1MSEC

Solution structure of a specific dna complex of the myb dna-binding domain with cooperative recognition helices
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
105
structure length
105
Chain Sequence
MLIKGPWTKEEDQRVIKLVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords DNA (5'-D(*CP*CP*TP*AP*AP*CP*TP*GP*AP*CP*AP*CP*AP*CP*AP*T)-3
publication title Solution structure of a specific DNA complex of the Myb DNA-binding domain with cooperative recognition helices.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 1995-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mseC01
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mseC02
2R5ZB 3M4OJ 2JMWA 2LY9A 2IAIA 1OFCX 2QCOA 4A3FJ 2AHQA 1WI3A 3W6VA 1OJLA 5E3MA 3BR2A 3ZQCA 3E7LA 3MN2A 5K7FA 1IV6A 1B8IB 2XB5A 3FKIJ 1G2HA 2R5ZA 1WCMJ 4FE7A 1RKWA 2DMPA 1TWFJ 1IRZA 2Y9ZA 3K2AA 2HXIA 4V2GA 5F08A 2R93J 2CRGA 1MBJA 3ZOBA 1SANA 1B8IA 3OIOA 2FJ1A 4NDLA 3ZQLA 1HOMA 1JTXA 3IH4A 1X2MA 3HM5A 2JA6J 1XS9A 2M0CA 2L0KA 3HKZN 4A3CJ 4FISA 1A5JA 4FE4A 1ZKGA 2DJNA 3QQAA 2CU7A 4IEJA 1F36A 1S7EA 3BR3A 2MGQA 1FTZA 3BG9A 4XK4A 1U78A 1MBEA 5FJ8J 3B6CA 1K61A 2HOTA 9ANTA 5GPCA 1VFCA 1HCRA 3BTIA 2COBA 1E3OC 1IDYA 3F0CA 2QF7A 3SJMA 2XB0X 1JJ8C 1HF0A 2DMUA 3BR1A 1RETA 2LLKA 1O4XA 3RQIA 2ME6A 2JA7J 2K9SA 1A6IA 2OPTA 2RAEA 2LTPA 1TWCJ 3HOZJ 3GTMJ 3H0GJ 5JLWA 4UUSB 1X2NA 2X6OA 3WHCA 5M5WJ 2EQRA 1Y1VJ 2CUEA 4DYCA 3S17J 1BJZA 2JA5J 4M3BA 1POGA 1RR7A 3IH3A 5IYCJ 3TEDA 3TW6A 2NOGA 3JRGA 5IPAA 5F04A 1H89C 3TP3A 2CUFA 1VI0A 3WHBA 4UUTA 1JGGA 4JP0A 3S1QJ 4UUSA 3QPSA 5F0HA 3S1RJ 2MG4A 3BQZA 2VI6A 4BBSJ 3O8HA 3GTGJ 2G0EA 3HOXJ 2DTZA 5M3MJ 1NTCA 2FX0A 1MSEC 1ETWA 4V2FA 3S2DJ 4JX6A 2DA5A 3G1OA 5J1YA 3UKGA 3BG3A 1I3QJ 4M3DA 4AC0A 1UG2A 2Y30A 4FTHA 3D1NI 3K7AJ 3HEFA 3MKLA 3BG5A 3M3YJ 1FIPA 1Z0XA 3TW7A 4A3GJ 5FKLA 1UMQA 3ZQFA 2DMNA 5FLVA 1WGXA 2M2EA 2M8GX 2HOAA 1IC8A 4A3IJ 5IYDJ 4L5EA 4A93J 1BA5A 3JR9A 3G1MA 2R5YB 4G12A 4X6AJ 2DN0A 2NVXJ 4D5FA 1IDZA 2HDDA 5J3LA 1EF4A 2HI3A 3HB9A 1BL0A 2HQ5A 1TWHJ 3S16J 1RPWA 1ZGWA 1I6HJ 4A69C 3JRDA 2ECCA 1H88C 2R5YA 3RZOJ 4X1EA 1HLVA 5DTDA 1AHDP 3HDDA 3HOUJ 1FEXA 4A3JJ 4BY7J 1JKRC 2X9DA 4Y7NJ 2E2IJ 1HDDC 4MO7A 4B3AA 1VNDA 4B1RA 1P7IA 1BW6A 4D7NA 1MBKA 1MH3A 2XPVA 5GPAA 3Q0VA 5C3EJ 3GTLJ 3GTKJ 3PO3J 1T56A 2DMTA 5FKKA 3FISA 5GP9A 1HDPA 3HGGA 3CDLA 2X48A 2FQ4A 1ETOA 4D7MA 5FKNA 3JRIA 4BBRJ 2E2HJ 2OF7A 4IHXA 3S2HJ 3HBLA 1I50J 1GV2A 5M3FJ 4XIDA 2HYJA 3PM1A 1MBFA 2XGEA 2CQXA 4BXXJ 1FJLA 4C2MJ 3IH2A 1XC5A 1SFOJ 3GTJJ 3H3VK 1QRYA 3BR6A 4S0HB 2N8GA 5F0FA 2K9QA 1JKPC 2XGCA 5IYBJ 1CQTA 2TCTA 1MBHA 3DEWA 2WV1A 4XICA 1NK3P 5JLXA 2ELKA 3S1NJ 3LSPA 5IP7J 1APLC 2K9NA 2NVQJ 2LVSA 3Q0WA 1JJ6C 4QIWN 5EG0A 5HODA 2LD5A 3JREA 1RKTA 3FK6A 1ETQA 1WPKA 1JTYA 3BR0A 4GFBA 3HOWJ 4W1UA 3BTCA 2DA7A 2EZLA 3DCFA 2O9LA 1AU7A 1W0UA 1DU0A 2H1KA 1AKHB 1T33A 3JRAA 1ZTRA 2JWTA 3BTJA 2DA2A 3JRFA 3G1LA 2DA3A 4W97A 1LFUP 2VPRA 2IBDA 1BW5A 1AKHA 1QVUA 2O8KA 3A02A 4XRSA 5IOYA 4AUXA 2MSYA 1ZR4A 1JT6A 2VUMJ 3FIWA 4DYQA 3GTPJ 3ZQGA 2DA4A 4I76A 2GLOA 5IP9J 5C4XJ 3QPLA 3CQZJ 2EBIA 4RDUA 3OSFA 3S1MJ 1IG7A 4MLOA 5IOZA 3S14J 5J1RA 2CJJA 5EDNA 1IUFA 2DA6A 2JN6A 3JRBA 1QPIA 5J1UA 1ETXA 5EZGA 1P7JA 4C3HJ 1D5YA 2R7ZJ 4A3BJ 2VKEA 1PUFB 2EZIA 4MFEA 2FD5A 1FIAA 2DMQA 2CQQA 4MFDA 2YU9J 1IGNA 3BT9A 1Z77A 2YUSA 2YS9A 5C44J 3NARA 5EZHA 1OCPA 1Q1VA 2R0QC 3GBGA 3S15J 5BNGA 1PUFA 1MH4A 2NVTJ 3BTLA 4BKXA 3L1PA 4AYBN 3OSGA 2E2JJ 2P81A 3O8GA 2L9RA 4M3FA 4B4CA 2JK3A 1F43A 1MNMC 4JYKA 2JJ7A 5EYRA 2NS7A 3C2BA 1QVTA 4DYRA 4IHWA 1DU6A 5E3LA 3LSRA 5E3OA 3TP0A 3BR5A 2MW8A 3CMYA 2IEKA 5M5YJ 1K83J 1B72B 4DW6A 5EF6A 2H8RA 4A3EJ 5F27A 4MIMA 5F0CA 4EEFG 2WAQN 4JX5A 4DZPA 1WH5A 2ID3A 2WB1N 3NAUA 2ZB9A 1ENHA 4CYCB 4I6ZA 2HXOA 1ITYA 3A03A 2Y0SN 3LNQA 1W0TA 4M3EA 2Y9YA 1Y1WJ 4QSHA 2XRLA 5FLMJ 1B72A 2Y31A 3I4MJ 5EG0B 4IHVA 2E19A 3A01B 1MSFC 5E3NA 2ECBA 4D5CA 3GTQJ 4CYCA 1WH7A 3HOYJ 2XPUA 1H8AC 1ETVA 2LFBA 1JKQC 3MVPA 4DZJA 3B6AA 2K40A 1TWGJ 1TWAJ 2E1OA 2NS8A 5FKMA 2GBYA 5IP6A 3Q0UA 3GTOJ 4C3IJ 2LKXA 3A01A 4M6VA 4J19A 1ZR2A 1JT0A 3BQYA 4A3MJ 4IHYA 1GDTA 2ME0A 2D5VA 1ZK8A 2B63J 2EH3A 2KT0A 4LOCA 3LSGA 1JUMA 2L7FP 2DA1A 1LE8B 5DS9A 3RKQA 2LK2A 3HGYA 1UHSA 1YRNB 3RZDJ 5C4JJ 1OCTC 5K7HA 2XPWA 3PO2J 2EZKA 1XG1A 3VPRA 1VF9A 3HOVJ 3LOCA 3ZQHA 1LE8A 2AO9A 5F1JA 2XSDC 2PMZN 1IJWC 3JRHA 2L7ZA 5M5XJ 1YRNA 1GV5A 1GUUA 1NK2P 1ETYA 4M3GA 1U9OA 2LP0A 2M9HA 2KDZA 1GT0C 1LFBA 5K7ZA 4C3JJ 1ORKA 4Y52J 1MBGA 2TRTA 3I4NJ 4FCYA 2R92J 2ID6A 2I10A 1ZQ3P 1ETKA 1JUPA 1TC3C 5EGOB 1RESA 4XRMA 1JUSA 3IV5A 3FK7A 3JRCA 1GVDA 2NVYJ 3CCYA 1JKOC 3LSJA 4A3DJ 4HNVA 2EZHA 3SFIA 2JA8J 2HOSA 2VKVA 4BY1J 3OOUA 4ABZA 4A3KJ 5EGOA 3ZQIA 2LR8A 2M34A 1R9TJ 2GM4A 1FTTA 1U9NA 5FKOA 5EEAA 1U8BA 4RBOA 2O7OA 2W48A 2L7MP 4A3LJ 4JX4A 2XGDA 2Y2ZA 3SDGA 3Q3SA 4QTRA 4XRSG 1X58A
chains in the Genus database with same CATH superfamily
2FSWA 1HW1A 3GZ6A 2R5ZB 1FP1D 2BBYA 5BQTA 3MKWB 1X3WB 1IRGA 1ZLJA 2IAIA 2AHQA 1S7OA 5GAEJ 1WI3A 5ILSA 3CC7I 3BR2A 3ZMSA 1IXCA 5K7FA 3KIOA 2X6YA 4HA8A 2DPUA 3KP7A 2PG4A 1U3EM 1G3WA 4IPAA 5D6EA 2R7TA 1EV7A 2XROA 1ZG5A 3TGNA 2DTRA 3PUBA 2HS5A 3K2AA 1LVKA 4BH9A 1YQAA 2LREA 2R93J 4P9UA 1AA7A 2XAGA 2NNYA 1R49A 3T5XA 3OIOA 1Z05A 2FJ1A 1PDNC 2LC2A 3ZQLA 1HOMA 1LUJB 1JTXA 2FEZA 3HRSA 2HU9A 2VQGA 1U2WA 2L0KA 3HKZN 3FXKA 2D2WA 4FISA 2RN7A 2DJNA 4H4KC 4HBLA 4HLYA 4I99C 2CU7A 4WWCA 5LEKA 2ACJA 3EUHA 2W24A 4EM2A 1FTZA 1D3YA 4XK4A 4U7DA 5FJ8J 1U78A 1HW5A 3B6CA 3UNGC 2KRCA 3KX2A 4MNUA 9ANTA 1SD4A 3FXLA 4KT6A 2UXXA 2GOXB 2NNNA 3OYCA 3L2VA 2YX7A 3H9QA 3K4BA 3ERMA 1IDYA 2STWA 1SAXA 3E3VA 2QF7A 3ABTA 1LEAA 2E1NA 4I0BA 2H6CA 1TZLA 2XB0X 3IWFA 3G4SI 4LLGF 2IA1A 1RETA 2V7FA 3SEZA 1XGOA 4EM1A 3RPQA 1STZA 1I1GA 1R1VA 1YI2I 1TWCJ 3M8FA 2OZ6A 1YJ9I 4XKVA 5LBQA 4UUSB 1X2NA 5M5WJ 1Z7UA 2QUFA 2CYYA 2CUEA 3S17J 2JA5J 4L0YB 4P5OA 3IH3A 1TNTA 4HPQA 3TW6A 3C2GA 3FMSA 3JRGA 5KK1A 3CMEI 4CYDA 3JW4A 4OAZA 1J59A 1VI0A 1RIOH 2IRFG 3QPTA 2EIMH 4YIIA 2VASA 1MZBA 4PDKA 3MAJA 3S1RJ 2HNHA 3OL4A 3J7ZI 3I5UA 3BQZA 4BBSJ 1Z7LA 1ZGJA 2VJ5A 4U0WA 1NG6A 2G7UA 2DFIA 3FXJA 3GMEA 2XAQA 2E7WA 3FDYA 1VQKI 2FA5A 4XKWA 2VQCA 2BY1A 5JHUA 3FMQA 5HOOA 2NVUB 3IAM2 3CCJI 2GXBA 2DA5A 2VQLA 5J1YA 3QWLA 2Y0MA 1X3ZB 3LSIA 4M3DA 4AC0A 1NHAA 4FTHA 3KE2A 3K69A 5FO5A 2MH2A 2XVCA 1Z0XA 3TW7A 2EJRA 3KZZA 4HF2A 2OCCH 5LHGA 3FMRA 4YRVA 2WWYA 4CCJA 2OTLI 4EJVA 4Y3OA 2DW4A 2HOAA 1GHCA 2MLKA 2KIQA 2XAHA 4A3IJ 4BHCA 1J2XA 5LGUA 5EEHA 5HDNA 2YX4A 3W6JB 2UV1A 4G12A 2HQNA 4D5FA 2HDDA 1T38A 5J3LA 1MNDA 2EIJH 1X1DA 4RAZA 2HQ5A 4NNJA 3S16J 2ZFUA 1XTAA 1I6HJ 3GF2A 5J8CA 4BDYA 4HQMA 3CTAA 3RZOJ 4X1EA 1HLVA 1MMNA 2JPCA 3CC4I 2V6CA 3HOUJ 1FEXA 2D1HA 1JKRC 4CCMA 2L2OA 2ELJA 3C3WA 4Y7NJ 5K1YA 4ESFA 4ZYAA 1HDDC 1L3LA 2A6EF 4B1RA 1YJNI 1P7IA 2C6YA 3IKVA 3F8MA 4F91B 3VOEA 3PFIA 1FYLA 1GXPA 1MJBA 3ABLH 1E0EA 5DCMA 3GEZA 1SVOA 5CKTA 3FISA 5GP9A 1HDPA 2HVSA 1X4OA 3KYCB 1BR4A 3OYBA 2FQ4A 5FKNA 1BI2A 2BVLA 4OOIA 3JRIA 3OL3A 4E7KA 5K5QA 3MD2A 3HRMA 1Z67A 1LFPA 1WJCA 4IHXA 3IAS2 3S2HJ 1WJFA 4DBRA 2VONA 1GV2A 1VQ4I 1BM9A 4E7SA 1VQ9I 1MBFA 2XGEA 3UR3C 3LAJA 1FJLA 2QWWA 2DJIA 4G6QA 3BR6A 3F9KA 4YELA 5F0FA 1Q1HA 2BE5F 2OQGA 3P5JA 1ZRFA 1YYVA 2XGCA 2I5UA 3V7CA 4ZDOA 2ZNYA 2E60A 4Q4ZF 4XICA 1ZG1A 4UNOA 1FOKA 4UVAA 5IP7J 2VXZA 1CF7A 1BOAA 5IT9Z 2LVSA 2ZXIA 3C1DA 3Q0WA 4ESJA 3WTSC 4BXUA 5EG0A 4A0YA 1FOXA 3L2RA 1WFXA 3EYIA 2CGPA 3CJTB 4W1UA 2HGCA 3IUOA 2E34A 3H3UA 3WG9A 3DCFA 3C18A 4A5NA 2VN2A 2MH9A 4KFCA 2DFFA 2QSFX 2GXGA 2F5DA 1KQ0A 4O5VA 3JRAA 1B1BA 2KRFA 2VPLA 2JWTA 4UUVA 3KZIC 2CO5A 1KU3A 1T2KA 4QWQA 3GZ5A 1T98A 5J8FA 3QU3A 2DBBA 3KP2A 1QVUA 1WI9A 2O8KA 4G6TB 3A02A 4M73A 4XRSA 5IOYA 3OYFA 1OYWA 2OAZA 1UCRA 4DYQA 3B73A 5JI6A 3DBHB 1F4KA 3KETA 1O3RA 3G3ZA 4MQVA 3QPLA 2KZVA 3S1MJ 1IG7A 3L7WA 3S14J 5J40A 3S32A 1R58A 3T8RA 2F4IA 2FRHA 2W82A 3S3MA 1QPIA 1IUFA 2DA6A 1L0OC 2MC4A 3DWLE 5J1UA 5EZGA 4AU7A 1MMGA 4LK0F 2PLYA 2Z9OA 2R7ZJ 3KP5A 5K5OA 2EZIA 2HEOA 3D0SA 1XD7A 2UWMA 2YU9J 3GYHX 1K78A 1IRXA 3VEPA 5FGMA 3BT9A 5JFRA 1DGWY 3ZR8X 4XOPA 1U5TB 2K85A 3M8JA 3S8PA 3NARA 3ELKA 4BAYA 1OCPA 4II3A 1Q1VA 3M9AA 3RPUD 3S15J 3DQVC 1XMKA 4UVBA 1OCOH 3L1PA 1XB4A 2VJ4A 3HRTA 3GWZA 4MEXF 3U9GA 2K3PA 1FWZA 2ZCWA 4RMNA 2P81A 3O8GA 2PMHA 1TTYA 3PNTA 1KGSA 2XF6A 5D8LB 1S3JA 3GFLA 3ZMDA 1Y6IA 4PJ0C 2KZGA 2NS7A 2GZWA 3C2BA 5HLHA 2WV0A 4IHWA 3H5AA 3CLQA 1Z91A 3CCSI 1QPMA 3RYPA 5A2QK 1SC7A 3VYTB 4Q47A 1LEBA 2D45A 2BY0A 2QA4I 2DYRH 3KPHA 3ZPLA 4DW6A 3TOAA 3P9KA 4EEFG 5F0CA 3DU5A 2O03A 1Y0NA 2AXTC 2LYCA 2VT2A 3NAUA 4BYYA 2HXOA 4N0BA 3LNQA 4BQAA 2R7RA 2Y9YA 1LJ9A 2LF8A 4IRHA 3M7GA 4BUPA 2PJRB 5KNLA 3GLLA 2DPDA 3I4MJ 4M9ZA 4XLNF 4V19K 4O6JA 3HC7A 