2MG4A

Computational design and experimental verification of a symmetric protein homodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
MEKRPRTEFSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRRKEQQIGWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Computational designed homodimer
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags De novo protein
total genus 17
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mg4A00
1IJWC 4A69C 2I10A 5C3EJ 1RESA 3NARA 4XIDA 4C2MJ 3MVPA 4A3GJ 4A3LJ 5EDNA 2M2EA 2EZIA 3HKZN 2QCOA 1I6HJ 4X6AJ 1LE8A 2Y0SN 2K9QA 3FKIJ 2Y2ZA 3F0CA 3OSGA 2TCTA 4D7MA 5FLVA 5GP9A 2E19A 2JA6J 5EGOA 1TC3C 4A3IJ 5JLWA 4M3BA 2LR8A 2NOGA 2YUSA 4MLOA 4RBOA 1VI0A 4A3JJ 1U78A 3GTOJ 2JMWA 1HF0A 3GTGJ 2HQ5A 4A93J 1JKOC 1I50J 3MKLA 2E1OA 5F0FA 2K40A 2ECBA 3IV5A 4S0HB 4L5EA 4I6ZA 4A3BJ 4BY1J 1F43A 1X58A 1P7IA 2M0CA 2WB1N 3HGGA 4B4CA 2GBYA 3Q0UA 1W0UA 1ETXA 4FE7A 1B72B 2DMQA 2VPRA 2X9DA 4FISA 3ZOBA 4XICA 2W48A 1B8IB 1VF9A 3IH4A 1MSFC 1FTZA 3ZQIA 1AKHA 1U9NA 1MBEA 4V2FA 1AKHB 1EF4A 1ETOA 3M3YJ 4D7NA 1FEXA 1ENHA 2E2JJ 5K7HA 2CRGA 2XB0X 1ZK8A 2DA6A 2ID6A 1JJ6C 4AC0A 1IDYA 4HNVA 5F0HA 3S1QJ 1BA5A 5M5WJ 1OCTC 3QPLA 3IH3A 2OPTA 4FE4A 3TW7A 1NK2P 1JT6A 3IH2A 3O8HA 1IV6A 2R5ZA 1I3QJ 2EZKA 2R5ZB 2RAEA 1MBGA 2NVTJ 2Y9YA 4UUSA 3E7LA 5F04A 1WCMJ 1FIAA 4UUSB 3S15J 3Q3SA 2IBDA 2WAQN 4AUXA 1POGA 2DMUA 3ZQHA 5EF6A 2EBIA 2JA8J 4XK4A 2DA4A 4V2GA 2NVQJ 1ETKA 2N8GA 4X1EA 1HLVA 2XSDC 4DYQA 2YS9A 3I4MJ 2D5VA 2COBA 3G1LA 2MG4A 3W6VA 1WI3A 1Z77A 3UKGA 1G2HA 2WV1A 3CMYA 5IOYA 1OFCX 1QRYA 1T56A 1WH5A 2EZHA 3BR5A 5J3LA 3JREA 5GPCA 3JRDA 2K9SA 5EZHA 1MBFA 1IDZA 3BTCA 1ETYA 3OIOA 1ZQ3P 1ZR4A 2CQXA 4B3AA 4MFDA 1MH4A 5IP6A 5IOZA 1JTYA 3PM1A 4XRSG 3H0GJ 4JYKA 2LKXA 2DMNA 2IAIA 2NS7A 2X6OA 3HGYA 3MN2A 5K7ZA 5C4JJ 4DYCA 3BQZA 1K61A 4QIWN 2IEKA 1QVTA 2JK3A 1RETA 4Y7NJ 3A02A 4M3FA 3TW6A 1PUFB 1RKWA 3ZQLA 4M3EA 1JTXA 1VFCA 3GTPJ 2EZLA 3LNQA 2G0EA 4EEFG 2XB5A 1MBHA 5F08A 2KDZA 1W0TA 4IHWA 5HODA 1LFUP 1HDPA 4M3GA 3Q0VA 2E2HJ 3GTKJ 1YRNA 5F1JA 2HDDA 3LSPA 3GTJJ 1MBKA 1YRNB 1JKQC 1UHSA 1K83J 1A5JA 1NTCA 2R0QC 4C3JJ 3HOYJ 3M4OJ 2NVYJ 3RZOJ 3WHBA 1TWGJ 3BG3A 1ZTRA 4C3IJ 3BTLA 2NS8A 2ME6A 1RKTA 5BNGA 1B72A 1ZKGA 2HOAA 5F27A 3QPSA 4I76A 3O8GA 5M3FJ 4FCYA 1B8IA 1ETWA 3ZQGA 3LOCA 2ID3A 1Z0XA 3S1NJ 3S17J 3C2BA 4GFBA 1JUPA 3BTJA 4BBSJ 1ORKA 2JJ7A 1APLC 3ZQFA 1GT0C 3FK7A 3HM5A 3B6AA 3L1PA 2EH3A 5J1YA 2OF7A 5FLMJ 4JX4A 2L7FP 3D1NI 2R92J 3OOUA 1XS9A 1IC8A 9ANTA 3HB9A 1GVDA 3S1RJ 1JKRC 1IGNA 3VPRA 3RZDJ 1MSEC 1RR7A 2L9RA 4JP0A 1AHDP 2HI3A 4Y52J 2M8GX 1IG7A 2KT0A 1SFOJ 2LP0A 1XG1A 3CQZJ 4MIMA 1E3OC 5E3NA 3LSRA 4BXXJ 5EG0B 4IEJA 2DA3A 5JLXA 4W97A 1JUMA 5FKNA 2GLOA 4AYBN 2GM4A 1ZR2A 1IUFA 1Y1WJ 5M3MJ 3S2HJ 1WH7A 1ITYA 1X2MA 1OJLA 1HOMA 1MH3A 4D5FA 5E3LA 1U9OA 3NAUA 1JJ8C 2L0KA 1JUSA 5DS9A 4CYCB 3GTLJ 2VKEA 4G12A 3BR3A 2LTPA 4A3MJ 1T33A 2HYJA 3BR6A 4QTRA 3FISA 1TWFJ 1DU6A 5M5YJ 3TEDA 2O7OA 5E3OA 2DA5A 5IPAA 1H8AC 3S16J 2E2IJ 2AHQA 5F0CA 3DCFA 3SDGA 2JN6A 2DJNA 4A3KJ 3PO2J 2HOSA 2LVSA 2XPUA 5DTDA 5FKKA 3BG9A 1D5YA 1FJLA 2VI6A 4NDLA 2Y31A 5E3MA 4D5CA 1X2NA 2HXOA 1BJZA 2FJ1A 5EZGA 4XRSA 3A01A 2LD5A 2Y9ZA 3HOWJ 3A01B 1VNDA 3BQYA 2CUEA 1PUFA 3RQIA 2FQ4A 1A6IA 2VUMJ 5IYDJ 5M5XJ 2NVXJ 5IP9J 3JRBA 5IYCJ 5C44J 2CU7A 1P7JA 2JA7J 2HOTA 2DA7A 5C4XJ 4M3DA 4IHVA 2MSYA 3A03A 2R93J 3HDDA 3GTQJ 2QF7A 3HOUJ 3JRFA 1FTTA 3HOZJ 1DU0A 2H8RA 1LE8B 1QVUA 3FK6A 4UUTA 1JKPC 1Q1VA 2CUFA 5IP7J 1UG2A 5EEAA 1GV5A 3HOVJ 2FD5A 1O4XA 3FIWA 2X48A 1GUUA 4RDUA 3JRGA 1WGXA 2B63J 3BTIA 2H1KA 4IHYA 2XRLA 2XPWA 5EGOB 1BW5A 1OCPA 2LFBA 4QSHA 4BBRJ 2JA5J 3H3VK 2DTZA 4JX5A 4DZJA 2HXIA 2Y30A 3BT9A 1FIPA 2VKVA 4B1RA 4J19A 1RPWA 2AO9A 3GTMJ 3LSGA 3K2AA 1MNMC 4MO7A 4FTHA 2YU9J 3G1OA 3DEWA 2ZB9A 1R9TJ 2O8KA 2R7ZJ 1BL0A 2XGDA 1F36A 1WPKA 1BW6A 2M9HA 4LOCA 3OSFA 5K7FA 2P81A 4BKXA 3K7AJ 2R5YA 3SFIA 4DYRA 3JR9A 2R5YB 4A3EJ 4W1UA 3PO3J 2DMPA 1S7EA 2PMZN 3JRCA 3CCYA 1H89C 1JT0A 1XC5A 1TWCJ 3LSJA 1ETVA 2L7ZA 2EQRA 3I4NJ 4XRMA 5EG0A 5EYRA 2JWTA 3JRHA 2L7MP 2LK2A 5FKOA 4A3FJ 3TP3A 1CQTA 1H88C 3S14J 1U8BA 2CQQA 1NK3P 1ETQA 1ZGWA 2ECCA 3S2DJ 3TP0A 2DMTA 4A3CJ 5IYBJ 1LFBA 5J1UA 4ABZA 3RKQA 1GV2A 3CDLA 3BR1A 1HCRA 5GPAA 4JX6A 4CYCA 2DN0A 2XGEA 1IRZA 4BY7J 5FKMA 1QPIA 4DZPA 3HEFA 3SJMA 2ELKA 4MFEA 1AU7A 3Q0WA 1GDTA 2MW8A 3BG5A 2XGCA 1TWAJ 2DA2A 2DA1A 4M6VA 3HOXJ 3QQAA 3S1MJ 2LY9A 1MBJA 4IHXA 2CJJA 3B6CA 3BR2A 4A3DJ 2XPVA 2ME0A 1Y1VJ 3ZQCA 1JGGA 5FJ8J 2M34A 2TRTA 3HBLA 3JRIA 2LLKA 3G1MA 3GBGA 5FKLA 4DW6A 1UMQA 3BR0A 3JRAA 2FX0A 3WHCA 1HDDC 4C3HJ 2O9LA 1SANA 5J1RA 2K9NA 2MGQA 1TWHJ
chains in the Genus database with same CATH superfamily
2V26A 5LHHA 5C3EJ 1HKTA 3H35A 3F8NA 3TDUC 2RNGA 3TBIA 1D3YA 2ZSIB 2O8XA 4D1QA 3SYTA 2DCEA 2F5DA 4A3LJ 3HPGA 5EDNA 2OTJI 2M2EA 4XKWA 2CW7A 3CCLI 1ULYA 1LE8A 3H3ZA 1X3ZB 2LDUA 2Z1DA 3ESWB 3FKIJ 5HNFA 2VODA 5TGTA 3IHUA 1BR1A 3OSGA 1MIJA 3D5SC 3SZPA 1DUXC 3T8RA 2E7XA 2JA6J 1BM9A 5L3FA 2LR8A 4MLOA 4MTEA 5H20A 3DU6A 2JMWA 4HPQA 1QZYA 3LAPA 2Y48A 3MKLA 2E1OA 2LNBA 3FHZA 5TRDA 2CS3A 2KISA 4I6ZA 1LB2A 1LDJA 4BY1J 2DJIA 3DTKA 3QRFF 2E36A 2G7UA 3VOEA 2WB1N 2PLYA 3S2WA 2JTVA 1LJ9A 1LVKA 2GBYA 3KYDB 3WU1B 4OIRF 3QWLA 1X1CA 2VKHA 1Y0UA 2X9DA 1HA8A 3S3MA 2O0YA 3F6VA 3ZOBA 2VBZA 4XICA 2GWRA 3OIQA 5TJJA 1B8IB 3BDDA 1YG2A 1VF9A 5HS9A 1JE8A 4XKBA 4BXFA 3F21A 3I3LA 3K4BA 1MSFC 1AKHA 1SAUA 2EFNA 1EF4A 1NHAA 3OYEA 4XRFA 4XN0A 1Z91A 2D45A 4CZZA 3VB2A 4D7NA 2ISZA 2XGXA 2J5OA 2XHKA 2CRGA 2Y75A 4E6KG 5K7HA 1XX5A 1FLIA 1E17A 2PX9A 4IQJA 1HKQA 1SD6A 4BHPA 3RDIA 1EJ9A 4YIIA 3J81Z 5L3DA 1BA5A 3ZMDA 1OCTC 4RLQA 4Z2YA 1S5LC 1WFXA 2PI0A 1TW3A 3IH3A 1BIAA 2OPTA 2F4OB 1Z7LA 2EB7A 3IWZA 3P9IA 2Z9OA 4MNUA 1D5VA 4HBLA 2V9PA 1IV6A 2L9NA 3DBRB 1TBXA 2A05A 2AQFA 4E4HA 2R5ZB 3ZGKA 1MBGA 1VTNC 2Y9YA 4RB1A 1D0XA 1FIAA 4EM1A 4RB3C 4UUSB 3G73A 3S15J 1Y8QB 2IBDA 5J6XA 1XSXA 2GXGA 3W6JB 1POGA 5EF6A 3KZIC 3VYRB 2EBIA 1OPCA 5D6EA 4XK4A 3BZCA 1X1PA 2DA4A 3CCVI 5ICCA 2K3PA 2XC7A 1ZG5A 5DCMB 4KISA 2ZFWA 3SDBA 2IT0A 2COBA 4L9TA 1WJAA 3E6DA 1WI3A 2Z99A 2CFXA 3SHFA 4ZZDA 3BOQA 5L3EA 2ESNA 3CMYA 1RR8C 2BY0A 5IOYA 1T56A 1WH5A 3D5RC 5J3LA 1HW1A 1LDDA 1YOVB 5GPCA 2WADA 3RSNA 4F3QA 3QU6A 1Z6TA 1ETYA 3OIOA 3I0TA 1R1VA 1B1BA 4MFDA 4CUGA 3LAJA 3L2WA 4XM3A 1ZGAA 5IP6A 1R49A 4YIFA 2IW5A 1LPQA 2OQGA 2DDAA 2DMNA 5C4JJ 5K7ZA 3WODF 3LA7A 4ENNA 1T0FC 1AA7A 4DBQA 3SEZA 4DYCA 1OCZH 2OUMA 3JTHA 2IEKA 4J01A 2ZFUA 2UV1A 5J4YA 2WAFA 1QVTA 2A6HF 4NNJA 3VYUB 4IRIA 1OMIA 5FFZA 1N25A 3ZXSA 4BEHB 1EH6A 5LD2C 2HWVA 4UVCA 1RKWA 2VL8A 3ZQLA 4LK1F 3A1YA 3QOPA 1JTXA 4M3EA 1VFCA 1CF7B 3I5UA 3CO6C 1W0TA 3FBIB 3GTKJ 4HDUA 5HODA 4LIUA 4LJZF 2BHZA 2M1BA 4IO9F 2XAJA 2G7HA 3HL2A 2K3FA 2EIMH 2HZTA 1VQMI 1UHSA 2HOEA 2R0QC 1Z7UA 1B9NA 4C3JJ 1EKEA 2L54A 4UHTA 4BACA 2QQ8A 4GCVA 5E8GA 1ZKGA 4EJTA 2HPIA 3MMYB 2AQEA 2RGVA 4EJWA 1QA6A 3CDIA 1XGMA 1IAWA 4FCYA 1DDNA 1HSJA 2XF5A 1K6OA 1UHMA 3IC7A 2FEZA 3S1NJ 2WC2A 2GAUA 2ZCWA 1HSTA 3C2BA 3ONQA 4BBSJ 4BE0A 3LA2A 2JJ7A 2K9LA 2ESHA 3DFGA 3FK7A 1PDNC 4ZTFA 4LB5A 2VBYA 2YX4A 3HM5A 4NC8A 4A6DA 2JPCA 2OF7A 5FLMJ 2MD0A 5DCFA 3D1NI 4EMSA 4M6XA 2XAUA 1XS9A 1BJAA 2VIXA 3CP2A 4CCOA 5KAFC 3HB9A 4HX7A 5IT3A 1GVDA 4X0GA 2M4GA 3DKWA 1J0RA 1HXDA 2P7CB 1FBQA 2VE8A 4JP0A 3OS0A 4Y52J 3CF5F 2M8GX 4RGUA 3TO9A 1UB9A 4D9JA 4Y15A 2H6BA 2DK5A 3LSRA 2VOPA 2LF7A 1YTYA 2DA3A 3AFHA 2BV6A 3LFUA 5FKNA 2GLOA 4L0YB 3GZ6A 1KA8A 4A5NA 2V9KA 1IN5A 2Y69H 3HSFA 3ZMVA 1Y1WJ 3LSIA 2CUZA 4BQNA 3U1KA 3RI4A 1S29A 2DFFA 3S32A 3OYJA 5LRSA 1WVRA 3KPHA 1R23A 3VSLA 4L0ZB 3DXJF 4P9UA 1O7LA 4OAZA 3ZP5A 4XBFA 1JUSA 1MJ9A 4XOPA 4OMZA 4JOMA 3PL8A 4CO8A 5B3SH 2XAHA 3P9KA 3RCOA 1LEAA 3KETA 3BLYA 3BR3A 1I3AA 2DODA 4A3MJ 1WWXA 4WX9A 3FXOA 3RKWA 1RIOH 2V7FA 1U5TA 2X6XA 4O3MA 4A0ZA 2V1DA 2DA5A 4GYGA 1O57A 3MWMA 1KQ8A 2CV2A 4L9JA 3U2RA 2JRTA 1W7PA 2IJLA 3HOTA 4WXHA 1T8IA 2ZMEC 2AHQA 2JN6A 3KZYA 1TTYA 1PUEE 3PO2J 3PNTA 3KEQA 4H0EA 1W36C 1WJEA 2XPUA 1J2XA 5DTDA 3OYLA 5FKKA 3BG9A 2KP6A 2LYCA 4OWRB 1D5YA 3IUOA 2HXOA 5EZGA 2L9SA 3HG9A 5BPIA 4AVZA 3L9FA 4ZJZA 2IVMA 3DEEA 4B47A 5IP9J 3JRBA 1PP7U 2BHYA 3KEYA 5LEKA 2CU7A 1P7JA 2JA7J 4QLCU 1RC9A 1X3WB 2Z5UA 2EA4A 2OCCH 4E7ZA 2MSYA 2YU3A 1XDSA 3GMEA 5F64A 3GTQJ 4AIJA 3ZMZA 3DWLE 3WGIA 1FTTA 1IXCA 2ICWG 4NBQA 3EUHC 2H8RA 1LE8B 1I6XA 1KQ0A 2LH9A 3FK6A 1JKPC 1Q1VA 1IN6A 5HDKA 1J75A 4YIRX 2FD5A 1O4XA 1XDUA 2CFOA 2Z3YA 3M1CA 5K5OA 4RDUA 2GXBA 2XKPA 2ZSHB 5ICGA 1Z6RA 3VEPA 1SMTA 4BL0B 2M45A 4UV9A 5E8IA 2Q8KA 1VQPI 1R58A 1OCPA 2CO5A 2IS2A 1RNLA 2MYSA 4BBRJ 2HNHA 4JX5A 3MCZA 2EIJH 2Y30A 3BT9A 4A2UA 4B1RA 1RPWA 2AO9A 4OIPF 2K5CA 2WBMA 5LEJA 4C2UA 2LREA 4FTHA 4RGXA 2ZKZA 3GWZA 3QYFA 