3UKGA

Crystal structure of rap1/dna complex
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
242
structure length
223
Chain Sequence
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRVYLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAIAVKKQFYRDLFQIDPDTGRSPNHVPGSEPNFAAYRTQSRRGPIAREFFKHFAEEHAAHTENAWRDRFRKFLLAYGIDDYISYYEAEKAQNREPEPMKNLTNRPKRPGVPTPGNYNSAAKRARN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The orientation of the C-terminal domain of the Saccharomyces cerevisiae Rap1 protein is determined by its binding to DNA.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords DNA-binding protein RAP1
total genus 60
structure length 223
sequence length 242
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
A PF09197 Rap1-DNA-bind Rap1, DNA-binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ukgA02
1U8BA 3BT9A 5EG0B 3BTIA 5M5WJ 1IG7A 1Y1WJ 1JJ8C 5C4XJ 3H0GJ 5M3FJ 2M34A 1ETQA 1JKPC 2IEKA 2R5YB 1W0UA 3IV5A 5GPAA 2IAIA 3S1QJ 1UG2A 3JRHA 2EZLA 1APLC 2YS9A 3JRBA 3IH4A 5JLXA 2XPWA 2R5YA 1SANA 1D5YA 2DA4A 3ZQLA 2HOAA 2K9QA 1FTZA 3M4OJ 4XRMA 3BG3A 3JRFA 5FLMJ 5M5XJ 3GTJJ 4A93J 2O9LA 3GTOJ 2XGDA 4DYCA 1ITYA 2FJ1A 3QPSA 3HOZJ 3S1NJ 4QTRA 4XRSA 4B4CA 2DMQA 5M5YJ 1JUPA 3BTJA 3JREA 3JRDA 1MBGA 2ME6A 2R5ZB 1OCTC 3LSGA 3BR6A 2K9SA 4I76A 3LSJA 1LFBA 3S2DJ 1Z0XA 2VI6A 1B72B 3QPLA 2M2EA 5IOYA 4A3BJ 1UHSA 1XC5A 3HGGA 2M0CA 4JYKA 1WGXA 4M6VA 2L7MP 4Y52J 5K7HA 2CQQA 2E2HJ 1GV2A 1U78A 1BL0A 1VNDA 1ETXA 1GDTA 1Q1VA 4MO7A 3DCFA 3SJMA 1ZR4A 1IC8A 1VFCA 2R7ZJ 3TP3A 2EZKA 2DA6A 4BXXJ 3E7LA 3GTLJ 5FKKA 1BW6A 5E3NA 2MSYA 2ME0A 4XRSG 5FKMA 2JA6J 1ORKA 3HDDA 1QPIA 4UUSA 1WI3A 4A3DJ 2N8GA 3MKLA 3BTCA 3IH3A 4FCYA 1TC3C 1AU7A 4MFDA 5EYRA 1O4XA 1H89C 3C2BA 3PO3J 4B3AA 4IHWA 2DN0A 4FISA 2PMZN 1VI0A 2QCOA 2XGCA 5F27A 5IP7J 3JRAA 3PM1A 2M8GX 5FKOA 2VKVA 2Y30A 1I3QJ 3HBLA 3RKQA 1B8IA 1JT0A 3S14J 2H1KA 2JA5J 2Y9ZA 4MIMA 4IHYA 2DA5A 1TWFJ 3CMYA 2JMWA 2H8RA 4M3BA 1A5JA 4C2MJ 3OSGA 3W6VA 3RQIA 2CQXA 1X2NA 2LLKA 3TP0A 5C44J 2DJNA 5EDNA 3CDLA 1QVUA 2AO9A 1JKRC 2EZIA 4XIDA 2DA3A 4HNVA 2ID3A 4X1EA 2JJ7A 5EGOB 1X58A 3K2AA 3ZQHA 3LSRA 3F0CA 3UKGA 1HDPA 3BQZA 4FE7A 2TRTA 4JX5A 1ZR2A 1E3OC 1IV6A 3GTQJ 1FTTA 2ECBA 1XS9A 1F36A 4M3FA 1MBJA 2DA2A 1IUFA 3VPRA 5J3LA 2HXIA 4FE4A 5GPCA 2WV1A 3S1MJ 2EBIA 5E3OA 2LD5A 1MH4A 1ZTRA 3Q0UA 1NK3P 2JN6A 2HQ5A 3M3YJ 3WHCA 1JJ6C 3FK6A 5C4JJ 4W97A 4NDLA 1BJZA 1WCMJ 3MVPA 1BA5A 3WHBA 4J19A 3S17J 1OCPA 4M3DA 1IRZA 4MFEA 3ZQFA 3NARA 2MGQA 1CQTA 1RPWA 4JP0A 3JRCA 1MNMC 2CUFA 2Y0SN 4QSHA 2B63J 1XG1A 3O8GA 5F08A 1ETVA 2XB0X 2XPUA 1JKQC 2XB5A 3ZQGA 1FJLA 5HODA 1S7EA 1A6IA 2NS8A 1TWCJ 4BY1J 3RZOJ 1YRNA 3MN2A 2HYJA 2HOSA 5K7FA 2L9RA 1IGNA 1MBFA 3Q0WA 3OOUA 4JX6A 4AYBN 2EQRA 2DTZA 2WB1N 2M9HA 2NVTJ 1MSFC 1HOMA 1JUMA 3PO2J 1X2MA 1ETOA 3FISA 2LFBA 4V2FA 2XGEA 1Z77A 4IHVA 3FK7A 4DZJA 5E3MA 3H3VK 3G1MA 2EZHA 3B6AA 2NOGA 4W1UA 4DW6A 2LK2A 1AKHA 1JTYA 3GTKJ 3HOVJ 1R9TJ 5IPAA 3BQYA 1AKHB 1GVDA 1RR7A 5GP9A 4DZPA 1RETA 4A69C 5FKLA 1RKWA 1ZQ3P 3RZDJ 2E2JJ 4D7NA 5EGOA 2XRLA 1PUFA 1T33A 3BR0A 2L7FP 2XPVA 3LOCA 4Y7NJ 4FTHA 2HOTA 4A3MJ 1UMQA 1AHDP 2LVSA 1GV5A 1VF9A 1Y1VJ 5FKNA 4S0HB 1JGGA 4ABZA 1QRYA 3OIOA 4BBSJ 2Y2ZA 2X9DA 5DTDA 1OJLA 2Y9YA 5J1UA 4C3HJ 4X6AJ 4D7MA 1ETWA 3BR1A 1MBKA 3SDGA 3SFIA 3GTMJ 2D5VA 2X48A 3HOXJ 2L0KA 2COBA 2EH3A 2ELKA 2XSDC 1U9NA 3LNQA 4BBRJ 2OPTA 1U9OA 5J1YA 3D1NI 1GT0C 2KDZA 1ZGWA 3A01B 1ZK8A 4A3FJ 2JA7J 1LFUP 5JLWA 2QF7A 5DS9A 5IYCJ 3A01A 2O7OA 1MH3A 2LP0A 1JUSA 1ETKA 5EZHA 3JR9A 3S16J 2GLOA 4QIWN 1SFOJ 2FD5A 3BG9A 3Q0VA 1TWHJ 1BW5A 5EG0A 1POGA 1H88C 3G1LA 4IHXA 2G0EA 4A3GJ 2JWTA 2R92J 4CYCB 1DU6A 1IJWC 5M3MJ 4LOCA 9ANTA 4RBOA 1I6HJ 1G2HA 4JX4A 1ETYA 2R93J 2DMNA 3BTLA 1RESA 4UUTA 1I50J 5EEAA 3GTGJ 3LSPA 3GBGA 4B1RA 4I6ZA 4G12A 1NK2P 1PUFB 2R0QC 3Q3SA 1B8IB 2VUMJ 3IH2A 1IDYA 5FLVA 3QQAA 1MSEC 3O8HA 3I4MJ 2ID6A 5IYBJ 4A3EJ 3G1OA 2K40A 3TW6A 3FIWA 3HEFA 1HCRA 4RDUA 1ZKGA 2JK3A 4BKXA 4DYQA 3CQZJ 2DMTA 1DU0A 1OFCX 4IEJA 1FIPA 3CCYA 4D5FA 2NS7A 3ZQIA 3HKZN 2CU7A 2FX0A 3K7AJ 2X6OA 1WPKA 2IBDA 4XK4A 1WH5A 1ENHA 2E19A 5F0CA 2DA7A 1JKOC 1FIAA 3A03A 2GM4A 3BR3A 5EZGA 2ZB9A 4M3GA 3OSFA 1IDZA 2GBYA 2NVYJ 3HB9A 5FJ8J 1T56A 3L1PA 2CUEA 2HI3A 3BR5A 3GTPJ 4GFBA 3HOUJ 5IOZA 2DA1A 2R5ZA 4M3EA 2DMUA 2O8KA 5IYDJ 1HF0A 1P7IA 3FKIJ 3HM5A 5IP9J 4V2GA 3NAUA 2NVQJ 5F0FA 2NVXJ 1GUUA 1FEXA 3HGYA 2ECCA 2Y31A 1JT6A 2YU9J 3B6CA 5F1JA 3ZQCA 2K9NA 2LKXA 4A3JJ 1W0TA 4A3CJ 5C3EJ 1TWGJ 2DMPA 2VPRA 4A3IJ 1B72A 2YUSA 2E1OA 1HLVA 4UUSB 2I10A 5F0HA 1H8AC 1QVTA 2VKEA 2AHQA 4D5CA 3A02A 2L7ZA 3S15J 4XICA 2CRGA 1NTCA 4L5EA 4EEFG 2KT0A 4AC0A 2W48A 5J1RA 2MG4A 3TW7A 2FQ4A 3JRGA 4BY7J 3HOWJ 5K7ZA 3BG5A 4A3LJ 1TWAJ 2P81A 1HDDC 5F04A 1LE8A 2E2IJ 1JTXA 4C3IJ 4A3KJ 1P7JA 1RKTA 4MLOA 5EF6A 3I4NJ 2LTPA 3TEDA 4AUXA 2LR8A 2MW8A 1MBHA 4CYCA 1EF4A 4DYRA 2JA8J 2HXOA 1K83J 2CJJA 2OF7A 1F43A 1WH7A 1YRNB 3ZOBA 3S1RJ 3DEWA 5IP6A 2HDDA 3JRIA 4C3JJ 3BR2A 1LE8B 3S2HJ 2LY9A 2WAQN 5BNGA 3HOYJ 1MBEA 5E3LA 1K61A 2RAEA 2TCTA
chains in the Genus database with same CATH superfamily
4KT5C 1U8BA 3BT9A 1LEBA 3WU2C 2GOMA 1UFMA 2LREA 3VYTB 5D4RA 2EV6A 3WTUC 1JJ8C 3H0GJ 1YI2I 2IW5A 2M34A 3C1DA 4KITB 3M07A 1JKPC 3CC2I 2RQPA 2K9LA 4BJ5C 1UG2A 4N9HA 3JRHA 2O0YA 1S72I 3FXQA 1Z1DA 3E3VA 4C30A 1D5YA 2DA4A 4BAYA 4AVZA 1KU9A 1XD7A 4HRIA 4XRMA 5FLMJ 2PQ8A 3C2GA 5GAEJ 2F5DA 3HRTA 4A93J 2O9LA 3F8MA 5EJCA 3OWTA 3S1NJ 2HWVA 2XAFA 4ESJA 5HNHA 3QOPA 1SFXA 4B8XA 2DMQA 2A3SA 1TW3A 3N97A 3ELKA 1KYWA 3JRDA 3M8EA 2AXLA 1UAAA 2HTSA 5JI6A 2VI6A 4IX7A 3VFZA 3QPLA 5IOYA 4AIHA 4A3BJ 3WU1B 3HGGA 2HDCA 2H6CA 3ABUA 1ONVA 5BS6A 3RPUD 1BR1A 3X2QH 2CQQA 4N0BA 2CYYA 2MC3A 1R58A 1BL0A 1ETXA 4LG3A 2ZJQF 3ZMTA 1S3JA 1O3SA 1Q1VA 2VQLA 3DCFA 1ZR4A 1IC8A 4LJZF 1VFCA 2QKMB 2HNHA 3H35A 2DDAA 2M5WA 4FETA 5BPIA 3KCCA 1BIAA 4Z6YA 4RB2C 4BXXJ 3GTLJ 1T2KA 5E3NA 3GUDA 1R00A 1G4DA 3KEQA 1RUNA 2ME0A 1GLNA 2K4JA 4A0ZA 1DUXC 1VQPI 4S05A 3HDDA 2GA2A 1QPIA 3L2UA 1EJ9A 5GTIC 1ZELA 4F93B 3IH3A 2GXAA 4TV7A 1TC3C 3ULQB 4UV9A 2DCEA 3I4PA 5EYRA 3QP5A 1O4XA 3C2BA 4ANJA 2ELJA 3AFHA 2YX4A 4U7DA 5FRMA 2L4MA 3ABLH 4CA0A 4IPAA 2IT0A 2DXIA 2QCOA 5IP7J 2M8GX 4HYEA 3TL4X 3RPUA 3OYDA 2VKVA 1I3QJ 3RKQA 1B8IA 3IWFA 2LBFB 3TDUC 2H94A 5L3FA 2H1KA 4MEYF 3CMYA 5A2QK 3KIOA 3OSGA 2CQXA 2DOEA 4XRFA 3H9QA 5C44J 2DJNA 3I71A 3A1YA 5EDNA 2PLYA 3KEYA 1FC3A 2V1DA 1JKRC 3VSKA 2CGPA 1ULYA 3OYLA 4HNVA 2ID3A 2JJ7A 3OV8A 3M7GA 1BI2A 1LNWA 3ZQHA 4HX8A 2V1NA 1EA3A 1FOKA 2M4GA 1B9NA 3UKGA 1BOAA 3EUHA 1WJ5A 2BHYA 3SZGA 3BQZA 1IV6A 3H9JA 5GAHJ 2VJ4A 3K4NA 3JSOA 1IUFA 3VPRA 3DV8A 2HXIA 3AAFA 2CS3A 4NBQA 2WV1A 3S1MJ 2EBIA 3GCMA 2V26A 2PJRA 2CW8A 2FMLA 1MH4A 1ZTRA 3RPQA 2K02A 5J8CA 1VQMI 4L0YB 1SAUA 2X6YA 3CJQB 4RB0A 3E6DA 2HQ5A 1VQ4I 4I99C 4R8HA 5H2FC 2LDUA 3M3YJ 1SVMA 3OYJA 1OKRA 2EV5A 5B1AH 4E7ZA 1Y39A 2QQ9A 4LIVA 2R7FA 4NDLA 4WXDA 2H1LA 1XCBA 2ZXWH 1NH3A 3N05A 4CYDA 2FBIA 1W7PA 4P5OA 4BDZA 2NYXA 5K5OA 3M8JA 4AU7A 3NEUA 2VXZA 3QU6A 3R61A 2EA2A 2DK8A 4M9XA 2EFPA 2O5RA 3HTUA 2EV0A 2Y0SN 4JOMA 3OYFA 2FOKA 4KA4A 3R0JA 4QSHA 2VQGA 2L5QA 4CICA 5F08A 2Y0SA 1ETVA 2KISA 1ZGAA 1V5FA 3ZQGA 2ZFUA 4U0YA 4I01A 2XKPA 1S7EA 1A6IA 2NS8A 1HW5A 2V1UA 3RZOJ 1V4RA 4KIGA 1Y6IA 3MN2A 2DFIA 4M73A 2HYJA 3HL2A 4PK4A 4CGZA 5K7FA 2L9RA 1MBFA 3VDXA 2LSOA 4HLYA 3FZVA 2D2WA 5CQEA 2Z2SB 4C9YA 4CUGA 1T6SA 3ASOH 1QZYA 4BACA 2VN2A 4HZFA 4ON0A 2NRAC 4V2FA 1G59A 3E6CC 2JVHA 4Y17A 2J5PA 4DZJA 2A6EF 1L3LA 3G1MA 4MGRA 3HUGB 1RNLA 1X1BA 2NOGA 4W1UA 3ZQ7A 3CJRB 2LK2A 1A31A 5BOXA 1GVJA 3FXKA 1Z21A 1AKHA 1JTYA 3HOVJ 2F5VA 4HSTA 5FD6A 1I1SA 1VTNC 3WGGA 5GP9A 4J01A 1HW1A 5HVQC 3E6MA 4YRVA 2E2JJ 2COMA 3PQJA 2V9VA 1I3AA 5EGOA 2XRLA 3OIPA 2L7FP 1YIJI 3TO7A 2ZFWA 3TOAA 2LVSA 3U9GA 2ZNYA 1Y1VJ 5FKNA 4S0HB 4NB5A 3I58A 1JGGA 2W57A 2X6WA 3KP5A 5H6QA 3HZJA 2X6XA 5HDGA 2W82A 4G8XA 3OYCA 2BVLA 5L3BA 2GXBA 4CHUA 4B44A 1MMDA 2BY0A 5HDKA 1A35A 1OJLA 3D5RC 4YIRX 4HF2A 1IAWA 4MHGA 1M1EB 4ZYEA 2P5VA 3FXJA 4X6AJ 3OL4A 2OQRA 1MBKA 3K70C 3GTMJ 4CCLA 3T0YA 3I53A 2BGCA 2BYVE 4S04A 4IRGA 1ZLKA 3GZ5A 1ZH5A 4BE0A 3AG1H 2VT3A 1U8RA 5J1YA 3D1NI 1QO0D 3A01B 1ZK8A 3ROUA 2JA7J 2ZXIA 3DTKA 5KCMA 4EJTA 3REOA 3A01A 3J81K 5ERIA 3I59A 1MH3A 1UJ8A 1OCZH 2IS1A 1ETKA 2K85A 1EH8A 3JR9A 3EDPA 3ZPLA 1N25A 2CSOA 2GLOA 3CCLI 1J9IA 3H5NA 4RAZA 1BC8C 1J59A 2FD5A 5LGTA 5J8FA 1YJWI 4LLGF 3MQ0A 4L5JA 3AKZA 1TWHJ 1T38A 1POGA 1OCCH 4C2TA 2A05A 1LPQA 4IHXA 5H6RA 3IAM2 2XGXA 2ZSIB 2RNJA 3LA3A 3ECOA 2QBYB 1ZHFA 5E1XA 5AIPA 4XLPF 1I50J 1KQ8A 5KAFC 3M1EA 1FLIA 3LSPA 3WTZA 4I6ZA 2MABA 1NK2P 1B8IB 2HZTA 3BCAA 5ILUA 1LVAA 2VT2A 2A6HF 2NS0A 3QPHA 3O8HA 5E8GA 5DM7F 2ID6A 5IYBJ 1S5LC 4KN4X 3GFJA 3ZMVA 5JVTA 1HSJA 1FBSA 4BKXA 3SDBA 5BQTA 