2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
b'AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cerebral protein 1
publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
5DX1A 2P3QA 1KIAA 1M0EA 1R18A 4YUVA 5LQKA 2ONZA 3G5TA 4ZTBA 4ER6A 2LD4A 4HC4A 3VSEA 3HTXA 3M6UA 1R8YA 2ZFUA 2P7HA 4E2ZA 2Z6AA 4GC5A 5K0LA 1VP9A 2I62A 3TRKA 1QAMA 2CMGA 3KQWA 1HNNA 3LDUA 5DLYA 1JG3A 2ONYA 3FUWA 2NXCA 3MGGA 4R8RA 3GJYA 4HG2A 2OYRA 4F84A 4PWYA 3G2OA 4UOEA 2Y1WA 4R8SA 5FQNA 1JQEA 1X1BA 4YUYA 4OQEA 4RVFA 3M33A 3P2IA 2PT6A 4MIKA 4GOOD 3VC1A 4CKBA 3OFJA 2P7IA 2NXNA 3KR9A 4KDRA 4FR0A 4OA5A 1TW3A 3B7PA 5CCBA 2NP7A 1I1NA 1EJ6A 3CJQA 4DF3A 1D2CA 3DUWA 5E1DA 2C7PA 3TQSA 3PVCA 2PX2A 2N47A 2IP2A 3B89A 4NECA 4HRAA 1N7IA 1NE2A 1MJFA 1XDUA 2B3TA 4IV0A 5EIWA 5DM4A 5LQJA 4L7VA 1H1DA 4P7JA 3LECA 3GRVA 4MWZA 4OA8A 4RTLA 3KPYA 4V0RA 3UZUA 3DLCA 4F85A 3PFHA 3EEYA 5EMJA 2VP3A 2EJUA 3HVHA 3JWJA 3P97A 3EMBA 5FUBA 5FWAA 4BP1A 2CWWA 2CMHA 2C7OA 1WS6A 4E2XA 5EQJB 4PYIA 5KQRA 3U81A 3HEMA 3K0BA 3GRUA 3G2QA 3MTEA 3BT7A 3EVCA 1QYRA 4YV2A 2CKDA 4YUZA 2PSSA 4QTTB 2B78A 2ZWVA 4HH4A 1JQDA 5U4XA 1JG4A 3MB5A 3R24A 4CTJA 1NBIA 1T43A 2H1RA 1G6Q1 4YV1A 3LCUA 3PTAA 3B3FA 4FP9A 3S68A 3KQVA 1BOOA 1JG2A 5EVJA 2AOVA 5EMLA 3EGVA 3PB3A 1TPYA 2PWPA 2YXEA 3ELYA 3A27A 4IKPA 3PT9A 5K0CA 2UYQA 1RI4A 2HV9A 3LBYA 2GH1A 4AZVA 4QPPA 2QM3A 2UYOA 2VDVE 2YTZA 1ORIA 3BXOA 5LSAA 4OX9Y 3HCDA 5D1HA 4MTLA 4E2YA 5HEKA 1VLMA 2PY6A 1MHTA 3DMFA 5C9ZA 1NW7A 1JTFA 3G2MA 4HSGA 2UYCA 2XYQA 5CVVA 3DXXA 2GA9A 5BW5A 5LQRA 1KPGA 2VDWA 2H11A 4QDJA 4RVGA 2UZ4A 4DKJA 2YVLA 5KYGA 2I6GA 2AN5A 5CVJA 2AOTB 1X1AA 4GC9A 1VL5A 4DCMA 5K01A 4HGYA 2ZBPA 4AZWA 3ANXA 3FPHA 3NMUF 5E8JA 5ICGA 2A14A 3EMDA 3MERA 4Y30A 2Y1XA 4C07A 5ICFA 4RTRA 2QRVB 2FK8A 3FTDA 5EG5A 5K03A 4XUCA 1FJXA 1ZGAA 3GIWA 5HIJA 5C1IA 3NJRA 1Y8CA 4R6XA 4R05A 3KKZA 5B1SA 3UJBA 4RVDA 4EVIA 10MHA 5EKUA 4ER3A 1P91A 2ZCJA 2O57A 2ZULA 4RTJA 2GLUA 5E9QA 5ERGB 1KYWA 3GGDA 1VBFA 3FRIA 3FUXA 4CKEA 2BR5A 5FQOA 3T7RA 3BKWA 3LSTA 4DA4A 1QAOA 2OO3A 4OQDA 3I9FA 3REOA 5BXYA 3FTFA 2FCAA 1G8SA 3GRRA 4P7FA 2YXLA 4PYQA 3GDHA 3UA4A 1VIDA 1EG2A 3GRZA 5C0OE 2PV0A 2ZW9A 5DXJA 2JHPA 5GM2A 5E8RA 3LCVB 2PXAA 4FGZA 1RI1A 1KPHA 1SUIA 3LGAA 1YFLA 1I4WA 3SR4A 2ESRA 5CVEA 3FUUA 4KWCA 4BLVA 2AZTA 4GOMD 3FYDA 3NTVA 1FP2A 2NXEA 2VZ9A 3OZRA 1FBNA 4RVHA 1DCTA 3EVGA 4YMGA 1P1BA 3KPUA 1EIZA 5EGSA 4LWPA 2PBFA 2JHAA 2NNWB 2ERCA 1R74A 1L9KA 5CM2Z 3HCCA 2BM9A 2PX8A 2ZTHA 3ID6C 5E2BA 5DM2A 2QY6A 3SM3A 3DR5A 2YR0A 3CVOA 2YXDA 4EQZA 2IGTA 2OKCA 3HP7A 5DTRA 1XTPA 3DTNA 4PIPA 3P9IA 3NDIA 2AN4A 4GUAA 4Y2HA 5DXAA 5G02A 5GIOE 3UJ8A 1Q0TA 3JWIA 1AF7A 5DSTA 3NVKI 1RI5A 2P1DA 2EG5A 1FP1D 4RTPA 2G8NA 3EVFA 4C03A 1UIRA 2FYTA 2P35A 3M70A 2BH2A 1WZNA 3G2PA 4PGGA 5EKXA 4AZSA 3O7WA 3CBGA 1O54A 3LDGA 4RTOA 5E1BA 5DWQA 1F38A 3G88A 3R0QA 2AOWA 3P9CA 