1MNEA 2VOOA 2ISYA 3W6KB 3G1OA 3J7AY 2ZB9A 1BL0A 2XGDA 4IHSA 4LIVA 2EFQA 5A2QK 4CCJA 2BEOA 2M87A 2BY2A 2V79A 4CSWA 3DEUA 3M9AA 2R5YB 2TDXA 1DGWY 4M73A 1MGTA 3VYTB 3PO3J 3FMQA 4AM3A 2CQ7A 3F8MA 1S7EA 2IA0A 3PUBA 1F4KA 1VQLI 2EPFA 5EG0A 2VONA 4BJTA 2KHMA 4G6QA 4I2OA 1REPC 2L7MP 3AG4H 3CZ6A 3K4CA 3V7RA 2BXYA 5HLTA 2LMDA 1CQTA 4XORA 2FA5A 3PFYA 4ZH4F 2MBFA 1U8BA 1FBSA 2PMUA 1K6YA 1ZGWA 3NWTA 1RUOA 2ECCA 4HLYA 1KGSA 1U6GA 3CC2I 3BZKA 3K1NA 2MD5A 4GDFA 5IYBJ 3DBHB 3FXJA 4FQGA 3FXLA 1FWZA 2GOXB 3CJTB 3CDLA 2KJCA 5GPAA 5D5XB 4ZZLA 2K9MA 2DN0A 3A0BC 3F6OA 4RAYA 1CGPA 2PJRA 5FKMA 3HRTA 1U8RA 4DNCA 2R7RA 1QPIA 1IXSB 1FOKA 3RYRA 1ZLJA 4XMYA 4IX7A 3ECHA 4MFEA 2VPLA 4RM3A 3BG5A 1Z1DA 2GOMA 4ANJA 2DA1A 5HLIA 5HDNA 3HOXJ 4GRIA 3FXQA 1QPMA 3B6CA 4L9VA 2DI3A 3MQ0A 4P5OA 3PNYA 3ZQ7A 4A3DJ 2XPVA 2ME0A 4II2A 3K70C 4XLHA 3EDPA 2DOFA 2FBKA 3ABKH 2O3FA 2OU2A 3DKYA 3I64A 4G94A 1Z3XA 2TRTA 3HBLA 2DQRA 5LLQA 3OYMA 3L2VA 4E7IA 4PFOA 3IAM2 3HC7A 4KN4X 4NUBA 4WF2A 2FX0A 3WHCA 1IO2A 3LA3A 3K10A 4II3A 2YSRA 3KLOA 3X2QH 3F72A 2ZXJA 4KMUX 2MGQA 4A69C 3J80K 3V7CA 2A5YB 5JI6A 4PJNA 1YHQI 3NARA 1P4AA 3MVPA 4DQ2A 1EV7A 4RA2A 2HQRA 2OZUA 2CW0F 5E20A 4HRIA 2G9WA 2HYGD 3GZ5A 2MLGA 4BXUA 2Y2ZA 4M71A 4F92B 2H8WA 1LEBA 3V4GA 3EPZA 5ILSA 1C0WA 1DP3A 1TC3C 4A3IJ 2C6YA 1E3PA 1UHWA 3V7SA 2COMA 1YE9A 5CKTA 4A3JJ 1U78A 3LQQA 1ACIA 3GLLA 4Q4ZF 2FU4A 3IAS2 3DPUA 1UZCA 2DK8A 1DPUA 4HF2A 2K40A 5JVGF 2IA1A 1JHFA 2ECBA 3JCUC 4ENMA 3LSHA 3IV5A 5GTIC 2DYSH 2GA2A 2PMHA 4IKFA 4MEXF 1F43A 1P7IA 2M0CA 2HVQA 4B4CA 3CCSI 1UFMA 3Q0UA 3QYEA 4GO1A 5FO5A 1IZ1A 2VQLA 4BS9A 2VPRA 4FISA 2D1HA 1QGPA 4PUSA 2DT5A 5IY5H 4E7HA 1XB4A 2IRFG 3IH4A 1IV8A 1V55H 4U7DA 3BJAA 4Q5SF 1Q1HA 4ENJA 4HZFA 4XLEA 1SVOA 4IOAF 1U9NA 1MBEA 4V2FA 4NQWA 2QSHX 4FASD 1ETOA 3M3YJ 2ACJA 2ETHA 2P6TA 2E2JJ 3DU5A 4IVNA 2RQPA 1W5CC 2FNAA 2BVMA 4RB2C 2XB0X 1ZK8A 3EUAA 1D8JA 2EV5A 2ID6A 3KP2A 1XGSA 1XSDA 2KLOA 5JHUA 2STWA 1BN5A 2F5VA 5F0HA 1FT9A 2LKPA 3K6GA 2PBIA 4JBAA 1MMDA 2F4MB 4Q47A 4R79A 2M30A 3CMMA 1J9IA 2V4JC 5EEGA 1NK2P 3TW7A 1JT6A 2L5QA 3ZRGA 2B9SA 4AYBA 2QQ9A 2PG4A 3IH2A 3QP5A 1WJ5A 4XN3A 4KT6A 4PFPA 4EM0B 2F48A 2RAEA 4BAYA 2WY8Q 2MH9A 2Y0MA 3KLNA 2W24A 1PJRA 3DPLC 3Q3SA 1SD4A 3CMAI 3TOBA 3ZQHA 3AAFA 3SFZA 3BWGA 3BG7A 1T39A 4V2GA 3IRRA 3IKTA 3WTSC 2UXXA 1HBXG 1MW7A 2Q2EB 1TQIA 2RDPA 1ETKA 3IKVA 3R0JA 2QENA 5F6FA 1HLVA 3ZPLA 2D5VA 1F9NA 2MG4A 3UR3C 3W6VA 5KVRA 1G2HA 2WV1A 5HS8A 3FKJA 2VC0A 4KMFA 1OFCX 1QRYA 5KCMA 3BR5A 3JREA 4P96A 4B48A 2K9SA 1YW9A 1IDZA 3HTSB 4IHTA 2A68F 1U5TB 2I5UA 1HW5A 3KP4A 4LB6B 4CDGA 1FPQA 5CVVA 4B3AA 1ZQ3P 1MH4A 2DT7B 2LKSA 2RREA 1JI8A 5BPDA 4YRVA 4IRHA 3R0AA 5D5UB 2LKXA 3HGYA 1E0EA 3DF8A 2GIZA 2BXZA 2IGNA 1VQ5I 1K61A 2CUJA 3GFJA 1IRXA 1BR2A 4QIWN 4S04A 3CJQB 2OV7A 2R7OA 5L3GA 1P92A 5CYVA 3VWBA 2FMYA 4EJOA 3OYAA 2R4GA 1FP1D 1SVLA 1YS7A 2JK3A 2OQRA 4HDVA 1KU7A 3A02A 2BW3A 2E60A 3ZR8X 2VN2A 4KYWA 1V5GA 1EA3A 4HLXA 1HQCA 3K9TA 1PYVA 2KZGA 2G0EA 2KDZA 2XB5A 1YYVA 3QOEA 4IHWA 4U87A 2FOWA 2H1LA 3FM5A 4M3GA 2E2HJ 1I1GA 3DLLF 1YRNA 2E1NA 5F1JA 1FZPB 2EV6A 3M07A 2HDDA 2VQHA 2GA1A 1MBKA 3GTJJ 1WJFA 5TISC 4LMYA 2QGUA 1JKQC 4I09A 1K83J 1NTCA 3T0YA 2ZJQF 4J00A 3RZOJ 2ZXHA 3BG3A 1SFUA 5J8CA 1B72A 2HOAA 4S05A 2RV8A 5F27A 5E18F 3AG1H 3O8GA 5M3FJ 3ZQGA 2LOOA 3LOCA 2ID3A 2E1CA 2DFHA 2YPRA 2QBYB 3E1SA 1X1DA 1IN4A 3ZN0A 3KE2A 5LHIA 5CVJA 2VJ5A 1JUPA 3JSPA 2P8TA 1ORKA 4FT8A 3CESA 4CCMA 2KIUA 4ETSA 3ZQFA 4ZTJA 2EIKH 4BHCA 5JFRA 1R7JA 1GT0C 4DIQA 3GLXA 2M4KA 1O3SA 3KP3A 3L1PA 4PSWA 4I02A 3R6SA 2L7FP 3LMMA 3V42A 1ZH5A 2R92J 3RKYA 2XV4S 4BE2A 2EFOA 3ERED 1U0JA 3S1RJ 3TO7A 3CCQI 1JKRC 1XMKA 1X4OA 3MZ8A 3K1PA 2BZTA 1IG7A 2FOKA 3GFIA 3N05A 1ZLKA 1E3OC 3QODA 3OS2A 1UAAA 4G7OF 3H0DA 4ESJA 4BXXJ 3D0SA 4MQ9F 5EG0B 4IEJA 1T0FA 4E7LA 5JLXA 3K0LA 2X51A 1JUMA 3I58A 4AYBN 5ILUA 2X0LA 3PSFA 1H0MA 1I1SA 3HJEA 1ZR2A 3S2HJ 1ITYA 4XLNF 5B66C 1MH3A 4D5FA 5E3LA 3NAUA 3OOPA 1JJ8C 3QPHA 1LDKB 3H5AA 2XAFA 4G12A 1BC8C 3JAMZ 4BQOA 3WTXC 1R36A 3DTIA 3WTYC 4ZYEA 4QTRA 4XLFA 3ZMSA 3HUGA 1V54H 4Y3OA 4ZYDA 1DU6A 3TEDA 2O7OA 2IGMA 2W4SA 3VDXA 3CLOA 5IPAA 1H8AC 3S16J 4XLPF 2EILH 3ZMTA 5CQGA 1VQ4I 1TT0A 4KDPA 2Q1ZB 2MC3A 4N0BA 1YW8A 4A3KJ 1W36D 1T98A 2HOSA 3CO7C 4P55A 5GADJ 2O6GE 1UELB 5DUKA 1FP2A 3BJ6A 1FMWA 1P4WA 1ZAOA 4JK1X 4D5CA 1X2NA 4PJ0C 1BJZA 2FJ1A 3A01A 2V1UA 1XCVA 2LD5A 2HS5A 5FRMA 1VNDA 3BQYA 2CUEA 2X85A 3HKZA 1PUFA 2F5CA 2IGOA 1OCRH 1B6AA 3AG2H 1A6IA 3N4MA 3V8JA 4LLNA 5IYCJ 1Y8RB 4AVPA 3I53A 4M3DA 3KYCB 3OYFA 3QAHA 4I01A 4AU7A 4IHVA 2VT3A 1Z21A 4ITVA 3KP5A 4R8HA 3EQLF 1K78A 3HOZJ 3I55I 1ON1A 4RS8A 5E1ZB 1S72I 3WG7H 2CUFA 2W25A 2P5KA 2QKMB 1GV5A 2HGCA 1MMNA 3FIWA 2LSOA 4CA0A 4Y17A 1WGXA 1FYMA 2B63J 1Y39A 3BTIA 2RC4A 2H1KA 2K4BA 2OD5A 2LY1A 1BW5A 3BG6A 4KIFA 2XDVA 2LFBA 2YR2A 3WTWC 1RUNA 2EA2A 1SFEA 5GAEJ 2MFZA 3W2AA 1J09A 3OY9A 2DTZA 4J19A 2NOJB 1ZG3A 1ZARA 3IP4B 3CUQB 4B8XA 2IPQX 2ZJPF 4BE1A 2V9VA 3K2AA 2Z16A 1OISA 3RKXA 3CDHA 4PSXA 1YW7A 4LD5A 3K4JA 3I54A 2HDCA 2OJED 1R00A 3EYYA 4QPOA 1R9TJ 2EJRA 2R7ZJ 1WPKA 4XLAA 1YX3A 4BKXA 4LITA 2H27A 3SFIA 2O5RA 3MFKA 4W1UA 4AD9A 3M1EA 2DMPA 2QUFA 1JT0A 2HR3A 1ETVA 4CHUA 2ZMEA 2EQRA 3MKWB 3G6EI 2M7BA 2JWTA 3G2BA 2VT2A 2FMLA 5FKOA 2P7VB 3TP3A 1N75A 3QPTA 4CZCA 1ZRDA 1KONA 6PAXA 2KL4A 3S14J 2LF8A 1NK3P 2OAZA 2E71A 3S2DJ 3F23A 4L18B 2WAQA 3UNGC 2IS4A 2X6WA 2E1MC 2VC1A 2M3AA 3R60A 3K4NA 3NQOA 3SZTA 1SAXA 1MDMA 5DD8A 2P5LC 4XOTA 4EJVA 4B09A 2XGEA 1IRZA 3I59B 5E79C 4BY7J 4DZPA 5KHDA 4XQFA 1UJ8A 3SJMA 1SD5A 4L9NA 3HHGA 4KICA 1U2WA 4K2EA 4Q48A 2LG4A 1TNSA 2HPMA 4LG0A 1TWAJ 2JRMA 4BGDA 4M6VA 3S1MJ 4IHXA 2ZXIA 3HYIA 4U0YA 3AL0B 4U0VA 3K70D 4XSXF 3O3KA 2E7WA 1IRGA 1BI0A 1OCOH 1SC7A 1O3TA 1Y1VJ 4YFNF 1R6RA 2FRHA 1D0YA 3RPUD 1G6NA 3G1MA 2RNJA 4DW6A 1BI1A 1R4MB 3TQNA 4D0PA 4KITB 1R1UA 5KK1A 2O9LA 2R7FA 1D1AA 2FE3A 1Y0NA 3RIRA 5BMZA 2GXAA 1IJWC 2R7UA 2I10A 4E70A 3MD2A 1A04A 4XIDA 1NG7A 4A3GJ 2KQRA 2R7XA 2ADUA 3E6MA 4HF1A 1ZRFA 4BH9A 2DPUA 1FYLA 1OQYA 3E5XA 3HKZN 4CGZA 2R7VA 5E1XA 4X6AJ 2K9QA 4BJ5C 1L3LA 3M8EA 1TNTA 3T1BA 4BJ6C 4D7MA 2KDOA 2QSFX 3HSEA 1G3YA 4M3BA 3MAJA 1ZELA 5IT9K 3C18A 2FUG2 2HKXA 1N78A 1HW2A 2R7TA 2ZBKA 1YO5C 1HF0A 2MC4A 4P1WA 2IS1A 3F3XA 4A93J 3ECOA 1I50J 1JKOC 5F0FA 3K2ZA 4PJMA 3TL4X 2KMUA 2H94A 3MZYA 1LQ1A 2QQAA 1U5TC 3ASNH 3FHNA 4S0HB 2V6EA 3CJNA 1FSHA 1X58A 2L4MA 4IF4A 3HGGA 1KYWA 1MMSA 1IW7F 4BHBA 1VQ6I 1B72B 1IN7A 3OYGA 4KNYA 2VASA 2I8DA 2KFDA 1FOXA 1MMGA 2W48A 3OYNA 2GQQA 1G3TA 4RAFA 2XKOA 1FTZA 4YEJA 3P9CA 3ZQIA 3W2VA 3E6CC 2OCEA 1AKHB 1P6RA 5HNHA 1O3QA 3BCAA 1ENHA 1QBJA 2M5WA 1GVJA 4KIGA 1VQ8I 4PGGA 2DFEA 2KIMA 4OOIA 1OYIA 2XUBA 3GF2A 3TMOA 1IUYA 2CYYA 4AC0A 4HQEA 1FNNA 4HNVA 4IXAA 4LLGF 3KP7A 2HYFA 3M8JA 1R5HA 4UB6C 3CUOA 5J4VA 2PQ8A 3C2GA 3F8CA 4FE4A 5BOXA 1SD7A 3CCMI 2WA0A 3QU3A 1I39A 3O8HA 4HEA2 2R5ZA 1X3UA 3DQVC 3VODA 2A6EF 1T95A 2NVTJ 4UUSA 1RRJA 1WCMJ 2NAZA 3H92A 4OIQF 2XASA 5CPRB 2WAQN 4AUXA 1OR7C 3H36A 2DMUA 1MJAA 4A12A 2JA8J 2FXAA 3QYBA 4FX0A 2V6CA 3U9GA 5DCMA 4ZYGA 3PIOF 2NS0A 3BCBA 2XAQA 2VBWA 4HX4A 2XSDC 4DYQA 2YS9A 4RLFA 3I4MJ 3ZMUA 1ONVA 4R1HA 2L02A 3S8PA 2IGKA 3UKGA 1WRJA 2CSOA 1T08B 3VSKA 1P9QC 3H9QA 2EZHA 1S8NA 1FBUA 3JRDA 5EZHA 3F8BA 3OR1C 4HNUA 2H09A 3H3UA 3BTCA 3HUGB 1E2XA 3OS1A 4MGRA 3OYCA 3WTTC 2QLZA 3PM1A 2RVCA 2VB6A 2ZXWH 4JYKA 5GAHJ 3MN2A 4ZDPA 4C9YA 2M8EA 3BQZA 1SMYF 2QZ8A 2NXNB 2R7SA 4E7SA 1F5TA 1RZ4A 5ED4A 4UVBA 3JW4A 2BYVE 3L2UA 4XL9A 2QM3A 3WU0A 3AG3H 1GXQA 3BP8A 4Y7NJ 5J40A 1K79A 4PK4A 1PUFB 4DJAA 3E97A 1CF7A 3ISPA 3WU2C 3ERMA 2EZLA 2GZWA 3LNQA 1QQIA 2X1EA 3TO6A 3F8FA 1LFUP 1YQAA 1GLNA 5FGMA 2WWYA 3WTUC 2BE5F 3LSPA 3VYSB 1YI2I 1K78B 1WJCA 1FOYA 3GCMA 2AXTC 1A5JA 2EINH 3M4OJ 3BPXA 3WHBA 2E1MB 2CG4A 4CYDA 1Z3YA 4ENKA 2ME6A 2NS8A 3MEXA 5K1YA 4KFCA 4NC6A 2A07F 3PJRA 4RAZA 2XF6A 4I76A 3L2CA 2UZKA 4BDZA 1ETWA 3RYPA 1Z0XA 1V4RA 5FD5A 3S17J 4BDYA 4RMNA 2CMPA 1XD7A 4GFBA 3BTJA 4EM2A 3E3VA 2VJ4A 2FSWA 4KN7X 1STZA 4ON0A 4CCNA 3CC4I 5DYMA 2HZDA 4KIBA 4G7HF 3FX3A 4OIOF 4TV7A 3NRVA 4JX4A 5J47A 4HV5A 1EH7A 4ZDOA 3HPHA 2AXLA 9ANTA 5K5RA 1B9MA 3VPRA 1YX5A 1AHDP 2X1DA 2QQBA 2HI3A 5DD4A 3CCUI 3Q9SA 1JXSA 2KT0A 3HSRA 2JVHA 1D0ZA 1XG1A 3CQZJ 1FOWA 1OCCH 2OA4A 4WXCA 3BJOA 2JQ7A 3W2WA 4B3XA 4W97A 1R5GA 1USTA 2X1CA 4WWCA 3WE2A 5M3MJ 4HA8A 2BVLA 5FLXZ 2K27A 1OJLA 4QWQA 2O61A 3CUQC 1TZLA 4CCKA 5B1BH 1G3WA 3ASOH 3T5XA 3JTGA 1P4XA 3K4MA 3A2KA 2JSCA 3SEQA 3CMEI 2NVUB 2W7NA 1WJDA 2L0KA 2NYXA 1YS6A 1T6SA 2Z33A 4YG2F 4I0AA 1H9GA 2XAGA 4IJAA 1T33A 2DAOA 4MQVA 2AS5F 2HYJA 2ELJA 1T2KA 3FISA 1TWFJ 5D4SA 3FZVA 1S6LA 3C1DA 5BQTA 5F1RA 4LG0B 2E2IJ 1ZRCA 4ESFA 1W7PB 5F0CA 3SDGA 4YFKF 3CJRB 3AKZA 4ZYAA 