5BMZA

Crystal structure of putative marr family transcriptional regulator hcar from acinetobacter sp. adp complexed with 24mer dna.
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
139
structure length
139
Chain Sequence
EEEPRLSYMIARVDRIISKYLTEHLSALEISLPQFTALSVLAAKPNLSNAKLAERSFIKPQSANKILQDLLANGWIEKAPDPTHGRRILVTVTPSGLDKLNQCNQVVQQLEAQMLQGVDINLAFLIRNNLELMVKNLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HcaR protein
publication title Crystal Structure of Putative MarR Family Transcriptional Regulator HcaR from Acinetobacter sp. ADP complexed with 24mer DNA.
rcsb
source organism Acinetobacter baylyi (strain atcc 33305 / bd413 / adp1)
total genus 42
structure length 139
sequence length 139
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5bmzA00
1XSDA 3I54A 3PFIA 1ON1A 2H6BA 4I7HA 3FXRA 1U8RA 2XKOA 4AIHA 1YS6A 1I6XA 1S3JA 1K79A 4QLCU 2VT3A 4G7HF 4CXFA 3HOTA 3U2RA 2LKPA 1YS7A 3R4KA 2D1VA 4RGXA 4HX8A 2VOOA 3BJOA 2PQ8A 4L0ZB 1WI9A 2CYYA 3KP4A 3TDZC 2AS5F 2G7UA 5LEJA 4HX7A 1CGPA 3MQ0A 4A0YA 1B59A 3OOPA 3WODF 3MFKA 3DV8A 2PN6A 3L7WA 2HEOA 3F6VA 1FYLA 4KIBA 3ZPLA 5K5OA 1FP1D 3TDUC 1LDDA 3C7JA 2XRNA 1J75A 2YR2A 5BPDA 2Z99A 1BM9A 2QWWA 4LFUA 1IRGA 2FBIA 4BHPA 3NRVA 5JVTA 5DEQA 1IAWA 3IKTA 4CDGA 1U78A 1IXCA 2V1XA 3TOBA 2A07F 4Z2YA 2L4MA 5CYVA 4A5MA 4IPAA 4M72A 2EB7A 2P7CB 2P4WA 1C0WA 4G7ZF 1F9NA 4BNCA 5ILSA 3GO5A 1IN4A 2JTVA 3QPHA 1U6GA 2DU9A 1TTYA 4ON0A 4I0BA 5F6FA 1HBXG 1KU2A 4YFKF 3F72A 3V7SA 2XVCA 3J7AO 5DUKA 4UUVA 4G94A 4LLLA 2QBYA 1Z05A 2ZJ2A 1UCRA 2V1DA 1QO0D 1R1VA 1J9IA 2RGVA 1FC3A 3DEUA 3IKVA 5FD6A 2VC1A 2QZ8A 4GO1A 1FY7A 1TLHB 3C18A 1O3RA 2ISYA 4CICA 1HQCA 3L09A 2CO5A 2ZBKA 3SZTA 3SZPA 2FMYA 1BI3A 5FD5A 5D5XB 2E1CA 5LGTA 1SMTA 2A3SA 2HZTA 3LWFA 1YFHA 2OZUA 4M74A 3ZN1A 1MGTA 1KQ8A 3RIRA 3H3ZA 1K78A 4UNOA 3O6BB 1UFMA 2QM3A 2GAUA 1XGOA 3FMSA 5DD8A 1BI0A 2ZO4A 5KK1A 2CW0F 1O7FA 2F5EA 4RB1A 3F21A 2L01A 1AWCA 4MEXF 1KU9A 3WGIA 4DQ2A 4M71A 3ZMVA 4ZH4F 3E6DA 2VONA 1F5TA 3FXQA 1J0RA 4KFCA 1Q1HA 2IA0A 1OPCA 1EH7A 1FT9A 2AXLA 3JSPA 5E17F 1R00A 2K02A 5CVIA 4HV6A 2DPUA 4Y13A 3K9TA 1I5ZA 2UZKA 2MLKA 5L3EA 4BAYA 1CF7A 1SFEA 2GQQA 1QZYA 4EGYA 4WF2A 4A6EA 3KP3A 3CUQA 1W5TA 3RYPA 4RGSA 3E6CC 2PG4A 3K0LA 3TO6A 4JBAA 3IRQA 1G3SA 4CZZA 4G8XA 3BJAA 3LFKA 2ZMEB 3H3UA 1USSA 4ZZLA 2LDUA 5E1ZB 1BJAA 3GLXA 3H92A 1Z91A 3JAMK 1HKTA 1D3YA 1SAXA 4Q4ZF 4Y15A 3TO9A 4UHTA 1MKMA 3ERED 4P55A 1K78B 2VE9A 2QQAA 3GWZA 4ESBA 2MA3A 1IN6A 2DFIA 2QENA 3WG9A 4RGRA 3CDHA 2VXZA 4UXNA 5ICCA 3L00A 2DLLA 3J80Z 1WWXA 2WWYA 2VT2A 3RI4A 6PAXA 2HWVA 1O3QA 3HYIA 2HYFA 1E2XA 2IJLA 1IRFA 4JQFA 2ACJA 2ESHA 1SD6A 3WTTC 2Q2EA 4ESFA 4ZYGA 2W84A 3K69A 3ZMTA 3P9IA 4FHTA 2P5LC 3ZMZA 3SFZA 5CJ9A 2EWNA 1JHHA 1S7AA 3P7NA 3RKWA 2MLGA 1ZREA 1O3SA 1YW8A 2EV5A 1YQAA 2V79A 4EJVA 1LB2A 4B09A 4FX0A 1TBXA 3T0YA 3FM5A 4HLYA 1S6LA 1ZRCA 2EK5A 2NS0A 2P8TA 2IP2A 1LJ9A 1BC7C 2LF8A 3FWEA 4KIGA 2OQGA 3TO7A 3CO6C 2OAZA 3K1NA 1KQ0A 2L02A 4BXUA 3VODA 4EV0A 2DQRA 4GXOA 4YG2F 3ZMDA 3MWMA 1U5TA 1R7JA 3EUHA 1KQ9A 2ESNA 3I64A 2DAOA 4OU0A 3KZZA 2IT0A 3QP5A 1X3UA 1EH8A 1UHMA 1ZLKA 1K7AA 4TV7A 2KIFA 3I58A 1RUNA 2DW4A 1GXQA 2O6GE 1QZZA 1B6AA 3SQNA 2ADUA 1HSTA 3EYIA 3ABUA 1NHAA 4UV8A 1ZYRF 1LNWA 4P9UA 5J6XA 1Z6RA 2P5KA 3Q9SA 2M5WA 4BH9A 5LGUA 3RPQA 3E3VA 2YPRA 2HFHA 3RJPA 1R23A 2HTSA 1MD0A 5L3BA 3HOSA 2RVCA 2HKXA 2ZCWA 1L0OC 1B9MA 5E8IA 4MEYF 3I5UA 3DPTA 3LA7A 3LSTA 1SFXA 2MH2A 5BQTA 3D0SA 4XSZF 3JTGA 3JAMZ 4OIQF 3EQLF 2VC0A 2F5FA 2XROA 2A61A 3FX3A 4G6DA 1U5TB 1ULYA 1KYZA 1XDUA 4A0ZA 3WTUC 1ZHFA 3B73A 3KZYA 2D2WA 4L5IA 4MQ9F 2M45A 2BBYA 4KIFA 1LEBA 4EMSA 2EFNA 1XCVA 4IF4A 5CLSA 1REPC 3FF5A 1I1GA 2EJRA 1S29A 1JGSA 5CVVA 1HXDA 2XAFA 1MDMA 4UVAA 5E1XA 4ENMA 3GFJA 3FXUA 4LK1F 3WE2A 5LRSA 5LRRA 2VODA 4KA4A 2Y48A 4U0WA 1TQPA 3T1BA 4HDUA 3IWFA 1A04A 2FRHA 3S2WA 3GEZA 4YIIA 2MC3A 3U9GA 4MTDA 3ZQ7A 1V4RA 4O3MA 4S04A 2Z33A 4B8XA 5J8CA 3RPUA 3E5XA 5K5QA 4S05A 1USTA 1E17A 4PGHA 3WTWC 3HHHA 1MZBA 1BBYA 1DDNA 4K2EA 1L3LA 2FA5A 3ML6A 2J5PA 2H09A 3FZVA 3F22A 4KICA 5DD4A 5BPIA 4BHCA 3WTSC 1JE8A 4KN4X 3DKWA 2WV0A 2DI3A 1KU7A 2FSWA 2TDXA 2MBFA 3F6OA 1FBSA 2HR3A 2KJCA 4N9IA 2QUFA 1J2XA 1GXPA 3E5QA 3IRRA 2FEZA 3GVAA 5AIPA 1LDJA 1V3FA 4HLXA 2OBPA 1LEAA 4HAMA 4MHGA 3V8KA 4RS8A 3MCZA 3FMQA 2IA1A 3KE2A 4EM0B 2VBZA 3V7CA 4UV9A 5DYMA 1FOKA 2M8EA 2E7WA 2HGCA 1MDMB 1BOAA 2O8XA 2EFOA 1DPRA 5FO5A 3KEQA 2DO7A 2XAGA 3K1MA 5EEHA 4G6QA 3HSFA 4HQEA 1PP7U 4XBFA 3ZN0A 3DQVC 5H6QA 4PGGA 4RAYA 1XDSA 1YG2A 3QU3A 1R5HA 1ZLJA 2BE5F 4ZYHA 1YW7A 5IT9K 4M9XA 3MEXA 1P2FA 4CO8A 3N4MA 5DDGA 2GXGA 3VEPA 2OA4A 4WXCA 3OV8A 2EFPA 2A69F 1IXRC 2FOKA 5DUIA 1B4AA 2UXNA 2VE8A 5F64A 3SXYA 2UXXA 3BZ6A 1FSEA 5D5VB 1YW9A 2DK8A 3RDIA 2M1BA 3T8TA 4UVCA 3CTAA 5FLXZ 4A12A 4IVNA 3WGGA 3R0JA 5H20A 5D5WB 1FLIA 3EYYA 2LNBA 2QQBA 3T8RA 3ELKA 2HDCA 3HRSA 4Q47A 2IW5A 1P4AA 4XLPF 1D8KA 5A2QZ 2FBKA 2A5YB 1FBUA 2Z3YA 5E20A 3WE3A 5AONA 1HKSA 1TNSA 3WU1B 5D8KB 4OMYA 2GIVA 1HSJA 4D0PA 4PDKA 1ON2A 2A6HF 1PDNC 1OR7A 2H6CA 4NHJA 1DP7P 3ISPA 2QBYB 5ERIA 4NB5A 3DPLC 5KVRA 4BHBA 2VBWA 4I02A 3ABTA 3BROA 1XGMA 1T6SA 5D6FA 4Q5SF 2PBIA 4QWQA 5BOXA 3QPTA 4KMFA 1SD7A 4A0XA 2O03A 2E7XA 5H6RA 1U3EM 3LA3A 2ZNYA 2R3SA 4LGWA 1YYVA 2OD5A 5D8LB 2V1UA 3BDDA 2PLYA 2FXAA 2X0LA 1QNTA 3E5UA 3IHUA 1EV7A 5ILVA 5HLHA 3CUQC 1Y0UA 1G6NA 4WXDA 5J8FA 3GFIA 3GFMA 1SD4A 1BN5A 3QP6A 4O5VA 5HOOA 2BV6A 1R58A 4HYEA 4IRHA 2PI0A 5L3CA 4HW0A 3M1EA 3V7RA 1KU3A 5BS6A 1W5SA 3TQNA 2XGXA 1STZA 4HBLA 3QAHA 4U88A 5JHUA 3KP2A 3LQQA 1FPQA 4U7DA 1P4WA 2YX4A 3RYRA 4GGGA 4YIFA 2RN7A 3T5XA 5ED4A 4KMUX 1XMAA 4U0VA 3HTSB 2W57A 2VOPA 5CVRA 1JHFA 4WWCA 4P5OA 2DTRA 1CF7B 3KLNA 2Z9OA 2O61A 1H9GA 1IZ1A 1IF1A 2Y0MA 3CUQB 4KDPA 1J7KA 5JFRA 3F23A 2FNAA 3I71A 4EM2A 3E6BA 1KA8A 1TW2A 1ZGAA 4NQWA 5FGMA 4RGUA 3GZ6A 2LSOA 4LG0A 2NRAC 3VB2A 1BI1A 2EA2A 1R36A 2IA2A 1P4XA 3HRTA 1T98A 1G4DA 1LDKB 1FP2A 3BPVA 1YTYA 2JT1A 4N0BA 2W24A 3B02A 4EGZA 4G9YA 2JPCA 4P9FA 2XASA 2V9VA 3ROUA 1H0MA 4KN7X 1W7PA 2HKOA 5AIQA 1OMIA 1YIOA 5HLGA 3G73A 2J5OA 3QU6A 2G7HA 2OQRA 4CHUA 2FBHA 1XSXA 2VN2A 2GA2A 4IXAA 4P96A 1BC8C 1DUXC 2QVOA 4PCQA 1XCBA 2MH9A 1SFUA 4EJTA 1U5TC 2WC2A 3KFWX 3SHFA 4EM1A 4I01A 1IW7F 1J59A 5L3DA 4LB6B 2Z5UA 3DF8A 1ZG1A 3WGHA 3RKYA 3N97A 3GYHX 4DNCA 2PJPA 1S7OA 4ASNA 2PEXA 2YSRA 4HQMA 2B0LA 1IN5A 2G9WA 2L4AA 3QRFF 2HYGD 4U7BA 1KYWA 4RB3C 5HS7A 2XAHA 5CVJA 4R79A 4LD5A 1FWZA 1Z6TA 2WTEA 2K4JA 1U2WA 3MZYA 4M6YA 3CLOA 3GZ5A 3V8LA 5D6EA 4WXHA 5K1YA 3JSOA 3COAC 1W7PB 3DXJF 4AIJA 4OMZA 2W85A 2K7LA 3J81K 2F5CA 2E1NA 3KETA 2XAQA 3BPXA 4M73A 4YFNF 1AOYA 4U0YA 1HW5A 2W25A 3GX4X 4RAZA 1QQIA 3Q5FA 1ONVA 4LJZF 2FNPA 2NNNA 1G3YA 4G7OF 5ICEA 1BI2A 1ZN2A 3O3KA 2K4BA 1T38A 1XGSA 1YLFA 4ENKA 2DPDA 1B9NA 4AVPA 3BP8A 5TJJA 3F8NA 4I0AA 2P5VA 1FYKA 1RZ4A 1TQIA 5HLIA 1ZH5A 5LHHA 4R8HA 2OU2A 4OIRF 2EFWA 4ENNA 2D45A 2COMA 3BOQA 4I09A 1GVJA 1UHWA 5DV5A 1MJAA 1ZG5A 2LF7A 4FX4A 1BIBA 5HVQC 3KP7A 4Y17A 1HW1A 1RUOA 3QOPA 5HDGA 4N9HA 2KKOA 2MD5A 1MJ9A 1WRJA 2JSCA 2RC4A 2DK5A 2O3FA 4M9ZA 3E6MA 2DT5A 2ZFWA 3NEUA 1I27A 4Q48A 2GXBA 1T2KA 1XD7A 2O0YA 2RNJA 4MGRA 4A5NA 5DCFA 3L9FA 4BYYA 3M7GA 2OZ6A 2XKPA 3DFGA 2CFXA 4ZYDA 3VOEA 1T0FA 5K5RA 2NAZA 1ZRFA 4IRIA 4ZYEA 1SD5A 3V8JA 3HSEA 4MQVA 1TW3A 3RKXA 3C1DA 2IRFG 3KEOA 3R60A 2JPBA 4HZFA 2FU4A 3BWGA 3VFZA 2RDPA 4I2OA 1KGSA 4KUMA 3J80K 4KYWA 2Q0OA 5EEGA 3NQOA 3WTXC 5JR3A 4ESJA 3ULQB 4FT8A 1Z7UA 3HRMA 1XGNA 4WX9A 3CUOA 3BY6A 3HUGA 2DBBA 2BYVE 4HX4A 3KP6A 4L5JA 2L54A 3GW2A 1D5VA 1ZGJA 3HIFA 2P7VB 2XAJA 2CGPA 3LAJA 3F8BA 2ELHA 3HSRA 2C6YA 1O57A 3ZMSA 1FBQA 2X4HA 1RI7A 2QLZA 1PP8F 1QBJA 1FX7A 4M9SA 2A6EF 5FFXA 2R7FA 4BQAA 4GYGA 3KLOA 1LVAA 1Z1DA 2DQLA 4HOBA 2Y75A 1DPUA 3MAJA 4F7ZA 4O6JA 3I0TA 3REOA 2VBXA 2ZMEA 3J81Z 3WTYC 3TKYA 3FHZA 5L3GA 3ZP5A 3KCCA 2IPQX 3IWZA 5JI6A 3WU0A 3M8EA 3P9KA 1F1ZA 4RB2C 1R5GA 5FB2A 3LAPA 3O2PE 2RKHA 3RTRA 4A2UA 2ETHA 2H27A 1B1BA 5HS8A 3G3ZA 4XRFA 2H94A 3IL2A 4JK1X 1OKRA 2XUBA 4A6DA 3Q9VA 3HHGA 3K1PA 4IHTA 5D4SA 5LLQA 1VTNC 4RB0A 2A68F 2CWEA 2FF4A 1TNTA 4L18B 2L3DA 5ICFA 3P9CA 3WTVC 4CGZA 2RV8A 2IVMA 2HQRA 2EV6A 4L9VA 1ODDA 2P6SA 3K2ZA 3I4PA 2F5DA 4UVBA 1D8JA 2YU3A 2ZXJA 3CO7C 3R61A 3W6KB 2KJBA 2NNYA 1G3WA 3R0AA 4M6XA 4EVIA 4LB5A 2NYXA 3LQRA 5CVUA 5LHIA 4ZZDA 2M87A 1S8NA 2FMLA 1O3TA 1I1SA 4ETSA 1XMKA 5HDKA 2GZWA 1GHCA 2PMHA 4R1HA 2BGCA 1SMYF 3GUDA 4MTEA 3AAFA 1RIOH 4LMYA 4AWXB 3F8MA 1P6RA 3ECHA 3IC7A 5TRDA 1IUYA 4HF1A 1FNNA 1ZAOA 1EH6A 1YO5C 4KNYA 2XHKA 3C3WA 3GF2A 1QPMA 3CJNA 5BMZA 5IT3A 4H0EA 3I59A 2QYOA 2Q8KA 4EJOA 3KP5A 3TOAA 2JZYA 1HW2A 3E97A 4LLGF 2BEOA 2K86A 2EV0A 2F2EA 4HDVA 4HA8A 5DCMA 5D5UB 1IXSB 5LGNA 4OOIA 1IN8A 1WSUA 5IT9Z 4IJAA 1XSVA 4L9JA 1G3TA 1OYIA 3V4GA 2HOEA 3U1DA 2PMUA 1OYWA 3EDPA 2GWRA 2YX7A 1W4MA 3F8FA 3PQKA 4AIKA 3GXOA 3JTHA 4XSXF 1XN7A 3R6SA 4XLNF 5ICGA 2STWA 2STTA 2M30A 3ECOA 1WQ2A 5HDNA 4EJWA 2ZNZA 1JXSA 4WCGA 4HF2A 1J5YA 2D1HA 2QQ9A 4LK0F 5E18F 5E8GA 2FE3A 3FM3A 2UWMA 2CQKA 1K6OA 1R1UA 1O7LA 5L3FA 5HS9A 3BJ6A 3I59B 2HTJA 2KRFA 2FQ3A 5D4RA 3W6JB 4IHSA 3PQJA 1MJBA 2EA4A 1H9TA 4EQQA 5DCMB 1UB9A 3I53A 3EETA 3HRUA 1QGPA 1HKQA 3TGNA 2XV4S 1FSHA 2K27A 4AD9A 1P92A 3GFLA 4L9NA 3DP7A 3D5LA 3HTUA 4I98B 1WKMA 2JRTA 2V6CA 3WTZA 3F8CA 4PZJA 4L9TA 2HS5A 2HQNA 4LLNA 2P6TA 4HF0A 1TQMA 1BIAA 5LEKA 3L2CA 2EFQA 3M9AA 2KIMA 5LBQA 1OYYA 4LG0B 3FMRA 1T39A 1FYMA 5FFZA 3LA2A 1RNLA 2XIGA 1LQ1A 1W7PD 4OIOF 4E70A 5F1RA 4IRGA 1R1TA 4GYIA 1R22A 4WK8F 2ISZA 1ZRDA 4GCVA 2ZKZA 4L0YB 4KT5C 2R7DA 3ZMUA 1XB4A 2CG4A 5FLXK 4EJUA 4HV5A 2PFBA 4OINF 1IN7A 1F4KA 3MZHA 2CSOA 1Z9CA 5ILUA 4YFXF 1ZG3A 5E1WA 3F3XA 1FZPB 4ENJA 2GA1A 5LHGA 1ZARA 2VBYA 4OIPF 4MNUA 3M8FA 1PUEE 2RQPA 4CYDA 2KIUA 5A2QK 3JW4A
chains in the Genus database with same CATH superfamily
1XMXA 2GBYA 2WAEA 3QPLA 1XSDA 3S1QJ 3I54A 1SAUA 3CF5F 4PSXA 3MKZA 3PFIA 1ON1A 2H6BA 1UJ8A 2LD5A 4I7HA 3GZNB 2L7KA 3FXRA 3JRHA 1U8RA 2M4GA 2XKOA 4AIHA 1YS6A 1I6XA 4A3JJ 5H2FC 1S3JA 1K79A 3MKWB 3SEQA 4QLCU 2VT3A 2L7MP 3SYTA 4G7HF 4CXFA 3LSGA 3HOTA 2BY0A 1OQYA 3U2RA 1I6HJ 4H4KC 2LKPA 4EEFG 1MMAA 1YS7A 3ABMH 3DKYA 2YU9J 3CQZJ 3R4KA 2D1VA 4XMYA 3MD2A 4RGXA 2L9NA 4HX8A 4BU2A 2VOOA 3BJOA 2PQ8A 4L0ZB 1OFCX 3LSPA 1WI9A 2X48A 2CYYA 3KP4A 1I39A 3TDZC 2AS5F 2G7UA 5LEJA 3TW6A 4HX7A 3S1RJ 1CGPA 3MQ0A 2M0MA 1WJCA 3A0HC 3TP0A 4A0YA 1B59A 4FISA 2QCOA 5IY5H 3OOPA 3L2WA 4MO7A 1MNEA 1T8IA 3WODF 2JSPA 5J1UA 4XICA 4DYQA 2LY2A 2DYSH 2ID6A 3KX2A 3MFKA 4F52A 3DV8A 2PN6A 3L7WA 2HEOA 4NC7A 3HDDA 3DCFA 1ORKA 3F6VA 1FYLA 2HDDA 4KIBA 1FMWA 3OYNA 3ZPLA 1DU6A 5K5OA 1FP1D 4BJ6C 3TDUC 3CCVI 1LDDA 1MBEA 2EINH 4DZPA 3LSIA 3C7JA 2XRNA 1FIAA 1J75A 2YR2A 5BPDA 2Z99A 2H8RA 1BM9A 2BVMA 2QWWA 3BG6A 4LFUA 4X6AJ 2HXIA 1IRGA 2B7EA 2CFOA 2O7OA 1RR8C 2FBIA 4BHPA 4ZTFA 3NRVA 5IOYA 3U1KA 5JVTA 5DEQA 1IAWA 3IKTA 4CDGA 1U78A 1IXCA 2V1XA 3CMYA 1W0UA 3TOBA 2AQFA 2AO9A 1B8IA 2A07F 4Z2YA 2L4MA 5CYVA 4A5MA 3AKZA 5EG0A 4I99C 3G1OA 4IPAA 3I56I 1X1DA 3OR1C 4IHXA 4DBQA 2GIZA 4XN3A 4M72A 4A3BJ 1FOYA 2M4KA 2Y2ZA 1FOXA 2EB7A 4IO9F 2P7CB 2P4WA 1T0FC 1C0WA 4G7ZF 1F9NA 3I3LA 5ILSA 4BNCA 3GO5A 1IN4A 2JTVA 2WADA 3W2AA 1V54H 3QPHA 4CH7A 1U6GA 2DU9A 3K7AJ 1TTYA 3A4CA 4ON0A 4I0BA 1EJ9A 5F6FA 2WY8Q 1HBXG 1KU2A 1VZ0A 4YFKF 4J01A 2LH9A 3F72A 4U87A 1YJ9I 3PNYA 1VFCA 1T56A 1GLNA 3V7SA 2XVCA 3J7AO 1XC5A 5DUKA 4UUVA 3BT9A 4G94A 4LLLA 2EQRA 1IJWC 1HC8A 2MSYA 2JN6A 1Z05A 2QBYA 3GTKJ 2ZJ2A 4PJNA 1UCRA 2V1DA 1QO0D 1Z67A 3LSRA 1R1VA 1W1WE 1EF4A 4OAZA 1J9IA 5F0FA 3D5SC 2RGVA 1FC3A 3DEUA 3IKVA 5EJCA 5FD6A 5K7ZA 2VC1A 2QZ8A 4GO1A 3G2BA 1FY7A 3KYCB 1TLHB 1IV8A 3MMYB 4E7JA 1X1BA 1X2MA 3C18A 3OR2C 1O3RA 2ISYA 4CICA 1IG7A 1HQCA 1Y56A 2CO5A 2LC2A 2ZBKA 3L09A 1Z77A 