5BMZA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 24mer dna.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 24mer DNA.
rcsb
source organism Acinetobacter baylyi (strain atcc 33305 / bd413 / adp1)
molecule tags Transcription
molecule keywords HcaR protein
total genus 42
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5bmzA00
3IHUA 4IJAA 2HEOA 1NHAA 1FP1D 1FYLA 4IRIA 3B02A 5AIQA 4M9SA 2V6CA 3B73A 2ZMEA 3R61A 2EFOA 2HTSA 5CVIA 3O6BB 5L3DA 4BHBA 1HW2A 3MEXA 4NHJA 2RN7A 4ENKA 3LSTA 3RPUA 1BI2A 5H6RA 3WTTC 1R23A 4ENNA 3P7NA 1YS6A 4D0PA 4XLPF 2Z5UA 3H92A 2GQQA 2R3SA 1YYVA 4KFCA 3RI4A 1LDJA 3WTYC 3GUDA 2OD5A 4HA8A 2YSRA 2CO5A 2W57A 3DEUA 2XAJA 3TO7A 4BHPA 2O8XA 4HX4A 3E6CC 3HSFA 4YFNF 3L2CA 5LRSA 2H6CA 5D4RA 4OIPF 2HWVA 4O6JA 2VONA 2QLZA 2E1NA 5ERIA 1E2XA 2IPQX 2MH2A 3EUHA 3R6SA 4Y17A 4I09A 4LJZF 3I5UA 1IN8A 4IRGA 4L9NA 4HOBA 4HQMA 1U78A 3WGGA 1W5SA 2YX7A 2H94A 1J7KA 1SD5A 4B8XA 4AIKA 4O3MA 3T0YA 4MTDA 2MLKA 3DPTA 1T6SA 5J8FA 1B6AA 3Q9SA 2OZ6A 1O3RA 4KYWA 1BC7C 3DXJF 1VTNC 4EV0A 1QPMA 1W5TA 4MEYF 4WXHA 4AVPA 1YIOA 4HZFA 3KE2A 2DBBA 5K5RA 2DFIA 4N9HA 1SMYF 3F3XA 3LFKA 2FBKA 2H6BA 2LF8A 2Q0OA 3WTVC 3LA3A 4EGZA 2EK5A 4IVNA 2QVOA 3LQQA 5K1YA 3RKYA 3QRFF 2PN6A 4BH9A 3N4MA 2G7HA 4QLCU 1HKQA 2DPDA 3WE2A 3R4KA 3JSOA 1BOAA 1U5TB 3GZ6A 4EJVA 4LG0A 1LJ9A 2EA2A 1KQ0A 2V1UA 1AOYA 1KU9A 1EH8A 4GO1A 2VOOA 2HKOA 1OMIA 2WTEA 5KK1A 1OYYA 4ENJA 1O3QA 1QZYA 4I98B 5HVQC 4KDPA 3RIRA 3HTUA 2GZWA 5HDNA 2HQNA 2BV6A 1G3YA 2A5YB 1V3FA 4N9IA 5DCMA 5CJ9A 1Q1HA 2ELHA 2VT2A 1WRJA 4M74A 1T39A 1SFEA 1J59A 3E5XA 1KYWA 1RZ4A 3ABUA 2YR2A 1R1VA 1YLFA 2BYVE 2UWMA 1HKTA 4KIGA 2D1VA 2DT5A 2F2EA 2ETHA 4CYDA 3QP5A 1CF7A 2XAQA 3K1PA 2O3FA 3V8LA 1ZREA 4LB5A 1MDMB 4EMSA 1BC8C 1P6RA 4I0BA 5LGNA 3C3WA 3LA2A 1FX7A 1PDNC 3I54A 4LD5A 3CUOA 3WGHA 3SHFA 2GAUA 2H09A 1U8RA 3P9IA 4A5MA 2FF4A 2HDCA 1R5HA 2K02A 2HZTA 2LSOA 1J0RA 3L00A 2P4WA 4M6YA 3KCCA 1F4KA 3IRQA 3QU6A 3IRRA 3SXYA 1G3TA 2F5EA 4L5IA 4P9FA 5E1ZB 1ZH5A 1OYIA 3F8CA 1CGPA 2OBPA 5ILSA 2L54A 4TV7A 3F6VA 3HTSB 1J75A 4L0YB 2O6GE 2K4BA 4Q47A 5JR3A 2P5VA 2XHKA 5HOOA 2E7XA 3JW4A 4OOIA 2QQ9A 2F5CA 5DD4A 3KEQA 1LDKB 2MA3A 5HLIA 4I2OA 5FFXA 4UUVA 5BOXA 4P55A 2A69F 1AWCA 5FO5A 3ZMTA 2ISZA 2QZ8A 3RKWA 3R60A 4GYGA 2COMA 3I59A 5CYVA 4RB1A 2P8TA 4U88A 4CO8A 3JSPA 1YW9A 3KEOA 2DLLA 2EJRA 2W84A 2PG4A 5HLHA 4JQFA 3PQKA 4MHGA 1WQ2A 4HW0A 5D5UB 4YIIA 4A0XA 1RI7A 2PQ8A 3ZN1A 1BIAA 1I1SA 2MD5A 2IJLA 5FD6A 4XSZF 3V7CA 2PFBA 4S04A 4LK1F 3VB2A 2VC1A 2P6SA 2IVMA 3WU0A 2LNBA 3CDHA 4P9UA 3LAJA 2ZCWA 1K78A 4KMFA 4KN4X 4ASNA 2IRFG 3P9CA 2DI3A 4Y15A 4A0ZA 1XMAA 3M8EA 2A07F 1FYKA 4KT5C 1ZRFA 4KUMA 1TLHB 1Z6TA 3FMRA 2EFQA 1XCVA 3RDIA 1O7FA 3ABTA 4S05A 2IA2A 4DNCA 4KIFA 1UHMA 2HTJA 2ZKZA 4LFUA 3MZHA 3U2RA 2M1BA 3IWZA 2OU2A 2PJPA 4UXNA 4AWXB 2A68F 1QBJA 1HSTA 3IC7A 2OQGA 5ICCA 3WTXC 2LDUA 3I64A 5HDKA 2FBHA 5JVTA 1IN4A 2ZJ2A 1BBYA 5AIPA 2Y48A 4ZYEA 2TDXA 1O7LA 4U7BA 1QNTA 4ZZLA 2VOPA 2KRFA 1IN5A 2VBWA 3ERED 4FHTA 3K2ZA 1FT9A 3F22A 3KP2A 3WTUC 5HS8A 2HFHA 4OMZA 1UB9A 5L3CA 5LHIA 2XASA 5DUIA 3V7SA 2R7FA 3CUQB 4L0ZB 1D8JA 4N0BA 5DD8A 3I4PA 4P96A 4CXFA 1TBXA 1IW7F 2D1HA 2VN2A 1HW5A 1O57A 4CDGA 3O3KA 3ZMZA 1S29A 1KGSA 1R1UA 2W24A 5TJJA 2P7VB 5D4SA 5F64A 3E5UA 5IT9Z 3CO7C 1T0FA 4KNYA 3CO6C 5FLXK 3T8RA 5D6FA 2ZNYA 1YFHA 4BNCA 3BJAA 1D3YA 2ZXJA 3KP5A 5DEQA 1ON1A 4IRHA 1IUYA 3ZQ7A 2KIMA 5ICEA 1LNWA 1W7PA 3GF2A 1YTYA 4G7OF 5TRDA 3WTSC 3RPQA 2HGCA 3H3UA 4QWQA 2NS0A 1ZG1A 1FBQA 2STTA 1TNTA 2QBYA 5LGUA 2E7WA 5FGMA 4G94A 3RYRA 3ZN0A 4WCGA 4RGUA 4YIFA 2V1DA 4LK0F 1XD7A 4JBAA 4UHTA 4OU0A 3WU1B 1XSDA 3W6JB 3HSRA 3F23A 1RIOH 1JGSA 3NQOA 1B9MA 4LLGF 1MJAA 4HBLA 1KU2A 2R7DA 4HLYA 3GZ5A 5CVRA 1FC3A 1HQCA 1HBXG 1DPRA 2CQKA 1BM9A 1MJ9A 2ZMEB 3TQNA 2X4HA 1T2KA 1MZBA 3GX4X 1LQ1A 1ZHFA 3GYHX 4XRFA 1JE8A 1I1GA 3E6BA 1WKMA 1I6XA 3GLXA 2Y0MA 2FMLA 4R79A 2DTRA 2FU4A 5HS9A 4M73A 2JPBA 3GFIA 2PI0A 4KIBA 2MLGA 3C1DA 1YO5C 4RAYA 3BDDA 1OPCA 4Y13A 1S7OA 4EGYA 3DPLC 5FLXZ 2WWYA 1HXDA 5LBQA 2HKXA 2RDPA 5ILUA 1K6OA 3TDZC 3F21A 1RNLA 4LMYA 2ZFWA 2GWRA 2V79A 4ESBA 2BBYA 5IT3A 1LEBA 4AIHA 2EWNA 1USSA 4ZYGA 1R58A 4A5NA 3GW2A 3HIFA 3BPVA 1P92A 1LEAA 3BP8A 1BI0A 5D5VB 3IKTA 5D5WB 4G7ZF 2VBXA 1RUNA 5E8GA 2JRTA 5KVRA 4M72A 1YW8A 3TGNA 3GFLA 3K9TA 5ED4A 2EV0A 5FB2A 4MQVA 4HYEA 3QP6A 3RJPA 4L9VA 1TW3A 1HW1A 3QPHA 3M9AA 3TDUC 5JFRA 1QO0D 2P6TA 3TOBA 3KETA 3BY6A 1Z05A 4ESJA 3BWGA 3FF5A 2JPCA 3COAC 4EVIA 2CYYA 1IAWA 2RC4A 3WTZA 2CWEA 3CUQC 2X0LA 3VEPA 3I59B 2E1CA 2K27A 1XSVA 1R5GA 2STWA 2LKPA 1W7PB 1XGOA 5EEGA 5DV5A 1JXSA 1ZLJA 4EM2A 1RUOA 3R0AA 3MAJA 4U0YA 3FMQA 1OKRA 4IHTA 1TQMA 2D2WA 4O5VA 3EDPA 4HQEA 1FBSA 4R8HA 4LLNA 1Y0UA 4HV6A 2M87A 1A04A 4G6DA 2IT0A 1ZARA 5FFZA 4RGSA 3KFWX 4A0YA 2A61A 1B9NA 4CZZA 3REOA 1ZG3A 3HRTA 3J80Z 1KYZA 4WX9A 1ODDA 3GFMA 3FX3A 1SAXA 3U9GA 2YPRA 4RB0A 1XCBA 3OV8A 1IF1A 1XB4A 3I0TA 5JHUA 4EJWA 2MC3A 1R36A 4RB2C 1J9IA 2DW4A 2G7UA 4NQWA 3WODF 2NYXA 5BPDA 3RTRA 5IT9K 4PDKA 3V7RA 3KP7A 3EYYA 1MJBA 4GGGA 4WXCA 2P5KA 1YG2A 1O3TA 2A6HF 3EYIA 2NRAC 5LHHA 3RKXA 2QYOA 1XSXA 3CLOA 4UV9A 3FZVA 5D6EA 1REPC 4WF2A 3KZZA 3D0SA 3NRVA 1ZYRF 2XAHA 3ZP5A 2P5LC 3ELKA 3I53A 4RB3C 4I7HA 3VODA 3M7GA 2H27A 4EM0B 3SZTA 3N97A 4L9JA 2UXXA 2EFWA 3KLNA 3DV8A 3DKWA 3M1EA 2DQRA 2VBZA 4HF2A 3KP6A 1X3UA 2RV8A 1QZZA 2ACJA 1FBUA 4OIOF 2XKOA 2O03A 2FOKA 1SD4A 2EA4A 5HDGA 4EJOA 1FWZA 5DYMA 3FMSA 5H20A 4HDVA 4B09A 5ICGA 3H3ZA 5K5OA 1S8NA 2ADUA 3ROUA 5L3GA 1TQPA 4G8XA 3J81Z 3BZ6A 2FSWA 4M9ZA 1XGSA 5J6XA 2NAZA 4BQAA 4FX0A 2CGPA 1YW7A 1R00A 2RKHA 2L4AA 1U5TA 4FT8A 2VBYA 2GA1A 5D8LB 3D5LA 2ESNA 2M30A 1FSEA 3MQ0A 1IRGA 6PAXA 3GWZA 1G3WA 4KA4A 3NEUA 3HRUA 2KIFA 3M8FA 1PP8F 2PLYA 4ENMA 2PMHA 2L4MA 5DCFA 3ML6A 2EV6A 2J5PA 1T98A 2Y75A 4DQ2A 1TNSA 3QAHA 1S7AA 3JTHA 2GXGA 3Q9VA 3EETA 1L0OC 3CTAA 3S2WA 4YFKF 2KJCA 3RYPA 3TOAA 2XKPA 4MEXF 4JK1X 2W25A 4GYIA 1Z1DA 2VC0A 1OYWA 1H0MA 2O0YA 2OZUA 3L9FA 2ISYA 1H9GA 2HYGD 5LEJA 1CF7B 1SFUA 2FBIA 2KIUA 4WXDA 2C6YA 3DFGA 3I58A 2FQ3A 1U3EM 1XMKA 4HF0A 2QM3A 2D45A 1QGPA 2VODA 3SFZA 3SQNA 2FNPA 4Z2YA 3FXQA 3F72A 1XGMA 1FPQA 3HUGA 5CVUA 3AAFA 3KP3A 4KN7X 3HRMA 3TO9A 5E18F 3J7AO 3C7JA 1D8KA 2XIGA 1GHCA 5CVVA 2QQAA 2K4JA 1KQ8A 1K79A 4AD9A 3DP7A 1WSUA 4ON0A 4IHSA 3LQRA 1HSJA 2HOEA 3K1MA 1PP7U 5JI6A 4OIQF 1KQ9A 2V9VA 1T38A 4YG2F 1O3SA 1R22A 2FMYA 3DF8A 1SD6A 3T8TA 2VXZA 4LB6B 2F5DA 2P7CB 1ZRCA 1Z91A 3FXRA 4RGXA 4KICA 3QOPA 4BXUA 1USTA 1W7PD 2JT1A 1DDNA 1UFMA 4RGRA 3TKYA 4ETSA 1HKSA 1OR7A 2HQRA 3F8MA 2XVCA 2VE9A 5CLSA 1XGNA 2AS5F 4FX4A 3DQVC 1STZA 1G4DA 1ZG5A 5E1WA 4GXOA 2ESHA 1JHFA 4L18B 3K0LA 1XDSA 3T1BA 5F6FA 3CUQA 1P4AA 4U7DA 4NB5A 1ZGJA 3V8JA 2KJBA 1FLIA 1XN7A 3V4GA 3T5XA 3ZMVA 5CVJA 2IP2A 1V4RA 2CG4A 3Q5FA 4H0EA 3MZYA 2FXAA 3ZMSA 2B0LA 4OIRF 2Z9OA 2LF7A 2FA5A 3MCZA 2WC2A 1BJAA 5E1XA 3BPXA 1EV7A 4LGWA 1SFXA 3L09A 1ZRDA 2K86A 2YU3A 4AIJA 4G7HF 4LLLA 3IL2A 1FOKA 1PUEE 4HLXA 2XUBA 5E20A 3KLOA 1GXQA 2A6EF 1F9NA 2AXLA 3G3ZA 4G9YA 4ZYDA 2DU9A 1WI9A 1B1BA 4YFXF 4ZZDA 3K69A 3F8FA 1BI1A 2XV4S 2CW0F 4MTEA 5J8CA 2RNJA 2W85A 5LGTA 4U0VA 3HRSA 2JTVA 3TO6A 2XAGA 4OINF 1ON2A 1Z6RA 3JAMK 2NNNA 4XLNF 1LVAA 1FY7A 1BIBA 5LRRA 3J81K 2MH9A 3E97A 2IA0A 4ESFA 2BEOA 2HR3A 4I0AA 1J5YA 2ZO4A 3WG9A 1E17A 2DK5A 2XROA 1U2WA 3FXUA 2EFNA 4HF1A 5BMZA 3FM5A 3WGIA 5BQTA 1EH6A 2CSOA 5AONA 4L9TA 4A12A 1U6GA 4IF4A 3BROA 3F8NA 5A2QZ 2V1XA 2UZKA 1EH7A 1ZLKA 4IXAA 4BAYA 1G3SA 3HSEA 2Q8KA 3F6OA 2M5WA 3E6DA 4PGGA 2OAZA 2PEXA 1F5TA 2BE5F 5F1RA 1IRFA 5LLQA 3SZPA 5ILVA 2PMUA 4M71A 2FEZA 2OA4A 2ZNZA 2Z33A 4HDUA 1FNNA 1ZAOA 5LEKA 3I71A 1FP2A 2QENA 2JZYA 2M8EA 3F8BA 2Q2EA 3WTWC 4BHCA 4EJTA 5FD5A 1KA8A 2EB7A 3ZPLA 1TW2A 3GFJA 3PFIA 3GO5A 4EM1A 1LDDA 3GEZA 4UV8A 4M6XA 3L7WA 1FZPB 4HAMA 3CJNA 3QU3A 1ZGAA 4P5OA 4R1HA 4A6DA 4RAZA 1GXPA 1BN5A 3GVAA 4M9XA 2RGVA 2XAFA 1IN7A 1Z7UA 3VFZA 2VE8A 1F1ZA 1ULYA 5H6QA 4HX8A 3KZYA 3E3VA 4Q48A 4EJUA 2FRHA 5E8IA 2GIVA 1ONVA 3ZMDA 1P4XA 5LHGA 3IWFA 1H9TA 2F5FA 4HV5A 4UVCA 4MGRA 2MBFA 5BS6A 4E70A 2M45A 4HX7A 5HLGA 2FNAA 3G73A 2Z3YA 2WV0A 4A6EA 3P9KA 3MWMA 1DUXC 2O61A 1LB2A 4UVAA 2YX4A 4CGZA 4I02A 5EEHA 4BYYA 1J2XA 1IZ1A 3O2PE 2DO7A 1B59A 3HHGA 1BI3A 4K2EA 1SMTA 4PCQA 3IKVA 4I01A 2QWWA 2FE3A 5L3EA 1R7JA 3BJ6A 2Z99A 1TTYA 5D5XB 2OQRA 5L3BA 1L3LA 2QBYB 3HOTA 1ZN2A 4RS8A 1Z9CA 1R1TA 4UVBA 1IXSB 1SD7A 3MFKA 2ZBKA 1IN6A 4KMUX 1WWXA 5DUKA 1JHHA 4A2UA 2DQLA 3R0JA 4WWCA 4U0WA 5K5QA 1DPUA 2GA2A 1YQAA 2HS5A 1UCRA 4PGHA 4MQ9F 1G6NA 2PBIA 1GVJA 4Q5SF 3FM3A 3JTGA 1MD0A 2DAOA 3C18A 1TQIA 2QQBA 4EQQA 1KU3A 1B4AA 2CFXA 1MKMA 4CHUA 2L01A 3PQJA 2IA1A 1P4WA 3FWEA 3BOQA 2EV5A 3E5QA 4Q4ZF 4F7ZA 2KKOA 2IW5A 1K78B 2DPUA 5E17F 3WE3A 3V8KA 1DP7P 5DDGA 2G9WA 3W6KB 3LA7A 2A3SA 5L3FA 4LG0B 2UXNA 4MNUA 2XRNA 2BGCA 4CICA 3E6MA 4GCVA 1D5VA 1IXCA 3EQLF 3ECHA 3U1DA 2DK8A 3LWFA 2L3DA 2RVCA 4ZH4F 4UNOA 2EFPA 1UHWA 5D8KB 4ZYHA 2JSCA 1C0WA 1QQIA 1IXRC 2VT3A 3HHHA 5ICFA 1S6LA 3LAPA 1U5TC 5HS7A 4PZJA 3ULQB 1KU7A 3FHZA 1P2FA 5A2QK 2J5OA 2NNYA 3OOPA 1XDUA 4OMYA 2K7LA 1S3JA 1I5ZA 1W4MA 5BPIA 1I27A 3ISPA 2GXBA 1FSHA 3K1NA 4WK8F 3BJOA 1YS7A 3QPTA 3KP4A 2RQPA 3HYIA 4IPAA 3VOEA 2HYFA 1MDMA 1FYMA 4XSXF 4XBFA 3J80K 2QUFA 3ZMUA 3JAMZ 3HOSA 1K7AA 2L02A 2XGXA 3GXOA 1MGTA 3ECOA 4G6QA 4L5JA 5DCMB
chains in the Genus database with same CATH superfamily
3IHUA 2R7QA 2A05A 4IJAA 4F93B 1WJAA 2HEOA 1NHAA 4PJLA 2L7ZA 4BGDA 1FP1D 5M3MJ 2DA7A 1FYLA 1X4OA 4IRIA 4C3JJ 3B02A 3LSJA 5AIQA 2JUGA 4M9SA 2V6CA 3B73A 2ZMEA 2LRDA 4E7KA 1LFPA 1VQNI 2VXDA 3JRBA 2IS2A 3IUOA 4BBSJ 1BA5A 3R61A 2EFOA 2HTSA 3KYDB 4YRVA 2JA2A 5CVIA 2NVQJ 3ASOH 4DYQA 3O6BB 1X4PA 5L3DA 4BHBA 1HW2A 2VUMJ 4BACA 1WPKA 3MEXA 4NHJA 2RN7A 3C2GA 4ENKA 3LSTA 1CQTA 3RPUA 1BI2A 2KMUA 5H6RA 3WTTC 1R23A 2DMQA 4ENNA 4B43A 3P7NA 3DLLF 1WZ2A 2Y0SA 1VQ6I 1YS6A 4D0PA 4XLPF 4XORA 5GPAA 2Z5UA 3CCEI 3GTLJ 3H92A 3OR2C 1JKOC 3CCJI 2HOAA 2GQQA 2R3SA 1YYVA 2WAFA 4KFCA 3RI4A 1JKPC 1V5EA 2DA1A 3EPZA 1LDJA 3WTYC 3GUDA 2OD5A 1LE8B 4F91B 2BY1A 1D1BA 1QZEA 4HA8A 2YSRA 5J1UA 4JP0A 2CO5A 2W57A 2R7OA 3DEUA 2XAJA 3TO7A 3L2WA 5GAEJ 4BHPA 2O8XA 4HX4A 3E6CC 1YITI 3HSFA 2BHZA 4YFNF 3L2CA 5LRSA 1GVDA 2H6CA 5D4RA 4OIPF 2HWVA 1IV8A 4O6JA 2VONA 4IO9F 1GT0C 4DYRA 1H8AC 4BXFA 2QLZA 4OAZA 5LFAA 1XTAA 3S1NJ 2E1NA 5ERIA 1E2XA 2IPQX 2MH2A 4C9YA 4M6VA 3EUHA 3R6SA 2P81A 4Y17A 4I09A 5KNLA 1YE9A 2AQEA 1UG0A 4LJZF 3H35A 3I5UA 1IN8A 2BVMA 2CJJA 4IRGA 4L9NA 4HOBA 2OCCH 1MH3A 4HQMA 1U78A 3WGGA 1W5SA 2YX7A 2H94A 2X6YA 3MVPA 4IQ4A 4N4OB 1J7KA 1SD5A 4B8XA 3SJMA 4AIKA 3T0YA 4O3MA 2ZXIA 1IV6A 3ZQHA 1MBHA 4MTDA 2MLKA 2KHMA 3DPTA 1T6SA 5J8FA 1B6AA 3VYRB 2R7ZJ 4C2TA 3Q9SA 2OZ6A 1O3RA 4KYWA 2NOJB 1MNDA 4H4KC 2WAQN 3NWTA 1BC7C 2GM4A 3TEDA 2Y9ZA 1W36C 2DA3A 3DXJF 1VTNC 4NDLA 4DBQA 4EV0A 3UKGA 1QPMA 1W5TA 3V42A 2EIMH 1VQOI 4MEYF 4B1RA 4WXHA 3ZGKA 4AVPA 1OFCX 4QPQA 1YIOA 4HZFA 3KE2A 1FMWA 2EZKA 2IAIA 2ZMEC 3H1CA 2DBBA 3IH2A 4XLEA 2DT7B 5K5RA 2DFIA 4PK4A 1R6RA 4N9HA 5J47A 1SMYF 1HDPA 3F3XA 2O9LA 1SEUA 3K10A 4E7LA 2OC6A 3LFKA 2FBKA 2H6BA 5F04A 2LF8A 2Q0OA 3WTVC 3PO2J 3LA3A 4EGZA 2EK5A 1A6IA 3HBLA 4IVNA 1YJNI 1W0TA 1DU6A 4AYBN 2QVOA 2NVXJ 5GAGJ 1YX3A 1OCPA 3W2VA 3JR9A 3LQQA 5K1YA 3GTGJ 3RKYA 2WAEA 5B3SH 3AG2H 1X1AA 3U21A 3QRFF 2RAEA 2PN6A 3N05A 4BH9A 2CRGA 3LSMA 4PSWA 3N4MA 1Y1WJ 3BTIA 2E2HJ 1FOWA 3CCYA 2OPTA 2G7HA 4QLCU 1HKQA 2DPDA 3WE2A 3R4KA 4UB6C 4XNFA 3JSOA 3B6AA 1BOAA 1U5TB 3GZ6A 4EJVA 1JKRC 4LG0A 1LJ9A 2EA2A 1KQ0A 2M0MA 3JRCA 3ZQFA 2V1UA 3BLYA 1Z3YA 1AOYA 1KU9A 2CH0A 4NC8A 5CKTA 3AKZA 1QA6A 2KISA 1EH8A 4GO1A 2VOOA 2HKOA 2ZSIB 5JVGF 4DJAA 3HJEA 3H9JA 4BQNA 1OMIA 2WTEA 5KK1A 3BC8A 1OYYA 2ZSHB 1X3ZB 