1R1UA 3CQZJ 2AXTC 2DMTA 2WB1A 2KRHA 4IQ4A 5AONA 3CCYA 1E3PA 1WVRA 3HKZN 2CU7A 3PNYA 4HF0A 4P55A 3JCUC 3OS2A 2WWYA 4UB8C 1FOXA 1ENHA 4FHTA 4KNYA 1IXSB 1XCVA 1IN8A 1FIAA 3A03A 3DBLB 2QZ8A 3HRSA 3DLLF 4IZZA 2ZXJA 3I54A 1FP1D 3C3WA 3LWFA 4PCQA 4EM1A 3L2QA 4E7IA 4RGUA 2OD5A 1B59A 4P9UA 3CCVI 3KP4A 1T56A 2DFHA 3MZYA 3GTPJ 1T0FC 2IVMA 2R5ZA 5ICFA 2IS4A 1HKTA 2WTEA 3BJOA 3HM5A 3NAUA 2NVQJ 3Q9VA 1X4PA 1IXCA 3NWSA 2MLGA 1TP4A 5FRNA 3BROA 4QWQA 1JT6A 3PJRA 2R7TA 2OZ6A 3DU6A 4HW0A 5F1JA 2GIVA 2R7RA 3R6SA 2K9NA 2LKXA 3A2KA 3RKXA 4YEJA 1RI7A 5C3EJ 2IA0A 3H9GA 4CH7A 1YW9A 1T39A 2KJCA 4UUSB 2A69F 4BJTA 1NHAA 3G6EI 1ZRFA 3E97A 3A02A 2FBKA 4ZJZA 1OYYA 1NTCA 4L5EA 4U0WA 4Y4RA 1O57A 4AC0A 2JT1A 3H1CA 5LHGA 4PZJA 3F6VA 2FE3A 1XB4A 2FQ4A 4Q4ZF 1Y0NA 2J5OA 3JTHA 3W3CA 2FSWA 1TWAJ 2P81A 4M72A 1R6RA 2DU9A 4E70A 1R71A 4A3KJ 2HDWA 4DIQA 1MMNA 3ZN0A 2R4GA 3HPGA 3TEDA 2Z16A 4AYBA 1IO2A 2OJED 4DYRA 2JA8J 4BQNA 3ECHA 2DFFA 1D8JA 2CJJA 4R79A 2OF7A 3DU5A 4A6EA 1ON1A 1F43A 5J40A 1QGPA 2ZKZA 3DEWA 5IP6A 2HDDA 3BR2A 2BV6A 1MBEA 3BZCA 5E3LA 2E36A 1QZEA 2RAEA 3BZ6A 2EIMH 4DGWB 2V4JC 1WHUA 3BTIA 5GADJ 1YS6A 1JHFA 1IG7A 2A07F 3JAMK 5C4XJ 2ADUA 2KHMA 4P9FA 1X4OA 3IV5A 5GPAA 3S1QJ 4I02A 1MDMB 4IF4A 4EQQA 1U5TA 1APLC 3JRBA 2XSJC 3KP7A 1UB9A 1SANA 4OU0A 1OISA 4BU2A 3FHZA 2R5YA 4LLNA 4Q47A 5LRSA 2E7XA 3C7JA 3R0AA 3JRFA 3M4OJ 2VQCA 1JXSA 1Z91A 4B09A 2QVOA 2E1MB 3L2CA 3EPZA 4ITVA 4CCOA 1LKXA 1FY7A 1TZLA 2R7OA 3K1NA 3CO6C 5CLSA 4XRSA 4QPQA 2E71A 1O3TA 4B4CA 2CV2A 1TBXA 2M3AA 1JUPA 2EA4A 1MBGA 1ZN2A 2GXGA 2R5ZB 3LSGA 4I76A 3LSJA 3H0DA 2RNGA 2XROA 1XSDA 3S2DJ 1DPRA 1MDMA 2R7WA 1XPXA 4HDUA 1UHSA 1XC5A 3I0TA 5D8LB 4JYKA 1WGXA 2KLOA 3LAPA 4X0GA 3PIOF 3CUQB 2LF8A 1GV2A 2B0LA 3DFGA 3VB2A 1GDTA 3PFYA 2VBXA 2EFQA 3BPVA 1JE8A 1MKMA 3IAS2 1IW7F 4RS8A 1Z9CA 4UNOA 3BDDA 1DDNA 1SEUA 4OIRF 3ERED 2F48A 4KDPA 2QUFA 2DA6A 1VQ5I 4BQOA 3V8LA 2R7UA 4HG2A 4XRSG 2VIXA 3ABKH 4JQFA 4II2A 5DD4A 2DQRA 3OYNA 2BY1A 2JA6J 1AA7A 2YX7A 5CYVA 3GYHX 1F9NA 2KIFA 5DM6F 3MKLA 5CVVA 2PI0A 4BQAA 3S32A 4FCYA 2G7HA 3A0BC 3KZZA 1B9MA 1MNDA 3SEQA 2OBPA 4BYYA 4HNTA 3GFIA 5JVGF 4MFDA 3IP4B 2VL8A 5CPRB 2QBYA 3RQ4A 1GHCA 3BLYA 4Y33A 2M0MA 2R3SA 4IHWA 1FYKA 2ICWG 4FISA 3KLNA 4XLCA 1WJBA 3KYLA 3S93A 2BBYA 1ZG1A 2CW7A 3CCSI 3PM1A 3J80Z 3QPTA 1OQYA 5J6XA 1MJBA 4F91B 3HBLA 4AVPA 1JT0A 3S14J 4RB3C 2Y9ZA 2V7FA 2Y69H 4MIMA 3L2VA 4NQWA 1Z7LA 4GO1A 1TWFJ 1ZRDA 2H8RA 4M3BA 3W6VA 5GAGJ 1X2NA 4A0XA 3IRQA 5JR3A 3KP2A 1BR2A 2EZIA 1Y8RB 3O3KA 3E5QA 4M74A 3K2AA 4Q5SF 4YFXF 2OAZA 2FNAA 4MEXF 4G94A 4XN0A 3GF2A 4LIUA 4FE7A 3M9AA 1LDKB 3PNTA 3ZRGA 1HSTA 1E2XA 2DOFA 4LB6B 2VC1A 3CMAI 3ZQQA 4CCKA 3SQNA 1X3WB 4EM0B 1U6GA 5J3LA 4IQJA 3IKVA 4L0ZB 2VJJA 2M7AA 2NNNA 2ZO4A 3OS1A 1OYWA 2HQAA 2E5ZA 2PFBA 4QLCU 1GXPA 1ODDA 3I64A 3RCOA 3TQNA 2TDXA 2EWNA 2AQEA 1RRJA 1YX5A 2EJRA 4JK1X 2AQFA 2BY2A 4E7LA 4XLAA 4XSXF 3MVPA 5L3DA 1YIOA 2ZXHA 1P4XA 3WHBA 5HLTA 2YR2A 1OCPA 4M3DA 3VEPA 5LEJA 1IRZA 3MAJA 4FT8A 2F6CA 3BJ6A 2BY3A 4KYWA 2MGQA 4HPQA 2PEXA 1RPWA 3GZNB 4L9TA 5L3EA 5CVUA 2QA4I 1FP2A 1J5YA 1R4NB 2UXXA 4EJWA 2DI3A 2B63J 5FLXZ 4Z2YA 3GWZA 1EH6A 5ICGA 4KN7X 5HLGA 1OCRH 2RV8A 4BEHB 4LG0A 2UWMA 1FJLA 3IRRA 4BY1J 2VXDA 2IP2A 2RREA 3QOEA 3HYIA 3JTGA 1FYMA 2EILH 3AL0B 4BEHA 1SD5A 4PSWA 1IGNA 1UHWA 2IA2A 4P1WA 1I6XA 2A61A 4AYBN 2EQRA 1WI9A 4UVCA 3RIRA 2KRCA 3DBHB 4HEA2 1HOMA 2X0LA 1ETOA 2QGUA 2V9KA 3T8TA 3J7ZI 1TW2A 3MFKA 1JHHA 1B6AA 3P9IA 2PMZA 4ZTJA 3HSFA 3QP6A 2CH0A 3GZ6A 3ZXSA 4E6KG 4BUPA 2BEOA 1O3RA 1MD0A 5IPAA 4A6DA 2KZGA 1RR7A 3VYSB 4WX9A 4N4NB 2WV0A 4ZDLA 3F3XA 1RETA 5CVJA 1RKWA 5B5EC 1ZQ3P 3SXYA 3RZDJ 1YO5C 4Y15A 4BXFA 4XORA 2DT6A 3S3MA 1Z67A 2XPVA 2HTJA 4XKCA 1ZAOA 3OOPA 1MJAA 4WXHA 1AHDP 2E1MC 2GWRA 4HNUA 4UUVA 1VZ0A 1FWZA 4KT6A 2DLLA 1HC8A 3CDIA 4F55A 2HGCA 2JPCA 3BZKA 2Y9YA 3H92A 5J1UA 1SFEA 1CF7A 1R5HA 2LC2A 4UY8I 4DBRA 2XRNA 1HXDA 2X85A 3MZ8A 3PNVA 4LITA 2RN7A 5B66C 2HS5A 4XLEA 5B3SH 2L0KA 2COBA 2ELKA 1U9NA 4MQVA 1X1DA 1L0OC 3Q9SA 2PJPA 1R22A 3BPXA 3RYRA 3HHHA 2NOJB 3KLOA 1U9OA 4LG0B 3LL7A 1AOYA 1XGNA 2ZSHB 1W4MA 3U1KA 1LFUP 2R7SA 1G3SA 4HQEA 4KMUX 5DS9A 3BG6A 1FOYA 3T5XA 4NNJA 1QBJA 2PMHA 4CZCA 2IGMA 4LK1F 2KIUA 4DQ2A 4NUBA 3I55I 2XAQA 3G73A 2CUJA 2PBIA 5LD2C 3BG9A 3Q0VA 2HEOA 3PFIA 2ZMEA 3VODA 4I2OA 1C0WA 4B3XA 4MTEA 1XSXA 4BQQA 4QPOA 2R7XA 5EG0A 1U2WA 1YOVB 4ESBA 3G1LA 4U87A 1VQ7I 2G0EA 3KX2A 4A5MA 2JWTA 3ZCOA 1LDDA 2R92J 2VODA 1IJWC 1DU6A 5M3MJ 4WCGA 3HTSB 2M7BA 2FOWA 4CCJA 1ETYA 1Q1HA 2QENA 1PUEE 4ZZLA 4PJMA 3ZMSA 5CJ9A 3GBGA 3HPHA 3CUQC 1VQ6I 4EATA 1MMGA 5D6EA 2VBYA 3LSKA 2P7VB 3HRUA 1XDUA 2OC6A 3DPLC 2HKXA 2X1EA 4YG2F 4AIJA 2BVMA 2E1NA 3QQAA 2WA0A 4BHCA 3I4MJ 1U0JA 1OMIA 1D1BA 1FMWA 2HVQA 1O3QA 1HCRA 3OS0A 3DXJF 4I98B 3HIFA 2F2EA 2QQ8A 2JK3A 2FRHA 4DYQA 1N77A 3CDHA 3FM3A 3SHFA 1OFCX 4FASD 5H20A 4HOBA 3PSFA 4E7HA 4OIPF 3L7WA 4M6YA 4RGRA 3RJPA 3K69A 4IRIA 1XMAA 4HQMA 2KP6A 2XKOA 2X6OA 3K6GA 2WY8Q 3IL2A 2E19A 5F0CA 2Y48A 2DA7A 3I3LA 2GM4A 2KFDA 1JI8A 3GX4X 4E7SA 3VYRB 2E1CA 2L2OA 4BHBA 4MTDA 1KGSA 2ZB9A 1YHQI 3IC7A 4LMYA 4XBFA 3LFKA 1SMTA 2GBYA 2NVYJ 4XKBA 1XSVA 2HI3A 4IJAA 2X4HA 4CCNA 4GFBA 2ESNA 3FMRA 2DA1A 2W84A 4M3EA 3FXLA 1P7IA 3FKIJ 3S3OA 1FBQA 4GGGA 4V2GA 2GA1A 4XLHA 4XONA 1GUUA 2L9VA 3V4GA 1X1AA 2JSCA 1VQOI 3CCUI 2EIKH 1ON2A 5KVRA 4N4OB 1XMKA 1V3FA 4A3CJ 1YYVA 3D5LA 2DMPA 2VPRA 4HLXA 4A3IJ 1B72A 2YUSA 1HLVA 2UZKA 2PX9A 2WBMA 4LGWA 2LYCA 3A4CA 1H8AC 3V7CA 1X3ZB 2H6BA 1YG2A 2Z33A 3FXUA 2QYOA 4D5CA 2L7ZA 2QWWA 3S15J 2VKDA 2CRGA 2NAZA 2OQGA 3EETA 1SD6A 2FUG2 1TL8A 2BW3B 3K4BA 1XTAA 5FO5A 5ILVA 4KISA 2BE5F 3TW7A 1S7AA 1G3TA 2Y0MA 1IN4A 4HSRA 3CMEI 2CMPA 5K7ZA 2KPMA 2EK5A 2O6GE 2VBWA 4PGHA 4MLOA 2VJ5A 2LTPA 4Y13A 5FFZA 2MW8A 1MBHA 3GFMA 2I5UA 2LRDA 2QEXI 1ZYRF 1EF4A 1QA6A 5TGTA 2HXOA 1K83J 4F7ZA 4RGXA 3S1RJ 1OCOH 3J7AY 2IJLA 4C3JJ 1A36A 4UVBA 4LFUA 1LE8B 2LY9A 2WAQN 1B4AA 6PAXA 4II3A 1EKEA 1IN6A 1K4TA 2EB7A 1IF1A 5IT9Z 3HRMA 1X3UA 2D45A 5EG0B 1K7AA 5M5WJ 3VSLA 2K5CA 3WG9A 1XMXA 2X51A 5E79C 2IGOA 2XUBA 5HOOA 1ETQA 2LY1A 1TNTA 4GYGA 2XHKA 2IEKA 2R5YB 1W0UA 3ZGKA 3RI4A 2IAIA 2EZLA 2YS9A 3G2BA 4WK8F 3IH4A 3U21A 1J2XA 3J81Z 2HOAA 5BMZA 4GRIA 1KQ0A 1LFPA 5LHIA 2UV1A 5M5XJ 1G6NA 3GTJJ 2VKHA 5IY5H 1YLFA 2XGDA 3GTOJ 1ITYA 4O5VA 5ICEA 2FJ1A 3HOZJ 4PJ0C 1J7KA 2VE8A 2XF7A 2IPQX 4QTRA 1Y0UA 3DF8A 5M5YJ 3FMSA 2EINH 3HJEA 2Z9OA 3BTJA 1U3EM 2F4IA 1VQLI 1OCTC 2BZTA 1SMYF 4YIFA 5BPDA 2KL4A 5JHFA 1IN5A 4EJUA 1W5SA 2GAUA 4HX4A 1Z0XA 2O8XA 1B72B 2M2EA 1YJNI 4KFCA 1EV7A 1WJAA 2M0CA 3DBRB 2YPRA 1T98A 1W5TA 5K7HA 3QODA 3T1BA 1VNDA 4NC6A 5ICCA 4G7HF 3BWGA 4MO7A 3SJMA 1J75A 1TTYA 1TT0A 1FYLA 3DLAA 3HG9A 3KZYA 2VC0A 1S8NA 2DJIA 1D0YA 1KYZA 1X19A 3E7LA 2VJIA 3I59B 5FKKA 2MSYA 2XAJA 4ETSA 1ORKA 2HR3A 3CCEI 1O7FA 4HDVA 1OYIA 1WI3A 2B9SA 2IA1A 2RC4A 3BTCA 2V1XA 5AIQA 4HBLA 1AU7A 3M1CA 2M30A 2LBFA 3F23A 2XDVA 4XMYA 2EIJH 1P92A 2H27A 4ZDPA 4M71A 1SFUA 1BC7C 2DN0A 5KNLA 4XOTA 3NRVA 1BI3A 1S6LA 2XAHA 1Z3YA 1VI0A 1Z6RA 3RYPA 1QZZA 1R1VA 3QYEA 4ZYGA 1N78A 2XV4S 3JRAA 2A6TA 5DD8A 4EVIA 2Y30A 4G7ZF 1XGMA 3CJTB 3F22A 2GQQA 2OV7A 2JA5J 1H9GA 3QYBA 3K4LA 4IHYA 3OYMA 2E34A 1XGSA 2JMWA 2KMUA 3DWLE 4A2UA 1IZ1A 2HFHA 2BOLA 2LLKA 3MKWB 3ESWB 4PGGA 2DQLA 4ENJA 2F5FA 4I09A 1QVUA 4RA2A 3K70D 2AO9A 2STWA 2ZC2A 2XF5A 5D5XB 4RAGA 2HQNA 1G8XA 4XIDA 1QU3A 3KYCB 3OL3A 3LSMA 5HDNA 1UELB 2CFOA 5LRRA 5EGOB 1W36D 1DP3A 3K4JA 5HLHA 3CC4I 1BI0A 3CESA 3F0CA 3GW2A 3CUQA 1HDPA 1IRFA 1R1TA 3FBIB 1REPC 2JSPA 2ECBA 3AG4H 5J4VA 3UR3C 4O3MA 4EGYA 4IL6C 1AWCA 1FOWA 1IRGA 1TQIA 4FE4A 5CQGA 1LQ1A 2Z1DA 1E17A 1QQIA 3Q0UA 3CMMA 3FMQA 2DOAA 4BJ6C 3E6BA 2P7CB 2EPFA 5D8KB 4ZYAA 1SC7A 1QHHD 3QWLA 1HKSA 4PDKA 2L54A 3OIQA 4EMSA 3SFZA 4BE1A 3F8FA 5E17F 5C4JJ 3RKWA 2DT5A 1BJZA 2QSFX 2KIQA 1BA5A 1CF7B 3W2AA 3S17J 1MMSA 2NNYA 3DQVC 3ZQFA 3FXOA 4CXFA 3CJNA 3NARA 3V8JA 5LGUA 1Z05A 2K27A 4KUMA 4RB1A 2G9WA 4G6TB 4L9VA 4M9ZA 2K7LA 3DKWA 3CP8A 3K9TA 3JRCA 1MMAA 4ZTFA 1MNMC 2HOEA 2O3FA 1PJRA 2CUFA 1WKMA 1X1CA 2V6CA 2VB6A 4ZC3A 3OYBA 1W7PB 2XB0X 2L9NA 2V79A 2XPUA 4B48A 2RVCA 2HYGD 3J7AO 1VQ9I 1V5GA 3KFWX 4RAYA 1XN7A 2M45A 1K6OA 1MNEA 2DAOA 2W24A 4EM2A 1DPUA 3PL8A 2HOSA 3L2WA 4JX6A 1XDSA 1UZCA 2DTZA 2RQQA 2M9HA 4PFOA 2NVTJ 1MSFC 1SFKA 1JUMA 3PO2J 1X2MA 2OCEA 3D5SC 3FISA 2EFOA 5KHDA 2P0WA 5D6FA 1D3YA 4I0BA 1K78A 2UUZA 4UB6C 4IHVA 3FK7A 3DPUA 5E3MA 3CZ6A 1T8IA 3H3VK 1OLTA 2ESHA 2C6YA 3TOBA 3ZMUA 1K79A 2W4SA 1UHMA 5B1BH 3H5AA 2E5NA 3MD2A 4L5IA 2XIGA 2CO5A 1H0MA 5DV5A 3BCBA 2HVRA 3EYIA 2P4WA 3RDIA 5CKTA 1AKHB 1U5TC 2CQKA 4IHTA 3ABTA 4DZPA 1LVKA 4OINF 2MH2A 3WTVC 1PUFA 3BR0A 3ZMDA 4FTHA 4IRHA 4Y7NJ 1DP7P 1HQCA 2HOTA 1TQPA 2BHZA 4A3MJ 1UMQA 1GV5A 2DFEA 1RUOA 1LB2A 2YU3A 2CQ7A 4NQWB 4BBSJ 1LJ9A 