1MBGA

Mouse c-myb dna-binding domain repeat 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbgA00
1MNMC 1JJ8C 5IP6A 3BR5A 3BT9A 1H88C 2H1KA 1RESA 5E3LA 3S1QJ 1ZKGA 2DN0A 3HM5A 4D7NA 2JJ7A 4A3IJ 5E3MA 2JA5J 1RKTA 2L0KA 4C2MJ 1T56A 2P81A 2XSDC 4DYRA 5F0HA 1X2MA 3TW6A 1QPIA 2CUFA 2R5ZA 2PMZN 2WAQN 2HDDA 2AO9A 3JRBA 4FISA 3A01A 4I76A 4BXXJ 3TEDA 2DMPA 4BY7J 2IBDA 1B72A 5EZHA 2HOAA 2XGEA 2JK3A 4B1RA 3ZQLA 1SFOJ 1FEXA 3FK7A 5GP9A 2CUEA 4FE4A 1ZR4A 2NVYJ 2ZB9A 2TCTA 3SJMA 1LE8A 2L7FP 5M5XJ 5FKOA 3HKZN 3SDGA 1VNDA 5FLVA 1G2HA 2XPVA 1JKOC 1WH5A 1U9NA 1RKWA 1WI3A 2RAEA 4G12A 5EYRA 3HOZJ 1MBKA 1QRYA 2G0EA 3ZQGA 2JA6J 2NS8A 1ZGWA 1P7IA 4IHWA 1EF4A 2NVXJ 5M3MJ 2Y0SN 5EG0B 2ECBA 4IHVA 5JLWA 4V2FA 5F08A 1E3OC 3JRCA 3LNQA 2X48A 1ZR2A 4M6VA 3G1OA 3MKLA 1MBJA 5J1RA 4XK4A 1IV6A 2DJNA 1ZQ3P 4UUSB 1VI0A 3I4MJ 2LP0A 3PO3J 3H0GJ 2DA4A 2X6OA 1RETA 3QQAA 4M3EA 1MSFC 3JRGA 3HOXJ 4D5CA 2XRLA 3K2AA 4XRSA 1FTTA 2HYJA 4L5EA 4UUTA 9ANTA 1W0TA 2JMWA 3LSJA 3LSRA 3DEWA 4MFEA 3SFIA 3ZQIA 3O8HA 2DMUA 1MH3A 1HDPA 1FTZA 5EG0A 3S1NJ 3IH2A 1POGA 2ECCA 2EZKA 3FKIJ 4BBRJ 4AUXA 3C2BA 1JT0A 5K7ZA 1AU7A 4B4CA 4UUSA 3HBLA 1K61A 1WGXA 2K40A 4JX4A 4W1UA 3GTQJ 1UHSA 4HNVA 5C44J 2Y9YA 1ETYA 1OCTC 1AHDP 4I6ZA 2N8GA 2R5ZB 2XB0X 2CU7A 3IH4A 2LTPA 4S0HB 4X6AJ 3GTGJ 3S15J 1ORKA 2EZLA 4BKXA 3JRHA 3BR6A 3JR9A 5FKNA 4A3FJ 3TW7A 5GPCA 4ABZA 3LSPA 5EEAA 2R93J 1IC8A 5EGOB 2AHQA 2VI6A 3GTOJ 1XS9A 5E3OA 5M5YJ 2KDZA 1LE8B 3GTMJ 3CQZJ 4A3DJ 4V2GA 3TP3A 3WHBA 5IPAA 5FKLA 3JRFA 3S2DJ 1ETKA 3Q0UA 3LSGA 2LK2A 3GBGA 4W97A 4XRSG 1LFUP 1S7EA 4FTHA 3JRAA 1Q1VA 2R5YB 1GV2A 5M5WJ 1OFCX 4QSHA 1ETVA 2B63J 2D5VA 5K7HA 5IP9J 4C3IJ 5C4JJ 1BL0A 4DZJA 2R7ZJ 5HODA 1BJZA 2CQQA 4X1EA 1JJ6C 4BBSJ 4A3BJ 4XRMA 4XIDA 1ZTRA 2O9LA 5F04A 1TC3C 1IUFA 2IAIA 3IV5A 1IG7A 1IGNA 5EGOA 2LR8A 4DYQA 2E1OA 2FQ4A 2HXIA 3G1MA 2Y2ZA 3GTKJ 3QPSA 2VUMJ 2LKXA 2Y31A 2MG4A 4MIMA 2L7ZA 2LFBA 2FJ1A 2R5YA 2EQRA 2HOSA 3BR1A 3A03A 2QCOA 3RQIA 3HGYA 1Z0XA 4Y52J 2EZIA 4EEFG 5C4XJ 1TWCJ 3FK6A 2ME0A 1U9OA 1QVTA 3D1NI 1I6HJ 2JN6A 1MBHA 5FKKA 1JUMA 2M8GX 1O4XA 2WB1N 1JGGA 5EF6A 5JLXA 1H8AC 2FX0A 3BTLA 3BTCA 1Z77A 3CMYA 2L9RA 2DA5A 2DA2A 1X2NA 3UKGA 1XC5A 3H3VK 2M0CA 1B8IA 1PUFA 2O7OA 3OIOA 1T33A 4J19A 5IYCJ 2LD5A 1IDYA 2DA1A 1JTXA 3Q3SA 4C3JJ 2HXOA 1GT0C 3O8GA 3JRDA 2OF7A 3S14J 3PO2J 4M3FA 2CQXA 3OSFA 1HLVA 5IYDJ 2CJJA 1MBEA 4D7MA 3S16J 2OPTA 4QIWN 2I10A 4A3KJ 3RKQA 5DTDA 4A3LJ 2YUSA 3IH3A 1TWGJ 4A3CJ 3CDLA 2HOTA 2Y30A 3B6CA 1R9TJ 1HF0A 2DTZA 1JUSA 4FE7A 5IOYA 5FJ8J 1MH4A 2JA8J 5BNGA 3WHCA 3HEFA 1SANA 1H89C 2VKEA 1RPWA 4M3BA 2GBYA 2K9SA 4LOCA 1FJLA 1NK2P 4FCYA 3BG3A 1IDZA 1BW5A 1GUUA 2CRGA 2E2JJ 2ID6A 3M4OJ 2L7MP 2O8KA 4MLOA 2NS7A 3GTJJ 4CYCA 1OJLA 4B3AA 3HOVJ 1ETOA 2K9QA 2KT0A 1P7JA 4XICA 3Q0VA 1APLC 5EZGA 5J1UA 2W48A 4D5FA 4BY1J 2QF7A 3K7AJ 4DZPA 1JUPA 2MGQA 3ZQCA 1MSEC 1JKQC 3CCYA 1CQTA 4MFDA 2FD5A 1JKRC 2LY9A 3FISA 3L1PA 3F0CA 5FLMJ 4A3JJ 2K9NA 2H8RA 4JYKA 4JX5A 2WV1A 2DA3A 3HOUJ 1I50J 2XPUA 2YS9A 2R92J 2ELKA 3NARA 5IP7J 2E2IJ 2COBA 2GM4A 1MBFA 1Y1WJ 1W0UA 3BG5A 3HGGA 3ZQFA 4A69C 3JRIA 1FIAA 1ETXA 3A02A 1JTYA 1IRZA 2M2EA 2M34A 3GTLJ 2NOGA 1DU0A 1HCRA 1UG2A 3S17J 3BTIA 1TWFJ 2DMTA 2LLKA 2XGDA 1B8IB 5C3EJ 2YU9J 1PUFB 2EBIA 3HDDA 1JT6A 2EH3A 1ENHA 5FKMA 5F1JA 5IYBJ 4NDLA 3S1MJ 1F43A 1RR7A 3JREA 1MBGA 1BW6A 3ZQHA 2HQ5A 1GV5A 1GDTA 4IHYA 3I4NJ 1UMQA 2LVSA 3OSGA 5K7FA 2E2HJ 3S2HJ 1I3QJ 1ETQA 2XB5A 2JA7J 2ME6A 4Y7NJ 4DW6A 1VFCA 2ID3A 3E7LA 1ETWA 2VKVA 2Y9ZA 1U78A 2DMQA 1BA5A 2NVTJ 5DS9A 1WCMJ 1YRNB 3ZOBA 2VPRA 3G1LA 1WH7A 1HDDC 3HB9A 1AKHB 1HOMA 4M3DA 5F27A 4RBOA 3Q0WA 3S1RJ 1DU6A 4IHXA 4AYBN 3RZDJ 4DYCA 1NK3P 3VPRA 5GPAA 5F0CA 5IOZA 4CYCB 3OOUA 3QPLA 3BQZA 4A3EJ 3HOYJ 4IEJA 1Y1VJ 2HI3A 2JWTA 1X58A 2R0QC 3BQYA 3FIWA 5J3LA 4C3HJ 3W6VA 4MO7A 3RZOJ 2DA6A 2IEKA 3B6AA 3BR3A 3DCFA 5M3FJ 2DA7A 4GFBA 2E19A 4RDUA 2NVQJ 2DMNA 1D5YA 1FIPA 1TWHJ 1YRNA 3BG9A 1U8BA 1WPKA 4A93J 1GVDA 1AKHA 1JKPC 2GLOA 3BTJA 1VF9A 3BR2A 1K83J 2M9HA 2XPWA 1QVUA 4AC0A 2MW8A 1LFBA 1IJWC 5EDNA 1TWAJ 4M3GA 2TRTA 4QTRA 3LOCA 4JX6A 3MVPA 1F36A 5E3NA 4A3MJ 1A6IA 3BR0A 3NAUA 3A01B 1NTCA 2X9DA 5F0FA 2EZHA 5J1YA 3M3YJ 3GTPJ 3HOWJ 3PM1A 1B72B 1ITYA 1OCPA 2XGCA 2MSYA 3MN2A 4JP0A 4A3GJ 1XG1A 1ZK8A 3TP0A 1A5JA
chains in the Genus database with same CATH superfamily
1TP4A 4C30A 1MNMC 3PFIA 2G9WA 5IP6A 4DQ2A 2VC1A 3KX2A 3CF5F 2L9SA 1RESA 5E3LA 2DI3A 3R61A 4U7BA 1W5TA 4D7NA 2HDCA 1OCCH 2JA5J 1XCBA 4AVZA 1ERDA 2KL4A 4C2MJ 2IS2A 4N9IA 1T56A 2V1XA 1WFXA 1XGSA 3KE2A 5F0HA 2XSDC 1NG6A 4CCNA 2A6HF 1V55H 2CUFA 4LK1F 2PMZN 4ZTFA 2JRTA 1YLFA 4OINF 1IW7F 3ZCOA 2VBYA 3A01A 4PUSA 4BHBA 4BXXJ 4XKWA 2X6YA 2XAFA 3WU0A 4F3QA 4RGSA 4BY7J 2FE3A 1B72A 2B0LA 2HOAA 4B1RA 2JK3A 2D45A 3BJ6A 4FE4A 2Z2SB 2E1CA 5E17F 2NVYJ 2F5VA 3DPTA 4R8HA 2NXNB 1LUJB 3FZVA 2IPQX 4P9UA 4FX0A 4JQFA 5CVUA 2IA1A 2KIMA 2DFFA 5AIPA 3B02A 3ASNH 1U9NA 4CXFA 4CHUA 1O57A 4EM2A 5J8FA 2H1LA 4RAYA 1YHQI 1MBKA 2CV0A 2MBFA 2M1BA 2G0EA 4I02A 2V6CA 2JA6J 1DPUA 3CLOA 4IOCF 2NVXJ 3MWMA 2BZTA 5KVRA 3T8TA 3LNQA 1ZG3A 4XSZF 1J75A 5KK1A 3EYIA 3OYLA 3JAMZ 2MH9A 2F4OB 4XK4A 1HXDA 1SVMA 4UUSB 4A6DA 2VOPA 3I4MJ 4A0YA 1FBQA 1G3TA 1TQMA 2KLOA 2X6OA 2Y69H 3E97A 3OYMA 2OQRA 3NRVA 3DKWA 3HOXJ 2QBYB 4CYDA 2HYJA 4L5EA 5CJ9A 4UUTA 3W6KB 2R7UA 3EUHA 1YYVA 4HX8A 2HKXA 1STZA 2JMWA 3H5RA 2P6TA 5DEQA 5TJJA 5LGUA 3QOEA 1WRJA 3BJAA 2EIKH 1HDPA 1A31A 3OL4A 1N25A 2WY8Q 5FFZA 3OYAA 2FRHA 4EM0B 3S1NJ 2DTRA 1BI2A 2KMUA 3OS2A 4GXOA 4PCQA 2ECCA 1JT0A 3AL0C 4UUSA 2K40A 4JX4A 5DD4A 4WCGA 3ZGKA 2CGPA 1T95A 2R7FA 3OV8A 3J80K 3PQKA 3G6EI 2N8GA 3D0SA 3IH4A 3HKZA 2LTPA 4S0HB 2I8DA 2P7CB 1QA6A 4D9JA 3S15J 1ORKA 4G7HF 2EZLA 5BS6A 5HOOA 3ZXSA 3ABLH 1KU3A 4B43A 5EEAA 2DYRH 5F1RA 3VSKA 3SHFA 4CICA 1B9MA 2VI6A 1MMSA 4YG2F 3HSEA 1FC3A 2KDZA 2IS6A 4A5NA 2M7AA 2BY3A 1IF1A 4E7SA 2Y48A 5FKLA 3JRFA 1HA8A 2HVQA 5L3GA 1LKXA 2LK2A 4PFOA 5B66C 3OYJA 3JRAA 2XF5A 1GXQA 1OFCX 2W84A 2R7SA 3ECHA 4E7JA 1B6AA 2B63J 4JOMA 2RV8A 5HS8A 5LHGA 2CG4A 2OD5A 5C4JJ 3E5XA 4M9XA 1BL0A 2CS3A 4N4NB 5B5EC 1BJZA 2COMA 2LC2A 4A3BJ 1Z21A 1ZTRA 1FOYA 2O9LA 5F04A 4LIVA 2IAIA 2PX9A 3VYTB 4U0VA 4MGRA 1Z6TA 4BACA 1WKMA 1D1CA 3T0YA 2HXIA 1MZBA 3VB2A 3GFIA 2PJPA 4XBFA 3A1YA 2M7BA 4KNYA 1FYLA 2CWEA 4BDZA 2E71A 1R1VA 3I0TA 1W5SA 3H35A 3BR1A 1X1DA 3WGHA 3KP2A 2X0LA 3HGYA 4Y52J 2V26A 3U21A 4BQQA 4RLQA 4EGYA 4KFCA 1AOYA 3TQNA 2VJ4A 2X6WA 2K27A 1TWCJ 4I0BA 1U9OA 4U87A 3HPHA 1IN4A 3WTSC 2GXBA 4LIUA 1PVEA 1JUMA 1OCZH 3J7AO 1O4XA 3Q9SA 1KQ0A 2A5WA 2FX0A 4HOBA 1R00A 3BTCA 3CMYA 1PP8F 4HZFA 4OMYA 4IHTA 2DA5A 1R5ID 1X2NA 1ZARA 2DA2A 5CVRA 5FLXK 1E2XA 3UKGA 4KDPA 2FU4A 1B59A 2JA2A 1XC5A 1SD6A 2WBMA 2VQLA 1QGPA 1I1SA 4J19A 1D0XA 2LD5A 1MKMA 2LKSA 4I01A 1OYWA 2CFOA 3Q3SA 4C3JJ 2IRFG 4Y13A 3EDPA 1T2KA 2PMZA 2Q2EB 1WI9A 3O8GA 2EFPA 2FXAA 2EK5A 3S14J 1BJAA 1X3ZB 2HEOA 1QZZA 1IRGA 2Z16A 4ZZLA 3RCOA 2E5NA 2VKHA 4F52A 1YIOA 3IWZA 5DUIA 3QPTA 4A3KJ 5A2QK 1U8RA 4A3LJ 2ZJQF 2M5WA 3IH3A 4EJUA 4G6QA 3CDLA 3CCQI 3LMMA 4LLGF 3TKYA 2KZGA 1K6OA 4XOPA 1JUSA 4CO8A 3J7YJ 1TQIA 4EJOA 5GAGJ 2IXSA 3DBRB 5IOYA 2JRMA 4Y3OA 3J7AY 3WHCA 3RIRA 1H89C 3RPUD 2VKEA 1F1ZA 1RPWA 4LOCA 2QENA 4ESJA 1SD5A 1RI7A 1IDZA 4XRFA 1BW5A 1ZG5A 2LH9A 2ID6A 2W00A 3M4OJ 3CJRB 4MLOA 3F8NA 2EFQA 1EJ9A 2VJIA 3FMRA 4YFKF 3ABUA 4B3AA 1FNNA 2KT0A 1ZG1A 1P7JA 2M3AA 2JVGA 2Q2EA 5ILUA 2M8EA 2HZDA 1WJFA 2XKPA 4KN7X 3LQRA 2V9PA 2B9SA 1MSEC 3ZQCA 3NWSA 4PZJA 4C9YA 3CMAI 1F9NA 3TDUC 4WXHA 2XKOA 4BAYA 4RM2A 2H27A 3MFKA 3HG9A 4QLCU 1S3JA 1WWXA 4A3JJ 1I6XA 3BWGA 3E6BA 1ZHFA 3LSKA 4J00A 3PSFA 2XPUA 3LSMA 2HGCA 2RVCA 2YS9A 3DF8A 4F91B 1IN6A 4EJWA 3NARA 2LMDA 2E35A 5IP7J 2UWMA 3K1NA 2OJED 2QKLB 2ZJPF 3CD6I 1P92A 2M4GA 1QU3A 1JTYA 2KRFA 5BMZA 2V1DA 1DU0A 2UXNA 1AA7A 1ON2A 3IKVA 5IT3A 2LLKA 3CCEI 1SFEA 2IP2A 4K2EA 1S29A 2XGDA 3GEZA 2EA4A 3OYFA 5C3EJ 3AG4H 2YU9J 1PUFB 4MTEA 1GHCA 3R0JA 5AONA 4M74A 3HTSB 2E36A 1BR4A 2QQBA 1WJ5A 2Z99A 3S1MJ 3M8FA 5CYVA 2DQRA 1BW6A 1O3SA 1OLTA 2DJIA 4L5IA 1V5EA 4L0YB 1YW7A 2XHKA 3WTYC 1X4PA 1VQKI 3Q9VA 1PUEE 2X1CA 1I3QJ 1ETQA 2XB5A 1VFCA 3WTVC 3E7LA 4HDUA 1ETWA 2AQFA 2XUBA 2EFNA 4IX7A 2QGUA 1K78A 3OR1C 3ABMH 1A6QA 1WH7A 5FD6A 1HDDC 3HB9A 1AKHB 1FOKA 1HOMA 2GZWA 2UV1A 4RBOA 3Q0WA 2XAJA 2EA2A 2WA0A 2ISZA 3HOSA 1DQUA 1KU9A 4IHXA 2YR2A 1VQLI 2V9VA 4XKVA 4A5MA 2CQ7A 2LSOA 3VPRA 3VOEA 3PIPF 2V1NA 4UB6C 3AG1H 3FX3A 3LWFA 5GPAA 5ILSA 3LFKA 4NHJA 1DGWY 5KNLA 2VBXA 2F5EA 4RB3C 4IEJA 4RMNA 2HWVA 2JWTA 3P9IA 3QYEA 2HPIA 2O8XA 1XD7A 4MO7A 3RZOJ 2MLGA 2EFOA 2IEKA 3QP6A 4LB6B 3J80Z 4GFBA 2XF7A 1UHMA 3VYRB 2E19A 2NVQJ 2DMNA 4G7OF 1CF7A 5IT9K 2QUFA 4BUPA 3MQ0A 3F8BA 