5IT3A 1LVAA 4CCOA 1H8AC 2O0YA 1ETVA 1JKQC 2X85A 5HDKA 1A36A 5DYMA 2DQRA 4C3IJ 3A01A 2OJED 1HBXG 4PGGA 1JT0A 2L54A 3QOPA 3GVAA 4KICA 1Y8RB 1ZK8A 4LMYA 1R4NB 2EH3A 2KT0A 3MQ0A 3LSGA 1JUMA 4XORA 5DUKA 1Y39A 1LE8B 3RPUA 2L3DA 1OYIA 1UJ8A 3HGYA 1IO2A 3RZDJ 2P6TA 4OMYA 2XASA 4BDZA 1OCTC 3J81Z 5FD5A 2DDBA 3RCOA 4ESBA 2JUGA 2K02A 3R4KA 3CUQC 3BZKA 1YW8A 2VIXA 3GO5A 5BPIA 2W84A 3ZQHA 1USSA 2L02A 4A0XA 2R7VA 1W36C 2ETHA 2L7ZA 2V1NA 3WTXC 1GV5A 1ETYA 1Y8QB 3OS0A 1U9OA 2LP0A 4QPQA 3H35A 2LF7A 4ZYHA 1GT0C 2AXLA 4NQWB 3DKXA 1YHQI 3CCLI 2KQRA 4BHPA 2LDUA 2H27A 5E17F 2JRMA 3EUAA 1EA3A 5E79C 1OLTA 3BG6A 2ID6A 3OYNA 1FYKA 1YW7A 5EJCA 3SZTA 3WE3A 5L3FA 3WODF 5EGOB 2JT1A 2P8TA 1W7PB 2JQ7A 3K1NA 3DXJF 3KLOA 3VFZA 3SFIA 2BXYA 3I58A 2X4HA 3IRRA 2MD0A 3H36A 4U0VA 2BVMA 3VYRB 5GTIC 4G7OF 2BW3B 3I4PA 1FTTA 5FKOA 4AIDA 1OCZH 2CFXA 1VQNI 2E7XA 2K86A 2L7MP 4ZTJA 3K70D 1OCRH 2UUZA 3Q3SA 4QTRA 1V55H 2PEXA 2EFPA 1YIOA 1RUOA 3OV8A 1XGMA 1X58A 5LEJA 1KA8A 4G7ZF 1FOWA 2JMWA 3OYJA 2LY9A 1JE8A 4A3FJ 1OFCX 3M8EA 3ASOH 4NC8A 3OMYA 3TO7A 3AG3H 1OJLA 3I54A 3SXYA 1B8IB 2VBWA 1V54H 3ZCOA 5ILVA 4IHSA 1G2HA 4RGUA 3ZN0A 4IXAA 3Q5FA 1P4AA 2K3FA 2X6WA 1B4AA 1RKWA 1T08B 3FXUA 2Y9ZA 2HXIA 4CUGA 3FBIB 1ZAOA 3DLAA 3ZGKA 2HTJA 3ZOBA 2L9NA 2R7FA 2XF7A 1PUEE 1ODDA 4S04A 1SFKA 5CQGA 3WTWC 2WB1A 4G8XA 5D4RA 1D1BA 2DT6A 1ZH5A 1A5JA 1ZKGA 4LD5A 3G2BA 4ZDPA 3VWBA 1S7EA 3LA2A 2ZFWA 5E8GA 3BR3A 3BG9A 5ILUA 2HOTA 2JVHA 4C2TA 2V9PA 4YIFA 2K9MA 1WHUA 3KP4A 3GLXA 1E3OC 4BXFA 2JRTA 1QBJA 2ZNZA 3F0CA 1YO5C 4YFKF 3DF8A 2WBMA 1FC3A 1JJ8C 3T1BA 3FWEA 2KJBA 1LB2A 2DMUA 3BR1A 2M7AA 1E3PA 5B1BH 3CUQA 4B48A 2ESNA 2JA7J 2GOMA 1MDMA 1A6IA 4EJOA 2RAEA 2LTPA 1D8JA 4XLFA 5LHHA 3GTMJ 4HG2A 4IVNA 5JLWA 4NBQA 3CDIA 4RAFA 2LRDA 2X6OA 2CV1A 4PK4A 1LDJA 4FX0A 3WHCA 5EEGA 2JSPA 1O7LA 4DYCA 1BJZA 4L9JA 2RQPA 1POGA 2FNPA 3RIRA 3TEDA 2NOGA 2MA3A 3A1YA 4JP0A 1XPXA 5A2QZ 3QYFA 2EB7A 2LKSA 1QHGA 5GADJ 2DOEA 5ERIA 1U6GA 2MG4A 4ENJA 6PAXA 3EETA 3HOXJ 3RKXA 4A2UA 1FZPB 1PP8F 2FX0A 1MSEC 1ETWA 3S2DJ 4PFPA 4JX6A 2F48A 1YX5A 2BY2A 3O6BB 4MEYF 4S05A 1I3QJ 2IS2A 3I3LA 5FFZA 5BMZA 1LNWA 4HW0A 3D1NI 1DPRA 2X1DA 3ECOA 5FRNA 1S7AA 4BEHB 2IVMA 1XSVA 2HFHA 3BG5A 2QBYB 3KEOA 2CG4A 5FKLA 3T0YA 2DI3A 1J75A 5FLVA 1WGXA 2M2EA 2EFWA 3ULQB 4RA2A 2R5YB 3G71I 3QYBA 2NVXJ 4N4NB 3ZMUA 4Y13A 4CGZA 1IN8A 1EF4A 3S2WA 2HI3A 2COMA 5LLQA 2F5EA 2M5WA 3CO7C 1BL0A 1T6SA 2P4WA 1RPWA 3CDHA 5L3CA 2UZKA 3BCBA 1YFHA 1B9NA 1I6XA 3JSOA 2ECCA 3JRDA 3NWSA 2DK8A 1FYMA 5E1XA 2WTEA 1AHDP 3HOSA 4LG3A 4BY7J 1QU3A 1J0RA 1DUXC 1D1AA 4PSWA 3SZGA 1VNDA 2HYGD 1LKXA 4HOBA 4KUMA 2BY3A 4PUSA 1BW6A 4IRGA 5HNHA 4WXCA 3AL0C 5DDGA 5D5WB 3PO3J 3L2WA 1W5TA 1ZYRF 2XV4S 1T56A 3E5UA 1EH6A 1MJAA 2M45A 2X48A 4MTEA 1ETOA 4D7MA 3OWTA 4BBRJ 3QAHA 4PSXA 1MMDA 3HBLA 3EQLF 1S72I 5M3FJ 1GVJA 4XIDA 1JHFA 5JVGF 4LITA 2O8XA 3ERED 1VQ7I 4BXXJ 4E7ZA 5KHDA 4NUBA 3IH2A 5DUIA 1SFOJ 3GTJJ 3H3VK 3ASNH 1UZCA 3CO6C 2RVCA 1WJDA 2UXNA 4FQGA 2M30A 1W7PD 3DEWA 2KKOA 4UXNA 3CUOA 2QGUA 4DQ2A 2V1UA 2R7XA 4UHTA 5JLXA 3LSPA 3QPHA 3E0JB 2NVQJ 2MYSA 3IL2A 3Q9VA 2V6EA 2RGVA 2Q2EB 4QIWN 1O3SA 2TDXA 2VXDA 2Q8KA 2LD5A 2IPQX 1RKTA 1WPKA 1GLNA 3AG1H 3BG7A 4GYIA 3BTCA 3L00A 4ITVA 5HVQC 4E7LA 1VQPI 2O9LA 3FXRA 4KA4A 4DIQA 1T33A 3NEUA 2CV0A 1ZTRA 3BTJA 3JRFA 2CH0A 3KP6A 3PQJA 2NS0A 3IRQA 3TMOA 1BI3A 1Y0UA 1O57A 4W97A 3OYDA 4KJZA 3FF5A 2L5QA 3OYAA 1BIAA 2ICWG 3SYTA 2EWNA 4DNCA 4OAYA 1X1CA 3IHUA 1AKHA 2X51A 3E6CC 3WE2A 2F4OB 3WTYC 4ZTFA 2KMUA 1I1SA 3DEUA 3GTPJ 3ZQGA 1SFUA 4I76A 1XGNA 2JSCA 1OMIA 2VL8A 3H5RA 2GLOA 4WXDA 3JTGA 2OUMA 5IP9J 1FBUA 3CQZJ 2EBIA 3F72A 4PJJA 3REOA 2E1CA 4XLPF 2QM3A 4ZC3A 4RDUA 2XKOA 4MLOA 4CH7A 2LOOA 2XAFA 2QEXI 1VTNC 5J1RA 2LBFA 5KAIC 2VOOA 4LG0A 1YE9A 2X0LA 4C3HJ 3DKYA 5JR3A 2FBKA 1D5YA 3LQQA 3I55I 5E8IA 4IL6C 4CA0A 2VODA 1R5HA 2A5WA 2Z3YA 2ZSHB 2B0LA 1QZZA 3BPXA 2LSOA 3GZNB 3C7JA 2PQ8A 2RV8A 5E20A 3VYUB 4QLCU 1YX3A 4EMSA 3S3NA 4HLXA 1Z77A 2YS9A 2WAFA 3F22A 2KIFA 1J7KA 3GBGA 2Y69H 1PUFA 1MH4A 2K9LA 3BTLA 1WQ2A 3KEYA 4XRFA 1QQIA 2E2JJ 3BZCA 1MGTA 2NOJB 3K4NA 2EV6A 4KITB 2L9RA 2F6CA 4M3FA 5J6XA 5FROA 4IZZA 3J81K 4G6DA 4A6DA 2JK3A 2BOLA 2PN6A 1MNMC 4M9SA 2W1OA 4I2OA 5IY5H 2JJ7A 2PBIA 1IN7A 2A07F 3M07A 3WTVC 3R61A 3GW2A 4P96A 4CHUA 1ZARA 5E3OA 3P7NA 1ACIA 1KQ9A 3TP0A 3RI4A 1QZEA 2IT0A 1ZG3A 3J80Z 3JSPA 2Z5UA 4RGSA 3PFYA 4U87A 2CMPA 2DOFA 4UVCA 3L9FA 1B72B 2G9WA 5EF6A 2JTVA 1TQPA 4JX5A 4DZPA 1WH5A 2WB1N 4ENNA 2OQRA 1ZELA 1ENHA 4XBFA 4CYCB 5CVIA 1DP3A 2ESHA 3A0HC 5ICCA 1W0TA 2QQ9A 4ZZLA 2R4GA 1YOVB 2XRLA 5FLMJ 3A0BC 4D9JA 4L18B 3WU0A 3DTEA 3TDUC 3COAC 4D5CA 2ZO4A 4N9IA 1WH7A 2VKDA 1H0MA 4R79A 4U7BA 5LHIA 1ERDA 1QHHD 1OR7A 4WCGA 3MVPA 2M8EA 4DZJA 3B6AA 2ZMEB 2KIUA 2IXSA 2NS8A 1T39A 5D5XB 3MKYB 4M6VA 2NRAC 4G94A 4KMUX 2EA2A 1ZR2A 1K6YA 3PUFA 4A3MJ 3QOEA 1GDTA 2ME0A 2D5VA 3JCUC 4OINF 2B63J 1TW3A 1IXRC 1DPUA 2QKMB 3K9TA 1SFEA 2KL4A 3E97A 3PIOF 4BQNA 2DA1A 2P5KA 4RM3A 4HNTA 3FZVA 2HDCA 3K1PA 1R1TA 2BHYA 3OYLA 1UHSA 2CQ7A 1YRNB 5C4JJ 3HIFA 2XPWA 2WY8Q 4RB1A 3VPRA 4M71A 3HOVJ 1OQYA 2HQRA 3PL8A 2HWVA 3GFMA 4E70A 2ZSIB 1P4WA 3LOCA 2AO9A 2ZC2A 4ENMA 4IRIA 2J5OA 1GXQA 3FXOA 1PYVA 1EKEA 1O3QA 4RLFA 1NK2P 4M3GA 1QO0D 1IN6A 3K0LA 1W4MA 1ON1A 2CFOA 4C3JJ 5K7ZA 3H1CA 2W7NA 1KYZA 2E5ZA 4Y52J 1MBGA 2W25A 3KLNA 2CQNA 4B47A 2VLAA 2PI0A 1S6LA 3RQ4A 1A04A 1EJ9A 2IS6A 2L9VA 2OA4A 1ZQ3P 4IKFA 1ETKA 1TC3C 4HQEA 1UG0A 2XKPA 1D1CA 3DPUA 4XRMA 3IV5A 5FFXA 4AWXB 4L5IA 1RUNA 5K5RA 4IQ4A 1J09A 4WX9A 5JHFA 3CCYA 3SZPA 2R7UA 1JKOC 4A3DJ 3EUKL 4I0AA 2HVQA 3TKYA 3RKWA 3QRFF 2F2EA 1XN7A 2HOSA 1FSEA 3PSFA 3MZHA 4EQQA 2HDWA 2HTSA 4A3KJ 2LR8A 2M34A 3HL2A 2NXNB 5D5UB 2MLGA 3BPVA 3E6BA 5EEAA 4RBOA 1JHHA 3CCVI 2O7OA 2W48A 5HNFA 3U2RA 1F5TA 4HRIA 2E1MB 1U8RA 1XDSA 3DTKA 2RNGA 4M9XA 3PIPF 1T95A 4GCVA 4UV8A 5E1ZB 3MZYA 2OD5A 2QCOA 2QSGX 1M1EB 4QPOA 4C2UA 1V4RA 3I59A 4RS8A 2QENA 5E3MA 5TISC 5AIQA 4RLQA 5ICEA 3E7LA 3MN2A 2XB5A 1UELB 4AIHA 1YS7A 2R5ZA 1WCMJ 4I98B 3NRVA 1RRJA 4OIRF 4FE7A 3D5SC 1SFXA 1T0FC 2DMPA 1TWFJ 2JA2A 2XRNA 5CVUA 1Z1DA 3MEXA 4V2GA 4ASNA 1MBJA 4DGWB 1O7FA 5H6QA 2M4KA 1SANA 2OZUA 5FLXK 4NDLA 2IGNA 2W85A 3WTZA 1BI0A 3FHNA 1X2MA 3HM5A 3BJOA 3I0TA 4F7ZA 1HKQA 3F3XA 2KRHA 1WRJA 1VZ0A 4A3CJ 2Y0SA 2CQKA 3QQAA 2MABA 2FOKA 1TNSA 1F36A 2OC6A 4MGRA 3N05A 4J00A 2GXAA 2MGQA 3KEQA 4LK1F 1MBEA 3LMMA 4GO1A 1K61A 2K5CA 4JBAA 1G3TA 4JOMA 1KONA 2IJLA 3VSKA 3OYKA 1VFCA 2O61A 2IA0A 3V7RA 2O5RA 3LL7A 1N77A 2HKXA 1DGRM 3SJMA 1NH3A 4N4OB 2V9VA 4AIKA 3BLYA 1O4XA 1XCBA 2ME6A 3RQIA 2K9SA 2OPTA 5HLTA 4JQFA 1YG2A 2P0WA 4OMZA 4CCKA 2EQRA 1Y1VJ 2L01A 2EFOA 2PFBA 3BOQA 4D1QA 4M3BA 2V79A 1W5CC 1R23A 1V5GA 4RAGA 1I27A 4P1WA 5IPAA 1YW9A 3F8BA 5F04A 1H89C 1N25A 4G9YA 2HQAA 3TP3A 3WHBA 5H2FC 5DD4A 1MD0A 2IA2A 3S1QJ 4UUSA 3QPSA 4KN4X 5TGTA 4OIQF 1UAAA 4IF4A 5L3DA 2YU3A 5ED4A 4Q48A 2G0EA 5DM6F 3CJQB 3ML6A 4L9TA 3BJ6A 3K70C 1HA8A 3GX4X 3EPZA 5M3MJ 4ETSA 2VBZA 2DT5A 1E2XA 3HPGA 4OIOF 1S29A 3F8FA 4NB5A 1K7AA 3LFKA 1F1ZA 3DPTA 3CJNA 4XQFA 2CUJA 3G1OA 4PCQA 3E1SA 3BG3A 4ZDLA 1DQUA 1UG2A 3K7AJ 2B9SA 2F5CA 1U0JA 1R36A 2LY2A 3QU6A 2QKLB 3I64A 1K4TA 3F6VA 3M3YJ 3FHZA 1XX5A 4TV7A 2R7WA 1K4SA 3SEQA 5HLGA 3X2QH 2DMNA 3ZQFA 3IKTA 3RTRA 2X6XA 2M8GX 2HPIA 1IC8A 4LIVA 1ONVA 3MZ8A 4L5EA 2P7VB 2Q0OA 3JR9A 3G1MA 2Z1DA 4X6AJ 4F55A 4DOZA 1IDZA 3ZMVA 4LB6B 3R0AA 1NG7A 3LFUA 2I8DA 3LSHA 3HB9A 3K2ZA 1IN4A 1WJAA 4X0GA 4H0EA 2XUBA 2LKPA 1TBXA 2BHZA 3TOBA 3E6MA 1FNNA 1H88C 3CP8A 1T0FA 3I71A 1R22A 5DTDA 5DCMB 3HDDA 1OPCA 2K4JA 3W2WA 2A3SA 5F6FA 2D1VA 2JPBA 4GGGA 4Y33A 4E4HA 2KHMA 4MO7A 2AQEA 4L9NA 1MBKA 1MH3A 2XPVA 3HXLA 5GPAA 3Q0VA 4BJ5C 1O3TA 2VT3A 3CCMI 4RGXA 2DMTA 3LA3A 3IWZA 4BE0A 1U5TC 1BR1A 3HGGA 2ZJ2A 3AG4H 5BPDA 1SEUA 2RDPA 3K10A 1MIJA 3CMAI 4E7IA 2E2HJ 4KYWA 4HV6A 4XMYA 1B6AA 2A68F 1P4XA 3RDIA 5CLSA 2HKOA 4KIFA 3HTUA 1YLFA 5J47A 4L0ZB 3PM1A 4YFNF 2CQXA 5D6FA 5J4VA 3BC8A 2DCEA 1XC5A 3BY6A 2CUZA 1QRYA 3I56I 1KQ8A 1XSXA 1CF7B 3V7SA 4LIUA 2N8GA 5H20A 2R7OA 4NC6A 1IAWA 2A05A 4N9HA 2CSOA 5IYBJ 2P7CB 1CQTA 2TCTA 1IV8A 4HSTA 4D0PA 1NK3P 2ELKA 5LD2C 1X1BA 3JAMK 3S1NJ 1MW7A 4CICA 1SD5A 2KIMA 3K1MA 2GIVA 4YFXF 1APLC 2P5LC 2K9NA 3H92A 3C2HA 4XM3A 2ZXHA 1JJ6C 1VQ6I 2B7EA 5HODA 3ZN1A 3JREA 3LQRA 1ETQA 1FLIA 3HOWJ 3BR0A 3WTUC 5E18F 2DA7A 2EZLA 1AU7A 4BQOA 3BZ6A 3L2UA 1J9IA 1VQ5I 3HPHA 1ZLKA 2DA2A 3J7YJ 4E7HA 3LSTA 1LFUP 1Z6TA 1ZHFA 1ZN2A 3OIQA 3GFIA 3J80K 2IBDA 3CESA 4EJUA 1BW5A 2XSJC 3ONQA 3QP6A 4I01A 4KIGA 4PFOA 4CSWA 4EM0B 4RGRA 1T8IA 3AFHA 5ICFA 5TJJA 3B02A 2V4JC 4AUXA 1R5GA 2FUG2 4HAMA 2QZ8A 1ZR4A 2VUMJ 2V26A 3FIWA 1YTYA 1H9GA 2QLZA 1E3HA 5FLXZ 4LJZF 2FBHA 4YG2F 2W4SA 5C4XJ 3H9GA 1G4DA 2GQQA 2PMUA 1HKSA 2Z99A 4FASD 1DP7P 1K78B 