4EM1A

Staphylococcus aureus marr native
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
143
structure length
143
Chain Sequence
MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Uncharacterized HTH-type transcriptional regulator SAR2349
publication title Staphylococcus aureus MarR native
rcsb
source organism Staphylococcus aureus
total genus 32
structure length 143
sequence length 143
ec nomenclature
pdb deposition date 2012-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4em1A00
1KYZA 3WTWC 1OYYA 3W6KB 4LK0F 3GXOA 3BJOA 3L09A 1LDDA 2A6EF 3GEZA 4BQAA 1FSEA 2A5YB 4S04A 3HYIA 4BH9A 2W25A 3HSEA 3W6JB 4EJTA 4ASNA 1MGTA 1ZGAA 4IJAA 3F23A 2YSRA 3JSPA 2QZ8A 2DK5A 1HKTA 4I7HA 4CZZA 3KEQA 5AIQA 4LG0A 3F72A 4EMSA 2GAUA 2V6CA 2HKXA 1MJBA 1CGPA 1BBYA 2XRNA 2FE3A 3TGNA 3WGGA 2O03A 1ODDA 1ON1A 2QQ9A 3KFWX 5ICFA 2P4WA 3WU1B 4BXUA 2UWMA 2VN2A 3LQQA 2FXAA 3I5UA 3CJNA 5LGUA 4KMFA 2O3FA 1G4DA 1ZG3A 2A69F 2YX4A 2DPUA 4HX8A 4GO1A 5D5UB 1S7OA 4M74A 4XSZF 2RC4A 1P4AA 1I5ZA 2K02A 4EM0B 3LSTA 1ONVA 3FHZA 5AONA 1U78A 2HKOA 2BE5F 4ZYHA 4ENJA 1IXSB 1SMYF 2P5KA 4EM2A 5BPDA 4U7DA 3L00A 2FSWA 4A12A 4Q4ZF 3K0LA 3M8EA 1S29A 3GFMA 2E1NA 1XDSA 3J80Z 3J81Z 4I09A 2P7VB 1HW2A 2D1HA 5CVIA 4HBLA 2QM3A 5HS7A 5ICEA 2XUBA 1KQ0A 3RKYA 5D4RA 4GYGA 4A5NA 2KRFA 1NHAA 4XRFA 2XAHA 4EQQA 4MGRA 3RIRA 1TW2A 4O3MA 4A6DA 4HZFA 1HBXG 4RAYA 1P2FA 2EFNA 4WWCA 1SFUA 1R1VA 2D2WA 4I0BA 2XAGA 3V8JA 3BP8A 2H27A 5DEQA 1XD7A 1U5TB 2R7FA 4BAYA 2VC0A 2YR2A 2NYXA 1HKSA 1SAXA 2XKOA 2V1XA 2WWYA 2VT2A 2PN6A 3GFJA 5E1XA 1FP1D 4A2UA 1SFEA 1BIBA 5F1RA 4U0YA 1BI3A 3P9KA 1BC8C 3R6SA 2STWA 3TDZC 3ELKA 4WX9A 4RGRA 2STTA 3RTRA 1J7KA 2HOEA 3GZ5A 5JI6A 2QENA 3WODF 5JVTA 2JTVA 1G3TA 4KDPA 4L0ZB 3FM3A 1LQ1A 2CQKA 3BY6A 3MAJA 4AIJA 2VONA 1AWCA 1EH8A 3BROA 4LK1F 2G7HA 3I4PA 3Q5FA 5TJJA 1G3YA 3E5UA 2DU9A 2Z3YA 5A2QZ 1YG2A 4YFKF 4PGHA 1ZHFA 2NRAC 5A2QK 1S7AA 3WE2A 1G3SA 3T5XA 4DNCA 3IKVA 4IRGA 2MLKA 5BMZA 3FMQA 4GYIA 3DFGA 1QQIA 2J5OA 1T2KA 1TNTA 2RKHA 4CYDA 3HRUA 4Y13A 3WG9A 1REPC 2RNJA 3K9TA 3OOPA 2L02A 4ENKA 3WTSC 1FX7A 2ESHA 5TRDA 1TTYA 2M30A 5D8KB 3P9CA 3RJPA 3IRQA 4UHTA 2GQQA 3TO9A 1RUOA 1XGMA 4G8XA 1QZZA 1XGNA 1EH7A 4I98B 2W24A 2DI3A 5CVUA 4OIOF 3U1DA 3H92A 2R3SA 4IXAA 5DUKA 2ADUA 1TQMA 2A68F 4O6JA 2CW0F 3F6OA 1IN6A 4IRIA 5CVVA 2IA2A 3NQOA 2G9WA 4G6QA 3U2RA 2VODA 1D5VA 2D45A 2ZMEB 4M71A 4RAZA 1HKQA 1IUYA 2K27A 5H6QA 5HDGA 4R1HA 4N9IA 2FMYA 3U9GA 4ESFA 5CYVA 1BI1A 3R61A 2VC1A 1TLHB 4QWQA 3TOBA 3HTUA 1LNWA 4L9TA 1P4WA 2DQLA 3F22A 3BPVA 1KQ9A 4CDGA 4HLXA 2JT1A 4ZYEA 5ERIA 3E3VA 4KN4X 3SXYA 2FU4A 3COAC 3VB2A 4ESBA 2RV8A 4KNYA 3JW4A 2OAZA 1FLIA 2GXBA 2CGPA 4M9SA 3E6MA 3V8LA 4TV7A 2KIMA 2YU3A 4KIFA 4KUMA 2L4AA 2F2EA 2X0LA 3WU0A 3WE3A 4CXFA 3ZPLA 3E97A 1PP7U 1B4AA 3F8NA 5IT9K 1XMAA 2EA2A 1YS7A 3NEUA 2EFPA 4UVCA 2FMLA 4CHUA 3QPHA 4YG2F 5E8IA 3MZHA 3KE2A 4U0WA 3O3KA 1BJAA 1HSTA 4H0EA 4HDVA 4HV5A 1U5TA 4HV6A 1O7FA 4HAMA 3C1DA 4D0PA 3ERED 3LQRA 1P92A 1OMIA 4FHTA 1UHMA 5LHHA 1L3LA 4I02A 1PUEE 4WF2A 3DF8A 1V4RA 1WSUA 3R4KA 1R5HA 3ZMVA 2ELHA 4OIRF 3FF5A 2MD5A 3I64A 3RPUA 4L9VA 1ZARA 1YW9A 3GFIA 2MH9A 2LKPA 1TBXA 2NNNA 4PCQA 1T38A 3HHHA 1R1TA 4I2OA 5AIPA 3VFZA 5FB2A 2TDXA 3EYYA 3RKWA 5E8GA 2M87A 3EQLF 4K2EA 3M1EA 3C3WA 2QQBA 2HYGD 3WTZA 1Z9CA 1H9GA 2VXZA 5EEGA 4AIKA 4A0YA 3BPXA 1RZ4A 4WXDA 2NAZA 5CLSA 1HW1A 4HDUA 3N97A 1R1UA 1QGPA 1BIAA 2IJLA 4NB5A 2JPCA 3GUDA 1P4XA 3P9IA 3GLXA 2FNPA 4AIHA 1YO5C 5D5XB 2FQ3A 3R60A 2JSCA 1OYWA 4A6EA 1S6LA 2DO7A 1YLFA 4XLPF 5L3EA 3HTSB 2E7WA 1FYKA 2PI0A 4B8XA 1FY7A 5FFXA 4LFUA 3P7NA 5E18F 1O3RA 1HW5A 4OMZA 2BYVE 3OV8A 3PQJA 1LEAA 2UXXA 2V9VA 1R58A 3PQKA 4XSXF 5E17F 3DP7A 2HTSA 4YIIA 2B0LA 2AXLA 1BI2A 5L3CA 3O6BB 2IVMA 2JPBA 1O57A 1KQ8A 1D8KA 4I0AA 5HVQC 4LB5A 1IRFA 1FBQA 4Q5SF 3R0AA 5JFRA 3GF2A 3KP5A 3ABUA 3CO6C 5JR3A 3SZPA 2E1CA 2P8TA 2ZMEA 1MKMA 4B09A 1J2XA 1MZBA 3Q9SA 3QPTA 3HRTA 2VT3A 1U2WA 3TKYA 2P7CB 2KKOA 2PG4A 3EETA 2FBHA 3ZMDA 2C6YA 3V4GA 2XGXA 3E6DA 4YFXF 1IRGA 2M1BA 3K2ZA 3ZN0A 2BV6A 1R5GA 2MLGA 3J80K 1IXRC 3J81K 4EJUA 1QPMA 2PFBA 1QO0D 4LLNA 3K69A 5DD4A 4BYYA 1J9IA 2COMA 2RGVA 4RB3C 4HQMA 3I53A 1UB9A 3CUQB 2IA0A 3VEPA 1USTA 1R36A 4BHCA 4IF4A 1YQAA 4L9JA 4LLLA 3WTTC 2FBIA 1O3QA 2ZO4A 1OR7A 2FNAA 1W5SA 2MC3A 1ULYA 4ZZLA 5LHGA 5F6FA 2Y48A 1Z7UA 3DPLC 1XSVA 2XHKA 4G6DA 4KICA 4PGGA 4MTEA 1UHWA 4G9YA 5D5VB 3BWGA 3EDPA 5D5WB 5L3BA 2FA5A 2E7XA 5BOXA 1ZG1A 2QWWA 2XV4S 3KZZA 2BEOA 3RKXA 2W84A 1W4MA 5CJ9A 2MBFA 3D0SA 3K1NA 3NRVA 4UVAA 1KU3A 3F8CA 1MJ9A 1YYVA 4HF0A 3QOPA 1LJ9A 6PAXA 3B02A 3PFIA 1ZGJA 4XLNF 1U6GA 3H3ZA 4G7OF 3MZYA 1YW7A 5J6XA 4ESJA 4RS8A 3IWFA 1K79A 1I6XA 2IT0A 1USSA 2UXNA 5IT3A 2OU2A 1EV7A 4P96A 3MQ0A 5LRRA 2DAOA 2R7DA 1XCVA 2ZKZA 2ACJA 4FX0A 2KIFA 5FD5A 4R79A 5L3DA 3SFZA 4UUVA 4LD5A 5DYMA 4HA8A 3TO6A 3HSRA 1W7PB 1B9NA 3RYPA 4G94A 1HSJA 2EJRA 1YW8A 2EFWA 5HOOA 4MQ9F 1FP2A 2BGCA 1MJAA 1Z1DA 1WQ2A 3E5QA 1Z6TA 1GVJA 2QBYB 1T39A 1R23A 1DPRA 2HQRA 4O5VA 5HLGA 5HLHA 1Y0UA 3E5XA 2M45A 4UV8A 2HS5A 1ZRCA 4JK1X 3V7CA 5D4SA 3IRRA 1TQIA 2H6BA 1ZRDA 1F5TA 1ZG5A 3G3ZA 2F5EA 2MA3A 3V7RA 2PLYA 3LWFA 4XBFA 3GW2A 4MQVA 2J5PA 5FFZA 5FLXZ 3QP5A 2PMUA 3KP2A 1F9NA 3QAHA 3FXRA 1PDNC 3HUGA 3JSOA 1CF7B 5LEJA 4KA4A 1K78B 3CO7C 2LSOA 4RGUA 5H6RA 4ENMA 1T0FA 5CVJA 2RVCA 4KFCA 5L3GA 2VE9A 3GX4X 2WV0A 3GYHX 1V3FA 3T1BA 2P6TA 2RN7A 4RB0A 5BQTA 1ZRFA 5DUIA 4WCGA 4ZH4F 3F8MA 4GCVA 3IHUA 3M9AA 3I71A 1FT9A 1GHCA 3ZP5A 3AAFA 5HDKA 1ZYRF 2Q8KA 5DCMB 2K4BA 3QP6A 3ROUA 3LFKA 4FT8A 5E1WA 5F64A 3V7SA 3WGIA 4HOBA 5ILUA 4M72A 1O7LA 3CDHA 4KN7X 2YX7A 1XGOA 3VODA 1B6AA 2EA4A 1S3JA 2DLLA 1FYLA 3DXJF 3C18A 1IW7F 2V79A 4ZYDA 2ZFWA 2DK8A 2W57A 5JHUA 5LGNA 5K1YA 5EEHA 1YIOA 4MHGA 4ENNA 4EV0A 1AOYA 2QLZA 2FF4A 1ZREA 1WRJA 3F21A 2GWRA 3FWEA 2GA1A 4Q47A 4EGZA 1T6SA 4KMUX 4A5MA 1GXPA 4OMYA 1J75A 2VOOA 1JE8A 5LEKA 2ZCWA 1ZH5A 3T8TA 1XSXA 3CUQA 1GXQA 2PEXA 3BOQA 4L18B 4KT5C 5J8FA 2O61A 3FMRA 2P6SA 1RNLA 4P5OA 5DD8A 1YTYA 4MEXF 4BHPA 2KIUA 2ZBKA 1DP7P 3ULQB 2A07F 2F5DA 5HS9A 4RB2C 3MEXA 3M7GA 2IRFG 4FX4A 1FOKA 3DQVC 2BBYA 2EV5A 2XAFA 2HDCA 5LRSA 3TDUC 1B1BA 1STZA 4GGGA 1QNTA 4PDKA 3IKTA 4OINF 1LVAA 3CLOA 4U7BA 2GXGA 5L3FA 1XMKA 1F4KA 2KJCA 3I0TA 2DW4A 3JTGA 3KP3A 4OU0A 3JAMZ 2X4HA 1FYMA 1C0WA 3JAMK 1U5TC 2XAQA 1WI9A 2VBWA 1D8JA 3RYRA 2DT5A 2O8XA 4HLYA 4PZJA 3IC7A 2Z5UA 2M8EA 4UNOA 4RGXA 4HX4A 1EH6A 1KA8A 3WTXC 2D1VA 5HS8A 1BOAA 1IN5A 1W7PA 4OIPF 2H09A 4M6YA 4M9XA 4NHJA 2L01A 1FC3A 5E20A 4EM1A 4MNUA 2IP2A 1ZN2A 1ZAOA 3FMSA 5BS6A 3I59B 3KLOA 4LMYA 1XDUA 5D6EA 3LAJA 1SMTA 4RGSA 2QBYA 2ZNYA 3R0JA 2LDUA 5DCFA 5ICGA 1T98A 3QRFF 3F8BA 3L9FA 3HSFA 2O0YA 5FO5A 4AD9A 2L4MA 1SD5A 4AWXB 4QLCU 1DPUA 1ON2A 2P5LC 1U8RA 2Y0MA 5FGMA 1SD4A 3V8KA 1PP8F 1BC7C 3KLNA 1VTNC 4NQWA 3WTUC 5DDGA 1KU9A 1CF7A 2QQAA 2XASA 4A0ZA 4P9FA 4Z2YA 3REOA 3GWZA 2FRHA 1K78A 1JGSA 4L0YB 5ILVA 4M73A 2WTEA 3MWMA 5FD6A 2XAJA 2V1UA 3ZMTA 3KP7A 3CTAA 3ISPA 2DBBA 4EVIA 4M9ZA 2EK5A 1MDMB 1IF1A 3KCCA 1B9MA 1JXSA 2IW5A 2EFOA 4BHBA 2QUFA 1IXCA 3FXUA 4I01A 5DCMA 5K5OA 1I1GA 2EFQA 4WK8F 5K5RA 2K86A 2CFXA 2ESNA 2Z33A 1WWXA 1RUNA 3MFKA 4ZYGA 4A0XA 2A6HF 2WC2A 4L5IA 1LDJA 2HFHA 2MH2A 4F7ZA 1P6RA 1I27A 1FZPB 1H9TA 2VBZA 3LAPA 3ZMUA 2H94A 2LNBA 2L54A 2OD5A 3GO5A 3HRMA 4UXNA 2Q2EA 2M5WA 2YPRA 4JQFA 4E70A 2HYFA 1TW3A 1BM9A 2XIGA 1Z05A 3RI4A 2AS5F 3EYIA 1BI0A 4EJVA 4DQ2A 1IN8A 3M8FA 2DTRA 2PBIA 3KP6A 4IHSA 1SFXA 1TNSA 2PJPA 3H3UA 1LEBA 1FWZA 5HDNA 2HEOA 2RQPA 1J0RA 4P9UA 2IA1A 4BNCA 4S05A 2HR3A 5LGTA 3IL2A 3D5LA 1J59A 5H20A 4EJOA 4JBAA 1G6NA 1OYIA 1ZLKA 1XB4A 2HGCA 2P5VA 1LB2A 1KGSA 2Z9OA 5HLIA 3ECOA 2CG4A 4L5JA 3T0YA 4U0VA 4ZZDA 2A61A 2HTJA 3L2CA 1O3TA 1W5TA 3MCZA 1FBUA 2HQNA 4Y17A 3T8RA 2VBYA 1FSHA 4YFNF 1KU2A 1WKMA 2OZUA 1ZLJA 1SD6A 4CGZA 4L9NA 2A3SA 5K5QA 1XSDA 3Q9VA 2CWEA 3IWZA 5ILSA 2EWNA 2DFIA 1I1SA 4OOIA 5KVRA 5D6FA 3GZ6A 2ETHA 2W85A 3HOSA 2GIVA 3KETA 1OPCA 2LF7A 4HW0A 5CVRA 1U3EM 2HZTA 5D8LB 2EB7A 3BJAA 2G7UA 1KYWA 2LF8A 4AVPA 3C7JA 2VBXA 2ISYA 1R22A 4KIGA 4Q48A 3F3XA 4GXOA 1XCBA 2Y75A 1R00A 2L3DA 1HXDA 3LA2A 4U88A 3J7AO 3BZ6A 3HHGA 2QYOA 4KYWA 4LG0B 1G3WA 2K7LA 3FM5A 4MTDA 3GVAA 1JHFA 2CSOA 2K4JA 3K1MA 2NS0A 3JTHA 3I59A 1DDNA 1XN7A 2DQRA 1E17A 3ABTA 4IVNA 5ED4A 3HOTA 1R7JA 1RI7A 4R8HA 4ETSA 1K6OA 3ECHA 4CO8A 5FLXK 3E6BA 3G73A 4UV9A 2F5FA 4IHTA 1D3YA 3DKWA 3WTVC 4Y15A 4EGYA 4IRHA 2GA2A 3TQNA 4EJWA 3QU3A 2XVCA 2GZWA 3CUOA 1YFHA 3DV8A 4N0BA 2QVOA 3TOAA 4N9HA 4HX7A 2FEZA 1FBSA 5KK1A 2JRTA 1E2XA 4HF2A 1F1ZA 5LLQA 1S8NA 5J8CA 2F5CA 1IZ1A 4MEYF 1QZYA 2ZNZA 1MDMA 5E1ZB 5ICCA 3I54A 1Q1HA 2JZYA 2OZ6A 3RPQA 2FOKA 3GFLA 3WGHA 4YIFA 2XKPA 3B73A 2HWVA 1H0MA 3RDIA 2V1DA 3EUHA 3BDDA 3LA7A 3SZTA 3SQNA 2ISZA 4KIBA 1UCRA 1BN5A 1Z6RA 2OQRA 1IN4A 2PMHA 1LDKB 4LLGF 1QBJA 3VOEA 1IN7A 2RDPA 1KU7A 2OQGA 1A04A 4LGWA 1UFMA 1K7AA 2O6GE 5IT9Z 2OBPA 3QU6A 1B59A 5BPIA 1W7PD 1HQCA 4OIQF 1MD0A 3HIFA 1Z91A 3F8FA 4M6XA 2PQ8A 3I58A 3ZN1A 4RB1A 2UZKA 2OA4A 2CO5A 2XROA 2EV6A 2ZXJA 3BJ6A 4CICA 3HRSA 3F6VA 2Q0OA 1J5YA 3SHFA 4UVBA 2DPDA 2H6CA 3FX3A 1OKRA 2EV0A 3KEOA 1JHHA 2VE8A 3FXQA 1YS6A 4IPAA 1O3SA 4G7ZF 1L0OC 2NNYA 3N4MA 1X3UA 2IPQX 3KZYA 1FPQA 3CUQC 4LJZF 2KJBA 2ZJ2A 3ZQ7A 3DEUA 4G7HF 2Z99A 1SD7A 4P55A 1TQPA 3S2WA 4LB6B 1XGSA 1DUXC 5DV5A 3WTYC 2FBKA 1RIOH 3ML6A 1FNNA 3E6CC 3ZMZA 5LHIA 3ZMSA 3O2PE 2CYYA 1IAWA 4HF1A 4WXHA 3TO7A 4HYEA 3FZVA 3K1PA 3DPTA 3KP4A 4WXCA 2VOPA 4HQEA 5LBQA 4ON0A 3LA3A 3L7WA
chains in the Genus database with same CATH superfamily
1KYZA 2KPMA 3QQAA 3WTWC 1OFCX 1OYYA 3CCJI 3KPHA 3W6KB 3W2AA 4XOPA 4LK0F 3GXOA 1JKRC 3BJOA 1N78A 3L09A 1E3HA 4BDZA 1LDDA 1YITI 2BY2A 2JA2A 2A6EF 3GEZA 1X2MA 4BQAA 1BR2A 3EPZA 1FSEA 2NOJB 2A5YB 4S04A 3HYIA 2L2OA 4BH9A 2W25A 3HSEA 3K7AJ 3ABMH 3NWTA 3W6JB 4XRMA 3S17J 4BEHA 3H9JA 1FOWA 4EJTA 4CCKA 4ASNA 1MGTA 3K4BA 1ZGAA 3DTIA 4IJAA 3F23A 3CCVI 1VQNI 2DT6A 2YSRA 3E7LA 2QZ8A 3JSPA 3G6EI 2PJRA 2DK5A 1HKTA 4I7HA 4CZZA 3OYHA 3KEQA 4UUTA 1Z3YA 2WY7Q 5EZHA 3S1QJ 5AIQA 1K83J 2E19A 5HODA 5BNGA 3G2BA 1V55H 5EYRA 4N4OB 4LG0A 4AM3A 3F72A 4EMSA 2GAUA 2V6CA 1RETA 2HKXA 2LKSA 1MJBA 1CGPA 4RAFA 4BY7J 2HOSA 1BBYA 5K7HA 3CP8A 2M9HA 2XRNA 2FE3A 3TBIA 3OL3A 3UKGA 2JK3A 3TGNA 3WGGA 2O03A 1ODDA 1ON1A 1X2NA 2QQ9A 3KFWX 4BL0B 5ICFA 2P4WA 4V2FA 2JN6A 4I99C 3WU1B 4BXUA 2UWMA 4BBSJ 2VN2A 3LQQA 3PSIA 1FMVA 3F9KA 2FXAA 2ZFUA 2V26A 2ECCA 2LK2A 4XONA 3I5UA 3CJNA 3IH3A 5LGUA 1PJRA 3K4JA 3VYSB 4RLQA 4KMFA 1XTAA 2O3FA 5J4VA 3CCEI 3S2DJ 1G4DA 3IUOA 3MN2A 1ZG3A 3H35A 2LG4A 1A6QA 2CQXA 3FDYA 2A69F 3CJTB 2XGEA 4Y3OA 2CQ7A 2YX4A 3OIOA 4ZC3A 1ZTRA 2DPUA 4HX8A 3KYDB 4GO1A 2DT7B 5D5UB 1S7OA 4Z6YA 4M74A 1RR7A 4XSZF 2RC4A 1P4AA 1I5ZA 2K02A 3K4LA 4EM0B 4F52A 2K5CA 4PJNA 4BQNA 3LSTA 2KISA 1ONVA 3FHZA 5AONA 1U78A 2HKOA 2BE5F 4ZYHA 4ENJA 1IXSB 4UB6C 1WH7A 1SMYF 2P5KA 2HQ5A 4EM2A 5BPDA 4U7DA 1KONA 2WB1N 3L00A 1IDZA 2FSWA 3BT9A 2O8KA 3Q0UA 4FQGA 1MH3A 4Y4RA 4A12A 4Q4ZF 3RZDJ 3K0LA 3M8EA 2F5VA 2ELKA 3E0JB 3DPUA 1S29A 3GFMA 2E1NA 1XDSA 3M1CA 3BR0A 3J80Z 3LMMA 3J81Z 1K4TA 2V9KA 4I09A 2P7VB 4QTRA 1HW2A 2D1HA 3S2HJ 2QCOA 5CVIA 3GLLA 4HBLA 2QM3A 3OYLA 5HS7A 4B48A 5ICEA 2XUBA 1KQ0A 2LBFB 3RKYA 4GYGA 5D4RA 4A5NA 2KRFA 3M3YJ 5FROA 5GTHC 1NHAA 4XRFA 1UAAA 2XAHA 4EQQA 4MGRA 2QEXI 3HOWJ 2LP0A 5GAEJ 1DP3A 3RIRA 2KRCA 1VQOI 1TW2A 4O3MA 3B6AA 4A6DA 4HZFA 1HBXG 1FTTA 4RAYA 5C3EJ 3DBLB 1P2FA 2EFNA 2M7BA 3QYEA 4WWCA 2JVGA 1SFUA 1R1VA 2WAEA 2D2WA 3IH4A 4I0BA 3SEQA 2XAGA 3V8JA 4HRIA 3BP8A 2H27A 5DEQA 5GAGJ 2CW7A 2CV2A 1XD7A 1U5TB 5C4JJ 2CRGA 2R7FA 4BXXJ 4BAYA 2VC0A 2YR2A 1Y8RB 2NYXA 1HKSA 4FTHA 3CD6I 3LL7A 4IKFA 3CCRI 3RQ4A 1SAXA 2XKOA 2V1XA 1JUMA 2IGNA 3DEWA 2WWYA 4YEJA 2VT2A 