2MC3A

Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
b'GSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUS81 endonuclease homolog (Yeast), isoform CRA_b
publication title A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mc3A00
5CVRA 5F6FA 2LNBA 4F7ZA 4CHUA 4ENMA 3WG9A 5FGMA 4UHTA 3BPVA 4LG0B 3J81Z 1FP2A 4LGWA 4PDKA 1KQ0A 4A5NA 3CO7C 2O8XA 1S8NA 2MH2A 3QU6A 3O6BB 1FPQA 1SFXA 1ZARA 4HF1A 2JSCA 3EYIA 4KIFA 4HF2A 4XRFA 3F6OA 1S6LA 1I1SA 5HS7A 1W7PB 2L01A 4A2UA 1BC8C 4ZZLA 5HS8A 4MQVA 1BI2A 3F6VA 2A61A 3IWFA 3HSRA 3HOSA 5BMZA 4I0AA 2L4AA 3BZ6A 3GWZA 1XD7A 2UWMA 1O3TA 2JTVA 2QZ8A 1XDSA 4KMFA 2EV5A 5BPDA 2QBYB 2YR2A 5JVTA 4U7DA 1R36A 4O6JA 3WTUC 3M7GA 3GYHX 3J80K 3P9KA 2IA1A 2XAQA 4RGSA 3QAHA 2M87A 3N97A 5CVIA 4CO8A 2VT3A 2JPCA 5JI6A 4M72A 2F5CA 1V4RA 2PLYA 3ZMVA 4OIPF 1G3SA 3ZMSA 1XMAA 1R5GA 4OMYA 4P55A 3IRRA 4MNUA 1ULYA 3J80Z 3Q9SA 5H6RA 2EA2A 4XBFA 2A5YB 3I4PA 1G6NA 3DFGA 2B0LA 4B8XA 3TGNA 5DUKA 1IN5A 5ICEA 5ICCA 1WSUA 5AIQA 4HBLA 3WTSC 1BM9A 4MTDA 2F5EA 4GYIA 2O3FA 5HVQC 2XROA 2MC3A 4RB2C 4I98B 1KU2A 2F5FA 1UB9A 2R7FA 3CLOA 3NQOA 2A6EF 4I0BA 2YU3A 2GXBA 4LLLA 2FXAA 3KP3A 2DBBA 1J2XA 1MJBA 2XUBA 3PFIA 3R0AA 2COMA 5ED4A 2RC4A 3LQQA 1F1ZA 1VTNC 1GXQA 2VOOA 1K6OA 2OA4A 2H94A 1FY7A 1RUOA 2FNPA 1OR7A 2Z9OA 4ESJA 2HTJA 1WWXA 3WTTC 3R6SA 2XRNA 4RB0A 5JHUA 3RTRA 3QU3A 2EWNA 4L9VA 3KLNA 4S05A 5H6QA 1RNLA 2DK5A 2HOEA 3F8FA 4IXAA 1LB2A 2R7DA 2FMYA 1REPC 5D8LB 4G6QA 1XN7A 2PI0A 5D5XB 1SMTA 5LGTA 4WF2A 5DYMA 3KETA 3TDZC 5L3CA 1FYKA 3F8NA 2K4BA 1U8RA 1GHCA 1K79A 1EV7A 3P9CA 3HOTA 4G94A 2VC1A 4IPAA 2IW5A 4RB1A 4P9FA 2W57A 2UXNA 3F3XA 3FX3A 4I09A 3REOA 2GIVA 5CVUA 2DPUA 4WXCA 3GVAA 2G9WA 1YTYA 3WGIA 4WXHA 3RI4A 1ZYRF 3AAFA 3CTAA 5HLGA 1OYWA 5BPIA 2ADUA 4UXNA 5LRSA 1Y0UA 1SFEA 5TRDA 2LSOA 4MGRA 3M1EA 2H27A 2HDCA 1USTA 4OIRF 3I54A 4MEXF 1QZYA 3T5XA 3ZPLA 1YG2A 5ILVA 4L5JA 3RYPA 1H9TA 3ZN1A 1U2WA 3S2WA 3VOEA 3FZVA 2HEOA 4G8XA 2Z5UA 4BH9A 1DP7P 4A6DA 3D0SA 2NNYA 3LFKA 1R22A 2G7HA 3QRFF 2XAFA 4LB6B 4ESBA 1STZA 3ZN0A 4AIJA 3ABUA 4L0ZB 4M9ZA 1YS6A 4HLYA 2XAGA 4AVPA 4YFNF 1Z91A 3P9IA 5LGUA 2VBWA 3JTHA 4I01A 1FSHA 2FU4A 2D1VA 2KJCA 1ZREA 3GLXA 4KN7X 3PQKA 4WK8F 4BHCA 3I58A 2FBHA 4CGZA 4AWXB 2CG4A 5FO5A 3J7AO 1E17A 2DFIA 1MJAA 3LAPA 2D45A 2GAUA 4L9JA 4AIKA 1I6XA 5LHHA 4L5IA 2Y48A 3L7WA 2CSOA 1HW5A 1UHMA 1R1TA 4EQQA 6PAXA 5E1ZB 2UZKA 1DUXC 4LD5A 4R79A 2XAHA 1IAWA 2LKPA 1SD5A 1YS7A 1BI0A 1IN7A 2LDUA 4IJAA 3V7RA 2IRFG 1QBJA 1XGNA 4Q48A 2PQ8A 5D4RA 4KUMA 1HKTA 4NB5A 2FBIA 5DV5A 3BJ6A 3KZYA 1CF7A 2E1CA 3EDPA 3RPQA 3SZPA 1ZRCA 4LLNA 1SD7A 4OOIA 1MJ9A 1ONVA 3HTSB 3LA7A 4GGGA 3BPXA 2P6TA 5HDNA 5D5VB 2TDXA 1ZAOA 1R23A 2F5DA 2G7UA 4EV0A 2IA2A 1RIOH 2FRHA 4Z2YA 4EM0B 1FOKA 1IRFA 4A0ZA 1OYYA 4HQMA 4WXDA 3IC7A 4DNCA 1O7LA 1Z6TA 2P5LC 1T38A 3JTGA 3WGGA 1W5SA 4KICA 2KIMA 1MGTA 5KVRA 3MAJA 1H0MA 4YFXF 2PEXA 3LAJA 1B6AA 1G3YA 4EVIA 1TQPA 3DPTA 1HQCA 2HZTA 4M9XA 2FEZA 1BN5A 1OMIA 3KEOA 4BAYA 4KN4X 3J81K 5L3EA 3TO6A 4CYDA 4HAMA 1R5HA 4WCGA 3U1DA 3KE2A 4RAZA 2P6SA 3ZMZA 3I71A 1PP8F 2HYGD 4U0VA 3H3ZA 3CUOA 1T98A 1KYWA 2DPDA 2E1NA 2FQ3A 4LLGF 5IT3A 3CO6C 2ZNYA 1K78B 1HSTA 1U78A 3H92A 1GVJA 3WTYC 4UNOA 4Q5SF 2PMUA 5FLXZ 3MEXA 3QOPA 4U7BA 1MDMB 3FWEA 3QPTA 4CZZA 4RGUA 3G3ZA 2GXGA 1D3YA 3K1NA 3GX4X 1KQ9A 3E5QA 3U2RA 3LQRA 3NEUA 1QO0D 2XASA 3B02A 4KIGA 4LG0A 1S7AA 4GCVA 5BQTA 3M8EA 1B9MA 4HV6A 4MTEA 4HOBA 4ZZDA 3HRTA 5FD6A 1W5TA 3WE3A 5ILUA 5AONA 1IW7F 1KU7A 3ZMDA 3FMQA 3JAMK 2Y0MA 4XLNF 3JSPA 2WTEA 1V3FA 1FYMA 1IF1A 4LFUA 1TNTA 3W6JB 3GFLA 2BV6A 4N0BA 2EJRA 4S04A 1BI3A 5LHGA 1W7PA 4AIHA 1FBQA 4EMSA 2JPBA 5LGNA 3GZ5A 4HX7A 4HQEA 3WU1B 2OD5A 3TKYA 4YFKF 3FHZA 2GA1A 3TO7A 2K86A 1TTYA 2PMHA 3I64A 1QPMA 1IXRC 3JAMZ 1P6RA 3CJNA 4P9UA 2L3DA 3ZMTA 2QBYA 1P2FA 1K7AA 2DT5A 3GFIA 3LSTA 2XKOA 3Q5FA 2XV4S 1I1GA 3Q9VA 4EJUA 3RJPA 5DCMB 1PDNC 3KP6A 3K69A 3WE2A 2H6BA 4H0EA 5HOOA 4KDPA 1BI1A 2PG4A 4BYYA 2Z33A 4JK1X 1I27A 2IP2A 2QQ9A 5H20A 5D4SA 1UCRA 3K1MA 4KMUX 5L3FA 3KP4A 2JT1A 2IJLA 2V1XA 5E8IA 4FX0A 4G9YA 2K7LA 3I59B 3PQJA 3C3WA 1F9NA 1R1VA 4BHPA 4L0YB 3M9AA 2BYVE 1KYZA 3ELKA 2GZWA 1ON1A 1BJAA 2YX4A 3U9GA 1XSDA 2ZKZA 1LJ9A 2V1UA 3K9TA 2NRAC 2EB7A 4GO1A 2HYFA 1FLIA 5E1XA 1J59A 2FSWA 1Z1DA 4LMYA 2KJBA 2F2EA 4KA4A 3F8BA 3JW4A 4FHTA 1YFHA 2OQRA 1ZGJA 3F8MA 3T0YA 3GUDA 4HYEA 5IT9K 3CUQB 4A5MA 5E17F 2O6GE 1Z05A 2W84A 1SFUA 1SAXA 3BY6A 4XLPF 2HGCA 2DO7A 1ZH5A 4HZFA 3GFMA 4JBAA 3EQLF 2VOPA 1XSVA 4UV9A 5IT9Z 5CJ9A 1S3JA 2E7WA 4EGYA 3E6MA 2STWA 2VBYA 2VBZA 2DLLA 4ZYEA 2WWYA 1G3TA 3T8TA 2HR3A 2Q8KA 5J8CA 2FA5A 1U5TB 2M5WA 3HTUA 2OZ6A 3ROUA 3HUGA 2CGPA 1EH7A 1JHFA 3RKYA 4P96A 2P5KA 4WX9A 5K1YA 3ECHA 4IRIA 3FF5A 3V8JA 5F64A 5JR3A 2IVMA 1ZLKA 1PUEE 1P4XA 3BP8A 3KLOA 2A68F 3LA2A 1LNWA 4BXUA 3P7NA 3WTVC 1SD4A 5K5QA 2Q0OA 3MZHA 1EH8A 5D8KB 3F22A 1R1UA 2RN7A 1IUYA 3NRVA 1W7PD 2P7VB 2KKOA 4L9TA 3G73A 1YIOA 1IN4A 1ON2A 4BNCA 4G7OF 2OAZA 4Y13A 1LEAA 2XGXA 3WGHA 4D0PA 2XAJA 3FXRA 4M73A 1ZGAA 3HYIA 3V7CA 2RQPA 1XCBA 3GW2A 1E2XA 4CDGA 1FC3A 1RUNA 3QP6A 3V7SA 1WRJA 4QLCU 1KQ8A 2YSRA 5K5OA 1TBXA 1U3EM 4OU0A 3R4KA 2CO5A 2V1DA 1DPUA 3M8FA 3BJOA 2AS5F 1B1BA 2MLKA 3F72A 2OZUA 1T0FA 2EFOA 2RDPA 1YLFA 3GEZA 2A6HF 2QYOA 3ABTA 3QP5A 4M71A 1TQIA 2EA4A 2QWWA 4AD9A 4R8HA 5F1RA 4TV7A 3DV8A 4ASNA 4A0YA 2YPRA 4EM1A 3WTXC 2OU2A 2W25A 5K5RA 3SHFA 2PBIA 5LLQA 1LQ1A 4HX4A 4WWCA 1B4AA 1B59A 1LDKB 1L3LA 3CUQC 3KFWX 1IRGA 3WTZA 4M6XA 2VE8A 1O7FA 1MZBA 1D5VA 5CVVA 3C7JA 3C1DA 2HFHA 4EJWA 1XGMA 5BS6A 4KIBA 1XGSA 1F5TA 2DTRA 4LJZF 2V9VA 1ZG5A 2ZMEB 1LVAA 1Z9CA 2HQNA 2J5PA 3IHUA 4ZH4F 4A6EA 2HKXA 1ZLJA 4KFCA 1OYIA 4ENJA 2ACJA 1J7KA 5HLIA 1O3SA 4IHSA 3O3KA 2ISYA 1XSXA 3V8LA 2R3SA 2P7CB 4P5OA 1IZ1A 4HF0A 3FM3A 2DW4A 4U0YA 2EFNA 4UVBA 3DF8A 3DEUA 2CWEA 3GFJA 4RGRA 5CVJA 5CLSA 1XCVA 1ZG3A 5E1WA 1O3QA 4ETSA 3HIFA 2Q2EA 3MFKA 3E6CC 3T8RA 5L3DA 3RKWA 3V4GA 1R7JA 2H6CA 4PGHA 4HDVA 3RKXA 2QENA 1AOYA 4EGZA 5FLXK 1D8JA 1LDDA 4N9IA 2VT2A 5DCFA 3T1BA 2EFQA 4Q47A 4HV5A 3IKVA 3RDIA 2ZXJA 2BBYA 5FFXA 4GYGA 4OMZA 2C6YA 4MHGA 1HSJA 5J8FA 1JGSA 4I2OA 4MQ9F 4ENKA 5JFRA 1JXSA 4G7HF 3E3VA 1WKMA 1L0OC 3L09A 4UVCA 2MLGA 3FMRA 1BOAA 3B73A 3ERED 2E7XA 2LF8A 2GA2A 4CXFA 1MKMA 3KP7A 5J6XA 3KCCA 4PCQA 1P4AA 3DPLC 5AIPA 1HKSA 3ZMUA 3DKWA 4A12A 2WC2A 2JZYA 3E5UA 1ZG1A 1K78A 4LK1F 3OV8A 2EFPA 2MA3A 3K1PA 1TNSA 2O61A 4RS8A 1D8KA 2FMLA 4Y17A 2ISZA 2QQBA 3DQVC 4KNYA 4M6YA 1MDMA 2M30A 3GXOA 3OOPA 1O3RA 2RKHA 2VC0A 2UXXA 4CICA 4HLXA 3FM5A 2OBPA 1FBSA 1NHAA 3BWGA 1FNNA 5DD8A 1J9IA 2RGVA 3R60A 1CGPA 4UV8A 1IN8A 3HHHA 1BIAA 1YYVA 1FYLA 1IXCA 2ZCWA 3HRMA 2YX7A 5FD5A 3FMSA 2RNJA 4ZYDA 2D2WA 2Y75A 4G6DA 2QUFA 2FOKA 5D6EA 4IHTA 3FXUA 4HA8A 1FWZA 2L4MA 3EETA 2JRTA 2ZO4A 1WQ2A 4M9SA 5LEJA 3E6BA 4LB5A 2K27A 3F21A 2DQRA 2VE9A 3HSFA 4NHJA 1J0RA 1TW2A 2OQGA 4B09A 1FZPB 1LDJA 4YIIA 4ESFA 1EH6A 5DD4A 2CQKA 2HS5A 1FSEA 2PJPA 1HBXG 4KYWA 1S29A 3V8KA 4G7ZF 4I7HA 2W24A 2XVCA 3KEQA 1T2KA 5DEQA 3L9FA 1F4KA 1HW1A 2ZJ2A 2KIUA 4UVAA 3L2CA 1IXSB 1XB4A 4HW0A 2QM3A 3ECOA 2XHKA 1OKRA 2RV8A 4NQWA 2BEOA 4U0WA 2Z99A 2L02A 1JHHA 2K02A 1A04A 2IT0A 4ENNA 3W6KB 5DCMA 2M8EA 4EJOA 5BOXA 5E8GA 1UHWA 3R0JA 5E20A 1B9NA 2DAOA 2ELHA 2DU9A 2VODA 1QZZA 1ZHFA 2A69F 4Y15A 1I5ZA 2KRFA 3VODA 1T39A 3MWMA 3HHGA 3ZQ7A 2STTA 2EK5A 1G3WA 3SXYA 1MD0A 1YW8A 3I59A 1YQAA 2K4JA 2ESHA 2RVCA 1X3UA 3I53A 5D5UB 5A2QK 3GF2A 1HW2A 2V79A 4XSXF 4RB3C 3EUHA 4ZYHA 1ZN2A 5TJJA 2CW0F 4FT8A 1S7OA 2IPQX 5FFZA 1GXPA 2FBKA 3FXQA 2MBFA 3E97A 3BDDA 5LBQA 3RIRA 4DQ2A 4OIOF 3RYRA 5A2QZ 1FX7A 1C0WA 3LWFA 4EM2A 3MZYA 5EEGA 3MCZA 5ERIA 2NYXA 3CUQA 5LHIA 2QVOA 3TOBA 2H09A 2QLZA 5ILSA 1FT9A 1R58A 4ZYGA 3GZ6A 1HXDA 4JQFA 3BJAA 4HDUA 2NS0A 2O0YA 2HWVA 4MEYF 1SD6A 1XGOA 4OIQF 3ML6A 3RPUA 5HS9A 2GWRA 1TQMA 3N4MA 3LA3A 3SFZA 3QPHA 2ZBKA 2EFWA 1LEBA 2HKOA 1Q1HA 3IWZA 4IF4A 1U5TA 3O2PE 1W4MA 5HDKA 3K2ZA 1Z6RA 1BBYA 2ZNZA 2PN6A 4BHBA 2IA0A 3IKTA 2FNAA 4N9HA 2DI3A 1J75A 3CDHA 1R00A 4HX8A 3IL2A 2EV0A 1KU9A 2O03A 3L00A 2P5VA 1FP1D 2ESNA 3SQNA 2NNNA 2V6CA 3EYYA 4IRGA 3KP5A 1XDUA 2D1HA 3C18A 3TOAA 3COAC 4I02A 1QNTA 2FF4A 2W85A 3D5LA 3I5UA 5D5WB 2VN2A 2J5OA 4IRHA 2Z3YA 1DPRA 5KK1A 1ZRDA 1JE8A 2P4WA 2ZFWA 4EJVA 1ODDA 1BC7C 3ZP5A 2EV6A 4RGXA 4OINF 3DP7A 5EEHA 4GXOA 2A07F 2VXZA 5L3BA 1CF7B 1H9GA 2P8TA 4L9NA 4M74A 1J5YA 3ISPA 4Q4ZF 1AWCA 1SMYF 1ZRFA 1TW3A 4U88A 5HDGA 4UUVA 3HRUA 1DDNA 4RAYA 3H3UA 1IN6A 3ULQB 5E18F 4XSZF 5FB2A 1PP7U 3E5XA 3VFZA 3GO5A 1O57A 1UFMA 5HLHA 2XKPA 1P92A 1FBUA 3TQNA 1P4WA 3KP2A 4EJTA 2MD5A 1YW9A 2KIFA 4L18B 4O3MA 3HSEA 1QGPA 1HKQA 4PGGA 2L54A 2DQLA 4BQAA 4FX4A 1BIBA 3WODF 1Z7UA 2VONA 5ICGA 2GQQA 4R1HA 4K2EA 3R61A 2MH9A 2A3SA 1YW7A 3BOQA 3IRQA 1T6SA 1XMKA 3BROA 2BE5F 1G4DA 3SZTA 2BGCA 3DXJF 4IVNA 4KT5C 5LRRA 5D6FA 3WU0A 1KU3A 1U5TC 2FE3A 2CFXA 3KZZA 2AXLA 5CYVA 2HQRA 1KGSA 4YIFA 3TO9A 3VB2A 2VBXA 5L3GA 1OPCA 5LEKA 3WTWC 2QQAA 2ZMEA 3E6DA 2HTSA 2X4HA 4O5VA 2M1BA 5ICFA 1RI7A 3F23A 1KA8A 2XIGA 1U6GA 3HRSA 1WI9A 3VEPA 1YO5C 3TDUC 1QQIA 4E70A 3F8CA 3MQ0A 3I0TA 2WV0A 2LF7A 2M45A 4LK0F 2DK8A 4YG2F 5DDGA 1USSA 3JSOA 5DUIA 2X0LA 1RZ4A 4PZJA 2CYYA 4A0XA 4QWQA 1TLHB 4ON0A 2ETHA 2NAZA 3K0LA 2PFBA
chains in the Genus database with same CATH superfamily
2HOTA 1OCRH 5CVRA 2QGUA 5F6FA 1WJCA 1VQ6I 4NC7A 2LNBA 3DLLF 4F7ZA 4CHUA 4ENMA 3WG9A 1FOYA 3IH4A 1JGGA 5FGMA 3W2WA 4UHTA 3BG7A 1ZELA 3VYRB 4AYBN 3BPVA 3OR2C 2LR8A 2OJED 3RPUD 4LG0B 1Z77A 2WY7Q 3VYUB 1ENHA 3HGGA 3J81Z 1FP2A 4IL6C 1MW7A 4LGWA 5F04A 2L7MP 4PDKA 1KQ0A 4A5NA 3CO7C 1JT6A 2O8XA 1S8NA 2MH2A 4QTRA 3QU6A 4XRSG 3S15J 2E34A 3IUOA 3O6BB 1FPQA 1SFXA 1ZARA 4HF1A 3PM1A 3OYEA 2JSCA 2DYRH 2DFFA 5KHDA 3EYIA 5IYDJ 4KIFA 1VQ7I 4HF2A 4BQQA 5JLXA 1IUFA 1JI8A 5EDNA 4XRFA 4CCJA 3F6OA 3SZGA 1S6LA 3RQ4A 1I1SA 5F27A 1D5YA 5HS7A 1K83J 1W7PB 4FASD 1E0EA 2L01A 2EZHA 4IQJA 4A2UA 1BC8C 4ZZLA 5HS8A 4MQVA 1W5CC 4YRVA 3NAUA 3WG7H 1ZGWA 1BI2A 1VQLI 3F6VA 2B9SA 2R5YB 4IQ4A 1Y1WJ 2JUCA 1YITI 4PK4A 2NXNB 2A61A 2I5UA 3IWFA 4J01A 3HSRA 3HOSA 5BMZA 2QKMB 4A3GJ 3BLYA 2B7EA 2L4AA 4I0AA 3G1MA 3BZ6A 3GWZA 1XD7A 2UWMA 3SDGA 1O3TA 3TP3A 2M34A 4F55A 3OYHA 2JTVA 2QZ8A 1XDSA 4KMFA 2WV1A 2EV5A 3CF5F 5BPDA 2QBYB 1NTCA 2ICWG 2YR2A 5EZHA 2M4GA 2XB0X 5JVTA 4PSWA 2KMUA 3M07A 5EEAA 4U7DA 1R36A 4BE1A 3SEZA 2DT6A 1TWAJ 2E2JJ 1TZLA 4O6JA 3K4LA 3WTUC 1MBJA 3M7GA 1HA8A 3GYHX 2K40A 3OR1C 3BR1A 1YRNB 3FKIJ 3J80K 3HB9A 3P9KA 1TL8A 3F0CA 3K4MA 1ETVA 2IA1A 4MFDA 2XAQA 1RC9A 1UG0A 4RGSA 2JVGA 3QAHA 2M87A 3N97A 4RLQA 3A02A 5CVIA 4CO8A 1SC7A 4BS9A 2NVUB 2LP0A 2VT3A 4A3LJ 2JPCA 2LBFA 2DMPA 4M72A 5JI6A 2F5CA 1V4RA 1EJ9A 3ZMVA 2PLYA 4OIPF 2IS1A 2FJ1A 1G3SA 4RAGA 3ZMSA 1XMAA 1R5GA 4OMYA 4A3BJ 4RA2A 3BG9A 4P55A 3IRRA 2I8DA 3PO2J 4MNUA 2R7XA 1MH4A 1YI2I 1ULYA 3CMMA 3J80Z 1RR7A 3Q9SA 5H6RA 2EA2A 1F36A 4XBFA 3JRFA 3L2RA 5M3FJ 3VSKA 2A5YB 1YIJI 1ETQA 3I4PA 1G6NA 3DFGA 1QA6A 2B0LA 4BDZA 2CQNA 4B8XA 3TGNA 3ZOBA 5DUKA 2KQRA 1IN5A 2GXAA 1IO2A 5ICEA 5ICCA 3BZKA 1WSUA 2ID6A 5AIQA 2D5VA 3DEWA 5F1JA 4HBLA 3WTSC 1BM9A 2WB1A 4MTDA 2F5EA 2O5RA 4GYIA 1E3OC 3MZ8A 4AYBA 2O3FA 2GIZA 3A0BC 1W0UA 5HVQC 4LIVA 2XROA 2DDAA 4DZJA 1I50J 4DBQA 2MC3A 4RB2C 4I98B 1KU2A 2F5FA 2ID3A 2EQRA 2F48A 5IP7J 3ASOH 3S14J 3I4MJ 1UB9A 1IG7A 1TC3C 4M6VA 3G1OA 2R7FA 2KPMA 3CLOA 2CV1A 2MSYA 4IHVA 3NQOA 4CYCA 2A6EF 4I0BA 4UUSA 3CJTB 3K4NA 2YU3A 1VZ0A 2GXBA 4LLLA 2FXAA 3KP3A 1W36D 1FOXA 3S16J 4AC0A 1YE9A 4EATA 1R5ID 2DBBA 1J2XA 1NK2P 2CMPA 1MJBA 2XUBA 3PFIA 3R0AA 2COMA 2M7BA 2UUZA 4HPQA 2R92J 1WJ5A 1Q1VA 1EA3A 5EGOA 5ED4A 2RC4A 2M8GX 3LQQA 1MMAA 1F1ZA 2PMZN 1VTNC 1GXQA 1X1DA 2VOOA 1K6OA 2OA4A 2E5NA 2H94A 1FY7A 1A6IA 1RUOA 2FNPA 