5BMZA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 24mer dna.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HcaR protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 24mer DNA.
rcsb
source organism Acinetobacter baylyi (strain atcc 33305 / bd413 / adp1)
molecule tags Transcription
total genus 42
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5bmzA00
3BPXA 5HOOA 4MHGA 4EQQA 1O3TA 2H09A 1PP8F 1O3SA 3I4PA 2DBBA 2A68F 3G73A 5LEJA 4I2OA 1IAWA 2MA3A 2QVOA 1AOYA 1GXQA 3I71A 1OYIA 4LK1F 4OMYA 1K78B 3TO6A 1WSUA 3KEQA 4U0WA 3IKVA 2FSWA 2PLYA 3C7JA 2F5FA 3QP6A 1ZREA 2ELHA 4L9VA 2MC3A 2EFPA 1B59A 1ZG3A 2YU3A 3VODA 4M6YA 4LG0A 2EWNA 2A6EF 4LLGF 1XGOA 1FOKA 1BI2A 3GX4X 1JHHA 1D8JA 1YQAA 3SZPA 3GZ5A 2W25A 2E1CA 1W5SA 2OZUA 2UXNA 3R6SA 4P96A 1CGPA 1ZYRF 4EGZA 2HFHA 2RC4A 1TTYA 3R60A 1ZGAA 3FMQA 1LDKB 2G9WA 3CUOA 3R0AA 3ML6A 3KP3A 2F5DA 2DPDA 3F8CA 1RZ4A 3T5XA 5FFXA 5EEGA 4LFUA 5D4SA 2K02A 2FBHA 2LF8A 3L00A 3RDIA 4RGSA 1FP2A 2C6YA 5LBQA 4HV5A 2GA1A 2KIFA 4M9SA 2V79A 3BPVA 2JZYA 3E6BA 3PQJA 2D1HA 3V7RA 4AIKA 5IT9K 2PMHA 4CXFA 2EV0A 2P5LC 3HRSA 2NNNA 2JSCA 4EJWA 3DEUA 3SHFA 1W7PD 3DFGA 4ZYGA 1RI7A 4KIGA 5CVRA 3T8TA 1I27A 4RAZA 4G9YA 2HDCA 4H0EA 4ASNA 3WGGA 3J81K 3VFZA 3GFIA 1QBJA 2IPQX 2YPRA 1FLIA 1QZZA 4KIBA 1XSDA 5FLXZ 1R36A 4G7ZF 5CVIA 1FSHA 2ISZA 4O3MA 3RKXA 3V7CA 1FZPB 3I54A 1YS7A 4P55A 3DP7A 2HTSA 1BOAA 2IVMA 2WV0A 2A3SA 1FNNA 2GWRA 4IHTA 5E17F 1Z7UA 1BC7C 1DUXC 4EV0A 2EFWA 2WWYA 3ZMZA 5HDKA 1XDUA 4L0ZB 2HQRA 4I09A 3NRVA 4UV8A 3L7WA 5LHGA 1IN5A 4YFXF 2JPCA 3HSRA 4B8XA 2FE3A 2E7WA 4BHBA 3BROA 4ENKA 5DEQA 2EFQA 1J59A 1XGSA 2PMUA 3LQRA 1XGNA 4A2UA 4G6DA 3WTXC 1R22A 2BV6A 2K4JA 3TGNA 3T0YA 4CO8A 2DW4A 2P8TA 4LMYA 3ABUA 3IHUA 4RGXA 5FB2A 1QPMA 1ZHFA 1IN8A 3RI4A 4UHTA 3QOPA 2D2WA 3EUHA 5AONA 1E17A 3KEOA 2XVCA 1S8NA 4GXOA 4HX8A 2IA0A 1KQ9A 3JAMK 1IRGA 1YW8A 2IJLA 1SD7A 4EGYA 1QZYA 3ELKA 1MZBA 3TO7A 1XCBA 1FYLA 3REOA 1LEAA 4DQ2A 1LQ1A 5CLSA 2QQAA 2UWMA 5D4RA 1Z6TA 2FU4A 3GEZA 3KP2A 2F2EA 5HDNA 5K5QA 5TRDA 3C1DA 2GIVA 1ZH5A 4M71A 5BPIA 3G3ZA 2VOOA 4JBAA 3L2CA 1IUYA 1U5TA 3QU6A 3WE3A 3D5LA 2QQ9A 3K1PA 3LQQA 3ECHA 1YLFA 4P9UA 4LB5A 5DD4A 5LGTA 5ERIA 4R1HA 4YIIA 4B09A 4A0YA 2FNPA 5D5VB 4LG0B 1HSJA 2H6BA 2A07F 1BN5A 2FRHA 1J5YA 4NHJA 2G7HA 1R23A 1B9NA 1MKMA 1SD4A 2CQKA 2NAZA 4HX4A 4A5NA 2V9VA 1UFMA 3TKYA 1G3WA 5H20A 3N97A 1RNLA 1F5TA 5LLQA 5FFZA 1UHWA 5HLGA 1TNTA 1WQ2A 4QLCU 3E3VA 1D8KA 3M1EA 4FT8A 2D45A 2BGCA 2ESHA 1A04A 2M5WA 2RV8A 1HSTA 2MLKA 5A2QK 2OQRA 2EA2A 1HQCA 1U78A 1F4KA 5ILUA 5KK1A 4BXUA 2J5PA 3VB2A 1XD7A 2YR2A 4RB2C 5DUIA 1O3QA 2FOKA 1F9NA 4IRGA 3ZPLA 1UCRA 4I0AA 4L9TA 3SXYA 1CF7B 1ZGJA 4GGGA 4ZZLA 1K6OA 2WTEA 2XKOA 4HYEA 1H9TA 3KZZA 4PZJA 5L3FA 4U0YA 3TDZC 2GZWA 3SFZA 1S3JA 2XHKA 3ZN0A 4UNOA 2PFBA 4A0ZA 4RAYA 2XUBA 2HGCA 4MTEA 5LHHA 1BJAA 1SFXA 1YIOA 1V4RA 4N0BA 3KETA 3RKWA 5D8LB 4ESFA 1P92A 4M73A 3ZMSA 1ON2A 1MJBA 4LLLA 2ADUA 2OAZA 4U7DA 2RDPA 4IRIA 5HDGA 3ZMTA 4O5VA 2LNBA 1TW2A 3RIRA 1TBXA 2P5VA 1J9IA 1KU7A 2VBWA 4KMUX 5H6QA 2VXZA 4KN4X 2MD5A 2LDUA 4EJOA 3RYPA 4F7ZA 3I59A 2OD5A 3KE2A 3H3ZA 5JR3A 2Y48A 2H6CA 2CFXA 5CYVA 5ICEA 3MFKA 2K4BA 4L9JA 3MZHA 2EFOA 5LRSA 2RQPA 3W6JB 3BZ6A 1Z9CA 4FX0A 3ABTA 3EYYA 1D5VA 1EV7A 4I01A 4RB0A 3E6DA 2NS0A 4XLPF 2YX4A 4ENNA 2FA5A 1SAXA 1YTYA 4MGRA 3IRRA 1P4WA 2DO7A 3ERED 3DQVC 5EEHA 2P6SA 4N9IA 1XMAA 3WODF 2ACJA 4ZYEA 3E6MA 2V1XA 1O57A 4Q47A 3HOTA 2M30A 3W6KB 3J80Z 2DT5A 3WE2A 4G8XA 4CICA 3FXRA 3LAPA 2ZNYA 1KA8A 4ENMA 1MJ9A 3R61A 1S6LA 1EH6A 3I64A 5E8GA 3F6OA 1QNTA 3I53A 4Z2YA 3U9GA 1ZRFA 2HKOA 3MZYA 3E97A 1SFUA 1LVAA 4KN7X 4M9XA 3M7GA 3CO6C 5CVUA 3VOEA 4KMFA 3HTUA 4KUMA 4MEXF 2L54A 5JHUA 4JK1X 1HKSA 5J8FA 5DV5A 4EMSA 3FZVA 3OOPA 2M45A 1QQIA 1ONVA 1LNWA 5LGNA 4LGWA 1ZLKA 2IW5A 1TQIA 2DQRA 4HV6A 1SD5A 3CLOA 2JT1A 1DP7P 1STZA 4CYDA 3HUGA 1YW9A 1W5TA 3ZQ7A 1MDMA 4Q48A 4BYYA 3QPTA 4L9NA 5KVRA 5CJ9A 2DTRA 5H6RA 3H92A 2HS5A 2VT3A 2X4HA 3C3WA 2ZXJA 4Y15A 3HSFA 1MGTA 2M8EA 2F5EA 5AIQA 3QPHA 4OOIA 2HYFA 3MQ0A 1SMYF 3JSOA 4KIFA 3QAHA 1OYYA 1W4MA 2XASA 3L9FA 3WTWC 2STWA 1GXPA 2VONA 2PI0A 4Q5SF 1WI9A 1T2KA 2FMYA 1IN7A 5BS6A 2VE9A 1ZAOA 4XSZF 1X3UA 5CVVA 3O3KA 5IT3A 1GVJA 4BHPA 2MBFA 2CGPA 4YG2F 4YIFA 4Y13A 3LA7A 1SMTA 4KFCA 3CUQC 5HS8A 3WU1B 2QYOA 3BJOA 2RNJA 3QP5A 4EM0B 1WWXA 2OBPA 2GA2A 1R1TA 3RJPA 3GWZA 4JQFA 4ZZDA 2VODA 1G4DA 4WK8F 4NB5A 3EYIA 2Z5UA 3C18A 4PCQA 2ZNZA 3HRMA 2VT2A 5E1ZB 1IN4A 5E1WA 2GXGA 4OU0A 4HQEA 1KU2A 5FGMA 1U2WA 2RN7A 1USTA 2L02A 4G7OF 3S2WA 1OKRA 1XMKA 5F1RA 4ESBA 4LK0F 1FT9A 1XB4A 4RGUA 2NYXA 4I02A 1FSEA 5F64A 2XAGA 2BYVE 3KZYA 2ZFWA 2IP2A 2UXXA 5HLIA 3N4MA 4OMZA 4Q4ZF 3M9AA 4IF4A 3F23A 3FM5A 1AWCA 1P4XA 2V1UA 3HHHA 2A5YB 4WXCA 2EFNA 4HW0A 5BQTA 2RVCA 2Z33A 5AIPA 3SQNA 3ULQB 1W7PB 2HQNA 2ZMEB 3GW2A 1R58A 2P7VB 4U88A 1BI3A 3F8BA 3KP6A 3V7SA 5L3EA 3L09A 1IF1A 4S05A 2FF4A 3BWGA 5IT9Z 1HW1A 1ZN2A 4HDUA 2R3SA 3E5UA 2G7UA 3LAJA 3TO9A 3F3XA 1V3FA 2M1BA 2DK8A 4HBLA 1REPC 2FQ3A 1XSVA 3J81Z 3LA3A 1OMIA 4CGZA 2NNYA 2OU2A 3KLNA 1B4AA 2E7XA 2BBYA 2V1DA 4E70A 1U6GA 3MCZA 2QUFA 1K78A 4HX7A 4LB6B 5JI6A 1EH7A 4AIJA 4EM2A 5DCMA 3FMSA 1E2XA 1KU9A 4OIPF 2QBYA 4U0VA 1WKMA 3HRTA 1QGPA 5E8IA 4RB1A 2RGVA 1G6NA 3KFWX 1LDDA 3FWEA 1XN7A 2ZBKA 3GYHX 2MLGA 4ZYDA 4ZH4F 3V8KA 4HAMA 1DPUA 3F8MA 1L0OC 2ZO4A 1LB2A 4WF2A 2IA2A 2QQBA 4RGRA 2HTJA 3MWMA 4M6XA 5L3GA 3BY6A 1I1SA 2QLZA 3B02A 3ZP5A 1YS6A 1R5GA 4KA4A 3P7NA 2COMA 2Z99A 3I0TA 4OINF 2O3FA 3O6BB 5JVTA 1D3YA 3HHGA 1R1VA 2RKHA 1RUOA 3JAMZ 2EV6A 1C0WA 4RS8A 3MEXA 4KNYA 4WWCA 4ETSA 1YW7A 1PDNC 2X0LA 2Z3YA 4HLXA 1BIAA 2CYYA 1JGSA 3WGIA 4LD5A 1T98A 1DDNA 2VOPA 4UXNA 2CWEA 2BEOA 2HOEA 2W85A 3HIFA 2HKXA 3FX3A 3IWZA 3HYIA 5D6FA 3GXOA 3TOAA 2DU9A 1IXCA 1HKQA 1S29A 3U1DA 3DPTA 1FWZA 2CO5A 2O61A 5D5XB 1RUNA 5ED4A 1MJAA 3V8JA 4HF0A 4L5JA 4EJVA 1VTNC 4KT5C 1XGMA 3GO5A 3LWFA 2R7FA 3F6VA 2Q2EA 2JRTA 4WXDA 2YSRA 3M8FA 5DD8A 1HKTA 2FNAA 1JE8A 3DKWA 2EK5A 2D1VA 4A5MA 3D0SA 3ZMUA 5BOXA 4DNCA 3GLXA 3WG9A 2HEOA 3QRFF 4KDPA 4L0YB 4UVCA 4I0BA 1FYMA 1J0RA 4I98B 4RB3C 2IRFG 3U2RA 4HF1A 2L4AA 5A2QZ 4YFNF 1ZRDA 4EJUA 2PEXA 4BH9A 2QM3A 3JW4A 3K1NA 4A0XA 3CUQA 1F1ZA 2QZ8A 2OZ6A 5TJJA 2FBKA 3HOSA 2DAOA 3IL2A 2OA4A 2E1NA 2EB7A 2DFIA 3TDUC 1FBSA 1IN6A 3QU3A 3CTAA 2DLLA 3CO7C 5LHIA 4A6EA 1TW3A 3JSPA 1ODDA 1R5HA 1FX7A 1IXRC 2XV4S 3ZN1A 3NQOA 4NQWA 1B9MA 4BNCA 2M87A 2DQLA 2GQQA 3F8NA 5E20A 3PFIA 4HDVA 1IRFA 4EJTA 3WTTC 2L3DA 1Z6RA 4TV7A 2PG4A 1PP7U 2UZKA 4BHCA 4S04A 1O7LA 2F5CA 4IJAA 3F22A 3P9KA 3SZTA 3WTVC 1L3LA 1ZG5A 2L01A 1Z05A 1U3EM 3LSTA 2YX7A 4KYWA 3GUDA 2EV5A 1LDJA 2LSOA 4HLYA 1K79A 4IRHA 1IZ1A 5K5RA 2FBIA 1U5TB 3HSEA 3ECOA 3DV8A 5DCMB 1WRJA 1UB9A 5L3DA 4HA8A 5DDGA 2LKPA 4WCGA 2QBYB 2EJRA 4UUVA 1T0FA 2AS5F 4EM1A 3BP8A 2ESNA 3WTSC 5ICGA 3FMRA 2HWVA 2VC1A 2CG4A 2DPUA 3M8EA 3WTUC 1ZARA 3BDDA 4GYIA 5FLXK 1K7AA 5E18F 4GYGA 3K2ZA 4LJZF 5HVQC 2WC2A 1YYVA 2W24A 4QWQA 4MQ9F 2Y75A 2KJBA 3H3UA 3E5QA 2FEZA 5ILVA 3BJ6A 3ISPA 4XBFA 5J6XA 1U8RA 1FBQA 2VBXA 2XAFA 1UHMA 1MD0A 4MTDA 5HLHA 3HTSB 2STTA 2KIMA 3KLOA 3ZMDA 4UVBA 2ZKZA 3TQNA 3WU0A 2QWWA 1Y0UA 3F8FA 1BC8C 1KU3A 2P4WA 2XIGA 3K69A 3NEUA 4K2EA 3I58A 3FF5A 1O7FA 1IW7F 3I5UA 2Q8KA 5LRRA 1YFHA 1DPRA 2ZCWA 1HW2A 1BI0A 1T38A 1FYKA 2R7DA 4O6JA 4PDKA 1CF7A 3T8RA 2J5OA 2P7CB 1I1GA 1OYWA 3GF2A 2XKPA 3V8LA 2OQGA 3K0LA 4IXAA 1P6RA 2BE5F 2XGXA 3F72A 2P6TA 1T39A 5F6FA 1J7KA 1Z1DA 3T1BA 2H94A 4D0PA 1TQPA 3RYRA 4BQAA 2MH2A 2HZTA 3K1MA 5HS7A 3WTZA 1R00A 4N9HA 2O8XA 3EDPA 2ZJ2A 2XRNA 4CDGA 4YFKF 1R1UA 3LA2A 1XCVA 3LFKA 3I59B 4L5IA 1USSA 4M9ZA 1G3YA 1XDSA 4IPAA 3AAFA 4G6QA 3R0JA 1B1BA 2VN2A 4G7HF 4GO1A 3Q9VA 2XAJA 1ULYA 2GXBA 4CZZA 5DCFA 1HW5A 5FO5A 2A69F 1FPQA 1Q1HA 4WX9A 4P5OA 1BI1A 4XSXF 1O3RA 2VBYA 2IT0A 3O2PE 5BMZA 2PBIA 3CUQB 4BAYA 4ENJA 3WGHA 1IXSB 5FD6A 4AD9A 2ETHA 2K86A 2Y0MA 2K27A 3RTRA 3E5XA 3K9TA 3IC7A 4AVPA 2CW0F 4R79A 4OIRF 1QO0D 1P2FA 5E1XA 5K1YA 3EQLF 4HQMA 5FD5A 3CJNA 2EA4A 4ZYHA 3HRUA 2B0LA 3V4GA 1BM9A 1ZG1A 2CSOA 3COAC 4XRFA 1LEBA 5L3CA 1OR7A 5D6EA 2K7LA 1KQ8A 4ON0A 4MNUA 1SFEA 3KCCA 4FX4A 2VE8A 3GVAA 4IHSA 4OIOF 2HYGD 1J2XA 1KGSA 1RIOH 3RKYA 4AIHA 3KP7A 1R7JA 4HOBA 3GFLA 3DPLC 2NRAC 5ICCA 1S7AA 1J75A 4AWXB 2IA1A 1S7OA 3IWFA 1SD6A 3WTYC 3VEPA 3ROUA 4XLNF 3DF8A 5D8KB 2O0YA 4ESJA 3GFMA 5D5UB 3P9CA 2XAHA 3RPUA 1HBXG 1BBYA 2KKOA 3GZ6A 1MDMB 4GCVA 4MEYF 2VC0A 4HZFA 6PAXA 4Y17A 4PGHA 2LF7A 4CHUA 2KRFA 3BJAA 3MAJA 3R4KA 2KIUA 3Q5FA 1GHCA 3JTGA 2L4MA 5ICFA 4G94A 4U7BA 4OIQF 1OPCA 2V6CA 2MH9A 3ZMVA 1FC3A 2XAQA 1P4AA 2PJPA 3BOQA 1ON1A 4M74A 1Z91A 4HF2A 1PUEE 1TQMA 1NHAA 4LLNA 2A61A 2P5KA 4L18B 2DK5A 1LJ9A 3CDHA 2XROA 3KP5A 3RPQA 3FHZA 3PQKA 1ZRCA 1KYZA 5DUKA 5JFRA 1TLHB 3J80K 5HS9A 1XSXA 2O6GE 1FBUA 5J8CA 2TDXA 1ZLJA 2W57A 2O03A 5K5OA 1EH8A 1I6XA 2VBZA 3KP4A 4PGGA 1JXSA 2JPBA 2HR3A 4KICA 2H27A 2GAUA 4IVNA 4I7HA 2KJCA 2AXLA 5DYMA 4UV9A 4EVIA 5L3BA 2JTVA 3IRQA 1HXDA 3Q9SA 2FXAA 2FMLA 4WXHA 3OV8A 3E6CC 2PQ8A 3FXUA 1T6SA 2ISYA 3GFJA 1U5TC 1YG2A 1B6AA 3DXJF 3P9IA 5BPDA 3FM3A 2QENA 3FXQA 4P9FA 5D5WB 1H0MA 1W7PA 4MQVA 4A6DA 2DI3A 2ZMEA 3F21A 1G3TA 1KQ0A 2Q0OA 1I5ZA 2Z9OA 4UVAA 4M72A 1YO5C 3J7AO 3TOBA 5CVJA 3IKTA 1FP1D 1JHFA 3EETA 5ILSA 1KYWA 1FY7A 2PN6A 1H9GA 1BIBA 4FHTA 1G3SA 1TNSA 2A6HF 4A12A 4R8HA 3JTHA 2W84A 3B73A 5LEKA 5LGUA
chains in the Genus database with same CATH superfamily
3CCMI 3BPXA 5HOOA 4MHGA 3BTCA 4EQQA 1O3TA 2WAEA 1ZR4A 2M4GA 4X0GA 2H09A 1PP8F 3HPHA 1O3SA 3I4PA 1ETKA 5J4VA 2DBBA 2A68F 3G73A 2DMUA 2LH9A 3BG5A 2IS6A 5LEJA 4I2OA 1IAWA 2MA3A 2EPFA 3CJQB 1WI3A 3OS2A 4IX7A 2V1NA 2QVOA 1AOYA 1MBFA 1GXQA 2LTPA 3I71A 1OYIA 4LK1F 4OMYA 3L1PA 1K78B 3TO6A 1WSUA 3KEQA 3OIOA 4U0WA 4BXFA 4GRIA 1H88C 3IKVA 2FSWA 2PLYA 2Y30A 3EPZA 3C7JA 2F5FA 2JRMA 3QP6A 4M3DA 1ZREA 2ELHA 1RETA 4NC6A 4L9VA 4OAYA 1NTCA 2MC3A 2EFPA 5KAIC 1B59A 2KP6A 1ZG3A 3GMEA 4NBQA 1ETWA 2GOMA 2YU3A 3VODA 4M6YA 4LG0A 4RDUA 2QEXI 4BDZA 5FLVA 1TT5B 2EWNA 1Y8RB 2A6EF 4LLGF 5J1RA 3OIQA 2KIQA 3A0BC 1XGOA 3ASOH 2CUZA 1FOKA 1BI2A 3K4LA 3GX4X 1JHHA 2BY3A 2LRDA 1DU0A 1D8JA 1YQAA 1H8AC 3SZPA 3GZ5A 2WAQN 2W25A 2E1CA 2GXAA 2M7BA 2VJ5A 1W5SA 4XK4A 2OZUA 2UXNA 3R6SA 3QOEA 4ZDLA 4P96A 3MD2A 1CGPA 1ZYRF 4D1QA 3CMYA 4EGZA 2HFHA 1JUSA 4G6TB 2RC4A 4XLFA 3IH2A 3OYAA 1XX5A 1TTYA 2M3AA 3R60A 1ZGAA 3FMQA 3BR5A 4BJ6C 1LDKB 2G9WA 3CUOA 4IHYA 3GBGA 3R0AA 4AUXA 3DTEA 5KHDA 2HDDA 3ML6A 3HGGA 3KP3A 2F5DA 2DPDA 3GTKJ 3AKZA 4J01A 2JVGA 3S16J 3F8CA 4Y3OA 1I6HJ 2KDZA 1RZ4A 3K4JA 3ASNH 3T5XA 5FFXA 2CRGA 5EEGA 4LFUA 3OYNA 5D4SA 4JX4A 2K02A 2O7OA 2FBHA 1DU6A 2LF8A 3L00A 2X85A 2K3PA 1ZELA 3TP0A 1LUJB 3RDIA 2W48A 2JVHA 3KPHA 4RGSA 1FP2A 5IOZA 2C6YA 2E1OA 5LBQA 1JTXA 5BNGA 1EJ9A 4M3BA 4HV5A 2GA1A 2KIFA 4M9SA 2V79A 3K4MA 3CMAI 2VKVA 3BPVA 5M3FJ 3GTGJ 2JZYA 2HQ5A 2GLOA 1YITI 3E6BA 1E3PA 2R5YA 1JUPA 3PQJA 1BR4A 1U0JA 2D1HA 3V7RA 5E3OA 4AIKA 4D5CA 1Y6IA 5IT9K 1A36A 3WHBA 2PMHA 4CXFA 2W7NA 3B6CA 2EV0A 2P5LC 3HRSA 4XKVA 2NNNA 2JSCA 1WZ2A 2AXTC 3DEUA 3CLQA 3SHFA 4EJWA 1W7PD 3DFGA 1IV6A 4ZYGA 1RI7A 4F91B 4KIGA 1OFCX 3DU5A 4HEA2 5CVRA 2Z2SB 3T8TA 1IO2A 3PSFA 1I27A 4RAZA 2LBFB 2L5QA 3CP2A 2V26A 2YU9J 4G9YA 2HDCA 4H0EA 1ETOA 4ASNA 2Q2EB 3WGGA 3J81K 2K9QA 2F4OB 3VFZA 3GFIA 1QBJA 2IPQX 2YPRA 1TC3C 1FLIA 4XONA 5B3SH 1QZZA 5FLMJ 3GTOJ 1WJAA 4KIBA 1VQLI 2F4MB 1XSDA 3NWTA 5FLXZ 1TWHJ 3A4CA 3BG7A 1R36A 4G7ZF 5CVIA 1FSHA 3J7YJ 2ISZA 2RREA 4BU2A 2BVLA 4O3MA 3RKXA 3V7CA 1FZPB 3I54A 1YS7A 4P55A 3DP7A 2DFHA 2HTSA 2E1MC 3X2QH 1MSFC 2O8KA 1BOAA 3AFHA 2IVMA 2WV0A 3MKYB 4IOAF 5JLWA 3JRDA 2A3SA 1FNNA 4BGDA 4B3XA 2GWRA 1IRXA 5GADJ 4IHTA 5E17F 1LVKA 1Z7UA 1BC7C 1DUXC 4EV0A 2EFWA 3C2HA 3QYEA 