2DO7A 4GYIA 2LVSA 4A5MA 4L5JA 2H6CA 1QHGA 3H9GA 4DGWB 1W1WE 3OV8A 2DPDA 4CXFA 4NDLA 2Y31A 3TKYA 2STTA 3RQIA 2FQ4A 1S3JA 4LG3A 2NRAC 3HOSA 2Y0SA 5IYDJ 1LVAA 2F6CA 5LHGA 2XSJC 4AIDA 3ZCOA 5C44J 1MKMA 1ZGJA 2DLLA 3A4CA 4I7HA 2DA7A 4KJZA 5C4XJ 4I0BA 4HX8A 3L2QA 5DM7F 1X1AA 2JUCA 3FWEA 2MABA 4Y33A 4NC7A 2L01A 1J5YA 2XVCA 1DU0A 4BU2A 3H1CA 3KCCA 1QVUA 2F5FA 4UUTA 4E7JA 3L2RA 5H6RA 1UG2A 2VQCA 5IP7J 3AL0C 1J7KA 4YELA 3K4KA 4C30A 4PJLA 2X48A 1GUUA 4GGGA 3GEZA 3SXYA 3E5QA 1FC3A 4IHYA 1JGSA 5D5WB 2XRLA 1FSEA 1S9HA 3WGHA 4PZJA 3CD6I 4QSHA 3JSOA 2FF4A 1YIOA 1BOAA 2HXIA 1XPXA 2W1OA 3LSKA 1A31A 2ZJRF 4PGHA 3GVAA 3LSGA 3KIOA 2D1VA 2HQNA 4MO7A 2XROA 4H4KC 2YU9J 2A5WA 4F52A 3DPTA 1WKMA 2UUZA 5CJ9A 4LOCA 3OSFA 5K7FA 4U0WA 2CV1A 1DQUA 3S93A 2CH0A 2R5YA 4DYRA 4DOZA 4OINF 4HAMA 5FB2A 3A0HC 1FYKA 3JRCA 3CCYA 1XC5A 3Q9VA 4M9ZA 5FROA 3LSJA 3WE3A 2L7ZA 5D5VB 2FNPA 3I4NJ 1WI9A 4HV6A 4OMYA 5DV5A 2LK2A 1ERDA 2BY3A 1R1TA 3KFWX 5HS7A 2QA4I 1H88C 1SEUA 1VQKI 1WSUA 2CQQA 3C2HA 1ETQA 2IP2A 3ZQQA 3TP0A 2B7EA 2K4JA 4HNTA 4A3CJ 5CVRA 1LFBA 5J1UA 4ABZA 3VFZA 3GW2A 3J81K 2K02A 5H6QA 2VBXA 1GV2A 4N9IA 1HCRA 1V5EA 4CYCA 2W82A 4XR6A 1K7AA 2PJRB 2WAEA 3HEFA 4HQMA 4AIHA 5ILVA 1NG6A 3RPQA 2ZC2A 1AU7A 2A6TA 4BQAA 3K4LA 2XGCA 4N4NB 5ERIA 2DA2A 1OKRA 4C2TA 3P5JA 3QQAA 4N4OB 2LBFA 4XKVA 2MLKA 3BR2A 4A0XA 2FQ3A 4XSZF 3COAC 2KIQA 3OR2C 2DYRH 2W84A 4RB0A 1JGGA 1I5ZA 2M34A 5LGTA 2LLKA 3GBGA 2K86A 3BR0A 4EJUA 5ICFA 1G8XA 3JRAA 2ELHA 3DKXA 1SANA 3NWSA 3ZN1A 4EV0A 1GHCA 3Q5FA 1TWHJ 1A36A 3GUDA 1RESA 1W5TA 3JAMK 2QKLB 4G9YA 4C2MJ 4BYYA 2QWWA 4Y13A 3DLAA 2EZIA 3J7AO 2JSPA 2QCOA 2RKHA 1KU2A 1I6HJ 2O03A 2VXDA 1IXRC 2Y0SN 1FY7A 3F9KA 3I56I 1BI3A 3F0CA 3U21A 1Y56A 2TCTA 1TLHB 5FLVA 5GP9A 2E19A 2LC2A 4I98B 4UVAA 4IL6C 5EGOA 5JLWA 1BI2A 1SVMA 4XONA 2NOGA 2YUSA 2FBIA 5HDGA 4RBOA 1VI0A 5E17F 3GTOJ 3GTGJ 4EQQA 5LGUA 2HQ5A 4B43A 1Z67A 1IF1A 3B73A 5FD6A 3KYLA 1V3FA 3LSMA 2KZVA 1VQ9I 3GO5A 1USSA 3IWFA 4G7ZF 1P2FA 2P4WA 1D8KA 3LL7A 4L5EA 1W7PD 4CH7A 1ZG1A 1A35A 4A3BJ 1FX7A 4N9HA 1LUJB 3FDYA 3OYKA 2R3SA 1W0UA 1ETXA 1QO0D 4FE7A 2MH2A 2DMQA 2BOLA 2QYOA 4XKCA 2WY7Q 4EVIA 4UY8I 2J5PA 4IQ4A 1LFPA 5E1WA 5EEHA 3HXLA 1TT5B 2KRCA 4FX4A 2QVOA 2HFHA 3CCEI 2HU9A 3MZHA 1F1ZA 2NNNA 4NQWB 5FFXA 1FMVA 1FEXA 2RN7A 3B02A 2R7WA 2JPBA 4NHJA 3V8KA 4A6EA 1WQ2A 2DA6A 1JJ6C 3FMRA 1TQPA 1IDYA 2DOEA 1XSVA 1OLTA 3S1QJ 1A6QA 2HQAA 3GFLA 1X4PA 1XGOA 3L09A 3ULQB 4MTDA 5M5WJ 3H5RA 1TP4A 2M0MA 3QPLA 4UUVA 3RTRA 2DXIA 3CLQA 1WHUA 4BQQA 2OZ6A 5DDGA 2CQKA 1WZ2A 1I3QJ 2EZKA 2W57A 4BNCA 3E7LA 4U88A 1UG0A 3K1MA 5F04A 3GX4X 3H5NA 5J8FA 4BUPA 4LLLA 3ML6A 3CCRI 5D4RA 1BR4A 1KU9A 3PSIA 5JR3A 3EUHA 4HW0A 1MD0A 2R7DA 2Q2EA 3N97A 3HZJA 4B44A 1S7AA 2NVQJ 2N8GA 4X1EA 4F55A 2UWMA 1LKXA 2GIVA 1W4MA 3G1LA 3WGGA 2A3SA 5AIQA 2W00A 1Z77A 1EH8A 3CP8A 5B5EC 2VJJA 5H2FC 4M72A 3OYIA 1HC8A 1DPRA 1Z05A 1XMXA 4JQFA 5HLHA 5EJCA 1HKSA 3KX2A 1MBFA 1G4DA 4GXOA 3HHHA 3FXKA 4UB8C 4WXDA 1ZR4A 2CQXA 1L0OC 5IOZA 1JHHA 1JTYA 2JA2A 2DBBA 4XRSG 3H0GJ 4F91B 3J7ZI 3OYDA 2DFIA 2IAIA 2NS7A 2X6OA 4MHGA 3U1DA 5CVUA 2KKOA 2LY2A 3MKYB 5L3CA 4FHTA 1DGRM 4EGZA 2JUGA 1G59A 3QP6A 2OTLI 1BIBA 2KRFA 1ZYRF 5CLSA 1RETA 2WTEA 5IT9Z 5JHFA 2BY1A 3R4KA 5D6FA 1TL8A 4M3FA 2F2EA 3TW6A 2JZYA 4HSRA 1BC7C 4HOBA 4V19K 2BW3B 2QSGX 1MZBA 4EATA 2HTSA 3SZGA 2B0LA 1YJ9I 5FRNA 3GTPJ 4O6JA 3OIPA 1D1CA 2KJBA 5D8LB 2BGCA 1XN7A 1G3SA 5ICEA 1OYWA 4EEFG 1MBHA 5F08A 5LRRA 3WTVC 1BBYA 1HDPA 3WTZA 3Q0VA 2Z2SB 3OL3A 1D1BA 4CICA 3S3NA 1ODDA 1YRNB 2MA3A 5A2QZ 4U7BA 1O3RA 4LFUA 1R71A 3PNVA 3BROA 1K4TA 3CC7I 3HOYJ 2NVYJ 4KA4A 1X1BA 1TWGJ 1ZTRA 2CW8A 3BTLA 4C3IJ 1RKTA 3TOAA 5BNGA 5LFAA 5LBQA 2X6YA 2PJPA 1T38A 3TDZC 3QPSA 4LK0F 2YX7A 3BC8A 1B8IA 1OR7A 2QBYA 3P7NA 4G6DA 3OYHA 2KRHA 2ZNYA 2L9VA 4O5VA 3CTAA 5LGNA 3EUKL 3G3ZA 2CQNA 1S7OA 2M7AA 1APLC 4IZZA 4KT5C 2PMZA 5HOOA 1QNTA 4IRGA 3B6AA 4OU0A 2EH3A 5J1YA 2HVRA 1VZ0A 2V1NA 2ZNZA 3OOUA 2IS6A 3RPUA 2R7QA 4CCLA 1IC8A 2K7LA 2EWNA 1SFXA 2RQQA 1OYYA 3KP6A 1IGNA 3RZDJ 4HF0A 1K4SA 1MSEC 3GZNB 1RR7A 1ZN2A 2L9RA 4HYEA 2VLAA 1SFOJ 2LP0A 1H9TA 1XTAA 4MIMA 5E3NA 2XIGA 2HVSA 2L3DA 1R4NB 2HDWA 3I4PA 2P5VA 4ZYHA 2KIFA 5DUIA 3FXUA 1QZZA 3PQJA 2DTRA 2GM4A 2IXSA 3GYHX 3C7JA 1IUFA 1WH7A 4F93B 3J7YJ 1X2MA 1E3HA 1HOMA 2ZJ2A 1I27A 3KZZA 5DEQA 1ZREA 1U9OA 4KUMA 4HSTA 3BZ6A 4NB5A 1NH3A 1YJWI 4UV8A 1LNWA 2P0WA 1PP8F 5DS9A 4CYCB 3GTLJ 2VKEA 3O6BB 3BPVA 3J80Z 3R61A 3G71I 1X19A 1RI7A 1UCRA 2PFBA 2LTPA 3OMYA 1GXPA 3BR6A 3CF2A 1J59A 5JVTA 5M5YJ 1M1EB 4M9XA 5E3OA 2VXZA 1XCBA 5AIPA 2LBFB 3HRSA 4RM2A 4HG2A 3DCFA 1QU3A 3KEOA 2DJNA 1MMAA 3DBLB 3PUFA 4OAYA 3LFKA 1DP7P 2OC6A 4L5IA 3LWFA 4MEYF 3K69A 1KZHA 3G4SI 4RGSA 4I99C 2CWEA 3RJPA 1FJLA 2DDBA 2VI6A 3I71A 5E3MA 2Y9ZA 3HIFA 3C3WA 4AWXB 4XRSA 1V5FA 2OBPA 4BEHA 3A01B 3HOWJ 2DW4A 2F4IA 3GFMA 5KNLA 4ESBA 2CGPA 3OYBA 1VQNI 2VUMJ 5M5XJ 2NVXJ 3GXOA 3NEUA 4UNOA 3FM3A 2EK5A 4WK8F 2HOTA 3A03A 1ZHFA 2R93J 2PEXA 4AIKA 3HDDA 2QF7A 5GAGJ 3HOUJ 4LGWA 3JRFA 2E34A 2D2WA 1WJBA 4ASNA 3W3CA 2X4HA 3D5LA 5EEAA 1N77A 3HOVJ 1KU3A 3LQRA 3HRMA 4UXNA 2DT6A 2L7KA 3JRGA 3E0JB 2EFPA 5CVIA 5KAIC 2K85A 2XRNA 1XMAA 1W5SA 3DTEA 2XPWA 5EGOB 1TW2A 3F22A 4XNFA 2WB1A 4PJJA 3L00A 2CV0A 2P6SA 4QPQA 3WG9A 4PDKA 3FF5A 2JA5J 1PVEA 2BBYA 2VJIA 2UXNA 3H3VK 4DZJA 4IOCF 4EGYA 1FIPA 2VKVA 1ON2A 3FXMA 3HTUA 3CUQA 3PQKA 1BOBA 4E7KA 3GTMJ 1Z9CA 2A61A 1Y6IA 1SFKA 2VKDA 2JT1A 1MNMC 1YITI 5K5QA 2VE9A 1XGNA 3CCJI 2VQGA 3DEWA 2O8KA 1VQOI 3OL4A 1U3EM 1F36A 3SQNA 1BW6A 3ROUA 2M9HA 4M74A 2P81A 3ELKA 2ZO4A 3K7AJ 3JR9A 4A3EJ 3LSTA 2L2OA 3M7GA 3DV8A 5GTHC 2L4AA 3PFIA 4RAGA 4G8XA 4DBRA 2WV0A 3TGNA 2EV0A 2PMZN 5CQEA 1KYZA 3ABLH 5L3BA 1YFHA 4Z6YA 1YJNI 1O7FA 1TWCJ 4M6YA 1H89C 2PN6A 5AONA 4XRMA 2ZMEB 1YLFA 3BY6A 3FBNB 5EYRA 1IN8A 3JRHA 2JVGA 2Q0OA 4A3FJ 1R22A 4IPAA 2E35A 1IRFA 4FETA 3RQ4A 3M8FA 3PIPF 2XF7A 5BS6A 2E5NA 3IL2A 1B59A 3EETA 2DMTA 4M9SA 3L7WA 3RKQA 1AOYA 1B4AA 4PCQA 2HTJA 2LRDA 3FXRA 4RGRA 5HLGA 4A0YA 3BR1A 3ABUA 3H9JA 4JX6A 1QHHD 3I59A 5D8KB 1MDMB 3REOA 2V1XA 4ZDLA 5DM6F 2ELKA 3ABMH 3V8LA 2E5ZA 2KPMA 3EYIA 2W85A 3FMSA 3I9V2 1MNDA 3Q0WA 1GDTA 2MW8A 2DU9A 4Y4RA 2EFWA 4XLCA 4WCGA 2HKOA 2LY9A 1MBJA 5HVQC 2CJJA 4G6TB 2A69F 1TQMA 2FBHA 3OWTA 1YIJI 2HEOA 3HRUA 2QEXI 2NNYA 5FLXK 4YFXF 3ZQCA 5FJ8J 3E5UA 1KQ9A 2DOAA 3JRIA 3O2PE 5FKLA 5B1AH 1UMQA 3DP7A 1QZEA 3ABTA 3E6BA 1MJBA 1R5ID 3S3OA 1AWCA 2IA2A 4C3HJ 1HDDC 3IRQA 3T8TA 4ZC3A 4F7ZA 2F5EA 4P9FA 1VQ7I 5J1RA 2K9NA 2DQLA 3MKZA
chains in the Genus database with same CATH topology
1IJWC 4A69C 2I10A 5C3EJ 1RESA 3NARA 4XIDA 4C2MJ 3MVPA 4A3GJ 4A3LJ 5EDNA 2M2EA 2EZIA 3HKZN 2QCOA 1I6HJ 4X6AJ 1LE8A 2Y0SN 2K9QA 3FKIJ 2Y2ZA 3F0CA 3OSGA 2TCTA 4D7MA 5FLVA 5GP9A 2E19A 2JA6J 5EGOA 1TC3C 4A3IJ 5JLWA 4M3BA 2LR8A 2NOGA 2YUSA 4MLOA 4RBOA 1VI0A 4A3JJ 1U78A 3GTOJ 2JMWA 1HF0A 3GTGJ 2HQ5A 4A93J 1JKOC 1I50J 3MKLA 2E1OA 5F0FA 2K40A 2ECBA 3IV5A 4S0HB 4L5EA 4I6ZA 4A3BJ 4BY1J 1F43A 1X58A 1P7IA 2M0CA 2WB1N 3HGGA 4B4CA 2GBYA 3Q0UA 1W0UA 1ETXA 4FE7A 1B72B 2DMQA 2VPRA 2X9DA 4FISA 3ZOBA 4XICA 2W48A 1B8IB 1VF9A 3IH4A 1MSFC 1FTZA 3ZQIA 1AKHA 1U9NA 1MBEA 4V2FA 1AKHB 1EF4A 1ETOA 3M3YJ 4D7NA 1FEXA 1ENHA 2E2JJ 5K7HA 2CRGA 2XB0X 1ZK8A 2DA6A 2ID6A 1JJ6C 4AC0A 1IDYA 4HNVA 5F0HA 3S1QJ 1BA5A 5M5WJ 1OCTC 3QPLA 3IH3A 2OPTA 4FE4A 3TW7A 1NK2P 1JT6A 3IH2A 3O8HA 1IV6A 2R5ZA 1I3QJ 2EZKA 2R5ZB 2RAEA 1MBGA 2NVTJ 2Y9YA 4UUSA 3E7LA 5F04A 1WCMJ 1FIAA 4UUSB 3S15J 3Q3SA 2IBDA 2WAQN 4AUXA 1POGA 2DMUA 3ZQHA 5EF6A 2EBIA 2JA8J 4XK4A 2DA4A 4V2GA 2NVQJ 1ETKA 2N8GA 4X1EA 1HLVA 2XSDC 4DYQA 2YS9A 3I4MJ 2D5VA 2COBA 3G1LA 2MG4A 3W6VA 1WI3A 1Z77A 3UKGA 1G2HA 2WV1A 3CMYA 5IOYA 1OFCX 1QRYA 1T56A 1WH5A 2EZHA 3BR5A 5J3LA 3JREA 5GPCA 3JRDA 2K9SA 5EZHA 1MBFA 1IDZA 3BTCA 1ETYA 3OIOA 1ZQ3P 1ZR4A 2CQXA 4B3AA 4MFDA 1MH4A 5IP6A 5IOZA 1JTYA 3PM1A 4XRSG 3H0GJ 4JYKA 2LKXA 2DMNA 2IAIA 2NS7A 2X6OA 3HGYA 3MN2A 5K7ZA 5C4JJ 4DYCA 3BQZA 1K61A 4QIWN 2IEKA 1QVTA 2JK3A 1RETA 4Y7NJ 3A02A 4M3FA 3TW6A 1PUFB 1RKWA 3ZQLA 4M3EA 1JTXA 1VFCA 3GTPJ 2EZLA 3LNQA 2G0EA 4EEFG 2XB5A 1MBHA 5F08A 2KDZA 1W0TA 4IHWA 5HODA 1LFUP 1HDPA 4M3GA 3Q0VA 2E2HJ 3GTKJ 1YRNA 5F1JA 2HDDA 3LSPA 3GTJJ 1MBKA 1YRNB 1JKQC 1UHSA 1K83J 1A5JA 1NTCA 2R0QC 4C3JJ 3HOYJ 3M4OJ 2NVYJ 3RZOJ 3WHBA 1TWGJ 3BG3A 1ZTRA 4C3IJ 3BTLA 2NS8A 2ME6A 1RKTA 5BNGA 1B72A 1ZKGA 2HOAA 5F27A 3QPSA 4I76A 3O8GA 5M3FJ 4FCYA 1B8IA 1ETWA 3ZQGA 3LOCA 2ID3A 1Z0XA 3S1NJ 3S17J 3C2BA 4GFBA 1JUPA 3BTJA 4BBSJ 1ORKA 2JJ7A 1APLC 3ZQFA 1GT0C 3FK7A 3HM5A 3B6AA 3L1PA 2EH3A 5J1YA 2OF7A 5FLMJ 4JX4A 2L7FP 3D1NI 2R92J 3OOUA 1XS9A 1IC8A 9ANTA 3HB9A 1GVDA 3S1RJ 1JKRC 1IGNA 3VPRA 3RZDJ 1MSEC 1RR7A 2L9RA 4JP0A 1AHDP 2HI3A 4Y52J 2M8GX 1IG7A 2KT0A 1SFOJ 