1Y56A 3RSNA 1I1GA 1FZPB 5HLIA 5DTDA 3DP7A 4C3HJ 5KK1A 1VQNI 4AWXB 1WSUA 4D7MA 1ETWA 2L02A 4DOZA 3BR1A 3SFIA 5J47A 4UXNA 2D5VA 2X48A 2CUZA 5FROA 4BDYA 4AD9A 2Q2EA 5JFRA 1XGOA 2EH3A 5F64A 3LNQA 1ZG5A 3AG3H 4BBRJ 3MMYB 2OPTA 2VBZA 1GT0C 3DEUA 3J80K 2F5CA 4WXCA 2X1CA 3SZPA 5JLWA 4BS9A 2LG4A 1P4WA 2Q1ZB 2F4MB 2QF7A 4XL9A 5LEKA 3JW4A 3CTAA 2LP0A 1T08B 1JUSA 2MH9A 2QLZA 3K1MA 2FEZA 3S16J 3MWMA 4QIWN 3FXRA 5D5WB 3R60A 3CF5F 1RZ4A 1SFOJ 1J09A 4LB5A 1FPQA 2PMUA 4CCMA 4IXAA 1P6RA 4U7BA 2IS2A 2Z5UA 2BW3A 3OYKA 2K3FA 2W1OA 2ZMEB 1BW5A 4IOAF 1H88C 4ENNA 4A3GJ 3KZIC 4XR6A 4PJJA 2LKPA 1SVLA 3ABMH 4CYCB 4V19K 1NG7A 2CG4A 1USTA 4LOCA 1FX7A 1I6HJ 3QU3A 4U0VA 4JX4A 4P96A 1SD7A 1G2HA 1FNNA 2L3DA 1PDNC 4UUTA 4RM2A 4ZYDA 3H3UA 1DGWY 2ZBKA 2CFXA 2G7UA 3M8FA 3OMYA 4PSXA 5LBQA 2MYSA 5FB2A 1ZLJA 2WC2A 1EH7A 2R0QC 1D0XA 1LUJB 2VUMJ 3IH2A 1IDYA 3DKYA 2YSRA 3HHGA 4U88A 2W00A 3IUOA 3K2ZA 2BXZA 4IO9F 4A3EJ 3G1OA 2K40A 3TKYA 3TW6A 3FIWA 3HEFA 1ZKGA 4RGSA 3RTRA 4IEJA 4D5FA 1BR4A 1Z6TA 2NS7A 3ASNH 4XKWA 4YELA 1YE9A 3Q5FA 2FX0A 2OTLI 3DTEA 2ISZA 1QNTA 2IBDA 1K78B 1D5VA 4GDFA 1JKOC 1CGPA 3G71I 3WODF 3E5UA 1RIOH 2R7VA 3BR3A 1BN5A 5F1RA 2OA4A 2R7QA 5EZGA 3COAC 4KMFA 2CQNA 4YFKF 4KIBA 4M3GA 2JZYA 3OSFA 3HB9A 3ZR8X 5FJ8J 3QRFF 3TGNA 3C18A 2CUEA 2RKHA 3V42A 5K5RA 3BR5A 5J4YA 2L9SA 3TBIA 3MKZA 1F4KA 2DMUA 3G3ZA 2O8KA 1H9TA 5FLXK 5IYDJ 3FX3A 3MEXA 2Q0OA 2XC7A 5TRDA 5IP9J 4Q48A 5F0FA 3OYIA 2NVXJ 2ACJA 2VQHA 2STTA 2ECCA 2RGVA 2Y31A 3I5UA 3G4SI 5HNFA 3B6CA 2DT7B 3BJAA 5GTHC 3J7YJ 3ZQCA 3PUBA 3L09A 2XVCA 4A3JJ 1W0TA 1D1AA 3F8CA 4ZZDA 1PP8F 3CC7I 1TWGJ 1QPMA 4B43A 1O7LA 2OZUA 4ENMA 2P6SA 1YTYA 3O6BB 1QVTA 2VKEA 4BHPA 4DBQA 2GZWA 4FX0A 3EYYA 1PP7U 2L7KA 2KT0A 4B47A 1YFHA 1PVEA 4OIQF 5J1RA 2LH9A 4F92B 1B1BA 1BIBA 3KP6A 5DEQA 3PSIA 4BY7J 1S29A 4EV0A 3HOWJ 4A3LJ 4AIDA 1HDDC 5F04A 5DUKA 2E2IJ 2Q8KA 1BOBA 3CCQI 1I39A 1JTXA 4C3IJ 1RKTA 4RLFA 3LSIA 5EF6A 3I4NJ 2LNBA 2JUCA 3BG7A 1OR7C 2LR8A 2P6TA 4CYCA 1BM9A 1HW2A 4E4HA 3CCRI 1RR8C 4PJNA 1YRNB 4G9YA 3K4KA 3DEEA 4HV6A 4RAFA 5HS7A 2BXYA 3JRIA 3BP8A 2FMYA 2M1BA 5BNGA 2CWEA 1K61A 1FT9A 1QHGA 5IOZA 2D1HA 3W6JB 2DYRH 4M9SA 4XN3A 2F4OB 3F72A 1TLHB 1Y1WJ 2OU2A 4OIOF 4K2EA 5M3FJ 5E1WA 2MC4A 5K5QA 2P8TA 1YITI 4HV5A 3A0HC 1MZBA 2WAFA 1JGSA 5JLXA 2XPWA 3CUOA 1Y8QB 4FQGA 2P5KA 3ZQLA 2K9QA 2M4KA 3NWTA 5IT9K 1FTZA 3VOEA 3BG3A 4I7HA 2QQBA 2CV1A 4DYCA 5CVRA 2XASA 2DPUA 3KP3A 3QPSA 3ISPA 3ML6A 2MBFA 3ONQA 4YFNF 3P5JA 3W2WA 3JREA 2GIZA 2ME6A 3U2RA 3HOTA 4E7KA 3BR6A 2K9SA 2KJBA 1Z7UA 3W2VA 1LFBA 4BE2A 3L00A 3WTYC 1WJEA 2KRFA 3BOQA 3LQRA 4XKVA 4M6VA 2L7MP 3JSPA 1YX3A 4Y52J 4MQ9F 2KQRA 4ENKA 1KU7A 2E2HJ 1U78A 4BNCA 1FMVA 4OMYA 4IHSA 5D4SA 3F6OA 1E3HA 3T8RA 3MZHA 3WE3A 2R7ZJ 4R1HA 3TP3A 1IUYA 4NC8A 3WGHA 2EZKA 4HX7A 1BW6A 3BC8A 4CSWA 5FKMA 3ZN1A 3OYGA 2W25A 4H4KC 4HF1A 4OWRB 1IXRC 1D0ZA 2OCCH 3LMMA 3WU0A 3LA7A 4UUSA 1K4SA 4A3DJ 2N8GA 3HUGA 3CLQA 1R4MB 3HOSA 1IRXA 4A12A 2B7EA 4HAMA 1I27A 2DO7A 3K0LA 5A2QZ 2HKOA 1H89C 1VQ8I 3D0SA 3I56I 1F1ZA 2ZJPF 3PO3J 3FDYA 3U1DA 3ZMZA 3OR1C 2M8EA 4B3AA 1S9HA 1ACIA 3LSTA 1J0RA 4OMZA 4LLLA 2V9PA 3E5XA 4M6XA 4GYIA 2PMZN 3HSRA 2XGCA 5EEGA 3PUFA 2LY2A 2HU9A 5F27A 1IN7A 2EFWA 3WTTC 3MKYB 4ZH4F 5FKOA 1T0FA 2WAQA 3F8BA 4OAYA 4UHTA 2HZDA 2DA5A 5D5VB 4CDGA 3KETA 1A5JA 1KA8A 1P2FA 4C2MJ 4FX4A 1R49A 3RQIA 3S8PA 5E8IA 4NC7A 3TP0A 3H36A 4ZYHA 1NG6A 3CDLA 4AIKA 4IVNA 5L3CA 2IS6A 2DA3A 5FGMA 2VOPA 4X1EA 4UVAA 3KPHA 3RKYA 1X58A 5K1YA 3LSRA 4BH9A 1OPCA 5KAIC 4KICA 1YS7A 4BGDA 1R5ID 3C2HA 4JX5A 1ZR2A 2TRTA 4XM3A 1E3OC 1DQUA 3GTQJ 1A6QA 3H3ZA 5IT3A 2ETHA 2EFNA 1FTTA 3TO6A 1P9QC 3H5RA 2RDPA 1F36A 2Z3YA 3E0JB 4M3FA 1XS9A 1MBJA 2JUGA 2DA2A 4EGZA 2MLKA 1MIJA 5GPCA 4XLFA 2JA2A 1I5ZA 5E3OA 2LD5A 3ZP5A 3AL0C 1NK3P 1MW7A 1WZ2A 2PJRB 1W7PD 3GLXA 2DW4A 1ZRCA 2JN6A 2DYSH 4Y3OA 2KZVA 1ERDA 5DCMA 3WHCA 3N4MA 1JJ6C 3FK6A 3UNGC 4W97A 4WWCA 4J00A 1BBYA 2WADA 2QSGX 1WRJA 1WCMJ 2A5YB 4XOPA 5HS8A 4J19A 3CF2A 4MFEA 1D8KA 1V55H 3L2RA 1STZA 1CQTA 1KU3A 3CP2A 4JP0A 1KONA 3VYUB 3E1SA 5LGNA 2K86A 3L9FA 2ZNZA 3QAHA 1IV8A 5LLQA 3F8NA 3ERMA 1HBXG 4RMNA 2VPLA 1XG1A 2FNPA 2VLAA 3O8GA 2IGKA 5DCMB 1GXQA 3OYHA 5E20A 2H09A 4XLNF 4IOCF 1JKQC 2XB5A 3DTIA 5HODA 4C2UA 1TWCJ 3F9KA 2I8DA 1YRNA 1BI1A 1K6YA 3CO7C 3K10A 2Y75A 3EUAA 4A0YA 3Q0WA 2DBBA 3OOUA 4WF2A 2R7DA 2OUMA 2WB1N 1FSHA 2E35A 2LFBA 2XAUA 2XGEA 1Z77A 3PQKA 4D0PA 4IKFA 1KU2A 3GFLA 2EZHA 1WFXA 3B6AA 4DW6A 5DUIA 3SZTA 3CCJI 2L01A 3P9KA 3FWEA 3SYTA 2P5LC 4YIIA 1FSEA 4MNUA 3S2WA 3GTKJ 1YQAA 1FBUA 2LMDA 2FBHA 5CVIA 5ED4A 4DNCA 5L3GA 5D5UB 1R9TJ 3BQYA 1GVDA 3QYFA 3DKXA 4I0AA 4A69C 3FBNB 1BJAA 5FKLA 1F5TA 3V7RA 4D7NA 5F6FA 1T33A 2LKSA 2ISYA 3GO5A 2CW0F 3LOCA 4KJZA 3P9CA 4XNFA 2MFZA 1VQKI 2HQRA 1U5TB 1TT5B 3CCMI 3KE2A 3LA2A 1VF9A 1G3YA 1Z3XA 4ABZA 1QRYA 2PG4A 3OIOA 1SD4A 2Y2ZA 2QQAA 2DODA 2X9DA 5DDGA 2V6EA 2L4AA 3EQLF 2VE9A 4DJAA 1KQ9A 2F5EA 1USSA 2KKOA 2K3PA 3TO9A 2VOOA 1WJFA 2MA3A 1WQ2A 4EJVA 1V54H 3SDGA 2OTJI 1SVOA 1D1CA 3HOXJ 3PIPF 2E60A 2XSDC 2KDOA 3K4CA 3B73A 4A5NA 4PUSA 3GLLA 2KIMA 4EJOA 2KDZA 1WJDA 1ZGWA 4A3FJ 3IWZA 2ZJRF 3OYEA 2MD0A 5IYCJ 2O7OA 1RC9A 3B02A 4OOIA 3KEOA 4L9NA 4LK0F 4XQFA 5EZHA 2Q2EB 2X1DA 3K4MA 3MCZA 1DGRM 2JRMA 1SAXA 3BY6A 3GMEA 2FF4A 5FD5A 3VWBA 3FXMA 3FM5A 2LF7A 2DK5A 4G6QA 1R36A 2XF6A 3I9V2 4BL0B 1UG0A 2Z99A 2W85A 4PFPA 3WG7H 1LEAA 3S3NA 1YW8A 3V7SA 2VASA 9ANTA 4RBOA 5E18F 2R93J 3EUKL 2DMNA 3BTLA 1KZHA 1YJ9I 1RESA 4G6DA 3OY9A 1ZGJA 2QSHX 5EEAA 2HPMA 1HA8A 1X1PA 4PJLA 1N75A 3GTGJ 3AG2H 4B1RA 4G12A 3EUHC 1PUFB 3R4KA 3HSEA 3Q3SA 3GVAA 5FLVA 3DPTA 4ASNA 2W7NA 1HKQA 1MSEC 2QM3A 2VONA 2O61A 2PN6A 2O03A 2UXNA 3O2PE 5TISC 3LFUA 1TQMA 3HXLA 4RDUA 5HS9A 2A5WA 1DU0A 1R23A 2IXSA 1FIPA 1PYVA 3ZQIA 4ZDOA 1E0EA 5LHHA 1T95A 4E7JA 3K7AJ 4GCVA 2JQ7A 1WPKA 3TMOA 3WTWC 4XK4A 5TJJA 1WH5A 2WY7Q 1A04A 3KYDB 4OAZA 5JHUA 2DDBA 3FHNA 2JTVA 1S7OA 3NQOA 3WTSC 1IDZA 2ZJ2A 1R5GA 2HYFA 4F3QA 3L1PA 4G7OF 2E7WA 3HOUJ 5DYMA 3TDZC 1P4AA 5DCFA 3LSHA 1HF0A 2FA5A 1LDJA 3HKZA 4KIFA 3OYAA 1G3WA 3CLOA 4D9JA 2HVSA 3HC7A 4L9JA 3WGIA 2DPDA 3HGYA 1FEXA 3WE2A 1R7JA 1TNSA 2GOXB 2YU9J 3GEZA 2JRTA 2FU4A 1MJ9A 1OR7A 1ZARA 4CO8A 4L18B 3LAJA 4F52A 4XSZF 2E1OA 3F21A 2ELHA 3WTXC 2IGNA 5LFAA 2I10A 5F0HA 1W1WE 3FKJA 3OR2C 2AHQA 4GXOA 5E1ZB 2ZMEC 3IHUA 4D1QA 2ZCWA 2NVUB 3W6KB 2A68F 2MD5A 4XICA 4HA8A 3LQQA 3P7NA 4AM3A 2AS5F 4CZZA 2NXNB 2XAGA 4EEFG 2M87A 4JBAA 2W48A 1MGTA 3V8KA 2MG4A 3JRGA 4NHJA 2WAEA 3BG5A 3K1PA 4ESFA 1UCRA 1LE8A 2CV0A 4H0EA 2HPIA 5ILSA 3GXOA 4O6JA 1YW7A 2FXAA 1P7JA 1WWXA 2DTRA 2JVGA 4UV8A 2K4BA 4BXUA 3FF5A 4AUXA 1V5EA 1ZREA 1WJCA 1W36C 4LD5A 3JAMZ 3SEZA 2IRFG 2JPBA 1WH7A 4RLQA 1ZG3A 3ZOBA 5FFXA 2QKLB 4N9IA 2FQ3A 2D1VA 2LOOA 1W5CC 2K9MA 3S2HJ 3HOYJ 5EEHA 1XX5A 4RM3A 3IKTA 3CD6I 2TCTA 2H8WA
chains in the Genus database with same CATH topology
1U8BA 3BT9A 5EG0B 3BTIA 5M5WJ 1IG7A 1Y1WJ 1JJ8C 5C4XJ 3H0GJ 5M3FJ 2M34A 1ETQA 1JKPC 2IEKA 2R5YB 1W0UA 3IV5A 5GPAA 2IAIA 3S1QJ 1UG2A 3JRHA 2EZLA 1APLC 2YS9A 3JRBA 3IH4A 5JLXA 2XPWA 2R5YA 1SANA 1D5YA 2DA4A 3ZQLA 2HOAA 2K9QA 1FTZA 3M4OJ 4XRMA 3BG3A 3JRFA 5FLMJ 5M5XJ 3GTJJ 4A93J 2O9LA 3GTOJ 2XGDA 4DYCA 1ITYA 2FJ1A 3QPSA 3HOZJ 3S1NJ 4QTRA 4XRSA 4B4CA 2DMQA 5M5YJ 1JUPA 3BTJA 3JREA 3JRDA 1MBGA 2ME6A 2R5ZB 1OCTC 3LSGA 3BR6A 2K9SA 4I76A 3LSJA 1LFBA 3S2DJ 1Z0XA 2VI6A 1B72B 3QPLA 2M2EA 5IOYA 4A3BJ 1UHSA 1XC5A 3HGGA 2M0CA 4JYKA 1WGXA 4M6VA 2L7MP 4Y52J 5K7HA 2CQQA 2E2HJ 1GV2A 1U78A 1BL0A 1VNDA 1ETXA 1GDTA 1Q1VA 4MO7A 3DCFA 3SJMA 1ZR4A 1IC8A 1VFCA 2R7ZJ 3TP3A 2EZKA 2DA6A 4BXXJ 3E7LA 3GTLJ 5FKKA 1BW6A 5E3NA 2MSYA 2ME0A 4XRSG 5FKMA 2JA6J 1ORKA 3HDDA 1QPIA 4UUSA 1WI3A 4A3DJ 2N8GA 3MKLA 3BTCA 3IH3A 4FCYA 1TC3C 1AU7A 4MFDA 5EYRA 1O4XA 1H89C 3C2BA 3PO3J 4B3AA 4IHWA 2DN0A 4FISA 2PMZN 1VI0A 2QCOA 2XGCA 5F27A 5IP7J 3JRAA 3PM1A 2M8GX 5FKOA 2VKVA 2Y30A 1I3QJ 3HBLA 3RKQA 1B8IA 1JT0A 3S14J 2H1KA 2JA5J 2Y9ZA 4MIMA 4IHYA 2DA5A 1TWFJ 3CMYA 2JMWA 2H8RA 4M3BA 1A5JA 4C2MJ 3OSGA 3W6VA 3RQIA 2CQXA 1X2NA 2LLKA 3TP0A 5C44J 2DJNA 5EDNA 3CDLA 1QVUA 2AO9A 1JKRC 2EZIA 4XIDA 2DA3A 4HNVA 2ID3A 4X1EA 2JJ7A 5EGOB 1X58A 3K2AA 3ZQHA 3LSRA 3F0CA 3UKGA 1HDPA 3BQZA 4FE7A 2TRTA 4JX5A 1ZR2A 1E3OC 1IV6A 3GTQJ 1FTTA 2ECBA 1XS9A 1F36A 4M3FA 1MBJA 2DA2A 1IUFA 3VPRA 5J3LA 2HXIA 4FE4A 5GPCA 2WV1A 3S1MJ 2EBIA 5E3OA 2LD5A 1MH4A 1ZTRA 3Q0UA 1NK3P 2JN6A 2HQ5A 3M3YJ 3WHCA 1JJ6C 3FK6A 5C4JJ 4W97A 4NDLA 1BJZA 1WCMJ 3MVPA 1BA5A 3WHBA 4J19A 3S17J 1OCPA 4M3DA 1IRZA 4MFEA 3ZQFA 3NARA 2MGQA 1CQTA 1RPWA 4JP0A 3JRCA 1MNMC 2CUFA 2Y0SN 4QSHA 2B63J 1XG1A 3O8GA 5F08A 1ETVA 2XB0X 2XPUA 1JKQC 2XB5A 3ZQGA 1FJLA 5HODA 1S7EA 1A6IA 2NS8A 1TWCJ 4BY1J 3RZOJ 1YRNA 3MN2A 2HYJA 2HOSA 5K7FA 2L9RA 1IGNA 1MBFA 3Q0WA 3OOUA 4JX6A 4AYBN 2EQRA 2DTZA 