2WWYA 3ZMZA 5HDKA 1XDUA 4L0ZB 2HQRA 1Z77A 4I09A 3NRVA 4UV8A 2JSPA 5J3LA 4BBRJ 3L7WA 1D0YA 1QVTA 3FKJA 5LHGA 1IN5A 4YFXF 1VQ8I 4C2TA 1JT6A 2JPCA 3HSRA 4B8XA 3S3MA 4ITVA 2FE3A 2QKMB 2WA0A 3DTKA 3RQIA 4XKBA 2E7WA 2L9NA 3G1LA 3BROA 4BHBA 3BR6A 3HG9A 3H9JA 4ENKA 1UAAA 1E3HA 4IQ4A 5DEQA 2EFQA 1J59A 1YRNA 1XGSA 2PMUA 2VJ4A 3LQRA 2LYCA 1XGNA 4A2UA 2OF7A 1JTYA 4G6DA 3WTXC 1S72I 1R22A 2BV6A 2K4JA 3HKZN 4M6VA 3TGNA 3ABKH 3T0YA 2XPUA 4CO8A 2DW4A 2P8TA 2X1EA 2WB1A 2BY2A 2DFFA 3CF2A 3O8HA 4LMYA 3ABUA 1MW7A 3IHUA 4RGXA 3ZQFA 5EYRA 5EDNA 5FB2A 3LSJA 1QPMA 2XSDC 1QA6A 2JUGA 3QWLA 5J4YA 2R7OA 2ZJRF 1ZHFA 3CCEI 2O9LA 1FOXA 1IN8A 1WJ5A 3RI4A 2QSFX 4UHTA 3QOPA 2D2WA 3EUHA 5AONA 3M8JA 5J1UA 4NQWB 2CFOA 1NG6A 2NVUB 1E17A 3KEOA 2XVCA 1S8NA 4GXOA 4HX8A 2BHZA 2IA0A 2WAFA 1KQ9A 3F9KA 3JAMK 3G6EI 1IRGA 1I3AA 5B66C 1D0ZA 2E2HJ 1YW8A 2IJLA 1SD7A 2JN6A 4EGYA 5EEAA 1QZYA 3ELKA 3LNQA 2LP0A 5CQEA 1MZBA 3TO7A 1XCBA 1HOMA 5KNLA 1FYLA 4XICA 4XRSG 3REOA 1LEAA 5B1BH 3MMYB 4DQ2A 1LQ1A 5CLSA 2QQAA 2UWMA 5D4RA 1Z6TA 2FU4A 3GEZA 3KP2A 2F2EA 5HDNA 5K5QA 4RM2A 1PVEA 5TRDA 3C1DA 2GIVA 1ZH5A 4M71A 5BPIA 2DFEA 3G3ZA 4JBAA 2VOOA 3GTJJ 4UUSA 2CQNA 2CV0A 2KZGA 3L2CA 1IUYA 3M3YJ 1Z0XA 1U5TA 3QU6A 3WE3A 3D5LA 2QQ9A 3K1PA 3LQQA 1RRJA 2X1DA 3ECHA 1YLFA 4PFOA 4P9UA 1Y1VJ 4E7LA 4LB5A 5DD4A 2BW3A 4FE7A 5LGTA 5ERIA 3K4BA 4R1HA 4YIIA 4B09A 4A0YA 2FNPA 2Y31A 5D5VB 4LG0B 2OC6A 2XGEA 3HOZJ 4CCNA 1VFCA 1HSJA 2H6BA 2A07F 3VYSB 1BN5A 2R7WA 1EA3A 2FRHA 1J5YA 3VYUB 4NHJA 4I6ZA 3PO3J 2EZKA 2G7HA 1R23A 1B9NA 1MMNA 1MKMA 1SD4A 2CQKA 1YJWI 2NAZA 4HX4A 2XC7A 4BBSJ 4FETA 4A5NA 2V9VA 1UFMA 1GUUA 1MMGA 3TKYA 1G3WA 3OS1A 3L2QA 5H20A 2WAQA 3N97A 1RNLA 1BL0A 1F5TA 1IGNA 5LLQA 1ZKGA 4W1UA 5FFZA 4A3MJ 3AG3H 1UHWA 5HLGA 3ESWB 1TNTA 1WQ2A 1ERDA 4QLCU 3E3VA 1D8KA 5KCMA 3CC2I 3M1EA 4FT8A 2D45A 2BGCA 4BUPA 2ESHA 3IAM2 5HLTA 1A04A 2M5WA 2RV8A 3TP3A 1HSTA 2MLKA 1WVRA 5A2QK 1Z3YA 2OQRA 2EA2A 1HQCA 1U78A 3S32A 1F4KA 2L7ZA 3H35A 5ILUA 1X2MA 1JT0A 5KK1A 4BXUA 2NXNB 3PSIA 2J5PA 3VB2A 3BT9A 3FXOA 1XD7A 2NOJB 3M1CA 2YR2A 3Q3SA 4RB2C 2FJ1A 5DUIA 1O3QA 1LPQA 2FOKA 1MSEC 3I4MJ 4YELA 1FMWA 3CC7I 1F9NA 4IRGA 4LITA 4XOPA 2DYRH 3ZPLA 1UCRA 4BEHA 4I0AA 4L9TA 4X6AJ 1TZLA 3SXYA 3AL0C 2Y9YA 2UUZA 1ZGJA 1CF7B 4AVZA 4GGGA 5E79C 4ZZLA 3MKWB 1K6OA 2WTEA 1POGA 2XKOA 4HYEA 1X1AA 3LSMA 1H9TA 2NVQJ 4DIQA 3BR2A 3KZZA 4PZJA 5L3FA 2R5YB 4U0YA 1MBKA 2OV7A 3TDZC 1OCCH 2JA2A 5FROA 2ME0A 2GZWA 3SFZA 1S3JA 2V7FA 4RM3A 2XHKA 1IRZA 3ZN0A 3OYFA 4UNOA 2PFBA 5GPAA 4A0ZA 4RAYA 2XUBA 2HGCA 4MTEA 5LHHA 1BJAA 2LG4A 1SFXA 4M3EA 1YIOA 1V4RA 3CCVI 4N0BA 3KETA 3RKWA 2Z16A 2MD0A 2EINH 5D8LB 3K70D 4ESFA 1P92A 4M73A 2VXDA 3ZMSA 1ON2A 3DLLF 3TEDA 1MJBA 1RR7A 1XTAA 4LLLA 2R7QA 5TGTA 3EUKL 2ADUA 4D9JA 4AC0A 2LKSA 5J47A 2LKXA 2F48A 2OAZA 3RCOA 4U7DA 2RDPA 3IH4A 4IRIA 5HDGA 4CYCA 3ZMTA 3S2HJ 1T08B 1G59A 2R7RA 4O5VA 3ZGKA 2B63J 2LNBA 1TW2A 3RIRA 1TBXA 1OCZH 3S8PA 2P5VA 2DMPA 3CC4I 3S93A 1KU7A 1J9IA 2VBWA 1QZEA 4KMUX 1A35A 3BZKA 5H6QA 2VXZA 4KN4X 3BQZA 3SZGA 3BG3A 2MD5A 2F5VA 3K4KA 3BR1A 2CU7A 2LDUA 4EJOA 3RYPA 4F7ZA 3I59A 2OD5A 3KE2A 4IQJA 3PIPF 3H3ZA 4PJNA 4PFPA 1JKOC 2KQRA 2EZIA 2HYJA 5JR3A 3CMMA 3S1RJ 3S17J 3DWLE 2Y48A 3B6AA 2IS4A 2H6CA 2CFXA 3GTMJ 1T56A 2DCEA 5CYVA 5ICEA 5M3MJ 3PIOF 2K9NA 4YRVA 1MMSA 1ENHA 3MFKA 2K4BA 4L9JA 2R5ZB 2R93J 4BJ5C 5FKMA 2DA4A 4QIWN 3ZQIA 3QYBA 3MZHA 2EFOA 3OSGA 3H5AA 1A5JA 5LRSA 3QQAA 2RQPA 3W6JB 1G2HA 3BZ6A 1Z9CA 5M5XJ 2HXOA 4KISA 4FX0A 3ABTA 3EYYA 3K10A 3PM1A 4DBQA 4V2GA 1D5VA 1EV7A 4I01A 4RB0A 2ZJPF 3ZQCA 1MBGA 3E6DA 2NS0A 4XLPF 1YRNB 2JJ7A 2YX4A 4ENNA 2FA5A 3GZNB 3OR2C 2GOXB 5GTHC 1YTYA 4MGRA 1SAXA 2OPTA 3IRRA 2R92J 1P4WA 2DO7A 1MBJA 3ERED 3DQVC 5EEHA 2P6SA 4N9IA 1XMAA 2EIKH 4NC8A 3HM5A 2KPMA 3WODF 3E1SA 2CUEA 2VLAA 1OCOH 2ACJA 1AU7A 1X58A 4ZYEA 3E6MA 4N4OB 2NS7A 3HKZA 2V1XA 1O57A 3DBRB 4Q47A 4A3LJ 3CZ6A 2XGDA 3HOTA 2M30A 3H1CA 3W6KB 2XDVA 3J80Z 2ME6A 1MBEA 2DT5A 3IUOA 4AU7A 3WE2A 1AKHA 4G8XA 3DEEA 5TISC 2JK3A 3FXRA 4CICA 3LAPA 3BLYA 2ZNYA 2BXYA 3A03A 4C3JJ 1KA8A 2E60A 4ENMA 1PYVA 1MJ9A 1YX3A 1E0EA 3R61A 3JRFA 1S6LA 1KZHA 1EH6A 1FIAA 3I64A 5E8GA 3F6OA 1QNTA 3A01A 3I53A 4Z2YA 3U9GA 1ZRFA 4F3QA 2HKOA 3MZYA 3E97A 1SFUA 1LVAA 2IXSA 4KN7X 4DJAA 5IOYA 4M9XA 5K7HA 2OTJI 3M7GA 3CCJI 1Y1WJ 3P5JA 1MBHA 1VQ4I 3CO6C 2KRHA 3FHNA 5CVUA 3VOEA 4KMFA 2X6XA 2X9DA 3HTUA 4KUMA 3JRGA 4MEXF 1GV5A 2L54A 3S3OA 5E3LA 1WH7A 5JHUA 5EG0A 3D1NI 4JK1X 1HKSA 5J8FA 5DV5A 1QU3A 4QSHA 3I56I 3N05A 2XPVA 4EMSA 2HNHA 1BA5A 1VQ7I 3FZVA 3OOPA 2M45A 1QQIA 2KDOA 2D5VA 1ONVA 5FKOA 4KT6A 1LNWA 5LGNA 4LGWA 1ZLKA 2IW5A 1TQIA 3NWSA 2H1KA 2BW3B 3DLAA 2DQRA 4HV6A 3AG1H 4HNUA 4FCYA 4HPQA 1SD5A 3CLOA 2JT1A 1DP7P 4F92B 1STZA 4CYDA 5J40A 1JJ8C 4FE4A 3HUGA 1YW9A 4P1WA 3KZIC 1W5TA 3ZQ7A 1MDMA 4Q48A 4DYRA 2DTZA 4BYYA 2X48A 3LSKA 1T95A 4CSWA 4NNJA 4PJJA 3A02A 3QPTA 4L9NA 5KVRA 4CCJA 5GAGJ 2Y9ZA 5CJ9A 1HC8A 1LE8A 2DTRA 5H6RA 1E3OC 3CMEI 3FK6A 3H92A 2HS5A 4B1RA 1RKTA 2VT3A 2X4HA 3L2RA 3PO2J 3C3WA 2ZXJA 2LC2A 5JHFA 4A3KJ 4C2UA 4Y15A 3HSFA 4XRSA 1MGTA 1GV2A 2M8EA 2F5EA 5AIQA 1BW6A 3FBIB 2CQQA 3QPHA 4XIDA 1OCTC 4OOIA 2HYFA 3MQ0A 1FEXA 1SMYF 1MNMC 3JSOA 3IV5A 3DPUA 4KIFA 3CDLA 3QAHA 4E7JA 1OYYA 1W4MA 1V55H 2XASA 3L9FA 2O5RA 3HJEA 3WTWC 1W36C 1GXPA 2X6YA 5E3MA 1JUMA 2PI0A 2STWA 2VONA 4Q5SF 1WI9A 3OYMA 3BCBA 1T2KA 2FMYA 4MFEA 1IN7A 5BS6A 2VE9A 1ZAOA 4XSZF 1X3UA 4Y4RA 5CVVA 3O3KA 2HVRA 1MMAA 1GVJA 2BZTA 2DJNA 5IT3A 3OYGA 3E7LA 4BHPA 2MBFA 3S14J 2CGPA 4YG2F 4CCMA 5EGOA 4YIFA 4Y13A 3LA7A 1IG7A 2BXZA 3LL7A 5EZHA 3ZRGA 4BEHB 3JRHA 1K61A 1SMTA 4KFCA 2DA2A 1TP4A 3TL4X 3CCRI 3CUQC 3DBHB 4QPOA 5HS8A 3WU1B 2QYOA 3BJOA 2RNJA 3QP5A 3OYBA 2DA5A 2JQ7A 5FRMA 4EM0B 1WWXA 3FXMA 2OBPA 1Y0NA 2HQAA 2K5CA 2MGQA 2GA2A 1R1TA 3I3LA 3KX2A 3RJPA 3GWZA 4JQFA 4A3DJ 4ZZDA 1Y39A 2DDBA 4IHWA 2VODA 1G4DA 1JGGA 2KLOA 4RLFA 3CQZJ 4WK8F 4NB5A 3EYIA 5B1AH 2VB6A 2Z5UA 5K7FA 3DKYA 3C18A 4PCQA 2ZNZA 4XR6A 2EILH 3HRMA 2K40A 2VT2A 2XF7A 3J7AY 5E1ZB 1IN4A 5E1WA 2GXGA 3FBNB 4OU0A 4HQEA 3FXKA 4D7MA 1KU2A 5FGMA 1U2WA 2KMUA 4J19A 2RN7A 3OYEA 3M07A 1USTA 2L02A 4G7OF 3S2WA 1OKRA 1XMKA 3S1NJ 1WJDA 3DBLB 4DYCA 5F1RA 4ESBA 2QQ8A 4LK0F 1FT9A 1XB4A 4RGUA 1B72B 2NYXA 2QKLB 3VDXA 4I02A 1PUFA 1FSEA 3MN2A 5F64A 4RAFA 2XAGA 1D1AA 4BQOA 3L2VA 1D5YA 3NAUA 2BYVE 3KZYA 4JOMA 4E7HA 2ZFWA 1ETVA 4OAZA 3Q0VA 2IP2A 1IV8A 2UXXA 5HLIA 3N4MA 2HZDA 3RKQA 4OMZA 4Q4ZF 3M9AA 2E2IJ 2K9LA 4IF4A 4MFDA 4V2FA 3F23A 1WJCA 3DTIA 1D1BA 3KYLA 3BZCA 3FM5A 1AWCA 4XQFA 2YUSA 1ETXA 1P4XA 2V1UA 3HHHA 2ELJA 3HEFA 2A5YB 3FISA 4WXCA 2EFNA 4HW0A 4A3FJ 5BQTA 3JRCA 2RVCA 3MZ8A 2Z33A 5AIPA 3PNVA 2HVQA 3H9QA 3SQNA 2XB0X 4B43A 3ULQB 1W7PB 1ITYA 2HQNA 2JWTA 1YOVB 2Q1ZB 4CUGA 2ZMEB 3S1QJ 3GW2A 3JREA 2LFBA 1T0FC 1HA8A 1R58A 2KZVA 2P7VB 2CW8A 1W0TA 4U88A 3SEZA 3LFUA 2VL8A 1BI3A 3GLLA 4XKWA 4M3FA 1UELB 3RZDJ 4ZTFA 4JX6A 1WCMJ 3F8BA 2R7UA 3KP6A 4PSXA 3V7SA 3L09A 5L3EA 1IF1A 3J7ZI 2PMZN 4S05A 2FF4A 3ONQA 1FTTA 2QF7A 4RLQA 5J1YA 1M1EB 4BQNA 3BWGA 5IT9Z 1TT0A 2M8GX 1HW1A 1K83J 3CF5F 1ZN2A 4HDUA 2QCOA 2R3SA 3BG9A 3E5UA 2JA6J 5FJ8J 2G7UA 4AM3A 3LAJA 3ZCOA 2E5NA 1ETYA 2AHQA 1RESA 3G2BA 4JP0A 3TO9A 2DXIA 3F3XA 3L2UA 3PL8A 1V3FA 4NC7A 2M1BA 4ZTJA 2DK8A 4HBLA 1REPC 1FOYA 2FQ3A 3LSHA 1XSVA 3J81Z 3LA3A 1OMIA 2M34A 4CGZA 2NNYA 1N77A 2VKEA 3TW6A 2OU2A 4ANJA 5C3EJ 1MH3A 4A69C 3KLNA 1B4AA 2E7XA 2E1MB 2BBYA 5CPRB 1UHSA 2OCEA 5IYCJ 2K9SA 3AG4H 3LOCA 2V1DA 4E70A 1YJNI 2QSGX 1U6GA 3MCZA 4LOCA 2KT0A 3JRIA 5HNHA 2QUFA 3BCAA 4PSWA 1K78A 2K85A 4IKFA 4HX7A 2PJRA 4LB6B 5JI6A 4ZDOA 3PUFA 3CCUI 1EH7A 3OY9A 4AIJA 3W6VA 4QPQA 4EM2A 5DCMA 2A5WA 4B3AA 4F55A 1W5CC 2AQFA 3FMSA 1E2XA 1KU9A 2NS8A 4OIPF 1Y8QB 3O8GA 1OCRH 1ORKA 2Y69H 2QBYA 3RZOJ 4U0VA 1P7JA 1WKMA 4BS9A 1OQYA 2IS1A 3W2WA 3HRTA 1QGPA 5E8IA 4RB1A 2RGVA 1G6NA 1J09A 3KFWX 4CCOA 1XS9A 1LDDA 2P0WA 3DCFA 3GCMA 3W3CA 5F1JA 2VQHA 3FWEA 5CKTA 1XN7A 2ZBKA 3GYHX 2KFDA 2MLGA 1P9QC 4XORA 3CESA 1I50J 4ZYDA 4IL6C 4XLAA 4ZH4F 1X3WB 1TL8A 3V8KA 4BACA 4HAMA 1DPUA 3CP8A 1L0OC 3F8MA 5EJCA 1WH5A 2ZO4A 1PJRA 1LB2A 3PJRA 4WF2A 3ZQQA 2IA2A 2QQBA 4RGRA 1V5EA 2MYSA 3KIOA 3GTLJ 2HTJA 4HSRA 2V6EA 3MWMA 4M6XA 5L3GA 3BY6A 2ECBA 2HI3A 5F04A 1I1SA 2QLZA 3B02A 3ZP5A 3A0HC 4CH7A 5EZGA 1YS6A 1R5GA 4KA4A 3P7NA 1U9NA 2COMA 1WJEA 2Z99A 3I0TA 3U1KA 4OINF 2O3FA 2W4SA 3O6BB 5JVTA 2R7ZJ 1D3YA 5GAEJ 3BQYA 3HHGA 5C44J 1R1VA 1NG7A 4IOCF 3CCYA 4YEJA 1GT0C 2RKHA 1RKWA 1RUOA 2VI6A 3JAMZ 2BOLA 2EV6A 1UZCA 1C0WA 3HXLA 4RS8A 3ZR8X 4PK4A 1ZTRA 3MEXA 1ZR2A 4KNYA 4B47A 4WWCA 1A31A 4ETSA 4RA2A 1YW7A 3ERMA 1PDNC 2X0LA 4N4NB 2Z3YA 3HPGA 4HLXA 1VQKI 1BIAA 2CYYA 2R4GA 1JGSA 1R71A 3WGIA 1X1DA 3K2AA 4LD5A 1T98A 1DDNA 3HC7A 2VOPA 4UXNA 2CWEA 2BEOA 2L0KA 2XGCA 1F43A 3LSGA 1XG1A 2HOEA 2LMDA 2W85A 3JRBA 4Z6YA 4A3EJ 2PX9A 3HIFA 2HKXA 3KEYA 3FX3A 3IWZA 3HYIA 5D6FA 3GXOA 3TOAA 2VQCA 2DU9A 1IXCA 1HKQA 1S29A 3U1DA 3DPTA 1I3QJ 3G1MA 2DYSH 2HVSA 1FWZA 3HL2A 1IDZA 2LD5A 2HOAA 2VASA 3OSFA 2HOTA 2CO5A 2CJJA 3SDBA 2FX0A 5GTIC 5D5XB 2O61A 1RUNA 5ED4A 2W00A 1MJAA 1I39A 2TCTA 4C9YA 3V8JA 4HF0A 4L5JA 4EJVA 1VTNC 1WJBA 4KT5C 1XGMA 3GO5A 3LWFA 4V19K 2DA1A 2MG4A 2EBIA 2R7FA 2Q2EA 3F6VA 3H9GA 2JRTA 1X19A 3QYFA 1OCPA 3H5RA 4WXDA 2BVMA 2YSRA 3M8FA 5DD8A 4BQQA 1HKTA 1LFUP 1QHGA 2FNAA 1JE8A 3DKWA 3JCUC 2EK5A 1X4PA 2JA7J 2D1VA 4A5MA 5JVGF 3D0SA 3ZMUA 5BOXA 3BR0A 4DNCA 1OR7C 3GLXA 2VJIA 3WG9A 2HEOA 2DN0A 3SDGA 3QRFF 2VUMJ 4KDPA 2KL4A 4L0YB 4AIDA 2M9HA 3Q0WA 4UVCA 4I0BA 5B5EC 1FYMA 4II3A 1FTZA 1J0RA 4I98B 1BOBA 1YJ9I 4RB3C 2GIZA 2IRFG 3U2RA 4E7SA 4HF1A 1Z21A 2VQGA 2L4AA 3Q0UA 5A2QZ 4XLCA 1IC8A 4KJZA 3W2VA 4AYBA 4YFNF 1ZRDA 3KYDB 1IDYA 4EJUA 2PEXA 4BH9A 2QM3A 3JW4A 3K1NA 4A0XA 3DKXA 1APLC 3BTLA 3CUQA 1F1ZA 2N8GA 2XPWA 2QZ8A 2OZ6A 4CZCA 4Y33A 5FKKA 5TJJA 2DA3A 2FBKA 2X6WA 1YX5A 3HOSA 4BDYA 2LLKA 2DAOA 4XLHA 3IL2A 1VNDA 2OA4A 4ZDPA 2R7VA 2E1NA 2EB7A 2VPRA 2DFIA 3E0JB 3TDUC 1FBSA 1IN6A 4A3CJ 3QU3A 1RR8C 2I10A 3PFYA 3CTAA 3JR9A 2DLLA 3CO7C 2VQLA 5LHIA 1SFOJ 2ZXWH 1TW3A 4A6EA 4HNVA 3S1MJ 1SVLA 4BY7J 3JSPA 1ODDA 1R5HA 1FX7A 1IXRC 2XV4S 1NK2P 3RPUD 1W1WE 2PMZA 3G1OA 2L9SA 3ZN1A 4PJLA 3NQOA 4NQWA 1B9MA 4BNCA 2M87A 2DQLA 3ZQGA 2GQQA 3F8NA 2CQ7A 5E20A 3PFIA 4HDVA 3SYTA 2NVYJ 1IRFA 4M3GA 4EJTA 2E34A 3WTTC 2L3DA 1Z6RA 1K4SA 4IHXA 1B8IA 4TV7A 2X6OA 2PG4A 1PP7U 2E2JJ 4BL0B 2UZKA 4BHCA 4S04A 2XRLA 1K6YA 1O7LA 2F5CA 4IJAA 3F22A 3OIPA 3P9KA 3SZTA 2NOGA 3VSKA 2DOAA 2ZXIA 3WTVC 1L3LA 2AQEA 2LOOA 1S7EA 2P81A 4IZZA 2ID6A 2K9MA 3H3VK 4FASD 4PUSA 1JI8A 3ZOBA 2L01A 1ZG5A 1OLTA 1Z05A 4HRIA 2X1CA 1U3EM 3LSTA 2H8WA 1SC7A 2YX7A 1ZK8A 4XL9A 4KYWA 2CW7A 4PJMA 5M5WJ 3GUDA 2EV5A 1LDJA 2LSOA 3TMOA 3HOXJ 2OJED 4HLYA 1K79A 4IRHA 2GBYA 1WGXA 4UUSB 3MKLA 1IZ1A 5K5RA 5E3NA 9ANTA 2G0EA 2FBIA 1Z7LA 1U5TB 3OMYA 3HSEA 4E7ZA 3ECOA 2PJRB 1W0UA 3DU6A 3IAS2 2OCCH 3OR1C 5HODA 3DV8A 1VQOI 4A93J 5DCMB 2CV1A 1WRJA 1UB9A 3AG2H 5L3DA 4HA8A 5DDGA 2LKPA 4WCGA 2QBYB 2VKHA 2EJRA 4UUVA 5GPCA 1ETQA 1T0FA 1WFXA 1K4TA 2AS5F 3L2WA 4EM1A 3BP8A 2ESNA 3G4SI 3WTSC 2L2OA 1WJFA 5ICGA 3LSPA 3KYCB 4Y52J 3FMRA 4ZYAA 2HWVA 2VC1A 3SEQA 1VZ0A 3IP4B 2CG4A 3I55I 2DPUA 3M8EA 3WTUC 1ZARA 2M4KA 3BDDA 4GYIA 3HOYJ 5FLXK 1XMXA 3BG6A 1R4NB 2I8DA 1XC5A 1K7AA 5E18F 2CV2A 3EUAA 3OYKA 3HZJA 1H89C 3UKGA 1QHHD 5DTDA 1QVUA 4GYGA 3K2ZA 4LJZF 5HVQC 1UG0A 2WC2A 4FISA 3OL3A 3WG7H 3OYHA 4A3JJ 1YYVA 1LFPA 4XOTA 1MMDA 2W24A 4QWQA 1KONA 2I5UA 2K3FA 4MQ9F 2Y75A 1JKRC 2KJBA 4KITB 3H3UA 3H5NA 3E5QA 2GM4A 2FEZA 3OYDA 4FTHA 1SANA 3PNTA 2ZJQF 5ILVA 3BJ6A 3ISPA 2KHMA 2XF5A 4XBFA 1LKXA 2E19A 2VIXA 3H36A 1FBQA 2VBXA 5J6XA 5K7ZA 2XAFA 1U8RA 1UHMA 1MD0A 4MTDA 5HLHA 2QSHX 3HTSB 2STTA 4GFBA 2KIMA 3KLOA 