1IV6A 1OR7A 2Z9OA 5B1BH 4ESJA 2HTJA 1LE8A 1I3QJ 4BACA 1WWXA 3WTTC 3PSFA 3R6SA 3M8JA 1S72I 2XRNA 4BBRJ 4RB0A 5J1UA 5JHUA 1HF0A 3RTRA 1GUUA 3QU3A 2IS6A 1B72A 4XN3A 2EWNA 4L9VA 1P7IA 3KLNA 4S05A 2EH3A 5FKNA 5H6QA 2CQXA 1FIAA 4E7ZA 1RNLA 2DK5A 1QHGA 2HOEA 2GOMA 3A01B 1APLC 1FTTA 1LFPA 3F8FA 4IXAA 4IX7A 4C2MJ 2CFOA 1LB2A 4L5EA 2R7DA 1AKHA 3OYNA 2FMYA 1REPC 5J47A 2CV2A 5D8LB 1JUPA 2XF5A 3HUGB 2L7ZA 4G6QA 1XN7A 3FXJA 2PI0A 5D5XB 2NVTJ 1SMTA 3HJEA 5LGTA 4H4KC 2NS7A 4WF2A 4XLFA 1YOVB 5DYMA 3MKLA 3KETA 3TDZC 5L3CA 1FYKA 3F8NA 5DS9A 2K4BA 1U8RA 1GHCA 3OY9A 1K79A 1EV7A 1WGXA 3P9CA 2X6WA 3HOTA 3GMEA 4G94A 1OLTA 2VC1A 4ABZA 2CUEA 4IPAA 2IW5A 4RB1A 4P9FA 2W57A 2UXNA 3F3XA 3FX3A 4I09A 3REOA 2DXIA 2GIVA 1A35A 3AKZA 5CVUA 2ECBA 4WXCA 2DPUA 2R7RA 3GVAA 2Z1DA 4UUTA 3MVPA 4Y33A 2VLAA 2G9WA 1YTYA 2R7VA 3WGIA 4WXHA 3RI4A 1EKEA 1ZYRF 4XLEA 2KHMA 3AAFA 3CTAA 5HLGA 2DFHA 1OYWA 3SEQA 5BPIA 2ADUA 3OSGA 2H8WA 4UXNA 2X1DA 3DKXA 2Z2SB 3HC7A 5LRSA 1Y0UA 1SFEA 5TRDA 1CQTA 2LSOA 3OIQA 4MGRA 4XN0A 3M1EA 3K4KA 2CJJA 1QVUA 2AXTC 3AFHA 4CCNA 2H27A 2HDCA 1USTA 3BTJA 3OS2A 1E3PA 2LY9A 4OIRF 1PUFA 4BJTA 2RAEA 3I54A 4MEXF 3LSKA 1QZYA 3DEEA 3T5XA 3CDIA 3ZPLA 1YG2A 3MD2A 1ERDA 2EPFA 5ILVA 4LOCA 3JRAA 1GV2A 4L5JA 3RYPA 3BTLA 1JJ6C 1XX5A 3S3NA 1H9TA 3ZN1A 3BT9A 1J09A 3OL3A 1BOBA 4HRIA 1U2WA 3PUFA 3S2WA 3VOEA 2BY2A 3FZVA 4RBOA 2HOAA 2HEOA 1WJAA 1Z21A 4G8XA 2Z5UA 1V5FA 4BH9A 4NDLA 1HLVA 1DP7P 1GV5A 3OYKA 4A6DA 3D0SA 1ETKA 1WJBA 3OYCA 2NNYA 3LFKA 1R4NB 1R22A 2OCEA 2JMWA 2JA5J 4HNVA 2ME6A 2G7HA 3QRFF 2XAFA 5EG0B 4LB6B 4ESBA 1STZA 3ZN0A 4AIJA 3ABUA 3PIPF 2NS8A 2OCCH 3AG4H 4L0ZB 4M9ZA 1YS6A 3OYAA 1VFCA 3LSMA 4HLYA 2XAGA 2XF7A 3L2VA 4AVPA 2PJRB 4YFNF 1Z91A 2LK2A 4RLFA 2AHQA 1Z0XA 3P9IA 3O8GA 4PJMA 4UY8I 5LGUA 1MMSA 2VBWA 3JTHA 2Y9ZA 4B3AA 4I01A 4AVZA 2EILH 1FSHA 2FU4A 4B43A 2OF7A 2D1VA 2KJCA 3BG6A 1ZREA 3CCVI 3ABLH 3GLXA 4KN7X 2IEKA 1FMVA 3PQKA 4V2FA 4BHCA 4WK8F 1NK3P 3I58A 2DMQA 2FBHA 4CGZA 3CCRI 2LYCA 3AL0B 1MBEA 3L2WA 4AWXB 2CG4A 5GPAA 2ZXIA 4FQGA 4BJ6C 5FO5A 2DMNA 3J7AO 1E17A 2DFIA 3LOCA 2R7TA 1MJAA 3LAPA 2VASA 2D45A 2GAUA 4M3FA 4L9JA 3SFIA 4AIKA 1I6XA 4BU2A 1VQ4I 1WH7A 5LHHA 4L5IA 2Y48A 3DU5A 3L7WA 2CSOA 3JRHA 1HW5A 1UHMA 4XORA 2IGKA 1R1TA 4EQQA 2YUSA 3BTCA 6PAXA 2K9SA 5E1ZB 2UZKA 1MBGA 4ZC3A 1DUXC 4LD5A 3CCMI 2BW3B 4XKBA 2R7SA 2K9LA 4R79A 4XMYA 2XAHA 2DA7A 2K5CA 5FRMA 1IAWA 1HC8A 2LKPA 1SD5A 4N4OB 3BR3A 1JKOC 3PJRA 1YS7A 4B3XA 1RPWA 1WFXA 5E3LA 5KNLA 5H2FC 1BI0A 1HOMA 3SDBA 1IN7A 1SVOA 1R4MB 2LDUA 5FJ8J 4IJAA 3V7RA 1MBFA 2IRFG 1QBJA 1XGNA 2LTPA 1OCCH 2PQ8A 4MO7A 4Q48A 5D4RA 3GTMJ 4KUMA 4XNFA 3UNGC 1R49A 2CQQA 2P0WA 1HKTA 4NB5A 2FBIA 5DV5A 1R6RA 3BR0A 2XAUA 4BXFA 3BJ6A 3KZYA 1KZHA 4XRSA 1CF7A 2E1CA 4Y3OA 1Y1VJ 2Y31A 3EDPA 4F93B 3I56I 3RPQA 4P1WA 3SZPA 1ZRCA 2ELJA 3OYFA 3FISA 4LLNA 4BE0A 1SD7A 4OOIA 2L7KA 5GTIC 1MJ9A 1ONVA 3HTSB 1VQPI 3LA7A 4GGGA 3BPXA 1LKXA 3LL7A 3HDDA 2P6TA 3K70C 5HDNA 5D5VB 1UZCA 2HPIA 1S7EA 2TDXA 1ZAOA 1R23A 2LKSA 2F5DA 2G7UA 2ZC2A 4EV0A 3DWLE 2IA2A 2HVRA 1RKWA 2BY0A 1RIOH 4XLHA 1A6QA 1MNMC 4BY7J 3N05A 2FRHA 5EZGA 4Z2YA 4CA0A 4EM0B 1FOKA 4JX5A 4CH7A 1IRFA 2V9KA 4A0ZA 3LSPA 2E36A 1OYYA 4XIDA 2K9QA 4CZCA 4HQMA 4WXDA 4C9YA 2MYSA 3IC7A 4DNCA 3CP2A 1O7LA 2VB6A 1U8BA 4CCOA 1Z6TA 2P5LC 2DA4A 1T38A 3JTGA 2IGNA 1UAAA 3WHCA 3WGGA 2EIKH 5HNFA 1W5SA 1D0XA 4KICA 2JJ7A 2KIMA 1MGTA 2EINH 2OTLI 5KVRA 2JA6J 3MAJA 1H0MA 4YFXF 4HSTA 2PEXA 2W00A 3LAJA 2HI3A 1B6AA 1G3YA 2O7OA 4EVIA 4A3FJ 1TQPA 2R7UA 1ZR2A 3DPTA 1TWFJ 1HQCA 3AG2H 4XOPA 4BEHB 3RZDJ 2HZTA 1ETWA 3J7ZI 3HPHA 4M9XA 2FEZA 1VNDA 5FROA 2VPRA 2M4KA 4XLCA 1BN5A 1GLNA 3HOYJ 1OMIA 3KEOA 1I3AA 2DFEA 4BAYA 4KN4X 3J81K 5L3EA 3ZQGA 3TO6A 4CYDA 1GT0C 4HAMA 1R5HA 2G0EA 4WCGA 3U1DA 1IJWC 1IRZA 3BZCA 3KE2A 4RAZA 2P6SA 3B6CA 4QSHA 3ZMZA 3KYDB 4A3IJ 1Z3YA 3JCUC 2WBMA 3RKQA 3CF2A 3PNYA 2OPTA 3I71A 4E7HA 2JK3A 1PP8F 2HYGD 4U0VA 3H3ZA 4ZDLA 3MKZA 3CUOA 3CMAI 1T98A 1P7JA 1LFUP 1KYWA 2DPDA 4DYQA 2E1NA 2FQ3A 4LLGF 5IT3A 3CO6C 4CCLA 2F4MB 2ZNYA 1K78B 1MIJA 2L9RA 1HSTA 3H36A 5CQGA 1U78A 1S9HA 3H92A 1GVJA 3WTYC 3VWBA 4UNOA 4IZZA 1T0FC 3BR5A 5GAGJ 4Q5SF 2PMUA 5FLXZ 3OWTA 3MEXA 4HNTA 3BCBA 3FKJA 3LSIA 3QOPA 4U7BA 4D5CA 1MDMB 3FWEA 2E19A 2VIXA 4QPOA 1Y6IA 1EF4A 3QPTA 3AL0C 4CZZA 4RGUA 2XPUA 2H1LA 3UKGA 3G3ZA 3WU2C 2GXGA 1D3YA 2KZVA 3K1NA 4GDFA 2L0KA 4B48A 3GX4X 1KQ9A 3E5QA 3U2RA 3LQRA 1VQ9I 1ZQ3P 2LFBA 1VQ8I 1WZ2A 3ZQLA 3A2KA 3NEUA 1QO0D 2NVQJ 4BDYA 2DMTA 2XASA 3B02A 4KIGA 4QPQA 3TP0A 3ZQHA 4LG0A 3L2QA 1S7AA 4GCVA 5BQTA 3M8EA 4DBRA 1A5JA 1B9MA 3BQZA 4KJZA 3L2UA 3S1MJ 4HV6A 4MTEA 4HOBA 4ZZDA 4M3GA 2WADA 3HRTA 2WA0A 5FD6A 1W1WE 1W5TA 3UR3C 3WE3A 5ILUA 5AONA 1IW7F 1KU7A 5GADJ 3K4BA 3ZMDA 3FMQA 3JAMK 2MFZA 3VSLA 2Y0MA 2JA2A 4XLNF 3JSPA 2WTEA 1V3FA 2TCTA 1FYMA 3OMYA 4LFUA 1TNTA 3W6JB 1IF1A 3GFLA 2BV6A 4N0BA 2EIJH 2LVSA 2EJRA 4S04A 1BI3A 5LFAA 5LHGA 1W7PA 3JREA 4AIHA 1FBQA 1X2NA 3H5NA 2GOXB 2X6YA 4EMSA 2JPBA 5FRNA 4E7SA 3O8HA 2X9DA 4C3HJ 2ZB9A 5LGNA 3GZ5A 4HX7A 2HQ5A 4HQEA 3WU1B 2OD5A 3TKYA 4YFKF 3FHZA 2R5YA 3H9GA 2GA1A 3TO7A 2H8RA 2K86A 1TTYA 2Y0SN 2PMHA 3I64A 3U1KA 2E2IJ 2GBYA 1QPMA 2DN0A 4BE2A 4UB8C 1IXRC 3E1SA 2CS3A 4XONA 3I3LA 3JAMZ 4C2UA 3OIOA 1P6RA 3BG5A 4EEFG 3CJNA 2QKLB 4IOCF 4P9UA 2L3DA 3ZCOA 3ZMTA 3HBLA 2QBYA 1P2FA 1K7AA 4KT6A 2DT5A 3FIWA 4PJNA 3GFIA 5E3OA 4Y52J 1BR4A 3LSTA 4U87A 4NNJA 2LD5A 2XKOA 1BW5A 3Q5FA 2WAQN 3B6AA 2V26A 2XV4S 1HDDC 2ECCA 3BTIA 1YRNA 1I1GA 3Q9VA 2VJIA 4NQWB 1VF9A 5E3MA 4EJUA 3HOVJ 3RJPA 2F6CA 1B8IB 5DCMB 1VI0A 4A3JJ 4G12A 2WY8Q 1PDNC 3KP6A 2M0MA 4GRIA 2QQ8A 3K69A 1AU7A 3WE2A 2H6BA 3CZ6A 5BNGA 5HOOA 4H0EA 4KDPA 2CUZA 1WJFA 4IHWA 4D7MA 3E0JB 1Y8QB 2L9SA 2XGCA 1BI1A 2XSDC 2PG4A 4BYYA 3FDYA 5F0CA 1YJWI 1TP4A 2JA7J 4F52A 2Z33A 4V2GA 4JK1X 1I27A 2IP2A 1MNDA 3OYDA 2CUJA 3IV5A 4FE7A 1MH3A 4FCYA 2QQ9A 5H20A 5D4SA 1UCRA 2Y30A 3K1MA 1IDYA 3W3CA 4KMUX 5L3FA 3KP4A 2JT1A 4IO9F 2IJLA 4RM2A 3TEDA 2V1XA 2HQAA 5E8IA 4M3EA 4FX0A 1YX5A 1TWHJ 4G9YA 2K7LA 3I59B 2QA4I 4HNUA 3PQJA 3C3WA 5CPRB 3LSRA 3GCMA 1F9NA 1R1VA 4BHPA 1NH3A 4L0YB 4JX4A 3M9AA 2BYVE 2EIMH 1KYZA 3ELKA 2GZWA 1ON1A 2CUFA 4DOZA 2QSGX 2LKXA 1BJAA 2H1KA 2ELKA 2YX4A 3U9GA 1XSDA 2ZKZA 1LJ9A 2V4JC 3PL8A 2HYJA 3K9TA 2NRAC 2V1UA 2EB7A 2E60A 4GO1A 2HYFA 1M1EB 1FLIA 5E1XA 1QHHD 1J59A 1S5LC 2FSWA 3DTIA 5J40A 5B5EC 1Z1DA 4LMYA 3I55I 3DKYA 2KJBA 3ZR8X 2F2EA 3IAM2 3CP8A 2R7OA 4KA4A 1ORKA 4NUBA 3F8BA 1H8AC 2KP6A 1LUJB 1DU0A 5FKLA 2RNGA 1PVEA 3DBHB 3JW4A 4FHTA 4CCKA 1YFHA 2OQRA 1ZGJA 2Q1ZB 2VXDA 3F8MA 3T0YA 2ME0A 5J4YA 1T95A 2QSFX 3GUDA 4HYEA 5IT9K 2BHZA 2KZGA 4A3MJ 3FXKA 2HVSA 4AM3A 3PIOF 4E7LA 3CUQB 4Z6YA 3RSNA 4A5MA 5E17F 4C2TA 1SFKA 2O6GE 4A3KJ 1Z05A 4W1UA 2W84A 1SFUA 1SAXA 2HVQA 3QPSA 1ZK8A 2KT0A 3BY6A 4XLPF 1HCRA 2HGCA 4GFBA 2DO7A 1Z67A 4B1RA 2NOGA 1ZH5A 1JTYA 2DOAA 1OCOH 4HZFA 2CV0A 5TISC 3GFMA 3CD6I 4JBAA 3EQLF 2VOPA 1XSVA 3HOXJ 5J1YA 4UV9A 5IT9Z 5CJ9A 1S3JA 2E7WA 5FLMJ 3E6MA 4EGYA 2STWA 5DM7F 2VBYA 3BCAA 5IOZA 2VUMJ 2VBZA 2DLLA 4ZYEA 2WAQA 3A01A 2WWYA 4XL9A 1BW6A 1G3TA 3T8TA 1XC5A 2HR3A 2XPVA 2Q8KA 5J8CA 3DBRB 2IBDA 4B4CA 2FA5A 3BC8A 4YIRX 1U5TB 4LITA 2M5WA 3BR2A 2OZ6A 3HTUA 4M3DA 5DTDA 1V5GA 3ROUA 3HGYA 2COBA 3HUGA 2CGPA 2NVYJ 2KIQA 2M2EA 5M5YJ 1T08B 1EH7A 1U9NA 1YJ9I 1JHFA 2VJ4A 3RKYA 3GTOJ 1D1CA 4P96A 2P5KA 1AHDP 3GTLJ 4WX9A 2O8KA 1V55H 3CC7I 5K1YA 3S3OA 3ECHA 4IRIA 3FF5A 2KDZA 2XRLA 3V8JA 2MABA 1VQKI 3LSHA 5F64A 1Y0NA 2BY3A 5JR3A 5DM6F 4RAFA 3SYTA 2IVMA 3K4CA 2OUMA 4IOAF 3K7AJ 1ZLKA 4PSXA 1PUEE 2QEXI 3PNTA 1P4XA 2GM4A 3BP8A 2BY1A 2K3PA 3IAS2 2JA8J 3KLOA 3TBIA 1P9QC 2A68F 3LA2A 3ABMH 2JQ7A 1LNWA 3RQIA 4XK4A 1MMNA 4BXUA 3KYLA 1X3ZB 4UB6C 4J19A 2OC6A 4C3IJ 3P7NA 2A6TA 3WTVC 1SD4A 5CQEA 2HXOA 2ZJQF 5K5QA 1OJLA 2Q0OA 1WCMJ 2YS9A 2FOWA 2CW7A 2Y69H 3MZHA 1EH8A 2Y2ZA 5D8KB 3F22A 1R1UA 2VQCA 2RN7A 1QVTA 2PMZA 1IUYA 3NRVA 3LNQA 1N25A 2KRHA 3GTKJ 1W7PD 2P7VB 2KKOA 2KISA 4L9TA 5C44J 3G73A 1YIOA 1MBKA 1IN4A 4KITB 3NARA 1ON2A 4OAZA 4BNCA 4G7OF 3ZXSA 2AO9A 2OAZA 4DYCA 4Y13A 1LEAA 2XGXA 1T56A 3WGHA 3BR6A 4D0PA 2HOSA 3QWLA 2MW8A 1OCZH 1RESA 3D5SC 3LFUA 2XAJA 3FXRA 3MKWB 4M73A 3S32A 2HNHA 1ZGAA 3HYIA 3V7CA 2RQPA 2VKDA 3X2QH 1XCBA 3J7AY 1X3WB 3GW2A 2N8GA 2OTJI 1E2XA 3IH2A 4CDGA 1MMGA 1FC3A 1RUNA 3QP6A 3V7SA 1WRJA 4QLCU 1F43A 4RMNA 2KRCA 3ZQQA 1KQ8A 1DGRM 2HXIA 2YSRA 1G2HA 4C3JJ 1K6YA 4X1EA 4YELA 3H0DA 5KAIC 2V9PA 1TBXA 5K5OA 2R5ZA 2L9NA 1U3EM 3M3YJ 4OU0A 3R4KA 2CO5A 2XC7A 5EG0A 2V1DA 4PJJA 4YEJA 1DPUA 3EUHC 3M8FA 3LMMA 1K4TA 2IGMA 3BJOA 2AS5F 2O9LA 1GVDA 1B1BA 2MLKA 4A3EJ 2PJRA 2E35A 3F72A 2OZUA 4Y7NJ 3CCSI 1T0FA 2EFOA 2RDPA 5GAEJ 1YLFA 1N77A 3GEZA 2A6HF 1XPXA 2QYOA 3ABTA 3RZOJ 3QP5A 4M71A 1TQIA 2EA4A 3CCYA 2QWWA 3CCEI 3Q3SA 4AD9A 4R8HA 3MMYB 1QU3A 4ZDPA 5F1RA 1FJLA 4TV7A 3DV8A 2DA1A 4ASNA 3S2DJ 4A0YA 2YPRA 4EM1A 2R93J 3WTXC 1JKQC 2OU2A 2W25A 5F08A 1ETYA 5K5RA 3TW6A 3SHFA 2PBIA 2DODA 3HKZN 5LLQA 2ZJRF 1LQ1A 3OS1A 4HX4A 4WWCA 1B4AA 3EUKL 1B59A 1LDKB 1L3LA 3CUQC 3KFWX 1IRGA 3WTZA 4M6XA 2VE8A 1O7FA 4JP0A 1MZBA 1D5VA 5CVVA 4DZPA 4I76A 1JTXA 3C7JA 3C1DA 2HFHA 3ZRGA 4EJWA 1W0TA 1KONA 1XGMA 4KIBA 5BS6A 2CW8A 2RREA 1YHQI 1XGSA 2BW3A 5IY5H 1D1AA 3W2AA 1F5TA 4DJAA 2DTRA 4LJZF 2V9VA 1ZG5A 2ZMEB 1LVAA 3KYCB 5JLWA 3QODA 1Z9CA 2HQNA 2J5PA 3IHUA 5GAHJ 4A6EA 4ZH4F 1LPQA 2X1CA 1TT0A 2HKXA 2X6XA 3DCFA 1ZLJA 3PFYA 2DDBA 4KFCA 3A1YA 1OYIA 4ENJA 4ZTJA 2ACJA 1J7KA 5HLIA 1RRJA 1MNEA 2W1OA 4XKVA 2E1OA 4JOMA 2V6EA 1TWCJ 2QSHX 4BKXA 2DOFA 2VJ5A 1O3SA 5K7FA 4IHSA 3O3KA 4D5FA 3QPLA 1WVRA 1H89C 2ISYA 1WPKA 1XSXA 5B1AH 3JRBA 2IGOA 1QRYA 3LSGA 3V8LA 2R3SA 3MKYB 1O4XA 1VQ5I 2Y9YA 2BZTA 2P7CB 4P5OA 2K85A 4A69C 1IZ1A 4HF0A 3FM3A 2DW4A 4U0YA 2EFNA 4UVBA 3S93A 5KAFC 3DF8A 4X6AJ 2L7FP 3DEUA 2CWEA 3CLQA 3GFJA 4RGRA 2XDVA 4RM3A 1ETXA 1DP3A 5CVJA 5CLSA 1XCVA 4Y4RA 3KEYA 1WHUA 1ZG3A 3JRGA 5E1WA 3H35A 1O3QA 4ETSA 3HIFA 2Q2EA 3MFKA 3E6CC 3T8RA 5L3DA 3RKWA 3V4GA 1UG2A 3A03A 1R7JA 3GTJJ 4NC6A 3GZNB 4PFOA 2H6CA 5J1RA 2LY2A 3EPZA 4PGHA 2E5ZA 1I39A 4HDVA 3S3MA 3RKXA 2QENA 1AOYA 4EGZA 5FLXK 3I9V2 2ZSHB 1D8JA 1LDDA 2TRTA 2LREA 4N9IA 5IPAA 2VT2A 2LLKA 5DCFA 3T1BA 2EFQA 4Q47A 4BJ5C 2K3FA 4HV5A 2R7ZJ 1V5EA 3JRCA 3IKVA 3OOUA 5FKOA 3OYGA 3RDIA 2ZXJA 4A3CJ 2L5QA 2BBYA 5FFXA 4GYGA 4OMZA 4E7KA 3CMYA 2C6YA 4MHGA 1HSJA 2HZDA 5J8FA 3HG9A 1JGSA 4BEHA 4I2OA 4MQ9F 4ENKA 1SVLA 5JFRA 1JXSA 4XKWA 4G7HF 3E3VA 4XR6A 1D1BA 3DTEA 1WJDA 1WKMA 1L0OC 3L09A 2AQFA 2M3AA 3K70D 4UVCA 2WB1N 1RETA 3K6GA 2DJIA 5TGTA 4A3DJ 4FETA 2DCEA 2MLGA 3GBGA 3FMRA 3PSIA 3H9JA 1BOAA 1JUMA 2B63J 3HKZA 2M0CA 3B73A 3ERED 1Z7LA 2E7XA 2LF8A 2X85A 2GA2A 2VJJA 4CXFA 1MKMA 3VPRA 2VPLA 2LMDA 4BL0B 3PO3J 3KP7A 4J00A 5J6XA 3KCCA 4PCQA 3OSFA 1P4AA 2E1MB 4B47A 3DPLC 2M9HA 5AIPA 1HKSA 2LG4A 2JVHA 3S8PA 3ZMUA 2EZKA 3DKWA 4A12A 3CMEI 2WC2A 5EF6A 5KCMA 1SAUA 2JZYA 3E5UA 1ZG1A 3FBNB 4XLAA 4LK1F 1K78A 3OV8A 2EFPA 2MA3A 3K1PA 3G2BA 1OFCX 1TNSA 3FXOA 2O61A 4RS8A 2FD5A 3D1NI 3NWTA 1D8KA 2FMLA 2QF7A 4Y17A 2ISZA 2QQBA 1FIPA 1D0YA 1T33A 2M7AA 3DQVC 4KNYA 3C2BA 4M6YA 1MDMA 2M30A 3GXOA 3S17J 4BQOA 3OOPA 3Q0WA 2RKHA 5B3SH 2VC0A 1X4PA 2UXXA 4CICA 1O3RA 4ZJZA 4HLXA 3FM5A 2OBPA 1WJEA 1FBSA 1NHAA 3FK7A 3BWGA 2V7FA 1ACIA 1FNNA 2LBFB 5DD8A 1TT5B 1A36A 1J9IA 2RGVA 3R60A 1K61A 1CGPA 4UV8A 1IN8A 2R0QC 2VQLA 1XTAA 3HHHA 1BIAA 2WAFA 4XICA 1YYVA 1FYLA 1IXCA 2ZCWA 3HEFA 4DW6A 1W36C 1BL0A 3S1QJ 3HRMA 1LVKA 2YX7A 5FD5A 2R7WA 1BR2A 2DOEA 3FMSA 2RNJA 2HPMA 3G1LA 5IOYA 3ZQIA 4ZYDA 3V42A 2D2WA 1E3HA 3L1PA 3ESWB 4IKFA 3HOUJ 2Y75A 4G6DA 3MN2A 2QUFA 2FOKA 3KZIC 5D6EA 2DA6A 2L2OA 3VDXA 3G71I 4IHTA 1VQOI 3IH3A 3C2GA 3FXUA 1XS9A 4HA8A 1FWZA 2ZMEC 2Z16A 2L4MA 