3UKGA

Crystal structure of rap1/dna complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
223
Chain Sequence
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA-binding protein RAP1
publication title The orientation of the C-terminal domain of the Saccharomyces cerevisiae Rap1 protein is determined by its binding to DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 60
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA02
2CU7A 1TWHJ 2Y30A 1WGXA 1JKOC 1MH4A 5GPCA 2XSDC 4XICA 5M5YJ 3O8HA 3ZQLA 2WB1N 3CCYA 1ORKA 2ME6A 3S17J 2JA5J 5EF6A 2E19A 3HM5A 3RZOJ 3PO3J 4J19A 1JTXA 1DU6A 3CQZJ 2GM4A 5C4XJ 1JTYA 3QQAA 4XK4A 1PUFB 3ZQFA 5EZGA 3G1MA 1JUPA 4V2GA 2DA4A 2NVXJ 5EG0A 4A3FJ 1TWAJ 2R5ZA 1TC3C 2NOGA 3M4OJ 3F0CA 5J1RA 3QPLA 3GTPJ 2H1KA 3JREA 1ITYA 4AYBN 1RETA 4A3CJ 1QRYA 4FTHA 3NARA 4UUSB 5E3OA 3S2DJ 2NS8A 1X2MA 4JX4A 3BQYA 4M6VA 1HLVA 1BL0A 1GV5A 4LOCA 1LFBA 4NDLA 2GBYA 1OJLA 1WCMJ 4G12A 3ZQCA 3JR9A 3S2HJ 2TCTA 2XGEA 4A69C 2DMQA 2HDDA 3TP3A 4M3EA 1ZK8A 3H0GJ 1BJZA 2N8GA 3MN2A 3HBLA 2DA1A 1A5JA 2LTPA 4RBOA 3S1MJ 4V2FA 1A6IA 5FKOA 2CUEA 1QPIA 2EZLA 2KT0A 4M3GA 1ZKGA 2LK2A 4DZJA 2NVQJ 2Y31A 5EG0B 1SANA 3SJMA 5HODA 2M2EA 2R5ZB 3HOZJ 2B63J 4HNVA 5IYCJ 2K40A 1IJWC 5IOYA 5F04A 5FJ8J 2FJ1A 1MBHA 2E2IJ 1D5YA 2HOAA 5J1YA 1AHDP 1P7JA 3L1PA 4I76A 4DYCA 1ETWA 2DA7A 1QVUA 1RKTA 3K7AJ 4IHVA 1JT6A 3BR2A 2I10A 4D5CA 1U8BA 2DJNA 2LVSA 2MG4A 3K2AA 3HOWJ 3BT9A 4UUTA 3ZQHA 4DYRA 3HGGA 2XB5A 3TP0A 1JT0A 2P81A 2DMTA 1FEXA 2VPRA 1JUMA 5IP7J 5F0HA 4IHWA 2ECBA 2M0CA 5DS9A 2Y9ZA 1RESA 1MNMC 3BR0A 2HYJA 1G2HA 2OPTA 1GT0C 1TWCJ 2E2HJ 3S14J 2DMNA 1JGGA 1X58A 5M3MJ 3CMYA 3TEDA 1MBEA 2YS9A 2X9DA 2EBIA 1B8IA 3BR5A 3G1LA 1NK2P 2Y9YA 1T56A 1ETVA 3IH4A 4A3MJ 2DA5A 1ENHA 3OIOA 2DTZA 3QPSA 4CYCA 3JRGA 2K9NA 1WI3A 3IH3A 2R5YA 4EEFG 1BW5A 1ETQA 4X1EA 2WV1A 3HOXJ 4BY1J 3LSPA 2GLOA 4W1UA 1ZR4A 3HOUJ 3VPRA 2CJJA 3RZDJ 2JMWA 5DTDA 1XG1A 2L9RA 4A3EJ 5IOZA 1BW6A 1RR7A 1MBJA 1WPKA 1IV6A 5JLWA 1VI0A 2JK3A 2AO9A 1AKHA 1FJLA 4M3BA 4A3DJ 2NVYJ 4JYKA 3BTIA 3TW7A 4DYQA 5K7ZA 3BR1A 1ZGWA 1JUSA 4BKXA 3SFIA 1WH5A 2XGCA 4D7MA 2TRTA 5J3LA 2O7OA 5J1UA 1F43A 5F1JA 2XRLA 1E3OC 4A93J 1YRNA 3A03A 2IBDA 2VI6A 2Y0SN 1LE8A 1I3QJ 4DZPA 1HDPA 4JP0A 1U9NA 2QF7A 1EF4A 1Z77A 1ZR2A 2O9LA 2JJ7A 3HOVJ 5FKLA 4FE4A 3ZOBA 1X2NA 1O4XA 2W48A 3JRDA 3A02A 1P7IA 3LSJA 2EZKA 2ID6A 2FD5A 1OCPA 3MVPA 2JA6J 5F0CA 1MH3A 2M34A 3FK7A 1GVDA 3A01A 1AKHB 1ETKA 2HI3A 1XC5A 4ABZA 5E3MA 1T33A 4DW6A 2R93J 2JA7J 1IRZA 1Q1VA 4JX6A 4C2MJ 3HOYJ 2VKEA 4BXXJ 3HKZN 3PM1A 3M3YJ 3S1QJ 2QCOA 3ZQGA 1POGA 2NS7A 2XGDA 2R92J 2VUMJ 4QTRA 3BTJA 4W97A 5FKMA 3JRIA 1MBGA 3OSFA 1RPWA 3I4MJ 5IYBJ 2XPVA 4A3GJ 2WAQN 3LSRA 1U78A 4BBSJ 1MSFC 5M3FJ 3FISA 3Q3SA 3LNQA 3WHBA 5F27A 1UMQA 2DA2A 3BR3A 2K9SA 4M3DA 2X6OA 1B72A 2ECCA 3S16J 4FE7A 1CQTA 2FX0A 2M9HA 2CUFA 3BG9A 4IEJA 2HQ5A 2G0EA 1H88C 1VF9A 1K61A 2R7ZJ 2LLKA 1SFOJ 1BA5A 3SDGA 4AUXA 1Y1WJ 4JX5A 4A3IJ 2L7FP 4A3LJ 3S15J 3BG3A 1MBFA 2CRGA 2HXIA 2IAIA 3JRCA 3OSGA 2E2JJ 3LOCA 2H8RA 4B4CA 4QSHA 2KDZA 4X6AJ 3BR6A 5FLMJ 2L0KA 2K9QA 2OF7A 2HOTA 1ZTRA 5FKNA 1R9TJ 1JJ8C 4C3IJ 2Y2ZA 1ETXA 3HGYA 4IHXA 5C44J 3B6AA 3OOUA 5E3LA 1XS9A 2DA3A 4C3HJ 3I4NJ 5JLXA 1DU0A 4XRMA 1JKQC 4MFEA 1HOMA 1S7EA 3GTQJ 2MW8A 1QVTA 4C3JJ 3E7LA 3RKQA 2LP0A 2DMUA 3Q0VA 3GBGA 1B72B 2JN6A 3GTOJ 1FIPA 2ELKA 2X48A 1HCRA 3GTJJ 5FKKA 4UUSA 5F0FA 3TW6A 1TWFJ 3FIWA 5EGOA 4Y52J 3UKGA 1H89C 1MBKA 3JRAA 2JA8J 4XRSG 1F36A 1Y1VJ 1W0TA 1B8IB 4BY7J 1HF0A 4FCYA 3GTLJ 1JKPC 2HOSA 2LD5A 1W0UA 3BG5A 5K7HA 2M8GX 3DCFA 2FQ4A 5BNGA 3FKIJ 4B1RA 1H8AC 3W6VA 3MKLA 3GTMJ 4CYCB 5FLVA 4S0HB 3CDLA 3HDDA 1JJ6C 2IEKA 3S1RJ 3LSGA 2R5YB 4M3FA 1UHSA 2E1OA 4A3BJ 4MO7A 4AC0A 4MFDA 4A3JJ 3WHCA 2COBA 3PO2J 1Z0XA 2DA6A 2DN0A 2YU9J 1TWGJ 1NTCA 2XB0X 5EGOB 4A3KJ 3G1OA 5K7FA 2VKVA 3NAUA 1LFUP 4GFBA 2DMPA 2XPUA 5F08A 1IG7A 5IPAA 1GUUA 3D1NI 1RKWA 3B6CA 5M5WJ 3IH2A 2ID3A 3HB9A 1YRNB 1HDDC 1VNDA 5EYRA 1IUFA 2AHQA 1FTZA 2EZHA 2EQRA 2O8KA 3DEWA 3BTCA 1LE8B 2MSYA 1GDTA 3IV5A 2PMZN 5C3EJ 2R0QC 5EEAA 1IGNA 1VFCA 4XRSA 1OCTC 4B3AA 2EZIA 1NK3P 1FTTA 2LR8A 1IC8A 2ME0A 4D5FA 3H3VK 1UG2A 2LY9A 2EH3A 5M5XJ 3C2BA 5E3NA 1I50J 4BBRJ 4L5EA 5IP9J 5C4JJ 9ANTA 2CQXA 2L7MP 5EDNA 3GTKJ 1OFCX 5IP6A 1APLC 2D5VA 3ZQIA 3A01B 2XPWA 5IYDJ 1JKRC 4Y7NJ 2LFBA 1I6HJ 2CQQA 1GV2A 4I6ZA 3JRHA 1IDZA 3JRBA 5GPAA 5GP9A 5EZHA 2NVTJ 1K83J 3BQZA 4IHYA 1ETYA 3FK6A 4MIMA 2HXOA 2ZB9A 1ZQ3P 3Q0WA 3GTGJ 3S1NJ 3JRFA 3RQIA 2YUSA 2JWTA 1PUFA 1FIAA 1IDYA 3O8GA 1U9OA 2L7ZA 4FISA 4XIDA 2RAEA 3HEFA 1AU7A 4RDUA 2MGQA 1ETOA 3BTLA 4D7NA 4MLOA 4QIWN 1MSEC 3Q0UA 2LKXA 1WH7A
chains in the Genus database with same CATH superfamily
1XX5A 2CU7A 1K4SA 3U1DA 2L4MA 1H9GA 1X4PA 4KICA 2DI3A 4XICA 1BR4A 2WB1N 5EJCA 4ENNA 3SEQA 3CCYA 3K4JA 4HV6A 1ORKA 4NC8A 2GAUA 3LSMA 3M1EA 2FU4A 2JA5J 1CGPA 4U7BA 1YX5A 2E19A 3PO3J 3I4PA 4LIUA 1H0MA 4B8XA 3G3ZA 1JTXA 1DU6A 3ZMVA 1T98A 1XTAA 2VT2A 3BPXA 1XGNA 3QQAA 2MD5A 2HQRA 2DTRA 4LG0A 1RIOH 4ZYHA 4XK4A 4M72A 4Y13A 1ZG5A 1PUFB 1GXPA 4EJOA 4HF0A 4S05A 5BQTA 3G1MA 4V2GA 4CGZA 3RIRA 3BROA 3GFJA 1A36A 2NVXJ 4RB2C 4IX7A 4XKBA 1QPMA 2R5ZA 1ZGAA 3ZR8X 3M4OJ 2OJED 2QQ9A 3QPLA 3RSNA 1OR7A 2MD0A 1MMNA 2RGVA 3JREA 4NC6A 5FLXK 1I1SA 1EH7A 3NARA 5CPRB 2WA0A 2XF5A 2NS8A 1X19A 3E3VA 3NEUA 4XR6A 1J9IA 1LFBA 2GBYA 2OQGA 1YE9A 4I09A 2R4GA 3ZQCA 2CH0A 2XSJC 2Z9OA 2DMQA 2Q0OA 3TP3A 1TQPA 1BJZA 2R7UA 3PJRA 3MN2A 2MLGA 1R5GA 2EIKH 3HBLA 3ABMH 3CCQI 5A2QK 1BOAA 4A0ZA 4RGXA 2CUEA 4UV9A 4GYGA 2EZLA 1SD6A 2NVQJ 2PJRB 2IGMA 2W57A 3PSIA 4LG3A 4HX7A 3UR3C 4XKCA 2K85A 4HNVA 3OYHA 4LK0F 3JSOA 2X4HA 1TTYA 1E3PA 4LIVA 5F04A 2E60A 3AG2H 1MBHA 5FJ8J 2IRFG 2K9LA 2CFXA 5J1YA 1WVRA 3SZGA 3BPVA 2QLZA 1P7JA 2BY1A 3J7AY 3KP4A 2VOOA 3S3OA 1G3SA 2BW3B 3DV8A 3P9CA 2BHZA 2OC6A 3SYTA 3PIPF 3TOAA 3LAPA 2MG4A 3KLNA 1XSVA 5D4RA 3HOWJ 3BT9A 3ZQHA 3JW4A 3HGGA 2XB5A 5D5VB 3HTUA 1VQPI 2QVOA 4BJTA 3ONQA 1FEXA 4ZTJA 3PUBA 3DKXA 1JUMA 5FFXA 1OCOH 1G3WA 5DS9A 4ZYDA 1MNMC 3BR0A 1W5SA 2HYJA 2K02A 1E3HA 4A0YA 1DGRM 5KAFC 2E2HJ 2DMNA 5B66C 1X58A 3GFMA 2D45A 4EATA 4ZYEA 1VQ4I 3VSLA 5A2QZ 2NAZA 1UJ8A 1WKMA 2X9DA 3L00A 1B8IA 4AIKA 4EGZA 4E7KA 4XKVA 1KQ0A 2Y9YA 1T56A 4A3MJ 5KVRA 3MMYB 3CCSI 2XASA 2K9NA 2VBZA 2XIGA 2YX4A 2F6CA 2PN6A 4B48A 2M7AA 5E17F 5BPIA 2R5YA 3TQNA 4N9HA 2OUMA 2QM3A 1PUEE 1ZHFA 4HDVA 2TDXA 3HOXJ 2CGPA 2CV0A 3WG7H 2GLOA 2FA5A 4W1UA 3K69A 1IRFA 2XAJA 1HBXG 1OCCH 1SFUA 1YITI 2UV1A 2QSGX 4BE1A 5DTDA 3N05A 2BOLA 2GZWA 1RR7A 3KP3A 1MBJA 1IV6A 4HBLA 1FSEA 2GQQA 5JLWA 4I98B 1VI0A 3I9V2 2JK3A 2AO9A 1Z21A 1FJLA 2BZTA 4M3BA 1PP7U 2NVYJ 2X1EA 3B73A 3TO7A 4JYKA 2JQ7A 3T8RA 2A5WA 2XGXA 3D5LA 1YW8A 2V6EA 1FT9A 5L3DA 4ASNA 4BU2A 2O7OA 5J1UA 2XRLA 2Q2EA 1E3OC 1P92A 3K0LA 6PAXA 2M87A 3L2RA 3OIPA 2HTSA 3U9GA 1D8JA 2ZXJA 3L2CA 3OYKA 5F1RA 3Q5FA 1LE8A 4EQQA 2GOMA 4B3XA 4G6DA 4RGRA 3S8PA 4A2UA 2J5OA 2W00A 4E7SA 3RKWA 3TO6A 1O4XA 3WTWC 1X1BA 2FBKA 1WJDA 1ZLJA 3H92A 3MVPA 3DPUA 4XLFA 5F0CA 2CV2A 1MH3A 2M34A 3LQRA 1LEAA 4LG0B 3PNVA 4ANJA 4ETSA 1AKHB 2XF6A 4N4NB 4RB0A 2KRHA 1XDSA 2NXNB 2OZUA 4GRIA 4E70A 1Q1VA 1P4XA 3CZ6A 2HDCA 3ECHA 1S8NA 2M4KA 3HKZN 5DUIA 4PJJA 3Q9VA 3S1QJ 1FZPB 1POGA 2OAZA 3K9TA 4CO8A 3HG9A 4DJAA 1MBGA 2F5DA 2IP2A 3DBLB 4A3GJ 1ZARA 3LSRA 3FISA 3KYCB 3GF2A 1T08B 5JFRA 4C2UA 5L3EA 5F27A 5HLIA 4XLHA 3AFHA 2PFBA 3UNGC 1QHGA 2IJLA 2GOXB 3IAM2 2GXBA 4M3DA 1FP1D 4XNFA 3FBNB 3S16J 3LA3A 2VQHA 4MTEA 4WXHA 4IOCF 2FX0A 1CQTA 2BEOA 1IAWA 3HJEA 2ZMEB 3V7SA 4A6EA 3OY9A 2KFDA 2LC2A 3ZN1A 1GLNA 3L9FA 3CCJI 4C2TA 1OR7C 3P7NA 5E79C 5FROA 3QP6A 3QYEA 3G6EI 4A3IJ 2CG4A 3BP8A 3A1YA 3BG3A 4CYDA 1OCZH 3JRCA 2HVQA 3LOCA 2H8RA 3IWFA 1WWXA 3BR6A 2GA1A 3QWLA 4QWQA 3OYFA 1HSTA 1XCVA 3F23A 1U2WA 1WHUA 2PBIA 1IN5A 2RDPA 2B9SA 5C44J 2RC4A 3B6AA 1LB2A 5E3LA 1XS9A 2DA3A 1JXSA 2CW7A 5JLXA 3RJPA 3EDPA 2KIUA 1Y0NA 4OAZA 5CVIA 2EJRA 3GTQJ 4KN7X 3E7LA 2VE9A 4KIFA 2ICWG 1B72B 2A69F 2JN6A 1OMIA 5CVRA 3GTOJ 3GX4X 3GTJJ 5FKKA 4AU7A 1TWFJ 3U1KA 4JBAA 3I3LA 4Q4ZF 2XAGA 2NS0A 2JA8J 1R1UA 4XRSG 4XOTA 1Y1VJ 3FXOA 1B8IB 4CH7A 2DW4A 3BG5A 1SAUA 3ZMSA 2M8GX 4ENKA 2VOPA 1K4TA 3GLXA 4B1RA 2DO7A 3J7YJ 3GTMJ 1DQUA 1IV8A 3WU1B 4B43A 3KZYA 1HW2A 4XOPA 4F3QA 1ZELA 4KDPA 4CA0A 5ICGA 4BE2A 2R5YB 4M3FA 2E1OA 3BCAA 1YOVB 1Z9CA 1BC8C 5BPDA 1A6QA 4CXFA 4AC0A 3CC7I 2J5PA 3OYMA 2KDOA 1RI7A 5HVQC 2COBA 3I58A 3K2ZA 3PO2J 2Z33A 2VC1A 1UFMA 4MQ9F 4CCJA 4LK1F 1ZRCA 1NTCA 2X6WA 1OYWA 4IHSA 4HRIA 3K1PA 3G1OA 2FBHA 5K7FA 3CCVI 3OS0A 4HDUA 2DMPA 2XPUA 3BG6A 1IG7A 4G6QA 1Z05A 1GVJA 4RLFA 2KIMA 3VEPA 4AVPA 2C6YA 4XSZF 4KMFA 1BIAA 2ZCWA 2QQ8A 3K4NA 1QGPA 2R7FA 3FHZA 3IL2A 5KK1A 2AHQA 2EZHA 5TRDA 4B09A 2QBYB 3DEWA 1QU3A 5KNLA 