3TW6A 4ENJA 1O3QA 1QZYA 4I98B 5HVQC 2LK2A 4KDPA 2NVUB 2JA6J 3RIRA 3HTUA 2GZWA 5HDNA 2VQGA 1H89C 2HQNA 5F08A 3GTQJ 4AVZA 2BV6A 1G3YA 1K83J 2A5YB 3KX2A 1V3FA 4N9IA 4BDYA 5DCMA 2HDWA 5CJ9A 1Q1HA 2ELHA 2VT2A 1WRJA 4M74A 5B1AH 1T39A 1NK3P 1SFEA 3I3LA 1J59A 4A3KJ 2VJIA 3E5XA 1KYWA 1RZ4A 3ABUA 4MFEA 2HZDA 5IOYA 2YR2A 2AO9A 1R1VA 1YLFA 2BYVE 3Q3SA 2UWMA 2DMUA 2VASA 1HKTA 4KIGA 4IZZA 1HOMA 5C4XJ 2D1VA 2DT5A 2F2EA 2ETHA 3LSKA 2DCEA 2ID3A 4CYDA 2R7SA 1XX5A 4RMNA 2PJRB 3QP5A 3AL0B 2HDDA 4RLFA 1CF7A 1W36D 2GOXB 1WH7A 1MSEC 1OCRH 2XAQA 2AHQA 2K9QA 3K1PA 2R4GA 2O3FA 5KCMA 3V8LA 3EUAA 1ZREA 5B1BH 2OTJI 4LB5A 2MGQA 1MDMB 2G0EA 2OTLI 1FJLA 3HXLA 4EMSA 1BC8C 3CDLA 1P6RA 1S7EA 4I0BA 3WG7H 3C3WA 5LGNA 3LA2A 4RM2A 1FX7A 1PDNC 3I54A 3H36A 4LD5A 3CUOA 3LSGA 3WGHA 3SHFA 3S1RJ 2GAUA 4XL9A 2H09A 3OL4A 5JLXA 1FEXA 2HXIA 1U8RA 1S9HA 4UUTA 4B44A 2NXNB 1BW6A 2LP0A 2F4OB 2IS6A 3P9IA 4A5MA 4DGWB 2FF4A 1X2NA 2HDCA 3AG3H 3ZQIA 2CV1A 1R5HA 2K02A 2Y31A 2HZTA 2LSOA 4Y33A 5IP9J 1J0RA 3L00A 4BJTA 1JTYA 2P4WA 3MKLA 3TP3A 1HA8A 4M6YA 3KCCA 4M3DA 1VQ7I 1F4KA 1YOVB 3IRQA 3QU6A 3IRRA 2X6XA 2JWTA 2HOSA 1DP3A 2JA5J 3K70D 3OYMA 3BQYA 1G3TA 3SXYA 1HCRA 2F5EA 4L5IA 2L9VA 4P9FA 2EIJH 1MBGA 5E1ZB 1ZH5A 3G1LA 1OYIA 3F8CA 5GPCA 1CGPA 4C2UA 4A3MJ 1I39A 2OBPA 1LKXA 2JA7J 5ILSA 5K7ZA 2XGEA 4P1WA 2H1KA 4AM3A 2L54A 3BTJA 1ETQA 2XGDA 4TV7A 3F6VA 3FXKA 3HTSB 1J75A 4L0YB 2O8KA 4BE0A 4Y7NJ 2K4BA 4BY7J 2O6GE 4Q47A 1D0XA 5JR3A 2P5VA 2XHKA 4CCOA 2BHYA 5HOOA 1I3QJ 3CC4I 3FKIJ 2E7XA 3JW4A 1R71A 1PYVA 3HDDA 4OOIA 2QQ9A 3A0BC 3MKZA 2K9SA 3RPUD 4HPQA 2F5CA 5DD4A 1ETXA 3JRAA 4QTRA 4IHVA 3QOEA 3KEQA 1LDKB 2MA3A 3VSLA 5HLIA 1YJWI 4XKVA 1XG1A 4E6KG 4I2OA 5FFXA 4B47A 3FK7A 4UUVA 3QYFA 3TBIA 5BOXA 2B7EA 2XPWA 4HNVA 4P55A 1LVKA 2A69F 1Z7LA 1AWCA 5FO5A 4D1QA 2VLAA 4XK4A 3ZMTA 1WH5A 5HNHA 4LIVA 2ISZA 2XRLA 1M1EB 1W1WE 2QZ8A 3RKWA 2M3AA 3RSNA 4CSWA 3DEEA 1IDYA 2E1MB 3R60A 5IYDJ 2VB6A 3G4SI 2VJ4A 4GYGA 5B5EC 2COMA 3I59A 5CYVA 3HKZN 4RB1A 2P8TA 2VIXA 4U88A 4CO8A 3JSPA 1YW9A 3BR1A 3KEOA 2DLLA 3OWTA 2EJRA 2W84A 4G12A 2QSFX 2V26A 2PG4A 5HLHA 1U9NA 1B72B 4JQFA 3CCLI 3PNTA 2DMPA 3VSKA 1A31A 3PQKA 3ZR8X 3DBRB 4MHGA 1R4MB 4JYKA 1WQ2A 3DBHB 4BU2A 4HW0A 5D5UB 4YIIA 3CJTB 4A0XA 1RI7A 2PQ8A 1A35A 1TWFJ 4II3A 3ZN1A 1UAAA 4GDFA 1BIAA 1HLVA 1I1SA 2MD5A 3ZQLA 1Z0XA 2IJLA 2X85A 4DZPA 4D9JA 1MMGA 5FD6A 1X1BA 1ETKA 4XSZF 3DTEA 3K4CA 3V7CA 2PFBA 4S04A 4LK1F 2IBDA 3VB2A 2VC1A 5F0HA 5JLWA 3VYUB 2P6SA 2DXIA 2IVMA 3WU0A 2LNBA 2LREA 2DA5A 2EIKH 3CDHA 5KAIC 4P9UA 5IOZA 3MKYB 5J40A 3CCMI 3LAJA 2ZCWA 4CCLA 1K78A 4KMFA 4KN4X 3I55I 3BTLA 4ASNA 2ZC2A 3FXMA 1MW7A 2IRFG 2JMWA 1O4XA 3D5RC 1BOBA 2NOGA 2V1NA 2M7AA 3P9CA 3P5JA 4IX7A 2DI3A 4Y15A 1IRZA 4ANJA 2KDZA 4A0ZA 2K9NA 4XLHA 5FRMA 1XMAA 3M8EA 1LFUP 1ITYA 2ZXWH 1ETWA 3SFIA 2A07F 1FYKA 2E5ZA 1VQ4I 4KT5C 4XR6A 5GTIC 1ZRFA 4KUMA 1TLHB 1Z6TA 3FMRA 5EGOA 2EFQA 1XCVA 3OIOA 2ZB9A 2E5NA 4A3DJ 4HSRA 1NTCA 2Z2SB 3RDIA 1O7FA 3A03A 3ABTA 3FK6A 2DT6A 1Z21A 4S05A 2IA2A 4DNCA 2QKMB 4A3IJ 4XM3A 1IJWC 4KIFA 1UHMA 2DA6A 2IEKA 3NWSA 2L7MP 2HTJA 2ZKZA 4LFUA 3MZHA 3U2RA 2M1BA 3IWZA 4RLQA 4F55A 2OU2A 2PJPA 1D1CA 4UXNA 3OYFA 4E7IA 4KJZA 3DEWA 3KYLA 2OF7A 1AKHA 4BE2A 4AWXB 2A68F 3GCMA 1D0ZA 1QBJA 3ZXSA 3HGYA 1HSTA 4IHXA 2F48A 1WFXA 3M07A 3I4MJ 3IC7A 4HSTA 2OQGA 5ICCA 1X1CA 3WTXC 2LDUA 1BR2A 2X6OA 5EGOB 3I64A 5HDKA 2FBHA 3LSPA 2I8DA 4QSHA 5JVTA 1IDZA 4KISA 1IN4A 3S3MA 2W1OA 2ZJ2A 2L7FP 1BBYA 5AIPA 2X51A 2R5ZA 1BL0A 5J1YA 2Y48A 4X1EA 1E0EA 4ZYEA 2TDXA 1MBJA 1O7LA 4U7BA 2V9KA 4D5FA 1QNTA 2BZTA 4ZZLA 2VOPA 4CYCA 2KRFA 2E2JJ 2ECCA 2ZFUA 3VPRA 1ZKGA 4DW6A 1IN5A 2VBWA 5F27A 3ERED 4FHTA 1A36A 2NVTJ 3BG5A 3K2ZA 1FT9A 3F22A 3KP2A 2EPFA 5H2FC 3WTUC 1VQLI 1DGRM 3G1OA 3K7AJ 5HS8A 2HFHA 4OMZA 1U0JA 1UB9A 3BR0A 5L3CA 1K61A 2MABA 2XASA 5LHIA 3OYIA 5DUIA 3V7SA 2R7FA 3S1QJ 3CUQB 5J1RA 1APLC 4L0ZB 3M4OJ 1I50J 5B66C 1SAUA 1D8JA 4N0BA 5DD8A 2ME6A 1V5GA 2FUG2 3I4PA 2HPIA 4P96A 1P9QC 2HVQA 1GV2A 2QEXI 3ABMH 4CXFA 3MN2A 1OQYA 1TBXA 3CMAI 1MSFC 3S8PA 2ZJRF 4UUSA 2JVHA 1S5LC 2FJ1A 3JRHA 1OCTC 4HRIA 1IW7F 1UMQA 2WV1A 2D1HA 2VN2A 1HW5A 1O57A 1QHHD 4CDGA 2DODA 4HNUA 3BTCA 3O3KA 3ZMZA 2X1CA 1S29A 1KGSA 4E7SA 1R1UA 4XQFA 1ACIA 3FDYA 2W24A 4A3LJ 4NBQA 5TJJA 1P7IA 4DYCA 2K5CA 3HPGA 2P7VB 4FE7A 1XS9A 5D4SA 5F64A 3E5UA 5IT9Z 3K4LA 2H8RA 3CO7C 1T0FA 1TL8A 4KNYA 3CO6C 4E7JA 5FLXK 3T8RA 2HI3A 1OLTA 2JK3A 5D6FA 2ZNYA 3WHBA 2OUMA 1YFHA 1ZR4A 4BBRJ 3BJAA 4BNCA 1TT5B 1ZQ3P 1RESA 1X58A 1D3YA 1W0UA 2ZXJA 2Q1ZB 1V55H 3HGGA 3KP5A 2EZLA 5DEQA 1PJRA 1ON1A 4IRHA 4J00A 3CESA 1IUYA 3I4NJ 2L9NA 2XF7A 4NUBA 3ZQ7A 2KIMA 5ICEA 2R7UA 1LNWA 3O8HA 1WJDA 1W7PA 3GF2A 1YTYA 2IXSA 4M3FA 4G7OF 3MMYB 2PX9A 2N8GA 1T8IA 2W82A 5TRDA 3WTSC 1ORKA 3RPQA 2HGCA 2QSGX 1N78A 5IP6A 2TCTA 3H3UA 2M0CA 4QWQA 2NS0A 1B8IB 3GTKJ 1ZG1A 5IYCJ 1FBQA 3FXOA 1K6YA 2STTA 3NARA 2MW8A 3MKWB 1TNTA 2X6WA 5LGUA 2E7WA 2QBYA 5FGMA 4LOCA 4AUXA 4G94A 4PJNA 3RYRA 2QF7A 5DM7F 1MBKA 2KZGA 5GADJ 3QYEA 3ZN0A 3JCUC 4WCGA 4RGUA 2CQQA 4YIFA 2HQ5A 4UY8I 2V1DA 4XKCA 5KHDA 4LK0F 1XD7A 4JBAA 1AU7A 4UHTA 4OU0A 1GDTA 4D7NA 2KL4A 2V7FA 3WU1B 2FOWA 1JUSA 2F4MB 2VQHA 1XSDA 3OYBA 3W6JB 3HSRA 2MYSA 3F23A 1RIOH 1JGSA 4LG3A 3NQOA 1B9MA 1Y1VJ 3CMMA 4LLGF 1MJAA 2WADA 2LH9A 4HBLA 2BXYA 1KU2A 2R7DA 2L7KA 3GZ5A 4QPOA 1FC3A 5CVRA 4HLYA 1PUFB 1JJ6C 1HQCA 1HBXG 3F9KA 1DPRA 2CQKA 1BM9A 1MJ9A 2ZMEB 4B3XA 2V4JC 3CC2I 2E35A 2XPUA 2QKLB 3D5SC 3TQNA 3S3NA 3SDGA 3CMEI 4X6AJ 2X4HA 1Y39A 1LFBA 1T2KA 1KONA 1MZBA 2EQRA 5FKNA 3GX4X 1JGGA 3TP0A 1LQ1A 4CZCA 1OISA 3OYAA 1YRNB 1ZHFA 3LNQA 1MIJA 1OJLA 2KZVA 4XRFA 3GYHX 4EATA 3E0JB 1JE8A 4I76A 1I1GA 3E6BA 1WKMA 3HM5A 1I6XA 3DKXA 1G8XA 2W48A 3GLXA 2Y0MA 3OYLA 2FMLA 3ONQA 3DTIA 4R79A 3LOCA 2DTRA 2FU4A 2XC7A 3CCSI 2LBFA 3H5RA 5HS9A 4M73A 5K7HA 2JPBA 3GFIA 2PI0A 2XAUA 3Q0VA 4RAFA 4KIBA 2MLGA 3C1DA 1YO5C 4RBOA 2VQLA 1ETYA 2ID6A 4RAYA 2XF5A 1OPCA 3BDDA 2DA4A 4Y13A 1S7OA 1T08B 3BR6A 4EGYA 3DPLC 1VI0A 5FLXZ 2WWYA 2IS1A 1HXDA 3OSFA 1RC9A 2OCEA 3ERMA 5LBQA 2DDBA 4XLFA 2EBIA 2HKXA 2RDPA 4N4NB 3K4NA 2QQ8A 3IP4B 5FKKA 5ILUA 1K6OA 1S72I 5CPRB 4RM3A 3TDZC 3RZOJ 3F21A 3QYBA 1RNLA 4LMYA 4HG2A 2ZFWA 2GWRA 3PIOF 4A69C 2V79A 1XC5A 1T95A 4ESBA 2BBYA 5IT3A 2MFZA 1LEBA 3DTKA 3S16J 4AIHA 3ZCOA 4FETA 2EWNA 1USSA 4ZYGA 1R58A 1D1AA 2AXTC 3GW2A 2DMNA 4A5NA 2K3FA 3HIFA 3BPVA 3G71I 1P92A 1LEAA 3OS2A 3BP8A 3EUKL 3CJQB 1BI0A 5D5VB 2V6EA 4PUSA 2LKSA 3IKTA 3BR3A 2EILH 2VKVA 4OWRB 5D5WB 4XMYA 1Y6IA 4G7ZF 2VBXA 1RUNA 5E8GA 2JRTA 5KVRA 4QIWN 5FKMA 4M72A 1YW8A 4B48A 2R7TA 5IPAA 3TGNA 4L5EA 2M8GX 3GFLA 4XN3A 3K9TA 2ME0A 4RA2A 5ED4A 4XKWA 2EV0A 5FB2A 4MQVA 3Q0UA 4HYEA 1DU0A 3QP6A 3CZ6A 3RJPA 5IY5H 4L9VA 1TW3A 1HW1A 3QPHA 3M9AA 3WHCA 2KIQA 1RKWA 3TDUC 4XRSG 5E3MA 5JFRA 3BG7A 1QO0D 1R5ID 2P6TA 4IHYA 2XSDC 2WY7Q 4CUGA 3DCFA 4YEJA 3TOBA 3KETA 3BY6A 1MNMC 1Z05A 2HNHA 3BWGA 3OYCA 4ESJA 4ZDOA 3FF5A 2JPCA 4PSXA 1E3PA 3COAC 4EVIA 2CYYA 1IAWA 2RC4A 2LTPA 2B63J 3WTZA 3E1SA 4BDZA 2CWEA 3CUQC 1U9OA 1TC3C 3OR1C 4C2MJ 3M3YJ 4IOAF 3AG1H 1UHSA 2X0LA 3VEPA 2R7WA 1YX5A 3I59B 2MD0A 2K27A 2B9SA 1BR4A 4FCYA 2E1CA 1LPQA 1DGWY 1XSVA 1R5GA 2STWA 3FBIB 2LKPA 4Y4RA 3CMYA 5KAFC 1W7PB 1XGOA 5EEGA 5DV5A 2DMTA 1MMNA 1IRXA 3OIQA 1JXSA 3HOUJ 1ZLJA 5C3EJ 2K3PA 4EM2A 3SDBA 1RUOA 3R0AA 3MAJA 3AL0C 1QVTA 2K9MA 3FMQA 4U0YA 1OKRA 4IHTA 1TQMA 5GP9A 1BW5A 2D2WA 1RRJA 2L9RA 4O5VA 3CP2A 1B8IA 3EDPA 4HQEA 4DZJA 1FBSA 4R8HA 4LLNA 1Y0UA 4HV6A 2M87A 3PFYA 1A04A 4G6DA 4NNJA 2IT0A 3S93A 1ZARA 5FFZA 4RGSA 4HEA2 3S17J 1N75A 1P7JA 2R7VA 3KFWX 5EJCA 4GFBA 1VQPI 5EDNA 1X3WB 5CQGA 1T33A 4A0YA 3DPUA 2A61A 1B9NA 4CCKA 4CZZA 3K70C 3REOA 1ZG3A 4ITVA 3HRTA 3J80Z 2LD5A 1KYZA 2I10A 1F36A 4WX9A 1ODDA 2VPRA 3GFMA 3FX3A 2XGCA 2BXZA 4AU7A 1SAXA 2VQCA 3U9GA 2YPRA 4RB0A 1XCBA 5DS9A 2LOOA 3OV8A 1IF1A 1XB4A 3I0TA 2IGOA 5JHUA 1NG7A 2MC3A 4EJWA 1R36A 3BCAA 3FXJA 4PFOA 2HPMA 2E1OA 4RB2C 1FOXA 2E60A 4UUSB 2NS7A 1J9IA 2DW4A 1ZK8A 3OS0A 2G7UA 4NQWA 3WODF 3ABLH 2H8WA 2NYXA 5BPDA 3RTRA 5IT9K 4PDKA 3V7RA 1SFKA 3KP7A 2NS8A 3EYYA 5DM6F 3HOWJ 1MJBA 4GGGA 2XB0X 4MIMA 1FTTA 1X1PA 2R92J 2R93J 4WXCA 3GBGA 2Y30A 2P5KA 5FKLA 1YG2A 1O3TA 1Y0NA 2PMZA 1N25A 1NK2P 2A6HF 2KT0A 1WHUA 3EYIA 2NRAC 5LHHA 3RKXA 4Y52J 3QPSA 2QYOA 1XSXA 2WB1A 2E1MC 3CLOA 4UV9A 3FZVA 5LD2C 5D6EA 1ZELA 2CMPA 1REPC 2QA4I 4WF2A 3KZZA 2JQ7A 3D0SA 2KRCA 2L9SA 3U1KA 3NRVA 2X1EA 1ZYRF 3PIPF 2XAHA 2VKDA 3QQAA 2DJNA 3ZP5A 2P5LC 3ELKA 1WJCA 3I53A 2LMDA 2XDVA 4II2A 5DTDA 2L2OA 3NAUA 2DDAA 1SVLA 3PJRA 4RB3C 4I7HA 3VODA 2RNGA 2YU9J 3M7GA 2H27A 1FOYA 4EM0B 2LKXA 1T56A 2CQNA 3SZTA 3N97A 4A93J 4L9JA 2UXXA 4XICA 2EFWA 3CLQA 4BJ5C 3KLNA 4FE4A 3DV8A 3IV5A 3DKWA 3M1EA 2DQRA 2DYSH 2WA0A 3ESWB 2VBZA 4HF2A 3KP6A 4JX6A 1X3UA 2RV8A 1ETVA 1QZZA 4LIUA 2ACJA 1FBUA 3GZNB 4OIOF 3BG9A 2F4IA 3QODA 2EINH 2XKOA 3S1MJ 2LY1A 3CJRB 2O03A 3CCVI 2FOKA 1SD4A 4I6ZA 3HPHA 4B4CA 2EA4A 4CYCB 5HDGA 4EJOA 1FWZA 3OYKA 2BY3A 2UUZA 2VI6A 3A02A 5J4VA 3H9QA 3K4MA 5DYMA 3FMSA 5H20A 4HDVA 2DA2A 4B09A 5EZGA 3H3ZA 5ICGA 4PJMA 5K5OA 4NQWB 1YHQI 1S8NA 2ADUA 2JVGA 3ROUA 5L3GA 1TQPA 1U8BA 1DQUA 4G8XA 3J81Z 3BZ6A 4ZC3A 2FSWA 3LMMA 4M9ZA 2WY8Q 1TWCJ 1D0YA 1XGSA 3G6EI 5FLVA 1JJ8C 1UG2A 5J6XA 2NAZA 4BQAA 4FX0A 3HOVJ 2CGPA 4C3IJ 3J7AY 1YW7A 2W4SA 1RKTA 3JREA 1R00A 1MMAA 3OYNA 2RKHA 4BJ6C 2L4AA 3OS1A 1MBFA 2RQQA 1U5TA 4FT8A 2VBYA 3O8GA 2GA1A 5D8LB 3GMEA 3D5LA 2ESNA 2M30A 1FSEA 2DFFA 1ZTRA 3MQ0A 4BE1A 4FQGA 1SC7A 1IRGA 4XOTA 1Y8RB 3GWZA 5HODA 6PAXA 1G3WA 3IH4A 1T0FC 2IGKA 4KA4A 1EF4A 1FMVA 3NEUA 3HRUA 3I56I 4XRMA 2KIFA 3M8FA 1WVRA 3VDXA 1RETA 1QU3A 3DWLE 1PP8F 2PLYA 2KP6A 4ENMA 1JUMA 2PMHA 2L4MA 1PUFA 1SANA 5DCFA 2TRTA 3ML6A 1KZHA 1SVMA 2EV6A 2ELKA 2J5PA 3AG4H 3J7YJ 1RPWA 1T98A 2JUCA 3KEYA 4V2FA 3E7LA 2Y75A 2O7OA 4ZJZA 4DQ2A 1TNSA 3HOZJ 2HOTA 3QAHA 5M5WJ 1S7AA 1HC8A 3ZQGA 3JTHA 2DN0A 5TGTA 5CQEA 1VQMI 2GXGA 3Q9VA 4X0GA 3EETA 2ZJQF 1L0OC 3CTAA 4GRIA 3S2WA 4YFKF 2KJCA 3RYPA 3L2RA 2MSYA 4V2GA 3TOAA 5HNFA 2XKPA 4MEXF 4JK1X 3FBNB 2BY2A 2W25A 4J19A 4GYIA 2K9LA 2X1DA 1Z1DA 2VC0A 2JN6A 1OYWA 3C2BA 3W3CA 1H0MA 3RCOA 4XONA 2LYCA 3K6GA 2O0YA 2OZUA 3A4CA 3L9FA 2ISYA 1WJBA 1H9GA 2HYGD 4DIQA 3FISA 2XF6A 3A01A 5LEJA 1CF7B 1SFUA 2CQXA 4FTHA 4CH7A 3SEQA 1BJZA 2HYJA 2FBIA 3MD2A 2KIUA 4WXDA 2C6YA 3DFGA 3I58A 2E2IJ 2Z16A 3FHNA 4M3EA 2FQ3A 2OV7A 3OL3A 1U3EM 2R7XA 1QHGA 4PJJA 1XMKA 1ERDA 4HF0A 2QM3A 2D45A 2LFBA 1QGPA 2VODA 3SFZA 3SQNA 4ABZA 2FNPA 4Z2YA 3FXQA 3K4KA 3UR3C 2O5RA 3F72A 1D5YA 1XGMA 1FPQA 4A3BJ 3LFUA 1YRNA 1LUJB 2IGMA 3C2HA 1X2MA 3CQZJ 3HUGA 1MMSA 2CU7A 2COBA 1VQ9I 5CVUA 3AAFA 3KP3A 2E36A 2LC2A 4KN7X 3HRMA 3A01B 3TO9A 5E18F 1X1DA 3BZKA 3J7AO 3G2BA 3C7JA 1D8KA 4IOCF 2XIGA 1GHCA 3SYTA 5CVVA 3IAM2 3PM1A 2QQAA 2EH3A 2K4JA 1KQ8A 1K79A 4AD9A 3DP7A 2D5VA 2JSPA 1WSUA 5JHFA 4ON0A 4IHSA 3GLLA 1MNEA 3LQRA 2LLKA 2AQFA 1HSJA 2HOEA 3KPHA 4ZYAA 4I99C 2L5QA 3K1MA 2NVYJ 1PP7U 3PNYA 5JI6A 1SVOA 4XIDA 4OIQF 1KQ9A 2V9VA 2BOLA 1GLNA 3OSGA 1T38A 2ZXHA 3EUHC 4YG2F 3OYEA 3H3VK 2CUEA 1O3SA 1R22A 2FMYA 2JRMA 3HC7A 3DF8A 1GV5A 1SD6A 3T8TA 4B3AA 2VXZA 2LR8A 3H9GA 4LB6B 3QWLA 2F5DA 5FKOA 4CCNA 2P7CB 1ZRCA 1VZ0A 3GTJJ 1Z91A 3FXRA 4RGXA 2QGUA 4KICA 3QOPA 4BXUA 1USTA 1W7PD 4W1UA 1YI2I 2F6CA 2JT1A 1DDNA 1UFMA 2CFOA 3BG6A 4RGRA 3TKYA 4ETSA 1HKSA 1OR7A 2HQRA 2BY0A 3HOYJ 3PSFA 3W2WA 3F8MA 3CC7I 2XVCA 3DU6A 2VE9A 5CLSA 4C3HJ 4AYBA 1XGNA 2AS5F 4FX4A 1H88C 3DQVC 1STZA 4W97A 3F0CA 4BEHA 1G4DA 2JA8J 2K40A 1ZG5A 4KITB 1JKQC 1MBEA 5E1WA 4GXOA 1N77A 3UNGC 4BKXA 4IEJA 1JUPA 2ESHA 2LVSA 4CCJA 3D1NI 3HOXJ 1JHFA 4L18B 3K0LA 4AC0A 2VKEA 1XDSA 3T1BA 5F6FA 3CUQA 4XLAA 3HUGB 2ICWG 1P4AA 1FIPA 1W5CC 4U7DA 4NB5A 1EA3A 