2MC3A

Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MUS81 endonuclease homolog (Yeast), isoform CRA_b
publication title A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes.
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mc3A00
2DI3A 3G73A 2P5KA 4ZYHA 5F6FA 1VTNC 5DEQA 4UVAA 4KMFA 5D4SA 3P7NA 1JXSA 4HLYA 4M74A 5J6XA 3QPTA 3P9CA 5LEJA 2V79A 2P6TA 3QRFF 4OINF 3IHUA 3K1MA 3EYYA 1XGNA 3MFKA 2FA5A 1Z6RA 4HQEA 1Z6TA 1IUYA 2IW5A 5L3EA 2EV0A 2RN7A 1I1SA 4HV6A 1MKMA 1FY7A 4WX9A 3KP3A 2G7UA 3GW2A 4I7HA 2ZXJA 1HW2A 3HRTA 4ENMA 3GEZA 2QVOA 1TLHB 3DV8A 4EM2A 1TQMA 1E17A 3KETA 5DCMB 4EMSA 3T5XA 3E97A 3L7WA 3HOTA 2HFHA 3BJOA 4BHCA 1Z05A 4A0YA 1QO0D 3GFMA 2DTRA 2GWRA 5K5RA 5JR3A 2RNJA 1IXSB 3C7JA 1KQ9A 1O3QA 1Z9CA 3TOBA 3TGNA 2VBYA 2W84A 5HDGA 2B0LA 3B73A 4KIFA 4TV7A 1U5TA 3IRQA 1XGMA 1R58A 1XGSA 3OOPA 5ICCA 5HLIA 2OU2A 3WTXC 1XSDA 3J80Z 1MGTA 1EH8A 1LNWA 1ZG3A 2ACJA 3KP2A 2XAJA 3GZ5A 5A2QZ 4AIJA 1QZZA 1MDMA 3LSTA 4UXNA 2QZ8A 3P9KA 1FWZA 3DF8A 2HKXA 1S7AA 3CUQC 3Q5FA 2C6YA 1RZ4A 3BWGA 3FWEA 2XIGA 4LLGF 5E20A 2HGCA 1MD0A 4CICA 1XD7A 2LSOA 2QUFA 2F5FA 2VXZA 3WG9A 4L9JA 4EVIA 1YLFA 1G3YA 3T0YA 2RKHA 4NQWA 1FBQA 3K1PA 5BOXA 1FP1D 1U6GA 2ZMEA 2XROA 2M45A 4I09A 4LB5A 4LGWA 5BPIA 2DFIA 2LKPA 5D4RA 2BV6A 3JSPA 1R1TA 3I4PA 1IRGA 3K2ZA 1H9GA 3ZMVA 1HW5A 4BHBA 2DBBA 1KYZA 2O8XA 4AIHA 3GZ6A 1SD4A 1ZRCA 4GO1A 2ETHA 4KUMA 1RNLA 1S7OA 3GYHX 4HDVA 3R61A 3CJNA 5BS6A 4WF2A 5F1RA 5F64A 4Y17A 3IKTA 3IRRA 4RB1A 2VBZA 4ZH4F 1OYWA 5FD5A 1IN5A 1SFEA 3C18A 4KT5C 2OAZA 5BPDA 3GFLA 2VOOA 3QP6A 4RGRA 2P6SA 1UHWA 5LGUA 5J8CA 4LG0B 1WSUA 2E1NA 4ZYEA 1U3EM 1RUOA 3BJ6A 5L3BA 5ILUA 1KU3A 5DUIA 2PJPA 2KIFA 4EJTA 3T8TA 4OIOF 4WXCA 4CO8A 4AIKA 3RTRA 1B6AA 1KU2A 1O57A 1AOYA 4U7DA 2EV5A 1MDMB 3FHZA 3DQVC 1SD7A 3U1DA 1X3UA 1B1BA 4ESBA 5LLQA 2IT0A 5E18F 2TDXA 4K2EA 2DO7A 3CLOA 1YFHA 4LMYA 2HYFA 4HA8A 3SZTA 2RDPA 4JQFA 1UFMA 1B9MA 4O5VA 4ZZLA 1F4KA 2XASA 3SXYA 2HZTA 2HTJA 2O03A 3WODF 4KICA 2MLKA 2HS5A 3OV8A 2K27A 4H0EA 2JPBA 2QWWA 3QPHA 1V4RA 2UZKA 2M30A 3GF2A 1XMKA 2FMLA 1SFXA 4RAZA 4M9XA 1UHMA 1D8JA 3C1DA 1DPRA 4BYYA 2E7XA 1H9TA 2G9WA 3QU6A 5DD4A 3ULQB 5IT9K 4IHSA 4KYWA 2KIMA 5ED4A 1J59A 5CVUA 2EB7A 2HWVA 4CZZA 2W85A 3WTWC 5JVTA 2PMHA 1ZREA 2HQNA 2A3SA 2HYGD 2QQ9A 2P8TA 2VE9A 3ERED 5LRSA 2FNAA 4HLXA 4HW0A 2Y48A 2DT5A 4L5JA 3F8BA 3GO5A 4UUVA 2OZUA 5J8FA 4MQVA 2L54A 1STZA 3IC7A 3C3WA 2HEOA 2D1VA 1BJAA 1XCBA 4QLCU 1OR7A 3PQKA 1ZARA 4GGGA 5TRDA 3NEUA 2L3DA 2FSWA 3TDZC 5K5OA 3H3UA 3M7GA 1IXCA 4S05A 4LFUA 3BP8A 2OQGA 2PBIA 2IA2A 1Q1HA 3DP7A 1G6NA 1RUNA 2ADUA 4BQAA 3TDUC 4KDPA 4HX7A 1PP8F 1IRFA 3FMSA 2EJRA 4IRGA 3FM5A 1R5HA 1RIOH 5ILSA 1FYKA 2EFOA 1R1VA 2JRTA 5CVRA 1BN5A 1O3TA 2KJBA 1QQIA 1JE8A 2K4JA 4LLLA 3BDDA 4EM1A 3RI4A 1J9IA 3M1EA 4HZFA 3DPLC 3FXUA 2GAUA 4PCQA 3EETA 4I0AA 5HVQC 2H27A 2D1HA 3PQJA 3SHFA 3TOAA 2X0LA 5AONA 1KYWA 4LK0F 4LK1F 4I98B 4MQ9F 1S8NA 1T38A 3I64A 2WV0A 2DW4A 2D45A 3HSFA 4ZYGA 3FZVA 2VBXA 1XDUA 1ULYA 4B8XA 5D5XB 3RIRA 3N97A 1EH6A 5HLHA 3LQQA 1P6RA 3WU1B 4NB5A 2HKOA 1KU7A 3WE2A 3R0AA 3RKYA 1FT9A 4MEYF 5H6RA 2PMUA 1YW8A 1OPCA 2DK5A 2RGVA 1BOAA 2VT2A 2MC3A 2FF4A 4IHTA 3EYIA 3CO6C 2RVCA 4OIQF 2CYYA 3BOQA 3V8JA 2JT1A 1XMAA 4FT8A 1BC8C 2UXXA 4M73A 4PDKA 3TO9A 1TQIA 3KP4A 3F6OA 1Z1DA 2K86A 4KA4A 1DDNA 2OD5A 4U0YA 1YW7A 2D2WA 3HTUA 2MBFA 1ZRDA 1ZGAA 4NHJA 2BYVE 3TKYA 5FLXZ 1LJ9A 1W4MA 1F1ZA 3KP5A 2K02A 3IWFA 1PP7U 3VEPA 3FF5A 1ZG1A 2JSCA 1ODDA 3P9IA 3L09A 2DPDA 2IPQX 4I02A 2FNPA 3RYRA 2G7HA 4L9NA 1BI3A 3K9TA 5DD8A 2L4AA 3V7RA 3NQOA 4ENKA 2ISYA 3F23A 4N9HA 2VC0A 4BNCA 2NRAC 2V1UA 1HKQA 1QNTA 1XSXA 2ELHA 4CXFA 3F8FA 2P4WA 2EA2A 3O3KA 1YO5C 2IJLA 1RI7A 3FXQA 3E6CC 3ZP5A 1D8KA 2UXNA 5E8IA 3GXOA 4CGZA 4EQQA 2Z9OA 4LG0A 5LHHA 3BY6A 3Q9VA 3KP7A 2FBHA 4S04A 1SD5A 2NNYA 3WTUC 1HSJA 5LRRA 3CO7C 4LB6B 1CF7B 3FXRA 3MZYA 3V7SA 3J81K 3T1BA 3NRVA 1P2FA 2IA1A 3BZ6A 2YPRA 4OOIA 4YFNF 1BC7C 1ON2A 2M87A 2CO5A 5FFXA 2FE3A 2HDCA 2KIUA 3KZZA 2FRHA 4GYIA 4HOBA 4Q47A 2Z3YA 5BQTA 4ENNA 2PI0A 2OA4A 5LHIA 4U0VA 4IF4A 4R1HA 4RB2C 3F22A 1T0FA 3ELKA 2EFQA 1OKRA 4LLNA 1XCVA 4OIPF 3MQ0A 2P7VB 3I0TA 1J75A 1Y0UA 3G3ZA 5D5VB 1G3WA 5JFRA 2P5LC 3HRUA 3HRMA 2GXGA 3F3XA 2Z33A 2MD5A 2HOEA 1LVAA 3ECHA 4XSXF 1K6OA 1R22A 5ERIA 3PFIA 4P9UA 2F5DA 3LWFA 3MCZA 1FX7A 3MZHA 3WE3A 4IRIA 1LDDA 1ZGJA 1MJAA 4PGHA 2FU4A 1HQCA 3HHHA 4ON0A 2HTSA 4WK8F 3SZPA 3WGIA 4P5OA 3FX3A 2L01A 4JBAA 4HF2A 1LDKB 4ESFA 2VT3A 5EEGA 3HIFA 4KIGA 1BM9A 3L00A 3QU3A 3M9AA 2YSRA 2Q0OA 3RYPA 4ZZDA 4IPAA 2XUBA 5CVJA 5CYVA 2PN6A 3HHGA 1YS7A 4EJWA 2GIVA 1ZHFA 1SD6A 2ESNA 2AXLA 4XBFA 1KQ8A 4HX8A 1MJBA 2A6HF 4AWXB 1KQ0A 1QGPA 5H6QA 1P4WA 1R36A 3F8MA 5LEKA 1REPC 1LEBA 3HSRA 4A2UA 2EFNA 1TQPA 4RGUA 4UHTA 2VOPA 1D5VA 3EDPA 2KRFA 4G6DA 2PLYA 1XGOA 1BIBA 5TJJA 1K78A 4G6QA 4MGRA 4BXUA 2NS0A 4EV0A 2LF7A 3K1NA 4OMZA 3E5UA 4RAYA 5DCFA 2QYOA 4A5NA 3KCCA 4MEXF 1IN4A 1AWCA 4HDUA 2V1XA 2NAZA 2FXAA 2LF8A 2PFBA 5K5QA 1R7JA 4HBLA 4HF1A 2K7LA 4BH9A 2CWEA 2XKOA 4FHTA 2OZ6A 3GFIA 3LAPA 2GQQA 3ISPA 3SQNA 1YYVA 4KN7X 1HXDA 3N4MA 3JAMK 3CTAA 6PAXA 1TTYA 1QZYA 4MTEA 2XGXA 3I54A 4KN4X 1SMTA 3ZMDA 2BGCA 1MJ9A 1FBSA 2BBYA 2O3FA 2RQPA 1JHHA 3E6MA 2Q2EA 2IP2A 3MWMA 3Q9SA 3R4KA 3DEUA 5IT3A 2DLLA 4HX4A 1U78A 1SMYF 1ONVA 1C0WA 4KMUX 1YQAA 4KFCA 3H92A 3IWZA 2DQLA 1S3JA 2A68F 2YX7A 5HDNA 1U5TC 1L3LA 1FYLA 3HTSB 1QPMA 4HAMA 3BPVA 1YS6A 1YIOA 1B4AA 1HKSA 2EV6A 2O61A 4O3MA 2A5YB 3I58A 1DP7P 1BBYA 4M72A 3CUQA 3GLXA 1P4XA 2L4MA 1G4DA 4LD5A 4WXDA 1ZRFA 3WU0A 2H09A 3ZPLA 2XKPA 1K78B 1FSHA 1LQ1A 3BROA 2DPUA 1K79A 1FC3A 2GA2A 1J5YA 5L3DA 4Z2YA 1ZAOA 1TW3A 2R3SA 3EQLF 1EV7A 3R60A 2O6GE 1P4AA 3M8FA 1QBJA 2V9VA 4XSZF 4Q4ZF 2XRNA 1ZLKA 1USTA 3S2WA 4UV9A 3LA3A 2KJCA 2XAGA 2WC2A 3TQNA 5E17F 5DDGA 4A0ZA 5L3CA 2W25A 4Y13A 5ILVA 2XV4S 3RJPA 1TBXA 3DXJF 3I5UA 4G9YA 3ZMZA 2DK8A 1U2WA 3K0LA 3R0JA 3ZMTA 4EM0B 4OIRF 3V7CA 5HOOA 3J80K 2FBIA 2MLGA 4MNUA 3E5QA 5D5UB 4L9VA 2WWYA 5A2QK 1I5ZA 1CF7A 4HV5A 5ICEA 2GXBA 3MAJA 4WXHA 4CYDA 4QWQA 4IRHA 2NNNA 2VONA 1FNNA 2Y75A 5IT9Z 1HBXG 2YX4A 5L3GA 2DQRA 2FBKA 1S29A 4EJOA 4PZJA 5D6FA 2KKOA 4R79A 1L0OC 5FFZA 2X4HA 4RGSA 1KU9A 5AIPA 3F72A 3FM3A 2OQRA 4I01A 1FZPB 1WQ2A 3E6BA 3WGHA 3MEXA 4EGYA 1UCRA 1WWXA 2XAFA 3D0SA 4RS8A 5BMZA 1O7FA 5E1ZB 3SFZA 4ESJA 3CUQB 2K4BA 1IN8A 5KK1A 1F5TA 1J0RA 1T98A 2GA1A 3U2RA 4BHPA 1Z7UA 4ENJA 4XLPF 3RDIA 1FOKA 5D8KB 2M5WA 4G8XA 2F5EA 1W5SA 1ZN2A 3DKWA 3RPUA 2F2EA 5LBQA 5ICFA 2DU9A 4AD9A 4CDGA 2A6EF 4M9SA 3JTGA 4D0PA 2ZJ2A 3ABTA 1HSTA 1H0MA 4L5IA 2PG4A 3BPXA 2F5CA 1IN7A 1YTYA 3RKXA 3V8KA 1YW9A 1KGSA 1I27A 4U7BA 3E3VA 1KA8A 3F8NA 2BEOA 3GUDA 2FOKA 2EFPA 1HKTA 3HOSA 3HRSA 4GXOA 2A07F 5CJ9A 2ZO4A 4L0YB 3LAJA 2CFXA 1WKMA 1T2KA 2JZYA 4A5MA 1FYMA 2XAHA 5E1XA 2R7DA 4HQMA 4B09A 4YFKF 4XLNF 5H20A 3HYIA 4YG2F 2VN2A 2CG4A 2QLZA 2W24A 3WTVC 4YIIA 3D5LA 4GCVA 4L0ZB 1T6SA 3W6KB 1ZG5A 4I2OA 3KEOA 3AAFA 1U8RA 5FGMA 2ZFWA 5LHGA 4L9TA 2CW0F 1FP2A 3LA2A 3KLOA 1Z91A 1R1UA 3JW4A 2COMA 3VOEA 4RGXA 2R7FA 2JTVA 3I59A 4AVPA 4BAYA 2VBWA 3V4GA 2HR3A 1B9NA 1YG2A 2RC4A 1FSEA 4YFXF 2E1CA 2STWA 3WTZA 1TW2A 3O2PE 3IKVA 5LGTA 3T8RA 3KZYA 4KNYA 1BI1A 5HLGA 3GFJA 4G7HF 4M9ZA 2STTA 1SFUA 1WI9A 1B59A 5E8GA 5DV5A 1F9NA 2MA3A 1OYIA 4DNCA 4A0XA 2LDUA 4HYEA 3W6JB 4DQ2A 2O0YA 1T39A 2H94A 3FMRA 4UV8A 4RB3C 4UVCA 3WGGA 1DUXC 1E2XA 3H3ZA 1W7PD 2FMYA 1GXPA 5DUKA 4WWCA 2J5PA 5DYMA 2EK5A 3J7AO 1IN6A 1MZBA 4WCGA 3M8EA 1USSA 4G94A 3DPTA 1I1GA 1W5TA 4UVBA 2VE8A 2M1BA 1GVJA 1O3RA 3DFGA 1R00A 2FEZA 2EWNA 4IJAA 3L9FA 3KP6A 2W57A 1U5TB 3RPQA 1JHFA 2LNBA 1P92A 2CGPA 1A04A 4Q48A 1I6XA 3V8LA 2AS5F 3JTHA 2VODA 5HS9A 1V3FA 3B02A 1G3SA 1IXRC 3J81Z 3CDHA 2V6CA 2QQAA 4U88A 3ZN0A 2P5VA 3VODA 3KE2A 2XVCA 4FX4A 3LQRA 4GYGA 3F21A 2Z99A 4CHUA 2MH9A 3I59B 3F8CA 3ZMSA 2XHKA 3I71A 3ZQ7A 1WRJA 5EEHA 4I0BA 4ASNA 2ZMEB 4EJUA 3I53A 4XRFA 4Y15A 1LEAA 3ECOA 1W7PA 1O7LA 4JK1X 1XB4A 4U0WA 5FO5A 1ZH5A 3GX4X 2IRFG 2VC1A 1ON1A 1HW1A 1G3TA 3E6DA 2NYXA 1XSVA 4F7ZA 1PDNC 5KVRA 2GZWA 1BI0A 2WTEA 1R5GA 2CSOA 2YU3A 1CGPA 2QBYA 5CVVA 1O3SA 1NHAA 2ZBKA 5HS7A 3VFZA 2A69F 5D5WB 2ZNYA 2ESHA 2OBPA 3ZMUA 3KLNA 3CUOA 1TNTA 2P7CB 2A61A 2QQBA 1S6LA 4P9FA 1LB2A 5AIQA 1UB9A 3F6VA 2IVMA 2ZCWA 3QAHA 5CVIA 3COAC 3WTSC 3TO6A 5FLXK 1J2XA 3IL2A 3KEQA 4Q5SF 2H6BA 4UNOA 2Y0MA 5JI6A 4IXAA 5ICGA 2DAOA 1IZ1A 3QP5A 5FB2A 3FMQA 1SAXA 3E5XA 3TO7A 3WTYC 1EH7A 1ZLJA 4O6JA 3O6BB 4EJVA 4R8HA 3QOPA 1FLIA 3GVAA 3ABUA 2RV8A 1LDJA 1J7KA 2XAQA 4KIBA 4M71A 1FBUA 4HF0A 4L18B 4E70A 1IW7F 1XDSA 2EA4A 3GWZA 1D3YA 4LJZF 2ZNZA 4EGZA 1GXQA 1PUEE 4MHGA 3KFWX 2YR2A 4PGGA 4RB0A 4A6EA 2UWMA 3LA7A 5HDKA 5K1YA 3R6SA 4MTDA 2EFWA 1XN7A 1OMIA 2H6CA 1BIAA 3ZN1A 2E7WA 3RKWA 1K7AA 2FQ3A 1W7PB 4ZYDA 2HQRA 3WTTC 1TNSA 2PEXA 3K69A 2Q8KA 1IAWA 4A12A 3ROUA 1OYYA 5DCMA 2QM3A 5JHUA 4G7OF 1GHCA 1R23A 2L02A 1IF1A 2QBYB 1FPQA 5E1WA 4M6YA 5L3FA 2V1DA 2IA0A 2BE5F 2CQKA 3LFKA 4P55A 2PQ8A 2ISZA 4M6XA 3EUHA 4A6DA 1DPUA 4FX0A 1ZYRF 3L2CA 4G7ZF 3ML6A 3U9GA 4N0BA 2J5OA 3JAMZ 3HUGA 1JGSA 5FD6A 3BJAA 3JSOA 4N9IA 2MH2A 4OU0A 3REOA 5CLSA 4P96A 5HS8A 5D8LB 5LGNA 2M8EA 4YIFA 2ZKZA 5D6EA 4ETSA 2QENA 2Z5UA 2JPCA 3VB2A 3HSEA 4IVNA 4OMYA 1BI2A
chains in the Genus database with same CATH superfamily
2HDDA 5DM6F 2DI3A 3G73A 2P5KA 1LE8A 2YUSA 4ZYHA 2CV1A 2LK2A 5F6FA 1Y6IA 3FHNA 4F91B 4BEHA 1VTNC 3S15J 5KAFC 5DEQA 3MKWB 2HOTA 4UVAA 4KMFA 3IUOA 5D4SA 5CQEA 2FUG2 5KNLA 3P7NA 4D5FA 1JXSA 4HLYA 4M74A 5J6XA 3QPTA 3CJRB 3P9CA 2VJIA 1G8XA 5CPRB 3GMEA 3K4NA 4JP0A 4CYCA 2L9NA 5LEJA 1G59A 3LMMA 2V79A 4YEJA 2P6TA 3QRFF 4OINF 3D5RC 3IHUA 3OYHA 3B6CA 3VYSB 2VUMJ 3K1MA 3EYYA 3A02A 1XGNA 3TP0A 3MFKA 1SFKA 2GBYA 4I6ZA 2JJ7A 2FA5A 1Z6RA 4G6TB 1VQ4I 4HQEA 4NBQA 2L9VA 1V5EA 4RM2A 1M1EB 1Z6TA 1IUYA 2JWTA 2IW5A 5L3EA 2EV0A 4OMYA 2RN7A 1RR8C 1I1SA 2QKLB 4HV6A 1YOVB 2LY2A 3BG5A 3SDBA 1MKMA 4ANJA 1FY7A 4WX9A 3KP3A 1JT6A 2G7UA 2CQ7A 3E7LA 3CCSI 3GW2A 2E5NA 4I7HA 3WU2C 2ZXJA 5M3MJ 1HW2A 1TZLA 2L7MP 3HRTA 4ENMA 1AHDP 5GTIC 5GPCA 3GEZA 4UUSA 2QVOA 1TLHB 2LP0A 1SFOJ 3DV8A 1TWGJ 2AQFA 4RAFA 2BHZA 4EM2A 1TQMA 2CMPA 4IOAF 1E17A 3KETA 1X1BA 5DCMB 1ETYA 3TEDA 4DW6A 4EMSA 3T5XA 4BQNA 3E97A 4AC0A 3MD2A 3L7WA 3HOTA 2HFHA 3BJOA 4BHCA 2DDAA 1Z05A 4A0YA 1QO0D 3GFMA 2JN6A 4DYRA 2DTRA 2F4MB 2GWRA 5F0HA 2VASA 2W1OA 3AL0B 5K5RA 5JR3A 2RNJA 1IXSB 3C7JA 1KQ9A 3CMMA 4DOZA 4E7HA 1AU7A 4XLFA 1O3QA 4MFEA 3AG1H 1Z9CA 3VSKA 3TOBA 3PO2J 4BDZA 3TGNA 2L7KA 2LH9A 2VBYA 2W84A 5HDGA 1D0ZA 2B0LA 1AKHA 3CMEI 3B73A 1Z77A 4KIFA 4TV7A 2V6EA 1U5TA 4GDFA 2DJIA 4BBRJ 3IRQA 1XGMA 1R58A 3HUGB 1XGSA 3OOPA 5ICCA 5HLIA 2OU2A 3QYBA 3WTXC 3I55I 2VLAA 2F4OB 3J80Z 4DGWB 1XSDA 1MGTA 1EH8A 1LNWA 1ZG3A 3DU5A 2X48A 2OPTA 2ACJA 3KP2A 2XAJA 3GZ5A 5A2QZ 4AIJA 1QZZA 4I76A 2M34A 3LSTA 4UXNA 1MDMA 1HOMA 2CQXA 2QZ8A 3P9KA 4OWRB 1FWZA 3DF8A 2HKXA 5FKOA 1S7AA 3CUQC 3ZQGA 3Q5FA 2C6YA 1RZ4A 3BWGA 3FWEA 2XIGA 3DKXA 4LLGF 2HGCA 1MD0A 5E20A 4CICA 1XD7A 2LSOA 2QUFA 2F5FA 3G4SI 2VXZA 3OMYA 3WG9A 4L9JA 4EVIA 3HGYA 4ITVA 1YLFA 1G3YA 1FOWA 3T0YA 2CW8A 1LE8B 2E1OA 3S14J 3CCUI 2RKHA 4XONA 4BEHB 4NQWA 1FBQA 3K1PA 5BOXA 1FP1D 1U6GA 2WBMA 1W1WE 2ZMEA 2XROA 2M45A 3HXLA 4AYBA 4I09A 4LB5A 2NVQJ 4LGWA 4N4NB 5BPIA 2MYSA 4XK4A 1O4XA 2DFIA 4KISA 3H3VK 2LKPA 4OAYA 4BACA 3G71I 5D4RA 2BV6A 3JSPA 1R1TA 3I4PA 4MIMA 3CCLI 1IRGA 2IXSA 3K2ZA 1H9GA 4CYCB 3ZMVA 1MH4A 1HW5A 1Y8QB 2HOAA 1XPXA 5LD2C 4BHBA 2DBBA 4NDLA 4IO9F 1WFXA 3BCAA 2ECCA 4L5EA 1MBKA 1KYZA 2VPLA 2CUEA 4AYBN 2O8XA 2GLOA 4AIHA 3JRCA 3GZ6A 1QHHD 1VQPI 4FCYA 1SD4A 4C3IJ 2HYJA 3K4MA 4IZZA 3NWSA 1ZRCA 2IS1A 3F9KA 3GTMJ 3M4OJ 4GO1A 4AVZA 2ETHA 4QTRA 4KUMA 1RNLA 2VJ4A 3S1MJ 3VWBA 