2LP0A 1XG1A 3CQZJ 4MIMA 1E3OC 5E3NA 3LSRA 4BXXJ 5EG0B 4IEJA 2DA3A 5JLXA 4W97A 1JUMA 5FKNA 2GLOA 4AYBN 2GM4A 1ZR2A 1IUFA 1Y1WJ 5M3MJ 3S2HJ 1WH7A 1ITYA 1X2MA 1OJLA 1HOMA 1MH3A 4D5FA 5E3LA 1U9OA 3NAUA 1JJ8C 2L0KA 1JUSA 5DS9A 4CYCB 3GTLJ 2VKEA 4G12A 3BR3A 2LTPA 4A3MJ 1T33A 2HYJA 3BR6A 4QTRA 3FISA 1TWFJ 1DU6A 5M5YJ 3TEDA 2O7OA 5E3OA 2DA5A 5IPAA 1H8AC 3S16J 2E2IJ 2AHQA 5F0CA 3DCFA 3SDGA 2JN6A 2DJNA 4A3KJ 3PO2J 2HOSA 2LVSA 2XPUA 5DTDA 5FKKA 3BG9A 1D5YA 1FJLA 2VI6A 4NDLA 2Y31A 5E3MA 4D5CA 1X2NA 2HXOA 1BJZA 2FJ1A 5EZGA 4XRSA 3A01A 2LD5A 2Y9ZA 3HOWJ 3A01B 1VNDA 3BQYA 2CUEA 1PUFA 3RQIA 2FQ4A 1A6IA 2VUMJ 5IYDJ 5M5XJ 2NVXJ 5IP9J 3JRBA 5IYCJ 5C44J 2CU7A 1P7JA 2JA7J 2HOTA 2DA7A 5C4XJ 4M3DA 4IHVA 2MSYA 3A03A 2R93J 3HDDA 3GTQJ 2QF7A 3HOUJ 3JRFA 1FTTA 3HOZJ 1DU0A 2H8RA 1LE8B 1QVUA 3FK6A 4UUTA 1JKPC 1Q1VA 2CUFA 5IP7J 1UG2A 5EEAA 1GV5A 3HOVJ 2FD5A 1O4XA 3FIWA 2X48A 1GUUA 4RDUA 3JRGA 1WGXA 2B63J 3BTIA 2H1KA 4IHYA 2XRLA 2XPWA 5EGOB 1BW5A 1OCPA 2LFBA 4QSHA 4BBRJ 2JA5J 3H3VK 2DTZA 4JX5A 4DZJA 2HXIA 2Y30A 3BT9A 1FIPA 2VKVA 4B1RA 4J19A 1RPWA 2AO9A 3GTMJ 3LSGA 3K2AA 1MNMC 4MO7A 4FTHA 2YU9J 3G1OA 3DEWA 2ZB9A 1R9TJ 2O8KA 2R7ZJ 1BL0A 2XGDA 1F36A 1WPKA 1BW6A 2M9HA 4LOCA 3OSFA 5K7FA 2P81A 4BKXA 3K7AJ 2R5YA 3SFIA 4DYRA 3JR9A 2R5YB 4A3EJ 4W1UA 3PO3J 2DMPA 1S7EA 2PMZN 3JRCA 3CCYA 1H89C 1JT0A 1XC5A 1TWCJ 3LSJA 1ETVA 2L7ZA 2EQRA 3I4NJ 4XRMA 5EG0A 5EYRA 2JWTA 3JRHA 2L7MP 2LK2A 5FKOA 4A3FJ 3TP3A 1CQTA 1H88C 3S14J 1U8BA 2CQQA 1NK3P 1ETQA 1ZGWA 2ECCA 3S2DJ 3TP0A 2DMTA 4A3CJ 5IYBJ 1LFBA 5J1UA 4ABZA 3RKQA 1GV2A 3CDLA 3BR1A 1HCRA 5GPAA 4JX6A 4CYCA 2DN0A 2XGEA 1IRZA 4BY7J 5FKMA 1QPIA 4DZPA 3HEFA 3SJMA 2ELKA 4MFEA 1AU7A 3Q0WA 1GDTA 2MW8A 3BG5A 2XGCA 1TWAJ 2DA2A 2DA1A 4M6VA 3HOXJ 3QQAA 3S1MJ 2LY9A 1MBJA 4IHXA 2CJJA 3B6CA 3BR2A 4A3DJ 2XPVA 2ME0A 1Y1VJ 3ZQCA 1JGGA 5FJ8J 2M34A 2TRTA 3HBLA 3JRIA 2LLKA 3G1MA 3GBGA 5FKLA 4DW6A 1UMQA 3BR0A 3JRAA 2FX0A 3WHCA 1HDDC 4C3HJ 2O9LA 1SANA 5J1RA 2K9NA 2MGQA 1TWHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJW C;  4A69 C;  2I10 A;  5C3E J;  1RES A;  3NAR A;  4XID A;  4C2M J;  3MVP A;  4A3G J;  4A3L J;  5EDN A;  2M2E A;  2EZI A;  3HKZ N;  2QCO A;  1I6H J;  4X6A J;  1LE8 A;  2Y0S N;  2K9Q A;  3FKI J;  2Y2Z A;  3F0C A;  3OSG A;  2TCT A;  4D7M A;  5FLV A;  5GP9 A;  2E19 A;  2JA6 J;  5EGO A;  1TC3 C;  4A3I J;  5JLW A;  4M3B A;  2LR8 A;  2NOG A;  2YUS A;  4MLO A;  4RBO A;  1VI0 A;  4A3J J;  1U78 A;  3GTO J;  2JMW A;  1HF0 A;  3GTG J;  2HQ5 A;  4A93 J;  1JKO C;  1I50 J;  3MKL A;  2E1O A;  5F0F A;  2K40 A;  2ECB A;  3IV5 A;  4S0H B;  4L5E A;  4I6Z A;  4A3B J;  4BY1 J;  1F43 A;  1X58 A;  1P7I A;  2M0C A;  2WB1 N;  3HGG A;  4B4C A;  2GBY A;  3Q0U A;  1W0U A;  1ETX A;  4FE7 A;  1B72 B;  2DMQ A;  2VPR A;  2X9D A;  4FIS A;  3ZOB A;  4XIC A;  2W48 A;  1B8I B;  1VF9 A;  3IH4 A;  1MSF C;  1FTZ A;  3ZQI A;  1AKH A;  1U9N A;  1MBE A;  4V2F A;  1AKH B;  1EF4 A;  1ETO A;  3M3Y J;  4D7N A;  1FEX A;  1ENH A;  2E2J J;  5K7H A;  2CRG A;  2XB0 X;  1ZK8 A;  2DA6 A;  2ID6 A;  1JJ6 C;  4AC0 A;  1IDY A;  4HNV A;  5F0H A;  3S1Q J;  1BA5 A;  5M5W J;  1OCT C;  3QPL A;  3IH3 A;  2OPT A;  4FE4 A;  3TW7 A;  1NK2 P;  1JT6 A;  3IH2 A;  3O8H A;  1IV6 A;  2R5Z A;  1I3Q J;  2EZK A;  2R5Z B;  2RAE A;  1MBG A;  2NVT J;  2Y9Y A;  4UUS A;  3E7L A;  5F04 A;  1WCM J;  1FIA A;  4UUS B;  3S15 J;  3Q3S A;  2IBD A;  2WAQ N;  4AUX A;  1POG A;  2DMU A;  3ZQH A;  5EF6 A;  2EBI A;  2JA8 J;  4XK4 A;  2DA4 A;  4V2G A;  2NVQ J;  1ETK A;  2N8G A;  4X1E A;  1HLV A;  2XSD C;  4DYQ A;  2YS9 A;  3I4M J;  2D5V A;  2COB A;  3G1L A;  2MG4 A;  3W6V A;  1WI3 A;  1Z77 A;  3UKG A;  1G2H A;  2WV1 A;  3CMY A;  5IOY A;  1OFC X;  1QRY A;  1T56 A;  1WH5 A;  2EZH A;  3BR5 A;  5J3L A;  3JRE A;  5GPC A;  3JRD A;  2K9S A;  5EZH A;  1MBF A;  1IDZ A;  3BTC A;  1ETY A;  3OIO A;  1ZQ3 P;  1ZR4 A;  2CQX A;  4B3A A;  4MFD A;  1MH4 A;  5IP6 A;  5IOZ A;  1JTY A;  3PM1 A;  4XRS G;  3H0G J;  4JYK A;  2LKX A;  2DMN A;  2IAI A;  2NS7 A;  2X6O A;  3HGY A;  3MN2 A;  5K7Z A;  5C4J J;  4DYC A;  3BQZ A;  1K61 A;  4QIW N;  2IEK A;  1QVT A;  2JK3 A;  1RET A;  4Y7N J;  3A02 A;  4M3F A;  3TW6 A;  1PUF B;  1RKW A;  3ZQL A;  4M3E A;  1JTX A;  1VFC A;  3GTP J;  2EZL A;  3LNQ A;  2G0E A;  4EEF G;  2XB5 A;  1MBH A;  5F08 A;  2KDZ A;  1W0T A;  4IHW A;  5HOD A;  1LFU P;  1HDP A;  4M3G A;  3Q0V A;  2E2H J;  3GTK J;  1YRN A;  5F1J A;  2HDD A;  3LSP A;  3GTJ J;  1MBK A;  1YRN B;  1JKQ C;  1UHS A;  1K83 J;  1A5J A;  1NTC A;  2R0Q C;  4C3J J;  3HOY J;  3M4O J;  2NVY J;  3RZO J;  3WHB A;  1TWG J;  3BG3 A;  1ZTR A;  4C3I J;  3BTL A;  2NS8 A;  2ME6 A;  1RKT A;  5BNG A;  1B72 A;  1ZKG A;  2HOA A;  5F27 A;  3QPS A;  4I76 A;  3O8G A;  5M3F J;  4FCY A;  1B8I A;  1ETW A;  3ZQG A;  3LOC A;  2ID3 A;  1Z0X A;  3S1N J;  3S17 J;  3C2B A;  4GFB A;  1JUP A;  3BTJ A;  4BBS J;  1ORK A;  2JJ7 A;  1APL C;  3ZQF A;  1GT0 C;  3FK7 A;  3HM5 A;  3B6A A;  3L1P A;  2EH3 A;  5J1Y A;  2OF7 A;  5FLM J;  4JX4 A;  2L7F P;  3D1N I;  2R92 J;  3OOU A;  1XS9 A;  1IC8 A;  9ANT A;  3HB9 A;  1GVD A;  3S1R J;  1JKR C;  1IGN A;  3VPR A;  3RZD J;  1MSE C;  1RR7 A;  2L9R A;  4JP0 A;  1AHD P;  2HI3 A;  4Y52 J;  2M8G X;  1IG7 A;  2KT0 A;  1SFO J;  2LP0 A;  1XG1 A;  3CQZ J;  4MIM A;  1E3O C;  5E3N A;  3LSR A;  4BXX J;  5EG0 B;  4IEJ A;  2DA3 A;  5JLX A;  4W97 A;  1JUM A;  5FKN A;  2GLO A;  4AYB N;  2GM4 A;  1ZR2 A;  1IUF A;  1Y1W J;  5M3M J;  3S2H J;  1WH7 A;  1ITY A;  1X2M A;  1OJL A;  1HOM A;  1MH3 A;  4D5F A;  5E3L A;  1U9O A;  3NAU A;  1JJ8 C;  2L0K A;  1JUS A;  5DS9 A;  4CYC B;  3GTL J;  2VKE A;  4G12 A;  3BR3 A;  2LTP A;  4A3M J;  1T33 A;  2HYJ A;  3BR6 A;  4QTR A;  3FIS A;  1TWF J;  1DU6 A;  5M5Y J;  3TED A;  2O7O A;  5E3O A;  2DA5 A;  5IPA A;  1H8A C;  3S16 J;  2E2I J;  2AHQ A;  5F0C A;  3DCF A;  3SDG A;  2JN6 A;  2DJN A;  4A3K J;  3PO2 J;  2HOS A;  2LVS A;  2XPU A;  5DTD A;  5FKK A;  3BG9 A;  1D5Y A;  1FJL A;  2VI6 A;  4NDL A;  2Y31 A;  5E3M A;  4D5C A;  1X2N A;  2HXO A;  1BJZ A;  2FJ1 A;  5EZG A;  4XRS A;  3A01 A;  2LD5 A;  2Y9Z A;  3HOW J;  3A01 B;  1VND A;  3BQY A;  2CUE A;  1PUF A;  3RQI A;  2FQ4 A;  1A6I A;  2VUM J;  5IYD J;  5M5X J;  2NVX J;  5IP9 J;  3JRB A;  5IYC J;  5C44 J;  2CU7 A;  1P7J A;  2JA7 J;  2HOT A;  2DA7 A;  5C4X J;  4M3D A;  4IHV A;  2MSY A;  3A03 A;  2R93 J;  3HDD A;  3GTQ J;  2QF7 A;  3HOU J;  3JRF A;  1FTT A;  3HOZ J;  1DU0 A;  2H8R A;  1LE8 B;  1QVU A;  3FK6 A;  4UUT A;  1JKP C;  1Q1V A;  2CUF A;  5IP7 J;  1UG2 A;  5EEA A;  1GV5 A;  3HOV J;  2FD5 A;  1O4X A;  3FIW A;  2X48 A;  1GUU A;  4RDU A;  3JRG A;  1WGX A;  2B63 J;  3BTI A;  2H1K A;  4IHY A;  2XRL A;  2XPW A;  5EGO B;  1BW5 A;  1OCP A;  2LFB A;  4QSH A;  4BBR J;  2JA5 J;  3H3V K;  2DTZ A;  4JX5 A;  4DZJ A;  2HXI A;  2Y30 A;  3BT9 A;  1FIP A;  2VKV A;  4B1R A;  4J19 A;  1RPW A;  2AO9 A;  3GTM J;  3LSG A;  3K2A A;  1MNM C;  4MO7 A;  4FTH A;  2YU9 J;  3G1O A;  3DEW A;  2ZB9 A;  1R9T J;  2O8K A;  2R7Z J;  1BL0 A;  2XGD A;  1F36 A;  1WPK A;  1BW6 A;  2M9H A;  4LOC A;  3OSF A;  5K7F A;  2P81 A;  4BKX A;  3K7A J;  2R5Y A;  3SFI A;  4DYR A;  3JR9 A;  2R5Y B;  4A3E J;  4W1U A;  3PO3 J;  2DMP A;  1S7E A;  2PMZ N;  3JRC A;  3CCY A;  1H89 C;  1JT0 A;  1XC5 A;  1TWC J;  3LSJ A;  1ETV A;  2L7Z A;  2EQR A;  3I4N J;  4XRM A;  5EG0 A;  5EYR A;  2JWT A;  3JRH A;  2L7M P;  2LK2 A;  5FKO A;  4A3F J;  3TP3 A;  1CQT A;  1H88 C;  3S14 J;  1U8B A;  2CQQ A;  1NK3 P;  1ETQ A;  1ZGW A;  2ECC A;  3S2D J;  3TP0 A;  2DMT A;  4A3C J;  5IYB J;  1LFB A;  5J1U A;  4ABZ A;  3RKQ A;  1GV2 A;  3CDL A;  3BR1 A;  1HCR A;  5GPA A;  4JX6 A;  4CYC A;  2DN0 A;  2XGE A;  1IRZ A;  4BY7 J;  5FKM A;  1QPI A;  4DZP A;  3HEF A;  3SJM A;  2ELK A;  4MFE A;  1AU7 A;  3Q0W A;  1GDT A;  2MW8 A;  3BG5 A;  2XGC A;  1TWA J;  2DA2 A;  2DA1 A;  4M6V A;  3HOX J;  3QQA A;  3S1M J;  2LY9 A;  1MBJ A;  4IHX A;  2CJJ A;  3B6C A;  3BR2 A;  4A3D J;  2XPV A;  2ME0 A;  1Y1V J;  3ZQC A;  1JGG A;  5FJ8 J;  2M34 A;  2TRT A;  3HBL A;  3JRI A;  2LLK A;  3G1M A;  3GBG A;  5FKL A;  4DW6 A;  1UMQ A;  3BR0 A;  3JRA A;  2FX0 A;  3WHC A;  1HDD C;  4C3H J;  2O9L A;  1SAN A;  5J1R A;  2K9N A;  2MGQ A;  1TWH J; 
#chains in the Genus database with same CATH topology