1LE8B 2MSYA 1GDTA 2R7RA 3W3CA 3GEZA 5AONA 2HU9A 3E1SA 5C3EJ 1TQMA 2EFOA 4AD9A 4HNUA 2V9VA 3ASOH 3FXJA 4R1HA 4RLQA 2DT5A 3E6DA 3BZCA 2L01A 2A3SA 4AIDA 3S93A 4XKWA 4LD5A 4FX0A 5C4JJ 2CQXA 3IRQA 2L7MP 2V4JC 3GTKJ 1ERDA 1OISA 3HHHA 2KHMA 1W5TA 2XPWA 3O3KA 4WCGA 1JKRC 5IYDJ 2YR2A 1IXSB 5DV5A 4YEJA 1LKXA 1TBXA 5GPAA 2M30A 3HC7A 4IVNA 3EUHC 1P4WA 2I5UA 1IN8A 1ETYA 1MMGA 2HXOA 4MIMA 3Q0WA 3VYRB 3BY6A 3CDIA 1XCBA 5ILUA 4KUMA 4OIPF 4PUSA 1KONA 1Z3YA 2F2EA 1O3TA 4M9SA 2FSWA 3M8FA 1PUFA 3H3ZA 1FIAA 1D1CA 1IDYA 3PNYA 3IUOA 2BXYA 1R1VA 3JTGA 1ACIA 2IGOA 1U9OA 2L7ZA 3PUFA 2W24A 4CICA 4XIDA 3L2UA 2P6TA 3RCOA 4Q5SF 4QPOA 1SD4A 2E34A 2Z99A 5B3SH 4P9FA 1ETOA 1X4OA 2MBFA 2NNYA 1G3TA 4P9UA 2HNHA 1DGWY 3CC2I 3Q0UA 1WH7A 4CZZA 2KZVA 3RYPA 5HS8A 3J81K 1K78A 1WGXA 5GPCA 2ETHA 3BCBA 4XLPF 3LL7A 5M5YJ 2R7WA 3O8HA 4UXNA 3TMOA 2F48A 4BS9A 1FOYA 3MKZA 1V5EA 1TQIA 2ZXHA 5D6FA 3S17J 2KMUA 3CJRB 3ZQQA 1I39A 1AWCA 2VXZA 2GM4A 5C4XJ 1VQ8I 4UV8A 2Z3YA 3SHFA 2F4OB 4HYEA 2CQ7A 3ZQFA 4BQOA 2XRNA 2D1HA 2LYCA 1D8KA 1HKQA 2E35A 4ZDOA 2NOGA 3PL8A 3X2QH 2DLLA 1MJBA 4RAGA 3CUOA 4ESJA 1RETA 4A3CJ 2KLOA 3LAJA 4FTHA 2DT6A 4CCNA 2BW3A 3S2DJ 1X2MA 4JX4A 4U0YA 2ZNZA 1YTYA 1XDUA 3AG3H 4BQAA 1MD0A 2LOOA 2KJCA 3DWLE 2VXDA 2QSHX 4HPQA 4XORA 1J75A 3J7AO 1ZK8A 3LFKA 3H0GJ 2N8GA 4PJNA 5LHHA 5HLHA 2ZJ2A 2P7VB 1A5JA 2CW8A 2DA1A 3KYDB 2JT1A 1OLTA 2HPIA 2KIQA 5J6XA 1ZRDA 4OAYA 5DD4A 2DFFA 3DKYA 3OL3A 2KT0A 1BOBA 5LLQA 2Y31A 2DFHA 2E7WA 3SJMA 1YLFA 3AL0B 2M2EA 5L3FA 5E1ZB 1K6YA 5IOYA 2PQ8A 1VTNC 2FJ1A 2LREA 1EA3A 1HA8A 3JSPA 2E1MB 2HOAA 3K1NA 4OOIA 1AA7A 4NB5A 4UVCA 2FOWA 2DA7A 2VT3A 1QVUA 3S2WA 3K7AJ 2ELHA 4NQWA 3OS2A 3L2WA 5B1BH 4D5CA 3HRSA 2DJNA 1E17A 2VJJA 1UB9A 4DYRA 2IGNA 5KHDA 1N78A 3U2RA 1JT0A 4EGYA 1B9MA 5HLTA 1XGSA 2ECBA 2M0CA 2OTLI 2MC4A 2L7KA 3ML6A 4PDKA 2Y9ZA 4KMUX 1FMWA 2OPTA 3AL0C 5CVJA 3S14J 4G94A 3RI4A 2ZNYA 4O5VA 1ULYA 4IHTA 2A61A 1JGGA 5M3MJ 4HX4A 3GFLA 1RC9A 1QO0D 1OQYA 3FWEA 2VBXA 1RNLA 1XD7A 4L5JA 2BGCA 5D4SA 2ACJA 3K4KA 4MGRA 4YFKF 2XHKA 5GAHJ 2EFWA 4CZCA 1V3FA 3FDYA 2DTZA 3OIOA 3JRGA 1R6RA 4P96A 4BGDA 3QPHA 1ON2A 3R0JA 4EEFG 1UZCA 2Y48A 1DDNA 4IL6C 3KLOA 2WB1A 4A12A 3V8KA 1ZRFA 1BM9A 3ISPA 3WODF 1ZR4A 3HOUJ 2NYXA 5FO5A 1VQLI 1XG1A 2HWVA 2L9RA 1P2FA 2DODA 5GAEJ 2GWRA 4Y17A 2CMPA 1XPXA 4E4HA 3FHNA 2FBIA 4QPQA 3BDDA 2FXAA 4F92B 4CHUA 1AKHA 3LFUA 3GCMA 3HSRA 4A3DJ 2VC0A 3BTIA 4OIQF 1BN5A 2LY1A 1Y39A 4XRFA 1YI2I 1V5FA 1HXDA 4QLCU 4D7MA 1NG7A 2K5CA 1YS7A 3K4MA 5AIQA 1F43A 3DKWA 3HRTA 5BOXA 3GZ5A 3A03A 1S5LC 3DXJF 3OIQA 1K78B 3HHGA 1MJAA 4IRHA 3WTTC 1HDPA 1Z7UA 1YS6A 2BHYA 4JP0A 3C2GA 1G59A 1BR1A 3FMSA 3BLYA 2JJ7A 3ZOBA 2H27A 2M0MA 3TDZC 3JRDA 1REPC 2EV5A 4YRVA 1R22A 3KCCA 4M74A 1OCPA 4XLAA 5H2FC 1P9QC 5GTIC 2F4MB 1JE8A 3J80Z 1ODDA 2ZMEA 4LLLA 1T95A 1BIBA 3C1DA 3A01A 4UB6C 4D1QA 4CCLA 4GXOA 2KPMA 2E7XA 3FXMA 1TT5B 2R93J 4HLXA 2EFPA 3LSTA 1IRZA 4JX6A 4YFXF 1VZ0A 2IVMA 4BXXJ 1K79A 4J00A 1DP7P 1IN4A 2W25A 3K4BA 2H6BA 2DOEA 2E5ZA 3LA7A 2QCOA 3E6MA 3I53A 2XGDA 4G6TB 1G4DA 3WTXC 2VUMJ 1NG6A 1QZZA 3WGGA 3A0BC 3IP4B 3JRIA 3TGNA 4CCKA 1FY7A 1FBUA 1GXQA 2WAQN 4Q47A 5M3FJ 4LB6B 4DOZA 1MSFC 2VPLA 2FOKA 5CJ9A 4UHTA 4OWRB 3WHBA 2DA2A 4G7HF 2JPBA 4BJ6C 2DOAA 2M3AA 1VQ7I 3OYIA 3QU3A 2X6OA 3OYNA 1B72A 4FE7A 3V42A 3WU0A 3FX3A 2CUFA 2YU3A 4M9ZA 1O57A 3OMYA 2G0EA 3WTYC 1N77A 3PQJA 2R7ZJ 3I59A 1XSXA 2AQEA 3SDGA 1GHCA 4H0EA 1VQKI 3S15J 3E5UA 3BZKA 2KP6A 4QSHA 1YFHA 4X6AJ 2FMLA 1F4KA 2HOTA 2K9QA 2OF7A 1USSA 1XN7A 2F5FA 2XUBA 4BEHA 4NBQA 2I8DA 4AVZA 3H9JA 1ETXA 3HPHA 4MTDA 5ICFA 1RRJA 4IHXA 4NQWB 4C3HJ 3I4NJ 5L3CA 1DP3A 2H94A 1ZREA 1S7EA 3EQLF 3H9GA 1BR2A 2VKHA 3CO6C 3CMAI 1R23A 4IF4A 1CF7A 2DMUA 2MLKA 3Q0VA 2FNAA 3GBGA 3Q9SA 3KETA 3ELKA 3LA2A 2VJIA 1SMTA 1FIPA 2ELKA 2X48A 5F0FA 4N9IA 3FIWA 4Y52J 1FPQA 2EILH 4WWCA 3MZHA 3UKGA 4KFCA 1QQIA 1MBKA 2ZFWA 4IQJA 4MEYF 1R36A 3CCUI 1NHAA 1Z91A 2L02A 3CJTB 4XLCA 1F36A 1R4MB 1A35A 3R60A 1W0TA 3HIFA 1X3UA 5JVGF 1HF0A 4PSXA 2L54A 1AOYA 3GTLJ 1JKPC 2HOSA 2G7UA 1I3AA 5K7HA 3F8BA 3DCFA 1H8AC 3W6VA 5IT9K 2GIZA 2QBYA 5FLVA 4S0HB 2M4GA 3CDLA 3V8LA 3OYDA 3H0DA 1KU9A 4UNOA 3LSGA 4V19K 1WJAA 2RNGA 3FXKA 1UHSA 4MO7A 4RGUA 2JA2A 1PJRA 3ZCOA 3KZZA 2W82A 3PFIA 4A3JJ 1J7KA 1KA8A 1R4NB 2M7BA 2DA6A 3VYUB 2DN0A 3H5RA 4ENJA 4BQQA 4GGGA 4IPAA 1W5CC 2V9PA 2FEZA 2YPRA 5EGOB 4BDZA 4A3KJ 1HW1A 4IO9F 3OS1A 1ZG3A 4KN4X 3FKJA 4NUBA 4EM0B 1D0XA 4Y33A 1H9TA 1XB4A 3JCUC 2E36A 2MABA 3W6KB 4E7IA 1EKEA 3B6CA 3T0YA 4HF2A 4CCOA 3OYBA 5ED4A 2EFQA 3HKZA 1R5ID 2ID3A 2VJ4A 3CLQA 2LY2A 1K7AA 4C9YA 4F93B 3FZVA 2COMA 2EQRA 5CLSA 2O8KA 3DEUA 1TP4A 2JZYA 4PJ0C 5L3GA 1F5TA 3F8NA 2PMZN 3ABUA 3LSKA 2R0QC 3H36A 2PMHA 5IT9Z 1EV7A 3BJAA 1VQ5I 1NK3P 4GCVA 1IC8A 5HNHA 3KYLA 2PG4A 4NC7A 3G73A 3FXRA 4HG2A 1MKMA 1P6RA 1UG2A 3DQVC 1TNTA 5M5XJ 3C2BA 3VDXA 1I50J 4JQFA 3ZQ7A 3CJNA 3F6VA 2WAFA 1Z6TA 4RA2A 4WF2A 4BBRJ 4YFNF 9ANTA 5HS7A 4ZH4F 3ZRGA 1OFCX 1APLC 3HSEA 3CCMI 4KYWA 5D5UB 1B59A 3A01B 2BY2A 1E2XA 1R49A 2P7CB 4Y7NJ 3DPLC 2BVMA 4RM2A 2LFBA 5D6EA 3COAC 3ASNH 3WGHA 5HNFA 3OOPA 2NVTJ 1K83J 2XAHA 5ERIA 2DJIA 1D5VA 2B0LA 3FK6A 2VQCA 5H6RA 1ZQ3P 3H35A 3QODA 3VB2A 4NNJA 3GTGJ 2HPMA 3S1NJ 4EVIA 1YG2A 1U5TB 2FE3A 2YUSA 2NVUB 4RAYA 3HXLA 3C18A 3F22A 1BI2A 3O8GA 1WQ2A 1SFXA 4OMYA 1YQAA 3IKVA 1V4RA 3HEFA 3M1CA 4PJMA 4R8HA 2G9WA 2MGQA 1S6LA 1SVLA 4JK1X 4LITA 4D7NA 4MLOA 2ZMEC 2X1CA 4BXFA 3LWFA 2QSFX 5D8KB 1IF1A 2XROA 1T2KA 1SD5A 3M9AA 2ELJA 3K70C 1YYVA 2CUZA 1E0EA 4ZYAA 1FOKA 4OINF 2OU2A 4XM3A 3ZQLA 1IRGA 5LRSA 2HDWA 2EFNA 1MNDA 4ZJZA 2HQNA 3I59B 1PVEA 2PX9A 4BDYA 1Z67A 3T8TA 5EF6A 3IC7A 3HTSB 1FOXA 4LMYA 3HM5A 3RZOJ 5FRNA 2VONA 3CQZJ 1IZ1A 2KIFA 3ZN0A 1VQ6I 1ZH5A 3FXUA 4RAZA 5D8LB 4BEHB 2O03A 4K2EA 4II3A 1DUXC 1JUPA 2LDUA 2IS2A 3GYHX 2DA4A 1MIJA 2P8TA 2MFZA 1TWAJ 2P0WA 1WJFA 1TC3C 3H5NA 4UY8I 2L9SA 5L3BA 3F0CA 4GDFA 1CF7B 3ECOA 5CVVA 4AYBN 5FB2A 3F9KA 5D5XB 2QENA 4AYBA 1MZBA 5E3OA 5K1YA 1HLVA 4M6VA 4F91B 2KZGA 3CF5F 2EK5A 1D0YA 5CYVA 3QU6A 4G12A 1W7PA 3JR9A 2EV6A 3S2HJ 2TCTA 2LMDA 5LHIA 2XGEA 2VKDA 4A69C 2A6HF 2CS3A 2QGUA 1ZG1A 2HDDA 3D5SC 1TLHB 1N75A 1EJ9A 5TJJA 2Z16A 1D1AA 2WAEA 3BZ6A 1SEUA 3CLOA 3S1MJ 4V2FA 2WY7Q 1BI3A 2YSRA 1QPIA 2XVCA 3EYYA 2IS1A 1ZKGA 2W4SA 1QBJA 1I5ZA 5EG0B 5HODA 1O3RA 2IXSA 4O3MA 5IYCJ 2K40A 1IJWC 1Y56A 4FT8A 5H6QA 4G8XA 4HSTA 2HR3A 1ETWA 2K4JA 2OA4A 1S7AA 3J7ZI 2DDAA 1KYWA 1PP8F 4IHVA 1JT6A 1OKRA 5LEKA 3BR2A 1R1TA 1R7JA 1X3ZB 4ZYGA 2JUGA 2O8XA 2WADA 3K2AA 4FETA 1I27A 4B47A 1T39A 2CV1A 3TP0A 3R61A 2DPDA 2P81A 4AIJA 5LGTA 2E1CA 5F0HA 4IRIA 1RESA 4ZZLA 4L9JA 5DD8A 4XL9A 5IT3A 3WGIA 4OIOF 3OYGA 1IXRC 3WE2A 5K5OA 3GVAA 1SVMA 1U0JA 3CMYA 2R7OA 5CKTA 1S29A 1MBEA 4KITB 1FSHA 2YS9A 2STWA 1Y8QB 2AQFA 3BR5A 4BNCA 3G1LA 2R7XA 1J59A 2H8WA 1ETVA 1XMXA 2LF7A 2DA5A 3REOA 4CYCA 2JTVA 2X6YA 1WI3A 2AS5F 3CTAA 2Z5UA 4X1EA 3MAJA 1G6NA 4UVBA 5DUKA 3GZNB 2JUCA 3BJ6A 2X1DA 3LQQA 2E71A 1XGMA 2AXLA 2H09A 2OCEA 4PK4A 3KP2A 3SEZA 5IOZA 3V7CA 1B1BA 3DP7A 1D1BA 5K5QA 2V9KA 3CCRI 1W36C 1PDNC 3PNTA 3R0AA 3VYSB 2QYOA 5J47A 1JHHA 3QPTA 3N97A 1YX3A 3SDBA 4DYQA 3BR1A 4FQGA 3MWMA 2V79A 1ZGWA 3W6JB 4BKXA 2NRAC 2VASA 5LRRA 2XGCA 1LNWA 3K4CA 2Y0MA 3DTEA 4MHGA 3HSFA 3DLAA 3JTHA 5J3LA 2ZSHB 2WV0A 2ISZA 3CCEI 4A93J 4M6YA 5AIPA 4XBFA 1J09A 2XC7A 2P4WA 2HKOA 2Y0SN 3SFZA 4P55A 3RKYA 1FBSA 3M8JA 2HKXA 4B44A 1EF4A 1C0WA 2UXNA 2WTEA 3A4CA 4HW0A 2ZJQF 1ZR2A 2O9LA 4OU0A 2ADUA 1FX7A 2HZTA 3HOVJ 4FE4A 1X2NA 2EA4A 2LKSA 4KISA 2MH2A 3CMMA 1P7IA 1ZAOA 3LSJA 2EZKA 4ZDLA 5KAIC 3PIOF 1I1GA 1YJ9I 1Z3XA 3GUDA 3NWTA 3OYEA 1B6AA 4KT5C 5DYMA 1TNSA 1ETKA 4ABZA 5E3MA 2A6TA 5HDGA 1T33A 4U88A 4DW6A 1YW7A 1G3YA 2HYGD 3CESA 1XGOA 2GA2A 2JA7J 4YG2F 4BL0B 3ROUA 4E7JA 2A05A 2DOFA 3HOYJ 2EIJH 2KKOA 1EH8A 2VKEA 1TT0A 2UUZA 2VBYA 3RPUA 3BG7A 2ZC2A 1YHQI 1YW9A 1JGSA 3D5RC 3ZMDA 4JOMA 1NH3A 3M3YJ 2NS7A 2A6EF 2R92J 4QTRA 2V7FA 3A2KA 3K70D 3OSFA 1BI0A 4ITVA 3EUAA 5IYBJ 1L0OC 2CWEA 1VQOI 1S9HA 1R58A 2V26A 3Q3SA 2VB6A 4I01A 5E8GA 3LNQA 4FX4A 4L0YB 1X1CA 2M45A 3BR3A 4P5OA 1W7PB 4GYIA 1VQNI 4L5IA 1LQ1A 4XLEA 2LRDA 3QOPA 4BUPA 2E5NA 1X1AA 2RKHA 1LDJA 4XSXF 4F52A 3P9KA 3SZTA 2M9HA 5E1XA 3ZXSA 2P5KA 3BG9A 4CCMA 2EA2A 1ZLKA 1U6GA 2HQ5A 2ZJPF 4L0ZB 3GXOA 1H88C 1S7OA 1OYYA 1K61A 3TO9A 2OBPA 2V1UA 1SFOJ 4AUXA 1Y1WJ 2QZ8A 2QKMB 4RGSA 1JI8A 2H6CA 4A3LJ 2HXIA 2E1MC 2IAIA 3VFZA 2X0LA 2E2JJ 2JRTA 4B4CA 2FRHA 2KDZA 4KJZA 1HC8A 2L0KA 3KP5A 4LB5A 2K3PA 1ZTRA 3CUQA 5FKNA 3QOEA 1R9TJ 2NNNA 4DNCA 1UAAA 1W1WE 1WJEA 4C3IJ 5J8CA 3DU6A 1KYZA 3HGYA 4E6KG 3V8JA 1LDDA 3U21A 3CF2A 1P4AA 3I64A 3OOUA 2ZKZA 1RZ4A 2FMYA 2GIVA 2K3FA 4I2OA 1G8XA 2DBBA 4IKFA 2EB7A 2BY0A 3J80K 3WG9A 2IW5A 2V6CA 4C3JJ 3RKQA 1F1ZA 2IA1A 