1QPIA 3K2AA 3SZTA 3SZPA 2XPWA 1EA3A 1BI3A 2FMYA 5FD5A 1A35A 3Q0VA 5D5XB 2E1CA 2IGNA 5LGTA 1SMTA 3K4NA 2A3SA 2HZTA 2DT6A 4QIWN 3LWFA 3VYRB 3LOCA 1YFHA 1FTZA 3J7YJ 2OZUA 2GOXB 4NC6A 1R4MB 4M74A 3ZN1A 1MGTA 3OYCA 1KQ8A 2EIKH 3RIRA 3G1LA 3H3ZA 1K78A 4PFOA 3O6BB 1UFMA 4UNOA 3ZQQA 1TP4A 4M3EA 2QM3A 2GAUA 1FEXA 1XGOA 3UNGC 2DXIA 3FMSA 3ASNH 5DD8A 2ZMEC 1BI0A 2ZO4A 3BG9A 5KK1A 3PJRA 2CW0F 1O7FA 2F5EA 4RB1A 4X1EA 5FKKA 5IOZA 3DEEA 3F21A 1JKPC 2L01A 1AWCA 4MEXF 1KU9A 3CF2A 3SZGA 4IX7A 2FD5A 2L7ZA 3ZQFA 3WGIA 4DQ2A 4M71A 5GAHJ 1D0ZA 1LE8A 1N78A 3ZMVA 4ZH4F 1V5GA 3E6DA 5J47A 2VONA 2LBFB 2M34A 1F5TA 3FXQA 3HUGB 2OUMA 1J0RA 1Y1WJ 2O5RA 2V9KA 4KFCA 1MNMC 4D1QA 1Q1HA 3D5RC 3IH2A 4XN0A 2IA0A 3FXOA 4BS9A 4A3GJ 1OPCA 1TWGJ 2VKEA 1EH7A 1FT9A 2E2IJ 2AXLA 2KRCA 3JSPA 5E17F 1R00A 2K02A 4AU7A 5CVIA 4HRIA 2JVGA 3BR0A 4HV6A 3A03A 2DPUA 4Y13A 1K4SA 3K9TA 4ZDPA 1Y8RB 1I5ZA 2UZKA 2MLKA 5L3EA 3K4KA 2JRMA 2CW7A 4BAYA 1CF7A 2P81A 3S16J 1SFEA 2GQQA 1QZYA 4EGYA 2E2JJ 1WCMJ 4NC8A 4OAYA 3TBIA 4L5EA 3BTJA 4WF2A 4A6EA 3KP3A 2DFEA 3PIOF 1WZ2A 1D0XA 3CUQA 2ZXHA 1W5TA 3RYPA 5J1RA 4RGSA 3E6CC 2PG4A 2LYCA 3K0LA 3TO6A 4JBAA 1APLC 2JA2A 3OMYA 2DCEA 3IRQA 2LR8A 1G3SA 1VQNI 4XOPA 4CZZA 3DLLF 2R5ZA 4YELA 2GOMA 4G8XA 2V1NA 1WH7A 3BJAA 3OYIA 3LFKA 2ZMEB 3H3UA 3HB9A 1PYVA 1USSA 4ZZLA 2LDUA 3CDIA 5E1ZB 1BJAA 2LKXA 3GLXA 3H92A 4E7LA 1Z91A 1SEUA 3JAMK 2L7FP 1S5LC 4J00A 1HKTA 3EUKL 3VPRA 1D3YA 1SAXA 4Q4ZF 1QVTA 4Y15A 3PNTA 3TO9A 4UHTA 1MKMA 3ERED 4P55A 1K78B 4ZJZA 2VE9A 2QQAA 2PJRB 3GWZA 1X1CA 2W1OA 4ESBA 3HGYA 3HM5A 2R5YA 1UG0A 2MA3A 1U8BA 3E1SA 2PMZN 1IN6A 3HGGA 1IC8A 2DFIA 2QENA 3WG9A 1RPWA 4RGRA 3CMAI 4JX4A 5HNFA 2K3PA 3CDHA 2VXZA 4E6KG 3AG4H 4UXNA 5ICCA 2LVSA 3L00A 1VQPI 5EEAA 5GTIC 1LVKA 2DLLA 3ZRGA 3WHBA 3J80Z 1WWXA 2WWYA 3TEDA 3FBIB 2VT2A 3RI4A 3ESWB 2X6OA 2HOAA 4BQQA 4II3A 2M9HA 3A0BC 4RMNA 6PAXA 3HPHA 2HWVA 1O3QA 3J7AY 3HYIA 2ELJA 2HYFA 1E2XA 4S0HB 5LFAA 1QHGA 2IJLA 1IRFA 3ERMA 1MMGA 2ESHA 4JQFA 1SD6A 5C3EJ 2ACJA 3WTTC 4BY1J 2Q2EA 2VKDA 4ESFA 4ZYGA 2W84A 3SFIA 3BR3A 3K69A 3ZMTA 1SFOJ 2I10A 3CJTB 3P9IA 4FHTA 1JKRC 2MW8A 2P5LC 1YRNA 3ZMZA 3SFZA 5K7HA 3H35A 2MGQA 5CJ9A 2EWNA 3TW7A 1I3AA 1JHHA 1S7AA 3P7NA 2HYJA 1AKHA 3RKWA 1DQUA 3S2DJ 2E36A 2HPMA 5KNLA 3LSMA 1OISA 2W48A 1XTAA 2MLGA 2CQ7A 1ZREA 3BTLA 4XLCA 1O3SA 3UR3C 1YW8A 2WV1A 3HOWJ 2LOOA 2EV5A 3NAUA 1YQAA 2R5ZB 3IH3A 4YEJA 2V79A 4EJVA 1LB2A 1Z21A 5GAEJ 5JLXA 4B09A 5IP9J 1S7EA 4FX0A 1TBXA 2NVYJ 3T0YA 4XQFA 5E3MA 1B72B 3FM5A 4LOCA 4P1WA 4HLYA 1S6LA 1BW5A 1ZRCA 2X6XA 2EK5A 4XLFA 2NS0A 4CCJA 4DOZA 2P8TA 1IO2A 2IP2A 2R7WA 4C2MJ 1LJ9A 3DU6A 1BC7C 2LF8A 2D5VA 2AHQA 3FWEA 4KIGA 1HDDC 2W82A 2OQGA 3VSKA 5IP6A 2LMDA 3TO7A 1GT0C 3CO6C 2OAZA 2Q1ZB 3K1NA 1KQ0A 4UUSA 2I5UA 2L02A 3B6CA 1NH3A 2EH3A 4BXUA 3ASOH 3VODA 4EV0A 2DQRA 4PJLA 1ETOA 4A3IJ 3P5JA 4GXOA 4XLAA 3GCMA 4YG2F 3ZMDA 3MWMA 5M5YJ 1U5TA 2L5QA 1R7JA 3A2KA 3EUHA 1KQ9A 2ESNA 1UHSA 2EPFA 2VPLA 3I64A 1HA8A 2RREA 4PK4A 2DAOA 3W6VA 3JRCA 4E7SA 4OU0A 3KZZA 1F36A 2IT0A 3BLYA 3S93A 3QP5A 3N05A 3DPUA 1X3UA 1EH8A 4E7HA 1UHMA 2GXAA 1ZLKA 4A3DJ 2LP0A 1K7AA 1WFXA 2DDAA 3FXLA 2LTPA 4TV7A 2KIFA 3I58A 2F4OB 1RUNA 2DW4A 1GXQA 1R49A 2O6GE 1G8XA 1QZZA 1B6AA 1NTCA 3SQNA 2ADUA 1ETYA 1DP3A 3RCOA 2IEKA 2R7XA 1HSTA 3EYIA 1TWAJ 4B44A 4IQJA 3ABUA 2H1LA 2IS2A 1NHAA 4UV8A 2ME6A 1ZYRF 4IOAF 3DLAA 2LFBA 1LNWA 2QSHX 3OL3A 3JCUC 4P9UA 5J6XA 1Z6RA 1KONA 3H0GJ 2P5KA 3Q9SA 3CP2A 2M5WA 4MLOA 5J4YA 3GTQJ 2NS7A 1JUSA 1GDTA 4B47A 4BH9A 5LGUA 4A3KJ 3RPQA 3E3VA 2P0WA 2YPRA 2E5NA 2VLAA 2HFHA 4CCKA 3RJPA 1R23A 1X1PA 2HTSA 1K6YA 2W00A 1D5YA 2CW8A 5IP7J 4RLQA 1MD0A 4A3FJ 5L3BA 3HOSA 2RVCA 4ZTJA 2HKXA 2ZCWA 1L0OC 1B9MA 1V5FA 3FKIJ 5E8IA 4MEYF 3M4OJ 3CCYA 3I5UA 1ZGWA 3DPTA 3LA7A 4RDUA 1YI2I 3LSTA 3K6GA 2QF7A 3PFYA 1SFXA 3CDLA 3F9KA 2MH2A 2JK3A 5BQTA 3RKQA 3D0SA 4XSZF 3G4SI 3JTGA 2XDVA 3OIPA 3JAMZ 4OIQF 2EBIA 3EQLF 2VC0A 1Y0NA 2F5FA 2XROA 2A61A 3FX3A 1OCPA 5FJ8J 4RLFA 1SVOA 1K83J 4G6DA 2R7OA 4W97A 3U21A 1U5TB 1ULYA 5KAFC 1WJBA 1KYZA 2DA4A 1XDUA 2RNGA 4A0ZA 3WTUC 2HOTA 1ZHFA 2JMWA 3B73A 4NBQA 1CQTA 2XPUA 1RESA 3KZYA 2D2WA 2CUFA 5EYRA 1QZEA 4L5IA 4MQ9F 2ZC2A 1T95A 2M45A 3GTGJ 1G2HA 2BBYA 2R7QA 4KIFA 4YRVA 2VUMJ 5FKNA 2BW3A 1LEBA 4EMSA 5E79C 3JRGA 2EFNA 1XCVA 4IF4A 5CLSA 1REPC 3FF5A 3IAS2 3PO2J 1U0JA 2IS6A 1I1GA 2EJRA 5M5XJ 2EZLA 2V4JC 3BCBA 1S29A 1JGSA 2NVTJ 5CVVA 1HXDA 4DYRA 3HOUJ 1RRJA 2XAFA 1MDMA 1XX5A 4UVAA 5E1XA 2QKLB 4ENMA 3GFJA 4MFEA 3FXUA 5J3LA 3CCQI 2X1EA 4LK1F 4ANJA 3WE2A 1MMSA 5LRSA 2V6EA 3BG7A 4HNTA 4XRSG 3G71I 5LRRA 5TISC 1H8AC 2VODA 1RKWA 4KA4A 3W3CA 2Y48A 4U0WA 1TQPA 3T1BA 4HDUA 3IWFA 1A04A 1JTXA 2FRHA 3S2WA 3GEZA 1VQ5I 2BY3A 4YIIA 3ZQIA 2MC3A 3HOVJ 4BQNA 3U9GA 3K10A 1HLVA 4MTDA 3ZQ7A 1V4RA 2BXYA 5EF6A 4O3MA 1VQMI 4EATA 4S04A 2Z33A 4B8XA 5J8CA 3RPUA 3E5XA 5DM7F 5K5QA 4S05A 1USTA 1E17A 4PGHA 3WTWC 3HHHA 2E1OA 1MZBA 1LUJB 1BBYA 1DDNA 4K2EA 2DT7B 2KDOA 2ME0A 2FA5A 1L3LA 4CSWA 1MSEC 3ML6A 2J5PA 2H09A 3FZVA 2ZXWH 3F22A 5B5EC 2K9SA 4KICA 5DD4A 1TT5B 4BHCA 3L1PA 5BPIA 3WTSC 3ONQA 3VYTB 3DU5A 2RQQA 1JE8A 4KN4X 2JUGA 3DKWA 2WV0A 4CYCA 1TWCJ 2OCEA 2CQQA 4LIVA 2DI3A 2Y0SN 2FSWA 2TDXA 1TWFJ 2MBFA 3F6OA 1PUFA 2E19A 5GADJ 4J19A 1FBSA 2K9QA 2HR3A 3EPZA 1POGA 2KJCA 3KZIC 4N9IA 2QUFA 5JVGF 1P9QC 1E0EA 1J2XA 1W36C 3RQIA 1GXPA 3E5QA 3IRRA 4V2FA 2W7NA 2FEZA 3GVAA 5AIPA 2WAQN 1LDJA 3LSHA 1V3FA 5IYCJ 4HLXA 2XB0X 1SVLA 2OBPA 1LEAA 2KT0A 4HAMA 4MHGA 3V8KA 4RS8A 3MCZA 1YJWI 3FMQA 2IA1A 3KE2A 5F04A 3PL8A 4EM0B 2VBZA 3V7CA 3CC7I 5IYBJ 4UV9A 2V9PA 5DYMA 1FOKA 2LKSA 2IGMA 4HNVA 3M1CA 2M8EA 1WJAA 1QHHD 2E7WA 1VF9A 2HGCA 4PJJA 1MDMB 3JR9A 1BOAA 5FLVA 2NVQJ 2O8XA 2EFOA 1DPRA 3GMEA 1NG7A 3S3MA 2Z2SB 5FO5A 1R71A 1FMVA 1T33A 2DO7A 2EILH 1BJZA 2XAGA 3CLQA 3KEQA 3K1MA 4FE4A 4NDLA 4HPQA 3HOZJ 2XF5A 5EEHA 4G6QA 3WHCA 3HSFA 3LMMA 4HQEA 2X51A 1PP7U 4AC0A 1BR4A 2ECBA 3ABKH 4XBFA 5F1JA 3JRFA 3ZN0A 3OYKA 3DQVC 5H6QA 4PGGA 4RAYA 2FUG2 2HXOA 2VIXA 1XDSA 1ETQA 1YG2A 3QU3A 4DYCA 4E7KA 5GAGJ 4QPQA 3CCJI 3LFUA 1R5HA 2L9RA 1ZLJA 2BE5F 2F6CA 1YX5A 4ZYHA 1YW7A 3HL2A 5IT9K 2ZFUA 4M9XA 3I4NJ 3MEXA 2MG4A 1P2FA 4CO8A 3N4MA 4DGWB 5DDGA 4LG3A 3OSFA 1NK2P 2GXGA 3CJQB 4G6TB 3S1MJ 3VEPA 2OA4A 4WXCA 3BR1A 2M0CA 3OV8A 2EFPA 4DW6A 2R7UA 2A69F 3BCAA 1IXRC 4Y52J 1MBKA 2TCTA 2FOKA 5DUIA 1B4AA 3QWLA 2HNHA 3OYDA 2DTZA 2UXNA 2VE8A 5F64A 2DOEA 3SXYA 2CS3A 5IYDJ 2UXXA 1PUFB 3BZ6A 3GTPJ 1FSEA 2V7FA 2ICWG 5D5VB 3H5NA 2OC6A 1YW9A 2L2OA 2DK8A 4DJAA 1FTTA 3G1MA 5IPAA 5K7FA 2KL4A 3RDIA 2M1BA 5EDNA 1NG6A 3T8TA 4UVCA 3CTAA 2WY7Q 4CA0A 4YIRX 5FLXZ 3CCRI 3S17J 2QKMB 5DM6F 4IVNA 3WGGA 3R0JA 5M3MJ 1MBGA 4A12A 1YX3A 4D5FA 3K70C 5H20A 3H3VK 2DFHA 5D5WB 3OY9A 3X2QH 1FLIA 1BR1A 2CUJA 3EYYA 2LNBA 1HDPA 2MC4A 2QQBA 1B8IB 1UZCA 1D1AA 3T8RA 2XGCA 3ELKA 1ETXA 2HDCA 4NUBA 5EG0B 2XSDC 3PM1A 3A01A 3GBGA 3HRSA 4Q47A 1SC7A 2GM4A 2IW5A 1P4AA 2IS1A 2BOLA 4XLPF 1D8KA 5A2QZ 1O4XA 2FBKA 2A5YB 4XR6A 1MNDA 1WJEA 1SFKA 2DA6A 2LY1A 3QYBA 1FBUA 1BL0A 2Z3YA 5E20A 3IUOA 3WE3A 5AONA 2KQRA 3NWSA 3K4JA 1HKSA 1A6IA 1TNSA 5C44J 3WU1B 5D8KB 4OMYA 3I4MJ 2GIVA 1HSJA 4D0PA 4PDKA 4F55A 4Z6YA 1ON2A 2A6HF 2HI3A 1PDNC 2K3FA 4A3CJ 1OR7A 4D7NA 2H6CA 4NHJA 1DP7P 3RQ4A 1E3OC 3K70D 3ISPA 2QBYB 5ERIA 1RETA 2DMQA 3DPLC 4NB5A 4BQOA 5KVRA 4BHBA 4F3QA 1WPKA 2VBWA 1Y6IA 4I02A 3ABTA 3BROA 1XGMA 1T6SA 5D6FA 4Q5SF 2WAFA 2XB5A 2PBIA 3S2HJ 1LFUP 2DODA 4QWQA 2DMUA 1E3PA 5BOXA 4OWRB 4IZZA 1JJ8C 3QPTA 4IHYA 1GVDA 4KMFA 1SD7A 2AXTC 4A0XA 2O03A 2E7XA 4BJ5C 2Y9ZA 5H6RA 1U3EM 3LA3A 1LFPA 1R4NB 2ZNYA 4XORA 1ENHA 2R3SA 4LGWA 1YYVA 2OD5A 1D1CA 3ZCOA 5D8LB 2V1UA 3BDDA 1Q1VA 2PLYA 3IAM2 4JP0A 2ZB9A 2FXAA 2X0LA 4F91B 3OS1A 1W5CC 1R9TJ 3BTCA 1QNTA 1WVRA 3E5UA 3KYDB 3IHUA 1OJLA 2TRTA 4BXFA 4ZDOA 1EV7A 1MH4A 5ILVA 1R6RA 5HLHA 2WBMA 3EUAA 3CUQC 1WI3A 1Y0UA 2CH0A 5F0CA 2VL8A 1G6NA 4WXDA 5J8FA 3OYGA 2E5ZA 4XKCA 1TT0A 3HC7A 3GFMA 3GFIA 1SD4A 1BN5A 3RSNA 2M7BA 3QP6A 4O5VA 2A05A 5HOOA 1HF0A 2BV6A 1R58A 4HYEA 4IRHA 2PI0A 5L3CA 4HW0A 1WH5A 5GP9A 3M1EA 3BR6A 1KU3A 1MBFA 3V7RA 3A01B 2CQXA 5BS6A 3TP3A 4ITVA 1W5SA 3TQNA 2XGXA 1STZA 1QU3A 2DFFA 4HBLA 2X6WA 1P7JA 2RAEA 2WB1N 4W1UA 4HSRA 1VQ7I 1LE8B 3QAHA 4U88A 5JHUA 2ZJRF 1RC9A 3KP2A 2XPVA 2HU9A 1TC3C 3LQQA 1FPQA 4U7DA 1P4WA 2YX4A 3CCLI 1PVEA 3RYRA 4GGGA 4YIFA 2RN7A 4IQ4A 2K9LA 3L2QA 3T5XA 4B3XA 5ED4A 4KMUX 1XMAA 2DMPA 3DKXA 4DZJA 2ECCA 4U0VA 3HTSB 2W57A 2VOPA 1X1AA 1N25A 1OCRH 5CVRA 2DA7A 1VQ4I 1JHFA 5DS9A 4WWCA 4P5OA 3L2VA 2WAQA 2DTRA 4BKXA 4E4HA 3MVPA 1CF7B 3KLNA 2Z1DA 3LSKA 2Z9OA 2E2HJ 2O61A 1H9GA 5GPAA 1IZ1A 1ERDA 3Q3SA 2FQ4A 2VQGA 2M2EA 1ETVA 2K85A 1IF1A 1ZR4A 3VWBA 2Y0MA 3CUQB 2F4IA 3QYFA 1K4TA 4KDPA 3M3YJ 1J7KA 2Y30A 1OCOH 5JFRA 1KZHA 1WJDA 5B1BH 4XRMA 3CCUI 3F23A 1X3ZB 1BR2A 1X2NA 2FNAA 2NOGA 3I71A 4IL6C 4QPOA 3CCEI 2M8GX 4EM2A 3E6BA 1KA8A 1TW2A 1ZGAA 4NQWA 1VQ6I 2KMUA 1Z3XA 3GTJJ 2L9VA 1X58A 1P7IA 5FGMA 4RGUA 3GZ6A 2KPMA 3OYBA 2DA2A 2LSOA 3Q0WA 3CESA 2Y69H 4LG0A 1J09A 3VB2A 2NRAC 3LSJA 1BI1A 2EA2A 2HDWA 1R36A 2IA2A 3IH4A 2QSFX 1P4XA 2PX9A 3HRTA 1T98A 3FXJA 1G4DA 1LDKB 1FP2A 4CCOA 3BPVA 1YTYA 2JT1A 2VQHA 3DWLE 1D0YA 1Y8QB 4N0BA 2X6YA 2W24A 1IDYA 3B02A 2R5YB 2JVHA 4EGZA 4G9YA 2JPCA 4P9FA 3WG7H 2XASA 2V9VA 3ROUA 1H0MA 4KN7X 2XF7A 4A3MJ 3E0JB 1W7PA 3AFHA 3HZJA 4Y7NJ 3FBNB 2KLOA 2HKOA 5AIQA 5GTHC 9ANTA 4BGDA 1OMIA 1YIOA 5HLGA 5E3NA 2A5WA 3G73A 3HG9A 4BUPA 4GFBA 2J5OA 5B3SH 3QU6A 3BZKA 2ELKA 2G7HA 2OQRA 3OWTA 4CHUA 2FBHA 1XSXA 2VN2A 2GA2A 1A36A 4C3JJ 4IHVA 3FK7A 4IXAA 4P96A 2F4MB 4B43A 1BC8C 4CUGA 3MZ8A 1DUXC 2QVOA 4PCQA 1XCBA 2MH9A 1SFUA 4V19K 4XKVA 4UY8I 2Q2EB 5M5WJ 4EJTA 1U5TC 2WC2A 1IGNA 3EUHC 1YRNB 2JA6J 3KFWX 2XC7A 3SHFA 2E1MC 4EM1A 3O8GA 1ACIA 4I01A 3AL0C 1IW7F 1J59A 2DA3A 5L3DA 4C2TA 1AKHB 4RAFA 4HEA2 3B6AA 4LB6B 2M7AA 2BHZA 2Z5UA 3DF8A 1N77A 3OIOA 3RZDJ 1ZG1A 3A02A 3WGHA 3OOUA 3RKYA 2UUZA 3ZXSA 3N97A 3GYHX 4DNCA 1BOBA 3H5RA 2PJPA 1XG1A 1S7OA 3K4MA 4ASNA 2PEXA 2YSRA 2G0EA 4HQMA 2B0LA 1IN5A 2G9WA 2L4AA 3QRFF 3VYUB 4NQWB 2HYGD 4BDYA 4U7BA 1AHDP 1KYWA 1JI8A 1ITYA 2XGEA 3FIWA 4RB3C 4RBOA 2N8GA 4CZCA 3RZOJ 2AQEA 5HS7A 4D5CA 2JA8J 1OCTC 4XRSA 2XAHA 1MBJA 1JT0A 5CVJA 2R93J 2I8DA 4R79A 1R5ID 1YITI 2VJIA 4LD5A 1ETKA 1FWZA 1Z6TA 2WTEA 2K4JA 1U2WA 2VPRA 5J40A 3MZYA 4M6YA 1X19A 3BR2A 4UUSB 3CLOA 2R7TA 3GZ5A 2FJ1A 3V8LA 3CC4I 5D6EA 4WXHA 1JKOC 3TMOA 2BHYA 3BR5A 5CKTA 4LITA 5K1YA 3JSOA 3COAC 4B1RA 5EGOA 1W7PB 3DXJF 4AIJA 4AVZA 3PUFA 2QEXI 3I9V2 4BBRJ 4OMZA 2W85A 2JQ7A 2B63J 5LD2C 2K7LA 3KEYA 3J81K 2F5CA 2KDZA 2E1MB 4XM3A 4I76A 5J4VA 4XKWA 3OL4A 3AL0B 2IGOA 2E1NA 3JRBA 3HOYJ 3KETA 2XAQA 3BPXA 4M73A 3FDYA 2IXSA 5FKLA 4YFNF 1AOYA 5CQEA 4PJMA 5FKOA 4U0YA 2IBDA 3V42A 1HW5A 2BVLA 2NVXJ 2W25A 1YJNI 3PSFA 1G59A 3GX4X 4XL9A 1OLTA 4RAZA 1QQIA 3Q5FA 1ONVA 3AG2H 4GRIA 2FNPA 4LJZF 2NNNA 1G3YA 1VQ9I 4G7OF 5ICEA 3SEZA 1BI2A 3HPGA 1GV5A 2E60A 3TL4X 1ZN2A 3O3KA 2K4BA 1T38A 1BW6A 2X9DA 1XGSA 2BXZA 1YLFA 1FJLA 2XSJC 4ENKA 3DTKA 2DPDA 1B9NA 4AVPA 3BP8A 4AYBN 3DBHB 5TJJA 2L0KA 3F8NA 5HLTA 1K61A 1KU7A 4I0AA 2P5VA 3PO3J 3PSIA 1FYKA 4C3HJ 2HVRA 1LFBA 1RZ4A 1TQIA 5HLIA 5M3FJ 1ZH5A 5LHHA 4R8HA 2OU2A 1HOMA 4OIRF 3S8PA 2HVSA 4DBRA 2EFWA 4ENNA 1TZLA 2D45A 2COMA 2KRHA 2MABA 3BOQA 4I09A 2PMZA 1LPQA 1GVJA 1UHWA 5DV5A 1MJAA 1ZG5A 3VDXA 1XS9A 2LF7A 1WJFA 3BC8A 3CP8A 4FX4A 2R7SA 1BIBA 2WB1A 1D1BA 4FASD 4PJ0C 5HVQC 3DTEA 3KP7A 4Y17A 4GDFA 1HW1A 1RUOA 1T08B 2KISA 3QOPA 1UAAA 5HDGA 2H8WA 2HZDA 4N9HA 2KKOA 2MD5A 1MJ9A 1IRXA 1WRJA 2R7RA 2JSCA 2RC4A 2R0QC 2DK5A 2O3FA 4M9ZA 3E6MA 3KYLA 2DT5A 1TL8A 1IUFA 2ZFWA 4Y33A 3NEUA 1S72I 2NOJB 1I27A 3NWTA 4M6VA 2HPIA 2R7VA 2YS9A 2KZVA 5F0HA 4Q48A 2OPTA 3OS0A 3DEWA 4XLHA 2GXBA 5EGOB 3FKJA 4JOMA 3S32A 1T2KA 3H0DA 1XD7A 