2CJJA 4DJAA 3ISPA 5EDNA 1OISA 2DODA 2ADUA 4B09A 1ETXA 2VJJA 3ABKH 3EYYA 3AKZA 4GYGA 3PNYA 1HQCA 4EJTA 3KYDB 4NHJA 1FIAA 1SVMA 2DMQA 2OBPA 5HLIA 1VQOI 1F9NA 5LGNA 1FBSA 2R3SA 4MFDA 5F64A 2IS4A 1PJRA 3LA7A 5B3SH 1SD6A 3SQNA 3T8TA 4AVPA 3AG2H 1IGNA 3NWTA 4HX7A 4OU0A 5EZHA 1XSDA 3AAFA 2R0QC 2EPFA 4BKXA 4CZCA 4RAYA 1TP4A 3OSGA 3QP5A 3ECHA 2M3AA 4AD9A 5GAGJ 5L3EA 1U5TA 4U0YA 1OCCH 5DEQA 4B4CA 1F43A 4HSRA 4BJTA 2DT7B 2EK5A 2GAUA 1G59A 4JYKA 1TT5B 2M0MA 3WTTC 2BEOA 2EIKH 2OTJI 1G6NA 1D0ZA 1QVTA 1DU6A 3R6SA 4GXOA 3QODA 3VB2A 2FMYA 1Z3XA 3TQNA 1XGSA 1R71A 3TO9A 4EGZA 3BR5A 5BS6A 2MW8A 1KU2A 1SMTA 1B59A 3U1KA 5M5YJ 1YJWI 4LFUA 1REPC 5CJ9A 1K79A 2FOWA 4UB8C 4A3EJ 5F27A 4MIMA 3SHFA 4Z6YA 5KVRA 2ID3A 4RB3C 4F3QA 4I6ZA 2M4GA 3CCUI 3A03A 2Y0SN 2HPMA 3MKZA 2XIGA 4ZYEA 2V9KA 2DLLA 2CW8A 1IN5A 1Z3YA 4QSHA 1DDNA 1A35A 2Y31A 4DBQA 3W3CA 2E19A 3A01B 1VQMI 4IX7A 3H0DA 1K6OA 3HTSB 2K27A 4CCNA 5E3NA 2ECBA 2KFDA 3GTQJ 1QGPA 3P9IA 4JK1X 3HOYJ 3WG7H 5CQEA 3FM3A 2LFBA 3R60A 2PJRA 1TWGJ 1TWAJ 5GTHC 5FKMA 3GTOJ 2EA4A 2EILH 4IJAA 2LKXA 5D4SA 3L2CA 4J19A 3NQOA 4XLHA 3WU2C 4MQ9F 1XDUA 4IHYA 2WADA 3QYEA 5D5VB 1OR7C 2R7SA 4Q5SF 1N78A 2E35A 4F92B 2WC2A 5LRRA 1P92A 2VBYA 1ZRDA 4CXFA 4XR6A 2HVRA 3CF2A 4HF1A 5BOXA 1R7JA 1BJAA 3RKQA 2LK2A 2V1XA 2RKHA 4RB2C 4IQJA 3ZXSA 3LAPA 3MMYB 2FNAA 1IRFA 4GDFA 2Z16A 4XSXF 1V3FA 1E17A 3BCAA 1I3AA 3PO2J 2EZKA 1XG1A 5E1WA 1VF9A 5FRMA 2F4MB 3KCCA 2WAEA 1RC9A 3VSLA 3FM5A 1LE8A 2QYOA 1SD7A 4C30A 2XSDC 1Z21A 2RQQA 1IJWC 2CW7A 3CLOA 5FD6A 4KT5C 5M5XJ 1FT9A 2OU2A 1GUUA 1A6QA 5H6RA 1TW2A 2M9HA 4E6KG 2HZTA 4MHGA 1LFBA 3HSEA 2MBFA 5B66C 1VQ8I 1V5EA 5HDGA 5D8KB 1R4MB 4M72A 3K4JA 4KN7X 4HNUA 2TRTA 2BZTA 2JVGA 3V8LA 3I4NJ 1FSHA 2A6HF 3F6OA 1JUPA 2ZJRF 1IW7F 2G7HA 3HHHA 2L7KA 2KISA 1JUSA 4R8HA 4ZH4F 4NQWA 3FK7A 3JRCA 1TQIA 4RB0A 1H9TA 4HDVA 3LSJA 3F23A 4HNVA 2EZHA 5ICGA 2JA8J 1ULYA 1RR8C 4XN0A 1Z6RA 3W2AA 2VKVA 3OYMA 4BY1J 3JAMZ 1HSTA 4AVZA 4L9VA 4E7JA 1TQMA 2P5VA 5EGOA 1C0WA 4HX8A 2PX9A 1W7PA 1U9NA 3H3ZA 2MD5A 4XL9A 4BGDA 1RI7A 1W5SA 4CZZA 2BV6A 4JX4A 2IP2A 3SDGA 4AYBA 4XRSG 4J01A 2BW3A 3J7AO 2JUCA 1LPQA 3K4CA 3M4OJ 2H94A 1S8NA 4WXHA 4YEJA 3ABUA 3W6VA 2L9SA 3TBIA 3WGGA 5TRDA 3ZQCA 1P2FA 3D5LA 1IV6A 2GWRA 4FT8A 3PQKA 4O3MA 5DM7F 2ZXJA 4Y17A 3FKIJ 1X3UA 1VQLI 3ROUA 1A31A 3GFJA 3HRUA 1PP7U 1IRZA 3PNVA 2QQAA 5F08A 2CRGA 3O3KA 1BI1A 3ABMH 1BIBA 5DV5A 3ZMZA 4EV0A 3LSMA 4HX4A 1RZ4A 1B8IA 1XMXA 1QA6A 1D8KA 4XLEA 2FQ3A 2WAQA 3IH4A 2JA6J 1XS9A 2M0CA 1MMAA 1YIJI 4LB5A 4FE4A 2XAUA 4XKBA 3V8JA 3LSKA 4ZYGA 3LWFA 4IEJA 1HXDA 3HUGB 1X1PA 3S3OA 1MKMA 1LDKB 1R1UA 4LGWA 4WF2A 4B8XA 2HR3A 3CUQB 1ZREA 1MDMB 1BBYA 1ZGAA 2FU4A 3OIPA 1JGSA 3OR2C 5GPCA 1HCRA 3BTIA 2COBA 3OYHA 3OYEA 2K4BA 4C9YA 1R5ID 4ENKA 3K4LA 5AONA 4BL0B 1HF0A 2LLKA 3OR1C 1FY7A 2F5FA 3HOZJ 3H0GJ 4KMFA 2F5VA 1LDDA 4RM2A 1JXSA 1IZ1A 1YITI 1TLHB 3RSNA 5GAHJ 1JI8A 3ZRGA 1RR7A 5IYCJ 2EFQA 4PJNA 4Y15A 3F21A 4I02A 5HS7A 3U21A 1BOBA 1ON2A 3GUDA 4I09A 2CUFA 2QQ8A 1RNLA 2CWEA 2Y48A 4FETA 4UUTA 5B5EC 5L3BA 1JGGA 1TL8A 2L4AA 2DYSH 5F0HA 2W00A 2VI6A 3RKYA 1X19A 2R7QA 3O8HA 5CYVA 3GTGJ 2EFNA 1IF1A 3S93A 4LLNA 2DTZA 2H8WA 3MCZA 2PMZA 5DD8A 2HZDA 1NTCA 4V2FA 3E5XA 3V4GA 2M87A 1G8XA 1KYWA 3UKGA 1UFMA 3W2VA 4FHTA 4R1HA 1WJEA 2Y30A 3VDXA 2VB6A 4FX4A 4M74A 2KJCA 1J5YA 3HEFA 3MKLA 3IP4B 4Y4RA 2VE8A 1FIPA 1QNTA 2LH9A 3ZP5A 4A3GJ 2STTA 4IOAF 1UMQA 1PVEA 2YR2A 4KDPA 2MC3A 1SAUA 2LMDA 2FF4A 4F52A 5IYDJ 1D5VA 5CVVA 4A93J 4BEHA 4EATA 1BA5A 4BS9A 2WY7Q 2QBYA 2DN0A 2HYFA 2W57A 1S9HA 2A6TA 4BACA 3CC2I 3K4KA 4NC7A 3HYIA 3G6EI 1SVLA 1TWHJ 3L09A 3ZMTA 1ZGWA 2BGCA 2ELHA 4A69C 1BC8C 2R5YA 3MFKA 4A5MA 4KIBA 2Y75A 4A3JJ 2X9DA 1EH8A 2FXAA 3WGHA 1ZRCA 2E2IJ 2LG4A 4B3AA 1TT0A 3ZQ7A 2DAOA 3CCEI 1UB9A 4D7NA 4BE2A 3RJPA 5C3EJ 3GTKJ 3GTLJ 2DQLA 2CW0F 3DP7A 3GCMA 5FKKA 4ZZDA 3CDLA 2HOEA 2ZJQF 3OS1A 2OF7A 4AIJA 3I9V2 1USTA 1I50J 2RC4A 3CMMA 1IUYA 2XHKA 2HYJA 3CF5F 2O6GE 4XNFA 3BDDA 4HZFA 4HYEA 4C2MJ 3HKZA 4A6EA 4CO8A 2EV5A 3KYLA 3CD6I 2DU9A 2RREA 2QVOA 4S0HB 1MMSA 2K9QA 1JKPC 3L2QA 4P9FA 3HSRA 4XOTA 3IC7A 3DLLF 1X4PA 3FXQA 1MBHA 2IGMA 2WV1A 4HV5A 4ON0A 2VQHA 3VODA 2E5NA 1WWXA 2H1LA 2XAJA 4IO9F 4HEA2 4Z2YA 2VC1A 4IHTA 4KISA 2NYXA 1I5ZA 3FK6A 4GFBA 1JTYA 2LY1A 2QQBA 1WJ5A 4HF0A 1W0UA 4G7HF 1DU0A 4UY8I 2H1KA 3HJEA 4BU2A 1AKHB 3FBNB 2Q2EA 2BXZA 5LGTA 1MNEA 1FOYA 2O3FA 4PJMA 3G1LA 2DA3A 2A69F 2FE3A 1WJBA 2VPRA 3MWMA 2VE9A 1XMAA 3SDBA 5CPRB 2ZMEC 2RNJA 4BQQA 2YSRA 5DCFA 1CGPA 4B3XA 3H9JA 2MSYA 3DV8A 1JT6A 3H5NA 2LBFB 1V5FA 2Z33A 4LG0B 2DA4A 2DOAA 3KFWX 2IS1A 2KP6A 3TO6A 4ZJZA 3SFZA 2VJIA 4K2EA 1FX7A 1FPQA 3V8KA 5LFAA 3OSFA 4EVIA 2WA0A 5IOZA 1BR2A 3DTIA 4ANJA 4MTDA 1WVRA 2QSHX 2ZKZA 3JRBA 2GA2A 2JN6A 1P7JA 3KP3A 4A3BJ 3W6KB 5F1RA 3JTHA 2VKEA 1PUFB 1BN5A 3O2PE 4MFEA 4BJ6C 1SMYF 2FD5A 3DEEA 3G73A 3Q9SA 2CQQA 4XN3A 3AL0B 4YIRX 3ESWB 3D5RC 5L3GA 3DPLC 2X1CA 3E6DA 2YUSA 5C44J 3PJRA 3J7AY 2J5PA 1AOYA 4BHBA 5BNGA 2OCEA 3HG9A 2NVTJ 1I39A 3VYSB 4AYBN 2Z2SB 1W36D 2DXIA 3FXMA 4XONA 2XC7A 2ISZA 2DFHA 1HW2A 5B1AH 2BYVE 4OIPF 1WKMA 3RYRA 5CVJA 5KCMA 1OKRA 5EYRA 2FMLA 4DYRA 2CS3A 4M6XA 5E3LA 3LSRA 4L5JA 4I7HA 1W1WE 1Y56A 4II2A 1AWCA 2IGKA 4B43A 1WSUA 3CMYA 2IEKA 2ZBKA 1K83J 3K6GA 2IGOA 4XSZF 2H8RA 4KNYA 2VOPA 2WAQN 1FP2A 3EDPA 2PJPA 1HC8A 1FBQA 3BWGA 2A61A 2MFZA 2ZB9A 4LLLA 1R00A 1ITYA 2E1MC 2EV0A 4M3EA 2AS5F 4HDUA 1HSJA 3M1CA 4IOCF 1Y1WJ 1B72A 5EG0B 4IHVA 1MSFC 4AM3A 2V1DA 5HS9A 3WGIA 4CYCA 2XPUA 1QZYA 3N97A 3F8CA 2EINH 2K40A 3CP2A 3PSIA 2DDAA 1G3YA 2E1OA 2X1EA 2GBYA 5IP6A 3Q0UA 2JZYA 3DU6A 2H6BA 3TL4X 1KU9A 3BQYA 3CCRI 1X1AA 2R7DA 5CVRA 3EUHC 3U1DA 1UHMA 4XLAA 3V42A 3HUGA 4U88A 2P6SA 2XGXA 2E36A 4LOCA 2ZMEA 5J4YA 3R0JA 5HS8A 2L7FP 1YS6A 1G3SA 5KAFC 2GA1A 2E71A 4WK8F 3N4MA 1FMVA 4CCLA 5DS9A 5JVTA 4BNCA 4PGHA 2H09A 4OWRB 4EJWA 2K7LA 3M1EA 1KZHA 3WU1B 1HKTA 3CJRB 3CCQI 5K7HA 2LNBA 3BROA 3OS2A 3A4CA 2XF5A 2A5YB 2VBXA 3I53A 3OYGA 4CDGA 1S5LC 2KLOA 4GRIA 2ISYA 1BC7C 1MJ9A 2GIZA 4BE1A 4PZJA 2XDVA 2Q1ZB 4M6YA 4XKCA 2DFEA 2M7BA 5F1JA 2PMZN 3JRHA 1R6RA 1Z9CA 1YRNA 1N75A 3CZ6A 4A12A 5AIPA 2DK5A 2KDZA 3BP8A 2NAZA 4B44A 1D0XA 1P9QC 3F8NA 1D0YA 1ORKA 1IXSB 2FBIA 3OY9A 4FCYA 4UV9A 4XLCA 3E5QA 2R92J 3P9CA 2I10A 4A0ZA 1RESA 4EGYA 2OV7A 2KPMA 3BJAA 4PJLA 2KDOA 3OYIA 3KZYA 3DKWA 2VKHA 3DFGA 1GVDA 3HZJA 1XCVA 2NVYJ 3FKJA 5LRSA 2L4MA 1B9MA 3OOPA 2ZXWH 1LQ1A 2YPRA 1EH7A 4P55A 5FB2A 3OOUA 3HSFA 1FMWA 1WZ2A 4ABZA 3ZQQA 4F93B 1OYYA 2M1BA 3ZQIA 1R9TJ 2GM4A 3GXOA 3DBRB 1P6RA 3K4MA 4UB6C 3TDZC 3FX3A 1UHWA 2AQFA 1U8BA 3DBLB 2ZJPF 1KU7A 5IT9K 2IW5A 3I59B 3A2KA 4A3LJ 2XGDA 2Y2ZA 2DO7A 4ZYDA 3HOTA 2CV2A 3HHGA 2VC0A
chains in the Genus database with same CATH topology
2R5ZB 3M4OJ 2JMWA 2LY9A 2IAIA 1OFCX 2QCOA 4A3FJ 2AHQA 1WI3A 3W6VA 1OJLA 5E3MA 3BR2A 3ZQCA 3E7LA 3MN2A 5K7FA 1IV6A 1B8IB 2XB5A 3FKIJ 1G2HA 2R5ZA 1WCMJ 4FE7A 1RKWA 2DMPA 1TWFJ 1IRZA 2Y9ZA 3K2AA 2HXIA 4V2GA 5F08A 2R93J 2CRGA 1MBJA 3ZOBA 1SANA 1B8IA 3OIOA 2FJ1A 4NDLA 3ZQLA 1HOMA 1JTXA 3IH4A 1X2MA 3HM5A 2JA6J 1XS9A 2M0CA 2L0KA 3HKZN 4A3CJ 4FISA 1A5JA 4FE4A 1ZKGA 2DJNA 3QQAA 2CU7A 4IEJA 1F36A 1S7EA 3BR3A 2MGQA 1FTZA 3BG9A 4XK4A 1U78A 1MBEA 5FJ8J 3B6CA 1K61A 2HOTA 9ANTA 5GPCA 1VFCA 1HCRA 3BTIA 2COBA 1E3OC 1IDYA 3F0CA 2QF7A 3SJMA 2XB0X 1JJ8C 1HF0A 2DMUA 3BR1A 1RETA 2LLKA 1O4XA 3RQIA 2ME6A 2JA7J 2K9SA 1A6IA 2OPTA 2RAEA 2LTPA 1TWCJ 3HOZJ 3GTMJ 3H0GJ 5JLWA 4UUSB 1X2NA 2X6OA 3WHCA 5M5WJ 2EQRA 1Y1VJ 2CUEA 4DYCA 3S17J 1BJZA 2JA5J 4M3BA 1POGA 1RR7A 3IH3A 5IYCJ 3TEDA 3TW6A 2NOGA 3JRGA 5IPAA 5F04A 1H89C 3TP3A 2CUFA 1VI0A 3WHBA 4UUTA 1JGGA 4JP0A 3S1QJ 4UUSA 3QPSA 5F0HA 3S1RJ 2MG4A 3BQZA 2VI6A 4BBSJ 3O8HA 3GTGJ 2G0EA 3HOXJ 2DTZA 5M3MJ 1NTCA 2FX0A 1MSEC 1ETWA 4V2FA 3S2DJ 4JX6A 2DA5A 3G1OA 5J1YA 3UKGA 3BG3A 1I3QJ 4M3DA 4AC0A 1UG2A 2Y30A 4FTHA 3D1NI 3K7AJ 3HEFA 3MKLA 3BG5A 3M3YJ 1FIPA 1Z0XA 3TW7A 4A3GJ 5FKLA 1UMQA 3ZQFA 2DMNA 5FLVA 1WGXA 2M2EA 2M8GX 2HOAA 1IC8A 4A3IJ 5IYDJ 4L5EA 4A93J 1BA5A 3JR9A 3G1MA 2R5YB 4G12A 4X6AJ 2DN0A 2NVXJ 4D5FA 1IDZA 2HDDA 5J3LA 1EF4A 2HI3A 3HB9A 1BL0A 2HQ5A 1TWHJ 3S16J 1RPWA 1ZGWA 1I6HJ 4A69C 3JRDA 2ECCA 1H88C 2R5YA 3RZOJ 4X1EA 1HLVA 5DTDA 1AHDP 3HDDA 3HOUJ 1FEXA 4A3JJ 4BY7J 1JKRC 2X9DA 4Y7NJ 2E2IJ 1HDDC 4MO7A 4B3AA 1VNDA 4B1RA 1P7IA 1BW6A 4D7NA 1MBKA 1MH3A 2XPVA 5GPAA 3Q0VA 5C3EJ 3GTLJ 3GTKJ 3PO3J 1T56A 2DMTA 5FKKA 3FISA 5GP9A 1HDPA 3HGGA 3CDLA 2X48A 2FQ4A 1ETOA 4D7MA 5FKNA 3JRIA 4BBRJ 2E2HJ 2OF7A 4IHXA 3S2HJ 3HBLA 1I50J 1GV2A 5M3FJ 4XIDA 2HYJA 3PM1A 1MBFA 2XGEA 2CQXA 4BXXJ 1FJLA 4C2MJ 3IH2A 1XC5A 1SFOJ 3GTJJ 3H3VK 1QRYA 3BR6A 4S0HB 2N8GA 5F0FA 2K9QA 1JKPC 2XGCA 5IYBJ 1CQTA 2TCTA 1MBHA 3DEWA 2WV1A 4XICA 1NK3P 5JLXA 2ELKA 3S1NJ 3LSPA 5IP7J 1APLC 2K9NA 2NVQJ 