 2V26 A;  5LHH A;  5C3E J;  1HKT A;  3H35 A;  3F8N A;  3TDU C;  2RNG A;  3TBI A;  1D3Y A;  2ZSI B;  2O8X A;  4D1Q A;  3SYT A;  2DCE A;  2F5D A;  4A3L J;  3HPG A;  5EDN A;  2OTJ I;  2M2E A;  4XKW A;  2CW7 A;  3CCL I;  1ULY A;  1LE8 A;  3H3Z A;  1X3Z B;  2LDU A;  2Z1D A;  3ESW B;  3FKI J;  5HNF A;  2VOD A;  5TGT A;  3IHU A;  1BR1 A;  3OSG A;  1MIJ A;  3D5S C;  3SZP A;  1DUX C;  3T8R A;  2E7X A;  2JA6 J;  1BM9 A;  5L3F A;  2LR8 A;  4MLO A;  4MTE A;  5H20 A;  3DU6 A;  2JMW A;  4HPQ A;  1QZY A;  3LAP A;  2Y48 A;  3MKL A;  2E1O A;  2LNB A;  3FHZ A;  5TRD A;  2CS3 A;  2KIS A;  4I6Z A;  1LB2 A;  1LDJ A;  4BY1 J;  2DJI A;  3DTK A;  3QRF F;  2E36 A;  2G7U A;  3VOE A;  2WB1 N;  2PLY A;  3S2W A;  2JTV A;  1LJ9 A;  1LVK A;  2GBY A;  3KYD B;  3WU1 B;  4OIR F;  3QWL A;  1X1C A;  2VKH A;  1Y0U A;  2X9D A;  1HA8 A;  3S3M A;  2O0Y A;  3F6V A;  3ZOB A;  2VBZ A;  4XIC A;  2GWR A;  3OIQ A;  5TJJ A;  1B8I B;  3BDD A;  1YG2 A;  1VF9 A;  5HS9 A;  1JE8 A;  4XKB A;  4BXF A;  3F21 A;  3I3L A;  3K4B A;  1MSF C;  1AKH A;  1SAU A;  2EFN A;  1EF4 A;  1NHA A;  3OYE A;  4XRF A;  4XN0 A;  1Z91 A;  2D45 A;  4CZZ A;  3VB2 A;  4D7N A;  2ISZ A;  2XGX A;  2J5O A;  2XHK A;  2CRG A;  2Y75 A;  4E6K G;  5K7H A;  1XX5 A;  1FLI A;  1E17 A;  2PX9 A;  4IQJ A;  1HKQ A;  1SD6 A;  4BHP A;  3RDI A;  1EJ9 A;  4YII A;  3J81 Z;  5L3D A;  1BA5 A;  3ZMD A;  1OCT C;  4RLQ A;  4Z2Y A;  1S5L C;  1WFX A;  2PI0 A;  1TW3 A;  3IH3 A;  1BIA A;  2OPT A;  2F4O B;  1Z7L A;  2EB7 A;  3IWZ A;  3P9I A;  2Z9O A;  4MNU A;  1D5V A;  4HBL A;  2V9P A;  1IV6 A;  2L9N A;  3DBR B;  1TBX A;  2A05 A;  2AQF A;  4E4H A;  2R5Z B;  3ZGK A;  1MBG A;  1VTN C;  2Y9Y A;  4RB1 A;  1D0X A;  1FIA A;  4EM1 A;  4RB3 C;  4UUS B;  3G73 A;  3S15 J;  1Y8Q B;  2IBD A;  5J6X A;  1XSX A;  2GXG A;  3W6J B;  1POG A;  5EF6 A;  3KZI C;  3VYR B;  2EBI A;  1OPC A;  5D6E A;  4XK4 A;  3BZC A;  1X1P A;  2DA4 A;  3CCV I;  5ICC A;  2K3P A;  2XC7 A;  1ZG5 A;  5DCM B;  4KIS A;  2ZFW A;  3SDB A;  2IT0 A;  2COB A;  4L9T A;  1WJA A;  3E6D A;  1WI3 A;  2Z99 A;  2CFX A;  3SHF A;  4ZZD A;  3BOQ A;  5L3E A;  2ESN A;  3CMY A;  1RR8 C;  2BY0 A;  5IOY A;  1T56 A;  1WH5 A;  3D5R C;  5J3L A;  1HW1 A;  1LDD A;  1YOV B;  5GPC A;  2WAD A;  3RSN A;  4F3Q A;  3QU6 A;  1Z6T A;  1ETY A;  3OIO A;  3I0T A;  1R1V A;  1B1B A;  4MFD A;  4CUG A;  3LAJ A;  3L2W A;  4XM3 A;  1ZGA A;  5IP6 A;  1R49 A;  4YIF A;  2IW5 A;  1LPQ A;  2OQG A;  2DDA A;  2DMN A;  5C4J J;  5K7Z A;  3WOD F;  3LA7 A;  4ENN A;  1T0F C;  1AA7 A;  4DBQ A;  3SEZ A;  4DYC A;  1OCZ H;  2OUM A;  3JTH A;  2IEK A;  4J01 A;  2ZFU A;  2UV1 A;  5J4Y A;  2WAF A;  1QVT A;  2A6H F;  4NNJ A;  3VYU B;  4IRI A;  1OMI A;  5FFZ A;  1N25 A;  3ZXS A;  4BEH B;  1EH6 A;  5LD2 C;  2HWV A;  4UVC A;  1RKW A;  2VL8 A;  3ZQL A;  4LK1 F;  3A1Y A;  3QOP A;  1JTX A;  4M3E A;  1VFC A;  1CF7 B;  3I5U A;  3CO6 C;  1W0T A;  3FBI B;  3GTK J;  4HDU A;  5HOD A;  4LIU A;  4LJZ F;  2BHZ A;  2M1B A;  4IO9 F;  2XAJ A;  2G7H A;  3HL2 A;  2K3F A;  2EIM H;  2HZT A;  1VQM I;  1UHS A;  2HOE A;  2R0Q C;  1Z7U A;  1B9N A;  4C3J J;  1EKE A;  2L54 A;  4UHT A;  4BAC A;  2QQ8 A;  4GCV A;  5E8G A;  1ZKG A;  4EJT A;  2HPI A;  3MMY B;  2AQE A;  2RGV A;  4EJW A;  1QA6 A;  3CDI A;  1XGM A;  1IAW A;  4FCY A;  1DDN A;  1HSJ A;  2XF5 A;  1K6O A;  1UHM A;  3IC7 A;  2FEZ A;  3S1N J;  2WC2 A;  2GAU A;  2ZCW A;  1HST A;  3C2B A;  3ONQ A;  4BBS J;  4BE0 A;  3LA2 A;  2JJ7 A;  2K9L A;  2ESH A;  3DFG A;  3FK7 A;  1PDN C;  4ZTF A;  4LB5 A;  2VBY A;  2YX4 A;  3HM5 A;  4NC8 A;  4A6D A;  2JPC A;  2OF7 A;  5FLM J;  2MD0 A;  5DCF A;  3D1N I;  4EMS A;  4M6X A;  2XAU A;  1XS9 A;  1BJA A;  2VIX A;  3CP2 A;  4CCO A;  5KAF C;  3HB9 A;  4HX7 A;  5IT3 A;  1GVD A;  4X0G A;  2M4G A;  3DKW A;  1J0R A;  1HXD A;  2P7C B;  1FBQ A;  2VE8 A;  4JP0 A;  3OS0 A;  4Y52 J;  3CF5 F;  2M8G X;  4RGU A;  3TO9 A;  1UB9 A;  4D9J A;  4Y15 A;  2H6B A;  2DK5 A;  3LSR A;  2VOP A;  2LF7 A;  1YTY A;  2DA3 A;  3AFH A;  2BV6 A;  3LFU A;  5FKN A;  2GLO A;  4L0Y B;  3GZ6 A;  1KA8 A;  4A5N A;  2V9K A;  1IN5 A;  2Y69 H;  3HSF A;  3ZMV A;  1Y1W J;  3LSI A;  2CUZ A;  4BQN A;  3U1K A;  3RI4 A;  1S29 A;  2DFF A;  3S32 A;  3OYJ A;  5LRS A;  1WVR A;  3KPH A;  1R23 A;  3VSL A;  4L0Z B;  3DXJ F;  4P9U A;  1O7L A;  4OAZ A;  3ZP5 A;  4XBF A;  1JUS A;  1MJ9 A;  4XOP A;  4OMZ A;  4JOM A;  3PL8 A;  4CO8 A;  5B3S H;  2XAH A;  3P9K A;  3RCO A;  1LEA A;  3KET A;  3BLY A;  3BR3 A;  1I3A A;  2DOD A;  4A3M J;  1WWX A;  4WX9 A;  3FXO A;  3RKW A;  1RIO H;  2V7F A;  1U5T A;  2X6X A;  4O3M A;  4A0Z A;  2V1D A;  2DA5 A;  4GYG A;  1O57 A;  3MWM A;  1KQ8 A;  2CV2 A;  4L9J A;  3U2R A;  2JRT A;  1W7P A;  2IJL A;  3HOT A;  4WXH A;  1T8I A;  2ZME C;  2AHQ A;  2JN6 A;  3KZY A;  1TTY A;  1PUE E;  3PO2 J;  3PNT A;  3KEQ A;  4H0E A;  1W36 C;  1WJE A;  2XPU A;  1J2X A;  5DTD A;  3OYL A;  5FKK A;  3BG9 A;  2KP6 A;  2LYC A;  4OWR B;  1D5Y A;  3IUO A;  2HXO A;  5EZG A;  2L9S A;  3HG9 A;  5BPI A;  4AVZ A;  3L9F A;  4ZJZ A;  2IVM A;  3DEE A;  4B47 A;  5IP9 J;  3JRB A;  1PP7 U;  2BHY A;  3KEY A;  5LEK A;  2CU7 A;  1P7J A;  2JA7 J;  4QLC U;  1RC9 A;  1X3W B;  2Z5U A;  2EA4 A;  2OCC H;  4E7Z A;  2MSY A;  2YU3 A;  1XDS A;  3GME A;  5F64 A;  3GTQ J;  4AIJ A;  3ZMZ A;  3DWL E;  3WGI A;  1FTT A;  1IXC A;  2ICW G;  4NBQ A;  3EUH C;  2H8R A;  1LE8 B;  1I6X A;  1KQ0 A;  2LH9 A;  3FK6 A;  1JKP C;  1Q1V A;  1IN6 A;  5HDK A;  1J75 A;  4YIR X;  2FD5 A;  1O4X A;  1XDU A;  2CFO A;  2Z3Y A;  3M1C A;  5K5O A;  4RDU A;  2GXB A;  2XKP A;  2ZSH B;  5ICG A;  1Z6R A;  3VEP A;  1SMT A;  4BL0 B;  2M45 A;  4UV9 A;  5E8I A;  2Q8K A;  1VQP I;  1R58 A;  1OCP A;  2CO5 A;  2IS2 A;  1RNL A;  2MYS A;  4BBR J;  2HNH A;  4JX5 A;  3MCZ A;  2EIJ H;  2Y30 A;  3BT9 A;  4A2U A;  4B1R A;  1RPW A;  2AO9 A;  4OIP F;  2K5C A;  2WBM A;  5LEJ A;  4C2U A;  2LRE A;  4FTH A;  4RGX A;  2ZKZ A;  3GWZ A;  3QYF A;  1MNE A;  2VOO A;  2ISY A;  3W6K B;  3G1O A;  3J7A Y;  2ZB9 A;  1BL0 A;  2XGD A;  4IHS A;  4LIV A;  2EFQ A;  5A2Q K;  4CCJ A;  2BEO A;  2M87 A;  2BY2 A;  2V79 A;  4CSW A;  3DEU A;  3M9A A;  2R5Y B;  2TDX A;  1DGW Y;  4M73 A;  1MGT A;  3VYT B;  3PO3 J;  3FMQ A;  4AM3 A;  2CQ7 A;  3F8M A;  1S7E A;  2IA0 A;  3PUB A;  1F4K A;  1VQL I;  2EPF A;  5EG0 A;  2VON A;  4BJT A;  2KHM A;  4G6Q A;  4I2O A;  1REP C;  2L7M P;  3AG4 H;  3CZ6 A;  3K4C A;  3V7R A;  2BXY A;  5HLT A;  2LMD A;  1CQT A;  4XOR A;  2FA5 A;  3PFY A;  4ZH4 F;  2MBF A;  1U8B A;  1FBS A;  2PMU A;  1K6Y A;  1ZGW A;  3NWT A;  1RUO A;  2ECC A;  4HLY A;  1KGS A;  1U6G A;  3CC2 I;  3BZK A;  3K1N A;  2MD5 A;  4GDF A;  5IYB J;  3DBH B;  3FXJ A;  4FQG A;  3FXL A;  1FWZ A;  2GOX B;  3CJT B;  3CDL A;  2KJC A;  5GPA A;  5D5X B;  4ZZL A;  2K9M A;  2DN0 A;  3A0B C;  3F6O A;  4RAY A;  1CGP A;  2PJR A;  5FKM A;  3HRT A;  1U8R A;  4DNC A;  2R7R A;  1QPI A;  1IXS B;  1FOK A;  3RYR A;  1ZLJ A;  4XMY A;  4IX7 A;  3ECH A;  4MFE A;  2VPL A;  4RM3 A;  3BG5 A;  1Z1D A;  2GOM A;  4ANJ A;  2DA1 A;  5HLI A;  5HDN A;  3HOX J;  4GRI A;  3FXQ A;  1QPM A;  3B6C A;  4L9V A;  2DI3 A;  3MQ0 A;  4P5O A;  3PNY A;  3ZQ7 A;  4A3D J;  2XPV A;  2ME0 A;  4II2 A;  3K70 C;  4XLH A;  3EDP A;  2DOF A;  2FBK A;  3ABK H;  2O3F A;  2OU2 A;  3DKY A;  3I64 A;  4G94 A;  1Z3X A;  2TRT A;  3HBL A;  2DQR A;  5LLQ A;  3OYM A;  3L2V A;  4E7I A;  4PFO A;  3IAM 2;  3HC7 A;  4KN4 X;  4NUB A;  4WF2 A;  2FX0 A;  3WHC A;  1IO2 A;  3LA3 A;  3K10 A;  4II3 A;  2YSR A;  3KLO A;  3X2Q H;  3F72 A;  2ZXJ A;  4KMU X;  2MGQ A;  4A69 C;  3J80 K;  3V7C A;  2A5Y B;  5JI6 A;  4PJN A;  1YHQ I;  3NAR A;  1P4A A;  3MVP A;  4DQ2 A;  1EV7 A;  4RA2 A;  2HQR A;  2OZU A;  2CW0 F;  5E20 A;  4HRI A;  2G9W A;  2HYG D;  3GZ5 A;  2MLG A;  4BXU A;  2Y2Z A;  4M71 A;  4F92 B;  2H8W A;  1LEB A;  3V4G A;  3EPZ A;  5ILS A;  1C0W A;  1DP3 A;  1TC3 C;  4A3I J;  2C6Y A;  1E3P A;  1UHW A;  3V7S A;  2COM A;  1YE9 A;  5CKT A;  4A3J J;  1U78 A;  3LQQ A;  1ACI A;  3GLL A;  4Q4Z F;  2FU4 A;  3IAS 2;  3DPU A;  1UZC A;  2DK8 A;  1DPU A;  4HF2 A;  2K40 A;  5JVG F;  2IA1 A;  1JHF A;  2ECB A;  3JCU C;  4ENM A;  3LSH A;  3IV5 A;  5GTI C;  2DYS H;  2GA2 A;  2PMH A;  4IKF A;  4MEX F;  1F43 A;  1P7I A;  2M0C A;  2HVQ A;  4B4C A;  3CCS I;  1UFM A;  3Q0U A;  3QYE A;  4GO1 A;  5FO5 A;  1IZ1 A;  2VQL A;  4BS9 A;  2VPR A;  4FIS A;  2D1H A;  1QGP A;  4PUS A;  2DT5 A;  5IY5 H;  4E7H A;  1XB4 A;  2IRF G;  3IH4 A;  1IV8 A;  1V55 H;  4U7D A;  3BJA A;  4Q5S F;  1Q1H A;  4ENJ A;  4HZF A;  4XLE A;  1SVO A;  4IOA F;  1U9N A;  1MBE A;  4V2F A;  4NQW A;  2QSH X;  4FAS D;  1ETO A;  3M3Y J;  2ACJ A;  2ETH A;  2P6T A;  2E2J J;  3DU5 A;  4IVN A;  2RQP A;  1W5C C;  2FNA A;  2BVM A;  4RB2 C;  2XB0 X;  1ZK8 A;  3EUA A;  1D8J A;  2EV5 A;  2ID6 A;  3KP2 A;  1XGS A;  1XSD A;  2KLO A;  5JHU A;  2STW A;  1BN5 A;  2F5V A;  5F0H A;  1FT9 A;  2LKP A;  3K6G A;  2PBI A;  4JBA A;  1MMD A;  