3EETA 2JRTA 2ZO4A 1WQ2A 2F5VA 2JRMA 5GTHC 1U9OA 4M9SA 4V19K 5LEJA 3E6BA 4LB5A 1N75A 2FX0A 2K27A 3F21A 2DQRA 2VE9A 3HSFA 4NHJA 1J0RA 1ZR4A 1TW2A 2XF6A 2OQGA 3FBIB 4B09A 1FZPB 2NVXJ 2F4IA 1UELB 4D7NA 1MBHA 4ANJA 1LDJA 4YIIA 4ESFA 1K4SA 1EH6A 5C3EJ 5DD4A 4PJLA 2CQKA 2HS5A 1POGA 1FSEA 2PJPA 1HDPA 3M1CA 1HBXG 2LC2A 4KYWA 1S29A 3V8KA 4CYCB 4G7ZF 4I7HA 4UUSB 1SEUA 2W24A 2XVCA 3KEQA 4C30A 2LRDA 5M5XJ 2W4SA 5M3MJ 1OCTC 4IEJA 1T2KA 5DEQA 3L9FA 4BY1J 3Q0UA 1F4KA 5E79C 1HW1A 2ZJ2A 2KIUA 4UVAA 2E2HJ 3L2CA 2GLOA 2EZLA 2DJNA 2ZFUA 3H9QA 4ITVA 2MGQA 1IXSB 1XB4A 4HW0A 2QM3A 3ECOA 2HDWA 2XHKA 3CQZJ 3H0GJ 5EGOB 3HL2A 1BA5A 3BQYA 1YX3A 1OKRA 2L9VA 4KISA 3GLLA 2AQEA 4BQNA 2RV8A 1G59A 3EUAA 4NQWA 2BEOA 2VQGA 2Z99A 2L02A 4NC8A 1JHHA 2K02A 3AG3H 3H1CA 4U0WA 4IHYA 1A04A 2IT0A 4ENNA 1LE8B 3HOWJ 3BG3A 3W6KB 1B8IA 5DCMA 3H5AA 2KL4A 2M8EA 2FUG2 3CDLA 1JT0A 2F4OB 3ERMA 3CC4I 4EJOA 5BOXA 3FHNA 1B72B 5E8GA 1UHWA 3RCOA 4XM3A 2BVMA 3R0JA 4BBSJ 5E20A 3P5JA 1B9NA 2DAOA 2ELHA 3CJRB 2ZXHA 2DU9A 2XGDA 1AKHB 1PYVA 2VODA 1QZZA 1ZHFA 1ZKGA 2A69F 4Y15A 4DIQA 3FXLA 1I5ZA 4QIWN 2ZJPF 3QYEA 4LIUA 2VKVA 2KRFA 3E7LA 4CCMA 1YJNI 1FMWA 3VODA 1T39A 3MWMA 3OYLA 1N78A 3H3VK 3HHGA 3K4JA 1VQNI 5LD2C 4A93J 5C4XJ 3ZQ7A 2STTA 2E71A 2EK5A 2W82A 1G3WA 5CKTA 4DGWB 3SXYA 1MD0A 2BXZA 3QOEA 1YW8A 1ZTRA 2BOLA 2I10A 3I59A 1YQAA 2K4JA 4AIDA 2ESHA 2RVCA 4JYKA 4XOTA 2IS4A 2E1MC 1X3UA 3I53A 5D5UB 4JX6A 5A2QK 3GF2A 3HPGA 4F3QA 1HW2A 2V79A 4XSXF 2DA2A 4RB3C 3TW7A 3EUHA 4ZYHA 1ZN2A 2Y0SA 5TJJA 2CW0F 3DU6A 3CCLI 4W97A 1Y39A 4FT8A 2YU9J 1LFBA 3VYSB 4HEA2 4S0HB 2CU7A 2W7NA 1S7OA 4X0GA 2IPQX 3ONQA 5FFZA 1GXPA 4II3A 2FBKA 1A31A 3FXQA 2MBFA 3DBLB 3E97A 3BDDA 5LBQA 3RIRA 3ZQFA 1X2MA 2JWTA 4DQ2A 4F91B 4PJ0C 3HZJA 4FE4A 4OIOF 4PFPA 4ZTFA 3GTGJ 3RYRA 5HNHA 3HOZJ 5A2QZ 4B44A 1FX7A 1C0WA 3LWFA 3TMOA 2A5WA 4EM2A 4D1QA 1PUFB 3MZYA 5EEGA 3MCZA 2ZXWH 2UV1A 5ERIA 4I99C 2NYXA 3CUQA 5LHIA 2QVOA 3TOBA 1UHSA 2H09A 2QLZA 5ILSA 3GTPJ 5HODA 4I6ZA 4OAYA 3TL4X 1FT9A 1R58A 3A0HC 4ZYGA 3GZ6A 1HXDA 4JQFA 3BJAA 3JRIA 3C2HA 4HDUA 2VQHA 2X1EA 5FKKA 5B66C 3M4OJ 2NS0A 2O0YA 3PUBA 2HWVA 3KIOA 5FKMA 1XG1A 4MEYF 1SD6A 1XGOA 4OIQF 5EYRA 4ZYAA 3ML6A 1NG6A 1BR1A 5HS9A 3RPUA 1RR8C 2GWRA 1R71A 1TQMA 3N4MA 3IP4B 3S1RJ 2X6OA 1JKPC 1OCPA 3LA3A 2CH0A 3SFZA 3QPHA 2ZBKA 1X1BA 3CCJI 2EFWA 1LEBA 3KX2A 2HKOA 3ZGKA 1Q1HA 3IWZA 1T8IA 3CCQI 4IF4A 1U5TA 3O2PE 4N4NB 1W4MA 5HDKA 3OS0A 4MFEA 3K2ZA 2PX9A 1V54H 4MLOA 2RQQA 1Z6RA 1BBYA 2ZNZA 5F0HA 1JJ8C 2KLOA 2PN6A 3SJMA 4BHBA 2IA0A 3PNVA 2X51A 1UMQA 3IKTA 5GPCA 2FNAA 1RKTA 2MD0A 2FQ4A 4N9HA 2DI3A 3G6EI 3K10A 1J75A 1SVMA 3CDHA 1XMXA 1R00A 3D5RC 4HX8A 4OWRB 2LOOA 3ASNH 5HLTA 2LH9A 3IL2A 5IP6A 2EV0A 1KU9A 1I6HJ 2O03A 3L00A 2P5VA 1FP1D 3ABKH 4E4HA 2ESNA 2XGEA 3SQNA 1Y8RB 4HSRA 3W2VA 1X1PA 2NNNA 2V6CA 1IRXA 3GTQJ 3EYYA 2DA3A 2R5ZB 3FXMA 4M3BA 4IRGA 3JR9A 4PUSA 3KP5A 2K9MA 1XDUA 2W48A 5C4JJ 2D1HA 3C18A 3TOAA 3COAC 4I02A 1QNTA 2IS2A 2VKEA 2MC4A 2FF4A 1DGWY 3FK6A 2W85A 5IYCJ 5J3LA 1X1AA 2R4GA 3D5LA 1OR7C 2NOJB 3I5UA 2VL8A 5D5WB 2VN2A 1JKRC 4XQFA 4FTHA 3CC2I 1FOWA 2VI6A 1H88C 3G4SI 2J5OA 4IRHA 2Z3YA 1DPRA 5KK1A 1ZRDA 4DYRA 1JE8A 3QYFA 2P4WA 5K7HA 3W6VA 2ZFWA 2KDOA 4EJVA 2DT7B 1ODDA 1BC7C 1FTZA 5JVGF 1DU6A 2JSPA 5K7ZA 2P81A 3ZP5A 2EV6A 2OV7A 4RGXA 2QCOA 3F9KA 4OINF 1OQYA 3DP7A 4GXOA 5EEHA 2A07F 2VXZA 1DQUA 5L3BA 1CF7B 1H9GA 1Y56A 2P8TA 4L9NA 4M74A 1J5YA 1X1CA 3ISPA 4Q4ZF 4G6TB 1AWCA 1SMYF 1ZRFA 1TW3A 4U88A 3HXLA 1OISA 5HDGA 4UUVA 3HRUA 1QZEA 1DDNA 5JHFA 2JUGA 4IHXA 4E7JA 4HG2A 4AU7A 2MG4A 3H5RA 4RAYA 2BHYA 3DLAA 3H3UA 1IN6A 3ULQB 5IYBJ 5E18F 1G8XA 4XSZF 5FB2A 3OYBA 1PP7U 3E5XA 2V1NA 3VFZA 3GO5A 1O57A 1TWGJ 1UFMA 5HLHA 2XKPA 1QPIA 1P92A 1FBUA 3OYJA 3TQNA 4AUXA 3S2HJ 2WAEA 2EBIA 3CJQB 5EJCA 2DTZA 1P4WA 3KP2A 2DMUA 3KPHA 2MD5A 4EJTA 1YW9A 2KIFA 3DPUA 4L18B 4O3MA 3OYIA 4D9JA 3HSEA 1QGPA 4E6KG 1HKQA 5J4VA 1D0ZA 4PGGA 1VQMI 2L54A 3OIPA 2DQLA 3NWSA 4BQAA 3AG1H 4FX4A 3I4NJ 1IDZA 2HU9A 1JUSA 1BIBA 3WHBA 1Z7UA 3WODF 2VONA 5ICGA 1R9TJ 2GQQA 4R1HA 5M5WJ 4BUPA 1U0JA 2IXSA 4K2EA 1BJZA 3R61A 2MH9A 2A3SA 1GDTA 3LSJA 1YW7A 4FISA 3BOQA 3IRQA 1T6SA 1XMKA 3A4CA 1IC8A 2BXYA 3BROA 1UJ8A 2BE5F 1PJRA 4MIMA 1G4DA 4F92B 3SZTA 2BGCA 3S1NJ 5FLVA 2DYSH 4II2A 4BXXJ 3DXJF 3OYMA 4IVNA 4KT5C 2VKHA 2IAIA 5LRRA 1SFOJ 5D6FA 2ZSIB 1KU3A 1U5TC 3WU0A 1FEXA 2FE3A 2CFXA 3K2AA 3ZQCA 2KFDA 1MSFC 3KZZA 1MMDA 2Q2EB 1NG7A 2AXLA 5CYVA 3J7YJ 1ITYA 4XKCA 2HQRA 1ETOA 1Z3XA 1KGSA 2X48A 3OL4A 4YIFA 2XB5A 3TO9A 3VB2A 3CCUI 3QQAA 2VBXA 5L3GA 1OPCA 2A05A 3VYTB 3JRDA 4ZDOA 4E7IA 5LEKA 1SANA 3WTWC 2QQAA 2ZMEA 3E6DA 2HTSA 2X4HA 2R7QA 4O5VA 2M1BA 3QYBA 5ICFA 2DA5A 2CQ7A 1RI7A 3F23A 3CESA 1WH5A 1KA8A 4LG3A 2XIGA 1AA7A 1U6GA 3HRSA 1WI9A 2K9NA 2LY1A 3VEPA 3DTKA 1YO5C 3TDUC 4NBQA 4RDUA 1QQIA 2JN6A 4E70A 2EZIA 3F8CA 4CSWA 3MQ0A 1IGNA 3U21A 3I0TA 1WI3A 2LF7A 2WV0A 2XSJC 4XRMA 1X4OA 5E3NA 5F0FA 2M45A 3Q0VA 4CUGA 4LK0F 1X19A 2DK8A 2XPWA 4YG2F 5GP9A 5DDGA 1USSA 2CRGA 2HDDA 9ANTA 3JSOA 3HM5A 5DUIA 4BGDA 2X0LA 1MSEC 1RZ4A 4PZJA 1IV8A 2CYYA 1X58A 2BVLA 4QWQA 4A0XA 1TLHB 5IP9J 4ON0A 2ETHA 2NAZA 3K0LA 2PFBA
chains in the Genus database with same CATH topology
5CVRA 5F6FA 2LNBA 4F7ZA 4CHUA 4ENMA 3WG9A 5FGMA 4UHTA 3BPVA 4LG0B 3J81Z 1FP2A 4LGWA 4PDKA 1KQ0A 4A5NA 3CO7C 2O8XA 1S8NA 2MH2A 3QU6A 3O6BB 1FPQA 1SFXA 1ZARA 4HF1A 2JSCA 3EYIA 4KIFA 4HF2A 4XRFA 3F6OA 1S6LA 1I1SA 5HS7A 1W7PB 2L01A 4A2UA 1BC8C 4ZZLA 5HS8A 4MQVA 1BI2A 3F6VA 2A61A 3IWFA 3HSRA 3HOSA 5BMZA 4I0AA 2L4AA 3BZ6A 3GWZA 1XD7A 2UWMA 1O3TA 2JTVA 2QZ8A 1XDSA 4KMFA 2EV5A 5BPDA 2QBYB 2YR2A 5JVTA 4U7DA 1R36A 4O6JA 3WTUC 3M7GA 3GYHX 3J80K 3P9KA 2IA1A 2XAQA 4RGSA 3QAHA 2M87A 3N97A 5CVIA 4CO8A 2VT3A 2JPCA 5JI6A 4M72A 2F5CA 1V4RA 2PLYA 3ZMVA 4OIPF 1G3SA 3ZMSA 1XMAA 1R5GA 4OMYA 4P55A 3IRRA 4MNUA 1ULYA 3J80Z 3Q9SA 5H6RA 2EA2A 4XBFA 2A5YB 3I4PA 1G6NA 3DFGA 2B0LA 4B8XA 3TGNA 5DUKA 1IN5A 5ICEA 5ICCA 1WSUA 5AIQA 4HBLA 3WTSC 1BM9A 4MTDA 2F5EA 4GYIA 2O3FA 5HVQC 2XROA 2MC3A 4RB2C 4I98B 1KU2A 2F5FA 1UB9A 2R7FA 3CLOA 3NQOA 2A6EF 4I0BA 2YU3A 2GXBA 4LLLA 2FXAA 3KP3A 2DBBA 1J2XA 1MJBA 2XUBA 3PFIA 3R0AA 2COMA 5ED4A 2RC4A 3LQQA 1F1ZA 1VTNC 1GXQA 2VOOA 1K6OA 2OA4A 2H94A 1FY7A 1RUOA 2FNPA 1OR7A 2Z9OA 4ESJA 2HTJA 1WWXA 3WTTC 3R6SA 2XRNA 4RB0A 5JHUA 3RTRA 3QU3A 2EWNA 4L9VA 3KLNA 4S05A 5H6QA 1RNLA 2DK5A 2HOEA 3F8FA 4IXAA 1LB2A 2R7DA 2FMYA 1REPC 5D8LB 4G6QA 1XN7A 2PI0A 5D5XB 1SMTA 5LGTA 4WF2A 5DYMA 3KETA 3TDZC 5L3CA 1FYKA 3F8NA 2K4BA 1U8RA 1GHCA 1K79A 1EV7A 3P9CA 3HOTA 4G94A 2VC1A 4IPAA 2IW5A 4RB1A 4P9FA 2W57A 2UXNA 3F3XA 3FX3A 4I09A 3REOA 2GIVA 5CVUA 2DPUA 4WXCA 3GVAA 2G9WA 1YTYA 3WGIA 4WXHA 3RI4A 1ZYRF 3AAFA 3CTAA 5HLGA 1OYWA 5BPIA 2ADUA 4UXNA 5LRSA 1Y0UA 1SFEA 5TRDA 2LSOA 4MGRA 3M1EA 2H27A 2HDCA 1USTA 4OIRF 3I54A 4MEXF 1QZYA 3T5XA 3ZPLA 1YG2A 5ILVA 4L5JA 3RYPA 1H9TA 3ZN1A 1U2WA 3S2WA 3VOEA 3FZVA 2HEOA 4G8XA 2Z5UA 4BH9A 1DP7P 4A6DA 3D0SA 2NNYA 3LFKA 1R22A 2G7HA 3QRFF 2XAFA 4LB6B 4ESBA 1STZA 3ZN0A 4AIJA 3ABUA 4L0ZB 4M9ZA 1YS6A 4HLYA 2XAGA 4AVPA 4YFNF 1Z91A 3P9IA 5LGUA 2VBWA 3JTHA 4I01A 1FSHA 2FU4A 2D1VA 2KJCA 1ZREA 3GLXA 4KN7X 3PQKA 4WK8F 4BHCA 3I58A 2FBHA 4CGZA 4AWXB 2CG4A 5FO5A 3J7AO 1E17A 2DFIA 1MJAA 3LAPA 2D45A 2GAUA 4L9JA 4AIKA 1I6XA 5LHHA 4L5IA 2Y48A 3L7WA 2CSOA 1HW5A 1UHMA 1R1TA 4EQQA 6PAXA 5E1ZB 2UZKA 1DUXC 4LD5A 4R79A 2XAHA 1IAWA 2LKPA 1SD5A 1YS7A 1BI0A 1IN7A 2LDUA 4IJAA 3V7RA 2IRFG 1QBJA 1XGNA 4Q48A 2PQ8A 5D4RA 4KUMA 1HKTA 4NB5A 2FBIA 5DV5A 3BJ6A 3KZYA 1CF7A 2E1CA 3EDPA 3RPQA 3SZPA 1ZRCA 4LLNA 1SD7A 4OOIA 1MJ9A 1ONVA 3HTSB 3LA7A 4GGGA 3BPXA 2P6TA 5HDNA 5D5VB 2TDXA 1ZAOA 1R23A 2F5DA 2G7UA 4EV0A 2IA2A 1RIOH 2FRHA 4Z2YA 4EM0B 1FOKA 1IRFA 4A0ZA 1OYYA 4HQMA 4WXDA 3IC7A 4DNCA 1O7LA 1Z6TA 2P5LC 1T38A 3JTGA 3WGGA 1W5SA 4KICA 2KIMA 1MGTA 5KVRA 3MAJA 1H0MA 4YFXF 2PEXA 3LAJA 1B6AA 1G3YA 4EVIA 1TQPA 3DPTA 1HQCA 2HZTA 4M9XA 2FEZA 1BN5A 1OMIA 3KEOA 4BAYA 4KN4X 3J81K 5L3EA 3TO6A 4CYDA 4HAMA 1R5HA 4WCGA 3U1DA 3KE2A 4RAZA 2P6SA 3ZMZA 3I71A 1PP8F 2HYGD 4U0VA 3H3ZA 3CUOA 1T98A 1KYWA 2DPDA 2E1NA 2FQ3A 4LLGF 5IT3A 3CO6C 2ZNYA 1K78B 1HSTA 1U78A 3H92A 1GVJA 3WTYC 4UNOA 4Q5SF 2PMUA 5FLXZ 3MEXA 3QOPA 4U7BA 1MDMB 3FWEA 3QPTA 4CZZA 4RGUA 3G3ZA 2GXGA 1D3YA 3K1NA 3GX4X 1KQ9A 3E5QA 3U2RA 3LQRA 3NEUA 1QO0D 2XASA 3B02A 4KIGA 4LG0A 1S7AA 4GCVA 5BQTA 3M8EA 1B9MA 4HV6A 4MTEA 4HOBA 4ZZDA 3HRTA 5FD6A 1W5TA 3WE3A 5ILUA 5AONA 1IW7F 1KU7A 3ZMDA 3FMQA 3JAMK 2Y0MA 4XLNF 3JSPA 2WTEA 1V3FA 1FYMA 1IF1A 4LFUA 1TNTA 3W6JB 3GFLA 2BV6A 4N0BA 2EJRA 4S04A 1BI3A 5LHGA 1W7PA 4AIHA 1FBQA 4EMSA 2JPBA 5LGNA 3GZ5A 4HX7A 4HQEA 3WU1B 2OD5A 3TKYA 4YFKF 3FHZA 2GA1A 3TO7A 2K86A 1TTYA 2PMHA 3I64A 1QPMA 1IXRC 3JAMZ 1P6RA 3CJNA 4P9UA 2L3DA 3ZMTA 2QBYA 1P2FA 1K7AA 2DT5A 3GFIA 3LSTA 2XKOA 3Q5FA 2XV4S 1I1GA 3Q9VA 4EJUA 3RJPA 5DCMB 1PDNC 3KP6A 3K69A 3WE2A 2H6BA 4H0EA 5HOOA 4KDPA 1BI1A 2PG4A 4BYYA 2Z33A 4JK1X 1I27A 2IP2A 2QQ9A 5H20A 5D4SA 1UCRA 3K1MA 4KMUX 5L3FA 3KP4A 2JT1A 2IJLA 2V1XA 5E8IA 4FX0A 4G9YA 2K7LA 3I59B 3PQJA 3C3WA 1F9NA 1R1VA 4BHPA 4L0YB 3M9AA 2BYVE 1KYZA 3ELKA 2GZWA 1ON1A 1BJAA 2YX4A 3U9GA 1XSDA 2ZKZA 1LJ9A 2V1UA 3K9TA 2NRAC 2EB7A 4GO1A 2HYFA 1FLIA 5E1XA 1J59A 2FSWA 1Z1DA 4LMYA 2KJBA 2F2EA 4KA4A 3F8BA 3JW4A 4FHTA 1YFHA 2OQRA 1ZGJA 3F8MA 3T0YA 3GUDA 4HYEA 5IT9K 3CUQB 4A5MA 5E17F 2O6GE 1Z05A 2W84A 1SFUA 1SAXA 3BY6A 4XLPF 2HGCA 2DO7A 1ZH5A 4HZFA 3GFMA 4JBAA 3EQLF 2VOPA 1XSVA 4UV9A 5IT9Z 5CJ9A 1S3JA 2E7WA 4EGYA 3E6MA 2STWA 2VBYA 2VBZA 2DLLA 4ZYEA 2WWYA 1G3TA 3T8TA 2HR3A 2Q8KA 5J8CA 2FA5A 1U5TB 2M5WA 3HTUA 2OZ6A 3ROUA 3HUGA 2CGPA 1EH7A 1JHFA 3RKYA 4P96A 2P5KA 4WX9A 5K1YA 3ECHA 4IRIA 3FF5A 3V8JA 5F64A 5JR3A 2IVMA 1ZLKA 1PUEE 1P4XA 3BP8A 3KLOA 2A68F 3LA2A 1LNWA 4BXUA 3P7NA 3WTVC 1SD4A 5K5QA 2Q0OA 3MZHA 1EH8A 5D8KB 3F22A 1R1UA 2RN7A 1IUYA 3NRVA 1W7PD 2P7VB 2KKOA 4L9TA 3G73A 1YIOA 1IN4A 1ON2A 4BNCA 4G7OF 2OAZA 4Y13A 1LEAA 2XGXA 3WGHA 4D0PA 2XAJA 3FXRA 4M73A 1ZGAA 3HYIA 3V7CA 2RQPA 1XCBA 3GW2A 1E2XA 4CDGA 1FC3A 1RUNA 3QP6A 3V7SA 1WRJA 4QLCU 1KQ8A 2YSRA 5K5OA 1TBXA 1U3EM 4OU0A 3R4KA 2CO5A 2V1DA 1DPUA 3M8FA 3BJOA 2AS5F 1B1BA 2MLKA 3F72A 2OZUA 1T0FA 2EFOA 2RDPA 1YLFA 3GEZA 2A6HF 2QYOA 3ABTA 3QP5A 4M71A 1TQIA 2EA4A 2QWWA 4AD9A 4R8HA 5F1RA 4TV7A 3DV8A 4ASNA 4A0YA 2YPRA 4EM1A 3WTXC 2OU2A 2W25A 5K5RA 3SHFA 2PBIA 5LLQA 1LQ1A 4HX4A 4WWCA 1B4AA 1B59A 1LDKB 1L3LA 3CUQC 3KFWX 1IRGA 3WTZA 4M6XA 2VE8A 1O7FA 1MZBA 1D5VA 5CVVA 3C7JA 3C1DA 2HFHA 4EJWA 1XGMA 5BS6A 4KIBA 1XGSA 1F5TA 2DTRA 4LJZF 2V9VA 1ZG5A 2ZMEB 1LVAA 1Z9CA 2HQNA 2J5PA 3IHUA 4ZH4F 4A6EA 2HKXA 1ZLJA 4KFCA 1OYIA 4ENJA 2ACJA 1J7KA 5HLIA 1O3SA 4IHSA 3O3KA 2ISYA 1XSXA 3V8LA 2R3SA 2P7CB 4P5OA 1IZ1A 4HF0A 3FM3A 2DW4A 4U0YA 2EFNA 4UVBA 3DF8A 3DEUA 2CWEA 3GFJA 4RGRA 5CVJA 5CLSA 1XCVA 1ZG3A 5E1WA 1O3QA 4ETSA 3HIFA 2Q2EA 3MFKA 3E6CC 3T8RA 5L3DA 3RKWA 3V4GA 1R7JA 2H6CA 4PGHA 4HDVA 3RKXA 2QENA 1AOYA 4EGZA 5FLXK 1D8JA 1LDDA 4N9IA 2VT2A 5DCFA 3T1BA 2EFQA 4Q47A 4HV5A 3IKVA 3RDIA 2ZXJA 2BBYA 5FFXA 4GYGA 4OMZA 2C6YA 4MHGA 1HSJA 5J8FA 1JGSA 4I2OA 4MQ9F 4ENKA 5JFRA 1JXSA 4G7HF 3E3VA 1WKMA 1L0OC 3L09A 4UVCA 2MLGA 3FMRA 1BOAA 3B73A 3ERED 2E7XA 2LF8A 2GA2A 4CXFA 1MKMA 3KP7A 5J6XA 3KCCA 4PCQA 1P4AA 3DPLC 5AIPA 1HKSA 3ZMUA 3DKWA 4A12A 2WC2A 2JZYA 3E5UA 1ZG1A 1K78A 4LK1F 3OV8A 2EFPA 2MA3A 3K1PA 1TNSA 2O61A 4RS8A 1D8KA 2FMLA 4Y17A 2ISZA 2QQBA 3DQVC 4KNYA 4M6YA 1MDMA 2M30A 3GXOA 3OOPA 1O3RA 2RKHA 2VC0A 2UXXA 4CICA 4HLXA 3FM5A 2OBPA 1FBSA 1NHAA 3BWGA 1FNNA 5DD8A 1J9IA 2RGVA 3R60A 1CGPA 4UV8A 1IN8A 3HHHA 1BIAA 1YYVA 1FYLA 1IXCA 2ZCWA 3HRMA 2YX7A 5FD5A 3FMSA 2RNJA 4ZYDA 2D2WA 2Y75A 4G6DA 2QUFA 2FOKA 5D6EA 4IHTA 3FXUA 4HA8A 