1MBGA

Mouse c-myb dna-binding domain repeat 2
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
52
structure length
52
Chain Sequence
LIKGPWTKEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Comparison of the free and DNA-complexed forms of the DNA-binding domain from c-Myb.
pubmed doi rcsb
molecule tags Dna binding protein
molecule keywords MYB PROTO-ONCOGENE PROTEIN
total genus 18
structure length 52
sequence length 52
ec nomenclature
pdb deposition date 1995-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1mbgA00
2LD5A 2JA5J 4BY7J 1P7JA 2X9DA 4A3KJ 2KDZA 3NAUA 4M3GA 4UUSB 1SANA 2DA6A 2QF7A 3K7AJ 5FKKA 3BTJA 2CQXA 1ZTRA 1MBJA 1APLC 3HOVJ 2GBYA 1B8IA 5F0FA 4XK4A 1JKOC 3IV5A 4IHYA 1I3QJ 3FKIJ 2HXOA 4QTRA 3VPRA 2EZLA 1P7IA 2R93J 3TW7A 5BNGA 2L7ZA 1H8AC 1ETYA 3JRDA 2VPRA 3JRHA 5E3OA 3LSRA 4C3HJ 3M4OJ 5IP9J 1DU6A 2DMNA 1BJZA 3CCYA 3BR3A 2K40A 1GDTA 4FCYA 1WGXA 1H89C 3WHCA 3HOZJ 4C3IJ 4GFBA 4JYKA 3Q0WA 5F08A 1QVUA 3S15J 2ZB9A 2DA5A 1A5JA 2E19A 3ZQCA 1LFUP 2ID6A 1VFCA 5F04A 3BG9A 1JUSA 3S2DJ 4A3CJ 2XGDA 2NS8A 2ID3A 3GBGA 2JA6J 4XIDA 3HGYA 1X58A 4B4CA 1XS9A 1K83J 5FKMA 2LVSA 3S14J 4B1RA 5M3FJ 5EF6A 2R7ZJ 2JN6A 4MFEA 5E3NA 2O8KA 1F43A 1WH7A 5IOZA 4A3JJ 1U8BA 5E3MA 2XGEA 1UHSA 4MO7A 2RAEA 1SFOJ 1JKRC 4AC0A 1BA5A 2K9NA 3IH4A 5C4JJ 4A3MJ 3S1RJ 1Y1VJ 2VKVA 2R5YB 1RKTA 4X1EA 2XPVA 2K9QA 2CQQA 2HDDA 2N8GA 1AKHB 1D5YA 2OPTA 1ETQA 3K2AA 2NVTJ 4M6VA 2MSYA 1HF0A 1ZKGA 2D5VA 2Y9ZA 4IEJA 3RZOJ 1OCPA 3Q0VA 2XPWA 3GTQJ 1WCMJ 1OCTC 3TP3A 1I6HJ 2ME0A 2DN0A 5IYBJ 4D5FA 3JRGA 3BR2A 2XPUA 5J1UA 1FTZA 2FQ4A 3RZDJ 1W0UA 2IEKA 3ZQLA 2HOSA 2FJ1A 2LR8A 2EQRA 2CU7A 1CQTA 2Y31A 3JRCA 5C3EJ 1FIPA 1RETA 3FK6A 2WAQN 4NDLA 5IP7J 4I6ZA 1IDYA 4ABZA 1MH4A 5J1YA 2XB5A 4M3FA 3FISA 1QVTA 4RDUA 3HB9A 1LE8A 3BQYA 3HM5A 4AUXA 2E1OA 1IV6A 5IYDJ 3G1MA 5DTDA 5M5XJ 3I4NJ 2EZHA 4QIWN 4XICA 1FJLA 9ANTA 3HKZN 3L1PA 2DMTA 4MLOA 1MNMC 1G2HA 1JJ8C 1BL0A 4A3BJ 2L0KA 1TC3C 2OF7A 2E2HJ 3HOUJ 2YUSA 1NTCA 4MIMA 1MBHA 2Y2ZA 5IOYA 3BR5A 2M0CA 1JJ6C 3TW6A 3HBLA 5IYCJ 2KT0A 1UG2A 2DMPA 3MVPA 1DU0A 1VI0A 3PO3J 2CJJA 4JX6A 1K61A 4X6AJ 4JX4A 2FD5A 2ME6A 5FLVA 2R5ZB 2XGCA 3H0GJ 2LY9A 4DW6A 2TRTA 3GTKJ 2ELKA 3BG3A 3HGGA 3F0CA 2YU9J 3H3VK 2L9RA 1AU7A 5EDNA 5GPAA 4M3EA 1ZR4A 2IBDA 2CUEA 5JLWA 2Y30A 1FIAA 2E2IJ 1TWFJ 1IDZA 3BG5A 1EF4A 1BW5A 1TWAJ 4B3AA 3RKQA 1PUFB 1FTTA 1MBEA 2LP0A 1ZR2A 3DCFA 2ECCA 4FISA 4JX5A 2VI6A 3UKGA 2MW8A 1OJLA 2M8GX 4JP0A 3HOWJ 1B72A 1HCRA 1TWGJ 2H1KA 1MSFC 1Y1WJ 1BW6A 1QRYA 3QQAA 1H88C 2HOTA 2XB0X 2VUMJ 3TP0A 4AYBN 4XRSG 1MSEC 4BKXA 3Q0UA 2DJNA 4A69C 2GLOA 1F36A 5C4XJ 2HQ5A 1VNDA 3D1NI 3GTPJ 2DA7A 4EEFG 2EH3A 5M3MJ 3JRAA 4RBOA 2R0QC 4A3IJ 3S1QJ 4A3GJ 3JR9A 3HDDA 5J3LA 1TWHJ 1YRNA 1IRZA 4W97A 3SDGA 4V2FA 1JGGA 4CYCB 1IC8A 4I76A 2LK2A 3BTLA 1HLVA 3LOCA 2LFBA 1IJWC 3O8GA 1JTXA 4DZPA 3CMYA 2L7FP 3TEDA 2NOGA 5GPCA 1HOMA 2XRLA 3BR6A 4A3DJ 2WV1A 3OSFA 4FE7A 3G1LA 5IPAA 2H8RA 2COBA 1JUMA 2DMQA 5M5YJ 5EZHA 4DZJA 5FLMJ 1GV2A 1NK2P 3GTJJ 3O8HA 3RQIA 2I10A 1U9OA 4UUSA 5F0HA 4BBRJ 3OOUA 4D7MA 3E7LA 3OIOA 3WHBA 1AKHA 1B8IB 3S16J 2HOAA 4DYQA 2LLKA 4A93J 2VKEA 3A02A 1JT0A 1UMQA 3ZOBA 1S7EA 2HI3A 3IH3A 2IAIA 3PM1A 3SFIA 1AHDP 2K9SA 1VF9A 2MGQA 2NVXJ 1ZK8A 4BXXJ 3GTGJ 3A03A 5FKLA 3GTOJ 3M3YJ 2P81A 5FJ8J 2JK3A 2M9HA 5EGOA 3BR0A 3GTMJ 2X6OA 2FX0A 1MBFA 2L7MP 3B6AA 5EEAA 4A3LJ 5JLXA 3LSPA 4C3JJ 5GP9A 4HNVA 4QSHA 1WH5A 2HXIA 2LKXA 1ZQ3P 1ETKA 5F1JA 1PUFA 2JJ7A 1ZGWA 1LE8B 3W6VA 5F0CA 2YS9A 5EG0A 2EZKA 4FE4A 2G0EA 4UUTA 1XG1A 2M34A 2Y0SN 5K7FA 5K7ZA 3JREA 1ENHA 2CRGA 3SJMA 2NS7A 1A6IA 2DA2A 2WB1N 1XC5A 3CQZJ 2R92J 2X48A 4MFDA 5HODA 1WI3A 4DYCA 3C2BA 3QPSA 4J19A 3S1MJ 1GV5A 2HYJA 1YRNB 3ZQIA 3BTCA 3OSGA 3QPLA 2B63J 3IH2A 1OFCX 1MBGA 3CDLA 4D5CA 4A3FJ 1QPIA 1LFBA 4Y52J 2CUFA 2LTPA 1ETVA 1GT0C 2NVQJ 1JUPA 3ZQHA 1HDDC 2JA8J 4IHXA 3ZQGA 4DYRA 3S1NJ 3BQZA 1RR7A 2ECBA 2XSDC 4A3EJ 1IUFA 4V2GA 1T56A 4S0HB 3PO2J 1Z77A 3ZQFA 4BY1J 3LSJA 2Y9YA 4W1UA 1GVDA 3HOXJ 2E2JJ 2O9LA 1RPWA 3S17J 1R9TJ 1U78A 3A01B 2DTZA 1MH3A 5IP6A 2GM4A 2O7OA 3FK7A 4XRMA 3FIWA 1Z0XA 4C2MJ 1IG7A 2DA1A 3BT9A 4FTHA 1WPKA 1POGA 4IHVA 5F27A 1GUUA 5C44J 1ORKA 3B6CA 5EYRA 3LSGA 1B72B 5E3LA 3HEFA 3JRFA 4Y7NJ 2EBIA 5K7HA 4M3DA 4D7NA 3JRIA 4M3BA 2M2EA 3MKLA 1X2MA 1U9NA 2AO9A 2DMUA 4XRSA 3HOYJ 3S2HJ 1ITYA 3NARA 2DA4A 3A01A 4G12A 3I4MJ 1ETWA 5M5WJ 1X2NA 3BTIA 1O4XA 2JA7J 2MG4A 4IHWA 1RKWA 3JRBA 1JT6A 3DEWA 5EGOB 2PMZN 2W48A 3LNQA 1Q1VA 1HDPA 2AHQA 1I50J 5FKOA 1ETXA 5J1RA 2JWTA 1NK3P 2R5YA 3BR1A 2JMWA 1FEXA 3G1OA 3GTLJ 2DA3A 1JKPC 1E3OC 1TWCJ 1ETOA 4CYCA 4BBSJ 2TCTA 1IGNA 2R5ZA 4LOCA 4L5EA 5EG0B 1W0TA 1MBKA 5EZGA 5DS9A 1RESA 1JKQC 2EZIA 3MN2A 3Q3SA 5FKNA 1JTYA 2NVYJ 1T33A 2QCOA
chains in the Genus database with same CATH superfamily
2JA5J 2V4JC 2X9DA 3K0LA 5LEJA 2B7EA 2QF7A 2IA0A 3HKZA 3K7AJ 1FYLA 3BTJA 4ITVA 1FWZA 4UXNA 2HZDA 3GF2A 4HV5A 3KP6A 3L09A 1B8IA 5FFZA 4Z6YA 2W25A 3FKIJ 4P1WA 3OYLA 2HXOA 1FBQA 4F52A 2Z33A 3DXJF 2UUZA 4CZCA 3V8JA 2Y75A 4CGZA 2IJLA 5D5WB 1YYVA 3BY6A 3TW7A 5BNGA 2L7ZA 2L3DA 1UG0A 3ZMTA 5E3OA 1IUYA 2WAQA 3TOAA 5IP9J 2CG4A 1S6LA 1BJZA 5BOXA 3FXMA 3BR3A 2L9SA 4QLCU 1P4WA 4FCYA 3IL2A 1FX7A 1I6XA 4CZZA 2CQKA 3E0JB 3PNTA 5F08A 2VONA 2CV0A 3ZN1A 1QVUA 2CH0A 2DA5A 2HKOA 1T0FC 1W7PA 2P7VB 3H9JA 3M8FA 2E19A 4IL6C 3RPQA 2KIQA 5F04A 3BG9A 4OAZA 2OD5A 3C7JA 2Y0SA 3GYHX 2QA4I 3VDXA 3HGYA 2EFQA 1R5ID 3AFHA 3TGNA 3ZGKA 3IP4B 1N77A 5EF6A 2XKPA 5E3NA 1DUXC 4NUBA 1WH7A 1L0OC 5IOZA 3ERMA 5HDGA 1U8BA 4I7HA 4KUMA 3ZP5A 4FX0A 1DP3A 2RAEA 4XR6A 1SFOJ 1BA5A 3IH4A 3WODF 5C4JJ 2RKHA 3GFMA 2STTA 4LGWA 2HDCA 2V6CA 2XC7A 1D1CA 2K9QA 4R79A 1ODDA 2DI3A 4AM3A 2JUCA 2OPTA 2QYOA 4OU0A 3K2AA 2VQHA 4Y17A 5BPDA 1IV8A 3REOA 4LFUA 4P9UA 1HW5A 1MJ9A 2EV5A 2UWMA 1QPMA 5CLSA 3V7RA 3CCJI 4NC7A 3Q0VA 3A4CA 3F8FA 1Z21A 1VQ5I 3BWGA 4EVIA 4M9SA 4D5FA 5HVQC 3BR2A 3H9GA 1KGSA 5TJJA 2VN2A 2FQ4A 3FXUA 3RZDJ 4X0GA 3CC2I 5ICEA 1QZZA 2MYSA 1FIPA 4NDLA 5DD4A 2DODA 2A07F 4O5VA 1SVOA 3CLQA 3WE3A 1VQPI 5E18F 5GAEJ 1XD7A 2KJBA 4AUXA 1EJ9A 4UY8I 1HA8A 3IWZA 1YX5A 4J00A 1USSA 4QIWN 1SFKA 9ANTA 5B3SH 5HNHA 3FXKA 4FT8A 3ABLH 3F9KA 4F7ZA 3L1PA 1MNMC 2MLKA 2ESNA 3MD2A 3WTTC 2Z5UA 1BL0A 1AOYA 4I01A 3ROUA 2Q8KA 1TC3C 2BY1A 1YFHA 1O3QA 2E2HJ 3HOUJ 2DXIA 3WTZA 4AYBA 2QGUA 3N97A 3KYLA 4HDUA 3MMYB 4U0YA 4E7IA 2FMYA 3HBLA 2O03A 1WQ2A 1DU0A 3RYPA 4HDVA 2CJJA 4JX6A 5E1XA 4X6AJ 2P6SA 2FD5A 2VE8A 2ELJA 2ME6A 2CGPA 2P5KA 5A2QK 2R5ZB 1FOXA 2XGCA 2YX7A 3H0DA 3O6BB 3EETA 1XGOA 2MC4A 3ISPA 1FSEA 2LY9A 2YX4A 3VYRB 2F4OB 2ELKA 3I0TA 5BMZA 2YU9J 3H3VK 2OTLI 2BY0A 3V8KA 4EJVA 4OIQF 2FF4A 2CUEA 1MMNA 2L9NA 5JLWA 3KZYA 1FIAA 1NG6A 3CP2A 1TWFJ 4AD9A 2IGKA 3U1DA 3TOBA 3BG5A 1K4SA 4EGYA 1TWAJ 3E6DA 2RGVA 4BACA 3BLYA 1FTTA 4DOZA 5B1BH 2HNHA 4FISA 2DFIA 4IPAA 2VI6A 2ESHA 3CESA 1HW2A 1IN7A 2P6TA 2GWRA 4IF4A 4KN7X 4ESJA 2X4HA 4Q47A 3TKYA 4IRGA 4ENNA 1BBYA 1R00A 1G3WA 3O2PE 4RGSA 3KEQA 1XTAA 2XVCA 1MIJA 2XSJC 4E7LA 2D2WA 1KA8A 1LNWA 2E36A 1D1BA 1E3HA 1FYKA 1F36A 5C4XJ 2HQ5A 1VNDA 2JUGA 2DA7A 2M8EA 4RBOA 1TNSA 4S05A 2XAFA 2R0QC 3LSMA 2W85A 2IA2A 3HDDA 1YIJI 5J3LA 3CDHA 2K9MA 2KZGA 3SDGA 4EQQA 2PG4A 3QU6A 3SZTA 4I76A 1VQOI 1OYIA 4P5OA 1Y0NA 4L5IA 3LOCA 4OIRF 3O8GA 1T39A 4DZPA 3CMYA 3T8RA 2GOMA 1TLHB 3NRVA 3ELKA 5H20A 4YIRX 4BHCA 3H9QA 1OKRA 3DEUA 1XMXA 1I5ZA 2ZJPF 2MH2A 2CFOA 3NQOA 1B4AA 5M5YJ 2JRMA 4ZZDA 2M4KA 3GTJJ 3RCOA 3DEEA 2OC6A 3E7LA 4NC6A 3WHBA 2VC0A 4EJOA 2F5CA 2XAJA 2Z2SB 3TO9A 2HOAA 1YOVB 2A69F 4DYQA 3PIPF 2IS2A 1EA3A 3A02A 1D8JA 2R7RA 4LMYA 1O7FA 2JSPA 3KP4A 1KZHA 4DQ2A 1IZ1A 1S7EA 2DK5A 2IAIA 1SC7A 4L0YB 1VQNI 4U7BA 1KQ0A 2A6HF 3R6SA 5DYMA 3GTGJ 3CC4I 4AVPA 1OYYA 3IRRA 2DYRH 5FJ8J 1A36A 2JK3A 2M9HA 3ZMUA 1OLTA 2KKOA 2VJ4A 3C1DA 4HYEA 1DGRM 3OR2C 5LGUA 3ZQ7A 3GTMJ 1ZG3A 2VBZA 5LLQA 4I99C 3VB2A 4EATA 2L4MA 3MZYA 4XBFA 3HC7A 1SMYF 1G59A 4XOPA 5GP9A 2R7OA 3BDDA 4AIKA 1ETKA 2X6XA 5TISC 1I3AA 2LF7A 2IP2A 1Y0UA 2R3SA 2KZVA 4IZZA 1F4KA 2VBYA 2G0EA 3BC8A 2CW7A 3JREA 1P6RA 1ENHA 2BW3B 3HSRA 4LB5A 5DM6F 3ZRGA 2R7FA 2NS7A 2W57A 5HLGA 2DA2A 2DAOA 2WB1N 4N9HA 4PSXA 2DPUA 1XC5A 4BE0A 4MEXF 3FXOA 3QP6A 2BHYA 3FMSA 4MFDA 2EK5A 3WTSC 1IXSB 1ON1A 2CFXA 4J19A 1R4MB 4LG3A 3J7AO 2H8WA 1BIBA 3ZQIA 2FE3A 1U5TA 1Y39A 2QBYA 2B63J 1HKTA 2QVOA 5GAHJ 1V55H 1E17A 3I71A 5HDKA 3GZ6A 2XF5A 3M8EA 4HOBA 1LFBA 2V9PA 5DM7F 1YG2A 4NHJA 3OYJA 2NVQJ 3ZQHA 2GIZA 3K4MA 3FKJA 2EA4A 2HKXA 2JTVA 4EJUA 2XSDC 1WVRA 4HV6A 3ZQFA 3DTIA 1V54H 1TBXA 2VL8A 2Y9YA 1CF7A 3DPTA 5IY5H 1X1PA 2OQGA 2E2JJ 1J59A 3F8CA 2R4GA 2FU4A 3CO7C 4MQVA 5IP6A 3I58A 3QRFF 2O7OA 4XRMA 4TV7A 3S32A 1TNTA 4PSWA 1JI8A 1EKEA 1LVKA 1Z0XA 2E1MC 2FSWA 2ICWG 3M1EA 1YJWI 3E6MA 2GQQA 2ZMEC 