3ZMDA 4MLOA 4UVBA 2Y0SN 1SAUA 1P7IA 2ZKZA 3FXLA 5FRNA 3TQNA 5JLXA 1HF0A 3WU0A 4A3BJ 2QWWA 1Y0UA 4XN3A 1X2NA 3CJTB 3F8FA 3PNYA 2QA4I 1A6QA 5M5YJ 4CCLA 1BC8C 1G8XA 1KU3A 2HU9A 1R6RA 2P4WA 2XIGA 1FMVA 3K69A 3NEUA 4K2EA 4C3IJ 1TWFJ 3I58A 3CCLI 1WHUA 2WY7Q 1NK3P 3S15J 3FF5A 4OWRB 1O7FA 2EH3A 1DGWY 5IP9J 1IW7F 3UNGC 1VQ9I 3I5UA 2Q8KA 1Q1VA 1S9HA 2Z1DA 5IY5H 3VYTB 1R5ID 3OWTA 2OUMA 1R4MB 3OL4A 1BR2A 5LRRA 1YFHA 1W36D 2IAIA 2KISA 1DPRA 2ZCWA 1Y56A 2RNGA 2ZMEC 1HW2A 1BI0A 2ZSHB 1T38A 1FYKA 2R7DA 3V42A 2CUJA 4O6JA 4PDKA 1IUFA 1JKPC 3D5SC 1WPKA 2J5OA 4C30A 3T8RA 1CF7A 2P7CB 1I1GA 4DBRA 1OYWA 3GF2A 2XKPA 3V8LA 2OQGA 4LG3A 3K0LA 4IXAA 1P6RA 2BE5F 2NVXJ 2XGXA 3F0CA 3F72A 2P6TA 3HOUJ 2CUFA 1T39A 5CQGA 5F6FA 3WHCA 1J7KA 1D0XA 1F36A 1Z1DA 1X1CA 3T1BA 1EF4A 2H94A 3H0DA 4D0PA 1TQPA 2B9SA 3CD6I 1T33A 3ZXSA 2DJIA 2HPIA 3RYRA 2FD5A 1Z3XA 4BQAA 4NDLA 3CCSI 2MH2A 2HZTA 2R7XA 2XB5A 2V9KA 3K1MA 5HS7A 2ID3A 3WTZA 1MH4A 2FOWA 4CYCB 1N25A 5IYDJ 1R00A 4N9HA 3M4OJ 2O8XA 3EDPA 3GTPJ 4JYKA 2ZJ2A 2XRNA 5F0FA 3S2DJ 2A05A 1UJ8A 4CDGA 1GLNA 2ECCA 4YFKF 2IEKA 3U21A 1UG2A 2FQ4A 1R1UA 3LA2A 1ZGWA 1TWGJ 1XCVA 3LFKA 3I59B 4L5IA 1USSA 4M9ZA 1G3YA 3OYIA 1AA7A 1XDSA 4AYBN 2EZLA 4IPAA 3AAFA 2OTLI 4G6QA 2AO9A 3R0JA 1B1BA 2F4IA 4UY8I 2VN2A 2L7KA 4BXXJ 4G7HF 4GO1A 1RC9A 5LD2C 3QODA 2V9PA 3Q9VA 2XAJA 4BY1J 2DA7A 4I99C 1ULYA 1RPWA 2M0MA 2GXBA 4CZZA 2DOEA 4RMNA 3WU2C 4J00A 5DCFA 1ACIA 4UB6C 1OJLA 2EZHA 4XN0A 1HW5A 5FO5A 2DDAA 2A69F 3H0GJ 1FPQA 4DGWB 1Q1HA 4H4KC 4B44A 4RBOA 3FK7A 3K4CA 1SFKA 4WX9A 1U9OA 3UR3C 2R5ZA 4P5OA 1BI1A 4G12A 4XSXF 4PJ0C 1O3RA 4MO7A 2FUG2 2VBYA 2LREA 2YS9A 3RQ4A 2IT0A 1VQNI 3O2PE 5BMZA 3C2BA 2PBIA 3CUQB 4BAYA 3K4NA 1IJWC 3FDYA 4E6KG 4ENJA 3LSRA 1S5LC 3HDDA 3WGHA 1X4OA 1IXSB 1A6IA 5FD6A 4AD9A 1BW5A 2E36A 2WV1A 5KAFC 2ETHA 2ZFUA 2K86A 2Y0MA 2H1LA 2K27A 4DZPA 3RTRA 3E5XA 3C2GA 2RQQA 2CS3A 3K9TA 2DA6A 3IC7A 4AVPA 2CW0F 4DZJA 5F08A 4OIRF 4R79A 4HG2A 1R49A 1X1BA 1YI2I 1QO0D 5GP9A 1FIPA 2M2EA 4F52A 1P2FA 2E35A 5E1XA 5K1YA 1AKHB 4IHVA 3EQLF 4HQMA 3CCQI 4UB8C 1CQTA 5FD5A 4DOZA 2HXIA 3CJNA 1Z67A 2EA4A 4ZYHA 3HRUA 3OS0A 1VQ5I 1AHDP 1FJLA 2B0LA 3V4GA 1BM9A 1ZG1A 3A01B 1B8IB 2L9RA 2BY0A 2CSOA 1GDTA 1MIJA 3COAC 2MC4A 4XRFA 1LEBA 4FQGA 5L3CA 5DM7F 1OR7A 5D6EA 2K7LA 1KQ8A 1JKQC 4IO9F 4ON0A 4MNUA 1SFEA 3KCCA 4FX4A 2VE8A 3GVAA 1MNEA 4DYQA 4IHSA 4OIOF 2R7SA 2HYGD 5IP7J 1J2XA 4HNTA 1KGSA 1RIOH 2IS2A 3RKYA 2L7MP 4NUBA 3KP7A 4AIHA 1DQUA 1R7JA 4DW6A 1BJZA 2W82A 4S0HB 4HOBA 3GFLA 3DPLC 5H2FC 4A3IJ 5ICCA 1S7AA 5EG0B 1J75A 2HPMA 2NRAC 4AWXB 4BE2A 1EKEA 2IA1A 1S7OA 3RSNA 3IWFA 3NARA 1SD6A 1ZQ3P 4ZC3A 3WTYC 3VEPA 3ABLH 1LFBA 2DOFA 3ROUA 4XLNF 1DP3A 3DF8A 4QTRA 4BE1A 3HOVJ 1YHQI 5D8KB 2O0YA 4ESJA 2EQRA 3GFMA 4E7IA 2MABA 4IEJA 5D5UB 2B7EA 3P9CA 3G71I 1YE9A 2XAHA 3BR3A 2LY9A 4LIVA 1YIJI 2DMTA 3RPUA 1HBXG 3VYRB 3HUGB 3LMMA 2R7TA 1BBYA 2KKOA 3GZ6A 1TWAJ 2EIMH 1MDMB 4XMYA 4GCVA 4MEYF 1HDPA 4YIRX 5LFAA 4C2MJ 2VC0A 3A1YA 4HZFA 3D5RC 4E7KA 1VQMI 3CJRB 3VSLA 2MW8A 4UUTA 2NVTJ 4GDFA 6PAXA 1VF9A 4Y17A 2XSJC 4PGHA 1LE8B 4CCKA 2LF7A 4LIUA 4CHUA 2KRFA 3BJAA 3MAJA 3R4KA 2KIUA 5DS9A 2XAUA 2ZSIB 2JMWA 3Q5FA 4HSTA 2M0CA 3VPRA 3JTGA 1GHCA 5IPAA 3I9V2 2L4MA 3OOUA 5ICFA 4G94A 4EEFG 4U7BA 3IH3A 3TBIA 4MIMA 2V4JC 4OIQF 2DT6A 1OPCA 3TW7A 3JRAA 2V6CA 2MH9A 5HNFA 3ZMVA 1FC3A 2XAQA 2CH0A 1P4AA 4U87A 3OYJA 2PJPA 3BOQA 1ON1A 5IYBJ 5F0HA 4JX5A 1HDDC 4M74A 2CQXA 1Z91A 2DMQA 4C3HJ 2Y0SA 4HF2A 2COBA 2H8RA 4L5EA 1PUEE 1TQMA 2WY8Q 1NHAA 2VPLA 2ZB9A 5EGOB 1NH3A 4LLNA 2A61A 2E71A 2P5KA 3FIWA 4L18B 2DK5A 2VJJA 2RAEA 1GVDA 1LJ9A 3CDHA 4XNFA 2XROA 2VKDA 2CMPA 2IGMA 3KP5A 2IGOA 3K70C 1VQPI 2L7FP 2IBDA 3RPQA 3FHZA 3PQKA 1N78A 3DEWA 1ZRCA 4W97A 1R9TJ 1JJ6C 5C4XJ 2ELKA 1V5GA 2UV1A 1KYZA 2DT7B 5DUKA 5FKLA 2L9VA 5JFRA 1TLHB 3J80K 5HS9A 1XSXA 2O6GE 2E5ZA 1FBUA 1VQ6I 2LBFA 5J8CA 1O4XA 2TDXA 4X1EA 2KRCA 3ZQLA 3HGYA 1X3ZB 1ZLJA 2W57A 2O03A 2LY1A 2Y2ZA 3EUHC 4F93B 5DM6F 5K5OA 1HLVA 1HCRA 1EH8A 1I6XA 2WADA 4XLEA 3CDIA 1T8IA 1N75A 5GAHJ 3S3NA 3QPSA 2VBZA 3KP4A 3PUBA 4PGGA 4A3GJ 1JXSA 2BY1A 3VWBA 2F6CA 3SFIA 2LK2A 2ICWG 3BTIA 2JPBA 5EF6A 2HR3A 2DODA 4KICA 2H27A 2GAUA 4IVNA 1PUFB 3ABMH 3BC8A 3MKZA 2WBMA 1B72A 3ZQHA 4BKXA 4I7HA 3OYCA 2KJCA 2A6TA 4XKCA 4II2A 2AXLA 3K6GA 1SVMA 5DYMA 4BJTA 4UV9A 4ZJZA 2HDWA 4ABZA 4EVIA 4D5FA 5L3BA 2JTVA 3IRQA 3SJMA 2IGKA 1HXDA 4E4HA 3Q9SA 2FXAA 2FMLA 4WXHA 3FXJA 3LSIA 5IP6A 2MFZA 3OV8A 3E6CC 4XM3A 3A2KA 2PQ8A 3OYLA 1OISA 3FXUA 1QPIA 1D1CA 1T6SA 4EATA 2ISYA 2TRTA 3QPLA 1V54H 3GFJA 1XPXA 1U8BA 1DGRM 3GTQJ 3K7AJ 1TWCJ 1U5TC 2MSYA 1YG2A 1FOWA 2LR8A 1B6AA 2LY2A 3DXJF 3P9IA 5BPDA 3FM3A 2QENA 3FXQA 4P9FA 5D5WB 1H0MA 1W7PA 3AL0B 1SEUA 4MQVA 2R0QC 2BHYA 4A6DA 2DI3A 2ZMEA 3F21A 2HOSA 1G3TA 5C4JJ 2WB1N 2IGNA 1KQ0A 2DMNA 4B48A 2W1OA 4RAGA 1SVOA 3W2AA 5F0CA 2JUCA 4I76A 2EIJH 1V5FA 4Y7NJ 2Q0OA 4B4CA 1I5ZA 2Z9OA 3HOWJ 2M7AA 3MVPA 4CA0A 4UVAA 2ZXHA 3FKIJ 4M72A 1YO5C 3J7AO 3TOBA 4D7NA 2XF6A 5CVJA 3IKTA 1FP1D 1X1PA 2JA8J 3I4NJ 1JHFA 3EETA 5ILSA 1KYWA 3HBLA 1MNDA 1FY7A 1QRYA 1VI0A 5FKNA 4XRMA 2PN6A 2JA5J 1H9GA 2QGUA 1BIBA 2LVSA 4FHTA 1G3SA 1BR1A 1TNSA 3BTJA 2A6HF 2X51A 2ZC2A 3HB9A 4BE0A 4A12A 4R8HA 5F27A 3JTHA 2W84A 3B73A 1UMQA 5LEKA 5LGUA
chains in the Genus database with same CATH topology
3BPXA 5HOOA 4MHGA 4EQQA 1O3TA 2H09A 1PP8F 1O3SA 3I4PA 2DBBA 2A68F 3G73A 5LEJA 4I2OA 1IAWA 2MA3A 2QVOA 1AOYA 1GXQA 3I71A 1OYIA 4LK1F 4OMYA 1K78B 3TO6A 1WSUA 3KEQA 4U0WA 3IKVA 2FSWA 2PLYA 3C7JA 2F5FA 3QP6A 1ZREA 2ELHA 4L9VA 2MC3A 2EFPA 1B59A 1ZG3A 2YU3A 3VODA 4M6YA 4LG0A 2EWNA 2A6EF 4LLGF 1XGOA 1FOKA 1BI2A 3GX4X 1JHHA 1D8JA 1YQAA 3SZPA 3GZ5A 2W25A 2E1CA 1W5SA 2OZUA 2UXNA 3R6SA 4P96A 1CGPA 1ZYRF 4EGZA 2HFHA 2RC4A 1TTYA 3R60A 1ZGAA 3FMQA 1LDKB 2G9WA 3CUOA 3R0AA 3ML6A 3KP3A 2F5DA 2DPDA 3F8CA 1RZ4A 3T5XA 5FFXA 5EEGA 4LFUA 5D4SA 2K02A 2FBHA 2LF8A 3L00A 3RDIA 4RGSA 1FP2A 2C6YA 5LBQA 4HV5A 2GA1A 2KIFA 4M9SA 2V79A 3BPVA 2JZYA 3E6BA 3PQJA 2D1HA 3V7RA 4AIKA 5IT9K 2PMHA 4CXFA 2EV0A 2P5LC 3HRSA 2NNNA 2JSCA 4EJWA 3DEUA 3SHFA 1W7PD 3DFGA 4ZYGA 1RI7A 4KIGA 5CVRA 3T8TA 1I27A 4RAZA 4G9YA 2HDCA 4H0EA 4ASNA 3WGGA 3J81K 3VFZA 3GFIA 1QBJA 2IPQX 2YPRA 1FLIA 1QZZA 4KIBA 1XSDA 5FLXZ 1R36A 4G7ZF 5CVIA 1FSHA 2ISZA 4O3MA 3RKXA 3V7CA 1FZPB 3I54A 1YS7A 4P55A 3DP7A 2HTSA 1BOAA 2IVMA 2WV0A 2A3SA 1FNNA 2GWRA 4IHTA 5E17F 1Z7UA 1BC7C 1DUXC 4EV0A 2EFWA 2WWYA 3ZMZA 5HDKA 1XDUA 4L0ZB 2HQRA 4I09A 3NRVA 4UV8A 3L7WA 5LHGA 1IN5A 4YFXF 2JPCA 3HSRA 4B8XA 2FE3A 2E7WA 4BHBA 3BROA 4ENKA 5DEQA 2EFQA 1J59A 1XGSA 2PMUA 3LQRA 1XGNA 4A2UA 4G6DA 3WTXC 1R22A 2BV6A 2K4JA 3TGNA 3T0YA 4CO8A 2DW4A 2P8TA 4LMYA 3ABUA 3IHUA 4RGXA 5FB2A 1QPMA 1ZHFA 1IN8A 3RI4A 4UHTA 3QOPA 2D2WA 3EUHA 5AONA 1E17A 3KEOA 2XVCA 1S8NA 4GXOA 4HX8A 2IA0A 1KQ9A 3JAMK 1IRGA 1YW8A 2IJLA 1SD7A 4EGYA 1QZYA 3ELKA 1MZBA 3TO7A 1XCBA 1FYLA 3REOA 1LEAA 4DQ2A 1LQ1A 5CLSA 2QQAA 2UWMA 5D4RA 1Z6TA 2FU4A 3GEZA 3KP2A 2F2EA 5HDNA 5K5QA 5TRDA 3C1DA 2GIVA 1ZH5A 4M71A 5BPIA 3G3ZA 2VOOA 4JBAA 3L2CA 1IUYA 1U5TA 3QU6A 3WE3A 3D5LA 2QQ9A 3K1PA 3LQQA 3ECHA 1YLFA 4P9UA 4LB5A 5DD4A 5LGTA 5ERIA 4R1HA 4YIIA 4B09A 4A0YA 2FNPA 5D5VB 4LG0B 1HSJA 2H6BA 2A07F 1BN5A 2FRHA 1J5YA 4NHJA 2G7HA 1R23A 1B9NA 1MKMA 1SD4A 2CQKA 2NAZA 4HX4A 4A5NA 2V9VA 1UFMA 3TKYA 1G3WA 5H20A 3N97A 1RNLA 1F5TA 5LLQA 5FFZA 1UHWA 5HLGA 1TNTA 1WQ2A 4QLCU 3E3VA 1D8KA 3M1EA 4FT8A 2D45A 2BGCA 2ESHA 1A04A 2M5WA 2RV8A 1HSTA 2MLKA 5A2QK 2OQRA 2EA2A 1HQCA 1U78A 1F4KA 5ILUA 5KK1A 4BXUA 2J5PA 3VB2A 1XD7A 2YR2A 4RB2C 5DUIA 1O3QA 2FOKA 1F9NA 4IRGA 3ZPLA 1UCRA 4I0AA 4L9TA 3SXYA 1CF7B 1ZGJA 4GGGA 4ZZLA 1K6OA 2WTEA 2XKOA 4HYEA 1H9TA 3KZZA 4PZJA 5L3FA 4U0YA 3TDZC 2GZWA 3SFZA 1S3JA 2XHKA 3ZN0A 4UNOA 2PFBA 4A0ZA 4RAYA 2XUBA 2HGCA 4MTEA 5LHHA 1BJAA 1SFXA 1YIOA 1V4RA 4N0BA 3KETA 3RKWA 5D8LB 4ESFA 1P92A 4M73A 3ZMSA 1ON2A 1MJBA 4LLLA 2ADUA 2OAZA 4U7DA 2RDPA 4IRIA 5HDGA 3ZMTA 4O5VA 2LNBA 1TW2A 3RIRA 1TBXA 2P5VA 1J9IA 1KU7A 2VBWA 4KMUX 5H6QA 2VXZA 4KN4X 2MD5A 2LDUA 4EJOA 3RYPA 4F7ZA 3I59A 2OD5A 3KE2A 3H3ZA 5JR3A 2Y48A 2H6CA 2CFXA 5CYVA 5ICEA 3MFKA 2K4BA 4L9JA 3MZHA 2EFOA 5LRSA 2RQPA 3W6JB 3BZ6A 1Z9CA 4FX0A 3ABTA 3EYYA 1D5VA 1EV7A 4I01A 4RB0A 3E6DA 2NS0A 4XLPF 2YX4A 4ENNA 2FA5A 1SAXA 1YTYA 4MGRA 3IRRA 1P4WA 2DO7A 3ERED 3DQVC 5EEHA 2P6SA 4N9IA 1XMAA 3WODF 2ACJA 4ZYEA 3E6MA 2V1XA 1O57A 4Q47A 3HOTA 2M30A 3W6KB 3J80Z 2DT5A 3WE2A 4G8XA 4CICA 3FXRA 3LAPA 2ZNYA 1KA8A 4ENMA 1MJ9A 3R61A 1S6LA 1EH6A 3I64A 5E8GA 3F6OA 1QNTA 3I53A 4Z2YA 3U9GA 1ZRFA 2HKOA 3MZYA 3E97A 1SFUA 1LVAA 4KN7X 4M9XA 3M7GA 3CO6C 5CVUA 3VOEA 4KMFA 3HTUA 4KUMA 4MEXF 2L54A 5JHUA 4JK1X 1HKSA 5J8FA 5DV5A 4EMSA 3FZVA 3OOPA 2M45A 1QQIA 1ONVA 1LNWA 5LGNA 4LGWA 1ZLKA 2IW5A 1TQIA 2DQRA 4HV6A 1SD5A 3CLOA 2JT1A 1DP7P 1STZA 4CYDA 3HUGA 1YW9A 1W5TA 3ZQ7A 1MDMA 4Q48A 4BYYA 3QPTA 4L9NA 5KVRA 5CJ9A 2DTRA 5H6RA 3H92A 2HS5A 2VT3A 2X4HA 3C3WA 2ZXJA 4Y15A 3HSFA 1MGTA 2M8EA 2F5EA 5AIQA 3QPHA 4OOIA 2HYFA 3MQ0A 1SMYF 3JSOA 4KIFA 3QAHA 1OYYA 1W4MA 2XASA 3L9FA 3WTWC 2STWA 1GXPA 2VONA 2PI0A 4Q5SF 1WI9A 1T2KA 2FMYA 1IN7A 5BS6A 2VE9A 1ZAOA 4XSZF 1X3UA 5CVVA 3O3KA 5IT3A 1GVJA 4BHPA 2MBFA 2CGPA 4YG2F 4YIFA 4Y13A 3LA7A 1SMTA 4KFCA 3CUQC 5HS8A 3WU1B 2QYOA 3BJOA 2RNJA 3QP5A 4EM0B 1WWXA 2OBPA 2GA2A 1R1TA 3RJPA 3GWZA 4JQFA 4ZZDA 2VODA 1G4DA 4WK8F 4NB5A 3EYIA 2Z5UA 3C18A 4PCQA 2ZNZA 3HRMA 2VT2A 5E1ZB 1IN4A 5E1WA 2GXGA 4OU0A 4HQEA 1KU2A 5FGMA 1U2WA 2RN7A 1USTA 2L02A 4G7OF 3S2WA 1OKRA 1XMKA 5F1RA 4ESBA 4LK0F 1FT9A 1XB4A 4RGUA 2NYXA 4I02A 1FSEA 5F64A 2XAGA 2BYVE 3KZYA 2ZFWA 2IP2A 2UXXA 5HLIA 3N4MA 4OMZA 4Q4ZF 3M9AA 4IF4A 3F23A 3FM5A 1AWCA 1P4XA 2V1UA 3HHHA 2A5YB 4WXCA 2EFNA 4HW0A 5BQTA 2RVCA 2Z33A 5AIPA 3SQNA 3ULQB 1W7PB 2HQNA 2ZMEB 3GW2A 1R58A 2P7VB 4U88A 1BI3A 3F8BA 3KP6A 3V7SA 5L3EA 3L09A 1IF1A 4S05A 2FF4A 3BWGA 5IT9Z 1HW1A 1ZN2A 4HDUA 2R3SA 3E5UA 2G7UA 3LAJA 3TO9A 3F3XA 1V3FA 2M1BA 2DK8A 4HBLA 1REPC 2FQ3A 1XSVA 3J81Z 3LA3A 1OMIA 4CGZA 2NNYA 2OU2A 3KLNA 1B4AA 2E7XA 2BBYA 2V1DA 4E70A 1U6GA 3MCZA 2QUFA 1K78A 4HX7A 4LB6B 5JI6A 1EH7A 4AIJA 4EM2A 5DCMA 3FMSA 1E2XA 1KU9A 4OIPF 2QBYA 4U0VA 1WKMA 3HRTA 1QGPA 5E8IA 4RB1A 2RGVA 1G6NA 3KFWX 1LDDA 3FWEA 1XN7A 2ZBKA 3GYHX 2MLGA 4ZYDA 4ZH4F 3V8KA 4HAMA 1DPUA 3F8MA 1L0OC 2ZO4A 1LB2A 4WF2A 2IA2A 2QQBA 4RGRA 2HTJA 3MWMA 4M6XA 5L3GA 3BY6A 1I1SA 2QLZA 3B02A 3ZP5A 1YS6A 1R5GA 4KA4A 3P7NA 2COMA 2Z99A 3I0TA 4OINF 2O3FA 3O6BB 5JVTA 1D3YA 3HHGA 1R1VA 2RKHA 1RUOA 3JAMZ 2EV6A 1C0WA 4RS8A 3MEXA 4KNYA 4WWCA 4ETSA 1YW7A 1PDNC 2X0LA 2Z3YA 4HLXA 1BIAA 2CYYA 1JGSA 3WGIA 4LD5A 1T98A 1DDNA 2VOPA 4UXNA 2CWEA 2BEOA 2HOEA 2W85A 3HIFA 2HKXA 3FX3A 3IWZA 3HYIA 5D6FA 3GXOA 3TOAA 2DU9A 1IXCA 1HKQA 1S29A 3U1DA 3DPTA 1FWZA 2CO5A 2O61A 5D5XB 1RUNA 5ED4A 1MJAA 3V8JA 4HF0A 4L5JA 4EJVA 1VTNC 4KT5C 1XGMA 3GO5A 3LWFA 2R7FA 3F6VA 2Q2EA 2JRTA 4WXDA 2YSRA 3M8FA 5DD8A 1HKTA 2FNAA 1JE8A 3DKWA 2EK5A 2D1VA 4A5MA 3D0SA 3ZMUA 5BOXA 4DNCA 3GLXA 3WG9A 2HEOA 3QRFF 4KDPA 4L0YB 4UVCA 4I0BA 1FYMA 1J0RA 4I98B 4RB3C 2IRFG 3U2RA 4HF1A 2L4AA 5A2QZ 4YFNF 1ZRDA 4EJUA 2PEXA 4BH9A 2QM3A 3JW4A 3K1NA 4A0XA 3CUQA 1F1ZA 2QZ8A 2OZ6A 5TJJA 2FBKA 3HOSA 2DAOA 3IL2A 2OA4A 2E1NA 2EB7A 2DFIA 3TDUC 1FBSA 1IN6A 3QU3A 3CTAA 2DLLA 3CO7C 5LHIA 4A6EA 1TW3A 3JSPA 1ODDA 1R5HA 1FX7A 1IXRC 2XV4S 3ZN1A 3NQOA 4NQWA 1B9MA 4BNCA 2M87A 2DQLA 2GQQA 3F8NA 5E20A 3PFIA 4HDVA 1IRFA 4EJTA 3WTTC 2L3DA 1Z6RA 4TV7A 2PG4A 1PP7U 2UZKA 4BHCA 4S04A 1O7LA 2F5CA 4IJAA 3F22A 3P9KA 3SZTA 3WTVC 1L3LA 1ZG5A 2L01A 1Z05A 1U3EM 3LSTA 2YX7A 4KYWA 3GUDA 2EV5A 1LDJA 2LSOA 4HLYA 1K79A 4IRHA 1IZ1A 5K5RA 2FBIA 1U5TB 3HSEA 3ECOA 3DV8A 5DCMB 1WRJA 1UB9A 5L3DA 4HA8A 5DDGA 2LKPA 4WCGA 2QBYB 2EJRA 4UUVA 1T0FA 2AS5F 4EM1A 3BP8A 2ESNA 3WTSC 5ICGA 3FMRA 2HWVA 2VC1A 2CG4A 2DPUA 3M8EA 3WTUC 1ZARA 3BDDA 4GYIA 5FLXK 1K7AA 5E18F 4GYGA 3K2ZA 4LJZF 5HVQC 2WC2A 1YYVA 2W24A 4QWQA 4MQ9F 2Y75A 2KJBA 3H3UA 3E5QA 2FEZA 5ILVA 3BJ6A 3ISPA 4XBFA 5J6XA 1U8RA 1FBQA 2VBXA 2XAFA 1UHMA 1MD0A 4MTDA 5HLHA 3HTSB 2STTA 2KIMA 3KLOA 3ZMDA 4UVBA 2ZKZA 3TQNA 3WU0A 2QWWA 1Y0UA 3F8FA 1BC8C 1KU3A 2P4WA 2XIGA 3K69A 3NEUA 4K2EA 3I58A 3FF5A 1O7FA 1IW7F 3I5UA 2Q8KA 5LRRA 1YFHA 1DPRA 2ZCWA 1HW2A 1BI0A 1T38A 1FYKA 2R7DA 4O6JA 4PDKA 1CF7A 3T8RA 2J5OA 2P7CB 1I1GA 1OYWA 3GF2A 2XKPA 3V8LA 2OQGA 3K0LA 4IXAA 1P6RA 2BE5F 2XGXA 3F72A 2P6TA 1T39A 5F6FA 1J7KA 1Z1DA 3T1BA 2H94A 4D0PA 1TQPA 3RYRA 4BQAA 2MH2A 2HZTA 3K1MA 5HS7A 3WTZA 1R00A 4N9HA 2O8XA 3EDPA 2ZJ2A 2XRNA 4CDGA 4YFKF 1R1UA 3LA2A 1XCVA 3LFKA 3I59B 4L5IA 1USSA 4M9ZA 1G3YA 1XDSA 4IPAA 3AAFA 4G6QA 3R0JA 1B1BA 2VN2A 4G7HF 4GO1A 3Q9VA 2XAJA 1ULYA 2GXBA 4CZZA 5DCFA 1HW5A 5FO5A 2A69F 1FPQA 1Q1HA 4WX9A 4P5OA 1BI1A 4XSXF 1O3RA 2VBYA 2IT0A 3O2PE 5BMZA 2PBIA 3CUQB 4BAYA 4ENJA 3WGHA 1IXSB 5FD6A 4AD9A 2ETHA 2K86A 2Y0MA 2K27A 3RTRA 3E5XA 3K9TA 3IC7A 4AVPA 2CW0F 4R79A 4OIRF 1QO0D 1P2FA 5E1XA 5K1YA 3EQLF 4HQMA 5FD5A 3CJNA 2EA4A 4ZYHA 3HRUA 2B0LA 3V4GA 1BM9A 1ZG1A 2CSOA 3COAC 4XRFA 1LEBA 5L3CA 1OR7A 5D6EA 2K7LA 1KQ8A 4ON0A 4MNUA 1SFEA 3KCCA 4FX4A 2VE8A 3GVAA 4IHSA 4OIOF 2HYGD 1J2XA 1KGSA 1RIOH 3RKYA 4AIHA 3KP7A 1R7JA 4HOBA 3GFLA 3DPLC 2NRAC 5ICCA 1S7AA 1J75A 4AWXB 2IA1A 1S7OA 3IWFA 1SD6A 3WTYC 3VEPA 3ROUA 4XLNF 3DF8A 5D8KB 2O0YA 4ESJA 3GFMA 5D5UB 3P9CA 2XAHA 3RPUA 1HBXG 1BBYA 2KKOA 3GZ6A 1MDMB 4GCVA 4MEYF 2VC0A 4HZFA 6PAXA 4Y17A 4PGHA 2LF7A 4CHUA 2KRFA 3BJAA 3MAJA 3R4KA 2KIUA 3Q5FA 1GHCA 3JTGA 2L4MA 5ICFA 4G94A 4U7BA 4OIQF 1OPCA 2V6CA 2MH9A 3ZMVA 1FC3A 2XAQA 1P4AA 2PJPA 3BOQA 1ON1A 4M74A 1Z91A 4HF2A 1PUEE 1TQMA 1NHAA 4LLNA 2A61A 2P5KA 4L18B 2DK5A 1LJ9A 3CDHA 2XROA 3KP5A 3RPQA 3FHZA 3PQKA 1ZRCA 1KYZA 5DUKA 5JFRA 1TLHB 3J80K 5HS9A 1XSXA 2O6GE 1FBUA 5J8CA 2TDXA 1ZLJA 2W57A 2O03A 5K5OA 1EH8A 1I6XA 2VBZA 3KP4A 4PGGA 1JXSA 2JPBA 2HR3A 4KICA 2H27A 2GAUA 4IVNA 4I7HA 2KJCA 2AXLA 5DYMA 4UV9A 4EVIA 5L3BA 2JTVA 3IRQA 1HXDA 3Q9SA 2FXAA 2FMLA 4WXHA 3OV8A 3E6CC 2PQ8A 3FXUA 1T6SA 2ISYA 3GFJA 1U5TC 1YG2A 1B6AA 3DXJF 3P9IA 5BPDA 3FM3A 2QENA 3FXQA 4P9FA 5D5WB 1H0MA 1W7PA 4MQVA 4A6DA 2DI3A 2ZMEA 3F21A 1G3TA 1KQ0A 2Q0OA 1I5ZA 2Z9OA 4UVAA 4M72A 1YO5C 3J7AO 3TOBA 5CVJA 3IKTA 1FP1D 1JHFA 3EETA 5ILSA 1KYWA 1FY7A 2PN6A 1H9GA 1BIBA 4FHTA 1G3SA 1TNSA 2A6HF 4A12A 4R8HA 3JTHA 2W84A 3B73A 5LEKA 5LGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPX A;  5HOO A;  4MHG A;  4EQQ A;  1O3T A;  2H09 A;  1PP8 F;  1O3S A;  3I4P A;  2DBB A;  2A68 F;  3G73 A;  5LEJ A;  4I2O A;  1IAW A;  2MA3 A;  2QVO A;  1AOY A;  1GXQ A;  3I71 A;  1OYI A;  4LK1 F;  4OMY A;  1K78 B;  3TO6 A;  1WSU A;  3KEQ A;  4U0W A;  3IKV A;  2FSW A;  2PLY A;  3C7J A;  2F5F A;  3QP6 A;  1ZRE A;  2ELH A;  4L9V A;  2MC3 A;  2EFP A;  1B59 A;  1ZG3 A;  2YU3 A;  3VOD A;  4M6Y A;  4LG0 A;  2EWN A;  2A6E F;  4LLG F;  1XGO A;  1FOK A;  1BI2 A;  3GX4 X;  1JHH A;  1D8J A;  1YQA A;  3SZP A;  3GZ5 A;  2W25 A;  2E1C A;  1W5S A;  2OZU A;  2UXN A;  3R6S A;  4P96 A;  1CGP A;  1ZYR F;  4EGZ A;  2HFH A;  2RC4 A;  1TTY A;  3R60 A;  1ZGA A;  3FMQ A;  1LDK B;  2G9W A;  3CUO A;  3R0A A;  3ML6 A;  3KP3 A;  2F5D A;  2DPD A;  3F8C A;  1RZ4 A;  3T5X A;  5FFX A;  5EEG A;  4LFU A;  5D4S A;  2K02 A;  2FBH A;  2LF8 A;  3L00 A;  3RDI A;  4RGS A;  1FP2 A;  2C6Y A;  5LBQ A;  4HV5 A;  2GA1 A;  2KIF A;  4M9S A;  2V79 A;  3BPV A;  2JZY A;  3E6B A;  3PQJ A;  2D1H A;  3V7R A;  4AIK A;  5IT9 K;  2PMH A;  4CXF A;  2EV0 A;  2P5L C;  3HRS A;  2NNN A;  2JSC A;  4EJW A;  3DEU A;  3SHF A;  1W7P D;  3DFG A;  4ZYG A;  1RI7 A;  4KIG A;  5CVR A;  3T8T A;  1I27 A;  4RAZ A;  4G9Y A;  2HDC A;  4H0E A;  4ASN A;  3WGG A;  3J81 K;  3VFZ A;  3GFI A;  1QBJ A;  2IPQ X;  2YPR A;  1FLI A;  1QZZ A;  4KIB A;  1XSD A;  5FLX Z;  1R36 A;  4G7Z F;  5CVI A;  1FSH A;  2ISZ A;  4O3M A;  3RKX A;  3V7C A;  1FZP B;  3I54 A;  1YS7 A;  4P55 A;  3DP7 A;  2HTS A;  1BOA A;  2IVM A;  2WV0 A;  2A3S A;  1FNN A;  2GWR A;  4IHT A;  5E17 F;  1Z7U A;  1BC7 C;  1DUX C;  4EV0 A;  2EFW A;  2WWY A;  3ZMZ A;  5HDK A;  1XDU A;  4L0Z B;  2HQR A;  4I09 A;  3NRV A;  4UV8 A;  3L7W A;  5LHG A;  1IN5 A;  4YFX F;  2JPC A;  3HSR A;  4B8X A;  2FE3 A;  2E7W A;  4BHB A;  3BRO A;  4ENK A;  5DEQ A;  2EFQ A;  1J59 A;  1XGS A;  2PMU A;  3LQR A;  1XGN A;  4A2U A;  4G6D A;  3WTX C;  1R22 A;  2BV6 A;  2K4J A;  3TGN A;  3T0Y A;  4CO8 A;  2DW4 A;  2P8T A;  4LMY A;  3ABU A;  3IHU A;  4RGX A;  5FB2 A;  1QPM A;  1ZHF A;  1IN8 A;  3RI4 A;  4UHT A;  3QOP A;  2D2W A;  3EUH A;  5AON A;  1E17 A;  3KEO A;  2XVC A;  1S8N A;  4GXO A;  4HX8 A;  2IA0 A;  1KQ9 A;  3JAM K;  1IRG A;  1YW8 A;  2IJL A;  1SD7 A;  4EGY A;  1QZY A;  3ELK A;  1MZB A;  3TO7 A;  1XCB A;  1FYL A;  3REO A;  1LEA A;  4DQ2 A;  1LQ1 A;  5CLS A;  2QQA A;  2UWM A;  5D4R A;  1Z6T A;  2FU4 A;  3GEZ A;  3KP2 A;  2F2E A;  5HDN A;  5K5Q A;  5TRD A;  3C1D A;  2GIV A;  1ZH5 A;  4M71 A;  5BPI A;  3G3Z A;  2VOO A;  4JBA A;  3L2C A;  1IUY A;  1U5T A;  3QU6 A;  3WE3 A;  3D5L A;  2QQ9 A;  3K1P A;  3LQQ A;  3ECH A;  1YLF A;  4P9U A;  4LB5 A;  5DD4 A;  5LGT A;  5ERI A;  4R1H A;  4YII A;  4B09 A;  4A0Y A;  2FNP A;  5D5V B;  4LG0 B;  1HSJ A;  2H6B A;  2A07 F;  1BN5 A;  2FRH A;  1J5Y A;  4NHJ A;  2G7H A;  1R23 A;  1B9N A;  1MKM A;  1SD4 A;  2CQK A;  2NAZ A;  4HX4 A;  4A5N A;  2V9V A;  1UFM A;  3TKY A;  1G3W A;  5H20 A;  3N97 A;  1RNL A;  1F5T A;  5LLQ A;  5FFZ A;  1UHW A;  5HLG A;  1TNT A;  1WQ2 A;  4QLC U;  3E3V A;  1D8K A;  3M1E A;  4FT8 A;  2D45 A;  2BGC A;  2ESH A;  1A04 A;  2M5W A;  2RV8 A;  1HST A;  2MLK A;  5A2Q K;  2OQR A;  2EA2 A;  1HQC A;  1U78 A;  1F4K A;  5ILU A;  5KK1 A;  4BXU A;  2J5P A;  3VB2 A;  1XD7 A;  2YR2 A;  4RB2 C;  5DUI A;  1O3Q A;  2FOK A;  1F9N A;  4IRG A;  3ZPL A;  1UCR A;  4I0A A;  4L9T A;  3SXY A;  1CF7 B;  1ZGJ A;  4GGG A;  4ZZL A;  1K6O A;  2WTE A;  2XKO A;  4HYE A;  1H9T A;  3KZZ A;  4PZJ A;  5L3F A;  4U0Y A;  3TDZ C;  2GZW A;  3SFZ A;  1S3J A;  2XHK A;  3ZN0 A;  4UNO A;  2PFB A;  4A0Z A;  4RAY A;  2XUB A;  2HGC A;  4MTE A;  5LHH A;  1BJA A;  1SFX A;  1YIO A;  1V4R A;  4N0B A;  3KET A;  3RKW A;  5D8L B;  4ESF A;  1P92 A;  4M73 A;  3ZMS A;  1ON2 A;  1MJB A;  4LLL A;  2ADU A;  2OAZ A;  4U7D A;  2RDP A;  4IRI A;  5HDG A;  3ZMT A;  4O5V A;  2LNB A;  1TW2 A;  3RIR A;  1TBX A;  2P5V A;  1J9I A;  1KU7 A;  2VBW A;  4KMU X;  5H6Q A;  2VXZ A;  4KN4 X;  2MD5 A;  2LDU A;  4EJO A;  3RYP A;  4F7Z A;  3I59 A;  2OD5 A;  3KE2 A;  3H3Z A;  5JR3 A;  2Y48 A;  2H6C A;  2CFX A;  5CYV A;  5ICE A;  3MFK A;  2K4B A;  4L9J A;  3MZH A;  2EFO A;  5LRS A;  2RQP A;  3W6J B;  3BZ6 A;  1Z9C A;  4FX0 A;  3ABT A;  3EYY A;  1D5V A;  1EV7 A;  4I01 A;  4RB0 A;  3E6D A;  2NS0 A;  4XLP F;  2YX4 A;  4ENN A;  2FA5 A;  1SAX A;  1YTY A;  4MGR A;  3IRR A;  1P4W A;  2DO7 A;  3ERE D;  3DQV C;  5EEH A;  2P6S A;  4N9I A;  1XMA A;  3WOD F;  2ACJ A;  4ZYE A;  3E6M A;  2V1X A;  1O57 A;  4Q47 A;  3HOT A;  2M30 A;  3W6K B;  3J80 Z;  2DT5 A;  3WE2 A;  4G8X A;  4CIC A;  3FXR A;  3LAP A;  2ZNY A;  1KA8 A;  4ENM A;  1MJ9 A;  3R61 A;  1S6L A;  1EH6 A;  3I64 A;  5E8G A;  3F6O A;  1QNT A;  3I53 A;  4Z2Y A;  3U9G A;  1ZRF A;  2HKO A;  3MZY A;  3E97 A;  1SFU A;  1LVA A;  4KN7 X;  4M9X A;  3M7G A;  3CO6 C;  5CVU A;  3VOE A;  4KMF A;  3HTU A;  4KUM A;  4MEX F;  2L54 A;  5JHU A;  4JK1 X;  1HKS A;  5J8F A;  5DV5 A;  4EMS A;  3FZV A;  3OOP A;  2M45 A;  1QQI A;  1ONV A;  1LNW A;  5LGN A;  4LGW A;  1ZLK A;  2IW5 A;  1TQI A;  2DQR A;  4HV6 A;  1SD5 A;  3CLO A;  2JT1 A;  1DP7 P;  1STZ A;  4CYD A;  3HUG A;  1YW9 A;  1W5T A;  3ZQ7 A;  1MDM A;  4Q48 A;  4BYY A;  3QPT A;  4L9N A;  5KVR A;  5CJ9 A;  2DTR A;  5H6R A;  3H92 A;  2HS5 A;  2VT3 A;  2X4H A;  3C3W A;  2ZXJ A;  4Y15 A;  3HSF A;  1MGT A;  2M8E A;  2F5E A;  5AIQ A;  3QPH A;  4OOI A;  2HYF A;  3MQ0 A;  1SMY F;  3JSO A;  4KIF A;  3QAH A;  1OYY A;  1W4M A;  2XAS A;  3L9F A;  3WTW C;  2STW A;  1GXP A;  2VON A;  2PI0 A;  4Q5S F;  1WI9 A;  1T2K A;  2FMY A;  1IN7 A;  5BS6 A;  2VE9 A;  1ZAO A;  4XSZ F;  1X3U A;  5CVV A;  3O3K A;  5IT3 A;  1GVJ A;  4BHP A;  2MBF A;  2CGP A;  4YG2 F;  4YIF A;  4Y13 A;  3LA7 A;  1SMT A;  4KFC A;  3CUQ C;  5HS8 A;  3WU1 B;  2QYO A;  3BJO A;  2RNJ A;  3QP5 A;  4EM0 B;  1WWX A;  2OBP A;  2GA2 A;  1R1T A;  3RJP A;  3GWZ A;  4JQF A;  4ZZD A;  2VOD A;  1G4D A;  4WK8 F;  4NB5 A;  3EYI A;  2Z5U A;  3C18 A;  4PCQ A;  2ZNZ A;  3HRM A;  2VT2 A;  5E1Z B;  1IN4 A;  5E1W A;  2GXG A;  4OU0 A;  4HQE A;  1KU2 A;  5FGM A;  1U2W A;  2RN7 A;  1UST A;  2L02 A;  4G7O F;  3S2W A;  1OKR A;  1XMK A;  5F1R A;  4ESB A;  4LK0 F;  1FT9 A;  1XB4 A;  4RGU A;  2NYX A;  4I02 A;  1FSE A;  5F64 A;  2XAG A;  2BYV E;  3KZY A;  2ZFW A;  2IP2 A;  2UXX A;  5HLI A;  3N4M A;  4OMZ A;  4Q4Z F;  3M9A A;  4IF4 A;  3F23 A;  3FM5 A;  1AWC A;  1P4X A;  2V1U A;  3HHH A;  2A5Y B;  4WXC A;  2EFN A;  4HW0 A;  5BQT A;  2RVC A;  2Z33 A;  5AIP A;  3SQN A;  3ULQ B;  1W7P B;  2HQN A;  2ZME B;  3GW2 A;  1R58 A;  2P7V B;  4U88 A;  1BI3 A;  3F8B A;  3KP6 A;  3V7S A;  5L3E A;  3L09 A;  1IF1 A;  4S05 A;  2FF4 A;  3BWG A;  5IT9 Z;  1HW1 A;  1ZN2 A;  4HDU A;  2R3S A;  3E5U A;  2G7U A;  3LAJ A;  3TO9 A;  3F3X A;  1V3F A;  2M1B A;  2DK8 A;  4HBL A;  1REP C;  2FQ3 A;  1XSV A;  3J81 Z;  3LA3 A;  1OMI A;  4CGZ A;  2NNY A;  2OU2 A;  3KLN A;  1B4A A;  2E7X A;  2BBY A;  2V1D A;  4E70 A;  1U6G A;  3MCZ A;  2QUF A;  1K78 A;  4HX7 A;  4LB6 B;  5JI6 A;  1EH7 A;  4AIJ A;  4EM2 A;  5DCM A;  3FMS A;  1E2X A;  1KU9 A;  4OIP F;  2QBY A;  4U0V A;  1WKM A;  3HRT A;  1QGP A;  5E8I A;  4RB1 A;  2RGV A;  1G6N A;  3KFW X;  1LDD A;  3FWE A;  1XN7 A;  2ZBK A;  3GYH X;  2MLG A;  4ZYD A;  4ZH4 F;  3V8K A;  4HAM A;  1DPU A;  3F8M A;  1L0O C;  2ZO4 A;  1LB2 A;  4WF2 A;  2IA2 A;  2QQB A;  4RGR A;  2HTJ A;  3MWM A;  4M6X A;  5L3G A;  3BY6 A;  1I1S A;  2QLZ A;  3B02 A;  3ZP5 A;  1YS6 A;  1R5G A;  4KA4 A;  3P7N A;  2COM A;  2Z99 A;  3I0T A;  4OIN F;  2O3F A;  3O6B B;  5JVT A;  1D3Y A;  3HHG A;  1R1V A;  2RKH A;  1RUO A;  3JAM Z;  2EV6 A;  1C0W A;  4RS8 A;  3MEX A;  4KNY A;  4WWC A;  4ETS A;  1YW7 A;  1PDN C;  2X0L A;  2Z3Y A;  4HLX A;  1BIA A;  2CYY A;  1JGS A;  3WGI A;  4LD5 A;  1T98 A;  1DDN A;  2VOP A;  4UXN A;  2CWE A;  2BEO A;  2HOE A;  2W85 A;  3HIF A;  2HKX A;  3FX3 A;  3IWZ A;  3HYI A;  5D6F A;  3GXO A;  3TOA A;  2DU9 A;  1IXC A;  1HKQ A;  1S29 A;  3U1D A;  3DPT A;  1FWZ A;  2CO5 A;  2O61 A;  5D5X B;  1RUN A;  5ED4 A;  1MJA A;  3V8J A;  4HF0 A;  4L5J A;  4EJV A;  1VTN C;  4KT5 C;  1XGM A;  3GO5 A;  3LWF A;  2R7F A;  3F6V A;  2Q2E A;  2JRT A;  4WXD A;  2YSR A;  3M8F A;  5DD8 A;  1HKT A;  2FNA A;  1JE8 A;  3DKW A;  2EK5 A;  2D1V A;  4A5M A;  3D0S A;  3ZMU A;  5BOX A;  4DNC A;  3GLX A;  3WG9 A;  2HEO A;  3QRF F;  4KDP A;  4L0Y B;  4UVC A;  4I0B A;  1FYM A;  1J0R A;  4I98 B;  4RB3 C;  2IRF G;  3U2R A;  4HF1 A;  2L4A A;  5A2Q Z;  4YFN F;  1ZRD A;  4EJU A;  2PEX A;  4BH9 A;  2QM3 A;  3JW4 A;  3K1N A;  4A0X A;  3CUQ A;  1F1Z A;  2QZ8 A;  2OZ6 A;  5TJJ A;  2FBK A;  3HOS A;  2DAO A;  3IL2 A;  2OA4 A;  2E1N A;  2EB7 A;  2DFI A;  3TDU C;  1FBS A;  1IN6 A;  3QU3 A;  3CTA A;  2DLL A;  3CO7 C;  5LHI A;  4A6E A;  1TW3 A;  3JSP A;  1ODD A;  1R5H A;  1FX7 A;  1IXR C;  2XV4 S;  3ZN1 A;  3NQO A;  4NQW A;  1B9M A;  4BNC A;  2M87 A;  2DQL A;  2GQQ A;  3F8N A;  5E20 A;  3PFI A;  4HDV A;  