2MC3A

Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MUS81 endonuclease homolog (Yeast), isoform CRA_b
publication title A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mc3A00
3F8FA 4RAYA 1V4RA 2K86A 1ZH5A 2P6TA 1G3YA 2W25A 3WU0A 1FY7A 1R58A 2CFXA 5LHHA 3HSEA 2NNYA 1OYYA 3U1DA 2GWRA 2A68F 4ESJA 5FD5A 4OIOF 4LK1F 4YG2F 2PBIA 1BM9A 3RI4A 1O3QA 2LF8A 4HAMA 4EM0B 4BH9A 2D2WA 1I5ZA 5L3GA 4WK8F 4EMSA 1PDNC 3CUQA 1P4XA 3PFIA 5CVRA 3R4KA 2DW4A 1ON1A 4Q5SF 1ZN2A 1J59A 4I2OA 3EYIA 5ICFA 3GXOA 1FBUA 4L5IA 3GFIA 1DUXC 3BJOA 1OR7A 4EJOA 5BQTA 1T38A 5JI6A 4XSXF 3CUQC 4KMUX 1KU2A 3KP4A 4IHTA 1JE8A 1ZREA 5L3CA 3I5UA 4P5OA 5HLIA 2QYOA 2PG4A 5BMZA 3ZPLA 1B1BA 1F1ZA 2Q0OA 2MLGA 1VTNC 2D45A 1SAXA 3MWMA 1QO0D 1XDUA 3HOTA 2XASA 2ESHA 3QP5A 3FHZA 3EQLF 4GYGA 4EM2A 3L9FA 1J5YA 5HDGA 2PEXA 1HW1A 4A6EA 1ZAOA 4HF2A 1IUYA 1G6NA 2GA2A 4LK0F 3DF8A 1YIOA 1IN8A 3IC7A 5DD8A 3HTSB 2YX7A 1T0FA 4E70A 4GO1A 5D6EA 3MZYA 2UWMA 5H20A 3IRQA 1G3WA 5TRDA 1IXRC 1FT9A 4RB2C 2HDCA 3IWFA 2IVMA 3ULQB 1W5TA 3B73A 3J80Z 2BBYA 2JPCA 2STWA 4M71A 1R1VA 1O7LA 2FNPA 5DCFA 2MBFA 1KA8A 3R60A 5E8IA 5HS7A 3WTTC 2ISZA 1TTYA 2XAHA 4GXOA 3FF5A 5DUIA 2YSRA 2IJLA 5D8KB 4GCVA 1IN6A 2P5LC 1B9MA 4LB5A 3P7NA 4PGGA 3T0YA 2VXZA 2XAFA 1QGPA 2HKOA 2DQLA 1SFUA 4FX4A 4RGRA 4M9XA 5L3EA 3E97A 4ZYGA 5E1XA 3ML6A 2FXAA 1CF7A 4IPAA 4BHBA 4G6QA 2XIGA 1IN7A 2V6CA 2AXLA 1XSVA 4U88A 4WXDA 1U3EM 2R7FA 4QLCU 3HIFA 3SXYA 4HV5A 2O8XA 4L0YB 1O7FA 5LLQA 2HEOA 2WV0A 1L0OC 3MAJA 1XMAA 3WTXC 4ENKA 2X0LA 1YS7A 4K2EA 2ETHA 1SFEA 2EFPA 2RC4A 1EH6A 1F9NA 3DKWA 3F22A 1P4WA 3WTWC 3QPTA 1C0WA 2VONA 3KEQA 2MC3A 1U2WA 5KVRA 3NQOA 2EV6A 4ESBA 4GGGA 4OMZA 3I64A 1WQ2A 4L18B 3ZMZA 1PP8F 4Q4ZF 5LHIA 4LD5A 3HOSA 1XSXA 1Y0UA 1SD7A 1UFMA 4BQAA 3MQ0A 3Q5FA 2HWVA 3GWZA 3BJ6A 1YW8A 2Y48A 3ERED 3LQRA 5HLGA 4I7HA 1HQCA 1W5SA 2FMLA 4IJAA 3JAMZ 5FD6A 3TOAA 1Z05A 1FC3A 1BIAA 2EA2A 4MEXF 2MD5A 2VODA 1O57A 1XCVA 4EQQA 1R00A 4D0PA 4UVBA 4PZJA 2DO7A 1HBXG 1YLFA 1LDJA 2M5WA 4FHTA 1YFHA 4HX8A 4HF0A 5LBQA 4Q47A 5DEQA 4MQVA 5FLXK 4KFCA 4IXAA 2P7CB 3T1BA 4B8XA 1SD5A 4IF4A 1RUNA 1IRFA 2V1UA 5HS9A 2QBYB 3BROA 4U0WA 1Z91A 1H9GA 4CGZA 2FBHA 5E20A 2XGXA 4G7ZF 1DPUA 4TV7A 1T98A 3GO5A 3DEUA 5K1YA 3RPUA 2LSOA 1GVJA 4HYEA 1FLIA 2DTRA 3M8FA 2A6HF 3GYHX 2ZJ2A 2PQ8A 3F21A 3FMSA 2K4BA 1ZRCA 1BIBA 2FA5A 3IHUA 1Q1HA 3FX3A 2P4WA 1FP1D 4G7HF 1MJBA 5FLXZ 2G7HA 4M9SA 3JSOA 4ZYHA 1MD0A 4A0ZA 2KKOA 2FF4A 3LAJA 5FO5A 3TQNA 2M87A 3SZTA 4RGUA 3WGIA 2L54A 2QM3A 4O3MA 1ZHFA 3OOPA 3E5QA 4EM1A 2P5VA 3E6BA 4MQ9F 2FRHA 2M45A 4KN4X 4PGHA 2BEOA 2G7UA 1J75A 1NHAA 2F2EA 1K6OA 4UUVA 1U5TB 2ZFWA 1IN5A 2XHKA 4HQEA 4CICA 2TDXA 1DDNA 3WTYC 3GLXA 3TO6A 2O0YA 4OMYA 2J5OA 4O5VA 3J81K 4N9IA 5HDKA 4UV8A 1QPMA 1YG2A 4CXFA 3ISPA 1RIOH 1G3SA 3RKYA 2IRFG 2VC0A 1P6RA 2A6EF 3RKXA 2KJCA 3KZYA 4N0BA 5F64A 5LGUA 1STZA 4RB3C 3MFKA 2F5DA 2B0LA 4L9TA 1TQMA 3KP3A 3CJNA 3E6CC 2YR2A 2DT5A 2CGPA 1EH7A 5D6FA 4AD9A 1ZG3A 4HBLA 1FYMA 2EV0A 4IRGA 4BNCA 2UZKA 1B9NA 2VE8A 3CO6C 3RIRA 1LVAA 3J81Z 3CUOA 5ILVA 1IZ1A 3DPLC 3HSFA 2GA1A 1SMYF 1HKTA 5HOOA 5D5WB 1ZGJA 3ZN1A 4FX0A 3N4MA 3W6KB 3D5LA 5F6FA 1YYVA 1RZ4A 3I54A 1B4AA 1YW7A 1K78A 1EV7A 1V3FA 4AWXB 4U0VA 1T6SA 4MTEA 1MDMB 4L5JA 3LA2A 1JXSA 1B59A 3V7CA 3ELKA 4M6YA 1XGSA 3O2PE 3C18A 1QZYA 4ENNA 3TKYA 4YFXF 1WSUA 2HTJA 3I59B 5DCMA 1SD4A 5EEHA 2JTVA 2NNNA 2RKHA 2Y75A 5CYVA 3V7RA 4M9ZA 2HZTA 2FBIA 2XVCA 2WWYA 4Y15A 1FP2A 1JGSA 1W7PA 4WCGA 1R1TA 2KRFA 4EGZA 3ZMVA 1I1GA 4AIJA 3L00A 1FSEA 3R0JA 2RQPA 3TGNA 5HLHA 2XAQA 1QNTA 2VBWA 3QU3A 2PI0A 1IRGA 2QLZA 4LFUA 2VBZA 3D0SA 2EFWA 2MLKA 1BI1A 1P4AA 2GIVA 1L3LA 2QZ8A 1I1SA 3LA7A 4AIKA 1OKRA 3G3ZA 2MH2A 2H27A 3MEXA 2PLYA 2Z9OA 2DK8A 2FNAA 5J6XA 4P96A 3WTZA 1E17A 3WTSC 4A5NA 2GAUA 4BXUA 1U78A 4RB1A 1F5TA 5A2QK 5ICEA 4G9YA 2JPBA 3V8LA 4HLXA 5FFZA 2H6BA 4RGXA 1KGSA 3U2RA 4LLNA 1MKMA 1R5HA 5ICGA 4XLNF 1FBQA 1T39A 4GYIA 4LJZF 2IA0A 2PFBA 3EYYA 4Y17A 1YTYA 1S7AA 4JK1X 4ETSA 2JSCA 4LGWA 4MNUA 4CDGA 3HHHA 1ZRDA 4CYDA 3CTAA 5ERIA 4A5MA 3JTHA 2EJRA 3K2ZA 4BHCA 3M1EA 2PMUA 3VB2A 3FM3A 5TJJA 1REPC 2BE5F 3KEOA 3R0AA 1KU7A 3BWGA 2ZBKA 2IT0A 3BPXA 2GXGA 1I6XA 6PAXA 3RPQA 3LWFA 2AS5F 3I71A 4NHJA 2UXNA 2OZ6A 4RB0A 2CSOA 4P9UA 3F3XA 3KFWX 5L3FA 3WE2A 3CUQB 5DDGA 4MGRA 2L01A 4EJWA 5DD4A 3ABTA 2JT1A 3NRVA 3T8TA 2F5EA 3LAPA 1BJAA 3H3ZA 3V8JA 3QOPA 5FFXA 1FSHA 1A04A 4CZZA 3F8NA 2ZCWA 2ZNZA 1Z6TA 1BI0A 5E18F 2K4JA 4UV9A 1QBJA 1K79A 4UXNA 3T5XA 4YFNF 3DXJF 2FU4A 1S6LA 4HW0A 3ZMDA 5BOXA 2ELHA 1IXSB 4L9NA 4BAYA 3P9CA 3NEUA 5LGNA 2IW5A 1SD6A 1FX7A 4DNCA 1PUEE 4ENMA 3RDIA 1GXPA 2H6CA 4HV6A 3EUHA 4OIPF 3CLOA 1ZARA 3O3KA 2OAZA 4KIBA 2EFOA 3GZ6A 5BPIA 3FMQA 1UCRA 2M1BA 5AIQA 3JTGA 2YU3A 3IRRA 3TDZC 3PQJA 1LJ9A 1D8JA 5CVJA 4MHGA 5JR3A 3QAHA 4WXCA 3WTUC 3F8BA 3LSTA 2KIFA 4EGYA 1R5GA 1XCBA 4AIHA 2EV5A 1YO5C 3OV8A 5J8CA 2XRNA 1OYIA 4XBFA 1WKMA 3MZHA 4KUMA 4EJUA 2DFIA 1H9TA 1J2XA 3Q9VA 1TQPA 3IL2A 3IWZA 4G8XA 4EVIA 2F5CA 4S04A 2XKOA 5JHUA 4OINF 3JSPA 1BOAA 3K1MA 1IW7F 1R23A 5IT9K 4DQ2A 1XMKA 3BJAA 1LQ1A 2EK5A 2OQGA 1QZZA 4O6JA 3GW2A 4BYYA 3E6DA 1FPQA 4ZYEA 2QQ9A 1CF7B 2A3SA 1ONVA 4WF2A 2F5FA 2O6GE 3HTUA 1BI3A 3GFLA 1P92A 4MEYF 2DK5A 3EDPA 2XAJA 1ZG1A 2HGCA 4U7DA 1MZBA 1HSTA 2HQNA 4HDVA 2QUFA 3E5XA 2RGVA 2Z5UA 2XAGA 1TNSA 4HOBA 1OMIA 2OU2A 4HF1A 2NRAC 5D4RA 1UHWA 1XGOA 1CGPA 1R1UA 1MJAA 3R61A 4JBAA 2A61A 2ZMEA 2MA3A 4YIFA 5D5XB 2WTEA 1XD7A 1LB2A 1LDDA 3GFMA 1HKSA 5HDNA 3JW4A 3VFZA 2MH9A 2NYXA 2KJBA 3KZZA 4ENJA 5CVUA 3QU6A 2R3SA 2O3FA 3F6OA 1PP7U 3GFJA 2NAZA 3KP7A 2EWNA 3TDUC 2RDPA 3LA3A 4HA8A 3WGHA 1HW2A 5ED4A 3K69A 5KK1A 3ZMSA 1R22A 1OYWA 3EETA 3FXRA 2A69F 4CHUA 2STTA 3C3WA 4A2UA 3ZN0A 4HX7A 5DYMA 4OOIA 3SFZA 1FYLA 4FT8A 2G9WA 3J7AO 3ROUA 1S29A 2VT2A 2EFQA 2QVOA 3E3VA 4KIFA 2QQAA 3TO7A 1KQ0A 5K5RA 3GX4X 3LQQA 4L0ZB 4UVAA 2A07F 2LKPA 4OIQF 3DQVC 1J0RA 4EJTA 5E17F 2L4MA 3RKWA 2W57A 1YW9A 2COMA 2J5PA 4KT5C 4F7ZA 4LG0A 2XKPA 3DP7A 4L9JA 2XROA 1ZRFA 2M30A 2L02A 3S2WA 1OPCA 2HOEA 3P9KA 4KA4A 1R7JA 2E7XA 3IKVA 3HRSA 1IF1A 4HDUA 1XDSA 4HQMA 2RVCA 1QQIA 4G6DA 2VT3A 3R6SA 2ACJA 2FBKA 3BPVA 3LFKA 3N97A 3FMRA 2Z3YA 2V9VA 4I01A 4MTDA 1KU3A 2VOPA 4LLLA 1Z6RA 1HKQA 5F1RA 2OA4A 5LRSA 3HRMA 3K0LA 3V7SA 4M74A 3T8RA 1ZYRF 4KYWA 4I0AA 2Q8KA 4ON0A 2VN2A 3K9TA 2UXXA 3FXQA 2IA2A 2HTSA 3O6BB 2OZUA 2OD5A 3K1NA 3ZQ7A 1RUOA 2DPUA 3WU1B 2M8EA 2OQRA 2PN6A 1D5VA 2KIUA 4P9FA 3ZP5A 2HKXA 3SHFA 1ON2A 1RNLA 3KLOA 1ZLKA 2ESNA 3KP2A 2RV8A 1AOYA 4XRFA 5FGMA 1U8RA 1ZGAA 5DV5A 4I09A 3H92A 3FM5A 3QRFF 4Y13A 3F6VA 3L7WA 4QWQA 3M9AA 4NQWA 2FMYA 4LG0B 4HX4A 1BI2A 1S8NA 3BY6A 3M8EA 4IHSA 2V1XA 3BDDA 4U0YA 2K7LA 1FBSA 3VEPA 1Z1DA 3VODA 4RS8A 3PQKA 2VE9A 5CJ9A 3VOEA 3I4PA 2DLLA 2DPDA 5ILUA 4P55A 5LEKA 3RTRA 1HSJA 2VBYA 5D8LB 3HRUA 1W7PD 4UHTA 3DFGA 1AWCA 3SZPA 3HRTA 4M6XA 5CLSA 1K78B 2FOKA 5AONA 2VBXA 3SQNA 3DV8A 2HYFA 2HR3A 1MJ9A 3FXUA 4R8HA 1GHCA 2P5KA 3GUDA 5K5OA 2IP2A 3J80K 3C7JA 1BC7C 2VOOA 5DCMB 3WTVC 2DBBA 4KICA 2E1NA 4A12A 5ILSA 1O3RA 5JFRA 2ISYA 2RN7A 4IRHA 5LEJA 2BGCA 2CO5A 5A2QZ 5FB2A 1W7PB 3GEZA 4M72A 3Q9SA 4RAZA 1BN5A 3G73A 3FWEA 3ABUA 1X3UA 2CG4A 3WG9A 2E7WA 5D5VB 4I0BA 5H6QA 5HVQC 1JHHA 2BYVE 2YPRA 4IRIA 3KCCA 3U9GA 4UNOA 4LMYA 2Z99A 2P6SA 1XN7A 3GF2A 2XUBA 4M73A 3WODF 1G4DA 1O3TA 1W4MA 3WGGA 2QWWA 2EFNA 1G3TA 1TLHB 4NB5A 1JHFA 1J7KA 5AIPA 4OIRF 5E1WA 4JQFA 3GZ5A 4Q48A 4XSZF 3RYRA 5JVTA 1FNNA 2ZO4A 3F8CA 3RYPA 1TQIA 4LB6B 2P8TA 1XGMA 2O03A 2K27A 2LNBA 2QBYA 3TOBA 2ADUA 3QP6A 3KETA 1GXQA 1UHMA 3K1PA 2LF7A 4ZZLA 5J8FA 1WWXA 4ESFA 2H94A 4KNYA 4KN7X 1TNTA 2OBPA 1U6GA 2DQRA 2L4AA 1ODDA 4U7BA 5HS8A 1FYKA 4KDPA 2K02A 3JAMK 4A0XA 1S3JA 2QENA 1D8KA 2CW0F 3ECHA 3B02A 4G7OF 5D5UB 2L3DA 2XV4S 1R36A 3W6JB 4XLPF 3KE2A 4OU0A 4B09A 1KU9A 1WRJA 1BC8C 1D3YA 4ZYDA 1KQ8A 1SFXA 4KMFA 1DPRA 4I98B 1T2KA 2R7DA 2LDUA 5IT3A 2BV6A 1I27A 1RI7A 2IA1A 1SMTA 4CO8A 2ZKZA 3KP6A 1LDKB 4WWCA 5CVVA 3KP5A 4ZH4F 2GQQA 2V1DA 1U5TA 4PDKA 2IPQX 4Z2YA 5LHGA 4I02A 3ECOA 3AAFA 3L2CA 4EJVA 3CDHA 4AVPA 1Z7UA 3HSRA 2WC2A 5EEGA 2HQRA 2RNJA 4EV0A 5BS6A 3HHGA 2Z33A 1XB4A 4BHPA 1MGTA 2C6YA 4HZFA 1U5TC 2JRTA 2ZNYA 1TW2A 2CWEA 2DU9A 4LLGF 3GVAA 5L3BA 4G94A 2H09A 5IT9Z 1KQ9A 1XGNA 2NS0A 3WE3A 4ASNA 2QQBA 1J9IA 3RJPA 2GZWA 1FOKA 4N9HA 2DI3A 1S7OA 2P7VB 2D1VA 1F4KA 4PCQA 1EH8A 1DP7P 4S05A 2GXBA 3F8MA 3IKTA 4R1HA 2Y0MA 2DAOA 3BOQA 2PMHA 2O61A 5CVIA 2FSWA 2ZXJA 1USSA 4IVNA 4YIIA 1K7AA 3M7GA 3DPTA 1USTA 2W24A 1H0MA 2D1HA 2CYYA 1YS6A 3ZMUA 3KLNA 2V79A 1MDMA 4A0YA 4UVCA 2JZYA 1LEBA 1E2XA 5DUKA 1ZG5A 2FEZA 2HFHA 3HYIA 3HUGA 3I58A 1BBYA 1XSDA 1LNWA 3I59A 5ICCA 4YFKF 3MCZA 3C1DA 2EB7A 4HLYA 1UB9A 4WX9A 5BPDA 2CQKA 3F72A 1FZPB 1B6AA 1TBXA 2HYGD 5E8GA 3BP8A 2Q2EA 4ZZDA 1Z9CA 2HS5A 3TO9A 1HXDA 1WI9A 2FE3A 1IN4A 2PJPA 1P2FA 2FQ3A 5K5QA 5LGTA 3REOA 4R79A 2ZMEB 3I53A 3V8KA 3COAC 1IAWA 3H3UA 2A5YB 1LEAA 4L9VA 1O3SA 1FWZA 4WXHA 2E1CA 1YQAA 5D4SA 2W85A 3QPHA 5L3DA 1TW3A 2W84A 1HW5A 4RGSA 2YX4A 3F23A 1ULYA 3V4GA 3P9IA 2VC1A 1IXCA 4H0EA 3L09A 3FZVA 3E6MA 2X4HA 3BZ6A 1KYZA 5E1ZB 3ZMTA 3E5UA 5H6RA 1KYWA 1ZLJA 3I0TA 2KIMA 4A6DA 4KIGA 5LRRA 3CO7C 2EA4A
chains in the Genus database with same CATH superfamily
3F8FA 3A2KA 4DJAA 1R6RA 4RAYA 1V4RA 2K86A 3CCMI 2DDAA 1Y0NA 3PSIA 3VWBA 1ZH5A 2P6TA 3GTOJ 2CFOA 1OCTC 3N05A 1G3YA 2W25A 4A3DJ 1RETA 3WU0A 1U8BA 1X3WB 2Y9ZA 1QU3A 1FY7A 1R58A 2CFXA 3BCAA 4DYRA 4XM3A 5LHHA 1P7IA 3HSEA 2KMUA 3IUOA 1YJ9I 1Z3XA 3BT9A 1Z21A 2NNYA 1OYYA 3U1DA 2QSHX 2GWRA 2A68F 3L1PA 4ESJA 3JREA 5FD5A 4OIOF 4LK1F 4YG2F 1HDPA 2PBIA 1BM9A 3RI4A 4XLCA 3J7YJ 1O3QA 2LF8A 4HAMA 4C3HJ 2HU9A 1X1CA 4EM0B 3HL2A 1TZLA 4BH9A 2D2WA 2VLAA 1I5ZA 5L3GA 4WK8F 2DT7B 4EMSA 2HZDA 1PDNC 3CUQA 1FOWA 1VI0A 2EZKA 1P4XA 3K4BA 3PFIA 5CVRA 3R4KA 3S2DJ 1NTCA 2DW4A 3OIQA 4PJJA 2R7OA 2M0CA 1ON1A 2X1CA 4Q5SF 1ZN2A 3ZQGA 3G1LA 1J59A 4I2OA 3EYIA 3Q3SA 5ICFA 5IPAA 3GXOA 1E0EA 1FBUA 3A01A 4L5IA 3GFIA 1K4SA 1IRZA 1DUXC 3S16J 3BJOA 1OR7A 4CCLA 5E3NA 3PL8A 4EJOA 2V9KA 4MIMA 5BQTA 1T38A 1MH3A 4XSXF 4B48A 3E0JB 5JI6A 2JA5J 3CUQC 4KMUX 2O5RA 1KU2A 3KP4A 4IHTA 1JE8A 1ZREA 3TW7A 2E2HJ 5L3CA 3I5UA 3QWLA 4P5OA 5HLIA 2QYOA 2PG4A 1ETWA 5BMZA 3ZPLA 1B1BA 4YRVA 1F1ZA 2Q0OA 1WJEA 2MLGA 1VTNC 2D45A 2VPRA 2WY8Q 1SAXA 1WH7A 3MWMA 1QO0D 5C4XJ 1XDUA 1GV5A 4PJLA 3L2VA 3HOTA 1D0YA 3OYGA 1OR7C 2DMQA 2XASA 2ESHA 3QP5A 2GIZA 3FXOA 2GM4A 2LTPA 4D5CA 3FHZA 3EQLF 4GYGA 4EM2A 2RNGA 3SZGA 3L9FA 5EGOB 1HOMA 3CLQA 2JVGA 1PYVA 3DBRB 1J5YA 5HDGA 4D7MA 2PEXA 2KDZA 1HW1A 4A6EA 2WAQN 2KHMA 4I6ZA 3ZQFA 1ZAOA 4HF2A 1IUYA 1G6NA 1MW7A 2GA2A 2XPWA 4LK0F 2LREA 3DF8A 1YRNA 2HQAA 4CUGA 1YIOA 1IN8A 3LSPA 2HOAA 2MFZA 3IC7A 5DD8A 3HTSB 3MD2A 2YX7A 1T0FA 2LFBA 4GO1A 5D6EA 2JUCA 3MZYA 4E70A 2HNHA 3VSLA 2UWMA 3AKZA 5H20A 3IRQA 3DWLE 2E35A 4NQWB 2E5ZA 4RLFA 1G3WA 1A31A 5J3LA 5TRDA 1IXRC 1FT9A 4RB2C 2HDCA 4XKWA 3IWFA 2IVMA 3ULQB 5M3MJ 4FTHA 2B9SA 1W5TA 2R7QA 3B73A 3J80Z 3QYBA 2BBYA 2L7ZA 4AYBN 5C44J 2JPCA 3JRDA 2STWA 2R7ZJ 3HBLA 2QSFX 3OYBA 3GTQJ 4BKXA 2LYCA 1JT6A 1TWAJ 2I10A 3AG3H 1R1VA 4M71A 4Y7NJ 1O7LA 1YITI 2LC2A 1VZ0A 1IV6A 1MMGA 2FNPA 5DCFA 1T0FC 2MBFA 3OS0A 1I3QJ 1KA8A 3R60A 5E8IA 5HS7A 3BG6A 3WTTC 5FROA 2ISZA 1TTYA 2XAHA 1U0JA 3FF5A 4GXOA 2YSRA 5DUIA 2IJLA 5D8KB 4GCVA 4A3FJ 3S3NA 1APLC 1IN6A 1JTXA 2R7WA 1V5GA 2FUG2 4A3JJ 1T08B 4G12A 2P5LC 1B9MA 2WV1A 3HXLA 4LB5A 3P7NA 1EF4A 1X58A 4PGGA 4A3IJ 3T0YA 2VXZA 2XAFA 3O8GA 1QGPA 2HKOA 3PSFA 3WG7H 3U1KA 2DQLA 1SFUA 4FX4A 2XSDC 1TT0A 2CQQA 3H0DA 2XC7A 4RGRA 4M9XA 4C2TA 5L3EA 3E97A 1H88C 3H5NA 4ZYGA 5E1XA 1JT0A 1Y8QB 3ML6A 2HVSA 2V7FA 1Y1WJ 2XGCA 2FXAA 3S8PA 2HPIA 1CF7A 4IPAA 4BHBA 2XIGA 4G6QA 4AU7A 