2MC3A

Nmr solution structure of the winged-helix domain from mus81 structure-specific endonuclease
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
103
structure length
103
Chain Sequence
GSYWPARHSGARVILLVLYREHLNPNGHHFLTKEELLQRCAQKSPRVAPGSAPPWPALRSLLHRNLVLRTHQPARYSLTPEGLELAQKLAESEGLSLLNVGIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A winged helix domain in human MUS81 binds DNA and modulates the endonuclease activity of MUS81 complexes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords MUS81 endonuclease homolog (Yeast), isoform CRA_b
total genus 19
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2013-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2mc3A00
5FFZA 1ULYA 2QBYA 1XSDA 1U5TB 3IKTA 3NEUA 4HV5A 1TNSA 1MDMB 2V1UA 5BPIA 3P7NA 2EFNA 1W5TA 1QO0D 5E8IA 1TBXA 1I1GA 1FP1D 3LWFA 2QBYB 1L3LA 1UB9A 1Y0UA 5D4SA 2FSWA 3V7SA 1QZYA 5HOOA 5BOXA 5JFRA 1MZBA 5E18F 3BJAA 1Z7UA 3FZVA 2QYOA 2Z99A 3W6JB 2MA3A 3ZMZA 1YG2A 2FU4A 1BI2A 1B9NA 4XBFA 5K1YA 4UNOA 1S8NA 2K7LA 3RKYA 3E5XA 1O7FA 4LLLA 1WSUA 2E1CA 2XAFA 3EDPA 5CVUA 4UVCA 1X3UA 4U7DA 5HDKA 5TRDA 1O3QA 4G7ZF 1ZN2A 4OINF 2GXGA 1PUEE 3I53A 3IC7A 5HDNA 1XCBA 2L4MA 2A3SA 3E97A 4RB1A 3GW2A 4Y13A 3T1BA 3L00A 4HYEA 3TQNA 1TW3A 1USSA 1LQ1A 5IT9K 4PDKA 2IRFG 2P8TA 4JK1X 2D45A 3BPXA 1R5GA 2P6SA 4KUMA 3JTHA 4RAYA 1R5HA 4KNYA 2LF8A 2F5CA 4A12A 1A04A 2A6HF 4G9YA 2IVMA 1OYIA 3QOPA 2B0LA 1XGNA 3D0SA 5DV5A 2JT1A 4XRFA 2F5DA 2QZ8A 2G9WA 3CJNA 4EQQA 2XKPA 1OKRA 4RB2C 1DDNA 2W25A 2J5PA 3IRQA 3GLXA 3K1NA 1S7OA 4FX0A 2E7WA 3I59B 1U3EM 2Y0MA 3HOTA 4BQAA 1BJAA 3SZPA 4KN7X 1GXQA 3R61A 1ZHFA 1LJ9A 4RB3C 4HZFA 3R6SA 5LHGA 2ZMEA 3ELKA 4WCGA 4MQVA 4MTDA 5FD5A 2O3FA 5HS7A 2FOKA 1BM9A 4I0AA 4ZZLA 4U7BA 1HKQA 4ESJA 2COMA 1JXSA 2X0LA 4ETSA 4U0VA 3DEUA 4L9NA 4CDGA 5LGTA 4UUVA 3LAJA 2ZMEB 5IT3A 1HW1A 2DBBA 4A6DA 1F9NA 3HSRA 5A2QZ 3TDZC 3Q9VA 5E1WA 2F5FA 2XUBA 2KJCA 5LEKA 2D1HA 4OMYA 2HYGD 3J80Z 3I58A 1JGSA 1W7PA 3ZMSA 2DI3A 3GZ5A 4RAZA 5HVQC 5JI6A 2FRHA 2OQGA 3IKVA 1P4AA 4U0WA 1ZAOA 2H6CA 2HTJA 3SFZA 2PN6A 3F22A 1FYLA 3U1DA 1JHHA 3B02A 1BIAA 5DYMA 2HKOA 3RDIA 1R23A 2GAUA 2BEOA 4KIFA 2EFPA 1H9TA 1B6AA 1E2XA 1U2WA 3V8JA 3ROUA 2P7CB 2DO7A 3CLOA 2EB7A 5J6XA 2FNPA 3NRVA 4IPAA 1FSHA 3ZMDA 3HRSA 4GCVA 2GWRA 4G6DA 3O6BB 4AVPA 2EFQA 2JRTA 3GVAA 2PQ8A 3KETA 3V4GA 3L09A 4TV7A 1Z1DA 3GF2A 1G3WA 1PDNC 3QAHA 4KFCA 3I71A 3E5UA 1QBJA 3REOA 1T0FA 3BY6A 1ZLKA 4BH9A 2RGVA 1IRFA 2M8EA 1TW2A 1BI1A 5L3BA 3PQJA 4GYIA 4HDVA 2VT2A 2ZBKA 4IF4A 4MHGA 2P5LC 3C7JA 3R0JA 4U88A 1B4AA 4A6EA 1U5TA 3HRTA 1AWCA 1MDMA 2M45A 1KGSA 3I4PA 2JPBA 4LLGF 1RZ4A 4KICA 5L3DA 3WTYC 3LA7A 2VT3A 4I01A 2ZFWA 3K2ZA 2EA2A 1YW8A 3DPTA 2Z33A 3RIRA 1MGTA 4UVAA 3N97A 3DFGA 4GGGA 3S2WA 4KA4A 4HAMA 2DQRA 1SAXA 2IT0A 4H0EA 2GQQA 1KU3A 2PMHA 1FY7A 4L0ZB 2YR2A 1WWXA 4AIJA 1R1UA 5HS8A 2W24A 1IN8A 1CF7B 3ZQ7A 4QLCU 3QP6A 3M8EA 3F6OA 2VBYA 4OIQF 1SFXA 2MC3A 2VOPA 3DV8A 2YX4A 3FX3A 1IAWA 1ON2A 5DD8A 1D3YA 4EJOA 2VC1A 2F2EA 3V8LA 1BIBA 4WK8F 3F23A 2OZ6A 4LG0B 1XSXA 4XSXF 1VTNC 3E5QA 1XDSA 2BBYA 3VB2A 3TDUC 4YIIA 1LNWA 2L01A 2HS5A 1P92A 3FMSA 1SD6A 4ZYDA 4Y17A 3HSEA 1IN6A 2EJRA 1JE8A 1KU2A 3ABUA 2VC0A 2DAOA 4XLNF 2ZCWA 1F1ZA 4HX7A 1BC8C 3I64A 1G3SA 4EM2A 3RPUA 3FMQA 2LDUA 2DPDA 5KK1A 1XGSA 2AXLA 2V1XA 4YG2F 3SXYA 1H0MA 2ISYA 2KJBA 2XASA 1LDKB 4KIGA 2XAGA 1XGOA 4ZYEA 5LHIA 2EA4A 1WKMA 3DF8A 4IJAA 4RGSA 3KEOA 1SD7A 2CFXA 3HOSA 3KLNA 3TO6A 2QQBA 5BQTA 2FBIA 3WG9A 5F64A 4CZZA 2M87A 2ISZA 5E20A 2ESNA 2FQ3A 4ASNA 4XSZF 3BWGA 2ELHA 1UFMA 3DQVC 4PCQA 3WGGA 4EJTA 4Q4ZF 4HQMA 4UV9A 1IRGA 2HTSA 2PEXA 1U8RA 1R22A 4NQWA 5DEQA 5LGNA 3B73A 1SMYF 2TDXA 1P6RA 3Q9SA 4UV8A 4ENNA 3FM5A 3J81Z 5JHUA 4S04A 2DU9A 3DKWA 1HKSA 1LB2A 1YIOA 5H6RA 1G6NA 4M6YA 4HX4A 3QPHA 3FWEA 2ZJ2A 4P9FA 4L0YB 1W7PB 3F8FA 1ZGAA 4KMUX 1S29A 4LK1F 2AS5F 3GFMA 4FX4A 3GXOA 5D5UB 5D4RA 2FXAA 3H3UA 2STTA 2W84A 2LNBA 1O7LA 4EJVA 2VODA 2WWYA 4Y15A 3FXQA 1SD4A 2L4AA 4LMYA 1XGMA 2JTVA 1RI7A 1UCRA 4LFUA 3MAJA 2DQLA 3BROA 4NB5A 3KP3A 5LLQA 5L3GA 5L3FA 3U9GA 3VEPA 1KU7A 2RQPA 1HW5A 3ML6A 2A68F 2MLGA 1B9MA 4BHPA 3K1PA 4Q47A 5TJJA 3P9IA 1FBSA 1FSEA 5D5VB 2HR3A 3M8FA 4AWXB 1YO5C 1YYVA 3H92A 4WWCA 2ZKZA 4G6QA 2E1NA 3WTZA 2BYVE 1RIOH 3BDDA 1ZG1A 1OPCA 2DFIA 4I09A 4ESFA 4AIHA 5L3EA 1REPC 1ZRCA 3EYIA 1T98A 4I98B 4OOIA 4HLYA 3W6KB 2Q0OA 1RUNA 4GYGA 5LRSA 1FX7A 3QU6A 3G3ZA 1ZG3A 4A0YA 3TOAA 3IHUA 1R7JA 2V9VA 2IPQX 1ZREA 4M72A 4HOBA 5FB2A 2O6GE 2OZUA 2LSOA 4ENJA 1H9GA 1J9IA 5DCFA 2VBWA 3RJPA 3LQRA 4P96A 2XKOA 1T39A 4CYDA 2QWWA 3ZMVA 4EVIA 1U6GA 3F8NA 4P9UA 1BC7C 2H94A 4FT8A 3V7RA 1GVJA 1BN5A 4HW0A 4HV6A 3D5LA 2F5EA 1BI3A 3C3WA 3E3VA 2PMUA 4BYYA 2BE5F 2OQRA 2Q2EA 3PQKA 2HOEA 1T2KA 1FLIA 2P5KA 2R7FA 4HDUA 2QQ9A 2QLZA 2HZTA 1EV7A 2NAZA 3ECOA 5D5WB 1TTYA 1P4WA 1B59A 2DT5A 4P55A 1XD7A 2K02A 2CW0F 3ZP5A 3E6BA 3ISPA 5KVRA 5LRRA 2XRNA 4L5IA 4HQEA 3DPLC 5ICEA 3RPQA 4A5NA 1R36A 1SMTA 2ACJA 4A2UA 1PP8F 5FFXA 2HQNA 4A0XA 1BOAA 2ETHA 3F3XA 1RUOA 2JZYA 3R60A 2FF4A 1XN7A 4KT5C 4A0ZA 1FP2A 1HQCA 2PBIA 1J5YA 4IHSA 2EV0A 3LAPA 5ICGA 3I5UA 2DK8A 1Z6TA 2L54A 3ULQB 3GYHX 1I6XA 2XAHA 1D8JA 2LF7A 3BJOA 1OR7A 1I1SA 3R0AA 1IN7A 3ECHA 3MZHA 1B1BA 1XMKA 2EWNA 4ZZDA 4O5VA 3WTVC 4LGWA 4CXFA 3VFZA 1L0OC 4CO8A 4YFXF 4G7HF 3HHHA 2C6YA 3WGIA 3RTRA 5HDGA 4MEYF 5J8FA 5JR3A 2EV6A 3LSTA 2PLYA 2RDPA 4IRGA 1FPQA 4L9TA 3KP7A 2KKOA 2FMYA 1KU9A 2YX7A 2YSRA 4M9SA 3R4KA 3ZN0A 3K0LA 2GXBA 3ERED 1O3RA 2M5WA 2FBHA 3ZMTA 1C0WA 5JVTA 3KP4A 2PG4A 4OMZA 1LEBA 1D5VA 1GXPA 4HA8A 3CUQC 1XMAA 3F21A 2IA2A 4CICA 4R1HA 3I0TA 2MH9A 3P9KA 1KQ9A 1IF1A 3HHGA 4EGYA 4HF2A 1IXRC 5AIQA 1ZARA 1EH8A 3KZZA 4I0BA 2NRAC 3H3ZA 4EV0A 1ZRFA 3JSPA 4CGZA 1G3YA 2VOOA 2VN2A 3L2CA 2W85A 4ON0A 1XSVA 1QGPA 1DPRA 3QP5A 3C1DA 4RS8A 5D8KB 3BJ6A 3QRFF 2ADUA 4YFKF 3KLOA 2GA1A 4G7OF 4EMSA 1W5SA 2HYFA 3KFWX 1SFUA 3RKXA 3CUQA 1MD0A 3LQQA 1T6SA 2QENA 3J7AO 4HF1A 5ILVA 1S7AA 3MZYA 5ICFA 4N9HA 5F1RA 1P4XA 3GFLA 5LBQA 2VBXA 2XGXA 2NNNA 5HLGA 3FF5A 3HTUA 4ENKA 3C18A 4RGXA 3K1MA 5FGMA 2HEOA 2HFHA 4AD9A 2ZXJA 2DLLA 2ZNZA 2DTRA 1FT9A 1U78A 1KQ8A 3GEZA 5DCMA 2XAQA 3HRMA 3WE2A 4BNCA 1OYWA 1RNLA 5D8LB 4DQ2A 3ZPLA 3Q5FA 4AIKA 2OD5A 2RN7A 3BOQA 2STWA 3EQLF 4ESBA 2KIFA 1HW2A 4L9VA 2O0YA 3RKWA 1WI9A 2O8XA 4G94A 1OYYA 4M73A 1J7KA 4M6XA 5E1XA 5DCMB 2JSCA 4OIOF 1QPMA 5CJ9A 2R3SA 1J75A 3WODF 5LGUA 1KYWA 1YFHA 4O6JA 3AAFA 4GXOA 1XCVA 3F6VA 3T8RA 1R1TA 5K5OA 1FYMA 1W4MA 3HYIA 2RV8A 1QQIA 2HQRA 4I2OA 2XHKA 1G3TA 3HUGA 3M1EA 2CO5A 1LEAA 1ZG5A 3KP6A 2A6EF 3HRUA 4MQ9F 3RI4A 1FOKA 2K27A 4OIRF 2FEZA 2IA0A 2NYXA 2ZNYA 2Z5UA 4EM0B 5BMZA 1FYKA 3TO7A 5CVRA 5CVJA 4CHUA 3T0YA 1WRJA 1TQPA 3CUOA 3J80K 1ON1A 4IXAA 2CYYA 5K5RA 2FNAA 2HKXA 3G73A 2UWMA 2V79A 1IW7F 1EH6A 3WU1B 1YW9A 3DXJF 1EH7A 2WC2A 4LD5A 2YU3A 1ONVA 3CDHA 4MNUA 1IXSB 2XV4S 4RGRA 2M1BA 5FD6A 3KCCA 3WTSC 3VOEA 5BS6A 1TNTA 1R1VA 2V1DA 3MQ0A 1SFEA 4LB5A 4HBLA 4M9XA 3L9FA 1O3TA 2P7VB 1Z05A 4R8HA 3MWMA 1K78A 3OV8A 4KIBA 3GO5A 2EFOA 3PFIA 1G4DA 1S6LA 3I54A 2D2WA 4U0YA 5CLSA 1MJAA 3JAMK 3JAMZ 2ESHA 2IA1A 3GUDA 2IJLA 3L7WA 2H27A 1BBYA 3HIFA 3KZYA 1BI0A 5HS9A 3U2RA 5CYVA 1K78B 1F4KA 2RC4A 1CGPA 1HKTA 4IVNA 1V3FA 4WX9A 2A69F 4HLXA 2L3DA 2K86A 3CO6C 3WTXC 2XIGA 4KMFA 1W7PD 5ICCA 1O57A 2CG4A 1LDDA 3QU3A 5D5XB 3J81K 1USTA 5K5QA 4K2EA 1DPUA 5EEGA 5ILSA 2G7UA 2IP2A 2OAZA 4YFNF 2EV5A 3TKYA 4D0PA 2CSOA 5E17F 1HSTA 4I7HA 5F6FA 2J5OA 2H6BA 2Z9OA 1FC3A 4UVBA 1K6OA 3SZTA 1Z6RA 4HF0A 1T38A 4BHBA 3FM3A 3WTWC 2MLKA 1K79A 3E6DA 3GFJA 3VODA 2QQAA 4ZH4F 2FA5A 3F8MA 1IXCA 3BP8A 4LK0F 5DUIA 5DD4A 1HSJA 3K9TA 4LG0A 3F8BA 5LEJA 1IUYA 4S05A 2G7HA 1V4RA 2Y48A 1ZYRF 2CWEA 3MEXA 2FE3A 2CQKA 1UHMA 4HX8A 4R79A 5ED4A 5FO5A 3FMRA 1QZZA 4EJUA 3CUQB 3IL2A 3WTUC 4O3MA 3E6CC 3ZN1A 2K4BA 1GHCA 1FWZA 2A07F 5E8GA 3RYRA 4B8XA 3E6MA 1KA8A 1D8KA 2KIUA 1TQMA 1MKMA 1QNTA 4IHTA 1I5ZA 1IZ1A 4L18B 3I59A 5FLXK 3F72A 1KQ0A 2DW4A 2WV0A 1Z91A 4B09A 3NQOA 3IWZA 4IRIA 2HWVA 2HDCA 3JSOA 1YQAA 2EK5A 1FZPB 1STZA 3K69A 1YS7A 5J8CA 4JBAA 1IN5A 3ABTA 2QUFA 1FBQA 2YPRA 1TQIA 4L9JA 4PGGA 3TGNA 3GFIA 2PI0A 1R00A 3FHZA 3KP2A 3RYPA 4LLNA 3WGHA 4KDPA 2D1VA 1J59A 2RKHA 3GZ6A 3WU0A 4UXNA 1MJ9A 3GX4X 3LA3A 1FBUA 1HXDA 1LVAA 3EETA 1I27A 2H09A 3MCZA 4UHTA 4M71A 4A5MA 1MJBA 4ENMA 2PJPA 4MGRA 3KE2A 2VXZA 4OU0A 5HLIA 2CGPA 1LDJA 4PGHA 4Q5SF 1TLHB 5DDGA 1FNNA 1YW7A 4ZYHA 2RVCA 2GZWA 2KIMA 2OU2A 1PP7U 3HSFA 2FBKA 1ZGJA 3BPVA 4MTEA 3BZ6A 4MEXF 4PZJA 2UXXA 5AIPA 3HTSB 1U5TC 4WXDA 3M7GA 5CVVA 4F7ZA 1SD5A 2RNJA 1DP7P 4RB0A 2JPCA 4E70A 2VE8A 1P2FA 4XLPF 1YLFA 4FHTA 3FXRA 2M30A 1XDUA 4P5OA 4OIPF 3DP7A 5ERIA 2KRFA 4YIFA 6PAXA 2P6TA 2UXNA 3TOBA 5CVIA 4WXHA 5DUKA 3T8TA 1S3JA 1ZRDA 2W57A 5EEHA 2MH2A 2V6CA 2WTEA 1O3SA 4G8XA 2NNYA 4WXCA 2FMLA 3QPTA 4BXUA 3LFKA 3EYYA 2A5YB 3COAC 2EFWA 1XB4A 3WTTC 3O2PE 1J2XA 1R58A 3KP5A 1E17A 2UZKA 2DK5A 3LA2A 1NHAA 4ZYGA 5L3CA 2LKPA 5FLXZ 3CO7C 2Z3YA 1YS6A 3GWZA 1ZH5A 2GA2A 5LHHA 4WF2A 3IRRA 1K7AA 3KEQA 2BGCA 1YTYA 4KN4X 3O3KA 2O03A 1F5TA 5HLHA 2VBZA 5AONA 1OMIA 1ZLJA 2A61A 2E7XA 4L5JA 3F8CA 2R7DA 2XROA 2K4JA 2MBFA 5A2QK 4EGZA 4JQFA 4BHCA 3T5XA 5H6QA 4DNCA 5H20A 4N9IA 2ZO4A 3IWFA 4NHJA 1HBXG 2Q8KA 3TO9A 4M74A 2GIVA 2QM3A 5ILUA 2IW5A 4Z2YA 2VONA 1WQ2A 1IN4A 4RGUA 2P4WA 3FXUA 3M9AA 4M9ZA 2MD5A 5E1ZB 1CF7A 5IT9Z 2PFBA 2OA4A 4EM1A 3CTAA 4KYWA 1DUXC 2O61A 4Q48A 5D6FA 3MFKA 1Q1HA 4N0BA 2Y75A 4QWQA 3P9CA 2OBPA 1J0RA 4GO1A 3V7CA 2HGCA 3ZMUA 3EUHA 4EJWA 1AOYA 4LB6B 3JW4A 2QVOA 1JHFA 3WE3A 1Z9CA 2NS0A 3N4MA 5BPDA 3SQNA 2L02A 4BAYA 2BV6A 3OOPA 4IRHA 2XVCA 2XAJA 1ODDA 2P5VA 2X4HA 5D6EA 3V8KA 1UHWA 2DPUA 1KYZA 2VE9A 3SHFA 4I02A 4LJZF 3JTGA
chains in the Genus database with same CATH superfamily
2V6EA 2LY1A 1U9OA 1WJEA 5BNGA 3ABMH 5FFZA 1PVEA 1ULYA 1JUMA 2QBYA 1XSDA 1U5TB 4YRVA 3IKTA 3NEUA 4HV5A 2W7NA 1TNSA 3OL3A 1MDMB 2V1UA 3ABKH 4DBQA 5BPIA 1TT5B 3P7NA 2M34A 2NS8A 1VQMI 2EFNA 1W5TA 2VKDA 2GLOA 1HDDC 2WAQN 4M3EA 1QO0D 4NBQA 5GPAA 5E8IA 3DEWA 1TBXA 3IH3A 1I1GA 1FP1D 2W1OA 3LWFA 3MD2A 2QBYB 1F43A 3KEYA 1L3LA 1UB9A 1Y0UA 1OCTC 5D4SA 1I39A 2FSWA 1LUJB 2NOGA 3V7SA 1XS9A 2DFHA 3OYLA 2CFOA 1KONA 2LRDA 1QZYA 5HOOA 5BOXA 2I5UA 3W2VA 4IX7A 2DA1A 2HVRA 5JFRA 1MZBA 1DQUA 5E18F 2XGCA 5IYBJ 3BJAA 3OYMA 4Y7NJ 1Z7UA 3DBLB 3O8GA 3FZVA 2QYOA 2Z99A 2KMUA 3L2WA 3W6JB 2MA3A 3ZMZA 1YG2A 1QZEA 2DMUA 2FU4A 3OMYA 1BI2A 1B9NA 4XBFA 5K1YA 2DA4A 4UNOA 1S8NA 2K7LA 3RKYA 3E5XA 3HDDA 1O7FA 4OAZA 5TISC 4LLLA 4XN0A 3CD6I 3PNYA 1WSUA 2E1CA 1WJCA 2XAFA 2BVMA 4F55A 3ASNH 4B48A 4A3MJ 3EDPA 3EUKL 5CVUA 1SVLA 4XK4A 4UVCA 4XOPA 1X3UA 3I9V2 4U7DA 2DDAA 5HDKA 1I50J 5TRDA 1VQNI 5EYRA 1O3QA 2CUZA 5HLTA 2CUFA 1MBJA 1VQ9I 2QA4I 1ZN2A 4G7ZF 4OINF 1X3ZB 2GXGA 2ZC2A 1PUEE 3I53A 3IC7A 5HDNA 4PSWA 1XCBA 2ZJPF 2L4MA 4RAGA 2A3SA 3E97A 4RB1A 2JWTA 5IP6A 3GW2A 4Y13A 4BY1J 2LBFB 5F0FA 4BKXA 2KPMA 2M2EA 3T1BA 2QKLB 3L00A 3NAUA 4HYEA 3S8PA 3TQNA 2ZMEC 1TW3A 4EEFG 1LFBA 2BZTA 1USSA 1LQ1A 3DLAA 3IAM2 3JRAA 1V5EA 4FCYA 3OS1A 5C4XJ 1P9QC 5IT9K 1X1DA 4PDKA 2IRFG 2P8TA 4JK1X 3CCJI 2DT6A 2D45A 2R0QC 1D1CA 3BPXA 2A6TA 3B6CA 3OSFA 2LLKA 1R5GA 2P6SA 4KUMA 5EF6A 1D1AA 3U21A 2KFDA 3MMYB 1X1BA 3JTHA 5GADJ 4CA0A 2NVQJ 4RAYA 5FKLA 4CSWA 4XONA 1R5HA 4KNYA 2LF8A 1OCOH 2F5CA 1A04A 4A12A 2A6HF 5F27A 3GTKJ 4G9YA 2IVMA 1OYIA 2X6WA 1MMDA 3HG9A 3QOPA 5DM6F 2B0LA 3UNGC 1HLVA 1XGNA 3D0SA 4KISA 3JRDA 5FKMA 3H5NA 4CCNA 2LY2A 2WY8Q 5DV5A 3A1YA 2JT1A 4XRFA 2F5DA 2QZ8A 2G9WA 3CJNA 4EQQA 2XKPA 2M4KA 1OKRA 4RB2C 1DDNA 3FXJA 5IYDJ 4D5FA 2W25A 2J5PA 3PO3J 3IRQA 2GM4A 3LOCA 1G2HA 1M1EB 3GLXA 2VKVA 3K1NA 2DFFA 4Y4RA 1S7OA 4GRIA 2WAFA 2L9VA 1UG2A 4FX0A 2E7WA 3I59B 4AC0A 1U3EM 3HKZN 2M8GX 2Y0MA 2WAQA 3HOTA 4BQAA 1BJAA 