;  5ICG A;  4E7K A;  1N77 A;  2PJR A;  3BDD A;  5EGO B;  4ESF A;  4E7L A;  3Q5F A;  4HNT A;  5FLM J;  1OIS A;  1S9H A;  4XLC A;  3ZR8 X;  3ZN1 A;  4AU7 A;  2XGE A;  4DZP A;  1NG6 A;  2VT3 A;  2O9L A;  3NQO A;  2VT2 A;  2BEO A;  5DDG A;  1XGS A;  1WI9 A;  4IHT A;  2ZJ2 A;  4OU0 A;  2K9S A;  2XUB A;  2GZW A;  2HVQ A;  4EJU A;  1W5C C;  2WV1 A;  4E7J A;  5KAI C;  1MMG A;  1QZY A;  4JK1 X;  1LUJ B;  1BC7 C;  2HGC A;  1OFC X;  5GAE J;  1D5Y A;  3OOU A;  4G7Z F;  2X0L A;  4LK0 F;  1B9M A;  3GX4 X;  1YX5 A;  1HW2 A;  1MJA A;  3QRF F;  2FA5 A;  3H3Z A;  5DTD A;  3ZMV A;  2MFZ A;  2JA2 A;  4LB5 A;  2A5Y B;  1I3A A;  3CCJ I;  2ZBK A;  5FRO A;  3CF2 A;  5D4R A;  1SMT A;  3G71 I;  2BY1 A;  3DLA A;  2KDZ A;  1X3W B;  2VOO A;  3VPR A;  3FM3 A;  2MAB A;  4XBF A;  1ZK8 A;  1GVJ A;  3DCF A;  2VJJ A;  2ETH A;  2M8E A;  3OR1 C;  4XQF A;  2XVC A;  2BV6 A;  3JSO A;  1K4S A;  3IKV A;  2F5C A;  2MH2 A;  2QSH X;  1MNE A;  2CV0 A;  2L5Q A;  3IWZ A;  1Y1W J;  4BQA A;  5DUI A;  1OYW A;  1O3Q A;  2N8G A;  1D0Y A;  4HEA 2;  3T8T A;  4BGD A;  3CLQ A;  1YTY A;  3ROU A;  3A01 A;  2O03 A;  3ECH A;  2VOD A;  4KN7 X;  2VC0 A;  3GZ5 A;  3HSE A;  1PUF A;  3KP7 A;  3OYL A;  3WGI A;  3V8J A;  4YFX F;  3L2W A;  4L5J A;  4A3J J;  2ACJ A;  1WFX A;  1WJC A;  1WH7 A;  4OIO F;  1KYW A;  4A93 J;  3WOD F;  4BU2 A;  3K7A J;  1KQ8 A;  2XRL A;  2CFO A;  3CCE I;  5LFA A;  1LQ1 A;  2E35 A;  1Y39 A;  1T98 A;  1LVA A;  3OOP A;  3T1B A;  1R5I D;  4RB0 A;  4WXC A;  1T56 A;  1R6R A;  3ZXS A;  2IGK A;  2QBY B;  1PVE A;  4L9J A;  2ZFW A;  4KIF A;  1Y8Q B;  2BVL A;  3FWE A;  5FRN A;  1Z67 A;  2QQ9 A;  2LKS A;  2HKX A;  2X6Y A;  5D5V B;  3KET A;  2XGX A;  2ME6 A;  5GAH J;  3J81 Z;  3ZQ7 A;  1RKT A;  2XAU A;  2CMP A;  1ACI A;  1SC7 A;  1IV6 A;  4XKB A;  3BQY A;  5LBQ A;  3KP6 A;  4KUM A;  2DXI A;  2HOE A;  2IS6 A;  2YUS A;  4XKV A;  1RR8 C;  4CGZ A;  2FBI A;  2ZJQ F;  3OYH A;  2RV8 A;  4UV8 A;  2RAE A;  1HKS A;  4RAG A;  4XSZ F;  3ERE D;  4IOA F;  2BHZ A;  2L9S A;  4XNF A;  1FIA A;  3TMO A;  3BCA A;  2STW A;  2ZCW A;  3CMY A;  2VQH A;  1V5G A;  3ABM H;  2BW3 B;  4XRS G;  3W3C A;  1E3P A;  1VF9 A;  1Y1V J;  1MBJ A;  1IC8 A;  3R60 A;  3N97 A;  2CV1 A;  1YRN B;  2K85 A;  1R58 A;  2XF6 A;  3GF2 A;  3Q0V A;  4XOP A;  4DYR A;  2XIG A;  4Y15 A;  3GFL A;  2DDB A;  2DA6 A;  2ID3 A;  3BCB A;  4AUX A;  5FKN A;  3MZH A;  1FBQ A;  1A6I A;  5JHF A;  1Z05 A;  3JSP A;  2NVY J;  4M3F A;  1A5J A;  1U6G A;  2LOO A;  3LA7 A;  1X1D A;  5E20 A;  2VPR A;  1GDT A;  3D5R C;  5DD8 A;  5J8F A;  1W36 C;  4I7H A;  2FQ3 A;  2EFP A;  3BZC A;  3CLO A;  3VYU B;  3ABL H;  1R22 A;  2EIN H;  2E19 A;  4WF2 A;  2KKO A;  4UVA A;  1XS9 A;  2VE9 A;  3R4K A;  1A35 A;  1DGR M;  2V1X A;  3H36 A;  3I59 B;  4WXD A;  4RDU A;  4IX7 A;  2QBY A;  3JRC A;  3EUH C;  1MKM A;  2G9W A;  2FMY A;  2M3A A;  3DKY A;  5LHG A;  3W6V A;  1VQ6 I;  4I02 A;  4AWX B;  5KAF C;  3GO5 A;  1YW8 A;  3SXY A;  4O5V A;  3GTJ J;  2XC7 A;  1ZTR A;  4E7I A;  5TJJ A;  2VQG A;  4PGH A;  2G0E A;  1MSF C;  5F64 A;  4BXF A;  3HUG A;  3QPS A;  4G9Y A;  4I01 A;  4B4C A;  4ZTJ A;  4GYI A;  4N4N B;  4ITV A;  4JX4 A;  3FKJ A;  4IHV A;  3BR3 A;  2JMW A;  1R9T J;  4BDZ A;  2GA1 A;  3QU6 A;  1ZAO A;  1R00 A;  3BPX A;  3VYR B;  1WSU A;  3HL2 A;  4XOR A;  2CV2 A;  3I54 A;  3CCY A;  4OAY A;  4A3G J;  2E2J J;  3DEU A;  3Q0U A;  3AG2 H;  2PI0 A;  5EDN A;  2BY2 A;  1OQY A;  1RUO A;  5F6F A;  2O6G E;  2I5U A;  3C18 A;  2YX4 A;  4BHC A;  4C3H J;  4RB1 A;  4LD5 A;  1J59 A;  2VKE A;  1FEX A;  1V54 H;  3QPH A;  3K4K A;  3I56 I;  1T0F C;  3JRF A;  2Z16 A;  5HS9 A;  3GBG A;  2JPC A;  3C2G A;  4HF1 A;  4LG0 A;  1Z91 A;  1SFE A;  2DOD A;  2ECC A;  4C30 A;  4KIS A;  1BIA A;  4EM0 B;  3TO7 A;  3HSR A;  2DYS H;  2NVU B;  3J7Y J;  3S2H J;  3J81 K;  5K7Z A;  1B8I B;  2QCO A;  3K4C A;  2DAO A;  4L5E A;  3KCC A;  2OCE A;  2IEK A;  4PJ0 C;  4E70 A;  1SVO A;  1SFK A;  1G4D A;  1YW9 A;  1Z1D A;  3V7R A;  2FOK A;  3BWG A;  2LK2 A;  4M3E A;  3FBI B;  1X4O A;  3DTK A;  2L7F P;  1VI0 A;  2XF5 A;  3H3V K;  2LP0 A;  4ANJ A;  1LPQ A;  1H88 C;  3C7J A;  3CJT B;  3S3M A;  1DDN A;  4CSW A;  3KZY A;  3OL4 A;  5EG0 B;  3NEU A;  3L1P A;  3BR5 A;  1K6Y A;  1ZR4 A;  2L0K A;  1MZB A;  2E1N A;  3K4L A;  3IH4 A;  2VBX A;  3L2V A;  2R5Z B;  3K2A A;  2HZD A;  2JWT A;  3ECO A;  2LBF B;  1R23 A;  2DA4 A;  2IJL