4IQJA 1S7OA 1AA7A 5KCMA 3GYHX 4HDVA 2DXIA 3GTGJ 3R61A 3CJNA 5BS6A 1Z21A 3MN2A 1LFBA 1MMGA 4KT6A 4WF2A 4UUSB 2O9LA 2XF6A 5DS9A 5F1RA 5F64A 2ZJQF 4A3KJ 1FEXA 4Y17A 4IHWA 3CD6I 5IYDJ 3IKTA 4PJMA 2ME6A 3IRRA 2W4SA 3JRHA 4RB1A 2XDVA 3HL2A 4ABZA 2VBZA 4ZH4F 1OYWA 5F0CA 1S72I 3OY9A 3WHBA 4FQGA 5FD5A 1IN5A 1SFEA 3MMYB 3C18A 4KT5C 2OAZA 1IGNA 5BPDA 3GFLA 2VOOA 3QP6A 2VPRA 4RGRA 5JLXA 2P6SA 1UHWA 3C2BA 4M3GA 5LGUA 3RZOJ 5J8CA 4LG0B 2NOGA 2KMUA 1WSUA 2E1NA 4ZYEA 3U21A 2CH0A 1Y8RB 3W6VA 1U3EM 2L9RA 1A31A 1WH7A 3A0BC 1RUOA 5HNHA 1FTTA 3BJ6A 3KYCB 5L3BA 1Y0NA 5ILUA 1KU3A 4XORA 1W5CC 3UKGA 4FASD 1A35A 5DUIA 1XX5A 2I10A 1AKHB 4C3JJ 2LR8A 4JX6A 2PJPA 2KIFA 3OYBA 1YRNB 4BQOA 4EJTA 2IGMA 3T8TA 4OIOF 5F08A 4WXCA 4CO8A 1Z67A 3O8HA 4AIKA 3RTRA 1B6AA 1KU2A 1O57A 1Q1VA 3GTJJ 1AOYA 4U7DA 4A3FJ 2EV5A 1MDMB 3FHZA 3DQVC 1N78A 2DN0A 1SD7A 3U1DA 4XNFA 3K4JA 1X3UA 1B1BA 2LRDA 4ESBA 5LLQA 2R0QC 2IT0A 2EH3A 5E18F 5HODA 2TDXA 3CCYA 4K2EA 2PJRB 2DO7A 3CLOA 4XRSG 1YFHA 2CV2A 4LMYA 2HYFA 4HA8A 3LOCA 3SZTA 4P1WA 2KISA 2RDPA 1T56A 4JQFA 1UFMA 3OWTA 1B9MA 3W2WA 3CMYA 4O5VA 2IS4A 1JKPC 2NS7A 3DEEA 5EZHA 5FLVA 2EZKA 4ZZLA 2XASA 4NQWB 4C3HJ 3SXYA 1F4KA 3FKIJ 4RA2A 2HZTA 2HTJA 3M07A 2O03A 3WODF 4KICA 1FJLA 2MLKA 2HS5A 3OV8A 2K27A 4A3DJ 2LMDA 1YX5A 4H0EA 3HKZN 2JPBA 2QWWA 3QPHA 2L9SA 1V4RA 2UZKA 5EG0A 2R7VA 3HOXJ 2M30A 3GF2A 1XMKA 1ZKGA 1SFXA 2FMLA 3A4CA 4RAZA 1X3ZB 1K4TA 4M9XA 1UHMA 1D8JA 2KHMA 3C1DA 3S1RJ 1DPRA 1TC3C 3IH2A 4BYYA 2E7XA 1H9TA 4FISA 2G9WA 3QU6A 5DD4A 3ULQB 3LSKA 5IT9K 4IHSA 4XMYA 4KYWA 2KIMA 2LBFA 2HVQA 5ED4A 4XRMA 3HEFA 3PFYA 1J59A 2B63J 1HLVA 5CVUA 1UJ8A 3AKZA 2EB7A 2JVGA 2HWVA 2QCOA 1ETKA 1SAUA 1QVUA 2W85A 4CZZA 3V42A 3WTWC 2GOMA 1VQKI 3ZR8X 5JVTA 2Z1DA 3FXJA 2HU9A 2PMHA 1ZREA 3H9QA 1NH3A 2HQNA 1MIJA 2A3SA 2HYGD 4W97A 2QQ9A 2P8TA 3LSIA 4XM3A 2DA4A 1Z3YA 2VE9A 4BXFA 3ERED 1NG7A 2O7OA 5LRSA 2FNAA 4HLXA 3IP4B 4HW0A 1S9HA 1VQOI 2LFBA 2Y48A 2DT5A 4L5JA 4ZJZA 3F8BA 3GO5A 3ZOBA 2H1KA 4UUVA 2OZUA 1EKEA 5J8FA 4MQVA 2L54A 1STZA 3IC7A 3C3WA 2XPVA 2D1VA 5KAIC 1WCMJ 2HEOA 1BJAA 1ETXA 1XCBA 1DP3A 3K6GA 2HQAA 4QLCU 1OR7A 3PQKA 1ZARA 2CFOA 4CCMA 2DMPA 4GGGA 3HPGA 1X1DA 1HDDC 5TRDA 3NEUA 2E19A 5E3OA 2VJJA 2L3DA 5J1YA 2F5VA 2FSWA 2X1DA 3AG2H 1T33A 2BHYA 3TDZC 5K5OA 3H3UA 3M7GA 3RSNA 1IXCA 4S05A 2CU7A 4LFUA 3BP8A 2OQGA 2CV0A 2CUZA 2PBIA 3HOWJ 2ZB9A 2RAEA 2IA2A 1Y39A 1Q1HA 3DP7A 1G6NA 5C4JJ 1RUNA 3BTJA 5JHFA 4IX7A 2XAUA 2ADUA 5FKLA 4BQAA 3TDUC 4KDPA 4HX7A 1PP8F 1IRFA 3FMSA 2EJRA 5B1BH 4IRGA 3FM5A 2HXOA 4E4HA 1R5HA 5IY5H 1OFCX 1RIOH 4M6VA 5ILSA 1FYKA 2R7TA 3M1CA 2EFOA 1X58A 1R1VA 1IDYA 4BUPA 2A6TA 3W2AA 1TWFJ 2JRTA 2KZVA 5CVRA 5TGTA 1BN5A 1O3TA 2KJBA 4ZDPA 2RREA 1QQIA 2KZGA 1JE8A 3ZQIA 5IP6A 2K4JA 4LLLA 2CS3A 3BDDA 4A69C 3L2RA 5FKNA 3MVPA 2IS2A 4EM1A 3RI4A 1J9IA 1SVLA 1MBGA 3M1EA 3QPSA 4HZFA 3DPLC 3FXUA 5TISC 3Q3SA 4A3MJ 1NTCA 2WAFA 2GAUA 1T95A 4PCQA 3EETA 4I0AA 5HVQC 3DTKA 5EG0B 2H27A 2D1HA 2R5YB 3PQJA 3SHFA 3TOAA 3HM5A 2OUMA 2X0LA 5AONA 1KYWA 2LY9A 2TRTA 2PMZA 4LK0F 2MFZA 4LK1F 4I98B 4J00A 3IAS2 2R7XA 2LC2A 4MQ9F 5EDNA 2XC7A 1BW5A 1S8NA 1T38A 3I64A 2WV0A 2DW4A 2K9SA 4QSHA 5J1UA 3OS0A 2D45A 2KRHA 2LBFB 1BJZA 1IO2A 3HSFA 4ZYGA 2JA8J 4BE1A 2ZC2A 3FZVA 2VBXA 1XDUA 2JK3A 3OR1C 1ULYA 2X6WA 2MABA 4B8XA 1FIAA 5D5XB 3RIRA 3VYRB 2PMZN 3N97A 2EPFA 1EH6A 1MSFC 2W48A 3RPUD 1ITYA 5HLHA 1VQLI 3LQQA 2E1MC 5IP9J 1P6RA 3WU1B 1JJ8C 2LLKA 2JMWA 4NB5A 2HKOA 1VF9A 2DA3A 5K7HA 1HF0A 3BTIA 3WE2A 1KU7A 3M3YJ 3R0AA 3RKYA 5H2FC 2XGEA 1JUSA 5IYBJ 3BR2A 4A3BJ 1FT9A 3CJQB 4MEYF 2OCCH 4E6KG 3L2VA 5H6RA 3J7YJ 2QEXI 5B66C 1ETQA 2PMUA 1YW8A 1OPCA 4BDYA 3CZ6A 2HVRA 3TW7A 2DK5A 2XPUA 2ZSIB 2RGVA 1BOAA 2VT2A 2Y9ZA 2MC3A 2FF4A 3ZQQA 4IHTA 3EYIA 3CO6C 1ETWA 4BE0A 2RVCA 2E2JJ 1BOBA 4B43A 3CC2I 2CYYA 4OIQF 2DMTA 3BOQA 1D1BA 2JQ7A 2LREA 3V8JA 5F1JA 2JT1A 2RNGA 4HNTA 1XMAA 4FT8A 4XIDA 2JUGA 3CDIA 3H36A 4LG3A 3OYIA 1BC8C 1QA6A 2UXXA 3AG4H 4FTHA 2VKEA 4M73A 2Z2SB 3EUKL 4PDKA 3TO9A 1TQIA 3KP4A 1LVKA 3F6OA 1Z1DA 2K86A 4KA4A 1Y1VJ 1DDNA 2OD5A 1RPWA 1W0TA 4U0YA 3I3LA 3OYGA 1YW7A 2D2WA 3OYJA 2CJJA 3HTUA 2MBFA 1N25A 1ZRDA 1ZGAA 4NHJA 4DJAA 3CC7I 2BYVE 3TKYA 5FLXZ 3BR3A 1LJ9A 1W4MA 2JA2A 1HA8A 1F1ZA 3KP5A 4RAGA 3H5NA 4LOCA 1R49A 2K02A 3IWFA 1PP7U 2QSHX 3HG9A 5EGOB 3VEPA 3FF5A 1ZG1A 2JSCA 3LSHA 1ODDA 3P9IA 2EZHA 3L09A 4KJZA 2DPDA 3D1NI 1FOXA 2IPQX 4I02A 2FNPA 1ORKA 4ZYAA 5IYCJ 4HSTA 1D0XA 3RYRA 2A5WA 2EIJH 2G7HA 2E60A 3HOUJ 2BY3A 4L9NA 4MO7A 2Q1ZB 3VYTB 2DMUA 1XC5A 3TBIA 1BI3A 2ZXIA 3K9TA 5DD8A 1LPQA 2L4AA 2X85A 4XKBA 3V7RA 2OTLI 3NQOA 4ENKA 2ISYA 4V19K 1K4SA 3F23A 1VNDA 4N9HA 2VC0A 3P5JA 2NRAC 4BNCA 2V1UA 1HKQA 3DU6A 1QNTA 1XSXA 2ELHA 4CXFA 1NK2P 2BY0A 3FISA 1E0EA 2Y0SA 3MKLA 2VKHA 1GLNA 2DOEA 3F8FA 3MZ8A 4IL6C 1G2HA 4E7JA 2P4WA 2EA2A 3FIWA 3O3KA 1YO5C 2IJLA 1RI7A 2KPMA 3FXQA 3E6CC 1JKRC 2DCEA 1D8KA 2UXNA 3ZP5A 2V9PA 3ASOH 2M7BA 5E8IA 5FRNA 3GXOA 4CGZA 4NUBA 2P81A 4EQQA 2Z9OA 1U9OA 1Y1WJ 5C4XJ 4LG0A 3VYUB 5LHHA 3BY6A 3Q9VA 3KP7A 2FBHA 1WGXA 4S04A 2F6CA 1SD5A 2MW8A 3RKQA 1MNDA 2KDOA 2NNYA 3PIOF 3WTUC 2IEKA 1HSJA 2MD0A 4DBRA 5LRRA 3Q0UA 2OV7A 3HDDA 3CO7C 2YU9J 4LB6B 2CUJA 1CF7B 2R92J 1I50J 2IAIA 3FXRA 5J4VA 3MZYA 4J19A 3GBGA 1APLC 3V7SA 2F48A 1YRNA 3J81K 3E0JB 2LY1A 3T1BA 2VKVA 4IHXA 2Y9YA 3FXOA 2IGKA 1RC9A 3NRVA 1UHSA 3K7AJ 1P2FA 1GDTA 2ZXWH 2IA1A 5F04A 2PX9A 3OSGA 3BZ6A 2YPRA 3O8GA 4OOIA 2DFHA 4Y7NJ 1GT0C 4YFNF 4DZJA 1SEUA 1BC7C 3JR9A 4XLCA 1ON2A 2M87A 3TMOA 3CQZJ 2CO5A 5FFXA 2FE3A 3KYDB 2OJED 3OYCA 2HDCA 2KIUA 3KZZA 5EEAA 2MSYA 1YI2I 2FRHA 2UUZA 1JGGA 4GYIA 5E79C 4HOBA 4Q47A 2HXIA 2Z3YA 2PJRA 5BQTA 4ENNA 4XLHA 2PI0A 2OA4A 5LHIA 4U0VA 2O8KA 1MMDA 4IF4A 2JVHA 4R1HA 4RB2C 1T0FA 1WH5A 3F22A 1QHGA 3ELKA 2K85A 3GTOJ 2EFQA 1OKRA 2BXYA 1KZHA 1XCVA 3HC7A 3H35A 4LLNA 4OIPF 3OR2C 2LD5A 2DFEA 3MQ0A 2P7VB 3I0TA 1J75A 1Y0UA 4FE4A 3G3ZA 3S16J 1OLTA 1E3OC 2M3AA 5D5VB 1G3WA 5JFRA 2BVMA 2P5LC 3SJMA 1YJNI 3HRUA 1D1CA 4BJ6C 4E7ZA 3HRMA 4LIVA 4PJLA 3DKYA 2R5ZB 2GXGA 1KONA 2ELJA 2H8WA 3F3XA 3L1PA 2Z33A 2MD5A 1WJEA 1WJ5A 2HOEA 3K70C 3DEWA 3HOZJ 1EJ9A 1LVAA 3ECHA 4IKFA 4ZDOA 4XSXF 3I9V2 3S93A 1VQ6I 1K6OA 3QYEA 2DA7A 1R22A 5ERIA 2AQEA 3PFIA 4P9UA 4BJ5C 2EIKH 2F5DA 3BCBA 2DOAA 3LWFA 3MCZA 1FX7A 3MZHA 3WE3A 4IRIA 1LDDA 1WZ2A 1EA3A 1YJ9I 1ZGJA 1MJAA 2AXTC 2LYCA 4PGHA 2FU4A 4IEJA 4UY8I 4B44A 5J40A 4KITB 1HQCA 3HHHA 4ON0A 2HTSA 2K9LA 1ACIA 4WK8F 3SZPA 2CQQA 2XRLA 3WGIA 4P5OA 3FX3A 3GTKJ 2L01A 4JBAA 2QA4I 4HF2A 1LDKB 4ESFA 2VT3A 5EEGA 1FMVA 3AL0C 3HIFA 1JTYA 4KIGA 3LSRA 2DA1A 1BM9A 3L00A 3QU3A 3M9AA 4BXXJ 2DA2A 3PNTA 3OS2A 2YSRA 3EUHC 2Q0OA 3RYPA 4C30A 4QIWN 4ZZDA 1EF4A 4IPAA 1DGRM 1VZ0A 2XUBA 3F0CA 4BL0B 5CVJA 4AIDA 2B7EA 4DYCA 4NC8A 5CYVA 3CJTB 4RLFA 2KQRA 2N8GA 2PN6A 3DWLE 3HHGA 4EEFG 1WHUA 4F52A 2M0MA 1YS7A 4FE7A 2CW7A 4EJWA 2LKSA 3OYAA 2QF7A 2GIVA 3BQZA 1SD6A 1ZHFA 2ESNA 4Y33A 1VQ5I 1SANA 4HPQA 2AXLA 4XBFA 1KQ8A 3L2QA 1B8IB 4PFPA 4B3XA 4HX8A 1V5GA 3ZGKA 1S7EA 3CCMI 1MJBA 2A6HF 4AWXB 1MBJA 1KQ0A 1QGPA 5H6QA 1P4WA 1R36A 4IHYA 3F8MA 3QPLA 5LEKA 1REPC 3ZRGA 2MG4A 1LEBA 3BG6A 3HSRA 4A2UA 2EFNA 2GIZA 1SVMA 4PSXA 1D1AA 1TQPA 4HEA2 4XLAA 4RGUA 4UHTA 4YELA 5IOZA 2VOPA 1D5VA 2O5RA 3EDPA 3CDLA 2KRFA 4G6DA 4ZC3A 5FRMA 3HOYJ 2PLYA 1XGOA 3CCQI 3S8PA 1BIBA 2GM4A 4B47A 5TJJA 1K78A 2LTPA 2ME0A 1OQYA 4G6QA 2ID6A 3BG3A 2I5UA 4MGRA 4BXUA 2NS0A 4EV0A 4X6AJ 2R7OA 2LF7A 3K1NA 2IGNA 4OMZA 1K61A 1FOYA 3FK7A 3E5UA 4RAYA 5E3LA 5DCFA 2QYOA 2DYSH 1K6YA 4XKCA 3SEZA 4A5NA 3KCCA 4MEXF 1IN4A 1AWCA 4HDUA 3ZCOA 5IOYA 1BR4A 3L2UA 3BTLA 3CF5F 2BOLA 2X1CA 3W2VA 2R5YA 1MBFA 3S3NA 1PYVA 4RM3A 2V1XA 2NAZA 2FXAA 3IH4A 3OIQA 1JKQC 2LF8A 1X19A 2PFBA 5K5QA 4BE2A 2NXNB 2R93J 2ZXHA 3FXMA 1R7JA 4HBLA 4AU7A 2K7LA 4HF1A 2M0CA 4IVNA 4M3DA 1OISA 2JA5J 4BH9A 2CWEA 2FQ4A 2KT0A 2XKOA 4FHTA 3S17J 5FKMA 5B5EC 1JKOC 2OZ6A 3GFIA 3LAPA 5FROA 2GQQA 3ISPA 3SQNA 1YYVA 4GRIA 1LKXA 4KN7X 1HXDA 3OSFA 3N4MA 1YE9A 3JAMK 3CTAA 6PAXA 1TT5B 5M5WJ 1YJWI 1MBEA 1TTYA 3DCFA 3MKZA 1QZYA 3NARA 4MTEA 2XGXA 3I54A 4A3CJ 4KN4X 2NVYJ 1ZR2A 4F3QA 1SMTA 3ZMDA 2BGCA 1MJ9A 1FBSA 2BBYA 2O3FA 2RQPA 2KIQA 3K10A 1JHHA 3E6MA 2Q2EA 2IP2A 4BKXA 1LFUP 3MWMA 3Q9SA 4J01A 3R4KA 3DEUA 3BG9A 4JOMA 1IJWC 1DU6A 5IT3A 2DLLA 1K83J 4HX4A 1U78A 1SMYF 1ONVA 3CCJI 1ZTRA 1C0WA 4KMUX 2KLOA 3WG7H 1YQAA 4KFCA 5C44J 3ASNH 3H92A 3IWZA 1I39A 2DQLA 1YHQI 3K70D 1W0UA 2BW3B 1S3JA 4RLQA 2A68F 1T08B 1UAAA 2YX7A 5HDNA 2VQGA 1U5TC 3CF2A 1L3LA 3C2GA 1FYLA 2VQCA 3HTSB 1QPMA 4HAMA 3BPVA 2EZIA 5K7FA 3SDGA 1X1CA 3QYFA 3WHCA 3DBLB 3K2AA 1YS6A 3IH3A 4A3JJ 2L5QA 3CCVI 5J47A 3UR3C 1YIOA 2JUCA 4M3FA 4D5CA 4CCLA 1RESA 3PL8A 1B4AA 1HKSA 2EV6A 1JTXA 2O61A 4O3MA 3S3MA 1RKWA 2DDBA 1WI3A 2A5YB 3I58A 1MNMC 1DP7P 1BBYA 1X3WB 4H4KC 4M72A 4XR6A 3CUQA 1R5ID 2FD5A 1YIJI 3GLXA 1P4XA 4MLOA 2L4MA 2QSGX 2M2EA 1G4DA 3OYLA 4LD5A 4WXDA 3OL3A 3OYEA 3TW6A 1VQNI 1XS9A 4JX4A 1ZRFA 2V1NA 2OC6A 3WU0A 5EGOA 1D5YA 1IDZA 2H09A 3LL7A 1JUPA 5M5YJ 4CCOA 3PM1A 3ZPLA 2XKPA 1K78B 1FSHA 2ZMEC 1LQ1A 1MNEA 2DFFA 2R7UA 3BROA 2DPUA 1K79A 1FC3A 5BNGA 1XMXA 2VI6A 2GA2A 2E2IJ 1J5YA 4B4CA 3BG7A 3LSMA 5L3DA 2KFDA 4Z2YA 1ZAOA 3VSLA 3RZDJ 1TW3A 2R3SA 3EQLF 3FDYA 1EV7A 4Y4RA 3R60A 3KYLA 2O6GE 1W36C 1P4AA 1QU3A 3M8FA 4NC7A 1PUFA 1ERDA 1QBJA 2V9VA 1A6QA 2XGCA 4XSZF 1X1PA 3A03A 4II3A 2CRGA 4Q4ZF 3NAUA 1R4MB 3LSJA 4CUGA 2XRNA 4BJTA 1ZLKA 1USTA 2X51A 3S2WA 4UV9A 4A3GJ 3LA3A 2KJCA 2VXDA 2XAGA 2WC2A 4G12A 3S2HJ 3TQNA 5E17F 1H8AC 1VQ7I 5DDGA 4A0ZA 5L3CA 2E36A 2W25A 3G1MA 4Y13A 3HGGA 3ZQLA 5ILVA 2XV4S 3RJPA 5J4YA 2HDWA 1TBXA 3DXJF 4BGDA 3I5UA 4U87A 4E7SA 4G9YA 3ZMZA 3A01B 2DK8A 1U2WA 3K0LA 3ERMA 3R0JA 3ZMTA 4EM0B 2K9NA 4OIRF 3V7CA 3BTCA 1JI8A 5HOOA 1OCOH 3J80K 3I4MJ 2FBIA 2MLGA 4MNUA 3E5QA 1RR7A 5D5UB 4L9VA 4XKVA 2WB1A 2WWYA 1MMSA 1ZR4A 2K3PA 5A2QK 2Q2EB 1I5ZA 1CF7A 4HV5A 3K4CA 2XF7A 1WJFA 5ICEA 1R9TJ 2GXBA 2CQNA 3MAJA 4A3LJ 3MKYB 4WXHA 1UMQA 4CYDA 4QWQA 4IRHA 2NNNA 2VONA 1FNNA 1MSEC 1Z7LA 2Y75A 4HNUA 5IT9Z 1JUMA 5M3FJ 1HBXG 1DQUA 3ZQCA 2YX4A 2ID3A 4CCNA 1VQ9I 2VL8A 5L3GA 2DQRA 3LFUA 1WJCA 2FBKA 3QOEA 3FKJA 1S29A 4EJOA 3N05A 3KIOA 1TWCJ 2QSFX 3J7ZI 4PZJA 1X2NA 3OL4A 2R7SA 5D6FA 2KKOA 2COBA 1X2MA 1GUUA 4C2TA 4R79A 1L0OC 5FFZA 2X4HA 4RGSA 1KU9A 5AIPA 3F72A 3FM3A 2JSPA 2OQRA 4I01A 4B3AA 4F92B 1WQ2A 3E6BA 1FZPB 3FK6A 3WGHA 3MEXA 2R4GA 1U0JA 1TP4A 4EATA 3HPHA 1OCCH 4EGYA 1UCRA 1WWXA 2XAFA 4XKWA 3OOUA 5GP9A 3D0SA 1X4PA 4RS8A 3RQIA 3ZQFA 1RKTA 5BMZA 1O7FA 5E1ZB 3SFZA 4ESJA 1DGWY 1WJAA 3CUQB 1BR2A 2K4BA 2QQ8A 1WVRA 2NOJB 1IN8A 5KK1A 2AHQA 1F5TA 4XOTA 2R5ZA 2K3FA 3OYDA 1J0RA 1T98A 1FIPA 2E71A 5JVGF 2GA1A 5K7ZA 5GAHJ 3U2RA 4BHPA 1IV8A 2FJ1A 3PIPF 3S2DJ 1Z7UA 5KHDA 4ENJA 1POGA 4XLPF 4AUXA 3RDIA 5B3SH 3GCMA 3CCEI 3PO3J 1FOKA 5D8KB 2M5WA 4G8XA 2F5EA 1W5SA 5M5XJ 4JX5A 1ZN2A 3QODA 3M8JA 1Z0XA 3DKWA 2LOOA 3RPUA 2F2EA 4CCJA 5LBQA 5ICFA 2DODA 2DU9A 4AD9A 2A6EF 4CDGA 3D5SC 3KX2A 4M9SA 1P9QC 3JTGA 4D0PA 1PUFB 3VDXA 2ZJ2A 1X4OA 3AFHA 3OIPA 1J09A 3ABTA 1E3PA 2XPWA 1HSTA 1H0MA 1RETA 1ZQ3P 4L5IA 2PG4A 3BPXA 2JRMA 3J7AY 1FTZA 3SYTA 4BQQA 1XG1A 2DA6A 1IN7A 2F5CA 1YTYA 3HB9A 3RKXA 2BVLA 1YW9A 1R4NB 1KGSA 1I27A 3BQYA 2DT6A 3V8KA 4DIQA 4U7BA 2M7AA 2Y30A 2EZLA 3E3VA 1KA8A 3F8NA 1ZGWA 1HDPA 1UG0A 2BEOA 3JREA 3GUDA 3FBNB 1D0YA 2FOKA 3AG3H 2AO9A 2EFPA 2Y0SN 3IV5A 1HKTA 1NG6A 1ZK8A 2E2HJ 3HOSA 3HRSA 4C2MJ 4GXOA 1E3HA 2A07F 5CJ9A 1W36D 3GZNB 1R71A 4N4OB 2ZO4A 4L0YB 3LAJA 3JRBA 2CFXA 1WKMA 3OYKA 2RQQA 2JZYA 2X6XA 2ZJPF 4XL9A 1T2KA 4A5MA 2E5ZA 1B8IA 2I8DA 3GTQJ 1FYMA 3I56I 2XAHA 5E1XA 2R7DA 1OR7C 3PUBA 4HQMA 1PVEA 2K5CA 4XQFA 4B09A 2QKMB 4YFKF 2X9DA 2WV1A 4XLNF 3SEQA 5H20A 3HYIA 2P0WA 4YG2F 