5GTHC 3CP2A 3DLLF 2BYVE 3M7GA 2RN7A 2UZKA 3S3MA 3OL4A 4UUSA 2BE5F 2D2WA 4PGHA 3TW6A 4A5NA 5EGOA 1FYMA 3I0TA 1B4AA 4Y3OA 2ZBKA 1H89C 3BC8A 3JRAA 3MD2A 2KL4A 3ULQB 5LGNA 1HKTA 4MNUA 4YIRX 4BY7J 3NRVA 5EEHA 2LD5A 2HVSA 3I54A 1F9NA 3WU2C 3FKIJ 2KISA 3KIOA 5J4YA 3MKLA 4CYCB 4BHCA 5F64A 4A6DA 3HDDA 4S04A 2IEKA 1USTA 1KQ8A 1M1EB 3FXLA 4A3BJ 2VODA 4ESBA 2QA4I 4PFPA 1U3EM 3GLLA 2ZXWH 4P1WA 1UELB 1MW7A 3H9QA 3K10A 2DFIA 1Y0UA 1Z0XA 1YO5C 2YU9J 1TWGJ 3FMQA 4L9VA 5DDGA 3RPQA 1LFPA 4XN0A 1YIJI 3NAUA 1LFUP 3FMRA 2E1NA 4M71A 1LJ9A 4GFBA 5F08A 1Z6RA 1GUUA 2HTJA 1MNEA 2KRCA 3D1NI 2BVLA 3NWSA 3ZP5A 2JVHA 3SQNA 3KPHA 3EYIA 3W2VA 2V1DA 3IH2A 2A5YB 2F5CA 2PMUA 1HDDC 3SXYA 1IUFA 1FTZA 1U5TA 4BYYA 2ESHA 4WX9A 1YJNI 4AM3A 1L3LA 2WC2A 2BY3A 3IV5A 5CQEA 5FRMA 5K5RA 2K9MA 2WAQA 2JSPA 2ZO4A 1IGNA 1OCTC 2Q1ZB 1UHWA 2EZIA 4XN3A 4A0XA 2VIXA 2LR8A 3MKYB 5E8IA 2EWNA 4D5FA 3H3VK 4MQVA 2MC3A 2EH3A 4RB1A 1LUJB 4A5MA 4J01A 5IP9J 1W36D 5E1WA 3KEYA 1T0FA 1XMAA 5EDNA 2IS4A 1J0RA 3ZQIA 2RQQA 1QA6A 4HOBA 4BH9A 5FLXZ 1J2XA 1MMDA 2CQQA 1TW2A 3JRHA 3FM3A 4RMNA 5EZHA 2M1BA 2QKLB 2MYSA 2JVGA 5FGMA 3MKWB 3VWBA 3I71A 4IHYA 2ZB9A 5D5WB 3IHUA 5B1AH 2HVRA 5BS6A 4ON0A 2M5WA 2X6XA 3TKYA 3RQIA 5ICEA 3E5QA 1XMKA 4HF1A 4G9YA 4I0AA 2OQRA 4IXAA 4F7ZA 1KGSA 3L2QA 3KFWX 4FISA 3RDIA 3BOQA 3P5JA 3OV8A 1SFKA 4R79A 4RDUA 2LBFA 2LKPA 2F5EA 4CSWA 1TW3A 2HOEA 2Z2SB 4ENMA 1X3WB 3RTRA 4X0GA 1MSEC 2LKXA 1TWHJ 2Y30A 1LVAA 2VL8A 2LSOA 1JKOC 1Y8RB 1MH4A 1ON1A 2XSDC 2XDVA 3LSIA 4HV5A 1FWZA 1BBYA 2FNPA 4XONA 2ME6A 3CCLI 4CDGA 3PSFA 1O7FA 2VQGA 4O6JA 2QEXI 3E5XA 4J19A 1QHHD 3GWZA 1JTYA 4BHPA 4BAYA 4F55A 3CUQB 4EJVA 3C2HA 2CFOA 3KE2A 1SAXA 5EZGA 2CSOA 2PI0A 2FUG2 1KU2A 1J5YA 4U0VA 2V1NA 5EG0A 1YIOA 4A3FJ 3OWTA 3G71I 1R71A 1BI1A 2B7EA 1LDKB 3GFIA 4IRGA 2F4IA 2RREA 2K27A 5J1RA 2IS6A 3B02A 4G7OF 2V1XA 3GTPJ 2H1KA 1ITYA 1MDMB 3L2VA 2WY8Q 3EUHA 1XSDA 1KU7A 4Y4RA 1A31A 1QRYA 4HX8A 2ESNA 2JSCA 1SD7A 4UUSB 2QUFA 3IRRA 2WBMA 5J40A 4D0PA 1WFXA 3BQYA 2ZSIB 1BL0A 1GV5A 1Y6IA 2CUJA 2P5VA 1WJBA 2VE8A 1IUYA 3KP6A 4LOCA 3DPTA 3F3XA 4NDLA 4UB8C 1K6OA 1OJLA 1WCMJ 3VSKA 4E7HA 4RS8A 2OCCH 2W84A 1V54H 3IAS2 2FF4A 3CUQC 2QQAA 4CUGA 4M3EA 2CQNA 4PZJA 1WJ5A 3FBIB 3QAHA 3F8FA 5E20A 2IPQX 4LLNA 2LTPA 5CQGA 3ESWB 3MEXA 4RBOA 2D1VA 5IY5H 2RQPA 1A6IA 5FKOA 2WWYA 1W7PD 4M3GA 3C7JA 2W1OA 4PJLA 2LK2A 4DZJA 1RUNA 5LEJA 1SANA 3MFKA 3CJQB 2IA2A 2R5ZB 2PMZA 3HOZJ 4KIGA 3JAMK 2B63J 1Z1DA 1FP2A 4I99C 3E97A 3P9IA 2XKPA 3IKTA 2EINH 2E2IJ 1D5YA 3VYTB 2XAUA 2XAFA 5LHGA 2FQ3A 1AHDP 3T1BA 5JVTA 3WTUC 3L1PA 4I76A 2H1LA 4DYCA 4FHTA 3QRFF 4HAMA 3ZGKA 1RKTA 5CVUA 5DM6F 4BHBA 2I10A 5EEGA 1U8BA 2LVSA 2PEXA 2HFHA 3MZYA 1HSJA 4UUTA 1LVKA 1S72I 1Z7LA 1X1PA 2DMTA 2VLAA 2VPRA 2DXIA 5IP7J 3TDUC 2EIMH 4G7ZF 3EUKL 1UCRA 4IHWA 5LBQA 1FLIA 1B9NA 1WRJA 1G2HA 2CW0F 2K7LA 1GT0C 1HQCA 1TWCJ 2LH9A 3OR1C 1FYKA 1ZGJA 4I02A 2BBYA 3TEDA 3W2AA 3D0SA 2EBIA 1RR8C 4HA8A 4EM1A 2R7QA 2XF7A 5E18F 1IRXA 4KIBA 2LF8A 2MA3A 4DIQA 1NK2P 3KX2A 3WTSC 3IH4A 3CD6I 1TZLA 1KQ9A 3QYFA 3N4MA 3ERMA 1ENHA 3C3WA 3QPSA 1W4MA 4LJZF 2QWWA 3ZMTA 3JAMZ 3O2PE 5ILSA 3EPZA 3S32A 3KP7A 3IH3A 4L9NA 1WSUA 1BW5A 4PGGA 3ABLH 4N4OB 1ETQA 3GO5A 2WV1A 4BY1J 1KU3A 3L7WA 2KRFA 1KZHA 3R6SA 3WTVC 3LSPA 3ZMUA 3H5AA 2CYYA 4MEXF 3HZJA 5DEQA 2DU9A 1U5TC 4HSRA 4PSWA 2CJJA 3VPRA 3CDHA 2X51A 2JMWA 3RZDJ 3F8CA 2P6SA 4A3EJ 2IGKA 1BW6A 4XQFA 2KJBA 4GO1A 2DFEA 5B5EC 3HL2A 1WPKA 2RV8A 4EJUA 4IOAF 3HUGA 4FASD 2DDBA 3V4GA 2O5RA 5JHUA 1SFEA 2UWMA 1STZA 4ZC3A 3TW7A 5K7ZA 1FNNA 1OPCA 3DEEA 1JUSA 5FD5A 4XMYA 1WH5A 3OR2C 3SFIA 2RVCA 3W2WA 3FF5A 3MCZA 5DCMA 2LBFB 2TRTA 4II2A 3DTIA 5F1JA 3CC4I 1IN7A 2P5LC 1T0FC 1MMSA 1OCRH 1YRNA 2LNBA 3RQ4A 3TL4X 5TGTA 2OTJI 2ISYA 3TBIA 4D9JA 2IBDA 2VI6A 1I3QJ 4DZPA 5JR3A 2KQRA 3GZ6A 1U9NA 1HW5A 5BMZA 2QF7A 1Z77A 4YELA 5FKLA 4C30A 1O7LA 1ZN2A 4RAFA 2AXTC 3DBRB 2W48A 3A02A 1T8IA 3SZPA 3OYJA 1WZ2A 2ID6A 3V7RA 4AIHA 5J4VA 2FD5A 1V5GA 2OV7A 3F6OA 2DPUA 2JA6J 1FYLA 2PJPA 3F72A 2R7DA 4XLNF 2ZFUA 3FK7A 1S3JA 1GVDA 2O3FA 2HI3A 4WXDA 1XC5A 4WK8F 3AG1H 3BJOA 4N0BA 5JI6A 3I56I 1VQMI 1BC7C 1R5HA 3FM5A 4DBRA 2L5QA 4H4KC 1WJCA 1QZEA 4U7DA 4C2MJ 4LGWA 1U8RA 5FFZA 3PM1A 2OZ6A 5GAGJ 3G4SI 3VOEA 4Z6YA 4BACA 2Q2EB 1R00A 3ZQGA 1SC7A 3LSHA 2R7VA 4UUVA 3H1CA 3AG4H 3G2BA 4M9XA 3GMEA 2UXXA 3S3NA 3BTJA 4W97A 5FKMA 2CQKA 5DM7F 1RPWA 4OMZA 3I4MJ 2XPVA 3NQOA 5ILVA 1U78A 3DF8A 4BBSJ 2L9VA 3RPUD 1IO2A 4EM2A 3DU5A 1UMQA 1DPRA 1YJWI 4U87A 2F5VA 2K9SA 3KZIC 4HZFA 4EJTA 3DTKA 1FBQA 1TL8A 2ECCA 4EMSA 3OYAA 4ZDPA 4BJ5C 4AWXB 1FC3A 2DT7B 4IEJA 2R7TA 2VQLA 3QYBA 2CO5A 2JRMA 2BXZA 2VN2A 3GW2A 1VF9A 3HRMA 4I0BA 3RKXA 2LLKA 1BA5A 2W85A 4JX5A 2DCEA 3AAFA 2L7FP 3HOTA 1T38A 3ZMZA 1FMVA 1DPUA 1MBFA 2CRGA 4E7LA 3OSGA 1RUOA 1N25A 1WI9A 2XAQA 5F6FA 1D3YA 4KNYA 3F8MA 2L2OA 5GADJ 5FLMJ 4RB3C 2W7NA 4BXUA 4BE0A 4EV0A 3WE3A 1JJ8C 4L18B 2Y2ZA 5HS9A 4I7HA 4PFOA 5LFAA 2L3DA 2DYSH 4Z2YA 2GXAA 2K4BA 3M8EA 3ERED 2IA0A 1SMYF 1DU0A 4DQ2A 4XRMA 1JKQC 4E7ZA 2K86A 3DBHB 4HQMA 4MFEA 1HOMA 5LD2C 3MQ0A 2MW8A 1QVTA 5HDKA 5TISC 2ZJRF 2LP0A 3K4LA 2Q8KA 1MMAA 1MJ9A 4M73A 4IZZA 2O61A 3PFYA 4HEA2 4EJWA 1HCRA 5DCFA 3L09A 1V55H 4ZTFA 1IXCA 3H3UA 4YIFA 4IQ4A 5HDNA 5HOOA 3KEOA 4DBQA 4KT6A 1VQ9I 3HPGA 5JHFA 3OYCA 2RNJA 2M8EA 2O6GE 2EPFA 4IJAA 3IWZA 4FCYA 3T5XA 3HOSA 3ZPLA 1Q1HA 2DAOA 1W0UA 1HKSA 2FQ4A 5BNGA 1I6XA 3ABTA 2XV4S 4ZZDA 4OIRF 5J8FA 2ZXIA 3WTZA 2A07F 2HZDA 1BJAA 5LGUA 1JJ6C 2HQAA 2G7HA 3S1RJ 2Y0SA 2PJRA 4YIIA 3CO7C 5HLGA 4MFDA 2YX7A 1ONVA 3K6GA 2R7SA 1OYIA 2R3SA 4KA4A 3WHCA 4NHJA 1IN6A 1SVOA 4ESFA 2X85A 2STTA 1FOWA 1O3SA 1IW7F 1T6SA 3K1MA 1LEBA 3HUGB 2XB0X 2DQRA 2NOJB 2VKVA 1UG0A 3R4KA 4WXCA 2QQBA 1QZYA 3E6CC 3PQKA 3I5UA 5IPAA 3DFGA 3J81Z 1RKWA 4PCQA 5M5WJ 5DCMB 2Y75A 3ABKH 3HB9A 3EETA 3MZ8A 1YRNB 2DQLA 2A68F 2GXGA 1VNDA 5EYRA 2DK8A 4TV7A 2HS5A 2Y69H 3F21A 2LG4A 3BTCA 2DYRH 3E6BA 5ICCA 3E0JB 2HEOA 4Q48A 1EH6A 5EEAA 3KEQA 1VFCA 4XRSA 4B3AA 2MH9A 1ZYRF 1FTTA 3I55I 3TOBA 2ME0A 1MGTA 1X1DA 1D0ZA 2EV0A 1PYVA 2LY9A 2DK5A 5E3NA 5KCMA 2OD5A 4L5EA 2XKOA 4HQEA 2Z1DA 5IP6A 2D5VA 2O0YA 3FXQA 4DGWB 4UVAA 4LLGF 3LMMA 1A04A 3CP8A 1I6HJ 2PLYA 1GV2A 4L9TA 4I6ZA 1IDZA 2VJ5A 3JRBA 5GP9A 3AKZA 2BV6A 3A0HC 4BQNA 3O6BB 2VBWA 1JHFA 4Y15A 3BQZA 1O3QA 4M6XA 4LFUA 1QNTA 2JPCA 3JRFA 4HNTA 2JWTA 4RM3A 2HYFA 3M07A 3QP5A 2L9NA 3HYIA 2L4AA 5H20A 3RYRA 2RAEA 4HLYA 1AU7A 2IT0A 3HRUA 1UHMA 3BTLA 5FD6A 1MDMA 3CMEI 3VODA 4QIWN 4U0WA 2HGCA 3BWGA 1LPQA 3OYLA
chains in the Genus database with same CATH topology
2CU7A 1TWHJ 2Y30A 1WGXA 1JKOC 1MH4A 5GPCA 2XSDC 4XICA 5M5YJ 3O8HA 3ZQLA 2WB1N 3CCYA 1ORKA 2ME6A 3S17J 2JA5J 5EF6A 2E19A 3HM5A 3RZOJ 3PO3J 4J19A 1JTXA 1DU6A 3CQZJ 2GM4A 5C4XJ 1JTYA 3QQAA 4XK4A 1PUFB 3ZQFA 5EZGA 3G1MA 1JUPA 4V2GA 2DA4A 2NVXJ 5EG0A 4A3FJ 1TWAJ 2R5ZA 1TC3C 2NOGA 3M4OJ 3F0CA 5J1RA 3QPLA 3GTPJ 2H1KA 3JREA 1ITYA 4AYBN 1RETA 4A3CJ 1QRYA 4FTHA 3NARA 4UUSB 5E3OA 3S2DJ 2NS8A 1X2MA 4JX4A 3BQYA 4M6VA 1HLVA 1BL0A 1GV5A 4LOCA 1LFBA 4NDLA 2GBYA 1OJLA 1WCMJ 4G12A 3ZQCA 3JR9A 3S2HJ 2TCTA 2XGEA 4A69C 2DMQA 2HDDA 3TP3A 4M3EA 1ZK8A 3H0GJ 1BJZA 2N8GA 3MN2A 3HBLA 2DA1A 1A5JA 2LTPA 4RBOA 3S1MJ 4V2FA 1A6IA 5FKOA 2CUEA 1QPIA 2EZLA 2KT0A 4M3GA 1ZKGA 2LK2A 4DZJA 2NVQJ 2Y31A 5EG0B 1SANA 3SJMA 5HODA 2M2EA 2R5ZB 3HOZJ 2B63J 4HNVA 5IYCJ 2K40A 1IJWC 5IOYA 5F04A 5FJ8J 2FJ1A 1MBHA 2E2IJ 1D5YA 2HOAA 5J1YA 1AHDP 1P7JA 3L1PA 4I76A 4DYCA 1ETWA 2DA7A 1QVUA 1RKTA 3K7AJ 4IHVA 1JT6A 3BR2A 2I10A 4D5CA 1U8BA 2DJNA 2LVSA 2MG4A 3K2AA 3HOWJ 3BT9A 4UUTA 3ZQHA 4DYRA 3HGGA 2XB5A 3TP0A 1JT0A 2P81A 2DMTA 1FEXA 2VPRA 1JUMA 5IP7J 5F0HA 4IHWA 2ECBA 2M0CA 5DS9A 2Y9ZA 1RESA 1MNMC 3BR0A 2HYJA 1G2HA 2OPTA 1GT0C 1TWCJ 2E2HJ 3S14J 2DMNA 1JGGA 1X58A 5M3MJ 3CMYA 3TEDA 1MBEA 2YS9A 2X9DA 2EBIA 1B8IA 3BR5A 3G1LA 1NK2P 2Y9YA 1T56A 1ETVA 3IH4A 4A3MJ 2DA5A 1ENHA 3OIOA 2DTZA 3QPSA 4CYCA 3JRGA 2K9NA 1WI3A 3IH3A 2R5YA 4EEFG 1BW5A 1ETQA 4X1EA 2WV1A 3HOXJ 4BY1J 3LSPA 2GLOA 4W1UA 1ZR4A 3HOUJ 3VPRA 2CJJA 3RZDJ 2JMWA 5DTDA 1XG1A 2L9RA 4A3EJ 5IOZA 1BW6A 1RR7A 1MBJA 1WPKA 1IV6A 5JLWA 1VI0A 2JK3A 2AO9A 1AKHA 1FJLA 4M3BA 4A3DJ 2NVYJ 4JYKA 3BTIA 3TW7A 4DYQA 5K7ZA 3BR1A 1ZGWA 1JUSA 4BKXA 3SFIA 1WH5A 2XGCA 4D7MA 2TRTA 5J3LA 2O7OA 5J1UA 1F43A 5F1JA 2XRLA 1E3OC 4A93J 1YRNA 3A03A 2IBDA 2VI6A 2Y0SN 1LE8A 1I3QJ 4DZPA 1HDPA 4JP0A 1U9NA 2QF7A 1EF4A 1Z77A 1ZR2A 2O9LA 2JJ7A 3HOVJ 5FKLA 4FE4A 3ZOBA 1X2NA 1O4XA 2W48A 3JRDA 3A02A 1P7IA 3LSJA 2EZKA 2ID6A 2FD5A 1OCPA 3MVPA 2JA6J 5F0CA 1MH3A 2M34A 3FK7A 1GVDA 3A01A 1AKHB 1ETKA 2HI3A 1XC5A 4ABZA 5E3MA 1T33A 4DW6A 2R93J 2JA7J 1IRZA 1Q1VA 4JX6A 4C2MJ 3HOYJ 2VKEA 4BXXJ 3HKZN 3PM1A 3M3YJ 3S1QJ 2QCOA 3ZQGA 1POGA 2NS7A 2XGDA 2R92J 2VUMJ 