1MBGA

Mouse c-myb dna-binding domain repeat 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MYB PROTO-ONCOGENE PROTEIN
publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbgA00
1AHDP 1VNDA 2HXOA 4C2MJ 1WGXA 3GTQJ 1ETQA 2CJJA 1GV2A 1K61A 2FD5A 3HBLA 3B6CA 1I6HJ 2X48A 1FTTA 4D5CA 3Q3SA 2GBYA 3OOUA 2HOSA 3BR1A 2DMQA 2KT0A 1A5JA 2NVXJ 3HKZN 3IH4A 1GVDA 1POGA 3G1LA 4A3MJ 3BR3A 3LNQA 3SJMA 1ETXA 4M3DA 5JLXA 1NK2P 5J1RA 2XB0X 1B8IB 1A6IA 1ETWA 3K2AA 3SDGA 3ZQGA 4A3CJ 1MBFA 5M5WJ 1P7IA 4Y7NJ 4MFEA 3GTPJ 4C3IJ 4AUXA 5EGOB 3S2DJ 9ANTA 3LSGA 4M3FA 4W1UA 1F36A 4M6VA 5C44J 5J1YA 2YUSA 3JRGA 1JUMA 3S17J 1ETOA 2EZLA 3HGGA 1T56A 1E3OC 1IUFA 2JA6J 1DU6A 1Q1VA 3SFIA 1ZK8A 3BR2A 1F43A 2IAIA 4BBRJ 4XRSG 3HOVJ 3GTOJ 3PO2J 2FQ4A 4FE4A 2ECCA 3Q0WA 1X2MA 3ZQLA 2XB5A 2RAEA 2WAQN 2GM4A 1MBJA 3DEWA 3JREA 2K40A 3HOZJ 2ELKA 5EZGA 3B6AA 2DN0A 3O8GA 4IHWA 5K7ZA 2VUMJ 3ZQCA 4FISA 4AC0A 3M3YJ 4QSHA 2ID6A 3CDLA 5F27A 4UUTA 5IOZA 4A3FJ 1NK3P 1GDTA 2GLOA 2LTPA 4B1RA 2EZKA 1QVUA 3OSGA 3BG3A 1WI3A 2CUEA 3I4NJ 2K9QA 3JR9A 4JX4A 2QCOA 2IEKA 4MLOA 4DZJA 1DU0A 1T33A 1TWFJ 5F08A 1ZR4A 5M5YJ 2E1OA 2ZB9A 4FE7A 5FKOA 2EH3A 2XRLA 1IG7A 1BW5A 1MBGA 1RESA 1IC8A 4A3JJ 2YS9A 2FJ1A 3BR5A 2CUFA 2CQXA 3M4OJ 4GFBA 3S14J 4DZPA 1JUSA 3BTJA 5J3LA 4D5FA 1ZTRA 2W48A 2FX0A 3RZDJ 2YU9J 2DA4A 4IHYA 3A02A 2VKVA 1RKWA 2HQ5A 2Y9YA 1JUPA 3H3VK 3HOYJ 4DYQA 4IEJA 1U8BA 2JWTA 2JK3A 3S16J 5IP7J 2LD5A 3IH2A 3LSRA 1JT6A 4NDLA 4XRSA 5EYRA 1ETYA 2H8RA 1U9OA 3MN2A 2M0CA 1H88C 2WV1A 2CQQA 4B3AA 4CYCA 2PMZN 1U9NA 2JN6A 2O7OA 3PO3J 1LFBA 3RKQA 3VPRA 2H1KA 1TWCJ 1WPKA 3C2BA 3G1MA 1HDPA 1VFCA 4A3BJ 4IHXA 2MGQA 2XPVA 2K9NA 3CQZJ 3LSPA 3RQIA 3GTLJ 1LFUP 2OF7A 1JGGA 2Y2ZA 1APLC 4JX6A 3BQZA 1HCRA 1H8AC 1TWHJ 3JRFA 1FJLA 4JX5A 5F04A 2NS7A 3S2HJ 1WH7A 3IV5A 3HDDA 3JRDA 4DYCA 2EZIA 5EZHA 1QPIA 3ZQHA 2ME0A 2LK2A 2HXIA 5IYCJ 3JRAA 2JA8J 4D7MA 5IYBJ 4M3GA 3LSJA 4A3KJ 3S15J 2NVYJ 1JKPC 4DW6A 1G2HA 5K7FA 4CYCB 1TWGJ 3OSFA 4XK4A 2R7ZJ 1IDYA 2OPTA 4MO7A 2E2JJ 2O8KA 2R5YA 2N8GA 3TW6A 4Y52J 3ZOBA 2XGDA 5IOYA 4V2FA 1I3QJ 2LVSA 4RBOA 1UG2A 1HLVA 1PUFA 1ZQ3P 3S1NJ 5J1UA 2P81A 1K83J 2NOGA 1B72A 3BT9A 5F0FA 5HODA 2DMTA 1YRNA 4QIWN 1Y1WJ 5K7HA 1RETA 1MSEC 1ENHA 1ITYA 1X2NA 1WH5A 1AU7A 2DMNA 4ABZA 3L1PA 1W0TA 2HYJA 1OFCX 1GT0C 1VF9A 4I6ZA 3JRBA 3E7LA 3FK7A 1FEXA 3HOXJ 2JMWA 4IHVA 3BTCA 4S0HB 1IGNA 2E19A 1I50J 3HM5A 2COBA 4FCYA 3BQYA 4A3GJ 4BY1J 1BA5A 2L7ZA 2LY9A 2KDZA 4DYRA 3QPLA 3MVPA 2X6OA 2JA5J 1ZR2A 5FLVA 5E3MA 4A93J 1BJZA 1FIAA 1UMQA 3RZOJ 2DA1A 1QVTA 4MIMA 5DS9A 5IYDJ 2EZHA 2R5YB 1IJWC 2M9HA 1JKQC 1XG1A 2IBDA 5FKNA 2I10A 1PUFB 5GPAA 3HGYA 3GTKJ 2G0EA 1B72B 4I76A 2WB1N 5FKMA 3HOWJ 4V2GA 3I4MJ 4C3HJ 4D7NA 1ZKGA 2R5ZA 4A3DJ 4XIDA 4AYBN 2L0KA 3TW7A 1MNMC 2DTZA 1CQTA 2HDDA 2XGEA 2Y30A 5E3OA 1GV5A 3FISA 5EDNA 2DA2A 2DMPA 5EF6A 2TRTA 4HNVA 5EEAA 5E3NA 5M5XJ 2NVQJ 5M3MJ 1ZGWA 4XICA 2NVTJ 4B4CA 1GUUA 3D1NI 4FTHA 4JYKA 2ID3A 2L9RA 2XPUA 5IP6A 3Q0VA 1RKTA 1S7EA 3Q0UA 3H0GJ 1HF0A 5IPAA 2NS8A 4A3LJ 2XPWA 2HOAA 1MSFC 3FIWA 3NARA 2DA7A 4M3BA 5BNGA 1IV6A 4QTRA 1RR7A 4MFDA 4C3JJ 2LFBA 3TEDA 1LE8A 1MBEA 1H89C 3G1OA 5GPCA 4XRMA 2LP0A 2CRGA 3QPSA 2B63J 1EF4A 5FKLA 3PM1A 2LKXA 3ZQIA 1XC5A 4BKXA 3CMYA 3DCFA 2R5ZB 4X1EA 1ETVA 1Z77A 1SANA 2DA6A 3FK6A 4J19A 2R0QC 1IRZA 1OCPA 3HEFA 2L7FP 2M2EA 2M8GX 3CCYA 2L7MP 3JRCA 1OJLA 3S1RJ 1TC3C 5EG0A 2DMUA 2JJ7A 2TCTA 1UHSA 3NAUA 3A01A 3HOUJ 4X6AJ 3K7AJ 2DJNA 2MW8A 3BG5A 1D5YA 2QF7A 5F0HA 2Y9ZA 3A03A 2MSYA 1ORKA 1WCMJ 4A3EJ 1QRYA 3BTLA 1U78A 1MBHA 1JTXA 3GBGA 2D5VA 1LE8B 1JKOC 2K9SA 1AKHA 3IH3A 3MKLA 3WHBA 2LLKA 2LR8A 1JJ8C 4UUSA 3UKGA 4BXXJ 5FKKA 1NTCA 2E2HJ 2XGCA 2DA3A 2R92J 1Z0XA 1ETKA 2VI6A 2Y31A 3QQAA 1R9TJ 2ECBA 4BBSJ 4BY7J 4RDUA 1MBKA 2EBIA 2AHQA 2M34A 1XS9A 1FIPA 2VPRA 1VI0A 4LOCA 3WHCA 2HOTA 1JKRC 1O4XA 2VKEA 2ME6A 3O8HA 1FTZA 3FKIJ 5EG0B 1JTYA 2EQRA 3LOCA 1MH3A 4L5EA 3HB9A 5GP9A 3JRHA 1BW6A 1OCTC 3A01B 4W97A 4A69C 1IDZA 4JP0A 3GTJJ 2X9DA 2E2IJ 5F0CA 3ZQFA 3BTIA 3F0CA 5C4JJ 1P7JA 1X58A 1TWAJ 3BG9A 5M3FJ 2R93J 5JLWA 5FJ8J 5E3LA 2JA7J 5IP9J 2Y0SN 4M3EA 1SFOJ 3BR0A 1MH4A 5FLMJ 1Y1VJ 2MG4A 1AKHB 1BL0A 1YRNB 1RPWA 1B8IA 4G12A 4UUSB 4A3IJ 2XSDC 2DA5A 1JJ6C 3OIOA 1JT0A 3JRIA 2O9LA 5EGOA 3TP0A 5F1JA 1W0UA 1HDDC 4EEFG 5C3EJ 1HOMA 2CU7A 2HI3A 3S1MJ 3S1QJ 3TP3A 2AO9A 3GTMJ 5C4XJ 3BR6A 5DTDA 3GTGJ 3W6VA
chains in the Genus database with same CATH superfamily
3HIFA 4CA0A 1VNDA 2W82A 4C2MJ 4HDVA 1AHDP 3GTQJ 4QPOA 2CJJA 3CUQC 1YW7A 1GV2A 4HSTA 5KAFC 1TW2A 2VOOA 3K4MA 3IAM2 2CW0F 2B0LA 3N4MA 2O5RA 3F21A 3Q3SA 5GAEJ 3OOUA 4MTDA 4LB6B 4ASNA 3CJRB 3TL4X 1D8KA 1UB9A 2YU3A 4HDUA 2PMUA 3NWTA 2HNHA 2ZXJA 3CZ6A 2LF7A 3VFZA 3LNQA 1RUNA 1FLIA 2JUCA 3S8PA 1NK2P 4JBAA 2FE3A 3FXLA 3K2AA 2QWWA 1E17A 1UAAA 2VE9A 3FMSA 3ERMA 4MFEA 3H9JA 4C3IJ 3S2DJ 4FQGA 1I5ZA 3QPTA 4FHTA 3IWZA 1P2FA 5E1WA 2Z16A 3CC4I 1JHHA 2M5WA 2WB1A 2V4JC 2NNNA 4IZZA 5DDGA 2EZLA 1DDNA 3JCUC 2E7WA 1WWXA 4MQVA 1E3OC 3WTTC 1DUXC 2V79A 4I02A 1UFMA 3E0JB 3K4BA 1V5EA 2GXBA 3HOVJ 3GTOJ 3L00A 3PO2J 4AIKA 1FOKA 2FQ4A 2DT7B 2IS4A 1JE8A 3F8BA 2DYRH 5D5XB 5TGTA 2WAQN 2GM4A 4A5MA 3K1PA 4A6EA 3JREA 2LNBA 4RB2C 5EZGA 2E34A 1OLTA 2DN0A 3B6AA 3N97A 4IHWA 2MH9A 1VQ5I 3ZMVA 1VQ6I 4FISA 4AC0A 3J7ZI 4J01A 2K5CA 2W84A 2EA4A 2ID6A 4GYGA 5KHDA 2L01A 3OYFA 2WAFA 1NK3P 2K4JA 1GDTA 1WJ5A 3O2PE 1QVUA 4H0EA 1YS7A 2MLGA 2Y75A 4M71A 4B47A 1WI3A 2CUEA 4KIFA 2KRCA 5HNFA 3I59A 4BEHB 2O0YA 1W4MA 4XLEA 1ULYA 1JGSA 2VQGA 3FHNA 4MLOA 3TGNA 4BQAA 4RAYA 5E1XA 4EJOA 2BW3A 3WE3A 1VQLI 5F08A 3CMMA 3CCUI 2ZSHB 1WJAA 4KMFA 1SD7A 3I71A 2VT2A 1NG7A 1BW5A 1MBGA 2G9WA 2JT1A 1IC8A 5GAGJ 3BR5A 2CUFA 3U9GA 4ZTJA 4ZDPA 1EH8A 1QZYA 2IJLA 2CQXA 4P96A 1GXQA 4PJJA 4RGUA 3JAMZ 3FDYA 1U2WA 4XLPF 2EA2A 2M30A 3J7YJ 3S14J 2YR2A 1DP3A 2XF7A 3FZVA 2E7XA 4D5FA 2IPQX 1DPRA 3K70D 2IGNA 1R5ID 3AG2H 1PYVA 3ASNH 2K7LA 2VKVA 1RKWA 3H3VK 1JUPA 3HOYJ 1PDNC 4ZH4F 4IEJA 3RPUD 3JSPA 4EJVA 3F9KA 2KJCA 1Z9CA 4IHSA 4ZYHA 1TP4A 3F72A 3RJPA 3RPUA 3LSRA 1YW9A 3A2KA 1JT6A 3NEUA 1R49A 1MJAA 3RPQA 1O7LA 5LRRA 4AVZA 2LRDA 4N9HA 5DCMB 3UNGC 2X1DA 2MFZA 4KN4X 1U9OA 3CCVI 4IX7A 4DQ2A 4IRGA 2BVMA 1USTA 2HZDA 5LHIA 4CYCA 3QOPA 3N05A 1FX7A 5FLXK 3E1SA 1Y0UA 4XNFA 1T08B 5ILSA 3OS2A 3ABLH 2H1KA 3KP5A 1YOVB 1EJ9A 2K9MA 3C2BA 5JVTA 1O3RA 1OYYA 4XQFA 2XRNA 3KP6A 1YIJI 2MGQA 2Y0SA 2W00A 2X6YA 2NYXA 2QLZA 5A2QZ 2QBYA 3RQIA 3QP6A 2P6SA 2Y2ZA 4NC8A 3PSIA 1APLC 3GZ6A 1YIOA 1HCRA 1U5TB 4OOIA 4CO8A 3W2WA 5HOOA 3S2HJ 5HNHA 1SFXA 1VQ7I 2GA1A 1R36A 4XOPA 3WG9A 2JA8J 4HV5A 4LK1F 1SMYF 3RDIA 4D7MA 3GWZA 4XN3A 3WTZA 3M9AA 4B44A 4A0YA 1SD5A 2MD5A 4DW6A 5DD8A 2KPMA 1Z7UA 2K02A 1A35A 4R79A 4M6YA 2XVCA 3OSFA 3PNYA 4AD9A 3IKVA 4C9YA 2OPTA 4MO7A 1MMAA 2K9LA 1FZPB 4MNUA 2R5YA 2E2JJ 3TW6A 2H27A 3ZOBA 2XGDA 4RBOA 1PUFA 4LG3A 2LKPA 3PIOF 3CC7I 4YRVA 3H36A 1X19A 5F0FA 3KYLA 3HSFA 3KEYA 1Y1WJ 1L0OC 4J00A 2DO7A 1MSEC 1CF7B 2BGCA 2XF5A 4CICA 2C6YA 2KIQA 2DLLA 4YEJA 4ABZA 3LL7A 3GF2A 1GT0C 1KU2A 3CTAA 2ZJ2A 5J6XA 2HYFA 3J81Z 2W7NA 3S3MA 3VB2A 1YE9A 2EK5A 4ZDOA 3FK7A 3OIQA 4Z2YA 1FEXA 3TO9A 3BTCA 1IGNA 1PVEA 2E19A 2QZ8A 1ZG1A 2COBA 4FCYA 5D5VB 4PJ0C 2E5ZA 1MNEA 3RYRA 5FO5A 4BXFA 4H4KC 2KDZA 3HSRA 3QPLA 3WTWC 2P5VA 3MVPA 2HOEA 2UZKA 1ZR2A 2OJED 5LBQA 2CQNA 2DOEA 1HBXG 2HPMA 1BJZA 1FIAA 1QVTA 3OYEA 2Z5UA 5DS9A 5IYDJ 1ZH5A 3TDZC 3RIRA 5FKNA 5KVRA 4BJ5C 3QPHA 2A6EF 5GPAA 4E7HA 2HQRA 3HGYA 3OOPA 1XGOA 5HS7A 4B09A 4XSXF 2Y0MA 3LA2A 2PBIA 2KIMA 4HX8A 5E3OA 4ESBA 4XMYA 1LDJA 1T38A 4BGDA 4N4OB 2DMPA 2TRTA 4KN7X 3EUAA 5M5XJ 2DTRA 4ZJZA 3LSIA 3IHUA 3R4KA 3IRQA 1I1SA 2KRHA 2NVTJ 2VASA 3FBIB 1ZYRF 2K3FA 1W7PB 1P4WA 1WVRA 2DFEA 5IP6A 3Q0VA 2ZFWA 3H0GJ 4E7JA 2EWNA 2EIMH 1MSFC 3NARA 2DA7A 2IA1A 3BDDA 4LITA 4QTRA 6PAXA 5B3SH 1FYMA 3R60A 5AIPA 4BDZA 5GPCA 3G6EI 3GX4X 2XAUA 2V1UA 2LKXA 4DJAA 1A04A 4WX9A 4WXDA 2PX9A 4WXCA 1N78A 1SANA 4U0YA 3F6VA 5EEHA 3AG1H 2OBPA 1IN4A 4XL9A 1J09A 4HOBA 3JRCA 3A4CA 3S1RJ 1TC3C 2R7WA 1FBSA 2MABA 2NS0A 4L9JA 2JJ7A 2X4HA 3A01A 4BNCA 2GXGA 3CF5F 4X6AJ 4BEHA 1R4NB 2KZVA 5GTHC 2FOKA 5J4YA 1D5YA 1YITI 2Q0OA 5F0HA 1UCRA 5J8CA 3A03A 2ZFUA 3ZN0A 3KP7A 3CCLI 1ORKA 3HHGA 1QQIA 1WCMJ 1TT0A 4EGZA 2ZBKA 3BZKA 3KYCB 3DU6A 4EVIA 3A0BC 3V42A 3BTLA 3CCEI 1V4RA 4E7SA 1JTXA 2FBKA 3DKYA 3EYIA 1E3PA 3K4JA 2HTJA 2CMPA 3IH3A 4KFCA 1FP1D 2PMZA 3VODA 1B59A 2MBFA 1D1AA 1LKXA 1T6SA 4IOCF 2VI6A 3QQAA 1R9TJ 2ECBA 4HF1A 2PEXA 4ZYDA 1S7AA 2AHQA 1J75A 3V4GA 3CP2A 3KP2A 4RLQA 5CVRA 1EH6A 2STTA 1R1UA 1ZN2A 2BZTA 2FBHA 4LOCA 4UVCA 5CJ9A 3WHCA 1K7AA 4LD5A 3O8HA 2ME6A 3PJRA 4R8HA 2D45A 1JTYA 2MD0A 3FXOA 4GRIA 1TNSA 5D8LB 4DBQA 2DOFA 4HX4A 2X9DA 5LEJA 3BTIA 4G7ZF 5D5UB 