4MO7A 2PN6A 3GFJA 5E1XA 1FP1D 4A2UA 1SFEA 1GV2A 1BIBA 2HVRA 1MBEA 5F1RA 3BZCA 4II2A 4U0YA 2CUEA 3HGYA 5F0HA 2VJ4A 1FEXA 1BI3A 3P9KA 1BC8C 1S5LC 3R6SA 2STWA 2MSYA 3FXKA 4BE1A 3TDZC 1W1WE 5C44J 2R7OA 3ELKA 4RGRA 4WX9A 5DS9A 2STTA 2TRTA 2M8GX 3RTRA 1J7KA 3WHCA 2HOEA 3RZOJ 3U1KA 3GZ5A 5JI6A 2O9LA 1LE8A 3CC7I 3TMOA 1HC8A 3NAUA 2QENA 2QQ8A 3WODF 1OISA 5JVTA 2KDZA 3P5JA 3AG1H 2JTVA 1D0ZA 3QYBA 4X6AJ 2IAIA 1G3TA 2R4GA 4CYCB 4KDPA 4L0ZB 3FM3A 1LQ1A 1WHUA 2CQKA 3BY6A 3MAJA 5IYDJ 4AIJA 2VONA 1AWCA 5EG0B 3JRAA 1JTXA 3S32A 1K4SA 1EH8A 1EKEA 3NWSA 3BROA 4HEA2 3MD2A 2X6WA 4OAYA 4LK1F 4DW6A 2G7HA 3I4PA 3Q5FA 2R7SA 2L7FP 5TJJA 2DFFA 1G3YA 2GBYA 3E5UA 2DU9A 2Z3YA 1XPXA 5A2QZ 1T95A 1BR1A 1OCRH 1YG2A 1JKQC 1FOYA 1TWCJ 4YFKF 3JRCA 5FKMA 4PGHA 1XX5A 3G4SI 2MYSA 4MLOA 3CZ6A 3OIPA 2DXIA 1ZHFA 5CKTA 1ZQ3P 2NRAC 5A2QK 2AHQA 2WA0A 3DLAA 2XSDC 2WBMA 1S7AA 3WE2A 3WU2C 2DN0A 1M1EB 1G3SA 3T5XA 4DNCA 3IKVA 4IRGA 2MLKA 3HKZN 3OS2A 5BMZA 1NK3P 3FMQA 4GYIA 5C4XJ 3DFGA 1QQIA 4ZDPA 2J5OA 1NK2P 2COBA 1T2KA 1TNTA 2RKHA 4CYDA 3HRUA 4Y13A 2NOGA 3OS0A 3WG9A 5K7ZA 2B9SA 1MBFA 1REPC 2RNJA 3K9TA 3OOPA 4RAGA 3JREA 3AL0B 2P81A 1X1DA 2L02A 3GBGA 3G1OA 3G1MA 2K3FA 2X48A 5CPRB 4ENKA 4AU7A 5JLWA 3BCBA 3GZNB 3FK6A 3M8JA 3WTSC 1MMSA 4Y33A 1FX7A 2ESHA 5TRDA 1TTYA 2M30A 2Z16A 5D8KB 1R6RA 4D7MA 3P9CA 3MKYB 3RJPA 3OY9A 4UHTA 2GQQA 3IRQA 4JOMA 1V5FA 3TO9A 1X1BA 2OV7A 3ZXSA 1RUOA 1XGMA 2CQQA 2I5UA 3CCQI 4G8XA 4YELA 3L2RA 3A01B 1QZZA 1ITYA 2WY8Q 1XGNA 1EH7A 3SYTA 2BVMA 4I98B 4ZDLA 1TWHJ 2W24A 1TP4A 2DI3A 5CVUA 5TGTA 4OIOF 1JKPC 3U1DA 4IHYA 1SVOA 1X1PA 3H92A 2R3SA 3OWTA 4IXAA 3X2QH 4XORA 4DIQA 5DUKA 2ADUA 1TQMA 5J1RA 2A68F 1RR8C 2VPRA 4O6JA 2CW0F 3F6OA 1IN6A 2VASA 4IRIA 4RBOA 3FBIB 5E3LA 1RKTA 2LH9A 1WZ2A 2JA5J 5CVVA 5E3MA 3TW7A 1YX3A 2IA2A 3KYCB 2G9WA 3NQOA 2LR8A 4G6QA 2E60A 3BTCA 4M3DA 3AFHA 2HI3A 3U2RA 4HNTA 1J09A 2W00A 2PMZA 1TL8A 2VODA 1D5VA 2D45A 2ZMEB 4AIDA 2YUSA 2VKDA 1HF0A 1MW7A 1R5ID 3OSFA 4M71A 3ZRGA 2BY3A 1VQ9I 4RAZA 1HKQA 1IUYA 2K27A 5H6QA 5HDGA 2JQ7A 3H5RA 4R1HA 2IXSA 4N9IA 2FMYA 3U9GA 4ESFA 2DA5A 5CYVA 2HPIA 3K6GA 1BI1A 3R61A 4BUPA 4F92B 4HSTA 4PJJA 4BJ6C 2VC1A 1TLHB 2E35A 4QWQA 4PK4A 3TOBA 1H8AC 1WFXA 3HTUA 2LVSA 4ZJZA 5EGOB 4IHVA 1LNWA 4L9TA 1P4WA 4CCOA 2OPTA 2QSFX 3W2WA 4DYCA 3GCMA 2XPUA 4JYKA 3FK7A 4B47A 3BR3A 4MFEA 4XQFA 3SDGA 2X1DA 4LG3A 1JKOC 2WADA 2DQLA 3F22A 1W5CC 1P9QC 3BPVA 1KQ9A 2OUMA 4CDGA 1X3ZB 5DM6F 1BR4A 4HLXA 2M2EA 4BQQA 1ACIA 2JT1A 2UV1A 2XAUA 4ZYEA 4DGWB 5ERIA 1LFPA 1WGXA 3E3VA 1VZ0A 4JP0A 4KN4X 2E71A 3SXYA 2FU4A 4JX6A 5F08A 3COAC 3VB2A 4ESBA 4PSXA 3S14J 2RV8A 3ZQGA 3CCUI 4KNYA 3JW4A 3LNQA 3ABKH 2OAZA 1FLIA 1OCTC 2X6OA 4LITA 2GXBA 5B3SH 3OL4A 2CGPA 4M9SA 3E6MA 3V8LA 4CCNA 4TV7A 2KIMA 2YU3A 4KIFA 3OYCA 2LBFA 3Q0WA 2A05A 1FMWA 3FXLA 4KUMA 2R93J 2L4AA 1RPWA 2F2EA 2X0LA 3WU0A 2EINH 3WE3A 4B43A 1XC5A 4CXFA 3OYFA 3ZPLA 4HNUA 3HC7A 2MFZA 2CUJA 3E97A 1PP7U 2QKLB 2CFOA 3PNTA 1B4AA 3F8NA 1LVKA 5KAIC 5IT9K 4E7SA 3JR9A 1WJAA 1XMAA 2EA2A 2M7AA 3KYLA 1YS7A 3NEUA 4M3EA 2EFPA 4UVCA 2FMLA 4CHUA 5IP9J 3CDLA 3QPHA 4YG2F 1RESA 3OYJA 4C3IJ 5GP9A 3HB9A 5E8IA 5HNFA 3KE2A 3MZHA 3PO2J 3MVPA 3SDBA 1JUSA 3EUHC 4U0WA 4IO9F 3O3KA 3ZQQA 1BJAA 1HSTA 1TC3C 1ZELA 4H0EA 2CV1A 4HDVA 1D1AA 4HV5A 1U5TA 4NC7A 3SZGA 4HV6A 1O7FA 2PMZN 4HAMA 4BDYA 1MMNA 2KMUA 3C1DA 4D0PA 3BR1A 3ERED 1WI3A 3LQRA 1P92A 3K4NA 1U9NA 4P1WA 1W0TA 4FASD 5JHFA 3D1NI 1OMIA 2L0KA 4FHTA 3D5SC 1UHMA 3UR3C 5LHHA 1L3LA 4I02A 4PFPA 1PUEE 1S7EA 2IS6A 2K9NA 4WF2A 2Y31A 3DF8A 4A3CJ 5CQGA 1E3PA 1V4RA 1WSUA 3R4KA 1R5HA 3ZMVA 2ZJPF 1ZGWA 2ELHA 4OIRF 3FF5A 2HPMA 2MD5A 3I64A 3NARA 3RPUA 4L9VA 1ZARA 1YW9A 2DCEA 2L9VA 3I56I 2HDDA 1QVTA 1RC9A 4JX4A 3QWLA 5IOYA 4XN0A 3DWLE 1YX5A 4XR6A 3GFIA 2W1OA 2MH9A 2LKPA 1TBXA 1ZKGA 2NNNA 4PCQA 1T38A 4QSHA 3HHHA 2IS2A 1ENHA 1D0XA 1R1TA 4JX5A 4I2OA 5AIPA 3VFZA 3IAS2 3L1PA 1OLTA 3O8GA 1JGGA 3ZQHA 5FB2A 3AG3H 2RNGA 2TDXA 2VKEA 3MZ8A 3EYYA 3RKWA 5E8GA 2M87A 1ETKA 2Y2ZA 3EQLF 4K2EA 2DMNA 3M1EA 4CYCA 4A3IJ 3C3WA 3HBLA 2QQBA 4W97A 2R7ZJ 2HYGD 3WTZA 1Z9CA 2E1MB 1H9GA 5EG0A 2VXZA 4XKVA 2LD5A 5EEGA 4S0HB 4A0YA 2L9SA 4AIKA 2V9PA 3BPXA 2CUFA 1YI2I 3D5RC 1HCRA 2DA1A 1RZ4A 4WXDA 4U87A 5B1BH 3H9QA 2NAZA 5CLSA 4NUBA 1HW1A 4HDUA 3N97A 2QF7A 4LOCA 4J01A 2XGCA 2R5ZB 1Z7LA 1R1UA 1QGPA 1BIAA 4EATA 3C2GA 1ETOA 2KZVA 3H5AA 1MIJA 2IJLA 2NVYJ 2OC6A 4NB5A 2DJIA 3VYTB 2JPCA 2BOLA 3GUDA 1P4XA 3P9IA 3GLXA 2FNPA 2MABA 4AIHA 1YO5C 5EZGA 3RCOA 2KL4A 5D5XB 1PUFB 3ZQIA 2FQ3A 3BQZA 3CJRB 3R60A 2JSCA 1OYWA 1UG0A 4BU2A 1OCOH 4II3A 4A6EA 1S6LA 3ZCOA 2DO7A 1MNMC 1YLFA 5IP6A 4NNJA 3A0HC 5L3EA 1VNDA 2E7WA 1Z67A 2VQLA 4XLPF 3HTSB 1FYKA 3HUGB 3I9V2 2PI0A 4B8XA 3QYFA 4XLAA 1FY7A 3H0DA 1Y1VJ 5FFXA 4LFUA 4PFOA 1Q1VA 2XF6A 3P7NA 3BZKA 2DOEA 5E18F 1O3RA 1HW5A 2NS8A 2QSGX 4OMZA 3S1NJ 2BYVE 3OV8A 3PQJA 1LEAA 2UXXA 5JLXA 5EEAA 2V9VA 2FUG2 1R58A 4IQJA 1X19A 4IEJA 3PQKA 3GTOJ 5B1AH 1V5GA 4XSXF 5E17F 1DGWY 3BG9A 2CMPA 3DP7A 3TEDA 2EQRA 4PJ0C 2HTSA 1X1CA 3A01A 4YIIA 5F0FA 2B0LA 2DDBA 2AXLA 1BI2A 5L3CA 5F0CA 3CCSI 3ONQA 4ZDOA 3O6BB 2IVMA 2JPBA 2R7TA 1TWFJ 1O57A 5HNHA 2E34A 1KQ8A 1D8KA 4I0AA 5HVQC 4LB5A 1IRFA 1FBQA 5FKNA 1O4XA 4DBQA 4Q5SF 3R0AA 5JFRA 3IP4B 1OQYA 2XPVA 3BR2A 5FRMA 3GF2A 3KP5A 3ABUA 4XMYA 3CO6C 5JR3A 3SZPA 3LSPA 1Y8QB 3BR6A 2R0QC 5E3NA 4RM3A 2E1CA 2P8TA 2ZMEA 2GLOA 1I50J 1MKMA 4B09A 1J2XA 1MZBA 3Q9SA 2KQRA 3QPTA 3HRTA 4C3JJ 4C2TA 2VT3A 4ABZA 1U2WA 3TKYA 2P7CB 4BE0A 2KKOA 3HJEA 2PG4A 3EETA 2FBHA 1SAUA 3ZMDA 4W1UA 3V4GA 2C6YA 1QHHD 1ZK8A 2FX0A 1G8XA 3VSLA 3W3CA 2CW8A 2XGXA 3E6DA 4HSRA 4YFXF 2ZSHB 1IRGA 3HZJA 2M1BA 3K2ZA 1ZR2A 3PUBA 3ZGKA 5EGOA 1POGA 3ZN0A 2BV6A 3PIOF 1N25A 1R5GA 2MLGA 3J80K 1IXRC 3J81K 4EJUA 1QPMA 2PFBA 3A03A 1QO0D 3CMYA 3FBNB 3K69A 5CQEA 4LLNA 4Y52J 5DD4A 2K40A 1VQPI 4BYYA 2OF7A 1APLC 4FCYA 3OYDA 2CS3A 2JJ7A 1MBGA 1J9IA 2COMA 2RGVA 4RB3C 4HQMA 1X1AA 2L7ZA 2YS9A 4CZCA 5M5YJ 3I53A 1UB9A 3IH2A 3CUQB 3QPSA 2KHMA 2IA0A 3K4CA 1USTA 3VEPA 3A4CA 4L5EA 1R36A 1ETVA 3W2VA 4BHCA 4IF4A 1YQAA 4L9JA 4LLLA 1UHSA 2FBIA 3WTTC 1O3QA 2ZO4A 1OR7A 2A6TA 2FNAA 3HOUJ 1W5SA 2MC3A 1ULYA 5M3MJ 4D1QA 1IJWC 1SC7A 2DFHA 2ZJRF 2BXZA 4ZZLA 5LHGA 5F6FA 5LD2C 2N8GA 2Y48A 5B5EC 1Z7UA 4XRSA 3PL8A 2DDAA 1XSVA 2XHKA 3DPLC 4G6DA 4KICA 4PGGA 5J47A 5KNLA 2LY1A 4MTEA 1UHWA 1D1BA 2JSPA 4G9YA 5D5VB 3OYNA 3SJMA 3BWGA 3EDPA 1GT0C 1DGRM 5D5WB 1UJ8A 5L3BA 4KISA 2FA5A 4E6KG 1X3WB 3BTJA 2E7XA 5BOXA 1ZG1A 2QWWA 3HDDA 1TWAJ 2H1LA 1I3AA 2XV4S 2ZXIA 3KZZA 2BEOA 4XK4A 3W6VA 2L7MP 3RKXA 2CUZA 3H3VK 2EH3A 3JCUC 2W84A 1W4MA 2BXYA 2DODA 5CJ9A 2MBFA 4CA0A 3L2VA 1MSEC 3D0SA 3K1NA 4GDFA 3JRBA 3NRVA 4UVAA 3OS1A 1KU3A 3OIQA 3F8CA 3ZR8X 1MJ9A 1YYVA 4HF0A 3QOPA 1LJ9A 5J1UA 2BY0A 6PAXA 3B02A 2WV1A 4BACA 3PFIA 4EEFG 1AA7A 2ZJQF 1ZGJA 4XM3A 1XS9A 1NH3A 3CQZJ 1WJFA 4XLNF 2NVTJ 4B4CA 1U6GA 3QOEA 3H3ZA 4NDLA 4G7OF 3VWBA 3MZYA 1YW7A 3Q3SA 4F91B 5J6XA 4ESJA 4A3JJ 1EA3A 2HXOA 3DBRB 1UG2A 4RS8A 4HPQA 3IWFA 1K79A 1I6XA 1X4PA 3RQIA 2IT0A 1USSA 3VSKA 2W82A 2EZKA 2UXNA 5IT3A 4RMNA 1N77A 2Z1DA 1GUUA 2OU2A 1EV7A 4P96A 3MQ0A 5LRRA 2DAOA 2R7DA 1XCVA 2R7RA 2CU7A 1BJZA 2ZKZA 1B72A 3CCYA 3PFYA 2ACJA 2JA6J 4FX0A 4XICA 3C2BA 1IV8A 3F0CA 2KIFA 3CCLI 4FE4A 2HOTA 2VJJA 5FD5A 5IYBJ 4R79A 1QU3A 5L3DA 3SFZA 2ZXWH 4C2UA 2TCTA 4UUVA 2HU9A 1QZEA 4LD5A 5DYMA 3CF5F 4HA8A 3TO6A 3HSRA 3V42A 1W7PB 3L2UA 1MNDA 4M6VA 1JT0A 3OYKA 4UY8I 4MFDA 1B9NA 3RYPA 4G94A 1HSJA 1IG7A 1GVDA 1SVMA 1T08B 2EJRA 2O7OA 3OR1C 4DOZA 1YW8A 1FIPA 2EFWA 5HOOA 4MQ9F 1MSFC 1FP2A 2BGCA 3ERMA 1MJAA 2I10A 3KX2A 2ELJA 1Z1DA 1WQ2A 5FJ8J 3E5QA 1AHDP 5GPCA 5FLVA 2B63J 1Z6TA 1JI8A 1GVJA 2QBYB 3Q0VA 3WG7H 1T39A 3S15J 2XRLA 1JT6A 1DPRA 1R23A 2HQRA 4O5VA 1SFOJ 5HLGA 2R5ZA 5HLHA 1Y0UA 2BZTA 3E5XA 2M45A 4UV8A 4A69C 2HS5A 4OWRB 1ZRCA 3HPGA 4JK1X 3V7CA 5D4SA 3IRRA 1VQ4I 1SANA 1TQIA 5K7FA 2H6BA 1ZRDA 3TW6A 1F5TA 4BQOA 1ZG5A 3G3ZA 2F5EA 2VKVA 2MA3A 3V7RA 2PLYA 3LWFA 1PUFA 2CQNA 4XBFA 1Y1WJ 5FKOA 1WJDA 3GW2A 4MQVA 2J5PA 3HOVJ 3OYGA 5FFZA 5FLXZ 3QP5A 2PMUA 4AUXA 3IAM2 1MBJA 2QGUA 3KP2A 4NQWB 3OYAA 1F9NA 2VJ5A 1E3OC 3QAHA 2CJJA 3FXRA 1PDNC 3FISA 2F4IA 3HUGA 3JSOA 1CQTA 1CF7B 4XLHA 3LSRA 4M3GA 1VQ6I 4AYBA 5LEJA 4KA4A 1K78B 3CO7C 3BQYA 2LSOA 4RGUA 5H6RA 4ENMA 1T0FA 5CVJA 2XB5A 4C3HJ 4DBRA 1W0UA 3GTGJ 2RVCA 4KFCA 5L3GA 4XRSG 2VE9A 1YRNB 4XL9A 1FIAA 4DJAA 1K61A 3GX4X 1I39A 2EILH 2WV0A 4D9JA 3GYHX 1V3FA 2LKXA 3T1BA 2P6TA 2RN7A 4RB0A 3DKYA 5BQTA 1A35A 1GV5A 1ZRFA 3FIWA 1P7IA 3CLQA 5DUIA 2L5QA 3PUFA 4WCGA 4ZH4F 3JRFA 1GLNA 3F8MA 3LSMA 1W36D 4GCVA 2A5WA 2AO9A 1VFCA 1SFKA 3IHUA 3M9AA 3EUKL 3I71A 2KLOA 1FT9A 1GHCA 3ZP5A 3AAFA 5HDKA 1ZYRF 2Q8KA 2NVQJ 1DU6A 5DCMB 5J4YA 3CDIA 2K4BA 3QP6A 4NC6A 3ROUA 2X85A 3LFKA 5IP7J 1R9TJ 3S3NA 3DU6A 4FT8A 5E1WA 5F64A 1OCZH 1R4NB 4ITVA 3V7SA 3WGIA 4HOBA 3TP0A 5ILUA 2V4JC 1FJLA 4M72A 3CJQB 3O8HA 1O7LA 3CDHA 4KN7X 2YX7A 1XGOA 3VODA 1B6AA 3J7AY 3HPHA 2G0EA 2EA4A 1F36A 1VQ5I 1S3JA 2DLLA 2HVQA 4DZJA 2EZLA 1FYLA 3DXJF 3C18A 2ID6A 1IW7F 2V79A 4ZYDA 2ZFWA 2DK8A 5DTDA 4QPOA 2IGMA 1TT5B 3U21A 2W57A 1HOMA 5JHUA 2HYJA 5LGNA 2DA6A 2DA2A 5K1YA 5EEHA 1YIOA 4MHGA 2VL8A 3RPUD 4ENNA 4EV0A 1AOYA 1IGNA 2JRMA 2QLZA 5FKLA 4A3BJ 1PYVA 1TT0A 3BC8A 2Q2EB 2ZSIB 2Z2SB 2W48A 1SVLA 2DJNA 2FF4A 2M0MA 1ZREA 3GTPJ 4FETA 4UUSB 3HOXJ 1JTYA 4KJZA 1WRJA 3F21A 2LY9A 2JUCA 3FXMA 2GWRA 3FWEA 2EPFA 2GA1A 2RAEA 2KZGA 4Q47A 4EGZA 1T6SA 4KMUX 4A5MA 1GXPA 4IQ4A 4DZPA 4OMYA 1J75A 2VOOA 1JE8A 4I6ZA 5LEKA 2ZCWA 2P0WA 2MG4A 1ZH5A 2IEKA 5B66C 3I4NJ 3T8TA 1XSXA 3CUQA 4J19A 5IPAA 1T8IA 3TL4X 1GXQA 2PEXA 2DOAA 1OJLA 3I3LA 3BOQA 2D5VA 2DFEA 4L18B 1G59A 1Y56A 4KT5C 2VQGA 5J8FA 2VXDA 2O61A 3FMRA 2P6SA 5IY5H 1RNLA 4P5OA 5DD8A 1YTYA 2E5ZA 1IV6A 3SFIA 4MEXF 4BHPA 2VB6A 3BG5A 1R4MB 2KIUA 1PVEA 2ZBKA 1DP7P 3QODA 1MH4A 3ULQB 2A07F 2F5DA 5HS9A 1A5JA 4RB2C 3MEXA 3M7GA 2IRFG 2XF7A 2VI6A 4UB8C 2YU9J 1IRZA 4FX4A 3DTKA 3AKZA 2FD5A 1FOKA 3DQVC 2VJIA 5H2FC 3G71I 2BBYA 2EV5A 5KAFC 2XAFA 3AG2H 1TZLA 3JRDA 5LRSA 2HDCA 3TDUC 2E2JJ 1B1BA 2LFBA 3OR2C 1STZA 5GADJ 5KHDA 4GGGA 4YIRX 1QNTA 3H9GA 4PDKA 2X6XA 1EF4A 3IKTA 4OINF 4D5FA 4XKWA 1LVAA 3CLOA 4U7BA 2BY1A 5LFAA 2BHYA 2GXGA 4XLEA 2EZHA 2DA7A 1Z21A 5L3FA 1RKWA 1YJWI 3DLLF 1XMKA 3JRGA 1F4KA 2KJCA 2X1CA 3FXOA 2R92J 1A6IA 1W36C 4LIVA 3I0TA 2DW4A 2XB0X 3JTGA 1VQKI 3MKZA 3KP3A 3ZQLA 3HG9A 4OU0A 3PIPF 5IOZA 2F4OB 1Y0NA 3JAMZ 2FJ1A 2X4HA 4E7LA 1FYMA 4C2MJ 1C0WA 1P7JA 2X9DA 5E79C 1LKXA 4E7IA 3JAMK 1U5TC 1NG6A 2XAQA 1WI9A 2VBWA 1D8JA 5J3LA 4A93J 2DMQA 3RYRA 2DT5A 3L2WA 2F4MB 2O8XA 1ETYA 4HLYA 1U9OA 2Y0SA 4PZJA 4E7JA 2ICWG 3IC7A 3ZQCA 2V7FA 2Z5UA 2M8EA 4BE2A 4RGXA 1H89C 4UNOA 4HX4A 1EH6A 1KA8A 3A0BC 3ASOH 4M3BA 3WTXC 3S3OA 4AVZA 3K4KA 5E3OA 5KCMA 1S72I 2WB1A 2D1VA 1ETWA 1BOAA 1VI0A 5HS8A 3BCAA 1IN5A 2AXTC 1W7PA 2BVLA 2H09A 4OIPF 1AKHB 4M6YA 4M9XA 4NHJA 2ZXHA 3CESA 2L01A 1FC3A 3S3MA 5E20A 4EM1A 5EJCA 4MNUA 4BS9A 1LFUP 2IP2A 3DTEA 1ZN2A 1ZAOA 3FMSA 5BS6A 4LIUA 1A36A 3I59B 3KLOA 1LUJB 4LMYA 3PNVA 2DA4A 2R7UA 1WJCA 4YRVA 1XDUA 4GFBA 1E0EA 1MNEA 3FHNA 2XGDA 5D6EA 2XC7A 3CMMA 3OYMA 2DYSH 5IYCJ 3LAJA 2X1EA 1K6YA 1SMTA 3AG4H 3K4MA 2M3AA 4RGSA 4QPQA 2QBYA 2ZNYA 3R0JA 3HXLA 3CC2I 2LDUA 5DCFA 5ICGA 1T98A 1D1CA 3QRFF 1HLVA 3QPLA 3F8BA 1UZCA 4H4KC 3L9FA 3IV5A 3HSFA 2O0YA 5FO5A 4AD9A 4BGDA 4IX7A 2L4MA 1SD5A 4AWXB 4QLCU 1DPUA 1ON2A 4I76A 2LY2A 2P5LC 4XLCA 5GPAA 1U8RA 2NVXJ 2EZIA 1HDPA 2Y0MA 5FGMA 1SD4A 2VLAA 4HNVA 3V8KA 1PP8F 1BC7C 4ZTFA 3KLNA 3LSJA 4B3XA 1VTNC 1OCCH 2HZDA 2LTPA 2GIZA 1WCMJ 4NQWA 3WTUC 1F43A 4HG2A 5DDGA 5GTIC 1KU9A 1CF7A 2QQAA 2XASA 4A0ZA 2GOMA 2X51A 4P9FA 4Z2YA 3REOA 5HLTA 3VPRA 3GWZA 2H1KA 2FRHA 2UUZA 2VKHA 3KZIC 3S1RJ 1K78A 1JGSA 4C30A 