4QTRA 3BTJA 4W97A 5FKMA 3JRIA 1MBGA 3OSFA 1RPWA 3I4MJ 5IYBJ 2XPVA 4A3GJ 2WAQN 3LSRA 1U78A 4BBSJ 1MSFC 5M3FJ 3FISA 3Q3SA 3LNQA 3WHBA 5F27A 1UMQA 2DA2A 3BR3A 2K9SA 4M3DA 2X6OA 1B72A 2ECCA 3S16J 4FE7A 1CQTA 2FX0A 2M9HA 2CUFA 3BG9A 4IEJA 2HQ5A 2G0EA 1H88C 1VF9A 1K61A 2R7ZJ 2LLKA 1SFOJ 1BA5A 3SDGA 4AUXA 1Y1WJ 4JX5A 4A3IJ 2L7FP 4A3LJ 3S15J 3BG3A 1MBFA 2CRGA 2HXIA 2IAIA 3JRCA 3OSGA 2E2JJ 3LOCA 2H8RA 4B4CA 4QSHA 2KDZA 4X6AJ 3BR6A 5FLMJ 2L0KA 2K9QA 2OF7A 2HOTA 1ZTRA 5FKNA 1R9TJ 1JJ8C 4C3IJ 2Y2ZA 1ETXA 3HGYA 4IHXA 5C44J 3B6AA 3OOUA 5E3LA 1XS9A 2DA3A 4C3HJ 3I4NJ 5JLXA 1DU0A 4XRMA 1JKQC 4MFEA 1HOMA 1S7EA 3GTQJ 2MW8A 1QVTA 4C3JJ 3E7LA 3RKQA 2LP0A 2DMUA 3Q0VA 3GBGA 1B72B 2JN6A 3GTOJ 1FIPA 2ELKA 2X48A 1HCRA 3GTJJ 5FKKA 4UUSA 5F0FA 3TW6A 1TWFJ 3FIWA 5EGOA 4Y52J 3UKGA 1H89C 1MBKA 3JRAA 2JA8J 4XRSG 1F36A 1Y1VJ 1W0TA 1B8IB 4BY7J 1HF0A 4FCYA 3GTLJ 1JKPC 2HOSA 2LD5A 1W0UA 3BG5A 5K7HA 2M8GX 3DCFA 2FQ4A 5BNGA 3FKIJ 4B1RA 1H8AC 3W6VA 3MKLA 3GTMJ 4CYCB 5FLVA 4S0HB 3CDLA 3HDDA 1JJ6C 2IEKA 3S1RJ 3LSGA 2R5YB 4M3FA 1UHSA 2E1OA 4A3BJ 4MO7A 4AC0A 4MFDA 4A3JJ 3WHCA 2COBA 3PO2J 1Z0XA 2DA6A 2DN0A 2YU9J 1TWGJ 1NTCA 2XB0X 5EGOB 4A3KJ 3G1OA 5K7FA 2VKVA 3NAUA 1LFUP 4GFBA 2DMPA 2XPUA 5F08A 1IG7A 5IPAA 1GUUA 3D1NI 1RKWA 3B6CA 5M5WJ 3IH2A 2ID3A 3HB9A 1YRNB 1HDDC 1VNDA 5EYRA 1IUFA 2AHQA 1FTZA 2EZHA 2EQRA 2O8KA 3DEWA 3BTCA 1LE8B 2MSYA 1GDTA 3IV5A 2PMZN 5C3EJ 2R0QC 5EEAA 1IGNA 1VFCA 4XRSA 1OCTC 4B3AA 2EZIA 1NK3P 1FTTA 2LR8A 1IC8A 2ME0A 4D5FA 3H3VK 1UG2A 2LY9A 2EH3A 5M5XJ 3C2BA 5E3NA 1I50J 4BBRJ 4L5EA 5IP9J 5C4JJ 9ANTA 2CQXA 2L7MP 5EDNA 3GTKJ 1OFCX 5IP6A 1APLC 2D5VA 3ZQIA 3A01B 2XPWA 5IYDJ 1JKRC 4Y7NJ 2LFBA 1I6HJ 2CQQA 1GV2A 4I6ZA 3JRHA 1IDZA 3JRBA 5GPAA 5GP9A 5EZHA 2NVTJ 1K83J 3BQZA 4IHYA 1ETYA 3FK6A 4MIMA 2HXOA 2ZB9A 1ZQ3P 3Q0WA 3GTGJ 3S1NJ 3JRFA 3RQIA 2YUSA 2JWTA 1PUFA 1FIAA 1IDYA 3O8GA 1U9OA 2L7ZA 4FISA 4XIDA 2RAEA 3HEFA 1AU7A 4RDUA 2MGQA 1ETOA 3BTLA 4D7NA 4MLOA 4QIWN 1MSEC 3Q0UA 2LKXA 1WH7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CU7 A;  1TWH J;  2Y30 A;  1WGX A;  1JKO C;  1MH4 A;  5GPC A;  2XSD C;  4XIC A;  5M5Y J;  3O8H A;  3ZQL A;  2WB1 N;  3CCY A;  1ORK A;  2ME6 A;  3S17 J;  2JA5 J;  5EF6 A;  2E19 A;  3HM5 A;  3RZO J;  3PO3 J;  4J19 A;  1JTX A;  1DU6 A;  3CQZ J;  2GM4 A;  5C4X J;  1JTY A;  3QQA A;  4XK4 A;  1PUF B;  3ZQF A;  5EZG A;  3G1M A;  1JUP A;  4V2G A;  2DA4 A;  2NVX J;  5EG0 A;  4A3F J;  1TWA J;  2R5Z A;  1TC3 C;  2NOG A;  3M4O J;  3F0C A;  5J1R A;  3QPL A;  3GTP J;  2H1K A;  3JRE A;  1ITY A;  4AYB N;  1RET A;  4A3C J;  1QRY A;  4FTH A;  3NAR A;  4UUS B;  5E3O A;  3S2D J;  2NS8 A;  1X2M A;  4JX4 A;  3BQY A;  4M6V A;  1HLV A;  1BL0 A;  1GV5 A;  4LOC A;  1LFB A;  4NDL A;  2GBY A;  1OJL A;  1WCM J;  4G12 A;  3ZQC A;  3JR9 A;  3S2H J;  2TCT A;  2XGE A;  4A69 C;  2DMQ A;  2HDD A;  3TP3 A;  4M3E A;  1ZK8 A;  3H0G J;  1BJZ A;  2N8G A;  3MN2 A;  3HBL A;  2DA1 A;  1A5J A;  2LTP A;  4RBO A;  3S1M J;  4V2F A;  1A6I A;  5FKO A;  2CUE A;  1QPI A;  2EZL A;  2KT0 A;  4M3G A;  1ZKG A;  2LK2 A;  4DZJ A;  2NVQ J;  2Y31 A;  5EG0 B;  1SAN A;  3SJM A;  5HOD A;  2M2E A;  2R5Z B;  3HOZ J;  2B63 J;  4HNV A;  5IYC J;  2K40 A;  1IJW C;  5IOY A;  5F04 A;  5FJ8 J;  2FJ1 A;  1MBH A;  2E2I J;  1D5Y A;  2HOA A;  5J1Y A;  1AHD P;  1P7J A;  3L1P A;  4I76 A;  4DYC A;  1ETW A;  2DA7 A;  1QVU A;  1RKT A;  3K7A J;  4IHV A;  1JT6 A;  3BR2 A;  2I10 A;  4D5C A;  1U8B A;  2DJN A;  2LVS A;  2MG4 A;  3K2A A;  3HOW J;  3BT9 A;  4UUT A;  3ZQH A;  4DYR A;  3HGG A;  2XB5 A;  3TP0 A;  1JT0 A;  2P81 A;  2DMT A;  1FEX A;  2VPR A;  1JUM A;  5IP7 J;  5F0H A;  4IHW A;  2ECB A;  2M0C A;  5DS9 A;  2Y9Z A;  1RES A;  1MNM C;  3BR0 A;  2HYJ A;  1G2H A;  2OPT A;  1GT0 C;  1TWC J;  2E2H J;  3S14 J;  2DMN A;  1JGG A;  1X58 A;  5M3M J;  3CMY A;  3TED A;  1MBE A;  2YS9 A;  2X9D A;  2EBI A;  1B8I A;  3BR5 A;  3G1L A;  1NK2 P;  2Y9Y A;  1T56 A;  1ETV A;  3IH4 A;  4A3M J;  2DA5 A;  1ENH A;  3OIO A;  2DTZ A;  3QPS A;  4CYC A;  3JRG A;  2K9N A;  1WI3 A;  3IH3 A;  2R5Y A;  4EEF G;  1BW5 A;  1ETQ A;  4X1E A;  2WV1 A;  3HOX J;  4BY1 J;  3LSP A;  2GLO A;  4W1U A;  1ZR4 A;  3HOU J;  3VPR A;  2CJJ A;  3RZD J;  2JMW A;  5DTD A;  1XG1 A;  2L9R A;  4A3E J;  5IOZ A;  1BW6 A;  1RR7 A;  1MBJ A;  1WPK A;  1IV6 A;  5JLW A;  1VI0 A;  2JK3 A;  2AO9 A;  1AKH A;  1FJL A;  4M3B A;  4A3D J;  2NVY J;  4JYK A;  3BTI A;  3TW7 A;  4DYQ A;  5K7Z A;  3BR1 A;  1ZGW A;  1JUS A;  4BKX A;  3SFI A;  1WH5 A;  2XGC A;  4D7M A;  2TRT A;  5J3L A;  2O7O A;  5J1U A;  1F43 A;  5F1J A;  2XRL A;  1E3O C;  4A93 J;  1YRN A;  3A03 A;  2IBD A;  2VI6 A;  2Y0S N;  1LE8 A;  1I3Q J;  4DZP A;  1HDP A;  4JP0 A;  1U9N A;  2QF7 A;  1EF4 A;  1Z77 A;  1ZR2 A;  2O9L A;  2JJ7 A;  3HOV J;  5FKL A;  4FE4 A;  3ZOB A;  1X2N A;  1O4X A;  2W48 A;  3JRD A;  3A02 A;  1P7I A;  3LSJ A;  2EZK A;  2ID6 A;  2FD5 A;  1OCP A;  3MVP A;  2JA6 J;  5F0C A;  1MH3 A;  2M34 A;  3FK7 A;  1GVD A;  3A01 A;  1AKH B;  1ETK A;  2HI3 A;  1XC5 A;  4ABZ A;  5E3M A;  1T33 A;  4DW6 A;  2R93 J;  2JA7 J;  1IRZ A;  1Q1V A;  4JX6 A;  4C2M J;  3HOY J;  2VKE A;  4BXX J;  3HKZ N;  3PM1 A;  3M3Y J;  3S1Q J;  2QCO A;  3ZQG A;  1POG A;  2NS7 A;  2XGD A;  2R92 J;  2VUM J;  4QTR A;  3BTJ A;  4W97 A;  5FKM A;  3JRI A;  1MBG A;  3OSF A;  1RPW A;  3I4M J;  5IYB J;  2XPV A;  4A3G J;  2WAQ N;  3LSR A;  1U78 A;  4BBS J;  1MSF C;  5M3F J;  3FIS A;  3Q3S A;  3LNQ A;  3WHB A;  5F27 A;  1UMQ A;  2DA2 A;  3BR3 A;  2K9S A;  4M3D A;  2X6O A;  1B72 A;  2ECC A;  3S16 J;  4FE7 A;  1CQT A;  2FX0 A;  2M9H A;  2CUF A;  3BG9 A;  4IEJ A;  2HQ5 A;  2G0E A;  1H88 C;  1VF9 A;  1K61 A;  2R7Z J;  2LLK A;  1SFO J;  1BA5 A;  3SDG A;  4AUX A;  1Y1W J;  4JX5 A;  4A3I J;  2L7F P;  4A3L J;  3S15 J;  3BG3 A;  1MBF A;  2CRG A;  2HXI A;  2IAI A;  3JRC A;  3OSG A;  2E2J J;  3LOC A;  2H8R A;  4B4C A;  4QSH A;  2KDZ A;  4X6A J;  3BR6 A;  5FLM J;  2L0K A;  2K9Q A;  2OF7 A;  2HOT A;  1ZTR A;  5FKN A;  1R9T J;  1JJ8 C;  4C3I J;  2Y2Z A;  1ETX A;  3HGY A;  4IHX A;  5C44 J;  3B6A A;  3OOU A;  5E3L A;  1XS9 A;  2DA3 A;  4C3H J;  3I4N J;  5JLX A;  1DU0 A;  4XRM A;  1JKQ C;  4MFE A;  1HOM A;  1S7E A;  3GTQ J;  2MW8 A;  1QVT A;  4C3J J;  3E7L A;  3RKQ A;  2LP0 A;  2DMU A;  3Q0V A;  3GBG A;  1B72 B;  2JN6 A;  3GTO J;  1FIP A;  2ELK A;  2X48 A;  1HCR A;  3GTJ J;  5FKK A;  4UUS A;  5F0F A;  3TW6 A;  1TWF J;  3FIW A;  5EGO A;  4Y52 J;  3UKG A;  1H89 C;  1MBK A;  3JRA A;  2JA8 J;  4XRS G;  1F36 A;  1Y1V J;  1W0T A;  1B8I B;  4BY7 J;  1HF0 A;  4FCY A;  3GTL J;  1JKP C;  2HOS A;  2LD5 A;  1W0U A;  3BG5 A;  5K7H A;  2M8G X;  3DCF A;  2FQ4 A;  5BNG A;  3FKI J;  4B1R A;  1H8A C;  3W6V A;  3MKL A;  3GTM J;  4CYC B;  5FLV A;  4S0H B;  3CDL A;  3HDD A;  1JJ6 C;  2IEK A;  3S1R J;  3LSG A;  2R5Y B;  4M3F A;  1UHS A;  2E1O A;  4A3B J;  4MO7 A;  4AC0 A;  4MFD A;  4A3J J;  3WHC A;  2COB A;  3PO2 J;  1Z0X A;  2DA6 A;  2DN0 A;  2YU9 J;  1TWG J;  1NTC A;  2XB0 X;  5EGO B;  4A3K J;  3G1O A;  5K7F A;  2VKV A;  3NAU A;  1LFU P;  4GFB A;  2DMP A;  2XPU A;  5F08 A;  1IG7 A;  5IPA A;  1GUU A;  3D1N I;  1RKW A;  3B6C A;  5M5W J;  3IH2 A;  2ID3 A;  3HB9 A;  1YRN B;  1HDD C;  1VND A;  5EYR A;  1IUF A;  2AHQ A;  1FTZ A;  2EZH A;  2EQR A;  2O8K A;  3DEW A;  3BTC A;  1LE8 B;  2MSY A;  1GDT A;  3IV5 A;  2PMZ N;  5C3E J;  2R0Q C;  5EEA A;  1IGN A;  1VFC A;  4XRS A;  1OCT C;  4B3A A;  2EZI A;  1NK3 P;  1FTT A;  2LR8 A;  1IC8 A;  2ME0 A;  4D5F A;  3H3V K;  1UG2 A;  2LY9 A;  2EH3 A;  5M5X J;  3C2B A;  5E3N A;  1I50 J;  4BBR J;  4L5E A;  5IP9 J;  5C4J J;  9ANT A;  2CQX A;  2L7M P;  5EDN A;  3GTK J;  1OFC X;  5IP6 A;  1APL C;  2D5V A;  3ZQI A;  3A01 B;  2XPW A;  5IYD J;  1JKR C;  4Y7N J;  2LFB A;  1I6H J;  2CQQ A;  1GV2 A;  4I6Z A;  3JRH A;  1IDZ A;  3JRB A;  5GPA A;  5GP9 A;  5EZH A;  2NVT J;  1K83 J;  3BQZ A;  4IHY A;  1ETY A;  3FK6 A;  4MIM A;  2HXO A;  2ZB9 A;  1ZQ3 P;  3Q0W A;  3GTG J;  3S1N J;  3JRF A;  3RQI A;  2YUS A;  2JWT A;  1PUF A;  1FIA A;  1IDY A;  3O8G A;  1U9O A;  2L7Z A;  4FIS A;  4XID A;  2RAE A;  3HEF A;  1AU7 A;  4RDU A;  2MGQ A;  1ETO A;  3BTL A;  4D7N A;  4MLO A;  4QIW N;  1MSE C;  3Q0U A;  2LKX A;  1WH7 A; 
#chains in the Genus database with same CATH topology