4A3JJ 3FK6A 3SZPA 1RESA 4KN7X 1GXQA 3R61A 1ZHFA 1LJ9A 4RB3C 3N05A 3FK7A 2Y2ZA 3FDYA 4HZFA 2F48A 4DJAA 3OSGA 2Y0SN 3R6SA 5LHGA 2ZMEA 3ELKA 2GBYA 4WCGA 4CYCA 5E79C 4B43A 3S3MA 1TC3C 4MQVA 3I55I 4MTDA 5FD5A 4C30A 4E4HA 2O3FA 3HL2A 5HS7A 2FUG2 2FOKA 1BM9A 2DN0A 2LMDA 4I0AA 2HXIA 4ZZLA 4U7BA 5F04A 3CLQA 4AVZA 1HKQA 4ESJA 2X51A 2COMA 1JXSA 3CP2A 4BE2A 2X0LA 4ETSA 3PNTA 4U0VA 5FRMA 3S1MJ 3C2HA 3DEUA 4L9NA 4CDGA 5GAGJ 1FTZA 3HEFA 2V7FA 5LGTA 4UUVA 3LAJA 2ZMEB 1YHQI 3K4NA 1DU6A 2K40A 1WJFA 4D5CA 3J7YJ 2ICWG 3LSJA 4XL9A 5IT3A 3TP3A 3ABLH 1HW1A 2DBBA 4A6DA 1F9NA 3H0GJ 3HSRA 2L0KA 5TGTA 2DMNA 5A2QZ 1ITYA 1WZ2A 2CJJA 3TDZC 3Q9VA 5E1WA 2F5FA 2XUBA 3NWTA 2KJCA 5LEKA 3JR9A 2D1HA 4OMYA 2HYGD 3VYRB 3J80Z 2XGDA 2EH3A 3F9KA 3I58A 3TW6A 1JGSA 1W7PA 3ZMSA 1OCZH 2DCEA 2DI3A 3GZ5A 4RAZA 5E3NA 3LMMA 5HVQC 5JI6A 4PJNA 2FRHA 2OQGA 3IKVA 1X58A 3CCVI 1JT6A 1RRJA 1P4AA 4U0WA 1ZAOA 2H6CA 2HTJA 3SFZA 3BR6A 2PN6A 3IAS2 2XPUA 3BR0A 3A0HC 4LIUA 3ZR8X 3F22A 1FYLA 3U1DA 4LIVA 1JHHA 2PJRB 2EZHA 4XKWA 3B02A 2BY3A 1BIAA 4BEHB 4LITA 5DYMA 1VZ0A 3DTKA 2HKOA 3HGYA 3RDIA 1JUSA 1ORKA 1R23A 2GAUA 5F08A 2BEOA 4KIFA 2EFPA 5IOZA 5E3MA 1H9TA 1B6AA 1E2XA 1U2WA 4CCOA 5CKTA 1NG6A 2KRHA 3OYIA 3V8JA 1I3QJ 3ROUA 2LFBA 2P7CB 4M3GA 2DO7A 3MKWB 3CLOA 3UKGA 2DFEA 2EB7A 4FASD 1X2MA 2FNPA 3ZQFA 1X1AA 3NRVA 5J6XA 4IPAA 1A35A 1FSHA 1B72B 2OCCH 1R49A 2R5ZA 2PJRA 2LR8A 3HRSA 3ZMDA 2IS2A 2F6CA 2JK3A 1YJNI 4GCVA 2GWRA 1U0JA 4G6DA 4IO9F 3O6BB 4AVPA 2DYSH 2EFQA 2JRTA 3GVAA 1S7EA 1VF9A 2PQ8A 1RPWA 3KETA 3V4GA 3L09A 2WAEA 1VQ7I 3C2BA 1D0ZA 3ZQLA 3OYNA 4TV7A 1Z1DA 3GF2A 3KYDB 1G3WA 2EBIA 2B9SA 1PDNC 1MNDA 3QAHA 1FJLA 2IGNA 4D1QA 4KFCA 2E2JJ 2QEXI 1SEUA 1SANA 3I71A 3E5UA 4HEA2 2LREA 1QBJA 2AQFA 2CS3A 1SC7A 3REOA 1T0FA 3BY6A 4CCLA 3Q0VA 2EZKA 1ZLKA 1E3HA 4BH9A 2RGVA 1IRFA 2FD5A 2M8EA 3OOUA 4XLEA 5FLMJ 3S2HJ 1UHSA 2DDBA 3QYEA 1TW2A 1BI1A 5L3BA 3PQJA 2PMZN 2XC7A 4GYIA 4HDVA 2VT2A 3SZGA 2VI6A 2ZBKA 4IF4A 1S9HA 4MHGA 2P5LC 3C7JA 3R0JA 4U88A 1FMVA 1B4AA 1IV6A 4JYKA 1OJLA 3HM5A 1U5TA 3HRTA 3G1LA 5FKNA 4A6EA 1AWCA 2V4JC 4A3FJ 4HPQA 3HOVJ 1MDMA 4RA2A 2LH9A 3QOEA 2M45A 1ETKA 3D1NI 1KGSA 2HDDA 3I4PA 2JPBA 4ZDPA 4LLGF 1NTCA 1RZ4A 4KICA 4BE1A 3BQZA 1E3OC 3LL7A 5L3DA 1DU0A 4AU7A 3WTYC 3LA7A 2VT3A 2JUGA 4I01A 4BQQA 2ZFWA 4DIQA 3K2ZA 4XKCA 4C2TA 2YU9J 4QPQA 1BW5A 3DPTA 2EA2A 1YW8A 1X1CA 3J7ZI 2Z33A 2LVSA 3RIRA 3S1QJ 3MZ8A 3SEQA 1MGTA 4F93B 1VFCA 3FXOA 4II2A 3JRFA 2HU9A 4UVAA 4HSTA 4ZJZA 3N97A 4UUTA 5C44J 2V9PA 3A01B 3QQAA 1HF0A 2AHQA 3DFGA 2XSDC 2GOXB 4GGGA 3S2WA 4KA4A 3K10A 2ID3A 3GTLJ 4A3LJ 2KZVA 4I99C 4HAMA 2DQRA 1SAXA 1N75A 2IT0A 4IHYA 3AFHA 4H0EA 2GQQA 2CRGA 1KU3A 2PMHA 5C3EJ 1FY7A 1SFKA 3DWLE 4L0ZB 2YR2A 1NK2P 1MMNA 1WWXA 4AIJA 1R1UA 5HS8A 1K4SA 2W24A 1IN8A 4HG2A 1CF7B 2QGUA 4RM3A 3ZQ7A 4QLCU 1Y8QB 3QP6A 2OC6A 3M8EA 3QODA 3S32A 3HOXJ 3F6OA 2EQRA 3LFUA 2VBYA 3OYCA 4NDLA 4OIQF 2GOMA 1SFXA 2E60A 2MC3A 2VOPA 3DV8A 2YX4A 2K3PA 3FX3A 1IAWA 2R5YA 1ON2A 5DD8A 2HOSA 2H1LA 1D3YA 4EJOA 2G0EA 2LBFA 2VC1A 2K85A 2F2EA 3V8LA 2K9MA 1BIBA 3PNVA 4WK8F 5LFAA 3RKQA 2TCTA 3F23A 2OZ6A 4LG0B 2DJNA 1XSXA 1FIPA 4OAYA 4XSXF 3DKYA 1VTNC 4A93J 2K9SA 3BR1A 2DA6A 3E5QA 1XDSA 3CDIA 2BBYA 2X1EA 4EATA 3VB2A 1WI3A 2QSHX 3TDUC 4JX4A 4YIIA 1RR7A 2W00A 1LNWA 2L01A 2L7MP 2HS5A 1ETVA 1P92A 3FMSA 3V42A 1SD6A 2DTZA 4ZYDA 4Y17A 3HSEA 1IN6A 2EJRA 1AKHB 3BT9A 1JE8A 1KU2A 3ABUA 2VC0A 2DAOA 4XLNF 2ZCWA 1JKRC 1F1ZA 4PK4A 4HX7A 1BC8C 1IDYA 2BXZA 4DOZA 2BY2A 3CZ6A 1G3SA 3I64A 3K4BA 4EM2A 3S1NJ 2UV1A 3RPUA 4A3EJ 4C9YA 3FMQA 3K7AJ 4UUSB 2LDUA 4IOAF 3BG5A 4BXXJ 5KK1A 1DGRM 3HGGA 2DPDA 1XGSA 3KIOA 2AXLA 2V1XA 2XB5A 1MBHA 4DZPA 4YG2F 4UB8C 4RLFA 3SXYA 1H0MA 2CQQA 2ISYA 5GTIC 2KJBA 2M4GA 2XASA 1LDKB 4KIGA 2XAGA 2P0WA 2HYJA 4RDUA 1XGOA 4ZYEA 5LHIA 3PIOF 4G6TB 2KRCA 1MMGA 2EA4A 1GT0C 1WKMA 2RQQA 4DZJA 3CCRI 3DF8A 4IJAA 4RGSA 3HC7A 3KEOA 1SD7A 1GLNA 4UUSA 1W0TA 2CFXA 1BR4A 4B47A 3HOSA 3KLNA 2UUZA 3TO6A 4E7JA 1N78A 2QQBA 3L1PA 3PM1A 5BQTA 3FXMA 2FBIA 3SFIA 3HJEA 5F64A 3TBIA 3WG9A 4CZZA 3CCMI 2M87A 1WPKA 5E20A 4ZYAA 1VQOI 4BU2A 2ISZA 4C3HJ 2FOWA 4JP0A 2ESNA 2FQ3A 4ASNA 3JRCA 4BDZA 3ZQGA 2JUCA 4XSZF 3BWGA 2MSYA 2ELHA 4CCMA 1UFMA 1HDPA 3DQVC 4PCQA 3OYGA 3WGGA 3D5SC 4EJTA 2PX9A 3W3CA 2KLOA 3P5JA 4Q4ZF 3CDLA 5LD2C 3PL8A 4NC6A 4HQMA 4M6VA 4UV9A 2R7SA 4PSXA 1ETWA 5FRNA 1DP3A 1IRGA 2HTSA 2PEXA 5KHDA 1U8RA 1R22A 4IL6C 4NQWA 5DEQA 3H9GA 5LGNA 2DA5A 4YIRX 1LPQA 4BACA 3B73A 3KYLA 4A3DJ 1SMYF 2DXIA 1WH7A 2DMPA 1FEXA 4FETA 2DODA 1BL0A 1H8AC 2TDXA 1P6RA 1MMAA 2M7AA 3Q9SA 4UV8A 2V26A 2RREA 1T8IA 1LKXA 4ENNA 3MKZA 3FM5A 3VYUB 3J81Z 3ZQCA 1ZKGA 5JHUA 3KX2A 4S04A 2L7FP 1JKQC 2DU9A 2VQGA 3DKWA 3LSRA 3IV5A 1HKSA 1R9TJ 1YIOA 5H6RA 1LB2A 4KT6A 1AHDP 1G6NA 3FBNB 4M6YA 4HX4A 3HB9A 2M7BA 3QPHA 4L5EA 3FWEA 2ZJ2A 4P9FA 4L0YB 1W7PB 3F8FA 3K4JA 1ZGAA 4KMUX 1S29A 3BTCA 4C3JJ 4LK1F 4CZCA 2AS5F 3GFMA 1IRXA 3H9JA 4B44A 3GXOA 4FX4A 5D5UB 2LP0A 5D4RA 5DTDA 2FXAA 3H3UA 2STTA 1JTYA 2W84A 2LNBA 1O7LA 1EF4A 1Y0NA 2E1MB 4EJVA 1U8BA 2VODA 2WWYA 4Y15A 3FXQA 1I6HJ 3W6VA 1SD4A 2L4AA 3HOWJ 4LMYA 4BGDA 4RMNA 1XGMA 2JTVA 4BEHA 1OFCX 1TWCJ 1RI7A 4AUXA 1HA8A 3VSKA 1ZQ3P 4MLOA 1UCRA 1LFUP 2Z2SB 4LFUA 3MAJA 2DQLA 3BROA 4E7HA 4NB5A 3KP3A 5LLQA 3JREA 2VQCA 2W4SA 2LD5A 2Y9YA 5L3GA 5L3FA 3U9GA 3VEPA 3ZCOA 2ME0A 1KU7A 2CW7A 3M07A 3CMAI 5J1UA 2PMZA 2RQPA 2LK2A 1H88C 3K70D 4AYBA 1HW5A 3GTMJ 2Q1ZB 5H2FC 3PIPF 4ZTFA 3ML6A 2A68F 2MLGA 1B9MA 4BHPA 3FXKA 3S16J 2L9RA 3A03A 1Z0XA 2VQHA 2OCEA 1UG0A 3K1PA 2NVXJ 1Y1WJ 4Q47A 2HI3A 3K4LA 5TJJA 3P9IA 3GLLA 4N4NB 2CQ7A 1FBSA 1FSEA 3RQ4A 5D5VB 2RAEA 2HR3A 1YE9A 3M8FA 4NC7A 5K7HA 4LG3A 4AWXB 1YO5C 1YYVA 3H92A 4WWCA 4E7LA 2ZKZA 4G6QA 1NK3P 4XLCA 4I6ZA 2E1NA 3WTZA 2BYVE 2JSPA 1RIOH 4I76A 2VKEA 1MBFA 3BDDA 3D5RC 4FE4A 1ZG1A 3S2DJ 4HRIA 1OPCA 2DFIA 3PJRA 4I09A 3OYBA 4ESFA 4AIHA 4IZZA 5L3EA 4XIDA 3EPZA 1REPC 1ZRCA 5B66C 3H1CA 3EYIA 1T98A 2NVYJ 2OPTA 4I98B 4OOIA 4Y3OA 3JRGA 4HLYA 1NH3A 3S15J 3W6KB 3BTJA 4QIWN 3RZOJ 3OYFA 2Q0OA 3G71I 1N77A 1RUNA 4GYGA 5LRSA 2LKSA 5HNHA 1FX7A 3DKXA 3QU6A 4IOCF 1WGXA 1FMWA 4RAFA 3FBIB 3G3ZA 4IQ4A 1ZG3A 2MD0A 4A0YA 5IYCJ 3TOAA 3IHUA 2R7XA 1R71A 1B8IA 1R7JA 2V9VA 2IPQX 1ZREA 2HQAA 1MMSA 4M72A 3CCQI 1Z21A 3ONQA 4HOBA 5FB2A 2DT7B 2L2OA 2KDZA 2O6GE 2OZUA 2LSOA 1UMQA 1WH5A 2EIKH 4ENJA 3S93A 1RETA 1H9GA 1J9IA 1S72I 5DCFA 2VBWA 3RJPA 3CMMA 3LQRA 2DMQA 4P96A 2MG4A 2XKOA 1V54H 2E1MC 3GBGA 1T39A 3M3YJ 3RQIA 4CYDA 2Q2EB 2QWWA 3CF5F 3ZMVA 4EVIA 1U6GA 2HPIA 4X1EA 3F8NA 4M3BA 4P9UA 1BC7C 3A01A 2V9KA 2H94A 2XB0X 4FT8A 3V7RA 2KDOA 1GVJA 1BN5A 4HW0A 2X6OA 2JA5J 4HV6A 4BL0B 2JA8J 3D5LA 3C3WA 2F5EA 1BI3A 1SVMA 3DEEA 2X1CA 4XICA 4A3IJ 2VL8A 3SYTA 3E3VA 2IEKA 2PMUA 4U87A 4BYYA 2BE5F 2OQRA 5EEAA 2Q2EA 3PQKA 2COBA 2HOEA 1T2KA 1FLIA 2P5KA 2NVTJ 4DYRA 4HNTA 2R7FA 4HDUA 1A6QA 2QQ9A 1XPXA 2QLZA 2HZTA 1EV7A 2NAZA 3ECOA 2F5VA 3H5RA 3OIQA 5D5WB 5GAHJ 2XGEA 1TTYA 4KJZA 1P4WA 1QU3A 2O7OA 1B59A 2F4OB 2JVGA 2DT5A 2P81A 2CV1A 4P55A 1QVTA 3MKYB 1E3PA 1I3AA 1XD7A 4J01A 2K02A 2CW0F 3PO2J 1OR7C 2DOFA 3ZP5A 3CJTB 3VWBA 3K70C 1BA5A 3E6BA 3ISPA 3C2GA 5KVRA 5LRRA 2BY0A 2XRNA 2Y9ZA 3LSIA 4F91B 4L5IA 4HQEA 1D5YA 1YITI 1VI0A 3DPLC 5ICEA 1X2NA 3RPQA 4A5NA 4NUBA 4HNUA 1OCRH 5F0HA 1G8XA 1R36A 3OYHA 2XDVA 1SMTA 2TRTA 2ACJA 4A2UA 1W36C 1PP8F 5FFXA 2HQNA 2HPMA 4V2GA 2IGKA 3M8JA 4A0XA 3DU6A 1BOAA 2ME6A 3L2RA 1ETQA 2ECCA 1BR1A 2K9QA 2ETHA 3F3XA 1RUOA 1YX3A 2JZYA 1YIJI 4P1WA 4MFEA 3R60A 2FF4A 2VUMJ 1XN7A 3DTEA 4KT5C 3ZQIA 4BBSJ 4FE7A 4A0ZA 1FP2A 1HQCA 2PBIA 1J5YA 4IHSA 2O9LA 2EV0A 3LAPA 2B7EA 5ICGA 3I5UA 4XLHA 3ZGKA 4X0GA 2VPRA 1XX5A 2DK8A 1Z6TA 4J19A 2L54A 3ULQB 9ANTA 4PJJA 3GYHX 4IQJA 1CQTA 1I6XA 2ECBA 4M3DA 5JLWA 2XAHA 2CV0A 1D8JA 2LF7A 3BJOA 1HOMA 1OR7A 1I1SA 3R0AA 2X6XA 1EKEA 1IN7A 3ECHA 3MZHA 1B1BA 1XMKA 2QSGX 2EWNA 2CV2A 2CH0A 2M9HA 4ZZDA 2HDWA 3FIWA 4O5VA 1AA7A 3FKIJ 3WTVC 4BXFA 4IKFA 1Y1VJ 3GZNB 2R93J 3CCEI 1WJBA 3AG4H 1IUFA 4LGWA 4CXFA 2Z16A 4QSHA 1YJ9I 3VFZA 4C3IJ 1L0OC 1Z67A 4CO8A 4YFXF 4G7HF 3HHHA 2C6YA 3WGIA 3RTRA 1T56A 5J1YA 4ANJA 5HDGA 1W1WE 4A3BJ 4BE0A 4MEYF 5J8FA 4J00A 1ZELA 5JR3A 2VJIA 3LSKA 3H5AA 1MNMC 1W0UA 4BS9A 3KPHA 2EV6A 3LSTA 5FJ8J 2PLYA 2RDPA 4IRGA 2KISA 1FPQA 4L9TA 5M5WJ 4ZDLA 3KP7A 2L9NA 3DLLF 2VJ5A 2DOEA 2CQXA 2QQ8A 2KKOA 4UB6C 3OR1C 1SAUA 2FMYA 1KU9A 2YX7A 3RSNA 2YSRA 1RR8C 3HPHA 1POGA 5EG0B 4M9SA 3K4CA 3R4KA 1TWAJ 3PSIA 1A31A 2X1DA 5F0CA 3ZN0A 3OYEA 3K0LA 2GXBA 3ERED 1O3RA 2M5WA 1QPIA 1FOXA 5CQEA 2ZXHA 4BBRJ 2FBHA 1J09A 2CUEA 1TWFJ 3OIOA 3ZMTA 1MNEA 3B6AA 1JUPA 1C0WA 3L2QA 5JVTA 3GTPJ 3KP4A 4XRMA 4PJLA 2PG4A 4OMZA 1LEBA 2DMTA 1D5VA 1GXPA 3NWSA 3QYBA 4HA8A 4ABZA 3CUQC 1XMAA 1JI8A 5K7FA 5EG0A 2IA2A 3F21A 2OTLI 1FOWA 2A05A 4CICA 4R1HA 3I3LA 3I0TA 2EZIA 2MH9A 2HZDA 3BTLA 2F4MB 3P9KA 2VPLA 1JT0A 1KQ9A 5JLXA 3AG2H 5J3LA 3BZCA 4NNJA 1KZHA 3HHGA 1IF1A 4EGYA 4HF2A 1IXRC 1WJ5A 5AIQA 4OWRB 4IHVA 1ZARA 1EH8A 3KZZA 4I0BA 2NRAC 3H3ZA 4EV0A 4ZC3A 1ZRFA 3JSPA 4CGZA 1D0YA 1G3YA 1U9NA 2VN2A 5B1AH 3L2CA 2VOOA 1AKHA 2W85A 4ON0A 1XSVA 1QGPA 2IXSA 5KCMA 5KNLA 2DA7A 1DPRA 3QP5A 2MC4A 5M3MJ 1Z3XA 3C1DA 4RS8A 3BJ6A 5D8KB 4BJ6C 3QRFF 3AL0C 2ADUA 4YFKF 3KLOA 2GA1A 4Y52J 3FKJA 4EMSA 4E6KG 4G7OF 1W5SA 4W97A 2CU7A 2HYFA 4XMYA 2R7UA 3KFWX 1RC9A 3LNQA 1HC8A 1SFUA 2LG4A 4XLFA 3RKXA 3BQYA 3CUQA 5DS9A 3DBRB 2HNHA 4AIDA 4PJMA 2JA6J 1MD0A 3DPUA 3G1OA 1TZLA 3LQQA 3WU2C 1T6SA 3CCUI 2QENA 3BC8A 3BTIA 4C2MJ 3J7AO 4HF1A 5ILVA 1IJWC 1S7AA 3MZYA 5ICFA 5J47A 1VQ8I 5HNFA 4N9HA 1O4XA 5J4YA 5F1RA 2E35A 1P4XA 1IGNA 3GFLA 2QCOA 5LBQA 2VBXA 2XGXA 2ZFUA 3G1MA 4XORA 2NNNA 2MW8A 5HLGA 3FF5A 3HTUA 4ENKA 3C18A 4RGXA 3K1MA 5FGMA 2HEOA 3TL4X 2HFHA 4AD9A 2ZXJA 2DLLA 1VQKI 2ZNZA 3X2QH 2DTRA 1LVKA 1FT9A 1ERDA 1U78A 1KQ8A 4B3AA 2XPWA 3TMOA 3S3NA 1D0XA 2KP6A 2VASA 3GEZA 3Q0UA 1XMXA 5M5XJ 5DCMA 2XAQA 3HRMA 4XN3A 4XOTA 4YELA 3WE2A 4BNCA 1OYWA 1RNLA 5GAEJ 5DM7F 5D8LB 3G4SI 4DQ2A 3HOUJ 3ZPLA 3J7AY 2DOAA 1QHHD 2E5ZA 1ENHA 3LSMA 3ZOBA 3Q5FA 2IAIA 4AIKA 1Z77A 2OD5A 2RN7A 2FJ1A 3BOQA 2STWA 3EQLF 4ESBA 5FKOA 2KIFA 1R6RA 2O0YA 4L9VA 1HW2A 1A36A 3RKWA 1MH4A 2Y0SA 1WI9A 2O8XA 4G94A 1OYYA 3BCAA 4M73A 3ZRGA 1J7KA 1MBKA 2YS9A 2NS7A 4M6XA 5E1XA 1IO2A 4XLAA 5DCMB 2JSCA 3QYFA 4OIOF 1QPMA 3CJQB 3OYDA 5CJ9A 5EZGA 2R7OA 2HVSA 2R3SA 2R7TA 3BG9A 3QPLA 1J75A 5KAIC 1IC8A 3WODF 3GTGJ 5LGUA 1KYWA 1PUFA 1JJ6C 2KZGA 1T95A 3FXLA 1YFHA 4O6JA 3AAFA 3FHNA 4GXOA 1XCVA 4RBOA 3F6VA 4AM3A 3T8RA 2R7VA 1R1TA 2CUJA 5K5OA 1FYMA 5IP9J 2X85A 1YRNA 1W4MA 4MIMA 3VYSB 1VQ5I 3HYIA 2RV8A 1QQIA 1WCMJ 3OS0A 3BLYA 1X4OA 2HQRA 5J40A 2CW8A 3ESWB 1TWGJ 3H9QA 2R5ZB 1APLC 4I2OA 2XHKA 1G3TA 3HUGA 3M1EA 2CO5A 2ZSHB 5CQGA 1LEAA 1ZG5A 3KP6A 5KAFC 2JA7J 2A6EF 3HRUA 1ETOA 3Q0WA 4MQ9F 4M3FA 3RI4A 2E5NA 1FOKA 3E7LA 3GTOJ 3WG7H 2K27A 4OIRF 2VIXA 3SDBA 2FEZA 1OISA 2IA0A 2NYXA 3LSHA 4GFBA 2ZNYA 2Z5UA 4EM0B 5BMZA 2XAUA 1FYKA 2LTPA 3TO7A 3VSLA 5CVRA 5CVJA 4DGWB 4A3CJ 4CHUA 1ETXA 3T0YA 1JKPC 1WRJA 1TQPA 3CUOA 2WB1A 3J80K 3U1KA 1X3WB 1ON1A 4IXAA 1MH3A 2CYYA 5K5RA 2FNAA 1Y6IA 2HKXA 3G73A 2UWMA 2OTJI 2V79A 1IW7F 3ZXSA 2MFZA 4FTHA 2E2HJ 3DU5A 1EH6A 3WU1B 3OYJA 4IHWA 2DJIA 4B1RA 1YW9A 3DXJF 2R7QA 1EH7A 3CJRB 2WC2A 4LD5A 1MBGA 3I4NJ 1GUUA 4BY7J 1W5CC 3TW7A 2YU3A 2AQEA 2IS6A 1VQ4I 4NC8A 1ONVA 4CCKA 3CDHA 4MNUA 1HCRA 1WFXA 4LOCA 1IXSB 3HKZA 3GTQJ 2XV4S 4RGRA 2M1BA 5FD6A 3SJMA 3KCCA 3WTSC 3VOEA 1GV2A 1RKWA 2JJ7A 3AKZA 5BS6A 1TNTA 1R1VA 2V1DA 1S5LC 4XR6A 5IPAA 3L2VA 3MQ0A 1SFEA 4HBLA 4M9XA 4LB5A 3EUHC 3PFYA 1P7JA 4YEJA 3L9FA 1O3TA 5FLVA 2P7VB 2BW3B 1R4NB 1Z05A 3OR2C 2DA2A 1ACIA 1GDTA 4R8HA 3MWMA 5IY5H 3JRIA 4JOMA 1K78A 3OV8A 2EILH 3GO5A 2WV1A 3BCBA 4KIBA 2EFOA 1A5JA 3PFIA 1G4DA 3IH2A 1XTAA 5EJCA 3H3VK 1S6LA 