2RNJA 5CLSA 3RSNA 1Z6RA 1XGNA 2RDPA 1WJBA 5LGNA 2JA7J 5IP9J 2BE5F 4FX0A 4ESFA 4A0XA 3DBRB 2LKSA 2P0WA 4BXUA 1AKHB 1UJ8A 2CSOA 1RPWA 3D5SC 1BL0A 1YRNB 2QSHX 1RRJA 1LB2A 3JAMK 2GIZA 2VJ5A 4UUSB 2KDOA 2FNPA 1VZ0A 2DA5A 1YX3A 4EM1A 1H9GA 1JT0A 5EGOA 4GGGA 5HDGA 2Q1ZB 4PFOA 1HDDC 1N75A 1XCBA 1GLNA 3WTSC 3SZTA 4U7BA 4RM2A 3S1QJ 1VQKI 4E6KG 3AG3H 3DLLF 3CCMI 3BR6A 2CGPA 3AKZA 1S72I 1RR8C 2Y69H 5E8IA 1U5TA 3REOA 3DP7A 3W3CA 5FLXZ 3PQKA 2JRMA 1A36A 2KLOA 2EV0A 2D2WA 3W2VA 1D3YA 2DJIA 3FHZA 3HBLA 3B6CA 2X48A 3CLQA 2OTLI 4D5CA 1EA3A 1HQCA 1S9HA 3V8LA 1VTNC 3BR1A 2QQAA 4PSXA 1A5JA 4WWCA 5JI6A 2OA4A 3G1LA 1YX5A 2DDBA 3NWSA 3HSEA 4E7IA 2O6GE 2OCCH 5J1RA 1B8IB 1W36D 1HC8A 3ZQGA 1R5GA 4UV9A 4NQWB 4A3CJ 1MBFA 3GYHX 5M5WJ 5D6FA 4CHUA 2QVOA 5L3GA 4OU0A 3LSGA 4W1UA 2DCEA 5E17F 2HVSA 1DGRM 1G3TA 1Z67A 5HVQC 3HRUA 5A2QK 3TOAA 3GMEA 3L2UA 5HLIA 3DLAA 1T56A 4LB5A 1SD6A 1Q1VA 3SFIA 5D8KB 1XB4A 3SDBA 4I98B 1QPMA 1XSXA 4XRSG 4Q48A 1K79A 2HQNA 2VBZA 4E7KA 2QSGX 3ABTA 4HQEA 3F3XA 2STWA 2CQKA 2ECCA 3B73A 1WHUA 4XM3A 2IP2A 3I3LA 4KA4A 2F4IA 1VQOI 5LHGA 1LEAA 2ELKA 3H1CA 3PQJA 4JQFA 1TQIA 3KE2A 1X4OA 5K7ZA 3ECOA 3HPGA 3SXYA 1MNDA 4UB6C 3ZQQA 3ZQCA 5B1AH 2KHMA 1FBUA 3SHFA 2QA4I 3BC8A 5FRMA 2EINH 4P9UA 2UWMA 2WWYA 2F4MB 4F7ZA 1XMKA 1Z1DA 2ESHA 2O3FA 2ZXWH 2EFWA 2WTEA 3PFIA 1G3YA 4MQ9F 4XKVA 3OSGA 3I4NJ 1OR7A 2L4MA 4IF4A 4LFUA 2K9QA 5H2FC 3S32A 2A5WA 2EIJH 4JX4A 3EYYA 1A6QA 4C30A 3J81K 1DU0A 3OYJA 2EFPA 2W25A 1WKMA 2VODA 1W7PD 1L3LA 2R3SA 4FE7A 5JVGF 3KIOA 2EH3A 3RI4A 3HG9A 2VLAA 1MJBA 5ERIA 1RESA 3OR2C 4A3JJ 2I8DA 2YS9A 1I27A 1TBXA 2XKPA 2PLYA 1MMSA 4HPQA 4MHGA 4GFBA 4DZPA 3TOBA 1X1AA 1JUSA 1BM9A 4RA2A 4XLHA 1FWZA 4LG0B 2FX0A 3RZDJ 5E8GA 2VBWA 2WBMA 4XORA 1R58A 2V1XA 2HU9A 4CCMA 4EJWA 2CW7A 2JWTA 1AOYA 3ERED 2BEOA 1MMDA 2O61A 2MH2A 2XHKA 3AFHA 3G73A 1LEBA 2L54A 1J7KA 1X1CA 4NDLA 3W6JB 3BCAA 3E5QA 3CESA 3OMYA 2ZNZA 4RB0A 4CXFA 4BU2A 2V9KA 2MLKA 4Y17A 5J47A 2GWRA 2RNGA 3DBLB 5LLQA 2CQ7A 2ZO4A 2DFFA 3S3OA 4HX7A 2LY2A 4RB3C 1SEUA 1QU3A 2O7OA 5J4VA 5KAIC 4PK4A 1LFBA 3RKXA 3Q9VA 3CJTB 3G1MA 2DOAA 2EFQA 1VFCA 4F92B 2Y48A 2DT6A 4HNUA 4M9SA 5K5QA 2CV0A 2XC7A 3SZGA 4U0WA 1T98A 2XPVA 4L9NA 1LVAA 2DW4A 4G6TB 3DTKA 2VONA 4QLCU 2OF7A 3J7AO 4BQNA 3ULQB 5L3BA 2CH0A 1BJAA 1P6RA 1H8AC 2WY7Q 3ZMDA 4JX5A 1P4XA 2NS7A 2X85A 2GXAA 2R7SA 2H6BA 1YI2I 3BJOA 1R1VA 2JSCA 2KIFA 3TO7A 3IRRA 1QPIA 3HDDA 1Y56A 2LYCA 4GXOA 1H9TA 2VL8A 3LA7A 2LK2A 2HXIA 5IYCJ 5KK1A 3KP4A 3JRAA 2Z1DA 4XKCA 1J9IA 2R7UA 2P7VB 3R0AA 2XAHA 2ZMEA 2D1VA 3NQOA 4PJNA 4P55A 5AIQA 3ESWB 1G2HA 2Z99A 4F52A 1IN7A 1TWGJ 3M7GA 2R7VA 3LSKA 2M8EA 2JSPA 1S5LC 2MYSA 1Y8QB 3U21A 4X0GA 3R0JA 2A07F 1HLVA 3CUQB 3S1NJ 2LC2A 2FXAA 3BWGA 1K83J 2IS1A 3Q9SA 3CCQI 3BT9A 1ACIA 1YRNA 5TRDA 2DFHA 1RETA 3R6SA 1DQUA 1BI2A 1ENHA 1IN6A 1ITYA 3VSKA 1HXDA 5ICCA 3C1DA 2Z2SB 3L1PA 3S3NA 1YTYA 2HYJA 1O3TA 1VF9A 2ISZA 3JRBA 4AM3A 3E7LA 5ICGA 2CYYA 3RYPA 2IGOA 2RV8A 1W5TA 1QNTA 3H3UA 1FMWA 4A3GJ 2LOOA 4PDKA 1XX5A 2QQ8A 4I01A 4YFNF 3IWFA 4PSWA 3FBNB 4KUMA 3CF2A 2XAJA 2X6OA 2JA5J 3WGIA 1ZHFA 1I1GA 3CUOA 1WQ2A 4NHJA 4BE2A 2DA1A 1B9NA 3W6KB 4B8XA 4DBRA 3FWEA 5J40A 2BXYA 2UUZA 2BY2A 3OYCA 2F5EA 4XN0A 2EZHA 2GA2A 3OL3A 2E5NA 2LY1A 1FOYA 3CCJI 2DXIA 5FRNA 2M9HA 3RKWA 2P4WA 4I7HA 2XDVA 4CZCA 2ZXHA 1R22A 1YLFA 2FMYA 3B02A 2QEXI 2WAQA 3FXMA 1B72B 3KZIC 3E5XA 4RMNA 3LFUA 2F48A 3I4MJ 2Q2EB 1XDUA 4D7NA 1IXSB 2R5ZA 4HLYA 5FFZA 4DIQA 2ZJRF 2L0KA 2XF6A 3CDIA 5ED4A 2DTZA 1CQTA 1N25A 4BACA 2Y30A 3FF5A 4PZJA 2IT0A 3FISA 2PJRB 2R7DA 2DA2A 5CVUA 2WY8Q 5ICEA 2FSWA 2HKXA 4HNVA 5EEAA 3CMAI 3NRVA 5DUKA 1X4PA 1TTYA 3PFYA 2ZCWA 2CFOA 4D0PA 3L2CA 4B4CA 1GUUA 3OYIA 3GZ5A 2DT5A 3V7SA 2L9RA 3ROUA 1F1ZA 2BY1A 1S7EA 1HF0A 1ZLJA 5D4RA 2JRTA 1FYLA 1D1BA 2MA3A 4ANJA 4U7DA 3RTRA 4FASD 4HRIA 1MW7A 3RKYA 3TBIA 2LFBA 2R4GA 1JHFA 3CLOA 2E1NA 1H89C 3G1OA 4CZZA 2DK5A 3LSHA 3WG7H 2GZWA 2B63J 2F5VA 4KT5C 3ZMUA 3PM1A 1R5HA 3ZQIA 1IXRC 1S3JA 3PSFA 4X1EA 2QUFA 1B6AA 2B7EA 2A05A 2DA6A 3QOEA 3FK6A 5DD4A 2KZGA 4XONA 3HEFA 4AIDA 2DPDA 1D0YA 2M2EA 4OIOF 4UVAA 2M8GX 4XLCA 5CPRB 3PNVA 4S04A 5EG0A 2VQHA 2OV7A 2DMUA 3EUHA 3O6BB 4II3A 4BJTA 3SFZA 4V19K 1WFXA 3FXQA 3K7AJ 2Z3YA 5BPIA 2AS5F 5FB2A 2FOWA 3T1BA 3HOTA 2M45A 4GYIA 3E6BA 5FROA 2DBBA 2M3AA 2OD5A 2OAZA 5FD6A 1XN7A 3SZPA 3ZRGA 3ZMTA 4B48A 5GTIC 1LE8B 1JKOC 2RREA 3H35A 2K9SA 2LR8A 1K78B 4G6DA 3BP8A 4P5OA 1NTCA 3HUGB 3DKWA 3M1EA 1K6YA 1PP8F 2PI0A 1J5YA 5ICFA 1ETKA 4BY7J 1E3HA 2PN6A 1G59A 1YS6A 4EM2A 3I0TA 3BPVA 1YHQI 1G3SA 1OMIA 2W57A 1VQPI 1FIPA 1VI0A 3CO6C 1JKRC 2VKEA 1R71A 4BQQA 3LOCA 3G2BA 2VJJA 1R4MB 3JRHA 1BW6A 1ZELA 1QBJA 2IS2A 3BZ6A 4A69C 2Q8KA 1IDZA 2VB6A 4HSRA 2JPBA 1ON2A 5HDKA 1RIOH 1IRXA 2Z33A 1UZCA 1GHCA 5E3LA 3BG7A 4GCVA 3LFKA 2EB7A 4DNCA 1KGSA 2PQ8A 5HS8A 1MH4A 1Y1VJ 2MG4A 3CMEI 4WXHA 3CD6I 2VXDA 1X1BA 2RKHA 1IAWA 3OIOA 1YJ9I 1QZZA 3JRIA 2O9LA 4RAFA 2DAOA 1W0UA 4EEFG 3VYUB 3BZCA 3S1MJ 4IPAA 2ETHA 4G94A 2DU9A 2AO9A 3GTMJ 4ZYEA 1SFEA 3QAHA 3VSLA 1ZG3A 2RC4A 3K10A 1O7FA 1WGXA 1MDMB 2GOXB 3OR1C 1CGPA 1IRGA 1Z6TA 4O6JA 3DXJF 3H5RA 5K1YA 3MD2A 3FM3A 1K61A 2LMDA 2H1LA 1I39A 2HQAA 4G7HF 4ZTFA 2GBYA 2HOSA 2KT0A 4XR6A 4UHTA 5L3DA 5DM7F 3HKZN 1LJ9A 3DF8A 4A3MJ 3OS0A 3BR3A 3C2HA 1IF1A 2AQEA 1HKQA 4ETSA 2JTVA 1OCRH 2KMUA 3LMMA 3WU2C 5JLXA 3O3KA 2XB0X 4KIBA 1ZLKA 3TQNA 1ETWA 3SDGA 1Y6IA 2ZMEC 1STZA 1P7IA 3QU6A 3T5XA 4Y7NJ 1Z3YA 4KITB 1YG2A 2KISA 3CUQA 4M3FA 1AA7A 1F36A 3QYBA 4M6VA 2OQRA 5C44J 5J1YA 4E7LA 2K27A 4YIFA 3L7WA 3P9IA 5CQGA 1JUMA 3JRGA 1FPQA 3S17J 2XSJC 4FETA 2XKOA 1ETOA 2L9NA 3HGGA 2DPUA 5GAHJ 2JA6J 1DU6A 1P9QC 4HBLA 3WGGA 3BR2A 1F43A 3J80Z 2IAIA 4BBRJ 3SEQA 4DOZA 3DEUA 3LA3A 3OYAA 1XSDA 1ZRFA 1X2MA 3OYKA 4UB8C 3ZQLA 5BOXA 3FXKA 3PNTA 4CCOA 2RAEA 1TQMA 1FYKA 1XTAA 1SVOA 2L3DA 4HLXA 1W5CC 3T8TA 2X6WA 2K40A 1W5SA 3JSOA 2XGXA 3H9GA 4MEXF 2H94A 1WJEA 3GVAA 2V1NA 4QWQA 1SFUA 1OPCA 5F6FA 1XMXA 4QSHA 1WZ2A 3CDLA 3U1DA 4RLFA 2X1CA 3HXLA 4UUTA 4YFKF 4A3FJ 1DPUA 1HA8A 2Q2EA 2PG4A 2LTPA 4B1RA 1K4TA 4BE1A 2AXTC 3FXUA 3E6CC 3BG3A 1BOAA 1QGPA 3BJAA 3JR9A 4G7OF 4IHTA 2IEKA 3K70C 1BR1A 1VQMI 5DCMA 1TWFJ 5HLGA 1QO0D 2FRHA 2K4BA 5F1RA 3OYGA 1ZR4A 3DU5A 1N77A 2E1OA 2ZB9A 3ZCOA 4UUVA 5FKOA 2XRLA 1YJNI 1IG7A 1WRJA 4LLNA 2OTJI 3A1YA 2H8WA 3F22A 4N9IA 2V6EA 2O03A 1IN8A 2NNYA 3FMRA 2A61A 3E3VA 4D9JA 4LJZF 4U88A 2H6CA 3C2GA 1A31A 1UG0A 3BTJA 3H5NA 5J3LA 4ZDLA 1ZTRA 5LEKA 1HSJA 3M1CA 1TT5B 2ESNA 5CVJA 4BUPA 3A02A 1D5VA 1FOWA 3K4KA 1X3ZB 1HW1A 2J5PA 1KZHA 1ON1A 1KYWA 3TKYA 3DTIA 2JK3A 3H9QA 4OWRB 3S16J 2YX4A 4IO9F 2OUMA 1KQ9A 2LDUA 2LD5A 3I59B 1C0WA 3AL0C 4BS9A 2A68F 4RM3A 4D1QA 3UR3C 4F3QA 2F4OB 4B43A 4XRSA 1TZLA 1ETYA 1V5FA 3I56I 1S7OA 2QSFX 2H8RA 1NHAA 3F23A 3MN2A 5LRSA 2PMHA 1X3UA 5IT9Z 2FQ3A 2WV1A 2CQQA 3FM5A 4B3AA 2BY0A 1O3SA 4KYWA 2EFOA 3PIPF 1SVLA 2QQ9A 1Q1HA 2L02A 2JQ7A 1V5GA 4IRHA 1TL8A 5LHHA 2RQQA 3PO3J 1YQAA 1TLHB 3RKQA 1OCCH 3EDPA 2E35A 1TWCJ 3EUHC 5DEQA 3VPRA 1WPKA 5HLTA 2L9SA 1HDPA 1V55H 4ENMA 1KYZA 4R1HA 4YG2F 4YIRX 3P7NA 2K9NA 2IA2A 3CQZJ 3VYRB 1YYVA 3DV8A 5ILUA 4WCGA 3ABKH 3LSPA 3GTLJ 1TNTA 1K78A 4RS8A 1SC7A 2YPRA 3U2RA 4N4NB 2XIGA 2X0LA 1CF7A 2HWVA 3BQZA 4JX6A 3L2VA 3TDUC 3JRFA 1FJLA 5F04A 3GFMA 3BLYA 3JRDA 4DYCA 2EZIA 5EZHA 3ZQHA 4CCNA 4A12A 2HGCA 4C2TA 4OAYA 3HZJA 5DM6F 3ZGKA 4HV6A 2JPCA 4M3GA 3I5UA 3LSJA 3WODF 1TW3A 4PJMA 1DP7P 2QKMB 5KNLA 1LVKA 3ZP5A 2Z9OA 2V26A 4HYEA 4XKBA 4BL0B 3OY9A 3F8NA 3OYBA 1QHGA 5JR3A 4CYCB 4XK4A 4MEYF 1J2XA 4HAMA 2E71A 4XLFA 1T8IA 1VQ9I 2N8GA 4CCLA 2VIXA 2BHYA 2LH9A 3M8FA 4KMUX 5LGTA 2R7OA 4V2FA 1I3QJ 2LVSA 1LQ1A 1SVMA 5FFXA 1P4AA 1UG2A 3C7JA 3GW2A 5J1UA 2P81A 3J7AY 3MZHA 2NOGA 4A2UA 5EJCA 2QBYB 5HODA 2DMTA 4QIWN 2F5CA 5K7HA 3AAFA 3MZ8A 4GO1A 1WH5A 2ZNYA 1IZ1A 3MAJA 3K1NA 1W0TA 1OFCX 2MC3A 2QGUA 3QYEA 4P1WA 4BHPA 4BH9A 5L3FA 4I6ZA 2CV2A 4PJLA 3SEZA 1RC9A 3I55I 3JTHA 4HA8A 2NXNB 1B1BA 3ZPLA 3ZMZA 4BY1J 3E5UA 2L7ZA 1BA5A 1Z21A 2LY9A 2FNAA 3DKXA 4DYRA 1W7PA 3WTVC 2XV4S 5FLVA 5CVVA 1S6LA 1Y0NA 5BS6A 1XGMA 5JHUA 3V8JA 3CCSI 1RZ4A 1SMTA 4OINF 4AIJA 2V9PA 2VKHA 4ON0A 4EV0A 3WU0A 2HS5A 2R5YB 4XOTA 2LBFB 4A5NA 5L3CA 1Y39A 3G3ZA 3MMYB 1PP7U 1XG1A 1H0MA 1BIAA 2NVUB 1XDSA 2I10A 1PUFB 3F8FA 3CO7C 1BC8C 3GTKJ 4BYYA 3DTEA 2WB1N 2XAQA 3IP4B 4RGRA 4V2GA 4TV7A 4AU7A 4C3HJ 2M7BA 1ZKGA 2W85A 2DQLA 2FU4A 4XIDA 4AYBN 1QZEA 3WU1B 1O3QA 4M74A 3TW7A 3X2QH 3K69A 2HDDA 3MZYA 1T39A 3ZQ7A 5CQEA 3CC2I 4IQJA 5CYVA 3ISPA 1KU9A 5LD2C 5EF6A 4KDPA 3RCOA 3V7RA 3OV8A 4PCQA 1ONVA 2VN2A 5E3NA 3CJNA 1ZGJA 5M3MJ 1BI3A 1ZGWA 4IL6C 5IT3A 1FMVA 1Y8RB 4G9YA 1BR2A 1FP2A 1U0JA 3VOEA 5HDNA 4FTHA 3E6MA 2NRAC 2ID3A 2XPUA 4P9FA 2VQCA 1RKTA 5H6RA 