 1XX5 A;  2CU7 A;  1K4S A;  3U1D A;  2L4M A;  1H9G A;  1X4P A;  4KIC A;  2DI3 A;  4XIC A;  1BR4 A;  2WB1 N;  5EJC A;  4ENN A;  3SEQ A;  3CCY A;  3K4J A;  4HV6 A;  1ORK A;  4NC8 A;  2GAU A;  3LSM A;  3M1E A;  2FU4 A;  2JA5 J;  1CGP A;  4U7B A;  1YX5 A;  2E19 A;  3PO3 J;  3I4P A;  4LIU A;  1H0M A;  4B8X A;  3G3Z A;  1JTX A;  1DU6 A;  3ZMV A;  1T98 A;  1XTA A;  2VT2 A;  3BPX A;  1XGN A;  3QQA A;  2MD5 A;  2HQR A;  2DTR A;  4LG0 A;  1RIO H;  4ZYH A;  4XK4 A;  4M72 A;  4Y13 A;  1ZG5 A;  1PUF B;  1GXP A;  4EJO A;  4HF0 A;  4S05 A;  5BQT A;  3G1M A;  4V2G A;  4CGZ A;  3RIR A;  3BRO A;  3GFJ A;  1A36 A;  2NVX J;  4RB2 C;  4IX7 A;  4XKB A;  1QPM A;  2R5Z A;  1ZGA A;  3ZR8 X;  3M4O J;  2OJE D;  2QQ9 A;  3QPL A;  3RSN A;  1OR7 A;  2MD0 A;  1MMN A;  2RGV A;  3JRE A;  4NC6 A;  5FLX K;  1I1S A;  1EH7 A;  3NAR A;  5CPR B;  2WA0 A;  2XF5 A;  2NS8 A;  1X19 A;  3E3V A;  3NEU A;  4XR6 A;  1J9I A;  1LFB A;  2GBY A;  2OQG A;  1YE9 A;  4I09 A;  2R4G A;  3ZQC A;  2CH0 A;  2XSJ C;  2Z9O A;  2DMQ A;  2Q0O A;  3TP3 A;  1TQP A;  1BJZ A;  2R7U A;  3PJR A;  3MN2 A;  2MLG A;  1R5G A;  2EIK H;  3HBL A;  3ABM H;  3CCQ I;  5A2Q K;  1BOA A;  4A0Z A;  4RGX A;  2CUE A;  4UV9 A;  4GYG A;  2EZL A;  1SD6 A;  2NVQ J;  2PJR B;  2IGM A;  2W57 A;  3PSI A;  4LG3 A;  4HX7 A;  3UR3 C;  4XKC A;  2K85 A;  4HNV A;  3OYH A;  4LK0 F;  3JSO A;  2X4H A;  1TTY A;  1E3P A;  4LIV A;  5F04 A;  2E60 A;  3AG2 H;  1MBH A;  5FJ8 J;  2IRF G;  2K9L A;  2CFX A;  5J1Y A;  1WVR A;  3SZG A;  3BPV A;  2QLZ A;  1P7J A;  2BY1 A;  3J7A Y;  3KP4 A;  2VOO A;  3S3O A;  1G3S A;  2BW3 B;  3DV8 A;  3P9C A;  2BHZ A;  2OC6 A;  3SYT A;  3PIP F;  3TOA A;  3LAP A;  2MG4 A;  3KLN A;  1XSV A;  5D4R A;  3HOW J;  3BT9 A;  3ZQH A;  3JW4 A;  3HGG A;  2XB5 A;  5D5V B;  3HTU A;  1VQP I;  2QVO A;  4BJT A;  3ONQ A;  1FEX A;  4ZTJ A;  3PUB A;  3DKX A;  1JUM A;  5FFX A;  1OCO H;  1G3W A;  5DS9 A;  4ZYD A;  1MNM C;  3BR0 A;  1W5S A;  2HYJ A;  2K02 A;  1E3H A;  4A0Y A;  1DGR M;  5KAF C;  2E2H J;  2DMN A;  5B66 C;  1X58 A;  3GFM A;  2D45 A;  4EAT A;  4ZYE A;  1VQ4 I;  3VSL A;  5A2Q Z;  2NAZ A;  1UJ8 A;  1WKM A;  2X9D A;  3L00 A;  1B8I A;  4AIK A;  4EGZ A;  4E7K A;  4XKV A;  1KQ0 A;  2Y9Y A;  1T56 A;  4A3M J;  5KVR A;  3MMY B;  3CCS I;  2XAS A;  2K9N A;  2VBZ A;  2XIG A;  2YX4 A;  2F6C A;  2PN6 A;  4B48 A;  2M7A A;  5E17 F;  5BPI A;  2R5Y A;  3TQN A;  4N9H A;  2OUM A;  2QM3 A;  1PUE E;  1ZHF A;  4HDV A;  2TDX A;  3HOX J;  2CGP A;  2CV0 A;  3WG7 H;  2GLO A;  2FA5 A;  4W1U A;  3K69 A;  1IRF A;  2XAJ A;  1HBX G;  1OCC H;  1SFU A;  1YIT I;  2UV1 A;  2QSG X;  4BE1 A;  5DTD A;  3N05 A;  2BOL A;  2GZW A;  1RR7 A;  3KP3 A;  1MBJ A;  1IV6 A;  4HBL A;  1FSE A;  2GQQ A;  5JLW A;  4I98 B;  1VI0 A;  3I9V 2;  2JK3 A;  2AO9 A;  1Z21 A;  1FJL A;  2BZT A;  4M3B A;  1PP7 U;  2NVY J;  2X1E A;  3B73 A;  3TO7 A;  4JYK A;  2JQ7 A;  3T8R A;  2A5W A;  2XGX A;  3D5L A;  1YW8 A;  2V6E A;  1FT9 A;  5L3D A;  4ASN A;  4BU2 A;  2O7O A;  5J1U A;  2XRL A;  2Q2E A;  1E3O C;  1P92 A;  3K0L A;  6PAX A;  2M87 A;  3L2R A;  3OIP A;  2HTS A;  3U9G A;  1D8J A;  2ZXJ A;  3L2C A;  3OYK A;  5F1R A;  3Q5F A;  1LE8 A;  4EQQ A;  2GOM A;  4B3X A;  4G6D A;  4RGR A;  3S8P A;  4A2U A;  2J5O A;  2W00 A;  4E7S A;  3RKW A;  3TO6 A;  1O4X A;  3WTW C;  1X1B A;  2FBK A;  1WJD A;  1ZLJ A;  3H92 A;  3MVP A;  3DPU A;  4XLF A;  5F0C A;  2CV2 A;  1MH3 A;  2M34 A;  3LQR A;  1LEA A;  4LG0 B;  3PNV A;  4ANJ A;  4ETS A;  1AKH B;  2XF6 A;  4N4N B;  4RB0 A;  2KRH A;  1XDS A;  2NXN B;  2OZU A;  4GRI A;  4E70 A;  1Q1V A;  1P4X A;  3CZ6 A;  2HDC A;  3ECH A;  1S8N A;  2M4K A;  3HKZ N;  5DUI A;  4PJJ A;  3Q9V A;  3S1Q J;  1FZP B;  1POG A;  2OAZ A;  3K9T A;  4CO8 A;  3HG9 A;  4DJA A;  1MBG A;  2F5D A;  2IP2 A;  3DBL B;  4A3G J;  1ZAR A;  3LSR A;  3FIS A;  3KYC B;  3GF2 A;  1T08 B;  5JFR A;  4C2U A;  5L3E A;  5F27 A;  5HLI A;  4XLH A;  3AFH A;  2PFB A;  3UNG C;  1QHG A;  2IJL A;  2GOX B;  3IAM 2;  2GXB A;  4M3D A;  1FP1 D;  4XNF A;  3FBN B;  3S16 J;  3LA3 A;  2VQH A;  4MTE A;  4WXH A;  4IOC F;  2FX0 A;  1CQT A;  2BEO A;  1IAW A;  3HJE A;  2ZME B;  3V7S A;  4A6E A;  3OY9 A;  2KFD A;  2LC2 A;  3ZN1 A;  1GLN A;  3L9F A;  3CCJ I;  4C2T A;  1OR7 C;  3P7N A;  5E79 C;  5FRO A;  3QP6 A;  3QYE A;  3G6E I;  4A3I J;  2CG4 A;  3BP8 A;  3A1Y A;  3BG3 A;  4CYD A;  1OCZ H;  3JRC A;  2HVQ A;  3LOC A;  2H8R A;  3IWF A;  1WWX A;  3BR6 A;  2GA1 A;  3QWL A;  4QWQ A;  3OYF A;  1HST A;  1XCV A;  3F23 A;  1U2W A;  1WHU A;  2PBI A;  1IN5 A;  2RDP A;  2B9S A;  5C44 J;  2RC4 A;  3B6A A;  1LB2 A;  5E3L A;  1XS9 A;  2DA3 A;  1JXS A;  2CW7 A;  5JLX A;  3RJP A;  3EDP A;  2KIU A;  1Y0N A;  4OAZ A;  5CVI A;  2EJR A;  3GTQ J;  4KN7 X;  3E7L A;  2VE9 A;  4KIF A;  2ICW G;  1B72 B;  2A69 F;  2JN6 A;  1OMI A;  5CVR A;  3GTO J;  3GX4 X;  3GTJ J;  5FKK A;  4AU7 A;  1TWF J;  3U1K A;  4JBA A;  3I3L A;  4Q4Z F;  2XAG A;  2NS0 A;  2JA8 J;  1R1U A;  4XRS G;  4XOT A;  1Y1V J;  3FXO A;  1B8I B;  4CH7 A;  2DW4 A;  3BG5 A;  1SAU A;  3ZMS A;  2M8G X;  4ENK A;  2VOP A;  1K4T A;  3GLX A;  4B1R A;  2DO7 A;  3J7Y J;  3GTM J;  1DQU A;  1IV8 A;  3WU1 B;  4B43 A;  3KZY A;  1HW2 A;  4XOP A;  4F3Q A;  1ZEL A;  4KDP A;  4CA0 A;  5ICG A;  4BE2 A;  2R5Y B;  4M3F A;  2E1O A;  3BCA A;  1YOV B;  1Z9C A;  1BC8 C;  5BPD A;  1A6Q A;  4CXF A;  4AC0 A;  3CC7 I;  2J5P A;  3OYM A;  2KDO A;  1RI7 A;  5HVQ C;  2COB A;  3I58 A;  3K2Z A;  3PO2 J;  2Z33 A;  2VC1 A;  1UFM A;  4MQ9 F;  4CCJ A;  4LK1 F;  1ZRC A;  1NTC A;  2X6W A;  1OYW A;  4IHS A;  4HRI A;  3K1P A;  3G1O A;  2FBH A;  5K7F A;  3CCV I;  3OS0 A;  4HDU A;  2DMP A;  2XPU A;  3BG6 A;  1IG7 A;  4G6Q A;  1Z05 A;  1GVJ A;  4RLF A;  2KIM A;  3VEP A;  4AVP A;  2C6Y A;  4XSZ F;  4KMF A;  1BIA A;  2ZCW A;  2QQ8 A;  3K4N A;  1QGP A;  2R7F A;  3FHZ A;  3IL2 A;  5KK1 A;  2AHQ A;  2EZH A;  5TRD A;  4B09 A;  2QBY B;  3DEW A;  1QU3 A;  5KNL A;  1LE8 B;  2MSY A;  1GDT A;  2R7R A;  3W3C A;  3GEZ A;  5AON A;  2HU9 A;  3E1S A;  5C3E J;  1TQM A;  2EFO A;  4AD9 A;  4HNU A;  2V9V A;  3ASO H;  3FXJ A;  4R1H A;  4RLQ A;  2DT5 A;  3E6D A;  3BZC A;  2L01 A;  2A3S A;  4AID A;  3S93 A;  4XKW A;  4LD5 A;  4FX0 A;  5C4J J;  2CQX A;  3IRQ A;  2L7M P;  2V4J C;  3GTK J;  1ERD A;  1OIS A;  3HHH A;  2KHM A;  1W5T A;  2XPW A;  3O3K A;  4WCG A;  1JKR C;  5IYD J;  2YR2 A;  1IXS B;  5DV5 A;  4YEJ A;  1LKX A;  1TBX A;  5GPA A;  2M30 A;  3HC7 A;  4IVN A;  3EUH C;  1P4W A;  2I5U A;  1IN8 A;  1ETY A;  1MMG A;  2HXO A;  4MIM A;  3Q0W A;  3VYR B;  3BY6 A;  3CDI A;  1XCB A;  5ILU A;  4KUM A;  4OIP F;  4PUS A;  1KON A;  1Z3Y A;  2F2E A;  1O3T A;  4M9S A;  2FSW A;  3M8F A;  1PUF A;  3H3Z A;  1FIA A;  1D1C A;  1IDY A;  3PNY A;  3IUO A;  2BXY A;  1R1V A;  3JTG A;  1ACI A;  2IGO A;  1U9O A;  2L7Z A;  3PUF A;  2W24 A;  4CIC A;  4XID A;  3L2U A;  2P6T A;  3RCO A;  4Q5S F;  4QPO A;  1SD4 A;  2E34 A;  2Z99 A;  5B3S H;  4P9F A;  1ETO A;  1X4O A;  2MBF A;  2NNY A;  1G3T A;  4P9U A;  2HNH A;  1DGW Y;  3CC2 I;  3Q0U A;  1WH7 A;  4CZZ A;  2KZV A;  3RYP A;  5HS8 A;  3J81 K;  1K78 A;  1WGX A;  5GPC A;  2ETH A;  3BCB A;  4XLP F;  3LL7 A;  5M5Y J;  2R7W A;  3O8H A;  4UXN A;  3TMO A;  2F48 A;  4BS9 A;  1FOY A;  3MKZ A;  1V5E A;  1TQI A;  2ZXH A;  5D6F A;  3S17 J;  2KMU A;  3CJR B;  3ZQQ A;  1I39 A;  1AWC A;  2VXZ A;  2GM4 A;  5C4X J;  1VQ8 I;  4UV8 A;  2Z3Y A;  3SHF A;  2F4O B;  4HYE A;  2CQ7 A;  3ZQF A;  4BQO A;  2XRN A;  2D1H A;  2LYC A;  1D8K A;  1HKQ A;  2E35 A;  4ZDO A;  2NOG A;  3PL8 A;  3X2Q H;  2DLL A;  1MJB A;  4RAG A;  3CUO A;  4ESJ A;  1RET A;  4A3C J;  2KLO A;  3LAJ A;  4FTH A;  2DT6 A;  4CCN A;  2BW3 A;  3S2D J;  1X2M A;  4JX4 A;  4U0Y A;  2ZNZ A;  1YTY A;  1XDU A;  3AG3 H;  4BQA A;  1MD0 A;  2LOO A;  2KJC A;  3DWL E;  2VXD A;  2QSH X;  4HPQ A;  4XOR A;  1J75 A;  3J7A O;  1ZK8 A;  3LFK A;  3H0G J;  2N8G A;  4PJN A;  5LHH A;  5HLH A;  2ZJ2 A;  2P7V B;  1A5J A;  2CW8 A;  2DA1 A;  3KYD B;  2JT1 A;  1OLT A;  2HPI A;  2KIQ A;  5J6X A;  1ZRD A;  4OAY A;  5DD4 A;  2DFF A;  3DKY A;  3OL3 A;  2KT0 A;  1BOB A;  5LLQ A;  2Y31 A;  2DFH A;  2E7W A;  3SJM A;  1YLF A;  3AL0 B;  2M2E A;  5L3F A;  5E1Z B;  1K6Y A;  5IOY A;  2PQ8 A;  1VTN C;  2FJ1 A;  2LRE A;  1EA3 A;  1HA8 A;  3JSP A;  2E1M B;  2HOA A;  3K1N A;  4OOI A;  1AA7 A;  4NB5 A;  4UVC A;  2FOW A;  2DA7 A;  2VT3 A;  1QVU A;  3S2W A;  3K7A J;  2ELH A;  4NQW A;  3OS2 A;  3L2W A;  5B1B H;  4D5C A;  3HRS A;  2DJN A;  1E17 A;  2VJJ A;  1UB9 A;  4DYR A;  2IGN A;  5KHD A;  1N78 A;  3U2R A;  1JT0 A;  4EGY A;  1B9M A;  5HLT A;  1XGS A;  2ECB A;  2M0C A;  2OTL I;  2MC4 A;  2L7K A;  3ML6 A;  4PDK A;  2Y9Z A;  4KMU X;  1FMW A;  2OPT A;  3AL0 C;  5CVJ A;  3S14 J;  4G94 A;  3RI4 A;  2ZNY A;  4O5V A;  1ULY A;  4IHT A;  2A61 A;  1JGG A;  5M3M J;  4HX4 A;  3GFL A;  1RC9 A;  1QO0 D;  1OQY A;  3FWE A;  2VBX A;  1RNL A;  1XD7 A;  4L5J A;  2BGC A;  5D4S A;  