4IL6C 3HOTA 2E7XA 3HHHA 2L2OA 4XONA 3ZPLA 4XKCA 4BYYA 1AKHA 3KEOA 2V4JC 3BTJA 4CCLA 1K83J 1GVJA 2IT0A 1FSHA 4P5OA 4IHSA 1QVUA 4O5VA 2R7RA 1LFBA 4OIOF 3N05A 1UHWA 4LGWA 1TWAJ 3MAJA 5HS7A 4DJAA 3WGIA 1D8JA 3MMYB 2TRTA 3LOCA 3T1BA 2GXAA 1F36A 2F4MB 3H9QA 3TO7A 1Z1DA 2VB6A 1FYKA 1U5TC 2XV4S 3V7SA 1G3WA 4BDYA 3LSHA 4ON0A 1X1CA 2P7VB 4Q4ZF 3SZTA 4L9VA 3F22A 4PK4A 3PM1A 1ITYA 1OCPA 4XL9A 3WODF 4JP0A 1LDJA 1A5JA 1Y6IA 1JJ8C 3HRMA 1XMAA 2EINH 3T8RA 1DP7P 1QPMA 3LL7A 5LD2C 2JJ7A 2XDVA 1FSEA 1XGMA 3UR3C 1BIAA 1V4RA 1FOWA 3BY6A 2QKMB 2KRCA 4DYRA 3SZGA 1X2MA 2BW3B 1QPIA 2R5ZA 2XAHA 4KIFA 1TT5B 2AO9A 3MZ8A 3JRBA 1T98A 1Z7UA 2BHZA 2DT5A 2HTSA 4DOZA 2Z5UA 1L3LA 2OCCH 2X6XA 4GGGA 3TEDA 1ZLKA 4C2TA 5HS9A 4MQ9F 4KISA 2IBDA 1Z9CA 2EV5A 2FEZA 2HU9A 5EZHA 5DYMA 1SFOJ 2EFWA 4UY8I 2VQHA 3DV8A 3DBLB 3CUOA 2W25A 1W36D 3SJMA 1MJAA 4IQJA 5M5XJ 3SFZA 4XN3A 3HKZN 3SDGA 1VNDA 2A69F 2VONA 1G2HA 1IRXA 4YIRX 4OIQF 1WH5A 1X1PA 3R0AA 1VQ5I 1W7PB 5DD8A 1FBSA 2DDAA 2E5ZA 2XASA 3GFLA 2OBPA 5D5XB 1RKWA 5FLXZ 4G12A 4Y15A 1D0ZA 1P2FA 2KRHA 4PSWA 4XORA 1ZGWA 3IC7A 1P7IA 4IHWA 3F9KA 2BW3A 3V8LA 5M3MJ 3ELKA 4IHVA 4UUVA 3GX4X 3BZKA 1B4AA 5F08A 3GLXA 2CV1A 2JUGA 2BEOA 4IRHA 1S5LC 1SVLA 4KITB 4M71A 1MBJA 1IV6A 1ZQ3P 3O2PE 1VI0A 1EH7A 1FMVA 2XROA 2KIUA 2LP0A 4D0PA 4AIKA 2A05A 1KYZA 1WVRA 3IKTA 1I27A 3OOPA 5JVGF 3RI4A 2X1EA 2BGCA 2HVRA 1RETA 3QQAA 3OYDA 2ZBKA 2KP6A 3H36A 4D5CA 2XRLA 1RZ4A 4XRSA 2NNYA 2STWA 1W7PA 2MC3A 1W0TA 4DBRA 1E17A 2R7WA 3GF2A 3LSRA 2JT1A 1Z7LA 4WXCA 3DEWA 3OIPA 4MFEA 5KAFC 4ENNA 2OQGA 1FTZA 1MH3A 3FBNB 1VQ8I 2WAQA 1VQ6I 3I55I 1BI1A 2K86A 2BV6A 3DKYA 3H5AA 2BVLA 2F6CA 3IH2A 5HNHA 2IS1A 4KA4A 1VQ7I 4E7HA 4GYGA 5ED4A 3VODA 1TTYA 4W1UA 4ENKA 1G4DA 2IGKA 2KPMA 4ZYAA 4NNJA 2A68F 4I6ZA 4LMYA 2CU7A 3L9FA 5DCFA 1T6SA 3FWEA 3EQLF 3LAJA 2JQ7A 2HNHA 1YTYA 3QODA 1OISA 4B09A 5FKNA 3TW7A 3LSPA 2PBIA 4U0WA 1IC8A 3SZPA 2EIMH 3KEQA 1H9GA 4CGZA 3WTTC 5M5YJ 2NNNA 1FPQA 2VASA 3OY9A 1J2XA 3CQZJ 4A3DJ 3I5UA 4WXDA 4ZYDA 2ZFWA 1H9TA 4HNUA 2W85A 3DPUA 1ETKA 3WTXC 3Q0UA 3S3NA 3GBGA 2NVUB 3QYFA 1S7EA 4FTHA 2O03A 2MD5A 2DODA 1GV2A 3MKYB 3RQ4A 3HYIA 3WE2A 3FM5A 1UG0A 2D5VA 5K7HA 3GYHX 5HNFA 3RKWA 4B3XA 5HODA 2CQQA 4WX9A 2L4AA 4XLCA 3EUKL 3GXOA 5ERIA 1JJ6C 4BBSJ 1B9NA 1IUYA 4HBLA 3LQQA 4ENMA 1P4WA 1TC3C 4U0YA 1IUFA 3N97A 1IV8A 4UV8A 1HW1A 5ICEA 2LR8A 5BPIA 3BOQA 1TLHB 2E1OA 3RKXA 3BZ6A 3DTIA 3BZCA 3CUQB 3D5LA 1HBXG 2VKDA 3BC8A 2K3FA 2KIQA 2OUMA 3I4PA 1YO5C 2VT2A 3E6DA 2VE9A 5J47A 4MTDA 4P96A 2Y31A 1XSXA 2MG4A 4MIMA 2L7ZA 3CESA 4AU7A 2FJ1A 2EQRA 3E3VA 4NUBA 2HOSA 2J5PA 3KLOA 3A03A 2JZYA 3RQIA 2H6CA 1Z0XA 4KMFA 2BY2A 3OMYA 3AAFA 2ME0A 1Y0UA 2FMYA 3F23A 3N4MA 1QVTA 2HKOA 1OR7C 3RDIA 3D1NI 1I6HJ 2IW5A 1ZELA 2DOEA 1O7LA 2QA4I 5CVVA 3IHUA 3LSTA 3BTLA 1R22A 5E1XA 4C2UA 1Z77A 3ZMDA 5AIQA 1I5ZA 2IA2A 2R4GA 3CLQA 3CUQA 4P55A 2LREA 3CCMI 1WJCA 2DU9A 3H3VK 3KYCB 1B8IA 4CZZA 4XN0A 3K69A 2L3DA 2DO7A 1IDYA 3QU6A 3PUFA 5DM6F 1LEAA 1JTXA 1GLNA 3K10A 4KT6A 3EYYA 2L01A 4Q5SF 3BJOA 3W6JB 5D8LB 3DFGA 5FO5A 2STTA 4ZZDA 1GT0C 3IAM2 5KHDA 1KA8A 1D8KA 3ABKH 2DFIA 4XKBA 4YELA 3S93A 2EV0A 1ON1A 3M1EA 1BI0A 3OSFA 2CJJA 2JSPA 3GFJA 4LK0F 2OPTA 3K1PA 5GAEJ 1R1UA 2RQQA 4HG2A 4XLEA 2R7TA 3IWFA 2Y30A 1YX3A 1P4XA 3GMEA 5LLQA 4FE7A 3MZYA 3GZ6A 2I5UA 4BNCA 1NG7A 3G4SI 1VZ0A 4ZYHA 4IOAF 1SANA 2FQ3A 2LY2A 4Q48A 1LEBA 1XTAA 2F5DA 2BBYA 4M3BA 1K79A 4PGGA 2A6TA 4EJTA 3M8EA 5E1ZB 1RRJA 2DW4A 2K5CA 2QQ9A 2E2JJ 1V5FA 2L7MP 2H94A 1OJLA 5BOXA 2BVMA 1ETOA 2CYYA 2K9QA 2KDOA 1D1AA 4P9FA 4L9TA 1ZRCA 4G6TB 1WJDA 3DLLF 5DM7F 3CCLI 4XICA 3Q0VA 1APLC 2ZCWA 1IN8A 2W48A 3NWTA 4BHCA 1Z67A 5DDGA 2QF7A 1SEUA 1PDNC 1MMNA 4G7ZF 3CC4I 3K7AJ 1G6NA 1BIBA 2H8WA 3PJRA 4IJAA 3M07A 1KZHA 1RNLA 2M4KA 1KYWA 1ONVA 3QPHA 4RB1A 1R23A 3FISA 5FLMJ 4HAMA 2PMHA 2H8RA 4JX5A 3L2QA 2WV1A 2DA3A 1LVAA 3R4KA 2FNAA 3G71I 2KKOA 1F5TA 1HW2A 2ELKA 2A3SA 2COBA 3OIQA 1O3RA 1MBFA 1MMAA 1KGSA 4FT8A 1YG2A 3BG5A 1NH3A 1XDUA 1OCOH 2O6GE 3K4LA 1IN5A 4KMUX 1VTNC 2X1DA 2NOGA 1HCRA 1UG2A 2ZMEC 3ISPA 2LRDA 4DBQA 2D1VA 2VQGA 3KEYA 1VQOI 3C1DA 3HDDA 1LNWA 1JT6A 2H09A 2EH3A 3FKJA 1ENHA 2KQRA 5E20A 2PMUA 5FKMA 1D0YA 3FDYA 1SFXA 1RR7A 3JREA 3F21A 4E7IA 1SMYF 1F43A 3K4BA 4ZJZA 4PJ0C 2ETHA 1XMXA 1SD7A 1GDTA 2HFHA 2P6SA 1NHAA 5GTHC 1ULYA 2CW7A 2LVSA 4HDVA 3OSGA 3RYPA 5K7FA 1MJBA 5D5VB 3S2HJ 4CCJA 2MC4A 1ZREA 2V1UA 5LEJA 4HX4A 2CUJA 2XSJC 4BJ6C 2ZXWH 1IZ1A 1R6RA 2VKVA 3HL2A 2Y9ZA 1U78A 1BR1A 1F4KA 3WTZA 1LVKA 3V7CA 5DS9A 4ENJA 2VPRA 5DUKA 5HDGA 3A2KA 4ZDOA 4B47A 2V7FA 2ZSIB 3IL2A 2OU2A 2IA0A 2UZKA 2K7LA 1R49A 1RUOA 3L2UA 3OYHA 2F2EA 4MQVA 2DXIA 1DP3A 4Q47A 3E6MA 4QPOA 2ZNYA 4UHTA 3SXYA 2XAQA 3QPLA 4QWQA 4FHTA 3AL0B 4S05A 3F6VA 2HYGD 4YEJA 3Q5FA 3BQYA 3ERED 4WK8F 2YX4A 4ASNA 3VWBA 1Z3YA 1QHHD 3GFMA 3M1CA 3BR3A 2ZNZA 2ZJ2A 3KZYA 4ZH4F 4UVBA 3SQNA 1D5YA 2CMPA 1TWHJ 4X0GA 2EIJH 3MCZA 4OIRF 2B7EA 3G73A 3BG9A 2ACJA 3H9GA 1GVDA 1Z6RA 2PJRA 3TOBA 4F92B 3FHZA 3GZ5A 5F64A 3ZMTA 1JKPC 1L0OC 4BXUA 1VF9A 4G6DA 1FYMA 5L3FA 2L5QA 3B73A 1IJWC 1KONA 2R7XA 5EDNA 3W2VA 2GXGA 4RGUA 2CW8A 1K4SA 4JX6A 3E1SA 2E1NA 3HTUA 2QSGX 3RSNA 1U0JA 2ELJA 2HZTA 1A6IA 1W4MA 2MA3A 2WAEA 4N0BA 4HF2A 3DWLE 4OIPF 5FRMA 3JSOA 4OAYA 2FNPA 3HRTA 3LA3A 2R7OA 2X9DA 3FXJA 2EZHA 5J1YA 3M3YJ 3K4CA 4RB2C 3GTPJ 2LF7A 3HOWJ 2ZSHB 3OS0A 3DTEA 2MSYA 3I71A 4LD5A 3L2WA 4A3GJ 2FF4A 2ELHA 3JCUC 2M0MA 3HC7A 4MEXF 1UB9A 3BR5A 2LBFB 3L09A 4AIHA 1G3SA 3QU3A 1SFUA 5K5QA 4AYBA 5FB2A 1O3TA 2GA1A 3PNTA 3P9CA 2E1MC 3CJNA 3CCRI 1K78B 4UB8C 5TGTA 2L9VA 2GQQA 3NQOA 4BE1A 2VODA 4NC7A 3GUDA 4XQFA 2P81A 2W4SA 4EVIA 2DT7B 3TW6A 2HQNA 2Q0OA 4UV9A 2DPDA 1OMIA 2WAQN 2HDDA 2VBWA 2W1OA 2PEXA 4CCMA 4BEHB 4HNTA 1YS7A 4FISA 3H92A 1R5HA 4I76A 2DMPA 4M72A 2OAZA 2P5LC 1IAWA 2LY1A 2XGEA 3I54A 2QVOA 4BXFA 3FK7A 5GP9A 2CUEA 4RAGA 2YU3A 3T5XA 2G7UA 1ZR4A 1C0WA 2P4WA 2OA4A 2OTLI 2EB7A 2KIFA 1HSTA 5L3BA 2LBFA 2TCTA 1LE8A 2L7FP 4HRIA 1IN7A 5FLVA 2XPVA 1JKOC 1S7AA 3FXOA 3ZP5A 1EH6A 2AS5F 3WTWC 1WI3A 2RAEA 1CF7B 5EYRA 1KQ8A 4XMYA 3GW2A 2D1HA 1QRYA 3COAC 4BGDA 3CCSI 1S6LA 2WV0A 2MABA 3KP5A 5LHHA 2ECBA 1I39A 3ZRGA 4EM1A 1E3OC 3BCBA 4BEHA 2X48A 2XVCA 4IVNA 1ZR2A 3G1OA 2OZ6A 3J81K 2L9NA 1FOXA 5HLGA 5J1RA 2RNGA 4N9HA 2DJNA 3PUBA 2HQRA 3K1MA 2VN2A 3PO3J 4L9JA 2P0WA 2E7WA 3M8JA 2XF6A 2DA4A 4AIDA 2HVSA 2LOOA 3WU1B 2ZC2A 3FXUA 1YQAA 2IGOA 1OKRA 1MSFC 2OCEA 3J7ZI 2JUCA 1FTTA 2WY7Q 2RQPA 9ANTA 2PQ8A 2BYVE 3TMOA 5GTIC 4V19K 3BROA 4WF2A 4EJVA 4Z2YA 4AIJA 3WU2C 2F4IA 3KETA 3HZJA 4DNCA 3O8HA 3JAMK 2VT3A 3GLLA 1TW3A 3L2RA 2DYSH 1N75A 1S8NA 2L7KA 1O3QA 2KZVA 5H6RA 3HRSA 3AG3H 1XSVA 3I59A 4KT5C 4CUGA 4TV7A 5K7ZA 2K3PA 1OCRH 3K4NA 1AU7A 3AFHA 1WZ2A 1J9IA 1K61A 2FBIA 1WGXA 2WWYA 3GTQJ 4HNVA 3CJQB 2Y9YA 1B1BA 2BY1A 4YIIA 1OCTC 1AHDP 1VQNI 4EATA 2R5ZB 2XB0X 3HJEA 1BC8C 4X6AJ 4BHPA 1HKQA 1TZLA 4A0ZA 3EUAA 4F55A 3CC7I 4ANJA 2DPUA 3BR6A 1YOVB 4A3FJ 2EWNA 3LA2A 4ABZA 1Q1HA 4OU0A 4NBQA 5EGOB 5D8KB 2AHQA 2WC2A 2Y0SA 1XS9A 3CMEI 4WWCA 1E3PA 1Z3XA 3F8CA 4GCVA 4A12A 3GTMJ 1PJRA 4PJNA 2DOFA 1UFMA 2AXTC 3TP3A 2KJCA 3WHBA 5ILVA 3JTHA 3RYRA 3S2DJ 5CPRB 3MKWB 4I99C 3C2GA 3SEQA 4XRSG 3E0JB 2GA2A 1Q1VA 1JE8A 3FMSA 2NOJB 3W2WA 4XLFA 4QSHA 1ZN2A 4KYWA 4RGRA 2FUG2 3CCJI 1D1BA 5D5WB 3AKZA 4L9NA 2NAZA 5HLHA 3ULQB 1QO0D 2WADA 1HQCA 3GO5A 4Y17A 3PFYA 1EKEA 2R7ZJ 4RAFA 4IQ4A 4X1EA 4A0XA 2BXYA 2ZXJA 2OV7A 5D4SA 1TQPA 3BG6A 2JPCA 3FF5A 3IV5A 4NC6A 5EGOA 4E6KG 3C3WA 3V42A 3ZN1A 5HVQC 1G8XA 4XR6A 2FQ4A 2K85A 3MEXA 2K9MA 1KU2A 1BBYA 2Y2ZA 3QPSA 2VUMJ 3CMMA 2LKXA 2XRNA 1ZLJA 3TDZC 3JTGA 1A04A 1J5YA 2E60A 4BE0A 1S9HA 4IRGA 1TNTA 2P8TA 1MDMB 5C4XJ 3TL4X 3MZHA 2MH2A 4M9SA 2XAGA 2R7DA 4AM3A 1MBHA 3GVAA 3DBHB 2O5RA 1MJ9A 1JGGA 3BDDA 4E70A 1H8AC 3S3OA 1DGRM 2M87A 2X85A 4NQWA 3EUHC 4BJTA 5A2QZ 3A0BC 1JHFA 1TW2A 2M0CA 3DXJF 2F5CA 5JI6A 4B48A 1OYYA 3JSPA 3OIOA 1OQYA 1T33A 3OL3A 5ICGA 2DA1A 4M6XA 2GOXB 3PNYA 1J59A 4E7KA 3EETA 2MYSA 2LKPA 3F6OA 1T39A 1MDMA 3JRDA 3BG7A 2OF7A 3VYSB 4BQAA 3PO2J 2RGVA 4M3FA 4YIFA 5LRSA 4EV0A 4JK1X 4H0EA 4M6YA 2PLYA 5IYDJ 1R1TA 2GOMA 1MBEA 2KISA 4E7ZA 4QIWN 2I10A 3H3UA 3RKQA 1YW9A 1U5TB 2DFEA 3LA7A 2HOTA 3B6CA 1YJ9I 2AQEA 3TOAA 1UZCA 5J4YA 4LG0A 1MH4A 2JA8J 2KFDA 3PIOF 3I9V2 4HA8A 2RDPA 3HEFA 4LITA 1UAAA 1MMDA 1BR2A 1MW7A 2GBYA 3QOPA 4FCYA 3BG3A 1GUUA 1Y8RB 5K5OA 3KP6A 1IRFA 4CYCA 1YI2I 2QLZA 5JHFA 1JHHA 5HDNA 3HOVJ 1LDKB 2Y75A 4GYIA 3QAHA 3TO6A 1LFPA 3IP4B 4D5FA 4BY1J 4DZPA 2MGQA 4J01A 3OYKA 5LRRA 3CCYA 1QZYA 4L5JA 1CQTA 2Z33A 4HSTA 1R4NB 1U5TA 2FD5A 3P9KA 2HR3A 3HRUA 4ZC3A 2LY9A 1ZGAA 4RAZA 4BL0B 4LG3A 4HYEA 3L1PA 3SEZA 2W57A 4JYKA 1V5GA 3OYNA 1UJ8A 4MNUA 4FASD 3H9JA 4HLYA 