1DPRA 2DFHA 2DA1A 2FXAA 3HIFA 1D5VA 3UNGC 3HHGA 2K85A 1GUUA 2M7AA 3OYIA 1B72B 2HS5A 3OMYA 3HEFA 2R7UA 1R1VA 3RI4A 1G6NA 1GVJA 3OS0A 5LEKA 2ZFUA 1VQ8I 1U9NA 4NQWA 4PFOA 2ZXHA 3OYMA 3J80Z 1K7AA 3I4MJ 2JVGA 2PMZA 1LDJA 2JA7J 1O4XA 1UB9A 4IHWA 5JR3A 5EGOB 3J7YJ 4CCJA 4CO8A 1MMAA 3H1CA 2PJRA 2HGCA 2Z1DA 2JWTA 1NK3P 2R5YA 2HDWA 3Q5FA 4ESFA 3TL4X 1YIOA 1UHWA 3G1OA 1RC9A 2HQNA 3ONQA 5E1ZB 3K6GA 2LKPA 1TWCJ 1K6OA 3FBNB 2TCTA 2V9VA 2KLOA 4RA2A 1A31A 3E5XA 5KAIC 1A04A 2H09A 1W0TA 3OYKA 5EZGA 2EZIA 2HVRA 4E7JA 2MA3A 4WXHA 3PUBA 3Q3SA 3KPHA 1XGSA 1X4PA 1RR8C 2A6EF 3RKYA 2Z99A 2QCOA 5HS8A 1O7LA 4A3KJ 4HNUA 1V5FA 3HPGA 3NAUA 4OAYA 4UUSB 1J5YA 5CQGA 3TQNA 3WGIA 2CQXA 3R0JA 4A6DA 1ZTRA 5HOOA 1E0EA 1SFXA 3HOVJ 2GBYA 3CF2A 2XKOA 4BE1A 4L9NA 4BXFA 1HW1A 5F0FA 2DYSH 4M71A 5ICFA 2LBFB 1IW7F 5IT9Z 1JKOC 3OY9A 1U6GA 5JFRA 1TTYA 2G7HA 3CUQA 4KN4X 5L3CA 1W5TA 4HX8A 1J7KA 4RS8A 4HLYA 5GTIC 3QP5A 2VIXA 3E5UA 1ETYA 1TT0A 4KIBA 1YITI 1FY7A 4GXOA 3SFZA 4C3HJ 4G6DA 3DLLF 4BDYA 2DMNA 2V79A 1KQ8A 1IAWA 2R7XA 1IXRC 4CCKA 1GDTA 2BE5F 2ZC2A 4AIJA 1WFXA 3WHCA 1H89C 4IRIA 1D8KA 1O3SA 2F5EA 5JVGF 3Q0WA 1XX5A 2FNPA 4BH9A 4RM3A 5KNLA 3KIOA 1KU9A 2WB1A 1XMKA 5KCMA 3VYSB 1P4XA 1KONA 3TMOA 1BI0A 1U0JA 3E1SA 2RC4A 3H5RA 1VFCA 3F22A 3HTSB 2W1OA 4G7OF 4YG2F 1H0MA 3GBGA 2DU9A 2L54A 2E7WA 2W82A 5E79C 4XIDA 1X58A 3I4PA 4UB8C 3KP7A 4Y4RA 4B4CA 1K83J 2DFFA 4A2UA 3KLOA 4ENJA 4RLQA 1LB2A 1Y8RB 2R7TA 3DFGA 5M3FJ 5B66C 4MFEA 2VC1A 4KT5C 3W2WA 2O8KA 4KIGA 2BVLA 4CH7A 1BOBA 2QQBA 3VYUB 1ONVA 1UHSA 2NNYA 2A6TA 2P5VA 1RIOH 3J81K 3K70C 4AC0A 1QQIA 2K9NA 2VQCA 4YEJA 2PJRB 3E6BA 3BPVA 1Y1VJ 3KCCA 1RKTA 2R5YB 1R36A 4M73A 2RNGA 2K4JA 1H9TA 5TGTA 2VT3A 1AKHB 1S29A 1WJAA 4OINF 3AG4H 4ZJZA 2E71A 4XKVA 3RTRA 1WJEA 1OR7A 4M6VA 3VSKA 1ZKGA 2RN7A 4Y15A 3K4CA 1REPC 1R7JA 2LREA 3RZOJ 4XORA 2HEOA 1JHFA 5GTHC 2XPWA 1WCMJ 3H35A 3TP3A 1R5HA 1U5TC 1J0RA 2ME0A 2VJIA 1T98A 2DN0A 5IYBJ 4HG2A 3VFZA 2XPUA 5J1UA 3NWSA 3WU0A 5BQTA 2QQ8A 2IEKA 3CCMI 2HOSA 1XN7A 2FJ1A 2EQRA 4II2A 3IKVA 1CQTA 2XUBA 2HR3A 2Y31A 3JRCA 5C3EJ 2WA0A 1RETA 4I6ZA 1L3LA 1TZLA 3M9AA 3RYRA 2G7UA 1MH4A 1RZ4A 3U9GA 3FISA 1UHMA 2BOLA 3CCRI 1LE8A 5JHFA 3KEYA 2F5DA 2H1LA 3BQYA 3GCMA 2NS0A 2PQ8A 4BNCA 3LAJA 1WJFA 5M5XJ 3PUFA 1S5LC 2CO5A 4XLAA 3I4NJ 4BHPA 4XICA 2W7NA 4XLNF 3ZXSA 4XLHA 3K1MA 5TRDA 2LRDA 3N4MA 1OISA 4I2OA 3ZCOA 1F1ZA 1ZGJA 2DMTA 1FBUA 2E34A 4MLOA 3OV8A 2M30A 4D0PA 4A3BJ 1FYMA 2OF7A 3LA3A 3E3VA 5FD5A 2XV4S 2AQEA 4HRIA 3CJNA 4RB2C 2Y2ZA 2K86A 5IOYA 2DQLA 4MGRA 1G3SA 4AVZA 4G7ZF 3FZVA 5ILSA 4LLGF 2M4GA 4RM2A 5KK1A 1UG2A 3K4LA 3MVPA 2OU2A 4YIFA 2O3FA 4DIQA 4CCMA 5LBQA 1SAUA 3WTXC 2Q2EB 3PQJA 3BG3A 4UB6C 3HGGA 1AU7A 3FXLA 5FROA 3LQQA 1OPCA 4LK1F 5GPAA 3PQKA 4M3EA 2I8DA 3DF8A 2IBDA 4H4KC 2DDBA 1U2WA 4ETSA 2Y30A 1B9NA 2GA2A 3HXLA 2E2IJ 1IDZA 2M1BA 1EF4A 3RKQA 1PUFB 3WTUC 2LMDA 1ZAOA 2ECCA 4JOMA 4JX5A 2QKLB 3VODA 2R7VA 3CMAI 2B0LA 3PNYA 5J4YA 2CUJA 2VXDA 1QHGA 3GMEA 3UKGA 3KP3A 3HOWJ 5K5OA 1HKSA 3AAFA 1Y1WJ 2RDPA 4YFKF 2KJCA 2CW0F 1H88C 1IXCA 5K5RA 1Z3XA 4HA8A 2RREA 1SD5A 3T0YA 3QWLA 4IHSA 3DLAA 1JXSA 3ECOA 3VEPA 3P9IA 2L5QA 1QBJA 4KT6A 3K1NA 1QHHD 3LWFA 1V5EA 3D1NI 3GTPJ 4EM0B 1HSTA 3F3XA 2EH3A 2FBKA 3JRAA 2M3AA 2HQAA 4M9ZA 3S1QJ 2GIVA 4ZYAA 2ZBKA 2GXBA 4UV8A 3JTGA 2V1DA 2DOAA 1TWHJ 1IRZA 2L7KA 1YTYA 2P4WA 4IOAF 5J40A 3WU2C 1SVMA 5CYVA 1LQ1A 1Q1HA 2DCEA 1BI2A 1IC8A 3MZHA 4BAYA 5E17F 4I0BA 2Z9OA 1IJWC 2OAZA 4I98B 2L7FP 3TEDA 1Z91A 5B5EC 2JT1A 4MNUA 1UELB 3EYYA 4WF2A 2WV1A 1O3TA 2EFNA 4ZDLA 3X2QH 4KMUX 2COBA 3CLOA 1JUMA 3JW4A 1SVLA 4HX4A 4HNTA 1N25A 2GAUA 5ILVA 1NK2P 3IAM2 2KRCA 3L2RA 4PCQA 3OS1A 3OYBA 4P55A 4PGGA 3IKTA 2IRFG 1B8IB 3S16J 4C30A 2VBXA 1C0WA 2LLKA 1QO0D 4HF0A 3OYGA 4C2TA 3OYDA 1X1DA 4Y3OA 2K3PA 3ZOBA 2Q2EA 2HI3A 2X51A 1R49A 3CP8A 3S3MA 2X6WA 2QWWA 1ZRDA 2MFZA 2LNBA 3EUHC 2IGNA 2VQLA 3S3NA 1BI3A 3R4KA 3DBHB 3DU6A 3BR0A 1B6AA 2WBMA 4U0VA 1QNTA 2KISA 4XLFA 2E5NA 4WXDA 2Y69H 3SEZA 3DTEA 4OMZA 1X1BA 3WG9A 3CCLI 2YU3A 5EEAA 3LL7A 2CYYA 2QBYB 5JLXA 2IA1A 3LSPA 2CMPA 2HXIA 3BJOA 2KDOA 2PFBA 5F1JA 4UNOA 2I5UA 3OYHA 2DOFA 2XF7A 4R1HA 5F0CA 2YS9A 4A6EA 4NNJA 2FOWA 1OCRH 4HBLA 1XG1A 2M34A 4EV0A 2Y0SN 1R58A 4L18B 1EH7A 4RAFA 4IQJA 1I1SA 5HDNA 4BDZA 4GO1A 2FA5A 3FBIB 1OCZH 3DKXA 4UHTA 1ZLJA 2WY8Q 3GEZA 4OIOF 1YX3A 2R92J 4QPOA 5HODA 2QSHX 3QPSA 2NNNA 5F1RA 3S1MJ 3I59B 2MC3A 1R22A 1SEUA 1WJDA 3IWFA 3QAHA 4ZDPA 1BR2A 1OFCX 2K9LA 3P5JA 5LHGA 1W5SA 3ML6A 4A3FJ 4KFCA 4P9FA 2OBPA 2DPDA 4Y52J 2HVSA 2LTPA 2MABA 1HDDC 4IHXA 3S1NJ 2M7BA 2FMLA 1UAAA 2BY3A 4CYDA 4ZYEA 4HSRA 1IUFA 4V2GA 5D5VB 4XL9A 2LSOA 1FBSA 2A5YB 4W1UA 1VZ0A 3CZ6A 1WSUA 3BP8A 2O9LA 3G2BA 1GXPA 2A3SA 1ULYA 1FP2A 3GLXA 3AG3H 2DTZA 3C18A 1MH3A 3UR3C 6PAXA 3FK7A 3GFIA 4G94A 2ZXJA 3PNVA 4WX9A 3ZR8X 2YPRA 4C2MJ 5B1AH 1IG7A 4O3MA 4PGHA 3BT9A 3DQVC 3DU5A 3COAC 5LRSA 3BROA 1B9MA 1X19A 3KE2A 4XN3A 3G3ZA 5EYRA 3LSGA 3OIQA 4L9TA 1T38A 1TW3A 2EBIA 2X1DA 4M3DA 4M3BA 1EH8A 2M2EA 2EA2A 1Z1DA 4RAGA 1U3EM 2FEZA 1S8NA 4XRSA 2RV8A 3CO6C 4B44A 1W7PD 3RIRA 5ERIA 3NARA 2DA4A 3WTWC 3A01A 4G12A 1T2KA 4ZTJA 3ZMDA 3DTKA 1K78A 5FRMA 1ETWA 3D5RC 3OYCA 5M5WJ 3WGHA 1Y56A 1VQ4I 1ZLKA 1RKWA 2ZMEA 3F6OA 5D5UB 1JT6A 1TQPA 3JRBA 4KA4A 2H6BA 2W48A 3LNQA 3MQ0A 4EJTA 1VTNC 4LLNA 1LEAA 2EFPA 4CCOA 2CV2A 3BR1A 4XN0A 1Z6RA 2O0YA 4MEYF 2E1MB 3D5SC 2W24A 1WJCA 3CMMA 1IN8A 3WG7H 2OQRA 5FLXZ 4GGGA 4CYCA 2JRTA 3R61A 4BBSJ 1IGNA 2JVHA 2R5ZA 2WC2A 2O61A 1I27A 2XASA 2QM3A 2X1CA 5ICCA 4LOCA 4L5EA 2AS5F 1EH6A 1LDDA 4R8HA 4PZJA 4C9YA 5KHDA 1RESA 3MN2A 1BC8C 1BOAA 3I59A 3FHNA 4RMNA 2LOOA 4KNYA 3BCBA 1VQ9I 2GXGA 1CGPA 4BY7J 5GAGJ 2KDZA 2E1NA 2EPFA 2CWEA 1KU3A 2R7WA 3OYNA 3QODA 3HSFA 5CVRA 2AXLA 1P9QC 3ZMZA 1MBJA 1APLC 1RUNA 1W36C 1R4NB 3T5XA 3EUKL 3CCVI 3LA2A 4XK4A 4CA0A 1ZELA 2PI0A 3IV5A 3ASOH 3I56I 4IHYA 1I3QJ 3TO7A 2EZLA 2KRFA 4KIFA 5DUKA 4HSTA 3JRDA 2VPRA 3LSRA 2K3FA 1DU6A 3CCYA 4EJWA 4N4NB 3ZPLA 1O3RA 2M87A 4CSWA 1HQCA 1WGXA 1WWXA 2LC2A 5FGMA 4C3IJ 5GADJ 4JYKA 4J01A 4GFBA 2KFDA 4M9XA 2LG4A 4BJ5C 4OMYA 3D0SA 3S15J 3L00A 3ZQCA 2ID6A 1YS6A 1PP8F 3S2DJ 3M07A 3V7CA 3HRUA 1E2XA 4A3CJ 3GZNB 2QENA 2NS8A 4IX7A 2JSCA 2DQRA 3IAS2 4YRVA 1N75A 1W1WE 1PYVA 1I39A 1BJAA 2OCEA 1XDSA 1T08B 3K4NA 1KU2A 2BBYA 5E20A 3ULQB 3S14J 2L2OA 2R7ZJ 3DPLC 3L2QA 4ZYHA 1ZYRF 1YE9A 1K78B 1F43A 2WV0A 1SFUA 4A3JJ 2XGEA 3ASNH 1IRFA 2HOEA 3LMMA 4MO7A 4Z2YA 1JKRC 4EGZA 1UZCA 2Z16A 4KDPA 1IO2A 4A3MJ 2ZSIB 3S1RJ 3CMEI 4ZC3A 2VKVA 4XONA 2ADUA 2D1VA 3HHHA 4X1EA 3G71I 2VXZA 2XPVA 3EPZA 2HDDA 3IUOA 5H6RA 3BCAA 2VB6A 2XGXA 3ABMH 3HOSA 3VOEA 3U2RA 1ETQA 2NVTJ 4RGXA 1S72I 4PFPA 1YW9A 3GFLA 1VQ6I 2OZ6A 2IPQX 4HPQA 1Z6TA 2LY1A 3KYCB 4XKCA 1UJ8A 1IN4A 3V42A 2Y9ZA 1T95A 4OWRB 2K4BA 3G4SI 1OCPA 2WAEA 2HU9A 4HQEA 5CVJA 2EIMH 3HRSA 1I6HJ 4XMYA 1SFEA 5AIQA 3PIOF 3JRGA 1ZGAA 3SHFA 2UV1A 4KICA 3KEOA 3F8MA 3G6EI 2COMA 1LKXA 1W0UA 1D0XA 4HF2A 3ZQLA 3KLNA 5HNFA 1UFMA 3HRMA 2HYFA 3S8PA 4LJZF 3FK6A 2WAQN 3ZQQA 1MNDA 2ZSHB 1D3YA 1IDYA 3LFUA 1V3FA 1PVEA 2L4AA 4BJTA 2ACJA 1QVTA 4RDUA 2J5OA 2EJRA 4PJ0C 2IS6A 1FOYA 2Y0MA 3OYFA 2X1EA 1MZBA 3HM5A 5L3BA 4LG0B 1T6SA 3G1MA 5DTDA 4BJ6C 1ZRCA 3FM5A 2X0LA 2JZYA 2DK8A 2EZHA 3ZMSA 2LYCA 2XAUA 4PJLA 5CJ9A 5FRNA 2YR2A 4A0ZA 3HKZN 2GZWA 2ZKZA 3U1KA 5CVIA 4B8XA 1G2HA 2PLYA 1O57A 2EWNA 2VODA 1S3JA 1MMSA 1J2XA 2PX9A 4ENMA 2A68F 5DCFA 3LSHA 1U5TB 3ECHA 3OS2A 4HW0A 1MBHA 1H9GA 4NBQA 2P0WA 3TDUC 3IC7A 1GHCA 4ENKA 1KYZA 2WWYA 3RPUD 1JJ6C 3FHZA 4NB5A 2QQAA 1STZA 5D5XB 2F5FA 5F6FA 3TW6A 1XSDA 5IYCJ 2KT0A 5KAFC 2DMPA 2W4SA 4WXCA 1BIAA 3PO3J 4L0ZB 3GW2A 3AG2H 1K61A 4A12A 1ZN2A 3OR1C 2EIJH 1U8RA 1TP4A 2BV6A 3H0GJ 4HZFA 2ZJRF 3DKWA 3GTKJ 3F0CA 1FOKA 2HPIA 3MKZA 4E7KA 2VOOA 1ZR4A 2BVMA 3U21A 4ON0A 3GX4X 3I55I 4XLCA 1WKMA 1JGSA 3RKXA 1V5GA 2Z3YA 1WHUA 2F4IA 1YLFA 4BL0B 1BW5A 1MBEA 4PJMA 1ZR2A 3DCFA 3SYTA 2LDUA 3ZN0A 3O3KA 2MW8A 1YO5C 2M8GX 4ZTFA 4JP0A 1B72A 4ZYGA 5LHHA 1MDMA 1HCRA 1TWGJ 2H1KA 1MSFC 1BW6A 2L02A 4IXAA 2RQQA 4IRHA 4LLLA 2DW4A 1W5CC 3QQAA 2HOTA 3QYBA 4C2UA 4E70A 4BS9A 2XROA 2KIUA 4XRSG 1MSEC 3CF5F 4BKXA 2DJNA 2HZTA 2GLOA 3TO6A 1YHQI 4PJJA 3V7SA 2CUZA 4BQQA 4LITA 4Y13A 1FT9A 1USTA 1OYWA 5BS6A 2IXSA 2IGOA 3ERED 2VQGA 3JR9A 2LH9A 4A3GJ 2P8TA 3W3CA 4DNCA 4E7HA 3PL8A 4B09A 3KP2A 1G8XA 3QOEA 3S3OA 2BXYA 4W97A 3BZKA 1Y6IA 3LFKA 1IRGA 3M8JA 3C3WA 5JI6A 1ZG5A 3Q9SA 3BTLA 4BQAA 1S7AA 1P4AA 2LFBA 4ASNA 4ZH4F 2NOGA 5GPCA 3SZPA 4IQ4A 1HOMA 2XRLA 3BR6A 4FE7A 2H6CA 2QQ9A 5D4SA 2PN6A 2H8RA 2HWVA 2DMQA 5H6QA 5EZHA 4DZJA 3O8HA 4UUSA 2BXZA 5F0HA 4RB0A 2NVUB 4D7MA 3K4BA 3OIOA 3J7AY 3QPTA 1FP1D 2E60A 4WCGA 4IHTA 2DOEA 4II3A 4A93J 2LBFA 3HPHA 4CHUA 3DWLE 5HS9A 3BJAA 4XLEA 2IS1A 3W6KB 4DJAA 2WADA 3CCQI 1FOWA 