A;  3E5X A;  3L2R A;  4XKW A;  2HZT A;  3HOU J;  3ZPL A;  3GWZ A;  3A0B C;  5F1R A;  3CC7 I;  4PJJ A;  1HBX G;  4HX8 A;  1VFC A;  5H6R A;  4Q5S F;  1MMS A;  3I4M J;  3OS2 A;  2AS5 F;  3CZ6 A;  3WTU C;  5IT9 K;  3FXR A;  2Y30 A;  3ZQC A;  1F43 A;  4WWC A;  4D1Q A;  4FCY A;  3HPH A;  3BC8 A;  4A0Z A;  1F1Z A;  1P4W A;  2GIZ A;  4UB8 C;  2BXY A;  1Z6T A;  1N25 A;  3GFJ A;  4FE4 A;  1OCO H;  2P5K A;  3G73 A;  5TRD A;  3KP4 A;  1VTN C;  3RCO A;  3A02 A;  5E1Z B;  5C4J J;  4HLY A;  1QVU A;  1DU0 A;  2GXB A;  5LHH A;  4NBQ A;  1F9N A;  3PO2 J;  3A1Y A;  2LY1 A;  2P81 A;  3K9T A;  3CUQ C;  2V9V A;  2O8X A;  3OV8 A;  2QUF A;  5GTH C;  1TWC J;  2WTE A;  5DYM A;  4C3I J;  1E3H A;  2DOF A;  2VOP A;  4IRI A;  3L9F A;  2WC2 A;  2R7R A;  5EGO A;  1VQL I;  4RGR A;  4EVI A;  1FT9 A;  4UHT A;  3R6S A;  3D1N I;  1XDS A;  2HTJ A;  2L9V A;  4NUB A;  2MD5 A;  3E7L A;  3CDI A;  1FMV A;  3M7G A;  3IL2 A;  2QEX I;  1JKO C;  1PJR A;  3EDP A;  1UST A;  4HF0 A;  2VXD A;  3BY6 A;  4Y33 A;  2R7U A;  1ZG3 A;  3OR2 C;  3VDX A;  2L9N A;  3IC7 A;  4W1U A;  2NYX A;  1TW3 A;  1CQT A;  3AL0 C;  3LNQ A;  3WTW C;  2F48 A;  2ZC2 A;  3PO3 J;  3K6G A;  4CCL A;  4BNC A;  1VQM I;  3JR9 A;  2QM3 A;  2HDC A;  3M8E A;  4D5F A;  2DFF A;  4MLO A;  1S29 A;  1BW5 A;  1TL8 A;  2UWM A;  4KT6 A;  2HU9 A;  3HSF A;  2MBF A;  1LEA A;  2LD5 A;  2EIK H;  3GTO J;  2ZKZ A;  3DWL E;  3HTU A;  3WE3 A;  2DT7 B;  4KN4 X;  1ZAR A;  5HNF A;  1Y0N A;  1DPR A;  4YII A;  4HV6 A;  3M8J A;  3WTV C;  3OYJ A;  3BRO A;  1MBK A;  1OLT A;  2P6T A;  3R61 A;  1Y8R B;  5HS8 A;  5GTI C;  5E3M A;  4HDU A;  1FYM A;  1U8R A;  4NQW A;  1QU3 A;  2A05 A;  3SZP A;  3M3Y J;  2FRH A;  4AD9 A;  2KIU A;  2P8T A;  4IQJ A;  5D6E A;  1HKQ A;  3QOP A;  1ETX A;  2MYS A;  1K61 A;  2E1M B;  2Y0S A;  3C2B A;  4O3M A;  4M71 A;  3RTR A;  4XRS A;  4I76 A;  2P6S A;  4B47 A;  2V7F A;  2CFX A;  2JA8 J;  4Y7N J;  1T39 A;  1KGS A;  3VSK A;  2WAF A;  4CCK A;  1P9Q C;  2JT1 A;  2IA1 A;  3E3V A;  1UG0 A;  2LC2 A;  3I3L A;  4S04 A;  4GO1 A;  2XV4 S;  2R4G A;  3CCQ I;  3LFK A;  5J4V A;  2GXA A;  4B3X A;  2FBK A;  2X9D A;  4I98 B;  3S3O A;  1VQP I;  3CC2 I;  2FNA A;  1X3U A;  2M34 A;  3LSM A;  3LOC A;  1MDM B;  5L3B A;  4RB3 C;  2K40 A;  4XSX F;  3IHU A;  3E6D A;  1G6N A;  3DKW A;  3RSN A;  2KRH A;  3PNT A;  1LFB A;  1VZ0 A;  4ABZ A;  4PDK A;  3V4G A;  1WH5 A;  1SFO J;  2W48 A;  5J1Y A;  2V1D A;  2MD0 A;  2M9H A;  1FIP A;  2FJ1 A;  1TWG J;  1R36 A;  4NB5 A;  2BW3 A;  4ZYD A;  1K4T A;  2NS7 A;  1JHF A;  5E8I A;  3CO7 C;  1SFX A;  4WXH A;  3VFZ A;  1T38 A;  4L18 B;  3K1N A;  1K83 J;  2DMP A;  2HS5 A;  4A69 C;  4NC7 A;  1T33 A;  4BE0 A;  2MC4 A;  3F8M A;  1ETO A;  1VQ9 I;  2JSP A;  2DA3 A;  1ZHF A;  2JUG A;  1I6X A;  4AIJ A;  1FOY A;  3IH2 A;  4LLN A;  1ZYR F;  2JRT A;  1REP C;  3PSI A;  5LGU A;  3U21 A;  4F3Q A;  5J4Y A;  2OJE D;  2W4S A;  3CDL A;  2OF7 A;  1JTY A;  1LJ9 A;  2MH9 A;  3DPL C;  1G3T A;  1MND A;  2NXN B;  2RVC A;  4U7B A;  2CWE A;  1QRY A;  2QYO A;  3DBL B;  5FLX Z;  4EJO A;  4UUV A;  4MEY F;  4W97 A;  3OY9 A;  2PJP A;  2DW4 A;  2EIM H;  2P5V A;  2G7U A;  3N4M A;  1QHG A;  1ETK A;  1I1G A;  1R1T A;  5AON A;  3KZI C;  3LSR A;  4B09 A;  4OWR B;  1W0U A;  4EGY A;  3ZMZ A;  2Z33 A;  1F4K A;  2UZK A;  4CUG A;  2A6H F;  2VJ5 A;  3D5L A;  5LHI A;  1BBY A;  2R5Z A;  2DQL A;  4MHG A;  4OOI A;  2WAD A;  1SFU A;  1FYL A;  1L0O C;  2H94 A;  1R7J A;  2QKM B;  5M5W J;  2PN6 A;  3Q0W A;  1MBF A;  1XTA A;  1QBJ A;  5BPD A;  2XAJ A;  1ETV A;  4MNU A;  5DCF A;  5M5Y J;  2F5F A;  2QZ8 A;  4GFB A;  1FPQ A;  2RNG A;  3COA C;  2NS8 A;  3WG7 H;  3K0L A;  4XLP F;  1FJL A;  1RRJ A;  1IXR C;  2W25 A;  3JAM Z;  2I10 A;  4II3 A;  2A6T A;  4BS9 A;  5FB2 A;  1V55 H;  3FXO A;  2EV0 A;  1BR4 A;  1JKR C;  4CH7 A;  3S1N J;  3TL4 X;  3CD6 I;  1QZE A;  3CJQ B;  4FX0 A;  3TGN A;  3DU5 A;  1SAU A;  4N0B A;  2E71 A;  3JCU C;  2AQF A;  1D1B A;  2EZI A;  3WHC A;  2W00 A;  1J0R A;  4FET A;  5E1W A;  1EH6 A;  4I0A A;  4NC6 A;  4BQO A;  4M73 A;  2W85 A;  2ZB9 A;  3FXU A;  2HDW A;  3A01 B;  4ESJ A;  1ZGJ A;  5H20 A;  3I53 A;  3ISP A;  4CHU A;  3K1M A;  3U1K A;  5HS7 A;  3RKQ A;  5ILU A;  1ZR2 A;  3PQJ A;  2BXZ A;  4DYQ A;  3MKW B;  2DPD A;  1UHS A;  2Q2E B;  2VJ4 A;  3Q9V A;  5L3E A;  3ZP5 A;  3GYH X;  1V5E A;  2CYY A;  3ZGK A;  4ZJZ A;  1HQC A;  2L9R A;  