4EM1A

Staphylococcus aureus marr native
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR native
rcsb
source organism Staphylococcus aureus
molecule tags Transcription
total genus 32
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em1A00
2ZJ2A 2JPBA 5IT9K 4HA8A 1LEAA 3TO7A 3WTXC 3SZPA 2CSOA 2PEXA 3ZMTA 2BGCA 1B6AA 1J75A 1U5TC 3R60A 3IKVA 2IA0A 3ABTA 3IL2A 1OYWA 1YIOA 5H6RA 3MWMA 2HYFA 4RGUA 2ZNYA 1J9IA 1L3LA 1OR7A 4A6EA 3IHUA 5K5RA 3DF8A 4Q48A 2IT0A 1QPMA 5ICFA 5L3FA 4ESBA 5D5VB 5LEJA 3JSOA 1NHAA 1ZREA 5HS7A 4AIJA 3KLOA 1T6SA 3NQOA 2D45A 3BWGA 5K5OA 3QOPA 4Y17A 3GXOA 3LFKA 1D8JA 2A68F 5HDKA 2DW4A 2NYXA 4QWQA 1ZLKA 4QLCU 3KZYA 1XCVA 4M72A 2HYGD 1IXRC 4BHPA 5H20A 2CFXA 3RDIA 4HDUA 3DPTA 4KDPA 3Q9VA 3ECOA 3TOBA 3FWEA 4B09A 4JQFA 1LDDA 4HLXA 1O7FA 4HF2A 2JTVA 5FFZA 3H3UA 4P5OA 5DCMA 3QU6A 4M9XA 3FXUA 2VT2A 4ZYHA 1LJ9A 3I59A 4MEYF 3QRFF 2O6GE 2ESHA 2ZFWA 5DEQA 3L2CA 1R23A 3WTVC 4M9SA 4P9UA 1Z7UA 2ACJA 1HKTA 2G7HA 2EV0A 2BYVE 2KKOA 3BJ6A 1VTNC 5J8CA 2D2WA 3IWZA 4CXFA 1R5HA 1ULYA 5HVQC 3HRUA 1CGPA 5FFXA 1XSXA 1FP1D 1MJBA 1E17A 5HLHA 3T1BA 5HLGA 3K9TA 3GVAA 5L3CA 1FP2A 4ESJA 4FX4A 1V4RA 4IRGA 1I1GA 5D5XB 2NNNA 5CVJA 4UV9A 2HQRA 1YW9A 5ED4A 2HTSA 2NS0A 4EM2A 4MNUA 1USSA 1REPC 3OOPA 2P5LC 4ZZLA 2W84A 5LLQA 2W24A 1LEBA 4BXUA 2EB7A 2KIMA 2E1CA 3R0JA 4EM0B 1OPCA 5ICGA 3K1MA 2L4MA 4YIFA 3VOEA 2PJPA 1FC3A 1ZAOA 4UUVA 2RV8A 1YS7A 2L54A 2FA5A 4G6QA 1IXSB 3FMSA 5FLXZ 2VC1A 3IRRA 1KU2A 1HQCA 5BQTA 3RKWA 3E6BA 4M73A 3IKTA 4JK1X 4HX8A 2PN6A 3DXJF 3T0YA 2M87A 4YG2F 4AWXB 1J2XA 3HOTA 3FMQA 3U2RA 2K4BA 4RAZA 3J81Z 1G4DA 1H9GA 2GXGA 4YFXF 4G9YA 1OYYA 3JTHA 4KNYA 4I7HA 2X0LA 3V8LA 3E5UA 3WE3A 5D4SA 4GYGA 2XAFA 1JGSA 4HBLA 2XGXA 4OU0A 4XSZF 5ILVA 2VXZA 2VBYA 3GFLA 1Z05A 4I09A 1GXPA 4UVCA 1LNWA 4AIKA 3MAJA 2L3DA 2EJRA 4ENKA 3ZMZA 1BIAA 2XAGA 4CO8A 1ZHFA 2P6TA 4EMSA 5AONA 1Z1DA 2PQ8A 3QPHA 5IT3A 2W25A 4Q47A 3RPUA 3V8JA 2NNYA 4EQQA 2DQRA 3I64A 1IRFA 3F6VA 1FYLA 3M8EA 4BHBA 2F5FA 2M5WA 2YPRA 3FM3A 1IN5A 3WU0A 3CO7C 4DNCA 1GVJA 1P6RA 1T98A 5CLSA 3FXRA 1UB9A 4U0WA 2VN2A 3KCCA 1K7AA 3CDHA 3WU1B 4GGGA 4A0ZA 3I71A 2JRTA 3SQNA 1SFUA 1HKQA 4HYEA 4R79A 2YX4A 1R58A 4ESFA 5AIPA 2M45A 2K02A 3E6MA 1AOYA 4G7OF 1FBUA 3GLXA 1U3EM 2OZUA 4LD5A 3KLNA 4UVBA 1FWZA 2A61A 3TKYA 2XAHA 3WODF 3I5UA 3DEUA 4KT5C 5ICCA 3JAMK 1DPRA 2DT5A 1ZGJA 4L0YB 2RN7A 5DD4A 4ZH4F 1J0RA 4LG0B 4YIIA 4H0EA 2K27A 1FBQA 2MLGA 1YW8A 3HYIA 4MQVA 1LDJA 3RIRA 3KEOA 3ZN1A 1FSEA 1BC7C 2P5KA 2QZ8A 1I5ZA 2MH2A 2P7CB 5E1ZB 2AXLA 3RI4A 1CF7A 5KVRA 2JZYA 2Z3YA 4EJVA 4KIFA 3PQJA 2WWYA 2R3SA 3HIFA 2WV0A 3E6CC 5HLIA 3LQQA 3GFIA 3KP6A 2J5OA 3R6SA 5ICEA 3COAC 5CVUA 2ISYA 1YO5C 3VODA 4EV0A 3I58A 2VBXA 4IPAA 3G73A 5HDNA 1ODDA 2IA2A 3EDPA 3KE2A 4M71A 1MJAA 4HW0A 2UWMA 4PGHA 2Y48A 2RC4A 4HF1A 4RGXA 3CUQA 1S8NA 3O6BB 5A2QK 3F72A 3IWFA 2XAQA 4KA4A 2QQBA 5IT9Z 3HRMA 1BBYA 1W7PA 1JXSA 1QBJA 4OMYA 4EJWA 1W5TA 1SAXA 1DUXC 2O0YA 1R7JA 4HQMA 1WKMA 2XKOA 5ILUA 2GAUA 2DPUA 4EM1A 2JPCA 2EFPA 2VE9A 2DQLA 3GW2A 2XROA 5E20A 3P9IA 1S6LA 1ZLJA 2H09A 2FQ3A 3BPVA 5F6FA 1TTYA 1O3RA 2EK5A 4RGRA 2QUFA 1K78A 1T39A 3CTAA 1JE8A 3SXYA 1O7LA 2OU2A 2STWA 1E2XA 4HOBA 5K5QA 4K2EA 1B59A 2DAOA 2M8EA 3GEZA 3TDUC 1MDMA 2GZWA 2FBIA 1ZG1A 5TRDA 3DKWA 3K69A 3KEQA 2KIFA 4I02A 5E17F 4ZYGA 1P92A 1WSUA 5LHIA 4YFNF 1W7PD 3TGNA 3J80K 4KFCA 3L7WA 2FE3A 3ZQ7A 1HW5A 1QZZA 4HV6A 2Z9OA 5L3GA 4Y13A 1L0OC 3F8BA 2A5YB 1XSVA 3WGHA 5FB2A 1RIOH 3GYHX 3HTUA 1I6XA 2FRHA 1BI0A 2R7FA 3GO5A 2FEZA 2X4HA 1IN4A 1HSTA 2L4AA 5CVRA 4NQWA 3P7NA 4G8XA 3HHHA 5LGTA 2DTRA 3WE2A 3T8RA 3GZ5A 3FM5A 3LA2A 5J6XA 3E3VA 4XRFA 1IUYA 1ONVA 2B0LA 2GA1A 4U7BA 4MTEA 5LEKA 4LLGF 3TO9A 1HKSA 2YR2A 5DCMB 4EJUA 1BC8C 4ENMA 2LNBA 1XN7A 4XLPF 5LGUA 5FO5A 4I0BA 2DK8A 3HUGA 2STTA 3I59B 4N0BA 1OKRA 1S7OA 3LAJA 5TJJA 3ZP5A 1PDNC 3RKXA 4E70A 1EH8A 2OZ6A 1Z6TA 2BEOA 2QLZA 2O8XA 1IN8A 4R1HA 1BI2A 1SD4A 5BPDA 1IRGA 2P6SA 5FD5A 2F5CA 1FBSA 2ZMEA 4B8XA 3K1PA 1RNLA 3BJOA 3BY6A 4IVNA 5BMZA 2XHKA 2RQPA 1T2KA 4A5NA 4ENJA 4O5VA 1ZRDA 5JFRA 4RB2C 4HDVA 1Z91A 5CVIA 1D5VA 1BM9A 3S2WA 1SMTA 1MJ9A 2IW5A 3MZYA 1TW3A 3TDZC 3RYRA 1S7AA 2QYOA 3C18A 4S04A 3AAFA 4BQAA 2CQKA 1P4WA 1QQIA 1YG2A 4Y15A 1H0MA 2M1BA 2KJBA 2LF8A 5D6FA 1IZ1A 1RI7A 1GHCA 1G3TA 3N4MA 1FNNA 4A5MA 1JHFA 4L9TA 2PI0A 3CUQC 1SD5A 4PGGA 1KQ8A 3ULQB 2ESNA 5DV5A 1QGPA 1ZH5A 3TO6A 3M8FA 4EGYA 2EFWA 1YW7A 1F9NA 1UCRA 1V3FA 4G7HF 4CYDA 5JR3A 3O2PE 2NRAC 2NAZA 1RUNA 2ZXJA 3EUHA 1H9TA 2FNPA 3E6DA 1XDSA 3QAHA 2ADUA 5HOOA 4UXNA 5AIQA 5H6QA 2A6EF 4LGWA 2F5EA 1B9MA 3BPXA 2VE8A 4EGZA 1S29A 3I54A 2EA2A 1I27A 4BHCA 2G7UA 3CLOA 1BIBA 3M1EA 2HOEA 2QVOA 3ZMDA 4I01A 2VONA 5DDGA 3F8MA 3JAMZ 5HDGA 2HZTA 2BBYA 2DI3A 1XB4A 2HGCA 3JW4A 3V7RA 1YQAA 5E8IA 2MH9A 2Z5UA 5E1XA 5EEHA 2A69F 1Z9CA 1W4MA 3V7SA 1ON2A 3BJAA 4LB6B 2FNAA 3SZTA 1QNTA 4BYYA 3N97A 4WXDA 5HS8A 3PQKA 4FHTA 2K4JA 2J5PA 5LBQA 2W57A 2YX7A 4MEXF 2IJLA 1BJAA 2IRFG 4A12A 5DUIA 4ASNA 5FGMA 5K1YA 1BN5A 4D0PA 3DFGA 3QPTA 4A0YA 5F64A 5D6EA 3FF5A 3GWZA 4HX7A 3K1NA 4LFUA 3RYPA 2PMHA 2PG4A 1R1TA 2UXXA 4P55A 4MHGA 2LSOA 5FLXK 2Y75A 4M9ZA 4NHJA 3ZN0A 2LF7A 1CF7B 3V8KA 1IXCA 4XBFA 5CJ9A 4LLLA 1KGSA 3R4KA 2IVMA 2Z99A 3I53A 5D4RA 4PCQA 3J81K 1KA8A 2E1NA 4CGZA 3K0LA 3CJNA 3RTRA 5D5UB 1WWXA 3OV8A 2Q2EA 1FX7A 2ZKZA 2XIGA 4UVAA 1JHHA 4OIQF 4EJOA 3WTUC 4FT8A 1R1UA 2OQRA 2XASA 2QBYA 4I98B 3CUQB 2VT3A 3L09A 1J5YA 4HLYA 3HRTA 3W6JB 2EWNA 1W7PB 5BPIA 3GZ6A 2DK5A 4S05A 1FT9A 2VBWA 4WCGA 1R5GA 1YTYA 1DP7P 3EYYA 4PZJA 3HSRA 2CW0F 4EJTA 3L9FA 3NRVA 2H6BA 3F3XA 3T8TA 1SMYF 4Q4ZF 3K2ZA 4M74A 2FXAA 3J80Z 4WXCA 1WRJA 4ZZDA 2MLKA 4RB1A 2HFHA 3C7JA 4LK0F 1O3TA 2XAJA 2HR3A 4L9NA 1DPUA 1B9NA 1K78B 4KMFA 4HQEA 3HRSA 1ZGAA 5FD6A 1SFXA 3PFIA 1A04A 2EFQA 2EFNA 3Q5FA 1MDMB 1TQPA 5EEGA 2QQAA 2WC2A 3R0AA 1XGSA 3I0TA 1YFHA 1P4XA 3ROUA 4MQ9F 2XV4S 2K86A 1BI3A 4L5JA 3MZHA 1XMAA 3T5XA 2XRNA 1FZPB 5LGNA 3WGIA 4L0ZB 4XSXF 1KU3A 2GQQA 4IHTA 1PP7U 2D1VA 3LSTA 4WX9A 3QU3A 3ZMVA 1F5TA 1O57A 4HF0A 2BV6A 5DCFA 1AWCA 2FU4A 4A6DA 3LWFA 4KUMA 2ZBKA 4OIRF 4HV5A 1UHWA 4OINF 3LQRA 2O61A 1B4AA 5L3EA 1Y0UA 2CO5A 3ISPA 1K79A 2MD5A 2FSWA 4HAMA 3FXQA 1O3QA 1SFEA 1ZG3A 2FBKA 3DQVC 1X3UA 5L3BA 4ON0A 2EV5A 3F8NA 3TOAA 1B1BA 3V7CA 4U88A 1OMIA 2UXNA 2DFIA 1G6NA 3H92A 2ZNZA 2HQNA 5BOXA 3O3KA 2JT1A 1MGTA 1ON1A 1QZYA 5HS9A 3MQ0A 4LMYA 2HTJA 1ZG5A 1R1VA 2Y0MA 2RKHA 3BOQA 1D3YA 2HKXA 3H3ZA 2W85A 2A3SA 2E7WA 4GO1A 4OIPF 3C3WA 4M6YA 2VODA 4GCVA 3NEUA 1ZARA 2OA4A 4IF4A 2DU9A 4IJAA 3MEXA 3J7AO 2V79A 4KICA 3IC7A 2PMUA 3GX4X 3WTTC 1IN7A 4F7ZA 3E5QA 1MZBA 3HSFA 2C6YA 1QO0D 5JI6A 2ZMEB 2RDPA 3F6OA 1XMKA 4ETSA 3LAPA 1G3YA 4UNOA 1XGMA 1FYMA 3M7GA 5JHUA 3REOA 3RJPA 3D0SA 1Q1HA 3FZVA 1UHMA 1MD0A 3WTWC 4N9HA 1K6OA 2KJCA 2WTEA 1TW2A 5ILSA 2H94A 1BI1A 5CYVA 2V1XA 4Z2YA 4AD9A 4O3MA 3D5LA 3DP7A 5DUKA 3F23A 4I2OA 3G3ZA 3JSPA 4P96A 2DBBA 4PDKA 4WK8F 4U0VA 4KYWA 4IXAA 2Q8KA 1IW7F 1RZ4A 1U8RA 3WTYC 4HX4A 3KP5A 3B02A 4L18B 4ZYEA 2CGPA 3Q9SA 3F21A 1YYVA 4HZFA 2QQ9A 3SHFA 3P9KA 3DPLC 1PUEE 1USTA 1R36A 5E18F 2P5VA 4KMUX 5F1RA 1XGNA 3QP5A 2COMA 5D5WB 2VOOA 4CZZA 3ZPLA 4U0YA 1IN6A 4FX0A 4KIGA 2XKPA 3W6KB 1FLIA 5LRRA 4TV7A 1KYZA 1HBXG 1J7KA 1RUOA 2GIVA 1FPQA 3RPQA 2ZCWA 2ISZA 3ELKA 2HKOA 2IPQX 1KU9A 3IRQA 2L02A 4U7DA 4DQ2A 1FOKA 1MKMA 2G9WA 2V1DA 4A0XA 3WTSC 2XVCA 2CYYA 2MC3A 1HSJA 2ELHA 2LDUA 1LQ1A 3E5XA 4LK1F 2ETHA 4CDGA 2FOKA 3EETA 2OD5A 1D8KA 3CO6C 1KQ9A 4A2UA 2EFOA 2Q0OA 4BAYA 1FYKA 2PFBA 1F1ZA 5CVVA 1U5TB 3F8FA 3LA7A 4G6DA 1LB2A 1I1SA 5LRSA 1SD6A 3U1DA 3KETA 4CICA 2KIUA 3WG9A 1P2FA 2OBPA 3ERED 1XD7A 2QWWA 3ZMUA 1XSDA 1TNTA 1PP8F 2V6CA 4G94A 1ZRCA 6PAXA 4O6JA 2A6HF 3V4GA 3F22A 2M30A 4R8HA 4P9FA 2K7LA 2XUBA 3BZ6A 3LA3A 1U5TA 1FY7A 4KN7X 4IRIA 3EYIA 4BNCA 3RKYA 2CG4A 2CWEA 2HS5A 4ZYDA 1ZN2A 2R7DA 4ENNA 2RNJA 3E97A 1T0FA 2IP2A 3QP6A 2YSRA 5E8GA 5DYMA 2MA3A 5JVTA 3KFWX 3WTZA 2LKPA 2AS5F 5A2QZ 2KRFA 4WXHA 1C0WA 2O3FA 4OOIA 1ZRFA 4RB3C 4NB5A 1G3WA 1U78A 4Q5SF 1KYWA 1YLFA 4AVPA 2D1HA 3VEPA 1EV7A 3KP3A 5L3DA 2FMLA 1XDUA 2QBYB 2GXBA 1OYIA 1FSHA 2TDXA 5E1WA 5ERIA 1HXDA 4I0AA 4WWCA 1UFMA 4RS8A 3C1DA 3VB2A 4G7ZF 3MFKA 3GF2A 4MTDA 1XGOA 2FBHA 1P4AA 2OAZA 4CHUA 3ECHA 5J8FA 2UZKA 2MBFA 1TBXA 1W5SA 3F8CA 1KQ0A 4L9VA 1J59A 1ZYRF 1O3SA 4KIBA 3GFMA 4WF2A 3HOSA 3FHZA 3ML6A 1Z6RA 2VBZA 4L9JA 4RAYA 1HW2A 5DD8A 1LVAA 3BDDA 2QM3A 4M6XA 2PBIA 2BE5F 3MCZA 2QENA 4BH9A 3GUDA 3FMRA 4GYIA 2YU3A 4IHSA 3M9AA 3FX3A 3SFZA 1LDKB 3B73A 3R61A 1DDNA 2P7VB 4LG0A 1TNSA 3ABUA 3HSEA 1TQMA 3HHGA 2RVCA 2F2EA 2GWRA 1EH6A 4IRHA 3I4PA 4KN4X 1IAWA 3U9GA 3BP8A 2IA1A 1U2WA 2P8TA 1HW1A 2H27A 2PLYA 2L01A 1R22A 2V1UA 2DO7A 4OMZA 2GA2A 2EV6A 5LHHA 1IF1A 2EA4A 3WGGA 2RGVA 3JTGA 2A07F 4XLNF 2HDCA 2HEOA 3GFJA 1G3SA 4UHTA 1S3JA 1XCBA 3KZZA 4LLNA 3P9CA 3CUOA 4RB0A 3VFZA 2FF4A 2F5DA 4RGSA 2JSCA 2DPDA 5D8KB 3BROA 4YFKF 2VOPA 1T38A 2P4WA 3L00A 2E7XA 2O03A 2HWVA 2VC0A 4EVIA 3KP2A 1U6GA 3KP4A 1R00A 3HTSB 4L5IA 5D8LB 5BS6A 2FMYA 1GXQA 3DV8A 2OQGA 4UV8A 4LJZF 1TQIA 4AIHA 3EQLF 1EH7A 1WI9A 2ZO4A 1KU7A 1SD7A 4JBAA 3TQNA 2V9VA 4GXOA 1F4KA 1BOAA 1TLHB 5LHGA 5KK1A 4LB5A 4OIOF 3KP7A 1WQ2A 3ZMSA 1YS6A 4MGRA 2DLLA 2Z33A 2H6CA 4N9IA 1STZA
chains in the Genus database with same CATH superfamily
2ZJ2A 3K4KA 2JPBA 4BBRJ 5IT9K 2OUMA 2CU7A 4HA8A 1B72B 1LEAA 3TO7A 2H1LA 1MMNA 3KX2A 3SZPA 3WTXC 2CSOA 1WJEA 2PEXA 1PUFB 3ZMTA 3OS1A 2BOLA 2BGCA 2DJIA 3EUKL 1B6AA 1J75A 1U5TC 3R60A 3IKVA 2IA0A 3ABTA 2R7XA 3IL2A 1OYWA 3QPSA 1YIOA 3NWTA 2BW3A 1MBGA 1VQ9I 1VQOI 5H6RA 3MWMA 2HYFA 4RGUA 2ZNYA 1J9IA 4DW6A 5GP9A 1L3LA 2HU9A 1OR7A 4E7SA 2IS1A 3S2HJ 4A6EA 3IHUA 5J1RA 5K5RA 3SZGA 3AG2H 1K83J 3DF8A 5TGTA 3M8JA 4Q48A 2IT0A 1RRJA 1QPMA 5ICFA 2AQFA 2DYSH 5L3FA 1DU0A 2OCCH 4ESBA 2E34A 5D5VB 5LFAA 1WFXA 2CH0A 5LEJA 3JSOA 1NHAA 2F4MB 3C2BA 1ZREA 1Z21A 4IHWA 5HS7A 4AIJA 3KLOA 2LOOA 1G2HA 1T6SA 3NQOA 2O7OA 3LSRA 1ETWA 2D45A 3BWGA 1MMAA 2D5VA 4CYCA 2V26A 2H8WA 5K5OA 3QOPA 4Y17A 3GXOA 2X6OA 3LFKA 3LNQA 3KYCB 3G6EI 3VWBA 2F4IA 1D8JA 1I50J 2NVYJ 1X58A 2DA6A 2VQCA 2A68F 3BG6A 4IL6C 5HDKA 3CCUI 5FLVA 3GTQJ 4KT6A 3ERMA 2DW4A 2NYXA 4QWQA 1YX5A 5E3LA 1ZLKA 3FK7A 4QLCU 3KEYA 5GAEJ 3KZYA 4HSTA 2EZKA 1XCVA 3JCUC 4M72A 4CZCA 2HYGD 2OF7A 2LP0A 3S32A 1IXRC 4BHPA 3G1MA 3R6SA 1ZKGA 5H20A 1Z7LA 2CFXA 3RDIA 1RKTA 4F3QA 4HDUA 3DPTA 4KDPA 3Q9VA 2E1OA 3FXLA 3ECOA 3TOBA 3FWEA 1R9TJ 4B09A 5CQGA 4M6VA 4AUXA 4JQFA 1LDDA 4HLXA 4DBRA 5DS9A 1O7FA 5TISC 3OYAA 4HF2A 2JTVA 3S2DJ 4Y7NJ 1JJ8C 5FFZA 3H3UA 4P5OA 5DCMA 1SVMA 1T33A 3QU6A 1X1BA 3NAUA 4M9XA 1JUSA 3FXUA 2MYSA 2VL8A 2VT2A 2GOMA 1UG2A 2LY9A 4ZYHA 1LJ9A 3K4MA 3I59A 4MEYF 9ANTA 3QRFF 4IO9F 1ERDA 2O6GE 2ESHA 2ZFWA 5DEQA 1EF4A 3L2CA 1ETYA 3LSPA 3PO2J 4DYRA 1N75A 1R23A 3WTVC 4M9SA 2JQ7A 4P9UA 2K3FA 1Z7UA 2R92J 2ACJA 1HA8A 1HKTA 3DTIA 2G7HA 2JA5J 2EV0A 2BYVE 2GOXB 2KKOA 2XDVA 3BJ6A 1VTNC 5J8CA 3DU6A 2D2WA 1H88C 2Y9ZA 3IWZA 2V9PA 2TRTA 5K7FA 4BU2A 1Z0XA 1FIAA 2DN0A 1TT0A 4CXFA 4E7IA 3K4BA 5EEAA 1K4SA 1QHHD 2XAUA 3VYUB 3OS2A 1DP3A 1R5HA 1ULYA 2EZHA 3PNVA 5HVQC 3HRUA 4LIVA 4L5EA 1CGPA 1JTYA 5FFXA 1XSXA 1FP1D 1MJBA 3GTJJ 1E17A 1WHUA 2XB0X 5E3NA 5HLHA 3T1BA 2BXYA 1JGGA 2MSYA 5HLGA 4X0GA 3HGYA 2IBDA 3GVAA 3K9TA 5L3CA 1DQUA 3BG3A 2CQNA 1FP2A 2BHYA 3I3LA 1GV2A 2R7RA 4E7ZA 2XPVA 4ESJA 4FX4A 1V4RA 1UHSA 2X1DA 4IRGA 1I1GA 1WH7A 5CQEA 1K6YA 2L7FP 5D5XB 2XSJC 2NNNA 5CVJA 4UV9A 4A69C 2HQRA 2LLKA 1YW9A 3CD6I 3MD2A 2VPLA 2QEXI 1P7JA 5ED4A 2HTSA 3MKYB 1A35A 2NS0A 4EM2A 4MNUA 1USSA 3GBGA 3L1PA 3LOCA 1REPC 1UMQA 3OOPA 2LH9A 2P5LC 4ZZLA 2QSFX 3CP8A 4XLHA 2W84A 5LLQA 1D0YA 2W24A 1LEBA 2W1OA 1PJRA 4BXUA 2EB7A 2KIMA 2E1CA 3R0JA 4EM0B 2PJRA 3G2BA 