2O0YA 2RNJA 4MGRA 4A5NA 4XONA 3H36A 4II2A 1TWHJ 3LL7A 3O8HA 5DCFA 3L9FA 4BE1A 1E3HA 4BYYA 3M7GA 3DTIA 2LY9A 1HCRA 2OZ6A 2BW3B 2XRLA 4XLEA 1XPXA 3GLLA 4JYKA 2XKPA 3DFGA 4JX5A 1MIJA 4NNJA 3E7LA 2CFXA 4ZYDA 3VOEA 1T0FA 2DYRH 3C2GA 2LK2A 5K5RA 2NAZA 1ZRFA 2O9LA 2VQLA 4IRIA 4ZYEA 3C2BA 1SD5A 3W2WA 3V8JA 3ZOBA 3HSEA 3K4CA 1JUPA 4F92B 3S3OA 2E71A 4MQVA 1IDZA 1TW3A 3RKXA 2DJIA 3C1DA 3D1NI 4C2UA 3HEFA 4BBSJ 2IRFG 1ZKGA 3KEOA 3PUBA 3ZQCA 3R60A 2JPBA 3L2RA 4HZFA 1NK3P 2FU4A 3RPUD 3BWGA 3VFZA 2FX0A 2RDPA 1KGSA 4KUMA 4F93B 4I2OA 3J80K 4KYWA 2Q0OA 5EEGA 3OIQA 3NQOA 1W36D 1VQLI 3WTXC 5JR3A 4FETA 4ESJA 2DA1A 2V26A 1JJ6C 3ULQB 3OYJA 1H88C 3S14J 3AG3H 4FT8A 3PNVA 3QODA 1Z7UA 4BACA 3HRMA 1XGNA 2ZJQF 5FRNA 1ZELA 2IS4A 4WX9A 5FLMJ 3OSGA 3CUOA 4UB6C 3BY6A 1U9OA 2LBFA 1VQKI 3HUGA 2DMTA 2VI6A 2DBBA 2CQNA 2BYVE 3OYEA 4HX4A 3KP6A 4L5JA 2L54A 3BQZA 2CJJA 3GW2A 2DA5A 1ZGJA 1D5VA 3HIFA 1N75A 2P7VB 2NXNB 2XAJA 2CGPA 3LAJA 3F8BA 3CMEI 4B3AA 3CD6I 5CPRB 4KITB 4CYCB 2ELHA 2HQ5A 3HSRA 2C6YA 1O57A 2EZIA 1BA5A 2NS8A 3M07A 5FROA 3ZMSA 1FBQA 2F48A 2X4HA 1RI7A 2WA0A 3Q0UA 5J1YA 1ZK8A 2QA4I 1VQOI 2QLZA 1PP8F 1QBJA 1FX7A 4M9SA 2A6EF 5FFXA 5HODA 1RR7A 2R7FA 4BQAA 4GYGA 1Z3YA 3KLOA 4Y4RA 1LVAA 1I3QJ 1Z1DA 4JX6A 3VSLA 4C3IJ 1S9HA 2DQLA 4HOBA 2Y75A 4ZYAA 2DDBA 1DPUA 3MAJA 4F7ZA 2QGUA 4O6JA 3K4BA 3I0TA 5E3OA 4A69C 3REOA 2VBXA 3BTIA 3DBLB 4UB8C 2ZMEA 3J81Z 3WTYC 3TKYA 3FHZA 1FOWA 2OCCH 4D7MA 1VQ8I 4AIDA 1X4OA 2IGKA 5L3GA 1JGGA 3ZP5A 3QYEA 4PUSA 3KCCA 4V2GA 2KP6A 2IPQX 2M3AA 4D9JA 3IWZA 5JI6A 3WU0A 3M8EA 3CZ6A 4A3EJ 3P9KA 3JRAA 5KHDA 1F1ZA 5CQGA 4RB2C 2OJED 5C4XJ 2BY2A 1R5GA 5FB2A 3LAPA 3LNQA 3O2PE 2RKHA 3FXKA 3RTRA 4A2UA 2ETHA 2DN0A 2H27A 2PJRA 1UG2A 1U9NA 4AM3A 1B1BA 2MD0A 5HS8A 3G3ZA 4RAGA 4A3LJ 4KJZA 4XRFA 1FIPA 2H94A 3I55I 3IL2A 2OV7A 1DU0A 3J7ZI 4I6ZA 4JK1X 3HKZN 1OKRA 2ZSHB 4Y3OA 4CCLA 2XUBA 4A6DA 3Q9VA 5B1AH 4IEJA 1YHQI 3HHGA 3K1PA 1IV6A 4IHTA 5D4SA 5LLQA 2LRDA 1VTNC 1WJ5A 2NVUB 2CV2A 3IV5A 1A5JA 3BG5A 2CRGA 4RB0A 2A68F 2CWEA 2FF4A 1TNTA 4L18B 2L3DA 5ICFA 1V55H 3P9CA 3WTVC 2XAUA 2GLOA 3MKYB 4CGZA 4LIUA 3L2UA 2RV8A 2IVMA 3ZQGA 2HQRA 5HNHA 2DMNA 1MMDA 2EV6A 3KIOA 1OR7C 4L9VA 1ODDA 3JRDA 3FISA 2P6SA 3K2ZA 2VXDA 3ZR8X 3I4PA 2F5DA 4C30A 4M3GA 4UVBA 1D8JA 2YU3A 2ZXJA 5KAIC 3CO7C 3R61A 2MYSA 2ID3A 2B9SA 1SANA 3W6KB 2KJBA 2NNYA 1G3WA 3R0AA 3MN2A 4M6XA 4EVIA 3H9GA 4LB5A 2NYXA 1AU7A 3LQRA 5CVUA 5LHIA 4ZZDA 1MSFC 2O8KA 2M87A 4HSTA 1S8NA 2FMLA 4BEHA 1O3TA 4ZC3A 1I1SA 1LKXA 2EIMH 3FHNA 4ETSA 1XMKA 2KHMA 5HDKA 2VJ4A 4FQGA 2H1KA 4MIMA 4AYBA 2GZWA 1GHCA 2PMHA 4R1HA 3UKGA 2BGCA 1SMYF 3CC2I 2XF6A 3GUDA 3ZQLA 4MTEA 1B72A 3AAFA 2K5CA 4BE2A 1RIOH 4LMYA 3S1NJ 1GV2A 3H9QA 4AWXB 1V5EA 3F8MA 1P6RA 4N4NB 3ECHA 3IC7A 5TRDA 4FTHA 1IUYA 2HOSA 3PIPF 4DIQA 2DOAA 4HF1A 1FNNA 4KT6A 1ZAOA 1EH6A 4M3FA 2Z16A 1YO5C 2KZGA 2R4GA 4B48A 4KNYA 3CCMI 2XGDA 2XHKA 3FXMA 1QVUA 3H1CA 4QTRA 3C3WA 3GF2A 1QPMA 3CJNA 5BMZA 5IT3A 4H0EA 3I59A 1ZTRA 1VI0A 2COBA 1AA7A 2QYOA 3QOEA 2Q8KA 1YIJI 4EJOA 3KP5A 3F0CA 3TOAA 1DGRM 1SVMA 4G12A 4XKBA 3G6EI 3ABLH 4FCYA 2Y0SA 5C4JJ 2E34A 2JZYA 3E97A 4LLGF 1HW2A 1PJRA 2BEOA 3GTOJ 1A31A 2K86A 4XIDA 4BY7J 1OCZH 2EV0A 2F2EA 2JJ7A 4IOCF 3OYLA 4BXXJ 1EKEA 4HDVA 1JKQC 4HA8A 5DCMA 4HNUA 4UUTA 5D5UB 4ABZA 1IXSB 2EZHA 5LGNA 4OOIA 4N4OB 1ZQ3P 1IN8A 5GPCA 2DJNA 1YE9A 2VASA 1WSUA 5IT9Z 2JA5J 1YOVB 4IJAA 1MH3A 1I50J 1XSVA 4L9JA 5JHFA 2OTLI 1G3TA 2ZXIA 1OYIA 3V4GA 2HOEA 3U1DA 2PMUA 2LG4A 1OYWA 5FKMA 3S3NA 2X1DA 3EDPA 2GWRA 2YX7A 2CUZA 1W4MA 3F8FA 3PQKA 3GTMJ 2IAIA 4AIKA 3GXOA 2JWTA 2DOFA 3JTHA 4ZDLA 5E3LA 4XSXF 2KFDA 1XN7A 2R7ZJ 3R6SA 2K9NA 4BEHB 4IKFA 4XLNF 5ICGA 1A6QA 4AUXA 2VJJA 2STWA 1X3WB 2L9SA 2STTA 4BL0B 2M30A 3ECOA 1WQ2A 5HDNA 4E7ZA 4EJWA 2K40A 2ZNZA 1Y1VJ 3OYFA 1JXSA 4WCGA 4X0GA 4HF2A 1J5YA 2D1HA 2QQ9A 4LK0F 5E18F 5E8GA 1VNDA 2Y9YA 2VJ5A 1UMQA 2FE3A 3SJMA 3FM3A 2UWMA 2CQKA 1K6OA 2A6TA 4XOTA 1MW7A 4RA2A 1R1UA 3H9JA 3FK6A 3IP4B 4PSWA 1O7LA 5L3FA 2ZSIB 5HS9A 3OYHA 3BJ6A 3M8JA 4PFPA 3I59B 4E7IA 1GUUA 4RM2A 1QRYA 2HTJA 3CMMA 1W0TA 2E35A 2MFZA 2OF7A 1OCCH 2KRFA 2FQ3A 5D4RA 3W6JB 4IHSA 2OTJI 2FOWA 2CUEA 4BDZA 5FRMA 2UV1A 2JA7J 1Z0XA 3C2HA 4XNFA 3PQJA 1MJBA 2EA4A 1H9TA 3OYAA 4KISA 1JUMA 5EZHA 3DBRB 5F08A 4EQQA 3S15J 5DCMB 2HQAA 5JLWA 1F43A 2K9MA 3SDBA 1UB9A 5BNGA 3OYMA 3I53A 3EETA 3HRUA 1QGPA 1HKQA 1WHUA 3TGNA 2XV4S 2F5VA 1FSHA 2K27A 4AD9A 4RM3A 2CU7A 1P92A 1ETWA 2HVQA 2VKHA 3GFLA 2YUSA 3H5AA 4L9NA 4B4CA 4BJTA 2QSGX 5DTDA 3DP7A 2R92J 3AG1H 3D5LA 3HTUA 4I98B 1JT6A 1WKMA 2JRTA 1JTYA 2V6CA 3WTZA 3F8CA 4MFDA 4PZJA 4L9TA 1UELB 2Y31A 2HS5A 4IHWA 2HQNA 1X4PA 2X1CA 4LLNA 2P6TA 1MBHA 4HF0A 1RKTA 1TQMA 4A93J 1BIAA 5LEKA 3L2CA 2EFQA 3A1YA 3M9AA 3KPHA 3K4LA 2KIMA 4HG2A 5F27A 3GTLJ 5LBQA 1OYYA 3HXLA 4LG0B 4QSHA 3CCSI 3NARA 3FMRA 2VKVA 1T39A 1FYMA 5FFZA 3LA2A 4BE0A 3BQYA 1RNLA 2XIGA 3W2VA 1LQ1A 1W7PD 2BZTA 4OIOF 3ZGKA 5KCMA 3BG3A 4E70A 5F1RA 2VQCA 3HKZA 5EZGA 4IRGA 3SDGA 3JREA 3OS2A 1R1TA 2EIJH 4GYIA 1R22A 4WK8F 3ZQHA 1QA6A 2ISZA 2LLKA 4C9YA 2JUCA 2CMPA 1ZRDA 2ZJPF 1Y39A 4GCVA 2ZKZA 3VYSB 4L0YB 4KT5C 2R7DA 3QQAA 3HBLA 4FE7A 3ZMUA 1Z7LA 1XB4A 2QQ8A 2CG4A 4CCNA 5FLXK 2VB6A 4EJUA 4HV5A 2PFBA 4OINF 1H89C 1IN7A 2BY1A 3BZCA 3MKLA 4XK4A 3MZHA 1DGWY 2CSOA 1F4KA 1Z9CA 1M1EB 4M3BA 5B66C 5ILUA 2X85A 4YFXF 1ZG3A 3CJRB 5E1WA 3F3XA 4M3DA 4CCMA 1MMNA 3HJEA 3HOXJ 1FZPB 4ENJA 2LREA 2GA1A 1ZR2A 5LHGA 1ZARA 2EZKA 1WGXA 2VBYA 2W4SA 3JRIA 4OIPF 3WU2C 5TGTA 2KIQA 1IRZA 2CV0A 4MNUA 3M8FA 1PUEE 2CV1A 3QPSA 2RQPA 4CYDA 2KIUA 5A2QK 3JW4A
chains in the Genus database with same CATH topology
1XSDA 3I54A 3PFIA 1ON1A 2H6BA 4I7HA 3FXRA 1U8RA 2XKOA 4AIHA 1YS6A 1I6XA 1S3JA 1K79A 4QLCU 2VT3A 4G7HF 4CXFA 3HOTA 3U2RA 2LKPA 1YS7A 3R4KA 2D1VA 4RGXA 4HX8A 2VOOA 3BJOA 2PQ8A 4L0ZB 1WI9A 2CYYA 3KP4A 3TDZC 2AS5F 2G7UA 5LEJA 4HX7A 1CGPA 3MQ0A 4A0YA 1B59A 3OOPA 3WODF 3MFKA 3DV8A 2PN6A 3L7WA 2HEOA 3F6VA 1FYLA 4KIBA 3ZPLA 5K5OA 1FP1D 3TDUC 1LDDA 3C7JA 2XRNA 1J75A 2YR2A 5BPDA 2Z99A 1BM9A 2QWWA 4LFUA 1IRGA 2FBIA 4BHPA 3NRVA 5JVTA 5DEQA 1IAWA 3IKTA 4CDGA 1U78A 1IXCA 2V1XA 3TOBA 2A07F 4Z2YA 2L4MA 5CYVA 4A5MA 4IPAA 4M72A 2EB7A 2P7CB 2P4WA 1C0WA 4G7ZF 1F9NA 4BNCA 5ILSA 3GO5A 1IN4A 2JTVA 3QPHA 1U6GA 2DU9A 1TTYA 4ON0A 4I0BA 5F6FA 1HBXG 1KU2A 4YFKF 3F72A 3V7SA 2XVCA 3J7AO 5DUKA 4UUVA 4G94A 4LLLA 2QBYA 1Z05A 2ZJ2A 1UCRA 2V1DA 1QO0D 1R1VA 1J9IA 2RGVA 1FC3A 3DEUA 3IKVA 5FD6A 2VC1A 2QZ8A 4GO1A 1FY7A 1TLHB 3C18A 1O3RA 2ISYA 4CICA 1HQCA 3L09A 2CO5A 2ZBKA 3SZTA 3SZPA 2FMYA 1BI3A 5FD5A 5D5XB 2E1CA 5LGTA 1SMTA 2A3SA 2HZTA 3LWFA 1YFHA 2OZUA 4M74A 3ZN1A 1MGTA 1KQ8A 3RIRA 3H3ZA 1K78A 4UNOA 3O6BB 1UFMA 2QM3A 2GAUA 1XGOA 3FMSA 5DD8A 1BI0A 2ZO4A 5KK1A 2CW0F 1O7FA 2F5EA 4RB1A 3F21A 2L01A 1AWCA 4MEXF 1KU9A 3WGIA 4DQ2A 4M71A 3ZMVA 4ZH4F 3E6DA 2VONA 1F5TA 3FXQA 1J0RA 4KFCA 1Q1HA 2IA0A 1OPCA 1EH7A 1FT9A 2AXLA 3JSPA 5E17F 1R00A 2K02A 5CVIA 4HV6A 2DPUA 4Y13A 3K9TA 1I5ZA 2UZKA 2MLKA 5L3EA 4BAYA 1CF7A 1SFEA 2GQQA 1QZYA 4EGYA 4WF2A 4A6EA 3KP3A 3CUQA 1W5TA 3RYPA 4RGSA 3E6CC 2PG4A 3K0LA 3TO6A 4JBAA 3IRQA 1G3SA 4CZZA 4G8XA 3BJAA 3LFKA 2ZMEB 3H3UA 1USSA 4ZZLA 2LDUA 5E1ZB 1BJAA 3GLXA 3H92A 1Z91A 3JAMK 1HKTA 1D3YA 1SAXA 4Q4ZF 4Y15A 3TO9A 4UHTA 1MKMA 3ERED 4P55A 1K78B 2VE9A 2QQAA 3GWZA 4ESBA 2MA3A 1IN6A 2DFIA 2QENA 3WG9A 4RGRA 3CDHA 2VXZA 4UXNA 5ICCA 3L00A 2DLLA 3J80Z 1WWXA 2WWYA 2VT2A 3RI4A 6PAXA 2HWVA 1O3QA 3HYIA 2HYFA 1E2XA 2IJLA 1IRFA 4JQFA 2ACJA 2ESHA 1SD6A 3WTTC 2Q2EA 4ESFA 4ZYGA 2W84A 3K69A 3ZMTA 3P9IA 4FHTA 2P5LC 3ZMZA 3SFZA 5CJ9A 2EWNA 1JHHA 1S7AA 3P7NA 3RKWA 2MLGA 1ZREA 1O3SA 1YW8A 2EV5A 1YQAA 2V79A 4EJVA 1LB2A 4B09A 4FX0A 1TBXA 3T0YA 3FM5A 4HLYA 1S6LA 1ZRCA 2EK5A 2NS0A 2P8TA 2IP2A 1LJ9A 1BC7C 2LF8A 3FWEA 4KIGA 2OQGA 3TO7A 3CO6C 2OAZA 3K1NA 1KQ0A 2L02A 4BXUA 3VODA 4EV0A 2DQRA 4GXOA 4YG2F 3ZMDA 3MWMA 1U5TA 1R7JA 3EUHA 1KQ9A 2ESNA 3I64A 2DAOA 4OU0A 3KZZA 2IT0A 3QP5A 1X3UA 1EH8A 1UHMA 1ZLKA 1K7AA 4TV7A 2KIFA 3I58A 1RUNA 2DW4A 1GXQA 2O6GE 1QZZA 1B6AA 3SQNA 2ADUA 1HSTA 3EYIA 3ABUA 1NHAA 4UV8A 1ZYRF 1LNWA 4P9UA 5J6XA 1Z6RA 2P5KA 3Q9SA 2M5WA 4BH9A 5LGUA 3RPQA 3E3VA 2YPRA 2HFHA 3RJPA 1R23A 2HTSA 1MD0A 5L3BA 3HOSA 2RVCA 2HKXA 2ZCWA 1L0OC 1B9MA 5E8IA 4MEYF 3I5UA 3DPTA 3LA7A 3LSTA 1SFXA 2MH2A 5BQTA 3D0SA 4XSZF 3JTGA 3JAMZ 4OIQF 3EQLF 2VC0A 2F5FA 2XROA 2A61A 3FX3A 4G6DA 1U5TB 1ULYA 1KYZA 1XDUA 4A0ZA 3WTUC 1ZHFA 3B73A 3KZYA 2D2WA 4L5IA 4MQ9F 2M45A 2BBYA 4KIFA 1LEBA 4EMSA 2EFNA 1XCVA 4IF4A 5CLSA 1REPC 3FF5A 1I1GA 2EJRA 1S29A 1JGSA 5CVVA 1HXDA 2XAFA 1MDMA 4UVAA 5E1XA 4ENMA 3GFJA 3FXUA 4LK1F 3WE2A 5LRSA 5LRRA 2VODA 4KA4A 2Y48A 4U0WA 1TQPA 3T1BA 4HDUA 3IWFA 1A04A 2FRHA 3S2WA 3GEZA 4YIIA 2MC3A 3U9GA 4MTDA 3ZQ7A 1V4RA 4O3MA 4S04A 2Z33A 4B8XA 5J8CA 3RPUA 3E5XA 5K5QA 4S05A 1USTA 1E17A 4PGHA 3WTWC 3HHHA 1MZBA 1BBYA 1DDNA 4K2EA 1L3LA 2FA5A 3ML6A 2J5PA 2H09A 3FZVA 3F22A 4KICA 5DD4A 5BPIA 4BHCA 3WTSC 1JE8A 4KN4X 3DKWA 2WV0A 2DI3A 1KU7A 2FSWA 2TDXA 2MBFA 3F6OA 1FBSA 2HR3A 2KJCA 4N9IA 2QUFA 1J2XA 1GXPA 3E5QA 3IRRA 2FEZA 3GVAA 5AIPA 1LDJA 1V3FA 4HLXA 2OBPA 1LEAA 4HAMA 4MHGA 3V8KA 4RS8A 3MCZA 3FMQA 2IA1A 3KE2A 4EM0B 2VBZA 3V7CA 4UV9A 5DYMA 1FOKA 2M8EA 2E7WA 2HGCA 1MDMB 1BOAA 2O8XA 2EFOA 1DPRA 5FO5A 3KEQA 2DO7A 2XAGA 3K1MA 5EEHA 4G6QA 3HSFA 4HQEA 1PP7U 4XBFA 3ZN0A 3DQVC 5H6QA 4PGGA 4RAYA 1XDSA 1YG2A 3QU3A 1R5HA 1ZLJA 2BE5F 4ZYHA 1YW7A 5IT9K 4M9XA 3MEXA 1P2FA 4CO8A 3N4MA 5DDGA 2GXGA 3VEPA 2OA4A 4WXCA 3OV8A 2EFPA 2A69F 1IXRC 2FOKA 5DUIA 1B4AA 2UXNA 2VE8A 5F64A 3SXYA 2UXXA 3BZ6A 1FSEA 5D5VB 1YW9A 2DK8A 3RDIA 2M1BA 3T8TA 4UVCA 3CTAA 5FLXZ 4A12A 4IVNA 3WGGA 3R0JA 5H20A 5D5WB 1FLIA 3EYYA 2LNBA 2QQBA 3T8RA 3ELKA 2HDCA 3HRSA 4Q47A 2IW5A 1P4AA 4XLPF 1D8KA 5A2QZ 2FBKA 2A5YB 1FBUA 2Z3YA 5E20A 3WE3A 5AONA 1HKSA 1TNSA 3WU1B 5D8KB 4OMYA 2GIVA 1HSJA 4D0PA 4PDKA 1ON2A 2A6HF 1PDNC 1OR7A 2H6CA 4NHJA 1DP7P 3ISPA 2QBYB 5ERIA 4NB5A 3DPLC 5KVRA 4BHBA 2VBWA 4I02A 3ABTA 3BROA 1XGMA 1T6SA 5D6FA 4Q5SF 2PBIA 4QWQA 5BOXA 3QPTA 4KMFA 1SD7A 4A0XA 2O03A 2E7XA 5H6RA 1U3EM 3LA3A 2ZNYA 2R3SA 4LGWA 1YYVA 2OD5A 5D8LB 2V1UA 3BDDA 2PLYA 2FXAA 2X0LA 1QNTA 3E5UA 3IHUA 1EV7A 5ILVA 5HLHA 3CUQC 1Y0UA 1G6NA 4WXDA 5J8FA 3GFIA 3GFMA 1SD4A 1BN5A 3QP6A 4O5VA 5HOOA 2BV6A 1R58A 4HYEA 4IRHA 2PI0A 5L3CA 4HW0A 3M1EA 3V7RA 1KU3A 5BS6A 1W5SA 3TQNA 2XGXA 1STZA 4HBLA 3QAHA 4U88A 5JHUA 3KP2A 3LQQA 1FPQA 4U7DA 1P4WA 2YX4A 3RYRA 4GGGA 4YIFA 2RN7A 3T5XA 5ED4A 4KMUX 1XMAA 4U0VA 3HTSB 2W57A 2VOPA 5CVRA 1JHFA 4WWCA 4P5OA 2DTRA 1CF7B 3KLNA 2Z9OA 2O61A 1H9GA 1IZ1A 1IF1A 2Y0MA 3CUQB 4KDPA 1J7KA 5JFRA 3F23A 2FNAA 3I71A 4EM2A 3E6BA 1KA8A 1TW2A 1ZGAA 4NQWA 5FGMA 4RGUA 3GZ6A 2LSOA 4LG0A 2NRAC 3VB2A 1BI1A 2EA2A 1R36A 2IA2A 1P4XA 3HRTA 1T98A 1G4DA 1LDKB 1FP2A 3BPVA 1YTYA 2JT1A 4N0BA 2W24A 3B02A 4EGZA 4G9YA 2JPCA 4P9FA 2XASA 2V9VA 3ROUA 1H0MA 4KN7X 1W7PA 2HKOA 5AIQA 1OMIA 1YIOA 5HLGA 3G73A 2J5OA 3QU6A 2G7HA 2OQRA 4CHUA 2FBHA 1XSXA 2VN2A 2GA2A 4IXAA 4P96A 1BC8C 1DUXC 2QVOA 4PCQA 1XCBA 2MH9A 1SFUA 4EJTA 1U5TC 2WC2A 3KFWX 3SHFA 4EM1A 4I01A 1IW7F 1J59A 5L3DA 4LB6B 2Z5UA 3DF8A 1ZG1A 3WGHA 3RKYA 3N97A 3GYHX 4DNCA 2PJPA 1S7OA 4ASNA 2PEXA 2YSRA 4HQMA 2B0LA 1IN5A 2G9WA 2L4AA 3QRFF 2HYGD 4U7BA 1KYWA 4RB3C 5HS7A 2XAHA 5CVJA 4R79A 4LD5A 1FWZA 1Z6TA 2WTEA 2K4JA 1U2WA 3MZYA 4M6YA 3CLOA 3GZ5A 3V8LA 5D6EA 4WXHA 5K1YA 3JSOA 3COAC 1W7PB 3DXJF 4AIJA 4OMZA 2W85A 2K7LA 3J81K 2F5CA 2E1NA 3KETA 2XAQA 3BPXA 4M73A 4YFNF 1AOYA 4U0YA 1HW5A 2W25A 3GX4X 4RAZA 1QQIA 3Q5FA 1ONVA 4LJZF 2FNPA 2NNNA 1G3YA 4G7OF 5ICEA 1BI2A 1ZN2A 3O3KA 2K4BA 1T38A 1XGSA 1YLFA 4ENKA 2DPDA 1B9NA 4AVPA 3BP8A 5TJJA 3F8NA 4I0AA 2P5VA 1FYKA 1RZ4A 1TQIA 5HLIA 1ZH5A 5LHHA 4R8HA 2OU2A 4OIRF 2EFWA 4ENNA 2D45A 2COMA 3BOQA 4I09A 1GVJA 1UHWA 