2MG4A

Computational design and experimental verification of a symmetric protein homodimer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
66
structure length
66
Chain Sequence
MEKRPRTEFSEEQKKALDLAFYFDRRLTPEWRRYLSQRLGLNEEQIERWFRRKEQQIGWSHPQFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Computational designed homodimer
publication title Computational design and experimental verification of a symmetric protein homodimer.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 17
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2mg4A00
2DA1A 1HOMA 2LD5A 3BTIA 3JRAA 3Q0WA 1IG7A 2JA7J 4A69C 2ECBA 1UMQA 2P81A 5GP9A 4A3LJ 5JLXA 3GTMJ 4M3EA 2D5VA 1ZTRA 1TWHJ 4JX4A 4DZJA 1BL0A 1Z0XA 3VPRA 4RBOA 2JJ7A 4AC0A 1JKQC 3QPLA 5EYRA 1Q1VA 5FKMA 4XRSG 3HOVJ 4A3BJ 1FIAA 1B72A 2JA6J 2MGQA 2ME0A 4L5EA 5IP9J 5J1UA 1AHDP 2Y9ZA 1MH3A 1APLC 1I6HJ 2FQ4A 3RZOJ 2K9SA 3QPSA 2LY9A 3BT9A 4DYCA 2I10A 2HXIA 2XPWA 5FLMJ 2CUFA 1AKHB 4V2FA 5F27A 1RPWA 1QPIA 3WHBA 2CQXA 3JRBA 3TEDA 1T56A 1YRNB 3GTPJ 1JKPC 3BR1A 4C3IJ 4A3EJ 1F36A 2L7ZA 3MKLA 5F0FA 3S14J 1VI0A 3A02A 2QF7A 2LKXA 1H8AC 1FTTA 4GFBA 1XG1A 2RAEA 1WH5A 1X2NA 3E7LA 1VNDA 2LP0A 3TW6A 4BY7J 3ZQHA 2VUMJ 3S2DJ 1RKWA 2HOTA 4I76A 5J1YA 4D7MA 1HDPA 2E1OA 5IYBJ 1U9NA 1LE8B 4S0HB 4JX6A 2K40A 3JRGA 1WGXA 3FIWA 3HKZN 3D1NI 5F04A 3JRIA 4AYBN 3S1NJ 5E3OA 2O8KA 3GTQJ 4DZPA 3OSGA 2M2EA 1AU7A 2HOSA 2VKEA 1LFUP 5J3LA 3TW7A 1VF9A 2ELKA 2M8GX 5IOZA 1NTCA 3CQZJ 2HQ5A 4M3BA 1UHSA 3JRDA 3JREA 5IP7J 1UG2A 2DMQA 2LVSA 2CJJA 4JP0A 5C4JJ 4MFDA 4M3DA 3G1OA 1Y1VJ 9ANTA 2B63J 4I6ZA 3F0CA 1OCTC 3IH4A 5F0CA 2HXOA 1DU6A 1GV5A 5EG0A 3HGYA 2TCTA 3O8GA 2ID6A 3HB9A 1MBJA 2DMNA 3RZDJ 2HI3A 3OOUA 3DCFA 1H88C 1MNMC 3S15J 3BG3A 3HDDA 5FKOA 5C3EJ 3LOCA 3FK7A 3M3YJ 3FK6A 1IDYA 5FJ8J 2R5YB 4FE7A 1Y1WJ 4BXXJ 1EF4A 2VPRA 5DS9A 5FKKA 1D5YA 3OIOA 1ETKA 1ETVA 1ETWA 3K7AJ 4A3FJ 3O8HA 1IDZA 2XPVA 1RKTA 5EF6A 1ENHA 1ZQ3P 2OPTA 2Y30A 1BJZA 2K9QA 1RR7A 1K61A 2VKVA 1I50J 3IV5A 1Z77A 3SFIA 5BNGA 1T33A 2DMTA 3JR9A 1IGNA 1F43A 2CUEA 4MFEA 2E2HJ 2LTPA 5FLVA 3GTLJ 5IYCJ 1GV2A 1ZK8A 1U8BA 5HODA 3LSPA 1ETYA 4LOCA 5C44J 4QIWN 2XGEA 4UUSA 4IHXA 5EEAA 5GPCA 2X9DA 3RQIA 2CU7A 4G12A 4FTHA 2WV1A 1FTZA 1B72B 4C3JJ 1WPKA 5E3LA 2E19A 3IH2A 2DA2A 3S1MJ 2K9NA 2IBDA 2LK2A 3GTOJ 1SFOJ 4FISA 2DA5A 2FD5A 2NOGA 4X1EA 2NVQJ 2ID3A 4IHVA 3BR6A 2YU9J 3A01A 1A6IA 1JT6A 2KDZA 2M9HA 2MW8A 3PO2J 1VFCA 1U78A 1WH7A 2JWTA 3LSGA 1ZR4A 5GPAA 4IEJA 2R0QC 1I3QJ 1H89C 4V2GA 2DA3A 4DYQA 3DEWA 2JK3A 3NARA 1R9TJ 2L9RA 4BY1J 1NK2P 4BKXA 4C2MJ 3BTCA 1BW6A 4IHWA 2QCOA 3JRCA 3GTGJ 2HOAA 2R5ZA 2XRLA 3LNQA 4D7NA 3M4OJ 2COBA 1XS9A 5M3MJ 2HYJA 3UKGA 3BR0A 2DJNA 1JUPA 1PUFA 2DA7A 1MH4A 2MG4A 1GDTA 4QSHA 2X48A 2WAQN 2R5ZB 3QQAA 2WB1N 3LSRA 5FKNA 4A3IJ 2AHQA 2O9LA 2L0KA 4CYCA 1HLVA 5M3FJ 3HM5A 4A3DJ 1HF0A 3MVPA 2YS9A 3CCYA 4XICA 5IP6A 2DMUA 2HDDA 3TP3A 3BR5A 2DA6A 1FEXA 2VI6A 5K7FA 2L7MP 5J1RA 1IV6A 2JN6A 2EZHA 4A3CJ 4RDUA 3BG5A 4XK4A 4MO7A 3BG9A 1B8IA 2NVYJ 3JRFA 3I4NJ 4BBRJ 1G2HA 1JUMA 1ORKA 2R7ZJ 1QVTA 3OSFA 3B6CA 4JX5A 3WHCA 4NDLA 3HOYJ 2NS8A 1JJ6C 3FKIJ 2N8GA 2CQQA 3Q3SA 4AUXA 1BA5A 1ZR2A 4XRSA 2Y0SN 1IRZA 1ZGWA 1JKOC 5EZHA 1HCRA 5EG0B 1MBEA 5EGOA 2H1KA 3S1QJ 3RKQA 3HBLA 1K83J 1A5JA 3GTKJ 2H8RA 3H0GJ 1LFBA 1TC3C 1S7EA 4MLOA 5M5WJ 3G1MA 2X6OA 3ZQGA 3ZQLA 2LR8A 3C2BA 5EGOB 2DMPA 3S2HJ 4DW6A 2EQRA 1JTYA 5JLWA 1WCMJ 3ZQCA 4BBSJ 5M5XJ 2EH3A 3FISA 2KT0A 2IAIA 2LFBA 3SJMA 2Y2ZA 2NVTJ 1JT0A 4D5CA 5K7ZA 4B1RA 5M5YJ 3PO3J 5EZGA 4XIDA 2R92J 2EZLA 5E3MA 3H3VK 2W48A 4D5FA 2OF7A 5F0HA 1BW5A 1DU0A 3CDLA 5C4XJ 4A3MJ 3S17J 5IYDJ 3B6AA 2JMWA 1O4XA 5F1JA 2FX0A 1MSFC 4C3HJ 4UUSB 1IC8A 4A3JJ 3SDGA 1W0TA 4W97A 3MN2A 3HOXJ 4IHYA 1HDDC 2XGDA 3BQZA 1FJLA 2E2IJ 1X2MA 3HGGA 1JKRC 4A3KJ 1MBHA 2TRTA 3NAUA 3BR2A 2LLKA 4J19A 3BQYA 2O7OA 3BTJA 4MIMA 3BTLA 1OJLA 2MSYA 1GUUA 1OCPA 1IUFA 1AKHA 1QRYA 4QTRA 4B4CA 4HNVA 1E3OC 1FIPA 2IEKA 1ZKGA 1XC5A 1YRNA 2YUSA 1JGGA 5DTDA 3A01B 2NVXJ 3ZQIA 1ETXA 5IPAA 4Y52J 3G1LA 2R93J 1MBFA 1QVUA 4UUTA 1GT0C 2EZKA 3HEFA 3W6VA 3S1RJ 2G0EA 1OFCX 4XRMA 1JUSA 4Y7NJ 3HOZJ 1TWFJ 1LE8A 3Q0VA 1MBGA 4M3FA 1PUFB 2CRGA 4A3GJ 1GVDA 2XGCA 1JTXA 3BR3A 1TWAJ 3L1PA 1ETQA 4JYKA 3PM1A 3IH3A 4CYCB 5F08A 3ZOBA 1ETOA 4M6VA 2ECCA 4X6AJ 5FKLA 4W1UA 3JRHA 2ME6A 3Q0UA 3ZQFA 1POGA 2XB0X 3HOUJ 1RESA 1IJWC 1X58A 2M34A 3S16J 1MBKA 2AO9A 4EEFG 3GTJJ 2GLOA 1B8IB 5E3NA 2DA4A 1TWGJ 1CQTA 2PMZN 1ITYA 4FE4A 2FJ1A 3GBGA 4M3GA 1TWCJ 1U9OA 1P7IA 2EZIA 2E2JJ 4FCYA 3I4MJ 1P7JA 2R5YA 2XPUA 1W0UA 2DN0A 5IOYA 3K2AA 3CMYA 1WI3A 2Y9YA 2JA8J 4ABZA 2NS7A 2DTZA 4B3AA 1NK3P 4DYRA 2JA5J 2XSDC 3TP0A 4A93J 3A03A 2Y31A 2XB5A 2GBYA 5K7HA 2ZB9A 5EDNA 2GM4A 3LSJA 2L7FP 3HOWJ 2M0CA 1RETA 1MSEC 2EBIA 1JJ8C 1SANA
chains in the Genus database with same CATH superfamily
1FSEA 4XLPF 1NG6A 4IHTA 3I71A 3BTIA 5B1BH 3W6JB 3Q0WA 4A69C 2E1NA 2MFZA 1S6LA 1OCZH 3M8JA 2HDCA 5JLXA 4BE1A 3GTMJ 4K2EA 2XRNA 1P6RA 1O3SA 3H5AA 3KYLA 1A31A 3VPRA 4RBOA 2JJ7A 4AC0A 4F3QA 3QPLA 5EYRA 3HOVJ 4NC6A 3JSPA 1DP7P 2EV5A 3KIOA 3K1PA 3FM3A 2FOWA 5IP9J 5HS7A 2HNHA 1AHDP 2Y9ZA 1MH3A 1BI2A 4ON0A 1K78B 4D9JA 4EGZA 1LB2A 5FLXK 3KE2A 1TQIA 4EM1A 2GA2A 4UV9A 3M7GA 3H9GA 3N4MA 3A0BC 4DYCA 2KIFA 2PFBA 2XPWA 3I58A 4F55A 5FD6A 5FLMJ 1AKHB 1RPWA 1FYMA 2HKXA 2RNJA 3WHBA 3GFMA 4I7HA 4XLEA 1MGTA 2AQFA 2OZUA 3GTPJ 1RZ4A 1JKPC 1OYIA 3TOAA 1F36A 2L7ZA 4A3EJ 3S14J 2VXDA 1FZPB 2WWYA 5E79C 3SXYA 4H0EA 2EFQA 4PK4A 4HDUA 1FTTA 4C30A 1XG1A 2BY2A 2RAEA 2RDPA 1J75A 1KU7A 4CH7A 2DYRH 4GFBA 2VBWA 2PLYA 4EV0A 1EH8A 3TW6A 4MEXF 3EUHA 4HEA2 1U2WA 4BQOA 1WZ2A 4BY7J 4HPQA 3HIFA 3ZQHA 2VJ4A 3S2DJ 2HOTA 1I1SA 2W85A 2VJJA 1K79A 3DBHB 3ABTA 3V4GA 4RGSA 2JRTA 4L0YB 4XKBA 4IL6C 4OU0A 2GXAA 3JRGA 3FIWA 4QPOA 1G59A 3C2HA 4JOMA 2DPDA 2B7EA 3CC7I 1AOYA 2BXZA 1ACIA 5E3OA 5BPDA 4DZPA 1SVLA 1ZAOA 1MNDA 4RAZA 1YI2I 2VKEA 1K4TA 1IN4A 3TW7A 2Y75A 5HS9A 1MKMA 3V7RA 2GXGA 3C7JA 3JREA 4N0BA 1T8IA 2DMQA 1N25A 3VODA 2CJJA 3FXOA 1EA3A 3KEQA 5C4JJ 9ANTA 3FXJA 3CMMA 2BEOA 2EIJH 2LYCA 1SFXA 1ZELA 1SMYF 4HQEA 1KU2A 2VJ5A 3KCCA 2JSCA 4LFUA 1GV5A 1ERDA 4KNYA 4Z6YA 2OU2A 3HGYA 3O8GA 1STZA 3HB9A 1IXRC 3VYTB 4BS9A 5F6FA 3OOUA 3CO6C 2A5YB 4MQVA 4I0BA 1A35A 2NXNB 3LOCA 3FK7A 1ZN2A 2F5CA 3D5LA 4DGWB 3MKZA 2R5YB 2ZFUA 3GCMA 5H2FC 3RJPA 3LA7A 4Y17A 4UHTA 1BI0A 1D5VA 1LDDA 2CMPA 4E7LA 1ETVA 4ENMA 5EF6A 4N4OB 1REPC 1A04A 2OPTA 1S5LC 4H4KC 1XCBA 1K61A 1V3FA 1I50J 2VKVA 3IV5A 1WJCA 3SFIA 1ZG1A 2DMTA 3F8FA 2LBFB 2XHKA 1IGNA 1F43A 2E2HJ 3GTLJ 4EQQA 4U88A 1U8BA 3OYFA 1X19A 3L2CA 1BR1A 5HVQC 2XGEA 4KICA 3L09A 1LEAA 4KIFA 1Y56A 3J7AY 1UHWA 1U5TA 4BL0B 1NHAA 1KA8A 2NAZA 5E3LA 3MKWB 2WA0A 2IBDA 3GTOJ 5DM7F 1WVRA 2KZGA 4RM2A 1HXDA 3J81Z 1YE9A 1TL8A 2ID3A 4IHVA 3DTEA 5BS6A 2CW7A 2RQQA 3D5RC 1O3RA 2YR2A 2YU9J 1UJ8A 2ICWG 3FM5A 1JT6A 1WI9A 1N77A 5D5UB 3A4CA 3PO2J 1VFCA 4OMZA 1T98A 1ZR4A 3FXQA 2P4WA 4C2TA 4PJMA 5GPAA 1EV7A 3KEYA 1I3QJ 1YG2A 4BU2A 2DA3A 4DYQA 2QSGX 1D1CA 4HV5A 3ERED 4IRIA 4ASNA 2R7DA 1XDUA 4HF2A 1NK2P 3H9QA 4GYGA 3BTCA 2OCEA 1HKQA 1BW6A 4IHWA 2QCOA 2XASA 4YFNF 3C18A 4PZJA 4D7NA 2COBA 5M3MJ 2VLAA 3BPXA 1JUPA 4FX0A 5K5OA 3WTXC 2ZKZA 3ASOH 3CDHA 4A5NA 2WB1N 2ZXJA 3BCAA 4A3IJ 4BYYA 1UG0A 3EUHC 2L0KA 3L9FA 5TGTA 3M1EA 4PFOA 2B9SA 2I5UA 3RSNA 1Z3YA 2IP2A 2DW4A 3MVPA 2YS9A 2DOEA 3CCYA 4A0ZA 3BZCA 5IP6A 4XICA 1V55H 3M8EA 3BR5A 2DPUA 3KP4A 4LB5A 1FEXA 4BJ5C 4KITB 1IRFA 2L7MP 4XR6A 1HW1A 2Q0OA 1UCRA 1DGWY 3HTUA 2JA2A 3CCUI 4MO7A 1BC7C 1PJRA 1MMAA 1P4AA 1JUMA 2KIUA 2ZMEC 4CXFA 1GXPA 3OSFA 5HLIA 1SD7A 3DBRB 2DFHA 4JX5A 2PQ8A 1M1EB 5TRDA 2N8GA 3Q3SA 4XNFA 2LREA 1QU3A 1Z9CA 3HTSB 1W5TA 4A2UA 3CTAA 4L9NA 4UV8A 3CCSI 4IKFA 2OCCH 3T5XA 2ESNA 4CCMA 2M5WA 2L9SA 1Z05A 5E1XA 2H8RA 2D2WA 2Z9OA 4MLOA 2XGXA 3ZQGA 1IUYA 3FXRA 1R5HA 1HW2A 1VQ9I 1YIOA 4RB2C 4OMYA 1X1PA 1ULYA 3R6SA 4OAYA 2E5ZA 3JTHA 2OTLI 3BJAA 5AIPA 5JLWA 4KFCA 1WCMJ 4F7ZA 1O7FA 3ZQCA 2VQGA 3Q5FA 4Z2YA 5L3GA 3PUFA 4PJNA 1TNSA 2Y2ZA 2RV8A 4D5CA 5K7ZA 5M5YJ 2E36A 4XIDA 1MW7A 2FXAA 2NYXA 1A6QA 4D0PA 4P9FA 4C2UA 1PDNC 2P5VA 4I01A 3CDLA 2MLKA 4XONA 4AWXB 3RPUD 3KETA 3J7AO 5IYDJ 1ON1A 1O4XA 5L3EA 1IRXA 3FZVA 2I8DA 2W00A 2IS6A 4BGDA 1W0TA 4KIBA 2IGOA 1W1WE 4W97A 3MN2A 4IOAF 4IHYA 1U5TB 1HDDC 2XGDA 2K4JA 3GWZA 1VQ6I 4G6QA 2Y48A 3HGGA 1JKRC 2TRTA 1LEBA 3TO7A 3U2RA 2QQAA 2LLKA 3OS1A 2O7OA 2V1DA 2DFEA 4HZFA 1OJLA 1FBUA 3PIPF 1GUUA 2K4BA 3FBIB 1E3PA 2VXZA 1HA8A 4B4CA 2CV2A 2CFOA 2IEKA 5B66C 4HF0A 1GHCA 4LG3A 1GVJA 1YRNA 5CQGA 1Z7LA 3K69A 3KX2A 2IXSA 2QSHX 3M8FA 2JT1A 3ECOA 3AG1H 5JVGF 2E1CA 2HEOA 5DTDA 4XSXF 2GXBA 3F8CA 5LEKA 5CVRA 4CCLA 4B3XA 4Y52J 3OIQA 3G1LA 4L5IA 1MBFA 1QVUA 2R93J 4UUTA 4RMNA 4I99C 1GT0C 2ZCWA 1DPUA 1P92A 2HYGD 3PL8A 