2LVSA 3Q0WA 1JJ6C 4QIWN 5EG0A 5HODA 2LD5A 3JREA 1RKTA 3FK6A 1ETQA 1WPKA 1JTYA 3BR0A 4GFBA 3HOWJ 4W1UA 3BTCA 2DA7A 2EZLA 3DCFA 2O9LA 1AU7A 1W0UA 1DU0A 2H1KA 1AKHB 1T33A 3JRAA 1ZTRA 2JWTA 3BTJA 2DA2A 3JRFA 3G1LA 2DA3A 4W97A 1LFUP 2VPRA 2IBDA 1BW5A 1AKHA 1QVUA 2O8KA 3A02A 4XRSA 5IOYA 4AUXA 2MSYA 1ZR4A 1JT6A 2VUMJ 3FIWA 4DYQA 3GTPJ 3ZQGA 2DA4A 4I76A 2GLOA 5IP9J 5C4XJ 3QPLA 3CQZJ 2EBIA 4RDUA 3OSFA 3S1MJ 1IG7A 4MLOA 5IOZA 3S14J 5J1RA 2CJJA 5EDNA 1IUFA 2DA6A 2JN6A 3JRBA 1QPIA 5J1UA 1ETXA 5EZGA 1P7JA 4C3HJ 1D5YA 2R7ZJ 4A3BJ 2VKEA 1PUFB 2EZIA 4MFEA 2FD5A 1FIAA 2DMQA 2CQQA 4MFDA 2YU9J 1IGNA 3BT9A 1Z77A 2YUSA 2YS9A 5C44J 3NARA 5EZHA 1OCPA 1Q1VA 2R0QC 3GBGA 3S15J 5BNGA 1PUFA 1MH4A 2NVTJ 3BTLA 4BKXA 3L1PA 4AYBN 3OSGA 2E2JJ 2P81A 3O8GA 2L9RA 4M3FA 4B4CA 2JK3A 1F43A 1MNMC 4JYKA 2JJ7A 5EYRA 2NS7A 3C2BA 1QVTA 4DYRA 4IHWA 1DU6A 5E3LA 3LSRA 5E3OA 3TP0A 3BR5A 2MW8A 3CMYA 2IEKA 5M5YJ 1K83J 1B72B 4DW6A 5EF6A 2H8RA 4A3EJ 5F27A 4MIMA 5F0CA 4EEFG 2WAQN 4JX5A 4DZPA 1WH5A 2ID3A 2WB1N 3NAUA 2ZB9A 1ENHA 4CYCB 4I6ZA 2HXOA 1ITYA 3A03A 2Y0SN 3LNQA 1W0TA 4M3EA 2Y9YA 1Y1WJ 4QSHA 2XRLA 5FLMJ 1B72A 2Y31A 3I4MJ 5EG0B 4IHVA 2E19A 3A01B 1MSFC 5E3NA 2ECBA 4D5CA 3GTQJ 4CYCA 1WH7A 3HOYJ 2XPUA 1H8AC 1ETVA 2LFBA 1JKQC 3MVPA 4DZJA 3B6AA 2K40A 1TWGJ 1TWAJ 2E1OA 2NS8A 5FKMA 2GBYA 5IP6A 3Q0UA 3GTOJ 4C3IJ 2LKXA 3A01A 4M6VA 4J19A 1ZR2A 1JT0A 3BQYA 4A3MJ 4IHYA 1GDTA 2ME0A 2D5VA 1ZK8A 2B63J 2EH3A 2KT0A 4LOCA 3LSGA 1JUMA 2L7FP 2DA1A 1LE8B 5DS9A 3RKQA 2LK2A 3HGYA 1UHSA 1YRNB 3RZDJ 5C4JJ 1OCTC 5K7HA 2XPWA 3PO2J 2EZKA 1XG1A 3VPRA 1VF9A 3HOVJ 3LOCA 3ZQHA 1LE8A 2AO9A 5F1JA 2XSDC 2PMZN 1IJWC 3JRHA 2L7ZA 5M5XJ 1YRNA 1GV5A 1GUUA 1NK2P 1ETYA 4M3GA 1U9OA 2LP0A 2M9HA 2KDZA 1GT0C 1LFBA 5K7ZA 4C3JJ 1ORKA 4Y52J 1MBGA 2TRTA 3I4NJ 4FCYA 2R92J 2ID6A 2I10A 1ZQ3P 1ETKA 1JUPA 1TC3C 5EGOB 1RESA 4XRMA 1JUSA 3IV5A 3FK7A 3JRCA 1GVDA 2NVYJ 3CCYA 1JKOC 3LSJA 4A3DJ 4HNVA 2EZHA 3SFIA 2JA8J 2HOSA 2VKVA 4BY1J 3OOUA 4ABZA 4A3KJ 5EGOA 3ZQIA 2LR8A 2M34A 1R9TJ 2GM4A 1FTTA 1U9NA 5FKOA 5EEAA 1U8BA 4RBOA 2O7OA 2W48A 2L7MP 4A3LJ 4JX4A 2XGDA 2Y2ZA 3SDGA 3Q3SA 4QTRA 4XRSG 1X58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5Z B;  3M4O J;  2JMW A;  2LY9 A;  2IAI A;  1OFC X;  2QCO A;  4A3F J;  2AHQ A;  1WI3 A;  3W6V A;  1OJL A;  5E3M A;  3BR2 A;  3ZQC A;  3E7L A;  3MN2 A;  5K7F A;  1IV6 A;  1B8I B;  2XB5 A;  3FKI J;  1G2H A;  2R5Z A;  1WCM J;  4FE7 A;  1RKW A;  2DMP A;  1TWF J;  1IRZ A;  2Y9Z A;  3K2A A;  2HXI A;  4V2G A;  5F08 A;  2R93 J;  2CRG A;  1MBJ A;  3ZOB A;  1SAN A;  1B8I A;  3OIO A;  2FJ1 A;  4NDL A;  3ZQL A;  1HOM A;  1JTX A;  3IH4 A;  1X2M A;  3HM5 A;  2JA6 J;  1XS9 A;  2M0C A;  2L0K A;  3HKZ N;  4A3C J;  4FIS A;  1A5J A;  4FE4 A;  1ZKG A;  2DJN A;  3QQA A;  2CU7 A;  4IEJ A;  1F36 A;  1S7E A;  3BR3 A;  2MGQ A;  1FTZ A;  3BG9 A;  4XK4 A;  1U78 A;  1MBE A;  5FJ8 J;  3B6C A;  1K61 A;  2HOT A;  9ANT A;  5GPC A;  1VFC A;  1HCR A;  3BTI A;  2COB A;  1E3O C;  1IDY A;  3F0C A;  2QF7 A;  3SJM A;  2XB0 X;  1JJ8 C;  1HF0 A;  2DMU A;  3BR1 A;  1RET A;  2LLK A;  1O4X A;  3RQI A;  2ME6 A;  2JA7 J;  2K9S A;  1A6I A;  2OPT A;  2RAE A;  2LTP A;  1TWC J;  3HOZ J;  3GTM J;  3H0G J;  5JLW A;  4UUS B;  1X2N A;  2X6O A;  3WHC A;  5M5W J;  2EQR A;  1Y1V J;  2CUE A;  4DYC A;  3S17 J;  1BJZ A;  2JA5 J;  4M3B A;  1POG A;  1RR7 A;  3IH3 A;  5IYC J;  3TED A;  3TW6 A;  2NOG A;  3JRG A;  5IPA A;  5F04 A;  1H89 C;  3TP3 A;  2CUF A;  1VI0 A;  3WHB A;  4UUT A;  1JGG A;  4JP0 A;  3S1Q J;  4UUS A;  3QPS A;  5F0H A;  3S1R J;  2MG4 A;  3BQZ A;  2VI6 A;  4BBS J;  3O8H A;  3GTG J;  2G0E A;  3HOX J;  2DTZ A;  5M3M J;  1NTC A;  2FX0 A;  1MSE C;  1ETW A;  4V2F A;  3S2D J;  4JX6 A;  2DA5 A;  3G1O A;  5J1Y A;  3UKG A;  3BG3 A;  1I3Q J;  4M3D A;  4AC0 A;  1UG2 A;  2Y30 A;  4FTH A;  3D1N I;  3K7A J;  3HEF A;  3MKL A;  3BG5 A;  3M3Y J;  1FIP A;  1Z0X A;  3TW7 A;  4A3G J;  5FKL A;  1UMQ A;  3ZQF A;  2DMN A;  5FLV A;  1WGX A;  2M2E A;  2M8G X;  2HOA A;  1IC8 A;  4A3I J;  5IYD J;  4L5E A;  4A93 J;  1BA5 A;  3JR9 A;  3G1M A;  2R5Y B;  4G12 A;  4X6A J;  2DN0 A;  2NVX J;  4D5F A;  1IDZ A;  2HDD A;  5J3L A;  1EF4 A;  2HI3 A;  3HB9 A;  1BL0 A;  2HQ5 A;  1TWH J;  3S16 J;  1RPW A;  1ZGW A;  1I6H J;  4A69 C;  3JRD A;  2ECC A;  1H88 C;  2R5Y A;  3RZO J;  4X1E A;  1HLV A;  5DTD A;  1AHD P;  3HDD A;  3HOU J;  1FEX A;  4A3J J;  4BY7 J;  1JKR C;  2X9D A;  4Y7N J;  2E2I J;  1HDD C;  4MO7 A;  4B3A A;  1VND A;  4B1R A;  1P7I A;  1BW6 A;  4D7N A;  1MBK A;  1MH3 A;  2XPV A;  5GPA A;  3Q0V A;  5C3E J;  3GTL J;  3GTK J;  3PO3 J;  1T56 A;  2DMT A;  5FKK A;  3FIS A;  5GP9 A;  1HDP A;  3HGG A;  3CDL A;  2X48 A;  2FQ4 A;  1ETO A;  4D7M A;  5FKN A;  3JRI A;  4BBR J;  2E2H J;  2OF7 A;  4IHX A;  3S2H J;  3HBL A;  1I50 J;  1GV2 A;  5M3F J;  4XID A;  2HYJ A;  3PM1 A;  1MBF A;  2XGE A;  2CQX A;  4BXX J;  1FJL A;  4C2M J;  3IH2 A;  1XC5 A;  1SFO J;  3GTJ J;  3H3V K;  1QRY A;  3BR6 A;  4S0H B;  2N8G A;  5F0F A;  2K9Q A;  1JKP C;  2XGC A;  5IYB J;  1CQT A;  2TCT A;  1MBH A;  3DEW A;  2WV1 A;  4XIC A;  1NK3 P;  5JLX A;  2ELK A;  3S1N J;  3LSP A;  5IP7 J;  1APL C;  2K9N A;  2NVQ J;  2LVS A;  3Q0W A;  1JJ6 C;  4QIW N;  5EG0 A;  5HOD A;  2LD5 A;  3JRE A;  1RKT A;  3FK6 A;  1ETQ A;  1WPK A;  1JTY A;  3BR0 A;  4GFB A;  3HOW J;  4W1U A;  3BTC A;  2DA7 A;  2EZL A;  3DCF A;  2O9L A;  1AU7 A;  1W0U A;  1DU0 A;  2H1K A;  1AKH B;  1T33 A;  3JRA A;  1ZTR A;  2JWT A;  3BTJ A;  2DA2 A;  3JRF A;  3G1L A;  2DA3 A;  4W97 A;  1LFU P;  2VPR A;  2IBD A;  1BW5 A;  1AKH A;  1QVU A;  2O8K A;  3A02 A;  4XRS A;  5IOY A;  4AUX A;  2MSY A;  1ZR4 A;  1JT6 A;  2VUM J;  3FIW A;  4DYQ A;  3GTP J;  3ZQG A;  2DA4 A;  4I76 A;  2GLO A;  5IP9 J;  5C4X J;  3QPL A;  3CQZ J;  2EBI A;  4RDU A;  3OSF A;  3S1M J;  1IG7 A;  4MLO A;  5IOZ A;  3S14 J;  5J1R A;  2CJJ A;  5EDN A;  1IUF A;  2DA6 A;  2JN6 A;  3JRB A;  1QPI A;  5J1U A;  1ETX A;  5EZG A;  1P7J A;  4C3H J;  1D5Y A;  2R7Z J;  4A3B J;  2VKE A;  1PUF B;  2EZI A;  4MFE A;  2FD5 A;  1FIA A;  2DMQ A;  2CQQ A;  4MFD A;  2YU9 J;  1IGN A;  3BT9 A;  1Z77 A;  2YUS A;  2YS9 A;  5C44 J;  3NAR A;  5EZH A;  1OCP A;  1Q1V A;  2R0Q C;  3GBG A;  3S15 J;  5BNG A;  1PUF A;  1MH4 A;  2NVT J;  3BTL A;  4BKX A;  3L1P A;  4AYB N;  3OSG A;  2E2J J;  2P81 A;  3O8G A;  2L9R A;  4M3F A;  4B4C A;  2JK3 A;  1F43 A;  1MNM C;  4JYK A;  2JJ7 A;  5EYR A;  2NS7 A;  3C2B A;  1QVT A;  4DYR A;  4IHW A;  1DU6 A;  5E3L A;  3LSR A;  5E3O A;  3TP0 A;  3BR5 A;  2MW8 A;  3CMY A;  2IEK A;  5M5Y J;  1K83 J;  1B72 B;  4DW6 A;  5EF6 A;  2H8R A;  4A3E J;  5F27 A;  4MIM A;  5F0C A;  4EEF G;  2WAQ N;  4JX5 A;  4DZP A;  1WH5 A;  2ID3 A;  2WB1 N;  3NAU A;  2ZB9 A;  1ENH A;  4CYC B;  4I6Z A;  2HXO A;  1ITY A;  3A03 A;  2Y0S N;  3LNQ A;  1W0T A;  4M3E A;  2Y9Y A;  1Y1W J;  4QSH A;  2XRL A;  5FLM J;  1B72 A;  2Y31 A;  3I4M J;  5EG0 B;  4IHV A;  2E19 A;  3A01 B;  1MSF C;  5E3N A;  2ECB A;  4D5C A;  3GTQ J;  4CYC A;  1WH7 A;  3HOY J;  2XPU A;  1H8A C;  1ETV A;  2LFB A;  1JKQ C;  3MVP A;  4DZJ A;  3B6A A;  2K40 A;  1TWG J;  1TWA J;  2E1O A;  2NS8 A;  5FKM A;  2GBY A;  5IP6 A;  3Q0U A;  3GTO J;  4C3I J;  2LKX A;  3A01 A;  4M6V A;  4J19 A;  1ZR2 A;  1JT0 A;  3BQY A;  4A3M J;  4IHY A;  1GDT A;  2ME0 A;  2D5V A;  1ZK8 A;  2B63 J;  2EH3 A;  2KT0 A;  4LOC A;  3LSG A;  1JUM A;  2L7F P;  2DA1 A;  1LE8 B;  5DS9 A;  3RKQ A;  2LK2 A;  3HGY A;  1UHS A;  1YRN B;  3RZD J;  5C4J J;  1OCT C;  5K7H A;  2XPW A;  3PO2 J;  2EZK A;  1XG1 A;  3VPR A;  1VF9 A;  3HOV J;  3LOC A;  3ZQH A;  1LE8 A;  2AO9 A;  5F1J A;  2XSD C;  2PMZ N;  1IJW C;  3JRH A;  2L7Z A;  5M5X J;  1YRN A;  1GV5 A;  1GUU A;  1NK2 P;  1ETY A;  4M3G A;  1U9O A;  2LP0 A;  2M9H A;  2KDZ A;  1GT0 C;  1LFB A;  5K7Z A;  4C3J J;  1ORK A;  4Y52 J;  1MBG A;  2TRT A;  3I4N J;  4FCY A;  2R92 J;  2ID6 A;  2I10 A;  1ZQ3 P;  1ETK A;  1JUP A;  1TC3 C;  5EGO B;  1RES A;  4XRM A;  1JUS A;  3IV5 A;  3FK7 A;  3JRC A;  1GVD A;  2NVY J;  3CCY A;  1JKO C;  3LSJ A;  4A3D J;  4HNV A;  2EZH A;  3SFI A;  2JA8 J;  2HOS A;  2VKV A;  4BY1 J;  3OOU A;  4ABZ A;  4A3K J;  5EGO A;  3ZQI A;  2LR8 A;  2M34 A;  1R9T J;  2GM4 A;  1FTT A;  1U9N A;  5FKO A;  5EEA A;  1U8B A;  4RBO A;  2O7O A;  2W48 A;  2L7M P;  4A3L J;  4JX4 A;  2XGD A;  2Y2Z A;  3SDG A;  3Q3S A;  4QTR A;  4XRS G;  1X58 A; 
#chains in the Genus database with same CATH topology