3UFBA 2P3OA 5JUWA 3RODA 3IV6A 4BLUA 4DQ0A 2I7CA 2VS1A 2IH2A 3AXTA 3UJ9A 5M5BA 3G8AA 3H2BA 1YZHA 3EVAA 1M6YA 3HVJA 3P9NA 1F3LA 2YUIA 5E1OA 2IFTA 3UJDA 3OU2A 2ZSUA 3E8SA 5DT2A 4BP3A 3KPWA 3GNLA 1KYZA 2YQZA 4JXJA 4KVZA 1BC5A 1NV8A 1INLA 4PYKA 4X41A 5KQSA 4HTFB 2IBTA 4FT4A 4H0NA 2QYOA 4PYNA 3OE5A 4PINA 4FS8A 4GQBA 2AOUB 2H00A 4PGHA 3EGEA 4M7RA 3Q87B 1RJEA 3LPMA 4V0QA 3JWGA 2NXJA 1KPIA 4KDCA 2ZZKA 3I5UA 2PXXA 2HWKA 1XDSA 4GOND 3E23A 4KRGA 3OU7A 2IPXA 3BWMA 3FUTA 3MCTA 2FPOA 3SSMA 5D1NA 1AV6A 3LKDA 3DOUA 4DCGA 1AQJA 5DPMA 4PYMA 3R6TA 2BR3A 3ER8A 1R8XA 5DM1A 2EJTA 3TMAA 3FPFA 5K05A 4DM3A 3BKXA 4EK9A 1NW3A 4QPNA 3AWIA 8MHTA 5DTMA 3PFGA 4RV9A 3GU3A 5GM1A 3UWPA 1VQ1A 4CTKA 3E7PA 1D2GA 5K0GA 1NV9A 4AZTA 1OR8A 1DUSA 1RJDA 2GS9A 4KW7A 2DPMA 2HTEA 5EPEA 5DX8A 5P8WA 4YMHA 5LQUA 2QE6A 2DULA 5FA8A 1NT2A 2WA2A 3TM4A 3SXJA 3THRA 4C05A 3TKAA 3HA7A 3CKKA 2HR1A 2R3SA 3QOXA 1FPQA 1RJFA 3G5LA 1SKMA 1G55A 3TLJA 4ER0A 2PX5A 3FUVA 2XBMA 2B25A 3C3PA 2HMYB 3LDFA 3LX6A 3D2LA 1RI3A 3M6VA 1ZG3A 3FPGA 1ORHA 3KQQA 3KQPA 5FA5A 5HOQA 1NW6A 2CL5A 3DMHA 1ZKDA 2VDUE 3KQMA 4ER7A 5E9JA 3P2EA 5GOZA 5KVAA 4RTSA 2BR4A 4LECA 5E9WA 1O9GA 3TFWA 5IH3A 2BM8A 5GINE 3LCCA 5K0FA 2ZBRA 3EVZA 1XCJA 3TKYA 2C7QA 2OY0A 4OBWA 3G89A 4WXHA 3THSA 5EMMA 5MHTA 5F2NA 1XXLA 5LQCA 3B5IA 3A26A 2PWYA 1NW8A 1HMYA 3EEOA 3I64A 4P7KA 1R00A 2XVAA 2NP6A 5HFJA 1R6AA 5FWDA 2IH5A 2R6ZA 2PVCA 2ORED 4LWOA 4B17A 4RTNA 9MHTA 1IY9A 5CVDA 5K0BA 2G71A 2O06A 2WA1A 3JWHA 4G56A 5EC8A 3CC8A 1XCLA 3FTCA 3CJRA 3P9KA 4KIGA 3QV2A 3RIEA 4ER5A 2OXTA 4R6WA 4X60A 3OZSA 3BWCA 2PXCA 1YFJA 5FHQA 3NW9A 5FTWA 4K6MA 4RTQA 4U7TB 4QQKA 5K09A 4QTUB 1QAQA 3G7UA 3KHKA 1UWVA 4CKCA 5EEHA 2P8JA 5LR6A 1WY7A 3VC2A 2IDJA 3M4XA 2AS0A 1JTEA 2P41A 3I58A 5E1MA 3ELUA 4A6DA 5IKMA 3HCFA 2O0LA 4EKGA 3C6KA 3BWBA 4FSXA 5DTQA 2JG3A 1EJ0A 2IBSA 3T0IA 3HCEA 3FPEA 5BW4A 2V74B 3EVEA 4PCAA 2GB4A 2E5WA 4YUWA 5CD1A 3QOWA 5EHGA 3WSTA 5ICCA 2ZBQA 3HA5A 4P58A 4X61A 2HNKA 3ORHA 3SVZA 2IDKA 3C0KA 5K0JA 3BZBA 4DMGA 3I53A 1VPTA 3LL7A 2AVNA 2OZVA 3KQTA 4EKIA 5HILA 1P1CA 2IIPA 4RYLA 4POOA 2O07A 5CVUA 4ISCA 3MAGA 3GWZA 2OB2A 3UJCA 4C4AA 2OPBA 4M37A 4QQNA 3SSNA 3SX0A 4C04A 3A4TA 1X1CA 1NKVA 1I9GA 1KP9A 3PX2A 3UJAA 3BGVA 2FRXA 1L3IA 1QANA 3HA3A 2I9KA 4IV8A 3GO4A 3P2KA 1EAMA 5E2AA 2ZZMA 5DM0A 4PIMA 2YX1A 3NWBA 3R3HA 3MQ2A 3OPNA 4Z2YA 1BKYA 1JSZA 1L1EA 3HM2A 5DRTA 3M6WA 3UJ6A 4O29A 5K8VA 1ZQ9A 3MCZA 1YZ3A 3KU1A 1SVUA 2O05A 3IYLW 2JH9A 3BUSA 4CXMA 1KXZA 1XVAA 4OBXA 5CIYA 4ATNA 1N2XA 4RTKA 3LKZA 1SG9A 3HVKA 3BGIA 3KR0A 3V97A 3V8VA 5ICEA 2P40A 1RI2A 5HIMA 3K6RA 4AX8A 2JJQA 1AQIA 3AXSA 1Q0SA 4X63A 1TW2A 3C3YA 5DRYA 5EEGA 3B3JA 4E70A 1NBHA 3GCZA 2ZIGA 2G1PA 3L8DA 1JR4A 1EQAA 5FHRA 4QVKA 5EMKA 3AJDA 1X1DA 4PCLA 3OE4A 2PKWA 4PYLA 2PT9A 1L3BA 1P39A 3KPVA 3NVMB 4FSDA 4FT2A 5JR3A 1YF3A 1X19A 4M38A 3CCFA 3GRYA 4GF5A 5T64A 