3HEFA 2LDUA 2F5FA 2G0EA 3QOEA 4XRMA 1Y6IA 4X0GA 3S3MA 1YX5A 4CCNA 2G7HA 1JUSA 4Y7NJ 3T0YA 2VOPA 2EIKH 1SVOA 3RKXA 3ZPLA 1LE8A 2QYOA 4XOPA 4RAYA 1MMNA 1WHUA 3DXJF 3PNYA 4KYWA 1FOYA 1GVDA 5J8FA 2XGCA 1Z6RA 1XGOA 3ROUA 2D45A 4IPAA 3L1PA 1LKXA 2GOMA 5CVVA 4JYKA 4M9XA 1AA7A 3C3WA 4BXFA 3C2GA 1D8KA 3BG6A 4AIJA 4X6AJ 1SFUA 4W1UA 2H27A 3KP5A 3AKZA 3ZN1A 2OC6A 2XAQA 2XB0X 4WF2A 4F92B 3D5SC 2ELJA 3CCRI 3CD6I 2CUZA 3HOUJ 4LB6B 2M30A 4L9VA 4ZYHA 2MD5A 4PSWA 3F72A 1LVAA 1OQYA 3T8RA 2F6CA 5E3NA 1TWGJ 1CQTA 1BOBA 1Z6TA 1ITYA 5AONA 2GA1A 1FOWA 2YPRA 4FE4A 2FJ1A 3GBGA 4YG2F 1TWCJ 3KP6A 4HSTA 3HRTA 2VC0A 3IRQA 4OIOF 2HR3A 2UXNA 3I4MJ 2DDBA 2G9WA 4L9JA 1IF1A 2CO5A 2COMA 4HSRA 1YYVA 4J01A 2GIZA 4XLCA 2ZNYA 3P7NA 1G8XA 4BXUA 2JTVA 4P5OA 4U0VA 3N97A 4ABZA 4YRVA 2FNPA 3IP4B 3G71I 3BCBA 2IW5A 4AD9A 3WGHA 1LPQA 2C6YA 2IA2A 3HUGA 1DPRA 2AS5F 5K7HA 5EDNA 2EK5A 2LC2A 2QEXI 1DDNA 5ICCA 3LSJA 5ICEA 3HOWJ 3TBIA 5LGNA 3S3NA 2DU9A 1VQOI 2EBIA 5J6XA 2X0LA 1JJ8C 2HVRA 4BH9A 2LD5A 3KPHA 1IG7A 2R7VA 4EMSA 2ECBA 2XAGA 1BR4A 2KKOA 5H6RA 3GUDA 3DPUA 2P7CB 3QODA 2KISA 2WB1A 1WJFA 2QBYB 1FYLA 3GZ6A 4PGGA 4A3BJ 5L3CA 1YLFA 2A68F 1FY7A 1KQ9A 3MZ8A 1W5CC 2ME0A 1YIJI 2R7RA 4WXHA 1R00A 3BOQA 3OS2A 2WAFA 3PSIA 5GAGJ 1AWCA 1APLC 1IV8A 5A2QK 2LY9A 5LD2C 3GFIA 2OZ6A 3O6BB 2YX4A 4L5JA 2XKPA 3AG4H 3WU0A 2I10A 2HXIA 1SVMA 4KIGA 4V2FA 3OOPA 5F27A 5CYVA 4CYDA 2QUFA 3JRBA 5CJ9A 2RKHA 3TEDA 2DT5A 5F64A 1VQKI 4Q4ZF 1T56A 4E7IA 2XF7A 1YRNB 3CF2A 4KDPA 2DT7B 5EEGA 3NWSA 3PJRA 5DD8A 3HL2A 3JAMK 2WC2A 4FQGA 3DKXA 2BGCA 5J47A 2F5VA 3QP6A 2KJCA 3F8BA 3X2QH 3JSOA 1X2NA 5IT9K 2LP0A 3LSHA 2VPLA 4RB1A 2QKLB 2M7BA 3TDZC 2VUMJ 2XAJA 3K2ZA 2E1OA 1V5FA 3GLXA 2A6TA 1T2KA 1RUOA 3OYHA 3PIOF 1LE8B 4JX6A 3FHZA 3H3ZA 2DOFA 2HFHA 3RCOA 4KA4A 1Y39A 3JRIA 3S1NJ 1D0YA 1RR8C 4G6TB 3WE3A 5CVIA 4A0XA 4XBFA 4G94A 3VB2A 5IOZA 3CQZJ 2HU9A 3DPLC 1D0ZA 2KIMA 5IP7J 3M9AA 1UG2A 2KJBA 4WXDA 2DYSH 3GFLA 4JP0A 3U1KA 3T8TA 2PJRA 3G1OA 1Y1VJ 2BBYA 2B63J 4I6ZA 4P96A 3RYRA 5LGUA 1R6RA 1PP8F 2MD0A 3E3VA 5HOOA 5HNFA 4E6KG 2K85A 1OCTC 3PNTA 1R1TA 3TOBA 2VASA 1ZG5A 4RGUA 1TW3A 1KYZA 5EG0A 3ML6A 3P9IA 3SQNA 4MQ9F 3RZDJ 3DCFA 1MNMC 1W36C 3L2WA 2F2EA 3BG3A 3U9GA 5C3EJ 4OIPF 2A6EF 3F23A 3FK6A 2EWNA 3V8LA 1X1AA 4U0YA 4FE7A 1Y1WJ 1QA6A 2X51A 1H0MA 2KRFA 2IA0A 1D5YA 2CV1A 4I2OA 4PFPA 1TT0A 4CICA 1WKMA 1BI1A 1ETKA 5DYMA 3R61A 3HUGB 1IDZA 5D5VB 3OMYA 2XPVA 1RKTA 2FA5A 4KMFA 4OAZA 1OMIA 2V9VA 4XKCA 3I9V2 4GCVA 2BY1A 5BNGA 1MMDA 4M9ZA 2LTPA 1WRJA 1XN7A 2BVMA 2CW8A 3SDBA 1ZGAA 4XSZF 4UUSA 5J40A 3LWFA 5GPCA 5EEAA 3NWTA 1BC8C 1XMAA 2W57A 2X9DA 1WJAA 3RQIA 3CCEI 4XQFA 2BVLA 1V5GA 3CLOA 2O03A 2PJPA 2ZJ2A 4G12A 3ZRGA 1QHGA 4FTHA 1V5EA 1FTZA 4RB0A 1R22A 1WPKA 1UHMA 4GGGA 1I1GA 5D5WB 3OYGA 4UXNA 3E6CC 3WTSC 4NUBA 4AIHA 4HDVA 1TQPA 4X1EA 4HX4A 3WU2C 2W24A 1FP1D 3DWLE 2DTRA 1HKSA 3IHUA 3AG2H 2QKMB 3CO7C 4M72A 3JAMZ 3BROA 2MW8A 1O57A 1R5GA 2JWTA 4EVIA 3KZYA 5IT9Z 2R0QC 2J5PA 1H89C 4V2GA 3DEWA 3QPHA 2JK3A 3NARA 3GX4X 1DUXC 5E17F 3FDYA 4I02A 4I98B 5EJCA 4BKXA 2DCEA 3I64A 1O3QA 1SFEA 2VKDA 2R7SA 3B73A 3CJTB 2FSWA 3LNQA 4HV6A 3FXMA 3IRRA 1XS9A 3BR0A 2IPQX 3F8NA 2RREA 3EYIA 1FT9A 3OWTA 1RUNA 2WAQN 1R4NB 2K3PA 3QQAA 3KYCB 4ESBA 5FKNA 2GWRA 2O0YA 4UVCA 1FOXA 4BJTA 1W4MA 3OYIA 2O9LA 2BXYA 2FMLA 4UB8C 2VKHA 5M3FJ 4HBLA 2L4AA 4NC7A 4A3DJ 1HF0A 2KHMA 4RB3C 3TP3A 5FRNA 3CCJI 1SFKA 2P7VB 4RLFA 2DA6A 3ZR8X 2VI6A 2K9LA 1KYWA 4A12A 4ETSA 2L3DA 2LF8A 4ITVA 3UR3C 3VSLA 1B8IA 2NVYJ 2WAEA 4BBRJ 3ISPA 1QVTA 2RNGA 2PJRB 3CP8A 2VBYA 2V6EA 1OR7C 1R23A 3WHCA 2KMUA 2BOLA 3VEPA 3WGGA 4NDLA 2NS8A 3FKIJ 2CQQA 3PQKA 3O2PE 2ADUA 4XRSA 2EV6A 2M8EA 2Y0SN 1IRZA 3OYNA 1J7KA 2QQBA 4DNCA 1MBEA 5EG0B 2IRFG 3ABKH 2F48A 3HBLA 1Z1DA 3DU5A 1K83J 4QPQA 3P5JA 3CJRB 2ACJA 3GZ5A 2R7TA 1FNNA 3H0GJ 1LFBA 5BOXA 1TC3C 5M5WJ 1ZG3A 2FE3A 4LJZF 4DQ2A 1CGPA 2FMYA 3E5XA 3KZIC 3ZQLA 2LR8A 2Z33A 3C2BA 4ZTJA 2DMPA 3RQ4A 1OISA 2RN7A 1JTYA 2A3SA 1KQ0A 4R8HA 1YITI 3FISA 2MH2A 4PJLA 2W4SA 3FX3A 1JT0A 4B1RA 1S7AA 1XDSA 2B0LA 4XL9A 1MD0A 3E5QA 2R92J 2EZLA 4JQFA 5HDNA 3H3VK 5F0HA 1BW5A 1UZCA 5D8KB 1KU3A 3RI4A 5C4XJ 2HPMA 3S17J 5LRSA 3B6AA 3WTTC 2BHZA 5BPIA 4E7HA 1IO2A 5F1JA 2FX0A 4C3HJ 3W2VA 2MBFA 4UUSB 5FLXZ 2L9VA 3TL4X 3FF5A 3IAS2 2DI3A 3CDIA 4A6DA 3HOXJ 4HA8A 1X2MA 2DQRA 4MTDA 1WJBA 3DBLB 1HBXG 1J5YA 3VYRB 3BR2A 2CG4A 3VYUB 2FF4A 3A0HC 3BQYA 3G73A 4J19A 2E60A 3BTLA 4HQMA 3K1NA 2MSYA 2RGVA 1FPQA 2GZWA 1QRYA 4AVZA 5CPRB 4QTRA 3F21A 4ZJZA 4HNVA 5KCMA 4N9IA 5E1ZB 1XC5A 4V19K 1XCVA 5JFRA 4E70A 5CQEA 4BQQA 4P1WA 3WE2A 4NC8A 3ZQIA 1ETXA 5IPAA 1U6GA 4IRGA 5HLHA 3UNGC 5HDKA 2BY0A 2H6CA 4U7DA 3W6VA 3QAHA 2H94A 3CMEI 3S1RJ 4G6DA 1R58A 2E1MB 2HDWA 2WBMA 3D0SA 1XX5A 1TWFJ 1SAXA 3AG3H 1MBGA 1S9HA 2ZXIA 1EH7A 3R0JA 3REOA 3TQNA 1E0EA 4HAMA 1BBYA 2Q1ZB 1A36A 4S05A 2IGKA 3CC4I 2QQ9A 4IO9F 1E17A 2XF5A 2QLZA 4Y15A 2CH0A 3LFUA 3G3ZA 1YW8A 4ZC3A 2XSJC 3IH3A 4ZDOA 4U87A 2Q2EA 4FETA 1ETOA 4BEHA 4M6VA 2YSRA 2BYVE 2ECCA 2ZXWH 2D1HA 4MTEA 4XM3A 4DJAA 3MEXA 2DDAA 3EPZA 3K10A 4AIDA 2BE5F 1KQ8A 1IJWC 3J7ZI 2F5EA 4HX8A 4MNUA 2XROA 1LFPA 1B8IB 2X1DA 2DA4A 1TQMA 2VBXA 5BMZA 2PMZN 4U7BA 3K4CA 1I39A 5E8IA 1W7PD 1MJBA 4M3GA 2XAUA 3IWFA 3W2AA 1HKTA 3G2BA 2E2JJ 2L54A 4OWRB 3QYEA 1P7JA 3MAJA 1QGPA 2XPUA 3KZZA 5IOYA 1Y0NA 4N9HA 1WI3A 3WGIA 2D1VA 1G4DA 4ZDLA 3KP2A 1TT5B 3B02A 4A93J 3A03A 2K9MA 4RS8A 3DKWA 2Y31A 4A0YA 2ZB9A 2FOKA 3GFJA 4OIRF 1S7OA 4M9SA 3DTKA 3L2VA 4UVBA 3L2QA 5B1AH 4D1QA 2ESHA 2MA3A 1MSEC 4N4NB 1XSVA 3HPHA 1SANA 2JSPA 4L0ZB 2QBYA 2BZTA 1HOMA 3JRAA 2V1UA 2JZYA 2EFPA 3TGNA 1EH6A 1IN5A 3ZMSA 4CZZA 1UMQA 3K4NA 2P81A 5GP9A 4A3LJ 1SD6A 2WAQA 4ZYGA 2DT6A 2F5DA 2Z16A 2A05A 4M3EA 1QBJA 4JX4A 1BL0A 4DZJA 1P2FA 1JKQC 2ZFWA 3DF8A 1Q1VA 4XRSG 5DD4A 1FIAA 2JA6J 1IN8A 2MGQA 2KRCA 4B8XA 1R71A 1W36D 1FYKA 3L00A 3RDIA 5JVTA 4LLGF 1ZRDA 1FC3A 1U5TC 2ZJRF 4ZZDA 2PMUA 3R4KA 2VONA 2NVUB 1IW7F 2VT3A 3RZOJ 2K9SA 3H5NA 2KZVA 2QGUA 3QPSA 4U0WA 3L2UA 1O7LA 1WJ5A 2QVOA 3GLLA 3LMMA 3ZCOA 3WTWC 2XVCA 3BT9A 4BHPA 3HOSA 1JHFA 1JGSA 2CUFA 5K5RA 5EEHA 2CQXA 1VQ4I 1S29A 3PNVA 3LA3A 1MJAA 2BHYA 3PSFA 1E3HA 2Y0SA 3SHFA 3PFYA 4C3IJ 1USTA 3MKLA 4WCGA 3CCLI 1VI0A 1R1VA 4EM0B 2IA1A 2KIQA 3A02A 2WV0A 3EETA 2XAFA 3FKJA 3LQQA 1RNLA 3TO6A 1YS6A 1B6AA 3WTUC 1H8AC 2VB6A 5LFAA 1WH5A 1VNDA 5LBQA 4E7KA 3DKYA 2XF6A 4AU7A 1NH3A 1XGNA 1RKWA 1BN5A 3W3CA 2OTJI 2OBPA 4I76A 4FASD 4UB6C 4D7MA 1HDPA 4BE2A 5ERIA 3F9KA 3L2RA 4Y13A 1IN6A 5IYBJ 3VOEA 1VQ8I 4YELA 2QWWA 1HC8A 3K4LA 3LSIA 2K40A 1BR2A 4NNJA 2W25A 3A2KA 4LITA 3QYFA 5JI6A 3D1NI 2E71A 2L01A 2CW0F 1VQ5I 3G6EI 3OSGA 1AU7A 2EFNA 2V26A 3WU1B 2VE9A 1SC7A 3G4SI 2BW3A 1SD4A 2X6YA 3E1SA 3I5UA 5J3LA 5H6QA 2ELKA 2H8WA 2M8GX 2RC4A 1FBQA 2HQ5A 3OIPA 4IQ4A 4M3BA 2HTSA 2Q2EB 3IKTA 3CZ6A 1QPMA 2P5LC 4BDYA 4BEHB 1U0JA 3K4MA 2LVSA 4LIVA 3ZMUA 2PN6A 5LHGA 3RYPA 1J9IA 2P0WA 3QWLA 3W6KB 1C0WA 2JVHA 5IT3A 3H0DA 5F0CA 2HXOA 4CCKA 5K5QA 3ZMTA 1ODDA 1V54H 2ID6A 1MBJA 2DMNA 5FO5A 2R7XA 1DP3A 3TMOA 4L18B 3WODF 1H88C 2JPCA 4XLAA 5DCFA 2RQPA 4HYEA 3HDDA 5ILVA 5FKOA 3S15J 3MKYB 1IZ1A 2V4JC 5FFZA 1J0RA 3M3YJ 4KN7X 1ON2A 2LKPA 3BZ6A 5FJ8J 2HWVA 3S3OA 3FMSA 1EF4A 3VSKA 2L7KA 4G8XA 1OCCH 5DS9A 3GVAA 4Q5SF 5FKKA 3HG9A 1OLTA 3OIOA 2NNNA 4GYIA 2KRHA 1JHHA 3Q9SA 2LH9A 4A3FJ 4PSXA 4BACA 1ENHA 1ZQ3P 3GO5A 5CKTA 2Y30A 2LF7A 3PUBA 1BJZA 2K9QA 3FHNA 4HOBA 1Z77A 3SFZA 2QENA 3SZGA 4BE0A 1T33A 3JR9A 1FBSA 2CUEA 2BV6A 5FLVA 5IYCJ 1D0XA 1GV2A 3E6BA 1ETYA 4YEJA 3FXUA 5H20A 4CCOA 3LSPA 2KL4A 3WTZA 3SEQA 2FNAA 2R7OA 1RI7A 2QA4I 2L9NA 1XGSA 3EDPA 3H9JA 3Q9VA 4MEYF 2A6HF 2CU7A 1B59A 4YIIA 1B9MA 4ZTFA 4FX4A 1DQUA 3V8KA 2IGNA 2WV1A 3DP7A 5FFXA 2ZO4A 3QP5A 2E7XA 2DA2A 3S1MJ 3OYJA 5HLTA 2LK2A 1TLHB 1PVEA 2DODA 3IC7A 4F91B 4J00A 1G3TA 2FBIA 4PDKA 1FWZA 3SEZA 1HW5A 4GO1A 4FISA 2DA5A 2FD5A 2NOGA 1R36A 1S8NA 1N75A 3F8MA 1LUJB 2PBIA 3RPQA 1A6IA 1OPCA 1USSA 2HQRA 2NOJB 2XDVA 4LD5A 2PMZA 1U78A 3LSGA 2K27A 4CUGA 4IEJA 2LMDA 2LY1A 3OYDA 2BY3A 3KEOA 1MZBA 2Z3YA 1KZHA 5K1YA 4A6EA 2HOAA 4AM3A 2E7WA 2XRLA 5DUKA 1KU9A 3CUQB 4UUVA 2HYJA 3UKGA 2DJNA 1PUFA 1VQMI 2EFWA 3GF2A 3F3XA 3LSKA 4EGYA 1E2XA 4LK1F 4QSHA 1GDTA 3ZN0A 2X48A 2R5ZB 2EB7A 4CCJA 2OQRA 3FMRA 1R1UA 2X85A 2V1XA 1R49A 5LHIA 2AHQA 2DBBA 3CC2I 5LGTA 4O5VA 2LNBA 4WX9A 3HM5A 1Z91A 1J59A 2PMHA 3VYSB 1YO5C 4BHBA 3O3KA 4NQWA 2DMUA 1D1AA 2HDDA 4CZCA 3ZP5A 2MC3A 2BW3B 5K7FA 3RKWA 4BUPA 1R4MB 5J1RA 3BJ6A 2M0MA 5FGMA 1IV6A 2JN6A 4RAFA 2EZHA 2HVSA 3ABUA 3SYTA 3GXOA 5DUIA 4XK4A 3ERMA 1ZH5A 3BPVA 3IAM2 1G2HA 1IN7A 2R7ZJ 2DXIA 2MC4A 1BM9A 3IKVA 3B6CA 4A5MA 4ENKA 3HOYJ 2OV7A 1Z21A 1BA5A 3I0TA 4Y4RA 1ZR2A 3GYHX 1ZGWA 1B9NA 4FHTA 1JKOC 1HCRA 3OR2C 4KN4X 2LKSA 2VOOA 3MMYB 3ZQ7A 3RKQA 