1X1DA 2KL4A 4A6DA 3K0LA 4A3LJ 2XPWA 2A3SA 4M3BA 5BNGA 3HOSA 4N0BA 1IV6A 3BOQA 3GFJA 3HRTA 2OU2A 4C3JJ 2NAZA 2VC0A 1KU7A 4M73A 3TEDA 1KQ0A 3ONQA 1B4AA 3FXRA 4HZFA 2HFHA 3KFWX 2ZSIB 2XROA 2XASA 4LIUA 3KZZA 3QPSA 2FEZA 2R7QA 4BKXA 2HVRA 2F5FA 1NG6A 1O57A 4RB1A 1Z77A 4OMZA 1BBYA 4NNJA 2VC1A 2O8XA 4G6QA 4J19A 2R0QC 3HRMA 1OCPA 3EQLF 3KCCA 2ZC2A 1XMAA 2NOJB 2W24A 2P5LC 1FBQA 3CCYA 5EEGA 2L7MP 1J59A 4BHBA 2K85A 2GAUA 3K2ZA 2TCTA 3NAUA 3HOUJ 4AYBA 5AONA 3DBHB 4U87A 1KU3A 2F2EA 2BBYA 1LFPA 2QF7A 1OCOH 3GO5A 2LSOA 4HF0A 3J80K 1SAXA 1REPC 2FUG2 4IRIA 2F6CA 2MSYA 2EV6A 1U6GA 5TJJA 3QYFA 3OYHA 3GBGA 2L7KA 2D5VA 2L9VA 4OMYA 1AKHA 3MKLA 1BIBA 4IVNA 3LSTA 4RGSA 4UUSA 1R6RA 3MKZA 4K2EA 1FNNA 2E2HJ 1LDDA 1LNWA 2V7FA 2XGCA 1ZGAA 2DA3A 2R92J 3K9TA 2Y31A 4BJ6C 4RDUA 2EBIA 1BOBA 2M34A 1DGWY 2F5DA 4IJAA 3VEPA 4JOMA 5ILVA 3I58A 1G6NA 1O4XA 1FTZA 5FGMA 3Q5FA 3BCBA 3FKIJ 3CJQB 4L5EA 1HKTA 1TQPA 5GP9A 3L2WA 1OCTC 3A01B 4UNOA 4JP0A 3GTJJ 2E2IJ 3M8JA 5F0CA 3ZQFA 1J0RA 3F0CA 2E36A 2M87A 3RQ4A 4KT6A 4AWXB 5C4JJ 3BG9A 3L9FA 2RN7A 1U5TC 4UVBA 2R93J 3E97A 4L5JA 2JA2A 3ZN1A 3ZXSA 3ABUA 2Y0SN 3FXJA 3K4LA 1FSEA 1MGTA 4GDFA 3IKTA 2P6TA 1V3FA 3BR0A 3K1MA 4PGGA 1U3EM 4KISA 4L18B 1B8IA 4BE0A 2IGKA 4G12A 4A0ZA 4NQWA 2A6TA 4PGHA 2M7AA 3E6DA 3DWLE 2BHZA 3D0SA 1T0FA 3TP0A 5F1JA 2FMLA 5C3EJ 2CU7A 2FA5A 3DFGA 1FC3A 3TP3A 4E70A 2G7UA 1FOXA 2A5YB 4PFPA 3GTPJ 3GTGJ 2LREA 4EMSA 5K5RA 2CS3A 3LAJA 1WJCA 3W6VA 2HXOA 1W36C 4FX4A 2W1OA 3G71I 3TO6A 1ETQA 1Z7LA 2OCEA 5B66C 2JUGA 1Z91A 1YW8A 3K6GA 2EJRA 2XAFA 2FD5A 1PJRA 1I6HJ 2L4AA 1FTTA 3OL4A 4ENKA 2DMQA 3V7CA 4NC7A 2NVXJ 2DYSH 3C18A 3IH4A 1GVDA 1POGA 4HEA2 1D1CA 2LF8A 1ERDA 2J5OA 5BPDA 2ADUA 3SJMA 1ETXA 4M3DA 4ESJA 5IT9K 3W2AA 2M4GA 3D5RC 3KP3A 4BAYA 4L0YB 1SD4A 1A6IA 3OWTA 4Y15A 5K5OA 4BQOA 4EJUA 4XLAA 4KJZA 4WK8F 3H5AA 3SQNA 5E79C 2DODA 5EGOB 4AUXA 9ANTA 5TISC 2KIUA 2HR3A 2VQLA 4ENJA 2QQBA 2IW5A 5DV5A 2YUSA 3HYIA 3ELKA 2COMA 1XPXA 4FT8A 3F6OA 5LFAA 3IUOA 4OIQF 1IUFA 2R7FA 4M6XA 1ZK8A 5CKTA 4CH7A 4L0ZB 1MJ9A 2UXXA 5D5WB 3P5JA 1JXSA 4FE4A 3KETA 3WTUC 1OR7C 3Q0WA 1WJFA 4IKFA 2XB5A 1D0ZA 3S93A 1OQYA 4LLGF 1MBJA 3DEWA 3HOZJ 3EETA 4PUSA 3K4NA 3O8GA 3VYSB 4F91B 1PUEE 5J8FA 2PJPA 2VUMJ 3LSMA 1X1PA 2VXZA 1IRFA 4LG0A 2KFDA 2DK8A 3MWMA 2LBFA 3GFIA 5E1ZB 2HPIA 1XCVA 4Y4RA 3M3YJ 2CUJA 5IY5H 5F27A 3M07A 1RI7A 3HPHA 5H6QA 5IOZA 3OYDA 3WGHA 1MZBA 2L2OA 2OZ6A 1MD0A 3GCMA 2GLOA 1BI0A 2EZKA 3H0DA 2VJIA 4RAZA 5HLHA 4UY8I 2HVQA 3KLOA 3JTGA 2P7CB 2M0MA 4ZYAA 4NB5A 2QCOA 1X3WB 5B1BH 3ZR8X 4DZJA 1T33A 3C3WA 2KQRA 2X51A 4LMYA 3F8CA 1IV8A 5M5YJ 5B5EC 4XSZF 3HRSA 2I5UA 1WJDA 4XBFA 1HKSA 2HDCA 1YO5C 2JVGA 3P9CA 2OZUA 1I6XA 3MCZA 2FJ1A 1MMNA 4KICA 2ICWG 1AWCA 3LAPA 4OAZA 3VWBA 1EH7A 2EIKH 2HZTA 3M4OJ 4E7ZA 2X6XA 2R7XA 2P5KA 2EFNA 2ISYA 4M9XA 2W48A 1FT9A 1R7JA 3GEZA 2YU9J 2DA4A 3DPLC 1NH3A 3GLXA 3I4PA 2BY3A 4IHYA 2QM3A 4RGXA 4CCJA 2HQ5A 2E60A 2Y9YA 4EGYA 4DYQA 1UELB 2OQGA 1U8BA 2WC2A 1KA8A 1LDKB 5IP7J 2EILH 5FD5A 1XGSA 3IL2A 4BHCA 3L09A 1G8XA 3ABMH 3IH2A 2DI3A 2VT3A 2CWEA 3CP8A 2ELJA 3I54A 5EYRA 2BVLA 4BDYA 2WA0A 3PUFA 5GADJ 2MC4A 2EV5A 3R61A 4CUGA 3PUBA 2M0CA 1H88C 2PMZN 5BMZA 3KPHA 2K86A 1KQ8A 1U9NA 2JN6A 3LQQA 4B3XA 4Y13A 2VBXA 1MIJA 2UXNA 4A3BJ 5BQTA 4S05A 2IXSA 3I64A 3KYDB 3OYLA 4EM0B 4IHXA 1GVJA 2DQRA 4I0BA 1JI8A 2RGVA 1LFUP 1JGGA 3T8RA 2R7TA 4OIPF 2A6HF 1OKRA 2AXLA 3QODA 1UHWA 4EJTA 1TWHJ 1SAUA 4L9TA 1D8JA 3H3ZA 2ZKZA 1BR4A 1WH7A 3EUKL 3IV5A 3VDXA 4KNYA 4M72A 2GOMA 2HTSA 2VE8A 3KEQA 3OIPA 1IO2A 2GIVA 2ME0A 1S8NA 5DUIA 5F64A 5IYBJ 4DGWB 4A3KJ 2KP6A 2HEOA 3S15J 2PFBA 2NVYJ 1Z05A 2JZYA 1R00A 3QP5A 4I0AA 4L9VA 1JKPC 1OYIA 5K7FA 1E0EA 4JK1X 2KJBA 4CSWA 5JFRA 1E2XA 2R7ZJ 1IDYA 1G4DA 3DPUA 4Y3OA 3QWLA 1ZG5A 2O8KA 3QRFF 4MGRA 4Y52J 3I9V2 5IOYA 4Q4ZF 2ZJQF 1BI1A 3H92A 3HKZA 2M4KA 1ZQ3P 2ZJPF 1QHHD 2YX7A 1B72A 3MFKA 3HTUA 3BPXA 2CV1A 3ECHA 1X2NA 1AU7A 1QA6A 2DMNA 3K4CA 2PJRA 3MKWB 1SFKA 4ENNA 2ACJA 1ODDA 4XKWA 3DQVC 3HOXJ 2JMWA 4ITVA 4AIHA 4S0HB 4IHVA 5CVIA 3HM5A 1I50J 3GFLA 3BROA 2BOLA 3BQYA 4I99C 1LUJB 1BC7C 3GXOA 4RAGA 4O5VA 4C2UA 2ZMEB 3KX2A 1T0FC 2IA0A 3BY6A 4I2OA 3GLLA 2VJ4A 3CCRI 3MQ0A 4EATA 5E3MA 2LG4A 1MMGA 2QKLB 4A93J 1K6OA 2VPLA 1UMQA 3RZOJ 3HL2A 2WAEA 4MIMA 3PL8A 3LQRA 3KZYA 1IJWC 2IGMA 3DEEA 1JKQC 2CO5A 2ELHA 2IBDA 2IS6A 2WADA 2WV0A 1K4SA 1G3WA 3KEOA 3L2RA 2G0EA 4I76A 4Q47A 5FKMA 3HOWJ 1OISA 3OS1A 3WE2A 2YSRA 2VKDA 1XD7A 2BV6A 3LWFA 4G8XA 4EQQA 4A3DJ 3T0YA 5KCMA 1MNMC 4O3MA 4U0VA 1WI9A 4HG2A 2XGEA 1GV5A 2JVHA 2DFIA 4YIIA 5EDNA 4Y33A 2B9SA 2M1BA 2E1CA 3IAS2 4UXNA 1USSA 1ZRDA 2NVQJ 2BW3B 2HKOA 2A69F 1XSVA 5D6EA 4XICA 1GXPA 3P9KA 2RQPA 3BJ6A 3D1NI 2CFXA 3TMOA 1HSTA 4JYKA 3CDHA 3EPZA 3Q0UA 3MKYB 3OYNA 2CW8A 5IPAA 1WSUA 2NS8A 2HOAA 5DYMA 3FIWA 3HJEA 2TDXA 3FMQA 1RR7A 4MFDA 4Q5SF 3M8EA 4ZZLA 1IW7F 5DCFA 4ZZDA 3SYTA 4HF2A 1LE8A 1MBEA 4F55A 4IXAA 3HHHA 5E18F 2K3PA 4XRMA 2LP0A 1P92A 2CRGA 3V8KA 1EF4A 3L2QA 2FBIA 5FKLA 3HUGA 1HW2A 3QU3A 2L5QA 4YFXF 2OC6A 1XC5A 2GQQA 1S29A 3AG4H 3DCFA 2E1MC 4YELA 4ZC3A 3CMYA 3COAC 2R5ZB 4IOAF 1IN5A 1ETVA 1YFHA 4QPQA 4XRFA 1IXCA 1IRZA 2RVCA 1F9NA 2FF4A 2L7FP 5LGUA 4CDGA 2P8TA 1BN5A 3FX3A 1ZARA 1OJLA 3I53A 1ZRCA 1B9MA 4LLLA 2W4SA 2CG4A 2DDAA 4HW0A 2V1DA 1UHSA 3GZNB 3F8MA 2AQFA 5L3EA 2DJNA 2MW8A 3G4SI 1Z3XA 3BG5A 3WTXC 4L5IA 2Y9ZA 4Z6YA 1LPQA 1I3AA 2VBYA 4UV8A 4HQMA 4A3EJ 1QRYA 4NBQA 5HS9A 3D5LA 1T2KA 4XLNF 2CUZA 1MBHA 1U78A 3AL0B 1IUYA 4LGWA 4CGZA 3ASOH 1JJ8C 1ZAOA 2QYOA 2LLKA 3WHBA 4I09A 2VOPA 1FY7A 4M9ZA 2BYVE 3UKGA 4F93B 1EKEA 1V54H 5FKKA 4BXXJ 1RNLA 1Z0XA 2IVMA 2EPFA 4BBSJ 2V9VA 1MBKA 2XAGA 3ZMSA 3S2WA 1F4KA 3OYMA 2QENA 1HW5A 1XS9A 2H09A 3BG6A 3U1KA 2VPRA 2HOTA 4KIGA 5E20A 1T95A 3HC7A 4LK0F 2IRFG 2ZXIA 4NUBA 2UV1A 2X1EA 5D4SA 2EQRA 3MEXA 1MH3A 5EG0B 1MDMA 1VQ8I 2G7HA 3HB9A 3HTSB 1UHMA 1MKMA 4W97A 3WTYC 2HDWA 3A0HC 1F5TA 1R1TA 1RUOA 1VQNI 1U8RA 2D1HA 2KKOA 2KRFA 3KLNA 4LIVA 4OIRF 1M1EB 1P7JA 1W1WE 1TWAJ 1X58A 4CCKA 5M3FJ 5JLWA 2BXZA 1EV7A 4MTEA 1OCZH 5FJ8J 4E4HA 2E1MB 2R7RA 3ML6A 5JHFA 4M3EA 1KONA 1OYWA 1SFOJ 5FLMJ 4ZYGA 1YJWI 2HYGD 3FKJA 4II2A 4WF2A 3JW4A 4A3IJ 2XSDC 2V6CA 1JJ6C 1ZREA 4NC6A 3DPTA 1HOMA 5H20A 3IC7A 2HI3A 4HNTA 1D0XA 2XUBA 3VYTB 1VQ4I 1R23A 4AVPA 1FSHA 3GUDA 4CYDA 5C4XJ 5DTDA 4IQ4A
chains in the Genus database with same CATH topology
1AHDP 1VNDA 2HXOA 4C2MJ 1WGXA 3GTQJ 1ETQA 2CJJA 1GV2A 1K61A 2FD5A 3HBLA 3B6CA 1I6HJ 2X48A 1FTTA 4D5CA 3Q3SA 2GBYA 3OOUA 2HOSA 3BR1A 2DMQA 2KT0A 1A5JA 2NVXJ 3HKZN 3IH4A 1GVDA 1POGA 3G1LA 4A3MJ 3BR3A 3LNQA 3SJMA 1ETXA 4M3DA 5JLXA 1NK2P 5J1RA 2XB0X 1B8IB 1A6IA 1ETWA 3K2AA 3SDGA 3ZQGA 4A3CJ 1MBFA 5M5WJ 1P7IA 4Y7NJ 4MFEA 3GTPJ 4C3IJ 4AUXA 5EGOB 3S2DJ 9ANTA 3LSGA 4M3FA 4W1UA 1F36A 4M6VA 5C44J 5J1YA 2YUSA 3JRGA 1JUMA 3S17J 1ETOA 2EZLA 3HGGA 1T56A 1E3OC 1IUFA 2JA6J 1DU6A 1Q1VA 3SFIA 1ZK8A 3BR2A 1F43A 2IAIA 4BBRJ 4XRSG 3HOVJ 3GTOJ 3PO2J 2FQ4A 4FE4A 2ECCA 3Q0WA 1X2MA 3ZQLA 2XB5A 2RAEA 2WAQN 2GM4A 1MBJA 3DEWA 3JREA 2K40A 3HOZJ 2ELKA 5EZGA 3B6AA 2DN0A 3O8GA 4IHWA 5K7ZA 2VUMJ 3ZQCA 4FISA 4AC0A 3M3YJ 4QSHA 2ID6A 3CDLA 5F27A 4UUTA 5IOZA 4A3FJ 1NK3P 1GDTA 2GLOA 2LTPA 4B1RA 2EZKA 1QVUA 3OSGA 3BG3A 1WI3A 2CUEA 3I4NJ 2K9QA 3JR9A 4JX4A 2QCOA 2IEKA 4MLOA 4DZJA 1DU0A 1T33A 1TWFJ 5F08A 1ZR4A 5M5YJ 2E1OA 2ZB9A 4FE7A 5FKOA 2EH3A 2XRLA 1IG7A 1BW5A 1MBGA 1RESA 1IC8A 4A3JJ 2YS9A 2FJ1A 3BR5A 2CUFA 2CQXA 3M4OJ 4GFBA 3S14J 4DZPA 1JUSA 3BTJA 5J3LA 4D5FA 1ZTRA 2W48A 2FX0A 3RZDJ 2YU9J 2DA4A 4IHYA 3A02A 2VKVA 1RKWA 2HQ5A 2Y9YA 1JUPA 3H3VK 3HOYJ 4DYQA 4IEJA 1U8BA 2JWTA 2JK3A 3S16J 5IP7J 2LD5A 3IH2A 3LSRA 1JT6A 4NDLA 4XRSA 5EYRA 1ETYA 2H8RA 1U9OA 3MN2A 2M0CA 1H88C 2WV1A 2CQQA 4B3AA 4CYCA 2PMZN 1U9NA 2JN6A 2O7OA 3PO3J 1LFBA 3RKQA 3VPRA 2H1KA 1TWCJ 1WPKA 3C2BA 3G1MA 1HDPA 1VFCA 4A3BJ 4IHXA 2MGQA 2XPVA 2K9NA 3CQZJ 3LSPA 3RQIA 3GTLJ 1LFUP 2OF7A 1JGGA 2Y2ZA 1APLC 4JX6A 3BQZA 1HCRA 1H8AC 1TWHJ 3JRFA 1FJLA 4JX5A 5F04A 2NS7A 3S2HJ 1WH7A 3IV5A 3HDDA 3JRDA 4DYCA 2EZIA 5EZHA 1QPIA 3ZQHA 2ME0A 2LK2A 2HXIA 5IYCJ 3JRAA 2JA8J 4D7MA 5IYBJ 4M3GA 3LSJA 4A3KJ 3S15J 2NVYJ 1JKPC 4DW6A 1G2HA 5K7FA 4CYCB 1TWGJ 3OSFA 4XK4A 2R7ZJ 1IDYA 2OPTA 4MO7A 2E2JJ 2O8KA 2R5YA 2N8GA 3TW6A 4Y52J 3ZOBA 2XGDA 5IOYA 4V2FA 1I3QJ 2LVSA 4RBOA 1UG2A 1HLVA 1PUFA 1ZQ3P 3S1NJ 5J1UA 2P81A 1K83J 2NOGA 1B72A 3BT9A 5F0FA 5HODA 2DMTA 1YRNA 4QIWN 1Y1WJ 5K7HA 1RETA 1MSEC 1ENHA 1ITYA 1X2NA 1WH5A 1AU7A 2DMNA 4ABZA 3L1PA 1W0TA 2HYJA 1OFCX 1GT0C 1VF9A 4I6ZA 3JRBA 3E7LA 3FK7A 1FEXA 3HOXJ 2JMWA 4IHVA 3BTCA 4S0HB 1IGNA 2E19A 1I50J 3HM5A 2COBA 4FCYA 3BQYA 4A3GJ 4BY1J 1BA5A 2L7ZA 2LY9A 2KDZA 4DYRA 3QPLA 3MVPA 2X6OA 2JA5J 1ZR2A 5FLVA 5E3MA 4A93J 1BJZA 