1FP1 D;  1B8I A;  1GVD A;  2AHQ A;  2G7H A;  1GHC A;  1CF7 A;  4JYK A;  2JA7 J;  1HXD A;  2E7X A;  2E5Z A;  3JRG A;  3F0C A;  2DJN A;  3C2H A;  4B3A A;  1SD7 A;  4H4K C;  4K2E A;  2F2E A;  3DXJ F;  2XKP A;  3J7A Y;  2OV7 A;  5ICE A;  1J2X A;  2QVO A;  5BMZ A;  5JLW A;  3DP7 A;  4CO8 A;  1T2K A;  4M6X A;  4CYC A;  3BT9 A;  4C2T A;  5D8K B;  2CQ7 A;  1Z9C A;  1D8K A;  2ESH A;  2E7W A;  1W1W E;  4I0B A;  4J00 A;  5LEK A;  1AKH A;  1WHU A;  3BTL A;  3MZ8 A;  4CCJ A;  1B9N A;  1YS7 A;  3VOE A;  5JI6 A;  3SFZ A;  5FRM A;  4LOC A;  3H92 A;  3OL3 A;  3OYM A;  2O8K A;  3HEF A;  3H5R A;  1GT0 C;  3FDY A;  1XC5 A;  2EWN A;  4BE2 A;  2E34 A;  4XID A;  1J09 A;  2AXL A;  3WTT C;  1XSD A;  1O3S A;  1YG2 A;  3ZMD A;  2OAZ A;  2EFQ A;  1XG1 A;  3CC4 I;  4G6T B;  4P9U A;  1JTX A;  1LE8 A;  2A5W A;  2LBF A;  4RLF A;  1YQA A;  1ZGA A;  1TT5 B;  2EQR A;  1VND A;  3HM5 A;  2XRN A;  2Z9O A;  1POG A;  5AIP A;  5IP7 J;  4EAT A;  2KDO A;  5DEQ A;  1B72 A;  4GXO A;  2Q1Z B;  1BI2 A;  2CW8 A;  2Q2E A;  1GV5 A;  4HQM A;  2O3F A;  3FX3 A;  3HTS B;  4Y17 A;  2K5C A;  5J47 A;  2CQK A;  3QP6 A;  2B9S A;  4Y52 J;  4PCQ A;  1BM9 A;  1HCR A;  1YI2 I;  2FU4 A;  2VE8 A;  2XGC A;  1D0X A;  5DM7 F;  2ECB A;  2V6C A;  3TW6 A;  3M9A A;  1UFM A;  2BZT A;  4OIN F;  2Z3Y A;  1UMQ A;  3HOS A;  2H6C A;  2OTL I;  3RKX A;  5K1Y A;  2K27 A;  3HC7 A;  4R1H A;  3KPH A;  2YU3 A;  5F0H A;  3R0J A;  5GP9 A;  2Y75 A;  4C9Y A;  1Q1H A;  1I27 A;  3DF8 A;  3CUQ A;  4WX9 A;  3JAM K;  1UZC A;  2CJJ A;  2F4I A;  4PJM A;  3L2C A;  2OU2 A;  2VIX A;  2OUM A;  2XHK A;  5F27 A;  4BXU A;  4D7M A;  2EZH A;  1BL0 A;  2L7Z A;  3FXK A;  2A61 A;  4FAS D;  4CYC B;  4KIB A;  4BQQ A;  4ZZL A;  1I50 J;  4I2O A;  2OZU A;  2DJI A;  3ZMU A;  2GWR A;  4HDV A;  3S17 J;  1W36 D;  3RPU D;  3FIS A;  3R0A A;  3PNV A;  1ZEL A;  3E0J B;  1JGG A;  4DOZ A;  2O7O A;  1V5F A;  2HVR A;  2RGV A;  1FOX A;  3HKZ A;  1FSE A;  2BY3 A;  3QYB A;  2W24 A;  2XAH A;  3ZQG A;  3MEX A;  4BH9 A;  4YG2 F;  1RPW A;  1DPU A;  4P1W A;  1U8B A;  3ZQF A;  4EGZ A;  4II2 A;  2Z5U A;  2MGQ A;  1LDD A;  2ZNZ A;  3V7C A;  2WWY A;  3ZRG A;  4LFU A;  1O7L A;  1BR2 A;  1BI0 A;  1B1B A;  3DKX A;  3BR0 A;  3O8H A;  5L3C A;  1TW2 A;  4HSR A;  2MC3 A;  2Z99 A;  2WV0 A;  2X51 A;  2IXS A;  3FK7 A;  1W7P B;  3IRR A;  2IPQ X;  3F6V A;  3LSI A;  4ZYA A;  5IY5 H;  1X1P A;  5DUK A;  2DPU A;  2RNJ A;  1FTZ A;  2LKP A;  3HYI A;  1G3W A;  1S7A A;  3SDB A;  2JSC A;  1I39 A;  2Y9Y A;  3FXJ A;  2H6B A;  4YFK F;  1SVL A;  3HOY J;  1ZGW A;  2JUC A;  3WGH A;  4AC0 A;  2LYC A;  3W2W A;  1XD7 A;  3FMQ A;  2H8R A;  1QHH D;  2IS1 A;  3EYI A;  2CGP A;  3CES A;  1GV2 A;  3LSK A;  2NNY A;  1P7J A;  3H0D A;  3S1R J;  4C2U A;  1RIO H;  3D0S A;  2DOE A;  2B7E A;  3H0G J;  4YIF A;  1I1S A;  2KPM A;  5M3F J;  3HG9 A;  2HQN A;  2JJ7 A;  4L0Y B;  3OYF A;  2JVG A;  2W82 A;  3HOT A;  3JRD A;  5FLV A;  3B6C A;  3HHH A;  4E7H A;  3G3Z A;  1ZLJ A;  2VAS A;  3S14 J;  5IP6 A;  3WHB A;  5BPI A;  1YRN A;  4U88 A;  3GTQ J;  5J3L A;  3HXL A;  2Y31 A;  3L00 A;  1GLN A;  4F93 B;  2ME0 A;  3JRB A;  1KYZ A;  4A3C J;  4KNY A;  2LLK A;  3WGG A;  1D1C A;  1Z7L A;  2M1B A;  4U0W A;  3PFI A;  2ELK A;  5B3S H;  2ZME A;  2IW5 A;  2M0M A;  2DYR H;  4M3G A;  4D0P A;  4E7S A;  5LRR A;  1QNT A;  4CCO A;  4CDG A;  3BG3 A;  3OYC A;  1OR7 A;  2YU9 J;  4Q4Z F;  1X1B A;  4N9I A;  1MNM C;  3JRH A;  2CUJ A;  3A4C A;  1IN5 A;  3CDH A;  3EUH A;  3AKZ A;  1RZ4 A;  4F7Z A;  3CMM A;  3J7Z I;  1OKR A;  1W7P D;  1VQO I;  1WJ5 A;  4PSX A;  2LY9 A;  2X6W A;  3TP3 A;  1B6A A;  1K6O A;  4R79 A;  1TWA J;  2DOA A;  4UVB A;  4IRG A;  3QYF A;  5E8G A;  1SVM A;  4X6A J;  2QLZ A;  2P0W A;  2ZXI A;  3BG9 A;  2O5R A;  2RQP A;  3L2Q A;  1BJZ A;  1KU2 A;  5DM6 F;  3GTL J;  4UNO A;  1EV7 A;  4HAM A;  3E5U A;  4IPA A;  1Y0U A;  2PFB A;  4A12 A;  3HRM A;  2EV6 A;  2WB1 A;  4WK8 F;  3N05 A;  3E6C C;  2ADU A;  2VBW A;  3L09 A;  3QOE A;  3TO6 A;  3J80 Z;  1T95 A;  3CTA A;  4ENM A;  4GGG A;  1G8X A;  2K9N A;  1RKW A;  3NAR A;  4G7O F;  1WJF A;  2JTV A;  2OZ6 A;  4X0G A;  4HNV A;  3FIW A;  4IL6 C;  4O6J A;  1X19 A;  3OIP A;  3A2K A;  3DPU A;  4E7Z A;  2Y9Z A;  2PMZ A;  2Y0M A;  2B0L A;  4BHB A;  2K02 A;  2M2E A;  4HLX A;  4JOM A;  5L3D A;  3GCM A;  3LSJ A;  1O3R A;  2ZME C;  3GME A;  3K70 C;  4TV7 A;  2DBB A;  3WU2 C;  1XX5 