1ZG1A 3SFIA 1AHDP 2K9SA 1VF9A 2MGQA 2NVXJ 1ZK8A 4BXXJ 1F5TA 3A03A 2JA6J 3GTOJ 1G3TA 2P81A 3AL0B 3DPUA 2ETHA 1PJRA 3WU1B 1T0FA 2ZJ2A 2X6OA 4B48A 3P9KA 1B1BA 4HLXA 4LIVA 3CCUI 2FX0A 2FOKA 4L9JA 1MBFA 2CSOA 2VLAA 1YJNI 4IVNA 2O5RA 3FF5A 3MWMA 4AWXB 1KYWA 2KIFA 3D5LA 2XHKA 3SQNA 4HNVA 3JAMZ 2LKSA 3BZ6A 3HG9A 4M74A 4JQFA 2EFOA 2LKXA 3PSIA 1ZQ3P 1S7OA 1PUFA 3L2WA 3P7NA 3W6VA 1DQUA 1TQMA 4PUSA 5EG0A 2EZKA 4RLFA 3RPUA 1XSXA 2XAGA 1FPQA 5K7ZA 5HLTA 2HTJA 1HKQA 2UXXA 4HQMA 4I09A 2CQ7A 2CRGA 1YW7A 1XPXA 1A6IA 4ZDOA 3T8TA 2ZNYA 4IO9F 3W2AA 4I0AA 2OUMA 3FWEA 2X48A 2ZFWA 4DYCA 3C2BA 1SD7A 1FMWA 4A5NA 4Q48A 3IH2A 1ON2A 4DBRA 2KMUA 1DPUA 2FNAA 3DP7A 3WE2A 4D5CA 1N78A 3I5UA 2E7XA 1QA6A 1QPIA 1D0ZA 2CS3A 2GA1A 3HJEA 1J09A 2NXNB 3GUDA 4XKBA 2WTEA 4M72A 1RR7A 1OMIA 5LFAA 3K69A 3LSIA 1T56A 1MMGA 4CCNA 2AXTC 5DEQA 4BYYA 4BY1J 3SDBA 1Z05A 5FB2A 3TDZC 3HOXJ 1X1CA 4BHBA 1U78A 3I53A 1XGNA 3E97A 2DLLA 3SXYA 3A01B 4LD5A 4N9IA 3H3ZA 4AIDA 3L2UA 3KZZA 4V19K 2JPBA 1YJ9I 5K5QA 4U0WA 3OOPA 2EB7A 4B47A 1XB4A 4RB3C 4H0EA 3MKYB 4I02A 1ACIA 1HSJA 2A61A 1X3UA 1WPKA 3P9CA 4KITB 2H94A 4IHVA 2E1CA 1G4DA 1MD0A 1R23A 2VT2A 3B6CA 4FETA 1FSHA 4XNFA 3CJQB 5K7HA 5D8LB 3PSFA 3JRIA 2L01A 1X2MA 3MKLA 1XMAA 2DMUA 3J7ZI 2VJ5A 4Q5SF 3S2HJ 5FFXA 1WI9A 5H2FC 3A2KA 2FQ3A 2JA2A 4FHTA 1GLNA 3KETA 1BC7C 2QSFX 3KP5A 2R7SA 1A35A 3CCSI 1X2NA 3BTIA 4F3QA 3A1YA 2MG4A 5HS7A 3DBRB 5ED4A 3DEWA 2PMZN 3PFYA 2HYGD 1I50J 1LPQA 2KP6A 4GCVA 5J1RA 2JMWA 2Q0OA 5F64A 1FEXA 3GTLJ 1W36D 1Z67A 1DGWY 3H5AA 4DBQA 1D0YA 4K2EA 4U87A 5DCMA 4OOIA 3S93A 4BGDA 1ETOA 2DT5A 3CUOA 3W2VA 1TW2A 5KVRA 2IW5A 2CV1A 3R60A 3AG1H 4KISA 4HF1A 2BEOA 2JQ7A 4XOTA 2Q1ZB 2NYXA 5FKNA 4XQFA 1SD6A 2ISYA 1T33A 4XLPF 2LD5A 1P7JA 2DJIA 4AU7A 4U7DA 4M3GA 1RI7A 2VJJA 1SANA 3JCUC 5A2QZ 4XSZF 2DA6A 5FKKA 2DFEA 5FO5A 1HBXG 2CQNA 4HX7A 2VBWA 1QGPA 3N05A 4E6KG 2HQRA 3F8NA 2QSGX 4E7ZA 3FDYA 3C2GA 5D6FA 2W00A 3LSKA 3MCZA 4QTRA 2VASA 2XIGA 3VPRA 1MW7A 4RGRA 1P7IA 5L3FA 3MEXA 2R93J 3RKWA 1H8AC 1TL8A 2YSRA 1SAXA 3JRHA 5LHIA 2KHMA 3M4OJ 3VSLA 2V1UA 4FX4A 3QOPA 3V4GA 2STWA 2K40A 4KJZA 5LGTA 4MTDA 5EEHA 2QKMB 3HOZJ 4AIHA 4L5JA 3MZ8A 2DDAA 3V8LA 4LB6B 2QUFA 3K1PA 1XCBA 2ZB9A 4ANJA 2J5PA 2XAQA 1A5JA 1LFUP 2MBFA 1RNLA 3K10A 1JUSA 3LA7A 4A0YA 2ZXIA 4BEHB 4FASD 2XGDA 2BHZA 2ID3A 1HXDA 4BQNA 1V4RA 1XS9A 5FKMA 3F23A 3OIPA 2LVSA 5D8KB 4B1RA 5LD2C 2JN6A 1PUEE 5IT9K 1F9NA 2X85A 2VKDA 1GXQA 2QZ8A 2WY7Q 1YS7A 5E3MA 4S04A 4RB1A 1VQMI 1KQ9A 2HFHA 2LY2A 1DP7P 4QWQA 3GFJA 4UV9A 2QLZA 4L9VA 2EILH 1ZHFA 3OWTA 4RAZA 2MD0A 1Z9CA 2CQQA 2N8GA 3DKYA 5DCMB 4PDKA 1J75A 1LEBA 1D5YA 3CTAA 3JSPA 2BYVE 2D1HA 3KYDB 3AKZA 4Q4ZF 1MKMA 1W4MA 1R71A 1FLIA 2V26A 2A05A 2MSYA 1HF0A 2OA4A 4M6XA 2D5VA 2XRNA 4HEA2 4F92B 4A5MA 2V9KA 4PK4A 4IEJA 4EMSA 5FLXK 3LSTA 2GOXB 3FXRA 2V1XA 2F4MB 3LQRA 2M5WA 1CF7B 3GTQJ 1OCTC 4G9YA 2EV0A 4F93B 2M45A 3DV8A 1WZ2A 4U88A 3KFWX 3KX2A 5D6EA 1FTZA 4IOCF 2X6YA 1B59A 2LR8A 2NOJB 2CU7A 3JTHA 3H36A 2OTJI 1MNEA 2BY2A 5IP7J 1M1EB 2PBIA 2M0MA 1G3YA 4MQ9F 2KIMA 3SEQA 4XRFA 3RJPA 4ABZA 3E6CC 3ABKH 3HZJA 2V1NA 1XDUA 2XB5A 4XM3A 4M3FA 5J1YA 1J9IA 3HB9A 2P5LC 1IN5A 5CVVA 2OJED 2UXNA 1LJ9A 3NWTA 2E1OA 4EM1A 1IV6A 4DGWB 5IYDJ 3Q9VA 3RSNA 2IS4A 4BUPA 1FJLA 2A5WA 3R0AA 5JVTA 3FMQA 5CQEA 4HAMA 3HYIA 2EV6A 5AONA 1JJ8C 3K4KA 5ILUA 1WJ5A 1TQIA 5HLHA 1BR1A 2L0KA 3BPXA 3FX3A 4FQGA 2YUSA 1NTCA 4MIMA 3I64A 4BEHA 4N0BA 2H27A 2O6GE 3KZIC 1R1TA 3BR5A 2M0CA 5L3GA 1VQLI 3M1CA 1VI0A 4JX4A 1Y8QB 2VPLA 2VOPA 2P7CB 3AL0C 1QU3A 5FLVA 3FXQA 3MKWB 4E7SA 4DW6A 2BGCA 2TRTA 2BZTA 2L9RA 3CC7I 5LRRA 5EDNA 2K5CA 4KYWA 3CDIA 4O6JA 3L9FA 3RQ4A 4UVBA 3WGGA 1IRXA 3FMRA 4IKFA 4XSXF 3MFKA 3CJTB 2K02A 3GO5A 3ZMVA 2JPCA 2DT7B 4EM2A 4B3AA 1PP7U 3GXOA 5ICGA 3HL2A 2K7LA 2LP0A 1BM9A 2PMUA 2D45A 2RVCA 4XKWA 3GWZA 1OJLA 2R7QA 5DV5A 2BW3A 2QEXI 3QPHA 4MTEA 1R6RA 2DO7A 3S2WA 1QRYA 3EUAA 3SZGA 4UVAA 2XB0X 4G7HF 4M6YA 1LDKB 2EINH 2OZUA 1R1UA 3HUGA 2VUMJ 3BOQA 2OV7A 2ELHA 3TP0A 4BXUA 4MHGA 5J6XA 4AYBN 2NRAC 3Q0UA 3J80K 2NAZA 4A69C 1PDNC 3WTVC 2ZXWH 2ZMEB 3I3LA 2L9VA 2RQPA 3BJ6A 4EEFG 5M3MJ 1BI1A 2TDXA 4A3IJ 1ZRFA 5CPRB 4UUVA 3HRTA 1JE8A 4UVCA 2KRHA 4GDFA 1YRNA 4N4OB 3F21A 5HLIA 1P92A 4V2FA 2V7FA 5J47A 1K4TA 3ESWB 4KMFA 1JGGA 4CYCB 3EYIA 2LK2A 1HLVA 2KPMA 4CCLA 2KL4A 1JTXA 1ZREA 1FC3A 3H3UA 4PJNA 4GYGA 4LG0A 4A3DJ 1IF1A 3OSFA 1BR4A 3BZCA 2PJPA 3G1LA 2RNJA 3FM3A 2F6CA 5IPAA 2XDVA 5E8GA 5FLMJ 3QYEA 1GV2A 2ISZA 2W84A 4ZZLA 1K6YA 2I10A 1U9OA 3RQIA 4BBRJ 3QYFA 4CUGA 1WJBA 3DBLB 3OOUA 4WK8F 1ZH5A 2FUG2 4CICA 3G73A 3H92A 3PFIA 1MGTA 3OL4A 3CCEI 1AKHA 1XSVA 3JAMK 1S9HA 2ZJQF 2K27A 1NHAA 2E5ZA 1NH3A 4LK0F 4BE2A 2VKEA 1X1AA 4GRIA 3W6JB 2VKHA 3EQLF 1JT0A 1P2FA 1UMQA 2MD5A 1MMDA 3IH3A 1RUOA 3ABTA 3PM1A 2XAHA 3RDIA 4NC8A 3L2VA 3GZ5A 4B43A 1JHHA 5FKLA 3M3YJ 2KQRA 3OYAA 1YW8A 1Z7UA 4Y33A 5EGOA 3OYEA 1MJAA 4ESBA 3H5NA 2XF6A 2F48A 3LAPA 4E4HA 2L7MP 3B6AA 1X3WB 1I1GA 1XCVA 3HTUA 1BN5A 1NG7A 4A3LJ 2ZNZA 2DTRA 5L3DA 4C3JJ 4QSHA 1WH5A 2FRHA 4B3XA 3BG6A 2JJ7A 3GVAA 1ZGWA 1LE8B 4GYIA 1EV7A 1FZPB 3HUGB 4FE4A 3F6VA 4UUTA 5CVUA 5K7FA 2DT6A 2C6YA 2FBHA 3VYTB 2CW8A 3E5QA 1IN6A 2F5VA 2LF8A 2E35A 1MDMB 5K1YA 3SJMA 3M7GA 1T8IA 1R5GA 1K79A 2FBIA 3HSEA 3EDPA 3CQZJ 4JBAA 5EJCA 1ZARA 3CD6I 3IRQA 2G9WA 1SD4A 1WI3A 3JSOA 4G8XA 2R7DA 3F8BA 5D4RA 1VQKI 3TBIA 1GV5A 2HYJA 2PMHA 2OCCH 1YRNB 5DDGA 5LGNA 3BTCA 3OSGA 3QPLA 1TT5B 3J81Z 2IT0A 1YI2I 1MBGA 4YFNF 3CDLA 5L3EA 4IJAA 3I54A 1AA7A 4WWCA 3CUQB 2EFWA 5IT3A 2HPMA 2CUFA 3B02A 1ETVA 1GT0C 1JUPA 5AIPA 2JA8J 1YQAA 1MJBA 3ZQGA 4DYRA 3BQZA 3VWBA 2ECBA 1DDNA 4A3EJ 4S0HB 3PO2J 1Z77A 3LSJA 1GVDA 5J8CA 3K2ZA 1OR7C 3CJRB 1RPWA 3FXJA 5CKTA 3S17J 1R9TJ 4CDGA 2MH9A 5FD6A 1QZYA 1Z3YA 2GM4A 3NEUA 3BG7A 1X3ZB 3K9TA 3FIWA 1FNNA 1A6QA 1HC8A 2DBBA 2PEXA 1KU7A 1ERDA 2O8XA 2EIKH 4FTHA 4F55A 5BPIA 5J8FA 1POGA 3HOTA 4YELA 5DD8A 4P96A 4QPQA 5F27A 5C44J 1ORKA 1OCCH 1Z7LA 4G6TB 2GXAA 4YFXF 4CXFA 1QZEA 1W7PB 2F2EA 5EEGA 3K70D 3F72A 1AWCA 5E3LA 3JRFA 4Y7NJ 3B73A 3A0BC 4D7NA 2V6EA 2AO9A 3A0HC 4JK1X 4RAYA 1XGMA 2HVQA 3HOYJ 5DUIA 2WAFA 4YIIA 1ITYA 1OCOH 3GLLA 2IGMA 5E1WA 3EUHA 4F91B 4BU2A 2VE9A 4BQOA 3L2CA 3T1BA 4OIPF 3L7WA 3K4JA 1FMVA 3ABUA 4ZYDA 3C2HA 4D1QA 1OQYA 2IVMA 3PJRA 1Q1VA 1HDPA 2AHQA 5FKOA 4RGUA 1ETXA 4D9JA 3OL3A 2ZCWA 1LFPA 2MLGA 1RRJA 1UCRA 1SMTA 2DA3A 5J4VA 3CUQC 1JKPC 3IHUA 4LIUA 3WTYC 1E3PA 1E3OC 2B9SA 3I9V2 1WRJA 1D1AA 1LUJB 1LVAA 2AQFA 4NQWB 2HTSA 5EG0B 3MAJA 4A0XA 4G6QA 2ZO4A 1VQ7I 1MBKA 3QU3A 5DS9A 2Y48A 1JKQC 5E8IA 5JHUA 1JTYA 1X4OA 2UZKA 2NVYJ
chains in the Genus database with same CATH topology
2LD5A 2JA5J 4BY7J 1P7JA 2X9DA 4A3KJ 2KDZA 3NAUA 4M3GA 4UUSB 1SANA 2DA6A 2QF7A 3K7AJ 5FKKA 3BTJA 2CQXA 1ZTRA 1MBJA 1APLC 3HOVJ 2GBYA 1B8IA 5F0FA 4XK4A 1JKOC 3IV5A 4IHYA 1I3QJ 3FKIJ 2HXOA 4QTRA 3VPRA 2EZLA 1P7IA 2R93J 3TW7A 5BNGA 2L7ZA 1H8AC 1ETYA 3JRDA 2VPRA 3JRHA 5E3OA 3LSRA 4C3HJ 3M4OJ 5IP9J 1DU6A 2DMNA 1BJZA 3CCYA 3BR3A 2K40A 1GDTA 4FCYA 1WGXA 1H89C 3WHCA 3HOZJ 4C3IJ 4GFBA 4JYKA 3Q0WA 5F08A 1QVUA 3S15J 2ZB9A 2DA5A 1A5JA 2E19A 3ZQCA 1LFUP 2ID6A 1VFCA 5F04A 3BG9A 1JUSA 3S2DJ 4A3CJ 2XGDA 2NS8A 2ID3A 3GBGA 2JA6J 4XIDA 3HGYA 1X58A 4B4CA 1XS9A 1K83J 5FKMA 2LVSA 3S14J 4B1RA 5M3FJ 5EF6A 2R7ZJ 2JN6A 4MFEA 5E3NA 2O8KA 1F43A 1WH7A 5IOZA 4A3JJ 1U8BA 5E3MA 2XGEA 1UHSA 4MO7A 2RAEA 1SFOJ 1JKRC 4AC0A 1BA5A 2K9NA 3IH4A 5C4JJ 4A3MJ 3S1RJ 1Y1VJ 2VKVA 2R5YB 1RKTA 4X1EA 2XPVA 2K9QA 2CQQA 2HDDA 2N8GA 1AKHB 1D5YA 2OPTA 1ETQA 3K2AA 2NVTJ 4M6VA 2MSYA 1HF0A 1ZKGA 2D5VA 2Y9ZA 4IEJA 3RZOJ 1OCPA 3Q0VA 2XPWA 3GTQJ 1WCMJ 1OCTC 3TP3A 1I6HJ 2ME0A 2DN0A 5IYBJ 4D5FA 3JRGA 3BR2A 2XPUA 5J1UA 1FTZA 2FQ4A 3RZDJ 1W0UA 2IEKA 3ZQLA 2HOSA 2FJ1A 2LR8A 2EQRA 2CU7A 1CQTA 2Y31A 3JRCA 5C3EJ 1FIPA 1RETA 3FK6A 2WAQN 4NDLA 5IP7J 4I6ZA 1IDYA 4ABZA 1MH4A 5J1YA 2XB5A 4M3FA 3FISA 1QVTA 4RDUA 3HB9A 1LE8A 3BQYA 3HM5A 4AUXA 2E1OA 1IV6A 5IYDJ 3G1MA 5DTDA 5M5XJ 3I4NJ 2EZHA 4QIWN 4XICA 1FJLA 9ANTA 3HKZN 3L1PA 2DMTA 4MLOA 1MNMC 1G2HA 1JJ8C 1BL0A 4A3BJ 2L0KA 1TC3C 2OF7A 2E2HJ 3HOUJ 2YUSA 1NTCA 4MIMA 1MBHA 2Y2ZA 5IOYA 3BR5A 2M0CA 1JJ6C 3TW6A 3HBLA 5IYCJ 2KT0A 1UG2A 2DMPA 3MVPA 1DU0A 1VI0A 3PO3J 2CJJA 4JX6A 1K61A 4X6AJ 4JX4A 2FD5A 2ME6A 5FLVA 2R5ZB 2XGCA 3H0GJ 2LY9A 4DW6A 2TRTA 3GTKJ 2ELKA 3BG3A 3HGGA 3F0CA 2YU9J 3H3VK 2L9RA 1AU7A 5EDNA 5GPAA 4M3EA 1ZR4A 2IBDA 2CUEA 5JLWA 2Y30A 1FIAA 2E2IJ 1TWFJ 1IDZA 3BG5A 1EF4A 1BW5A 1TWAJ 4B3AA 3RKQA 1PUFB 1FTTA 1MBEA 2LP0A 1ZR2A 3DCFA 2ECCA 4FISA 4JX5A 2VI6A 3UKGA 2MW8A 1OJLA 2M8GX 4JP0A 3HOWJ 1B72A 1HCRA 1TWGJ 2H1KA 1MSFC 1Y1WJ 1BW6A 1QRYA 3QQAA 1H88C 2HOTA 2XB0X 2VUMJ 3TP0A 4AYBN 4XRSG 1MSEC 4BKXA 3Q0UA 2DJNA 4A69C 2GLOA 1F36A 5C4XJ 2HQ5A 1VNDA 3D1NI 3GTPJ 2DA7A 