2E2IJ 3K70D 1Y1WJ 1W0UA 3A0HC 4GO1A 3ZMVA 1XCVA 3JRIA 3OYIA 1FIAA 4ITVA 2VOOA 4GDFA 3L2CA 3A02A 3KLNA 4I98B 4LLNA 3WE3A 1P6RA 3CJTB 2ZJRF 1I1GA 2YPRA 3S17J 2W7NA 2DOAA 3FXKA 3BTIA 2DMTA 2PI0A 2QQ8A 2QSFX 2FBKA 1B8IB 4L18B 3H5NA 4G8XA 1R36A 2BXZA 4XOTA 5F1JA 1HKSA 1T08B 5IYBJ 1YIJI 4NDLA 3CP2A 3KZIC 3QP5A 3KP3A 5E8GA 4ESFA 3ZQHA 2GIVA 4IHYA 4PJMA 3IRRA 2R3SA 2IJLA 3J81Z 1UMQA 1S7OA 2E2HJ 2NYXA 3BLYA 2JA7J 3U1KA 4DW6A 2ID3A 2JVHA 4CH7A 2DK5A 1DUXC 5H2FC 2A61A 3RPUA 5L3DA 4BQOA 4AVPA 1FWZA 3OYBA 3W2AA 3GCMA 1BA5A 3ZOBA 4ZYGA 2F48A 1XN7A 1XMKA 3W3CA 5LGNA 1K7AA 5H20A 4KIBA 2GIZA 3WTUC 2VXDA 4DIQA 2M30A 4BH9A 5F27A 1Y39A 2EILH 3WGGA 5IT9Z 3KZZA 2EJRA 1SAXA 1DU6A 3UNGC 2VXZA 1Z91A 4M9ZA 1FT9A 4AYBN 3CDHA 4CZCA 2CUZA 2O3FA 3DQVC 3ZR8X 2KJBA 5F0CA 1X3WB 3KIOA 4OWRB 5LHIA 4A3EJ 2DFHA 3HOYJ 1YITI 1Y1VJ 3IUOA 3FIWA 3H0DA 3C18A 4RM3A 2DA6A 1EV7A 5KAIC 2VQCA 2DA7A 2KHMA 2VC0A 4RDUA 1W36C 4HPQA 4ZYEA 4IPAA 4R1HA 2ESHA 1U6GA 2L02A 5E1WA 2R7QA 3U1DA 2L4MA 1XX5A 3CZ6A 4FETA 4PGHA 4AD9A 1ACIA 2GLOA 2FMLA 4IO9F 3DLAA 3ZMSA 1A36A 2M9HA 3L00A 2HDWA 1VQ4I 3CDIA 4M3GA 1VQPI 2A07F 4JBAA 3TGNA 3ZQ7A 4PSXA 4BJ5C 3FBIB 4HEA2 5HLIA 1E3HA 3MVPA 5FGMA 1EH8A 2CSOA 2EV6A 5D5UB 4L0ZB 3GWZA 2M45A 1YS6A 1I3AA 2QZ8A 1E0EA 3BR0A 2QBYA 5J4VA 1J7KA 2ZFUA 1NTCA 3S8PA 4B8XA 5GAHJ 3CTAA 5F0FA 1BOBA 1T0FC 2RNJA 2HS5A 3CF2A 3DP7A 5J6XA 2XGCA 2VJ5A 3V7RA 1XG1A 4HW0A 4A3MJ 3TP0A 1YFHA 5KCMA 5EJCA 1IO2A 1MIJA 3BT9A 4OAZA 4S04A 3F8FA 3QWLA 1W7PD 4KUMA 1WSUA 1H88C 2H1KA 2QWWA 4P1WA 3U2RA 3V8KA 3S1QJ 1ZKGA 1FY7A 2DN0A 3HM5A 3SYTA 3R6SA 4A3IJ 1M1EB 4YRVA 5E3MA 1MNDA 3OYGA 1YJWI 1J09A 1RKTA 4LLLA 4NC8A 2L0KA 1TNSA 5CKTA 2A6EF 2Q1ZB 4F7ZA 4XLPF 3VDXA 1R71A 2BOLA 5E18F 3HXLA 2WTEA 3ONQA 1YX5A 2TDXA 2VL8A 4Z6YA 1EA3A 1QBJA 2Z1DA 1FEXA 5DV5A 1QQIA 3ZQLA 4LB5A 3DEEA 5B1AH 4CCOA 1G3YA 5ICFA 2QQAA 2LG4A 1HKTA 3REOA 1G59A 3AG2H 2ZB9A 4N4OB 5CVIA 1TT0A 2LDUA 3IAS2 4OMZA 2RREA 4Y33A 1MD0A 3ZMZA 4BS9A 4EQQA 3K6GA 3ZN0A 5FKOA 2LNBA 1Y56A 2JTVA 1RIOH 4U7DA 2VBZA 2BY0A 5E8IA 3HOZJ 1OPCA 3VFZA 4KICA 1Y8QB 1SAUA 3ZQGA 2PJRB 2NS8A 4RS8A 1EF4A 2OZUA 2Y0SN 1XB4A 5EG0B 3CO7C 1MGTA 5JLWA 4V2FA 2OC6A 2ICWG 3JRCA 4ZDPA 4M6VA 4KJZA 3MKLA 1H0MA 5LGTA 3OYCA 2VJJA 4FX4A 4IXAA 4LJZF 1OR7A 4HSRA 3ERMA 2K4JA 3H0GJ 1BI3A 5JR3A 4BQNA 2FOWA 1PP7U 4M3EA 4HX7A 3K70C 2DCEA 4RB0A 3JRGA 3R60A 2X51A 1LJ9A 3K2AA 2K02A 2RKHA 5TISC 2ZO4A 4XLHA 6PAXA 2L54A 2W24A 1ZRFA 3LSJA 1JGSA 3KFWX 1JXSA 2XGXA 3BPVA 4PFPA 3SFIA 3ZQIA 4NB5A 3VYUB 2DMUA 3KYLA 2YX7A 2K9LA 3P7NA 5EG0A 3C7JA 2A5YB 5LEKA 2HTJA 3L7WA 1POGA 3E6CC 2EZKA 1UELB 2CV2A 3FKIJ 4AUXA 3S3MA 5JHUA 2PN6A 3C2BA 4B4CA 1P9QC 4XNFA 3HBLA 3CO6C 3ABTA 1KQ9A 1UHSA 5C44J 1VQ9I 1ETYA 2XC7A 4D1QA 4QPQA 3RJPA 3GTGJ 4ZDLA 4A6EA 1X4OA 5FRNA 1YE9A 2DT6A 3P5JA 1HSJA 1N78A 1HW5A 2FOKA 3BP8A 2K4BA 4BKXA 2DAOA 3C2HA 3JRHA 3JR9A 5GPCA 5D4RA 1RUNA 1K4TA 2R93J 5B3SH 2RN7A 4I7HA 4PDKA 3GTOJ 1WJEA 5E3OA 1LE8B 3CC2I 3FM3A 2XIGA 2CFXA 3D5SC 3KP4A 4V2GA 3A4CA 5IPAA 5FFXA 4A2UA 3LSGA 2IGMA 3E5QA 4W97A 1LFUP 2Q8KA 2E34A 2ZMEB 2R5YB 1FP1D 2IS4A 4HLXA 4RLFA 5M5WJ 2Z9OA 3I53A 4ESBA 4IKFA 5EEHA 4CSWA 5BQTA 1ETVA 2CW0F 3DKXA 3WG7H 1GXPA 4Y4RA 1T0FA 5IP9J 4C3IJ 4DZJA 2Z3YA 2ISYA 5H6QA 4I2OA 2V6EA 1QNTA 2UUZA 2ZKZA 4U88A 3DTKA 4XRMA 4XIDA 3V4GA 5LBQA 1D3YA 1IG7A 4MEYF 1IGNA 4GRIA 3ROUA 4DYQA 3M9AA 2V9KA 4II3A 4FQGA 5JFRA 3G1MA 3GTKJ 3FHNA 1JI8A 1W5CC 2ZXIA 3LAPA 1IXCA 4M73A 1DPRA 2LFBA 3BPXA 1WHUA 3KYDB 2ZMEA 2DK8A 2R5YA 1U3EM 3IRQA 2J5OA 2QYOA 4IRIA 2QCOA 4CA0A 4I0AA 1OYIA 3CCVI 4O3MA 5CVJA 2EZIA 3F72A 5F6FA 4EEFG 2DDBA 2MD0A 2BHYA 3FK6A 2VIXA 1R5GA 4KIGA 1FP2A 5GADJ 2JN6A 3I59B 3LSIA 4G9YA 4XM3A 5FKKA 2M8GX 2WB1N 2VPLA 2X4HA 5EF6A 3CCUI 5JLXA 1LPQA 2H6BA 1X19A 2CH0A 3DEUA 3ZMUA 4E7LA 1SD4A 2L9RA 1XSDA 1FLIA 4PJLA 1VQMI 1J0RA 1DDNA 2OTJI 2RC4A 3OS1A 1PUFA 1T8IA 1R4MB 2O7OA 3CP8A 3FXQA 5IYCJ 4ZTJA 4KN4X 2QSHX 3H3ZA 1YJNI 5CLSA 5HLTA 2HXOA 1ZAOA 5LFAA 5DCMB 3SDBA 2LF8A 3E5UA 3NEUA 5J8CA 2CQNA 2QM3A 1IXSB 3PQJA 4G94A 2CQXA 1HLVA 4D7MA 3S16J 3G3ZA 3U9GA 5CQGA 5D6FA 1SVOA 2F5FA 2Y0MA 2YUSA 3H1CA 5DTDA 3K4JA 3JW4A 2VLAA 1TWGJ 4A3CJ 1R9TJ 1HF0A 3F8MA 1SC7A 3HUGB 2DTZA 3WG9A 2C6YA 5FJ8J 5BNGA 1X1BA 3OYEA 2DLLA 2ZXHA 2K9SA 1FJLA 1U2WA 1NK2P 1XPXA 3EPZA 3HPGA 2CRGA 1ZRDA 4BE2A 3FXRA 4BU2A 2O8KA 4XSXF 2NS7A 3TO9A 5EEGA 3GTJJ 1RC9A 2HQAA 2MFZA 5DCMA 3RTRA 1O7FA 2E1MB 3DPLC 2GWRA 1AWCA 5L3CA 4MHGA 5EZGA 5J1UA 3OR2C 1CGPA 3L2VA 3I56I 5K5RA 4PJJA 3F3XA 1UCRA 1JUPA 1JKQC 2UXXA 2WAFA 3PNVA 5K1YA 4I09A 4MFDA 5D6EA 3MKZA 1WQ2A 4R79A 3K4KA 1JKRC 2JSCA 2DQLA 1XGOA 2ADUA 3DU6A 2CQKA 3HUGA 4B44A 4EGZA 1RR8C 1XGNA 3F0CA 1TL8A 1SFKA 2K9NA 3TBIA 3ASOH 1X1AA 3HOUJ 1ZH5A 1I50J 4YFNF 2R92J 1Z05A 2XAUA 2VE8A 2G7HA 2GM4A 3HGGA 3ZQFA 3LFUA 4A69C 4UXNA 1S72I 3DU5A 1ETXA 4RGXA 1IRZA 2M2EA 2M34A 4NQWB 4OOIA 4RA2A 3GTLJ 3RKYA 2ESNA 3GZNB 2FSWA 2HOEA 1TWFJ 2NRAC 4UVAA 2LYCA 2P5VA 3K2ZA 3FXMA 3PL8A 4CDGA 4E4HA 5JVTA 5TRDA 1T38A 4HQMA 2EBIA 1ZYRF 1QZEA 2GAUA 3I64A 2D2WA 1MBGA 2JPBA 3FXLA 3QRFF 5HDKA 2HQ5A 1GV5A 1BOAA 2FBHA 2BE5F 3I4NJ 4HQEA 4HV6A 2V79A 5ICCA 4O6JA 2YSRA 2IVMA 5J40A 2ME6A 1WJBA 4Y7NJ 1MMGA 2AXLA 1ODDA 1W1WE 1D5VA 1P4AA 2O0YA 3CUQC 1USTA 4ETSA 3O6BB 2P5KA 2DMQA 5B1BH 3V8JA 4IF4A 2NVTJ 5FD5A 1WCMJ 3FMQA 1YRNB 2PG4A 3HSFA 3G1LA 1A35A 4HF1A 3VSLA 4LG0B 3M7GA 1FBUA 1PYVA 3QYBA 2O61A 1R58A 3S2WA 1HC8A 4M3DA 2QEXI 1V54H 3K0LA 3KCCA 3S1RJ 2W82A 4EMSA 3I3LA 3HIFA 3RZDJ 1R7JA 4UVCA 4DYCA 1NK3P 4IZZA 4YFXF 5IOZA 3K9TA 3HSRA 4AWXB 4CYCB 1N77A 1TBXA 3ML6A 3O3KA 3BQZA 1FMWA 3OOUA 4CCKA 3G2BA 4XLNF 3PSIA 2HI3A 3HHGA 1X58A 3MD2A 2R0QC 5J3LA 4C3HJ 1FZPB 5E79C 3W6VA 3D5RC 1XDSA 3ECOA 3OWTA 4H4KC 5FROA 3ZQQA 1LDDA 3B6AA 3DCFA 5M3FJ 2FA5A 1ZGJA 1WJAA 2EPFA 1FIPA 4XLAA 4II2A 1YRNA 1BN5A 4HF0A 1U8BA 2IGNA 1WPKA 4A93J 4LFUA 4F93B 1BM9A 3BR2A 2R7VA 3VEPA 2XPWA 1SMTA 4AC0A 2MW8A 2NS0A 3S32A 3K4MA 1QHGA 4QTRA 1USSA 1X3UA 3ESWB 1K6YA 1MNEA 1LB2A 1FX7A 5BPDA 5CQEA 3I58A 2MLKA 5E3NA 2HPMA 1KU7A 5IY5H 2HYFA 3BCAA 2WB1A 1Y0NA 3KPHA 3NAUA 4HV5A 3A01B 3X2QH 1REPC 1IXRC 5L3EA 1V3FA 4DGWB 2PFBA 1B72B 3KP7A 3RPQA 1YW8A 2DBBA 1LQ1A 4UNOA 3MN2A 1ZK8A 1BC7C 4BBRJ 2CO5A
chains in the Genus database with same CATH topology
1MNMC 1JJ8C 5IP6A 3BR5A 3BT9A 1H88C 2H1KA 1RESA 5E3LA 3S1QJ 1ZKGA 2DN0A 3HM5A 4D7NA 2JJ7A 4A3IJ 5E3MA 2JA5J 1RKTA 2L0KA 4C2MJ 1T56A 2P81A 2XSDC 4DYRA 5F0HA 1X2MA 3TW6A 1QPIA 2CUFA 2R5ZA 2PMZN 2WAQN 2HDDA 2AO9A 3JRBA 4FISA 3A01A 4I76A 4BXXJ 3TEDA 2DMPA 4BY7J 2IBDA 1B72A 5EZHA 2HOAA 2XGEA 2JK3A 4B1RA 3ZQLA 1SFOJ 1FEXA 3FK7A 5GP9A 2CUEA 4FE4A 1ZR4A 2NVYJ 2ZB9A 2TCTA 3SJMA 1LE8A 2L7FP 5M5XJ 5FKOA 3HKZN 3SDGA 1VNDA 5FLVA 1G2HA 2XPVA 1JKOC 1WH5A 1U9NA 1RKWA 1WI3A 2RAEA 4G12A 5EYRA 3HOZJ 1MBKA 1QRYA 2G0EA 3ZQGA 2JA6J 2NS8A 1ZGWA 1P7IA 4IHWA 1EF4A 2NVXJ 5M3MJ 2Y0SN 5EG0B 2ECBA 4IHVA 5JLWA 4V2FA 5F08A 1E3OC 3JRCA 3LNQA 2X48A 1ZR2A 4M6VA 3G1OA 3MKLA 1MBJA 5J1RA 4XK4A 1IV6A 2DJNA 1ZQ3P 4UUSB 1VI0A 3I4MJ 2LP0A 3PO3J 3H0GJ 2DA4A 2X6OA 1RETA 3QQAA 4M3EA 1MSFC 3JRGA 3HOXJ 4D5CA 2XRLA 3K2AA 4XRSA 1FTTA 2HYJA 4L5EA 4UUTA 9ANTA 1W0TA 2JMWA 3LSJA 3LSRA 3DEWA 4MFEA 3SFIA 3ZQIA 3O8HA 2DMUA 1MH3A 1HDPA 1FTZA 5EG0A 3S1NJ 3IH2A 1POGA 2ECCA 2EZKA 3FKIJ 4BBRJ 4AUXA 3C2BA 1JT0A 5K7ZA 1AU7A 4B4CA 4UUSA 3HBLA 1K61A 1WGXA 2K40A 4JX4A 4W1UA 3GTQJ 1UHSA 4HNVA 5C44J 2Y9YA 1ETYA 1OCTC 1AHDP 4I6ZA 2N8GA 2R5ZB 2XB0X 2CU7A 3IH4A 2LTPA 4S0HB 4X6AJ 3GTGJ 3S15J 1ORKA 2EZLA 4BKXA 3JRHA 3BR6A 3JR9A 5FKNA 4A3FJ 3TW7A 5GPCA 4ABZA 3LSPA 5EEAA 2R93J 1IC8A 5EGOB 2AHQA 2VI6A 3GTOJ 1XS9A 5E3OA 5M5YJ 2KDZA 1LE8B 3GTMJ 3CQZJ 4A3DJ 4V2GA 3TP3A 3WHBA 5IPAA 5FKLA 3JRFA 3S2DJ 1ETKA 3Q0UA 3LSGA 2LK2A 3GBGA 4W97A 4XRSG 1LFUP 1S7EA 4FTHA 3JRAA 1Q1VA 2R5YB 1GV2A 5M5WJ 1OFCX 4QSHA 1ETVA 2B63J 2D5VA 5K7HA 5IP9J 4C3IJ 5C4JJ 1BL0A 4DZJA 2R7ZJ 5HODA 1BJZA 2CQQA 4X1EA 1JJ6C 4BBSJ 4A3BJ 4XRMA 4XIDA 1ZTRA 2O9LA 5F04A 1TC3C 1IUFA 2IAIA 3IV5A 1IG7A 1IGNA 5EGOA 2LR8A 4DYQA 2E1OA 2FQ4A 2HXIA 3G1MA 2Y2ZA 3GTKJ 3QPSA 2VUMJ 2LKXA 2Y31A 2MG4A 4MIMA 2L7ZA 2LFBA 2FJ1A 2R5YA 2EQRA 2HOSA 3BR1A 3A03A 2QCOA 3RQIA 3HGYA 1Z0XA 4Y52J 2EZIA 4EEFG 5C4XJ 1TWCJ 3FK6A 2ME0A 1U9OA 1QVTA 3D1NI 1I6HJ 2JN6A 1MBHA 5FKKA 1JUMA 2M8GX 1O4XA 2WB1N 1JGGA 5EF6A 5JLXA 1H8AC 2FX0A 3BTLA 3BTCA 1Z77A 3CMYA 2L9RA 2DA5A 2DA2A 1X2NA 3UKGA 1XC5A 3H3VK 2M0CA 1B8IA 1PUFA 2O7OA 3OIOA 1T33A 4J19A 5IYCJ 2LD5A 1IDYA 2DA1A 1JTXA 3Q3SA 4C3JJ 2HXOA 1GT0C 3O8GA 3JRDA 2OF7A 3S14J 3PO2J 4M3FA 2CQXA 3OSFA 1HLVA 5IYDJ 2CJJA 1MBEA 4D7MA 3S16J 2OPTA 4QIWN 2I10A 4A3KJ 3RKQA 5DTDA 4A3LJ 2YUSA 3IH3A 1TWGJ 4A3CJ 3CDLA 2HOTA 2Y30A 