2KT0A 3I54A 2D2WA 4U0YA 5CLSA 2VKHA 1MJAA 1PYVA 3JAMK 1YOVB 3JAMZ 2ESHA 3I56I 1SFOJ 1AU7A 2IA1A 3GUDA 1MSEC 2IJLA 3L7WA 2H27A 1K6YA 1K61A 1BBYA 2K9NA 3HIFA 3KZYA 2BW3A 1BI0A 1WVRA 4RM2A 5HS9A 3U2RA 1UZCA 5CYVA 3WHCA 4JX5A 1K78B 1F4KA 2RC4A 1CGPA 1ZR4A 1HKTA 3UR3C 2WY7Q 3GTJJ 2IBDA 2BHYA 4IVNA 3F0CA 4S0HB 1V3FA 4WX9A 2A69F 1FTTA 3PSFA 4HLXA 4A3GJ 3CC7I 2L3DA 4IHXA 1WJDA 2K86A 5JVGF 3S1RJ 1PJRA 2I10A 3CO6C 3WTXC 2XIGA 3OY9A 4KMFA 3RCOA 1W7PD 5ICCA 3CMYA 2ZSIB 3ERMA 1O57A 2CG4A 1LDDA 3DTIA 3QU3A 2L5QA 1VQ6I 5D5XB 3J81K 1USTA 2WA0A 4N4OB 4XRSG 3O8HA 5K5QA 5F1JA 4K2EA 5IOYA 1WJAA 1H89C 1DPUA 4GDFA 5EEGA 2HOAA 5ILSA 4XQFA 2G7UA 2IP2A 2BOLA 2OAZA 4YFNF 5K7ZA 2XSJC 1G59A 2EV5A 3TKYA 4D0PA 2W82A 2CSOA 5E17F 2NVUB 3JCUC 1HSTA 4I7HA 2CMPA 2J5OA 5F6FA 3BR2A 2H6BA 4RLQA 2Z9OA 1MIJA 3HPGA 1JGGA 1FC3A 4UVBA 3G2BA 5CPRB 1T33A 4BDYA 1K6OA 3SZTA 1Z6RA 5E3OA 4QTRA 2OUMA 2H1KA 4HF0A 1T38A 4BHBA 3FM3A 3WTWC 2BHZA 2MLKA 1VQPI 1K79A 5C4JJ 5FROA 4D7NA 3E6DA 3GFJA 3G6EI 2R5YB 3VODA 3MKLA 3A02A 4BQOA 2EIJH 2QQAA 4D9JA 4XRSA 1XG1A 4ZH4F 2ZXWH 1GVDA 2X9DA 2FA5A 4C2UA 3F8MA 1GV5A 1IXCA 1UELB 1TP4A 3BP8A 1V5GA 4LK0F 3LSPA 5DUIA 1IG7A 2XF6A 1HSJA 5DD4A 4A3KJ 3K9TA 4XKVA 3F8BA 4LG0A 5LEJA 3OS2A 1IUYA 3H0DA 1P7IA 4DYQA 4CCJA 4S05A 1SVOA 2G7HA 1V4RA 1JTXA 1MW7A 1OCCH 1ZYRF 2CWEA 2QSFX 2Y48A 3MEXA 4DBRA 1YX5A 2B63J 2FE3A 2CQKA 1UHMA 4HX8A 2A5WA 4R79A 2JA2A 2N8GA 3JRBA 3BG7A 4XKBA 5ED4A 3ZQQA 2GIZA 5FO5A 3FMRA 4KITB 1QZZA 4EJUA 2AO9A 3CUQB 3IL2A 3S17J 3WTUC 4O3MA 2E1OA 3E6CC 3ZN1A 2K4BA 2R92J 1Z7LA 3DBHB 1GHCA 1FWZA 2A07F 2DYRH 5E8GA 3RYRA 4B8XA 3E6MA 2LY9A 1KA8A 1D8KA 1EA3A 1V55H 2KIUA 1NG7A 2JRMA 1TQMA 1MKMA 1QNTA 4IHTA 1TWHJ 2YUSA 3HBLA 4CH7A 1I5ZA 1IZ1A 1BW6A 2E34A 2HXOA 2LC2A 2LYCA 3I59A 4L18B 5FLXK 5B3SH 1ZTRA 2FQ4A 3F72A 1KQ0A 1LFPA 2DW4A 2WV0A 1Z91A 3CESA 4B09A 5JHFA 3NQOA 3IWZA 4IRIA 2K9LA 2KIQA 4NQWB 2HWVA 3BR3A 2HDCA 1FIAA 3JSOA 1YQAA 2EK5A 2BVLA 1FZPB 1STZA 4E7KA 3K69A 1YS7A 3KYCB 5J8CA 3A0BC 4JBAA 1IN5A 3ABTA 5J4VA 2QUFA 4CYCB 3KZIC 1FBQA 2YPRA 2L7KA 2X48A 1TQIA 4L9JA 1QA6A 3QPSA 3SEZA 4II3A 4PGGA 2XF7A 3SDGA 3TGNA 3GFIA 2PI0A 1R00A 3FHZA 3KP2A 3RYPA 4LLNA 1EJ9A 3WGHA 2WADA 2X6YA 1UAAA 3HOZJ 4Z6YA 4KDPA 2OV7A 2D1VA 2KHMA 1J59A 2HOTA 1BOBA 2RKHA 2QF7A 3GZ6A 2EZLA 2CQNA 4BQNA 2VJJA 4PUSA 4UXNA 1IV8A 3WU0A 1K83J 2F4IA 1MJ9A 3GX4X 3LA3A 1FBUA 1HXDA 1LVAA 1QRYA 3MVPA 3EETA 1I27A 3H36A 5IP7J 2H09A 3MCZA 4UHTA 1R4MB 2ELJA 4M71A 4DYCA 4A5MA 1MJBA 4ENMA 3W2AA 2Y30A 4MGRA 2PJPA 3L2UA 3KE2A 2VXZA 4OU0A 5HLIA 1T0FC 2CGPA 1LDJA 4PGHA 4Q5SF 1TLHB 5DDGA 1FNNA 1YW7A 2IGOA 4ZYHA 2RVCA 2GZWA 2KIMA 2OU2A 3DCFA 5FKKA 1PP7U 3CMEI 3IP4B 1T08B 3HSFA 1IDZA 2E71A 3A2KA 2FBKA 1ZGJA 2K3FA 3BPVA 4MTEA 3BZ6A 4MEXF 5B5EC 4PZJA 3BZKA 2UXXA 4DW6A 5AIPA 3CQZJ 4D7MA 4V19K 3HTSB 1U5TC 4WXDA 3M7GA 5CVVA 2WB1N 4F7ZA 1SD5A 2GXAA 1LE8B 1UJ8A 3K6GA 1OLTA 2EINH 2IGMA 2HQ5A 2RNJA 1DP7P 4RB0A 2OJED 4BUPA 2DA3A 2BY1A 4F92B 2JPCA 3HUGB 4E70A 2VE8A 3K2AA 1P2FA 3W2WA 4XLPF 2V1NA 5HODA 1OQYA 1V5FA 3HXLA 1YLFA 4FHTA 2XF5A 2MGQA 3FXRA 2H8RA 3AG3H 4W1UA 1MSFC 4IEJA 2R7ZJ 2M30A 1XDUA 4P5OA 4OIPF 3BG6A 2WBMA 4FISA 1YI2I 3DP7A 1A6IA 2E19A 1LE8A 2ZB9A 2K5CA 4ITVA 5ERIA 3CF2A 2L9SA 3CCSI 1OCPA 1Z3YA 2KRFA 4A69C 1ZK8A 4YIFA 2QKMB 6PAXA 5J1RA 2P6TA 2UXNA 3TOBA 5CVIA 5GP9A 4WXHA 5DUKA 4XNFA 3T8TA 1K4TA 2Y31A 1JJ8C 1S3JA 1ZRDA 2EIMH 5M3FJ 2LKXA 2W57A 5M5YJ 5EEHA 2MH2A 3VPRA 5GPCA 2V6CA 2ID6A 2WTEA 3FISA 4G8XA 1O3SA 5EGOA 3TP0A 5B1BH 2NNYA 3NARA 2FMLA 3QPTA 4WXCA 2JMWA 4BXUA 2R7RA 2JVHA 3LFKA 3M4OJ 3EYYA 2I8DA 1QVUA 2A5YB 3COAC 2EFWA 2XPVA 1XB4A 3WTTC 3Q3SA 3O2PE 1J2XA 1ZR2A 3HOYJ 1R58A 3KP5A 1E17A 2UZKA 2DK5A 3LA2A 4MFDA 1X1PA 2AXTC 1DGWY 1NHAA 1WHUA 4ZTJA 4ZYGA 5L3CA 3H35A 2LKPA 4PJ0C 3RPUD 4B4CA 2BXYA 5FLXZ 5EGOB 3K4KA 3CO7C 2XRLA 2L7ZA 2Z3YA 1JKOC 1VQLI 1YS6A 3GWZA 5E3LA 3AG1H 1ZH5A 2GA2A 2H8WA 5LHHA 4WF2A 1E0EA 3IRRA 1Y8RB 4B3XA 3OL4A 1K7AA 3KEQA 2M0MA 2BGCA 3CCYA 3E0JB 1YTYA 1ETYA 4KN4X 2FX0A 3O3KA 3QWLA 2O03A 1F5TA 3OWTA 5HLHA 2VBZA 5AONA 2KQRA 4FQGA 1OMIA 2NXNB 1ZLJA 2A61A 2IS4A 2E7XA 3OIPA 1Y56A 4XM3A 1Q1VA 4L5JA 2VXDA 1PUFB 3F8CA 2R7DA 2XROA 1N25A 3I4MJ 5EDNA 2K4JA 2MBFA 2VQLA 5A2QK 4EGZA 4JQFA 3ZQHA 4HSRA 4BHCA 3HZJA 3T5XA 1YRNB 4Y33A 5H6QA 4H4KC 4BJTA 4DNCA 4F3QA 5H20A 4HNVA 4N9IA 1B8IB 2EPFA 2ZO4A 2W48A 3IWFA 3AL0B 4NHJA 1IRZA 1HBXG 3IH4A 2Q8KA 3TO9A 1BR2A 1D1BA 2R4GA 3TEDA 4M74A 3S14J 2JN6A 4PFPA 1BJZA 2GIVA 2QM3A 2OF7A 5ILUA 3ASOH 3IUOA 2IW5A 2KL4A 4Z2YA 2VONA 2ZJQF 1WQ2A 1MBEA 4JX6A 1IN4A 2O5RA 2LOOA 1ZGWA 4RGUA 2NOJB 3EUAA 2P4WA 2RNGA 5EZHA 3FXUA 3M9AA 2MABA 4M9ZA 4BJ5C 2MD5A 5E1ZB 1CF7A 2M0CA 4MO7A 5IT9Z 2PFBA 3LSGA 1B72A 3CC2I 3M1CA 2OA4A 4V2FA 2IS1A 4EM1A 3CTAA 4KYWA 2HVQA 1DUXC 3MN2A 2VB6A 2O61A 1YJWI 2MYSA 4Q48A 1TT0A 5D6FA 3MFKA 4CUGA 3K4MA 1Q1HA 4N0BA 2ZXIA 3VYTB 2D5VA 1RKTA 3CCLI 2Y75A 4QWQA 3P9CA 2ZJRF 4E7ZA 1QHGA 3GCMA 3VDXA 2VLAA 3BR5A 1R5ID 2OBPA 3PUBA 1FOYA 1J0RA 3BG3A 3PUFA 4GO1A 3V7CA 3OYAA 4G12A 2HGCA 1F36A 4AYBN 3ZMUA 1XC5A 3EUHA 4F52A 3CC4I 4EJWA 4UY8I 1AOYA 3CP8A 4LB6B 3JW4A 4PFOA 3RZDJ 1TL8A 2QVOA 1JHFA 3WE3A 1Z9CA 1W36D 2NS0A 3N4MA 2O8KA 4E7IA 5BPDA 3A4CA 1VNDA 3SQNA 2L02A 4QPOA 1X4PA 2ELKA 4E7SA 2M3AA 4BAYA 3JRHA 2BV6A 3OOPA 4X6AJ 4IRHA 1X19A 2XVCA 2XAJA 1ODDA 4ZDOA 3OYKA 2P5VA 2X4HA 3WHBA 5D6EA 3V8KA 2E2IJ 1UHWA 2DPUA 2Z1DA 2VJ4A 2R7WA 1KYZA 2VE9A 5GTHC 2Y69H 2JQ7A 3GMEA 3E1SA 3SHFA 4I02A 4LJZF 1Y39A 3JTGA 3S3OA 2E36A
chains in the Genus database with same CATH topology
5FFZA 1ULYA 2QBYA 1XSDA 1U5TB 3IKTA 3NEUA 4HV5A 1TNSA 1MDMB 2V1UA 5BPIA 3P7NA 2EFNA 1W5TA 1QO0D 5E8IA 1TBXA 1I1GA 1FP1D 3LWFA 2QBYB 1L3LA 1UB9A 1Y0UA 5D4SA 2FSWA 3V7SA 1QZYA 5HOOA 5BOXA 5JFRA 1MZBA 5E18F 3BJAA 1Z7UA 3FZVA 2QYOA 2Z99A 3W6JB 2MA3A 3ZMZA 1YG2A 2FU4A 1BI2A 1B9NA 4XBFA 5K1YA 4UNOA 1S8NA 2K7LA 3RKYA 3E5XA 1O7FA 4LLLA 1WSUA 2E1CA 2XAFA 3EDPA 5CVUA 4UVCA 1X3UA 4U7DA 5HDKA 5TRDA 1O3QA 4G7ZF 1ZN2A 4OINF 2GXGA 1PUEE 3I53A 3IC7A 5HDNA 1XCBA 2L4MA 2A3SA 3E97A 4RB1A 3GW2A 4Y13A 3T1BA 3L00A 4HYEA 3TQNA 1TW3A 1USSA 1LQ1A 5IT9K 4PDKA 2IRFG 2P8TA 4JK1X 2D45A 3BPXA 1R5GA 2P6SA 4KUMA 3JTHA 4RAYA 1R5HA 4KNYA 2LF8A 2F5CA 4A12A 1A04A 2A6HF 4G9YA 2IVMA 1OYIA 3QOPA 2B0LA 1XGNA 3D0SA 5DV5A 2JT1A 4XRFA 2F5DA 2QZ8A 2G9WA 3CJNA 4EQQA 2XKPA 1OKRA 4RB2C 1DDNA 2W25A 2J5PA 3IRQA 3GLXA 3K1NA 1S7OA 4FX0A 2E7WA 3I59B 1U3EM 2Y0MA 3HOTA 4BQAA 1BJAA 3SZPA 4KN7X 1GXQA 3R61A 1ZHFA 1LJ9A 4RB3C 4HZFA 3R6SA 5LHGA 2ZMEA 3ELKA 4WCGA 4MQVA 4MTDA 5FD5A 2O3FA 5HS7A 2FOKA 1BM9A 4I0AA 4ZZLA 4U7BA 1HKQA 4ESJA 2COMA 1JXSA 2X0LA 4ETSA 4U0VA 3DEUA 4L9NA 4CDGA 5LGTA 4UUVA 3LAJA 2ZMEB 5IT3A 1HW1A 2DBBA 4A6DA 1F9NA 3HSRA 5A2QZ 3TDZC 3Q9VA 5E1WA 2F5FA 2XUBA 2KJCA 5LEKA 2D1HA 4OMYA 2HYGD 3J80Z 3I58A 1JGSA 1W7PA 3ZMSA 2DI3A 3GZ5A 4RAZA 5HVQC 5JI6A 2FRHA 2OQGA 3IKVA 1P4AA 4U0WA 1ZAOA 2H6CA 2HTJA 3SFZA 2PN6A 3F22A 1FYLA 3U1DA 1JHHA 3B02A 1BIAA 5DYMA 2HKOA 3RDIA 1R23A 2GAUA 2BEOA 4KIFA 2EFPA 1H9TA 1B6AA 1E2XA 1U2WA 3V8JA 3ROUA 2P7CB 2DO7A 3CLOA 2EB7A 5J6XA 2FNPA 3NRVA 4IPAA 1FSHA 3ZMDA 3HRSA 4GCVA 2GWRA 4G6DA 3O6BB 4AVPA 2EFQA 2JRTA 3GVAA 2PQ8A 3KETA 3V4GA 3L09A 4TV7A 1Z1DA 3GF2A 1G3WA 1PDNC 3QAHA 4KFCA 3I71A 3E5UA 1QBJA 3REOA 1T0FA 3BY6A 1ZLKA 4BH9A 2RGVA 1IRFA 2M8EA 1TW2A 1BI1A 5L3BA 3PQJA 4GYIA 4HDVA 2VT2A 2ZBKA 4IF4A 4MHGA 2P5LC 3C7JA 3R0JA 4U88A 1B4AA 4A6EA 1U5TA 3HRTA 1AWCA 1MDMA 2M45A 1KGSA 3I4PA 2JPBA 4LLGF 1RZ4A 4KICA 5L3DA 3WTYC 3LA7A 2VT3A 4I01A 2ZFWA 3K2ZA 2EA2A 1YW8A 3DPTA 2Z33A 3RIRA 1MGTA 4UVAA 3N97A 3DFGA 4GGGA 3S2WA 4KA4A 4HAMA 2DQRA 1SAXA 2IT0A 4H0EA 2GQQA 1KU3A 2PMHA 1FY7A 4L0ZB 2YR2A 1WWXA 4AIJA 1R1UA 5HS8A 2W24A 1IN8A 1CF7B 3ZQ7A 4QLCU 3QP6A 3M8EA 3F6OA 2VBYA 4OIQF 1SFXA 2MC3A 2VOPA 3DV8A 2YX4A 3FX3A 1IAWA 1ON2A 5DD8A 1D3YA 4EJOA 2VC1A 2F2EA 3V8LA 1BIBA 4WK8F 3F23A 2OZ6A 4LG0B 1XSXA 4XSXF 1VTNC 3E5QA 1XDSA 2BBYA 3VB2A 3TDUC 4YIIA 1LNWA 2L01A 2HS5A 1P92A 3FMSA 1SD6A 4ZYDA 4Y17A 3HSEA 1IN6A 2EJRA 1JE8A 1KU2A 3ABUA 2VC0A 2DAOA 4XLNF 2ZCWA 1F1ZA 4HX7A 1BC8C 3I64A 1G3SA 4EM2A 3RPUA 3FMQA 2LDUA 2DPDA 5KK1A 1XGSA 2AXLA 2V1XA 4YG2F 3SXYA 1H0MA 2ISYA 2KJBA 2XASA 1LDKB 4KIGA 2XAGA 1XGOA 4ZYEA 5LHIA 2EA4A 1WKMA 3DF8A 4IJAA 4RGSA 3KEOA 1SD7A 2CFXA 3HOSA 3KLNA 3TO6A 2QQBA 5BQTA 2FBIA 3WG9A 5F64A 4CZZA 2M87A 2ISZA 5E20A 2ESNA 2FQ3A 4ASNA 4XSZF 3BWGA 2ELHA 1UFMA 3DQVC 4PCQA 3WGGA 4EJTA 4Q4ZF 4HQMA 4UV9A 1IRGA 2HTSA 2PEXA 1U8RA 1R22A 4NQWA 5DEQA 5LGNA 3B73A 1SMYF 2TDXA 1P6RA 3Q9SA 4UV8A 4ENNA 3FM5A 3J81Z 5JHUA 4S04A 2DU9A 3DKWA 1HKSA 1LB2A 1YIOA 5H6RA 1G6NA 4M6YA 4HX4A 3QPHA 3FWEA 2ZJ2A 4P9FA 4L0YB 1W7PB 3F8FA 1ZGAA 4KMUX 1S29A 4LK1F 2AS5F 3GFMA 4FX4A 3GXOA 5D5UB 5D4RA 2FXAA 3H3UA 2STTA 2W84A 2LNBA 1O7LA 4EJVA 2VODA 2WWYA 4Y15A 3FXQA 1SD4A 2L4AA 4LMYA 1XGMA 2JTVA 1RI7A 1UCRA 4LFUA 3MAJA 2DQLA 3BROA 4NB5A 3KP3A 5LLQA 5L3GA 5L3FA 3U9GA 3VEPA 1KU7A 2RQPA 1HW5A 3ML6A 2A68F 2MLGA 1B9MA 4BHPA 3K1PA 4Q47A 5TJJA 3P9IA 1FBSA 1FSEA 5D5VB 2HR3A 3M8FA 4AWXB 1YO5C 1YYVA 3H92A 4WWCA 2ZKZA 4G6QA 2E1NA 3WTZA 2BYVE 1RIOH 3BDDA 1ZG1A 1OPCA 2DFIA 4I09A 4ESFA 4AIHA 5L3EA 1REPC 1ZRCA 3EYIA 1T98A 4I98B 4OOIA 4HLYA 3W6KB 2Q0OA 1RUNA 4GYGA 5LRSA 1FX7A 3QU6A 3G3ZA 1ZG3A 4A0YA 3TOAA 3IHUA 1R7JA 2V9VA 2IPQX 1ZREA 4M72A 4HOBA 5FB2A 2O6GE 2OZUA 2LSOA 4ENJA 1H9GA 1J9IA 5DCFA 2VBWA 3RJPA 3LQRA 4P96A 2XKOA 1T39A 4CYDA 2QWWA 3ZMVA 4EVIA 1U6GA 3F8NA 4P9UA 1BC7C 2H94A 4FT8A 3V7RA 1GVJA 1BN5A 4HW0A 4HV6A 3D5LA 2F5EA 1BI3A 3C3WA 3E3VA 2PMUA 4BYYA 2BE5F 2OQRA 2Q2EA 3PQKA 2HOEA 1T2KA 1FLIA 2P5KA 2R7FA 4HDUA 2QQ9A 2QLZA 2HZTA 1EV7A 2NAZA 3ECOA 5D5WB 1TTYA 1P4WA 1B59A 2DT5A 4P55A 1XD7A 2K02A 2CW0F 3ZP5A 3E6BA 3ISPA 5KVRA 5LRRA 2XRNA 4L5IA 4HQEA 3DPLC 5ICEA 3RPQA 4A5NA 1R36A 1SMTA 2ACJA 4A2UA 1PP8F 5FFXA 2HQNA 4A0XA 1BOAA 2ETHA 3F3XA 1RUOA 2JZYA 3R60A 2FF4A 1XN7A 4KT5C 4A0ZA 1FP2A 1HQCA 2PBIA 1J5YA 4IHSA 2EV0A 3LAPA 5ICGA 3I5UA 2DK8A 1Z6TA 2L54A 3ULQB 3GYHX 1I6XA 2XAHA 1D8JA 2LF7A 3BJOA 1OR7A 1I1SA 3R0AA 1IN7A 3ECHA 3MZHA 1B1BA 1XMKA 2EWNA 4ZZDA 4O5VA 3WTVC 4LGWA 4CXFA 3VFZA 1L0OC 4CO8A 4YFXF 4G7HF 3HHHA 2C6YA 3WGIA 3RTRA 5HDGA 4MEYF 5J8FA 5JR3A 2EV6A 3LSTA 2PLYA 2RDPA 4IRGA 1FPQA 4L9TA 3KP7A 2KKOA 2FMYA 1KU9A 2YX7A 2YSRA 4M9SA 3R4KA 3ZN0A 3K0LA 2GXBA 3ERED 1O3RA 2M5WA 2FBHA 3ZMTA 1C0WA 5JVTA 3KP4A 2PG4A 4OMZA 1LEBA 1D5VA 1GXPA 4HA8A 3CUQC 1XMAA 3F21A 2IA2A 4CICA 4R1HA 3I0TA 2MH9A 3P9KA 1KQ9A 1IF1A 3HHGA 4EGYA 4HF2A 1IXRC 5AIQA 1ZARA 1EH8A 3KZZA 4I0BA 2NRAC 3H3ZA 4EV0A 1ZRFA 3JSPA 4CGZA 1G3YA 2VOOA 2VN2A 3L2CA 2W85A 4ON0A 1XSVA 1QGPA 1DPRA 3QP5A 3C1DA 4RS8A 5D8KB 3BJ6A 3QRFF 2ADUA 4YFKF 3KLOA 2GA1A 4G7OF 4EMSA 1W5SA 2HYFA 3KFWX 1SFUA 3RKXA 3CUQA 1MD0A 3LQQA 1T6SA 2QENA 3J7AO 4HF1A 5ILVA 1S7AA 3MZYA 5ICFA 4N9HA 5F1RA 1P4XA 3GFLA 5LBQA 2VBXA 2XGXA 2NNNA 5HLGA 3FF5A 3HTUA 4ENKA 3C18A 4RGXA 3K1MA 5FGMA 2HEOA 2HFHA 4AD9A 2ZXJA 2DLLA 2ZNZA 2DTRA 1FT9A 1U78A 1KQ8A 3GEZA 5DCMA 2XAQA 3HRMA 3WE2A 4BNCA 1OYWA 1RNLA 5D8LB 4DQ2A 3ZPLA 3Q5FA 4AIKA 2OD5A 2RN7A 3BOQA 2STWA 3EQLF 4ESBA 2KIFA 1HW2A 4L9VA 2O0YA 3RKWA 1WI9A 2O8XA 4G94A 1OYYA 4M73A 1J7KA 4M6XA 5E1XA 5DCMB 2JSCA 4OIOF 1QPMA 5CJ9A 2R3SA 1J75A 3WODF 5LGUA 1KYWA 1YFHA 4O6JA 3AAFA 4GXOA 1XCVA 3F6VA 3T8RA 1R1TA 5K5OA 1FYMA 1W4MA 3HYIA 2RV8A 1QQIA 2HQRA 4I2OA 2XHKA 1G3TA 3HUGA 3M1EA 2CO5A 1LEAA 1ZG5A 3KP6A 2A6EF 3HRUA 4MQ9F 3RI4A 1FOKA 2K27A 4OIRF 2FEZA 2IA0A 2NYXA 2ZNYA 2Z5UA 4EM0B 5BMZA 1FYKA 3TO7A 5CVRA 5CVJA 4CHUA 3T0YA 1WRJA 1TQPA 3CUOA 3J80K 1ON1A 4IXAA 2CYYA 5K5RA 2FNAA 2HKXA 3G73A 2UWMA 2V79A 1IW7F 1EH6A 3WU1B 1YW9A 3DXJF 1EH7A 2WC2A 4LD5A 2YU3A 1ONVA 3CDHA 4MNUA 1IXSB 2XV4S 4RGRA 2M1BA 5FD6A 3KCCA 3WTSC 3VOEA 5BS6A 