A;  3BZK A;  2H1L A;  1FLI A;  2VXZ A;  1VQ4 I;  1IO2 A;  3B02 A;  4MQV A;  2XAS A;  2ZXH A;  1OMI A;  3HJE A;  3CQZ J;  5IT9 Z;  1PUE E;  2IT0 A;  1MH3 A;  4QLC U;  5LGN A;  5DV5 A;  5HLH A;  2MSY A;  3KP5 A;  4S0H B;  2BBY A;  2TRT A;  2LR8 A;  3DTE A;  3F72 A;  2ZME B;  1H0M A;  1KQ0 A;  4UY8 I;  2VKH A;  4XON A;  2NS0 A;  2O0Y A;  3QAH A;  4YEJ A;  2PLY A;  4UXN A;  1TC3 C;  4MQ9 F;  5KCM A;  2L4M A;  5HNH A;  2GOX B;  5CJ9 A;  5CLS A;  3NAU A;  3H35 A;  3W2A A;  3BG5 A;  4DBR A;  4N4O B;  4EV0 A;  1ORK A;  4CZZ A;  3W6K B;  1U78 A;  4IEJ A;  1EH7 A;  1MBE A;  5CYV A;  1XGO A;  2FXA A;  1WI3 A;  2KIM A;  1BJA A;  1HST A;  3CF5 F;  4L9N A;  4BUP A;  1IV8 A;  3LA3 A;  4JP0 A;  3PL8 A;  1E2X A;  1BA5 A;  4KYW A;  2WAE A;  4EEF G;  2P7C B;  3RPQ A;  1CF7 B;  2YPR A;  5TGT A;  3MQ0 A;  1LKX A;  1SD5 A;  4Z6Y A;  2ZSH B;  2YS9 A;  3FXQ A;  5CQG A;  4HF2 A;  2HTS A;  4EQQ A;  3LMM A;  1FP2 A;  5J40 A;  4Y4R A;  2PMH A;  1R1U A;  2HDD A;  5AIQ A;  1BOA A;  2R7W A;  2NNN A;  1MJ9 A;  2D45 A;  2VBZ A;  2R92 J;  2Y48 A;  4BJ5 C;  2Y0S N;  1MD0 A;  4RLQ A;  4UV9 A;  2MLK A;  2VON A;  1NTC A;  2TDX A;  3SFI A;  3VOD A;  2B63 J;  1U9O A;  4X1E A;  1YJ9 I;  2BE5 F;  2R0Q C;  2O61 A;  3OWT A;  3BR6 A;  2FX0 A;  2LFB A;  4MFE A;  3BJ6 A;  3JTG A;  1LB2 A;  1G59 A;  2DA2 A;  5EEA A;  2F5D A;  3L2U A;  1KZH A;  4C3J J;  1QPI A;  2DTR A;  1E0E A;  3BLY A;  4A3M J;  1Z77 A;  3BTC A;  5LLQ A;  4LJZ F;  2OC6 A;  3BG6 A;  2DFH A;  1RI7 A;  1F36 A;  2C6Y A;  2JZY A;  3DEE A;  3W6J B;  3OIO A;  1YIJ I;  2ZJP F;  1D5V A;  1UJ8 A;  1W5T A;  3HB9 A;  4EM1 A;  4OMY A;  1SAN A;  4XRM A;  1FBS A;  3Q9S A;  3U1D A;  2OPT A;  4MTE A;  4HNU A;  4L0Z B;  2LMD A;  5GAD J;  2FEZ A;  1BIB A;  1FNN A;  1UG2 A;  1S8N A;  2V1N A;  1JGS A;  4ZTF A;  3CP8 A;  1ZRC A;  4ZZD A;  5CVI A;  2JPB A;  2YX7 A;  4XOT A;  1B72 B;  3M07 A;  4P9F A;  3K2Z A;  4RGS A;  3ERM A;  1WQ2 A;  3HOW J;  4R8H A;  2KRF A;  2RDP A;  5K7H A;  4UUS B;  3KP3 A;  1P92 A;  1J5Y A;  1IRF A;  3SZT A;  2RKH A;  2XB0 X;  4JX6 A;  4NC8 A;  1J9I A;  4KFC A;  1YO5 C;  3ELK A;  2XAF A;  3OSF A;  4A5M A;  1ZG1 A;  3F3X A;  2AQE A;  3IV5 A;  1XB4 A;  2X85 A;  2EA2 A;  3UR3 C;  4BXX J;  4A5N A;  4BHP A;  3RDI A;  1HC8 A;  1WZ2 A;  1G2H A;  5CVU A;  2GXG A;  4AVP A;  1SAX A;  2CO5 A;  2EB7 A;  1MMA A;  3GXO A;  1FOK A;  4NNJ A;  2IS4 A;  2JN6 A;  1D3Y A;  3PIO F;  2LF7 A;  2QKL B;  2IRF G;  1O4X A;  4EJT A;  2E36 A;  4YEL A;  1AA7 A;  1DUX C;  2E2I J;  3TED A;  1APL C;  5IYD J;  2EFO A;  1OR7 C;  1P2F A;  2L3D A;  3ULQ B;  1EH8 A;  4RBO A;  1MBH A;  2FSW A;  4YFN F;  1MBG A;  4LMY A;  3GTP J;  1JUM A;  2DU9 A;  5IYC J;  1ETQ A;  1N75 A;  3M8F A;  1FY7 A;  1QZZ A;  2OCC H;  2DCE A;  3F21 A;  3GFI A;  1D0Z A;  4PSW A;  3DFG A;  2ZO4 A;  1VQN I;  4AYB A;  2QSF X;  2OBP A;  2NVT J;  1KU3 A;  1YOV B;  2R7S A;  1WRJ A;  4CCN A;  1FX7 A;  4DQ2 A;  2HYJ A;  2MA3 A;  1HLV A;  3GTG J;  1R4N B;  1X1C A;  3KYC B;  2K4J A;  2HYG D;  1EKE A;  2CSO A;  1UAA A;  2UUZ A;  3I5U A;  3ESW B;  2DO7 A;  1FOW A;  2PG4 A;  1BW6 A;  2LF8 A;  3U2R A;  2CUF A;  5FJ8 J;  5ICF A;  3S16 J;  3H9J A;  1U5T C;  4FE7 A;  5D5X B;  3OYA A;  5LD2 C;  3H9Q A;  5GPA A;  3S3N A;  5ILS A;  1XMA A;  4RAZ A;  3WG9 A;  2K3P A;  3DV8 A;  2J5O A;  3K4B A;  5JR3 A;  2F6C A;  2QSG X;  1KA8 A;  4G6Q A;  1MDM A;  1VQ5 I;  3F23 A;  4PFO A;  3G4S I;  5BQT A;  3BP8 A;  1MSE C;  3BJO A;  2VPL A;  2EZL A;  3E6M A;  2X1C A;  5CVJ A;  3MZY A;  3EUA A;  5HVQ C;  2KIF A;  3FM5 A;  2IA2 A;  3CCS I;  2HKO A;  2HEO A;  5IT3 A;  2HWV A;  2XPU A;  4RGX A;  4HYE A;  1JT0 A;  9ANT A;  4PGG A;  3FK6 A;  1WKM A;  1KU7 A;  3I71 A;  5EYR A;  4HOB A;  2M0C A;  3FHZ A;  2E1O A;  3AG4 H;  4G8X A;  1EA3 A;  1TQP A;  2QQB A;  2UV1 A;  1X2M A;  2L54 A;  3F8F A;  3I55 I;  2LSO A;  3KEO A;  1R1V A;  2L01 A;  4CZC A;  4HX4 A;  5FKO A;  1FWZ A;  4A3F J;  1HF0 A;  1STZ A;  3T0Y A;  1ON2 A;  2PQ8 A;  3KE2 A;  3BTJ A;  3KLO A;  2MG4 A;  4L5I A;  1LEB A;  5LGT A;  1O57 A;  5HDG A;  1XMX A;  2NAZ A;  3KX2 A;  1X2N A;  3EUK L;  4ZDO A;  4A3L J;  2CW0 F;  1FTT A;  3OYN A;  1TQM A;  1YLF A;  1G3S A;  5A2Q K;  2HOA A;  1ZRF A;  1ITY A;  1IRZ A;  3RKY A;  1YJW I;  4BL0 B;  5K5Q A;  3SYT A;  4QPQ A;  4V19 K;  4HV5 A;  1TBX A;  3JRI A;  1YHQ I;  4UB6 C;  4EMS A;  1S6L A;  5E3N A;  