1LFUP 3RQ4A 1OPCA 5ICGA 3K1MA 2L4MA 4YIFA 3VOEA 2JA6J 2PJPA 3HXLA 1FC3A 4RA2A 1Y39A 1ZAOA 4UUVA 2RV8A 1YS7A 2L54A 2FA5A 4PJ0C 3WHBA 3OIPA 4G6QA 1IXSB 3FMSA 5FLXZ 2VC1A 3IRRA 4IQJA 2IS6A 1KU2A 2YUSA 1HOMA 2V1NA 1HQCA 4MFEA 3K4CA 5BQTA 3K4JA 3RKWA 1YIJI 1D0XA 3E6BA 4M73A 4XK4A 3TBIA 3IKTA 4JK1X 4HX8A 2PN6A 3DXJF 2DA4A 3T0YA 4DZPA 3FHNA 2M87A 1RR8C 5C3EJ 4YG2F 5FRNA 4Z6YA 4AWXB 1J2XA 2E71A 3HOTA 3FMQA 5GPAA 2E19A 3U2RA 1HF0A 2K4BA 2BY3A 2VKEA 1WCMJ 4RAZA 1E3PA 3J81Z 1G4DA 3TL4X 2HXIA 1H9GA 2GXGA 4YFXF 1U8BA 4G9YA 3SYTA 1OYYA 4G6TB 1WPKA 3JTHA 1IGNA 4KNYA 3FISA 3S1MJ 1X2MA 1ORKA 3H5NA 3IAS2 2X0LA 4I7HA 3E5UA 3NARA 3H9JA 3V8LA 3WE3A 5D4SA 4GYGA 4RAGA 3FIWA 5EJCA 1Z3XA 2MFZA 2XAFA 2O8KA 1JGSA 2V7FA 1NK3P 2R7ZJ 4HBLA 2XGXA 4OU0A 1H89C 4XSZF 5ILVA 2VXZA 3HOYJ 2VBYA 3GFLA 1Z05A 4I09A 1GXPA 4UVCA 1LNWA 1TZLA 4AIKA 3MAJA 2L3DA 2EJRA 4ENKA 3ZMZA 2BY2A 1BIAA 3DBHB 2X6XA 2XAGA 4CCKA 3WG7H 4CO8A 4PFPA 1ZHFA 4ZDPA 3DBLB 5EGOB 2P6TA 4EMSA 5AONA 2ZFUA 2IAIA 2DOEA 1Z1DA 2PQ8A 3TMOA 1VQ7I 3QPHA 5IT3A 4N4OB 2PMZA 2W25A 4Q47A 1HDDC 1QVUA 3KZIC 1R5ID 3RPUA 3V8JA 2NNYA 4EQQA 1W0UA 2DQRA 3I64A 1IRFA 1HDPA 3F6VA 3MZ8A 1WH5A 1FYLA 3SEZA 2WY7Q 3M8EA 4BHBA 3DKXA 2F5FA 3D5SC 2M5WA 1XG1A 2YPRA 2LBFB 1T0FC 4CSWA 1T95A 3FM3A 1IN5A 1WJCA 2EZLA 3WU0A 1VQMI 3CO7C 2QQ8A 3PM1A 4IEJA 4DNCA 1GVJA 1P6RA 1T98A 2BY0A 5CLSA 2CQ7A 3FXRA 1UB9A 4V19K 4U0WA 2VN2A 3H0DA 2VQLA 5GTHC 3KCCA 1YX3A 1A31A 2X1CA 1K7AA 1S72I 3ZQIA 3CDHA 3WU1B 4GRIA 4GGGA 4A0ZA 1OQYA 3PSFA 3I71A 4JX6A 4BY1J 1OR7C 2DDAA 2HOAA 2JRTA 3SQNA 1SFUA 1HKQA 2FX0A 4HYEA 4R79A 1X4OA 1MNEA 2YX4A 3LMMA 4XN3A 1R58A 2EPFA 4PSXA 4ESFA 5AIPA 2M45A 2R7UA 2K02A 3E6MA 1AOYA 4G7OF 4RBOA 5B1AH 1FBUA 4LIUA 1F43A 3OYKA 3GLXA 4PJNA 2ZJQF 5C44J 4QPQA 1U3EM 2Z1DA 1OCZH 2OZUA 4LD5A 4IZZA 2WAFA 3BZCA 4Y4RA 3KLNA 4UVBA 1FWZA 2A61A 3TKYA 1ETQA 2XAHA 3WODF 3I5UA 3DEUA 4KT5C 5ICCA 3JAMK 3FXJA 1DPRA 2DT5A 2W00A 1ZGJA 2E35A 2DA3A 2RN7A 5DD4A 4L0YB 4ZH4F 1J0RA 4LG0B 4RAFA 4YIIA 4H0EA 2K27A 1FBQA 2E2IJ 2P81A 3BTJA 1Y1WJ 2JRMA 2QF7A 2MLGA 1YW8A 2DT7B 3HYIA 4HSRA 4MQVA 2EZIA 4DOZA 1LDJA 3RIRA 1MNDA 1TWFJ 3RPUD 3KEOA 3ZN1A 4BE2A 1FSEA 3V42A 2HZDA 3OYNA 1VZ0A 4X1EA 2CFOA 5FKOA 4UUSA 2LR8A 4XOTA 2XC7A 1BC7C 2P5KA 3TW6A 1SEUA 2QZ8A 1I5ZA 4AM3A 2MH2A 2P7CB 5E1ZB 2AXLA 3RI4A 5E79C 1YE9A 1XC5A 2Y9YA 2DMPA 1CF7A 2OCEA 5KVRA 1WJDA 2JZYA 3BTIA 1JI8A 1V54H 2VUMJ 2Z3YA 1UZCA 4EJVA 3JR9A 1BR2A 4KIFA 3PQJA 3H1CA 3S17J 2WWYA 1TWAJ 2R3SA 3HIFA 2WV0A 3E6CC 2F6CA 5HLIA 3LQQA 4HRIA 3BR3A 4BEHB 3CMAI 3GFIA 2ZXWH 1WJBA 2FOWA 2IGNA 2J5OA 2ZXIA 3KP6A 3QOEA 5CVUA 1X1DA 2NXNB 5GAGJ 5ICEA 1GV5A 2ISYA 1YO5C 4GFBA 3VODA 4EV0A 3I58A 2K9NA 4F55A 2VBXA 1W0TA 4IPAA 3G73A 5HDNA 1ODDA 4FISA 1VQNI 2IA2A 3A2KA 3EDPA 3KE2A 4M71A 1MJAA 4HW0A 2UWMA 4PGHA 2QCOA 1PYVA 4C2UA 3RCOA 3G71I 2Y48A 2ECBA 2RC4A 4HF1A 3HJEA 4RGXA 4A3FJ 3CUQA 1S8NA 3O6BB 5A2QK 3F72A 3IWFA 2X48A 2XAQA 4KA4A 2QQBA 3QYFA 5IT9Z 3QODA 1IV6A 3HRMA 1BBYA 2HOTA 3GTPJ 1W7PA 3JRAA 2IS4A 1JXSA 5B1BH 1QBJA 5FKMA 4OMYA 5CPRB 4EJWA 1W5TA 1SAXA 1OFCX 1DUXC 2JA8J 2O0YA 3Q0VA 1JUMA 2MG4A 3CCLI 1R7JA 3BG5A 5HNHA 3CCEI 4HQMA 1WGXA 1WKMA 2XKOA 1SAUA 2GAUA 5ILUA 5EYRA 4EM1A 2DPUA 2JPCA 1QA6A 2E1MC 2EFPA 2VE9A 2DQLA 2K9MA 3K2AA 3GW2A 1D1AA 1BJZA 4CH7A 4QPOA 1YHQI 3WHCA 1IC8A 2XROA 2QSGX 3DCFA 5E20A 2RNGA 1D0ZA 2VXDA 1S6LA 1RKWA 1ZLJA 3P9IA 2HI3A 2ME0A 3U21A 3OS0A 2M0CA 3UKGA 2H09A 2FQ3A 3BPVA 5F6FA 1YI2I 1TTYA 1O3RA 2EK5A 2IS2A 3B6CA 3BT9A 4RGRA 2VLAA 2B9SA 2QUFA 1ETKA 1K78A 1T39A 3CTAA 3CMYA 3O8GA 2K40A 2DFHA 1JE8A 1DGRM 1O7LA 2OU2A 3SXYA 3OYLA 2STWA 1E2XA 4HOBA 4IHXA 5K5QA 4CCJA 3E0JB 2X6YA 3MKLA 4K2EA 3X2QH 1B59A 2DAOA 2M8EA 2P0WA 3Q0UA 3GEZA 3TDUC 2LVSA 2HQ5A 1Y0NA 2GZWA 2V4JC 3SJMA 1TL8A 2FBIA 1MDMA 4I99C 3DWLE 2M4GA 4KITB 4XQFA 2VKVA 1ZG1A 5TRDA 3HL2A 3DKWA 3K69A 4ZDLA 2DOAA 3KEQA 4IKFA 1S7EA 2KIFA 2M9HA 4I02A 1RESA 2KLOA 1VNDA 2OPTA 3S1NJ 5E17F 3CJQB 3TP3A 2ZJRF 3VSKA 1NG6A 4ZYGA 1RETA 2JJ7A 2KIQA 4BACA 2BW3B 1P92A 2V9KA 4C3JJ 3K7AJ 3CF5F 3IAM2 3OYCA 2ELKA 2M8GX 1WSUA 5LHIA 4YFNF 1W7PD 3TGNA 3J80K 4KFCA 3L7WA 2DODA 2FE3A 3ZQ7A 5GADJ 1HW5A 1QZZA 3DLAA 4HV6A 2Z9OA 2W48A 4B3XA 2HOSA 2XF7A 5L3GA 4Y13A 1L0OC 3F8BA 4CYCB 2KZGA 2A5YB 1XSVA 3WGHA 5FB2A 1RIOH 3HTUA 3GYHX 1I6XA 5M3FJ 1VQLI 2DFEA 2FRHA 4XNFA 1BI0A 4IHYA 2R7FA 4RLFA 3GO5A 2FEZA 3LSKA 2X4HA 1IN4A 1HSTA 2L4AA 3PJRA 5JLXA 5CVRA 4NQWA 4CA0A 3F9KA 3P7NA 1MW7A 3SDGA 2VB6A 2JK3A 3SEQA 4E6KG 1ZQ3P 3ABLH 3SDBA 4G8XA 2X1EA 3HHHA 2JWTA 5LGTA 3HPHA 2RAEA 4A3EJ 3RZDJ 2YU9J 2DTRA 3WE2A 3T8RA 5JVGF 3GZ5A 3ZRGA 3CCSI 2XRLA 3FM5A 2HYJA 3FKIJ 3LA2A 1IDYA 5J6XA 3E3VA 4XRFA 1E3HA 4E7JA 1IUYA 4CCMA 1ONVA 2B0LA 2R93J 2V6EA 4XLEA 2GA1A 2OTLI 4U7BA 1BA5A 4MTEA 2DCEA 5LEKA 4LLGF 3TO9A 4A3GJ 1IUFA 1HKSA 4F52A 2YR2A 5DCMB 4EJUA 1BC8C 4ENMA 2LNBA 1XN7A 5J40A 4CUGA 3S14J 4XLPF 4ZJZA 4OAZA 5KHDA 5LGUA 1EA3A 4I0BA 5FO5A 2DK8A 3HUGA 4OWRB 2STTA 2BVMA 3S3NA 2ZB9A 3I59B 2K3PA 4N0BA 1OKRA 1S7OA 4DYCA 3LAJA 3CCRI 4BJTA 3OOUA 5TJJA 3ZP5A 2UUZA 1PDNC 3RKXA 4E70A 1EH8A 2OZ6A 3VPRA 3KYLA 1JT0A 1Z6TA 1A6IA 3FBIB 2BEOA 2QLZA 2W4SA 2O8XA 4AC0A 3KPHA 5KNLA 3ABMH 4E7LA 2RREA 1IN8A 4R1HA 1Q1VA 1BI2A 3RZOJ 1SD4A 2B7EA 2XF5A 1QZEA 5BPDA 1IRGA 4NC7A 2P6SA 5FD5A 4M3BA 4B47A 2W82A 3DU5A 1GT0C 1WVRA 3ZCOA 3JRFA 2F5CA 3H9QA 2W7NA 1LVKA 2XF6A 1FBSA 2ZMEA 1XS9A 1X1CA 5DM7F 4B8XA 4PK4A 3K1PA 4GDFA 1RNLA 3CMEI 2AXTC 3BJOA 3BY6A 4IVNA 5BMZA 2XHKA 2RQPA 1T2KA 4A5NA 2CV2A 3FXOA 4ENJA 4O5VA 1ZRDA 2LKSA 1SFKA 4ZYAA 2DFFA 4HNVA 5J1YA 5JFRA 4RB2C 4HDVA 4QSHA 3ASOH 1Z91A 5F0FA 2Z16A 5CVIA 2MD0A 1D5VA 1BM9A 3S2WA 2E1MB 2ZXHA 1SMTA 3H36A 2CMPA 2M3AA 2KT0A 1MJ9A 4F91B 2IW5A 3MZYA 1TW3A 3ZQCA 4A3KJ 2K9SA 3TDZC 3RYRA 1S7AA 4NNJA 2QYOA 3HG9A 2PJRB 3C18A 4S04A 3AAFA 1MBKA 4IHVA 2R5YA 3AG4H 2PX9A 4BQAA 4NC8A 1QVTA 2CQKA 1P4WA 1QQIA 1YG2A 4Y15A 1H0MA 2M1BA 2KJBA 2LF8A 2BY1A 3HEFA 1IZ1A 1RI7A 3CDIA 4MFDA 5D6FA 4D1QA 1GHCA 4DGWB 1G3TA 3N4MA 1IV8A 1FNNA 4JP0A 5HLTA 4A5MA 2LTPA 4W97A 1X1PA 1JHFA 1NTCA 3LSGA 1J09A 4L9TA 2PI0A 3CUQC 3CZ6A 1YOVB 3QYBA 1SD5A 4BDYA 4PGGA 4OAYA 1KQ8A 3ULQB 3LFUA 1HC8A 5K7HA 2LD5A 1V5FA 1JKOC 2A05A 3A03A 2ESNA 3A02A 4ZC3A 3K4LA 2NS7A 2DJNA 5DV5A 1QGPA 2DT6A 4EEFG 3TO6A 2QKLB 1ZH5A 3NWSA 3M8FA 4EGYA 2DMNA 4YELA 2K9LA 1MBHA 4B48A 4V2GA 1R49A 1CQTA 2ICWG 2EFWA 1EJ9A 1YW7A 2YS9A 1F9NA 1VQPI 1UCRA 1V3FA 4G7HF 4CYDA 4PUSA 5JR3A 3O2PE 2Y30A 1Y6IA 2NRAC 2NAZA 1RUNA 1D5YA 2LKXA 2ZXJA 3E1SA 3COAC 3EUHA 2NVTJ 3BR5A 4FE7A 1H9TA 1OCCH 1TP4A 2FNPA 3E6DA 1LPQA 1XDSA 2WA0A 3QAHA 2ADUA 5HOOA 2R7VA 3I55I 4UXNA 5EZHA 5AIQA 5H6QA 2BZTA 1MSEC 1X4PA 2A6EF 2DYRH 2BVLA 4LGWA 2F5EA 1B9MA 2EH3A 3BPXA 2VE8A 3FBNB 2LFBA 4EGZA 1S29A 3I54A 2EA2A 2VJIA 1I27A 4E4HA 3EUAA 1Z67A 4BHCA 4XMYA 3ESWB 2G7UA 1U9OA 2ID6A 3W3CA 4U87A 3L2WA 1IJWC 3AFHA 4BKXA 5H2FC 3CLOA 1BIBA 3M1EA 3PIOF 2HOEA 2QVOA 3ZMDA 2FQ4A 4I01A 2DTZA 1HCRA 2VONA 5DDGA 5J4VA 1BR1A 3F8MA 2HNHA 4FCYA 3JAMZ 1KZHA 5HDGA 3F0CA 5EZGA 4D5CA 1VQ8I 2HZTA 4II3A 3ZQGA 2BBYA 2ID3A 2DI3A 1IRXA 1XB4A 2HGCA 3JW4A 3V7RA 4JOMA 1YQAA 5E8IA 5IP9J 3AG3H 2BHZA 2MH9A 2KFDA 1SVLA 2Z5UA 5IY5H 1XTAA 5E1XA 5EEHA 2A69F 3LSIA 1Z9CA 3CP2A 4XONA 2CW7A 1W4MA 3V7SA 1ON2A 1DGWY 2R7OA 3JRHA 4BUPA 1S5LC 5CKTA 5E3MA 2XPWA 1ETXA 2KHMA 3ZXSA 3EPZA 1FTTA 4D9JA 3BJAA 3GTMJ 4LB6B 3VYSB 1GLNA 2FNAA 4XM3A 1RR7A 2FUG2 3SZTA 4XN0A 1QNTA 4BYYA 4XRSG 3GTKJ 1OCTC 5M5XJ 3N97A 4M3GA 1TWCJ 4WXDA 5HS8A 3PQKA 1APLC 1P7IA 3CF2A 5E3OA 2HDWA 4FHTA 2K4JA 2J5PA 4XL9A 3G1LA 5LBQA 2W57A 2YX7A 4MEXF 2WB1N 3K4NA 2IJLA 1BJAA 2IRFG 4A12A 4E7KA 2K9QA 4XKWA 5DUIA 1P9QC 4ASNA 2DMUA 2NVQJ 4XORA 5FGMA 1FMVA 5K1YA 3A1YA 1BN5A 4D0PA 3P5JA 1G8XA 3OYJA 3DFGA 3QPTA 1AHDP 4FQGA 2WAQN 3I56I 4A0YA 5F64A 3DTEA 5D6EA 2R5ZA 1ZTRA 1WZ2A 1GVDA 1MBEA 3FF5A 3GWZA 4HX7A 1OJLA 3K1NA 2L9SA 5K7ZA 2I8DA 4LFUA 3RYPA 2PMHA 1V55H 1TWGJ 2PG4A 5GAHJ 1R1TA 2UXXA 1STZA 4P55A 4MHGA 1K61A 3OSGA 2LSOA 5FLXK 4UUSB 2Y75A 1E0EA 4M9ZA 2R7SA 2KP6A 2DA7A 3CJTB 4NHJA 2LG4A 2L9VA 3ZN0A 2LF7A 1CF7B 2VKHA 3V8KA 1B8IA 1IXCA 4XBFA 3GTLJ 5CJ9A 4LLLA 1LE8A 1QU3A 1KGSA 3R4KA 2IVMA 2Z99A 3I53A 5D4RA 3OYIA 4ZTFA 2HVSA 4PCQA 3OIOA 3J81K 2JUGA 3VSLA 3M1CA 1KA8A 2E1NA 4CGZA 3K0LA 4BBSJ 3CJNA 5FJ8J 1V5EA 3RTRA 2IEKA 1WWXA 5D5UB 3IV5A 4XKBA 2VJ4A 3OV8A 2K5CA 2HVRA 2Q2EA 2E5ZA 1FX7A 2ZKZA 2XIGA 3IP4B 3LL7A 3S15J 3OYHA 4UVAA 1JHHA 5GPCA 4OIQF 4EJOA 1VI0A 3PNYA 4NUBA 4EATA 3WTUC 4FT8A 4YEJA 3DEWA 1R1UA 1Z3YA 1GUUA 4E7HA 1WI3A 4I76A 2OQRA 2XASA 4II2A 4HNUA 2QBYA 4I98B 1N25A 4F93B 3BCBA 3CUQB 2VT3A 2ZMEC 3H0GJ 3L09A 3DLLF 1J5YA 2VJJA 4HLYA 3HRTA 4LG3A 1X19A 3W6JB 3UNGC 2EWNA 1W7PB 4BL0B 5BPIA 3GZ6A 3HB9A 2DK5A 2DA2A 4S05A 3GTOJ 1FT9A 1XX5A 2VBWA 3HC7A 4WCGA 1R5GA 1YTYA 1DP7P 2IGOA 3EYYA 4PZJA 1R6RA 5FROA 3HSRA 2CW0F 2MABA 1N77A 4EJTA 3DTKA 3L9FA 3NRVA 3N05A 2H6BA 4DZJA 5IP6A 4CCLA 3F3XA 3T8TA 2I10A 1SMYF 3OYGA 1MSFC 4Q4ZF 2CUZA 3J7YJ 3K2ZA 3ASNH 4M74A 5J47A 2FXAA 3SFIA 3J80Z 1W36D 3BZKA 4WXCA 5BNGA 4ANJA 1YITI 4HPQA 1WRJA 4ZZDA 2MLKA 4RB1A 2HFHA 3C7JA 4LK0F 1O3TA 2XAJA 2HR3A 2ZSIB 2EIJH 4L9NA 3DKYA 3HOXJ 1DPUA 1B9NA 3MKZA 2LREA 1K78B 1OCPA 5DM6F 2KISA 4KMFA 4RM3A 5C4XJ 4HQEA 4A3BJ 4B43A 3HRSA 1ZGAA 5FD6A 3PO3J 1PVEA 1FEXA 1X3WB 1SFXA 3PFIA 4FE4A 4FETA 1MBFA 1A04A 3J7AY 4M3DA 2EFQA 2EFNA 2KPMA 3HGGA 2VPRA 3MN2A 1F36A 3Q5FA 1MDMB 1TQPA 5EEGA 2QQAA 2WC2A 3R0AA 3JRIA 1XGSA 3I0TA 1XMXA 1YFHA 1P4XA 3ROUA 4MQ9F 2ME6A 2VQGA 4XKCA 2XV4S 2DMTA 1OCRH 3OSFA 2K86A 1BI3A 3IUOA 2XSDC 4RLQA 4L5JA 2XGEA 3MZHA 1JKQC 3IH2A 4QTRA 1XMAA 3T5XA 1IRZA 2XRNA 5FRMA 2WV1A 2JN6A 1HLVA 3OY9A 3L2UA 1FZPB 4PFOA 5LGNA 2XGCA 2DXIA 1FTZA 1OCOH 3WGIA 4NBQA 3S3OA 4XSXF 1KU3A 4L0ZB 2GQQA 4IHTA 5HNFA 1PP7U 5IP7J 3EUHC 2D1VA 3LSTA 1Z77A 5B5EC 4WX9A 5EG0A 3QU3A 3ZMVA 1F5TA 4C3IJ 3CCYA 1O57A 2DOFA 3W2WA 5HODA 3ABKH 1EKEA 3TEDA 4IOAF 5IYCJ 4HF0A 3BR6A 2BV6A 5DCFA 1AWCA 1S9HA 2FU4A 4A6DA 1M1EB 3LWFA 3BG7A 3PUFA 4KUMA 2ZBKA 4OIRF 4C2MJ 2UV1A 1UHWA 4HV5A 3LQRA 4OINF 1VQ5I 2O61A 1B4AA 2M7BA 1POGA 2KQRA 3A4CA 5L3EA 1NG7A 2F4OB 1MMGA 1Y0UA 2CO5A 2L9NA 3ISPA 5LD2C 2KZVA 2LRDA 1K79A 2QGUA 3BTLA 2MD5A 4HG2A 4NQWB 3JRBA 2FSWA 3L2QA 4HAMA 1QPIA 3FXQA 1O3QA 1SFEA 1IG7A 1ZG3A 2FBKA 4BE1A 3DQVC 1X3UA 3VYRB 1YRNA 1JT6A 5L3BA 1RPWA 4ON0A 2MW8A 2EV5A 3F8NA 2F48A 2RQQA 1TC3C 3TOAA 1B1BA 3V7CA 4U88A 2GXAA 1OMIA 2L7ZA 3OR2C 4X6AJ 5FKLA 2EIMH 1FOYA 2DFIA 2UXNA 3O8HA 1MMSA 1G6NA 3H92A 2ZNZA 1I39A 3OYEA 2HQNA 2M4KA 3S93A 5BOXA 2AO9A 3O3KA 2M2EA 2JT1A 3UR3C 1MGTA 1ON1A 1QZYA 5HS9A 3HUGB 3MQ0A 4LMYA 2HTJA 1ZG5A 1R1VA 2Y0MA 2RKHA 3BOQA 1K4TA 1D3YA 2HKXA 1OISA 3H3ZA 1I6HJ 2W85A 1AKHB 3OL3A 2A3SA 2E7WA 4GO1A 4OIPF 3C3WA 4M6YA 2VODA 5KCMA 3W2VA 2GBYA 4GCVA 3NEUA 5JLWA 1ZARA 1UJ8A 2OA4A 1V5GA 4IF4A 4BXXJ 2XB5A 5JHFA 3CDLA 2DU9A 4IJAA 1X1AA 2AQEA 3MEXA 3J7AO 4AIDA 2V79A 3FDYA 4KICA 3IC7A 2PMUA 1SVOA 3IH4A 3GX4X 3WTTC 1NH3A 1IN7A 3D5RC 4F7ZA 4D5FA 1Y8RB 2FD5A 3E5QA 1MZBA 3HSFA 4BJ6C 3JRGA 5M5WJ 5FKKA 2C6YA 1QO0D 5JI6A 2ZMEB 2XPUA 2EINH 5B3SH 3ONQA 2RDPA 4LITA 3H5AA 4BQQA 1B72A 3ZQFA 2CQQA 1XMKA 3F6OA 1AA7A 1JKRC 4ETSA 1PUFA 3LAPA 3H5RA 3ZR8X 1AKHA 1G3YA 3A0BC 1W36C 4UNOA 1XGMA 2E36A 1FYMA 3I4MJ 3M7GA 5JHUA 3REOA 3RJPA 1ZR4A 3H35A 3FKJA 1X2NA 3FXKA 3D0SA 1ZR2A 1Q1HA 4XR6A 3M4OJ 4RDUA 4D7MA 3FZVA 1UHMA 4H4KC 1MD0A 3QPLA 3WTWC 2NS8A 4N9HA 1K6OA 2CJJA 3KIOA 2KJCA 2WTEA 2R0QC 1TW2A 5ILSA 2WY8Q 3G4SI 2H94A 1MNMC 2KRCA 1BI1A 1VFCA 3CC4I 5CYVA 2V1XA 1A6QA 4Z2YA 4AD9A 4I6ZA 4O3MA 3D5LA 3DP7A 5DUKA 3F23A 3A0HC 2KMUA 2X6WA 2R5YB 4I2OA 3E7LA 3G3ZA 3BTCA 3JSPA 4P96A 1JTXA 4C3HJ 2DBBA 4BGDA 4P1WA 3HOZJ 4PDKA 3I4NJ 