5E3NA 4XLCA 1ZGJA 3V8JA 2W00A 2KJBA 3JRGA 1FTZA 1FLIA 1XN7A 3V4GA 3T5XA 5IYBJ 3PNVA 1QRYA 3ZMVA 5CVJA 2R5ZB 5E79C 1RR7A 2IP2A 1V4RA 2CG4A 4BY1J 3Q5FA 4A3CJ 3DU5A 1WJEA 4H0EA 3OYGA 3H0GJ 2K85A 3MZYA 2FXAA 3ZMSA 2FX0A 2B0LA 4OIRF 5EEAA 1IUFA 2FQ4A 3OYHA 3L2UA 2Z9OA 2LF7A 3LSRA 1UZCA 1ZGWA 4E7ZA 1K4SA 1BR1A 2FA5A 1IGNA 3MCZA 2WC2A 1BJAA 2GBYA 5EG0B 5E1XA 3BPXA 1EV7A 4NC7A 4LGWA 3PO3J 1SFXA 3L09A 4D5CA 1ZRDA 1Z3XA 2K86A 2DOAA 3PSIA 3PUBA 4AIDA 2YU3A 4CA0A 3A2KA 2M4GA 2LY2A 4AIJA 4G7HF 4LLLA 3IL2A 1FOKA 1PUEE 4HLXA 2XUBA 2LBFB 4BL0B 4M3BA 2W7NA 5E20A 2Y69H 3KLOA 1GXQA 2I5UA 3CCUI 3TW7A 3KYCB 5F0CA 1MMDA 2A6EF 1G2HA 1F9NA 2AXLA 3G3ZA 4Y3OA 4G9YA 4ZYDA 2DU9A 1OCZH 4IHWA 1WI9A 1B1BA 4YFXF 3RQIA 4ZZDA 1XPXA 3K69A 4MLOA 3ZQCA 1OCOH 1Z77A 3F8FA 5FROA 5FLMJ 1BI1A 2CW7A 2XV4S 1LE8A 2A6TA 2CW0F 4BEHB 4MTEA 5J8CA 1HF0A 2RNJA 2W85A 4E4HA 5LGTA 2DOEA 4U0VA 3LL7A 1I3AA 3HRSA 2JTVA 3TO6A 2XAGA 4OINF 1ON2A 1Z6RA 3HZJA 3JAMK 2NNNA 4XLNF 1LVAA 4HNTA 1FY7A 1BIBA 5LRRA 3J81K 2MH9A 4RAGA 4XOPA 3E97A 3FIWA 2IA0A 1E3HA 4ESFA 2BEOA 2HR3A 4I0AA 1J5YA 2ZO4A 3WG9A 2R5YB 1GUUA 2BW3A 1E17A 2DK5A 3OMYA 5TISC 1V5FA 2KLOA 2XROA 4ZTFA 1U2WA 3S3OA 4A3EJ 3FXUA 4XKBA 1IO2A 2E34A 2EFNA 4HF1A 1SFOJ 2KFDA 2HXOA 5M5YJ 3FM5A 3A0HC 3WGIA 5BMZA 5BQTA 1EH6A 1J09A 3OOUA 2CSOA 5AONA 5HLTA 2ELJA 4L9TA 3RZDJ 2VJ5A 4A12A 1U6GA 4IF4A 3WU2C 1X19A 3BROA 3F8NA 5A2QZ 2V1XA 2UZKA 2R5YA 1EH7A 1ZLKA 4IXAA 4BAYA 1G3SA 4MFDA 5J3LA 3HSEA 3ZQQA 2Q8KA 3F6OA 1OCCH 3TMOA 3FKJA 2M5WA 3E6DA 4OAYA 3CCQI 4C30A 4PGGA 2OAZA 2KRHA 1IG7A 3PL8A 2CUZA 2PEXA 2XB5A 1F5TA 5FRNA 4KT6A 5EG0A 1RR8C 2BE5F 5F1RA 4YELA 1JI8A 1IRFA 2DJIA 5LLQA 5EZHA 3SZPA 4FASD 5ILVA 2PMUA 3A1YA 2KQRA 1JT0A 5IP7J 4M71A 3VWBA 2FEZA 2OA4A 2ZNZA 3BR5A 3VYSB 2Z33A 4HDUA 5EYRA 3GTMJ 1FNNA 1ZAOA 5LEKA 3I71A 1FP2A 3CD6I 2OJED 2QENA 4XRSA 2M2EA 2JZYA 3CF5F 1F43A 2M8EA 3F8BA 1WGXA 2Q2EA 4A3GJ 1WI3A 5F1JA 3WTWC 4BHCA 4EJTA 2LY9A 5FD5A 1YIJI 1KA8A 2EB7A 3ZPLA 1TW2A 3BQZA 3GFJA 1WJ5A 3PFIA 4NC6A 3GO5A 4EM1A 2WBMA 1LDDA 3GEZA 4UV8A 3HEFA 4M6XA 1TZLA 3L7WA 2P0WA 4XN0A 5FJ8J 1K4TA 1FZPB 4HAMA 1QVUA 4BQQA 3CJNA 3QU3A 1ZGAA 3FXLA 4P5OA 4R1HA 4A6DA 2LG4A 2GXAA 2DFHA 3S32A 2CV2A 3W2AA 3DBLB 4RAZA 2Y0SN 1Z67A 1GXPA 1BN5A 2HQAA 3GVAA 2QCOA 4A3JJ 2CS3A 4M9XA 2L0KA 2RGVA 2XAFA 1IN7A 1Z7UA 2DTZA 3H0DA 1AKHB 3S15J 3VFZA 4F92B 2VE8A 1R49A 3OIPA 1F1ZA 1ULYA 2F5VA 5H6QA 2RREA 4HX8A 2X9DA 4BXXJ 3AFHA 5GAHJ 3KZYA 3E3VA 3K2AA 5E3OA 4Q48A 4EJUA 2FRHA 2Y2ZA 5E8IA 3QPLA 2GIVA 1ONVA 3ZMDA 3VYTB 3KIOA 1P4XA 5LHGA 3SEZA 1AA7A 3IWFA 1TWAJ 1H9TA 2F5FA 3BCBA 4HV5A 3X2QH 4D7MA 3JRIA 4UVCA 4MGRA 3OYJA 1R4NB 4S0HB 2MBFA 5BS6A 4E70A 2M45A 4M3GA 1VFCA 2CUFA 3H5NA 4UB8C 4HX7A 5GTHC 4IKFA 5HLGA 2FNAA 3G73A 2Z3YA 2H1LA 2WV0A 2ZJPF 2GLOA 2E19A 2MC4A 4A6EA 3P9KA 3MWMA 4PFPA 1DUXC 4YIRX 2O61A 1LB2A 2YUSA 2YX4A 4UVAA 4I02A 4CGZA 5EEHA 4BYYA 1J2XA 5M3FJ 1VQKI 1IZ1A 2XSJC 1WJFA 3O2PE 4JOMA 1HDDC 2DO7A 3BR2A 1B59A 3HHGA 1BI3A 4K2EA 1QPIA 1SMTA 3ZRGA 4PCQA 1G59A 3ASNH 3IKVA 1IC8A 3DLAA 4I01A 2QWWA 3HKZA 4BQOA 2FE3A 4G6TB 5L3EA 1R7JA 3BG3A 3BJ6A 1VQ5I 2Z99A 3RQ4A 1TTYA 4Z6YA 5D5XB 2OQRA 5L3BA 1L3LA 2VKHA 2PJRA 2QBYB 2JJ7A 4PJ0C 3HOTA 1EJ9A 1VQ8I 3W6VA 5F0FA 1ZN2A 4RS8A 3BZCA 1Z9CA 1R1TA 4UVBA 1IXSB 1Y8QB 3KZIC 4F52A 1SD7A 3S2DJ 3MFKA 4F3QA 2ZBKA 1IN6A 3CCRI 4KMUX 1WWXA 3H5AA 5DUKA 1JHHA 4A2UA 4CCMA 3CF2A 1R9TJ 3ZOBA 2DQLA 3R0JA 4WWCA 4U0WA 2Z1DA 2CQ7A 5K5QA 4IL6C 1DPUA 2GA2A 3B6CA 1YQAA 2HS5A 1UCRA 4PGHA 4MQ9F 1G6NA 2PBIA 1GVJA 4Q5SF 3FM3A 3JTGA 4U87A 2CW8A 1MD0A 1UJ8A 2E71A 3G1MA 3DKYA 4DOZA 2DAOA 3MZ8A 2R7RA 3C18A 1WCMJ 2M4KA 5M5XJ 3PUFA 1TQIA 2QQBA 4EQQA 1KU3A 1B4AA 4BS9A 4V19K 2CFXA 1MKMA 4CHUA 2L01A 3PQJA 2IA1A 1P4WA 2DOFA 2M9HA 1TWGJ 3FWEA 3BOQA 2EV5A 3E5QA 1EKEA 3SZGA 3GTPJ 4Q4ZF 2GOMA 2Q2EB 3K4JA 4J01A 4F7ZA 2KKOA 2IW5A 2XPVA 1K78B 2VPLA 4ZDLA 2DPUA 2V9PA 1UELB 3WE3A 5E17F 4LITA 3V8KA 1Y56A 1DP7P 5DDGA 2G9WA 3W6KB 3IH3A 3Q0WA 3HG9A 3LA7A 2A3SA 5L3FA 4E7HA 5E3LA 2UXNA 4LG0B 4ZDPA 4JX4A 3JRFA 4MNUA 2ECBA 2WB1N 2XRNA 2FD5A 2BGCA 4RDUA 4CICA 3RKQA 3E6MA 4GCVA 1Q1VA 1B72A 1D5VA 1IXCA 2WAQA 3S14J 1FIAA 1V54H 3EQLF 1YJ9I 1TP4A 3ECHA 4BUPA 2A5WA 3L2QA 3U1DA 4A3FJ 5EF6A 2IGNA 2DK8A 3LWFA 5J4YA 3LSHA 2EZHA 2L3DA 2RVCA 4ZH4F 4UNOA 3L1PA 2EFPA 2UV1A 1UHWA 5D8KB 4ZYHA 3CDIA 2HVRA 5K7FA 2JSCA 1OR7C 1PVEA 1C0WA 3TL4X 2DYRH 1QQIA 1ZR2A 3OYDA 1IXRC 1POGA 1VF9A 2VT3A 2KDOA 3HHHA 2IS4A 2KPMA 5ICFA 1S6LA 3LAPA 2GIZA 3HB9A 3IAS2 3M8JA 2BW3B 5C4JJ 1U5TC 2VL8A 4DBRA 2CV0A 5HS7A 2EZIA 3BT9A 2M34A 3M1CA 1JTXA 3OY9A 9ANTA 3GTOJ 4PZJA 3ULQB 4EEFG 3HL2A 1KU7A 3FHZA 1JT6A 2Y9YA 1P2FA 5A2QK 2J5OA 2NNYA 3OOPA 1XDUA 4OMYA 2K7LA 1S3JA 1I5ZA 1W4MA 2YS9A 5BPIA 1I6HJ 1I27A 3K4BA 4IQJA 3ISPA 4FISA 2HVSA 3LSIA 3K1NA 2QSHX 2X48A 3BJOA 4WK8F 2GXBA 1FSHA 1TT0A 1YS7A 3QPTA 3KP4A 3L2VA 2MG4A 1A5JA 3J7ZI 1TWHJ 2RQPA 2BVLA 3HYIA 1A6QA 4IPAA 3JRDA 1AHDP 5BNGA 3VOEA 2PMZN 2CUJA 5C44J 2HYFA 1MDMA 1FYMA 2HU9A 4XSXF 4XBFA 1NG6A 3J80K 3S2HJ 2DFEA 2QUFA 3I9V2 2M7BA 3ZMUA 2VJJA 3JAMZ 1VNDA 1ETOA 3HOSA 1ENHA 1K7AA 2L02A 2XGXA 3CP8A 3GXOA 1NH3A 4JX5A 1XMXA 1MGTA 1MH4A 3ECOA 4G6QA 3ABKH 4L5JA 4ZTJA 2R0QC 4MO7A 1E3OC 5DCMB
chains in the Genus database with same CATH topology
3IHUA 4IJAA 2HEOA 1NHAA 1FP1D 1FYLA 4IRIA 3B02A 5AIQA 4M9SA 2V6CA 3B73A 2ZMEA 3R61A 2EFOA 2HTSA 5CVIA 3O6BB 5L3DA 4BHBA 1HW2A 3MEXA 4NHJA 2RN7A 4ENKA 3LSTA 3RPUA 1BI2A 5H6RA 3WTTC 1R23A 4ENNA 3P7NA 1YS6A 4D0PA 4XLPF 2Z5UA 3H92A 2GQQA 2R3SA 1YYVA 4KFCA 3RI4A 1LDJA 3WTYC 3GUDA 2OD5A 4HA8A 2YSRA 2CO5A 2W57A 3DEUA 2XAJA 3TO7A 4BHPA 2O8XA 4HX4A 3E6CC 3HSFA 4YFNF 3L2CA 5LRSA 2H6CA 5D4RA 4OIPF 2HWVA 4O6JA 2VONA 2QLZA 2E1NA 5ERIA 1E2XA 2IPQX 2MH2A 3EUHA 3R6SA 4Y17A 4I09A 4LJZF 3I5UA 1IN8A 4IRGA 4L9NA 4HOBA 4HQMA 1U78A 3WGGA 1W5SA 2YX7A 2H94A 1J7KA 1SD5A 4B8XA 4AIKA 4O3MA 3T0YA 4MTDA 2MLKA 3DPTA 1T6SA 5J8FA 1B6AA 3Q9SA 2OZ6A 1O3RA 4KYWA 1BC7C 3DXJF 1VTNC 4EV0A 1QPMA 1W5TA 4MEYF 4WXHA 4AVPA 1YIOA 4HZFA 3KE2A 2DBBA 5K5RA 2DFIA 4N9HA 1SMYF 3F3XA 3LFKA 2FBKA 2H6BA 2LF8A 2Q0OA 3WTVC 3LA3A 4EGZA 2EK5A 4IVNA 2QVOA 3LQQA 5K1YA 3RKYA 3QRFF 2PN6A 4BH9A 3N4MA 2G7HA 4QLCU 1HKQA 2DPDA 3WE2A 3R4KA 3JSOA 1BOAA 1U5TB 3GZ6A 4EJVA 4LG0A 1LJ9A 2EA2A 1KQ0A 2V1UA 1AOYA 1KU9A 1EH8A 4GO1A 2VOOA 2HKOA 1OMIA 2WTEA 5KK1A 1OYYA 4ENJA 1O3QA 1QZYA 4I98B 5HVQC 4KDPA 3RIRA 3HTUA 2GZWA 5HDNA 2HQNA 2BV6A 1G3YA 2A5YB 1V3FA 4N9IA 5DCMA 5CJ9A 1Q1HA 2ELHA 2VT2A 1WRJA 4M74A 1T39A 1SFEA 1J59A 3E5XA 1KYWA 1RZ4A 3ABUA 2YR2A 1R1VA 1YLFA 2BYVE 2UWMA 1HKTA 4KIGA 2D1VA 2DT5A 2F2EA 2ETHA 4CYDA 3QP5A 1CF7A 2XAQA 3K1PA 2O3FA 3V8LA 1ZREA 4LB5A 1MDMB 4EMSA 1BC8C 1P6RA 4I0BA 5LGNA 3C3WA 3LA2A 1FX7A 1PDNC 3I54A 4LD5A 3CUOA 3WGHA 3SHFA 2GAUA 2H09A 1U8RA 3P9IA 4A5MA 2FF4A 2HDCA 1R5HA 2K02A 2HZTA 2LSOA 1J0RA 3L00A 2P4WA 4M6YA 3KCCA 1F4KA 3IRQA 3QU6A 3IRRA 3SXYA 1G3TA 2F5EA 4L5IA 4P9FA 5E1ZB 1ZH5A 1OYIA 3F8CA 1CGPA 2OBPA 5ILSA 2L54A 4TV7A 3F6VA 3HTSB 1J75A 4L0YB 2O6GE 2K4BA 4Q47A 5JR3A 2P5VA 2XHKA 5HOOA 2E7XA 3JW4A 4OOIA 2QQ9A 2F5CA 5DD4A 3KEQA 1LDKB 2MA3A 5HLIA 4I2OA 5FFXA 4UUVA 5BOXA 4P55A 2A69F 1AWCA 5FO5A 3ZMTA 2ISZA 2QZ8A 3RKWA 3R60A 4GYGA 2COMA 3I59A 5CYVA 4RB1A 2P8TA 4U88A 4CO8A 3JSPA 1YW9A 3KEOA 2DLLA 2EJRA 2W84A 2PG4A 5HLHA 4JQFA 3PQKA 4MHGA 1WQ2A 4HW0A 5D5UB 4YIIA 4A0XA 1RI7A 2PQ8A 3ZN1A 1BIAA 1I1SA 2MD5A 2IJLA 5FD6A 4XSZF 3V7CA 2PFBA 4S04A 4LK1F 3VB2A 2VC1A 2P6SA 2IVMA 3WU0A 2LNBA 3CDHA 4P9UA 3LAJA 2ZCWA 1K78A 4KMFA 4KN4X 4ASNA 2IRFG 3P9CA 2DI3A 4Y15A 4A0ZA 1XMAA 3M8EA 2A07F 1FYKA 4KT5C 1ZRFA 4KUMA 1TLHB 1Z6TA 3FMRA 2EFQA 1XCVA 3RDIA 1O7FA 3ABTA 4S05A 2IA2A 4DNCA 4KIFA 1UHMA 2HTJA 2ZKZA 4LFUA 3MZHA 3U2RA 2M1BA 3IWZA 2OU2A 2PJPA 4UXNA 4AWXB 2A68F 1QBJA 1HSTA 3IC7A 2OQGA 5ICCA 3WTXC 2LDUA 3I64A 5HDKA 2FBHA 5JVTA 1IN4A 2ZJ2A 1BBYA 5AIPA 2Y48A 4ZYEA 2TDXA 1O7LA 4U7BA 1QNTA 4ZZLA 2VOPA 2KRFA 1IN5A 2VBWA 3ERED 4FHTA 3K2ZA 1FT9A 3F22A 3KP2A 3WTUC 5HS8A 2HFHA 4OMZA 1UB9A 5L3CA 5LHIA 2XASA 5DUIA 3V7SA 2R7FA 3CUQB 4L0ZB 1D8JA 4N0BA 5DD8A 3I4PA 4P96A 4CXFA 1TBXA 1IW7F 2D1HA 2VN2A 1HW5A 1O57A 4CDGA 3O3KA 3ZMZA 1S29A 1KGSA 1R1UA 2W24A 5TJJA 2P7VB 5D4SA 5F64A 3E5UA 5IT9Z 3CO7C 1T0FA 4KNYA 3CO6C 5FLXK 3T8RA 5D6FA 2ZNYA 1YFHA 4BNCA 3BJAA 1D3YA 2ZXJA 3KP5A 5DEQA 1ON1A 4IRHA 1IUYA 3ZQ7A 2KIMA 5ICEA 1LNWA 1W7PA 3GF2A 1YTYA 4G7OF 5TRDA 3WTSC 3RPQA 2HGCA 3H3UA 4QWQA 2NS0A 1ZG1A 1FBQA 2STTA 1TNTA 2QBYA 5LGUA 2E7WA 5FGMA 4G94A 3RYRA 3ZN0A 4WCGA 4RGUA 4YIFA 2V1DA 4LK0F 1XD7A 4JBAA 4UHTA 4OU0A 3WU1B 1XSDA 3W6JB 3HSRA 3F23A 1RIOH 1JGSA 3NQOA 1B9MA 4LLGF 1MJAA 4HBLA 1KU2A 2R7DA 4HLYA 3GZ5A 5CVRA 1FC3A 1HQCA 1HBXG 1DPRA 2CQKA 1BM9A 1MJ9A 2ZMEB 3TQNA 2X4HA 1T2KA 1MZBA 3GX4X 1LQ1A 1ZHFA 3GYHX 4XRFA 1JE8A 1I1GA 3E6BA 1WKMA 1I6XA 3GLXA 2Y0MA 2FMLA 4R79A 2DTRA 2FU4A 5HS9A 4M73A 2JPBA 3GFIA 2PI0A 4KIBA 2MLGA 3C1DA 1YO5C 4RAYA 3BDDA 1OPCA 4Y13A 1S7OA 4EGYA 3DPLC 5FLXZ 2WWYA 1HXDA 5LBQA 2HKXA 2RDPA 5ILUA 1K6OA 3TDZC 3F21A 1RNLA 4LMYA 2ZFWA 2GWRA 2V79A 4ESBA 2BBYA 5IT3A 1LEBA 4AIHA 2EWNA 1USSA 4ZYGA 1R58A 4A5NA 3GW2A 3HIFA 3BPVA 1P92A 1LEAA 3BP8A 1BI0A 5D5VB 3IKTA 5D5WB 4G7ZF 2VBXA 1RUNA 5E8GA 2JRTA 5KVRA 4M72A 1YW8A 3TGNA 3GFLA 3K9TA 5ED4A 2EV0A 5FB2A 4MQVA 4HYEA 3QP6A 3RJPA 4L9VA 1TW3A 1HW1A 3QPHA 3M9AA 3TDUC 5JFRA 1QO0D 2P6TA 3TOBA 3KETA 3BY6A 1Z05A 4ESJA 3BWGA 3FF5A 2JPCA 3COAC 4EVIA 2CYYA 1IAWA 2RC4A 3WTZA 2CWEA 3CUQC 2X0LA 3VEPA 3I59B 2E1CA 2K27A 1XSVA 1R5GA 2STWA 2LKPA 1W7PB 1XGOA 5EEGA 5DV5A 1JXSA 1ZLJA 4EM2A 1RUOA 3R0AA 3MAJA 4U0YA 3FMQA 1OKRA 4IHTA 1TQMA 2D2WA 4O5VA 3EDPA 4HQEA 1FBSA 4R8HA 4LLNA 1Y0UA 4HV6A 2M87A 1A04A 4G6DA 2IT0A 1ZARA 5FFZA 4RGSA 3KFWX 4A0YA 2A61A 1B9NA 4CZZA 3REOA 1ZG3A 3HRTA 3J80Z 1KYZA 4WX9A 1ODDA 3GFMA 3FX3A 1SAXA 3U9GA 2YPRA 4RB0A 1XCBA 3OV8A 1IF1A 1XB4A 3I0TA 5JHUA 4EJWA 2MC3A 1R36A 4RB2C 1J9IA 2DW4A 2G7UA 4NQWA 3WODF 2NYXA 5BPDA 3RTRA 5IT9K 4PDKA 3V7RA 3KP7A 3EYYA 1MJBA 4GGGA 4WXCA 2P5KA 1YG2A 1O3TA 2A6HF 3EYIA 2NRAC 5LHHA 3RKXA 2QYOA 1XSXA 3CLOA 4UV9A 3FZVA 5D6EA 1REPC 4WF2A 3KZZA 3D0SA 3NRVA 1ZYRF 2XAHA 3ZP5A 2P5LC 3ELKA 3I53A 4RB3C 4I7HA 3VODA 3M7GA 2H27A 4EM0B 3SZTA 3N97A 4L9JA 2UXXA 2EFWA 3KLNA 3DV8A 3DKWA 3M1EA 2DQRA 2VBZA 4HF2A 3KP6A 1X3UA 2RV8A 1QZZA 2ACJA 1FBUA 4OIOF 2XKOA 2O03A 2FOKA 1SD4A 2EA4A 5HDGA 4EJOA 1FWZA 5DYMA 3FMSA 5H20A 4HDVA 4B09A 5ICGA 3H3ZA 5K5OA 1S8NA 2ADUA 3ROUA 5L3GA 1TQPA 4G8XA 3J81Z 3BZ6A 2FSWA 4M9ZA 1XGSA 5J6XA 2NAZA 4BQAA 4FX0A 2CGPA 1YW7A 1R00A 2RKHA 2L4AA 1U5TA 4FT8A 2VBYA 2GA1A 5D8LB 3D5LA 2ESNA 2M30A 1FSEA 3MQ0A 1IRGA 6PAXA 3GWZA 1G3WA 4KA4A 3NEUA 3HRUA 2KIFA 3M8FA 1PP8F 2PLYA 4ENMA 2PMHA 2L4MA 5DCFA 3ML6A 2EV6A 2J5PA 1T98A 2Y75A 4DQ2A 1TNSA 3QAHA 1S7AA 3JTHA 2GXGA 3Q9VA 3EETA 1L0OC 3CTAA 3S2WA 4YFKF 2KJCA 3RYPA 3TOAA 2XKPA 4MEXF 4JK1X 2W25A 4GYIA 1Z1DA 2VC0A 1OYWA 1H0MA 2O0YA 2OZUA 3L9FA 2ISYA 1H9GA 2HYGD 5LEJA 1CF7B 1SFUA 2FBIA 2KIUA 4WXDA 2C6YA 3DFGA 3I58A 2FQ3A 1U3EM 1XMKA 4HF0A 2QM3A 2D45A 1QGPA 2VODA 3SFZA 3SQNA 2FNPA 4Z2YA 3FXQA 3F72A 1XGMA 1FPQA 3HUGA 5CVUA 3AAFA 3KP3A 4KN7X 3HRMA 3TO9A 5E18F 3J7AO 3C7JA 1D8KA 2XIGA 1GHCA 5CVVA 2QQAA 2K4JA 1KQ8A 1K79A 4AD9A 3DP7A 1WSUA 4ON0A 4IHSA 3LQRA 1HSJA 2HOEA 3K1MA 1PP7U 5JI6A 4OIQF 1KQ9A 2V9VA 1T38A 4YG2F 1O3SA 1R22A 2FMYA 3DF8A 1SD6A 3T8TA 2VXZA 4LB6B 2F5DA 2P7CB 1ZRCA 1Z91A 3FXRA 4RGXA 4KICA 3QOPA 4BXUA 1USTA 1W7PD 2JT1A 1DDNA 1UFMA 4RGRA 3TKYA 4ETSA 1HKSA 1OR7A 2HQRA 3F8MA 2XVCA 2VE9A 5CLSA 1XGNA 2AS5F 4FX4A 3DQVC 1STZA 1G4DA 1ZG5A 5E1WA 4GXOA 2ESHA 1JHFA 4L18B 3K0LA 1XDSA 3T1BA 5F6FA 3CUQA 1P4AA 4U7DA 4NB5A 1ZGJA 3V8JA 2KJBA 1FLIA 1XN7A 3V4GA 3T5XA 3ZMVA 5CVJA 2IP2A 