5DV5A 1MJAA 1ZG5A 2LF7A 4FX4A 1BIBA 5HVQC 3KP7A 4Y17A 1HW1A 1RUOA 3QOPA 5HDGA 4N9HA 2KKOA 2MD5A 1MJ9A 1WRJA 2JSCA 2RC4A 2DK5A 2O3FA 4M9ZA 3E6MA 2DT5A 2ZFWA 3NEUA 1I27A 4Q48A 2GXBA 1T2KA 1XD7A 2O0YA 2RNJA 4MGRA 4A5NA 5DCFA 3L9FA 4BYYA 3M7GA 2OZ6A 2XKPA 3DFGA 2CFXA 4ZYDA 3VOEA 1T0FA 5K5RA 2NAZA 1ZRFA 4IRIA 4ZYEA 1SD5A 3V8JA 3HSEA 4MQVA 1TW3A 3RKXA 3C1DA 2IRFG 3KEOA 3R60A 2JPBA 4HZFA 2FU4A 3BWGA 3VFZA 2RDPA 4I2OA 1KGSA 4KUMA 3J80K 4KYWA 2Q0OA 5EEGA 3NQOA 3WTXC 5JR3A 4ESJA 3ULQB 4FT8A 1Z7UA 3HRMA 1XGNA 4WX9A 3CUOA 3BY6A 3HUGA 2DBBA 2BYVE 4HX4A 3KP6A 4L5JA 2L54A 3GW2A 1D5VA 1ZGJA 3HIFA 2P7VB 2XAJA 2CGPA 3LAJA 3F8BA 2ELHA 3HSRA 2C6YA 1O57A 3ZMSA 1FBQA 2X4HA 1RI7A 2QLZA 1PP8F 1QBJA 1FX7A 4M9SA 2A6EF 5FFXA 2R7FA 4BQAA 4GYGA 3KLOA 1LVAA 1Z1DA 2DQLA 4HOBA 2Y75A 1DPUA 3MAJA 4F7ZA 4O6JA 3I0TA 3REOA 2VBXA 2ZMEA 3J81Z 3WTYC 3TKYA 3FHZA 5L3GA 3ZP5A 3KCCA 2IPQX 3IWZA 5JI6A 3WU0A 3M8EA 3P9KA 1F1ZA 4RB2C 1R5GA 5FB2A 3LAPA 3O2PE 2RKHA 3RTRA 4A2UA 2ETHA 2H27A 1B1BA 5HS8A 3G3ZA 4XRFA 2H94A 3IL2A 4JK1X 1OKRA 2XUBA 4A6DA 3Q9VA 3HHGA 3K1PA 4IHTA 5D4SA 5LLQA 1VTNC 4RB0A 2A68F 2CWEA 2FF4A 1TNTA 4L18B 2L3DA 5ICFA 3P9CA 3WTVC 4CGZA 2RV8A 2IVMA 2HQRA 2EV6A 4L9VA 1ODDA 2P6SA 3K2ZA 3I4PA 2F5DA 4UVBA 1D8JA 2YU3A 2ZXJA 3CO7C 3R61A 3W6KB 2KJBA 2NNYA 1G3WA 3R0AA 4M6XA 4EVIA 4LB5A 2NYXA 3LQRA 5CVUA 5LHIA 4ZZDA 2M87A 1S8NA 2FMLA 1O3TA 1I1SA 4ETSA 1XMKA 5HDKA 2GZWA 1GHCA 2PMHA 4R1HA 2BGCA 1SMYF 3GUDA 4MTEA 3AAFA 1RIOH 4LMYA 4AWXB 3F8MA 1P6RA 3ECHA 3IC7A 5TRDA 1IUYA 4HF1A 1FNNA 1ZAOA 1EH6A 1YO5C 4KNYA 2XHKA 3C3WA 3GF2A 1QPMA 3CJNA 5BMZA 5IT3A 4H0EA 3I59A 2QYOA 2Q8KA 4EJOA 3KP5A 3TOAA 2JZYA 1HW2A 3E97A 4LLGF 2BEOA 2K86A 2EV0A 2F2EA 4HDVA 4HA8A 5DCMA 5D5UB 1IXSB 5LGNA 4OOIA 1IN8A 1WSUA 5IT9Z 4IJAA 1XSVA 4L9JA 1G3TA 1OYIA 3V4GA 2HOEA 3U1DA 2PMUA 1OYWA 3EDPA 2GWRA 2YX7A 1W4MA 3F8FA 3PQKA 4AIKA 3GXOA 3JTHA 4XSXF 1XN7A 3R6SA 4XLNF 5ICGA 2STWA 2STTA 2M30A 3ECOA 1WQ2A 5HDNA 4EJWA 2ZNZA 1JXSA 4WCGA 4HF2A 1J5YA 2D1HA 2QQ9A 4LK0F 5E18F 5E8GA 2FE3A 3FM3A 2UWMA 2CQKA 1K6OA 1R1UA 1O7LA 5L3FA 5HS9A 3BJ6A 3I59B 2HTJA 2KRFA 2FQ3A 5D4RA 3W6JB 4IHSA 3PQJA 1MJBA 2EA4A 1H9TA 4EQQA 5DCMB 1UB9A 3I53A 3EETA 3HRUA 1QGPA 1HKQA 3TGNA 2XV4S 1FSHA 2K27A 4AD9A 1P92A 3GFLA 4L9NA 3DP7A 3D5LA 3HTUA 4I98B 1WKMA 2JRTA 2V6CA 3WTZA 3F8CA 4PZJA 4L9TA 2HS5A 2HQNA 4LLNA 2P6TA 4HF0A 1TQMA 1BIAA 5LEKA 3L2CA 2EFQA 3M9AA 2KIMA 5LBQA 1OYYA 4LG0B 3FMRA 1T39A 1FYMA 5FFZA 3LA2A 1RNLA 2XIGA 1LQ1A 1W7PD 4OIOF 4E70A 5F1RA 4IRGA 1R1TA 4GYIA 1R22A 4WK8F 2ISZA 1ZRDA 4GCVA 2ZKZA 4L0YB 4KT5C 2R7DA 3ZMUA 1XB4A 2CG4A 5FLXK 4EJUA 4HV5A 2PFBA 4OINF 1IN7A 1F4KA 3MZHA 2CSOA 1Z9CA 5ILUA 4YFXF 1ZG3A 5E1WA 3F3XA 1FZPB 4ENJA 2GA1A 5LHGA 1ZARA 2VBYA 4OIPF 4MNUA 3M8FA 1PUEE 2RQPA 4CYDA 2KIUA 5A2QK 3JW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XSD A;  3I54 A;  3PFI A;  1ON1 A;  2H6B A;  4I7H A;  3FXR A;  1U8R A;  2XKO A;  4AIH A;  1YS6 A;  1I6X A;  1S3J A;  1K79 A;  4QLC U;  2VT3 A;  4G7H F;  4CXF A;  3HOT A;  3U2R A;  2LKP A;  1YS7 A;  3R4K A;  2D1V A;  4RGX A;  4HX8 A;  2VOO A;  3BJO A;  2PQ8 A;  4L0Z B;  1WI9 A;  2CYY A;  3KP4 A;  3TDZ C;  2AS5 F;  2G7U A;  5LEJ A;  4HX7 A;  1CGP A;  3MQ0 A;  4A0Y A;  1B59 A;  3OOP A;  3WOD F;  3MFK A;  3DV8 A;  2PN6 A;  3L7W A;  2HEO A;  3F6V A;  1FYL A;  4KIB A;  3ZPL A;  5K5O A;  1FP1 D;  3TDU C;  1LDD A;  3C7J A;  2XRN A;  1J75 A;  2YR2 A;  5BPD A;  2Z99 A;  1BM9 A;  2QWW A;  4LFU A;  1IRG A;  2FBI A;  4BHP A;  3NRV A;  5JVT A;  5DEQ A;  1IAW A;  3IKT A;  4CDG A;  1U78 A;  1IXC A;  2V1X A;  3TOB A;  2A07 F;  4Z2Y A;  2L4M A;  5CYV A;  4A5M A;  4IPA A;  4M72 A;  2EB7 A;  2P7C B;  2P4W A;  1C0W A;  4G7Z F;  1F9N A;  4BNC A;  5ILS A;  3GO5 A;  1IN4 A;  2JTV A;  3QPH A;  1U6G A;  2DU9 A;  1TTY A;  4ON0 A;  4I0B A;  5F6F A;  1HBX G;  1KU2 A;  4YFK F;  3F72 A;  3V7S A;  2XVC A;  3J7A O;  5DUK A;  4UUV A;  4G94 A;  4LLL A;  2QBY A;  1Z05 A;  2ZJ2 A;  1UCR A;  2V1D A;  1QO0 D;  1R1V A;  1J9I A;  2RGV A;  1FC3 A;  3DEU A;  3IKV A;  5FD6 A;  2VC1 A;  2QZ8 A;  4GO1 A;  1FY7 A;  1TLH B;  3C18 A;  1O3R A;  2ISY A;  4CIC A;  1HQC A;  3L09 A;  2CO5 A;  2ZBK A;  3SZT A;  3SZP A;  2FMY A;  1BI3 A;  5FD5 A;  5D5X B;  2E1C A;  5LGT A;  1SMT A;  2A3S A;  2HZT A;  3LWF A;  1YFH A;  2OZU A;  4M74 A;  3ZN1 A;  1MGT A;  1KQ8 A;  3RIR A;  3H3Z A;  1K78 A;  4UNO A;  3O6B B;  1UFM A;  2QM3 A;  2GAU A;  1XGO A;  3FMS A;  5DD8 A;  1BI0 A;  2ZO4 A;  5KK1 A;  2CW0 F;  1O7F A;  2F5E A;  4RB1 A;  3F21 A;  2L01 A;  1AWC A;  4MEX F;  1KU9 A;  3WGI A;  4DQ2 A;  4M71 A;  3ZMV A;  4ZH4 F;  3E6D A;  2VON A;  1F5T A;  3FXQ A;  1J0R A;  4KFC A;  1Q1H A;  2IA0 A;  1OPC A;  1EH7 A;  1FT9 A;  2AXL A;  3JSP A;  5E17 F;  1R00 A;  2K02 A;  5CVI A;  4HV6 A;  2DPU A;  4Y13 A;  3K9T A;  1I5Z A;  2UZK A;  2MLK A;  5L3E A;  4BAY A;  1CF7 A;  1SFE A;  2GQQ A;  1QZY A;  4EGY A;  4WF2 A;  4A6E A;  3KP3 A;  3CUQ A;  1W5T A;  3RYP A;  4RGS A;  3E6C C;  2PG4 A;  3K0L A;  3TO6 A;  4JBA A;  3IRQ A;  1G3S A;  4CZZ A;  4G8X A;  3BJA A;  3LFK A;  2ZME B;  3H3U A;  1USS A;  4ZZL A;  2LDU A;  5E1Z B;  1BJA A;  3GLX A;  3H92 A;  1Z91 A;  3JAM K;  1HKT A;  1D3Y A;  1SAX A;  4Q4Z F;  4Y15 A;  3TO9 A;  4UHT A;  1MKM A;  3ERE D;  4P55 A;  1K78 B;  2VE9 A;  2QQA A;  3GWZ A;  4ESB A;  2MA3 A;  1IN6 A;  2DFI A;  2QEN A;  3WG9 A;  4RGR A;  3CDH A;  2VXZ A;  4UXN A;  5ICC A;  3L00 A;  2DLL A;  3J80 Z;  1WWX A;  2WWY A;  2VT2 A;  3RI4 A;  6PAX A;  2HWV A;  1O3Q A;  3HYI A;  2HYF A;  1E2X A;  2IJL A;  1IRF A;  4JQF A;  2ACJ A;  2ESH A;  1SD6 A;  3WTT C;  2Q2E A;  4ESF A;  4ZYG A;  2W84 A;  3K69 A;  3ZMT A;  3P9I A;  4FHT A;  2P5L C;  3ZMZ A;  3SFZ A;  5CJ9 A;  2EWN A;  1JHH A;  1S7A A;  3P7N A;  3RKW A;  2MLG A;  1ZRE A;  1O3S A;  1YW8 A;  2EV5 A;  1YQA A;  2V79 A;  4EJV A;  1LB2 A;  4B09 A;  4FX0 A;  1TBX A;  3T0Y A;  3FM5 A;  4HLY A;  1S6L A;  1ZRC A;  2EK5 A;  2NS0 A;  2P8T A;  2IP2 A;  1LJ9 A;  1BC7 C;  2LF8 A;  3FWE A;  4KIG A;  2OQG A;  3TO7 A;  3CO6 C;  2OAZ A;  3K1N A;  1KQ0 A;  2L02 A;  4BXU A;  3VOD A;  4EV0 A;  2DQR A;  4GXO A;  4YG2 F;  3ZMD A;  3MWM A;  1U5T A;  1R7J A;  3EUH A;  1KQ9 A;  2ESN A;  3I64 A;  2DAO A;  4OU0 A;  3KZZ A;  2IT0 A;  3QP5 A;  1X3U A;  1EH8 A;  1UHM A;  1ZLK A;  1K7A A;  4TV7 A;  2KIF A;  3I58 A;  1RUN A;  2DW4 A;  1GXQ A;  2O6G E;  1QZZ A;  1B6A A;  3SQN A;  2ADU A;  1HST A;  3EYI A;  3ABU A;  1NHA A;  4UV8 A;  1ZYR F;  1LNW A;  4P9U A;  5J6X A;  1Z6R A;  2P5K A;  3Q9S A;  2M5W A;  4BH9 A;  5LGU A;  3RPQ A;  3E3V A;  2YPR A;  2HFH A;  3RJP A;  1R23 A;  2HTS A;  1MD0 A;  5L3B A;  3HOS A;  2RVC A;  2HKX A;  2ZCW A;  1L0O C;  1B9M A;  5E8I A;  4MEY F;  3I5U A;  3DPT A;  3LA7 A;  3LST A;  1SFX A;  2MH2 A;  5BQT A;  3D0S A;  4XSZ F;  3JTG A;  3JAM Z;  4OIQ F;  3EQL F;  2VC0 A;  2F5F A;  2XRO A;  2A61 A;  3FX3 A;  4G6D A;  1U5T B;  1ULY A;  1KYZ A;  1XDU A;  4A0Z A;  3WTU C;  1ZHF A;  3B73 A;  3KZY A;  2D2W A;  4L5I A;  4MQ9 F;  2M45 A;  2BBY A;  4KIF A;  1LEB A;  4EMS A;  2EFN A;  1XCV A;  4IF4 A;  5CLS A;  1REP C;  3FF5 A;  1I1G A;  2EJR A;  1S29 A;  1JGS A;  5CVV A;  1HXD A;  2XAF A;  1MDM A;  4UVA A;  5E1X A;  4ENM A;  3GFJ A;  3FXU A;  4LK1 F;  3WE2 A;  5LRS A;  5LRR A;  2VOD A;  4KA4 A;  2Y48 A;  4U0W A;  1TQP A;  3T1B A;  4HDU A;  3IWF A;  1A04 A;  2FRH A;  3S2W A;  3GEZ A;  4YII A;  2MC3 A;  3U9G A;  4MTD A;  3ZQ7 A;  1V4R A;  4O3M A;  4S04 A;  2Z33 A;  4B8X A;  5J8C A;  3RPU A;  3E5X A;  5K5Q A;  4S05 A;  1UST A;  1E17 A;  4PGH A;  3WTW C;  3HHH A;  1MZB A;  1BBY A;  1DDN A;  4K2E A;  1L3L A;  2FA5 A;  3ML6 A;  2J5P A;  2H09 A;  3FZV A;  3F22 A;  4KIC A;  5DD4 A;  5BPI A;  4BHC A;  3WTS C;  1JE8 A;  4KN4 X;  3DKW A;  2WV0 A;  2DI3 A;  1KU7 A;  2FSW A;  2TDX A;  2MBF A;  3F6O A;  1FBS A;  2HR3 A;  2KJC A;  4N9I A;  2QUF A;  1J2X A;  1GXP A;  3E5Q A;  3IRR A;  2FEZ A;  3GVA A;  5AIP A;  1LDJ A;  1V3F A;  4HLX A;  2OBP A;  1LEA A;  4HAM A;  4MHG A;  3V8K A;  4RS8 A;  3MCZ A;  3FMQ A;  2IA1 A;  3KE2 A;  4EM0 B;  2VBZ A;  3V7C A;  4UV9 A;  5DYM A;  1FOK A;  2M8E A;  2E7W A;  2HGC A;  1MDM B;  1BOA A;  2O8X A;  2EFO A;  1DPR A;  5FO5 A;  3KEQ A;  2DO7 A;  2XAG A;  3K1M A;  5EEH A;  4G6Q A;  3HSF A;  4HQE A;  1PP7 U;  4XBF A;  3ZN0 A;  3DQV C;  5H6Q A;  4PGG A;  4RAY A;  1XDS A;  1YG2 A;  3QU3 A;  1R5H A;  1ZLJ A;  2BE5 F;  4ZYH A;  1YW7 A;  5IT9 K;  4M9X A;  3MEX A;  1P2F A;  4CO8 A;  3N4M A;  5DDG A;  2GXG A;  3VEP A;  2OA4 A;  4WXC A;  3OV8 A;  2EFP A;  2A69 F;  1IXR C;  2FOK A;  5DUI A;  1B4A A;  2UXN A;  2VE8 A;  5F64 A;  3SXY A;  2UXX A;  3BZ6 A;  1FSE A;  5D5V B;  1YW9 A;  2DK8 A;  3RDI A;  2M1B A;  3T8T A;  4UVC A;  3CTA A;  5FLX Z;  4A12 A;  4IVN A;  3WGG A;  3R0J A;  5H20 A;  5D5W B;  1FLI A;  3EYY A;  2LNB A;  2QQB A;  3T8R A;  3ELK A;  2HDC A;  3HRS A;  4Q47 A;  2IW5 A;  1P4A A;  4XLP F;  1D8K A;  5A2Q Z;  2FBK A;  2A5Y B;  1FBU A;  2Z3Y A;  5E20 A;  3WE3 A;  5AON A;  1HKS A;  1TNS A;  3WU1 B;  5D8K B;  4OMY A;  2GIV A;  1HSJ A;  4D0P A;  4PDK A;  1ON2 A;  2A6H F;  1PDN C;  1OR7 A;  2H6C A;  4NHJ A;  1DP7 P;  3ISP A;  2QBY B;  5ERI A;  4NB5 A;  3DPL C;  5KVR A;  4BHB A;  2VBW A;  4I02 A;  3ABT A;  3BRO A;  1XGM A;  1T6S A;  5D6F A;  4Q5S F;  2PBI A;  4QWQ A;  5BOX A;  3QPT A;  4KMF A;  1SD7 A;  4A0X A;  2O03 A;  2E7X A;  5H6R A;  1U3E M;  3LA3 A;  2ZNY A;  2R3S A;  4LGW A;  1YYV A;  2OD5 A;  5D8L B;  2V1U A;  3BDD A;  2PLY A;  2FXA A;  2X0L A;  1QNT A;  3E5U A;  3IHU A;  1EV7 A;  5ILV A;  5HLH A;  3CUQ C;  1Y0U A;  1G6N A;  4WXD A;  5J8F A;  3GFI A;  3GFM A;  1SD4 A;  1BN5 A;  3QP6 A;  4O5V A;  5HOO A;  2BV6 A;  1R58 A;  4HYE A;  4IRH A;  2PI0 A;  5L3C A;  4HW0 A;  3M1E A;  3V7R A;  1KU3 A;  5BS6 A;  1W5S A;  3TQN A;  2XGX A;  1STZ A;  4HBL A;  3QAH A;  4U88 A;  5JHU A;  3KP2 A;  3LQQ A;  1FPQ A;  4U7D A;  1P4W A;  2YX4 A;  3RYR A;  4GGG A;  4YIF A;  2RN7 A;  3T5X A;  5ED4 A;  4KMU X;  1XMA A;  4U0V A;  3HTS B;  2W57 A;  2VOP A;  5CVR A;  1JHF A;  4WWC A;  4P5O A;  2DTR A;  1CF7 B;  3KLN A;  2Z9O A;  2O61 A;  1H9G A;  1IZ1 A;  1IF1 A;  2Y0M A;  3CUQ B;  4KDP A;  1J7K A;  5JFR A;  3F23 A;  2FNA A;  3I71 A;  4EM2 A;  3E6B A;  1KA8 A;  1TW2 A;  1ZGA A;  4NQW A;  5FGM A;  4RGU A;  3GZ6 A;  2LSO A;  4LG0 A;  2NRA C;  3VB2 A;  1BI1 A;  2EA2 A;  1R36 A;  2IA2 A;  1P4X A;  3HRT A;  1T98 A;  1G4D A;  1LDK B;  1FP2 A;  3BPV A;  1YTY A;  2JT1 A;  4N0B A;  2W24 A;  3B02 A;  4EGZ A;  4G9Y A;  2JPC A;  4P9F A;  2XAS A;  2V9V A;  3ROU A;  1H0M A;  4KN7 X;  1W7P A;  2HKO A;  5AIQ A;  1OMI A;  1YIO A;  5HLG A;  3G73 A;  2J5O A;  3QU6 A;  2G7H A;  2OQR A;  4CHU A;  2FBH A;  1XSX A;  2VN2 A;  2GA2 A;  4IXA A;  4P96 A;  1BC8 C;  1DUX C;  2QVO A;  4PCQ A;  1XCB A;  2MH9 A;  1SFU A;  4EJT A;  1U5T C;  2WC2 A;  3KFW X;  3SHF A;  4EM1 A;  4I01 A;  1IW7 F;  1J59 A;  5L3D A;  4LB6 B;  2Z5U A;  3DF8 A;  1ZG1 A;  3WGH A;  3RKY A;  3N97 A;  3GYH X;  4DNC A;  2PJP A;  1S7O A;  4ASN A;  2PEX A;  2YSR A;  4HQM A;  2B0L A;  1IN5 A;  2G9W A;  2L4A A;  3QRF F;  2HYG D;  4U7B A;  1KYW A;  4RB3 C;  5HS7 A;  2XAH A;  5CVJ A;  4R79 A;  4LD5 A;  1FWZ A;  1Z6T A;  2WTE A;  2K4J A;  1U2W A;  3MZY A;  4M6Y A;  3CLO A;  3GZ5 A;  3V8L A;  5D6E A;  4WXH A;  5K1Y A;  3JSO A;  3COA C;  1W7P B;  3DXJ F;  4AIJ A;  4OMZ A;  2W85 A;  2K7L A;  3J81 K;  2F5C A;  2E1N A;  3KET A;  2XAQ A;  3BPX A;  4M73 A;  4YFN F;  1AOY A;  4U0Y A;  1HW5 A;  2W25 A;  3GX4 X;  4RAZ A;  1QQI A;  3Q5F A;  1ONV A;  4LJZ F;  2FNP A;  2NNN A;  1G3Y A;  4G7O F;  5ICE A;  