1RC9A 2OTJI 3HM5A 4WK8F 4U0VA 3TW7A 3H3VK 2CRGA 2HDDA 4KYWA 4ABZA 2VASA 3PUBA 4IXAA 2CV1A 2Q8KA 4HEA2 3GZNB 2F5VA 1FMWA 1IW7F 1RZ4A 4IX7A 1U8RA 3WTYC 4HX4A 2KL4A 1YJWI 1N78A 3KP5A 4C2TA 3B02A 4L18B 2EQRA 4ZYEA 2CGPA 3Q9SA 3F21A 2X51A 4XLFA 1YYVA 1MH4A 4HZFA 2QQ9A 1T8IA 2VJ5A 3SHFA 3P9KA 2EILH 4XIDA 3DPLC 1PUEE 1USTA 4BE0A 1R36A 3I9V2 5E18F 2P5VA 3DEEA 4KMUX 5F1RA 1XGNA 2E2JJ 4M3FA 5KAIC 2CUEA 1QHGA 2BXZA 3QP5A 3FK6A 3HPGA 2COBA 2COMA 5D5WB 2VOOA 4CZZA 2KDZA 3ZPLA 2TCTA 4U0YA 1IN6A 4FX0A 2HQAA 3GTGJ 4KIGA 2ELJA 4N4NB 1FOXA 2XKPA 4S0HB 3ZQQA 3W6KB 1FLIA 2QA4I 3BR2A 1U0JA 1ZGWA 1VQKI 5LRRA 2HVQA 4TV7A 2HPIA 3VYTB 4JX4A 5GTIC 2ZSHB 3BQZA 1KYZA 4B1RA 1HBXG 1FIPA 4J19A 1J7KA 1RUOA 2GIVA 1FPQA 3RPQA 2ZCWA 4DYQA 2ISZA 2B63J 2L5QA 3BR1A 3HBLA 3OMYA 3S16J 3ELKA 2HKOA 3HOVJ 1X3ZB 2IPQX 1KU9A 3IRQA 1W5CC 2M34A 2L02A 1UG0A 4U7DA 4DQ2A 2AHQA 1FOKA 1MKMA 4XLAA 2CQXA 2G9WA 2V1DA 4A0XA 3WTSC 2XVCA 2M0MA 5J3LA 2CYYA 1R4MB 2VQHA 3PIPF 1R71A 2MC3A 4DIQA 1HSJA 2Y69H 1D1BA 5C4JJ 2ELHA 2ZC2A 2LDUA 1LQ1A 1U9NA 3E5XA 3OIQA 4LK1F 2ETHA 1ENHA 4UB6C 4CDGA 2FOKA 3A01B 4B44A 1NK2P 1I3QJ 3EETA 3GLLA 2OD5A 5F0CA 4ZTJA 3AL0C 3LSMA 1D8KA 1WJFA 2R4GA 3LSJA 3CCMI 4BQNA 1DU6A 3TP0A 2LY1A 1ETVA 2JVHA 3CO6C 1KQ9A 3HOUJ 2E2HJ 4A2UA 2EFOA 2Z2SB 4KISA 3K70D 2Q0OA 4BAYA 1FYKA 5IYDJ 3RQIA 2PFBA 1F1ZA 1Y1VJ 1D1CA 1U5TB 3F8FA 3LA7A 3PNTA 4G6DA 5CVVA 1LB2A 1I1SA 5LRSA 1JKPC 1SD6A 3U1DA 3KETA 2LY2A 4CICA 2KIUA 2E5NA 3WG9A 2E60A 3OYDA 3CESA 3S8PA 5IOZA 2CS3A 2JMWA 1P2FA 1MBJA 1G59A 5F0HA 2OBPA 3ERED 3A01A 1XD7A 2QWWA 3PL8A 3ZMUA 2WB1A 1ZELA 1XSDA 2H8RA 1TNTA 1PP8F 3DBRB 4MO7A 4UUTA 2NVXJ 1BL0A 1BW5A 3OWTA 2V6CA 4PJLA 4G94A 4BJ5C 5FLMJ 1ZRCA 4CCNA 2IGKA 6PAXA 1LFPA 2NOGA 1XPXA 3ZOBA 4Y52J 4O6JA 2DA5A 2A6HF 2O9LA 1Y8QB 3V4GA 3F22A 2WADA 1T08B 2M30A 4R8HA 2WAQA 2Y0SA 2R5ZB 3LSHA 4P9FA 1Y56A 4ZDOA 2NVUB 2K7LA 2XUBA 4JX5A 3W2AA 3BZ6A 3LA3A 1U5TA 1FY7A 4KN7X 4IRIA 2A5WA 2HPMA 4QIWN 1GDTA 3W6VA 3EYIA 4BNCA 2I5UA 3RKYA 3PFYA 4HNTA 2CG4A 3HDDA 2CWEA 2HS5A 4ZYDA 4XOPA 5J1UA 2L7KA 1ZN2A 2R7DA 1BOBA 1BR4A 3AKZA 2H1KA 4ENNA 2RNJA 3E97A 3S3MA 2IP2A 3QP6A 2ZJPF 4J01A 2YSRA 1H8AC 2QKMB 3D1NI 1B8IB 5E8GA 5DYMA 2MA3A 2L7MP 1LE8B 2ECCA 4PJMA 5JVTA 3KFWX 2Y2ZA 3BR0A 4IQ4A 3IH3A 5M5YJ 3WTZA 2Y0SN 2LKPA 2AS5F 5A2QZ 2KRFA 5EGOA 2QSHX 3K6GA 4WXHA 4ITVA 5KAFC 4G12A 1C0WA 2O3FA 4OOIA 1ZRFA 3CCVI 4KJZA 4RB3C 2PMZN 3Q3SA 4JYKA 1G3WA 4NB5A 2CUJA 2VIXA 1MMDA 1U78A 2Q2EB 4Q5SF 1MH3A 4A3CJ 2DDBA 3CQZJ 4RMNA 1KYWA 1YLFA 2OV7A 4AVPA 2D1HA 2OJED 3VEPA 4C9YA 1EV7A 3KP3A 4MIMA 2R7QA 5L3DA 2FMLA 1YJNI 1XDUA 2QBYB 2GXBA 4YIRX 4M3EA 2LBFA 2M7AA 1BW6A 1OYIA 2IXSA 1FSHA 4BS9A 3CCJI 1IDZA 1AU7A 4XRSA 4A93J 2TDXA 5E1WA 3CLQA 3OYMA 2LMDA 5ERIA 1HXDA 3S1RJ 4I0AA 4WWCA 1UFMA 4RS8A 3C1DA 3VB2A 4PJJA 4D7NA 3MFKA 4G7ZF 3OL4A 3GF2A 2Y31A 4NC6A 4MTDA 1XGOA 2FBHA 3L2RA 3MKWB 3L2VA 1P4AA 4YRVA 2WBMA 2O5RA 2OAZA 4CHUA 3GMEA 3ECHA 5J8FA 5F1JA 3MMYB 4XKVA 2UZKA 2MBFA 1TBXA 3K10A 1W5SA 3F8CA 4MLOA 1I3AA 1KQ0A 2L9RA 4DBQA 2LK2A 4L9VA 1J59A 1ZYRF 1O3SA 2CV0A 2GM4A 4KIBA 2GIZA 3GFMA 5B66C 4A3MJ 2EBIA 4WF2A 4BQOA 2N8GA 3HOSA 2LC2A 3ML6A 3FHZA 1Z6RA 2VBZA 3KYDB 4XRMA 3S1QJ 4CCOA 4LOCA 4BY7J 1R4NB 4L9JA 1SC7A 4RAYA 1HW2A 4B3AA 5DD8A 1VQ6I 3CCQI 1LVAA 3BDDA 2QM3A 4M6XA 3BCAA 2PBIA 1WJ5A 2BE5F 4F92B 3MCZA 1ETOA 3AG1H 3HKZA 1LUJB 2QENA 4BH9A 3GUDA 3FMRA 3JRDA 4GYIA 2YU3A 4XICA 4IHSA 3M9AA 3M07A 3FX3A 4FASD 5IOYA 3SFZA 3ZQHA 3VDXA 5EDNA 1LDKB 3B73A 3QYEA 4V2FA 3CMMA 1JUPA 2P7VB 3BLYA 3BQYA 3R61A 1DDNA 2JA7J 4AU7A 2Q1ZB 4LG0A 1TNSA 3ABUA 3HOWJ 4A3LJ 3FXMA 3HSEA 1TQMA 2R7TA 3HHGA 1JJ6C 2RVCA 3BC8A 2FJ1A 3OYFA 3K70C 2F2EA 2L0KA 1WJAA 1LKXA 1LFBA 3RSNA 2JVGA 1VQ4I 2GWRA 1EH6A 1O4XA 4IRHA 3AL0B 1A5JA 4NDLA 2X85A 3C2HA 1MIJA 3ZGKA 3I4PA 4KN4X 1IAWA 3HKZN 3U9GA 3JRCA 3BP8A 2IA1A 1U2WA 2KRHA 1FOWA 2P8TA 3J7ZI 1HW1A 2CUFA 4A3IJ 2H27A 2PLYA 3H9GA 2L01A 5IYBJ 4FTHA 1R22A 3MVPA 2V1UA 3M3YJ 2DO7A 4OMZA 5EG0B 4B4CA 2CW8A 3G1OA 1VF9A 2GA2A 3HZJA 1TWHJ 2EV6A 5LHHA 1IF1A 2EA4A 2KDOA 5IPAA 3WGGA 2RGVA 3JTGA 2A07F 3JREA 4XLNF 2HDCA 3QQAA 5F27A 2HEOA 4BEHA 3GFJA 2VI6A 3CC2I 1G3SA 2XGDA 4UHTA 5M3MJ 1KONA 1S3JA 4A3DJ 1XCBA 3KZZA 1QRYA 2EIKH 4LLNA 4UY8I 3PSIA 3P9CA 3CUOA 3QWLA 4Y3OA 1SANA 4RB0A 2IGMA 3VFZA 2FF4A 1UELB 2F5DA 4RGSA 1UAAA 2JSCA 2DPDA 2MC4A 5D8KB 2NOJB 3BROA 4XLCA 5FKNA 4DJAA 2MGQA 2HXOA 4YFKF 2VOPA 1T38A 2P4WA 1YRNB 3L00A 3CJRB 2VKDA 2E7XA 5F04A 2O03A 5F08A 1W1WE 4PSWA 3WU2C 2HWVA 2VC0A 1SFOJ 2K85A 2L2OA 3KP2A 4EVIA 2G0EA 1U6GA 1ZK8A 3KP4A 1R00A 3C2GA 3HTSB 4L5IA 5D8LB 5BS6A 2LYCA 4UB8C 4BXFA 3RKQA 3GCMA 2FMYA 1GXQA 3Q0WA 3DV8A 2WAEA 3B6AA 2GLOA 4AYBA 3ZQLA 5EF6A 4RM2A 4Y33A 2OQGA 4UV8A 4LJZF 1TQIA 4AIHA 3OR1C 3EQLF 1T56A 1EH7A 1WI9A 1A36A 2ZO4A 1KU7A 1SD7A 4JBAA 2R7WA 3TQNA 2X9DA 3DPUA 1TT5B 4BDZA 1E3OC 2V9VA 4GXOA 1YJ9I 2DA1A 1F4KA 1BOAA 4W1UA 1TLHB 2JSPA 1ACIA 2JUCA 4A3JJ 5LHGA 2JA2A 1ITYA 2OC6A 4C30A 5KK1A 5J4YA 4LB5A 4OIOF 3KP7A 3OYBA 3U1KA 1WQ2A 3ZMSA 4J00A 1YS6A 4IOCF 4MGRA 2DLLA 2DMQA 5DTDA 2A6TA 2Z33A 2H6CA 1FJLA 4AYBN 3CC7I 4AVZA 1OLTA 3BG9A 4N9IA 1IO2A 1T0FA
chains in the Genus database with same CATH topology
2ZJ2A 2JPBA 5IT9K 4HA8A 1LEAA 3TO7A 3WTXC 3SZPA 2CSOA 2PEXA 3ZMTA 2BGCA 1B6AA 1J75A 1U5TC 3R60A 3IKVA 2IA0A 3ABTA 3IL2A 1OYWA 1YIOA 5H6RA 3MWMA 2HYFA 4RGUA 2ZNYA 1J9IA 1L3LA 1OR7A 4A6EA 3IHUA 5K5RA 3DF8A 4Q48A 2IT0A 1QPMA 5ICFA 5L3FA 4ESBA 5D5VB 5LEJA 3JSOA 1NHAA 1ZREA 5HS7A 4AIJA 3KLOA 1T6SA 3NQOA 2D45A 3BWGA 5K5OA 3QOPA 4Y17A 3GXOA 3LFKA 1D8JA 2A68F 5HDKA 2DW4A 2NYXA 4QWQA 1ZLKA 4QLCU 3KZYA 1XCVA 4M72A 2HYGD 1IXRC 4BHPA 5H20A 2CFXA 3RDIA 4HDUA 3DPTA 4KDPA 3Q9VA 3ECOA 3TOBA 3FWEA 4B09A 4JQFA 1LDDA 4HLXA 1O7FA 4HF2A 2JTVA 5FFZA 3H3UA 4P5OA 5DCMA 3QU6A 4M9XA 3FXUA 2VT2A 4ZYHA 1LJ9A 3I59A 4MEYF 3QRFF 2O6GE 2ESHA 2ZFWA 5DEQA 3L2CA 1R23A 3WTVC 4M9SA 4P9UA 1Z7UA 2ACJA 1HKTA 2G7HA 2EV0A 2BYVE 2KKOA 3BJ6A 1VTNC 5J8CA 2D2WA 3IWZA 4CXFA 1R5HA 1ULYA 5HVQC 3HRUA 1CGPA 5FFXA 1XSXA 1FP1D 1MJBA 1E17A 5HLHA 3T1BA 5HLGA 3K9TA 3GVAA 5L3CA 1FP2A 4ESJA 4FX4A 1V4RA 4IRGA 1I1GA 5D5XB 2NNNA 5CVJA 4UV9A 2HQRA 1YW9A 5ED4A 2HTSA 2NS0A 4EM2A 4MNUA 1USSA 1REPC 3OOPA 2P5LC 4ZZLA 2W84A 5LLQA 2W24A 1LEBA 4BXUA 2EB7A 2KIMA 2E1CA 3R0JA 4EM0B 1OPCA 5ICGA 3K1MA 2L4MA 4YIFA 3VOEA 2PJPA 1FC3A 1ZAOA 4UUVA 2RV8A 1YS7A 2L54A 2FA5A 4G6QA 1IXSB 3FMSA 5FLXZ 2VC1A 3IRRA 1KU2A 1HQCA 5BQTA 3RKWA 3E6BA 4M73A 3IKTA 4JK1X 4HX8A 2PN6A 3DXJF 3T0YA 2M87A 4YG2F 4AWXB 1J2XA 3HOTA 3FMQA 3U2RA 2K4BA 4RAZA 3J81Z 1G4DA 1H9GA 2GXGA 4YFXF 4G9YA 1OYYA 3JTHA 4KNYA 4I7HA 2X0LA 3V8LA 3E5UA 3WE3A 5D4SA 4GYGA 2XAFA 1JGSA 4HBLA 2XGXA 4OU0A 4XSZF 5ILVA 2VXZA 2VBYA 3GFLA 1Z05A 4I09A 1GXPA 4UVCA 1LNWA 4AIKA 3MAJA 2L3DA 2EJRA 4ENKA 3ZMZA 1BIAA 2XAGA 4CO8A 1ZHFA 2P6TA 4EMSA 5AONA 1Z1DA 2PQ8A 3QPHA 5IT3A 2W25A 4Q47A 3RPUA 3V8JA 2NNYA 4EQQA 2DQRA 3I64A 1IRFA 3F6VA 1FYLA 3M8EA 4BHBA 2F5FA 2M5WA 2YPRA 3FM3A 1IN5A 3WU0A 3CO7C 4DNCA 1GVJA 1P6RA 1T98A 5CLSA 3FXRA 1UB9A 4U0WA 2VN2A 3KCCA 1K7AA 3CDHA 3WU1B 4GGGA 4A0ZA 3I71A 2JRTA 3SQNA 1SFUA 1HKQA 4HYEA 4R79A 2YX4A 1R58A 4ESFA 5AIPA 2M45A 2K02A 3E6MA 1AOYA 4G7OF 1FBUA 3GLXA 1U3EM 2OZUA 4LD5A 3KLNA 4UVBA 1FWZA 2A61A 3TKYA 2XAHA 3WODF 3I5UA 3DEUA 4KT5C 5ICCA 3JAMK 1DPRA 2DT5A 1ZGJA 4L0YB 2RN7A 5DD4A 4ZH4F 1J0RA 4LG0B 4YIIA 4H0EA 2K27A 1FBQA 2MLGA 1YW8A 3HYIA 4MQVA 1LDJA 3RIRA 3KEOA 3ZN1A 1FSEA 1BC7C 2P5KA 2QZ8A 1I5ZA 2MH2A 2P7CB 5E1ZB 2AXLA 3RI4A 1CF7A 5KVRA 2JZYA 2Z3YA 4EJVA 4KIFA 3PQJA 2WWYA 2R3SA 3HIFA 2WV0A 3E6CC 5HLIA 3LQQA 3GFIA 3KP6A 2J5OA 3R6SA 5ICEA 3COAC 5CVUA 2ISYA 1YO5C 3VODA 4EV0A 3I58A 2VBXA 4IPAA 3G73A 5HDNA 1ODDA 2IA2A 3EDPA 3KE2A 4M71A 1MJAA 4HW0A 2UWMA 4PGHA 2Y48A 2RC4A 4HF1A 4RGXA 3CUQA 1S8NA 3O6BB 5A2QK 3F72A 3IWFA 2XAQA 4KA4A 2QQBA 5IT9Z 3HRMA 1BBYA 1W7PA 1JXSA 1QBJA 4OMYA 4EJWA 1W5TA 1SAXA 1DUXC 2O0YA 1R7JA 4HQMA 1WKMA 2XKOA 5ILUA 2GAUA 2DPUA 4EM1A 2JPCA 2EFPA 2VE9A 2DQLA 3GW2A 2XROA 5E20A 3P9IA 1S6LA 1ZLJA 2H09A 2FQ3A 3BPVA 5F6FA 1TTYA 1O3RA 2EK5A 4RGRA 2QUFA 1K78A 1T39A 3CTAA 1JE8A 3SXYA 1O7LA 2OU2A 2STWA 1E2XA 4HOBA 5K5QA 4K2EA 1B59A 2DAOA 2M8EA 3GEZA 3TDUC 1MDMA 2GZWA 2FBIA 1ZG1A 5TRDA 3DKWA 3K69A 3KEQA 2KIFA 4I02A 5E17F 4ZYGA 1P92A 1WSUA 5LHIA 4YFNF 1W7PD 3TGNA 3J80K 4KFCA 3L7WA 2FE3A 3ZQ7A 1HW5A 1QZZA 4HV6A 2Z9OA 5L3GA 4Y13A 1L0OC 3F8BA 2A5YB 1XSVA 3WGHA 5FB2A 1RIOH 3GYHX 3HTUA 1I6XA 2FRHA 1BI0A 2R7FA 3GO5A 2FEZA 2X4HA 1IN4A 1HSTA 2L4AA 5CVRA 4NQWA 3P7NA 4G8XA 3HHHA 5LGTA 2DTRA 3WE2A 3T8RA 3GZ5A 3FM5A 3LA2A 5J6XA 3E3VA 4XRFA 1IUYA 1ONVA 2B0LA 2GA1A 4U7BA 4MTEA 5LEKA 4LLGF 3TO9A 1HKSA 2YR2A 5DCMB 4EJUA 1BC8C 4ENMA 2LNBA 1XN7A 4XLPF 5LGUA 5FO5A 4I0BA 2DK8A 3HUGA 2STTA 3I59B 4N0BA 1OKRA 1S7OA 3LAJA 5TJJA 3ZP5A 1PDNC 3RKXA 4E70A 1EH8A 2OZ6A 1Z6TA 2BEOA 2QLZA 2O8XA 1IN8A 4R1HA 1BI2A 1SD4A 5BPDA 1IRGA 2P6SA 5FD5A 2F5CA 1FBSA 2ZMEA 4B8XA 3K1PA 1RNLA 3BJOA 3BY6A 4IVNA 5BMZA 2XHKA 2RQPA 1T2KA 4A5NA 4ENJA 4O5VA 1ZRDA 5JFRA 4RB2C 4HDVA 1Z91A 5CVIA 1D5VA 1BM9A 3S2WA 1SMTA 1MJ9A 2IW5A 3MZYA 1TW3A 3TDZC 3RYRA 1S7AA 2QYOA 3C18A 4S04A 3AAFA 4BQAA 2CQKA 1P4WA 1QQIA 1YG2A 4Y15A 1H0MA 2M1BA 2KJBA 2LF8A 5D6FA 1IZ1A 1RI7A 1GHCA 1G3TA 3N4MA 1FNNA 4A5MA 1JHFA 4L9TA 2PI0A 3CUQC 1SD5A 4PGGA 1KQ8A 3ULQB 2ESNA 5DV5A 1QGPA 1ZH5A 3TO6A 3M8FA 4EGYA 2EFWA 1YW7A 1F9NA 1UCRA 1V3FA 4G7HF 4CYDA 5JR3A 3O2PE 2NRAC 2NAZA 1RUNA 2ZXJA 3EUHA 1H9TA 2FNPA 3E6DA 1XDSA 3QAHA 2ADUA 5HOOA 4UXNA 5AIQA 5H6QA 2A6EF 4LGWA 2F5EA 1B9MA 3BPXA 2VE8A 4EGZA 1S29A 3I54A 2EA2A 1I27A 4BHCA 2G7UA 3CLOA 1BIBA 3M1EA 2HOEA 2QVOA 3ZMDA 4I01A 2VONA 5DDGA 3F8MA 3JAMZ 5HDGA 2HZTA 2BBYA 2DI3A 1XB4A 2HGCA 3JW4A 3V7RA 1YQAA 5E8IA 2MH9A 2Z5UA 5E1XA 5EEHA 2A69F 1Z9CA 1W4MA 3V7SA 1ON2A 3BJAA 4LB6B 2FNAA 3SZTA 1QNTA 4BYYA 3N97A 4WXDA 5HS8A 3PQKA 4FHTA 2K4JA 2J5PA 5LBQA 2W57A 2YX7A 4MEXF 2IJLA 1BJAA 2IRFG 4A12A 5DUIA 4ASNA 5FGMA 5K1YA 1BN5A 4D0PA 3DFGA 3QPTA 4A0YA 5F64A 5D6EA 3FF5A 3GWZA 4HX7A 3K1NA 4LFUA 3RYPA 2PMHA 2PG4A 1R1TA 2UXXA 4P55A 4MHGA 2LSOA 5FLXK 2Y75A 4M9ZA 4NHJA 3ZN0A 2LF7A 1CF7B 3V8KA 1IXCA 4XBFA 5CJ9A 4LLLA 1KGSA 3R4KA 2IVMA 2Z99A 3I53A 5D4RA 4PCQA 3J81K 1KA8A 2E1NA 4CGZA 3K0LA 3CJNA 3RTRA 5D5UB 1WWXA 3OV8A 2Q2EA 1FX7A 2ZKZA 2XIGA 4UVAA 1JHHA 4OIQF 4EJOA 3WTUC 4FT8A 1R1UA 2OQRA 2XASA 2QBYA 4I98B 3CUQB 2VT3A 3L09A 1J5YA 4HLYA 3HRTA 3W6JB 2EWNA 1W7PB 5BPIA 3GZ6A 2DK5A 4S05A 1FT9A 2VBWA 4WCGA 1R5GA 1YTYA 1DP7P 3EYYA 4PZJA 3HSRA 2CW0F 4EJTA 3L9FA 3NRVA 2H6BA 3F3XA 3T8TA 1SMYF 4Q4ZF 3K2ZA 4M74A 2FXAA 3J80Z 4WXCA 1WRJA 4ZZDA 2MLKA 4RB1A 2HFHA 3C7JA 4LK0F 1O3TA 2XAJA 2HR3A 4L9NA 1DPUA 1B9NA 1K78B 4KMFA 4HQEA 3HRSA 1ZGAA 5FD6A 1SFXA 3PFIA 1A04A 2EFQA 2EFNA 3Q5FA 1MDMB 1TQPA 5EEGA 2QQAA 2WC2A 3R0AA 1XGSA 3I0TA 1YFHA 1P4XA 3ROUA 4MQ9F 2XV4S 2K86A 1BI3A 4L5JA 3MZHA 1XMAA 3T5XA 2XRNA 1FZPB 5LGNA 3WGIA 4L0ZB 4XSXF 1KU3A 2GQQA 4IHTA 1PP7U 2D1VA 3LSTA 4WX9A 3QU3A 3ZMVA 1F5TA 1O57A 4HF0A 2BV6A 5DCFA 1AWCA 2FU4A 4A6DA 3LWFA 4KUMA 2ZBKA 4OIRF 4HV5A 1UHWA 4OINF 3LQRA 2O61A 1B4AA 5L3EA 1Y0UA 2CO5A 3ISPA 1K79A 2MD5A 2FSWA 4HAMA 3FXQA 1O3QA 1SFEA 1ZG3A 2FBKA 3DQVC 1X3UA 5L3BA 4ON0A 2EV5A 3F8NA 3TOAA 1B1BA 3V7CA 4U88A 1OMIA 2UXNA 2DFIA 1G6NA 3H92A 2ZNZA 2HQNA 5BOXA 3O3KA 2JT1A 1MGTA 1ON1A 1QZYA 5HS9A 3MQ0A 4LMYA 2HTJA 1ZG5A 1R1VA 2Y0MA 2RKHA 3BOQA 1D3YA 2HKXA 3H3ZA 2W85A 2A3SA 2E7WA 4GO1A 4OIPF 3C3WA 4M6YA 2VODA 4GCVA 3NEUA 1ZARA 2OA4A 4IF4A 2DU9A 4IJAA 3MEXA 3J7AO 2V79A 4KICA 3IC7A 2PMUA 3GX4X 3WTTC 1IN7A 4F7ZA 3E5QA 1MZBA 3HSFA 2C6YA 1QO0D 5JI6A 2ZMEB 2RDPA 3F6OA 1XMKA 4ETSA 3LAPA 1G3YA 4UNOA 1XGMA 1FYMA 3M7GA 5JHUA 3REOA 3RJPA 3D0SA 1Q1HA 