1FWZA 2L4MA 3EETA 2JRTA 2ZO4A 1WQ2A 4M9SA 5LEJA 3E6BA 4LB5A 2K27A 3F21A 2DQRA 2VE9A 3HSFA 4NHJA 1J0RA 1TW2A 2OQGA 4B09A 1FZPB 1LDJA 4YIIA 4ESFA 1EH6A 5DD4A 2CQKA 2HS5A 1FSEA 2PJPA 1HBXG 4KYWA 1S29A 3V8KA 4G7ZF 4I7HA 2W24A 2XVCA 3KEQA 1T2KA 5DEQA 3L9FA 1F4KA 1HW1A 2ZJ2A 2KIUA 4UVAA 3L2CA 1IXSB 1XB4A 4HW0A 2QM3A 3ECOA 2XHKA 1OKRA 2RV8A 4NQWA 2BEOA 4U0WA 2Z99A 2L02A 1JHHA 2K02A 1A04A 2IT0A 4ENNA 3W6KB 5DCMA 2M8EA 4EJOA 5BOXA 5E8GA 1UHWA 3R0JA 5E20A 1B9NA 2DAOA 2ELHA 2DU9A 2VODA 1QZZA 1ZHFA 2A69F 4Y15A 1I5ZA 2KRFA 3VODA 1T39A 3MWMA 3HHGA 3ZQ7A 2STTA 2EK5A 1G3WA 3SXYA 1MD0A 1YW8A 3I59A 1YQAA 2K4JA 2ESHA 2RVCA 1X3UA 3I53A 5D5UB 5A2QK 3GF2A 1HW2A 2V79A 4XSXF 4RB3C 3EUHA 4ZYHA 1ZN2A 5TJJA 2CW0F 4FT8A 1S7OA 2IPQX 5FFZA 1GXPA 2FBKA 3FXQA 2MBFA 3E97A 3BDDA 5LBQA 3RIRA 4DQ2A 4OIOF 3RYRA 5A2QZ 1FX7A 1C0WA 3LWFA 4EM2A 3MZYA 5EEGA 3MCZA 5ERIA 2NYXA 3CUQA 5LHIA 2QVOA 3TOBA 2H09A 2QLZA 5ILSA 1FT9A 1R58A 4ZYGA 3GZ6A 1HXDA 4JQFA 3BJAA 4HDUA 2NS0A 2O0YA 2HWVA 4MEYF 1SD6A 1XGOA 4OIQF 3ML6A 3RPUA 5HS9A 2GWRA 1TQMA 3N4MA 3LA3A 3SFZA 3QPHA 2ZBKA 2EFWA 1LEBA 2HKOA 1Q1HA 3IWZA 4IF4A 1U5TA 3O2PE 1W4MA 5HDKA 3K2ZA 1Z6RA 1BBYA 2ZNZA 2PN6A 4BHBA 2IA0A 3IKTA 2FNAA 4N9HA 2DI3A 1J75A 3CDHA 1R00A 4HX8A 3IL2A 2EV0A 1KU9A 2O03A 3L00A 2P5VA 1FP1D 2ESNA 3SQNA 2NNNA 2V6CA 3EYYA 4IRGA 3KP5A 1XDUA 2D1HA 3C18A 3TOAA 3COAC 4I02A 1QNTA 2FF4A 2W85A 3D5LA 3I5UA 5D5WB 2VN2A 2J5OA 4IRHA 2Z3YA 1DPRA 5KK1A 1ZRDA 1JE8A 2P4WA 2ZFWA 4EJVA 1ODDA 1BC7C 3ZP5A 2EV6A 4RGXA 4OINF 3DP7A 5EEHA 4GXOA 2A07F 2VXZA 5L3BA 1CF7B 1H9GA 2P8TA 4L9NA 4M74A 1J5YA 3ISPA 4Q4ZF 1AWCA 1SMYF 1ZRFA 1TW3A 4U88A 5HDGA 4UUVA 3HRUA 1DDNA 4RAYA 3H3UA 1IN6A 3ULQB 5E18F 4XSZF 5FB2A 1PP7U 3E5XA 3VFZA 3GO5A 1O57A 1UFMA 5HLHA 2XKPA 1P92A 1FBUA 3TQNA 1P4WA 3KP2A 4EJTA 2MD5A 1YW9A 2KIFA 4L18B 4O3MA 3HSEA 1QGPA 1HKQA 4PGGA 2L54A 2DQLA 4BQAA 4FX4A 1BIBA 3WODF 1Z7UA 2VONA 5ICGA 2GQQA 4R1HA 4K2EA 3R61A 2MH9A 2A3SA 1YW7A 3BOQA 3IRQA 1T6SA 1XMKA 3BROA 2BE5F 1G4DA 3SZTA 2BGCA 3DXJF 4IVNA 4KT5C 5LRRA 5D6FA 3WU0A 1KU3A 1U5TC 2FE3A 2CFXA 3KZZA 2AXLA 5CYVA 2HQRA 1KGSA 4YIFA 3TO9A 3VB2A 2VBXA 5L3GA 1OPCA 5LEKA 3WTWC 2QQAA 2ZMEA 3E6DA 2HTSA 2X4HA 4O5VA 2M1BA 5ICFA 1RI7A 3F23A 1KA8A 2XIGA 1U6GA 3HRSA 1WI9A 3VEPA 1YO5C 3TDUC 1QQIA 4E70A 3F8CA 3MQ0A 3I0TA 2WV0A 2LF7A 2M45A 4LK0F 2DK8A 4YG2F 5DDGA 1USSA 3JSOA 5DUIA 2X0LA 1RZ4A 4PZJA 2CYYA 4A0XA 4QWQA 1TLHB 4ON0A 2ETHA 2NAZA 3K0LA 2PFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVR A;  5F6F A;  2LNB A;  4F7Z A;  4CHU A;  4ENM A;  3WG9 A;  5FGM A;  4UHT A;  3BPV A;  4LG0 B;  3J81 Z;  1FP2 A;  4LGW A;  4PDK A;  1KQ0 A;  4A5N A;  3CO7 C;  2O8X A;  1S8N A;  2MH2 A;  3QU6 A;  3O6B B;  1FPQ A;  1SFX A;  1ZAR A;  4HF1 A;  2JSC A;  3EYI A;  4KIF A;  4HF2 A;  4XRF A;  3F6O A;  1S6L A;  1I1S A;  5HS7 A;  1W7P B;  2L01 A;  4A2U A;  1BC8 C;  4ZZL A;  5HS8 A;  4MQV A;  1BI2 A;  3F6V A;  2A61 A;  3IWF A;  3HSR A;  3HOS A;  5BMZ A;  4I0A A;  2L4A A;  3BZ6 A;  3GWZ A;  1XD7 A;  2UWM A;  1O3T A;  2JTV A;  2QZ8 A;  1XDS A;  4KMF A;  2EV5 A;  5BPD A;  2QBY B;  2YR2 A;  5JVT A;  4U7D A;  1R36 A;  4O6J A;  3WTU C;  3M7G A;  3GYH X;  3J80 K;  3P9K A;  2IA1 A;  2XAQ A;  4RGS A;  3QAH A;  2M87 A;  3N97 A;  5CVI A;  4CO8 A;  2VT3 A;  2JPC A;  5JI6 A;  4M72 A;  2F5C A;  1V4R A;  2PLY A;  3ZMV A;  4OIP F;  1G3S A;  3ZMS A;  1XMA A;  1R5G A;  4OMY A;  4P55 A;  3IRR A;  4MNU A;  1ULY A;  3J80 Z;  3Q9S A;  5H6R A;  2EA2 A;  4XBF A;  2A5Y B;  3I4P A;  1G6N A;  3DFG A;  2B0L A;  4B8X A;  3TGN A;  5DUK A;  1IN5 A;  5ICE A;  5ICC A;  1WSU A;  5AIQ A;  4HBL A;  3WTS C;  1BM9 A;  4MTD A;  2F5E A;  4GYI A;  2O3F A;  5HVQ C;  2XRO A;  2MC3 A;  4RB2 C;  4I98 B;  1KU2 A;  2F5F A;  1UB9 A;  2R7F A;  3CLO A;  3NQO A;  2A6E F;  4I0B A;  2YU3 A;  2GXB A;  4LLL A;  2FXA A;  3KP3 A;  2DBB A;  1J2X A;  1MJB A;  2XUB A;  3PFI A;  3R0A A;  2COM A;  5ED4 A;  2RC4 A;  3LQQ A;  1F1Z A;  1VTN C;  1GXQ A;  2VOO A;  1K6O A;  2OA4 A;  2H94 A;  1FY7 A;  1RUO A;  2FNP A;  1OR7 A;  2Z9O A;  4ESJ A;  2HTJ A;  1WWX A;  3WTT C;  3R6S A;  2XRN A;  4RB0 A;  5JHU A;  3RTR A;  3QU3 A;  2EWN A;  4L9V A;  3KLN A;  4S05 A;  5H6Q A;  1RNL A;  2DK5 A;  2HOE A;  3F8F A;  4IXA A;  1LB2 A;  2R7D A;  2FMY A;  1REP C;  5D8L B;  4G6Q A;  1XN7 A;  2PI0 A;  5D5X B;  1SMT A;  5LGT A;  4WF2 A;  5DYM A;  3KET A;  3TDZ C;  5L3C A;  1FYK A;  3F8N A;  2K4B A;  1U8R A;  1GHC A;  1K79 A;  1EV7 A;  3P9C A;  3HOT A;  4G94 A;  2VC1 A;  4IPA A;  2IW5 A;  4RB1 A;  4P9F A;  2W57 A;  2UXN A;  3F3X A;  3FX3 A;  4I09 A;  3REO A;  2GIV A;  5CVU A;  2DPU A;  4WXC A;  3GVA A;  2G9W A;  1YTY A;  3WGI A;  4WXH A;  3RI4 A;  1ZYR F;  3AAF A;  3CTA A;  5HLG A;  1OYW A;  5BPI A;  2ADU A;  4UXN A;  5LRS A;  1Y0U A;  1SFE A;  5TRD A;  2LSO A;  4MGR A;  3M1E A;  2H27 A;  2HDC A;  1UST A;  4OIR F;  3I54 A;  4MEX F;  1QZY A;  3T5X A;  3ZPL A;  1YG2 A;  5ILV A;  4L5J A;  3RYP A;  1H9T A;  3ZN1 A;  1U2W A;  3S2W A;  3VOE A;  3FZV A;  2HEO A;  4G8X A;  2Z5U A;  4BH9 A;  1DP7 P;  4A6D A;  3D0S A;  2NNY A;  3LFK A;  1R22 A;  2G7H A;  3QRF F;  2XAF A;  4LB6 B;  4ESB A;  1STZ A;  3ZN0 A;  4AIJ A;  3ABU A;  4L0Z B;  4M9Z A;  1YS6 A;  4HLY A;  2XAG A;  4AVP A;  4YFN F;  1Z91 A;  3P9I A;  5LGU A;  2VBW A;  3JTH A;  4I01 A;  1FSH A;  2FU4 A;  2D1V A;  2KJC A;  1ZRE A;  3GLX A;  4KN7 X;  3PQK A;  4WK8 F;  4BHC A;  3I58 A;  2FBH A;  4CGZ A;  4AWX B;  2CG4 A;  5FO5 A;  3J7A O;  1E17 A;  2DFI A;  1MJA A;  3LAP A;  2D45 A;  2GAU A;  4L9J A;  4AIK A;  1I6X A;  5LHH A;  4L5I A;  2Y48 A;  3L7W A;  2CSO A;  1HW5 A;  1UHM A;  1R1T A;  4EQQ A;  6PAX A;  5E1Z B;  2UZK A;  1DUX C;  4LD5 A;  4R79 A;  2XAH A;  1IAW A;  2LKP A;  1SD5 A;  1YS7 A;  1BI0 A;  1IN7 A;  2LDU A;  4IJA A;  3V7R A;  2IRF G;  1QBJ A;  1XGN A;  4Q48 A;  2PQ8 A;  5D4R A;  4KUM A;  1HKT A;  4NB5 A;  2FBI A;  5DV5 A;  3BJ6 A;  3KZY A;  1CF7 A;  2E1C A;  3EDP A;  3RPQ A;  3SZP A;  1ZRC A;  4LLN A;  1SD7 A;  4OOI A;  1MJ9 A;  1ONV A;  3HTS B;  3LA7 A;  4GGG A;  3BPX A;  2P6T A;  5HDN A;  5D5V B;  2TDX A;  1ZAO A;  1R23 A;  2F5D A;  2G7U A;  4EV0 A;  2IA2 A;  1RIO H;  2FRH A;  4Z2Y A;  4EM0 B;  1FOK A;  1IRF A;  4A0Z A;  1OYY A;  4HQM A;  4WXD A;  3IC7 A;  4DNC A;  1O7L A;  1Z6T A;  2P5L C;  1T38 A;  3JTG A;  3WGG A;  1W5S A;  4KIC A;  2KIM A;  1MGT A;  5KVR A;  3MAJ A;  1H0M A;  4YFX F;  2PEX A;  3LAJ A;  1B6A A;  1G3Y A;  4EVI A;  1TQP A;  3DPT A;  1HQC A;  2HZT A;  4M9X A;  2FEZ A;  1BN5 A;  1OMI A;  3KEO A;  4BAY A;  4KN4 X;  3J81 K;  5L3E A;  3TO6 A;  4CYD A;  4HAM A;  1R5H A;  4WCG A;  3U1D A;  3KE2 A;  4RAZ A;  2P6S A;  3ZMZ A;  3I71 A;  1PP8 F;  2HYG D;  4U0V A;  3H3Z A;  3CUO A;  1T98 A;  1KYW A;  2DPD A;  2E1N A;  2FQ3 A;  4LLG F;  5IT3 A;  3CO6 C;  2ZNY A;  1K78 B;  1HST A;  1U78 A;  3H92 A;  1GVJ A;  3WTY C;  4UNO A;  4Q5S F;  2PMU A;  5FLX Z;  3MEX A;  3QOP A;  4U7B A;  1MDM B;  3FWE A;  3QPT A;  4CZZ A;  4RGU A;  3G3Z A;  2GXG A;  1D3Y A;  3K1N A;  3GX4 X;  1KQ9 A;  3E5Q A;  3U2R A;  3LQR A;  3NEU A;  1QO0 D;  2XAS A;  3B02 A;  4KIG A;  4LG0 A;  1S7A A;  4GCV A;  5BQT A;  3M8E A;  1B9M A;  4HV6 A;  4MTE A;  4HOB A;  4ZZD A;  3HRT A;  5FD6 A;  1W5T A;  3WE3 A;  5ILU A;  5AON A;  1IW7 F;  1KU7 A;  3ZMD A;  3FMQ A;  3JAM K;  2Y0M A;  4XLN F;  3JSP A;  2WTE A;  1V3F A;  1FYM A;  1IF1 A;  4LFU A;  1TNT A;  3W6J B;  3GFL A;  2BV6 A;  4N0B A;  2EJR A;  4S04 A;  1BI3 A;  5LHG A;  1W7P A;  4AIH A;  1FBQ A;  4EMS A;  2JPB A;  5LGN A;  3GZ5 A;  4HX7 A;  4HQE A;  3WU1 B;  2OD5 A;  3TKY A;  4YFK F;  3FHZ A;  2GA1 A;  3TO7 A;  2K86 A;  1TTY A;  2PMH A;  3I64 A;  1QPM A;  1IXR C;  3JAM Z;  1P6R A;  3CJN A;  4P9U A;  2L3D A;  3ZMT A;  2QBY A;  1P2F A;  1K7A A;  2DT5 A;  3GFI A;  3LST A;  2XKO A;  3Q5F A;  2XV4 S;  1I1G A;  3Q9V A;  4EJU A;  3RJP A;  5DCM B;  1PDN C;  3KP6 A;  3K69 A;  3WE2 A;  2H6B A;  4H0E A;  5HOO A;  4KDP A;  1BI1 A;  2PG4 A;  4BYY A;  2Z33 A;  4JK1 X;  1I27 A;  2IP2 A;  2QQ9 A;  5H20 A;  5D4S A;  1UCR A;  3K1M A;  4KMU X;  5L3F A;  3KP4 A;  2JT1 A;  2IJL A;  2V1X A;  5E8I A;  4FX0 A;  4G9Y A;  2K7L A;  3I59 B;  3PQJ A;  3C3W A;  1F9N A;  1R1V A;  4BHP A;  4L0Y B;  3M9A A;  2BYV E;  1KYZ A;  3ELK A;  2GZW A;  1ON1 A;  1BJA A;  2YX4 A;  3U9G A;  1XSD A;  2ZKZ A;  1LJ9 A;  2V1U A;  3K9T A;  2NRA C;  2EB7 A;  4GO1 A;  2HYF A;  1FLI A;  5E1X A;  1J59 A;  2FSW A;  1Z1D A;  4LMY A;  2KJB A;  2F2E A;  4KA4 A;  3F8B A;  3JW4 A;  4FHT A;  1YFH A;  2OQR A;  1ZGJ A;  3F8M A;  3T0Y A;  3GUD A;  4HYE A;  5IT9 K;  3CUQ B;  4A5M A;  5E17 F;  2O6G E;  1Z05 A;  2W84 A;  1SFU A;  1SAX A;  3BY6 A;  4XLP F;  2HGC A;  2DO7 A;  1ZH5 A;  4HZF A;  3GFM A;  4JBA A;  3EQL F;  2VOP A;  1XSV A;  4UV9 A;  5IT9 Z;  5CJ9 A;  1S3J A;  2E7W A;  4EGY A;  3E6M A;  2STW A;  2VBY A;  2VBZ A;  2DLL A;  4ZYE A;  2WWY A;  1G3T A;  3T8T A;  2HR3 A;  2Q8K A;  5J8C A;  2FA5 A;  1U5T B;  2M5W A;  3HTU A;  2OZ6 A;  3ROU A;  3HUG A;  2CGP A;  1EH7 A;  1JHF A;  3RKY A;  4P96 A;  2P5K A;  4WX9 A;  5K1Y A;  3ECH A;  4IRI A;  3FF5 A;  3V8J A;  5F64 A;  5JR3 A;  2IVM A;  1ZLK A;  1PUE E;  1P4X A;  3BP8 A;  3KLO A;  2A68 F;  3LA2 A;  1LNW A;  4BXU A;  3P7N A;  3WTV C;  1SD4 A;  5K5Q A;  2Q0O A;  3MZH A;  1EH8 A;  5D8K B;  3F22 A;  1R1U A;  2RN7 A;  1IUY A;  3NRV A;  1W7P D;  2P7V B;  2KKO A;  4L9T A;  3G73 A;  1YIO A;  1IN4 A;  1ON2 A;  4BNC A;  4G7O F;  2OAZ A;  4Y13 A;  1LEA A;  2XGX A;  3WGH A;  4D0P A;  2XAJ A;  3FXR A;  4M73 A;  1ZGA A;  3HYI A;  3V7C A;  2RQP A;  1XCB A;  3GW2 A;  1E2X A;  4CDG A;  1FC3 A;  1RUN A;  3QP6 A;  3V7S A;  1WRJ A;  4QLC U;  1KQ8 A;  2YSR A;  5K5O A;  1TBX A;  1U3E M;  4OU0 A;  3R4K A;  2CO5 A;  2V1D A;  1DPU A;  3M8F A;  3BJO A;  2AS5 F;  1B1B A;  2MLK A;  3F72 A;  2OZU A;  1T0F A;  2EFO A;  2RDP A;  1YLF A;  3GEZ A;  2A6H F;  2QYO A;  3ABT A;  3QP5 A;  4M71 A;  1TQI A;  2EA4 A;  2QWW A;  4AD9 A;  4R8H A;  5F1R A;  4TV7 A;  3DV8 A;  4ASN A;  4A0Y A;  2YPR A;  4EM1 A;  3WTX C;  2OU2 A;  2W25 A;  5K5R A;  3SHF A;  2PBI A;  5LLQ A;  1LQ1 A;  4HX4 A;  4WWC A;  1B4A A;  1B59 A;  1LDK B;  1L3L A;  3CUQ C;  3KFW X;  1IRG A;  3WTZ A;  4M6X A;  2VE8 A;  1O7F A;  1MZB A;  1D5V A;  5CVV A;  3C7J A;  3C1D A;  2HFH A;  4EJW A;  1XGM A;  5BS6 A;  4KIB A;  1XGS A;  1F5T A;  2DTR A;  4LJZ F;  2V9V A;  1ZG5 A;  2ZME B;  1LVA A;  1Z9C A;  2HQN A;  2J5P A;  3IHU A;  4ZH4 F;  4A6E A;  2HKX A;  1ZLJ A;  4KFC A;  1OYI A;  4ENJ A;  2ACJ A;  1J7K A;  5HLI A;  1O3S A;  4IHS A;  3O3K A;  2ISY A;  1XSX A;  3V8L A;  2R3S A;  2P7C B;  4P5O A;  1IZ1 A;  4HF0 A;  3FM3 A;  2DW4 A;  4U0Y A;  2EFN A;  4UVB A;  3DF8 A;  3DEU A;  2CWE A;  3GFJ A;  4RGR A;  5CVJ A;  5CLS A;  1XCV A;  1ZG3 A;  5E1W A;  1O3Q A;  4ETS A;  3HIF A;  2Q2E A;  3MFK A;  3E6C C;  3T8R A;  5L3D A;  3RKW A;  3V4G A;  1R7J A;  2H6C A;  4PGH A;  4HDV A;  3RKX A;  2QEN A;  1AOY A;  4EGZ A;  5FLX K;  1D8J A;  1LDD A;  4N9I A;  2VT2 A;  5DCF A;  3T1B A;  2EFQ A;  4Q47 A;  4HV5 A;  3IKV A;  3RDI A;  2ZXJ A;  2BBY A;  5FFX A;  4GYG A;  4OMZ A;  2C6Y A;  4MHG A;  1HSJ A;  5J8F A;  1JGS A;  4I2O A;  4MQ9 F;  4ENK A;  5JFR A;  1JXS A;  4G7H F;  3E3V A;  1WKM A;  1L0O C;  3L09 A;  4UVC A;  2MLG A;  3FMR A;  1BOA A;  3B73 A;  3ERE D;  2E7X A;  2LF8 A;  2GA2 A;  4CXF A;  1MKM A;  3KP7 A;  5J6X A;  3KCC A;  4PCQ A;  1P4A A;  3DPL C;  5AIP A;  1HKS A;  3ZMU A;  3DKW A;  4A12 A;  2WC2 A;  2JZY A;  3E5U A;  1ZG1 A;  1K78 A;  4LK1 F;  3OV8 A;  2EFP