1IRF A;  4EJT A;  3WTT C;  2L3D A;  1Z6R A;  4TV7 A;  2PG4 A;  1PP7 U;  2UZK A;  4BHC A;  4S04 A;  1O7L A;  2F5C A;  4IJA A;  3F22 A;  3P9K A;  3SZT A;  3WTV C;  1L3L A;  1ZG5 A;  2L01 A;  1Z05 A;  1U3E M;  3LST A;  2YX7 A;  4KYW A;  3GUD A;  2EV5 A;  1LDJ A;  2LSO A;  4HLY A;  1K79 A;  4IRH A;  1IZ1 A;  5K5R A;  2FBI A;  1U5T B;  3HSE A;  3ECO A;  3DV8 A;  5DCM B;  1WRJ A;  1UB9 A;  5L3D A;  4HA8 A;  5DDG A;  2LKP A;  4WCG A;  2QBY B;  2EJR A;  4UUV A;  1T0F A;  2AS5 F;  4EM1 A;  3BP8 A;  2ESN A;  3WTS C;  5ICG A;  3FMR A;  2HWV A;  2VC1 A;  2CG4 A;  2DPU A;  3M8E A;  3WTU C;  1ZAR A;  3BDD A;  4GYI A;  5FLX K;  1K7A A;  5E18 F;  4GYG A;  3K2Z A;  4LJZ F;  5HVQ C;  2WC2 A;  1YYV A;  2W24 A;  4QWQ A;  4MQ9 F;  2Y75 A;  2KJB A;  3H3U A;  3E5Q A;  2FEZ A;  5ILV A;  3BJ6 A;  3ISP A;  4XBF A;  5J6X A;  1U8R A;  1FBQ A;  2VBX A;  2XAF A;  1UHM A;  1MD0 A;  4MTD A;  5HLH A;  3HTS B;  2STT A;  2KIM A;  3KLO A;  3ZMD A;  4UVB A;  2ZKZ A;  3TQN A;  3WU0 A;  2QWW A;  1Y0U A;  3F8F A;  1BC8 C;  1KU3 A;  2P4W A;  2XIG A;  3K69 A;  3NEU A;  4K2E A;  3I58 A;  3FF5 A;  1O7F A;  1IW7 F;  3I5U A;  2Q8K A;  5LRR A;  1YFH A;  1DPR A;  2ZCW A;  1HW2 A;  1BI0 A;  1T38 A;  1FYK A;  2R7D A;  4O6J A;  4PDK A;  1CF7 A;  3T8R A;  2J5O A;  2P7C B;  1I1G A;  1OYW A;  3GF2 A;  2XKP A;  3V8L A;  2OQG A;  3K0L A;  4IXA A;  1P6R A;  2BE5 F;  2XGX A;  3F72 A;  2P6T A;  1T39 A;  5F6F A;  1J7K A;  1Z1D A;  3T1B A;  2H94 A;  4D0P A;  1TQP A;  3RYR A;  4BQA A;  2MH2 A;  2HZT A;  3K1M A;  5HS7 A;  3WTZ A;  1R00 A;  4N9H A;  2O8X A;  3EDP A;  2ZJ2 A;  2XRN A;  4CDG A;  4YFK F;  1R1U A;  3LA2 A;  1XCV A;  3LFK A;  3I59 B;  4L5I A;  1USS A;  4M9Z A;  1G3Y A;  1XDS A;  4IPA A;  3AAF A;  4G6Q A;  3R0J A;  1B1B A;  2VN2 A;  4G7H F;  4GO1 A;  3Q9V A;  2XAJ A;  1ULY A;  2GXB A;  4CZZ A;  5DCF A;  1HW5 A;  5FO5 A;  2A69 F;  1FPQ A;  1Q1H A;  4WX9 A;  4P5O A;  1BI1 A;  4XSX F;  1O3R A;  2VBY A;  2IT0 A;  3O2P E;  5BMZ A;  2PBI A;  3CUQ B;  4BAY A;  4ENJ A;  3WGH A;  1IXS B;  5FD6 A;  4AD9 A;  2ETH A;  2K86 A;  2Y0M A;  2K27 A;  3RTR A;  3E5X A;  3K9T A;  3IC7 A;  4AVP A;  2CW0 F;  4R79 A;  4OIR F;  1QO0 D;  1P2F A;  5E1X A;  5K1Y A;  3EQL F;  4HQM A;  5FD5 A;  3CJN A;  2EA4 A;  4ZYH A;  3HRU A;  2B0L A;  3V4G A;  1BM9 A;  1ZG1 A;  2CSO A;  3COA C;  4XRF A;  1LEB A;  5L3C A;  1OR7 A;  5D6E A;  2K7L A;  1KQ8 A;  4ON0 A;  4MNU A;  1SFE A;  3KCC A;  4FX4 A;  2VE8 A;  3GVA A;  4IHS A;  4OIO F;  2HYG D;  1J2X A;  1KGS A;  1RIO H;  3RKY A;  4AIH A;  3KP7 A;  1R7J A;  4HOB A;  3GFL A;  3DPL C;  2NRA C;  5ICC A;  1S7A A;  1J75 A;  4AWX B;  2IA1 A;  1S7O A;  3IWF A;  1SD6 A;  3WTY C;  3VEP A;  3ROU A;  4XLN F;  3DF8 A;  5D8K B;  2O0Y A;  4ESJ A;  3GFM A;  5D5U B;  3P9C A;  2XAH A;  3RPU A;  1HBX G;  1BBY A;  2KKO A;  3GZ6 A;  1MDM B;  4GCV A;  4MEY F;  2VC0 A;  4HZF A;  6PAX A;  4Y17 A;  4PGH A;  2LF7 A;  4CHU A;  2KRF A;  3BJA A;  3MAJ A;  3R4K A;  2KIU A;  3Q5F A;  1GHC A;  3JTG A;  2L4M A;  5ICF A;  4G94 A;  4U7B A;  4OIQ F;  1OPC A;  2V6C A;  2MH9 A;  3ZMV A;  1FC3 A;  2XAQ A;  1P4A A;  2PJP A;  3BOQ A;  1ON1 A;  4M74 A;  1Z91 A;  4HF2 A;  1PUE E;  1TQM A;  1NHA A;  4LLN A;  2A61 A;  2P5K A;  4L18 B;  2DK5 A;  1LJ9 A;  3CDH A;  2XRO A;  3KP5 A;  3RPQ A;  3FHZ A;  3PQK A;  1ZRC A;  1KYZ A;  5DUK A;  5JFR A;  1TLH B;  3J80 K;  5HS9 A;  1XSX A;  2O6G E;  1FBU A;  5J8C A;  2TDX A;  1ZLJ A;  2W57 A;  2O03 A;  5K5O A;  1EH8 A;  1I6X A;  2VBZ A;  3KP4 A;  4PGG A;  1JXS A;  2JPB A;  2HR3 A;  4KIC A;  2H27 A;  2GAU A;  4IVN A;  4I7H A;  2KJC A;  2AXL A;  5DYM A;  4UV9 A;  4EVI A;  5L3B A;  2JTV A;  3IRQ A;  1HXD A;  3Q9S A;  2FXA A;  2FML A;  4WXH A;  3OV8 A;  3E6C C;  2PQ8 A;  3FXU A;  1T6S A;  2ISY A;  3GFJ A;  1U5T C;  1YG2 A;  1B6A A;  3DXJ F;  3P9I A;  5BPD A;  3FM3 A;  2QEN A;  3FXQ A;  4P9F A;  5D5W B;  1H0M A;  1W7P A;  4MQV A;  4A6D A;  2DI3 A;  2ZME A;  3F21 A;  1G3T A;  1KQ0 A;  2Q0O A;  1I5Z A;  2Z9O A;  4UVA A;  4M72 A;  1YO5 C;  3J7A O;  3TOB A;  5CVJ A;  3IKT A;  1FP1 D;  1JHF A;  3EET A;  5ILS A;  1KYW A;  1FY7 A;  2PN6 A;  1H9G A;  1BIB A;  4FHT A;  1G3S A;  1TNS A;  2A6H F;  4A12 A;  4R8H A;  3JTH A;  2W84 A;  3B73 A;  5LEK A;  5LGU A; 
#chains in the Genus database with same CATH topology
 3CCM I;  3BPX A;  5HOO A;  4MHG A;  3BTC A;  4EQQ A;  1O3T A;  2WAE A;  1ZR4 A;  2M4G A;  4X0G A;  2H09 A;  1PP8 F;  3HPH A;  1O3S A;  3I4P A;  1ETK A;  5J4V A;  2DBB A;  2A68 F;  3G73 A;  2DMU A;  2LH9 A;  3BG5 A;  2IS6 A;  5LEJ A;  4I2O A;  1IAW A;  2MA3 A;  2EPF A;  3CJQ B;  1WI3 A;  3OS2 A;  4IX7 A;  2V1N A;  2QVO A;  1AOY A;  1MBF A;  1GXQ A;  2LTP A;  3I71 A;  1OYI A;  4LK1 F;  4OMY A;  3L1P A;  1K78 B;  3TO6 A;  1WSU A;  3KEQ A;  3OIO A;  4U0W A;  4BXF A;  4GRI A;  1H88 C;  3IKV A;  2FSW A;  2PLY A;  2Y30 A;  3EPZ A;  3C7J A;  2F5F A;  2JRM A;  3QP6 A;  4M3D A;  1ZRE A;  2ELH A;  1RET A;  4NC6 A;  4L9V A;  4OAY A;  1NTC A;  2MC3 A;  2EFP A;  5KAI C;  1B59 A;  2KP6 A;  1ZG3 A;  3GME A;  4NBQ A;  1ETW A;  2GOM A;  2YU3 A;  3VOD A;  4M6Y A;  4LG0 A;  4RDU A;  2QEX I;  4BDZ A;  5FLV A;  1TT5 B;  2EWN A;  1Y8R B;  2A6E F;  4LLG F;  5J1R A;  3OIQ A;  2KIQ A;  3A0B C;  1XGO A;  3ASO H;  2CUZ A;  1FOK A;  1BI2 A;  3K4L A;  3GX4 X;  1JHH A;  2BY3 A;  2LRD A;  1DU0 A;  1D8J A;  1YQA A;  1H8A C;  3SZP A;  3GZ5 A;  2WAQ N;  2W25 A;  2E1C A;  2GXA A;  2M7B A;  2VJ5 A;  1W5S A;  4XK4 A;  2OZU A;  2UXN A;  3R6S A;  3QOE A;  4ZDL A;  4P96 A;  3MD2 A;  1CGP A;  1ZYR F;  4D1Q A;  3CMY A;  4EGZ A;  2HFH A;  1JUS A;  4G6T B;  2RC4 A;  4XLF A;  3IH2 A;  3OYA A;  1XX5 A;  1TTY A;  2M3A A;  3R60 A;  1ZGA A;  3FMQ A;  3BR5 A;  4BJ6 C;  1LDK B;  2G9W A;  3CUO A;  4IHY A;  3GBG A;  3R0A A;  4AUX A;  3DTE A;  5KHD A;  2HDD A;  3ML6 A;  3HGG A;  3KP3 A;  2F5D A;  2DPD A;  3GTK J;  3AKZ A;  4J01 A;  2JVG A;  3S16 J;  3F8C A;  4Y3O A;  1I6H J;  2KDZ A;  1RZ4 A;  3K4J A;  3ASN H;  3T5X A;  5FFX A;  2CRG A;  5EEG A;  4LFU A;  3OYN A;  5D4S A;  4JX4 A;  2K02 A;  2O7O A;  2FBH A;  1DU6 A;  2LF8 A;  3L00 A;  2X85 A;  2K3P A;  1ZEL A;  3TP0 A;  1LUJ B;  3RDI A;  2W48 A;  2JVH A;  3KPH A;  4RGS A;  1FP2 A;  5IOZ A;  2C6Y A;  2E1O A;  5LBQ A;  1JTX A;  5BNG A;  1EJ9 A;  4M3B A;  4HV5 A;  2GA1 A;  2KIF A;  4M9S A;  2V79 A;  3K4M A;  3CMA I;  2VKV A;  3BPV A;  5M3F J;  3GTG J;  2JZY A;  2HQ5 A;  2GLO A;  1YIT I;  3E6B A;  1E3P A;  2R5Y A;  1JUP A;  3PQJ A;  1BR4 A;  1U0J A;  2D1H A;  3V7R A;  5E3O A;  4AIK A;  4D5C A;  1Y6I A;  5IT9 K;  1A36 A;  3WHB A;  2PMH A;  4CXF A;  2W7N A;  3B6C A;  2EV0 A;  2P5L C;  3HRS A;  4XKV A;  2NNN A;  2JSC A;  1WZ2 A;  2AXT C;  3DEU A;  3CLQ A;  3SHF A;  4EJW A;  1W7P D;  3DFG A;  1IV6 A;  4ZYG A;  1RI7 A;  4F91 B;  4KIG A;  1OFC X;  3DU5 A;  4HEA 2;  5CVR A;  2Z2S B;  3T8T A;  1IO2 A;  3PSF A;  1I27 A;  4RAZ A;  2LBF B;  2L5Q A;  3CP2 A;  2V26 A;  2YU9 J;  4G9Y A;  2HDC A;  4H0E A;  1ETO A;  4ASN A;  2Q2E B;  3WGG A;  3J81 K;  2K9Q A;  2F4O B;  3VFZ A;  3GFI A;  1QBJ A;  2IPQ X;  2YPR A;  1TC3 C;  1FLI A;  4XON A;  5B3S H;  1QZZ A;  5FLM J;  3GTO J;  1WJA A;  4KIB A;  1VQL I;  2F4M B;  1XSD A;  3NWT A;  5FLX Z;  1TWH J;  3A4C A;  3BG7 A;  1R36 A;  4G7Z F;  5CVI A;  1FSH A;  3J7Y J;  2ISZ A;  2RRE A;  4BU2 A;  2BVL A;  4O3M A;  3RKX A;  3V7C A;  1FZP B;  3I54 A;  1YS7 A;  4P55 A;  3DP7 A;  2DFH A;  2HTS A;  2E1M C;  3X2Q H;  1MSF C;  2O8K A;  1BOA A;  3AFH A;  2IVM A;  2WV0 A;  3MKY B;  4IOA F;  5JLW A;  3JRD A;  2A3S A;  1FNN A;  4BGD A;  4B3X A;  2GWR A;  1IRX A;  5GAD J;  4IHT A;  5E17 F;  1LVK A;  1Z7U A;  1BC7 C;  1DUX C;  4EV0 A;  2EFW A;  3C2H A;  3QYE A;  2WWY A;  3ZMZ A;  5HDK A;  1XDU A;  4L0Z B;  2HQR A;  1Z77 A;  4I09 A;  3NRV A;  4UV8 A;  2JSP A;  5J3L A;  4BBR J;  3L7W A;  1D0Y A;  1QVT A;  3FKJ A;  5LHG A;  1IN5 A;  4YFX F;  1VQ8 I;  4C2T A;  1JT6 A;  2JPC A;  3HSR A;  4B8X A;  3S3M A;  4ITV A;  2FE3 A;  2QKM B;  2WA0 A;  3DTK A;  3RQI A;  4XKB A;  2E7W A;  2L9N A;  3G1L A;  3BRO A;  4BHB A;  3BR6 A;  3HG9 A;  3H9J A;  4ENK A;  1UAA A;  1E3H A;  4IQ4 A;  5DEQ A;  2EFQ A;  1J59 A;  1YRN A;  1XGS A;  2PMU A;  2VJ4 A;  3LQR A;  2LYC A;  1XGN A;  4A2U A;  2OF7 A;  1JTY A;  4G6D A;  3WTX C;  1S72 I;  1R22 A;  2BV6 A;  2K4J A;  3HKZ N;  4M6V A;  3TGN A;  3ABK H;  3T0Y A;  2XPU A;  4CO8 A;  2DW4 A;  2P8T A;  2X1E A;  2WB1 A;  2BY2 A;  2DFF A;  3CF2 A;  3O8H A;  4LMY A;  3ABU A;  1MW7 A;  3IHU A;  4RGX A;  3ZQF A;  5EYR A;  5EDN A;  5FB2 A;  3LSJ A;  1QPM A;  2XSD C;  1QA6 A;  2JUG A;  3QWL A;  5J4Y A;  2R7O A;  2ZJR F;  1ZHF A;  3CCE I;  2O9L A;  1FOX A;  1IN8 A;  1WJ5 A;  3RI4 A;  2QSF X;  4UHT A;  3QOP A;  2D2W A;  3EUH A;  5AON A;  3M8J A;  5J1U A;  4NQW B;  2CFO A;  1NG6 A;  2NVU B;  1E17 A;  3KEO A;  2XVC A;  1S8N A;  4GXO A;  4HX8 A;  2BHZ A;  2IA0 A;  2WAF A;  1KQ9 A;  3F9K A;  3JAM K;  3G6E I;  1IRG A;  1I3A A;  5B66 C;  1D0Z A;  2E2H J;  1YW8 A;  2IJL A;  1SD7 A;  2JN6 A;  4EGY A;  5EEA A;  1QZY A;  3ELK A;  3LNQ A;  2LP0 A;  5CQE A;  1MZB A;  3TO7 A;  1XCB A;  1HOM A;  5KNL A;  1FYL A;  4XIC A;  4XRS G;  3REO A;  1LEA A;  5B1B H;  3MMY B;  4DQ2 A;  1LQ1 A;  5CLS A;  2QQA A;  2UWM A;  5D4R A;  1Z6T A;  2FU4 A;  3GEZ A;  3KP2 A;  2F2E A;  5HDN A;  5K5Q A;  4RM2 A;  1PVE A;  5TRD A;  3C1D A;  2GIV A;  1ZH5 A;  4M71 A;  5BPI A;  2DFE A;  3G3Z A;  4JBA A;  2VOO A;  3GTJ J;  4UUS A;  2CQN A;  2CV0 A;  2KZG A;  3L2C A;  1IUY A;  3M3Y J;  1Z0X A;  1U5T A;  3QU6 A;  3WE3 A;  3D5L A;  2QQ9 A;  3K1P A;  3LQQ A;  1RRJ A;  2X1D A;  3ECH A;  1YLF A;  4PFO A;  4P9U A;  1Y1V J;  4E7L A;  4LB5 A;  5DD4 A;  2BW3 A;  4FE7 A;  5LGT A;  5ERI A;  3K4B A;  4R1H A;  4YII A;  4B09 A;  4A0Y A;  2FNP A;  2Y31 A;  5D5V B;  4LG0 B;  2OC6 A;  2XGE A;  3HOZ J;  4CCN A;  1VFC A;  1HSJ A;  2H6B A;  2A07 F;  3VYS B;  1BN5 A;  2R7W A;  1EA3 A;  2FRH A;  1J5Y A;  3VYU B;  4NHJ A;  4I6Z A;  3PO3 J;  2EZK A;  2G7H A;  1R23 A;  1B9N A;  1MMN A;  1MKM A;  1SD4 A;  2CQK A;  1YJW I;  2NAZ A;  4HX4 A;  2XC7 A;  4BBS J;  4FET A;  4A5N A;  2V9V A;  1UFM A;  1GUU A;  1MMG A;  3TKY A;  1G3W A;  3OS1 A;  3L2Q A;  5H20 A;  2WAQ A;  3N97 A;  1RNL A;  1BL0 A;  1F5T A;  1IGN A;  5LLQ A;  1ZKG A;  4W1U A;  5FFZ A;  4A3M J;  3AG3 H;  1UHW A;  5HLG A;  3ESW B;  1TNT A;  1WQ2 A;  1ERD A;  4QLC U;  3E3V A;  1D8K A;  5KCM A;  3CC2 I;  3M1E A;  4FT8 A;  2D45 A;  2BGC A;  4BUP A;  2ESH A;  3IAM 2;  5HLT A;  1A04 A;  2M5W A;  2RV8 A;  3TP3 A;  1HST A;  2MLK A;  1WVR A;  5A2Q K;  1Z3Y A;  2OQR A;  2EA2 A;  1HQC A;  1U78 A;  3S32 A;  1F4K A;  2L7Z A;  3H35 A;  5ILU A;  1X2M A;  1JT0 A;  5KK1 A;  4BXU A;  2NXN B;  3PSI A;  2J5P A;  3VB2 A;  3BT9 A;  3FXO A;  1XD7 A;  2NOJ B;  3M1C A;  2YR2 A;  3Q3S A;  4RB2 C;  2FJ1 A;  5DUI A;  1O3Q A;  1LPQ A;  2FOK A;  1MSE C;  3I4M J;  4YEL A;  1FMW A;  3CC7 I;  1F9N A;  4IRG A;  4LIT A;  4XOP A;  2DYR H;  3ZPL A;  1UCR A;  4BEH A;  4I0A A;  4L9T A;  4X6A J;  1TZL A;  3SXY A;  3AL0 C;  2Y9Y A;  2UUZ A;  1ZGJ A;  1CF7 B;  4AVZ A;  4GGG A;  5E79 C;  4ZZL A;  3MKW B;  1K6O A;  2WTE A;  1POG A;  2XKO A;  4HYE A;  1X1A A;  3LSM A;  1H9T A;  2NVQ J;  4DIQ A;  3BR2 A;  3KZZ A;  4PZJ A;  5L3F A;  2R5Y B;  4U0Y A;  1MBK A;  2OV7 A;  3TDZ C;  1OCC H;  2JA2 A;  5FRO A;  2ME0 A;  2GZW A;  3SFZ A;  1S3J A;  2V7F A;  4RM3 A;  2XHK A;  1IRZ A;  3ZN0 A;  3OYF A;  4UNO A;  2PFB A;  5GPA A;  4A0Z A;  4RAY A;  2XUB A;  2HGC A;  4MTE A;  5LHH A;  1BJA