1TNTA 1R1VA 2V1DA 3MQ0A 1SFEA 4LB5A 4HBLA 4M9XA 3L9FA 1O3TA 2P7VB 1Z05A 4R8HA 3MWMA 1K78A 3OV8A 4KIBA 3GO5A 2EFOA 3PFIA 1G4DA 1S6LA 3I54A 2D2WA 4U0YA 5CLSA 1MJAA 3JAMK 3JAMZ 2ESHA 2IA1A 3GUDA 2IJLA 3L7WA 2H27A 1BBYA 3HIFA 3KZYA 1BI0A 5HS9A 3U2RA 5CYVA 1K78B 1F4KA 2RC4A 1CGPA 1HKTA 4IVNA 1V3FA 4WX9A 2A69F 4HLXA 2L3DA 2K86A 3CO6C 3WTXC 2XIGA 4KMFA 1W7PD 5ICCA 1O57A 2CG4A 1LDDA 3QU3A 5D5XB 3J81K 1USTA 5K5QA 4K2EA 1DPUA 5EEGA 5ILSA 2G7UA 2IP2A 2OAZA 4YFNF 2EV5A 3TKYA 4D0PA 2CSOA 5E17F 1HSTA 4I7HA 5F6FA 2J5OA 2H6BA 2Z9OA 1FC3A 4UVBA 1K6OA 3SZTA 1Z6RA 4HF0A 1T38A 4BHBA 3FM3A 3WTWC 2MLKA 1K79A 3E6DA 3GFJA 3VODA 2QQAA 4ZH4F 2FA5A 3F8MA 1IXCA 3BP8A 4LK0F 5DUIA 5DD4A 1HSJA 3K9TA 4LG0A 3F8BA 5LEJA 1IUYA 4S05A 2G7HA 1V4RA 2Y48A 1ZYRF 2CWEA 3MEXA 2FE3A 2CQKA 1UHMA 4HX8A 4R79A 5ED4A 5FO5A 3FMRA 1QZZA 4EJUA 3CUQB 3IL2A 3WTUC 4O3MA 3E6CC 3ZN1A 2K4BA 1GHCA 1FWZA 2A07F 5E8GA 3RYRA 4B8XA 3E6MA 1KA8A 1D8KA 2KIUA 1TQMA 1MKMA 1QNTA 4IHTA 1I5ZA 1IZ1A 4L18B 3I59A 5FLXK 3F72A 1KQ0A 2DW4A 2WV0A 1Z91A 4B09A 3NQOA 3IWZA 4IRIA 2HWVA 2HDCA 3JSOA 1YQAA 2EK5A 1FZPB 1STZA 3K69A 1YS7A 5J8CA 4JBAA 1IN5A 3ABTA 2QUFA 1FBQA 2YPRA 1TQIA 4L9JA 4PGGA 3TGNA 3GFIA 2PI0A 1R00A 3FHZA 3KP2A 3RYPA 4LLNA 3WGHA 4KDPA 2D1VA 1J59A 2RKHA 3GZ6A 3WU0A 4UXNA 1MJ9A 3GX4X 3LA3A 1FBUA 1HXDA 1LVAA 3EETA 1I27A 2H09A 3MCZA 4UHTA 4M71A 4A5MA 1MJBA 4ENMA 2PJPA 4MGRA 3KE2A 2VXZA 4OU0A 5HLIA 2CGPA 1LDJA 4PGHA 4Q5SF 1TLHB 5DDGA 1FNNA 1YW7A 4ZYHA 2RVCA 2GZWA 2KIMA 2OU2A 1PP7U 3HSFA 2FBKA 1ZGJA 3BPVA 4MTEA 3BZ6A 4MEXF 4PZJA 2UXXA 5AIPA 3HTSB 1U5TC 4WXDA 3M7GA 5CVVA 4F7ZA 1SD5A 2RNJA 1DP7P 4RB0A 2JPCA 4E70A 2VE8A 1P2FA 4XLPF 1YLFA 4FHTA 3FXRA 2M30A 1XDUA 4P5OA 4OIPF 3DP7A 5ERIA 2KRFA 4YIFA 6PAXA 2P6TA 2UXNA 3TOBA 5CVIA 4WXHA 5DUKA 3T8TA 1S3JA 1ZRDA 2W57A 5EEHA 2MH2A 2V6CA 2WTEA 1O3SA 4G8XA 2NNYA 4WXCA 2FMLA 3QPTA 4BXUA 3LFKA 3EYYA 2A5YB 3COAC 2EFWA 1XB4A 3WTTC 3O2PE 1J2XA 1R58A 3KP5A 1E17A 2UZKA 2DK5A 3LA2A 1NHAA 4ZYGA 5L3CA 2LKPA 5FLXZ 3CO7C 2Z3YA 1YS6A 3GWZA 1ZH5A 2GA2A 5LHHA 4WF2A 3IRRA 1K7AA 3KEQA 2BGCA 1YTYA 4KN4X 3O3KA 2O03A 1F5TA 5HLHA 2VBZA 5AONA 1OMIA 1ZLJA 2A61A 2E7XA 4L5JA 3F8CA 2R7DA 2XROA 2K4JA 2MBFA 5A2QK 4EGZA 4JQFA 4BHCA 3T5XA 5H6QA 4DNCA 5H20A 4N9IA 2ZO4A 3IWFA 4NHJA 1HBXG 2Q8KA 3TO9A 4M74A 2GIVA 2QM3A 5ILUA 2IW5A 4Z2YA 2VONA 1WQ2A 1IN4A 4RGUA 2P4WA 3FXUA 3M9AA 4M9ZA 2MD5A 5E1ZB 1CF7A 5IT9Z 2PFBA 2OA4A 4EM1A 3CTAA 4KYWA 1DUXC 2O61A 4Q48A 5D6FA 3MFKA 1Q1HA 4N0BA 2Y75A 4QWQA 3P9CA 2OBPA 1J0RA 4GO1A 3V7CA 2HGCA 3ZMUA 3EUHA 4EJWA 1AOYA 4LB6B 3JW4A 2QVOA 1JHFA 3WE3A 1Z9CA 2NS0A 3N4MA 5BPDA 3SQNA 2L02A 4BAYA 2BV6A 3OOPA 4IRHA 2XVCA 2XAJA 1ODDA 2P5VA 2X4HA 5D6EA 3V8KA 1UHWA 2DPUA 1KYZA 2VE9A 3SHFA 4I02A 4LJZF 3JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFZ A;  1ULY A;  2QBY A;  1XSD A;  1U5T B;  3IKT A;  3NEU A;  4HV5 A;  1TNS A;  1MDM B;  2V1U A;  5BPI A;  3P7N A;  2EFN A;  1W5T A;  1QO0 D;  5E8I A;  1TBX A;  1I1G A;  1FP1 D;  3LWF A;  2QBY B;  1L3L A;  1UB9 A;  1Y0U A;  5D4S A;  2FSW A;  3V7S A;  1QZY A;  5HOO A;  5BOX A;  5JFR A;  1MZB A;  5E18 F;  3BJA A;  1Z7U A;  3FZV A;  2QYO A;  2Z99 A;  3W6J B;  2MA3 A;  3ZMZ A;  1YG2 A;  2FU4 A;  1BI2 A;  1B9N A;  4XBF A;  5K1Y A;  4UNO A;  1S8N A;  2K7L A;  3RKY A;  3E5X A;  1O7F A;  4LLL A;  1WSU A;  2E1C A;  2XAF A;  3EDP A;  5CVU A;  4UVC A;  1X3U A;  4U7D A;  5HDK A;  5TRD A;  1O3Q A;  4G7Z F;  1ZN2 A;  4OIN F;  2GXG A;  1PUE E;  3I53 A;  3IC7 A;  5HDN A;  1XCB A;  2L4M A;  2A3S A;  3E97 A;  4RB1 A;  3GW2 A;  4Y13 A;  3T1B A;  3L00 A;  4HYE A;  3TQN A;  1TW3 A;  1USS A;  1LQ1 A;  5IT9 K;  4PDK A;  2IRF G;  2P8T A;  4JK1 X;  2D45 A;  3BPX A;  1R5G A;  2P6S A;  4KUM A;  3JTH A;  4RAY A;  1R5H A;  4KNY A;  2LF8 A;  2F5C A;  4A12 A;  1A04 A;  2A6H F;  4G9Y A;  2IVM A;  1OYI A;  3QOP A;  2B0L A;  1XGN A;  3D0S A;  5DV5 A;  2JT1 A;  4XRF A;  2F5D A;  2QZ8 A;  2G9W A;  3CJN A;  4EQQ A;  2XKP A;  1OKR A;  4RB2 C;  1DDN A;  2W25 A;  2J5P A;  3IRQ A;  3GLX A;  3K1N A;  1S7O A;  4FX0 A;  2E7W A;  3I59 B;  1U3E M;  2Y0M A;  3HOT A;  4BQA A;  1BJA A;  3SZP A;  4KN7 X;  1GXQ A;  3R61 A;  1ZHF A;  1LJ9 A;  4RB3 C;  4HZF A;  3R6S A;  5LHG A;  2ZME A;  3ELK A;  4WCG A;  4MQV A;  4MTD A;  5FD5 A;  2O3F A;  5HS7 A;  2FOK A;  1BM9 A;  4I0A A;  4ZZL A;  4U7B A;  1HKQ A;  4ESJ A;  2COM A;  1JXS A;  2X0L A;  4ETS A;  4U0V A;  3DEU A;  4L9N A;  4CDG A;  5LGT A;  4UUV A;  3LAJ A;  2ZME B;  5IT3 A;  1HW1 A;  2DBB A;  4A6D A;  1F9N A;  3HSR A;  5A2Q Z;  3TDZ C;  3Q9V A;  5E1W A;  2F5F A;  2XUB A;  2KJC A;  5LEK A;  2D1H A;  4OMY A;  2HYG D;  3J80 Z;  3I58 A;  1JGS A;  1W7P A;  3ZMS A;  2DI3 A;  3GZ5 A;  4RAZ A;  5HVQ C;  5JI6 A;  2FRH A;  2OQG A;  3IKV A;  1P4A A;  4U0W A;  1ZAO A;  2H6C A;  2HTJ A;  3SFZ A;  2PN6 A;  3F22 A;  1FYL A;  3U1D A;  1JHH A;  3B02 A;  1BIA A;  5DYM A;  2HKO A;  3RDI A;  1R23 A;  2GAU A;  2BEO A;  4KIF A;  2EFP A;  1H9T A;  1B6A A;  1E2X A;  1U2W A;  3V8J A;  3ROU A;  2P7C B;  2DO7 A;  3CLO A;  2EB7 A;  5J6X A;  2FNP A;  3NRV A;  4IPA A;  1FSH A;  3ZMD A;  3HRS A;  4GCV A;  2GWR A;  4G6D A;  3O6B B;  4AVP A;  2EFQ A;  2JRT A;  3GVA A;  2PQ8 A;  3KET A;  3V4G A;  3L09 A;  4TV7 A;  1Z1D A;  3GF2 A;  1G3W A;  1PDN C;  3QAH A;  4KFC A;  3I71 A;  3E5U A;  1QBJ A;  3REO A;  1T0F A;  3BY6 A;  1ZLK A;  4BH9 A;  2RGV A;  1IRF A;  2M8E A;  1TW2 A;  1BI1 A;  5L3B A;  3PQJ A;  4GYI A;  4HDV A;  2VT2 A;  2ZBK A;  4IF4 A;  4MHG A;  2P5L C;  3C7J A;  3R0J A;  4U88 A;  1B4A A;  4A6E A;  1U5T A;  3HRT A;  1AWC A;  1MDM A;  2M45 A;  1KGS A;  3I4P A;  2JPB A;  4LLG F;  1RZ4 A;  4KIC A;  5L3D A;  3WTY C;  3LA7 A;  2VT3 A;  4I01 A;  2ZFW A;  3K2Z A;  2EA2 A;  1YW8 A;  3DPT A;  2Z33 A;  3RIR A;  1MGT A;  4UVA A;  3N97 A;  3DFG A;  4GGG A;  3S2W A;  4KA4 A;  4HAM A;  2DQR A;  1SAX A;  2IT0 A;  4H0E A;  2GQQ A;  1KU3 A;  2PMH A;  1FY7 A;  4L0Z B;  2YR2 A;  1WWX A;  4AIJ A;  1R1U A;  5HS8 A;  2W24 A;  1IN8 A;  1CF7 B;  3ZQ7 A;  4QLC U;  3QP6 A;  3M8E A;  3F6O A;  2VBY A;  4OIQ F;  1SFX A;  2MC3 A;  2VOP A;  3DV8 A;  2YX4 A;  3FX3 A;  1IAW A;  1ON2 A;  5DD8 A;  1D3Y A;  4EJO A;  2VC1 A;  2F2E A;  3V8L A;  1BIB A;  4WK8 F;  3F23 A;  2OZ6 A;  4LG0 B;  1XSX A;  4XSX F;  1VTN C;  3E5Q A;  1XDS A;  2BBY A;  3VB2 A;  3TDU C;  4YII A;  1LNW A;  2L01 A;  2HS5 A;  1P92 A;  3FMS A;  1SD6 A;  4ZYD A;  4Y17 A;  3HSE A;  1IN6 A;  2EJR A;  1JE8 A;  1KU2 A;  3ABU A;  2VC0 A;  2DAO A;  4XLN F;  2ZCW A;  1F1Z A;  4HX7 A;  1BC8 C;  3I64 A;  1G3S A;  4EM2 A;  3RPU A;  3FMQ A;  2LDU A;  2DPD A;  5KK1 A;  1XGS A;  2AXL A;  2V1X A;  4YG2 F;  3SXY A;  1H0M A;  2ISY A;  2KJB A;  2XAS A;  1LDK B;  4KIG A;  2XAG A;  1XGO A;  4ZYE A;  5LHI A;  2EA4 A;  1WKM A;  3DF8 A;  4IJA A;  4RGS A;  3KEO A;  1SD7 A;  2CFX A;  3HOS A;  3KLN A;  3TO6 A;  2QQB A;  5BQT A;  2FBI A;  3WG9 A;  5F64 A;  4CZZ A;  2M87 A;  2ISZ A;  5E20 A;  2ESN A;  2FQ3 A;  4ASN A;  4XSZ F;  3BWG A;  2ELH A;  1UFM A;  3DQV C;  4PCQ A;  3WGG A;  4EJT A;  4Q4Z F;  4HQM A;  4UV9 A;  1IRG A;  2HTS A;  2PEX A;  1U8R A;  1R22 A;  4NQW A;  5DEQ A;  5LGN A;  3B73 A;  1SMY F;  2TDX A;  1P6R A;  3Q9S A;  4UV8 A;  4ENN A;  3FM5 A;  3J81 Z;  5JHU A;  4S04 A;  2DU9 A;  3DKW A;  1HKS A;  1LB2 A;  1YIO A;  5H6R A;  1G6N A;  4M6Y A;  4HX4 A;  3QPH A;  3FWE A;  2ZJ2 A;  4P9F A;  4L0Y B;  1W7P B;  3F8F A;  1ZGA A;  4KMU X;  1S29 A;  4LK1 F;  2AS5 F;  3GFM A;  4FX4 A;  3GXO A;  5D5U B;  5D4R A;  2FXA A;  3H3U A;  2STT A;  2W84 A;  2LNB A;  1O7L A;  4EJV A;  2VOD A;  2WWY A;  4Y15 A;  3FXQ A;  1SD4 A;  2L4A A;  4LMY A;  1XGM A;  2JTV A;  1RI7 A;  1UCR A;  4LFU A;  3MAJ A;  2DQL A;  3BRO A;  4NB5 A;  3KP3 A;  5LLQ A;  5L3G A;  5L3F A;  3U9G A;  3VEP A;  1KU7 A;  2RQP A;  1HW5 A;  3ML6 A;  2A68 F;  2MLG A;  1B9M A;  4BHP A;  3K1P A;  4Q47 A;  5TJJ A;  3P9I A;  1FBS A;  1FSE A;  5D5V B;  2HR3 A;  3M8F A;  4AWX B;  1YO5 C;  1YYV A;  3H92 A;  4WWC A;  2ZKZ A;  4G6Q A;  2E1N A;  3WTZ A;  2BYV E;  1RIO H;  3BDD A;  1ZG1 A;  1OPC A;  2DFI A;  4I09 A;  4ESF A;  4AIH A;  5L3E A;  1REP C;  1ZRC A;  3EYI A;  1T98 A;  4I98 B;  4OOI A;  4HLY A;  3W6K B;  2Q0O A;  1RUN A;  4GYG A;  5LRS A;  1FX7 A;  3QU6 A;  3G3Z A;  1ZG3 A;  4A0Y A;  3TOA A;  3IHU A;  1R7J A;  2V9V A;  2IPQ X;  1ZRE A;  4M72 A;  4HOB A;  5FB2 A;  2O6G E;  2OZU A;  2LSO A;  4ENJ A;  1H9G A;  1J9I A;  5DCF A;  2VBW A;  3RJP A;  3LQR A;  4P96 A;  2XKO A;  1T39 A;  4CYD A;  2QWW A;  3ZMV A;  4EVI A;  1U6G A;  3F8N A;  4P9U A;  1BC7 C;  2H94 A;  4FT8 A;  3V7R A;  1GVJ A;  1BN5 A;  4HW0 A;  4HV6 A;  3D5L A;  2F5E A;  1BI3 A;  3C3W A;  3E3V A;  2PMU A;  4BYY A;  2BE5 F;  2OQR A;  2Q2E A;  3PQK A;  2HOE A;  1T2K A;  1FLI A;  2P5K A;  2R7F A;  4HDU A;  2QQ9 A;  2QLZ A;  2HZT A;  1EV7 A;  2NAZ A;  3ECO A;  5D5W B;  1TTY A;  1P4W A;  1B59 A;  2DT5 A;  4P55 A;  1XD7 A;  2K02 A;  2CW0 F;  3ZP5 A;  3E6B A;  3ISP A;  5KVR A;  5LRR A;  2XRN A;  4L5I A;  4HQE A;  3DPL C;  5ICE A;  3RPQ A;  4A5N A;  1R36 A;  1SMT A;  2ACJ A;  4A2U A;  1PP8 F;  5FFX A;  2HQN A;  4A0X A;  1BOA A;  2ETH A;  3F3X A;  1RUO A;  2JZY A;  3R60 A;  2FF4 A;  1XN7 A;  4KT5 C;  4A0Z A;  1FP2 A;  1HQC A;  2PBI A;  1J5Y A;  4IHS A;  2EV0 A;  3LAP A;  5ICG A;  3I5U A;  2DK8 A;  1Z6T A;  2L54 A;  3ULQ B;  3GYH X;  1I6X A;  2XAH A;  1D8J A;  2LF7 A;  3BJO A;  1OR7 A;  1I1S A;  3R0A A;  1IN7 A;  3ECH A;  3MZH A;  1B1B A;  1XMK A;  2EWN A;  4ZZD A;  4O5V A;  3WTV C;  4LGW A;  4CXF A;  3VFZ A;  1L0O C;  4CO8 A;  4YFX F;  4G7H F;  3HHH A;  2C6Y A;  3WGI A;  3RTR A;  5HDG A;  4MEY F;  5J8F A;  5JR3 A;  2EV6 A;  3LST A;  2PLY A;  2RDP A;  4IRG A;  1FPQ A;  4L9T A;  3KP7 A;  2KKO A;  2FMY A;  1KU9 A;  2YX7 A;  2YSR A;  4M9S A;  3R4K A;  3ZN0 A;  3K0L A;  2GXB A;  3ERE D;  1O3R A;  2M5W A;  2FBH A;  3ZMT A;  1C0W A;  5JVT A;  3KP4 A;  2PG4 A;  4OMZ A;  1LEB A;  1D5V A;  1GXP A;  4HA8 A;  3CUQ C;  1XMA A;  3F21 A;  2IA2 A;  4CIC A;  4R1H A;  3I0T A;  2MH9 A;  3P9K A;  1KQ9 A;  1IF1 A;  3HHG A;  4EGY A;  4HF2 A;  1IXR C;  5AIQ A;  1ZAR A;  1EH8 A;  3KZZ A;  4I0B A;  2NRA C;  3H3Z A;  4EV0 A;  1ZRF A;  3JSP A;  4CGZ A;  1G3Y A;  2VOO A;  2VN2 A;  3L2C A;  2W85 A;  4ON0 A;  1XSV A;  1QGP A;  1DPR A;  3QP5 A;  3C1D A;  4RS8 A;  5D8K B;  3BJ6 A;  3QRF F;  2ADU A;  4YFK F;  3KLO A;  2GA1 A;  4G7O F;  4EMS A;  1W5S A;  2HYF A;  3KFW X;  1SFU A;  3RKX A;  3CUQ A;  1MD0 A;  3LQQ A;  1T6S A;  2QEN A;  3J7A O;  4HF1 A;  5ILV A;  1S7A A;  3MZY A;  5ICF A;  4N9H A;  5F1R A;  1P4X A;  3GFL A;  5LBQ A;  2VBX A;  2XGX A;  2NNN A;  5HLG A;  3FF5 A;  3HTU A;  4ENK A;  3C18 A;  4RGX A;  3K1M A;  5FGM A;  2HEO A;  2HFH A;  4AD9 A;  2ZXJ A;  2DLL A;  2ZNZ A;  2DTR A;  1FT9 A;  1U78 A;  1KQ8 A;  3GEZ A;  5DCM A;  2XAQ A;  3HRM A;  3WE2 A;  4BNC A;  1OYW A;  1RNL A;  5D8L B;  4DQ2 A;  3ZPL A;  3Q5F A;  4AIK A;  2OD5 A;  2RN7 A;  3BOQ A;  2STW A;  3EQL F;  4ESB A;  2KIF A;  1HW2 A;  4L9V A;  2O0Y A;  3RKW A;  1WI9 A;  2O8X A;  4G94 A;  1OYY A;  4M73 A;  1J7K A;  4M6X A;  5E1X A;  5DCM B;  2JSC A;  4OIO F;  1QPM A;  5CJ9 A;  2R3S A;  1J75 A;  3WOD F;  5LGU A;  1KYW A;  1YFH A;  4O6J A;  3AAF A;  4GXO A;  1XCV A;  3F6V A;  3T8R A;  1R1T A;  5K5O A;  1FYM A;  1W4M A;  3HYI A;  2RV8 A;  1QQI A;  2HQR A;  4I2O A;  2XHK A;  1G3T A;  3HUG A;  3M1E A;  2CO5 A;  1LEA A;  1ZG5 A;  3KP6 A;  2A6E F;  3HRU A;  4MQ9 F;  3RI4 A;  1FOK A;  2K27 A;  4OIR F;  2FEZ A;  2IA0 A;  2NYX A;  2ZNY A;  2Z5U A;  4EM0 B;  5BMZ A;  1FYK A;  3TO7 A;  5CVR A;  5CVJ A;  4CHU