3UKGA

Crystal structure of rap1/dna complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
223
Chain Sequence
b'KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title The orientation of the C-terminal domain of the Saccharomyces cerevisiae Rap1 protein is determined by its binding to DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 60
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA02
1HLVA 5FKKA 3L1PA 4FE4A 4A3MJ 1MBEA 5EZHA 2ID6A 2K9SA 1HOMA 2M34A 4BBSJ 1I50J 4UUSB 3O8GA 5IP7J 1YRNB 1RESA 2NVYJ 2Y9YA 3ZQFA 3A01B 1B8IB 2HI3A 5IYBJ 5F08A 1W0UA 2LR8A 2WV1A 5IPAA 5J3LA 3FKIJ 3IH3A 2CJJA 4D7MA 3HGYA 4X1EA 1P7JA 1P7IA 4IHVA 1MH3A 3ZQLA 2IEKA 2TCTA 4GFBA 4A3JJ 2XB5A 3BQZA 2X48A 2HOAA 3E7LA 3K2AA 1JJ8C 3O8HA 1NTCA 4DZPA 4M3GA 5JLXA 4B1RA 1IV6A 2JA7J 3M4OJ 3SDGA 1FJLA 1JUPA 3HB9A 1GV5A 4D7NA 3GTOJ 2R5ZB 2XRLA 1Z0XA 2EZIA 4A3IJ 1IUFA 3JRHA 2DA5A 4AYBN 1I3QJ 2KDZA 1XG1A 1RETA 2GBYA 3OSFA 5EZGA 4UUTA 3B6AA 4XRSA 2E2JJ 1IRZA 3HEFA 2ELKA 1RKTA 1DU0A 1UHSA 3DCFA 2ME0A 2PMZN 3HOUJ 2E1OA 2NS8A 4S0HB 4XRMA 1BL0A 4C3IJ 5F1JA 3F0CA 5FJ8J 3I4MJ 1VFCA 2ZB9A 3BTLA 3BR5A 3LSPA 2LP0A 5J1UA 4G12A 2XGEA 1TWFJ 3PM1A 3IV5A 1R9TJ 1FEXA 1NK2P 2JA8J 5EF6A 2CRGA 2GM4A 2Y9ZA 3A03A 1GDTA 3CQZJ 4IEJA 1OCPA 2P81A 3HOXJ 1AU7A 2M2EA 2YS9A 2XPWA 2DMPA 3JREA 5IOZA 3B6CA 4HNVA 2R5YA 3MVPA 4D5FA 1FIAA 2EZHA 5F27A 3S14J 2EZKA 1ETVA 3TW7A 2JA6J 2DMTA 4MFDA 3TP0A 2CU7A 2FD5A 4C3HJ 1B72A 2XSDC 5EG0B 5C4XJ 2JJ7A 4C2MJ 4J19A 1QVUA 1VF9A 2KT0A 4Y52J 3MKLA 4W1UA 1WPKA 3FIWA 3GBGA 1K61A 2EBIA 3BTCA 2LK2A 5E3MA 1SFOJ 2LVSA 2CQQA 4A3KJ 3UKGA 5M5XJ 3BR2A 4FCYA 2LKXA 2VKEA 3BR1A 5EEAA 3PO2J 1JT6A 1RR7A 4MIMA 1VNDA 1UMQA 4MO7A 2AO9A 4DYRA 1Y1WJ 3I4NJ 3S1MJ 5GPCA 1FTZA 2H8RA 2E19A 3GTKJ 3JR9A 2QCOA 1ETWA 2K9QA 1WH5A 1LE8B 3GTMJ 3QPLA 1MBKA 2D5VA 2MSYA 2L9RA 3BT9A 2L7ZA 2TRTA 2YU9J 3WHBA 4QIWN 1BW6A 5EGOB 3S16J 1POGA 3ZOBA 3RZDJ 1ETXA 5F04A 1OFCX 3Q0WA 4BKXA 5IP9J 2IAIA 5E3LA 3FISA 2YUSA 2DA3A 2VI6A 2VPRA 3A02A 3PO3J 5FKLA 4M3DA 3TW6A 1EF4A 3JRCA 2X6OA 1H89C 4B3AA 2M8GX 1MBHA 5K7ZA 2XB0X 2XPVA 5C3EJ 2N8GA 3BR3A 2Y31A 1ZGWA 3HDDA 4MLOA 3BTJA 3RKQA 4A3DJ 2MW8A 2R5YB 1TWAJ 3WHCA 4IHWA 3HOZJ 3BG9A 4JX5A 1OJLA 4DZJA 1ITYA 2DA7A 4A3CJ 3GTJJ 1B72B 1QPIA 4RBOA 3JRIA 4A69C 3HBLA 2HXOA 2EZLA 5K7FA 5M5YJ 2XPUA 3HM5A 4UUSA 2LY9A 1Z77A 2CUFA 3M3YJ 2OF7A 4BY1J 1ZTRA 1ZQ3P 3OOUA 4DYCA 2R0QC 5FLMJ 1B8IA 3S2HJ 1A5JA 1GUUA 5M3FJ 2K9NA 1D5YA 2NS7A 1JT0A 1JKRC 4C3JJ 2JN6A 4EEFG 1U8BA 1O4XA 1F43A 3GTQJ 2DA4A 3BTIA 2R93J 1BW5A 1ZK8A 2ECCA 5J1RA 1IC8A 5FLVA 4DYQA 3GTGJ 2HXIA 4RDUA 1WCMJ 3HOVJ 5EDNA 4JP0A 3JRGA 3JRBA 1X58A 1JJ6C 2DA2A 2Y2ZA 5M5WJ 2DTZA 4A3LJ 5C4JJ 1JKQC 3SJMA 3BG5A 5HODA 2K40A 3HGGA 2EQRA 3IH2A 2R7ZJ 2Y30A 1LFUP 1ZKGA 4DW6A 5EYRA 5F0CA 1JGGA 5J1YA 4XICA 3QPSA 2E2IJ 1W0TA 1HDDC 2R5ZA 3W6VA 2DMQA 1MSFC 2DJNA 3S2DJ 1GVDA 4AC0A 4FTHA 2W48A 3TEDA 2COBA 1E3OC 2XGDA 1S7EA 2LFBA 1Y1VJ 1IGNA 3FK6A 4QSHA 3MN2A 1PUFA 3CMYA 1BJZA 1U9OA 1UG2A 2OPTA 1IDZA 4CYCA 5BNGA 2DA1A 1U78A 2GLOA 1HDPA 2FQ4A 5FKMA 2RAEA 2DN0A 1ETYA 3Q3SA 1ZR2A 1HCRA 2M9HA 2HOSA 5GPAA 4XIDA 1FIPA 1U9NA 1OCTC 1MBFA 2L0KA 2NOGA 3RZOJ 2H1KA 1G2HA 2NVQJ 2ID3A 4I76A 5IOYA 2NVXJ 2M0CA 4I6ZA 1JTYA 3JRDA 2HDDA 1K83J 2XGCA 1H8AC 5IP6A 1TC3C 4D5CA 2AHQA 5FKNA 3HOYJ 2DA6A 1QRYA 4JX4A 4ABZA 5IYDJ 2HOTA 2WAQN 3C2BA 4JYKA 4JX6A 1VI0A 4QTRA 1IJWC 1APLC 2JK3A 1H88C 1BA5A 2JA5J 4X6AJ 4XK4A 5IYCJ 1GV2A 2IBDA 3QQAA 3JRAA 3NARA 3HOWJ 4M6VA 1ETKA 1ETOA 1JUSA 2HYJA 4W97A 3BG3A 2ECBA 2JWTA 3RQIA 2X9DA 1RPWA 3GTLJ 1CQTA 2ME6A 3LSJA 1T33A 4V2GA 3OSGA 5EG0A 1AKHA 4A3GJ 3LSRA 5K7HA 4V2FA 1A6IA 3VPRA 2R92J 3ZQCA 1DU6A 1ENHA 1I6HJ 2CUEA 1WH7A 3ZQGA 5M3MJ 1MNMC 2LLKA 2O8KA 1FTTA 3DEWA 1Q1VA 4MFEA 1JKPC 1JUMA 1ZR4A 1X2MA 1MSEC 1AHDP 3FK7A 2EH3A 2VUMJ 2LTPA 5GP9A 3H0GJ 1YRNA 2QF7A 4L5EA 1PUFB 2FX0A 1T56A 3JRFA 3A01A 4CYCB 4BY7J 1LFBA 4A3FJ 2L7FP 5C44J 2G0EA 3BR6A 2L7MP 4FISA 4B4CA 1GT0C 2FJ1A 3IH4A 3NAUA 4IHYA 1MBJA 3G1OA 5DS9A 3S1NJ 4NDLA 3CCYA 4M3BA 3LNQA 4XRSG 3SFIA 3K7AJ 2LD5A 1LE8A 1HF0A 3OIOA 2MG4A 1RKWA 2VKVA 5E3NA 2O7OA 3Q0UA 4Y7NJ 4A3EJ 3LOCA 3BR0A 5EGOA 3TP3A 3D1NI 1ORKA 4LOCA 1TWGJ 3G1MA 2WB1N 1WGXA 1NK3P 3Q0VA 2CQXA 2Y0SN 1IDYA 5JLWA 5F0HA 2O9LA 1TWHJ 3ZQHA 4M3FA 4IHXA 1XC5A 1QVTA 1XS9A 5F0FA 5FKOA 3H3VK 1F36A 1X2NA 4AUXA 1WI3A 3BQYA 2B63J 2NVTJ 2DMUA 2HQ5A 1ETQA 2I10A 3S1RJ 4A3BJ 3G1LA 4FE7A 3S17J 4A93J 1IG7A 1MBGA 4BXXJ 3ZQIA 3LSGA 4BBRJ 9ANTA 3HKZN 1TWCJ 1JKOC 3CDLA 4M3EA 3S15J 2DMNA 1JTXA 2E2HJ 2MGQA 3S1QJ 5DTDA 1AKHB 3GTPJ 1MH4A 2JMWA 1SANA 5E3OA
chains in the Genus database with same CATH superfamily
3CTAA 5FO5A 3LA7A 1H9GA 3E5QA 3FZVA 4XLAA 4ENNA 1K6YA 1T39A 5EZHA 4M9XA 4KT6A 1G3TA 3O8GA 5IP7J 2XROA 3E6DA 3BCAA 3CC2I 1FY7A 2EV6A 3CO7C 1FYLA 2Q8KA 3A01B 4EMSA 3I5UA 4L9VA 2VBZA 2FEZA 5IYBJ 4M6XA 3AKZA 4HNUA 1R5HA 4E6KG 2KIFA 1WJDA 5FD5A 1OYYA 5IPAA 3FKIJ 2XIGA 3IH3A 3U21A 3LSHA 2DT7B 2LYCA 2Z1DA 3QYFA 3K2ZA 3T1BA 2CQ7A 1R5ID 4G7OF 3ZQLA 2TCTA 2QWWA 1WQ2A 4R8HA 3WGGA 2DYSH 2DLLA 4NHJA 4RAYA 2CUJA 1YO5C 4H4KC 1T95A 5K5QA 2HOAA 3K2AA 1O3RA 3M07A 3CUOA 2GXAA 3D5RC 3DBLB 2JA7J 4II2A 1A35A 1FJLA 4NC7A 3T8TA 1YITI 4GGGA 2H6CA 2IGNA 1USSA 4AIDA 4WWCA 1GV5A 3SEQA 1ZRCA 2HKXA 1Z0XA 2EZIA 2IGMA 5L3DA 1RUOA 2DA5A 3CMMA 1GXPA 4PK4A 4EATA 4A0YA 5K5OA 4UXNA 1ZG1A 1RUNA 3OSFA 2PX9A 2OC6A 3B6AA 2VT2A 3HEFA 3F8FA 1XD7A 3DCFA 2PMZN 1HKSA 3B02A 1W36C 1KQ9A 5F1JA 3FMRA 5KAIC 5FJ8J 2NYXA 2ZB9A 3WTVC 2ZXIA 3BTLA 2UXNA 3PUBA 3LSPA 2K86A 2ZFWA 3FKJA 2ELJA 3CLOA 2DT5A 4RAGA 2VJJA 4E7IA 3Q9VA 1BOAA 1YW9A 2IW5A 3ERMA 1DDNA 1FLIA 1BJAA 3RKXA 4CXFA 4E7HA 1NK2P 2J5OA 4HLYA 3K1MA 5EF6A 1Z1DA 2A68F 1E3HA 2XKOA 2Y9ZA 2VPLA 4ESFA 1MJAA 3A03A 4XLHA 1G4DA 1R1TA 2MYSA 3AFHA 3CQZJ 3V7RA 1XB4A 1W5TA 2XPWA 2A6EF 1BBYA 3K4BA 3B6CA 2HZDA 3M1CA 1SFKA 4HNVA 4P5OA 2F5DA 1YJ9I 3S14J 1HKTA 2CGPA 3VDXA 3TW7A 2UXXA 2KFDA 2DMTA 2FD5A 4C3HJ 2BY0A 2XASA 5EG0B 5BOXA 3MQ0A 4RGRA 4PSWA 4F92B 3L2UA 4EJVA 1TNSA 1W1WE 4J19A 4E70A 3PSIA 5BPIA 1KU2A 4EJWA 2QEXI 2CW7A 2V26A 2IS4A 4W1UA 4HRIA 2O0YA 3GBGA 3JTHA 4D9JA 1JHFA 3ZCOA 2MH9A 4C30A 2LK2A 1SFOJ 2OJED 2CQQA 2F5FA 3M8JA 2CUZA 3UKGA 3BR2A 3MZ8A 3GWZA 3GFLA 1WJAA 2Z99A 2A5YB 3PO2J 5J4VA 3LQRA 4CYDA 4O3MA 4PJMA 2W4SA 2HQNA 4MIMA 2R7QA 3CCMI 1XTAA 3OL4A 1FP2A 1UMQA 2AO9A 2HS5A 4XOPA 1Y1WJ 2DPDA 1KONA 4AM3A 2ZXWH 1T8IA 5GPCA 3H5NA 2H8RA 5CVUA 1T0FA 2EK5A 1WH5A 2QZ8A 1BIAA 1MBKA 3FDYA 3BT9A 2WC2A 2G9WA 2TRTA 2P0WA 1HSJA 5ERIA 2L4AA 3CF2A 3F8CA 4L5JA 3ZMUA 3BJ6A 3N97A 3HPGA 2ZC2A 1DPRA 2LOOA 3ECOA 4ON0A 2RV8A 5IP9J 2YUSA 3ZN0A 2ICWG 1KQ8A 1H0MA 3TW6A 2X6OA 3AL0B 4PCQA 2CH0A 1FNNA 3J80Z 2XUBA 1OISA 1U6GA 2X6XA 2FE3A 1ZGWA 3F3XA 4EGZA 3MKZA 3BTJA 1V4RA 1IUYA 4DBRA 2MW8A 2YX7A 3WHCA 3P7NA 4E7KA 1OJLA 2DA7A 2V7FA 3GTJJ 1Z21A 2L54A 4LLNA 1B72B 1T98A 2O61A 3LL7A 3BZ6A 3REOA 4IQ4A 3HBLA 1I27A 2HXOA 3KP6A 3LMMA 2IS1A 3TQNA 2LMDA 5LEKA 3FF5A 1SMTA 3HM5A 3O6BB 2VJ5A 1Z7LA 2KMUA 3I59A 4UUSA 2KPMA 2CUFA 4BY1J 4BQAA 1ZTRA 5HVQC 1KU9A 3VYUB 4DYCA 2BXZA 2R0QC 3S2HJ 1A5JA 3KYCB 1GUUA 2QQBA 4XKBA 2BE5F 1XGNA 2EIMH 2K9NA 3CJQB 5B5EC 2XKPA 1JT0A 2CV2A 1MZBA 2NVUB 3GLXA 3ABMH 4BEHB 1U0JA 3LFUA 2EWNA 2GWRA 2M87A 3Q9SA 2R93J 1BW5A 2EA2A 3T5XA 5J1RA 1XMKA 4DYQA 3GTGJ 4RDUA 5FRNA 5F1RA 4JP0A 3A1YA 5J8FA 3OYFA 3RPUA 5M5WJ 2H94A 3LSTA 3RTRA 4A3LJ 5C4JJ 4C2TA 3OYGA 4CCMA 2P6TA 3QYBA 4IL6C 3IH2A 2MABA 2Y30A 5TGTA 1W36D 3F8MA 3OYLA 4KIFA 2IA2A 4OOIA 4XICA 2RC4A 2E2IJ 1W0TA 3IWZA 5BQTA 5LHGA 1HDDC 2R5ZA 4KN7X 2EB7A 1YQAA 3W6VA 2ZO4A 3MEXA 4HQMA 2CW0F 5DYMA 2FQ3A 1I5ZA 3FM3A 3S32A 5EEGA 3AG4H 3TEDA 3IAS2 3S3OA 1CGPA 2DOAA 4CGZA 3G6EI 2K3PA 4JBAA 4MGRA 3OYNA 2K9LA 4IJAA 2AXLA 3CMYA 2EV0A 4GRIA 4CYCA 2VE8A 2HWVA 2C6YA 2DCEA 1AWCA 4G9YA 4GYGA 2DN0A 1SD7A 3Q3SA 4Q4ZF 4M6YA 5GPAA 3FXOA 4ESBA 4LGWA 3L00A 3KYDB 2YSRA 3CC4I 2X85A 4EQQA 2YPRA 2X1CA 1S9HA 2ID3A 2LC2A 5E18F 2EINH 2WB1A 1JTYA 3JRDA 4G6DA 1K83J 2Y0SA 2BYVE 5E20A 5GAGJ 3KEOA 2AHQA 3EETA 5FKNA 2UV1A 2F2EA 3WTSC 4XLPF 4ABZA 2UUZA 3IL2A 2HOTA 3C2BA 1D1AA 4JYKA 1HBXG 3VSKA 4ESJA 1F1ZA 1J5YA 2P5VA 3F6VA 3IAM2 2VL8A 4L0ZB 2QBYA 2JK3A 1G3WA 5TISC 1MMDA 1E17A 4X6AJ 3A2KA 2FRHA 4XLFA 2PFBA 2XHKA 2IBDA 3E1SA 2Q2EB 3HKZA 3HOWJ 1OCOH 4EV0A 1ETKA 3NWTA 4RGSA 4W97A 3T8RA 3BG3A 1KYZA 3WG9A 1Z7UA 5D6EA 2BW3A 1SD5A 3F8BA 1V5FA 2ME6A 4HSRA 4BQNA 2CV1A 3OSGA 2R7OA 4U7DA 1MMGA 2VQCA 4MTDA 2A61A 2DFIA 3MCZA 4V2FA 2V79A 3ZQCA 4I99C 2HEOA 2EFPA 2IXSA 1I6HJ 2CUEA 3ZMVA 1MDMA 1V5EA 2ZKZA 2M0MA 2VB6A 2LLKA 3NQOA 2O8KA 2ZJ2A 4M71A 3F72A 3SZTA 5JHUA 3E6MA 3FHNA 5FRMA 3FK7A 2VUMJ 2LTPA 2R7SA 4RGUA 3H0GJ 1I1SA 2QF7A 2IPQX 2PBIA 5E17F 1S3JA 4XL9A 