4L0YB 4M73A 5ILVA 2WTEA 3LSKA 3MWMA 1BL0A 2HVSA 5FD6A 2XAJA 2V1UA 3ZMTA 3I4MJ 3KP7A 3CTAA 3ISPA 1GDTA 1YRNA 2DBBA 1U8BA 2DA3A 5FKKA 1IO2A 4EVIA 1HA8A 4M9ZA 3MKWB 3OMYA 2EK5A 4M3FA 1MDMB 1IF1A 3AL0C 3KCCA 3HOYJ 1KZHA 1B9MA 1JXSA 2IW5A 3EUAA 1VQLI 2EFOA 3CF2A 1S9HA 4BHBA 2QUFA 1D0YA 1YHQI 1IXCA 2VQHA 3FXUA 4I01A 4F55A 4IOCF 5DCMA 4CUGA 5K5OA 2R7QA 1I1GA 2E5NA 2Y0SN 3PSFA 2EFQA 4WK8F 2HOAA 2DMPA 4CH7A 5K5RA 3ESWB 3VDXA 2K86A 2K9SA 2CFXA 2ESNA 2Z33A 1WWXA 2EIMH 1RUNA 1DQUA 2IGKA 3MFKA 3A02A 3UNGC 1VQ7I 4ZYGA 4A0XA 2VIXA 2A6HF 1G2HA 3OOUA 2QKMB 2WC2A 5J1YA 3K70D 2M34A 3BG3A 4L5IA 1LDJA 1NTCA 2BHZA 2HFHA 2H8RA 3HOZJ 1ERDA 4FE7A 3BG6A 4CCJA 2FOWA 2I8DA 2MH2A 2R7WA 4F7ZA 1P6RA 1I27A 1DU0A 1FZPB 1H9TA 2VBZA 3LAPA 4B3AA 3ZMUA 2H94A 3H5NA 2LNBA 2L54A 2OD5A 2JVHA 3VYUB 3GO5A 2E2IJ 3HRMA 4G12A 4UXNA 3K2AA 2ZMEC 2Q2EA 3BR5A 1VQMI 4Y7NJ 2M5WA 2OCCH 2YPRA 2FQ4A 4JQFA 2BW3B 3BLYA 4G6TB 2NVUB 1NG7A 4DYQA 4PUSA 2Y30A 4E70A 2JUGA 3H0GJ 2HYFA 3H1CA 3A2KA 2CV0A 4UUSA 1TW3A 1BM9A 2XIGA 2KT0A 1Z05A 3RI4A 2AS5F 3EYIA 3HKZA 1BI0A 3M07A 2XDVA 4IHWA 4BJTA 4DQ2A 4EJVA 2E2HJ 1IN8A 1IRXA 3M8FA 1Z0XA 2DTRA 2Q1ZB 2PBIA 3KEYA 3PNYA 3KP6A 4IHSA 1SFXA 4X1EA 2OJED 1TNSA 5F1JA 2PJPA 2VUMJ 1R71A 3H3UA 1LEBA 1FWZA 3DKXA 3CMEI 3GTQJ 5HDNA 2HEOA 3ABLH 4E4HA 4E7HA 2RQPA 1J0RA 4P9UA 2IA1A 4BNCA 4S05A 2HR3A 4XLFA 2R7VA 5LGTA 3IL2A 3D5LA 1J59A 5H20A 4EJOA 3GTJJ 3PO3J 4JBAA 1G6NA 1OYIA 1ZLKA 4N4NB 2EIJH 1XB4A 4IZZA 1B8IB 2HGCA 2P5VA 1VQ8I 4GRIA 5F27A 1LB2A 4FISA 1KGSA 1V5EA 1WH5A 2ZB9A 3CCMI 1YJ9I 5HLIA 2Z9OA 3ECOA 2CG4A 4L5JA 3T0YA 4U0VA 4ZZDA 2A61A 2V1NA 5FRNA 2HTJA 4V19K 3DU5A 1UELB 3L2CA 1O3TA 1W5TA 3MCZA 1UMQA 2EBIA 2JA8J 1FBUA 2HQNA 4Y17A 3T8RA 3CP2A 2VBYA 1OR7C 4NBQA 1VF9A 2L9NA 2OCEA 3S8PA 4YFNF 1FSHA 2R5YB 1QRYA 2RQQA 2ID3A 1KU2A 2OTJI 2F48A 1WKMA 2E36A 2OZUA 1ZLJA 4XN3A 2GXAA 4B1RA 2HXIA 1SD6A 1BW6A 4CCMA 1TWGJ 4CGZA 4L9NA 3OSGA 4V2GA 2A3SA 5K5QA 3SEZA 1XSDA 3Q9VA 4ANJA 3HEFA 2CWEA 3J7YJ 1EJ9A 4E7KA 3IWZA 2IS1A 4KT6A 5ILSA 2E1OA 2EWNA 2DFIA 3BTLA 3CMAI 1I1SA 3GTMJ 3A1YA 1V54H 1XMXA 4OOIA 5M5XJ 1ETXA 5F04A 3H36A 3GTLJ 5KVRA 5D6FA 2LMDA 3GZ6A 2ETHA 2W85A 3HOSA 2GIVA 3TP3A 3KETA 3PM1A 3BTIA 1R49A 1OPCA 2LF7A 4HW0A 2LREA 3MMYB 5CVRA 2KP6A 4PSWA 1U3EM 2HZTA 5D8LB 2EB7A 3BJAA 2G7UA 2NXNB 4E7ZA 2KIQA 1KYWA 2LF8A 2RREA 4AVPA 4D7NA 3PJRA 3N05A 2ME6A 3MKLA 4BEHB 3LOCA 3C7JA 4F93B 1YJNI 2VBXA 4XKBA 2ISYA 1QVUA 3DEEA 2LOOA 3K70C 2PJRB 1R22A 2LYCA 4KIGA 4Q48A 3FXJA 3F3XA 1I3QJ 4GXOA 1XCBA 2Y75A 1R00A 2L3DA 2K9MA 2MD0A 5GAHJ 1HXDA 3LA2A 3LSIA 2AQFA 4U88A 5DM7F 3J7AO 1SEUA 3BZ6A 3HHGA 2QYOA 2ME0A 4KYWA 1IUFA 4LG0B 1AKHA 1G3WA 5FLMJ 3M4OJ 1MMGA 3HM5A 2K7LA 1FOXA 3FM5A 2ZC2A 5EDNA 2LRDA 4MTDA 2MGQA 1MBHA 2DMUA 3ASNH 3GVAA 1MBKA 1JHFA 2CSOA 2K4JA 3K1MA 2NS0A 2XF5A 3JTHA 3I59A 1DDNA 1XN7A 2DQRA 3RKQA 3ABTA 1YOVB 3I55I 1E17A 4J00A 4IVNA 1FTZA 1YE9A 2K85A 5ED4A 2WAQA 1MMAA 2M0CA 3HOTA 2DYRH 1R7JA 1RI7A 4R8HA 4BBRJ 4ETSA 1K6OA 3ECHA 4CO8A 5FLXK 3E6BA 2Y9YA 3G73A 4UV9A 3WHBA 2F5FA 4IHTA 1D3YA 3DKWA 3WTVC 9ANTA 1LFBA 4Y15A 4EGYA 4IRHA 2GA2A 2E1MC 3TQNA 4PJLA 4BXFA 1H88C 4EJWA 3QU3A 4RLFA 2MC4A 1BA5A 4IOAF 5M5WJ 2XVCA 2VPLA 1ETQA 2GZWA 3CUOA 1YFHA 3DV8A 3K10A 2XPWA 4N0BA 3CC4I 2QVOA 3TOAA 4N9HA 1T56A 4HX7A 2FEZA 1JUPA 2W7NA 2O5RA 1FBSA 5KK1A 2JRTA 4DYRA 1HDDC 4A3KJ 1A31A 4NC8A 2W4SA 1E2XA 4BY1J 5EF6A 4XKCA 4HF2A 1Y6IA 3ZQFA 4AC0A 4X0GA 2K9LA 4PJMA 1F1ZA 5LLQA 2WAFA 2M4GA 1I6HJ 1S8NA 1QHGA 4XIDA 5J8CA 3GTKJ 2F5CA 4A3EJ 1Z77A 1IZ1A 4XNFA 3JRHA 4MEYF 1QZYA 3JRIA 2VQCA 2ZNZA 1MDMA 2HDWA 3GMEA 1U0JA 5E1ZB 5ICCA 3I54A 1Q1HA 2M4KA 2JZYA 5JVGF 1ZR4A 1BOBA 3DBHB 3RSNA 1T0FC 2OZ6A 2KFDA 2FOKA 4RA2A 3RPQA 2L9RA 3GFLA 3WGHA 4YIFA 2XKPA 2H8WA 3LFUA 3B73A 2HWVA 1H0MA 1JJ8C 3RDIA 3S16J 2V1DA 4XOTA 2NS7A 2V6EA 2JWTA 2JMWA 2Y9ZA 3EUHA 2HNHA 1JJ6C 2XSJC 4RM2A 1AU7A 3LSHA 3BDDA 3LA7A 3SZTA 1WJ5A 3SQNA 2KDOA 2ISZA 4KIBA 1OCPA 1UCRA 1BN5A 2IBDA 1Z6RA 3OYIA 4QIWN 3BG7A 3G1LA 3ZOBA 1WJBA 3KIOA 2OQRA 3J7ZI 1IN4A 4KITB 4A3GJ 1WJEA 2PMHA 1LDKB 2X6YA 1QPIA 3DCFA 1XG1A 2WAQN 4LLGF 1QBJA 3VOEA 1IN7A 2AQEA 2RDPA 2B7EA 4A3MJ 1KU7A 1BW5A 2OQGA 1A04A 4LGWA 1UFMA 4A3LJ 3L2QA 4AYBN 1X4OA 1X58A 1K7AA 5M3FJ 2O6GE 5IT9Z 1RRJA 4A3FJ 2OTLI 1ORKA 2OBPA 4IL6C 2ECBA 2BW3A 2IGOA 3QU6A 1B59A 4BKXA 4C9YA 3S93A 3HGGA 5BPIA 2GOXB 1T33A 1W7PD 1HQCA 3OYBA 4OIQF 1MD0A 3HIFA 3FKIJ 1D5YA 1N75A 1Z91A 2MW8A 2CH0A 3F8FA 4M6XA 2PQ8A 3I58A 3HL2A 3ZN1A 4RB1A 2KRHA 4IHXA 4ZTJA 2UZKA 2OA4A 2CO5A 2XROA 2EV6A 2ZXJA 2K9QA 2L7KA 3BJ6A 4CICA 4B44A 3HRSA 3F6VA 2Q0OA 1J5YA 3SHFA 4F3QA 5TISC 3B6CA 3OYEA 2QSHX 4UVBA 1LE8B 2DPDA 1Y39A 2H6CA 3FX3A 3C2HA 1QA6A 1OKRA 1WVRA 2EV0A 1WPKA 2DMTA 3KEOA 1Z3XA 1JHHA 2LC2A 2VE8A 1IC8A 4BJ5C 3FXQA 1B8IA 1YS6A 2DOFA 4IPAA 2R7XA 1O3SA 2Y69H 4G7ZF 1L0OC 2NNYA 3N4MA 1X3UA 2IPQX 3KZYA 1FPQA 3CUQC 4LJZF 4A3DJ 2KJBA 2ZJ2A 2IS4A 3ZQ7A 3DEUA 2Z99A 4G7HF 1SD7A 4P55A 1TQPA 2QA4I 1IDYA 2GM4A 2JA7J 3VYRB 1B72B 3S2WA 4LB6B 4ZYAA 2EIKH 1XGSA 1DUXC 5DV5A 3WTYC 2FBKA 1RIOH 2R5YA 3ML6A 1FNNA 3E6CC 3S1MJ 3FKJA 3ZMZA 1MMDA 5LHIA 4D5CA 3ZMSA 2PX9A 4CCLA 5J40A 1YIJI 3O2PE 2CYYA 1IAWA 4HF1A 4WXHA 2LLKA 4CSWA 2K3PA 3TO7A 4HYEA 1LPQA 3FZVA 3K1PA 3DPTA 2DTZA 3E1SA 4RDUA 3KP4A 4WXCA 2F6CA 2VOPA 4HQEA 4MIMA 5LBQA 4ON0A 2HQAA 4OAZA 3LSGA 3LA3A 3L7WA
chains in the Genus database with same CATH topology
1KYZA 3WTWC 1OYYA 3W6KB 4LK0F 3GXOA 3BJOA 3L09A 1LDDA 2A6EF 3GEZA 4BQAA 1FSEA 2A5YB 4S04A 3HYIA 4BH9A 2W25A 3HSEA 3W6JB 4EJTA 4ASNA 1MGTA 1ZGAA 4IJAA 3F23A 2YSRA 3JSPA 2QZ8A 2DK5A 1HKTA 4I7HA 4CZZA 3KEQA 5AIQA 4LG0A 3F72A 4EMSA 2GAUA 2V6CA 2HKXA 1MJBA 1CGPA 1BBYA 2XRNA 2FE3A 3TGNA 3WGGA 2O03A 1ODDA 1ON1A 2QQ9A 3KFWX 5ICFA 2P4WA 3WU1B 4BXUA 2UWMA 2VN2A 3LQQA 2FXAA 3I5UA 3CJNA 5LGUA 4KMFA 2O3FA 1G4DA 1ZG3A 2A69F 2YX4A 2DPUA 4HX8A 4GO1A 5D5UB 1S7OA 4M74A 4XSZF 2RC4A 1P4AA 1I5ZA 2K02A 4EM0B 3LSTA 1ONVA 3FHZA 5AONA 1U78A 2HKOA 2BE5F 4ZYHA 4ENJA 1IXSB 1SMYF 2P5KA 4EM2A 5BPDA 4U7DA 3L00A 2FSWA 4A12A 4Q4ZF 3K0LA 3M8EA 1S29A 3GFMA 2E1NA 1XDSA 3J80Z 3J81Z 4I09A 2P7VB 1HW2A 2D1HA 5CVIA 4HBLA 2QM3A 5HS7A 5ICEA 2XUBA 1KQ0A 3RKYA 5D4RA 4GYGA 4A5NA 2KRFA 1NHAA 4XRFA 2XAHA 4EQQA 4MGRA 3RIRA 1TW2A 4O3MA 4A6DA 4HZFA 1HBXG 4RAYA 1P2FA 2EFNA 4WWCA 1SFUA 1R1VA 2D2WA 4I0BA 2XAGA 3V8JA 3BP8A 2H27A 5DEQA 1XD7A 1U5TB 2R7FA 4BAYA 2VC0A 2YR2A 2NYXA 1HKSA 1SAXA 2XKOA 2V1XA 2WWYA 2VT2A 2PN6A 3GFJA 5E1XA 1FP1D 4A2UA 1SFEA 1BIBA 5F1RA 4U0YA 1BI3A 3P9KA 1BC8C 3R6SA 2STWA 3TDZC 3ELKA 4WX9A 4RGRA 2STTA 3RTRA 1J7KA 2HOEA 3GZ5A 5JI6A 2QENA 3WODF 5JVTA 2JTVA 1G3TA 4KDPA 4L0ZB 3FM3A 1LQ1A 2CQKA 3BY6A 3MAJA 4AIJA 2VONA 1AWCA 1EH8A 3BROA 4LK1F 2G7HA 3I4PA 3Q5FA 5TJJA 1G3YA 3E5UA 2DU9A 2Z3YA 5A2QZ 1YG2A 4YFKF 4PGHA 1ZHFA 2NRAC 5A2QK 1S7AA 3WE2A 1G3SA 3T5XA 4DNCA 3IKVA 4IRGA 2MLKA 5BMZA 3FMQA 4GYIA 3DFGA 1QQIA 2J5OA 1T2KA 1TNTA 2RKHA 4CYDA 3HRUA 4Y13A 3WG9A 1REPC 2RNJA 3K9TA 3OOPA 2L02A 4ENKA 3WTSC 1FX7A 2ESHA 5TRDA 1TTYA 2M30A 5D8KB 3P9CA 3RJPA 3IRQA 4UHTA 2GQQA 3TO9A 1RUOA 1XGMA 4G8XA 1QZZA 1XGNA 1EH7A 4I98B 2W24A 2DI3A 5CVUA 4OIOF 3U1DA 3H92A 2R3SA 4IXAA 5DUKA 2ADUA 1TQMA 2A68F 4O6JA 2CW0F 3F6OA 1IN6A 4IRIA 5CVVA 2IA2A 3NQOA 2G9WA 4G6QA 3U2RA 2VODA 1D5VA 2D45A 2ZMEB 4M71A 4RAZA 1HKQA 1IUYA 2K27A 5H6QA 5HDGA 4R1HA 4N9IA 2FMYA 3U9GA 4ESFA 5CYVA 1BI1A 3R61A 2VC1A 1TLHB 4QWQA 3TOBA 3HTUA 1LNWA 4L9TA 1P4WA 2DQLA 3F22A 3BPVA 1KQ9A 4CDGA 4HLXA 2JT1A 4ZYEA 5ERIA 3E3VA 4KN4X 3SXYA 2FU4A 3COAC 3VB2A 4ESBA 2RV8A 4KNYA 3JW4A 2OAZA 1FLIA 2GXBA 2CGPA 4M9SA 3E6MA 3V8LA 4TV7A 2KIMA 2YU3A 4KIFA 4KUMA 2L4AA 2F2EA 2X0LA 3WU0A 3WE3A 4CXFA 3ZPLA 3E97A 1PP7U 1B4AA 3F8NA 5IT9K 1XMAA 2EA2A 1YS7A 3NEUA 2EFPA 4UVCA 2FMLA 4CHUA 3QPHA 4YG2F 5E8IA 3MZHA 3KE2A 4U0WA 3O3KA 1BJAA 1HSTA 4H0EA 4HDVA 4HV5A 1U5TA 4HV6A 1O7FA 4HAMA 3C1DA 4D0PA 3ERED 3LQRA 1P92A 1OMIA 4FHTA 1UHMA 5LHHA 1L3LA 4I02A 1PUEE 4WF2A 3DF8A 1V4RA 1WSUA 3R4KA 1R5HA 3ZMVA 2ELHA 4OIRF 3FF5A 2MD5A 3I64A 3RPUA 4L9VA 1ZARA 1YW9A 3GFIA 2MH9A 2LKPA 1TBXA 2NNNA 4PCQA 1T38A 3HHHA 1R1TA 4I2OA 5AIPA 3VFZA 5FB2A 2TDXA 3EYYA 3RKWA 5E8GA 2M87A 3EQLF 4K2EA 3M1EA 3C3WA 2QQBA 2HYGD 3WTZA 1Z9CA 1H9GA 2VXZA 5EEGA 4AIKA 4A0YA 3BPXA 1RZ4A 4WXDA 2NAZA 5CLSA 1HW1A 4HDUA 3N97A 1R1UA 1QGPA 1BIAA 2IJLA 4NB5A 2JPCA 3GUDA 1P4XA 3P9IA 3GLXA 2FNPA 4AIHA 1YO5C 5D5XB 2FQ3A 3R60A 2JSCA 1OYWA 4A6EA 1S6LA 2DO7A 1YLFA 4XLPF 5L3EA 3HTSB 2E7WA 1FYKA 2PI0A 4B8XA 1FY7A 5FFXA 4LFUA 3P7NA 5E18F 1O3RA 1HW5A 4OMZA 2BYVE 3OV8A 3PQJA 1LEAA 2UXXA 2V9VA 1R58A 3PQKA 4XSXF 5E17F 3DP7A 2HTSA 4YIIA 2B0LA 2AXLA 1BI2A 5L3CA 3O6BB 2IVMA 2JPBA 1O57A 1KQ8A 1D8KA 4I0AA 5HVQC 4LB5A 1IRFA 1FBQA 4Q5SF 3R0AA 5JFRA 3GF2A 3KP5A 3ABUA 3CO6C 5JR3A 3SZPA 2E1CA 2P8TA 2ZMEA 1MKMA 4B09A 1J2XA 1MZBA 3Q9SA 3QPTA 3HRTA 2VT3A 1U2WA 3TKYA 2P7CB 2KKOA 2PG4A 3EETA 2FBHA 3ZMDA 2C6YA 3V4GA 2XGXA 3E6DA 4YFXF 1IRGA 2M1BA 3K2ZA 3ZN0A 2BV6A 1R5GA 2MLGA 3J80K 1IXRC 3J81K 4EJUA 1QPMA 2PFBA 1QO0D 4LLNA 3K69A 5DD4A 4BYYA 1J9IA 2COMA 2RGVA 4RB3C 4HQMA 3I53A 1UB9A 3CUQB 2IA0A 3VEPA 1USTA 1R36A 4BHCA 4IF4A 1YQAA 4L9JA 4LLLA 3WTTC 2FBIA 1O3QA 2ZO4A 1OR7A 2FNAA 1W5SA 2MC3A 1ULYA 4ZZLA 5LHGA 5F6FA 2Y48A 1Z7UA 3DPLC 1XSVA 2XHKA 4G6DA 4KICA 4PGGA 4MTEA 1UHWA 4G9YA 5D5VB 3BWGA 3EDPA 5D5WB 5L3BA 2FA5A 2E7XA 5BOXA 1ZG1A 2QWWA 2XV4S 3KZZA 2BEOA 3RKXA 2W84A 1W4MA 5CJ9A 2MBFA 3D0SA 3K1NA 3NRVA 4UVAA 1KU3A 3F8CA 1MJ9A 1YYVA 4HF0A 3QOPA 1LJ9A 6PAXA 3B02A 3PFIA 1ZGJA 4XLNF 1U6GA 3H3ZA 4G7OF 3MZYA 1YW7A 5J6XA 4ESJA 4RS8A 3IWFA 1K79A 1I6XA 2IT0A 1USSA 2UXNA 5IT3A 2OU2A 1EV7A 4P96A 3MQ0A 5LRRA 2DAOA 2R7DA 1XCVA 2ZKZA 2ACJA 4FX0A 2KIFA 5FD5A 4R79A 5L3DA 3SFZA 4UUVA 4LD5A 5DYMA 4HA8A 3TO6A 3HSRA 1W7PB 1B9NA 3RYPA 4G94A 1HSJA 2EJRA 1YW8A 2EFWA 5HOOA 4MQ9F 1FP2A 2BGCA 1MJAA 1Z1DA 1WQ2A 3E5QA 1Z6TA 1GVJA 2QBYB 1T39A 1R23A 1DPRA 2HQRA 4O5VA 5HLGA 5HLHA 1Y0UA 3E5XA 2M45A 4UV8A 2HS5A 1ZRCA 4JK1X 3V7CA 5D4SA 3IRRA 1TQIA 2H6BA 1ZRDA 1F5TA 1ZG5A 3G3ZA 2F5EA 2MA3A 3V7RA 2PLYA 3LWFA 4XBFA 3GW2A 4MQVA 2J5PA 5FFZA 5FLXZ 3QP5A 2PMUA 3KP2A 1F9NA 3QAHA 3FXRA 1PDNC 3HUGA 3JSOA 1CF7B 5LEJA 4KA4A 1K78B 3CO7C 2LSOA 4RGUA 5H6RA 4ENMA 1T0FA 5CVJA 2RVCA 4KFCA 5L3GA 2VE9A 3GX4X 2WV0A 3GYHX 1V3FA 3T1BA 2P6TA 2RN7A 4RB0A 5BQTA 1ZRFA 5DUIA 4WCGA 4ZH4F 3F8MA 4GCVA 3IHUA 3M9AA 3I71A 1FT9A 1GHCA 3ZP5A 3AAFA 5HDKA 1ZYRF 2Q8KA 5DCMB 2K4BA 3QP6A 3ROUA 3LFKA 4FT8A 5E1WA 5F64A 3V7SA 3WGIA 4HOBA 5ILUA 4M72A 1O7LA 3CDHA 4KN7X 2YX7A 1XGOA 3VODA 1B6AA 2EA4A 1S3JA 2DLLA 1FYLA 3DXJF 3C18A 1IW7F 2V79A 4ZYDA 2ZFWA 2DK8A 2W57A 5JHUA 5LGNA 5K1YA 5EEHA 1YIOA 4MHGA 4ENNA 4EV0A 1AOYA 2QLZA 2FF4A 1ZREA 1WRJA 3F21A 2GWRA 3FWEA 2GA1A 4Q47A 4EGZA 1T6SA 4KMUX 4A5MA 1GXPA 4OMYA 1J75A 2VOOA 1JE8A 5LEKA 2ZCWA 1ZH5A 3T8TA 1XSXA 3CUQA 1GXQA 2PEXA 3BOQA 4L18B 4KT5C 5J8FA 2O61A 3FMRA 2P6SA 1RNLA 4P5OA 5DD8A 1YTYA 4MEXF 4BHPA 2KIUA 2ZBKA 1DP7P 3ULQB 2A07F 2F5DA 5HS9A 4RB2C 3MEXA 3M7GA 2IRFG 4FX4A 1FOKA 3DQVC 2BBYA 2EV5A 2XAFA 2HDCA 5LRSA 3TDUC 1B1BA 1STZA 4GGGA 1QNTA 4PDKA 3IKTA 4OINF 1LVAA 3CLOA 4U7BA 2GXGA 5L3FA 1XMKA 1F4KA 2KJCA 3I0TA 2DW4A 3JTGA 3KP3A 4OU0A 3JAMZ 2X4HA 1FYMA 1C0WA 3JAMK 1U5TC 2XAQA 1WI9A 2VBWA 1D8JA 3RYRA 2DT5A 2O8XA 4HLYA 4PZJA 3IC7A 2Z5UA 2M8EA 4UNOA 4RGXA 4HX4A 1EH6A 1KA8A 3WTXC 2D1VA 5HS8A 1BOAA 1IN5A 1W7PA 4OIPF 2H09A 4M6YA 4M9XA 4NHJA 2L01A 1FC3A 5E20A 4EM1A 4MNUA 2IP2A 1ZN2A 1ZAOA 3FMSA 5BS6A 3I59B 3KLOA 4LMYA 1XDUA 5D6EA 3LAJA 1SMTA 4RGSA 2QBYA 2ZNYA 3R0JA 2LDUA 5DCFA 5ICGA 1T98A 3QRFF 3F8BA 3L9FA 3HSFA 2O0YA 5FO5A 4AD9A 2L4MA 1SD5A 4AWXB 4QLCU 1DPUA 1ON2A 2P5LC 1U8RA 2Y0MA 5FGMA 1SD4A 3V8KA 1PP8F 1BC7C 3KLNA 1VTNC 4NQWA 3WTUC 5DDGA 1KU9A 1CF7A 