3FZVA 1UHMA 1MD0A 3WTWC 4N9HA 1K6OA 2KJCA 2WTEA 1TW2A 5ILSA 2H94A 1BI1A 5CYVA 2V1XA 4Z2YA 4AD9A 4O3MA 3D5LA 3DP7A 5DUKA 3F23A 4I2OA 3G3ZA 3JSPA 4P96A 2DBBA 4PDKA 4WK8F 4U0VA 4KYWA 4IXAA 2Q8KA 1IW7F 1RZ4A 1U8RA 3WTYC 4HX4A 3KP5A 3B02A 4L18B 4ZYEA 2CGPA 3Q9SA 3F21A 1YYVA 4HZFA 2QQ9A 3SHFA 3P9KA 3DPLC 1PUEE 1USTA 1R36A 5E18F 2P5VA 4KMUX 5F1RA 1XGNA 3QP5A 2COMA 5D5WB 2VOOA 4CZZA 3ZPLA 4U0YA 1IN6A 4FX0A 4KIGA 2XKPA 3W6KB 1FLIA 5LRRA 4TV7A 1KYZA 1HBXG 1J7KA 1RUOA 2GIVA 1FPQA 3RPQA 2ZCWA 2ISZA 3ELKA 2HKOA 2IPQX 1KU9A 3IRQA 2L02A 4U7DA 4DQ2A 1FOKA 1MKMA 2G9WA 2V1DA 4A0XA 3WTSC 2XVCA 2CYYA 2MC3A 1HSJA 2ELHA 2LDUA 1LQ1A 3E5XA 4LK1F 2ETHA 4CDGA 2FOKA 3EETA 2OD5A 1D8KA 3CO6C 1KQ9A 4A2UA 2EFOA 2Q0OA 4BAYA 1FYKA 2PFBA 1F1ZA 5CVVA 1U5TB 3F8FA 3LA7A 4G6DA 1LB2A 1I1SA 5LRSA 1SD6A 3U1DA 3KETA 4CICA 2KIUA 3WG9A 1P2FA 2OBPA 3ERED 1XD7A 2QWWA 3ZMUA 1XSDA 1TNTA 1PP8F 2V6CA 4G94A 1ZRCA 6PAXA 4O6JA 2A6HF 3V4GA 3F22A 2M30A 4R8HA 4P9FA 2K7LA 2XUBA 3BZ6A 3LA3A 1U5TA 1FY7A 4KN7X 4IRIA 3EYIA 4BNCA 3RKYA 2CG4A 2CWEA 2HS5A 4ZYDA 1ZN2A 2R7DA 4ENNA 2RNJA 3E97A 1T0FA 2IP2A 3QP6A 2YSRA 5E8GA 5DYMA 2MA3A 5JVTA 3KFWX 3WTZA 2LKPA 2AS5F 5A2QZ 2KRFA 4WXHA 1C0WA 2O3FA 4OOIA 1ZRFA 4RB3C 4NB5A 1G3WA 1U78A 4Q5SF 1KYWA 1YLFA 4AVPA 2D1HA 3VEPA 1EV7A 3KP3A 5L3DA 2FMLA 1XDUA 2QBYB 2GXBA 1OYIA 1FSHA 2TDXA 5E1WA 5ERIA 1HXDA 4I0AA 4WWCA 1UFMA 4RS8A 3C1DA 3VB2A 4G7ZF 3MFKA 3GF2A 4MTDA 1XGOA 2FBHA 1P4AA 2OAZA 4CHUA 3ECHA 5J8FA 2UZKA 2MBFA 1TBXA 1W5SA 3F8CA 1KQ0A 4L9VA 1J59A 1ZYRF 1O3SA 4KIBA 3GFMA 4WF2A 3HOSA 3FHZA 3ML6A 1Z6RA 2VBZA 4L9JA 4RAYA 1HW2A 5DD8A 1LVAA 3BDDA 2QM3A 4M6XA 2PBIA 2BE5F 3MCZA 2QENA 4BH9A 3GUDA 3FMRA 4GYIA 2YU3A 4IHSA 3M9AA 3FX3A 3SFZA 1LDKB 3B73A 3R61A 1DDNA 2P7VB 4LG0A 1TNSA 3ABUA 3HSEA 1TQMA 3HHGA 2RVCA 2F2EA 2GWRA 1EH6A 4IRHA 3I4PA 4KN4X 1IAWA 3U9GA 3BP8A 2IA1A 1U2WA 2P8TA 1HW1A 2H27A 2PLYA 2L01A 1R22A 2V1UA 2DO7A 4OMZA 2GA2A 2EV6A 5LHHA 1IF1A 2EA4A 3WGGA 2RGVA 3JTGA 2A07F 4XLNF 2HDCA 2HEOA 3GFJA 1G3SA 4UHTA 1S3JA 1XCBA 3KZZA 4LLNA 3P9CA 3CUOA 4RB0A 3VFZA 2FF4A 2F5DA 4RGSA 2JSCA 2DPDA 5D8KB 3BROA 4YFKF 2VOPA 1T38A 2P4WA 3L00A 2E7XA 2O03A 2HWVA 2VC0A 4EVIA 3KP2A 1U6GA 3KP4A 1R00A 3HTSB 4L5IA 5D8LB 5BS6A 2FMYA 1GXQA 3DV8A 2OQGA 4UV8A 4LJZF 1TQIA 4AIHA 3EQLF 1EH7A 1WI9A 2ZO4A 1KU7A 1SD7A 4JBAA 3TQNA 2V9VA 4GXOA 1F4KA 1BOAA 1TLHB 5LHGA 5KK1A 4LB5A 4OIOF 3KP7A 1WQ2A 3ZMSA 1YS6A 4MGRA 2DLLA 2Z33A 2H6CA 4N9IA 1STZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJ2 A;  2JPB A;  5IT9 K;  4HA8 A;  1LEA A;  3TO7 A;  3WTX C;  3SZP A;  2CSO A;  2PEX A;  3ZMT A;  2BGC A;  1B6A A;  1J75 A;  1U5T C;  3R60 A;  3IKV A;  2IA0 A;  3ABT A;  3IL2 A;  1OYW A;  1YIO A;  5H6R A;  3MWM A;  2HYF A;  4RGU A;  2ZNY A;  1J9I A;  1L3L A;  1OR7 A;  4A6E A;  3IHU A;  5K5R A;  3DF8 A;  4Q48 A;  2IT0 A;  1QPM A;  5ICF A;  5L3F A;  4ESB A;  5D5V B;  5LEJ A;  3JSO A;  1NHA A;  1ZRE A;  5HS7 A;  4AIJ A;  3KLO A;  1T6S A;  3NQO A;  2D45 A;  3BWG A;  5K5O A;  3QOP A;  4Y17 A;  3GXO A;  3LFK A;  1D8J A;  2A68 F;  5HDK A;  2DW4 A;  2NYX A;  4QWQ A;  1ZLK A;  4QLC U;  3KZY A;  1XCV A;  4M72 A;  2HYG D;  1IXR C;  4BHP A;  5H20 A;  2CFX A;  3RDI A;  4HDU A;  3DPT A;  4KDP A;  3Q9V A;  3ECO A;  3TOB A;  3FWE A;  4B09 A;  4JQF A;  1LDD A;  4HLX A;  1O7F A;  4HF2 A;  2JTV A;  5FFZ A;  3H3U A;  4P5O A;  5DCM A;  3QU6 A;  4M9X A;  3FXU A;  2VT2 A;  4ZYH A;  1LJ9 A;  3I59 A;  4MEY F;  3QRF F;  2O6G E;  2ESH A;  2ZFW A;  5DEQ A;  3L2C A;  1R23 A;  3WTV C;  4M9S A;  4P9U A;  1Z7U A;  2ACJ A;  1HKT A;  2G7H A;  2EV0 A;  2BYV E;  2KKO A;  3BJ6 A;  1VTN C;  5J8C A;  2D2W A;  3IWZ A;  4CXF A;  1R5H A;  1ULY A;  5HVQ C;  3HRU A;  1CGP A;  5FFX A;  1XSX A;  1FP1 D;  1MJB A;  1E17 A;  5HLH A;  3T1B A;  5HLG A;  3K9T A;  3GVA A;  5L3C A;  1FP2 A;  4ESJ A;  4FX4 A;  1V4R A;  4IRG A;  1I1G A;  5D5X B;  2NNN A;  5CVJ A;  4UV9 A;  2HQR A;  1YW9 A;  5ED4 A;  2HTS A;  2NS0 A;  4EM2 A;  4MNU A;  1USS A;  1REP C;  3OOP A;  2P5L C;  4ZZL A;  2W84 A;  5LLQ A;  2W24 A;  1LEB A;  4BXU A;  2EB7 A;  2KIM A;  2E1C A;  3R0J A;  4EM0 B;  1OPC A;  5ICG A;  3K1M A;  2L4M A;  4YIF A;  3VOE A;  2PJP A;  1FC3 A;  1ZAO A;  4UUV A;  2RV8 A;  1YS7 A;  2L54 A;  2FA5 A;  4G6Q A;  1IXS B;  3FMS A;  5FLX Z;  2VC1 A;  3IRR A;  1KU2 A;  1HQC A;  5BQT A;  3RKW A;  3E6B A;  4M73 A;  3IKT A;  4JK1 X;  4HX8 A;  2PN6 A;  3DXJ F;  3T0Y A;  2M87 A;  4YG2 F;  4AWX B;  1J2X A;  3HOT A;  3FMQ A;  3U2R A;  2K4B A;  4RAZ A;  3J81 Z;  1G4D A;  1H9G A;  2GXG A;  4YFX F;  4G9Y A;  1OYY A;  3JTH A;  4KNY A;  4I7H A;  2X0L A;  3V8L A;  3E5U A;  3WE3 A;  5D4S A;  4GYG A;  2XAF A;  1JGS A;  4HBL A;  2XGX A;  4OU0 A;  4XSZ F;  5ILV A;  2VXZ A;  2VBY A;  3GFL A;  1Z05 A;  4I09 A;  1GXP A;  4UVC A;  1LNW A;  4AIK A;  3MAJ A;  2L3D A;  2EJR A;  4ENK A;  3ZMZ A;  1BIA A;  2XAG A;  4CO8 A;  1ZHF A;  2P6T A;  4EMS A;  5AON A;  1Z1D A;  2PQ8 A;  3QPH A;  5IT3 A;  2W25 A;  4Q47 A;  3RPU A;  3V8J A;  2NNY A;  4EQQ A;  2DQR A;  3I64 A;  1IRF A;  3F6V A;  1FYL A;  3M8E A;  4BHB A;  2F5F A;  2M5W A;  2YPR A;  3FM3 A;  1IN5 A;  3WU0 A;  3CO7 C;  4DNC A;  1GVJ A;  1P6R A;  1T98 A;  5CLS A;  3FXR A;  1UB9 A;  4U0W A;  2VN2 A;  3KCC A;  1K7A A;  3CDH A;  3WU1 B;  4GGG A;  4A0Z A;  3I71 A;  2JRT A;  3SQN A;  1SFU A;  1HKQ A;  4HYE A;  4R79 A;  2YX4 A;  1R58 A;  4ESF A;  5AIP A;  2M45 A;  2K02 A;  3E6M A;  1AOY A;  4G7O F;  1FBU A;  3GLX A;  1U3E M;  2OZU A;  4LD5 A;  3KLN A;  4UVB A;  1FWZ A;  2A61 A;  3TKY A;  2XAH A;  3WOD F;  3I5U A;  3DEU A;  4KT5 C;  5ICC A;  3JAM K;  1DPR A;  2DT5 A;  1ZGJ A;  4L0Y B;  2RN7 A;  5DD4 A;  4ZH4 F;  1J0R A;  4LG0 B;  4YII A;  4H0E A;  2K27 A;  1FBQ A;  2MLG A;  1YW8 A;  3HYI A;  4MQV A;  1LDJ A;  3RIR A;  3KEO A;  3ZN1 A;  1FSE A;  1BC7 C;  2P5K A;  2QZ8 A;  1I5Z A;  2MH2 A;  2P7C B;  5E1Z B;  2AXL A;  3RI4 A;  1CF7 A;  5KVR A;  2JZY A;  2Z3Y A;  4EJV A;  4KIF A;  3PQJ A;  2WWY A;  2R3S A;  3HIF A;  2WV0 A;  3E6C C;  5HLI A;  3LQQ A;  3GFI A;  3KP6 A;  2J5O A;  3R6S A;  5ICE A;  3COA C;  5CVU A;  2ISY A;  1YO5 C;  3VOD A;  4EV0 A;  3I58 A;  2VBX A;  4IPA A;  3G73 A;  5HDN A;  1ODD A;  2IA2 A;  3EDP A;  3KE2 A;  4M71 A;  1MJA A;  4HW0 A;  2UWM A;  4PGH A;  2Y48 A;  2RC4 A;  4HF1 A;  4RGX A;  3CUQ A;  1S8N A;  3O6B B;  5A2Q K;  3F72 A;  3IWF A;  2XAQ A;  4KA4 A;  2QQB A;  5IT9 Z;  3HRM A;  1BBY A;  1W7P A;  1JXS A;  1QBJ A;  4OMY A;  4EJW A;  1W5T A;  1SAX A;  1DUX C;  2O0Y A;  1R7J A;  4HQM A;  1WKM A;  2XKO A;  5ILU A;  2GAU A;  2DPU A;  4EM1 A;  2JPC A;  2EFP A;  2VE9 A;  2DQL A;  3GW2 A;  2XRO A;  5E20 A;  3P9I A;  1S6L A;  1ZLJ A;  2H09 A;  2FQ3 A;  3BPV A;  5F6F A;  1TTY A;  1O3R A;  2EK5 A;  4RGR A;  2QUF A;  1K78 A;  1T39 A;  3CTA A;  1JE8 A;  3SXY A;  1O7L A;  2OU2 A;  2STW A;  1E2X A;  4HOB A;  5K5Q A;  4K2E A;  1B59 A;  2DAO A;  2M8E A;  3GEZ A;  3TDU C;  1MDM A;  2GZW A;  2FBI A;  1ZG1 A;  5TRD A;  3DKW A;  3K69 A;  3KEQ A;  2KIF A;  4I02 A;  5E17 F;  4ZYG A;  1P92 A;  1WSU A;  5LHI A;  4YFN F;  1W7P D;  3TGN A;  3J80 K;  4KFC A;  3L7W A;  2FE3 A;  3ZQ7 A;  1HW5 A;  1QZZ A;  4HV6 A;  2Z9O A;  5L3G A;  4Y13 A;  1L0O C;  3F8B A;  2A5Y B;  1XSV A;  3WGH A;  5FB2 A;  1RIO H;  3GYH X;  3HTU A;  1I6X A;  2FRH A;  1BI0 A;  2R7F A;  3GO5 A;  2FEZ A;  2X4H A;  1IN4 A;  1HST A;  2L4A A;  5CVR A;  4NQW A;  3P7N A;  4G8X A;  3HHH A;  5LGT A;  2DTR A;  3WE2 A;  3T8R A;  3GZ5 A;  3FM5 A;  3LA2 A;  5J6X A;  3E3V A;  4XRF A;  1IUY A;  1ONV A;  2B0L A;  2GA1 A;  4U7B A;  4MTE A;  5LEK A;  4LLG F;  3TO9 A;  1HKS A;  2YR2 A;  5DCM B;  4EJU A;  1BC8 C;  4ENM A;  2LNB A;  1XN7 A;  4XLP F;  5LGU A;  5FO5 A;  4I0B A;  2DK8 A;  3HUG A;  2STT A;  3I59 B;  4N0B A;  1OKR A;  1S7O A;  3LAJ A;  5TJJ A;  3ZP5 A;  1PDN C;  3RKX A;  4E70 A;  1EH8 A;  2OZ6 A;  1Z6T A;  2BEO A;  2QLZ A;  2O8X A;  1IN8 A;  4R1H A;  1BI2 A;  1SD4 A;  5BPD A;  1IRG A;  2P6S A;  5FD5 A;  2F5C A;  1FBS A;  2ZME A;  4B8X A;  3K1P A;  1RNL A;  3BJO A;  3BY6 A;  4IVN A;  5BMZ A;  2XHK A;  2RQP A;  1T2K A;  4A5N A;  4ENJ A;  4O5V A;  1ZRD A;  5JFR A;  4RB2 C;  4HDV A;  1Z91 A;  5CVI A;  1D5V A;  1BM9 A;  3S2W A;  1SMT A;  1MJ9 A;  2IW5 A;  3MZY A;  1TW3 A;  3TDZ C;  3RYR A;  1S7A A;  2QYO A;  3C18 A;  4S04 A;  3AAF A;  4BQA A;  2CQK A;  1P4W A;  1QQI A;  1YG2 A;  4Y15 A;  1H0M A;  2M1B A;  2KJB A;  2LF8 A;  5D6F A;  1IZ1 A;  1RI7 A;  1GHC A;  1G3T A;  3N4M A;  1FNN A;  4A5M A;  1JHF A;  4L9T A;  2PI0 A;  3CUQ C;  1SD5 A;  4PGG A;  1KQ8 A;  3ULQ B;  2ESN A;  5DV5 A;  1QGP A;  1ZH5 A;  3TO6 A;  3M8F A;  4EGY A;  2EFW A;  1YW7 A;  1F9N A;  1UCR A;  1V3F A;  4G7H F;  4CYD A;  5JR3 A;  3O2P E;  2NRA C;  2NAZ A;  1RUN A;  2ZXJ A;  3EUH A;  1H9T A;  2FNP A;  3E6D A;  1XDS A;  3QAH A;  2ADU A;  5HOO A;  4UXN A;  5AIQ A;  5H6Q A;  2A6E F;  4LGW A;  2F5E A;  1B9M A;  3BPX A;  2VE8 A;  4EGZ A;  1S29 A;  3I54 A;  2EA2 A;  1I27 A;  4BHC A;  2G7U A;  3CLO A;  1BIB A;  3M1E A;  2HOE A;  2QVO A;  3ZMD A;  4I01 A;  2VON A;  5DDG A;  3F8M A;  3JAM Z;  5HDG A;  2HZT A;  2BBY A;  2DI3 A;  1XB4 A;  2HGC A;  3JW4 A;  3V7R A;  1YQA A;  5E8I A;  2MH9 A;  2Z5U A;  5E1X A;  5EEH A;  2A69 F;  1Z9C A;  1W4M A;  3V7S A;  1ON2 A;  3BJA A;  4LB6 B;  2FNA A;  3SZT A;  1QNT A;  4BYY A;  3N97 A;  4WXD A;  5HS8 A;  3PQK A;  4FHT A;  2K4J A;  2J5P A;  5LBQ A;  2W57 A;  2YX7 A;  4MEX F;  2IJL A;  1BJA A;  2IRF G;  4A12 A;  5DUI A;  4ASN A;  5FGM A;  5K1Y A;  1BN5 A;  4D0P A;  3DFG A;  3QPT A;  4A0Y A;  5F64 A;  5D6E A;  3FF5 A;  3GWZ A;  4HX7 A;  3K1N A;  4LFU A;  3RYP A;  2PMH A;  2PG4 A;  1R1T A;  2UXX A;  4P55 A;  4MHG A;  2LSO A;  5FLX K;  2Y75 A;  4M9Z A;  4NHJ A;  3ZN0 A;  2LF7 A;  1CF7 B;  3V8K A;  1IXC A;  4XBF A;  5CJ9 A;  4LLL A;  1KGS A;  3R4K A;  2IVM A;  2Z99 A;  3I53 A;  5D4R A;  4PCQ A;  3J81 K;  1KA8 A;  2E1N A;  4CGZ A;  3K0L A;  3CJN A;  3RTR A;  5D5U B;  1WWX A;  3OV8 A;  2Q2E A;  1FX7 A;  2ZKZ A;  2XIG A;  4UVA A;  1JHH A;  4OIQ F;  4EJO A;  3WTU C;  4FT8 A;  1R1U A;  2OQR A;  2XAS A;  2QBY A;  4I98 B;  3CUQ B;  2VT3 A;  3L09 A;  1J5Y A;  4HLY A;  3HRT A;  3W6J B;  2EWN A;  1W7P B;  5BPI A;  3GZ6 A;  2DK5 A;  4S05 A;  1FT9 A;  2VBW A;  4WCG A;  1R5G A;  1YTY A;  1DP7 P;  3EYY A;  4PZJ A;  3HSR A;  2CW0 F;  4EJT A;  3L9F A;  3NRV A;  2H6B A;  3F3X A;  3T8T A;  1SMY F;  4Q4Z F;  3K2Z A;  4M74 A;  2FXA A;  3J80 Z;  4WXC A;  1WRJ A;  4ZZD A;  2MLK A;  4RB1 A;  2HFH A;  3C7J A;  4LK0 F;  1O3T A;  2XAJ A;  2HR3 A;  4L9N A;  1DPU A;  1B9N A;  1K78 B;  4KMF A;  4HQE A;  3HRS A;  1ZGA A;  5FD6 A;  1SFX A;  3PFI A;  1A04 A;  2EFQ A;  2EFN A;  3Q5F A;  1MDM B;  1TQP A;  5EEG A;  2QQA A;  2WC2 A;  3R0A A;  1XGS A;  3I0T A;  1YFH A;  1P4X A;  3ROU A;  4MQ9 F;  2XV4 S;  2K86 A;  1BI3 A;  4L5J A;  3MZH A;  1XMA A;  3T5X A;  2XRN A;  1FZP B;  5LGN A;  3WGI A;  4L0Z B;  4XSX F;  1KU3 A;  2GQQ A;  4IHT A;  1PP7 U;  2D1V A;  3LST A;  4WX9 A;  3QU3 A;  3ZMV A;  1F5T A;  1O57 A;  4HF0 A;  2BV6 A;  5DCF A;  1AWC A;  2FU4 A;  4A6D A;  3LWF A;  4KUM A;  2ZBK A;  4OIR F;  4HV5 A;  1UHW A;  4OIN F;  3LQR A;  2O61 A;  1B4A A;  5L3E A;  1Y0U A;  2CO5 A;  3ISP A;  1K79 A;  2MD5 A;  2FSW A;  4HAM A;  3FXQ A;  1O3Q A;  1SFE A;  1ZG3 A;  2FBK A;  3DQV C;  1X3U A;  5L3B A;  4ON0 A;  2EV5 A;  3F8N A;  3TOA A;  1B1B A;  3V7C A;  4U88 A;  1OMI A;  2UXN A;  2DFI A;  1G6N A;  3H92 A;  2ZNZ A;  2HQN A;  5BOX A;  3O3K A;  2JT1 A;  1MGT A;  1ON1 A;  1QZY A;  5HS9 A;  