3B6CA 1R9TJ 1HF0A 2DTZA 1JUSA 4FE7A 5IOYA 5FJ8J 1MH4A 2JA8J 5BNGA 3WHCA 3HEFA 1SANA 1H89C 2VKEA 1RPWA 4M3BA 2GBYA 2K9SA 4LOCA 1FJLA 1NK2P 4FCYA 3BG3A 1IDZA 1BW5A 1GUUA 2CRGA 2E2JJ 2ID6A 3M4OJ 2L7MP 2O8KA 4MLOA 2NS7A 3GTJJ 4CYCA 1OJLA 4B3AA 3HOVJ 1ETOA 2K9QA 2KT0A 1P7JA 4XICA 3Q0VA 1APLC 5EZGA 5J1UA 2W48A 4D5FA 4BY1J 2QF7A 3K7AJ 4DZPA 1JUPA 2MGQA 3ZQCA 1MSEC 1JKQC 3CCYA 1CQTA 4MFDA 2FD5A 1JKRC 2LY9A 3FISA 3L1PA 3F0CA 5FLMJ 4A3JJ 2K9NA 2H8RA 4JYKA 4JX5A 2WV1A 2DA3A 3HOUJ 1I50J 2XPUA 2YS9A 2R92J 2ELKA 3NARA 5IP7J 2E2IJ 2COBA 2GM4A 1MBFA 1Y1WJ 1W0UA 3BG5A 3HGGA 3ZQFA 4A69C 3JRIA 1FIAA 1ETXA 3A02A 1JTYA 1IRZA 2M2EA 2M34A 3GTLJ 2NOGA 1DU0A 1HCRA 1UG2A 3S17J 3BTIA 1TWFJ 2DMTA 2LLKA 2XGDA 1B8IB 5C3EJ 2YU9J 1PUFB 2EBIA 3HDDA 1JT6A 2EH3A 1ENHA 5FKMA 5F1JA 5IYBJ 4NDLA 3S1MJ 1F43A 1RR7A 3JREA 1MBGA 1BW6A 3ZQHA 2HQ5A 1GV5A 1GDTA 4IHYA 3I4NJ 1UMQA 2LVSA 3OSGA 5K7FA 2E2HJ 3S2HJ 1I3QJ 1ETQA 2XB5A 2JA7J 2ME6A 4Y7NJ 4DW6A 1VFCA 2ID3A 3E7LA 1ETWA 2VKVA 2Y9ZA 1U78A 2DMQA 1BA5A 2NVTJ 5DS9A 1WCMJ 1YRNB 3ZOBA 2VPRA 3G1LA 1WH7A 1HDDC 3HB9A 1AKHB 1HOMA 4M3DA 5F27A 4RBOA 3Q0WA 3S1RJ 1DU6A 4IHXA 4AYBN 3RZDJ 4DYCA 1NK3P 3VPRA 5GPAA 5F0CA 5IOZA 4CYCB 3OOUA 3QPLA 3BQZA 4A3EJ 3HOYJ 4IEJA 1Y1VJ 2HI3A 2JWTA 1X58A 2R0QC 3BQYA 3FIWA 5J3LA 4C3HJ 3W6VA 4MO7A 3RZOJ 2DA6A 2IEKA 3B6AA 3BR3A 3DCFA 5M3FJ 2DA7A 4GFBA 2E19A 4RDUA 2NVQJ 2DMNA 1D5YA 1FIPA 1TWHJ 1YRNA 3BG9A 1U8BA 1WPKA 4A93J 1GVDA 1AKHA 1JKPC 2GLOA 3BTJA 1VF9A 3BR2A 1K83J 2M9HA 2XPWA 1QVUA 4AC0A 2MW8A 1LFBA 1IJWC 5EDNA 1TWAJ 4M3GA 2TRTA 4QTRA 3LOCA 4JX6A 3MVPA 1F36A 5E3NA 4A3MJ 1A6IA 3BR0A 3NAUA 3A01B 1NTCA 2X9DA 5F0FA 2EZHA 5J1YA 3M3YJ 3GTPJ 3HOWJ 3PM1A 1B72B 1ITYA 1OCPA 2XGCA 2MSYA 3MN2A 4JP0A 4A3GJ 1XG1A 1ZK8A 3TP0A 1A5JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MNM C;  1JJ8 C;  5IP6 A;  3BR5 A;  3BT9 A;  1H88 C;  2H1K A;  1RES A;  5E3L A;  3S1Q J;  1ZKG A;  2DN0 A;  3HM5 A;  4D7N A;  2JJ7 A;  4A3I J;  5E3M A;  2JA5 J;  1RKT A;  2L0K A;  4C2M J;  1T56 A;  2P81 A;  2XSD C;  4DYR A;  5F0H A;  1X2M A;  3TW6 A;  1QPI A;  2CUF A;  2R5Z A;  2PMZ N;  2WAQ N;  2HDD A;  2AO9 A;  3JRB A;  4FIS A;  3A01 A;  4I76 A;  4BXX J;  3TED A;  2DMP A;  4BY7 J;  2IBD A;  1B72 A;  5EZH A;  2HOA A;  2XGE A;  2JK3 A;  4B1R A;  3ZQL A;  1SFO J;  1FEX A;  3FK7 A;  5GP9 A;  2CUE A;  4FE4 A;  1ZR4 A;  2NVY J;  2ZB9 A;  2TCT A;  3SJM A;  1LE8 A;  2L7F P;  5M5X J;  5FKO A;  3HKZ N;  3SDG A;  1VND A;  5FLV A;  1G2H A;  2XPV A;  1JKO C;  1WH5 A;  1U9N A;  1RKW A;  1WI3 A;  2RAE A;  4G12 A;  5EYR A;  3HOZ J;  1MBK A;  1QRY A;  2G0E A;  3ZQG A;  2JA6 J;  2NS8 A;  1ZGW A;  1P7I A;  4IHW A;  1EF4 A;  2NVX J;  5M3M J;  2Y0S N;  5EG0 B;  2ECB A;  4IHV A;  5JLW A;  4V2F A;  5F08 A;  1E3O C;  3JRC A;  3LNQ A;  2X48 A;  1ZR2 A;  4M6V A;  3G1O A;  3MKL A;  1MBJ A;  5J1R A;  4XK4 A;  1IV6 A;  2DJN A;  1ZQ3 P;  4UUS B;  1VI0 A;  3I4M J;  2LP0 A;  3PO3 J;  3H0G J;  2DA4 A;  2X6O A;  1RET A;  3QQA A;  4M3E A;  1MSF C;  3JRG A;  3HOX J;  4D5C A;  2XRL A;  3K2A A;  4XRS A;  1FTT A;  2HYJ A;  4L5E A;  4UUT A;  9ANT A;  1W0T A;  2JMW A;  3LSJ A;  3LSR A;  3DEW A;  4MFE A;  3SFI A;  3ZQI A;  3O8H A;  2DMU A;  1MH3 A;  1HDP A;  1FTZ A;  5EG0 A;  3S1N J;  3IH2 A;  1POG A;  2ECC A;  2EZK A;  3FKI J;  4BBR J;  4AUX A;  3C2B A;  1JT0 A;  5K7Z A;  1AU7 A;  4B4C A;  4UUS A;  3HBL A;  1K61 A;  1WGX A;  2K40 A;  4JX4 A;  4W1U A;  3GTQ J;  1UHS A;  4HNV A;  5C44 J;  2Y9Y A;  1ETY A;  1OCT C;  1AHD P;  4I6Z A;  2N8G A;  2R5Z B;  2XB0 X;  2CU7 A;  3IH4 A;  2LTP A;  4S0H B;  4X6A J;  3GTG J;  3S15 J;  1ORK A;  2EZL A;  4BKX A;  3JRH A;  3BR6 A;  3JR9 A;  5FKN A;  4A3F J;  3TW7 A;  5GPC A;  4ABZ A;  3LSP A;  5EEA A;  2R93 J;  1IC8 A;  5EGO B;  2AHQ A;  2VI6 A;  3GTO J;  1XS9 A;  5E3O A;  5M5Y J;  2KDZ A;  1LE8 B;  3GTM J;  3CQZ J;  4A3D J;  4V2G A;  3TP3 A;  3WHB A;  5IPA A;  5FKL A;  3JRF A;  3S2D J;  1ETK A;  3Q0U A;  3LSG A;  2LK2 A;  3GBG A;  4W97 A;  4XRS G;  1LFU P;  1S7E A;  4FTH A;  3JRA A;  1Q1V A;  2R5Y B;  1GV2 A;  5M5W J;  1OFC X;  4QSH A;  1ETV A;  2B63 J;  2D5V A;  5K7H A;  5IP9 J;  4C3I J;  5C4J J;  1BL0 A;  4DZJ A;  2R7Z J;  5HOD A;  1BJZ A;  2CQQ A;  4X1E A;  1JJ6 C;  4BBS J;  4A3B J;  4XRM A;  4XID A;  1ZTR A;  2O9L A;  5F04 A;  1TC3 C;  1IUF A;  2IAI A;  3IV5 A;  1IG7 A;  1IGN A;  5EGO A;  2LR8 A;  4DYQ A;  2E1O A;  2FQ4 A;  2HXI A;  3G1M A;  2Y2Z A;  3GTK J;  3QPS A;  2VUM J;  2LKX A;  2Y31 A;  2MG4 A;  4MIM A;  2L7Z A;  2LFB A;  2FJ1 A;  2R5Y A;  2EQR A;  2HOS A;  3BR1 A;  3A03 A;  2QCO A;  3RQI A;  3HGY A;  1Z0X A;  4Y52 J;  2EZI A;  4EEF G;  5C4X J;  1TWC J;  3FK6 A;  2ME0 A;  1U9O A;  1QVT A;  3D1N I;  1I6H J;  2JN6 A;  1MBH A;  5FKK A;  1JUM A;  2M8G X;  1O4X A;  2WB1 N;  1JGG A;  5EF6 A;  5JLX A;  1H8A C;  2FX0 A;  3BTL A;  3BTC A;  1Z77 A;  3CMY A;  2L9R A;  2DA5 A;  2DA2 A;  1X2N A;  3UKG A;  1XC5 A;  3H3V K;  2M0C A;  1B8I A;  1PUF A;  2O7O A;  3OIO A;  1T33 A;  4J19 A;  5IYC J;  2LD5 A;  1IDY A;  2DA1 A;  1JTX A;  3Q3S A;  4C3J J;  2HXO A;  1GT0 C;  3O8G A;  3JRD A;  2OF7 A;  3S14 J;  3PO2 J;  4M3F A;  2CQX A;  3OSF A;  1HLV A;  5IYD J;  2CJJ A;  1MBE A;  4D7M A;  3S16 J;  2OPT A;  4QIW N;  2I10 A;  4A3K J;  3RKQ A;  5DTD A;  4A3L J;  2YUS A;  3IH3 A;  1TWG J;  4A3C J;  3CDL A;  2HOT A;  2Y30 A;  3B6C A;  1R9T J;  1HF0 A;  2DTZ A;  1JUS A;  4FE7 A;  5IOY A;  5FJ8 J;  1MH4 A;  2JA8 J;  5BNG A;  3WHC A;  3HEF A;  1SAN A;  1H89 C;  2VKE A;  1RPW A;  4M3B A;  2GBY A;  2K9S A;  4LOC A;  1FJL A;  1NK2 P;  4FCY A;  3BG3 A;  1IDZ A;  1BW5 A;  1GUU A;  2CRG A;  2E2J J;  2ID6 A;  3M4O J;  2L7M P;  2O8K A;  4MLO A;  2NS7 A;  3GTJ J;  4CYC A;  1OJL A;  4B3A A;  3HOV J;  1ETO A;  2K9Q A;  2KT0 A;  1P7J A;  4XIC A;  3Q0V A;  1APL C;  5EZG A;  5J1U A;  2W48 A;  4D5F A;  4BY1 J;  2QF7 A;  3K7A J;  4DZP A;  1JUP A;  2MGQ A;  3ZQC A;  1MSE C;  1JKQ C;  3CCY A;  1CQT A;  4MFD A;  2FD5 A;  1JKR C;  2LY9 A;  3FIS A;  3L1P A;  3F0C A;  5FLM J;  4A3J J;  2K9N A;  2H8R A;  4JYK A;  4JX5 A;  2WV1 A;  2DA3 A;  3HOU J;  1I50 J;  2XPU A;  2YS9 A;  2R92 J;  2ELK A;  3NAR A;  5IP7 J;  2E2I J;  2COB A;  2GM4 A;  1MBF A;  1Y1W J;  1W0U A;  3BG5 A;  3HGG A;  3ZQF A;  4A69 C;  3JRI A;  1FIA A;  1ETX A;  3A02 A;  1JTY A;  1IRZ A;  2M2E A;  2M34 A;  3GTL J;  2NOG A;  1DU0 A;  1HCR A;  1UG2 A;  3S17 J;  3BTI A;  1TWF J;  2DMT A;  2LLK A;  2XGD A;  1B8I B;  5C3E J;  2YU9 J;  1PUF B;  2EBI A;  3HDD A;  1JT6 A;  2EH3 A;  1ENH A;  5FKM A;  5F1J A;  5IYB J;  4NDL A;  3S1M J;  1F43 A;  1RR7 A;  3JRE A;  1MBG A;  1BW6 A;  3ZQH A;  2HQ5 A;  1GV5 A;  1GDT A;  4IHY A;  3I4N J;  1UMQ A;  2LVS A;  3OSG A;  5K7F A;  2E2H J;  3S2H J;  1I3Q J;  1ETQ A;  2XB5 A;  2JA7 J;  2ME6 A;  4Y7N J;  4DW6 A;  1VFC A;  2ID3 A;  3E7L A;  1ETW A;  2VKV A;  2Y9Z A;  1U78 A;  2DMQ A;  1BA5 A;  2NVT J;  5DS9 A;  1WCM J;  1YRN B;  3ZOB A;  2VPR A;  3G1L A;  1WH7 A;  1HDD C;  3HB9 A;  1AKH B;  1HOM A;  4M3D A;  5F27 A;  4RBO A;  3Q0W A;  3S1R J;  1DU6 A;  4IHX A;  4AYB N;  3RZD J;  4DYC A;  1NK3 P;  3VPR A;  5GPA A;  5F0C A;  5IOZ A;  4CYC B;  3OOU A;  3QPL A;  3BQZ A;  4A3E J;  3HOY J;  4IEJ A;  1Y1V J;  2HI3 A;  2JWT A;  1X58 A;  2R0Q C;  3BQY A;  3FIW A;  5J3L A;  4C3H J;  3W6V A;  4MO7 A;  3RZO J;  2DA6 A;  2IEK A;  3B6A A;  3BR3 A;  3DCF A;  5M3F J;  2DA7 A;  4GFB A;  2E19 A;  4RDU A;  2NVQ J;  2DMN A;  1D5Y A;  1FIP A;  1TWH J;  1YRN A;  3BG9 A;  1U8B A;  1WPK A;  4A93 J;  1GVD A;  1AKH A;  1JKP C;  2GLO A;  3BTJ A;  1VF9 A;  3BR2 A;  1K83 J;  2M9H A;  2XPW A;  1QVU A;  4AC0 A;  2MW8 A;  1LFB A;  1IJW C;  5EDN A;  1TWA J;  4M3G A;  2TRT A;  4QTR A;  3LOC A;  4JX6 A;  3MVP A;  1F36 A;  5E3N A;  4A3M J;  1A6I A;  3BR0 A;  3NAU A;  3A01 B;  1NTC A;  2X9D A;  5F0F A;  2EZH A;  5J1Y A;  3M3Y J;  3GTP J;  3HOW J;  3PM1 A;  1B72 B;  1ITY A;  1OCP A;  2XGC A;  2MSY A;  3MN2 A;  4JP0 A;  4A3G J;  1XG1 A;  1ZK8 A;  3TP0 A;  1A5J A; 
#chains in the Genus database with same CATH topology