1JG1A 2AVDA 3KR1A 3X0DA 7MHTA 5F2KA 3DMGA 2AOTA 5DX0A 5KS2A 1YB2A 3EVBA 3KQOA 5K0NA 2FHPA 4RX1A 4C08A 3TOSA 2BZGA 4IWNA 4AUKA 5H02A 3ELWA 3HCAA 4E32A 4RWZA 3C6MA 4PYOA 3IEIA 2QRVA 3EPPA 1L3CA 3PS9A 3KR2A 3OFKA 4M36A 2ZLBA 1M6EX 3BGDA 2F8LA 5EOVA 4A6EA 3R9XB 3P71T 3OU6A 5T6BA 3ER9A 5HIIA 5EZQA 1YUBA 1B42A 1O9HA 4BY9E 2OB1A 2ZZNA 1PRYA 4XUDA 1KHHA 1IXKA 1VP3A 3P8ZA 4RTMA 3DXYA 4GEKA 4YUXA 2Q41A 3FTEA 4FZVA 2AR0A 1G8AA 3TPZA 4E31A 4GOLD 5EHIA 1DL5A 3SGLA 2GPYA 5CUQA 3T7SA 1ZHFA 3NWEA 1SUSA 4X1OA 5GIPE 2UYHA 3FYCA 5BP7A 2Z6QA 3FRHA 5LQAA 2WK1A 2G72A 5T67A 2ADMA 2G70A 2AN3A 4DZRA 1SQGA 3PX3A 2C7RA 2NYUA 3EGIA 4E30A 3DLIA 2FK7A 4PONA 3ME5A 3TM5A 3NDJA 4U7PB 5EIFA 3VYWA 2EX4A 4F86A 1D2HA 1ZGJA 2ZWAA 4KIFA 1XJ5A 3CJTA 3KPJA 4MHTA 3T7TA 1JSXA 2ZIFA 3G8BA 1IM8A 3LHDA 2XYVA 4HGZA 3OZTA 4QDKA 3FPJA 2PGXA 3A7EA 4QVGA 3E05A 2Z6UA 3MTIA 3DH0A 3DP7A 5F2OA 4CWAA 3SSOA 3UBTA 1VE3A 2AOXA 3ERCA 2B9EA 4P7GA 3LBFA 4E2WA 3DULA 1V39A 3AY0A 4E33A 4EMSA 3UA3A 4PNEA 5CCXA 4GBED 1U2ZA 3F4KA 2KW5A 2P3LA 3CGGA 3O4FA 4WVLA 5GWXA 1NW5A 2ZIEA 3OCJA 2EFJA 3BWYA 1N7JA 3A25A 3A7DA 2JH8A 1JQ3A 4C06A 3O31A 5DSXA 5EZSA 5FADA 2B2CA 1G60A 1WXWA 2GAFA 4RSRA 3UJ7A 5HZMA 1SQFA 2XVMA 1WG8A 5GP1A 1RJGA 4PYJA 5K0EA 3PLAE 3TR6A 1KR5A 5FCDA 4XUEA 4MQ4A 3SMQA 1XDZA 3KQYA 4BLWA 1PJZA 1UFKA 1Z3CA 1QZZA 2PLWA 2XYRA 3HVIA 3HNRA 3IHTA 4LG1A 1G38A 2ZVJA 3ELDA 3RW9A 3Q7EA 3M6XA 2PX4A 2K4MA 4XCXA 3HCBA 3KQSA 1BHJA 3EVDA 5LQNA 4HTFA 1WXXA 2IH4A 3DXZA 2OBFA 3GXOA 2V7EA 4YV0A 2JHCA 2AOUA 3MHTA 5HIKA 2PJDA 3B3GA 3FZGA 5FULA
chains in the Genus database with same CATH superfamily
1MOQA 2IV3A 3V7CA 2Z5LA 2QSZA 1GRRA 3JRNA 2FU5C 5HUJA 5KHOC 1B9MA 3TB4A 1ISJA 2A07F 2XNHA 5C3EJ 2A68F 3ZW8A 4US0R 2QQ9A 1R27A 2VPXA 1XLVA 3P0RA 2PKXA 3R1IA 2NTVA 3Q5DA 1G5RA 1G7RA 3E9CA 2NADA 3F5MA 4W97A 1DKMA 2WB1N 2WSBA 4E11A 2OGZA 4QTTB 5CHYA 1OCTC 4M0FA 1U0RA 2C4KA 2QMQA 3GBSA 1TZCA 4L8FA 4EX6A 2PY6A 3IOEA 4D6XA 4CHTA 2Z56A 2Q28A 1BRMA 3MILA 2YN0A 4R7ZA 3AFOA 1TM2A 3DTYA 3F6EX 2HGSA 4UHBA 1D6MA 1PEYA 2Y1XA 4R9NA 1LK7A 3GQBB 2FLWA 1SUEA 1FU4A 5ESRA 2UZ0A 3VPRA 2PUCA 1KU6A 1Y1SA 5D3QA 5TQ2A 1JAYA 3L6RA 3A1EA 2WJJA 4NDZA 5IT0A 3F5QA 1ZRFA 1THGA 3SYLA 4QBKA 3C3XA 4MRPA 3THWA 4GW3A 1W46A 4G2TA 4OIQF 4KWHA 4EHKA 4IILA 4ZZ3A 4RTOA 4HLUC 2O2ZA 4G6TB 1WX1A 2V6MA 1H05A 3C4JA 2VC2B 4XUGB 4RPJA 1I5ZA 4Q18A 3T5MA 2RC4A 2V97A 3UMJA 1UZMA 3OE5A 4FETA 4HNRA 4UTVA 3BCUA 3IVCA 5H59A 4BRWA 3JYPA 1J9EA 2IW3A 2EVWX 4PNPA 4DIDA 3KOZA 2B6NA 2VC1A 2E37A 4CNQA 5K4HA 3AWIA 1CX9B 3EXFB 1JILA 3FXRA 3UWPA 3L1JA 2DPMA 3BJMA 3SHQA 4NULA 2X51A 1GT0C 4C05A 4MEJA 4IO9F 5KNDH 1P0QA 4HT3B 3GPBA 3M0EA 1NJ6A 3F4LA 3DZ8A 1XCOA 3LD9A 4WOBA 1XB2A 1U28C 2VNIA 1NL3A 5ALIA 1JVBA 3D8SA 1Y7LA 1MMAA 1PJBA 4RHUA 2X7JA 2O5EA 1V16B 3PC8A 1CUSA 2F67A 1GPMA 3IO3A 2GVNA 2BI8A 2GPTA 2GTIA 4HN9A 3KO8A 