A;  3T0Y A;  1WRJ A;  1TQP A;  3CUO A;  3J80 K;  1ON1 A;  4IXA A;  2CYY A;  5K5R A;  2FNA A;  2HKX A;  3G73 A;  2UWM A;  2V79 A;  1IW7 F;  1EH6 A;  3WU1 B;  1YW9 A;  3DXJ F;  1EH7 A;  2WC2 A;  4LD5 A;  2YU3 A;  1ONV A;  3CDH A;  4MNU A;  1IXS B;  2XV4 S;  4RGR A;  2M1B A;  5FD6 A;  3KCC A;  3WTS C;  3VOE A;  5BS6 A;  1TNT A;  1R1V A;  2V1D A;  3MQ0 A;  1SFE A;  4LB5 A;  4HBL A;  4M9X A;  3L9F A;  1O3T A;  2P7V B;  1Z05 A;  4R8H A;  3MWM A;  1K78 A;  3OV8 A;  4KIB A;  3GO5 A;  2EFO A;  3PFI A;  1G4D A;  1S6L A;  3I54 A;  2D2W A;  4U0Y A;  5CLS A;  1MJA A;  3JAM K;  3JAM Z;  2ESH A;  2IA1 A;  3GUD A;  2IJL A;  3L7W A;  2H27 A;  1BBY A;  3HIF A;  3KZY A;  1BI0 A;  5HS9 A;  3U2R A;  5CYV A;  1K78 B;  1F4K A;  2RC4 A;  1CGP A;  1HKT A;  4IVN A;  1V3F A;  4WX9 A;  2A69 F;  4HLX A;  2L3D A;  2K86 A;  3CO6 C;  3WTX C;  2XIG A;  4KMF A;  1W7P D;  5ICC A;  1O57 A;  2CG4 A;  1LDD A;  3QU3 A;  5D5X B;  3J81 K;  1UST A;  5K5Q A;  4K2E A;  1DPU A;  5EEG A;  5ILS A;  2G7U A;  2IP2 A;  2OAZ A;  4YFN F;  2EV5 A;  3TKY A;  4D0P A;  2CSO A;  5E17 F;  1HST A;  4I7H A;  5F6F A;  2J5O A;  2H6B A;  2Z9O A;  1FC3 A;  4UVB A;  1K6O A;  3SZT A;  1Z6R A;  4HF0 A;  1T38 A;  4BHB A;  3FM3 A;  3WTW C;  2MLK A;  1K79 A;  3E6D A;  3GFJ A;  3VOD A;  2QQA A;  4ZH4 F;  2FA5 A;  3F8M A;  1IXC A;  3BP8 A;  4LK0 F;  5DUI A;  5DD4 A;  1HSJ A;  3K9T A;  4LG0 A;  3F8B A;  5LEJ A;  1IUY A;  4S05 A;  2G7H A;  1V4R A;  2Y48 A;  1ZYR F;  2CWE A;  3MEX A;  2FE3 A;  2CQK A;  1UHM A;  4HX8 A;  4R79 A;  5ED4 A;  5FO5 A;  3FMR A;  1QZZ A;  4EJU A;  3CUQ B;  3IL2 A;  3WTU C;  4O3M A;  3E6C C;  3ZN1 A;  2K4B A;  1GHC A;  1FWZ A;  2A07 F;  5E8G A;  3RYR A;  4B8X A;  3E6M A;  1KA8 A;  1D8K A;  2KIU A;  1TQM A;  1MKM A;  1QNT A;  4IHT A;  1I5Z A;  1IZ1 A;  4L18 B;  3I59 A;  5FLX K;  3F72 A;  1KQ0 A;  2DW4 A;  2WV0 A;  1Z91 A;  4B09 A;  3NQO A;  3IWZ A;  4IRI A;  2HWV A;  2HDC A;  3JSO A;  1YQA A;  2EK5 A;  1FZP B;  1STZ A;  3K69 A;  1YS7 A;  5J8C A;  4JBA A;  1IN5 A;  3ABT A;  2QUF A;  1FBQ A;  2YPR A;  1TQI A;  4L9J A;  4PGG A;  3TGN A;  3GFI A;  2PI0 A;  1R00 A;  3FHZ A;  3KP2 A;  3RYP A;  4LLN A;  3WGH A;  4KDP A;  2D1V A;  1J59 A;  2RKH A;  3GZ6 A;  3WU0 A;  4UXN A;  1MJ9 A;  3GX4 X;  3LA3 A;  1FBU A;  1HXD A;  1LVA A;  3EET A;  1I27 A;  2H09 A;  3MCZ A;  4UHT A;  4M71 A;  4A5M A;  1MJB A;  4ENM A;  2PJP A;  4MGR A;  3KE2 A;  2VXZ A;  4OU0 A;  5HLI A;  2CGP A;  1LDJ A;  4PGH A;  4Q5S F;  1TLH B;  5DDG A;  1FNN A;  1YW7 A;  4ZYH A;  2RVC A;  2GZW A;  2KIM A;  2OU2 A;  1PP7 U;  3HSF A;  2FBK A;  1ZGJ A;  3BPV A;  4MTE A;  3BZ6 A;  4MEX F;  4PZJ A;  2UXX A;  5AIP A;  3HTS B;  1U5T C;  4WXD A;  3M7G A;  5CVV A;  4F7Z A;  1SD5 A;  2RNJ A;  1DP7 P;  4RB0 A;  2JPC A;  4E70 A;  2VE8 A;  1P2F A;  4XLP F;  1YLF A;  4FHT A;  3FXR A;  2M30 A;  1XDU A;  4P5O A;  4OIP F;  3DP7 A;  5ERI A;  2KRF A;  4YIF A;  6PAX A;  2P6T A;  2UXN A;  3TOB A;  5CVI A;  4WXH A;  5DUK A;  3T8T A;  1S3J A;  1ZRD A;  2W57 A;  5EEH A;  2MH2 A;  2V6C A;  2WTE A;  1O3S A;  4G8X A;  2NNY A;  4WXC A;  2FML A;  3QPT A;  4BXU A;  3LFK A;  3EYY A;  2A5Y B;  3COA C;  2EFW A;  1XB4 A;  3WTT C;  3O2P E;  1J2X A;  1R58 A;  3KP5 A;  1E17 A;  2UZK A;  2DK5 A;  3LA2 A;  1NHA A;  4ZYG A;  5L3C A;  2LKP A;  5FLX Z;  3CO7 C;  2Z3Y A;  1YS6 A;  3GWZ A;  1ZH5 A;  2GA2 A;  5LHH A;  4WF2 A;  3IRR A;  1K7A A;  3KEQ A;  2BGC A;  1YTY A;  4KN4 X;  3O3K A;  2O03 A;  1F5T A;  5HLH A;  2VBZ A;  5AON A;  1OMI A;  1ZLJ A;  2A61 A;  2E7X A;  4L5J A;  3F8C A;  2R7D A;  2XRO A;  2K4J A;  2MBF A;  5A2Q K;  4EGZ A;  4JQF A;  4BHC A;  3T5X A;  5H6Q A;  4DNC A;  5H20 A;  4N9I A;  2ZO4 A;  3IWF A;  4NHJ A;  1HBX G;  2Q8K A;  3TO9 A;  4M74 A;  2GIV A;  2QM3 A;  5ILU A;  2IW5 A;  4Z2Y A;  2VON A;  1WQ2 A;  1IN4 A;  4RGU A;  2P4W A;  3FXU A;  3M9A A;  4M9Z A;  2MD5 A;  5E1Z B;  1CF7 A;  5IT9 Z;  2PFB A;  2OA4 A;  4EM1 A;  3CTA A;  4KYW A;  1DUX C;  2O61 A;  4Q48 A;  5D6F A;  3MFK A;  1Q1H A;  4N0B A;  2Y75 A;  4QWQ A;  3P9C A;  2OBP A;  1J0R A;  4GO1 A;  3V7C A;  2HGC A;  3ZMU A;  3EUH A;  4EJW A;  1AOY A;  4LB6 B;  3JW4 A;  2QVO A;  1JHF A;  3WE3 A;  1Z9C A;  2NS0 A;  3N4M A;  5BPD A;  3SQN A;  2L02 A;  4BAY A;  2BV6 A;  3OOP A;  4IRH A;  2XVC A;  2XAJ A;  1ODD A;  2P5V A;  2X4H A;  5D6E A;  3V8K A;  1UHW A;  2DPU A;  1KYZ A;  2VE9 A;  3SHF A;  4I02 A;  4LJZ F;  3JTG A; 
#chains in the Genus database with same CATH topology
 2V6E A;  2LY1 A;  1U9O A;  1WJE A;  5BNG A;  3ABM H;  5FFZ A;  1PVE A;  1ULY A;  1JUM A;  2QBY A;  1XSD A;  1U5T B;  4YRV A;  3IKT A;  3NEU A;  4HV5 A;  2W7N A;  1TNS A;  3OL3 A;  1MDM B;  2V1U A;  3ABK H;  4DBQ A;  5BPI A;  1TT5 B;  3P7N A;  2M34 A;  2NS8 A;  1VQM I;  2EFN A;  1W5T A;  2VKD A;  2GLO A;  1HDD C;  2WAQ N;  4M3E A;  1QO0 D;  4NBQ A;  5GPA A;  5E8I A;  3DEW A;  1TBX A;  3IH3 A;  1I1G A;  1FP1 D;  2W1O A;  3LWF A;  3MD2 A;  2QBY B;  1F43 A;  3KEY A;  1L3L A;  1UB9 A;  1Y0U A;  1OCT C;  5D4S A;  1I39 A;  2FSW A;  1LUJ B;  2NOG A;  3V7S A;  1XS9 A;  2DFH A;  3OYL A;  2CFO A;  1KON A;  2LRD A;  1QZY A;  5HOO A;  5BOX A;  2I5U A;  3W2V A;  4IX7 A;  2DA1 A;  2HVR A;  5JFR A;  1MZB A;  1DQU A;  5E18 F;  2XGC A;  5IYB J;  3BJA A;  3OYM A;  4Y7N J;  1Z7U A;  3DBL B;  3O8G A;  3FZV A;  2QYO A;  2Z99 A;  2KMU A;  3L2W A;  3W6J B;  2MA3 A;  3ZMZ A;  1YG2 A;  1QZE A;  2DMU A;  2FU4 A;  3OMY A;  1BI2 A;  1B9N A;  4XBF A;  5K1Y A;  2DA4 A;  4UNO A;  1S8N A;  2K7L A;  3RKY A;  3E5X A;  3HDD A;  1O7F A;  4OAZ A;  5TIS C;  4LLL A;  4XN0 A;  3CD6 I;  3PNY A;  1WSU A;  2E1C A;  1WJC A;  2XAF A;  2BVM A;  4F55 A;  3ASN H;  4B48 A;  4A3M J;  3EDP A;  3EUK L;  5CVU A;  1SVL A;  4XK4 A;  4UVC A;  4XOP A;  1X3U A;  3I9V 2;  4U7D A;  2DDA A;  5HDK A;  1I50 J;  5TRD A;  1VQN I;  5EYR A;  1O3Q A;  2CUZ A;  5HLT A;  2CUF A;  1MBJ A;  1VQ9 I;  2QA4 I;  1ZN2 A;  4G7Z F;  4OIN F;  1X3Z B;  2GXG A;  2ZC2 A;  1PUE E;  3I53 A;  3IC7 A;  5HDN A;  4PSW A;  1XCB A;  2ZJP F;  2L4M A;  4RAG A;  2A3S A;  3E97 A;  4RB1 A;  2JWT A;  5IP6 A;  3GW2 A;  4Y13 A;  4BY1 J;  2LBF B;  5F0F A;  4BKX A;  2KPM A;  2M2E A;  3T1B A;  2QKL B;  3L00 A;  3NAU A;  4HYE A;  3S8P A;  3TQN A;  2ZME C;  1TW3 A;  4EEF G;  1LFB A;  2BZT A;  1USS A;  1LQ1 A;  3DLA A;  3IAM 2;  3JRA A;  1V5E A;  4FCY A;  3OS1 A;  5C4X J;  1P9Q C;  5IT9 K;  1X1D A;  4PDK A;  2IRF G;  2P8T A;  4JK1 X;  3CCJ I;  2DT6 A;  2D45 A;  2R0Q C;  1D1C A;  3BPX A;  2A6T A;  3B6C A;  3OSF A;  2LLK A;  1R5G A;  2P6S A;  4KUM A;  5EF6 A;  1D1A A;  3U21 A;  2KFD A;  3MMY B;  1X1B A;  3JTH A;  5GAD J;  4CA0 A;  2NVQ J;  4RAY A;  5FKL A;  4CSW A;  4XON A;  1R5H A;  4KNY A;  2LF8 A;  1OCO H;  2F5C A;  1A04 A;  4A12 A;  2A6H F;  5F27 A;  3GTK J;  4G9Y A;  2IVM A;  1OYI A;  2X6W A;  1MMD A;  3HG9 A;  3QOP A;  5DM6 F;  2B0L A;  3UNG C;  1HLV A;  1XGN A;  3D0S A;  4KIS A;  3JRD A;  5FKM A;  3H5N A;  4CCN A;  2LY2 A;  2WY8 Q;  5DV5 A;  3A1Y A;  2JT1 A;  4XRF A;  2F5D A;  2QZ8 A;  2G9W A;  3CJN A;  4EQQ A;  2XKP A;  2M4K A;  1OKR A;  4RB2 C;  1DDN A;  3FXJ A;  5IYD J;  4D5F A;  2W25 A;  2J5P A;  3PO3 J;  3IRQ A;  2GM4 A;  3LOC A;  1G2H A;  1M1E B;  3GLX A;  2VKV A;  3K1N A;  2DFF A;  4Y4R A;  1S7O A;  4GRI A;  2WAF A;  2L9V A;  1UG2 A;  4FX0 A;  2E7W A;  3I59 B;  4AC0 A;  1U3E M;  3HKZ N;  2M8G X;  2Y0M A;  2WAQ A;  3HOT A;  4BQA A;  1BJA A;  4A3J J;  3FK6 A;  3SZP A;  1RES A;  4KN7 X;  1GXQ A;  3R61 A;  1ZHF A;  1LJ9 A;  4RB3 C;  3N05 A;  3FK7 A;  2Y2Z A;  3FDY A;  4HZF A;  2F48 A;  4DJA A;  3OSG A;  2Y0S N;  3R6S A;  5LHG A;  2ZME A;  3ELK A;  2GBY A;  4WCG A;  4CYC A;  5E79 C;  4B43 A;  3S3M A;  1TC3 C;  4MQV A;  3I55 I;  4MTD A;  5FD5 A;  4C30 A;  4E4H A;  2O3F A;  3HL2 A;  5HS7 A;  2FUG 2;  2FOK A;  1BM9 A;  2DN0 A;  2LMD A;  4I0A A;  2HXI A;  4ZZL A;  4U7B A;  5F04 A;  3CLQ A;  4AVZ A;  1HKQ A;  4ESJ A;  2X51 A;  2COM A;  1JXS A;  3CP2 A;  4BE2 A;  2X0L A;  4ETS A;  3PNT A;  4U0V A;  5FRM A;  3S1M J;  3C2H A;  3DEU A;  4L9N A;  4CDG A;  5GAG J;  1FTZ A;  3HEF A;  2V7F A;  5LGT A;  4UUV A;  3LAJ A;  2ZME B;  1YHQ I;  3K4N A;  1DU6 A;  2K40 A;  1WJF A;  4D5C A;  3J7Y J;  2ICW G;  3LSJ A;  4XL9 A;  5IT3 A;  3TP3 A;  3ABL H;  1HW1 A;  2DBB A;  4A6D A;  1F9N A;  3H0G J;  3HSR A;  2L0K A;  5TGT A;  2DMN A;  5A2Q Z;  1ITY A;  1WZ2 A;  2CJJ A;  3TDZ C;  3Q9V A;  5E1W A;  2F5F A;  2XUB A;  3NWT A;  2KJC A;  5LEK A;  3JR9 A;  2D1H A;  4OMY A;  2HYG D;  3VYR B;  3J80 Z;  2XGD A;  2EH3 A;  3F9K A;  3I58 A;  3TW6 A;  1JGS A;  1W7P A;  3ZMS A;  1OCZ H;  2DCE A;  2DI3 A;  3GZ5 A;  4RAZ A;  5E3N A;  3LMM A;  5HVQ C;  5JI6 A;  4PJN A;  2FRH A;  2OQG A;  3IKV A;  1X58 A;  3CCV I;  1JT6 A;  1RRJ A;  1P4A A;  4U0W A;  1ZAO A;  2H6C A;  2HTJ A;  3SFZ A;  3BR6 A;  2PN6 A;  3IAS 2;  2XPU A;  3BR0 A;  3A0H C;  4LIU A;  3ZR8 X;  3F22 A;  1FYL A;  3U1D A;  4LIV A;  1JHH A;  2PJR B;  2EZH A;  4XKW A;  3B02 A;  2BY3 A;  1BIA A;  4BEH B;  4LIT A;  5DYM A;  1VZ0 A;  3DTK A;  2HKO A;  3HGY A;  3RDI A;  1JUS A;  1ORK A;  1R23 A;  2GAU A;  5F08 A;  2BEO A;  4KIF A;  2EFP A;  5IOZ A;  5E3M A;  1H9T A;  1B6A A;  1E2X A;  1U2W A;  4CCO A;  5CKT A;  1NG6 A;  2KRH A;  3OYI A;  3V8J A;  1I3Q J;  3ROU A;  2LFB A;  2P7C B;  4M3G A;  2DO7 A;  3MKW B;  3CLO A;  3UKG A;  2DFE A;  2EB7 A;  4FAS D;  1X2M A;  2FNP A;  3ZQF A;  1X1A A;  3NRV A;  5J6X A;  4IPA A;  1A35 A;  1FSH A;  1B72 B;  2OCC H;  1R49 A;  2R5Z A;  2PJR A;  2LR8 A;  3HRS A;  3ZMD A;  2IS2 A;  2F6C A;  2JK3 A;  1YJN I;  4GCV A;  2GWR A;  1U0J A;  4G6D A;  4IO9 F;  3O6B B;  4AVP A;  2DYS H;  2EFQ A;  2JRT A;  3GVA A;  1S7E A;  1VF9 A;  2PQ8 A;  1RPW A;  3KET A;  3V4G A;  3L09 A;  2WAE A;  1VQ7 I;  3C2B A;  1D0Z A;  3ZQL A;  3OYN A;  4TV7 A;  1Z1D A;  3GF2 A;  3KYD B;  1G3W A;  2EBI A;  2B9S A;  1PDN C;  1MND A;  3QAH A;  1FJL A;  2IGN A;  4D1Q A;  4KFC A;  2E2J J;  2QEX I;  1SEU A;  1SAN A;  3I71 A;  3E5U A;  4HEA 2;  2LRE A;  1QBJ A;  2AQF A;  2CS3 A;  1SC7 A;  3REO A;  1T0F A;  3BY6 A;  4CCL A;  3Q0V A;  2EZK A;  1ZLK A;  1E3H A;  4BH9 A;  2RGV A;  1IRF A;  2FD5 A;  2M8E A;  3OOU A;  4XLE A;  5FLM J;  3S2H J;  1UHS A;  2DDB A;  3QYE A;  1TW2 A;  1BI1 A;  5L3B A;  3PQJ A;  2PMZ N;  2XC7 A;  4GYI A;  4HDV A;  2VT2 A;  3SZG A;  2VI6 A;  2ZBK A;  4IF4 A;  1S9H A;  4MHG A;  2P5L C;  3C7J A;  3R0J A;  4U88 A;  1FMV A;  1B4A A;  1IV6 A;  4JYK A;  1OJL A;  3HM5 A;  1U5T A;  3HRT A;  3G1L A;  5FKN A;  4A6E A;  1AWC A;  2V4J C;  4A3F J;  4HPQ A;  3HOV J;  1MDM A;  4RA2 A;  2LH9 A;  3QOE A;  2M45 A;  1ETK A;  3D1N I;  1KGS A;  2HDD A;  3I4P A;  2JPB A;  4ZDP A;  4LLG F;  1NTC A;  1RZ4 A;  4KIC A;  4BE1 A;  3BQZ A;  1E3O C;  3LL7 A;  5L3D A;  1DU0 A;  4AU7 A;  3WTY C;  3LA7 A;  2VT3 A;  2JUG A;  4I01 A;  4BQQ A;  2ZFW A;  4DIQ A;  3K2Z A;  4XKC A;  4C2T A;  2YU9 J;  4QPQ A;  1BW5 A;  3DPT A;  2EA2 A;  1YW8 A;  1X1C A;  3J7Z I;  2Z33 A;  2LVS A;  3RIR A;  3S1Q J;  3MZ8 A;  3SEQ A;  1MGT A;  4F93 B;  1VFC A;  3FXO A;  4II2 A;  3JRF A;  2HU9 A;  4UVA A;  4HST A;  4ZJZ A;  3N97 A;  4UUT A;  5C44 J;  2V9P A;  3A01 B;  3QQA A;  1HF0 A;  2AHQ A;  3DFG A;  2XSD C;  2GOX B;  4GGG A;  3S2W A;  4KA4 A;  3K10 A;  2ID3 A;  3GTL J;  4A3L J;  2KZV A;  4I99 C;  4HAM A;  2DQR A;  1SAX A;  1N75 A;  2IT0 A;  4IHY A;  3AFH A;  4H0E A;  2GQQ A;  2CRG A;  1KU3 A;  2PMH A;  5C3E J;  1FY7 A;  1SFK A;  3DWL E;  4L0Z B;  2YR2 A;  1NK2 P;  1MMN A;  1WWX A;  4AIJ A;  1R1U A;  5HS8 A;  1K4S A;  2W24 A;  1IN8 A;  