4EEFG 2EH3A 5M3MJ 3JRAA 4RBOA 2R0QC 4A3IJ 3S1QJ 4A3GJ 3JR9A 3HDDA 5J3LA 1TWHJ 1YRNA 1IRZA 4W97A 3SDGA 4V2FA 1JGGA 4CYCB 1IC8A 4I76A 2LK2A 3BTLA 1HLVA 3LOCA 2LFBA 1IJWC 3O8GA 1JTXA 4DZPA 3CMYA 2L7FP 3TEDA 2NOGA 5GPCA 1HOMA 2XRLA 3BR6A 4A3DJ 2WV1A 3OSFA 4FE7A 3G1LA 5IPAA 2H8RA 2COBA 1JUMA 2DMQA 5M5YJ 5EZHA 4DZJA 5FLMJ 1GV2A 1NK2P 3GTJJ 3O8HA 3RQIA 2I10A 1U9OA 4UUSA 5F0HA 4BBRJ 3OOUA 4D7MA 3E7LA 3OIOA 3WHBA 1AKHA 1B8IB 3S16J 2HOAA 4DYQA 2LLKA 4A93J 2VKEA 3A02A 1JT0A 1UMQA 3ZOBA 1S7EA 2HI3A 3IH3A 2IAIA 3PM1A 3SFIA 1AHDP 2K9SA 1VF9A 2MGQA 2NVXJ 1ZK8A 4BXXJ 3GTGJ 3A03A 5FKLA 3GTOJ 3M3YJ 2P81A 5FJ8J 2JK3A 2M9HA 5EGOA 3BR0A 3GTMJ 2X6OA 2FX0A 1MBFA 2L7MP 3B6AA 5EEAA 4A3LJ 5JLXA 3LSPA 4C3JJ 5GP9A 4HNVA 4QSHA 1WH5A 2HXIA 2LKXA 1ZQ3P 1ETKA 5F1JA 1PUFA 2JJ7A 1ZGWA 1LE8B 3W6VA 5F0CA 2YS9A 5EG0A 2EZKA 4FE4A 2G0EA 4UUTA 1XG1A 2M34A 2Y0SN 5K7FA 5K7ZA 3JREA 1ENHA 2CRGA 3SJMA 2NS7A 1A6IA 2DA2A 2WB1N 1XC5A 3CQZJ 2R92J 2X48A 4MFDA 5HODA 1WI3A 4DYCA 3C2BA 3QPSA 4J19A 3S1MJ 1GV5A 2HYJA 1YRNB 3ZQIA 3BTCA 3OSGA 3QPLA 2B63J 3IH2A 1OFCX 1MBGA 3CDLA 4D5CA 4A3FJ 1QPIA 1LFBA 4Y52J 2CUFA 2LTPA 1ETVA 1GT0C 2NVQJ 1JUPA 3ZQHA 1HDDC 2JA8J 4IHXA 3ZQGA 4DYRA 3S1NJ 3BQZA 1RR7A 2ECBA 2XSDC 4A3EJ 1IUFA 4V2GA 1T56A 4S0HB 3PO2J 1Z77A 3ZQFA 4BY1J 3LSJA 2Y9YA 4W1UA 1GVDA 3HOXJ 2E2JJ 2O9LA 1RPWA 3S17J 1R9TJ 1U78A 3A01B 2DTZA 1MH3A 5IP6A 2GM4A 2O7OA 3FK7A 4XRMA 3FIWA 1Z0XA 4C2MJ 1IG7A 2DA1A 3BT9A 4FTHA 1WPKA 1POGA 4IHVA 5F27A 1GUUA 5C44J 1ORKA 3B6CA 5EYRA 3LSGA 1B72B 5E3LA 3HEFA 3JRFA 4Y7NJ 2EBIA 5K7HA 4M3DA 4D7NA 3JRIA 4M3BA 2M2EA 3MKLA 1X2MA 1U9NA 2AO9A 2DMUA 4XRSA 3HOYJ 3S2HJ 1ITYA 3NARA 2DA4A 3A01A 4G12A 3I4MJ 1ETWA 5M5WJ 1X2NA 3BTIA 1O4XA 2JA7J 2MG4A 4IHWA 1RKWA 3JRBA 1JT6A 3DEWA 5EGOB 2PMZN 2W48A 3LNQA 1Q1VA 1HDPA 2AHQA 1I50J 5FKOA 1ETXA 5J1RA 2JWTA 1NK3P 2R5YA 3BR1A 2JMWA 1FEXA 3G1OA 3GTLJ 2DA3A 1JKPC 1E3OC 1TWCJ 1ETOA 4CYCA 4BBSJ 2TCTA 1IGNA 2R5ZA 4LOCA 4L5EA 5EG0B 1W0TA 1MBKA 5EZGA 5DS9A 1RESA 1JKQC 2EZIA 3MN2A 3Q3SA 5FKNA 1JTYA 2NVYJ 1T33A 2QCOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LD5 A;  2JA5 J;  4BY7 J;  1P7J A;  2X9D A;  4A3K J;  2KDZ A;  3NAU A;  4M3G A;  4UUS B;  1SAN A;  2DA6 A;  2QF7 A;  3K7A J;  5FKK A;  3BTJ A;  2CQX A;  1ZTR A;  1MBJ A;  1APL C;  3HOV J;  2GBY A;  1B8I A;  5F0F A;  4XK4 A;  1JKO C;  3IV5 A;  4IHY A;  1I3Q J;  3FKI J;  2HXO A;  4QTR A;  3VPR A;  2EZL A;  1P7I A;  2R93 J;  3TW7 A;  5BNG A;  2L7Z A;  1H8A C;  1ETY A;  3JRD A;  2VPR A;  3JRH A;  5E3O A;  3LSR A;  4C3H J;  3M4O J;  5IP9 J;  1DU6 A;  2DMN A;  1BJZ A;  3CCY A;  3BR3 A;  2K40 A;  1GDT A;  4FCY A;  1WGX A;  1H89 C;  3WHC A;  3HOZ J;  4C3I J;  4GFB A;  4JYK A;  3Q0W A;  5F08 A;  1QVU A;  3S15 J;  2ZB9 A;  2DA5 A;  1A5J A;  2E19 A;  3ZQC A;  1LFU P;  2ID6 A;  1VFC A;  5F04 A;  3BG9 A;  1JUS A;  3S2D J;  4A3C J;  2XGD A;  2NS8 A;  2ID3 A;  3GBG A;  2JA6 J;  4XID A;  3HGY A;  1X58 A;  4B4C A;  1XS9 A;  1K83 J;  5FKM A;  2LVS A;  3S14 J;  4B1R A;  5M3F J;  5EF6 A;  2R7Z J;  2JN6 A;  4MFE A;  5E3N A;  2O8K A;  1F43 A;  1WH7 A;  5IOZ A;  4A3J J;  1U8B A;  5E3M A;  2XGE A;  1UHS A;  4MO7 A;  2RAE A;  1SFO J;  1JKR C;  4AC0 A;  1BA5 A;  2K9N A;  3IH4 A;  5C4J J;  4A3M J;  3S1R J;  1Y1V J;  2VKV A;  2R5Y B;  1RKT A;  4X1E A;  2XPV A;  2K9Q A;  2CQQ A;  2HDD A;  2N8G A;  1AKH B;  1D5Y A;  2OPT A;  1ETQ A;  3K2A A;  2NVT J;  4M6V A;  2MSY A;  1HF0 A;  1ZKG A;  2D5V A;  2Y9Z A;  4IEJ A;  3RZO J;  1OCP A;  3Q0V A;  2XPW A;  3GTQ J;  1WCM J;  1OCT C;  3TP3 A;  1I6H J;  2ME0 A;  2DN0 A;  5IYB J;  4D5F A;  3JRG A;  3BR2 A;  2XPU A;  5J1U A;  1FTZ A;  2FQ4 A;  3RZD J;  1W0U A;  2IEK A;  3ZQL A;  2HOS A;  2FJ1 A;  2LR8 A;  2EQR A;  2CU7 A;  1CQT A;  2Y31 A;  3JRC A;  5C3E J;  1FIP A;  1RET A;  3FK6 A;  2WAQ N;  4NDL A;  5IP7 J;  4I6Z A;  1IDY A;  4ABZ A;  1MH4 A;  5J1Y A;  2XB5 A;  4M3F A;  3FIS A;  1QVT A;  4RDU A;  3HB9 A;  1LE8 A;  3BQY A;  3HM5 A;  4AUX A;  2E1O A;  1IV6 A;  5IYD J;  3G1M A;  5DTD A;  5M5X J;  3I4N J;  2EZH A;  4QIW N;  4XIC A;  1FJL A;  9ANT A;  3HKZ N;  3L1P A;  2DMT A;  4MLO A;  1MNM C;  1G2H A;  1JJ8 C;  1BL0 A;  4A3B J;  2L0K A;  1TC3 C;  2OF7 A;  2E2H J;  3HOU J;  2YUS A;  1NTC A;  4MIM A;  1MBH A;  2Y2Z A;  5IOY A;  3BR5 A;  2M0C A;  1JJ6 C;  3TW6 A;  3HBL A;  5IYC J;  2KT0 A;  1UG2 A;  2DMP A;  3MVP A;  1DU0 A;  1VI0 A;  3PO3 J;  2CJJ A;  4JX6 A;  1K61 A;  4X6A J;  4JX4 A;  2FD5 A;  2ME6 A;  5FLV A;  2R5Z B;  2XGC A;  3H0G J;  2LY9 A;  4DW6 A;  2TRT A;  3GTK J;  2ELK A;  3BG3 A;  3HGG A;  3F0C A;  2YU9 J;  3H3V K;  2L9R A;  1AU7 A;  5EDN A;  5GPA A;  4M3E A;  1ZR4 A;  2IBD A;  2CUE A;  5JLW A;  2Y30 A;  1FIA A;  2E2I J;  1TWF J;  1IDZ A;  3BG5 A;  1EF4 A;  1BW5 A;  1TWA J;  4B3A A;  3RKQ A;  1PUF B;  1FTT A;  1MBE A;  2LP0 A;  1ZR2 A;  3DCF A;  2ECC A;  4FIS A;  4JX5 A;  2VI6 A;  3UKG A;  2MW8 A;  1OJL A;  2M8G X;  4JP0 A;  3HOW J;  1B72 A;  1HCR A;  1TWG J;  2H1K A;  1MSF C;  1Y1W J;  1BW6 A;  1QRY A;  3QQA A;  1H88 C;  2HOT A;  2XB0 X;  2VUM J;  3TP0 A;  4AYB N;  4XRS G;  1MSE C;  4BKX A;  3Q0U A;  2DJN A;  4A69 C;  2GLO A;  1F36 A;  5C4X J;  2HQ5 A;  1VND A;  3D1N I;  3GTP J;  2DA7 A;  4EEF G;  2EH3 A;  5M3M J;  3JRA A;  4RBO A;  2R0Q C;  4A3I J;  3S1Q J;  4A3G J;  3JR9 A;  3HDD A;  5J3L A;  1TWH J;  1YRN A;  1IRZ A;  4W97 A;  3SDG A;  4V2F A;  1JGG A;  4CYC B;  1IC8 A;  4I76 A;  2LK2 A;  3BTL A;  1HLV A;  3LOC A;  2LFB A;  1IJW C;  3O8G A;  1JTX A;  4DZP A;  3CMY A;  2L7F P;  3TED A;  2NOG A;  5GPC A;  1HOM A;  2XRL A;  3BR6 A;  4A3D J;  2WV1 A;  3OSF A;  4FE7 A;  3G1L A;  5IPA A;  2H8R A;  2COB A;  1JUM A;  2DMQ A;  5M5Y J;  5EZH A;  4DZJ A;  5FLM J;  1GV2 A;  1NK2 P;  3GTJ J;  3O8H A;  3RQI A;  2I10 A;  1U9O A;  4UUS A;  5F0H A;  4BBR J;  3OOU A;  4D7M A;  3E7L A;  3OIO A;  3WHB A;  1AKH A;  1B8I B;  3S16 J;  2HOA A;  4DYQ A;  2LLK A;  4A93 J;  2VKE A;  3A02 A;  1JT0 A;  1UMQ A;  3ZOB A;  1S7E A;  2HI3 A;  3IH3 A;  2IAI A;  3PM1 A;  3SFI A;  1AHD P;  2K9S A;  1VF9 A;  2MGQ A;  2NVX J;  1ZK8 A;  4BXX J;  3GTG J;  3A03 A;  5FKL A;  3GTO J;  3M3Y J;  2P81 A;  5FJ8 J;  2JK3 A;  2M9H A;  5EGO A;  3BR0 A;  3GTM J;  2X6O A;  2FX0 A;  1MBF A;  2L7M P;  3B6A A;  5EEA A;  4A3L J;  5JLX A;  3LSP A;  4C3J J;  5GP9 A;  4HNV A;  4QSH A;  1WH5 A;  2HXI A;  2LKX A;  1ZQ3 P;  1ETK A;  5F1J A;  1PUF A;  2JJ7 A;  1ZGW A;  1LE8 B;  3W6V A;  5F0C A;  2YS9 A;  5EG0 A;  2EZK A;  4FE4 A;  2G0E A;  4UUT A;  1XG1 A;  2M34 A;  2Y0S N;  5K7F A;  5K7Z A;  3JRE A;  1ENH A;  2CRG A;  3SJM A;  2NS7 A;  1A6I A;  2DA2 A;  2WB1 N;  1XC5 A;  3CQZ J;  2R92 J;  2X48 A;  4MFD A;  5HOD A;  1WI3 A;  4DYC A;  3C2B A;  3QPS A;  4J19 A;  3S1M J;  1GV5 A;  2HYJ A;  1YRN B;  3ZQI A;  3BTC A;  3OSG A;  3QPL A;  2B63 J;  3IH2 A;  1OFC X;  1MBG A;  3CDL A;  4D5C A;  4A3F J;  1QPI A;  1LFB A;  4Y52 J;  2CUF A;  2LTP A;  1ETV A;  1GT0 C;  2NVQ J;  1JUP A;  3ZQH A;  1HDD C;  2JA8 J;  4IHX A;  3ZQG A;  4DYR A;  3S1N J;  3BQZ A;  1RR7 A;  2ECB A;  2XSD C;  4A3E J;  1IUF A;  4V2G A;  1T56 A;  4S0H B;  3PO2 J;  1Z77 A;  3ZQF A;  4BY1 J;  3LSJ A;  2Y9Y A;  4W1U A;  1GVD A;  3HOX J;  2E2J J;  2O9L A;  1RPW A;  3S17 J;  1R9T J;  1U78 A;  3A01 B;  2DTZ A;  1MH3 A;  5IP6 A;  2GM4 A;  2O7O A;  3FK7 A;  4XRM A;  3FIW A;  1Z0X A;  4C2M J;  1IG7 A;  2DA1 A;  3BT9 A;  4FTH A;  1WPK A;  1POG A;  4IHV A;  5F27 A;  1GUU A;  5C44 J;  1ORK A;  3B6C A;  5EYR A;  3LSG A;  1B72 B;  5E3L A;  3HEF A;  3JRF A;  4Y7N J;  2EBI A;  5K7H A;  4M3D A;  4D7N A;  3JRI A;  4M3B A;  2M2E A;  3MKL A;  1X2M A;  1U9N A;  2AO9 A;  2DMU A;  4XRS A;  3HOY J;  3S2H J;  1ITY A;  3NAR A;  2DA4 A;  3A01 A;  4G12 A;  3I4M J;  1ETW A;  5M5W J;  1X2N A;  3BTI A;  1O4X A;  2JA7 J;  2MG4 A;  4IHW A;  1RKW A;  3JRB A;  1JT6 A;  3DEW A;  5EGO B;  2PMZ N;  2W48 A;  3LNQ A;  1Q1V A;  1HDP A;  2AHQ A;  1I50 J;  5FKO A;  1ETX A;  5J1R A;  2JWT A;  1NK3 P;  2R5Y A;  3BR1 A;  2JMW A;  1FEX A;  3G1O A;  3GTL J;  2DA3 A;  1JKP C;  1E3O C;  1TWC J;  1ETO A;  4CYC A;  4BBS J;  2TCT A;  1IGN A;  2R5Z A;  4LOC A;  4L5E A;  5EG0 B;  1W0T A;  1MBK A;  5EZG A;  5DS9 A;  1RES A;  1JKQ C;  2EZI A;  3MN2 A;  3Q3S A;  5FKN A;  1JTY A;  2NVY J;  1T33 A;  2QCO A; 
#chains in the Genus database with same CATH topology