2WB1N 2M9HA 2NVTJ 1MSFC 1HOMA 1JUMA 3PO2J 1X2MA 1ETOA 3FISA 2LFBA 4V2FA 2XGEA 1Z77A 4IHVA 3FK7A 4DZJA 5E3MA 3H3VK 3G1MA 2EZHA 3B6AA 2NOGA 4W1UA 4DW6A 2LK2A 1AKHA 1JTYA 3GTKJ 3HOVJ 1R9TJ 5IPAA 3BQYA 1AKHB 1GVDA 1RR7A 5GP9A 4DZPA 1RETA 4A69C 5FKLA 1RKWA 1ZQ3P 3RZDJ 2E2JJ 4D7NA 5EGOA 2XRLA 1PUFA 1T33A 3BR0A 2L7FP 2XPVA 3LOCA 4Y7NJ 4FTHA 2HOTA 4A3MJ 1UMQA 1AHDP 2LVSA 1GV5A 1VF9A 1Y1VJ 5FKNA 4S0HB 1JGGA 4ABZA 1QRYA 3OIOA 4BBSJ 2Y2ZA 2X9DA 5DTDA 1OJLA 2Y9YA 5J1UA 4C3HJ 4X6AJ 4D7MA 1ETWA 3BR1A 1MBKA 3SDGA 3SFIA 3GTMJ 2D5VA 2X48A 3HOXJ 2L0KA 2COBA 2EH3A 2ELKA 2XSDC 1U9NA 3LNQA 4BBRJ 2OPTA 1U9OA 5J1YA 3D1NI 1GT0C 2KDZA 1ZGWA 3A01B 1ZK8A 4A3FJ 2JA7J 1LFUP 5JLWA 2QF7A 5DS9A 5IYCJ 3A01A 2O7OA 1MH3A 2LP0A 1JUSA 1ETKA 5EZHA 3JR9A 3S16J 2GLOA 4QIWN 1SFOJ 2FD5A 3BG9A 3Q0VA 1TWHJ 1BW5A 5EG0A 1POGA 1H88C 3G1LA 4IHXA 2G0EA 4A3GJ 2JWTA 2R92J 4CYCB 1DU6A 1IJWC 5M3MJ 4LOCA 9ANTA 4RBOA 1I6HJ 1G2HA 4JX4A 1ETYA 2R93J 2DMNA 3BTLA 1RESA 4UUTA 1I50J 5EEAA 3GTGJ 3LSPA 3GBGA 4B1RA 4I6ZA 4G12A 1NK2P 1PUFB 2R0QC 3Q3SA 1B8IB 2VUMJ 3IH2A 1IDYA 5FLVA 3QQAA 1MSEC 3O8HA 3I4MJ 2ID6A 5IYBJ 4A3EJ 3G1OA 2K40A 3TW6A 3FIWA 3HEFA 1HCRA 4RDUA 1ZKGA 2JK3A 4BKXA 4DYQA 3CQZJ 2DMTA 1DU0A 1OFCX 4IEJA 1FIPA 3CCYA 4D5FA 2NS7A 3ZQIA 3HKZN 2CU7A 2FX0A 3K7AJ 2X6OA 1WPKA 2IBDA 4XK4A 1WH5A 1ENHA 2E19A 5F0CA 2DA7A 1JKOC 1FIAA 3A03A 2GM4A 3BR3A 5EZGA 2ZB9A 4M3GA 3OSFA 1IDZA 2GBYA 2NVYJ 3HB9A 5FJ8J 1T56A 3L1PA 2CUEA 2HI3A 3BR5A 3GTPJ 4GFBA 3HOUJ 5IOZA 2DA1A 2R5ZA 4M3EA 2DMUA 2O8KA 5IYDJ 1HF0A 1P7IA 3FKIJ 3HM5A 5IP9J 4V2GA 3NAUA 2NVQJ 5F0FA 2NVXJ 1GUUA 1FEXA 3HGYA 2ECCA 2Y31A 1JT6A 2YU9J 3B6CA 5F1JA 3ZQCA 2K9NA 2LKXA 4A3JJ 1W0TA 4A3CJ 5C3EJ 1TWGJ 2DMPA 2VPRA 4A3IJ 1B72A 2YUSA 2E1OA 1HLVA 4UUSB 2I10A 5F0HA 1H8AC 1QVTA 2VKEA 2AHQA 4D5CA 3A02A 2L7ZA 3S15J 4XICA 2CRGA 1NTCA 4L5EA 4EEFG 2KT0A 4AC0A 2W48A 5J1RA 2MG4A 3TW7A 2FQ4A 3JRGA 4BY7J 3HOWJ 5K7ZA 3BG5A 4A3LJ 1TWAJ 2P81A 1HDDC 5F04A 1LE8A 2E2IJ 1JTXA 4C3IJ 4A3KJ 1P7JA 1RKTA 4MLOA 5EF6A 3I4NJ 2LTPA 3TEDA 4AUXA 2LR8A 2MW8A 1MBHA 4CYCA 1EF4A 4DYRA 2JA8J 2HXOA 1K83J 2CJJA 2OF7A 1F43A 1WH7A 1YRNB 3ZOBA 3S1RJ 3DEWA 5IP6A 2HDDA 3JRIA 4C3JJ 3BR2A 1LE8B 3S2HJ 2LY9A 2WAQN 5BNGA 3HOYJ 1MBEA 5E3LA 1K61A 2RAEA 2TCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U8B A;  3BT9 A;  5EG0 B;  3BTI A;  5M5W J;  1IG7 A;  1Y1W J;  1JJ8 C;  5C4X J;  3H0G J;  5M3F J;  2M34 A;  1ETQ A;  1JKP C;  2IEK A;  2R5Y B;  1W0U A;  3IV5 A;  5GPA A;  2IAI A;  3S1Q J;  1UG2 A;  3JRH A;  2EZL A;  1APL C;  2YS9 A;  3JRB A;  3IH4 A;  5JLX A;  2XPW A;  2R5Y A;  1SAN A;  1D5Y A;  2DA4 A;  3ZQL A;  2HOA A;  2K9Q A;  1FTZ A;  3M4O J;  4XRM A;  3BG3 A;  3JRF A;  5FLM J;  5M5X J;  3GTJ J;  4A93 J;  2O9L A;  3GTO J;  2XGD A;  4DYC A;  1ITY A;  2FJ1 A;  3QPS A;  3HOZ J;  3S1N J;  4QTR A;  4XRS A;  4B4C A;  2DMQ A;  5M5Y J;  1JUP A;  3BTJ A;  3JRE A;  3JRD A;  1MBG A;  2ME6 A;  2R5Z B;  1OCT C;  3LSG A;  3BR6 A;  2K9S A;  4I76 A;  3LSJ A;  1LFB A;  3S2D J;  1Z0X A;  2VI6 A;  1B72 B;  3QPL A;  2M2E A;  5IOY A;  4A3B J;  1UHS A;  1XC5 A;  3HGG A;  2M0C A;  4JYK A;  1WGX A;  4M6V A;  2L7M P;  4Y52 J;  5K7H A;  2CQQ A;  2E2H J;  1GV2 A;  1U78 A;  1BL0 A;  1VND A;  1ETX A;  1GDT A;  1Q1V A;  4MO7 A;  3DCF A;  3SJM A;  1ZR4 A;  1IC8 A;  1VFC A;  2R7Z J;  3TP3 A;  2EZK A;  2DA6 A;  4BXX J;  3E7L A;  3GTL J;  5FKK A;  1BW6 A;  5E3N A;  2MSY A;  2ME0 A;  4XRS G;  5FKM A;  2JA6 J;  1ORK A;  3HDD A;  1QPI A;  4UUS A;  1WI3 A;  4A3D J;  2N8G A;  3MKL A;  3BTC A;  3IH3 A;  4FCY A;  1TC3 C;  1AU7 A;  4MFD A;  5EYR A;  1O4X A;  1H89 C;  3C2B A;  3PO3 J;  4B3A A;  4IHW A;  2DN0 A;  4FIS A;  2PMZ N;  1VI0 A;  2QCO A;  2XGC A;  5F27 A;  5IP7 J;  3JRA A;  3PM1 A;  2M8G X;  5FKO A;  2VKV A;  2Y30 A;  1I3Q J;  3HBL A;  3RKQ A;  1B8I A;  1JT0 A;  3S14 J;  2H1K A;  2JA5 J;  2Y9Z A;  4MIM A;  4IHY A;  2DA5 A;  1TWF J;  3CMY A;  2JMW A;  2H8R A;  4M3B A;  1A5J A;  4C2M J;  3OSG A;  3W6V A;  3RQI A;  2CQX A;  1X2N A;  2LLK A;  3TP0 A;  5C44 J;  2DJN A;  5EDN A;  3CDL A;  1QVU A;  2AO9 A;  1JKR C;  2EZI A;  4XID A;  2DA3 A;  4HNV A;  2ID3 A;  4X1E A;  2JJ7 A;  5EGO B;  1X58 A;  3K2A A;  3ZQH A;  3LSR A;  3F0C A;  3UKG A;  1HDP A;  3BQZ A;  4FE7 A;  2TRT A;  4JX5 A;  1ZR2 A;  1E3O C;  1IV6 A;  3GTQ J;  1FTT A;  2ECB A;  1XS9 A;  1F36 A;  4M3F A;  1MBJ A;  2DA2 A;  1IUF A;  3VPR A;  5J3L A;  2HXI A;  4FE4 A;  5GPC A;  2WV1 A;  3S1M J;  2EBI A;  5E3O A;  2LD5 A;  1MH4 A;  1ZTR A;  3Q0U A;  1NK3 P;  2JN6 A;  2HQ5 A;  3M3Y J;  3WHC A;  1JJ6 C;  3FK6 A;  5C4J J;  4W97 A;  4NDL A;  1BJZ A;  1WCM J;  3MVP A;  1BA5 A;  3WHB A;  4J19 A;  3S17 J;  1OCP A;  4M3D A;  1IRZ A;  4MFE A;  3ZQF A;  3NAR A;  2MGQ A;  1CQT A;  1RPW A;  4JP0 A;  3JRC A;  1MNM C;  2CUF A;  2Y0S N;  4QSH A;  2B63 J;  1XG1 A;  3O8G A;  5F08 A;  1ETV A;  2XB0 X;  2XPU A;  1JKQ C;  2XB5 A;  3ZQG A;  1FJL A;  5HOD A;  1S7E A;  1A6I A;  2NS8 A;  1TWC J;  4BY1 J;  3RZO J;  1YRN A;  3MN2 A;  2HYJ A;  2HOS A;  5K7F A;  2L9R A;  1IGN A;  1MBF A;  3Q0W A;  3OOU A;  4JX6 A;  4AYB N;  2EQR A;  2DTZ A;  2WB1 N;  2M9H A;  2NVT J;  1MSF C;  1HOM A;  1JUM A;  3PO2 J;  1X2M A;  1ETO A;  3FIS A;  2LFB A;  4V2F A;  2XGE A;  1Z77 A;  4IHV A;  3FK7 A;  4DZJ A;  5E3M A;  3H3V K;  3G1M A;  2EZH A;  3B6A A;  2NOG A;  4W1U A;  4DW6 A;  2LK2 A;  1AKH A;  1JTY A;  3GTK J;  3HOV J;  1R9T J;  5IPA A;  3BQY A;  1AKH B;  1GVD A;  1RR7 A;  5GP9 A;  4DZP A;  1RET A;  4A69 C;  5FKL A;  1RKW A;  1ZQ3 P;  3RZD J;  2E2J J;  4D7N A;  5EGO A;  2XRL A;  1PUF A;  1T33 A;  3BR0 A;  2L7F P;  2XPV A;  3LOC A;  4Y7N J;  4FTH A;  2HOT A;  4A3M J;  1UMQ A;  1AHD P;  2LVS A;  1GV5 A;  1VF9 A;  1Y1V J;  5FKN A;  4S0H B;  1JGG A;  4ABZ A;  1QRY A;  3OIO A;  4BBS J;  2Y2Z A;  2X9D A;  5DTD A;  1OJL A;  2Y9Y A;  5J1U A;  4C3H J;  4X6A J;  4D7M A;  1ETW A;  3BR1 A;  1MBK A;  3SDG A;  3SFI A;  3GTM J;  2D5V A;  2X48 A;  3HOX J;  2L0K A;  2COB A;  2EH3 A;  2ELK A;  2XSD C;  1U9N A;  3LNQ A;  4BBR J;  2OPT A;  1U9O A;  5J1Y A;  3D1N I;  1GT0 C;  2KDZ A;  1ZGW A;  3A01 B;  1ZK8 A;  4A3F J;  2JA7 J;  1LFU P;  5JLW A;  2QF7 A;  5DS9 A;  5IYC J;  3A01 A;  2O7O A;  1MH3 A;  2LP0 A;  1JUS A;  1ETK A;  5EZH A;  3JR9 A;  3S16 J;  2GLO A;  4QIW N;  1SFO J;  2FD5 A;  3BG9 A;  3Q0V A;  1TWH J;  1BW5 A;  5EG0 A;  1POG A;  1H88 C;  3G1L A;  4IHX A;  2G0E A;  4A3G J;  2JWT A;  2R92 J;  4CYC B;  1DU6 A;  1IJW C;  5M3M J;  4LOC A;  9ANT A;  4RBO A;  1I6H J;  1G2H A;  4JX4 A;  1ETY A;  2R93 J;  2DMN A;  3BTL A;  1RES A;  4UUT A;  1I50 J;  5EEA A;  3GTG J;  3LSP A;  3GBG A;  4B1R A;  4I6Z A;  4G12 A;  1NK2 P;  1PUF B;  2R0Q C;  3Q3S A;  1B8I B;  2VUM J;  3IH2 A;  1IDY A;  5FLV A;  3QQA A;  1MSE C;  3O8H A;  3I4M J;  2ID6 A;  5IYB J;  4A3E J;  3G1O A;  2K40 A;  3TW6 A;  3FIW A;  3HEF A;  1HCR A;  4RDU A;  1ZKG A;  2JK3 A;  4BKX A;  4DYQ A;  3CQZ J;  2DMT A;  1DU0 A;  1OFC X;  4IEJ A;  1FIP A;  3CCY A;  4D5F A;  2NS7 A;  3ZQI A;  3HKZ N;  2CU7 A;  2FX0 A;  3K7A J;  2X6O A;  1WPK A;  2IBD A;  4XK4 A;  1WH5 A;  1ENH A;  2E19 A;  5F0C A;  2DA7 A;  1JKO C;  1FIA A;  3A03 A;  2GM4 A;  3BR3 A;  5EZG A;  2ZB9 A;  4M3G A;  3OSF A;  1IDZ A;  2GBY A;  2NVY J;  3HB9 A;  5FJ8 J;  1T56 A;  3L1P A;  2CUE A;  2HI3 A;  3BR5 A;  3GTP J;  4GFB A;  3HOU J;  5IOZ A;  2DA1 A;  2R5Z A;  4M3E A;  2DMU A;  2O8K A;  5IYD J;  1HF0 A;  1P7I A;  3FKI J;  3HM5 A;  5IP9 J;  4V2G A;  3NAU A;  2NVQ J;  5F0F A;  2NVX J;  1GUU A;  1FEX A;  3HGY A;  2ECC A;  2Y31 A;  1JT6 A;  2YU9 J;  3B6C A;  5F1J A;  3ZQC A;  2K9N A;  2LKX A;  4A3J J;  1W0T A;  4A3C J;  5C3E J;  1TWG J;  2DMP A;  2VPR A;  4A3I J;  1B72 A;  2YUS A;  2E1O A;  1HLV A;  4UUS B;  2I10 A;  5F0H A;  1H8A C;  1QVT A;  2VKE A;  2AHQ A;  4D5C A;  3A02 A;  2L7Z A;  3S15 J;  4XIC A;  2CRG A;  1NTC A;  4L5E A;  4EEF G;  2KT0 A;  4AC0 A;  2W48 A;  5J1R A;  2MG4 A;  3TW7 A;  2FQ4 A;  3JRG A;  4BY7 J;  3HOW J;  5K7Z A;  3BG5 A;  4A3L J;  1TWA J;  2P81 A;  1HDD C;  5F04 A;  1LE8 A;  2E2I J;  1JTX A;  4C3I J;  4A3K J;  1P7J A;  1RKT A;  4MLO A;  5EF6 A;  3I4N J;  2LTP A;  3TED A;  4AUX A;  2LR8 A;  2MW8 A;  1MBH A;  4CYC A;  1EF4 A;  4DYR A;  2JA8 J;  2HXO A;  1K83 J;  2CJJ A;  2OF7 A;  1F43 A;  1WH7 A;  1YRN B;  3ZOB A;  3S1R J;  3DEW A;  5IP6 A;  2HDD A;  3JRI A;  4C3J J;  3BR2 A;  1LE8 B;  3S2H J;  2LY9 A;  2WAQ N;  5BNG A;  3HOY J;  1MBE A;  5E3L A;  1K61 A;  2RAE A;  2TCT A; 
#chains in the Genus database with same CATH topology