1KYYA 3W2VA 3JQ8B 1BMQA 3BMQB 1ETOA 3HS3A 1PWEA 3GWGA 1R6DA 3UKGA 1DBVO 5FBRB 3IE0A 1MAVA 1CY7A 1B2LA 1KONA 4NEGA 3TO7A 2A30A 4A5SA 4FDVA 3AHGA 2QLNA 1QIFA 5A06A 1VPTA 4NBNA 5LZ2A 5H2FC 3LPLA 2IYOA 4WZBB 4Z5XA 3ASNH 5E2AA 1Z8NA 3TP0A 2Z04A 4QFDA 2GHRA 3A0HC 3S2IA 2A5GA 4DCJA 2R7MA 1Y3CE 3MEQA 3NEAA 3ICQB 1FMWA 5KAFC 4AX8A 3K6RA 3JAWB 2QUAA 3FDIA 3COWA 3S2FA 1UBRS 2G9NA 1NY6A 1YI0A 3ZP5A 5BWCA 1X19A 4GI2A 3KP6A 4IX1A 2PVSA 1YB2A 3D0OA 3WTYC 3I71A 3RE1A 3K96A 5JJIA 1VDZA 4GE0A 1U1FA 3ESDA 3E15A 1P45A 4FHZA 1N5MA 2JGKA 3SNKA 2EYUA 1Z82A 3IUMA 1LTKA 2CQNA 4KQ6A 2SECE 1WB5A 1DC4A 3H5LA 1QVUA 4EOGA 2J7KA 2QN9A 5CB4A 5AI6A 2GN4A 4LOCA 3BA1A 3AR2A 2L0KA 4YI3A 1TLTA 2ZE6A 1PJ8A 2JJ8A 1FOYA 3T5BA 3AOGA 5J58A 1SOVA 1HA3A 4DREA 1ZG1A 4LLGF 5CCEA 2YHUA 3L4BA 4B2YA 4FYJA 3CGGA 4RY0A 4D0RA 2ZIEA 4RMHA 1JEOA 2GJKA 1DHRA 4JQSA 4TV8B 4OGKA 4W6QA 2D1SA 1KDRA 4IVPA 3F7NA 1KE1A 3HVIA 3H9EO 4R0VA 1UBUS 2CQKA 5HX7A 5IKXA 2A5WA 3RC3A 1KKLA 4G8XA 4LZNA 4QJBA 1Y6ZA 1VQ4I 1A6IA 2DOKA 5ALYA 5TEVA 3WV5A 2FR1A 3UMCA 1RQRA 4GG1A 3MTJA 2ZRCA 1WIWA 1DJLA 1NAHA 2PXHA 3E61A 3ITKA 4QUIA 5FL7D 1OT5A 1P6UA 3ZGNA 2GDJA 1PNTA 2AF4C 3MGBA 1LDBA 2GN0A 1WS6A 1BMDA 4EJ0A 3IJPA 3K7EA 3QU5A 4F46A 2ZBDA 3AR8A 1PR1A 3FAKA 3UYKA 3A06A 3L7YA 5CFLA 1KEEB 1JAIA 1BDHA 3TX2A 1Y9EA 3KEGA 2P5YA 3WSVA 3K4NA 3EHDA 3ISJA 1SKBA 3M81A 3JW8A 4GXOA 4LVCA 3EMKA 4P86A 1E3LA 4PJJA 1QCCA 5CDSA 3O4VA 4MRNA 3TZKA 2NX2A 4X6UA 4JYKA 1C9DB 3C8HA 2GAJA 4Z8YA 4WKPA 2GLUA 3RS0A 5CG1A 2C4NA 3BORA 3BN3A 1JX6A 1N2GA 4QHYA 3ZDXB 1XMAA 2PTHA 1GYQA 2AA3A 4A3JJ 3BTUA 4KQFA 2ESRA 1E7WA 1WABA 1EIZA 3JYLA 4B5LA 1ZBQA 1NIPA 2VP6A 3QPLA 2QY6A 1ZIYA 1FZQA 2IU0A 3I9V6 5I48A 4CCWA 2H1IA 4WHMA 3CLSC 3TO9A 3FGZA 1LF0A 2KDZA 3CPSA 3PUWA 3WSWA 3R7BA 4XYBA 3E3VA 1UJ8A 1YFZA 1ZOPA 2YZGA 2ZEJA 3HMKA 1ESMA 2X9QA 2G0AA 3FOZA 4KGXA 5A4AA 3ZV4A 3EGEA 2HVSA 4DT1A 3OU7A 3RPEA 3SXUB 2O2CA 4EMTA 2M45A 4URFA 5DPMA 1ZZGA 1ZR4A 4ETSA 1SRQA 5BR4A 4EK9A 3ASOH 3JYHA 5KHAA 3MM4A 1NTRA 2UZKA 2FQ3A 2IBMA 4I6JA 5CX1B 4EO4A 2DC1A 3CZ4A 4FDLA 2CLKB 1M74A 2B8JA 3A6LA 4BAUA 2XAJA 3FUVA 4DZTA 1ZG3A 2F2TA 3F73A 4AY6A 2H1LA 3TR0A 4LB6B 1RHJA 3GTKJ 1N25A 4MS4B 2O7QA 2IV2X 4WNYA 3KXKA 2NP6A 3AUXA 9MHTA 4TL9A 1Y9DA 4QUEA 2WIJA 2A9RA 1N3YA 4OV6B 1CJSA 3CMEI 3PBKA 2DKOA 3QFHA 4LNUB 4B82A 3GBPA 4UC0A 1CERA 1JGSA 1PNOA 2Y30A 2VODA 2YASA 5A5GA 1QCZA 4I3GA 4EKIA 4MMZB 4QUHA 3QF4B 4HAIA 4NFYA 4MGRA 2CJXA 2WLSA 3I2HA 4PLZA 4I5DA 1FSEA 2YJ3A 3FIUA 1WKVA 4RAZA 2EQ5A 4PRZA 1H89C 4J16C 1JPVA 2XPCA 1R3DA 4NV1A 5K5QA 4YT2A 4ND2A 1SCJA 3K9BA 3ASUA 2WV0A 1T5LA 1T2KA 6ABPA 2PT9A 1P73A 4UUMA 2WSMA 2PNJA 1FUKA 4C0BA 5K3DA 5EJ8A 4D25A 1E2IA 5DUIA 3IRUA 2RGXA 2GXGA 4R2MA 4EI2A 3PGLA 3BROA 2MFZA 4BLQA 3GEEA 3F8FA 2YZNA 4XKCA 4WLVA 2O4CA 4X20A 4TUYA 1GXSA 5DLEA 4X1OA 3R20A 4MVJD 3E97A 1NQVA 1MX5A 3CE6A 4C6TB 