1P7JA 4HSRA 2VN2A 4PFOA 1BL0A 1IRZA 4BS9A 3ZQHA 2CG4A 1B72B 2QLZA 2W24A 3WTVC 4YIIA 2ZFUA 1F36A 1GV2A 3D5LA 3DPUA 4GCVA 1ETOA 2VB6A 5FJ8J 1QVTA 4L0ZB 1T6SA 4E7LA 5EJCA 2IBDA 3W6KB 2MC4A 1ZG5A 4I2OA 4OAZA 3JRFA 3KEOA 3AAFA 4BY1J 1U8RA 4IOCF 5FGMA 2ZFWA 5LHGA 4L9TA 2CW0F 1FP2A 3LA2A 3IAM2 2H8RA 3KLOA 1Z91A 1R1UA 1MBHA 3JW4A 3K4LA 2COMA 3G1LA 2EBIA 4IQ4A 1U8BA 4XN0A 2V26A 3VOEA 4RGXA 2R7FA 2JTVA 3I59A 4Y3OA 4AVPA 4BAYA 2VBWA 3V4GA 2HR3A 3BC8A 2XSDC 2W00A 1B9NA 2BZTA 1YG2A 2RC4A 1FSEA 2KDZA 1VQMI 1QZEA 4YFXF 5JLWA 3TP3A 2E1CA 2STWA 3WTZA 1TW2A 1GV5A 1IG7A 3O2PE 2XSJC 3IKVA 1IRXA 3T8RA 3KZYA 5LGTA 3TL4X 4HG2A 4KNYA 1BI1A 5HLGA 3HOVJ 3GFJA 4ZDLA 3KZIC 4II2A 5B1AH 4G7HF 4M9ZA 2STTA 4PK4A 1SFUA 4LIUA 1WI9A 3B6AA 1B59A 4UB8C 5E8GA 5DV5A 5C3EJ 1F9NA 3OIOA 5CQGA 2MA3A 1OYIA 4DNCA 4A0XA 2LDUA 4HYEA 4X1EA 3W6JB 2KRCA 4DQ2A 1QPIA 1S5LC 2O0YA 1MMAA 1T39A 4CA0A 1OCZH 3S1QJ 2H94A 2WY8Q 3FMRA 2BY2A 4UV8A 3LSPA 4DYQA 4RB3C 3JRIA 4UVCA 4IHVA 3WGGA 3ABLH 2BW3A 1DUXC 2DMNA 1E2XA 2OF7A 3GTPJ 3H3ZA 2WY7Q 1W7PD 2FMYA 1ZELA 3JCUC 1GXPA 5DUKA 4RDUA 1MW7A 2L2OA 2J5PA 3ABMH 5DYMA 4WWCA 3H0GJ 1OJLA 3PJRA 2EK5A 2JA6J 3J7AO 2X6YA 1XTAA 2DMQA 1N75A 1DU0A 5DTDA 1IN6A 1MZBA 4WCGA 5GPAA 3M8EA 1USSA 4QPQA 5HNFA 4PJJA 4G94A 3DPTA 2KL4A 5F0FA 1I1GA 3ONQA 2M9HA 1OCTC 4YIRX 1OCRH 1W5TA 4UVBA 3CMAI 2VE8A 2M1BA 3CP2A 2FOWA 2GOXB 1GVJA 1R6RA 1O3RA 2TCTA 3DFGA 4E7IA 1R00A 2FEZA 4HNVA 2XB0X 2EWNA 4IJAA 3Q0VA 5E3MA 5EYRA 4C2UA 3DLAA 3L9FA 2ZJRF 2VQLA 2A05A 3CLQA 3KP6A 2BY1A 4RMNA 4PSWA 3BR6A 2W57A 3BLYA 1U5TB 5FLMJ 3RPQA 4GFBA 1LUJB 1JHFA 2LNBA 4LITA 1P92A 2IGOA 2CGPA 1A04A 3H9GA 4Q48A 1I6XA 3V8LA 2NS8A 2E35A 3H5RA 4CH7A 2AS5F 3ABKH 3JTHA 4D9JA 4XICA 1A5JA 1H88C 3CCRI 2VODA 5HS9A 1V3FA 3B02A 4F55A 3ESWB 3K4BA 1I6HJ 4DBQA 5GAGJ 2E34A 1G3SA 1IXRC 3J81Z 3CDHA 2DTZA 2M4GA 2V6CA 4YRVA 5GAEJ 3DTEA 2QQAA 4W1UA 1SC7A 4A93J 3HKZA 1A6IA 3QQAA 3BZKA 3BT9A 4U88A 3ZN0A 2P5VA 1MMNA 2EILH 3VODA 2H1LA 1I3AA 3KE2A 2XVCA 3DBRB 4FX4A 1X1AA 2Z16A 3LQRA 4GYGA 3F21A 2Z99A 4CHUA 2MH9A 2F4IA 3I59B 3F8CA 4V2FA 2Y69H 3ZMSA 1VQ8I 3HJEA 3U1KA 2XHKA 1I3QJ 3KPHA 4D7MA 3I71A 3ZQ7A 1WRJA 5EEHA 4I0BA 4ASNA 2OTJI 2ZMEB 3G6EI 4EJUA 3I53A 4XRFA 4Y15A 5FKKA 1LEAA 3OYMA 1OCPA 2DJNA 3ECOA 1W7PA 2WADA 2ICWG 1O7LA 1UELB 4FETA 4JK1X 3I4NJ 2WAQA 2EQRA 1XB4A 4U0WA 5FO5A 1YITI 4F93B 3A2KA 1ZH5A 3A01A 3GX4X 3QWLA 3GLLA 3L2WA 2IRFG 2X1EA 2VKDA 2VC1A 1ON1A 3DTIA 1HW1A 2HI3A 2LVSA 1G3TA 2DYRH 2M8GX 3JRGA 3E6DA 2NYXA 1XSVA 4F7ZA 1PDNC 5KVRA 2R7ZJ 4S0HB 3NWTA 1NK3P 2GZWA 1BI0A 1BW6A 3ZXSA 2WTEA 1R5GA 2CSOA 2EIMH 2YU3A 4B48A 1CGPA 2QBYA 5CVVA 3OYNA 5J1RA 1O3SA 1NHAA 2GXAA 2WAQN 2ZBKA 5GADJ 2L7FP 2WA0A 1WPKA 1FMWA 4UUTA 4E7KA 1IC8A 9ANTA 5HS7A 3BZCA 3BR5A 4C9YA 3RCOA 2R7RA 3VFZA 2Y2ZA 2A69F 5D5WB 2LKXA 2ZNYA 3FBIB 2ESHA 3GTLJ 1YX3A 2QGUA 2WAEA 2OBPA 4XOPA 4D7NA 3ZMUA 1HC8A 3KLNA 5F27A 5IP7J 3CUOA 1TWHJ 5J3LA 1TNTA 4I99C 3UNGC 2P7CB 4XRSA 3VPRA 2R7QA 1LFPA 3K4KA 2A61A 2JA7J 2QQBA 1S6LA 4P9FA 1LB2A 2K9MA 1Y56A 2E1MB 3JRAA 3CESA 2VIXA 5AIQA 1UB9A 3F6VA 2IVMA 4D1QA 1TWAJ 2ZCWA 1U9NA 3QAHA 5CVIA 3COAC 1WJDA 3WTSC 3OYFA 3FXLA 2G0EA 3TO6A 3OS1A 5LFAA 1J2XA 2CUFA 2R7WA 2HPMA 2D5VA 5FLXK 3IL2A 3KEQA 1V5FA 2XB5A 2H6BA 4Q5SF 4UNOA 2Y31A 2Y0MA 5JI6A 3A1YA 4IXAA 1V54H 5E3NA 5ICGA 3PSFA 1P7IA 2DAOA 2W82A 1IZ1A 3QP5A 1JJ6C 5FB2A 3FMQA 4X0GA 2MGQA 1SAXA 3EPZA 3E5XA 3TO7A 3WTYC 1EH7A 1ZLJA 4O6JA 3O6BB 3H0DA 4EJVA 2V9KA 3C2HA 3QOPA 4R8HA 1FLIA 3G1OA 4BBSJ 1T0FC 3PNYA 3GVAA 3HZJA 3ABUA 3KEYA 1BR1A 2XGDA 2RV8A 1HCRA 3JRDA 1LDJA 1J7KA 2XAQA 4KIBA 3E1SA 1JT0A 3DBHB 4M71A 4CCKA 1FBUA 1WJBA 1VI0A 4HF0A 4L18B 4E70A 2DOFA 1IW7F 1RRJA 5IPAA 4ZTFA 2UV1A 2W7NA 1XDSA 2EA4A 2DA5A 4B1RA 3GWZA 4PJNA 2HPIA 3G2BA 1TT0A 1T8IA 1D3YA 3RQ4A 4LJZF 3BR0A 3SZGA 2ZNZA 4EGZA 2ECBA 2IS6A 1GXQA 1ETVA 2HVSA 1PUEE 4MHGA 4M3BA 3KFWX 2YR2A 4PGGA 4RB0A 2X6OA 4A6EA 4MFDA 3H5AA 2UWMA 3LA7A 5HDKA 4NC6A 3PSIA 5K1YA 3FXKA 3H1CA 1TL8A 3R6SA 4MTDA 3H9JA 2EFWA 2M4KA 2YS9A 1XN7A 4V2GA 1OMIA 2BXZA 3HBLA 2H6CA 2LG4A 2V4JC 3S3OA 1BIAA 3ZN1A 2E7WA 3RKWA 4A3EJ 2HQ5A 1VFCA 2VJ5A 4PUSA 4UB6C 1K7AA 2FQ3A 3CP8A 2ELKA 1QRYA 4BU2A 1W7PB 2DT7B 2B9SA 4ZYDA 3PNVA 5GTHC 2HQRA 5HLTA 3WTTC 1TNSA 2PEXA 3A0HC 3K69A 2ZSHB 4NNJA 4XLEA 2Q8KA 1BA5A 1IAWA 2VQHA 4A12A 5EF6A 4ZTJA 3ROUA 3BR1A 1OYYA 5DCMA 4JYKA 4Y52J 1SVOA 2QM3A 5JHUA 4G7OF 1N77A 4AM3A 2HZDA 1R23A 2L02A 1GHCA 1IF1A 2K9QA 2QBYB 1FPQA 3PUFA 4DZPA 5E1WA 4CZCA 4M6YA 5L3FA 3S1NJ 5DM7F 2V1DA 2IA0A 3X2QH 2BE5F 2K40A 2NVUB 2CQKA 4XN3A 3LFKA 1GVDA 4P55A 2PQ8A 2ISZA 4M6XA 1V55H 3EUHA 1Z3XA 1MH3A 3Q0WA 4A6DA 1DPUA 1UG2A 1IUFA 4FX0A 1ZYRF 3LSGA 3L2CA 2NVXJ 4G7ZF 2WB1N 3ML6A 3U9GA 1F43A 4N0BA 2J5OA 2V7FA 3JAMZ 3HUGA 1CQTA 1JGSA 1B72A 5FD6A 1PJRA 2OCEA 3BJAA 3JSOA 4N9IA 5CKTA 4Z6YA 1A36A 2MH2A 3S32A 2NVTJ 4OU0A 3REOA 2HOSA 2EINH 5CLSA 2L7ZA 3SFIA 1H89C 4P96A 5HS8A 4A3IJ 4BY7J 2XF5A 3CC4I 5D8LB 5LGNA 4RBOA 2M8EA 1IV6A 4CSWA 4PJ0C 3W3CA 4YIFA 2ZKZA 2HNHA 1ENHA 5D6EA 3LNQA 2FX0A 2L0KA 4ETSA 2QENA 3EUAA 4QPOA 3DLLF 4HRIA 2Z5UA 1UZCA 2JPCA 3VB2A 5EZGA 3HSEA 2KP6A 4M3EA 1BI2A
chains in the Genus database with same CATH topology
2DI3A 3G73A 2P5KA 4ZYHA 5F6FA 1VTNC 5DEQA 4UVAA 4KMFA 5D4SA 3P7NA 1JXSA 4HLYA 4M74A 5J6XA 3QPTA 3P9CA 5LEJA 2V79A 2P6TA 3QRFF 4OINF 3IHUA 3K1MA 3EYYA 1XGNA 3MFKA 2FA5A 1Z6RA 4HQEA 1Z6TA 1IUYA 2IW5A 5L3EA 2EV0A 2RN7A 1I1SA 4HV6A 1MKMA 1FY7A 4WX9A 3KP3A 2G7UA 3GW2A 4I7HA 2ZXJA 1HW2A 3HRTA 4ENMA 3GEZA 2QVOA 1TLHB 3DV8A 4EM2A 1TQMA 1E17A 3KETA 5DCMB 4EMSA 3T5XA 3E97A 3L7WA 3HOTA 2HFHA 3BJOA 4BHCA 1Z05A 4A0YA 1QO0D 3GFMA 2DTRA 2GWRA 5K5RA 5JR3A 2RNJA 1IXSB 3C7JA 1KQ9A 1O3QA 1Z9CA 3TOBA 3TGNA 2VBYA 2W84A 5HDGA 2B0LA 3B73A 4KIFA 4TV7A 1U5TA 3IRQA 1XGMA 1R58A 1XGSA 3OOPA 5ICCA 5HLIA 2OU2A 3WTXC 1XSDA 3J80Z 1MGTA 1EH8A 1LNWA 1ZG3A 2ACJA 3KP2A 2XAJA 3GZ5A 5A2QZ 4AIJA 1QZZA 1MDMA 3LSTA 4UXNA 2QZ8A 3P9KA 1FWZA 3DF8A 2HKXA 1S7AA 3CUQC 3Q5FA 2C6YA 1RZ4A 3BWGA 3FWEA 2XIGA 4LLGF 5E20A 2HGCA 1MD0A 4CICA 1XD7A 2LSOA 2QUFA 2F5FA 2VXZA 3WG9A 4L9JA 4EVIA 1YLFA 1G3YA 3T0YA 2RKHA 4NQWA 1FBQA 3K1PA 5BOXA 1FP1D 1U6GA 2ZMEA 2XROA 2M45A 4I09A 4LB5A 4LGWA 5BPIA 2DFIA 2LKPA 5D4RA 2BV6A 3JSPA 1R1TA 3I4PA 1IRGA 3K2ZA 1H9GA 3ZMVA 1HW5A 4BHBA 2DBBA 1KYZA 2O8XA 4AIHA 3GZ6A 1SD4A 1ZRCA 4GO1A 2ETHA 4KUMA 1RNLA 1S7OA 3GYHX 4HDVA 3R61A 3CJNA 5BS6A 4WF2A 5F1RA 5F64A 4Y17A 3IKTA 3IRRA 4RB1A 2VBZA 4ZH4F 1OYWA 5FD5A 1IN5A 1SFEA 3C18A 4KT5C 2OAZA 5BPDA 3GFLA 2VOOA 3QP6A 4RGRA 2P6SA 1UHWA 5LGUA 5J8CA 4LG0B 1WSUA 2E1NA 4ZYEA 1U3EM 1RUOA 3BJ6A 5L3BA 5ILUA 1KU3A 5DUIA 2PJPA 2KIFA 4EJTA 3T8TA 4OIOF 4WXCA 4CO8A 4AIKA 3RTRA 1B6AA 1KU2A 1O57A 1AOYA 4U7DA 2EV5A 1MDMB 3FHZA 3DQVC 1SD7A 3U1DA 1X3UA 1B1BA 4ESBA 5LLQA 2IT0A 5E18F 2TDXA 4K2EA 2DO7A 3CLOA 1YFHA 4LMYA 2HYFA 4HA8A 3SZTA 2RDPA 4JQFA 1UFMA 1B9MA 4O5VA 4ZZLA 1F4KA 2XASA 3SXYA 2HZTA 2HTJA 2O03A 3WODF 4KICA 2MLKA 2HS5A 3OV8A 2K27A 4H0EA 2JPBA 2QWWA 3QPHA 1V4RA 2UZKA 2M30A 3GF2A 1XMKA 2FMLA 1SFXA 4RAZA 4M9XA 1UHMA 1D8JA 3C1DA 1DPRA 4BYYA 2E7XA 1H9TA 2G9WA 3QU6A 5DD4A 3ULQB 5IT9K 4IHSA 4KYWA 2KIMA 5ED4A 1J59A 5CVUA 2EB7A 2HWVA 4CZZA 2W85A 3WTWC 5JVTA 2PMHA 1ZREA 2HQNA 2A3SA 2HYGD 2QQ9A 2P8TA 2VE9A 3ERED 5LRSA 2FNAA 4HLXA 4HW0A 2Y48A 2DT5A 4L5JA 3F8BA 3GO5A 4UUVA 2OZUA 5J8FA 4MQVA 2L54A 1STZA 3IC7A 3C3WA 2HEOA 2D1VA 1BJAA 1XCBA 4QLCU 1OR7A 3PQKA 1ZARA 4GGGA 5TRDA 3NEUA 2L3DA 2FSWA 3TDZC 5K5OA 3H3UA 3M7GA 1IXCA 4S05A 4LFUA 3BP8A 2OQGA 2PBIA 2IA2A 1Q1HA 3DP7A 1G6NA 1RUNA 2ADUA 4BQAA 3TDUC 4KDPA 4HX7A 1PP8F 1IRFA 3FMSA 2EJRA 4IRGA 3FM5A 1R5HA 1RIOH 5ILSA 1FYKA 2EFOA 1R1VA 2JRTA 5CVRA 1BN5A 1O3TA 2KJBA 1QQIA 1JE8A 2K4JA 4LLLA 3BDDA 4EM1A 3RI4A 1J9IA 3M1EA 4HZFA 3DPLC 3FXUA 2GAUA 4PCQA 3EETA 4I0AA 5HVQC 2H27A 2D1HA 3PQJA 3SHFA 3TOAA 2X0LA 5AONA 1KYWA 4LK0F 4LK1F 4I98B 4MQ9F 1S8NA 1T38A 3I64A 2WV0A 2DW4A 2D45A 3HSFA 4ZYGA 3FZVA 2VBXA 1XDUA 1ULYA 4B8XA 5D5XB 3RIRA 3N97A 1EH6A 5HLHA 3LQQA 1P6RA 3WU1B 4NB5A 2HKOA 1KU7A 3WE2A 3R0AA 3RKYA 1FT9A 4MEYF 5H6RA 2PMUA 1YW8A 1OPCA 2DK5A 2RGVA 1BOAA 2VT2A 2MC3A 2FF4A 4IHTA 3EYIA 3CO6C 2RVCA 4OIQF 2CYYA 3BOQA 3V8JA 2JT1A 1XMAA 4FT8A 1BC8C 2UXXA 4M73A 4PDKA 3TO9A 1TQIA 3KP4A 3F6OA 1Z1DA 2K86A 4KA4A 1DDNA 2OD5A 4U0YA 1YW7A 2D2WA 3HTUA 2MBFA 1ZRDA 1ZGAA 4NHJA 2BYVE 3TKYA 5FLXZ 1LJ9A 1W4MA 1F1ZA 3KP5A 2K02A 3IWFA 1PP7U 3VEPA 3FF5A 1ZG1A 2JSCA 1ODDA 3P9IA 3L09A 2DPDA 2IPQX 4I02A 2FNPA 3RYRA 2G7HA 4L9NA 1BI3A 3K9TA 5DD8A 2L4AA 3V7RA 3NQOA 4ENKA 2ISYA 3F23A 4N9HA 2VC0A 4BNCA 2NRAC 2V1UA 1HKQA 1QNTA 1XSXA 2ELHA 4CXFA 3F8FA 2P4WA 2EA2A 3O3KA 1YO5C 2IJLA 1RI7A 3FXQA 3E6CC 3ZP5A 1D8KA 2UXNA 5E8IA 3GXOA 4CGZA 4EQQA 2Z9OA 4LG0A 5LHHA 3BY6A 3Q9VA 3KP7A 2FBHA 4S04A 1SD5A 2NNYA 3WTUC 1HSJA 5LRRA 3CO7C 4LB6B 1CF7B 3FXRA 3MZYA 3V7SA 3J81K 3T1BA 3NRVA 1P2FA 2IA1A 3BZ6A 2YPRA 4OOIA 4YFNF 1BC7C 1ON2A 2M87A 2CO5A 5FFXA 2FE3A 2HDCA 2KIUA 3KZZA 2FRHA 4GYIA 4HOBA 4Q47A 2Z3YA 5BQTA 4ENNA 2PI0A 2OA4A 5LHIA 4U0VA 4IF4A 4R1HA 4RB2C 3F22A 1T0FA 3ELKA 2EFQA 1OKRA 4LLNA 1XCVA 4OIPF 3MQ0A 2P7VB 3I0TA 1J75A 1Y0UA 3G3ZA 5D5VB 1G3WA 5JFRA 2P5LC 3HRUA 3HRMA 2GXGA 3F3XA 2Z33A 2MD5A 2HOEA 1LVAA 3ECHA 4XSXF 1K6OA 1R22A 5ERIA 3PFIA 4P9UA 2F5DA 3LWFA 3MCZA 1FX7A 3MZHA 3WE3A 4IRIA 1LDDA 1ZGJA 1MJAA 4PGHA 2FU4A 1HQCA 3HHHA 4ON0A 2HTSA 4WK8F 3SZPA 3WGIA 4P5OA 3FX3A 2L01A 4JBAA 4HF2A 1LDKB 4ESFA 2VT3A 5EEGA 3HIFA 4KIGA 1BM9A 3L00A 3QU3A 3M9AA 2YSRA 2Q0OA 3RYPA 4ZZDA 4IPAA 2XUBA 5CVJA 5CYVA 2PN6A 3HHGA 1YS7A 4EJWA 2GIVA 1ZHFA 1SD6A 2ESNA 2AXLA 4XBFA 1KQ8A 4HX8A 1MJBA 2A6HF 4AWXB 1KQ0A 1QGPA 5H6QA 1P4WA 1R36A 3F8MA 5LEKA 1REPC 1LEBA 3HSRA 4A2UA 2EFNA 1TQPA 4RGUA 4UHTA 2VOPA 1D5VA 3EDPA 2KRFA 4G6DA 2PLYA 1XGOA 1BIBA 5TJJA 1K78A 4G6QA 4MGRA 4BXUA 2NS0A 4EV0A 2LF7A 3K1NA 4OMZA 3E5UA 4RAYA 5DCFA 2QYOA 4A5NA 3KCCA 4MEXF 1IN4A 1AWCA 4HDUA 2V1XA 2NAZA 2FXAA 2LF8A 2PFBA 5K5QA 1R7JA 4HBLA 4HF1A 2K7LA 4BH9A 2CWEA 2XKOA 4FHTA 2OZ6A 3GFIA 3LAPA 2GQQA 3ISPA 3SQNA 1YYVA 4KN7X 1HXDA 3N4MA 3JAMK 3CTAA 6PAXA 1TTYA 1QZYA 4MTEA 2XGXA 3I54A 4KN4X 1SMTA 3ZMDA 2BGCA 1MJ9A 1FBSA 2BBYA 2O3FA 2RQPA 1JHHA 3E6MA 2Q2EA 2IP2A 3MWMA 3Q9SA 3R4KA 3DEUA 5IT3A 2DLLA 4HX4A 1U78A 1SMYF 1ONVA 1C0WA 4KMUX 1YQAA 4KFCA 3H92A 3IWZA 2DQLA 1S3JA 2A68F 2YX7A 5HDNA 1U5TC 1L3LA 1FYLA 3HTSB 1QPMA 4HAMA 3BPVA 1YS6A 1YIOA 1B4AA 1HKSA 2EV6A 2O61A 4O3MA 2A5YB 3I58A 1DP7P 1BBYA 4M72A 3CUQA 3GLXA 1P4XA 2L4MA 1G4DA 4LD5A 4WXDA 1ZRFA 3WU0A 2H09A 3ZPLA 2XKPA 1K78B 1FSHA 1LQ1A 3BROA 2DPUA 1K79A 1FC3A 2GA2A 1J5YA 5L3DA 4Z2YA 1ZAOA 1TW3A 2R3SA 3EQLF 1EV7A 3R60A 2O6GE 1P4AA 3M8FA 1QBJA 2V9VA 4XSZF 4Q4ZF 2XRNA 1ZLKA 1USTA 3S2WA 4UV9A 3LA3A 2KJCA 2XAGA 2WC2A 3TQNA 5E17F 5DDGA 4A0ZA 5L3CA 2W25A 4Y13A 5ILVA 2XV4S 3RJPA 1TBXA 3DXJF 3I5UA 4G9YA 3ZMZA 2DK8A 1U2WA 3K0LA 3R0JA 3ZMTA 4EM0B 4OIRF 3V7CA 5HOOA 3J80K 2FBIA 2MLGA 4MNUA 3E5QA 5D5UB 4L9VA 2WWYA 5A2QK 1I5ZA 1CF7A 4HV5A 5ICEA 2GXBA 3MAJA 4WXHA 4CYDA 4QWQA 4IRHA 2NNNA 2VONA 1FNNA 2Y75A 5IT9Z 1HBXG 2YX4A 5L3GA 2DQRA 2FBKA 1S29A 4EJOA 4PZJA 5D6FA 2KKOA 4R79A 1L0OC 5FFZA 2X4HA 4RGSA 1KU9A 5AIPA 3F72A 3FM3A 2OQRA 4I01A 1FZPB 1WQ2A 3E6BA 3WGHA 3MEXA 4EGYA 1UCRA 1WWXA 2XAFA 3D0SA 4RS8A 5BMZA 1O7FA 5E1ZB 3SFZA 4ESJA 3CUQB 2K4BA 1IN8A 5KK1A 1F5TA 1J0RA 1T98A 2GA1A 3U2RA 4BHPA 1Z7UA 4ENJA 4XLPF 3RDIA 1FOKA 5D8KB 2M5WA 4G8XA 2F5EA 1W5SA 1ZN2A 3DKWA 3RPUA 2F2EA 5LBQA 5ICFA 2DU9A 4AD9A 4CDGA 2A6EF 4M9SA 3JTGA 4D0PA 2ZJ2A 3ABTA 1HSTA 1H0MA 4L5IA 2PG4A 3BPXA 2F5CA 1IN7A 1YTYA 3RKXA 3V8KA 1YW9A 1KGSA 1I27A 4U7BA 3E3VA 1KA8A 3F8NA 2BEOA 3GUDA 2FOKA 2EFPA 1HKTA 3HOSA 3HRSA 4GXOA 2A07F 5CJ9A 2ZO4A 4L0YB 