4O3MA 1S3JA 3HSFA 1TW2A 3GTKJ 1S7EA 3I56I 2X6OA 1UAAA 3ZMDA 5DDGA 4CHUA 5EGOB 3VWBA 3U21A 5ILSA 3WG9A 1SMTA 3DEEA 1VQ7I 2LOOA 2FEZA 1WSUA 2KT0A 2LFBA 4JBAA 3SJMA 2NVTJ 3AFHA 1S72I 4IRHA 3PO3J 5E20A 5EZGA 3DLLF 3FBNB 1BJAA 1RC9A 5E3MA 5FD5A 2O5RA 2OF7A 2X4HA 4Q48A 1DU0A 1R5ID 3P9CA 3CCVI 2K02A 1J2XA 3FXKA 1MDMA 1XD7A 2DK5A 4PJ0C 5HDGA 3DEUA 5DM6F 5A2QZ 5L3BA 3KLNA 2ETHA 1IC8A 2HKOA 1FOKA 2O8XA 1QZEA 1SAUA 2QQ8A 1F4KA 5J4YA 2V6CA 1IXCA 1VZ0A 2E2IJ 2K3FA 4A3KJ 3HSEA 3NAUA 2VODA 2TDXA 5KNLA 2JQ7A 3LL7A 3I54A 2V9KA 4OINF 4MIMA 3DLAA 4FT8A 4IJAA 1OCPA 4BQNA 1FIPA 2PEXA 5LEJA 1ZRFA 1JGGA 2W84A 1EJ9A 3K6GA 2YU3A 1FMVA 3MFKA 3RKYA 3OL4A 2CSOA 2GOXB 3K9TA 3J81K 4LLNA 4JK1X 3K1MA 2J5OA 3OL3A 5E1WA 2DQLA 4ZYAA 1LDKB 2X1CA 3ONQA 3W2WA 3ECHA 1OFCX 2EJRA 1YHQI 1JXSA 3K4JA 2UV1A 3OS0A 4G7ZF 1F9NA 1Z7UA 2K5CA 2HYFA 2XAHA 4BHCA 2M1BA 5HLGA 1GXQA 1YW7A 2Y69H 2LRDA 1PUFB 2CRGA 3H36A 1MJ9A 4A3GJ 5HNHA 3H5RA 3H3UA 5JHFA 1QO0D 4EJOA 1JTXA 3BR3A 2P8TA 1WJEA 1YOVB 2JRMA 2VQHA 4IOCF 2EA4A 1B1BA 1DGRM 2XIGA 3QOPA 5GADJ 5F08A 3ZOBA 3EUKL 3MZHA 1V4RA 4XN0A 5FKLA 2OD5A 1ZYRF 4NQWB 3JRHA 2ME6A 3AAFA 2ZMEA 3Q0UA 4PUSA 1LJ9A 1FSHA 1XMXA 4TV7A 3J80K 2M3AA 2M34A 5J8CA 3HZJA 1WQ2A 2AO9A 3DFGA 2ZNZA 5LRRA 3KP7A 2ELHA 2HQAA 4RLQA 1J09A 3GTJJ 4F52A 3OV8A 4HF1A 2M87A 3LAJA 1ZHFA 4XLHA 5L3FA 3CLQA 4LK0F 4C9YA 1P9QC 2QZ8A 1O3TA 2FUG2 3EUAA 5KVRA 4EJTA 2VQLA 1W0UA 4Y3OA 1CF7A 2F4IA 4NBQA 3CMYA 2JA8J 2HPIA 2UUZA 5D6EA 4E7ZA 4HX7A 2DTZA 1XB4A 4B3AA 2DFIA 2JA5J 4DYRA 1I6XA 3TP0A 3DV8A 2XB5A 2E34A 2GBYA 3BP8A 2FQ3A 2V1NA 5E18F 1YJNI 3V7SA 2GM4A 3KP3A 1ONVA 2L7FP 1MMGA 2M0CA 4EJVA 1RETA 1Y8QB 5ICFA 2WADA 1MSFC 2DA1A 5GTIC 1EKEA 1FP2A 4KISA 1KONA 5L3DA 1X4PA 4IXAA 4QLCU 2JA7J 3OR1C 1X1DA 4G7HF 1JE8A 3NRVA 2VE8A 1X3ZB 2LG4A 3FMQA 2D5VA 1ZTRA 1TWHJ 1Z0XA 2EFOA 3KYDB 2JVGA 4KUMA 1YX3A 4B48A 4BAYA 3CF5F 1MDMB 5FKMA 2KFDA 2CQNA 1UELB 4ZH4F 1B72A 4UY8I 3BZKA 1SD5A 4L5EA 2WY8Q 4PGHA 5FRMA 5GTHC 4MGRA 1LNWA 5J1UA 2HTJA 4LMYA 1XMKA 3WTYC 1G3YA 2VJIA 3HJEA 5B3SH 4PJJA 1I6HJ 2FQ4A 3S8PA 4IF4A 2MLGA 2XV4S 1VQNI 3RTRA 4CA0A 4YIFA 3WTVC 3HHHA 4M74A 1QPIA 5KHDA 5HS8A 4KMUX 5ILUA 2X6XA 2Y0MA 3ABLH 2MH9A 1MNEA 1Z67A 3WG7H 3BR1A 5F0FA 2DOAA 2QF7A 4ENJA 1X3WB 2LKXA 1VQPI 3F6VA 2K7LA 2OAZA 3HHGA 1OCRH 3CESA 2STWA 3E7LA 4F93B 4B43A 2IVMA 3A1YA 3OYKA 3CCMI 3KFWX 2OUMA 6PAXA 3IL2A 2E1MC 2VL8A 3BWGA 5D5XB 4DIQA 2MABA 3JW4A 5J1YA 2IJLA 2VBZA 4LG0A 3EYYA 1JI8A 1GLNA 2VQCA 3LFKA 1U9NA 1I3AA 3CJQB 2H6BA 4S0HB 4DOZA 1XSDA 1WGXA 3CUOA 3HKZN 2PG4A 4UVAA 4KT6A 3QU6A 4LGWA 2ZSIB 5F04A 3K70C 4AYBN 2O8KA 2MYSA 3GTQJ 1T0FA 2M2EA 1KGSA 2E35A 2HOSA 1LFUP 2FBKA 3ESWB 1VF9A 3J80Z 2DO7A 2ZSHB 2M4GA 1NTCA 1TTYA 2DK8A 4I0AA 4XKVA 2V9PA 1UHSA 3JRDA 5KAIC 4YFXF 3M07A 4EM2A 2QSFX 4NHJA 4BDZA 2G7UA 2HVQA 1PP7U 5TJJA 4MFDA 1L3LA 4M3DA 2IS1A 3C1DA 2UWMA 5DCMA 2ZMEB 3ZGKA 3F6OA 2A5WA 4PCQA 3MCZA 4ESFA 3F0CA 2AXLA 3CMAI 3AL0B 3IH4A 3MWMA 1G3WA 1K4SA 1DU6A 3P9KA 1P4XA 1R7JA 1X3UA 2TCTA 2M4KA 2XC7A 2KQRA 4DBQA 4EJUA 3ZMVA 1K6OA 3I59A 3AL0C 2CQKA 2HI3A 3ZQQA 3DTIA 3EQLF 4RM3A 1LDJA 4Y33A 1NG7A 4HW0A 2CYYA 5J4VA 3N05A 1IDYA 1MMSA 4II3A 1WWXA 4IVNA 4BXXJ 1B4AA 1CF7B 2NS0A 3V42A 2L4MA 2VPRA 2Z2SB 3M1CA 4AVPA 1G6NA 4S04A 3HYIA 2IS2A 1XSXA 2M7AA 5D4SA 2UXXA 1ETWA 1ZGJA 3K7AJ 2DJIA 3O8HA 3MZYA 2Q8KA 2W1OA 4R1HA 4LLLA 2CGPA 4GRIA 1ZARA 1Q1HA 5D8LB 2Z1DA 1RR7A 2L02A 2UZKA 3DPTA 3HSRA 3I3LA 4YFKF 3OYLA 4MFEA 4E4HA 3E6MA 4II2A 1X1CA 1ZK8A 4CDGA 4EATA 5HODA 4LOCA 4MHGA 5C44J 2DFFA 3BDDA 3R60A 4QIWN 2PI0A 1L0OC 4IHXA 4HLXA 5AIQA 5LLQA 4ENNA 1TNTA 2O3FA 1YJ9I 5BQTA 3NEUA 3S93A 4XOTA 1WJDA 1B72B 1LQ1A 3E6DA 2DLLA 4P55A 4C3JJ 2X6WA 1F5TA 3BC8A 1TP4A 2E19A 4G9YA 3IH2A 1I5ZA 3S32A 3VFZA 3ELKA 1ZRCA 2K9NA 4UNOA 1OKRA 1SEUA 1SFOJ 2O6GE 5ED4A 1BOAA 1H9GA 2P6SA 2NVQJ 4B09A 4OIQF 1QHHD 3E5UA 3BR6A 3A01A 2KDZA 2R4GA 1RRJA 2M9HA 1D8JA 1T6SA 5FROA 1WH7A 3DQVC 4IX7A 4M71A 4IZZA 3GMEA 1YJWI 3OYCA 3CUQA 5JR3A 1QQIA 4XN3A 4B44A 1T95A 1R9TJ 4CSWA 4OOIA 2KDOA 4ZYDA 2L9RA 1W7PA 1YFHA 2NRAC 4BY1J 4C2MJ 1BIAA 3JRCA 3GTGJ 2R5ZA 1K7AA 1D1BA 2CWEA 5DEQA 3M4OJ 2E5NA 3LQRA 2AQEA 3ULQB 2DA7A 1MH4A 2MG4A 1YTYA 1QZYA 2Z99A 4M73A 1YS7A 4XKWA 2EIMH 2H09A 4LG0B 2HZDA 3LSRA 3CJNA 3I55I 1X4OA 4QWQA 5CLSA 3U1DA 2RVCA 3K4KA 3MD2A 3HXLA 2K86A 2EPFA 4CYCA 1HLVA 2EILH 3K4BA 3SZTA 4BQAA 3COAC 4RGXA 3SZPA 2CV0A 3PQJA 3RPUA 3GZNB 2OQGA 4ESJA 2V79A 2A69F 3FXLA 4L9TA 4HG2A 2R7WA 3TO9A 4M6XA 4A3CJ 4RDUA 2KLOA 3BG5A 2HOEA 1T0FC 2P5KA 2X1EA 3BG9A 2JUGA 3JRFA 3I4NJ 3TDUC 3DU6A 1ORKA 2FBHA 5DCMB 4WK8F 1IAWA 3OYEA 1XGMA 3GEZA 4CGZA 2ZC2A 5D4RA 1JJ6C 1T08B 3FWEA 1TZLA 4AUXA 2ZBKA 1YQAA 5EZHA 2M45A 1HSTA 5EGOA 2H1KA 4RA2A 4XORA 3S1QJ 2STTA 1A5JA 2IGMA 2VN2A 3I59B 4HNTA 3HRSA 3E0JB 3G1MA 2LY2A 2KP6A 2FRHA 1Y0UA 4ZDPA 3S2HJ 3ASNH 4DW6A 1OCOH 1WFXA 2EQRA 1XPXA 2VT2A 3H1CA 4BBSJ 5M5XJ 2AXTC 2EH3A 5JHUA 4XRFA 4E7JA 2IAIA 4BJ6C 2L2OA 3HRMA 1IXSB 3I4PA 4YIRX 5GAHJ 2P6TA 5CVUA 3TKYA 1FMWA 2NNYA 1OYYA 3ZMZA 2F4MB 2W48A 4D5FA 3LAPA 1T39A 3J7YJ 1FX7A 2FU4A 2CQ7A 3JTGA 1TBXA 2XUBA 2WTEA 4A3MJ 2PX9A 2R3SA 4Q47A 3V7CA 3HKZA 2JMWA 2DAOA 1G3SA 1UB9A 4I09A 1QZZA 4AYBA 2CUJA 4E7SA 2OJED 4A3JJ 3SDGA 4ZYEA 2WY7Q 1LVKA 1W5SA 4KT5C 4EJWA 4BNCA 2JPBA 3BQZA 1FJLA 1XTAA 2ISZA 1K78A 2HGCA 4G7OF 4WWCA 1U8RA 1MBHA 1Z3XA 3ABMH 3OY9A 1ZREA 4B47A 2Z5UA 3BTJA 3BG7A 5E8GA 3GW2A 2HS5A 3I53A 1AKHA 1IUFA 5FB2A 3H92A 5TISC 1IRGA 1X1BA 3JCUC 5D6FA 1E3OC 2HZTA 1F1ZA 3LSMA 1ZKGA 2YUSA 2EA2A 5KAFC 1ZLJA 2GAUA 4NB5A 1H9TA 5F1RA 1HSJA 2LSOA 3IUOA 2HQNA 3A01B 2IT0A 2NVXJ 2O61A 2ZJQF 3QRFF 3ZXSA 1FLIA 4HLYA 2EZKA 5ICGA 4HRIA 1MIJA 1OYWA 3QPTA 3T1BA 4IHSA 2W82A 1W7PB 3HOZJ 4P9UA 3HOTA 3HRUA 3Q0VA 2ZXHA 1PUEE 2R7FA 3CUQC 3BJOA 4M3FA 1QNTA 2L5QA 2A07F 4GDFA 2QM3A 3PFIA 2CS3A 2GIVA 2GQQA 1I27A 3KLOA 4KJZA 4HNUA 5B5EC 1TWAJ 1HQCA 3V8JA 1ETQA 1D3YA 3PM1A 5IY5H 4LIUA 2IS4A 4ZZLA 3QU3A 2F4OB 4CYCB 3K0LA 5KK1A 2CFXA 1VQLI 3BY6A 2ZJPF 3OYMA 3HPGA 1VTNC 4R79A 2VC1A 4ANJA 1BI3A 3R0AA 3BLYA 1POGA 3ZQFA 4GXOA 4WXCA 1RESA 3HC7A 3F22A 2V7FA 1X58A 1OR7A 1PYVA 1RIOH 2R7UA 1T38A 3S16J 1MBKA 4EEFG 1ZLKA 3CCQI 2ISYA 5LHHA 5DV5A 4RAGA 2GLOA 2W7NA 1P4WA 2OA4A 2A61A 3OYAA 1N78A 3E97A 4O6JA 2YX7A 1P7IA 1U9OA 3S2WA 4CO8A 4RGRA 2EZIA 3CP2A 4DBRA 4AIKA 4FCYA 4XLFA 2EINH 2R7QA 2EV0A 1UFMA 3RIRA 2R5YA 2DN0A 3MQ0A 1YW9A 3LA2A 5GAEJ 3K2AA 2Y9YA 3OYBA 5CVJA 3K70D 2NS7A 2KPMA 1BIBA 3H35A 4M6YA 2XKOA 1NK3P 3NQOA 2XSDC 3LSTA 3QYBA 4XMYA 3IWZA 4IQJA 1Y8RB 4XLNF 1U3EM 2JUCA 1K6YA 3L7WA 2H1LA 3VDXA 2LBFA 2VIXA
chains in the Genus database with same CATH topology
2DA1A 1HOMA 2LD5A 3BTIA 3JRAA 3Q0WA 1IG7A 2JA7J 4A69C 2ECBA 1UMQA 2P81A 5GP9A 4A3LJ 5JLXA 3GTMJ 4M3EA 2D5VA 1ZTRA 1TWHJ 4JX4A 4DZJA 1BL0A 1Z0XA 3VPRA 4RBOA 2JJ7A 4AC0A 1JKQC 3QPLA 5EYRA 1Q1VA 5FKMA 4XRSG 3HOVJ 4A3BJ 1FIAA 1B72A 2JA6J 2MGQA 2ME0A 4L5EA 5IP9J 5J1UA 1AHDP 2Y9ZA 1MH3A 1APLC 1I6HJ 2FQ4A 3RZOJ 2K9SA 3QPSA 2LY9A 3BT9A 4DYCA 2I10A 2HXIA 2XPWA 5FLMJ 2CUFA 1AKHB 4V2FA 5F27A 1RPWA 1QPIA 3WHBA 2CQXA 3JRBA 3TEDA 1T56A 1YRNB 3GTPJ 1JKPC 3BR1A 4C3IJ 4A3EJ 1F36A 2L7ZA 3MKLA 5F0FA 3S14J 1VI0A 3A02A 2QF7A 2LKXA 1H8AC 1FTTA 4GFBA 1XG1A 2RAEA 1WH5A 1X2NA 3E7LA 1VNDA 2LP0A 3TW6A 4BY7J 3ZQHA 2VUMJ 3S2DJ 1RKWA 2HOTA 4I76A 5J1YA 4D7MA 1HDPA 2E1OA 5IYBJ 1U9NA 1LE8B 4S0HB 4JX6A 2K40A 3JRGA 1WGXA 3FIWA 3HKZN 3D1NI 5F04A 3JRIA 4AYBN 3S1NJ 5E3OA 2O8KA 3GTQJ 4DZPA 3OSGA 2M2EA 1AU7A 2HOSA 2VKEA 1LFUP 5J3LA 3TW7A 1VF9A 2ELKA 2M8GX 5IOZA 1NTCA 3CQZJ 2HQ5A 4M3BA 1UHSA 3JRDA 3JREA 5IP7J 1UG2A 2DMQA 2LVSA 2CJJA 4JP0A 5C4JJ 4MFDA 4M3DA 3G1OA 1Y1VJ 9ANTA 2B63J 4I6ZA 3F0CA 1OCTC 3IH4A 5F0CA 2HXOA 1DU6A 1GV5A 5EG0A 3HGYA 2TCTA 3O8GA 2ID6A 3HB9A 1MBJA 2DMNA 3RZDJ 2HI3A 3OOUA 3DCFA 1H88C 1MNMC 3S15J 3BG3A 3HDDA 5FKOA 5C3EJ 3LOCA 3FK7A 3M3YJ 3FK6A 1IDYA 5FJ8J 2R5YB 4FE7A 1Y1WJ 4BXXJ 1EF4A 2VPRA 5DS9A 5FKKA 1D5YA 3OIOA 1ETKA 1ETVA 1ETWA 3K7AJ 4A3FJ 3O8HA 1IDZA 2XPVA 1RKTA 5EF6A 1ENHA 1ZQ3P 2OPTA 2Y30A 1BJZA 2K9QA 1RR7A 1K61A 2VKVA 1I50J 3IV5A 1Z77A 3SFIA 5BNGA 1T33A 2DMTA 3JR9A 1IGNA 1F43A 2CUEA 4MFEA 2E2HJ 2LTPA 5FLVA 3GTLJ 5IYCJ 1GV2A 1ZK8A 1U8BA 5HODA 3LSPA 1ETYA 4LOCA 5C44J 4QIWN 2XGEA 4UUSA 4IHXA 5EEAA 5GPCA 2X9DA 3RQIA 2CU7A 4G12A 4FTHA 2WV1A 1FTZA 1B72B 4C3JJ 1WPKA 5E3LA 2E19A 3IH2A 2DA2A 3S1MJ 2K9NA 2IBDA 2LK2A 3GTOJ 1SFOJ 4FISA 2DA5A 2FD5A 2NOGA 4X1EA 2NVQJ 2ID3A 4IHVA 3BR6A 2YU9J 3A01A 1A6IA 1JT6A 2KDZA 2M9HA 2MW8A 3PO2J 1VFCA 1U78A 1WH7A 2JWTA 3LSGA 1ZR4A 5GPAA 4IEJA 2R0QC 1I3QJ 1H89C 4V2GA 2DA3A 4DYQA 3DEWA 2JK3A 3NARA 1R9TJ 2L9RA 4BY1J 1NK2P 4BKXA 4C2MJ 3BTCA 1BW6A 4IHWA 2QCOA 3JRCA 3GTGJ 2HOAA 2R5ZA 2XRLA 3LNQA 4D7NA 3M4OJ 2COBA 1XS9A 5M3MJ 2HYJA 