2QQAA 2XASA 4A0ZA 4P9FA 4Z2YA 3REOA 3GWZA 2FRHA 1K78A 1JGSA 4L0YB 5ILVA 4M73A 2WTEA 3MWMA 5FD6A 2XAJA 2V1UA 3ZMTA 3KP7A 3CTAA 3ISPA 2DBBA 4EVIA 4M9ZA 2EK5A 1MDMB 1IF1A 3KCCA 1B9MA 1JXSA 2IW5A 2EFOA 4BHBA 2QUFA 1IXCA 3FXUA 4I01A 5DCMA 5K5OA 1I1GA 2EFQA 4WK8F 5K5RA 2K86A 2CFXA 2ESNA 2Z33A 1WWXA 1RUNA 3MFKA 4ZYGA 4A0XA 2A6HF 2WC2A 4L5IA 1LDJA 2HFHA 2MH2A 4F7ZA 1P6RA 1I27A 1FZPB 1H9TA 2VBZA 3LAPA 3ZMUA 2H94A 2LNBA 2L54A 2OD5A 3GO5A 3HRMA 4UXNA 2Q2EA 2M5WA 2YPRA 4JQFA 4E70A 2HYFA 1TW3A 1BM9A 2XIGA 1Z05A 3RI4A 2AS5F 3EYIA 1BI0A 4EJVA 4DQ2A 1IN8A 3M8FA 2DTRA 2PBIA 3KP6A 4IHSA 1SFXA 1TNSA 2PJPA 3H3UA 1LEBA 1FWZA 5HDNA 2HEOA 2RQPA 1J0RA 4P9UA 2IA1A 4BNCA 4S05A 2HR3A 5LGTA 3IL2A 3D5LA 1J59A 5H20A 4EJOA 4JBAA 1G6NA 1OYIA 1ZLKA 1XB4A 2HGCA 2P5VA 1LB2A 1KGSA 2Z9OA 5HLIA 3ECOA 2CG4A 4L5JA 3T0YA 4U0VA 4ZZDA 2A61A 2HTJA 3L2CA 1O3TA 1W5TA 3MCZA 1FBUA 2HQNA 4Y17A 3T8RA 2VBYA 1FSHA 4YFNF 1KU2A 1WKMA 2OZUA 1ZLJA 1SD6A 4CGZA 4L9NA 2A3SA 5K5QA 1XSDA 3Q9VA 2CWEA 3IWZA 5ILSA 2EWNA 2DFIA 1I1SA 4OOIA 5KVRA 5D6FA 3GZ6A 2ETHA 2W85A 3HOSA 2GIVA 3KETA 1OPCA 2LF7A 4HW0A 5CVRA 1U3EM 2HZTA 5D8LB 2EB7A 3BJAA 2G7UA 1KYWA 2LF8A 4AVPA 3C7JA 2VBXA 2ISYA 1R22A 4KIGA 4Q48A 3F3XA 4GXOA 1XCBA 2Y75A 1R00A 2L3DA 1HXDA 3LA2A 4U88A 3J7AO 3BZ6A 3HHGA 2QYOA 4KYWA 4LG0B 1G3WA 2K7LA 3FM5A 4MTDA 3GVAA 1JHFA 2CSOA 2K4JA 3K1MA 2NS0A 3JTHA 3I59A 1DDNA 1XN7A 2DQRA 1E17A 3ABTA 4IVNA 5ED4A 3HOTA 1R7JA 1RI7A 4R8HA 4ETSA 1K6OA 3ECHA 4CO8A 5FLXK 3E6BA 3G73A 4UV9A 2F5FA 4IHTA 1D3YA 3DKWA 3WTVC 4Y15A 4EGYA 4IRHA 2GA2A 3TQNA 4EJWA 3QU3A 2XVCA 2GZWA 3CUOA 1YFHA 3DV8A 4N0BA 2QVOA 3TOAA 4N9HA 4HX7A 2FEZA 1FBSA 5KK1A 2JRTA 1E2XA 4HF2A 1F1ZA 5LLQA 1S8NA 5J8CA 2F5CA 1IZ1A 4MEYF 1QZYA 2ZNZA 1MDMA 5E1ZB 5ICCA 3I54A 1Q1HA 2JZYA 2OZ6A 3RPQA 2FOKA 3GFLA 3WGHA 4YIFA 2XKPA 3B73A 2HWVA 1H0MA 3RDIA 2V1DA 3EUHA 3BDDA 3LA7A 3SZTA 3SQNA 2ISZA 4KIBA 1UCRA 1BN5A 1Z6RA 2OQRA 1IN4A 2PMHA 1LDKB 4LLGF 1QBJA 3VOEA 1IN7A 2RDPA 1KU7A 2OQGA 1A04A 4LGWA 1UFMA 1K7AA 2O6GE 5IT9Z 2OBPA 3QU6A 1B59A 5BPIA 1W7PD 1HQCA 4OIQF 1MD0A 3HIFA 1Z91A 3F8FA 4M6XA 2PQ8A 3I58A 3ZN1A 4RB1A 2UZKA 2OA4A 2CO5A 2XROA 2EV6A 2ZXJA 3BJ6A 4CICA 3HRSA 3F6VA 2Q0OA 1J5YA 3SHFA 4UVBA 2DPDA 2H6CA 3FX3A 1OKRA 2EV0A 3KEOA 1JHHA 2VE8A 3FXQA 1YS6A 4IPAA 1O3SA 4G7ZF 1L0OC 2NNYA 3N4MA 1X3UA 2IPQX 3KZYA 1FPQA 3CUQC 4LJZF 2KJBA 2ZJ2A 3ZQ7A 3DEUA 4G7HF 2Z99A 1SD7A 4P55A 1TQPA 3S2WA 4LB6B 1XGSA 1DUXC 5DV5A 3WTYC 2FBKA 1RIOH 3ML6A 1FNNA 3E6CC 3ZMZA 5LHIA 3ZMSA 3O2PE 2CYYA 1IAWA 4HF1A 4WXHA 3TO7A 4HYEA 3FZVA 3K1PA 3DPTA 3KP4A 4WXCA 2VOPA 4HQEA 5LBQA 4ON0A 3LA3A 3L7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYZ A;  3WTW C;  1OYY A;  3W6K B;  4LK0 F;  3GXO A;  3BJO A;  3L09 A;  1LDD A;  2A6E F;  3GEZ A;  4BQA A;  1FSE A;  2A5Y B;  4S04 A;  3HYI A;  4BH9 A;  2W25 A;  3HSE A;  3W6J B;  4EJT A;  4ASN A;  1MGT A;  1ZGA A;  4IJA A;  3F23 A;  2YSR A;  3JSP A;  2QZ8 A;  2DK5 A;  1HKT A;  4I7H A;  4CZZ A;  3KEQ A;  5AIQ A;  4LG0 A;  3F72 A;  4EMS A;  2GAU A;  2V6C A;  2HKX A;  1MJB A;  1CGP A;  1BBY A;  2XRN A;  2FE3 A;  3TGN A;  3WGG A;  2O03 A;  1ODD A;  1ON1 A;  2QQ9 A;  3KFW X;  5ICF A;  2P4W A;  3WU1 B;  4BXU A;  2UWM A;  2VN2 A;  3LQQ A;  2FXA A;  3I5U A;  3CJN A;  5LGU A;  4KMF A;  2O3F A;  1G4D A;  1ZG3 A;  2A69 F;  2YX4 A;  2DPU A;  4HX8 A;  4GO1 A;  5D5U B;  1S7O A;  4M74 A;  4XSZ F;  2RC4 A;  1P4A A;  1I5Z A;  2K02 A;  4EM0 B;  3LST A;  1ONV A;  3FHZ A;  5AON A;  1U78 A;  2HKO A;  2BE5 F;  4ZYH A;  4ENJ A;  1IXS B;  1SMY F;  2P5K A;  4EM2 A;  5BPD A;  4U7D A;  3L00 A;  2FSW A;  4A12 A;  4Q4Z F;  3K0L A;  3M8E A;  1S29 A;  3GFM A;  2E1N A;  1XDS A;  3J80 Z;  3J81 Z;  4I09 A;  2P7V B;  1HW2 A;  2D1H A;  5CVI A;  4HBL A;  2QM3 A;  5HS7 A;  5ICE A;  2XUB A;  1KQ0 A;  3RKY A;  5D4R A;  4GYG A;  4A5N A;  2KRF A;  1NHA A;  4XRF A;  2XAH A;  4EQQ A;  4MGR A;  3RIR A;  1TW2 A;  4O3M A;  4A6D A;  4HZF A;  1HBX G;  4RAY A;  1P2F A;  2EFN A;  4WWC A;  1SFU A;  1R1V A;  2D2W A;  4I0B A;  2XAG A;  3V8J A;  3BP8 A;  2H27 A;  5DEQ A;  1XD7 A;  1U5T B;  2R7F A;  4BAY A;  2VC0 A;  2YR2 A;  2NYX A;  1HKS A;  1SAX A;  2XKO A;  2V1X A;  2WWY A;  2VT2 A;  2PN6 A;  3GFJ A;  5E1X A;  1FP1 D;  4A2U A;  1SFE A;  1BIB A;  5F1R A;  4U0Y A;  1BI3 A;  3P9K A;  1BC8 C;  3R6S A;  2STW A;  3TDZ C;  3ELK A;  4WX9 A;  4RGR A;  2STT A;  3RTR A;  1J7K A;  2HOE A;  3GZ5 A;  5JI6 A;  2QEN A;  3WOD F;  5JVT A;  2JTV A;  1G3T A;  4KDP A;  4L0Z B;  3FM3 A;  1LQ1 A;  2CQK A;  3BY6 A;  3MAJ A;  4AIJ A;  2VON A;  1AWC A;  1EH8 A;  3BRO A;  4LK1 F;  2G7H A;  3I4P A;  3Q5F A;  5TJJ A;  1G3Y A;  3E5U A;  2DU9 A;  2Z3Y A;  5A2Q Z;  1YG2 A;  4YFK F;  4PGH A;  1ZHF A;  2NRA C;  5A2Q K;  1S7A A;  3WE2 A;  1G3S A;  3T5X A;  4DNC A;  3IKV A;  4IRG A;  2MLK A;  5BMZ A;  3FMQ A;  4GYI A;  3DFG A;  1QQI A;  2J5O A;  1T2K A;  1TNT A;  2RKH A;  4CYD A;  3HRU A;  4Y13 A;  3WG9 A;  1REP C;  2RNJ A;  3K9T A;  3OOP A;  2L02 A;  4ENK A;  3WTS C;  1FX7 A;  2ESH A;  5TRD A;  1TTY A;  2M30 A;  5D8K B;  3P9C A;  3RJP A;  3IRQ A;  4UHT A;  2GQQ A;  3TO9 A;  1RUO A;  1XGM A;  4G8X A;  1QZZ A;  1XGN A;  1EH7 A;  4I98 B;  2W24 A;  2DI3 A;  5CVU A;  4OIO F;  3U1D A;  3H92 A;  2R3S A;  4IXA A;  5DUK A;  2ADU A;  1TQM A;  2A68 F;  4O6J A;  2CW0 F;  3F6O A;  1IN6 A;  4IRI A;  5CVV A;  2IA2 A;  3NQO A;  2G9W A;  4G6Q A;  3U2R A;  2VOD A;  1D5V A;  2D45 A;  2ZME B;  4M71 A;  4RAZ A;  1HKQ A;  1IUY A;  2K27 A;  5H6Q A;  5HDG A;  4R1H A;  4N9I A;  2FMY A;  3U9G A;  4ESF A;  5CYV A;  1BI1 A;  3R61 A;  2VC1 A;  1TLH B;  4QWQ A;  3TOB A;  3HTU A;  1LNW A;  4L9T A;  1P4W A;  2DQL A;  3F22 A;  3BPV A;  1KQ9 A;  4CDG A;  4HLX A;  2JT1 A;  4ZYE A;  5ERI A;  3E3V A;  4KN4 X;  3SXY A;  2FU4 A;  3COA C;  3VB2 A;  4ESB A;  2RV8 A;  4KNY A;  3JW4 A;  2OAZ A;  1FLI A;  2GXB A;  2CGP A;  4M9S A;  3E6M A;  3V8L A;  4TV7 A;  2KIM A;  2YU3 A;  4KIF A;  4KUM A;  2L4A A;  2F2E A;  2X0L A;  3WU0 A;  3WE3 A;  4CXF A;  3ZPL A;  3E97 A;  1PP7 U;  1B4A A;  3F8N A;  5IT9 K;  1XMA A;  2EA2 A;  1YS7 A;  3NEU A;  2EFP A;  4UVC A;  2FML A;  4CHU A;  3QPH A;  4YG2 F;  5E8I A;  3MZH A;  3KE2 A;  4U0W A;  3O3K A;  1BJA A;  1HST A;  4H0E A;  4HDV A;  4HV5 A;  1U5T A;  4HV6 A;  1O7F A;  4HAM A;  3C1D A;  4D0P A;  3ERE D;  3LQR A;  1P92 A;  1OMI A;  4FHT A;  1UHM A;  5LHH A;  1L3L A;  4I02 A;  1PUE E;  4WF2 A;  3DF8 A;  1V4R A;  1WSU A;  3R4K A;  1R5H A;  3ZMV A;  2ELH A;  4OIR F;  3FF5 A;  2MD5 A;  3I64 A;  3RPU A;  4L9V A;  1ZAR A;  1YW9 A;  3GFI A;  2MH9 A;  2LKP A;  1TBX A;  2NNN A;  4PCQ A;  1T38 A;  3HHH A;  1R1T A;  4I2O A;  5AIP A;  3VFZ A;  5FB2 A;  2TDX A;  3EYY A;  3RKW A;  5E8G A;  2M87 A;  3EQL F;  4K2E A;  3M1E A;  3C3W A;  2QQB A;  2HYG D;  3WTZ A;  1Z9C A;  1H9G A;  2VXZ A;  5EEG A;  4AIK A;  4A0Y A;  3BPX A;  1RZ4 A;  4WXD A;  2NAZ A;  5CLS A;  1HW1 A;  4HDU A;  3N97 A;  1R1U A;  1QGP A;  1BIA A;  2IJL A;  4NB5 A;  2JPC A;  3GUD A;  1P4X A;  3P9I A;  3GLX A;  2FNP A;  4AIH A;  1YO5 C;  5D5X B;  2FQ3 A;  3R60 A;  2JSC A;  1OYW A;  4A6E A;  1S6L A;  2DO7 A;  1YLF A;  4XLP F;  5L3E A;  3HTS B;  2E7W A;  1FYK A;  2PI0 A;  4B8X A;  1FY7 A;  5FFX A;  4LFU A;  3P7N A;  5E18 F;  1O3R A;  1HW5 A;  4OMZ A;  2BYV E;  3OV8 A;  3PQJ A;  1LEA A;  2UXX A;  2V9V A;  1R58 A;  3PQK A;  4XSX F;  5E17 F;  3DP7 A;  2HTS A;  4YII A;  2B0L A;  2AXL A;  1BI2 A;  5L3C A;  3O6B B;  2IVM A;  2JPB A;  1O57 A;  1KQ8 A;  1D8K A;  4I0A A;  5HVQ C;  4LB5 A;  1IRF A;  1FBQ A;  4Q5S F;  3R0A A;  5JFR A;  3GF2 A;  3KP5 A;  3ABU A;  3CO6 C;  5JR3 A;  3SZP A;  2E1C A;  2P8T A;  2ZME A;  1MKM A;  4B09 A;  1J2X A;  1MZB A;  3Q9S A;  3QPT A;  3HRT A;  2VT3 A;  1U2W A;  3TKY A;  2P7C B;  2KKO A;  2PG4 A;  3EET A;  2FBH A;  3ZMD A;  2C6Y A;  3V4G A;  2XGX A;  3E6D A;  4YFX F;  1IRG A;  2M1B A;  3K2Z A;  3ZN0 A;  2BV6 A;  1R5G A;  2MLG A;  3J80 K;  1IXR C;  3J81 K;  4EJU A;  1QPM A;  2PFB A;  1QO0 D;  4LLN A;  3K69 A;  5DD4 A;  4BYY A;  1J9I A;  2COM A;  2RGV A;  4RB3 C;  4HQM A;  3I53 A;  1UB9 A;  3CUQ B;  2IA0 A;  3VEP A;  1UST A;  1R36 A;  4BHC A;  4IF4 A;  1YQA A;  4L9J A;  4LLL A;  3WTT C;  2FBI A;  1O3Q A;  2ZO4 A;  1OR7 A;  2FNA A;  1W5S A;  2MC3 A;  1ULY A;  4ZZL A;  5LHG A;  5F6F A;  2Y48 A;  1Z7U A;  3DPL C;  1XSV A;  2XHK A;  4G6D A;  4KIC A;  4PGG A;  4MTE A;  1UHW A;  4G9Y A;  5D5V B;  3BWG A;  3EDP A;  5D5W B;  5L3B A;  2FA5 A;  2E7X A;  5BOX A;  1ZG1 A;  2QWW A;  2XV4 S;  3KZZ A;  2BEO A;  3RKX A;  2W84 A;  1W4M A;  5CJ9 A;  2MBF A;  3D0S A;  3K1N A;  3NRV A;  4UVA A;  1KU3 A;  3F8C A;  1MJ9 A;  1YYV A;  4HF0 A;  3QOP A;  1LJ9 A;  6PAX A;  3B02 A;  3PFI A;  1ZGJ A;  4XLN F;  1U6G A;  3H3Z A;  4G7O F;  3MZY A;  1YW7 A;  5J6X A;  4ESJ A;  4RS8 A;  3IWF A;  1K79 A;  1I6X A;  2IT0 A;  1USS A;  2UXN A;  5IT3 A;  2OU2 A;  1EV7 A;  4P96 A;  3MQ0 A;  5LRR A;  2DAO A;  2R7D A;  1XCV A;  2ZKZ A;  2ACJ A;  4FX0 A;  2KIF A;  5FD5 A;  4R79 A;  5L3D A;  3SFZ A;  4UUV A;  4LD5 A;  5DYM A;  4HA8 A;  3TO6 A;  3HSR A;  1W7P B;  1B9N A;  3RYP A;  4G94 A;  1HSJ A;  2EJR A;  1YW8 A;  2EFW A;  5HOO A;  4MQ9 F;  1FP2 A;  2BGC A;  1MJA A;  1Z1D A;  1WQ2 A;  3E5Q A;  1Z6T A;  1GVJ A;  2QBY B;  1T39 A;  1R23 A;  1DPR A;  2HQR A;  4O5V A;  5HLG A;  5HLH A;  1Y0U A;  3E5X A;  2M45 A;  4UV8 A;  2HS5 A;  1ZRC A;  4JK1 X;  3V7C A;  5D4S A;  3IRR A;  1TQI A;  2H6B A;  1ZRD A;  1F5T A;  1ZG5 A;  3G3Z A;  2F5E A;  2MA3 A;  3V7R A;  2PLY A;  3LWF A;  4XBF A;  3GW2 A;  4MQV A;  2J5P A;  5FFZ A;  5FLX Z;  3QP5 A;  2PMU A;  3KP2 A;  1F9N A;  3QAH A;  3FXR A;  1PDN C;  3HUG A;  3JSO A;  1CF7 B;  5LEJ A;  4KA4 A;  1K78 B;  3CO7 C;  2LSO A;  4RGU A;  5H6R A;  4ENM A;  1T0F A;  5CVJ A;  2RVC A;  4KFC A;  5L3G A;  2VE9 A;  3GX4 X;  2WV0 A;  3GYH X;  1V3F A;  3T1B A;  2P6T A;  2RN7 A;  4RB0 A;  5BQT A;  1ZRF A;  5DUI A;  4WCG A;  4ZH4 F;  3F8M A;  4GCV A;  3IHU A;  3M9A A;  3I71 A;  1FT9 A;  1GHC A;  3ZP5 A;  3AAF A;  5HDK A;  1ZYR F;  2Q8K A;  5DCM B;  2K4B A;  3QP6 A;  3ROU A;  3LFK A;  4FT8 A;  5E1W A;  5F64 A;  3V7S A;  3WGI A;  4HOB A;  5ILU A;  4M72 A;  1O7L A;  3CDH A;  4KN7 X;  2YX7 A;  1XGO A;  3VOD A;  1B6A A;  2EA4 A;  1S3J A;  2DLL A;  1FYL A;  3DXJ F;  3C18 A;  1IW7 F;  2V79 A;  4ZYD A;  2ZFW A;  2DK8 A;  2W57 A;  5JHU A;  5LGN A;  5K1Y A;  5EEH A;  1YIO A;  4MHG A;  4ENN A;  4EV0 A;  1AOY A;  2QLZ A;  2FF4 A;  1ZRE A;  1WRJ A;  3F21 A;  2GWR A;  3FWE A;  2GA1 A;  4Q47 A;  4EGZ A;  1T6S A;  4KMU X;  4A5M A;  1GXP A;  4OMY A;  1J75 A;  2VOO A;  1JE8 A;  5LEK A;  2ZCW A;  1ZH5 A;  3T8T A;  1XSX A;  3CUQ A;  1GXQ A;  2PEX A;  3BOQ A;  4L18 B;  4KT5 C;  5J8F A;  2O61 A;  3FMR A;  2P6S A;  1RNL A;  4P5O A;  5DD8 A;  1YTY A;  4MEX F;  4BHP A;  2KIU A;  2ZBK A;  1DP7 P;  3ULQ B;  2A07 F;  2F5D A;  5HS9 A;  4RB2 C;  3MEX A;  3M7G A;  2IRF G;  4FX4 A;  1FOK A;  3DQV C;  2BBY A;  2EV5 A;  2XAF A;  2HDC A;  5LRS A;  3TDU C;  1B1B A;  1STZ A;  4GGG A;  1QNT A;  4PDK A;  3IKT A;  4OIN F;  1LVA A;  3CLO A;  4U7B A;  2GXG A;  5L3F A;  1XMK A;  1F4K A;  2KJC A;  3I0T A;  2DW4 A;  3JTG A;  3KP3 A;  4OU0 A;  3JAM Z;  2X4H A;  1FYM A;  1C0W A;  3JAM K;  1U5T C;  2XAQ A;  1WI9 A;  2VBW A;  1D8J A;  3RYR A;  2DT5 A;  2O8X A;  4HLY A;  4PZJ A;  3IC7 A;  2Z5U A;  2M8E A;  4UNO A;  4RGX A;  4HX4 A;  1EH6 A;  1KA8 A;  3WTX C;  2D1V A;  5HS8 A;  1BOA A;  1IN5 A;  1W7P A;  4OIP F;  2H09 A;  4M6Y A;  4M9X A;  4NHJ A;  2L01 A;  1FC3 A;  5E20 A;  4EM1 A;  4MNU A;  2IP2 A;  1ZN2 A;  