3MQ0 A;  4LMY A;  2HTJ A;  1ZG5 A;  1R1V A;  2Y0M A;  2RKH A;  3BOQ A;  1D3Y A;  2HKX A;  3H3Z A;  2W85 A;  2A3S A;  2E7W A;  4GO1 A;  4OIP F;  3C3W A;  4M6Y A;  2VOD A;  4GCV A;  3NEU A;  1ZAR A;  2OA4 A;  4IF4 A;  2DU9 A;  4IJA A;  3MEX A;  3J7A O;  2V79 A;  4KIC A;  3IC7 A;  2PMU A;  3GX4 X;  3WTT C;  1IN7 A;  4F7Z A;  3E5Q A;  1MZB A;  3HSF A;  2C6Y A;  1QO0 D;  5JI6 A;  2ZME B;  2RDP A;  3F6O A;  1XMK A;  4ETS A;  3LAP A;  1G3Y A;  4UNO A;  1XGM A;  1FYM A;  3M7G A;  5JHU A;  3REO A;  3RJP A;  3D0S A;  1Q1H A;  3FZV A;  1UHM A;  1MD0 A;  3WTW C;  4N9H A;  1K6O A;  2KJC A;  2WTE A;  1TW2 A;  5ILS A;  2H94 A;  1BI1 A;  5CYV A;  2V1X A;  4Z2Y A;  4AD9 A;  4O3M A;  3D5L A;  3DP7 A;  5DUK A;  3F23 A;  4I2O A;  3G3Z A;  3JSP A;  4P96 A;  2DBB A;  4PDK A;  4WK8 F;  4U0V A;  4KYW A;  4IXA A;  2Q8K A;  1IW7 F;  1RZ4 A;  1U8R A;  3WTY C;  4HX4 A;  3KP5 A;  3B02 A;  4L18 B;  4ZYE A;  2CGP A;  3Q9S A;  3F21 A;  1YYV A;  4HZF A;  2QQ9 A;  3SHF A;  3P9K A;  3DPL C;  1PUE E;  1UST A;  1R36 A;  5E18 F;  2P5V A;  4KMU X;  5F1R A;  1XGN A;  3QP5 A;  2COM A;  5D5W B;  2VOO A;  4CZZ A;  3ZPL A;  4U0Y A;  1IN6 A;  4FX0 A;  4KIG A;  2XKP A;  3W6K B;  1FLI A;  5LRR A;  4TV7 A;  1KYZ A;  1HBX G;  1J7K A;  1RUO A;  2GIV A;  1FPQ A;  3RPQ A;  2ZCW A;  2ISZ A;  3ELK A;  2HKO A;  2IPQ X;  1KU9 A;  3IRQ A;  2L02 A;  4U7D A;  4DQ2 A;  1FOK A;  1MKM A;  2G9W A;  2V1D A;  4A0X A;  3WTS C;  2XVC A;  2CYY A;  2MC3 A;  1HSJ A;  2ELH A;  2LDU A;  1LQ1 A;  3E5X A;  4LK1 F;  2ETH A;  4CDG A;  2FOK A;  3EET A;  2OD5 A;  1D8K A;  3CO6 C;  1KQ9 A;  4A2U A;  2EFO A;  2Q0O A;  4BAY A;  1FYK A;  2PFB A;  1F1Z A;  5CVV A;  1U5T B;  3F8F A;  3LA7 A;  4G6D A;  1LB2 A;  1I1S A;  5LRS A;  1SD6 A;  3U1D A;  3KET A;  4CIC A;  2KIU A;  3WG9 A;  1P2F A;  2OBP A;  3ERE D;  1XD7 A;  2QWW A;  3ZMU A;  1XSD A;  1TNT A;  1PP8 F;  2V6C A;  4G94 A;  1ZRC A;  6PAX A;  4O6J A;  2A6H F;  3V4G A;  3F22 A;  2M30 A;  4R8H A;  4P9F A;  2K7L A;  2XUB A;  3BZ6 A;  3LA3 A;  1U5T A;  1FY7 A;  4KN7 X;  4IRI A;  3EYI A;  4BNC A;  3RKY A;  2CG4 A;  2CWE A;  2HS5 A;  4ZYD A;  1ZN2 A;  2R7D A;  4ENN A;  2RNJ A;  3E97 A;  1T0F A;  2IP2 A;  3QP6 A;  2YSR A;  5E8G A;  5DYM A;  2MA3 A;  5JVT A;  3KFW X;  3WTZ A;  2LKP A;  2AS5 F;  5A2Q Z;  2KRF A;  4WXH A;  1C0W A;  2O3F A;  4OOI A;  1ZRF A;  4RB3 C;  4NB5 A;  1G3W A;  1U78 A;  4Q5S F;  1KYW A;  1YLF A;  4AVP A;  2D1H A;  3VEP A;  1EV7 A;  3KP3 A;  5L3D A;  2FML A;  1XDU A;  2QBY B;  2GXB A;  1OYI A;  1FSH A;  2TDX A;  5E1W A;  5ERI A;  1HXD A;  4I0A A;  4WWC A;  1UFM A;  4RS8 A;  3C1D A;  3VB2 A;  4G7Z F;  3MFK A;  3GF2 A;  4MTD A;  1XGO A;  2FBH A;  1P4A A;  2OAZ A;  4CHU A;  3ECH A;  5J8F A;  2UZK A;  2MBF A;  1TBX A;  1W5S A;  3F8C A;  1KQ0 A;  4L9V A;  1J59 A;  1ZYR F;  1O3S A;  4KIB A;  3GFM A;  4WF2 A;  3HOS A;  3FHZ A;  3ML6 A;  1Z6R A;  2VBZ A;  4L9J A;  4RAY A;  1HW2 A;  5DD8 A;  1LVA A;  3BDD A;  2QM3 A;  4M6X A;  2PBI A;  2BE5 F;  3MCZ A;  2QEN A;  4BH9 A;  3GUD A;  3FMR A;  4GYI A;  2YU3 A;  4IHS A;  3M9A A;  3FX3 A;  3SFZ A;  1LDK B;  3B73 A;  3R61 A;  1DDN A;  2P7V B;  4LG0 A;  1TNS A;  3ABU A;  3HSE A;  1TQM A;  3HHG A;  2RVC A;  2F2E A;  2GWR A;  1EH6 A;  4IRH A;  3I4P A;  4KN4 X;  1IAW A;  3U9G A;  3BP8 A;  2IA1 A;  1U2W A;  2P8T A;  1HW1 A;  2H27 A;  2PLY A;  2L01 A;  1R22 A;  2V1U A;  2DO7 A;  4OMZ A;  2GA2 A;  2EV6 A;  5LHH A;  1IF1 A;  2EA4 A;  3WGG A;  2RGV A;  3JTG A;  2A07 F;  4XLN F;  2HDC A;  2HEO A;  3GFJ A;  1G3S A;  4UHT A;  1S3J A;  1XCB A;  3KZZ A;  4LLN A;  3P9C A;  3CUO A;  4RB0 A;  3VFZ A;  2FF4 A;  2F5D A;  4RGS A;  2JSC A;  2DPD A;  5D8K B;  3BRO A;  4YFK F;  2VOP A;  1T38 A;  2P4W A;  3L00 A;  2E7X A;  2O03 A;  2HWV A;  2VC0 A;  4EVI A;  3KP2 A;  1U6G A;  3KP4 A;  1R00 A;  3HTS B;  4L5I A;  5D8L B;  5BS6 A;  2FMY A;  1GXQ A;  3DV8 A;  2OQG A;  4UV8 A;  4LJZ F;  1TQI A;  4AIH A;  3EQL F;  1EH7 A;  1WI9 A;  2ZO4 A;  1KU7 A;  1SD7 A;  4JBA A;  3TQN A;  2V9V A;  4GXO A;  1F4K A;  1BOA A;  1TLH B;  5LHG A;  5KK1 A;  4LB5 A;  4OIO F;  3KP7 A;  1WQ2 A;  3ZMS A;  1YS6 A;  4MGR A;  2DLL A;  2Z33 A;  2H6C A;  4N9I A;  1STZ A; 
#chains in the Genus database with same CATH topology
 2ZJ2 A;  3K4K A;  2JPB A;  4BBR J;  5IT9 K;  2OUM A;  2CU7 A;  4HA8 A;  1B72 B;  1LEA A;  3TO7 A;  2H1L A;  1MMN A;  3KX2 A;  3SZP A;  3WTX C;  2CSO A;  1WJE A;  2PEX A;  1PUF B;  3ZMT A;  3OS1 A;  2BOL A;  2BGC A;  2DJI A;  3EUK L;  1B6A A;  1J75 A;  1U5T C;  3R60 A;  3IKV A;  2IA0 A;  3ABT A;  2R7X A;  3IL2 A;  1OYW A;  3QPS A;  1YIO A;  3NWT A;  2BW3 A;  1MBG A;  1VQ9 I;  1VQO I;  5H6R A;  3MWM A;  2HYF A;  4RGU A;  2ZNY A;  1J9I A;  4DW6 A;  5GP9 A;  1L3L A;  2HU9 A;  1OR7 A;  4E7S A;  2IS1 A;  3S2H J;  4A6E A;  3IHU A;  5J1R A;  5K5R A;  3SZG A;  3AG2 H;  1K83 J;  3DF8 A;  5TGT A;  3M8J A;  4Q48 A;  2IT0 A;  1RRJ A;  1QPM A;  5ICF A;  2AQF A;  2DYS H;  5L3F A;  1DU0 A;  2OCC H;  4ESB A;  2E34 A;  5D5V B;  5LFA A;  1WFX A;  2CH0 A;  5LEJ A;  3JSO A;  1NHA A;  2F4M B;  3C2B A;  1ZRE A;  1Z21 A;  4IHW A;  5HS7 A;  4AIJ A;  3KLO A;  2LOO A;  1G2H A;  1T6S A;  3NQO A;  2O7O A;  3LSR A;  1ETW A;  2D45 A;  3BWG A;  1MMA A;  2D5V A;  4CYC A;  2V26 A;  2H8W A;  5K5O A;  3QOP A;  4Y17 A;  3GXO A;  2X6O A;  3LFK A;  3LNQ A;  3KYC B;  3G6E I;  3VWB A;  2F4I A;  1D8J A;  1I50 J;  2NVY J;  1X58 A;  2DA6 A;  2VQC A;  2A68 F;  3BG6 A;  4IL6 C;  5HDK A;  3CCU I;  5FLV A;  3GTQ J;  4KT6 A;  3ERM A;  2DW4 A;  2NYX A;  4QWQ A;  1YX5 A;  5E3L A;  1ZLK A;  3FK7 A;  4QLC U;  3KEY A;  5GAE J;  3KZY A;  4HST A;  2EZK A;  1XCV A;  3JCU C;  4M72 A;  4CZC A;  2HYG D;  2OF7 A;  2LP0 A;  3S32 A;  1IXR C;  4BHP A;  3G1M A;  3R6S A;  1ZKG A;  5H20 A;  1Z7L A;  2CFX A;  3RDI A;  1RKT A;  4F3Q A;  4HDU A;  3DPT A;  4KDP A;  3Q9V A;  2E1O A;  3FXL A;  3ECO A;  3TOB A;  3FWE A;  1R9T J;  4B09 A;  5CQG A;  4M6V A;  4AUX A;  4JQF A;  1LDD A;  4HLX A;  4DBR A;  5DS9 A;  1O7F A;  5TIS C;  3OYA A;  4HF2 A;  2JTV A;  3S2D J;  4Y7N J;  1JJ8 C;  5FFZ A;  3H3U A;  4P5O A;  5DCM A;  1SVM A;  1T33 A;  3QU6 A;  1X1B A;  3NAU A;  4M9X A;  1JUS A;  3FXU A;  2MYS A;  2VL8 A;  2VT2 A;  2GOM A;  1UG2 A;  2LY9 A;  4ZYH A;  1LJ9 A;  3K4M A;  3I59 A;  4MEY F;  9ANT A;  3QRF F;  4IO9 F;  1ERD A;  2O6G E;  2ESH A;  2ZFW A;  5DEQ A;  1EF4 A;  3L2C A;  1ETY A;  3LSP A;  3PO2 J;  4DYR A;  1N75 A;  1R23 A;  3WTV C;  4M9S A;  2JQ7 A;  4P9U A;  2K3F A;  1Z7U A;  2R92 J;  2ACJ A;  1HA8 A;  1HKT A;  3DTI A;  2G7H A;  2JA5 J;  2EV0 A;  2BYV E;  2GOX B;  2KKO A;  2XDV A;  3BJ6 A;  1VTN C;  5J8C A;  3DU6 A;  2D2W A;  1H88 C;  2Y9Z A;  3IWZ A;  2V9P A;  2TRT A;  5K7F A;  4BU2 A;  1Z0X A;  1FIA A;  2DN0 A;  1TT0 A;  4CXF A;  4E7I A;  3K4B A;  5EEA A;  1K4S A;  1QHH D;  2XAU A;  3VYU B;  3OS2 A;  1DP3 A;  1R5H A;  1ULY A;  2EZH A;  3PNV A;  5HVQ C;  3HRU A;  4LIV A;  4L5E A;  1CGP A;  1JTY A;  5FFX A;  1XSX A;  1FP1 D;  1MJB A;  3GTJ J;  1E17 A;  1WHU A;  2XB0 X;  5E3N A;  5HLH A;  3T1B A;  2BXY A;  1JGG A;  2MSY A;  5HLG A;  4X0G A;  3HGY A;  2IBD A;  3GVA A;  3K9T A;  5L3C A;  1DQU A;  3BG3 A;  2CQN A;  1FP2 A;  2BHY A;  3I3L A;  1GV2 A;  2R7R A;  4E7Z A;  2XPV A;  4ESJ A;  4FX4 A;  1V4R A;  1UHS A;  2X1D A;  4IRG A;  1I1G A;  1WH7 A;  5CQE A;  1K6Y A;  2L7F P;  5D5X B;  2XSJ C;  2NNN A;  5CVJ A;  4UV9 A;  4A69 C;  2HQR A;  2LLK A;  1YW9 A;  3CD6 I;  3MD2 A;  2VPL A;  2QEX I;  1P7J A;  5ED4 A;  2HTS A;  3MKY B;  1A35 A;  2NS0 A;  4EM2 A;  4MNU A;  1USS A;  3GBG A;  3L1P A;  3LOC A;  1REP C;  1UMQ A;  3OOP A;  2LH9 A;  2P5L C;  4ZZL A;  2QSF X;  3CP8 A;  4XLH A;  2W84 A;  5LLQ A;  1D0Y A;  2W24 A;  1LEB A;  2W1O A;  1PJR A;  4BXU A;  2EB7 A;  2KIM A;  2E1C A;  3R0J A;  4EM0 B;  2PJR A;  3G2B A;  1LFU P;  3RQ4 A;  1OPC A;  5ICG A;  3K1M A;  2L4M A;  4YIF A;  3VOE A;  2JA6 J;  2PJP A;  3HXL A;  1FC3 A;  4RA2 A;  1Y39 A;  1ZAO A;  4UUV A;  2RV8 A;  1YS7 A;  2L54 A;  2FA5 A;  4PJ0 C;  3WHB A;  3OIP A;  4G6Q A;  1IXS B;  3FMS A;  5FLX Z;  2VC1 A;  3IRR A;  4IQJ A;  2IS6 A;  1KU2 A;  2YUS A;  1HOM A;  2V1N A;  1HQC A;  4MFE A;  3K4C A;  5BQT A;  3K4J A;  3RKW A;  1YIJ I;  1D0X A;  3E6B A;  4M73 A;  4XK4 A;  3TBI A;  3IKT A;  4JK1 X;  4HX8 A;  2PN6 A;  3DXJ F;  2DA4 A;  3T0Y A;  4DZP A;  3FHN A;  2M87 A;  1RR8 C;  5C3E J;  4YG2 F;  5FRN A;  4Z6Y A;  4AWX B;  1J2X A;  2E71 A;  3HOT A;  3FMQ A;  5GPA A;  2E19 A;  3U2R A;  1HF0 A;  2K4B A;  2BY3 A;  2VKE A;  1WCM J;  4RAZ A;  1E3P A;  3J81 Z;  1G4D A;  3TL4 X;  2HXI A;  1H9G A;  2GXG A;  4YFX F;  1U8B A;  4G9Y A;  3SYT A;  1OYY A;  4G6T B;  1WPK A;  3JTH A;  1IGN A;  4KNY A;  3FIS A;  3S1M J;  1X2M A;  1ORK A;  3H5N A;  3IAS 2;  2X0L A;  4I7H A;  3E5U A;  3NAR A;  3H9J A;  3V8L A;  3WE3 A;  5D4S A;  4GYG A;  4RAG A;  3FIW A;  5EJC A;  1Z3X A;  2MFZ A;  2XAF A;  2O8K A;  1JGS A;  2V7F A;  1NK3 P;  2R7Z J;  4HBL A;  2XGX A;  4OU0 A;  1H89 C;  4XSZ F;  5ILV A;  2VXZ A;  3HOY J;  2VBY A;  3GFL A;  1Z05 A;  4I09 A;  1GXP A;  4UVC A;  1LNW A;  1TZL A;  4AIK A;  3MAJ A;  2L3D A;  2EJR A;  4ENK A;  3ZMZ A;  2BY2 A;  1BIA A;  3DBH B;  2X6X A;  2XAG A;  4CCK A;  3WG7 H;  4CO8 A;  4PFP A;  1ZHF A;  4ZDP A;  3DBL B;  5EGO B;  2P6T A;  4EMS A;  5AON A;  2ZFU A;  2IAI A;  2DOE A;  1Z1D A;  2PQ8 A;  3TMO A;  1VQ7 I;  3QPH A;  5IT3 A;  4N4O B;  2PMZ A;  2W25 A;  4Q47 A;  1HDD C;  1QVU A;  3KZI C;  1R5I D;  3RPU A;  3V8J A;  2NNY A;  4EQQ A;  1W0U A;  2DQR A;  3I64 A;  1IRF A;  1HDP A;  3F6V A;  3MZ8 A;  1WH5 A;  1FYL A;  3SEZ A;  2WY7 Q;  3M8E A;  4BHB A;  3DKX A;  2F5F A;  3D5S C;  2M5W A;  1XG1 A;  2YPR A;  2LBF B;  1T0F C;  4CSW A;  1T95 A;  3FM3 A;  1IN5 A;  1WJC A;  2EZL A;  3WU0 A;  1VQM I;  3CO7 C;  2QQ8 A;  3PM1 A;  4IEJ A;  4DNC A;  1GVJ A;  1P6R A;  1T98 A;  2BY0 A;  5CLS A;  2CQ7 A;  3FXR A;  1UB9 A;  4V19 K;  4U0W A;  2VN2 A;  3H0D A;  2VQL A;  5GTH C;  3KCC A;  1YX3 A;  1A31 A;  2X1C A;  1K7A A;  1S72 I;  3ZQI A;  3CDH A;  3WU1 B;  4GRI A;  4GGG A;  4A0Z A;  1OQY A;  3PSF A;  3I71 A;  4JX6 A;  4BY1 J;  1OR7 C;  2DDA A;  2HOA A;  2JRT A;  3SQN A;  1SFU A;  1HKQ A;  2FX0 A;  4HYE A;  4R79 A;  1X4O A;  1MNE A;  2YX4 A;  3LMM A;  4XN3 A;  1R58 A;  2EPF A;  4PSX A;  4ESF A;  5AIP A;  2M45 A;  2R7U A;  2K02 A;  3E6M A;  1AOY A;  4G7O F;  4RBO A;  5B1A H;  1FBU A;  4LIU A;  1F43 A;  3OYK A;  3GLX A;  4PJN A;  2ZJQ F;  5C44 J;  4QPQ A;  1U3E M;  2Z1D A;  1OCZ H;  2OZU A;  4LD5 A;  4IZZ A;  2WAF A;  3BZC A;  4Y4R A;  3KLN A;  4UVB A;  1FWZ A;  2A61 A;  3TKY A;  1ETQ A;  2XAH A;  3WOD F;  3I5U A;  3DEU A;  4KT5 C;  5ICC A;  3JAM K;  3FXJ A;  1DPR A;  2DT5 A;  2W00 A;  1ZGJ A;  2E35 A;  2DA3 A;  2RN7 A;  5DD4 A;  4L0Y B;  4ZH4 F;  1J0R A;  4LG0 B;  4RAF A;  4YII A;  4H0E A;  2K27 A;  1FBQ A;  2E2I J;  2P81 A;  3BTJ A;  1Y1W J;  2JRM A;  2QF7 A;  2MLG A;  1YW8 A;  2DT7 B;  3HYI A;  4HSR A;  4MQV A;  2EZI A;  4DOZ A;  1LDJ A;  3RIR A;  1MND A;  1TWF J;  3RPU D;  3KEO A;  3ZN1 A;  4BE2 A;  1FSE A;  3V42 A;  2HZD A;  3OYN A;  1VZ0 A;  4X1E A;  2CFO A;  5FKO A;  4UUS A;  2LR8 A;  4XOT A;  2XC7 A;  1BC7 C;  2P5K A;  3TW6 A;  1SEU A;  2QZ8 A;  1I5Z A;  4AM3 A;  2MH2 A;  2P7C B;  5E1Z B;  2AXL A;  3RI4 A;  5E79 C;  1YE9 A;  1XC5 A;  2Y9Y A;  2DMP A;  1CF7 A;  2OCE A;  5KVR A;  1WJD A;  2JZY A;  3BTI A;  1JI8 A;  1V54 H;  2VUM J;  2Z3Y A;  1UZC A;  4EJV A;  3JR9 A;  1BR2 A;  4KIF A;  3PQJ A;  3H1C A;  3S17 J;  2WWY