3UKGA 3BR0A 2DJNA 1JUPA 1PUFA 2DA7A 1MH4A 2MG4A 1GDTA 4QSHA 2X48A 2WAQN 2R5ZB 3QQAA 2WB1N 3LSRA 5FKNA 4A3IJ 2AHQA 2O9LA 2L0KA 4CYCA 1HLVA 5M3FJ 3HM5A 4A3DJ 1HF0A 3MVPA 2YS9A 3CCYA 4XICA 5IP6A 2DMUA 2HDDA 3TP3A 3BR5A 2DA6A 1FEXA 2VI6A 5K7FA 2L7MP 5J1RA 1IV6A 2JN6A 2EZHA 4A3CJ 4RDUA 3BG5A 4XK4A 4MO7A 3BG9A 1B8IA 2NVYJ 3JRFA 3I4NJ 4BBRJ 1G2HA 1JUMA 1ORKA 2R7ZJ 1QVTA 3OSFA 3B6CA 4JX5A 3WHCA 4NDLA 3HOYJ 2NS8A 1JJ6C 3FKIJ 2N8GA 2CQQA 3Q3SA 4AUXA 1BA5A 1ZR2A 4XRSA 2Y0SN 1IRZA 1ZGWA 1JKOC 5EZHA 1HCRA 5EG0B 1MBEA 5EGOA 2H1KA 3S1QJ 3RKQA 3HBLA 1K83J 1A5JA 3GTKJ 2H8RA 3H0GJ 1LFBA 1TC3C 1S7EA 4MLOA 5M5WJ 3G1MA 2X6OA 3ZQGA 3ZQLA 2LR8A 3C2BA 5EGOB 2DMPA 3S2HJ 4DW6A 2EQRA 1JTYA 5JLWA 1WCMJ 3ZQCA 4BBSJ 5M5XJ 2EH3A 3FISA 2KT0A 2IAIA 2LFBA 3SJMA 2Y2ZA 2NVTJ 1JT0A 4D5CA 5K7ZA 4B1RA 5M5YJ 3PO3J 5EZGA 4XIDA 2R92J 2EZLA 5E3MA 3H3VK 2W48A 4D5FA 2OF7A 5F0HA 1BW5A 1DU0A 3CDLA 5C4XJ 4A3MJ 3S17J 5IYDJ 3B6AA 2JMWA 1O4XA 5F1JA 2FX0A 1MSFC 4C3HJ 4UUSB 1IC8A 4A3JJ 3SDGA 1W0TA 4W97A 3MN2A 3HOXJ 4IHYA 1HDDC 2XGDA 3BQZA 1FJLA 2E2IJ 1X2MA 3HGGA 1JKRC 4A3KJ 1MBHA 2TRTA 3NAUA 3BR2A 2LLKA 4J19A 3BQYA 2O7OA 3BTJA 4MIMA 3BTLA 1OJLA 2MSYA 1GUUA 1OCPA 1IUFA 1AKHA 1QRYA 4QTRA 4B4CA 4HNVA 1E3OC 1FIPA 2IEKA 1ZKGA 1XC5A 1YRNA 2YUSA 1JGGA 5DTDA 3A01B 2NVXJ 3ZQIA 1ETXA 5IPAA 4Y52J 3G1LA 2R93J 1MBFA 1QVUA 4UUTA 1GT0C 2EZKA 3HEFA 3W6VA 3S1RJ 2G0EA 1OFCX 4XRMA 1JUSA 4Y7NJ 3HOZJ 1TWFJ 1LE8A 3Q0VA 1MBGA 4M3FA 1PUFB 2CRGA 4A3GJ 1GVDA 2XGCA 1JTXA 3BR3A 1TWAJ 3L1PA 1ETQA 4JYKA 3PM1A 3IH3A 4CYCB 5F08A 3ZOBA 1ETOA 4M6VA 2ECCA 4X6AJ 5FKLA 4W1UA 3JRHA 2ME6A 3Q0UA 3ZQFA 1POGA 2XB0X 3HOUJ 1RESA 1IJWC 1X58A 2M34A 3S16J 1MBKA 2AO9A 4EEFG 3GTJJ 2GLOA 1B8IB 5E3NA 2DA4A 1TWGJ 1CQTA 2PMZN 1ITYA 4FE4A 2FJ1A 3GBGA 4M3GA 1TWCJ 1U9OA 1P7IA 2EZIA 2E2JJ 4FCYA 3I4MJ 1P7JA 2R5YA 2XPUA 1W0UA 2DN0A 5IOYA 3K2AA 3CMYA 1WI3A 2Y9YA 2JA8J 4ABZA 2NS7A 2DTZA 4B3AA 1NK3P 4DYRA 2JA5J 2XSDC 3TP0A 4A93J 3A03A 2Y31A 2XB5A 2GBYA 5K7HA 2ZB9A 5EDNA 2GM4A 3LSJA 2L7FP 3HOWJ 2M0CA 1RETA 1MSEC 2EBIA 1JJ8C 1SANA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA1 A;  1HOM A;  2LD5 A;  3BTI A;  3JRA A;  3Q0W A;  1IG7 A;  2JA7 J;  4A69 C;  2ECB A;  1UMQ A;  2P81 A;  5GP9 A;  4A3L J;  5JLX A;  3GTM J;  4M3E A;  2D5V A;  1ZTR A;  1TWH J;  4JX4 A;  4DZJ A;  1BL0 A;  1Z0X A;  3VPR A;  4RBO A;  2JJ7 A;  4AC0 A;  1JKQ C;  3QPL A;  5EYR A;  1Q1V A;  5FKM A;  4XRS G;  3HOV J;  4A3B J;  1FIA A;  1B72 A;  2JA6 J;  2MGQ A;  2ME0 A;  4L5E A;  5IP9 J;  5J1U A;  1AHD P;  2Y9Z A;  1MH3 A;  1APL C;  1I6H J;  2FQ4 A;  3RZO J;  2K9S A;  3QPS A;  2LY9 A;  3BT9 A;  4DYC A;  2I10 A;  2HXI A;  2XPW A;  5FLM J;  2CUF A;  1AKH B;  4V2F A;  5F27 A;  1RPW A;  1QPI A;  3WHB A;  2CQX A;  3JRB A;  3TED A;  1T56 A;  1YRN B;  3GTP J;  1JKP C;  3BR1 A;  4C3I J;  4A3E J;  1F36 A;  2L7Z A;  3MKL A;  5F0F A;  3S14 J;  1VI0 A;  3A02 A;  2QF7 A;  2LKX A;  1H8A C;  1FTT A;  4GFB A;  1XG1 A;  2RAE A;  1WH5 A;  1X2N A;  3E7L A;  1VND A;  2LP0 A;  3TW6 A;  4BY7 J;  3ZQH A;  2VUM J;  3S2D J;  1RKW A;  2HOT A;  4I76 A;  5J1Y A;  4D7M A;  1HDP A;  2E1O A;  5IYB J;  1U9N A;  1LE8 B;  4S0H B;  4JX6 A;  2K40 A;  3JRG A;  1WGX A;  3FIW A;  3HKZ N;  3D1N I;  5F04 A;  3JRI A;  4AYB N;  3S1N J;  5E3O A;  2O8K A;  3GTQ J;  4DZP A;  3OSG A;  2M2E A;  1AU7 A;  2HOS A;  2VKE A;  1LFU P;  5J3L A;  3TW7 A;  1VF9 A;  2ELK A;  2M8G X;  5IOZ A;  1NTC A;  3CQZ J;  2HQ5 A;  4M3B A;  1UHS A;  3JRD A;  3JRE A;  5IP7 J;  1UG2 A;  2DMQ A;  2LVS A;  2CJJ A;  4JP0 A;  5C4J J;  4MFD A;  4M3D A;  3G1O A;  1Y1V J;  9ANT A;  2B63 J;  4I6Z A;  3F0C A;  1OCT C;  3IH4 A;  5F0C A;  2HXO A;  1DU6 A;  1GV5 A;  5EG0 A;  3HGY A;  2TCT A;  3O8G A;  2ID6 A;  3HB9 A;  1MBJ A;  2DMN A;  3RZD J;  2HI3 A;  3OOU A;  3DCF A;  1H88 C;  1MNM C;  3S15 J;  3BG3 A;  3HDD A;  5FKO A;  5C3E J;  3LOC A;  3FK7 A;  3M3Y J;  3FK6 A;  1IDY A;  5FJ8 J;  2R5Y B;  4FE7 A;  1Y1W J;  4BXX J;  1EF4 A;  2VPR A;  5DS9 A;  5FKK A;  1D5Y A;  3OIO A;  1ETK A;  1ETV A;  1ETW A;  3K7A J;  4A3F J;  3O8H A;  1IDZ A;  2XPV A;  1RKT A;  5EF6 A;  1ENH A;  1ZQ3 P;  2OPT A;  2Y30 A;  1BJZ A;  2K9Q A;  1RR7 A;  1K61 A;  2VKV A;  1I50 J;  3IV5 A;  1Z77 A;  3SFI A;  5BNG A;  1T33 A;  2DMT A;  3JR9 A;  1IGN A;  1F43 A;  2CUE A;  4MFE A;  2E2H J;  2LTP A;  5FLV A;  3GTL J;  5IYC J;  1GV2 A;  1ZK8 A;  1U8B A;  5HOD A;  3LSP A;  1ETY A;  4LOC A;  5C44 J;  4QIW N;  2XGE A;  4UUS A;  4IHX A;  5EEA A;  5GPC A;  2X9D A;  3RQI A;  2CU7 A;  4G12 A;  4FTH A;  2WV1 A;  1FTZ A;  1B72 B;  4C3J J;  1WPK A;  5E3L A;  2E19 A;  3IH2 A;  2DA2 A;  3S1M J;  2K9N A;  2IBD A;  2LK2 A;  3GTO J;  1SFO J;  4FIS A;  2DA5 A;  2FD5 A;  2NOG A;  4X1E A;  2NVQ J;  2ID3 A;  4IHV A;  3BR6 A;  2YU9 J;  3A01 A;  1A6I A;  1JT6 A;  2KDZ A;  2M9H A;  2MW8 A;  3PO2 J;  1VFC A;  1U78 A;  1WH7 A;  2JWT A;  3LSG A;  1ZR4 A;  5GPA A;  4IEJ A;  2R0Q C;  1I3Q J;  1H89 C;  4V2G A;  2DA3 A;  4DYQ A;  3DEW A;  2JK3 A;  3NAR A;  1R9T J;  2L9R A;  4BY1 J;  1NK2 P;  4BKX A;  4C2M J;  3BTC A;  1BW6 A;  4IHW A;  2QCO A;  3JRC A;  3GTG J;  2HOA A;  2R5Z A;  2XRL A;  3LNQ A;  4D7N A;  3M4O J;  2COB A;  1XS9 A;  5M3M J;  2HYJ A;  3UKG A;  3BR0 A;  2DJN A;  1JUP A;  1PUF A;  2DA7 A;  1MH4 A;  2MG4 A;  1GDT A;  4QSH A;  2X48 A;  2WAQ N;  2R5Z B;  3QQA A;  2WB1 N;  3LSR A;  5FKN A;  4A3I J;  2AHQ A;  2O9L A;  2L0K A;  4CYC A;  1HLV A;  5M3F J;  3HM5 A;  4A3D J;  1HF0 A;  3MVP A;  2YS9 A;  3CCY A;  4XIC A;  5IP6 A;  2DMU A;  2HDD A;  3TP3 A;  3BR5 A;  2DA6 A;  1FEX A;  2VI6 A;  5K7F A;  2L7M P;  5J1R A;  1IV6 A;  2JN6 A;  2EZH A;  4A3C J;  4RDU A;  3BG5 A;  4XK4 A;  4MO7 A;  3BG9 A;  1B8I A;  2NVY J;  3JRF A;  3I4N J;  4BBR J;  1G2H A;  1JUM A;  1ORK A;  2R7Z J;  1QVT A;  3OSF A;  3B6C A;  4JX5 A;  3WHC A;  4NDL A;  3HOY J;  2NS8 A;  1JJ6 C;  3FKI J;  2N8G A;  2CQQ A;  3Q3S A;  4AUX A;  1BA5 A;  1ZR2 A;  4XRS A;  2Y0S N;  1IRZ A;  1ZGW A;  1JKO C;  5EZH A;  1HCR A;  5EG0 B;  1MBE A;  5EGO A;  2H1K A;  3S1Q J;  3RKQ A;  3HBL A;  1K83 J;  1A5J A;  3GTK J;  2H8R A;  3H0G J;  1LFB A;  1TC3 C;  1S7E A;  4MLO A;  5M5W J;  3G1M A;  2X6O A;  3ZQG A;  3ZQL A;  2LR8 A;  3C2B A;  5EGO B;  2DMP A;  3S2H J;  4DW6 A;  2EQR A;  1JTY A;  5JLW A;  1WCM J;  3ZQC A;  4BBS J;  5M5X J;  2EH3 A;  3FIS A;  2KT0 A;  2IAI A;  2LFB A;  3SJM A;  2Y2Z A;  2NVT J;  1JT0 A;  4D5C A;  5K7Z A;  4B1R A;  5M5Y J;  3PO3 J;  5EZG A;  4XID A;  2R92 J;  2EZL A;  5E3M A;  3H3V K;  2W48 A;  4D5F A;  2OF7 A;  5F0H A;  1BW5 A;  1DU0 A;  3CDL A;  5C4X J;  4A3M J;  3S17 J;  5IYD J;  3B6A A;  2JMW A;  1O4X A;  5F1J A;  2FX0 A;  1MSF C;  4C3H J;  4UUS B;  1IC8 A;  4A3J J;  3SDG A;  1W0T A;  4W97 A;  3MN2 A;  3HOX J;  4IHY A;  1HDD C;  2XGD A;  3BQZ A;  1FJL A;  2E2I J;  1X2M A;  3HGG A;  1JKR C;  4A3K J;  1MBH A;  2TRT A;  3NAU A;  3BR2 A;  2LLK A;  4J19 A;  3BQY A;  2O7O A;  3BTJ A;  4MIM A;  3BTL A;  1OJL A;  2MSY A;  1GUU A;  1OCP A;  1IUF A;  1AKH A;  1QRY A;  4QTR A;  4B4C A;  4HNV A;  1E3O C;  1FIP A;  2IEK A;  1ZKG A;  1XC5 A;  1YRN A;  2YUS A;  1JGG A;  5DTD A;  3A01 B;  2NVX J;  3ZQI A;  1ETX A;  5IPA A;  4Y52 J;  3G1L A;  2R93 J;  1MBF A;  1QVU A;  4UUT A;  1GT0 C;  2EZK A;  3HEF A;  3W6V A;  3S1R J;  2G0E A;  1OFC X;  4XRM A;  1JUS A;  4Y7N J;  3HOZ J;  1TWF J;  1LE8 A;  3Q0V A;  1MBG A;  4M3F A;  1PUF B;  2CRG A;  4A3G J;  1GVD A;  2XGC A;  1JTX A;  3BR3 A;  1TWA J;  3L1P A;  1ETQ A;  4JYK A;  3PM1 A;  3IH3 A;  4CYC B;  5F08 A;  3ZOB A;  1ETO A;  4M6V A;  2ECC A;  4X6A J;  5FKL A;  4W1U A;  3JRH A;  2ME6 A;  3Q0U A;  3ZQF A;  1POG A;  2XB0 X;  3HOU J;  1RES A;  1IJW C;  1X58 A;  2M34 A;  3S16 J;  1MBK A;  2AO9 A;  4EEF G;  3GTJ J;  2GLO A;  1B8I B;  5E3N A;  2DA4 A;  1TWG J;  1CQT A;  2PMZ N;  1ITY A;  4FE4 A;  2FJ1 A;  3GBG A;  4M3G A;  1TWC J;  1U9O A;  1P7I A;  2EZI A;  2E2J J;  4FCY A;  3I4M J;  1P7J A;  2R5Y A;  2XPU A;  1W0U A;  2DN0 A;  5IOY A;  3K2A A;  3CMY A;  1WI3 A;  2Y9Y A;  2JA8 J;  4ABZ A;  2NS7 A;  2DTZ A;  4B3A A;  1NK3 P;  4DYR A;  2JA5 J;  2XSD C;  3TP0 A;  4A93 J;  3A03 A;  2Y31 A;  2XB5 A;  2GBY A;  5K7H A;  2ZB9 A;  5EDN A;  2GM4 A;  3LSJ A;  2L7F P;  3HOW J;  2M0C A;  1RET A;  1MSE C;  2EBI A;  1JJ8 C;  1SAN A; 
#chains in the Genus database with same CATH topology