 4KT5 C;  1U8B A;  3BT9 A;  1LEB A;  3WU2 C;  2GOM A;  1UFM A;  2LRE A;  3VYT B;  5D4R A;  2EV6 A;  3WTU C;  1JJ8 C;  3H0G J;  1YI2 I;  2IW5 A;  2M34 A;  3C1D A;  4KIT B;  3M07 A;  1JKP C;  3CC2 I;  2RQP A;  2K9L A;  4BJ5 C;  1UG2 A;  4N9H A;  3JRH A;  2O0Y A;  1S72 I;  3FXQ A;  1Z1D A;  3E3V A;  4C30 A;  1D5Y A;  2DA4 A;  4BAY A;  4AVZ A;  1KU9 A;  1XD7 A;  4HRI A;  4XRM A;  5FLM J;  2PQ8 A;  3C2G A;  5GAE J;  2F5D A;  3HRT A;  4A93 J;  2O9L A;  3F8M A;  5EJC A;  3OWT A;  3S1N J;  2HWV A;  2XAF A;  4ESJ A;  5HNH A;  3QOP A;  1SFX A;  4B8X A;  2DMQ A;  2A3S A;  1TW3 A;  3N97 A;  3ELK A;  1KYW A;  3JRD A;  3M8E A;  2AXL A;  1UAA A;  2HTS A;  5JI6 A;  2VI6 A;  4IX7 A;  3VFZ A;  3QPL A;  5IOY A;  4AIH A;  4A3B J;  3WU1 B;  3HGG A;  2HDC A;  2H6C A;  3ABU A;  1ONV A;  5BS6 A;  3RPU D;  1BR1 A;  3X2Q H;  2CQQ A;  4N0B A;  2CYY A;  2MC3 A;  1R58 A;  1BL0 A;  1ETX A;  4LG3 A;  2ZJQ F;  3ZMT A;  1S3J A;  1O3S A;  1Q1V A;  2VQL A;  3DCF A;  1ZR4 A;  1IC8 A;  4LJZ F;  1VFC A;  2QKM B;  2HNH A;  3H35 A;  2DDA A;  2M5W A;  4FET A;  5BPI A;  3KCC A;  1BIA A;  4Z6Y A;  4RB2 C;  4BXX J;  3GTL J;  1T2K A;  5E3N A;  3GUD A;  1R00 A;  1G4D A;  3KEQ A;  1RUN A;  2ME0 A;  1GLN A;  2K4J A;  4A0Z A;  1DUX C;  1VQP I;  4S05 A;  3HDD A;  2GA2 A;  1QPI A;  3L2U A;  1EJ9 A;  5GTI C;  1ZEL A;  4F93 B;  3IH3 A;  2GXA A;  4TV7 A;  1TC3 C;  3ULQ B;  4UV9 A;  2DCE A;  3I4P A;  5EYR A;  3QP5 A;  1O4X A;  3C2B A;  4ANJ A;  2ELJ A;  3AFH A;  2YX4 A;  4U7D A;  5FRM A;  2L4M A;  3ABL H;  4CA0 A;  4IPA A;  2IT0 A;  2DXI A;  2QCO A;  5IP7 J;  2M8G X;  4HYE A;  3TL4 X;  3RPU A;  3OYD A;  2VKV A;  1I3Q J;  3RKQ A;  1B8I A;  3IWF A;  2LBF B;  3TDU C;  2H94 A;  5L3F A;  2H1K A;  4MEY F;  3CMY A;  5A2Q K;  3KIO A;  3OSG A;  2CQX A;  2DOE A;  4XRF A;  3H9Q A;  5C44 J;  2DJN A;  3I71 A;  3A1Y A;  5EDN A;  2PLY A;  3KEY A;  1FC3 A;  2V1D A;  1JKR C;  3VSK A;  2CGP A;  1ULY A;  3OYL A;  4HNV A;  2ID3 A;  2JJ7 A;  3OV8 A;  3M7G A;  1BI2 A;  1LNW A;  3ZQH A;  4HX8 A;  2V1N A;  1EA3 A;  1FOK A;  2M4G A;  1B9N A;  3UKG A;  1BOA A;  3EUH A;  1WJ5 A;  2BHY A;  3SZG A;  3BQZ A;  1IV6 A;  3H9J A;  5GAH J;  2VJ4 A;  3K4N A;  3JSO A;  1IUF A;  3VPR A;  3DV8 A;  2HXI A;  3AAF A;  2CS3 A;  4NBQ A;  2WV1 A;  3S1M J;  2EBI A;  3GCM A;  2V26 A;  2PJR A;  2CW8 A;  2FML A;  1MH4 A;  1ZTR A;  3RPQ A;  2K02 A;  5J8C A;  1VQM I;  4L0Y B;  1SAU A;  2X6Y A;  3CJQ B;  4RB0 A;  3E6D A;  2HQ5 A;  1VQ4 I;  4I99 C;  4R8H A;  5H2F C;  2LDU A;  3M3Y J;  1SVM A;  3OYJ A;  1OKR A;  2EV5 A;  5B1A H;  4E7Z A;  1Y39 A;  2QQ9 A;  4LIV A;  2R7F A;  4NDL A;  4WXD A;  2H1L A;  1XCB A;  2ZXW H;  1NH3 A;  3N05 A;  4CYD A;  2FBI A;  1W7P A;  4P5O A;  4BDZ A;  2NYX A;  5K5O A;  3M8J A;  4AU7 A;  3NEU A;  2VXZ A;  3QU6 A;  3R61 A;  2EA2 A;  2DK8 A;  4M9X A;  2EFP A;  2O5R A;  3HTU A;  2EV0 A;  2Y0S N;  4JOM A;  3OYF A;  2FOK A;  4KA4 A;  3R0J A;  4QSH A;  2VQG A;  2L5Q A;  4CIC A;  5F08 A;  2Y0S A;  1ETV A;  2KIS A;  1ZGA A;  1V5F A;  3ZQG A;  2ZFU A;  4U0Y A;  4I01 A;  2XKP A;  1S7E A;  1A6I A;  2NS8 A;  1HW5 A;  2V1U A;  3RZO J;  1V4R A;  4KIG A;  1Y6I A;  3MN2 A;  2DFI A;  4M73 A;  2HYJ A;  3HL2 A;  4PK4 A;  4CGZ A;  5K7F A;  2L9R A;  1MBF A;  3VDX A;  2LSO A;  4HLY A;  3FZV A;  2D2W A;  5CQE A;  2Z2S B;  4C9Y A;  4CUG A;  1T6S A;  3ASO H;  1QZY A;  4BAC A;  2VN2 A;  4HZF A;  4ON0 A;  2NRA C;  4V2F A;  1G59 A;  3E6C C;  2JVH A;  4Y17 A;  2J5P A;  4DZJ A;  2A6E F;  1L3L A;  3G1M A;  4MGR A;  3HUG B;  1RNL A;  1X1B A;  2NOG A;  4W1U A;  3ZQ7 A;  3CJR B;  2LK2 A;  1A31 A;  5BOX A;  1GVJ A;  3FXK A;  1Z21 A;  1AKH A;  1JTY A;  3HOV J;  2F5V A;  4HST A;  5FD6 A;  1I1S A;  1VTN C;  3WGG A;  5GP9 A;  4J01 A;  1HW1 A;  5HVQ C;  3E6M A;  4YRV A;  2E2J J;  2COM A;  3PQJ A;  2V9V A;  1I3A A;  5EGO A;  2XRL A;  3OIP A;  2L7F P;  1YIJ I;  3TO7 A;  2ZFW A;  3TOA A;  2LVS A;  3U9G A;  2ZNY A;  1Y1V J;  5FKN A;  4S0H B;  4NB5 A;  3I58 A;  1JGG A;  2W57 A;  2X6W A;  3KP5 A;  5H6Q A;  3HZJ A;  2X6X A;  5HDG A;  2W82 A;  4G8X A;  3OYC A;  2BVL A;  5L3B A;  2GXB A;  4CHU A;  4B44 A;  1MMD A;  2BY0 A;  5HDK A;  1A35 A;  1OJL A;  3D5R C;  4YIR X;  4HF2 A;  1IAW A;  4MHG A;  1M1E B;  4ZYE A;  2P5V A;  3FXJ A;  4X6A J;  3OL4 A;  2OQR A;  1MBK A;  3K70 C;  3GTM J;  4CCL A;  3T0Y A;  3I53 A;  2BGC A;  2BYV E;  4S04 A;  4IRG A;  1ZLK A;  3GZ5 A;  1ZH5 A;  4BE0 A;  3AG1 H;  2VT3 A;  1U8R A;  5J1Y A;  3D1N I;  1QO0 D;  3A01 B;  1ZK8 A;  3ROU A;  2JA7 J;  2ZXI A;  3DTK A;  5KCM A;  4EJT A;  3REO A;  3A01 A;  3J81 K;  5ERI A;  3I59 A;  1MH3 A;  1UJ8 A;  1OCZ H;  2IS1 A;  1ETK A;  2K85 A;  1EH8 A;  3JR9 A;  3EDP A;  3ZPL A;  1N25 A;  2CSO A;  2GLO A;  3CCL I;  1J9I A;  3H5N A;  4RAZ A;  1BC8 C;  1J59 A;  2FD5 A;  5LGT A;  5J8F A;  1YJW I;  4LLG F;  3MQ0 A;  4L5J A;  3AKZ A;  1TWH J;  1T38 A;  1POG A;  1OCC H;  4C2T A;  2A05 A;  1LPQ A;  4IHX A;  5H6R A;  3IAM 2;  2XGX A;  2ZSI B;  2RNJ A;  3LA3 A;  3ECO A;  2QBY B;  1ZHF A;  5E1X A;  5AIP A;  4XLP F;  1I50 J;  1KQ8 A;  5KAF C;  3M1E A;  1FLI A;  3LSP A;  3WTZ A;  4I6Z A;  2MAB A;  1NK2 P;  1B8I B;  2HZT A;  3BCA A;  5ILU A;  1LVA A;  2VT2 A;  2A6H F;  2NS0 A;  3QPH A;  3O8H A;  5E8G A;  5DM7 F;  2ID6 A;  5IYB J;  1S5L C;  4KN4 X;  3GFJ A;  3ZMV A;  5JVT A;  1HSJ A;  1FBS A;  4BKX A;  3SDB A;  5BQT A;  1R1U A;  3CQZ J;  2AXT C;  2DMT A;  2WB1 A;  2KRH A;  4IQ4 A;  5AON A;  3CCY A;  1E3P A;  1WVR A;  3HKZ N;  2CU7 A;  3PNY A;  4HF0 A;  4P55 A;  3JCU C;  3OS2 A;  2WWY A;  4UB8 C;  1FOX A;  1ENH A;  4FHT A;  4KNY A;  1IXS B;  1XCV A;  1IN8 A;  1FIA A;  3A03 A;  3DBL B;  2QZ8 A;  3HRS A;  3DLL F;  4IZZ A;  2ZXJ A;  3I54 A;  1FP1 D;  3C3W A;  3LWF A;  4PCQ A;  4EM1 A;  3L2Q A;  4E7I A;  4RGU A;  2OD5 A;  1B59 A;  4P9U A;  3CCV I;  3KP4 A;  1T56 A;  2DFH A;  3MZY A;  3GTP J;  1T0F C;  2IVM A;  2R5Z A;  5ICF A;  2IS4 A;  1HKT A;  2WTE A;  3BJO A;  3HM5 A;  3NAU A;  2NVQ J;  3Q9V A;  1X4P A;  1IXC A;  3NWS A;  2MLG A;  1TP4 A;  5FRN A;  3BRO A;  4QWQ A;  1JT6 A;  3PJR A;  2R7T A;  2OZ6 A;  3DU6 A;  4HW0 A;  5F1J A;  2GIV A;  2R7R A;  3R6S A;  2K9N A;  2LKX A;  3A2K A;  3RKX A;  4YEJ A;  1RI7 A;  5C3E J;  2IA0 A;  3H9G A;  4CH7 A;  1YW9 A;  1T39 A;  2KJC A;  4UUS B;  2A69 F;  4BJT A;  1NHA A;  3G6E I;  1ZRF A;  3E97 A;  3A02 A;  2FBK A;  4ZJZ A;  1OYY A;  1NTC A;  4L5E A;  4U0W A;  4Y4R A;  1O57 A;  4AC0 A;  2JT1 A;  3H1C A;  5LHG A;  4PZJ A;  3F6V A;  2FE3 A;  1XB4 A;  2FQ4 A;  4Q4Z F;  1Y0N A;  2J5O A;  3JTH A;  3W3C A;  2FSW A;  1TWA J;  2P81 A;  4M72 A;  1R6R A;  2DU9 A;  4E70 A;  1R71 A;  4A3K J;  2HDW A;  4DIQ A;  1MMN A;  3ZN0 A;  2R4G A;  3HPG A;  3TED A;  2Z16 A;  4AYB A;  1IO2 A;  2OJE D;  4DYR A;  2JA8 J;  4BQN A;  3ECH A;  2DFF A;  1D8J A;  2CJJ A;  4R79 A;  2OF7 A;  3DU5 A;  4A6E A;  1ON1 A;  1F43 A;  5J40 A;  1QGP A;  2ZKZ A;  3DEW A;  5IP6 A;  2HDD A;  3BR2 A;  2BV6 A;  1MBE A;  3BZC A;  5E3L A;  2E36 A;  1QZE A;  2RAE A;  3BZ6 A;  2EIM H;  4DGW B;  2V4J C;  1WHU A;  3BTI A;  5GAD J;  1YS6 A;  1JHF A;  1IG7 A;  2A07 F;  3JAM K;  5C4X J;  2ADU A;  2KHM A;  4P9F A;  1X4O A;  3IV5 A;  5GPA A;  3S1Q J;  4I02 A;  1MDM B;  4IF4 A;  4EQQ A;  1U5T A;  1APL C;  3JRB A;  2XSJ C;  3KP7 A;  1UB9 A;  1SAN A;  4OU0 A;  1OIS A;  4BU2 A;  3FHZ A;  2R5Y A;  4LLN A;  4Q47 A;  5LRS A;  2E7X A;  3C7J A;  3R0A A;  3JRF A;  3M4O J;  2VQC A;  1JXS A;  1Z91 A;  4B09 A;  2QVO A;  2E1M B;  3L2C A;  3EPZ A;  4ITV A;  4CCO A;  1LKX A;  1FY7 A;  1TZL A;  2R7O A;  3K1N A;  3CO6 C;  5CLS A;  4XRS A;  4QPQ A;  2E71 A;  1O3T A;  4B4C A;  2CV2 A;  1TBX A;  2M3A A;  1JUP A;  2EA4 A;  1MBG A;  1ZN2 A;  2GXG A;  2R5Z B;  3LSG A;  4I76 A;  3LSJ A;  3H0D A;  2RNG A;  2XRO A;  1XSD A;  3S2D J;  1DPR A;  1MDM A;  2R7W A;  1XPX A;  4HDU A;  1UHS A;  1XC5 A;  3I0T A;  5D8L B;  4JYK A;  1WGX A;  2KLO A;  3LAP A;  4X0G A;  3PIO F;  3CUQ B;  2LF8 A;  1GV2 A;  2B0L A;  3DFG A;  3VB2 A;  1GDT A;  3PFY A;  2VBX A;  2EFQ A;  3BPV A;  1JE8 A;  1MKM A;  3IAS 2;  1IW7 F;  4RS8 A;  1Z9C A;  4UNO A;  3BDD A;  1DDN A;  1SEU A;  4OIR F;  3ERE D;  2F48 A;  4KDP A;  2QUF A;  2DA6 A;  1VQ5 I;  4BQO A;  3V8L A;  2R7U A;  4HG2 A;  4XRS G;  2VIX A;  3ABK H;  4JQF A;  4II2 A;  5DD4 A;  2DQR A;  3OYN A;  2BY1 A;  2JA6 J;  1AA7 A;  2YX7 A;  5CYV A;  3GYH X;  1F9N A;  2KIF A;  5DM6 F;  3MKL A;  5CVV A;  2PI0 A;  4BQA A;  3S32 A;  4FCY A;  2G7H A;  3A0B C;  3KZZ A;  1B9M A;  1MND A;  3SEQ A;  2OBP A;  4BYY A;  4HNT A;  3GFI A;  5JVG F;  4MFD A;  3IP4 B;  2VL8 A;  5CPR B;  2QBY A;  3RQ4 A;  1GHC A;  3BLY A;  4Y33 A;  2M0M A;  2R3S A;  4IHW A;  1FYK A;  2ICW G;  4FIS A;  3KLN A;  4XLC A;  1WJB A;  3KYL A;  3S93 A;  2BBY A;  1ZG1 