 1TP4 A;  4C30 A;  1MNM C;  3PFI A;  2G9W A;  5IP6 A;  4DQ2 A;  2VC1 A;  3KX2 A;  3CF5 F;  2L9S A;  1RES A;  5E3L A;  2DI3 A;  3R61 A;  4U7B A;  1W5T A;  4D7N A;  2HDC A;  1OCC H;  2JA5 J;  1XCB A;  4AVZ A;  1ERD A;  2KL4 A;  4C2M J;  2IS2 A;  4N9I A;  1T56 A;  2V1X A;  1WFX A;  1XGS A;  3KE2 A;  5F0H A;  2XSD C;  1NG6 A;  4CCN A;  2A6H F;  1V55 H;  2CUF A;  4LK1 F;  2PMZ N;  4ZTF A;  2JRT A;  1YLF A;  4OIN F;  1IW7 F;  3ZCO A;  2VBY A;  3A01 A;  4PUS A;  4BHB A;  4BXX J;  4XKW A;  2X6Y A;  2XAF A;  3WU0 A;  4F3Q A;  4RGS A;  4BY7 J;  2FE3 A;  1B72 A;  2B0L A;  2HOA A;  4B1R A;  2JK3 A;  2D45 A;  3BJ6 A;  4FE4 A;  2Z2S B;  2E1C A;  5E17 F;  2NVY J;  2F5V A;  3DPT A;  4R8H A;  2NXN B;  1LUJ B;  3FZV A;  2IPQ X;  4P9U A;  4FX0 A;  4JQF A;  5CVU A;  2IA1 A;  2KIM A;  2DFF A;  5AIP A;  3B02 A;  3ASN H;  1U9N A;  4CXF A;  4CHU A;  1O57 A;  4EM2 A;  5J8F A;  2H1L A;  4RAY A;  1YHQ I;  1MBK A;  2CV0 A;  2MBF A;  2M1B A;  2G0E A;  4I02 A;  2V6C A;  2JA6 J;  1DPU A;  3CLO A;  4IOC F;  2NVX J;  3MWM A;  2BZT A;  5KVR A;  3T8T A;  3LNQ A;  1ZG3 A;  4XSZ F;  1J75 A;  5KK1 A;  3EYI A;  3OYL A;  3JAM Z;  2MH9 A;  2F4O B;  4XK4 A;  1HXD A;  1SVM A;  4UUS B;  4A6D A;  2VOP A;  3I4M J;  4A0Y A;  1FBQ A;  1G3T A;  1TQM A;  2KLO A;  2X6O A;  2Y69 H;  3E97 A;  3OYM A;  2OQR A;  3NRV A;  3DKW A;  3HOX J;  2QBY B;  4CYD A;  2HYJ A;  4L5E A;  5CJ9 A;  4UUT A;  3W6K B;  2R7U A;  3EUH A;  1YYV A;  4HX8 A;  2HKX A;  1STZ A;  2JMW A;  3H5R A;  2P6T A;  5DEQ A;  5TJJ A;  5LGU A;  3QOE A;  1WRJ A;  3BJA A;  2EIK H;  1HDP A;  1A31 A;  3OL4 A;  1N25 A;  2WY8 Q;  5FFZ A;  3OYA A;  2FRH A;  4EM0 B;  3S1N J;  2DTR A;  1BI2 A;  2KMU A;  3OS2 A;  4GXO A;  4PCQ A;  2ECC A;  1JT0 A;  3AL0 C;  4UUS A;  2K40 A;  4JX4 A;  5DD4 A;  4WCG A;  3ZGK A;  2CGP A;  1T95 A;  2R7F A;  3OV8 A;  3J80 K;  3PQK A;  3G6E I;  2N8G A;  3D0S A;  3IH4 A;  3HKZ A;  2LTP A;  4S0H B;  2I8D A;  2P7C B;  1QA6 A;  4D9J A;  3S15 J;  1ORK A;  4G7H F;  2EZL A;  5BS6 A;  5HOO A;  3ZXS A;  3ABL H;  1KU3 A;  4B43 A;  5EEA A;  2DYR H;  5F1R A;  3VSK A;  3SHF A;  4CIC A;  1B9M A;  2VI6 A;  1MMS A;  4YG2 F;  3HSE A;  1FC3 A;  2KDZ A;  2IS6 A;  4A5N A;  2M7A A;  2BY3 A;  1IF1 A;  4E7S A;  2Y48 A;  5FKL A;  3JRF A;  1HA8 A;  2HVQ A;  5L3G A;  1LKX A;  2LK2 A;  4PFO A;  5B66 C;  3OYJ A;  3JRA A;  2XF5 A;  1GXQ A;  1OFC X;  2W84 A;  2R7S A;  3ECH A;  4E7J A;  1B6A A;  2B63 J;  4JOM A;  2RV8 A;  5HS8 A;  5LHG A;  2CG4 A;  2OD5 A;  5C4J J;  3E5X A;  4M9X A;  1BL0 A;  2CS3 A;  4N4N B;  5B5E C;  1BJZ A;  2COM A;  2LC2 A;  4A3B J;  1Z21 A;  1ZTR A;  1FOY A;  2O9L A;  5F04 A;  4LIV A;  2IAI A;  2PX9 A;  3VYT B;  4U0V A;  4MGR A;  1Z6T A;  4BAC A;  1WKM A;  1D1C A;  3T0Y A;  2HXI A;  1MZB A;  3VB2 A;  3GFI A;  2PJP A;  4XBF A;  3A1Y A;  2M7B A;  4KNY A;  1FYL A;  2CWE A;  4BDZ A;  2E71 A;  1R1V A;  3I0T A;  1W5S A;  3H35 A;  3BR1 A;  1X1D A;  3WGH A;  3KP2 A;  2X0L A;  3HGY A;  4Y52 J;  2V26 A;  3U21 A;  4BQQ A;  4RLQ A;  4EGY A;  4KFC A;  1AOY A;  3TQN A;  2VJ4 A;  2X6W A;  2K27 A;  1TWC J;  4I0B A;  1U9O A;  4U87 A;  3HPH A;  1IN4 A;  3WTS C;  2GXB A;  4LIU A;  1PVE A;  1JUM A;  1OCZ H;  3J7A O;  1O4X A;  3Q9S A;  1KQ0 A;  2A5W A;  2FX0 A;  4HOB A;  1R00 A;  3BTC A;  3CMY A;  1PP8 F;  4HZF A;  4OMY A;  4IHT A;  2DA5 A;  1R5I D;  1X2N A;  1ZAR A;  2DA2 A;  5CVR A;  5FLX K;  1E2X A;  3UKG A;  4KDP A;  2FU4 A;  1B59 A;  2JA2 A;  1XC5 A;  1SD6 A;  2WBM A;  2VQL A;  1QGP A;  1I1S A;  4J19 A;  1D0X A;  2LD5 A;  1MKM A;  2LKS A;  4I01 A;  1OYW A;  2CFO A;  3Q3S A;  4C3J J;  2IRF G;  4Y13 A;  3EDP A;  1T2K A;  2PMZ A;  2Q2E B;  1WI9 A;  3O8G A;  2EFP A;  2FXA A;  2EK5 A;  3S14 J;  1BJA A;  1X3Z B;  2HEO A;  1QZZ A;  1IRG A;  2Z16 A;  4ZZL A;  3RCO A;  2E5N A;  2VKH A;  4F52 A;  1YIO A;  3IWZ A;  5DUI A;  3QPT A;  4A3K J;  5A2Q K;  1U8R A;  4A3L J;  2ZJQ F;  2M5W A;  3IH3 A;  4EJU A;  4G6Q A;  3CDL A;  3CCQ I;  3LMM A;  4LLG F;  3TKY A;  2KZG A;  1K6O A;  4XOP A;  1JUS A;  4CO8 A;  3J7Y J;  1TQI A;  4EJO A;  5GAG J;  2IXS A;  3DBR B;  5IOY A;  2JRM A;  4Y3O A;  3J7A Y;  3WHC A;  3RIR A;  1H89 C;  3RPU D;  2VKE A;  1F1Z A;  1RPW A;  4LOC A;  2QEN A;  4ESJ A;  1SD5 A;  1RI7 A;  1IDZ A;  4XRF A;  1BW5 A;  1ZG5 A;  2LH9 A;  2ID6 A;  2W00 A;  3M4O J;  3CJR B;  4MLO A;  3F8N A;  2EFQ A;  1EJ9 A;  2VJI A;  3FMR A;  4YFK F;  3ABU A;  4B3A A;  1FNN A;  2KT0 A;  1ZG1 A;  1P7J A;  2M3A A;  2JVG A;  2Q2E A;  5ILU A;  2M8E A;  2HZD A;  1WJF A;  2XKP A;  4KN7 X;  3LQR A;  2V9P A;  2B9S A;  1MSE C;  3ZQC A;  3NWS A;  4PZJ A;  4C9Y A;  3CMA I;  1F9N A;  3TDU C;  4WXH A;  2XKO A;  4BAY A;  4RM2 A;  2H27 A;  3MFK A;  3HG9 A;  4QLC U;  1S3J A;  1WWX A;  4A3J J;  1I6X A;  3BWG A;  3E6B A;  1ZHF A;  3LSK A;  4J00 A;  3PSF A;  2XPU A;  3LSM A;  2HGC A;  2RVC A;  2YS9 A;  3DF8 A;  4F91 B;  1IN6 A;  4EJW A;  3NAR A;  2LMD A;  2E35 A;  5IP7 J;  2UWM A;  3K1N A;  2OJE D;  2QKL B;  2ZJP F;  3CD6 I;  1P92 A;  2M4G A;  1QU3 A;  1JTY A;  2KRF A;  5BMZ A;  2V1D A;  1DU0 A;  2UXN A;  1AA7 A;  1ON2 A;  3IKV A;  5IT3 A;  2LLK A;  3CCE I;  1SFE A;  2IP2 A;  4K2E A;  1S29 A;  2XGD A;  3GEZ A;  2EA4 A;  3OYF A;  5C3E J;  3AG4 H;  2YU9 J;  1PUF B;  4MTE A;  1GHC A;  3R0J A;  5AON A;  4M74 A;  3HTS B;  2E36 A;  1BR4 A;  2QQB A;  1WJ5 A;  2Z99 A;  3S1M J;  3M8F A;  5CYV A;  2DQR A;  1BW6 A;  1O3S A;  1OLT A;  2DJI A;  4L5I A;  1V5E A;  4L0Y B;  1YW7 A;  2XHK A;  3WTY C;  1X4P A;  1VQK I;  3Q9V A;  1PUE E;  2X1C A;  1I3Q J;  1ETQ A;  2XB5 A;  1VFC A;  3WTV C;  3E7L A;  4HDU A;  1ETW A;  2AQF A;  2XUB A;  2EFN A;  4IX7 A;  2QGU A;  1K78 A;  3OR1 C;  3ABM H;  1A6Q A;  1WH7 A;  5FD6 A;  1HDD C;  3HB9 A;  1AKH B;  1FOK A;  1HOM A;  2GZW A;  2UV1 A;  4RBO A;  3Q0W A;  2XAJ A;  2EA2 A;  2WA0 A;  2ISZ A;  3HOS A;  1DQU A;  1KU9 A;  4IHX A;  2YR2 A;  1VQL I;  2V9V A;  4XKV A;  4A5M A;  2CQ7 A;  2LSO A;  3VPR A;  3VOE A;  3PIP F;  2V1N A;  4UB6 C;  3AG1 H;  3FX3 A;  3LWF A;  5GPA A;  5ILS A;  3LFK A;  4NHJ A;  1DGW Y;  5KNL A;  2VBX A;  2F5E A;  4RB3 C;  4IEJ A;  4RMN A;  2HWV A;  2JWT A;  3P9I A;  3QYE A;  2HPI A;  2O8X A;  1XD7 A;  4MO7 A;  3RZO J;  2MLG A;  2EFO A;  2IEK A;  3QP6 A;  4LB6 B;  3J80 Z;  4GFB A;  2XF7 A;  1UHM A;  3VYR B;  2E19 A;  2NVQ J;  2DMN A;  4G7O F;  1CF7 A;  5IT9 K;  2QUF A;  4BUP A;  3MQ0 A;  3F8B A;  4IL6 C;  3HOT A;  2E7X A;  3HHH A;  2L2O A;  4XON A;  3ZPL A;  4XKC A;  4BYY A;  1AKH A;  3KEO A;  2V4J C;  3BTJ A;  4CCL A;  1K83 J;  1GVJ A;  2IT0 A;  1FSH A;  4P5O A;  4IHS A;  1QVU A;  4O5V A;  2R7R A;  1LFB A;  4OIO F;  3N05 A;  1UHW A;  4LGW A;  1TWA J;  3MAJ A;  5HS7 A;  4DJA A;  3WGI A;  1D8J A;  3MMY B;  2TRT A;  3LOC A;  3T1B A;  2GXA A;  1F36 A;  2F4M B;  3H9Q A;  3TO7 A;  1Z1D A;  2VB6 A;  1FYK A;  1U5T C;  2XV4 S;  3V7S A;  1G3W A;  4BDY A;  3LSH A;  4ON0 A;  1X1C A;  2P7V B;  4Q4Z F;  3SZT A;  4L9V A;  3F22 A;  4PK4 A;  3PM1 A;  1ITY A;  1OCP A;  4XL9 A;  3WOD F;  4JP0 A;  1LDJ A;  1A5J A;  1Y6I A;  1JJ8 C;  3HRM A;  1XMA A;  2EIN H;  3T8R A;  1DP7 P;  1QPM A;  3LL7 A;  5LD2 C;  2JJ7 A;  2XDV A;  1FSE A;  1XGM A;  3UR3 C;  1BIA A;  1V4R A;  1FOW A;  3BY6 A;  2QKM B;  2KRC A;  4DYR A;  3SZG A;  1X2M A;  2BW3 B;  1QPI A;  2R5Z A;  2XAH A;  4KIF A;  1TT5 B;  2AO9 A;  3MZ8 A;  3JRB A;  1T98 A;  1Z7U A;  2BHZ A;  2DT5 A;  2HTS A;  4DOZ A;  2Z5U A;  1L3L A;  2OCC H;  2X6X A;  4GGG A;  3TED A;  1ZLK A;  4C2T A;  5HS9 A;  4MQ9 F;  4KIS A;  2IBD A;  1Z9C A;  2EV5 A;  2FEZ A;  2HU9 A;  5EZH A;  5DYM A;  1SFO J;  2EFW A;  4UY8 I;  2VQH A;  3DV8 A;  3DBL B;  3CUO A;  2W25 A;  1W36 D;  3SJM A;  1MJA A;  4IQJ A;  5M5X J;  3SFZ A;  4XN3 A;  3HKZ N;  3SDG A;  1VND A;  2A69 F;  2VON A;  1G2H A;  1IRX A;  4YIR X;  4OIQ F;  1WH5 A;  1X1P A;  3R0A A;  1VQ5 I;  1W7P B;  5DD8 A;  1FBS A;  2DDA A;  2E5Z A;  2XAS A;  3GFL A;  2OBP A;  5D5X B;  1RKW A;  5FLX Z;  4G12 A;  4Y15 A;  1D0Z A;  1P2F A;  2KRH A;  4PSW A;  4XOR A;  1ZGW A;  3IC7 A;  1P7I A;  4IHW A;  3F9K A;  2BW3 A;  3V8L A;  5M3M J;  3ELK A;  4IHV A;  4UUV A;  3GX4 X;  3BZK A;  1B4A A;  5F08 A;  3GLX A;  2CV1 A;  2JUG A;  2BEO A;  4IRH A;  1S5L C;  1SVL A;  4KIT B;  4M71 A;  1MBJ A;  1IV6 A;  1ZQ3 P;  3O2P E;  1VI0 A;  1EH7 A;  1FMV A;  2XRO A;  2KIU A;  2LP0 A;  4D0P A;  4AIK A;  2A05 A;  1KYZ A;  1WVR A;  3IKT A;  1I27 A;  3OOP A;  5JVG F;  3RI4 A;  2X1E A;  2BGC A;  2HVR A;  1RET A;  3QQA A;  3OYD A;  2ZBK A;  2KP6 A;  3H36 A;  4D5C A;  2XRL A;  1RZ4 A;  4XRS A;  2NNY A;  2STW A;  1W7P A;  2MC3 A;  1W0T A;  4DBR A;  1E17 A;  2R7W A;  3GF2 A;  3LSR A;  2JT1 A;  1Z7L A;  4WXC A;  3DEW A;  3OIP A;  4MFE A;  5KAF C;  4ENN A;  2OQG A;  1FTZ A;  1MH3 A;  3FBN B;  1VQ8 I;  2WAQ A;  1VQ6 I;  3I55 I;  1BI1 A;  2K86 A;  2BV6 A;  3DKY A;  3H5A A;  2BVL A;  2F6C A;  3IH2 A;  5HNH A;  2IS1 A;  4KA4 A;  1VQ7 I;  4E7H A;  4GYG A;  5ED4 A;  3VOD A;  1TTY A;  4W1U A;  4ENK A;  1G4D A;  2IGK A;  2KPM A;  4ZYA A;  4NNJ A;  2A68 F;  4I6Z A;  4LMY A;  