1ZAO A;  3FMS A;  5BS6 A;  3I59 B;  3KLO A;  4LMY A;  1XDU A;  5D6E A;  3LAJ A;  1SMT A;  4RGS A;  2QBY A;  2ZNY A;  3R0J A;  2LDU A;  5DCF A;  5ICG A;  1T98 A;  3QRF F;  3F8B A;  3L9F A;  3HSF A;  2O0Y A;  5FO5 A;  4AD9 A;  2L4M A;  1SD5 A;  4AWX B;  4QLC U;  1DPU A;  1ON2 A;  2P5L C;  1U8R A;  2Y0M A;  5FGM A;  1SD4 A;  3V8K A;  1PP8 F;  1BC7 C;  3KLN A;  1VTN C;  4NQW A;  3WTU C;  5DDG A;  1KU9 A;  1CF7 A;  2QQA A;  2XAS A;  4A0Z A;  4P9F A;  4Z2Y A;  3REO A;  3GWZ A;  2FRH A;  1K78 A;  1JGS A;  4L0Y B;  5ILV A;  4M73 A;  2WTE A;  3MWM A;  5FD6 A;  2XAJ A;  2V1U A;  3ZMT A;  3KP7 A;  3CTA A;  3ISP A;  2DBB A;  4EVI A;  4M9Z A;  2EK5 A;  1MDM B;  1IF1 A;  3KCC A;  1B9M A;  1JXS A;  2IW5 A;  2EFO A;  4BHB A;  2QUF A;  1IXC A;  3FXU A;  4I01 A;  5DCM A;  5K5O A;  1I1G A;  2EFQ A;  4WK8 F;  5K5R A;  2K86 A;  2CFX A;  2ESN A;  2Z33 A;  1WWX A;  1RUN A;  3MFK A;  4ZYG A;  4A0X A;  2A6H F;  2WC2 A;  4L5I A;  1LDJ A;  2HFH A;  2MH2 A;  4F7Z A;  1P6R A;  1I27 A;  1FZP B;  1H9T A;  2VBZ A;  3LAP A;  3ZMU A;  2H94 A;  2LNB A;  2L54 A;  2OD5 A;  3GO5 A;  3HRM A;  4UXN A;  2Q2E A;  2M5W A;  2YPR A;  4JQF A;  4E70 A;  2HYF A;  1TW3 A;  1BM9 A;  2XIG A;  1Z05 A;  3RI4 A;  2AS5 F;  3EYI A;  1BI0 A;  4EJV A;  4DQ2 A;  1IN8 A;  3M8F A;  2DTR A;  2PBI A;  3KP6 A;  4IHS A;  1SFX A;  1TNS A;  2PJP A;  3H3U A;  1LEB A;  1FWZ A;  5HDN A;  2HEO A;  2RQP A;  1J0R A;  4P9U A;  2IA1 A;  4BNC A;  4S05 A;  2HR3 A;  5LGT A;  3IL2 A;  3D5L A;  1J59 A;  5H20 A;  4EJO A;  4JBA A;  1G6N A;  1OYI A;  1ZLK A;  1XB4 A;  2HGC A;  2P5V A;  1LB2 A;  1KGS A;  2Z9O A;  5HLI A;  3ECO A;  2CG4 A;  4L5J A;  3T0Y A;  4U0V A;  4ZZD A;  2A61 A;  2HTJ A;  3L2C A;  1O3T A;  1W5T A;  3MCZ A;  1FBU A;  2HQN A;  4Y17 A;  3T8R A;  2VBY A;  1FSH A;  4YFN F;  1KU2 A;  1WKM A;  2OZU A;  1ZLJ A;  1SD6 A;  4CGZ A;  4L9N A;  2A3S A;  5K5Q A;  1XSD A;  3Q9V A;  2CWE A;  3IWZ A;  5ILS A;  2EWN A;  2DFI A;  1I1S A;  4OOI A;  5KVR A;  5D6F A;  3GZ6 A;  2ETH A;  2W85 A;  3HOS A;  2GIV A;  3KET A;  1OPC A;  2LF7 A;  4HW0 A;  5CVR A;  1U3E M;  2HZT A;  5D8L B;  2EB7 A;  3BJA A;  2G7U A;  1KYW A;  2LF8 A;  4AVP A;  3C7J A;  2VBX A;  2ISY A;  1R22 A;  4KIG A;  4Q48 A;  3F3X A;  4GXO A;  1XCB A;  2Y75 A;  1R00 A;  2L3D A;  1HXD A;  3LA2 A;  4U88 A;  3J7A O;  3BZ6 A;  3HHG A;  2QYO A;  4KYW A;  4LG0 B;  1G3W A;  2K7L A;  3FM5 A;  4MTD A;  3GVA A;  1JHF A;  2CSO A;  2K4J A;  3K1M A;  2NS0 A;  3JTH A;  3I59 A;  1DDN A;  1XN7 A;  2DQR A;  1E17 A;  3ABT A;  4IVN A;  5ED4 A;  3HOT A;  1R7J A;  1RI7 A;  4R8H A;  4ETS A;  1K6O A;  3ECH A;  4CO8 A;  5FLX K;  3E6B A;  3G73 A;  4UV9 A;  2F5F A;  4IHT A;  1D3Y A;  3DKW A;  3WTV C;  4Y15 A;  4EGY A;  4IRH A;  2GA2 A;  3TQN A;  4EJW A;  3QU3 A;  2XVC A;  2GZW A;  3CUO A;  1YFH A;  3DV8 A;  4N0B A;  2QVO A;  3TOA A;  4N9H A;  4HX7 A;  2FEZ A;  1FBS A;  5KK1 A;  2JRT A;  1E2X A;  4HF2 A;  1F1Z A;  5LLQ A;  1S8N A;  5J8C A;  2F5C A;  1IZ1 A;  4MEY F;  1QZY A;  2ZNZ A;  1MDM A;  5E1Z B;  5ICC A;  3I54 A;  1Q1H A;  2JZY A;  2OZ6 A;  3RPQ A;  2FOK A;  3GFL A;  3WGH A;  4YIF A;  2XKP A;  3B73 A;  2HWV A;  1H0M A;  3RDI A;  2V1D A;  3EUH A;  3BDD A;  3LA7 A;  3SZT A;  3SQN A;  2ISZ A;  4KIB A;  1UCR A;  1BN5 A;  1Z6R A;  2OQR A;  1IN4 A;  2PMH A;  1LDK B;  4LLG F;  1QBJ A;  3VOE A;  1IN7 A;  2RDP A;  1KU7 A;  2OQG A;  1A04 A;  4LGW A;  1UFM A;  1K7A A;  2O6G E;  5IT9 Z;  2OBP A;  3QU6 A;  1B59 A;  5BPI A;  1W7P D;  1HQC A;  4OIQ F;  1MD0 A;  3HIF A;  1Z91 A;  3F8F A;  4M6X A;  2PQ8 A;  3I58 A;  3ZN1 A;  4RB1 A;  2UZK A;  2OA4 A;  2CO5 A;  2XRO A;  2EV6 A;  2ZXJ A;  3BJ6 A;  4CIC A;  3HRS A;  3F6V A;  2Q0O A;  1J5Y A;  3SHF A;  4UVB A;  2DPD A;  2H6C A;  3FX3 A;  1OKR A;  2EV0 A;  3KEO A;  1JHH A;  2VE8 A;  3FXQ A;  1YS6 A;  4IPA A;  1O3S A;  4G7Z F;  1L0O C;  2NNY A;  3N4M A;  1X3U A;  2IPQ X;  3KZY A;  1FPQ A;  3CUQ C;  4LJZ F;  2KJB A;  2ZJ2 A;  3ZQ7 A;  3DEU A;  4G7H F;  2Z99 A;  1SD7 A;  4P55 A;  1TQP A;  3S2W A;  4LB6 B;  1XGS A;  1DUX C;  5DV5 A;  3WTY C;  2FBK A;  1RIO H;  3ML6 A;  1FNN A;  3E6C C;  3ZMZ A;  5LHI A;  3ZMS A;  3O2P E;  2CYY A;  1IAW A;  4HF1 A;  4WXH A;  3TO7 A;  4HYE A;  3FZV A;  3K1P A;  3DPT A;  3KP4 A;  4WXC A;  2VOP A;  4HQE A;  5LBQ A;  4ON0 A;  3LA3 A;  3L7W A; 
#chains in the Genus database with same CATH topology
 1KYZ A;  2KPM A;  3QQA A;  3WTW C;  1OFC X;  1OYY A;  3CCJ I;  3KPH A;  3W6K B;  3W2A A;  4XOP A;  4LK0 F;  3GXO A;  1JKR C;  3BJO A;  1N78 A;  3L09 A;  1E3H A;  4BDZ A;  1LDD A;  1YIT I;  2BY2 A;  2JA2 A;  2A6E F;  3GEZ A;  1X2M A;  4BQA A;  1BR2 A;  3EPZ A;  1FSE A;  2NOJ B;  2A5Y B;  4S04 A;  3HYI A;  2L2O A;  4BH9 A;  2W25 A;  3HSE A;  3K7A J;  3ABM H;  3NWT A;  3W6J B;  4XRM A;  3S17 J;  4BEH A;  3H9J A;  1FOW A;  4EJT A;  4CCK A;  4ASN A;  1MGT A;  3K4B A;  1ZGA A;  3DTI A;  4IJA A;  3F23 A;  3CCV I;  1VQN I;  2DT6 A;  2YSR A;  3E7L A;  2QZ8 A;  3JSP A;  3G6E I;  2PJR A;  2DK5 A;  1HKT A;  4I7H A;  4CZZ A;  3OYH A;  3KEQ A;  4UUT A;  1Z3Y A;  2WY7 Q;  5EZH A;  3S1Q J;  5AIQ A;  1K83 J;  2E19 A;  5HOD A;  5BNG A;  3G2B A;  1V55 H;  5EYR A;  4N4O B;  4LG0 A;  4AM3 A;  3F72 A;  4EMS A;  2GAU A;  2V6C A;  1RET A;  2HKX A;  2LKS A;  1MJB A;  1CGP A;  4RAF A;  4BY7 J;  2HOS A;  1BBY A;  5K7H A;  3CP8 A;  2M9H A;  2XRN A;  2FE3 A;  3TBI A;  3OL3 A;  3UKG A;  2JK3 A;  3TGN A;  3WGG A;  2O03 A;  1ODD A;  1ON1 A;  1X2N A;  2QQ9 A;  3KFW X;  4BL0 B;  5ICF A;  2P4W A;  4V2F A;  2JN6 A;  4I99 C;  3WU1 B;  4BXU A;  2UWM A;  4BBS J;  2VN2 A;  3LQQ A;  3PSI A;  1FMV A;  3F9K A;  2FXA A;  2ZFU A;  2V26 A;  2ECC A;  2LK2 A;  4XON A;  3I5U A;  3CJN A;  3IH3 A;  5LGU A;  1PJR A;  3K4J A;  3VYS B;  4RLQ A;  4KMF A;  1XTA A;  2O3F A;  5J4V A;  3CCE I;  3S2D J;  1G4D A;  3IUO A;  3MN2 A;  1ZG3 A;  3H35 A;  2LG4 A;  1A6Q A;  2CQX A;  3FDY A;  2A69 F;  3CJT B;  2XGE A;  4Y3O A;  2CQ7 A;  2YX4 A;  3OIO A;  4ZC3 A;  1ZTR A;  2DPU A;  4HX8 A;  3KYD B;  4GO1 A;  2DT7 B;  5D5U B;  1S7O A;  4Z6Y A;  4M74 A;  1RR7 A;  4XSZ F;  2RC4 A;  1P4A A;  1I5Z A;  2K02 A;  3K4L A;  4EM0 B;  4F52 A;  2K5C A;  4PJN A;  4BQN A;  3LST A;  2KIS A;  1ONV A;  3FHZ A;  5AON A;  1U78 A;  2HKO A;  2BE5 F;  4ZYH A;  4ENJ A;  1IXS B;  4UB6 C;  1WH7 A;  1SMY F;  2P5K A;  2HQ5 A;  4EM2 A;  5BPD A;  4U7D A;  1KON A;  2WB1 N;  3L00 A;  1IDZ A;  2FSW A;  3BT9 A;  2O8K A;  3Q0U A;  4FQG A;  1MH3 A;  4Y4R A;  4A12 A;  4Q4Z F;  3RZD J;  3K0L A;  3M8E A;  2F5V A;  2ELK A;  3E0J B;  3DPU A;  1S29 A;  3GFM A;  2E1N A;  1XDS A;  3M1C A;  3BR0 A;  3J80 Z;  3LMM A;  3J81 Z;  1K4T A;  2V9K A;  4I09 A;  2P7V B;  4QTR A;  1HW2 A;  2D1H A;  3S2H J;  2QCO A;  5CVI A;  3GLL A;  4HBL A;  2QM3 A;  3OYL A;  5HS7 A;  4B48 A;  5ICE A;  2XUB A;  1KQ0 A;  2LBF B;  3RKY A;  4GYG A;  5D4R A;  4A5N A;  2KRF A;  3M3Y J;  5FRO A;  5GTH C;  1NHA A;  4XRF A;  1UAA A;  2XAH A;  4EQQ A;  4MGR A;  2QEX I;  3HOW J;  2LP0 A;  5GAE J;  1DP3 A;  3RIR A;  2KRC A;  1VQO I;  1TW2 A;  4O3M A;  3B6A A;  4A6D A;  4HZF A;  1HBX G;  1FTT A;  4RAY A;  5C3E J;  3DBL B;  1P2F A;  2EFN A;  2M7B A;  3QYE A;  4WWC A;  2JVG A;  1SFU A;  1R1V A;  2WAE A;  2D2W A;  3IH4 A;  4I0B A;  3SEQ A;  2XAG A;  3V8J A;  4HRI A;  3BP8 A;  2H27 A;  5DEQ A;  5GAG J;  2CW7 A;  2CV2 A;  1XD7 A;  1U5T B;  5C4J J;  2CRG A;  2R7F A;  4BXX J;  4BAY A;  2VC0 A;  2YR2 A;  1Y8R B;  2NYX A;  1HKS A;  4FTH A;  3CD6 I;  3LL7 A;  4IKF A;  3CCR I;  3RQ4 A;  1SAX A;  2XKO A;  2V1X A;  1JUM A;  2IGN A;  3DEW A;  2WWY A;  4YEJ A;  2VT2 A;  4MO7 A;  2PN6 A;  3GFJ A;  5E1X A;  1FP1 D;  4A2U A;  1SFE A;  1GV2 A;  1BIB A;  2HVR A;  1MBE A;  5F1R A;  3BZC A;  4II2 A;  4U0Y A;  2CUE A;  3HGY A;  5F0H A;  2VJ4 A;  1FEX A;  1BI3 A;  3P9K A;  1BC8 C;  1S5L C;  3R6S A;  2STW A;  2MSY A;  3FXK A;  4BE1 A;  3TDZ C;  1W1W E;  5C44 J;  2R7O A;  3ELK A;  4RGR A;  4WX9 A;  5DS9 A;  2STT A;  2TRT A;  2M8G X;  3RTR A;  1J7K A;  3WHC A;  2HOE A;  3RZO J;  3U1K A;  3GZ5 A;  5JI6 A;  2O9L A;  1LE8 A;  3CC7 I;  3TMO A;  1HC8 A;  3NAU A;  2QEN A;  2QQ8 A;  3WOD F;  1OIS A;  5JVT A;  2KDZ A;  3P5J A;  3AG1 H;  2JTV A;  1D0Z A;  3QYB A;  4X6A J;  2IAI A;  1G3T A;  2R4G A;  4CYC B;  4KDP A;  4L0Z B;  3FM3 A;  1LQ1 A;  1WHU A;  2CQK A;  3BY6 A;  3MAJ A;  5IYD J;  4AIJ A;  2VON A;  1AWC A;  5EG0 B;  3JRA A;  1JTX A;  3S32 A;  1K4S A;  1EH8 A;  1EKE A;  3NWS A;  3BRO A;  4HEA 2;  3MD2 A;  2X6W A;  4OAY A;  4LK1 F;  4DW6 A;  2G7H A;  3I4P A;  3Q5F A;  2R7S A;  2L7F P;  5TJJ A;  2DFF A;  1G3Y A;  2GBY A;  3E5U A;  2DU9 A;  2Z3Y A;  1XPX A;  5A2Q Z;  1T95 A;  1BR1 A;  1OCR H;  1YG2 A;  1JKQ C;  1FOY A;  1TWC J;  4YFK F;  3JRC A;  5FKM A;  4PGH A;  1XX5 A;  3G4S I;  2MYS A;  4MLO A;  3CZ6 A;  3OIP A;  2DXI A;  1ZHF A;  5CKT A;  1ZQ3 P;  2NRA C;  5A2Q K;  2AHQ A;  2WA0 A;  3DLA A;  2XSD C;  2WBM A;  1S7A A;  3WE2 A;  3WU2 C;  2DN0 A;  1M1E B;  1G3S A;  3T5X A;  4DNC A;  3IKV A;  4IRG A;  2MLK A;  3HKZ N;  3OS2 A;  5BMZ A;  1NK3 P;  3FMQ A;  4GYI A;  5C4X J;  3DFG A;  1QQI A;  4ZDP A;  2J5O A;  1NK2 P;  2COB A;  1T2K A;  1TNT A;  2RKH A;  4CYD A;  3HRU A;  4Y13 A;  2NOG A;  3OS0 A;  3WG9 A;  5K7Z A;  2B9S A;  1MBF A;  1REP C;  2RNJ A;  3K9T A;  3OOP A;  4RAG A;  3JRE A;  3AL0 B;  2P81 A;  1X1D A;  2L02 A;  3GBG A;  3G1O A;  3G1M A;  2K3F A;  2X48 A;  5CPR B;  4ENK A;  4AU7 A;  5JLW A;  3BCB A;  3GZN B;  3FK6 A;  3M8J A;  3WTS C;  1MMS A;  4Y33 A;  1FX7 A;  2ESH A;  5TRD A;  1TTY A;  2M30 A;  2Z16 A;  5D8K B;  1R6R A;  4D7M A;  3P9C A;  3MKY B;  3RJP A;  3OY9 A;  4UHT A;  2GQQ A;  3IRQ A;  4JOM A;  1V5F A;  3TO9 A;  1X1B A;  2OV7 A;  3ZXS A;  1RUO A;  1XGM A;  2CQQ A;  2I5U A;  3CCQ I;  4G8X A;  4YEL A;  3L2R A;  3A01 B;  1QZZ A;  1ITY A;  2WY8 Q;  1XGN A;  1EH7 A;  3SYT A;  2BVM A;  4I98 B;  4ZDL A;  1TWH J;  2W24 A;  1TP4 A;  2DI3 A;  5CVU A;  5TGT A;  4OIO F;  1JKP C;  3U1D A;  4IHY A;  1SVO A;  1X1P A;  3H92 A;  2R3S A;  3OWT A;  4IXA A;  3X2Q H;  4XOR A;  4DIQ A;  5DUK A;  2ADU A;  1TQM A;  5J1R A;  2A68 F;  1RR8 C;  2VPR A;  4O6J A;  2CW0 F;  3F6O A;  1IN6 A;  2VAS A;  4IRI A;  4RBO A;  3FBI B;  5E3L A;  1RKT A;  2LH9 A;  1WZ2 A;  2JA5 J;  5CVV A;  5E3M A;  3TW7 A;  1YX3 A;  2IA2 A;  3KYC B;  2G9W A;  3NQO A;  2LR8 A;  4G6Q A;  2E60 A;  3BTC A;  4M3D A;  3AFH A;  2HI3 A;  3U2R A;  4HNT A;  1J09 A;  2W00 A;  2PMZ A;  1TL8 A;  2VOD A;  1D5V A;  2D45 A;  2ZME B;  4AID A;  2YUS A;  2VKD A;  1HF0 A;  1MW7 A;  1R5I D;  3OSF A;  4M71 A;  3ZRG A;  2BY3 A;  1VQ9 I;  4RAZ A;  1HKQ A;  1IUY A;  2K27 A;  5H6Q A;  5HDG A;  2JQ7 A;  3H5R A;  4R1H A;  2IXS A;  4N9I A;  2FMY A;  3U9G A;  4ESF A;  2DA5 A;  5CYV A;  2HPI A;  3K6G A;  1BI1 A;  3R61 A;  4BUP A;  4F92 B;  4HST A;  4PJJ A;  4BJ6 C;  2VC1 A;  1TLH B;  2E35 A;  4QWQ A;  4PK4 A;  3TOB A;  1H8A C;  1WFX A;  3HTU A;  2LVS A;  4ZJZ A;  5EGO B;  4IHV A;  1LNW A;  4L9T A;  1P4W A;  4CCO A;  2OPT A;  2QSF X;  3W2W A;  4DYC A;  3GCM A;  2XPU A;  4JYK A;  3FK7 A;  4B47 A;  3BR3 A;  4MFE A;  4XQF A;  3SDG A;  2X1D A;  4LG3 A;  1JKO C;  2WAD A;  2DQL A;  3F22 A;  1W5C C;  1P9Q C;  3BPV A;  1KQ9 A;  2OUM A;  4CDG A;  1X3Z B;  5DM6 F;  1BR4 A;  4HLX A;  2M2E A;  4BQQ A;  1ACI A;  2JT1 A;  2UV1 A;  2XAU A;  4ZYE A;  4DGW B;  5ERI A;  1LFP A;  1WGX A;  3E3V A;  1VZ0 A;  4JP0 A;  4KN4 X;  2E71 A;  3SXY A;  2FU4 A;  4JX6 A;  5F08 A;  3COA C;  3VB2 A;  4ESB A;  4PSX A;  3S14 J;  2RV8 A;  3ZQG A;  3CCU I;  4KNY A;  