 1FSE A;  4XLP F;  1NG6 A;  4IHT A;  3I71 A;  3BTI A;  5B1B H;  3W6J B;  3Q0W A;  4A69 C;  2E1N A;  2MFZ A;  1S6L A;  1OCZ H;  3M8J A;  2HDC A;  5JLX A;  4BE1 A;  3GTM J;  4K2E A;  2XRN A;  1P6R A;  1O3S A;  3H5A A;  3KYL A;  1A31 A;  3VPR A;  4RBO A;  2JJ7 A;  4AC0 A;  4F3Q A;  3QPL A;  5EYR A;  3HOV J;  4NC6 A;  3JSP A;  1DP7 P;  2EV5 A;  3KIO A;  3K1P A;  3FM3 A;  2FOW A;  5IP9 J;  5HS7 A;  2HNH A;  1AHD P;  2Y9Z A;  1MH3 A;  1BI2 A;  4ON0 A;  1K78 B;  4D9J A;  4EGZ A;  1LB2 A;  5FLX K;  3KE2 A;  1TQI A;  4EM1 A;  2GA2 A;  4UV9 A;  3M7G A;  3H9G A;  3N4M A;  3A0B C;  4DYC A;  2KIF A;  2PFB A;  2XPW A;  3I58 A;  4F55 A;  5FD6 A;  5FLM J;  1AKH B;  1RPW A;  1FYM A;  2HKX A;  2RNJ A;  3WHB A;  3GFM A;  4I7H A;  4XLE A;  1MGT A;  2AQF A;  2OZU A;  3GTP J;  1RZ4 A;  1JKP C;  1OYI A;  3TOA A;  1F36 A;  2L7Z A;  4A3E J;  3S14 J;  2VXD A;  1FZP B;  2WWY A;  5E79 C;  3SXY A;  4H0E A;  2EFQ A;  4PK4 A;  4HDU A;  1FTT A;  4C30 A;  1XG1 A;  2BY2 A;  2RAE A;  2RDP A;  1J75 A;  1KU7 A;  4CH7 A;  2DYR H;  4GFB A;  2VBW A;  2PLY A;  4EV0 A;  1EH8 A;  3TW6 A;  4MEX F;  3EUH A;  4HEA 2;  1U2W A;  4BQO A;  1WZ2 A;  4BY7 J;  4HPQ A;  3HIF A;  3ZQH A;  2VJ4 A;  3S2D J;  2HOT A;  1I1S A;  2W85 A;  2VJJ A;  1K79 A;  3DBH B;  3ABT A;  3V4G A;  4RGS A;  2JRT A;  4L0Y B;  4XKB A;  4IL6 C;  4OU0 A;  2GXA A;  3JRG A;  3FIW A;  4QPO A;  1G59 A;  3C2H A;  4JOM A;  2DPD A;  2B7E A;  3CC7 I;  1AOY A;  2BXZ A;  1ACI A;  5E3O A;  5BPD A;  4DZP A;  1SVL A;  1ZAO A;  1MND A;  4RAZ A;  1YI2 I;  2VKE A;  1K4T A;  1IN4 A;  3TW7 A;  2Y75 A;  5HS9 A;  1MKM A;  3V7R A;  2GXG A;  3C7J A;  3JRE A;  4N0B A;  1T8I A;  2DMQ A;  1N25 A;  3VOD A;  2CJJ A;  3FXO A;  1EA3 A;  3KEQ A;  5C4J J;  9ANT A;  3FXJ A;  3CMM A;  2BEO A;  2EIJ H;  2LYC A;  1SFX A;  1ZEL A;  1SMY F;  4HQE A;  1KU2 A;  2VJ5 A;  3KCC A;  2JSC A;  4LFU A;  1GV5 A;  1ERD A;  4KNY A;  4Z6Y A;  2OU2 A;  3HGY A;  3O8G A;  1STZ A;  3HB9 A;  1IXR C;  3VYT B;  4BS9 A;  5F6F A;  3OOU A;  3CO6 C;  2A5Y B;  4MQV A;  4I0B A;  1A35 A;  2NXN B;  3LOC A;  3FK7 A;  1ZN2 A;  2F5C A;  3D5L A;  4DGW B;  3MKZ A;  2R5Y B;  2ZFU A;  3GCM A;  5H2F C;  3RJP A;  3LA7 A;  4Y17 A;  4UHT A;  1BI0 A;  1D5V A;  1LDD A;  2CMP A;  4E7L A;  1ETV A;  4ENM A;  5EF6 A;  4N4O B;  1REP C;  1A04 A;  2OPT A;  1S5L C;  4H4K C;  1XCB A;  1K61 A;  1V3F A;  1I50 J;  2VKV A;  3IV5 A;  1WJC A;  3SFI A;  1ZG1 A;  2DMT A;  3F8F A;  2LBF B;  2XHK A;  1IGN A;  1F43 A;  2E2H J;  3GTL J;  4EQQ A;  4U88 A;  1U8B A;  3OYF A;  1X19 A;  3L2C A;  1BR1 A;  5HVQ C;  2XGE A;  4KIC A;  3L09 A;  1LEA A;  4KIF A;  1Y56 A;  3J7A Y;  1UHW A;  1U5T A;  4BL0 B;  1NHA A;  1KA8 A;  2NAZ A;  5E3L A;  3MKW B;  2WA0 A;  2IBD A;  3GTO J;  5DM7 F;  1WVR A;  2KZG A;  4RM2 A;  1HXD A;  3J81 Z;  1YE9 A;  1TL8 A;  2ID3 A;  4IHV A;  3DTE A;  5BS6 A;  2CW7 A;  2RQQ A;  3D5R C;  1O3R A;  2YR2 A;  2YU9 J;  1UJ8 A;  2ICW G;  3FM5 A;  1JT6 A;  1WI9 A;  1N77 A;  5D5U B;  3A4C A;  3PO2 J;  1VFC A;  4OMZ A;  1T98 A;  1ZR4 A;  3FXQ A;  2P4W A;  4C2T A;  4PJM A;  5GPA A;  1EV7 A;  3KEY A;  1I3Q J;  1YG2 A;  4BU2 A;  2DA3 A;  4DYQ A;  2QSG X;  1D1C A;  4HV5 A;  3ERE D;  4IRI A;  4ASN A;  2R7D A;  1XDU A;  4HF2 A;  1NK2 P;  3H9Q A;  4GYG A;  3BTC A;  2OCE A;  1HKQ A;  1BW6 A;  4IHW A;  2QCO A;  2XAS A;  4YFN F;  3C18 A;  4PZJ A;  4D7N A;  2COB A;  5M3M J;  2VLA A;  3BPX A;  1JUP A;  4FX0 A;  5K5O A;  3WTX C;  2ZKZ A;  3ASO H;  3CDH A;  4A5N A;  2WB1 N;  2ZXJ A;  3BCA A;  4A3I J;  4BYY A;  1UG0 A;  3EUH C;  2L0K A;  3L9F A;  5TGT A;  3M1E A;  4PFO A;  2B9S A;  2I5U A;  3RSN A;  1Z3Y A;  2IP2 A;  2DW4 A;  3MVP A;  2YS9 A;  2DOE A;  3CCY A;  4A0Z A;  3BZC A;  5IP6 A;  4XIC A;  1V55 H;  3M8E A;  3BR5 A;  2DPU A;  3KP4 A;  4LB5 A;  1FEX A;  4BJ5 C;  4KIT B;  1IRF A;  2L7M P;  4XR6 A;  1HW1 A;  2Q0O A;  1UCR A;  1DGW Y;  3HTU A;  2JA2 A;  3CCU I;  4MO7 A;  1BC7 C;  1PJR A;  1MMA A;  1P4A A;  1JUM A;  2KIU A;  2ZME C;  4CXF A;  1GXP A;  3OSF A;  5HLI A;  1SD7 A;  3DBR B;  2DFH A;  4JX5 A;  2PQ8 A;  1M1E B;  5TRD A;  2N8G A;  3Q3S A;  4XNF A;  2LRE A;  1QU3 A;  1Z9C A;  3HTS B;  1W5T A;  4A2U A;  3CTA A;  4L9N A;  4UV8 A;  3CCS I;  4IKF A;  2OCC H;  3T5X A;  2ESN A;  4CCM A;  2M5W A;  2L9S A;  1Z05 A;  5E1X A;  2H8R A;  2D2W A;  2Z9O A;  4MLO A;  2XGX A;  3ZQG A;  1IUY A;  3FXR A;  1R5H A;  1HW2 A;  1VQ9 I;  1YIO A;  4RB2 C;  4OMY A;  1X1P A;  1ULY A;  3R6S A;  4OAY A;  2E5Z A;  3JTH A;  2OTL I;  3BJA A;  5AIP A;  5JLW A;  4KFC A;  1WCM J;  4F7Z A;  1O7F A;  3ZQC A;  2VQG A;  3Q5F A;  4Z2Y A;  5L3G A;  3PUF A;  4PJN A;  1TNS A;  2Y2Z A;  2RV8 A;  4D5C A;  5K7Z A;  5M5Y J;  2E36 A;  4XID A;  1MW7 A;  2FXA A;  2NYX A;  1A6Q A;  4D0P A;  4P9F A;  4C2U A;  1PDN C;  2P5V A;  4I01 A;  3CDL A;  2MLK A;  4XON A;  4AWX B;  3RPU D;  3KET A;  3J7A O;  5IYD J;  1ON1 A;  1O4X A;  5L3E A;  1IRX A;  3FZV A;  2I8D A;  2W00 A;  2IS6 A;  4BGD A;  1W0T A;  4KIB A;  2IGO A;  1W1W E;  4W97 A;  3MN2 A;  4IOA F;  4IHY A;  1U5T B;  1HDD C;  2XGD A;  2K4J A;  3GWZ A;  1VQ6 I;  4G6Q A;  2Y48 A;  3HGG A;  1JKR C;  2TRT A;  1LEB A;  3TO7 A;  3U2R A;  2QQA A;  2LLK A;  3OS1 A;  2O7O A;  2V1D A;  2DFE A;  4HZF A;  1OJL A;  1FBU A;  3PIP F;  1GUU A;  2K4B A;  3FBI B;  1E3P A;  2VXZ A;  1HA8 A;  4B4C A;  2CV2 A;  2CFO A;  2IEK A;  5B66 C;  4HF0 A;  1GHC A;  4LG3 A;  1GVJ A;  1YRN A;  5CQG A;  1Z7L A;  3K69 A;  3KX2 A;  2IXS A;  2QSH X;  3M8F A;  2JT1 A;  3ECO A;  3AG1 H;  5JVG F;  2E1C A;  2HEO A;  5DTD A;  4XSX F;  2GXB A;  3F8C A;  5LEK A;  5CVR A;  4CCL A;  4B3X A;  4Y52 J;  3OIQ A;  3G1L A;  4L5I A;  1MBF A;  1QVU A;  2R93 J;  4UUT A;  4RMN A;  4I99 C;  1GT0 C;  2ZCW A;  1DPU A;  1P92 A;  2HYG D;  3PL8 A;  3HEF A;  2LDU A;  2F5F A;  2G0E A;  3QOE A;  4XRM A;  1Y6I A;  4X0G A;  3S3M A;  1YX5 A;  4CCN A;  2G7H A;  1JUS A;  4Y7N J;  3T0Y A;  2VOP A;  2EIK H;  1SVO A;  3RKX A;  3ZPL A;  1LE8 A;  2QYO A;  4XOP A;  4RAY A;  1MMN A;  1WHU A;  3DXJ F;  3PNY A;  4KYW A;  1FOY A;  1GVD A;  5J8F A;  2XGC A;  1Z6R A;  1XGO A;  3ROU A;  2D45 A;  4IPA A;  3L1P A;  1LKX A;  2GOM A;  5CVV A;  4JYK A;  4M9X A;  1AA7 A;  3C3W A;  4BXF A;  3C2G A;  1D8K A;  3BG6 A;  4AIJ A;  4X6A J;  1SFU A;  4W1U A;  2H27 A;  3KP5 A;  3AKZ A;  3ZN1 A;  2OC6 A;  2XAQ A;  2XB0 X;  4WF2 A;  4F92 B;  3D5S C;  2ELJ A;  3CCR I;  3CD6 I;  2CUZ A;  3HOU J;  4LB6 B;  2M30 A;  4L9V A;  4ZYH A;  2MD5 A;  4PSW A;  3F72 A;  1LVA A;  1OQY A;  3T8R A;  2F6C A;  5E3N A;  1TWG J;  1CQT A;  1BOB A;  1Z6T A;  1ITY A;  5AON A;  2GA1 A;  1FOW A;  2YPR A;  4FE4 A;  2FJ1 A;  3GBG A;  4YG2 F;  1TWC J;  3KP6 A;  4HST A;  3HRT A;  2VC0 A;  3IRQ A;  4OIO F;  2HR3 A;  2UXN A;  3I4M J;  2DDB A;  2G9W A;  4L9J A;  1IF1 A;  2CO5 A;  2COM A;  4HSR A;  1YYV A;  4J01 A;  2GIZ A;  4XLC A;  2ZNY A;  3P7N A;  1G8X A;  4BXU A;  2JTV A;  4P5O A;  4U0V A;  3N97 A;  4ABZ A;  4YRV A;  2FNP A;  3IP4 B;  3G71 I;  3BCB A;  2IW5 A;  4AD9 A;  3WGH A;  1LPQ A;  2C6Y A;  2IA2 A;  3HUG A;  1DPR A;  2AS5 F;  5K7H A;  5EDN A;  2EK5 A;  2LC2 A;  2QEX I;  1DDN A;  5ICC A;  3LSJ A;  5ICE A;  3HOW J;  3TBI A;  5LGN A;  3S3N A;  2DU9 A;  1VQO I;  2EBI A;  5J6X A;  2X0L A;  1JJ8 C;  2HVR A;  4BH9 A;  2LD5 A;  3KPH A;  1IG7 A;  2R7V A;  4EMS A;  2ECB A;  2XAG A;  1BR4 A;  2KKO A;  5H6R A;  3GUD A;  3DPU A;  2P7C B;  3QOD A;  2KIS A;  2WB1 A;  1WJF A;  2QBY B;  1FYL A;  3GZ6 A;  4PGG A;  4A3B J;  5L3C A;  1YLF A;  2A68 F;  1FY7 A;  1KQ9 A;  3MZ8 A;  1W5C C;  2ME0 A;  1YIJ I;  2R7R A;  4WXH A;  1R00 A;  3BOQ A;  3OS2 A;  2WAF A;  3PSI A;  5GAG J;  1AWC A;  1APL C;  1IV8 A;  5A2Q K;  2LY9 A;  5LD2 C;  3GFI A;  2OZ6 A;  3O6B B;  2YX4 A;  4L5J A;  2XKP A;  3AG4 H;  3WU0 A;  2I10 A;  2HXI A;  1SVM A;  4KIG A;  4V2F A;  3OOP A;  5F27 A;  5CYV A;  4CYD A;  2QUF A;  3JRB A;  5CJ9 A;  2RKH A;  3TED A;  2DT5 A;  5F64 A;  1VQK I;  4Q4Z F;  1T56 A;  4E7I A;  2XF7 A;  1YRN B;  3CF2 A;  4KDP A;  2DT7 B;  5EEG A;  3NWS A;  3PJR A;  5DD8 A;  3HL2 A;  3JAM K;  2WC2 A;  4FQG A;  3DKX A;  2BGC A;  5J47 A;  2F5V A;  3QP6 A;  2KJC A;  3F8B A;  3X2Q H;  3JSO A;  1X2N A;  5IT9 K;  2LP0 A;  3LSH A;  2VPL A;  4RB1 A;  2QKL B;  2M7B A;  3TDZ C;  2VUM J;  2XAJ A;  3K2Z A;  2E1O A;  1V5F A;  3GLX A;  2A6T A;  1T2K A;  1RUO A;  3OYH A;  3PIO F;  1LE8 B;  4JX6 A;  3FHZ A;  3H3Z A;  2DOF A;  2HFH A;  3RCO A;  4KA4 A;  1Y39 A;  3JRI A;  3S1N J;  1D0Y A;  1RR8 C;  4G6T B;  3WE3 A;  5CVI A;  4A0X A;  4XBF A;  4G94 A;  3VB2 A;  5IOZ A;  3CQZ J;  2HU9 A;  3DPL C;  1D0Z A;  2KIM A;  5IP7 J;  3M9A A;  1UG2 A;  2KJB A;  4WXD A;  2DYS H;  3GFL A;  4JP0 A;  3U1K A;  3T8T A;  2PJR A;  3G1O A;  1Y1V J;  2BBY A;  2B63 J;  4I6Z A;  4P96 A;  3RYR A;  5LGU A;  1R6R A;  1PP8 F;  2MD0 A;  3E3V A;  5HOO A;  5HNF A;  4E6K G;  2K85 A;  1OCT C;  3PNT