3LAJA 2CFXA 1WKMA 1T2KA 2JZYA 4A5MA 1FYMA 2XAHA 5E1XA 2R7DA 4HQMA 4B09A 4YFKF 4XLNF 5H20A 3HYIA 4YG2F 2VN2A 2CG4A 2QLZA 2W24A 3WTVC 4YIIA 3D5LA 4GCVA 4L0ZB 1T6SA 3W6KB 1ZG5A 4I2OA 3KEOA 3AAFA 1U8RA 5FGMA 2ZFWA 5LHGA 4L9TA 2CW0F 1FP2A 3LA2A 3KLOA 1Z91A 1R1UA 3JW4A 2COMA 3VOEA 4RGXA 2R7FA 2JTVA 3I59A 4AVPA 4BAYA 2VBWA 3V4GA 2HR3A 1B9NA 1YG2A 2RC4A 1FSEA 4YFXF 2E1CA 2STWA 3WTZA 1TW2A 3O2PE 3IKVA 5LGTA 3T8RA 3KZYA 4KNYA 1BI1A 5HLGA 3GFJA 4G7HF 4M9ZA 2STTA 1SFUA 1WI9A 1B59A 5E8GA 5DV5A 1F9NA 2MA3A 1OYIA 4DNCA 4A0XA 2LDUA 4HYEA 3W6JB 4DQ2A 2O0YA 1T39A 2H94A 3FMRA 4UV8A 4RB3C 4UVCA 3WGGA 1DUXC 1E2XA 3H3ZA 1W7PD 2FMYA 1GXPA 5DUKA 4WWCA 2J5PA 5DYMA 2EK5A 3J7AO 1IN6A 1MZBA 4WCGA 3M8EA 1USSA 4G94A 3DPTA 1I1GA 1W5TA 4UVBA 2VE8A 2M1BA 1GVJA 1O3RA 3DFGA 1R00A 2FEZA 2EWNA 4IJAA 3L9FA 3KP6A 2W57A 1U5TB 3RPQA 1JHFA 2LNBA 1P92A 2CGPA 1A04A 4Q48A 1I6XA 3V8LA 2AS5F 3JTHA 2VODA 5HS9A 1V3FA 3B02A 1G3SA 1IXRC 3J81Z 3CDHA 2V6CA 2QQAA 4U88A 3ZN0A 2P5VA 3VODA 3KE2A 2XVCA 4FX4A 3LQRA 4GYGA 3F21A 2Z99A 4CHUA 2MH9A 3I59B 3F8CA 3ZMSA 2XHKA 3I71A 3ZQ7A 1WRJA 5EEHA 4I0BA 4ASNA 2ZMEB 4EJUA 3I53A 4XRFA 4Y15A 1LEAA 3ECOA 1W7PA 1O7LA 4JK1X 1XB4A 4U0WA 5FO5A 1ZH5A 3GX4X 2IRFG 2VC1A 1ON1A 1HW1A 1G3TA 3E6DA 2NYXA 1XSVA 4F7ZA 1PDNC 5KVRA 2GZWA 1BI0A 2WTEA 1R5GA 2CSOA 2YU3A 1CGPA 2QBYA 5CVVA 1O3SA 1NHAA 2ZBKA 5HS7A 3VFZA 2A69F 5D5WB 2ZNYA 2ESHA 2OBPA 3ZMUA 3KLNA 3CUOA 1TNTA 2P7CB 2A61A 2QQBA 1S6LA 4P9FA 1LB2A 5AIQA 1UB9A 3F6VA 2IVMA 2ZCWA 3QAHA 5CVIA 3COAC 3WTSC 3TO6A 5FLXK 1J2XA 3IL2A 3KEQA 4Q5SF 2H6BA 4UNOA 2Y0MA 5JI6A 4IXAA 5ICGA 2DAOA 1IZ1A 3QP5A 5FB2A 3FMQA 1SAXA 3E5XA 3TO7A 3WTYC 1EH7A 1ZLJA 4O6JA 3O6BB 4EJVA 4R8HA 3QOPA 1FLIA 3GVAA 3ABUA 2RV8A 1LDJA 1J7KA 2XAQA 4KIBA 4M71A 1FBUA 4HF0A 4L18B 4E70A 1IW7F 1XDSA 2EA4A 3GWZA 1D3YA 4LJZF 2ZNZA 4EGZA 1GXQA 1PUEE 4MHGA 3KFWX 2YR2A 4PGGA 4RB0A 4A6EA 2UWMA 3LA7A 5HDKA 5K1YA 3R6SA 4MTDA 2EFWA 1XN7A 1OMIA 2H6CA 1BIAA 3ZN1A 2E7WA 3RKWA 1K7AA 2FQ3A 1W7PB 4ZYDA 2HQRA 3WTTC 1TNSA 2PEXA 3K69A 2Q8KA 1IAWA 4A12A 3ROUA 1OYYA 5DCMA 2QM3A 5JHUA 4G7OF 1GHCA 1R23A 2L02A 1IF1A 2QBYB 1FPQA 5E1WA 4M6YA 5L3FA 2V1DA 2IA0A 2BE5F 2CQKA 3LFKA 4P55A 2PQ8A 2ISZA 4M6XA 3EUHA 4A6DA 1DPUA 4FX0A 1ZYRF 3L2CA 4G7ZF 3ML6A 3U9GA 4N0BA 2J5OA 3JAMZ 3HUGA 1JGSA 5FD6A 3BJAA 3JSOA 4N9IA 2MH2A 4OU0A 3REOA 5CLSA 4P96A 5HS8A 5D8LB 5LGNA 2M8EA 4YIFA 2ZKZA 5D6EA 4ETSA 2QENA 2Z5UA 2JPCA 3VB2A 3HSEA 4IVNA 4OMYA 1BI2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DI3 A;  3G73 A;  2P5K A;  4ZYH A;  5F6F A;  1VTN C;  5DEQ A;  4UVA A;  4KMF A;  5D4S A;  3P7N A;  1JXS A;  4HLY A;  4M74 A;  5J6X A;  3QPT A;  3P9C A;  5LEJ A;  2V79 A;  2P6T A;  3QRF F;  4OIN F;  3IHU A;  3K1M A;  3EYY A;  1XGN A;  3MFK A;  2FA5 A;  1Z6R A;  4HQE A;  1Z6T A;  1IUY A;  2IW5 A;  5L3E A;  2EV0 A;  2RN7 A;  1I1S A;  4HV6 A;  1MKM A;  1FY7 A;  4WX9 A;  3KP3 A;  2G7U A;  3GW2 A;  4I7H A;  2ZXJ A;  1HW2 A;  3HRT A;  4ENM A;  3GEZ A;  2QVO A;  1TLH B;  3DV8 A;  4EM2 A;  1TQM A;  1E17 A;  3KET A;  5DCM B;  4EMS A;  3T5X A;  3E97 A;  3L7W A;  3HOT A;  2HFH A;  3BJO A;  4BHC A;  1Z05 A;  4A0Y A;  1QO0 D;  3GFM A;  2DTR A;  2GWR A;  5K5R A;  5JR3 A;  2RNJ A;  1IXS B;  3C7J A;  1KQ9 A;  1O3Q A;  1Z9C A;  3TOB A;  3TGN A;  2VBY A;  2W84 A;  5HDG A;  2B0L A;  3B73 A;  4KIF A;  4TV7 A;  1U5T A;  3IRQ A;  1XGM A;  1R58 A;  1XGS A;  3OOP A;  5ICC A;  5HLI A;  2OU2 A;  3WTX C;  1XSD A;  3J80 Z;  1MGT A;  1EH8 A;  1LNW A;  1ZG3 A;  2ACJ A;  3KP2 A;  2XAJ A;  3GZ5 A;  5A2Q Z;  4AIJ A;  1QZZ A;  1MDM A;  3LST A;  4UXN A;  2QZ8 A;  3P9K A;  1FWZ A;  3DF8 A;  2HKX A;  1S7A A;  3CUQ C;  3Q5F A;  2C6Y A;  1RZ4 A;  3BWG A;  3FWE A;  2XIG A;  4LLG F;  5E20 A;  2HGC A;  1MD0 A;  4CIC A;  1XD7 A;  2LSO A;  2QUF A;  2F5F A;  2VXZ A;  3WG9 A;  4L9J A;  4EVI A;  1YLF A;  1G3Y A;  3T0Y A;  2RKH A;  4NQW A;  1FBQ A;  3K1P A;  5BOX A;  1FP1 D;  1U6G A;  2ZME A;  2XRO A;  2M45 A;  4I09 A;  4LB5 A;  4LGW A;  5BPI A;  2DFI A;  2LKP A;  5D4R A;  2BV6 A;  3JSP A;  1R1T A;  3I4P A;  1IRG A;  3K2Z A;  1H9G A;  3ZMV A;  1HW5 A;  4BHB A;  2DBB A;  1KYZ A;  2O8X A;  4AIH A;  3GZ6 A;  1SD4 A;  1ZRC A;  4GO1 A;  2ETH A;  4KUM A;  1RNL A;  1S7O A;  3GYH X;  4HDV A;  3R61 A;  3CJN A;  5BS6 A;  4WF2 A;  5F1R A;  5F64 A;  4Y17 A;  3IKT A;  3IRR A;  4RB1 A;  2VBZ A;  4ZH4 F;  1OYW A;  5FD5 A;  1IN5 A;  1SFE A;  3C18 A;  4KT5 C;  2OAZ A;  5BPD A;  3GFL A;  2VOO A;  3QP6 A;  4RGR A;  2P6S A;  1UHW A;  5LGU A;  5J8C A;  4LG0 B;  1WSU A;  2E1N A;  4ZYE A;  1U3E M;  1RUO A;  3BJ6 A;  5L3B A;  5ILU A;  1KU3 A;  5DUI A;  2PJP A;  2KIF A;  4EJT A;  3T8T A;  4OIO F;  4WXC A;  4CO8 A;  4AIK A;  3RTR A;  1B6A A;  1KU2 A;  1O57 A;  1AOY A;  4U7D A;  2EV5 A;  1MDM B;  3FHZ A;  3DQV C;  1SD7 A;  3U1D A;  1X3U A;  1B1B A;  4ESB A;  5LLQ A;  2IT0 A;  5E18 F;  2TDX A;  4K2E A;  2DO7 A;  3CLO A;  1YFH A;  4LMY A;  2HYF A;  4HA8 A;  3SZT A;  2RDP A;  4JQF A;  1UFM A;  1B9M A;  4O5V A;  4ZZL A;  1F4K A;  2XAS A;  3SXY A;  2HZT A;  2HTJ A;  2O03 A;  3WOD F;  4KIC A;  2MLK A;  2HS5 A;  3OV8 A;  2K27 A;  4H0E A;  2JPB A;  2QWW A;  3QPH A;  1V4R A;  2UZK A;  2M30 A;  3GF2 A;  1XMK A;  2FML A;  1SFX A;  4RAZ A;  4M9X A;  1UHM A;  1D8J A;  3C1D A;  1DPR A;  4BYY A;  2E7X A;  1H9T A;  2G9W A;  3QU6 A;  5DD4 A;  3ULQ B;  5IT9 K;  4IHS A;  4KYW A;  2KIM A;  5ED4 A;  1J59 A;  5CVU A;  2EB7 A;  2HWV A;  4CZZ A;  2W85 A;  3WTW C;  5JVT A;  2PMH A;  1ZRE A;  2HQN A;  2A3S A;  2HYG D;  2QQ9 A;  2P8T A;  2VE9 A;  3ERE D;  5LRS A;  2FNA A;  4HLX A;  4HW0 A;  2Y48 A;  2DT5 A;  4L5J A;  3F8B A;  3GO5 A;  4UUV A;  2OZU A;  5J8F A;  4MQV A;  2L54 A;  1STZ A;  3IC7 A;  3C3W A;  2HEO A;  2D1V A;  1BJA A;  1XCB A;  4QLC U;  1OR7 A;  3PQK A;  1ZAR A;  4GGG A;  5TRD A;  3NEU A;  2L3D A;  2FSW A;  3TDZ C;  5K5O A;  3H3U A;  3M7G A;  1IXC A;  4S05 A;  4LFU A;  3BP8 A;  2OQG A;  2PBI A;  2IA2 A;  1Q1H A;  3DP7 A;  1G6N A;  1RUN A;  2ADU A;  4BQA A;  3TDU C;  4KDP A;  4HX7 A;  1PP8 F;  1IRF A;  3FMS A;  2EJR A;  4IRG A;  3FM5 A;  1R5H A;  1RIO H;  5ILS A;  1FYK A;  2EFO A;  1R1V A;  2JRT A;  5CVR A;  1BN5 A;  1O3T A;  2KJB A;  1QQI A;  1JE8 A;  2K4J A;  4LLL A;  3BDD A;  4EM1 A;  3RI4 A;  1J9I A;  3M1E A;  4HZF A;  3DPL C;  3FXU A;  2GAU A;  4PCQ A;  3EET A;  4I0A A;  5HVQ C;  2H27 A;  2D1H A;  3PQJ A;  3SHF A;  3TOA A;  2X0L A;  5AON A;  1KYW A;  4LK0 F;  4LK1 F;  4I98 B;  4MQ9 F;  1S8N A;  1T38 A;  3I64 A;  2WV0 A;  2DW4 A;  2D45 A;  3HSF A;  4ZYG A;  3FZV A;  2VBX A;  1XDU A;  1ULY A;  4B8X A;  5D5X B;  3RIR A;  3N97 A;  1EH6 A;  5HLH A;  3LQQ A;  1P6R A;  3WU1 B;  4NB5 A;  2HKO A;  1KU7 A;  3WE2 A;  3R0A A;  3RKY A;  1FT9 A;  4MEY F;  5H6R A;  2PMU A;  1YW8 A;  1OPC A;  2DK5 A;  2RGV A;  1BOA A;  2VT2 A;  2MC3 A;  2FF4 A;  4IHT A;  3EYI A;  3CO6 C;  2RVC A;  4OIQ F;  2CYY A;  3BOQ A;  3V8J A;  2JT1 A;  1XMA A;  4FT8 A;  1BC8 C;  2UXX A;  4M73 A;  4PDK A;  3TO9 A;  1TQI A;  3KP4 A;  3F6O A;  1Z1D A;  2K86 A;  4KA4 A;  1DDN A;  2OD5 A;  4U0Y A;  1YW7 A;  2D2W A;  3HTU A;  2MBF A;  1ZRD A;  1ZGA A;  4NHJ A;  2BYV E;  3TKY A;  5FLX Z;  1LJ9 A;  1W4M A;  1F1Z A;  3KP5 A;  2K02 A;  3IWF A;  1PP7 U;  3VEP A;  3FF5 A;  1ZG1 A;  2JSC A;  1ODD A;  3P9I A;  3L09 A;  2DPD A;  2IPQ X;  4I02 A;  2FNP A;  3RYR A;  2G7H A;  4L9N A;  1BI3 A;  3K9T A;  5DD8 A;  2L4A A;  3V7R A;  3NQO A;  4ENK A;  2ISY A;  3F23 A;  4N9H A;  2VC0 A;  4BNC A;  2NRA C;  2V1U A;  1HKQ A;  1QNT A;  1XSX A;  2ELH A;  4CXF A;  3F8F A;  2P4W A;  2EA2 A;  3O3K A;  1YO5 C;  2IJL A;  1RI7 A;  3FXQ A;  3E6C C;  3ZP5 A;  1D8K A;  2UXN A;  5E8I A;  3GXO A;  4CGZ A;  4EQQ A;  2Z9O A;  4LG0 A;  5LHH A;  3BY6 A;  3Q9V A;  3KP7 A;  2FBH A;  4S04 A;  1SD5 A;  2NNY A;  3WTU C;  1HSJ A;  5LRR A;  3CO7 C;  4LB6 B;  1CF7 B;  3FXR A;  3MZY A;  3V7S A;  3J81 K;  3T1B A;  3NRV A;  1P2F A;  2IA1 A;  3BZ6 A;  2YPR A;  4OOI A;  4YFN F;  1BC7 C;  1ON2 A;  2M87 A;  2CO5 A;  5FFX A;  2FE3 A;  2HDC A;  2KIU A;  3KZZ A;  2FRH A;  4GYI A;  4HOB A;  4Q47 A;  2Z3Y A;  5BQT A;  4ENN A;  2PI0 A;  2OA4 A;  5LHI A;  4U0V A;  4IF4 A;  4R1H A;  4RB2 C;  3F22 A;  1T0F A;  3ELK A;  2EFQ A;  1OKR A;  4LLN A;  1XCV A;  4OIP F;  3MQ0 A;  2P7V B;  3I0T A;  1J75 A;  1Y0U A;  3G3Z A;  5D5V B;  1G3W A;  5JFR A;  2P5L C;  3HRU A;  3HRM A;  2GXG A;  3F3X A;  2Z33 A;  2MD5 A;  2HOE A;  1LVA A;  3ECH A;  4XSX F;  1K6O A;  1R22 A;  5ERI A;  3PFI A;  4P9U A;  2F5D A;  3LWF A;  3MCZ A;  1FX7 A;  3MZH A;  3WE3 A;  4IRI A;  1LDD A;  1ZGJ A;  1MJA A;  4PGH A;  2FU4 A;  1HQC A;  3HHH A;  4ON0 A;  2HTS A;  4WK8 F;  3SZP A;  3WGI A;  4P5O A;  3FX3 A;  2L01 A;  4JBA A;  4HF2 A;  1LDK B;  4ESF A;  2VT3 A;  5EEG A;  3HIF A;  4KIG A;  1BM9 A;  3L00 A;  3QU3 A;  3M9A A;  2YSR A;  2Q0O A;  3RYP A;  4ZZD A;  4IPA A;  2XUB A;  5CVJ A;  5CYV A;  2PN6 A;  3HHG A;  1YS7 A;  4EJW A;  2GIV A;  1ZHF A;  1SD6 A;  2ESN A;  2AXL A;  4XBF A;  1KQ8 A;  4HX8 A;  1MJB A;  2A6H F;  4AWX B;  1KQ0 A;  1QGP A;  5H6Q A;  1P4W A;  1R36 A;  3F8M A;  5LEK A;  1REP C;  1LEB A;  3HSR A;  4A2U A;  2EFN A;  1TQP A;  4RGU A;  4UHT A;  2VOP A;  1D5V A;  3EDP A;  2KRF A;  4G6D A;  2PLY A;  1XGO A;  1BIB A;  5TJJ A;  1K78 A;  4G6Q A;  4MGR A;  4BXU A;  2NS0 A;  4EV0 A;  2LF7 A;  3K1N A;  4OMZ A;  3E5U A;  4RAY A;  5DCF A;  2QYO A;  4A5N A;  3KCC A;  4MEX F;  1IN4 A;  1AWC A;  4HDU A;  2V1X A;  2NAZ A;  2FXA A;  2LF8 A;  2PFB A;  5K5Q A;  1R7J A;  4HBL A;  4HF1 A;  2K7L A;  4BH9 A;  2CWE A;  2XKO A;  4FHT A;  2OZ6 A;  3GFI A;  3LAP A;  2GQQ A;  3ISP A;  3SQN A;  1YYV A;  4KN7 X;  1HXD A;  3N4M A;  3JAM K;  3CTA A;  6PAX A;  1TTY A;  1QZY A;  4MTE A;  2XGX A;  3I54 A;  4KN4 X;  1SMT A;  3ZMD A;  2BGC A;  1MJ9 A;  1FBS A;  2BBY A;  2O3F A;  2RQP A;  1JHH A;  3E6M A;  2Q2E A;  2IP2 A;  3MWM A;  3Q9S A;  3R4K A;  3DEU A;  5IT3 A;  2DLL A;  4HX4 A;  1U78 A;  1SMY F;  1ONV A;  1C0W A;  4KMU X;  1YQA A;  4KFC A;  3H92 A;  3IWZ A;  2DQL A;  1S3J A;  2A68 F;  2YX7 A;  5HDN A;  1U5T C;  1L3L A;  1FYL A;  3HTS B;  1QPM A;  4HAM A;  3BPV A;  1YS6 A;  1YIO A;  1B4A A;  1HKS A;  2EV6 A;  2O61 A;  4O3M A;  2A5Y B;  3I58 A;  1DP7 P;  1BBY A;  4M72 A;  3CUQ A;  3GLX A;  1P4X A;  2L4M A;  1G4D A;  4LD5 A;  4WXD A;  1ZRF A;  3WU0 A;  2H09 A;  3ZPL A;  2XKP A;  1K78 B;  1FSH A;  1LQ1 A;  3BRO A;  2DPU A;  1K79 A;  1FC3 A;  2GA2 A;  1J5Y A;  5L3D A;  4Z2Y A;  1ZAO A;  1TW3 A;  2R3S A;  3EQL F;  1EV7 A;  3R60 A;  2O6G E;  1P4A A;  3M8F A;  1QBJ A;  2V9V A;  4XSZ F;  4Q4Z F;  2XRN A;  1ZLK A;  1UST A;  3S2W A;  4UV9 A;  3LA3 A;  2KJC A;  2XAG A;  2WC2 A;  3TQN A;  5E17 F;  5DDG A;  4A0Z A;  5L3C A;  2W25 A;  4Y13 A;  5ILV A;  2XV4 S;  3RJP A;  1TBX A;  3DXJ F;  3I5U A;  4G9Y A;  3ZMZ A;  2DK8 A;  1U2W A;  3K0L A;  3R0J A;  3ZMT A;  4EM0 B;  4OIR F;  3V7C A;  5HOO A;  3J80 K;  2FBI A;  2MLG A;  4MNU A;  3E5Q A;  5D5U B;  4L9V A;  2WWY A;  5A2Q K;  1I5Z A;  1CF7 A;  4HV5 A;  5ICE A;  2GXB A;  3MAJ A;  4WXH A;  4CYD A;  4QWQ A;  4IRH A;  2NNN A;  2VON A;  1FNN A;  2Y75 A;  5IT9 Z;  1HBX G;  2YX4 A;  5L3G A;  2DQR A;  2FBK A;  1S29 A;  4EJO A;  4PZJ A;  5D6F A;  2KKO A;  4R79 A;  1L0O C;  5FFZ A;  2X4H A;  4RGS A;  1KU9 A;  5AIP A;  3F72 A;  3FM3 A;  2OQR A;  4I01 A;  1FZP B;  1WQ2 A;  3E6B A;  3WGH A;  3MEX A;  4EGY A;  1UCR A;  1WWX A;  2XAF A;  3D0S A;  4RS8 A;  5BMZ A;  1O7F A;  5E1Z B;  3SFZ A;  4ESJ A;  3CUQ B;  2K4B A;  1IN8 A;  5KK1 A;  1F5T A;  1J0R A;  