2VWQA 4QBHA 1B26A 2JT1A 3WYNA 5LDDC 3DLLF 2MLGA 1I13A 1T0UA 1O2DA 3CPHA 4NU0A 5HE8A 4CYCB 4WFJA 1FFWA 1ECPA 4IQGA 4IXAA 4HXFB 3DDHA 2JJMA 1JHVA 4G4IA 4B4KA 1CJBA 1ZX1A 2K4MA 3G71I 1WXXA 2V1NA 5JZOA 2BOVA 4XRGA 2Q1UA 5DNUA 4LV8B 4RMJA 2RCNA 4MOWA 3D7MA 4GNKA 3NBKA 3ACCA 4I1RA 2GPJA 3LBHA 5F7OA 2HDWA 1NJ5A 3O3KA 4TS4A 4G84A 4MV1A 4KGZA 4BNMA 1TM4E 2Z09A 4X8MA 1JJ7A 1O58A 3H9BA 4M87A 1UC9A 4BX3A 3E3NA 2KRHA 4MMXB 1E7QA 2HGCA 3K1PA 1OAOA 4IV0A 3FPSA 3BDVA 3BRWA 5E7JA 1H4VB 4V0RA 4PAGA 5C37A 3ERMA 3DPSA 2DYSH 2VOEA 1F9AA 3VR5H 2PSSA 4HH4A 2R1VB 2CGPA 4EY4A 1DDNA 2V9ZA 4KSCA 4QXOA 2IA0A 2PQ6A 1OZ0A 2O03A 1Q21A 2YWGA 3KZKA 2CYCA 2HAEA 4L75A 1MOSA 3OZXA 4OM8A 1T1RA 4ZYAA 1KSFX 3C5WP 2I6GA 1HSJA 4P7BA 1E3IA 4YPVA 1FP7A 2FF5A 2JAUA 1UF9A 3PCTA 1KZ4A 4CSWA 3NX4A 4EECA 3QF7A 3EQ9A 1OH6A 2RGRA 3TOBA 1J06A 4G1MB 3PGKA 3QH4A 3IC7A 2JHPA 3FZQA 4K2AA 1Q0QA 4IIHA 3H5TA 1SUIA 1YFLA 1LPSA 2NO0A 4K2EA 4KYVA 1NU8A 1QYCA 4YAWA 4OB6A 2EKPA 4WKBA 3C1OA 1T4CB 2BM9A 4AMBA 3NDBB 4RGRA 1GGMA 2CF5A 2JDIA 5H4HA 1Z4LA 2I7DA 3U60B 5K0SA 3ZWCA 3DTVD 4BJTA 3WRXC 2P35A 3NDRA 2OYCA 3V80A 5E1BA 4CV0A 1KAMA 2G5TA 2NPIA 3T7DA 2EP8A 4I98B 5FH9A 1IVSA 3AERB 1ECJA 3SKYA 3ICOA 4XLEA 3EAGA 2GLOA 5LVAA 1G20E 4N49A 2QLJA 3W5SA 3D9QX 5E6RA 4RD0A 5AW5A 3FYSA 5DUKA 2O2SA 2O8VA 1C41A 5AESA 3NBYC 2YIJA 5K0GA 3W2AA 1R10A 1NG7A 4PK4A 5FA8A 4NYJR 2CMPA 2E7XA 2KLHA 2KFDA 4HNVA 2L0XA 1QS0A 2XGDA 1GL3A 1M1YE 2QM8A 1FTNA 2HLNA 3UHJA 1J8YF 1BI3A 3SQMA 1J6UA 5L7YA 4P6VF 4HLUA 1K7CA 2GZRA 2Q5JA 2VNHA 3M1LA 4D5GA 1AXRA 3A3KA 3IKTA 1N33B 2JFZA 2PVCA 5LOVF 3K9CA 6ADHA 2WIKA 3HGMA 1Q92A 4M88A 1GKYA 3CNOA 3LCMA 4FOSA 4Q0MA 1GA4A 2WWIA 1EWKA 3VTZA 3M3YJ 4OY3A 5BW4A 3OYHA 1L5WA 3BAZA 5CD1A 5TGTA 5FUYA 2VONA 3EGXA 5FAKA 1FX0B 1FJLA 4MXDA 2PH1A 3BR3A 3R0JA 3KZCA 2R5YB 2HFKA 3BTLA 3WGIA 4HX8A 2DPDA 3K9HA 2E36A 2G1UA 4J29A 5GTDA 1YT5A 5AHWA 2PGDA 2BV3A 3PNQA 1QV6A 5AM3A 4DSTA 3WGTA 2H2FA 4YAGA 5FD5A 5KYYB 2GEJA 2Q49A 1U7WA 2Q3JA 2JVGA 2NS0A 5A5DA 2XODA 4GLJA 5FIUA 2M0CA 4FW9A 4KYIB 1XAHA 2HT6A 4QNNA 4JEHA 4TYNA 4ZOQI 4PC6A 3RQ4A 2H4YA 5EJ4A 5FT9A 3KSAC 4AG6A 3TP3A 1RWXA 2D7DA 1GPWB 1QGYA 1EXNA 4RIHA 2JLCA 4E5PA 3ER9A 3CRNA 1O9HA 2GBLC 1IXKA 3TLGA 3PFBA 1HKTA 1P1JA 4PN3A 3ZD7A 4N8DA 2G9ZA 3M34A 5T67A 1A2BA 1U0FA 3U7FB 4MUYA 3K0EA 4XGNA 1P7YA 2Q5FA 4AJEA 3E05A 3UOWA 1MW7A 3BFPA 2NW6A 3F4KA 3NAZA 2P3LA 5CEFA 1UFMA 3N75A 2IUEA 4MPPA 1WWKA 1EA7A 3PICA 4LJ8A 2P4QA 4GOKA 2DFDA 4BO0A 2F59A 3FCAA 3LC0A 3ONDA 4KK3A 3GXOA 4YV0A 2F43B 5AHXA 2IF0A 4EYSA 5CVIA 3L0CA 2PV7A 3PNLA 1AB6A 4GM4A 3U0BA 4CW7A 1QORA 1TL7C 4HAMA 4MIKA 3C97A 3QGMA 1O94D 1U2EA 4Z53A 3WBBA 2QPAA 1CYDA 4L2IA 3KVVA 3L6DA 3LY8A 5D01A 4WFKA 3GD5A 3LOCA 1YJQA 4MP8A 3QP6A 2CFIA 5IKOA 4EVQA 2LF8A 3IP6A 2CYAA 1ZITA 1P6XA 1PT6A 1NYLA 4MV8A 2IZ0A 1W47A 5JSKA 2YJTD 2XLBA 4D3SA 1YB7A 3LF1A 4DKXA 