A;  1R1T A;  3TOB A;  2VAS A;  1ZG5 A;  4RGU A;  1TW3 A;  1KYZ A;  5EG0 A;  3ML6 A;  3P9I A;  3SQN A;  4MQ9 F;  3RZD J;  3DCF A;  1MNM C;  1W36 C;  3L2W A;  2F2E A;  3BG3 A;  3U9G A;  5C3E J;  4OIP F;  2A6E F;  3F23 A;  3FK6 A;  2EWN A;  3V8L A;  1X1A A;  4U0Y A;  4FE7 A;  1Y1W J;  1QA6 A;  2X51 A;  1H0M A;  2KRF A;  2IA0 A;  1D5Y A;  2CV1 A;  4I2O A;  4PFP A;  1TT0 A;  4CIC A;  1WKM A;  1BI1 A;  1ETK A;  5DYM A;  3R61 A;  3HUG B;  1IDZ A;  5D5V B;  3OMY A;  2XPV A;  1RKT A;  2FA5 A;  4KMF A;  4OAZ A;  1OMI A;  2V9V A;  4XKC A;  3I9V 2;  4GCV A;  2BY1 A;  5BNG A;  1MMD A;  4M9Z A;  2LTP A;  1WRJ A;  1XN7 A;  2BVM A;  2CW8 A;  3SDB A;  1ZGA A;  4XSZ F;  4UUS A;  5J40 A;  3LWF A;  5GPC A;  5EEA A;  3NWT A;  1BC8 C;  1XMA A;  2W57 A;  2X9D A;  1WJA A;  3RQI A;  3CCE I;  4XQF A;  2BVL A;  1V5G A;  3CLO A;  2O03 A;  2PJP A;  2ZJ2 A;  4G12 A;  3ZRG A;  1QHG A;  4FTH A;  1V5E A;  1FTZ A;  4RB0 A;  1R22 A;  1WPK A;  1UHM A;  4GGG A;  1I1G A;  5D5W B;  3OYG A;  4UXN A;  3E6C C;  3WTS C;  4NUB A;  4AIH A;  4HDV A;  1TQP A;  4X1E A;  4HX4 A;  3WU2 C;  2W24 A;  1FP1 D;  3DWL E;  2DTR A;  1HKS A;  3IHU A;  3AG2 H;  2QKM B;  3CO7 C;  4M72 A;  3JAM Z;  3BRO A;  2MW8 A;  1O57 A;  1R5G A;  2JWT A;  4EVI A;  3KZY A;  5IT9 Z;  2R0Q C;  2J5P A;  1H89 C;  4V2G A;  3DEW A;  3QPH A;  2JK3 A;  3NAR A;  3GX4 X;  1DUX C;  5E17 F;  3FDY A;  4I02 A;  4I98 B;  5EJC A;  4BKX A;  2DCE A;  3I64 A;  1O3Q A;  1SFE A;  2VKD A;  2R7S A;  3B73 A;  3CJT B;  2FSW A;  3LNQ A;  4HV6 A;  3FXM A;  3IRR A;  1XS9 A;  3BR0 A;  2IPQ X;  3F8N A;  2RRE A;  3EYI A;  1FT9 A;  3OWT A;  1RUN A;  2WAQ N;  1R4N B;  2K3P A;  3QQA A;  3KYC B;  4ESB A;  5FKN A;  2GWR A;  2O0Y A;  4UVC A;  1FOX A;  4BJT A;  1W4M A;  3OYI A;  2O9L A;  2BXY A;  2FML A;  4UB8 C;  2VKH A;  5M3F J;  4HBL A;  2L4A A;  4NC7 A;  4A3D J;  1HF0 A;  2KHM A;  4RB3 C;  3TP3 A;  5FRN A;  3CCJ I;  1SFK A;  2P7V B;  4RLF A;  2DA6 A;  3ZR8 X;  2VI6 A;  2K9L A;  1KYW A;  4A12 A;  4ETS A;  2L3D A;  2LF8 A;  4ITV A;  3UR3 C;  3VSL A;  1B8I A;  2NVY J;  2WAE A;  4BBR J;  3ISP A;  1QVT A;  2RNG A;  2PJR B;  3CP8 A;  2VBY A;  2V6E A;  1OR7 C;  1R23 A;  3WHC A;  2KMU A;  2BOL A;  3VEP A;  3WGG A;  4NDL A;  2NS8 A;  3FKI J;  2CQQ A;  3PQK A;  3O2P E;  2ADU A;  4XRS A;  2EV6 A;  2M8E A;  2Y0S N;  1IRZ A;  3OYN A;  1J7K A;  2QQB A;  4DNC A;  1MBE A;  5EG0 B;  2IRF G;  3ABK H;  2F48 A;  3HBL A;  1Z1D A;  3DU5 A;  1K83 J;  4QPQ A;  3P5J A;  3CJR B;  2ACJ A;  3GZ5 A;  2R7T A;  1FNN A;  3H0G J;  1LFB A;  5BOX A;  1TC3 C;  5M5W J;  1ZG3 A;  2FE3 A;  4LJZ F;  4DQ2 A;  1CGP A;  2FMY A;  3E5X A;  3KZI C;  3ZQL A;  2LR8 A;  2Z33 A;  3C2B A;  4ZTJ A;  2DMP A;  3RQ4 A;  1OIS A;  2RN7 A;  1JTY A;  2A3S A;  1KQ0 A;  4R8H A;  1YIT I;  3FIS A;  2MH2 A;  4PJL A;  2W4S A;  3FX3 A;  1JT0 A;  4B1R A;  1S7A A;  1XDS A;  2B0L A;  4XL9 A;  1MD0 A;  3E5Q A;  2R92 J;  2EZL A;  4JQF A;  5HDN A;  3H3V K;  5F0H A;  1BW5 A;  1UZC A;  5D8K B;  1KU3 A;  3RI4 A;  5C4X J;  2HPM A;  3S17 J;  5LRS A;  3B6A A;  3WTT C;  2BHZ A;  5BPI A;  4E7H A;  1IO2 A;  5F1J A;  2FX0 A;  4C3H J;  3W2V A;  2MBF A;  4UUS B;  5FLX Z;  2L9V A;  3TL4 X;  3FF5 A;  3IAS 2;  2DI3 A;  3CDI A;  4A6D A;  3HOX J;  4HA8 A;  1X2M A;  2DQR A;  4MTD A;  1WJB A;  3DBL B;  1HBX G;  1J5Y A;  3VYR B;  3BR2 A;  2CG4 A;  3VYU B;  2FF4 A;  3A0H C;  3BQY A;  3G73 A;  4J19 A;  2E60 A;  3BTL A;  4HQM A;  3K1N A;  2MSY A;  2RGV A;  1FPQ A;  2GZW A;  1QRY A;  4AVZ A;  5CPR B;  4QTR A;  3F21 A;  4ZJZ A;  4HNV A;  5KCM A;  4N9I A;  5E1Z B;  1XC5 A;  4V19 K;  1XCV A;  5JFR A;  4E70 A;  5CQE A;  4BQQ A;  4P1W A;  3WE2 A;  4NC8 A;  3ZQI A;  1ETX A;  5IPA A;  1U6G A;  4IRG A;  5HLH A;  3UNG C;  5HDK A;  2BY0 A;  2H6C A;  4U7D A;  3W6V A;  3QAH A;  2H94 A;  3CME I;  3S1R J;  4G6D A;  1R58 A;  2E1M B;  2HDW A;  2WBM A;  3D0S A;  1XX5 A;  1TWF J;  1SAX A;  3AG3 H;  1MBG A;  1S9H A;  2ZXI A;  1EH7 A;  3R0J A;  3REO A;  3TQN A;  1E0E A;  4HAM A;  1BBY A;  2Q1Z B;  1A36 A;  4S05 A;  2IGK A;  3CC4 I;  2QQ9 A;  4IO9 F;  1E17 A;  2XF5 A;  2QLZ A;  4Y15 A;  2CH0 A;  3LFU A;  3G3Z A;  1YW8 A;  4ZC3 A;  2XSJ C;  3IH3 A;  4ZDO A;  4U87 A;  2Q2E A;  4FET A;  1ETO A;  4BEH A;  4M6V A;  2YSR A;  2BYV E;  2ECC A;  2ZXW H;  2D1H A;  4MTE A;  4XM3 A;  4DJA A;  3MEX A;  2DDA A;  3EPZ A;  3K10 A;  4AID A;  2BE5 F;  1KQ8 A;  1IJW C;  3J7Z I;  2F5E A;  4HX8 A;  4MNU A;  2XRO A;  1LFP A;  1B8I B;  2X1D A;  2DA4 A;  1TQM A;  2VBX A;  5BMZ A;  2PMZ N;  4U7B A;  3K4C A;  1I39 A;  5E8I A;  1W7P D;  1MJB A;  4M3G A;  2XAU A;  3IWF A;  3W2A A;  1HKT A;  3G2B A;  2E2J J;  2L54 A;  4OWR B;  3QYE A;  1P7J A;  3MAJ A;  1QGP A;  2XPU A;  3KZZ A;  5IOY A;  1Y0N A;  4N9H A;  1WI3 A;  3WGI A;  2D1V A;  1G4D A;  4ZDL A;  3KP2 A;  1TT5 B;  3B02 A;  4A93 J;  3A03 A;  2K9M A;  4RS8 A;  3DKW A;  2Y31 A;  4A0Y A;  2ZB9 A;  2FOK A;  3GFJ A;  4OIR F;  1S7O A;  4M9S A;  3DTK A;  3L2V A;  4UVB A;  3L2Q A;  5B1A H;  4D1Q A;  2ESH A;  2MA3 A;  1MSE C;  4N4N B;  1XSV A;  3HPH A;  1SAN A;  2JSP A;  4L0Z B;  2QBY A;  2BZT A;  1HOM A;  3JRA A;  2V1U A;  2JZY A;  2EFP A;  3TGN A;  1EH6 A;  1IN5 A;  3ZMS A;  4CZZ A;  1UMQ A;  3K4N A;  2P81 A;  5GP9 A;  4A3L J;  1SD6 A;  2WAQ A;  4ZYG A;  2DT6 A;  2F5D A;  2Z16 A;  2A05 A;  4M3E A;  1QBJ A;  4JX4 A;  1BL0 A;  4DZJ A;  1P2F A;  1JKQ C;  2ZFW A;  3DF8 A;  1Q1V A;  4XRS G;  5DD4 A;  1FIA A;  2JA6 J;  1IN8 A;  2MGQ A;  2KRC A;  4B8X A;  1R71 A;  1W36 D;  1FYK A;  3L00 A;  3RDI A;  5JVT A;  4LLG F;  1ZRD A;  1FC3 A;  1U5T C;  2ZJR F;  4ZZD A;  2PMU A;  3R4K A;  2VON A;  2NVU B;  1IW7 F;  2VT3 A;  3RZO J;  2K9S A;  3H5N A;  2KZV A;  2QGU A;  3QPS A;  4U0W A;  3L2U A;  1O7L A;  1WJ5 A;  2QVO A;  3GLL A;  3LMM A;  3ZCO A;  3WTW C;  2XVC A;  3BT9 A;  4BHP A;  3HOS A;  1JHF A;  1JGS A;  2CUF A;  5K5R A;  5EEH A;  2CQX A;  1VQ4 I;  1S29 A;  3PNV A;  3LA3 A;  1MJA A;  2BHY A;  3PSF A;  1E3H A;  2Y0S A;  3SHF A;  3PFY A;  4C3I J;  1UST A;  3MKL A;  4WCG A;  3CCL I;  1VI0 A;  1R1V A;  4EM0 B;  2IA1 A;  2KIQ A;  3A02 A;  2WV0 A;  3EET A;  2XAF A;  3FKJ A;  3LQQ A;  1RNL A;  3TO6 A;  1YS6 A;  1B6A A;  3WTU C;  1H8A C;  2VB6 A;  5LFA A;  1WH5 A;  1VND A;  5LBQ A;  4E7K A;  3DKY A;  2XF6 A;  4AU7 A;  1NH3 A;  1XGN A;  1RKW A;  1BN5 A;  3W3C A;  2OTJ I;  2OBP A;  4I76 A;  4FAS D;  4UB6 C;  4D7M A;  1HDP A;  4BE2 A;  5ERI A;  3F9K A;  3L2R A;  4Y13 A;  1IN6 A;  5IYB J;  3VOE A;  1VQ8 I;  4YEL A;  2QWW A;  1HC8 A;  3K4L A;  3LSI A;  2K40 A;  1BR2 A;  4NNJ A;  2W25 A;  3A2K A;  4LIT A;  3QYF A;  5JI6 A;  3D1N I;  2E71 A;  2L01 A;  2CW0 F;  1VQ5 I;  3G6E I;  3OSG A;  1AU7 A;  2EFN A;  2V26 A;  3WU1 B;  2VE9 A;  1SC7 A;  3G4S I;  2BW3 A;  1SD4 A;  2X6Y A;  3E1S A;  3I5U A;  5J3L A;  5H6Q A;  2ELK A;  2H8W A;  2M8G X;  2RC4 A;  1FBQ A;  2HQ5 A;  3OIP A;  4IQ4 A;  4M3B A;  2HTS A;  2Q2E B;  3IKT A;  3CZ6 A;  1QPM A;  2P5L C;  4BDY A;  4BEH B;  1U0J A;  3K4M A;  2LVS A;  4LIV A;  3ZMU A;  2PN6 A;  5LHG A;  3RYP A;  1J9I A;  2P0W A;  3QWL A;  3W6K B;  1C0W A;  2JVH A;  5IT3 A;  3H0D A;  5F0C A;  2HXO A;  4CCK A;  5K5Q A;  3ZMT A;  1ODD A;  1V54 H;  2ID6 A;  1MBJ A;  2DMN A;  5FO5 A;  2R7X A;  1DP3 A;  3TMO A;  4L18 B;  3WOD F;  1H88 C;  2JPC A;  4XLA A;  5DCF A;  2RQP A;  4HYE A;  3HDD A;  5ILV A;  5FKO A;  3S15 J;  3MKY B;  1IZ1 A;  2V4J C;  5FFZ A;  1J0R A;  3M3Y J;  4KN7 X;  1ON2 A;  2LKP A;  3BZ6 A;  5FJ8 J;  2HWV A;  3S3O A;  3FMS A;  1EF4 A;  3VSK A;  2L7K A;  4G8X A;  1OCC H;  5DS9 A;  3GVA A;  4Q5S F;  5FKK A;  3HG9 A;  1OLT A;  3OIO A;  2NNN A;  4GYI A;  2KRH A;  1JHH A;  3Q9S A;  2LH9 A;  4A3F J;  4PSX A;  4BAC A;  1ENH A;  1ZQ3 P;  3GO5 A;  5CKT A;  2Y30 A;  2LF7 A;  3PUB A;  1BJZ A;  2K9Q A;  3FHN A;  4HOB A;  1Z77 A;  3SFZ A;  2QEN A;  3SZG A;  4BE0 A;  1T33 A;  3JR9 A;  1FBS A;  2CUE A;  2BV6 A;  5FLV A;  5IYC J;  1D0X A;  1GV2 A;  3E6B A;  1ETY A;  4YEJ A;  3FXU A;  5H20 A;  4CCO A;  3LSP A;  2KL4 A;  3WTZ A;  3SEQ A;  2FNA A;  2R7O A;  1RI7 A;  2QA4 I;  2L9N A;  1XGS A;  3EDP A;  3H9J A;  3Q9V A;  4MEY F;  2A6H F;  2CU7 A;  1B59 A;  4YII A;  1B9M A;  4ZTF A;  4FX4 A;  1DQU A;  3V8K A;  2IGN A;  2WV1 A;  3DP7 A;  5FFX A;  2ZO4 A;  3QP5 A;  2E7X A;  2DA2 A;  3S1M J;  3OYJ A;  5HLT A;  2LK2 A;  1TLH B;  1PVE A;  2DOD A;  3IC7 A;  4F91 B;  4J00 A;  1G3T A;  2FBI A;  4PDK A;  1FWZ A;  3SEZ A;  1HW5 A;  4GO1 A;  4FIS A;  2DA5 A;  2FD5 A;  2NOG A;  1R36 A;  1S8N A;  1N75 A;  3F8M A;  1LUJ B;  2PBI A;  3RPQ A;  1A6I A;  1OPC A;  1USS A;  2HQR A;  2NOJ B;  2XDV A;  4LD5 A;  2PMZ A;  1U78 A;  3LSG A;  2K27 A;  4CUG A;  4IEJ A;  2LMD A;  2LY1 A;  3OYD A;  2BY3 A;  3KEO A;  1MZB A;  2Z3Y A;  1KZH A;  5K1Y A;  4A6E A;  2HOA A;  4AM3 A;  2E7W A;  2XRL A;  5DUK A;  1KU9 A;  3CUQ B;  4UUV A;  2HYJ A;  3UKG A;  2DJN A;  1PUF A;  1VQM I;  2EFW A;  3GF2 A;  3F3X A;  3LSK A;  4EGY A;  1E2X A;  4LK1 F;  4QSH A;  1GDT A;  3ZN0 A;  2X48 A;  2R5Z B;  2EB7 A;  4CCJ A;  2OQR A;  3FMR A;  1R1U A;  2X85 A;  2V1X A;  1R49 A;  5LHI A;  2AHQ A;  2DBB A;  3CC2 I;  5LGT A;  4O5V A;  2LNB A;  4WX9 A;  3HM5 A;  1Z91 A;  1J59 A;  2PMH A;  3VYS B;  1YO5 C;  4BHB A;  3O3K A;  4NQW A;  2DMU A;  1D1A A;  2HDD A;  4CZC A;  3ZP5 A;  2MC3 A;  2BW3 B;  5K7F A;  3RKW A;  4BUP A;  1R4M B;  5J1R A;  3BJ6 A;  2M0M A;  5FGM A;  1IV6 A;  2JN6 A;  4RAF A;  2EZH A;  2HVS A;  3ABU A;  3SYT A;  3GXO A;  5DUI A;  4XK4 A;  3ERM A;  1ZH5 A;  3BPV A;  3IAM 2;  1G2H A;  1IN7 A;  2R7Z J;  2DXI A;  2MC4 A;  1BM9 A;  3IKV A;  3B6C A;  4A5M A;  4ENK A;  3HOY J;  2OV7 A;  1Z21 A;  1BA5 A;  3I0T A;  4Y4R A;  1ZR2 A;  3GYH X;  1ZGW A;  1B9N A;  4FHT A;  1JKO C;  1HCR A;  3OR2 C;  4KN4 X;  2LKS A;  2VOO A;  3MMY B;  3ZQ7 A;  3RKQ A;  4O3M A;  1S3J A;  3HSF A;  1TW2 A;  3GTK J;  1S7E A;  3I56 I;  2X6O A;  1UAA A;  3ZMD A;  5DDG A;  4CHU A;  5EGO B;  3VWB A;  3U21 A;  5ILS A;  3WG9 A;  1SMT A;  3DEE A;  1VQ7 I;  2LOO A;  2FEZ A;  1WSU A;  2KT0 A;  2LFB A;  4JBA A;  3SJM A;  2NVT J;  3AFH A;  1S72 I;  4IRH A;  3PO3 J;  5E20 A;  5EZG A;  3DLL F;  3FBN B;  1BJA A;  1RC9 A;  5E3M A;  5FD5 A;  2O5R A;  2OF7 A;  2X4H A;  4Q48 A;  1DU0 A;  1R5I D;  3P9C A;  3CCV I;  2K02 A;  1J2X A;  3FXK A;  1MDM A;  1XD7 A;  2DK5 A;  4PJ0 C;  5HDG A;  3DEU A;  5DM6 F;  5A2Q Z;  5L3B A;  3KLN A;  2ETH A;  1IC8 A;  2HKO A;  1FOK A;  2O8X A;  1QZE A;  1SAU A;  2QQ8 A;  1F4K A;  5J4Y A;  2V6C A;  1IXC A;  1VZ0 A;  2E2I J;  2K3F A;  4A3K J;  3HSE A;  3NAU A;  2VOD A;  2TDX A;  5KNL A;  2JQ7 A;  3LL7 A;  3I54 A;  2V9K A;  4OIN F;  4MIM A;  3DLA A;  4FT8 A;  4IJA A;  1OCP A;  4BQN A;  1FIP A;  2PEX A;  5LEJ A;  1ZRF A;  1JGG A;  2W84 A;  1EJ9 A;  3K6G A;  2YU3 A;  1FMV A;  3MFK A;  3RKY A;  3OL4 A;  2CSO A;  2GOX B;  3K9T A;  3J81 K;  4LLN A;  4JK1 X;  3K1M A;  2J5O A;  3OL3 A;  5E1W A;  2DQL A;  4ZYA A;  1LDK B;  2X1C A;  3ONQ A;  3W2W A;  3ECH A;  1OFC X;  2EJR A;  1YHQ I;  1JXS A;  3K4J A;  2UV1 A;  3OS0 A;  4G7Z F;  1F9N A;  1Z7U A;  2K5C A;  2HYF A;  2XAH A;  4BHC A;  2M1B A;  5HLG A;  1GXQ A;  1YW7 A;  2Y69 H;  2LRD A;  1PUF B;  2CRG A;  3H36 A;  1MJ9 A;  4A3G J;  5HNH A;  3H5R A;  3H3U A;  5JHF A;  1QO0 D;  4EJO A;  1JTX A;  3BR3 A;  2P8T A;  1WJE A;  1YOV B;  2JRM A;  2VQH A;  4IOC F;  2EA4 A;  1B1B A;  1DGR M;  2XIG A;  3QOP A;  5GAD J;  5F08 A;  3ZOB A;  3EUK L;  3MZH A;  1V4R A;  4XN0 A;  5FKL A;  2OD5 A;  1ZYR F;  4NQW B;  3JRH A;  2ME6 A;  3AAF A;  2ZME A;  3Q0U A;  4PUS A;  1LJ9 A;  1FSH A;  1XMX A;  4TV7 A;  3J80 K;  2M3A A;  2M34 A;  5J8C A;  3HZJ A;  1WQ2 A;  2AO9 A;  3DFG A;  2ZNZ A;  5LRR A;  3KP7 A;  2ELH A;  2HQA A;  4RLQ A;  1J09 A;  3GTJ J;  4F52 A;  3OV8 A;  4HF1 A;  2M87 A;  3LAJ A;  1ZHF A;  4XLH A;  5L3F A;  3CLQ A;  4LK0 F;  4C9Y A;  1P9Q C;  2QZ8 A;  1O3T A;  2FUG 2;  3EUA A;  5KVR A;  4EJT A;  2VQL A;  1W0U A;  4Y3O A;  1CF7 A;  2F4I A;  4NBQ A;  3CMY A;  2JA8 J;  2HPI A;  2UUZ A;  5D6E A;  4E7Z A;  4HX7 A;  2DTZ A;  1XB4 A;  4B3A A;  2DFI A;  2JA5 J;  4DYR A;  1I6X A;  3TP0 A;  3DV8 A;  2XB5 A;  2E34 A;  2GBY A;  3BP8 A;  2FQ3 A;  2V1N A;  5E18 F;  1YJN I;  3V7S A;  2GM4 A;  3KP3 A;  1ONV A;  2L7F P;  1MMG A;  2M0C A;  4EJV A;  1RET A;  1Y8Q B;  5ICF A;  2WAD A;  1MSF C;  2DA1 A;  5GTI C;  1EKE A;  1FP2 A;  4KIS A;  1KON A;  5L3D A;  1X4P A;  4IXA A;  4QLC U;  2JA7 J;  3OR1 C;  1X1D A;  4G7H F;  1JE8 A;  3NRV A;  2VE8 A;  1X3Z B;  2LG4 A;  3FMQ A;  2D5V A;  1ZTR A;  1TWH J;  1Z0X A;  2EFO A;  3KYD B;  2JVG A;  4KUM A;  1YX3 A;  4B48 A;  4BAY A;  3CF5 F;  1MDM B;  5FKM A;  2KFD A;  2CQN A;  1UEL B;  4ZH4 F;  1B72 A;  4UY8 I;  3BZK A;  1SD5 A;  4L5E A;  2WY8 Q;  4PGH A;  5FRM A;  5GTH C;  4MGR A;  1LNW A;  5J1U A;  2HTJ A;  4LMY A;  1XMK A;  3WTY C;  1G3Y A;  2VJI A;  3HJE A;  5B3S H;  4PJJ A;  1I6H J;  2FQ4 A;  3S8P A;  4IF4 A;  2MLG A;  2XV4 S;  1VQN I;  3RTR A;  4CA0 A;  4YIF A;  3WTV C;  3HHH A;  4M74 A;  1QPI A;  5KHD A;  5HS8 A;  4KMU X;  5ILU A;  2X6X A;  2Y0M A;  3ABL H;  2MH9 A;  1MNE A;  1Z67 A;  3WG7 H;  3BR1 A;  5F0F A;  2DOA A;  2QF7 A;  4ENJ A;  1X3W B;  2LKX A;  1VQP I;  3F6V A;  2K7L A;  2OAZ A;  3HHG A;  1OCR H;  3CES A;  2STW A;  3E7L A;  4F93 B;  4B43 A;  2IVM A;  3A1Y A;  3OYK A;  3CCM I;  3KFW X;  2OUM A;  6PAX A;  3IL2 A;  2E1M C;  2VL8 A;  3BWG A;  5D5X B;  4DIQ A;  2MAB A;  3JW4 A;  5J1Y A;  2IJL A;  2VBZ A;  4LG0 A;  3EYY A;  1JI8 A;  1GLN A;  2VQC A;  3LFK A;  1U9N A;  1I3A A;  3CJQ B;  2H6B A;  4S0H B;  4DOZ A;  1XSD A;  1WGX A;  3CUO A;  3HKZ N;  2PG4 A;  4UVA A;  4KT6 A;  3QU6 A;  4LGW A;  2ZSI B;  5F04 A;  3K70 C;  4AYB N;  2O8K A;  2MYS A;  3GTQ J;  1T0F A;  2M2E A;  1KGS A;  2E35 A;  2HOS A;  1LFU P;  2FBK A;  3ESW B;  1VF9 A;  3J80 Z;  2DO7 A;  2ZSH B;  2M4G A;  1NTC A;  1TTY A;  2DK8 A;  4I0A A;  4XKV A;  2V9P A;  1UHS A;  3JRD A;  5KAI C;  4YFX F;  3M07 A;  4EM2 A;  2QSF X;  4NHJ A;  4BDZ A;  2G7U A;  2HVQ A;  1PP7 U;  5TJJ A;  4MFD A;  1L3L A;  4M3D A;  2IS1 A;  3C1D A;  2UWM A;  5DCM A;  2ZME B;  3ZGK A;  3F6O A;  2A5W A;  4PCQ A;  3MCZ A;  4ESF A;  3F0C A;  2AXL A;  3CMA I;  3AL0 B;  3IH4 A;  3MWM A;  1G3W A;  1K4S A;  1DU6 A;  3P9K A;  1P4X A;  1R7J A;  1X3U A;  2TCT A;  2M4K A;  2XC7 A;  2KQR A;  4DBQ A;  4EJU A;  3ZMV A;  1K6O A;  3I59 A;  3AL0 C;  2CQK A;  2HI3 A;  3ZQQ A;  3DTI A;  3EQL F;  4RM3 A;  1LDJ A;  4Y33 A;  1NG7 A;  4HW0 A;  2CYY A;  5J4V A;  3N05 A;  1IDY A;  1MMS A;  4II3 A;  1WWX A;  4IVN A;  4BXX J;  1B4A A;  1CF7 B;  2NS0 A;  3V42 A;  2L4M A;  2VPR A;  2Z2S B;  3M1C A;  4AVP A;  1G6N A;  4S04 A;  3HYI A;  2IS2 A;  1XSX A;  2M7A A;  5D4S A;  2UXX A;  1ETW A;  1ZGJ A;  3K7A J;  2DJI A;  3O8H A;  3MZY A;  2Q8K A;  2W1O A;  4R1H A;  4LLL A;  2CGP A;  4GRI A;  1ZAR A;  1Q1H A;  5D8L B;  2Z1D A;  1RR7 A;  2L02 A;  2UZK A;  3DPT A;  3HSR A;  3I3L A;  4YFK F;  3OYL A;  4MFE A;  4E4H A;  3E6M A;  4II2 A;  1X1C A;  1ZK8 A;  4CDG A;  4EAT A;  5HOD A;  4LOC A;  4MHG A;  5C44 J;  2DFF A;  3BDD A;  3R60 A;  4QIW N;  2PI0 A;  1L0O C;  4IHX A;  4HLX A;  5AIQ A;  5LLQ A;  4ENN A;  1TNT A;  2O3F A;  1YJ9 I;  5BQT A;  3NEU A;  3S93 A;  4XOT A;  1WJD A;  1B72 B;  1LQ1 A;  3E6D A;  2DLL A;  4P55 A;  4C3J J;  2X6W A;  1F5T A;  3BC8 A;  1TP4 A;  2E19 A;  4G9Y A;  3IH2 A;  1I5Z A;  3S32 A;  3VFZ A;  3ELK A;  1ZRC A;  2K9N A;  4UNO A;  1OKR A;  1SEU A;  1SFO J;  2O6G E;  5ED4 A;  1BOA A;  1H9G A;  2P6S A;  2NVQ J;  4B09 A;  4OIQ F;  1QHH D;  3E5U A;  3BR6 A;  3A01 A;  2KDZ A;  2R4G A;  1RRJ A;  2M9H A;  1D8J A;  1T6S A;  5FRO A;  1WH7 A;  3DQV C;  4IX7 A;  4M71 A;  4IZZ A;  3GME A;  1YJW I;  3OYC A;  3CUQ A;  5JR3 A;  1QQI A;  4XN3 A;  4B44 A;  1T95 A;  1R9T J;  4CSW A;  4OOI A;  2KDO A;  4ZYD A;  2L9R A;  1W7P A;  1YFH A;  2NRA C;  4BY1 J;  4C2M J;  1BIA A;  3JRC A;  3GTG J;  2R5Z A;  1K7A A;  1D1B A;  2CWE A;  5DEQ A;  3M4O J;  2E5N A;  3LQR A;  2AQE A;  3ULQ B;  2DA7 A;  1MH4 A;  2MG4 A;  1YTY A;  1QZY A;  2Z99 A;  4M73 A;  1YS7 A;  4XKW A;  2EIM H;  2H09 A;  4LG0 B;  2HZD A;  3LSR A;  3CJN A;  3I55 I;  1X4O A;  4QWQ A;  5CLS A;  3U1D A;  2RVC A;  3K4K A;  3MD2 A;  3HXL A;  2K86 A;  2EPF A;  4CYC A;  1HLV A;  2EIL H;  3K4B A;  3SZT A;  4BQA A;  3COA C;  4RGX A;  3SZP A;  2CV0 A;  3PQJ A;  3RPU A;  3GZN B;  2OQG A;  4ESJ A;  2V79 A;  2A69 F;  3FXL A;  4L9T A;  4HG2 A;  2R7W A;  3TO9 A;  4M6X A;  4A3C J;  4RDU A;  2KLO A;  3BG5 A;  2HOE A;  1T0F C;  2P5K A;  2X1E A;  3BG9 A;  2JUG A;  3JRF A;  3I4N J;  3TDU C;  3DU6 A;  1ORK A;  2FBH A;  5DCM B;  4WK8 F;  1IAW A;  3OYE A;  1XGM A;  3GEZ A;  4CGZ A;  2ZC2 A;  5D4R A;  1JJ6 C;  1T08 B;  3FWE A;  1TZL A;  4AUX A;  2ZBK A;  1YQA A;  5EZH A;  2M45 A;  1HST A;  5EGO A;  2H1K A;  4RA2 A;  4XOR A;  3S1Q J;  2STT A;  1A5J A;  2IGM A;  2VN2 A;  3I59 B;  4HNT A;  3HRS A;  3E0J B;  3G1M A;  2LY2 A;  2KP6 A;  2FRH A;  1Y0U A;  4ZDP A;  3S2H J;  3ASN H;  4DW6 A;  1OCO H;  1WFX A;  2EQR A;  1XPX A;  2VT2 A;  3H1C A;  4BBS J;  5M5X J;  2AXT C;  2EH3 A;  5JHU A;  4XRF A;  4E7J A;  2IAI A;  4BJ6 C;  2L2O A;  3HRM A;  1IXS B;  3I4P A;  4YIR X;  5GAH J;  2P6T A;  5CVU A;  3TKY A;  1FMW