A;  2LG4 A;  1SFX A;  4M3E A;  1YIO A;  1V4R A;  3CCV I;  4N0B A;  3KET A;  3RKW A;  2Z16 A;  2MD0 A;  2EIN H;  5D8L B;  3K70 D;  4ESF A;  1P92 A;  4M73 A;  2VXD A;  3ZMS A;  1ON2 A;  3DLL F;  3TED A;  1MJB A;  1RR7 A;  1XTA A;  4LLL A;  2R7Q A;  5TGT A;  3EUK L;  2ADU A;  4D9J A;  4AC0 A;  2LKS A;  5J47 A;  2LKX A;  2F48 A;  2OAZ A;  3RCO A;  4U7D A;  2RDP A;  3IH4 A;  4IRI A;  5HDG A;  4CYC A;  3ZMT A;  3S2H J;  1T08 B;  1G59 A;  2R7R A;  4O5V A;  3ZGK A;  2B63 J;  2LNB A;  1TW2 A;  3RIR A;  1TBX A;  1OCZ H;  3S8P A;  2P5V A;  2DMP A;  3CC4 I;  3S93 A;  1KU7 A;  1J9I A;  2VBW A;  1QZE A;  4KMU X;  1A35 A;  3BZK A;  5H6Q A;  2VXZ A;  4KN4 X;  3BQZ A;  3SZG A;  3BG3 A;  2MD5 A;  2F5V A;  3K4K A;  3BR1 A;  2CU7 A;  2LDU A;  4EJO A;  3RYP A;  4F7Z A;  3I59 A;  2OD5 A;  3KE2 A;  4IQJ A;  3PIP F;  3H3Z A;  4PJN A;  4PFP A;  1JKO C;  2KQR A;  2EZI A;  2HYJ A;  5JR3 A;  3CMM A;  3S1R J;  3S17 J;  3DWL E;  2Y48 A;  3B6A A;  2IS4 A;  2H6C A;  2CFX A;  3GTM J;  1T56 A;  2DCE A;  5CYV A;  5ICE A;  5M3M J;  3PIO F;  2K9N A;  4YRV A;  1MMS A;  1ENH A;  3MFK A;  2K4B A;  4L9J A;  2R5Z B;  2R93 J;  4BJ5 C;  5FKM A;  2DA4 A;  4QIW N;  3ZQI A;  3QYB A;  3MZH A;  2EFO A;  3OSG A;  3H5A A;  1A5J A;  5LRS A;  3QQA A;  2RQP A;  3W6J B;  1G2H A;  3BZ6 A;  1Z9C A;  5M5X J;  2HXO A;  4KIS A;  4FX0 A;  3ABT A;  3EYY A;  3K10 A;  3PM1 A;  4DBQ A;  4V2G A;  1D5V A;  1EV7 A;  4I01 A;  4RB0 A;  2ZJP F;  3ZQC A;  1MBG A;  3E6D A;  2NS0 A;  4XLP F;  1YRN B;  2JJ7 A;  2YX4 A;  4ENN A;  2FA5 A;  3GZN B;  3OR2 C;  2GOX B;  5GTH C;  1YTY A;  4MGR A;  1SAX A;  2OPT A;  3IRR A;  2R92 J;  1P4W A;  2DO7 A;  1MBJ A;  3ERE D;  3DQV C;  5EEH A;  2P6S A;  4N9I A;  1XMA A;  2EIK H;  4NC8 A;  3HM5 A;  2KPM A;  3WOD F;  3E1S A;  2CUE A;  2VLA A;  1OCO H;  2ACJ A;  1AU7 A;  1X58 A;  4ZYE A;  3E6M A;  4N4O B;  2NS7 A;  3HKZ A;  2V1X A;  1O57 A;  3DBR B;  4Q47 A;  4A3L J;  3CZ6 A;  2XGD A;  3HOT A;  2M30 A;  3H1C A;  3W6K B;  2XDV A;  3J80 Z;  2ME6 A;  1MBE A;  2DT5 A;  3IUO A;  4AU7 A;  3WE2 A;  1AKH A;  4G8X A;  3DEE A;  5TIS C;  2JK3 A;  3FXR A;  4CIC A;  3LAP A;  3BLY A;  2ZNY A;  2BXY A;  3A03 A;  4C3J J;  1KA8 A;  2E60 A;  4ENM A;  1PYV A;  1MJ9 A;  1YX3 A;  1E0E A;  3R61 A;  3JRF A;  1S6L A;  1KZH A;  1EH6 A;  1FIA A;  3I64 A;  5E8G A;  3F6O A;  1QNT A;  3A01 A;  3I53 A;  4Z2Y A;  3U9G A;  1ZRF A;  4F3Q A;  2HKO A;  3MZY A;  3E97 A;  1SFU A;  1LVA A;  2IXS A;  4KN7 X;  4DJA A;  5IOY A;  4M9X A;  5K7H A;  2OTJ I;  3M7G A;  3CCJ I;  1Y1W J;  3P5J A;  1MBH A;  1VQ4 I;  3CO6 C;  2KRH A;  3FHN A;  5CVU A;  3VOE A;  4KMF A;  2X6X A;  2X9D A;  3HTU A;  4KUM A;  3JRG A;  4MEX F;  1GV5 A;  2L54 A;  3S3O A;  5E3L A;  1WH7 A;  5JHU A;  5EG0 A;  3D1N I;  4JK1 X;  1HKS A;  5J8F A;  5DV5 A;  1QU3 A;  4QSH A;  3I56 I;  3N05 A;  2XPV A;  4EMS A;  2HNH A;  1BA5 A;  1VQ7 I;  3FZV A;  3OOP A;  2M45 A;  1QQI A;  2KDO A;  2D5V A;  1ONV A;  5FKO A;  4KT6 A;  1LNW A;  5LGN A;  4LGW A;  1ZLK A;  2IW5 A;  1TQI A;  3NWS A;  2H1K A;  2BW3 B;  3DLA A;  2DQR A;  4HV6 A;  3AG1 H;  4HNU A;  4FCY A;  4HPQ A;  1SD5 A;  3CLO A;  2JT1 A;  1DP7 P;  4F92 B;  1STZ A;  4CYD A;  5J40 A;  1JJ8 C;  4FE4 A;  3HUG A;  1YW9 A;  4P1W A;  3KZI C;  1W5T A;  3ZQ7 A;  1MDM A;  4Q48 A;  4DYR A;  2DTZ A;  4BYY A;  2X48 A;  3LSK A;  1T95 A;  4CSW A;  4NNJ A;  4PJJ A;  3A02 A;  3QPT A;  4L9N A;  5KVR A;  4CCJ A;  5GAG J;  2Y9Z A;  5CJ9 A;  1HC8 A;  1LE8 A;  2DTR A;  5H6R A;  1E3O C;  3CME I;  3FK6 A;  3H92 A;  2HS5 A;  4B1R A;  1RKT A;  2VT3 A;  2X4H A;  3L2R A;  3PO2 J;  3C3W A;  2ZXJ A;  2LC2 A;  5JHF A;  4A3K J;  4C2U A;  4Y15 A;  3HSF A;  4XRS A;  1MGT A;  1GV2 A;  2M8E A;  2F5E A;  5AIQ A;  1BW6 A;  3FBI B;  2CQQ A;  3QPH A;  4XID A;  1OCT C;  4OOI A;  2HYF A;  3MQ0 A;  1FEX A;  1SMY F;  1MNM C;  3JSO A;  3IV5 A;  3DPU A;  4KIF A;  3CDL A;  3QAH A;  4E7J A;  1OYY A;  1W4M A;  1V55 H;  2XAS A;  3L9F A;  2O5R A;  3HJE A;  3WTW C;  1W36 C;  1GXP A;  2X6Y A;  5E3M A;  1JUM A;  2PI0 A;  2STW A;  2VON A;  4Q5S F;  1WI9 A;  3OYM A;  3BCB A;  1T2K A;  2FMY A;  4MFE A;  1IN7 A;  5BS6 A;  2VE9 A;  1ZAO A;  4XSZ F;  1X3U A;  4Y4R A;  5CVV A;  3O3K A;  2HVR A;  1MMA A;  1GVJ A;  2BZT A;  2DJN A;  5IT3 A;  3OYG A;  3E7L A;  4BHP A;  2MBF A;  3S14 J;  2CGP A;  4YG2 F;  4CCM A;  5EGO A;  4YIF A;  4Y13 A;  3LA7 A;  1IG7 A;  2BXZ A;  3LL7 A;  5EZH A;  3ZRG A;  4BEH B;  3JRH A;  1K61 A;  1SMT A;  4KFC A;  2DA2 A;  1TP4 A;  3TL4 X;  3CCR I;  3CUQ C;  3DBH B;  4QPO A;  5HS8 A;  3WU1 B;  2QYO A;  3BJO A;  2RNJ A;  3QP5 A;  3OYB A;  2DA5 A;  2JQ7 A;  5FRM A;  4EM0 B;  1WWX A;  3FXM A;  2OBP A;  1Y0N A;  2HQA A;  2K5C A;  2MGQ A;  2GA2 A;  1R1T A;  3I3L A;  3KX2 A;  3RJP A;  3GWZ A;  4JQF A;  4A3D J;  4ZZD A;  1Y39 A;  2DDB A;  4IHW A;  2VOD A;  1G4D A;  1JGG A;  2KLO A;  4RLF A;  3CQZ J;  4WK8 F;  4NB5 A;  3EYI A;  5B1A H;  2VB6 A;  2Z5U A;  5K7F A;  3DKY A;  3C18 A;  4PCQ A;  2ZNZ A;  4XR6 A;  2EIL H;  3HRM A;  2K40 A;  2VT2 A;  2XF7 A;  3J7A Y;  5E1Z B;  1IN4 A;  5E1W A;  2GXG A;  3FBN B;  4OU0 A;  4HQE A;  3FXK A;  4D7M A;  1KU2 A;  5FGM A;  1U2W A;  2KMU A;  4J19 A;  2RN7 A;  3OYE A;  3M07 A;  1UST A;  2L02 A;  4G7O F;  3S2W A;  1OKR A;  1XMK A;  3S1N J;  1WJD A;  3DBL B;  4DYC A;  5F1R A;  4ESB A;  2QQ8 A;  4LK0 F;  1FT9 A;  1XB4 A;  4RGU A;  1B72 B;  2NYX A;  2QKL B;  3VDX A;  4I02 A;  1PUF A;  1FSE A;  3MN2 A;  5F64 A;  4RAF A;  2XAG A;  1D1A A;  4BQO A;  3L2V A;  1D5Y A;  3NAU A;  2BYV E;  3KZY A;  4JOM A;  4E7H A;  2ZFW A;  1ETV A;  4OAZ A;  3Q0V A;  2IP2 A;  1IV8 A;  2UXX A;  5HLI A;  3N4M A;  2HZD A;  3RKQ A;  4OMZ A;  4Q4Z F;  3M9A A;  2E2I J;  2K9L A;  4IF4 A;  4MFD A;  4V2F A;  3F23 A;  1WJC A;  3DTI A;  1D1B A;  3KYL A;  3BZC A;  3FM5 A;  1AWC A;  4XQF A;  2YUS A;  1ETX A;  1P4X A;  2V1U A;  3HHH A;  2ELJ A;  3HEF A;  2A5Y B;  3FIS A;  4WXC A;  2EFN A;  4HW0 A;  4A3F J;  5BQT A;  3JRC A;  2RVC A;  3MZ8 A;  2Z33 A;  5AIP A;  3PNV A;  2HVQ A;  3H9Q A;  3SQN A;  2XB0 X;  4B43 A;  3ULQ B;  1W7P B;  1ITY A;  2HQN A;  2JWT A;  1YOV B;  2Q1Z B;  4CUG A;  2ZME B;  3S1Q J;  3GW2 A;  3JRE A;  2LFB A;  1T0F C;  1HA8 A;  1R58 A;  2KZV A;  2P7V B;  2CW8 A;  1W0T A;  4U88 A;  3SEZ A;  3LFU A;  2VL8 A;  1BI3 A;  3GLL A;  4XKW A;  4M3F A;  1UEL B;  3RZD J;  4ZTF A;  4JX6 A;  1WCM J;  3F8B A;  2R7U A;  3KP6 A;  4PSX A;  3V7S A;  3L09 A;  5L3E A;  1IF1 A;  3J7Z I;  2PMZ N;  4S05 A;  2FF4 A;  3ONQ A;  1FTT A;  2QF7 A;  4RLQ A;  5J1Y A;  1M1E B;  4BQN A;  3BWG A;  5IT9 Z;  1TT0 A;  2M8G X;  1HW1 A;  1K83 J;  3CF5 F;  1ZN2 A;  4HDU A;  2QCO A;  2R3S A;  3BG9 A;  3E5U A;  2JA6 J;  5FJ8 J;  2G7U A;  4AM3 A;  3LAJ A;  3ZCO A;  2E5N A;  1ETY A;  2AHQ A;  1RES A;  3G2B A;  4JP0 A;  3TO9 A;  2DXI A;  3F3X A;  3L2U A;  3PL8 A;  1V3F A;  4NC7 A;  2M1B A;  4ZTJ A;  2DK8 A;  4HBL A;  1REP C;  1FOY A;  2FQ3 A;  3LSH A;  1XSV A;  3J81 Z;  3LA3 A;  1OMI A;  2M34 A;  4CGZ A;  2NNY A;  1N77 A;  2VKE A;  3TW6 A;  2OU2 A;  4ANJ A;  5C3E J;  1MH3 A;  4A69 C;  3KLN A;  1B4A A;  2E7X A;  2E1M B;  2BBY A;  5CPR B;  1UHS A;  2OCE A;  5IYC J;  2K9S A;  3AG4 H;  3LOC A;  2V1D A;  4E70 A;  1YJN I;  2QSG X;  1U6G A;  3MCZ A;  4LOC A;  2KT0 A;  3JRI A;  5HNH A;  2QUF A;  3BCA A;  4PSW A;  1K78 A;  2K85 A;  4IKF A;  4HX7 A;  2PJR A;  4LB6 B;  5JI6 A;  4ZDO A;  3PUF A;  3CCU I;  1EH7 A;  3OY9 A;  4AIJ A;  3W6V A;  4QPQ A;  4EM2 A;  5DCM A;  2A5W A;  4B3A A;  4F55 A;  1W5C C;  2AQF A;  3FMS A;  1E2X A;  1KU9 A;  2NS8 A;  4OIP F;  1Y8Q B;  3O8G A;  1OCR H;  1ORK A;  2Y69 H;  2QBY A;  3RZO J;  4U0V A;  1P7J A;  1WKM A;  4BS9 A;  1OQY A;  2IS1 A;  3W2W A;  3HRT A;  1QGP A;  5E8I A;  4RB1 A;  2RGV A;  1G6N A;  1J09 A;  3KFW X;  4CCO A;  1XS9 A;  1LDD A;  2P0W A;  3DCF A;  3GCM A;  3W3C A;  5F1J A;  2VQH A;  3FWE A;  5CKT A;  1XN7 A;  2ZBK A;  3GYH X;  2KFD A;  2MLG A;  1P9Q C;  4XOR A;  3CES A;  1I50 J;  4ZYD A;  4IL6 C;  4XLA A;  4ZH4 F;  1X3W B;  1TL8 A;  3V8K A;  4BAC A;  4HAM A;  1DPU A;  3CP8 A;  1L0O C;  3F8M A;  5EJC A;  1WH5 A;  2ZO4 A;  1PJR A;  1LB2 A;  3PJR A;  4WF2 A;  3ZQQ A;  2IA2 A;  2QQB A;  4RGR A;  1V5E A;  2MYS A;  3KIO A;  3GTL J;  2HTJ A;  4HSR A;  2V6E A;  3MWM A;  4M6X A;  5L3G A;  3BY6 A;  2ECB A;  2HI3 A;  5F04 A;  1I1S A;  2QLZ A;  3B02 A;  3ZP5 A;  3A0H C;  4CH7 A;  5EZG A;  1YS6 A;  1R5G A;  4KA4 A;  3P7N A;  1U9N A;  2COM A;  1WJE A;  2Z99 A;  3I0T A;  3U1K A;  4OIN F;  2O3F A;  2W4S A;  3O6B B;  5JVT A;  2R7Z J;  1D3Y A;  5GAE J;  3BQY A;  3HHG A;  5C44 J;  1R1V A;  1NG7 A;  4IOC F;  3CCY A;  4YEJ A;  1GT0 C;  2RKH A;  1RKW A;  1RUO A;  2VI6 A;  3JAM Z;  2BOL A;  2EV6 A;  1UZC A;  1C0W A;  3HXL A;  4RS8 A;  3ZR8 X;  4PK4 A;  1ZTR A;  3MEX A;  1ZR2 A;  4KNY A;  4B47 A;  4WWC A;  1A31 A;  4ETS A;  4RA2 A;  1YW7 A;  3ERM A;  1PDN C;  2X0L A;  4N4N B;  2Z3Y A;  3HPG A;  4HLX A;  1VQK I;  1BIA A;  2CYY A;  2R4G A;  1JGS A;  1R71 A;  3WGI A;  1X1D A;  3K2A A;  4LD5 A;  1T98 A;  1DDN A;  3HC7 A;  2VOP A;  4UXN A;  2CWE A;  2BEO A;  2L0K A;  2XGC A;  1F43 A;  3LSG A;  1XG1 A;  2HOE A;  2LMD A;  2W85 A;  3JRB A;  4Z6Y A;  4A3E J;  2PX9 A;  3HIF A;  2HKX A;  3KEY A;  3FX3 A;  3IWZ A;  3HYI A;  5D6F A;  3GXO A;  3TOA A;  2VQC A;  2DU9 A;  1IXC A;  1HKQ A;  1S29 A;  3U1D A;  3DPT A;  1I3Q J;  3G1M A;  2DYS H;  2HVS A;  1FWZ A;  3HL2 A;  1IDZ A;  2LD5 A;  2HOA A;  2VAS A;  3OSF A;  2HOT A;  2CO5 A;  2CJJ A;  3SDB A;  2FX0 A;  5GTI C;  5D5X B;  2O61 A;  1RUN A;  5ED4 A;  2W00 A;  1MJA A;  1I39 A;  2TCT A;  4C9Y A;  3V8J A;  4HF0 A;  4L5J A;  4EJV A;  1VTN C;  1WJB A;  4KT5 C;  1XGM A;  3GO5 A;  3LWF A;  4V19 K;  2DA1 A;  2MG4 A;  2EBI A;  2R7F A;  2Q2E A;  3F6V A;  3H9G A;  2JRT A;  1X19 A;  3QYF A;  1OCP A;  3H5R A;  4WXD A;  2BVM A;  2YSR A;  3M8F A;  5DD8 A;  4BQQ A;  1HKT A;  1LFU P;  1QHG A;  2FNA A;  1JE8 A;  3DKW A;  3JCU C;  2EK5 A;  1X4P A;  2JA7 J;  2D1V A;  4A5M A;  5JVG F;  3D0S A;  3ZMU A;  5BOX A;  3BR0 A;  4DNC A;  1OR7 C;  3GLX A;  2VJI A;  3WG9 A;  2HEO A;  2DN0 A;  3SDG A;  3QRF F;  2VUM J;  4KDP A;  2KL4 A;  4L0Y B;  4AID A;  2M9H A;  3Q0W A;  4UVC A;  4I0B A;  5B5E C;  1FYM A;  4II3 A;  1FTZ A;  1J0R A;  4I98 B;  1BOB A;  1YJ9 I;  4RB3 C;  2GIZ A;  2IRF G;  3U2R A;  4E7S A;  4HF1 A;  1Z21 A;  2VQG A;  2L4A A;  3Q0U A;  5A2Q Z;  4XLC A;  1IC8 A;  4KJZ A;  3W2V A;  4AYB A;  4YFN F;  1ZRD A;  3KYD B;  1IDY A;  4EJU A;  2PEX A;  4BH9 A;  2QM3 A;  3JW4 A;  3K1N A;  4A0X A;  3DKX A;  1APL C;  3BTL A;  3CUQ A;  1F1Z A;  2N8G A;  2XPW A;  2QZ8 A;  2OZ6 A;  4CZC A;  4Y33 A;  5FKK A;  5TJJ A;  2DA3 A;  2FBK A;  2X6W A;  1YX5 A;  3HOS A;  4BDY A;  2LLK A;  2DAO A;  4XLH A;  3IL2 A;  1VND A;  2OA4 A;  4ZDP A;  2R7V A;  2E1N A;  2EB7 A;  2VPR A;  2DFI A;  3E0J B;  3TDU C;  1FBS A;  1IN6 A;  4A3C J;  3QU3 A;  1RR8 C;  2I10 A;  3PFY A;  3CTA A;  3JR9 A;  2DLL A;  3CO7 C;  2VQL A;  5LHI A;  1SFO J;  2ZXW H;  1TW3 A;  4A6E A;  4HNV A;  3S1M J;  1SVL A;  4BY7 J;  3JSP A;  1ODD A;  1R5H A;  1FX7 A;  1IXR C;  2XV4 S;  1NK2 P;  3RPU D;  1W1W E;  2PMZ A;  3G1O A;  2L9S A;  3ZN1 A;  4PJL A;  3NQO A;  4NQW A;  1B9M A;  4BNC A;  2M87 A;  2DQL A;  3ZQG A;  2GQQ A;  3F8N A;  2CQ7 A;  5E20 A;  3PFI A;  4HDV A;  3SYT A;  2NVY J;  1IRF A;  4M3G A;  4EJT A;  2E34 A;  3WTT C;  2L3D A;  1Z6R A;  1K4S A;  4IHX A;  1B8I A;  4TV7 A;  2X6O A;  2PG4 A;  1PP7 U;  2E2J J;  4BL0 B;  2UZK A;  4BHC A;  4S04 A;  2XRL A;  