A;  1TWA J;  2R3S A;  3HIF A;  2WV0 A;  3E6C C;  2F6C A;  5HLI A;  3LQQ A;  4HRI A;  3BR3 A;  4BEH B;  3CMA I;  3GFI A;  2ZXW H;  1WJB A;  2FOW A;  2IGN A;  2J5O A;  2ZXI A;  3KP6 A;  3QOE A;  5CVU A;  1X1D A;  2NXN B;  5GAG J;  5ICE A;  1GV5 A;  2ISY A;  1YO5 C;  4GFB A;  3VOD A;  4EV0 A;  3I58 A;  2K9N A;  4F55 A;  2VBX A;  1W0T A;  4IPA A;  3G73 A;  5HDN A;  1ODD A;  4FIS A;  1VQN I;  2IA2 A;  3A2K A;  3EDP A;  3KE2 A;  4M71 A;  1MJA A;  4HW0 A;  2UWM A;  4PGH A;  2QCO A;  1PYV A;  4C2U A;  3RCO A;  3G71 I;  2Y48 A;  2ECB A;  2RC4 A;  4HF1 A;  3HJE A;  4RGX A;  4A3F J;  3CUQ A;  1S8N A;  3O6B B;  5A2Q K;  3F72 A;  3IWF A;  2X48 A;  2XAQ A;  4KA4 A;  2QQB A;  3QYF A;  5IT9 Z;  3QOD A;  1IV6 A;  3HRM A;  1BBY A;  2HOT A;  3GTP J;  1W7P A;  3JRA A;  2IS4 A;  1JXS A;  5B1B H;  1QBJ A;  5FKM A;  4OMY A;  5CPR B;  4EJW A;  1W5T A;  1SAX A;  1OFC X;  1DUX C;  2JA8 J;  2O0Y A;  3Q0V A;  1JUM A;  2MG4 A;  3CCL I;  1R7J A;  3BG5 A;  5HNH A;  3CCE I;  4HQM A;  1WGX A;  1WKM A;  2XKO A;  1SAU A;  2GAU A;  5ILU A;  5EYR A;  4EM1 A;  2DPU A;  2JPC A;  1QA6 A;  2E1M C;  2EFP A;  2VE9 A;  2DQL A;  2K9M A;  3K2A A;  3GW2 A;  1D1A A;  1BJZ A;  4CH7 A;  4QPO A;  1YHQ I;  3WHC A;  1IC8 A;  2XRO A;  2QSG X;  3DCF A;  5E20 A;  2RNG A;  1D0Z A;  2VXD A;  1S6L A;  1RKW A;  1ZLJ A;  3P9I A;  2HI3 A;  2ME0 A;  3U21 A;  3OS0 A;  2M0C A;  3UKG A;  2H09 A;  2FQ3 A;  3BPV A;  5F6F A;  1YI2 I;  1TTY A;  1O3R A;  2EK5 A;  2IS2 A;  3B6C A;  3BT9 A;  4RGR A;  2VLA A;  2B9S A;  2QUF A;  1ETK A;  1K78 A;  1T39 A;  3CTA A;  3CMY A;  3O8G A;  2K40 A;  2DFH A;  1JE8 A;  1DGR M;  1O7L A;  2OU2 A;  3SXY A;  3OYL A;  2STW A;  1E2X A;  4HOB A;  4IHX A;  5K5Q A;  4CCJ A;  3E0J B;  2X6Y A;  3MKL A;  4K2E A;  3X2Q H;  1B59 A;  2DAO A;  2M8E A;  2P0W A;  3Q0U A;  3GEZ A;  3TDU C;  2LVS A;  2HQ5 A;  1Y0N A;  2GZW A;  2V4J C;  3SJM A;  1TL8 A;  2FBI A;  1MDM A;  4I99 C;  3DWL E;  2M4G A;  4KIT B;  4XQF A;  2VKV A;  1ZG1 A;  5TRD A;  3HL2 A;  3DKW A;  3K69 A;  4ZDL A;  2DOA A;  3KEQ A;  4IKF A;  1S7E A;  2KIF A;  2M9H A;  4I02 A;  1RES A;  2KLO A;  1VND A;  2OPT A;  3S1N J;  5E17 F;  3CJQ B;  3TP3 A;  2ZJR F;  3VSK A;  1NG6 A;  4ZYG A;  1RET A;  2JJ7 A;  2KIQ A;  4BAC A;  2BW3 B;  1P92 A;  2V9K A;  4C3J J;  3K7A J;  3CF5 F;  3IAM 2;  3OYC A;  2ELK A;  2M8G X;  1WSU A;  5LHI A;  4YFN F;  1W7P D;  3TGN A;  3J80 K;  4KFC A;  3L7W A;  2DOD A;  2FE3 A;  3ZQ7 A;  5GAD J;  1HW5 A;  1QZZ A;  3DLA A;  4HV6 A;  2Z9O A;  2W48 A;  4B3X A;  2HOS A;  2XF7 A;  5L3G A;  4Y13 A;  1L0O C;  3F8B A;  4CYC B;  2KZG A;  2A5Y B;  1XSV A;  3WGH A;  5FB2 A;  1RIO H;  3HTU A;  3GYH X;  1I6X A;  5M3F J;  1VQL I;  2DFE A;  2FRH A;  4XNF A;  1BI0 A;  4IHY A;  2R7F A;  4RLF A;  3GO5 A;  2FEZ A;  3LSK A;  2X4H A;  1IN4 A;  1HST A;  2L4A A;  3PJR A;  5JLX A;  5CVR A;  4NQW A;  4CA0 A;  3F9K A;  3P7N A;  1MW7 A;  3SDG A;  2VB6 A;  2JK3 A;  3SEQ A;  4E6K G;  1ZQ3 P;  3ABL H;  3SDB A;  4G8X A;  2X1E A;  3HHH A;  2JWT A;  5LGT A;  3HPH A;  2RAE A;  4A3E J;  3RZD J;  2YU9 J;  2DTR A;  3WE2 A;  3T8R A;  5JVG F;  3GZ5 A;  3ZRG A;  3CCS I;  2XRL A;  3FM5 A;  2HYJ A;  3FKI J;  3LA2 A;  1IDY A;  5J6X A;  3E3V A;  4XRF A;  1E3H A;  4E7J A;  1IUY A;  4CCM A;  1ONV A;  2B0L A;  2R93 J;  2V6E A;  4XLE A;  2GA1 A;  2OTL I;  4U7B A;  1BA5 A;  4MTE A;  2DCE A;  5LEK A;  4LLG F;  3TO9 A;  4A3G J;  1IUF A;  1HKS A;  4F52 A;  2YR2 A;  5DCM B;  4EJU A;  1BC8 C;  4ENM A;  2LNB A;  1XN7 A;  5J40 A;  4CUG A;  3S14 J;  4XLP F;  4ZJZ A;  4OAZ A;  5KHD A;  5LGU A;  1EA3 A;  4I0B A;  5FO5 A;  2DK8 A;  3HUG A;  4OWR B;  2STT A;  2BVM A;  3S3N A;  2ZB9 A;  3I59 B;  2K3P A;  4N0B A;  1OKR A;  1S7O A;  4DYC A;  3LAJ A;  3CCR I;  4BJT A;  3OOU A;  5TJJ A;  3ZP5 A;  2UUZ A;  1PDN C;  3RKX A;  4E70 A;  1EH8 A;  2OZ6 A;  3VPR A;  3KYL A;  1JT0 A;  1Z6T A;  1A6I A;  3FBI B;  2BEO A;  2QLZ A;  2W4S A;  2O8X A;  4AC0 A;  3KPH A;  5KNL A;  3ABM H;  4E7L A;  2RRE A;  1IN8 A;  4R1H A;  1Q1V A;  1BI2 A;  3RZO J;  1SD4 A;  2B7E A;  2XF5 A;  1QZE A;  5BPD A;  1IRG A;  4NC7 A;  2P6S A;  5FD5 A;  4M3B A;  4B47 A;  2W82 A;  3DU5 A;  1GT0 C;  1WVR A;  3ZCO A;  3JRF A;  2F5C A;  3H9Q A;  2W7N A;  1LVK A;  2XF6 A;  1FBS A;  2ZME A;  1XS9 A;  1X1C A;  5DM7 F;  4B8X A;  4PK4 A;  3K1P A;  4GDF A;  1RNL A;  3CME I;  2AXT C;  3BJO A;  3BY6 A;  4IVN A;  5BMZ A;  2XHK A;  2RQP A;  1T2K A;  4A5N A;  2CV2 A;  3FXO A;  4ENJ A;  4O5V A;  1ZRD A;  2LKS A;  1SFK A;  4ZYA A;  2DFF A;  4HNV A;  5J1Y A;  5JFR A;  4RB2 C;  4HDV A;  4QSH A;  3ASO H;  1Z91 A;  5F0F A;  2Z16 A;  5CVI A;  2MD0 A;  1D5V A;  1BM9 A;  3S2W A;  2E1M B;  2ZXH A;  1SMT A;  3H36 A;  2CMP A;  2M3A A;  2KT0 A;  1MJ9 A;  4F91 B;  2IW5 A;  3MZY A;  1TW3 A;  3ZQC A;  4A3K J;  2K9S A;  3TDZ C;  3RYR A;  1S7A A;  4NNJ A;  2QYO A;  3HG9 A;  2PJR B;  3C18 A;  4S04 A;  3AAF A;  1MBK A;  4IHV A;  2R5Y A;  3AG4 H;  2PX9 A;  4BQA A;  4NC8 A;  1QVT A;  2CQK A;  1P4W A;  1QQI A;  1YG2 A;  4Y15 A;  1H0M A;  2M1B A;  2KJB A;  2LF8 A;  2BY1 A;  3HEF A;  1IZ1 A;  1RI7 A;  3CDI A;  4MFD A;  5D6F A;  4D1Q A;  1GHC A;  4DGW B;  1G3T A;  3N4M A;  1IV8 A;  1FNN A;  4JP0 A;  5HLT A;  4A5M A;  2LTP A;  4W97 A;  1X1P A;  1JHF A;  1NTC A;  3LSG A;  1J09 A;  4L9T A;  2PI0 A;  3CUQ C;  3CZ6 A;  1YOV B;  3QYB A;  1SD5 A;  4BDY A;  4PGG A;  4OAY A;  1KQ8 A;  3ULQ B;  3LFU A;  1HC8 A;  5K7H A;  2LD5 A;  1V5F A;  1JKO C;  2A05 A;  3A03 A;  2ESN A;  3A02 A;  4ZC3 A;  3K4L A;  2NS7 A;  2DJN A;  5DV5 A;  1QGP A;  2DT6 A;  4EEF G;  3TO6 A;  2QKL B;  1ZH5 A;  3NWS A;  3M8F A;  4EGY A;  2DMN A;  4YEL A;  2K9L A;  1MBH A;  4B48 A;  4V2G A;  1R49 A;  1CQT A;  2ICW G;  2EFW A;  1EJ9 A;  1YW7 A;  2YS9 A;  1F9N A;  1VQP I;  1UCR A;  1V3F A;  4G7H F;  4CYD A;  4PUS A;  5JR3 A;  3O2P E;  2Y30 A;  1Y6I A;  2NRA C;  2NAZ A;  1RUN A;  1D5Y A;  2LKX A;  2ZXJ A;  3E1S A;  3COA C;  3EUH A;  2NVT J;  3BR5 A;  4FE7 A;  1H9T A;  1OCC H;  1TP4 A;  2FNP A;  3E6D A;  1LPQ A;  1XDS A;  2WA0 A;  3QAH A;  2ADU A;  5HOO A;  2R7V A;  3I55 I;  4UXN A;  5EZH A;  5AIQ A;  5H6Q A;  2BZT A;  1MSE C;  1X4P A;  2A6E F;  2DYR H;  2BVL A;  4LGW A;  2F5E A;  1B9M A;  2EH3 A;  3BPX A;  2VE8 A;  3FBN B;  2LFB A;  4EGZ A;  1S29 A;  3I54 A;  2EA2 A;  2VJI A;  1I27 A;  4E4H A;  3EUA A;  1Z67 A;  4BHC A;  4XMY A;  3ESW B;  2G7U A;  1U9O A;  2ID6 A;  3W3C A;  4U87 A;  3L2W A;  1IJW C;  3AFH A;  4BKX A;  5H2F C;  3CLO A;  1BIB A;  3M1E A;  3PIO F;  2HOE A;  2QVO A;  3ZMD A;  2FQ4 A;  4I01 A;  2DTZ A;  1HCR A;  2VON A;  5DDG A;  5J4V A;  1BR1 A;  3F8M A;  2HNH A;  4FCY A;  3JAM Z;  1KZH A;  5HDG A;  3F0C A;  5EZG A;  4D5C A;  1VQ8 I;  2HZT A;  4II3 A;  3ZQG A;  2BBY A;  2ID3 A;  2DI3 A;  1IRX A;  1XB4 A;  2HGC A;  3JW4 A;  3V7R A;  4JOM A;  1YQA A;  5E8I A;  5IP9 J;  3AG3 H;  2BHZ A;  2MH9 A;  2KFD A;  1SVL A;  2Z5U A;  5IY5 H;  1XTA A;  5E1X A;  5EEH A;  2A69 F;  3LSI A;  1Z9C A;  3CP2 A;  4XON A;  2CW7 A;  1W4M A;  3V7S A;  1ON2 A;  1DGW Y;  2R7O A;  3JRH A;  4BUP A;  1S5L C;  5CKT A;  5E3M A;  2XPW A;  1ETX A;  2KHM A;  3ZXS A;  3EPZ A;  1FTT A;  4D9J A;  3BJA A;  3GTM J;  4LB6 B;  3VYS B;  1GLN A;  2FNA A;  4XM3 A;  1RR7 A;  2FUG 2;  3SZT A;  4XN0 A;  1QNT A;  4BYY A;  4XRS G;  3GTK J;  1OCT C;  5M5X J;  3N97 A;  4M3G A;  1TWC J;  4WXD A;  5HS8 A;  3PQK A;  1APL C;  1P7I A;  3CF2 A;  5E3O A;  2HDW A;  4FHT A;  2K4J A;  2J5P A;  4XL9 A;  3G1L A;  5LBQ A;  2W57 A;  2YX7 A;  4MEX F;  2WB1 N;  3K4N A;  2IJL A;  1BJA A;  2IRF G;  4A12 A;  4E7K A;  2K9Q A;  4XKW A;  5DUI A;  1P9Q C;  4ASN A;  2DMU A;  2NVQ J;  4XOR A;  5FGM A;  1FMV A;  5K1Y A;  3A1Y A;  1BN5 A;  4D0P A;  3P5J A;  1G8X A;  3OYJ A;  3DFG A;  3QPT A;  1AHD P;  4FQG A;  2WAQ N;  3I56 I;  4A0Y A;  5F64 A;  3DTE A;  5D6E A;  2R5Z A;  1ZTR A;  1WZ2 A;  1GVD A;  1MBE A;  3FF5 A;  3GWZ A;  4HX7 A;  1OJL A;  3K1N A;  2L9S A;  5K7Z A;  2I8D A;  4LFU A;  3RYP A;  2PMH A;  1V55 H;  1TWG J;  2PG4 A;  5GAH J;  1R1T A;  2UXX A;  1STZ A;  4P55 A;  4MHG A;  1K61 A;  3OSG A;  2LSO A;  5FLX K;  4UUS B;  2Y75 A;  1E0E A;  4M9Z A;  2R7S A;  2KP6 A;  2DA7 A;  3CJT B;  4NHJ A;  2LG4 A;  2L9V A;  3ZN0 A;  2LF7 A;  1CF7 B;  2VKH A;  3V8K A;  1B8I A;  1IXC A;  4XBF A;  3GTL J;  5CJ9 A;  4LLL A;  1LE8 A;  1QU3 A;  1KGS A;  3R4K A;  2IVM A;  2Z99 A;  3I53 A;  5D4R A;  3OYI A;  4ZTF A;  2HVS A;  4PCQ A;  3OIO A;  3J81 K;  2JUG A;  3VSL A;  3M1C A;  1KA8 A;  2E1N A;  4CGZ A;  3K0L A;  4BBS J;  3CJN A;  5FJ8 J;  1V5E A;  3RTR A;  2IEK A;  1WWX A;  5D5U B;  3IV5 A;  4XKB A;  2VJ4 A;  3OV8 A;  2K5C A;  2HVR A;  2Q2E A;  2E5Z A;  1FX7 A;  2ZKZ A;  2XIG A;  3IP4 B;  3LL7 A;  3S15 J;  3OYH A;  4UVA A;  1JHH A;  5GPC A;  4OIQ F;  4EJO A;  1VI0 A;  3PNY A;  4NUB A;  4EAT A;  3WTU C;  4FT8 A;  4YEJ A;  3DEW A;  1R1U A;  1Z3Y A;  1GUU A;  4E7H A;  1WI3 A;  4I76 A;  2OQR A;  2XAS A;  4II2 A;  4HNU A;  2QBY A;  4I98 B;  1N25 A;  4F93 B;  3BCB A;  3CUQ B;  2VT3 A;  2ZME C;  3H0G J;  3L09 A;  3DLL F;  1J5Y A;  2VJJ A;  4HLY A;  3HRT A;  4LG3 A;  1X19 A;  3W6J B;  3UNG C;  2EWN A;  1W7P B;  4BL0 B;  5BPI A;  3GZ6 A;  3HB9 A;  2DK5 A;  2DA2 A;  4S05 A;  3GTO J;  1FT9 A;  1XX5 A;  2VBW A;  3HC7 A;  4WCG A;  1R5G A;  1YTY A;  1DP7 P;  2IGO A;  3EYY A;  4PZJ A;  1R6R A;  5FRO A;  3HSR A;  2CW0 F;  2MAB A;  1N77 A;  4EJT A;  3DTK A;  3L9F A;  3NRV A;  3N05 A;  2H6B A;  4DZJ A;  5IP6 A;  4CCL A;  3F3X A;  3T8T A;  2I10 A;  1SMY F;  3OYG A;  1MSF C;  4Q4Z F;  2CUZ A;  3J7Y J;  3K2Z A;  3ASN H;  4M74 A;  5J47 A;  2FXA A;  3SFI A;  3J80 Z;  1W36 D;  3BZK A;  4WXC A;  5BNG A;  4ANJ A;  1YIT I;  4HPQ A;  1WRJ A;  4ZZD A;  2MLK A;  4RB1 A;  2HFH A;  3C7J A;  4LK0 F;  1O3T A;  2XAJ A;  2HR3 A;  2ZSI B;  2EIJ H;  4L9N A;  3DKY A;  3HOX J;  1DPU A;  1B9N A;  3MKZ A;  2LRE A;  1K78 B;  1OCP A;  5DM6 F;  2KIS A;  4KMF A;  4RM3 A;  5C4X J;  4HQE A;  4A3B J;  4B43 A;  3HRS A;  1ZGA A;  5FD6 A;  3PO3 J;  1PVE A;  1FEX A;  1X3W B;  1SFX A;  3PFI A;  4FE4 A;  4FET A;  1MBF A;  1A04 A;  3J7A Y;  4M3D A;  2EFQ A;  2EFN A;  2KPM A;  3HGG A;  2VPR A;  3MN2 A;  1F36 A;  3Q5F A;  1MDM B;  1TQP A;  5EEG A;  2QQA A;  2WC2 A;  3R0A A;  3JRI A;  1XGS A;  3I0T A;  1XMX A;  1YFH A;  1P4X A;  3ROU A;  4MQ9 F;  2ME6 A;  2VQG A;  4XKC A;  2XV4 S;  2DMT A;  1OCR H;  3OSF A;  2K86 A;  1BI3 A;  3IUO A;  2XSD C;  4RLQ A;  4L5J A;  2XGE A;  3MZH A;  1JKQ C;  3IH2 A;  4QTR A;  1XMA A;  3T5X A;  1IRZ A;  2XRN A;  5FRM A;  2WV1 A;  2JN6 A;  1HLV A;  3OY9 A;  3L2U A;  1FZP B;  4PFO A;  5LGN A;  2XGC A;  2DXI A;  1FTZ A;  1OCO H;  3WGI A;  4NBQ A;  3S3O A;  4XSX F;  1KU3 A;  4L0Z B;  2GQQ A;  4IHT A;  5HNF A;  1PP7 U;  5IP7 J;  3EUH C;  2D1V A;  3LST A;  1Z77 A;  5B5E C;  4WX9 A;  5EG0 A;  3QU3 A;  3ZMV A;  1F5T A;  4C3I J;  3CCY A;  1O57 A;  2DOF A;  3W2W A;  5HOD A;  3ABK H;  1EKE A;  3TED A;  4IOA F;  5IYC J;  4HF0 A;  3BR6 A;  2BV6 A;  5DCF A;  1AWC A;  1S9H A;  2FU4 A;  4A6D A;  1M1E B;  3LWF A;  3BG7 A;  3PUF A;  4KUM A;  2ZBK A;  4OIR F;  4C2M J;  2UV1 A;  1UHW A;  4HV5 A;  3LQR A;  4OIN F;  1VQ5 I;  2O61 A;  1B4A A;  2M7B A;  1POG A;  2KQR A;  3A4C A;  5L3E A;  1NG7 A;  2F4O B;  1MMG A;  1Y0U A;  2CO5 A;  2L9N A;  3ISP A;  5LD2 C;  2KZV A;  2LRD A;  1K79 A;  2QGU A;  3BTL A;  2MD5 A;  4HG2 A;  4NQW B;  3JRB A;  2FSW A;  3L2Q A;  4HAM A;  1QPI A;  3FXQ A;  1O3Q A;  1SFE A;  1IG7 A;  1ZG3 A;  2FBK A;  4BE1 A;  3DQV C;  1X3U