1FIAA 1UMQA 3RZOJ 2DA1A 1QVTA 4MIMA 5DS9A 5IYDJ 2EZHA 2R5YB 1IJWC 2M9HA 1JKQC 1XG1A 2IBDA 5FKNA 2I10A 1PUFB 5GPAA 3HGYA 3GTKJ 2G0EA 1B72B 4I76A 2WB1N 5FKMA 3HOWJ 4V2GA 3I4MJ 4C3HJ 4D7NA 1ZKGA 2R5ZA 4A3DJ 4XIDA 4AYBN 2L0KA 3TW7A 1MNMC 2DTZA 1CQTA 2HDDA 2XGEA 2Y30A 5E3OA 1GV5A 3FISA 5EDNA 2DA2A 2DMPA 5EF6A 2TRTA 4HNVA 5EEAA 5E3NA 5M5XJ 2NVQJ 5M3MJ 1ZGWA 4XICA 2NVTJ 4B4CA 1GUUA 3D1NI 4FTHA 4JYKA 2ID3A 2L9RA 2XPUA 5IP6A 3Q0VA 1RKTA 1S7EA 3Q0UA 3H0GJ 1HF0A 5IPAA 2NS8A 4A3LJ 2XPWA 2HOAA 1MSFC 3FIWA 3NARA 2DA7A 4M3BA 5BNGA 1IV6A 4QTRA 1RR7A 4MFDA 4C3JJ 2LFBA 3TEDA 1LE8A 1MBEA 1H89C 3G1OA 5GPCA 4XRMA 2LP0A 2CRGA 3QPSA 2B63J 1EF4A 5FKLA 3PM1A 2LKXA 3ZQIA 1XC5A 4BKXA 3CMYA 3DCFA 2R5ZB 4X1EA 1ETVA 1Z77A 1SANA 2DA6A 3FK6A 4J19A 2R0QC 1IRZA 1OCPA 3HEFA 2L7FP 2M2EA 2M8GX 3CCYA 2L7MP 3JRCA 1OJLA 3S1RJ 1TC3C 5EG0A 2DMUA 2JJ7A 2TCTA 1UHSA 3NAUA 3A01A 3HOUJ 4X6AJ 3K7AJ 2DJNA 2MW8A 3BG5A 1D5YA 2QF7A 5F0HA 2Y9ZA 3A03A 2MSYA 1ORKA 1WCMJ 4A3EJ 1QRYA 3BTLA 1U78A 1MBHA 1JTXA 3GBGA 2D5VA 1LE8B 1JKOC 2K9SA 1AKHA 3IH3A 3MKLA 3WHBA 2LLKA 2LR8A 1JJ8C 4UUSA 3UKGA 4BXXJ 5FKKA 1NTCA 2E2HJ 2XGCA 2DA3A 2R92J 1Z0XA 1ETKA 2VI6A 2Y31A 3QQAA 1R9TJ 2ECBA 4BBSJ 4BY7J 4RDUA 1MBKA 2EBIA 2AHQA 2M34A 1XS9A 1FIPA 2VPRA 1VI0A 4LOCA 3WHCA 2HOTA 1JKRC 1O4XA 2VKEA 2ME6A 3O8HA 1FTZA 3FKIJ 5EG0B 1JTYA 2EQRA 3LOCA 1MH3A 4L5EA 3HB9A 5GP9A 3JRHA 1BW6A 1OCTC 3A01B 4W97A 4A69C 1IDZA 4JP0A 3GTJJ 2X9DA 2E2IJ 5F0CA 3ZQFA 3BTIA 3F0CA 5C4JJ 1P7JA 1X58A 1TWAJ 3BG9A 5M3FJ 2R93J 5JLWA 5FJ8J 5E3LA 2JA7J 5IP9J 2Y0SN 4M3EA 1SFOJ 3BR0A 1MH4A 5FLMJ 1Y1VJ 2MG4A 1AKHB 1BL0A 1YRNB 1RPWA 1B8IA 4G12A 4UUSB 4A3IJ 2XSDC 2DA5A 1JJ6C 3OIOA 1JT0A 3JRIA 2O9LA 5EGOA 3TP0A 5F1JA 1W0UA 1HDDC 4EEFG 5C3EJ 1HOMA 2CU7A 2HI3A 3S1MJ 3S1QJ 3TP3A 2AO9A 3GTMJ 5C4XJ 3BR6A 5DTDA 3GTGJ 3W6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AHD P;  1VND A;  2HXO A;  4C2M J;  1WGX A;  3GTQ J;  1ETQ A;  2CJJ A;  1GV2 A;  1K61 A;  2FD5 A;  3HBL A;  3B6C A;  1I6H J;  2X48 A;  1FTT A;  4D5C A;  3Q3S A;  2GBY A;  3OOU A;  2HOS A;  3BR1 A;  2DMQ A;  2KT0 A;  1A5J A;  2NVX J;  3HKZ N;  3IH4 A;  1GVD A;  1POG A;  3G1L A;  4A3M J;  3BR3 A;  3LNQ A;  3SJM A;  1ETX A;  4M3D A;  5JLX A;  1NK2 P;  5J1R A;  2XB0 X;  1B8I B;  1A6I A;  1ETW A;  3K2A A;  3SDG A;  3ZQG A;  4A3C J;  1MBF A;  5M5W J;  1P7I A;  4Y7N J;  4MFE A;  3GTP J;  4C3I J;  4AUX A;  5EGO B;  3S2D J;  9ANT A;  3LSG A;  4M3F A;  4W1U A;  1F36 A;  4M6V A;  5C44 J;  5J1Y A;  2YUS A;  3JRG A;  1JUM A;  3S17 J;  1ETO A;  2EZL A;  3HGG A;  1T56 A;  1E3O C;  1IUF A;  2JA6 J;  1DU6 A;  1Q1V A;  3SFI A;  1ZK8 A;  3BR2 A;  1F43 A;  2IAI A;  4BBR J;  4XRS G;  3HOV J;  3GTO J;  3PO2 J;  2FQ4 A;  4FE4 A;  2ECC A;  3Q0W A;  1X2M A;  3ZQL A;  2XB5 A;  2RAE A;  2WAQ N;  2GM4 A;  1MBJ A;  3DEW A;  3JRE A;  2K40 A;  3HOZ J;  2ELK A;  5EZG A;  3B6A A;  2DN0 A;  3O8G A;  4IHW A;  5K7Z A;  2VUM J;  3ZQC A;  4FIS A;  4AC0 A;  3M3Y J;  4QSH A;  2ID6 A;  3CDL A;  5F27 A;  4UUT A;  5IOZ A;  4A3F J;  1NK3 P;  1GDT A;  2GLO A;  2LTP A;  4B1R A;  2EZK A;  1QVU A;  3OSG A;  3BG3 A;  1WI3 A;  2CUE A;  3I4N J;  2K9Q A;  3JR9 A;  4JX4 A;  2QCO A;  2IEK A;  4MLO A;  4DZJ A;  1DU0 A;  1T33 A;  1TWF J;  5F08 A;  1ZR4 A;  5M5Y J;  2E1O A;  2ZB9 A;  4FE7 A;  5FKO A;  2EH3 A;  2XRL A;  1IG7 A;  1BW5 A;  1MBG A;  1RES A;  1IC8 A;  4A3J J;  2YS9 A;  2FJ1 A;  3BR5 A;  2CUF A;  2CQX A;  3M4O J;  4GFB A;  3S14 J;  4DZP A;  1JUS A;  3BTJ A;  5J3L A;  4D5F A;  1ZTR A;  2W48 A;  2FX0 A;  3RZD J;  2YU9 J;  2DA4 A;  4IHY A;  3A02 A;  2VKV A;  1RKW A;  2HQ5 A;  2Y9Y A;  1JUP A;  3H3V K;  3HOY J;  4DYQ A;  4IEJ A;  1U8B A;  2JWT A;  2JK3 A;  3S16 J;  5IP7 J;  2LD5 A;  3IH2 A;  3LSR A;  1JT6 A;  4NDL A;  4XRS A;  5EYR A;  1ETY A;  2H8R A;  1U9O A;  3MN2 A;  2M0C A;  1H88 C;  2WV1 A;  2CQQ A;  4B3A A;  4CYC A;  2PMZ N;  1U9N A;  2JN6 A;  2O7O A;  3PO3 J;  1LFB A;  3RKQ A;  3VPR A;  2H1K A;  1TWC J;  1WPK A;  3C2B A;  3G1M A;  1HDP A;  1VFC A;  4A3B J;  4IHX A;  2MGQ A;  2XPV A;  2K9N A;  3CQZ J;  3LSP A;  3RQI A;  3GTL J;  1LFU P;  2OF7 A;  1JGG A;  2Y2Z A;  1APL C;  4JX6 A;  3BQZ A;  1HCR A;  1H8A C;  1TWH J;  3JRF A;  1FJL A;  4JX5 A;  5F04 A;  2NS7 A;  3S2H J;  1WH7 A;  3IV5 A;  3HDD A;  3JRD A;  4DYC A;  2EZI A;  5EZH A;  1QPI A;  3ZQH A;  2ME0 A;  2LK2 A;  2HXI A;  5IYC J;  3JRA A;  2JA8 J;  4D7M A;  5IYB J;  4M3G A;  3LSJ A;  4A3K J;  3S15 J;  2NVY J;  1JKP C;  4DW6 A;  1G2H A;  5K7F A;  4CYC B;  1TWG J;  3OSF A;  4XK4 A;  2R7Z J;  1IDY A;  2OPT A;  4MO7 A;  2E2J J;  2O8K A;  2R5Y A;  2N8G A;  3TW6 A;  4Y52 J;  3ZOB A;  2XGD A;  5IOY A;  4V2F A;  1I3Q J;  2LVS A;  4RBO A;  1UG2 A;  1HLV A;  1PUF A;  1ZQ3 P;  3S1N J;  5J1U A;  2P81 A;  1K83 J;  2NOG A;  1B72 A;  3BT9 A;  5F0F A;  5HOD A;  2DMT A;  1YRN A;  4QIW N;  1Y1W J;  5K7H A;  1RET A;  1MSE C;  1ENH A;  1ITY A;  1X2N A;  1WH5 A;  1AU7 A;  2DMN A;  4ABZ A;  3L1P A;  1W0T A;  2HYJ A;  1OFC X;  1GT0 C;  1VF9 A;  4I6Z A;  3JRB A;  3E7L A;  3FK7 A;  1FEX A;  3HOX J;  2JMW A;  4IHV A;  3BTC A;  4S0H B;  1IGN A;  2E19 A;  1I50 J;  3HM5 A;  2COB A;  4FCY A;  3BQY A;  4A3G J;  4BY1 J;  1BA5 A;  2L7Z A;  2LY9 A;  2KDZ A;  4DYR A;  3QPL A;  3MVP A;  2X6O A;  2JA5 J;  1ZR2 A;  5FLV A;  5E3M A;  4A93 J;  1BJZ A;  1FIA A;  1UMQ A;  3RZO J;  2DA1 A;  1QVT A;  4MIM A;  5DS9 A;  5IYD J;  2EZH A;  2R5Y B;  1IJW C;  2M9H A;  1JKQ C;  1XG1 A;  2IBD A;  5FKN A;  2I10 A;  1PUF B;  5GPA A;  3HGY A;  3GTK J;  2G0E A;  1B72 B;  4I76 A;  2WB1 N;  5FKM A;  3HOW J;  4V2G A;  3I4M J;  4C3H J;  4D7N A;  1ZKG A;  2R5Z A;  4A3D J;  4XID A;  4AYB N;  2L0K A;  3TW7 A;  1MNM C;  2DTZ A;  1CQT A;  2HDD A;  2XGE A;  2Y30 A;  5E3O A;  1GV5 A;  3FIS A;  5EDN A;  2DA2 A;  2DMP A;  5EF6 A;  2TRT A;  4HNV A;  5EEA A;  5E3N A;  5M5X J;  2NVQ J;  5M3M J;  1ZGW A;  4XIC A;  2NVT J;  4B4C A;  1GUU A;  3D1N I;  4FTH A;  4JYK A;  2ID3 A;  2L9R A;  2XPU A;  5IP6 A;  3Q0V A;  1RKT A;  1S7E A;  3Q0U A;  3H0G J;  1HF0 A;  5IPA A;  2NS8 A;  4A3L J;  2XPW A;  2HOA A;  1MSF C;  3FIW A;  3NAR A;  2DA7 A;  4M3B A;  5BNG A;  1IV6 A;  4QTR A;  1RR7 A;  4MFD A;  4C3J J;  2LFB A;  3TED A;  1LE8 A;  1MBE A;  1H89 C;  3G1O A;  5GPC A;  4XRM A;  2LP0 A;  2CRG A;  3QPS A;  2B63 J;  1EF4 A;  5FKL A;  3PM1 A;  2LKX A;  3ZQI A;  1XC5 A;  4BKX A;  3CMY A;  3DCF A;  2R5Z B;  4X1E A;  1ETV A;  1Z77 A;  1SAN A;  2DA6 A;  3FK6 A;  4J19 A;  2R0Q C;  1IRZ A;  1OCP A;  3HEF A;  2L7F P;  2M2E A;  2M8G X;  3CCY A;  2L7M P;  3JRC A;  1OJL A;  3S1R J;  1TC3 C;  5EG0 A;  2DMU A;  2JJ7 A;  2TCT A;  1UHS A;  3NAU A;  3A01 A;  3HOU J;  4X6A J;  3K7A J;  2DJN A;  2MW8 A;  3BG5 A;  1D5Y A;  2QF7 A;  5F0H A;  2Y9Z A;  3A03 A;  2MSY A;  1ORK A;  1WCM J;  4A3E J;  1QRY A;  3BTL A;  1U78 A;  1MBH A;  1JTX A;  3GBG A;  2D5V A;  1LE8 B;  1JKO C;  2K9S A;  1AKH A;  3IH3 A;  3MKL A;  3WHB A;  2LLK A;  2LR8 A;  1JJ8 C;  4UUS A;  3UKG A;  4BXX J;  5FKK A;  1NTC A;  2E2H J;  2XGC A;  2DA3 A;  2R92 J;  1Z0X A;  1ETK A;  2VI6 A;  2Y31 A;  3QQA A;  1R9T J;  2ECB A;  4BBS J;  4BY7 J;  4RDU A;  1MBK A;  2EBI A;  2AHQ A;  2M34 A;  1XS9 A;  1FIP A;  2VPR A;  1VI0 A;  4LOC A;  3WHC A;  2HOT A;  1JKR C;  1O4X A;  2VKE A;  2ME6 A;  3O8H A;  1FTZ A;  3FKI J;  5EG0 B;  1JTY A;  2EQR A;  3LOC A;  1MH3 A;  4L5E A;  3HB9 A;  5GP9 A;  3JRH A;  1BW6 A;  1OCT C;  3A01 B;  4W97 A;  4A69 C;  1IDZ A;  4JP0 A;  3GTJ J;  2X9D A;  2E2I J;  5F0C A;  3ZQF A;  3BTI A;  3F0C A;  5C4J J;  1P7J A;  1X58 A;  1TWA J;  3BG9 A;  5M3F J;  2R93 J;  5JLW A;  5FJ8 J;  5E3L A;  2JA7 J;  5IP9 J;  2Y0S N;  4M3E A;  1SFO J;  3BR0 A;  1MH4 A;  5FLM J;  1Y1V J;  2MG4 A;  1AKH B;  1BL0 A;  1YRN B;  1RPW A;  1B8I A;  4G12 A;  4UUS B;  4A3I J;  2XSD C;  2DA5 A;  1JJ6 C;  3OIO A;  1JT0 A;  3JRI A;  2O9L A;  5EGO A;  3TP0 A;  5F1J A;  1W0U A;  1HDD C;  4EEF G;  5C3E J;  1HOM A;  2CU7 A;  2HI3 A;  3S1M J;  3S1Q J;  3TP3 A;  2AO9 A;  3GTM J;  5C4X J;  3BR6 A;  5DTD A;  3GTG J;  3W6V A; 
#chains in the Genus database with same CATH topology