3JW4 A;  3LNQ A;  3ABK H;  2OAZ A;  1FLI A;  1OCT C;  2X6O A;  4LIT A;  2GXB A;  5B3S H;  3OL4 A;  2CGP A;  4M9S A;  3E6M A;  3V8L A;  4CCN A;  4TV7 A;  2KIM A;  2YU3 A;  4KIF A;  3OYC A;  2LBF A;  3Q0W A;  2A05 A;  1FMW A;  3FXL A;  4KUM A;  2R93 J;  2L4A A;  1RPW A;  2F2E A;  2X0L A;  3WU0 A;  2EIN H;  3WE3 A;  4B43 A;  1XC5 A;  4CXF A;  3OYF A;  3ZPL A;  4HNU A;  3HC7 A;  2MFZ A;  2CUJ A;  3E97 A;  1PP7 U;  2QKL B;  2CFO A;  3PNT A;  1B4A A;  3F8N A;  1LVK A;  5KAI C;  5IT9 K;  4E7S A;  3JR9 A;  1WJA A;  1XMA A;  2EA2 A;  2M7A A;  3KYL A;  1YS7 A;  3NEU A;  4M3E A;  2EFP A;  4UVC A;  2FML A;  4CHU A;  5IP9 J;  3CDL A;  3QPH A;  4YG2 F;  1RES A;  3OYJ A;  4C3I J;  5GP9 A;  3HB9 A;  5E8I A;  5HNF A;  3KE2 A;  3MZH A;  3PO2 J;  3MVP A;  3SDB A;  1JUS A;  3EUH C;  4U0W A;  4IO9 F;  3O3K A;  3ZQQ A;  1BJA A;  1HST A;  1TC3 C;  1ZEL A;  4H0E A;  2CV1 A;  4HDV A;  1D1A A;  4HV5 A;  1U5T A;  4NC7 A;  3SZG A;  4HV6 A;  1O7F A;  2PMZ N;  4HAM A;  4BDY A;  1MMN A;  2KMU A;  3C1D A;  4D0P A;  3BR1 A;  3ERE D;  1WI3 A;  3LQR A;  1P92 A;  3K4N A;  1U9N A;  4P1W A;  1W0T A;  4FAS D;  5JHF A;  3D1N I;  1OMI A;  2L0K A;  4FHT A;  3D5S C;  1UHM A;  3UR3 C;  5LHH A;  1L3L A;  4I02 A;  4PFP A;  1PUE E;  1S7E A;  2IS6 A;  2K9N A;  4WF2 A;  2Y31 A;  3DF8 A;  4A3C J;  5CQG A;  1E3P A;  1V4R A;  1WSU A;  3R4K A;  1R5H A;  3ZMV A;  2ZJP F;  1ZGW A;  2ELH A;  4OIR F;  3FF5 A;  2HPM A;  2MD5 A;  3I64 A;  3NAR A;  3RPU A;  4L9V A;  1ZAR A;  1YW9 A;  2DCE A;  2L9V A;  3I56 I;  2HDD A;  1QVT A;  1RC9 A;  4JX4 A;  3QWL A;  5IOY A;  4XN0 A;  3DWL E;  1YX5 A;  4XR6 A;  3GFI A;  2W1O A;  2MH9 A;  2LKP A;  1TBX A;  1ZKG A;  2NNN A;  4PCQ A;  1T38 A;  4QSH A;  3HHH A;  2IS2 A;  1ENH A;  1D0X A;  1R1T A;  4JX5 A;  4I2O A;  5AIP A;  3VFZ A;  3IAS 2;  3L1P A;  1OLT A;  3O8G A;  1JGG A;  3ZQH A;  5FB2 A;  3AG3 H;  2RNG A;  2TDX A;  2VKE A;  3MZ8 A;  3EYY A;  3RKW A;  5E8G A;  2M87 A;  1ETK A;  2Y2Z A;  3EQL F;  4K2E A;  2DMN A;  3M1E A;  4CYC A;  4A3I J;  3C3W A;  3HBL A;  2QQB A;  4W97 A;  2R7Z J;  2HYG D;  3WTZ A;  1Z9C A;  2E1M B;  1H9G A;  5EG0 A;  2VXZ A;  4XKV A;  2LD5 A;  5EEG A;  4S0H B;  4A0Y A;  2L9S A;  4AIK A;  2V9P A;  3BPX A;  2CUF A;  1YI2 I;  3D5R C;  1HCR A;  2DA1 A;  1RZ4 A;  4WXD A;  4U87 A;  5B1B H;  3H9Q A;  2NAZ A;  5CLS A;  4NUB A;  1HW1 A;  4HDU A;  3N97 A;  2QF7 A;  4LOC A;  4J01 A;  2XGC A;  2R5Z B;  1Z7L A;  1R1U A;  1QGP A;  1BIA A;  4EAT A;  3C2G A;  1ETO A;  2KZV A;  3H5A A;  1MIJ A;  2IJL A;  2NVY J;  2OC6 A;  4NB5 A;  2DJI A;  3VYT B;  2JPC A;  2BOL A;  3GUD A;  1P4X A;  3P9I A;  3GLX A;  2FNP A;  2MAB A;  4AIH A;  1YO5 C;  5EZG A;  3RCO A;  2KL4 A;  5D5X B;  1PUF B;  3ZQI A;  2FQ3 A;  3BQZ A;  3CJR B;  3R60 A;  2JSC A;  1OYW A;  1UG0 A;  4BU2 A;  1OCO H;  4II3 A;  4A6E A;  1S6L A;  3ZCO A;  2DO7 A;  1MNM C;  1YLF A;  5IP6 A;  4NNJ A;  3A0H C;  5L3E A;  1VND A;  2E7W A;  1Z67 A;  2VQL A;  4XLP F;  3HTS B;  1FYK A;  3HUG B;  3I9V 2;  2PI0 A;  4B8X A;  3QYF A;  4XLA A;  1FY7 A;  3H0D A;  1Y1V J;  5FFX A;  4LFU A;  4PFO A;  1Q1V A;  2XF6 A;  3P7N A;  3BZK A;  2DOE A;  5E18 F;  1O3R A;  1HW5 A;  2NS8 A;  2QSG X;  4OMZ A;  3S1N J;  2BYV E;  3OV8 A;  3PQJ A;  1LEA A;  2UXX A;  5JLX A;  5EEA A;  2V9V A;  2FUG 2;  1R58 A;  4IQJ A;  1X19 A;  4IEJ A;  3PQK A;  3GTO J;  5B1A H;  1V5G A;  4XSX F;  5E17 F;  1DGW Y;  3BG9 A;  2CMP A;  3DP7 A;  3TED A;  2EQR A;  4PJ0 C;  2HTS A;  1X1C A;  3A01 A;  4YII A;  5F0F A;  2B0L A;  2DDB A;  2AXL A;  1BI2 A;  5L3C A;  5F0C A;  3CCS I;  3ONQ A;  4ZDO A;  3O6B B;  2IVM A;  2JPB A;  2R7T A;  1TWF J;  1O57 A;  5HNH A;  2E34 A;  1KQ8 A;  1D8K A;  4I0A A;  5HVQ C;  4LB5 A;  1IRF A;  1FBQ A;  5FKN A;  1O4X A;  4DBQ A;  4Q5S F;  3R0A A;  5JFR A;  3IP4 B;  1OQY A;  2XPV A;  3BR2 A;  5FRM A;  3GF2 A;  3KP5 A;  3ABU A;  4XMY A;  3CO6 C;  5JR3 A;  3SZP A;  3LSP A;  1Y8Q B;  3BR6 A;  2R0Q C;  5E3N A;  4RM3 A;  2E1C A;  2P8T A;  2ZME A;  2GLO A;  1I50 J;  1MKM A;  4B09 A;  1J2X A;  1MZB A;  3Q9S A;  2KQR A;  3QPT A;  3HRT A;  4C3J J;  4C2T A;  2VT3 A;  4ABZ A;  1U2W A;  3TKY A;  2P7C B;  4BE0 A;  2KKO A;  3HJE A;  2PG4 A;  3EET A;  2FBH A;  1SAU A;  3ZMD A;  4W1U A;  3V4G A;  2C6Y A;  1QHH D;  1ZK8 A;  2FX0 A;  1G8X A;  3VSL A;  3W3C A;  2CW8 A;  2XGX A;  3E6D A;  4HSR A;  4YFX F;  2ZSH B;  1IRG A;  3HZJ A;  2M1B A;  3K2Z A;  1ZR2 A;  3PUB A;  3ZGK A;  5EGO A;  1POG A;  3ZN0 A;  2BV6 A;  3PIO F;  1N25 A;  1R5G A;  2MLG A;  3J80 K;  1IXR C;  3J81 K;  4EJU A;  1QPM A;  2PFB A;  3A03 A;  1QO0 D;  3CMY A;  3FBN B;  3K69 A;  5CQE A;  4LLN A;  4Y52 J;  5DD4 A;  2K40 A;  1VQP I;  4BYY A;  2OF7 A;  1APL C;  4FCY A;  3OYD A;  2CS3 A;  2JJ7 A;  1MBG A;  1J9I A;  2COM A;  2RGV A;  4RB3 C;  4HQM A;  1X1A A;  2L7Z A;  2YS9 A;  4CZC A;  5M5Y J;  3I53 A;  1UB9 A;  3IH2 A;  3CUQ B;  3QPS A;  2KHM A;  2IA0 A;  3K4C A;  1UST A;  3VEP A;  3A4C A;  4L5E A;  1R36 A;  1ETV A;  3W2V A;  4BHC A;  4IF4 A;  1YQA A;  4L9J A;  4LLL A;  1UHS A;  2FBI A;  3WTT C;  1O3Q A;  2ZO4 A;  1OR7 A;  2A6T A;  2FNA A;  3HOU J;  1W5S A;  2MC3 A;  1ULY A;  5M3M J;  4D1Q A;  1IJW C;  1SC7 A;  2DFH A;  2ZJR F;  2BXZ A;  4ZZL A;  5LHG A;  5F6F A;  5LD2 C;  2N8G A;  2Y48 A;  5B5E C;  1Z7U A;  4XRS A;  3PL8 A;  2DDA A;  1XSV A;  2XHK A;  3DPL C;  4G6D A;  4KIC A;  4PGG A;  5J47 A;  5KNL A;  2LY1 A;  4MTE A;  1UHW A;  1D1B A;  2JSP A;  4G9Y A;  5D5V B;  3OYN A;  3SJM A;  3BWG A;  3EDP A;  1GT0 C;  1DGR M;  5D5W B;  1UJ8 A;  5L3B A;  4KIS A;  2FA5 A;  4E6K G;  1X3W B;  3BTJ A;  2E7X A;  5BOX A;  1ZG1 A;  2QWW A;  3HDD A;  1TWA J;  2H1L A;  1I3A A;  2XV4 S;  2ZXI A;  3KZZ A;  2BEO A;  4XK4 A;  3W6V A;  2L7M P;  3RKX A;  2CUZ A;  3H3V K;  2EH3 A;  3JCU C;  2W84 A;  1W4M A;  2BXY A;  2DOD A;  5CJ9 A;  2MBF A;  4CA0 A;  3L2V A;  1MSE C;  3D0S A;  3K1N A;  4GDF A;  3JRB A;  3NRV A;  4UVA A;  3OS1 A;  1KU3 A;  3OIQ A;  3F8C A;  3ZR8 X;  1MJ9 A;  1YYV A;  4HF0 A;  3QOP A;  1LJ9 A;  5J1U A;  2BY0 A;  6PAX A;  3B02 A;  2WV1 A;  4BAC A;  3PFI A;  4EEF G;  1AA7 A;  2ZJQ F;  1ZGJ A;  4XM3 A;  1XS9 A;  1NH3 A;  3CQZ J;  1WJF A;  4XLN F;  2NVT J;  4B4C A;  1U6G A;  3QOE A;  3H3Z A;  4NDL A;  4G7O F;  3VWB A;  3MZY A;  1YW7 A;  3Q3S A;  4F91 B;  5J6X A;  4ESJ A;  4A3J J;  1EA3 A;  2HXO A;  3DBR B;  1UG2 A;  4RS8 A;  4HPQ A;  3IWF A;  1K79 A;  1I6X A;  1X4P A;  3RQI A;  2IT0 A;  1USS A;  3VSK A;  2W82 A;  2EZK A;  2UXN A;  5IT3 A;  4RMN A;  1N77 A;  2Z1D A;  1GUU A;  2OU2 A;  1EV7 A;  4P96 A;  3MQ0 A;  5LRR A;  2DAO A;  2R7D A;  1XCV A;  2R7R A;  2CU7 A;  1BJZ A;  2ZKZ A;  1B72 A;  3CCY A;  3PFY A;  2ACJ A;  2JA6 J;  4FX0 A;  4XIC A;  3C2B A;  1IV8 A;  3F0C A;  2KIF A;  3CCL I;  4FE4 A;  2HOT A;  2VJJ A;  5FD5 A;  5IYB J;  4R79 A;  1QU3 A;  5L3D A;  3SFZ A;  2ZXW H;  4C2U A;  2TCT A;  4UUV A;  2HU9 A;  1QZE A;  4LD5 A;  5DYM A;  3CF5 F;  4HA8 A;  3TO6 A;  3HSR A;  3V42 A;  1W7P B;  3L2U A;  1MND A;  4M6V A;  1JT0 A;  3OYK A;  4UY8 I;  4MFD A;  1B9N A;  3RYP A;  4G94 A;  1HSJ A;  1IG7 A;  1GVD A;  1SVM A;  1T08 B;  2EJR A;  2O7O A;  3OR1 C;  4DOZ A;  1YW8 A;  1FIP A;  2EFW A;  5HOO A;  4MQ9 F;  1MSF C;  1FP2 A;  2BGC A;  3ERM A;  1MJA A;  2I10 A;  3KX2 A;  2ELJ A;  1Z1D A;  1WQ2 A;  5FJ8 J;  3E5Q A;  1AHD P;  5GPC A;  5FLV A;  2B63 J;  1Z6T A;  1JI8 A;  1GVJ A;  2QBY B;  3Q0V A;  3WG7 H;  1T39 A;  3S15 J;  2XRL A;  1JT6 A;  1DPR A;  1R23 A;  2HQR A;  4O5V A;  1SFO J;  5HLG A;  2R5Z A;  5HLH A;  1Y0U A;  2BZT A;  3E5X A;  2M45 A;  4UV8 A;  4A69 C;  2HS5 A;  4OWR B;  1ZRC A;  3HPG A;  4JK1 X;  3V7C A;  5D4S A;  3IRR A;  1VQ4 I;  1SAN A;  1TQI A;  5K7F A;  2H6B A;  1ZRD A;  3TW6 A;  1F5T A;  4BQO A;  1ZG5 A;  3G3Z A;  2F5E A;  2VKV A;  2MA3 A;  3V7R A;  2PLY A;  3LWF A;  1PUF A;  2CQN A;  4XBF A;  1Y1W J;  5FKO A;  1WJD A;  3GW2 A;  4MQV A;  2J5P A;  3HOV J;  3OYG A;  5FFZ A;  5FLX Z;  3QP5 A;  2PMU A;  4AUX A;  3IAM 2;  1MBJ A;  2QGU A;  3KP2 A;  4NQW B;  3OYA A;  1F9N A;  2VJ5 A;  1E3O C;  3QAH A;  2CJJ A;  3FXR A;  1PDN C;  3FIS A;  2F4I A;  3HUG A;  3JSO A;  1CQT A;  1CF7 B;  4XLH A;  3LSR A;  4M3G A;  1VQ6 I;  4AYB A;  5LEJ A;  4KA4 A;  1K78 B;  3CO7 C;  3BQY A;  2LSO A;  4RGU A;  5H6R A;  4ENM A;  1T0F A;  5CVJ A;  2XB5 A;  4C3H J;  4DBR A;  1W0U A;  3GTG J;  2RVC A;  4KFC A;  5L3G A;  4XRS G;  2VE9 A;  1YRN B;  4XL9 A;  1FIA A;  4DJA A;  1K61 A;  3GX4 X;  1I39 A;  2EIL H;  2WV0 A;  4D9J A;  3GYH X;  1V3F A;  2LKX A;  3T1B A;  2P6T A;  2RN7 A;  4RB0 A;  3DKY A;  5BQT A;  1A35 A;  1GV5 A;  1ZRF A;  3FIW A;  1P7I A;  3CLQ A;  5DUI A;  2L5Q A;  3PUF A;  4WCG A;  4ZH4 F;  3JRF A;  1GLN A;  3F8M A;  3LSM A;  1W36 D;  4GCV A;  2A5W A;  2AO9 A;  1VFC A;  1SFK A;  3IHU A;  3M9A A;  3EUK L;  3I71 A;  2KLO A;  1FT9 A;  1GHC A;  3ZP5 A;  3AAF A;  5HDK A;  1ZYR F;  2Q8K A;  2NVQ J;  1DU6 A;  5DCM B;  5J4Y A;  3CDI A;  2K4B A;  3QP6 A;  4NC6 A;  3ROU A;  2X85 A;  3LFK A;  5IP7 J;  1R9T J;  3S3N A;  3DU6 A;  4FT8 A;  5E1W A;  5F64 A;  1OCZ H;  1R4N B;  4ITV A;  3V7S A;  3WGI A;  4HOB A;  3TP0 A;  5ILU A;  2V4J C;  1FJL A;  4M72 A;  3CJQ B;  3O8H A;  1O7L A;  3CDH A;  4KN7 X;  2YX7 A;  1XGO A;  3VOD A;  1B6A A;  3J7A Y;  3HPH A;  2G0E A;  2EA4 A;  1F36 A;  1VQ5 I;  1S3J A;  2DLL A;  2HVQ A;  4DZJ A;  2EZL A;  1FYL A;  3DXJ F;  3C18 A;  2ID6 A;  1IW7 F;  2V79 A;  4ZYD A;  2ZFW A;  2DK8 A;  5DTD A;  4QPO A;  2IGM A;  1TT5 B;  3U21 A;  2W57 A;  1HOM A;  5JHU A;  2HYJ A;  5LGN A;  2DA6 A;  2DA2 A;  5K1Y A;  5EEH A;  1YIO A;  4MHG A;  2VL8 A;  3RPU D;  4ENN A;  4EV0 A;  1AOY A;  1IGN A;  2JRM A;  2QLZ A;  5FKL A;  4A3B J;  1PYV A;  1TT0 A;  3BC8 A;  2Q2E B;  2ZSI B;  2Z2S B;  2W48 A;  1SVL A;  2DJN A;  2FF4 A;  2M0M A;  1ZRE A;  3GTP J;  4FET A;  4UUS B;  3HOX J;  1JTY A;  4KJZ A;  1WRJ A;  3F21 A;  2LY9 A;  2JUC A;  3FXM A;  2GWR A;  3FWE A;  2EPF A;  2GA1 A;  2RAE A;  2KZG A;  4Q47 A;  4EGZ A;  1T6S A;  4KMU X;  4A5M A;  1GXP A;  4IQ4 A;  4DZP A;  4OMY A;  1J75 A;  2VOO A;  1JE8 A;  4I6Z A;  5LEK A;  2ZCW A;  2P0W A;  2MG4 A;  1ZH5 A;  2IEK A;  5B66 C;  3I4N J;  3T8T A;  1XSX A;  3CUQ A;  4J19 A;  5IPA A;  1T8I A;  3TL4 X;  1GXQ A;  2PEX A;  2DOA A;  1OJL A;  3I3L A;  3BOQ A;  2D5V A;  2DFE A;  4L18 B;  1G59 A;  1Y56 A;  4KT5 C;  2VQG A;  5J8F A;  2VXD A;  2O61 A;  3FMR A;  2P6S A;  5IY5 H;  1RNL A;  4P5O A;  5DD8 A;  1YTY A;  2E5Z A;  1IV6 A;  3SFI A;  4MEX F;  4BHP A;  2VB6 A;  3BG5 A;  1R4M B;  2KIU A;  1PVE A;  2ZBK A;  1DP7 P;  3QOD A;  1MH4 A;  3ULQ B;  2A07 F;  2F5D A;  5HS9 A;  1A5J A;  4RB2 C;  3MEX A;  3M7G A;  2IRF G;  2XF7 A;  2VI6 A;  4UB8 C;  2YU9 J;  1IRZ A;  4FX4 A;  3DTK A;  3AKZ A;  2FD5 A;  1FOK A;  3DQV C;  2VJI A;  5H2F C;  3G71 I;  2BBY A;  2EV5 A;  5KAF C;  2XAF A;  3AG2 H;  1TZL A;  3JRD A;  5LRS A;  2HDC A;  3TDU C;  2E2J J;  1B1B A;  2LFB A;  3OR2 C;  1STZ A;  5GAD J;  5KHD A;  4GGG A;  4YIR X;  1QNT A;  3H9G A;  4PDK A;  2X6X A;  1EF4 A;  3IKT A;  4OIN F;  4D5F A;  4XKW A;  1LVA A;  3CLO A;  4U7B A;  2BY1 A;  5LFA A;  2BHY A;  2GXG A;  4XLE A;  2EZH A;  2DA7 A;  1Z21 A;  5L3F A;  1RKW A;  1YJW I;  3DLL F;  1XMK A;  3JRG A;  1F4K A;  2KJC A;  2X1C A;  3FXO A;  2R92 J;  1A6I A;  1W36 C;  4LIV A;  3I0T A;  2DW4 A;  2XB0 X;  3JTG A;  1VQK I;  3MKZ A;  3KP3 A;  3ZQL A;  3HG9 A;  4OU0 A;  3PIP F;  5IOZ A;  2F4O B;  1Y0N A;  3JAM Z;  2FJ1 A;  2X4H A;  4E7L A;  1FYM A;  4C2M J;  1C0W A;  1P7J A;  2X9D A;  5E79 C;  1LKX A;  4E7I A;  3JAM