2CU7 A;  3L9F A;  5DCF A;  1T6S A;  3FWE A;  3EQL F;  3LAJ A;  2JQ7 A;  2HNH A;  1YTY A;  3QOD A;  1OIS A;  4B09 A;  5FKN A;  3TW7 A;  3LSP A;  2PBI A;  4U0W A;  1IC8 A;  3SZP A;  2EIM H;  3KEQ A;  1H9G A;  4CGZ A;  3WTT C;  5M5Y J;  2NNN A;  1FPQ A;  2VAS A;  3OY9 A;  1J2X A;  3CQZ J;  4A3D J;  3I5U A;  4WXD A;  4ZYD A;  2ZFW A;  1H9T A;  4HNU A;  2W85 A;  3DPU A;  1ETK A;  3WTX C;  3Q0U A;  3S3N A;  3GBG A;  2NVU B;  3QYF A;  1S7E A;  4FTH A;  2O03 A;  2MD5 A;  2DOD A;  1GV2 A;  3MKY B;  3RQ4 A;  3HYI A;  3WE2 A;  3FM5 A;  1UG0 A;  2D5V A;  5K7H A;  3GYH X;  5HNF A;  3RKW A;  4B3X A;  5HOD A;  2CQQ A;  4WX9 A;  2L4A A;  4XLC A;  3EUK L;  3GXO A;  5ERI A;  1JJ6 C;  4BBS J;  1B9N A;  1IUY A;  4HBL A;  3LQQ A;  4ENM A;  1P4W A;  1TC3 C;  4U0Y A;  1IUF A;  3N97 A;  1IV8 A;  4UV8 A;  1HW1 A;  5ICE A;  2LR8 A;  5BPI A;  3BOQ A;  1TLH B;  2E1O A;  3RKX A;  3BZ6 A;  3DTI A;  3BZC A;  3CUQ B;  3D5L A;  1HBX G;  2VKD A;  3BC8 A;  2K3F A;  2KIQ A;  2OUM A;  3I4P A;  1YO5 C;  2VT2 A;  3E6D A;  2VE9 A;  5J47 A;  4MTD A;  4P96 A;  2Y31 A;  1XSX A;  2MG4 A;  4MIM A;  2L7Z A;  3CES A;  4AU7 A;  2FJ1 A;  2EQR A;  3E3V A;  4NUB A;  2HOS A;  2J5P A;  3KLO A;  3A03 A;  2JZY A;  3RQI A;  2H6C A;  1Z0X A;  4KMF A;  2BY2 A;  3OMY A;  3AAF A;  2ME0 A;  1Y0U A;  2FMY A;  3F23 A;  3N4M A;  1QVT A;  2HKO A;  1OR7 C;  3RDI A;  3D1N I;  1I6H J;  2IW5 A;  1ZEL A;  2DOE A;  1O7L A;  2QA4 I;  5CVV A;  3IHU A;  3LST A;  3BTL A;  1R22 A;  5E1X A;  4C2U A;  1Z77 A;  3ZMD A;  5AIQ A;  1I5Z A;  2IA2 A;  2R4G A;  3CLQ A;  3CUQ A;  4P55 A;  2LRE A;  3CCM I;  1WJC A;  2DU9 A;  3H3V K;  3KYC B;  1B8I A;  4CZZ A;  4XN0 A;  3K69 A;  2L3D A;  2DO7 A;  1IDY A;  3QU6 A;  3PUF A;  5DM6 F;  1LEA A;  1JTX A;  1GLN A;  3K10 A;  4KT6 A;  3EYY A;  2L01 A;  4Q5S F;  3BJO A;  3W6J B;  5D8L B;  3DFG A;  5FO5 A;  2STT A;  4ZZD A;  1GT0 C;  3IAM 2;  5KHD A;  1KA8 A;  1D8K A;  3ABK H;  2DFI A;  4XKB A;  4YEL A;  3S93 A;  2EV0 A;  1ON1 A;  3M1E A;  1BI0 A;  3OSF A;  2CJJ A;  2JSP A;  3GFJ A;  4LK0 F;  2OPT A;  3K1P A;  5GAE J;  1R1U A;  2RQQ A;  4HG2 A;  4XLE A;  2R7T A;  3IWF A;  2Y30 A;  1YX3 A;  1P4X A;  3GME A;  5LLQ A;  4FE7 A;  3MZY A;  3GZ6 A;  2I5U A;  4BNC A;  1NG7 A;  3G4S I;  1VZ0 A;  4ZYH A;  4IOA F;  1SAN A;  2FQ3 A;  2LY2 A;  4Q48 A;  1LEB A;  1XTA A;  2F5D A;  2BBY A;  4M3B A;  1K79 A;  4PGG A;  2A6T A;  4EJT A;  3M8E A;  5E1Z B;  1RRJ A;  2DW4 A;  2K5C A;  2QQ9 A;  2E2J J;  1V5F A;  2L7M P;  2H94 A;  1OJL A;  5BOX A;  2BVM A;  1ETO A;  2CYY A;  2K9Q A;  2KDO A;  1D1A A;  4P9F A;  4L9T A;  1ZRC A;  4G6T B;  1WJD A;  3DLL F;  5DM7 F;  3CCL I;  4XIC A;  3Q0V A;  1APL C;  2ZCW A;  1IN8 A;  2W48 A;  3NWT A;  4BHC A;  1Z67 A;  5DDG A;  2QF7 A;  1SEU A;  1PDN C;  1MMN A;  4G7Z F;  3CC4 I;  3K7A J;  1G6N A;  1BIB A;  2H8W A;  3PJR A;  4IJA A;  3M07 A;  1KZH A;  1RNL A;  2M4K A;  1KYW A;  1ONV A;  3QPH A;  4RB1 A;  1R23 A;  3FIS A;  5FLM J;  4HAM A;  2PMH A;  2H8R A;  4JX5 A;  3L2Q A;  2WV1 A;  2DA3 A;  1LVA A;  3R4K A;  2FNA A;  3G71 I;  2KKO A;  1F5T A;  1HW2 A;  2ELK A;  2A3S A;  2COB A;  3OIQ A;  1O3R A;  1MBF A;  1MMA A;  1KGS A;  4FT8 A;  1YG2 A;  3BG5 A;  1NH3 A;  1XDU A;  1OCO H;  2O6G E;  3K4L A;  1IN5 A;  4KMU X;  1VTN C;  2X1D A;  2NOG A;  1HCR A;  1UG2 A;  2ZME C;  3ISP A;  2LRD A;  4DBQ A;  2D1V A;  2VQG A;  3KEY A;  1VQO I;  3C1D A;  3HDD A;  1LNW A;  1JT6 A;  2H09 A;  2EH3 A;  3FKJ A;  1ENH A;  2KQR A;  5E20 A;  2PMU A;  5FKM A;  1D0Y A;  3FDY A;  1SFX A;  1RR7 A;  3JRE A;  3F21 A;  4E7I A;  1SMY F;  1F43 A;  3K4B A;  4ZJZ A;  4PJ0 C;  2ETH A;  1XMX A;  1SD7 A;  1GDT A;  2HFH A;  2P6S A;  1NHA A;  5GTH C;  1ULY A;  2CW7 A;  2LVS A;  4HDV A;  3OSG A;  3RYP A;  5K7F A;  1MJB A;  5D5V B;  3S2H J;  4CCJ A;  2MC4 A;  1ZRE A;  2V1U A;  5LEJ A;  4HX4 A;  2CUJ A;  2XSJ C;  4BJ6 C;  2ZXW H;  1IZ1 A;  1R6R A;  2VKV A;  3HL2 A;  2Y9Z A;  1U78 A;  1BR1 A;  1F4K A;  3WTZ A;  1LVK A;  3V7C A;  5DS9 A;  4ENJ A;  2VPR A;  5DUK A;  5HDG A;  3A2K A;  4ZDO A;  4B47 A;  2V7F A;  2ZSI B;  3IL2 A;  2OU2 A;  2IA0 A;  2UZK A;  2K7L A;  1R49 A;  1RUO A;  3L2U A;  3OYH A;  2F2E A;  4MQV A;  2DXI A;  1DP3 A;  4Q47 A;  3E6M A;  4QPO A;  2ZNY A;  4UHT A;  3SXY A;  2XAQ A;  3QPL A;  4QWQ A;  4FHT A;  3AL0 B;  4S05 A;  3F6V A;  2HYG D;  4YEJ A;  3Q5F A;  3BQY A;  3ERE D;  4WK8 F;  2YX4 A;  4ASN A;  3VWB A;  1Z3Y A;  1QHH D;  3GFM A;  3M1C A;  3BR3 A;  2ZNZ A;  2ZJ2 A;  3KZY A;  4ZH4 F;  4UVB A;  3SQN A;  1D5Y A;  2CMP A;  1TWH J;  4X0G A;  2EIJ H;  3MCZ A;  4OIR F;  2B7E A;  3G73 A;  3BG9 A;  2ACJ A;  3H9G A;  1GVD A;  1Z6R A;  2PJR A;  3TOB A;  4F92 B;  3FHZ A;  3GZ5 A;  5F64 A;  3ZMT A;  1JKP C;  1L0O C;  4BXU A;  1VF9 A;  4G6D A;  1FYM A;  5L3F A;  2L5Q A;  3B73 A;  1IJW C;  1KON A;  2R7X A;  5EDN A;  3W2V A;  2GXG A;  4RGU A;  2CW8 A;  1K4S A;  4JX6 A;  3E1S A;  2E1N A;  3HTU A;  2QSG X;  3RSN A;  1U0J A;  2ELJ A;  2HZT A;  1A6I A;  1W4M A;  2MA3 A;  2WAE A;  4N0B A;  4HF2 A;  3DWL E;  4OIP F;  5FRM A;  3JSO A;  4OAY A;  2FNP A;  3HRT A;  3LA3 A;  2R7O A;  2X9D A;  3FXJ A;  2EZH A;  5J1Y A;  3M3Y J;  3K4C A;  4RB2 C;  3GTP J;  2LF7 A;  3HOW J;  2ZSH B;  3OS0 A;  3DTE A;  2MSY A;  3I71 A;  4LD5 A;  3L2W A;  4A3G J;  2FF4 A;  2ELH A;  3JCU C;  2M0M A;  3HC7 A;  4MEX F;  1UB9 A;  3BR5 A;  2LBF B;  3L09 A;  4AIH A;  1G3S A;  3QU3 A;  1SFU A;  5K5Q A;  4AYB A;  5FB2 A;  1O3T A;  2GA1 A;  3PNT A;  3P9C A;  2E1M C;  3CJN A;  3CCR I;  1K78 B;  4UB8 C;  5TGT A;  2L9V A;  2GQQ A;  3NQO A;  4BE1 A;  2VOD A;  4NC7 A;  3GUD A;  4XQF A;  2P81 A;  2W4S A;  4EVI A;  2DT7 B;  3TW6 A;  2HQN A;  2Q0O A;  4UV9 A;  2DPD A;  1OMI A;  2WAQ N;  2HDD A;  2VBW A;  2W1O A;  2PEX A;  4CCM A;  4BEH B;  4HNT A;  1YS7 A;  4FIS A;  3H92 A;  1R5H A;  4I76 A;  2DMP A;  4M72 A;  2OAZ A;  2P5L C;  1IAW A;  2LY1 A;  2XGE A;  3I54 A;  2QVO A;  4BXF A;  3FK7 A;  5GP9 A;  2CUE A;  4RAG A;  2YU3 A;  3T5X A;  2G7U A;  1ZR4 A;  1C0W A;  2P4W A;  2OA4 A;  2OTL I;  2EB7 A;  2KIF A;  1HST A;  5L3B A;  2LBF A;  2TCT A;  1LE8 A;  2L7F P;  4HRI A;  1IN7 A;  5FLV A;  2XPV A;  1JKO C;  1S7A A;  3FXO A;  3ZP5 A;  1EH6 A;  2AS5 F;  3WTW C;  1WI3 A;  2RAE A;  1CF7 B;  5EYR A;  1KQ8 A;  4XMY A;  3GW2 A;  2D1H A;  1QRY A;  3COA C;  4BGD A;  3CCS I;  1S6L A;  2WV0 A;  2MAB A;  3KP5 A;  5LHH A;  2ECB A;  1I39 A;  3ZRG A;  4EM1 A;  1E3O C;  3BCB A;  4BEH A;  2X48 A;  2XVC A;  4IVN A;  1ZR2 A;  3G1O A;  2OZ6 A;  3J81 K;  2L9N A;  1FOX A;  5HLG A;  5J1R A;  2RNG A;  4N9H A;  2DJN A;  3PUB A;  2HQR A;  3K1M A;  2VN2 A;  3PO3 J;  4L9J A;  2P0W A;  2E7W A;  3M8J A;  2XF6 A;  2DA4 A;  4AID A;  2HVS A;  2LOO A;  3WU1 B;  2ZC2 A;  3FXU A;  1YQA A;  2IGO A;  1OKR A;  1MSF C;  2OCE A;  3J7Z I;  2JUC A;  1FTT A;  2WY7 Q;  2RQP A;  9ANT A;  2PQ8 A;  2BYV E;  3TMO A;  5GTI C;  4V19 K;  3BRO A;  4WF2 A;  4EJV A;  4Z2Y A;  4AIJ A;  3WU2 C;  2F4I A;  3KET A;  3HZJ A;  4DNC A;  3O8H A;  3JAM K;  2VT3 A;  3GLL A;  1TW3 A;  3L2R A;  2DYS H;  1N75 A;  1S8N A;  2L7K A;  1O3Q A;  2KZV A;  5H6R A;  3HRS A;  3AG3 H;  1XSV A;  3I59 A;  4KT5 C;  4CUG A;  4TV7 A;  5K7Z A;  2K3P A;  1OCR H;  3K4N A;  1AU7 A;  3AFH A;  1WZ2 A;  1J9I A;  1K61 A;  2FBI A;  1WGX A;  2WWY A;  3GTQ J;  4HNV A;  3CJQ B;  2Y9Y A;  1B1B A;  2BY1 A;  4YII A;  1OCT C;  1AHD P;  1VQN I;  4EAT A;  2R5Z B;  2XB0 X;  3HJE A;  1BC8 C;  4X6A J;  4BHP A;  1HKQ A;  1TZL A;  4A0Z A;  3EUA A;  4F55 A;  3CC7 I;  4ANJ A;  2DPU A;  3BR6 A;  1YOV B;  4A3F J;  2EWN A;  3LA2 A;  4ABZ A;  1Q1H A;  4OU0 A;  4NBQ A;  5EGO B;  5D8K B;  2AHQ A;  2WC2 A;  2Y0S A;  1XS9 A;  3CME I;  4WWC A;  1E3P A;  1Z3X A;  3F8C A;  4GCV A;  4A12 A;  3GTM J;  1PJR A;  4PJN A;  2DOF A;  1UFM A;  2AXT C;  3TP3 A;  2KJC A;  3WHB A;  5ILV A;  3JTH A;  3RYR A;  3S2D J;  5CPR B;  3MKW B;  4I99 C;  3C2G A;  3SEQ A;  4XRS G;  3E0J B;  2GA2 A;  1Q1V A;  1JE8 A;  3FMS A;  2NOJ B;  3W2W A;  4XLF A;  4QSH A;  1ZN2 A;  4KYW A;  4RGR A;  2FUG 2;  3CCJ I;  1D1B A;  5D5W B;  3AKZ A;  4L9N A;  2NAZ A;  5HLH A;  3ULQ B;  1QO0 D;  2WAD A;  1HQC A;  3GO5 A;  4Y17 A;  3PFY A;  1EKE A;  2R7Z J;  4RAF A;  4IQ4 A;  4X1E A;  4A0X A;  2BXY A;  2ZXJ A;  2OV7 A;  5D4S A;  1TQP A;  3BG6 A;  2JPC A;  3FF5 A;  3IV5 A;  4NC6 A;  5EGO A;  4E6K G;  3C3W A;  3V42 A;  3ZN1 A;  5HVQ C;  1G8X A;  4XR6 A;  2FQ4 A;  2K85 A;  3MEX A;  2K9M A;  1KU2 A;  1BBY A;  2Y2Z A;  3QPS A;  2VUM J;  3CMM A;  2LKX A;  2XRN A;  1ZLJ A;  3TDZ C;  3JTG A;  