1V4RA 2CG4A 3Q5FA 4H0EA 3MZYA 2FXAA 3ZMSA 2B0LA 4OIRF 2Z9OA 2LF7A 2FA5A 3MCZA 2WC2A 1BJAA 5E1XA 3BPXA 1EV7A 4LGWA 1SFXA 3L09A 1ZRDA 2K86A 2YU3A 4AIJA 4G7HF 4LLLA 3IL2A 1FOKA 1PUEE 4HLXA 2XUBA 5E20A 3KLOA 1GXQA 2A6EF 1F9NA 2AXLA 3G3ZA 4G9YA 4ZYDA 2DU9A 1WI9A 1B1BA 4YFXF 4ZZDA 3K69A 3F8FA 1BI1A 2XV4S 2CW0F 4MTEA 5J8CA 2RNJA 2W85A 5LGTA 4U0VA 3HRSA 2JTVA 3TO6A 2XAGA 4OINF 1ON2A 1Z6RA 3JAMK 2NNNA 4XLNF 1LVAA 1FY7A 1BIBA 5LRRA 3J81K 2MH9A 3E97A 2IA0A 4ESFA 2BEOA 2HR3A 4I0AA 1J5YA 2ZO4A 3WG9A 1E17A 2DK5A 2XROA 1U2WA 3FXUA 2EFNA 4HF1A 5BMZA 3FM5A 3WGIA 5BQTA 1EH6A 2CSOA 5AONA 4L9TA 4A12A 1U6GA 4IF4A 3BROA 3F8NA 5A2QZ 2V1XA 2UZKA 1EH7A 1ZLKA 4IXAA 4BAYA 1G3SA 3HSEA 2Q8KA 3F6OA 2M5WA 3E6DA 4PGGA 2OAZA 2PEXA 1F5TA 2BE5F 5F1RA 1IRFA 5LLQA 3SZPA 5ILVA 2PMUA 4M71A 2FEZA 2OA4A 2ZNZA 2Z33A 4HDUA 1FNNA 1ZAOA 5LEKA 3I71A 1FP2A 2QENA 2JZYA 2M8EA 3F8BA 2Q2EA 3WTWC 4BHCA 4EJTA 5FD5A 1KA8A 2EB7A 3ZPLA 1TW2A 3GFJA 3PFIA 3GO5A 4EM1A 1LDDA 3GEZA 4UV8A 4M6XA 3L7WA 1FZPB 4HAMA 3CJNA 3QU3A 1ZGAA 4P5OA 4R1HA 4A6DA 4RAZA 1GXPA 1BN5A 3GVAA 4M9XA 2RGVA 2XAFA 1IN7A 1Z7UA 3VFZA 2VE8A 1F1ZA 1ULYA 5H6QA 4HX8A 3KZYA 3E3VA 4Q48A 4EJUA 2FRHA 5E8IA 2GIVA 1ONVA 3ZMDA 1P4XA 5LHGA 3IWFA 1H9TA 2F5FA 4HV5A 4UVCA 4MGRA 2MBFA 5BS6A 4E70A 2M45A 4HX7A 5HLGA 2FNAA 3G73A 2Z3YA 2WV0A 4A6EA 3P9KA 3MWMA 1DUXC 2O61A 1LB2A 4UVAA 2YX4A 4CGZA 4I02A 5EEHA 4BYYA 1J2XA 1IZ1A 3O2PE 2DO7A 1B59A 3HHGA 1BI3A 4K2EA 1SMTA 4PCQA 3IKVA 4I01A 2QWWA 2FE3A 5L3EA 1R7JA 3BJ6A 2Z99A 1TTYA 5D5XB 2OQRA 5L3BA 1L3LA 2QBYB 3HOTA 1ZN2A 4RS8A 1Z9CA 1R1TA 4UVBA 1IXSB 1SD7A 3MFKA 2ZBKA 1IN6A 4KMUX 1WWXA 5DUKA 1JHHA 4A2UA 2DQLA 3R0JA 4WWCA 4U0WA 5K5QA 1DPUA 2GA2A 1YQAA 2HS5A 1UCRA 4PGHA 4MQ9F 1G6NA 2PBIA 1GVJA 4Q5SF 3FM3A 3JTGA 1MD0A 2DAOA 3C18A 1TQIA 2QQBA 4EQQA 1KU3A 1B4AA 2CFXA 1MKMA 4CHUA 2L01A 3PQJA 2IA1A 1P4WA 3FWEA 3BOQA 2EV5A 3E5QA 4Q4ZF 4F7ZA 2KKOA 2IW5A 1K78B 2DPUA 5E17F 3WE3A 3V8KA 1DP7P 5DDGA 2G9WA 3W6KB 3LA7A 2A3SA 5L3FA 4LG0B 2UXNA 4MNUA 2XRNA 2BGCA 4CICA 3E6MA 4GCVA 1D5VA 1IXCA 3EQLF 3ECHA 3U1DA 2DK8A 3LWFA 2L3DA 2RVCA 4ZH4F 4UNOA 2EFPA 1UHWA 5D8KB 4ZYHA 2JSCA 1C0WA 1QQIA 1IXRC 2VT3A 3HHHA 5ICFA 1S6LA 3LAPA 1U5TC 5HS7A 4PZJA 3ULQB 1KU7A 3FHZA 1P2FA 5A2QK 2J5OA 2NNYA 3OOPA 1XDUA 4OMYA 2K7LA 1S3JA 1I5ZA 1W4MA 5BPIA 1I27A 3ISPA 2GXBA 1FSHA 3K1NA 4WK8F 3BJOA 1YS7A 3QPTA 3KP4A 2RQPA 3HYIA 4IPAA 3VOEA 2HYFA 1MDMA 1FYMA 4XSXF 4XBFA 3J80K 2QUFA 3ZMUA 3JAMZ 3HOSA 1K7AA 2L02A 2XGXA 3GXOA 1MGTA 3ECOA 4G6QA 4L5JA 5DCMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHU A;  4IJA A;  2HEO A;  1NHA A;  1FP1 D;  1FYL A;  4IRI A;  3B02 A;  5AIQ A;  4M9S A;  2V6C A;  3B73 A;  2ZME A;  3R61 A;  2EFO A;  2HTS A;  5CVI A;  3O6B B;  5L3D A;  4BHB A;  1HW2 A;  3MEX A;  4NHJ A;  2RN7 A;  4ENK A;  3LST A;  3RPU A;  1BI2 A;  5H6R A;  3WTT C;  1R23 A;  4ENN A;  3P7N A;  1YS6 A;  4D0P A;  4XLP F;  2Z5U A;  3H92 A;  2GQQ A;  2R3S A;  1YYV A;  4KFC A;  3RI4 A;  1LDJ A;  3WTY C;  3GUD A;  2OD5 A;  4HA8 A;  2YSR A;  2CO5 A;  2W57 A;  3DEU A;  2XAJ A;  3TO7 A;  4BHP A;  2O8X A;  4HX4 A;  3E6C C;  3HSF A;  4YFN F;  3L2C A;  5LRS A;  2H6C A;  5D4R A;  4OIP F;  2HWV A;  4O6J A;  2VON A;  2QLZ A;  2E1N A;  5ERI A;  1E2X A;  2IPQ X;  2MH2 A;  3EUH A;  3R6S A;  4Y17 A;  4I09 A;  4LJZ F;  3I5U A;  1IN8 A;  4IRG A;  4L9N A;  4HOB A;  4HQM A;  1U78 A;  3WGG A;  1W5S A;  2YX7 A;  2H94 A;  1J7K A;  1SD5 A;  4B8X A;  4AIK A;  4O3M A;  3T0Y A;  4MTD A;  2MLK A;  3DPT A;  1T6S A;  5J8F A;  1B6A A;  3Q9S A;  2OZ6 A;  1O3R A;  4KYW A;  1BC7 C;  3DXJ F;  1VTN C;  4EV0 A;  1QPM A;  1W5T A;  4MEY F;  4WXH A;  4AVP A;  1YIO A;  4HZF A;  3KE2 A;  2DBB A;  5K5R A;  2DFI A;  4N9H A;  1SMY F;  3F3X A;  3LFK A;  2FBK A;  2H6B A;  2LF8 A;  2Q0O A;  3WTV C;  3LA3 A;  4EGZ A;  2EK5 A;  4IVN A;  2QVO A;  3LQQ A;  5K1Y A;  3RKY A;  3QRF F;  2PN6 A;  4BH9 A;  3N4M A;  2G7H A;  4QLC U;  1HKQ A;  2DPD A;  3WE2 A;  3R4K A;  3JSO A;  1BOA A;  1U5T B;  3GZ6 A;  4EJV A;  4LG0 A;  1LJ9 A;  2EA2 A;  1KQ0 A;  2V1U A;  1AOY A;  1KU9 A;  1EH8 A;  4GO1 A;  2VOO A;  2HKO A;  1OMI A;  2WTE A;  5KK1 A;  1OYY A;  4ENJ A;  1O3Q A;  1QZY A;  4I98 B;  5HVQ C;  4KDP A;  3RIR A;  3HTU A;  2GZW A;  5HDN A;  2HQN A;  2BV6 A;  1G3Y A;  2A5Y B;  1V3F A;  4N9I A;  5DCM A;  5CJ9 A;  1Q1H A;  2ELH A;  2VT2 A;  1WRJ A;  4M74 A;  1T39 A;  1SFE A;  1J59 A;  3E5X A;  1KYW A;  1RZ4 A;  3ABU A;  2YR2 A;  1R1V A;  1YLF A;  2BYV E;  2UWM A;  1HKT A;  4KIG A;  2D1V A;  2DT5 A;  2F2E A;  2ETH A;  4CYD A;  3QP5 A;  1CF7 A;  2XAQ A;  3K1P A;  2O3F A;  3V8L A;  1ZRE A;  4LB5 A;  1MDM B;  4EMS A;  1BC8 C;  1P6R A;  4I0B A;  5LGN A;  3C3W A;  3LA2 A;  1FX7 A;  1PDN C;  3I54 A;  4LD5 A;  3CUO A;  3WGH A;  3SHF A;  2GAU A;  2H09 A;  1U8R A;  3P9I A;  4A5M A;  2FF4 A;  2HDC A;  1R5H A;  2K02 A;  2HZT A;  2LSO A;  1J0R A;  3L00 A;  2P4W A;  4M6Y A;  3KCC A;  1F4K A;  3IRQ A;  3QU6 A;  3IRR A;  3SXY A;  1G3T A;  2F5E A;  4L5I A;  4P9F A;  5E1Z B;  1ZH5 A;  1OYI A;  3F8C A;  1CGP A;  2OBP A;  5ILS A;  2L54 A;  4TV7 A;  3F6V A;  3HTS B;  1J75 A;  4L0Y B;  2O6G E;  2K4B A;  4Q47 A;  5JR3 A;  2P5V A;  2XHK A;  5HOO A;  2E7X A;  3JW4 A;  4OOI A;  2QQ9 A;  2F5C A;  5DD4 A;  3KEQ A;  1LDK B;  2MA3 A;  5HLI A;  4I2O A;  5FFX A;  4UUV A;  5BOX A;  4P55 A;  2A69 F;  1AWC A;  5FO5 A;  3ZMT A;  2ISZ A;  2QZ8 A;  3RKW A;  3R60 A;  4GYG A;  2COM A;  3I59 A;  5CYV A;  4RB1 A;  2P8T A;  4U88 A;  4CO8 A;  3JSP A;  1YW9 A;  3KEO A;  2DLL A;  2EJR A;  2W84 A;  2PG4 A;  5HLH A;  4JQF A;  3PQK A;  4MHG A;  1WQ2 A;  4HW0 A;  5D5U B;  4YII A;  4A0X A;  1RI7 A;  2PQ8 A;  3ZN1 A;  1BIA A;  1I1S A;  2MD5 A;  2IJL A;  5FD6 A;  4XSZ F;  3V7C A;  2PFB A;  4S04 A;  4LK1 F;  3VB2 A;  2VC1 A;  2P6S A;  2IVM A;  3WU0 A;  2LNB A;  3CDH A;  4P9U A;  3LAJ A;  2ZCW A;  1K78 A;  4KMF A;  4KN4 X;  4ASN A;  2IRF G;  3P9C A;  2DI3 A;  4Y15 A;  4A0Z A;  1XMA A;  3M8E A;  2A07 F;  1FYK A;  4KT5 C;  1ZRF A;  4KUM A;  1TLH B;  1Z6T A;  3FMR A;  2EFQ A;  1XCV A;  3RDI A;  1O7F A;  3ABT A;  4S05 A;  2IA2 A;  4DNC A;  4KIF A;  1UHM A;  2HTJ A;  2ZKZ A;  4LFU A;  3MZH A;  3U2R A;  2M1B A;  3IWZ A;  2OU2 A;  2PJP A;  4UXN A;  4AWX B;  2A68 F;  1QBJ A;  1HST A;  3IC7 A;  2OQG A;  5ICC A;  3WTX C;  2LDU A;  3I64 A;  5HDK A;  2FBH A;  5JVT A;  1IN4 A;  2ZJ2 A;  1BBY A;  5AIP A;  2Y48 A;  4ZYE A;  2TDX A;  1O7L A;  4U7B A;  1QNT A;  4ZZL A;  2VOP A;  2KRF A;  1IN5 A;  2VBW A;  3ERE D;  4FHT A;  3K2Z A;  1FT9 A;  3F22 A;  3KP2 A;  3WTU C;  5HS8 A;  2HFH A;  4OMZ A;  1UB9 A;  5L3C A;  5LHI A;  2XAS A;  5DUI A;  3V7S A;  2R7F A;  3CUQ B;  4L0Z B;  1D8J A;  4N0B A;  5DD8 A;  3I4P A;  4P96 A;  4CXF A;  1TBX A;  1IW7 F;  2D1H A;  2VN2 A;  1HW5 A;  1O57 A;  4CDG A;  3O3K A;  3ZMZ A;  1S29 A;  1KGS A;  1R1U A;  2W24 A;  5TJJ A;  2P7V B;  5D4S A;  5F64 A;  3E5U A;  5IT9 Z;  3CO7 C;  1T0F A;  4KNY A;  3CO6 C;  5FLX K;  3T8R A;  5D6F A;  2ZNY A;  1YFH A;  4BNC A;  3BJA A;  1D3Y A;  2ZXJ A;  3KP5 A;  5DEQ A;  1ON1 A;  4IRH A;  1IUY A;  3ZQ7 A;  2KIM A;  5ICE A;  1LNW A;  1W7P A;  3GF2 A;  1YTY A;  4G7O F;  5TRD A;  3WTS C;  3RPQ A;  2HGC A;  3H3U A;  4QWQ A;  2NS0 A;  1ZG1 A;  1FBQ A;  2STT A;  1TNT A;  2QBY A;  5LGU A;  2E7W A;  5FGM A;  4G94 A;  3RYR A;  3ZN0 A;  4WCG A;  4RGU A;  4YIF A;  2V1D A;  4LK0 F;  1XD7 A;  4JBA A;  4UHT A;  4OU0 A;  3WU1 B;  1XSD A;  3W6J B;  3HSR A;  3F23 A;  1RIO H;  1JGS A;  3NQO A;  1B9M A;  4LLG F;  1MJA A;  4HBL A;  1KU2 A;  2R7D A;  4HLY A;  3GZ5 A;  5CVR A;  1FC3 A;  1HQC A;  1HBX G;  1DPR A;  2CQK A;  1BM9 A;  1MJ9 A;  2ZME B;  3TQN A;  2X4H A;  1T2K A;  1MZB A;  3GX4 X;  1LQ1 A;  1ZHF A;  3GYH X;  4XRF A;  1JE8 A;  1I1G A;  3E6B A;  1WKM A;  1I6X A;  3GLX A;  2Y0M A;  2FML A;  4R79 A;  2DTR A;  2FU4 A;  5HS9 A;  4M73 A;  2JPB A;  3GFI A;  2PI0 A;  4KIB A;  2MLG A;  3C1D A;  1YO5 C;  4RAY A;  3BDD A;  1OPC A;  4Y13 A;  1S7O A;  4EGY A;  3DPL C;  5FLX Z;  2WWY A;  1HXD A;  5LBQ A;  2HKX A;  2RDP A;  5ILU A;  1K6O A;  3TDZ C;  3F21 A;  1RNL A;  4LMY A;  2ZFW A;  2GWR A;  2V79 A;  4ESB A;  2BBY A;  5IT3 A;  1LEB A;  4AIH A;  2EWN A;  1USS A;  4ZYG A;  1R58 A;  4A5N A;  3GW2 A;  3HIF A;  3BPV A;  1P92 A;  1LEA A;  3BP8 A;  1BI0 A;  5D5V B;  3IKT A;  5D5W B;  4G7Z F;  2VBX A;  1RUN A;  5E8G A;  2JRT A;  5KVR A;  4M72 A;  1YW8 A;  3TGN A;  3GFL A;  3K9T A;  5ED4 A;  2EV0 A;  5FB2 A;  4MQV A;  4HYE A;  3QP6 A;  3RJP A;  4L9V A;  1TW3 A;  1HW1 A;  3QPH A;  3M9A A;  3TDU C;  5JFR A;  1QO0 D;  2P6T A;  3TOB A;  3KET A;  3BY6 A;  1Z05 A;  4ESJ A;  3BWG A;  3FF5 A;  2JPC A;  3COA C;  4EVI A;  2CYY A;  1IAW A;  2RC4 A;  3WTZ A;  2CWE A;  3CUQ C;  2X0L A;  3VEP A;  3I59 B;  2E1C A;  2K27 A;  1XSV A;  1R5G A;  2STW A;  2LKP A;  1W7P B;  1XGO A;  5EEG A;  5DV5 A;  1JXS A;  1ZLJ A;  4EM2 A;  1RUO A;  3R0A A;  3MAJ A;  4U0Y A;  3FMQ A;  1OKR A;  4IHT A;  1TQM A;  2D2W A;  4O5V A;  3EDP A;  4HQE A;  1FBS A;  4R8H A;  4LLN A;  1Y0U A;  4HV6 A;  2M87 A;  1A04 A;  4G6D A;  2IT0 A;  1ZAR A;  5FFZ A;  4RGS A;  3KFW X;  4A0Y A;  2A61 A;  1B9N A;  4CZZ A;  3REO A;  1ZG3 A;  3HRT A;  3J80 Z;  1KYZ A;  4WX9 A;  1ODD A;  3GFM A;  3FX3 A;  1SAX A;  3U9G A;  2YPR A;  4RB0 A;  1XCB A;  3OV8 A;  1IF1 A;  1XB4 A;  3I0T A;  5JHU A;  4EJW A;  2MC3 A;  1R36 A;  4RB2 C;  1J9I A;  2DW4 A;  2G7U A;  4NQW A;  3WOD F;  2NYX A;  5BPD A;  3RTR A;  5IT9 K;  4PDK A;  3V7R A;  3KP7 A;  3EYY A;  1MJB A;  4GGG A;  4WXC A;  2P5K A;  1YG2 A;  1O3T A;  2A6H F;  3EYI A;  2NRA C;  5LHH A;  3RKX A;  2QYO A;  1XSX A;  3CLO A;  4UV9 A;  3FZV A;  5D6E A;  1REP C;  4WF2 A;  3KZZ A;  3D0S A;  3NRV A;  1ZYR F;  2XAH A;  3ZP5 A;  2P5L C;  3ELK A;  3I53 A;  4RB3 C;  4I7H A;  3VOD A;  3M7G A;  2H27 A;  4EM0 B;  3SZT A;  3N97 A;  4L9J A;  2UXX A;  2EFW A;  3KLN A;  3DV8 A;  3DKW A;  3M1E A;  2DQR A;  2VBZ A;  4HF2 A;  3KP6 A;  1X3U A;  2RV8 A;  1QZZ A;  2ACJ A;  1FBU A;  4OIO F;  2XKO A;  2O03 A;  2FOK A;  1SD4 A;  2EA4 A;  5HDG A;  4EJO A;  1FWZ A;  5DYM A;  3FMS A;  5H20 A;  4HDV A;  4B09 A;  5ICG A;  3H3Z A;  5K5O A;  1S8N A;  2ADU A;  3ROU A;  5L3G A;  1TQP A;  4G8X A;  3J81 Z;  3BZ6 A;  2FSW A;  4M9Z A;  1XGS A;  5J6X A;  2NAZ A;  4BQA A;  4FX0 A;  2CGP A;  1YW7 A;  1R00 A;  2RKH A;  2L4A A;  1U5T A;  4FT8 A;  2VBY A;  2GA1 A;  5D8L B;  3D5L A;  2ESN A;  2M30 A;  1FSE A;  3MQ0 A;  1IRG A;  6PAX A;  3GWZ A;  1G3W A;  4KA4 A;  3NEU A;  3HRU A;  2KIF A;  3M8F A;  1PP8 F;  2PLY A;  4ENM A;  2PMH A;  2L4M A;  5DCF A;  3ML6 A;  2EV6 A;  2J5P A;  1T98 A;  2Y75 A;  4DQ2 A;  1TNS A;  3QAH A;  1S7A A;  3JTH A;  2GXG A;  3Q9V A;  3EET A;  1L0O C;  3CTA A;  3S2W A;  4YFK F;  2KJC A;  3RYP A;  3TOA A;  2XKP A;  4MEX F;  4JK1 X;  2W25 A;  4GYI A;  1Z1D A;  2VC0 A;  1OYW A;  1H0M A;  2O0Y A;  2OZU A;  3L9F A;  2ISY A;  1H9G A;  2HYG D;  5LEJ A;  1CF7 B;  1SFU A;  2FBI A;  2KIU A;  4WXD A;  2C6Y A;  3DFG A;  3I58 A;  2FQ3 A;  1U3E M;  1XMK A;  4HF0 A;  2QM3 A;  2D45 A;  1QGP A;  2VOD A;  3SFZ A;  3SQN A;  2FNP A;  4Z2Y A;  3FXQ A;  3F72 A;  1XGM A;  1FPQ A;  3HUG A;  5CVU A;  3AAF A;  3KP3 A;  4KN7 X;  3HRM A;  3TO9 A;  5E18 F;  3J7A O;  3C7J A;  1D8K A;  2XIG A;  1GHC A;  5CVV A;  2QQA A;  2K4J A;  1KQ8 A;  1K79 A;  4AD9 A;  3DP7 A;  1WSU A;  4ON0 A;  4IHS A;  3LQR A;  1HSJ A;  2HOE A;  3K1M A;  1PP7 U;  5JI6 A;  4OIQ F;  1KQ9 A;  2V9V A;  1T38 A;  4YG2 F;  1O3S A;  1R22 A;  2FMY A;  3DF8 A;  1SD6 A;  3T8T A;  2VXZ A;  4LB6 B;  2F5D