1TLH B;  3DPT A;  3HOZ J;  1O7F A;  5E79 C;  2EA4 A;  5HOO A;  3JRA A;  4RA2 A;  2R5Y A;  2R3S A;  5JHU A;  5J8C A;  3CME I;  2COB A;  1MMN A;  3TKY A;  1OYI A;  3ABU A;  4G6D A;  1VQK I;  2HOS A;  2VLA A;  2XPV A;  2PEX A;  1MMD A;  4I6Z A;  3QWL A;  3QU3 A;  4C2M J;  1OCR H;  3V8K A;  2D5V A;  1QPM A;  2QF7 A;  1ON1 A;  1YIO A;  4FT8 A;  2Q8K A;  1RES A;  1H8A C;  3OSG A;  1BI1 A;  1QGP A;  1GXQ A;  1XMK A;  4J19 A;  4M9S A;  1BR1 A;  2VKV A;  5F08 A;  2ELH A;  2M7B A;  3GW2 A;  4KDP A;  3GTK J;  4LGW A;  2YR2 A;  2Q0O A;  1XPX A;  3RPU A;  5F0C A;  3ASO H;  5EZH A;  2PMZ N;  5IOZ A;  2GBY A;  3HPG A;  1FZP B;  2K7L A;  2M4K A;  2R7O A;  3DQV C;  3I4N J;  5IOY A;  3LWF A;  2FML A;  3JRE A;  4OIP F;  2TCT A;  4HBL A;  4XK4 A;  4KMU X;  3E1S A;  3F6O A;  4A3K J;  2BGC A;  2KIS A;  2KZG A;  4D5C A;  5KNL A;  2LH9 A;  3MKY B;  4M6V A;  1PDN C;  3S1M J;  3P9C A;  2QWW A;  4GDF A;  3RKW A;  3NWS A;  4A3B J;  5C4X J;  1NH3 A;  5LRS A;  1T0F A;  1R5H A;  4BE1 A;  3VYT B;  4B43 A;  3T8R A;  2QQA A;  4BY7 J;  4B1R A;  1JJ8 C;  2VKD A;  1CGP A;  1IRX A;  1LVK A;  3H5N A;  3ZMT A;  1ZRE A;  4QWQ A;  4M74 A;  4ZYH A;  5ICC A;  2COM A;  2EV5 A;  1IN6 A;  1A04 A;  3IAS 2;  5KK1 A;  4M9Z A;  3LFU A;  2KLO A;  1I3Q J;  3CJR B;  2HXO A;  4U0Y A;  1V3F A;  4XLN F;  5FFZ A;  2K4B A;  3PIP F;  2LNB A;  3GLX A;  1YS6 A;  5HDN A;  1D1A A;  3B73 A;  1KQ9 A;  2HPI A;  2DTZ A;  3P9I A;  5TIS C;  3LAJ A;  1IN4 A;  2QA4 I;  1H89 C;  3TDU C;  5FGM A;  5H6Q A;  3FXM A;  5GPC A;  2ZXJ A;  4ASN A;  2BY0 A;  3IP4 B;  3S93 A;  5IPA A;  4RAF A;  2L2O A;  5DCM B;  3TW7 A;  5FKM A;  2EZK A;  5D5U B;  4XMY A;  3HBL A;  2VC1 A;  3LA2 A;  4BY1 J;  1HKT A;  3IWF A;  3HIF A;  1MJB A;  2DLL A;  4Q48 A;  1ONV A;  1HW5 A;  3CP2 A;  3MCZ A;  1EJ9 A;  2DA5 A;  4RMN A;  3SEZ A;  3VWB A;  2PMU A;  3C3W A;  2ZJR F;  3CCV I;  3M4O J;  2DMT A;  4OAZ A;  3F8N A;  3V7S A;  3OYB A;  2KZV A;  3UKG A;  1SD6 A;  2M87 A;  3MVP A;  3V8L A;  1RR7 A;  4KMF A;  5HLI A;  2M4G A;  3FMR A;  3VYS B;  3TOB A;  2E2H J;  1AOY A;  2JVH A;  5JLX A;  1GXP A;  1VQ8 I;  3GZ6 A;  3GEZ A;  5M5X J;  1HSJ A;  1KON A;  4XLF A;  2EFW A;  2K9L A;  5FO5 A;  1W4M A;  5L3G A;  3BOQ A;  3KFW X;  4FX4 A;  1Z6R A;  4ZH4 F;  2GM4 A;  1FC3 A;  3AFH A;  3M1E A;  1LE8 B;  4CXF A;  1OCZ H;  3SQN A;  3SEQ A;  1E17 A;  1DP7 P;  2MW8 A;  3EQL F;  1IN7 A;  2QGU A;  4RB2 C;  1K78 A;  4AM3 A;  4LG0 B;  1TQI A;  1MW7 A;  3BQZ A;  2CQX A;  1QQI A;  4XLA A;  5B1A H;  5HLG A;  5L3F A;  2JRM A;  3W2V A;  2GQQ A;  3RQI A;  4ENJ A;  2DFE A;  3T5X A;  1E3O C;  4BEH B;  4P96 A;  4M3D A;  2A3S A;  4ZYE A;  4KIC A;  4ENK A;  1XCB A;  1MIJ A;  4N9H A;  4H0E A;  5CKT A;  1X3Z B;  4G12 A;  4ZDP A;  2IAI A;  3K10 A;  1Y56 A;  2IGM A;  1PYV A;  1Q1V A;  1HDD C;  3BR1 A;  4HZF A;  4D9J A;  1IG7 A;  3QOD A;  1Z7U A;  3HHG A;  4A3D J;  1TWH J;  3A0H C;  2E5N A;  3OYD A;  4DGW B;  3OMY A;  4BBR J;  5D5W B;  3CCM I;  2CQQ A;  4IHY A;  2OTJ I;  3MKZ A;  1ZQ3 P;  5CPR B;  3OS1 A;  1QA6 A;  3QQA A;  5B5E C;  3KIO A;  1JJ6 C;  3Q3S A;  1J7K A;  3EPZ A;  2M7A A;  1K7A A;  3HOV J;  3U9G A;  3WU0 A;  4AID A;  3GZN B;  1W0T A;  1P4X A;  3H1C A;  4Q47 A;  2CU7 A;  5EF6 A;  5HOD A;  2R93 J;  1USS A;  4DZJ A;  2NOG A;  2Z1D A;  4NHJ A;  2NOJ B;  2STT A;  2W7N A;  1T8I A;  4RGU A;  1A31 A;  1W5S A;  3QYE A;  2XB5 A;  2V26 A;  3JW4 A;  3PFY A;  4NDL A;  1U5T A;  3TQN A;  1YE9 A;  1V4R A;  3WTX C;  2K9Q A;  5ILV A;  5E3O A;  2FOW A;  3TBI A;  2AO9 A;  1IZ1 A;  3CUO A;  4XR6 A;  4OIQ F;  2IGO A;  3KYD B;  2LRD A;  1XN7 A;  4YIR X;  1IJW C;  2D1H A;  5ED4 A;  4HW0 A;  1BC8 C;  2VJI A;  3GTM J;  4M72 A;  1SMY F;  3HUG B;  1N78 A;  3QPL A;  2A6E F;  2VQL A;  3IH3 A;  3K70 D;  1ZRD A;  3K4M A;  4MO7 A;  2HQR A;  4U0V A;  4G7H F;  4A2U A;  3CCL I;  3KZZ A;  2KJB A;  3MFK A;  4BAC A;  1YJN I;  2NRA C;  4BJT A;  2BHY A;  1B59 A;  2WAQ N;  4LB6 B;  4GYG A;  2D1V A;  5J1U A;  3RI4 A;  4LLG F;  4XIC A;  4E4H A;  1U9N A;  4XN0 A;  1DU6 A;  4PJN A;  3A03 A;  4M9X A;  2L7M P;  4QTR A;  2WA0 A;  3NWT A;  4HG2 A;  1VQ7 I;  1BN5 A;  1IN8 A;  1FSH A;  4F91 B;  3HGG A;  1TWF J;  2M30 A;  1T08 B;  2H1K A;  3IRQ A;  3ABK H;  4PFP A;  4ESB A; 
#chains in the Genus database with same CATH homology