1BI2 A;  1ZN2 A;  3O3K A;  2K4B A;  1T38 A;  1XGS A;  1YLF A;  4ENK A;  2DPD A;  1B9N A;  4AVP A;  3BP8 A;  5TJJ A;  3F8N A;  4I0A A;  2P5V A;  1FYK A;  1RZ4 A;  1TQI A;  5HLI A;  1ZH5 A;  5LHH A;  4R8H A;  2OU2 A;  4OIR F;  2EFW A;  4ENN A;  2D45 A;  2COM A;  3BOQ A;  4I09 A;  1GVJ A;  1UHW A;  5DV5 A;  1MJA A;  1ZG5 A;  2LF7 A;  4FX4 A;  1BIB A;  5HVQ C;  3KP7 A;  4Y17 A;  1HW1 A;  1RUO A;  3QOP A;  5HDG A;  4N9H A;  2KKO A;  2MD5 A;  1MJ9 A;  1WRJ A;  2JSC A;  2RC4 A;  2DK5 A;  2O3F A;  4M9Z A;  3E6M A;  2DT5 A;  2ZFW A;  3NEU A;  1I27 A;  4Q48 A;  2GXB A;  1T2K A;  1XD7 A;  2O0Y A;  2RNJ A;  4MGR A;  4A5N A;  5DCF A;  3L9F A;  4BYY A;  3M7G A;  2OZ6 A;  2XKP A;  3DFG A;  2CFX A;  4ZYD A;  3VOE A;  1T0F A;  5K5R A;  2NAZ A;  1ZRF A;  4IRI A;  4ZYE A;  1SD5 A;  3V8J A;  3HSE A;  4MQV A;  1TW3 A;  3RKX A;  3C1D A;  2IRF G;  3KEO A;  3R60 A;  2JPB A;  4HZF A;  2FU4 A;  3BWG A;  3VFZ A;  2RDP A;  4I2O A;  1KGS A;  4KUM A;  3J80 K;  4KYW A;  2Q0O A;  5EEG A;  3NQO A;  3WTX C;  5JR3 A;  4ESJ A;  3ULQ B;  4FT8 A;  1Z7U A;  3HRM A;  1XGN A;  4WX9 A;  3CUO A;  3BY6 A;  3HUG A;  2DBB A;  2BYV E;  4HX4 A;  3KP6 A;  4L5J A;  2L54 A;  3GW2 A;  1D5V A;  1ZGJ A;  3HIF A;  2P7V B;  2XAJ A;  2CGP A;  3LAJ A;  3F8B A;  2ELH A;  3HSR A;  2C6Y A;  1O57 A;  3ZMS A;  1FBQ A;  2X4H A;  1RI7 A;  2QLZ A;  1PP8 F;  1QBJ A;  1FX7 A;  4M9S A;  2A6E F;  5FFX A;  2R7F A;  4BQA A;  4GYG A;  3KLO A;  1LVA A;  1Z1D A;  2DQL A;  4HOB A;  2Y75 A;  1DPU A;  3MAJ A;  4F7Z A;  4O6J A;  3I0T A;  3REO A;  2VBX A;  2ZME A;  3J81 Z;  3WTY C;  3TKY A;  3FHZ A;  5L3G A;  3ZP5 A;  3KCC A;  2IPQ X;  3IWZ A;  5JI6 A;  3WU0 A;  3M8E A;  3P9K A;  1F1Z A;  4RB2 C;  1R5G A;  5FB2 A;  3LAP A;  3O2P E;  2RKH A;  3RTR A;  4A2U A;  2ETH A;  2H27 A;  1B1B A;  5HS8 A;  3G3Z A;  4XRF A;  2H94 A;  3IL2 A;  4JK1 X;  1OKR A;  2XUB A;  4A6D A;  3Q9V A;  3HHG A;  3K1P A;  4IHT A;  5D4S A;  5LLQ A;  1VTN C;  4RB0 A;  2A68 F;  2CWE A;  2FF4 A;  1TNT A;  4L18 B;  2L3D A;  5ICF A;  3P9C A;  3WTV C;  4CGZ A;  2RV8 A;  2IVM A;  2HQR A;  2EV6 A;  4L9V A;  1ODD A;  2P6S A;  3K2Z A;  3I4P A;  2F5D A;  4UVB A;  1D8J A;  2YU3 A;  2ZXJ A;  3CO7 C;  3R61 A;  3W6K B;  2KJB A;  2NNY A;  1G3W A;  3R0A A;  4M6X A;  4EVI A;  4LB5 A;  2NYX A;  3LQR A;  5CVU A;  5LHI A;  4ZZD A;  2M87 A;  1S8N A;  2FML A;  1O3T A;  1I1S A;  4ETS A;  1XMK A;  5HDK A;  2GZW A;  1GHC A;  2PMH A;  4R1H A;  2BGC A;  1SMY F;  3GUD A;  4MTE A;  3AAF A;  1RIO H;  4LMY A;  4AWX B;  3F8M A;  1P6R A;  3ECH A;  3IC7 A;  5TRD A;  1IUY A;  4HF1 A;  1FNN A;  1ZAO A;  1EH6 A;  1YO5 C;  4KNY A;  2XHK A;  3C3W A;  3GF2 A;  1QPM A;  3CJN A;  5BMZ A;  5IT3 A;  4H0E A;  3I59 A;  2QYO A;  2Q8K A;  4EJO A;  3KP5 A;  3TOA A;  2JZY A;  1HW2 A;  3E97 A;  4LLG F;  2BEO A;  2K86 A;  2EV0 A;  2F2E A;  4HDV A;  4HA8 A;  5DCM A;  5D5U B;  1IXS B;  5LGN A;  4OOI A;  1IN8 A;  1WSU A;  5IT9 Z;  4IJA A;  1XSV A;  4L9J A;  1G3T A;  1OYI A;  3V4G A;  2HOE A;  3U1D A;  2PMU A;  1OYW A;  3EDP A;  2GWR A;  2YX7 A;  1W4M A;  3F8F A;  3PQK A;  4AIK A;  3GXO A;  3JTH A;  4XSX F;  1XN7 A;  3R6S A;  4XLN F;  5ICG A;  2STW A;  2STT A;  2M30 A;  3ECO A;  1WQ2 A;  5HDN A;  4EJW A;  2ZNZ A;  1JXS A;  4WCG A;  4HF2 A;  1J5Y A;  2D1H A;  2QQ9 A;  4LK0 F;  5E18 F;  5E8G A;  2FE3 A;  3FM3 A;  2UWM A;  2CQK A;  1K6O A;  1R1U A;  1O7L A;  5L3F A;  5HS9 A;  3BJ6 A;  3I59 B;  2HTJ A;  2KRF A;  2FQ3 A;  5D4R A;  3W6J B;  4IHS A;  3PQJ A;  1MJB A;  2EA4 A;  1H9T A;  4EQQ A;  5DCM B;  1UB9 A;  3I53 A;  3EET A;  3HRU A;  1QGP A;  1HKQ A;  3TGN A;  2XV4 S;  1FSH A;  2K27 A;  4AD9 A;  1P92 A;  3GFL A;  4L9N A;  3DP7 A;  3D5L A;  3HTU A;  4I98 B;  1WKM A;  2JRT A;  2V6C A;  3WTZ A;  3F8C A;  4PZJ A;  4L9T A;  2HS5 A;  2HQN A;  4LLN A;  2P6T A;  4HF0 A;  1TQM A;  1BIA A;  5LEK A;  3L2C A;  2EFQ A;  3M9A A;  2KIM A;  5LBQ A;  1OYY A;  4LG0 B;  3FMR A;  1T39 A;  1FYM A;  5FFZ A;  3LA2 A;  1RNL A;  2XIG A;  1LQ1 A;  1W7P D;  4OIO F;  4E70 A;  5F1R A;  4IRG A;  1R1T A;  4GYI A;  1R22 A;  4WK8 F;  2ISZ A;  1ZRD A;  4GCV A;  2ZKZ A;  4L0Y B;  4KT5 C;  2R7D A;  3ZMU A;  1XB4 A;  2CG4 A;  5FLX K;  4EJU A;  4HV5 A;  2PFB A;  4OIN F;  1IN7 A;  1F4K A;  3MZH A;  2CSO A;  1Z9C A;  5ILU A;  4YFX F;  1ZG3 A;  5E1W A;  3F3X A;  1FZP B;  4ENJ A;  2GA1 A;  5LHG A;  1ZAR A;  2VBY A;  4OIP F;  4MNU A;  3M8F A;  1PUE E;  2RQP A;  4CYD A;  2KIU A;  5A2Q K;  3JW4 A; 
#chains in the Genus database with same CATH topology
 1XMX A;  2GBY A;  2WAE A;  3QPL A;  1XSD A;  3S1Q J;  3I54 A;  1SAU A;  3CF5 F;  4PSX A;  3MKZ A;  3PFI A;  1ON1 A;  2H6B A;  1UJ8 A;  2LD5 A;  4I7H A;  3GZN B;  2L7K A;  3FXR A;  3JRH A;  1U8R A;  2M4G A;  2XKO A;  4AIH A;  1YS6 A;  1I6X A;  4A3J J;  5H2F C;  1S3J A;  1K79 A;  3MKW B;  3SEQ A;  4QLC U;  2VT3 A;  2L7M P;  3SYT A;  4G7H F;  4CXF A;  3LSG A;  3HOT A;  2BY0 A;  1OQY A;  3U2R A;  1I6H J;  4H4K C;  2LKP A;  4EEF G;  1MMA A;  1YS7 A;  3ABM H;  3DKY A;  2YU9 J;  3CQZ J;  3R4K A;  2D1V A;  4XMY A;  3MD2 A;  4RGX A;  2L9N A;  4HX8 A;  4BU2 A;  2VOO A;  3BJO A;  2PQ8 A;  4L0Z B;  1OFC X;  3LSP A;  1WI9 A;  2X48 A;  2CYY A;  3KP4 A;  1I39 A;  3TDZ C;  2AS5 F;  2G7U A;  5LEJ A;  3TW6 A;  4HX7 A;  3S1R J;  1CGP A;  3MQ0 A;  2M0M A;  1WJC A;  3A0H C;  3TP0 A;  4A0Y A;  1B59 A;  4FIS A;  2QCO A;  5IY5 H;  3OOP A;  3L2W A;  4MO7 A;  1MNE A;  1T8I A;  3WOD F;  2JSP A;  5J1U A;  4XIC A;  4DYQ A;  2LY2 A;  2DYS H;  2ID6 A;  3KX2 A;  3MFK A;  4F52 A;  3DV8 A;  2PN6 A;  3L7W A;  2HEO A;  4NC7 A;  3HDD A;  3DCF A;  1ORK A;  3F6V A;  1FYL A;  2HDD A;  4KIB A;  1FMW A;  3OYN A;  3ZPL A;  1DU6 A;  5K5O A;  1FP1 D;  4BJ6 C;  3TDU C;  3CCV I;  1LDD A;  1MBE A;  2EIN H;  4DZP A;  3LSI A;  3C7J A;  2XRN A;  1FIA A;  1J75 A;  2YR2 A;  5BPD A;  2Z99 A;  2H8R A;  1BM9 A;  2BVM A;  2QWW A;  3BG6 A;  4LFU A;  4X6A J;  2HXI A;  1IRG A;  2B7E A;  2CFO A;  2O7O A;  1RR8 C;  2FBI A;  4BHP A;  4ZTF A;  3NRV A;  5IOY A;  3U1K A;  5JVT A;  5DEQ A;  1IAW A;  3IKT A;  4CDG A;  1U78 A;  1IXC A;  2V1X A;  3CMY A;  1W0U A;  3TOB A;  2AQF A;  2AO9 A;  1B8I A;  2A07 F;  4Z2Y A;  2L4M A;  5CYV A;  4A5M A;  3AKZ A;  5EG0 A;  4I99 C;  3G1O A;  4IPA A;  3I56 I;  1X1D A;  3OR1 C;  4IHX A;  4DBQ A;  2GIZ A;  4XN3 A;  4M72 A;  4A3B J;  1FOY A;  2M4K A;  2Y2Z A;  1FOX A;  2EB7 A;  4IO9 F;  2P7C B;  2P4W A;  1T0F C;  1C0W A;  4G7Z F;  1F9N A;  3I3L A;  5ILS A;  4BNC A;  3GO5 A;  1IN4 A;  2JTV A;  2WAD A;  3W2A A;  1V54 H;  3QPH A;  4CH7 A;  1U6G A;  2DU9 A;  3K7A J;  1TTY A;  3A4C A;  4ON0 A;  4I0B A;  1EJ9 A;  5F6F A;  2WY8 Q;  1HBX G;  1KU2 A;  1VZ0 A;  4YFK F;  4J01 A;  2LH9 A;  3F72 A;  4U87 A;  1YJ9 I;  3PNY A;  1VFC A;  1T56 A;  1GLN A;  3V7S A;  2XVC A;  3J7A O;  1XC5 A;  5DUK A;  4UUV A;  3BT9 A;  4G94 A;  4LLL A;  2EQR A;  1IJW C;  1HC8 A;  2MSY A;  2JN6 A;  1Z05 A;  2QBY A;  3GTK J;  2ZJ2 A;  4PJN A;  1UCR A;  2V1D A;  1QO0 D;  1Z67 A;  3LSR A;  1R1V A;  1W1W E;  1EF4 A;  4OAZ A;  1J9I A;  5F0F A;  3D5S C;  2RGV A;  1FC3 A;  3DEU A;  3IKV A;  5EJC A;  5FD6 A;  5K7Z A;  2VC1 A;  2QZ8 A;  4GO1 A;  3G2B A;  1FY7 A;  3KYC B;  1TLH B;  1IV8 A;  3MMY B;  4E7J A;  1X1B A;  1X2M A;  3C18 A;  3OR2 C;  1O3R A;  2ISY A;  4CIC A;  1IG7 A;  1HQC A;  1Y56 A;  2CO5 A;  2LC2 A;  2ZBK A;  3L09 A;  1Z77 A;  1QPI A;  3K2A A;  3SZT A;  3SZP A;  2XPW A;  1EA3 A;  1BI3 A;  2FMY A;  5FD5 A;  1A35 A;  3Q0V A;  5D5X B;  2E1C A;  2IGN A;  5LGT A;  1SMT A;  3K4N A;  2A3S A;  2HZT A;  2DT6 A;  4QIW N;  3LWF A;  3VYR B;  3LOC A;  1YFH A;  1FTZ A;  3J7Y J;  2OZU A;  2GOX B;  4NC6 A;  1R4M B;  4M74 A;  3ZN1 A;  1MGT A;  3OYC A;  1KQ8 A;  2EIK H;  3RIR A;  3G1L A;  3H3Z A;  1K78 A;  4PFO A;  3O6B B;  1UFM A;  4UNO A;  3ZQQ A;  1TP4 A;  4M3E A;  2QM3 A;  2GAU A;  1FEX A;  1XGO A;  3UNG C;  2DXI A;  3FMS A;  3ASN H;  5DD8 A;  2ZME C;  1BI0 A;  2ZO4 A;  3BG9 A;  5KK1 A;  3PJR A;  2CW0 F;  1O7F A;  2F5E A;  4RB1 A;  4X1E A;  5FKK A;  5IOZ A;  3DEE A;  3F21 A;  1JKP C;  2L01 A;  1AWC A;  4MEX F;  1KU9 A;  3CF2 A;  3SZG A;  4IX7 A;  2FD5 A;  2L7Z A;  3ZQF A;  3WGI A;  4DQ2 A;  4M71 A;  5GAH J;  1D0Z A;  1LE8 A;  1N78 A;  3ZMV A;  4ZH4 F;  1V5G A;  3E6D A;  5J47 A;  2VON A;  2LBF B;  2M34 A;  1F5T A;  3FXQ A;  3HUG B;  2OUM A;  1J0R A;  1Y1W J;  2O5R A;  2V9K A;  4KFC A;  1MNM C;  4D1Q A;  1Q1H A;  3D5R C;  3IH2 A;  4XN0 A;  2IA0 A;  3FXO A;  4BS9 A;  4A3G J;  1OPC A;  1TWG J;  2VKE A;  1EH7 A;  1FT9 A;  2E2I J;  2AXL A;  2KRC A;  3JSP A;  5E17 F;  1R00 A;  2K02 A;  4AU7 A;  5CVI A;  4HRI A;  2JVG A;  3BR0 A;  4HV6 A;  3A03 A;  2DPU A;  4Y13 A;  1K4S A;  3K9T A;  4ZDP A;  1Y8R B;  1I5Z A;  2UZK A;  2MLK A;  5L3E A;  3K4K A;  2JRM A;  2CW7 A;  4BAY A;  1CF7 A;  2P81 A;  3S16 J;  1SFE A;  2GQQ A;  1QZY A;  4EGY A;  2E2J J;  1WCM J;  4NC8 A;  4OAY A;  3TBI A;  4L5E A;  3BTJ A;  4WF2 A;  4A6E A;  3KP3 A;  2DFE A;  3PIO F;  1WZ2 A;  1D0X A;  3CUQ A;  2ZXH A;  1W5T A;  3RYP A;  5J1R A;  4RGS A;  3E6C C;  2PG4 A;  2LYC A;  3K0L A;  3TO6 A;  4JBA A;  1APL C;  2JA2 A;  3OMY A;  2DCE A;  3IRQ A;  2LR8 A;  1G3S A;  1VQN I;  4XOP A;  4CZZ A;  3DLL F;  2R5Z A;  4YEL A;  2GOM A;  4G8X A;  2V1N A;  1WH7 A;  3BJA A;  3OYI A;  3LFK A;  2ZME B;  3H3U A;  3HB9 A;  1PYV A;  1USS A;  4ZZL A;  2LDU A;  3CDI A;  5E1Z B;  1BJA A;  2LKX A;  3GLX A;  3H92 A;  4E7L A;  1Z91 A;  1SEU A;  3JAM K;  2L7F P;  1S5L C;  4J00 A;  1HKT A;  3EUK L;  3VPR A;  1D3Y A;  1SAX A;  4Q4Z F;  1QVT A;  4Y15 A;  3PNT A;  3TO9 A;  4UHT A;  1MKM A;  3ERE D;  4P55 A;  1K78 B;  4ZJZ A;  2VE9 A;  2QQA A;  2PJR B;  3GWZ A;  1X1C A;  2W1O A;  4ESB A;  3HGY A;  3HM5 A;  2R5Y A;  1UG0 A;  2MA3 A;  1U8B A;  3E1S A;  2PMZ N;  1IN6 A;  3HGG A;  1IC8 A;  2DFI A;  2QEN A;  3WG9 A;  1RPW A;  4RGR A;  3CMA I;  4JX4 A;  5HNF A;  2K3P A;  3CDH A;  2VXZ A;  4E6K G;  3AG4 H;  4UXN A;  5ICC A;  2LVS A;  3L00 A;  1VQP I;  5EEA A;  5GTI C;  1LVK A;  2DLL A;  3ZRG A;  3WHB A;  3J80 Z;  1WWX A;  2WWY A;  3TED A;  3FBI B;  2VT2 A;  3RI4 A;  3ESW B;  2X6O A;  2HOA A;  4BQQ A;  4II3 A;  2M9H A;  3A0B C;  4RMN A;  6PAX A;  3HPH A;  2HWV A;  1O3Q A;  3J7A Y;  3HYI A;  2ELJ A;  2HYF A;  1E2X A;  4S0H B;  5LFA A;  1QHG A;  2IJL A;  1IRF A;  3ERM A;  1MMG A;  2ESH A;  4JQF A;  1SD6 A;  5C3E J;  2ACJ A;  3WTT C;  4BY1 J;  2Q2E A;  2VKD A;  4ESF A;  4ZYG A;  2W84 A;  3SFI A;  3BR3 A;  3K69 A;  3ZMT A;  1SFO J;  2I10 A;  3CJT B;  3P9I A;  4FHT A;  1JKR C;  2MW8 A;  2P5L C;  1YRN A;  3ZMZ A;  3SFZ A;  5K7H A;  3H35 A;  2MGQ A;  5CJ9 A;  2EWN A;  3TW7 A;  1I3A A;  1JHH A;  1S7A A;  3P7N A;  2HYJ A;  1AKH A;  3RKW A;  1DQU A;  3S2D J;  2E36 A;  2HPM A;  5KNL A;  3LSM A;  1OIS A;  2W48 A;  1XTA A;  2MLG A;  2CQ7 A;  1ZRE A;  3BTL A;  4XLC A;  1O3S A;  3UR3 C;  1YW8 A;  2WV1 A;  3HOW J;  2LOO A;  2EV5 A;  3NAU A;  1YQA A;  2R5Z B;  3IH3 A;  4YEJ A;  2V79 A;  4EJV A;  1LB2 A;  1Z21 A;  5GAE J;  5JLX A;  4B09 A;  5IP9 J;  1S7E A;  4FX0 A;  1TBX A;  2NVY J;  3T0Y A;  4XQF A;  5E3M A;  1B72 B;  3FM5 A;  4LOC A;  4P1W A;  4HLY A;  1S6L A;  1BW5 A;  1ZRC A;  2X6X A;  2EK5 A;  4XLF A;  2NS0 A;  4CCJ A;  4DOZ A;  2P8T A;  1IO2 A;  2IP2 A;  2R7W A;  4C2M J;  1LJ9 A;  3DU6 A;  1BC7 C;  2LF8 A;  2D5V A;  2AHQ A;  3FWE A;  4KIG A;  1HDD C;  2W82 A;  2OQG A;  3VSK A;  5IP6 A;  2LMD A;  3TO7 A;  1GT0 C;  3CO6 C;  2OAZ A;  2Q1Z B;  3K1N A;  1KQ0 A;  4UUS A;  2I5U A;  2L02 A;  3B6C A;  1NH3 A;  2EH3 A;  4BXU A;  3ASO H;  3VOD A;  4EV0 A;  2DQR A;  