A;  2CW7 A;  3CCS I;  3PM1 A;  3J80 Z;  3QPT A;  1OQY A;  5J6X A;  1MJB A;  4F91 B;  3HBL A;  4AVP A;  1JT0 A;  3S14 J;  4RB3 C;  2Y9Z A;  2V7F A;  2Y69 H;  4MIM A;  3L2V A;  4NQW A;  1Z7L A;  4GO1 A;  1TWF J;  1ZRD A;  2H8R A;  4M3B A;  3W6V A;  5GAG J;  1X2N A;  4A0X A;  3IRQ A;  5JR3 A;  3KP2 A;  1BR2 A;  2EZI A;  1Y8R B;  3O3K A;  3E5Q A;  4M74 A;  3K2A A;  4Q5S F;  4YFX F;  2OAZ A;  2FNA A;  4MEX F;  4G94 A;  4XN0 A;  3GF2 A;  4LIU A;  4FE7 A;  3M9A A;  1LDK B;  3PNT A;  3ZRG A;  1HST A;  1E2X A;  2DOF A;  4LB6 B;  2VC1 A;  3CMA I;  3ZQQ A;  4CCK A;  3SQN A;  1X3W B;  4EM0 B;  1U6G A;  5J3L A;  4IQJ A;  3IKV A;  4L0Z B;  2VJJ A;  2M7A A;  2NNN A;  2ZO4 A;  3OS1 A;  1OYW A;  2HQA A;  2E5Z A;  2PFB A;  4QLC U;  1GXP A;  1ODD A;  3I64 A;  3RCO A;  3TQN A;  2TDX A;  2EWN A;  2AQE A;  1RRJ A;  1YX5 A;  2EJR A;  4JK1 X;  2AQF A;  2BY2 A;  4E7L A;  4XLA A;  4XSX F;  3MVP A;  5L3D A;  1YIO A;  2ZXH A;  1P4X A;  3WHB A;  5HLT A;  2YR2 A;  1OCP A;  4M3D A;  3VEP A;  5LEJ A;  1IRZ A;  3MAJ A;  4FT8 A;  2F6C A;  3BJ6 A;  2BY3 A;  4KYW A;  2MGQ A;  4HPQ A;  2PEX A;  1RPW A;  3GZN B;  4L9T A;  5L3E A;  5CVU A;  2QA4 I;  1FP2 A;  1J5Y A;  1R4N B;  2UXX A;  4EJW A;  2DI3 A;  2B63 J;  5FLX Z;  4Z2Y A;  3GWZ A;  1EH6 A;  5ICG A;  4KN7 X;  5HLG A;  1OCR H;  2RV8 A;  4BEH B;  4LG0 A;  2UWM A;  1FJL A;  3IRR A;  4BY1 J;  2VXD A;  2IP2 A;  2RRE A;  3QOE A;  3HYI A;  3JTG A;  1FYM A;  2EIL H;  3AL0 B;  4BEH A;  1SD5 A;  4PSW A;  1IGN A;  1UHW A;  2IA2 A;  4P1W A;  1I6X A;  2A61 A;  4AYB N;  2EQR A;  1WI9 A;  4UVC A;  3RIR A;  2KRC A;  3DBH B;  4HEA 2;  1HOM A;  2X0L A;  1ETO A;  2QGU A;  2V9K A;  3T8T A;  3J7Z I;  1TW2 A;  3MFK A;  1JHH A;  1B6A A;  3P9I A;  2PMZ A;  4ZTJ A;  3HSF A;  3QP6 A;  2CH0 A;  3GZ6 A;  3ZXS A;  4E6K G;  4BUP A;  2BEO A;  1O3R A;  1MD0 A;  5IPA A;  4A6D A;  2KZG A;  1RR7 A;  3VYS B;  4WX9 A;  4N4N B;  2WV0 A;  4ZDL A;  3F3X A;  1RET A;  5CVJ A;  1RKW A;  5B5E C;  1ZQ3 P;  3SXY A;  3RZD J;  1YO5 C;  4Y15 A;  4BXF A;  4XOR A;  2DT6 A;  3S3M A;  1Z67 A;  2XPV A;  2HTJ A;  4XKC A;  1ZAO A;  3OOP A;  1MJA A;  4WXH A;  1AHD P;  2E1M C;  2GWR A;  4HNU A;  4UUV A;  1VZ0 A;  1FWZ A;  4KT6 A;  2DLL A;  1HC8 A;  3CDI A;  4F55 A;  2HGC A;  2JPC A;  3BZK A;  2Y9Y A;  3H92 A;  5J1U A;  1SFE A;  1CF7 A;  1R5H A;  2LC2 A;  4UY8 I;  4DBR A;  2XRN A;  1HXD A;  2X85 A;  3MZ8 A;  3PNV A;  4LIT A;  2RN7 A;  5B66 C;  2HS5 A;  4XLE A;  5B3S H;  2L0K A;  2COB A;  2ELK A;  1U9N A;  4MQV A;  1X1D A;  1L0O C;  3Q9S A;  2PJP A;  1R22 A;  3BPX A;  3RYR A;  3HHH A;  2NOJ B;  3KLO A;  1U9O A;  4LG0 B;  3LL7 A;  1AOY A;  1XGN A;  2ZSH B;  1W4M A;  3U1K A;  1LFU P;  2R7S A;  1G3S A;  4HQE A;  4KMU X;  5DS9 A;  3BG6 A;  1FOY A;  3T5X A;  4NNJ A;  1QBJ A;  2PMH A;  4CZC A;  2IGM A;  4LK1 F;  2KIU A;  4DQ2 A;  4NUB A;  3I55 I;  2XAQ A;  3G73 A;  2CUJ A;  2PBI A;  5LD2 C;  3BG9 A;  3Q0V A;  2HEO A;  3PFI A;  2ZME A;  3VOD A;  4I2O A;  1C0W A;  4B3X A;  4MTE A;  1XSX A;  4BQQ A;  4QPO A;  2R7X A;  5EG0 A;  1U2W A;  1YOV B;  4ESB A;  3G1L A;  4U87 A;  1VQ7 I;  2G0E A;  3KX2 A;  4A5M A;  2JWT A;  3ZCO A;  1LDD A;  2R92 J;  2VOD A;  1IJW C;  1DU6 A;  5M3M J;  4WCG A;  3HTS B;  2M7B A;  2FOW A;  4CCJ A;  1ETY A;  1Q1H A;  2QEN A;  1PUE E;  4ZZL A;  4PJM A;  3ZMS A;  5CJ9 A;  3GBG A;  3HPH A;  3CUQ C;  1VQ6 I;  4EAT A;  1MMG A;  5D6E A;  2VBY A;  3LSK A;  2P7V B;  3HRU A;  1XDU A;  2OC6 A;  3DPL C;  2HKX A;  2X1E A;  4YG2 F;  4AIJ A;  2BVM A;  2E1N A;  3QQA A;  2WA0 A;  4BHC A;  3I4M J;  1U0J A;  1OMI A;  1D1B A;  1FMW A;  2HVQ A;  1O3Q A;  1HCR A;  3OS0 A;  3DXJ F;  4I98 B;  3HIF A;  2F2E A;  2QQ8 A;  2JK3 A;  2FRH A;  4DYQ A;  1N77 A;  3CDH A;  3FM3 A;  3SHF A;  1OFC X;  4FAS D;  5H20 A;  4HOB A;  3PSF A;  4E7H A;  4OIP F;  3L7W A;  4M6Y A;  4RGR A;  3RJP A;  3K69 A;  4IRI A;  1XMA A;  4HQM A;  2KP6 A;  2XKO A;  2X6O A;  3K6G A;  2WY8 Q;  3IL2 A;  2E19 A;  5F0C A;  2Y48 A;  2DA7 A;  3I3L A;  2GM4 A;  2KFD A;  1JI8 A;  3GX4 X;  4E7S A;  3VYR B;  2E1C A;  2L2O A;  4BHB A;  4MTD A;  1KGS A;  2ZB9 A;  1YHQ I;  3IC7 A;  4LMY A;  4XBF A;  3LFK A;  1SMT A;  2GBY A;  2NVY J;  4XKB A;  1XSV A;  2HI3 A;  4IJA A;  2X4H A;  4CCN A;  4GFB A;  2ESN A;  3FMR A;  2DA1 A;  2W84 A;  4M3E A;  3FXL A;  1P7I A;  3FKI J;  3S3O A;  1FBQ A;  4GGG A;  4V2G A;  2GA1 A;  4XLH A;  4XON A;  1GUU A;  2L9V A;  3V4G A;  1X1A A;  2JSC A;  1VQO I;  3CCU I;  2EIK H;  1ON2 A;  5KVR A;  4N4O B;  1XMK A;  1V3F A;  4A3C J;  1YYV A;  3D5L A;  2DMP A;  2VPR A;  4HLX A;  4A3I J;  1B72 A;  2YUS A;  1HLV A;  2UZK A;  2PX9 A;  2WBM A;  4LGW A;  2LYC A;  3A4C A;  1H8A C;  3V7C A;  1X3Z B;  2H6B A;  1YG2 A;  2Z33 A;  3FXU A;  2QYO A;  4D5C A;  2L7Z A;  2QWW A;  3S15 J;  2VKD A;  2CRG A;  2NAZ A;  2OQG A;  3EET A;  1SD6 A;  2FUG 2;  1TL8 A;  2BW3 B;  3K4B A;  1XTA A;  5FO5 A;  5ILV A;  4KIS A;  2BE5 F;  3TW7 A;  1S7A A;  1G3T A;  2Y0M A;  1IN4 A;  4HSR A;  3CME I;  2CMP A;  5K7Z A;  2KPM A;  2EK5 A;  2O6G E;  2VBW A;  4PGH A;  4MLO A;  2VJ5 A;  2LTP A;  4Y13 A;  5FFZ A;  2MW8 A;  1MBH A;  3GFM A;  2I5U A;  2LRD A;  2QEX I;  1ZYR F;  1EF4 A;  1QA6 A;  5TGT A;  2HXO A;  1K83 J;  4F7Z A;  4RGX A;  3S1R J;  1OCO H;  3J7A Y;  2IJL A;  4C3J J;  1A36 A;  4UVB A;  4LFU A;  1LE8 B;  2LY9 A;  2WAQ N;  1B4A A;  6PAX A;  4II3 A;  1EKE A;  1IN6 A;  1K4T A;  2EB7 A;  1IF1 A;  5IT9 Z;  3HRM A;  1X3U A;  2D45 A;  5EG0 B;  1K7A A;  5M5W J;  3VSL A;  2K5C A;  3WG9 A;  1XMX A;  2X51 A;  5E79 C;  2IGO A;  2XUB A;  5HOO A;  1ETQ A;  2LY1 A;  1TNT A;  4GYG A;  2XHK A;  2IEK A;  2R5Y B;  1W0U A;  3ZGK A;  3RI4 A;  2IAI A;  2EZL A;  2YS9 A;  3G2B A;  4WK8 F;  3IH4 A;  3U21 A;  1J2X A;  3J81 Z;  2HOA A;  5BMZ A;  4GRI A;  1KQ0 A;  1LFP A;  5LHI A;  2UV1 A;  5M5X J;  1G6N A;  3GTJ J;  2VKH A;  5IY5 H;  1YLF A;  2XGD A;  3GTO J;  1ITY A;  4O5V A;  5ICE A;  2FJ1 A;  3HOZ J;  4PJ0 C;  1J7K A;  2VE8 A;  2XF7 A;  2IPQ X;  4QTR A;  1Y0U A;  3DF8 A;  5M5Y J;  3FMS A;  2EIN H;  3HJE A;  2Z9O A;  3BTJ A;  1U3E M;  2F4I A;  1VQL I;  1OCT C;  2BZT A;  1SMY F;  4YIF A;  5BPD A;  2KL4 A;  5JHF A;  1IN5 A;  4EJU A;  1W5S A;  2GAU A;  4HX4 A;  1Z0X A;  2O8X A;  1B72 B;  2M2E A;  1YJN I;  4KFC A;  1EV7 A;  1WJA A;  2M0C A;  3DBR B;  2YPR A;  1T98 A;  1W5T A;  5K7H A;  3QOD A;  3T1B A;  1VND A;  4NC6 A;  5ICC A;  4G7H F;  3BWG A;  4MO7 A;  3SJM A;  1J75 A;  1TTY A;  1TT0 A;  1FYL A;  3DLA A;  3HG9 A;  3KZY A;  2VC0 A;  1S8N A;  2DJI A;  1D0Y A;  1KYZ A;  1X19 A;  3E7L A;  2VJI A;  3I59 B;  5FKK A;  2MSY A;  2XAJ A;  4ETS A;  1ORK A;  2HR3 A;  3CCE I;  1O7F A;  4HDV A;  1OYI A;  1WI3 A;  2B9S A;  2IA1 A;  2RC4 A;  3BTC A;  2V1X A;  5AIQ A;  4HBL A;  1AU7 A;  3M1C A;  2M30 A;  2LBF A;  3F23 A;  2XDV A;  4XMY A;  2EIJ H;  1P92 A;  2H27 A;  4ZDP A;  4M71 A;  1SFU A;  1BC7 C;  2DN0 A;  5KNL A;  4XOT A;  3NRV A;  1BI3 A;  1S6L A;  2XAH A;  1Z3Y A;  1VI0 A;  1Z6R A;  3RYP A;  1QZZ A;  1R1V A;  3QYE A;  4ZYG A;  1N78 A;  2XV4 S;  3JRA A;  2A6T A;  5DD8 A;  4EVI A;  2Y30 A;  4G7Z F;  1XGM A;  3CJT B;  3F22 A;  2GQQ A;  2OV7 A;  2JA5 J;  1H9G A;  3QYB A;  3K4L A;  4IHY A;  3OYM A;  2E34 A;  1XGS A;  2JMW A;  2KMU A;  3DWL E;  4A2U A;  1IZ1 A;  2HFH A;  2BOL A;  2LLK A;  3MKW B;  3ESW B;  4PGG A;  2DQL A;  4ENJ A;  2F5F A;  4I09 A;  1QVU A;  4RA2 A;  3K70 D;  2AO9 A;  2STW A;  2ZC2 A;  2XF5 A;  5D5X B;  4RAG A;  2HQN A;  1G8X A;  4XID A;  1QU3 A;  3KYC B;  3OL3 A;  3LSM A;  5HDN A;  1UEL B;  2CFO A;  5LRR A;  5EGO B;  1W36 D;  1DP3 A;  3K4J A;  5HLH A;  3CC4 I;  1BI0 A;  3CES A;  3F0C A;  3GW2 A;  3CUQ A;  1HDP A;  1IRF A;  1R1T A;  3FBI B;  1REP C;  2JSP A;  2ECB A;  3AG4 H;  5J4V A;  3UR3 C;  4O3M A;  4EGY A;  4IL6 C;  1AWC A;  1FOW A;  1IRG A;  1TQI A;  4FE4 A;  5CQG A;  1LQ1 A;  2Z1D A;  1E17 A;  1QQI A;  3Q0U A;  3CMM A;  3FMQ A;  2DOA A;  4BJ6 C;  3E6B A;  2P7C B;  2EPF A;  5D8K B;  4ZYA A;  1SC7 A;  1QHH D;  3QWL A;  1HKS A;  4PDK A;  2L54 A;  3OIQ A;  4EMS A;  3SFZ A;  4BE1 A;  3F8F A;  5E17 F;  5C4J J;  3RKW A;  2DT5 A;  1BJZ A;  2QSF X;  2KIQ A;  1BA5 A;  1CF7 B;  3W2A A;  3S17 J;  1MMS A;  2NNY A;  3DQV C;  3ZQF A;  3FXO A;  4CXF A;  3CJN A;  3NAR A;  3V8J A;  5LGU A;  1Z05 A;  2K27 A;  4KUM A;  4RB1 A;  2G9W A;  4G6T B;  4L9V A;  4M9Z A;  2K7L A;  3DKW A;  3CP8 A;  3K9T A;  3JRC A;  1MMA A;  4ZTF A;  1MNM C;  2HOE A;  2O3F A;  1PJR A;  2CUF A;  1WKM A;  1X1C A;  2V6C A;  2VB6 A;  4ZC3 A;  3OYB A;  1W7P B;  2XB0 X;  2L9N A;  2V79 A;  2XPU A;  4B48 A;  2RVC A;  2HYG D;  3J7A O;  1VQ9 I;  1V5G A;  3KFW