2R7TA 3A01A 4IPAA 2JRTA 4BY7J 4A3FJ 2G0EA 3K70C 2PEXA 1PJRA 4B4CA 1OCCH 2FJ1A 3IH4A 1MBJA 1IN7A 3WU0A 5CPRB 5HDKA 3S1NJ 4BJ5C 5KAFC 4M3BA 3BG7A 4XKVA 3ZQQA 1W4MA 1D0XA 1P2FA 1E0EA 1LE8A 1I1GA 4KT5C 4NB5A 2LKSA 2VKVA 4IOCF 3OWTA 4Y7NJ 3RIRA 3LOCA 3CP2A 3BR0A 4YG2F 3BPVA 2X0LA 4LOCA 4XN3A 3A0BC 5D8LB 4G6QA 3G1MA 1NK3P 1WGXA 1Y8QB 3Q0VA 1Z9CA 2VN2A 3HZJA 1T0FC 3PNTA 4WXHA 4FX4A 4FT8A 3ZQHA 1CF7B 2PI0A 2CG4A 3H36A 4RAZA 3L7WA 2M7BA 4N4NB 3C2HA 2J5PA 2ESNA 3BQYA 2B63J 4QLCU 2NVTJ 1Y6IA 2E71A 2I10A 2XAGA 3RI4A 3S1RJ 4A3BJ 2GOMA 3G1LA 2DOFA 1W7PB 1FOKA 1IG7A 1FC3A 1PDNC 4DNCA 3KP2A 1TWCJ 3Q5FA 2M1BA 3CDLA 1UAAA 1F5TA 3S15J 2FSWA 2DMNA 1JTXA 1BI0A 2O8XA 3H9GA 2FNPA 2MGQA 3HXLA 3ZN1A 1IRXA 3OL3A 1EH7A 3H92A 2O3FA 3VFZA 1YLFA 4BYYA 1LDKB 3CF5F 2R7WA 2DBBA 2XDVA 4XSZF 1I6XA 5HS9A 4LB5A 4HV5A 4A6EA 4PZJA 1OYWA 2DFHA 5HS7A 3L1PA 2HU9A 1P4WA 4FE4A 2V9KA 5AONA 1R00A 1UHMA 4ZH4F 4KFCA 2HVQA 4ENMA 2K9SA 1HOMA 2OU2A 3DPLC 4UUSB 4P9UA 1YRNB 1ZRFA 1RESA 3SZGA 4Q5SF 3ZQFA 4Y17A 1D1CA 3SDBA 1R6RA 2H27A 4AVZA 4HLXA 2ZJPF 1R1UA 2F48A 3F22A 1ZELA 2B9SA 2EILH 3GFMA 2QA4I 2VT3A 4OMZA 5J3LA 1KYWA 4ETSA 1X1PA 1P7IA 4IHVA 1MH3A 2IEKA 3TOAA 4XORA 2HPIA 4A3JJ 2ISYA 1SD6A 2JRMA 3E7LA 4IRGA 4HNTA 3R6SA 2HYGD 3O8HA 3BY6A 1NTCA 4DZPA 4RAFA 4B1RA 4BQOA 5J47A 1IV6A 3M4OJ 5HNHA 1I39A 4LLGF 1PP8F 2WY7Q 2K7LA 1OMIA 1S8NA 2Y69H 3D5LA 3HB9A 4D7NA 2R5ZB 2XRLA 5CJ9A 3K6GA 3S3NA 1DUXC 2L5QA 4HBLA 4YRVA 4AYBN 1OCZH 2ESHA 3W2AA 2O03A 3DLAA 3JAMZ 3OYKA 4U87A 5LHIA 2GBYA 1HXDA 2Y48A 4CSWA 2E2JJ 1IRZA 2V6EA 1SMYF 1XDSA 2BHZA 2HTJA 2JPBA 1DU0A 1Z05A 3FM5A 2VJ4A 3HHHA 1KQ0A 4OAZA 2NS8A 4S0HB 2LNBA 3F0CA 4JQFA 1T6SA 3G71I 3I53A 2E34A 1SD4A 4P1WA 2LP0A 2OUMA 2A6HF 2JZYA 3TBIA 3LWFA 4PJJA 1VQMI 1T2KA 1R9TJ 4HDUA 3PQJA 3HYIA 1FEXA 3BC8A 2FA5A 4ASNA 3CCLI 1UELB 2FMYA 4CZZA 2GM4A 4UB6C 1N75A 4IX7A 2WAEA 5CVVA 1SVMA 2EFOA 4PJ0C 2EFNA 4YFNF 1OCPA 2K4JA 3WTYC 2XAJA 2EA4A 1WJFA 1A36A 3AG2H 3V8LA 3JREA 1Y39A 1LPQA 1LDJA 2GXBA 5IOZA 4IZZA 2CS3A 4WXCA 3K70D 2O6GE 3MVPA 4DQ2A 5ICCA 1FIAA 5FFZA 4ZYAA 2EZHA 5F27A 2JT1A 1OYIA 3I64A 4ZJZA 2NRAC 1YJNI 2NAZA 2EZKA 3H3ZA 2JA6J 4MFDA 3G4SI 2AXTC 1B72A 2XSDC 1WSUA 1PYVA 4ZDPA 2FUG2 3WTWC 3OYHA 2JJ7A 4C2MJ 5JVTA 3HOTA 1VF9A 1MJBA 1HW5A 5L3FA 4Y52J 2D45A 1MDMB 2W25A 2KJBA 3MKLA 5AIPA 2JSCA 3ZXSA 1J09A 1D5VA 2KKOA 4HX8A 3FIWA 2WBMA 2DK8A 4I98B 3N4MA 2IJLA 3PFYA 3TO6A 4IHTA 2BOLA 2D2WA 1D0ZA 5A2QZ 1UZCA 5LRRA 3J80K 2HR3A 2X6WA 4KIGA 2A6TA 2QKMB 1KA8A 1YS6A 2VKEA 2XF6A 3KEQA 5EEAA 2M30A 4K2EA 1GHCA 4BEHA 2VE9A 1YYVA 3GXOA 5J40A 3IKTA 2IS6A 4MO7A 3R0AA 3WE2A 1XGMA 2MA3A 3I4NJ 1FTZA 4HZFA 3GTKJ 1ETWA 4NC8A 4YELA 1UCRA 4CUGA 1LE8B 3RJPA 2MSYA 2L9RA 3ZRGA 4XBFA 2AQEA 3DPTA 1YIJI 4Y4RA 4ZDOA 3WHBA 4QIWN 1BW6A 2ZNYA 3S16J 1B6AA 1POGA 4KICA 3LFKA 2DJIA 4I0AA 1R49A 4BKXA 3IC7A 3H9JA 3ZGKA 2IAIA 2DQRA 2DA3A 2VI6A 3A02A 5FKLA 3GZNB 4M3DA 2RQPA 1MBHA 4I7HA 5C3EJ 1AOYA 2N8GA 3VWBA 4KYWA 2P4WA 1J75A 3BR3A 2PJRB 4MLOA 3CCEI 1G59A 3ZMSA 3QYEA 3RKQA 3C2GA 2KRCA 2R5YB 3VSLA 3I58A 3HUGB 5FD6A 4HSTA 3MZYA 1OCRH 3DEEA 5D6FA 4LITA 3KLOA 4YIRX 3K4CA 3KFWX 2LBFA 3QU3A 3TKYA 4RBOA 3FXJA 3JRIA 1UG0A 1D1BA 5K7FA 2Q0OA 4IRIA 2XAQA 1HW1A 4BH9A 2VJIA 1Z91A 3MKWB 3M3YJ 2F4OB 4BNCA 4ZYDA 2PN6A 3HJEA 1LUJB 3RPUD 3OOUA 1TQPA 2QSHX 1B8IA 1B9NA 3BP8A 4U7BA 2GZWA 1YI2I 4UV8A 1WVRA 1D5YA 3GMEA 3UR3C 5H2FC 1JKRC 1MMNA 1P9QC 2M7AA 1F43A 2ZCWA 2BVLA 3GTQJ 2DA4A 3DFGA 2F5VA 4LK0F 1IC8A 5FLVA 2Q2EA 3ASOH 1WCMJ 2COMA 1ON1A 2WV0A 1X58A 1JJ6C 5F6FA 3BROA 2DA2A 4XRFA 1WI9A 4ITVA 3FXRA 1YIOA 4A0ZA 4EGYA 1IW7F 3HSRA 2K40A 3K4NA 2XGXA 2R7ZJ 1BI3A 1BOBA 4DW6A 1O3SA 2UZKA 1XMXA 4L9TA 2X4HA 3CESA 2WAFA 3HRTA 2QQAA 3CP8A 1ZAOA 3BZCA 4ZZDA 4ENJA 1VQ9I 5ICGA 3CCQI 1EKEA 2HOEA 2CMPA 5L3EA 4AC0A 4FTHA 3S2WA 2W48A 4MTEA 3H1CA 3RPQA 2EIJH 3TMOA 5CVRA 5LEJA 1S7EA 1BC8C 3QRFF 1MNEA 4WX9A 4F55A 4D1QA 3FK6A 4BJ6C 3CCRI 3LSKA 2LDUA 3KIOA 3OR2C 1U9OA 1RNLA 2DA1A 3K10A 1U78A 3K0LA 1HDPA 5HLGA 2VQLA 2RAEA 5KNLA 1ETYA 3SYTA 2HOSA 2F4MB 4LMYA 1KGSA 3QU6A 1FIPA 1MBFA 4BL0B 1JGSA 1PP7U 1BR1A 4KJZA 2IA1A 2H1KA 4AU7A 5B1AH 2VASA 1QZZA 4I76A 3FXQA 4NQWB 4XM3A 4I01A 2M0CA 4L9NA 5H20A 4OIPF 4OU0A 1TC3C 4M9SA 3ULQB 1S5LC 3OV8A 5TJJA 2LF8A 3GCMA 4M9ZA 1IJWC 2F6CA 1CF7A 3S93A 3G2BA 1Y0NA 2Z5UA 3G3ZA 2WY8Q 1BA5A 1IV8A 2OV7A 3BJOA 2YX4A 3ZR8X 3KPHA 5IYCJ 4CH7A 1FZPB 2IT0A 1TW2A 3NARA 1W7PA 1ZHFA 1IO2A 1B1BA 3LSMA 1ETOA 4OIQF 1ONVA 1I3AA 5LRSA 2V1UA 2ECBA 5J6XA 4BDYA 3DWLE 3OYJA 3AL0C 2DDBA 4XKWA 1X3UA 2DW4A 1MIJA 2DDAA 4HA8A 4A3GJ 3LSRA 5K7HA 2EPFA 4MQ9F 1DU6A 3BG6A 1P92A 4EJOA 3RKYA 4C2UA 5DCMB 1YG2A 3VYSB 3DEWA 1JKPC 1JUMA 1SAUA 4OAYA 1X2MA 1ZR4A 1MSEC 2M4GA 1AHDP 5CLSA 4C9YA 3FBIB 2GIVA 1YRNA 2VODA 4L5EA 1R36A 3NRVA 1X4PA 1SC7A 2EFWA 2DK5A 2Z3YA 2MBFA 2H09A 2VKDA 2FXAA 1E2XA 2L7MP 1YOVB 2VQGA 3CUQB 4NBQA 3E5XA 5E1XA 1TQIA 2VOOA 1QNTA 3CCYA 1D8KA 4BE0A 3A0HC 2D1VA 3ERED 4KMUX 1HA8A 5IT9Z 3EPZA 5CQGA 5HNFA 2KJCA 3K7AJ 2ISZA 2MG4A 3SHFA 2Z16A 2QSFX 4M73A 5E3NA 4UNOA 3Q0UA 2JSPA 2ADUA 1J2XA 2DYRH 1XGSA 1FX7A 3TP3A 3J7ZI 4Y33A 4BE2A 1L3LA 3LA2A 1HSTA 4GDFA 2WB1N 3EDPA 4Q48A 2DI3A 2Y0SN 3EYIA 4UB8C 1TWHJ 3I4PA 4M3FA 5J8CA 1F36A 2PQ8A 3QPTA 1X2NA 2LRDA 3BWGA 3CCJI 2DMUA 2HQ5A 3IUOA 1EH6A 2EV5A 4P96A 5D4SA 2ACJA 2OA4A 4FE7A 4L9JA 1MBGA 2W85A 3OYMA 4DIQA 9ANTA 3HKZN 3DQVC 4BHBA 1JKOC 1MMAA 4ZYHA 4DGWB 1KU3A 1R22A 3RSNA 3IP4B 3C7JA 3HRMA 3NEUA 3S1QJ 3PL8A 5DTDA 4NNJA 3GTPJ 2EJRA 2HVSA 1MH4A 4F7ZA 1WJCA 3CCSI 3E0JB 2JMWA 4XOTA 1QBJA 5LGNA 2DU9A 5CVIA 1DP3A 5LLQA 3E97A 2LBFB 5E3OA 4ZDLA 1HLVA 3L2QA 5FKKA 1K6OA 4A3MJ 1MBEA 2P8TA 3H5AA 3S3MA 2BY1A 4HYEA 1I50J 4XKCA 3W3CA 4B43A 2NVYJ 1XN7A 3JAMK 4KMFA 2A07F 1B8IB 2WWYA 3KCCA 2MFZA 4ZYEA 1SFUA 1X4OA 1WWXA 2QQ8A 5F08A 3ML6A 4AIHA 2XF5A 3ABTA 4ZTJA 2WV1A 4QPOA 2R7DA 4EM1A 2G7HA 3F21A 1B4AA 2CJJA 4D7MA 3HGYA 4X1EA 4R79A 1JHHA 1P7JA 2BGCA 4CA0A 3HTSB 1FBUA 4LK1F 3DEUA 1FPQA 3CMEI 4GFBA 2EIKH 4LG3A 2RKHA 1K4SA 2MLGA 2XB5A 3BQZA 2X48A 3C18A 3PUFA 4BAYA 2MC4A 1JJ8C 2JVGA 2VC1A 3J81Z 4HQEA 1OQYA 5JLXA 2BY3A 4DBQA 3ZP5A 1VQOI 5E8GA 4AIJA 1LDDA 3SDGA 1TZLA 2I8DA 4HV6A 2I5UA 3BZKA 3EUHC 4YFKF 3OYAA 3HC7A 3GTOJ 4GCVA 2QGUA 1TT5B 3JRHA 1ERDA 2BY2A 3GX4X 3WTZA 2V1NA 4KA4A 1I3QJ 2WTEA 1BN5A 1MJ9A 1S6LA 5DDGA 1W5CC 1HC8A 4BGDA 1XG1A 4L5IA 1RETA 1U5TB 5HOOA 2M4KA 2L01A 5EZGA 3SQNA 5GTIC 5D5VB 3TOBA 2V1XA 2DTRA 2JUCA 4M74A 1RKTA 5D5WB 1UHSA 1F9NA 3BOQA 3GUDA 3ZMDA 5DV5A 3QPHA 3W6KB 4IKFA 2KHMA 1SFXA 4OMYA 4A6DA 2NNNA 3DP7A 4PGGA 1VFCA 5KVRA 4R1HA 3E5UA 2VKHA 2CO5A 3BR5A 2LY2A 4WXDA 5DUKA 1FOXA 3V8KA 2KRFA 4G12A 1E3PA 2XGEA 5D5UB 4UVCA 3PM1A 1XX5A 3IV5A 3F9KA 4HAMA 2IGOA 3ELKA 3WU2C 2ZMEB 4O6JA 2NNYA 1G3SA 1LVAA 5IY5H 1YHQI 5A2QK 1MKMA 4JOMA 1NHAA 2FBKA 2H1LA 2QLZA 2JUGA 2ZMEC 1RRJA 3DKYA 4BQQA 4RB0A 2STWA 2KZVA 3IKVA 4CCLA 1AU7A 3HOXJ 3CD6I 3QP6A 4IRHA 2M2EA 1K7AA 4QWQA 5E8IA 4G7ZF 2DMPA 2PJRA 1U2WA 2PLYA 3L9FA 2YU3A 3BJAA 3I0TA 3NWSA 1T08B 4NUBA 2R5YA 3HUGA 1UJ8A 4BXUA 3WTUC 3RDIA 1GXQA 1TTYA 4E7LA 3ONQA 2VBYA 4U0YA 1G8XA 2PMHA 4ZYGA 2E36A 1QVUA 1WJBA 3KP7A 4G7HF 4UUVA 3U2RA 3DKWA 1AA7A 1Z3YA 5DCFA 1WPKA 2KISA 1J9IA 5KCMA 1K61A 2EBIA 2LVSA 5LHHA 1G6NA 2JA2A 3PNYA 4UHTA 4A3KJ 2JTVA 4ZZLA 1ZN2A 3ZQ7A 4FCYA 2CWEA 2XSJC 1FBQA 4CDGA 1F4KA 1EV7A 6PAXA 3EYYA 2CQKA 3OYCA 2M45A 4EJTA 3V4GA 3O3KA 3U1KA 5L3CA 4BHCA 2DOEA 5D8KB 1ULYA 3R61A 2Z33A 1TL8A 1Y0UA 2FU4A 3DBHB 3TDUC 3TGNA 3WODF 1U8RA 3S1MJ 3R4KA 2E1CA 2L3DA 3LQQA 2K9QA 4AVPA 4RM3A 2GQQA 2ZXHA 3QPLA 2HFHA 2D5VA 2IRFG 1S7OA 3SFZA 1QO0D 2L7ZA 3JCUC 2YU9J 4PFPA 5GADJ 5CKTA 3VODA 1XCVA 1YJWI 1FOYA 4MEXF 1O57A 1A6QA 1REPC 1O3QA 3ZOBA 3LA3A 2XRNA 4PJNA 3RZDJ 1P4AA 1ETXA 2A69F 5F04A 1OFCX 2OCEA 3CJNA 1UB9A 4IOAF 5E3LA 1R5GA 2W1OA 2VPRA 3AG1H 3PO3J 3MWMA 3LAJA 1EF4A 3JRCA 2X1EA 2M8GX 3FMSA 1VQPI 5K7ZA 4HF1A 2ZBKA 3T0YA 1X1CA 1VQNI 1XSVA 3CCVI 1RIOH 4FQGA 1ZGAA 2HKOA 3RQ4A 3HDDA 4MNUA 1YFHA 3L2RA 4A3DJ 3OIPA 2K3FA 3O2PE 5DM7F 2HDWA 4S04A 3PIOF 2UWMA 2HNHA 3HOZJ 4IHWA 3BG9A 3KZZA 2F5EA 2QM3A 3D0SA 4DZJA 3PSFA 3S8PA 4EJUA 1ITYA 1QPIA 2M8EA 1YW7A 5TRDA 3OYDA 4H0EA 1WZ2A 2EZLA 2L9SA 5M5YJ 4NQWA 3HOSA 1K4TA 3BLYA 2XPUA 4MHGA 1QHGA 1IRFA 5E1ZB 5DD4A 1QGPA 3PJRA 3DF8A 3WTXC 2HZTA 4TV7A 2LY9A 2OF7A 2Z9OA 2XVCA 2ZJQF 1DGRM 1ZQ3P 1YS7A 1Q1HA 1P4XA 2E1MB 3E3VA 5HDGA 5M3FJ 3F8NA 1FYKA 2NS7A 2W82A 2E5ZA 3VYTB 1QU3A 2W84A 1U8BA 2HTSA 2E1MC 2ECCA 1V3FA 2X6YA 5AIQA 4AIKA 2DODA 3K4MA 3HOVJ 3GO5A 3JRGA 1BR2A 1OR7A 2MC3A 3JRBA 1EJ9A 1YE9A 2Y2ZA 2M5WA 3KZYA 1XGOA 2DFFA 5D5XB 1JKQC 1C0WA 5KK1A 3ABKH 3SJMA 2L2OA 4L18B 2FBIA 3HGGA 3OS0A 1LFUP 5FB2A 2E7WA 3M7GA 1QHHD 2GA1A 1IN4A 5F0CA 1X1DA 5J1YA 