1IN7A 2HXIA 2VQGA 1RKWA 3I4MJ 4MO7A 1S7EA 3D5SC 4F92B 1FTTA 2V6CA 4IHYA 1OCRH 2LG4A 2AXLA 1XSVA 4U88A 4KJZA 4WXDA 1U3EM 2E34A 2R7FA 3PNYA 1QZEA 4QLCU 3HIFA 2D5VA 3BZKA 3OYMA 5C3EJ 3SXYA 4HV5A 2LR8A 3H9JA 2O8XA 3S14J 4DBQA 2Y0SA 1R4MB 2DXIA 4L0YB 3A0HC 1O7FA 5LLQA 1ETKA 2A05A 4XKCA 3OS2A 2XGEA 1GT0C 2HEOA 1IV8A 3H1CA 2WV0A 1L0OC 3MAJA 1XMAA 3WTXC 4ENKA 4IHWA 2X0LA 4D1QA 3CMEI 4L5EA 1SFOJ 3MKYB 1YS7A 4K2EA 3K4JA 3TP3A 2ETHA 1SFEA 2BY1A 2EFPA 4ZJZA 2RC4A 1EH6A 1F9NA 3DKWA 4FE7A 1P4WA 3F22A 3WTWC 3IH4A 2E1MB 3W2WA 3QPTA 1C0WA 2L2OA 2OCCH 2DN0A 3OOUA 3RSNA 1ETOA 2M0MA 1TC3C 3HB9A 3KEQA 2VONA 2OJED 3GTLJ 3HOVJ 2MC3A 1MMSA 1U2WA 4CH7A 5KVRA 4A93J 3NQOA 2EV6A 4FQGA 4ESBA 1H89C 4GGGA 1K83J 4OMZA 3I64A 4E6KG 1WQ2A 4L18B 3ZMZA 5GPAA 1PP8F 4XRMA 4Q4ZF 2M4GA 4LD5A 3ZOBA 5LHIA 3HOSA 2EZHA 1XSXA 1Y0UA 1SD7A 1UFMA 2HOSA 2E5NA 3KPHA 5J4YA 1UG0A 4BQAA 1T8IA 3MQ0A 2AHQA 3HKZN 2QGUA 2F4MB 3Q5FA 1X4PA 2HWVA 2WAFA 3BJ6A 1YW8A 2Y48A 3GWZA 1I3AA 3ERED 5JHFA 3LQRA 1OQYA 2OCEA 3S93A 3JRAA 3I9V2 5HLGA 4I7HA 1HQCA 1TWGJ 5KAIC 1W5SA 2QF7A 2FMLA 1MSFC 4IJAA 2R5YB 3JAMZ 5FD6A 4E7ZA 3TOAA 3H0GJ 1Z05A 1ERDA 1FC3A 4PK4A 1BIAA 2EA2A 3CCJI 2MD5A 4MEXF 2VODA 1O57A 1XCVA 2OF7A 3PIOF 4XLFA 4HNUA 4EQQA 1R00A 4LIVA 4D0PA 4UVBA 3AG4H 3EPZA 4PZJA 5FJ8J 2DO7A 1HBXG 3DCFA 3S3MA 1YLFA 1LDJA 2M5WA 4FHTA 5HNHA 4HX8A 1YFHA 2VI6A 4HF0A 5LBQA 2DA3A 4Q47A 2VJ4A 5IYBJ 1BR1A 1VNDA 5DEQA 1SVOA 4MQVA 1B72A 5FLXK 1PUFB 4KFCA 4IXAA 3J7ZI 5EG0A 2P7CB 3T1BA 4B8XA 1SD5A 4IF4A 5E79C 1RUNA 1IRFA 3M1CA 2V1UA 5HS9A 2QBYB 3BROA 4U0WA 1Z91A 1H9GA 5CKTA 2JA8J 5FKOA 4CGZA 2FBHA 5E20A 2EIKH 2K9LA 3CJTB 3OYJA 1OCCH 2CUFA 2XGXA 1MNDA 3MMYB 2E36A 4G7ZF 1WGXA 1B8IB 2W4SA 3ZQHA 4ZDLA 5K7HA 3ASOH 1DPUA 4TV7A 1T98A 3SYTA 3GO5A 5DTDA 3DEUA 1A36A 5K1YA 3RPUA 3ZQLA 1Y56A 1RPWA 3CESA 3X2QH 1Y6IA 2BZTA 2LSOA 1GVJA 5E3MA 3P5JA 4HYEA 5B66C 2KT0A 2BHYA 1FLIA 1OCZH 2WADA 1AHDP 2DTRA 3M8FA 2A6HF 3GYHX 2ZJ2A 2PQ8A 3F21A 5GP9A 1AA7A 3FMSA 2I5UA 2K4BA 1ZRCA 3FXLA 2V4JC 4BEHB 1QVTA 4HRIA 1BIBA 2FA5A 1I50J 3IHUA 1Q1HA 3CCUI 3FX3A 2VQCA 2P4WA 1FP1D 4G7HF 2DFEA 3H5AA 1MJBA 1VQOI 5FLXZ 2G7HA 4M9SA 3JSOA 2NVYJ 2IS1A 4ZYHA 1MD0A 4A0ZA 2KKOA 1Z0XA 2O9LA 3M8JA 4BJTA 2FF4A 2R5ZB 3LAJA 5EZGA 5FO5A 3TQNA 3OYFA 2M87A 3SZTA 1MMNA 2BY2A 2FQ4A 1IO2A 3GTJJ 3OYCA 4RGUA 3WGIA 2L54A 3SDGA 2WB1A 2QM3A 1NG6A 2CQXA 4O3MA 3OWTA 1ZHFA 3OOPA 3E5QA 4EM1A 2X6OA 2P5VA 3E6BA 4MQ9F 2FRHA 1RKTA 2M45A 1PVEA 1MH4A 1WVRA 4LITA 2VJJA 3IV5A 4KN4X 2ZXWH 4PGHA 2EILH 2BEOA 3OYAA 2NOJB 2RREA 3ESWB 1WPKA 2EZIA 2BHZA 1JJ6C 2G7UA 2Y69H 1J75A 1NHAA 2LKXA 2F2EA 1K6OA 4QPQA 2DT6A 5J1UA 4D9JA 3UR3C 1ETQA 4UUVA 1U5TB 3S15J 2ZFWA 1VQ4I 1IN5A 2XHKA 4HQEA 2K3FA 1DU6A 5J47A 2DCEA 4CICA 3Q0WA 5C4JJ 2TDXA 1LE8A 5M5XJ 2XSJC 1DDNA 4XRSG 2BOLA 3WTYC 4QTRA 5M5WJ 3GLXA 3TO6A 2O0YA 4OMYA 2J5OA 1XTAA 1Z67A 4O5VA 3J81K 4N9IA 5HDKA 4UV8A 5JLXA 1QA6A 1QPMA 3K4KA 1YG2A 4CXFA 3ISPA 2CW7A 1RIOH 1VQLI 1FOXA 1G3SA 4JYKA 1MMDA 3BR6A 4S0HB 3BQYA 1D0ZA 2NVUB 2DA6A 2R4GA 3RKYA 3TW6A 5F1JA 2IRFG 5IYCJ 2VC0A 1K61A 2H1LA 1P6RA 2A6EF 3RKQA 2NOGA 1GV2A 4A69C 2VB6A 3RKXA 2KJCA 1RRJA 3RZDJ 3KZYA 1D0XA 2ZJRF 1QHHD 2HVRA 4N0BA 5F64A 2GLOA 5LGUA 1STZA 4RB3C 3MFKA 2F5DA 2B0LA 3D5RC 4L9TA 1I6HJ 1TQMA 3KP3A 1E3PA 4CCOA 3CJNA 3E6CC 2YR2A 1AU7A 2DT5A 5KAFC 2CGPA 1EH7A 5D6FA 4AD9A 1ZG3A 4HBLA 2YU9J 1FYMA 2EV0A 4IRGA 2MABA 3WHCA 4X1EA 4HNTA 4BNCA 2UZKA 1B9NA 2VE8A 3CO6C 3RIRA 5F0HA 2H8WA 2WAQA 4E7SA 9ANTA 3C2BA 1LVAA 3J81Z 5CPRB 1FTZA 3CUOA 1TT5B 2V9PA 5ILVA 1IZ1A 1PJRA 3DPLC 3HSFA 2GA1A 1SMYF 1OJLA 2LY2A 1HKTA 5HOOA 5D5WB 1ZGJA 2IXSA 3ZN1A 4FX0A 5FKKA 3N4MA 1R9TJ 3W6KB 3D5LA 5F6FA 3JRHA 4C2MJ 1YYVA 1RZ4A 4M6VA 2IS2A 3I54A 1B4AA 1WH5A 1YW7A 2F48A 1EV7A 1K78A 4KT6A 4UUSB 1V3FA 4AWXB 4U0VA 1T6SA 2CUJA 1IC8A 3A03A 4MTEA 1MDMB 4C9YA 4L5JA 4DIQA 2N8GA 3LA2A 3LOCA 1YJWI 1JXSA 1B59A 3AL0C 3V7CA 3ELKA 4M6YA 1XGSA 4CCJA 3O2PE 3HUGB 3C18A 2DTZA 1QZYA 2K3PA 4ENNA 1POGA 5F04A 3TKYA 4YFXF 1WSUA 2HTJA 3I59B 3LL7A 5DCMA 2Z2SB 1SD4A 3PNTA 5EEHA 2JTVA 2NNNA 1NG7A 3BTLA 4A3EJ 2RKHA 1JKPC 2Y75A 5CYVA 1UAAA 5KCMA 3V7RA 4M9ZA 4BQQA 2HZTA 2FBIA 2VIXA 1M1EB 2R0QC 3ERMA 2IGOA 1A6QA 2XVCA 2WWYA 1KZHA 4Y15A 2WB1N 1FP2A 2OPTA 4XL9A 2VUMJ 1N75A 1JGSA 1W7PA 4WCGA 3TBIA 2WBMA 1R1TA 1FMWA 3W3CA 5B3SH 3BR2A 3ZQCA 2Q2EB 4B44A 2CV1A 3ABMH 4DOZA 1LFUP 2DMTA 2KRFA 3FIWA 4EGZA 1WHUA 2CRGA 3ZMVA 3IAS2 1I1GA 4AIJA 2DFFA 3L00A 3TMOA 1YI2I 1FSEA 4DGWB 1LVKA 3GLLA 5M3FJ 3R0JA 2RQPA 3TGNA 4BQNA 5HLHA 2XAQA 5FKNA 5B1AH 2OUMA 1QNTA 2VBWA 1JUMA 1N25A 3BCBA 3QU3A 2PI0A 2H1KA 1WJDA 2BXZA 5IP7J 4XLAA 1GDTA 1IRGA 2QLZA 3VYSB 4GDFA 4HNVA 2LVSA 4LFUA 2VBZA 3D0SA 2EFWA 1JKRC 2MLKA 1BI1A 3FK6A 4J19A 2MW8A 4M3EA 1P4AA 2MSYA 2GIVA 1WFXA 1L3LA 2QZ8A 1RR8C 4RAGA 3HM5A 1I1SA 3LA7A 2XB0X 4XONA 3CMYA 4AIKA 3LSGA 1VF9A 1OKRA 2EIMH 2MH2A 3G3ZA 2H27A 3MEXA 2PLYA 1YHQI 2Z9OA 2DK8A 2LY1A 2FNAA 4E7JA 5J6XA 4P96A 3WTZA 5DS9A 1E17A 2KL4A 1IDYA 3GZNB 3AG2H 3WTSC 3U21A 2VKHA 4A5NA 2GAUA 3LMMA 4BXUA 1U78A 4RB1A 1G2HA 2WY7Q 1F5TA 2JK3A 2W82A 5A2QK 4RA2A 2XF7A 4G9YA 4KITB 5ICEA 4RM2A 2NVQJ 2QKLB 2JPBA 4BDYA 1UMQA 2Y30A 2JVHA 4HLXA 2RAEA 3V8LA 2ZXHA 3GCMA 3LSHA 1MBGA 4FISA 5FFZA 2H6BA 3AFHA 1KGSA 4RGXA 4ZC3A 1JTYA 5FLMJ 3U2RA 4LLNA 1MKMA 1R5HA 2OV7A 5ICGA 3HKZA 4XLNF 4AVZA 1FBQA 1WJCA 4A3MJ 1T39A 1YIJI 4GYIA 4LJZF 2IA0A 2AQFA 2PFBA 3EYYA 4XOPA 3B6AA 4Y17A 1YTYA 4BGDA 4XRSA 1S7AA 4NC6A 2E2JJ 3BQZA 3LSKA 4JK1X 4ETSA 1IG7A 2JSCA 4LGWA 2Q1ZB 1IRXA 3OMYA 2XAUA 4MNUA 4CDGA 4GRIA 5FLVA 4QPOA 3OSFA 3HHHA 2K9MA 3I4NJ 3OR2C 1HCRA 1ZRDA 4CYDA 1JI8A 2K5CA 3HGYA 3CTAA 5ERIA 4A5MA 3JTHA 2EJRA 3K2ZA 1A5JA 4B4CA 4QIWN 1AKHA 2H8RA 4BHCA 1OCPA 3L2WA 3M1EA 2PMUA 3VB2A 2M8GX 3FM3A 5TJJA 5EZHA 1REPC 2KZVA 2M3AA 2BE5F 3KEOA 3R0AA 1KU7A 3BWGA 2ZBKA 2IT0A 3BPXA 2GXGA 1I6XA 6PAXA 4I76A 3RPQA 3LWFA 2AS5F 3I71A 4NHJA 2W1OA 2M7BA 2UXNA 5HNFA 2OZ6A 2YS9A 4RB0A 2CSOA 4P9UA 3F3XA 3KFWX 5L3FA 3EUAA 2X1EA 3CUQB 3WE2A 4MGRA 5DDGA 1BL0A 4AUXA 2L01A 4Y33A 4EJWA 3SDBA 1ETXA 3FXJA 5DD4A 3LSRA 3ABTA 2PJRA 2JT1A 3NRVA 1WJFA 3T8TA 3MKWB 3CP8A 2F5EA 3BTCA 3LAPA 1BJAA 3H3ZA 3V8JA 1WCMJ 3QOPA 3HC7A 3JRGA 2K85A 3S1QJ 5FFXA 1FSHA 1A04A 2L9SA 2P0WA 4CZZA 3A01B 3F8NA 2ZCWA 2ZNZA 1Z6TA 4BUPA 1BI0A 5E18F 2K4JA 5EDNA 2X6XA 4UV9A 5TISC 3DEWA 4RLQA 3BG7A 1QBJA 1K79A 4E7LA 3BR5A 4UXNA 2X9DA 3T5XA 4YFNF 1ZK8A 3DXJF 3OYDA 2FU4A 1S6LA 2LRDA 3BTIA 4PJMA 4HW0A 3ZMDA 2L7MP 2NXNB 1VQNI 3G4SI 1IGNA 5BOXA 2ELHA 1WJBA 1IXSB 2Y31A 1YE9A 5IP9J 3S3OA 4L9NA 4BAYA 1HDDC 3P9CA 1J09A 1GUUA 3NEUA 2IW5A 5LGNA 1SD6A 1FX7A 3FKJA 2XGDA 4DNCA 1PUEE 4ZTFA 4ENMA 3S2HJ 3ZRGA 3RDIA 2BY3A 4AIDA 1GXPA 2H6CA 4HV6A 3EUHA 4OIPF 3CLOA 1ZARA 2QQ8A 2OAZA 3O3KA 2XPVA 4KIBA 2EFOA 3GZ6A 1MNMC 5BPIA 1SVLA 3FMQA 2LBFA 4OWRB 4MLOA 4UB6C 2R7SA 1NK3P 1UCRA 3BR0A 2M1BA 5AIQA 5IYDJ 2MGQA 3DU6A 2KIQA 1D1CA 3JTGA 2V26A 2E71A 2YU3A 3IRRA 3M3YJ 1YRNB 3TDZC 4DYQA 2PX9A 3PQJA 1LJ9A 4N4NB 5JLWA 3RQIA 1D8JA 2IGMA 5CVJA 3EUHC 4MHGA 5JR3A 3QAHA 3L2QA 2VASA 4WXCA 3WTUC 3F8BA 4NNJA 3LSTA 4XORA 4PFPA 2KIFA 1VFCA 1XPXA 4EGYA 1T95A 4MFEA 1R5GA 2KRCA 2LKSA 3FBIB 1XCBA 4AIHA 2E60A 2EV5A 5DM6F 1YO5C 3VPRA 2UUZA 4IKFA 4EATA 3OV8A 5EJCA 5J8CA 2XRNA 1E3OC 3CC2I 3H9GA 4GFBA 2GXAA 4CCNA 1OYIA 2EBIA 3BR1A 2DODA 3H5RA 4XBFA 5IOYA 1Y8RB 1WKMA 1H8AC 3MZHA 4KUMA 4EJUA 2DFIA 1H9TA 3HOXJ 1YX3A 4UUTA 1J2XA 2DMPA 2CUEA 3Q9VA 1TQPA 2CW8A 4BACA 3A0BC 3IL2A 3IWZA 3SFIA 3DEEA 3OIPA 4G8XA 2AQEA 4EVIA 3GTGJ 2F5CA 1BOBA 2R7UA 3L2RA 3PO3J 3K6GA 4S04A 2DYSH 2BW3A 2XKOA 4IQJA 5JHUA 4OINF 2EPFA 3JSPA 1BOAA 3K1MA 1IW7F 1R23A 5IT9K 1XMXA 2TCTA 4DQ2A 1XMKA 5IOZA 3OYEA 4D7NA 3G6EI 1ORKA 3MN2A 3BJAA 1LQ1A 2EK5A 2OQGA 1QZZA 4O6JA 3GW2A 4BYYA 3E6DA 1FPQA 4BL0B 3FXKA 2DDBA 4ZYEA 2L0KA 2WA0A 2QQ9A 4UB8C 1CF7B 3OIOA 1ETYA 1ONVA 2A3SA 1GVDA 4WF2A 2F5FA 3K7AJ 1D1AA 2O6GE 3PNVA 3HTUA 1BI3A 4YIRX 2LH9A 2ZC2A 3GFLA 3NWTA 2AO9A 1P92A 4MEYF 2DK5A 3CD6I 3PUFA 3KX2A 3EDPA 3JRBA 3OS1A 1XS9A 1SAUA 2XAJA 1ZG1A 1BW6A 3S1NJ 2HGCA 4U7DA 4BY1J 4LG3A 4CSWA 4U87A 1BR2A 1MZBA 4HEA2 1V54H 1HSTA 2HXOA 2HQNA 4H4KC 3VYUB 2I8DA 4A3CJ 3ZGKA 4HDVA 2QUFA 2CQ7A 1W1WE 3E5XA 4NC8A 3PIPF 1ZR2A 1IJWC 2RGVA 2Z5UA 4ANJA 1X2NA 1VQ9I 2XAGA 4MFDA 1JKOC 5K7FA 3K10A 1TNSA 3M07A 3RQ4A 4HOBA 1OMIA 2OU2A 2JA6J 4HF1A 4IHVA 3PM1A 4IL6C 2PMZA 2NRAC 3GTMJ 3WU2C 4C2UA 5D4RA 1VQ8I 1UHWA 3VDXA 1RR7A 1XGOA 4Z6YA 4E7KA 1HLVA 1R1UA 1CGPA 1MJAA 3R61A 3CC4I 4A3KJ 4JBAA 2A61A 3EUKL 1WI3A 4C30A 2ZMEA 2R7XA 3BG3A 2MA3A 1W36C 4YIFA 5D5XB 2WTEA 2L7FP 1XD7A 3F0CA 1LB2A 3K4NA 1FIPA 1LDDA 3GFMA 1EA3A 1HKSA 5HDNA 3JW4A 1K4TA 3VFZA 3ZQIA 2MH9A 2NYXA 2KJBA 3KZZA 4ENJA 5CVUA 2LK2A 4RAFA 3QU6A 2R3SA 1QHGA 4BE1A 1LPQA 2O3FA 3CCYA 3F6OA 1PP7U 3GFJA 1QRYA 2NAZA 3KP7A 2EWNA 3TDUC 2OTLI 3CDIA 2RDPA 1MSEC 2MYSA 1YJNI 3LA3A 3TL4X 4HA8A 3WGHA 2A6TA 3J7AY 1T56A 2ZMEC 4M3BA 5ED4A 1HW2A 3K69A 2XRLA 4DYCA 5KK1A 3ZMSA 2F4OB 2K9SA 3MKZA 1R22A 1OYWA 3BR3A 4XLHA 1R5ID 2WAEA 4AC0A 3DKYA 1UHSA 3B6CA 3E7LA 3EETA 3RPUD 3FXRA 2A69F 4CHUA 2STTA 5FRNA 3C3WA 4NBQA 4A2UA 3ZN0A 2RQQA 5E3OA 5F08A 4M3GA 4HX7A 1RC9A 4OOIA 5DYMA 3SFZA 2VQHA 1FYLA 5CQGA 3CQZJ 4KISA 4FT8A 2G9WA 3J7AO 1QVUA 1S9HA 3ROUA 1MBEA 1S29A 2VT2A 2HDDA 1TL8A 2HVQA 2EFQA 3W2VA 4IEJA 2QVOA 3E3VA 3HOYJ 4KIFA 2QQAA 2X6YA 1B72B 4W97A 1P9QC 3TO7A 1KQ0A 5K5RA 2IEKA 3GX4X 3LQQA 4L0ZB 1S72I 4UVAA 5EG0B 3FHNA 1XG1A 3A4CA 2LKPA 2A07F 4OIQF 3DQVC 5IY5H 4B47A 1J0RA 4CCKA 4EJTA 2DMUA 1HA8A 5E17F 3Q0VA 2L4MA 2MG4A 2M9HA 3K4MA 1TWHJ 3RKWA 2W57A 1YW9A 2COMA 2J5PA 4KT5C 3OL4A 4F7ZA 4LG0A 2VJ5A 4BU2A 2XKPA 3DP7A 4L9JA 4XK4A 2XROA 1N78A 1ZRFA 2M30A 2L02A 1GLNA 3S2WA 1OPCA 2B7EA 2HOEA 3BG5A 3HOZJ 3P9KA 3K70C 3HGGA 4KA4A 4PUSA 2HYJA 1R7JA 1DGRM 2E7XA 3KEYA 3IKVA 1DP3A 3HRSA 1IF1A 2GOMA 4HDUA 3CCVI 1XDSA 1X1AA 4C3JJ 3JRCA 4HQMA 2RVCA 2IS6A 2ID3A 1G8XA 1QQIA 4G6DA 4XICA 3IH3A 2VT3A 3G71I 3R6SA 2ACJA 2FBKA 3BPVA 3QYEA 2CU7A 3LFKA 3N97A 3FMRA 2Z3YA 2V9VA 2L9NA 5LD2C 2BVMA 4I01A 3GTPJ 1ZQ3P 4MTDA 2ZFUA 2ZB9A 2JMWA 1KU3A 1LFBA 3C2GA 2XDVA 4LLLA 2M4KA 2VOPA 2W7NA 2R7VA 1UELB 1Z6RA 4JP0A 4RMNA 1HKQA 4XR6A 5F1RA 1JKQC 2OA4A 1VQPI 4XLEA 5LRSA 2LLKA 2VJIA 1TWFJ 3HRMA 3S1MJ 2CV2A 3K0LA 2ZSIB 3V7SA 4XOTA 4M74A 3VYRB 2ZJPF 3T8RA 2KISA 1ZYRF 4KYWA 4I0AA 2Q8KA 4BE0A 4ON0A 1BJZA 2VN2A 3CZ6A 3K9TA 2UXXA 3FXQA 2K9NA 3KYLA 2M7AA 2IA2A 2HTSA 2PMZN 3O6BB 2VL8A 2OZUA 2OD5A 1ITYA 3I55I 3K1NA 3ZQ7A 1T33A 1RUOA 2DPUA 2BXYA 1D5YA 2LY9A 2HOTA 3WU1B 2VPLA 4DZPA 3H35A 3K4LA 2M8EA 2OQRA 2PN6A 3ASNH 3DU5A 1D5VA 2ME0A 4A3LJ 2KIUA 3CCLI 2M34A 4P9FA 1X1BA 3ZP5A 1LE8B 4IZZA 2HKXA 3SEZA 1VQKI 3LFUA 2CJJA 3SHFA 1ON2A 5EGOA 4RDUA 1QPIA 1RNLA 2EQRA 3KLOA 3ABLH 1ZLKA 2X1DA 5H2FC 2ESNA 3KP2A 4QSHA 1OISA 2ELJA 1ACIA 2RV8A 4A3BJ 3AG1H 5J1RA 1N77A 1R49A 1AOYA 3C2HA 4P1WA 3TP0A 2JA7J 4XRFA 3VYTB 2IGKA 5FGMA 1U8RA 1ZGAA 5DV5A 4I09A 3H92A 3FM5A 3QRFF 4Y13A 3FK7A 1S5LC 3F6VA 3L7WA 3JRFA 1ZGWA 4QWQA 4ZDPA 1JGGA 3M9AA 2L7KA 4NQWA 3CCRI 2FMYA 4LG0B 1WJAA 4HX4A 1BI2A 5B5EC 1G59A 1S8NA 3BY6A 3E1SA 3M8EA 1Y39A 4DBRA 1A6IA 4IHSA 4NDLA 2V1XA 4B3XA 3DKXA 5TGTA 2X48A 3BDDA 4U0YA 2K7LA 3G2BA 1U9NA 1FBSA 3SJMA 3VEPA 1Z1DA 3VODA 4RS8A 5E3LA 1D1BA 4Y3OA 2CMPA 1Y1VJ 3PQKA 2VE9A 1MNEA 5CJ9A 3VOEA 4BJ6C 2E2IJ 3G1OA 5EYRA 3I4PA 2ZJQF 2L9VA 4BBRJ 4BS9A 2DLLA 4F93B 1F36A 3MZ8A 2DPDA 2ID6A 4JX5A 3HEFA 5GAEJ 5ILUA 1VQ5I 3FDYA 4G6TB 3AL0B 4P55A 4X0GA 3H3VK 5LEKA 5J40A 3RTRA 1HSJA 3GMEA 2VBYA 2W00A 4LOCA 5D8LB 3HRUA 3IH2A 3OYHA 1W7PD 4UHTA 4DW6A 3DFGA 4HG2A 3VSKA 1AWCA 3SZPA 3HRTA 2E19A 4M6XA 1A35A 5CLSA 1K78B 4XQFA 2FOKA 5B1BH 2R92J 3DPUA 2JQ7A 5AONA 3L2UA 