3AHJA 3NC0C 4BMOB 4MB2A 4UQOA 5LB2A 1KJ8A 3G68A 3AIMA 4W5NA 4L5JA 4MMYB 1U0EA 3GFGA 3KHUA 3KYCB 2ZUWA 4WK4B 3Q15C 1G5HA 4YREA 5AXAA 1QGOA 3MOSA 2L9RA 2VPWA 2OHGA 4Y2YA 2OCGA 4WADA 4XMYA 2V96A 2J3QA 4ODIA 4AP9A 3W2HA 1UC8A 3OY7A 4M21A 2OILA 1Z06A 2RREA 5HLHA 5BSEA 4BUJA 3T95A 3OFVA 3G6EI 1SC6A 5IT4A 2FPUA 1F6DA 4BFSA 5C0OE 5L51A 2EKQA 2YWXA 2D2WA 2HTSA 2VZ0A 5FV4A 1MO4A 1EDEA 3VFZA 2LUOA 5IDYA 4R1PA 4ZC1A 4JITA 5C5DA 3V7SA 2WNSA 5DF1A 1KJQA 4O4IF 3IJEB 1UMCA 1ZAYA 2Y8EA 3PHBE 3PHIA 1KKMA 5JNWA 2XYHA 2BKEA 1XRLA 1K61A 4TQGA 2IP1A 1O87A 4U00A 2XOKD 5FOUA 1CEQA 4AB1A 5TVGA 4W5HA 1EWTA 1IAVA 2XIJA 2P79A 4U5XA 1C30B 4PINA 1RJEA 2HA2A 4PQFA 2E49A 5I01A 4UFOA 2FA9A 3OIDA 4FT8A 4NCAA 4PG4A 1F6BA 3IP7A 5G2OA 2HMWA 1AKHB 3QFFA 1XLTA 2GZ1A 1TQ8A 1ACLA 4EFDA 4XX0A 3SXJA 3DZKA 3THRA 2CL0X 2DBZA 4OAPA 3VR6A 3M6FA 1AZTA 3VYVA 1S2OA 4FLFA 4MCIA 4MYUA 4XLAA 2AD5A 1K7EB 4M99A 1AF4A 1EFUA 4Z51A 3EDYA 3B9PA 5KVAA 3SE0A 2ZXJA 4WOCA 1DFHA 3BC8A 2WAAA 1PI3A 3F47A 1P4JA 4P55A 4ARVA 3JVUA 3G7SA 1M6NA 1TUGA 4KNWA 1W1IA 4QU9A 3A4NA 4ZJYA 2P5VA 1DJQA 1JA9A 2EZ4A 4X60A 1SUBA 2J5BA 4MWEA 4N8SA 3P4XA 4KVGA 4CIYA 1U90A 1HFEL 4RD4A 3K4BA 1KSGA 2LKPA 4GR9A 1JU3A 3AW8A 3CGWA 1CY8A 2G9QA 3KALA 2JLXA 1W7PB 1NUTA 1Q1VA 1KQ9A 2DT5A 2CD9A 2K9MA 1M2VA 2C2MA 1QANA 3AONB 1C8KA 1T8UA 2X9DA 1ZS9A 5CM9C 4US1R 1KE2A 3GFQA 5JAMA 4LGCA 2OQRA 3ESCA 2L7MP 1N92A 4BGVA 3REQB 2AEMA 4RHCA 1L7OA 5LBQA 3J7AC 4J90A 5COBA 1SVSA 3PQDA 2G1PA 3KTDA 5AOBA 3WVNA 4QGHA 4QVKA 2DMTA 4IQ4A 1WM1A 2J31A 2SKDA 5FD6A 5AK3A 1IOWA 4PLGA 5EMNA 1CZUA 3UENA 1PT7A 2ZVPX 3ZYZA 2FXVA 2E4XA 3KQUA 1V7PC 2VF4X 1PYGA 4XM1A 2CXXA 5DDIP 3X2QH 2FQ1A 3V42A 2CQXA 1QYWA 2XGMA 1KHHA 1T9GS 2AT1A 4CT5A 4G4GA 1SULA 1NJ1A 4CLEA 4ES6A 4PBSA 4AJLA 3R9KA 4P4NA 3OYFA 3J7YJ 2X0LA 1FTZA 4TXMA 5DNYB 5ES3A 4J16A 1CRQA 2CUEA 3UPDA 2PSEA 1I6LA 4L6IA 4F2PA 1JEAA 4KPYA 3PRJA 1KA9H 1B1CA 1YKFA 1DMSA 1N9KA 5DI9A 3N5CA 3HLKA 3ICEA 3ZJ5A 3QPVA 1X42A 3SMQA 2FKAA 3ADCA 3R4CA 2Z2XA 3HNRA 1G5IA 3L0DA 1M0EA 1NVDA 3FMIA 4HS9A 4L4YA 5DBOA 3HCOA 1T15A 1Q0UA 3E9YA 3NBAA 3KFVA 5FTKA 5F7JA 4LCEA 4MRMA 4RW0A 4YRSA 4JK3A 1USKA 3R7DA 4MB0A 4H6WA 2QZSA 4KAXA 2ODWA 3VC1A 3VAZA 3DE0X 4OJTA 4Z6KA 4EHLA 1OYVA 4IJQA 3CJQA 4ITRC 3GG9A 2PH3A 4N3AA 4KK4A 5HKKA 1GHTA 1Q74A 4YC7A 1O95C 4JUAA 4QUGA 2EJUA 1B9NA 2DU8A 4BLRA 4C2TA 4Y1EA 2PO7A 2JH3A 5C18A 3S2WA 3HEMA 4X97A 4YUZA 2B4TO 1TOAA 2NGRA 4U02A 1TK2A 1B3BA 1L4NA 3Q7TA 4IP0A 3ECSA 1BH6A 3GP3A 1HF3A 3S81A 2Q2OA 1JKMA 3L1VA 2E71A 2R7XA 3M8JA 3A6EA 1NRXA 4QA9A 5B58T 4CF4A 3JR7A 3THYB 1XPRA 1S3FA 4M2LA 1OB2A 2Z6VA 3OPQA 2C2BA 1LX7A 3TG8A 1CR6A 2JCGA 4C4ZA 4Q1CA 1LQ1A 4JC5A 4NE7A 1I5EA 3JQFC 2WY2D 3U9SA 5IVIA 1H2FA 5JE8A 4OD0A 4UVHA 3M6LA 2W6ZA 2R5FA 2BR5A 2R79A 1O0SA 1DRJA 2FETA 2H4FA 3ZWWA 1XROA 2QL5A 1X1SA 4ZGGA 3ITEA 2Q1SA 1FVOA 3WLOA 3OWOA 1AE1A 