X;  4RAY A;  1XN7 A;  2M45 A;  1K6O A;  1MNE A;  2DAO A;  2W24 A;  4EM2 A;  1DPU A;  3PL8 A;  2HOS A;  3L2W A;  4JX6 A;  1XDS A;  1UZC A;  2DTZ A;  2RQQ A;  2M9H A;  4PFO A;  2NVT J;  1MSF C;  1SFK A;  1JUM A;  3PO2 J;  1X2M A;  2OCE A;  3D5S C;  3FIS A;  2EFO A;  5KHD A;  2P0W A;  5D6F A;  1D3Y A;  4I0B A;  1K78 A;  2UUZ A;  4UB6 C;  4IHV A;  3FK7 A;  3DPU A;  5E3M A;  3CZ6 A;  1T8I A;  3H3V K;  1OLT A;  2ESH A;  2C6Y A;  3TOB A;  3ZMU A;  1K79 A;  2W4S A;  1UHM A;  5B1B H;  3H5A A;  2E5N A;  3MD2 A;  4L5I A;  2XIG A;  2CO5 A;  1H0M A;  5DV5 A;  3BCB A;  2HVR A;  3EYI A;  2P4W A;  3RDI A;  5CKT A;  1AKH B;  1U5T C;  2CQK A;  4IHT A;  3ABT A;  4DZP A;  1LVK A;  4OIN F;  2MH2 A;  3WTV C;  1PUF A;  3BR0 A;  3ZMD A;  4FTH A;  4IRH A;  4Y7N J;  1DP7 P;  1HQC A;  2HOT A;  1TQP A;  2BHZ A;  4A3M J;  1UMQ A;  1GV5 A;  2DFE A;  1RUO A;  1LB2 A;  2YU3 A;  2CQ7 A;  4NQW B;  4BBS J;  1LJ9 A;  1Y56 A;  3RSN A;  1I1G A;  1FZP B;  5HLI A;  5DTD A;  3DP7 A;  4C3H J;  5KK1 A;  1VQN I;  4AWX B;  1WSU A;  4D7M A;  1ETW A;  2L02 A;  4DOZ A;  3BR1 A;  3SFI A;  5J47 A;  4UXN A;  2D5V A;  2X48 A;  2CUZ A;  5FRO A;  4BDY A;  4AD9 A;  2Q2E A;  5JFR A;  1XGO A;  2EH3 A;  5F64 A;  3LNQ A;  1ZG5 A;  3AG3 H;  4BBR J;  3MMY B;  2OPT A;  2VBZ A;  1GT0 C;  3DEU A;  3J80 K;  2F5C A;  4WXC A;  2X1C A;  3SZP A;  5JLW A;  4BS9 A;  2LG4 A;  1P4W A;  2Q1Z B;  2F4M B;  2QF7 A;  4XL9 A;  5LEK A;  3JW4 A;  3CTA A;  2LP0 A;  1T08 B;  1JUS A;  2MH9 A;  2QLZ A;  3K1M A;  2FEZ A;  3S16 J;  3MWM A;  4QIW N;  3FXR A;  5D5W B;  3R60 A;  3CF5 F;  1RZ4 A;  1SFO J;  1J09 A;  4LB5 A;  1FPQ A;  2PMU A;  4CCM A;  4IXA A;  1P6R A;  4U7B A;  2IS2 A;  2Z5U A;  2BW3 A;  3OYK A;  2K3F A;  2W1O A;  2ZME B;  1BW5 A;  4IOA F;  1H88 C;  4ENN A;  4A3G J;  3KZI C;  4XR6 A;  4PJJ A;  2LKP A;  1SVL A;  3ABM H;  4CYC B;  4V19 K;  1NG7 A;  2CG4 A;  1UST A;  4LOC A;  1FX7 A;  1I6H J;  3QU3 A;  4U0V A;  4JX4 A;  4P96 A;  1SD7 A;  1G2H A;  1FNN A;  2L3D A;  1PDN C;  4UUT A;  4RM2 A;  4ZYD A;  3H3U A;  1DGW Y;  2ZBK A;  2CFX A;  2G7U A;  3M8F A;  3OMY A;  4PSX A;  5LBQ A;  2MYS A;  5FB2 A;  1ZLJ A;  2WC2 A;  1EH7 A;  2R0Q C;  1D0X A;  1LUJ B;  2VUM J;  3IH2 A;  1IDY A;  3DKY A;  2YSR A;  3HHG A;  4U88 A;  2W00 A;  3IUO A;  3K2Z A;  2BXZ A;  4IO9 F;  4A3E J;  3G1O A;  2K40 A;  3TKY A;  3TW6 A;  3FIW A;  3HEF A;  1ZKG A;  4RGS A;  3RTR A;  4IEJ A;  4D5F A;  1BR4 A;  1Z6T A;  2NS7 A;  3ASN H;  4XKW A;  4YEL A;  1YE9 A;  3Q5F A;  2FX0 A;  2OTL I;  3DTE A;  2ISZ A;  1QNT A;  2IBD A;  1K78 B;  1D5V A;  4GDF A;  1JKO C;  1CGP A;  3G71 I;  3WOD F;  3E5U A;  1RIO H;  2R7V A;  3BR3 A;  1BN5 A;  5F1R A;  2OA4 A;  2R7Q A;  5EZG A;  3COA C;  4KMF A;  2CQN A;  4YFK F;  4KIB A;  4M3G A;  2JZY A;  3OSF A;  3HB9 A;  3ZR8 X;  5FJ8 J;  3QRF F;  3TGN A;  3C18 A;  2CUE A;  2RKH A;  3V42 A;  5K5R A;  3BR5 A;  5J4Y A;  2L9S A;  3TBI A;  3MKZ A;  1F4K A;  2DMU A;  3G3Z A;  2O8K A;  1H9T A;  5FLX K;  5IYD J;  3FX3 A;  3MEX A;  2Q0O A;  2XC7 A;  5TRD A;  5IP9 J;  4Q48 A;  5F0F A;  3OYI A;  2NVX J;  2ACJ A;  2VQH A;  2STT A;  2ECC A;  2RGV A;  2Y31 A;  3I5U A;  3G4S I;  5HNF A;  3B6C A;  2DT7 B;  3BJA A;  5GTH C;  3J7Y J;  3ZQC A;  3PUB A;  3L09 A;  2XVC A;  4A3J J;  1W0T A;  1D1A A;  3F8C A;  4ZZD A;  1PP8 F;  3CC7 I;  1TWG J;  1QPM A;  4B43 A;  1O7L A;  2OZU A;  4ENM A;  2P6S A;  1YTY A;  3O6B B;  1QVT A;  2VKE A;  4BHP A;  4DBQ A;  2GZW A;  4FX0 A;  3EYY A;  1PP7 U;  2L7K A;  2KT0 A;  4B47 A;  1YFH A;  1PVE A;  4OIQ F;  5J1R A;  2LH9 A;  4F92 B;  1B1B A;  1BIB A;  3KP6 A;  5DEQ A;  3PSI A;  4BY7 J;  1S29 A;  4EV0 A;  3HOW J;  4A3L J;  4AID A;  1HDD C;  5F04 A;  5DUK A;  2E2I J;  2Q8K A;  1BOB A;  3CCQ I;  1I39 A;  1JTX A;  4C3I J;  1RKT A;  4RLF A;  3LSI A;  5EF6 A;  3I4N J;  2LNB A;  2JUC A;  3BG7 A;  1OR7 C;  2LR8 A;  2P6T A;  4CYC A;  1BM9 A;  1HW2 A;  4E4H A;  3CCR I;  1RR8 C;  4PJN A;  1YRN B;  4G9Y A;  3K4K A;  3DEE A;  4HV6 A;  4RAF A;  5HS7 A;  2BXY A;  3JRI A;  3BP8 A;  2FMY A;  2M1B A;  5BNG A;  2CWE A;  1K61 A;  1FT9 A;  1QHG A;  5IOZ A;  2D1H A;  3W6J B;  2DYR H;  4M9S A;  4XN3 A;  2F4O B;  3F72 A;  1TLH B;  1Y1W J;  2OU2 A;  4OIO F;  4K2E A;  5M3F J;  5E1W A;  2MC4 A;  5K5Q A;  2P8T A;  1YIT I;  4HV5 A;  3A0H C;  1MZB A;  2WAF A;  1JGS A;  5JLX A;  2XPW A;  3CUO A;  1Y8Q B;  4FQG A;  2P5K A;  3ZQL A;  2K9Q A;  2M4K A;  3NWT A;  5IT9 K;  1FTZ A;  3VOE A;  3BG3 A;  4I7H A;  2QQB A;  2CV1 A;  4DYC A;  5CVR A;  2XAS A;  2DPU A;  3KP3 A;  3QPS A;  3ISP A;  3ML6 A;  2MBF A;  3ONQ A;  4YFN F;  3P5J A;  3W2W A;  3JRE A;  2GIZ A;  2ME6 A;  3U2R A;  3HOT A;  4E7K A;  3BR6 A;  2K9S A;  2KJB A;  1Z7U A;  3W2V A;  1LFB A;  4BE2 A;  3L00 A;  3WTY C;  1WJE A;  2KRF A;  3BOQ A;  3LQR A;  4XKV A;  4M6V A;  2L7M P;  3JSP A;  1YX3 A;  4Y52 J;  4MQ9 F;  2KQR A;  4ENK A;  1KU7 A;  2E2H J;  1U78 A;  4BNC A;  1FMV A;  4OMY A;  4IHS A;  5D4S A;  3F6O A;  1E3H A;  3T8R A;  3MZH A;  3WE3 A;  2R7Z J;  4R1H A;  3TP3 A;  1IUY A;  4NC8 A;  3WGH A;  2EZK A;  4HX7 A;  1BW6 A;  3BC8 A;  4CSW A;  5FKM A;  3ZN1 A;  3OYG A;  2W25 A;  4H4K C;  4HF1 A;  4OWR B;  1IXR C;  1D0Z A;  2OCC H;  3LMM A;  3WU0 A;  3LA7 A;  4UUS A;  1K4S A;  4A3D J;  2N8G A;  3HUG A;  3CLQ A;  1R4M B;  3HOS A;  1IRX A;  4A12 A;  2B7E A;  4HAM A;  1I27 A;  2DO7 A;  3K0L A;  5A2Q Z;  2HKO A;  1H89 C;  1VQ8 I;  3D0S A;  3I56 I;  1F1Z A;  2ZJP F;  3PO3 J;  3FDY A;  3U1D A;  3ZMZ A;  3OR1 C;  2M8E A;  4B3A A;  1S9H A;  1ACI A;  3LST A;  1J0R A;  4OMZ A;  4LLL A;  2V9P A;  3E5X A;  4M6X A;  4GYI A;  2PMZ N;  3HSR A;  2XGC A;  5EEG A;  3PUF A;  2LY2 A;  2HU9 A;  5F27 A;  1IN7 A;  2EFW A;  3WTT C;  3MKY B;  4ZH4 F;  5FKO A;  1T0F A;  2WAQ A;  3F8B A;  4OAY A;  4UHT A;  2HZD A;  2DA5 A;  5D5V B;  4CDG A;  3KET A;  1A5J A;  1KA8 A;  1P2F A;  4C2M J;  4FX4 A;  1R49 A;  3RQI A;  3S8P A;  5E8I A;  4NC7 A;  3TP0 A;  3H36 A;  4ZYH A;  1NG6 A;  3CDL A;  4AIK A;  4IVN A;  5L3C A;  2IS6 A;  2DA3 A;  5FGM A;  2VOP A;  4X1E A;  4UVA A;  3KPH A;  3RKY A;  1X58 A;  5K1Y A;  3LSR A;  4BH9 A;  1OPC A;  5KAI C;  4KIC A;  1YS7 A;  4BGD A;  1R5I D;  3C2H A;  4JX5 A;  1ZR2 A;  2TRT A;  4XM3 A;  1E3O C;  1DQU A;  3GTQ J;  1A6Q A;  3H3Z A;  5IT3 A;  2ETH A;  2EFN A;  1FTT A;  3TO6 A;  1P9Q C;  3H5R A;  2RDP A;  1F36 A;  2Z3Y A;  3E0J B;  4M3F A;  1XS9 A;  1MBJ A;  2JUG A;  2DA2 A;  4EGZ A;  2MLK A;  1MIJ A;  5GPC A;  4XLF A;  2JA2 A;  1I5Z A;  5E3O A;  2LD5 A;  3ZP5 A;  3AL0 C;  1NK3 P;  1MW7 A;  1WZ2 A;  2PJR B;  1W7P D;  3GLX A;  2DW4 A;  1ZRC A;  2JN6 A;  2DYS H;  4Y3O A;  2KZV A;  1ERD A;  5DCM A;  3WHC A;  3N4M A;  1JJ6 C;  3FK6 A;  3UNG C;  4W97 A;  4WWC A;  4J00 A;  1BBY A;  2WAD A;  2QSG X;  1WRJ A;  1WCM J;  2A5Y B;  4XOP A;  5HS8 A;  4J19 A;  3CF2 A;  4MFE A;  1D8K A;  1V55 H;  3L2R A;  1STZ A;  1CQT A;  1KU3 A;  3CP2 A;  4JP0 A;  1KON A;  3VYU B;  3E1S A;  5LGN A;  2K86 A;  3L9F A;  2ZNZ A;  3QAH A;  1IV8 A;  5LLQ A;  3F8N A;  3ERM A;  1HBX G;  4RMN A;  2VPL A;  1XG1 A;  2FNP A;  2VLA A;  3O8G A;  2IGK A;  5DCM B;  1GXQ A;  3OYH A;  5E20 A;  2H09 A;  4XLN F;  4IOC F;  1JKQ C;  2XB5 A;  3DTI A;  5HOD A;  4C2U A;  1TWC J;  3F9K A;  2I8D A;  1YRN A;  1BI1 A;  1K6Y A;  3CO7 C;  3K10 A;  2Y75 A;  3EUA A;  4A0Y A;  3Q0W A;  2DBB A;  3OOU A;  4WF2 A;  2R7D A;  2OUM A;  2WB1 N;  1FSH A;  2E35 A;  2LFB A;  2XAU A;  2XGE A;  1Z77 A;  3PQK A;  4D0P A;  4IKF A;  1KU2 A;  3GFL A;  2EZH A;  1WFX A;  3B6A A;  4DW6 A;  5DUI A;  3SZT A;  3CCJ I;  2L01 A;  3P9K A;  3FWE A;  3SYT A;  2P5L C;  4YII A;  1FSE A;  4MNU A;  3S2W A;  3GTK J;  1YQA A;  1FBU A;  2LMD A;  2FBH A;  5CVI A;  5ED4 A;  4DNC A;  5L3G A;  5D5U B;  1R9T J;  3BQY A;  1GVD A;  3QYF A;  3DKX A;  4I0A A;  4A69 C;  3FBN B;  1BJA A;  5FKL A;  1F5T A;  3V7R A;  4D7N A;  5F6F A;  1T33 A;  2LKS A;  2ISY A;  3GO5 A;  2CW0 F;  3LOC A;  4KJZ A;  3P9C A;  4XNF A;  2MFZ A;  1VQK I;  2HQR A;  1U5T B;  1TT5 B;  3CCM I;  3KE2 A;  3LA2 A;  1VF9 A;  1G3Y A;  1Z3X A;  4ABZ A;  1QRY A;  2PG4 A;  3OIO A;  1SD4 A;  2Y2Z A;  2QQA A;  2DOD A;  2X9D A;  5DDG A;  2V6E A;  2L4A A;  3EQL F;  2VE9 A;  4DJA A;  1KQ9 A;  2F5E A;  1USS A;  2KKO A;  2K3P A;  3TO9 A;  2VOO A;  1WJF A;  2MA3 A;  1WQ2 A;  4EJV A;  1V54 H;  3SDG A;  2OTJ I;  1SVO A;  1D1C A;  3HOX J;  3PIP F;  2E60 A;  2XSD C;  2KDO A;  3K4C A;  3B73 A;  4A5N A;  4PUS A;  3GLL A;  2KIM A;  4EJO A;  2KDZ A;  1WJD A;  1ZGW A;  4A3F J;  3IWZ A;  2ZJR F;  3OYE A;  2MD0 A;  5IYC J;  2O7O A;  1RC9 A;  3B02 A;  4OOI A;  3KEO A;  4L9N A;  4LK0 F;  4XQF A;  5EZH A;  2Q2E