 3HIF A;  4CA0 A;  1VND A;  2W82 A;  4C2M J;  4HDV A;  1AHD P;  3GTQ J;  4QPO A;  2CJJ A;  3CUQ C;  1YW7 A;  1GV2 A;  4HST A;  5KAF C;  1TW2 A;  2VOO A;  3K4M A;  3IAM 2;  2CW0 F;  2B0L A;  3N4M A;  2O5R A;  3F21 A;  3Q3S A;  5GAE J;  3OOU A;  4MTD A;  4LB6 B;  4ASN A;  3CJR B;  3TL4 X;  1D8K A;  1UB9 A;  2YU3 A;  4HDU A;  2PMU A;  3NWT A;  2HNH A;  2ZXJ A;  3CZ6 A;  2LF7 A;  3VFZ A;  3LNQ A;  1RUN A;  1FLI A;  2JUC A;  3S8P A;  1NK2 P;  4JBA A;  2FE3 A;  3FXL A;  3K2A A;  2QWW A;  1E17 A;  1UAA A;  2VE9 A;  3FMS A;  3ERM A;  4MFE A;  3H9J A;  4C3I J;  3S2D J;  4FQG A;  1I5Z A;  3QPT A;  4FHT A;  3IWZ A;  1P2F A;  5E1W A;  2Z16 A;  3CC4 I;  1JHH A;  2M5W A;  2WB1 A;  2V4J C;  2NNN A;  4IZZ A;  5DDG A;  2EZL A;  1DDN A;  3JCU C;  2E7W A;  1WWX A;  4MQV A;  1E3O C;  3WTT C;  1DUX C;  2V79 A;  4I02 A;  1UFM A;  3E0J B;  3K4B A;  1V5E A;  2GXB A;  3HOV J;  3GTO J;  3L00 A;  3PO2 J;  4AIK A;  1FOK A;  2FQ4 A;  2DT7 B;  2IS4 A;  1JE8 A;  3F8B A;  2DYR H;  5D5X B;  5TGT A;  2WAQ N;  2GM4 A;  4A5M A;  3K1P A;  4A6E A;  3JRE A;  2LNB A;  4RB2 C;  5EZG A;  2E34 A;  1OLT A;  2DN0 A;  3B6A A;  3N97 A;  4IHW A;  2MH9 A;  1VQ5 I;  3ZMV A;  1VQ6 I;  4FIS A;  4AC0 A;  3J7Z I;  4J01 A;  2K5C A;  2W84 A;  2EA4 A;  2ID6 A;  4GYG A;  5KHD A;  2L01 A;  3OYF A;  2WAF A;  1NK3 P;  2K4J A;  1GDT A;  1WJ5 A;  3O2P E;  1QVU A;  4H0E A;  1YS7 A;  2MLG A;  2Y75 A;  4M71 A;  4B47 A;  1WI3 A;  2CUE A;  4KIF A;  2KRC A;  5HNF A;  3I59 A;  4BEH B;  2O0Y A;  1W4M A;  4XLE A;  1ULY A;  1JGS A;  2VQG A;  3FHN A;  4MLO A;  3TGN A;  4BQA A;  4RAY A;  5E1X A;  4EJO A;  2BW3 A;  3WE3 A;  1VQL I;  5F08 A;  3CMM A;  3CCU I;  2ZSH B;  1WJA A;  4KMF A;  1SD7 A;  3I71 A;  2VT2 A;  1NG7 A;  1BW5 A;  1MBG A;  2G9W A;  2JT1 A;  1IC8 A;  5GAG J;  3BR5 A;  2CUF A;  3U9G A;  4ZTJ A;  4ZDP A;  1EH8 A;  1QZY A;  2IJL A;  2CQX A;  4P96 A;  1GXQ A;  4PJJ A;  4RGU A;  3JAM Z;  3FDY A;  1U2W A;  4XLP F;  2EA2 A;  2M30 A;  3J7Y J;  3S14 J;  2YR2 A;  1DP3 A;  2XF7 A;  3FZV A;  2E7X A;  4D5F A;  2IPQ X;  1DPR A;  3K70 D;  2IGN A;  1R5I D;  3AG2 H;  1PYV A;  3ASN H;  2K7L A;  2VKV A;  1RKW A;  3H3V K;  1JUP A;  3HOY J;  1PDN C;  4ZH4 F;  4IEJ A;  3RPU D;  3JSP A;  4EJV A;  3F9K A;  2KJC A;  1Z9C A;  4IHS A;  4ZYH A;  1TP4 A;  3F72 A;  3RJP A;  3RPU A;  3LSR A;  1YW9 A;  3A2K A;  1JT6 A;  3NEU A;  1R49 A;  1MJA A;  3RPQ A;  1O7L A;  5LRR A;  4AVZ A;  2LRD A;  4N9H A;  5DCM B;  3UNG C;  2X1D A;  2MFZ A;  4KN4 X;  1U9O A;  3CCV I;  4IX7 A;  4DQ2 A;  4IRG A;  2BVM A;  1UST A;  2HZD A;  5LHI A;  4CYC A;  3QOP A;  3N05 A;  1FX7 A;  5FLX K;  3E1S A;  1Y0U A;  4XNF A;  1T08 B;  5ILS A;  3OS2 A;  3ABL H;  2H1K A;  3KP5 A;  1YOV B;  1EJ9 A;  2K9M A;  3C2B A;  5JVT A;  1O3R A;  1OYY A;  4XQF A;  2XRN A;  3KP6 A;  1YIJ I;  2MGQ A;  2Y0S A;  2W00 A;  2X6Y A;  2NYX A;  2QLZ A;  5A2Q Z;  2QBY A;  3RQI A;  3QP6 A;  2P6S A;  2Y2Z A;  4NC8 A;  3PSI A;  1APL C;  3GZ6 A;  1YIO A;  1HCR A;  1U5T B;  4OOI A;  4CO8 A;  3W2W A;  5HOO A;  3S2H J;  5HNH A;  1SFX A;  1VQ7 I;  2GA1 A;  1R36 A;  4XOP A;  3WG9 A;  2JA8 J;  4HV5 A;  4LK1 F;  1SMY F;  3RDI A;  4D7M A;  3GWZ A;  4XN3 A;  3WTZ A;  3M9A A;  4B44 A;  4A0Y A;  1SD5 A;  2MD5 A;  4DW6 A;  5DD8 A;  2KPM A;  1Z7U A;  2K02 A;  1A35 A;  4R79 A;  4M6Y A;  2XVC A;  3OSF A;  3PNY A;  4AD9 A;  3IKV A;  4C9Y A;  2OPT A;  4MO7 A;  1MMA A;  2K9L A;  1FZP B;  4MNU A;  2R5Y A;  2E2J J;  3TW6 A;  2H27 A;  3ZOB A;  2XGD A;  4RBO A;  1PUF A;  4LG3 A;  2LKP A;  3PIO F;  3CC7 I;  4YRV A;  3H36 A;  1X19 A;  5F0F A;  3KYL A;  3HSF A;  3KEY A;  1Y1W J;  1L0O C;  4J00 A;  2DO7 A;  1MSE C;  1CF7 B;  2BGC A;  2XF5 A;  4CIC A;  2C6Y A;  2KIQ A;  2DLL A;  4YEJ A;  4ABZ A;  3LL7 A;  3GF2 A;  1GT0 C;  1KU2 A;  3CTA A;  2ZJ2 A;  5J6X A;  2HYF A;  3J81 Z;  2W7N A;  3S3M A;  3VB2 A;  1YE9 A;  2EK5 A;  4ZDO A;  3FK7 A;  3OIQ A;  4Z2Y A;  1FEX A;  3TO9 A;  3BTC A;  1IGN A;  1PVE A;  2E19 A;  2QZ8 A;  1ZG1 A;  2COB A;  4FCY A;  5D5V B;  4PJ0 C;  2E5Z A;  1MNE A;  3RYR A;  5FO5 A;  4BXF A;  4H4K C;  2KDZ A;  3HSR A;  3QPL A;  3WTW C;  2P5V A;  3MVP A;  2HOE A;  2UZK A;  1ZR2 A;  2OJE D;  5LBQ A;  2CQN A;  2DOE A;  1HBX G;  2HPM A;  1BJZ A;  1FIA A;  1QVT A;  3OYE A;  2Z5U A;  5DS9 A;  5IYD J;  1ZH5 A;  3TDZ C;  3RIR A;  5FKN A;  5KVR A;  4BJ5 C;  3QPH A;  2A6E F;  5GPA A;  4E7H A;  2HQR A;  3HGY A;  3OOP A;  1XGO A;  5HS7 A;  4B09 A;  4XSX F;  2Y0M A;  3LA2 A;  2PBI A;  2KIM A;  4HX8 A;  5E3O A;  4ESB A;  4XMY A;  1LDJ A;  1T38 A;  4BGD A;  4N4O B;  2DMP A;  2TRT A;  4KN7 X;  3EUA A;  5M5X J;  2DTR A;  4ZJZ A;  3LSI A;  3IHU A;  3R4K A;  3IRQ A;  1I1S A;  2KRH A;  2NVT J;  2VAS A;  3FBI B;  1ZYR F;  2K3F A;  1W7P B;  1P4W A;  1WVR A;  2DFE A;  5IP6 A;  3Q0V A;  2ZFW A;  3H0G J;  4E7J A;  2EWN A;  2EIM H;  1MSF C;  3NAR A;  2DA7 A;  2IA1 A;  3BDD A;  4LIT A;  4QTR A;  6PAX A;  5B3S H;  1FYM A;  3R60 A;  5AIP A;  4BDZ A;  5GPC A;  3G6E I;  3GX4 X;  2XAU A;  2V1U A;  2LKX A;  4DJA A;  1A04 A;  4WX9 A;  4WXD A;  2PX9 A;  4WXC A;  1N78 A;  1SAN A;  4U0Y A;  3F6V A;  5EEH A;  3AG1 H;  2OBP A;  1IN4 A;  4XL9 A;  1J09 A;  4HOB A;  3JRC A;  3A4C A;  3S1R J;  1TC3 C;  2R7W A;  1FBS A;  2MAB A;  2NS0 A;  4L9J A;  2JJ7 A;  2X4H A;  3A01 A;  4BNC A;  2GXG A;  3CF5 F;  4X6A J;  4BEH A;  1R4N B;  2KZV A;  5GTH C;  2FOK A;  5J4Y A;  1D5Y A;  1YIT I;  2Q0O A;  5F0H A;  1UCR A;  5J8C A;  3A03 A;  2ZFU A;  3ZN0 A;  3KP7 A;  3CCL I;  1ORK A;  3HHG A;  1QQI A;  1WCM J;  1TT0 A;  4EGZ A;  2ZBK A;  3BZK A;  3KYC B;  3DU6 A;  4EVI A;  3A0B C;  3V42 A;  3BTL A;  3CCE I;  1V4R A;  4E7S A;  1JTX A;  2FBK A;  3DKY A;  3EYI A;  1E3P A;  3K4J A;  2HTJ A;  2CMP A;  3IH3 A;  4KFC A;  1FP1 D;  2PMZ A;  3VOD A;  1B59 A;  2MBF A;  1D1A A;  1LKX A;  1T6S A;  4IOC F;  2VI6 A;  3QQA A;  1R9T J;  2ECB A;  4HF1 A;  2PEX A;  4ZYD A;  1S7A A;  2AHQ A;  1J75 A;  3V4G A;  3CP2 A;  3KP2 A;  4RLQ A;  5CVR A;  1EH6 A;  2STT A;  1R1U A;  1ZN2 A;  2BZT A;  2FBH A;  4LOC A;  4UVC A;  5CJ9 A;  3WHC A;  1K7A A;  4LD5 A;  3O8H A;  2ME6 A;  3PJR A;  4R8H A;  2D45 A;  1JTY A;  2MD0 A;  3FXO A;  4GRI A;  1TNS A;  5D8L B;  4DBQ A;  2DOF A;  4HX4 A;  2X9D A;  5LEJ A;  3BTI A;  4G7Z F;  5D5U B;  2RNJ A;  5CLS A;  3RSN A;  1Z6R A;  1XGN A;  2RDP A;  1WJB A;  5LGN A;  2JA7 J;  5IP9 J;  2BE5 F;  4FX0 A;  4ESF A;  4A0X A;  3DBR B;  2LKS A;  2P0W A;  4BXU A;  1AKH B;  1UJ8 A;  2CSO A;  1RPW A;  3D5S C;  1BL0 A;  1YRN B;  2QSH X;  1RRJ A;  1LB2 A;  3JAM K;  2GIZ A;  2VJ5 A;  4UUS B;  2KDO A;  2FNP A;  1VZ0 A;  2DA5 A;  1YX3 A;  4EM1 A;  1H9G A;  1JT0 A;  5EGO A;  4GGG A;  5HDG A;  2Q1Z B;  4PFO A;  1HDD C;  1N75 A;  1XCB A;  1GLN A;  3WTS C;  3SZT A;  4U7B A;  4RM2 A;  3S1Q J;  1VQK I;  4E6K G;  3AG3 H;  3DLL F;  3CCM I;  3BR6 A;  2CGP A;  3AKZ A;  1S72 I;  1RR8 C;  2Y69 H;  5E8I A;  1U5T A;  3REO A;  3DP7 A;  3W3C A;  5FLX Z;  3PQK A;  2JRM A;  1A36 A;  2KLO A;  2EV0 A;  2D2W A;  3W2V A;  1D3Y A;  2DJI A;  3FHZ A;  3HBL A;  3B6C A;  2X48 A;  3CLQ A;  2OTL I;  4D5C A;  1EA3 A;  1HQC A;  1S9H A;  3V8L A;  1VTN C;  3BR1 A;  2QQA A;  4PSX A;  1A5J A;  4WWC A;  5JI6 A;  2OA4 A;  3G1L A;  1YX5 A;  2DDB A;  3NWS A;  3HSE A;  4E7I A;  2O6G E;  2OCC H;  5J1R A;  1B8I B;  1W36 D;  1HC8 A;  3ZQG A;  1R5G A;  4UV9 A;  4NQW B;  4A3C J;  1MBF A;  3GYH X;  5M5W J;  5D6F A;  4CHU A;  2QVO A;  5L3G A;  4OU0 A;  3LSG A;  4W1U A;  2DCE A;  5E17 F;  2HVS A;  1DGR M;  1G3T A;  1Z67 A;  5HVQ C;  3HRU A;  5A2Q K;  3TOA A;  3GME A;  3L2U A;  5HLI A;  3DLA A;  1T56 A;  4LB5 A;  1SD6 A;  1Q1V A;  3SFI A;  5D8K B;  1XB4 A;  3SDB A;  4I98 B;  1QPM A;  1XSX A;  4XRS G;  4Q48 A;  1K79 A;  2HQN A;  2VBZ A;  4E7K A;  2QSG X;  3ABT A;  4HQE A;  3F3X A;  2STW A;  2CQK A;  2ECC A;  3B73 A;  1WHU A;  4XM3 A;  2IP2 A;  3I3L A;  4KA4 A;  2F4I A;  1VQO I;  5LHG A;  1LEA A;  2ELK A;  3H1C A;  3PQJ A;  4JQF A;  1TQI A;  3KE2 A;  1X4O A;  5K7Z A;  3ECO A;  3HPG A;  3SXY A;  1MND A;  4UB6 C;  3ZQQ A;  3ZQC A;  5B1A H;  2KHM A;  1FBU A;  3SHF A;  2QA4 I;  3BC8 A;  5FRM A;  2EIN H;  4P9U A;  2UWM A;  2WWY A;  2F4M B;  4F7Z A;  1XMK A;  1Z1D A;  2ESH A;  2O3F A;  2ZXW H;  2EFW A;  2WTE A;  3PFI A;  1G3Y A;  4MQ9 F;  4XKV A;  3OSG A;  3I4N J;  1OR7 A;  2L4M A;  4IF4 A;  4LFU A;  2K9Q A;  5H2F C;  3S32 A;  2A5W A;  2EIJ H;  4JX4 A;  3EYY A;  1A6Q A;  4C30 A;  3J81 K;  1DU0 A;  3OYJ A;  2EFP A;  2W25 A;  1WKM A;  2VOD A;  1W7P D;  1L3L A;  2R3S A;  4FE7 A;  5JVG F;  3KIO A;  2EH3 A;  3RI4 A;  3HG9 A;  2VLA A;  1MJB A;  5ERI A;  1RES A;  3OR2 C;  4A3J J;  2I8D A;  2YS9 A;  1I27 A;  1TBX A;  2XKP A;  2PLY A;  1MMS A;  4HPQ A;  4MHG A;  4GFB A;  4DZP A;  3TOB A;  1X1A A;  1JUS A;  1BM9 A;  4RA2 A;  4XLH A;  1FWZ A;  4LG0 B;  2FX0 A;  3RZD J;  5E8G A;  2VBW A;  2WBM A;  4XOR A;  1R58 A;  2V1X A;  2HU9 A;  4CCM A;  4EJW A;  2CW7 A;  2JWT A;  1AOY A;  3ERE D;  2BEO A;  1MMD A;  2O61 A;  2MH2 A;  2XHK A;  3AFH A;  3G73 