3DLLF 3OSGA 2VBXA 3SQNA 5EEAA 1LKXA 3DV8A 2HYFA 1FEXA 2HR3A 1MJ9A 3FXUA 4R8HA 1GHCA 2P5KA 3GUDA 2ZXIA 1MBHA 2UV1A 3K4CA 2XPUA 1ZTRA 1LUJB 5K5OA 2IP2A 3J80K 3C7JA 2DA5A 1BC7C 2CS3A 4XN0A 2VOOA 5DCMB 3WTVC 2DBBA 3HOWJ 4KICA 3NAUA 2VKDA 3CCQI 2E1NA 4A12A 5ILSA 3V42A 1O3RA 2FX0A 5JFRA 2ISYA 2KQRA 2RN7A 4IRHA 2KZGA 5LEJA 2BGCA 4XKBA 2VXDA 1SANA 3OYLA 4B43A 4ZYAA 3BC8A 2CO5A 3PO2J 5A2QZ 2DA4A 5FB2A 2DJIA 1W7PB 3GEZA 5GTHC 3KIOA 4M72A 3Q9SA 4RAZA 1BN5A 3D1NI 1KONA 3FWEA 3ABUA 4PJNA 3G73A 5HLTA 3CF2A 1X3UA 4NC7A 3LNQA 1DU0A 2CG4A 3HDDA 2ICWG 2R93J 5GAHJ 3WG9A 2E7WA 5D5VB 4I0BA 2W48A 1SC7A 5H6QA 5HVQC 1JHHA 2BYVE 1XX5A 3KYDB 5M5YJ 4ZTJA 1X3ZB 2YPRA 4X6AJ 4IRIA 3KCCA 4FASD 3U9GA 4ABZA 4UNOA 1U9OA 2CQNA 4LMYA 1BW5A 2Z99A 2YUSA 1ZR4A 5EF6A 2JN6A 2P6SA 1XN7A 2KDOA 2DOFA 3CC7I 2DOEA 3H9QA 2OTJI 3GF2A 2E1MC 2XUBA 1SVMA 1CQTA 2DA7A 2CUZA 4V2GA 1JUPA 4M73A 3WODF 2Z1DA 1G4DA 4IHXA 4V19K 1O3TA 1W4MA 4CYCA 2L5QA 3PFYA 2R5YA 4E7HA 3RZOJ 3WGGA 5FKLA 1X2MA 1ZKGA 1FJLA 5BNGA 2VQLA 2QWWA 2EFNA 2V1NA 2P81A 2OC6A 3PUBA 1G3TA 1TLHB 4NB5A 1JUSA 3HOUJ 4BBSJ 1JHFA 1ZELA 1J7KA 4EEFG 5AIPA 4OIRF 2LOOA 4CCMA 1FMVA 5E1WA 2VKVA 4JQFA 3GZ5A 2JWTA 4E4HA 4Q48A 4XSZF 1YX5A 3RYRA 3OYNA 1MIJA 3NARA 1FNNA 5JVTA 1X1PA 2ZO4A 2EIJH 3F8CA 3A02A 2QEXI 2DMNA 1PUFA 3CCEI 3RYPA 1TQIA 4LB6B 2P8TA 4V2FA 1XGMA 2HI3A 4OAZA 3DTEA 2QCOA 5KHDA 2CV0A 2EZLA 2O03A 1WZ2A 2K27A 2LNBA 2QBYA 1UJ8A 2TRTA 2ADUA 2Y2ZA 3TOBA 4XIDA 3QP6A 3KETA 1FIAA 4PJ0C 3UKGA 1GXQA 2JSPA 1UHMA 3K1PA 4BDZA 2LF7A 4ZZLA 3DLAA 1B8IA 1TWCJ 5J8FA 4IQ4A 1WWXA 1R71A 2HQ5A 4ESFA 4CA0A 1VQ6I 2H94A 3JRIA 4KNYA 4KN7X 3JCUC 2LP0A 3QODA 1BR4A 1RESA 1TNTA 2OBPA 2X6WA 1U6GA 2DQRA 2L4AA 1ODDA 4U7BA 5HS8A 2K40A 1FYKA 4KDPA 2K02A 3JAMK 3TEDA 4A0XA 4BEHA 1S3JA 1AKHB 2QENA 1JJ8C 4D5FA 1MMAA 5LFAA 3SEQA 1D8KA 2CW0F 1MBKA 3ECHA 4ZDOA 4A3GJ 5IP6A 1V5EA 5GADJ 3B02A 4G7OF 2JA2A 1TP4A 2GBYA 3HJEA 2R5ZA 5D5UB 2L3DA 5K7ZA 2XV4S 2LD5A 1R36A 3W6JB 4XLPF 3G1MA 3KE2A 4OU0A 4B09A 1KU9A 1WRJA 1P7JA 1D3YA 2QKMB 3IAM2 1FOYA 1BC8C 2QSGX 4YEJA 5F27A 3HG9A 4ZYDA 1KQ8A 1SFXA 4PSXA 4KMFA 1X4OA 3LSIA 1XC5A 2PJRB 1DPRA 4I98B 1T2KA 2EH3A 2R7DA 3ZCOA 1W5CC 2LDUA 1EJ9A 5IT3A 2ECBA 1UG2A 1X19A 3GBGA 4C3IJ 4B1RA 2ZSHB 3DTIA 3QOEA 2LMDA 2BV6A 2VKEA 1VQMI 1I27A 3K2AA 1RI7A 3FISA 5GTIC 2IA1A 3NWSA 2BY0A 1W0TA 3FKIJ 3HPHA 4BJ5C 4CYCB 1WJ5A 1VQ7I 1SMTA 4CO8A 2NVTJ 4BXXJ 2ZKZA 3KP6A 2F6CA 1LDKB 4WWCA 5CVVA 3KP5A 4ZH4F 3I56I 2AXTC 2GQQA 2V1DA 1U5TA 4PDKA 2IPQX 4Z2YA 5LHGA 2EINH 4XMYA 4I02A 1IDZA 3ECOA 3W2AA 4IOAF 3AAFA 1Z7LA 2ELKA 3L2CA 4EJVA 2B63J 3CDHA 4AVPA 4II3A 3M4OJ 3BZCA 1Z7UA 3HSRA 2WC2A 5EEGA 2ME6A 2HQRA 5J1YA 1E3HA 1BA5A 2RNJA 2R7TA 3LSMA 4EV0A 2DYRH 3MVPA 2JUGA 5BS6A 4CZCA 3HHGA 2Z33A 1XB4A 2KRHA 3I3LA 4BHPA 1K6YA 1MGTA 2LBFB 2C6YA 4HZFA 1U5TC 2ZNYA 2DFHA 1TW2A 2CWEA 2DU9A 2JRTA 5F0FA 4LLGF 3FXMA 5GAGJ 3GVAA 2X85A 4AM3A 4F3QA 4FCYA 5F0CA 1YOVB 5L3BA 2IS4A 4G94A 2H09A 5IT9Z 1NH3A 2R7RA 1KQ9A 1I39A 2O7OA 1XGNA 2NS0A 3WE3A 2Z16A 5JVGF 5DM7F 4ASNA 2QQBA 1J9IA 3RJPA 2GZWA 4ITVA 5GPCA 1FOKA 4N9HA 2DI3A 2M2EA 1S7OA 2P7VB 2D1VA 1F4KA 4PCQA 3ZR8X 1EH8A 3FBNB 1DP7P 4S05A 2FJ1A 2GXBA 3F8MA 3IKTA 4IOCF 4R1HA 3CF5F 2Y0MA 1OFCX 1UZCA 3HZJA 1V5FA 2DAOA 3CMAI 4OAYA 3PJRA 4M3DA 1ETVA 3BOQA 3OYKA 2PMHA 2O61A 3F9KA 5CVIA 2FSWA 2JRMA 2ZXJA 4DZJA 1USSA 4IVNA 2O8KA 2BVLA 1MBFA 4BQOA 4YIIA 5FRMA 1K7AA 2QA4I 3M7GA 2COBA 4IX7A 3DPTA 3QPSA 1USTA 3CCSI 2F5VA 2MC4A 2W24A 1H0MA 4UY8I 3OYIA 2Y0SN 4NUBA 2D1HA 2CYYA 2L9RA 1YS6A 3DBHB 3ZMUA 5FKMA 2KPMA 1W36D 2CH0A 2MD0A 3KLNA 2BW3B 4UUSA 3CP2A 2V79A 2V6EA 2K9QA 1MDMA 3OY9A 2KP6A 4A0YA 3S1RJ 4UVCA 2JZYA 1LEBA 1E2XA 2JJ7A 3Q0UA 5DUKA 1ZG5A 4XNFA 2FEZA 3HPGA 5HODA 1NK2P 2HFHA 4F52A 1HC8A 3HYIA 3H36A 3HUGA 3OR1C 1R4NB 1DQUA 4I99C 2IGNA 3UNGC 3I58A 4YELA 1BBYA 5CQEA 3ZXSA 5J4VA 3DTKA 4BXFA 1XSDA 3W6VA 3QYFA 1LNWA 3I59A 4M3FA 5ICCA 4YFKF 1Z77A 3MCZA 2NS7A 3C1DA 2EB7A 1V55H 4JX4A 4HLYA 1IUFA 1O4XA 3IP4B 1Z3YA 1UB9A 4II2A 4J01A 4WX9A 3KZIC 5BPDA 2CQKA 3F72A 2HPMA 1FZPB 1B6AA 3S32A 1TBXA 4PSWA 2HYGD 2G0EA 1Q1VA 4Y52J 3BTJA 5E8GA 3JR9A 3BP8A 2Q2EA 2FD5A 4ZZDA 1Z9CA 4HPQA 3ZQQA 3QQAA 2HS5A 1X1DA 3TO9A 1F43A 2DA2A 4RM3A 4Y4RA 1HXDA 2FOWA 1WI9A 3LSJA 3MKLA 1OLTA 2FE3A 4F55A 4PFOA 2KLOA 4BE2A 1IN4A 4HSRA 3GTKJ 2PJPA 2XB5A 1EKEA 1P2FA 2ECCA 2FQ3A 5K5QA 1DGWY 2NS8A 3CJRB 3RCOA 3REOA 5LGTA 4R79A 3S17J 4JOMA 2ZMEB 2X51A 2KFDA 3I53A 4W1UA 4XN3A 3V8KA 4E7IA 4BY7J 5KNLA 3DBLB 3COAC 1IAWA 3BLYA 3H3UA 4IO9F 2IAIA 4XKVA 2A5YB 1LEAA 2E1OA 2F4IA 4L9VA 1SEUA 1O3SA 1FWZA 4WXHA 3K70D 2IBDA 2Y9YA 3CMMA 3ONQA 2E1CA 2A5WA 1YQAA 5D4SA 2W85A 3QPHA 5L3DA 1TW3A 2DA1A 1ENHA 4FE4A 1SFKA 1HW5A 2W84A 2GOXB 4RGSA 4FETA 1W0UA 3BG9A 2YX4A 3OL3A 1ULYA 3V4GA 3F23A 4F91B 4RBOA 3P9IA 4JX6A 2VC1A 4LIUA 3CDLA 1IXCA 4H0EA 4N4OB 3L09A 3FZVA 3E6MA 3QPLA 2X4HA 4B3AA 3BZ6A 1MBJA 3ABKH 1KYZA 4AYBA 1HF0A 5E1ZB 4J00A 3ZMTA 3E5UA 3KYCB 2DJNA 3O8HA 5H6RA 1OCOH 2HDWA 1KYWA 1ZLJA 3A1YA 2XF6A 2XF5A 3I0TA 2KIMA 4A6DA 4KIGA 5LRRA 2DOAA 1LFPA 3WHBA 3CO7C 2NVXJ 3CJQB 2EA4A 4HSTA
chains in the Genus database with same CATH topology
3F8FA 4RAYA 1V4RA 2K86A 1ZH5A 2P6TA 1G3YA 2W25A 3WU0A 1FY7A 1R58A 2CFXA 5LHHA 3HSEA 2NNYA 1OYYA 3U1DA 2GWRA 2A68F 4ESJA 5FD5A 4OIOF 4LK1F 4YG2F 2PBIA 1BM9A 3RI4A 1O3QA 2LF8A 4HAMA 4EM0B 4BH9A 2D2WA 1I5ZA 5L3GA 4WK8F 4EMSA 1PDNC 3CUQA 1P4XA 3PFIA 5CVRA 3R4KA 2DW4A 1ON1A 4Q5SF 1ZN2A 1J59A 4I2OA 3EYIA 5ICFA 3GXOA 1FBUA 4L5IA 3GFIA 1DUXC 3BJOA 1OR7A 4EJOA 5BQTA 1T38A 5JI6A 4XSXF 3CUQC 4KMUX 1KU2A 3KP4A 4IHTA 1JE8A 1ZREA 5L3CA 3I5UA 4P5OA 5HLIA 2QYOA 2PG4A 5BMZA 3ZPLA 1B1BA 1F1ZA 2Q0OA 2MLGA 1VTNC 2D45A 1SAXA 3MWMA 1QO0D 1XDUA 3HOTA 2XASA 2ESHA 3QP5A 3FHZA 3EQLF 4GYGA 4EM2A 3L9FA 1J5YA 5HDGA 2PEXA 1HW1A 4A6EA 1ZAOA 4HF2A 1IUYA 1G6NA 2GA2A 4LK0F 3DF8A 1YIOA 1IN8A 3IC7A 5DD8A 3HTSB 2YX7A 1T0FA 4E70A 4GO1A 5D6EA 3MZYA 2UWMA 5H20A 3IRQA 1G3WA 5TRDA 1IXRC 1FT9A 4RB2C 2HDCA 3IWFA 2IVMA 3ULQB 1W5TA 3B73A 3J80Z 2BBYA 2JPCA 2STWA 4M71A 1R1VA 1O7LA 2FNPA 5DCFA 2MBFA 1KA8A 3R60A 5E8IA 5HS7A 3WTTC 2ISZA 1TTYA 2XAHA 4GXOA 3FF5A 5DUIA 2YSRA 2IJLA 5D8KB 4GCVA 1IN6A 2P5LC 1B9MA 4LB5A 3P7NA 4PGGA 3T0YA 2VXZA 2XAFA 1QGPA 2HKOA 2DQLA 1SFUA 4FX4A 4RGRA 4M9XA 5L3EA 3E97A 4ZYGA 5E1XA 3ML6A 2FXAA 1CF7A 4IPAA 4BHBA 4G6QA 2XIGA 1IN7A 2V6CA 2AXLA 1XSVA 4U88A 4WXDA 1U3EM 2R7FA 4QLCU 3HIFA 3SXYA 4HV5A 2O8XA 4L0YB 1O7FA 5LLQA 2HEOA 2WV0A 1L0OC 3MAJA 1XMAA 3WTXC 4ENKA 2X0LA 1YS7A 4K2EA 2ETHA 1SFEA 2EFPA 2RC4A 1EH6A 1F9NA 3DKWA 3F22A 1P4WA 3WTWC 3QPTA 1C0WA 2VONA 3KEQA 2MC3A 1U2WA 5KVRA 3NQOA 2EV6A 4ESBA 4GGGA 4OMZA 3I64A 1WQ2A 4L18B 3ZMZA 1PP8F 4Q4ZF 5LHIA 4LD5A 3HOSA 1XSXA 1Y0UA 1SD7A 1UFMA 4BQAA 3MQ0A 3Q5FA 2HWVA 3GWZA 3BJ6A 1YW8A 2Y48A 3ERED 3LQRA 5HLGA 4I7HA 1HQCA 1W5SA 2FMLA 4IJAA 3JAMZ 5FD6A 3TOAA 1Z05A 1FC3A 1BIAA 2EA2A 4MEXF 2MD5A 2VODA 1O57A 1XCVA 4EQQA 1R00A 4D0PA 4UVBA 4PZJA 2DO7A 1HBXG 1YLFA 1LDJA 2M5WA 4FHTA 1YFHA 4HX8A 4HF0A 5LBQA 4Q47A 5DEQA 4MQVA 5FLXK 4KFCA 4IXAA 2P7CB 3T1BA 4B8XA 1SD5A 4IF4A 1RUNA 1IRFA 2V1UA 5HS9A 2QBYB 3BROA 4U0WA 1Z91A 1H9GA 4CGZA 2FBHA 5E20A 2XGXA 4G7ZF 1DPUA 4TV7A 1T98A 3GO5A 3DEUA 5K1YA 3RPUA 2LSOA 1GVJA 4HYEA 1FLIA 2DTRA 3M8FA 2A6HF 3GYHX 2ZJ2A 2PQ8A 3F21A 3FMSA 2K4BA 1ZRCA 1BIBA 2FA5A 3IHUA 1Q1HA 3FX3A 2P4WA 1FP1D 4G7HF 1MJBA 5FLXZ 2G7HA 4M9SA 3JSOA 4ZYHA 1MD0A 4A0ZA 2KKOA 2FF4A 3LAJA 5FO5A 3TQNA 2M87A 3SZTA 4RGUA 3WGIA 2L54A 2QM3A 4O3MA 1ZHFA 3OOPA 3E5QA 4EM1A 2P5VA 3E6BA 4MQ9F 2FRHA 2M45A 4KN4X 4PGHA 2BEOA 2G7UA 1J75A 1NHAA 2F2EA 1K6OA 4UUVA 1U5TB 2ZFWA 1IN5A 2XHKA 4HQEA 4CICA 2TDXA 1DDNA 3WTYC 3GLXA 3TO6A 2O0YA 4OMYA 2J5OA 4O5VA 3J81K 4N9IA 5HDKA 4UV8A 1QPMA 1YG2A 4CXFA 3ISPA 1RIOH 1G3SA 3RKYA 2IRFG 2VC0A 1P6RA 2A6EF 3RKXA 2KJCA 3KZYA 4N0BA 5F64A 5LGUA 1STZA 4RB3C 3MFKA 2F5DA 2B0LA 4L9TA 1TQMA 3KP3A 3CJNA 3E6CC 2YR2A 2DT5A 2CGPA 1EH7A 5D6FA 4AD9A 1ZG3A 4HBLA 1FYMA 2EV0A 4IRGA 4BNCA 2UZKA 1B9NA 2VE8A 3CO6C 3RIRA 1LVAA 3J81Z 3CUOA 5ILVA 1IZ1A 3DPLC 3HSFA 2GA1A 1SMYF 1HKTA 5HOOA 5D5WB 1ZGJA 3ZN1A 4FX0A 3N4MA 3W6KB 3D5LA 5F6FA 1YYVA 1RZ4A 3I54A 1B4AA 1YW7A 1K78A 1EV7A 1V3FA 4AWXB 4U0VA 1T6SA 4MTEA 1MDMB 4L5JA 3LA2A 1JXSA 1B59A 3V7CA 3ELKA 4M6YA 1XGSA 3O2PE 3C18A 1QZYA 4ENNA 3TKYA 4YFXF 1WSUA 2HTJA 3I59B 5DCMA 1SD4A 5EEHA 2JTVA 2NNNA 2RKHA 2Y75A 5CYVA 3V7RA 4M9ZA 2HZTA 2FBIA 2XVCA 2WWYA 4Y15A 1FP2A 1JGSA 1W7PA 4WCGA 1R1TA 2KRFA 4EGZA 3ZMVA 1I1GA 4AIJA 3L00A 1FSEA 3R0JA 2RQPA 3TGNA 5HLHA 2XAQA 1QNTA 2VBWA 3QU3A 2PI0A 1IRGA 2QLZA 4LFUA 2VBZA 3D0SA 2EFWA 2MLKA 1BI1A 1P4AA 2GIVA 1L3LA 2QZ8A 1I1SA 3LA7A 4AIKA 1OKRA 3G3ZA 2MH2A 2H27A 3MEXA 2PLYA 2Z9OA 2DK8A 2FNAA 5J6XA 4P96A 3WTZA 1E17A 3WTSC 4A5NA 2GAUA 4BXUA 1U78A 4RB1A 1F5TA 5A2QK 5ICEA 4G9YA 2JPBA 3V8LA 4HLXA 5FFZA 2H6BA 4RGXA 1KGSA 3U2RA 4LLNA 1MKMA 1R5HA 5ICGA 4XLNF 1FBQA 1T39A 4GYIA 4LJZF 2IA0A 2PFBA 3EYYA 4Y17A 1YTYA 1S7AA 4JK1X 4ETSA 2JSCA 4LGWA 4MNUA 4CDGA 3HHHA 1ZRDA 4CYDA 3CTAA 5ERIA 4A5MA 3JTHA 2EJRA 3K2ZA 4BHCA 3M1EA 2PMUA 3VB2A 3FM3A 5TJJA 1REPC 2BE5F 3KEOA 3R0AA 1KU7A 3BWGA 2ZBKA 2IT0A 3BPXA 2GXGA 1I6XA 6PAXA 3RPQA 3LWFA 2AS5F 3I71A 4NHJA 2UXNA 2OZ6A 4RB0A 2CSOA 4P9UA 3F3XA 3KFWX 5L3FA 3WE2A 3CUQB 5DDGA 4MGRA 2L01A 4EJWA 5DD4A 3ABTA 2JT1A 3NRVA 3T8TA 2F5EA 3LAPA 1BJAA 3H3ZA 3V8JA 3QOPA 5FFXA 1FSHA 1A04A 4CZZA 3F8NA 2ZCWA 2ZNZA 1Z6TA 1BI0A 5E18F 2K4JA 4UV9A 1QBJA 1K79A 4UXNA 3T5XA 4YFNF 3DXJF 2FU4A 1S6LA 4HW0A 3ZMDA 5BOXA 2ELHA 1IXSB 4L9NA 4BAYA 3P9CA 3NEUA 5LGNA 2IW5A 1SD6A 1FX7A 4DNCA 1PUEE 4ENMA 3RDIA 1GXPA 2H6CA 4HV6A 3EUHA 4OIPF 3CLOA 1ZARA 3O3KA 2OAZA 4KIBA 2EFOA 3GZ6A 5BPIA 3FMQA 1UCRA 2M1BA 5AIQA 3JTGA 2YU3A 3IRRA 3TDZC 3PQJA 1LJ9A 1D8JA 5CVJA 4MHGA 5JR3A 3QAHA 4WXCA 3WTUC 3F8BA 3LSTA 2KIFA 4EGYA 1R5GA 1XCBA 4AIHA 2EV5A 1YO5C 3OV8A 5J8CA 2XRNA 1OYIA 4XBFA 1WKMA 3MZHA 4KUMA 4EJUA 2DFIA 1H9TA 1J2XA 3Q9VA 1TQPA 3IL2A 3IWZA 4G8XA 4EVIA 2F5CA 4S04A 2XKOA 5JHUA 4OINF 3JSPA 1BOAA 3K1MA 1IW7F 1R23A 5IT9K 4DQ2A 1XMKA 3BJAA 1LQ1A 2EK5A 2OQGA 1QZZA 4O6JA 3GW2A 4BYYA 3E6DA 1FPQA 4ZYEA 2QQ9A 1CF7B 2A3SA 1ONVA 4WF2A 2F5FA 2O6GE 3HTUA 1BI3A 3GFLA 1P92A 4MEYF 2DK5A 3EDPA 2XAJA 1ZG1A 2HGCA 4U7DA 1MZBA 1HSTA 2HQNA 4HDVA 2QUFA 3E5XA 2RGVA 2Z5UA 2XAGA 1TNSA 4HOBA 1OMIA 2OU2A 4HF1A 2NRAC 5D4RA 1UHWA 1XGOA 1CGPA 1R1UA 1MJAA 3R61A 4JBAA 2A61A 2ZMEA 2MA3A 4YIFA 5D5XB 2WTEA 1XD7A 1LB2A 1LDDA 3GFMA 1HKSA 5HDNA 3JW4A 3VFZA 2MH9A 2NYXA 2KJBA 3KZZA 4ENJA 5CVUA 3QU6A 2R3SA 2O3FA 3F6OA 1PP7U 3GFJA 2NAZA 3KP7A 2EWNA 3TDUC 2RDPA 3LA3A 4HA8A 3WGHA 1HW2A 5ED4A 3K69A 5KK1A 3ZMSA 1R22A 1OYWA 3EETA 3FXRA 2A69F 4CHUA 2STTA 3C3WA 4A2UA 3ZN0A 4HX7A 5DYMA 4OOIA 3SFZA 1FYLA 4FT8A 2G9WA 3J7AO 3ROUA 1S29A 2VT2A 2EFQA 2QVOA 3E3VA 4KIFA 2QQAA 3TO7A 1KQ0A 5K5RA 3GX4X 3LQQA 4L0ZB 4UVAA 2A07F 2LKPA 4OIQF 3DQVC 1J0RA 4EJTA 5E17F 2L4MA 3RKWA 2W57A 1YW9A 2COMA 2J5PA 4KT5C 4F7ZA 4LG0A 2XKPA 3DP7A 4L9JA 2XROA 1ZRFA 2M30A 2L02A 3S2WA 1OPCA 2HOEA 3P9KA 4KA4A 1R7JA 2E7XA 3IKVA 3HRSA 1IF1A 4HDUA 1XDSA 4HQMA 2RVCA 1QQIA 4G6DA 2VT3A 3R6SA 2ACJA 2FBKA 3BPVA 3LFKA 3N97A 3FMRA 2Z3YA 2V9VA 4I01A 4MTDA 1KU3A 2VOPA 4LLLA 1Z6RA 1HKQA 5F1RA 2OA4A 5LRSA 3HRMA 3K0LA 3V7SA 4M74A 3T8RA 1ZYRF 4KYWA 4I0AA 2Q8KA 4ON0A 2VN2A 3K9TA 2UXXA 3FXQA 2IA2A 2HTSA 3O6BB 2OZUA 2OD5A 3K1NA 3ZQ7A 1RUOA 2DPUA 3WU1B 2M8EA 2OQRA 2PN6A 1D5VA 2KIUA 4P9FA 3ZP5A 2HKXA 3SHFA 1ON2A 1RNLA 3KLOA 1ZLKA 2ESNA 3KP2A 2RV8A 1AOYA 4XRFA 5FGMA 1U8RA 1ZGAA 5DV5A 4I09A 3H92A 3FM5A 3QRFF 4Y13A 3F6VA 3L7WA 4QWQA 3M9AA 4NQWA 2FMYA 4LG0B 4HX4A 1BI2A 1S8NA 3BY6A 3M8EA 4IHSA 2V1XA 3BDDA 4U0YA 2K7LA 1FBSA 3VEPA 1Z1DA 3VODA 4RS8A 3PQKA 2VE9A 5CJ9A 3VOEA 3I4PA 2DLLA 2DPDA 5ILUA 4P55A 5LEKA 3RTRA 1HSJA 2VBYA 5D8LB 3HRUA 1W7PD 4UHTA 3DFGA 1AWCA 3SZPA 3HRTA 4M6XA 5CLSA 1K78B 2FOKA 5AONA 2VBXA 3SQNA 3DV8A 2HYFA 2HR3A 1MJ9A 3FXUA 4R8HA 1GHCA 2P5KA 3GUDA 5K5OA 2IP2A 3J80K 3C7JA 1BC7C 2VOOA 5DCMB 3WTVC 2DBBA 4KICA 2E1NA 4A12A 5ILSA 1O3RA 5JFRA 2ISYA 2RN7A 4IRHA 5LEJA 2BGCA 2CO5A 5A2QZ 5FB2A 1W7PB 3GEZA 4M72A 3Q9SA 4RAZA 1BN5A 3G73A 3FWEA 3ABUA 1X3UA 2CG4A 3WG9A 2E7WA 5D5VB 4I0BA 5H6QA 5HVQC 1JHHA 2BYVE 2YPRA 4IRIA 3KCCA 3U9GA 4UNOA 4LMYA 2Z99A 2P6SA 1XN7A 3GF2A 2XUBA 4M73A 3WODF 1G4DA 1O3TA 1W4MA 3WGGA 2QWWA 2EFNA 1G3TA 1TLHB 4NB5A 1JHFA 1J7KA 5AIPA 4OIRF 5E1WA 4JQFA 3GZ5A 4Q48A 4XSZF 3RYRA 5JVTA 1FNNA 2ZO4A 3F8CA 3RYPA 1TQIA 4LB6B 2P8TA 1XGMA 2O03A 2K27A 2LNBA 2QBYA 3TOBA 2ADUA 3QP6A 3KETA 1GXQA 1UHMA 3K1PA 2LF7A 4ZZLA 5J8FA 1WWXA 4ESFA 2H94A 4KNYA 4KN7X 1TNTA 2OBPA 1U6GA 2DQRA 2L4AA 1ODDA 4U7BA 5HS8A 1FYKA 4KDPA 2K02A 3JAMK 4A0XA 1S3JA 2QENA 1D8KA 2CW0F 3ECHA 3B02A 4G7OF 5D5UB 2L3DA 2XV4S 1R36A 3W6JB 4XLPF 3KE2A 4OU0A 4B09A 1KU9A 1WRJA 1BC8C 1D3YA 4ZYDA 1KQ8A 1SFXA 4KMFA 1DPRA 4I98B 1T2KA 2R7DA 2LDUA 5IT3A 2BV6A 1I27A 1RI7A 2IA1A 1SMTA 4CO8A 2ZKZA 3KP6A 1LDKB 4WWCA 5CVVA 3KP5A 4ZH4F 2GQQA 2V1DA 1U5TA 4PDKA 2IPQX 4Z2YA 5LHGA 4I02A 3ECOA 3AAFA 3L2CA 4EJVA 3CDHA 4AVPA 1Z7UA 3HSRA 2WC2A 5EEGA 2HQRA 2RNJA 4EV0A 5BS6A 3HHGA 2Z33A 1XB4A 4BHPA 1MGTA 2C6YA 4HZFA 1U5TC 2JRTA 2ZNYA 1TW2A 2CWEA 2DU9A 4LLGF 3GVAA 5L3BA 4G94A 2H09A 5IT9Z 1KQ9A 1XGNA 2NS0A 3WE3A 4ASNA 2QQBA 1J9IA 3RJPA 2GZWA 1FOKA 4N9HA 2DI3A 1S7OA 2P7VB 2D1VA 1F4KA 4PCQA 1EH8A 1DP7P 4S05A 2GXBA 3F8MA 3IKTA 4R1HA 2Y0MA 2DAOA 3BOQA 2PMHA 2O61A 5CVIA 2FSWA 2ZXJA 1USSA 4IVNA 4YIIA 1K7AA 3M7GA 3DPTA 1USTA 2W24A 1H0MA 2D1HA 2CYYA 1YS6A 3ZMUA 3KLNA 2V79A 1MDMA 4A0YA 4UVCA 2JZYA 1LEBA 1E2XA 5DUKA 1ZG5A 2FEZA 2HFHA 3HYIA 3HUGA 3I58A 1BBYA 1XSDA 1LNWA 3I59A 5ICCA 4YFKF 3MCZA 3C1DA 2EB7A 4HLYA 1UB9A 4WX9A 5BPDA 2CQKA 3F72A 1FZPB 1B6AA 1TBXA 2HYGD 5E8GA 3BP8A 2Q2EA 4ZZDA 1Z9CA 2HS5A 3TO9A 1HXDA 1WI9A 2FE3A 1IN4A 2PJPA 1P2FA 2FQ3A 5K5QA 5LGTA 3REOA 4R79A 2ZMEB 3I53A 3V8KA 3COAC 1IAWA 3H3UA 2A5YB 1LEAA 4L9VA 1O3SA 1FWZA 4WXHA 2E1CA 1YQAA 5D4SA 2W85A 3QPHA 5L3DA 1TW3A 2W84A 1HW5A 4RGSA 2YX4A 3F23A 1ULYA 3V4GA 3P9IA 2VC1A 1IXCA 4H0EA 3L09A 3FZVA 3E6MA 2X4HA 3BZ6A 1KYZA 5E1ZB 3ZMTA 3E5UA 5H6RA 1KYWA 1ZLJA 3I0TA 2KIMA 4A6DA 4KIGA 5LRRA 3CO7C 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8F A;  4RAY A;  1V4R A;  2K86 A;  1ZH5 A;  2P6T A;  1G3Y A;  2W25 A;  3WU0 A;  1FY7 A;  1R58 A;  2CFX A;  5LHH A;  3HSE A;  2NNY A;  1OYY A;  3U1D A;  2GWR A;  2A68 F;  4ESJ A;  5FD5 A;  4OIO F;  4LK1 F;  4YG2 F;  2PBI A;  1BM9 A;  3RI4 A;  1O3Q A;  2LF8 A;  4HAM A;  4EM0 B;  4BH9 A;  2D2W A;  1I5Z A;  5L3G A;  4WK8 F;  4EMS A;  1PDN C;  3CUQ A;  1P4X A;  3PFI A;  5CVR A;  3R4K A;  2DW4 A;  1ON1 A;  4Q5S F;  1ZN2 A;  1J59 A;  4I2O A;  3EYI A;  5ICF A;  3GXO A;  1FBU A;  4L5I A;  3GFI A;  1DUX C;  3BJO A;  1OR7 A;  4EJO A;  5BQT A;  1T38 A;  5JI6 A;  4XSX F;  3CUQ C;  4KMU X;  1KU2 A;  3KP4 A;  4IHT A;  1JE8 A;  1ZRE A;  5L3C A;  3I5U A;  4P5O A;  5HLI A;  2QYO A;  2PG4 A;  5BMZ A;  3ZPL A;  1B1B A;  1F1Z A;  2Q0O A;  2MLG A;  1VTN C;  2D45 A;  1SAX A;  3MWM A;  1QO0 D;  1XDU A;  3HOT A;  2XAS A;  2ESH A;  3QP5 A;  3FHZ A;  3EQL F;  4GYG A;  4EM2 A;  3L9F A;  1J5Y A;  5HDG A;  2PEX A;  1HW1 A;  4A6E A;  1ZAO A;  4HF2 A;  1IUY A;  1G6N A;  2GA2 A;  4LK0 F;  3DF8 A;  1YIO A;  1IN8 A;  3IC7 A;  5DD8 A;  3HTS B;  2YX7 A;  1T0F A;  4E70 A;  4GO1 A;  5D6E A;  3MZY A;  2UWM A;  5H20 A;  3IRQ A;  1G3W A;  5TRD A;  1IXR C;  1FT9 A;  4RB2 C;  2HDC A;  3IWF A;  2IVM A;  3ULQ B;  1W5T A;  3B73 A;  3J80 Z;  2BBY A;  2JPC A;  2STW A;  4M71 A;  1R1V A;  1O7L A;  2FNP A;  5DCF A;  2MBF A;  1KA8 A;  3R60 A;  5E8I A;  5HS7 A;  3WTT C;  2ISZ A;  1TTY A;  2XAH A;  4GXO A;  3FF5 A;  5DUI A;  2YSR A;  2IJL A;  5D8K B;  4GCV A;  1IN6 A;  2P5L C;  1B9M A;  4LB5 A;  3P7N A;  4PGG A;  3T0Y A;  2VXZ A;  2XAF A;  1QGP A;  2HKO A;  2DQL A;  1SFU A;  4FX4 A;  4RGR A;  4M9X A;  5L3E A;  3E97 A;  4ZYG A;  5E1X A;  3ML6 A;  2FXA A;  1CF7 A;  4IPA A;  4BHB A;  4G6Q A;  2XIG A;  1IN7 A;  2V6C A;  2AXL A;  1XSV A;  4U88 A;  4WXD A;  1U3E M;  2R7F A;  4QLC U;  3HIF A;  3SXY A;  4HV5 A;  2O8X A;  4L0Y B;  1O7F A;  5LLQ A;  2HEO A;  2WV0 A;  1L0O C;  3MAJ A;  1XMA A;  3WTX C;  4ENK A;  2X0L A;  1YS7 A;  4K2E A;  2ETH A;  1SFE A;  2EFP A;  2RC4 A;  1EH6 A;  1F9N A;  3DKW A;  3F22 A;  1P4W A;  3WTW C;  3QPT A;  1C0W A;  2VON A;  3KEQ A;  2MC3 A;  1U2W A;  5KVR A;  3NQO A;  2EV6 A;  4ESB A;  4GGG A;  4OMZ A;  3I64 A;  1WQ2 A;  4L18 B;  3ZMZ A;  1PP8 F;  4Q4Z F;  5LHI A;  4LD5 A;  3HOS A;  1XSX A;  1Y0U A;  1SD7 A;  1UFM A;  4BQA A;  3MQ0 A;  3Q5F A;  2HWV A;  3GWZ A;  3BJ6 A;  1YW8 A;  2Y48 A;  3ERE D;  3LQR A;  5HLG A;  4I7H A;  1HQC A;  1W5S A;  2FML A;  4IJA A;  3JAM Z;  5FD6 A;  3TOA A;  1Z05 A;  1FC3 A;  1BIA A;  2EA2 A;  4MEX F;  2MD5 A;  2VOD A;  1O57 A;  1XCV A;  4EQQ A;  1R00 A;  4D0P A;  4UVB A;  4PZJ A;  2DO7 A;  1HBX G;  1YLF A;  1LDJ A;  2M5W A;  4FHT A;  1YFH A;  4HX8 A;  4HF0 A;  5LBQ A;  4Q47 A;  5DEQ A;  4MQV A;  5FLX K;  4KFC A;  4IXA A;  2P7C B;  3T1B A;  4B8X A;  1SD5 A;  4IF4 A;  1RUN A;  1IRF A;  2V1U A;  5HS9 A;  2QBY B;  3BRO A;  4U0W A;  1Z91 A;  1H9G A;  4CGZ A;  2FBH A;  5E20 A;  2XGX A;  4G7Z F;  1DPU A;  4TV7 A;  1T98 A;  3GO5 A;  3DEU A;  5K1Y A;  3RPU A;  2LSO A;  1GVJ A;  4HYE A;  1FLI A;  2DTR A;  3M8F A;  2A6H F;  3GYH X;  2ZJ2 A;  2PQ8 A;  3F21 A;  3FMS A;  2K4B A;  1ZRC A;  1BIB A;  2FA5 A;  3IHU A;  1Q1H A;  3FX3 A;  2P4W A;  1FP1 D;  4G7H F;  1MJB A;  5FLX Z;  2G7H A;  4M9S A;  3JSO A;  4ZYH A;  1MD0 A;  4A0Z A;  2KKO A;  2FF4 A;  3LAJ A;  5FO5 A;  3TQN A;  2M87 A;  3SZT A;  4RGU A;  3WGI A;  2L54 A;  2QM3 A;  4O3M A;  1ZHF A;  3OOP A;  3E5Q A;  4EM1 A;  2P5V A;  3E6B A;  4MQ9 F;  2FRH A;  2M45 A;  4KN4 X;  4PGH A;  2BEO A;  2G7U A;  1J75 A;  1NHA A;  2F2E A;  1K6O A;  4UUV A;  1U5T B;  2ZFW A;  1IN5 A;  2XHK A;  4HQE A;  4CIC A;  2TDX A;  1DDN A;  3WTY C;  3GLX A;  3TO6 A;  2O0Y A;  4OMY A;  2J5O A;  4O5V A;  3J81 K;  4N9I A;  5HDK A;  4UV8 A;  1QPM A;  1YG2 A;  4CXF A;  3ISP A;  1RIO H;  1G3S A;  3RKY A;  2IRF G;  2VC0 A;  1P6R A;  2A6E F;  3RKX A;  2KJC A;  3KZY A;  4N0B A;  5F64 A;  5LGU A;  1STZ A;  4RB3 C;  3MFK A;  2F5D A;  2B0L A;  4L9T A;  1TQM A;  3KP3 A;  3CJN A;  3E6C C;  2YR2 A;  2DT5 A;  2CGP A;  1EH7 A;  5D6F A;  4AD9 A;  1ZG3 A;  4HBL A;  1FYM A;  2EV0 A;  4IRG A;  4BNC A;  2UZK A;  1B9N A;  2VE8 A;  3CO6 C;  3RIR A;  1LVA A;  3J81 Z;  3CUO A;  5ILV A;  1IZ1 A;  3DPL C;  3HSF A;  2GA1 A;  1SMY F;  1HKT A;  5HOO A;  5D5W B;  1ZGJ A;  3ZN1 A;  4FX0 A;  3N4M A;  3W6K B;  3D5L A;  5F6F A;  1YYV A;  1RZ4 A;  3I54 A;  1B4A A;  1YW7 A;  1K78 A;  1EV7 A;  1V3F A;  4AWX B;  4U0V A;  1T6S A;  4MTE A;  1MDM B;  4L5J A;  3LA2 A;  1JXS A;  1B59 A;  3V7C A;  3ELK A;  4M6Y A;  1XGS A;  3O2P E;  3C18 A;  1QZY A;  4ENN A;  3TKY A;  4YFX F;  1WSU A;  2HTJ A;  3I59 B;  5DCM A;  1SD4 A;  5EEH A;  2JTV A;  2NNN A;  2RKH A;  2Y75 A;  5CYV A;  3V7R A;  4M9Z A;  2HZT A;  2FBI A;  2XVC A;  2WWY A;  4Y15 A;  1FP2 A;  1JGS A;  1W7P A;  4WCG A;  1R1T A;  2KRF A;  4EGZ A;  3ZMV A;  1I1G A;  4AIJ A;  3L00 A;  1FSE A;  3R0J A;  2RQP A;  3TGN A;  5HLH A;  2XAQ A;  1QNT A;  2VBW A;  3QU3 A;  2PI0 A;  1IRG A;  2QLZ A;  4LFU A;  2VBZ A;  3D0S A;  2EFW A;  2MLK A;  1BI1 A;  1P4A A;  2GIV A;  1L3L A;  2QZ8 A;  1I1S A;  3LA7 A;  4AIK A;  1OKR A;  3G3Z A;  2MH2 A;  2H27 A;  3MEX A;  2PLY A;  2Z9O A;  2DK8 A;  2FNA A;  5J6X A;  4P96 A;  3WTZ A;  1E17 A;  3WTS C;  4A5N A;  2GAU A;  4BXU A;  1U78 A;  4RB1 A;  1F5T A;  5A2Q K;  5ICE A;  4G9Y A;  2JPB A;  3V8L A;  4HLX A;  5FFZ A;  2H6B A;  4RGX A;  1KGS A;  3U2R A;  4LLN A;  1MKM A;  1R5H A;  5ICG A;  4XLN F;  1FBQ A;  1T39 A;  4GYI A;  4LJZ F;  2IA0 A;  2PFB A;  3EYY A;  4Y17 A;  1YTY A;  1S7A A;  4JK1 X;  4ETS A;  2JSC A;  4LGW A;  4MNU A;  4CDG A;  3HHH A;  1ZRD A;  4CYD A;  3CTA A;  5ERI A;  4A5M A;  3JTH A;  2EJR A;  3K2Z A;  4BHC A;  3M1E A;  2PMU A;  3VB2 A;  3FM3 A;  5TJJ A;  1REP C;  2BE5 F;  3KEO A;  3R0A A;  1KU7 A;  3BWG A;  2ZBK A;  2IT0 A;  3BPX A;  2GXG A;  1I6X A;  6PAX A;  3RPQ A;  3LWF A;  2AS5 F;  3I71 A;  4NHJ A;  2UXN A;  2OZ6 A;  4RB0 A;  2CSO A;  4P9U A;  3F3X A;  3KFW X;  5L3F A;  3WE2 A;  3CUQ B;  5DDG A;  4MGR A;  2L01 A;  4EJW A;  5DD4 A;  3ABT A;  2JT1 A;  3NRV A;  3T8T A;  2F5E A;  3LAP A;  1BJA A;  3H3Z A;  3V8J A;  3QOP A;  5FFX A;  1FSH A;  1A04 A;  4CZZ A;  3F8N A;  2ZCW A;  2ZNZ A;  1Z6T A;  1BI0 A;  5E18 F;  2K4J A;  4UV9 A;  1QBJ A;  1K79 A;  4UXN A;  3T5X A;  4YFN F;  3DXJ F;  2FU4 A;  1S6L A;  4HW0 A;  3ZMD A;  5BOX A;  2ELH A;  1IXS B;  4L9N A;  4BAY A;  3P9C A;  3NEU A;  5LGN A;  2IW5 A;  1SD6 A;  1FX7 A;  4DNC A;  1PUE E;  4ENM A;  3RDI A;  1GXP A;  2H6C A;  4HV6 A;  3EUH A;  4OIP F;  3CLO A;  1ZAR A;  3O3K A;  2OAZ A;  4KIB A;  2EFO A;  3GZ6 A;  5BPI A;  3FMQ A;  1UCR A;  2M1B A;  5AIQ A;  3JTG A;  2YU3 A;  3IRR A;  3TDZ C;  3PQJ A;  1LJ9 A;  1D8J A;  5CVJ A;  4MHG A;  5JR3 A;  3QAH A;  4WXC A;  3WTU C;  3F8B A;  3LST A;  2KIF A;  4EGY A;  1R5G A;  1XCB A;  4AIH A;  2EV5 A;  1YO5 C;  3OV8 A;  5J8C A;  2XRN A;  1OYI A;  4XBF A;  1WKM A;  3MZH A;  4KUM A;  4EJU A;  2DFI A;  1H9T A;  1J2X A;  3Q9V A;  1TQP A;  3IL2 A;  3IWZ A;  4G8X A;  4EVI A;  2F5C A;  4S04 A;  2XKO A;  5JHU A;  4OIN F;  3JSP A;  1BOA A;  3K1M A;  1IW7 F;  1R23 A;  5IT9 K;  4DQ2 A;  1XMK A;  3BJA A;  1LQ1 A;  2EK5 A;  2OQG A;  1QZZ A;  4O6J A;  3GW2 A;  4BYY A;  3E6D A;  1FPQ A;  4ZYE A;  2QQ9 A;  1CF7 B;  2A3S A;  1ONV A;  4WF2 A;  2F5F A;  2O6G E;  3HTU A;  1BI3 A;  3GFL A;  1P92 A;  4MEY F;  2DK5 A;  3EDP A;  2XAJ A;  1ZG1 A;  2HGC A;  4U7D A;  1MZB A;  1HST A;  2HQN A;  4HDV A;  2QUF A;  3E5X A;  2RGV A;  2Z5U A;  2XAG A;  1TNS A;  4HOB A;  1OMI A;  2OU2 A;  4HF1 A;  2NRA C;  5D4R A;  1UHW A;  1XGO A;  1CGP A;  1R1U A;  1MJA A;  3R61 A;  4JBA A;  2A61 A;  2ZME A;  2MA3 A;  4YIF A;  5D5X B;  2WTE A;  1XD7 A;  1LB2 A;  1LDD A;  3GFM A;  1HKS A;  5HDN A;  3JW4 A;  3VFZ A;  2MH9 A;  2NYX A;  2KJB A;  3KZZ A;  4ENJ A;  5CVU A;  3QU6 A;  2R3S A;  2O3F A;  3F6O A;  1PP7 U;  3GFJ A;  2NAZ A;  3KP7 A;  2EWN A;  3TDU C;  2RDP A;  3LA3 A;  4HA8 A;  3WGH A;  1HW2 A;  5ED4 A;  3K69 A;  5KK1 A;  3ZMS A;  1R22 A;  1OYW A;  3EET A;  3FXR A;  2A69 F;  4CHU A;  2STT A;  3C3W A;  4A2U A;  3ZN0 A;  4HX7 A;  5DYM A;  4OOI A;  3SFZ A;  1FYL A;  4FT8 A;  2G9W A;  3J7A O;  3ROU A;  1S29 A;  2VT2 A;  2EFQ A;  2QVO A;  3E3V A;  4KIF A;  2QQA A;  3TO7 A;  1KQ0 A;  5K5R A;  3GX4 X;  3LQQ A;  4L0Z B;  4UVA A;  2A07 F;  2LKP A;  4OIQ F;  3DQV C;  1J0R A;  4EJT A;  5E17 F;  2L4M A;  3RKW A;  2W57 A;  1YW9 A;  2COM A;  2J5P A;  4KT5 C;  4F7Z A;  4LG0 A;  2XKP A;  3DP7 A;  4L9J A;  2XRO A;  1ZRF A;  2M30 A;  2L02 A;  3S2W A;  1OPC A;  2HOE A;  3P9K A;  4KA4 A;  1R7J A;  2E7X A;  3IKV A;  3HRS A;  1IF1 A;  4HDU A;  1XDS A;  4HQM A;  2RVC A;  1QQI A;  4G6D A;  2VT3 A;  3R6S A;  2ACJ A;  2FBK A;  3BPV A;  3LFK A;  3N97 A;  3FMR A;  2Z3Y A;  2V9V A;  4I01 A;  4MTD A;  1KU3 A;  2VOP A;  4LLL A;  1Z6R A;  1HKQ A;  5F1R A;  2OA4 A;  5LRS A;  3HRM A;  3K0L A;  3V7S A;  4M74 A;  3T8R A;  1ZYR F;  4KYW A;  4I0A A;  2Q8K A;  4ON0 A;  2VN2 A;  3K9T A;  2UXX A;  3FXQ A;  2IA2 A;  2HTS A;  3O6B B;  2OZU A;  2OD5 A;  3K1N A;  3ZQ7 A;  1RUO A;  2DPU A;  3WU1 B;  2M8E A;  2OQR A;  2PN6 A;  1D5V A;  2KIU A;  4P9F A;  3ZP5 A;  2HKX A;  3SHF A;  1ON2 A;  1RNL A;  3KLO A;  1ZLK A;  2ESN A;  3KP2 A;  2RV8 A;  1AOY A;  4XRF A;  5FGM A;  1U8R A;  1ZGA A;  5DV5 A;  4I09 A;  3H92 A;  3FM5 A;  3QRF F;  4Y13 A;  3F6V A;  3L7W A;  4QWQ A;  3M9A A;  4NQW A;  2FMY A;  4LG0 B;  4HX4 A;  1BI2 A;  1S8N A;  3BY6 A;  3M8E A;  4IHS A;  2V1X A;  3BDD A;  4U0Y A;  2K7L A;  1FBS A;  3VEP A;  1Z1D A;  3VOD A;  4RS8 A;  3PQK A;  2VE9 A;  5CJ9 A;  3VOE A;  3I4P A;  2DLL A;  2DPD A;  5ILU A;  4P55 A;  5LEK A;  3RTR A;  1HSJ A;  2VBY A;  5D8L B;  3HRU A;  1W7P D;  4UHT A;  3DFG A;  1AWC A;  3SZP A;  3HRT A;  4M6X A;  5CLS A;  1K78 B;  2FOK A;  5AON A;  2VBX A;  3SQN A;  3DV8 A;  2HYF A;  2HR3 A;  1MJ9 A;  3FXU A;  4R8H A;  1GHC A;  2P5K A;  3GUD A;  5K5O A;  2IP2 A;  3J80 K;  3C7J A;  1BC7 C;  2VOO A;  5DCM B;  3WTV C;  2DBB A;  4KIC A;  2E1N A;  4A12 A;  5ILS A;  1O3R A;  5JFR A;  2ISY A;  2RN7 A;  4IRH A;  5LEJ A;  2BGC A;  2CO5 A;  5A2Q Z;  5FB2 A;  1W7P B;  3GEZ A;  4M72 A;  3Q9S A;  4RAZ A;  1BN5 A;  3G73 A;  3FWE A;  3ABU A;  1X3U A;  2CG4 A;  3WG9 A;  2E7W A;  5D5V B;  4I0B A;  5H6Q A;  5HVQ C;  1JHH A;  2BYV E;  2YPR A;  4IRI A;  3KCC A;  3U9G A;  4UNO A;  4LMY A;  2Z99 A;  2P6S A;  1XN7 A;  3GF2 A;  2XUB A;  4M73 A;  3WOD F;  1G4D A;  1O3T A;  1W4M A;  3WGG A;  2QWW A;  2EFN A;  1G3T A;  1TLH B;  4NB5 A;  1JHF A;  1J7K A;  5AIP A;  4OIR F;  5E1W A;  4JQF A;  3GZ5 A;  4Q48 A;  4XSZ F;  3RYR A;  5JVT A;  1FNN A;  2ZO4 A;  3F8C A;  3RYP A;  1TQI A;  4LB6 B;  2P8T A;  1XGM A;  2O03 A;  2K27 A;  2LNB A;  2QBY A;  3TOB A;  2ADU A;  3QP6 A;  3KET A;  1GXQ A;  1UHM A;  3K1P A;  2LF7 A;  4ZZL A;  5J8F A;  1WWX A;  4ESF A;  2H94 A;  4KNY A;  4KN7 X;  1TNT A;  2OBP A;  1U6G A;  2DQR A;  2L4A A;  1ODD A;  4U7B A;  5HS8 A;  1FYK A;  4KDP A;  2K02 A;  3JAM K;  4A0X A;  1S3J A;  2QEN A;  1D8K A;  2CW0 F;  3ECH A;  3B02 A;  4G7O F;  5D5U B;  2L3D A;  2XV4 S;  1R36 A;  3W6J B;  4XLP F;  3KE2 A;  4OU0 A;  4B09 A;  1KU9 A;  1WRJ A;  1BC8 C;  1D3Y A;  4ZYD A;  1KQ8 A;  1SFX A;  4KMF A;  1DPR A;  4I98 B;  1T2K A;  2R7D A;  2LDU A;  5IT3 A;  2BV6 A;  1I27 A;  1RI7 A;  2IA1 A;  1SMT A;  4CO8 A;  2ZKZ A;  3KP6 A;  1LDK B;  4WWC A;  5CVV A;  3KP5 A;  4ZH4 F;  2GQQ A;  2V1D A;  1U5T A;  4PDK A;  2IPQ X;  4Z2Y A;  5LHG A;  4I02 A;  3ECO A;  3AAF A;  3L2C A;  4EJV A;  3CDH A;  4AVP A;  1Z7U A;  3HSR A;  2WC2 A;  5EEG A;  2HQR A;  2RNJ A;  4EV0 A;  5BS6 A;  3HHG A;  2Z33 A;  1XB4 A;  4BHP A;  1MGT A;  2C6Y A;  4HZF A;  1U5T C;  2JRT A;  2ZNY A;  1TW2 A;  2CWE A;  2DU9 A;  4LLG F;  3GVA A;  5L3B A;  4G94 A;  2H09 A;  5IT9 Z;  1KQ9 A;  1XGN A;  2NS0 A;  3WE3 A;  4ASN A;  2QQB A;  1J9I A;  3RJP A;  2GZW A;  1FOK A;  4N9H A;  2DI3 A;  1S7O A;  2P7V B;  2D1V A;  1F4K A;  4PCQ A;  1EH8 A;  1DP7 P;  4S05 A;  2GXB A;  3F8M A;  3IKT A;  4R1H A;  2Y0M A;  2DAO A;  3BOQ A;  2PMH A;  2O61 A;  5CVI A;  2FSW A;  2ZXJ A;  1USS A;  4IVN A;  4YII A;  1K7A A;  3M7G A;  3DPT A;  1UST A;  2W24 A;  1H0M A;  2D1H A;  2CYY A;  1YS6 A;  3ZMU A;  3KLN A;  2V79 A;  1MDM A;  4A0Y A;  4UVC A;  2JZY A;  1LEB A;  1E2X A;  5DUK A;  1ZG5 A;  2FEZ A;  2HFH A;  3HYI A;  3HUG A;  3I58 A;  1BBY A;  1XSD A;  1LNW A;  3I59 A;  5ICC A;  4YFK F;  3MCZ A;  3C1D A;  2EB7 A;  4HLY A;  1UB9 A;  4WX9 A;  5BPD A;  2CQK A;  3F72 A;  1FZP B;  1B6A A;  1TBX A;  2HYG D;  5E8G A;  3BP8 A;  2Q2E A;  4ZZD A;  1Z9C A;  2HS5 A;  3TO9 A;  1HXD A;  1WI9 A;  2FE3 A;  1IN4 A;  2PJP A;  1P2F A;  2FQ3 A;  5K5Q A;  5LGT A;  3REO A;  4R79 A;  2ZME B;  3I53 A;  3V8K A;  3COA C;  1IAW A;  3H3U A;  2A5Y B;  1LEA A;  4L9V A;  1O3S A;  1FWZ A;  4WXH A;  2E1C A;  1YQA A;  5D4S A;  2W85 A;  3QPH A;  5L3D A;  1TW3 A;  2W84 A;  1HW5 A;  4RGS A;  2YX4 A;  3F23 A;  1ULY A;  3V4G A;  3P9I A;  2VC1 A;  1IXC A;  4H0E A;  3L09 A;  3FZV A;  3E6M A;  2X4H A;  3BZ6 A;  1KYZ A;  5E1Z B;  3ZMT A;  3E5U A;  5H6R A;  1KYW A;  1ZLJ A;  3I0T A;  2KIM A;  4A6D A;  4KIG A;  5LRR A;  3CO7 C;  2EA4 A; 
#chains in the Genus database with same CATH topology
 3F8F A;  3A2K A;  4DJA A;  1R6R A;  4RAY A;  1V4R A;  2K86 A;  3CCM I;  2DDA A;  1Y0N A;  3PSI A;  3VWB A;  1ZH5 A;  2P6T A;  3GTO J;  2CFO A;  1OCT C;  3N05 A;  1G3Y A;  2W25 A;  4A3D J;  1RET A;  3WU0 A;  1U8B A;  1X3W B;  2Y9Z A;  1QU3 A;  1FY7 A;  1R58 A;  2CFX A;  3BCA A;  4DYR A;  4XM3 A;  5LHH A;  1P7I A;  3HSE A;  2KMU A;  3IUO A;  1YJ9 I;  1Z3X A;  3BT9 A;  1Z21 A;  2NNY A;  1OYY A;  3U1D A;  2QSH X;  2GWR A;  2A68 F;  3L1P A;  4ESJ A;  3JRE A;  5FD5 A;  4OIO F;  4LK1 F;  4YG2 F;  1HDP A;  2PBI A;  1BM9 A;  3RI4 A;  4XLC A;  3J7Y J;  1O3Q A;  2LF8 A;  4HAM A;  4C3H J;  2HU9 A;  1X1C A;  4EM0 B;  3HL2 A;  1TZL A;  4BH9 A;  2D2W A;  2VLA A;  1I5Z A;  5L3G A;  4WK8 F;  2DT7 B;  4EMS A;  2HZD A;  1PDN C;  3CUQ A;  1FOW A;  1VI0 A;  2EZK A;  1P4X A;  3K4B A;  3PFI A;  5CVR A;  3R4K A;  3S2D J;  1NTC A;  2DW4 A;  3OIQ A;  4PJJ A;  2R7O A;  2M0C A;  1ON1 A;  2X1C A;  4Q5S F;  1ZN2 A;  3ZQG A;  3G1L A;  1J59 A;  4I2O A;  3EYI A;  3Q3S A;  5ICF A;  5IPA A;  3GXO A;  1E0E A;  1FBU A;  3A01 A;  4L5I A;  3GFI A;  1K4S A;  1IRZ A;  1DUX C;  3S16 J;  3BJO A;  1OR7 A;  4CCL A;  5E3N A;  3PL8 A;  4EJO A;  2V9K A;  4MIM A;  5BQT A;  1T38 A;  1MH3 A;  4XSX F;  4B48 A;  3E0J B;  5JI6 A;  2JA5 J;  3CUQ C;  4KMU X;  2O5R A;  1KU2 A;  3KP4 A;  4IHT A;  1JE8 A;  1ZRE A;  3TW7 A;  2E2H J;  5L3C A;  3I5U A;  3QWL A;  4P5O A;  5HLI A;  2QYO A;  2PG4 A;  1ETW A;  5BMZ A;  3ZPL A;  1B1B A;  4YRV A;  1F1Z A;  2Q0O A;  1WJE A;  2MLG A;  1VTN C;  2D45 A;  2VPR A;  2WY8 Q;  1SAX A;  1WH7 A;  3MWM A;  1QO0 D;  5C4X J;  1XDU A;  1GV5 A;  4PJL A;  3L2V A;  3HOT A;  1D0Y A;  3OYG A;  1OR7 C;  2DMQ A;  2XAS A;  2ESH A;  3QP5 A;  2GIZ A;  3FXO A;  2GM4 A;  2LTP A;  4D5C A;  3FHZ A;  3EQL F;  4GYG A;  4EM2 A;  2RNG A;  3SZG A;  3L9F A;  5EGO B;  1HOM A;  3CLQ A;  2JVG A;  1PYV A;  3DBR B;  1J5Y A;  5HDG A;  4D7M A;  2PEX A;  2KDZ A;  1HW1 A;  4A6E A;  2WAQ N;  2KHM A;  4I6Z A;  3ZQF A;  1ZAO A;  4HF2 A;  1IUY A;  1G6N A;  1MW7 A;  2GA2 A;  2XPW A;  4LK0 F;  2LRE A;  3DF8 A;  1YRN A;  2HQA A;  4CUG A;  1YIO A;  1IN8 A;  3LSP A;  2HOA A;  2MFZ A;  3IC7 A;  5DD8 A;  3HTS B;  3MD2 A;  2YX7 A;  1T0F A;  2LFB A;  4GO1 A;  5D6E A;  2JUC A;  3MZY A;  4E70 A;  2HNH A;  3VSL A;  2UWM A;  3AKZ A;  5H20 A;  3IRQ A;  3DWL E;  2E35 A;  4NQW B;  2E5Z A;  4RLF A;  1G3W A;  1A31 A;  5J3L A;  5TRD A;  1IXR C;  1FT9 A;  4RB2 C;  2HDC A;  4XKW A;  3IWF A;  2IVM A;  3ULQ B;  5M3M J;  4FTH A;  2B9S A;  1W5T A;  2R7Q A;  3B73 A;  3J80 Z;  3QYB A;  2BBY A;  2L7Z A;  4AYB N;  5C44 J;  2JPC A;  3JRD A;  2STW A;  2R7Z J;  3HBL A;  2QSF X;  3OYB A;  3GTQ J;  4BKX A;  2LYC A;  1JT6 A;  1TWA J;  2I10 A;  3AG3 H;  1R1V A;  4M71 A;  4Y7N J;  1O7L A;  1YIT I;  2LC2 A;  1VZ0 A;  1IV6 A;  1MMG A;  2FNP A;  5DCF A;  1T0F C;  2MBF A;  3OS0 A;  1I3Q J;  1KA8 A;  3R60 A;  5E8I A;  5HS7 A;  3BG6 A;  3WTT C;  5FRO A;  2ISZ A;  1TTY A;  2XAH A;  1U0J A;  3FF5 A;  4GXO A;  2YSR A;  5DUI A;  2IJL A;  5D8K B;  4GCV A;  4A3F J;  3S3N A;  1APL C;  1IN6 A;  1JTX A;  2R7W A;  1V5G A;  2FUG 2;  4A3J J;  1T08 B;  4G12 A;  2P5L C;  1B9M A;  2WV1 A;  3HXL A;  4LB5 A;  3P7N A;  1EF4 A;  1X58 A;  4PGG A;  4A3I J;  3T0Y A;  2VXZ A;  2XAF A;  3O8G A;  1QGP A;  2HKO A;  3PSF A;  3WG7 H;  3U1K A;  2DQL A;  1SFU A;  4FX4 A;  2XSD C;  1TT0 A;  2CQQ A;  3H0D A;  2XC7 A;  4RGR A;  4M9X A;  4C2T A;  5L3E A;  3E97 A;  1H88 C;  3H5N A;  4ZYG A;  5E1X A;  1JT0 A;  1Y8Q B;  3ML6 A;  2HVS A;  2V7F A;  1Y1W J;  2XGC A;  2FXA A;  3S8P A;  2HPI A;  1CF7 A;  4IPA A;  4BHB A;  2XIG A;  4G6Q A;  4AU7 A;  1IN7 A;  2HXI A;  2VQG A;  1RKW A;  3I4M J;  4MO7 A;  1S7E A;  3D5S C;  4F92 B;  1FTT A;  2V6C A;  4IHY A;  1OCR H;  2LG4 A;  2AXL A;  1XSV A;  4U88 A;  4KJZ A;  4WXD A;  1U3E M;  2E34 A;  2R7F A;  3PNY A;  1QZE A;  4QLC U;  3HIF A;  2D5V A;  3BZK A;  3OYM A;  5C3E J;  3SXY A;  4HV5 A;  2LR8 A;  3H9J A;  2O8X A;  3S14 J;  4DBQ A;  2Y0S A;  1R4M B;  2DXI A;  4L0Y B;  3A0H C;  1O7F A;  5LLQ A;  1ETK A;  2A05 A;  4XKC A;  3OS2 A;  2XGE A;  1GT0 C;  2HEO A;  1IV8 A;  3H1C A;  2WV0 A;  1L0O C;  3MAJ A;  1XMA A;  3WTX C;  4ENK A;  4IHW A;  2X0L A;  4D1Q A;  3CME I;  4L5E A;  1SFO J;  3MKY B;  1YS7 A;  4K2E A;  3K4J A;  3TP3 A;  2ETH A;  1SFE A;  2BY1 A;  2EFP A;  4ZJZ A;  2RC4 A;  1EH6 A;  1F9N A;  3DKW A;  4FE7 A;  1P4W A;  3F22 A;  3WTW C;  3IH4 A;  2E1M B;  3W2W A;  3QPT A;  1C0W A;  2L2O A;  2OCC H;  2DN0 A;  3OOU A;  3RSN A;  1ETO A;  2M0M A;  1TC3 C;  3HB9 A;  3KEQ A;  2VON A;  2OJE D;  3GTL J;  3HOV J;  2MC3 A;  1MMS A;  1U2W A;  4CH7 A;  5KVR A;  4A93 J;  3NQO A;  2EV6 A;  4FQG A;  4ESB A;  1H89 C;  4GGG A;  1K83 J;  4OMZ A;  3I64 A;  4E6K G;  1WQ2 A;  4L18 B;  3ZMZ A;  5GPA A;  1PP8 F;  4XRM A;  4Q4Z F;  2M4G A;  4LD5 A;  3ZOB A;  5LHI A;  3HOS A;  2EZH A;  1XSX A;  1Y0U A;  1SD7 A;  1UFM A;  2HOS A;  2E5N A;  3KPH A;  5J4Y A;  1UG0 A;  4BQA A;  1T8I A;  3MQ0 A;  2AHQ A;  3HKZ N;  2QGU A;  2F4M B;  3Q5F A;  1X4P A;  2HWV A;  2WAF A;  3BJ6 A;  1YW8 A;  2Y48 A;  3GWZ A;  1I3A A;  3ERE D;  5JHF A;  3LQR A;  1OQY A;  2OCE A;  3S93 A;  3JRA A;  3I9V 2;  5HLG A;  4I7H A;  1HQC A;  1TWG J;  5KAI C;  1W5S A;  2QF7 A;  2FML A;  1MSF C;  4IJA A;  2R5Y B;  3JAM Z;  5FD6 A;  4E7Z A;  3TOA A;  3H0G J;  1Z05 A;  1ERD A;  1FC3 A;  4PK4 A;  1BIA A;  2EA2 A;  3CCJ I;  2MD5 A;  4MEX F;  2VOD A;  1O57 A;  1XCV A;  2OF7 A;  3PIO F;  4XLF A;  4HNU A;  4EQQ A;  1R00 A;  4LIV A;  4D0P A;  4UVB A;  3AG4 H;  3EPZ A;  4PZJ A;  5FJ8 J;  2DO7 A;  1HBX G;  3DCF A;  3S3M A;  1YLF A;  1LDJ A;  2M5W A;  4FHT A;  5HNH A;  4HX8 A;  1YFH A;  2VI6 A;  4HF0 A;  5LBQ A;  2DA3 A;  4Q47 A;  2VJ4 A;  5IYB J;  1BR1 A;  1VND A;  5DEQ A;  1SVO A;  4MQV A;  1B72 A;  5FLX K;  1PUF B;  4KFC A;  4IXA A;  3J7Z I;  5EG0 A;  2P7C B;  3T1B A;  4B8X A;  1SD5 A;  4IF4 A;  5E79 C;  1RUN A;  1IRF A;  3M1C A;  2V1U A;  5HS9 A;  2QBY B;  3BRO A;  4U0W A;  1Z91 A;  1H9G A;  5CKT A;  2JA8 J;  5FKO A;  4CGZ A;  2FBH A;  5E20 A;  2EIK H;  2K9L A;  3CJT B;  3OYJ A;  1OCC H;  2CUF A;  2XGX A;  1MND A;  3MMY B;  2E36 A;  4G7Z F;  1WGX A;  1B8I B;  2W4S A;  3ZQH A;  4ZDL A;  5K7H A;  3ASO H;  1DPU A;  4TV7 A;  1T98 A;  3SYT A;  3GO5 A;  5DTD A;  3DEU A;  1A36 A;  5K1Y A;  3RPU A;  3ZQL A;  1Y56 A;  1RPW A;  3CES A;  3X2Q H;  1Y6I A;  2BZT A;  2LSO A;  1GVJ A;  5E3M A;  3P5J A;  4HYE A;  5B66 C;  2KT0 A;  2BHY A;  1FLI A;  1OCZ H;  2WAD A;  1AHD P;  2DTR A;  3M8F A;  2A6H F;  3GYH X;  2ZJ2 A;  2PQ8 A;  3F21 A;  5GP9 A;  1AA7 A;  3FMS A;  2I5U A;  2K4B A;  1ZRC A;  3FXL A;  2V4J C;  4BEH B;  1QVT A;  4HRI A;  1BIB A;  2FA5 A;  1I50 J;  3IHU A;  1Q1H A;  3CCU I;  3FX3 A;  2VQC A;  2P4W A;  1FP1 D;  4G7H F;  2DFE A;  3H5A A;  1MJB A;  1VQO I;  5FLX Z;  2G7H A;  4M9S A;  3JSO A;  2NVY J;  2IS1 A;  4ZYH A;  1MD0 A;  4A0Z A;  2KKO A;  1Z0X A;  2O9L A;  3M8J A;  4BJT A;  2FF4 A;  2R5Z B;  3LAJ A;  5EZG A;  5FO5 A;  3TQN A;  3OYF A;  2M87 A;  3SZT A;  1MMN A;  2BY2 A;  2FQ4 A;  1IO2 A;  3GTJ J;  3OYC A;  4RGU A;  3WGI A;  2L54 A;  3SDG A;  2WB1 A;  2QM3 A;  1NG6 A;  2CQX A;  4O3M A;  3OWT A;  1ZHF A;  3OOP A;  3E5Q A;  4EM1 A;  2X6O A;  2P5V A;  3E6B A;  4MQ9 F;  