1OIXA 2RKHA 1HCRA 3NHLA 3V33A 2BEWA 2E4UA 1DXYA 1XCMA 4FNMA 1QTRA 2H4JA 4TMFA 3SM3A 3RJ5A 3EXIB 2YXDA 3ABKH 2IGTA 1XTPA 1AS3A 3B6ZA 2JA6J 1DC6A 2I7VA 2Q4DA 4OHCA 4JX5A 4DCUA 5C7IO 4OLJA 2PDAA 3I5YA 1PZFA 4OMZA 2XNCA 3V7YA 3U4QA 3RODA 4U0VA 4IHJB 4LRWA 4LTDA 1U2GC 5D5UB 5JVDF 4B8ZA 1LJLA 2Q5LA 3R44A 7MDHA 1RWMA 4AF8A 1WOYA 5J9FA 2XXAA 4TMWA 1H0SA 1JHYA 2JVIA 2BBYA 4DCGA 4EGZA 4BXFA 5HE9A 2JPDA 1SFEA 1UBOS 4ZT3A 3ZC3A 5K4GA 2WYWA 4E7SA 2QZPA 1Y7PA 4HQEA 1DCKA 5CQGA 1RM0A 5DNWA 1M1ZA 1JHPA 2AV6A 2H1FA 3QPUA 1ODTC 3GFBA 3UCEA 4C9YA 2BM1A 5GAJA 4L4SA 1TM1E 2P2DA 4IFIA 3RTEA 1QIHA 3HBNA 4QT0A 1EWRA 1R71A 3NJ4A 3MTBA 2HVQA 3RFTA 3WRXA 4NYIR 4YCAA 2WWFA 3OF2A 3EFOA 2JA1A 4QLCU 1WP4A 5E79C 1HO3A 1IY1A 4A3KJ 3A9WA 1QVTA 2I80A 4Z9AA 4I1UA 3OJ0A 1MNQA 3TTSA 4C5AA 3MZ0A 1IN8A 3E6BA 1SXIA 3WU0A 4JLVA 3NH9A 1KRWA 3D8UA 3QMWA 1TMKA 1L5HB 2O8EB 3PUXA 3SC2A 1F2DA 4IDOA 5CK4A 2AR9A 5H20A 4BFLA 1EAMA 3CNEA 4IVNA 5AKHA 2WZCA 2W2XA 1SC7A 4XWAA 4LZWA 2E21A 3UPTA 4EI7A 2LCFA 1ZQ9A 1WUKS 5FTNA 4PQRA 1N2CA 2Q3CA 3BXXA 2O23A 1WCIA 3H11B 1Y5IA 2PMHA 4QNMA 5L7WA 1PR0A 4AP6A 3HPHA 2H16A 4RA9B 2XE7A 3QTLA 4C3VA 1ZU4A 3P45A 3MT8A 4GRAA 3JREA 1X92A 2FZCA 3KQOA 5KUTA 4FXPA 2M4GA 2CYYA 3CZ6A 4GX5A 2RI0A 1L3CA 1T8SA 2J9FB 3L8EA 3WGQA 1KMIY 1DXHA 3QUCA 3ZLUA 2TMDA 2YHSA 2YU3A 3D4PA 1QDUA 3VKWA 4MJXA 4KNVA 1OGYA 3KYIB 1R6VA 4LG0B 4ZI7B 2AN3A 3HHEA 4R0NA 2CJYA 1RWKA 2KSQA 1KKUA 3TK1A 3O8DA 4HGZA 1ULUA 2NN3C 3BGWA 2JD0A 1LV7A 1D4OA 1ZP6A 2ZBUA 3GELA 5F0FA 2OCDA 1J7JA 4B7UA 1ZA1A 5EERA 2CW7A 4WI1A 1M8JA 4BEVA 1VQNI 4PXAA 3ZQCA 8ABPA 4KG7A 1XBTA 4I4IA 4DSUA 5CNJA 3Q3VA 1FLNA 3FLBA 4NZ9A 1YO5C 3EF0A 4MZXA 4IWYA 1HYQA 2P7HA 1N2JA 3WNCA 1SMYF 1UK9A 4MGHA 1UBSB 1D6JA 1JSLA 2VXYA 3GA0A 1WHTB 5I7UA 1E9EA 2VL8A 3KSDO 4BNGA 2H06A 1I1GA 2V6EA 3B6JA 3OR2C 1C4OA 4LRQA 4YDSA 2CMHA 2VXCA 4C2UA 1XD7A 5A4DA 3RJPA 3WLRA 3D8HA 2UVPA 5E1WA 1PDWA 2PL1A 5FO0A 5AD1A 1NW4A 1HRDA 3OM9A 4XKWA 3RVNA 5TRDA 1E2BA 4MS1B 3OS0A 6PFKA 5K0TA 1ORIA 5LSAA 3L09A 3TWOA 3VOSA 3E9ZA 5ILQA 5UKDA 2AHOA 1KQ8A 3NU1A 1R0BA 3W9BA 3QLJA 1XRNA 3SBXA 3EQ6A 3WNBA 3ABMH 1E8NA 2C8VA 1A4IA 3P19A 4B2IA 4BATA 4CZZA 1FYMA 5F04A 4CV2A 1W96A 2GA2A 3CTMA 4WY8A 2Q5CA 2NO7A 1A5AB 3PP8A 1T38A 1RPJA 1IPFA 4EY3A 4ESVA 4FGZA 4LXQA 4ZAXA 4KACA 2JCBA 2QY9A 4Y9TA 3K32A 2JWTA 1W5TA 1JIIA 4EJ2A 1SU8A 2AB0A 2DX7A 1E3DA 1UBGA 1H9TA 2KIFA 1PFWA 5JARA 3E5QA 5TY0A 2HOSA 3VPBA 2ZIUB 3DFZA 2SCUA 1F5SA 2YOGA 3UFBA 2P6MA 3EFHA 4YAIA 2XB0X 2Q9CA 1KQ3A 1V8BA 3VYTB 5IT3A 2OCPA 2FRDA 2XXJA 5M34A 2YWRA 4I6GA 4AZ3B 1XDSA 1L5SA 1ZM4A 4I1VA 1AQJA 1BXKA 1QGUB 4FCWA 4AM3A 4IGKA 3ECHA 3FD8A 4QJ3A 1E64A 4M1OA 3N70A 5P8WA 5EKTA 4EZIA 3DEWA 3TAUA 1SHJA 4RF3A 3SZ3A 4BTVA 3D2LA 4FEYA 5JASA 1G8HA 5LHGA 1OA1A 1YTLA 3IBCA 1BCSB 5AVTA 3IJRA 3VR4H 4WZAA 4LITA 2FPIB 2ZCUA 4X8HA 4JI6B 3IEXA 1DIOB 1WTAA 2CMFA 