4HG2 A;  1CF7 B;  2QGU A;  4RM3 A;  3ZQ7 A;  4QLC U;  1Y8Q B;  3QP6 A;  2OC6 A;  3M8E A;  3QOD A;  3S32 A;  3HOX J;  3F6O A;  2EQR A;  3LFU A;  2VBY A;  3OYC A;  4NDL A;  4OIQ F;  2GOM A;  1SFX A;  2E60 A;  2MC3 A;  2VOP A;  3DV8 A;  2YX4 A;  2K3P A;  3FX3 A;  1IAW A;  2R5Y A;  1ON2 A;  5DD8 A;  2HOS A;  2H1L A;  1D3Y A;  4EJO A;  2G0E A;  2LBF A;  2VC1 A;  2K85 A;  2F2E A;  3V8L A;  2K9M A;  1BIB A;  3PNV A;  4WK8 F;  5LFA A;  3RKQ A;  2TCT A;  3F23 A;  2OZ6 A;  4LG0 B;  2DJN A;  1XSX A;  1FIP A;  4OAY A;  4XSX F;  3DKY A;  1VTN C;  4A93 J;  2K9S A;  3BR1 A;  2DA6 A;  3E5Q A;  1XDS A;  3CDI A;  2BBY A;  2X1E A;  4EAT A;  3VB2 A;  1WI3 A;  2QSH X;  3TDU C;  4JX4 A;  4YII A;  1RR7 A;  2W00 A;  1LNW A;  2L01 A;  2L7M P;  2HS5 A;  1ETV A;  1P92 A;  3FMS A;  3V42 A;  1SD6 A;  2DTZ A;  4ZYD A;  4Y17 A;  3HSE A;  1IN6 A;  2EJR A;  1AKH B;  3BT9 A;  1JE8 A;  1KU2 A;  3ABU A;  2VC0 A;  2DAO A;  4XLN F;  2ZCW A;  1JKR C;  1F1Z A;  4PK4 A;  4HX7 A;  1BC8 C;  1IDY A;  2BXZ A;  4DOZ A;  2BY2 A;  3CZ6 A;  1G3S A;  3I64 A;  3K4B A;  4EM2 A;  3S1N J;  2UV1 A;  3RPU A;  4A3E J;  4C9Y A;  3FMQ A;  3K7A J;  4UUS B;  2LDU A;  4IOA F;  3BG5 A;  4BXX J;  5KK1 A;  1DGR M;  3HGG A;  2DPD A;  1XGS A;  3KIO A;  2AXL A;  2V1X A;  2XB5 A;  1MBH A;  4DZP A;  4YG2 F;  4UB8 C;  4RLF A;  3SXY A;  1H0M A;  2CQQ A;  2ISY A;  5GTI C;  2KJB A;  2M4G A;  2XAS A;  1LDK B;  4KIG A;  2XAG A;  2P0W A;  2HYJ A;  4RDU A;  1XGO A;  4ZYE A;  5LHI A;  3PIO F;  4G6T B;  2KRC A;  1MMG A;  2EA4 A;  1GT0 C;  1WKM A;  2RQQ A;  4DZJ A;  3CCR I;  3DF8 A;  4IJA A;  4RGS A;  3HC7 A;  3KEO A;  1SD7 A;  1GLN A;  4UUS A;  1W0T A;  2CFX A;  1BR4 A;  4B47 A;  3HOS A;  3KLN A;  2UUZ A;  3TO6 A;  4E7J A;  1N78 A;  2QQB A;  3L1P A;  3PM1 A;  5BQT A;  3FXM A;  2FBI A;  3SFI A;  3HJE A;  5F64 A;  3TBI A;  3WG9 A;  4CZZ A;  3CCM I;  2M87 A;  1WPK A;  5E20 A;  4ZYA A;  1VQO I;  4BU2 A;  2ISZ A;  4C3H J;  2FOW A;  4JP0 A;  2ESN A;  2FQ3 A;  4ASN A;  3JRC A;  4BDZ A;  3ZQG A;  2JUC A;  4XSZ F;  3BWG A;  2MSY A;  2ELH A;  4CCM A;  1UFM A;  1HDP A;  3DQV C;  4PCQ A;  3OYG A;  3WGG A;  3D5S C;  4EJT A;  2PX9 A;  3W3C A;  2KLO A;  3P5J A;  4Q4Z F;  3CDL A;  5LD2 C;  3PL8 A;  4NC6 A;  4HQM A;  4M6V A;  4UV9 A;  2R7S A;  4PSX A;  1ETW A;  5FRN A;  1DP3 A;  1IRG A;  2HTS A;  2PEX A;  5KHD A;  1U8R A;  1R22 A;  4IL6 C;  4NQW A;  5DEQ A;  3H9G A;  5LGN A;  2DA5 A;  4YIR X;  1LPQ A;  4BAC A;  3B73 A;  3KYL A;  4A3D J;  1SMY F;  2DXI A;  1WH7 A;  2DMP A;  1FEX A;  4FET A;  2DOD A;  1BL0 A;  1H8A C;  2TDX A;  1P6R A;  1MMA A;  2M7A A;  3Q9S A;  4UV8 A;  2V26 A;  2RRE A;  1T8I A;  1LKX A;  4ENN A;  3MKZ A;  3FM5 A;  3VYU B;  3J81 Z;  3ZQC A;  1ZKG A;  5JHU A;  3KX2 A;  4S04 A;  2L7F P;  1JKQ C;  2DU9 A;  2VQG A;  3DKW A;  3LSR A;  3IV5 A;  1HKS A;  1R9T J;  1YIO A;  5H6R A;  1LB2 A;  4KT6 A;  1AHD P;  1G6N A;  3FBN B;  4M6Y A;  4HX4 A;  3HB9 A;  2M7B A;  3QPH A;  4L5E A;  3FWE A;  2ZJ2 A;  4P9F A;  4L0Y B;  1W7P B;  3F8F A;  3K4J A;  1ZGA A;  4KMU X;  1S29 A;  3BTC A;  4C3J J;  4LK1 F;  4CZC A;  2AS5 F;  3GFM A;  1IRX A;  3H9J A;  4B44 A;  3GXO A;  4FX4 A;  5D5U B;  2LP0 A;  5D4R A;  5DTD A;  2FXA A;  3H3U A;  2STT A;  1JTY A;  2W84 A;  2LNB A;  1O7L A;  1EF4 A;  1Y0N A;  2E1M B;  4EJV A;  1U8B A;  2VOD A;  2WWY A;  4Y15 A;  3FXQ A;  1I6H J;  3W6V A;  1SD4 A;  2L4A A;  3HOW J;  4LMY A;  4BGD A;  4RMN A;  1XGM A;  2JTV A;  4BEH A;  1OFC X;  1TWC J;  1RI7 A;  4AUX A;  1HA8 A;  3VSK A;  1ZQ3 P;  4MLO A;  1UCR A;  1LFU P;  2Z2S B;  4LFU A;  3MAJ A;  2DQL A;  3BRO A;  4E7H A;  4NB5 A;  3KP3 A;  5LLQ A;  3JRE A;  2VQC A;  2W4S A;  2LD5 A;  2Y9Y A;  5L3G A;  5L3F A;  3U9G A;  3VEP A;  3ZCO A;  2ME0 A;  1KU7 A;  2CW7 A;  3M07 A;  3CMA I;  5J1U A;  2PMZ A;  2RQP A;  2LK2 A;  1H88 C;  3K70 D;  4AYB A;  1HW5 A;  3GTM J;  2Q1Z B;  5H2F C;  3PIP F;  4ZTF A;  3ML6 A;  2A68 F;  2MLG A;  1B9M A;  4BHP A;  3FXK A;  3S16 J;  2L9R A;  3A03 A;  1Z0X A;  2VQH A;  2OCE A;  1UG0 A;  3K1P A;  2NVX J;  1Y1W J;  4Q47 A;  2HI3 A;  3K4L A;  5TJJ A;  3P9I A;  3GLL A;  4N4N B;  2CQ7 A;  1FBS A;  1FSE A;  3RQ4 A;  5D5V B;  2RAE A;  2HR3 A;  1YE9 A;  3M8F A;  4NC7 A;  5K7H A;  4LG3 A;  4AWX B;  1YO5 C;  1YYV A;  3H92 A;  4WWC A;  4E7L A;  2ZKZ A;  4G6Q A;  1NK3 P;  4XLC A;  4I6Z A;  2E1N A;  3WTZ A;  2BYV E;  2JSP A;  1RIO H;  4I76 A;  2VKE A;  1MBF A;  3BDD A;  3D5R C;  4FE4 A;  1ZG1 A;  3S2D J;  4HRI A;  1OPC A;  2DFI A;  3PJR A;  4I09 A;  3OYB A;  4ESF A;  4AIH A;  4IZZ A;  5L3E A;  4XID A;  3EPZ A;  1REP C;  1ZRC A;  5B66 C;  3H1C A;  3EYI A;  1T98 A;  2NVY J;  2OPT A;  4I98 B;  4OOI A;  4Y3O A;  3JRG A;  4HLY A;  1NH3 A;  3S15 J;  3W6K B;  3BTJ A;  4QIW N;  3RZO J;  3OYF A;  2Q0O A;  3G71 I;  1N77 A;  1RUN A;  4GYG A;  5LRS A;  2LKS A;  5HNH A;  1FX7 A;  3DKX A;  3QU6 A;  4IOC F;  1WGX A;  1FMW A;  4RAF A;  3FBI B;  3G3Z A;  4IQ4 A;  1ZG3 A;  2MD0 A;  4A0Y A;  5IYC J;  3TOA A;  3IHU A;  2R7X A;  1R71 A;  1B8I A;  1R7J A;  2V9V A;  2IPQ X;  1ZRE A;  2HQA A;  1MMS A;  4M72 A;  3CCQ I;  1Z21 A;  3ONQ A;  4HOB A;  5FB2 A;  2DT7 B;  2L2O A;  2KDZ A;  2O6G E;  2OZU A;  2LSO A;  1UMQ A;  1WH5 A;  2EIK H;  4ENJ A;  3S93 A;  1RET A;  1H9G A;  1J9I A;  1S72 I;  5DCF A;  2VBW A;  3RJP A;  3CMM A;  3LQR A;  2DMQ A;  4P96 A;  2MG4 A;  2XKO A;  1V54 H;  2E1M C;  3GBG A;  1T39 A;  3M3Y J;  3RQI A;  4CYD A;  2Q2E B;  2QWW A;  3CF5 F;  3ZMV A;  4EVI A;  1U6G A;  2HPI A;  4X1E A;  3F8N A;  4M3B A;  4P9U A;  1BC7 C;  3A01 A;  2V9K A;  2H94 A;  2XB0 X;  4FT8 A;  3V7R A;  2KDO A;  1GVJ A;  1BN5 A;  4HW0 A;  2X6O A;  2JA5 J;  4HV6 A;  4BL0 B;  2JA8 J;  3D5L A;  3C3W A;  2F5E A;  1BI3 A;  1SVM A;  3DEE A;  2X1C A;  4XIC A;  4A3I J;  2VL8 A;  3SYT A;  3E3V A;  2IEK A;  2PMU A;  4U87 A;  4BYY A;  2BE5 F;  2OQR A;  5EEA A;  2Q2E A;  3PQK A;  2COB A;  2HOE A;  1T2K A;  1FLI A;  2P5K A;  2NVT J;  4DYR A;  4HNT A;  2R7F A;  4HDU A;  1A6Q A;  2QQ9 A;  1XPX A;  2QLZ A;  2HZT A;  1EV7 A;  2NAZ A;  3ECO A;  2F5V A;  3H5R A;  3OIQ A;  5D5W B;  5GAH J;  2XGE A;  1TTY A;  4KJZ A;  1P4W A;  1QU3 A;  2O7O A;  1B59 A;  2F4O B;  2JVG A;  2DT5 A;  2P81 A;  2CV1 A;  4P55 A;  1QVT A;  3MKY B;  1E3P A;  1I3A A;  1XD7 A;  4J01 A;  2K02 A;  2CW0 F;  3PO2 J;  1OR7 C;  2DOF A;  3ZP5 A;  3CJT B;  3VWB A;  3K70 C;  1BA5 A;  3E6B A;  3ISP A;  3C2G A;  5KVR A;  5LRR A;  2BY0 A;  2XRN A;  2Y9Z A;  3LSI A;  4F91 B;  4L5I A;  4HQE A;  1D5Y A;  1YIT I;  1VI0 A;  3DPL C;  5ICE A;  1X2N A;  3RPQ A;  4A5N A;  4NUB A;  4HNU A;  1OCR H;  5F0H A;  1G8X A;  1R36 A;  3OYH A;  2XDV A;  1SMT A;  2TRT A;  2ACJ A;  4A2U A;  1W36 C;  1PP8 F;  5FFX A;  2HQN A;  2HPM A;  4V2G A;  2IGK A;  3M8J A;  4A0X A;  3DU6 A;  1BOA A;  2ME6 A;  3L2R A;  1ETQ A;  2ECC A;  1BR1 A;  2K9Q A;  2ETH A;  3F3X A;  1RUO A;  1YX3 A;  2JZY A;  1YIJ I;  4P1W A;  4MFE A;  3R60 A;  2FF4 A;  2VUM J;  1XN7 A;  3DTE A;  4KT5 C;  3ZQI A;  4BBS J;  4FE7 A;  4A0Z A;  1FP2 A;  1HQC A;  2PBI A;  1J5Y A;  4IHS A;  2O9L A;  2EV0 A;  3LAP A;  2B7E A;  5ICG A;  3I5U A;  4XLH A;  3ZGK A;  4X0G A;  2VPR A;  1XX5 A;  2DK8 A;  1Z6T A;  4J19 A;  2L54 A;  3ULQ B;  9ANT A;  4PJJ A;  3GYH X;  4IQJ A;  1CQT A;  1I6X A;  2ECB A;  4M3D A;  5JLW A;  2XAH A;  2CV0 A;  1D8J A;  2LF7 A;  3BJO A;  1HOM A;  1OR7 A;  1I1S A;  3R0A A;  2X6X A;  1EKE A;  1IN7 A;  3ECH A;  3MZH A;  1B1B A;  1XMK A;  2QSG X;  2EWN A;  2CV2 A;  2CH0 A;  2M9H A;  4ZZD A;  2HDW A;  3FIW A;  4O5V A;  1AA7 A;  3FKI J;  3WTV C;  4BXF A;  4IKF A;  1Y1V J;  3GZN B;  2R93 J;  3CCE I;  1WJB A;  3AG4 H;  1IUF A;  4LGW A;  4CXF A;  2Z16 A;  4QSH A;  1YJ9 I;  3VFZ A;  4C3I J;  1L0O C;  1Z67 A;  4CO8 A;  4YFX F;  4G7H F;  3HHH A;  2C6Y A;  3WGI A;  3RTR A;  1T56 A;  5J1Y A;  4ANJ A;  5HDG A;  1W1W E;  4A3B J;  4BE0 A;  4MEY F;  5J8F A;  4J00 A;  1ZEL A;  5JR3 A;  2VJI A;  3LSK A;  3H5A A;  1MNM C;  1W0U A;  4BS9 A;  3KPH A;  2EV6 A;  3LST A;  5FJ8 J;  2PLY A;  2RDP A;  4IRG A;  2KIS A;  1FPQ A;  4L9T A;  5M5W J;  4ZDL A;  3KP7 A;  2L9N A;  3DLL F;  2VJ5 A;  2DOE A;  2CQX A;  2QQ8 A;  2KKO A;  4UB6 C;  3OR1 C;  1SAU A;  2FMY A;  1KU9 A;  2YX7 A;  3RSN A;  2YSR A;  1RR8 C;  3HPH A;  1POG A;  5EG0 B;  4M9S A;  3K4C A;  3R4K A;  1TWA J;  3PSI A;  1A31 A;  2X1D A;  5F0C A;  3ZN0 A;  3OYE A;  3K0L A;  2GXB A;  3ERE D;  1O3R A;  2M5W A;  1QPI A;  1FOX A;  5CQE A;  2ZXH A;  4BBR J;  2FBH A;  1J09 A;  2CUE A;  1TWF J;  3OIO A;  3ZMT A;  1MNE A;  3B6A A;  1JUP A;  1C0W A;  3L2Q A;  5JVT A;  3GTP J;  3KP4 A;  4XRM A;  4PJL A;  2PG4 A;  4OMZ A;  1LEB A;  2DMT A;  1D5V A;  1GXP A;  3NWS A;  3QYB A;  4HA8 A;  4ABZ A;  3CUQ C;  1XMA A;  1JI8 A;  5K7F A;  5EG0 A;  2IA2 A;  3F21 A;  2OTL I;  1FOW A;  2A05 A;  4CIC A;  4R1H A;  3I3L A;  3I0T A;  2EZI A;  2MH9 A;  2HZD A;  3BTL A;  2F4M B;  3P9K A;  2VPL A;  1JT0 A;  1KQ9 A;  5JLX A;  3AG2 H;  5J3L A;  3BZC A;  4NNJ A;  1KZH A;  3HHG A;  1IF1 A;  4EGY A;  4HF2 A;  1IXR C;  1WJ5 A;  5AIQ A;  4OWR B;  4IHV A;  1ZAR A;  1EH8 A;  3KZZ A;  4I0B A;  2NRA C;  3H3Z A;  4EV0 A;  4ZC3 A;  1ZRF A;  3JSP A;  4CGZ A;  1D0Y A;  1G3Y A;  1U9N A;  2VN2 A;  5B1A H;  3L2C A;  2VOO A;  1AKH A;  2W85 A;  4ON0 A;  1XSV A;  1QGP A;  2IXS A;  5KCM A;  5KNL A;  2DA7 A;  1DPR A;  3QP5 A;  2MC4 A;  5M3M J;  1Z3X A;  3C1D A;  4RS8 A;  3BJ6 A;  5D8K B;  4BJ6 C;  3QRF F;  3AL0 C;  2ADU A;  4YFK F;  3KLO A;  2GA1 A;  4Y52 J;  3FKJ A;  4EMS A;  4E6K G;  4G7O F;  1W5S A;  4W97 A;  2CU7 A;  2HYF A;  4XMY A;  2R7U A;  3KFW X;  1RC9 A;  3LNQ A;  1HC8 A;  1SFU A;  2LG4 A;  4XLF A;  3RKX A;  3BQY A;  3CUQ A;  5DS9 A;  3DBR B;  2HNH A;  4AID A;  4PJM A;  2JA6 J;  1MD0 A;  3DPU A;  3G1O A;  1TZL A;  3LQQ A;  3WU2 C;  1T6S A;  3CCU I;  2QEN A;  3BC8 A;  3BTI A;  4C2M J;  3J7A O;  4HF1 A;  5ILV A;  1IJW C;  1S7A A;  3MZY A;  5ICF A;  5J47 A;  1VQ8 I;  5HNF A;  4N9H A;  1O4X A;  5J4Y A;  5F1R A;  2E35 A;  1P4X A;  1IGN A;  3GFL A;  2QCO A;  5LBQ A;  2VBX A;  2XGX A;  2ZFU A;  3G1M A;  4XOR A;  2NNN A;  2MW8 A;  5HLG A;  3FF5 A;  3HTU A;  4ENK A;  3C18 A;  4RGX A;  3K1M A;  5FGM A;  2HEO A;  3TL4 X;  2HFH A;  4AD9 A;  2ZXJ A;  2DLL A;  1VQK I;  2ZNZ A;  3X2Q H;  2DTR A;  1LVK A;  1FT9 A;  1ERD A;  1U78 A;  1KQ8 A;  4B3A A;  2XPW A;  3TMO A;  3S3N A;  1D0X A;  2KP6 A;  2VAS A;  3GEZ A;  3Q0U A;  1XMX A;  5M5X J;  5DCM A;  2XAQ A;  3HRM A;  4XN3 A;  4XOT A;  4YEL A;  3WE2 A;  4BNC A;  1OYW A;  1RNL A;  5GAE J;  5DM7 F;  5D8L B;  3G4S I;  4DQ2 A;  3HOU J;  3ZPL A;  3J7A Y;  2DOA A;  1QHH D;  2E5Z A;  1ENH A;  3LSM A;  3ZOB A;  3Q5F A;  2IAI A;  4AIK A;  1Z77 A;  2OD5 A;  2RN7 A;  2FJ1 A;  3BOQ A;  2STW A;  3EQL F;  4ESB A;  5FKO A;  2KIF A;  1R6R A;  2O0Y A;  4L9V A;  1HW2 A;  1A36 A;  3RKW A;  1MH4 A;  2Y0S A;  1WI9 A;  2O8X A;  4G94 A;  1OYY A;  3BCA A;  4M73 A;  3ZRG A;  1J7K A;  1MBK A;  2YS9 A;  2NS7 A;  4M6X A;  5E1X A;  1IO2 A;  4XLA A;  5DCM B;  2JSC A;  3QYF A;  4OIO F;  1QPM A;  3CJQ B;  3OYD A;  5CJ9 A;  5EZG A;  2R7O A;  2HVS A;  2R3S A;  2R7T A;  3BG9 A;  3QPL A;  1J75 A;  5KAI C;  1IC8 A;  3WOD F;  3GTG J;  5LGU A;  1KYW A;  1PUF A;  1JJ6 C;  2KZG A;  1T95 A;  3FXL A;  1YFH A;  4O6J A;  3AAF A;  3FHN A;  4GXO A;  1XCV A;  4RBO A;  3F6V A;  4AM3 A;  3T8R A;  2R7V A;  1R1T A;  2CUJ A;  5K5O A;  1FYM A;  5IP9 J;  2X85 A;  1YRN A;  1W4M A;  4MIM A;  3VYS B;  1VQ5 I;  3HYI A;  2RV8 A;  1QQI A;  1WCM J;  3OS0 A;  3BLY A;  1X4O A;  2HQR A;  5J40 A;  2CW8 A;  3ESW B;  1TWG J;  