K;  1U5T C;  1NG6 A;  2XAQ A;  1WI9 A;  2VBW A;  1D8J A;  5J3L A;  4A93 J;  2DMQ A;  3RYR A;  2DT5 A;  3L2W A;  2F4M B;  2O8X A;  1ETY A;  4HLY A;  1U9O A;  2Y0S A;  4PZJ A;  4E7J A;  2ICW G;  3IC7 A;  3ZQC A;  2V7F A;  2Z5U A;  2M8E A;  4BE2 A;  4RGX A;  1H89 C;  4UNO A;  4HX4 A;  1EH6 A;  1KA8 A;  3A0B C;  3ASO H;  4M3B A;  3WTX C;  3S3O A;  4AVZ A;  3K4K A;  5E3O A;  5KCM A;  1S72 I;  2WB1 A;  2D1V A;  1ETW A;  1BOA A;  1VI0 A;  5HS8 A;  3BCA A;  1IN5 A;  2AXT C;  1W7P A;  2BVL A;  2H09 A;  4OIP F;  1AKH B;  4M6Y A;  4M9X A;  4NHJ A;  2ZXH A;  3CES A;  2L01 A;  1FC3 A;  3S3M A;  5E20 A;  4EM1 A;  5EJC A;  4MNU A;  4BS9 A;  1LFU P;  2IP2 A;  3DTE A;  1ZN2 A;  1ZAO A;  3FMS A;  5BS6 A;  4LIU A;  1A36 A;  3I59 B;  3KLO A;  1LUJ B;  4LMY A;  3PNV A;  2DA4 A;  2R7U A;  1WJC A;  4YRV A;  1XDU A;  4GFB A;  1E0E A;  1MNE A;  3FHN A;  2XGD A;  5D6E A;  2XC7 A;  3CMM A;  3OYM A;  2DYS H;  5IYC J;  3LAJ A;  2X1E A;  1K6Y A;  1SMT A;  3AG4 H;  3K4M A;  2M3A A;  4RGS A;  4QPQ A;  2QBY A;  2ZNY A;  3R0J A;  3HXL A;  3CC2 I;  2LDU A;  5DCF A;  5ICG A;  1T98 A;  1D1C A;  3QRF F;  1HLV A;  3QPL A;  3F8B A;  1UZC A;  4H4K C;  3L9F A;  3IV5 A;  3HSF A;  2O0Y A;  5FO5 A;  4AD9 A;  4BGD A;  4IX7 A;  2L4M A;  1SD5 A;  4AWX B;  4QLC U;  1DPU A;  1ON2 A;  4I76 A;  2LY2 A;  2P5L C;  4XLC A;  5GPA A;  1U8R A;  2NVX J;  2EZI A;  1HDP A;  2Y0M A;  5FGM A;  1SD4 A;  2VLA A;  4HNV A;  3V8K A;  1PP8 F;  1BC7 C;  4ZTF A;  3KLN A;  3LSJ A;  4B3X A;  1VTN C;  1OCC H;  2HZD A;  2LTP A;  2GIZ A;  1WCM J;  4NQW A;  3WTU C;  1F43 A;  4HG2 A;  5DDG A;  5GTI C;  1KU9 A;  1CF7 A;  2QQA A;  2XAS A;  4A0Z A;  2GOM A;  2X51 A;  4P9F A;  4Z2Y A;  3REO A;  5HLT A;  3VPR A;  3GWZ A;  2H1K A;  2FRH A;  2UUZ A;  2VKH A;  3KZI C;  3S1R J;  1K78 A;  1JGS A;  4C30 A;  4L0Y B;  4M73 A;  5ILV A;  2WTE A;  3LSK A;  3MWM A;  1BL0 A;  2HVS A;  5FD6 A;  2XAJ A;  2V1U A;  3ZMT A;  3I4M J;  3KP7 A;  3CTA A;  3ISP A;  1GDT A;  1YRN A;  2DBB A;  1U8B A;  2DA3 A;  5FKK A;  1IO2 A;  4EVI A;  1HA8 A;  4M9Z A;  3MKW B;  3OMY A;  2EK5 A;  4M3F A;  1MDM B;  1IF1 A;  3AL0 C;  3KCC A;  3HOY J;  1KZH A;  1B9M A;  1JXS A;  2IW5 A;  3EUA A;  1VQL I;  2EFO A;  3CF2 A;  1S9H A;  4BHB A;  2QUF A;  1D0Y A;  1YHQ I;  1IXC A;  2VQH A;  3FXU A;  4I01 A;  4F55 A;  4IOC F;  5DCM A;  4CUG A;  5K5O A;  2R7Q A;  1I1G A;  2E5N A;  2Y0S N;  3PSF A;  2EFQ A;  4WK8 F;  2HOA A;  2DMP A;  4CH7 A;  5K5R A;  3ESW B;  3VDX A;  2K86 A;  2K9S A;  2CFX A;  2ESN A;  2Z33 A;  1WWX A;  2EIM H;  1RUN A;  1DQU A;  2IGK A;  3MFK A;  3A02 A;  3UNG C;  1VQ7 I;  4ZYG A;  4A0X A;  2VIX A;  2A6H F;  1G2H A;  3OOU A;  2QKM B;  2WC2 A;  5J1Y A;  3K70 D;  2M34 A;  3BG3 A;  4L5I A;  1LDJ A;  1NTC A;  2BHZ A;  2HFH A;  2H8R A;  3HOZ J;  1ERD A;  4FE7 A;  3BG6 A;  4CCJ A;  2FOW A;  2I8D A;  2MH2 A;  2R7W A;  4F7Z A;  1P6R A;  1I27 A;  1DU0 A;  1FZP B;  1H9T A;  2VBZ A;  3LAP A;  4B3A A;  3ZMU A;  2H94 A;  3H5N A;  2LNB A;  2L54 A;  2OD5 A;  2JVH A;  3VYU B;  3GO5 A;  2E2I J;  3HRM A;  4G12 A;  4UXN A;  3K2A A;  2ZME C;  2Q2E A;  3BR5 A;  1VQM I;  4Y7N J;  2M5W A;  2OCC H;  2YPR A;  2FQ4 A;  4JQF A;  2BW3 B;  3BLY A;  4G6T B;  2NVU B;  1NG7 A;  4DYQ A;  4PUS A;  2Y30 A;  4E70 A;  2JUG A;  3H0G J;  2HYF A;  3H1C A;  3A2K A;  2CV0 A;  4UUS A;  1TW3 A;  1BM9 A;  2XIG A;  2KT0 A;  1Z05 A;  3RI4 A;  2AS5 F;  3EYI A;  3HKZ A;  1BI0 A;  3M07 A;  2XDV A;  4IHW A;  4BJT A;  4DQ2 A;  4EJV A;  2E2H J;  1IN8 A;  1IRX A;  3M8F A;  1Z0X A;  2DTR A;  2Q1Z B;  2PBI A;  3KEY A;  3PNY A;  3KP6 A;  4IHS A;  1SFX A;  4X1E A;  2OJE D;  1TNS A;  5F1J A;  2PJP A;  2VUM J;  1R71 A;  3H3U A;  1LEB A;  1FWZ A;  3DKX A;  3CME I;  3GTQ J;  5HDN A;  2HEO A;  3ABL H;  4E4H A;  4E7H A;  2RQP A;  1J0R A;  4P9U A;  2IA1 A;  4BNC A;  4S05 A;  2HR3 A;  4XLF A;  2R7V A;  5LGT A;  3IL2 A;  3D5L A;  1J59 A;  5H20 A;  4EJO A;  3GTJ J;  3PO3 J;  4JBA A;  1G6N A;  1OYI A;  1ZLK A;  4N4N B;  2EIJ H;  1XB4 A;  4IZZ A;  1B8I B;  2HGC A;  2P5V A;  1VQ8 I;  4GRI A;  5F27 A;  1LB2 A;  4FIS A;  1KGS A;  1V5E A;  1WH5 A;  2ZB9 A;  3CCM I;  1YJ9 I;  5HLI A;  2Z9O A;  3ECO A;  2CG4 A;  4L5J A;  3T0Y A;  4U0V A;  4ZZD A;  2A61 A;  2V1N A;  5FRN A;  2HTJ A;  4V19 K;  3DU5 A;  1UEL B;  3L2C A;  1O3T A;  1W5T A;  3MCZ A;  1UMQ A;  2EBI A;  2JA8 J;  1FBU A;  2HQN A;  4Y17 A;  3T8R A;  3CP2 A;  2VBY A;  1OR7 C;  4NBQ A;  1VF9 A;  2L9N A;  2OCE A;  3S8P A;  4YFN F;  1FSH A;  2R5Y B;  1QRY A;  2RQQ A;  2ID3 A;  1KU2 A;  2OTJ I;  2F48 A;  1WKM A;  2E36 A;  2OZU A;  1ZLJ A;  4XN3 A;  2GXA A;  4B1R A;  2HXI A;  1SD6 A;  1BW6 A;  4CCM A;  1TWG J;  4CGZ A;  4L9N A;  3OSG A;  4V2G A;  2A3S A;  5K5Q A;  3SEZ A;  1XSD A;  3Q9V A;  4ANJ A;  3HEF A;  2CWE A;  3J7Y J;  1EJ9 A;  4E7K A;  3IWZ A;  2IS1 A;  4KT6 A;  5ILS A;  2E1O A;  2EWN A;  2DFI A;  3BTL A;  3CMA I;  1I1S A;  3GTM J;  3A1Y A;  1V54 H;  1XMX A;  4OOI A;  5M5X J;  1ETX A;  5F04 A;  3H36 A;  3GTL J;  5KVR A;  5D6F A;  2LMD A;  3GZ6 A;  2ETH A;  2W85 A;  3HOS A;  2GIV A;  3TP3 A;  3KET A;  3PM1 A;  3BTI A;  1R49 A;  1OPC A;  2LF7 A;  4HW0 A;  2LRE A;  3MMY B;  5CVR A;  2KP6 A;  4PSW A;  1U3E M;  2HZT A;  5D8L B;  2EB7 A;  3BJA A;  2G7U A;  2NXN B;  4E7Z A;  2KIQ A;  1KYW A;  2LF8 A;  2RRE A;  4AVP A;  4D7N A;  3PJR A;  3N05 A;  2ME6 A;  3MKL A;  4BEH B;  3LOC A;  3C7J A;  4F93 B;  1YJN I;  2VBX A;  4XKB A;  2ISY A;  1QVU A;  3DEE A;  2LOO A;  3K70 C;  2PJR B;  1R22 A;  2LYC A;  4KIG A;  4Q48 A;  3FXJ A;  3F3X A;  1I3Q J;  4GXO A;  1XCB A;  2Y75 A;  1R00 A;  2L3D A;  2K9M A;  2MD0 A;  5GAH J;  1HXD A;  3LA2 A;  3LSI A;  2AQF A;  4U88 A;  5DM7 F;  3J7A O;  1SEU A;  3BZ6 A;  3HHG A;  2QYO A;  2ME0 A;  4KYW A;  1IUF A;  4LG0 B;  1AKH A;  1G3W A;  5FLM J;  3M4O J;  1MMG A;  3HM5 A;  2K7L A;  1FOX A;  3FM5 A;  2ZC2 A;  5EDN A;  2LRD A;  4MTD A;  2MGQ A;  1MBH A;  2DMU A;  3ASN H;  3GVA A;  1MBK A;  1JHF A;  2CSO A;  2K4J A;  3K1M A;  2NS0 A;  2XF5 A;  3JTH A;  3I59 A;  1DDN A;  1XN7 A;  2DQR A;  3RKQ A;  3ABT A;  1YOV B;  3I55 I;  1E17 A;  4J00 A;  4IVN A;  1FTZ A;  1YE9 A;  2K85 A;  5ED4 A;  2WAQ A;  1MMA A;  2M0C A;  3HOT A;  2DYR H;  1R7J A;  1RI7 A;  4R8H A;  4BBR J;  4ETS A;  1K6O A;  3ECH A;  4CO8 A;  5FLX K;  3E6B A;  2Y9Y A;  3G73 A;  4UV9 A;  3WHB A;  2F5F A;  4IHT A;  1D3Y A;  3DKW A;  3WTV C;  9ANT A;  1LFB A;  4Y15 A;  4EGY A;  4IRH A;  2GA2 A;  2E1M C;  3TQN A;  4PJL A;  4BXF A;  1H88 C;  4EJW A;  3QU3 A;  4RLF A;  2MC4 A;  1BA5 A;  4IOA F;  5M5W J;  2XVC A;  2VPL A;  1ETQ A;  2GZW A;  3CUO A;  1YFH A;  3DV8 A;  3K10 A;  2XPW A;  4N0B A;  3CC4 I;  2QVO A;  3TOA A;  4N9H A;  1T56 A;  4HX7 A;  2FEZ A;  1JUP A;  2W7N A;  2O5R A;  1FBS A;  5KK1 A;  2JRT A;  4DYR A;  1HDD C;  4A3K J;  1A31 A;  4NC8 A;  2W4S A;  1E2X A;  4BY1 J;  5EF6 A;  4XKC A;  4HF2 A;  1Y6I A;  3ZQF A;  4AC0 A;  4X0G A;  2K9L A;  4PJM A;  1F1Z A;  5LLQ A;  2WAF A;  2M4G A;  1I6H J;  1S8N A;  1QHG A;  4XID A;  5J8C A;  3GTK J;  2F5C A;  4A3E J;  1Z77 A;  1IZ1 A;  4XNF A;  3JRH A;  4MEY F;  1QZY A;  3JRI A;  2VQC A;  2ZNZ A;  1MDM A;  2HDW A;  3GME A;  1U0J A;  5E1Z B;  5ICC A;  3I54 A;  1Q1H A;  2M4K A;  2JZY A;  5JVG F;  1ZR4 A;  1BOB A;  3DBH B;  3RSN A;  1T0F C;  2OZ6 A;  2KFD A;  2FOK A;  4RA2 A;  3RPQ A;  2L9R A;  3GFL A;  3WGH A;  4YIF A;  2XKP A;  2H8W A;  3LFU A;  3B73 A;  2HWV A;  1H0M A;  1JJ8 C;  3RDI A;  3S16 J;  2V1D A;  4XOT A;  2NS7 A;  2V6E A;  2JWT A;  2JMW A;  2Y9Z A;  3EUH A;  2HNH A;  1JJ6 C;  2XSJ C;  4RM2 A;  1AU7 A;  3LSH A;  3BDD A;  3LA7 A;  3SZT A;  1WJ5 A;  3SQN A;  2KDO A;  2ISZ A;  4KIB A;  1OCP A;  1UCR A;  1BN5 A;  2IBD A;  1Z6R A;  3OYI A;  4QIW N;  3BG7 A;  3G1L A;  3ZOB A;  1WJB A;  3KIO A;  2OQR A;  3J7Z I;  1IN4 A;  4KIT B;  4A3G J;  1WJE A;  2PMH A;  1LDK B;  2X6Y A;  1QPI A;  3DCF A;  1XG1 A;  2WAQ N;  4LLG F;  1QBJ A;  3VOE A;  1IN7 A;  2AQE A;  2RDP A;  2B7E A;  4A3M J;  1KU7 A;  1BW5 A;  2OQG A;  1A04 A;  4LGW A;  1UFM A;  4A3L J;  3L2Q A;  4AYB N;  1X4O A;  1X58 A;  1K7A A;  5M3F J;  2O6G E;  5IT9 Z;  1RRJ A;  4A3F J;  2OTL I;  1ORK A;  2OBP A;  4IL6 C;  2ECB A;  2BW3 A;  2IGO A;  3QU6 A;  1B59 A;  4BKX A;  4C9Y A;  3S93 A;  3HGG A;  5BPI A;  2GOX B;  1T33 A;  1W7P D;  1HQC A;  3OYB A;  4OIQ F;  1MD0 A;  3HIF A;  3FKI J;  1D5Y A;  1N75 A;  1Z91 A;  2MW8 A;  2CH0 A;  3F8F A;  4M6X A;  2PQ8 A;  3I58 A;  3HL2 A;  3ZN1 A;  4RB1 A;  2KRH A;  4IHX A;  4ZTJ A;  2UZK A;  2OA4 A;  2CO5 A;  2XRO A;  2EV6 A;  2ZXJ A;  2K9Q A;  2L7K A;  3BJ6 A;  4CIC A;  4B44 A;  3HRS A;  3F6V A;  2Q0O A;  1J5Y A;  3SHF A;  4F3Q A;  5TIS C;  3B6C A;  3OYE A;  2QSH X;  4UVB A;  1LE8 B;  2DPD A;  1Y39 A;  2H6C A;  3FX3 A;  3C2H A;  1QA6 A;  1OKR A;  1WVR A;  2EV0 A;  1WPK A;  2DMT A;  3KEO A;  1Z3X A;  1JHH A;  2LC2 A;  2VE8 A;  1IC8 A;  4BJ5 C;  3FXQ A;  1B8I A;  1YS6 A;  2DOF A;  4IPA A;  2R7X A;  1O3S A;  2Y69 H;  4G7Z F;  1L0O C;  2NNY A;  3N4M A;  1X3U A;  2IPQ X;  3KZY A;  1FPQ A;  3CUQ C;  4LJZ F;  4A3D J;  2KJB A;  2ZJ2 A;  2IS4 A;  3ZQ7 A;  3DEU A;  2Z99 A;  4G7H F;  1SD7 A;  4P55 A;  1TQP A;  2QA4 I;  1IDY A;  2GM4 A;  2JA7 J;  3VYR B;  1B72 B;  3S2W A;  4LB6 B;  4ZYA A;  2EIK H;  1XGS A;  1DUX C;  5DV5 A;  3WTY C;  2FBK A;  1RIO H;  2R5Y A;  3ML6 A;  1FNN A;  3E6C C;  3S1M J;  3FKJ A;  3ZMZ A;  1MMD A;  5LHI A;  4D5C A;  3ZMS A;  2PX9 A;  4CCL A;  5J40 A;  1YIJ I;  3O2P E;  2CYY A;  1IAW A;  4HF1 A;  4WXH A;  2LLK A;  4CSW A;  2K3P A;  3TO7 A;  4HYE A;  1LPQ A;  3FZV A;  3K1P A;  3DPT A;  2DTZ A;  3E1S A;  4RDU A;  3KP4 A;  4WXC A;  2F6C A;  2VOP A;  4HQE A;  4MIM A;  5LBQ A;  4ON0 A;  2HQA A;  4OAZ A;  3LSG A;  3LA3 A;  3L7W A; 
#chains in the Genus database with same CATH homology
 1KYZ A;  3WTW C;  1OYY A;  3W6K B;  4LK0 F;  3GXO A;  3BJO A;  3L09 A;  1LDD A;  2A6E F;  3GEZ A;  4BQA A;  1FSE A;  2A5Y B;  4S04 A;  3HYI A;  4BH9 A;  2W25 A;  3HSE A;  3W6J B;  4EJT A;  4ASN A;  1MGT A;  1ZGA A;  4IJA A;  3F23 A;  2YSR A;  3JSP A;  2QZ8 A;  2DK5 A;  1HKT A;  4I7H A;  4CZZ A;  3KEQ A;  5AIQ A;  4LG0 A;  3F72 A;  4EMS A;  2GAU A;  2V6C A;  2HKX A;  1MJB A;  1CGP A;  1BBY A;  2XRN A;  2FE3 A;  3TGN A;  3WGG A;  2O03 A;  1ODD A;  1ON1 A;  2QQ9 A;  3KFW X;  5ICF A;  2P4W A;  3WU1 B;  4BXU A;  2UWM A;  2VN2 A;  3LQQ A;  2FXA A;  3I5U A;  3CJN A;  5LGU A;  4KMF A;  2O3F A;  1G4D A;  1ZG3 A;  2A69 F;  2YX4 A;  2DPU A;  4HX8 A;  4GO1 A;  5D5U B;  1S7O A;  4M74 A;  4XSZ F;  2RC4 A;  1P4A A;  1I5Z A;  2K02 A;  4EM0 B;  3LST A;  1ONV A;  3FHZ A;  5AON A;  1U78 A;  2HKO A;  2BE5 F;  4ZYH A;  4ENJ A;  1IXS B;  1SMY F;  2P5K A;  4EM2 A;  5BPD A;  4U7D A;  3L00 A;  2FSW A;  4A12 A;  4Q4Z F;  3K0L A;  3M8E A;  1S29 A;  3GFM A;  2E1N A;  1XDS A;  3J80 Z;  3J81 Z;  4I09 A;  2P7V B;  1HW2 A;  2D1H A;  5CVI A;  4HBL A;  2QM3 A;  5HS7 A;  5ICE A;  2XUB A;  1KQ0 A;  3RKY A;  5D4R A;  4GYG A;  4A5N A;  2KRF A;  1NHA A;  4XRF A;  2XAH A;  4EQQ A;  4MGR A;  3RIR A;  1TW2 A;  4O3M A;  4A6D A;  4HZF A;  1HBX G;  4RAY A;  1P2F A;  2EFN A;  4WWC A;  1SFU A;  1R1V A;  2D2W A;  4I0B A;  2XAG A;  3V8J A;  3BP8 A;  2H27 A;  5DEQ A;  1XD7 A;  1U5T B;  2R7F A;  4BAY A;  2VC0 A;  2YR2 A;  2NYX A;  1HKS A;  1SAX A;  2XKO A;  2V1X A;  2WWY A;  2VT2 A;  2PN6 A;  3GFJ A;  5E1X A;  1FP1 D;  4A2U A;  1SFE A;  1BIB A;  5F1R A;  4U0Y A;  1BI3 A;  3P9K A;  1BC8 C;  3R6S A;  2STW A;  3TDZ C;  3ELK A;  4WX9 A;  4RGR A;  2STT A;  3RTR A;  1J7K A;  2HOE