2F4M B;  4Q47 A;  4R79 A;  2M30 A;  3CMM A;  1J9I A;  2V4J C;  5EEG A;  1NK2 P;  3TW7 A;  1JT6 A;  2L5Q A;  3ZRG A;  2B9S A;  4AYB A;  2QQ9 A;  2PG4 A;  3IH2 A;  3QP5 A;  1WJ5 A;  4XN3 A;  4KT6 A;  4PFP A;  4EM0 B;  2F48 A;  2RAE A;  4BAY A;  2WY8 Q;  2MH9 A;  2Y0M A;  3KLN A;  2W24 A;  1PJR A;  3DPL C;  3Q3S A;  1SD4 A;  3CMA I;  3TOB A;  3ZQH A;  3AAF A;  3SFZ A;  3BWG A;  3BG7 A;  1T39 A;  4V2G A;  3IRR A;  3IKT A;  3WTS C;  2UXX A;  1HBX G;  1MW7 A;  2Q2E B;  1TQI A;  2RDP A;  1ETK A;  3IKV A;  3R0J A;  2QEN A;  5F6F A;  1HLV A;  3ZPL A;  2D5V A;  1F9N A;  2MG4 A;  3UR3 C;  3W6V A;  5KVR A;  1G2H A;  2WV1 A;  5HS8 A;  3FKJ A;  2VC0 A;  4KMF A;  1OFC X;  1QRY A;  5KCM A;  3BR5 A;  3JRE A;  4P96 A;  4B48 A;  2K9S A;  1YW9 A;  1IDZ A;  3HTS B;  4IHT A;  2A68 F;  1U5T B;  2I5U A;  1HW5 A;  3KP4 A;  4LB6 B;  4CDG A;  1FPQ A;  5CVV A;  4B3A A;  1ZQ3 P;  1MH4 A;  2DT7 B;  2LKS A;  2RRE A;  1JI8 A;  5BPD A;  4YRV A;  4IRH A;  3R0A A;  5D5U B;  2LKX A;  3HGY A;  1E0E A;  3DF8 A;  2GIZ A;  2BXZ A;  2IGN A;  1VQ5 I;  1K61 A;  2CUJ A;  3GFJ A;  1IRX A;  1BR2 A;  4QIW N;  4S04 A;  3CJQ B;  2OV7 A;  2R7O A;  5L3G A;  1P92 A;  5CYV A;  3VWB A;  2FMY A;  4EJO A;  3OYA A;  2R4G A;  1FP1 D;  1SVL A;  1YS7 A;  2JK3 A;  2OQR A;  4HDV A;  1KU7 A;  3A02 A;  2BW3 A;  2E60 A;  3ZR8 X;  2VN2 A;  4KYW A;  1V5G A;  1EA3 A;  4HLX A;  1HQC A;  3K9T A;  1PYV A;  2KZG A;  2G0E A;  2KDZ A;  2XB5 A;  1YYV A;  3QOE A;  4IHW A;  4U87 A;  2FOW A;  2H1L A;  3FM5 A;  4M3G A;  2E2H J;  1I1G A;  3DLL F;  1YRN A;  2E1N A;  5F1J A;  1FZP B;  2EV6 A;  3M07 A;  2HDD A;  2VQH A;  2GA1 A;  1MBK A;  3GTJ J;  1WJF A;  5TIS C;  4LMY A;  2QGU A;  1JKQ C;  4I09 A;  1K83 J;  1NTC A;  3T0Y A;  2ZJQ F;  4J00 A;  3RZO J;  2ZXH A;  3BG3 A;  1SFU A;  5J8C A;  1B72 A;  2HOA A;  4S05 A;  2RV8 A;  5F27 A;  5E18 F;  3AG1 H;  3O8G A;  5M3F J;  3ZQG A;  2LOO A;  3LOC A;  2ID3 A;  2E1C A;  2DFH A;  2YPR A;  2QBY B;  3E1S A;  1X1D A;  1IN4 A;  3ZN0 A;  3KE2 A;  5LHI A;  5CVJ A;  2VJ5 A;  1JUP A;  3JSP A;  2P8T A;  1ORK A;  4FT8 A;  3CES A;  4CCM A;  2KIU A;  4ETS A;  3ZQF A;  4ZTJ A;  2EIK H;  4BHC A;  5JFR A;  1R7J A;  1GT0 C;  4DIQ A;  3GLX A;  2M4K A;  1O3S A;  3KP3 A;  3L1P A;  4PSW A;  4I02 A;  3R6S A;  2L7F P;  3LMM A;  3V42 A;  1ZH5 A;  2R92 J;  3RKY A;  2XV4 S;  4BE2 A;  2EFO A;  3ERE D;  1U0J A;  3S1R J;  3TO7 A;  3CCQ I;  1JKR C;  1XMK A;  1X4O A;  3MZ8 A;  3K1P A;  2BZT A;  1IG7 A;  2FOK A;  3GFI A;  3N05 A;  1ZLK A;  1E3O C;  3QOD A;  3OS2 A;  1UAA A;  4G7O F;  3H0D A;  4ESJ A;  4BXX J;  3D0S A;  4MQ9 F;  5EG0 B;  4IEJ A;  1T0F A;  4E7L A;  5JLX A;  3K0L A;  2X51 A;  1JUM A;  3I58 A;  4AYB N;  5ILU A;  2X0L A;  3PSF A;  1H0M A;  1I1S A;  3HJE A;  1ZR2 A;  3S2H J;  1ITY A;  4XLN F;  5B66 C;  1MH3 A;  4D5F A;  5E3L A;  3NAU A;  3OOP A;  1JJ8 C;  3QPH A;  1LDK B;  3H5A A;  2XAF A;  4G12 A;  1BC8 C;  3JAM Z;  4BQO A;  3WTX C;  1R36 A;  3DTI A;  3WTY C;  4ZYE A;  4QTR A;  4XLF A;  3ZMS A;  3HUG A;  1V54 H;  4Y3O A;  4ZYD A;  1DU6 A;  3TED A;  2O7O A;  2IGM A;  2W4S A;  3VDX A;  3CLO A;  5IPA A;  1H8A C;  3S16 J;  4XLP F;  2EIL H;  3ZMT A;  5CQG A;  1VQ4 I;  1TT0 A;  4KDP A;  2Q1Z B;  2MC3 A;  4N0B A;  1YW8 A;  4A3K J;  1W36 D;  1T98 A;  2HOS A;  3CO7 C;  4P55 A;  5GAD J;  2O6G E;  1UEL B;  5DUK A;  1FP2 A;  3BJ6 A;  1FMW A;  1P4W A;  1ZAO A;  4JK1 X;  4D5C A;  1X2N A;  4PJ0 C;  1BJZ A;  2FJ1 A;  3A01 A;  2V1U A;  1XCV A;  2LD5 A;  2HS5 A;  5FRM A;  1VND A;  3BQY A;  2CUE A;  2X85 A;  3HKZ A;  1PUF A;  2F5C A;  2IGO A;  1OCR H;  1B6A A;  3AG2 H;  1A6I A;  3N4M A;  3V8J A;  4LLN A;  5IYC J;  1Y8R B;  4AVP A;  3I53 A;  4M3D A;  3KYC B;  3OYF A;  3QAH A;  4I01 A;  4AU7 A;  4IHV A;  2VT3 A;  1Z21 A;  4ITV A;  3KP5 A;  4R8H A;  3EQL F;  1K78 A;  3HOZ J;  3I55 I;  1ON1 A;  4RS8 A;  5E1Z B;  1S72 I;  3WG7 H;  2CUF A;  2W25 A;  2P5K A;  2QKM B;  1GV5 A;  2HGC A;  1MMN A;  3FIW A;  2LSO A;  4CA0 A;  4Y17 A;  1WGX A;  1FYM A;  2B63 J;  1Y39 A;  3BTI A;  2RC4 A;  2H1K A;  2K4B A;  2OD5 A;  2LY1 A;  1BW5 A;  3BG6 A;  4KIF A;  2XDV A;  2LFB A;  2YR2 A;  3WTW C;  1RUN A;  2EA2 A;  1SFE A;  5GAE J;  2MFZ A;  3W2A A;  1J09 A;  3OY9 A;  2DTZ A;  4J19 A;  2NOJ B;  1ZG3 A;  1ZAR A;  3IP4 B;  3CUQ B;  4B8X A;  2IPQ X;  2ZJP F;  4BE1 A;  2V9V A;  3K2A A;  2Z16 A;  1OIS A;  3RKX A;  3CDH A;  4PSX A;  1YW7 A;  4LD5 A;  3K4J A;  3I54 A;  2HDC A;  2OJE D;  1R00 A;  3EYY A;  4QPO A;  1R9T J;  2EJR A;  2R7Z J;  1WPK A;  4XLA A;  1YX3 A;  4BKX A;  4LIT A;  2H27 A;  3SFI A;  2O5R A;  3MFK A;  4W1U A;  4AD9 A;  3M1E A;  2DMP A;  2QUF A;  1JT0 A;  2HR3 A;  1ETV A;  4CHU A;  2ZME A;  2EQR A;  3MKW B;  3G6E I;  2M7B A;  2JWT A;  3G2B A;  2VT2 A;  2FML A;  5FKO A;  2P7V B;  3TP3 A;  1N75 A;  3QPT A;  4CZC A;  1ZRD A;  1KON A;  6PAX A;  2KL4 A;  3S14 J;  2LF8 A;  1NK3 P;  2OAZ A;  2E71 A;  3S2D J;  3F23 A;  4L18 B;  2WAQ A;  3UNG C;  2IS4 A;  2X6W A;  2E1M C;  2VC1 A;  2M3A A;  3R60 A;  3K4N A;  3NQO A;  3SZT A;  1SAX A;  1MDM A;  5DD8 A;  2P5L C;  4XOT A;  4EJV A;  4B09 A;  2XGE A;  1IRZ A;  3I59 B;  5E79 C;  4BY7 J;  4DZP A;  5KHD A;  4XQF A;  1UJ8 A;  3SJM A;  1SD5 A;  4L9N A;  3HHG A;  4KIC A;  1U2W A;  4K2E A;  4Q48 A;  2LG4 A;  1TNS A;  2HPM A;  4LG0 A;  1TWA J;  2JRM A;  4BGD A;  4M6V A;  3S1M J;  4IHX A;  2ZXI A;  3HYI A;  4U0Y A;  3AL0 B;  4U0V A;  3K70 D;  4XSX F;  3O3K A;  2E7W A;  1IRG A;  1BI0 A;  1OCO H;  1SC7 A;  1O3T A;  1Y1V J;  4YFN F;  1R6R A;  2FRH A;  1D0Y A;  3RPU D;  1G6N A;  3G1M A;  2RNJ A;  4DW6 A;  1BI1 A;  1R4M B;  3TQN A;  4D0P A;  4KIT B;  1R1U A;  5KK1 A;  2O9L A;  2R7F A;  1D1A A;  2FE3 A;  1Y0N A;  3RIR A;  5BMZ A;  2GXA A;  1IJW C;  2R7U A;  2I10 A;  4E70 A;  3MD2 A;  1A04 A;  4XID A;  1NG7 A;  4A3G J;  2KQR A;  2R7X A;  2ADU A;  3E6M A;  4HF1 A;  1ZRF A;  4BH9 A;  2DPU A;  1FYL A;  1OQY A;  3E5X A;  3HKZ N;  4CGZ A;  2R7V A;  5E1X A;  4X6A J;  2K9Q A;  4BJ5 C;  1L3L A;  3M8E A;  1TNT A;  3T1B A;  4BJ6 C;  4D7M A;  2KDO A;  2QSF X;  3HSE A;  1G3Y A;  4M3B A;  3MAJ A;  1ZEL A;  5IT9 K;  3C18 A;  2FUG 2;  2HKX A;  1N78 A;  1HW2 A;  2R7T A;  2ZBK A;  1YO5 C;  1HF0 A;  2MC4 A;  4P1W A;  2IS1 A;  3F3X A;  4A93 J;  3ECO A;  1I50 J;  1JKO C;  5F0F A;  3K2Z A;  4PJM A;  3TL4 X;  2KMU A;  2H94 A;  3MZY A;  1LQ1 A;  2QQA A;  1U5T C;  3ASN H;  3FHN A;  4S0H B;  2V6E A;  3CJN A;  1FSH A;  1X58 A;  2L4M A;  4IF4 A;  3HGG A;  1KYW A;  1MMS A;  1IW7 F;  4BHB A;  1VQ6 I;  1B72 B;  1IN7 A;  3OYG A;  4KNY A;  2VAS A;  2I8D A;  2KFD A;  1FOX A;  1MMG A;  2W48 A;  3OYN A;  2GQQ A;  1G3T A;  4RAF A;  2XKO A;  1FTZ A;  4YEJ A;  3P9C A;  3ZQI A;  3W2V A;  3E6C C;  2OCE A;  1AKH B;  1P6R A;  5HNH A;  1O3Q A;  3BCA A;  1ENH A;  1QBJ A;  2M5W A;  1GVJ A;  4KIG A;  1VQ8 I;  4PGG A;  2DFE A;  2KIM A;  4OOI A;  1OYI A;  2XUB A;  3GF2 A;  3TMO A;  1IUY A;  2CYY A;  4AC0 A;  4HQE A;  1FNN A;  4HNV A;  4IXA A;  4LLG F;  3KP7 A;  2HYF A;  3M8J A;  1R5H A;  4UB6 C;  3CUO A;  5J4V A;  2PQ8 A;  3C2G A;  3F8C A;  4FE4 A;  5BOX A;  1SD7 A;  3CCM I;  2WA0 A;  3QU3 A;  1I39 A;  3O8H A;  4HEA 2;  2R5Z A;  1X3U A;  3DQV C;  3VOD A;  2A6E F;  1T95 A;  2NVT J;  4UUS A;  1RRJ A;  1WCM J;  2NAZ A;  3H92 A;  4OIQ F;  2XAS A;  5CPR B;  2WAQ N;  4AUX A;  1OR7 C;  3H36 A;  2DMU A;  1MJA A;  4A12 A;  2JA8 J;  2FXA A;  3QYB A;  4FX0 A;  2V6C A;  3U9G A;  5DCM A;  4ZYG A;  3PIO F;  2NS0 A;  3BCB A;  2XAQ A;  2VBW A;  4HX4 A;  2XSD C;  4DYQ A;  2YS9 A;  4RLF A;  3I4M J;  3ZMU A;  1ONV A;  4R1H A;  2L02 A;  3S8P A;  2IGK A;  3UKG A;  1WRJ A;  2CSO A;  1T08 B;  3VSK A;  1P9Q C;  3H9Q A;  2EZH A;  1S8N A;  1FBU A;  3JRD A;  5EZH A;  3F8B A;  3OR1 C;  4HNU A;  2H09 A;  3H3U A;  3BTC A;  3HUG B;  1E2X A;  3OS1 A;  4MGR A;  3OYC A;  3WTT C;  2QLZ A;  3PM1 A;  2RVC A;  2VB6 A;  2ZXW H;  4JYK A;  5GAH J;  3MN2 A;  4ZDP A;  4C9Y A;  2M8E A;  3BQZ A;  1SMY F;  2QZ8 A;  2NXN B;  2R7S A;  4E7S A;  1F5T A;  1RZ4 A;  5ED4 A;  4UVB A;  3JW4 A;  2BYV E;  3L2U A;  4XL9 A;  2QM3 A;  3WU0 A;  3AG3 H;  1GXQ A;  3BP8 A;  4Y7N J;  5J40 A;  1K79 A;  4PK4 A;  1PUF B;  4DJA A;  3E97 A;  1CF7 A;  3ISP A;  3WU2 C;  3ERM A;  2EZL A;  2GZW A;  3LNQ A;  1QQI A;  2X1E A;  3TO6 A;  3F8F A;  1LFU P;  1YQA A;  1GLN A;  5FGM A;  2WWY A;  3WTU C;  2BE5 F;  3LSP A;  3VYS B;  1YI2 I;  1K78 B;  1WJC A;  1FOY A;  3GCM A;  2AXT C;  1A5J A;  2EIN H;  3M4O J;  3BPX A;  3WHB A;  2E1M B;  2CG4 A;  4CYD A;  1Z3Y A;  4ENK A;  2ME6 A;  2NS8 A;  3MEX A;  5K1Y A;  4KFC A;  4NC6 A;  2A07 