 5JVT A;  3CJN A;  2FE3 A;  2UXN A;  5FLX K;  3NRV A;  3TO9 A;  2A69 F;  4Y13 A;  1LDK B;  1JXS A;  4RAY A;  1IUY A;  4BYY A;  2BYV E;  2GIV A;  1U5T B;  3LAP A;  1JHH A;  2QEN A;  5FFX A;  4GCV A;  2P5L C;  3KEQ A;  4KA4 A;  4IF4 A;  2OQG A;  3VEP A;  2EK5 A;  2ESN A;  1IF1 A;  3BPV A;  4LLL A;  4KT5 C;  3LQR A;  3REO A;  4B8X A;  1YW7 A;  3EYY A;  4ZYG A;  1UHM A;  2ISZ A;  2CG4 A;  4CYD A;  2V79 A;  1ULY A;  1ZN2 A;  3P7N A;  1HW1 A;  1XDU A;  5D4S A;  4AIH A;  5EEH A;  1OPC A;  1ZLK A;  4IXA A;  2K86 A;  1O3T A;  1IXC A;  4ON0 A;  3J80 K;  3FF5 A;  4LK1 F;  5FD6 A;  4U7D A;  3O3K A;  1UCR A;  1U2W A;  1XGM A;  2HYF A;  5E18 F;  2XKO A;  2R7F A;  1H9T A;  4BAY A;  4CIC A;  1OYY A;  1JE8 A;  3KP2 A;  3P9K A;  5BS6 A;  3WTY C;  4HX7 A;  1IW7 F;  3GVA A;  3QPT A;  4G94 A;  2OQR A;  4IJA A;  2DFI A;  3GFM A;  2RN7 A;  1SD4 A;  1ZH5 A;  1RUN A;  2UXX A;  5EEG A;  3H3U A;  3SHF A;  2DQR A;  3WU1 B;  1K79 A;  1F5T A;  4I09 A;  2L02 A;  1P6R A;  4PZJ A;  1YFH A;  2ZNY A;  1G3Y A;  2RC4 A;  4OMZ A;  3C1D A;  6PAX A;  3PQK A;  3EET A;  1QO0 D;  1U3E M;  3LQQ A;  1XSV A;  3GUD A;  1XCV A;  3RYR A;  1NHA A;  4OIR F;  5J6X A;  3AAF A;  3RJP A;  3F8B A;  5DCM A;  2GAU A;  3E5Q A;  3HRU A;  5K5R A;  4P5O A;  3ML6 A;  1B4A A;  2HFH A;  1KU9 A;  1TNT A;  4ETS A;  1PP8 F;  3HRS A;  5K5O A;  3K69 A;  3LST A;  3WTZ A;  3E6B A;  3CUQ B;  2DK8 A;  2DI3 A;  2DK5 A;  1LNW A;  4RS8 A;  1XGN A;  2A68 F;  2IA0 A;  3JTH A;  2R7D A;  1AWC A;  5E17 F;  1TTY A;  2YSR A;  5FD5 A;  3VB2 A;  5E1X A;  3F8C A;  2EFN A;  4A0X A;  3IKT A;  2FBH A;  4A6E A;  4L9V A;  3BZ6 A;  3RIR A;  3I58 A;  2J5P A;  2VBY A;  3CO6 C;  5A2Q Z;  2A07 F;  2L4A A;  4IVN A;  4ENN A;  2IVM A;  3L7W A;  1R5G A;  3O6B B;  3FZV A;  1S3J A;  2H27 A;  2FNP A;  1W7P A;  4IRH A;  1K78 B;  3I59 A;  4MGR A;  1PP7 U;  4Z2Y A;  4EJV A;  1ODD A;  5CVV A;  4S05 A;  2V1U A;  3MWM A;  2PBI A;  2P4W A;  3WTS C;  1XSX A;  5LEJ A;  3QP5 A;  5ERI A;  1IXS B;  4MTD A;  3O2P E;  4XRF A;  1C0W A;  1P4A A;  2LDU A;  2HR3 A;  3F22 A;  1ZG5 A;  4HQE A;  5DD4 A;  1TNS A;  4FHT A;  4M6Y A;  3RYP A;  3S2W A;  4DNC A;  3ZMS A;  4JBA A;  1MGT A;  3KLN A;  3ABT A;  4A6D A;  4UVC A;  3J7A O;  2FF4 A;  2X4H A;  4IHS A;  1UB9 A;  1LDJ A;  2GA2 A;  3I4P A;  1FBU A;  4JQF A;  4L9T A;  2XRO A;  1WWX A;  2W57 A;  1BI3 A;  3TOA A;  5BOX A;  3BJA A;  1IAW A;  2W84 A;  1T6S A;  2ISY A;  4A0Y A;  1D8J A;  2MLG A;  1IRG A;  1YYV A;  1L3L A;  2DT5 A;  2OD5 A;  2H09 A;  2E1C A;  5JFR A;  4EJW A;  3K1P A;  1UHW A;  1S7O A;  2VN2 A;  1I5Z A;  5HDK A;  3I0T A;  3I64 A;  4P55 A;  1RNL A;  2D2W A;  2M5W A;  3FMS A;  3MAJ A;  4MEX F;  2KJC A;  2P7V B;  2XAQ A;  4HA8 A;  2F5E A;  2OA4 A;  3WE2 A;  2EJR A;  3TDZ C;  1J75 A;  4WCG A;  3ZN0 A;  5CVR A;  4AIK A;  3HRT A;  5KVR A;  2M45 A;  2IP2 A;  1H9G A;  4EM2 A;  1FYK A;  3E97 A;  2XAG A;  4KIG A;  5D8L B;  5D6F A;  5ICG A;  3BDD A;  4ESF A;  3Q5F A;  3ZN1 A;  2VT3 A;  3NQO A;  2VT2 A;  2BEO A;  5DDG A;  1XGS A;  1WI9 A;  4IHT A;  2ZJ2 A;  4OU0 A;  2XUB A;  2GZW A;  4EJU A;  1QZY A;  4JK1 X;  1BC7 C;  2HGC A;  4G7Z F;  2X0L A;  4LK0 F;  1B9M A;  1HW2 A;  3GX4 X;  1MJA A;  3QRF F;  2FA5 A;  3H3Z A;  3ZMV A;  4LB5 A;  2A5Y B;  2ZBK A;  5D4R A;  1SMT A;  2VOO A;  3FM3 A;  4XBF A;  1GVJ A;  2ETH A;  2M8E A;  2XVC A;  2BV6 A;  3JSO A;  3IKV A;  2F5C A;  2MH2 A;  3IWZ A;  4BQA A;  5DUI A;  1OYW A;  1O3Q A;  3T8T A;  1YTY A;  3ROU A;  2O03 A;  3ECH A;  2VOD A;  4KN7 X;  2VC0 A;  3GZ5 A;  3HSE A;  3KP7 A;  3WGI A;  3V8J A;  4YFX F;  4OIO F;  4L5J A;  2ACJ A;  1KYW A;  3WOD F;  1KQ8 A;  1LQ1 A;  1T98 A;  1LVA A;  3OOP A;  3T1B A;  4RB0 A;  4WXC A;  2QBY B;  4L9J A;  2ZFW A;  4KIF A;  3FWE A;  2QQ9 A;  2HKX A;  5D5V B;  3KET A;  2XGX A;  3J81 Z;  3ZQ7 A;  5LBQ A;  3KP6 A;  4KUM A;  2HOE A;  4CGZ A;  2FBI A;  2RV8 A;  4UV8 A;  1HKS A;  4XSZ F;  3ERE D;  2STW A;  2ZCW A;  3R60 A;  3N97 A;  1R58 A;  3GF2 A;  2XIG A;  4Y15 A;  3GFL A;  3MZH A;  1FBQ A;  1Z05 A;  3JSP A;  1U6G A;  3LA7 A;  5E20 A;  5DD8 A;  5J8F A;  4I7H A;  2FQ3 A;  2EFP A;  3CLO A;  1R22 A;  4WF2 A;  2KKO A;  4UVA A;  2VE9 A;  3R4K A;  2V1X A;  3I59 B;  4WXD A;  2QBY A;  1MKM A;  2G9W A;  2FMY A;  5LHG A;  4I02 A;  4AWX B;  3GO5 A;  1YW8 A;  3SXY A;  4O5V A;  5TJJ A;  4PGH A;  5F64 A;  3HUG A;  4G9Y A;  4I01 A;  4GYI A;  2GA1 A;  3QU6 A;  1ZAO A;  1R00 A;  3BPX A;  1WSU A;  3I54 A;  3DEU