 2JA5 J;  2V4J C;  2X9D A;  3K0L A;  5LEJ A;  2B7E A;  2QF7 A;  2IA0 A;  3HKZ A;  3K7A J;  1FYL A;  3BTJ A;  4ITV A;  1FWZ A;  4UXN A;  2HZD A;  3GF2 A;  4HV5 A;  3KP6 A;  3L09 A;  1B8I A;  5FFZ A;  4Z6Y A;  2W25 A;  3FKI J;  4P1W A;  3OYL A;  2HXO A;  1FBQ A;  4F52 A;  2Z33 A;  3DXJ F;  2UUZ A;  4CZC A;  3V8J A;  2Y75 A;  4CGZ A;  2IJL A;  5D5W B;  1YYV A;  3BY6 A;  3TW7 A;  5BNG A;  2L7Z A;  2L3D A;  1UG0 A;  3ZMT A;  5E3O A;  1IUY A;  2WAQ A;  3TOA A;  5IP9 J;  2CG4 A;  1S6L A;  1BJZ A;  5BOX A;  3FXM A;  3BR3 A;  2L9S A;  4QLC U;  1P4W A;  4FCY A;  3IL2 A;  1FX7 A;  1I6X A;  4CZZ A;  2CQK A;  3E0J B;  3PNT A;  5F08 A;  2VON A;  2CV0 A;  3ZN1 A;  1QVU A;  2CH0 A;  2DA5 A;  2HKO A;  1T0F C;  1W7P A;  2P7V B;  3H9J A;  3M8F A;  2E19 A;  4IL6 C;  3RPQ A;  2KIQ A;  5F04 A;  3BG9 A;  4OAZ A;  2OD5 A;  3C7J A;  2Y0S A;  3GYH X;  2QA4 I;  3VDX A;  3HGY A;  2EFQ A;  1R5I D;  3AFH A;  3TGN A;  3ZGK A;  3IP4 B;  1N77 A;  5EF6 A;  2XKP A;  5E3N A;  1DUX C;  4NUB A;  1WH7 A;  1L0O C;  5IOZ A;  3ERM A;  5HDG A;  1U8B A;  4I7H A;  4KUM A;  3ZP5 A;  4FX0 A;  1DP3 A;  2RAE A;  4XR6 A;  1SFO J;  1BA5 A;  3IH4 A;  3WOD F;  5C4J J;  2RKH A;  3GFM A;  2STT A;  4LGW A;  2HDC A;  2V6C A;  2XC7 A;  1D1C A;  2K9Q A;  4R79 A;  1ODD A;  2DI3 A;  4AM3 A;  2JUC A;  2OPT A;  2QYO A;  4OU0 A;  3K2A A;  2VQH A;  4Y17 A;  5BPD A;  1IV8 A;  3REO A;  4LFU A;  4P9U A;  1HW5 A;  1MJ9 A;  2EV5 A;  2UWM A;  1QPM A;  5CLS A;  3V7R A;  3CCJ I;  4NC7 A;  3Q0V A;  3A4C A;  3F8F A;  1Z21 A;  1VQ5 I;  3BWG A;  4EVI A;  4M9S A;  4D5F A;  5HVQ C;  3BR2 A;  3H9G A;  1KGS A;  5TJJ A;  2VN2 A;  2FQ4 A;  3FXU A;  3RZD J;  4X0G A;  3CC2 I;  5ICE A;  1QZZ A;  2MYS A;  1FIP A;  4NDL A;  5DD4 A;  2DOD A;  2A07 F;  4O5V A;  1SVO A;  3CLQ A;  3WE3 A;  1VQP I;  5E18 F;  5GAE J;  1XD7 A;  2KJB A;  4AUX A;  1EJ9 A;  4UY8 I;  1HA8 A;  3IWZ A;  1YX5 A;  4J00 A;  1USS A;  4QIW N;  1SFK A;  9ANT A;  5B3S H;  5HNH A;  3FXK A;  4FT8 A;  3ABL H;  3F9K A;  4F7Z A;  3L1P A;  1MNM C;  2MLK A;  2ESN A;  3MD2 A;  3WTT C;  2Z5U A;  1BL0 A;  1AOY A;  4I01 A;  3ROU A;  2Q8K A;  1TC3 C;  2BY1 A;  1YFH A;  1O3Q A;  2E2H J;  3HOU J;  2DXI A;  3WTZ A;  4AYB A;  2QGU A;  3N97 A;  3KYL A;  4HDU A;  3MMY B;  4U0Y A;  4E7I A;  2FMY A;  3HBL A;  2O03 A;  1WQ2 A;  1DU0 A;  3RYP A;  4HDV A;  2CJJ A;  4JX6 A;  5E1X A;  4X6A J;  2P6S A;  2FD5 A;  2VE8 A;  2ELJ A;  2ME6 A;  2CGP A;  2P5K A;  5A2Q K;  2R5Z B;  1FOX A;  2XGC A;  2YX7 A;  3H0D A;  3O6B B;  3EET A;  1XGO A;  2MC4 A;  3ISP A;  1FSE A;  2LY9 A;  2YX4 A;  3VYR B;  2F4O B;  2ELK A;  3I0T A;  5BMZ A;  2YU9 J;  3H3V K;  2OTL I;  2BY0 A;  3V8K A;  4EJV A;  4OIQ F;  2FF4 A;  2CUE A;  1MMN A;  2L9N A;  5JLW A;  3KZY A;  1FIA A;  1NG6 A;  3CP2 A;  1TWF J;  4AD9 A;  2IGK A;  3U1D A;  3TOB A;  3BG5 A;  1K4S A;  4EGY A;  1TWA J;  3E6D A;  2RGV A;  4BAC A;  3BLY A;  1FTT A;  4DOZ A;  5B1B H;  2HNH A;  4FIS A;  2DFI A;  4IPA A;  2VI6 A;  2ESH A;  3CES A;  1HW2 A;  1IN7 A;  2P6T A;  2GWR A;  4IF4 A;  4KN7 X;  4ESJ A;  2X4H A;  4Q47 A;  3TKY A;  4IRG A;  4ENN A;  1BBY A;  1R00 A;  1G3W A;  3O2P E;  4RGS A;  3KEQ A;  1XTA A;  2XVC A;  1MIJ A;  2XSJ C;  4E7L A;  2D2W A;  1KA8 A;  1LNW A;  2E36 A;  1D1B A;  1E3H A;  1FYK A;  1F36 A;  5C4X J;  2HQ5 A;  1VND A;  2JUG A;  2DA7 A;  2M8E A;  4RBO A;  1TNS A;  4S05 A;  2XAF A;  2R0Q C;  3LSM A;  2W85 A;  2IA2 A;  3HDD A;  1YIJ I;  5J3L A;  3CDH A;  2K9M A;  2KZG A;  3SDG A;  4EQQ A;  2PG4 A;  3QU6 A;  3SZT A;  4I76 A;  1VQO I;  1OYI A;  4P5O A;  1Y0N A;  4L5I A;  3LOC A;  4OIR F;  3O8G A;  1T39 A;  4DZP A;  3CMY A;  3T8R A;  2GOM A;  1TLH B;  3NRV A;  3ELK A;  5H20 A;  4YIR X;  4BHC A;  3H9Q A;  1OKR A;  3DEU A;  1XMX A;  1I5Z A;  2ZJP F;  2MH2 A;  2CFO A;  3NQO A;  1B4A A;  5M5Y J;  2JRM A;  4ZZD A;  2M4K A;  3GTJ J;  3RCO A;  3DEE A;  2OC6 A;  3E7L A;  4NC6 A;  3WHB A;  2VC0 A;  4EJO A;  2F5C A;  2XAJ A;  2Z2S B;  3TO9 A;  2HOA A;  1YOV B;  2A69 F;  4DYQ A;  3PIP F;  2IS2 A;  1EA3 A;  3A02 A;  1D8J A;  2R7R A;  4LMY A;  1O7F A;  2JSP A;  3KP4 A;  1KZH A;  4DQ2 A;  1IZ1 A;  1S7E A;  2DK5 A;  2IAI A;  1SC7 A;  4L0Y B;  1VQN I;  4U7B A;  1KQ0 A;  2A6H F;  3R6S A;  5DYM A;  3GTG J;  3CC4 I;  4AVP A;  1OYY A;  3IRR A;  2DYR H;  5FJ8 J;  1A36 A;  2JK3 A;  2M9H A;  3ZMU A;  1OLT A;  2KKO A;  2VJ4 A;  3C1D A;  4HYE A;  1DGR M;  3OR2 C;  5LGU A;  3ZQ7 A;  3GTM J;  1ZG3 A;  2VBZ A;  5LLQ A;  4I99 C;  3VB2 A;  4EAT A;  2L4M A;  3MZY A;  4XBF A;  3HC7 A;  1SMY F;  1G59 A;  4XOP A;  5GP9 A;  2R7O A;  3BDD A;  4AIK A;  1ETK A;  2X6X A;  5TIS C;  1I3A A;  2LF7 A;  2IP2 A;  1Y0U A;  2R3S A;  2KZV A;  4IZZ A;  1F4K A;  2VBY A;  2G0E A;  3BC8 A;  2CW7 A;  3JRE A;  1P6R A;  1ENH A;  2BW3 B;  3HSR A;  4LB5 A;  5DM6 F;  3ZRG A;  2R7F A;  2NS7 A;  2W57 A;  5HLG A;  2DA2 A;  2DAO A;  2WB1 N;  4N9H A;  4PSX A;  2DPU A;  1XC5 A;  4BE0 A;  4MEX F;  3FXO A;  3QP6 A;  2BHY A;  3FMS A;  4MFD A;  2EK5 A;  3WTS C;  1IXS B;  1ON1 A;  2CFX A;  4J19 A;  1R4M B;  4LG3 A;  3J7A O;  2H8W A;  1BIB A;  3ZQI A;  2FE3 A;  1U5T A;  1Y39 A;  2QBY A;  2B63 J;  1HKT A;  2QVO A;  5GAH J;  1V55 H;  1E17 A;  3I71 A;  5HDK A;  3GZ6 A;  2XF5 A;  3M8E A;  4HOB A;  1LFB A;  2V9P A;  5DM7 F;  1YG2 A;  4NHJ A;  3OYJ A;  2NVQ J;  3ZQH A;  2GIZ A;  3K4M A;  3FKJ A;  2EA4 A;  2HKX A;  2JTV A;  4EJU A;  2XSD C;  1WVR A;  4HV6 A;  3ZQF A;  3DTI A;  1V54 H;  1TBX A;  2VL8 A;  2Y9Y A;  1CF7 A;  3DPT A;  5IY5 H;  1X1P A;  2OQG A;  2E2J J;  1J59 A;  3F8C A;  2R4G A;  2FU4 A;  3CO7 C;  4MQV A;  5IP6 A;  3I58 A;  3QRF F;  2O7O A;  4XRM A;  4TV7 A;  3S32 A;  1TNT A;  4PSW A;  1JI8 A;  1EKE A;  1LVK A;  1Z0X A;  2E1M C;  2FSW A;  2ICW G;  3M1E A;  1YJW I;  3E6M A;  2GQQ A;  2ZME C;  1DPR A;  2DFH A;  2DA1 A;  2FXA A;  3HIF A;  1D5V A;  3UNG C;  3HHG A;  2K85 A;  1GUU A;  2M7A A;  3OYI A;  1B72 B;  2HS5 A;  3OMY A;  3HEF A;  2R7U A;  1R1V A;  3RI4 A;  1G6N A;  1GVJ A;  3OS0 A;  5LEK A;  2ZFU A;  1VQ8 I;  1U9N A;  4NQW A;  4PFO A;  2ZXH A;  3OYM A;  3J80 Z;  1K7A A;  3I4M J;  2JVG A;  2PMZ A;  1LDJ A;  2JA7 J;  1O4X A;  1UB9 A;  4IHW A;  5JR3 A;  5EGO B;  3J7Y J;  4CCJ A;  4CO8 A;  1MMA A;  3H1C A;  2PJR A;  2HGC A;  2Z1D A;  2JWT A;  1NK3 P;  2R5Y A;  2HDW A;  3Q5F A;  4ESF A;  3TL4 X;  1YIO A;  1UHW A;  3G1O A;  1RC9 A;  2HQN A;  3ONQ A;  5E1Z B;  3K6G A;  2LKP A;  1TWC J;  1K6O A;  3FBN B;  2TCT A;  2V9V A;  2KLO A;  4RA2 A;  1A31 A;  3E5X A;  5KAI C;  1A04 A;  2H09 A;  1W0T A;  3OYK A;  5EZG A;  2EZI A;  2HVR A;  4E7J A;  2MA3 A;  4WXH A;  3PUB A;  3Q3S A;  3KPH A;  1XGS A;  1X4P A;  1RR8 C;  2A6E F;  3RKY A;  2Z99 A;  2QCO A;  5HS8 A;  1O7L A;  4A3K J;  4HNU A;  1V5F A;  3HPG A;  3NAU A;  4OAY A;  4UUS B;  1J5Y A;  5CQG A;  3TQN A;  3WGI A;  2CQX A;  3R0J A;  4A6D A;  1ZTR A;  5HOO A;  1E0E A;  1SFX A;  3HOV J;  2GBY A;  3CF2 A;  2XKO A;  4BE1 A;  4L9N A;  4BXF A;  1HW1 A;  5F0F A;  2DYS H;  4M71 A;  5ICF A;  2LBF B;  1IW7 F;  5IT9 Z;  1JKO C;  3OY9 A;  1U6G A;  5JFR A;  1TTY A;  2G7H A;  3CUQ A;  4KN4 X;  5L3C A;  1W5T A;  4HX8 A;  1J7K A;  4RS8 A;  4HLY A;  5GTI C;  3QP5 A;  2VIX A;  3E5U A;  1ETY A;  1TT0 A;  4KIB A;  1YIT I;  1FY7 A;  4GXO A;  3SFZ A;  4C3H J;  4G6D A;  3DLL F;  4BDY A;  2DMN A;  2V79 A;  1KQ8 A;  1IAW A;  2R7X A;  1IXR C;  4CCK A;  1GDT A;  2BE5 F;  2ZC2 A;  4AIJ A;  1WFX A;  3WHC A;  1H89 C;  4IRI A;  1D8K A;  1O3S A;  2F5E A;  5JVG F;  3Q0W A;  1XX5 A;  2FNP A;  4BH9 A;  4RM3 A;  5KNL A;  3KIO A;  1KU9 A;  2WB1 A;  1XMK A;  5KCM A;  3VYS B;  1P4X A;  1KON A;  3TMO A;  1BI0 A;  1U0J A;  3E1S A;  2RC4 A;  3H5R A;  1VFC A;  3F22 A;  3HTS B;  2W1O A;  4G7O F;  4YG2 F;  1H0M A;  3GBG A;  2DU9 A;  2L54 A;  2E7W A;  2W82 A;  5E79 C;  4XID A;  1X58 A;  3I4P A;  4UB8 C;  3KP7 A;  4Y4R A;  4B4C A;  1K83 J;  2DFF A;  4A2U A;  3KLO A;  4ENJ A;  4RLQ A;  1LB2 A;  1Y8R B;  2R7T A;  3DFG A;  5M3F J;  5B66 C;  4MFE A;  2VC1 A;  4KT5 C;  3W2W A;  2O8K A;  4KIG A;  2BVL A;  4CH7 A;  1BOB A;  2QQB A;  3VYU B;  1ONV A;  1UHS A;  2NNY A;  2A6T A;  2P5V A;  1RIO H;  3J81 K;  3K70 C;  4AC0 A;  1QQI A;  2K9N A;  2VQC A;  4YEJ A;  2PJR B;  3E6B A;  3BPV A;  1Y1V J;  3KCC A;  1RKT A;  2R5Y B;  1R36 A;  4M73 A;  2RNG A;  2K4J A;  1H9T A;  5TGT A;  2VT3 A;  1AKH B;  1S29 A;  1WJA A;  4OIN F;  3AG4 H;  4ZJZ A;  2E71 A;  4XKV A;  3RTR A;  1WJE A;  1OR7 A;  4M6V A;  3VSK A;  1ZKG A;  2RN7 A;  4Y15 A;  3K4C A;  1REP C;  1R7J A;  2LRE A;  3RZO J;  4XOR A;  2HEO A;  1JHF A;  5GTH C;  2XPW A;  1WCM J;  3H35 A;  3TP3 A;  1R5H A;  1U5T C;  1J0R A;  2ME0 A;  2VJI A;  1T98 A;  2DN0 A;  5IYB J;  4HG2 A;  3VFZ A;  2XPU A;  5J1U A;  3NWS A;  3WU0 A;  5BQT A;  2QQ8 A;  2IEK A;  3CCM I;  2HOS A;  1XN7 A;  2FJ1 A;  2EQR A;  4II2 A;  3IKV A;  1CQT A;  2XUB A;  2HR3 A;  2Y31 A;  3JRC A;  