A;  2P7C B;  1ZRC A;  1Z91 A;  3FXR A;  4RGX A;  4KIC A;  3QOP A;  4BXU A;  1UST A;  1W7P D;  2JT1 A;  1DDN A;  1UFM A;  4RGR A;  3TKY A;  4ETS A;  1HKS A;  1OR7 A;  2HQR A;  3F8M A;  2XVC A;  2VE9 A;  5CLS A;  1XGN A;  2AS5 F;  4FX4 A;  3DQV C;  1STZ A;  1G4D A;  1ZG5 A;  5E1W A;  4GXO A;  2ESH A;  1JHF A;  4L18 B;  3K0L A;  1XDS A;  3T1B A;  5F6F A;  3CUQ A;  1P4A A;  4U7D A;  4NB5 A;  1ZGJ A;  3V8J A;  2KJB A;  1FLI A;  1XN7 A;  3V4G A;  3T5X A;  3ZMV A;  5CVJ A;  2IP2 A;  1V4R A;  2CG4 A;  3Q5F A;  4H0E A;  3MZY A;  2FXA A;  3ZMS A;  2B0L A;  4OIR F;  2Z9O A;  2LF7 A;  2FA5 A;  3MCZ A;  2WC2 A;  1BJA A;  5E1X A;  3BPX A;  1EV7 A;  4LGW A;  1SFX A;  3L09 A;  1ZRD A;  2K86 A;  2YU3 A;  4AIJ A;  4G7H F;  4LLL A;  3IL2 A;  1FOK A;  1PUE E;  4HLX A;  2XUB A;  5E20 A;  3KLO A;  1GXQ A;  2A6E F;  1F9N A;  2AXL A;  3G3Z A;  4G9Y A;  4ZYD A;  2DU9 A;  1WI9 A;  1B1B A;  4YFX F;  4ZZD A;  3K69 A;  3F8F A;  1BI1 A;  2XV4 S;  2CW0 F;  4MTE A;  5J8C A;  2RNJ A;  2W85 A;  5LGT A;  4U0V A;  3HRS A;  2JTV A;  3TO6 A;  2XAG A;  4OIN F;  1ON2 A;  1Z6R A;  3JAM K;  2NNN A;  4XLN F;  1LVA A;  1FY7 A;  1BIB A;  5LRR A;  3J81 K;  2MH9 A;  3E97 A;  2IA0 A;  4ESF A;  2BEO A;  2HR3 A;  4I0A A;  1J5Y A;  2ZO4 A;  3WG9 A;  1E17 A;  2DK5 A;  2XRO A;  1U2W A;  3FXU A;  2EFN A;  4HF1 A;  5BMZ A;  3FM5 A;  3WGI A;  5BQT A;  1EH6 A;  2CSO A;  5AON A;  4L9T A;  4A12 A;  1U6G A;  4IF4 A;  3BRO A;  3F8N A;  5A2Q Z;  2V1X A;  2UZK A;  1EH7 A;  1ZLK A;  4IXA A;  4BAY A;  1G3S A;  3HSE A;  2Q8K A;  3F6O A;  2M5W A;  3E6D A;  4PGG A;  2OAZ A;  2PEX A;  1F5T A;  2BE5 F;  5F1R A;  1IRF A;  5LLQ A;  3SZP A;  5ILV A;  2PMU A;  4M71 A;  2FEZ A;  2OA4 A;  2ZNZ A;  2Z33 A;  4HDU A;  1FNN A;  1ZAO A;  5LEK A;  3I71 A;  1FP2 A;  2QEN A;  2JZY A;  2M8E A;  3F8B A;  2Q2E A;  3WTW C;  4BHC A;  4EJT A;  5FD5 A;  1KA8 A;  2EB7 A;  3ZPL A;  1TW2 A;  3GFJ A;  3PFI A;  3GO5 A;  4EM1 A;  1LDD A;  3GEZ A;  4UV8 A;  4M6X A;  3L7W A;  1FZP B;  4HAM A;  3CJN A;  3QU3 A;  1ZGA A;  4P5O A;  4R1H A;  4A6D A;  4RAZ A;  1GXP A;  1BN5 A;  3GVA A;  4M9X A;  2RGV A;  2XAF A;  1IN7 A;  1Z7U A;  3VFZ A;  2VE8 A;  1F1Z A;  1ULY A;  5H6Q A;  4HX8 A;  3KZY A;  3E3V A;  4Q48 A;  4EJU A;  2FRH A;  5E8I A;  2GIV A;  1ONV A;  3ZMD A;  1P4X A;  5LHG A;  3IWF A;  1H9T A;  2F5F A;  4HV5 A;  4UVC A;  4MGR A;  2MBF A;  5BS6 A;  4E70 A;  2M45 A;  4HX7 A;  5HLG A;  2FNA A;  3G73 A;  2Z3Y A;  2WV0 A;  4A6E A;  3P9K A;  3MWM A;  1DUX C;  2O61 A;  1LB2 A;  4UVA A;  2YX4 A;  4CGZ A;  4I02 A;  5EEH A;  4BYY A;  1J2X A;  1IZ1 A;  3O2P E;  2DO7 A;  1B59 A;  3HHG A;  1BI3 A;  4K2E A;  1SMT A;  4PCQ A;  3IKV A;  4I01 A;  2QWW A;  2FE3 A;  5L3E A;  1R7J A;  3BJ6 A;  2Z99 A;  1TTY A;  5D5X B;  2OQR A;  5L3B A;  1L3L A;  2QBY B;  3HOT A;  1ZN2 A;  4RS8 A;  1Z9C A;  1R1T A;  4UVB A;  1IXS B;  1SD7 A;  3MFK A;  2ZBK A;  1IN6 A;  4KMU X;  1WWX A;  5DUK A;  1JHH A;  4A2U A;  2DQL A;  3R0J A;  4WWC A;  4U0W A;  5K5Q A;  1DPU A;  2GA2 A;  1YQA A;  2HS5 A;  1UCR A;  4PGH A;  4MQ9 F;  1G6N A;  2PBI A;  1GVJ A;  4Q5S F;  3FM3 A;  3JTG A;  1MD0 A;  2DAO A;  3C18 A;  1TQI A;  2QQB A;  4EQQ A;  1KU3 A;  1B4A A;  2CFX A;  1MKM A;  4CHU A;  2L01 A;  3PQJ A;  2IA1 A;  1P4W A;  3FWE A;  3BOQ A;  2EV5 A;  3E5Q A;  4Q4Z F;  4F7Z A;  2KKO A;  2IW5 A;  1K78 B;  2DPU A;  5E17 F;  3WE3 A;  3V8K A;  1DP7 P;  5DDG A;  2G9W A;  3W6K B;  3LA7 A;  2A3S A;  5L3F A;  4LG0 B;  2UXN A;  4MNU A;  2XRN A;  2BGC A;  4CIC A;  3E6M A;  4GCV A;  1D5V A;  1IXC A;  3EQL F;  3ECH A;  3U1D A;  2DK8 A;  3LWF A;  2L3D A;  2RVC A;  4ZH4 F;  4UNO A;  2EFP A;  1UHW A;  5D8K B;  4ZYH A;  2JSC A;  1C0W A;  1QQI A;  1IXR C;  2VT3 A;  3HHH A;  5ICF A;  1S6L A;  3LAP A;  1U5T C;  5HS7 A;  4PZJ A;  3ULQ B;  1KU7 A;  3FHZ A;  1P2F A;  5A2Q K;  2J5O A;  2NNY A;  3OOP A;  1XDU A;  4OMY A;  2K7L A;  1S3J A;  1I5Z A;  1W4M A;  5BPI A;  1I27 A;  3ISP A;  2GXB A;  1FSH A;  3K1N A;  4WK8 F;  3BJO A;  1YS7 A;  3QPT A;  3KP4 A;  2RQP A;  3HYI A;  4IPA A;  3VOE A;  2HYF A;  1MDM A;  1FYM A;  4XSX F;  4XBF A;  3J80 K;  2QUF A;  3ZMU A;  3JAM Z;  3HOS A;  1K7A A;  2L02 A;  2XGX A;  3GXO A;  1MGT A;  3ECO A;  4G6Q A;  4L5J A;  5DCM B; 
#chains in the Genus database with same CATH topology
 3IHU A;  2R7Q A;  2A05 A;  4IJA A;  4F93 B;  1WJA A;  2HEO A;  1NHA A;  4PJL A;  2L7Z A;  4BGD A;  1FP1 D;  5M3M J;  2DA7 A;  1FYL A;  1X4O A;  4IRI A;  4C3J J;  3B02 A;  3LSJ A;  5AIQ A;  2JUG A;  4M9S A;  2V6C A;  3B73 A;  2ZME A;  2LRD A;  4E7K A;  1LFP A;  1VQN I;  2VXD A;  3JRB A;  2IS2 A;  3IUO A;  4BBS J;  1BA5 A;  3R61 A;  2EFO A;  2HTS A;  3KYD B;  4YRV A;  2JA2 A;  5CVI A;  2NVQ J;  3ASO H;  4DYQ A;  3O6B B;  1X4P A;  5L3D A;  4BHB A;  1HW2 A;  2VUM J;  4BAC A;  1WPK A;  3MEX A;  4NHJ A;  2RN7 A;  3C2G A;  4ENK A;  3LST A;  1CQT A;  3RPU A;  1BI2 A;  2KMU A;  5H6R A;  3WTT C;  1R23 A;  2DMQ A;  4ENN A;  4B43 A;  3P7N A;  3DLL F;  1WZ2 A;  2Y0S A;  1VQ6 I;  1YS6 A;  4D0P A;  4XLP F;  4XOR A;  5GPA A;  2Z5U A;  3CCE I;  3GTL J;  3H92 A;  3OR2 C;  1JKO C;  3CCJ I;  2HOA A;  2GQQ A;  2R3S A;  1YYV A;  2WAF A;  4KFC A;  3RI4 A;  1JKP C;  1V5E A;  2DA1 A;  3EPZ A;  1LDJ A;  3WTY C;  3GUD A;  2OD5 A;  1LE8 B;  4F91 B;  2BY1 A;  1D1B A;  1QZE A;  4HA8 A;  2YSR A;  5J1U A;  4JP0 A;  2CO5 A;  2W57 A;  2R7O A;  3DEU A;  2XAJ A;  3TO7 A;  3L2W A;  5GAE J;  4BHP A;  2O8X A;  4HX4 A;  3E6C C;  1YIT I;  3HSF A;  2BHZ A;  4YFN F;  3L2C A;  5LRS A;  1GVD A;  2H6C A;  5D4R A;  4OIP F;  2HWV A;  1IV8 A;  4O6J A;  2VON A;  4IO9 F;  1GT0 C;  4DYR A;  1H8A C;  4BXF A;  2QLZ A;  4OAZ A;  5LFA A;  1XTA A;  3S1N J;  2E1N A;  5ERI A;  1E2X A;  2IPQ X;  2MH2 A;  4C9Y A;  4M6V A;  3EUH A;  3R6S A;  2P81 A;  4Y17 A;  4I09 A;  5KNL A;  1YE9 A;  2AQE A;  1UG0 A;  4LJZ F;  3H35 A;  3I5U A;  1IN8 A;  2BVM A;  2CJJ A;  4IRG A;  4L9N A;  4HOB A;  2OCC H;  1MH3 A;  4HQM A;  1U78 A;  3WGG A;  1W5S A;  2YX7 A;  2H94 A;  2X6Y A;  3MVP A;  4IQ4 A;  4N4O B;  1J7K A;  1SD5 A;  4B8X A;  3SJM A;  4AIK A;  3T0Y A;  4O3M A;  2ZXI A;  1IV6 A;  3ZQH A;  1MBH A;  4MTD A;  2MLK A;  2KHM A;  3DPT A;  1T6S A;  5J8F A;  1B6A A;  3VYR B;  2R7Z J;  4C2T A;  3Q9S A;  2OZ6 A;  1O3R A;  4KYW A;  2NOJ B;  1MND A;  4H4K C;  2WAQ N;  3NWT A;  1BC7 C;  2GM4 A;  3TED A;  2Y9Z A;  1W36 C;  2DA3 A;  3DXJ F;  1VTN C;  4NDL A;  4DBQ A;  4EV0 A;  3UKG A;  1QPM A;  1W5T A;  3V42 A;  2EIM H;  1VQO I;  4MEY F;  4B1R A;  4WXH A;  3ZGK A;  4AVP A;  1OFC X;  4QPQ A;  1YIO A;  4HZF A;  3KE2 A;  1FMW A;  2EZK A;  2IAI A;  2ZME C;  3H1C A;  2DBB A;  3IH2 A;  4XLE A;  2DT7 B;  5K5R A;  2DFI A;  4PK4 A;  1R6R A;  4N9H A;  5J47 A;  1SMY F;  1HDP A;  3F3X A;  2O9L A;  1SEU A;  3K10 A;  4E7L A;  2OC6 A;  3LFK A;  2FBK A;  2H6B A;  5F04 A;  2LF8 A;  2Q0O A;  3WTV C;  3PO2 J;  3LA3 A;  4EGZ A;  2EK5 A;  1A6I A;  3HBL A;  4IVN A;  1YJN I;  1W0T A;  1DU6 A;  4AYB N;  2QVO A;  2NVX J;  5GAG J;  1YX3 A;  1OCP A;  3W2V A;  3JR9 A;  3LQQ A;  5K1Y A;  3GTG J;  3RKY A;  2WAE A;  5B3S H;  3AG2 H;  1X1A A;  3U21 A;  3QRF F;  2RAE A;  2PN6 A;  3N05 A;  4BH9 A;  2CRG A;  3LSM A;  4PSW A;  3N4M A;  1Y1W J;  3BTI A;  2E2H J;  1FOW A;  3CCY A;  2OPT A;  2G7H A;  4QLC U;  1HKQ A;  2DPD A;  3WE2 A;  3R4K A;  4UB6 C;  4XNF A;  3JSO A;  3B6A A;  1BOA A;  1U5T B;  3GZ6 A;  4EJV A;  1JKR C;  4LG0 A;  1LJ9 A;  2EA2 A;  1KQ0 A;  2M0M A;  3JRC A;  3ZQF A;  2V1U A;  3BLY A;  1Z3Y A;  1AOY A;  1KU9 A;  2CH0 A;  4NC8 A;  5CKT A;  3AKZ A;  1QA6 A;  2KIS A;  1EH8 A;  4GO1 A;  2VOO A;  2HKO A;  2ZSI B;  5JVG F;  4DJA A;  3HJE A;  3H9J A;  4BQN A;  1OMI A;  2WTE A;  5KK1 A;  3BC8 A;  1OYY A;  2ZSH B;  1X3Z B;  3TW6 A;  4ENJ A;  1O3Q A;  1QZY A;  4I98 B;  5HVQ C;  2LK2 A;  4KDP A;  2NVU B;  2JA6 J;  3RIR A;  3HTU A;  2GZW A;  5HDN A;  2VQG A;  1H89 C;  2HQN A;  5F08 A;  3GTQ J;  4AVZ A;  2BV6 A;  1G3Y A;  1K83 J;  2A5Y B;  3KX2 A;  1V3F A;  4N9I A;  4BDY A;  5DCM A;  2HDW A;  5CJ9 A;  1Q1H A;  2ELH A;  2VT2 A;  1WRJ A;  4M74 A;  5B1A H;  1T39 A;  1NK3 P;  1SFE A;  3I3L A;  1J59 A;  4A3K J;  2VJI A;  3E5X A;  1KYW A;  1RZ4 A;  3ABU A;  4MFE A;  2HZD A;  5IOY A;  2YR2 A;  2AO9 A;  1R1V A;  1YLF A;  2BYV E;  3Q3S A;  2UWM A;  2DMU A;  2VAS A;  1HKT A;  4KIG A;  4IZZ A;  1HOM A;  5C4X J;  2D1V A;  2DT5 A;  2F2E A;  2ETH A;  3LSK A;  2DCE A;  2ID3 A;  4CYD A;  2R7S A;  1XX5 A;  4RMN A;  2PJR B;  3QP5 A;  3AL0 B;  2HDD A;  4RLF A;  1CF7 A;  1W36 D;  2GOX B;  1WH7 A;  1MSE C;  1OCR H;  2XAQ A;  2AHQ A;  2K9Q A;  3K1P A;  2R4G A;  2O3F A;  5KCM A;  3V8L A;  3EUA A;  1ZRE A;  5B1B H;  2OTJ I;  4LB5 A;  2MGQ A;  1MDM B;  2G0E A;  2OTL I;  1FJL A;  3HXL A;  4EMS A;  1BC8 C;  3CDL A;  1P6R A;  1S7E A;  4I0B A;  3WG7 H;  3C3W A;  5LGN A;  3LA2 A;  4RM2 A;  1FX7 A;  1PDN C;  3I54 A;  3H36 A;  4LD5 A;  3CUO A;  3LSG A;  3WGH A;  3SHF A;  3S1R J;  2GAU A;  4XL9 A;  2H09 A;  3OL4 A;  5JLX A;  1FEX A;  2HXI A;  1U8R A;  1S9H A;  4UUT A;  4B44 A;  2NXN B;  1BW6 A;  2LP0 A;  2F4O B;  2IS6 A;  3P9I A;  4A5M A;  4DGW B;  2FF4 A;  1X2N A;  2HDC A;  3AG3 H;  3ZQI A;  2CV1 A;  1R5H A;  2K02 A;  2Y31 A;  2HZT A;  2LSO A;  4Y33 A;  5IP9 J;  1J0R A;  3L00 A;  4BJT A;  1JTY A;  2P4W A;  3MKL A;  3TP3 A;  1HA8 A;  4M6Y A;  3KCC A;  4M3D A;  1VQ7 I;  1F4K A;  1YOV B;  3IRQ A;  3QU6 A;  3IRR A;  2X6X A;  2JWT A;  2HOS A;  1DP3 A;  2JA5 J;  3K70 D;  3OYM A;  3BQY A;  1G3T A;  3SXY A;  1HCR A;  2F5E A;  4L5I A;  2L9V A;  4P9F A;  2EIJ H;  1MBG A;  5E1Z B;  1ZH5 A;  3G1L A;  1OYI A;  3F8C A;  5GPC A;  1CGP A;  4C2U A;  4A3M J;  1I39 A;  2OBP A;  1LKX A;  2JA7 J;  5ILS A;  5K7Z A;  2XGE A;  4P1W A;  2H1K A;  4AM3 A;  2L54 A;  3BTJ A;  1ETQ A;  2XGD A;  4TV7 A;  3F6V A;  3FXK A;  3HTS B;  1J75 A;  4L0Y B;  2O8K A;  4BE0 A;  4Y7N J;  2K4B A;  4BY7 J;  2O6G E;  4Q47 A;  1D0X A;  5JR3 A;  2P5V A;  2XHK A;  4CCO A;  2BHY A;  5HOO A;  1I3Q J;  3CC4 I;  3FKI J;  2E7X A;  3JW4 A;  1R71 A;  1PYV A;  3HDD A;  4OOI A;  2QQ9 A;  3A0B C;  3MKZ A;  2K9S A;  3RPU D;  4HPQ A;  2F5C A;  5DD4 A;  1ETX A;  3JRA A;  4QTR A;  4IHV A;  3QOE A;  3KEQ A;  1LDK B;  2MA3 A;  3VSL A;  5HLI A;  1YJW I;  4XKV A;  1XG1 A;  4E6K G;  4I2O A;  5FFX A;  4B47 A;  3FK7 A;  4UUV A;  3QYF A;  3TBI A;  5BOX A;  2B7E A;  2XPW A;  4HNV A;  4P55 A;  1LVK A;  2A69 F;  1Z7L A;  1AWC A;  5FO5 A;  4D1Q A;  2VLA A;  4XK4 A;  3ZMT A;  1WH5 A;  5HNH A;  4LIV A;  2ISZ A;  2XRL A;  1M1E B;  1W1W E;  2QZ8 A;  3RKW A;  2M3A A;  3RSN A;  4CSW A;  3DEE A;  1IDY A;  2E1M B;  3R60 A;  5IYD J;  2VB6 A;  3G4S I;  2VJ4 A;  4GYG A;  5B5E C;  2COM A;  3I59 A;  5CYV A;  3HKZ N;  4RB1 A;  2P8T A;  2VIX A;  4U88 A;  4CO8 A;  3JSP A;  1YW9 A;  3BR1 A;  3KEO A;  2DLL A;  3OWT A;  2EJR A;  2W84 A;  4G12 A;  2QSF X;  2V26 A;  2PG4 A;  5HLH A;  1U9N A;  1B72 B;  4JQF A;  3CCL I;  3PNT A;  2DMP A;  3VSK A;  1A31 A;  3PQK A;  3ZR8 X;  3DBR B;  4MHG A;  1R4M B;  4JYK A;  1WQ2 A;  3DBH B;  4BU2 A;  4HW0 A;  5D5U B;  4YII A;  3CJT B;  4A0X A;  1RI7 A;  2PQ8 A;  1A35 A;  1TWF J;  4II3 A;  3ZN1 A;  1UAA A;  4GDF A;  1BIA A;  1HLV A;  1I1S A;  2MD5 A;  3ZQL A;  1Z0X A;  2IJL A;  2X85 A;  4DZP A;  4D9J A;  1MMG A;  5FD6 A;  1X1B A;  1ETK A;  4XSZ F;  3DTE A;  3K4C A;  3V7C A;  2PFB A;  4S04 A;  4LK1 F;  2IBD A;  3VB2 A;  2VC1 A;  5F0H A;  5JLW A;  3VYU B;  2P6S A;  2DXI A;  2IVM A;  3WU0 A;  2LNB A;  2LRE A;  2DA5 A;  2EIK H;  3CDH A;  5KAI C;  4P9U