1T98 A;  2GA1 A;  3U2R A;  4BHP A;  1Z7U A;  4ENJ A;  4XLP F;  3RDI A;  1FOK A;  5D8K B;  2M5W A;  4G8X A;  2F5E A;  1W5S A;  1ZN2 A;  3DKW A;  3RPU A;  2F2E A;  5LBQ A;  5ICF A;  2DU9 A;  4AD9 A;  4CDG A;  2A6E F;  4M9S A;  3JTG A;  4D0P A;  2ZJ2 A;  3ABT A;  1HST A;  1H0M A;  4L5I A;  2PG4 A;  3BPX A;  2F5C A;  1IN7 A;  1YTY A;  3RKX A;  3V8K A;  1YW9 A;  1KGS A;  1I27 A;  4U7B A;  3E3V A;  1KA8 A;  3F8N A;  2BEO A;  3GUD A;  2FOK A;  2EFP A;  1HKT A;  3HOS A;  3HRS A;  4GXO A;  2A07 F;  5CJ9 A;  2ZO4 A;  4L0Y B;  3LAJ A;  2CFX A;  1WKM A;  1T2K A;  2JZY A;  4A5M A;  1FYM A;  2XAH A;  5E1X A;  2R7D A;  4HQM A;  4B09 A;  4YFK F;  4XLN F;  5H20 A;  3HYI A;  4YG2 F;  2VN2 A;  2CG4 A;  2QLZ A;  2W24 A;  3WTV C;  4YII A;  3D5L A;  4GCV A;  4L0Z B;  1T6S A;  3W6K B;  1ZG5 A;  4I2O A;  3KEO A;  3AAF A;  1U8R A;  5FGM A;  2ZFW A;  5LHG A;  4L9T A;  2CW0 F;  1FP2 A;  3LA2 A;  3KLO A;  1Z91 A;  1R1U A;  3JW4 A;  2COM A;  3VOE A;  4RGX A;  2R7F A;  2JTV A;  3I59 A;  4AVP A;  4BAY A;  2VBW A;  3V4G A;  2HR3 A;  1B9N A;  1YG2 A;  2RC4 A;  1FSE A;  4YFX F;  2E1C A;  2STW A;  3WTZ A;  1TW2 A;  3O2P E;  3IKV A;  5LGT A;  3T8R A;  3KZY A;  4KNY A;  1BI1 A;  5HLG A;  3GFJ A;  4G7H F;  4M9Z A;  2STT A;  1SFU A;  1WI9 A;  1B59 A;  5E8G A;  5DV5 A;  1F9N A;  2MA3 A;  1OYI A;  4DNC A;  4A0X A;  2LDU A;  4HYE A;  3W6J B;  4DQ2 A;  2O0Y A;  1T39 A;  2H94 A;  3FMR A;  4UV8 A;  4RB3 C;  4UVC A;  3WGG A;  1DUX C;  1E2X A;  3H3Z A;  1W7P D;  2FMY A;  1GXP A;  5DUK A;  4WWC A;  2J5P A;  5DYM A;  2EK5 A;  3J7A O;  1IN6 A;  1MZB A;  4WCG A;  3M8E A;  1USS A;  4G94 A;  3DPT A;  1I1G A;  1W5T A;  4UVB A;  2VE8 A;  2M1B A;  1GVJ A;  1O3R A;  3DFG A;  1R00 A;  2FEZ A;  2EWN A;  4IJA A;  3L9F A;  3KP6 A;  2W57 A;  1U5T B;  3RPQ A;  1JHF A;  2LNB A;  1P92 A;  2CGP A;  1A04 A;  4Q48 A;  1I6X A;  3V8L A;  2AS5 F;  3JTH A;  2VOD A;  5HS9 A;  1V3F A;  3B02 A;  1G3S A;  1IXR C;  3J81 Z;  3CDH A;  2V6C A;  2QQA A;  4U88 A;  3ZN0 A;  2P5V A;  3VOD A;  3KE2 A;  2XVC A;  4FX4 A;  3LQR A;  4GYG A;  3F21 A;  2Z99 A;  4CHU A;  2MH9 A;  3I59 B;  3F8C A;  3ZMS A;  2XHK A;  3I71 A;  3ZQ7 A;  1WRJ A;  5EEH A;  4I0B A;  4ASN A;  2ZME B;  4EJU A;  3I53 A;  4XRF A;  4Y15 A;  1LEA A;  3ECO A;  1W7P A;  1O7L A;  4JK1 X;  1XB4 A;  4U0W A;  5FO5 A;  1ZH5 A;  3GX4 X;  2IRF G;  2VC1 A;  1ON1 A;  1HW1 A;  1G3T A;  3E6D A;  2NYX A;  1XSV A;  4F7Z A;  1PDN C;  5KVR A;  2GZW A;  1BI0 A;  2WTE A;  1R5G A;  2CSO A;  2YU3 A;  1CGP A;  2QBY A;  5CVV A;  1O3S A;  1NHA A;  2ZBK A;  5HS7 A;  3VFZ A;  2A69 F;  5D5W B;  2ZNY A;  2ESH A;  2OBP A;  3ZMU A;  3KLN A;  3CUO A;  1TNT A;  2P7C B;  2A61 A;  2QQB A;  1S6L A;  4P9F A;  1LB2 A;  5AIQ A;  1UB9 A;  3F6V A;  2IVM A;  2ZCW A;  3QAH A;  5CVI A;  3COA C;  3WTS C;  3TO6 A;  5FLX K;  1J2X A;  3IL2 A;  3KEQ A;  4Q5S F;  2H6B A;  4UNO A;  2Y0M A;  5JI6 A;  4IXA A;  5ICG A;  2DAO A;  1IZ1 A;  3QP5 A;  5FB2 A;  3FMQ A;  1SAX A;  3E5X A;  3TO7 A;  3WTY C;  1EH7 A;  1ZLJ A;  4O6J A;  3O6B B;  4EJV A;  4R8H A;  3QOP A;  1FLI A;  3GVA A;  3ABU A;  2RV8 A;  1LDJ A;  1J7K A;  2XAQ A;  4KIB A;  4M71 A;  1FBU A;  4HF0 A;  4L18 B;  4E70 A;  1IW7 F;  1XDS A;  2EA4 A;  3GWZ A;  1D3Y A;  4LJZ F;  2ZNZ A;  4EGZ A;  1GXQ A;  1PUE E;  4MHG A;  3KFW X;  2YR2 A;  4PGG A;  4RB0 A;  4A6E A;  2UWM A;  3LA7 A;  5HDK A;  5K1Y A;  3R6S A;  4MTD A;  2EFW A;  1XN7 A;  1OMI A;  2H6C A;  1BIA A;  3ZN1 A;  2E7W A;  3RKW A;  1K7A A;  2FQ3 A;  1W7P B;  4ZYD A;  2HQR A;  3WTT C;  1TNS A;  2PEX A;  3K69 A;  2Q8K A;  1IAW A;  4A12 A;  3ROU A;  1OYY A;  5DCM A;  2QM3 A;  5JHU A;  4G7O F;  1GHC A;  1R23 A;  2L02 A;  1IF1 A;  2QBY B;  1FPQ A;  5E1W A;  4M6Y A;  5L3F A;  2V1D A;  2IA0 A;  2BE5 F;  2CQK A;  3LFK A;  4P55 A;  2PQ8 A;  2ISZ A;  4M6X A;  3EUH A;  4A6D A;  1DPU A;  4FX0 A;  1ZYR F;  3L2C A;  4G7Z F;  3ML6 A;  3U9G A;  4N0B A;  2J5O A;  3JAM Z;  3HUG A;  1JGS A;  5FD6 A;  3BJA A;  3JSO A;  4N9I A;  2MH2 A;  4OU0 A;  3REO A;  5CLS A;  4P96 A;  5HS8 A;  5D8L B;  5LGN A;  2M8E A;  4YIF A;  2ZKZ A;  5D6E A;  4ETS A;  2QEN A;  2Z5U A;  2JPC A;  3VB2 A;  3HSE A;  4IVN A;  4OMY A;  1BI2 A; 
#chains in the Genus database with same CATH topology
 2HDD A;  5DM6 F;  2DI3 A;  3G73 A;  2P5K A;  1LE8 A;  2YUS A;  4ZYH A;  2CV1 A;  2LK2 A;  5F6F A;  1Y6I A;  3FHN A;  4F91 B;  4BEH A;  1VTN C;  3S15 J;  5KAF C;  5DEQ A;  3MKW B;  2HOT A;  4UVA A;  4KMF A;  3IUO A;  5D4S A;  5CQE A;  2FUG 2;  5KNL A;  3P7N A;  4D5F A;  1JXS A;  4HLY A;  4M74 A;  5J6X A;  3QPT A;  3CJR B;  3P9C A;  2VJI A;  1G8X A;  5CPR B;  3GME A;  3K4N A;  4JP0 A;  4CYC A;  2L9N A;  5LEJ A;  1G59 A;  3LMM A;  2V79 A;  4YEJ A;  2P6T A;  3QRF F;  4OIN F;  3D5R C;  3IHU A;  3OYH A;  3B6C A;  3VYS B;  2VUM J;  3K1M A;  3EYY A;  3A02 A;  1XGN A;  3TP0 A;  3MFK A;  1SFK A;  2GBY A;  4I6Z A;  2JJ7 A;  2FA5 A;  1Z6R A;  4G6T B;  1VQ4 I;  4HQE A;  4NBQ A;  2L9V A;  1V5E A;  4RM2 A;  1M1E B;  1Z6T A;  1IUY A;  2JWT A;  2IW5 A;  5L3E A;  2EV0 A;  4OMY A;  2RN7 A;  1RR8 C;  1I1S A;  2QKL B;  4HV6 A;  1YOV B;  2LY2 A;  3BG5 A;  3SDB A;  1MKM A;  4ANJ A;  1FY7 A;  4WX9 A;  3KP3 A;  1JT6 A;  2G7U A;  2CQ7 A;  3E7L A;  3CCS I;  3GW2 A;  2E5N A;  4I7H A;  3WU2 C;  2ZXJ A;  5M3M J;  1HW2 A;  1TZL A;  2L7M P;  3HRT A;  4ENM A;  1AHD P;  5GTI C;  5GPC A;  3GEZ A;  4UUS A;  2QVO A;  1TLH B;  2LP0 A;  1SFO J;  3DV8 A;  1TWG J;  2AQF A;  4RAF A;  2BHZ A;  4EM2 A;  1TQM A;  2CMP A;  4IOA F;  1E17 A;  3KET A;  1X1B A;  5DCM B;  1ETY A;  3TED A;  4DW6 A;  4EMS A;  3T5X A;  4BQN A;  3E97 A;  4AC0 A;  3MD2 A;  3L7W A;  3HOT A;  2HFH A;  3BJO A;  4BHC A;  2DDA A;  1Z05 A;  4A0Y A;  1QO0 D;  3GFM A;  2JN6 A;  4DYR A;  2DTR A;  2F4M B;  2GWR A;  5F0H A;  2VAS A;  2W1O A;  3AL0 B;  5K5R A;  5JR3 A;  2RNJ A;  1IXS B;  3C7J A;  1KQ9 A;  3CMM A;  4DOZ A;  4E7H A;  1AU7 A;  4XLF A;  1O3Q A;  4MFE A;  3AG1 H;  1Z9C A;  3VSK A;  3TOB A;  3PO2 J;  4BDZ A;  3TGN A;  2L7K A;  2LH9 A;  2VBY A;  2W84 A;  5HDG A;  1D0Z A;  2B0L A;  1AKH A;  3CME I;  3B73 A;  1Z77 A;  4KIF A;  4TV7 A;  2V6E A;  1U5T A;  4GDF A;  2DJI A;  4BBR J;  3IRQ A;  1XGM A;  1R58 A;  3HUG B;  1XGS A;  3OOP A;  5ICC A;  5HLI A;  2OU2 A;  3QYB A;  3WTX C;  3I55 I;  2VLA A;  2F4O B;  3J80 Z;  4DGW B;  1XSD A;  1MGT A;  1EH8 A;  1LNW A;  1ZG3 A;  3DU5 A;  2X48 A;  2OPT A;  2ACJ A;  3KP2 A;  2XAJ A;  3GZ5 A;  5A2Q Z;  4AIJ A;  1QZZ A;  4I76 A;  2M34 A;  3LST A;  4UXN A;  1MDM A;  1HOM A;  2CQX A;  2QZ8 A;  3P9K A;  4OWR B;  1FWZ A;  3DF8 A;  2HKX A;  5FKO A;  1S7A A;  3CUQ C;  3ZQG A;  3Q5F A;  2C6Y A;  1RZ4 A;  3BWG A;  3FWE A;  2XIG A;  3DKX A;  4LLG F;  2HGC A;  1MD0 A;  5E20 A;  4CIC A;  1XD7 A;  2LSO A;  2QUF A;  2F5F A;  3G4S I;  2VXZ A;  3OMY A;  3WG9 A;  4L9J A;  4EVI A;  3HGY A;  4ITV A;  1YLF A;  1G3Y A;  1FOW A;  3T0Y A;  2CW8 A;  1LE8 B;  2E1O A;  3S14 J;  3CCU I;  2RKH A;  4XON A;  4BEH B;  4NQW A;  1FBQ A;  3K1P A;  5BOX A;  1FP1 D;  1U6G A;  2WBM A;  1W1W E;  2ZME A;  2XRO A;  2M45 A;  3HXL A;  4AYB A;  4I09 A;  4LB5 A;  2NVQ J;  4LGW A;  4N4N B;  5BPI A;  2MYS A;  4XK4 A;  1O4X A;  2DFI A;  4KIS A;  3H3V K;  2LKP A;  4OAY A;  4BAC A;  3G71 I;  5D4R A;  2BV6 A;  3JSP A;  1R1T A;  3I4P A;  4MIM A;  3CCL I;  1IRG A;  2IXS A;  3K2Z A;  1H9G A;  4CYC B;  3ZMV A;  1MH4 A;  1HW5 A;  1Y8Q B;  2HOA A;  1XPX A;  5LD2 C;  4BHB A;  2DBB A;  4NDL A;  4IO9 F;  1WFX A;  3BCA A;  2ECC A;  4L5E A;  1MBK A;  1KYZ A;  2VPL A;  2CUE A;  4AYB N;  2O8X A;  2GLO A;  4AIH A;  3JRC A;  3GZ6 A;  1QHH D;  1VQP I;  4FCY A;  1SD4 A;  4C3I J;  2HYJ A;  3K4M A;  4IZZ A;  3NWS A;  1ZRC A;  2IS1 A;  3F9K A;  3GTM J;  3M4O J;  4GO1 A;  4AVZ A;  2ETH A;  4QTR A;  4KUM A;  1RNL A;  2VJ4 A;  3S1M J;  3VWB A;  4IQJ A;  1S7O A;  1AA7 A;  5KCM A;  3GYH X;  4HDV A;  2DXI A;  3GTG J;  3R61 A;  3CJN A;  5BS6 A;  1Z21 A;  3MN2 A;  1LFB A;  1MMG A;  4KT6 A;  4WF2 A;  4UUS B;  2O9L A;  2XF6 A;  5DS9 A;  5F1R A;  5F64 A;  2ZJQ F;  4A3K J;  1FEX A;  4Y17 A;  4IHW A;  3CD6 I;  5IYD J;  3IKT A;  4PJM A;  2ME6 A;  3IRR A;  2W4S A;  3JRH A;  4RB1 A;  2XDV A;  3HL2 A;  4ABZ A;  2VBZ A;  4ZH4 F;  1OYW A;  5F0C A;  1S72 I;  3OY9 A;  3WHB A;  4FQG A;  5FD5 A;  1IN5 A;  1SFE A;  3MMY B;  3C18 A;  4KT5 C;  2OAZ A;  1IGN A;  5BPD A;  3GFL A;  2VOO A;  3QP6 A;  2VPR A;  4RGR A;  5JLX A;  2P6S A;  1UHW A;  3C2B A;  4M3G A;  5LGU A;  3RZO J;  5J8C A;  4LG0 B;  2NOG A;  2KMU A;  1WSU A;  2E1N A;  4ZYE A;  3U21 A;  2CH0 A;  1Y8R B;  3W6V A;  1U3E M;  2L9R A;  1A31 A;  1WH7 A;  3A0B C;  1RUO A;  5HNH A;  1FTT A;  3BJ6 A;  3KYC B;  5L3B A;  1Y0N A;  5ILU A;  1KU3 A;  4XOR A;  1W5C C;  3UKG A;  4FAS D;  1A35 A;  5DUI A;  1XX5 A;  2I10 A;  1AKH B;  4C3J J;  2LR8 A;  4JX6 A;  2PJP A;  2KIF A;  3OYB A;  1YRN B;  4BQO A;  4EJT A;  2IGM A;  3T8T A;  4OIO F;  5F08 A;  4WXC A;  4CO8 A;  1Z67 A;  3O8H A;  4AIK A;  3RTR A;  1B6A A;  1KU2 A;  1O57 A;  1Q1V A;  3GTJ J;  1AOY A;  4U7D A;  4A3F J;  2EV5 A;  1MDM B;  3FHZ A;  3DQV C;  1N78 A;  2DN0 A;  1SD7 A;  3U1D A;  4XNF A;  3K4J A;  1X3U A;  1B1B A;  2LRD A;  4ESB A;  5LLQ A;  2R0Q C;  2IT0 A;  2EH3 A;  5E18 F;  5HOD A;  2TDX A;  3CCY A;  4K2E A;  2PJR B;  2DO7 A;  3CLO A;  4XRS G;  1YFH A;  2CV2 A;  4LMY A;  2HYF A;  4HA8 A;  3LOC A;  3SZT A;  4P1W A;  2KIS A;  2RDP A;  1T56 A;  4JQF A;  1UFM A;  3OWT A;  1B9M A;  3W2W A;  3CMY A;  4O5V A;  2IS4 A;  1JKP C;  2NS7 A;  3DEE A;  5EZH A;  5FLV A;  2EZK A;  4ZZL A;  2XAS A;  4NQW B;  4C3H J;  3SXY A;  1F4K A;  3FKI J;  4RA2 A;  2HZT A;  2HTJ A;  3M07 A;  2O03 A;  3WOD F;  4KIC A;  1FJL A;  2MLK A;  2HS5 A;  3OV8 A;  2K27 A;  4A3D J;  2LMD A;  1YX5 A;  4H0E A;  3HKZ N;  2JPB A;  2QWW A;  3QPH A;  2L9S A;  1V4R A;  2UZK A;  5EG0 A;  2R7V A;  3HOX J;  2M30 A;  3GF2 A;  1XMK A;  1ZKG A;  1SFX A;  2FML A;  3A4C A;  4RAZ A;  1X3Z B;  1K4T A;  4M9X A;  1UHM A;  1D8J A;  2KHM A;  3C1D A;  3S1R J;  1DPR A;  1TC3 C;  3IH2 A;  4BYY A;  2E7X A;  1H9T A;  4FIS A;  2G9W A;  3QU6 A;  5DD4 A;  3ULQ B;  3LSK A;  5IT9 K;  4IHS A;  4XMY A;  4KYW A;  2KIM A;  2LBF A;  2HVQ A;  5ED4 A;  4XRM A;  3HEF A;  3PFY A;  1J59 A;  2B63 J;  1HLV A;  5CVU A;  1UJ8 A;  3AKZ A;  2EB7 A;  2JVG A;  2HWV A;  2QCO A;  1ETK A;  1SAU A;  1QVU A;  2W85 A;  4CZZ A;  3V42 A;  3WTW C;  2GOM A;  1VQK I;  3ZR8 X;  5JVT A;  2Z1D A;  3FXJ A;  2HU9 A;  2PMH A;  1ZRE A;  3H9Q A;  1NH3 A;  2HQN A;  1MIJ A;  2A3S A;  2HYG D;  4W97 A;  2QQ9 A;  2P8T A;  3LSI A;  4XM3 A;  2DA4 A;  1Z3Y A;  2VE9 A;  4BXF A;  3ERE D;  1NG7 A;  2O7O A;  5LRS A;  2FNA A;  4HLX A;  3IP4 B;  4HW0 A;  1S9H A;  1VQO I;  2LFB A;  2Y48 A;  2DT5 A;  4L5J A;  4ZJZ A;  3F8B A;  3GO5 A;  3ZOB A;  2H1K A;  4UUV A;  2OZU A;  1EKE A;  5J8F A;  4MQV A;  2L54 A;  1STZ A;  3IC7 A;  3C3W A;  2XPV A;  2D1V A;  5KAI C;  1WCM J;  2HEO A;  1BJA A;  1ETX A;  1XCB A;  1DP3 A;  3K6G A;  2HQA A;  4QLC U;  1OR7 A;  3PQK A;  1ZAR A;  2CFO A;  4CCM A;  2DMP A;  4GGG A;  3HPG A;  1X1D A;  1HDD C;  5TRD A;  3NEU A;  2E19 A;  5E3O A;  2VJJ A;  2L3D A;  5J1Y A;  2F5V A;  2FSW A;  2X1D A;  3AG2 H;  1T33 A;  2BHY A;  3TDZ C;  5K5O A;  3H3U A;  3M7G A;  3RSN A;  1IXC A;  4S05 A;  2CU7 A;  4LFU A;  3BP8 A;  2OQG A;  2CV0 A;  2CUZ A;  2PBI A;  3HOW J;  2ZB9 A;  2RAE A;  2IA2 A;  1Y39 A;  1Q1H A;  3DP7 A;  1G6N A;  5C4J J;  1RUN A;  3BTJ A;  5JHF A;  4IX7 A;  2XAU A;  2ADU A;  5FKL A;  4BQA A;  3TDU C;  