1K6Y A;  1O7L A;  2F5C A;  4IJA A;  3F22 A;  3OIP A;  3P9K A;  3SZT A;  2NOG A;  3VSK A;  2DOA A;  2ZXI A;  3WTV C;  1L3L A;  2AQE A;  2LOO A;  1S7E A;  2P81 A;  4IZZ A;  2ID6 A;  2K9M A;  3H3V K;  4FAS D;  4PUS A;  1JI8 A;  3ZOB A;  2L01 A;  1ZG5 A;  1OLT A;  1Z05 A;  4HRI A;  2X1C A;  1U3E M;  3LST A;  2H8W A;  1SC7 A;  2YX7 A;  1ZK8 A;  4XL9 A;  4KYW A;  2CW7 A;  4PJM A;  5M5W J;  3GUD A;  2EV5 A;  1LDJ A;  2LSO A;  3TMO A;  3HOX J;  2OJE D;  4HLY A;  1K79 A;  4IRH A;  2GBY A;  1WGX A;  4UUS B;  3MKL A;  1IZ1 A;  5K5R A;  5E3N A;  9ANT A;  2G0E A;  2FBI A;  1Z7L A;  1U5T B;  3OMY A;  3HSE A;  4E7Z A;  3ECO A;  2PJR B;  1W0U A;  3DU6 A;  3IAS 2;  2OCC H;  3OR1 C;  5HOD A;  3DV8 A;  1VQO I;  4A93 J;  5DCM B;  2CV1 A;  1WRJ A;  1UB9 A;  3AG2 H;  5L3D A;  4HA8 A;  5DDG A;  2LKP A;  4WCG A;  2QBY B;  2VKH A;  2EJR A;  4UUV A;  5GPC A;  1ETQ A;  1T0F A;  1WFX A;  1K4T A;  2AS5 F;  3L2W A;  4EM1 A;  3BP8 A;  2ESN A;  3G4S I;  3WTS C;  2L2O A;  1WJF A;  5ICG A;  3LSP A;  3KYC B;  4Y52 J;  3FMR A;  4ZYA A;  2HWV A;  2VC1 A;  3SEQ A;  1VZ0 A;  3IP4 B;  2CG4 A;  3I55 I;  2DPU A;  3M8E A;  3WTU C;  1ZAR A;  2M4K A;  3BDD A;  4GYI A;  3HOY J;  5FLX K;  1XMX A;  3BG6 A;  1R4N B;  2I8D A;  1XC5 A;  1K7A A;  5E18 F;  2CV2 A;  3EUA A;  3OYK A;  3HZJ A;  1H89 C;  3UKG A;  1QHH D;  5DTD A;  1QVU A;  4GYG A;  3K2Z A;  4LJZ F;  5HVQ C;  1UG0 A;  2WC2 A;  4FIS A;  3OL3 A;  3WG7 H;  3OYH A;  4A3J J;  1YYV A;  1LFP A;  4XOT A;  1MMD A;  2W24 A;  4QWQ A;  1KON A;  2I5U A;  2K3F A;  4MQ9 F;  2Y75 A;  1JKR C;  2KJB A;  4KIT B;  3H3U A;  3H5N A;  3E5Q A;  2GM4 A;  2FEZ A;  3OYD A;  4FTH A;  1SAN A;  3PNT A;  2ZJQ F;  5ILV A;  3BJ6 A;  3ISP A;  2KHM A;  2XF5 A;  4XBF A;  1LKX A;  2E19 A;  2VIX A;  3H36 A;  1FBQ A;  2VBX A;  5J6X A;  5K7Z A;  2XAF A;  1U8R A;  1UHM A;  1MD0 A;  4MTD A;  5HLH A;  2QSH X;  3HTS B;  2STT A;  4GFB A;  2KIM A;  3KLO A;  3ZMD A;  4MLO A;  4UVB A;  2Y0S N;  1SAU A;  1P7I A;  2ZKZ A;  3FXL A;  5FRN A;  3TQN A;  5JLX A;  1HF0 A;  3WU0 A;  4A3B J;  2QWW A;  1Y0U A;  4XN3 A;  1X2N A;  3CJT B;  3F8F A;  3PNY A;  2QA4 I;  1A6Q A;  5M5Y J;  4CCL A;  1BC8 C;  1G8X A;  1KU3 A;  2HU9 A;  1R6R A;  2P4W A;  2XIG A;  1FMV A;  3K69 A;  3NEU A;  4K2E A;  4C3I J;  1TWF J;  3I58 A;  3CCL I;  1WHU A;  2WY7 Q;  1NK3 P;  3S15 J;  3FF5 A;  4OWR B;  1O7F A;  2EH3 A;  1DGW Y;  5IP9 J;  1IW7 F;  3UNG C;  1VQ9 I;  3I5U A;  2Q8K A;  1Q1V A;  1S9H A;  2Z1D A;  5IY5 H;  3VYT B;  1R5I D;  3OWT A;  2OUM A;  1R4M B;  3OL4 A;  1BR2 A;  5LRR A;  1YFH A;  1W36 D;  2IAI A;  2KIS A;  1DPR A;  2ZCW A;  1Y56 A;  2RNG A;  2ZME C;  1HW2 A;  1BI0 A;  2ZSH B;  1T38 A;  1FYK A;  2R7D A;  3V42 A;  2CUJ A;  4O6J A;  4PDK A;  1IUF A;  1JKP C;  3D5S C;  1WPK A;  2J5O A;  4C30 A;  3T8R A;  1CF7 A;  2P7C B;  1I1G A;  4DBR A;  1OYW A;  3GF2 A;  2XKP A;  3V8L A;  2OQG A;  4LG3 A;  3K0L A;  4IXA A;  1P6R A;  2BE5 F;  2NVX J;  2XGX A;  3F0C A;  3F72 A;  2P6T A;  3HOU J;  2CUF A;  1T39 A;  5CQG A;  5F6F A;  3WHC A;  1J7K A;  1D0X A;  1F36 A;  1Z1D A;  1X1C A;  3T1B A;  1EF4 A;  2H94 A;  3H0D A;  4D0P A;  1TQP A;  2B9S A;  3CD6 I;  1T33 A;  3ZXS A;  2DJI A;  2HPI A;  3RYR A;  2FD5 A;  1Z3X A;  4BQA A;  4NDL A;  3CCS I;  2MH2 A;  2HZT A;  2R7X A;  2XB5 A;  2V9K A;  3K1M A;  5HS7 A;  2ID3 A;  3WTZ A;  1MH4 A;  2FOW A;  4CYC B;  1N25 A;  5IYD J;  1R00 A;  4N9H A;  3M4O J;  2O8X A;  3EDP A;  3GTP J;  4JYK A;  2ZJ2 A;  2XRN A;  5F0F A;  3S2D J;  2A05 A;  1UJ8 A;  4CDG A;  1GLN A;  2ECC A;  4YFK F;  2IEK A;  3U21 A;  1UG2 A;  2FQ4 A;  1R1U A;  3LA2 A;  1ZGW A;  1TWG J;  1XCV A;  3LFK A;  3I59 B;  4L5I A;  1USS A;  4M9Z A;  1G3Y A;  3OYI A;  1AA7 A;  1XDS A;  4AYB N;  2EZL A;  4IPA A;  3AAF A;  2OTL I;  4G6Q A;  2AO9 A;  3R0J A;  1B1B A;  2F4I A;  4UY8 I;  2VN2 A;  2L7K A;  4BXX J;  4G7H F;  4GO1 A;  1RC9 A;  5LD2 C;  3QOD A;  2V9P A;  3Q9V A;  2XAJ A;  4BY1 J;  2DA7 A;  4I99 C;  1ULY A;  1RPW A;  2M0M A;  2GXB A;  4CZZ A;  2DOE A;  4RMN A;  3WU2 C;  4J00 A;  5DCF A;  1ACI A;  4UB6 C;  1OJL A;  2EZH A;  4XN0 A;  1HW5 A;  5FO5 A;  2DDA A;  2A69 F;  3H0G J;  1FPQ A;  4DGW B;  1Q1H A;  4H4K C;  4B44 A;  4RBO A;  3FK7 A;  3K4C A;  1SFK A;  4WX9 A;  1U9O A;  3UR3 C;  2R5Z A;  4P5O A;  1BI1 A;  4G12 A;  4XSX F;  4PJ0 C;  1O3R A;  4MO7 A;  2FUG 2;  2VBY A;  2LRE A;  2YS9 A;  3RQ4 A;  2IT0 A;  1VQN I;  3O2P E;  5BMZ A;  3C2B A;  2PBI A;  3CUQ B;  4BAY A;  3K4N A;  1IJW C;  3FDY A;  4E6K G;  4ENJ A;  3LSR A;  1S5L C;  3HDD A;  3WGH A;  1X4O A;  1IXS B;  1A6I A;  5FD6 A;  4AD9 A;  1BW5 A;  2E36 A;  2WV1 A;  5KAF C;  2ETH A;  2ZFU A;  2K86 A;  2Y0M A;  2H1L A;  2K27 A;  4DZP A;  3RTR A;  3E5X A;  3C2G A;  2RQQ A;  2CS3 A;  3K9T A;  2DA6 A;  3IC7 A;  4AVP A;  2CW0 F;  4DZJ A;  5F08 A;  4OIR F;  4R79 A;  4HG2 A;  1R49 A;  1X1B A;  1YI2 I;  1QO0 D;  5GP9 A;  1FIP A;  2M2E A;  4F52 A;  1P2F A;  2E35 A;  5E1X A;  5K1Y A;  1AKH B;  4IHV A;  3EQL F;  4HQM A;  3CCQ I;  4UB8 C;  1CQT A;  5FD5 A;  4DOZ A;  2HXI A;  3CJN A;  1Z67 A;  2EA4 A;  4ZYH A;  3HRU A;  3OS0 A;  1VQ5 I;  1AHD P;  1FJL A;  2B0L A;  3V4G A;  1BM9 A;  1ZG1 A;  3A01 B;  1B8I B;  2L9R A;  2BY0 A;  2CSO A;  1GDT A;  1MIJ A;  3COA C;  2MC4 A;  4XRF A;  1LEB A;  4FQG A;  5L3C A;  5DM7 F;  1OR7 A;  5D6E A;  2K7L A;  1KQ8 A;  1JKQ C;  4IO9 F;  4ON0 A;  4MNU A;  1SFE A;  3KCC A;  4FX4 A;  2VE8 A;  3GVA A;  1MNE A;  4DYQ A;  4IHS A;  4OIO F;  2R7S A;  2HYG D;  5IP7 J;  1J2X A;  4HNT A;  1KGS A;  1RIO H;  2IS2 A;  3RKY A;  2L7M P;  4NUB A;  3KP7 A;  4AIH A;  1DQU A;  1R7J A;  4DW6 A;  1BJZ A;  2W82 A;  4S0H B;  4HOB A;  3GFL A;  3DPL C;  5H2F C;  4A3I J;  5ICC A;  1S7A A;  5EG0 B;  1J75 A;  2HPM A;  2NRA C;  4AWX B;  4BE2 A;  1EKE A;  2IA1 A;  1S7O A;  3RSN A;  3IWF A;  3NAR A;  1SD6 A;  1ZQ3 P;  4ZC3 A;  3WTY C;  3VEP A;  3ABL H;  1LFB A;  2DOF A;  3ROU A;  4XLN F;  1DP3 A;  3DF8 A;  4QTR A;  4BE1 A;  3HOV J;  1YHQ I;  5D8K B;  2O0Y A;  4ESJ A;  2EQR A;  3GFM A;  4E7I A;  2MAB A;  4IEJ A;  5D5U B;  2B7E A;  3P9C A;  3G71 I;  1YE9 A;  2XAH A;  3BR3 A;  2LY9 A;  4LIV A;  1YIJ I;  2DMT A;  3RPU A;  1HBX G;  3VYR B;  3HUG B;  3LMM A;  2R7T A;  1BBY A;  2KKO A;  3GZ6 A;  1TWA J;  2EIM H;  1MDM B;  4XMY A;  4GCV A;  4MEY F;  1HDP A;  4YIR X;  5LFA A;  4C2M J;  2VC0 A;  3A1Y A;  4HZF A;  3D5R C;  4E7K A;  1VQM I;  3CJR B;  3VSL A;  2MW8 A;  4UUT A;  2NVT J;  4GDF A;  6PAX A;  1VF9 A;  4Y17 A;  2XSJ C;  4PGH A;  1LE8 B;  4CCK A;  2LF7 A;  4LIU A;  4CHU A;  2KRF A;  3BJA A;  3MAJ A;  3R4K A;  2KIU A;  5DS9 A;  2XAU A;  2ZSI B;  2JMW A;  3Q5F A;  4HST A;  2M0C A;  3VPR A;  3JTG A;  1GHC A;  5IPA A;  3I9V 2;  2L4M A;  3OOU A;  5ICF A;  4G94 A;  4EEF G;  4U7B A;  3IH3 A;  3TBI A;  4MIM A;  2V4J C;  4OIQ F;  2DT6 A;  1OPC A;  3TW7 A;  3JRA A;  2V6C A;  2MH9 A;  5HNF A;  3ZMV A;  1FC3 A;  2XAQ A;  2CH0 A;  1P4A A;  4U87 A;  3OYJ A;  2PJP A;  3BOQ A;  1ON1 A;  5IYB J;  5F0H A;  4JX5 A;  1HDD C;  4M74 A;  2CQX A;  1Z91 A;  2DMQ A;  4C3H J;  2Y0S A;  4HF2 A;  2COB A;  2H8R A;  4L5E A;  1PUE E;  1TQM A;  2WY8 Q;  1NHA A;  2VPL A;  2ZB9 A;  5EGO B;  1NH3 A;  4LLN A;  2A61 A;  2E71 A;  2P5K A;  3FIW A;  4L18 B;  2DK5 A;  2VJJ A;  2RAE A;  1GVD A;  1LJ9 A;  3CDH A;  4XNF A;  2XRO A;  2VKD A;  2CMP A;  2IGM A;  3KP5 A;  2IGO A;  3K70 C;  1VQP I;  2L7F P;  2IBD A;  3RPQ A;  3FHZ A;  3PQK A;  1N78 A;  3DEW A;  1ZRC A;  4W97 A;  1R9T J;  1JJ6 C;  5C4X J;  2ELK A;  1V5G A;  2UV1 A;  1KYZ A;  2DT7 B;  5DUK A;  5FKL A;  2L9V A;  5JFR A;  1TLH B;  3J80 K;  5HS9 A;  1XSX A;  2O6G E;  2E5Z A;  1FBU A;  1VQ6 I;  2LBF A;  5J8C A;  1O4X A;  2TDX A;  4X1E A;  2KRC A;  3ZQL A;  3HGY A;  1X3Z B;  1ZLJ A;  2W57 A;  2O03 A;  2LY1 A;  2Y2Z A;  3EUH C;  4F93 B;  5DM6 F;  5K5O A;  1HLV A;  1HCR A;  1EH8 A;  1I6X A;  2WAD A;  4XLE A;  3CDI A;  1T8I A;  1N75 A;  5GAH J;  3S3N A;  3QPS A;  2VBZ A;  3KP4 A;  3PUB A;  4PGG A;  4A3G J;  1JXS A;  2BY1 A;  3VWB A;  2F6C A;  3SFI A;  2LK2 A;  2ICW G;  3BTI A;  2JPB A;  5EF6 A;  2HR3 A;  2DOD A;  4KIC A;  2H27 A;  2GAU A;  4IVN A;  1PUF B;  3ABM H;  3BC8 A;  3MKZ A;  2WBM A;  1B72 A;  3ZQH A;  4BKX A;  4I7H A;  3OYC A;  2KJC A;  2A6T A;  4XKC A;  4II2 A;  2AXL A;  3K6G A;  1SVM A;  5DYM A;  4BJT A;  4UV9 A;  4ZJZ A;  2HDW A;  4ABZ A;  4EVI A;  4D5F A;  5L3B A;  2JTV A;  3IRQ A;  3SJM A;  2IGK A;  1HXD A;  4E4H A;  3Q9S A;  2FXA A;  2FML A;  4WXH A;  3FXJ A;  3LSI A;  5IP6 A;  2MFZ A;  3OV8 A;  3E6C C;  4XM3 A;  3A2K A;  2PQ8 A;  3OYL A;  1OIS A;  3FXU A;  1QPI A;  1D1C A;  1T6S A;  4EAT A;  2ISY A;  2TRT A;  3QPL A;  1V54 H;  3GFJ A;  1XPX A;  1U8B A;  1DGR M;  3GTQ J;  3K7A J;  1TWC J;  1U5T C;  2MSY A;  1YG2 A;  1FOW A;  2LR8 A;  1B6A A;  2LY2 A;  3DXJ F;  3P9I A;  5BPD A;  3FM3 A;  2QEN A;  3FXQ A;  4P9F A;  5D5W B;  1H0M A;  1W7P A;  3AL0 B;  1SEU A;  4MQV A;  2R0Q C;  2BHY A;  4A6D A;  2DI3 A;  2ZME A;  3F21 A;  2HOS A;  1G3T A;  5C4J J;  2WB1 N;  2IGN A;  1KQ0 A;  2DMN A;  4B48 A;  2W1O A;  4RAG A;  1SVO A;  3W2A A;  5F0C A;  2JUC A;  4I76 A;  2EIJ H;  1V5F A;  4Y7N J;  2Q0O A;  4B4C A;  1I5Z A;  2Z9O A;  3HOW J;  2M7A A;  3MVP A;  4CA0 A;  4UVA A;  2ZXH A;  3FKI J;  4M72 A;  1YO5 C;  3J7A O;  3TOB A;  4D7N A;  2XF6 A;  5CVJ A;  3IKT A;  1FP1 D;  1X1P A;  2JA8 J;  3I4N J;  1JHF A;  3EET A;  5ILS A;  1KYW A;  3HBL A;  1MND A;  1FY7 A;  1QRY A;  1VI0 A;  5FKN A;  4XRM A;  2PN6 A;  2JA5 J;  1H9G A;  2QGU A;  1BIB A;  2LVS A;  4FHT A;  1G3S A;  1BR1 A;  1TNS A;  3BTJ A;  2A6H F;  2X51 A;  2ZC2 A;  3HB9 A;  4BE0 A;  4A12 A;  4R8H A;  5F27 A;  3JTH A;  2W84 A;  3B73 A;  1UMQ A;  5LEK A;  5LGU A; 
#chains in the Genus database with same CATH homology
 3BPX A;  5HOO A;  4MHG A;  4EQQ A;  1O3T A;  2H09 A;  1PP8 F;  1O3S A;  3I4P A;  2DBB A;  2A68 F;  3G73 A;  5LEJ A;  4I2O A;  1IAW A;  2MA3 A;  2QVO A;  1AOY A;  1GXQ A;  3I71 A;  1OYI A;  4LK1 F;  4OMY A;  1K78 B;  3TO6 A;  1WSU A;  3KEQ A;  4U0W A;  3IKV A;  2FSW A;  2PLY A;  3C7J A;  2F5F A;  3QP6 A;  1ZRE A;  2ELH A;  4L9V A;  2MC3 A;  2EFP A;  1B59 A;  1ZG3 A;  2YU3 A;  3VOD A;  4M6Y A;  4LG0 A;  2EWN A;  2A6E F;  4LLG F;  1XGO A;  1FOK A;  1BI2 A;  3GX4 X;  1JHH A;  1D8J A;  1YQA A;  3SZP A;  3GZ5 A;  2W25 A;  2E1C A;  1W5S A;  2OZU A;  2UXN A;  3R6S A;  4P96 A;  1CGP A;  1ZYR F;  4EGZ A;  2HFH A;  2RC4 A;  1TTY A;  3R60 A;  1ZGA A;  3FMQ A;  1LDK B;  2G9W A;  3CUO A;  3R0A A;  3ML6 A;  3KP3 A;  2F5D A;  2DPD A;  3F8C A;  1RZ4 A;  3T5X A;  5FFX A;  5EEG A;  4LFU A;  5D4S A;  2K02 A;  2FBH A;  2LF8 A;  3L00 A;  3RDI A;  4RGS A;  1FP2 A;  2C6Y A;  5LBQ A;  4HV5 A;  2GA1 A;  2KIF A;  4M9S A;  2V79 A;  3BPV A;  2JZY A;  3E6B A;  3PQJ A;  2D1H A;  3V7R A;  4AIK A;  5IT9 K;  2PMH A;  4CXF A;  2EV0 A;  2P5L C;  3HRS A;  2NNN A;  2JSC A;  4EJW A;  3DEU A;  3SHF A;  1W7P D;  3DFG A;  4ZYG A;  1RI7 A;  4KIG A;  5CVR A;  3T8T A;  1I27 A;  4RAZ A;  4G9Y A;  2HDC A;  4H0E A;  4ASN A;  3WGG A;  3J81 K;  3VFZ A;  3GFI A;  1QBJ A;  2IPQ X;  2YPR A;  1FLI A;  1QZZ A;  4KIB A;  1XSD A;  5FLX Z;  1R36 A;  4G7Z F;  5CVI A;  1FSH A;  2ISZ A;  4O3M A;  3RKX A;  3V7C A;  1FZP B;  3I54 A;  1YS7 A;  4P55 A;  3DP7 A;  2HTS A;  1BOA A;  2IVM A;  2WV0 A;  2A3S A;  1FNN A;  2GWR A;  4IHT A;  5E17 F;  1Z7U A;  1BC7 C;  1DUX C;  4EV0 A;  2EFW A;  2WWY A;  3ZMZ A;  5HDK A;  1XDU A;  4L0Z B;  2HQR A;  4I09 A;  3NRV A;  4UV8 A;  3L7W A;  5LHG A;  1IN5 A;  4YFX F;  