2FRH A;  1RKT A;  2M45 A;  1PVE A;  1MH4 A;  1WVR A;  4LIT A;  2VJJ A;  3IV5 A;  4KN4 X;  2ZXW H;  4PGH A;  2EIL H;  2BEO A;  3OYA A;  2NOJ B;  2RRE A;  3ESW B;  1WPK A;  2EZI A;  2BHZ A;  1JJ6 C;  2G7U A;  2Y69 H;  1J75 A;  1NHA A;  2LKX A;  2F2E A;  1K6O A;  4QPQ A;  2DT6 A;  5J1U A;  4D9J A;  3UR3 C;  1ETQ A;  4UUV A;  1U5T B;  3S15 J;  2ZFW A;  1VQ4 I;  1IN5 A;  2XHK A;  4HQE A;  2K3F A;  1DU6 A;  5J47 A;  2DCE A;  4CIC A;  3Q0W A;  5C4J J;  2TDX A;  1LE8 A;  5M5X J;  2XSJ C;  1DDN A;  4XRS G;  2BOL A;  3WTY C;  4QTR A;  5M5W J;  3GLX A;  3TO6 A;  2O0Y A;  4OMY A;  2J5O A;  1XTA A;  1Z67 A;  4O5V A;  3J81 K;  4N9I A;  5HDK A;  4UV8 A;  5JLX A;  1QA6 A;  1QPM A;  3K4K A;  1YG2 A;  4CXF A;  3ISP A;  2CW7 A;  1RIO H;  1VQL I;  1FOX A;  1G3S A;  4JYK A;  1MMD A;  3BR6 A;  4S0H B;  3BQY A;  1D0Z A;  2NVU B;  2DA6 A;  2R4G A;  3RKY A;  3TW6 A;  5F1J A;  2IRF G;  5IYC J;  2VC0 A;  1K61 A;  2H1L A;  1P6R A;  2A6E F;  3RKQ A;  2NOG A;  1GV2 A;  4A69 C;  2VB6 A;  3RKX A;  2KJC A;  1RRJ A;  3RZD J;  3KZY A;  1D0X A;  2ZJR F;  1QHH D;  2HVR A;  4N0B A;  5F64 A;  2GLO A;  5LGU A;  1STZ A;  4RB3 C;  3MFK A;  2F5D A;  2B0L A;  3D5R C;  4L9T A;  1I6H J;  1TQM A;  3KP3 A;  1E3P A;  4CCO A;  3CJN A;  3E6C C;  2YR2 A;  1AU7 A;  2DT5 A;  5KAF C;  2CGP A;  1EH7 A;  5D6F A;  4AD9 A;  1ZG3 A;  4HBL A;  2YU9 J;  1FYM A;  2EV0 A;  4IRG A;  2MAB A;  3WHC A;  4X1E A;  4HNT A;  4BNC A;  2UZK A;  1B9N A;  2VE8 A;  3CO6 C;  3RIR A;  5F0H A;  2H8W A;  2WAQ A;  4E7S A;  9ANT A;  3C2B A;  1LVA A;  3J81 Z;  5CPR B;  1FTZ A;  3CUO A;  1TT5 B;  2V9P A;  5ILV A;  1IZ1 A;  1PJR A;  3DPL C;  3HSF A;  2GA1 A;  1SMY F;  1OJL A;  2LY2 A;  1HKT A;  5HOO A;  5D5W B;  1ZGJ A;  2IXS A;  3ZN1 A;  4FX0 A;  5FKK A;  3N4M A;  1R9T J;  3W6K B;  3D5L A;  5F6F A;  3JRH A;  4C2M J;  1YYV A;  1RZ4 A;  4M6V A;  2IS2 A;  3I54 A;  1B4A A;  1WH5 A;  1YW7 A;  2F48 A;  1EV7 A;  1K78 A;  4KT6 A;  4UUS B;  1V3F A;  4AWX B;  4U0V A;  1T6S A;  2CUJ A;  1IC8 A;  3A03 A;  4MTE A;  1MDM B;  4C9Y A;  4L5J A;  4DIQ A;  2N8G A;  3LA2 A;  3LOC A;  1YJW I;  1JXS A;  1B59 A;  3AL0 C;  3V7C A;  3ELK A;  4M6Y A;  1XGS A;  4CCJ A;  3O2P E;  3HUG B;  3C18 A;  2DTZ A;  1QZY A;  2K3P A;  4ENN A;  1POG A;  5F04 A;  3TKY A;  4YFX F;  1WSU A;  2HTJ A;  3I59 B;  3LL7 A;  5DCM A;  2Z2S B;  1SD4 A;  3PNT A;  5EEH A;  2JTV A;  2NNN A;  1NG7 A;  3BTL A;  4A3E J;  2RKH A;  1JKP C;  2Y75 A;  5CYV A;  1UAA A;  5KCM A;  3V7R A;  4M9Z A;  4BQQ A;  2HZT A;  2FBI A;  2VIX A;  1M1E B;  2R0Q C;  3ERM A;  2IGO A;  1A6Q A;  2XVC A;  2WWY A;  1KZH A;  4Y15 A;  2WB1 N;  1FP2 A;  2OPT A;  4XL9 A;  2VUM J;  1N75 A;  1JGS A;  1W7P A;  4WCG A;  3TBI A;  2WBM A;  1R1T A;  1FMW A;  3W3C A;  5B3S H;  3BR2 A;  3ZQC A;  2Q2E B;  4B44 A;  2CV1 A;  3ABM H;  4DOZ A;  1LFU P;  2DMT A;  2KRF A;  3FIW A;  4EGZ A;  1WHU A;  2CRG A;  3ZMV A;  3IAS 2;  1I1G A;  4AIJ A;  2DFF A;  3L00 A;  3TMO A;  1YI2 I;  1FSE A;  4DGW B;  1LVK A;  3GLL A;  5M3F J;  3R0J A;  2RQP A;  3TGN A;  4BQN A;  5HLH A;  2XAQ A;  5FKN A;  5B1A H;  2OUM A;  1QNT A;  2VBW A;  1JUM A;  1N25 A;  3BCB A;  3QU3 A;  2PI0 A;  2H1K A;  1WJD A;  2BXZ A;  5IP7 J;  4XLA A;  1GDT A;  1IRG A;  2QLZ A;  3VYS B;  4GDF A;  4HNV A;  2LVS A;  4LFU A;  2VBZ A;  3D0S A;  2EFW A;  1JKR C;  2MLK A;  1BI1 A;  3FK6 A;  4J19 A;  2MW8 A;  4M3E A;  1P4A A;  2MSY A;  2GIV A;  1WFX A;  1L3L A;  2QZ8 A;  1RR8 C;  4RAG A;  3HM5 A;  1I1S A;  3LA7 A;  2XB0 X;  4XON A;  3CMY A;  4AIK A;  3LSG A;  1VF9 A;  1OKR A;  2EIM H;  2MH2 A;  3G3Z A;  2H27 A;  3MEX A;  2PLY A;  1YHQ I;  2Z9O A;  2DK8 A;  2LY1 A;  2FNA A;  4E7J A;  5J6X A;  4P96 A;  3WTZ A;  5DS9 A;  1E17 A;  2KL4 A;  1IDY A;  3GZN B;  3AG2 H;  3WTS C;  3U21 A;  2VKH A;  4A5N A;  2GAU A;  3LMM A;  4BXU A;  1U78 A;  4RB1 A;  1G2H A;  2WY7 Q;  1F5T A;  2JK3 A;  2W82 A;  5A2Q K;  4RA2 A;  2XF7 A;  4G9Y A;  4KIT B;  5ICE A;  4RM2 A;  2NVQ J;  2QKL B;  2JPB A;  4BDY A;  1UMQ A;  2Y30 A;  2JVH A;  4HLX A;  2RAE A;  3V8L A;  2ZXH A;  3GCM A;  3LSH A;  1MBG A;  4FIS A;  5FFZ A;  2H6B A;  3AFH A;  1KGS A;  4RGX A;  4ZC3 A;  1JTY A;  5FLM J;  3U2R A;  4LLN A;  1MKM A;  1R5H A;  2OV7 A;  5ICG A;  3HKZ A;  4XLN F;  4AVZ A;  1FBQ A;  1WJC A;  4A3M J;  1T39 A;  1YIJ I;  4GYI A;  4LJZ F;  2IA0 A;  2AQF A;  2PFB A;  3EYY A;  4XOP A;  3B6A A;  4Y17 A;  1YTY A;  4BGD A;  4XRS A;  1S7A A;  4NC6 A;  2E2J J;  3BQZ A;  3LSK A;  4JK1 X;  4ETS A;  1IG7 A;  2JSC A;  4LGW A;  2Q1Z B;  1IRX A;  3OMY A;  2XAU A;  4MNU A;  4CDG A;  4GRI A;  5FLV A;  4QPO A;  3OSF A;  3HHH A;  2K9M A;  3I4N J;  3OR2 C;  1HCR A;  1ZRD A;  4CYD A;  1JI8 A;  2K5C A;  3HGY A;  3CTA A;  5ERI A;  4A5M A;  3JTH A;  2EJR A;  3K2Z A;  1A5J A;  4B4C A;  4QIW N;  1AKH A;  2H8R A;  4BHC A;  1OCP A;  3L2W A;  3M1E A;  2PMU A;  3VB2 A;  2M8G X;  3FM3 A;  5TJJ A;  5EZH A;  1REP C;  2KZV A;  2M3A A;  2BE5 F;  3KEO A;  3R0A A;  1KU7 A;  3BWG A;  2ZBK A;  2IT0 A;  3BPX A;  2GXG A;  1I6X A;  6PAX A;  4I76 A;  3RPQ A;  3LWF A;  2AS5 F;  3I71 A;  4NHJ A;  2W1O A;  2M7B A;  2UXN A;  5HNF A;  2OZ6 A;  2YS9 A;  4RB0 A;  2CSO A;  4P9U A;  3F3X A;  3KFW X;  5L3F A;  3EUA A;  2X1E A;  3CUQ B;  3WE2 A;  4MGR A;  5DDG A;  1BL0 A;  4AUX A;  2L01 A;  4Y33 A;  4EJW A;  3SDB A;  1ETX A;  3FXJ A;  5DD4 A;  3LSR A;  3ABT A;  2PJR A;  2JT1 A;  3NRV A;  1WJF A;  3T8T A;  3MKW B;  3CP8 A;  2F5E A;  3BTC A;  3LAP A;  1BJA A;  3H3Z A;  3V8J A;  1WCM J;  3QOP A;  3HC7 A;  3JRG A;  2K85 A;  3S1Q J;  5FFX A;  1FSH A;  1A04 A;  2L9S A;  2P0W A;  4CZZ A;  3A01 B;  3F8N A;  2ZCW A;  2ZNZ A;  1Z6T A;  4BUP A;  1BI0 A;  5E18 F;  2K4J A;  5EDN A;  2X6X A;  4UV9 A;  5TIS C;  3DEW A;  4RLQ A;  3BG7 A;  1QBJ A;  1K79 A;  4E7L A;  3BR5 A;  4UXN A;  2X9D A;  3T5X A;  4YFN F;  1ZK8 A;  3DXJ F;  3OYD A;  2FU4 A;  1S6L A;  2LRD A;  3BTI A;  4PJM A;  4HW0 A;  3ZMD A;  2L7M P;  2NXN B;  1VQN I;  3G4S I;  1IGN A;  5BOX A;  2ELH A;  1WJB A;  1IXS B;  2Y31 A;  1YE9 A;  5IP9 J;  3S3O A;  4L9N A;  4BAY A;  1HDD C;  3P9C A;  1J09 A;  1GUU A;  3NEU A;  2IW5 A;  5LGN A;  1SD6 A;  1FX7 A;  3FKJ A;  2XGD A;  4DNC A;  1PUE E;  4ZTF A;  4ENM A;  3S2H J;  3ZRG A;  3RDI A;  2BY3 A;  4AID A;  1GXP A;  2H6C A;  4HV6 A;  3EUH A;  4OIP F;  3CLO A;  1ZAR A;  2QQ8 A;  2OAZ A;  3O3K A;  2XPV A;  4KIB A;  2EFO A;  3GZ6 A;  1MNM C;  5BPI A;  1SVL A;  3FMQ A;  2LBF A;  4OWR B;  4MLO A;  4UB6 C;  2R7S A;  1NK3 P;  1UCR A;  3BR0 A;  2M1B A;  5AIQ A;  5IYD J;  2MGQ A;  3DU6 A;  2KIQ A;  1D1C A;  3JTG A;  2V26 A;  2E71 A;  2YU3 A;  3IRR A;  3M3Y J;  1YRN B;  3TDZ C;  4DYQ A;  2PX9 A;  3PQJ A;  1LJ9 A;  4N4N B;  5JLW A;  3RQI A;  1D8J A;  2IGM A;  5CVJ A;  3EUH C;  4MHG A;  5JR3 A;  3QAH A;  3L2Q A;  2VAS A;  4WXC A;  3WTU C;  3F8B A;  4NNJ A;  3LST A;  4XOR A;  4PFP A;  2KIF A;  1VFC A;  1XPX A;  4EGY A;  1T95 A;  4MFE A;  1R5G A;  2KRC A;  2LKS A;  3FBI B;  1XCB A;  4AIH A;  2E60 A;  2EV5 A;  5DM6 F;  1YO5 C;  3VPR A;  2UUZ A;  4IKF A;  4EAT A;  3OV8 A;  5EJC A;  5J8C A;  2XRN A;  1E3O C;  3CC2 I;  3H9G A;  4GFB A;  2GXA A;  4CCN A;  1OYI A;  2EBI A;  3BR1 A;  2DOD A;  3H5R A;  4XBF A;  5IOY A;  1Y8R B;  1WKM A;  1H8A C;  3MZH A;  4KUM A;  4EJU A;  2DFI A;  1H9T A;  3HOX J;  1YX3 A;  4UUT A;  1J2X A;  2DMP A;  2CUE A;  3Q9V A;  1TQP A;  2CW8 A;  4BAC A;  3A0B C;  3IL2 A;  3IWZ A;  3SFI A;  3DEE A;  3OIP A;  4G8X A;  2AQE A;  4EVI A;  3GTG J;  2F5C A;  1BOB A;  2R7U A;  3L2R A;  3PO3 J;  3K6G A;  4S04 A;  2DYS H;  2BW3 A;  2XKO A;  4IQJ A;  5JHU A;  4OIN F;  2EPF A;  3JSP A;  1BOA A;  3K1M A;  1IW7 F;  1R23 A;  5IT9 K;  1XMX A;  2TCT A;  4DQ2 A;  1XMK A;  5IOZ A;  3OYE A;  4D7N A;  3G6E I;  1ORK A;  3MN2 A;  3BJA A;  1LQ1 A;  2EK5 A;  2OQG A;  1QZZ A;  4O6J A;  3GW2 A;  4BYY A;  3E6D A;  1FPQ A;  4BL0 B;  3FXK A;  2DDB A;  4ZYE A;  2L0K A;  2WA0 A;  2QQ9 A;  4UB8 C;  1CF7 B;  3OIO A;  1ETY A;  1ONV A;  2A3S A;  1GVD A;  4WF2 A;  2F5F A;  3K7A J;  1D1A A;  2O6G E;  3PNV A;  3HTU A;  1BI3 A;  4YIR X;  2LH9 A;  2ZC2 A;  3GFL A;  3NWT A;  2AO9 A;  1P92 A;  4MEY F;  2DK5 A;  3CD6 I;  3PUF A;  3KX2 A;  3EDP A;  3JRB A;  3OS1 A;  1XS9 A;  1SAU A;  2XAJ A;  1ZG1 A;  1BW6 A;  3S1N J;  2HGC A;  4U7D A;  4BY1 J;  4LG3 A;  4CSW A;  4U87 A;  1BR2 A;  1MZB A;  4HEA 2;  1V54 H;  1HST A;  2HXO A;  2HQN A;  4H4K C;  3VYU B;  2I8D A;  4A3C J;  3ZGK A;  4HDV A;  2QUF A;  2CQ7 A;  1W1W E;  3E5X A;  4NC8 A;  3PIP F;  1ZR2 A;  1IJW C;  2RGV A;  2Z5U A;  4ANJ A;  1X2N A;  1VQ9 I;  2XAG A;  4MFD A;  1JKO C;  5K7F A;  3K10 A;  1TNS A;  3M07 A;  3RQ4 A;  4HOB A;  1OMI A;  2OU2 A;  2JA6 J;  4HF1 A;  4IHV A;  3PM1 A;  4IL6 C;  2PMZ A;  2NRA C;  3GTM J;  3WU2 C;  4C2U A;  5D4R A;  1VQ8 I;  1UHW A;  3VDX A;  1RR7 A;  1XGO A;  4Z6Y A;  4E7K A;  1HLV A;  1R1U A;  1CGP A;  1MJA A;  3R61 A;  3CC4 I;  4A3K J;  4JBA A;  2A61 A;  3EUK L;  1WI3 A;  4C30 A;  2ZME A;  2R7X A;  3BG3 A;  2MA3 A;  1W36 C;  4YIF A;  5D5X B;  2WTE A;  2L7F P;  1XD7 A;  3F0C A;  1LB2 A;  3K4N A;  1FIP A;  1LDD A;  3GFM A;  1EA3 A;  1HKS A;  5HDN A;  3JW4 A;  1K4T A;  3VFZ A;  3ZQI A;  2MH9 A;  2NYX A;  2KJB A;  3KZZ A;  4ENJ A;  5CVU A;  2LK2 A;  4RAF A;  3QU6 A;  2R3S A;  1QHG A;  4BE1 A;  1LPQ A;  2O3F A;  3CCY A;  3F6O A;  1PP7 U;  3GFJ A;  1QRY A;  2NAZ A;  3KP7 A;  2EWN A;  3TDU C;  2OTL I;  3CDI A;  2RDP A;  1MSE C;  2MYS A;  1YJN I;  3LA3 A;  3TL4 X;  4HA8 A;  3WGH A;  2A6T A;  3J7A Y;  1T56 A;  2ZME C;  4M3B A;  5ED4 A;  1HW2 A;  3K69 A;  2XRL A;  4DYC A;  5KK1 A;  3ZMS A;  2F4O B;  2K9S A;  3MKZ A;  1R22 A;  1OYW A;  3BR3 A;  4XLH A;  1R5I D;  2WAE A;  4AC0 A;  3DKY A;  1UHS A;  3B6C A;  3E7L A;  3EET A;  3RPU D;  3FXR A;  2A69 F;  4CHU A;  2STT A;  5FRN A;  3C3W A;  4NBQ A;  4A2U A;  3ZN0 A;  2RQQ A;  5E3O A;  5F08 A;  4M3G A;  4HX7 A;  1RC9 A;  4OOI A;  5DYM A;  3SFZ A;  2VQH A;  1FYL A;  5CQG A;  3CQZ J;  4KIS A;  4FT8 A;  2G9W A;  3J7A O;  1QVU A;  1S9H A;  3ROU A;  1MBE A;  1S29 A;  2VT2 A;  2HDD A;  1TL8 A;  2HVQ A;  2EFQ A;  3W2V A;  4IEJ A;  2QVO A;  3E3V A;  3HOY J;  4KIF A;  2QQA A;  2X6Y A;  1B72 B;  4W97 A;  1P9Q C;  3TO7 A;  1KQ0 A;  5K5R A;  2IEK A;  3GX4 X;  3LQQ A;  4L0Z B;  1S72 I;  4UVA A;  5EG0 B;  3FHN A;  1XG1 A;  3A4C A;  2LKP A;  2A07 F;  4OIQ F;  3DQV C;  5IY5 H;  4B47 A;  1J0R A;  4CCK A;  4EJT A;  2DMU A;  1HA8 A;  5E17 F;  3Q0V A;  2L4M A;  2MG4 A;  2M9H A;  3K4M A;  1TWH J;  3RKW A;  2W57 A;  1YW9 A;  2COM A;  2J5P A;  4KT5 C;  3OL4 A;  4F7Z A;  4LG0 A;  2VJ5 A;  4BU2 A;  2XKP A;  3DP7 A;  4L9J A;  4XK4 A;  2XRO A;  1N78 A;  1ZRF A;  2M30 A;  2L02 A;  1GLN A;  3S2W A;  1OPC A;  2B7E A;  2HOE A;  3BG5 A;  3HOZ J;  3P9K A;  3K70 C;  3HGG A;  4KA4 A;  4PUS A;  2HYJ A;  1R7J A;  1DGR M;  2E7X A;  3KEY A;  3IKV A;  1DP3 A;  3HRS A;  1IF1 A;  2GOM A;  4HDU A;  3CCV I;  1XDS A;  1X1A A;  4C3J J;  3JRC A;  4HQM A;  2RVC A;  2IS6 A;  2ID3 A;  1G8X A;  1QQI A;  4G6D A;  4XIC A;  3IH3 A;  2VT3 A;  3G71 I;  3R6S A;  2ACJ A;  2FBK A;  3BPV A;  3QYE A;  2CU7 A;  3LFK A;  3N97 A;  3FMR A;  2Z3Y A;  2V9V A;  2L9N A;  5LD2 C;  2BVM A;  4I01 A;  3GTP J;  1ZQ3 P;  4MTD A;  2ZFU A;  2ZB9 A;  2JMW A;  1KU3 A;  1LFB A;  3C2G A;  2XDV A;  4LLL A;  2M4K A;  2VOP A;  2W7N A;  2R7V A;  1UEL B;  1Z6R A;  4JP0 A;  4RMN A;  1HKQ A;  4XR6 A;  5F1R A;  1JKQ C;  2OA4 A;  1VQP I;  4XLE A;  5LRS A;  2LLK A;  2VJI A;  1TWF J;  3HRM A;  3S1M J;  2CV2 