A;  5IOZ A;  3MKY B;  5J40 A;  3CCM I;  3LAJ A;  2ZCW A;  4CCL A;  1K78 A;  4KMF A;  4KN4 X;  3I55 I;  3BTL A;  4ASN A;  2ZC2 A;  3FXM A;  1MW7 A;  2IRF G;  2JMW A;  1O4X A;  3D5R C;  1BOB A;  2NOG A;  2V1N A;  2M7A A;  3P9C A;  3P5J A;  4IX7 A;  2DI3 A;  4Y15 A;  1IRZ A;  4ANJ A;  2KDZ A;  4A0Z A;  2K9N A;  4XLH A;  5FRM A;  1XMA A;  3M8E A;  1LFU P;  1ITY A;  2ZXW H;  1ETW A;  3SFI A;  2A07 F;  1FYK A;  2E5Z A;  1VQ4 I;  4KT5 C;  4XR6 A;  5GTI C;  1ZRF A;  4KUM A;  1TLH B;  1Z6T A;  3FMR A;  5EGO A;  2EFQ A;  1XCV A;  3OIO A;  2ZB9 A;  2E5N A;  4A3D J;  4HSR A;  1NTC A;  2Z2S B;  3RDI A;  1O7F A;  3A03 A;  3ABT A;  3FK6 A;  2DT6 A;  1Z21 A;  4S05 A;  2IA2 A;  4DNC A;  2QKM B;  4A3I J;  4XM3 A;  1IJW C;  4KIF A;  1UHM A;  2DA6 A;  2IEK A;  3NWS A;  2L7M P;  2HTJ A;  2ZKZ A;  4LFU A;  3MZH A;  3U2R A;  2M1B A;  3IWZ A;  4RLQ A;  4F55 A;  2OU2 A;  2PJP A;  1D1C A;  4UXN A;  3OYF A;  4E7I A;  4KJZ A;  3DEW A;  3KYL A;  2OF7 A;  1AKH A;  4BE2 A;  4AWX B;  2A68 F;  3GCM A;  1D0Z A;  1QBJ A;  3ZXS A;  3HGY A;  1HST A;  4IHX A;  2F48 A;  1WFX A;  3M07 A;  3I4M J;  3IC7 A;  4HST A;  2OQG A;  5ICC A;  1X1C A;  3WTX C;  2LDU A;  1BR2 A;  2X6O A;  5EGO B;  3I64 A;  5HDK A;  2FBH A;  3LSP A;  2I8D A;  4QSH A;  5JVT A;  1IDZ A;  4KIS A;  1IN4 A;  3S3M A;  2W1O A;  2ZJ2 A;  2L7F P;  1BBY A;  5AIP A;  2X51 A;  2R5Z A;  1BL0 A;  5J1Y A;  2Y48 A;  4X1E A;  1E0E A;  4ZYE A;  2TDX A;  1MBJ A;  1O7L A;  4U7B A;  2V9K A;  4D5F A;  1QNT A;  2BZT A;  4ZZL A;  2VOP A;  4CYC A;  2KRF A;  2E2J J;  2ECC A;  2ZFU A;  3VPR A;  1ZKG A;  4DW6 A;  1IN5 A;  2VBW A;  5F27 A;  3ERE D;  4FHT A;  1A36 A;  2NVT J;  3BG5 A;  3K2Z A;  1FT9 A;  3F22 A;  3KP2 A;  2EPF A;  5H2F C;  3WTU C;  1VQL I;  1DGR M;  3G1O A;  3K7A J;  5HS8 A;  2HFH A;  4OMZ A;  1U0J A;  1UB9 A;  3BR0 A;  5L3C A;  1K61 A;  2MAB A;  2XAS A;  5LHI A;  3OYI A;  5DUI A;  3V7S A;  2R7F A;  3S1Q J;  3CUQ B;  5J1R A;  1APL C;  4L0Z B;  3M4O J;  1I50 J;  5B66 C;  1SAU A;  1D8J A;  4N0B A;  5DD8 A;  2ME6 A;  1V5G A;  2FUG 2;  3I4P A;  2HPI A;  4P96 A;  1P9Q C;  2HVQ A;  1GV2 A;  2QEX I;  3ABM H;  4CXF A;  3MN2 A;  1OQY A;  1TBX A;  3CMA I;  1MSF C;  3S8P A;  2ZJR F;  4UUS A;  2JVH A;  1S5L C;  2FJ1 A;  3JRH A;  1OCT C;  4HRI A;  1IW7 F;  1UMQ A;  2WV1 A;  2D1H A;  2VN2 A;  1HW5 A;  1O57 A;  1QHH D;  4CDG A;  2DOD A;  4HNU A;  3BTC A;  3O3K A;  3ZMZ A;  2X1C A;  1S29 A;  1KGS A;  4E7S A;  1R1U A;  4XQF A;  1ACI A;  3FDY A;  2W24 A;  4A3L J;  4NBQ A;  5TJJ A;  1P7I A;  4DYC A;  2K5C A;  3HPG A;  2P7V B;  4FE7 A;  1XS9 A;  5D4S A;  5F64 A;  3E5U A;  5IT9 Z;  3K4L A;  2H8R A;  3CO7 C;  1T0F A;  1TL8 A;  4KNY A;  3CO6 C;  4E7J A;  5FLX K;  3T8R A;  2HI3 A;  1OLT A;  2JK3 A;  5D6F A;  2ZNY A;  3WHB A;  2OUM A;  1YFH A;  1ZR4 A;  4BBR J;  3BJA A;  4BNC A;  1TT5 B;  1ZQ3 P;  1RES A;  1X58 A;  1D3Y A;  1W0U A;  2ZXJ A;  2Q1Z B;  1V55 H;  3HGG A;  3KP5 A;  2EZL A;  5DEQ A;  1PJR A;  1ON1 A;  4IRH A;  4J00 A;  3CES A;  1IUY A;  3I4N J;  2L9N A;  2XF7 A;  4NUB A;  3ZQ7 A;  2KIM A;  5ICE A;  2R7U A;  1LNW A;  3O8H A;  1WJD A;  1W7P A;  3GF2 A;  1YTY A;  2IXS A;  4M3F A;  4G7O F;  3MMY B;  2PX9 A;  2N8G A;  1T8I A;  2W82 A;  5TRD A;  3WTS C;  1ORK A;  3RPQ A;  2HGC A;  2QSG X;  1N78 A;  5IP6 A;  2TCT A;  3H3U A;  2M0C A;  4QWQ A;  2NS0 A;  1B8I B;  3GTK J;  1ZG1 A;  5IYC J;  1FBQ A;  3FXO A;  1K6Y A;  2STT A;  3NAR A;  2MW8 A;  3MKW B;  1TNT A;  2X6W A;  5LGU A;  2E7W A;  2QBY A;  5FGM A;  4LOC A;  4AUX A;  4G94 A;  4PJN A;  3RYR A;  2QF7 A;  5DM7 F;  1MBK A;  2KZG A;  5GAD J;  3QYE A;  3ZN0 A;  3JCU C;  4WCG A;  4RGU A;  2CQQ A;  4YIF A;  2HQ5 A;  4UY8 I;  2V1D A;  4XKC A;  5KHD A;  4LK0 F;  1XD7 A;  4JBA A;  1AU7 A;  4UHT A;  4OU0 A;  1GDT A;  4D7N A;  2KL4 A;  2V7F A;  3WU1 B;  2FOW A;  1JUS A;  2F4M B;  2VQH A;  1XSD A;  3OYB A;  3W6J B;  3HSR A;  2MYS A;  3F23 A;  1RIO H;  1JGS A;  4LG3 A;  3NQO A;  1B9M A;  1Y1V J;  3CMM A;  4LLG F;  1MJA A;  2WAD A;  2LH9 A;  4HBL A;  2BXY A;  1KU2 A;  2R7D A;  2L7K A;  3GZ5 A;  4QPO A;  1FC3 A;  5CVR A;  4HLY A;  1PUF B;  1JJ6 C;  1HQC A;  1HBX G;  3F9K A;  1DPR A;  2CQK A;  1BM9 A;  1MJ9 A;  2ZME B;  4B3X A;  2V4J C;  3CC2 I;  2E35 A;  2XPU A;  2QKL B;  3D5S C;  3TQN A;  3S3N A;  3SDG A;  3CME I;  4X6A J;  2X4H A;  1Y39 A;  1LFB A;  1T2K A;  1KON A;  1MZB A;  2EQR A;  5FKN A;  3GX4 X;  1JGG A;  3TP0 A;  1LQ1 A;  4CZC A;  1OIS A;  3OYA A;  1YRN B;  1ZHF A;  3LNQ A;  1MIJ A;  1OJL A;  2KZV A;  4XRF A;  3GYH X;  4EAT A;  3E0J B;  1JE8 A;  4I76 A;  1I1G A;  3E6B A;  1WKM A;  3HM5 A;  1I6X A;  3DKX A;  1G8X A;  2W48 A;  3GLX A;  2Y0M A;  3OYL A;  2FML A;  3ONQ A;  3DTI A;  4R79 A;  3LOC A;  2DTR A;  2FU4 A;  2XC7 A;  3CCS I;  2LBF A;  3H5R A;  5HS9 A;  4M73 A;  5K7H A;  2JPB A;  3GFI A;  2PI0 A;  2XAU A;  3Q0V A;  4RAF A;  4KIB A;  2MLG A;  3C1D A;  1YO5 C;  4RBO A;  2VQL A;  1ETY A;  2ID6 A;  4RAY A;  2XF5 A;  1OPC A;  3BDD A;  2DA4 A;  4Y13 A;  1S7O A;  1T08 B;  3BR6 A;  4EGY A;  3DPL C;  1VI0 A;  5FLX Z;  2WWY A;  2IS1 A;  1HXD A;  3OSF A;  1RC9 A;  2OCE A;  3ERM A;  5LBQ A;  2DDB A;  4XLF A;  2EBI A;  2HKX A;  2RDP A;  4N4N B;  3K4N A;  2QQ8 A;  3IP4 B;  5FKK A;  5ILU A;  1K6O A;  1S72 I;  5CPR B;  4RM3 A;  3TDZ C;  3RZO J;  3F21 A;  3QYB A;  1RNL A;  4LMY A;  4HG2 A;  2ZFW A;  2GWR A;  3PIO F;  4A69 C;  2V79 A;  1XC5 A;  1T95 A;  4ESB A;  2BBY A;  5IT3 A;  2MFZ A;  1LEB A;  3DTK A;  3S16 J;  4AIH A;  3ZCO A;  4FET A;  2EWN A;  1USS A;  4ZYG A;  1R58 A;  1D1A A;  2AXT C;  3GW2 A;  2DMN A;  4A5N A;  2K3F A;  3HIF A;  3BPV A;  3G71 I;  1P92 A;  1LEA A;  3OS2 A;  3BP8 A;  3EUK L;  3CJQ B;  1BI0 A;  5D5V B;  2V6E A;  4PUS A;  2LKS A;  3IKT A;  3BR3 A;  2EIL H;  2VKV A;  4OWR B;  5D5W B;  4XMY A;  1Y6I A;  4G7Z F;  2VBX A;  1RUN A;  5E8G A;  2JRT A;  5KVR A;  4QIW N;  5FKM A;  4M72 A;  1YW8 A;  4B48 A;  2R7T A;  5IPA A;  3TGN A;  4L5E A;  2M8G X;  3GFL A;  4XN3 A;  3K9T A;  2ME0 A;  4RA2 A;  5ED4 A;  4XKW A;  2EV0 A;  5FB2 A;  4MQV A;  3Q0U A;  4HYE A;  1DU0 A;  3QP6 A;  3CZ6 A;  3RJP A;  5IY5 H;  4L9V A;  1TW3 A;  1HW1 A;  3QPH A;  3M9A A;  3WHC A;  2KIQ A;  1RKW A;  3TDU C;  4XRS G;  5E3M A;  5JFR A;  3BG7 A;  1QO0 D;  1R5I D;  2P6T A;  4IHY A;  2XSD C;  2WY7 Q;  4CUG A;  3DCF A;  4YEJ A;  3TOB A;  3KET A;  3BY6 A;  1MNM C;  1Z05 A;  2HNH A;  3BWG A;  3OYC A;  4ESJ A;  4ZDO A;  3FF5 A;  2JPC A;  4PSX A;  1E3P A;  3COA C;  4EVI A;  2CYY A;  1IAW A;  2RC4 A;  2LTP A;  2B63 J;  3WTZ A;  3E1S A;  4BDZ A;  2CWE A;  3CUQ C;  1U9O A;  1TC3 C;  3OR1 C;  4C2M J;  3M3Y J;  4IOA F;  3AG1 H;  1UHS A;  2X0L A;  3VEP A;  2R7W A;  1YX5 A;  3I59 B;  2MD0 A;  2K27 A;  2B9S A;  1BR4 A;  4FCY A;  2E1C A;  1LPQ A;  1DGW Y;  1XSV A;  1R5G A;  2STW A;  3FBI B;  2LKP A;  4Y4R A;  3CMY A;  5KAF C;  1W7P B;  1XGO A;  5EEG A;  5DV5 A;  2DMT A;  1MMN A;  1IRX A;  3OIQ A;  1JXS A;  3HOU J;  1ZLJ A;  5C3E J;  2K3P A;  4EM2 A;  3SDB A;  1RUO A;  3R0A A;  3MAJ A;  3AL0 C;  1QVT A;  2K9M A;  3FMQ A;  4U0Y A;  1OKR A;  4IHT A;  1TQM A;  5GP9 A;  1BW5 A;  2D2W A;  1RRJ A;  2L9R A;  4O5V A;  3CP2 A;  1B8I A;  3EDP A;  4HQE A;  4DZJ A;  1FBS A;  4R8H A;  4LLN A;  1Y0U A;  4HV6 A;  2M87 A;  3PFY A;  1A04 A;  4G6D A;  4NNJ A;  2IT0 A;  3S93 A;  1ZAR A;  5FFZ A;  4RGS A;  4HEA 2;  3S17 J;  1N75 A;  1P7J A;  2R7V A;  3KFW X;  5EJC A;  4GFB A;  1VQP I;  5EDN A;  1X3W B;  5CQG A;  1T33 A;  4A0Y A;  3DPU A;  2A61 A;  1B9N A;  4CCK A;  4CZZ A;  3K70 C;  3REO A;  1ZG3 A;  4ITV A;  3HRT A;  3J80 Z;  2LD5 A;  1KYZ A;  2I10 A;  1F36 A;  4WX9 A;  1ODD A;  2VPR A;  3GFM A;  3FX3 A;  2XGC A;  2BXZ A;  4AU7 A;  1SAX A;  2VQC A;  3U9G A;  2YPR A;  4RB0 A;  1XCB A;  5DS9 A;  2LOO A;  3OV8 A;  1IF1 A;  1XB4 A;  3I0T A;  2IGO A;  5JHU A;  1NG7 A;  2MC3 A;  4EJW A;  1R36 A;  3BCA A;  3FXJ A;  4PFO A;  2HPM A;  2E1O A;  4RB2 C;  1FOX A;  2E60 A;  4UUS B;  2NS7 A;  1J9I A;  2DW4 A;  1ZK8 A;  3OS0 A;  2G7U A;  4NQW A;  3WOD F;  3ABL H;  2H8W A;  2NYX A;  5BPD A;  3RTR A;  5IT9 K;  4PDK A;  3V7R A;  1SFK A;  3KP7 A;  2NS8 A;  3EYY A;  5DM6 F;  3HOW J;  1MJB A;  4GGG A;  2XB0 X;  4MIM A;  1FTT A;  1X1P A;  2R92 J;  2R93 J;  4WXC A;  3GBG A;  2Y30 A;  2P5K A;  5FKL A;  1YG2 A;  1O3T A;  1Y0N A;  2PMZ A;  1N25 A;  1NK2 P;  2A6H F;  2KT0 A;  1WHU A;  3EYI A;  2NRA C;  5LHH A;  3RKX A;  4Y52 J;  3QPS A;  2QYO A;  1XSX A;  2WB1 A;  2E1M C;  3CLO A;  4UV9 A;  3FZV A;  5LD2 C;  5D6E A;  1ZEL A;  2CMP A;  1REP C;  2QA4 I;  4WF2 A;  3KZZ A;  2JQ7 A;  3D0S A;  2KRC A;  2L9S A;  3U1K A;  3NRV A;  2X1E A;  1ZYR F;  3PIP F;  2XAH A;  2VKD A;  3QQA A;  2DJN A;  3ZP5 A;  2P5L C;  3ELK A;  1WJC A;  3I53 A;  2LMD A;  2XDV A;  4II2 A;  5DTD A;  2L2O A;  3NAU A;  2DDA A;  1SVL A;  3PJR A;  4RB3 C;  4I7H A;  3VOD A;  2RNG A;  2YU9 J;  3M7G A;  2H27 A;  1FOY A;  4EM0 B;  2LKX A;  1T56 A;  2CQN A;  3SZT A;  3N97 A;  4A93 J;  4L9J A;  2UXX A;  4XIC A;  2EFW A;  3CLQ A;  4BJ5 C;  3KLN A;  4FE4 A;  3DV8 A;  3IV5 A;  3DKW A;  3M1E A;  2DQR A;  2DYS H;  2WA0 A;  3ESW B;  2VBZ A;  4HF2 A;  3KP6 A;  4JX6 A;  1X3U A;  2RV8 A;  1ETV A;  1QZZ A;  4LIU A;  2ACJ A;  1FBU A;  3GZN B;  4OIO F;  3BG9 A;  2F4I A;  3QOD A;  2EIN H;  2XKO A;  3S1M J;  2LY1 A;  3CJR B;  2O03 A;  3CCV I;  2FOK A;  1SD4 A;  4I6Z A;  3HPH A;  4B4C A;  2EA4 A;  4CYC B;  5HDG A;  4EJO A;  1FWZ A;  3OYK A;  2BY3 A;  2UUZ A;  2VI6 A;  3A02 A;  5J4V A;  3H9Q A;  3K4M A;  5DYM A;  3FMS A;  5H20 A;  4HDV A;  2DA2 A;  4B09 A;  5EZG A;  3H3Z A;  5ICG A;  4PJM A;  5K5O A;  4NQW B;  1YHQ I;  1S8N A;  2ADU A;  2JVG A;  3ROU A;  5L3G A;  1TQP A;  1U8B A;  1DQU A;  4G8X A;  3J81 Z;  3BZ6 A;  4ZC3 A;  2FSW A;  3LMM A;  4M9Z A;  2WY8 Q;  1TWC J;  1D0Y A;  1XGS A;  3G6E I;  5FLV A;  1JJ8 C;  1UG2 A;  5J6X A;  2NAZ A;  4BQA A;  4FX0 A;  3HOV J;  2CGP A;  4C3I J;  3J7A Y;  1YW7 A;  2W4S A;  1RKT A;  3JRE A;  1R00 A;  1MMA A;  3OYN A;  2RKH A;  4BJ6 C;  2L4A A;  3OS1 A;  1MBF A;  2RQQ A;  1U5T A;  4FT8 A;  2VBY A;  3O8G A;  2GA1 A;  5D8L B;  3GME A;  3D5L A;  2ESN A;  2M30 A;  1FSE A;  2DFF A;  1ZTR A;  3MQ0 A;  4BE1 A;  4FQG A;  1SC7 A;  1IRG A;  4XOT A;  1Y8R B;  3GWZ A;  5HOD A;  6PAX A;  1G3W A;  3IH4 A;  1T0F C;  2IGK A;  4KA4 A;  1EF4 A;  1FMV A;  3NEU A;  3HRU A;  3I56 I;  4XRM A;  2KIF A;  3M8F A;  1WVR A;  3VDX A;  1RET A;  1QU3 A;  3DWL E;  1PP8 F;  2PLY A;  2KP6 A;  4ENM A;  1JUM A;  2PMH A;  2L4M A;  1PUF A;  1SAN A;  5DCF A;  2TRT A;  3ML6 A;  1KZH A;  1SVM A;  2EV6 A;  2ELK A;  2J5P A;  3AG4 H;  3J7Y J;  1RPW A;  1T98 A;  2JUC A;  3KEY A;  4V2F A;  3E7L A;  2Y75 A;  2O7O A;  4ZJZ A;  4DQ2 A;  1TNS A;  3HOZ J;  2HOT A;  3QAH A;  5M5W J;  1S7A A;  1HC8 A;  3ZQG A;  3JTH A;  2DN0 A;  5TGT A;  5CQE A;  1VQM I;  2GXG A;  3Q9V A;  4X0G A;  3EET A;  2ZJQ F;  1L0O C;  3CTA A;  4GRI A;  3S2W A;  4YFK F;  2KJC A;  3RYP A;  3L2R A;  2MSY A;  4V2G A;  3TOA A;  5HNF A;  2XKP A;  4MEX F;  4JK1 X;  3FBN B;  2BY2 A;  2W25 A;  4J19 A;  4GYI A;  2K9L A;  2X1D A;  1Z1D A;  2VC0 A;  2JN6 A;  1OYW A;  3C2B A;  3W3C A;  1H0M A;  3RCO A;  4XON A;  2LYC A;  3K6G A;  2O0Y A;  2OZU A;  3A4C A;  3L9F A;  2ISY A;  1WJB A;  1H9G A;  2HYG D;  4DIQ A;  3FIS A;  2XF6 A;  3A01 A;  5LEJ A;  1CF7 B;  1SFU A;  2CQX A;  4FTH A;  4CH7 A;  3SEQ A;  1BJZ A;  2HYJ A;  2FBI A;  3MD2 A;  2KIU A;  4WXD A;  2C6Y A;  3DFG A;  3I58 A;  2E2I J;  2Z16 A;  3FHN A;  4M3E A;  2FQ3 A;  2OV7 