4KDP A;  4HX7 A;  1PP8 F;  1IRF A;  3FMS A;  2EJR A;  5B1B H;  4IRG A;  3FM5 A;  2HXO A;  4E4H A;  1R5H A;  5IY5 H;  1OFC X;  1RIO H;  4M6V A;  5ILS A;  1FYK A;  2R7T A;  3M1C A;  2EFO A;  1X58 A;  1R1V A;  1IDY A;  4BUP A;  2A6T A;  3W2A A;  1TWF J;  2JRT A;  2KZV A;  5CVR A;  5TGT A;  1BN5 A;  1O3T A;  2KJB A;  4ZDP A;  2RRE A;  1QQI A;  2KZG A;  1JE8 A;  3ZQI A;  5IP6 A;  2K4J A;  4LLL A;  2CS3 A;  3BDD A;  4A69 C;  3L2R A;  5FKN A;  3MVP A;  2IS2 A;  4EM1 A;  3RI4 A;  1J9I A;  1SVL A;  1MBG A;  3M1E A;  3QPS A;  4HZF A;  3DPL C;  3FXU A;  5TIS C;  3Q3S A;  4A3M J;  1NTC A;  2WAF A;  2GAU A;  1T95 A;  4PCQ A;  3EET A;  4I0A A;  5HVQ C;  3DTK A;  5EG0 B;  2H27 A;  2D1H A;  2R5Y B;  3PQJ A;  3SHF A;  3TOA A;  3HM5 A;  2OUM A;  2X0L A;  5AON A;  1KYW A;  2LY9 A;  2TRT A;  2PMZ A;  4LK0 F;  2MFZ A;  4LK1 F;  4I98 B;  4J00 A;  3IAS 2;  2R7X A;  2LC2 A;  4MQ9 F;  5EDN A;  2XC7 A;  1BW5 A;  1S8N A;  1T38 A;  3I64 A;  2WV0 A;  2DW4 A;  2K9S A;  4QSH A;  5J1U A;  3OS0 A;  2D45 A;  2KRH A;  2LBF B;  1BJZ A;  1IO2 A;  3HSF A;  4ZYG A;  2JA8 J;  4BE1 A;  2ZC2 A;  3FZV A;  2VBX A;  1XDU A;  2JK3 A;  3OR1 C;  1ULY A;  2X6W A;  2MAB A;  4B8X A;  1FIA A;  5D5X B;  3RIR A;  3VYR B;  2PMZ N;  3N97 A;  2EPF A;  1EH6 A;  1MSF C;  2W48 A;  3RPU D;  1ITY A;  5HLH A;  1VQL I;  3LQQ A;  2E1M C;  5IP9 J;  1P6R A;  3WU1 B;  1JJ8 C;  2LLK A;  2JMW A;  4NB5 A;  2HKO A;  1VF9 A;  2DA3 A;  5K7H A;  1HF0 A;  3BTI A;  3WE2 A;  1KU7 A;  3M3Y J;  3R0A A;  3RKY A;  5H2F C;  2XGE A;  1JUS A;  5IYB J;  3BR2 A;  4A3B J;  1FT9 A;  3CJQ B;  4MEY F;  2OCC H;  4E6K G;  3L2V A;  5H6R A;  3J7Y J;  2QEX I;  5B66 C;  1ETQ A;  2PMU A;  1YW8 A;  1OPC A;  4BDY A;  3CZ6 A;  2HVR A;  3TW7 A;  2DK5 A;  2XPU A;  2ZSI B;  2RGV A;  1BOA A;  2VT2 A;  2Y9Z A;  2MC3 A;  2FF4 A;  3ZQQ A;  4IHT A;  3EYI A;  3CO6 C;  1ETW A;  4BE0 A;  2RVC A;  2E2J J;  1BOB A;  4B43 A;  3CC2 I;  2CYY A;  4OIQ F;  2DMT A;  3BOQ A;  1D1B A;  2JQ7 A;  2LRE A;  3V8J A;  5F1J A;  2JT1 A;  2RNG A;  4HNT A;  1XMA A;  4FT8 A;  4XID A;  2JUG A;  3CDI A;  3H36 A;  4LG3 A;  3OYI A;  1BC8 C;  1QA6 A;  2UXX A;  3AG4 H;  4FTH A;  2VKE A;  4M73 A;  2Z2S B;  3EUK L;  4PDK A;  3TO9 A;  1TQI A;  3KP4 A;  1LVK A;  3F6O A;  1Z1D A;  2K86 A;  4KA4 A;  1Y1V J;  1DDN A;  2OD5 A;  1RPW A;  1W0T A;  4U0Y A;  3I3L A;  3OYG A;  1YW7 A;  2D2W A;  3OYJ A;  2CJJ A;  3HTU A;  2MBF A;  1N25 A;  1ZRD A;  1ZGA A;  4NHJ A;  4DJA A;  3CC7 I;  2BYV E;  3TKY A;  5FLX Z;  3BR3 A;  1LJ9 A;  1W4M A;  2JA2 A;  1HA8 A;  1F1Z A;  3KP5 A;  4RAG A;  3H5N A;  4LOC A;  1R49 A;  2K02 A;  3IWF A;  1PP7 U;  2QSH X;  3HG9 A;  5EGO B;  3VEP A;  3FF5 A;  1ZG1 A;  2JSC A;  3LSH A;  1ODD A;  3P9I A;  2EZH A;  3L09 A;  4KJZ A;  2DPD A;  3D1N I;  1FOX A;  2IPQ X;  4I02 A;  2FNP A;  1ORK A;  4ZYA A;  5IYC J;  4HST A;  1D0X A;  3RYR A;  2A5W A;  2EIJ H;  2G7H A;  2E60 A;  3HOU J;  2BY3 A;  4L9N A;  4MO7 A;  2Q1Z B;  3VYT B;  2DMU A;  1XC5 A;  3TBI A;  1BI3 A;  2ZXI A;  3K9T A;  5DD8 A;  1LPQ A;  2L4A A;  2X85 A;  4XKB A;  3V7R A;  2OTL I;  3NQO A;  4ENK A;  2ISY A;  4V19 K;  1K4S A;  3F23 A;  1VND A;  4N9H A;  2VC0 A;  3P5J A;  2NRA C;  4BNC A;  2V1U A;  1HKQ A;  3DU6 A;  1QNT A;  1XSX A;  2ELH A;  4CXF A;  1NK2 P;  2BY0 A;  3FIS A;  1E0E A;  2Y0S A;  3MKL A;  2VKH A;  1GLN A;  2DOE A;  3F8F A;  3MZ8 A;  4IL6 C;  1G2H A;  4E7J A;  2P4W A;  2EA2 A;  3FIW A;  3O3K A;  1YO5 C;  2IJL A;  1RI7 A;  2KPM A;  3FXQ A;  3E6C C;  1JKR C;  2DCE A;  1D8K A;  2UXN A;  3ZP5 A;  2V9P A;  3ASO H;  2M7B A;  5E8I A;  5FRN A;  3GXO A;  4CGZ A;  4NUB A;  2P81 A;  4EQQ A;  2Z9O A;  1U9O A;  1Y1W J;  5C4X J;  4LG0 A;  3VYU B;  5LHH A;  3BY6 A;  3Q9V A;  3KP7 A;  2FBH A;  1WGX A;  4S04 A;  2F6C A;  1SD5 A;  2MW8 A;  3RKQ A;  1MND A;  2KDO A;  2NNY A;  3PIO F;  3WTU C;  2IEK A;  1HSJ A;  2MD0 A;  4DBR A;  5LRR A;  3Q0U A;  2OV7 A;  3HDD A;  3CO7 C;  2YU9 J;  4LB6 B;  2CUJ A;  1CF7 B;  2R92 J;  1I50 J;  2IAI A;  3FXR A;  5J4V A;  3MZY A;  4J19 A;  3GBG A;  1APL C;  3V7S A;  2F48 A;  1YRN A;  3J81 K;  3E0J B;  2LY1 A;  3T1B A;  2VKV A;  4IHX A;  2Y9Y A;  3FXO A;  2IGK A;  1RC9 A;  3NRV A;  1UHS A;  3K7A J;  1P2F A;  1GDT A;  2ZXW H;  2IA1 A;  5F04 A;  2PX9 A;  3OSG A;  3BZ6 A;  2YPR A;  3O8G A;  4OOI A;  2DFH A;  4Y7N J;  1GT0 C;  4YFN F;  4DZJ A;  1SEU A;  1BC7 C;  3JR9 A;  4XLC A;  1ON2 A;  2M87 A;  3TMO A;  3CQZ J;  2CO5 A;  5FFX A;  2FE3 A;  3KYD B;  2OJE D;  3OYC A;  2HDC A;  2KIU A;  3KZZ A;  5EEA A;  2MSY A;  1YI2 I;  2FRH A;  2UUZ A;  1JGG A;  4GYI A;  5E79 C;  4HOB A;  4Q47 A;  2HXI A;  2Z3Y A;  2PJR A;  5BQT A;  4ENN A;  4XLH A;  2PI0 A;  2OA4 A;  5LHI A;  4U0V A;  2O8K A;  1MMD A;  4IF4 A;  2JVH A;  4R1H A;  4RB2 C;  1T0F A;  1WH5 A;  3F22 A;  1QHG A;  3ELK A;  2K85 A;  3GTO J;  2EFQ A;  1OKR A;  2BXY A;  1KZH A;  1XCV A;  3HC7 A;  3H35 A;  4LLN A;  4OIP F;  3OR2 C;  2LD5 A;  2DFE A;  3MQ0 A;  2P7V B;  3I0T A;  1J75 A;  1Y0U A;  4FE4 A;  3G3Z A;  3S16 J;  1OLT A;  1E3O C;  2M3A A;  5D5V B;  1G3W A;  5JFR A;  2BVM A;  2P5L C;  3SJM A;  1YJN I;  3HRU A;  1D1C A;  4BJ6 C;  4E7Z A;  3HRM A;  4LIV A;  4PJL A;  3DKY A;  2R5Z B;  2GXG A;  1KON A;  2ELJ A;  2H8W A;  3F3X A;  3L1P A;  2Z33 A;  2MD5 A;  1WJE A;  1WJ5 A;  2HOE A;  3K70 C;  3DEW A;  3HOZ J;  1EJ9 A;  1LVA A;  3ECH A;  4IKF A;  4ZDO A;  4XSX F;  3I9V 2;  3S93 A;  1VQ6 I;  1K6O A;  3QYE A;  2DA7 A;  1R22 A;  5ERI A;  2AQE A;  3PFI A;  4P9U A;  4BJ5 C;  2EIK H;  2F5D A;  3BCB A;  2DOA A;  3LWF A;  3MCZ A;  1FX7 A;  3MZH A;  3WE3 A;  4IRI A;  1LDD A;  1WZ2 A;  1EA3 A;  1YJ9 I;  1ZGJ A;  1MJA A;  2AXT C;  2LYC A;  4PGH A;  2FU4 A;  4IEJ A;  4UY8 I;  4B44 A;  5J40 A;  4KIT B;  1HQC A;  3HHH A;  4ON0 A;  2HTS A;  2K9L A;  1ACI A;  4WK8 F;  3SZP A;  2CQQ A;  2XRL A;  3WGI A;  4P5O A;  3FX3 A;  3GTK J;  2L01 A;  4JBA A;  2QA4 I;  4HF2 A;  1LDK B;  4ESF A;  2VT3 A;  5EEG A;  1FMV A;  3AL0 C;  3HIF A;  1JTY A;  4KIG A;  3LSR A;  2DA1 A;  1BM9 A;  3L00 A;  3QU3 A;  3M9A A;  4BXX J;  2DA2 A;  3PNT A;  3OS2 A;  2YSR A;  3EUH C;  2Q0O A;  3RYP A;  4C30 A;  4QIW N;  4ZZD A;  1EF4 A;  4IPA A;  1DGR M;  1VZ0 A;  2XUB A;  3F0C A;  4BL0 B;  5CVJ A;  4AID A;  2B7E A;  4DYC A;  4NC8 A;  5CYV A;  3CJT B;  4RLF A;  2KQR A;  2N8G A;  2PN6 A;  3DWL E;  3HHG A;  4EEF G;  1WHU A;  4F52 A;  2M0M A;  1YS7 A;  4FE7 A;  2CW7 A;  4EJW A;  2LKS A;  3OYA A;  2QF7 A;  2GIV A;  3BQZ A;  1SD6 A;  1ZHF A;  2ESN A;  4Y33 A;  1VQ5 I;  1SAN A;  4HPQ A;  2AXL A;  4XBF A;  1KQ8 A;  3L2Q A;  1B8I B;  4PFP A;  4B3X A;  4HX8 A;  1V5G A;  3ZGK A;  1S7E A;  3CCM I;  1MJB A;  2A6H F;  4AWX B;  1MBJ A;  1KQ0 A;  1QGP A;  5H6Q A;  1P4W A;  1R36 A;  4IHY A;  3F8M A;  3QPL A;  5LEK A;  1REP C;  3ZRG A;  2MG4 A;  1LEB A;  3BG6 A;  3HSR A;  4A2U A;  2EFN A;  2GIZ A;  1SVM A;  4PSX A;  1D1A A;  1TQP A;  4HEA 2;  4XLA A;  4RGU A;  4UHT A;  4YEL A;  5IOZ A;  2VOP A;  1D5V A;  2O5R A;  3EDP A;  3CDL A;  2KRF A;  4G6D A;  4ZC3 A;  5FRM A;  3HOY J;  2PLY A;  1XGO A;  3CCQ I;  3S8P A;  1BIB A;  2GM4 A;  4B47 A;  5TJJ A;  1K78 A;  2LTP A;  2ME0 A;  1OQY A;  4G6Q A;  2ID6 A;  3BG3 A;  2I5U A;  4MGR A;  4BXU A;  2NS0 A;  4EV0 A;  4X6A J;  2R7O A;  2LF7 A;  3K1N A;  2IGN A;  4OMZ A;  1K61 A;  1FOY A;  3FK7 A;  3E5U A;  4RAY A;  5E3L A;  5DCF A;  2QYO A;  2DYS H;  1K6Y A;  4XKC A;  3SEZ A;  4A5N A;  3KCC A;  4MEX F;  1IN4 A;  1AWC A;  4HDU A;  3ZCO A;  5IOY A;  1BR4 A;  3L2U A;  3BTL A;  3CF5 F;  2BOL A;  2X1C A;  3W2V A;  2R5Y A;  1MBF A;  3S3N A;  1PYV A;  4RM3 A;  2V1X A;  2NAZ A;  2FXA A;  3IH4 A;  3OIQ A;  1JKQ C;  2LF8 A;  1X19 A;  2PFB A;  5K5Q A;  4BE2 A;  2NXN B;  2R93 J;  2ZXH A;  3FXM A;  1R7J A;  4HBL A;  4AU7 A;  2K7L A;  4HF1 A;  2M0C A;  4IVN A;  4M3D A;  1OIS A;  2JA5 J;  4BH9 A;  2CWE A;  2FQ4 A;  2KT0 A;  2XKO A;  4FHT A;  3S17 J;  5FKM A;  5B5E C;  1JKO C;  2OZ6 A;  3GFI A;  3LAP A;  5FRO A;  2GQQ A;  3ISP A;  3SQN A;  1YYV A;  4GRI A;  1LKX A;  4KN7 X;  1HXD A;  3OSF A;  3N4M A;  1YE9 A;  3JAM K;  3CTA A;  6PAX A;  1TT5 B;  5M5W J;  1YJW I;  1MBE A;  1TTY A;  3DCF A;  3MKZ A;  1QZY A;  3NAR A;  4MTE A;  2XGX A;  3I54 A;  4A3C J;  4KN4 X;  2NVY J;  1ZR2 A;  4F3Q A;  1SMT A;  3ZMD A;  2BGC A;  1MJ9 A;  1FBS A;  2BBY A;  2O3F A;  2RQP A;  2KIQ A;  3K10 A;  1JHH A;  3E6M A;  2Q2E A;  2IP2 A;  4BKX A;  1LFU P;  3MWM A;  3Q9S A;  4J01 A;  3R4K A;  3DEU A;  3BG9 A;  4JOM A;  1IJW C;  1DU6 A;  5IT3 A;  2DLL A;  1K83 J;  4HX4 A;  1U78 A;  1SMY F;  1ONV A;  3CCJ I;  1ZTR A;  1C0W A;  4KMU X;  2KLO A;  3WG7 H;  1YQA A;  4KFC A;  5C44 J;  3ASN H;  3H92 A;  3IWZ A;  1I39 A;  2DQL A;  1YHQ I;  3K70 D;  1W0U A;  2BW3 B;  1S3J A;  4RLQ A;  2A68 F;  1T08 B;  1UAA A;  2YX7 A;  5HDN A;  2VQG A;  1U5T C;  3CF2 A;  1L3L A;  3C2G A;  1FYL A;  2VQC A;  3HTS B;  1QPM A;  4HAM A;  3BPV A;  2EZI A;  5K7F A;  3SDG A;  1X1C A;  3QYF A;  3WHC A;  3DBL B;  3K2A A;  1YS6 A;  3IH3 A;  4A3J J;  2L5Q A;  3CCV I;  5J47 A;  3UR3 C;  1YIO A;  2JUC A;  4M3F A;  4D5C A;  4CCL A;  1RES A;  3PL8 A;  1B4A A;  1HKS A;  2EV6 A;  1JTX A;  2O61 A;  4O3M A;  3S3M A;  1RKW A;  2DDB A;  1WI3 A;  2A5Y B;  3I58 A;  1MNM C;  1DP7 P;  1BBY A;  1X3W B;  4H4K C;  4M72 A;  4XR6 A;  3CUQ A;  1R5I D;  2FD5 A;  1YIJ I;  3GLX A;  1P4X A;  4MLO A;  2L4M A;  2QSG X;  2M2E A;  1G4D A;  3OYL A;  4LD5 A;  4WXD A;  3OL3 A;  3OYE A;  3TW6 A;  1VQN I;  1XS9 A;  4JX4 A;  1ZRF A;  2V1N A;  2OC6 A;  3WU0 A;  5EGO A;  1D5Y A;  1IDZ A;  2H09 A;  3LL7 A;  1JUP A;  5M5Y J;  4CCO A;  3PM1 A;  3ZPL A;  2XKP A;  1K78 B;  1FSH A;  2ZME C;  1LQ1 A;  1MNE A;  2DFF A;  2R7U A;  3BRO A;  2DPU A;  1K79 A;  1FC3 A;  5BNG A;  1XMX A;  2VI6 A;  2GA2 A;  2E2I J;  1J5Y A;  4B4C A;  3BG7 A;  3LSM A;  5L3D A;  2KFD A;  4Z2Y A;  1ZAO A;  3VSL A;  3RZD J;  1TW3 A;  2R3S A;  3EQL F;  3FDY A;  1EV7 A;  4Y4R A;  3R60 A;  3KYL A;  2O6G E;  1W36 C;  1P4A A;  1QU3 A;  3M8F A;  4NC7 A;  1PUF A;  1ERD A;  1QBJ A;  2V9V A;  1A6Q A;  2XGC A;  4XSZ F;  1X1P A;  3A03 A;  4II3 A;  2CRG A;  4Q4Z F;  3NAU A;  1R4M B;  3LSJ A;  4CUG A;  2XRN A;  4BJT A;  1ZLK A;  1UST A;  2X51 A;  3S2W A;  4UV9 A;  4A3G J;  3LA3 A;  2KJC A;  2VXD A;  2XAG A;  2WC2 A;  4G12 A;  3S2H J;  3TQN A;  5E17 F;  1H8A C;  1VQ7 I;  5DDG A;  4A0Z A;  5L3C A;  2E36 A;  2W25 A;  3G1M A;  4Y13 A;  3HGG A;  3ZQL A;  5ILV A;  2XV4 S;  3RJP A;  5J4Y A;  2HDW A;  1TBX A;  3DXJ F;  4BGD A;  3I5U A;  4U87 A;  4E7S A;  4G9Y A;  3ZMZ A;  3A01 B;  2DK8 A;  1U2W A;  3K0L A;  3ERM A;  3R0J A;  3ZMT A;  4EM0 B;  2K9N A;  4OIR F;  3V7C A;  3BTC A;  1JI8 A;  5HOO A;  1OCO H;  3J80 K;  3I4M J;  2FBI A;  2MLG A;  4MNU A;  3E5Q A;  1RR7 A;  5D5U B;  4L9V A;  4XKV A;  2WB1 A;  2WWY A;  1MMS A;  1ZR4 A;  2K3P A;  5A2Q K;  2Q2E B;  1I5Z A;  1CF7 A;  4HV5 A;  3K4C A;  2XF7 A;  1WJF A;  5ICE A;  1R9T J;  2GXB A;  2CQN A;  3MAJ A;  4A3L J;  3MKY B;  4WXH A;  1UMQ A;  4CYD A;  4QWQ A;  4IRH A;  2NNN A;  2VON A;  1FNN A;  1MSE C;  1Z7L A;  2Y75 A;  4HNU A;  5IT9 Z;  1JUM A;  5M3F J;  1HBX G;  1DQU A;  3ZQC A;  2YX4 A;  2ID3 A;  4CCN A;  1VQ9 I;  2VL8 A;  5L3G A;  2DQR A;  3LFU A;  1WJC A;  2FBK A;  3QOE A;  3FKJ A;  1S29 A;  4EJO A;  3N05 A;  3KIO A;  1TWC J;  2QSF X;  3J7Z I;  4PZJ A;  1X2N A;  3OL4 A;  2R7S A;  5D6F A;  2KKO A;  2COB A;  1X2M A;  1GUU A;  4C2T A;  4R79 A;  1L0O C;  5FFZ A;  2X4H A;  4RGS A;  1KU9 A;  5AIP A;  3F72 A;  3FM3 A;  2JSP