A;  2MA3 A;  3K1P A;  1TNS A;  2O61 A;  4RS8 A;  1D8K A;  2FML A;  4Y17 A;  2ISZ A;  2QQB A;  3DQV C;  4KNY A;  4M6Y A;  1MDM A;  2M30 A;  3GXO A;  3OOP A;  1O3R A;  2RKH A;  2VC0 A;  2UXX A;  4CIC A;  4HLX A;  3FM5 A;  2OBP A;  1FBS A;  1NHA A;  3BWG A;  1FNN A;  5DD8 A;  1J9I A;  2RGV A;  3R60 A;  1CGP A;  4UV8 A;  1IN8 A;  3HHH A;  1BIA A;  1YYV A;  1FYL A;  1IXC A;  2ZCW A;  3HRM A;  2YX7 A;  5FD5 A;  3FMS A;  2RNJ A;  4ZYD A;  2D2W A;  2Y75 A;  4G6D A;  2QUF A;  2FOK A;  5D6E A;  4IHT A;  3FXU A;  4HA8 A;  1FWZ A;  2L4M A;  3EET A;  2JRT A;  2ZO4 A;  1WQ2 A;  4M9S A;  5LEJ A;  3E6B A;  4LB5 A;  2K27 A;  3F21 A;  2DQR A;  2VE9 A;  3HSF A;  4NHJ A;  1J0R A;  1TW2 A;  2OQG A;  4B09 A;  1FZP B;  1LDJ A;  4YII A;  4ESF A;  1EH6 A;  5DD4 A;  2CQK A;  2HS5 A;  1FSE A;  2PJP A;  1HBX G;  4KYW A;  1S29 A;  3V8K A;  4G7Z F;  4I7H A;  2W24 A;  2XVC A;  3KEQ A;  1T2K A;  5DEQ A;  3L9F A;  1F4K A;  1HW1 A;  2ZJ2 A;  2KIU A;  4UVA A;  3L2C A;  1IXS B;  1XB4 A;  4HW0 A;  2QM3 A;  3ECO A;  2XHK A;  1OKR A;  2RV8 A;  4NQW A;  2BEO A;  4U0W A;  2Z99 A;  2L02 A;  1JHH A;  2K02 A;  1A04 A;  2IT0 A;  4ENN A;  3W6K B;  5DCM A;  2M8E A;  4EJO A;  5BOX A;  5E8G A;  1UHW A;  3R0J A;  5E20 A;  1B9N A;  2DAO A;  2ELH A;  2DU9 A;  2VOD A;  1QZZ A;  1ZHF A;  2A69 F;  4Y15 A;  1I5Z A;  2KRF A;  3VOD A;  1T39 A;  3MWM A;  3HHG A;  3ZQ7 A;  2STT A;  2EK5 A;  1G3W A;  3SXY A;  1MD0 A;  1YW8 A;  3I59 A;  1YQA A;  2K4J A;  2ESH A;  2RVC A;  1X3U A;  3I53 A;  5D5U B;  5A2Q K;  3GF2 A;  1HW2 A;  2V79 A;  4XSX F;  4RB3 C;  3EUH A;  4ZYH A;  1ZN2 A;  5TJJ A;  2CW0 F;  4FT8 A;  1S7O A;  2IPQ X;  5FFZ A;  1GXP A;  2FBK A;  3FXQ A;  2MBF A;  3E97 A;  3BDD A;  5LBQ A;  3RIR A;  4DQ2 A;  4OIO F;  3RYR A;  5A2Q Z;  1FX7 A;  1C0W A;  3LWF A;  4EM2 A;  3MZY A;  5EEG A;  3MCZ A;  5ERI A;  2NYX A;  3CUQ A;  5LHI A;  2QVO A;  3TOB A;  2H09 A;  2QLZ A;  5ILS A;  1FT9 A;  1R58 A;  4ZYG A;  3GZ6 A;  1HXD A;  4JQF A;  3BJA A;  4HDU A;  2NS0 A;  2O0Y A;  2HWV A;  4MEY F;  1SD6 A;  1XGO A;  4OIQ F;  3ML6 A;  3RPU A;  5HS9 A;  2GWR A;  1TQM A;  3N4M A;  3LA3 A;  3SFZ A;  3QPH A;  2ZBK A;  2EFW A;  1LEB A;  2HKO A;  1Q1H A;  3IWZ A;  4IF4 A;  1U5T A;  3O2P E;  1W4M A;  5HDK A;  3K2Z A;  1Z6R A;  1BBY A;  2ZNZ A;  2PN6 A;  4BHB A;  2IA0 A;  3IKT A;  2FNA A;  4N9H A;  2DI3 A;  1J75 A;  3CDH A;  1R00 A;  4HX8 A;  3IL2 A;  2EV0 A;  1KU9 A;  2O03 A;  3L00 A;  2P5V A;  1FP1 D;  2ESN A;  3SQN A;  2NNN A;  2V6C A;  3EYY A;  4IRG A;  3KP5 A;  1XDU A;  2D1H A;  3C18 A;  3TOA A;  3COA C;  4I02 A;  1QNT A;  2FF4 A;  2W85 A;  3D5L A;  3I5U A;  5D5W B;  2VN2 A;  2J5O A;  4IRH A;  2Z3Y A;  1DPR A;  5KK1 A;  1ZRD A;  1JE8 A;  2P4W A;  2ZFW A;  4EJV A;  1ODD A;  1BC7 C;  3ZP5 A;  2EV6 A;  4RGX A;  4OIN F;  3DP7 A;  5EEH A;  4GXO A;  2A07 F;  2VXZ A;  5L3B A;  1CF7 B;  1H9G A;  2P8T A;  4L9N A;  4M74 A;  1J5Y A;  3ISP A;  4Q4Z F;  1AWC A;  1SMY F;  1ZRF A;  1TW3 A;  4U88 A;  5HDG A;  4UUV A;  3HRU A;  1DDN A;  4RAY A;  3H3U A;  1IN6 A;  3ULQ B;  5E18 F;  4XSZ F;  5FB2 A;  1PP7 U;  3E5X A;  3VFZ A;  3GO5 A;  1O57 A;  1UFM A;  5HLH A;  2XKP A;  1P92 A;  1FBU A;  3TQN A;  1P4W A;  3KP2 A;  4EJT A;  2MD5 A;  1YW9 A;  2KIF A;  4L18 B;  4O3M A;  3HSE A;  1QGP A;  1HKQ A;  4PGG A;  2L54 A;  2DQL A;  4BQA A;  4FX4 A;  1BIB A;  3WOD F;  1Z7U A;  2VON A;  5ICG A;  2GQQ A;  4R1H A;  4K2E A;  3R61 A;  2MH9 A;  2A3S A;  1YW7 A;  3BOQ A;  3IRQ A;  1T6S A;  1XMK A;  3BRO A;  2BE5 F;  1G4D A;  3SZT A;  2BGC A;  3DXJ F;  4IVN A;  4KT5 C;  5LRR A;  5D6F A;  3WU0 A;  1KU3 A;  1U5T C;  2FE3 A;  2CFX A;  3KZZ A;  2AXL A;  5CYV A;  2HQR A;  1KGS A;  4YIF A;  3TO9 A;  3VB2 A;  2VBX A;  5L3G A;  1OPC A;  5LEK A;  3WTW C;  2QQA A;  2ZME A;  3E6D A;  2HTS A;  2X4H A;  4O5V A;  2M1B A;  5ICF A;  1RI7 A;  3F23 A;  1KA8 A;  2XIG A;  1U6G A;  3HRS A;  1WI9 A;  3VEP A;  1YO5 C;  3TDU C;  1QQI A;  4E70 A;  3F8C A;  3MQ0 A;  3I0T A;  2WV0 A;  2LF7 A;  2M45 A;  4LK0 F;  2DK8 A;  4YG2 F;  5DDG A;  1USS A;  3JSO A;  5DUI A;  2X0L A;  1RZ4 A;  4PZJ A;  2CYY A;  4A0X A;  4QWQ A;  1TLH B;  4ON0 A;  2ETH A;  2NAZ A;  3K0L A;  2PFB A; 
#chains in the Genus database with same CATH topology
 2HOT A;  1OCR H;  5CVR A;  2QGU A;  5F6F A;  1WJC A;  1VQ6 I;  4NC7 A;  2LNB A;  3DLL F;  4F7Z A;  4CHU A;  4ENM A;  3WG9 A;  1FOY A;  3IH4 A;  1JGG A;  5FGM A;  3W2W A;  4UHT A;  3BG7 A;  1ZEL A;  3VYR B;  4AYB N;  3BPV A;  3OR2 C;  2LR8 A;  2OJE D;  3RPU D;  4LG0 B;  1Z77 A;  2WY7 Q;  3VYU B;  1ENH A;  3HGG A;  3J81 Z;  1FP2 A;  4IL6 C;  1MW7 A;  4LGW A;  5F04 A;  2L7M P;  4PDK A;  1KQ0 A;  4A5N A;  3CO7 C;  1JT6 A;  2O8X A;  1S8N A;  2MH2 A;  4QTR A;  3QU6 A;  4XRS G;  3S15 J;  2E34 A;  3IUO A;  3O6B B;  1FPQ A;  1SFX A;  1ZAR A;  4HF1 A;  3PM1 A;  3OYE A;  2JSC A;  2DYR H;  2DFF A;  5KHD A;  3EYI A;  5IYD J;  4KIF A;  1VQ7 I;  4HF2 A;  4BQQ A;  5JLX A;  1IUF A;  1JI8 A;  5EDN A;  4XRF A;  4CCJ A;  3F6O A;  3SZG A;  1S6L A;  3RQ4 A;  1I1S A;  5F27 A;  1D5Y A;  5HS7 A;  1K83 J;  1W7P B;  4FAS D;  1E0E A;  2L01 A;  2EZH A;  4IQJ A;  4A2U A;  1BC8 C;  4ZZL A;  5HS8 A;  4MQV A;  1W5C C;  4YRV A;  3NAU A;  3WG7 H;  1ZGW A;  1BI2 A;  1VQL I;  3F6V A;  2B9S A;  2R5Y B;  4IQ4 A;  1Y1W J;  2JUC A;  1YIT I;  4PK4 A;  2NXN B;  2A61 A;  2I5U A;  3IWF A;  4J01 A;  3HSR A;  3HOS A;  5BMZ A;  2QKM B;  4A3G J;  3BLY A;  2B7E A;  2L4A A;  4I0A A;  3G1M A;  3BZ6 A;  3GWZ A;  1XD7 A;  2UWM A;  3SDG A;  1O3T A;  3TP3 A;  2M34 A;  4F55 A;  3OYH A;  2JTV A;  2QZ8 A;  1XDS A;  4KMF A;  2WV1 A;  2EV5 A;  3CF5 F;  5BPD A;  2QBY B;  1NTC A;  2ICW G;  2YR2 A;  5EZH A;  2M4G A;  2XB0 X;  5JVT A;  4PSW A;  2KMU A;  3M07 A;  5EEA A;  4U7D A;  1R36 A;  4BE1 A;  3SEZ A;  2DT6 A;  1TWA J;  2E2J J;  1TZL A;  4O6J A;  3K4L A;  3WTU C;  1MBJ A;  3M7G A;  1HA8 A;  3GYH X;  2K40 A;  3OR1 C;  3BR1 A;  1YRN B;  3FKI J;  3J80 K;  3HB9 A;  3P9K A;  1TL8 A;  3F0C A;  3K4M A;  1ETV A;  2IA1 A;  4MFD A;  2XAQ A;  1RC9 A;  1UG0 A;  4RGS A;  2JVG A;  3QAH A;  2M87 A;  3N97 A;  4RLQ A;  3A02 A;  5CVI A;  4CO8 A;  1SC7 A;  4BS9 A;  2NVU B;  2LP0 A;  2VT3 A;  4A3L J;  2JPC A;  2LBF A;  2DMP A;  4M72 A;  5JI6 A;  2F5C A;  1V4R A;  1EJ9 A;  3ZMV A;  2PLY A;  4OIP F;  2IS1 A;  2FJ1 A;  1G3S A;  4RAG A;  3ZMS A;  1XMA A;  1R5G A;  4OMY A;  4A3B J;  4RA2 A;  3BG9 A;  4P55 A;  3IRR A;  2I8D A;  3PO2 J;  4MNU A;  2R7X A;  1MH4 A;  1YI2 I;  1ULY A;  3CMM A;  3J80 Z;  1RR7 A;  3Q9S A;  5H6R A;  2EA2 A;  1F36 A;  4XBF A;  3JRF A;  3L2R A;  5M3F J;  3VSK A;  2A5Y B;  1YIJ I;  1ETQ A;  3I4P A;  1G6N A;  3DFG A;  1QA6 A;  2B0L A;  4BDZ A;  2CQN A;  4B8X A;  3TGN A;  3ZOB A;  5DUK A;  2KQR A;  1IN5 A;  2GXA A;  1IO2 A;  5ICE A;  5ICC A;  3BZK A;  1WSU A;  2ID6 A;  5AIQ A;  2D5V A;  3DEW A;  5F1J A;  4HBL A;  3WTS C;  1BM9 A;  2WB1 A;  4MTD A;  2F5E A;  2O5R A;  4GYI A;  1E3O C;  3MZ8 A;  4AYB A;  2O3F A;  2GIZ A;  3A0B C;  1W0U A;  5HVQ C;  4LIV A;  2XRO A;  2DDA A;  4DZJ A;  1I50 J;  4DBQ A;  2MC3 A;  4RB2 C;  4I98 B;  1KU2 A;  2F5F A;  2ID3 A;  2EQR A;  2F48 A;  5IP7 J;  3ASO H;  3S14 J;  3I4M J;  1UB9 A;  1IG7 A;  1TC3 C;  4M6V A;  3G1O A;  2R7F A;  2KPM A;  3CLO A;  2CV1 A;  2MSY A;  4IHV A;  3NQO A;  4CYC A;  2A6E F;  4I0B A;  4UUS A;  3CJT B;  3K4N A;  2YU3 A;  1VZ0 A;  2GXB A;  4LLL A;  2FXA A;  3KP3 A;  1W36 D;  1FOX A;  3S16 J;  4AC0 A;  1YE9 A;  4EAT A;  1R5I D;  2DBB A;  1J2X A;  1NK2 P;  2CMP A;  1MJB A;  2XUB A;  3PFI A;  3R0A A;  2COM A;  2M7B A;  2UUZ A;  4HPQ A;  2R92 J;  1WJ5 A;  1Q1V A;  1EA3 A;  5EGO A;  5ED4 A;  2RC4 A;  2M8G X;  3LQQ A;  1MMA A;  1F1Z A;  2PMZ N;  1VTN C;  1GXQ A;  1X1D A;  2VOO A;  1K6O A;  2OA4 A;  2E5N A;  2H94 A;  1FY7 A;  1A6I A;  1RUO A;  2FNP A;  1IV6 A;  1OR7 A;  2Z9O A;  5B1B H;  4ESJ A;  2HTJ A;  1LE8 A;  1I3Q J;  4BAC A;  1WWX A;  3WTT C;  3PSF A;  3R6S A;  3M8J A;  1S72 I;  2XRN A;  4BBR J;  4RB0 A;  5J1U A;  5JHU A;  1HF0 A;  3RTR A;  1GUU A;  3QU3 A;  2IS6 A;  1B72 A;  4XN3 A;  2EWN A;  4L9V A;  1P7I A;  3KLN A;  4S05 A;  2EH3 A;  5FKN A;  5H6Q A;  2CQX A;  1FIA A;  4E7Z A;  1RNL A;  2DK5 A;  1QHG A;  2HOE A;  2GOM A;  3A01 B;  1APL C;  1FTT A;  1LFP A;  3F8F A;  4IXA A;  4IX7 A;  4C2M J;  2CFO A;  1LB2 A;  4L5E A;  2R7D A;  1AKH A;  3OYN A;  2FMY A;  1REP C;  5J47 A;  2CV2 A;  5D8L B;  1JUP A;  2XF5 A;  3HUG B;  2L7Z A;  4G6Q A;  1XN7 A;  3FXJ A;  2PI0 A;  5D5X B;  2NVT J;  1SMT A;  3HJE A;  5LGT A;  4H4K C;  2NS7 A;  4WF2 A;  4XLF A;  1YOV B;  5DYM A;  3MKL A;  3KET A;  3TDZ C;  5L3C A;  1FYK A;  3F8N A;  5DS9 A;  2K4B A;  1U8R A;  1GHC A;  3OY9 A;  1K79 A;  1EV7 A;  1WGX A;  3P9C A;  2X6W A;  3HOT A;  3GME A;  4G94 A;  1OLT A;  2VC1 A;  4ABZ A;  2CUE A;  4IPA A;  2IW5 A;  4RB1 A;  4P9F A;  2W57 A;  2UXN A;  3F3X A;  3FX3 A;  4I09 A;  3REO A;  2DXI A;  2GIV A;  1A35 A;  3AKZ A;  5CVU A;  2ECB A;  4WXC A;  2DPU A;  2R7R A;  3GVA A;  2Z1D A;  4UUT A;  3MVP A;  4Y33 A;  2VLA A;  2G9W A;  1YTY A;  2R7V A;  3WGI A;  4WXH A;  3RI4 A;  1EKE A;  1ZYR F;  4XLE A;  2KHM A;  3AAF A;  3CTA A;  5HLG A;  2DFH A;  1OYW A;  3SEQ A;  5BPI A;  2ADU A;  3OSG A;  2H8W A;  4UXN A;  2X1D A;  3DKX A;  2Z2S B;  3HC7 A;  5LRS A;  1Y0U A;  1SFE A;  5TRD A;  1CQT A;  2LSO A;  3OIQ A;  4MGR A;  4XN0 A;  3M1E A;  3K4K A;  2CJJ A;  1QVU A;  2AXT C;  3AFH A;  4CCN A;  2H27 A;  2HDC A;  1UST A;  3BTJ A;  3OS2 A;  1E3P A;  2LY9 A;  4OIR F;  1PUF A;  4BJT A;  2RAE A;  3I54 A;  4MEX F;  3LSK A;  1QZY A;  3DEE A;  3T5X A;  3CDI A;  3ZPL A;  1YG2 A;  3MD2 A;  1ERD A;  2EPF A;  5ILV A;  4LOC A;  3JRA A;  1GV2 A;  4L5J A;  3RYP A;  3BTL A;  1JJ6 C;  1XX5 A;  3S3N A;  1H9T A;  3ZN1 A;  3BT9 A;  1J09 A;  3OL3 A;  1BOB A;  4HRI A;  1U2W A;  3PUF A;  3S2W A;  3VOE A;  2BY2 A;  3FZV A;  4RBO A;  2HOA A;  2HEO A;  1WJA A;  1Z21 A;  4G8X A;  2Z5U A;  1V5F A;  4BH9 A;  4NDL A;  1HLV A;  1DP7 P;  1GV5 A;  3OYK A;  4A6D A;  3D0S A;  1ETK A;  1WJB A;  3OYC A;  2NNY A;  3LFK A;  1R4N B;  1R22 A;  2OCE A;  2JMW A;  2JA5 J;  4HNV A;  2ME6 A;  2G7H A;  3QRF F;  2XAF A;  5EG0 B;  4LB6 B;  4ESB A;  1STZ A;  3ZN0 A;  4AIJ A;  3ABU A;  3PIP F;  2NS8 A;  2OCC H;  3AG4 H;  4L0Z B;  4M9Z A;  1YS6 A;  3OYA A;  1VFC A;  3LSM A;  4HLY A;  2XAG A;  2XF7 A;  3L2V A;  4AVP A;  2PJR B;  4YFN F;  1Z91 A;  2LK2 A;  4RLF A;  2AHQ A;  1Z0X A;  3P9I A;  3O8G A;  4PJM A;  4UY8 I;  5LGU A;  1MMS A;  2VBW A;  3JTH A;  2Y9Z A;  4B3A A;  4I01 A;  4AVZ A;  2EIL H;  1FSH A;  2FU4 A;  4B43 A;  2OF7 A;  2D1V A;  2KJC A;  3BG6 A;  1ZRE A;  3CCV I;  3ABL H;  3GLX A;  4KN7 X;  2IEK A;  1FMV A;  3PQK A;  4V2F A;  4BHC A;  4WK8 F;  1NK3 P;  3I58 A;  2DMQ A;  2FBH A;  4CGZ A;  3CCR I;  2LYC A;  3AL0 B;  1MBE A;  3L2W A;  4AWX B;  2CG4 A;  5GPA A;  2ZXI A;  4FQG A;  4BJ6 C;  5FO5 A;  2DMN A;  3J7A O;  1E17 A;  2DFI A;  3LOC A;  2R7T A;  1MJA A;  3LAP A;  2VAS A;  2D45 A;  2GAU A;  4M3F A;  4L9J A;  3SFI A;  4AIK A;  1I6X A;  4BU2 A;  1VQ4 I;  1WH7 A;  5LHH A;  4L5I A;  2Y48 A;  3DU5 A;  3L7W A;  2CSO A;  3JRH A;  1HW5 A;  1UHM A;  4XOR A;  2IGK A;  1R1T A;  4EQQ A;  2YUS A;  3BTC A;  6PAX A;  2K9S A;  5E1Z B;  2UZK A;  1MBG A;  4ZC3 A;  1DUX C;  4LD5 A;  3CCM I;  2BW3 B;  4XKB A;  2R7S A;  2K9L A;  4R79 A;  4XMY A;  2XAH A;  2DA7 A;  2K5C A;  5FRM A;  1IAW A;  1HC8 A;  2LKP A;  1SD5 A;  4N4O B;  3BR3 A;  1JKO C;  3PJR A;  1YS7 A;  4B3X A;  1RPW A;  1WFX A;  5E3L A;  