5C3E J;  2WA0 A;  1RET A;  4I6Z A;  1L3L A;  1TZL A;  3M9A A;  3RYR A;  2G7U A;  1MH4 A;  1RZ4 A;  3U9G A;  3FIS A;  1UHM A;  2BOL A;  3CCR I;  1LE8 A;  5JHF A;  3KEY A;  2F5D A;  2H1L A;  3BQY A;  3GCM A;  2NS0 A;  2PQ8 A;  4BNC A;  3LAJ A;  1WJF A;  5M5X J;  3PUF A;  1S5L C;  2CO5 A;  4XLA A;  3I4N J;  4BHP A;  4XIC A;  2W7N A;  4XLN F;  3ZXS A;  4XLH A;  3K1M A;  5TRD A;  2LRD A;  3N4M A;  1OIS A;  4I2O A;  3ZCO A;  1F1Z A;  1ZGJ A;  2DMT A;  1FBU A;  2E34 A;  4MLO A;  3OV8 A;  2M30 A;  4D0P A;  4A3B J;  1FYM A;  2OF7 A;  3LA3 A;  3E3V A;  5FD5 A;  2XV4 S;  2AQE A;  4HRI A;  3CJN A;  4RB2 C;  2Y2Z A;  2K86 A;  5IOY A;  2DQL A;  4MGR A;  1G3S A;  4AVZ A;  4G7Z F;  3FZV A;  5ILS A;  4LLG F;  2M4G A;  4RM2 A;  5KK1 A;  1UG2 A;  3K4L A;  3MVP A;  2OU2 A;  4YIF A;  2O3F A;  4DIQ A;  4CCM A;  5LBQ A;  1SAU A;  3WTX C;  2Q2E B;  3PQJ A;  3BG3 A;  4UB6 C;  3HGG A;  1AU7 A;  3FXL A;  5FRO A;  3LQQ A;  1OPC A;  4LK1 F;  5GPA A;  3PQK A;  4M3E A;  2I8D A;  3DF8 A;  2IBD A;  4H4K C;  2DDB A;  1U2W A;  4ETS A;  2Y30 A;  1B9N A;  2GA2 A;  3HXL A;  2E2I J;  1IDZ A;  2M1B A;  1EF4 A;  3RKQ A;  1PUF B;  3WTU C;  2LMD A;  1ZAO A;  2ECC A;  4JOM A;  4JX5 A;  2QKL B;  3VOD A;  2R7V A;  3CMA I;  2B0L A;  3PNY A;  5J4Y A;  2CUJ A;  2VXD A;  1QHG A;  3GME A;  3UKG A;  3KP3 A;  3HOW J;  5K5O A;  1HKS A;  3AAF A;  1Y1W J;  2RDP A;  4YFK F;  2KJC A;  2CW0 F;  1H88 C;  1IXC A;  5K5R A;  1Z3X A;  4HA8 A;  2RRE A;  1SD5 A;  3T0Y A;  3QWL A;  4IHS A;  3DLA A;  1JXS A;  3ECO A;  3VEP A;  3P9I A;  2L5Q A;  1QBJ A;  4KT6 A;  3K1N A;  1QHH D;  3LWF A;  1V5E A;  3D1N I;  3GTP J;  4EM0 B;  1HST A;  3F3X A;  2EH3 A;  2FBK A;  3JRA A;  2M3A A;  2HQA A;  4M9Z A;  3S1Q J;  2GIV A;  4ZYA A;  2ZBK A;  2GXB A;  4UV8 A;  3JTG A;  2V1D A;  2DOA A;  1TWH J;  1IRZ A;  2L7K A;  1YTY A;  2P4W A;  4IOA F;  5J40 A;  3WU2 C;  1SVM A;  5CYV A;  1LQ1 A;  1Q1H A;  2DCE A;  1BI2 A;  1IC8 A;  3MZH A;  4BAY A;  5E17 F;  4I0B A;  2Z9O A;  1IJW C;  2OAZ A;  4I98 B;  2L7F P;  3TED A;  1Z91 A;  5B5E C;  2JT1 A;  4MNU A;  1UEL B;  3EYY A;  4WF2 A;  2WV1 A;  1O3T A;  2EFN A;  4ZDL A;  3X2Q H;  4KMU X;  2COB A;  3CLO A;  1JUM A;  3JW4 A;  1SVL A;  4HX4 A;  4HNT A;  1N25 A;  2GAU A;  5ILV A;  1NK2 P;  3IAM 2;  2KRC A;  3L2R A;  4PCQ A;  3OS1 A;  3OYB A;  4P55 A;  4PGG A;  3IKT A;  2IRF G;  1B8I B;  3S16 J;  4C30 A;  2VBX A;  1C0W A;  2LLK A;  1QO0 D;  4HF0 A;  3OYG A;  4C2T A;  3OYD A;  1X1D A;  4Y3O A;  2K3P A;  3ZOB A;  2Q2E A;  2HI3 A;  2X51 A;  1R49 A;  3CP8 A;  3S3M A;  2X6W A;  2QWW A;  1ZRD A;  2MFZ A;  2LNB A;  3EUH C;  2IGN A;  2VQL A;  3S3N A;  1BI3 A;  3R4K A;  3DBH B;  3DU6 A;  3BR0 A;  1B6A A;  2WBM A;  4U0V A;  1QNT A;  2KIS A;  4XLF A;  2E5N A;  4WXD A;  2Y69 H;  3SEZ A;  3DTE A;  4OMZ A;  1X1B A;  3WG9 A;  3CCL I;  2YU3 A;  5EEA A;  3LL7 A;  2CYY A;  2QBY B;  5JLX A;  2IA1 A;  3LSP A;  2CMP A;  2HXI A;  3BJO A;  2KDO A;  2PFB A;  5F1J A;  4UNO A;  2I5U A;  3OYH A;  2DOF A;  2XF7 A;  4R1H A;  5F0C A;  2YS9 A;  4A6E A;  4NNJ A;  2FOW A;  1OCR H;  4HBL A;  1XG1 A;  2M34 A;  4EV0 A;  2Y0S N;  1R58 A;  4L18 B;  1EH7 A;  4RAF A;  4IQJ A;  1I1S A;  5HDN A;  4BDZ A;  4GO1 A;  2FA5 A;  3FBI B;  1OCZ H;  3DKX A;  4UHT A;  1ZLJ A;  2WY8 Q;  3GEZ A;  4OIO F;  1YX3 A;  2R92 J;  4QPO A;  5HOD A;  2QSH X;  3QPS A;  2NNN A;  5F1R A;  3S1M J;  3I59 B;  2MC3 A;  1R22 A;  1SEU A;  1WJD A;  3IWF A;  3QAH A;  4ZDP A;  1BR2 A;  1OFC X;  2K9L A;  3P5J A;  5LHG A;  1W5S A;  3ML6 A;  4A3F J;  4KFC A;  4P9F A;  2OBP A;  2DPD A;  4Y52 J;  2HVS A;  2LTP A;  2MAB A;  1HDD C;  4IHX A;  3S1N J;  2M7B A;  2FML A;  1UAA A;  2BY3 A;  4CYD A;  4ZYE A;  4HSR A;  1IUF A;  4V2G A;  5D5V B;  4XL9 A;  2LSO A;  1FBS A;  2A5Y B;  4W1U A;  1VZ0 A;  3CZ6 A;  1WSU A;  3BP8 A;  2O9L A;  3G2B A;  1GXP A;  2A3S A;  1ULY A;  1FP2 A;  3GLX A;  3AG3 H;  2DTZ A;  3C18 A;  1MH3 A;  3UR3 C;  6PAX A;  3FK7 A;  3GFI A;  4G94 A;  2ZXJ A;  3PNV A;  4WX9 A;  3ZR8 X;  2YPR A;  4C2M J;  5B1A H;  1IG7 A;  4O3M A;  4PGH A;  3BT9 A;  3DQV C;  3DU5 A;  3COA C;  5LRS A;  3BRO A;  1B9M A;  1X19 A;  3KE2 A;  4XN3 A;  3G3Z A;  5EYR A;  3LSG A;  3OIQ A;  4L9T A;  1T38 A;  1TW3 A;  2EBI A;  2X1D A;  4M3D A;  4M3B A;  1EH8 A;  2M2E A;  2EA2 A;  1Z1D A;  4RAG A;  1U3E M;  2FEZ A;  1S8N A;  4XRS A;  2RV8 A;  3CO6 C;  4B44 A;  1W7P D;  3RIR A;  5ERI A;  3NAR A;  2DA4 A;  3WTW C;  3A01 A;  4G12 A;  1T2K A;  4ZTJ A;  3ZMD A;  3DTK A;  1K78 A;  5FRM A;  1ETW A;  3D5R C;  3OYC A;  5M5W J;  3WGH A;  1Y56 A;  1VQ4 I;  1ZLK A;  1RKW A;  2ZME A;  3F6O A;  5D5U B;  1JT6 A;  1TQP A;  3JRB A;  4KA4 A;  2H6B A;  2W48 A;  3LNQ A;  3MQ0 A;  4EJT A;  1VTN C;  4LLN A;  1LEA A;  2EFP A;  4CCO A;  2CV2 A;  3BR1 A;  4XN0 A;  1Z6R A;  2O0Y A;  4MEY F;  2E1M B;  3D5S C;  2W24 A;  1WJC A;  3CMM A;  1IN8 A;  3WG7 H;  2OQR A;  5FLX Z;  4GGG A;  4CYC A;  2JRT A;  3R61 A;  4BBS J;  1IGN A;  2JVH A;  2R5Z A;  2WC2 A;  2O61 A;  1I27 A;  2XAS A;  2QM3 A;  2X1C A;  5ICC A;  4LOC A;  4L5E A;  2AS5 F;  1EH6 A;  1LDD A;  4R8H A;  4PZJ A;  4C9Y A;  5KHD A;  1RES A;  3MN2 A;  1BC8 C;  1BOA A;  3I59 A;  3FHN A;  4RMN A;  2LOO A;  4KNY A;  3BCB A;  1VQ9 I;  2GXG A;  1CGP A;  4BY7 J;  5GAG J;  2KDZ A;  2E1N A;  2EPF A;  2CWE A;  1KU3 A;  2R7W A;  3OYN A;  3QOD A;  3HSF A;  5CVR A;  2AXL A;  1P9Q C;  3ZMZ A;  1MBJ A;  1APL C;  1RUN A;  1W36 C;  1R4N B;  3T5X A;  3EUK L;  3CCV I;  3LA2 A;  4XK4 A;  4CA0 A;  1ZEL A;  2PI0 A;  3IV5 A;  3ASO H;  3I56 I;  4IHY A;  1I3Q J;  3TO7 A;  2EZL A;  2KRF A;  4KIF A;  5DUK A;  4HST A;  3JRD A;  2VPR A;  3LSR A;  2K3F A;  1DU6 A;  3CCY A;  4EJW A;  4N4N B;  3ZPL A;  1O3R A;  2M87 A;  4CSW A;  1HQC A;  1WGX A;  1WWX A;  2LC2 A;  5FGM A;  4C3I J;  5GAD J;  4JYK A;  4J01 A;  4GFB A;  2KFD A;  4M9X A;  2LG4 A;  4BJ5 C;  4OMY A;  3D0S A;  3S15 J;  3L00 A;  3ZQC A;  2ID6 A;  1YS6 A;  1PP8 F;  3S2D J;  3M07 A;  3V7C A;  3HRU A;  1E2X A;  4A3C J;  3GZN B;  2QEN A;  2NS8 A;  4IX7 A;  2JSC A;  2DQR A;  3IAS 2;  4YRV A;  1N75 A;  1W1W E;  1PYV A;  1I39 A;  1BJA A;  2OCE A;  1XDS A;  1T08 B;  3K4N A;  1KU2 A;  2BBY A;  5E20 A;  3ULQ B;  3S14 J;  2L2O A;  2R7Z J;  3DPL C;  3L2Q A;  4ZYH A;  1ZYR F;  1YE9 A;  1K78 B;  1F43 A;  2WV0 A;  1SFU A;  4A3J J;  2XGE A;  3ASN H;  1IRF A;  2HOE A;  3LMM A;  4MO7 A;  4Z2Y A;  1JKR C;  4EGZ A;  1UZC A;  2Z16 A;  4KDP A;  1IO2 A;  4A3M J;  2ZSI B;  3S1R J;  3CME I;  4ZC3 A;  2VKV A;  4XON A;  2ADU A;  2D1V A;  3HHH A;  4X1E A;  3G71 I;  2VXZ A;  2XPV A;  3EPZ A;  2HDD A;  3IUO A;  5H6R A;  3BCA A;  2VB6 A;  2XGX A;  3ABM H;  3HOS A;  3VOE A;  3U2R A;  1ETQ A;  2NVT J;  4RGX A;  1S72 I;  4PFP A;  1YW9 A;  3GFL A;  1VQ6 I;  2OZ6 A;  2IPQ X;  4HPQ A;  1Z6T A;  2LY1 A;  3KYC B;  4XKC A;  1UJ8 A;  1IN4 A;  3V42 A;  2Y9Z A;  1T95 A;  4OWR B;  2K4B A;  3G4S I;  1OCP A;  2WAE A;  2HU9 A;  4HQE A;  5CVJ A;  2EIM H;  3HRS A;  1I6H J;  4XMY A;  1SFE A;  5AIQ A;  3PIO F;  3JRG A;  1ZGA A;  3SHF A;  2UV1 A;  4KIC A;  3KEO A;  3F8M A;  3G6E I;  2COM A;  1LKX A;  1W0U A;  1D0X A;  4HF2 A;  3ZQL A;  3KLN A;  5HNF A;  1UFM A;  3HRM A;  2HYF A;  3S8P A;  4LJZ F;  3FK6 A;  2WAQ N;  3ZQQ A;  1MND A;  2ZSH B;  1D3Y A;  1IDY A;  3LFU A;  1V3F A;  1PVE A;  2L4A A;  4BJT A;  2ACJ A;  1QVT A;  4RDU A;  2J5O A;  2EJR A;  4PJ0 C;  2IS6 A;  1FOY A;  2Y0M A;  3OYF A;  2X1E A;  1MZB A;  3HM5 A;  5L3B A;  4LG0 B;  1T6S A;  3G1M A;  5DTD A;  4BJ6 C;  1ZRC A;  3FM5 A;  2X0L A;  2JZY A;  2DK8 A;  2EZH A;  3ZMS A;  2LYC A;  2XAU A;  4PJL A;  5CJ9 A;  5FRN A;  2YR2 A;  4A0Z A;  3HKZ N;  2GZW A;  2ZKZ A;  3U1K A;  5CVI A;  4B8X A;  1G2H A;  2PLY A;  1O57 A;  2EWN A;  2VOD A;  1S3J A;  1MMS A;  1J2X A;  2PX9 A;  4ENM A;  2A68 F;  5DCF A;  3LSH A;  1U5T B;  3ECH A;  3OS2 A;  4HW0 A;  1MBH A;  1H9G A;  4NBQ A;  2P0W A;  3TDU C;  3IC7 A;  1GHC A;  4ENK A;  1KYZ A;  2WWY A;  3RPU D;  1JJ6 C;  3FHZ A;  4NB5 A;  2QQA A;  1STZ A;  5D5X B;  2F5F A;  5F6F A;  3TW6 A;  1XSD A;  5IYC J;  2KT0 A;  5KAF C;  2DMP A;  2W4S A;  4WXC A;  1BIA A;  3PO3 J;  4L0Z B;  3GW2 A;  3AG2 H;  1K61 A;  4A12 A;  1ZN2 A;  3OR1 C;  2EIJ H;  1U8R A;  1TP4 A;  2BV6 A;  3H0G J;  4HZF A;  2ZJR F;  3DKW A;  3GTK J;  3F0C A;  1FOK A;  2HPI A;  3MKZ A;  4E7K A;  2VOO A;  1ZR4 A;  2BVM A;  3U21 A;  4ON0 A;  3GX4 X;  3I55 I;  4XLC A;  1WKM A;  1JGS A;  3RKX A;  1V5G A;  2Z3Y A;  1WHU A;  2F4I A;  1YLF A;  4BL0 B;  1BW5 A;  1MBE A;  4PJM A;  1ZR2 A;  3DCF A;  3SYT A;  2LDU A;  3ZN0 A;  3O3K A;  2MW8 A;  1YO5 C;  2M8G X;  