4PJL A;  1ETO A;  4A3I J;  3P5J A;  4GXO A;  4XLA A;  3GCM A;  4YG2 F;  3ZMD A;  3MWM A;  5M5Y J;  1U5T A;  2L5Q A;  1R7J A;  3A2K A;  3EUH A;  1KQ9 A;  2ESN A;  1UHS A;  2EPF A;  2VPL A;  3I64 A;  1HA8 A;  2RRE A;  4PK4 A;  2DAO A;  3W6V A;  3JRC A;  4E7S A;  4OU0 A;  3KZZ A;  1F36 A;  2IT0 A;  3BLY A;  3S93 A;  3QP5 A;  3N05 A;  3DPU A;  1X3U A;  1EH8 A;  4E7H A;  1UHM A;  2GXA A;  1ZLK A;  4A3D J;  2LP0 A;  1K7A A;  1WFX A;  2DDA A;  3FXL A;  2LTP A;  4TV7 A;  2KIF A;  3I58 A;  2F4O B;  1RUN A;  2DW4 A;  1GXQ A;  1R49 A;  2O6G E;  1G8X A;  1QZZ A;  1B6A A;  1NTC A;  3SQN A;  2ADU A;  1ETY A;  1DP3 A;  3RCO A;  2IEK A;  2R7X A;  1HST A;  3EYI A;  1TWA J;  4B44 A;  4IQJ A;  3ABU A;  2H1L A;  2IS2 A;  1NHA A;  4UV8 A;  2ME6 A;  1ZYR F;  4IOA F;  3DLA A;  2LFB A;  1LNW A;  2QSH X;  3OL3 A;  3JCU C;  4P9U A;  5J6X A;  1Z6R A;  1KON A;  3H0G J;  2P5K A;  3Q9S A;  3CP2 A;  2M5W A;  4MLO A;  5J4Y A;  3GTQ J;  2NS7 A;  1JUS A;  1GDT A;  4B47 A;  4BH9 A;  5LGU A;  4A3K J;  3RPQ A;  3E3V A;  2P0W A;  2YPR A;  2E5N A;  2VLA A;  2HFH A;  4CCK A;  3RJP A;  1R23 A;  1X1P A;  2HTS A;  1K6Y A;  2W00 A;  1D5Y A;  2CW8 A;  5IP7 J;  4RLQ A;  1MD0 A;  4A3F J;  5L3B A;  3HOS A;  2RVC A;  4ZTJ A;  2HKX A;  2ZCW A;  1L0O C;  1B9M A;  1V5F A;  3FKI J;  5E8I A;  4MEY F;  3M4O J;  3CCY A;  3I5U A;  1ZGW A;  3DPT A;  3LA7 A;  4RDU A;  1YI2 I;  3LST A;  3K6G A;  2QF7 A;  3PFY A;  1SFX A;  3CDL A;  3F9K A;  2MH2 A;  2JK3 A;  5BQT A;  3RKQ A;  3D0S A;  4XSZ F;  3G4S I;  3JTG A;  2XDV A;  3OIP A;  3JAM Z;  4OIQ F;  2EBI A;  3EQL F;  2VC0 A;  1Y0N A;  2F5F A;  2XRO A;  2A61 A;  3FX3 A;  1OCP A;  5FJ8 J;  4RLF A;  1SVO A;  1K83 J;  4G6D A;  2R7O A;  4W97 A;  3U21 A;  1U5T B;  1ULY A;  5KAF C;  1WJB A;  1KYZ A;  2DA4 A;  1XDU A;  2RNG A;  4A0Z A;  3WTU C;  2HOT A;  1ZHF A;  2JMW A;  3B73 A;  4NBQ A;  1CQT A;  2XPU A;  1RES A;  3KZY A;  2D2W A;  2CUF A;  5EYR A;  1QZE A;  4L5I A;  4MQ9 F;  2ZC2 A;  1T95 A;  2M45 A;  3GTG J;  1G2H A;  2BBY A;  2R7Q A;  4KIF A;  4YRV A;  2VUM J;  5FKN A;  2BW3 A;  1LEB A;  4EMS A;  5E79 C;  3JRG A;  2EFN A;  1XCV A;  4IF4 A;  5CLS A;  1REP C;  3FF5 A;  3IAS 2;  3PO2 J;  1U0J A;  2IS6 A;  1I1G A;  2EJR A;  5M5X J;  2EZL A;  2V4J C;  3BCB A;  1S29 A;  1JGS A;  2NVT J;  5CVV A;  1HXD A;  4DYR A;  3HOU J;  1RRJ A;  2XAF A;  1MDM A;  1XX5 A;  4UVA A;  5E1X A;  2QKL B;  4ENM A;  3GFJ A;  4MFE A;  3FXU A;  5J3L A;  3CCQ I;  2X1E A;  4LK1 F;  4ANJ A;  3WE2 A;  1MMS A;  5LRS A;  2V6E A;  3BG7 A;  4HNT A;  4XRS G;  3G71 I;  5LRR A;  5TIS C;  1H8A C;  2VOD A;  1RKW A;  4KA4 A;  3W3C A;  2Y48 A;  4U0W A;  1TQP A;  3T1B A;  4HDU A;  3IWF A;  1A04 A;  1JTX A;  2FRH A;  3S2W A;  3GEZ A;  1VQ5 I;  2BY3 A;  4YII A;  3ZQI A;  2MC3 A;  3HOV J;  4BQN A;  3U9G A;  3K10 A;  1HLV A;  4MTD A;  3ZQ7 A;  1V4R A;  2BXY A;  5EF6 A;  4O3M A;  1VQM I;  4EAT A;  4S04 A;  2Z33 A;  4B8X A;  5J8C A;  3RPU A;  3E5X A;  5DM7 F;  5K5Q A;  4S05 A;  1UST A;  1E17 A;  4PGH A;  3WTW C;  3HHH A;  2E1O A;  1MZB A;  1LUJ B;  1BBY A;  1DDN A;  4K2E A;  2DT7 B;  2KDO A;  2ME0 A;  2FA5 A;  1L3L A;  4CSW A;  1MSE C;  3ML6 A;  2J5P A;  2H09 A;  3FZV A;  2ZXW H;  3F22 A;  5B5E C;  2K9S A;  4KIC A;  5DD4 A;  1TT5 B;  4BHC A;  3L1P A;  5BPI A;  3WTS C;  3ONQ A;  3VYT B;  3DU5 A;  2RQQ A;  1JE8 A;  4KN4 X;  2JUG A;  3DKW A;  2WV0 A;  4CYC A;  1TWC J;  2OCE A;  2CQQ A;  4LIV A;  2DI3 A;  2Y0S N;  2FSW A;  2TDX A;  1TWF J;  2MBF A;  3F6O A;  1PUF A;  2E19 A;  5GAD J;  4J19 A;  1FBS A;  2K9Q A;  2HR3 A;  3EPZ A;  1POG A;  2KJC A;  3KZI C;  4N9I A;  2QUF A;  5JVG F;  1P9Q C;  1E0E A;  1J2X A;  1W36 C;  3RQI A;  1GXP A;  3E5Q A;  3IRR A;  4V2F A;  2W7N A;  2FEZ A;  3GVA A;  5AIP A;  2WAQ N;  1LDJ A;  3LSH A;  1V3F A;  5IYC J;  4HLX A;  2XB0 X;  1SVL A;  2OBP A;  1LEA A;  2KT0 A;  4HAM A;  4MHG A;  3V8K A;  4RS8 A;  3MCZ A;  1YJW I;  3FMQ A;  2IA1 A;  3KE2 A;  5F04 A;  3PL8 A;  4EM0 B;  2VBZ A;  3V7C A;  3CC7 I;  5IYB J;  4UV9 A;  2V9P A;  5DYM A;  1FOK A;  2LKS A;  2IGM A;  4HNV A;  3M1C A;  2M8E A;  1WJA A;  1QHH D;  2E7W A;  1VF9 A;  2HGC A;  4PJJ A;  1MDM B;  3JR9 A;  1BOA A;  5FLV A;  2NVQ J;  2O8X A;  2EFO A;  1DPR A;  3GME A;  1NG7 A;  3S3M A;  2Z2S B;  5FO5 A;  1R71 A;  1FMV A;  1T33 A;  2DO7 A;  2EIL H;  1BJZ A;  2XAG A;  3CLQ A;  3KEQ A;  3K1M A;  4FE4 A;  4NDL A;  4HPQ A;  3HOZ J;  2XF5 A;  5EEH A;  4G6Q A;  3WHC A;  3HSF A;  3LMM A;  4HQE A;  2X51 A;  1PP7 U;  4AC0 A;  1BR4 A;  2ECB A;  3ABK H;  4XBF A;  5F1J A;  3JRF A;  3ZN0 A;  3OYK A;  3DQV C;  5H6Q A;  4PGG A;  4RAY A;  2FUG 2;  2HXO A;  2VIX A;  1XDS A;  1ETQ A;  1YG2 A;  3QU3 A;  4DYC A;  4E7K A;  5GAG J;  4QPQ A;  3CCJ I;  3LFU A;  1R5H A;  2L9R A;  1ZLJ A;  2BE5 F;  2F6C A;  1YX5 A;  4ZYH A;  1YW7 A;  3HL2 A;  5IT9 K;  2ZFU A;  4M9X A;  3I4N J;  3MEX A;  2MG4 A;  1P2F A;  4CO8 A;  3N4M A;  4DGW B;  5DDG A;  4LG3 A;  3OSF A;  1NK2 P;  2GXG A;  3CJQ B;  4G6T B;  3S1M J;  3VEP A;  2OA4 A;  4WXC A;  3BR1 A;  2M0C A;  3OV8 A;  2EFP A;  4DW6 A;  2R7U A;  2A69 F;  3BCA A;  1IXR C;  4Y52 J;  1MBK A;  2TCT A;  2FOK A;  5DUI A;  1B4A A;  3QWL A;  2HNH A;  3OYD A;  2DTZ A;  2UXN A;  2VE8 A;  5F64 A;  2DOE A;  3SXY A;  2CS3 A;  5IYD J;  2UXX A;  1PUF B;  3BZ6 A;  3GTP J;  1FSE A;  2V7F A;  2ICW G;  5D5V B;  3H5N A;  2OC6 A;  1YW9 A;  2L2O A;  2DK8 A;  4DJA A;  1FTT A;  3G1M A;  5IPA A;  5K7F A;  2KL4 A;  3RDI A;  2M1B A;  5EDN A;  1NG6 A;  3T8T A;  4UVC A;  3CTA A;  2WY7 Q;  4CA0 A;  4YIR X;  5FLX Z;  3CCR I;  3S17 J;  2QKM B;  5DM6 F;  4IVN A;  3WGG A;  3R0J A;  5M3M J;  1MBG A;  4A12 A;  1YX3 A;  4D5F A;  3K70 C;  5H20 A;  3H3V K;  2DFH A;  5D5W B;  3OY9 A;  3X2Q H;  1FLI A;  1BR1 A;  2CUJ A;  3EYY A;  2LNB A;  1HDP A;  2MC4 A;  2QQB A;  1B8I B;  1UZC A;  1D1A A;  3T8R A;  2XGC A;  3ELK A;  1ETX A;  2HDC A;  4NUB A;  5EG0 B;  2XSD C;  3PM1 A;  3A01 A;  3GBG A;  3HRS A;  4Q47 A;  1SC7 A;  2GM4 A;  2IW5 A;  1P4A A;  2IS1 A;  2BOL A;  4XLP F;  1D8K A;  5A2Q Z;  1O4X A;  2FBK A;  2A5Y B;  4XR6 A;  1MND A;  1WJE A;  1SFK A;  2DA6 A;  2LY1 A;  3QYB A;  1FBU A;  1BL0 A;  2Z3Y A;  5E20 A;  3IUO A;  3WE3 A;  5AON A;  2KQR A;  3NWS A;  3K4J A;  1HKS A;  1A6I A;  1TNS A;  5C44 J;  3WU1 B;  5D8K B;  4OMY A;  3I4M J;  2GIV A;  1HSJ A;  4D0P A;  4PDK A;  4F55 A;  4Z6Y A;  1ON2 A;  2A6H F;  2HI3 A;  1PDN C;  2K3F A;  4A3C J;  1OR7 A;  4D7N A;  2H6C A;  4NHJ A;  1DP7 P;  3RQ4 A;  1E3O C;  3K70 D;  3ISP A;  2QBY B;  5ERI A;  1RET A;  2DMQ A;  3DPL C;  4NB5 A;  4BQO A;  5KVR A;  4BHB A;  4F3Q A;  1WPK A;  2VBW A;  1Y6I A;  4I02 A;  3ABT A;  3BRO A;  1XGM A;  1T6S A;  5D6F A;  4Q5S F;  2WAF A;  2XB5 A;  2PBI A;  3S2H J;  1LFU P;  2DOD A;  4QWQ A;  2DMU A;  1E3P A;  5BOX A;  4OWR B;  4IZZ A;  1JJ8 C;  3QPT A;  4IHY A;  1GVD A;  4KMF A;  1SD7 A;  2AXT C;  4A0X A;  2O03 A;  2E7X A;  4BJ5 C;  2Y9Z A;  5H6R A;  1U3E M;  3LA3 A;  1LFP A;  1R4N B;  2ZNY A;  4XOR A;  1ENH A;  2R3S A;  4LGW A;  1YYV A;  2OD5 A;  1D1C A;  3ZCO A;  5D8L B;  2V1U A;  3BDD A;  1Q1V A;  2PLY A;  3IAM 2;  4JP0 A;  2ZB9 A;  2FXA A;  2X0L A;  4F91 B;  3OS1 A;  1W5C C;  1R9T J;  3BTC A;  1QNT A;  1WVR A;  3E5U A;  3KYD B;  3IHU A;  1OJL A;  2TRT A;  4BXF A;  4ZDO A;  1EV7 A;  1MH4 A;  5ILV A;  1R6R A;  5HLH A;  2WBM A;  3EUA A;  3CUQ C;  1WI3 A;  1Y0U A;  2CH0 A;  5F0C A;  2VL8 A;  1G6N A;  4WXD A;  5J8F A;  3OYG A;  2E5Z A;  4XKC A;  1TT0 A;  3HC7 A;  3GFM A;  3GFI A;  1SD4 A;  1BN5 A;  3RSN A;  2M7B A;  3QP6 A;  4O5V A;  2A05 A;  5HOO A;  1HF0 A;  2BV6 A;  1R58 A;  4HYE A;  4IRH A;  2PI0 A;  5L3C A;  4HW0 A;  1WH5 A;  5GP9 A;  3M1E A;  3BR6 A;  1KU3 A;  1MBF A;  3V7R A;  3A01 B;  2CQX A;  5BS6 A;  3TP3 A;  4ITV A;  1W5S A;  3TQN A;  2XGX A;  1STZ A;  1QU3 A;  2DFF A;  4HBL A;  2X6W A;  1P7J A;  2RAE A;  2WB1 N;  4W1U A;  4HSR A;  1VQ7 I;  1LE8 B;  3QAH A;  4U88 A;  5JHU A;  2ZJR F;  1RC9 A;  3KP2 A;  2XPV A;  2HU9 A;  1TC3 C;  3LQQ A;  1FPQ A;  4U7D A;  1P4W A;  2YX4 A;  3CCL I;  1PVE A;  3RYR A;  4GGG A;  4YIF A;  2RN7 A;  4IQ4 A;  2K9L A;  3L2Q A;  3T5X A;  4B3X A;  5ED4 A;  4KMU X;  1XMA A;  2DMP A;  3DKX A;  4DZJ A;  2ECC A;  4U0V A;  3HTS B;  2W57 A;  2VOP A;  1X1A A;  1N25 A;  1OCR H;  5CVR A;  2DA7 A;  1VQ4 I;  1JHF A;  5DS9 A;  4WWC A;  4P5O A;  3L2V A;  2WAQ A;  2DTR A;  4BKX A;  4E4H A;  3MVP A;  1CF7 B;  3KLN A;  2Z1D A;  3LSK A;  2Z9O A;  2E2H J;  2O61 A;  1H9G A;  5GPA A;  1IZ1 A;  1ERD A;  3Q3S A;  2FQ4 A;  2VQG A;  2M2E A;  1ETV A;  2K85 A;  1IF1 A;  1ZR4 A;  3VWB A;  2Y0M A;  3CUQ B;  2F4I A;  3QYF A;  1K4T A;  4KDP A;  3M3Y J;  1J7K A;  2Y30 A;  1OCO H;  5JFR A;  1KZH A;  1WJD A;  5B1B H;  4XRM A;  3CCU I;  3F23 A;  1X3Z B;  1BR2 A;  1X2N A;  2FNA A;  2NOG A;  3I71 A;  4IL6 C;  4QPO A;  3CCE I;  2M8G X;  4EM2 A;  3E6B A;  1KA8 A;  1TW2 A;  1ZGA A;  4NQW A;  1VQ6 I;  2KMU A;  1Z3X A;  3GTJ J;  2L9V A;  1X58 A;  1P7I A;  5FGM A;  4RGU A;  3GZ6 A;  2KPM A;  3OYB A;  2DA2 A;  2LSO A;  3Q0W A;  3CES A;  2Y69 H;  4LG0 A;  1J09 A;  3VB2 A;  2NRA C;  3LSJ A;  1BI1 A;  2EA2 A;  2HDW A;  1R36 A;  2IA2 A;  3IH4 A;  2QSF X;  1P4X A;  2PX9 A;  3HRT A;  1T98 A;  3FXJ A;  1G4D A;  1LDK B;  1FP2 A;  4CCO A;  3BPV A;  1YTY A;  2JT1 A;  2VQH A;  3DWL E;  1D0Y A;  1Y8Q B;  4N0B A;  2X6Y A;  2W24 A;  1IDY A;  3B02 A;  2R5Y B;  2JVH A;  4EGZ A;  4G9Y A;  2JPC A;  4P9F A;  3WG7 H;  2XAS A;  2V9V A;  3ROU A;  1H0M A;  4KN7 X;  2XF7 A;  4A3M J;  3E0J B;  1W7P A;  3AFH A;  3HZJ A;  4Y7N J;  3FBN B;  2KLO A;  2HKO A;  5AIQ A;  5GTH C;  9ANT A;  4BGD A;  1OMI A;  1YIO A;  5HLG A;  5E3N A;  2A5W A;  3G73 A;  3HG9 A;  4BUP A;  4GFB A;  2J5O A;  5B3S H;  3QU6 A;  3BZK A;  2ELK A;  2G7H A;  2OQR A;  3OWT A;  4CHU A;  2FBH A;  1XSX A;  2VN2 A;  2GA2 A;  1A36 A;  4C3J J;  4IHV A;  3FK7 A;  4IXA A;  4P96 A;  2F4M B;  4B43 A;  1BC8 C;  4CUG A;  3MZ8 A;  1DUX C;  2QVO A;  4PCQ A;  1XCB A;  2MH9 A;  1SFU A;  4V19 K;  4XKV A;  4UY8 I;  2Q2E B;  5M5W J;  4EJT A;  1U5T C;  2WC2 A;  1IGN A;  3EUH C;  1YRN B;  2JA6 J;  3KFW X;  2XC7 A;  3SHF A;  2E1M C;  4EM1 A;  3O8G A;  1ACI A;  4I01 A;  3AL0 C;  1IW7 F;  1J59 A;  2DA3 A;  5L3D A;  4C2T A;  1AKH B;  4RAF A;  4HEA 2;  3B6A A;  4LB6 B;  2M7A A;  2BHZ A;  2Z5U A;  3DF8 A;  1N77 A;  3OIO A;  3RZD J;  1ZG1 A;  3A02 A;  3WGH A;  3OOU A;  3RKY A;  2UUZ A;  3ZXS A;  3N97 A;  3GYH X;  4DNC A;  1BOB A;  3H5R A;  2PJP A;  1XG1 A;  1S7O A;  3K4M A;  4ASN A;  2PEX A;  2YSR A;  2G0E A;  4HQM A;  2B0L A;  1IN5 A;  2G9W A;  2L4A A;  3QRF F;  3VYU B;  4NQW B;  2HYG D;  4BDY A;  4U7B A;  1AHD P;  1KYW A;  1JI8 A;  1ITY A;  2XGE A;  3FIW A;  4RB3 C;  4RBO A;  2N8G A;  4CZC A;  3RZO J;  2AQE A;  5HS7 A;  4D5C A;  2JA8 J;  1OCT C;  4XRS A;  2XAH A;  1MBJ A;  1JT0 A;  5CVJ A;  2R93 J;  2I8D A;  4R79 A;  1R5I D;  1YIT I;  2VJI A;  4LD5 A;  1ETK A;  1FWZ A;  1Z6T A;  2WTE A;  2K4J A;  1U2W A;  2VPR A;  5J40 A;  3MZY A;  4M6Y A;  1X19 A;  3BR2 A;  4UUS B;  3CLO A;  2R7T A;  3GZ5 A;  2FJ1 A;  3V8L A;  3CC4 I;  5D6E A;  4WXH A;  1JKO C;  3TMO A;  2BHY A;  3BR5 A;  5CKT A;  4LIT A;  5K1Y A;  3JSO A;  3COA C;  4B1R A;  5EGO A;  1W7P B;  3DXJ F;  4AIJ A;  4AVZ A;  3PUF A;  2QEX I;  3I9V 2;  4BBR J;  4OMZ A;  2W85 A;  2JQ7 A;  2B63 J;  5LD2 C;  2K7L A;  3KEY A;  3J81 K;  2F5C A;  2KDZ A;  2E1M B;  4XM3 A;  4I76 A;  5J4V A;  4XKW A;  3OL4 A;  3AL0 B;  2IGO A;  2E1N A;  3JRB A;  3HOY J;  3KET A;  2XAQ A;  3BPX A;  4M73 A;  3FDY A;  2IXS A;  5FKL A;  4YFN F;  1AOY A;  