2JPC A;  3HSR A;  4B8X A;  2FE3 A;  2E7W A;  4BHB A;  3BRO A;  4ENK A;  5DEQ A;  2EFQ A;  1J59 A;  1XGS A;  2PMU A;  3LQR A;  1XGN A;  4A2U A;  4G6D A;  3WTX C;  1R22 A;  2BV6 A;  2K4J A;  3TGN A;  3T0Y A;  4CO8 A;  2DW4 A;  2P8T A;  4LMY A;  3ABU A;  3IHU A;  4RGX A;  5FB2 A;  1QPM A;  1ZHF A;  1IN8 A;  3RI4 A;  4UHT A;  3QOP A;  2D2W A;  3EUH A;  5AON A;  1E17 A;  3KEO A;  2XVC A;  1S8N A;  4GXO A;  4HX8 A;  2IA0 A;  1KQ9 A;  3JAM K;  1IRG A;  1YW8 A;  2IJL A;  1SD7 A;  4EGY A;  1QZY A;  3ELK A;  1MZB A;  3TO7 A;  1XCB A;  1FYL A;  3REO A;  1LEA A;  4DQ2 A;  1LQ1 A;  5CLS A;  2QQA A;  2UWM A;  5D4R A;  1Z6T A;  2FU4 A;  3GEZ A;  3KP2 A;  2F2E A;  5HDN A;  5K5Q A;  5TRD A;  3C1D A;  2GIV A;  1ZH5 A;  4M71 A;  5BPI A;  3G3Z A;  2VOO A;  4JBA A;  3L2C A;  1IUY A;  1U5T A;  3QU6 A;  3WE3 A;  3D5L A;  2QQ9 A;  3K1P A;  3LQQ A;  3ECH A;  1YLF A;  4P9U A;  4LB5 A;  5DD4 A;  5LGT A;  5ERI A;  4R1H A;  4YII A;  4B09 A;  4A0Y A;  2FNP A;  5D5V B;  4LG0 B;  1HSJ A;  2H6B A;  2A07 F;  1BN5 A;  2FRH A;  1J5Y A;  4NHJ A;  2G7H A;  1R23 A;  1B9N A;  1MKM A;  1SD4 A;  2CQK A;  2NAZ A;  4HX4 A;  4A5N A;  2V9V A;  1UFM A;  3TKY A;  1G3W A;  5H20 A;  3N97 A;  1RNL A;  1F5T A;  5LLQ A;  5FFZ A;  1UHW A;  5HLG A;  1TNT A;  1WQ2 A;  4QLC U;  3E3V A;  1D8K A;  3M1E A;  4FT8 A;  2D45 A;  2BGC A;  2ESH A;  1A04 A;  2M5W A;  2RV8 A;  1HST A;  2MLK A;  5A2Q K;  2OQR A;  2EA2 A;  1HQC A;  1U78 A;  1F4K A;  5ILU A;  5KK1 A;  4BXU A;  2J5P A;  3VB2 A;  1XD7 A;  2YR2 A;  4RB2 C;  5DUI A;  1O3Q A;  2FOK A;  1F9N A;  4IRG A;  3ZPL A;  1UCR A;  4I0A A;  4L9T A;  3SXY A;  1CF7 B;  1ZGJ A;  4GGG A;  4ZZL A;  1K6O A;  2WTE A;  2XKO A;  4HYE A;  1H9T A;  3KZZ A;  4PZJ A;  5L3F A;  4U0Y A;  3TDZ C;  2GZW A;  3SFZ A;  1S3J A;  2XHK A;  3ZN0 A;  4UNO A;  2PFB A;  4A0Z A;  4RAY A;  2XUB A;  2HGC A;  4MTE A;  5LHH A;  1BJA A;  1SFX A;  1YIO A;  1V4R A;  4N0B A;  3KET A;  3RKW A;  5D8L B;  4ESF A;  1P92 A;  4M73 A;  3ZMS A;  1ON2 A;  1MJB A;  4LLL A;  2ADU A;  2OAZ A;  4U7D A;  2RDP A;  4IRI A;  5HDG A;  3ZMT A;  4O5V A;  2LNB A;  1TW2 A;  3RIR A;  1TBX A;  2P5V A;  1J9I A;  1KU7 A;  2VBW A;  4KMU X;  5H6Q A;  2VXZ A;  4KN4 X;  2MD5 A;  2LDU A;  4EJO A;  3RYP A;  4F7Z A;  3I59 A;  2OD5 A;  3KE2 A;  3H3Z A;  5JR3 A;  2Y48 A;  2H6C A;  2CFX A;  5CYV A;  5ICE A;  3MFK A;  2K4B A;  4L9J A;  3MZH A;  2EFO A;  5LRS A;  2RQP A;  3W6J B;  3BZ6 A;  1Z9C A;  4FX0 A;  3ABT A;  3EYY A;  1D5V A;  1EV7 A;  4I01 A;  4RB0 A;  3E6D A;  2NS0 A;  4XLP F;  2YX4 A;  4ENN A;  2FA5 A;  1SAX A;  1YTY A;  4MGR A;  3IRR A;  1P4W A;  2DO7 A;  3ERE D;  3DQV C;  5EEH A;  2P6S A;  4N9I A;  1XMA A;  3WOD F;  2ACJ A;  4ZYE A;  3E6M A;  2V1X A;  1O57 A;  4Q47 A;  3HOT A;  2M30 A;  3W6K B;  3J80 Z;  2DT5 A;  3WE2 A;  4G8X A;  4CIC A;  3FXR A;  3LAP A;  2ZNY A;  1KA8 A;  4ENM A;  1MJ9 A;  3R61 A;  1S6L A;  1EH6 A;  3I64 A;  5E8G A;  3F6O A;  1QNT A;  3I53 A;  4Z2Y A;  3U9G A;  1ZRF A;  2HKO A;  3MZY A;  3E97 A;  1SFU A;  1LVA A;  4KN7 X;  4M9X A;  3M7G A;  3CO6 C;  5CVU A;  3VOE A;  4KMF A;  3HTU A;  4KUM A;  4MEX F;  2L54 A;  5JHU A;  4JK1 X;  1HKS A;  5J8F A;  5DV5 A;  4EMS A;  3FZV A;  3OOP A;  2M45 A;  1QQI A;  1ONV A;  1LNW A;  5LGN A;  4LGW A;  1ZLK A;  2IW5 A;  1TQI A;  2DQR A;  4HV6 A;  1SD5 A;  3CLO A;  2JT1 A;  1DP7 P;  1STZ A;  4CYD A;  3HUG A;  1YW9 A;  1W5T A;  3ZQ7 A;  1MDM A;  4Q48 A;  4BYY A;  3QPT A;  4L9N A;  5KVR A;  5CJ9 A;  2DTR A;  5H6R A;  3H92 A;  2HS5 A;  2VT3 A;  2X4H A;  3C3W A;  2ZXJ A;  4Y15 A;  3HSF A;  1MGT A;  2M8E A;  2F5E A;  5AIQ A;  3QPH A;  4OOI A;  2HYF A;  3MQ0 A;  1SMY F;  3JSO A;  4KIF A;  3QAH A;  1OYY A;  1W4M A;  2XAS A;  3L9F A;  3WTW C;  2STW A;  1GXP A;  2VON A;  2PI0 A;  4Q5S F;  1WI9 A;  1T2K A;  2FMY A;  1IN7 A;  5BS6 A;  2VE9 A;  1ZAO A;  4XSZ F;  1X3U A;  5CVV A;  3O3K A;  5IT3 A;  1GVJ A;  4BHP A;  2MBF A;  2CGP A;  4YG2 F;  4YIF A;  4Y13 A;  3LA7 A;  1SMT A;  4KFC A;  3CUQ C;  5HS8 A;  3WU1 B;  2QYO A;  3BJO A;  2RNJ A;  3QP5 A;  4EM0 B;  1WWX A;  2OBP A;  2GA2 A;  1R1T A;  3RJP A;  3GWZ A;  4JQF A;  4ZZD A;  2VOD A;  1G4D A;  4WK8 F;  4NB5 A;  3EYI A;  2Z5U A;  3C18 A;  4PCQ A;  2ZNZ A;  3HRM A;  2VT2 A;  5E1Z B;  1IN4 A;  5E1W A;  2GXG A;  4OU0 A;  4HQE A;  1KU2 A;  5FGM A;  1U2W A;  2RN7 A;  1UST A;  2L02 A;  4G7O F;  3S2W A;  1OKR A;  1XMK A;  5F1R A;  4ESB A;  4LK0 F;  1FT9 A;  1XB4 A;  4RGU A;  2NYX A;  4I02 A;  1FSE A;  5F64 A;  2XAG A;  2BYV E;  3KZY A;  2ZFW A;  2IP2 A;  2UXX A;  5HLI A;  3N4M A;  4OMZ A;  4Q4Z F;  3M9A A;  4IF4 A;  3F23 A;  3FM5 A;  1AWC A;  1P4X A;  2V1U A;  3HHH A;  2A5Y B;  4WXC A;  2EFN A;  4HW0 A;  5BQT A;  2RVC A;  2Z33 A;  5AIP A;  3SQN A;  3ULQ B;  1W7P B;  2HQN A;  2ZME B;  3GW2 A;  1R58 A;  2P7V B;  4U88 A;  1BI3 A;  3F8B A;  3KP6 A;  3V7S A;  5L3E A;  3L09 A;  1IF1 A;  4S05 A;  2FF4 A;  3BWG A;  5IT9 Z;  1HW1 A;  1ZN2 A;  4HDU A;  2R3S A;  3E5U A;  2G7U A;  3LAJ A;  3TO9 A;  3F3X A;  1V3F A;  2M1B A;  2DK8 A;  4HBL A;  1REP C;  2FQ3 A;  1XSV A;  3J81 Z;  3LA3 A;  1OMI A;  4CGZ A;  2NNY A;  2OU2 A;  3KLN A;  1B4A A;  2E7X A;  2BBY A;  2V1D A;  4E70 A;  1U6G A;  3MCZ A;  2QUF A;  1K78 A;  4HX7 A;  4LB6 B;  5JI6 A;  1EH7 A;  4AIJ A;  4EM2 A;  5DCM A;  3FMS A;  1E2X A;  1KU9 A;  4OIP F;  2QBY A;  4U0V A;  1WKM A;  3HRT A;  1QGP A;  5E8I A;  4RB1 A;  2RGV A;  1G6N A;  3KFW X;  1LDD A;  3FWE A;  1XN7 A;  2ZBK A;  3GYH X;  2MLG A;  4ZYD A;  4ZH4 F;  3V8K A;  4HAM A;  1DPU A;  3F8M A;  1L0O C;  2ZO4 A;  1LB2 A;  4WF2 A;  2IA2 A;  2QQB A;  4RGR A;  2HTJ A;  3MWM A;  4M6X A;  5L3G A;  3BY6 A;  1I1S A;  2QLZ A;  3B02 A;  3ZP5 A;  1YS6 A;  1R5G A;  4KA4 A;  3P7N A;  2COM A;  2Z99 A;  3I0T A;  4OIN F;  2O3F A;  3O6B B;  5JVT A;  1D3Y A;  3HHG A;  1R1V A;  2RKH A;  1RUO A;  3JAM Z;  2EV6 A;  1C0W A;  4RS8 A;  3MEX A;  4KNY A;  4WWC A;  4ETS A;  1YW7 A;  1PDN C;  2X0L A;  2Z3Y A;  4HLX A;  1BIA A;  2CYY A;  1JGS A;  3WGI A;  4LD5 A;  1T98 A;  1DDN A;  2VOP A;  4UXN A;  2CWE A;  2BEO A;  2HOE A;  2W85 A;  3HIF A;  2HKX A;  3FX3 A;  3IWZ A;  3HYI A;  5D6F A;  3GXO A;  3TOA A;  2DU9 A;  1IXC A;  1HKQ A;  1S29 A;  3U1D A;  3DPT A;  1FWZ A;  2CO5 A;  2O61 A;  5D5X B;  1RUN A;  5ED4 A;  1MJA A;  3V8J A;  4HF0 A;  4L5J A;  4EJV A;  1VTN C;  4KT5 C;  1XGM A;  3GO5 A;  3LWF A;  2R7F A;  3F6V A;  2Q2E A;  2JRT A;  4WXD A;  2YSR A;  3M8F A;  5DD8 A;  1HKT A;  2FNA A;  1JE8 A;  3DKW A;  2EK5 A;  2D1V A;  4A5M A;  3D0S A;  3ZMU A;  5BOX A;  4DNC A;  3GLX A;  3WG9 A;  2HEO A;  3QRF F;  4KDP A;  4L0Y B;  4UVC A;  4I0B A;  1FYM A;  1J0R A;  4I98 B;  4RB3 C;  2IRF G;  3U2R A;  4HF1 A;  2L4A A;  5A2Q Z;  4YFN F;  1ZRD A;  4EJU A;  2PEX A;  4BH9 A;  2QM3 A;  3JW4 A;  3K1N A;  4A0X A;  3CUQ A;  1F1Z A;  2QZ8 A;  2OZ6 A;  5TJJ A;  2FBK A;  3HOS A;  2DAO A;  3IL2 A;  2OA4 A;  2E1N A;  2EB7 A;  2DFI A;  3TDU C;  1FBS A;  1IN6 A;  3QU3 A;  3CTA A;  2DLL A;  3CO7 C;  5LHI A;  4A6E A;  1TW3 A;  3JSP A;  1ODD A;  1R5H A;  1FX7 A;  1IXR C;  2XV4 S;  3ZN1 A;  3NQO A;  4NQW A;  1B9M A;  4BNC A;  2M87 A;  2DQL A;  2GQQ A;  3F8N A;  5E20 A;  3PFI A;  4HDV A;  1IRF A;  4EJT A;  3WTT C;  2L3D A;  1Z6R A;  4TV7 A;  2PG4 A;  1PP7 U;  2UZK A;  4BHC A;  4S04 A;  1O7L A;  2F5C A;  4IJA A;  3F22 A;  3P9K A;  3SZT A;  3WTV C;  1L3L A;  1ZG5 A;  2L01 A;  1Z05 A;  1U3E M;  3LST A;  2YX7 A;  4KYW A;  3GUD A;  2EV5 A;  1LDJ A;  2LSO A;  4HLY A;  1K79 A;  4IRH A;  1IZ1 A;  5K5R A;  2FBI A;  1U5T B;  3HSE A;  3ECO A;  3DV8 A;  5DCM B;  1WRJ A;  1UB9 A;  5L3D A;  4HA8 A;  5DDG A;  2LKP A;  4WCG A;  2QBY B;  2EJR A;  4UUV A;  1T0F A;  2AS5 F;  4EM1 A;  3BP8 A;  2ESN A;  3WTS C;  5ICG A;  3FMR A;  2HWV A;  2VC1 A;  2CG4 A;  2DPU A;  3M8E A;  3WTU C;  1ZAR A;  3BDD A;  4GYI A;  5FLX K;  1K7A A;  5E18 F;  4GYG A;  3K2Z A;  4LJZ F;  5HVQ C;  2WC2 A;  1YYV A;  2W24 A;  4QWQ A;  4MQ9 F;  2Y75 A;  2KJB A;  3H3U A;  3E5Q A;  2FEZ A;  5ILV A;  3BJ6 A;  3ISP A;  4XBF A;  5J6X A;  1U8R A;  1FBQ A;  2VBX A;  2XAF A;  1UHM A;  1MD0 A;  4MTD A;  5HLH A;  3HTS B;  2STT A;  2KIM A;  3KLO A;  3ZMD A;  4UVB A;  2ZKZ A;  3TQN A;  3WU0 A;  2QWW A;  1Y0U A;  3F8F A;  1BC8 C;  1KU3 A;  2P4W A;  2XIG A;  3K69 A;  3NEU A;  4K2E A;  3I58 A;  3FF5 A;  1O7F A;  1IW7 F;  3I5U A;  2Q8K A;  5LRR A;  1YFH A;  1DPR A;  2ZCW A;  1HW2 A;  1BI0 A;  1T38 A;  1FYK A;  2R7D A;  4O6J A;  4PDK A;  1CF7 A;  3T8R A;  2J5O A;  2P7C B;  1I1G A;  1OYW A;  3GF2 A;  2XKP A;  3V8L A;  2OQG A;  3K0L A;  4IXA A;  1P6R A;  2BE5 F;  2XGX A;  3F72 A;  2P6T A;  1T39 A;  5F6F A;  1J7K A;  1Z1D A;  3T1B A;  2H94 A;  4D0P A;  1TQP A;  3RYR A;  4BQA A;  2MH2 A;  2HZT A;  3K1M A;  5HS7 A;  3WTZ A;  1R00 A;  4N9H A;  2O8X A;  3EDP A;  2ZJ2 A;  2XRN A;  4CDG A;  4YFK F;  1R1U A;  3LA2 A;  1XCV A;  3LFK A;  3I59 B;  4L5I A;  1USS A;  4M9Z A;  1G3Y A;  1XDS A;  4IPA A;  3AAF A;  4G6Q A;  3R0J A;  1B1B A;  2VN2 A;  4G7H F;  4GO1 A;  3Q9V A;  2XAJ A;  1ULY A;  2GXB A;  4CZZ A;  5DCF A;  1HW5 A;  5FO5 A;  2A69 F;  1FPQ A;  1Q1H A;  4WX9 A;  4P5O A;  1BI1 A;  4XSX F;  1O3R A;  2VBY A;  2IT0 A;  3O2P E;  5BMZ A;  2PBI A;  3CUQ B;  4BAY A;  4ENJ A;  3WGH A;  1IXS B;  5FD6 A;  4AD9 A;  2ETH A;  2K86 A;  2Y0M A;  2K27 A;  3RTR A;  3E5X A;  3K9T A;  3IC7 A;  4AVP A;  2CW0 F;  4R79 A;  4OIR F;  1QO0 D;  1P2F A;  5E1X A;  5K1Y A;  3EQL F;  4HQM A;  5FD5 A;  3CJN A;  2EA4 A;  4ZYH A;  3HRU A;  2B0L A;  3V4G A;  1BM9 A;  1ZG1 A;  2CSO A;  3COA C;  4XRF A;  1LEB A;  5L3C A;  1OR7 A;  5D6E A;  2K7L A;  1KQ8 A;  4ON0 A;  4MNU A;  1SFE A;  3KCC A;  4FX4 A;  2VE8 A;  3GVA A;  4IHS A;  4OIO F;  2HYG D;  1J2X A;  1KGS A;  1RIO H;  3RKY A;  4AIH A;  3KP7 A;  1R7J A;  4HOB A;  3GFL A;  3DPL C;  2NRA C;  5ICC A;  1S7A A;  1J75 A;  4AWX B;  2IA1 A;  1S7O A;  3IWF A;  1SD6 A;  3WTY C;  3VEP A;  3ROU A;  4XLN F;  3DF8 A;  5D8K B;  2O0Y A;  4ESJ A;  3GFM A;  5D5U B;  3P9C A;  2XAH A;  3RPU A;  1HBX G;  1BBY A;  2KKO A;  3GZ6 A;  1MDM B;  4GCV A;  4MEY F;  2VC0 A;  4HZF A;  6PAX A;  4Y17 A;  4PGH A;  2LF7 A;  4CHU A;  2KRF A;  3BJA A;  3MAJ A;  3R4K A;  2KIU A;  3Q5F A;  1GHC A;  3JTG A;  2L4M A;  5ICF A;  4G94 A;  4U7B A;  4OIQ F;  1OPC A;  2V6C A;  2MH9 A;  3ZMV A;  1FC3 A;  2XAQ A;  1P4A A;  2PJP A;  3BOQ A;  1ON1 A;  4M74 A;  1Z91 A;  4HF2 A;  1PUE E;  1TQM A;  1NHA A;  4LLN A;  2A61 A;  2P5K A;  4L18 B;  2DK5 A;  1LJ9 A;  3CDH A;  2XRO A;  3KP5 A;  3RPQ A;  3FHZ A;  3PQK A;  1ZRC A;  1KYZ A;  5DUK A;  5JFR A;  1TLH B;  3J80 K;  5HS9 A;  1XSX A;  2O6G E;  1FBU A;  5J8C A;  2TDX A;  1ZLJ A;  2W57 A;  2O03 A;  5K5O A;  1EH8 A;  1I6X A;  2VBZ A;  3KP4 A;  4PGG A;  1JXS A;  2JPB A;  2HR3 A;  4KIC A;  2H27 A;  2GAU A;  4IVN A;  4I7H A;  2KJC A;  2AXL A;  5DYM A;  4UV9 A;  4EVI A;  5L3B A;  2JTV A;  3IRQ A;  1HXD A;  3Q9S A;  2FXA A;  2FML A;  4WXH A;  3OV8 A;  3E6C C;  2PQ8 A;  3FXU A;  1T6S A;  2ISY A;  3GFJ A;  1U5T C;  1YG2 A;  1B6A A;  3DXJ F;  3P9I A;  5BPD A;  3FM3 A;  2QEN A;  3FXQ A;  4P9F A;  5D5W B;  1H0M A;  1W7P A;  4MQV A;  4A6D A;  2DI3 A;  2ZME A;  3F21 A;  1G3T A;  1KQ0 A;  2Q0O A;  1I5Z A;  2Z9O A;  4UVA A;  4M72 A;  1YO5 C;  3J7A O;  3TOB A;  5CVJ A;  3IKT A;  1FP1 D;  1JHF A;  3EET A;  5ILS A;  1KYW A;  1FY7 A;  2PN6 A;  1H9G A;  1BIB A;  4FHT A;  1G3S A;  1TNS A;  2A6H F;  4A12 A;  4R8H A;  3JTH A;  2W84 A;  3B73 A;  5LEK A;  5LGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...