 2FSW A;  1HW1 A;  3GZ6 A;  2R5Z B;  1FP1 D;  2BBY A;  5BQT A;  3MKW B;  1X3W B;  1IRG A;  1ZLJ A;  2IAI A;  2AHQ A;  1S7O A;  5GAE J;  1WI3 A;  5ILS A;  3CC7 I;  3BR2 A;  3ZMS A;  1IXC A;  5K7F A;  3KIO A;  2X6Y A;  4HA8 A;  2DPU A;  3KP7 A;  2PG4 A;  1U3E M;  1G3W A;  4IPA A;  5D6E A;  2R7T A;  1EV7 A;  2XRO A;  1ZG5 A;  3TGN A;  2DTR A;  3PUB A;  2HS5 A;  3K2A A;  1LVK A;  4BH9 A;  1YQA A;  2LRE A;  2R93 J;  4P9U A;  1AA7 A;  2XAG A;  2NNY A;  1R49 A;  3T5X A;  3OIO A;  1Z05 A;  2FJ1 A;  1PDN C;  2LC2 A;  3ZQL A;  1HOM A;  1LUJ B;  1JTX A;  2FEZ A;  3HRS A;  2HU9 A;  2VQG A;  1U2W A;  2L0K A;  3HKZ N;  3FXK A;  2D2W A;  4FIS A;  2RN7 A;  2DJN A;  4H4K C;  4HBL A;  4HLY A;  4I99 C;  2CU7 A;  4WWC A;  5LEK A;  2ACJ A;  3EUH A;  2W24 A;  4EM2 A;  1FTZ A;  1D3Y A;  4XK4 A;  4U7D A;  5FJ8 J;  1U78 A;  1HW5 A;  3B6C A;  3UNG C;  2KRC A;  3KX2 A;  4MNU A;  9ANT A;  1SD4 A;  3FXL A;  4KT6 A;  2UXX A;  2GOX B;  2NNN A;  3OYC A;  3L2V A;  2YX7 A;  3H9Q A;  3K4B A;  3ERM A;  1IDY A;  2STW A;  1SAX A;  3E3V A;  2QF7 A;  3ABT A;  1LEA A;  2E1N A;  4I0B A;  2H6C A;  1TZL A;  2XB0 X;  3IWF A;  3G4S I;  4LLG F;  2IA1 A;  1RET A;  2V7F A;  3SEZ A;  1XGO A;  4EM1 A;  3RPQ A;  1STZ A;  1I1G A;  1R1V A;  1YI2 I;  1TWC J;  3M8F A;  2OZ6 A;  1YJ9 I;  4XKV A;  5LBQ A;  4UUS B;  1X2N A;  5M5W J;  1Z7U A;  2QUF A;  2CYY A;  2CUE A;  3S17 J;  2JA5 J;  4L0Y B;  4P5O A;  3IH3 A;  1TNT A;  4HPQ A;  3TW6 A;  3C2G A;  3FMS A;  3JRG A;  5KK1 A;  3CME I;  4CYD A;  3JW4 A;  4OAZ A;  1J59 A;  1VI0 A;  1RIO H;  2IRF G;  3QPT A;  2EIM H;  4YII A;  2VAS A;  1MZB A;  4PDK A;  3MAJ A;  3S1R J;  2HNH A;  3OL4 A;  3J7Z I;  3I5U A;  3BQZ A;  4BBS J;  1Z7L A;  1ZGJ A;  2VJ5 A;  4U0W A;  1NG6 A;  2G7U A;  2DFI A;  3FXJ A;  3GME A;  2XAQ A;  2E7W A;  3FDY A;  1VQK I;  2FA5 A;  4XKW A;  2VQC A;  2BY1 A;  5JHU A;  3FMQ A;  5HOO A;  2NVU B;  3IAM 2;  3CCJ I;  2GXB A;  2DA5 A;  2VQL A;  5J1Y A;  3QWL A;  2Y0M A;  1X3Z B;  3LSI A;  4M3D A;  4AC0 A;  1NHA A;  4FTH A;  3KE2 A;  3K69 A;  5FO5 A;  2MH2 A;  2XVC A;  1Z0X A;  3TW7 A;  2EJR A;  3KZZ A;  4HF2 A;  2OCC H;  5LHG A;  3FMR A;  4YRV A;  2WWY A;  4CCJ A;  2OTL I;  4EJV A;  4Y3O A;  2DW4 A;  2HOA A;  1GHC A;  2MLK A;  2KIQ A;  2XAH A;  4A3I J;  4BHC A;  1J2X A;  5LGU A;  5EEH A;  5HDN A;  2YX4 A;  3W6J B;  2UV1 A;  4G12 A;  2HQN A;  4D5F A;  2HDD A;  1T38 A;  5J3L A;  1MND A;  2EIJ H;  1X1D A;  4RAZ A;  2HQ5 A;  4NNJ A;  3S16 J;  2ZFU A;  1XTA A;  1I6H J;  3GF2 A;  5J8C A;  4BDY A;  4HQM A;  3CTA A;  3RZO J;  4X1E A;  1HLV A;  1MMN A;  2JPC A;  3CC4 I;  2V6C A;  3HOU J;  1FEX A;  2D1H A;  1JKR C;  4CCM A;  2L2O A;  2ELJ A;  3C3W A;  4Y7N J;  5K1Y A;  4ESF A;  4ZYA A;  1HDD C;  1L3L A;  2A6E F;  4B1R A;  1YJN I;  1P7I A;  2C6Y A;  3IKV A;  3F8M A;  4F91 B;  3VOE A;  3PFI A;  1FYL A;  1GXP A;  1MJB A;  3ABL H;  1E0E A;  5DCM A;  3GEZ A;  1SVO A;  5CKT A;  3FIS A;  5GP9 A;  1HDP A;  2HVS A;  1X4O A;  3KYC B;  1BR4 A;  3OYB A;  2FQ4 A;  5FKN A;  1BI2 A;  2BVL A;  4OOI A;  3JRI A;  3OL3 A;  4E7K A;  5K5Q A;  3MD2 A;  3HRM A;  1Z67 A;  1LFP A;  1WJC A;  4IHX A;  3IAS 2;  3S2H J;  1WJF A;  4DBR A;  2VON A;  1GV2 A;  1VQ4 I;  1BM9 A;  4E7S A;  1VQ9 I;  1MBF A;  2XGE A;  3UR3 C;  3LAJ A;  1FJL A;  2QWW A;  2DJI A;  4G6Q A;  3BR6 A;  3F9K A;  4YEL A;  5F0F A;  1Q1H A;  2BE5 F;  2OQG A;  3P5J A;  1ZRF A;  1YYV A;  2XGC A;  2I5U A;  3V7C A;  4ZDO A;  2ZNY A;  2E60 A;  4Q4Z F;  4XIC A;  1ZG1 A;  4UNO A;  1FOK A;  4UVA A;  5IP7 J;  2VXZ A;  1CF7 A;  1BOA A;  5IT9 Z;  2LVS A;  2ZXI A;  3C1D A;  3Q0W A;  4ESJ A;  3WTS C;  4BXU A;  5EG0 A;  4A0Y A;  1FOX A;  3L2R A;  1WFX A;  3EYI A;  2CGP A;  3CJT B;  4W1U A;  2HGC A;  3IUO A;  2E34 A;  3H3U A;  3WG9 A;  3DCF A;  3C18 A;  4A5N A;  2VN2 A;  2MH9 A;  4KFC A;  2DFF A;  2QSF X;  2GXG A;  2F5D A;  1KQ0 A;  4O5V A;  3JRA A;  1B1B A;  2KRF A;  2VPL A;  2JWT A;  4UUV A;  3KZI C;  2CO5 A;  1KU3 A;  1T2K A;  4QWQ A;  3GZ5 A;  1T98 A;  5J8F A;  3QU3 A;  2DBB A;  3KP2 A;  1QVU A;  1WI9 A;  2O8K A;  4G6T B;  3A02 A;  4M73 A;  4XRS A;  5IOY A;  3OYF A;  1OYW A;  2OAZ A;  1UCR A;  4DYQ A;  3B73 A;  5JI6 A;  3DBH B;  1F4K A;  3KET A;  1O3R A;  3G3Z A;  4MQV A;  3QPL A;  2KZV A;  3S1M J;  1IG7 A;  3L7W A;  3S14 J;  5J40 A;  3S32 A;  1R58 A;  3T8R A;  2F4I A;  2FRH A;  2W82 A;  3S3M A;  1QPI A;  1IUF A;  2DA6 A;  1L0O C;  2MC4 A;  3DWL E;  5J1U A;  5EZG A;  4AU7 A;  1MMG A;  4LK0 F;  2PLY A;  2Z9O A;  2R7Z J;  3KP5 A;  5K5O A;  2EZI A;  2HEO A;  3D0S A;  1XD7 A;  2UWM A;  2YU9 J;  3GYH X;  1K78 A;  1IRX A;  3VEP A;  5FGM A;  3BT9 A;  5JFR A;  1DGW Y;  3ZR8 X;  4XOP A;  1U5T B;  2K85 A;  3M8J A;  3S8P A;  3NAR A;  3ELK A;  4BAY A;  1OCP A;  4II3 A;  1Q1V A;  3M9A A;  3RPU D;  3S15 J;  3DQV C;  1XMK A;  4UVB A;  1OCO H;  3L1P A;  1XB4 A;  2VJ4 A;  3HRT A;  3GWZ A;  4MEX F;  3U9G A;  2K3P A;  1FWZ A;  2ZCW A;  4RMN A;  2P81 A;  3O8G A;  2PMH A;  1TTY A;  3PNT A;  1KGS A;  2XF6 A;  5D8L B;  1S3J A;  3GFL A;  3ZMD A;  1Y6I A;  4PJ0 C;  2KZG A;  2NS7 A;  2GZW A;  3C2B A;  5HLH A;  2WV0 A;  4IHW A;  3H5A A;  3CLQ A;  1Z91 A;  3CCS I;  1QPM A;  3RYP A;  5A2Q K;  1SC7 A;  3VYT B;  4Q47 A;  1LEB A;  2D45 A;  2BY0 A;  2QA4 I;  2DYR H;  3KPH A;  3ZPL A;  4DW6 A;  3TOA A;  3P9K A;  4EEF G;  5F0C A;  3DU5 A;  2O03 A;  1Y0N A;  2AXT C;  2LYC A;  2VT2 A;  3NAU A;  4BYY A;  2HXO A;  4N0B A;  3LNQ A;  4BQA A;  2R7R A;  2Y9Y A;  1LJ9 A;  2LF8 A;  4IRH A;  3M7G A;  4BUP A;  2PJR B;  5KNL A;  3GLL A;  2DPD A;  3I4M J;  4M9Z A;  4XLN F;  4V19 K;  4O6J A;  3HC7 A;  5IT3 A;  1LVA A;  4CCO A;  1H8A C;  2O0Y A;  1ETV A;  1JKQ C;  2X85 A;  5HDK A;  1A36 A;  5DYM A;  2DQR A;  4C3I J;  3A01 A;  2OJE D;  1HBX G;  4PGG A;  1JT0 A;  2L54 A;  3QOP A;  3GVA A;  4KIC A;  1Y8R B;  1ZK8 A;  4LMY A;  1R4N B;  2EH3 A;  2KT0 A;  3MQ0 A;  3LSG A;  1JUM A;  4XOR A;  5DUK A;  1Y39 A;  1LE8 B;  3RPU A;  2L3D A;  1OYI A;  1UJ8 A;  3HGY A;  1IO2 A;  3RZD J;  2P6T A;  4OMY A;  2XAS A;  4BDZ A;  1OCT C;  3J81 Z;  5FD5 A;  2DDB A;  3RCO A;  4ESB A;  2JUG A;  2K02 A;  3R4K A;  3CUQ C;  3BZK A;  1YW8 A;  2VIX A;  3GO5 A;  5BPI A;  2W84 A;  3ZQH A;  1USS A;  2L02 A;  4A0X A;  2R7V A;  1W36 C;  2ETH A;  2L7Z A;  2V1N A;  3WTX C;  1GV5 A;  1ETY A;  1Y8Q B;  3OS0 A;  1U9O A;  2LP0 A;  4QPQ A;  3H35 A;  2LF7 A;  4ZYH A;  1GT0 C;  2AXL A;  4NQW B;  3DKX A;  1YHQ I;  3CCL I;  2KQR A;  4BHP A;  2LDU A;  2H27 A;  5E17 F;  2JRM A;  3EUA A;  1EA3 A;  5E79 C;  1OLT A;  3BG6 A;  2ID6 A;  3OYN A;  1FYK A;  1YW7 A;  5EJC A;  3SZT A;  3WE3 A;  5L3F A;  3WOD F;  5EGO B;  2JT1 A;  2P8T A;  1W7P B;  2JQ7 A;  3K1N A;  3DXJ F;  3KLO A;  3VFZ A;  3SFI A;  2BXY A;  3I58 A;  2X4H A;  3IRR A;  2MD0 A;  3H36 A;  4U0V A;  2BVM A;  3VYR B;  5GTI C;  4G7O F;  2BW3 B;  3I4P A;  1FTT A;  5FKO A;  4AID A;  1OCZ H;  2CFX A;  1VQN I;  2E7X A;  2K86 A;  2L7M P;  4ZTJ A;  3K70 D;  1OCR H;  2UUZ A;  3Q3S A;  4QTR A;  1V55 H;  2PEX A;  2EFP A;  1YIO A;  1RUO A;  3OV8 A;  1XGM A;  1X58 A;  5LEJ A;  1KA8 A;  4G7Z F;  1FOW A;  2JMW A;  3OYJ A;  2LY9 A;  1JE8 A;  4A3F J;  1OFC X;  3M8E A;  3ASO H;  4NC8 A;  3OMY A;  3TO7 A;  3AG3 H;  1OJL A;  3I54 A;  3SXY A;  1B8I B;  2VBW A;  1V54 H;  3ZCO A;  5ILV A;  4IHS A;  1G2H A;  4RGU A;  3ZN0 A;  4IXA A;  3Q5F A;  1P4A A;  2K3F A;  2X6W A;  1B4A A;  1RKW A;  1T08 B;  3FXU A;  2Y9Z A;  2HXI A;  4CUG A;  3FBI B;  1ZAO A;  3DLA A;  3ZGK A;  2HTJ A;  3ZOB A;  2L9N A;  2R7F A;  2XF7 A;  1PUE E;  1ODD A;  4S04 A;  1SFK A;  5CQG A;  3WTW C;  2WB1 A;  4G8X A;  5D4R A;  1D1B A;  2DT6 A;  1ZH5 A;  1A5J A;  1ZKG A;  4LD5 A;  3G2B A;  4ZDP A;  3VWB A;  1S7E A;  3LA2 A;  2ZFW A;  5E8G A;  3BR3 A;  3BG9 A;  5ILU A;  2HOT A;  2JVH A;  4C2T A;  2V9P A;  4YIF A;  2K9M A;  1WHU A;  3KP4 A;  3GLX A;  1E3O C;  4BXF A;  2JRT A;  1QBJ A;  2ZNZ A;  3F0C A;  1YO5 C;  4YFK F;  3DF8 A;  2WBM A;  1FC3 A;  1JJ8 C;  3T1B A;  3FWE A;  2KJB A;  1LB2 A;  2DMU A;  3BR1 A;  2M7A A;  1E3P A;  5B1B H;  3CUQ A;  4B48 A;  2ESN A;  2JA7 J;  2GOM A;  1MDM A;  1A6I A;  4EJO A;  2RAE A;  2LTP A;  1D8J A;  4XLF A;  5LHH A;  3GTM J;  4HG2 A;  4IVN A;  5JLW A;  4NBQ A;  3CDI A;  4RAF A;  2LRD A;  2X6O A;  2CV1 A;  4PK4 A;  1LDJ A;  4FX0 A;  3WHC A;  5EEG A;  2JSP A;  1O7L A;  4DYC A;  1BJZ A;  4L9J A;  2RQP A;  1POG A;  2FNP A;  3RIR A;  3TED A;  2NOG A;  2MA3 A;  3A1Y A;  4JP0 A;  1XPX A;  5A2Q Z;  3QYF A;  2EB7 A;  2LKS A;  1QHG A;  5GAD J;  2DOE A;  5ERI A;  1U6G A;  2MG4 A;  4ENJ A;  6PAX A;  3EET A;  3HOX J;  3RKX A;  4A2U A;  1FZP B;  1PP8 F;  2FX0 A;  1MSE C;  1ETW A;  3S2D J;  4PFP A;  4JX6 A;  2F48 A;  1YX5 A;  2BY2 A;  3O6B B;  4MEY F;  4S05 A;  1I3Q J;  2IS2 A;  3I3L A;  5FFZ A;  5BMZ A;  1LNW A;  4HW0 A;  3D1N I;  1DPR A;  