5CQE A;  4PJM A;  5FKO A;  4U0Y A;  2IBD A;  3V42 A;  1HW5 A;  2BVL A;  2NVX J;  2W25 A;  1YJN I;  3PSF A;  1G59 A;  3GX4 X;  4XL9 A;  1OLT A;  4RAZ A;  1QQI A;  3Q5F A;  1ONV A;  3AG2 H;  4GRI A;  2FNP A;  4LJZ F;  2NNN A;  1G3Y A;  1VQ9 I;  4G7O F;  5ICE A;  3SEZ A;  1BI2 A;  3HPG A;  1GV5 A;  2E60 A;  3TL4 X;  1ZN2 A;  3O3K A;  2K4B A;  1T38 A;  1BW6 A;  2X9D A;  1XGS A;  2BXZ A;  1YLF A;  1FJL A;  2XSJ C;  4ENK A;  3DTK A;  2DPD A;  1B9N A;  4AVP A;  3BP8 A;  4AYB N;  3DBH B;  5TJJ A;  2L0K A;  3F8N A;  5HLT A;  1K61 A;  1KU7 A;  4I0A A;  2P5V A;  3PO3 J;  3PSI A;  1FYK A;  4C3H J;  2HVR A;  1LFB A;  1RZ4 A;  1TQI A;  5HLI A;  5M3F J;  1ZH5 A;  5LHH A;  4R8H A;  2OU2 A;  1HOM A;  4OIR F;  3S8P A;  2HVS A;  4DBR A;  2EFW A;  4ENN A;  1TZL A;  2D45 A;  2COM A;  2KRH A;  2MAB A;  3BOQ A;  4I09 A;  2PMZ A;  1LPQ A;  1GVJ A;  1UHW A;  5DV5 A;  1MJA A;  1ZG5 A;  3VDX A;  1XS9 A;  2LF7 A;  1WJF A;  3BC8 A;  3CP8 A;  4FX4 A;  2R7S A;  1BIB A;  2WB1 A;  1D1B A;  4FAS D;  4PJ0 C;  5HVQ C;  3DTE A;  3KP7 A;  4Y17 A;  4GDF A;  1HW1 A;  1RUO A;  1T08 B;  2KIS A;  3QOP A;  1UAA A;  5HDG A;  2H8W A;  2HZD A;  4N9H A;  2KKO A;  2MD5 A;  1MJ9 A;  1IRX A;  1WRJ A;  2R7R A;  2JSC A;  2RC4 A;  2R0Q C;  2DK5 A;  2O3F A;  4M9Z A;  3E6M A;  3KYL A;  2DT5 A;  1TL8 A;  1IUF A;  2ZFW A;  4Y33 A;  3NEU A;  1S72 I;  2NOJ B;  1I27 A;  3NWT A;  4M6V A;  2HPI A;  2R7V A;  2YS9 A;  2KZV A;  5F0H A;  4Q48 A;  2OPT A;  3OS0 A;  3DEW A;  4XLH A;  2GXB A;  5EGO B;  3FKJ A;  4JOM A;  3S32 A;  1T2K A;  3H0D A;  1XD7 A;  2O0Y A;  2RNJ A;  4MGR A;  4A5N A;  4XON A;  3H36 A;  4II2 A;  1TWH J;  3LL7 A;  3O8H A;  5DCF A;  3L9F A;  4BE1 A;  1E3H A;  4BYY A;  3M7G A;  3DTI A;  2LY9 A;  1HCR A;  2OZ6 A;  2BW3 B;  2XRL A;  4XLE A;  1XPX A;  3GLL A;  4JYK A;  2XKP A;  3DFG A;  4JX5 A;  1MIJ A;  4NNJ A;  3E7L A;  2CFX A;  4ZYD A;  3VOE A;  1T0F A;  2DYR H;  3C2G A;  2LK2 A;  5K5R A;  2NAZ A;  1ZRF A;  2O9L A;  2VQL A;  4IRI A;  4ZYE A;  3C2B A;  1SD5 A;  3W2W A;  3V8J A;  3ZOB A;  3HSE A;  3K4C A;  1JUP A;  4F92 B;  3S3O A;  2E71 A;  4MQV A;  1IDZ A;  1TW3 A;  3RKX A;  2DJI A;  3C1D A;  3D1N I;  4C2U A;  3HEF A;  4BBS J;  2IRF G;  1ZKG A;  3KEO A;  3PUB A;  3ZQC A;  3R60 A;  2JPB A;  3L2R A;  4HZF A;  1NK3 P;  2FU4 A;  3RPU D;  3BWG A;  3VFZ A;  2FX0 A;  2RDP A;  1KGS A;  4KUM A;  4F93 B;  4I2O A;  3J80 K;  4KYW A;  2Q0O A;  5EEG A;  3OIQ A;  3NQO A;  1W36 D;  1VQL I;  3WTX C;  5JR3 A;  4FET A;  4ESJ A;  2DA1 A;  2V26 A;  1JJ6 C;  3ULQ B;  3OYJ A;  1H88 C;  3S14 J;  3AG3 H;  4FT8 A;  3PNV A;  3QOD A;  1Z7U A;  4BAC A;  3HRM A;  1XGN A;  2ZJQ F;  5FRN A;  1ZEL A;  2IS4 A;  4WX9 A;  5FLM J;  3OSG A;  3CUO A;  4UB6 C;  3BY6 A;  1U9O A;  2LBF A;  1VQK I;  3HUG A;  2DMT A;  2VI6 A;  2DBB A;  2CQN A;  2BYV E;  3OYE A;  4HX4 A;  3KP6 A;  4L5J A;  2L54 A;  3BQZ A;  2CJJ A;  3GW2 A;  2DA5 A;  1ZGJ A;  1D5V A;  3HIF A;  1N75 A;  2P7V B;  2NXN B;  2XAJ A;  2CGP A;  3LAJ A;  3F8B A;  3CME I;  4B3A A;  3CD6 I;  5CPR B;  4KIT B;  4CYC B;  2ELH A;  2HQ5 A;  3HSR A;  2C6Y A;  1O57 A;  2EZI A;  1BA5 A;  2NS8 A;  3M07 A;  5FRO A;  3ZMS A;  1FBQ A;  2F48 A;  2X4H A;  1RI7 A;  2WA0 A;  3Q0U A;  5J1Y A;  1ZK8 A;  2QA4 I;  1VQO I;  2QLZ A;  1PP8 F;  1QBJ A;  1FX7 A;  4M9S A;  2A6E F;  5FFX A;  5HOD A;  1RR7 A;  2R7F A;  4BQA A;  4GYG A;  1Z3Y A;  3KLO A;  4Y4R A;  1LVA A;  1I3Q J;  1Z1D A;  4JX6 A;  3VSL A;  4C3I J;  1S9H A;  2DQL A;  4HOB A;  2Y75 A;  4ZYA A;  2DDB A;  1DPU A;  3MAJ A;  4F7Z A;  2QGU A;  4O6J A;  3K4B A;  3I0T A;  5E3O A;  4A69 C;  3REO A;  2VBX A;  3BTI A;  3DBL B;  4UB8 C;  2ZME A;  3J81 Z;  3WTY C;  3TKY A;  3FHZ A;  1FOW A;  2OCC H;  4D7M A;  1VQ8 I;  4AID A;  1X4O A;  2IGK A;  5L3G A;  1JGG A;  3ZP5 A;  3QYE A;  4PUS A;  3KCC A;  4V2G A;  2KP6 A;  2IPQ X;  2M3A A;  4D9J A;  3IWZ A;  5JI6 A;  3WU0 A;  3M8E A;  3CZ6 A;  4A3E J;  3P9K A;  3JRA A;  5KHD A;  1F1Z A;  5CQG A;  4RB2 C;  2OJE D;  5C4X J;  2BY2 A;  1R5G A;  5FB2 A;  3LAP A;  3LNQ A;  3O2P E;  2RKH A;  3FXK A;  3RTR A;  4A2U A;  2ETH A;  2DN0 A;  2H27 A;  2PJR A;  1UG2 A;  1U9N A;  4AM3 A;  1B1B A;  2MD0 A;  5HS8 A;  3G3Z A;  4RAG A;  4A3L J;  4KJZ A;  4XRF A;  1FIP A;  2H94 A;  3I55 I;  3IL2 A;  2OV7 A;  1DU0 A;  3J7Z I;  4I6Z A;  4JK1 X;  3HKZ N;  1OKR A;  2ZSH B;  4Y3O A;  4CCL A;  2XUB A;  4A6D A;  3Q9V A;  5B1A H;  4IEJ A;  1YHQ I;  3HHG A;  3K1P A;  1IV6 A;  4IHT A;  5D4S A;  5LLQ A;  2LRD A;  1VTN C;  1WJ5 A;  2NVU B;  2CV2 A;  3IV5 A;  1A5J A;  3BG5 A;  2CRG A;  4RB0 A;  2A68 F;  2CWE A;  2FF4 A;  1TNT A;  4L18 B;  2L3D A;  5ICF A;  1V55 H;  3P9C A;  3WTV C;  2XAU A;  2GLO A;  3MKY B;  4CGZ A;  4LIU A;  3L2U A;  2RV8 A;  2IVM A;  3ZQG A;  2HQR A;  5HNH A;  2DMN A;  1MMD A;  2EV6 A;  3KIO A;  1OR7 C;  4L9V A;  1ODD A;  3JRD A;  3FIS A;  2P6S A;  3K2Z A;  2VXD A;  3ZR8 X;  3I4P A;  2F5D A;  4C30 A;  4M3G A;  4UVB A;  1D8J A;  2YU3 A;  2ZXJ A;  5KAI C;  3CO7 C;  3R61 A;  2MYS A;  2ID3 A;  2B9S A;  1SAN A;  3W6K B;  2KJB A;  2NNY A;  1G3W A;  3R0A A;  3MN2 A;  4M6X A;  4EVI A;  3H9G A;  4LB5 A;  2NYX A;  1AU7 A;  3LQR A;  5CVU A;  5LHI A;  4ZZD A;  1MSF C;  2O8K A;  2M87 A;  4HST A;  1S8N A;  2FML A;  4BEH A;  1O3T A;  4ZC3 A;  1I1S A;  1LKX A;  2EIM H;  3FHN A;  4ETS A;  1XMK A;  2KHM A;  5HDK A;  2VJ4 A;  4FQG A;  2H1K A;  4MIM A;  4AYB A;  2GZW A;  1GHC A;  2PMH A;  4R1H A;  3UKG A;  2BGC A;  1SMY F;  3CC2 I;  2XF6 A;  3GUD A;  3ZQL A;  4MTE A;  1B72 A;  3AAF A;  2K5C A;  4BE2 A;  1RIO H;  4LMY A;  3S1N J;  1GV2 A;  3H9Q A;  4AWX B;  1V5E A;  3F8M A;  1P6R A;  4N4N B;  3ECH A;  3IC7 A;  5TRD A;  4FTH A;  1IUY A;  2HOS A;  3PIP F;  4DIQ A;  2DOA A;  4HF1 A;  1FNN A;  4KT6 A;  1ZAO A;  1EH6 A;  4M3F A;  2Z16 A;  1YO5 C;  2KZG A;  2R4G A;  4B48 A;  4KNY A;  3CCM I;  2XGD A;  2XHK A;  3FXM A;  1QVU A;  3H1C A;  4QTR A;  3C3W A;  3GF2 A;  1QPM A;  3CJN A;  5BMZ A;  5IT3 A;  4H0E A;  3I59 A;  1ZTR A;  1VI0 A;  2COB A;  1AA7 A;  2QYO A;  3QOE A;  2Q8K A;  1YIJ I;  4EJO A;  3KP5 A;  3F0C A;  3TOA A;  1DGR M;  1SVM A;  4G12 A;  4XKB A;  3G6E I;  3ABL H;  4FCY A;  2Y0S A;  5C4J J;  2E34 A;  2JZY A;  3E97 A;  4LLG F;  1HW2 A;  1PJR A;  2BEO A;  3GTO J;  1A31 A;  2K86 A;  4XID A;  4BY7 J;  1OCZ H;  2EV0 A;  2F2E A;  2JJ7 A;  4IOC F;  3OYL A;  4BXX J;  1EKE A;  4HDV A;  1JKQ C;  4HA8 A;  5DCM A;  4HNU A;  4UUT A;  5D5U B;  4ABZ A;  1IXS B;  2EZH A;  5LGN A;  4OOI A;  4N4O B;  1ZQ3 P;  1IN8 A;  5GPC A;  2DJN A;  1YE9 A;  2VAS A;  1WSU A;  5IT9 Z;  2JA5 J;  1YOV B;  4IJA A;  1MH3 A;  1I50 J;  1XSV A;  4L9J A;  5JHF A;  2OTL I;  1G3T A;  2ZXI A;  1OYI A;  3V4G A;  2HOE A;  3U1D A;  2PMU A;  2LG4 A;  1OYW A;  5FKM A;  3S3N A;  2X1D A;  3EDP A;  2GWR A;  2YX7 A;  2CUZ A;  1W4M A;  3F8F A;  3PQK A;  3GTM J;  2IAI A;  4AIK A;  3GXO A;  2JWT A;  2DOF A;  3JTH A;  4ZDL A;  5E3L A;  4XSX F;  2KFD A;  1XN7 A;  2R7Z J;  3R6S A;  2K9N A;  4BEH B;  4IKF A;  4XLN F;  5ICG A;  1A6Q A;  4AUX A;  2VJJ A;  2STW A;  1X3W B;  2L9S A;  2STT A;  4BL0 B;  2M30 A;  3ECO A;  1WQ2 A;  5HDN A;  4E7Z A;  4EJW A;  2K40 A;  2ZNZ A;  1Y1V J;  3OYF A;  1JXS A;  4WCG A;  4X0G A;  4HF2 A;  1J5Y A;  2D1H A;  2QQ9 A;  4LK0 F;  5E18 F;  5E8G A;  1VND A;  2Y9Y A;  2VJ5 A;  1UMQ A;  2FE3 A;  3SJM A;  3FM3 A;  2UWM A;  2CQK A;  1K6O A;  2A6T A;  4XOT A;  1MW7 A;  4RA2 A;  1R1U A;  3H9J A;  3FK6 A;  3IP4 B;  4PSW A;  1O7L A;  5L3F A;  2ZSI B;  5HS9 A;  3OYH A;  3BJ6 A;  3M8J A;  4PFP A;  3I59 B;  4E7I A;  1GUU A;  4RM2 A;  1QRY A;  2HTJ A;  3CMM A;  1W0T A;  2E35 A;  2MFZ A;  2OF7 A;  1OCC H;  2KRF A;  2FQ3 A;  5D4R A;  3W6J B;  4IHS A;  2OTJ I;  2FOW A;  2CUE A;  4BDZ A;  5FRM A;  2UV1 A;  2JA7 J;  1Z0X A;  3C2H A;  4XNF A;  3PQJ A;  1MJB A;  2EA4 A;  1H9T A;  3OYA A;  4KIS A;  1JUM A;  5EZH A;  3DBR B;  5F08 A;  4EQQ A;  3S15 J;  5DCM B;  2HQA A;  5JLW A;  1F43 A;  2K9M A;  3SDB A;  1UB9 A;  5BNG A;  3OYM A;  3I53 A;  3EET A;  3HRU A;  1QGP A;  1HKQ A;  1WHU A;  3TGN A;  2XV4 S;  2F5V A;  1FSH A;  2K27 A;  4AD9 A;  4RM3 A;  2CU7 A;  1P92 A;  1ETW A;  2HVQ A;  2VKH A;  3GFL A;  2YUS A;  3H5A A;  4L9N A;  4B4C A;  4BJT A;  2QSG X;  5DTD A;  3DP7 A;  2R92 J;  3AG1 H;  3D5L A;  3HTU A;  4I98 B;  1JT6 A;  1WKM A;  2JRT A;  1JTY A;  2V6C A;  3WTZ A;  3F8C A;  4MFD A;  4PZJ A;  4L9T A;  1UEL B;  2Y31 A;  2HS5 A;  4IHW A;  2HQN A;  1X4P A;  2X1C A;  4LLN A;  2P6T A;  1MBH A;  4HF0 A;  1RKT A;  1TQM A;  4A93 J;  1BIA A;  5LEK A;  3L2C A;  2EFQ A;  3A1Y A;  3M9A A;  3KPH A;  3K4L A;  2KIM A;  4HG2 A;  5F27 A;  3GTL J;  5LBQ A;  1OYY A;  3HXL A;  4LG0 B;  4QSH A;  3CCS I;  3NAR A;  3FMR A;  2VKV A;  1T39 A;  1FYM A;  5FFZ A;  3LA2 A;  4BE0 A;  3BQY A;  1RNL A;  2XIG A;  3W2V A;  1LQ1 A;  1W7P D;  2BZT A;  4OIO F;  3ZGK A;  5KCM A;  3BG3 A;  4E70 A;  5F1R A;  2VQC A;  3HKZ A;  5EZG A;  4IRG A;  3SDG A;  3JRE A;  3OS2 A;  1R1T A;  2EIJ H;  4GYI A;  1R22 A;  4WK8 F;  3ZQH A;  1QA6 A;  2ISZ A;  2LLK A;  4C9Y A;  2JUC A;  2CMP A;  1ZRD A;  2ZJP F;  1Y39 A;  4GCV A;  2ZKZ A;  3VYS B;  4L0Y B;  4KT5 C;  2R7D A;  3QQA A;  3HBL A;  4FE7 A;  3ZMU A;  1Z7L A;  1XB4 A;  2QQ8 A;  2CG4 A;  4CCN A;  5FLX K;  2VB6 A;  4EJU A;  4HV5 A;  2PFB A;  4OIN F;  1H89 C;  1IN7 A;  2BY1 A;  3BZC A;  3MKL A;  4XK4 A;  3MZH A;  1DGW Y;  2CSO A;  1F4K A;  1Z9C A;  1M1E B;  4M3B A;  5B66 C;  5ILU A;  2X85 A;  4YFX F;  1ZG3 A;  3CJR B;  5E1W A;  3F3X A;  4M3D A;  4CCM A;  1MMN A;  3HJE A;  3HOX J;  1FZP B;  4ENJ A;  2LRE A;  2GA1 A;  1ZR2 A;  5LHG A;  1ZAR A;  2EZK A;  1WGX A;  2VBY A;  2W4S A;  3JRI A;  4OIP F;  3WU2 C;  5TGT A;  2KIQ A;  1IRZ A;  2CV0 A;  4MNU A;  3M8F A;  1PUE E;  2CV1 A;  3QPS A;  2RQP A;  4CYD A;  2KIU A;  5A2Q K;  3JW4 A; 
#chains in the Genus database with same CATH homology