2ACJ A;  3K4K A;  4MGR A;  4YFK F;  2XHK A;  5GAH J;  2EFW A;  4CZC A;  1V3F A;  3FDY A;  2DTZ A;  3OIO A;  3JRG A;  1R6R A;  4P96 A;  4BGD A;  3QPH A;  1ON2 A;  3R0J A;  4EEF G;  1UZC A;  2Y48 A;  1DDN A;  4IL6 C;  3KLO A;  2WB1 A;  4A12 A;  3V8K A;  1ZRF A;  1BM9 A;  3ISP A;  3WOD F;  1ZR4 A;  3HOU J;  2NYX A;  5FO5 A;  1VQL I;  1XG1 A;  2HWV A;  2L9R A;  1P2F A;  2DOD A;  5GAE J;  2GWR A;  4Y17 A;  2CMP A;  1XPX A;  4E4H A;  3FHN A;  2FBI A;  4QPQ A;  3BDD A;  2FXA A;  4F92 B;  4CHU A;  1AKH A;  3LFU A;  3GCM A;  3HSR A;  4A3D J;  2VC0 A;  3BTI A;  4OIQ F;  1BN5 A;  2LY1 A;  1Y39 A;  4XRF A;  1YI2 I;  1V5F A;  1HXD A;  4QLC U;  4D7M A;  1NG7 A;  2K5C A;  1YS7 A;  3K4M A;  5AIQ A;  1F43 A;  3DKW A;  3HRT A;  5BOX A;  3GZ5 A;  3A03 A;  1S5L C;  3DXJ F;  3OIQ A;  1K78 B;  3HHG A;  1MJA A;  4IRH A;  3WTT C;  1HDP A;  1Z7U A;  1YS6 A;  2BHY A;  4JP0 A;  3C2G A;  1G59 A;  1BR1 A;  3FMS A;  3BLY A;  2JJ7 A;  3ZOB A;  2H27 A;  2M0M A;  3TDZ C;  3JRD A;  1REP C;  2EV5 A;  4YRV A;  1R22 A;  3KCC A;  4M74 A;  1OCP A;  4XLA A;  5H2F C;  1P9Q C;  5GTI C;  2F4M B;  1JE8 A;  3J80 Z;  1ODD A;  2ZME A;  4LLL A;  1T95 A;  1BIB A;  3C1D A;  3A01 A;  4UB6 C;  4D1Q A;  4CCL A;  4GXO A;  2KPM A;  2E7X A;  3FXM A;  1TT5 B;  2R93 J;  4HLX A;  2EFP A;  3LST A;  1IRZ A;  4JX6 A;  4YFX F;  1VZ0 A;  2IVM A;  4BXX J;  1K79 A;  4J00 A;  1DP7 P;  1IN4 A;  2W25 A;  3K4B A;  2H6B A;  2DOE A;  2E5Z A;  3LA7 A;  2QCO A;  3E6M A;  3I53 A;  2XGD A;  4G6T B;  1G4D A;  3WTX C;  2VUM J;  1NG6 A;  1QZZ A;  3WGG A;  3A0B C;  3IP4 B;  3JRI A;  3TGN A;  4CCK A;  1FY7 A;  1FBU A;  1GXQ A;  2WAQ N;  4Q47 A;  5M3F J;  4LB6 B;  4DOZ A;  1MSF C;  2VPL A;  2FOK A;  5CJ9 A;  4UHT A;  4OWR B;  3WHB A;  2DA2 A;  4G7H F;  2JPB A;  4BJ6 C;  2DOA A;  2M3A A;  1VQ7 I;  3OYI A;  3QU3 A;  2X6O A;  3OYN A;  1B72 A;  4FE7 A;  3V42 A;  3WU0 A;  3FX3 A;  2CUF A;  2YU3 A;  4M9Z A;  1O57 A;  3OMY A;  2G0E A;  3WTY C;  1N77 A;  3PQJ A;  2R7Z J;  3I59 A;  1XSX A;  2AQE A;  3SDG A;  1GHC A;  4H0E A;  1VQK I;  3S15 J;  3E5U A;  3BZK A;  2KP6 A;  4QSH A;  1YFH A;  4X6A J;  2FML A;  1F4K A;  2HOT A;  2K9Q A;  2OF7 A;  1USS A;  1XN7 A;  2F5F A;  2XUB A;  4BEH A;  4NBQ A;  2I8D A;  4AVZ A;  3H9J A;  1ETX A;  3HPH A;  4MTD A;  5ICF A;  1RRJ A;  4IHX A;  4NQW B;  4C3H J;  3I4N J;  5L3C A;  1DP3 A;  2H94 A;  1ZRE A;  1S7E A;  3EQL F;  3H9G A;  1BR2 A;  2VKH A;  3CO6 C;  3CMA I;  1R23 A;  4IF4 A;  1CF7 A;  2DMU A;  2MLK A;  3Q0V A;  2FNA A;  3GBG A;  3Q9S A;  3KET A;  3ELK A;  3LA2 A;  2VJI A;  1SMT A;  1FIP A;  2ELK A;  2X48 A;  5F0F A;  4N9I A;  3FIW A;  4Y52 J;  1FPQ A;  2EIL H;  4WWC A;  3MZH A;  3UKG A;  4KFC A;  1QQI A;  1MBK A;  2ZFW A;  4IQJ A;  4MEY F;  1R36 A;  3CCU I;  1NHA A;  1Z91 A;  2L02 A;  3CJT B;  4XLC A;  1F36 A;  1R4M B;  1A35 A;  3R60 A;  1W0T A;  3HIF A;  1X3U A;  5JVG F;  1HF0 A;  4PSX A;  2L54 A;  1AOY A;  3GTL J;  1JKP C;  2HOS A;  2G7U A;  1I3A A;  5K7H A;  3F8B A;  3DCF A;  1H8A C;  3W6V A;  5IT9 K;  2GIZ A;  2QBY A;  5FLV A;  4S0H B;  2M4G A;  3CDL A;  3V8L A;  3OYD A;  3H0D A;  1KU9 A;  4UNO A;  3LSG A;  4V19 K;  1WJA A;  2RNG A;  3FXK A;  1UHS A;  4MO7 A;  4RGU A;  2JA2 A;  1PJR A;  3ZCO A;  3KZZ A;  2W82 A;  3PFI A;  4A3J J;  1J7K A;  1KA8 A;  1R4N B;  2M7B A;  2DA6 A;  3VYU B;  2DN0 A;  3H5R A;  4ENJ A;  4BQQ A;  4GGG A;  4IPA A;  1W5C C;  2V9P A;  2FEZ A;  2YPR A;  5EGO B;  4BDZ A;  4A3K J;  1HW1 A;  4IO9 F;  3OS1 A;  1ZG3 A;  4KN4 X;  3FKJ A;  4NUB A;  4EM0 B;  1D0X A;  4Y33 A;  1H9T A;  1XB4 A;  3JCU C;  2E36 A;  2MAB A;  3W6K B;  4E7I A;  1EKE A;  3B6C A;  3T0Y A;  4HF2 A;  4CCO A;  3OYB A;  5ED4 A;  2EFQ A;  3HKZ A;  1R5I D;  2ID3 A;  2VJ4 A;  3CLQ A;  2LY2 A;  1K7A A;  4C9Y A;  4F93 B;  3FZV A;  2COM A;  2EQR A;  5CLS A;  2O8K A;  3DEU A;  1TP4 A;  2JZY A;  4PJ0 C;  5L3G A;  1F5T A;  3F8N A;  2PMZ N;  3ABU A;  3LSK A;  2R0Q C;  3H36 A;  2PMH A;  5IT9 Z;  1EV7 A;  3BJA A;  1VQ5 I;  1NK3 P;  4GCV A;  1IC8 A;  5HNH A;  3KYL A;  2PG4 A;  4NC7 A;  3G73 A;  3FXR A;  4HG2 A;  1MKM A;  1P6R A;  1UG2 A;  3DQV C;  1TNT A;  5M5X J;  3C2B A;  3VDX A;  1I50 J;  4JQF A;  3ZQ7 A;  3CJN A;  3F6V A;  2WAF A;  1Z6T A;  4RA2 A;  4WF2 A;  4BBR J;  4YFN F;  9ANT A;  5HS7 A;  4ZH4 F;  3ZRG A;  1OFC X;  1APL C;  3HSE A;  3CCM I;  4KYW A;  5D5U B;  1B59 A;  3A01 B;  2BY2 A;  1E2X A;  1R49 A;  2P7C B;  4Y7N J;  3DPL C;  2BVM A;  4RM2 A;  2LFB A;  5D6E A;  3COA C;  3ASN H;  3WGH A;  5HNF A;  3OOP A;  2NVT J;  1K83 J;  2XAH A;  5ERI A;  2DJI A;  1D5V A;  2B0L A;  3FK6 A;  2VQC A;  5H6R A;  1ZQ3 P;  3H35 A;  3QOD A;  3VB2 A;  4NNJ A;  3GTG J;  2HPM A;  3S1N J;  4EVI A;  1YG2 A;  1U5T B;  2FE3 A;  2YUS A;  2NVU B;  4RAY A;  3HXL A;  3C18 A;  3F22 A;  1BI2 A;  3O8G A;  1WQ2 A;  1SFX A;  4OMY A;  1YQA A;  3IKV A;  1V4R A;  3HEF A;  3M1C A;  4PJM A;  4R8H A;  2G9W A;  2MGQ A;  1S6L A;  1SVL A;  4JK1 X;  4LIT A;  4D7N A;  4MLO A;  2ZME C;  2X1C A;  4BXF A;  3LWF A;  2QSF X;  5D8K B;  1IF1 A;  2XRO A;  1T2K A;  1SD5 A;  3M9A A;  2ELJ A;  3K70 C;  1YYV A;  2CUZ A;  1E0E A;  4ZYA A;  1FOK A;  4OIN F;  2OU2 A;  4XM3 A;  3ZQL A;  1IRG A;  5LRS A;  2HDW A;  2EFN A;  1MND A;  4ZJZ A;  2HQN A;  3I59 B;  1PVE A;  2PX9 A;  4BDY A;  1Z67 A;  3T8T A;  5EF6 A;  3IC7 A;  3HTS B;  1FOX A;  4LMY A;  3HM5 A;  3RZO J;  5FRN A;  2VON A;  3CQZ J;  1IZ1 A;  2KIF A;  3ZN0 A;  1VQ6 I;  1ZH5 A;  3FXU A;  4RAZ A;  5D8L B;  4BEH B;  2O03 A;  4K2E A;  4II3 A;  1DUX C;  1JUP A;  2LDU A;  2IS2 A;  3GYH X;  2DA4 A;  1MIJ A;  2P8T A;  2MFZ A;  1TWA J;  2P0W A;  1WJF A;  1TC3 C;  3H5N A;  4UY8 I;  2L9S A;  5L3B A;  3F0C A;  4GDF A;  1CF7 B;  3ECO A;  5CVV A;  4AYB N;  5FB2 A;  3F9K A;  5D5X B;  2QEN A;  4AYB A;  1MZB A;  5E3O A;  5K1Y A;  1HLV A;  4M6V A;  4F91 B;  2KZG A;  3CF5 F;  2EK5 A;  1D0Y A;  5CYV A;  3QU6 A;  4G12 A;  1W7P A;  3JR9 A;  2EV6 A;  3S2H J;  2TCT A;  2LMD A;  5LHI A;  2XGE A;  2VKD A;  4A69 C;  2A6H F;  2CS3 A;  2QGU A;  1ZG1 A;  2HDD A;  3D5S C;  1TLH B;  1N75 A;  1EJ9 A;  5TJJ A;  2Z16 A;  1D1A A;  2WAE A;  3BZ6 A;  1SEU A;  3CLO A;  3S1M J;  4V2F A;  2WY7 Q;  1BI3 A;  2YSR A;  1QPI A;  2XVC A;  3EYY A;  2IS1 A;  1ZKG A;  2W4S A;  1QBJ A;  1I5Z A;  5EG0 B;  5HOD A;  1O3R A;  2IXS A;  4O3M A;  5IYC J;  2K40 A;  1IJW C;  1Y56 A;  4FT8 A;  5H6Q A;  4G8X A;  4HST A;  2HR3 A;  1ETW A;  2K4J A;  2OA4 A;  1S7A A;  3J7Z I;  2DDA A;  1KYW A;  1PP8 F;  4IHV A;  1JT6 A;  1OKR A;  5LEK A;  3BR2 A;  1R1T A;  1R7J A;  1X3Z B;  4ZYG A;  2JUG A;  2O8X A;  2WAD A;  3K2A A;  4FET A;  1I27 A;  4B47 A;  1T39 A;  2CV1 A;  3TP0 A;  3R61 A;  2DPD A;  2P81 A;  4AIJ A;  5LGT A;  2E1C A;  5F0H A;  4IRI A;  1RES A;  4ZZL A;  4L9J A;  5DD8 A;  4XL9 A;  5IT3 A;  3WGI A;  4OIO F;  3OYG A;  1IXR C;  3WE2 A;  5K5O A;  3GVA A;  1SVM A;  1U0J A;  3CMY A;  2R7O A;  5CKT A;  1S29 A;  1MBE A;  4KIT B;  1FSH A;  2YS9 A;  2STW A;  1Y8Q B;  2AQF A;  3BR5 A;  4BNC A;  3G1L A;  2R7X A;  1J59 A;  2H8W A;  1ETV A;  1XMX A;  2LF7 A;  2DA5 A;  3REO A;  4CYC A;  2JTV A;  2X6Y A;  1WI3 A;  2AS5 F;  3CTA A;  2Z5U A;  4X1E A;  3MAJ A;  1G6N A;  4UVB A;  5DUK A;  3GZN B;  2JUC A;  3BJ6 A;  2X1D A;  3LQQ A;  2E71 A;  1XGM A;  2AXL A;  2H09 A;  2OCE A;  4PK4 A;  3KP2 A;  3SEZ A;  5IOZ A;  3V7C A;  1B1B A;  3DP7 A;  1D1B A;  5K5Q A;  2V9K A;  3CCR I;  1W36 C;  1PDN C;  3PNT A;  3R0A A;  3VYS B;  2QYO A;  5J47 A;  1JHH A;  3QPT A;  3N97 A;  1YX3 A;  3SDB A;  4DYQ A;  3BR1 A;  4FQG A;  3MWM A;  2V79 A;  1ZGW A;  3W6J B;  4BKX A;  2NRA C;  2VAS A;  5LRR A;  2XGC A;  1LNW A;  3K4C A;  2Y0M A;  3DTE A;  4MHG A;  3HSF A;  3DLA A;  3JTH A;  5J3L A;  2ZSH B;  2WV0 A;  2ISZ A;  3CCE I;  4A93 J;  4M6Y A;  5AIP A;  4XBF A;  1J09 A;  2XC7 A;  2P4W A;  2HKO A;  2Y0S N;  3SFZ A;  4P55 A;  3RKY A;  1FBS A;  3M8J A;  2HKX A;  4B44 A;  1EF4 A;  1C0W A;  2UXN A;  2WTE A;  3A4C A;  4HW0 A;  2ZJQ F;  1ZR2 A;  2O9L A;  4OU0 A;  2ADU A;  1FX7 A;  2HZT A;  3HOV J;  4FE4 A;  1X2N A;  2EA4 A;  2LKS A;  4KIS A;  2MH2 A;  3CMM A;  1P7I A;  1ZAO A;  3LSJ A;  2EZK A;  4ZDL A;  5KAI C;  3PIO F;  1I1G A;  1YJ9 I;  1Z3X A;  3GUD A;  3NWT A;  3OYE A;  1B6A A;  4KT5 C;  5DYM A;  1TNS A;  1ETK A;  4ABZ A;  5E3M A;  2A6T A;  5HDG A;  1T33 A;  4U88 A;  4DW6 A;  1YW7 A;  1G3Y A;  2HYG D;  3CES A;  1XGO A;  2GA2 A;  2JA7 J;  4YG2 F;  4BL0 B;  3ROU A;  4E7J A;  2A05 A;  2DOF A;  3HOY J;  2EIJ H;  2KKO A;  1EH8 A;  2VKE A;  1TT0 A;  2UUZ A;  2VBY A;  3RPU A;  3BG7 A;  2ZC2 A;  1YHQ I;  1YW9 A;  1JGS