2X1D A;  3ECO A;  5FRN A;  1S7A A;  4BEH B;  2IVM A;  1XSV A;  2HFH A;  3BG5 A;  2QBY B;  3KEO A;  2CG4 A;  5FKL A;  3T0Y A;  2DI3 A;  1J75 A;  5FLV A;  1WGX A;  2M2E A;  2EFW A;  3ULQ B;  4RA2 A;  2R5Y B;  3G71 I;  3QYB A;  2NVX J;  4N4N B;  3ZMU A;  4Y13 A;  4CGZ A;  1IN8 A;  1EF4 A;  3S2W A;  2HI3 A;  2COM A;  5LLQ A;  2F5E A;  2M5W A;  3CO7 C;  1BL0 A;  1T6S A;  2P4W A;  1RPW A;  3CDH A;  5L3C A;  2UZK A;  3BCB A;  1YFH A;  1B9N A;  1I6X A;  3JSO A;  2ECC A;  3JRD A;  3NWS A;  2DK8 A;  1FYM A;  5E1X A;  2WTE A;  1AHD P;  3HOS A;  4LG3 A;  4BY7 J;  1QU3 A;  1J0R A;  1DUX C;  1D1A A;  4PSW A;  3SZG A;  1VND A;  2HYG D;  1LKX A;  4HOB A;  4KUM A;  2BY3 A;  4PUS A;  1BW6 A;  4IRG A;  5HNH A;  4WXC A;  3AL0 C;  5DDG A;  5D5W B;  3PO3 J;  3L2W A;  1W5T A;  1ZYR F;  2XV4 S;  1T56 A;  3E5U A;  1EH6 A;  1MJA A;  2M45 A;  2X48 A;  4MTE A;  1ETO A;  4D7M A;  3OWT A;  4BBR J;  3QAH A;  4PSX A;  1MMD A;  3HBL A;  3EQL F;  1S72 I;  5M3F J;  1GVJ A;  4XID A;  1JHF A;  5JVG F;  4LIT A;  2O8X A;  3ERE D;  1VQ7 I;  4BXX J;  4E7Z A;  5KHD A;  4NUB A;  3IH2 A;  5DUI A;  1SFO J;  3GTJ J;  3H3V K;  3ASN H;  1UZC A;  3CO6 C;  2RVC A;  1WJD A;  2UXN A;  4FQG A;  2M30 A;  1W7P D;  3DEW A;  2KKO A;  4UXN A;  3CUO A;  2QGU A;  4DQ2 A;  2V1U A;  2R7X A;  4UHT A;  5JLX A;  3LSP A;  3QPH A;  3E0J B;  2NVQ J;  2MYS A;  3IL2 A;  3Q9V A;  2V6E A;  2RGV A;  2Q2E B;  4QIW N;  1O3S A;  2TDX A;  2VXD A;  2Q8K A;  2LD5 A;  2IPQ X;  1RKT A;  1WPK A;  1GLN A;  3AG1 H;  3BG7 A;  4GYI A;  3BTC A;  3L00 A;  4ITV A;  5HVQ C;  4E7L A;  1VQP I;  2O9L A;  3FXR A;  4KA4 A;  4DIQ A;  1T33 A;  3NEU A;  2CV0 A;  1ZTR A;  3BTJ A;  3JRF A;  2CH0 A;  3KP6 A;  3PQJ A;  2NS0 A;  3IRQ A;  3TMO A;  1BI3 A;  1Y0U A;  1O57 A;  4W97 A;  3OYD A;  4KJZ A;  3FF5 A;  2L5Q A;  3OYA A;  1BIA A;  2ICW G;  3SYT A;  2EWN A;  4DNC A;  4OAY A;  1X1C A;  3IHU A;  1AKH A;  2X51 A;  3E6C C;  3WE2 A;  2F4O B;  3WTY C;  4ZTF A;  2KMU A;  1I1S A;  3DEU A;  3GTP J;  3ZQG A;  1SFU A;  4I76 A;  1XGN A;  2JSC A;  1OMI A;  2VL8 A;  3H5R A;  2GLO A;  4WXD A;  3JTG A;  2OUM A;  5IP9 J;  1FBU A;  3CQZ J;  2EBI A;  3F72 A;  4PJJ A;  3REO A;  2E1C A;  4XLP F;  2QM3 A;  4ZC3 A;  4RDU A;  2XKO A;  4MLO A;  4CH7 A;  2LOO A;  2XAF A;  2QEX I;  1VTN C;  5J1R A;  2LBF A;  5KAI C;  2VOO A;  4LG0 A;  1YE9 A;  2X0L A;  4C3H J;  3DKY A;  5JR3 A;  2FBK A;  1D5Y A;  3LQQ A;  3I55 I;  5E8I A;  4IL6 C;  4CA0 A;  2VOD A;  1R5H A;  2A5W A;  2Z3Y A;  2ZSH B;  2B0L A;  1QZZ A;  3BPX A;  2LSO A;  3GZN B;  3C7J A;  2PQ8 A;  2RV8 A;  5E20 A;  3VYU B;  4QLC U;  1YX3 A;  4EMS A;  3S3N A;  4HLX A;  1Z77 A;  2YS9 A;  2WAF A;  3F22 A;  2KIF A;  1J7K A;  3GBG A;  2Y69 H;  1PUF A;  1MH4 A;  2K9L A;  3BTL A;  1WQ2 A;  3KEY A;  4XRF A;  1QQI A;  2E2J J;  3BZC A;  1MGT A;  2NOJ B;  3K4N A;  2EV6 A;  4KIT B;  2L9R A;  2F6C A;  4M3F A;  5J6X A;  5FRO A;  4IZZ A;  3J81 K;  4G6D A;  4A6D A;  2JK3 A;  2BOL A;  2PN6 A;  1MNM C;  4M9S A;  2W1O A;  4I2O A;  5IY5 H;  2JJ7 A;  2PBI A;  1IN7 A;  2A07 F;  3M07 A;  3WTV C;  3R61 A;  3GW2 A;  4P96 A;  4CHU A;  1ZAR A;  5E3O A;  3P7N A;  1ACI A;  1KQ9 A;  3TP0 A;  3RI4 A;  1QZE A;  2IT0 A;  1ZG3 A;  3J80 Z;  3JSP A;  2Z5U A;  4RGS A;  3PFY A;  4U87 A;  2CMP A;  2DOF A;  4UVC A;  3L9F A;  1B72 B;  2G9W A;  5EF6 A;  2JTV A;  1TQP A;  4JX5 A;  4DZP A;  1WH5 A;  2WB1 N;  4ENN A;  2OQR A;  1ZEL A;  1ENH A;  4XBF A;  4CYC B;  5CVI A;  1DP3 A;  2ESH A;  3A0H C;  5ICC A;  1W0T A;  2QQ9 A;  4ZZL A;  2R4G A;  1YOV B;  2XRL A;  5FLM J;  3A0B C;  4D9J A;  4L18 B;  3WU0 A;  3DTE A;  3TDU C;  3COA C;  4D5C A;  2ZO4 A;  4N9I A;  1WH7 A;  2VKD A;  1H0M A;  4R79 A;  4U7B A;  5LHI A;  1ERD A;  1QHH D;  1OR7 A;  4WCG A;  3MVP A;  2M8E A;  4DZJ A;  3B6A A;  2ZME B;  2KIU A;  2IXS A;  2NS8 A;  1T39 A;  5D5X B;  3MKY B;  4M6V A;  2NRA C;  4G94 A;  4KMU X;  2EA2 A;  1ZR2 A;  1K6Y A;  3PUF A;  4A3M J;  3QOE A;  1GDT A;  2ME0 A;  2D5V A;  3JCU C;  4OIN F;  2B63 J;  1TW3 A;  1IXR C;  1DPU A;  2QKM B;  3K9T A;  1SFE A;  2KL4 A;  3E97 A;  3PIO F;  4BQN A;  2DA1 A;  2P5K A;  4RM3 A;  4HNT A;  3FZV A;  2HDC A;  3K1P A;  1R1T A;  2BHY A;  3OYL A;  1UHS A;  2CQ7 A;  1YRN B;  5C4J J;  3HIF A;  2XPW A;  2WY8 Q;  4RB1 A;  3VPR A;  4M71 A;  3HOV J;  1OQY A;  2HQR A;  3PL8 A;  2HWV A;  3GFM A;  4E70 A;  2ZSI B;  1P4W A;  3LOC A;  2AO9 A;  2ZC2 A;  4ENM A;  4IRI A;  2J5O A;  1GXQ A;  3FXO A;  1PYV A;  1EKE A;  1O3Q A;  4RLF A;  1NK2 P;  4M3G A;  1QO0 D;  1IN6 A;  3K0L A;  1W4M A;  1ON1 A;  2CFO A;  4C3J J;  5K7Z A;  3H1C A;  2W7N A;  1KYZ A;  2E5Z A;  4Y52 J;  1MBG A;  2W25 A;  3KLN A;  2CQN A;  4B47 A;  2VLA A;  2PI0 A;  1S6L A;  3RQ4 A;  1A04 A;  1EJ9 A;  2IS6 A;  2L9V A;  2OA4 A;  1ZQ3 P;  4IKF A;  1ETK A;  1TC3 C;  4HQE A;  1UG0 A;  2XKP A;  1D1C A;  3DPU A;  4XRM A;  3IV5 A;  5FFX A;  4AWX B;  4L5I A;  1RUN A;  5K5R A;  4IQ4 A;  1J09 A;  4WX9 A;  5JHF A;  3CCY A;  3SZP A;  2R7U A;  1JKO C;  4A3D J;  3EUK L;  4I0A A;  2HVQ A;  3TKY A;  3RKW A;  3QRF F;  2F2E A;  1XN7 A;  2HOS A;  1FSE A;  3PSF A;  3MZH A;  4EQQ A;  2HDW A;  2HTS A;  4A3K J;  2LR8 A;  2M34 A;  3HL2 A;  2NXN B;  5D5U B;  2MLG A;  3BPV A;  3E6B A;  5EEA A;  4RBO A;  1JHH A;  3CCV I;  2O7O A;  2W48 A;  5HNF A;  3U2R A;  1F5T A;  4HRI A;  2E1M B;  1U8R A;  1XDS A;  3DTK A;  2RNG A;  4M9X A;  3PIP F;  1T95 A;  4GCV A;  4UV8 A;  5E1Z B;  3MZY A;  2OD5 A;  2QCO A;  2QSG X;  1M1E B;  4QPO A;  4C2U A;  1V4R A;  3I59 A;  4RS8 A;  2QEN A;  5E3M A;  5TIS C;  5AIQ A;  4RLQ A;  5ICE A;  3E7L A;  3MN2 A;  2XB5 A;  1UEL B;  4AIH A;  1YS7 A;  2R5Z A;  1WCM J;  4I98 B;  3NRV A;  1RRJ A;  4OIR F;  4FE7 A;  3D5S C;  1SFX A;  1T0F C;  2DMP A;  1TWF J;  2JA2 A;  2XRN A;  5CVU A;  1Z1D A;  3MEX A;  4V2G A;  4ASN A;  1MBJ A;  4DGW B;  1O7F A;  5H6Q A;  2M4K A;  1SAN A;  2OZU A;  5FLX K;  4NDL A;  2IGN A;  2W85 A;  3WTZ A;  1BI0 A;  3FHN A;  1X2M A;  3HM5 A;  3BJO A;  3I0T A;  4F7Z A;  1HKQ A;  3F3X A;  2KRH A;  1WRJ A;  1VZ0 A;  4A3C J;  2Y0S A;  2CQK A;  3QQA A;  2MAB A;  2FOK A;  1TNS A;  1F36 A;  2OC6 A;  4MGR A;  3N05 A;  4J00 A;  2GXA A;  2MGQ A;  3KEQ A;  4LK1 F;  1MBE A;  3LMM A;  4GO1 A;  1K61 A;  2K5C A;  4JBA A;  1G3T A;  4JOM A;  1KON A;  2IJL A;  3VSK A;  3OYK A;  1VFC A;  2O61 A;  2IA0 A;  3V7R A;  2O5R A;  3LL7 A;  1N77 A;  2HKX A;  1DGR M;  3SJM A;  1NH3 A;  4N4O B;  2V9V A;  4AIK A;  3BLY A;  1O4X A;  1XCB A;  2ME6 A;  3RQI A;  2K9S A;  2OPT A;  5HLT A;  4JQF A;  1YG2 A;  2P0W A;  4OMZ A;  4CCK A;  2EQR A;  1Y1V J;  2L01 A;  2EFO A;  2PFB A;  3BOQ A;  4D1Q A;  4M3B A;  2V79 A;  1W5C C;  1R23 A;  1V5G A;  4RAG A;  1I27 A;  4P1W A;  5IPA A;  1YW9 A;  3F8B A;  5F04 A;  1H89 C;  1N25 A;  4G9Y A;  2HQA A;  3TP3 A;  3WHB A;  5H2F C;  5DD4 A;  1MD0 A;  2IA2 A;  3S1Q J;  4UUS A;  3QPS A;  4KN4 X;  5TGT A;  4OIQ F;  1UAA A;  4IF4 A;  5L3D A;  2YU3 A;  5ED4 A;  4Q48 A;  2G0E A;  5DM6 F;  3CJQ B;  3ML6 A;  4L9T A;  3BJ6 A;  3K70 C;  1HA8 A;  3GX4 X;  3EPZ A;  5M3M J;  4ETS A;  2VBZ A;  2DT5 A;  1E2X A;  3HPG A;  4OIO F;  1S29 A;  3F8F A;  4NB5 A;  1K7A A;  3LFK A;  1F1Z A;  3DPT A;  3CJN A;  4XQF A;  2CUJ A;  3G1O A;  4PCQ A;  3E1S A;  3BG3 A;  4ZDL A;  1DQU A;  1UG2 A;  3K7A J;  2B9S A;  2F5C A;  1U0J A;  1R36 A;  2LY2 A;  3QU6 A;  2QKL B;  3I64 A;  1K4T A;  3F6V A;  3M3Y J;  3FHZ A;  1XX5 A;  4TV7 A;  2R7W A;  1K4S A;  3SEQ A;  5HLG A;  3X2Q H;  2DMN A;  3ZQF A;  3IKT A;  3RTR A;  2X6X A;  2M8G X;  2HPI A;  1IC8 A;  4LIV A;  1ONV A;  3MZ8 A;  4L5E A;  2P7V B;  2Q0O A;  3JR9 A;  3G1M A;  2Z1D A;  4X6A J;  4F55 A;  4DOZ A;  1IDZ A;  3ZMV A;  4LB6 B;  3R0A A;  1NG7 A;  3LFU A;  2I8D A;  3LSH A;  3HB9 A;  3K2Z A;  1IN4 A;  1WJA A;  4X0G A;  4H0E A;  2XUB A;  2LKP A;  1TBX A;  2BHZ A;  3TOB A;  3E6M A;  1FNN A;  1H88 C;  3CP8 A;  1T0F A;  3I71 A;  1R22 A;  5DTD A;  5DCM B;  3HDD A;  1OPC A;  2K4J A;  3W2W A;  2A3S A;  5F6F A;  2D1V A;  2JPB A;  4GGG A;  4Y33 A;  4E4H A;  2KHM A;  4MO7 A;  2AQE A;  4L9N A;  1MBK A;  1MH3 A;  2XPV A;  3HXL A;  5GPA A;  3Q0V A;  4BJ5 C;  1O3T A;  2VT3 A;  3CCM I;  4RGX A;  2DMT A;  3LA3 A;  3IWZ A;  4BE0 A;  1U5T C;  1BR1 A;  3HGG A;  2ZJ2 A;  3AG4 H;  5BPD A;  1SEU A;  2RDP A;  3K10 A;  1MIJ A;  3CMA I;  4E7I A;  2E2H J;  4KYW A;  4HV6 A;  4XMY A;  1B6A A;  2A68 F;  1P4X A;  3RDI A;  5CLS A;  2HKO A;  4KIF A;  3HTU A;  1YLF A;  5J47 A;  4L0Z B;  3PM1 A;  4YFN F;  2CQX A;  5D6F A;  5J4V A;  3BC8 A;  2DCE A;  1XC5 A;  3BY6 A;  2CUZ A;  1QRY A;  3I56 I;  1KQ8 A;  1XSX A;  1CF7 B;  3V7S A;  4LIU A;  2N8G A;  5H20 A;  2R7O A;  4NC6 A;  1IAW A;  2A05 A;  4N9H A;  2CSO A;  5IYB J;  2P7C B;  1CQT A;  2TCT A;  1IV8 A;  4HST A;  4D0P A;  1NK3 P;  2ELK A;  5LD2 C;  1X1B A;  3JAM K;  3S1N J;  1MW7 A;  4CIC A;  1SD5 A;  2KIM A;  3K1M A;  2GIV A;  4YFX F;  1APL C;  2P5L C;  2K9N A;  3H92 A;  3C2H A;  4XM3 A;  2ZXH A;  1JJ6 C;  1VQ6 I;  2B7E A;  5HOD A;  3ZN1 A;  3JRE A;  3LQR A;  1ETQ A;  1FLI A;  3HOW J;  3BR0 A;  3WTU C;  5E18 F;  2DA7 A;  2EZL A;  1AU7 A;  4BQO A;  3BZ6 A;  3L2U A;  1J9I A;  1VQ5 I;  3HPH A;  1ZLK A;  2DA2 A;  3J7Y J;  4E7H A;  3LST A;  1LFU P;  1Z6T A;  1ZHF A;  1ZN2 A;  3OIQ A;  3GFI A;  3J80 K;  2IBD A;  3CES A;  4EJU A;  1BW5 A;  2XSJ C;  3ONQ A;  3QP6 A;  4I01 A;  4KIG A;  4PFO A;  4CSW A;  4EM0 B;  4RGR A;  1T8I A;  3AFH A;  5ICF A;  5TJJ A;  3B02 A;  2V4J C;  4AUX A;  1R5G A;  2FUG 2;  4HAM A;  2QZ8 A;  1ZR4 A;  2VUM J;  2V26 A;  3FIW A;  1YTY A;  1H9G A;  2QLZ A;  1E3H A;  5FLX Z;  4LJZ F;  2FBH A;  4YG2 F;  2W4S A;  5C4X J;  3H9G A;  1G4D A;  2GQQ A;  2PMU A;  1HKS A;  2Z99 A;  4FAS D;  1DP7 P;  1K78 B;  2CJJ A;  4DJA A;  3ISP A;  5EDN A;  1OIS A;  2DOD A;  2ADU A;  4B09 A;  1ETX A;  2VJJ A;  3ABK H;  3EYY A;  3AKZ A;  4GYG A;  3PNY A;  1HQC A;  4EJT A;  3KYD B;  4NHJ A;  1FIA A;  1SVM A;  2DMQ A;  2OBP A;  5HLI A;  1VQO I;  1F9N A;  5LGN A;  1FBS A;  2R3S A;  4MFD A;  5F64 A;  2IS4 A;  1PJR A;  3LA7 A;  5B3S H;  1SD6 A;  3SQN A;  3T8T A;  4AVP A;  3AG2 H;  1IGN A;  3NWT A;  4HX7 A;  4OU0 A;  5EZH A;  1XSD A;  3AAF A;  2R0Q C;  2EPF A;  4BKX A;  4CZC A;  4RAY A;  1TP4 A;  3OSG A;  3QP5 A;  3ECH A;  2M3A A;  4AD9 A;  5GAG J;  5L3E A;  1U5T A;  4U0Y A;  1OCC H;  5DEQ A;  4B4C A;  1F43 A;  4HSR A;  4BJT A;  2DT7 B;  2EK5 A;  2GAU A;  1G59 A;  4JYK A;  1TT5 B;  2M0M A;  3WTT C;  2BEO A;  2EIK H;  2OTJ I;  1G6N A;  1D0Z A;  1QVT A;  1DU6 A;  3R6S A;  4GXO A;  3QOD A;  3VB2 A;  2FMY A;  1Z3X A;  3TQN A;  1XGS A;  1R71 A;  3TO9 A;  4EGZ A;  3BR5 A;  5BS6 A;  2MW8 A;  1KU2 A;  1SMT A;  1B59 A;  3U1K A;  5M5Y J;  1YJW I;  4LFU A;  1REP C;  5CJ9 A;  1K79 A;  2FOW A;  4UB8 C;  4A3E J;  5F27 A;  4MIM A;  3SHF A;  4Z6Y A;  5KVR A;  2ID3 A;  4RB3 C;  4F3Q A;  4I6Z A;  2M4G A;  3CCU I;  3A03 A;  2Y0S N;  2HPM A;  3MKZ A;  2XIG A;  4ZYE A;  2V9K A;  2DLL A;  2CW8 A;  1IN5 A;  1Z3Y A;  4QSH A;  1DDN A;  1A35 A;  2Y31 A;  4DBQ A;  3W3C A;  2E19 A;  3A01 B;  1VQM I;  4IX7 A;  3H0D A;  1K6O A;  3HTS B;  2K27 A;  4CCN A;  5E3N A;  2ECB A;  2KFD A;  3GTQ J;  1QGP A;  3P9I A;  4JK1 X;  3HOY J;  3WG7 H;  5CQE A;  3FM3 A;  2LFB A;  3R60 A;  2PJR A;  1TWG J;  1TWA J;  5GTH C;  5FKM A;  3GTO J;  2EA4 A;  2EIL H;  4IJA A;  2LKX A;  5D4S A;  3L2C A;  4J19 A;  3NQO A;  4XLH A;  3WU2 C;  4MQ9 F;  1XDU A;  4IHY A;  2WAD A;  3QYE A;  5D5V B;  1OR7 C;  2R7S A;  4Q5S F;  1N78 A;  2E35 A;  4F92 B;  2WC2 A;  5LRR A;  1P92 A;  2VBY A;  1ZRD A;  4CXF A;  4XR6 A;  2HVR A;  3CF2 A;  4HF1 A;  5BOX A;  1R7J A;  1BJA A;  3RKQ A;  2LK2 A;  2V1X A;  2RKH A;  4RB2 C;  4IQJ A;  3ZXS A;  3LAP A;  3MMY B;  2FNA A;  1IRF A;  4GDF A;  2Z16 A;  4XSX F;  1V3F A;  1E17 A;  3BCA A;  1I3A A;  3PO2 J;  2EZK A;  1XG1 A;  5E1W A;  1VF9 A;  5FRM A;  2F4M B;  3KCC A;  2WAE A;  1RC9 A;  3VSL A;  3FM5 A;  1LE8 A;  2QYO A;  1SD7 A;  4C30 A;  2XSD C;  1Z21 A;  2RQQ A;  1IJW C;  2CW7 A;  3CLO A;  5FD6 A;  4KT5 C;  5M5X J;  1FT9 A;  2OU2 A;  1GUU A;  1A6Q A;  5H6R A;  1TW2 A;  2M9H A;  4E6K G;  2HZT A;  4MHG A;  1LFB A;  3HSE A;  2MBF A;  5B66 C;  1VQ8 I;  1V5E A;  5HDG A;  5D8K B;  1R4M B;  4M72 A;  3K4J A;  4KN7 X;  4HNU A;  2TRT A;  2BZT A;  2JVG A;  3V8L A;  3I4N J;  1FSH A;  2A6H F;  3F6O A;  1JUP A;  2ZJR F;  1IW7 F;  2G7H A;  3HHH A;  2L7K A;  2KIS A;  1JUS A;  4R8H A;  4ZH4 F;  4NQW A;  3FK7 A;  3JRC A;  1TQI A;  4RB0 A;  1H9T A;  4HDV A;  3LSJ A;  3F23 A;  4HNV A;  2EZH A;  5ICG A;  2JA8 J;  1ULY A;  1RR8 C;  4XN0 A;  1Z6R A;  3W2A A;  2VKV A;  3OYM A;  4BY1 J;  3JAM Z;  1HST A;  4AVZ A;  4L9V A;  4E7J A;  1TQM A;  2P5V A;  5EGO A;  1C0W A;  4HX8 A;  2PX9 A;  1W7P A;  1U9N A;  3H3Z A;  2MD5 A;  4XL9 A;  4BGD A;  1RI7 A;  1W5S A;  4CZZ A;  2BV6 A;  4JX4 A;  2IP2 A;  3SDG A;  4AYB A;  4XRS G;  4J01 A;  2BW3 A;  3J7A O;  2JUC A;  1LPQ A;  3K4C A;  3M4O J;  2H94 A;  1S8N A;  4WXH A;  4YEJ A;  3ABU A;  3W6V A;  2L9S A;  3TBI A;  3WGG A;  5TRD A;  3ZQC A;  1P2F A;  3D5L A;  1IV6 A;  2GWR A;  4FT8 A;  3PQK A;  4O3M A;  5DM7 F;  2ZXJ A;  4Y17 A;  3FKI J;  1X3U A;  1VQL I;  3ROU A;  1A31 A;  3GFJ A;  3HRU A;  1PP7 U;  1IRZ A;  3PNV A;  2QQA A;  5F08 A;  2CRG A;  3O3K A;  1BI1 A;  3ABM H;  1BIB A;  5DV5 A;  3ZMZ A;  4EV0 A;  3LSM A;  4HX4 A;  1RZ4 A;  1B8I A;  1XMX A;  1QA6 A;  1D8K A;  4XLE A;  2FQ3 A;  2WAQ A;  3IH4 A;  2JA6 J;  1XS9 A;  2M0C A;  1MMA A;  1YIJ I;  4LB5 A;  4FE4 A;  2XAU A;  4XKB A;  3V8J A;  3LSK A;  4ZYG A;  3LWF A;  4IEJ A;  1HXD A;  3HUG B;  1X1P A;  3S3O A;  1MKM A;  1LDK B;  1R1U A;  4LGW A;  4WF2 A;  4B8X A;  2HR3 A;  3CUQ B;  1ZRE A;  1MDM B;  1BBY A;  1ZGA A;  2FU4 A;  3OIP A;  1JGS A;  3OR2 C;  5GPC A;  1HCR A;  3BTI A;  2COB A;  3OYH A;  3OYE A;  2K4B A;  4C9Y A;  1R5I D;  4ENK A;  3K4L A;  5AON A;  4BL0 B;  1HF0 A;  2LLK A;  3OR1 C;  1FY7 A;  2F5F A;  3HOZ J;  3H0G J;  4KMF A;  2F5V A;  1LDD A;  4RM2 A;  1JXS A;  1IZ1 A;  1YIT I;  1TLH B;  3RSN A;  5GAH J;  1JI8 A;  3ZRG A;  1RR7 A;  5IYC J;  2EFQ A;  4PJN A;  4Y15 A;  3F21 A;  4I02 A;  5HS7 A;  3U21 A;  1BOB A;  1ON2 A;  3GUD A;  4I09 A;  2CUF A;  2QQ8 A;  1RNL A;  2CWE A;  2Y48 A;  4FET A;  4UUT A;  5B5E C;  5L3B A;  1JGG A;  1TL8 A;  2L4A A;  2DYS H;  5F0H A;  2W00 A;  2VI6 A;  3RKY A;  1X19 A;  2R7Q A;  3O8H A;  5CYV A;  3GTG J;  2EFN A;  1IF1 A;  3S93 A;  4LLN A;  2DTZ A;  2H8W A;  3MCZ A;  2PMZ A;  5DD8 A;  2HZD A;  1NTC A;  4V2F A;  3E5X A;  3V4G A;  2M87 A;  1G8X A;  1KYW A;  3UKG A;  1UFM A;  3W2V A;  4FHT A;  4R1H A;  1WJE A;  2Y30 A;  3VDX A;  2VB6 A;  4FX4 A;  4M74 A;  2KJC A;  1J5Y A;  3HEF A;  3MKL A;  3IP4 B;  4Y4R A;  2VE8 A;  1FIP A;  1QNT A;  2LH9 A;  3ZP5 A;  4A3G J;  2STT A;  4IOA F;  1UMQ A;  1PVE A;  2YR2 A;  4KDP A;  2MC3 A;  1SAU A;  2LMD A;  2FF4 A;  4F52 A;  5IYD J;  1D5V A;  5CVV A;  4A93 J;  4BEH A;  4EAT A;  1BA5 A;  4BS9 A;  2WY7 Q;  2QBY A;  2DN0 A;  2HYF A;  2W57 A;  1S9H A;  2A6T A;  4BAC A;  3CC2 I;  3K4K A;  4NC7 A;  3HYI A;  3G6E I;  1SVL A;  1TWH J;  3L09 A;  3ZMT A;  1ZGW A;  2BGC A;  2ELH A;  4A69 C;  1BC8 C;  2R5Y A;  3MFK A;  4A5M A;  4KIB A;  2Y75 A;  4A3J J;  2X9D A;  1EH8 A;  2FXA A;  3WGH A;  1ZRC A;  2E2I J;  2LG4 A;  4B3A A;  1TT0 A;  3ZQ7 A;  2DAO A;  3CCE I;  1UB9 A;  4D7N A;  4BE2 A;  3RJP A;  5C3E J;  3GTK J;  3GTL J;  2DQL A;  2CW0 F;  3DP7 A;  3GCM A;  5FKK A;  4ZZD A;  3CDL A;  2HOE A;  2ZJQ F;  3OS1 A;  2OF7 A;  4AIJ A;  3I9V 2;  1UST A;  1I50 J;  2RC4 A;  3CMM A;  1IUY A;  2XHK A;  2HYJ A;  3CF5 F;  2O6G E;  4XNF A;  3BDD A;  4HZF A;  4HYE A;  4C2M J;  3HKZ A;  4A6E A;  4CO8 A;  2EV5 A;  3KYL A;  3CD6 I;  2DU9 A;  2RRE A;  2QVO A;  4S0H B;  1MMS A;  2K9Q A;  1JKP C;  3L2Q A;  4P9F A;  3HSR A;  4XOT A;  3IC7 A;  3DLL F;  1X4P A;  3FXQ A;  1MBH A;  2IGM A;  2WV1 A;  4HV5 A;  4ON0 A;  2VQH A;  3VOD A;  2E5N A;  1WWX A;  2H1L A;  2XAJ A;  4IO9 F;  4HEA 2;  4Z2Y A;  2VC1 A;  4IHT A;  4KIS A;  2NYX A;  1I5Z A;  3FK6 A;  4GFB A;  1JTY A;  2LY1 A;  2QQB A;  1WJ5 A;  4HF0 A;  1W0U A;  4G7H F;  1DU0 A;  4UY8 I;  2H1K A;  3HJE A;  4BU2 A;  1AKH B;  3FBN B;  2Q2E A;  2BXZ A;  5LGT A;  1MNE A;  1FOY A;  2O3F A;  4PJM A;  3G1L A;  2DA3 A;  2A69 F;  2FE3 A;  1WJB A;  2VPR A;  3MWM A;  2VE9 A;  1XMA A;  3SDB A;  5CPR B;  2ZME C;  2RNJ A;  4BQQ A;  2YSR A;  5DCF A;  1CGP A;  4B3X A;  3H9J A;  2MSY A;  3DV8 A;  1JT6 A;  3H5N A;  2LBF B;  1V5F A;  2Z33 A;  4LG0 B;  2DA4 A;  2DOA A;  3KFW X;  2IS1 A;  2KP6 A;  3TO6 A;  4ZJZ A;  3SFZ A;  2VJI A;  4K2E A;  1FX7 A;  1FPQ A;  3V8K A;  5LFA A;  3OSF A;  4EVI A;  2WA0 A;  5IOZ A;  1BR2 A;  3DTI A;  4ANJ A;  4MTD A;  1WVR A;  2QSH X;  2ZKZ A;  3JRB A;  2GA2 A;  2JN6 A;  1P7J A;  3KP3 A;  4A3B J;  3W6K B;  5F1R A;  3JTH A;  2VKE A;  1PUF B;  1BN5 A;  3O2P E;  4MFE A;  4BJ6 C;  1SMY F;  2FD5 A;  3DEE A;  3G73 A;  3Q9S A;  2CQQ A;  4XN3 A;  3AL0 B;  4YIR X;  3ESW B;  3D5R C;  5L3G A;  3DPL C;  2X1C A;  3E6D A;  2YUS A;  5C44 J;  3PJR A;  3J7A Y;  2J5P A;  1AOY A;  4BHB A;  5BNG A;  2OCE A;  3HG9 A;  2NVT J;  1I39 A;  3VYS B;  4AYB N;  2Z2S B;  1W36 D;  2DXI A;  3FXM A;  4XON A;  2XC7 A;  2ISZ A;  2DFH A;  1HW2 A;  5B1A H;  2BYV E;  4OIP F;  