1A04 A;  1J5Y A;  2E60 A;  4BE0 A;  1S9H A;  4IRG A;  1TNT A;  2P8T A;  1MDM B;  5C4X J;  3TL4 X;  3MZH A;  2MH2 A;  4M9S A;  2XAG A;  2R7D A;  4AM3 A;  1MBH A;  3GVA A;  3DBH B;  2O5R A;  1MJ9 A;  1JGG A;  3BDD A;  4E70 A;  1H8A C;  3S3O A;  1DGR M;  2M87 A;  2X85 A;  4NQW A;  3EUH C;  4BJT A;  5A2Q Z;  3A0B C;  1JHF A;  1TW2 A;  2M0C A;  3DXJ F;  2F5C A;  5JI6 A;  4B48 A;  1OYY A;  3JSP A;  3OIO A;  1OQY A;  1T33 A;  3OL3 A;  5ICG A;  2DA1 A;  4M6X A;  2GOX B;  3PNY A;  1J59 A;  4E7K A;  3EET A;  2MYS A;  2LKP A;  3F6O A;  1T39 A;  1MDM A;  3JRD A;  3BG7 A;  2OF7 A;  3VYS B;  4BQA A;  3PO2 J;  2RGV A;  4M3F A;  4YIF A;  5LRS A;  4EV0 A;  4JK1 X;  4H0E A;  4M6Y A;  2PLY A;  5IYD J;  1R1T A;  2GOM A;  1MBE A;  2KIS A;  4E7Z A;  4QIW N;  2I10 A;  3H3U A;  3RKQ A;  1YW9 A;  1U5T B;  2DFE A;  3LA7 A;  2HOT A;  3B6C A;  1YJ9 I;  2AQE A;  3TOA A;  1UZC A;  5J4Y A;  4LG0 A;  1MH4 A;  2JA8 J;  2KFD A;  3PIO F;  3I9V 2;  4HA8 A;  2RDP A;  3HEF A;  4LIT A;  1UAA A;  1MMD A;  1BR2 A;  1MW7 A;  2GBY A;  3QOP A;  4FCY A;  3BG3 A;  1GUU A;  1Y8R B;  5K5O A;  3KP6 A;  1IRF A;  4CYC A;  1YI2 I;  2QLZ A;  5JHF A;  1JHH A;  5HDN A;  3HOV J;  1LDK B;  2Y75 A;  4GYI A;  3QAH A;  3TO6 A;  1LFP A;  3IP4 B;  4D5F A;  4BY1 J;  4DZP A;  2MGQ A;  4J01 A;  3OYK A;  5LRR A;  3CCY A;  1QZY A;  4L5J A;  1CQT A;  2Z33 A;  4HST A;  1R4N B;  1U5T A;  2FD5 A;  3P9K A;  2HR3 A;  3HRU A;  4ZC3 A;  2LY9 A;  1ZGA A;  4RAZ A;  4BL0 B;  4LG3 A;  4HYE A;  3L1P A;  3SEZ A;  2W57 A;  4JYK A;  1V5G A;  3OYN A;  1UJ8 A;  4MNU A;  4FAS D;  3H9J A;  4HLY A;  2E2I J;  3K70 D;  1Y1W J;  1W0U A;  3A0H C;  4GO1 A;  3ZMV A;  1XCV A;  3JRI A;  3OYI A;  1FIA A;  4ITV A;  2VOO A;  4GDF A;  3L2C A;  3A02 A;  3KLN A;  4I98 B;  4LLN A;  3WE3 A;  1P6R A;  3CJT B;  2ZJR F;  1I1G A;  2YPR A;  3S17 J;  2W7N A;  2DOA A;  3FXK A;  3BTI A;  2DMT A;  2PI0 A;  2QQ8 A;  2QSF X;  2FBK A;  1B8I B;  4L18 B;  3H5N A;  4G8X A;  1R36 A;  2BXZ A;  4XOT A;  5F1J A;  1HKS A;  1T08 B;  5IYB J;  1YIJ I;  4NDL A;  3CP2 A;  3KZI C;  3QP5 A;  3KP3 A;  5E8G A;  4ESF A;  3ZQH A;  2GIV A;  4IHY A;  4PJM A;  3IRR A;  2R3S A;  2IJL A;  3J81 Z;  1UMQ A;  1S7O A;  2E2H J;  2NYX A;  3BLY A;  2JA7 J;  3U1K A;  4DW6 A;  2ID3 A;  2JVH A;  4CH7 A;  2DK5 A;  1DUX C;  5H2F C;  2A61 A;  3RPU A;  5L3D A;  4BQO A;  4AVP A;  1FWZ A;  3OYB A;  3W2A A;  3GCM A;  1BA5 A;  3ZOB A;  4ZYG A;  2F48 A;  1XN7 A;  1XMK A;  3W3C A;  5LGN A;  1K7A A;  5H20 A;  4KIB A;  2GIZ A;  3WTU C;  2VXD A;  4DIQ A;  2M30 A;  4BH9 A;  5F27 A;  1Y39 A;  2EIL H;  3WGG A;  5IT9 Z;  3KZZ A;  2EJR A;  1SAX A;  1DU6 A;  3UNG C;  2VXZ A;  1Z91 A;  4M9Z A;  1FT9 A;  4AYB N;  3CDH A;  4CZC A;  2CUZ A;  2O3F A;  3DQV C;  3ZR8 X;  2KJB A;  5F0C A;  1X3W B;  3KIO A;  4OWR B;  5LHI A;  4A3E J;  2DFH A;  3HOY J;  1YIT I;  1Y1V J;  3IUO A;  3FIW A;  3H0D A;  3C18 A;  4RM3 A;  2DA6 A;  1EV7 A;  5KAI C;  2VQC A;  2DA7 A;  2KHM A;  2VC0 A;  4RDU A;  1W36 C;  4HPQ A;  4ZYE A;  4IPA A;  4R1H A;  2ESH A;  1U6G A;  2L02 A;  5E1W A;  2R7Q A;  3U1D A;  2L4M A;  1XX5 A;  3CZ6 A;  4FET A;  4PGH A;  4AD9 A;  1ACI A;  2GLO A;  2FML A;  4IO9 F;  3DLA A;  3ZMS A;  1A36 A;  2M9H A;  3L00 A;  2HDW A;  1VQ4 I;  3CDI A;  4M3G A;  1VQP I;  2A07 F;  4JBA A;  3TGN A;  3ZQ7 A;  4PSX A;  4BJ5 C;  3FBI B;  4HEA 2;  5HLI A;  1E3H A;  3MVP A;  5FGM A;  1EH8 A;  2CSO A;  2EV6 A;  5D5U B;  4L0Z B;  3GWZ A;  2M45 A;  1YS6 A;  1I3A A;  2QZ8 A;  1E0E A;  3BR0 A;  2QBY A;  5J4V A;  1J7K A;  2ZFU A;  1NTC A;  3S8P A;  4B8X A;  5GAH J;  3CTA A;  5F0F A;  1BOB A;  1T0F C;  2RNJ A;  2HS5 A;  3CF2 A;  3DP7 A;  5J6X A;  2XGC A;  2VJ5 A;  3V7R A;  1XG1 A;  4HW0 A;  4A3M J;  3TP0 A;  1YFH A;  5KCM A;  5EJC A;  1IO2 A;  1MIJ A;  3BT9 A;  4OAZ A;  4S04 A;  3F8F A;  3QWL A;  1W7P D;  4KUM A;  1WSU A;  1H88 C;  2H1K A;  2QWW A;  4P1W A;  3U2R A;  3V8K A;  3S1Q J;  1ZKG A;  1FY7 A;  2DN0 A;  3HM5 A;  3SYT A;  3R6S A;  4A3I J;  1M1E B;  4YRV A;  5E3M A;  1MND A;  3OYG A;  1YJW I;  1J09 A;  1RKT A;  4LLL A;  4NC8 A;  2L0K A;  1TNS A;  5CKT A;  2A6E F;  2Q1Z B;  4F7Z A;  4XLP F;  3VDX A;  1R71 A;  2BOL A;  5E18 F;  3HXL A;  2WTE A;  3ONQ A;  1YX5 A;  2TDX A;  2VL8 A;  4Z6Y A;  1EA3 A;  1QBJ A;  2Z1D A;  1FEX A;  5DV5 A;  1QQI A;  3ZQL A;  4LB5 A;  3DEE A;  5B1A H;  4CCO A;  1G3Y A;  5ICF A;  2QQA A;  2LG4 A;  1HKT A;  3REO A;  1G59 A;  3AG2 H;  2ZB9 A;  4N4O B;  5CVI A;  1TT0 A;  2LDU A;  3IAS 2;  4OMZ A;  2RRE A;  4Y33 A;  1MD0 A;  3ZMZ A;  4BS9 A;  4EQQ A;  3K6G A;  3ZN0 A;  5FKO A;  2LNB A;  1Y56 A;  2JTV A;  1RIO H;  4U7D A;  2VBZ A;  2BY0 A;  5E8I A;  3HOZ J;  1OPC A;  3VFZ A;  4KIC A;  1Y8Q B;  1SAU A;  3ZQG A;  2PJR B;  2NS8 A;  4RS8 A;  1EF4 A;  2OZU A;  2Y0S N;  1XB4 A;  5EG0 B;  3CO7 C;  1MGT A;  5JLW A;  4V2F A;  2OC6 A;  2ICW G;  3JRC A;  4ZDP A;  4M6V A;  4KJZ A;  3MKL A;  1H0M A;  5LGT A;  3OYC A;  2VJJ A;  4FX4 A;  4IXA A;  4LJZ F;  1OR7 A;  4HSR A;  3ERM A;  2K4J A;  3H0G J;  1BI3 A;  5JR3 A;  4BQN A;  2FOW A;  1PP7 U;  4M3E A;  4HX7 A;  3K70 C;  2DCE A;  4RB0 A;  3JRG A;  3R60 A;  2X51 A;  1LJ9 A;  3K2A A;  2K02 A;  2RKH A;  5TIS C;  2ZO4 A;  4XLH A;  6PAX A;  2L54 A;  2W24 A;  1ZRF A;  3LSJ A;  1JGS A;  3KFW X;  1JXS A;  2XGX A;  3BPV A;  4PFP A;  3SFI A;  3ZQI A;  4NB5 A;  3VYU B;  2DMU A;  3KYL A;  2YX7 A;  2K9L A;  3P7N A;  5EG0 A;  3C7J A;  2A5Y B;  5LEK A;  2HTJ A;  3L7W A;  1POG A;  3E6C C;  2EZK A;  1UEL B;  2CV2 A;  3FKI J;  4AUX A;  3S3M A;  5JHU A;  2PN6 A;  3C2B A;  4B4C A;  1P9Q C;  4XNF A;  3HBL A;  3CO6 C;  3ABT A;  1KQ9 A;  1UHS A;  5C44 J;  1VQ9 I;  1ETY A;  2XC7 A;  4D1Q A;  4QPQ A;  3RJP A;  3GTG J;  4ZDL A;  4A6E A;  1X4O A;  5FRN A;  1YE9 A;  2DT6 A;  3P5J A;  1HSJ A;  1N78 A;  1HW5 A;  2FOK A;  3BP8 A;  2K4B A;  4BKX A;  2DAO A;  3C2H A;  3JRH A;  3JR9 A;  5GPC A;  5D4R A;  1RUN A;  1K4T A;  2R93 J;  5B3S H;  2RN7 A;  4I7H A;  4PDK A;  3GTO J;  1WJE A;  5E3O A;  1LE8 B;  3CC2 I;  3FM3 A;  2XIG A;  2CFX A;  3D5S C;  3KP4 A;  4V2G A;  3A4C A;  5IPA A;  5FFX A;  4A2U A;  3LSG A;  2IGM A;  3E5Q A;  4W97 A;  1LFU P;  2Q8K A;  2E34 A;  2ZME B;  2R5Y B;  1FP1 D;  2IS4 A;  4HLX A;  4RLF A;  5M5W J;  2Z9O A;  3I53 A;  4ESB A;  4IKF A;  5EEH A;  4CSW A;  5BQT A;  1ETV A;  2CW0 F;  3DKX A;  3WG7 H;  1GXP A;  4Y4R A;  1T0F A;  5IP9 J;  4C3I J;  4DZJ A;  2Z3Y A;  2ISY A;  5H6Q A;  4I2O A;  2V6E A;  1QNT A;  2UUZ A;  2ZKZ A;  4U88 A;  3DTK A;  4XRM A;  4XID A;  3V4G A;  5LBQ A;  1D3Y A;  1IG7 A;  4MEY F;  1IGN A;  4GRI A;  3ROU A;  4DYQ A;  3M9A A;  2V9K A;  4II3 A;  4FQG A;  5JFR A;  3G1M A;  3GTK J;  3FHN A;  1JI8 A;  1W5C C;  2ZXI A;  3LAP A;  1IXC A;  4M73 A;  1DPR A;  2LFB A;  3BPX A;  1WHU A;  3KYD B;  2ZME A;  2DK8 A;  2R5Y A;  1U3E M;  3IRQ A;  2J5O A;  2QYO A;  4IRI A;  2QCO A;  4CA0 A;  4I0A A;  1OYI A;  3CCV I;  4O3M A;  5CVJ A;  2EZI A;  3F72 A;  5F6F A;  4EEF G;  2DDB A;  2MD0 A;  2BHY A;  3FK6 A;  2VIX A;  1R5G A;  4KIG A;  1FP2 A;  5GAD J;  2JN6 A;  3I59 B;  3LSI A;  4G9Y A;  4XM3 A;  5FKK A;  2M8G X;  2WB1 N;  2VPL A;  2X4H A;  5EF6 A;  3CCU I;  5JLX A;  1LPQ A;  2H6B A;  1X19 A;  2CH0 A;  3DEU A;  3ZMU A;  4E7L A;  1SD4 A;  2L9R A;  1XSD A;  1FLI A;  4PJL A;  1VQM I;  1J0R A;  1DDN A;  2OTJ I;  2RC4 A;  3OS1 A;  1PUF A;  1T8I A;  1R4M B;  2O7O A;  3CP8 A;  3FXQ A;  5IYC J;  4ZTJ A;  4KN4 X;  2QSH X;  3H3Z A;  1YJN I;  5CLS A;  5HLT A;  2HXO A;  1ZAO A;  5LFA A;  5DCM B;  3SDB A;  2LF8 A;  3E5U A;  3NEU A;  5J8C A;  2CQN A;  2QM3 A;  1IXS B;  3PQJ A;  4G94 A;  2CQX A;  1HLV A;  4D7M A;  3S16 J;  3G3Z A;  3U9G A;  5CQG A;  5D6F A;  1SVO A;  2F5F A;  2Y0M A;  2YUS A;  3H1C A;  5DTD A;  3K4J A;  3JW4 A;  2VLA A;  1TWG J;  4A3C J;  1R9T J;  1HF0 A;  3F8M A;  1SC7 A;  3HUG B;  2DTZ A;  3WG9 A;  2C6Y A;  5FJ8 J;  5BNG A;  1X1B A;  3OYE A;  2DLL A;  2ZXH A;  2K9S A;  1FJL A;  1U2W A;  1NK2 P;  1XPX A;  3EPZ A;  3HPG A;  2CRG A;  1ZRD A;  4BE2 A;  3FXR A;  4BU2 A;  2O8K A;  4XSX F;  2NS7 A;  3TO9 A;  5EEG A;  3GTJ J;  1RC9 A;  2HQA A;  2MFZ A;  5DCM A;  3RTR A;  1O7F A;  2E1M B;  3DPL C;  2GWR A;  1AWC A;  5L3C A;  4MHG A;  5EZG A;  5J1U A;  3OR2 C;  1CGP A;  3L2V A;  3I56 I;  5K5R A;  4PJJ A;  3F3X A;  1UCR A;  1JUP A;  1JKQ C;  2UXX A;  2WAF A;  3PNV A;  5K1Y A;  4I09 A;  4MFD A;  5D6E A;  3MKZ A;  1WQ2 A;  4R79 A;  3K4K A;  1JKR C;  2JSC A;  2DQL A;  1XGO A;  2ADU A;  3DU6 A;  2CQK A;  3HUG A;  4B44 A;  4EGZ A;  1RR8 C;  1XGN A;  3F0C A;  