5KNL A;  5H2F C;  1BI0 A;  1HOM A;  3SDB A;  1IN7 A;  1SVO A;  1R4M B;  2LDU A;  5FJ8 J;  4IJA A;  3V7R A;  1MBF A;  2IRF G;  1QBJ A;  1XGN A;  2LTP A;  1OCC H;  2PQ8 A;  4MO7 A;  4Q48 A;  5D4R A;  3GTM J;  4KUM A;  4XNF A;  3UNG C;  1R49 A;  2CQQ A;  2P0W A;  1HKT A;  4NB5 A;  2FBI A;  5DV5 A;  1R6R A;  3BR0 A;  2XAU A;  4BXF A;  3BJ6 A;  3KZY A;  1KZH A;  4XRS A;  1CF7 A;  2E1C A;  4Y3O A;  1Y1V J;  2Y31 A;  3EDP A;  4F93 B;  3I56 I;  3RPQ A;  4P1W A;  3SZP A;  1ZRC A;  2ELJ A;  3OYF A;  3FIS A;  4LLN A;  4BE0 A;  1SD7 A;  4OOI A;  2L7K A;  5GTI C;  1MJ9 A;  1ONV A;  3HTS B;  1VQP I;  3LA7 A;  4GGG A;  3BPX A;  1LKX A;  3LL7 A;  3HDD A;  2P6T A;  3K70 C;  5HDN A;  5D5V B;  1UZC A;  2HPI A;  1S7E A;  2TDX A;  1ZAO A;  1R23 A;  2LKS A;  2F5D A;  2G7U A;  2ZC2 A;  4EV0 A;  3DWL E;  2IA2 A;  2HVR A;  1RKW A;  2BY0 A;  1RIO H;  4XLH A;  1A6Q A;  1MNM C;  4BY7 J;  3N05 A;  2FRH A;  5EZG A;  4Z2Y A;  4CA0 A;  4EM0 B;  1FOK A;  4JX5 A;  4CH7 A;  1IRF A;  2V9K A;  4A0Z A;  3LSP A;  2E36 A;  1OYY A;  4XID A;  2K9Q A;  4CZC A;  4HQM A;  4WXD A;  4C9Y A;  2MYS A;  3IC7 A;  4DNC A;  3CP2 A;  1O7L A;  2VB6 A;  1U8B A;  4CCO A;  1Z6T A;  2P5L C;  2DA4 A;  1T38 A;  3JTG A;  2IGN A;  1UAA A;  3WHC A;  3WGG A;  2EIK H;  5HNF A;  1W5S A;  1D0X A;  4KIC A;  2JJ7 A;  2KIM A;  1MGT A;  2EIN H;  2OTL I;  5KVR A;  2JA6 J;  3MAJ A;  1H0M A;  4YFX F;  4HST A;  2PEX A;  2W00 A;  3LAJ A;  2HI3 A;  1B6A A;  1G3Y A;  2O7O A;  4EVI A;  4A3F J;  1TQP A;  2R7U A;  1ZR2 A;  3DPT A;  1TWF J;  1HQC A;  3AG2 H;  4XOP A;  4BEH B;  3RZD J;  2HZT A;  1ETW A;  3J7Z I;  3HPH A;  4M9X A;  2FEZ A;  1VND A;  5FRO A;  2VPR A;  2M4K A;  4XLC A;  1BN5 A;  1GLN A;  3HOY J;  1OMI A;  3KEO A;  1I3A A;  2DFE A;  4BAY A;  4KN4 X;  3J81 K;  5L3E A;  3ZQG A;  3TO6 A;  4CYD A;  1GT0 C;  4HAM A;  1R5H A;  2G0E A;  4WCG A;  3U1D A;  1IJW C;  1IRZ A;  3BZC A;  3KE2 A;  4RAZ A;  2P6S A;  3B6C A;  4QSH A;  3ZMZ A;  3KYD B;  4A3I J;  1Z3Y A;  3JCU C;  2WBM A;  3RKQ A;  3CF2 A;  3PNY A;  2OPT A;  3I71 A;  4E7H A;  2JK3 A;  1PP8 F;  2HYG D;  4U0V A;  3H3Z A;  4ZDL A;  3MKZ A;  3CUO A;  3CMA I;  1T98 A;  1P7J A;  1LFU P;  1KYW A;  2DPD A;  4DYQ A;  2E1N A;  2FQ3 A;  4LLG F;  5IT3 A;  3CO6 C;  4CCL A;  2F4M B;  2ZNY A;  1K78 B;  1MIJ A;  2L9R A;  1HST A;  3H36 A;  5CQG A;  1U78 A;  1S9H A;  3H92 A;  1GVJ A;  3WTY C;  3VWB A;  4UNO A;  4IZZ A;  1T0F C;  3BR5 A;  5GAG J;  4Q5S F;  2PMU A;  5FLX Z;  3OWT A;  3MEX A;  4HNT A;  3BCB A;  3FKJ A;  3LSI A;  3QOP A;  4U7B A;  4D5C A;  1MDM B;  3FWE A;  2E19 A;  2VIX A;  4QPO A;  1Y6I A;  1EF4 A;  3QPT A;  3AL0 C;  4CZZ A;  4RGU A;  2XPU A;  2H1L A;  3UKG A;  3G3Z A;  3WU2 C;  2GXG A;  1D3Y A;  2KZV A;  3K1N A;  4GDF A;  2L0K A;  4B48 A;  3GX4 X;  1KQ9 A;  3E5Q A;  3U2R A;  3LQR A;  1VQ9 I;  1ZQ3 P;  2LFB A;  1VQ8 I;  1WZ2 A;  3ZQL A;  3A2K A;  3NEU A;  1QO0 D;  2NVQ J;  4BDY A;  2DMT A;  2XAS A;  3B02 A;  4KIG A;  4QPQ A;  3TP0 A;  3ZQH A;  4LG0 A;  3L2Q A;  1S7A A;  4GCV A;  5BQT A;  3M8E A;  4DBR A;  1A5J A;  1B9M A;  3BQZ A;  4KJZ A;  3L2U A;  3S1M J;  4HV6 A;  4MTE A;  4HOB A;  4ZZD A;  4M3G A;  2WAD A;  3HRT A;  2WA0 A;  5FD6 A;  1W1W E;  1W5T A;  3UR3 C;  3WE3 A;  5ILU A;  5AON A;  1IW7 F;  1KU7 A;  5GAD J;  3K4B A;  3ZMD A;  3FMQ A;  3JAM K;  2MFZ A;  3VSL A;  2Y0M A;  2JA2 A;  4XLN F;  3JSP A;  2WTE A;  1V3F A;  2TCT A;  1FYM A;  3OMY A;  4LFU A;  1TNT A;  3W6J B;  1IF1 A;  3GFL A;  2BV6 A;  4N0B A;  2EIJ H;  2LVS A;  2EJR A;  4S04 A;  1BI3 A;  5LFA A;  5LHG A;  1W7P A;  3JRE A;  4AIH A;  1FBQ A;  1X2N A;  3H5N A;  2GOX B;  2X6Y A;  4EMS A;  2JPB A;  5FRN A;  4E7S A;  3O8H A;  2X9D A;  4C3H J;  2ZB9 A;  5LGN A;  3GZ5 A;  4HX7 A;  2HQ5 A;  4HQE A;  3WU1 B;  2OD5 A;  3TKY A;  4YFK F;  3FHZ A;  2R5Y A;  3H9G A;  2GA1 A;  3TO7 A;  2H8R A;  2K86 A;  1TTY A;  2Y0S N;  2PMH A;  3I64 A;  3U1K A;  2E2I J;  2GBY A;  1QPM A;  2DN0 A;  4BE2 A;  4UB8 C;  1IXR C;  3E1S A;  2CS3 A;  4XON A;  3I3L A;  3JAM Z;  4C2U A;  3OIO A;  1P6R A;  3BG5 A;  4EEF G;  3CJN A;  2QKL B;  4IOC F;  4P9U A;  2L3D A;  3ZCO A;  3ZMT A;  3HBL A;  2QBY A;  1P2F A;  1K7A A;  4KT6 A;  2DT5 A;  3FIW A;  4PJN A;  3GFI A;  5E3O A;  4Y52 J;  1BR4 A;  3LST A;  4U87 A;  4NNJ A;  2LD5 A;  2XKO A;  1BW5 A;  3Q5F A;  2WAQ N;  3B6A A;  2V26 A;  2XV4 S;  1HDD C;  2ECC A;  3BTI A;  1YRN A;  1I1G A;  3Q9V A;  2VJI A;  4NQW B;  1VF9 A;  5E3M A;  4EJU A;  3HOV J;  3RJP A;  2F6C A;  1B8I B;  5DCM B;  1VI0 A;  4A3J J;  4G12 A;  2WY8 Q;  1PDN C;  3KP6 A;  2M0M A;  4GRI A;  2QQ8 A;  3K69 A;  1AU7 A;  3WE2 A;  2H6B A;  3CZ6 A;  5BNG A;  5HOO A;  4H0E A;  4KDP A;  2CUZ A;  1WJF A;  4IHW A;  4D7M A;  3E0J B;  1Y8Q B;  2L9S A;  2XGC A;  1BI1 A;  2XSD C;  2PG4 A;  4BYY A;  3FDY A;  5F0C A;  1YJW I;  1TP4 A;  2JA7 J;  4F52 A;  2Z33 A;  4V2G A;  4JK1 X;  1I27 A;  2IP2 A;  1MND A;  3OYD A;  2CUJ A;  3IV5 A;  4FE7 A;  1MH3 A;  4FCY A;  2QQ9 A;  5H20 A;  5D4S A;  1UCR A;  2Y30 A;  3K1M A;  1IDY A;  3W3C A;  4KMU X;  5L3F A;  3KP4 A;  2JT1 A;  4IO9 F;  2IJL A;  4RM2 A;  3TED A;  2V1X A;  2HQA A;  5E8I A;  4M3E A;  4FX0 A;  1YX5 A;  1TWH J;  4G9Y A;  2K7L A;  3I59 B;  2QA4 I;  4HNU A;  3PQJ A;  3C3W A;  5CPR B;  3LSR A;  3GCM A;  1F9N A;  1R1V A;  4BHP A;  1NH3 A;  4L0Y B;  4JX4 A;  3M9A A;  2BYV E;  2EIM H;  1KYZ A;  3ELK A;  2GZW A;  1ON1 A;  2CUF A;  4DOZ A;  2QSG X;  2LKX A;  1BJA A;  2H1K A;  2ELK A;  2YX4 A;  3U9G A;  1XSD A;  2ZKZ A;  1LJ9 A;  2V4J C;  3PL8 A;  2HYJ A;  3K9T A;  2NRA C;  2V1U A;  2EB7 A;  2E60 A;  4GO1 A;  2HYF A;  1M1E B;  1FLI A;  5E1X A;  1QHH D;  1J59 A;  1S5L C;  2FSW A;  3DTI A;  5J40 A;  5B5E C;  1Z1D A;  4LMY A;  3I55 I;  3DKY A;  2KJB A;  3ZR8 X;  2F2E A;  3IAM 2;  3CP8 A;  2R7O A;  4KA4 A;  1ORK A;  4NUB A;  3F8B A;  1H8A C;  2KP6 A;  1LUJ B;  1DU0 A;  5FKL A;  2RNG A;  1PVE A;  3DBH B;  3JW4 A;  4FHT A;  4CCK A;  1YFH A;  2OQR A;  1ZGJ A;  2Q1Z B;  2VXD A;  3F8M A;  3T0Y A;  2ME0 A;  5J4Y A;  1T95 A;  2QSF X;  3GUD A;  4HYE A;  5IT9 K;  2BHZ A;  2KZG A;  4A3M J;  3FXK A;  2HVS A;  4AM3 A;  3PIO F;  4E7L A;  3CUQ B;  4Z6Y A;  3RSN A;  4A5M A;  5E17 F;  4C2T A;  1SFK A;  2O6G E;  4A3K J;  1Z05 A;  4W1U A;  2W84 A;  1SFU A;  1SAX A;  2HVQ A;  3QPS A;  1ZK8 A;  2KT0 A;  3BY6 A;  4XLP F;  1HCR A;  2HGC A;  4GFB A;  2DO7 A;  1Z67 A;  4B1R A;  2NOG A;  1ZH5 A;  1JTY A;  2DOA A;  1OCO H;  4HZF A;  2CV0 A;  5TIS C;  3GFM A;  3CD6 I;  4JBA A;  3EQL F;  2VOP A;  1XSV A;  3HOX J;  5J1Y A;  4UV9 A;  5IT9 Z;  5CJ9 A;  1S3J A;  2E7W A;  5FLM J;  3E6M A;  4EGY A;  2STW A;  5DM7 F;  2VBY A;  3BCA A;  5IOZ A;  2VUM J;  2VBZ A;  2DLL A;  4ZYE A;  2WAQ A;  3A01 A;  2WWY A;  4XL9 A;  1BW6 A;  1G3T A;  3T8T A;  1XC5 A;  2HR3 A;  2XPV A;  2Q8K A;  5J8C A;  3DBR B;  2IBD A;  4B4C A;  2FA5 A;  3BC8 A;  4YIR X;  1U5T B;  4LIT A;  2M5W A;  3BR2 A;  2OZ6 A;  3HTU A;  4M3D A;  5DTD A;  1V5G A;  3ROU A;  3HGY A;  2COB A;  3HUG A;  2CGP A;  2NVY J;  2KIQ A;  2M2E A;  5M5Y J;  1T08 B;  1EH7 A;  1U9N A;  1YJ9 I;  1JHF A;  2VJ4 A;  3RKY A;  3GTO J;  1D1C A;  4P96 A;  2P5K A;  1AHD P;  3GTL J;  4WX9 A;  2O8K A;  1V55 H;  3CC7 I;  5K1Y A;  3S3O A;  3ECH A;  4IRI A;  3FF5 A;  2KDZ A;  2XRL A;  3V8J A;  2MAB A;  1VQK I;  3LSH A;  5F64 A;  1Y0N A;  2BY3 A;  5JR3 A;  5DM6 F;  4RAF A;  3SYT A;  2IVM A;  3K4C A;  2OUM A;  4IOA F;  3K7A J;  1ZLK A;  4PSX A;  1PUE E;  2QEX I;  3PNT A;  1P4X A;  2GM4 A;  3BP8 A;  2BY1 A;  2K3P A;  3IAS 2;  2JA8 J;  3KLO A;  3TBI A;  1P9Q C;  2A68 F;  3LA2 A;  3ABM H;  2JQ7 A;  1LNW A;  3RQI A;  4XK4 A;  1MMN A;  4BXU A;  3KYL A;  1X3Z B;  4UB6 C;  4J19 A;  2OC6 A;  4C3I J;  3P7N A;  2A6T A;  3WTV C;  1SD4 A;  5CQE A;  2HXO A;  2ZJQ F;  5K5Q A;  1OJL A;  2Q0O A;  1WCM J;  2YS9 A;  2FOW A;  2CW7 A;  2Y69 H;  3MZH A;  1EH8 A;  2Y2Z A;  5D8K B;  3F22 A;  1R1U A;  2VQC A;  2RN7 A;  1QVT A;  2PMZ A;  1IUY A;  3NRV A;  3LNQ A;  1N25 A;  2KRH A;  3GTK J;  1W7P D;  2P7V B;  2KKO A;  2KIS A;  4L9T A;  5C44 J;  3G73 A;  1YIO A;  1MBK A;  1IN4 A;  4KIT B;  3NAR A;  1ON2 A;  4OAZ A;  4BNC A;  4G7O F;  3ZXS A;  2AO9 A;  2OAZ A;  4DYC A;  4Y13 A;  1LEA A;  2XGX A;  1T56 A;  3WGH A;  3BR6 A;  4D0P A;  2HOS A;  3QWL A;  2MW8 A;  1OCZ H;  1RES A;  3D5S C;  3LFU A;  2XAJ A;  3FXR A;  3MKW B;  4M73 A;  3S32 A;  2HNH A;  1ZGA A;  3HYI A;  3V7C A;  2RQP A;  2VKD A;  3X2Q H;  1XCB A;  3J7A Y;  1X3W B;  3GW2 A;  2N8G A;  2OTJ I;  1E2X A;  3IH2 A;  4CDG A;  1MMG A;  1FC3 A;  1RUN A;  3QP6 A;  3V7S A;  1WRJ A;  4QLC U;  1F43 A;  4RMN A;  2KRC A;  3ZQQ A;  1KQ8 A;  1DGR M;  2HXI A;  2YSR A;  1G2H A;  4C3J J;  1K6Y A;  4X1E A;  4YEL A;  3H0D A;  5KAI C;  2V9P A;  1TBX A;  5K5O A;  2R5Z A;  2L9N A;  1U3E M;  3M3Y J;  4OU0 A;  3R4K A;  2CO5 A;  2XC7 A;  5EG0 A;  2V1D A;  4PJJ A;  4YEJ A;  1DPU A;  3EUH C;  3M8F A;  3LMM A;  1K4T A;  2IGM A;  3BJO A;  2AS5 F;  2O9L A;  1GVD A;  1B1B A;  2MLK A;  4A3E J;  2PJR A;  2E35 A;  3F72 A;  2OZU A;  4Y7N J;  3CCS I;  1T0F A;  2EFO A;  2RDP A;  5GAE J;  1YLF A;  1N77 A;  3GEZ A;  2A6H F;  1XPX A;  2QYO A;  3ABT A;  3RZO J;  3QP5 A;  4M71 A;  1TQI A;  2EA4 A;  3CCY A;  2QWW A;  3CCE I;  3Q3S A;  4AD9 A;  4R8H A;  3MMY B;  1QU3 A;  4ZDP A;  5F1R A;  1FJL A;  4TV7 A;  3DV8 A;  2DA1 A;  4ASN A;  3S2D J;  4A0Y A;  2YPR A;  4EM1 A;  2R93 J;  3WTX C;  1JKQ C;  2OU2 A;  2W25 A;  5F08 A;  1ETY A;  5K5R A;  3TW6 A;  3SHF A;  2PBI A;  2DOD A;  3HKZ N;  5LLQ A;  2ZJR F;  1LQ1 A;  3OS1 A;  4HX4 A;  4WWC A;  1B4A A;  3EUK L;  1B59 A;  1LDK B;  1L3L A;  3CUQ C;  3KFW X;  1IRG A;  3WTZ A;  4M6X A;  2VE8 A;  1O7F A;  4JP0 A;  1MZB A;  1D5V A;  5CVV A;  4DZP A;  4I76 A;  1JTX A;  3C7J A;  3C1D A;  2HFH A;  3ZRG A;  4EJW A;  1W0T A;  1KON A;  1XGM A;  4KIB A;  5BS6 A;  2CW8 A;  2RRE A;  1YHQ I;  1XGS A;  2BW3 A;  5IY5 H;  1D1A A;  3W2A A;  1F5T A;  4DJA A;  2DTR A;  4LJZ F;  2V9V A;  1ZG5 A;  2ZME B;  1LVA A;  3KYC B;  5JLW A;  3QOD A;  1Z9C A;  2HQN A;  2J5P A;  3IHU A;  5GAH J;  4A6E A;  4ZH4 F;  1LPQ A;  2X1C A;  1TT0 A;  2HKX A;  2X6X A;  3DCF A;  1ZLJ A;  3PFY A;  2DDB A;  4KFC A;  3A1Y A;  1OYI A;  4ENJ A;  4ZTJ A;  2ACJ A;  1J7K A;  5HLI A;  1RRJ A;  1MNE A;  2W1O A;  4XKV A;  2E1O A;  4JOM A;  2V6E A;  1TWC J;  2QSH X;  4BKX A;  2DOF A;  2VJ5 A;  1O3S A;  5K7F A;  4IHS A;  3O3K A;  4D5F A;  3QPL A;  1WVR A;  1H89 C;  2ISY A;  1WPK A;  1XSX A;  5B1A H;  3JRB A;  2IGO A;  1QRY A;  3LSG A;  3V8L A;  2R3S A;  3MKY B;  1O4X A;  1VQ5 I;  2Y9Y A;  2BZT A;  2P7C B;  4P5O A;  2K85 A;  4A69 C;  1IZ1 A;  4HF0 A;  3FM3 A;  2DW4 A;  4U0Y A;  2EFN A;  4UVB A;  3S93 A;  5KAF C;  3DF8 A;  4X6A J;  2L7F P;  3DEU A;  2CWE A;  3CLQ A;  3GFJ A;  4RGR A;  2XDV A;  4RM3 A;  1ETX A;  1DP3 A;  5CVJ A;  5CLS A;  1XCV A;  4Y4R A;  3KEY A;  1WHU A;  1ZG3 A;  3JRG A;  5E1W A;  3H35 A;  1O3Q A;  4ETS A;  3HIF A;  2Q2E A;  3MFK A;  3E6C C;  3T8R A;  5L3D A;  3RKW A;  3V4G A;  1UG2 A;  3A03 A;  1R7J A;  3GTJ J;  4NC6 A;  3GZN B;  4PFO A;  2H6C A;  5J1R A;  2LY2 A;  3EPZ A;  4PGH A;  2E5Z A;  1I39 A;  4HDV A;  3S3M A;  3RKX A;  2QEN A;  1AOY A;  4EGZ A;  5FLX K;  3I9V 2;  2ZSH B;  1D8J A;  1LDD A;  2TRT A;  2LRE A;  4N9I A;  5IPA A;  2VT2 A;  2LLK A;  5DCF A;  3T1B A;  2EFQ A;  4Q47 A;  4BJ5 C;  2K3F A;  4HV5 A;  2R7Z J;  1V5E A;  3JRC A;  3IKV A;  3OOU A;  5FKO A;  3OYG A;  3RDI A;  2ZXJ A;  4A3C J;  2L5Q A;  2BBY A;  5FFX A;  4GYG A;  4OMZ A;  4E7K A;  3CMY A;  2C6Y A;  4MHG A;  1HSJ A;  2HZD A;  5J8F A;  3HG9 A;  1JGS A;  4BEH A;  4I2O A;  4MQ9 F;  4ENK A;  1SVL A;  5JFR A;  1JXS A;  4XKW A;  4G7H F;  3E3V A;  4XR6 A;  1D1B A;  3DTE A;  1WJD A;  1WKM A;  1L0O C;  3L09 A;  2AQF A;  2M3A A;  3K70 D;  4UVC A;  2WB1 N;  1RET A;  3K6G A;  2DJI A;  5TGT A;  4A3D J;  4FET A;  2DCE A;  2MLG A;  3GBG A;  3FMR A;  3PSI A;  3H9J A;  1BOA A;  1JUM A;  2B63 J;  3HKZ A;  2M0C A;  3B73 A;  3ERE D;  1Z7L A;  2E7X A;  2LF8 A;  2X85 A;  2GA2 A;  2VJJ A;  4CXF A;  1MKM A;  3VPR A;  2VPL A;  2LMD A;  4BL0 B;  3PO3 J;  3KP7 A;  4J00 A;  5J6X A;  3KCC A;  4PCQ A;  3OSF A;  1P4A A;  2E1M B;  4B47 A;  3DPL C;  2M9H A;  5AIP A;  1HKS A;  2LG4 A;  2JVH A;  3S8P A;  3ZMU A;  2EZK A;  3DKW A;  4A12 A;  3CME I;  2WC2 A;  5EF6 A;  5KCM A;  1SAU A;  2JZY A;  3E5U A;  1ZG1 A;  3FBN B;  4XLA A;  4LK1 F;  1K78 A;  3OV8 A;  2EFP A;  2MA3 A;  3K1P A;  3G2B A;  1OFC X;  1TNS A;  3FXO A;  2O61 A;  4RS8 A;  2FD5 A;  3D1N I;  3NWT A;  1D8K A;  2FML A;  2QF7 A;  4Y17 A;  2ISZ A;  2QQB A;  1FIP A;  1D0Y A;  1T33 A;  2M7A A;  3DQV C;  4KNY A;  3C2B A;  4M6Y A;  1MDM A;  2M30 A;  3GXO A;  3S17 J;  4BQO A;  3OOP A;  3Q0W A;  2RKH A;  5B3S H;  2VC0 A;  1X4P A;  2UXX A;  4CIC A;  1O3R A;  4ZJZ A;  4HLX A;  3FM5 A;  2OBP A;  1WJE A;  1FBS A;  1NHA A;  3FK7 A;  3BWG A;  2V7F A;  1ACI A;  1FNN A;  2LBF B;  5DD8 A;  1TT5 B;  1A36 A;  1J9I A;  2RGV A;  3R60 A;  1K61 A;  1CGP A;  4UV8 A;  1IN8 A;  2R0Q C;  2VQL A;  1XTA A;  3HHH A;  1BIA A;  2WAF A;  4XIC A;  1YYV A;  1FYL A;  1IXC A;  2ZCW A;  3HEF A;  4DW6 A;  1W36 C;  1BL0 A;  3S1Q J;  3HRM A;  1LVK A;  2YX7 A;  5FD5 A;  2R7W A;  1BR2 A;  2DOE A;  3FMS A;  2RNJ A;  2HPM A;  3G1L A;  5IOY A;  3ZQI A;  4ZYD A;  3V42 A;  2D2W A;  1E3H A;  3L1P A;  3ESW B;  4IKF A;  3HOU J;  2Y75 A;  4G6D A;  3MN2 A;  2QUF A;  2FOK A;  3KZI C;  5D6E A;  2DA6 A;  2L2O A;  3VDX A;  3G71 I;  4IHT A;  1VQO I;  3IH3 A;  3C2G A;  3FXU A;  1XS9 A;  4HA8 A;  1FWZ A;  2ZME C;  2Z16 A;  2L4M A;  3EET A;  2JRT A;  2ZO4 A;  1WQ2 A;  2F5V A;  2JRM A;  5GTH C;  1U9O A;  4M9S A;  4V19 K;  5LEJ A;  3E6B A;  4LB5 A;  1N75 A;  2FX0 A;  2K27 A;  3F21 A;  2DQR A;  2VE9 A;  3HSF A;  4NHJ A;  1J0R A;  1ZR4 A;  1TW2 A;  2XF6 A;  2OQG A;  3FBI B;  4B09 A;  1FZP B;  2NVX J;  2F4I A;  1UEL B;  4D7N A;  1MBH A;  4ANJ A;  1LDJ A;  4YII A;  4ESF A;  1K4S A;  1EH6 A;  5C3E J;  5DD4 A;  4PJL A;  2CQK A;  2HS5 A;  1POG A;  1FSE A;  2PJP A;  1HDP A;  3M1C A;  1HBX G;  2LC2 A;  4KYW A;  1S29 A;  3V8K A;  4CYC B;  4G7Z F;  4I7H A;  4UUS B;  1SEU A;  2W24 A;  2XVC A;  3KEQ A;  4C30 A;  2LRD A;  5M5X J;  2W4S A;  5M3M J;  1OCT C;  4IEJ A;  1T2K A;  5DEQ A;  3L9F A;  4BY1 J;  3Q0U A;  1F4K A;  5E79 C;  1HW1 A;  2ZJ2 A;  2KIU A;  4UVA A;  2E2H J;  3L2C A;  2GLO A;  2EZL A;  2DJN A;  2ZFU A;  3H9Q A;  4ITV A;  2MGQ A;  1IXS B;  1XB4 A;  4HW0 A;  2QM3 A;  3ECO A;  2HDW A;  2XHK A;  3CQZ J;  3H0G J;  5EGO B;  3HL2 A;  1BA5 A;  3BQY A;  1YX3 A;  1OKR A;  2L9V A;  4KIS A;  3GLL A;  2AQE A;  4BQN A;  2RV8 A;  1G59 A;  3EUA A;  4NQW A;  2BEO A;  2VQG A;  2Z99 A;  2L02 A;  4NC8 A;  1JHH A;  2K02 A;  3AG3 H;  3H1C A;  4U0W A;  4IHY A;  1A04 A;  2IT0 A;  4ENN A;  1LE8 B;  3HOW J;  3BG3 A;  3W6K B;  1B8I A;  5DCM A;  3H5A A;  2KL4 A;  2M8E A;  2FUG 2;  3CDL A;  1JT0 A;  2F4O B;  3ERM A;  3CC4 I;  4EJO A;  5BOX A;  3FHN A;  1B72 B;  5E8G A;  1UHW A;  3RCO A;  4XM3 A;  2BVM A;  3R0J A;  4BBS J;  5E20 A;  3P5J A;  1B9N A;  2DAO A;  2ELH A;  3CJR B;  2ZXH A;  2DU9 A;  2XGD A;  1AKH B;  1PYV A;  2VOD A;  1QZZ A;  1ZHF A;  1ZKG A;  2A69 F;  4Y15 A;  4DIQ A;  3FXL A;  1I5Z A;  4QIW N;  2ZJP F;  3QYE A;  4LIU A;  2VKV A;  2KRF A;  3E7L A;  4CCM A;  1YJN I;  1FMW A;  3VOD A;  1T39 A;  3MWM A;  3OYL A;  1N78 A;  3H3V K;  3HHG A;  3K4J A;  1VQN I;  5LD2 C;  4A93 J;  5C4X J;  3ZQ7 A;  2STT A;  2E71 A;  2EK5 A;  2W82 A;  1G3W A;  5CKT A;  4DGW B;  3SXY A;  1MD0 A;  2BXZ A;  3QOE A;  1YW8 A;  1ZTR A;  2BOL A;  2I10 A;  3I59 A;  1YQA A;  2K4J A;  4AID A;  2ESH A;  2RVC A;  4JYK A;  4XOT A;  2IS4 A;  2E1M C;  1X3U A;  3I53 A;  5D5U B;  4JX6 A;  5A2Q K;  3GF2 A;  3HPG A;  4F3Q A;  1HW2 A;  2V79 A;  4XSX F;  2DA2 A;  4RB3 C;  3TW7 A;  3EUH A;  4ZYH A;  1ZN2 A;  2Y0S A;  5TJJ A;  2CW0 F;  3DU6 A;  3CCL I;  4W97 A;  1Y39 A;  4FT8 A;  2YU9 J;  1LFB A;  3VYS B;  4HEA 2;  4S0H B;  2CU7 A;  2W7N A;  1S7O A;  4X0G A;  2IPQ X;  3ONQ A;  5FFZ A;  1GXP A;  4II3 A;  2FBK A;  1A31 A;  3FXQ A;  2MBF A;  3DBL B;  3E97 A;  3BDD A;  5LBQ A;  3RIR A;  3ZQF A;  1X2M A;  2JWT A;  4DQ2 A;  4F91 B;  4PJ0 C;  3HZJ A;  4FE4 A;  4OIO F;  4PFP A;  4ZTF A;  3GTG J;  3RYR A;  5HNH A;  3HOZ J;  5A2Q Z;  4B44 A;  1FX7 A;  1C0W A;  3LWF A;  3TMO A;  2A5W A;  4EM2 A;  4D1Q A;  1PUF B;  3MZY A;  5EEG A;  3MCZ A;  2ZXW H;  2UV1 A;  5ERI A;  4I99 C;  2NYX A;  3CUQ A;  5LHI A;  2QVO A;  3TOB A;  1UHS A;  2H09 A;  2QLZ A;  5ILS A;  3GTP J;  5HOD A;  4I6Z A;  4OAY A;  3TL4 X;  1FT9 A;  1R58 A;  3A0H C;  4ZYG A;  3GZ6 A;  1HXD A;  4JQF A;  3BJA A;  3JRI A;  3C2H A;  4HDU A;  2VQH A;  2X1E A;  5FKK A;  5B66 C;  3M4O J;  2NS0 A;  2O0Y A;  3PUB A;  2HWV A;  3KIO A;  5FKM A;  1XG1 A;  4MEY F;  1SD6 A;  1XGO A;  4OIQ F;  5EYR A;  4ZYA A;  3ML6 A;  1NG6 A;  1BR1 A;  5HS9 A;  3RPU A;  1RR8 C;  2GWR A;  1R71 A;  1TQM A;  3N4M A;  3IP4 B;  3S1R J;  2X6O A;  1JKP C;  1OCP A;  3LA3 A;  2CH0 A;  3SFZ A;  3QPH A;  2ZBK A;  1X1B A;  3CCJ I;  2EFW A;  1LEB A;  3KX2 A;  2HKO A;  3ZGK A;  1Q1H A;  3IWZ A;  1T8I A;  3CCQ I;  4IF4 A;  1U5T A;  3O2P E;  4N4N B;  1W4M A;  5HDK A;  3OS0 A;  4MFE A;  3K2Z A;  2PX9 A;  1V54 H;  4MLO A;  2RQQ A;  1Z6R A;  1BBY A;  2ZNZ A;  5F0H A;  1JJ8 C;  2KLO A;  2PN6 A;  3SJM A;  4BHB A;  2IA0 A;  3PNV A;  2X51 A;  1UMQ A;  3IKT A;  5GPC A;  2FNA A;  1RKT A;  2MD0 A;  2FQ4 A;  4N9H A;  2DI3 A;  3G6E I;  3K10 A;  1J75 A;  1SVM A;  3CDH A;  1XMX A;  1R00 A;  3D5R C;  4HX8 A;  4OWR B;  2LOO A;  3ASN H;  5HLT A;  2LH9 A;  3IL2 A;  5IP6 A;  2EV0 A;  1KU9 A;  1I6H J;  2O03 A;  3L00 A;  2P5V A;  1FP1 D;  3ABK H;  4E4H A;  2ESN A;  2XGE A;  3SQN A;  1Y8R B;  4HSR A;  3W2V A;  1X1P A;  2NNN A;  2V6C A;  1IRX A;  3GTQ J;  3EYY A;  2DA3 A;  2R5Z B;  3FXM A;  4M3B A;  4IRG A;  3JR9 A;  4PUS A;  3KP5 A;  2K9M A;  1XDU A;  2W48 A;  5C4J J;  2D1H A;  3C18 A;  3TOA A;  3COA C;  4I02 A;  1QNT A;  2IS2 A;  2VKE A;  2MC4 A;  2FF4 A;  1DGW Y;  3FK6 A;  2W85 A;  5IYC J;  5J3L A;  1X1A A;  2R4G A;  3D5L A;  1OR7 C;  2NOJ B;  3I5U A;  2VL8 A;  5D5W B;  2VN2 A;  1JKR C;  4XQF A;  4FTH A;  3CC2 I;  1FOW A;  2VI6 A;  1H88 C;  3G4S I;  2J5O A;  4IRH A;  2Z3Y A;  1DPR A;  5KK1 A;  1ZRD A;  4DYR A;  1JE8 A;  3QYF A;  2P4W A;  5K7H A;  3W6V A;  2ZFW A;  2KDO A;  4EJV A;  2DT7 B;  1ODD A;  1BC7 C;  1FTZ A;  5JVG F;  1DU6 A;  2JSP A;  5K7Z A;  2P81 A;  3ZP5 A;  2EV6 A;  2OV7 A;  4RGX A;  2QCO A;  3F9K A;  4OIN F;  1OQY A;  3DP7 A;  4GXO A;  5EEH A;  2A07 F;  2VXZ A;  1DQU A;  5L3B A;  1CF7 B;  1H9G A;  1Y56 A;  2P8T A;  4L9N A;  4M74 A;  1J5Y A;  1X1C A;  3ISP A;  4Q4Z F;  4G6T B;  1AWC A;  1SMY F;  1ZRF A;  1TW3 A;  4U88 A;  3HXL A;  1OIS A;  5HDG A;  4UUV A;  3HRU A;  1QZE A;  1DDN A;  5JHF A;  2JUG A;  4IHX A;  4E7J A;  4HG2 A;  4AU7 A;  2MG4 A;  3H5R A;  4RAY A;  2BHY A;  3DLA A;  3H3U A;  1IN6 A;  3ULQ B;  5IYB J;  5E18 F;  1G8X A;  4XSZ F;  5FB2 A;  3OYB A;  1PP7 U;  3E5X A;  2V1N A;  3VFZ A;  3GO5 A;  1O57 A;  1TWG J;  1UFM A;  5HLH A;  2XKP A;  1QPI A;  1P92 A;  1FBU A;  3OYJ A;  3TQN A;  4AUX A;  3S2H J;  2WAE A;  2EBI A;  3CJQ B;  5EJC A;  2DTZ A;  1P4W A;  3KP2 A;  2DMU A;  3KPH A;  2MD5 A;  4EJT A;  1YW9 A;  2KIF A;  3DPU A;  4L18 B;  4O3M A;  3OYI A;  4D9J A;  3HSE A;  1QGP A;  4E6K G;  1HKQ A;  5J4V A;  1D0Z A;  4PGG A;  1VQM I;  2L54 A;  3OIP A;  2DQL A;  3NWS A;  4BQA A;  3AG1 H;  4FX4 A;  3I4N J;  1IDZ A;  2HU9 A;  1JUS A;  1BIB A;  3WHB A;  1Z7U A;  3WOD F;  2VON A;  5ICG A;  1R9T J;  2GQQ A;  4R1H A;  5M5W J;  4BUP A;  1U0J A;  2IXS A;  4K2E A;  1BJZ A;  3R61 A;  2MH9 A;  2A3S A;  1GDT A;  3LSJ A;  1YW7 A;  4FIS A;  3BOQ A;  3IRQ A;  1T6S A;  1XMK A;  3A4C A;  1IC8 A;  2BXY A;  3BRO A;  1UJ8 A;  2BE5 F;  1PJR A;  4MIM A;  1G4D A;  4F92 B;  3SZT A;  2BGC A;  3S1N J;  5FLV A;  2DYS H;  4II2 A;  4BXX J;  3DXJ F;  3OYM A;  4IVN A;  4KT5 C;  2VKH A;  2IAI A;  5LRR A;  1SFO J;  5D6F A;  2ZSI B;  1KU3 A;  1U5T C;  3WU0 A;  1FEX A;  2FE3 A;  2CFX A;  3K2A A;  3ZQC A;  2KFD A;  1MSF C;  3KZZ A;  1MMD A;  2Q2E B;  1NG7 A;  2AXL A;  5CYV A;  3J7Y J;  1ITY A;  4XKC A;  2HQR A;  1ETO A;  1Z3X A;  1KGS A;  2X48 A;  3OL4 A;  4YIF A;  2XB5 A;  3TO9 A;  3VB2 A;  3CCU I;  3QQA A;  2VBX A;  5L3G A;  1OPC A;  2A05 A;  3VYT B;  3JRD A;  4ZDO A;  4E7I A;  5LEK A;  1SAN A;  3WTW C;  2QQA A;  2ZME A;  3E6D A;  2HTS A;  2X4H A;  2R7Q A;  4O5V A;  2M1B A;  3QYB A;  5ICF A;  2DA5 A;  2CQ7 A;  1RI7 A;  3F23 A;  3CES A;  1WH5 A;  1KA8 A;  4LG3 A;  2XIG A;  1AA7 A;  1U6G A;  3HRS A;  1WI9 A;  2K9N A;  2LY1 A;  3VEP A;  3DTK A;  1YO5 C;  3TDU C;  4NBQ A;  4RDU A;  1QQI A;  2JN6 A;  4E70 A;  2EZI A;  3F8C A;  4CSW A;  3MQ0 A;  1IGN A;  3U21 A;  3I0T A;  1WI3 A;  2LF7 A;  2WV0 A;  2XSJ C;  4XRM A;  1X4O A;  5E3N A;  5F0F A;  2M45 A;  3Q0V A;  4CUG A;  4LK0 F;  1X19 A;  2DK8 A;  2XPW A;  4YG2 F;  5GP9 A;  5DDG A;  1USS A;  2CRG A;  2HDD A;  9ANT A;  3JSO A;  3HM5 A;  5DUI A;  4BGD A;  2X0L A;  1MSE C;  1RZ4 A;  4PZJ A;  1IV8 A;  2CYY A;  1X58 A;  2BVL A;  4QWQ A;  4A0X A;  1TLH B;  5IP9 J;  4ON0 A;  2ETH A;  2NAZ A;  3K0L A;  2PFB A; 
#chains in the Genus database with same CATH homology
 5CVR A;  5F6F A;  2LNB A;  4F7Z A;  4CHU A;  4ENM A;  3WG9 A;  5FGM A;  4UHT A;  3BPV A;  4LG0 B;  3J81 Z;  1FP2 A;  4LGW A;  4PDK A;  1KQ0 A;  4A5N A;  3CO7 C;  2O8X A;  1S8N A;  2MH2 A;  3QU6 A;  3O6B B;  1FPQ A;  1SFX A;  1ZAR A;  4HF1 A;  2JSC A;  3EYI A;  4KIF A;  4HF2 A;  4XRF A;  3F6O A;  1S6L A;  1I1S A;  5HS7 A;  1W7P B;  2L01 A;  4A2U A;  1BC8 C;  4ZZL A;  5HS8 A;  4MQV A;  1BI2 A;  3F6V A;  2A61 A;  3IWF A;  3HSR A;  3HOS A;  5BMZ A;  4I0A A;  2L4A A;  3BZ6 A;  3GWZ A;  1XD7 A;  2UWM A;  1O3T A;  2JTV A;  2QZ8 A;  1XDS A;  4KMF A;  2EV5 A;  5BPD A;  2QBY B;  2YR2 A;  5JVT A;  4U7D A;  1R36 A;  4O6J A;  3WTU C;  3M7G A;  3GYH X;  3J80 K;  3P9K A;  2IA1 A;  2XAQ A;  4RGS A;  3QAH A;  2M87 A;  3N97 A;  5CVI A;  4CO8 A;  2VT3 A;  2JPC A;  5JI6 A;  4M72 A;  2F5C A;  1V4R A;  2PLY A;  3ZMV A;  4OIP F;  1G3S A;  3ZMS A;  1XMA A;  1R5G A;  4OMY A;  4P55 A;  3IRR A;  4MNU A;  1ULY A;  3J80 Z;  3Q9S A;  5H6R A;  2EA2 A;  4XBF A;  2A5Y B;  3I4P A;  1G6N A;  3DFG A;  2B0L A;  4B8X A;  3TGN A;  5DUK A;  1IN5 A;  5ICE A;  5ICC A;  1WSU A;  5AIQ A;  4HBL A;  3WTS C;  1BM9 A;  4MTD A;  2F5E A;  4GYI A;  2O3F A;  5HVQ C;  2XRO A;  2MC3 A;  4RB2 C;  4I98 B;  1KU2 A;  2F5F A;  1UB9 A;  2R7F A;  3CLO A;  3NQO A;  2A6E F;  4I0B A;  2YU3 A;  2GXB A;  4LLL A;  2FXA A;  3KP3 A;  2DBB A;  1J2X A;  1MJB A;  2XUB A;  3PFI A;  3R0A A;  2COM A;  5ED4 A;  2RC4 A;  3LQQ A;  1F1Z A;  1VTN C;  1GXQ A;  2VOO A;  1K6O A;  2OA4 A;  2H94 A;  1FY7 A;  1RUO A;  2FNP A;  1OR7 A;  2Z9O A;  4ESJ A;  2HTJ A;  1WWX A;  3WTT C;  3R6S A;  2XRN A;  4RB0 A;  5JHU A;  3RTR A;  3QU3 A;  2EWN A;  4L9V A;  3KLN A;  4S05 A;  5H6Q A;  1RNL A;  2DK5 A;  2HOE A;  3F8F A;  4IXA A;  1LB2 A;  2R7D A;  