F;  3PJR A;  4RAZ A;  2XF6 A;  4I76 A;  3L2C A;  2UZK A;  4BDZ A;  1ETW A;  3RYP A;  1Z0X A;  1V4R A;  5FD5 A;  3S17 J;  4BDY A;  4RMN A;  2CMP A;  1XD7 A;  4GFB A;  3BTJ A;  4EM2 A;  3E3V A;  2VJ4 A;  2FSW A;  4KN7 X;  1STZ A;  4ON0 A;  4CCN A;  3CC4 I;  5DYM A;  2HZD A;  4KIB A;  4G7H F;  3FX3 A;  4OIO F;  4TV7 A;  3NRV A;  4JX4 A;  5J47 A;  4HV5 A;  1EH7 A;  4ZDO A;  3HPH A;  2AXL A;  9ANT A;  5K5R A;  1B9M A;  3VPR A;  1YX5 A;  1AHD P;  2X1D A;  2QQB A;  2HI3 A;  5DD4 A;  3CCU I;  3Q9S A;  1JXS A;  2KT0 A;  3HSR A;  2JVH A;  1D0Z A;  1XG1 A;  3CQZ J;  1FOW A;  1OCC H;  2OA4 A;  4WXC A;  3BJO A;  2JQ7 A;  3W2W A;  4B3X A;  4W97 A;  1R5G A;  1UST A;  2X1C A;  4WWC A;  3WE2 A;  5M3M J;  4HA8 A;  2BVL A;  5FLX Z;  2K27 A;  1OJL A;  4QWQ A;  2O61 A;  3CUQ C;  1TZL A;  4CCK A;  5B1B H;  1G3W A;  3ASO H;  3T5X A;  3JTG A;  1P4X A;  3K4M A;  3A2K A;  2JSC A;  3SEQ A;  3CME I;  2NVU B;  2W7N A;  1WJD A;  2L0K A;  2NYX A;  1YS6 A;  1T6S A;  2Z33 A;  4YG2 F;  4I0A A;  1H9G A;  2XAG A;  4IJA A;  1T33 A;  2DAO A;  4MQV A;  2AS5 F;  2HYJ A;  2ELJ A;  1T2K A;  3FIS A;  1TWF J;  5D4S A;  3FZV A;  1S6L A;  3C1D A;  5BQT A;  5F1R A;  4LG0 B;  2E2I J;  1ZRC A;  4ESF A;  1W7P B;  5F0C A;  3SDG A;  4YFK F;  3CJR B;  3AKZ A;  4ZYA A;  2DO7 A;  4GYI A;  2LVS A;  4A5M A;  4L5J A;  2H6C A;  1QHG A;  3H9G A;  4DGW B;  1W1W E;  3OV8 A;  2DPD A;  4CXF A;  4NDL A;  2Y31 A;  3TKY A;  2STT A;  3RQI A;  2FQ4 A;  1S3J A;  4LG3 A;  2NRA C;  3HOS A;  2Y0S A;  5IYD J;  1LVA A;  2F6C A;  5LHG A;  2XSJ C;  4AID A;  3ZCO A;  5C44 J;  1MKM A;  1ZGJ A;  2DLL A;  3A4C A;  4I7H A;  2DA7 A;  4KJZ A;  5C4X J;  4I0B A;  4HX8 A;  3L2Q A;  5DM7 F;  1X1A A;  2JUC A;  3FWE A;  2MAB A;  4Y33 A;  4NC7 A;  2L01 A;  1J5Y A;  2XVC A;  1DU0 A;  4BU2 A;  3H1C A;  3KCC A;  1QVU A;  2F5F A;  4UUT A;  4E7J A;  3L2R A;  5H6R A;  1UG2 A;  2VQC A;  5IP7 J;  3AL0 C;  1J7K A;  4YEL A;  3K4K A;  4C30 A;  4PJL A;  2X48 A;  1GUU A;  4GGG A;  3GEZ A;  3SXY A;  3E5Q A;  1FC3 A;  4IHY A;  1JGS A;  5D5W B;  2XRL A;  1FSE A;  1S9H A;  3WGH A;  4PZJ A;  3CD6 I;  4QSH A;  3JSO A;  2FF4 A;  1YIO A;  1BOA A;  2HXI A;  1XPX A;  2W1O A;  3LSK A;  1A31 A;  2ZJR F;  4PGH A;  3GVA A;  3LSG A;  3KIO A;  2D1V A;  2HQN A;  4MO7 A;  2XRO A;  4H4K C;  2YU9 J;  2A5W A;  4F52 A;  3DPT A;  1WKM A;  2UUZ A;  5CJ9 A;  4LOC A;  3OSF A;  5K7F A;  4U0W A;  2CV1 A;  1DQU A;  3S93 A;  2CH0 A;  2R5Y A;  4DYR A;  4DOZ A;  4OIN F;  4HAM A;  5FB2 A;  3A0H C;  1FYK A;  3JRC A;  3CCY A;  1XC5 A;  3Q9V A;  4M9Z A;  5FRO A;  3LSJ A;  3WE3 A;  2L7Z A;  5D5V B;  2FNP A;  3I4N J;  1WI9 A;  4HV6 A;  4OMY A;  5DV5 A;  2LK2 A;  1ERD A;  2BY3 A;  1R1T A;  3KFW X;  5HS7 A;  2QA4 I;  1H88 C;  1SEU A;  1VQK I;  1WSU A;  2CQQ A;  3C2H A;  1ETQ A;  2IP2 A;  3ZQQ A;  3TP0 A;  2B7E A;  2K4J A;  4HNT A;  4A3C J;  5CVR A;  1LFB A;  5J1U A;  4ABZ A;  3VFZ A;  3GW2 A;  3J81 K;  2K02 A;  5H6Q A;  2VBX A;  1GV2 A;  4N9I A;  1HCR A;  1V5E A;  4CYC A;  2W82 A;  4XR6 A;  1K7A A;  2PJR B;  2WAE A;  3HEF A;  4HQM A;  4AIH A;  5ILV A;  1NG6 A;  3RPQ A;  2ZC2 A;  1AU7 A;  2A6T A;  4BQA A;  3K4L A;  2XGC A;  4N4N B;  5ERI A;  2DA2 A;  1OKR A;  4C2T A;  3P5J A;  3QQA A;  4N4O B;  2LBF A;  4XKV A;  2MLK A;  3BR2 A;  4A0X A;  2FQ3 A;  4XSZ F;  3COA C;  2KIQ A;  3OR2 C;  2DYR H;  2W84 A;  4RB0 A;  1JGG A;  1I5Z A;  2M34 A;  5LGT A;  2LLK A;  3GBG A;  2K86 A;  3BR0 A;  4EJU A;  5ICF A;  1G8X A;  3JRA A;  2ELH A;  3DKX A;  1SAN A;  3NWS A;  3ZN1 A;  4EV0 A;  1GHC A;  3Q5F A;  1TWH J;  1A36 A;  3GUD A;  1RES A;  1W5T A;  3JAM K;  2QKL B;  4G9Y A;  4C2M J;  4BYY A;  2QWW A;  4Y13 A;  3DLA A;  2EZI A;  3J7A O;  2JSP A;  2QCO A;  2RKH A;  1KU2 A;  1I6H J;  2O03 A;  2VXD A;  1IXR C;  2Y0S N;  1FY7 A;  3F9K A;  3I56 I;  1BI3 A;  3F0C A;  3U21 A;  1Y56 A;  2TCT A;  1TLH B;  5FLV A;  5GP9 A;  2E19 A;  2LC2 A;  4I98 B;  4UVA A;  4IL6 C;  5EGO A;  5JLW A;  1BI2 A;  1SVM A;  4XON A;  2NOG A;  2YUS A;  2FBI A;  5HDG A;  4RBO A;  1VI0 A;  5E17 F;  3GTO J;  3GTG J;  4EQQ A;  5LGU A;  2HQ5 A;  4B43 A;  1Z67 A;  1IF1 A;  3B73 A;  5FD6 A;  3KYL A;  1V3F A;  3LSM A;  2KZV A;  1VQ9 I;  3GO5 A;  1USS A;  3IWF A;  4G7Z F;  1P2F A;  2P4W A;  1D8K A;  3LL7 A;  4L5E A;  1W7P D;  4CH7 A;  1ZG1 A;  1A35 A;  4A3B J;  1FX7 A;  4N9H A;  1LUJ B;  3FDY A;  3OYK A;  2R3S A;  1W0U A;  1ETX A;  1QO0 D;  4FE7 A;  2MH2 A;  2DMQ A;  2BOL A;  2QYO A;  4XKC A;  2WY7 Q;  4EVI A;  4UY8 I;  2J5P A;  4IQ4 A;  1LFP A;  5E1W A;  5EEH A;  3HXL A;  1TT5 B;  2KRC A;  4FX4 A;  2QVO A;  2HFH A;  3CCE I;  2HU9 A;  3MZH A;  1F1Z A;  2NNN A;  4NQW B;  5FFX A;  1FMV A;  1FEX A;  2RN7 A;  3B02 A;  2R7W A;  2JPB A;  4NHJ A;  3V8K A;  4A6E A;  1WQ2 A;  2DA6 A;  1JJ6 C;  3FMR A;  1TQP A;  1IDY A;  2DOE A;  1XSV A;  1OLT A;  3S1Q J;  1A6Q A;  2HQA A;  3GFL A;  1X4P A;  1XGO A;  3L09 A;  3ULQ B;  4MTD A;  5M5W J;  3H5R A;  1TP4 A;  2M0M A;  3QPL A;  4UUV A;  3RTR A;  2DXI A;  3CLQ A;  1WHU A;  4BQQ A;  2OZ6 A;  5DDG A;  2CQK A;  1WZ2 A;  1I3Q J;  2EZK A;  2W57 A;  4BNC A;  3E7L A;  4U88 A;  1UG0 A;  3K1M A;  5F04 A;  3GX4 X;  3H5N A;  5J8F A;  4BUP A;  4LLL A;  3ML6 A;  3CCR I;  5D4R A;  1BR4 A;  1KU9 A;  3PSI A;  5JR3 A;  3EUH A;  4HW0 A;  1MD0 A;  2R7D A;  2Q2E A;  3N97 A;  3HZJ A;  4B44 A;  1S7A A;  2NVQ J;  2N8G A;  4X1E A;  4F55 A;  2UWM A;  1LKX A;  2GIV A;  1W4M A;  3G1L A;  3WGG A;  2A3S A;  5AIQ A;  2W00 A;  1Z77 A;  1EH8 A;  3CP8 A;  5B5E C;  2VJJ A;  5H2F C;  4M72 A;  3OYI A;  1HC8 A;  1DPR A;  1Z05 A;  1XMX A;  4JQF A;  5HLH A;  5EJC A;  1HKS A;  3KX2 A;  1MBF A;  1G4D A;  4GXO A;  3HHH A;  3FXK A;  4UB8 C;  4WXD A;  1ZR4 A;  2CQX A;  1L0O C;  5IOZ A;  1JHH A;  1JTY A;  2JA2 A;  2DBB A;  4XRS G;  3H0G J;  4F91 B;  3J7Z I;  3OYD A;  2DFI A;  2IAI A;  2NS7 A;  2X6O A;  4MHG A;  3U1D A;  5CVU A;  2KKO A;  2LY2 A;  3MKY B;  5L3C A;  4FHT A;  1DGR M;  4EGZ A;  2JUG A;  1G59 A;  3QP6 A;  2OTL I;  1BIB A;  2KRF A;  1ZYR F;  5CLS A;  1RET A;  2WTE A;  5IT9 Z;  5JHF A;  2BY1 A;  3R4K A;  5D6F A;  1TL8 A;  4M3F A;  2F2E A;  3TW6 A;  2JZY A;  4HSR A;  1BC7 C;  4HOB A;  4V19 K;  2BW3 B;  2QSG X;  1MZB A;  4EAT A;  2HTS A;  3SZG A;  2B0L A;  1YJ9 I;  5FRN A;  3GTP J;  4O6J A;  3OIP A;  1D1C A;  2KJB A;  5D8L B;  2BGC A;  1XN7 A;  1G3S A;  5ICE A;  1OYW A;  4EEF G;  1MBH A;  5F08 A;  5LRR A;  3WTV C;  1BBY A;  1HDP A;  3WTZ A;  3Q0V A;  2Z2S B;  3OL3 A;  1D1B A;  4CIC A;  3S3N A;  1ODD A;  1YRN B;  2MA3 A;  5A2Q Z;  4U7B A;  1O3R A;  4LFU A;  1R71 A;  3PNV A;  3BRO A;  1K4T A;  3CC7 I;  3HOY J;  2NVY J;  4KA4 A;  1X1B A;  1TWG J;  1ZTR A;  2CW8 A;  3BTL A;  4C3I J;  1RKT A;  3TOA A;  5BNG A;  5LFA A;  5LBQ A;  2X6Y A;  2PJP A;  1T38 A;  3TDZ C;  3QPS A;  4LK0 F;  2YX7 A;  3BC8 A;  1B8I A;  1OR7 A;  2QBY A;  3P7N A;  4G6D A;  3OYH A;  2KRH A;  2ZNY A;  2L9V A;  4O5V A;  3CTA A;  5LGN A;  3EUK L;  3G3Z A;  2CQN A;  1S7O A;  2M7A A;  1APL C;  4IZZ A;  4KT5 C;  2PMZ A;  5HOO A;  1QNT A;  4IRG A;  3B6A A;  4OU0 A;  2EH3 A;  5J1Y A;  2HVR A;  1VZ0 A;  2V1N A;  2ZNZ A;  3OOU A;  2IS6 A;  3RPU A;  2R7Q A;  4CCL A;  1IC8 A;  2K7L A;  2EWN A;  1SFX A;  2RQQ A;  1OYY A;  3KP6 A;  1IGN A;  3RZD J;  4HF0 A;  1K4S A;  1MSE C;  3GZN B;  1RR7 A;  1ZN2 A;  2L9R A;  4HYE A;  2VLA A;  1SFO J;  2LP0 A;  1H9T A;  1XTA A;  4MIM A;  5E3N A;  2XIG A;  2HVS A;  2L3D A;  1R4N B;  2HDW A;  3I4P A;  2P5V A;  4ZYH A;  2KIF A;  5DUI A;  3FXU A;  1QZZ A;  3PQJ A;  2DTR A;  2GM4 A;  2IXS A;  3GYH X;  3C7J A;  1IUF A;  1WH7 A;  4F93 B;  3J7Y J;  1X2M A;  1E3H A;  1HOM A;  2ZJ2 A;  1I27 A;  3KZZ A;  5DEQ A;  1ZRE A;  1U9O A;  4KUM A;  4HST A;  3BZ6 A;  4NB5 A;  1NH3 A;  1YJW I;  4UV8 A;  1LNW A;  2P0W A;  1PP8 F;  5DS9 A;  4CYC B;  3GTL J;  2VKE A;  3O6B B;  3BPV A;  3J80 Z;  3R61 A;  3G71 I;  1X19 A;  1RI7 A;  1UCR A;  2PFB A;  2LTP A;  3OMY A;  1GXP A;  3BR6 A;  3CF2 A;  1J59 A;  5JVT A;  5M5Y J;  1M1E B;  4M9X A;  5E3O A;  2VXZ A;  1XCB A;  5AIP A;  2LBF B;  3HRS A;  4RM2 A;  4HG2 A;  3DCF A;  1QU3 A;  3KEO A;  2DJN A;  1MMA A;  3DBL B;  3PUF A;  4OAY A;  3LFK A;  1DP7 P;  2OC6 A;  4L5I A;  3LWF A;  4MEY F;  3K69 A;  1KZH A;  3G4S I;  4RGS A;  4I99 C;  2CWE A;  3RJP A;  1FJL A;  2DDB A;  2VI6 A;  3I71 A;  5E3M A;  2Y9Z A;  3HIF A;  3C3W A;  4AWX B;  4XRS A;  1V5F A;  2OBP A;  4BEH A;  3A01 B;  3HOW J;  2DW4 A;  2F4I A;  3GFM A;  5KNL A;  4ESB A;  2CGP A;  3OYB A;  1VQN I;  2VUM J;  5M5X J;  2NVX J;  3GXO A;  3NEU A;  4UNO A;  3FM3 A;  2EK5 A;  4WK8 F;  