A;  1LEB A;  2L54 A;  1J7K A;  1X1C A;  4NDL A;  3W6J B;  3BCA A;  3E5Q A;  3CES A;  3OMY A;  2ZNZ A;  4RB0 A;  4CXF A;  4BU2 A;  2V9K A;  2MLK A;  4Y17 A;  5J47 A;  2GWR A;  2RNG A;  3DBL B;  5LLQ A;  2CQ7 A;  2ZO4 A;  2DFF A;  3S3O A;  4HX7 A;  2LY2 A;  4RB3 C;  1SEU A;  1QU3 A;  2O7O A;  5J4V A;  5KAI C;  4PK4 A;  1LFB A;  3RKX A;  3Q9V A;  3CJT B;  3G1M A;  2DOA A;  2EFQ A;  1VFC A;  4F92 B;  2Y48 A;  2DT6 A;  4HNU A;  4M9S A;  5K5Q A;  2CV0 A;  2XC7 A;  3SZG A;  4U0W A;  1T98 A;  2XPV A;  4L9N A;  1LVA A;  2DW4 A;  4G6T B;  3DTK A;  2VON A;  4QLC U;  2OF7 A;  3J7A O;  4BQN A;  3ULQ B;  5L3B A;  2CH0 A;  1BJA A;  1P6R A;  1H8A C;  2WY7 Q;  3ZMD A;  4JX5 A;  1P4X A;  2NS7 A;  2X85 A;  2GXA A;  2R7S A;  2H6B A;  1YI2 I;  3BJO A;  1R1V A;  2JSC A;  2KIF A;  3TO7 A;  3IRR A;  1QPI A;  3HDD A;  1Y56 A;  2LYC A;  4GXO A;  1H9T A;  2VL8 A;  3LA7 A;  2LK2 A;  2HXI A;  5IYC J;  5KK1 A;  3KP4 A;  3JRA A;  2Z1D A;  4XKC A;  1J9I A;  2R7U A;  2P7V B;  3R0A A;  2XAH A;  2ZME A;  2D1V A;  3NQO A;  4PJN A;  4P55 A;  5AIQ A;  3ESW B;  1G2H A;  2Z99 A;  4F52 A;  1IN7 A;  1TWG J;  3M7G A;  2R7V A;  3LSK A;  2M8E A;  2JSP A;  1S5L C;  2MYS A;  1Y8Q B;  3U21 A;  4X0G A;  3R0J A;  2A07 F;  1HLV A;  3CUQ B;  3S1N J;  2LC2 A;  2FXA A;  3BWG A;  1K83 J;  2IS1 A;  3Q9S A;  3CCQ I;  3BT9 A;  1ACI A;  1YRN A;  5TRD A;  2DFH A;  1RET A;  3R6S A;  1DQU A;  1BI2 A;  1ENH A;  1IN6 A;  1ITY A;  3VSK A;  1HXD A;  5ICC A;  3C1D A;  2Z2S B;  3L1P A;  3S3N A;  1YTY A;  2HYJ A;  1O3T A;  1VF9 A;  2ISZ A;  3JRB A;  4AM3 A;  3E7L A;  5ICG A;  2CYY A;  3RYP A;  2IGO A;  2RV8 A;  1W5T A;  1QNT A;  3H3U A;  1FMW A;  4A3G J;  2LOO A;  4PDK A;  1XX5 A;  2QQ8 A;  4I01 A;  4YFN F;  3IWF A;  4PSW A;  3FBN B;  4KUM A;  3CF2 A;  2XAJ A;  2X6O A;  2JA5 J;  3WGI A;  1ZHF A;  1I1G A;  3CUO A;  1WQ2 A;  4NHJ A;  4BE2 A;  2DA1 A;  1B9N A;  3W6K B;  4B8X A;  4DBR A;  3FWE A;  5J40 A;  2BXY A;  2UUZ A;  2BY2 A;  3OYC A;  2F5E A;  4XN0 A;  2EZH A;  2GA2 A;  3OL3 A;  2E5N A;  2LY1 A;  1FOY A;  3CCJ I;  2DXI A;  5FRN A;  2M9H A;  3RKW A;  2P4W A;  4I7H A;  2XDV A;  4CZC A;  2ZXH A;  1R22 A;  1YLF A;  2FMY A;  3B02 A;  2QEX I;  2WAQ A;  3FXM A;  1B72 B;  3KZI C;  3E5X A;  4RMN A;  3LFU A;  2F48 A;  3I4M J;  2Q2E B;  1XDU A;  4D7N A;  1IXS B;  2R5Z A;  4HLY A;  5FFZ A;  4DIQ A;  2ZJR F;  2L0K A;  2XF6 A;  3CDI A;  5ED4 A;  2DTZ A;  1CQT A;  1N25 A;  4BAC A;  2Y30 A;  3FF5 A;  4PZJ A;  2IT0 A;  3FIS A;  2PJR B;  2R7D A;  2DA2 A;  5CVU A;  2WY8 Q;  5ICE A;  2FSW A;  2HKX A;  4HNV A;  5EEA A;  3CMA I;  3NRV A;  5DUK A;  1X4P A;  1TTY A;  3PFY A;  2ZCW A;  2CFO A;  4D0P A;  3L2C A;  4B4C A;  1GUU A;  3OYI A;  3GZ5 A;  2DT5 A;  3V7S A;  2L9R A;  3ROU A;  1F1Z A;  2BY1 A;  1S7E A;  1HF0 A;  1ZLJ A;  5D4R A;  2JRT A;  1FYL A;  1D1B A;  2MA3 A;  4ANJ A;  4U7D A;  3RTR A;  4FAS D;  4HRI A;  1MW7 A;  3RKY A;  3TBI A;  2LFB A;  2R4G A;  1JHF A;  3CLO A;  2E1N A;  1H89 C;  3G1O A;  4CZZ A;  2DK5 A;  3LSH A;  3WG7 H;  2GZW A;  2B63 J;  2F5V A;  4KT5 C;  3ZMU A;  3PM1 A;  1R5H A;  3ZQI A;  1IXR C;  1S3J A;  3PSF A;  4X1E A;  2QUF A;  1B6A A;  2B7E A;  2A05 A;  2DA6 A;  3QOE A;  3FK6 A;  5DD4 A;  2KZG A;  4XON A;  3HEF A;  4AID A;  2DPD A;  1D0Y A;  2M2E A;  4OIO F;  4UVA A;  2M8G X;  4XLC A;  5CPR B;  3PNV A;  4S04 A;  5EG0 A;  2VQH A;  2OV7 A;  2DMU A;  3EUH A;  3O6B B;  4II3 A;  4BJT A;  3SFZ A;  4V19 K;  1WFX A;  3FXQ A;  3K7A J;  2Z3Y A;  5BPI A;  2AS5 F;  5FB2 A;  2FOW A;  3T1B A;  3HOT A;  2M45 A;  4GYI A;  3E6B A;  5FRO A;  2DBB A;  2M3A A;  2OD5 A;  2OAZ A;  5FD6 A;  1XN7 A;  3SZP A;  3ZRG A;  3ZMT A;  4B48 A;  5GTI C;  1LE8 B;  1JKO C;  2RRE A;  3H35 A;  2K9S A;  2LR8 A;  1K78 B;  4G6D A;  3BP8 A;  4P5O A;  1NTC A;  3HUG B;  3DKW A;  3M1E A;  1K6Y A;  1PP8 F;  2PI0 A;  1J5Y A;  5ICF A;  1ETK A;  4BY7 J;  1E3H A;  2PN6 A;  1G59 A;  1YS6 A;  4EM2 A;  3I0T A;  3BPV A;  1YHQ I;  1G3S A;  1OMI A;  2W57 A;  1VQP I;  1FIP A;  1VI0 A;  3CO6 C;  1JKR C;  2VKE A;  1R71 A;  4BQQ A;  3LOC A;  3G2B A;  2VJJ A;  1R4M B;  3JRH A;  1BW6 A;  1ZEL A;  1QBJ A;  2IS2 A;  3BZ6 A;  4A69 C;  2Q8K A;  1IDZ A;  2VB6 A;  4HSR A;  2JPB A;  1ON2 A;  5HDK A;  1RIO H;  1IRX A;  2Z33 A;  1UZC A;  1GHC A;  5E3L A;  3BG7 A;  4GCV A;  3LFK A;  2EB7 A;  4DNC A;  1KGS A;  2PQ8 A;  5HS8 A;  1MH4 A;  1Y1V J;  2MG4 A;  3CME I;  4WXH A;  3CD6 I;  2VXD A;  1X1B A;  2RKH A;  1IAW A;  3OIO A;  1YJ9 I;  1QZZ A;  3JRI A;  2O9L A;  4RAF A;  2DAO A;  1W0U A;  4EEF G;  3VYU B;  3BZC A;  3S1M J;  4IPA A;  2ETH A;  4G94 A;  2DU9 A;  2AO9 A;  3GTM J;  4ZYE A;  1SFE A;  3QAH A;  3VSL A;  1ZG3 A;  2RC4 A;  3K10 A;  1O7F A;  1WGX A;  1MDM B;  2GOX B;  3OR1 C;  1CGP A;  1IRG A;  1Z6T A;  4O6J A;  3DXJ F;  3H5R A;  5K1Y A;  3MD2 A;  3FM3 A;  1K61 A;  2LMD A;  2H1L A;  1I39 A;  2HQA A;  4G7H F;  4ZTF A;  2GBY A;  2HOS A;  2KT0 A;  4XR6 A;  4UHT A;  5L3D A;  5DM7 F;  3HKZ N;  1LJ9 A;  3DF8 A;  4A3M J;  3OS0 A;  3BR3 A;  3C2H A;  1IF1 A;  2AQE A;  1HKQ A;  4ETS A;  2JTV A;  1OCR H;  2KMU A;  3LMM A;  3WU2 C;  5JLX A;  3O3K A;  2XB0 X;  4KIB A;  1ZLK A;  3TQN A;  1ETW A;  3SDG A;  1Y6I A;  2ZME C;  1STZ A;  1P7I A;  3QU6 A;  3T5X A;  4Y7N J;  1Z3Y A;  4KIT B;  1YG2 A;  2KIS A;  3CUQ A;  4M3F A;  1AA7 A;  1F36 A;  3QYB A;  4M6V A;  2OQR A;  5C44 J;  5J1Y A;  4E7L A;  2K27 A;  4YIF A;  3L7W A;  3P9I A;  5CQG A;  1JUM A;  3JRG A;  1FPQ A;  3S17 J;  2XSJ C;  4FET A;  2XKO A;  1ETO A;  2L9N A;  3HGG A;  2DPU A;  5GAH J;  2JA6 J;  1DU6 A;  1P9Q C;  4HBL A;  3WGG A;  3BR2 A;  1F43 A;  3J80 Z;  2IAI A;  4BBR J;  3SEQ A;  4DOZ A;  3DEU A;  3LA3 A;  3OYA A;  1XSD A;  1ZRF A;  1X2M A;  3OYK A;  4UB8 C;  3ZQL A;  5BOX A;  3FXK A;  3PNT A;  4CCO A;  2RAE A;  1TQM A;  1FYK A;  1XTA A;  1SVO A;  2L3D A;  4HLX A;  1W5C C;  3T8T A;  2X6W A;  2K40 A;  1W5S A;  3JSO A;  2XGX A;  3H9G A;  4MEX F;  2H94 A;  1WJE A;  3GVA A;  2V1N A;  4QWQ A;  1SFU A;  1OPC A;  5F6F A;  1XMX A;  4QSH A;  1WZ2 A;  3CDL A;  3U1D A;  4RLF A;  2X1C A;  3HXL A;  4UUT A;  4YFK F;  4A3F J;  1DPU A;  1HA8 A;  2Q2E A;  2PG4 A;  2LTP A;  4B1R A;  1K4T A;  4BE1 A;  2AXT C;  3FXU A;  3E6C C;  3BG3 A;  1BOA A;  1QGP A;  3BJA A;  3JR9 A;  4G7O F;  4IHT A;  2IEK A;  3K70 C;  1BR1 A;  1VQM I;  5DCM A;  1TWF J;  5HLG A;  1QO0 D;  2FRH A;  2K4B A;  5F1R A;  3OYG A;  1ZR4 A;  3DU5 A;  1N77 A;  2E1O A;  2ZB9 A;  3ZCO A;  4UUV A;  5FKO A;  2XRL A;  1YJN I;  1IG7 A;  1WRJ A;  4LLN A;  2OTJ I;  3A1Y A;  2H8W A;  3F22 A;  4N9I A;  2V6E A;  2O03 A;  1IN8 A;  2NNY A;  3FMR A;  2A61 A;  3E3V A;  4D9J A;  4LJZ F;  4U88 A;  2H6C A;  3C2G A;  1A31 A;  1UG0 A;  3BTJ A;  3H5N A;  5J3L A;  4ZDL A;  1ZTR A;  5LEK A;  1HSJ A;  3M1C A;  1TT5 B;  2ESN A;  5CVJ A;  4BUP A;  3A02 A;  1D5V A;  1FOW A;  3K4K A;  1X3Z B;  1HW1 A;  2J5P A;  1KZH A;  1ON1 A;  1KYW A;  3TKY A;  3DTI A;  2JK3 A;  3H9Q A;  4OWR B;  3S16 J;  2YX4 A;  4IO9 F;  2OUM A;  1KQ9 A;  2LDU A;  2LD5 A;  3I59 B;  1C0W A;  3AL0 C;  4BS9 A;  2A68 F;  4RM3 A;  4D1Q A;  3UR3 C;  4F3Q A;  2F4O B;  4B43 A;  4XRS A;  1TZL A;  1ETY A;  1V5F A;  3I56 I;  1S7O A;  2QSF X;  2H8R A;  1NHA A;  3F23 A;  3MN2 A;  5LRS A;  2PMH A;  1X3U A;  5IT9 Z;  2FQ3 A;  2WV1 A;  2CQQ A;  3FM5 A;  4B3A A;  2BY0 A;  1O3S A;  4KYW A;  2EFO A;  3PIP F;  1SVL A;  2QQ9 A;  1Q1H A;  2L02 A;  2JQ7 A;  1V5G A;  4IRH A;  1TL8 A;  5LHH A;  2RQQ A;  3PO3 J;  1YQA A;  1TLH B;  3RKQ A;  1OCC H;  3EDP A;  2E35 A;  1TWC J;  3EUH C;  5DEQ A;  3VPR A;  1WPK A;  5HLT A;  2L9S A;  1HDP A;  1V55 H;  4ENM A;  1KYZ A;  4R1H A;  4YG2 F;  4YIR X;  3P7N A;  2K9N A;  2IA2 A;  3CQZ J;  3VYR B;  1YYV A;  3DV8 A;  5ILU A;  4WCG A;  3ABK H;  3LSP A;  3GTL J;  1TNT A;  1K78 A;  4RS8 A;  1SC7 A;  2YPR A;  3U2R A;  4N4N B;  2XIG A;  2X0L A;  1CF7 A;  2HWV A;  3BQZ A;  4JX6 A;  3L2V A;  3TDU C;  3JRF A;  1FJL A;  5F04 A;  3GFM A;  3BLY A;  3JRD A;  4DYC A;  2EZI A;  5EZH A;  3ZQH A;  4CCN A;  4A12 A;  2HGC A;  4C2T A;  4OAY A;  3HZJ A;  5DM6 F;  3ZGK A;  4HV6 A;  2JPC A;  4M3G A;  3I5U A;  3LSJ A;  3WOD F;  1TW3 A;  4PJM A;  1DP7 P;  2QKM B;  5KNL A;  1LVK A;  3ZP5 A;  2Z9O A;  2V26 A;  4HYE A;  4XKB A;  4BL0 B;  3OY9 A;  3F8N A;  3OYB A;  1QHG A;  5JR3 A;  4CYC B;  4XK4 A;  4MEY F;  1J2X A;  4HAM A;  2E71 A;  4XLF A;  1T8I A;  1VQ9 I;  2N8G A;  4CCL A;  2VIX A;  2BHY A;  2LH9 A;  3M8F A;  4KMU X;  5LGT A;  2R7O A;  4V2F A;  1I3Q J;  2LVS A;  1LQ1 A;  1SVM A;  5FFX A;  1P4A A;  1UG2 A;  3C7J