A;  3D5R C;  3ZMD A;  4JOM A;  1NH3 A;  3M3Y J;  2NS7 A;  2A6E F;  2R92 J;  4QTR A;  2V7F A;  3A2K A;  3K70 D;  3OSF A;  1BI0 A;  4ITV A;  3EUA A;  5IYB J;  1L0O C;  2CWE A;  1VQO I;  1S9H A;  1R58 A;  2V26 A;  3Q3S A;  2VB6 A;  4I01 A;  5E8G A;  3LNQ A;  4FX4 A;  4L0Y B;  1X1C A;  2M45 A;  3BR3 A;  4P5O A;  1W7P B;  4GYI A;  1VQN I;  4L5I A;  1LQ1 A;  4XLE A;  2LRD A;  3QOP A;  4BUP A;  2E5N A;  1X1A A;  2RKH A;  1LDJ A;  4XSX F;  4F52 A;  3P9K A;  3SZT A;  2M9H A;  5E1X A;  3ZXS A;  2P5K A;  3BG9 A;  4CCM A;  2EA2 A;  1ZLK A;  1U6G A;  2HQ5 A;  2ZJP F;  4L0Z B;  3GXO A;  1H88 C;  1S7O A;  1OYY A;  1K61 A;  3TO9 A;  2OBP A;  2V1U A;  1SFO J;  4AUX A;  1Y1W J;  2QZ8 A;  2QKM B;  4RGS A;  1JI8 A;  2H6C A;  4A3L J;  2HXI A;  2E1M C;  2IAI A;  3VFZ A;  2X0L A;  2E2J J;  2JRT A;  4B4C A;  2FRH A;  2KDZ A;  4KJZ A;  1HC8 A;  2L0K A;  3KP5 A;  4LB5 A;  2K3P A;  1ZTR A;  3CUQ A;  5FKN A;  3QOE A;  1R9T J;  2NNN A;  4DNC A;  1UAA A;  1W1W E;  1WJE A;  4C3I J;  5J8C A;  3DU6 A;  1KYZ A;  3HGY A;  4E6K G;  3V8J A;  1LDD A;  3U21 A;  3CF2 A;  1P4A A;  3I64 A;  3OOU A;  2ZKZ A;  1RZ4 A;  2FMY A;  2GIV A;  2K3F A;  4I2O A;  1G8X A;  2DBB A;  4IKF A;  2EB7 A;  2BY0 A;  3J80 K;  3WG9 A;  2IW5 A;  2V6C A;  4C3J J;  3RKQ A;  1F1Z A;  2IA1 A;  5GTH C;  3CP2 A;  3DLL F;  2BYV E;  3M7G A;  2RN7 A;  2UZK A;  3S3M A;  3OL4 A;  4UUS A;  2BE5 F;  2D2W A;  4PGH A;  3TW6 A;  4A5N A;  5EGO A;  1FYM A;  3I0T A;  1B4A A;  4Y3O A;  2ZBK A;  1H89 C;  3BC8 A;  3JRA A;  3MD2 A;  2KL4 A;  3ULQ B;  5LGN A;  1HKT A;  4MNU A;  4YIR X;  4BY7 J;  3NRV A;  5EEH A;  2LD5 A;  2HVS A;  3I54 A;  1F9N A;  3WU2 C;  3FKI J;  2KIS A;  3KIO A;  5J4Y A;  3MKL A;  4CYC B;  4BHC A;  5F64 A;  4A6D A;  3HDD A;  4S04 A;  2IEK A;  1UST A;  1KQ8 A;  1M1E B;  3FXL A;  4A3B J;  2VOD A;  4ESB A;  2QA4 I;  4PFP A;  1U3E M;  3GLL A;  2ZXW H;  4P1W A;  1UEL B;  1MW7 A;  3H9Q A;  3K10 A;  2DFI A;  1Y0U A;  1Z0X A;  1YO5 C;  2YU9 J;  1TWG J;  3FMQ A;  4L9V A;  5DDG A;  3RPQ A;  1LFP A;  4XN0 A;  1YIJ I;  3NAU A;  1LFU P;  3FMR A;  2E1N A;  4M71 A;  1LJ9 A;  4GFB A;  5F08 A;  1Z6R A;  1GUU A;  2HTJ A;  1MNE A;  2KRC A;  3D1N I;  2BVL A;  3NWS A;  3ZP5 A;  2JVH A;  3SQN A;  3KPH A;  3EYI A;  3W2V A;  2V1D A;  3IH2 A;  2A5Y B;  2F5C A;  2PMU A;  1HDD C;  3SXY A;  1IUF A;  1FTZ A;  1U5T A;  4BYY A;  2ESH A;  4WX9 A;  1YJN I;  4AM3 A;  1L3L A;  2WC2 A;  2BY3 A;  3IV5 A;  5CQE A;  5FRM A;  5K5R A;  2K9M A;  2WAQ A;  2JSP A;  2ZO4 A;  1IGN A;  1OCT C;  2Q1Z B;  1UHW A;  2EZI A;  4XN3 A;  4A0X A;  2VIX A;  2LR8 A;  3MKY B;  5E8I A;  2EWN A;  4D5F A;  3H3V K;  4MQV A;  2MC3 A;  2EH3 A;  4RB1 A;  1LUJ B;  4A5M A;  4J01 A;  5IP9 J;  1W36 D;  5E1W A;  3KEY A;  1T0F A;  1XMA A;  5EDN A;  2IS4 A;  1J0R A;  3ZQI A;  2RQQ A;  1QA6 A;  4HOB A;  4BH9 A;  5FLX Z;  1J2X A;  1MMD A;  2CQQ A;  1TW2 A;  3JRH A;  3FM3 A;  4RMN A;  5EZH A;  2M1B A;  2QKL B;  2MYS A;  2JVG A;  5FGM A;  3MKW B;  3VWB A;  3I71 A;  4IHY A;  2ZB9 A;  5D5W B;  3IHU A;  5B1A H;  2HVR A;  5BS6 A;  4ON0 A;  2M5W A;  2X6X A;  3TKY A;  3RQI A;  5ICE A;  3E5Q A;  1XMK A;  4HF1 A;  4G9Y A;  4I0A A;  2OQR A;  4IXA A;  4F7Z A;  1KGS A;  3L2Q A;  3KFW X;  4FIS A;  3RDI A;  3BOQ A;  3P5J A;  3OV8 A;  1SFK A;  4R79 A;  4RDU A;  2LBF A;  2LKP A;  2F5E A;  4CSW A;  1TW3 A;  2HOE A;  2Z2S B;  4ENM A;  1X3W B;  3RTR A;  4X0G A;  1MSE C;  2LKX A;  1TWH J;  2Y30 A;  1LVA A;  2VL8 A;  2LSO A;  1JKO C;  1Y8R B;  1MH4 A;  1ON1 A;  2XSD C;  2XDV A;  3LSI A;  4HV5 A;  1FWZ A;  1BBY A;  2FNP A;  4XON A;  2ME6 A;  3CCL I;  4CDG A;  3PSF A;  1O7F A;  2VQG A;  4O6J A;  2QEX I;  3E5X A;  4J19 A;  1QHH D;  3GWZ A;  1JTY A;  4BHP A;  4BAY A;  4F55 A;  3CUQ B;  4EJV A;  3C2H A;  2CFO A;  3KE2 A;  1SAX A;  5EZG A;  2CSO A;  2PI0 A;  2FUG 2;  1KU2 A;  1J5Y A;  4U0V A;  2V1N A;  5EG0 A;  1YIO A;  4A3F J;  3OWT A;  3G71 I;  1R71 A;  1BI1 A;  2B7E A;  1LDK B;  3GFI A;  4IRG A;  2F4I A;  2RRE A;  2K27 A;  5J1R A;  2IS6 A;  3B02 A;  4G7O F;  2V1X A;  3GTP J;  2H1K A;  1ITY A;  1MDM B;  3L2V A;  2WY8 Q;  3EUH A;  1XSD A;  1KU7 A;  4Y4R A;  1A31 A;  1QRY A;  4HX8 A;  2ESN A;  2JSC A;  1SD7 A;  4UUS B;  2QUF A;  3IRR A;  2WBM A;  5J40 A;  4D0P A;  1WFX A;  3BQY A;  2ZSI B;  1BL0 A;  1GV5 A;  1Y6I A;  2CUJ A;  2P5V A;  1WJB A;  2VE8 A;  1IUY A;  3KP6 A;  4LOC A;  3DPT A;  3F3X A;  4NDL A;  4UB8 C;  1K6O A;  1OJL A;  1WCM J;  3VSK A;  4E7H A;  4RS8 A;  2OCC H;  2W84 A;  1V54 H;  3IAS 2;  2FF4 A;  3CUQ C;  2QQA A;  4CUG A;  4M3E A;  2CQN A;  4PZJ A;  1WJ5 A;  3FBI B;  3QAH A;  3F8F A;  5E20 A;  2IPQ X;  4LLN A;  2LTP A;  5CQG A;  3ESW B;  3MEX A;  4RBO A;  2D1V A;  5IY5 H;  2RQP A;  1A6I A;  5FKO A;  2WWY A;  1W7P D;  4M3G A;  3C7J A;  2W1O A;  4PJL A;  2LK2 A;  4DZJ A;  1RUN A;  5LEJ A;  1SAN A;  3MFK A;  3CJQ B;  2IA2 A;  2R5Z B;  2PMZ A;  3HOZ J;  4KIG A;  3JAM K;  2B63 J;  1Z1D A;  1FP2 A;  4I99 C;  3E97 A;  3P9I A;  2XKP A;  3IKT A;  2EIN H;  2E2I J;  1D5Y A;  3VYT B;  2XAU A;  2XAF A;  5LHG A;  2FQ3 A;  1AHD P;  3T1B A;  5JVT A;  3WTU C;  3L1P A;  4I76 A;  2H1L A;  4DYC A;  4FHT A;  3QRF F;  4HAM A;  3ZGK A;  1RKT A;  5CVU A;  5DM6 F;  4BHB A;  2I10 A;  5EEG A;  1U8B A;  2LVS A;  2PEX A;  2HFH A;  3MZY A;  1HSJ A;  4UUT A;  1LVK A;  1S72 I;  1Z7L A;  1X1P A;  2DMT A;  2VLA A;  2VPR A;  2DXI A;  5IP7 J;  3TDU C;  2EIM H;  4G7Z F;  3EUK L;  1UCR A;  4IHW A;  5LBQ A;  1FLI A;  1B9N A;  1WRJ A;  1G2H A;  2CW0 F;  2K7L A;  1GT0 C;  1HQC A;  1TWC J;  2LH9 A;  3OR1 C;  1FYK A;  1ZGJ A;  4I02 A;  2BBY A;  3TED A;  3W2A A;  3D0S A;  2EBI A;  1RR8 C;  4HA8 A;  4EM1 A;  2R7Q A;  2XF7 A;  5E18 F;  1IRX A;  4KIB A;  2LF8 A;  2MA3 A;  4DIQ A;  1NK2 P;  3KX2 A;  3WTS C;  3IH4 A;  3CD6 I;  1TZL A;  1KQ9 A;  3QYF A;  3N4M A;  3ERM A;  1ENH A;  3C3W A;  3QPS A;  1W4M A;  4LJZ F;  2QWW A;  3ZMT A;  3JAM Z;  3O2P E;  5ILS A;  3EPZ A;  3S32 A;  3KP7 A;  3IH3 A;  4L9N A;  1WSU A;  1BW5 A;  4PGG A;  3ABL H;  4N4O B;  1ETQ A;  3GO5 A;  2WV1 A;  4BY1 J;  1KU3 A;  3L7W A;  2KRF A;  1KZH A;  3R6S A;  3WTV C;  3LSP A;  3ZMU A;  3H5A A;  2CYY A;  4MEX F;  3HZJ A;  5DEQ A;  2DU9 A;  1U5T C;  4HSR A;  4PSW A;  2CJJ A;  3VPR A;  3CDH A;  2X51 A;  2JMW A;  3RZD J;  3F8C A;  2P6S A;  4A3E J;  2IGK A;  1BW6 A;  4XQF A;  2KJB A;  4GO1 A;  2DFE A;  5B5E C;  3HL2 A;  1WPK A;  2RV8 A;  4EJU A;  4IOA F;  3HUG A;  4FAS D;  2DDB A;  3V4G A;  2O5R A;  5JHU A;  1SFE A;  2UWM A;  1STZ A;  4ZC3 A;  3TW7 A;  5K7Z A;  1FNN A;  1OPC A;  3DEE A;  1JUS A;  5FD5 A;  4XMY A;  1WH5 A;  3OR2 C;  3SFI A;  2RVC A;  3W2W A;  3FF5 A;  3MCZ A;  5DCM A;  2LBF B;  2TRT A;  4II2 A;  3DTI A;  5F1J A;  3CC4 I;  1IN7 A;  2P5L C;  1T0F C;  1MMS A;  1OCR H;  1YRN A;  2LNB A;  3RQ4 A;  3TL4 X;  5TGT A;  2OTJ I;  2ISY A;  3TBI A;  4D9J A;  2IBD A;  2VI6 A;  1I3Q J;  4DZP A;  5JR3 A;  2KQR A;  3GZ6 A;  1U9N A;  1HW5 A;  5BMZ A;  2QF7 A;  1Z77 A;  4YEL A;  5FKL A;  4C30 A;  1O7L A;  1ZN2 A;  4RAF A;  2AXT C;  3DBR B;  2W48 A;  3A02 A;  1T8I A;  3SZP A;  3OYJ A;  1WZ2 A;  2ID6 A;  3V7R A;  4AIH A;  5J4V A;  2FD5 A;  1V5G A;  2OV7 A;  3F6O A;  2DPU A;  2JA6 J;  1FYL A;  2PJP A;  3F72 A;  2R7D A;  4XLN F;  2ZFU A;  3FK7 A;  1S3J A;  1GVD A;  2O3F A;  2HI3 A;  4WXD A;  1XC5 A;  4WK8 F;  3AG1 H;  3BJO A;  4N0B A;  5JI6 A;  3I56 I;  1VQM I;  1BC7 C;  1R5H A;  3FM5 A;  4DBR A;  2L5Q A;  4H4K C;  1WJC A;  1QZE A;  4U7D A;  4C2M J;  4LGW A;  1U8R A;  5FFZ A;  3PM1 A;  2OZ6 A;  5GAG J;  3G4S I;  3VOE A;  4Z6Y A;  4BAC A;  2Q2E B;  1R00 A;  3ZQG A;  1SC7 A;  3LSH A;  2R7V A;  4UUV A;  3H1C A;  3AG4 H;  3G2B A;  4M9X A;  3GME A;  2UXX A;  3S3N A;  3BTJ A;  4W97 A;  5FKM A;  2CQK A;  5DM7 F;  1RPW A;  4OMZ A;  3I4M J;  2XPV A;  3NQO A;  5ILV A;  1U78 A;  3DF8 A;  4BBS J;  2L9V A;  3RPU D;  1IO2 A;  4EM2 A;  3DU5 A;  1UMQ A;  1DPR A;  1YJW I;  4U87 A;  2F5V A;  2K9S A;  3KZI C;  4HZF A;  4EJT A;  3DTK A;  1FBQ A;  1TL8 A;  2ECC A;  4EMS A;  3OYA A;  4ZDP A;  4BJ5 C;  4AWX B;  1FC3 A;  2DT7 B;  4IEJ A;  2R7T A;  2VQL A;  3QYB A;  2CO5 A;  2JRM A;  2BXZ A;  2VN2 A;  3GW2 A;  1VF9 A;  3HRM A;  4I0B A;  3RKX A;  2LLK A;  1BA5 A;  2W85 A;  4JX5 A;  2DCE A;  3AAF A;  2L7F P;  3HOT A;  1T38 A;  3ZMZ A;  1FMV A;  1DPU A;  1MBF A;  2CRG A;  4E7L A;  3OSG A;  1RUO A;  1N25 A;  1WI9 A;  2XAQ A;  5F6F A;  1D3Y A;  4KNY A;  3F8M A;  2L2O A;  5GAD J;  5FLM J;  4RB3 C;  2W7N A;  4BXU A;  4BE0 A;  4EV0 A;  3WE3 A;  1JJ8 C;  4L18 B;  2Y2Z A;  5HS9 A;  4I7H A;  4PFO A;  5LFA A;  