A;  2OQR A;  4I01 A;  4B3A A;  4F92 B;  1WQ2 A;  3E6B A;  1FZP B;  3FK6 A;  3WGH A;  3MEX A;  2R4G A;  1U0J A;  1TP4 A;  4EAT A;  3HPH A;  1OCC H;  4EGY A;  1UCR A;  1WWX A;  2XAF A;  4XKW A;  3OOU A;  5GP9 A;  3D0S A;  1X4P A;  4RS8 A;  3RQI A;  3ZQF A;  1RKT A;  5BMZ A;  1O7F A;  5E1Z B;  3SFZ A;  4ESJ A;  1DGW Y;  1WJA A;  3CUQ B;  1BR2 A;  2K4B A;  2QQ8 A;  1WVR A;  2NOJ B;  1IN8 A;  5KK1 A;  2AHQ A;  1F5T A;  4XOT A;  2R5Z A;  2K3F A;  3OYD A;  1J0R A;  1T98 A;  1FIP A;  2E71 A;  5JVG F;  2GA1 A;  5K7Z A;  5GAH J;  3U2R A;  4BHP A;  1IV8 A;  2FJ1 A;  3PIP F;  3S2D J;  1Z7U A;  5KHD A;  4ENJ A;  1POG A;  4XLP F;  4AUX A;  3RDI A;  5B3S H;  3GCM A;  3CCE I;  3PO3 J;  1FOK A;  5D8K B;  2M5W A;  4G8X A;  2F5E A;  1W5S A;  5M5X J;  4JX5 A;  1ZN2 A;  3QOD A;  3M8J A;  1Z0X A;  3DKW A;  2LOO A;  3RPU A;  2F2E A;  4CCJ A;  5LBQ A;  5ICF A;  2DOD A;  2DU9 A;  4AD9 A;  2A6E F;  4CDG A;  3D5S C;  3KX2 A;  4M9S A;  1P9Q C;  3JTG A;  4D0P A;  1PUF B;  3VDX A;  2ZJ2 A;  1X4O A;  3AFH A;  3OIP A;  1J09 A;  3ABT A;  1E3P A;  2XPW A;  1HST A;  1H0M A;  1RET A;  1ZQ3 P;  4L5I A;  2PG4 A;  3BPX A;  2JRM A;  3J7A Y;  1FTZ A;  3SYT A;  4BQQ A;  1XG1 A;  2DA6 A;  1IN7 A;  2F5C A;  1YTY A;  3HB9 A;  3RKX A;  2BVL A;  1YW9 A;  1R4N B;  1KGS A;  1I27 A;  3BQY A;  2DT6 A;  3V8K A;  4DIQ A;  4U7B A;  2M7A A;  2Y30 A;  2EZL A;  3E3V A;  1KA8 A;  3F8N A;  1ZGW A;  1HDP A;  1UG0 A;  2BEO A;  3JRE A;  3GUD A;  3FBN B;  1D0Y A;  2FOK A;  3AG3 H;  2AO9 A;  2EFP A;  2Y0S N;  3IV5 A;  1HKT A;  1NG6 A;  1ZK8 A;  2E2H J;  3HOS A;  3HRS A;  4C2M J;  4GXO A;  1E3H A;  2A07 F;  5CJ9 A;  1W36 D;  3GZN B;  1R71 A;  4N4O B;  2ZO4 A;  4L0Y B;  3LAJ A;  3JRB A;  2CFX A;  1WKM A;  3OYK A;  2RQQ A;  2JZY A;  2X6X A;  2ZJP F;  4XL9 A;  1T2K A;  4A5M A;  2E5Z A;  1B8I A;  2I8D A;  3GTQ J;  1FYM A;  3I56 I;  2XAH A;  5E1X A;  2R7D A;  1OR7 C;  3PUB A;  4HQM A;  1PVE A;  2K5C A;  4XQF A;  4B09 A;  2QKM B;  4YFK F;  2X9D A;  2WV1 A;  4XLN F;  3SEQ A;  5H20 A;  3HYI A;  2P0W A;  4YG2 F;  1P7J A;  4HSR A;  2VN2 A;  4PFO A;  1BL0 A;  1IRZ A;  4BS9 A;  3ZQH A;  2CG4 A;  1B72 B;  2QLZ A;  2W24 A;  3WTV C;  4YII A;  2ZFU A;  1F36 A;  1GV2 A;  3D5L A;  3DPU A;  4GCV A;  1ETO A;  2VB6 A;  5FJ8 J;  1QVT A;  4L0Z B;  1T6S A;  4E7L A;  5EJC A;  2IBD A;  3W6K B;  2MC4 A;  1ZG5 A;  4I2O A;  4OAZ A;  3JRF A;  3KEO A;  3AAF A;  4BY1 J;  1U8R A;  4IOC F;  5FGM A;  2ZFW A;  5LHG A;  4L9T A;  2CW0 F;  1FP2 A;  3LA2 A;  3IAM 2;  2H8R A;  3KLO A;  1Z91 A;  1R1U A;  1MBH A;  3JW4 A;  3K4L A;  2COM A;  3G1L A;  2EBI A;  4IQ4 A;  1U8B A;  4XN0 A;  2V26 A;  3VOE A;  4RGX A;  2R7F A;  2JTV A;  3I59 A;  4Y3O A;  4AVP A;  4BAY A;  2VBW A;  3V4G A;  2HR3 A;  3BC8 A;  2XSD C;  2W00 A;  1B9N A;  2BZT A;  1YG2 A;  2RC4 A;  1FSE A;  2KDZ A;  1VQM I;  1QZE A;  4YFX F;  5JLW A;  3TP3 A;  2E1C A;  2STW A;  3WTZ A;  1TW2 A;  1GV5 A;  1IG7 A;  3O2P E;  2XSJ C;  3IKV A;  1IRX A;  3T8R A;  3KZY A;  5LGT A;  3TL4 X;  4HG2 A;  4KNY A;  1BI1 A;  5HLG A;  3HOV J;  3GFJ A;  4ZDL A;  3KZI C;  4II2 A;  5B1A H;  4G7H F;  4M9Z A;  2STT A;  4PK4 A;  1SFU A;  4LIU A;  1WI9 A;  3B6A A;  1B59 A;  4UB8 C;  5E8G A;  5DV5 A;  5C3E J;  1F9N A;  3OIO A;  5CQG A;  2MA3 A;  1OYI A;  4DNC A;  4A0X A;  2LDU A;  4HYE A;  4X1E A;  3W6J B;  2KRC A;  4DQ2 A;  1QPI A;  1S5L C;  2O0Y A;  1MMA A;  1T39 A;  4CA0 A;  1OCZ H;  3S1Q J;  2H94 A;  2WY8 Q;  3FMR A;  2BY2 A;  4UV8 A;  3LSP A;  4DYQ A;  4RB3 C;  3JRI A;  4UVC A;  4IHV A;  3WGG A;  3ABL H;  2BW3 A;  1DUX C;  2DMN A;  1E2X A;  2OF7 A;  3GTP J;  3H3Z A;  2WY7 Q;  1W7P D;  2FMY A;  1ZEL A;  3JCU C;  1GXP A;  5DUK A;  4RDU A;  1MW7 A;  2L2O A;  2J5P A;  3ABM H;  5DYM A;  4WWC A;  3H0G J;  1OJL A;  3PJR A;  2EK5 A;  2JA6 J;  3J7A O;  2X6Y A;  1XTA A;  2DMQ A;  1N75 A;  1DU0 A;  5DTD A;  1IN6 A;  1MZB A;  4WCG A;  5GPA A;  3M8E A;  1USS A;  4QPQ A;  5HNF A;  4PJJ A;  4G94 A;  3DPT A;  2KL4 A;  5F0F A;  1I1G A;  3ONQ A;  2M9H A;  1OCT C;  4YIR X;  1OCR H;  1W5T A;  4UVB A;  3CMA I;  2VE8 A;  2M1B A;  3CP2 A;  2FOW A;  2GOX B;  1GVJ A;  1R6R A;  1O3R A;  2TCT A;  3DFG A;  4E7I A;  1R00 A;  2FEZ A;  4HNV A;  2XB0 X;  2EWN A;  4IJA A;  3Q0V A;  5E3M A;  5EYR A;  4C2U A;  3DLA A;  3L9F A;  2ZJR F;  2VQL A;  2A05 A;  3CLQ A;  3KP6 A;  2BY1 A;  4RMN A;  4PSW A;  3BR6 A;  2W57 A;  3BLY A;  1U5T B;  5FLM J;  3RPQ A;  4GFB A;  1LUJ B;  1JHF A;  2LNB A;  4LIT A;  1P92 A;  2IGO A;  2CGP A;  1A04 A;  3H9G A;  4Q48 A;  1I6X A;  3V8L A;  2NS8 A;  2E35 A;  3H5R A;  4CH7 A;  2AS5 F;  3ABK H;  3JTH A;  4D9J A;  4XIC A;  1A5J A;  1H88 C;  3CCR I;  2VOD A;  5HS9 A;  1V3F A;  3B02 A;  4F55 A;  3ESW B;  3K4B A;  1I6H J;  4DBQ A;  5GAG J;  2E34 A;  1G3S A;  1IXR C;  3J81 Z;  3CDH A;  2DTZ A;  2M4G A;  2V6C A;  4YRV A;  5GAE J;  3DTE A;  2QQA A;  4W1U A;  1SC7 A;  4A93 J;  3HKZ A;  1A6I A;  3QQA A;  3BZK A;  3BT9 A;  4U88 A;  3ZN0 A;  2P5V A;  1MMN A;  2EIL H;  3VOD A;  2H1L A;  1I3A A;  3KE2 A;  2XVC A;  3DBR B;  4FX4 A;  1X1A A;  2Z16 A;  3LQR A;  4GYG A;  3F21 A;  2Z99 A;  4CHU A;  2MH9 A;  2F4I A;  3I59 B;  3F8C A;  4V2F A;  2Y69 H;  3ZMS A;  1VQ8 I;  3HJE A;  3U1K A;  2XHK A;  1I3Q J;  3KPH A;  4D7M A;  3I71 A;  3ZQ7 A;  1WRJ A;  5EEH A;  4I0B A;  4ASN A;  2OTJ I;  2ZME B;  3G6E I;  4EJU A;  3I53 A;  4XRF A;  4Y15 A;  5FKK A;  1LEA A;  3OYM A;  1OCP A;  2DJN A;  3ECO A;  1W7P A;  2WAD A;  2ICW G;  1O7L A;  1UEL B;  4FET A;  4JK1 X;  3I4N J;  2WAQ A;  2EQR A;  1XB4 A;  4U0W A;  5FO5 A;  1YIT I;  4F93 B;  3A2K A;  1ZH5 A;  3A01 A;  3GX4 X;  3QWL A;  3GLL A;  3L2W A;  2IRF G;  2X1E A;  2VKD A;  2VC1 A;  1ON1 A;  3DTI A;  1HW1 A;  2HI3 A;  2LVS A;  1G3T A;  2DYR H;  2M8G X;  3JRG A;  3E6D A;  2NYX A;  1XSV A;  4F7Z A;  1PDN C;  5KVR A;  2R7Z J;  4S0H B;  3NWT A;  1NK3 P;  2GZW A;  1BI0 A;  1BW6 A;  3ZXS A;  2WTE A;  1R5G A;  2CSO A;  2EIM H;  2YU3 A;  4B48 A;  1CGP A;  2QBY A;  5CVV A;  3OYN A;  5J1R A;  1O3S A;  1NHA A;  2GXA A;  2WAQ N;  2ZBK A;  5GAD J;  2L7F P;  2WA0 A;  1WPK A;  1FMW A;  4UUT A;  4E7K A;  1IC8 A;  9ANT A;  5HS7 A;  3BZC A;  3BR5 A;  4C9Y A;  3RCO A;  2R7R A;  3VFZ A;  2Y2Z A;  2A69 F;  5D5W B;  2LKX A;  2ZNY A;  3FBI B;  2ESH A;  3GTL J;  1YX3 A;  2QGU A;  2WAE A;  2OBP A;  4XOP A;  4D7N A;  3ZMU A;  1HC8 A;  3KLN A;  5F27 A;  5IP7 J;  3CUO A;  1TWH J;  5J3L A;  1TNT A;  4I99 C;  3UNG C;  2P7C B;  4XRS A;  3VPR A;  2R7Q A;  1LFP A;  3K4K A;  2A61 A;  2JA7 J;  2QQB A;  1S6L A;  4P9F A;  1LB2 A;  2K9M A;  1Y56 A;  2E1M B;  3JRA A;  3CES A;  2VIX A;  5AIQ A;  1UB9 A;  3F6V A;  2IVM A;  4D1Q A;  1TWA J;  2ZCW A;  1U9N A;  3QAH A;  5CVI A;  3COA C;  1WJD A;  3WTS C;  3OYF A;  3FXL A;  2G0E A;  3TO6 A;  3OS1 A;  5LFA A;  1J2X A;  2CUF A;  2R7W A;  2HPM A;  2D5V A;  5FLX K;  3IL2 A;  3KEQ A;  1V5F A;  2XB5 A;  2H6B A;  4Q5S F;  4UNO A;  2Y31 A;  2Y0M A;  5JI6 A;  3A1Y A;  4IXA A;  1V54 H;  5E3N A;  5ICG A;  3PSF A;  1P7I A;  2DAO A;  2W82 A;  1IZ1 A;  3QP5 A;  1JJ6 C;  5FB2 A;  3FMQ A;  4X0G A;  2MGQ A;  1SAX A;  3EPZ A;  3E5X A;  3TO7 A;  3WTY C;  1EH7 A;  1ZLJ A;  4O6J A;  3O6B B;  3H0D A;  4EJV A;  2V9K A;  3C2H A;  3QOP A;  4R8H A;  1FLI A;  3G1O A;  4BBS J;  1T0F C;  3PNY A;  3GVA A;  3HZJ A;  3ABU A;  3KEY A;  1BR1 A;  2XGD A;  2RV8 A;  1HCR A;  3JRD A;  1LDJ A;  1J7K A;  2XAQ A;  4KIB A;  3E1S A;  1JT0 A;  3DBH B;  4M71 A;  4CCK A;  1FBU A;  1WJB A;  1VI0 A;  4HF0 A;  4L18 B;  4E70 A;  2DOF A;  1IW7 F;  1RRJ A;  5IPA A;  4ZTF A;  2UV1 A;  2W7N A;  1XDS A;  2EA4 A;  2DA5 A;  4B1R A;  3GWZ A;  4PJN A;  2HPI A;  3G2B A;  1TT0 A;  1T8I A;  1D3Y A;  3RQ4 A;  4LJZ F;  3BR0 A;  3SZG A;  2ZNZ A;  4EGZ A;  2ECB A;  2IS6 A;  1GXQ A;  1ETV A;  2HVS A;  1PUE E;  4MHG A;  4M3B A;  3KFW X;  2YR2 A;  4PGG A;  4RB0 A;  2X6O A;  4A6E A;  4MFD A;  3H5A A;  2UWM A;  3LA7 A;  5HDK A;  4NC6 A;  3PSI A;  5K1Y A;  3FXK A;  3H1C A;  1TL8 A;  3R6S A;  4MTD A;  3H9J A;  2EFW A;  2M4K A;  2YS9 A;  1XN7 A;  4V2G A;  1OMI A;  2BXZ A;  3HBL A;  2H6C A;  2LG4 A;  2V4J C;  3S3O A;  1BIA A;  3ZN1 A;  2E7W A;  3RKW A;  4A3E J;  2HQ5 A;  1VFC A;  2VJ5 A;  4PUS A;  4UB6 C;  1K7A A;  2FQ3 A;  3CP8 A;  2ELK A;  1QRY A;  4BU2 A;  1W7P B;  2DT7 B;  2B9S A;  4ZYD A;  3PNV A;  5GTH C;  2HQR A;  5HLT A;  3WTT C;  1TNS A;  2PEX A;  3A0H C;  3K69 A;  2ZSH B;  4NNJ A;  4XLE A;  2Q8K A;  1BA5 A;  1IAW A;  2VQH A;  4A12 A;  5EF6 A;  4ZTJ A;  3ROU A;  3BR1 A;  1OYY A;  5DCM A;  4JYK A;  4Y52 J;  1SVO A;  2QM3 A;  5JHU A;  4G7O F;  1N77 A;  4AM3 A;  2HZD A;  1R23 A;  2L02 A;  1GHC A;  1IF1 A;  2K9Q A;  2QBY B;  1FPQ A;  3PUF A;  4DZP A;  5E1W A;  4CZC A;  4M6Y A;  5L3F A;  3S1N J;  5DM7 F;  2V1D A;  2IA0 A;  3X2Q H;  2BE5 F;  2K40 A;  2NVU B;  2CQK A;  4XN3 A;  3LFK A;  1GVD A;  4P55 A;  2PQ8 A;  2ISZ A;  4M6X A;  1V55 H;  3EUH A;  1Z3X A;  1MH3 A;  3Q0W A;  4A6D A;  1DPU A;  1UG2 A;  1IUF A;  4FX0 A;  1ZYR F;  3LSG A;  3L2C A;  2NVX J;  4G7Z F;  2WB1 N;  3ML6 A;  3U9G A;  1F43 A;  4N0B A;  2J5O A;  2V7F A;  3JAM Z;  3HUG A;  1CQT A;  1JGS A;  1B72 A;  5FD6 A;  1PJR A;  2OCE A;  3BJA A;  3JSO A;  4N9I A;  5CKT A;  4Z6Y A;  1A36 A;  2MH2 A;  3S32 A;  2NVT J;  4OU0 A;  3REO A;  2HOS A;  2EIN H;  5CLS A;  2L7Z A;  3SFI A;  1H89 C;  4P96 A;  5HS8 A;  4A3I J;  4BY7 J;  2XF5 A;  3CC4 I;  5D8L B;  5LGN A;  4RBO A;  2M8E A;  1IV6 A;  4CSW A;  4PJ0 C;  3W3C A;  4YIF A;  2ZKZ A;  2HNH A;  1ENH A;  5D6E A;  3LNQ A;  2FX0 A;  2L0K A;  4ETS A;  2QEN A;  3EUA A;  4QPO A;  3DLL F;  4HRI A;  2Z5U A;  1UZC A;  2JPC A;  3VB2 A;  5EZG A;  3HSE A;  2KP6 A;  4M3E A;  1BI2 A; 
#chains in the Genus database with same CATH homology
 2DI3 A;  3G73 A;  2P5K A;  4ZYH A;  5F6F A;  1VTN C;  5DEQ A;  4UVA A;  4KMF A;  5D4S A;  3P7N A;  1JXS A;  4HLY A;  4M74 A;  5J6X A;  3QPT A;  3P9C A;  5LEJ A;  2V79 A;  2P6T A;  3QRF F;  4OIN F;  3IHU A;  3K1M A;  3EYY A;  1XGN A;  3MFK A;  2FA5 A;  1Z6R A;  4HQE A;  1Z6T A;  1IUY A;  2IW5 A;  5L3E A;  2EV0 A;  2RN7 A;  1I1S A;  4HV6 A;  1MKM A;  1FY7 A;  4WX9 A;  3KP3 A;  2G7U A;  3GW2 A;  4I7H A;  2ZXJ A;  1HW2 A;  3HRT A;  4ENM A;  3GEZ A;  2QVO A;  1TLH B;  3DV8 A;  4EM2 A;  1TQM A;  1E17 A;  3KET A;  5DCM B;  4EMS A;  3T5X A;  3E97 A;  3L7W A;  3HOT A;  2HFH A;  3BJO A;  4BHC A;  1Z05 A;  4A0Y A;  1QO0 D;  3GFM A;  2DTR A;  2GWR A;  5K5R A;  5JR3 A;  2RNJ A;  1IXS B;  3C7J A;  1KQ9 A;  1O3Q A;  1Z9C A;  3TOB A;  3TGN A;  2VBY A;  2W84 A;  5HDG A;  2B0L A;  3B73 A;  4KIF A;  4TV7 A;  1U5T A;  3IRQ A;  1XGM A;  1R58 A;  1XGS A;  3OOP A;  5ICC A;  5HLI A;  2OU2 A;  3WTX C;  1XSD A;  3J80 Z;  1MGT A;  1EH8 A;  1LNW A;  1ZG3 A;  2ACJ A;  3KP2 A;  2XAJ A;  3GZ5 A;  5A2Q Z;  4AIJ A;  1QZZ A;  1MDM A;  3LST A;  4UXN A;  2QZ8 A;  3P9K A;  1FWZ A;  3DF8 A;  2HKX A;  1S7A A;  3CUQ C;  3Q5F A;  2C6Y A;  1RZ4 A;  3BWG A;  3FWE A;  2XIG A;  4LLG F;  5E20 A;  2HGC A;  1MD0 A;  4CIC A;  1XD7 A;  2LSO A;  2QUF A;  2F5F A;  2VXZ A;  3WG9 A;  4L9J A;  4EVI A;  1YLF A;  1G3Y A;  3T0Y A;  2RKH A;  4NQW A;  1FBQ A;  3K1P A;  5BOX A;  1FP1 D;  1U6G A;  2ZME A;  2XRO A;  2M45 A;  4I09 A;  4LB5 A;  4LGW A;  5BPI A;  2DFI A;  2LKP A;  5D4R A;  2BV6 A;  3JSP A;  1R1T A;  3I4P A;  1IRG A;  3K2Z A;  1H9G A;  3ZMV A;  1HW5 A;  4BHB A;  2DBB A;  1KYZ A;  2O8X A;  4AIH A;  3GZ6 A;  1SD4 A;  1ZRC A;  4GO1 A;  2ETH A;  4KUM A;  1RNL A;  1S7O A;  3GYH X;  4HDV A;  3R61 A;  3CJN A;  