B;  2X1D A;  3K4M A;  3MCZ A;  1DGR M;  2JRM A;  1SAX A;  3BY6 A;  3GME A;  2FF4 A;  5FD5 A;  3VWB A;  3FXM A;  3FM5 A;  2LF7 A;  2DK5 A;  4G6Q A;  1R36 A;  2XF6 A;  3I9V 2;  4BL0 B;  1UG0 A;  2Z99 A;  2W85 A;  4PFP A;  3WG7 H;  1LEA A;  3S3N A;  1YW8 A;  3V7S A;  2VAS A;  9ANT A;  4RBO A;  5E18 F;  2R93 J;  3EUK L;  2DMN A;  3BTL A;  1KZH A;  1YJ9 I;  1RES A;  4G6D A;  3OY9 A;  1ZGJ A;  2QSH X;  5EEA A;  2HPM A;  1HA8 A;  1X1P A;  4PJL A;  1N75 A;  3GTG J;  3AG2 H;  4B1R A;  4G12 A;  3EUH C;  1PUF B;  3R4K A;  3HSE A;  3Q3S A;  3GVA A;  5FLV A;  3DPT A;  4ASN A;  2W7N A;  1HKQ A;  1MSE C;  2QM3 A;  2VON A;  2O61 A;  2PN6 A;  2O03 A;  2UXN A;  3O2P E;  5TIS C;  3LFU A;  1TQM A;  3HXL A;  4RDU A;  5HS9 A;  2A5W A;  1DU0 A;  1R23 A;  2IXS A;  1FIP A;  1PYV A;  3ZQI A;  4ZDO A;  1E0E A;  5LHH A;  1T95 A;  4E7J A;  3K7A J;  4GCV A;  2JQ7 A;  1WPK A;  3TMO A;  3WTW C;  4XK4 A;  5TJJ A;  1WH5 A;  2WY7 Q;  1A04 A;  3KYD B;  4OAZ A;  5JHU A;  2DDB A;  3FHN A;  2JTV A;  1S7O A;  3NQO A;  3WTS C;  1IDZ A;  2ZJ2 A;  1R5G A;  2HYF A;  4F3Q A;  3L1P A;  4G7O F;  2E7W A;  3HOU J;  5DYM A;  3TDZ C;  1P4A A;  5DCF A;  3LSH A;  1HF0 A;  2FA5 A;  1LDJ A;  3HKZ A;  4KIF A;  3OYA A;  1G3W A;  3CLO A;  4D9J A;  2HVS A;  3HC7 A;  4L9J A;  3WGI A;  2DPD A;  3HGY A;  1FEX A;  3WE2 A;  1R7J A;  1TNS A;  2GOX B;  2YU9 J;  3GEZ A;  2JRT A;  2FU4 A;  1MJ9 A;  1OR7 A;  1ZAR A;  4CO8 A;  4L18 B;  3LAJ A;  4F52 A;  4XSZ F;  2E1O A;  3F21 A;  2ELH A;  3WTX C;  2IGN A;  5LFA A;  2I10 A;  5F0H A;  1W1W E;  3FKJ A;  3OR2 C;  2AHQ A;  4GXO A;  5E1Z B;  2ZME C;  3IHU A;  4D1Q A;  2ZCW A;  2NVU B;  3W6K B;  2A68 F;  2MD5 A;  4XIC A;  4HA8 A;  3LQQ A;  3P7N A;  4AM3 A;  2AS5 F;  4CZZ A;  2NXN B;  2XAG A;  4EEF G;  2M87 A;  4JBA A;  2W48 A;  1MGT A;  3V8K A;  2MG4 A;  3JRG A;  4NHJ A;  2WAE A;  3BG5 A;  3K1P A;  4ESF A;  1UCR A;  1LE8 A;  2CV0 A;  4H0E A;  2HPI A;  5ILS A;  3GXO A;  4O6J A;  1YW7 A;  2FXA A;  1P7J A;  1WWX A;  2DTR A;  2JVG A;  4UV8 A;  2K4B A;  4BXU A;  3FF5 A;  4AUX A;  1V5E A;  1ZRE A;  1WJC A;  1W36 C;  4LD5 A;  3JAM Z;  3SEZ A;  2IRF G;  2JPB A;  1WH7 A;  4RLQ A;  1ZG3 A;  3ZOB A;  5FFX A;  2QKL B;  4N9I A;  2FQ3 A;  2D1V A;  2LOO A;  1W5C C;  2K9M A;  3S2H J;  3HOY J;  5EEH A;  1XX5 A;  4RM3 A;  3IKT A;  3CD6 I;  2TCT A;  2H8W A; 
#chains in the Genus database with same CATH homology
 1U8B A;  3BT9 A;  5EG0 B;  3BTI A;  5M5W J;  1IG7 A;  1Y1W J;  1JJ8 C;  5C4X J;  3H0G J;  5M3F J;  2M34 A;  1ETQ A;  1JKP C;  2IEK A;  2R5Y B;  1W0U A;  3IV5 A;  5GPA A;  2IAI A;  3S1Q J;  1UG2 A;  3JRH A;  2EZL A;  1APL C;  2YS9 A;  3JRB A;  3IH4 A;  5JLX A;  2XPW A;  2R5Y A;  1SAN A;  1D5Y A;  2DA4 A;  3ZQL A;  2HOA A;  2K9Q A;  1FTZ A;  3M4O J;  4XRM A;  3BG3 A;  3JRF A;  5FLM J;  5M5X J;  3GTJ J;  4A93 J;  2O9L A;  3GTO J;  2XGD A;  4DYC A;  1ITY A;  2FJ1 A;  3QPS A;  3HOZ J;  3S1N J;  4QTR A;  4XRS A;  4B4C A;  2DMQ A;  5M5Y J;  1JUP A;  3BTJ A;  3JRE A;  3JRD A;  1MBG A;  2ME6 A;  2R5Z B;  1OCT C;  3LSG A;  3BR6 A;  2K9S A;  4I76 A;  3LSJ A;  1LFB A;  3S2D J;  1Z0X A;  2VI6 A;  1B72 B;  3QPL A;  2M2E A;  5IOY A;  4A3B J;  1UHS A;  1XC5 A;  3HGG A;  2M0C A;  4JYK A;  1WGX A;  4M6V A;  2L7M P;  4Y52 J;  5K7H A;  2CQQ A;  2E2H J;  1GV2 A;  1U78 A;  1BL0 A;  1VND A;  1ETX A;  1GDT A;  1Q1V A;  4MO7 A;  3DCF A;  3SJM A;  1ZR4 A;  1IC8 A;  1VFC A;  2R7Z J;  3TP3 A;  2EZK A;  2DA6 A;  4BXX J;  3E7L A;  3GTL J;  5FKK A;  1BW6 A;  5E3N A;  2MSY A;  2ME0 A;  4XRS G;  5FKM A;  2JA6 J;  1ORK A;  3HDD A;  1QPI A;  4UUS A;  1WI3 A;  4A3D J;  2N8G A;  3MKL A;  3BTC A;  3IH3 A;  4FCY A;  1TC3 C;  1AU7 A;  4MFD A;  5EYR A;  1O4X A;  1H89 C;  3C2B A;  3PO3 J;  4B3A A;  4IHW A;  2DN0 A;  4FIS A;  2PMZ N;  1VI0 A;  2QCO A;  2XGC A;  5F27 A;  5IP7 J;  3JRA A;  3PM1 A;  2M8G X;  5FKO A;  2VKV A;  2Y30 A;  1I3Q J;  3HBL A;  3RKQ A;  1B8I A;  1JT0 A;  3S14 J;  2H1K A;  2JA5 J;  2Y9Z A;  4MIM A;  4IHY A;  2DA5 A;  1TWF J;  3CMY A;  2JMW A;  2H8R A;  4M3B A;  1A5J A;  4C2M J;  3OSG A;  3W6V A;  3RQI A;  2CQX A;  1X2N A;  2LLK A;  3TP0 A;  5C44 J;  2DJN A;  5EDN A;  3CDL A;  1QVU A;  2AO9 A;  1JKR C;  2EZI A;  4XID A;  2DA3 A;  4HNV A;  2ID3 A;  4X1E A;  2JJ7 A;  5EGO B;  1X58 A;  3K2A A;  3ZQH A;  3LSR A;  3F0C A;  3UKG A;  1HDP A;  3BQZ A;  4FE7 A;  2TRT A;  4JX5 A;  1ZR2 A;  1E3O C;  1IV6 A;  3GTQ J;  1FTT A;  2ECB A;  1XS9 A;  1F36 A;  4M3F A;  1MBJ A;  2DA2 A;  1IUF A;  3VPR A;  5J3L A;  2HXI A;  4FE4 A;  5GPC A;  2WV1 A;  3S1M J;  2EBI A;  5E3O A;  2LD5 A;  1MH4 A;  1ZTR A;  3Q0U A;  1NK3 P;  2JN6 A;  2HQ5 A;  3M3Y J;  3WHC A;  1JJ6 C;  3FK6 A;  5C4J J;  4W97 A;  4NDL A;  1BJZ A;  1WCM J;  3MVP A;  1BA5 A;  3WHB A;  4J19 A;  3S17 J;  1OCP A;  4M3D A;  1IRZ A;  4MFE A;  3ZQF A;  3NAR A;  2MGQ A;  1CQT A;  1RPW A;  4JP0 A;  3JRC A;  1MNM C;  2CUF A;  2Y0S N;  4QSH A;  2B63 J;  1XG1 A;  3O8G A;  5F08 A;  1ETV A;  2XB0 X;  2XPU A;  1JKQ C;  2XB5 A;  3ZQG A;  1FJL A;  5HOD A;  1S7E A;  1A6I A;  2NS8 A;  1TWC J;  4BY1 J;  3RZO J;  1YRN A;  3MN2 A;  2HYJ A;  2HOS A;  5K7F A;  2L9R A;  1IGN A;  1MBF A;  3Q0W A;  3OOU A;  4JX6 A;  4AYB N;  2EQR A;  2DTZ A;  2WB1 N;  2M9H A;  2NVT J;  1MSF C;  1HOM A;  1JUM A;  3PO2 J;  1X2M A;  1ETO A;  3FIS A;  2LFB A;  4V2F A;  2XGE A;  1Z77 A;  4IHV A;  3FK7 A;  4DZJ A;  5E3M A;  3H3V K;  3G1M A;  2EZH A;  3B6A A;  2NOG A;  4W1U A;  4DW6 A;  2LK2 A;  1AKH A;  1JTY A;  3GTK J;  3HOV J;  1R9T J;  5IPA A;  3BQY A;  1AKH B;  1GVD A;  1RR7 A;  5GP9 A;  4DZP A;  1RET A;  4A69 C;  5FKL A;  1RKW A;  1ZQ3 P;  3RZD J;  2E2J J;  4D7N A;  5EGO A;  2XRL A;  1PUF A;  1T33 A;  3BR0 A;  2L7F P;  2XPV A;  3LOC A;  4Y7N J;  4FTH A;  2HOT A;  4A3M J;  1UMQ A;  1AHD P;  2LVS A;  1GV5 A;  1VF9 A;  1Y1V J;  5FKN A;  4S0H B;  1JGG A;  4ABZ A;  1QRY A;  3OIO A;  4BBS J;  2Y2Z A;  2X9D A;  5DTD A;  1OJL A;  2Y9Y A;  5J1U A;  4C3H J;  4X6A J;  4D7M A;  1ETW A;  3BR1 A;  1MBK A;  3SDG A;  3SFI A;  3GTM J;  2D5V A;  2X48 A;  3HOX J;  2L0K A;  2COB A;  2EH3 A;  2ELK A;  2XSD C;  1U9N A;  3LNQ A;  4BBR J;  2OPT A;  1U9O A;  5J1Y A;  3D1N I;  1GT0 C;  2KDZ A;  1ZGW A;  3A01 B;  1ZK8 A;  4A3F J;  2JA7 J;  1LFU P;  5JLW A;  2QF7 A;  5DS9 A;  5IYC J;  3A01 A;  2O7O A;  1MH3 A;  2LP0 A;  1JUS A;  1ETK A;  5EZH A;  3JR9 A;  3S16 J;  2GLO A;  4QIW N;  1SFO J;  2FD5 A;  3BG9 A;  3Q0V A;  1TWH J;  1BW5 A;  5EG0 A;  1POG A;  1H88 C;  3G1L A;  4IHX A;  2G0E A;  4A3G J;  2JWT A;  2R92 J;  4CYC B;  1DU6 A;  1IJW C;  5M3M J;  4LOC A;  9ANT A;  4RBO A;  1I6H J;  1G2H A;  4JX4 A;  1ETY A;  2R93 J;  2DMN A;  3BTL A;  1RES A;  4UUT A;  1I50 J;  5EEA A;  3GTG J;  3LSP A;  3GBG A;  4B1R A;  4I6Z A;  4G12 A;  1NK2 P;  1PUF B;  2R0Q C;  3Q3S A;  1B8I B;  2VUM J;  3IH2 A;  1IDY A;  5FLV A;  3QQA A;  1MSE C;  3O8H A;  3I4M J;  2ID6 A;  5IYB J;  4A3E J;  3G1O A;  2K40 A;  3TW6 A;  3FIW A;  3HEF A;  1HCR A;  4RDU A;  1ZKG A;  2JK3 A;  4BKX A;  4DYQ A;  3CQZ J;  2DMT A;  1DU0 A;  1OFC X;  4IEJ A;  1FIP A;  3CCY A;  4D5F A;  2NS7 A;  3ZQI A;  3HKZ N;  2CU7 A;  2FX0 A;  3K7A J;  2X6O A;  1WPK A;  2IBD A;  4XK4 A;  1WH5 A;  1ENH A;  2E19 A;  5F0C A;  2DA7 A;  1JKO C;  1FIA A;  3A03 A;  2GM4 A;  3BR3 A;  5EZG A;  2ZB9 A;  4M3G A;  3OSF A;  1IDZ A;  2GBY A;  2NVY J;  3HB9 A;  5FJ8 J;  1T56 A;  3L1P A;  2CUE A;  2HI3 A;  3BR5 A;  3GTP J;  4GFB A;  3HOU J;  5IOZ A;  2DA1 A;  2R5Z A;  4M3E A;  2DMU A;  2O8K A;  5IYD J;  1HF0 A;  1P7I A;  3FKI J;  3HM5 A;  5IP9 J;  4V2G A;  3NAU A;  2NVQ J;  5F0F A;  2NVX J;  1GUU A;  1FEX A;  3HGY A;  2ECC A;  2Y31 A;  1JT6 A;  2YU9 J;  3B6C A;  5F1J A;  3ZQC A;  2K9N A;  2LKX A;  4A3J J;  1W0T A;  4A3C J;  5C3E J;  1TWG J;  2DMP A;  2VPR A;  4A3I J;  1B72 A;  2YUS A;  2E1O A;  1HLV A;  4UUS B;  2I10 A;  5F0H A;  1H8A C;  1QVT A;  2VKE A;  2AHQ A;  4D5C A;  3A02 A;  2L7Z A;  3S15 J;  4XIC A;  2CRG A;  1NTC A;  4L5E A;  4EEF G;  2KT0 A;  4AC0 A;  2W48 A;  5J1R A;  2MG4 A;  3TW7 A;  2FQ4 A;  3JRG A;  4BY7 J;  3HOW J;  5K7Z A;  3BG5 A;  4A3L J;  1TWA J;  2P81 A;  1HDD C;  5F04 A;  1LE8 A;  2E2I J;  1JTX A;  4C3I J;  4A3K J;  1P7J A;  1RKT A;  4MLO A;  5EF6 A;  3I4N J;  2LTP A;  3TED A;  4AUX A;  2LR8 A;  2MW8 A;  1MBH A;  4CYC A;  1EF4 A;  4DYR A;  2JA8 J;  2HXO A;  1K83 J;  2CJJ A;  2OF7 A;  1F43 A;  1WH7 A;  1YRN B;  3ZOB A;  3S1R J;  3DEW A;  5IP6 A;  2HDD A;  3JRI A;  4C3J J;  3BR2 A;  1LE8 B;  3S2H J;  2LY9 A;  2WAQ N;  5BNG A;  3HOY J;  1MBE A;  5E3L A;  1K61 A;  2RAE A;  2TCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...