1TL8 A;  1SFK A;  2K9N A;  3TBI A;  3ASO H;  1X1A A;  3HOU J;  1ZH5 A;  1I50 J;  4YFN F;  2R92 J;  1Z05 A;  2XAU A;  2VE8 A;  2G7H A;  2GM4 A;  3HGG A;  3ZQF A;  3LFU A;  4A69 C;  4UXN A;  1S72 I;  3DU5 A;  1ETX A;  4RGX A;  1IRZ A;  2M2E A;  2M34 A;  4NQW B;  4OOI A;  4RA2 A;  3GTL J;  3RKY A;  2ESN A;  3GZN B;  2FSW A;  2HOE A;  1TWF J;  2NRA C;  4UVA A;  2LYC A;  2P5V A;  3K2Z A;  3FXM A;  3PL8 A;  4CDG A;  4E4H A;  5JVT A;  5TRD A;  1T38 A;  4HQM A;  2EBI A;  1ZYR F;  1QZE A;  2GAU A;  3I64 A;  2D2W A;  1MBG A;  2JPB A;  3FXL A;  3QRF F;  5HDK A;  2HQ5 A;  1GV5 A;  1BOA A;  2FBH A;  2BE5 F;  3I4N J;  4HQE A;  4HV6 A;  2V79 A;  5ICC A;  4O6J A;  2YSR A;  2IVM A;  5J40 A;  2ME6 A;  1WJB A;  4Y7N J;  1MMG A;  2AXL A;  1ODD A;  1W1W E;  1D5V A;  1P4A A;  2O0Y A;  3CUQ C;  1UST A;  4ETS A;  3O6B B;  2P5K A;  2DMQ A;  5B1B H;  3V8J A;  4IF4 A;  2NVT J;  5FD5 A;  1WCM J;  3FMQ A;  1YRN B;  2PG4 A;  3HSF A;  3G1L A;  1A35 A;  4HF1 A;  3VSL A;  4LG0 B;  3M7G A;  1FBU A;  1PYV A;  3QYB A;  2O61 A;  1R58 A;  3S2W A;  1HC8 A;  4M3D A;  2QEX I;  1V54 H;  3K0L A;  3KCC A;  3S1R J;  2W82 A;  4EMS A;  3I3L A;  3HIF A;  3RZD J;  1R7J A;  4UVC A;  4DYC A;  1NK3 P;  4IZZ A;  4YFX F;  5IOZ A;  3K9T A;  3HSR A;  4AWX B;  4CYC B;  1N77 A;  1TBX A;  3ML6 A;  3O3K A;  3BQZ A;  1FMW A;  3OOU A;  4CCK A;  3G2B A;  4XLN F;  3PSI A;  2HI3 A;  3HHG A;  1X58 A;  3MD2 A;  2R0Q C;  5J3L A;  4C3H J;  1FZP B;  5E79 C;  3W6V A;  3D5R C;  1XDS A;  3ECO A;  3OWT A;  4H4K C;  5FRO A;  3ZQQ A;  1LDD A;  3B6A A;  3DCF A;  5M3F J;  2FA5 A;  1ZGJ A;  1WJA A;  2EPF A;  1FIP A;  4XLA A;  4II2 A;  1YRN A;  1BN5 A;  4HF0 A;  1U8B A;  2IGN A;  1WPK A;  4A93 J;  4LFU A;  4F93 B;  1BM9 A;  3BR2 A;  2R7V A;  3VEP A;  2XPW A;  1SMT A;  4AC0 A;  2MW8 A;  2NS0 A;  3S32 A;  3K4M A;  1QHG A;  4QTR A;  1USS A;  1X3U A;  3ESW B;  1K6Y A;  1MNE A;  1LB2 A;  1FX7 A;  5BPD A;  5CQE A;  3I58 A;  2MLK A;  5E3N A;  2HPM A;  1KU7 A;  5IY5 H;  2HYF A;  3BCA A;  2WB1 A;  1Y0N A;  3KPH A;  3NAU A;  4HV5 A;  3A01 B;  3X2Q H;  1REP C;  1IXR C;  5L3E A;  1V3F A;  4DGW B;  2PFB A;  1B72 B;  3KP7 A;  3RPQ A;  1YW8 A;  2DBB A;  1LQ1 A;  4UNO A;  3MN2 A;  1ZK8 A;  1BC7 C;  4BBR J;  2CO5 A; 
#chains in the Genus database with same CATH homology
 1MNM C;  1JJ8 C;  5IP6 A;  3BR5 A;  3BT9 A;  1H88 C;  2H1K A;  1RES A;  5E3L A;  3S1Q J;  1ZKG A;  2DN0 A;  3HM5 A;  4D7N A;  2JJ7 A;  4A3I J;  5E3M A;  2JA5 J;  1RKT A;  2L0K A;  4C2M J;  1T56 A;  2P81 A;  2XSD C;  4DYR A;  5F0H A;  1X2M A;  3TW6 A;  1QPI A;  2CUF A;  2R5Z A;  2PMZ N;  2WAQ N;  2HDD A;  2AO9 A;  3JRB A;  4FIS A;  3A01 A;  4I76 A;  4BXX J;  3TED A;  2DMP A;  4BY7 J;  2IBD A;  1B72 A;  5EZH A;  2HOA A;  2XGE A;  2JK3 A;  4B1R A;  3ZQL A;  1SFO J;  1FEX A;  3FK7 A;  5GP9 A;  2CUE A;  4FE4 A;  1ZR4 A;  2NVY J;  2ZB9 A;  2TCT A;  3SJM A;  1LE8 A;  2L7F P;  5M5X J;  5FKO A;  3HKZ N;  3SDG A;  1VND A;  5FLV A;  1G2H A;  2XPV A;  1JKO C;  1WH5 A;  1U9N A;  1RKW A;  1WI3 A;  2RAE A;  4G12 A;  5EYR A;  3HOZ J;  1MBK A;  1QRY A;  2G0E A;  3ZQG A;  2JA6 J;  2NS8 A;  1ZGW A;  1P7I A;  4IHW A;  1EF4 A;  2NVX J;  5M3M J;  2Y0S N;  5EG0 B;  2ECB A;  4IHV A;  5JLW A;  4V2F A;  5F08 A;  1E3O C;  3JRC A;  3LNQ A;  2X48 A;  1ZR2 A;  4M6V A;  3G1O A;  3MKL A;  1MBJ A;  5J1R A;  4XK4 A;  1IV6 A;  2DJN A;  1ZQ3 P;  4UUS B;  1VI0 A;  3I4M J;  2LP0 A;  3PO3 J;  3H0G J;  2DA4 A;  2X6O A;  1RET A;  3QQA A;  4M3E A;  1MSF C;  3JRG A;  3HOX J;  4D5C A;  2XRL A;  3K2A A;  4XRS A;  1FTT A;  2HYJ A;  4L5E A;  4UUT A;  9ANT A;  1W0T A;  2JMW A;  3LSJ A;  3LSR A;  3DEW A;  4MFE A;  3SFI A;  3ZQI A;  3O8H A;  2DMU A;  1MH3 A;  1HDP A;  1FTZ A;  5EG0 A;  3S1N J;  3IH2 A;  1POG A;  2ECC A;  2EZK A;  3FKI J;  4BBR J;  4AUX A;  3C2B A;  1JT0 A;  5K7Z A;  1AU7 A;  4B4C A;  4UUS A;  3HBL A;  1K61 A;  1WGX A;  2K40 A;  4JX4 A;  4W1U A;  3GTQ J;  1UHS A;  4HNV A;  5C44 J;  2Y9Y A;  1ETY A;  1OCT C;  1AHD P;  4I6Z A;  2N8G A;  2R5Z B;  2XB0 X;  2CU7 A;  3IH4 A;  2LTP A;  4S0H B;  4X6A J;  3GTG J;  3S15 J;  1ORK A;  2EZL A;  4BKX A;  3JRH A;  3BR6 A;  3JR9 A;  5FKN A;  4A3F J;  3TW7 A;  5GPC A;  4ABZ A;  3LSP A;  5EEA A;  2R93 J;  1IC8 A;  5EGO B;  2AHQ A;  2VI6 A;  3GTO J;  1XS9 A;  5E3O A;  5M5Y J;  2KDZ A;  1LE8 B;  3GTM J;  3CQZ J;  4A3D J;  4V2G A;  3TP3 A;  3WHB A;  5IPA A;  5FKL A;  3JRF A;  3S2D J;  1ETK A;  3Q0U A;  3LSG A;  2LK2 A;  3GBG A;  4W97 A;  4XRS G;  1LFU P;  1S7E A;  4FTH A;  3JRA A;  1Q1V A;  2R5Y B;  1GV2 A;  5M5W J;  1OFC X;  4QSH A;  1ETV A;  2B63 J;  2D5V A;  5K7H A;  5IP9 J;  4C3I J;  5C4J J;  1BL0 A;  4DZJ A;  2R7Z J;  5HOD A;  1BJZ A;  2CQQ A;  4X1E A;  1JJ6 C;  4BBS J;  4A3B J;  4XRM A;  4XID A;  1ZTR A;  2O9L A;  5F04 A;  1TC3 C;  1IUF A;  2IAI A;  3IV5 A;  1IG7 A;  1IGN A;  5EGO A;  2LR8 A;  4DYQ A;  2E1O A;  2FQ4 A;  2HXI A;  3G1M A;  2Y2Z A;  3GTK J;  3QPS A;  2VUM J;  2LKX A;  2Y31 A;  2MG4 A;  4MIM A;  2L7Z A;  2LFB A;  2FJ1 A;  2R5Y A;  2EQR A;  2HOS A;  3BR1 A;  3A03 A;  2QCO A;  3RQI A;  3HGY A;  1Z0X A;  4Y52 J;  2EZI A;  4EEF G;  5C4X J;  1TWC J;  3FK6 A;  2ME0 A;  1U9O A;  1QVT A;  3D1N I;  1I6H J;  2JN6 A;  1MBH A;  5FKK A;  1JUM A;  2M8G X;  1O4X A;  2WB1 N;  1JGG A;  5EF6 A;  5JLX A;  1H8A C;  2FX0 A;  3BTL A;  3BTC A;  1Z77 A;  3CMY A;  2L9R A;  2DA5 A;  2DA2 A;  1X2N A;  3UKG A;  1XC5 A;  3H3V K;  2M0C A;  1B8I A;  1PUF A;  2O7O A;  3OIO A;  1T33 A;  4J19 A;  5IYC J;  2LD5 A;  1IDY A;  2DA1 A;  1JTX A;  3Q3S A;  4C3J J;  2HXO A;  1GT0 C;  3O8G A;  3JRD A;  2OF7 A;  3S14 J;  3PO2 J;  4M3F A;  2CQX A;  3OSF A;  1HLV A;  5IYD J;  2CJJ A;  1MBE A;  4D7M A;  3S16 J;  2OPT A;  4QIW N;  2I10 A;  4A3K J;  3RKQ A;  5DTD A;  4A3L J;  2YUS A;  3IH3 A;  1TWG J;  4A3C J;  3CDL A;  2HOT A;  2Y30 A;  3B6C A;  1R9T J;  1HF0 A;  2DTZ A;  1JUS A;  4FE7 A;  5IOY A;  5FJ8 J;  1MH4 A;  2JA8 J;  5BNG A;  3WHC A;  3HEF A;  1SAN A;  1H89 C;  2VKE A;  1RPW A;  4M3B A;  2GBY A;  2K9S A;  4LOC A;  1FJL A;  1NK2 P;  4FCY A;  3BG3 A;  1IDZ A;  1BW5 A;  1GUU A;  2CRG A;  2E2J J;  2ID6 A;  3M4O J;  2L7M P;  2O8K A;  4MLO A;  2NS7 A;  3GTJ J;  4CYC A;  1OJL A;  4B3A A;  3HOV J;  1ETO A;  2K9Q A;  2KT0 A;  1P7J A;  4XIC A;  3Q0V A;  1APL C;  5EZG A;  5J1U A;  2W48 A;  4D5F A;  4BY1 J;  2QF7 A;  3K7A J;  4DZP A;  1JUP A;  2MGQ A;  3ZQC A;  1MSE C;  1JKQ C;  3CCY A;  1CQT A;  4MFD A;  2FD5 A;  1JKR C;  2LY9 A;  3FIS A;  3L1P A;  3F0C A;  5FLM J;  4A3J J;  2K9N A;  2H8R A;  4JYK A;  4JX5 A;  2WV1 A;  2DA3 A;  3HOU J;  1I50 J;  2XPU A;  2YS9 A;  2R92 J;  2ELK A;  3NAR A;  5IP7 J;  2E2I J;  2COB A;  2GM4 A;  1MBF A;  1Y1W J;  1W0U A;  3BG5 A;  3HGG A;  3ZQF A;  4A69 C;  3JRI A;  1FIA A;  1ETX A;  3A02 A;  1JTY A;  1IRZ A;  2M2E A;  2M34 A;  3GTL J;  2NOG A;  1DU0 A;  1HCR A;  1UG2 A;  3S17 J;  3BTI A;  1TWF J;  2DMT A;  2LLK A;  2XGD A;  1B8I B;  5C3E J;  2YU9 J;  1PUF B;  2EBI A;  3HDD A;  1JT6 A;  2EH3 A;  1ENH A;  5FKM A;  5F1J A;  5IYB J;  4NDL A;  3S1M J;  1F43 A;  1RR7 A;  3JRE A;  1MBG A;  1BW6 A;  3ZQH A;  2HQ5 A;  1GV5 A;  1GDT A;  4IHY A;  3I4N J;  1UMQ A;  2LVS A;  3OSG A;  5K7F A;  2E2H J;  3S2H J;  1I3Q J;  1ETQ A;  2XB5 A;  2JA7 J;  2ME6 A;  4Y7N J;  4DW6 A;  1VFC A;  2ID3 A;  3E7L A;  1ETW A;  2VKV A;  2Y9Z A;  1U78 A;  2DMQ A;  1BA5 A;  2NVT J;  5DS9 A;  1WCM J;  1YRN B;  3ZOB A;  2VPR A;  3G1L A;  1WH7 A;  1HDD C;  3HB9 A;  1AKH B;  1HOM A;  4M3D A;  5F27 A;  4RBO A;  3Q0W A;  3S1R J;  1DU6 A;  4IHX A;  4AYB N;  3RZD J;  4DYC A;  1NK3 P;  3VPR A;  5GPA A;  5F0C A;  5IOZ A;  4CYC B;  3OOU A;  3QPL A;  3BQZ A;  4A3E J;  3HOY J;  4IEJ A;  1Y1V J;  2HI3 A;  2JWT A;  1X58 A;  2R0Q C;  3BQY A;  3FIW A;  5J3L A;  4C3H J;  3W6V A;  4MO7 A;  3RZO J;  2DA6 A;  2IEK A;  3B6A A;  3BR3 A;  3DCF A;  5M3F J;  2DA7 A;  4GFB A;  2E19 A;  4RDU A;  2NVQ J;  2DMN A;  1D5Y A;  1FIP A;  1TWH J;  1YRN A;  3BG9 A;  1U8B A;  1WPK A;  4A93 J;  1GVD A;  1AKH A;  1JKP C;  2GLO A;  3BTJ A;  1VF9 A;  3BR2 A;  1K83 J;  2M9H A;  2XPW A;  1QVU A;  4AC0 A;  2MW8 A;  1LFB A;  1IJW C;  5EDN A;  1TWA J;  4M3G A;  2TRT A;  4QTR A;  3LOC A;  4JX6 A;  3MVP A;  1F36 A;  5E3N A;  4A3M J;  1A6I A;  3BR0 A;  3NAU A;  3A01 B;  1NTC A;  2X9D A;  5F0F A;  2EZH A;  5J1Y A;  3M3Y J;  3GTP J;  3HOW J;  3PM1 A;  1B72 B;  1ITY A;  1OCP A;  2XGC A;  2MSY A;  3MN2 A;  4JP0 A;  4A3G J;  1XG1 A;  1ZK8 A;  3TP0 A;  1A5J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...