A;  2PI0 A;  1RUO A;  5F6F A;  2O6G E;  3C18 A;  2YX4 A;  4BHC A;  4RB1 A;  4LD5 A;  1J59 A;  3QPH A;  5HS9 A;  2JPC A;  4HF1 A;  4LG0 A;  1Z91 A;  1SFE A;  1BIA A;  4EM0 B;  3TO7 A;  3HSR A;  3J81 K;  2DAO A;  3KCC A;  4E70 A;  1G4D A;  1YW9 A;  1Z1D A;  3V7R A;  2FOK A;  3BWG A;  3C7J A;  1DDN A;  3KZY A;  3NEU A;  1MZB A;  2E1N A;  2VBX A;  3ECO A;  1R23 A;  2IJL A;  3E5X A;  2HZT A;  3ZPL A;  3GWZ A;  5F1R A;  1HBX G;  4HX8 A;  5H6R A;  4Q5S F;  2AS5 F;  3WTU C;  5IT9 K;  3FXR A;  4WWC A;  4A0Z A;  1F1Z A;  1P4W A;  1Z6T A;  3GFJ A;  2P5K A;  3G73 A;  5TRD A;  3KP4 A;  1VTN C;  5E1Z B;  2GXB A;  4HLY A;  5LHH A;  1F9N A;  3K9T A;  3CUQ C;  2V9V A;  2O8X A;  3OV8 A;  2QUF A;  2WTE A;  5DYM A;  2VOP A;  4IRI A;  3L9F A;  2WC2 A;  4RGR A;  4EVI A;  1FT9 A;  4UHT A;  3R6S A;  1XDS A;  2HTJ A;  2MD5 A;  3M7G A;  3IL2 A;  3EDP A;  1UST A;  4HF0 A;  3BY6 A;  1ZG3 A;  3IC7 A;  2NYX A;  1TW3 A;  3WTW C;  4BNC A;  2QM3 A;  2HDC A;  3M8E A;  1S29 A;  2UWM A;  3HSF A;  2MBF A;  1LEA A;  2ZKZ A;  3HTU A;  3WE3 A;  4KN4 X;  1ZAR A;  1DPR A;  4YII A;  4HV6 A;  3WTV C;  3BRO A;  2P6T A;  3R61 A;  5HS8 A;  4HDU A;  1FYM A;  1U8R A;  4NQW A;  3SZP A;  2FRH A;  4AD9 A;  2KIU A;  2P8T A;  5D6E A;  1HKQ A;  3QOP A;  4O3M A;  4M71 A;  3RTR A;  2P6S A;  2CFX A;  1T39 A;  1KGS A;  2JT1 A;  2IA1 A;  3E3V A;  4S04 A;  4GO1 A;  2XV4 S;  3LFK A;  2FBK A;  4I98 B;  2FNA A;  1X3U A;  1MDM B;  5L3B A;  4RB3 C;  4XSX F;  3IHU A;  3E6D A;  1G6N A;  3DKW A;  4PDK A;  3V4G A;  2V1D A;  1R36 A;  4NB5 A;  4ZYD A;  1JHF A;  5E8I A;  3CO7 C;  1SFX A;  4L18 B;  4WXH A;  3VFZ A;  1T38 A;  3K1N A;  2HS5 A;  3F8M A;  1ZHF A;  1I6X A;  4AIJ A;  4LLN A;  1ZYR F;  2JRT A;  1REP C;  5LGU A;  2MH9 A;  1LJ9 A;  3DPL C;  1G3T A;  2RVC A;  4U7B A;  2CWE A;  2QYO A;  5FLX Z;  4EJO A;  4UUV A;  4MEY F;  2PJP A;  2DW4 A;  2P5V A;  3N4M A;  2G7U A;  1I1G A;  1R1T A;  5AON A;  4B09 A;  4EGY A;  3ZMZ A;  2Z33 A;  1F4K A;  2UZK A;  2A6H F;  3D5L A;  5LHI A;  1BBY A;  2DQL A;  4MHG A;  4OOI A;  1SFU A;  1FYL A;  1L0O C;  2H94 A;  1R7J A;  2PN6 A;  1QBJ A;  5BPD A;  2XAJ A;  4MNU A;  5DCF A;  2F5F A;  2QZ8 A;  1FPQ A;  3COA C;  4XLP F;  3K0L A;  1IXR C;  2W25 A;  3JAM Z;  5FB2 A;  2EV0 A;  3TGN A;  4FX0 A;  4N0B A;  1J0R A;  5E1W A;  1EH6 A;  4I0A A;  4M73 A;  2W85 A;  3FXU A;  4ESJ A;  1ZGJ A;  5H20 A;  3I53 A;  3ISP A;  4CHU A;  3K1M A;  5HS7 A;  2DPD A;  5ILU A;  3PQJ A;  3Q9V A;  5L3E A;  3ZP5 A;  3GYH X;  2CYY A;  1HQC A;  1FP1 D;  2G7H A;  1GHC A;  1CF7 A;  1HXD A;  2E7X A;  1SD7 A;  4K2E A;  2F2E A;  3DXJ F;  2XKP A;  5ICE A;  1J2X A;  2QVO A;  5BMZ A;  3DP7 A;  4CO8 A;  1T2K A;  4M6X A;  5D8K B;  1Z9C A;  1D8K A;  2ESH A;  2E7W A;  4I0B A;  5LEK A;  1B9N A;  1YS7 A;  3VOE A;  5JI6 A;  3SFZ A;  3H92 A;  2EWN A;  2AXL A;  3WTT C;  1XSD A;  1O3S A;  1YG2 A;  3ZMD A;  2OAZ A;  2EFQ A;  4P9U A;  1YQA A;  1ZGA A;  2XRN A;  2Z9O A;  5AIP A;  5DEQ A;  4GXO A;  1BI2 A;  2Q2E A;  4HQM A;  2O3F A;  3FX3 A;  3HTS B;  4Y17 A;  2CQK A;  3QP6 A;  4PCQ A;  1BM9 A;  2FU4 A;  2VE8 A;  2V6C A;  3M9A A;  1UFM A;  4OIN F;  2Z3Y A;  3HOS A;  2H6C A;  3RKX A;  5K1Y A;  2K27 A;  4R1H A;  2YU3 A;  3R0J A;  2Y75 A;  1Q1H A;  1I27 A;  3DF8 A;  3CUQ A;  4WX9 A;  3JAM K;  3L2C A;  2OU2 A;  2XHK A;  4BXU A;  2A61 A;  4KIB A;  4ZZL A;  4I2O A;  2OZU A;  3ZMU A;  4HDV A;  2GWR A;  3R0A A;  2RGV A;  4BH9 A;  4YG2 F;  1FSE A;  2W24 A;  2XAH A;  3MEX A;  1DPU A;  4EGZ A;  2Z5U A;  1LDD A;  2ZNZ A;  3V7C A;  2WWY A;  4LFU A;  1O7L A;  1BI0 A;  1B1B A;  5L3C A;  1TW2 A;  2MC3 A;  2Z99 A;  2WV0 A;  3IRR A;  1W7P B;  2IPQ X;  3F6V A;  5DUK A;  2DPU A;  2RNJ A;  2LKP A;  3HYI A;  1G3W A;  1S7A A;  2JSC A;  2H6B A;  4YFK F;  3WGH A;  1XD7 A;  3FMQ A;  3EYI A;  2CGP A;  2NNY A;  1RIO H;  3D0S A;  1I1S A;  4YIF A;  2HQN A;  4L0Y B;  3HOT A;  3HHH A;  3G3Z A;  1ZLJ A;  5BPI A;  4U88 A;  3L00 A;  1KYZ A;  4KNY A;  3WGG A;  2M1B A;  4U0W A;  3PFI A;  2ZME A;  2IW5 A;  4D0P A;  5LRR A;  1QNT A;  4CDG A;  1OR7 A;  4Q4Z F;  4N9I A;  1IN5 A;  3CDH A;  3EUH A;  1RZ4 A;  4F7Z A;  1OKR A;  1W7P D;  1K6O A;  1B6A A;  4R79 A;  4UVB A;  4IRG A;  5E8G A;  2QLZ A;  2RQP A;  1KU2 A;  4UNO A;  1EV7 A;  4HAM A;  3E5U A;  4IPA A;  1Y0U A;  2PFB A;  4A12 A;  3HRM A;  2EV6 A;  4WK8 F;  3E6C C;  2ADU A;  2VBW A;  3L09 A;  