A;  3GZ5 A;  5JI6 A;  2QEN A;  3WOD F;  5JVT A;  2JTV A;  1G3T A;  4KDP A;  4L0Z B;  3FM3 A;  1LQ1 A;  2CQK A;  3BY6 A;  3MAJ A;  4AIJ A;  2VON A;  1AWC A;  1EH8 A;  3BRO A;  4LK1 F;  2G7H A;  3I4P A;  3Q5F A;  5TJJ A;  1G3Y A;  3E5U A;  2DU9 A;  2Z3Y A;  5A2Q Z;  1YG2 A;  4YFK F;  4PGH A;  1ZHF A;  2NRA C;  5A2Q K;  1S7A A;  3WE2 A;  1G3S A;  3T5X A;  4DNC A;  3IKV A;  4IRG A;  2MLK A;  5BMZ A;  3FMQ A;  4GYI A;  3DFG A;  1QQI A;  2J5O A;  1T2K A;  1TNT A;  2RKH A;  4CYD A;  3HRU A;  4Y13 A;  3WG9 A;  1REP C;  2RNJ A;  3K9T A;  3OOP A;  2L02 A;  4ENK A;  3WTS C;  1FX7 A;  2ESH A;  5TRD A;  1TTY A;  2M30 A;  5D8K B;  3P9C A;  3RJP A;  3IRQ A;  4UHT A;  2GQQ A;  3TO9 A;  1RUO A;  1XGM A;  4G8X A;  1QZZ A;  1XGN A;  1EH7 A;  4I98 B;  2W24 A;  2DI3 A;  5CVU A;  4OIO F;  3U1D A;  3H92 A;  2R3S A;  4IXA A;  5DUK A;  2ADU A;  1TQM A;  2A68 F;  4O6J A;  2CW0 F;  3F6O A;  1IN6 A;  4IRI A;  5CVV A;  2IA2 A;  3NQO A;  2G9W A;  4G6Q A;  3U2R A;  2VOD A;  1D5V A;  2D45 A;  2ZME B;  4M71 A;  4RAZ A;  1HKQ A;  1IUY A;  2K27 A;  5H6Q A;  5HDG A;  4R1H A;  4N9I A;  2FMY A;  3U9G A;  4ESF A;  5CYV A;  1BI1 A;  3R61 A;  2VC1 A;  1TLH B;  4QWQ A;  3TOB A;  3HTU A;  1LNW A;  4L9T A;  1P4W A;  2DQL A;  3F22 A;  3BPV A;  1KQ9 A;  4CDG A;  4HLX A;  2JT1 A;  4ZYE A;  5ERI A;  3E3V A;  4KN4 X;  3SXY A;  2FU4 A;  3COA C;  3VB2 A;  4ESB A;  2RV8 A;  4KNY A;  3JW4 A;  2OAZ A;  1FLI A;  2GXB A;  2CGP A;  4M9S A;  3E6M A;  3V8L A;  4TV7 A;  2KIM A;  2YU3 A;  4KIF A;  4KUM A;  2L4A A;  2F2E A;  2X0L A;  3WU0 A;  3WE3 A;  4CXF A;  3ZPL A;  3E97 A;  1PP7 U;  1B4A A;  3F8N A;  5IT9 K;  1XMA A;  2EA2 A;  1YS7 A;  3NEU A;  2EFP A;  4UVC A;  2FML A;  4CHU A;  3QPH A;  4YG2 F;  5E8I A;  3MZH A;  3KE2 A;  4U0W A;  3O3K A;  1BJA A;  1HST A;  4H0E A;  4HDV A;  4HV5 A;  1U5T A;  4HV6 A;  1O7F A;  4HAM A;  3C1D A;  4D0P A;  3ERE D;  3LQR A;  1P92 A;  1OMI A;  4FHT A;  1UHM A;  5LHH A;  1L3L A;  4I02 A;  1PUE E;  4WF2 A;  3DF8 A;  1V4R A;  1WSU A;  3R4K A;  1R5H A;  3ZMV A;  2ELH A;  4OIR F;  3FF5 A;  2MD5 A;  3I64 A;  3RPU A;  4L9V A;  1ZAR A;  1YW9 A;  3GFI A;  2MH9 A;  2LKP A;  1TBX A;  2NNN A;  4PCQ A;  1T38 A;  3HHH A;  1R1T A;  4I2O A;  5AIP A;  3VFZ A;  5FB2 A;  2TDX A;  3EYY A;  3RKW A;  5E8G A;  2M87 A;  3EQL F;  4K2E A;  3M1E A;  3C3W A;  2QQB A;  2HYG D;  3WTZ A;  1Z9C A;  1H9G A;  2VXZ A;  5EEG A;  4AIK A;  4A0Y A;  3BPX A;  1RZ4 A;  4WXD A;  2NAZ A;  5CLS A;  1HW1 A;  4HDU A;  3N97 A;  1R1U A;  1QGP A;  1BIA A;  2IJL A;  4NB5 A;  2JPC A;  3GUD A;  1P4X A;  3P9I A;  3GLX A;  2FNP A;  4AIH A;  1YO5 C;  5D5X B;  2FQ3 A;  3R60 A;  2JSC A;  1OYW A;  4A6E A;  1S6L A;  2DO7 A;  1YLF A;  4XLP F;  5L3E A;  3HTS B;  2E7W A;  1FYK A;  2PI0 A;  4B8X A;  1FY7 A;  5FFX A;  4LFU A;  3P7N A;  5E18 F;  1O3R A;  1HW5 A;  4OMZ A;  2BYV E;  3OV8 A;  3PQJ A;  1LEA A;  2UXX A;  2V9V A;  1R58 A;  3PQK A;  4XSX F;  5E17 F;  3DP7 A;  2HTS A;  4YII A;  2B0L A;  2AXL A;  1BI2 A;  5L3C A;  3O6B B;  2IVM A;  2JPB A;  1O57 A;  1KQ8 A;  1D8K A;  4I0A A;  5HVQ C;  4LB5 A;  1IRF A;  1FBQ A;  4Q5S F;  3R0A A;  5JFR A;  3GF2 A;  3KP5 A;  3ABU A;  3CO6 C;  5JR3 A;  3SZP A;  2E1C A;  2P8T A;  2ZME A;  1MKM A;  4B09 A;  1J2X A;  1MZB A;  3Q9S A;  3QPT A;  3HRT A;  2VT3 A;  1U2W A;  3TKY A;  2P7C B;  2KKO A;  2PG4 A;  3EET A;  2FBH A;  3ZMD A;  2C6Y A;  3V4G A;  2XGX A;  3E6D A;  4YFX F;  1IRG A;  2M1B A;  3K2Z A;  3ZN0 A;  2BV6 A;  1R5G A;  2MLG A;  3J80 K;  1IXR C;  3J81 K;  4EJU A;  1QPM A;  2PFB A;  1QO0 D;  4LLN A;  3K69 A;  5DD4 A;  4BYY A;  1J9I A;  2COM A;  2RGV A;  4RB3 C;  4HQM A;  3I53 A;  1UB9 A;  3CUQ B;  2IA0 A;  3VEP A;  1UST A;  1R36 A;  4BHC A;  4IF4 A;  1YQA A;  4L9J A;  4LLL A;  3WTT C;  2FBI A;  1O3Q A;  2ZO4 A;  1OR7 A;  2FNA A;  1W5S A;  2MC3 A;  1ULY A;  4ZZL A;  5LHG A;  5F6F A;  2Y48 A;  1Z7U A;  3DPL C;  1XSV A;  2XHK A;  4G6D A;  4KIC A;  4PGG A;  4MTE A;  1UHW A;  4G9Y A;  5D5V B;  3BWG A;  3EDP A;  5D5W B;  5L3B A;  2FA5 A;  2E7X A;  5BOX A;  1ZG1 A;  2QWW A;  2XV4 S;  3KZZ A;  2BEO A;  3RKX A;  2W84 A;  1W4M A;  5CJ9 A;  2MBF A;  3D0S A;  3K1N A;  3NRV A;  4UVA A;  1KU3 A;  3F8C A;  1MJ9 A;  1YYV A;  4HF0 A;  3QOP A;  1LJ9 A;  6PAX A;  3B02 A;  3PFI A;  1ZGJ A;  4XLN F;  1U6G A;  3H3Z A;  4G7O F;  3MZY A;  1YW7 A;  5J6X A;  4ESJ A;  4RS8 A;  3IWF A;  1K79 A;  1I6X A;  2IT0 A;  1USS A;  2UXN A;  5IT3 A;  2OU2 A;  1EV7 A;  4P96 A;  3MQ0 A;  5LRR A;  2DAO A;  2R7D A;  1XCV A;  2ZKZ A;  2ACJ A;  4FX0 A;  2KIF A;  5FD5 A;  4R79 A;  5L3D A;  3SFZ A;  4UUV A;  4LD5 A;  5DYM A;  4HA8 A;  3TO6 A;  3HSR A;  1W7P B;  1B9N A;  3RYP A;  4G94 A;  1HSJ A;  2EJR A;  1YW8 A;  2EFW A;  5HOO A;  4MQ9 F;  1FP2 A;  2BGC A;  1MJA A;  1Z1D A;  1WQ2 A;  3E5Q A;  1Z6T A;  1GVJ A;  2QBY B;  1T39 A;  1R23 A;  1DPR A;  2HQR A;  4O5V A;  5HLG A;  5HLH A;  1Y0U A;  3E5X A;  2M45 A;  4UV8 A;  2HS5 A;  1ZRC A;  4JK1 X;  3V7C A;  5D4S A;  3IRR A;  1TQI A;  2H6B A;  1ZRD A;  1F5T A;  1ZG5 A;  3G3Z A;  2F5E A;  2MA3 A;  3V7R A;  2PLY A;  3LWF A;  4XBF A;  3GW2 A;  4MQV A;  2J5P A;  5FFZ A;  5FLX Z;  3QP5 A;  2PMU A;  3KP2 A;  1F9N A;  3QAH A;  3FXR A;  1PDN C;  3HUG A;  3JSO A;  1CF7 B;  5LEJ A;  4KA4 A;  1K78 B;  3CO7 C;  2LSO A;  4RGU A;  5H6R A;  4ENM A;  1T0F A;  5CVJ A;  2RVC A;  4KFC A;  5L3G A;  2VE9 A;  3GX4 X;  2WV0 A;  3GYH X;  1V3F A;  3T1B A;  2P6T A;  2RN7 A;  4RB0 A;  5BQT A;  1ZRF A;  5DUI A;  4WCG A;  4ZH4 F;  3F8M A;  4GCV A;  3IHU A;  3M9A A;  3I71 A;  1FT9 A;  1GHC A;  3ZP5 A;  3AAF A;  5HDK A;  1ZYR F;  2Q8K A;  5DCM B;  2K4B A;  3QP6 A;  3ROU A;  3LFK A;  4FT8 A;  5E1W A;  5F64 A;  3V7S A;  3WGI A;  4HOB A;  5ILU A;  4M72 A;  1O7L A;  3CDH A;  4KN7 X;  2YX7 A;  1XGO A;  3VOD A;  1B6A A;  2EA4 A;  1S3J A;  2DLL A;  1FYL A;  3DXJ F;  3C18 A;  1IW7 F;  2V79 A;  4ZYD A;  2ZFW A;  2DK8 A;  2W57 A;  5JHU A;  5LGN A;  5K1Y A;  5EEH A;  1YIO A;  4MHG A;  4ENN A;  4EV0 A;  1AOY A;  2QLZ A;  2FF4 A;  1ZRE A;  1WRJ A;  3F21 A;  2GWR A;  3FWE A;  2GA1 A;  4Q47 A;  4EGZ A;  1T6S A;  4KMU X;  4A5M A;  1GXP A;  4OMY A;  1J75 A;  2VOO A;  1JE8 A;  5LEK A;  2ZCW A;  1ZH5 A;  3T8T A;  1XSX A;  3CUQ A;  1GXQ A;  2PEX A;  3BOQ A;  4L18 B;  4KT5 C;  5J8F A;  2O61 A;  3FMR A;  2P6S A;  1RNL A;  4P5O A;  5DD8 A;  1YTY A;  4MEX F;  4BHP A;  2KIU A;  2ZBK A;  1DP7 P;  3ULQ B;  2A07 F;  2F5D A;  5HS9 A;  4RB2 C;  3MEX A;  3M7G A;  2IRF G;  4FX4 A;  1FOK A;  3DQV C;  2BBY A;  2EV5 A;  2XAF A;  2HDC A;  5LRS A;  3TDU C;  1B1B A;  1STZ A;  4GGG A;  1QNT A;  4PDK A;  3IKT A;  4OIN F;  1LVA A;  3CLO A;  4U7B A;  2GXG A;  5L3F A;  1XMK A;  1F4K A;  2KJC A;  3I0T A;  2DW4 A;  3JTG A;  3KP3 A;  4OU0 A;  3JAM Z;  2X4H A;  1FYM A;  1C0W A;  3JAM K;  1U5T C;  2XAQ A;  1WI9 A;  2VBW A;  1D8J A;  3RYR A;  2DT5 A;  2O8X A;  4HLY A;  4PZJ A;  3IC7 A;  2Z5U A;  2M8E A;  4UNO A;  4RGX A;  4HX4 A;  1EH6 A;  1KA8 A;  3WTX C;  2D1V A;  5HS8 A;  1BOA A;  1IN5 A;  1W7P A;  4OIP F;  2H09 A;  4M6Y A;  4M9X A;  4NHJ A;  2L01 A;  1FC3 A;  5E20 A;  4EM1 A;  4MNU A;  2IP2 A;  1ZN2 A;  1ZAO A;  3FMS A;  5BS6 A;  3I59 B;  3KLO A;  4LMY A;  1XDU A;  5D6E A;  3LAJ A;  1SMT A;  4RGS A;  2QBY A;  2ZNY A;  3R0J A;  2LDU A;  5DCF A;  5ICG A;  1T98 A;  3QRF F;  3F8B A;  3L9F A;  3HSF A;  2O0Y A;  5FO5 A;  4AD9 A;  2L4M A;  1SD5 A;  4AWX B;  4QLC U;  1DPU A;  1ON2 A;  2P5L C;  1U8R A;  2Y0M A;  5FGM A;  1SD4 A;  3V8K A;  1PP8 F;  1BC7 C;  3KLN A;  1VTN C;  4NQW A;  3WTU C;  5DDG A;  1KU9 A;  1CF7 A;  2QQA A;  2XAS A;  4A0Z A;  4P9F A;  4Z2Y A;  3REO A;  3GWZ A;  2FRH A;  1K78 A;  1JGS A;  4L0Y B;  5ILV A;  4M73 A;  2WTE A;  3MWM A;  5FD6 A;  2XAJ A;  2V1U A;  3ZMT A;  3KP7 A;  3CTA A;  3ISP A;  2DBB A;  4EVI A;  4M9Z A;  2EK5 A;  1MDM B;  1IF1 A;  3KCC A;  1B9M A;  1JXS A;  2IW5 A;  2EFO A;  4BHB A;  2QUF A;  1IXC A;  3FXU A;  4I01 A;  5DCM A;  5K5O A;  1I1G A;  2EFQ A;  4WK8 F;  5K5R A;  2K86 A;  2CFX A;  2ESN A;  2Z33 A;  1WWX A;  1RUN A;  3MFK A;  4ZYG A;  4A0X A;  2A6H F;  2WC2 A;  4L5I A;  1LDJ A;  2HFH A;  2MH2 A;  4F7Z A;  1P6R A;  1I27 A;  1FZP B;  1H9T A;  2VBZ A;  3LAP A;  3ZMU A;  2H94 A;  2LNB A;  2L54 A;  2OD5 A;  3GO5 A;  3HRM A;  4UXN A;  2Q2E A;  2M5W A;  2YPR A;  4JQF A;  4E70 A;  2HYF A;  1TW3 A;  1BM9 A;  2XIG A;  1Z05 A;  3RI4 A;  2AS5 F;  3EYI A;  1BI0 A;  4EJV A;  4DQ2 A;  1IN8 A;  3M8F A;  2DTR A;  2PBI A;  3KP6 A;  4IHS A;  1SFX A;  1TNS A;  2PJP A;  3H3U A;  1LEB A;  1FWZ A;  5HDN A;  2HEO A;  2RQP A;  1J0R A;  4P9U A;  2IA1 A;  4BNC A;  4S05 A;  2HR3 A;  5LGT A;  3IL2 A;  3D5L A;  1J59 A;  5H20 A;  4EJO A;  4JBA A;  1G6N A;  1OYI A;  1ZLK A;  1XB4 A;  2HGC A;  2P5V A;  1LB2 A;  1KGS A;  2Z9O A;  5HLI A;  3ECO A;  2CG4 A;  4L5J A;  3T0Y A;  4U0V A;  4ZZD A;  2A61 A;  2HTJ A;  3L2C A;  1O3T A;  1W5T A;  3MCZ A;  1FBU A;  2HQN A;  4Y17 A;  3T8R A;  2VBY A;  1FSH A;  4YFN F;  1KU2 A;  1WKM A;  2OZU A;  1ZLJ A;  1SD6 A;  4CGZ A;  4L9N A;  2A3S A;  5K5Q A;  1XSD A;  3Q9V A;  2CWE A;  3IWZ A;  5ILS A;  2EWN A;  2DFI A;  1I1S A;  4OOI A;  5KVR A;  5D6F A;  3GZ6 A;  2ETH A;  2W85 A;  3HOS A;  2GIV A;  3KET A;  1OPC A;  2LF7 A;  4HW0 A;  5CVR A;  1U3E M;  2HZT A;  5D8L B;  2EB7 A;  3BJA A;  2G7U A;  1KYW A;  2LF8 A;  4AVP A;  3C7J A;  2VBX A;  2ISY A;  1R22 A;  4KIG A;  4Q48 A;  3F3X A;  4GXO A;  1XCB A;  2Y75 A;  1R00 A;  2L3D A;  1HXD A;  3LA2 A;  4U88 A;  3J7A O;  3BZ6 A;  3HHG A;  2QYO A;  4KYW A;  4LG0 B;  1G3W A;  2K7L A;  3FM5 A;  4MTD A;  3GVA A;  1JHF A;  2CSO A;  2K4J A;  3K1M A;  2NS0 A;  3JTH A;  3I59 A;  1DDN A;  1XN7 A;  2DQR A;  1E17 A;  3ABT A;  4IVN A;  5ED4 A;  3HOT A;  1R7J A;  1RI7 A;  4R8H A;  4ETS A;  1K6O A;  3ECH A;  4CO8 A;  5FLX K;  3E6B A;  3G73 A;  4UV9 A;  2F5F A;  4IHT A;  1D3Y A;  3DKW A;  3WTV C;  4Y15 A;  4EGY A;  4IRH A;  2GA2 A;  3TQN A;  4EJW A;  3QU3 A;  2XVC A;  2GZW A;  3CUO A;  1YFH A;  3DV8 A;  4N0B A;  2QVO A;  3TOA A;  4N9H A;  4HX7 A;  2FEZ A;  1FBS A;  5KK1 A;  2JRT A;  1E2X A;  4HF2 A;  1F1Z A;  5LLQ A;  1S8N A;  5J8C A;  2F5C A;  1IZ1 A;  4MEY F;  1QZY A;  2ZNZ A;  1MDM A;  5E1Z B;  5ICC A;  3I54 A;  1Q1H A;  2JZY A;  2OZ6 A;  3RPQ A;  2FOK A;  3GFL A;  3WGH A;  4YIF A;  2XKP A;  3B73 A;  2HWV A;  1H0M A;  3RDI A;  2V1D A;  3EUH A;  3BDD A;  3LA7 A;  3SZT A;  3SQN A;  2ISZ A;  4KIB A;  1UCR A;  1BN5 A;  1Z6R A;  2OQR A;  1IN4 A;  2PMH A;  1LDK B;  4LLG F;  1QBJ A;  3VOE A;  1IN7 A;  2RDP A;  1KU7 A;  2OQG A;  1A04 A;  4LGW A;  1UFM A;  1K7A A;  2O6G E;  5IT9 Z;  2OBP A;  3QU6 A;  1B59 A;  5BPI A;  1W7P D;  1HQC A;  4OIQ F;  1MD0 A;  3HIF A;  1Z91 A;  3F8F A;  4M6X A;  2PQ8 A;  3I58 A;  3ZN1 A;  4RB1 A;  2UZK A;  2OA4 A;  2CO5 A;  2XRO A;  2EV6 A;  2ZXJ A;  3BJ6 A;  4CIC A;  3HRS A;  3F6V A;  2Q0O A;  1J5Y A;  3SHF A;  4UVB A;  2DPD A;  2H6C A;  3FX3 A;  1OKR A;  2EV0 A;  3KEO A;  1JHH A;  2VE8 A;  3FXQ A;  1YS6 A;  4IPA A;  1O3S A;  4G7Z F;  1L0O C;  2NNY A;  3N4M A;  1X3U A;  2IPQ X;  3KZY A;  1FPQ A;  3CUQ C;  4LJZ F;  2KJB A;  2ZJ2 A;  3ZQ7 A;  3DEU A;  4G7H F;  2Z99 A;  1SD7 A;  4P55 A;  1TQP A;  3S2W A;  4LB6 B;  1XGS A;  1DUX C;  5DV5 A;  3WTY C;  2FBK A;  1RIO H;  3ML6 A;  1FNN A;  3E6C C;  3ZMZ A;  5LHI A;  3ZMS A;  3O2P E;  2CYY A;  1IAW A;  4HF1 A;  4WXH A;  3TO7 A;  4HYE A;  3FZV A;  3K1P A;  3DPT A;  3KP4 A;  4WXC A;  2VOP A;  4HQE A;  5LBQ A;  4ON0 A;  3LA3 A;  3L7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...