4ZTF A;  4JP0 A;  1B72 A;  4ZYG A;  5LHH A;  1MDM A;  1HCR A;  1TWG J;  2H1K A;  1MSF C;  1BW6 A;  2L02 A;  4IXA A;  2RQQ A;  4IRH A;  4LLL A;  2DW4 A;  1W5C C;  3QQA A;  2HOT A;  3QYB A;  4C2U A;  4E70 A;  4BS9 A;  2XRO A;  2KIU A;  4XRS G;  1MSE C;  3CF5 F;  4BKX A;  2DJN A;  2HZT A;  2GLO A;  3TO6 A;  1YHQ I;  4PJJ A;  3V7S A;  2CUZ A;  4BQQ A;  4LIT A;  4Y13 A;  1FT9 A;  1UST A;  1OYW A;  5BS6 A;  2IXS A;  2IGO A;  3ERE D;  2VQG A;  3JR9 A;  2LH9 A;  4A3G J;  2P8T A;  3W3C A;  4DNC A;  4E7H A;  3PL8 A;  4B09 A;  3KP2 A;  1G8X A;  3QOE A;  3S3O A;  2BXY A;  4W97 A;  3BZK A;  1Y6I A;  3LFK A;  1IRG A;  3M8J A;  3C3W A;  5JI6 A;  1ZG5 A;  3Q9S A;  3BTL A;  4BQA A;  1S7A A;  1P4A A;  2LFB A;  4ASN A;  4ZH4 F;  2NOG A;  5GPC A;  3SZP A;  4IQ4 A;  1HOM A;  2XRL A;  3BR6 A;  4FE7 A;  2H6C A;  2QQ9 A;  5D4S A;  2PN6 A;  2H8R A;  2HWV A;  2DMQ A;  5H6Q A;  5EZH A;  4DZJ A;  3O8H A;  4UUS A;  2BXZ A;  5F0H A;  4RB0 A;  2NVU B;  4D7M A;  3K4B A;  3OIO A;  3J7A Y;  3QPT A;  1FP1 D;  2E60 A;  4WCG A;  4IHT A;  2DOE A;  4II3 A;  4A93 J;  2LBF A;  3HPH A;  4CHU A;  3DWL E;  5HS9 A;  3BJA A;  4XLE A;  2IS1 A;  3W6K B;  4DJA A;  2WAD A;  3CCQ I;  1FOW A;  1ZG1 A;  3SFI A;  1AHD P;  2K9S A;  1VF9 A;  2MGQ A;  2NVX J;  1ZK8 A;  4BXX J;  1F5T A;  3A03 A;  2JA6 J;  3GTO J;  1G3T A;  2P81 A;  3AL0 B;  3DPU A;  2ETH A;  1PJR A;  3WU1 B;  1T0F A;  2ZJ2 A;  2X6O A;  4B48 A;  3P9K A;  1B1B A;  4HLX A;  4LIV A;  3CCU I;  2FX0 A;  2FOK A;  4L9J A;  1MBF A;  2CSO A;  2VLA A;  1YJN I;  4IVN A;  2O5R A;  3FF5 A;  3MWM A;  4AWX B;  1KYW A;  2KIF A;  3D5L A;  2XHK A;  3SQN A;  4HNV A;  3JAM Z;  2LKS A;  3BZ6 A;  3HG9 A;  4M74 A;  4JQF A;  2EFO A;  2LKX A;  3PSI A;  1ZQ3 P;  1S7O A;  1PUF A;  3L2W A;  3P7N A;  3W6V A;  1DQU A;  1TQM A;  4PUS A;  5EG0 A;  2EZK A;  4RLF A;  3RPU A;  1XSX A;  2XAG A;  1FPQ A;  5K7Z A;  5HLT A;  2HTJ A;  1HKQ A;  2UXX A;  4HQM A;  4I09 A;  2CQ7 A;  2CRG A;  1YW7 A;  1XPX A;  1A6I A;  4ZDO A;  3T8T A;  2ZNY A;  4IO9 F;  3W2A A;  4I0A A;  2OUM A;  3FWE A;  2X48 A;  2ZFW A;  4DYC A;  3C2B A;  1SD7 A;  1FMW A;  4A5N A;  4Q48 A;  3IH2 A;  1ON2 A;  4DBR A;  2KMU A;  1DPU A;  2FNA A;  3DP7 A;  3WE2 A;  4D5C A;  1N78 A;  3I5U A;  2E7X A;  1QA6 A;  1QPI A;  1D0Z A;  2CS3 A;  2GA1 A;  3HJE A;  1J09 A;  2NXN B;  3GUD A;  4XKB A;  2WTE A;  4M72 A;  1RR7 A;  1OMI A;  5LFA A;  3K69 A;  3LSI A;  1T56 A;  1MMG A;  4CCN A;  2AXT C;  5DEQ A;  4BYY A;  4BY1 J;  3SDB A;  1Z05 A;  5FB2 A;  3TDZ C;  3HOX J;  1X1C A;  4BHB A;  1U78 A;  3I53 A;  1XGN A;  3E97 A;  2DLL A;  3SXY A;  3A01 B;  4LD5 A;  4N9I A;  3H3Z A;  4AID A;  3L2U A;  3KZZ A;  4V19 K;  2JPB A;  1YJ9 I;  5K5Q A;  4U0W A;  3OOP A;  2EB7 A;  4B47 A;  1XB4 A;  4RB3 C;  4H0E A;  3MKY B;  4I02 A;  1ACI A;  1HSJ A;  2A61 A;  1X3U A;  1WPK A;  3P9C A;  4KIT B;  2H94 A;  4IHV A;  2E1C A;  1G4D A;  1MD0 A;  1R23 A;  2VT2 A;  3B6C A;  4FET A;  1FSH A;  4XNF A;  3CJQ B;  5K7H A;  5D8L B;  3PSF A;  3JRI A;  2L01 A;  1X2M A;  3MKL A;  1XMA A;  2DMU A;  3J7Z I;  2VJ5 A;  4Q5S F;  3S2H J;  5FFX A;  1WI9 A;  5H2F C;  3A2K A;  2FQ3 A;  2JA2 A;  4FHT A;  1GLN A;  3KET A;  1BC7 C;  2QSF X;  3KP5 A;  2R7S A;  1A35 A;  3CCS I;  1X2N A;  3BTI A;  4F3Q A;  3A1Y A;  2MG4 A;  5HS7 A;  3DBR B;  5ED4 A;  3DEW A;  2PMZ N;  3PFY A;  2HYG D;  1I50 J;  1LPQ A;  2KP6 A;  4GCV A;  5J1R A;  2JMW A;  2Q0O A;  5F64 A;  1FEX A;  3GTL J;  1W36 D;  1Z67 A;  1DGW Y;  3H5A A;  4DBQ A;  1D0Y A;  4K2E A;  4U87 A;  5DCM A;  4OOI A;  3S93 A;  4BGD A;  1ETO A;  2DT5 A;  3CUO A;  3W2V A;  1TW2 A;  5KVR A;  2IW5 A;  2CV1 A;  3R60 A;  3AG1 H;  4KIS A;  4HF1 A;  2BEO A;  2JQ7 A;  4XOT A;  2Q1Z B;  2NYX A;  5FKN A;  4XQF A;  1SD6 A;  2ISY A;  1T33 A;  4XLP F;  2LD5 A;  1P7J A;  2DJI A;  4AU7 A;  4U7D A;  4M3G A;  1RI7 A;  2VJJ A;  1SAN A;  3JCU C;  5A2Q Z;  4XSZ F;  2DA6 A;  5FKK A;  2DFE A;  5FO5 A;  1HBX G;  2CQN A;  4HX7 A;  2VBW A;  1QGP A;  3N05 A;  4E6K G;  2HQR A;  3F8N A;  2QSG X;  4E7Z A;  3FDY A;  3C2G A;  5D6F A;  2W00 A;  3LSK A;  3MCZ A;  4QTR A;  2VAS A;  2XIG A;  3VPR A;  1MW7 A;  4RGR A;  1P7I A;  5L3F A;  3MEX A;  2R93 J;  3RKW A;  1H8A C;  1TL8 A;  2YSR A;  1SAX A;  3JRH A;  5LHI A;  2KHM A;  3M4O J;  3VSL A;  2V1U A;  4FX4 A;  3QOP A;  3V4G A;  2STW A;  2K40 A;  4KJZ A;  5LGT A;  4MTD A;  5EEH A;  2QKM B;  3HOZ J;  4AIH A;  4L5J A;  3MZ8 A;  2DDA A;  3V8L A;  4LB6 B;  2QUF A;  3K1P A;  1XCB A;  2ZB9 A;  4ANJ A;  2J5P A;  2XAQ A;  1A5J A;  1LFU P;  2MBF A;  1RNL A;  3K10 A;  1JUS A;  3LA7 A;  4A0Y A;  2ZXI A;  4BEH B;  4FAS D;  2XGD A;  2BHZ A;  2ID3 A;  1HXD A;  4BQN A;  1V4R A;  1XS9 A;  5FKM A;  3F23 A;  3OIP A;  2LVS A;  5D8K B;  4B1R A;  5LD2 C;  2JN6 A;  1PUE E;  5IT9 K;  1F9N A;  2X85 A;  2VKD A;  1GXQ A;  2QZ8 A;  2WY7 Q;  1YS7 A;  5E3M A;  4S04 A;  4RB1 A;  1VQM I;  1KQ9 A;  2HFH A;  2LY2 A;  1DP7 P;  4QWQ A;  3GFJ A;  4UV9 A;  2QLZ A;  4L9V A;  2EIL H;  1ZHF A;  3OWT A;  4RAZ A;  2MD0 A;  1Z9C A;  2CQQ A;  2N8G A;  3DKY A;  5DCM B;  4PDK A;  1J75 A;  1LEB A;  1D5Y A;  3CTA A;  3JSP A;  2BYV E;  2D1H A;  3KYD B;  3AKZ A;  4Q4Z F;  1MKM A;  1W4M A;  1R71 A;  1FLI A;  2V26 A;  2A05 A;  2MSY A;  1HF0 A;  2OA4 A;  4M6X A;  2D5V A;  2XRN A;  4HEA 2;  4F92 B;  4A5M A;  2V9K A;  4PK4 A;  4IEJ A;  4EMS A;  5FLX K;  3LST A;  2GOX B;  3FXR A;  2V1X A;  2F4M B;  3LQR A;  2M5W A;  1CF7 B;  3GTQ J;  1OCT C;  4G9Y A;  2EV0 A;  4F93 B;  2M45 A;  3DV8 A;  1WZ2 A;  4U88 A;  3KFW X;  3KX2 A;  5D6E A;  1FTZ A;  4IOC F;  2X6Y A;  1B59 A;  2LR8 A;  2NOJ B;  2CU7 A;  3JTH A;  3H36 A;  2OTJ I;  1MNE A;  2BY2 A;  5IP7 J;  1M1E B;  2PBI A;  2M0M A;  1G3Y A;  4MQ9 F;  2KIM A;  3SEQ A;  4XRF A;  3RJP A;  4ABZ A;  3E6C C;  3ABK H;  3HZJ A;  2V1N A;  1XDU A;  2XB5 A;  4XM3 A;  4M3F A;  5J1Y A;  1J9I A;  3HB9 A;  2P5L C;  1IN5 A;  5CVV A;  2OJE D;  2UXN A;  1LJ9 A;  3NWT A;  2E1O A;  4EM1 A;  1IV6 A;  4DGW B;  5IYD J;  3Q9V A;  3RSN A;  2IS4 A;  4BUP A;  1FJL A;  2A5W A;  3R0A A;  5JVT A;  3FMQ A;  5CQE A;  4HAM A;  3HYI A;  2EV6 A;  5AON A;  1JJ8 C;  3K4K A;  5ILU A;  1WJ5 A;  1TQI A;  5HLH A;  1BR1 A;  2L0K A;  3BPX A;  3FX3 A;  4FQG A;  2YUS A;  1NTC A;  4MIM A;  3I64 A;  4BEH A;  4N0B A;  2H27 A;  2O6G E;  3KZI C;  1R1T A;  3BR5 A;  2M0C A;  5L3G A;  1VQL I;  3M1C A;  1VI0 A;  4JX4 A;  1Y8Q B;  2VPL A;  2VOP A;  2P7C B;  3AL0 C;  1QU3 A;  5FLV A;  3FXQ A;  3MKW B;  4E7S A;  4DW6 A;  2BGC A;  2TRT A;  2BZT A;  2L9R A;  3CC7 I;  5LRR A;  5EDN A;  2K5C A;  4KYW A;  3CDI A;  4O6J A;  3L9F A;  3RQ4 A;  4UVB A;  3WGG A;  1IRX A;  3FMR A;  4IKF A;  4XSX F;  3MFK A;  3CJT B;  2K02 A;  3GO5 A;  3ZMV A;  2JPC A;  2DT7 B;  4EM2 A;  4B3A A;  1PP7 U;  3GXO A;  5ICG A;  3HL2 A;  2K7L A;  2LP0 A;  1BM9 A;  2PMU A;  2D45 A;  2RVC A;  4XKW A;  3GWZ A;  1OJL A;  2R7Q A;  5DV5 A;  2BW3 A;  2QEX I;  3QPH A;  4MTE A;  1R6R A;  2DO7 A;  3S2W A;  1QRY A;  3EUA A;  3SZG A;  4UVA A;  2XB0 X;  4G7H F;  4M6Y A;  1LDK B;  2EIN H;  2OZU A;  1R1U A;  3HUG A;  2VUM J;  3BOQ A;  2OV7 A;  2ELH A;  3TP0 A;  4BXU A;  4MHG A;  5J6X A;  4AYB N;  2NRA C;  3Q0U A;  3J80 K;  2NAZ A;  4A69 C;  1PDN C;  3WTV C;  2ZXW H;  2ZME B;  3I3L A;  2L9V A;  2RQP A;  3BJ6 A;  4EEF G;  5M3M J;  1BI1 A;  2TDX A;  4A3I J;  1ZRF A;  5CPR B;  4UUV A;  3HRT A;  1JE8 A;  4UVC A;  2KRH A;  4GDF A;  1YRN A;  4N4O B;  3F21 A;  5HLI A;  1P92 A;  4V2F A;  2V7F A;  5J47 A;  1K4T A;  3ESW B;  4KMF A;  1JGG A;  4CYC B;  3EYI A;  2LK2 A;  1HLV A;  2KPM A;  4CCL A;  2KL4 A;  1JTX A;  1ZRE A;  1FC3 A;  3H3U A;  4PJN A;  4GYG A;  4LG0 A;  4A3D J;  1IF1 A;  3OSF A;  1BR4 A;  3BZC A;  2PJP A;  3G1L A;  2RNJ A;  3FM3 A;  2F6C A;  5IPA A;  2XDV A;  5E8G A;  5FLM J;  3QYE A;  1GV2 A;  2ISZ A;  2W84 A;  4ZZL A;  1K6Y A;  2I10 A;  1U9O A;  3RQI A;  4BBR J;  3QYF A;  4CUG A;  1WJB A;  3DBL B;  3OOU A;  4WK8 F;  1ZH5 A;  2FUG 2;  4CIC A;  3G73 A;  3H92 A;  3PFI A;  1MGT A;  3OL4 A;  3CCE I;  1AKH A;  1XSV A;  3JAM K;  1S9H A;  2ZJQ F;  2K27 A;  1NHA A;  2E5Z A;  1NH3 A;  4LK0 F;  4BE2 A;  2VKE A;  1X1A A;  4GRI A;  3W6J B;  2VKH A;  3EQL F;  1JT0 A;  1P2F A;  1UMQ A;  2MD5 A;  1MMD A;  3IH3 A;  1RUO A;  3ABT A;  3PM1 A;  2XAH A;  3RDI A;  4NC8 A;  3L2V A;  3GZ5 A;  4B43 A;  1JHH A;  5FKL A;  3M3Y J;  2KQR A;  3OYA A;  1YW8 A;  1Z7U A;  4Y33 A;  5EGO A;  3OYE A;  1MJA A;  4ESB A;  3H5N A;  2XF6 A;  2F48 A;  3LAP A;  4E4H A;  2L7M P;  3B6A A;  1X3W B;  1I1G A;  1XCV A;  3HTU A;  1BN5 A;  1NG7 A;  4A3L J;  2ZNZ A;  2DTR A;  5L3D A;  