2FMY A;  1REP C;  5D8L B;  4G6Q A;  1XN7 A;  2PI0 A;  5D5X B;  1SMT A;  5LGT A;  4WF2 A;  5DYM A;  3KET A;  3TDZ C;  5L3C A;  1FYK A;  3F8N A;  2K4B A;  1U8R A;  1GHC A;  1K79 A;  1EV7 A;  3P9C A;  3HOT A;  4G94 A;  2VC1 A;  4IPA A;  2IW5 A;  4RB1 A;  4P9F A;  2W57 A;  2UXN A;  3F3X A;  3FX3 A;  4I09 A;  3REO A;  2GIV A;  5CVU A;  2DPU A;  4WXC A;  3GVA A;  2G9W A;  1YTY A;  3WGI A;  4WXH A;  3RI4 A;  1ZYR F;  3AAF A;  3CTA A;  5HLG A;  1OYW A;  5BPI A;  2ADU A;  4UXN A;  5LRS A;  1Y0U A;  1SFE A;  5TRD A;  2LSO A;  4MGR A;  3M1E A;  2H27 A;  2HDC A;  1UST A;  4OIR F;  3I54 A;  4MEX F;  1QZY A;  3T5X A;  3ZPL A;  1YG2 A;  5ILV A;  4L5J A;  3RYP A;  1H9T A;  3ZN1 A;  1U2W A;  3S2W A;  3VOE A;  3FZV A;  2HEO A;  4G8X A;  2Z5U A;  4BH9 A;  1DP7 P;  4A6D A;  3D0S A;  2NNY A;  3LFK A;  1R22 A;  2G7H A;  3QRF F;  2XAF A;  4LB6 B;  4ESB A;  1STZ A;  3ZN0 A;  4AIJ A;  3ABU A;  4L0Z B;  4M9Z A;  1YS6 A;  4HLY A;  2XAG A;  4AVP A;  4YFN F;  1Z91 A;  3P9I A;  5LGU A;  2VBW A;  3JTH A;  4I01 A;  1FSH A;  2FU4 A;  2D1V A;  2KJC A;  1ZRE A;  3GLX A;  4KN7 X;  3PQK A;  4WK8 F;  4BHC A;  3I58 A;  2FBH A;  4CGZ A;  4AWX B;  2CG4 A;  5FO5 A;  3J7A O;  1E17 A;  2DFI A;  1MJA A;  3LAP A;  2D45 A;  2GAU A;  4L9J A;  4AIK A;  1I6X A;  5LHH A;  4L5I A;  2Y48 A;  3L7W A;  2CSO A;  1HW5 A;  1UHM A;  1R1T A;  4EQQ A;  6PAX A;  5E1Z B;  2UZK A;  1DUX C;  4LD5 A;  4R79 A;  2XAH A;  1IAW A;  2LKP A;  1SD5 A;  1YS7 A;  1BI0 A;  1IN7 A;  2LDU A;  4IJA A;  3V7R A;  2IRF G;  1QBJ A;  1XGN A;  4Q48 A;  2PQ8 A;  5D4R A;  4KUM A;  1HKT A;  4NB5 A;  2FBI A;  5DV5 A;  3BJ6 A;  3KZY A;  1CF7 A;  2E1C A;  3EDP A;  3RPQ A;  3SZP A;  1ZRC A;  4LLN A;  1SD7 A;  4OOI A;  1MJ9 A;  1ONV A;  3HTS B;  3LA7 A;  4GGG A;  3BPX A;  2P6T A;  5HDN A;  5D5V B;  2TDX A;  1ZAO A;  1R23 A;  2F5D A;  2G7U A;  4EV0 A;  2IA2 A;  1RIO H;  2FRH A;  4Z2Y A;  4EM0 B;  1FOK A;  1IRF A;  4A0Z A;  1OYY A;  4HQM A;  4WXD A;  3IC7 A;  4DNC A;  1O7L A;  1Z6T A;  2P5L C;  1T38 A;  3JTG A;  3WGG A;  1W5S A;  4KIC A;  2KIM A;  1MGT A;  5KVR A;  3MAJ A;  1H0M A;  4YFX F;  2PEX A;  3LAJ A;  1B6A A;  1G3Y A;  4EVI A;  1TQP A;  3DPT A;  1HQC A;  2HZT A;  4M9X A;  2FEZ A;  1BN5 A;  1OMI A;  3KEO A;  4BAY A;  4KN4 X;  3J81 K;  5L3E A;  3TO6 A;  4CYD A;  4HAM A;  1R5H A;  4WCG A;  3U1D A;  3KE2 A;  4RAZ A;  2P6S A;  3ZMZ A;  3I71 A;  1PP8 F;  2HYG D;  4U0V A;  3H3Z A;  3CUO A;  1T98 A;  1KYW A;  2DPD A;  2E1N A;  2FQ3 A;  4LLG F;  5IT3 A;  3CO6 C;  2ZNY A;  1K78 B;  1HST A;  1U78 A;  3H92 A;  1GVJ A;  3WTY C;  4UNO A;  4Q5S F;  2PMU A;  5FLX Z;  3MEX A;  3QOP A;  4U7B A;  1MDM B;  3FWE A;  3QPT A;  4CZZ A;  4RGU A;  3G3Z A;  2GXG A;  1D3Y A;  3K1N A;  3GX4 X;  1KQ9 A;  3E5Q A;  3U2R A;  3LQR A;  3NEU A;  1QO0 D;  2XAS A;  3B02 A;  4KIG A;  4LG0 A;  1S7A A;  4GCV A;  5BQT A;  3M8E A;  1B9M A;  4HV6 A;  4MTE A;  4HOB A;  4ZZD A;  3HRT A;  5FD6 A;  1W5T A;  3WE3 A;  5ILU A;  5AON A;  1IW7 F;  1KU7 A;  3ZMD A;  3FMQ A;  3JAM K;  2Y0M A;  4XLN F;  3JSP A;  2WTE A;  1V3F A;  1FYM A;  1IF1 A;  4LFU A;  1TNT A;  3W6J B;  3GFL A;  2BV6 A;  4N0B A;  2EJR A;  4S04 A;  1BI3 A;  5LHG A;  1W7P A;  4AIH A;  1FBQ A;  4EMS A;  2JPB A;  5LGN A;  3GZ5 A;  4HX7 A;  4HQE A;  3WU1 B;  2OD5 A;  3TKY A;  4YFK F;  3FHZ A;  2GA1 A;  3TO7 A;  2K86 A;  1TTY A;  2PMH A;  3I64 A;  1QPM A;  1IXR C;  3JAM Z;  1P6R A;  3CJN A;  4P9U A;  2L3D A;  3ZMT A;  2QBY A;  1P2F A;  1K7A A;  2DT5 A;  3GFI A;  3LST A;  2XKO A;  3Q5F A;  2XV4 S;  1I1G A;  3Q9V A;  4EJU A;  3RJP A;  5DCM B;  1PDN C;  3KP6 A;  3K69 A;  3WE2 A;  2H6B A;  4H0E A;  5HOO A;  4KDP A;  1BI1 A;  2PG4 A;  4BYY A;  2Z33 A;  4JK1 X;  1I27 A;  2IP2 A;  2QQ9 A;  5H20 A;  5D4S A;  1UCR A;  3K1M A;  4KMU X;  5L3F A;  3KP4 A;  2JT1 A;  2IJL A;  2V1X A;  5E8I A;  4FX0 A;  4G9Y A;  2K7L A;  3I59 B;  3PQJ A;  3C3W A;  1F9N A;  1R1V A;  4BHP A;  4L0Y B;  3M9A A;  2BYV E;  1KYZ A;  3ELK A;  2GZW A;  1ON1 A;  1BJA A;  2YX4 A;  3U9G A;  1XSD A;  2ZKZ A;  1LJ9 A;  2V1U A;  3K9T A;  2NRA C;  2EB7 A;  4GO1 A;  2HYF A;  1FLI A;  5E1X A;  1J59 A;  2FSW A;  1Z1D A;  4LMY A;  2KJB A;  2F2E A;  4KA4 A;  3F8B A;  3JW4 A;  4FHT A;  1YFH A;  2OQR A;  1ZGJ A;  3F8M A;  3T0Y A;  3GUD A;  4HYE A;  5IT9 K;  3CUQ B;  4A5M A;  5E17 F;  2O6G E;  1Z05 A;  2W84 A;  1SFU A;  1SAX A;  3BY6 A;  4XLP F;  2HGC A;  2DO7 A;  1ZH5 A;  4HZF A;  3GFM A;  4JBA A;  3EQL F;  2VOP A;  1XSV A;  4UV9 A;  5IT9 Z;  5CJ9 A;  1S3J A;  2E7W A;  4EGY A;  3E6M A;  2STW A;  2VBY A;  2VBZ A;  2DLL A;  4ZYE A;  2WWY A;  1G3T A;  3T8T A;  2HR3 A;  2Q8K A;  5J8C A;  2FA5 A;  1U5T B;  2M5W A;  3HTU A;  2OZ6 A;  3ROU A;  3HUG A;  2CGP A;  1EH7 A;  1JHF A;  3RKY A;  4P96 A;  2P5K A;  4WX9 A;  5K1Y A;  3ECH A;  4IRI A;  3FF5 A;  3V8J A;  5F64 A;  5JR3 A;  2IVM A;  1ZLK A;  1PUE E;  1P4X A;  3BP8 A;  3KLO A;  2A68 F;  3LA2 A;  1LNW A;  4BXU A;  3P7N A;  3WTV C;  1SD4 A;  5K5Q A;  2Q0O A;  3MZH A;  1EH8 A;  5D8K B;  3F22 A;  1R1U A;  2RN7 A;  1IUY A;  3NRV A;  1W7P D;  2P7V B;  2KKO A;  4L9T A;  3G73 A;  1YIO A;  1IN4 A;  1ON2 A;  4BNC A;  4G7O F;  2OAZ A;  4Y13 A;  1LEA A;  2XGX A;  3WGH A;  4D0P A;  2XAJ A;  3FXR A;  4M73 A;  1ZGA A;  3HYI A;  3V7C A;  2RQP A;  1XCB A;  3GW2 A;  1E2X A;  4CDG A;  1FC3 A;  1RUN A;  3QP6 A;  3V7S A;  1WRJ A;  4QLC U;  1KQ8 A;  2YSR A;  5K5O A;  1TBX A;  1U3E M;  4OU0 A;  3R4K A;  2CO5 A;  2V1D A;  1DPU A;  3M8F A;  3BJO A;  2AS5 F;  1B1B A;  2MLK A;  3F72 A;  2OZU A;  1T0F A;  2EFO A;  2RDP A;  1YLF A;  3GEZ A;  2A6H F;  2QYO A;  3ABT A;  3QP5 A;  4M71 A;  1TQI A;  2EA4 A;  2QWW A;  4AD9 A;  4R8H A;  5F1R A;  4TV7 A;  3DV8 A;  4ASN A;  4A0Y A;  2YPR A;  4EM1 A;  3WTX C;  2OU2 A;  2W25 A;  5K5R A;  3SHF A;  2PBI A;  5LLQ A;  1LQ1 A;  4HX4 A;  4WWC A;  1B4A A;  1B59 A;  1LDK B;  1L3L A;  3CUQ C;  3KFW X;  1IRG A;  3WTZ A;  4M6X A;  2VE8 A;  1O7F A;  1MZB A;  1D5V A;  5CVV A;  3C7J A;  3C1D A;  2HFH A;  4EJW A;  1XGM A;  5BS6 A;  4KIB A;  1XGS A;  1F5T A;  2DTR A;  4LJZ F;  2V9V A;  1ZG5 A;  2ZME B;  1LVA A;  1Z9C A;  2HQN A;  2J5P A;  3IHU A;  4ZH4 F;  4A6E A;  2HKX A;  1ZLJ A;  4KFC A;  1OYI A;  4ENJ A;  2ACJ A;  1J7K A;  5HLI A;  1O3S A;  4IHS A;  3O3K A;  2ISY A;  1XSX A;  3V8L A;  2R3S A;  2P7C B;  4P5O A;  1IZ1 A;  4HF0 A;  3FM3 A;  2DW4 A;  4U0Y A;  2EFN A;  4UVB A;  3DF8 A;  3DEU A;  2CWE A;  3GFJ A;  4RGR A;  5CVJ A;  5CLS A;  1XCV A;  1ZG3 A;  5E1W A;  1O3Q A;  4ETS A;  3HIF A;  2Q2E A;  3MFK A;  3E6C C;  3T8R A;  5L3D A;  3RKW A;  3V4G A;  1R7J A;  2H6C A;  4PGH A;  4HDV A;  3RKX A;  2QEN A;  1AOY A;  4EGZ A;  5FLX K;  1D8J A;  1LDD A;  4N9I A;  2VT2 A;  5DCF A;  3T1B A;  2EFQ A;  4Q47 A;  4HV5 A;  3IKV A;  3RDI A;  2ZXJ A;  2BBY A;  5FFX A;  4GYG A;  4OMZ A;  2C6Y A;  4MHG A;  1HSJ A;  5J8F A;  1JGS A;  4I2O A;  4MQ9 F;  4ENK A;  5JFR A;  1JXS A;  4G7H F;  3E3V A;  1WKM A;  1L0O C;  3L09 A;  4UVC A;  2MLG A;  3FMR A;  1BOA A;  3B73 A;  3ERE D;  2E7X A;  2LF8 A;  2GA2 A;  4CXF A;  1MKM A;  3KP7 A;  5J6X A;  3KCC A;  4PCQ A;  1P4A A;  3DPL C;  5AIP A;  1HKS A;  3ZMU A;  3DKW A;  4A12 A;  2WC2 A;  2JZY A;  3E5U A;  1ZG1 A;  1K78 A;  4LK1 F;  3OV8 A;  2EFP A;  2MA3 A;  3K1P A;  1TNS A;  2O61 A;  4RS8 A;  1D8K A;  2FML A;  4Y17 A;  2ISZ A;  2QQB A;  3DQV C;  4KNY A;  4M6Y A;  1MDM A;  2M30 A;  3GXO A;  3OOP A;  1O3R A;  2RKH A;  2VC0 A;  2UXX A;  4CIC A;  4HLX A;  3FM5 A;  2OBP A;  1FBS A;  1NHA A;  3BWG A;  1FNN A;  5DD8 A;  1J9I A;  2RGV A;  3R60 A;  1CGP A;  4UV8 A;  1IN8 A;  3HHH A;  1BIA A;  1YYV A;  1FYL A;  1IXC A;  2ZCW A;  3HRM A;  2YX7 A;  5FD5 A;  3FMS A;  2RNJ A;  4ZYD A;  2D2W A;  2Y75 A;  4G6D A;  2QUF A;  2FOK A;  5D6E A;  4IHT A;  3FXU A;  4HA8 A;  1FWZ A;  2L4M A;  3EET A;  2JRT A;  2ZO4 A;  1WQ2 A;  4M9S A;  5LEJ A;  3E6B A;  4LB5 A;  2K27 A;  3F21 A;  2DQR A;  2VE9 A;  3HSF A;  4NHJ A;  1J0R A;  1TW2 A;  2OQG A;  4B09 A;  1FZP B;  1LDJ A;  4YII A;  4ESF A;  1EH6 A;  5DD4 A;  2CQK A;  2HS5 A;  1FSE A;  2PJP A;  1HBX G;  4KYW A;  1S29 A;  3V8K A;  4G7Z F;  4I7H A;  2W24 A;  2XVC A;  3KEQ A;  1T2K A;  5DEQ A;  3L9F A;  1F4K A;  1HW1 A;  2ZJ2 A;  2KIU A;  4UVA A;  3L2C A;  1IXS B;  1XB4 A;  4HW0 A;  2QM3 A;  3ECO A;  2XHK A;  1OKR A;  2RV8 A;  4NQW A;  2BEO A;  4U0W A;  2Z99 A;  2L02 A;  1JHH A;  2K02 A;  1A04 A;  2IT0 A;  4ENN A;  3W6K B;  5DCM A;  2M8E A;  4EJO A;  5BOX A;  5E8G A;  1UHW A;  3R0J A;  5E20 A;  1B9N A;  2DAO A;  2ELH A;  2DU9 A;  2VOD A;  1QZZ A;  1ZHF A;  2A69 F;  4Y15 A;  1I5Z A;  2KRF A;  3VOD A;  1T39 A;  3MWM A;  3HHG A;  3ZQ7 A;  2STT A;  2EK5 A;  1G3W A;  3SXY A;  1MD0 A;  1YW8 A;  3I59 A;  1YQA A;  2K4J A;  2ESH A;  2RVC A;  1X3U A;  3I53 A;  5D5U B;  5A2Q K;  3GF2 A;  1HW2 A;  2V79 A;  4XSX F;  4RB3 C;  3EUH A;  4ZYH A;  1ZN2 A;  5TJJ A;  2CW0 F;  4FT8 A;  1S7O A;  2IPQ X;  5FFZ A;  1GXP A;  2FBK A;  3FXQ A;  2MBF A;  3E97 A;  3BDD A;  5LBQ A;  3RIR A;  4DQ2 A;  4OIO F;  3RYR A;  5A2Q Z;  1FX7 A;  1C0W A;  3LWF A;  4EM2 A;  3MZY A;  5EEG A;  3MCZ A;  5ERI A;  2NYX A;  3CUQ A;  5LHI A;  2QVO A;  3TOB A;  2H09 A;  2QLZ A;  5ILS A;  1FT9 A;  1R58 A;  4ZYG A;  3GZ6 A;  1HXD A;  4JQF A;  3BJA A;  4HDU A;  2NS0 A;  2O0Y A;  2HWV A;  4MEY F;  1SD6 A;  1XGO A;  4OIQ F;  3ML6 A;  3RPU A;  5HS9 A;  2GWR A;  1TQM A;  3N4M A;  3LA3 A;  3SFZ A;  3QPH A;  2ZBK A;  2EFW A;  1LEB A;  2HKO A;  1Q1H A;  3IWZ A;  4IF4 A;  1U5T A;  3O2P E;  1W4M A;  5HDK A;  3K2Z A;  1Z6R A;  1BBY A;  2ZNZ A;  2PN6 A;  4BHB A;  2IA0 A;  3IKT A;  2FNA A;  4N9H A;  2DI3 A;  1J75 A;  3CDH A;  1R00 A;  4HX8 A;  3IL2 A;  2EV0 A;  1KU9 A;  2O03 A;  3L00 A;  2P5V A;  1FP1 D;  2ESN A;  3SQN A;  2NNN A;  2V6C A;  3EYY A;  4IRG A;  3KP5 A;  1XDU A;  2D1H A;  3C18 A;  3TOA A;  3COA C;  4I02 A;  1QNT A;  2FF4 A;  2W85 A;  3D5L A;  3I5U A;  5D5W B;  2VN2 A;  2J5O A;  4IRH A;  2Z3Y A;  1DPR A;  5KK1 A;  1ZRD A;  1JE8 A;  2P4W A;  2ZFW A;  4EJV A;  1ODD A;  1BC7 C;  3ZP5 A;  2EV6 A;  4RGX A;  4OIN F;  3DP7 A;  5EEH A;  4GXO A;  2A07 F;  2VXZ A;  5L3B A;  1CF7 B;  1H9G A;  2P8T A;  4L9N A;  4M74 A;  1J5Y A;  3ISP A;  4Q4Z F;  1AWC A;  1SMY F;  1ZRF A;  1TW3 A;  4U88 A;  5HDG A;  4UUV A;  3HRU A;  1DDN A;  4RAY A;  3H3U A;  1IN6 A;  3ULQ B;  5E18 F;  4XSZ F;  5FB2 A;  1PP7 U;  3E5X A;  3VFZ A;  3GO5 A;  1O57 A;  1UFM A;  5HLH A;  2XKP A;  1P92 A;  1FBU A;  3TQN A;  1P4W A;  3KP2 A;  4EJT A;  2MD5 A;  1YW9 A;  2KIF A;  4L18 B;  4O3M A;  3HSE A;  1QGP A;  1HKQ A;  4PGG A;  2L54 A;  2DQL A;  4BQA A;  4FX4 A;  1BIB A;  3WOD F;  1Z7U A;  2VON A;  5ICG A;  2GQQ A;  4R1H A;  4K2E A;  3R61 A;  2MH9 A;  2A3S A;  1YW7 A;  3BOQ A;  3IRQ A;  1T6S A;  1XMK A;  3BRO A;  2BE5 F;  1G4D A;  3SZT A;  2BGC A;  3DXJ F;  4IVN A;  4KT5 C;  5LRR A;  5D6F A;  3WU0 A;  1KU3 A;  1U5T C;  2FE3 A;  2CFX A;  3KZZ A;  2AXL A;  5CYV A;  2HQR A;  1KGS A;  4YIF A;  3TO9 A;  3VB2 A;  2VBX A;  5L3G A;  1OPC A;  5LEK A;  3WTW C;  2QQA A;  2ZME A;  3E6D A;  2HTS A;  2X4H A;  4O5V A;  2M1B A;  5ICF A;  1RI7 A;  3F23 A;  1KA8 A;  2XIG A;  1U6G A;  3HRS A;  1WI9 A;  3VEP A;  1YO5 C;  3TDU C;  1QQI A;  4E70 A;  3F8C A;  3MQ0 A;  3I0T A;  2WV0 A;  2LF7 A;  2M45 A;  4LK0 F;  2DK8 A;  4YG2 F;  5DDG A;  1USS A;  3JSO A;  5DUI A;  2X0L A;  1RZ4 A;  4PZJ A;  2CYY A;  4A0X A;  4QWQ A;  1TLH B;  4ON0 A;  2ETH A;  2NAZ A;  3K0L A;  2PFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...