5BS6 A;  4WF2 A;  5F1R A;  5F64 A;  4Y17 A;  3IKT A;  3IRR A;  4RB1 A;  2VBZ A;  4ZH4 F;  1OYW A;  5FD5 A;  1IN5 A;  1SFE A;  3C18 A;  4KT5 C;  2OAZ A;  5BPD A;  3GFL A;  2VOO A;  3QP6 A;  4RGR A;  2P6S A;  1UHW A;  5LGU A;  5J8C A;  4LG0 B;  1WSU A;  2E1N A;  4ZYE A;  1U3E M;  1RUO A;  3BJ6 A;  5L3B A;  5ILU A;  1KU3 A;  5DUI A;  2PJP A;  2KIF A;  4EJT A;  3T8T A;  4OIO F;  4WXC A;  4CO8 A;  4AIK A;  3RTR A;  1B6A A;  1KU2 A;  1O57 A;  1AOY A;  4U7D A;  2EV5 A;  1MDM B;  3FHZ A;  3DQV C;  1SD7 A;  3U1D A;  1X3U A;  1B1B A;  4ESB A;  5LLQ A;  2IT0 A;  5E18 F;  2TDX A;  4K2E A;  2DO7 A;  3CLO A;  1YFH A;  4LMY A;  2HYF A;  4HA8 A;  3SZT A;  2RDP A;  4JQF A;  1UFM A;  1B9M A;  4O5V A;  4ZZL A;  1F4K A;  2XAS A;  3SXY A;  2HZT A;  2HTJ A;  2O03 A;  3WOD F;  4KIC A;  2MLK A;  2HS5 A;  3OV8 A;  2K27 A;  4H0E A;  2JPB A;  2QWW A;  3QPH A;  1V4R A;  2UZK A;  2M30 A;  3GF2 A;  1XMK A;  2FML A;  1SFX A;  4RAZ A;  4M9X A;  1UHM A;  1D8J A;  3C1D A;  1DPR A;  4BYY A;  2E7X A;  1H9T A;  2G9W A;  3QU6 A;  5DD4 A;  3ULQ B;  5IT9 K;  4IHS A;  4KYW A;  2KIM A;  5ED4 A;  1J59 A;  5CVU A;  2EB7 A;  2HWV A;  4CZZ A;  2W85 A;  3WTW C;  5JVT A;  2PMH A;  1ZRE A;  2HQN A;  2A3S A;  2HYG D;  2QQ9 A;  2P8T A;  2VE9 A;  3ERE D;  5LRS A;  2FNA A;  4HLX A;  4HW0 A;  2Y48 A;  2DT5 A;  4L5J A;  3F8B A;  3GO5 A;  4UUV A;  2OZU A;  5J8F A;  4MQV A;  2L54 A;  1STZ A;  3IC7 A;  3C3W A;  2HEO A;  2D1V A;  1BJA A;  1XCB A;  4QLC U;  1OR7 A;  3PQK A;  1ZAR A;  4GGG A;  5TRD A;  3NEU A;  2L3D A;  2FSW A;  3TDZ C;  5K5O A;  3H3U A;  3M7G A;  1IXC A;  4S05 A;  4LFU A;  3BP8 A;  2OQG A;  2PBI A;  2IA2 A;  1Q1H A;  3DP7 A;  1G6N A;  1RUN A;  2ADU A;  4BQA A;  3TDU C;  4KDP A;  4HX7 A;  1PP8 F;  1IRF A;  3FMS A;  2EJR A;  4IRG A;  3FM5 A;  1R5H A;  1RIO H;  5ILS A;  1FYK A;  2EFO A;  1R1V A;  2JRT A;  5CVR A;  1BN5 A;  1O3T A;  2KJB A;  1QQI A;  1JE8 A;  2K4J A;  4LLL A;  3BDD A;  4EM1 A;  3RI4 A;  1J9I A;  3M1E A;  4HZF A;  3DPL C;  3FXU A;  2GAU A;  4PCQ A;  3EET A;  4I0A A;  5HVQ C;  2H27 A;  2D1H A;  3PQJ A;  3SHF A;  3TOA A;  2X0L A;  5AON A;  1KYW A;  4LK0 F;  4LK1 F;  4I98 B;  4MQ9 F;  1S8N A;  1T38 A;  3I64 A;  2WV0 A;  2DW4 A;  2D45 A;  3HSF A;  4ZYG A;  3FZV A;  2VBX A;  1XDU A;  1ULY A;  4B8X A;  5D5X B;  3RIR A;  3N97 A;  1EH6 A;  5HLH A;  3LQQ A;  1P6R A;  3WU1 B;  4NB5 A;  2HKO A;  1KU7 A;  3WE2 A;  3R0A A;  3RKY A;  1FT9 A;  4MEY F;  5H6R A;  2PMU A;  1YW8 A;  1OPC A;  2DK5 A;  2RGV A;  1BOA A;  2VT2 A;  2MC3 A;  2FF4 A;  4IHT A;  3EYI A;  3CO6 C;  2RVC A;  4OIQ F;  2CYY A;  3BOQ A;  3V8J A;  2JT1 A;  1XMA A;  4FT8 A;  1BC8 C;  2UXX A;  4M73 A;  4PDK A;  3TO9 A;  1TQI A;  3KP4 A;  3F6O A;  1Z1D A;  2K86 A;  4KA4 A;  1DDN A;  2OD5 A;  4U0Y A;  1YW7 A;  2D2W A;  3HTU A;  2MBF A;  1ZRD A;  1ZGA A;  4NHJ A;  2BYV E;  3TKY A;  5FLX Z;  1LJ9 A;  1W4M A;  1F1Z A;  3KP5 A;  2K02 A;  3IWF A;  1PP7 U;  3VEP A;  3FF5 A;  1ZG1 A;  2JSC A;  1ODD A;  3P9I A;  3L09 A;  2DPD A;  2IPQ X;  4I02 A;  2FNP A;  3RYR A;  2G7H A;  4L9N A;  1BI3 A;  3K9T A;  5DD8 A;  2L4A A;  3V7R A;  3NQO A;  4ENK A;  2ISY A;  3F23 A;  4N9H A;  2VC0 A;  4BNC A;  2NRA C;  2V1U A;  1HKQ A;  1QNT A;  1XSX A;  2ELH A;  4CXF A;  3F8F A;  2P4W A;  2EA2 A;  3O3K A;  1YO5 C;  2IJL A;  1RI7 A;  3FXQ A;  3E6C C;  3ZP5 A;  1D8K A;  2UXN A;  5E8I A;  3GXO A;  4CGZ A;  4EQQ A;  2Z9O A;  4LG0 A;  5LHH A;  3BY6 A;  3Q9V A;  3KP7 A;  2FBH A;  4S04 A;  1SD5 A;  2NNY A;  3WTU C;  1HSJ A;  5LRR A;  3CO7 C;  4LB6 B;  1CF7 B;  3FXR A;  3MZY A;  3V7S A;  3J81 K;  3T1B A;  3NRV A;  1P2F A;  2IA1 A;  3BZ6 A;  2YPR A;  4OOI A;  4YFN F;  1BC7 C;  1ON2 A;  2M87 A;  2CO5 A;  5FFX A;  2FE3 A;  2HDC A;  2KIU A;  3KZZ A;  2FRH A;  4GYI A;  4HOB A;  4Q47 A;  2Z3Y A;  5BQT A;  4ENN A;  2PI0 A;  2OA4 A;  5LHI A;  4U0V A;  4IF4 A;  4R1H A;  4RB2 C;  3F22 A;  1T0F A;  3ELK A;  2EFQ A;  1OKR A;  4LLN A;  1XCV A;  4OIP F;  3MQ0 A;  2P7V B;  3I0T A;  1J75 A;  1Y0U A;  3G3Z A;  5D5V B;  1G3W A;  5JFR A;  2P5L C;  3HRU A;  3HRM A;  2GXG A;  3F3X A;  2Z33 A;  2MD5 A;  2HOE A;  1LVA A;  3ECH A;  4XSX F;  1K6O A;  1R22 A;  5ERI A;  3PFI A;  4P9U A;  2F5D A;  3LWF A;  3MCZ A;  1FX7 A;  3MZH A;  3WE3 A;  4IRI A;  1LDD A;  1ZGJ A;  1MJA A;  4PGH A;  2FU4 A;  1HQC A;  3HHH A;  4ON0 A;  2HTS A;  4WK8 F;  3SZP A;  3WGI A;  4P5O A;  3FX3 A;  2L01 A;  4JBA A;  4HF2 A;  1LDK B;  4ESF A;  2VT3 A;  5EEG A;  3HIF A;  4KIG A;  1BM9 A;  3L00 A;  3QU3 A;  3M9A A;  2YSR A;  2Q0O A;  3RYP A;  4ZZD A;  4IPA A;  2XUB A;  5CVJ A;  5CYV A;  2PN6 A;  3HHG A;  1YS7 A;  4EJW A;  2GIV A;  1ZHF A;  1SD6 A;  2ESN A;  2AXL A;  4XBF A;  1KQ8 A;  4HX8 A;  1MJB A;  2A6H F;  4AWX B;  1KQ0 A;  1QGP A;  5H6Q A;  1P4W A;  1R36 A;  3F8M A;  5LEK A;  1REP C;  1LEB A;  3HSR A;  4A2U A;  2EFN A;  1TQP A;  4RGU A;  4UHT A;  2VOP A;  1D5V A;  3EDP A;  2KRF A;  4G6D A;  2PLY A;  1XGO A;  1BIB A;  5TJJ A;  1K78 A;  4G6Q A;  4MGR A;  4BXU A;  2NS0 A;  4EV0 A;  2LF7 A;  3K1N A;  4OMZ A;  3E5U A;  4RAY A;  5DCF A;  2QYO A;  4A5N A;  3KCC A;  4MEX F;  1IN4 A;  1AWC A;  4HDU A;  2V1X A;  2NAZ A;  2FXA A;  2LF8 A;  2PFB A;  5K5Q A;  1R7J A;  4HBL A;  4HF1 A;  2K7L A;  4BH9 A;  2CWE A;  2XKO A;  4FHT A;  2OZ6 A;  3GFI A;  3LAP A;  2GQQ A;  3ISP A;  3SQN A;  1YYV A;  4KN7 X;  1HXD A;  3N4M A;  3JAM K;  3CTA A;  6PAX A;  1TTY A;  1QZY A;  4MTE A;  2XGX A;  3I54 A;  4KN4 X;  1SMT A;  3ZMD A;  2BGC A;  1MJ9 A;  1FBS A;  2BBY A;  2O3F A;  2RQP A;  1JHH A;  3E6M A;  2Q2E A;  2IP2 A;  3MWM A;  3Q9S A;  3R4K A;  3DEU A;  5IT3 A;  2DLL A;  4HX4 A;  1U78 A;  1SMY F;  1ONV A;  1C0W A;  4KMU X;  1YQA A;  4KFC A;  3H92 A;  3IWZ A;  2DQL A;  1S3J A;  2A68 F;  2YX7 A;  5HDN A;  1U5T C;  1L3L A;  1FYL A;  3HTS B;  1QPM A;  4HAM A;  3BPV A;  1YS6 A;  1YIO A;  1B4A A;  1HKS A;  2EV6 A;  2O61 A;  4O3M A;  2A5Y B;  3I58 A;  1DP7 P;  1BBY A;  4M72 A;  3CUQ A;  3GLX A;  1P4X A;  2L4M A;  1G4D A;  4LD5 A;  4WXD A;  1ZRF A;  3WU0 A;  2H09 A;  3ZPL A;  2XKP A;  1K78 B;  1FSH A;  1LQ1 A;  3BRO A;  2DPU A;  1K79 A;  1FC3 A;  2GA2 A;  1J5Y A;  5L3D A;  4Z2Y A;  1ZAO A;  1TW3 A;  2R3S A;  3EQL F;  1EV7 A;  3R60 A;  2O6G E;  1P4A A;  3M8F A;  1QBJ A;  2V9V A;  4XSZ F;  4Q4Z F;  2XRN A;  1ZLK A;  1UST A;  3S2W A;  4UV9 A;  3LA3 A;  2KJC A;  2XAG A;  2WC2 A;  3TQN A;  5E17 F;  5DDG A;  4A0Z A;  5L3C A;  2W25 A;  4Y13 A;  5ILV A;  2XV4 S;  3RJP A;  1TBX A;  3DXJ F;  3I5U A;  4G9Y A;  3ZMZ A;  2DK8 A;  1U2W A;  3K0L A;  3R0J A;  3ZMT A;  4EM0 B;  4OIR F;  3V7C A;  5HOO A;  3J80 K;  2FBI A;  2MLG A;  4MNU A;  3E5Q A;  5D5U B;  4L9V A;  2WWY A;  5A2Q K;  1I5Z A;  1CF7 A;  4HV5 A;  5ICE A;  2GXB A;  3MAJ A;  4WXH A;  4CYD A;  4QWQ A;  4IRH A;  2NNN A;  2VON A;  1FNN A;  2Y75 A;  5IT9 Z;  1HBX G;  2YX4 A;  5L3G A;  2DQR A;  2FBK A;  1S29 A;  4EJO A;  4PZJ A;  5D6F A;  2KKO A;  4R79 A;  1L0O C;  5FFZ A;  2X4H A;  4RGS A;  1KU9 A;  5AIP A;  3F72 A;  3FM3 A;  2OQR A;  4I01 A;  1FZP B;  1WQ2 A;  3E6B A;  3WGH A;  3MEX A;  4EGY A;  1UCR A;  1WWX A;  2XAF A;  3D0S A;  4RS8 A;  5BMZ A;  1O7F A;  5E1Z B;  3SFZ A;  4ESJ A;  3CUQ B;  2K4B A;  1IN8 A;  5KK1 A;  1F5T A;  1J0R A;  1T98 A;  2GA1 A;  3U2R A;  4BHP A;  1Z7U A;  4ENJ A;  4XLP F;  3RDI A;  1FOK A;  5D8K B;  2M5W A;  4G8X A;  2F5E A;  1W5S A;  1ZN2 A;  3DKW A;  3RPU A;  2F2E A;  5LBQ A;  5ICF A;  2DU9 A;  4AD9 A;  4CDG A;  2A6E F;  4M9S A;  3JTG A;  4D0P A;  2ZJ2 A;  3ABT A;  1HST A;  1H0M A;  4L5I A;  2PG4 A;  3BPX A;  2F5C A;  1IN7 A;  1YTY A;  3RKX A;  3V8K A;  1YW9 A;  1KGS A;  1I27 A;  4U7B A;  3E3V A;  1KA8 A;  3F8N A;  2BEO A;  3GUD A;  2FOK A;  2EFP A;  1HKT A;  3HOS A;  3HRS A;  4GXO A;  2A07 F;  5CJ9 A;  2ZO4 A;  4L0Y B;  3LAJ A;  2CFX A;  1WKM A;  1T2K A;  2JZY A;  4A5M A;  1FYM A;  2XAH A;  5E1X A;  2R7D A;  4HQM A;  4B09 A;  4YFK F;  4XLN F;  5H20 A;  3HYI A;  4YG2 F;  2VN2 A;  2CG4 A;  2QLZ A;  2W24 A;  3WTV C;  4YII A;  3D5L A;  4GCV A;  4L0Z B;  1T6S A;  3W6K B;  1ZG5 A;  4I2O A;  3KEO A;  3AAF A;  1U8R A;  5FGM A;  2ZFW A;  5LHG A;  4L9T A;  2CW0 F;  1FP2 A;  3LA2 A;  3KLO A;  1Z91 A;  1R1U A;  3JW4 A;  2COM A;  3VOE A;  4RGX A;  2R7F A;  2JTV A;  3I59 A;  4AVP A;  4BAY A;  2VBW A;  3V4G A;  2HR3 A;  1B9N A;  1YG2 A;  2RC4 A;  1FSE A;  4YFX F;  2E1C A;  2STW A;  3WTZ A;  1TW2 A;  3O2P E;  3IKV A;  5LGT A;  3T8R A;  3KZY A;  4KNY A;  1BI1 A;  5HLG A;  3GFJ A;  4G7H F;  4M9Z A;  2STT A;  1SFU A;  1WI9 A;  1B59 A;  5E8G A;  5DV5 A;  1F9N A;  2MA3 A;  1OYI A;  4DNC A;  4A0X A;  2LDU A;  4HYE A;  3W6J B;  4DQ2 A;  2O0Y A;  1T39 A;  2H94 A;  3FMR A;  4UV8 A;  4RB3 C;  4UVC A;  3WGG A;  1DUX C;  1E2X A;  3H3Z A;  1W7P D;  2FMY A;  1GXP A;  5DUK A;  4WWC A;  2J5P A;  5DYM A;  2EK5 A;  3J7A O;  1IN6 A;  1MZB A;  4WCG A;  3M8E A;  1USS A;  4G94 A;  3DPT A;  1I1G A;  1W5T A;  4UVB A;  2VE8 A;  2M1B A;  1GVJ A;  1O3R A;  3DFG A;  1R00 A;  2FEZ A;  2EWN A;  4IJA A;  3L9F A;  3KP6 A;  2W57 A;  1U5T B;  3RPQ A;  1JHF A;  2LNB A;  1P92 A;  2CGP A;  1A04 A;  4Q48 A;  1I6X A;  3V8L A;  2AS5 F;  3JTH A;  2VOD A;  5HS9 A;  1V3F A;  3B02 A;  1G3S A;  1IXR C;  3J81 Z;  3CDH A;  2V6C A;  2QQA A;  4U88 A;  3ZN0 A;  2P5V A;  3VOD A;  3KE2 A;  2XVC A;  4FX4 A;  3LQR A;  4GYG A;  3F21 A;  2Z99 A;  4CHU A;  2MH9 A;  3I59 B;  3F8C A;  3ZMS A;  2XHK A;  3I71 A;  3ZQ7 A;  1WRJ A;  5EEH A;  4I0B A;  4ASN A;  2ZME B;  4EJU A;  3I53 A;  4XRF A;  4Y15 A;  1LEA A;  3ECO A;  1W7P A;  1O7L A;  4JK1 X;  1XB4 A;  4U0W A;  5FO5 A;  1ZH5 A;  3GX4 X;  2IRF G;  2VC1 A;  1ON1 A;  1HW1 A;  1G3T A;  3E6D A;  2NYX A;  1XSV A;  4F7Z A;  1PDN C;  5KVR A;  2GZW A;  1BI0 A;  2WTE A;  1R5G A;  2CSO A;  2YU3 A;  1CGP A;  2QBY A;  5CVV A;  1O3S A;  1NHA A;  2ZBK A;  5HS7 A;  3VFZ A;  2A69 F;  5D5W B;  2ZNY A;  2ESH A;  2OBP A;  3ZMU A;  3KLN A;  3CUO A;  1TNT A;  2P7C B;  2A61 A;  2QQB A;  1S6L A;  4P9F A;  1LB2 A;  5AIQ A;  1UB9 A;  3F6V A;  2IVM A;  2ZCW A;  3QAH A;  5CVI A;  3COA C;  3WTS C;  3TO6 A;  5FLX K;  1J2X A;  3IL2 A;  3KEQ A;  4Q5S F;  2H6B A;  4UNO A;  2Y0M A;  5JI6 A;  4IXA A;  5ICG A;  2DAO A;  1IZ1 A;  3QP5 A;  5FB2 A;  3FMQ A;  1SAX A;  3E5X A;  3TO7 A;  3WTY C;  1EH7 A;  1ZLJ A;  4O6J A;  3O6B B;  4EJV A;  4R8H A;  3QOP A;  1FLI A;  3GVA A;  3ABU A;  2RV8 A;  1LDJ A;  1J7K A;  2XAQ A;  4KIB A;  4M71 A;  1FBU A;  4HF0 A;  4L18 B;  4E70 A;  1IW7 F;  1XDS A;  2EA4 A;  3GWZ A;  1D3Y A;  4LJZ F;  2ZNZ A;  4EGZ A;  1GXQ A;  1PUE E;  4MHG A;  3KFW X;  2YR2 A;  4PGG A;  4RB0 A;  4A6E A;  2UWM A;  3LA7 A;  5HDK A;  5K1Y A;  3R6S A;  4MTD A;  2EFW A;  1XN7 A;  1OMI A;  2H6C A;  1BIA A;  3ZN1 A;  2E7W A;  3RKW A;  1K7A A;  2FQ3 A;  1W7P B;  4ZYD A;  2HQR A;  3WTT C;  1TNS A;  2PEX A;  3K69 A;  2Q8K A;  1IAW A;  4A12 A;  3ROU A;  1OYY A;  5DCM A;  2QM3 A;  5JHU A;  4G7O F;  1GHC A;  1R23 A;  2L02 A;  1IF1 A;  2QBY B;  1FPQ A;  5E1W A;  4M6Y A;  5L3F A;  2V1D A;  2IA0 A;  2BE5 F;  2CQK A;  3LFK A;  4P55 A;  2PQ8 A;  2ISZ A;  4M6X A;  3EUH A;  4A6D A;  1DPU A;  4FX0 A;  1ZYR F;  3L2C A;  4G7Z F;  3ML6 A;  3U9G A;  4N0B A;  2J5O A;  3JAM Z;  3HUG A;  1JGS A;  5FD6 A;  3BJA A;  3JSO A;  4N9I A;  2MH2 A;  4OU0 A;  3REO A;  5CLS A;  4P96 A;  5HS8 A;  5D8L B;  5LGN A;  2M8E A;  4YIF A;  2ZKZ A;  5D6E A;  4ETS A;  2QEN A;  2Z5U A;  2JPC A;  3VB2 A;  3HSE A;  4IVN A;  4OMY A;  1BI2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...