3TO6 A;  3J80 Z;  3CTA A;  4ENM A;  4GGG A;  4G7O F;  2JTV A;  2OZ6 A;  4O6J A;  2Y0M A;  2B0L A;  4BHB A;  2K02 A;  4HLX A;  5L3D A;  1O3R A;  4TV7 A;  2DBB A;  1FLI A;  2VXZ A;  3B02 A;  4MQV A;  2XAS A;  1OMI A;  5IT9 Z;  1PUE E;  2IT0 A;  4QLC U;  5LGN A;  5DV5 A;  5HLH A;  3KP5 A;  2BBY A;  3F72 A;  2ZME B;  1H0M A;  1KQ0 A;  2NS0 A;  2O0Y A;  3QAH A;  2PLY A;  4UXN A;  4MQ9 F;  2L4M A;  5CJ9 A;  5CLS A;  4EV0 A;  4CZZ A;  3W6K B;  1U78 A;  1EH7 A;  5CYV A;  1XGO A;  2FXA A;  2KIM A;  1BJA A;  1HST A;  4L9N A;  3LA3 A;  1E2X A;  4KYW A;  2P7C B;  3RPQ A;  1CF7 B;  2YPR A;  3MQ0 A;  1SD5 A;  3FXQ A;  4HF2 A;  2HTS A;  4EQQ A;  1FP2 A;  2PMH A;  1R1U A;  5AIQ A;  1BOA A;  2NNN A;  1MJ9 A;  2D45 A;  2VBZ A;  2Y48 A;  4UV9 A;  1MD0 A;  2VON A;  2MLK A;  2TDX A;  3VOD A;  2BE5 F;  2O61 A;  3BJ6 A;  3JTG A;  1LB2 A;  2F5D A;  2DTR A;  5LLQ A;  4LJZ F;  2C6Y A;  1RI7 A;  2JZY A;  3W6J B;  1D5V A;  1W5T A;  4EM1 A;  4OMY A;  1FBS A;  3Q9S A;  3U1D A;  4MTE A;  4L0Z B;  2FEZ A;  1BIB A;  1FNN A;  1S8N A;  1JGS A;  1ZRC A;  4ZZD A;  5CVI A;  2JPB A;  2YX7 A;  4P9F A;  3K2Z A;  4RGS A;  1WQ2 A;  4R8H A;  2KRF A;  2RDP A;  3KP3 A;  1P92 A;  1J5Y A;  1IRF A;  3SZT A;  2RKH A;  1J9I A;  4KFC A;  1YO5 C;  3ELK A;  2XAF A;  4A5M A;  1ZG1 A;  3F3X A;  1XB4 A;  2EA2 A;  4A5N A;  4BHP A;  3RDI A;  5CVU A;  2GXG A;  4AVP A;  1SAX A;  2CO5 A;  2EB7 A;  3GXO A;  1FOK A;  1D3Y A;  2LF7 A;  2IRF G;  4EJT A;  1DUX C;  2EFO A;  1P2F A;  2L3D A;  3ULQ B;  1EH8 A;  2FSW A;  4YFN F;  4LMY A;  2DU9 A;  3M8F A;  1FY7 A;  1QZZ A;  3F21 A;  3GFI A;  3DFG A;  2ZO4 A;  2OBP A;  1KU3 A;  1WRJ A;  1FX7 A;  4DQ2 A;  2MA3 A;  2K4J A;  2HYG D;  2CSO A;  3I5U A;  2DO7 A;  2PG4 A;  2LF8 A;  3U2R A;  5ICF A;  1U5T C;  5D5X B;  5ILS A;  1XMA A;  4RAZ A;  3WG9 A;  3DV8 A;  2J5O A;  5JR3 A;  1KA8 A;  4G6Q A;  1MDM A;  3F23 A;  5BQT A;  3BP8 A;  3BJO A;  3E6M A;  5CVJ A;  3MZY A;  5HVQ C;  2KIF A;  3FM5 A;  2IA2 A;  2HEO A;  2HKO A;  5IT3 A;  2HWV A;  4RGX A;  4HYE A;  4PGG A;  1WKM A;  1KU7 A;  3I71 A;  4HOB A;  3FHZ A;  4G8X A;  1TQP A;  2QQB A;  2L54 A;  3F8F A;  2LSO A;  3KEO A;  1R1V A;  2L01 A;  4HX4 A;  1FWZ A;  1STZ A;  3T0Y A;  1ON2 A;  2PQ8 A;  3KE2 A;  3KLO A;  4L5I A;  1LEB A;  5LGT A;  1O57 A;  5HDG A;  2NAZ A;  2CW0 F;  1TQM A;  1YLF A;  1G3S A;  5A2Q K;  1ZRF A;  3RKY A;  5K5Q A;  4HV5 A;  1TBX A;  4EMS A;  1S6L A;  1TLH B;  3DPT A;  1O7F A;  2EA4 A;  5HOO A;  2R3S A;  5JHU A;  5J8C A;  3TKY A;  1OYI A;  3ABU A;  4G6D A;  2PEX A;  3QU3 A;  3V8K A;  1QPM A;  1ON1 A;  1YIO A;  4FT8 A;  2Q8K A;  1BI1 A;  1QGP A;  1GXQ A;  1XMK A;  4M9S A;  2ELH A;  3GW2 A;  4KDP A;  4LGW A;  2YR2 A;  2Q0O A;  3RPU A;  1FZP B;  2K7L A;  3DQV C;  3LWF A;  2FML A;  4OIP F;  4HBL A;  4KMU X;  3F6O A;  2BGC A;  1PDN C;  3P9C A;  2QWW A;  3RKW A;  5LRS A;  1T0F A;  1R5H A;  3T8R A;  2QQA A;  1CGP A;  3ZMT A;  1ZRE A;  4QWQ A;  4M74 A;  4ZYH A;  5ICC A;  2COM A;  2EV5 A;  1IN6 A;  1A04 A;  5KK1 A;  4M9Z A;  4U0Y A;  1V3F A;  4XLN F;  5FFZ A;  2K4B A;  2LNB A;  3GLX A;  1YS6 A;  5HDN A;  3B73 A;  1KQ9 A;  3P9I A;  3LAJ A;  1IN4 A;  3TDU C;  5FGM A;  5H6Q A;  2ZXJ A;  4ASN A;  5DCM B;  5D5U B;  2VC1 A;  3LA2 A;  1HKT A;  3IWF A;  3HIF A;  1MJB A;  2DLL A;  4Q48 A;  1ONV A;  1HW5 A;  3MCZ A;  2PMU A;  3C3W A;  3F8N A;  3V7S A;  1SD6 A;  2M87 A;  4KMF A;  3V8L A;  5HLI A;  3FMR A;  3TOB A;  1AOY A;  1GXP A;  3GZ6 A;  3GEZ A;  1HSJ A;  2EFW A;  5FO5 A;  1W4M A;  5L3G A;  3BOQ A;  3KFW X;  4FX4 A;  1Z6R A;  4ZH4 F;  1FC3 A;  3M1E A;  4CXF A;  3SQN A;  1E17 A;  1DP7 P;  3EQL F;  1IN7 A;  4RB2 C;  1K78 A;  4LG0 B;  1TQI A;  1QQI A;  5HLG A;  5L3F A;  2GQQ A;  4ENJ A;  3T5X A;  4P96 A;  4ZYE A;  2A3S A;  4KIC A;  4ENK A;  1XCB A;  4N9H A;  4H0E A;  4HZF A;  1Z7U A;  3HHG A;  5D5W B;  1J7K A;  1K7A A;  3U9G A;  3WU0 A;  1P4X A;  4Q47 A;  1USS A;  4NHJ A;  2STT A;  4RGU A;  1W5S A;  3JW4 A;  1U5T A;  3TQN A;  1V4R A;  3WTX C;  5ILV A;  1IZ1 A;  3CUO A;  4OIQ F;  1XN7 A;  2D1H A;  5ED4 A;  4HW0 A;  1BC8 C;  4M72 A;  1SMY F;  2A6E F;  1ZRD A;  4G7H F;  2HQR A;  4U0V A;  4A2U A;  3KZZ A;  2KJB A;  3MFK A;  2NRA C;  1B59 A;  4LB6 B;  3RI4 A;  4GYG A;  2D1V A;  4LLG F;  4M9X A;  1BN5 A;  1IN8 A;  1FSH A;  2M30 A;  3IRQ A;  4ESB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...