A;  3K0L A;  2ZSI B;  3V7S A;  4XOT A;  4M74 A;  3VYR B;  2ZJP F;  3T8R A;  2KIS A;  1ZYR F;  4KYW A;  4I0A A;  2Q8K A;  4BE0 A;  4ON0 A;  1BJZ A;  2VN2 A;  3CZ6 A;  3K9T A;  2UXX A;  3FXQ A;  2K9N A;  3KYL A;  2M7A A;  2IA2 A;  2HTS A;  2PMZ N;  3O6B B;  2VL8 A;  2OZU A;  2OD5 A;  1ITY A;  3I55 I;  3K1N A;  3ZQ7 A;  1T33 A;  1RUO A;  2DPU A;  2BXY A;  1D5Y A;  2LY9 A;  2HOT A;  3WU1 B;  2VPL A;  4DZP A;  3H35 A;  3K4L A;  2M8E A;  2OQR A;  2PN6 A;  3ASN H;  3DU5 A;  1D5V A;  2ME0 A;  4A3L J;  2KIU A;  3CCL I;  2M34 A;  4P9F A;  1X1B A;  3ZP5 A;  1LE8 B;  4IZZ A;  2HKX A;  3SEZ A;  1VQK I;  3LFU A;  2CJJ A;  3SHF A;  1ON2 A;  5EGO A;  4RDU A;  1QPI A;  1RNL A;  2EQR A;  3KLO A;  3ABL H;  1ZLK A;  2X1D A;  5H2F C;  2ESN A;  3KP2 A;  4QSH A;  1OIS A;  2ELJ A;  1ACI A;  2RV8 A;  4A3B J;  3AG1 H;  5J1R A;  1N77 A;  1R49 A;  1AOY A;  3C2H A;  4P1W A;  3TP0 A;  2JA7 J;  4XRF A;  3VYT B;  2IGK A;  5FGM A;  1U8R A;  1ZGA A;  5DV5 A;  4I09 A;  3H92 A;  3FM5 A;  3QRF F;  4Y13 A;  3FK7 A;  1S5L C;  3F6V A;  3L7W A;  3JRF A;  1ZGW A;  4QWQ A;  4ZDP A;  1JGG A;  3M9A A;  2L7K A;  4NQW A;  3CCR I;  2FMY A;  4LG0 B;  1WJA A;  4HX4 A;  1BI2 A;  5B5E C;  1G59 A;  1S8N A;  3BY6 A;  3E1S A;  3M8E A;  1Y39 A;  4DBR A;  1A6I A;  4IHS A;  4NDL A;  2V1X A;  4B3X A;  3DKX A;  5TGT A;  2X48 A;  3BDD A;  4U0Y A;  2K7L A;  3G2B A;  1U9N A;  1FBS A;  3SJM A;  3VEP A;  1Z1D A;  3VOD A;  4RS8 A;  5E3L A;  1D1B A;  4Y3O A;  2CMP A;  1Y1V J;  3PQK A;  2VE9 A;  1MNE A;  5CJ9 A;  3VOE A;  4BJ6 C;  2E2I J;  3G1O A;  5EYR A;  3I4P A;  2ZJQ F;  2L9V A;  4BBR J;  4BS9 A;  2DLL A;  4F93 B;  1F36 A;  3MZ8 A;  2DPD A;  2ID6 A;  4JX5 A;  3HEF A;  5GAE J;  5ILU A;  1VQ5 I;  3FDY A;  4G6T B;  3AL0 B;  4P55 A;  4X0G A;  3H3V K;  5LEK A;  5J40 A;  3RTR A;  1HSJ A;  3GME A;  2VBY A;  2W00 A;  4LOC A;  5D8L B;  3HRU A;  3IH2 A;  3OYH A;  1W7P D;  4UHT A;  4DW6 A;  3DFG A;  4HG2 A;  3VSK A;  1AWC A;  3SZP A;  3HRT A;  2E19 A;  4M6X A;  1A35 A;  5CLS A;  1K78 B;  4XQF A;  2FOK A;  5B1B H;  2R92 J;  3DPU A;  2JQ7 A;  5AON A;  3L2U A;  3DLL F;  3OSG A;  2VBX A;  3SQN A;  5EEA A;  1LKX A;  3DV8 A;  2HYF A;  1FEX A;  2HR3 A;  1MJ9 A;  3FXU A;  4R8H A;  1GHC A;  2P5K A;  3GUD A;  2ZXI A;  1MBH A;  2UV1 A;  3K4C A;  2XPU A;  1ZTR A;  1LUJ B;  5K5O A;  2IP2 A;  3J80 K;  3C7J A;  2DA5 A;  1BC7 C;  2CS3 A;  4XN0 A;  2VOO A;  5DCM B;  3WTV C;  2DBB A;  3HOW J;  4KIC A;  3NAU A;  2VKD A;  3CCQ I;  2E1N A;  4A12 A;  5ILS A;  3V42 A;  1O3R A;  2FX0 A;  5JFR A;  2ISY A;  2KQR A;  2RN7 A;  4IRH A;  2KZG A;  5LEJ A;  2BGC A;  4XKB A;  2VXD A;  1SAN A;  3OYL A;  4B43 A;  4ZYA A;  3BC8 A;  2CO5 A;  3PO2 J;  5A2Q Z;  2DA4 A;  5FB2 A;  2DJI A;  1W7P B;  3GEZ A;  5GTH C;  3KIO A;  4M72 A;  3Q9S A;  4RAZ A;  1BN5 A;  3D1N I;  1KON A;  3FWE A;  3ABU A;  4PJN A;  3G73 A;  5HLT A;  3CF2 A;  1X3U A;  4NC7 A;  3LNQ A;  1DU0 A;  2CG4 A;  3HDD A;  2ICW G;  2R93 J;  5GAH J;  3WG9 A;  2E7W A;  5D5V B;  4I0B A;  2W48 A;  1SC7 A;  5H6Q A;  5HVQ C;  1JHH A;  2BYV E;  1XX5 A;  3KYD B;  5M5Y J;  4ZTJ A;  1X3Z B;  2YPR A;  4X6A J;  4IRI A;  3KCC A;  4FAS D;  3U9G A;  4ABZ A;  4UNO A;  1U9O A;  2CQN A;  4LMY A;  1BW5 A;  2Z99 A;  2YUS A;  1ZR4 A;  5EF6 A;  2JN6 A;  2P6S A;  1XN7 A;  2KDO A;  2DOF A;  3CC7 I;  2DOE A;  3H9Q A;  2OTJ I;  3GF2 A;  2E1M C;  2XUB A;  1SVM A;  1CQT A;  2DA7 A;  2CUZ A;  4V2G A;  1JUP A;  4M73 A;  3WOD F;  2Z1D A;  1G4D A;  4IHX A;  4V19 K;  1O3T A;  1W4M A;  4CYC A;  2L5Q A;  3PFY A;  2R5Y A;  4E7H A;  3RZO J;  3WGG A;  5FKL A;  1X2M A;  1ZKG A;  1FJL A;  5BNG A;  2VQL A;  2QWW A;  2EFN A;  2V1N A;  2P81 A;  2OC6 A;  3PUB A;  1G3T A;  1TLH B;  4NB5 A;  1JUS A;  3HOU J;  4BBS J;  1JHF A;  1ZEL A;  1J7K A;  4EEF G;  5AIP A;  4OIR F;  2LOO A;  4CCM A;  1FMV A;  5E1W A;  2VKV A;  4JQF A;  3GZ5 A;  2JWT A;  4E4H A;  4Q48 A;  4XSZ F;  1YX5 A;  3RYR A;  3OYN A;  1MIJ A;  3NAR A;  1FNN A;  5JVT A;  1X1P A;  2ZO4 A;  2EIJ H;  3F8C A;  3A02 A;  2QEX I;  2DMN A;  1PUF A;  3CCE I;  3RYP A;  1TQI A;  4LB6 B;  2P8T A;  4V2F A;  1XGM A;  2HI3 A;  4OAZ A;  3DTE A;  2QCO A;  5KHD A;  2CV0 A;  2EZL A;  2O03 A;  1WZ2 A;  2K27 A;  2LNB A;  2QBY A;  1UJ8 A;  2TRT A;  2ADU A;  2Y2Z A;  3TOB A;  4XID A;  3QP6 A;  3KET A;  1FIA A;  4PJ0 C;  3UKG A;  1GXQ A;  2JSP A;  1UHM A;  3K1P A;  4BDZ A;  2LF7 A;  4ZZL A;  3DLA A;  1B8I A;  1TWC J;  5J8F A;  4IQ4 A;  1WWX A;  1R71 A;  2HQ5 A;  4ESF A;  4CA0 A;  1VQ6 I;  2H94 A;  3JRI A;  4KNY A;  4KN7 X;  3JCU C;  2LP0 A;  3QOD A;  1BR4 A;  1RES A;  1TNT A;  2OBP A;  2X6W A;  1U6G A;  2DQR A;  2L4A A;  1ODD A;  4U7B A;  5HS8 A;  2K40 A;  1FYK A;  4KDP A;  2K02 A;  3JAM K;  3TED A;  4A0X A;  4BEH A;  1S3J A;  1AKH B;  2QEN A;  1JJ8 C;  4D5F A;  1MMA A;  5LFA A;  3SEQ A;  1D8K A;  2CW0 F;  1MBK A;  3ECH A;  4ZDO A;  4A3G J;  5IP6 A;  1V5E A;  5GAD J;  3B02 A;  4G7O F;  2JA2 A;  1TP4 A;  2GBY A;  3HJE A;  2R5Z A;  5D5U B;  2L3D A;  5K7Z A;  2XV4 S;  2LD5 A;  1R36 A;  3W6J B;  4XLP F;  3G1M A;  3KE2 A;  4OU0 A;  4B09 A;  1KU9 A;  1WRJ A;  1P7J A;  1D3Y A;  2QKM B;  3IAM 2;  1FOY A;  1BC8 C;  2QSG X;  4YEJ A;  5F27 A;  3HG9 A;  4ZYD A;  1KQ8 A;  1SFX A;  4PSX A;  4KMF A;  1X4O A;  3LSI A;  1XC5 A;  2PJR B;  1DPR A;  4I98 B;  1T2K A;  2EH3 A;  2R7D A;  3ZCO A;  1W5C C;  2LDU A;  1EJ9 A;  5IT3 A;  2ECB A;  1UG2 A;  1X19 A;  3GBG A;  4C3I J;  4B1R A;  2ZSH B;  3DTI A;  3QOE A;  2LMD A;  2BV6 A;  2VKE A;  1VQM I;  1I27 A;  3K2A A;  1RI7 A;  3FIS A;  5GTI C;  2IA1 A;  3NWS A;  2BY0 A;  1W0T A;  3FKI J;  3HPH A;  4BJ5 C;  4CYC B;  1WJ5 A;  1VQ7 I;  1SMT A;  4CO8 A;  2NVT J;  4BXX J;  2ZKZ A;  3KP6 A;  2F6C A;  1LDK B;  4WWC A;  5CVV A;  3KP5 A;  4ZH4 F;  3I56 I;  2AXT C;  2GQQ A;  2V1D A;  1U5T A;  4PDK A;  2IPQ X;  4Z2Y A;  5LHG A;  2EIN H;  4XMY A;  4I02 A;  1IDZ A;  3ECO A;  3W2A A;  4IOA F;  3AAF A;  1Z7L A;  2ELK A;  3L2C A;  4EJV A;  2B63 J;  3CDH A;  4AVP A;  4II3 A;  3M4O J;  3BZC A;  1Z7U A;  3HSR A;  2WC2 A;  5EEG A;  2ME6 A;  2HQR A;  5J1Y A;  1E3H A;  1BA5 A;  2RNJ A;  2R7T A;  3LSM A;  4EV0 A;  2DYR H;  3MVP A;  2JUG A;  5BS6 A;  4CZC A;  3HHG A;  2Z33 A;  1XB4 A;  2KRH A;  3I3L A;  4BHP A;  1K6Y A;  1MGT A;  2LBF B;  2C6Y A;  4HZF A;  1U5T C;  2ZNY A;  2DFH A;  1TW2 A;  2CWE A;  2DU9 A;  2JRT A;  5F0F A;  4LLG F;  3FXM A;  5GAG J;  3GVA A;  2X85 A;  4AM3 A;  4F3Q A;  4FCY A;  5F0C A;  1YOV B;  5L3B A;  2IS4 A;  4G94 A;  2H09 A;  5IT9 Z;  1NH3 A;  2R7R A;  1KQ9 A;  1I39 A;  2O7O A;  1XGN A;  2NS0 A;  3WE3 A;  2Z16 A;  5JVG F;  5DM7 F;  4ASN A;  2QQB A;  1J9I A;  3RJP A;  2GZW A;  4ITV A;  5GPC A;  1FOK A;  4N9H A;  2DI3 A;  2M2E A;  1S7O A;  2P7V B;  2D1V A;  1F4K A;  4PCQ A;  3ZR8 X;  1EH8 A;  3FBN B;  1DP7 P;  4S05 A;  2FJ1 A;  2GXB A;  3F8M A;  3IKT A;  4IOC F;  4R1H A;  3CF5 F;  2Y0M A;  1OFC X;  1UZC A;  3HZJ A;  1V5F A;  2DAO A;  3CMA I;  4OAY A;  3PJR A;  4M3D A;  1ETV A;  3BOQ A;  3OYK A;  2PMH A;  2O61 A;  3F9K A;  5CVI A;  2FSW A;  2JRM A;  2ZXJ A;  4DZJ A;  1USS A;  4IVN A;  2O8K A;  2BVL A;  1MBF A;  4BQO A;  4YII A;  5FRM A;  1K7A A;  2QA4 I;  3M7G A;  2COB A;  4IX7 A;  3DPT A;  3QPS A;  1UST A;  3CCS I;  2F5V A;  2MC4 A;  2W24 A;  1H0M A;  4UY8 I;  3OYI A;  2Y0S N;  4NUB A;  2D1H A;  2CYY A;  2L9R A;  1YS6 A;  3DBH B;  3ZMU A;  5FKM A;  2KPM A;  1W36 D;  2CH0 A;  2MD0 A;  3KLN A;  2BW3 B;  4UUS A;  3CP2 A;  2V79 A;  2V6E A;  2K9Q A;  1MDM A;  3OY9 A;  2KP6 A;  4A0Y A;  3S1R J;  4UVC A;  2JZY A;  1LEB A;  1E2X A;  2JJ7 A;  3Q0U A;  5DUK A;  1ZG5 A;  4XNF A;  2FEZ A;  3HPG A;  5HOD A;  1NK2 P;  2HFH A;  4F52 A;  1HC8 A;  3HYI A;  3H36 A;  3HUG A;  3OR1 C;  1R4N B;  1DQU A;  4I99 C;  2IGN A;  3UNG C;  3I58 A;  4YEL A;  1BBY A;  5CQE A;  3ZXS A;  5J4V A;  3DTK A;  4BXF A;  1XSD A;  3W6V A;  3QYF A;  1LNW A;  3I59 A;  4M3F A;  5ICC A;  4YFK F;  1Z77 A;  3MCZ A;  2NS7 A;  3C1D A;  2EB7 A;  1V55 H;  4JX4 A;  4HLY A;  1IUF A;  1O4X A;  3IP4 B;  1Z3Y A;  1UB9 A;  4II2 A;  4J01 A;  4WX9 A;  3KZI C;  5BPD A;  2CQK A;  3F72 A;  2HPM A;  1FZP B;  1B6A A;  3S32 A;  1TBX A;  4PSW A;  2HYG D;  2G0E A;  1Q1V A;  4Y52 J;  3BTJ A;  5E8G A;  3JR9 A;  3BP8 A;  2Q2E A;  2FD5 A;  4ZZD A;  1Z9C A;  4HPQ A;  3ZQQ A;  3QQA A;  2HS5 A;  1X1D A;  3TO9 A;  1F43 A;  2DA2 A;  4RM3 A;  4Y4R A;  1HXD A;  2FOW A;  1WI9 A;  3LSJ A;  3MKL A;  1OLT A;  2FE3 A;  4F55 A;  4PFO A;  2KLO A;  4BE2 A;  1IN4 A;  4HSR A;  3GTK J;  2PJP A;  2XB5 A;  1EKE A;  1P2F A;  2ECC A;  2FQ3 A;  5K5Q A;  1DGW Y;  2NS8 A;  3CJR B;  3RCO A;  3REO A;  5LGT A;  4R79 A;  3S17 J;  4JOM A;  2ZME B;  2X51 A;  2KFD A;  3I53 A;  4W1U A;  4XN3 A;  3V8K A;  4E7I A;  4BY7 J;  5KNL A;  3DBL B;  3COA C;  1IAW A;  3BLY A;  3H3U A;  4IO9 F;  2IAI A;  4XKV A;  2A5Y B;  1LEA A;  2E1O A;  2F4I A;  4L9V A;  1SEU A;  1O3S A;  1FWZ A;  4WXH A;  3K70 D;  2IBD A;  2Y9Y A;  3CMM A;  3ONQ A;  2E1C A;  2A5W A;  1YQA A;  5D4S A;  2W85 A;  3QPH A;  5L3D A;  1TW3 A;  2DA1 A;  1ENH A;  4FE4 A;  1SFK A;  1HW5 A;  2W84 A;  2GOX B;  4RGS A;  4FET A;  1W0U A;  3BG9 A;  2YX4 A;  3OL3 A;  1ULY A;  3V4G A;  3F23 A;  4F91 B;  4RBO A;  3P9I A;  4JX6 A;  2VC1 A;  4LIU A;  3CDL A;  1IXC A;  4H0E A;  4N4O B;  3L09 A;  3FZV A;  3E6M A;  3QPL A;  2X4H A;  4B3A A;  3BZ6 A;  1MBJ A;  3ABK H;  1KYZ A;  4AYB A;  1HF0 A;  5E1Z B;  4J00 A;  3ZMT A;  3E5U A;  3KYC B;  2DJN A;  3O8H A;  5H6R A;  1OCO H;  2HDW A;  1KYW A;  1ZLJ A;  3A1Y A;  2XF6 A;  2XF5 A;  3I0T A;  2KIM A;  4A6D A;  4KIG A;  5LRR A;  2DOA A;  1LFP A;  3WHB A;  3CO7 C;  2NVX J;  3CJQ B;  2EA4 A;  4HST A; 
#chains in the Genus database with same CATH homology
 3F8F A;  4RAY A;  1V4R A;  2K86 A;  1ZH5 A;  2P6T A;  1G3Y A;  2W25 A;  3WU0 A;  1FY7 A;  1R58 A;  2CFX A;  5LHH A;  3HSE A;  2NNY A;  1OYY A;  3U1D A;  2GWR A;  2A68 F;  4ESJ A;  5FD5 A;  4OIO F;  4LK1 F;  4YG2 F;  2PBI A;  1BM9 A;  3RI4 A;  1O3Q A;  2LF8 A;  4HAM A;  4EM0 B;  4BH9 A;  2D2W A;  1I5Z A;  5L3G A;  4WK8 F;  4EMS A;  1PDN C;  3CUQ A;  1P4X A;  3PFI A;  5CVR A;  3R4K A;  2DW4 A;  1ON1 A;  4Q5S F;  1ZN2 A;  1J59 A;  4I2O A;  3EYI A;  5ICF A;  3GXO A;  1FBU A;  4L5I A;  3GFI A;  1DUX C;  3BJO A;  1OR7 A;  4EJO A;  5BQT A;  1T38 A;  5JI6 A;  4XSX F;  3CUQ C;  4KMU X;  1KU2 A;  3KP4 A;  4IHT A;  1JE8 A;  1ZRE A;  5L3C A;  3I5U A;  4P5O A;  5HLI A;  2QYO A;  2PG4 A;  5BMZ A;  3ZPL A;  1B1B A;  1F1Z A;  2Q0O A;  2MLG A;  1VTN C;  2D45 A;  1SAX A;  3MWM A;  1QO0 D;  1XDU A;  3HOT A;  2XAS A;  2ESH A;  3QP5 A;  3FHZ A;  3EQL F;  4GYG A;  4EM2 A;  3L9F A;  1J5Y A;  5HDG A;  2PEX A;  1HW1 A;  4A6E A;  1ZAO A;  4HF2 A;  1IUY A;  1G6N A;  2GA2 A;  4LK0 F;  3DF8 A;  1YIO A;  1IN8 A;  3IC7 A;  5DD8 A;  3HTS B;  2YX7 A;  1T0F A;  4E70 A;  4GO1 A;  5D6E A;  3MZY A;  2UWM A;  5H20 A;  3IRQ A;  1G3W A;  5TRD A;  1IXR C;  1FT9 A;  4RB2 C;  2HDC A;  3IWF A;  2IVM A;  3ULQ B;  1W5T A;  3B73 A;  3J80 Z;  2BBY A;  2JPC A;  2STW A;  4M71 A;  1R1V A;  1O7L A;  2FNP A;  5DCF A;  2MBF A;  1KA8 A;  3R60 A;  5E8I A;  5HS7 A;  3WTT C;  2ISZ A;  1TTY A;  2XAH A;  4GXO A;  3FF5 A;  5DUI A;  2YSR A;  2IJL A;  5D8K B;  4GCV A;  1IN6 A;  2P5L C;  1B9M A;  4LB5 A;  3P7N A;  4PGG A;  3T0Y A;  2VXZ A;  2XAF A;  1QGP A;  2HKO A;  2DQL A;  1SFU A;  4FX4 A;  4RGR A;  4M9X A;  5L3E A;  3E97 A;  4ZYG A;  5E1X A;  3ML6 A;  2FXA A;  1CF7 A;  4IPA A;  4BHB A;  4G6Q A;  2XIG A;  1IN7 A;  2V6C