A;  3OL3 A;  1U3E M;  2R7X A;  1QHG A;  4PJJ A;  1XMK A;  1ERD A;  4HF0 A;  2QM3 A;  2D45 A;  2LFB A;  1QGP A;  2VOD A;  3SFZ A;  3SQN A;  4ABZ A;  2FNP A;  4Z2Y A;  3FXQ A;  3K4K A;  3UR3 C;  2O5R A;  3F72 A;  1D5Y A;  1XGM A;  1FPQ A;  4A3B J;  3LFU A;  1YRN A;  1LUJ B;  2IGM A;  3C2H A;  1X2M A;  3CQZ J;  3HUG A;  1MMS A;  2CU7 A;  2COB A;  1VQ9 I;  5CVU A;  3AAF A;  3KP3 A;  2E36 A;  2LC2 A;  4KN7 X;  3HRM A;  3A01 B;  3TO9 A;  5E18 F;  1X1D A;  3BZK A;  3J7A O;  3G2B A;  3C7J A;  1D8K A;  4IOC F;  2XIG A;  1GHC A;  3SYT A;  5CVV A;  3IAM 2;  3PM1 A;  2QQA A;  2EH3 A;  2K4J A;  1KQ8 A;  1K79 A;  4AD9 A;  3DP7 A;  2D5V A;  2JSP A;  1WSU A;  5JHF A;  4ON0 A;  4IHS A;  3GLL A;  1MNE A;  3LQR A;  2LLK A;  2AQF A;  1HSJ A;  2HOE A;  3KPH A;  4ZYA A;  4I99 C;  2L5Q A;  3K1M A;  2NVY J;  1PP7 U;  3PNY A;  5JI6 A;  1SVO A;  4XID A;  4OIQ F;  1KQ9 A;  2V9V A;  2BOL A;  1GLN A;  3OSG A;  1T38 A;  2ZXH A;  3EUH C;  4YG2 F;  3OYE A;  3H3V K;  2CUE A;  1O3S A;  1R22 A;  2FMY A;  2JRM A;  3HC7 A;  3DF8 A;  1GV5 A;  1SD6 A;  3T8T A;  4B3A A;  2VXZ A;  2LR8 A;  3H9G A;  4LB6 B;  3QWL A;  2F5D A;  5FKO A;  4CCN A;  2P7C B;  1ZRC A;  1VZ0 A;  3GTJ J;  1Z91 A;  3FXR A;  4RGX A;  2QGU A;  4KIC A;  3QOP A;  4BXU A;  1UST A;  1W7P D;  4W1U A;  1YI2 I;  2F6C A;  2JT1 A;  1DDN A;  1UFM A;  2CFO A;  3BG6 A;  4RGR A;  3TKY A;  4ETS A;  1HKS A;  1OR7 A;  2HQR A;  2BY0 A;  3HOY J;  3PSF A;  3W2W A;  3F8M A;  3CC7 I;  2XVC A;  3DU6 A;  2VE9 A;  5CLS A;  4C3H J;  4AYB A;  1XGN A;  2AS5 F;  4FX4 A;  1H88 C;  3DQV C;  1STZ A;  4W97 A;  3F0C A;  4BEH A;  1G4D A;  2JA8 J;  2K40 A;  1ZG5 A;  4KIT B;  1JKQ C;  1MBE A;  5E1W A;  4GXO A;  1N77 A;  3UNG C;  4BKX A;  4IEJ A;  1JUP A;  2ESH A;  2LVS A;  4CCJ A;  3D1N I;  3HOX J;  1JHF A;  4L18 B;  3K0L A;  4AC0 A;  2VKE A;  1XDS A;  3T1B A;  5F6F A;  3CUQ A;  4XLA A;  3HUG B;  2ICW G;  1P4A A;  1FIP A;  1W5C C;  4U7D A;  4NB5 A;  1EA3 A;  5E3N A;  4XLC A;  1ZGJ A;  3V8J A;  2W00 A;  2KJB A;  3JRG A;  1FTZ A;  1FLI A;  1XN7 A;  3V4G A;  3T5X A;  5IYB J;  3PNV A;  1QRY A;  3ZMV A;  5CVJ A;  2R5Z B;  5E79 C;  1RR7 A;  2IP2 A;  1V4R A;  2CG4 A;  4BY1 J;  3Q5F A;  4A3C J;  3DU5 A;  1WJE A;  4H0E A;  3OYG A;  3H0G J;  2K85 A;  3MZY A;  2FXA A;  3ZMS A;  2FX0 A;  2B0L A;  4OIR F;  5EEA A;  1IUF A;  2FQ4 A;  3OYH A;  3L2U A;  2Z9O A;  2LF7 A;  3LSR A;  1UZC A;  1ZGW A;  4E7Z A;  1K4S A;  1BR1 A;  2FA5 A;  1IGN A;  3MCZ A;  2WC2 A;  1BJA A;  2GBY A;  5EG0 B;  5E1X A;  3BPX A;  1EV7 A;  4NC7 A;  4LGW A;  3PO3 J;  1SFX A;  3L09 A;  4D5C A;  1ZRD A;  1Z3X A;  2K86 A;  2DOA A;  3PSI A;  3PUB A;  4AID A;  2YU3 A;  4CA0 A;  3A2K A;  2M4G A;  2LY2 A;  4AIJ A;  4G7H F;  4LLL A;  3IL2 A;  1FOK A;  1PUE E;  4HLX A;  2XUB A;  2LBF B;  4BL0 B;  4M3B A;  2W7N A;  5E20 A;  2Y69 H;  3KLO A;  1GXQ A;  2I5U A;  3CCU I;  3TW7 A;  3KYC B;  5F0C A;  1MMD A;  2A6E F;  1G2H A;  1F9N A;  2AXL A;  3G3Z A;  4Y3O A;  4G9Y A;  4ZYD A;  2DU9 A;  1OCZ H;  4IHW A;  1WI9 A;  1B1B A;  4YFX F;  3RQI A;  4ZZD A;  1XPX A;  3K69 A;  4MLO A;  3ZQC A;  1OCO H;  1Z77 A;  3F8F A;  5FRO A;  5FLM J;  1BI1 A;  2CW7 A;  2XV4 S;  1LE8 A;  2A6T A;  2CW0 F;  4BEH B;  4MTE A;  5J8C A;  1HF0 A;  2RNJ A;  2W85 A;  4E4H A;  5LGT A;  2DOE A;  4U0V A;  3LL7 A;  1I3A A;  3HRS A;  2JTV A;  3TO6 A;  2XAG A;  4OIN F;  1ON2 A;  1Z6R A;  3HZJ A;  3JAM K;  2NNN A;  4XLN F;  1LVA A;  4HNT A;  1FY7 A;  1BIB A;  5LRR A;  3J81 K;  2MH9 A;  4RAG A;  4XOP A;  3E97 A;  3FIW A;  2IA0 A;  1E3H A;  4ESF A;  2BEO A;  2HR3 A;  4I0A A;  1J5Y A;  2ZO4 A;  3WG9 A;  2R5Y B;  1GUU A;  2BW3 A;  1E17 A;  2DK5 A;  3OMY A;  5TIS C;  1V5F A;  2KLO A;  2XRO A;  4ZTF A;  1U2W A;  3S3O A;  4A3E J;  3FXU A;  4XKB A;  1IO2 A;  2E34 A;  2EFN A;  4HF1 A;  1SFO J;  2KFD A;  2HXO A;  5M5Y J;  3FM5 A;  3A0H C;  3WGI A;  5BMZ A;  5BQT A;  1EH6 A;  1J09 A;  3OOU A;  2CSO A;  5AON A;  5HLT A;  2ELJ A;  4L9T A;  3RZD J;  2VJ5 A;  4A12 A;  1U6G A;  4IF4 A;  3WU2 C;  1X19 A;  3BRO A;  3F8N A;  5A2Q Z;  2V1X A;  2UZK A;  2R5Y A;  1EH7 A;  1ZLK A;  4IXA A;  4BAY A;  1G3S A;  4MFD A;  5J3L A;  3HSE A;  3ZQQ A;  2Q8K A;  3F6O A;  1OCC H;  3TMO A;  3FKJ A;  2M5W A;  3E6D A;  4OAY A;  3CCQ I;  4C30 A;  4PGG A;  2OAZ A;  2KRH A;  1IG7 A;  3PL8 A;  2CUZ A;  2PEX A;  2XB5 A;  1F5T A;  5FRN A;  4KT6 A;  5EG0 A;  1RR8 C;  2BE5 F;  5F1R A;  4YEL A;  1JI8 A;  1IRF A;  2DJI A;  5LLQ A;  5EZH A;  3SZP A;  4FAS D;  5ILV A;  2PMU A;  3A1Y A;  2KQR A;  1JT0 A;  5IP7 J;  4M71 A;  3VWB A;  2FEZ A;  2OA4 A;  2ZNZ A;  3BR5 A;  3VYS B;  2Z33 A;  4HDU A;  5EYR A;  3GTM J;  1FNN A;  1ZAO A;  5LEK A;  3I71 A;  1FP2 A;  3CD6 I;  2OJE D;  2QEN A;  4XRS A;  2M2E A;  2JZY A;  3CF5 F;  1F43 A;  2M8E A;  3F8B A;  1WGX A;  2Q2E A;  4A3G J;  1WI3 A;  5F1J A;  3WTW C;  4BHC A;  4EJT A;  2LY9 A;  5FD5 A;  1YIJ I;  1KA8 A;  2EB7 A;  3ZPL A;  1TW2 A;  3BQZ A;  3GFJ A;  1WJ5 A;  3PFI A;  4NC6 A;  3GO5 A;  4EM1 A;  2WBM A;  1LDD A;  3GEZ A;  4UV8 A;  3HEF A;  4M6X A;  1TZL A;  3L7W A;  2P0W A;  4XN0 A;  5FJ8 J;  1K4T A;  1FZP B;  4HAM A;  1QVU A;  4BQQ A;  3CJN A;  3QU3 A;  1ZGA A;  3FXL A;  4P5O A;  4R1H A;  4A6D A;  2LG4 A;  2GXA A;  2DFH A;  3S32 A;  2CV2 A;  3W2A A;  3DBL B;  4RAZ A;  2Y0S N;  1Z67 A;  1GXP A;  1BN5 A;  2HQA A;  3GVA A;  2QCO A;  4A3J J;  2CS3 A;  4M9X A;  2L0K A;  2RGV A;  2XAF A;  1IN7 A;  1Z7U A;  2DTZ A;  3H0D A;  1AKH B;  3S15 J;  3VFZ A;  4F92 B;  2VE8 A;  1R49 A;  3OIP A;  1F1Z A;  1ULY A;  2F5V A;  5H6Q A;  2RRE A;  4HX8 A;  2X9D A;  4BXX J;  3AFH A;  5GAH J;  3KZY A;  3E3V A;  3K2A A;  5E3O A;  4Q48 A;  4EJU A;  2FRH A;  2Y2Z A;  5E8I A;  3QPL A;  2GIV A;  1ONV A;  3ZMD A;  3VYT B;  3KIO A;  1P4X A;  5LHG A;  3SEZ A;  1AA7 A;  3IWF A;  1TWA J;  1H9T A;  2F5F A;  3BCB A;  4HV5 A;  3X2Q H;  4D7M A;  3JRI A;  4UVC A;  4MGR A;  3OYJ A;  1R4N B;  4S0H B;  2MBF A;  5BS6 A;  4E70 A;  2M45 A;  4M3G A;  1VFC A;  2CUF A;  3H5N A;  4UB8 C;  4HX7 A;  5GTH C;  4IKF A;  5HLG A;  2FNA A;  3G73 A;  2Z3Y A;  2H1L A;  2WV0 A;  2ZJP F;  2GLO A;  2E19 A;  2MC4 A;  4A6E A;  3P9K A;  3MWM A;  4PFP A;  1DUX C;  4YIR X;  2O61 A;  1LB2 A;  2YUS A;  2YX4 A;  4UVA A;  4I02 A;  4CGZ A;  5EEH A;  4BYY A;  1J2X A;  5M3F J;  1VQK I;  1IZ1 A;  2XSJ C;  1WJF A;  3O2P E;  4JOM A;  1HDD C;  2DO7 A;  3BR2 A;  1B59 A;  3HHG A;  1BI3 A;  4K2E A;  1QPI A;  1SMT A;  3ZRG A;  4PCQ A;  1G59 A;  3ASN H;  3IKV A;  1IC8 A;  3DLA A;  4I01 A;  2QWW A;  3HKZ A;  4BQO A;  2FE3 A;  4G6T B;  5L3E A;  1R7J A;  3BG3 A;  3BJ6 A;  1VQ5 I;  2Z99 A;  3RQ4 A;  1TTY A;  4Z6Y A;  5D5X B;  2OQR A;  5L3B A;  1L3L A;  2VKH A;  2PJR A;  2QBY B;  2JJ7 A;  4PJ0 C;  3HOT A;  1EJ9 A;  1VQ8 I;  3W6V A;  5F0F A;  1ZN2 A;  4RS8 A;  3BZC A;  1Z9C A;  1R1T A;  4UVB A;  1IXS B;  1Y8Q B;  3KZI C;  4F52 A;  1SD7 A;  3S2D J;  3MFK A;  4F3Q A;  2ZBK A;  1IN6 A;  3CCR I;  4KMU X;  1WWX A;  3H5A A;  5DUK A;  1JHH A;  4A2U A;  4CCM A;  3CF2 A;  1R9T J;  3ZOB A;  2DQL A;  3R0J A;  4WWC A;  4U0W A;  2Z1D A;  2CQ7 A;  5K5Q A;  4IL6 C;  1DPU A;  2GA2 A;  3B6C A;  1YQA A;  2HS5 A;  1UCR A;  4PGH A;  4MQ9 F;  1G6N A;  2PBI A;  1GVJ A;  4Q5S F;  3FM3 A;  3JTG A;  4U87 A;  2CW8 A;  1MD0 A;  1UJ8 A;  2E71 A;  3G1M A;  3DKY A;  4DOZ A;  2DAO A;  3MZ8 A;  2R7R A;  3C18 A;  1WCM J;  2M4K A;  5M5X J;  3PUF A;  1TQI A;  2QQB A;  4EQQ A;  1KU3 A;  1B4A A;  4BS9 A;  4V19 K;  2CFX A;  1MKM A;  4CHU A;  2L01 A;  3PQJ A;  2IA1 A;  1P4W A;  2DOF A;  2M9H A;  1TWG J;  3FWE A;  3BOQ A;  2EV5 A;  3E5Q A;  1EKE A;  3SZG A;  3GTP J;  4Q4Z F;  2GOM A;  2Q2E B;  3K4J A;  4J01 A;  4F7Z A;  2KKO A;  2IW5 A;  2XPV A;  1K78 B;  2VPL A;  4ZDL A;  2DPU A;  2V9P A;  1UEL B;  3WE3 A;  5E17 F;  4LIT A;  3V8K A;  1Y56 A;  1DP7 P;  5DDG A;  2G9W A;  3W6K B;  3IH3 A;  3Q0W A;  3HG9 A;  3LA7 A;  2A3S A;  5L3F A;  4E7H A;  5E3L A;  2UXN A;  4LG0 B;  4ZDP A;  4JX4 A;  3JRF A;  4MNU A;  2ECB A;  2WB1 N;  2XRN A;  2FD5 A;  2BGC A;  4RDU A;  4CIC A;  3RKQ A;  3E6M A;  4GCV A;  1Q1V A;  1B72 A;  1D5V A;  1IXC A;  2WAQ A;  3S14 J;  1FIA A;  1V54 H;  3EQL F;  1YJ9 I;  1TP4 A;  3ECH A;  4BUP A;  2A5W A;  3L2Q A;  3U1D A;  4A3F J;  5EF6 A;  2IGN A;  2DK8 A;  3LWF A;  5J4Y A;  3LSH A;  2EZH A;  2L3D A;  2RVC A;  4ZH4 F;  4UNO A;  3L1P A;  2EFP A;  2UV1 A;  1UHW A;  5D8K B;  4ZYH A;  3CDI A;  2HVR A;  5K7F A;  2JSC A;  1OR7 C;  1PVE A;  1C0W A;  3TL4 X;  2DYR H;  1QQI A;  1ZR2 A;  3OYD A;  1IXR C;  1POG A;  1VF9 A;  2VT3 A;  2KDO A;  3HHH A;  2IS4 A;  2KPM A;  5ICF A;  1S6L A;  3LAP A;  2GIZ A;  3HB9 A;  3IAS 2;  3M8J A;  2BW3 B;  5C4J J;  1U5T C;  2VL8 A;  4DBR A;  2CV0 A;  5HS7 A;  2EZI A;  3BT9 A;  2M34 A;  3M1C A;  1JTX A;  3OY9 A;  9ANT A;  3GTO J;  4PZJ A;  3ULQ B;  4EEF G;  3HL2 A;  1KU7 A;  3FHZ A;  1JT6 A;  2Y9Y A;  1P2F A;  5A2Q K;  2J5O A;  2NNY A;  3OOP A;  1XDU A;  4OMY A;  2K7L A;  1S3J A;  1I5Z A;  1W4M A;  2YS9 A;  5BPI A;  1I6H J;  1I27 A;  3K4B A;  4IQJ A;  3ISP A;  4FIS A;  2HVS A;  3LSI A;  3K1N A;  2QSH X;  2X48 A;  3BJO A;  4WK8 F;  2GXB A;  1FSH A;  1TT0 A;  1YS7 A;  3QPT A;  3KP4 A;  3L2V A;  2MG4 A;  1A5J A;  3J7Z I;  1TWH J;  2RQP A;  2BVL A;  3HYI A;  1A6Q A;  4IPA A;  3JRD A;  1AHD P;  5BNG A;  3VOE A;  2PMZ N;  2CUJ A;  5C44 J;  2HYF A;  1MDM A;  1FYM A;  2HU9 A;  4XSX F;  4XBF A;  1NG6 A;  3J80 K;  3S2H J;  2DFE A;  2QUF A;  3I9V 2;  2M7B A;  3ZMU A;  2VJJ A;  3JAM Z;  1VND A;  1ETO A;  3HOS A;  1ENH A;  1K7A A;  2L02 A;  2XGX A;  3CP8 A;  3GXO A;  1NH3 A;  4JX5 A;  1XMX A;  1MGT A;  1MH4 A;  3ECO A;  4G6Q A;  3ABK H;  4L5J A;  4ZTJ A;  2R0Q C;  4MO7 A;  1E3O C;  5DCM B; 
#chains in the Genus database with same CATH homology
 3IHU A;  4IJA A;  2HEO A;  1NHA A;  1FP1 D;  1FYL A;  4IRI A;  3B02 A;  5AIQ A;  4M9S A;  2V6C A;  3B73 A;  2ZME A;  3R61 A;  2EFO A;  2HTS A;  5CVI A;  3O6B B;  5L3D A;  4BHB A;  1HW2 A;  3MEX A;  4NHJ A;  2RN7 A;  4ENK A;  3LST A;  3RPU A;  1BI2 A;  5H6R A;  3WTT C;  1R23 A;  4ENN A;  3P7N A;  1YS6 A;  4D0P A;  4XLP F;  2Z5U A;  3H92 A;  2GQQ A;  2R3S A;  1YYV A;  4KFC A;  3RI4 A;  1LDJ A;  3WTY C;  3GUD A;  2OD5 A;  4HA8 A;  2YSR A;  2CO5 A;  2W57 A;  3DEU A;  2XAJ A;  3TO7 A;  4BHP A;  2O8X A;  4HX4 A;  3E6C C;  3HSF A;  4YFN F;  3L2C A;  5LRS A;  2H6C A;  5D4R A;  4OIP F;  2HWV A;  4O6J A;  2VON A;  2QLZ A;  2E1N A;  5ERI A;  1E2X A;  2IPQ X;  2MH2 A;  3EUH A;  3R6S A;  4Y17 A;  4I09 A;  4LJZ F;  3I5U A;  1IN8 A;  4IRG A;  4L9N A;  4HOB A;  4HQM A;  1U78 A;  3WGG A;  1W5S A;  2YX7 A;  2H94 A;  1J7K A;  1SD5 A;  4B8X A;  4AIK A;  4O3M A;  3T0Y A;  4MTD A;  2MLK A;  3DPT A;  1T6S A;  5J8F A;  1B6A A;  3Q9S A;  2OZ6 A;  1O3R A;  4KYW A;  1BC7 C;  3DXJ F;  1VTN C;  4EV0 A;  1QPM A;  1W5T A;  4MEY F;  4WXH A;  4AVP A;  1YIO A;  4HZF A;  3KE2 A;  2DBB A;  5K5R A;  2DFI A;  4N9H A;  1SMY F;  3F3X A;  3LFK A;  2FBK A;  2H6B A;  2LF8 A;  2Q0O A;  3WTV C;  3LA3 A;  4EGZ A;  2EK5 A;  4IVN A;  2QVO A;  3LQQ A;  5K1Y A;  3RKY A;  3QRF F;  2PN6 A;  4BH9 A;  3N4M A;  2G7H A;  4QLC U;  1HKQ A;  2DPD A;  3WE2 A;  3R4K A;  3JSO A;  1BOA A;  1U5T B;  3GZ6 A;  4EJV A;  4LG0 A;  1LJ9 A;  2EA2 A;  1KQ0 A;  2V1U A;  1AOY A;  1KU9 A;  1EH8 A;  4GO1 A;  2VOO A;  2HKO A;  1OMI A;  2WTE A;  5KK1 A;  1OYY A;  4ENJ A;  1O3Q A;  1QZY A;  4I98 B;  5HVQ C;  4KDP A;  3RIR A;  3HTU A;  2GZW A;  5HDN A;  2HQN A;  2BV6 A;  1G3Y A;  2A5Y B;  1V3F A;  4N9I A;  5DCM A;  5CJ9 