3H9Q A;  2R5Z B;  1APL C;  4I2O A;  2XHK A;  1G3T A;  3HUG A;  3M1E A;  2CO5 A;  2ZSH B;  5CQG A;  1LEA A;  1ZG5 A;  3KP6 A;  5KAF C;  2JA7 J;  2A6E F;  3HRU A;  1ETO A;  3Q0W A;  4MQ9 F;  4M3F A;  3RI4 A;  2E5N A;  1FOK A;  3E7L A;  3GTO J;  3WG7 H;  2K27 A;  4OIR F;  2VIX A;  3SDB A;  2FEZ A;  1OIS A;  2IA0 A;  2NYX A;  3LSH A;  4GFB A;  2ZNY A;  2Z5U A;  4EM0 B;  5BMZ A;  2XAU A;  1FYK A;  2LTP A;  3TO7 A;  3VSL A;  5CVR A;  5CVJ A;  4DGW B;  4A3C J;  4CHU A;  1ETX A;  3T0Y A;  1JKP C;  1WRJ A;  1TQP A;  3CUO A;  2WB1 A;  3J80 K;  3U1K A;  1X3W B;  1ON1 A;  4IXA A;  1MH3 A;  2CYY A;  5K5R A;  2FNA A;  1Y6I A;  2HKX A;  3G73 A;  2UWM A;  2OTJ I;  2V79 A;  1IW7 F;  3ZXS A;  2MFZ A;  4FTH A;  2E2H J;  3DU5 A;  1EH6 A;  3WU1 B;  3OYJ A;  4IHW A;  2DJI A;  4B1R A;  1YW9 A;  3DXJ F;  2R7Q A;  1EH7 A;  3CJR B;  2WC2 A;  4LD5 A;  1MBG A;  3I4N J;  1GUU A;  4BY7 J;  1W5C C;  3TW7 A;  2YU3 A;  2AQE A;  2IS6 A;  1VQ4 I;  4NC8 A;  1ONV A;  4CCK A;  3CDH A;  4MNU A;  1HCR A;  1WFX A;  4LOC A;  1IXS B;  3HKZ A;  3GTQ J;  2XV4 S;  4RGR A;  2M1B A;  5FD6 A;  3SJM A;  3KCC A;  3WTS C;  3VOE A;  1GV2 A;  1RKW A;  2JJ7 A;  3AKZ A;  5BS6 A;  1TNT A;  1R1V A;  2V1D A;  1S5L C;  4XR6 A;  5IPA A;  3L2V A;  3MQ0 A;  1SFE A;  4HBL A;  4M9X A;  4LB5 A;  3EUH C;  3PFY A;  1P7J A;  4YEJ A;  3L9F A;  1O3T A;  5FLV A;  2P7V B;  2BW3 B;  1R4N B;  1Z05 A;  3OR2 C;  2DA2 A;  1ACI A;  1GDT A;  4R8H A;  3MWM A;  5IY5 H;  3JRI A;  4JOM A;  1K78 A;  3OV8 A;  2EIL H;  3GO5 A;  2WV1 A;  3BCB A;  4KIB A;  2EFO A;  1A5J A;  3PFI A;  1G4D A;  3IH2 A;  1XTA A;  5EJC A;  3H3V K;  1S6L A;  2KT0 A;  3I54 A;  2D2W A;  4U0Y A;  5CLS A;  2VKH A;  1MJA A;  1PYV A;  3JAM K;  1YOV B;  3JAM Z;  2ESH A;  3I56 I;  1SFO J;  1AU7 A;  2IA1 A;  3GUD A;  1MSE C;  2IJL A;  3L7W A;  2H27 A;  1K6Y A;  1K61 A;  1BBY A;  2K9N A;  3HIF A;  3KZY A;  2BW3 A;  1BI0 A;  1WVR A;  4RM2 A;  5HS9 A;  3U2R A;  1UZC A;  5CYV A;  3WHC A;  4JX5 A;  1K78 B;  1F4K A;  2RC4 A;  1CGP A;  1ZR4 A;  1HKT A;  3UR3 C;  2WY7 Q;  3GTJ J;  2IBD A;  2BHY A;  4IVN A;  3F0C A;  4S0H B;  1V3F A;  4WX9 A;  2A69 F;  1FTT A;  3PSF A;  4HLX A;  4A3G J;  3CC7 I;  2L3D A;  4IHX A;  1WJD A;  2K86 A;  5JVG F;  3S1R J;  1PJR A;  2I10 A;  3CO6 C;  3WTX C;  2XIG A;  3OY9 A;  4KMF A;  3RCO A;  1W7P D;  5ICC A;  3CMY A;  2ZSI B;  3ERM A;  1O57 A;  2CG4 A;  1LDD A;  3DTI A;  3QU3 A;  2L5Q A;  1VQ6 I;  5D5X B;  3J81 K;  1UST A;  2WA0 A;  4N4O B;  4XRS G;  3O8H A;  5K5Q A;  5F1J A;  4K2E A;  5IOY A;  1WJA A;  1H89 C;  1DPU A;  4GDF A;  5EEG A;  2HOA A;  5ILS A;  4XQF A;  2G7U A;  2IP2 A;  2BOL A;  2OAZ A;  4YFN F;  5K7Z A;  2XSJ C;  1G59 A;  2EV5 A;  3TKY A;  4D0P A;  2W82 A;  2CSO A;  5E17 F;  2NVU B;  3JCU C;  1HST A;  4I7H A;  2CMP A;  2J5O A;  5F6F A;  3BR2 A;  2H6B A;  4RLQ A;  2Z9O A;  1MIJ A;  3HPG A;  1JGG A;  1FC3 A;  4UVB A;  3G2B A;  5CPR B;  1T33 A;  4BDY A;  1K6O A;  3SZT A;  1Z6R A;  5E3O A;  4QTR A;  2OUM A;  2H1K A;  4HF0 A;  1T38 A;  4BHB A;  3FM3 A;  3WTW C;  2BHZ A;  2MLK A;  1VQP I;  1K79 A;  5C4J J;  5FRO A;  4D7N A;  3E6D A;  3GFJ A;  3G6E I;  2R5Y B;  3VOD A;  3MKL A;  3A02 A;  4BQO A;  2EIJ H;  2QQA A;  4D9J A;  4XRS A;  1XG1 A;  4ZH4 F;  2ZXW H;  1GVD A;  2X9D A;  2FA5 A;  4C2U A;  3F8M A;  1GV5 A;  1IXC A;  1UEL B;  1TP4 A;  3BP8 A;  1V5G A;  4LK0 F;  3LSP A;  5DUI A;  1IG7 A;  2XF6 A;  1HSJ A;  5DD4 A;  4A3K J;  3K9T A;  4XKV A;  3F8B A;  4LG0 A;  5LEJ A;  3OS2 A;  1IUY A;  3H0D A;  1P7I A;  4DYQ A;  4CCJ A;  4S05 A;  1SVO A;  2G7H A;  1V4R A;  1JTX A;  1MW7 A;  1OCC H;  1ZYR F;  2CWE A;  2QSF X;  2Y48 A;  3MEX A;  4DBR A;  1YX5 A;  2B63 J;  2FE3 A;  2CQK A;  1UHM A;  4HX8 A;  2A5W A;  4R79 A;  2JA2 A;  2N8G A;  3JRB A;  3BG7 A;  4XKB A;  5ED4 A;  3ZQQ A;  2GIZ A;  5FO5 A;  3FMR A;  4KIT B;  1QZZ A;  4EJU A;  2AO9 A;  3CUQ B;  3IL2 A;  3S17 J;  3WTU C;  4O3M A;  2E1O A;  3E6C C;  3ZN1 A;  2K4B A;  2R92 J;  1Z7L A;  3DBH B;  1GHC A;  1FWZ A;  2A07 F;  2DYR H;  5E8G A;  3RYR A;  4B8X A;  3E6M A;  2LY9 A;  1KA8 A;  1D8K A;  1EA3 A;  1V55 H;  2KIU A;  1NG7 A;  2JRM A;  1TQM A;  1MKM A;  1QNT A;  4IHT A;  1TWH J;  2YUS A;  3HBL A;  4CH7 A;  1I5Z A;  1IZ1 A;  1BW6 A;  2E34 A;  2HXO A;  2LC2 A;  2LYC A;  3I59 A;  4L18 B;  5FLX K;  5B3S H;  1ZTR A;  2FQ4 A;  3F72 A;  1KQ0 A;  1LFP A;  2DW4 A;  2WV0 A;  1Z91 A;  3CES A;  4B09 A;  5JHF A;  3NQO A;  3IWZ A;  4IRI A;  2K9L A;  2KIQ A;  4NQW B;  2HWV A;  3BR3 A;  2HDC A;  1FIA A;  3JSO A;  1YQA A;  2EK5 A;  2BVL A;  1FZP B;  1STZ A;  4E7K A;  3K69 A;  1YS7 A;  3KYC B;  5J8C A;  3A0B C;  4JBA A;  1IN5 A;  3ABT A;  5J4V A;  2QUF A;  4CYC B;  3KZI C;  1FBQ A;  2YPR A;  2L7K A;  2X48 A;  1TQI A;  4L9J A;  1QA6 A;  3QPS A;  3SEZ A;  4II3 A;  4PGG A;  2XF7 A;  3SDG A;  3TGN A;  3GFI A;  2PI0 A;  1R00 A;  3FHZ A;  3KP2 A;  3RYP A;  4LLN A;  1EJ9 A;  3WGH A;  2WAD A;  2X6Y A;  1UAA A;  3HOZ J;  4Z6Y A;  4KDP A;  2OV7 A;  2D1V A;  2KHM A;  1J59 A;  2HOT A;  1BOB A;  2RKH A;  2QF7 A;  3GZ6 A;  2EZL A;  2CQN A;  4BQN A;  2VJJ A;  4PUS A;  4UXN A;  1IV8 A;  3WU0 A;  1K83 J;  2F4I A;  1MJ9 A;  3GX4 X;  3LA3 A;  1FBU A;  1HXD A;  1LVA A;  1QRY A;  3MVP A;  3EET A;  1I27 A;  3H36 A;  5IP7 J;  2H09 A;  3MCZ A;  4UHT A;  1R4M B;  2ELJ A;  4M71 A;  4DYC A;  4A5M A;  1MJB A;  4ENM A;  3W2A A;  2Y30 A;  4MGR A;  2PJP A;  3L2U A;  3KE2 A;  2VXZ A;  4OU0 A;  5HLI A;  1T0F C;  2CGP A;  1LDJ A;  4PGH A;  4Q5S F;  1TLH B;  5DDG A;  1FNN A;  1YW7 A;  2IGO A;  4ZYH A;  2RVC A;  2GZW A;  2KIM A;  2OU2 A;  3DCF A;  5FKK A;  1PP7 U;  3CME I;  3IP4 B;  1T08 B;  3HSF A;  1IDZ A;  2E71 A;  3A2K A;  2FBK A;  1ZGJ A;  2K3F A;  3BPV A;  4MTE A;  3BZ6 A;  4MEX F;  5B5E C;  4PZJ A;  3BZK A;  2UXX A;  4DW6 A;  5AIP A;  3CQZ J;  4D7M A;  4V19 K;  3HTS B;  1U5T C;  4WXD A;  3M7G A;  5CVV A;  2WB1 N;  4F7Z A;  1SD5 A;  2GXA A;  1LE8 B;  1UJ8 A;  3K6G A;  1OLT A;  2EIN H;  2IGM A;  2HQ5 A;  2RNJ A;  1DP7 P;  4RB0 A;  2OJE D;  4BUP A;  2DA3 A;  2BY1 A;  4F92 B;  2JPC A;  3HUG B;  4E70 A;  2VE8 A;  3K2A A;  1P2F A;  3W2W A;  4XLP F;  2V1N A;  5HOD A;  1OQY A;  1V5F A;  3HXL A;  1YLF A;  4FHT A;  2XF5 A;  2MGQ A;  3FXR A;  2H8R A;  3AG3 H;  4W1U A;  1MSF C;  4IEJ A;  2R7Z J;  2M30 A;  1XDU A;  4P5O A;  4OIP F;  3BG6 A;  2WBM A;  4FIS A;  1YI2 I;  3DP7 A;  1A6I A;  2E19 A;  1LE8 A;  2ZB9 A;  2K5C A;  4ITV A;  5ERI A;  3CF2 A;  2L9S A;  3CCS I;  1OCP A;  1Z3Y A;  2KRF A;  4A69 C;  1ZK8 A;  4YIF A;  2QKM B;  6PAX A;  5J1R A;  2P6T A;  2UXN A;  3TOB A;  5CVI A;  5GP9 A;  4WXH A;  5DUK A;  4XNF A;  3T8T A;  1K4T A;  2Y31 A;  1JJ8 C;  1S3J A;  1ZRD A;  2EIM H;  5M3F J;  2LKX A;  2W57 A;  5M5Y J;  5EEH A;  2MH2 A;  3VPR A;  5GPC A;  2V6C A;  2ID6 A;  2WTE A;  3FIS A;  4G8X A;  1O3S A;  5EGO A;  3TP0 A;  5B1B H;  2NNY A;  3NAR A;  2FML A;  3QPT A;  4WXC A;  2JMW A;  4BXU A;  2R7R A;  2JVH A;  3LFK A;  3M4O J;  3EYY A;  2I8D A;  1QVU A;  2A5Y B;  3COA C;  2EFW A;  2XPV A;  1XB4 A;  3WTT C;  3Q3S A;  3O2P E;  1J2X A;  1ZR2 A;  3HOY J;  1R58 A;  3KP5 A;  1E17 A;  2UZK A;  2DK5 A;  3LA2 A;  4MFD A;  1X1P A;  2AXT C;  1DGW Y;  1NHA A;  1WHU A;  4ZTJ A;  4ZYG A;  5L3C A;  3H35 A;  2LKP A;  4PJ0 C;  3RPU D;  4B4C A;  2BXY A;  5FLX Z;  5EGO B;  3K4K A;  3CO7 C;  2XRL A;  2L7Z A;  2Z3Y A;  1JKO C;  1VQL I;  1YS6 A;  3GWZ A;  5E3L A;  3AG1 H;  1ZH5 A;  2GA2 A;  2H8W A;  5LHH A;  4WF2 A;  1E0E A;  3IRR A;  1Y8R B;  4B3X A;  3OL4 A;  1K7A A;  3KEQ A;  2M0M A;  2BGC A;  3CCY A;  3E0J B;  1YTY A;  1ETY A;  4KN4 X;  2FX0 A;  3O3K A;  3QWL A;  2O03 A;  1F5T A;  3OWT A;  5HLH A;  2VBZ A;  5AON A;  2KQR A;  4FQG A;  1OMI A;  2NXN B;  1ZLJ A;  2A61 A;  2IS4 A;  2E7X A;  3OIP A;  1Y56 A;  4XM3 A;  1Q1V A;  4L5J A;  2VXD A;  1PUF B;  3F8C A;  2R7D A;  2XRO A;  1N25 A;  3I4M J;  5EDN A;  2K4J A;  2MBF A;  2VQL A;  5A2Q K;  4EGZ A;  4JQF A;  3ZQH A;  4HSR A;  4BHC A;  3HZJ A;  3T5X A;  1YRN B;  4Y33 A;  5H6Q A;  4H4K C;  4BJT A;  4DNC A;  4F3Q A;  5H20 A;  4HNV A;  4N9I A;  1B8I B;  2EPF A;  2ZO4 A;  2W48 A;  3IWF A;  3AL0 B;  4NHJ A;  1IRZ A;  1HBX G;  3IH4 A;  2Q8K A;  3TO9 A;  1BR2 A;  1D1B A;  2R4G A;  3TED A;  4M74 A;  3S14 J;  2JN6 A;  4PFP A;  1BJZ A;  2GIV A;  2QM3 A;  2OF7 A;  5ILU A;  3ASO H;  3IUO A;  2IW5 A;  2KL4 A;  4Z2Y A;  2VON A;  2ZJQ F;  1WQ2 A;  1MBE A;  4JX6 A;  1IN4 A;  2O5R A;  2LOO A;  1ZGW A;  4RGU A;  2NOJ B;  3EUA A;  2P4W A;  2RNG A;  5EZH A;  3FXU A;  3M9A A;  2MAB A;  4M9Z A;  4BJ5 C;  2MD5 A;  5E1Z B;  1CF7 A;  2M0C A;  4MO7 A;  5IT9 Z;  2PFB A;  3LSG A;  1B72 A;  3CC2 I;  3M1C A;  2OA4 A;  4V2F A;  2IS1 A;  4EM1 A;  3CTA A;  4KYW A;  2HVQ A;  1DUX C;  3MN2 A;  2VB6 A;  2O61 A;  1YJW I;  2MYS A;  4Q48 A;  1TT0 A;  5D6F A;  3MFK A;  4CUG A;  3K4M A;  1Q1H A;  4N0B A;  2ZXI A;  3VYT B;  2D5V A;  1RKT A;  3CCL I;  2Y75 A;  4QWQ A;  3P9C A;  2ZJR F;  4E7Z A;  1QHG A;  3GCM A;  3VDX A;  2VLA A;  3BR5 A;  1R5I D;  2OBP A;  3PUB A;  1FOY A;  1J0R A;  3BG3 A;  3PUF A;  4GO1 A;  3V7C A;  3OYA A;  4G12 A;  2HGC A;  1F36 A;  4AYB N;  3ZMU A;  1XC5 A;  3EUH A;  4F52 A;  3CC4 I;  4EJW A;  4UY8 I;  1AOY A;  3CP8 A;  4LB6 B;  3JW4 A;  4PFO A;  3RZD J;  1TL8 A;  2QVO A;  1JHF A;  3WE3 A;  1Z9C A;  1W36 D;  2NS0 A;  3N4M A;  2O8K A;  4E7I A;  5BPD A;  3A4C A;  1VND A;  3SQN A;  2L02 A;  4QPO A;  1X4P A;  2ELK A;  4E7S A;  2M3A A;  4BAY A;  3JRH A;  2BV6 A;  3OOP A;  4X6A J;  4IRH A;  1X19 A;  2XVC A;  2XAJ A;  1ODD A;  4ZDO A;  3OYK A;  2P5V A;  2X4H A;  3WHB A;  5D6E A;  3V8K A;  2E2I J;  1UHW A;  2DPU A;  2Z1D A;  2VJ4 A;  2R7W A;  1KYZ A;  2VE9 A;  5GTH C;  2Y69 H;  2JQ7 A;  3GME A;  3E1S A;  3SHF A;  4I02 A;  4LJZ F;  1Y39 A;  3JTG A;  3S3O A;  2E36 A; 
#chains in the Genus database with same CATH homology