A;  3GW2 A;  5J1U A;  2P81 A;  3J7A Y;  3MZH A;  2NOG A;  4A2U A;  5EJC A;  2QBY B;  5HOD A;  2DMT A;  4QIW N;  2F5C A;  5K7H A;  3AAF A;  3MZ8 A;  4GO1 A;  1WH5 A;  2ZNY A;  1IZ1 A;  3MAJ A;  3K1N A;  1W0T A;  1OFC X;  2MC3 A;  2QGU A;  3QYE A;  4P1W A;  4BHP A;  4BH9 A;  5L3F A;  4I6Z A;  2CV2 A;  4PJL A;  3SEZ A;  1RC9 A;  3I55 I;  3JTH A;  4HA8 A;  2NXN B;  1B1B A;  3ZPL A;  3ZMZ A;  4BY1 J;  3E5U A;  2L7Z A;  1BA5 A;  1Z21 A;  2LY9 A;  2FNA A;  3DKX A;  4DYR A;  1W7P A;  3WTV C;  2XV4 S;  5FLV A;  5CVV A;  1S6L A;  1Y0N A;  5BS6 A;  1XGM A;  5JHU A;  3V8J A;  3CCS I;  1RZ4 A;  1SMT A;  4OIN F;  4AIJ A;  2V9P A;  2VKH A;  4ON0 A;  4EV0 A;  3WU0 A;  2HS5 A;  2R5Y B;  4XOT A;  2LBF B;  4A5N A;  5L3C A;  1Y39 A;  3G3Z A;  3MMY B;  1PP7 U;  1XG1 A;  1H0M A;  1BIA A;  2NVU B;  1XDS A;  2I10 A;  1PUF B;  3F8F A;  3CO7 C;  1BC8 C;  3GTK J;  4BYY A;  3DTE A;  2WB1 N;  2XAQ A;  3IP4 B;  4RGR A;  4V2G A;  4TV7 A;  4AU7 A;  4C3H J;  2M7B A;  1ZKG A;  2W85 A;  2DQL A;  2FU4 A;  4XID A;  4AYB N;  1QZE A;  3WU1 B;  1O3Q A;  4M74 A;  3TW7 A;  3X2Q H;  3K69 A;  2HDD A;  3MZY A;  1T39 A;  3ZQ7 A;  5CQE A;  3CC2 I;  4IQJ A;  5CYV A;  3ISP A;  1KU9 A;  5LD2 C;  5EF6 A;  4KDP A;  3RCO A;  3V7R A;  3OV8 A;  4PCQ A;  1ONV A;  2VN2 A;  5E3N A;  3CJN A;  1ZGJ A;  5M3M J;  1BI3 A;  1ZGW A;  4IL6 C;  5IT3 A;  1FMV A;  1Y8R B;  4G9Y A;  1BR2 A;  1FP2 A;  1U0J A;  3VOE A;  5HDN A;  4FTH A;  3E6M A;  2NRA C;  2ID3 A;  2XPU A;  4P9F A;  2VQC A;  1RKT A;  5H6R A;  1X1D A;  2KL4 A;  4A6D A;  3K0L A;  4A3L J;  2XPW A;  2A3S A;  4M3B A;  5BNG A;  3HOS A;  4N0B A;  1IV6 A;  3BOQ A;  3GFJ A;  3HRT A;  2OU2 A;  4C3J J;  2NAZ A;  2VC0 A;  1KU7 A;  4M73 A;  3TED A;  1KQ0 A;  3ONQ A;  1B4A A;  3FXR A;  4HZF A;  2HFH A;  3KFW X;  2ZSI B;  2XRO A;  2XAS A;  4LIU A;  3KZZ A;  3QPS A;  2FEZ A;  2R7Q A;  4BKX A;  2HVR A;  2F5F A;  1NG6 A;  1O57 A;  4RB1 A;  1Z77 A;  4OMZ A;  1BBY A;  4NNJ A;  2VC1 A;  2O8X A;  4G6Q A;  4J19 A;  2R0Q C;  3HRM A;  1OCP A;  3EQL F;  3KCC A;  2ZC2 A;  1XMA A;  2NOJ B;  2W24 A;  2P5L C;  1FBQ A;  3CCY A;  5EEG A;  2L7M P;  1J59 A;  4BHB A;  2K85 A;  2GAU A;  3K2Z A;  2TCT A;  3NAU A;  3HOU J;  4AYB A;  5AON A;  3DBH B;  4U87 A;  1KU3 A;  2F2E A;  2BBY A;  1LFP A;  2QF7 A;  1OCO H;  3GO5 A;  2LSO A;  4HF0 A;  3J80 K;  1SAX A;  1REP C;  2FUG 2;  4IRI A;  2F6C A;  2MSY A;  2EV6 A;  1U6G A;  5TJJ A;  3QYF A;  3OYH A;  3GBG A;  2L7K A;  2D5V A;  2L9V A;  4OMY A;  1AKH A;  3MKL A;  1BIB A;  4IVN A;  3LST A;  4RGS A;  4UUS A;  1R6R A;  3MKZ A;  4K2E A;  1FNN A;  2E2H J;  1LDD A;  1LNW A;  2V7F A;  2XGC A;  1ZGA A;  2DA3 A;  2R92 J;  3K9T A;  2Y31 A;  4BJ6 C;  4RDU A;  2EBI A;  1BOB A;  2M34 A;  1DGW Y;  2F5D A;  4IJA A;  3VEP A;  4JOM A;  5ILV A;  3I58 A;  1G6N A;  1O4X A;  1FTZ A;  5FGM A;  3Q5F A;  3BCB A;  3FKI J;  3CJQ B;  4L5E A;  1HKT A;  1TQP A;  5GP9 A;  3L2W A;  1OCT C;  3A01 B;  4UNO A;  4JP0 A;  3GTJ J;  2E2I J;  3M8J A;  5F0C A;  3ZQF A;  1J0R A;  3F0C A;  2E36 A;  2M87 A;  3RQ4 A;  4KT6 A;  4AWX B;  5C4J J;  3BG9 A;  3L9F A;  2RN7 A;  1U5T C;  4UVB A;  2R93 J;  3E97 A;  4L5J A;  2JA2 A;  3ZN1 A;  3ZXS A;  3ABU A;  2Y0S N;  3FXJ A;  3K4L A;  1FSE A;  1MGT A;  4GDF A;  3IKT A;  2P6T A;  1V3F A;  3BR0 A;  3K1M A;  4PGG A;  1U3E M;  4KIS A;  4L18 B;  1B8I A;  4BE0 A;  2IGK A;  4G12 A;  4A0Z A;  4NQW A;  2A6T A;  4PGH A;  2M7A A;  3E6D A;  3DWL E;  2BHZ A;  3D0S A;  1T0F A;  3TP0 A;  5F1J A;  2FML A;  5C3E J;  2CU7 A;  2FA5 A;  3DFG A;  1FC3 A;  3TP3 A;  4E70 A;  2G7U A;  1FOX A;  2A5Y B;  4PFP A;  3GTP J;  3GTG J;  2LRE A;  4EMS A;  5K5R A;  2CS3 A;  3LAJ A;  1WJC A;  3W6V A;  2HXO A;  1W36 C;  4FX4 A;  2W1O A;  3G71 I;  3TO6 A;  1ETQ A;  1Z7L A;  2OCE A;  5B66 C;  2JUG A;  1Z91 A;  1YW8 A;  3K6G A;  2EJR A;  2XAF A;  2FD5 A;  1PJR A;  1I6H J;  2L4A A;  1FTT A;  3OL4 A;  4ENK A;  2DMQ A;  3V7C A;  4NC7 A;  2NVX J;  2DYS H;  3C18 A;  3IH4 A;  1GVD A;  1POG A;  4HEA 2;  1D1C A;  2LF8 A;  1ERD A;  2J5O A;  5BPD A;  2ADU A;  3SJM A;  1ETX A;  4M3D A;  4ESJ A;  5IT9 K;  3W2A A;  2M4G A;  3D5R C;  3KP3 A;  4BAY A;  4L0Y B;  1SD4 A;  1A6I A;  3OWT A;  4Y15 A;  5K5O A;  4BQO A;  4EJU A;  4XLA A;  4KJZ A;  4WK8 F;  3H5A A;  3SQN A;  5E79 C;  2DOD A;  5EGO B;  4AUX A;  9ANT A;  5TIS C;  2KIU A;  2HR3 A;  2VQL A;  4ENJ A;  2QQB A;  2IW5 A;  5DV5 A;  2YUS A;  3HYI A;  3ELK A;  2COM A;  1XPX A;  4FT8 A;  3F6O A;  5LFA A;  3IUO A;  4OIQ F;  1IUF A;  2R7F A;  4M6X A;  1ZK8 A;  5CKT A;  4CH7 A;  4L0Z B;  1MJ9 A;  2UXX A;  5D5W B;  3P5J A;  1JXS A;  4FE4 A;  3KET A;  3WTU C;  1OR7 C;  3Q0W A;  1WJF A;  4IKF A;  2XB5 A;  1D0Z A;  3S93 A;  1OQY A;  4LLG F;  1MBJ A;  3DEW A;  3HOZ J;  3EET A;  4PUS A;  3K4N A;  3O8G A;  3VYS B;  4F91 B;  1PUE E;  5J8F A;  2PJP A;  2VUM J;  3LSM A;  1X1P A;  2VXZ A;  1IRF A;  4LG0 A;  2KFD A;  2DK8 A;  3MWM A;  2LBF A;  3GFI A;  5E1Z B;  2HPI A;  1XCV A;  4Y4R A;  3M3Y J;  2CUJ A;  5IY5 H;  5F27 A;  3M07 A;  1RI7 A;  3HPH A;  5H6Q A;  5IOZ A;  3OYD A;  3WGH A;  1MZB A;  2L2O A;  2OZ6 A;  1MD0 A;  3GCM A;  2GLO A;  1BI0 A;  2EZK A;  3H0D A;  2VJI A;  4RAZ A;  5HLH A;  4UY8 I;  2HVQ A;  3KLO A;  3JTG A;  2P7C B;  2M0M A;  4ZYA A;  4NB5 A;  2QCO A;  1X3W B;  5B1B H;  3ZR8 X;  4DZJ A;  1T33 A;  3C3W A;  2KQR A;  2X51 A;  4LMY A;  3F8C A;  1IV8 A;  5M5Y J;  5B5E C;  4XSZ F;  3HRS A;  2I5U A;  1WJD A;  4XBF A;  1HKS A;  2HDC A;  1YO5 C;  2JVG A;  3P9C A;  2OZU A;  1I6X A;  3MCZ A;  2FJ1 A;  1MMN A;  4KIC A;  2ICW G;  1AWC A;  3LAP A;  4OAZ A;  3VWB A;  1EH7 A;  2EIK H;  2HZT A;  3M4O J;  4E7Z A;  2X6X A;  2R7X A;  2P5K A;  2EFN A;  2ISY A;  4M9X A;  2W48 A;  1FT9 A;  1R7J A;  3GEZ A;  2YU9 J;  2DA4 A;  3DPL C;  1NH3 A;  3GLX A;  3I4P A;  2BY3 A;  4IHY A;  2QM3 A;  4RGX A;  4CCJ A;  2HQ5 A;  2E60 A;  2Y9Y A;  4EGY A;  4DYQ A;  1UEL B;  2OQG A;  1U8B A;  2WC2 A;  1KA8 A;  1LDK B;  5IP7 J;  2EIL H;  5FD5 A;  1XGS A;  3IL2 A;  4BHC A;  3L09 A;  1G8X A;  3ABM H;  3IH2 A;  2DI3 A;  2VT3 A;  2CWE A;  3CP8 A;  2ELJ A;  3I54 A;  5EYR A;  2BVL A;  4BDY A;  2WA0 A;  3PUF A;  5GAD J;  2MC4 A;  2EV5 A;  3R61 A;  4CUG A;  3PUB A;  2M0C A;  1H88 C;  2PMZ N;  5BMZ A;  3KPH A;  2K86 A;  1KQ8 A;  1U9N A;  2JN6 A;  3LQQ A;  4B3X A;  4Y13 A;  2VBX A;  1MIJ A;  2UXN A;  4A3B J;  5BQT A;  4S05 A;  2IXS A;  3I64 A;  3KYD B;  3OYL A;  4EM0 B;  4IHX A;  1GVJ A;  2DQR A;  4I0B A;  1JI8 A;  2RGV A;  1LFU P;  1JGG A;  3T8R A;  2R7T A;  4OIP F;  2A6H F;  1OKR A;  2AXL A;  3QOD A;  1UHW A;  4EJT A;  1TWH J;  1SAU A;  4L9T A;  1D8J A;  3H3Z A;  2ZKZ A;  1BR4 A;  1WH7 A;  3EUK L;  3IV5 A;  3VDX A;  4KNY A;  4M72 A;  2GOM A;  2HTS A;  2VE8 A;  3KEQ A;  3OIP A;  1IO2 A;  2GIV A;  2ME0 A;  1S8N A;  5DUI A;  5F64 A;  5IYB J;  4DGW B;  4A3K J;  2KP6 A;  2HEO A;  3S15 J;  2PFB A;  2NVY J;  1Z05 A;  2JZY A;  1R00 A;  3QP5 A;  4I0A A;  4L9V A;  1JKP C;  1OYI A;  5K7F A;  1E0E A;  4JK1 X;  2KJB A;  4CSW A;  5JFR A;  1E2X A;  2R7Z J;  1IDY A;  1G4D A;  3DPU A;  4Y3O A;  3QWL A;  1ZG5 A;  2O8K A;  3QRF F;  4MGR A;  4Y52 J;  3I9V 2;  5IOY A;  4Q4Z F;  2ZJQ F;  1BI1 A;  3H92 A;  3HKZ A;  2M4K A;  1ZQ3 P;  2ZJP F;  1QHH D;  2YX7 A;  1B72 A;  3MFK A;  3HTU A;  3BPX A;  2CV1 A;  3ECH A;  1X2N A;  1AU7 A;  1QA6 A;  2DMN A;  3K4C A;  2PJR A;  3MKW B;  1SFK A;  4ENN A;  2ACJ A;  1ODD A;  4XKW A;  3DQV C;  3HOX J;  2JMW A;  4ITV A;  4AIH A;  4S0H B;  4IHV A;  5CVI A;  3HM5 A;  1I50 J;  3GFL A;  3BRO A;  2BOL A;  3BQY A;  4I99 C;  1LUJ B;  1BC7 C;  3GXO A;  4RAG A;  4O5V A;  4C2U A;  2ZME B;  3KX2 A;  1T0F C;  2IA0 A;  3BY6 A;  4I2O A;  3GLL A;  2VJ4 A;  3CCR I;  3MQ0 A;  4EAT A;  5E3M A;  2LG4 A;  1MMG A;  2QKL B;  4A93 J;  1K6O A;  2VPL A;  1UMQ A;  3RZO J;  3HL2 A;  2WAE A;  4MIM A;  3PL8 A;  3LQR A;  3KZY A;  1IJW C;  2IGM A;  3DEE A;  1JKQ C;  2CO5 A;  2ELH A;  2IBD A;  2IS6 A;  2WAD A;  2WV0 A;  1K4S A;  1G3W A;  3KEO A;  3L2R A;  2G0E A;  4I76 A;  4Q47 A;  5FKM A;  3HOW J;  1OIS A;  3OS1 A;  3WE2 A;  2YSR A;  2VKD A;  1XD7 A;  2BV6 A;  3LWF A;  4G8X A;  4EQQ A;  4A3D J;  3T0Y A;  5KCM A;  1MNM C;  4O3M A;  4U0V A;  1WI9 A;  4HG2 A;  2XGE A;  1GV5 A;  2JVH A;  2DFI A;  4YII A;  5EDN A;  4Y33 A;  2B9S A;  2M1B A;  2E1C A;  3IAS 2;  4UXN A;  1USS A;  1ZRD A;  2NVQ J;  2BW3 B;  2HKO A;  2A69 F;  1XSV A;  5D6E A;  4XIC A;  1GXP A;  3P9K A;  2RQP A;  3BJ6 A;  3D1N I;  2CFX A;  3TMO A;  1HST A;  4JYK A;  3CDH A;  3EPZ A;  3Q0U A;  3MKY B;  3OYN A;  2CW8 