A;  2AXL A;  1XSV A;  4U88 A;  4WXD A;  1U3E M;  2R7F A;  4QLC U;  3HIF A;  3SXY A;  4HV5 A;  2O8X A;  4L0Y B;  1O7F A;  5LLQ A;  2HEO A;  2WV0 A;  1L0O C;  3MAJ A;  1XMA A;  3WTX C;  4ENK A;  2X0L A;  1YS7 A;  4K2E A;  2ETH A;  1SFE A;  2EFP A;  2RC4 A;  1EH6 A;  1F9N A;  3DKW A;  3F22 A;  1P4W A;  3WTW C;  3QPT A;  1C0W A;  2VON A;  3KEQ A;  2MC3 A;  1U2W A;  5KVR A;  3NQO A;  2EV6 A;  4ESB A;  4GGG A;  4OMZ A;  3I64 A;  1WQ2 A;  4L18 B;  3ZMZ A;  1PP8 F;  4Q4Z F;  5LHI A;  4LD5 A;  3HOS A;  1XSX A;  1Y0U A;  1SD7 A;  1UFM A;  4BQA A;  3MQ0 A;  3Q5F A;  2HWV A;  3GWZ A;  3BJ6 A;  1YW8 A;  2Y48 A;  3ERE D;  3LQR A;  5HLG A;  4I7H A;  1HQC A;  1W5S A;  2FML A;  4IJA A;  3JAM Z;  5FD6 A;  3TOA A;  1Z05 A;  1FC3 A;  1BIA A;  2EA2 A;  4MEX F;  2MD5 A;  2VOD A;  1O57 A;  1XCV A;  4EQQ A;  1R00 A;  4D0P A;  4UVB A;  4PZJ A;  2DO7 A;  1HBX G;  1YLF A;  1LDJ A;  2M5W A;  4FHT A;  1YFH A;  4HX8 A;  4HF0 A;  5LBQ A;  4Q47 A;  5DEQ A;  4MQV A;  5FLX K;  4KFC A;  4IXA A;  2P7C B;  3T1B A;  4B8X A;  1SD5 A;  4IF4 A;  1RUN A;  1IRF A;  2V1U A;  5HS9 A;  2QBY B;  3BRO A;  4U0W A;  1Z91 A;  1H9G A;  4CGZ A;  2FBH A;  5E20 A;  2XGX A;  4G7Z F;  1DPU A;  4TV7 A;  1T98 A;  3GO5 A;  3DEU A;  5K1Y A;  3RPU A;  2LSO A;  1GVJ A;  4HYE A;  1FLI A;  2DTR A;  3M8F A;  2A6H F;  3GYH X;  2ZJ2 A;  2PQ8 A;  3F21 A;  3FMS A;  2K4B A;  1ZRC A;  1BIB A;  2FA5 A;  3IHU A;  1Q1H A;  3FX3 A;  2P4W A;  1FP1 D;  4G7H F;  1MJB A;  5FLX Z;  2G7H A;  4M9S A;  3JSO A;  4ZYH A;  1MD0 A;  4A0Z A;  2KKO A;  2FF4 A;  3LAJ A;  5FO5 A;  3TQN A;  2M87 A;  3SZT A;  4RGU A;  3WGI A;  2L54 A;  2QM3 A;  4O3M A;  1ZHF A;  3OOP A;  3E5Q A;  4EM1 A;  2P5V A;  3E6B A;  4MQ9 F;  2FRH A;  2M45 A;  4KN4 X;  4PGH A;  2BEO A;  2G7U A;  1J75 A;  1NHA A;  2F2E A;  1K6O A;  4UUV A;  1U5T B;  2ZFW A;  1IN5 A;  2XHK A;  4HQE A;  4CIC A;  2TDX A;  1DDN A;  3WTY C;  3GLX A;  3TO6 A;  2O0Y A;  4OMY A;  2J5O A;  4O5V A;  3J81 K;  4N9I A;  5HDK A;  4UV8 A;  1QPM A;  1YG2 A;  4CXF A;  3ISP A;  1RIO H;  1G3S A;  3RKY A;  2IRF G;  2VC0 A;  1P6R A;  2A6E F;  3RKX A;  2KJC A;  3KZY A;  4N0B A;  5F64 A;  5LGU A;  1STZ A;  4RB3 C;  3MFK A;  2F5D A;  2B0L A;  4L9T A;  1TQM A;  3KP3 A;  3CJN A;  3E6C C;  2YR2 A;  2DT5 A;  2CGP A;  1EH7 A;  5D6F A;  4AD9 A;  1ZG3 A;  4HBL A;  1FYM A;  2EV0 A;  4IRG A;  4BNC A;  2UZK A;  1B9N A;  2VE8 A;  3CO6 C;  3RIR A;  1LVA A;  3J81 Z;  3CUO A;  5ILV A;  1IZ1 A;  3DPL C;  3HSF A;  2GA1 A;  1SMY F;  1HKT A;  5HOO A;  5D5W B;  1ZGJ A;  3ZN1 A;  4FX0 A;  3N4M A;  3W6K B;  3D5L A;  5F6F A;  1YYV A;  1RZ4 A;  3I54 A;  1B4A A;  1YW7 A;  1K78 A;  1EV7 A;  1V3F A;  4AWX B;  4U0V A;  1T6S A;  4MTE A;  1MDM B;  4L5J A;  3LA2 A;  1JXS A;  1B59 A;  3V7C A;  3ELK A;  4M6Y A;  1XGS A;  3O2P E;  3C18 A;  1QZY A;  4ENN A;  3TKY A;  4YFX F;  1WSU A;  2HTJ A;  3I59 B;  5DCM A;  1SD4 A;  5EEH A;  2JTV A;  2NNN A;  2RKH A;  2Y75 A;  5CYV A;  3V7R A;  4M9Z A;  2HZT A;  2FBI A;  2XVC A;  2WWY A;  4Y15 A;  1FP2 A;  1JGS A;  1W7P A;  4WCG A;  1R1T A;  2KRF A;  4EGZ A;  3ZMV A;  1I1G A;  4AIJ A;  3L00 A;  1FSE A;  3R0J A;  2RQP A;  3TGN A;  5HLH A;  2XAQ A;  1QNT A;  2VBW A;  3QU3 A;  2PI0 A;  1IRG A;  2QLZ A;  4LFU A;  2VBZ A;  3D0S A;  2EFW A;  2MLK A;  1BI1 A;  1P4A A;  2GIV A;  1L3L A;  2QZ8 A;  1I1S A;  3LA7 A;  4AIK A;  1OKR A;  3G3Z A;  2MH2 A;  2H27 A;  3MEX A;  2PLY A;  2Z9O A;  2DK8 A;  2FNA A;  5J6X A;  4P96 A;  3WTZ A;  1E17 A;  3WTS C;  4A5N A;  2GAU A;  4BXU A;  1U78 A;  4RB1 A;  1F5T A;  5A2Q K;  5ICE A;  4G9Y A;  2JPB A;  3V8L A;  4HLX A;  5FFZ A;  2H6B A;  4RGX A;  1KGS A;  3U2R A;  4LLN A;  1MKM A;  1R5H A;  5ICG A;  4XLN F;  1FBQ A;  1T39 A;  4GYI A;  4LJZ F;  2IA0 A;  2PFB A;  3EYY A;  4Y17 A;  1YTY A;  1S7A A;  4JK1 X;  4ETS A;  2JSC A;  4LGW A;  4MNU A;  4CDG A;  3HHH A;  1ZRD A;  4CYD A;  3CTA A;  5ERI A;  4A5M A;  3JTH A;  2EJR A;  3K2Z A;  4BHC A;  3M1E A;  2PMU A;  3VB2 A;  3FM3 A;  5TJJ A;  1REP C;  2BE5 F;  3KEO A;  3R0A A;  1KU7 A;  3BWG A;  2ZBK A;  2IT0 A;  3BPX A;  2GXG A;  1I6X A;  6PAX A;  3RPQ A;  3LWF A;  2AS5 F;  3I71 A;  4NHJ A;  2UXN A;  2OZ6 A;  4RB0 A;  2CSO A;  4P9U A;  3F3X A;  3KFW X;  5L3F A;  3WE2 A;  3CUQ B;  5DDG A;  4MGR A;  2L01 A;  4EJW A;  5DD4 A;  3ABT A;  2JT1 A;  3NRV A;  3T8T A;  2F5E A;  3LAP A;  1BJA A;  3H3Z A;  3V8J A;  3QOP A;  5FFX A;  1FSH A;  1A04 A;  4CZZ A;  3F8N A;  2ZCW A;  2ZNZ A;  1Z6T A;  1BI0 A;  5E18 F;  2K4J A;  4UV9 A;  1QBJ A;  1K79 A;  4UXN A;  3T5X A;  4YFN F;  3DXJ F;  2FU4 A;  1S6L A;  4HW0 A;  3ZMD A;  5BOX A;  2ELH A;  1IXS B;  4L9N A;  4BAY A;  3P9C A;  3NEU A;  5LGN A;  2IW5 A;  1SD6 A;  1FX7 A;  4DNC A;  1PUE E;  4ENM A;  3RDI A;  1GXP A;  2H6C A;  4HV6 A;  3EUH A;  4OIP F;  3CLO A;  1ZAR A;  3O3K A;  2OAZ A;  4KIB A;  2EFO A;  3GZ6 A;  5BPI A;  3FMQ A;  1UCR A;  2M1B A;  5AIQ A;  3JTG A;  2YU3 A;  3IRR A;  3TDZ C;  3PQJ A;  1LJ9 A;  1D8J A;  5CVJ A;  4MHG A;  5JR3 A;  3QAH A;  4WXC A;  3WTU C;  3F8B A;  3LST A;  2KIF A;  4EGY A;  1R5G A;  1XCB A;  4AIH A;  2EV5 A;  1YO5 C;  3OV8 A;  5J8C A;  2XRN A;  1OYI A;  4XBF A;  1WKM A;  3MZH A;  4KUM A;  4EJU A;  2DFI A;  1H9T A;  1J2X A;  3Q9V A;  1TQP A;  3IL2 A;  3IWZ A;  4G8X A;  4EVI A;  2F5C A;  4S04 A;  2XKO A;  5JHU A;  4OIN F;  3JSP A;  1BOA A;  3K1M A;  1IW7 F;  1R23 A;  5IT9 K;  4DQ2 A;  1XMK A;  3BJA A;  1LQ1 A;  2EK5 A;  2OQG A;  1QZZ A;  4O6J A;  3GW2 A;  4BYY A;  3E6D A;  1FPQ A;  4ZYE A;  2QQ9 A;  1CF7 B;  2A3S A;  1ONV A;  4WF2 A;  2F5F A;  2O6G E;  3HTU A;  1BI3 A;  3GFL A;  1P92 A;  4MEY F;  2DK5 A;  3EDP A;  2XAJ A;  1ZG1 A;  2HGC A;  4U7D A;  1MZB A;  1HST A;  2HQN A;  4HDV A;  2QUF A;  3E5X A;  2RGV A;  2Z5U A;  2XAG A;  1TNS A;  4HOB A;  1OMI A;  2OU2 A;  4HF1 A;  2NRA C;  5D4R A;  1UHW A;  1XGO A;  1CGP A;  1R1U A;  1MJA A;  3R61 A;  4JBA A;  2A61 A;  2ZME A;  2MA3 A;  4YIF A;  5D5X B;  2WTE A;  1XD7 A;  1LB2 A;  1LDD A;  3GFM A;  1HKS A;  5HDN A;  3JW4 A;  3VFZ A;  2MH9 A;  2NYX A;  2KJB A;  3KZZ A;  4ENJ A;  5CVU A;  3QU6 A;  2R3S A;  2O3F A;  3F6O A;  1PP7 U;  3GFJ A;  2NAZ A;  3KP7 A;  2EWN A;  3TDU C;  2RDP A;  3LA3 A;  4HA8 A;  3WGH A;  1HW2 A;  5ED4 A;  3K69 A;  5KK1 A;  3ZMS A;  1R22 A;  1OYW A;  3EET A;  3FXR A;  2A69 F;  4CHU A;  2STT A;  3C3W A;  4A2U A;  3ZN0 A;  4HX7 A;  5DYM A;  4OOI A;  3SFZ A;  1FYL A;  4FT8 A;  2G9W A;  3J7A O;  3ROU A;  1S29 A;  2VT2 A;  2EFQ A;  2QVO A;  3E3V A;  4KIF A;  2QQA A;  3TO7 A;  1KQ0 A;  5K5R A;  3GX4 X;  3LQQ A;  4L0Z B;  4UVA A;  2A07 F;  2LKP A;  4OIQ F;  3DQV C;  1J0R A;  4EJT A;  5E17 F;  2L4M A;  3RKW A;  2W57 A;  1YW9 A;  2COM A;  2J5P A;  4KT5 C;  4F7Z A;  4LG0 A;  2XKP A;  3DP7 A;  4L9J A;  2XRO A;  1ZRF A;  2M30 A;  2L02 A;  3S2W A;  1OPC A;  2HOE A;  3P9K A;  4KA4 A;  1R7J A;  2E7X A;  3IKV A;  3HRS A;  1IF1 A;  4HDU A;  1XDS A;  4HQM A;  2RVC A;  1QQI A;  4G6D A;  2VT3 A;  3R6S A;  2ACJ A;  2FBK A;  3BPV A;  3LFK A;  3N97 A;  3FMR A;  2Z3Y A;  2V9V A;  4I01 A;  4MTD A;  1KU3 A;  2VOP A;  4LLL A;  1Z6R A;  1HKQ A;  5F1R A;  2OA4 A;  5LRS A;  3HRM A;  3K0L A;  3V7S A;  4M74 A;  3T8R A;  1ZYR F;  4KYW A;  4I0A A;  2Q8K A;  4ON0 A;  2VN2 A;  3K9T A;  2UXX A;  3FXQ A;  2IA2 A;  2HTS A;  3O6B B;  2OZU A;  2OD5 A;  3K1N A;  3ZQ7 A;  1RUO A;  2DPU A;  3WU1 B;  2M8E A;  2OQR A;  2PN6 A;  1D5V A;  2KIU A;  4P9F A;  3ZP5 A;  2HKX A;  3SHF A;  1ON2 A;  1RNL A;  3KLO A;  1ZLK A;  2ESN A;  3KP2 A;  2RV8 A;  1AOY A;  4XRF A;  5FGM A;  1U8R A;  1ZGA A;  5DV5 A;  4I09 A;  3H92 A;  3FM5 A;  3QRF F;  4Y13 A;  3F6V A;  3L7W A;  4QWQ A;  3M9A A;  4NQW A;  2FMY A;  4LG0 B;  4HX4 A;  1BI2 A;  1S8N A;  3BY6 A;  3M8E A;  4IHS A;  2V1X A;  3BDD A;  4U0Y A;  2K7L A;  1FBS A;  3VEP A;  1Z1D A;  3VOD A;  4RS8 A;  3PQK A;  2VE9 A;  5CJ9 A;  3VOE A;  3I4P A;  2DLL A;  2DPD A;  5ILU A;  4P55 A;  5LEK A;  3RTR A;  1HSJ A;  2VBY A;  5D8L B;  3HRU A;  1W7P D;  4UHT A;  3DFG A;  1AWC A;  3SZP A;  3HRT A;  4M6X A;  5CLS A;  1K78 B;  2FOK A;  5AON A;  2VBX A;  3SQN A;  3DV8 A;  2HYF A;  2HR3 A;  1MJ9 A;  3FXU A;  4R8H A;  1GHC A;  2P5K A;  3GUD A;  5K5O A;  2IP2 A;  3J80 K;  3C7J A;  1BC7 C;  2VOO A;  5DCM B;  3WTV C;  2DBB A;  4KIC A;  2E1N A;  4A12 A;  5ILS A;  1O3R A;  5JFR A;  2ISY A;  2RN7 A;  4IRH A;  5LEJ A;  2BGC A;  2CO5 A;  5A2Q Z;  5FB2 A;  1W7P B;  3GEZ A;  4M72 A;  3Q9S A;  4RAZ A;  1BN5 A;  3G73 A;  3FWE A;  3ABU A;  1X3U A;  2CG4 A;  3WG9 A;  2E7W A;  5D5V B;  4I0B A;  5H6Q A;  5HVQ C;  1JHH A;  2BYV E;  2YPR A;  4IRI A;  3KCC A;  3U9G A;  4UNO A;  4LMY A;  2Z99 A;  2P6S A;  1XN7 A;  3GF2 A;  2XUB A;  4M73 A;  3WOD F;  1G4D A;  1O3T A;  1W4M A;  3WGG A;  2QWW A;  2EFN A;  1G3T A;  1TLH B;  4NB5 A;  1JHF A;  1J7K A;  5AIP A;  4OIR F;  5E1W A;  4JQF A;  3GZ5 A;  4Q48 A;  4XSZ F;  3RYR A;  5JVT A;  1FNN A;  2ZO4 A;  3F8C A;  3RYP A;  1TQI A;  4LB6 B;  2P8T A;  1XGM A;  2O03 A;  2K27 A;  2LNB A;  2QBY A;  3TOB A;  2ADU A;  3QP6 A;  3KET A;  1GXQ A;  1UHM A;  3K1P A;  2LF7 A;  4ZZL A;  5J8F A;  1WWX A;  4ESF A;  2H94 A;  4KNY A;  4KN7 X;  1TNT A;  2OBP A;  1U6G A;  2DQR A;  2L4A A;  1ODD A;  4U7B A;  5HS8 A;  1FYK A;  4KDP A;  2K02 A;  3JAM K;  4A0X A;  1S3J A;  2QEN A;  1D8K A;  2CW0 F;  3ECH A;  3B02 A;  4G7O F;  5D5U B;  2L3D A;  2XV4 S;  1R36 A;  3W6J B;  4XLP F;  3KE2 A;  4OU0 A;  4B09 A;  1KU9 A;  1WRJ A;  1BC8 C;  1D3Y A;  4ZYD A;  1KQ8 A;  1SFX A;  4KMF A;  1DPR A;  4I98 B;  1T2K A;  2R7D A;  2LDU A;  5IT3 A;  2BV6 A;  1I27 A;  1RI7 A;  2IA1 A;  1SMT A;  4CO8 A;  2ZKZ A;  3KP6 A;  1LDK B;  4WWC A;  5CVV A;  3KP5 A;  4ZH4 F;  2GQQ A;  2V1D A;  1U5T A;  4PDK A;  2IPQ X;  4Z2Y A;  5LHG A;  4I02 A;  3ECO A;  3AAF A;  3L2C A;  4EJV A;  3CDH A;  4AVP A;  1Z7U A;  3HSR A;  2WC2 A;  5EEG A;  2HQR A;  2RNJ A;  4EV0 A;  5BS6 A;  3HHG A;  2Z33 A;  1XB4 A;  4BHP A;  1MGT A;  2C6Y A;  4HZF A;  1U5T C;  2JRT A;  2ZNY A;  1TW2 A;  2CWE A;  2DU9 A;  4LLG F;  3GVA A;  5L3B A;  4G94 A;  2H09 A;  5IT9 Z;  1KQ9 A;  1XGN A;  2NS0 A;  3WE3 A;  4ASN A;  2QQB A;  1J9I A;  3RJP A;  2GZW A;  1FOK A;  4N9H A;  2DI3 A;  1S7O A;  2P7V B;  2D1V A;  1F4K A;  4PCQ A;  1EH8 A;  1DP7 P;  4S05 A;  2GXB A;  3F8M A;  3IKT A;  4R1H A;  2Y0M A;  2DAO A;  3BOQ A;  2PMH A;  2O61 A;  5CVI A;  2FSW A;  2ZXJ A;  1USS A;  4IVN A;  4YII A;  1K7A A;  3M7G A;  3DPT A;  1UST A;  2W24 A;  1H0M A;  2D1H A;  2CYY A;  1YS6 A;  3ZMU A;  3KLN A;  2V79 A;  1MDM A;  4A0Y A;  4UVC A;  2JZY A;  1LEB A;  1E2X A;  5DUK A;  1ZG5 A;  2FEZ A;  2HFH A;  3HYI A;  3HUG A;  3I58 A;  1BBY A;  1XSD A;  1LNW A;  3I59 A;  5ICC A;  4YFK F;  3MCZ A;  3C1D A;  2EB7 A;  4HLY A;  1UB9 A;  4WX9 A;  5BPD A;  2CQK A;  3F72 A;  1FZP B;  1B6A A;  1TBX A;  2HYG D;  5E8G A;  3BP8 A;  2Q2E A;  4ZZD A;  1Z9C A;  2HS5 A;  3TO9 A;  1HXD A;  1WI9 A;  2FE3 A;  1IN4 A;  2PJP A;  1P2F A;  2FQ3 A;  5K5Q A;  5LGT A;  3REO A;  4R79 A;  2ZME B;  3I53 A;  3V8K A;  3COA C;  1IAW A;  3H3U A;  2A5Y B;  1LEA A;  4L9V A;  1O3S A;  1FWZ A;  4WXH A;  2E1C A;  1YQA A;  5D4S A;  2W85 A;  3QPH A;  5L3D A;  1TW3 A;  2W84 A;  1HW5 A;  4RGS A;  2YX4 A;  3F23 A;  1ULY A;  3V4G A;  3P9I A;  2VC1 A;  1IXC A;  4H0E A;  3L09 A;  3FZV A;  3E6M A;  2X4H A;  3BZ6 A;  1KYZ A;  5E1Z B;  3ZMT A;  3E5U A;  5H6R A;  1KYW A;  1ZLJ A;  3I0T A;  2KIM A;  4A6D A;  4KIG A;  5LRR A;  3CO7 C;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...