2L3D A;  2DYS H;  4Z2Y A;  2GXA A;  2K4B A;  3M8E A;  3ERE D;  2IA0 A;  1SMY F;  1DU0 A;  4DQ2 A;  4XRM A;  1JKQ C;  4E7Z A;  2K86 A;  3DBH B;  4HQM A;  4MFE A;  1HOM A;  5LD2 C;  3MQ0 A;  2MW8 A;  1QVT A;  5HDK A;  5TIS C;  2ZJR F;  2LP0 A;  3K4L A;  2Q8K A;  1MMA A;  1MJ9 A;  4M73 A;  4IZZ A;  2O61 A;  3PFY A;  4HEA 2;  4EJW A;  1HCR A;  5DCF A;  3L09 A;  1V55 H;  4ZTF A;  1IXC A;  3H3U A;  4YIF A;  4IQ4 A;  5HDN A;  5HOO A;  3KEO A;  4DBQ A;  4KT6 A;  1VQ9 I;  3HPG A;  5JHF A;  3OYC A;  2RNJ A;  2M8E A;  2O6G E;  2EPF A;  4IJA A;  3IWZ A;  4FCY A;  3T5X A;  3HOS A;  3ZPL A;  1Q1H A;  2DAO A;  1W0U A;  1HKS A;  2FQ4 A;  5BNG A;  1I6X A;  3ABT A;  2XV4 S;  4ZZD A;  4OIR F;  5J8F A;  2ZXI A;  3WTZ A;  2A07 F;  2HZD A;  1BJA A;  5LGU A;  1JJ6 C;  2HQA A;  2G7H A;  3S1R J;  2Y0S A;  2PJR A;  4YII A;  3CO7 C;  5HLG A;  4MFD A;  2YX7 A;  1ONV A;  3K6G A;  2R7S A;  1OYI A;  2R3S A;  4KA4 A;  3WHC A;  4NHJ A;  1IN6 A;  1SVO A;  4ESF A;  2X85 A;  2STT A;  1FOW A;  1O3S A;  1IW7 F;  1T6S A;  3K1M A;  1LEB A;  3HUG B;  2XB0 X;  2DQR A;  2NOJ B;  2VKV A;  1UG0 A;  3R4K A;  4WXC A;  2QQB A;  1QZY A;  3E6C C;  3PQK A;  3I5U A;  5IPA A;  3DFG A;  3J81 Z;  1RKW A;  4PCQ A;  5M5W J;  5DCM B;  2Y75 A;  3ABK H;  3HB9 A;  3EET A;  3MZ8 A;  1YRN B;  2DQL A;  2A68 F;  2GXG A;  1VND A;  5EYR A;  2DK8 A;  4TV7 A;  2HS5 A;  2Y69 H;  3F21 A;  2LG4 A;  3BTC A;  2DYR H;  3E6B A;  5ICC A;  3E0J B;  2HEO A;  4Q48 A;  1EH6 A;  5EEA A;  3KEQ A;  1VFC A;  4XRS A;  4B3A A;  2MH9 A;  1ZYR F;  1FTT A;  3I55 I;  3TOB A;  2ME0 A;  1MGT A;  1X1D A;  1D0Z A;  2EV0 A;  1PYV A;  2LY9 A;  2DK5 A;  5E3N A;  5KCM A;  2OD5 A;  4L5E A;  2XKO A;  4HQE A;  2Z1D A;  5IP6 A;  2D5V A;  2O0Y A;  3FXQ A;  4DGW B;  4UVA A;  4LLG F;  3LMM A;  1A04 A;  3CP8 A;  1I6H J;  2PLY A;  1GV2 A;  4L9T A;  4I6Z A;  1IDZ A;  2VJ5 A;  3JRB A;  5GP9 A;  3AKZ A;  2BV6 A;  3A0H C;  4BQN A;  3O6B B;  2VBW A;  1JHF A;  4Y15 A;  3BQZ A;  1O3Q A;  4M6X A;  4LFU A;  1QNT A;  2JPC A;  3JRF A;  4HNT A;  2JWT A;  4RM3 A;  2HYF A;  3M07 A;  3QP5 A;  2L9N A;  3HYI A;  2L4A A;  5H20 A;  3RYR A;  2RAE A;  4HLY A;  1AU7 A;  2IT0 A;  3HRU A;  1UHM A;  3BTL A;  5FD6 A;  1MDM A;  3CME I;  3VOD A;  4QIW N;  4U0W A;  2HGC A;  3BWG A;  1LPQ A;  3OYL A; 
#chains in the Genus database with same CATH homology
 2CU7 A;  1TWH J;  2Y30 A;  1WGX A;  1JKO C;  1MH4 A;  5GPC A;  2XSD C;  4XIC A;  5M5Y J;  3O8H A;  3ZQL A;  2WB1 N;  3CCY A;  1ORK A;  2ME6 A;  3S17 J;  2JA5 J;  5EF6 A;  2E19 A;  3HM5 A;  3RZO J;  3PO3 J;  4J19 A;  1JTX A;  1DU6 A;  3CQZ J;  2GM4 A;  5C4X J;  1JTY A;  3QQA A;  4XK4 A;  1PUF B;  3ZQF A;  5EZG A;  3G1M A;  1JUP A;  4V2G A;  2DA4 A;  2NVX J;  5EG0 A;  4A3F J;  1TWA J;  2R5Z A;  1TC3 C;  2NOG A;  3M4O J;  3F0C A;  5J1R A;  3QPL A;  3GTP J;  2H1K A;  3JRE A;  1ITY A;  4AYB N;  1RET A;  4A3C J;  1QRY A;  4FTH A;  3NAR A;  4UUS B;  5E3O A;  3S2D J;  2NS8 A;  1X2M A;  4JX4 A;  3BQY A;  4M6V A;  1HLV A;  1BL0 A;  1GV5 A;  4LOC A;  1LFB A;  4NDL A;  2GBY A;  1OJL A;  1WCM J;  4G12 A;  3ZQC A;  3JR9 A;  3S2H J;  2TCT A;  2XGE A;  4A69 C;  2DMQ A;  2HDD A;  3TP3 A;  4M3E A;  1ZK8 A;  3H0G J;  1BJZ A;  2N8G A;  3MN2 A;  3HBL A;  2DA1 A;  1A5J A;  2LTP A;  4RBO A;  3S1M J;  4V2F A;  1A6I A;  5FKO A;  2CUE A;  1QPI A;  2EZL A;  2KT0 A;  4M3G A;  1ZKG A;  2LK2 A;  4DZJ A;  2NVQ J;  2Y31 A;  5EG0 B;  1SAN A;  3SJM A;  5HOD A;  2M2E A;  2R5Z B;  3HOZ J;  2B63 J;  4HNV A;  5IYC J;  2K40 A;  1IJW C;  5IOY A;  5F04 A;  5FJ8 J;  2FJ1 A;  1MBH A;  2E2I J;  1D5Y A;  2HOA A;  5J1Y A;  1AHD P;  1P7J A;  3L1P A;  4I76 A;  4DYC A;  1ETW A;  2DA7 A;  1QVU A;  1RKT A;  3K7A J;  4IHV A;  1JT6 A;  3BR2 A;  2I10 A;  4D5C A;  1U8B A;  2DJN A;  2LVS A;  2MG4 A;  3K2A A;  3HOW J;  3BT9 A;  4UUT A;  3ZQH A;  4DYR A;  3HGG A;  2XB5 A;  3TP0 A;  1JT0 A;  2P81 A;  2DMT A;  1FEX A;  2VPR A;  1JUM A;  5IP7 J;  5F0H A;  4IHW A;  2ECB A;  2M0C A;  5DS9 A;  2Y9Z A;  1RES A;  1MNM C;  3BR0 A;  2HYJ A;  1G2H A;  2OPT A;  1GT0 C;  1TWC J;  2E2H J;  3S14 J;  2DMN A;  1JGG A;  1X58 A;  5M3M J;  3CMY A;  3TED A;  1MBE A;  2YS9 A;  2X9D A;  2EBI A;  1B8I A;  3BR5 A;  3G1L A;  1NK2 P;  2Y9Y A;  1T56 A;  1ETV A;  3IH4 A;  4A3M J;  2DA5 A;  1ENH A;  3OIO A;  2DTZ A;  3QPS A;  4CYC A;  3JRG A;  2K9N A;  1WI3 A;  3IH3 A;  2R5Y A;  4EEF G;  1BW5 A;  1ETQ A;  4X1E A;  2WV1 A;  3HOX J;  4BY1 J;  3LSP A;  2GLO A;  4W1U A;  1ZR4 A;  3HOU J;  3VPR A;  2CJJ A;  3RZD J;  2JMW A;  5DTD A;  1XG1 A;  2L9R A;  4A3E J;  5IOZ A;  1BW6 A;  1RR7 A;  1MBJ A;  1WPK A;  1IV6 A;  5JLW A;  1VI0 A;  2JK3 A;  2AO9 A;  1AKH A;  1FJL A;  4M3B A;  4A3D J;  2NVY J;  4JYK A;  3BTI A;  3TW7 A;  4DYQ A;  5K7Z A;  3BR1 A;  1ZGW A;  1JUS A;  4BKX A;  3SFI A;  1WH5 A;  2XGC A;  4D7M A;  2TRT A;  5J3L A;  2O7O A;  5J1U A;  1F43 A;  5F1J A;  2XRL A;  1E3O C;  4A93 J;  1YRN A;  3A03 A;  2IBD A;  2VI6 A;  2Y0S N;  1LE8 A;  1I3Q J;  4DZP A;  1HDP A;  4JP0 A;  1U9N A;  2QF7 A;  1EF4 A;  1Z77 A;  1ZR2 A;  2O9L A;  2JJ7 A;  3HOV J;  5FKL A;  4FE4 A;  3ZOB A;  1X2N A;  1O4X A;  2W48 A;  3JRD A;  3A02 A;  1P7I A;  3LSJ A;  2EZK A;  2ID6 A;  2FD5 A;  1OCP A;  3MVP A;  2JA6 J;  5F0C A;  1MH3 A;  2M34 A;  3FK7 A;  1GVD A;  3A01 A;  1AKH B;  1ETK A;  2HI3 A;  1XC5 A;  4ABZ A;  5E3M A;  1T33 A;  4DW6 A;  2R93 J;  2JA7 J;  1IRZ A;  1Q1V A;  4JX6 A;  4C2M J;  3HOY J;  2VKE A;  4BXX J;  3HKZ N;  3PM1 A;  3M3Y J;  3S1Q J;  2QCO A;  3ZQG A;  1POG A;  2NS7 A;  2XGD A;  2R92 J;  2VUM J;  4QTR A;  3BTJ A;  4W97 A;  5FKM A;  3JRI A;  1MBG A;  3OSF A;  1RPW A;  3I4M J;  5IYB J;  2XPV A;  4A3G J;  2WAQ N;  3LSR A;  1U78 A;  4BBS J;  1MSF C;  5M3F J;  3FIS A;  3Q3S A;  3LNQ A;  3WHB A;  5F27 A;  1UMQ A;  2DA2 A;  3BR3 A;  2K9S A;  4M3D A;  2X6O A;  1B72 A;  2ECC A;  3S16 J;  4FE7 A;  1CQT A;  2FX0 A;  2M9H A;  2CUF A;  3BG9 A;  4IEJ A;  2HQ5 A;  2G0E A;  1H88 C;  1VF9 A;  1K61 A;  2R7Z J;  2LLK A;  1SFO J;  1BA5 A;  3SDG A;  4AUX A;  1Y1W J;  4JX5 A;  4A3I J;  2L7F P;  4A3L J;  3S15 J;  3BG3 A;  1MBF A;  2CRG A;  2HXI A;  2IAI A;  3JRC A;  3OSG A;  2E2J J;  3LOC A;  2H8R A;  4B4C A;  4QSH A;  2KDZ A;  4X6A J;  3BR6 A;  5FLM J;  2L0K A;  2K9Q A;  2OF7 A;  2HOT A;  1ZTR A;  5FKN A;  1R9T J;  1JJ8 C;  4C3I J;  2Y2Z A;  1ETX A;  3HGY A;  4IHX A;  5C44 J;  3B6A A;  3OOU A;  5E3L A;  1XS9 A;  2DA3 A;  4C3H J;  3I4N J;  5JLX A;  1DU0 A;  4XRM A;  1JKQ C;  4MFE A;  1HOM A;  1S7E A;  3GTQ J;  2MW8 A;  1QVT A;  4C3J J;  3E7L A;  3RKQ A;  2LP0 A;  2DMU A;  3Q0V A;  3GBG A;  1B72 B;  2JN6 A;  3GTO J;  1FIP A;  2ELK A;  2X48 A;  1HCR A;  3GTJ J;  5FKK A;  4UUS A;  5F0F A;  3TW6 A;  1TWF J;  3FIW A;  5EGO A;  4Y52 J;  3UKG A;  1H89 C;  1MBK A;  3JRA A;  2JA8 J;  4XRS G;  1F36 A;  1Y1V J;  1W0T A;  1B8I B;  4BY7 J;  1HF0 A;  4FCY A;  3GTL J;  1JKP C;  2HOS A;  2LD5 A;  1W0U A;  3BG5 A;  5K7H A;  2M8G X;  3DCF A;  2FQ4 A;  5BNG A;  3FKI J;  4B1R A;  1H8A C;  3W6V A;  3MKL A;  3GTM J;  4CYC B;  5FLV A;  4S0H B;  3CDL A;  3HDD A;  1JJ6 C;  2IEK A;  3S1R J;  3LSG A;  2R5Y B;  4M3F A;  1UHS A;  2E1O A;  4A3B J;  4MO7 A;  4AC0 A;  4MFD A;  4A3J J;  3WHC A;  2COB A;  3PO2 J;  1Z0X A;  2DA6 A;  2DN0 A;  2YU9 J;  1TWG J;  1NTC A;  2XB0 X;  5EGO B;  4A3K J;  3G1O A;  5K7F A;  2VKV A;  3NAU A;  1LFU P;  4GFB A;  2DMP A;  2XPU A;  5F08 A;  1IG7 A;  5IPA A;  1GUU A;  3D1N I;  1RKW A;  3B6C A;  5M5W J;  3IH2 A;  2ID3 A;  3HB9 A;  1YRN B;  1HDD C;  1VND A;  5EYR A;  1IUF A;  2AHQ A;  1FTZ A;  2EZH A;  2EQR A;  2O8K A;  3DEW A;  3BTC A;  1LE8 B;  2MSY A;  1GDT A;  3IV5 A;  2PMZ N;  5C3E J;  2R0Q C;  5EEA A;  1IGN A;  1VFC A;  4XRS A;  1OCT C;  4B3A A;  2EZI A;  1NK3 P;  1FTT A;  2LR8 A;  1IC8 A;  2ME0 A;  4D5F A;  3H3V K;  1UG2 A;  2LY9 A;  2EH3 A;  5M5X J;  3C2B A;  5E3N A;  1I50 J;  4BBR J;  4L5E A;  5IP9 J;  5C4J J;  9ANT A;  2CQX A;  2L7M P;  5EDN A;  3GTK J;  1OFC X;  5IP6 A;  1APL C;  2D5V A;  3ZQI A;  3A01 B;  2XPW A;  5IYD J;  1JKR C;  4Y7N J;  2LFB A;  1I6H J;  2CQQ A;  1GV2 A;  4I6Z A;  3JRH A;  1IDZ A;  3JRB A;  5GPA A;  5GP9 A;  5EZH A;  2NVT J;  1K83 J;  3BQZ A;  4IHY A;  1ETY A;  3FK6 A;  4MIM A;  2HXO A;  2ZB9 A;  1ZQ3 P;  3Q0W A;  3GTG J;  3S1N J;  3JRF A;  3RQI A;  2YUS A;  2JWT A;  1PUF A;  1FIA A;  1IDY A;  3O8G A;  1U9O A;  2L7Z A;  4FIS A;  4XID A;  2RAE A;  3HEF A;  1AU7 A;  4RDU A;  2MGQ A;  1ETO A;  3BTL A;  4D7N A;  4MLO A;  4QIW N;  1MSE C;  3Q0U A;  2LKX A;  1WH7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...