A;  5IPA A;  1WSU A;  2NS8 A;  2HOA A;  5DYM A;  3FIW A;  3HJE A;  2TDX A;  3FMQ A;  1RR7 A;  4MFD A;  4Q5S F;  3M8E A;  4ZZL A;  1IW7 F;  5DCF A;  4ZZD A;  3SYT A;  4HF2 A;  1LE8 A;  1MBE A;  4F55 A;  4IXA A;  3HHH A;  5E18 F;  2K3P A;  4XRM A;  2LP0 A;  1P92 A;  2CRG A;  3V8K A;  1EF4 A;  3L2Q A;  2FBI A;  5FKL A;  3HUG A;  1HW2 A;  3QU3 A;  2L5Q A;  4YFX F;  2OC6 A;  1XC5 A;  2GQQ A;  1S29 A;  3AG4 H;  3DCF A;  2E1M C;  4YEL A;  4ZC3 A;  3CMY A;  3COA C;  2R5Z B;  4IOA F;  1IN5 A;  1ETV A;  1YFH A;  4QPQ A;  4XRF A;  1IXC A;  1IRZ A;  2RVC A;  1F9N A;  2FF4 A;  2L7F P;  5LGU A;  4CDG A;  2P8T A;  1BN5 A;  3FX3 A;  1ZAR A;  1OJL A;  3I53 A;  1ZRC A;  1B9M A;  4LLL A;  2W4S A;  2CG4 A;  2DDA A;  4HW0 A;  2V1D A;  1UHS A;  3GZN B;  3F8M A;  2AQF A;  5L3E A;  2DJN A;  2MW8 A;  3G4S I;  1Z3X A;  3BG5 A;  3WTX C;  4L5I A;  2Y9Z A;  4Z6Y A;  1LPQ A;  1I3A A;  2VBY A;  4UV8 A;  4HQM A;  4A3E J;  1QRY A;  4NBQ A;  5HS9 A;  3D5L A;  1T2K A;  4XLN F;  2CUZ A;  1MBH A;  1U78 A;  3AL0 B;  1IUY A;  4LGW A;  4CGZ A;  3ASO H;  1JJ8 C;  1ZAO A;  2QYO A;  2LLK A;  3WHB A;  4I09 A;  2VOP A;  1FY7 A;  4M9Z A;  2BYV E;  3UKG A;  4F93 B;  1EKE A;  1V54 H;  5FKK A;  4BXX J;  1RNL A;  1Z0X A;  2IVM A;  2EPF A;  4BBS J;  2V9V A;  1MBK A;  2XAG A;  3ZMS A;  3S2W A;  1F4K A;  3OYM A;  2QEN A;  1HW5 A;  1XS9 A;  2H09 A;  3BG6 A;  3U1K A;  2VPR A;  2HOT A;  4KIG A;  5E20 A;  1T95 A;  3HC7 A;  4LK0 F;  2IRF G;  2ZXI A;  4NUB A;  2UV1 A;  2X1E A;  5D4S A;  2EQR A;  3MEX A;  1MH3 A;  5EG0 B;  1MDM A;  1VQ8 I;  2G7H A;  3HB9 A;  3HTS B;  1UHM A;  1MKM A;  4W97 A;  3WTY C;  2HDW A;  3A0H C;  1F5T A;  1R1T A;  1RUO A;  1VQN I;  1U8R A;  2D1H A;  2KKO A;  2KRF A;  3KLN A;  4LIV A;  4OIR F;  1M1E B;  1P7J A;  1W1W E;  1TWA J;  1X58 A;  4CCK A;  5M3F J;  5JLW A;  2BXZ A;  1EV7 A;  4MTE A;  1OCZ H;  5FJ8 J;  4E4H A;  2E1M B;  2R7R A;  3ML6 A;  5JHF A;  4M3E A;  1KON A;  1OYW A;  1SFO J;  5FLM J;  4ZYG A;  1YJW I;  2HYG D;  3FKJ A;  4II2 A;  4WF2 A;  3JW4 A;  4A3I J;  2XSD C;  2V6C A;  1JJ6 C;  1ZRE A;  4NC6 A;  3DPT A;  1HOM A;  5H20 A;  3IC7 A;  2HI3 A;  4HNT A;  1D0X A;  2XUB A;  3VYT B;  1VQ4 I;  1R23 A;  4AVP A;  1FSH A;  3GUD A;  4CYD A;  5C4X J;  5DTD A;  4IQ4 A; 
#chains in the Genus database with same CATH homology
 1AHD P;  1VND A;  2HXO A;  4C2M J;  1WGX A;  3GTQ J;  1ETQ A;  2CJJ A;  1GV2 A;  1K61 A;  2FD5 A;  3HBL A;  3B6C A;  1I6H J;  2X48 A;  1FTT A;  4D5C A;  3Q3S A;  2GBY A;  3OOU A;  2HOS A;  3BR1 A;  2DMQ A;  2KT0 A;  1A5J A;  2NVX J;  3HKZ N;  3IH4 A;  1GVD A;  1POG A;  3G1L A;  4A3M J;  3BR3 A;  3LNQ A;  3SJM A;  1ETX A;  4M3D A;  5JLX A;  1NK2 P;  5J1R A;  2XB0 X;  1B8I B;  1A6I A;  1ETW A;  3K2A A;  3SDG A;  3ZQG A;  4A3C J;  1MBF A;  5M5W J;  1P7I A;  4Y7N J;  4MFE A;  3GTP J;  4C3I J;  4AUX A;  5EGO B;  3S2D J;  9ANT A;  3LSG A;  4M3F A;  4W1U A;  1F36 A;  4M6V A;  5C44 J;  5J1Y A;  2YUS A;  3JRG A;  1JUM A;  3S17 J;  1ETO A;  2EZL A;  3HGG A;  1T56 A;  1E3O C;  1IUF A;  2JA6 J;  1DU6 A;  1Q1V A;  3SFI A;  1ZK8 A;  3BR2 A;  1F43 A;  2IAI A;  4BBR J;  4XRS G;  3HOV J;  3GTO J;  3PO2 J;  2FQ4 A;  4FE4 A;  2ECC A;  3Q0W A;  1X2M A;  3ZQL A;  2XB5 A;  2RAE A;  2WAQ N;  2GM4 A;  1MBJ A;  3DEW A;  3JRE A;  2K40 A;  3HOZ J;  2ELK A;  5EZG A;  3B6A A;  2DN0 A;  3O8G A;  4IHW A;  5K7Z A;  2VUM J;  3ZQC A;  4FIS A;  4AC0 A;  3M3Y J;  4QSH A;  2ID6 A;  3CDL A;  5F27 A;  4UUT A;  5IOZ A;  4A3F J;  1NK3 P;  1GDT A;  2GLO A;  2LTP A;  4B1R A;  2EZK A;  1QVU A;  3OSG A;  3BG3 A;  1WI3 A;  2CUE A;  3I4N J;  2K9Q A;  3JR9 A;  4JX4 A;  2QCO A;  2IEK A;  4MLO A;  4DZJ A;  1DU0 A;  1T33 A;  1TWF J;  5F08 A;  1ZR4 A;  5M5Y J;  2E1O A;  2ZB9 A;  4FE7 A;  5FKO A;  2EH3 A;  2XRL A;  1IG7 A;  1BW5 A;  1MBG A;  1RES A;  1IC8 A;  4A3J J;  2YS9 A;  2FJ1 A;  3BR5 A;  2CUF A;  2CQX A;  3M4O J;  4GFB A;  3S14 J;  4DZP A;  1JUS A;  3BTJ A;  5J3L A;  4D5F A;  1ZTR A;  2W48 A;  2FX0 A;  3RZD J;  2YU9 J;  2DA4 A;  4IHY A;  3A02 A;  2VKV A;  1RKW A;  2HQ5 A;  2Y9Y A;  1JUP A;  3H3V K;  3HOY J;  4DYQ A;  4IEJ A;  1U8B A;  2JWT A;  2JK3 A;  3S16 J;  5IP7 J;  2LD5 A;  3IH2 A;  3LSR A;  1JT6 A;  4NDL A;  4XRS A;  5EYR A;  1ETY A;  2H8R A;  1U9O A;  3MN2 A;  2M0C A;  1H88 C;  2WV1 A;  2CQQ A;  4B3A A;  4CYC A;  2PMZ N;  1U9N A;  2JN6 A;  2O7O A;  3PO3 J;  1LFB A;  3RKQ A;  3VPR A;  2H1K A;  1TWC J;  1WPK A;  3C2B A;  3G1M A;  1HDP A;  1VFC A;  4A3B J;  4IHX A;  2MGQ A;  2XPV A;  2K9N A;  3CQZ J;  3LSP A;  3RQI A;  3GTL J;  1LFU P;  2OF7 A;  1JGG A;  2Y2Z A;  1APL C;  4JX6 A;  3BQZ A;  1HCR A;  1H8A C;  1TWH J;  3JRF A;  1FJL A;  4JX5 A;  5F04 A;  2NS7 A;  3S2H J;  1WH7 A;  3IV5 A;  3HDD A;  3JRD A;  4DYC A;  2EZI A;  5EZH A;  1QPI A;  3ZQH A;  2ME0 A;  2LK2 A;  2HXI A;  5IYC J;  3JRA A;  2JA8 J;  4D7M A;  5IYB J;  4M3G A;  3LSJ A;  4A3K J;  3S15 J;  2NVY J;  1JKP C;  4DW6 A;  1G2H A;  5K7F A;  4CYC B;  1TWG J;  3OSF A;  4XK4 A;  2R7Z J;  1IDY A;  2OPT A;  4MO7 A;  2E2J J;  2O8K A;  2R5Y A;  2N8G A;  3TW6 A;  4Y52 J;  3ZOB A;  2XGD A;  5IOY A;  4V2F A;  1I3Q J;  2LVS A;  4RBO A;  1UG2 A;  1HLV A;  1PUF A;  1ZQ3 P;  3S1N J;  5J1U A;  2P81 A;  1K83 J;  2NOG A;  1B72 A;  3BT9 A;  5F0F A;  5HOD A;  2DMT A;  1YRN A;  4QIW N;  1Y1W J;  5K7H A;  1RET A;  1MSE C;  1ENH A;  1ITY A;  1X2N A;  1WH5 A;  1AU7 A;  2DMN A;  4ABZ A;  3L1P A;  1W0T A;  2HYJ A;  1OFC X;  1GT0 C;  1VF9 A;  4I6Z A;  3JRB A;  3E7L A;  3FK7 A;  1FEX A;  3HOX J;  2JMW A;  4IHV A;  3BTC A;  4S0H B;  1IGN A;  2E19 A;  1I50 J;  3HM5 A;  2COB A;  4FCY A;  3BQY A;  4A3G J;  4BY1 J;  1BA5 A;  2L7Z A;  2LY9 A;  2KDZ A;  4DYR A;  3QPL A;  3MVP A;  2X6O A;  2JA5 J;  1ZR2 A;  5FLV A;  5E3M A;  4A93 J;  1BJZ A;  1FIA A;  1UMQ A;  3RZO J;  2DA1 A;  1QVT A;  4MIM A;  5DS9 A;  5IYD J;  2EZH A;  2R5Y B;  1IJW C;  2M9H A;  1JKQ C;  1XG1 A;  2IBD A;  5FKN A;  2I10 A;  1PUF B;  5GPA A;  3HGY A;  3GTK J;  2G0E A;  1B72 B;  4I76 A;  2WB1 N;  5FKM A;  3HOW J;  4V2G A;  3I4M J;  4C3H J;  4D7N A;  1ZKG A;  2R5Z A;  4A3D J;  4XID A;  4AYB N;  2L0K A;  3TW7 A;  1MNM C;  2DTZ A;  1CQT A;  2HDD A;  2XGE A;  2Y30 A;  5E3O A;  1GV5 A;  3FIS A;  5EDN A;  2DA2 A;  2DMP A;  5EF6 A;  2TRT A;  4HNV A;  5EEA A;  5E3N A;  5M5X J;  2NVQ J;  5M3M J;  1ZGW A;  4XIC A;  2NVT J;  4B4C A;  1GUU A;  3D1N I;  4FTH A;  4JYK A;  2ID3 A;  2L9R A;  2XPU A;  5IP6 A;  3Q0V A;  1RKT A;  1S7E A;  3Q0U A;  3H0G J;  1HF0 A;  5IPA A;  2NS8 A;  4A3L J;  2XPW A;  2HOA A;  1MSF C;  3FIW A;  3NAR A;  2DA7 A;  4M3B A;  5BNG A;  1IV6 A;  4QTR A;  1RR7 A;  4MFD A;  4C3J J;  2LFB A;  3TED A;  1LE8 A;  1MBE A;  1H89 C;  3G1O A;  5GPC A;  4XRM A;  2LP0 A;  2CRG A;  3QPS A;  2B63 J;  1EF4 A;  5FKL A;  3PM1 A;  2LKX A;  3ZQI A;  1XC5 A;  4BKX A;  3CMY A;  3DCF A;  2R5Z B;  4X1E A;  1ETV A;  1Z77 A;  1SAN A;  2DA6 A;  3FK6 A;  4J19 A;  2R0Q C;  1IRZ A;  1OCP A;  3HEF A;  2L7F P;  2M2E A;  2M8G X;  3CCY A;  2L7M P;  3JRC A;  1OJL A;  3S1R J;  1TC3 C;  5EG0 A;  2DMU A;  2JJ7 A;  2TCT A;  1UHS A;  3NAU A;  3A01 A;  3HOU J;  4X6A J;  3K7A J;  2DJN A;  2MW8 A;  3BG5 A;  1D5Y A;  2QF7 A;  5F0H A;  2Y9Z A;  3A03 A;  2MSY A;  1ORK A;  1WCM J;  4A3E J;  1QRY A;  3BTL A;  1U78 A;  1MBH A;  1JTX A;  3GBG A;  2D5V A;  1LE8 B;  1JKO C;  2K9S A;  1AKH A;  3IH3 A;  3MKL A;  3WHB A;  2LLK A;  2LR8 A;  1JJ8 C;  4UUS A;  3UKG A;  4BXX J;  5FKK A;  1NTC A;  2E2H J;  2XGC A;  2DA3 A;  2R92 J;  1Z0X A;  1ETK A;  2VI6 A;  2Y31 A;  3QQA A;  1R9T J;  2ECB A;  4BBS J;  4BY7 J;  4RDU A;  1MBK A;  2EBI A;  2AHQ A;  2M34 A;  1XS9 A;  1FIP A;  2VPR A;  1VI0 A;  4LOC A;  3WHC A;  2HOT A;  1JKR C;  1O4X A;  2VKE A;  2ME6 A;  3O8H A;  1FTZ A;  3FKI J;  5EG0 B;  1JTY A;  2EQR A;  3LOC A;  1MH3 A;  4L5E A;  3HB9 A;  5GP9 A;  3JRH A;  1BW6 A;  1OCT C;  3A01 B;  4W97 A;  4A69 C;  1IDZ A;  4JP0 A;  3GTJ J;  2X9D A;  2E2I J;  5F0C A;  3ZQF A;  3BTI A;  3F0C A;  5C4J J;  1P7J A;  1X58 A;  1TWA J;  3BG9 A;  5M3F J;  2R93 J;  5JLW A;  5FJ8 J;  5E3L A;  2JA7 J;  5IP9 J;  2Y0S N;  4M3E A;  1SFO J;  3BR0 A;  1MH4 A;  5FLM J;  1Y1V J;  2MG4 A;  1AKH B;  1BL0 A;  1YRN B;  1RPW A;  1B8I A;  4G12 A;  4UUS B;  4A3I J;  2XSD C;  2DA5 A;  1JJ6 C;  3OIO A;  1JT0 A;  3JRI A;  2O9L A;  5EGO A;  3TP0 A;  5F1J A;  1W0U A;  1HDD C;  4EEF G;  5C3E J;  1HOM A;  2CU7 A;  2HI3 A;  3S1M J;  3S1Q J;  3TP3 A;  2AO9 A;  3GTM J;  5C4X J;  3BR6 A;  5DTD A;  3GTG J;  3W6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...