 5FFZ A;  1ULY A;  2QBY A;  1XSD A;  1U5T B;  3IKT A;  3NEU A;  4HV5 A;  1TNS A;  1MDM B;  2V1U A;  5BPI A;  3P7N A;  2EFN A;  1W5T A;  1QO0 D;  5E8I A;  1TBX A;  1I1G A;  1FP1 D;  3LWF A;  2QBY B;  1L3L A;  1UB9 A;  1Y0U A;  5D4S A;  2FSW A;  3V7S A;  1QZY A;  5HOO A;  5BOX A;  5JFR A;  1MZB A;  5E18 F;  3BJA A;  1Z7U A;  3FZV A;  2QYO A;  2Z99 A;  3W6J B;  2MA3 A;  3ZMZ A;  1YG2 A;  2FU4 A;  1BI2 A;  1B9N A;  4XBF A;  5K1Y A;  4UNO A;  1S8N A;  2K7L A;  3RKY A;  3E5X A;  1O7F A;  4LLL A;  1WSU A;  2E1C A;  2XAF A;  3EDP A;  5CVU A;  4UVC A;  1X3U A;  4U7D A;  5HDK A;  5TRD A;  1O3Q A;  4G7Z F;  1ZN2 A;  4OIN F;  2GXG A;  1PUE E;  3I53 A;  3IC7 A;  5HDN A;  1XCB A;  2L4M A;  2A3S A;  3E97 A;  4RB1 A;  3GW2 A;  4Y13 A;  3T1B A;  3L00 A;  4HYE A;  3TQN A;  1TW3 A;  1USS A;  1LQ1 A;  5IT9 K;  4PDK A;  2IRF G;  2P8T A;  4JK1 X;  2D45 A;  3BPX A;  1R5G A;  2P6S A;  4KUM A;  3JTH A;  4RAY A;  1R5H A;  4KNY A;  2LF8 A;  2F5C A;  4A12 A;  1A04 A;  2A6H F;  4G9Y A;  2IVM A;  1OYI A;  3QOP A;  2B0L A;  1XGN A;  3D0S A;  5DV5 A;  2JT1 A;  4XRF A;  2F5D A;  2QZ8 A;  2G9W A;  3CJN A;  4EQQ A;  2XKP A;  1OKR A;  4RB2 C;  1DDN A;  2W25 A;  2J5P A;  3IRQ A;  3GLX A;  3K1N A;  1S7O A;  4FX0 A;  2E7W A;  3I59 B;  1U3E M;  2Y0M A;  3HOT A;  4BQA A;  1BJA A;  3SZP A;  4KN7 X;  1GXQ A;  3R61 A;  1ZHF A;  1LJ9 A;  4RB3 C;  4HZF A;  3R6S A;  5LHG A;  2ZME A;  3ELK A;  4WCG A;  4MQV A;  4MTD A;  5FD5 A;  2O3F A;  5HS7 A;  2FOK A;  1BM9 A;  4I0A A;  4ZZL A;  4U7B A;  1HKQ A;  4ESJ A;  2COM A;  1JXS A;  2X0L A;  4ETS A;  4U0V A;  3DEU A;  4L9N A;  4CDG A;  5LGT A;  4UUV A;  3LAJ A;  2ZME B;  5IT3 A;  1HW1 A;  2DBB A;  4A6D A;  1F9N A;  3HSR A;  5A2Q Z;  3TDZ C;  3Q9V A;  5E1W A;  2F5F A;  2XUB A;  2KJC A;  5LEK A;  2D1H A;  4OMY A;  2HYG D;  3J80 Z;  3I58 A;  1JGS A;  1W7P A;  3ZMS A;  2DI3 A;  3GZ5 A;  4RAZ A;  5HVQ C;  5JI6 A;  2FRH A;  2OQG A;  3IKV A;  1P4A A;  4U0W A;  1ZAO A;  2H6C A;  2HTJ A;  3SFZ A;  2PN6 A;  3F22 A;  1FYL A;  3U1D A;  1JHH A;  3B02 A;  1BIA A;  5DYM A;  2HKO A;  3RDI A;  1R23 A;  2GAU A;  2BEO A;  4KIF A;  2EFP A;  1H9T A;  1B6A A;  1E2X A;  1U2W A;  3V8J A;  3ROU A;  2P7C B;  2DO7 A;  3CLO A;  2EB7 A;  5J6X A;  2FNP A;  3NRV A;  4IPA A;  1FSH A;  3ZMD A;  3HRS A;  4GCV A;  2GWR A;  4G6D A;  3O6B B;  4AVP A;  2EFQ A;  2JRT A;  3GVA A;  2PQ8 A;  3KET A;  3V4G A;  3L09 A;  4TV7 A;  1Z1D A;  3GF2 A;  1G3W A;  1PDN C;  3QAH A;  4KFC A;  3I71 A;  3E5U A;  1QBJ A;  3REO A;  1T0F A;  3BY6 A;  1ZLK A;  4BH9 A;  2RGV A;  1IRF A;  2M8E A;  1TW2 A;  1BI1 A;  5L3B A;  3PQJ A;  4GYI A;  4HDV A;  2VT2 A;  2ZBK A;  4IF4 A;  4MHG A;  2P5L C;  3C7J A;  3R0J A;  4U88 A;  1B4A A;  4A6E A;  1U5T A;  3HRT A;  1AWC A;  1MDM A;  2M45 A;  1KGS A;  3I4P A;  2JPB A;  4LLG F;  1RZ4 A;  4KIC A;  5L3D A;  3WTY C;  3LA7 A;  2VT3 A;  4I01 A;  2ZFW A;  3K2Z A;  2EA2 A;  1YW8 A;  3DPT A;  2Z33 A;  3RIR A;  1MGT A;  4UVA A;  3N97 A;  3DFG A;  4GGG A;  3S2W A;  4KA4 A;  4HAM A;  2DQR A;  1SAX A;  2IT0 A;  4H0E A;  2GQQ A;  1KU3 A;  2PMH A;  1FY7 A;  4L0Z B;  2YR2 A;  1WWX A;  4AIJ A;  1R1U A;  5HS8 A;  2W24 A;  1IN8 A;  1CF7 B;  3ZQ7 A;  4QLC U;  3QP6 A;  3M8E A;  3F6O A;  2VBY A;  4OIQ F;  1SFX A;  2MC3 A;  2VOP A;  3DV8 A;  2YX4 A;  3FX3 A;  1IAW A;  1ON2 A;  5DD8 A;  1D3Y A;  4EJO A;  2VC1 A;  2F2E A;  3V8L A;  1BIB A;  4WK8 F;  3F23 A;  2OZ6 A;  4LG0 B;  1XSX A;  4XSX F;  1VTN C;  3E5Q A;  1XDS A;  2BBY A;  3VB2 A;  3TDU C;  4YII A;  1LNW A;  2L01 A;  2HS5 A;  1P92 A;  3FMS A;  1SD6 A;  4ZYD A;  4Y17 A;  3HSE A;  1IN6 A;  2EJR A;  1JE8 A;  1KU2 A;  3ABU A;  2VC0 A;  2DAO A;  4XLN F;  2ZCW A;  1F1Z A;  4HX7 A;  1BC8 C;  3I64 A;  1G3S A;  4EM2 A;  3RPU A;  3FMQ A;  2LDU A;  2DPD A;  5KK1 A;  1XGS A;  2AXL A;  2V1X A;  4YG2 F;  3SXY A;  1H0M A;  2ISY A;  2KJB A;  2XAS A;  1LDK B;  4KIG A;  2XAG A;  1XGO A;  4ZYE A;  5LHI A;  2EA4 A;  1WKM A;  3DF8 A;  4IJA A;  4RGS A;  3KEO A;  1SD7 A;  2CFX A;  3HOS A;  3KLN A;  3TO6 A;  2QQB A;  5BQT A;  2FBI A;  3WG9 A;  5F64 A;  4CZZ A;  2M87 A;  2ISZ A;  5E20 A;  2ESN A;  2FQ3 A;  4ASN A;  4XSZ F;  3BWG A;  2ELH A;  1UFM A;  3DQV C;  4PCQ A;  3WGG A;  4EJT A;  4Q4Z F;  4HQM A;  4UV9 A;  1IRG A;  2HTS A;  2PEX A;  1U8R A;  1R22 A;  4NQW A;  5DEQ A;  5LGN A;  3B73 A;  1SMY F;  2TDX A;  1P6R A;  3Q9S A;  4UV8 A;  4ENN A;  3FM5 A;  3J81 Z;  5JHU A;  4S04 A;  2DU9 A;  3DKW A;  1HKS A;  1LB2 A;  1YIO A;  5H6R A;  1G6N A;  4M6Y A;  4HX4 A;  3QPH A;  3FWE A;  2ZJ2 A;  4P9F A;  4L0Y B;  1W7P B;  3F8F A;  1ZGA A;  4KMU X;  1S29 A;  4LK1 F;  2AS5 F;  3GFM A;  4FX4 A;  3GXO A;  5D5U B;  5D4R A;  2FXA A;  3H3U A;  2STT A;  2W84 A;  2LNB A;  1O7L A;  4EJV A;  2VOD A;  2WWY A;  4Y15 A;  3FXQ A;  1SD4 A;  2L4A A;  4LMY A;  1XGM A;  2JTV A;  1RI7 A;  1UCR A;  4LFU A;  3MAJ A;  2DQL A;  3BRO A;  4NB5 A;  3KP3 A;  5LLQ A;  5L3G A;  5L3F A;  3U9G A;  3VEP A;  1KU7 A;  2RQP A;  1HW5 A;  3ML6 A;  2A68 F;  2MLG A;  1B9M A;  4BHP A;  3K1P A;  4Q47 A;  5TJJ A;  3P9I A;  1FBS A;  1FSE A;  5D5V B;  2HR3 A;  3M8F A;  4AWX B;  1YO5 C;  1YYV A;  3H92 A;  4WWC A;  2ZKZ A;  4G6Q A;  2E1N A;  3WTZ A;  2BYV E;  1RIO H;  3BDD A;  1ZG1 A;  1OPC A;  2DFI A;  4I09 A;  4ESF A;  4AIH A;  5L3E A;  1REP C;  1ZRC A;  3EYI A;  1T98 A;  4I98 B;  4OOI A;  4HLY A;  3W6K B;  2Q0O A;  1RUN A;  4GYG A;  5LRS A;  1FX7 A;  3QU6 A;  3G3Z A;  1ZG3 A;  4A0Y A;  3TOA A;  3IHU A;  1R7J A;  2V9V A;  2IPQ X;  1ZRE A;  4M72 A;  4HOB A;  5FB2 A;  2O6G E;  2OZU A;  2LSO A;  4ENJ A;  1H9G A;  1J9I A;  5DCF A;  2VBW A;  3RJP A;  3LQR A;  4P96 A;  2XKO A;  1T39 A;  4CYD A;  2QWW A;  3ZMV A;  4EVI A;  1U6G A;  3F8N A;  4P9U A;  1BC7 C;  2H94 A;  4FT8 A;  3V7R A;  1GVJ A;  1BN5 A;  4HW0 A;  4HV6 A;  3D5L A;  2F5E A;  1BI3 A;  3C3W A;  3E3V A;  2PMU A;  4BYY A;  2BE5 F;  2OQR A;  2Q2E A;  3PQK A;  2HOE A;  1T2K A;  1FLI A;  2P5K A;  2R7F A;  4HDU A;  2QQ9 A;  2QLZ A;  2HZT A;  1EV7 A;  2NAZ A;  3ECO A;  5D5W B;  1TTY A;  1P4W A;  1B59 A;  2DT5 A;  4P55 A;  1XD7 A;  2K02 A;  2CW0 F;  3ZP5 A;  3E6B A;  3ISP A;  5KVR A;  5LRR A;  2XRN A;  4L5I A;  4HQE A;  3DPL C;  5ICE A;  3RPQ A;  4A5N A;  1R36 A;  1SMT A;  2ACJ A;  4A2U A;  1PP8 F;  5FFX A;  2HQN A;  4A0X A;  1BOA A;  2ETH A;  3F3X A;  1RUO A;  2JZY A;  3R60 A;  2FF4 A;  1XN7 A;  4KT5 C;  4A0Z A;  1FP2 A;  1HQC A;  2PBI A;  1J5Y A;  4IHS A;  2EV0 A;  3LAP A;  5ICG A;  3I5U A;  2DK8 A;  1Z6T A;  2L54 A;  3ULQ B;  3GYH X;  1I6X A;  2XAH A;  1D8J A;  2LF7 A;  3BJO A;  1OR7 A;  1I1S A;  3R0A A;  1IN7 A;  3ECH A;  3MZH A;  1B1B A;  1XMK A;  2EWN A;  4ZZD A;  4O5V A;  3WTV C;  4LGW A;  4CXF A;  3VFZ A;  1L0O C;  4CO8 A;  4YFX F;  4G7H F;  3HHH A;  2C6Y A;  3WGI A;  3RTR A;  5HDG A;  4MEY F;  5J8F A;  5JR3 A;  2EV6 A;  3LST A;  2PLY A;  2RDP A;  4IRG A;  1FPQ A;  4L9T A;  3KP7 A;  2KKO A;  2FMY A;  1KU9 A;  2YX7 A;  2YSR A;  4M9S A;  3R4K A;  3ZN0 A;  3K0L A;  2GXB A;  3ERE D;  1O3R A;  2M5W A;  2FBH A;  3ZMT A;  1C0W A;  5JVT A;  3KP4 A;  2PG4 A;  4OMZ A;  1LEB A;  1D5V A;  1GXP A;  4HA8 A;  3CUQ C;  1XMA A;  3F21 A;  2IA2 A;  4CIC A;  4R1H A;  3I0T A;  2MH9 A;  3P9K A;  1KQ9 A;  1IF1 A;  3HHG A;  4EGY A;  4HF2 A;  1IXR C;  5AIQ A;  1ZAR A;  1EH8 A;  3KZZ A;  4I0B A;  2NRA C;  3H3Z A;  4EV0 A;  1ZRF A;  3JSP A;  4CGZ A;  1G3Y A;  2VOO A;  2VN2 A;  3L2C A;  2W85 A;  4ON0 A;  1XSV A;  1QGP A;  1DPR A;  3QP5 A;  3C1D A;  4RS8 A;  5D8K B;  3BJ6 A;  3QRF F;  2ADU A;  4YFK F;  3KLO A;  2GA1 A;  4G7O F;  4EMS A;  1W5S A;  2HYF A;  3KFW X;  1SFU A;  3RKX A;  3CUQ A;  1MD0 A;  3LQQ A;  1T6S A;  2QEN A;  3J7A O;  4HF1 A;  5ILV A;  1S7A A;  3MZY A;  5ICF A;  4N9H A;  5F1R A;  1P4X A;  3GFL A;  5LBQ A;  2VBX A;  2XGX A;  2NNN A;  5HLG A;  3FF5 A;  3HTU A;  4ENK A;  3C18 A;  4RGX A;  3K1M A;  5FGM A;  2HEO A;  2HFH A;  4AD9 A;  2ZXJ A;  2DLL A;  2ZNZ A;  2DTR A;  1FT9 A;  1U78 A;  1KQ8 A;  3GEZ A;  5DCM A;  2XAQ A;  3HRM A;  3WE2 A;  4BNC A;  1OYW A;  1RNL A;  5D8L B;  4DQ2 A;  3ZPL A;  3Q5F A;  4AIK A;  2OD5 A;  2RN7 A;  3BOQ A;  2STW A;  3EQL F;  4ESB A;  2KIF A;  1HW2 A;  4L9V A;  2O0Y A;  3RKW A;  1WI9 A;  2O8X A;  4G94 A;  1OYY A;  4M73 A;  1J7K A;  4M6X A;  5E1X A;  5DCM B;  2JSC A;  4OIO F;  1QPM A;  5CJ9 A;  2R3S A;  1J75 A;  3WOD F;  5LGU A;  1KYW A;  1YFH A;  4O6J A;  3AAF A;  4GXO A;  1XCV A;  3F6V A;  3T8R A;  1R1T A;  5K5O A;  1FYM A;  1W4M A;  3HYI A;  2RV8 A;  1QQI A;  2HQR A;  4I2O A;  2XHK A;  1G3T A;  3HUG A;  3M1E A;  2CO5 A;  1LEA A;  1ZG5 A;  3KP6 A;  2A6E F;  3HRU A;  4MQ9 F;  3RI4 A;  1FOK A;  2K27 A;  4OIR F;  2FEZ A;  2IA0 A;  2NYX A;  2ZNY A;  2Z5U A;  4EM0 B;  5BMZ A;  1FYK A;  3TO7 A;  5CVR A;  5CVJ A;  4CHU A;  3T0Y A;  1WRJ A;  1TQP A;  3CUO A;  3J80 K;  1ON1 A;  4IXA A;  2CYY A;  5K5R A;  2FNA A;  2HKX A;  3G73 A;  2UWM A;  2V79 A;  1IW7 F;  1EH6 A;  3WU1 B;  1YW9 A;  3DXJ F;  1EH7 A;  2WC2 A;  4LD5 A;  2YU3 A;  1ONV A;  3CDH A;  4MNU A;  1IXS B;  2XV4 S;  4RGR A;  2M1B A;  5FD6 A;  3KCC A;  3WTS C;  3VOE A;  5BS6 A;  1TNT A;  1R1V A;  2V1D A;  3MQ0 A;  1SFE A;  4LB5 A;  4HBL A;  4M9X A;  3L9F A;  1O3T A;  2P7V B;  1Z05 A;  4R8H A;  3MWM A;  1K78 A;  3OV8 A;  4KIB A;  3GO5 A;  2EFO A;  3PFI A;  1G4D A;  1S6L A;  3I54 A;  2D2W A;  4U0Y A;  5CLS A;  1MJA A;  3JAM K;  3JAM Z;  2ESH A;  2IA1 A;  3GUD A;  2IJL A;  3L7W A;  2H27 A;  1BBY A;  3HIF A;  3KZY A;  1BI0 A;  5HS9 A;  3U2R A;  5CYV A;  1K78 B;  1F4K A;  2RC4 A;  1CGP A;  1HKT A;  4IVN A;  1V3F A;  4WX9 A;  2A69 F;  4HLX A;  2L3D A;  2K86 A;  3CO6 C;  3WTX C;  2XIG A;  4KMF A;  1W7P D;  5ICC A;  1O57 A;  2CG4 A;  1LDD A;  3QU3 A;  5D5X B;  3J81 K;  1UST A;  5K5Q A;  4K2E A;  1DPU A;  5EEG A;  5ILS A;  2G7U A;  2IP2 A;  2OAZ A;  4YFN F;  2EV5 A;  3TKY A;  4D0P A;  2CSO A;  5E17 F;  1HST A;  4I7H A;  5F6F A;  2J5O A;  2H6B A;  2Z9O A;  1FC3 A;  4UVB A;  1K6O A;  3SZT A;  1Z6R A;  4HF0 A;  1T38 A;  4BHB A;  3FM3 A;  3WTW C;  2MLK A;  1K79 A;  3E6D A;  3GFJ A;  3VOD A;  2QQA A;  4ZH4 F;  2FA5 A;  3F8M A;  1IXC A;  3BP8 A;  4LK0 F;  5DUI A;  5DD4 A;  1HSJ A;  3K9T A;  4LG0 A;  3F8B A;  5LEJ A;  1IUY A;  4S05 A;  2G7H A;  1V4R A;  2Y48 A;  1ZYR F;  2CWE A;  3MEX A;  2FE3 A;  2CQK A;  1UHM A;  4HX8 A;  4R79 A;  5ED4 A;  5FO5 A;  3FMR A;  1QZZ A;  4EJU A;  3CUQ B;  3IL2 A;  3WTU C;  4O3M A;  3E6C C;  3ZN1 A;  2K4B A;  1GHC A;  1FWZ A;  2A07 F;  5E8G A;  3RYR A;  4B8X A;  3E6M A;  1KA8 A;  1D8K A;  2KIU A;  1TQM A;  1MKM A;  1QNT A;  4IHT A;  1I5Z A;  1IZ1 A;  4L18 B;  3I59 A;  5FLX K;  3F72 A;  1KQ0 A;  2DW4 A;  2WV0 A;  1Z91 A;  4B09 A;  3NQO A;  3IWZ A;  4IRI A;  2HWV A;  2HDC A;  3JSO A;  1YQA A;  2EK5 A;  1FZP B;  1STZ A;  3K69 A;  1YS7 A;  5J8C A;  4JBA A;  1IN5 A;  3ABT A;  2QUF A;  1FBQ A;  2YPR A;  1TQI A;  4L9J A;  4PGG A;  3TGN A;  3GFI A;  2PI0 A;  1R00 A;  3FHZ A;  3KP2 A;  3RYP A;  4LLN A;  3WGH A;  4KDP A;  2D1V A;  1J59 A;  2RKH A;  3GZ6 A;  3WU0 A;  4UXN A;  1MJ9 A;  3GX4 X;  3LA3 A;  1FBU A;  1HXD A;  1LVA A;  3EET A;  1I27 A;  2H09 A;  3MCZ A;  4UHT A;  4M71 A;  4A5M A;  1MJB A;  4ENM A;  2PJP A;  4MGR A;  3KE2 A;  2VXZ A;  4OU0 A;  5HLI A;  2CGP A;  1LDJ A;  4PGH A;  4Q5S F;  1TLH B;  5DDG A;  1FNN A;  1YW7 A;  4ZYH A;  2RVC A;  2GZW A;  2KIM A;  2OU2 A;  1PP7 U;  3HSF A;  2FBK A;  1ZGJ A;  3BPV A;  4MTE A;  3BZ6 A;  4MEX F;  4PZJ A;  2UXX A;  5AIP A;  3HTS B;  1U5T C;  4WXD A;  3M7G A;  5CVV A;  4F7Z A;  1SD5 A;  2RNJ A;  1DP7 P;  4RB0 A;  2JPC A;  4E70 A;  2VE8 A;  1P2F A;  4XLP F;  1YLF A;  4FHT A;  3FXR A;  2M30 A;  1XDU A;  4P5O A;  4OIP F;  3DP7 A;  5ERI A;  2KRF A;  4YIF A;  6PAX A;  2P6T A;  2UXN A;  3TOB A;  5CVI A;  4WXH A;  5DUK A;  3T8T A;  1S3J A;  1ZRD A;  2W57 A;  5EEH A;  2MH2 A;  2V6C A;  2WTE A;  1O3S A;  4G8X A;  2NNY A;  4WXC A;  2FML A;  3QPT A;  4BXU A;  3LFK A;  3EYY A;  2A5Y B;  3COA C;  2EFW A;  1XB4 A;  3WTT C;  3O2P E;  1J2X A;  1R58 A;  3KP5 A;  1E17 A;  2UZK A;  2DK5 A;  3LA2 A;  1NHA A;  4ZYG A;  5L3C A;  2LKP A;  5FLX Z;  3CO7 C;  2Z3Y A;  1YS6 A;  3GWZ A;  1ZH5 A;  2GA2 A;  5LHH A;  4WF2 A;  3IRR A;  1K7A A;  3KEQ A;  2BGC A;  1YTY A;  4KN4 X;  3O3K A;  2O03 A;  1F5T A;  5HLH A;  2VBZ A;  5AON A;  1OMI A;  1ZLJ A;  2A61 A;  2E7X A;  4L5J A;  3F8C A;  2R7D A;  2XRO A;  2K4J A;  2MBF A;  5A2Q K;  4EGZ A;  4JQF A;  4BHC A;  3T5X A;  5H6Q A;  4DNC A;  5H20 A;  4N9I A;  2ZO4 A;  3IWF A;  4NHJ A;  1HBX G;  2Q8K A;  3TO9 A;  4M74 A;  2GIV A;  2QM3 A;  5ILU A;  2IW5 A;  4Z2Y A;  2VON A;  1WQ2 A;  1IN4 A;  4RGU A;  2P4W A;  3FXU A;  3M9A A;  4M9Z A;  2MD5 A;  5E1Z B;  1CF7 A;  5IT9 Z;  2PFB A;  2OA4 A;  4EM1 A;  3CTA A;  4KYW A;  1DUX C;  2O61 A;  4Q48 A;  5D6F A;  3MFK A;  1Q1H A;  4N0B A;  2Y75 A;  4QWQ A;  3P9C A;  2OBP A;  1J0R A;  4GO1 A;  3V7C A;  2HGC A;  3ZMU A;  3EUH A;  4EJW A;  1AOY A;  4LB6 B;  3JW4 A;  2QVO A;  1JHF A;  3WE3 A;  1Z9C A;  2NS0 A;  3N4M A;  5BPD A;  3SQN A;  2L02 A;  4BAY A;  2BV6 A;  3OOP A;  4IRH A;  2XVC A;  2XAJ A;  1ODD A;  2P5V A;  2X4H A;  5D6E A;  3V8K A;  1UHW A;  2DPU A;  1KYZ A;  2VE9 A;  3SHF A;  4I02 A;  4LJZ F;  3JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...