1X3ZB 5LGTA 2Z2SB 1U3EM 1FWZA 5JI6A 2LY1A 2DMQA 2IGKA 2DJNA 3S2DJ 5DCMA 1GVDA 2FF4A 4GYIA 5JFRA 5FROA 2HPMA 1E3OC 5B66C 2XGDA 1X1AA 1Y1VJ 3VOEA 1TLHB 1IGNA 2VBWA 1RC9A 2LH9A 3KP5A 2ELHA 4YIIA 4QSHA 1SAXA 1BJZA 2YR2A 2OPTA 5BNGA 3MFKA 4A5MA 1DQUA 2FOWA 2GLOA 3OMYA 2FQ4A 4J00A 3CUQA 1ZR2A 1HCRA 2M9HA 1BR4A 4XIDA 4ENKA 3HSEA 1U9NA 2CFXA 4E7SA 1WKMA 4N4OB 2H8WA 2P5LC 1OCTC 4AD9A 5E1WA 4II3A 4LG0A 4RB1A 3ROUA 1G2HA 2KIUA 2DAOA 2NVQJ 5IOYA 2NVXJ 3IRRA 3KX2A 2FNAA 3DXJF 3GW2A 2K27A 1W7PD 5IP6A 1VZ0A 3U9GA 4PGHA 2B0LA 3I55I 3DTIA 3HOYJ 2DA6A 3PNVA 4JX4A 2XAFA 4E4HA 2FBHA 2K02A 2WAQN 4JX6A 4QTRA 1VI0A 2BVMA 5ED4A 3HHGA 5JVGF 1APLC 4GO1A 2RQQA 4HEA2 2BBYA 3UNGC 4N0BA 2MLKA 1N77A 4RMNA 2R7XA 1GV2A 3QQAA 4F91B 4BXFA 4XLEA 3H35A 3QP5A 1QA6A 1JUSA 2HYJA 4Y3OA 3L2WA 5IT9K 1RPWA 3GTLJ 4RB2C 3WU1B 1CQTA 1FYMA 3MAJA 3OS2A 4OIRF 2P7CB 4KISA 4YEJA 5FLXZ 1A6IA 1MD0A 2X1DA 5LBQA 1LB2A 1SFEA 2IVMA 5M3MJ 3B73A 3HTUA 1TT0A 3KZIC 1T38A 5L3BA 1BIBA 1MW7A 1Q1VA 4MFEA 3J7AO 4XR6A 3JSPA 2PJPA 2K9MA 2R7RA 3KP3A 3HIFA 2WAQA 3IWFA 4CCOA 1PUFB 2FX0A 1WJ5A 3OOPA 1XPXA 2R7UA 4G94A 3MD2A 3H5RA 2CQNA 2HGCA 2L7FP 2O5RA 3ZPLA 2PG4A 5C44J 3BR6A 1SVOA 1WJEA 2OTLI 5D4RA 1LVKA 3NAUA 3TL4X 3G1OA 4IF4A 5DS9A 4IHYA 5BPDA 3SFIA 2XV4S 2ZNZA 4B48A 2LKPA 1TW3A 2DT6A 3FXUA 1FOWA 3QOPA 3RCOA 5EGOA 5DUIA 4RS8A 3D1NI 3U1DA 3EUHA 3GEZA 1YTYA 2VBXA 2LREA 2R3SA 2W57A 3K69A 2CQXA 4XMYA 1O7FA 5H6QA 3F6OA 5F0HA 4HX4A 2A5WA 1LEBA 4V19K 4IHXA 4OWRB 1D0YA 1XS9A 3OYEA 5FKOA 3H3VK 4AUXA 3CZ6A 4IVNA 3WTTC 4UVAA 5LFAA 1J0RA 2V1DA 4DJAA 1ZG5A 2L7KA 3R0JA 2XC7A 1U5TA 2CV0A 3ZQIA 2PMZA 4HOBA 2VQHA 2D1HA 4A5NA 5IT3A 2E2HJ 3N05A 3V7CA 1AKHB 2RNJA 3J81K 2OTJI 4XSXF 2KIMA 2QYOA 5H6RA 4YIFA 1K79A 4D0PA 2XAHA 4U0VA 4KN4X 5DD8A 1VQKI 4LFUA 3ISPA 1OLTA 2KIQA 4Y15A 1O3TA 1X3WB 3TO7A 5ILUA 3FMQA 5LD2C 2ID6A 2M34A 4BBSJ 4XQFA 2JQ7A 4A0XA 2ZMEA 4XLNF 4HX7A 2E1NA 3L2CA 2Y9YA 3KYLA 3OR1C 4BU2A 3I54A 4CCNA 2KQRA 3M9AA 1B59A 2HI3A 3WE3A 1OPCA 2DXIA 3M1EA 3BPXA 4F3QA 1TQMA 4N9IA 3E6CC 3M8EA 3X2QH 1W0UA 2LR8A 1FBSA 1YW8A 5JHFA 4ZC3A 5CQEA 3OIQA 1S29A 3J7YJ 1XSDA 1R4MB 5CVJA 2FMLA 2E5NA 3L09A 4M3GA 2LG4A 1OR7C 1GVJA 1XCBA 3E6BA 4PDKA 3EUAA 2V4JC 5L3GA 2QKLB 1JUPA 1MGTA 1MMSA 3H3UA 4IQJA 3P5JA 3ABUA 2STTA 4A3IJ 1IUFA 1LQ1A 1STZA 1IXRC 5HLHA 3KE2A 3M8FA 4JK1X 2KDZA 4HF0A 2ZXJA 3VB2A 2NS0A 1XSXA 2R4GA 4UUTA 4XRSA 3KLNA 4G6TB 2ELKA 2CFOA 3I9V2 1HQCA 3FXKA 2ME0A 2ZFUA 5FGMA 3HOUJ 2E1OA 4XRMA 1BL0A 4BE1A 3K4LA 1X19A 5F64A 4C3IJ 1PUEE 4L0YB 1UHWA 3WGHA 4I2OA 3I4MJ 1QQIA 1N25A 3PIPF 3W6JB 3CUQC 5J1UA 4LG0B 1TWFJ 3FXMA 4BS9A 4AWXB 2QQ9A 3CLQA 4KIBA 3J7AY 5BMZA 1KZHA 3GVAA 1FT9A 3GZ5A 1HW2A 2JA8J 5EJCA 1PVEA 3GF2A 2ZJRF 2QSGX 2CRGA 2IA0A 1ZGJA 3RYPA 2CW8A 3CMAI 1GDTA 3D5SC 1YX5A 4IEJA 2P81A 2GIZA 2VXDA 1VQ5I 2YS9A 4KNYA 5CYVA 3GZ6A 2GA2A 2P7VB 4N9HA 4RLQA 2L02A 2WADA 2E60A 2MH2A 2TDXA 4KITB 1ZH5A 3DPUA 4D5FA 2A3SA 1ETVA 2DQLA 2IP2A 1K78A 1JXSA 4PJLA 4Q47A 4B09A 3TP0A 5E79C 2CU7A 4HF2A 1BI1A 4X0GA 2OAZA 5K5RA 3DBRB 2GAUA 5C4XJ 3MZHA 3P9IA 2L9NA 2IS2A 5B3SH 2KT0A 1D3YA 1M1EB 2A05A 4XN0A 3RKWA 3EQLF 2XAUA 1R4NB 1LKXA 3QAHA 3V8JA 4ZTFA 4NC6A 3EUKL 3OS1A 4UVBA 1A31A 1IRGA 2HQRA 3JW4A 2RGVA 2MD0A 4FHTA 3JTGA 3BTCA 5E3MA 3QOEA 4PUSA 3AAFA 2RREA 3K1PA 1DPUA 5M5XJ 2R7FA 2LKXA 1Y8RB 3OYBA 3BR1A 1N78A 2F4IA 2Q1ZB 2CYYA 5HLTA 2HYFA 3OY9A 1JT6A 4Y13A 2FOKA 1RR7A 1VNDA 2X51A 4Z6YA 4DYRA 1V5GA 1XDUA 1RR8C 4B47A 4XONA 2E35A 2E19A 3JR9A 2QCOA 3QWLA 3DU6A 3GTMJ 3GLLA 3DLLF 1W5SA 5EGOB 1WHUA 4GXOA 1EA3A 3SEZA 1BI2A 3K9TA 3Q0WA 1O7LA 4DOZA 3CDIA 2P6SA 3CC7I 4WK8F 3FISA 4LLLA 5BS6A 1LNWA 2OZUA 2W7NA 1H89C 5GAHJ 4B3AA 1QZYA 2DO7A 3ZMTA 3IRQA 2XB0X 2XPVA 3SZPA 1FP1D 1R23A 1VQ4I 4E7ZA 1OKRA 2Y31A 1Z6TA 3OYIA 4B44A 1VQ8I 4HDVA 3ABLH 4CICA 4BHPA 4IO9F 1V54H 3ECHA 1TWAJ 4E7JA 1TP4A 4JX5A 3R60A 1J59A 1BM9A 4O5VA 4WCGA 4A3CJ 3P9CA 4XNFA 3I56I 5EEHA 1R71A 5GTHC 4FASD 2K85A 3ASNH 3PQKA 1U5TC 5LGUA 3FHZA 1GLNA 3V42A 3P9KA 2RVCA 4A69C 2L9VA 4CCKA 2HVRA 2E7XA 3CJRB 1DP7P 2V9VA 2CSOA 3HRSA 3KETA 1ZARA 1TNTA 2OQGA 3BDDA 1Z77A 4BACA 2AQFA 1WRJA 3AG3H 2JPCA 4HG2A 5B1BH 2BV6A 1LEAA 2HQAA 5FLMJ 3ZMZA 1XMAA 4Z2YA 3F23A 1Z3XA 1S7AA 3KP4A 5DEQA 5ILSA 4C3JJ 2JN6A 4EEFG 1O4XA 1LJ9A 3TO9A 2OZ6A 2ZSHB 3BTIA 2Y0MA 4F52A 1ZK8A 1YX3A 2ZSIB 2HXIA 1RZ4A 3H9QA 4B3XA 5EDNA 3FWEA 1VQ6I 3RYRA 3G73A 1USTA 2DTZA 1Z6RA 4LIVA 3FXLA 2OBPA 3HRUA 1IXSB 4LIUA 2VC0A 3BG5A 5HODA 2DPUA 2BXYA 2W00A 2EQRA 1MNDA 4CHUA 1X1BA 1ZKGA 4RGXA 2EFQA 5EYRA 1QZEA 1JGGA 1ZLJA 3QPSA 4S05A 2BZTA 3LSIA 1MSFC 4I09A 4EVIA 2COBA 2LFBA 3HG9A 2VONA 4U88A 1L0OC 4PSXA 1HKQA 3MN2A 1PUFA 2P5KA 3SXYA 1UG2A 4OINF 3HSFA 1IDZA 3W2VA 2RNGA 4CZCA 2RN7A 1ZREA 3FBNB 4G8XA 2V6CA 1LFPA 5FKMA 2PMUA 1KU7A 1DGWY 3COAC 3C3WA 4WF2A 1VTNC 5DM6F 1ZRDA 2L0KA 2NOGA 3RZOJ 5HLIA 3K4JA 4U0WA 2K4BA 5KHDA 5FLXK 4EM2A 2QENA 2HDCA 4I6ZA 2HDDA 2XGCA 1H8AC 1WFXA 3I59B 2Y75A 4LJZF 4KDPA 4D5CA 2L4MA 2VIXA 4LD5A 5FFXA 3WG7H 1NG7A 1QRYA 2MD5A 5IYDJ 2BHYA 4I0BA 2JVHA 2AS5F 2KRHA 1H88C 1IN5A 2JA5J 4XK4A 5ILVA 5J4YA 4A2UA 2KP6A 4BUPA 5JR3A 3JRAA 2QVOA 2KZGA 5ICEA 4PFOA 3CDHA 4HW0A 4M6VA 4BDZA 4IXAA 1ZYRF 4F93B 1ACIA 4UY8I 2ETHA 3RQIA 2JWTA 2X9DA 4J01A 1Z67A 3VYRB 4RB3C 3LSJA 2BEOA 1T33A 2KDOA 1SVLA 4V2GA 1A04A 2XF7A 3DU5A 3H0DA 5EG0A 1AKHA 3DTKA 3QODA 4P55A 1K78B 1IF1A 1P6RA 3VPRA 2R92J 1FSHA 2K5CA 1IXCA 1ENHA 2OD5A 3DV8A 1R58A 3K1NA 1WH7A 3ZQGA 1MNMC 1ON2A 2R7VA 3L2VA 1FTTA 4RA2A 2OQRA 1BC7C 4KUMA 4FETA 4ANJA 2V9PA 3HL2A 1R1VA 2VLAA 1D8JA 2EH3A 1RI7A 3CJTB 1ZG3A 1V55H 2NXNB 4I02A 5GP9A 1FMWA 3WGIA 4BJTA 3CO6C 1T56A 2B7EA 3VEPA 1UFMA 3JRFA 3C1DA 4CYCB 3PFIA 2NOJB 1LFBA 1J7KA 2DFEA 4P9FA 4B8XA 4HPQA 1EH8A 4FISA 1B9MA 3DKXA 5HDNA 1GT0C 3FX3A 4MQVA 4LB6B 5HS8A 3JSOA 1QPMA 3KEYA 4NDLA 3DTEA 3I71A 3LNQA 4XRSG 4RLFA 4A12A 2M3AA 2LD5A 2WA0A 3V7SA 3OIOA 1HF0A 1RKWA 2VXZA 4QPQA 1ZLKA 2VOPA 1H9TA 3IHUA 2O7OA 4A3EJ 1S72I 1JE8A 1ODDA 4XLCA 3GFIA 1ORKA 2W24A 2H6BA 3ESWB 1SEUA 1TWGJ 2GOXB 3W2WA 4OIOF 1IDYA 5JLWA 1Y56A 1NG6A 2O9LA 3BCBA 3I3LA 3K4KA 3A4CA 5GAEJ 1XC5A 1QVTA 2RDPA 4AYBA 3MKYB 2QBYB 4MEYF 5F0FA 2GXGA 3TDZC 4CO8A 1WI3A 1R7JA 2KL4A 1IZ1A 1ETQA 1G3YA 3GFJA 1FSEA 4M72A 3GYHX 4FX0A 2G7UA 3S17J 4A93J 1IN6A 1TBXA 3CCUI 4BXXJ 2OCCH 3LSGA 4YFXF 4BBRJ 1IAWA 1VQLI 2F5CA 4M3EA 2BW3B 4EM0B 5ICFA 2QUFA 5K1YA 1FMVA 3LAPA 4RM2A 2KLOA 3MMYB 1NH3A 1JI8A 1IN8A 3HPHA 1VQ7I 4UV9A 2LSOA 4IHSA 1SANA 4CCJA 2LF7A
chains in the Genus database with same CATH topology
1HLVA 5FKKA 3L1PA 4FE4A 4A3MJ 1MBEA 5EZHA 2ID6A 2K9SA 1HOMA 2M34A 4BBSJ 1I50J 4UUSB 3O8GA 5IP7J 1YRNB 1RESA 2NVYJ 2Y9YA 3ZQFA 3A01B 1B8IB 2HI3A 5IYBJ 5F08A 1W0UA 2LR8A 2WV1A 5IPAA 5J3LA 3FKIJ 3IH3A 2CJJA 4D7MA 3HGYA 4X1EA 1P7JA 1P7IA 4IHVA 1MH3A 3ZQLA 2IEKA 2TCTA 4GFBA 4A3JJ 2XB5A 3BQZA 2X48A 2HOAA 3E7LA 3K2AA 1JJ8C 3O8HA 1NTCA 4DZPA 4M3GA 5JLXA 4B1RA 1IV6A 2JA7J 3M4OJ 3SDGA 1FJLA 1JUPA 3HB9A 1GV5A 4D7NA 3GTOJ 2R5ZB 2XRLA 1Z0XA 2EZIA 4A3IJ 1IUFA 3JRHA 2DA5A 4AYBN 1I3QJ 2KDZA 1XG1A 1RETA 2GBYA 3OSFA 5EZGA 4UUTA 3B6AA 4XRSA 2E2JJ 1IRZA 3HEFA 2ELKA 1RKTA 1DU0A 1UHSA 3DCFA 2ME0A 2PMZN 3HOUJ 2E1OA 2NS8A 4S0HB 4XRMA 1BL0A 4C3IJ 5F1JA 3F0CA 5FJ8J 3I4MJ 1VFCA 2ZB9A 3BTLA 3BR5A 3LSPA 2LP0A 5J1UA 4G12A 2XGEA 1TWFJ 3PM1A 3IV5A 1R9TJ 1FEXA 1NK2P 2JA8J 5EF6A 2CRGA 2GM4A 2Y9ZA 3A03A 1GDTA 3CQZJ 4IEJA 1OCPA 2P81A 3HOXJ 1AU7A 2M2EA 2YS9A 2XPWA 2DMPA 3JREA 5IOZA 3B6CA 4HNVA 2R5YA 3MVPA 4D5FA 1FIAA 2EZHA 5F27A 3S14J 2EZKA 1ETVA 3TW7A 2JA6J 2DMTA 4MFDA 3TP0A 2CU7A 2FD5A 4C3HJ 1B72A 2XSDC 5EG0B 5C4XJ 2JJ7A 4C2MJ 4J19A 1QVUA 1VF9A 2KT0A 4Y52J 3MKLA 4W1UA 1WPKA 3FIWA 3GBGA 1K61A 2EBIA 3BTCA 2LK2A 5E3MA 1SFOJ 2LVSA 2CQQA 4A3KJ 3UKGA 5M5XJ 3BR2A 4FCYA 2LKXA 2VKEA 3BR1A 5EEAA 3PO2J 1JT6A 1RR7A 4MIMA 1VNDA 1UMQA 4MO7A 2AO9A 4DYRA 1Y1WJ 3I4NJ 3S1MJ 5GPCA 1FTZA 2H8RA 2E19A 3GTKJ 3JR9A 2QCOA 1ETWA 2K9QA 1WH5A 1LE8B 3GTMJ 3QPLA 1MBKA 2D5VA 2MSYA 2L9RA 3BT9A 2L7ZA 2TRTA 2YU9J 3WHBA 4QIWN 1BW6A 5EGOB 3S16J 1POGA 3ZOBA 3RZDJ 1ETXA 5F04A 1OFCX 3Q0WA 4BKXA 5IP9J 2IAIA 5E3LA 3FISA 2YUSA 2DA3A 2VI6A 2VPRA 3A02A 3PO3J 5FKLA 4M3DA 3TW6A 1EF4A 3JRCA 2X6OA 1H89C 4B3AA 2M8GX 1MBHA 5K7ZA 2XB0X 2XPVA 5C3EJ 2N8GA 3BR3A 2Y31A 1ZGWA 3HDDA 4MLOA 3BTJA 3RKQA 4A3DJ 2MW8A 2R5YB 1TWAJ 3WHCA 4IHWA 3HOZJ 3BG9A 4JX5A 1OJLA 4DZJA 1ITYA 2DA7A 4A3CJ 3GTJJ 1B72B 1QPIA 4RBOA 3JRIA 4A69C 3HBLA 2HXOA 2EZLA 5K7FA 5M5YJ 2XPUA 3HM5A 4UUSA 2LY9A 1Z77A 2CUFA 3M3YJ 2OF7A 4BY1J 1ZTRA 1ZQ3P 3OOUA 4DYCA 2R0QC 5FLMJ 1B8IA 3S2HJ 1A5JA 1GUUA 5M3FJ 2K9NA 1D5YA 2NS7A 1JT0A 1JKRC 4C3JJ 2JN6A 4EEFG 1U8BA 1O4XA 1F43A 3GTQJ 2DA4A 3BTIA 2R93J 1BW5A 1ZK8A 2ECCA 5J1RA 1IC8A 5FLVA 4DYQA 3GTGJ 2HXIA 