 1XSD A;  3I54 A;  3PFI A;  1ON1 A;  2H6B A;  4I7H A;  3FXR A;  1U8R A;  2XKO A;  4AIH A;  1YS6 A;  1I6X A;  1S3J A;  1K79 A;  4QLC U;  2VT3 A;  4G7H F;  4CXF A;  3HOT A;  3U2R A;  2LKP A;  1YS7 A;  3R4K A;  2D1V A;  4RGX A;  4HX8 A;  2VOO A;  3BJO A;  2PQ8 A;  4L0Z B;  1WI9 A;  2CYY A;  3KP4 A;  3TDZ C;  2AS5 F;  2G7U A;  5LEJ A;  4HX7 A;  1CGP A;  3MQ0 A;  4A0Y A;  1B59 A;  3OOP A;  3WOD F;  3MFK A;  3DV8 A;  2PN6 A;  3L7W A;  2HEO A;  3F6V A;  1FYL A;  4KIB A;  3ZPL A;  5K5O A;  1FP1 D;  3TDU C;  1LDD A;  3C7J A;  2XRN A;  1J75 A;  2YR2 A;  5BPD A;  2Z99 A;  1BM9 A;  2QWW A;  4LFU A;  1IRG A;  2FBI A;  4BHP A;  3NRV A;  5JVT A;  5DEQ A;  1IAW A;  3IKT A;  4CDG A;  1U78 A;  1IXC A;  2V1X A;  3TOB A;  2A07 F;  4Z2Y A;  2L4M A;  5CYV A;  4A5M A;  4IPA A;  4M72 A;  2EB7 A;  2P7C B;  2P4W A;  1C0W A;  4G7Z F;  1F9N A;  4BNC A;  5ILS A;  3GO5 A;  1IN4 A;  2JTV A;  3QPH A;  1U6G A;  2DU9 A;  1TTY A;  4ON0 A;  4I0B A;  5F6F A;  1HBX G;  1KU2 A;  4YFK F;  3F72 A;  3V7S A;  2XVC A;  3J7A O;  5DUK A;  4UUV A;  4G94 A;  4LLL A;  2QBY A;  1Z05 A;  2ZJ2 A;  1UCR A;  2V1D A;  1QO0 D;  1R1V A;  1J9I A;  2RGV A;  1FC3 A;  3DEU A;  3IKV A;  5FD6 A;  2VC1 A;  2QZ8 A;  4GO1 A;  1FY7 A;  1TLH B;  3C18 A;  1O3R A;  2ISY A;  4CIC A;  1HQC A;  3L09 A;  2CO5 A;  2ZBK A;  3SZT A;  3SZP A;  2FMY A;  1BI3 A;  5FD5 A;  5D5X B;  2E1C A;  5LGT A;  1SMT A;  2A3S A;  2HZT A;  3LWF A;  1YFH A;  2OZU A;  4M74 A;  3ZN1 A;  1MGT A;  1KQ8 A;  3RIR A;  3H3Z A;  1K78 A;  4UNO A;  3O6B B;  1UFM A;  2QM3 A;  2GAU A;  1XGO A;  3FMS A;  5DD8 A;  1BI0 A;  2ZO4 A;  5KK1 A;  2CW0 F;  1O7F A;  2F5E A;  4RB1 A;  3F21 A;  2L01 A;  1AWC A;  4MEX F;  1KU9 A;  3WGI A;  4DQ2 A;  4M71 A;  3ZMV A;  4ZH4 F;  3E6D A;  2VON A;  1F5T A;  3FXQ A;  1J0R A;  4KFC A;  1Q1H A;  2IA0 A;  1OPC A;  1EH7 A;  1FT9 A;  2AXL A;  3JSP A;  5E17 F;  1R00 A;  2K02 A;  5CVI A;  4HV6 A;  2DPU A;  4Y13 A;  3K9T A;  1I5Z A;  2UZK A;  2MLK A;  5L3E A;  4BAY A;  1CF7 A;  1SFE A;  2GQQ A;  1QZY A;  4EGY A;  4WF2 A;  4A6E A;  3KP3 A;  3CUQ A;  1W5T A;  3RYP A;  4RGS A;  3E6C C;  2PG4 A;  3K0L A;  3TO6 A;  4JBA A;  3IRQ A;  1G3S A;  4CZZ A;  4G8X A;  3BJA A;  3LFK A;  2ZME B;  3H3U A;  1USS A;  4ZZL A;  2LDU A;  5E1Z B;  1BJA A;  3GLX A;  3H92 A;  1Z91 A;  3JAM K;  1HKT A;  1D3Y A;  1SAX A;  4Q4Z F;  4Y15 A;  3TO9 A;  4UHT A;  1MKM A;  3ERE D;  4P55 A;  1K78 B;  2VE9 A;  2QQA A;  3GWZ A;  4ESB A;  2MA3 A;  1IN6 A;  2DFI A;  2QEN A;  3WG9 A;  4RGR A;  3CDH A;  2VXZ A;  4UXN A;  5ICC A;  3L00 A;  2DLL A;  3J80 Z;  1WWX A;  2WWY A;  2VT2 A;  3RI4 A;  6PAX A;  2HWV A;  1O3Q A;  3HYI A;  2HYF A;  1E2X A;  2IJL A;  1IRF A;  4JQF A;  2ACJ A;  2ESH A;  1SD6 A;  3WTT C;  2Q2E A;  4ESF A;  4ZYG A;  2W84 A;  3K69 A;  3ZMT A;  3P9I A;  4FHT A;  2P5L C;  3ZMZ A;  3SFZ A;  5CJ9 A;  2EWN A;  1JHH A;  1S7A A;  3P7N A;  3RKW A;  2MLG A;  1ZRE A;  1O3S A;  1YW8 A;  2EV5 A;  1YQA A;  2V79 A;  4EJV A;  1LB2 A;  4B09 A;  4FX0 A;  1TBX A;  3T0Y A;  3FM5 A;  4HLY A;  1S6L A;  1ZRC A;  2EK5 A;  2NS0 A;  2P8T A;  2IP2 A;  1LJ9 A;  1BC7 C;  2LF8 A;  3FWE A;  4KIG A;  2OQG A;  3TO7 A;  3CO6 C;  2OAZ A;  3K1N A;  1KQ0 A;  2L02 A;  4BXU A;  3VOD A;  4EV0 A;  2DQR A;  4GXO A;  4YG2 F;  3ZMD A;  3MWM A;  1U5T A;  1R7J A;  3EUH A;  1KQ9 A;  2ESN A;  3I64 A;  2DAO A;  4OU0 A;  3KZZ A;  2IT0 A;  3QP5 A;  1X3U A;  1EH8 A;  1UHM A;  1ZLK A;  1K7A A;  4TV7 A;  2KIF A;  3I58 A;  1RUN A;  2DW4 A;  1GXQ A;  2O6G E;  1QZZ A;  1B6A A;  3SQN A;  2ADU A;  1HST A;  3EYI A;  3ABU A;  1NHA A;  4UV8 A;  1ZYR F;  1LNW A;  4P9U A;  5J6X A;  1Z6R A;  2P5K A;  3Q9S A;  2M5W A;  4BH9 A;  5LGU A;  3RPQ A;  3E3V A;  2YPR A;  2HFH A;  3RJP A;  1R23 A;  2HTS A;  1MD0 A;  5L3B A;  3HOS A;  2RVC A;  2HKX A;  2ZCW A;  1L0O C;  1B9M A;  5E8I A;  4MEY F;  3I5U A;  3DPT A;  3LA7 A;  3LST A;  1SFX A;  2MH2 A;  5BQT A;  3D0S A;  4XSZ F;  3JTG A;  3JAM Z;  4OIQ F;  3EQL F;  2VC0 A;  2F5F A;  2XRO A;  2A61 A;  3FX3 A;  4G6D A;  1U5T B;  1ULY A;  1KYZ A;  1XDU A;  4A0Z A;  3WTU C;  1ZHF A;  3B73 A;  3KZY A;  2D2W A;  4L5I A;  4MQ9 F;  2M45 A;  2BBY A;  4KIF A;  1LEB A;  4EMS A;  2EFN A;  1XCV A;  4IF4 A;  5CLS A;  1REP C;  3FF5 A;  1I1G A;  2EJR A;  1S29 A;  1JGS A;  5CVV A;  1HXD A;  2XAF A;  1MDM A;  4UVA A;  5E1X A;  4ENM A;  3GFJ A;  3FXU A;  4LK1 F;  3WE2 A;  5LRS A;  5LRR A;  2VOD A;  4KA4 A;  2Y48 A;  4U0W A;  1TQP A;  3T1B A;  4HDU A;  3IWF A;  1A04 A;  2FRH A;  3S2W A;  3GEZ A;  4YII A;  2MC3 A;  3U9G A;  4MTD A;  3ZQ7 A;  1V4R A;  4O3M A;  4S04 A;  2Z33 A;  4B8X A;  5J8C A;  3RPU A;  3E5X A;  5K5Q A;  4S05 A;  1UST A;  1E17 A;  4PGH A;  3WTW C;  3HHH A;  1MZB A;  1BBY A;  1DDN A;  4K2E A;  1L3L A;  2FA5 A;  3ML6 A;  2J5P A;  2H09 A;  3FZV A;  3F22 A;  4KIC A;  5DD4 A;  5BPI A;  4BHC A;  3WTS C;  1JE8 A;  4KN4 X;  3DKW A;  2WV0 A;  2DI3 A;  1KU7 A;  2FSW A;  2TDX A;  2MBF A;  3F6O A;  1FBS A;  2HR3 A;  2KJC A;  4N9I A;  2QUF A;  1J2X A;  1GXP A;  3E5Q A;  3IRR A;  2FEZ A;  3GVA A;  5AIP A;  1LDJ A;  1V3F A;  4HLX A;  2OBP A;  1LEA A;  4HAM A;  4MHG A;  3V8K A;  4RS8 A;  3MCZ A;  3FMQ A;  2IA1 A;  3KE2 A;  4EM0 B;  2VBZ A;  3V7C A;  4UV9 A;  5DYM A;  1FOK A;  2M8E A;  2E7W A;  2HGC A;  1MDM B;  1BOA A;  2O8X A;  2EFO A;  1DPR A;  5FO5 A;  3KEQ A;  2DO7 A;  2XAG A;  3K1M A;  5EEH A;  4G6Q A;  3HSF A;  4HQE A;  1PP7 U;  4XBF A;  3ZN0 A;  3DQV C;  5H6Q A;  4PGG A;  4RAY A;  1XDS A;  1YG2 A;  3QU3 A;  1R5H A;  1ZLJ A;  2BE5 F;  4ZYH A;  1YW7 A;  5IT9 K;  4M9X A;  3MEX A;  1P2F A;  4CO8 A;  3N4M A;  5DDG A;  2GXG A;  3VEP A;  2OA4 A;  4WXC A;  3OV8 A;  2EFP A;  2A69 F;  1IXR C;  2FOK A;  5DUI A;  1B4A A;  2UXN A;  2VE8 A;  5F64 A;  3SXY A;  2UXX A;  3BZ6 A;  1FSE A;  5D5V B;  1YW9 A;  2DK8 A;  3RDI A;  2M1B A;  3T8T A;  4UVC A;  3CTA A;  5FLX Z;  4A12 A;  4IVN A;  3WGG A;  3R0J A;  5H20 A;  5D5W B;  1FLI A;  3EYY A;  2LNB A;  2QQB A;  3T8R A;  3ELK A;  2HDC A;  3HRS A;  4Q47 A;  2IW5 A;  1P4A A;  4XLP F;  1D8K A;  5A2Q Z;  2FBK A;  2A5Y B;  1FBU A;  2Z3Y A;  5E20 A;  3WE3 A;  5AON A;  1HKS A;  1TNS A;  3WU1 B;  5D8K B;  4OMY A;  2GIV A;  1HSJ A;  4D0P A;  4PDK A;  1ON2 A;  2A6H F;  1PDN C;  1OR7 A;  2H6C A;  4NHJ A;  1DP7 P;  3ISP A;  2QBY B;  5ERI A;  4NB5 A;  3DPL C;  5KVR A;  4BHB A;  2VBW A;  4I02 A;  3ABT A;  3BRO A;  1XGM A;  1T6S A;  5D6F A;  4Q5S F;  2PBI A;  4QWQ A;  5BOX A;  3QPT A;  4KMF A;  1SD7 A;  4A0X A;  2O03 A;  2E7X A;  5H6R A;  1U3E M;  3LA3 A;  2ZNY A;  2R3S A;  4LGW A;  1YYV A;  2OD5 A;  5D8L B;  2V1U A;  3BDD A;  2PLY A;  2FXA A;  2X0L A;  1QNT A;  3E5U A;  3IHU A;  1EV7 A;  5ILV A;  5HLH A;  3CUQ C;  1Y0U A;  1G6N A;  4WXD A;  5J8F A;  3GFI A;  3GFM A;  1SD4 A;  1BN5 A;  3QP6 A;  4O5V A;  5HOO A;  2BV6 A;  1R58 A;  4HYE A;  4IRH A;  2PI0 A;  5L3C A;  4HW0 A;  3M1E A;  3V7R A;  1KU3 A;  5BS6 A;  1W5S A;  3TQN A;  2XGX A;  1STZ A;  4HBL A;  3QAH A;  4U88 A;  5JHU A;  3KP2 A;  3LQQ A;  1FPQ A;  4U7D A;  1P4W A;  2YX4 A;  3RYR A;  4GGG A;  4YIF A;  2RN7 A;  3T5X A;  5ED4 A;  4KMU X;  1XMA A;  4U0V A;  3HTS B;  2W57 A;  2VOP A;  5CVR A;  1JHF A;  4WWC A;  4P5O A;  2DTR A;  1CF7 B;  3KLN A;  2Z9O A;  2O61 A;  1H9G A;  1IZ1 A;  1IF1 A;  2Y0M A;  3CUQ B;  4KDP A;  1J7K A;  5JFR A;  3F23 A;  2FNA A;  3I71 A;  4EM2 A;  3E6B A;  1KA8 A;  1TW2 A;  1ZGA A;  4NQW A;  5FGM A;  4RGU A;  3GZ6 A;  2LSO A;  4LG0 A;  2NRA C;  3VB2 A;  1BI1 A;  2EA2 A;  1R36 A;  2IA2 A;  1P4X A;  3HRT A;  1T98 A;  1G4D A;  1LDK B;  1FP2 A;  3BPV A;  1YTY A;  2JT1 A;  4N0B A;  2W24 A;  3B02 A;  4EGZ A;  4G9Y A;  2JPC A;  4P9F A;  2XAS A;  2V9V A;  3ROU A;  1H0M A;  4KN7 X;  1W7P A;  2HKO A;  5AIQ A;  1OMI A;  1YIO A;  5HLG A;  3G73 A;  2J5O A;  3QU6 A;  2G7H A;  2OQR A;  4CHU A;  2FBH A;  1XSX A;  2VN2 A;  2GA2 A;  4IXA A;  4P96 A;  1BC8 C;  1DUX C;  2QVO A;  4PCQ A;  1XCB A;  2MH9 A;  1SFU A;  4EJT A;  1U5T C;  2WC2 A;  3KFW X;  3SHF A;  4EM1 A;  4I01 A;  1IW7 F;  1J59 A;  5L3D A;  4LB6 B;  2Z5U A;  3DF8 A;  1ZG1 A;  3WGH A;  3RKY A;  3N97 A;  3GYH X;  4DNC A;  2PJP A;  1S7O A;  4ASN A;  2PEX A;  2YSR A;  4HQM A;  2B0L A;  1IN5 A;  2G9W A;  2L4A A;  3QRF F;  2HYG D;  4U7B A;  1KYW A;  4RB3 C;  5HS7 A;  2XAH A;  5CVJ A;  4R79 A;  4LD5 A;  1FWZ A;  1Z6T A;  2WTE A;  2K4J A;  1U2W A;  3MZY A;  4M6Y A;  3CLO A;  3GZ5 A;  3V8L A;  5D6E A;  4WXH A;  5K1Y A;  3JSO A;  3COA C;  1W7P B;  3DXJ F;  4AIJ A;  4OMZ A;  2W85 A;  2K7L A;  3J81 K;  2F5C A;  2E1N A;  3KET A;  2XAQ A;  3BPX A;  4M73 A;  4YFN F;  1AOY A;  4U0Y A;  1HW5 A;  2W25 A;  3GX4 X;  4RAZ A;  1QQI A;  3Q5F A;  1ONV A;  4LJZ F;  2FNP A;  2NNN A;  1G3Y A;  4G7O F;  5ICE A;  1BI2 A;  1ZN2 A;  3O3K A;  2K4B A;  1T38 A;  1XGS A;  1YLF A;  4ENK A;  2DPD A;  1B9N A;  4AVP A;  3BP8 A;  5TJJ A;  3F8N A;  4I0A A;  2P5V A;  1FYK A;  1RZ4 A;  1TQI A;  5HLI A;  1ZH5 A;  5LHH A;  4R8H A;  2OU2 A;  4OIR F;  2EFW A;  4ENN A;  2D45 A;  2COM A;  3BOQ A;  4I09 A;  1GVJ A;  1UHW A;  5DV5 A;  1MJA A;  1ZG5 A;  2LF7 A;  4FX4 A;  1BIB A;  5HVQ C;  3KP7 A;  4Y17 A;  1HW1 A;  1RUO A;  3QOP A;  5HDG A;  4N9H A;  2KKO A;  2MD5 A;  1MJ9 A;  1WRJ A;  2JSC A;  2RC4 A;  2DK5 A;  2O3F A;  4M9Z A;  3E6M A;  2DT5 A;  2ZFW A;  3NEU A;  1I27 A;  4Q48 A;  2GXB A;  1T2K A;  1XD7 A;  2O0Y A;  2RNJ A;  4MGR A;  4A5N A;  5DCF A;  3L9F A;  4BYY A;  3M7G A;  2OZ6 A;  2XKP A;  3DFG A;  2CFX A;  4ZYD A;  3VOE A;  1T0F A;  5K5R A;  2NAZ A;  1ZRF A;  4IRI A;  4ZYE A;  1SD5 A;  3V8J A;  3HSE A;  4MQV A;  1TW3 A;  3RKX A;  3C1D A;  2IRF G;  3KEO A;  3R60 A;  2JPB A;  4HZF A;  2FU4 A;  3BWG A;  3VFZ A;  2RDP A;  4I2O A;  1KGS A;  4KUM A;  3J80 K;  4KYW A;  2Q0O A;  5EEG A;  3NQO A;  3WTX C;  5JR3 A;  4ESJ A;  3ULQ B;  4FT8 A;  1Z7U A;  3HRM A;  1XGN A;  4WX9 A;  3CUO A;  3BY6 A;  3HUG A;  2DBB A;  2BYV E;  4HX4 A;  3KP6 A;  4L5J A;  2L54 A;  3GW2 A;  1D5V A;  1ZGJ A;  3HIF A;  2P7V B;  2XAJ A;  2CGP A;  3LAJ A;  3F8B A;  2ELH A;  3HSR A;  2C6Y A;  1O57 A;  3ZMS A;  1FBQ A;  2X4H A;  1RI7 A;  2QLZ A;  1PP8 F;  1QBJ A;  1FX7 A;  4M9S A;  2A6E F;  5FFX A;  2R7F A;  4BQA A;  4GYG A;  3KLO A;  1LVA A;  1Z1D A;  2DQL A;  4HOB A;  2Y75 A;  1DPU A;  3MAJ A;  4F7Z A;  4O6J A;  3I0T A;  3REO A;  2VBX A;  2ZME A;  3J81 Z;  3WTY C;  3TKY A;  3FHZ A;  5L3G A;  3ZP5 A;  3KCC A;  2IPQ X;  3IWZ A;  5JI6 A;  3WU0 A;  3M8E A;  3P9K A;  1F1Z A;  4RB2 C;  1R5G A;  5FB2 A;  3LAP A;  3O2P E;  2RKH A;  3RTR A;  4A2U A;  2ETH A;  2H27 A;  1B1B A;  5HS8 A;  3G3Z A;  4XRF A;  2H94 A;  3IL2 A;  4JK1 X;  1OKR A;  2XUB A;  4A6D A;  3Q9V A;  3HHG A;  3K1P A;  4IHT A;  5D4S A;  5LLQ A;  1VTN C;  4RB0 A;  2A68 F;  2CWE A;  2FF4 A;  1TNT A;  4L18 B;  2L3D A;  5ICF A;  3P9C A;  3WTV C;  4CGZ A;  2RV8 A;  2IVM A;  2HQR A;  2EV6 A;  4L9V A;  1ODD A;  2P6S A;  3K2Z A;  3I4P A;  2F5D A;  4UVB A;  1D8J A;  2YU3 A;  2ZXJ A;  3CO7 C;  3R61 A;  3W6K B;  2KJB A;  2NNY A;  1G3W A;  3R0A A;  4M6X A;  4EVI A;  4LB5 A;  2NYX A;  3LQR A;  5CVU A;  5LHI A;  4ZZD A;  2M87 A;  1S8N A;  2FML A;  1O3T A;  1I1S A;  4ETS A;  1XMK A;  5HDK A;  2GZW A;  1GHC A;  2PMH A;  4R1H A;  2BGC A;  1SMY F;  3GUD A;  4MTE A;  3AAF A;  1RIO H;  4LMY A;  4AWX B;  3F8M A;  1P6R A;  3ECH A;  3IC7 A;  5TRD A;  1IUY A;  4HF1 A;  1FNN A;  1ZAO A;  1EH6 A;  1YO5 C;  4KNY A;  2XHK A;  3C3W A;  3GF2 A;  1QPM A;  3CJN A;  5BMZ A;  5IT3 A;  4H0E A;  3I59 A;  2QYO A;  2Q8K A;  4EJO A;  3KP5 A;  3TOA A;  2JZY A;  1HW2 A;  3E97 A;  4LLG F;  2BEO A;  2K86 A;  2EV0 A;  2F2E A;  4HDV A;  4HA8 A;  5DCM A;  5D5U B;  1IXS B;  5LGN A;  4OOI A;  1IN8 A;  1WSU A;  5IT9 Z;  4IJA A;  1XSV A;  4L9J A;  1G3T A;  1OYI A;  3V4G A;  2HOE A;  3U1D A;  2PMU A;  1OYW A;  3EDP A;  2GWR A;  2YX7 A;  1W4M A;  3F8F A;  3PQK A;  4AIK A;  3GXO A;  3JTH A;  4XSX F;  1XN7 A;  3R6S A;  4XLN F;  5ICG A;  2STW A;  2STT A;  2M30 A;  3ECO A;  1WQ2 A;  5HDN A;  4EJW A;  2ZNZ A;  1JXS A;  4WCG A;  4HF2 A;  1J5Y A;  2D1H A;  2QQ9 A;  4LK0 F;  5E18 F;  5E8G A;  2FE3 A;  3FM3 A;  2UWM A;  2CQK A;  1K6O A;  1R1U A;  1O7L A;  5L3F A;  5HS9 A;  3BJ6 A;  3I59 B;  2HTJ A;  2KRF A;  2FQ3 A;  5D4R A;  3W6J B;  4IHS A;  3PQJ A;  1MJB A;  2EA4 A;  1H9T A;  4EQQ A;  5DCM B;  1UB9 A;  3I53 A;  3EET A;  3HRU A;  1QGP A;  1HKQ A;  3TGN A;  2XV4 S;  1FSH A;  2K27 A;  4AD9 A;  1P92 A;  3GFL A;  4L9N A;  3DP7 A;  3D5L A;  3HTU A;  4I98 B;  1WKM A;  2JRT A;  2V6C A;  3WTZ A;  3F8C A;  4PZJ A;  4L9T A;  2HS5 A;  2HQN A;  4LLN A;  2P6T A;  4HF0 A;  1TQM A;  1BIA A;  5LEK A;  3L2C A;  2EFQ A;  3M9A A;  2KIM A;  5LBQ A;  1OYY A;  4LG0 B;  3FMR A;  1T39 A;  1FYM A;  5FFZ A;  3LA2 A;  1RNL A;  2XIG A;  1LQ1 A;  1W7P D;  4OIO F;  4E70 A;  5F1R A;  4IRG A;  1R1T A;  4GYI A;  1R22 A;  4WK8 F;  2ISZ A;  1ZRD A;  4GCV A;  2ZKZ A;  4L0Y B;  4KT5 C;  2R7D A;  3ZMU A;  1XB4 A;  2CG4 A;  5FLX K;  4EJU A;  4HV5 A;  2PFB A;  4OIN F;  1IN7 A;  1F4K A;  3MZH A;  2CSO A;  1Z9C A;  5ILU A;  4YFX F;  1ZG3 A;  5E1W A;  3F3X A;  1FZP B;  4ENJ A;  2GA1 A;  5LHG A;  1ZAR A;  2VBY A;  4OIP F;  4MNU A;  3M8F A;  1PUE E;  2RQP A;  4CYD A;  2KIU A;  5A2Q K;  3JW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...