4C3J J;  4QSH A;  1WH5 A;  2FRH A;  4B3X A;  3BG6 A;  2JJ7 A;  3GVA A;  1ZGW A;  1LE8 B;  4GYI A;  1EV7 A;  1FZP B;  3HUG B;  4FE4 A;  3F6V A;  4UUT A;  5CVU A;  5K7F A;  2DT6 A;  2C6Y A;  2FBH A;  3VYT B;  2CW8 A;  3E5Q A;  1IN6 A;  2F5V A;  2LF8 A;  2E35 A;  1MDM B;  5K1Y A;  3SJM A;  3M7G A;  1T8I A;  1R5G A;  1K79 A;  2FBI A;  3HSE A;  3EDP A;  3CQZ J;  4JBA A;  5EJC A;  1ZAR A;  3CD6 I;  3IRQ A;  2G9W A;  1SD4 A;  1WI3 A;  3JSO A;  4G8X A;  2R7D A;  3F8B A;  5D4R A;  1VQK I;  3TBI A;  1GV5 A;  2HYJ A;  2PMH A;  2OCC H;  1YRN B;  5DDG A;  5LGN A;  3BTC A;  3OSG A;  3QPL A;  1TT5 B;  3J81 Z;  2IT0 A;  1YI2 I;  1MBG A;  4YFN F;  3CDL A;  5L3E A;  4IJA A;  3I54 A;  1AA7 A;  4WWC A;  3CUQ B;  2EFW A;  5IT3 A;  2HPM A;  2CUF A;  3B02 A;  1ETV A;  1GT0 C;  1JUP A;  5AIP A;  2JA8 J;  1YQA A;  1MJB A;  3ZQG A;  4DYR A;  3BQZ A;  3VWB A;  2ECB A;  1DDN A;  4A3E J;  4S0H B;  3PO2 J;  1Z77 A;  3LSJ A;  1GVD A;  5J8C A;  3K2Z A;  1OR7 C;  3CJR B;  1RPW A;  3FXJ A;  5CKT A;  3S17 J;  1R9T J;  4CDG A;  2MH9 A;  5FD6 A;  1QZY A;  1Z3Y A;  2GM4 A;  3NEU A;  3BG7 A;  1X3Z B;  3K9T A;  3FIW A;  1FNN A;  1A6Q A;  1HC8 A;  2DBB A;  2PEX A;  1KU7 A;  1ERD A;  2O8X A;  2EIK H;  4FTH A;  4F55 A;  5BPI A;  5J8F A;  1POG A;  3HOT A;  4YEL A;  5DD8 A;  4P96 A;  4QPQ A;  5F27 A;  5C44 J;  1ORK A;  1OCC H;  1Z7L A;  4G6T B;  2GXA A;  4YFX F;  4CXF A;  1QZE A;  1W7P B;  2F2E A;  5EEG A;  3K70 D;  3F72 A;  1AWC A;  5E3L A;  3JRF A;  4Y7N J;  3B73 A;  3A0B C;  4D7N A;  2V6E A;  2AO9 A;  3A0H C;  4JK1 X;  4RAY A;  1XGM A;  2HVQ A;  3HOY J;  5DUI A;  2WAF A;  4YII A;  1ITY A;  1OCO H;  3GLL A;  2IGM A;  5E1W A;  3EUH A;  4F91 B;  4BU2 A;  2VE9 A;  4BQO A;  3L2C A;  3T1B A;  4OIP F;  3L7W A;  3K4J A;  1FMV A;  3ABU A;  4ZYD A;  3C2H A;  4D1Q A;  1OQY A;  2IVM A;  3PJR A;  1Q1V A;  1HDP A;  2AHQ A;  5FKO A;  4RGU A;  1ETX A;  4D9J A;  3OL3 A;  2ZCW A;  1LFP A;  2MLG A;  1RRJ A;  1UCR A;  1SMT A;  2DA3 A;  5J4V A;  3CUQ C;  1JKP C;  3IHU A;  4LIU A;  3WTY C;  1E3P A;  1E3O C;  2B9S A;  3I9V 2;  1WRJ A;  1D1A A;  1LUJ B;  1LVA A;  2AQF A;  4NQW B;  2HTS A;  5EG0 B;  3MAJ A;  4A0X A;  4G6Q A;  2ZO4 A;  1VQ7 I;  1MBK A;  3QU3 A;  5DS9 A;  2Y48 A;  1JKQ C;  5E8I A;  5JHU A;  1JTY A;  1X4O A;  2UZK A;  2NVY J; 
#chains in the Genus database with same CATH homology
 2LD5 A;  2JA5 J;  4BY7 J;  1P7J A;  2X9D A;  4A3K J;  2KDZ A;  3NAU A;  4M3G A;  4UUS B;  1SAN A;  2DA6 A;  2QF7 A;  3K7A J;  5FKK A;  3BTJ A;  2CQX A;  1ZTR A;  1MBJ A;  1APL C;  3HOV J;  2GBY A;  1B8I A;  5F0F A;  4XK4 A;  1JKO C;  3IV5 A;  4IHY A;  1I3Q J;  3FKI J;  2HXO A;  4QTR A;  3VPR A;  2EZL A;  1P7I A;  2R93 J;  3TW7 A;  5BNG A;  2L7Z A;  1H8A C;  1ETY A;  3JRD A;  2VPR A;  3JRH A;  5E3O A;  3LSR A;  4C3H J;  3M4O J;  5IP9 J;  1DU6 A;  2DMN A;  1BJZ A;  3CCY A;  3BR3 A;  2K40 A;  1GDT A;  4FCY A;  1WGX A;  1H89 C;  3WHC A;  3HOZ J;  4C3I J;  4GFB A;  4JYK A;  3Q0W A;  5F08 A;  1QVU A;  3S15 J;  2ZB9 A;  2DA5 A;  1A5J A;  2E19 A;  3ZQC A;  1LFU P;  2ID6 A;  1VFC A;  5F04 A;  3BG9 A;  1JUS A;  3S2D J;  4A3C J;  2XGD A;  2NS8 A;  2ID3 A;  3GBG A;  2JA6 J;  4XID A;  3HGY A;  1X58 A;  4B4C A;  1XS9 A;  1K83 J;  5FKM A;  2LVS A;  3S14 J;  4B1R A;  5M3F J;  5EF6 A;  2R7Z J;  2JN6 A;  4MFE A;  5E3N A;  2O8K A;  1F43 A;  1WH7 A;  5IOZ A;  4A3J J;  1U8B A;  5E3M A;  2XGE A;  1UHS A;  4MO7 A;  2RAE A;  1SFO J;  1JKR C;  4AC0 A;  1BA5 A;  2K9N A;  3IH4 A;  5C4J J;  4A3M J;  3S1R J;  1Y1V J;  2VKV A;  2R5Y B;  1RKT A;  4X1E A;  2XPV A;  2K9Q A;  2CQQ A;  2HDD A;  2N8G A;  1AKH B;  1D5Y A;  2OPT A;  1ETQ A;  3K2A A;  2NVT J;  4M6V A;  2MSY A;  1HF0 A;  1ZKG A;  2D5V A;  2Y9Z A;  4IEJ A;  3RZO J;  1OCP A;  3Q0V A;  2XPW A;  3GTQ J;  1WCM J;  1OCT C;  3TP3 A;  1I6H J;  2ME0 A;  2DN0 A;  5IYB J;  4D5F A;  3JRG A;  3BR2 A;  2XPU A;  5J1U A;  1FTZ A;  2FQ4 A;  3RZD J;  1W0U A;  2IEK A;  3ZQL A;  2HOS A;  2FJ1 A;  2LR8 A;  2EQR A;  2CU7 A;  1CQT A;  2Y31 A;  3JRC A;  5C3E J;  1FIP A;  1RET A;  3FK6 A;  2WAQ N;  4NDL A;  5IP7 J;  4I6Z A;  1IDY A;  4ABZ A;  1MH4 A;  5J1Y A;  2XB5 A;  4M3F A;  3FIS A;  1QVT A;  4RDU A;  3HB9 A;  1LE8 A;  3BQY A;  3HM5 A;  4AUX A;  2E1O A;  1IV6 A;  5IYD J;  3G1M A;  5DTD A;  5M5X J;  3I4N J;  2EZH A;  4QIW N;  4XIC A;  1FJL A;  9ANT A;  3HKZ N;  3L1P A;  2DMT A;  4MLO A;  1MNM C;  1G2H A;  1JJ8 C;  1BL0 A;  4A3B J;  2L0K A;  1TC3 C;  2OF7 A;  2E2H J;  3HOU J;  2YUS A;  1NTC A;  4MIM A;  1MBH A;  2Y2Z A;  5IOY A;  3BR5 A;  2M0C A;  1JJ6 C;  3TW6 A;  3HBL A;  5IYC J;  2KT0 A;  1UG2 A;  2DMP A;  3MVP A;  1DU0 A;  1VI0 A;  3PO3 J;  2CJJ A;  4JX6 A;  1K61 A;  4X6A J;  4JX4 A;  2FD5 A;  2ME6 A;  5FLV A;  2R5Z B;  2XGC A;  3H0G J;  2LY9 A;  4DW6 A;  2TRT A;  3GTK J;  2ELK A;  3BG3 A;  3HGG A;  3F0C A;  2YU9 J;  3H3V K;  2L9R A;  1AU7 A;  5EDN A;  5GPA A;  4M3E A;  1ZR4 A;  2IBD A;  2CUE A;  5JLW A;  2Y30 A;  1FIA A;  2E2I J;  1TWF J;  1IDZ A;  3BG5 A;  1EF4 A;  1BW5 A;  1TWA J;  4B3A A;  3RKQ A;  1PUF B;  1FTT A;  1MBE A;  2LP0 A;  1ZR2 A;  3DCF A;  2ECC A;  4FIS A;  4JX5 A;  2VI6 A;  3UKG A;  2MW8 A;  1OJL A;  2M8G X;  4JP0 A;  3HOW J;  1B72 A;  1HCR A;  1TWG J;  2H1K A;  1MSF C;  1Y1W J;  1BW6 A;  1QRY A;  3QQA A;  1H88 C;  2HOT A;  2XB0 X;  2VUM J;  3TP0 A;  4AYB N;  4XRS G;  1MSE C;  4BKX A;  3Q0U A;  2DJN A;  4A69 C;  2GLO A;  1F36 A;  5C4X J;  2HQ5 A;  1VND A;  3D1N I;  3GTP J;  2DA7 A;  4EEF G;  2EH3 A;  5M3M J;  3JRA A;  4RBO A;  2R0Q C;  4A3I J;  3S1Q J;  4A3G J;  3JR9 A;  3HDD A;  5J3L A;  1TWH J;  1YRN A;  1IRZ A;  4W97 A;  3SDG A;  4V2F A;  1JGG A;  4CYC B;  1IC8 A;  4I76 A;  2LK2 A;  3BTL A;  1HLV A;  3LOC A;  2LFB A;  1IJW C;  3O8G A;  1JTX A;  4DZP A;  3CMY A;  2L7F P;  3TED A;  2NOG A;  5GPC A;  1HOM A;  2XRL A;  3BR6 A;  4A3D J;  2WV1 A;  3OSF A;  4FE7 A;  3G1L A;  5IPA A;  2H8R A;  2COB A;  1JUM A;  2DMQ A;  5M5Y J;  5EZH A;  4DZJ A;  5FLM J;  1GV2 A;  1NK2 P;  3GTJ J;  3O8H A;  3RQI A;  2I10 A;  1U9O A;  4UUS A;  5F0H A;  4BBR J;  3OOU A;  4D7M A;  3E7L A;  3OIO A;  3WHB A;  1AKH A;  1B8I B;  3S16 J;  2HOA A;  4DYQ A;  2LLK A;  4A93 J;  2VKE A;  3A02 A;  1JT0 A;  1UMQ A;  3ZOB A;  1S7E A;  2HI3 A;  3IH3 A;  2IAI A;  3PM1 A;  3SFI A;  1AHD P;  2K9S A;  1VF9 A;  2MGQ A;  2NVX J;  1ZK8 A;  4BXX J;  3GTG J;  3A03 A;  5FKL A;  3GTO J;  3M3Y J;  2P81 A;  5FJ8 J;  2JK3 A;  2M9H A;  5EGO A;  3BR0 A;  3GTM J;  2X6O A;  2FX0 A;  1MBF A;  2L7M P;  3B6A A;  5EEA A;  4A3L J;  5JLX A;  3LSP A;  4C3J J;  5GP9 A;  4HNV A;  4QSH A;  1WH5 A;  2HXI A;  2LKX A;  1ZQ3 P;  1ETK A;  5F1J A;  1PUF A;  2JJ7 A;  1ZGW A;  1LE8 B;  3W6V A;  5F0C A;  2YS9 A;  5EG0 A;  2EZK A;  4FE4 A;  2G0E A;  4UUT A;  1XG1 A;  2M34 A;  2Y0S N;  5K7F A;  5K7Z A;  3JRE A;  1ENH A;  2CRG A;  3SJM A;  2NS7 A;  1A6I A;  2DA2 A;  2WB1 N;  1XC5 A;  3CQZ J;  2R92 J;  2X48 A;  4MFD A;  5HOD A;  1WI3 A;  4DYC A;  3C2B A;  3QPS A;  4J19 A;  3S1M J;  1GV5 A;  2HYJ A;  1YRN B;  3ZQI A;  3BTC A;  3OSG A;  3QPL A;  2B63 J;  3IH2 A;  1OFC X;  1MBG A;  3CDL A;  4D5C A;  4A3F J;  1QPI A;  1LFB A;  4Y52 J;  2CUF A;  2LTP A;  1ETV A;  1GT0 C;  2NVQ J;  1JUP A;  3ZQH A;  1HDD C;  2JA8 J;  4IHX A;  3ZQG A;  4DYR A;  3S1N J;  3BQZ A;  1RR7 A;  2ECB A;  2XSD C;  4A3E J;  1IUF A;  4V2G A;  1T56 A;  4S0H B;  3PO2 J;  1Z77 A;  3ZQF A;  4BY1 J;  3LSJ A;  2Y9Y A;  4W1U A;  1GVD A;  3HOX J;  2E2J J;  2O9L A;  1RPW A;  3S17 J;  1R9T J;  1U78 A;  3A01 B;  2DTZ A;  1MH3 A;  5IP6 A;  2GM4 A;  2O7O A;  3FK7 A;  4XRM A;  3FIW A;  1Z0X A;  4C2M J;  1IG7 A;  2DA1 A;  3BT9 A;  4FTH A;  1WPK A;  1POG A;  4IHV A;  5F27 A;  1GUU A;  5C44 J;  1ORK A;  3B6C A;  5EYR A;  3LSG A;  1B72 B;  5E3L A;  3HEF A;  3JRF A;  4Y7N J;  2EBI A;  5K7H A;  4M3D A;  4D7N A;  3JRI A;  4M3B A;  2M2E A;  3MKL A;  1X2M A;  1U9N A;  2AO9 A;  2DMU A;  4XRS A;  3HOY J;  3S2H J;  1ITY A;  3NAR A;  2DA4 A;  3A01 A;  4G12 A;  3I4M J;  1ETW A;  5M5W J;  1X2N A;  3BTI A;  1O4X A;  2JA7 J;  2MG4 A;  4IHW A;  1RKW A;  3JRB A;  1JT6 A;  3DEW A;  5EGO B;  2PMZ N;  2W48 A;  3LNQ A;  1Q1V A;  1HDP A;  2AHQ A;  1I50 J;  5FKO A;  1ETX A;  5J1R A;  2JWT A;  1NK3 P;  2R5Y A;  3BR1 A;  2JMW A;  1FEX A;  3G1O A;  3GTL J;  2DA3 A;  1JKP C;  1E3O C;  1TWC J;  1ETO A;  4CYC A;  4BBS J;  2TCT A;  1IGN A;  2R5Z A;  4LOC A;  4L5E A;  5EG0 B;  1W0T A;  1MBK A;  5EZG A;  5DS9 A;  1RES A;  1JKQ C;  2EZI A;  3MN2 A;  3Q3S A;  5FKN A;  1JTY A;  2NVY J;  1T33 A;  2QCO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...