A;  1Q1H A;  2ELH A;  2VT2 A;  1WRJ A;  4M74 A;  1T39 A;  1SFE A;  1J59 A;  3E5X A;  1KYW A;  1RZ4 A;  3ABU A;  2YR2 A;  1R1V A;  1YLF A;  2BYV E;  2UWM A;  1HKT A;  4KIG A;  2D1V A;  2DT5 A;  2F2E A;  2ETH A;  4CYD A;  3QP5 A;  1CF7 A;  2XAQ A;  3K1P A;  2O3F A;  3V8L A;  1ZRE A;  4LB5 A;  1MDM B;  4EMS A;  1BC8 C;  1P6R A;  4I0B A;  5LGN A;  3C3W A;  3LA2 A;  1FX7 A;  1PDN C;  3I54 A;  4LD5 A;  3CUO A;  3WGH A;  3SHF A;  2GAU A;  2H09 A;  1U8R A;  3P9I A;  4A5M A;  2FF4 A;  2HDC A;  1R5H A;  2K02 A;  2HZT A;  2LSO A;  1J0R A;  3L00 A;  2P4W A;  4M6Y A;  3KCC A;  1F4K A;  3IRQ A;  3QU6 A;  3IRR A;  3SXY A;  1G3T A;  2F5E A;  4L5I A;  4P9F A;  5E1Z B;  1ZH5 A;  1OYI A;  3F8C A;  1CGP A;  2OBP A;  5ILS A;  2L54 A;  4TV7 A;  3F6V A;  3HTS B;  1J75 A;  4L0Y B;  2O6G E;  2K4B A;  4Q47 A;  5JR3 A;  2P5V A;  2XHK A;  5HOO A;  2E7X A;  3JW4 A;  4OOI A;  2QQ9 A;  2F5C A;  5DD4 A;  3KEQ A;  1LDK B;  2MA3 A;  5HLI A;  4I2O A;  5FFX A;  4UUV A;  5BOX A;  4P55 A;  2A69 F;  1AWC A;  5FO5 A;  3ZMT A;  2ISZ A;  2QZ8 A;  3RKW A;  3R60 A;  4GYG A;  2COM A;  3I59 A;  5CYV A;  4RB1 A;  2P8T A;  4U88 A;  4CO8 A;  3JSP A;  1YW9 A;  3KEO A;  2DLL A;  2EJR A;  2W84 A;  2PG4 A;  5HLH A;  4JQF A;  3PQK A;  4MHG A;  1WQ2 A;  4HW0 A;  5D5U B;  4YII A;  4A0X A;  1RI7 A;  2PQ8 A;  3ZN1 A;  1BIA A;  1I1S A;  2MD5 A;  2IJL A;  5FD6 A;  4XSZ F;  3V7C A;  2PFB A;  4S04 A;  4LK1 F;  3VB2 A;  2VC1 A;  2P6S A;  2IVM A;  3WU0 A;  2LNB A;  3CDH A;  4P9U A;  3LAJ A;  2ZCW A;  1K78 A;  4KMF A;  4KN4 X;  4ASN A;  2IRF G;  3P9C A;  2DI3 A;  4Y15 A;  4A0Z A;  1XMA A;  3M8E A;  2A07 F;  1FYK A;  4KT5 C;  1ZRF A;  4KUM A;  1TLH B;  1Z6T A;  3FMR A;  2EFQ A;  1XCV A;  3RDI A;  1O7F A;  3ABT A;  4S05 A;  2IA2 A;  4DNC A;  4KIF A;  1UHM A;  2HTJ A;  2ZKZ A;  4LFU A;  3MZH A;  3U2R A;  2M1B A;  3IWZ A;  2OU2 A;  2PJP A;  4UXN A;  4AWX B;  2A68 F;  1QBJ A;  1HST A;  3IC7 A;  2OQG A;  5ICC A;  3WTX C;  2LDU A;  3I64 A;  5HDK A;  2FBH A;  5JVT A;  1IN4 A;  2ZJ2 A;  1BBY A;  5AIP A;  2Y48 A;  4ZYE A;  2TDX A;  1O7L A;  4U7B A;  1QNT A;  4ZZL A;  2VOP A;  2KRF A;  1IN5 A;  2VBW A;  3ERE D;  4FHT A;  3K2Z A;  1FT9 A;  3F22 A;  3KP2 A;  3WTU C;  5HS8 A;  2HFH A;  4OMZ A;  1UB9 A;  5L3C A;  5LHI A;  2XAS A;  5DUI A;  3V7S A;  2R7F A;  3CUQ B;  4L0Z B;  1D8J A;  4N0B A;  5DD8 A;  3I4P A;  4P96 A;  4CXF A;  1TBX A;  1IW7 F;  2D1H A;  2VN2 A;  1HW5 A;  1O57 A;  4CDG A;  3O3K A;  3ZMZ A;  1S29 A;  1KGS A;  1R1U A;  2W24 A;  5TJJ A;  2P7V B;  5D4S A;  5F64 A;  3E5U A;  5IT9 Z;  3CO7 C;  1T0F A;  4KNY A;  3CO6 C;  5FLX K;  3T8R A;  5D6F A;  2ZNY A;  1YFH A;  4BNC A;  3BJA A;  1D3Y A;  2ZXJ A;  3KP5 A;  5DEQ A;  1ON1 A;  4IRH A;  1IUY A;  3ZQ7 A;  2KIM A;  5ICE A;  1LNW A;  1W7P A;  3GF2 A;  1YTY A;  4G7O F;  5TRD A;  3WTS C;  3RPQ A;  2HGC A;  3H3U A;  4QWQ A;  2NS0 A;  1ZG1 A;  1FBQ A;  2STT A;  1TNT A;  2QBY A;  5LGU A;  2E7W A;  5FGM A;  4G94 A;  3RYR A;  3ZN0 A;  4WCG A;  4RGU A;  4YIF A;  2V1D A;  4LK0 F;  1XD7 A;  4JBA A;  4UHT A;  4OU0 A;  3WU1 B;  1XSD A;  3W6J B;  3HSR A;  3F23 A;  1RIO H;  1JGS A;  3NQO A;  1B9M A;  4LLG F;  1MJA A;  4HBL A;  1KU2 A;  2R7D A;  4HLY A;  3GZ5 A;  5CVR A;  1FC3 A;  1HQC A;  1HBX G;  1DPR A;  2CQK A;  1BM9 A;  1MJ9 A;  2ZME B;  3TQN A;  2X4H A;  1T2K A;  1MZB A;  3GX4 X;  1LQ1 A;  1ZHF A;  3GYH X;  4XRF A;  1JE8 A;  1I1G A;  3E6B A;  1WKM A;  1I6X A;  3GLX A;  2Y0M A;  2FML A;  4R79 A;  2DTR A;  2FU4 A;  5HS9 A;  4M73 A;  2JPB A;  3GFI A;  2PI0 A;  4KIB A;  2MLG A;  3C1D A;  1YO5 C;  4RAY A;  3BDD A;  1OPC A;  4Y13 A;  1S7O A;  4EGY A;  3DPL C;  5FLX Z;  2WWY A;  1HXD A;  5LBQ A;  2HKX A;  2RDP A;  5ILU A;  1K6O A;  3TDZ C;  3F21 A;  1RNL A;  4LMY A;  2ZFW A;  2GWR A;  2V79 A;  4ESB A;  2BBY A;  5IT3 A;  1LEB A;  4AIH A;  2EWN A;  1USS A;  4ZYG A;  1R58 A;  4A5N A;  3GW2 A;  3HIF A;  3BPV A;  1P92 A;  1LEA A;  3BP8 A;  1BI0 A;  5D5V B;  3IKT A;  5D5W B;  4G7Z F;  2VBX A;  1RUN A;  5E8G A;  2JRT A;  5KVR A;  4M72 A;  1YW8 A;  3TGN A;  3GFL A;  3K9T A;  5ED4 A;  2EV0 A;  5FB2 A;  4MQV A;  4HYE A;  3QP6 A;  3RJP A;  4L9V A;  1TW3 A;  1HW1 A;  3QPH A;  3M9A A;  3TDU C;  5JFR A;  1QO0 D;  2P6T A;  3TOB A;  3KET A;  3BY6 A;  1Z05 A;  4ESJ A;  3BWG A;  3FF5 A;  2JPC A;  3COA C;  4EVI A;  2CYY A;  1IAW A;  2RC4 A;  3WTZ A;  2CWE A;  3CUQ C;  2X0L A;  3VEP A;  3I59 B;  2E1C A;  2K27 A;  1XSV A;  1R5G A;  2STW A;  2LKP A;  1W7P B;  1XGO A;  5EEG A;  5DV5 A;  1JXS A;  1ZLJ A;  4EM2 A;  1RUO A;  3R0A A;  3MAJ A;  4U0Y A;  3FMQ A;  1OKR A;  4IHT A;  1TQM A;  2D2W A;  4O5V A;  3EDP A;  4HQE A;  1FBS A;  4R8H A;  4LLN A;  1Y0U A;  4HV6 A;  2M87 A;  1A04 A;  4G6D A;  2IT0 A;  1ZAR A;  5FFZ A;  4RGS A;  3KFW X;  4A0Y A;  2A61 A;  1B9N A;  4CZZ A;  3REO A;  1ZG3 A;  3HRT A;  3J80 Z;  1KYZ A;  4WX9 A;  1ODD A;  3GFM A;  3FX3 A;  1SAX A;  3U9G A;  2YPR A;  4RB0 A;  1XCB A;  3OV8 A;  1IF1 A;  1XB4 A;  3I0T A;  5JHU A;  4EJW A;  2MC3 A;  1R36 A;  4RB2 C;  1J9I A;  2DW4 A;  2G7U A;  4NQW A;  3WOD F;  2NYX A;  5BPD A;  3RTR A;  5IT9 K;  4PDK A;  3V7R A;  3KP7 A;  3EYY A;  1MJB A;  4GGG A;  4WXC A;  2P5K A;  1YG2 A;  1O3T A;  2A6H F;  3EYI A;  2NRA C;  5LHH A;  3RKX A;  2QYO A;  1XSX A;  3CLO A;  4UV9 A;  3FZV A;  5D6E A;  1REP C;  4WF2 A;  3KZZ A;  3D0S A;  3NRV A;  1ZYR F;  2XAH A;  3ZP5 A;  2P5L C;  3ELK A;  3I53 A;  4RB3 C;  4I7H A;  3VOD A;  3M7G A;  2H27 A;  4EM0 B;  3SZT A;  3N97 A;  4L9J A;  2UXX A;  2EFW A;  3KLN A;  3DV8 A;  3DKW A;  3M1E A;  2DQR A;  2VBZ A;  4HF2 A;  3KP6 A;  1X3U A;  2RV8 A;  1QZZ A;  2ACJ A;  1FBU A;  4OIO F;  2XKO A;  2O03 A;  2FOK A;  1SD4 A;  2EA4 A;  5HDG A;  4EJO A;  1FWZ A;  5DYM A;  3FMS A;  5H20 A;  4HDV A;  4B09 A;  5ICG A;  3H3Z A;  5K5O A;  1S8N A;  2ADU A;  3ROU A;  5L3G A;  1TQP A;  4G8X A;  3J81 Z;  3BZ6 A;  2FSW A;  4M9Z A;  1XGS A;  5J6X A;  2NAZ A;  4BQA A;  4FX0 A;  2CGP A;  1YW7 A;  1R00 A;  2RKH A;  2L4A A;  1U5T A;  4FT8 A;  2VBY A;  2GA1 A;  5D8L B;  3D5L A;  2ESN A;  2M30 A;  1FSE A;  3MQ0 A;  1IRG A;  6PAX A;  3GWZ A;  1G3W A;  4KA4 A;  3NEU A;  3HRU A;  2KIF A;  3M8F A;  1PP8 F;  2PLY A;  4ENM A;  2PMH A;  2L4M A;  5DCF A;  3ML6 A;  2EV6 A;  2J5P A;  1T98 A;  2Y75 A;  4DQ2 A;  1TNS A;  3QAH A;  1S7A A;  3JTH A;  2GXG A;  3Q9V A;  3EET A;  1L0O C;  3CTA A;  3S2W A;  4YFK F;  2KJC A;  3RYP A;  3TOA A;  2XKP A;  4MEX F;  4JK1 X;  2W25 A;  4GYI A;  1Z1D A;  2VC0 A;  1OYW A;  1H0M A;  2O0Y A;  2OZU A;  3L9F A;  2ISY A;  1H9G A;  2HYG D;  5LEJ A;  1CF7 B;  1SFU A;  2FBI A;  2KIU A;  4WXD A;  2C6Y A;  3DFG A;  3I58 A;  2FQ3 A;  1U3E M;  1XMK A;  4HF0 A;  2QM3 A;  2D45 A;  1QGP A;  2VOD A;  3SFZ A;  3SQN A;  2FNP A;  4Z2Y A;  3FXQ A;  3F72 A;  1XGM A;  1FPQ A;  3HUG A;  5CVU A;  3AAF A;  3KP3 A;  4KN7 X;  3HRM A;  3TO9 A;  5E18 F;  3J7A O;  3C7J A;  1D8K A;  2XIG A;  1GHC A;  5CVV A;  2QQA A;  2K4J A;  1KQ8 A;  1K79 A;  4AD9 A;  3DP7 A;  1WSU A;  4ON0 A;  4IHS A;  3LQR A;  1HSJ A;  2HOE A;  3K1M A;  1PP7 U;  5JI6 A;  4OIQ F;  1KQ9 A;  2V9V A;  1T38 A;  4YG2 F;  1O3S A;  1R22 A;  2FMY A;  3DF8 A;  1SD6 A;  3T8T A;  2VXZ A;  4LB6 B;  2F5D A;  2P7C B;  1ZRC A;  1Z91 A;  3FXR A;  4RGX A;  4KIC A;  3QOP A;  4BXU A;  1UST A;  1W7P D;  2JT1 A;  1DDN A;  1UFM A;  4RGR A;  3TKY A;  4ETS A;  1HKS A;  1OR7 A;  2HQR A;  3F8M A;  2XVC A;  2VE9 A;  5CLS A;  1XGN A;  2AS5 F;  4FX4 A;  3DQV C;  1STZ A;  1G4D A;  1ZG5 A;  5E1W A;  4GXO A;  2ESH A;  1JHF A;  4L18 B;  3K0L A;  1XDS A;  3T1B A;  5F6F A;  3CUQ A;  1P4A A;  4U7D A;  4NB5 A;  1ZGJ A;  3V8J A;  2KJB A;  1FLI A;  1XN7 A;  3V4G A;  3T5X A;  3ZMV A;  5CVJ A;  2IP2 A;  1V4R A;  2CG4 A;  3Q5F A;  4H0E A;  3MZY A;  2FXA A;  3ZMS A;  2B0L A;  4OIR F;  2Z9O A;  2LF7 A;  2FA5 A;  3MCZ A;  2WC2 A;  1BJA A;  5E1X A;  3BPX A;  1EV7 A;  4LGW A;  1SFX A;  3L09 A;  1ZRD A;  2K86 A;  2YU3 A;  4AIJ A;  4G7H F;  4LLL A;  3IL2 A;  1FOK A;  1PUE E;  4HLX A;  2XUB A;  5E20 A;  3KLO A;  1GXQ A;  2A6E F;  1F9N A;  2AXL A;  3G3Z A;  4G9Y A;  4ZYD A;  2DU9 A;  1WI9 A;  1B1B A;  4YFX F;  4ZZD A;  3K69 A;  3F8F A;  1BI1 A;  2XV4 S;  2CW0 F;  4MTE A;  5J8C A;  2RNJ A;  2W85 A;  5LGT A;  4U0V A;  3HRS A;  2JTV A;  3TO6 A;  2XAG A;  4OIN F;  1ON2 A;  1Z6R A;  3JAM K;  2NNN A;  4XLN F;  1LVA A;  1FY7 A;  1BIB A;  5LRR A;  3J81 K;  2MH9 A;  3E97 A;  2IA0 A;  4ESF A;  2BEO A;  2HR3 A;  4I0A A;  1J5Y A;  2ZO4 A;  3WG9 A;  1E17 A;  2DK5 A;  2XRO A;  1U2W A;  3FXU A;  2EFN A;  4HF1 A;  5BMZ A;  3FM5 A;  3WGI A;  5BQT A;  1EH6 A;  2CSO A;  5AON A;  4L9T A;  4A12 A;  1U6G A;  4IF4 A;  3BRO A;  3F8N A;  5A2Q Z;  2V1X A;  2UZK A;  1EH7 A;  1ZLK A;  4IXA A;  4BAY A;  1G3S A;  3HSE A;  2Q8K A;  3F6O A;  2M5W A;  3E6D A;  4PGG A;  2OAZ A;  2PEX A;  1F5T A;  2BE5 F;  5F1R A;  1IRF A;  5LLQ A;  3SZP A;  5ILV A;  2PMU A;  4M71 A;  2FEZ A;  2OA4 A;  2ZNZ A;  2Z33 A;  4HDU A;  1FNN A;  1ZAO A;  5LEK A;  3I71 A;  1FP2 A;  2QEN A;  2JZY A;  2M8E A;  3F8B A;  2Q2E A;  3WTW C;  4BHC A;  4EJT A;  5FD5 A;  1KA8 A;  2EB7 A;  3ZPL A;  1TW2 A;  3GFJ A;  3PFI A;  3GO5 A;  4EM1 A;  1LDD A;  3GEZ A;  4UV8 A;  4M6X A;  3L7W A;  1FZP B;  4HAM A;  3CJN A;  3QU3 A;  1ZGA A;  4P5O A;  4R1H A;  4A6D A;  4RAZ A;  1GXP A;  1BN5 A;  3GVA A;  4M9X A;  2RGV A;  2XAF A;  1IN7 A;  1Z7U A;  3VFZ A;  2VE8 A;  1F1Z A;  1ULY A;  5H6Q A;  4HX8 A;  3KZY A;  3E3V A;  4Q48 A;  4EJU A;  2FRH A;  5E8I A;  2GIV A;  1ONV A;  3ZMD A;  1P4X A;  5LHG A;  3IWF A;  1H9T A;  2F5F A;  4HV5 A;  4UVC A;  4MGR A;  2MBF A;  5BS6 A;  4E70 A;  2M45 A;  4HX7 A;  5HLG A;  2FNA A;  3G73 A;  2Z3Y A;  2WV0 A;  4A6E A;  3P9K A;  3MWM A;  1DUX C;  2O61 A;  1LB2 A;  4UVA A;  2YX4 A;  4CGZ A;  4I02 A;  5EEH A;  4BYY A;  1J2X A;  1IZ1 A;  3O2P E;  2DO7 A;  1B59 A;  3HHG A;  1BI3 A;  4K2E A;  1SMT A;  4PCQ A;  3IKV A;  4I01 A;  2QWW A;  2FE3 A;  5L3E A;  1R7J A;  3BJ6 A;  2Z99 A;  1TTY A;  5D5X B;  2OQR A;  5L3B A;  1L3L A;  2QBY B;  3HOT A;  1ZN2 A;  4RS8 A;  1Z9C A;  1R1T A;  4UVB A;  1IXS B;  1SD7 A;  3MFK A;  2ZBK A;  1IN6 A;  4KMU X;  1WWX A;  5DUK A;  1JHH A;  4A2U A;  2DQL A;  3R0J A;  4WWC A;  4U0W A;  5K5Q A;  1DPU A;  2GA2 A;  1YQA A;  2HS5 A;  1UCR A;  4PGH A;  4MQ9 F;  1G6N A;  2PBI A;  1GVJ A;  4Q5S F;  3FM3 A;  3JTG A;  1MD0 A;  2DAO A;  3C18 A;  1TQI A;  2QQB A;  4EQQ A;  1KU3 A;  1B4A A;  2CFX A;  1MKM A;  4CHU A;  2L01 A;  3PQJ A;  2IA1 A;  1P4W A;  3FWE A;  3BOQ A;  2EV5 A;  3E5Q A;  4Q4Z F;  4F7Z A;  2KKO A;  2IW5 A;  1K78 B;  2DPU A;  5E17 F;  3WE3 A;  3V8K A;  1DP7 P;  5DDG A;  2G9W A;  3W6K B;  3LA7 A;  2A3S A;  5L3F A;  4LG0 B;  2UXN A;  4MNU A;  2XRN A;  2BGC A;  4CIC A;  3E6M A;  4GCV A;  1D5V A;  1IXC A;  3EQL F;  3ECH A;  3U1D A;  2DK8 A;  3LWF A;  2L3D A;  2RVC A;  4ZH4 F;  4UNO A;  2EFP A;  1UHW A;  5D8K B;  4ZYH A;  2JSC A;  1C0W A;  1QQI A;  1IXR C;  2VT3 A;  3HHH A;  5ICF A;  1S6L A;  3LAP A;  1U5T C;  5HS7 A;  4PZJ A;  3ULQ B;  1KU7 A;  3FHZ A;  1P2F A;  5A2Q K;  2J5O A;  2NNY A;  3OOP A;  1XDU A;  4OMY A;  2K7L A;  1S3J A;  1I5Z A;  1W4M A;  5BPI A;  1I27 A;  3ISP A;  2GXB A;  1FSH A;  3K1N A;  4WK8 F;  3BJO A;  1YS7 A;  3QPT A;  3KP4 A;  2RQP A;  3HYI A;  4IPA A;  3VOE A;  2HYF A;  1MDM A;  1FYM A;  4XSX F;  4XBF A;  3J80 K;  2QUF A;  3ZMU A;  3JAM Z;  3HOS A;  1K7A A;  2L02 A;  2XGX A;  3GXO A;  1MGT A;  3ECO A;  4G6Q A;  4L5J A;  5DCM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...