A;  2NNY A;  1OYY A;  3ZMZ A;  2F4M B;  2W48 A;  4D5F A;  3LAP A;  1T39 A;  3J7Y J;  1FX7 A;  2FU4 A;  2CQ7 A;  3JTG A;  1TBX A;  2XUB A;  2WTE A;  4A3M J;  2PX9 A;  2R3S A;  4Q47 A;  3V7C A;  3HKZ A;  2JMW A;  2DAO A;  1G3S A;  1UB9 A;  4I09 A;  1QZZ A;  4AYB A;  2CUJ A;  4E7S A;  2OJE D;  4A3J J;  3SDG A;  4ZYE A;  2WY7 Q;  1LVK A;  1W5S A;  4KT5 C;  4EJW A;  4BNC A;  2JPB A;  3BQZ A;  1FJL A;  1XTA A;  2ISZ A;  1K78 A;  2HGC A;  4G7O F;  4WWC A;  1U8R A;  1MBH A;  1Z3X A;  3ABM H;  3OY9 A;  1ZRE A;  4B47 A;  2Z5U A;  3BTJ A;  3BG7 A;  5E8G A;  3GW2 A;  2HS5 A;  3I53 A;  1AKH A;  1IUF A;  5FB2 A;  3H92 A;  5TIS C;  1IRG A;  1X1B A;  3JCU C;  5D6F A;  1E3O C;  2HZT A;  1F1Z A;  3LSM A;  1ZKG A;  2YUS A;  2EA2 A;  5KAF C;  1ZLJ A;  2GAU A;  4NB5 A;  1H9T A;  5F1R A;  1HSJ A;  2LSO A;  3IUO A;  2HQN A;  3A01 B;  2IT0 A;  2NVX J;  2O61 A;  2ZJQ F;  3QRF F;  3ZXS A;  1FLI A;  4HLY A;  2EZK A;  5ICG A;  4HRI A;  1MIJ A;  1OYW A;  3QPT A;  3T1B A;  4IHS A;  2W82 A;  1W7P B;  3HOZ J;  4P9U A;  3HOT A;  3HRU A;  3Q0V A;  2ZXH A;  1PUE E;  2R7F A;  3CUQ C;  3BJO A;  4M3F A;  1QNT A;  2L5Q A;  2A07 F;  4GDF A;  2QM3 A;  3PFI A;  2CS3 A;  2GIV A;  2GQQ A;  1I27 A;  3KLO A;  4KJZ A;  4HNU A;  5B5E C;  1TWA J;  1HQC A;  3V8J A;  1ETQ A;  1D3Y A;  3PM1 A;  5IY5 H;  4LIU A;  2IS4 A;  4ZZL A;  3QU3 A;  2F4O B;  4CYC B;  3K0L A;  5KK1 A;  2CFX A;  1VQL I;  3BY6 A;  2ZJP F;  3OYM A;  3HPG A;  1VTN C;  4R79 A;  2VC1 A;  4ANJ A;  1BI3 A;  3R0A A;  3BLY A;  1POG A;  3ZQF A;  4GXO A;  4WXC A;  1RES A;  3HC7 A;  3F22 A;  2V7F A;  1X58 A;  1OR7 A;  1PYV A;  1RIO H;  2R7U A;  1T38 A;  3S16 J;  1MBK A;  4EEF G;  1ZLK A;  3CCQ I;  2ISY A;  5LHH A;  5DV5 A;  4RAG A;  2GLO A;  2W7N A;  1P4W A;  2OA4 A;  2A61 A;  3OYA A;  1N78 A;  3E97 A;  4O6J A;  2YX7 A;  1P7I A;  1U9O A;  3S2W A;  4CO8 A;  4RGR A;  2EZI A;  3CP2 A;  4DBR A;  4AIK A;  4FCY A;  4XLF A;  2EIN H;  2R7Q A;  2EV0 A;  1UFM A;  3RIR A;  2R5Y A;  2DN0 A;  3MQ0 A;  1YW9 A;  3LA2 A;  5GAE J;  3K2A A;  2Y9Y A;  3OYB A;  5CVJ A;  3K70 D;  2NS7 A;  2KPM A;  1BIB A;  3H35 A;  4M6Y A;  2XKO A;  1NK3 P;  3NQO A;  2XSD C;  3LST A;  3QYB A;  4XMY A;  3IWZ A;  4IQJ A;  1Y8R B;  4XLN F;  1U3E M;  2JUC A;  1K6Y A;  3L7W A;  2H1L A;  3VDX A;  2LBF A;  2VIX A; 
#chains in the Genus database with same CATH homology
 2DA1 A;  1HOM A;  2LD5 A;  3BTI A;  3JRA A;  3Q0W A;  1IG7 A;  2JA7 J;  4A69 C;  2ECB A;  1UMQ A;  2P81 A;  5GP9 A;  4A3L J;  5JLX A;  3GTM J;  4M3E A;  2D5V A;  1ZTR A;  1TWH J;  4JX4 A;  4DZJ A;  1BL0 A;  1Z0X A;  3VPR A;  4RBO A;  2JJ7 A;  4AC0 A;  1JKQ C;  3QPL A;  5EYR A;  1Q1V A;  5FKM A;  4XRS G;  3HOV J;  4A3B J;  1FIA A;  1B72 A;  2JA6 J;  2MGQ A;  2ME0 A;  4L5E A;  5IP9 J;  5J1U A;  1AHD P;  2Y9Z A;  1MH3 A;  1APL C;  1I6H J;  2FQ4 A;  3RZO J;  2K9S A;  3QPS A;  2LY9 A;  3BT9 A;  4DYC A;  2I10 A;  2HXI A;  2XPW A;  5FLM J;  2CUF A;  1AKH B;  4V2F A;  5F27 A;  1RPW A;  1QPI A;  3WHB A;  2CQX A;  3JRB A;  3TED A;  1T56 A;  1YRN B;  3GTP J;  1JKP C;  3BR1 A;  4C3I J;  4A3E J;  1F36 A;  2L7Z A;  3MKL A;  5F0F A;  3S14 J;  1VI0 A;  3A02 A;  2QF7 A;  2LKX A;  1H8A C;  1FTT A;  4GFB A;  1XG1 A;  2RAE A;  1WH5 A;  1X2N A;  3E7L A;  1VND A;  2LP0 A;  3TW6 A;  4BY7 J;  3ZQH A;  2VUM J;  3S2D J;  1RKW A;  2HOT A;  4I76 A;  5J1Y A;  4D7M A;  1HDP A;  2E1O A;  5IYB J;  1U9N A;  1LE8 B;  4S0H B;  4JX6 A;  2K40 A;  3JRG A;  1WGX A;  3FIW A;  3HKZ N;  3D1N I;  5F04 A;  3JRI A;  4AYB N;  3S1N J;  5E3O A;  2O8K A;  3GTQ J;  4DZP A;  3OSG A;  2M2E A;  1AU7 A;  2HOS A;  2VKE A;  1LFU P;  5J3L A;  3TW7 A;  1VF9 A;  2ELK A;  2M8G X;  5IOZ A;  1NTC A;  3CQZ J;  2HQ5 A;  4M3B A;  1UHS A;  3JRD A;  3JRE A;  5IP7 J;  1UG2 A;  2DMQ A;  2LVS A;  2CJJ A;  4JP0 A;  5C4J J;  4MFD A;  4M3D A;  3G1O A;  1Y1V J;  9ANT A;  2B63 J;  4I6Z A;  3F0C A;  1OCT C;  3IH4 A;  5F0C A;  2HXO A;  1DU6 A;  1GV5 A;  5EG0 A;  3HGY A;  2TCT A;  3O8G A;  2ID6 A;  3HB9 A;  1MBJ A;  2DMN A;  3RZD J;  2HI3 A;  3OOU A;  3DCF A;  1H88 C;  1MNM C;  3S15 J;  3BG3 A;  3HDD A;  5FKO A;  5C3E J;  3LOC A;  3FK7 A;  3M3Y J;  3FK6 A;  1IDY A;  5FJ8 J;  2R5Y B;  4FE7 A;  1Y1W J;  4BXX J;  1EF4 A;  2VPR A;  5DS9 A;  5FKK A;  1D5Y A;  3OIO A;  1ETK A;  1ETV A;  1ETW A;  3K7A J;  4A3F J;  3O8H A;  1IDZ A;  2XPV A;  1RKT A;  5EF6 A;  1ENH A;  1ZQ3 P;  2OPT A;  2Y30 A;  1BJZ A;  2K9Q A;  1RR7 A;  1K61 A;  2VKV A;  1I50 J;  3IV5 A;  1Z77 A;  3SFI A;  5BNG A;  1T33 A;  2DMT A;  3JR9 A;  1IGN A;  1F43 A;  2CUE A;  4MFE A;  2E2H J;  2LTP A;  5FLV A;  3GTL J;  5IYC J;  1GV2 A;  1ZK8 A;  1U8B A;  5HOD A;  3LSP A;  1ETY A;  4LOC A;  5C44 J;  4QIW N;  2XGE A;  4UUS A;  4IHX A;  5EEA A;  5GPC A;  2X9D A;  3RQI A;  2CU7 A;  4G12 A;  4FTH A;  2WV1 A;  1FTZ A;  1B72 B;  4C3J J;  1WPK A;  5E3L A;  2E19 A;  3IH2 A;  2DA2 A;  3S1M J;  2K9N A;  2IBD A;  2LK2 A;  3GTO J;  1SFO J;  4FIS A;  2DA5 A;  2FD5 A;  2NOG A;  4X1E A;  2NVQ J;  2ID3 A;  4IHV A;  3BR6 A;  2YU9 J;  3A01 A;  1A6I A;  1JT6 A;  2KDZ A;  2M9H A;  2MW8 A;  3PO2 J;  1VFC A;  1U78 A;  1WH7 A;  2JWT A;  3LSG A;  1ZR4 A;  5GPA A;  4IEJ A;  2R0Q C;  1I3Q J;  1H89 C;  4V2G A;  2DA3 A;  4DYQ A;  3DEW A;  2JK3 A;  3NAR A;  1R9T J;  2L9R A;  4BY1 J;  1NK2 P;  4BKX A;  4C2M J;  3BTC A;  1BW6 A;  4IHW A;  2QCO A;  3JRC A;  3GTG J;  2HOA A;  2R5Z A;  2XRL A;  3LNQ A;  4D7N A;  3M4O J;  2COB A;  1XS9 A;  5M3M J;  2HYJ A;  3UKG A;  3BR0 A;  2DJN A;  1JUP A;  1PUF A;  2DA7 A;  1MH4 A;  2MG4 A;  1GDT A;  4QSH A;  2X48 A;  2WAQ N;  2R5Z B;  3QQA A;  2WB1 N;  3LSR A;  5FKN A;  4A3I J;  2AHQ A;  2O9L A;  2L0K A;  4CYC A;  1HLV A;  5M3F J;  3HM5 A;  4A3D J;  1HF0 A;  3MVP A;  2YS9 A;  3CCY A;  4XIC A;  5IP6 A;  2DMU A;  2HDD A;  3TP3 A;  3BR5 A;  2DA6 A;  1FEX A;  2VI6 A;  5K7F A;  2L7M P;  5J1R A;  1IV6 A;  2JN6 A;  2EZH A;  4A3C J;  4RDU A;  3BG5 A;  4XK4 A;  4MO7 A;  3BG9 A;  1B8I A;  2NVY J;  3JRF A;  3I4N J;  4BBR J;  1G2H A;  1JUM A;  1ORK A;  2R7Z J;  1QVT A;  3OSF A;  3B6C A;  4JX5 A;  3WHC A;  4NDL A;  3HOY J;  2NS8 A;  1JJ6 C;  3FKI J;  2N8G A;  2CQQ A;  3Q3S A;  4AUX A;  1BA5 A;  1ZR2 A;  4XRS A;  2Y0S N;  1IRZ A;  1ZGW A;  1JKO C;  5EZH A;  1HCR A;  5EG0 B;  1MBE A;  5EGO A;  2H1K A;  3S1Q J;  3RKQ A;  3HBL A;  1K83 J;  1A5J A;  3GTK J;  2H8R A;  3H0G J;  1LFB A;  1TC3 C;  1S7E A;  4MLO A;  5M5W J;  3G1M A;  2X6O A;  3ZQG A;  3ZQL A;  2LR8 A;  3C2B A;  5EGO B;  2DMP A;  3S2H J;  4DW6 A;  2EQR A;  1JTY A;  5JLW A;  1WCM J;  3ZQC A;  4BBS J;  5M5X J;  2EH3 A;  3FIS A;  2KT0 A;  2IAI A;  2LFB A;  3SJM A;  2Y2Z A;  2NVT J;  1JT0 A;  4D5C A;  5K7Z A;  4B1R A;  5M5Y J;  3PO3 J;  5EZG A;  4XID A;  2R92 J;  2EZL A;  5E3M A;  3H3V K;  2W48 A;  4D5F A;  2OF7 A;  5F0H A;  1BW5 A;  1DU0 A;  3CDL A;  5C4X J;  4A3M J;  3S17 J;  5IYD J;  3B6A A;  2JMW A;  1O4X A;  5F1J A;  2FX0 A;  1MSF C;  4C3H J;  4UUS B;  1IC8 A;  4A3J J;  3SDG A;  1W0T A;  4W97 A;  3MN2 A;  3HOX J;  4IHY A;  1HDD C;  2XGD A;  3BQZ A;  1FJL A;  2E2I J;  1X2M A;  3HGG A;  1JKR C;  4A3K J;  1MBH A;  2TRT A;  3NAU A;  3BR2 A;  2LLK A;  4J19 A;  3BQY A;  2O7O A;  3BTJ A;  4MIM A;  3BTL A;  1OJL A;  2MSY A;  1GUU A;  1OCP A;  1IUF A;  1AKH A;  1QRY A;  4QTR A;  4B4C A;  4HNV A;  1E3O C;  1FIP A;  2IEK A;  1ZKG A;  1XC5 A;  1YRN A;  2YUS A;  1JGG A;  5DTD A;  3A01 B;  2NVX J;  3ZQI A;  1ETX A;  5IPA A;  4Y52 J;  3G1L A;  2R93 J;  1MBF A;  1QVU A;  4UUT A;  1GT0 C;  2EZK A;  3HEF A;  3W6V A;  3S1R J;  2G0E A;  1OFC X;  4XRM A;  1JUS A;  4Y7N J;  3HOZ J;  1TWF J;  1LE8 A;  3Q0V A;  1MBG A;  4M3F A;  1PUF B;  2CRG A;  4A3G J;  1GVD A;  2XGC A;  1JTX A;  3BR3 A;  1TWA J;  3L1P A;  1ETQ A;  4JYK A;  3PM1 A;  3IH3 A;  4CYC B;  5F08 A;  3ZOB A;  1ETO A;  4M6V A;  2ECC A;  4X6A J;  5FKL A;  4W1U A;  3JRH A;  2ME6 A;  3Q0U A;  3ZQF A;  1POG A;  2XB0 X;  3HOU J;  1RES A;  1IJW C;  1X58 A;  2M34 A;  3S16 J;  1MBK A;  2AO9 A;  4EEF G;  3GTJ J;  2GLO A;  1B8I B;  5E3N A;  2DA4 A;  1TWG J;  1CQT A;  2PMZ N;  1ITY A;  4FE4 A;  2FJ1 A;  3GBG A;  4M3G A;  1TWC J;  1U9O A;  1P7I A;  2EZI A;  2E2J J;  4FCY A;  3I4M J;  1P7J A;  2R5Y A;  2XPU A;  1W0U A;  2DN0 A;  5IOY A;  3K2A A;  3CMY A;  1WI3 A;  2Y9Y A;  2JA8 J;  4ABZ A;  2NS7 A;  2DTZ A;  4B3A A;  1NK3 P;  4DYR A;  2JA5 J;  2XSD C;  3TP0 A;  4A93 J;  3A03 A;  2Y31 A;  2XB5 A;  2GBY A;  5K7H A;  2ZB9 A;  5EDN A;  2GM4 A;  3LSJ A;  2L7F P;  3HOW J;  2M0C A;  1RET A;  1MSE C;  2EBI A;  1JJ8 C;  1SAN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...