A;  3VYR B;  1YRN A;  1JT6 A;  5L3B A;  1RPW A;  4ON0 A;  2MW8 A;  2EV5 A;  3F8N A;  2F48 A;  2RQQ A;  1TC3 C;  3TOA A;  1B1B A;  3V7C A;  4U88 A;  2GXA A;  1OMI A;  2L7Z A;  3OR2 C;  4X6A J;  5FKL A;  2EIM H;  1FOY A;  2DFI A;  2UXN A;  3O8H A;  1MMS A;  1G6N A;  3H92 A;  2ZNZ A;  1I39 A;  3OYE A;  2HQN A;  2M4K A;  3S93 A;  5BOX A;  2AO9 A;  3O3K A;  2M2E A;  2JT1 A;  3UR3 C;  1MGT A;  1ON1 A;  1QZY A;  5HS9 A;  3HUG B;  3MQ0 A;  4LMY A;  2HTJ A;  1ZG5 A;  1R1V A;  2Y0M A;  2RKH A;  3BOQ A;  1K4T A;  1D3Y A;  2HKX A;  1OIS A;  3H3Z A;  1I6H J;  2W85 A;  1AKH B;  3OL3 A;  2A3S A;  2E7W A;  4GO1 A;  4OIP F;  3C3W A;  4M6Y A;  2VOD A;  5KCM A;  3W2V A;  2GBY A;  4GCV A;  3NEU A;  5JLW A;  1ZAR A;  1UJ8 A;  2OA4 A;  1V5G A;  4IF4 A;  4BXX J;  2XB5 A;  5JHF A;  3CDL A;  2DU9 A;  4IJA A;  1X1A A;  2AQE A;  3MEX A;  3J7A O;  4AID A;  2V79 A;  3FDY A;  4KIC A;  3IC7 A;  2PMU A;  1SVO A;  3IH4 A;  3GX4 X;  3WTT C;  1NH3 A;  1IN7 A;  3D5R C;  4F7Z A;  4D5F A;  1Y8R B;  2FD5 A;  3E5Q A;  1MZB A;  3HSF A;  4BJ6 C;  3JRG A;  5M5W J;  5FKK A;  2C6Y A;  1QO0 D;  5JI6 A;  2ZME B;  2XPU A;  2EIN H;  5B3S H;  3ONQ A;  2RDP A;  4LIT A;  3H5A A;  4BQQ A;  1B72 A;  3ZQF A;  2CQQ A;  1XMK A;  3F6O A;  1AA7 A;  1JKR C;  4ETS A;  1PUF A;  3LAP A;  3H5R A;  3ZR8 X;  1AKH A;  1G3Y A;  3A0B C;  1W36 C;  4UNO A;  1XGM A;  2E36 A;  1FYM A;  3I4M J;  3M7G A;  5JHU A;  3REO A;  3RJP A;  1ZR4 A;  3H35 A;  3FKJ A;  1X2N A;  3FXK A;  3D0S A;  1ZR2 A;  1Q1H A;  4XR6 A;  3M4O J;  4RDU A;  4D7M A;  3FZV A;  1UHM A;  4H4K C;  1MD0 A;  3QPL A;  3WTW C;  2NS8 A;  4N9H A;  1K6O A;  2CJJ A;  3KIO A;  2KJC A;  2WTE A;  2R0Q C;  1TW2 A;  5ILS A;  2WY8 Q;  3G4S I;  2H94 A;  1MNM C;  2KRC A;  1BI1 A;  1VFC A;  3CC4 I;  5CYV A;  2V1X A;  1A6Q A;  4Z2Y A;  4AD9 A;  4I6Z A;  4O3M A;  3D5L A;  3DP7 A;  5DUK A;  3F23 A;  3A0H C;  2KMU A;  2X6W A;  2R5Y B;  4I2O A;  3E7L A;  3G3Z A;  3BTC A;  3JSP A;  4P96 A;  1JTX A;  4C3H J;  2DBB A;  4BGD A;  4P1W A;  3HOZ J;  4PDK A;  3I4N J;  1RC9 A;  2OTJ I;  3HM5 A;  4WK8 F;  4U0V A;  3TW7 A;  3H3V K;  2CRG A;  2HDD A;  4KYW A;  4ABZ A;  2VAS A;  3PUB A;  4IXA A;  2CV1 A;  2Q8K A;  4HEA 2;  3GZN B;  2F5V A;  1FMW A;  1IW7 F;  1RZ4 A;  4IX7 A;  1U8R A;  3WTY C;  4HX4 A;  2KL4 A;  1YJW I;  1N78 A;  3KP5 A;  4C2T A;  3B02 A;  4L18 B;  2EQR A;  4ZYE A;  2CGP A;  3Q9S A;  3F21 A;  2X51 A;  4XLF A;  1YYV A;  1MH4 A;  4HZF A;  2QQ9 A;  1T8I A;  2VJ5 A;  3SHF A;  3P9K A;  2EIL H;  4XID A;  3DPL C;  1PUE E;  1UST A;  4BE0 A;  1R36 A;  3I9V 2;  5E18 F;  2P5V A;  3DEE A;  4KMU X;  5F1R A;  1XGN A;  2E2J J;  4M3F A;  5KAI C;  2CUE A;  1QHG A;  2BXZ A;  3QP5 A;  3FK6 A;  3HPG A;  2COB A;  2COM A;  5D5W B;  2VOO A;  4CZZ A;  2KDZ A;  3ZPL A;  2TCT A;  4U0Y A;  1IN6 A;  4FX0 A;  2HQA A;  3GTG J;  4KIG A;  2ELJ A;  4N4N B;  1FOX A;  2XKP A;  4S0H B;  3ZQQ A;  3W6K B;  1FLI A;  2QA4 I;  3BR2 A;  1U0J A;  1ZGW A;  1VQK I;  5LRR A;  2HVQ A;  4TV7 A;  2HPI A;  3VYT B;  4JX4 A;  5GTI C;  2ZSH B;  3BQZ A;  1KYZ A;  4B1R A;  1HBX G;  1FIP A;  4J19 A;  1J7K A;  1RUO A;  2GIV A;  1FPQ A;  3RPQ A;  2ZCW A;  4DYQ A;  2ISZ A;  2B63 J;  2L5Q A;  3BR1 A;  3HBL A;  3OMY A;  3S16 J;  3ELK A;  2HKO A;  3HOV J;  1X3Z B;  2IPQ X;  1KU9 A;  3IRQ A;  1W5C C;  2M34 A;  2L02 A;  1UG0 A;  4U7D A;  4DQ2 A;  2AHQ A;  1FOK A;  1MKM A;  4XLA A;  2CQX A;  2G9W A;  2V1D A;  4A0X A;  3WTS C;  2XVC A;  2M0M A;  5J3L A;  2CYY A;  1R4M B;  2VQH A;  3PIP F;  1R71 A;  2MC3 A;  4DIQ A;  1HSJ A;  2Y69 H;  1D1B A;  5C4J J;  2ELH A;  2ZC2 A;  2LDU A;  1LQ1 A;  1U9N A;  3E5X A;  3OIQ A;  4LK1 F;  2ETH A;  1ENH A;  4UB6 C;  4CDG A;  2FOK A;  3A01 B;  4B44 A;  1NK2 P;  1I3Q J;  3EET A;  3GLL A;  2OD5 A;  5F0C A;  4ZTJ A;  3AL0 C;  3LSM A;  1D8K A;  1WJF A;  2R4G A;  3LSJ A;  3CCM I;  4BQN A;  1DU6 A;  3TP0 A;  2LY1 A;  1ETV A;  2JVH A;  3CO6 C;  1KQ9 A;  3HOU J;  2E2H J;  4A2U A;  2EFO A;  2Z2S B;  4KIS A;  3K70 D;  2Q0O A;  4BAY A;  1FYK A;  5IYD J;  3RQI A;  2PFB A;  1F1Z A;  1Y1V J;  1D1C A;  1U5T B;  3F8F A;  3LA7 A;  3PNT A;  4G6D A;  5CVV A;  1LB2 A;  1I1S A;  5LRS A;  1JKP C;  1SD6 A;  3U1D A;  3KET A;  2LY2 A;  4CIC A;  2KIU A;  2E5N A;  3WG9 A;  2E60 A;  3OYD A;  3CES A;  3S8P A;  5IOZ A;  2CS3 A;  2JMW A;  1P2F A;  1MBJ A;  1G59 A;  5F0H A;  2OBP A;  3ERE D;  3A01 A;  1XD7 A;  2QWW A;  3PL8 A;  3ZMU A;  2WB1 A;  1ZEL A;  1XSD A;  2H8R A;  1TNT A;  1PP8 F;  3DBR B;  4MO7 A;  4UUT A;  2NVX J;  1BL0 A;  1BW5 A;  3OWT A;  2V6C A;  4PJL A;  4G94 A;  4BJ5 C;  5FLM J;  1ZRC A;  4CCN A;  2IGK A;  6PAX A;  1LFP A;  2NOG A;  1XPX A;  3ZOB A;  4Y52 J;  4O6J A;  2DA5 A;  2A6H F;  2O9L A;  1Y8Q B;  3V4G A;  3F22 A;  2WAD A;  1T08 B;  2M30 A;  4R8H A;  2WAQ A;  2Y0S A;  2R5Z B;  3LSH A;  4P9F A;  1Y56 A;  4ZDO A;  2NVU B;  2K7L A;  2XUB A;  4JX5 A;  3W2A A;  3BZ6 A;  3LA3 A;  1U5T A;  1FY7 A;  4KN7 X;  4IRI A;  2A5W A;  2HPM A;  4QIW N;  1GDT A;  3W6V A;  3EYI A;  4BNC A;  2I5U A;  3RKY A;  3PFY A;  4HNT A;  2CG4 A;  3HDD A;  2CWE A;  2HS5 A;  4ZYD A;  4XOP A;  5J1U A;  2L7K A;  1ZN2 A;  2R7D A;  1BOB A;  1BR4 A;  3AKZ A;  2H1K A;  4ENN A;  2RNJ A;  3E97 A;  3S3M A;  2IP2 A;  3QP6 A;  2ZJP F;  4J01 A;  2YSR A;  1H8A C;  2QKM B;  3D1N I;  1B8I B;  5E8G A;  5DYM A;  2MA3 A;  2L7M P;  1LE8 B;  2ECC A;  4PJM A;  5JVT A;  3KFW X;  2Y2Z A;  3BR0 A;  4IQ4 A;  3IH3 A;  5M5Y J;  3WTZ A;  2Y0S N;  2LKP A;  2AS5 F;  5A2Q Z;  2KRF A;  5EGO A;  2QSH X;  3K6G A;  4WXH A;  4ITV A;  5KAF C;  4G12 A;  1C0W A;  2O3F A;  4OOI A;  1ZRF A;  3CCV I;  4KJZ A;  4RB3 C;  2PMZ N;  3Q3S A;  4JYK A;  1G3W A;  4NB5 A;  2CUJ A;  2VIX A;  1MMD A;  1U78 A;  2Q2E B;  4Q5S F;  1MH3 A;  4A3C J;  2DDB A;  3CQZ J;  4RMN A;  1KYW A;  1YLF A;  2OV7 A;  4AVP A;  2D1H A;  2OJE D;  3VEP A;  4C9Y A;  1EV7 A;  3KP3 A;  4MIM A;  2R7Q A;  5L3D A;  2FML A;  1YJN I;  1XDU A;  2QBY B;  2GXB A;  4YIR X;  4M3E A;  2LBF A;  2M7A A;  1BW6 A;  1OYI A;  2IXS A;  1FSH A;  4BS9 A;  3CCJ I;  1IDZ A;  1AU7 A;  4XRS A;  4A93 J;  2TDX A;  5E1W A;  3CLQ A;  3OYM A;  2LMD A;  5ERI A;  1HXD A;  3S1R J;  4I0A A;  4WWC A;  1UFM A;  4RS8 A;  3C1D A;  3VB2 A;  4PJJ A;  4D7N A;  3MFK A;  4G7Z F;  3OL4 A;  3GF2 A;  2Y31 A;  4NC6 A;  4MTD A;  1XGO A;  2FBH A;  3L2R A;  3MKW B;  3L2V A;  1P4A A;  4YRV A;  2WBM A;  2O5R A;  2OAZ A;  4CHU A;  3GME A;  3ECH A;  5J8F A;  5F1J A;  3MMY B;  4XKV A;  2UZK A;  2MBF A;  1TBX A;  3K10 A;  1W5S A;  3F8C A;  4MLO A;  1I3A A;  1KQ0 A;  2L9R A;  4DBQ A;  2LK2 A;  4L9V A;  1J59 A;  1ZYR F;  1O3S A;  2CV0 A;  2GM4 A;  4KIB A;  2GIZ A;  3GFM A;  5B66 C;  4A3M J;  2EBI A;  4WF2 A;  4BQO A;  2N8G A;  3HOS A;  2LC2 A;  3ML6 A;  3FHZ A;  1Z6R A;  2VBZ A;  3KYD B;  4XRM A;  3S1Q J;  4CCO A;  4LOC A;  4BY7 J;  1R4N B;  4L9J A;  1SC7 A;  4RAY A;  1HW2 A;  4B3A A;  5DD8 A;  1VQ6 I;  3CCQ I;  1LVA A;  3BDD A;  2QM3 A;  4M6X A;  3BCA A;  2PBI A;  1WJ5 A;  2BE5 F;  4F92 B;  3MCZ A;  1ETO A;  3AG1 H;  3HKZ A;  1LUJ B;  2QEN A;  4BH9 A;  3GUD A;  3FMR A;  3JRD A;  4GYI A;  2YU3 A;  4XIC A;  4IHS A;  3M9A A;  3M07 A;  3FX3 A;  4FAS D;  5IOY A;  3SFZ A;  3ZQH A;  3VDX A;  5EDN A;  1LDK B;  3B73 A;  3QYE A;  4V2F A;  3CMM A;  1JUP A;  2P7V B;  3BLY A;  3BQY A;  3R61 A;  1DDN A;  2JA7 J;  4AU7 A;  2Q1Z B;  4LG0 A;  1TNS A;  3ABU A;  3HOW J;  4A3L J;  3FXM A;  3HSE A;  1TQM A;  2R7T A;  3HHG A;  1JJ6 C;  2RVC A;  3BC8 A;  2FJ1 A;  3OYF A;  3K70 C;  2F2E A;  2L0K A;  1WJA A;  1LKX A;  1LFB A;  3RSN A;  2JVG A;  1VQ4 I;  2GWR A;  1EH6 A;  1O4X A;  4IRH A;  3AL0 B;  1A5J A;  4NDL A;  2X85 A;  3C2H A;  1MIJ A;  3ZGK A;  3I4P A;  4KN4 X;  1IAW A;  3HKZ N;  3U9G A;  3JRC A;  3BP8 A;  2IA1 A;  1U2W A;  2KRH A;  1FOW A;  2P8T A;  3J7Z I;  1HW1 A;  2CUF A;  4A3I J;  2H27 A;  2PLY A;  3H9G A;  2L01 A;  5IYB J;  4FTH A;  1R22 A;  3MVP A;  2V1U A;  3M3Y J;  2DO7 A;  4OMZ A;  5EG0 B;  4B4C A;  2CW8 A;  3G1O A;  1VF9 A;  2GA2 A;  3HZJ A;  1TWH J;  2EV6 A;  5LHH A;  1IF1 A;  2EA4 A;  2KDO A;  5IPA A;  3WGG A;  2RGV A;  3JTG A;  2A07 F;  3JRE A;  4XLN F;  2HDC A;  3QQA A;  5F27 A;  2HEO A;  4BEH A;  3GFJ A;  2VI6 A;  3CC2 I;  1G3S A;  2XGD A;  4UHT A;  5M3M J;  1KON A;  1S3J A;  4A3D J;  1XCB A;  3KZZ A;  1QRY A;  2EIK H;  4LLN A;  4UY8 I;  3PSI A;  3P9C A;  3CUO A;  3QWL A;  4Y3O A;  1SAN A;  4RB0 A;  2IGM A;  3VFZ A;  2FF4 A;  1UEL B;  2F5D A;  4RGS A;  1UAA A;  2JSC A;  2DPD A;  2MC4 A;  5D8K B;  2NOJ B;  3BRO A;  4XLC A;  5FKN A;  4DJA A;  2MGQ A;  2HXO A;  4YFK F;  2VOP A;  1T38 A;  2P4W A;  1YRN B;  3L00 A;  3CJR B;  2VKD A;  2E7X A;  5F04 A;  2O03 A;  5F08 A;  1W1W E;  4PSW A;  3WU2 C;  2HWV A;  2VC0 A;  1SFO J;  2K85 A;  2L2O A;  3KP2 A;  4EVI A;  2G0E A;  1U6G A;  1ZK8 A;  3KP4 A;  1R00 A;  3C2G A;  3HTS B;  4L5I A;  5D8L B;  5BS6 A;  2LYC A;  4UB8 C;  4BXF A;  3RKQ A;  3GCM A;  2FMY A;  1GXQ A;  3Q0W A;  3DV8 A;  2WAE A;  3B6A A;  2GLO A;  4AYB A;  3ZQL A;  5EF6 A;  4RM2 A;  4Y33 A;  2OQG A;  4UV8 A;  4LJZ F;  1TQI A;  4AIH A;  3OR1 C;  3EQL F;  1T56 A;  1EH7 A;  1WI9 A;  1A36 A;  2ZO4 A;  1KU7 A;  1SD7 A;  4JBA A;  2R7W A;  3TQN A;  2X9D A;  3DPU A;  1TT5 B;  4BDZ A;  1E3O C;  2V9V A;  4GXO A;  1YJ9 I;  2DA1 A;  1F4K A;  1BOA A;  4W1U A;  1TLH B;  2JSP A;  1ACI A;  2JUC A;  4A3J J;  5LHG A;  2JA2 A;  1ITY A;  2OC6 A;  4C30 A;  5KK1 A;  5J4Y A;  4LB5 A;  4OIO F;  3KP7 A;  3OYB A;  3U1K A;  1WQ2 A;  3ZMS A;  4J00 A;  1YS6 A;  4IOC F;  4MGR A;  2DLL A;  2DMQ A;  5DTD A;  2A6T A;  2Z33 A;  2H6C A;  1FJL A;  4AYB N;  3CC7 I;  4AVZ A;  1OLT A;  3BG9 A;  4N9I A;  1IO2 A;  1T0F A; 
#chains in the Genus database with same CATH homology
 2ZJ2 A;  2JPB A;  5IT9 K;  4HA8 A;  1LEA A;  3TO7 A;  3WTX C;  3SZP A;  2CSO A;  2PEX A;  3ZMT A;  2BGC A;  1B6A A;  1J75 A;  1U5T C;  3R60 A;  3IKV A;  2IA0 A;  3ABT A;  3IL2 A;  1OYW A;  1YIO A;  5H6R A;  3MWM A;  2HYF A;  4RGU A;  2ZNY A;  1J9I A;  1L3L A;  1OR7 A;  4A6E A;  3IHU A;  5K5R A;  3DF8 A;  4Q48 A;  2IT0 A;  1QPM A;  5ICF A;  5L3F A;  4ESB A;  5D5V B;  5LEJ A;  3JSO A;  1NHA A;  1ZRE A;  5HS7 A;  4AIJ A;  3KLO A;  1T6S A;  3NQO A;  2D45 A;  3BWG A;  5K5O A;  3QOP A;  4Y17 A;  3GXO A;  3LFK A;  1D8J A;  2A68 F;  5HDK A;  2DW4 A;  2NYX A;  4QWQ A;  1ZLK A;  4QLC U;  3KZY A;  1XCV A;  4M72 A;  2HYG D;  1IXR C;  4BHP A;  5H20 A;  2CFX A;  3RDI A;  4HDU A;  3DPT A;  4KDP A;  3Q9V A;  3ECO A;  3TOB A;  3FWE A;  4B09 A;  4JQF A;  1LDD A;  4HLX A;  1O7F A;  4HF2 A;  2JTV A;  5FFZ A;  3H3U A;  4P5O A;  5DCM A;  3QU6 A;  4M9X A;  3FXU A;  2VT2 A;  4ZYH A;  1LJ9 A;  3I59 A;  4MEY F;  3QRF F;  2O6G E;  2ESH A;  2ZFW A;  5DEQ A;  3L2C A;  1R23 A;  3WTV C;  4M9S A;  4P9U A;  1Z7U A;  2ACJ A;  1HKT A;  2G7H A;  2EV0 A;  2BYV E;  2KKO A;  3BJ6 A;  1VTN C;  5J8C A;  2D2W A;  3IWZ A;  4CXF A;  1R5H A;  1ULY A;  5HVQ C;  3HRU A;  1CGP A;  5FFX A;  1XSX A;  1FP1 D;  1MJB A;  1E17 A;  5HLH A;  3T1B A;  5HLG A;  3K9T A;  3GVA A;  5L3C A;  1FP2 A;  4ESJ A;  4FX4 A;  1V4R A;  4IRG A;  1I1G A;  5D5X B;  2NNN A;  5CVJ A;  4UV9 A;  2HQR A;  1YW9 A;  5ED4 A;  2HTS A;  2NS0 A;  4EM2 A;  4MNU A;  1USS A;  1REP C;  3OOP A;  2P5L C;  4ZZL A;  2W84 A;  5LLQ A;  2W24 A;  1LEB A;  4BXU A;  2EB7 A;  2KIM A;  2E1C A;  3R0J A;  4EM0 B;  1OPC A;  5ICG A;  3K1M A;  2L4M A;  4YIF A;  3VOE A;  2PJP A;  1FC3 A;  1ZAO A;  4UUV A;  2RV8 A;  1YS7 A;  2L54 A;  2FA5 A;  4G6Q A;  1IXS B;  