4RDUA 1WCMJ 3HOVJ 5EDNA 4JP0A 3JRGA 3JRBA 1X58A 1JJ6C 2DA2A 2Y2ZA 5M5WJ 2DTZA 4A3LJ 5C4JJ 1JKQC 3SJMA 3BG5A 5HODA 2K40A 3HGGA 2EQRA 3IH2A 2R7ZJ 2Y30A 1LFUP 1ZKGA 4DW6A 5EYRA 5F0CA 1JGGA 5J1YA 4XICA 3QPSA 2E2IJ 1W0TA 1HDDC 2R5ZA 3W6VA 2DMQA 1MSFC 2DJNA 3S2DJ 1GVDA 4AC0A 4FTHA 2W48A 3TEDA 2COBA 1E3OC 2XGDA 1S7EA 2LFBA 1Y1VJ 1IGNA 3FK6A 4QSHA 3MN2A 1PUFA 3CMYA 1BJZA 1U9OA 1UG2A 2OPTA 1IDZA 4CYCA 5BNGA 2DA1A 1U78A 2GLOA 1HDPA 2FQ4A 5FKMA 2RAEA 2DN0A 1ETYA 3Q3SA 1ZR2A 1HCRA 2M9HA 2HOSA 5GPAA 4XIDA 1FIPA 1U9NA 1OCTC 1MBFA 2L0KA 2NOGA 3RZOJ 2H1KA 1G2HA 2NVQJ 2ID3A 4I76A 5IOYA 2NVXJ 2M0CA 4I6ZA 1JTYA 3JRDA 2HDDA 1K83J 2XGCA 1H8AC 5IP6A 1TC3C 4D5CA 2AHQA 5FKNA 3HOYJ 2DA6A 1QRYA 4JX4A 4ABZA 5IYDJ 2HOTA 2WAQN 3C2BA 4JYKA 4JX6A 1VI0A 4QTRA 1IJWC 1APLC 2JK3A 1H88C 1BA5A 2JA5J 4X6AJ 4XK4A 5IYCJ 1GV2A 2IBDA 3QQAA 3JRAA 3NARA 3HOWJ 4M6VA 1ETKA 1ETOA 1JUSA 2HYJA 4W97A 3BG3A 2ECBA 2JWTA 3RQIA 2X9DA 1RPWA 3GTLJ 1CQTA 2ME6A 3LSJA 1T33A 4V2GA 3OSGA 5EG0A 1AKHA 4A3GJ 3LSRA 5K7HA 4V2FA 1A6IA 3VPRA 2R92J 3ZQCA 1DU6A 1ENHA 1I6HJ 2CUEA 1WH7A 3ZQGA 5M3MJ 1MNMC 2LLKA 2O8KA 1FTTA 3DEWA 1Q1VA 4MFEA 1JKPC 1JUMA 1ZR4A 1X2MA 1MSEC 1AHDP 3FK7A 2EH3A 2VUMJ 2LTPA 5GP9A 3H0GJ 1YRNA 2QF7A 4L5EA 1PUFB 2FX0A 1T56A 3JRFA 3A01A 4CYCB 4BY7J 1LFBA 4A3FJ 2L7FP 5C44J 2G0EA 3BR6A 2L7MP 4FISA 4B4CA 1GT0C 2FJ1A 3IH4A 3NAUA 4IHYA 1MBJA 3G1OA 5DS9A 3S1NJ 4NDLA 3CCYA 4M3BA 3LNQA 4XRSG 3SFIA 3K7AJ 2LD5A 1LE8A 1HF0A 3OIOA 2MG4A 1RKWA 2VKVA 5E3NA 2O7OA 3Q0UA 4Y7NJ 4A3EJ 3LOCA 3BR0A 5EGOA 3TP3A 3D1NI 1ORKA 4LOCA 1TWGJ 3G1MA 2WB1N 1WGXA 1NK3P 3Q0VA 2CQXA 2Y0SN 1IDYA 5JLWA 5F0HA 2O9LA 1TWHJ 3ZQHA 4M3FA 4IHXA 1XC5A 1QVTA 1XS9A 5F0FA 5FKOA 3H3VK 1F36A 1X2NA 4AUXA 1WI3A 3BQYA 2B63J 2NVTJ 2DMUA 2HQ5A 1ETQA 2I10A 3S1RJ 4A3BJ 3G1LA 4FE7A 3S17J 4A93J 1IG7A 1MBGA 4BXXJ 3ZQIA 3LSGA 4BBRJ 9ANTA 3HKZN 1TWCJ 1JKOC 3CDLA 4M3EA 3S15J 2DMNA 1JTXA 2E2HJ 2MGQA 3S1QJ 5DTDA 1AKHB 3GTPJ 1MH4A 2JMWA 1SANA 5E3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLV A;  5FKK A;  3L1P A;  4FE4 A;  4A3M J;  1MBE A;  5EZH A;  2ID6 A;  2K9S A;  1HOM A;  2M34 A;  4BBS J;  1I50 J;  4UUS B;  3O8G A;  5IP7 J;  1YRN B;  1RES A;  2NVY J;  2Y9Y A;  3ZQF A;  3A01 B;  1B8I B;  2HI3 A;  5IYB J;  5F08 A;  1W0U A;  2LR8 A;  2WV1 A;  5IPA A;  5J3L A;  3FKI J;  3IH3 A;  2CJJ A;  4D7M A;  3HGY A;  4X1E A;  1P7J A;  1P7I A;  4IHV A;  1MH3 A;  3ZQL A;  2IEK A;  2TCT A;  4GFB A;  4A3J J;  2XB5 A;  3BQZ A;  2X48 A;  2HOA A;  3E7L A;  3K2A A;  1JJ8 C;  3O8H A;  1NTC A;  4DZP A;  4M3G A;  5JLX A;  4B1R A;  1IV6 A;  2JA7 J;  3M4O J;  3SDG A;  1FJL A;  1JUP A;  3HB9 A;  1GV5 A;  4D7N A;  3GTO J;  2R5Z B;  2XRL A;  1Z0X A;  2EZI A;  4A3I J;  1IUF A;  3JRH A;  2DA5 A;  4AYB N;  1I3Q J;  2KDZ A;  1XG1 A;  1RET A;  2GBY A;  3OSF A;  5EZG A;  4UUT A;  3B6A A;  4XRS A;  2E2J J;  1IRZ A;  3HEF A;  2ELK A;  1RKT A;  1DU0 A;  1UHS A;  3DCF A;  2ME0 A;  2PMZ N;  3HOU J;  2E1O A;  2NS8 A;  4S0H B;  4XRM A;  1BL0 A;  4C3I J;  5F1J A;  3F0C A;  5FJ8 J;  3I4M J;  1VFC A;  2ZB9 A;  3BTL A;  3BR5 A;  3LSP A;  2LP0 A;  5J1U A;  4G12 A;  2XGE A;  1TWF J;  3PM1 A;  3IV5 A;  1R9T J;  1FEX A;  1NK2 P;  2JA8 J;  5EF6 A;  2CRG A;  2GM4 A;  2Y9Z A;  3A03 A;  1GDT A;  3CQZ J;  4IEJ A;  1OCP A;  2P81 A;  3HOX J;  1AU7 A;  2M2E A;  2YS9 A;  2XPW A;  2DMP A;  3JRE A;  5IOZ A;  3B6C A;  4HNV A;  2R5Y A;  3MVP A;  4D5F A;  1FIA A;  2EZH A;  5F27 A;  3S14 J;  2EZK A;  1ETV A;  3TW7 A;  2JA6 J;  2DMT A;  4MFD A;  3TP0 A;  2CU7 A;  2FD5 A;  4C3H J;  1B72 A;  2XSD C;  5EG0 B;  5C4X J;  2JJ7 A;  4C2M J;  4J19 A;  1QVU A;  1VF9 A;  2KT0 A;  4Y52 J;  3MKL A;  4W1U A;  1WPK A;  3FIW A;  3GBG A;  1K61 A;  2EBI A;  3BTC A;  2LK2 A;  5E3M A;  1SFO J;  2LVS A;  2CQQ A;  4A3K J;  3UKG A;  5M5X J;  3BR2 A;  4FCY A;  2LKX A;  2VKE A;  3BR1 A;  5EEA A;  3PO2 J;  1JT6 A;  1RR7 A;  4MIM A;  1VND A;  1UMQ A;  4MO7 A;  2AO9 A;  4DYR A;  1Y1W J;  3I4N J;  3S1M J;  5GPC A;  1FTZ A;  2H8R A;  2E19 A;  3GTK J;  3JR9 A;  2QCO A;  1ETW A;  2K9Q A;  1WH5 A;  1LE8 B;  3GTM J;  3QPL A;  1MBK A;  2D5V A;  2MSY A;  2L9R A;  3BT9 A;  2L7Z A;  2TRT A;  2YU9 J;  3WHB A;  4QIW N;  1BW6 A;  5EGO B;  3S16 J;  1POG A;  3ZOB A;  3RZD J;  1ETX A;  5F04 A;  1OFC X;  3Q0W A;  4BKX A;  5IP9 J;  2IAI A;  5E3L A;  3FIS A;  2YUS A;  2DA3 A;  2VI6 A;  2VPR A;  3A02 A;  3PO3 J;  5FKL A;  4M3D A;  3TW6 A;  1EF4 A;  3JRC A;  2X6O A;  1H89 C;  4B3A A;  2M8G X;  1MBH A;  5K7Z A;  2XB0 X;  2XPV A;  5C3E J;  2N8G A;  3BR3 A;  2Y31 A;  1ZGW A;  3HDD A;  4MLO A;  3BTJ A;  3RKQ A;  4A3D J;  2MW8 A;  2R5Y B;  1TWA J;  3WHC A;  4IHW A;  3HOZ J;  3BG9 A;  4JX5 A;  1OJL A;  4DZJ A;  1ITY A;  2DA7 A;  4A3C J;  3GTJ J;  1B72 B;  1QPI A;  4RBO A;  3JRI A;  4A69 C;  3HBL A;  2HXO A;  2EZL A;  5K7F A;  5M5Y J;  2XPU A;  3HM5 A;  4UUS A;  2LY9 A;  1Z77 A;  2CUF A;  3M3Y J;  2OF7 A;  4BY1 J;  1ZTR A;  1ZQ3 P;  3OOU A;  4DYC A;  2R0Q C;  5FLM J;  1B8I A;  3S2H J;  1A5J A;  1GUU A;  5M3F J;  2K9N A;  1D5Y A;  2NS7 A;  1JT0 A;  1JKR C;  4C3J J;  2JN6 A;  4EEF G;  1U8B A;  1O4X A;  1F43 A;  3GTQ J;  2DA4 A;  3BTI A;  2R93 J;  1BW5 A;  1ZK8 A;  2ECC A;  5J1R A;  1IC8 A;  5FLV A;  4DYQ A;  3GTG J;  2HXI A;  4RDU A;  1WCM J;  3HOV J;  5EDN A;  4JP0 A;  3JRG A;  3JRB A;  1X58 A;  1JJ6 C;  2DA2 A;  2Y2Z A;  5M5W J;  2DTZ A;  4A3L J;  5C4J J;  1JKQ C;  3SJM A;  3BG5 A;  5HOD A;  2K40 A;  3HGG A;  2EQR A;  3IH2 A;  2R7Z J;  2Y30 A;  1LFU P;  1ZKG A;  4DW6 A;  5EYR A;  5F0C A;  1JGG A;  5J1Y A;  4XIC A;  3QPS A;  2E2I J;  1W0T A;  1HDD C;  2R5Z A;  3W6V A;  2DMQ A;  1MSF C;  2DJN A;  3S2D J;  1GVD A;  4AC0 A;  4FTH A;  2W48 A;  3TED A;  2COB A;  1E3O C;  2XGD A;  1S7E A;  2LFB A;  1Y1V J;  1IGN A;  3FK6 A;  4QSH A;  3MN2 A;  1PUF A;  3CMY A;  1BJZ A;  1U9O A;  1UG2 A;  2OPT A;  1IDZ A;  4CYC A;  5BNG A;  2DA1 A;  1U78 A;  2GLO A;  1HDP A;  2FQ4 A;  5FKM A;  2RAE A;  2DN0 A;  1ETY A;  3Q3S A;  1ZR2 A;  1HCR A;  2M9H A;  2HOS A;  5GPA A;  4XID A;  1FIP A;  1U9N A;  1OCT C;  1MBF A;  2L0K A;  2NOG A;  3RZO J;  2H1K A;  1G2H A;  2NVQ J;  2ID3 A;  4I76 A;  5IOY A;  2NVX J;  2M0C A;  4I6Z A;  1JTY A;  3JRD A;  2HDD A;  1K83 J;  2XGC A;  1H8A C;  5IP6 A;  1TC3 C;  4D5C A;  2AHQ A;  5FKN A;  3HOY J;  2DA6 A;  1QRY A;  4JX4 A;  4ABZ A;  5IYD J;  2HOT A;  2WAQ N;  3C2B A;  4JYK A;  4JX6 A;  1VI0 A;  4QTR A;  1IJW C;  1APL C;  2JK3 A;  1H88 C;  1BA5 A;  2JA5 J;  4X6A J;  4XK4 A;  5IYC J;  1GV2 A;  2IBD A;  3QQA A;  3JRA A;  3NAR A;  3HOW J;  4M6V A;  1ETK A;  1ETO A;  1JUS A;  2HYJ A;  4W97 A;  3BG3 A;  2ECB A;  2JWT A;  3RQI A;  2X9D A;  1RPW A;  3GTL J;  1CQT A;  2ME6 A;  3LSJ A;  1T33 A;  4V2G A;  3OSG A;  5EG0 A;  1AKH A;  4A3G J;  3LSR A;  5K7H A;  4V2F A;  1A6I A;  3VPR A;  2R92 J;  3ZQC A;  1DU6 A;  1ENH A;  1I6H J;  2CUE A;  1WH7 A;  3ZQG A;  5M3M J;  1MNM C;  2LLK A;  2O8K A;  1FTT A;  3DEW A;  1Q1V A;  4MFE A;  1JKP C;  1JUM A;  1ZR4 A;  1X2M A;  1MSE C;  1AHD P;  3FK7 A;  2EH3 A;  2VUM J;  2LTP A;  5GP9 A;  3H0G J;  1YRN A;  2QF7 A;  4L5E A;  1PUF B;  2FX0 A;  1T56 A;  3JRF A;  3A01 A;  4CYC B;  4BY7 J;  1LFB A;  4A3F J;  2L7F P;  5C44 J;  2G0E A;  3BR6 A;  2L7M P;  4FIS A;  4B4C A;  1GT0 C;  2FJ1 A;  3IH4 A;  3NAU A;  4IHY A;  1MBJ A;  3G1O A;  5DS9 A;  3S1N J;  4NDL A;  3CCY A;  4M3B A;  3LNQ A;  4XRS G;  3SFI A;  3K7A J;  2LD5 A;  1LE8 A;  1HF0 A;  3OIO A;  2MG4 A;  1RKW A;  2VKV A;  5E3N A;  2O7O A;  3Q0U A;  4Y7N J;  4A3E J;  3LOC A;  3BR0 A;  5EGO A;  3TP3 A;  3D1N I;  1ORK A;  4LOC A;  1TWG J;  3G1M A;  2WB1 N;  1WGX A;  1NK3 P;  3Q0V A;  2CQX A;  2Y0S N;  1IDY A;  5JLW A;  5F0H A;  2O9L A;  1TWH J;  3ZQH A;  4M3F A;  4IHX A;  1XC5 A;  1QVT A;  1XS9 A;  5F0F A;  5FKO A;  3H3V K;  1F36 A;  1X2N A;  4AUX A;  1WI3 A;  3BQY A;  2B63 J;  2NVT J;  2DMU A;  2HQ5 A;  1ETQ A;  2I10 A;  3S1R J;  4A3B J;  3G1L A;  4FE7 A;  3S17 J;  4A93 J;  1IG7 A;  1MBG A;  4BXX J;  3ZQI A;  3LSG A;  4BBR J;  9ANT A;  3HKZ N;  1TWC J;  1JKO C;  3CDL A;  4M3E A;  3S15 J;  2DMN A;  1JTX A;  2E2H J;  2MGQ A;  3S1Q J;  5DTD A;  1AKH B;  3GTP J;  1MH4 A;  2JMW A;  1SAN A;  5E3O A; 
#chains in the Genus database with same CATH topology