2HOT A;  3A03 A;  1ZHF A;  2R93 J;  2PEX A;  4AIK A;  3HDD A;  2QF7 A;  5GAG J;  3HOU J;  4LGW A;  3JRF A;  2E34 A;  2D2W A;  1WJB A;  4ASN A;  3W3C A;  2X4H A;  3D5L A;  5EEA A;  1N77 A;  3HOV J;  1KU3 A;  3LQR A;  3HRM A;  4UXN A;  2DT6 A;  2L7K A;  3JRG A;  3E0J B;  2EFP A;  5CVI A;  5KAI C;  2K85 A;  2XRN A;  1XMA A;  1W5S A;  3DTE A;  2XPW A;  5EGO B;  1TW2 A;  3F22 A;  4XNF A;  2WB1 A;  4PJJ A;  3L00 A;  2CV0 A;  2P6S A;  4QPQ A;  3WG9 A;  4PDK A;  3FF5 A;  2JA5 J;  1PVE A;  2BBY A;  2VJI A;  2UXN A;  3H3V K;  4DZJ A;  4IOC F;  4EGY A;  1FIP A;  2VKV A;  1ON2 A;  3FXM A;  3HTU A;  3CUQ A;  3PQK A;  1BOB A;  4E7K A;  3GTM J;  1Z9C A;  2A61 A;  1Y6I A;  1SFK A;  2VKD A;  2JT1 A;  1MNM C;  1YIT I;  5K5Q A;  2VE9 A;  1XGN A;  3CCJ I;  2VQG A;  3DEW A;  2O8K A;  1VQO I;  3OL4 A;  1U3E M;  1F36 A;  3SQN A;  1BW6 A;  3ROU A;  2M9H A;  4M74 A;  2P81 A;  3ELK A;  2ZO4 A;  3K7A J;  3JR9 A;  4A3E J;  3LST A;  2L2O A;  3M7G A;  3DV8 A;  5GTH C;  2L4A A;  3PFI A;  4RAG A;  4G8X A;  4DBR A;  2WV0 A;  3TGN A;  2EV0 A;  2PMZ N;  5CQE A;  1KYZ A;  3ABL H;  5L3B A;  1YFH A;  4Z6Y A;  1YJN I;  1O7F A;  1TWC J;  4M6Y A;  1H89 C;  2PN6 A;  5AON A;  4XRM A;  2ZME B;  1YLF A;  3BY6 A;  3FBN B;  5EYR A;  1IN8 A;  3JRH A;  2JVG A;  2Q0O A;  4A3F J;  1R22 A;  4IPA A;  2E35 A;  1IRF A;  4FET A;  3RQ4 A;  3M8F A;  3PIP F;  2XF7 A;  5BS6 A;  2E5N A;  3IL2 A;  1B59 A;  3EET A;  2DMT A;  4M9S A;  3L7W A;  3RKQ A;  1AOY A;  1B4A A;  4PCQ A;  2HTJ A;  2LRD A;  3FXR A;  4RGR A;  5HLG A;  4A0Y A;  3BR1 A;  3ABU A;  3H9J A;  4JX6 A;  1QHH D;  3I59 A;  5D8K B;  1MDM B;  3REO A;  2V1X A;  4ZDL A;  5DM6 F;  2ELK A;  3ABM H;  3V8L A;  2E5Z A;  2KPM A;  3EYI A;  2W85 A;  3FMS A;  3I9V 2;  1MND A;  3Q0W A;  1GDT A;  2MW8 A;  2DU9 A;  4Y4R A;  2EFW A;  4XLC A;  4WCG A;  2HKO A;  2LY9 A;  1MBJ A;  5HVQ C;  2CJJ A;  4G6T B;  2A69 F;  1TQM A;  2FBH A;  3OWT A;  1YIJ I;  2HEO A;  3HRU A;  2QEX I;  2NNY A;  5FLX K;  4YFX F;  3ZQC A;  5FJ8 J;  3E5U A;  1KQ9 A;  2DOA A;  3JRI A;  3O2P E;  5FKL A;  5B1A H;  1UMQ A;  3DP7 A;  1QZE A;  3ABT A;  3E6B A;  1MJB A;  1R5I D;  3S3O A;  1AWC A;  2IA2 A;  4C3H J;  1HDD C;  3IRQ A;  3T8T A;  4ZC3 A;  4F7Z A;  2F5E A;  4P9F A;  1VQ7 I;  5J1R A;  2K9N A;  2DQL A;  3MKZ A; 
#chains in the Genus database with same CATH homology
 1IJW C;  4A69 C;  2I10 A;  5C3E J;  1RES A;  3NAR A;  4XID A;  4C2M J;  3MVP A;  4A3G J;  4A3L J;  5EDN A;  2M2E A;  2EZI A;  3HKZ N;  2QCO A;  1I6H J;  4X6A J;  1LE8 A;  2Y0S N;  2K9Q A;  3FKI J;  2Y2Z A;  3F0C A;  3OSG A;  2TCT A;  4D7M A;  5FLV A;  5GP9 A;  2E19 A;  2JA6 J;  5EGO A;  1TC3 C;  4A3I J;  5JLW A;  4M3B A;  2LR8 A;  2NOG A;  2YUS A;  4MLO A;  4RBO A;  1VI0 A;  4A3J J;  1U78 A;  3GTO J;  2JMW A;  1HF0 A;  3GTG J;  2HQ5 A;  4A93 J;  1JKO C;  1I50 J;  3MKL A;  2E1O A;  5F0F A;  2K40 A;  2ECB A;  3IV5 A;  4S0H B;  4L5E A;  4I6Z A;  4A3B J;  4BY1 J;  1F43 A;  1X58 A;  1P7I A;  2M0C A;  2WB1 N;  3HGG A;  4B4C A;  2GBY A;  3Q0U A;  1W0U A;  1ETX A;  4FE7 A;  1B72 B;  2DMQ A;  2VPR A;  2X9D A;  4FIS A;  3ZOB A;  4XIC A;  2W48 A;  1B8I B;  1VF9 A;  3IH4 A;  1MSF C;  1FTZ A;  3ZQI A;  1AKH A;  1U9N A;  1MBE A;  4V2F A;  1AKH B;  1EF4 A;  1ETO A;  3M3Y J;  4D7N A;  1FEX A;  1ENH A;  2E2J J;  5K7H A;  2CRG A;  2XB0 X;  1ZK8 A;  2DA6 A;  2ID6 A;  1JJ6 C;  4AC0 A;  1IDY A;  4HNV A;  5F0H A;  3S1Q J;  1BA5 A;  5M5W J;  1OCT C;  3QPL A;  3IH3 A;  2OPT A;  4FE4 A;  3TW7 A;  1NK2 P;  1JT6 A;  3IH2 A;  3O8H A;  1IV6 A;  2R5Z A;  1I3Q J;  2EZK A;  2R5Z B;  2RAE A;  1MBG A;  2NVT J;  2Y9Y A;  4UUS A;  3E7L A;  5F04 A;  1WCM J;  1FIA A;  4UUS B;  3S15 J;  3Q3S A;  2IBD A;  2WAQ N;  4AUX A;  1POG A;  2DMU A;  3ZQH A;  5EF6 A;  2EBI A;  2JA8 J;  4XK4 A;  2DA4 A;  4V2G A;  2NVQ J;  1ETK A;  2N8G A;  4X1E A;  1HLV A;  2XSD C;  4DYQ A;  2YS9 A;  3I4M J;  2D5V A;  2COB A;  3G1L A;  2MG4 A;  3W6V A;  1WI3 A;  1Z77 A;  3UKG A;  1G2H A;  2WV1 A;  3CMY A;  5IOY A;  1OFC X;  1QRY A;  1T56 A;  1WH5 A;  2EZH A;  3BR5 A;  5J3L A;  3JRE A;  5GPC A;  3JRD A;  2K9S A;  5EZH A;  1MBF A;  1IDZ A;  3BTC A;  1ETY A;  3OIO A;  1ZQ3 P;  1ZR4 A;  2CQX A;  4B3A A;  4MFD A;  1MH4 A;  5IP6 A;  5IOZ A;  1JTY A;  3PM1 A;  4XRS G;  3H0G J;  4JYK A;  2LKX A;  2DMN A;  2IAI A;  2NS7 A;  2X6O A;  3HGY A;  3MN2 A;  5K7Z A;  5C4J J;  4DYC A;  3BQZ A;  1K61 A;  4QIW N;  2IEK A;  1QVT A;  2JK3 A;  1RET A;  4Y7N J;  3A02 A;  4M3F A;  3TW6 A;  1PUF B;  1RKW A;  3ZQL A;  4M3E A;  1JTX A;  1VFC A;  3GTP J;  2EZL A;  3LNQ A;  2G0E A;  4EEF G;  2XB5 A;  1MBH A;  5F08 A;  2KDZ A;  1W0T A;  4IHW A;  5HOD A;  1LFU P;  1HDP A;  4M3G A;  3Q0V A;  2E2H J;  3GTK J;  1YRN A;  5F1J A;  2HDD A;  3LSP A;  3GTJ J;  1MBK A;  1YRN B;  1JKQ C;  1UHS A;  1K83 J;  1A5J A;  1NTC A;  2R0Q C;  4C3J J;  3HOY J;  3M4O J;  2NVY J;  3RZO J;  3WHB A;  1TWG J;  3BG3 A;  1ZTR A;  4C3I J;  3BTL A;  2NS8 A;  2ME6 A;  1RKT A;  5BNG A;  1B72 A;  1ZKG A;  2HOA A;  5F27 A;  3QPS A;  4I76 A;  3O8G A;  5M3F J;  4FCY A;  1B8I A;  1ETW A;  3ZQG A;  3LOC A;  2ID3 A;  1Z0X A;  3S1N J;  3S17 J;  3C2B A;  4GFB A;  1JUP A;  3BTJ A;  4BBS J;  1ORK A;  2JJ7 A;  1APL C;  3ZQF A;  1GT0 C;  3FK7 A;  3HM5 A;  3B6A A;  3L1P A;  2EH3 A;  5J1Y A;  2OF7 A;  5FLM J;  4JX4 A;  2L7F P;  3D1N I;  2R92 J;  3OOU A;  1XS9 A;  1IC8 A;  9ANT A;  3HB9 A;  1GVD A;  3S1R J;  1JKR C;  1IGN A;  3VPR A;  3RZD J;  1MSE C;  1RR7 A;  2L9R A;  4JP0 A;  1AHD P;  2HI3 A;  4Y52 J;  2M8G X;  1IG7 A;  2KT0 A;  1SFO J;  2LP0 A;  1XG1 A;  3CQZ J;  4MIM A;  1E3O C;  5E3N A;  3LSR A;  4BXX J;  5EG0 B;  4IEJ A;  2DA3 A;  5JLX A;  4W97 A;  1JUM A;  5FKN A;  2GLO A;  4AYB N;  2GM4 A;  1ZR2 A;  1IUF A;  1Y1W J;  5M3M J;  3S2H J;  1WH7 A;  1ITY A;  1X2M A;  1OJL A;  1HOM A;  1MH3 A;  4D5F A;  5E3L A;  1U9O A;  3NAU A;  1JJ8 C;  2L0K A;  1JUS A;  5DS9 A;  4CYC B;  3GTL J;  2VKE A;  4G12 A;  3BR3 A;  2LTP A;  4A3M J;  1T33 A;  2HYJ A;  3BR6 A;  4QTR A;  3FIS A;  1TWF J;  1DU6 A;  5M5Y J;  3TED A;  2O7O A;  5E3O A;  2DA5 A;  5IPA A;  1H8A C;  3S16 J;  2E2I J;  2AHQ A;  5F0C A;  3DCF A;  3SDG A;  2JN6 A;  2DJN A;  4A3K J;  3PO2 J;  2HOS A;  2LVS A;  2XPU A;  5DTD A;  5FKK A;  3BG9 A;  1D5Y A;  1FJL A;  2VI6 A;  4NDL A;  2Y31 A;  5E3M A;  4D5C A;  1X2N A;  2HXO A;  1BJZ A;  2FJ1 A;  5EZG A;  4XRS A;  3A01 A;  2LD5 A;  2Y9Z A;  3HOW J;  3A01 B;  1VND A;  3BQY A;  2CUE A;  1PUF A;  3RQI A;  2FQ4 A;  1A6I A;  2VUM J;  5IYD J;  5M5X J;  2NVX J;  5IP9 J;  3JRB A;  5IYC J;  5C44 J;  2CU7 A;  1P7J A;  2JA7 J;  2HOT A;  2DA7 A;  5C4X J;  4M3D A;  4IHV A;  2MSY A;  3A03 A;  2R93 J;  3HDD A;  3GTQ J;  2QF7 A;  3HOU J;  3JRF A;  1FTT A;  3HOZ J;  1DU0 A;  2H8R A;  1LE8 B;  1QVU A;  3FK6 A;  4UUT A;  1JKP C;  1Q1V A;  2CUF A;  5IP7 J;  1UG2 A;  5EEA A;  1GV5 A;  3HOV J;  2FD5 A;  1O4X A;  3FIW A;  2X48 A;  1GUU A;  4RDU A;  3JRG A;  1WGX A;  2B63 J;  3BTI A;  2H1K A;  4IHY A;  2XRL A;  2XPW A;  5EGO B;  1BW5 A;  1OCP A;  2LFB A;  4QSH A;  4BBR J;  2JA5 J;  3H3V K;  2DTZ A;  4JX5 A;  4DZJ A;  2HXI A;  2Y30 A;  3BT9 A;  1FIP A;  2VKV A;  4B1R A;  4J19 A;  1RPW A;  2AO9 A;  3GTM J;  3LSG A;  3K2A A;  1MNM C;  4MO7 A;  4FTH A;  2YU9 J;  3G1O A;  3DEW A;  2ZB9 A;  1R9T J;  2O8K A;  2R7Z J;  1BL0 A;  2XGD A;  1F36 A;  1WPK A;  1BW6 A;  2M9H A;  4LOC A;  3OSF A;  5K7F A;  2P81 A;  4BKX A;  3K7A J;  2R5Y A;  3SFI A;  4DYR A;  3JR9 A;  2R5Y B;  4A3E J;  4W1U A;  3PO3 J;  2DMP A;  1S7E A;  2PMZ N;  3JRC A;  3CCY A;  1H89 C;  1JT0 A;  1XC5 A;  1TWC J;  3LSJ A;  1ETV A;  2L7Z A;  2EQR A;  3I4N J;  4XRM A;  5EG0 A;  5EYR A;  2JWT A;  3JRH A;  2L7M P;  2LK2 A;  5FKO A;  4A3F J;  3TP3 A;  1CQT A;  1H88 C;  3S14 J;  1U8B A;  2CQQ A;  1NK3 P;  1ETQ A;  1ZGW A;  2ECC A;  3S2D J;  3TP0 A;  2DMT A;  4A3C J;  5IYB J;  1LFB A;  5J1U A;  4ABZ A;  3RKQ A;  1GV2 A;  3CDL A;  3BR1 A;  1HCR A;  5GPA A;  4JX6 A;  4CYC A;  2DN0 A;  2XGE A;  1IRZ A;  4BY7 J;  5FKM A;  1QPI A;  4DZP A;  3HEF A;  3SJM A;  2ELK A;  4MFE A;  1AU7 A;  3Q0W A;  1GDT A;  2MW8 A;  3BG5 A;  2XGC A;  1TWA J;  2DA2 A;  2DA1 A;  4M6V A;  3HOX J;  3QQA A;  3S1M J;  2LY9 A;  1MBJ A;  4IHX A;  2CJJ A;  3B6C A;  3BR2 A;  4A3D J;  2XPV A;  2ME0 A;  1Y1V J;  3ZQC A;  1JGG A;  5FJ8 J;  2M34 A;  2TRT A;  3HBL A;  3JRI A;  2LLK A;  3G1M A;  3GBG A;  5FKL A;  4DW6 A;  1UMQ A;  3BR0 A;  3JRA A;  2FX0 A;  3WHC A;  1HDD C;  4C3H J;  2O9L A;  1SAN A;  5J1R A;  2K9N A;  2MGQ A;  1TWH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...