1WKM A;  3RYR A;  5CVJ A;  5KCM A;  1OKR A;  5EYR A;  2FML A;  4DYR A;  2CS3 A;  4M6X A;  5E3L A;  3LSR A;  4L5J A;  4I7H A;  1W1W E;  1Y56 A;  4II2 A;  1AWC A;  2IGK A;  4B43 A;  1WSU A;  3CMY A;  2IEK A;  2ZBK A;  1K83 J;  3K6G A;  2IGO A;  4XSZ F;  2H8R A;  4KNY A;  2VOP A;  2WAQ N;  1FP2 A;  3EDP A;  2PJP A;  1HC8 A;  1FBQ A;  3BWG A;  2A61 A;  2MFZ A;  2ZB9 A;  4LLL A;  1R00 A;  1ITY A;  2E1M C;  2EV0 A;  4M3E A;  2AS5 F;  4HDU A;  1HSJ A;  3M1C A;  4IOC F;  1Y1W J;  1B72 A;  5EG0 B;  4IHV A;  1MSF C;  4AM3 A;  2V1D A;  5HS9 A;  3WGI A;  4CYC A;  2XPU A;  1QZY A;  3N97 A;  3F8C A;  2EIN H;  2K40 A;  3CP2 A;  3PSI A;  2DDA A;  1G3Y A;  2E1O A;  2X1E A;  2GBY A;  5IP6 A;  3Q0U A;  2JZY A;  3DU6 A;  2H6B A;  3TL4 X;  1KU9 A;  3BQY A;  3CCR I;  1X1A A;  2R7D A;  5CVR A;  3EUH C;  3U1D A;  1UHM A;  4XLA A;  3V42 A;  3HUG A;  4U88 A;  2P6S A;  2XGX A;  2E36 A;  4LOC A;  2ZME A;  5J4Y A;  3R0J A;  5HS8 A;  2L7F P;  1YS6 A;  1G3S A;  5KAF C;  2GA1 A;  2E71 A;  4WK8 F;  3N4M A;  1FMV A;  4CCL A;  5DS9 A;  5JVT A;  4BNC A;  4PGH A;  2H09 A;  4OWR B;  4EJW A;  2K7L A;  3M1E A;  1KZH A;  3WU1 B;  1HKT A;  3CJR B;  3CCQ I;  5K7H A;  2LNB A;  3BRO A;  3OS2 A;  3A4C A;  2XF5 A;  2A5Y B;  2VBX A;  3I53 A;  3OYG A;  4CDG A;  1S5L C;  2KLO A;  4GRI A;  2ISY A;  1BC7 C;  1MJ9 A;  2GIZ A;  4BE1 A;  4PZJ A;  2XDV A;  2Q1Z B;  4M6Y A;  4XKC A;  2DFE A;  2M7B A;  5F1J A;  2PMZ N;  3JRH A;  1R6R A;  1Z9C A;  1YRN A;  1N75 A;  3CZ6 A;  4A12 A;  5AIP A;  2DK5 A;  2KDZ A;  3BP8 A;  2NAZ A;  4B44 A;  1D0X A;  1P9Q C;  3F8N A;  1D0Y A;  1ORK A;  1IXS B;  2FBI A;  3OY9 A;  4FCY A;  4UV9 A;  4XLC A;  3E5Q A;  2R92 J;  3P9C A;  2I10 A;  4A0Z A;  1RES A;  4EGY A;  2OV7 A;  2KPM A;  3BJA A;  4PJL A;  2KDO A;  3OYI A;  3KZY A;  3DKW A;  2VKH A;  3DFG A;  1GVD A;  3HZJ A;  1XCV A;  2NVY J;  3FKJ A;  5LRS A;  2L4M A;  1B9M A;  3OOP A;  2ZXW H;  1LQ1 A;  2YPR A;  1EH7 A;  4P55 A;  5FB2 A;  3OOU A;  3HSF A;  1FMW A;  1WZ2 A;  4ABZ A;  3ZQQ A;  4F93 B;  1OYY A;  2M1B A;  3ZQI A;  1R9T J;  2GM4 A;  3GXO A;  3DBR B;  1P6R A;  3K4M A;  4UB6 C;  3TDZ C;  3FX3 A;  1UHW A;  2AQF A;  1U8B A;  3DBL B;  2ZJP F;  1KU7 A;  5IT9 K;  2IW5 A;  3I59 B;  3A2K A;  4A3L J;  2XGD A;  2Y2Z A;  2DO7 A;  4ZYD A;  3HOT A;  2CV2 A;  3HHG A;  2VC0 A; 
#chains in the Genus database with same CATH homology
 2R5Z B;  3M4O J;  2JMW A;  2LY9 A;  2IAI A;  1OFC X;  2QCO A;  4A3F J;  2AHQ A;  1WI3 A;  3W6V A;  1OJL A;  5E3M A;  3BR2 A;  3ZQC A;  3E7L A;  3MN2 A;  5K7F A;  1IV6 A;  1B8I B;  2XB5 A;  3FKI J;  1G2H A;  2R5Z A;  1WCM J;  4FE7 A;  1RKW A;  2DMP A;  1TWF J;  1IRZ A;  2Y9Z A;  3K2A A;  2HXI A;  4V2G A;  5F08 A;  2R93 J;  2CRG A;  1MBJ A;  3ZOB A;  1SAN A;  1B8I A;  3OIO A;  2FJ1 A;  4NDL A;  3ZQL A;  1HOM A;  1JTX A;  3IH4 A;  1X2M A;  3HM5 A;  2JA6 J;  1XS9 A;  2M0C A;  2L0K A;  3HKZ N;  4A3C J;  4FIS A;  1A5J A;  4FE4 A;  1ZKG A;  2DJN A;  3QQA A;  2CU7 A;  4IEJ A;  1F36 A;  1S7E A;  3BR3 A;  2MGQ A;  1FTZ A;  3BG9 A;  4XK4 A;  1U78 A;  1MBE A;  5FJ8 J;  3B6C A;  1K61 A;  2HOT A;  9ANT A;  5GPC A;  1VFC A;  1HCR A;  3BTI A;  2COB A;  1E3O C;  1IDY A;  3F0C A;  2QF7 A;  3SJM A;  2XB0 X;  1JJ8 C;  1HF0 A;  2DMU A;  3BR1 A;  1RET A;  2LLK A;  1O4X A;  3RQI A;  2ME6 A;  2JA7 J;  2K9S A;  1A6I A;  2OPT A;  2RAE A;  2LTP A;  1TWC J;  3HOZ J;  3GTM J;  3H0G J;  5JLW A;  4UUS B;  1X2N A;  2X6O A;  3WHC A;  5M5W J;  2EQR A;  1Y1V J;  2CUE A;  4DYC A;  3S17 J;  1BJZ A;  2JA5 J;  4M3B A;  1POG A;  1RR7 A;  3IH3 A;  5IYC J;  3TED A;  3TW6 A;  2NOG A;  3JRG A;  5IPA A;  5F04 A;  1H89 C;  3TP3 A;  2CUF A;  1VI0 A;  3WHB A;  4UUT A;  1JGG A;  4JP0 A;  3S1Q J;  4UUS A;  3QPS A;  5F0H A;  3S1R J;  2MG4 A;  3BQZ A;  2VI6 A;  4BBS J;  3O8H A;  3GTG J;  2G0E A;  3HOX J;  2DTZ A;  5M3M J;  1NTC A;  2FX0 A;  1MSE C;  1ETW A;  4V2F A;  3S2D J;  4JX6 A;  2DA5 A;  3G1O A;  5J1Y A;  3UKG A;  3BG3 A;  1I3Q J;  4M3D A;  4AC0 A;  1UG2 A;  2Y30 A;  4FTH A;  3D1N I;  3K7A J;  3HEF A;  3MKL A;  3BG5 A;  3M3Y J;  1FIP A;  1Z0X A;  3TW7 A;  4A3G J;  5FKL A;  1UMQ A;  3ZQF A;  2DMN A;  5FLV A;  1WGX A;  2M2E A;  2M8G X;  2HOA A;  1IC8 A;  4A3I J;  5IYD J;  4L5E A;  4A93 J;  1BA5 A;  3JR9 A;  3G1M A;  2R5Y B;  4G12 A;  4X6A J;  2DN0 A;  2NVX J;  4D5F A;  1IDZ A;  2HDD A;  5J3L A;  1EF4 A;  2HI3 A;  3HB9 A;  1BL0 A;  2HQ5 A;  1TWH J;  3S16 J;  1RPW A;  1ZGW A;  1I6H J;  4A69 C;  3JRD A;  2ECC A;  1H88 C;  2R5Y A;  3RZO J;  4X1E A;  1HLV A;  5DTD A;  1AHD P;  3HDD A;  3HOU J;  1FEX A;  4A3J J;  4BY7 J;  1JKR C;  2X9D A;  4Y7N J;  2E2I J;  1HDD C;  4MO7 A;  4B3A A;  1VND A;  4B1R A;  1P7I A;  1BW6 A;  4D7N A;  1MBK A;  1MH3 A;  2XPV A;  5GPA A;  3Q0V A;  5C3E J;  3GTL J;  3GTK J;  3PO3 J;  1T56 A;  2DMT A;  5FKK A;  3FIS A;  5GP9 A;  1HDP A;  3HGG A;  3CDL A;  2X48 A;  2FQ4 A;  1ETO A;  4D7M A;  5FKN A;  3JRI A;  4BBR J;  2E2H J;  2OF7 A;  4IHX A;  3S2H J;  3HBL A;  1I50 J;  1GV2 A;  5M3F J;  4XID A;  2HYJ A;  3PM1 A;  1MBF A;  2XGE A;  2CQX A;  4BXX J;  1FJL A;  4C2M J;  3IH2 A;  1XC5 A;  1SFO J;  3GTJ J;  3H3V K;  1QRY A;  3BR6 A;  4S0H B;  2N8G A;  5F0F A;  2K9Q A;  1JKP C;  2XGC A;  5IYB J;  1CQT A;  2TCT A;  1MBH A;  3DEW A;  2WV1 A;  4XIC A;  1NK3 P;  5JLX A;  2ELK A;  3S1N J;  3LSP A;  5IP7 J;  1APL C;  2K9N A;  2NVQ J;  2LVS A;  3Q0W A;  1JJ6 C;  4QIW N;  5EG0 A;  5HOD A;  2LD5 A;  3JRE A;  1RKT A;  3FK6 A;  1ETQ A;  1WPK A;  1JTY A;  3BR0 A;  4GFB A;  3HOW J;  4W1U A;  3BTC A;  2DA7 A;  2EZL A;  3DCF A;  2O9L A;  1AU7 A;  1W0U A;  1DU0 A;  2H1K A;  1AKH B;  1T33 A;  3JRA A;  1ZTR A;  2JWT A;  3BTJ A;  2DA2 A;  3JRF A;  3G1L A;  2DA3 A;  4W97 A;  1LFU P;  2VPR A;  2IBD A;  1BW5 A;  1AKH A;  1QVU A;  2O8K A;  3A02 A;  4XRS A;  5IOY A;  4AUX A;  2MSY A;  1ZR4 A;  1JT6 A;  2VUM J;  3FIW A;  4DYQ A;  3GTP J;  3ZQG A;  2DA4 A;  4I76 A;  2GLO A;  5IP9 J;  5C4X J;  3QPL A;  3CQZ J;  2EBI A;  4RDU A;  3OSF A;  3S1M J;  1IG7 A;  4MLO A;  5IOZ A;  3S14 J;  5J1R A;  2CJJ A;  5EDN A;  1IUF A;  2DA6 A;  2JN6 A;  3JRB A;  1QPI A;  5J1U A;  1ETX A;  5EZG A;  1P7J A;  4C3H J;  1D5Y A;  2R7Z J;  4A3B J;  2VKE A;  1PUF B;  2EZI A;  4MFE A;  2FD5 A;  1FIA A;  2DMQ A;  2CQQ A;  4MFD A;  2YU9 J;  1IGN A;  3BT9 A;  1Z77 A;  2YUS A;  2YS9 A;  5C44 J;  3NAR A;  5EZH A;  1OCP A;  1Q1V A;  2R0Q C;  3GBG A;  3S15 J;  5BNG A;  1PUF A;  1MH4 A;  2NVT J;  3BTL A;  4BKX A;  3L1P A;  4AYB N;  3OSG A;  2E2J J;  2P81 A;  3O8G A;  2L9R A;  4M3F A;  4B4C A;  2JK3 A;  1F43 A;  1MNM C;  4JYK A;  2JJ7 A;  5EYR A;  2NS7 A;  3C2B A;  1QVT A;  4DYR A;  4IHW A;  1DU6 A;  5E3L A;  3LSR A;  5E3O A;  3TP0 A;  3BR5 A;  2MW8 A;  3CMY A;  2IEK A;  5M5Y J;  1K83 J;  1B72 B;  4DW6 A;  5EF6 A;  2H8R A;  4A3E J;  5F27 A;  4MIM A;  5F0C A;  4EEF G;  2WAQ N;  4JX5 A;  4DZP A;  1WH5 A;  2ID3 A;  2WB1 N;  3NAU A;  2ZB9 A;  1ENH A;  4CYC B;  4I6Z A;  2HXO A;  1ITY A;  3A03 A;  2Y0S N;  3LNQ A;  1W0T A;  4M3E A;  2Y9Y A;  1Y1W J;  4QSH A;  2XRL A;  5FLM J;  1B72 A;  2Y31 A;  3I4M J;  5EG0 B;  4IHV A;  2E19 A;  3A01 B;  1MSF C;  5E3N A;  2ECB A;  4D5C A;  3GTQ J;  4CYC A;  1WH7 A;  3HOY J;  2XPU A;  1H8A C;  1ETV A;  2LFB A;  1JKQ C;  3MVP A;  4DZJ A;  3B6A A;  2K40 A;  1TWG J;  1TWA J;  2E1O A;  2NS8 A;  5FKM A;  2GBY A;  5IP6 A;  3Q0U A;  3GTO J;  4C3I J;  2LKX A;  3A01 A;  4M6V A;  4J19 A;  1ZR2 A;  1JT0 A;  3BQY A;  4A3M J;  4IHY A;  1GDT A;  2ME0 A;  2D5V A;  1ZK8 A;  2B63 J;  2EH3 A;  2KT0 A;  4LOC A;  3LSG A;  1JUM A;  2L7F P;  2DA1 A;  1LE8 B;  5DS9 A;  3RKQ A;  2LK2 A;  3HGY A;  1UHS A;  1YRN B;  3RZD J;  5C4J J;  1OCT C;  5K7H A;  2XPW A;  3PO2 J;  2EZK A;  1XG1 A;  3VPR A;  1VF9 A;  3HOV J;  3LOC A;  3ZQH A;  1LE8 A;  2AO9 A;  5F1J A;  2XSD C;  2PMZ N;  1IJW C;  3JRH A;  2L7Z A;  5M5X J;  1YRN A;  1GV5 A;  1GUU A;  1NK2 P;  1ETY A;  4M3G A;  1U9O A;  2LP0 A;  2M9H A;  2KDZ A;  1GT0 C;  1LFB A;  5K7Z A;  4C3J J;  1ORK A;  4Y52 J;  1MBG A;  2TRT A;  3I4N J;  4FCY A;  2R92 J;  2ID6 A;  2I10 A;  1ZQ3 P;  1ETK A;  1JUP A;  1TC3 C;  5EGO B;  1RES A;  4XRM A;  1JUS A;  3IV5 A;  3FK7 A;  3JRC A;  1GVD A;  2NVY J;  3CCY A;  1JKO C;  3LSJ A;  4A3D J;  4HNV A;  2EZH A;  3SFI A;  2JA8 J;  2HOS A;  2VKV A;  4BY1 J;  3OOU A;  4ABZ A;  4A3K J;  5EGO A;  3ZQI A;  2LR8 A;  2M34 A;  1R9T J;  2GM4 A;  1FTT A;  1U9N A;  5FKO A;  5EEA A;  1U8B A;  4RBO A;  2O7O A;  2W48 A;  2L7M P;  4A3L J;  4JX4 A;  2XGD A;  2Y2Z A;  3SDG A;  3Q3S A;  4QTR A;  4XRS G;  1X58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...