 3CTA A;  5FO5 A;  3LA7 A;  1H9G A;  3E5Q A;  3FZV A;  4XLA A;  4ENN A;  1K6Y A;  1T39 A;  5EZH A;  4M9X A;  4KT6 A;  1G3T A;  3O8G A;  5IP7 J;  2XRO A;  3E6D A;  3BCA A;  3CC2 I;  1FY7 A;  2EV6 A;  3CO7 C;  1FYL A;  2Q8K A;  3A01 B;  4EMS A;  3I5U A;  4L9V A;  2VBZ A;  2FEZ A;  5IYB J;  4M6X A;  3AKZ A;  4HNU A;  1R5H A;  4E6K G;  2KIF A;  1WJD A;  5FD5 A;  1OYY A;  5IPA A;  3FKI J;  2XIG A;  3IH3 A;  3U21 A;  3LSH A;  2DT7 B;  2LYC A;  2Z1D A;  3QYF A;  3K2Z A;  3T1B A;  2CQ7 A;  1R5I D;  4G7O F;  3ZQL A;  2TCT A;  2QWW A;  1WQ2 A;  4R8H A;  3WGG A;  2DYS H;  2DLL A;  4NHJ A;  4RAY A;  2CUJ A;  1YO5 C;  4H4K C;  1T95 A;  5K5Q A;  2HOA A;  3K2A A;  1O3R A;  3M07 A;  3CUO A;  2GXA A;  3D5R C;  3DBL B;  2JA7 J;  4II2 A;  1A35 A;  1FJL A;  4NC7 A;  3T8T A;  1YIT I;  4GGG A;  2H6C A;  2IGN A;  1USS A;  4AID A;  4WWC A;  1GV5 A;  3SEQ A;  1ZRC A;  2HKX A;  1Z0X A;  2EZI A;  2IGM A;  5L3D A;  1RUO A;  2DA5 A;  3CMM A;  1GXP A;  4PK4 A;  4EAT A;  4A0Y A;  5K5O A;  4UXN A;  1ZG1 A;  1RUN A;  3OSF A;  2PX9 A;  2OC6 A;  3B6A A;  2VT2 A;  3HEF A;  3F8F A;  1XD7 A;  3DCF A;  2PMZ N;  1HKS A;  3B02 A;  1W36 C;  1KQ9 A;  5F1J A;  3FMR A;  5KAI C;  5FJ8 J;  2NYX A;  2ZB9 A;  3WTV C;  2ZXI A;  3BTL A;  2UXN A;  3PUB A;  3LSP A;  2K86 A;  2ZFW A;  3FKJ A;  2ELJ A;  3CLO A;  2DT5 A;  4RAG A;  2VJJ A;  4E7I A;  3Q9V A;  1BOA A;  1YW9 A;  2IW5 A;  3ERM A;  1DDN A;  1FLI A;  1BJA A;  3RKX A;  4CXF A;  4E7H A;  1NK2 P;  2J5O A;  4HLY A;  3K1M A;  5EF6 A;  1Z1D A;  2A68 F;  1E3H A;  2XKO A;  2Y9Z A;  2VPL A;  4ESF A;  1MJA A;  3A03 A;  4XLH A;  1G4D A;  1R1T A;  2MYS A;  3AFH A;  3CQZ J;  3V7R A;  1XB4 A;  1W5T A;  2XPW A;  2A6E F;  1BBY A;  3K4B A;  3B6C A;  2HZD A;  3M1C A;  1SFK A;  4HNV A;  4P5O A;  2F5D A;  1YJ9 I;  3S14 J;  1HKT A;  2CGP A;  3VDX A;  3TW7 A;  2UXX A;  2KFD A;  2DMT A;  2FD5 A;  4C3H J;  2BY0 A;  2XAS A;  5EG0 B;  5BOX A;  3MQ0 A;  4RGR A;  4PSW A;  4F92 B;  3L2U A;  4EJV A;  1TNS A;  1W1W E;  4J19 A;  4E70 A;  3PSI A;  5BPI A;  1KU2 A;  4EJW A;  2QEX I;  2CW7 A;  2V26 A;  2IS4 A;  4W1U A;  4HRI A;  2O0Y A;  3GBG A;  3JTH A;  4D9J A;  1JHF A;  3ZCO A;  2MH9 A;  4C30 A;  2LK2 A;  1SFO J;  2OJE D;  2CQQ A;  2F5F A;  3M8J A;  2CUZ A;  3UKG A;  3BR2 A;  3MZ8 A;  3GWZ A;  3GFL A;  1WJA A;  2Z99 A;  2A5Y B;  3PO2 J;  5J4V A;  3LQR A;  4CYD A;  4O3M A;  4PJM A;  2W4S A;  2HQN A;  4MIM A;  2R7Q A;  3CCM I;  1XTA A;  3OL4 A;  1FP2 A;  1UMQ A;  2AO9 A;  2HS5 A;  4XOP A;  1Y1W J;  2DPD A;  1KON A;  4AM3 A;  2ZXW H;  1T8I A;  5GPC A;  3H5N A;  2H8R A;  5CVU A;  1T0F A;  2EK5 A;  1WH5 A;  2QZ8 A;  1BIA A;  1MBK A;  3FDY A;  3BT9 A;  2WC2 A;  2G9W A;  2TRT A;  2P0W A;  1HSJ A;  5ERI A;  2L4A A;  3CF2 A;  3F8C A;  4L5J A;  3ZMU A;  3BJ6 A;  3N97 A;  3HPG A;  2ZC2 A;  1DPR A;  2LOO A;  3ECO A;  4ON0 A;  2RV8 A;  5IP9 J;  2YUS A;  3ZN0 A;  2ICW G;  1KQ8 A;  1H0M A;  3TW6 A;  2X6O A;  3AL0 B;  4PCQ A;  2CH0 A;  1FNN A;  3J80 Z;  2XUB A;  1OIS A;  1U6G A;  2X6X A;  2FE3 A;  1ZGW A;  3F3X A;  4EGZ A;  3MKZ A;  3BTJ A;  1V4R A;  1IUY A;  4DBR A;  2MW8 A;  2YX7 A;  3WHC A;  3P7N A;  4E7K A;  1OJL A;  2DA7 A;  2V7F A;  3GTJ J;  1Z21 A;  2L54 A;  4LLN A;  1B72 B;  1T98 A;  2O61 A;  3LL7 A;  3BZ6 A;  3REO A;  4IQ4 A;  3HBL A;  1I27 A;  2HXO A;  3KP6 A;  3LMM A;  2IS1 A;  3TQN A;  2LMD A;  5LEK A;  3FF5 A;  1SMT A;  3HM5 A;  3O6B B;  2VJ5 A;  1Z7L A;  2KMU A;  3I59 A;  4UUS A;  2KPM A;  2CUF A;  4BY1 J;  4BQA A;  1ZTR A;  5HVQ C;  1KU9 A;  3VYU B;  4DYC A;  2BXZ A;  2R0Q C;  3S2H J;  1A5J A;  3KYC B;  1GUU A;  2QQB A;  4XKB A;  2BE5 F;  1XGN A;  2EIM H;  2K9N A;  3CJQ B;  5B5E C;  2XKP A;  1JT0 A;  2CV2 A;  1MZB A;  2NVU B;  3GLX A;  3ABM H;  4BEH B;  1U0J A;  3LFU A;  2EWN A;  2GWR A;  2M87 A;  3Q9S A;  2R93 J;  1BW5 A;  2EA2 A;  3T5X A;  5J1R A;  1XMK A;  4DYQ A;  3GTG J;  4RDU A;  5FRN A;  5F1R A;  4JP0 A;  3A1Y A;  5J8F A;  3OYF A;  3RPU A;  5M5W J;  2H94 A;  3LST A;  3RTR A;  4A3L J;  5C4J J;  4C2T A;  3OYG A;  4CCM A;  2P6T A;  3QYB A;  4IL6 C;  3IH2 A;  2MAB A;  2Y30 A;  5TGT A;  1W36 D;  3F8M A;  3OYL A;  4KIF A;  2IA2 A;  4OOI A;  4XIC A;  2RC4 A;  2E2I J;  1W0T A;  3IWZ A;  5BQT A;  5LHG A;  1HDD C;  2R5Z A;  4KN7 X;  2EB7 A;  1YQA A;  3W6V A;  2ZO4 A;  3MEX A;  4HQM A;  2CW0 F;  5DYM A;  2FQ3 A;  1I5Z A;  3FM3 A;  3S32 A;  5EEG A;  3AG4 H;  3TED A;  3IAS 2;  3S3O A;  1CGP A;  2DOA A;  4CGZ A;  3G6E I;  2K3P A;  4JBA A;  4MGR A;  3OYN A;  2K9L A;  4IJA A;  2AXL A;  3CMY A;  2EV0 A;  4GRI A;  4CYC A;  2VE8 A;  2HWV A;  2C6Y A;  2DCE A;  1AWC A;  4G9Y A;  4GYG A;  2DN0 A;  1SD7 A;  3Q3S A;  4Q4Z F;  4M6Y A;  5GPA A;  3FXO A;  4ESB A;  4LGW A;  3L00 A;  3KYD B;  2YSR A;  3CC4 I;  2X85 A;  4EQQ A;  2YPR A;  2X1C A;  1S9H A;  2ID3 A;  2LC2 A;  5E18 F;  2EIN H;  2WB1 A;  1JTY A;  3JRD A;  4G6D A;  1K83 J;  2Y0S A;  2BYV E;  5E20 A;  5GAG J;  3KEO A;  2AHQ A;  3EET A;  5FKN A;  2UV1 A;  2F2E A;  3WTS C;  4XLP F;  4ABZ A;  2UUZ A;  3IL2 A;  2HOT A;  3C2B A;  1D1A A;  4JYK A;  1HBX G;  3VSK A;  4ESJ A;  1F1Z A;  1J5Y A;  2P5V A;  3F6V A;  3IAM 2;  2VL8 A;  4L0Z B;  2QBY A;  2JK3 A;  1G3W A;  5TIS C;  1MMD A;  1E17 A;  4X6A J;  3A2K A;  2FRH A;  4XLF A;  2PFB A;  2XHK A;  2IBD A;  3E1S A;  2Q2E B;  3HKZ A;  3HOW J;  1OCO H;  4EV0 A;  1ETK A;  3NWT A;  4RGS A;  4W97 A;  3T8R A;  3BG3 A;  1KYZ A;  3WG9 A;  1Z7U A;  5D6E A;  2BW3 A;  1SD5 A;  3F8B A;  1V5F A;  2ME6 A;  4HSR A;  4BQN A;  2CV1 A;  3OSG A;  2R7O A;  4U7D A;  1MMG A;  2VQC A;  4MTD A;  2A61 A;  2DFI A;  3MCZ A;  4V2F A;  2V79 A;  3ZQC A;  4I99 C;  2HEO A;  2EFP A;  2IXS A;  1I6H J;  2CUE A;  3ZMV A;  1MDM A;  1V5E A;  2ZKZ A;  2M0M A;  2VB6 A;  2LLK A;  3NQO A;  2O8K A;  2ZJ2 A;  4M71 A;  3F72 A;  3SZT A;  5JHU A;  3E6M A;  3FHN A;  5FRM A;  3FK7 A;  2VUM J;  2LTP A;  2R7S A;  4RGU A;  3H0G J;  1I1S A;  2QF7 A;  2IPQ X;  2PBI A;  5E17 F;  1S3J A;  4XL9 A;  2R7T A;  3A01 A;  4IPA A;  2JRT A;  4BY7 J;  4A3F J;  2G0E A;  3K70 C;  2PEX A;  1PJR A;  4B4C A;  1OCC H;  2FJ1 A;  3IH4 A;  1MBJ A;  1IN7 A;  3WU0 A;  5CPR B;  5HDK A;  3S1N J;  4BJ5 C;  5KAF C;  4M3B A;  3BG7 A;  4XKV A;  3ZQQ A;  1W4M A;  1D0X A;  1P2F A;  1E0E A;  1LE8 A;  1I1G A;  4KT5 C;  4NB5 A;  2LKS A;  2VKV A;  4IOC F;  3OWT A;  4Y7N J;  3RIR A;  3LOC A;  3CP2 A;  3BR0 A;  4YG2 F;  3BPV A;  2X0L A;  4LOC A;  4XN3 A;  3A0B C;  5D8L B;  4G6Q A;  3G1M A;  1NK3 P;  1WGX A;  1Y8Q B;  3Q0V A;  1Z9C A;  2VN2 A;  3HZJ A;  1T0F C;  3PNT A;  4WXH A;  4FX4 A;  4FT8 A;  3ZQH A;  1CF7 B;  2PI0 A;  2CG4 A;  3H36 A;  4RAZ A;  3L7W A;  2M7B A;  4N4N B;  3C2H A;  2J5P A;  2ESN A;  3BQY A;  2B63 J;  4QLC U;  2NVT J;  1Y6I A;  2E71 A;  2I10 A;  2XAG A;  3RI4 A;  3S1R J;  4A3B J;  2GOM A;  3G1L A;  2DOF A;  1W7P B;  1FOK A;  1IG7 A;  1FC3 A;  1PDN C;  4DNC A;  3KP2 A;  1TWC J;  3Q5F A;  2M1B A;  3CDL A;  1UAA A;  1F5T A;  3S15 J;  2FSW A;  2DMN A;  1JTX A;  1BI0 A;  2O8X A;  3H9G A;  2FNP A;  2MGQ A;  3HXL A;  3ZN1 A;  1IRX A;  3OL3 A;  1EH7 A;  3H92 A;  2O3F A;  3VFZ A;  1YLF A;  4BYY A;  1LDK B;  3CF5 F;  2R7W A;  2DBB A;  2XDV A;  4XSZ F;  1I6X A;  5HS9 A;  4LB5 A;  4HV5 A;  4A6E A;  4PZJ A;  1OYW A;  2DFH A;  5HS7 A;  3L1P A;  2HU9 A;  1P4W A;  4FE4 A;  2V9K A;  5AON A;  1R00 A;  1UHM A;  4ZH4 F;  4KFC A;  2HVQ A;  4ENM A;  2K9S A;  1HOM A;  2OU2 A;  3DPL C;  4UUS B;  4P9U A;  1YRN B;  1ZRF A;  1RES A;  3SZG A;  4Q5S F;  3ZQF A;  4Y17 A;  1D1C A;  3SDB A;  1R6R A;  2H27 A;  4AVZ A;  4HLX A;  2ZJP F;  1R1U A;  2F48 A;  3F22 A;  1ZEL A;  2B9S A;  2EIL H;  3GFM A;  2QA4 I;  2VT3 A;  4OMZ A;  5J3L A;  1KYW A;  4ETS A;  1X1P A;  1P7I A;  4IHV A;  1MH3 A;  2IEK A;  3TOA A;  4XOR A;  2HPI A;  4A3J J;  2ISY A;  1SD6 A;  2JRM A;  3E7L A;  4IRG A;  4HNT A;  3R6S A;  2HYG D;  3O8H A;  3BY6 A;  1NTC A;  4DZP A;  4RAF A;  4B1R A;  4BQO A;  5J47 A;  1IV6 A;  3M4O J;  5HNH A;  1I39 A;  4LLG F;  1PP8 F;  2WY7 Q;  2K7L A;  1OMI A;  1S8N A;  2Y69 H;  3D5L A;  3HB9 A;  4D7N A;  2R5Z B;  2XRL A;  5CJ9 A;  3K6G A;  3S3N A;  1DUX C;  2L5Q A;  4HBL A;  4YRV A;  4AYB N;  1OCZ H;  2ESH A;  3W2A A;  2O03 A;  3DLA A;  3JAM Z;  3OYK A;  4U87 A;  5LHI A;  2GBY A;  1HXD A;  2Y48 A;  4CSW A;  2E2J J;  1IRZ A;  2V6E A;  1SMY F;  1XDS A;  2BHZ A;  2HTJ A;  2JPB A;  1DU0 A;  1Z05 A;  3FM5 A;  2VJ4 A;  3HHH A;  1KQ0 A;  4OAZ A;  2NS8 A;  4S0H B;  2LNB A;  3F0C A;  4JQF A;  1T6S A;  3G71 I;  3I53 A;  2E34 A;  1SD4 A;  4P1W A;  2LP0 A;  2OUM A;  2A6H F;  2JZY A;  3TBI A;  3LWF A;  4PJJ A;  1VQM I;  1T2K A;  1R9T J;  4HDU A;  3PQJ A;  3HYI A;  1FEX A;  3BC8 A;  2FA5 A;  4ASN A;  3CCL I;  1UEL B;  2FMY A;  4CZZ A;  2GM4 A;  4UB6 C;  1N75 A;  4IX7 A;  2WAE A;  5CVV A;  1SVM A;  2EFO A;  4PJ0 C;  2EFN A;  4YFN F;  1OCP A;  2K4J A;  3WTY C;  2XAJ A;  2EA4 A;  1WJF A;  1A36 A;  3AG2 H;  3V8L A;  3JRE A;  1Y39 A;  1LPQ A;  1LDJ A;  2GXB A;  5IOZ A;  4IZZ A;  2CS3 A;  4WXC A;  3K70 D;  2O6G E;  3MVP A;  4DQ2 A;  5ICC A;  1FIA A;  5FFZ A;  4ZYA A;  2EZH A;  5F27 A;  2JT1 A;  1OYI A;  3I64 A;  4ZJZ A;  2NRA C;  1YJN I;  2NAZ A;  2EZK A;  3H3Z A;  2JA6 J;  4MFD A;  3G4S I;  2AXT C;  1B72 A;  2XSD C;  1WSU A;  1PYV A;  4ZDP A;  2FUG 2;  3WTW C;  3OYH A;  2JJ7 A;  4C2M J;  5JVT A;  3HOT A;  1VF9 A;  1MJB A;  1HW5 A;  5L3F A;  4Y52 J;  2D45 A;  1MDM B;  2W25 A;  2KJB A;  3MKL A;  5AIP A;  2JSC A;  3ZXS A;  1J09 A;  1D5V A;  2KKO A;  4HX8 A;  3FIW A;  2WBM A;  2DK8 A;  4I98 B;  3N4M A;  2IJL A;  3PFY A;  3TO6 A;  4IHT A;  2BOL A;  2D2W A;  1D0Z A;  5A2Q Z;  1UZC A;  5LRR A;  3J80 K;  2HR3 A;  2X6W A;  4KIG A;  2A6T A;  2QKM B;  1KA8 A;  1YS6 A;  2VKE A;  2XF6 A;  3KEQ A;  5EEA A;  2M30 A;  4K2E A;  1GHC A;  4BEH A;  2VE9 A;  1YYV A;  3GXO A;  5J40 A;  3IKT A;  2IS6 A;  4MO7 A;  3R0A A;  3WE2 A;  1XGM A;  2MA3 A;  3I4N J;  1FTZ A;  4HZF A;  3GTK J;  1ETW A;  4NC8 A;  4YEL A;  1UCR A;  4CUG A;  1LE8 B;  3RJP A;  2MSY A;  2L9R A;  3ZRG A;  4XBF A;  2AQE A;  3DPT A;  1YIJ I;  4Y4R A;  4ZDO A;  3WHB A;  4QIW N;  1BW6 A;  2ZNY A;  3S16 J;  1B6A A;  1POG A;  4KIC A;  3LFK A;  2DJI A;  4I0A A;  1R49 A;  4BKX A;  3IC7 A;  3H9J A;  3ZGK A;  2IAI A;  2DQR A;  2DA3 A;  2VI6 A;  3A02 A;  5FKL A;  3GZN B;  4M3D A;  2RQP A;  1MBH A;  4I7H A;  5C3E J;  1AOY A;  2N8G A;  3VWB A;  4KYW A;  2P4W A;  1J75 A;  3BR3 A;  2PJR B;  4MLO A;  3CCE I;  1G59 A;  3ZMS A;  3QYE A;  3RKQ A;  3C2G A;  2KRC A;  2R5Y B;  3VSL A;  3I58 A;  3HUG B;  5FD6 A;  4HST A;  3MZY A;  1OCR H;  3DEE A;  5D6F A;  4LIT A;  3KLO A;  4YIR X;  3K4C A;  3KFW X;  2LBF A;  3QU3 A;  3TKY A;  4RBO A;  3FXJ A;  3JRI A;  1UG0 A;  1D1B A;  5K7F A;  2Q0O A;  4IRI A;  2XAQ A;  1HW1 A;  4BH9 A;  2VJI A;  1Z91 A;  3MKW B;  3M3Y J;  2F4O B;  4BNC A;  4ZYD A;  2PN6 A;  3HJE A;  1LUJ B;  3RPU D;  3OOU A;  1TQP A;  2QSH X;  1B8I A;  1B9N A;  3BP8 A;  4U7B A;  2GZW A;  1YI2 I;  4UV8 A;  1WVR A;  1D5Y A;  3GME A;  3UR3 C;  5H2F C;  1JKR C;  1MMN A;  1P9Q C;  2M7A A;  1F43 A;  2ZCW A;  2BVL A;  3GTQ J;  2DA4 A;  3DFG A;  2F5V A;  4LK0 F;  1IC8 A;  5FLV A;  2Q2E A;  3ASO H;  1WCM J;  2COM A;  1ON1 A;  2WV0 A;  1X58 A;  1JJ6 C;  5F6F A;  3BRO A;  2DA2 A;  4XRF A;  1WI9 A;  4ITV A;  3FXR A;  1YIO A;  4A0Z A;  4EGY A;  1IW7 F;  3HSR A;  2K40 A;  3K4N A;  2XGX A;  2R7Z J;  1BI3 A;  1BOB A;  4DW6 A;  1O3S A;  2UZK A;  1XMX A;  4L9T A;  2X4H A;  3CES A;  2WAF A;  3HRT A;  2QQA A;  3CP8 A;  1ZAO A;  3BZC A;  4ZZD A;  4ENJ A;  1VQ9 I;  5ICG A;  3CCQ I;  1EKE A;  2HOE A;  2CMP A;  5L3E A;  4AC0 A;  4FTH A;  3S2W A;  2W48 A;  4MTE A;  3H1C A;  3RPQ A;  2EIJ H;  3TMO A;  5CVR A;  5LEJ A;  1S7E A;  1BC8 C;  3QRF F;  1MNE A;  4WX9 A;  4F55 A;  4D1Q A;  3FK6 A;  4BJ6 C;  3CCR I;  3LSK A;  2LDU A;  3KIO A;  3OR2 C;  1U9O A;  1RNL A;  2DA1 A;  3K10 A;  1U78 A;  3K0L A;  1HDP A;  5HLG A;  2VQL A;  2RAE A;  5KNL A;  1ETY A;  3SYT A;  2HOS A;  2F4M B;  4LMY A;  1KGS A;  3QU6 A;  1FIP A;  1MBF A;  4BL0 B;  1JGS A;  1PP7 U;  1BR1 A;  4KJZ A;  2IA1 A;  2H1K A;  4AU7 A;  5B1A H;  2VAS A;  1QZZ A;  4I76 A;  3FXQ A;  4NQW B;  4XM3 A;  4I01 A;  2M0C A;  4L9N A;  5H20 A;  4OIP F;  4OU0 A;  1TC3 C;  4M9S A;  3ULQ B;  1S5L C;  3OV8 A;  5TJJ A;  2LF8 A;  3GCM A;  4M9Z A;  1IJW C;  2F6C A;  1CF7 A;  3S93 A;  3G2B A;  1Y0N A;  2Z5U A;  3G3Z A;  2WY8 Q;  1BA5 A;  1IV8 A;  2OV7 A;  3BJO A;  2YX4 A;  3ZR8 X;  3KPH A;  5IYC J;  4CH7 A;  1FZP B;  2IT0 A;  1TW2 A;  3NAR A;  1W7P A;  1ZHF A;  1IO2 A;  1B1B A;  3LSM A;  1ETO A;  4OIQ F;  1ONV A;  1I3A A;  5LRS A;  2V1U A;  2ECB A;  5J6X A;  4BDY A;  3DWL E;  3OYJ A;  3AL0 C;  2DDB A;  4XKW A;  1X3U A;  2DW4 A;  1MIJ A;  2DDA A;  4HA8 A;  4A3G J;  3LSR A;  5K7H A;  2EPF A;  4MQ9 F;  1DU6 A;  3BG6 A;  1P92 A;  4EJO A;  3RKY A;  4C2U A;  5DCM B;  1YG2 A;  3VYS B;  3DEW A;  1JKP C;  1JUM A;  1SAU A;  4OAY A;  1X2M A;  1ZR4 A;  1MSE C;  2M4G A;  1AHD P;  5CLS A;  4C9Y A;  3FBI B;  2GIV A;  1YRN A;  2VOD A;  4L5E A;  1R36 A;  3NRV A;  1X4P A;  1SC7 A;  2EFW A;  2DK5 A;  2Z3Y A;  2MBF A;  2H09 A;  2VKD A;  2FXA A;  1E2X A;  2L7M P;  1YOV B;  2VQG A;  3CUQ B;  4NBQ A;  3E5X A;  5E1X A;  1TQI A;  2VOO A;  1QNT A;  3CCY A;  1D8K A;  4BE0 A;  3A0H C;  2D1V A;  3ERE D;  4KMU X;  1HA8 A;  5IT9 Z;  3EPZ A;  5CQG A;  5HNF A;  2KJC A;  3K7A J;  2ISZ A;  2MG4 A;  3SHF A;  2Z16 A;  2QSF X;  4M73 A;  5E3N A;  4UNO A;  3Q0U A;  2JSP A;  2ADU A;  1J2X A;  2DYR H;  1XGS A;  1FX7 A;  3TP3 A;  3J7Z I;  4Y33 A;  4BE2 A;  1L3L A;  3LA2 A;  1HST A;  4GDF A;  2WB1 N;  3EDP A;  4Q48 A;  2DI3 A;  2Y0S N;  3EYI A;  4UB8 C;  1TWH J;  3I4P A;  4M3F A;  5J8C A;  1F36 A;  2PQ8 A;  3QPT A;  1X2N A;  2LRD A;  3BWG A;  3CCJ I;  2DMU A;  2HQ5 A;  3IUO A;  1EH6 A;  2EV5 A;  4P96 A;  5D4S A;  2ACJ A;  2OA4 A;  4FE7 A;  4L9J A;  1MBG A;  2W85 A;  3OYM A;  4DIQ A;  9ANT A;  3HKZ N;  3DQV C;  4BHB A;  1JKO C;  1MMA A;  4ZYH A;  4DGW B;  1KU3 A;  1R22 A;  3RSN A;  3IP4 B;  3C7J A;  3HRM A;  3NEU A;  3S1Q J;  3PL8 A;  5DTD A;  4NNJ A;  3GTP J;  2EJR A;  2HVS A;  1MH4 A;  4F7Z A;  1WJC A;  3CCS I;  3E0J B;  2JMW A;  4XOT A;  1QBJ A;  5LGN A;  2DU9 A;  5CVI A;  1DP3 A;  5LLQ A;  3E97 A;  2LBF B;  5E3O A;  4ZDL A;  1HLV A;  3L2Q A;  5FKK A;  1K6O A;  4A3M J;  1MBE A;  2P8T A;  3H5A A;  3S3M A;  2BY1 A;  4HYE A;  1I50 J;  4XKC A;  3W3C A;  4B43 A;  2NVY J;  1XN7 A;  3JAM K;  4KMF A;  2A07 F;  1B8I B;  2WWY A;  3KCC A;  2MFZ A;  4ZYE A;  1SFU A;  1X4O A;  1WWX A;  2QQ8 A;  5F08 A;  3ML6 A;  4AIH A;  2XF5 A;  3ABT A;  4ZTJ A;  2WV1 A;  4QPO A;  2R7D A;  4EM1 A;  2G7H A;  3F21 A;  1B4A A;  2CJJ A;  4D7M A;  3HGY A;  4X1E A;  4R79 A;  1JHH A;  1P7J A;  2BGC A;  4CA0 A;  3HTS B;  1FBU A;  4LK1 F;  3DEU A;  1FPQ A;  3CME I;  4GFB A;  2EIK H;  4LG3 A;  2RKH A;  1K4S A;  2MLG A;  2XB5 A;  3BQZ A;  2X48 A;  3C18 A;  3PUF A;  4BAY A;  2MC4 A;  1JJ8 C;  2JVG A;  2VC1 A;  3J81 Z;  4HQE A;  1OQY A;  5JLX A;  2BY3 A;  4DBQ A;  3ZP5 A;  1VQO I;  5E8G A;  4AIJ A;  1LDD A;  3SDG A;  1TZL A;  2I8D A;  4HV6 A;  2I5U A;  3BZK A;  3EUH C;  4YFK F;  3OYA A;  3HC7 A;  3GTO J;  4GCV A;  2QGU A;  1TT5 B;  3JRH A;  1ERD A;  2BY2 A;  3GX4 X;  3WTZ A;  2V1N A;  4KA4 A;  1I3Q J;  2WTE A;  1BN5 A;  1MJ9 A;  1S6L A;  5DDG A;  1W5C C;  1HC8 A;  4BGD A;  1XG1 A;  4L5I A;  1RET A;  1U5T B;  5HOO A;  2M4K A;  2L01 A;  5EZG A;  3SQN A;  5GTI C;  5D5V B;  3TOB A;  2V1X A;  2DTR A;  2JUC A;  4M74 A;  1RKT A;  5D5W B;  1UHS A;  1F9N A;  3BOQ A;  3GUD A;  3ZMD A;  5DV5 A;  3QPH A;  3W6K B;  4IKF A;  2KHM A;  1SFX A;  4OMY A;  4A6D A;  2NNN A;  3DP7 A;  4PGG A;  1VFC A;  5KVR A;  4R1H A;  3E5U A;  2VKH A;  2CO5 A;  3BR5 A;  2LY2 A;  4WXD A;  5DUK A;  1FOX A;  3V8K A;  2KRF A;  4G12 A;  1E3P A;  2XGE A;  5D5U B;  4UVC A;  3PM1 A;  1XX5 A;  3IV5 A;  3F9K A;  4HAM A;  2IGO A;  3ELK A;  3WU2 C;  2ZME B;  4O6J A;  2NNY A;  1G3S A;  1LVA A;  5IY5 H;  1YHQ I;  5A2Q K;  1MKM A;  4JOM A;  1NHA A;  2FBK A;  2H1L A;  2QLZ A;  2JUG A;  2ZME C;  1RRJ A;  3DKY A;  4BQQ A;  4RB0 A;  2STW A;  2KZV A;  3IKV A;  4CCL A;  1AU7 A;  3HOX J;  3CD6 I;  3QP6 A;  4IRH A;  2M2E A;  1K7A A;  4QWQ A;  5E8I A;  4G7Z F;  2DMP A;  2PJR A;  1U2W A;  2PLY A;  3L9F A;  2YU3 A;  3BJA A;  3I0T A;  3NWS A;  1T08 B;  4NUB A;  2R5Y A;  3HUG A;  1UJ8 A;  4BXU A;  3WTU C;  3RDI A;  1GXQ A;  1TTY A;  4E7L A;  3ONQ A;  2VBY A;  4U0Y A;  1G8X A;  2PMH A;  4ZYG A;  2E36 A;  1QVU A;  1WJB A;  3KP7 A;  4G7H F;  4UUV A;  3U2R A;  3DKW A;  1AA7 A;  1Z3Y A;  5DCF A;  1WPK A;  2KIS A;  1J9I A;  5KCM A;  1K61 A;  2EBI A;  2LVS A;  5LHH A;  1G6N A;  2JA2 A;  3PNY A;  4UHT A;  4A3K J;  2JTV A;  4ZZL A;  1ZN2 A;  3ZQ7 A;  4FCY A;  2CWE A;  2XSJ C;  1FBQ A;  4CDG A;  1F4K A;  1EV7 A;  6PAX A;  3EYY A;  2CQK A;  3OYC A;  2M45 A;  4EJT A;  3V4G A;  3O3K A;  3U1K A;  5L3C A;  4BHC A;  2DOE A;  5D8K B;  1ULY A;  3R61 A;  2Z33 A;  1TL8 A;  1Y0U A;  2FU4 A;  3DBH B;  3TDU C;  3TGN A;  3WOD F;  1U8R A;  3S1M J;  3R4K A;  2E1C A;  2L3D A;  3LQQ A;  2K9Q A;  4AVP A;  4RM3 A;  2GQQ A;  2ZXH A;  3QPL A;  2HFH A;  2D5V A;  2IRF G;  1S7O A;  3SFZ A;  1QO0 D;  2L7Z A;  3JCU C;  2YU9 J;  4PFP A;  5GAD J;  5CKT A;  3VOD A;  1XCV A;  1YJW I;  1FOY A;  4MEX F;  1O57 A;  1A6Q A;  1REP C;  1O3Q A;  3ZOB A;  3LA3 A;  2XRN A;  4PJN A;  3RZD J;  1P4A A;  1ETX A;  2A69 F;  5F04 A;  1OFC X;  2OCE A;  3CJN A;  1UB9 A;  4IOA F;  5E3L A;  1R5G A;  2W1O A;  2VPR A;  3AG1 H;  3PO3 