3FMS A;  5FLX Z;  2VC1 A;  3IRR A;  1KU2 A;  1HQC A;  5BQT A;  3RKW A;  3E6B A;  4M73 A;  3IKT A;  4JK1 X;  4HX8 A;  2PN6 A;  3DXJ F;  3T0Y A;  2M87 A;  4YG2 F;  4AWX B;  1J2X A;  3HOT A;  3FMQ A;  3U2R A;  2K4B A;  4RAZ A;  3J81 Z;  1G4D A;  1H9G A;  2GXG A;  4YFX F;  4G9Y A;  1OYY A;  3JTH A;  4KNY A;  4I7H A;  2X0L A;  3V8L A;  3E5U A;  3WE3 A;  5D4S A;  4GYG A;  2XAF A;  1JGS A;  4HBL A;  2XGX A;  4OU0 A;  4XSZ F;  5ILV A;  2VXZ A;  2VBY A;  3GFL A;  1Z05 A;  4I09 A;  1GXP A;  4UVC A;  1LNW A;  4AIK A;  3MAJ A;  2L3D A;  2EJR A;  4ENK A;  3ZMZ A;  1BIA A;  2XAG A;  4CO8 A;  1ZHF A;  2P6T A;  4EMS A;  5AON A;  1Z1D A;  2PQ8 A;  3QPH A;  5IT3 A;  2W25 A;  4Q47 A;  3RPU A;  3V8J A;  2NNY A;  4EQQ A;  2DQR A;  3I64 A;  1IRF A;  3F6V A;  1FYL A;  3M8E A;  4BHB A;  2F5F A;  2M5W A;  2YPR A;  3FM3 A;  1IN5 A;  3WU0 A;  3CO7 C;  4DNC A;  1GVJ A;  1P6R A;  1T98 A;  5CLS A;  3FXR A;  1UB9 A;  4U0W A;  2VN2 A;  3KCC A;  1K7A A;  3CDH A;  3WU1 B;  4GGG A;  4A0Z A;  3I71 A;  2JRT A;  3SQN A;  1SFU A;  1HKQ A;  4HYE A;  4R79 A;  2YX4 A;  1R58 A;  4ESF A;  5AIP A;  2M45 A;  2K02 A;  3E6M A;  1AOY A;  4G7O F;  1FBU A;  3GLX A;  1U3E M;  2OZU A;  4LD5 A;  3KLN A;  4UVB A;  1FWZ A;  2A61 A;  3TKY A;  2XAH A;  3WOD F;  3I5U A;  3DEU A;  4KT5 C;  5ICC A;  3JAM K;  1DPR A;  2DT5 A;  1ZGJ A;  4L0Y B;  2RN7 A;  5DD4 A;  4ZH4 F;  1J0R A;  4LG0 B;  4YII A;  4H0E A;  2K27 A;  1FBQ A;  2MLG A;  1YW8 A;  3HYI A;  4MQV A;  1LDJ A;  3RIR A;  3KEO A;  3ZN1 A;  1FSE A;  1BC7 C;  2P5K A;  2QZ8 A;  1I5Z A;  2MH2 A;  2P7C B;  5E1Z B;  2AXL A;  3RI4 A;  1CF7 A;  5KVR A;  2JZY A;  2Z3Y A;  4EJV A;  4KIF A;  3PQJ A;  2WWY A;  2R3S A;  3HIF A;  2WV0 A;  3E6C C;  5HLI A;  3LQQ A;  3GFI A;  3KP6 A;  2J5O A;  3R6S A;  5ICE A;  3COA C;  5CVU A;  2ISY A;  1YO5 C;  3VOD A;  4EV0 A;  3I58 A;  2VBX A;  4IPA A;  3G73 A;  5HDN A;  1ODD A;  2IA2 A;  3EDP A;  3KE2 A;  4M71 A;  1MJA A;  4HW0 A;  2UWM A;  4PGH A;  2Y48 A;  2RC4 A;  4HF1 A;  4RGX A;  3CUQ A;  1S8N A;  3O6B B;  5A2Q K;  3F72 A;  3IWF A;  2XAQ A;  4KA4 A;  2QQB A;  5IT9 Z;  3HRM A;  1BBY A;  1W7P A;  1JXS A;  1QBJ A;  4OMY A;  4EJW A;  1W5T A;  1SAX A;  1DUX C;  2O0Y A;  1R7J A;  4HQM A;  1WKM A;  2XKO A;  5ILU A;  2GAU A;  2DPU A;  4EM1 A;  2JPC A;  2EFP A;  2VE9 A;  2DQL A;  3GW2 A;  2XRO A;  5E20 A;  3P9I A;  1S6L A;  1ZLJ A;  2H09 A;  2FQ3 A;  3BPV A;  5F6F A;  1TTY A;  1O3R A;  2EK5 A;  4RGR A;  2QUF A;  1K78 A;  1T39 A;  3CTA A;  1JE8 A;  3SXY A;  1O7L A;  2OU2 A;  2STW A;  1E2X A;  4HOB A;  5K5Q A;  4K2E A;  1B59 A;  2DAO A;  2M8E A;  3GEZ A;  3TDU C;  1MDM A;  2GZW A;  2FBI A;  1ZG1 A;  5TRD A;  3DKW A;  3K69 A;  3KEQ A;  2KIF A;  4I02 A;  5E17 F;  4ZYG A;  1P92 A;  1WSU A;  5LHI A;  4YFN F;  1W7P D;  3TGN A;  3J80 K;  4KFC A;  3L7W A;  2FE3 A;  3ZQ7 A;  1HW5 A;  1QZZ A;  4HV6 A;  2Z9O A;  5L3G A;  4Y13 A;  1L0O C;  3F8B A;  2A5Y B;  1XSV A;  3WGH A;  5FB2 A;  1RIO H;  3GYH X;  3HTU A;  1I6X A;  2FRH A;  1BI0 A;  2R7F A;  3GO5 A;  2FEZ A;  2X4H A;  1IN4 A;  1HST A;  2L4A A;  5CVR A;  4NQW A;  3P7N A;  4G8X A;  3HHH A;  5LGT A;  2DTR A;  3WE2 A;  3T8R A;  3GZ5 A;  3FM5 A;  3LA2 A;  5J6X A;  3E3V A;  4XRF A;  1IUY A;  1ONV A;  2B0L A;  2GA1 A;  4U7B A;  4MTE A;  5LEK A;  4LLG F;  3TO9 A;  1HKS A;  2YR2 A;  5DCM B;  4EJU A;  1BC8 C;  4ENM A;  2LNB A;  1XN7 A;  4XLP F;  5LGU A;  5FO5 A;  4I0B A;  2DK8 A;  3HUG A;  2STT A;  3I59 B;  4N0B A;  1OKR A;  1S7O A;  3LAJ A;  5TJJ A;  3ZP5 A;  1PDN C;  3RKX A;  4E70 A;  1EH8 A;  2OZ6 A;  1Z6T A;  2BEO A;  2QLZ A;  2O8X A;  1IN8 A;  4R1H A;  1BI2 A;  1SD4 A;  5BPD A;  1IRG A;  2P6S A;  5FD5 A;  2F5C A;  1FBS A;  2ZME A;  4B8X A;  3K1P A;  1RNL A;  3BJO A;  3BY6 A;  4IVN A;  5BMZ A;  2XHK A;  2RQP A;  1T2K A;  4A5N A;  4ENJ A;  4O5V A;  1ZRD A;  5JFR A;  4RB2 C;  4HDV A;  1Z91 A;  5CVI A;  1D5V A;  1BM9 A;  3S2W A;  1SMT A;  1MJ9 A;  2IW5 A;  3MZY A;  1TW3 A;  3TDZ C;  3RYR A;  1S7A A;  2QYO A;  3C18 A;  4S04 A;  3AAF A;  4BQA A;  2CQK A;  1P4W A;  1QQI A;  1YG2 A;  4Y15 A;  1H0M A;  2M1B A;  2KJB A;  2LF8 A;  5D6F A;  1IZ1 A;  1RI7 A;  1GHC A;  1G3T A;  3N4M A;  1FNN A;  4A5M A;  1JHF A;  4L9T A;  2PI0 A;  3CUQ C;  1SD5 A;  4PGG A;  1KQ8 A;  3ULQ B;  2ESN A;  5DV5 A;  1QGP A;  1ZH5 A;  3TO6 A;  3M8F A;  4EGY A;  2EFW A;  1YW7 A;  1F9N A;  1UCR A;  1V3F A;  4G7H F;  4CYD A;  5JR3 A;  3O2P E;  2NRA C;  2NAZ A;  1RUN A;  2ZXJ A;  3EUH A;  1H9T A;  2FNP A;  3E6D A;  1XDS A;  3QAH A;  2ADU A;  5HOO A;  4UXN A;  5AIQ A;  5H6Q A;  2A6E F;  4LGW A;  2F5E A;  1B9M A;  3BPX A;  2VE8 A;  4EGZ A;  1S29 A;  3I54 A;  2EA2 A;  1I27 A;  4BHC A;  2G7U A;  3CLO A;  1BIB A;  3M1E A;  2HOE A;  2QVO A;  3ZMD A;  4I01 A;  2VON A;  5DDG A;  3F8M A;  3JAM Z;  5HDG A;  2HZT A;  2BBY A;  2DI3 A;  1XB4 A;  2HGC A;  3JW4 A;  3V7R A;  1YQA A;  5E8I A;  2MH9 A;  2Z5U A;  5E1X A;  5EEH A;  2A69 F;  1Z9C A;  1W4M A;  3V7S A;  1ON2 A;  3BJA A;  4LB6 B;  2FNA A;  3SZT A;  1QNT A;  4BYY A;  3N97 A;  4WXD A;  5HS8 A;  3PQK A;  4FHT A;  2K4J A;  2J5P A;  5LBQ A;  2W57 A;  2YX7 A;  4MEX F;  2IJL A;  1BJA A;  2IRF G;  4A12 A;  5DUI A;  4ASN A;  5FGM A;  5K1Y A;  1BN5 A;  4D0P A;  3DFG A;  3QPT A;  4A0Y A;  5F64 A;  5D6E A;  3FF5 A;  3GWZ A;  4HX7 A;  3K1N A;  4LFU A;  3RYP A;  2PMH A;  2PG4 A;  1R1T A;  2UXX A;  4P55 A;  4MHG A;  2LSO A;  5FLX K;  2Y75 A;  4M9Z A;  4NHJ A;  3ZN0 A;  2LF7 A;  1CF7 B;  3V8K A;  1IXC A;  4XBF A;  5CJ9 A;  4LLL A;  1KGS A;  3R4K A;  2IVM A;  2Z99 A;  3I53 A;  5D4R A;  4PCQ A;  3J81 K;  1KA8 A;  2E1N A;  4CGZ A;  3K0L A;  3CJN A;  3RTR A;  5D5U B;  1WWX A;  3OV8 A;  2Q2E A;  1FX7 A;  2ZKZ A;  2XIG A;  4UVA A;  1JHH A;  4OIQ F;  4EJO A;  3WTU C;  4FT8 A;  1R1U A;  2OQR A;  2XAS A;  2QBY A;  4I98 B;  3CUQ B;  2VT3 A;  3L09 A;  1J5Y A;  4HLY A;  3HRT A;  3W6J B;  2EWN A;  1W7P B;  5BPI A;  3GZ6 A;  2DK5 A;  4S05 A;  1FT9 A;  2VBW A;  4WCG A;  1R5G A;  1YTY A;  1DP7 P;  3EYY A;  4PZJ A;  3HSR A;  2CW0 F;  4EJT A;  3L9F A;  3NRV A;  2H6B A;  3F3X A;  3T8T A;  1SMY F;  4Q4Z F;  3K2Z A;  4M74 A;  2FXA A;  3J80 Z;  4WXC A;  1WRJ A;  4ZZD A;  2MLK A;  4RB1 A;  2HFH A;  3C7J A;  4LK0 F;  1O3T A;  2XAJ A;  2HR3 A;  4L9N A;  1DPU A;  1B9N A;  1K78 B;  4KMF A;  4HQE A;  3HRS A;  1ZGA A;  5FD6 A;  1SFX A;  3PFI A;  1A04 A;  2EFQ A;  2EFN A;  3Q5F A;  1MDM B;  1TQP A;  5EEG A;  2QQA A;  2WC2 A;  3R0A A;  1XGS A;  3I0T A;  1YFH A;  1P4X A;  3ROU A;  4MQ9 F;  2XV4 S;  2K86 A;  1BI3 A;  4L5J A;  3MZH A;  1XMA A;  3T5X A;  2XRN A;  1FZP B;  5LGN A;  3WGI A;  4L0Z B;  4XSX F;  1KU3 A;  2GQQ A;  4IHT A;  1PP7 U;  2D1V A;  3LST A;  4WX9 A;  3QU3 A;  3ZMV A;  1F5T A;  1O57 A;  4HF0 A;  2BV6 A;  5DCF A;  1AWC A;  2FU4 A;  4A6D A;  3LWF A;  4KUM A;  2ZBK A;  4OIR F;  4HV5 A;  1UHW A;  4OIN F;  3LQR A;  2O61 A;  1B4A A;  5L3E A;  1Y0U A;  2CO5 A;  3ISP A;  1K79 A;  2MD5 A;  2FSW A;  4HAM A;  3FXQ A;  1O3Q A;  1SFE A;  1ZG3 A;  2FBK A;  3DQV C;  1X3U A;  5L3B A;  4ON0 A;  2EV5 A;  3F8N A;  3TOA A;  1B1B A;  3V7C A;  4U88 A;  1OMI A;  2UXN A;  2DFI A;  1G6N A;  3H92 A;  2ZNZ A;  2HQN A;  5BOX A;  3O3K A;  2JT1 A;  1MGT A;  1ON1 A;  1QZY A;  5HS9 A;  3MQ0 A;  4LMY A;  2HTJ A;  1ZG5 A;  1R1V A;  2Y0M A;  2RKH A;  3BOQ A;  1D3Y A;  2HKX A;  3H3Z A;  2W85 A;  2A3S A;  2E7W A;  4GO1 A;  4OIP F;  3C3W A;  4M6Y A;  2VOD A;  4GCV A;  3NEU A;  1ZAR A;  2OA4 A;  4IF4 A;  2DU9 A;  4IJA A;  3MEX A;  3J7A O;  2V79 A;  4KIC A;  3IC7 A;  2PMU A;  3GX4 X;  3WTT C;  1IN7 A;  4F7Z A;  3E5Q A;  1MZB A;  3HSF A;  2C6Y A;  1QO0 D;  5JI6 A;  2ZME B;  2RDP A;  3F6O A;  1XMK A;  4ETS A;  3LAP A;  1G3Y A;  4UNO A;  1XGM A;  1FYM A;  3M7G A;  5JHU A;  3REO A;  3RJP A;  3D0S A;  1Q1H A;  3FZV A;  1UHM A;  1MD0 A;  3WTW C;  4N9H A;  1K6O A;  2KJC A;  2WTE A;  1TW2 A;  5ILS A;  2H94 A;  1BI1 A;  5CYV A;  2V1X A;  4Z2Y A;  4AD9 A;  4O3M A;  3D5L A;  3DP7 A;  5DUK A;  3F23 A;  4I2O A;  3G3Z A;  3JSP A;  4P96 A;  2DBB A;  4PDK A;  4WK8 F;  4U0V A;  4KYW A;  4IXA A;  2Q8K A;  1IW7 F;  1RZ4 A;  1U8R A;  3WTY C;  4HX4 A;  3KP5 A;  3B02 A;  4L18 B;  4ZYE A;  2CGP A;  3Q9S A;  3F21 A;  1YYV A;  4HZF A;  2QQ9 A;  3SHF A;  3P9K A;  3DPL C;  1PUE E;  1UST A;  1R36 A;  5E18 F;  2P5V A;  4KMU X;  5F1R A;  1XGN A;  3QP5 A;  2COM A;  5D5W B;  2VOO A;  4CZZ A;  3ZPL A;  4U0Y A;  1IN6 A;  4FX0 A;  4KIG A;  2XKP A;  3W6K B;  1FLI A;  5LRR A;  4TV7 A;  1KYZ A;  1HBX G;  1J7K A;  1RUO A;  2GIV A;  1FPQ A;  3RPQ A;  2ZCW A;  2ISZ A;  3ELK A;  2HKO A;  2IPQ X;  1KU9 A;  3IRQ A;  2L02 A;  4U7D A;  4DQ2 A;  1FOK A;  1MKM A;  2G9W A;  2V1D A;  4A0X A;  3WTS C;  2XVC A;  2CYY A;  2MC3 A;  1HSJ A;  2ELH A;  2LDU A;  1LQ1 A;  3E5X A;  4LK1 F;  2ETH A;  4CDG A;  2FOK A;  3EET A;  2OD5 A;  1D8K A;  3CO6 C;  1KQ9 A;  4A2U A;  2EFO A;  2Q0O A;  4BAY A;  1FYK A;  2PFB A;  1F1Z A;  5CVV A;  1U5T B;  3F8F A;  3LA7 A;  4G6D A;  1LB2 A;  1I1S A;  5LRS A;  1SD6 A;  3U1D A;  3KET A;  4CIC A;  2KIU A;  3WG9 A;  1P2F A;  2OBP A;  3ERE D;  1XD7 A;  2QWW A;  3ZMU A;  1XSD A;  1TNT A;  1PP8 F;  2V6C A;  4G94 A;  1ZRC A;  6PAX A;  4O6J A;  2A6H F;  3V4G A;  3F22 A;  2M30 A;  4R8H A;  4P9F A;  2K7L A;  2XUB A;  3BZ6 A;  3LA3 A;  1U5T A;  1FY7 A;  4KN7 X;  4IRI A;  3EYI A;  4BNC A;  3RKY A;  2CG4 A;  2CWE A;  2HS5 A;  4ZYD A;  1ZN2 A;  2R7D A;  4ENN A;  2RNJ A;  3E97 A;  1T0F A;  2IP2 A;  3QP6 A;  2YSR A;  5E8G A;  5DYM A;  2MA3 A;  5JVT A;  3KFW X;  3WTZ A;  2LKP A;  2AS5 F;  5A2Q Z;  2KRF A;  4WXH A;  1C0W A;  2O3F A;  4OOI A;  1ZRF A;  4RB3 C;  4NB5 A;  1G3W A;  1U78 A;  4Q5S F;  1KYW A;  1YLF A;  4AVP A;  2D1H A;  3VEP A;  1EV7 A;  3KP3 A;  5L3D A;  2FML A;  1XDU A;  2QBY B;  2GXB A;  1OYI A;  1FSH A;  2TDX A;  5E1W A;  5ERI A;  1HXD A;  4I0A A;  4WWC A;  1UFM A;  4RS8 A;  3C1D A;  3VB2 A;  4G7Z F;  3MFK A;  3GF2 A;  4MTD A;  1XGO A;  2FBH A;  1P4A A;  2OAZ A;  4CHU A;  3ECH A;  5J8F A;  2UZK A;  2MBF A;  1TBX A;  1W5S A;  3F8C A;  1KQ0 A;  4L9V A;  1J59 A;  1ZYR F;  1O3S A;  4KIB A;  3GFM A;  4WF2 A;  3HOS A;  3FHZ A;  3ML6 A;  1Z6R A;  2VBZ A;  4L9J A;  4RAY A;  1HW2 A;  5DD8 A;  1LVA A;  3BDD A;  2QM3 A;  4M6X A;  2PBI A;  2BE5 F;  3MCZ A;  2QEN A;  4BH9 A;  3GUD A;  3FMR A;  4GYI A;  2YU3 A;  4IHS A;  3M9A A;  3FX3 A;  3SFZ A;  1LDK B;  3B73 A;  3R61 A;  1DDN A;  2P7V B;  4LG0 A;  1TNS A;  3ABU A;  3HSE A;  1TQM A;  3HHG A;  2RVC A;  2F2E A;  2GWR A;  1EH6 A;  4IRH A;  3I4P A;  4KN4 X;  1IAW A;  3U9G A;  3BP8 A;  2IA1 A;  1U2W A;  2P8T A;  1HW1 A;  2H27 A;  2PLY A;  2L01 A;  1R22 A;  2V1U A;  2DO7 A;  4OMZ A;  2GA2 A;  2EV6 A;  5LHH A;  1IF1 A;  2EA4 A;  3WGG A;  2RGV A;  3JTG A;  2A07 F;  4XLN F;  2HDC A;  2HEO A;  3GFJ A;  1G3S A;  4UHT A;  1S3J A;  1XCB A;  3KZZ A;  4LLN A;  3P9C A;  3CUO A;  4RB0 A;  3VFZ A;  2FF4 A;  2F5D A;  4RGS A;  2JSC A;  2DPD A;  5D8K B;  3BRO A;  4YFK F;  2VOP A;  1T38 A;  2P4W A;  3L00 A;  2E7X A;  2O03 A;  2HWV A;  2VC0 A;  4EVI A;  3KP2 A;  1U6G A;  3KP4 A;  1R00 A;  3HTS B;  4L5I A;  5D8L B;  5BS6 A;  2FMY A;  1GXQ A;  3DV8 A;  2OQG A;  4UV8 A;  4LJZ F;  1TQI A;  4AIH A;  3EQL F;  1EH7 A;  1WI9 A;  2ZO4 A;  1KU7 A;  1SD7 A;  4JBA A;  3TQN A;  2V9V A;  4GXO A;  1F4K A;  1BOA A;  1TLH B;  5LHG A;  5KK1 A;  4LB5 A;  4OIO F;  3KP7 A;  1WQ2 A;  3ZMS A;  1YS6 A;  4MGR A;  2DLL A;  2Z33 A;  2H6C A;  4N9I A;  1STZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...