J;  3MWM A;  3LAJ A;  1EF4 A;  3JRC A;  2X1E A;  2M8G X;  3FMS A;  1VQP I;  5K7Z A;  4HF1 A;  2ZBK A;  3T0Y A;  1X1C A;  1VQN I;  1XSV A;  3CCV I;  1RIO H;  4FQG A;  1ZGA A;  2HKO A;  3RQ4 A;  3HDD A;  4MNU A;  1YFH A;  3L2R A;  4A3D J;  3OIP A;  2K3F A;  3O2P E;  5DM7 F;  2HDW A;  4S04 A;  3PIO F;  2UWM A;  2HNH A;  3HOZ J;  4IHW A;  3BG9 A;  3KZZ A;  2F5E A;  2QM3 A;  3D0S A;  4DZJ A;  3PSF A;  3S8P A;  4EJU A;  1ITY A;  1QPI A;  2M8E A;  1YW7 A;  5TRD A;  3OYD A;  4H0E A;  1WZ2 A;  2EZL A;  2L9S A;  5M5Y J;  4NQW A;  3HOS A;  1K4T A;  3BLY A;  2XPU A;  4MHG A;  1QHG A;  1IRF A;  5E1Z B;  5DD4 A;  1QGP A;  3PJR A;  3DF8 A;  3WTX C;  2HZT A;  4TV7 A;  2LY9 A;  2OF7 A;  2Z9O A;  2XVC A;  2ZJQ F;  1DGR M;  1ZQ3 P;  1YS7 A;  1Q1H A;  1P4X A;  2E1M B;  3E3V A;  5HDG A;  5M3F J;  3F8N A;  1FYK A;  2NS7 A;  2W82 A;  2E5Z A;  3VYT B;  1QU3 A;  2W84 A;  1U8B A;  2HTS A;  2E1M C;  2ECC A;  1V3F A;  2X6Y A;  5AIQ A;  4AIK A;  2DOD A;  3K4M A;  3HOV J;  3GO5 A;  3JRG A;  1BR2 A;  1OR7 A;  2MC3 A;  3JRB A;  1EJ9 A;  1YE9 A;  2Y2Z A;  2M5W A;  3KZY A;  1XGO A;  2DFF A;  5D5X B;  1JKQ C;  1C0W A;  5KK1 A;  3ABK H;  3SJM A;  2L2O A;  4L18 B;  2FBI A;  3HGG A;  3OS0 A;  1LFU P;  5FB2 A;  2E7W A;  3M7G A;  1QHH D;  2GA1 A;  1IN4 A;  5F0C A;  1X1D A;  5J1Y A;  1X3Z B;  5LGT A;  2Z2S B;  1U3E M;  1FWZ A;  5JI6 A;  2LY1 A;  2DMQ A;  2IGK A;  2DJN A;  3S2D J;  5DCM A;  1GVD A;  2FF4 A;  4GYI A;  5JFR A;  5FRO A;  2HPM A;  1E3O C;  5B66 C;  2XGD A;  1X1A A;  1Y1V J;  3VOE A;  1TLH B;  1IGN A;  2VBW A;  1RC9 A;  2LH9 A;  3KP5 A;  2ELH A;  4YII A;  4QSH A;  1SAX A;  1BJZ A;  2YR2 A;  2OPT A;  5BNG A;  3MFK A;  4A5M A;  1DQU A;  2FOW A;  2GLO A;  3OMY A;  2FQ4 A;  4J00 A;  3CUQ A;  1ZR2 A;  1HCR A;  2M9H A;  1BR4 A;  4XID A;  4ENK A;  3HSE A;  1U9N A;  2CFX A;  4E7S A;  1WKM A;  4N4O B;  2H8W A;  2P5L C;  1OCT C;  4AD9 A;  5E1W A;  4II3 A;  4LG0 A;  4RB1 A;  3ROU A;  1G2H A;  2KIU A;  2DAO A;  2NVQ J;  5IOY A;  2NVX J;  3IRR A;  3KX2 A;  2FNA A;  3DXJ F;  3GW2 A;  2K27 A;  1W7P D;  5IP6 A;  1VZ0 A;  3U9G A;  4PGH A;  2B0L A;  3I55 I;  3DTI A;  3HOY J;  2DA6 A;  3PNV A;  4JX4 A;  2XAF A;  4E4H A;  2FBH A;  2K02 A;  2WAQ N;  4JX6 A;  4QTR A;  1VI0 A;  2BVM A;  5ED4 A;  3HHG A;  5JVG F;  1APL C;  4GO1 A;  2RQQ A;  4HEA 2;  2BBY A;  3UNG C;  4N0B A;  2MLK A;  1N77 A;  4RMN A;  2R7X A;  1GV2 A;  3QQA A;  4F91 B;  4BXF A;  4XLE A;  3H35 A;  3QP5 A;  1QA6 A;  1JUS A;  2HYJ A;  4Y3O A;  3L2W A;  5IT9 K;  1RPW A;  3GTL J;  4RB2 C;  3WU1 B;  1CQT A;  1FYM A;  3MAJ A;  3OS2 A;  4OIR F;  2P7C B;  4KIS A;  4YEJ A;  5FLX Z;  1A6I A;  1MD0 A;  2X1D A;  5LBQ A;  1LB2 A;  1SFE A;  2IVM A;  5M3M J;  3B73 A;  3HTU A;  1TT0 A;  3KZI C;  1T38 A;  5L3B A;  1BIB A;  1MW7 A;  1Q1V A;  4MFE A;  3J7A O;  4XR6 A;  3JSP A;  2PJP A;  2K9M A;  2R7R A;  3KP3 A;  3HIF A;  2WAQ A;  3IWF A;  4CCO A;  1PUF B;  2FX0 A;  1WJ5 A;  3OOP A;  1XPX A;  2R7U A;  4G94 A;  3MD2 A;  3H5R A;  2CQN A;  2HGC A;  2L7F P;  2O5R A;  3ZPL A;  2PG4 A;  5C44 J;  3BR6 A;  1SVO A;  1WJE A;  2OTL I;  5D4R A;  1LVK A;  3NAU A;  3TL4 X;  3G1O A;  4IF4 A;  5DS9 A;  4IHY A;  5BPD A;  3SFI A;  2XV4 S;  2ZNZ A;  4B48 A;  2LKP A;  1TW3 A;  2DT6 A;  3FXU A;  1FOW A;  3QOP A;  3RCO A;  5EGO A;  5DUI A;  4RS8 A;  3D1N I;  3U1D A;  3EUH A;  3GEZ A;  1YTY A;  2VBX A;  2LRE A;  2R3S A;  2W57 A;  3K69 A;  2CQX A;  4XMY A;  1O7F A;  5H6Q A;  3F6O A;  5F0H A;  4HX4 A;  2A5W A;  1LEB A;  4V19 K;  4IHX A;  4OWR B;  1D0Y A;  1XS9 A;  3OYE A;  5FKO A;  3H3V K;  4AUX A;  3CZ6 A;  4IVN A;  3WTT C;  4UVA A;  5LFA A;  1J0R A;  2V1D A;  4DJA A;  1ZG5 A;  2L7K A;  3R0J A;  2XC7 A;  1U5T A;  2CV0 A;  3ZQI A;  2PMZ A;  4HOB A;  2VQH A;  2D1H A;  4A5N A;  5IT3 A;  2E2H J;  3N05 A;  3V7C A;  1AKH B;  2RNJ A;  3J81 K;  2OTJ I;  4XSX F;  2KIM A;  2QYO A;  5H6R A;  4YIF A;  1K79 A;  4D0P A;  2XAH A;  4U0V A;  4KN4 X;  5DD8 A;  1VQK I;  4LFU A;  3ISP A;  1OLT A;  2KIQ A;  4Y15 A;  1O3T A;  1X3W B;  3TO7 A;  5ILU A;  3FMQ A;  5LD2 C;  2ID6 A;  2M34 A;  4BBS J;  4XQF A;  2JQ7 A;  4A0X A;  2ZME A;  4XLN F;  4HX7 A;  2E1N A;  3L2C A;  2Y9Y A;  3KYL A;  3OR1 C;  4BU2 A;  3I54 A;  4CCN A;  2KQR A;  3M9A A;  1B59 A;  2HI3 A;  3WE3 A;  1OPC A;  2DXI A;  3M1E A;  3BPX A;  4F3Q A;  1TQM A;  4N9I A;  3E6C C;  3M8E A;  3X2Q H;  1W0U A;  2LR8 A;  1FBS A;  1YW8 A;  5JHF A;  4ZC3 A;  5CQE A;  3OIQ A;  1S29 A;  3J7Y J;  1XSD A;  1R4M B;  5CVJ A;  2FML A;  2E5N A;  3L09 A;  4M3G A;  2LG4 A;  1OR7 C;  1GVJ A;  1XCB A;  3E6B A;  4PDK A;  3EUA A;  2V4J C;  5L3G A;  2QKL B;  1JUP A;  1MGT A;  1MMS A;  3H3U A;  4IQJ A;  3P5J A;  3ABU A;  2STT A;  4A3I J;  1IUF A;  1LQ1 A;  1STZ A;  1IXR C;  5HLH A;  3KE2 A;  3M8F A;  4JK1 X;  2KDZ A;  4HF0 A;  2ZXJ A;  3VB2 A;  2NS0 A;  1XSX A;  2R4G A;  4UUT A;  4XRS A;  3KLN A;  4G6T B;  2ELK A;  2CFO A;  3I9V 2;  1HQC A;  3FXK A;  2ME0 A;  2ZFU A;  5FGM A;  3HOU J;  2E1O A;  4XRM A;  1BL0 A;  4BE1 A;  3K4L A;  1X19 A;  5F64 A;  4C3I J;  1PUE E;  4L0Y B;  1UHW A;  3WGH A;  4I2O A;  3I4M J;  1QQI A;  1N25 A;  3PIP F;  3W6J B;  3CUQ C;  5J1U A;  4LG0 B;  1TWF J;  3FXM A;  4BS9 A;  4AWX B;  2QQ9 A;  3CLQ A;  4KIB A;  3J7A Y;  5BMZ A;  1KZH A;  3GVA A;  1FT9 A;  3GZ5 A;  1HW2 A;  2JA8 J;  5EJC A;  1PVE A;  3GF2 A;  2ZJR F;  2QSG X;  2CRG A;  2IA0 A;  1ZGJ A;  3RYP A;  2CW8 A;  3CMA I;  1GDT A;  3D5S C;  1YX5 A;  4IEJ A;  2P81 A;  2GIZ A;  2VXD A;  1VQ5 I;  2YS9 A;  4KNY A;  5CYV A;  3GZ6 A;  2GA2 A;  2P7V B;  4N9H A;  4RLQ A;  2L02 A;  2WAD A;  2E60 A;  2MH2 A;  2TDX A;  4KIT B;  1ZH5 A;  3DPU A;  4D5F A;  2A3S A;  1ETV A;  2DQL A;  2IP2 A;  1K78 A;  1JXS A;  4PJL A;  4Q47 A;  4B09 A;  3TP0 A;  5E79 C;  2CU7 A;  4HF2 A;  1BI1 A;  4X0G A;  2OAZ A;  5K5R A;  3DBR B;  2GAU A;  5C4X J;  3MZH A;  3P9I A;  2L9N A;  2IS2 A;  5B3S H;  2KT0 A;  1D3Y A;  1M1E B;  2A05 A;  4XN0 A;  3RKW A;  3EQL F;  2XAU A;  1R4N B;  1LKX A;  3QAH A;  3V8J A;  4ZTF A;  4NC6 A;  3EUK L;  3OS1 A;  4UVB A;  1A31 A;  1IRG A;  2HQR A;  3JW4 A;  2RGV A;  2MD0 A;  4FHT A;  3JTG A;  3BTC A;  5E3M A;  3QOE A;  4PUS A;  3AAF A;  2RRE A;  3K1P A;  1DPU A;  5M5X J;  2R7F A;  2LKX A;  1Y8R B;  3OYB A;  3BR1 A;  1N78 A;  2F4I A;  2Q1Z B;  2CYY A;  5HLT A;  2HYF A;  3OY9 A;  1JT6 A;  4Y13 A;  2FOK A;  1RR7 A;  1VND A;  2X51 A;  4Z6Y A;  4DYR A;  1V5G A;  1XDU A;  1RR8 C;  4B47 A;  4XON A;  2E35 A;  2E19 A;  3JR9 A;  2QCO A;  3QWL A;  3DU6 A;  3GTM J;  3GLL A;  3DLL F;  1W5S A;  5EGO B;  1WHU A;  4GXO A;  1EA3 A;  3SEZ A;  1BI2 A;  3K9T A;  3Q0W A;  1O7L A;  4DOZ A;  3CDI A;  2P6S A;  3CC7 I;  4WK8 F;  3FIS A;  4LLL A;  5BS6 A;  1LNW A;  2OZU A;  2W7N A;  1H89 C;  5GAH J;  4B3A A;  1QZY A;  2DO7 A;  3ZMT A;  3IRQ A;  2XB0 X;  2XPV A;  3SZP A;  1FP1 D;  1R23 A;  1VQ4 I;  4E7Z A;  1OKR A;  2Y31 A;  1Z6T A;  3OYI A;  4B44 A;  1VQ8 I;  4HDV A;  3ABL H;  4CIC A;  4BHP A;  4IO9 F;  1V54 H;  3ECH A;  1TWA J;  4E7J A;  1TP4 A;  4JX5 A;  3R60 A;  1J59 A;  1BM9 A;  4O5V A;  4WCG A;  4A3C J;  3P9C A;  4XNF A;  3I56 I;  5EEH A;  1R71 A;  5GTH C;  4FAS D;  2K85 A;  3ASN H;  3PQK A;  1U5T C;  5LGU A;  3FHZ A;  1GLN A;  3V42 A;  3P9K A;  2RVC A;  4A69 C;  2L9V A;  4CCK A;  2HVR A;  2E7X A;  3CJR B;  1DP7 P;  2V9V A;  2CSO A;  3HRS A;  3KET A;  1ZAR A;  1TNT A;  2OQG A;  3BDD A;  1Z77 A;  4BAC A;  2AQF A;  1WRJ A;  3AG3 H;  2JPC A;  4HG2 A;  5B1B H;  2BV6 A;  1LEA A;  2HQA A;  5FLM J;  3ZMZ A;  1XMA A;  4Z2Y A;  3F23 A;  1Z3X A;  1S7A A;  3KP4 A;  5DEQ A;  5ILS A;  4C3J J;  2JN6 A;  4EEF G;  1O4X A;  1LJ9 A;  3TO9 A;  2OZ6 A;  2ZSH B;  3BTI A;  2Y0M A;  4F52 A;  1ZK8 A;  1YX3 A;  2ZSI B;  2HXI A;  1RZ4 A;  3H9Q A;  4B3X A;  5EDN A;  3FWE A;  1VQ6 I;  3RYR A;  3G73 A;  1UST A;  2DTZ A;  1Z6R A;  4LIV A;  3FXL A;  2OBP A;  3HRU A;  1IXS B;  4LIU A;  2VC0 A;  3BG5 A;  5HOD A;  2DPU A;  2BXY A;  2W00 A;  2EQR A;  1MND A;  4CHU A;  1X1B A;  1ZKG A;  4RGX A;  2EFQ A;  5EYR A;  1QZE A;  1JGG A;  1ZLJ A;  3QPS A;  4S05 A;  2BZT A;  3LSI A;  1MSF C;  4I09 A;  4EVI A;  2COB A;  2LFB A;  3HG9 A;  2VON A;  4U88 A;  1L0O C;  4PSX A;  1HKQ A;  3MN2 A;  1PUF A;  2P5K A;  3SXY A;  1UG2 A;  4OIN F;  3HSF A;  1IDZ A;  3W2V A;  2RNG A;  4CZC A;  2RN7 A;  1ZRE A;  3FBN B;  4G8X A;  2V6C A;  1LFP A;  5FKM A;  2PMU A;  1KU7 A;  1DGW Y;  3COA C;  3C3W A;  4WF2 A;  1VTN C;  5DM6 F;  1ZRD A;  2L0K A;  2NOG A;  3RZO J;  5HLI A;  3K4J A;  4U0W A;  2K4B A;  5KHD A;  5FLX K;  4EM2 A;  2QEN A;  2HDC A;  4I6Z A;  2HDD A;  2XGC A;  1H8A C;  1WFX A;  3I59 B;  2Y75 A;  4LJZ F;  4KDP A;  4D5C A;  2L4M A;  2VIX A;  4LD5 A;  5FFX A;  3WG7 H;  1NG7 A;  1QRY A;  2MD5 A;  5IYD J;  2BHY A;  4I0B A;  2JVH A;  2AS5 F;  2KRH A;  1H88 C;  1IN5 A;  2JA5 J;  4XK4 A;  5ILV A;  5J4Y A;  4A2U A;  2KP6 A;  4BUP A;  5JR3 A;  3JRA A;  2QVO A;  2KZG A;  5ICE A;  4PFO A;  3CDH A;  4HW0 A;  4M6V A;  4BDZ A;  4IXA A;  1ZYR F;  4F93 B;  1ACI A;  4UY8 I;  2ETH A;  3RQI A;  2JWT A;  2X9D A;  4J01 A;  1Z67 A;  3VYR B;  4RB3 C;  3LSJ A;  2BEO A;  1T33 A;  2KDO A;  1SVL A;  4V2G A;  1A04 A;  2XF7 A;  3DU5 A;  3H0D A;  5EG0 A;  1AKH A;  3DTK A;  3QOD A;  4P55 A;  1K78 B;  1IF1 A;  1P6R A;  3VPR A;  2R92 J;  1FSH A;  2K5C A;  1IXC A;  1ENH A;  2OD5 A;  3DV8 A;  1R58 A;  3K1N A;  1WH7 A;  3ZQG A;  1MNM C;  1ON2 A;  2R7V A;  3L2V A;  1FTT A;  4RA2 A;  2OQR A;  1BC7 C;  4KUM A;  4FET A;  4ANJ A;  2V9P A;  3HL2 A;  1R1V A;  2VLA A;  1D8J A;  2EH3 A;  1RI7 A;  3CJT B;  1ZG3 A;  1V55 H;  2NXN B;  4I02 A;  5GP9 A;  1FMW A;  3WGI A;  4BJT A;  3CO6 C;  1T56 A;  2B7E A;  3VEP A;  1UFM A;  3JRF A;  3C1D A;  4CYC B;  3PFI A;  2NOJ B;  1LFB A;  1J7K A;  2DFE A;  4P9F A;  4B8X A;  4HPQ A;  1EH8 A;  4FIS A;  1B9M A;  3DKX A;  5HDN A;  1GT0 C;  3FX3 A;  4MQV A;  4LB6 B;  5HS8 A;  3JSO A;  1QPM A;  3KEY A;  4NDL A;  3DTE A;  3I71 A;  3LNQ A;  4XRS G;  4RLF A;  4A12 A;  2M3A A;  2LD5 A;  2WA0 A;  3V7S A;  3OIO A;  1HF0 A;  1RKW A;  2VXZ A;  4QPQ A;  1ZLK A;  2VOP A;  1H9T A;  3IHU A;  2O7O A;  4A3E J;  1S72 I;  1JE8 A;  1ODD A;  4XLC A;  3GFI A;  1ORK A;  2W24 A;  2H6B A;  3ESW B;  1SEU A;  1TWG J;  2GOX B;  3W2W A;  4OIO F;  1IDY A;  5JLW A;  1Y56 A;  1NG6 A;  2O9L A;  3BCB A;  3I3L A;  3K4K A;  3A4C A;  5GAE J;  1XC5 A;  1QVT A;  2RDP A;  4AYB A;  3MKY B;  2QBY B;  4MEY F;  5F0F A;  2GXG A;  3TDZ C;  4CO8 A;  1WI3 A;  1R7J A;  2KL4 A;  1IZ1 A;  1ETQ A;  1G3Y A;  3GFJ A;  1FSE A;  4M72 A;  3GYH X;  4FX0 A;  2G7U A;  3S17 J;  4A93 J;  1IN6 A;  1TBX A;  3CCU I;  4BXX J;  2OCC H;  3LSG A;  4YFX F;  4BBR J;  1IAW A;  1VQL I;  2F5C A;  4M3E A;  2BW3 B;  4EM0 B;  5ICF A;  2QUF A;  5K1Y A;  1FMV A;  3LAP A;  4RM2 A;  2KLO A;  3MMY B;  1NH3 A;  1JI8 A;  1IN8 A;  3HPH A;  1VQ7 I;  4UV9 A;  2LSO A;  4IHS A;  1SAN A;  4CCJ A;  2LF7 A; 
#chains in the Genus database with same CATH homology
 1HLV A;  5FKK A;  3L1P A;  4FE4 A;  4A3M J;  1MBE A;  5EZH A;  2ID6 A;  2K9S A;  1HOM A;  2M34 A;  4BBS J;  1I50 J;  4UUS B;  3O8G A;  5IP7 J;  1YRN B;  1RES A;  2NVY J;  2Y9Y A;  3ZQF A;  3A01 B;  1B8I B;  2HI3 A;  5IYB J;  5F08 A;  1W0U A;  2LR8 A;  2WV1 A;  5IPA A;  5J3L A;  3FKI J;  3IH3 A;  2CJJ A;  4D7M A;  3HGY A;  4X1E A;  1P7J A;  1P7I A;  4IHV A;  1MH3 A;  3ZQL A;  2IEK A;  2TCT A;  4GFB A;  4A3J J;  2XB5 A;  3BQZ A;  2X48 A;  2HOA A;  3E7L A;  3K2A A;  1JJ8 C;  3O8H A;  1NTC A;  4DZP A;  4M3G A;  5JLX A;  4B1R A;  1IV6 A;  2JA7 J;  3M4O J;  3SDG A;  1FJL A;  1JUP A;  3HB9 A;  1GV5 A;  4D7N A;  3GTO J;  2R5Z B;  2XRL A;  1Z0X A;  2EZI A;  4A3I J;  1IUF A;  3JRH A;  2DA5 A;  4AYB N;  1I3Q J;  2KDZ A;  1XG1 A;  1RET A;  2GBY A;  3OSF A;  5EZG A;  4UUT A;  3B6A A;  4XRS A;  2E2J J;  1IRZ A;  3HEF A;  2ELK A;  1RKT A;  1DU0 A;  1UHS A;  3DCF A;  2ME0 A;  2PMZ N;  3HOU J;  2E1O A;  2NS8 A;  4S0H B;  4XRM A;  1BL0 A;  4C3I J;  5F1J A;  3F0C A;  5FJ8 J;  3I4M J;  1VFC A;  2ZB9 A;  3BTL A;  3BR5 A;  3LSP A;  2LP0 A;  5J1U A;  4G12 A;  2XGE A;  1TWF J;  3PM1 A;  3IV5 A;  1R9T J;  1FEX A;  1NK2 P;  2JA8 J;  5EF6 A;  2CRG A;  2GM4 A;  2Y9Z A;  3A03 A;  1GDT A;  3CQZ J;  4IEJ A;  1OCP A;  2P81 A;  3HOX J;  1AU7 A;  2M2E A;  2YS9 A;  2XPW A;  2DMP A;  3JRE A;  5IOZ A;  3B6C A;  4HNV A;  2R5Y A;  3MVP A;  4D5F A;  1FIA A;  2EZH A;  5F27 A;  3S14 J;  2EZK A;  1ETV A;  3TW7 A;  2JA6 J;  2DMT A;  4MFD A;  3TP0 A;  2CU7 A;  2FD5 A;  4C3H J;  1B72 A;  2XSD C;  5EG0 B;  5C4X J;  2JJ7 A;  4C2M J;  4J19 A;  1QVU A;  1VF9 A;  2KT0 A;  4Y52 J;  3MKL A;  4W1U A;  1WPK A;  3FIW A;  3GBG A;  1K61 A;  2EBI A;  3BTC A;  2LK2 A;  5E3M A;  1SFO J;  2LVS A;  2CQQ A;  4A3K J;  3UKG A;  5M5X J;  3BR2 A;  4FCY A;  2LKX A;  2VKE A;  3BR1 A;  5EEA A;  3PO2 J;  1JT6 A;  1RR7 A;  4MIM A;  1VND A;  1UMQ A;  4MO7 A;  2AO9 A;  4DYR A;  1Y1W J;  3I4N J;  3S1M J;  5GPC A;  1FTZ A;  2H8R A;  2E19 A;  3GTK J;  3JR9 A;  2QCO A;  1ETW A;  2K9Q A;  1WH5 A;  1LE8 B;  3GTM J;  3QPL A;  1MBK A;  2D5V A;  2MSY A;  2L9R A;  3BT9 A;  2L7Z A;  2TRT A;  2YU9 J;  3WHB A;  4QIW N;  1BW6 A;  5EGO B;  3S16 J;  1POG A;  3ZOB A;  3RZD J;  1ETX A;  5F04 A;  1OFC X;  3Q0W A;  4BKX A;  5IP9 J;  2IAI A;  5E3L A;  3FIS A;  2YUS A;  2DA3 A;  2VI6 A;  2VPR A;  3A02 A;  3PO3 J;  5FKL A;  4M3D A;  3TW6 A;  1EF4 A;  3JRC A;  2X6O A;  1H89 C;  4B3A A;  2M8G X;  1MBH A;  5K7Z A;  2XB0 X;  2XPV A;  5C3E J;  2N8G A;  3BR3 A;  2Y31 A;  1ZGW A;  3HDD A;  4MLO A;  3BTJ A;  3RKQ A;  4A3D J;  2MW8 A;  2R5Y B;  1TWA J;  3WHC A;  4IHW A;  3HOZ J;  3BG9 A;  4JX5 A;  1OJL A;  4DZJ A;  1ITY A;  2DA7 A;  4A3C J;  3GTJ J;  1B72 B;  1QPI A;  4RBO A;  3JRI A;  4A69 C;  3HBL A;  2HXO A;  2EZL A;  5K7F A;  5M5Y J;  2XPU A;  3HM5 A;  4UUS A;  2LY9 A;  1Z77 A;  2CUF A;  3M3Y J;  2OF7 A;  4BY1 J;  1ZTR A;  1ZQ3 P;  3OOU A;  4DYC A;  2R0Q C;  5FLM J;  1B8I A;  3S2H J;  1A5J A;  1GUU A;  5M3F J;  2K9N A;  1D5Y A;  2NS7 A;  1JT0 A;  1JKR C;  4C3J J;  2JN6 A;  4EEF G;  1U8B A;  1O4X A;  1F43 A;  3GTQ J;  2DA4 A;  3BTI A;  2R93 J;  1BW5 A;  1ZK8 A;  2ECC A;  5J1R A;  1IC8 A;  5FLV A;  4DYQ A;  3GTG J;  2HXI A;  4RDU A;  1WCM J;  3HOV J;  5EDN A;  4JP0 A;  3JRG A;  3JRB A;  1X58 A;  1JJ6 C;  2DA2 A;  2Y2Z A;  5M5W J;  2DTZ A;  4A3L J;  5C4J J;  1JKQ C;  3SJM A;  3BG5 A;  5HOD A;  2K40 A;  3HGG A;  2EQR A;  3IH2 A;  2R7Z J;  2Y30 A;  1LFU P;  1ZKG A;  4DW6 A;  5EYR A;  5F0C A;  1JGG A;  5J1Y A;  4XIC A;  3QPS A;  2E2I J;  1W0T A;  1HDD C;  2R5Z A;  3W6V A;  2DMQ A;  1MSF C;  2DJN A;  3S2D J;  1GVD A;  4AC0 A;  4FTH A;  2W48 A;  3TED A;  2COB A;  1E3O C;  2XGD A;  1S7E A;  2LFB A;  1Y1V J;  1IGN A;  3FK6 A;  4QSH A;  3MN2 A;  1PUF A;  3CMY A;  1BJZ A;  1U9O A;  1UG2 A;  2OPT A;  1IDZ A;  4CYC A;  5BNG A;  2DA1 A;  1U78 A;  2GLO A;  1HDP A;  2FQ4 A;  5FKM A;  2RAE A;  2DN0 A;  1ETY A;  3Q3S A;  1ZR2 A;  1HCR A;  2M9H A;  2HOS A;  5GPA A;  4XID A;  1FIP A;  1U9N A;  1OCT C;  1MBF A;  2L0K A;  2NOG A;  3RZO J;  2H1K A;  1G2H A;  2NVQ J;  2ID3 A;  4I76 A;  5IOY A;  2NVX J;  2M0C A;  4I6Z A;  1JTY A;  3JRD A;  2HDD A;  1K83 J;  2XGC A;  1H8A C;  5IP6 A;  1TC3 C;  4D5C A;  2AHQ A;  5FKN A;  3HOY J;  2DA6 A;  1QRY A;  4JX4 A;  4ABZ A;  5IYD J;  2HOT A;  2WAQ N;  3C2B A;  4JYK A;  4JX6 A;  1VI0 A;  4QTR A;  1IJW C;  1APL C;  2JK3 A;  1H88 C;  1BA5 A;  2JA5 J;  4X6A J;  4XK4 A;  5IYC J;  1GV2 A;  2IBD A;  3QQA A;  3JRA A;  3NAR A;  3HOW J;  4M6V A;  1ETK A;  1ETO A;  1JUS A;  2HYJ A;  4W97 A;  3BG3 A;  2ECB A;  2JWT A;  3RQI A;  2X9D A;  1RPW A;  3GTL J;  1CQT A;  2ME6 A;  3LSJ A;  1T33 A;  4V2G A;  3OSG A;  5EG0 A;  1AKH A;  4A3G J;  3LSR A;  5K7H A;  4V2F A;  1A6I A;  3VPR A;  2R92 J;  3ZQC A;  1DU6 A;  1ENH A;  1I6H J;  2CUE A;  1WH7 A;  3ZQG A;  5M3M J;  1MNM C;  2LLK A;  2O8K A;  1FTT A;  3DEW A;  1Q1V A;  4MFE A;  1JKP C;  1JUM A;  1ZR4 A;  1X2M A;  1MSE C;  1AHD P;  3FK7 A;  2EH3 A;  2VUM J;  2LTP A;  5GP9 A;  3H0G J;  1YRN A;  2QF7 A;  4L5E A;  1PUF B;  2FX0 A;  1T56 A;  3JRF A;  3A01 A;  4CYC B;  4BY7 J;  1LFB A;  4A3F J;  2L7F P;  5C44 J;  2G0E A;  3BR6 A;  2L7M P;  4FIS A;  4B4C A;  1GT0 C;  2FJ1 A;  3IH4 A;  3NAU A;  4IHY A;  1MBJ A;  3G1O A;  5DS9 A;  3S1N J;  4NDL A;  3CCY A;  4M3B A;  3LNQ A;  4XRS G;  3SFI A;  3K7A J;  2LD5 A;  1LE8 A;  1HF0 A;  3OIO A;  2MG4 A;  1RKW A;  2VKV A;  5E3N A;  2O7O A;  3Q0U A;  4Y7N J;  4A3E J;  3LOC A;  3BR0 A;  5EGO A;  3TP3 A;  3D1N I;  1ORK A;  4LOC A;  1TWG J;  3G1M A;  2WB1 N;  1WGX A;  1NK3 P;  3Q0V A;  2CQX A;  2Y0S N;  1IDY A;  5JLW A;  5F0H A;  2O9L A;  1TWH J;  3ZQH A;  4M3F A;  4IHX A;  1XC5 A;  1QVT A;  1XS9 A;  5F0F A;  5FKO A;  3H3V K;  1F36 A;  1X2N A;  4AUX A;  1WI3 A;  3BQY A;  2B63 J;  2NVT J;  2DMU A;  2HQ5 A;  1ETQ A;  2I10 A;  3S1R J;  4A3B J;  3G1L A;  4FE7 A;  3S17 J;  4A93 J;  1IG7 A;  1MBG A;  4BXX J;  3ZQI A;  3LSG A;  4BBR J;  9ANT A;  3HKZ N;  1TWC J;  1JKO C;  3CDL A;  4M3E A;  3S15 J;  2DMN A;  1JTX A;  2E2H J;  2MGQ A;  3S1Q J;  5DTD A;  1AKH B;  3GTP J;  1MH4 A;  2JMW A;  1SAN A;  5E3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...