5G0TA 5HMLA 3VYRB 5KWIA 3FHZA 4J1NA 2XDVA 5CVDA 3U61B 4LN1A 3OYAA 1NY5A 1DQPA 4IFTA 4QLAA 1MUUA 1LX6A 4RCVA 3GPDG 3W6KB 1Q2UA 4J0DA 3AR6A 3NM5A 2C95A 2VK8A 3GFPA 2C1ZA 1A1VA 2GB4A 3BMOA 2WP0A 3V3KA 1GZDA 1Z12A 3MWYW 2WFLA 1VHLA 2H8WA 4GFBA 3SJAA 3TRIA 3D5EA 4R83A 4Z2YA 1WJAA 3BRWD 1QE3A 3SIRA 3OM8A 1HH4A 1RS0A 4ATNA 4Z7NB 1WEHA 3KKOA 4FUTA 5BVGA 3NHBA 3AXSA 4NCIA 4FTHA 4BO4A 3GROA 3DMYA 2QX8A 2ZXUA 1V5EA 2XZOA 1UCFA 4MQ5A 3RRZA 3RWBA 2FFJA 4EPXA 1D07A 4V2FA 4RF4A 3FVTA 3R5HA 4CYMA 2J33A 3IEIA 4NHEA 4JBNA 1RRPA 1YJCA 4X24A 3DOCA 2R6R1 3ZJYA 1N36B 3KM0A 1WHSB 3T9BA 2GKGA 1AQUA 3N2IA 4MH0R 4QOHA 4R81A 1BE8A 1Q7RA 1QQ5A 2GTHA 1V0JA 4S1OA 5KTSA 3NDJA 4MQUA 3NUZA 1DUXC 1DDOA 2X76A 1WJDA 2Z9BA 1LNWA 3C3KA 2CZCA 1LXCA 2RC5A 1XL0A 5HVQC 1ZGBA 1CZKA 3A25A 3DQQA 3O31A 1QV9A 2O2XA 4ZGBA 1JLHA 3HJUA 3H1FA 2EJVA 3F1KA 1OFIA 2AS5F 3D0SA 3L7OA 2DTEA 1U0HC 3OT1A 4BMCA 4A3GJ 3IWZA 2LCQA 1VYHA 2VK2A 4QLBA 2AKYA 1PG0A 4F6RA 3O21A 3N2KA 4HYEA 1YG2A 2N42A 4PGAA 3NHMA 1M1UA 2BVNA 1YYVA 2ZSIB 1E18A 3EZGA 4HTAA 1WUYA 1EDZA 1C2TA 2G77B 4YCLA 2QP3A 3V48A 2UYYA 2NZVG 4P84A 3I01M 4D9JA 2B82A 2QUHA 2G82A 3GFJA 3NIBA 4QICA 4TRMA 4FOLA 2VCEA 2RQQA 4WK8F 1NOJA 2QRLA 2VDVE 4AIRA 1JHFA 4E2YA 5JI3E 1TEZA 3DQPA 2DRIA 4KSYA 2P6RA 3R0IA 5FKNA 2XJ9A 3AF0A 2VDWA 5KTMA 2UZ4A 4R16A 4YALA 3IH5A 2XPWA 5IDQA 2NT3A 1HDIA 2Q4TA 1KBOA 2G09A 3ZTTA 1U5TC 3E2IA 5B66C 3M7IA 1DPGA 4FDMA 3E9MA 5AVSA 1VJDA 3FRIA 2OGUA 1KEUA 2C0PA 4OQ4A 1O95A 3F71A 4R1UA 2CJWA 1I4WA 5C8XA 3NFRA 3QHPA 2NUTB 2OGTA 3ROFA 4ZOLB 3TD2A 2OV7A 1TCCA 4I8XA 1VL0A 1ZUWA 1MB2A 3DEFA 4AU7A 1N6OA 1Y8QA 3ID6C 3L0BA 4JQZA 3UFXA 1YB5A 1W5FA 2R1TA 3Q0EA 1CY6A 2L02A 4JODA 1SEUA 1TYZA 2GO1A 5JY6A 2VRNA 3WFIA 4WCGA 4RBOA 3IV6A 4RKYA 1BFDA 2EW8A 2EWVA 3DAHA 3JQFA 4IDEA 3Q2OA 2JFQA 4GQBA 3WMWA 4AIKA 3GRAA 4LBWA 4S04A 1U0JA 2O2HA 1X7XA 4B3TB 2C9YA 5HBGA 3HSRA 4C7KA 1JDSA 3ILXA 5EPEA 2FPPA 2NVUB 3T4UA 5GQSA 1IBKB 1VE9A 3QVGB 3ZBUA 3JARA 1FJ2A 1EUCA 4HUQA 3FCYA 5I7VA 2FN3A 1YIAA 1FDWA 5B3JC 1WMSA 4GEGA 2REQA 5ALFA 4ZVKA 3OCVA 1Z35A 2HLHA 2O2JA 3FCOA 3HOYJ 1RBQA 4Y2GA 2MR5A 4EFKA 2X6QA 3CCBA 3RIEA 3QENA 2ESHA 3I58A 1P3Y1 2BEVB 1Y4UA 4ZYZA 5K1YA 5HJ2A 4G2NA 3RG8A 4QYXA 2CXTA 1W76A 4ZYYA 3I53A 3AEUA 3MJFA 4MWOA 1J8QA 3K1AB 4D9EA 1ZCFA 2BMAA 1KARA 1G3TA 4P3XA 5JS2A 2J30A 4DDWA 1RW4A 1A36A 1WCXA 3V7NA 5DLPA 5TC4A 5GP9A 5J5CA 1Z4NA 2W57A 1KI9A 2YFHA 5EL0A 2QM7A 4TWZA 3TQTA 3IHUA 3G8CA 5H3CA 1MNEA 1UP6A 3QWHA 1X1DA 5GONF 3N3BC 2I54A 5HQJA 4ZZ0A 4FT2A 1JR3A 4YAFA 3RIMA 3WK9A 1SG6A 3WE2A 5BR1A 1GFSA 2Y9YA 5EP1A 4X0EA 4XYEA 1NR1A 3HUFA 3UV3A 1WSBA 5DYGA 4IOMA 3S2ZA 1B42A 5IEJA 4H7IA 3QTBA 3WLHA 5C80A 3N8HA 4ZYXA 2WTEA 4GOLD 3BJOA 5AVJA 1ZH0A 4R1MA 3E9NA 3C98A 3FISA 1ZJJA 3JR3A 2C5SA 1XAJA 4KXNA 3SQWA 4J1SA 2XUAA 1UT5A 2JFFA 2GUGA 2CNWD 1VJTA 1LSSA 2K3PA 4EF5A 2XQFA 2PAAA 1P8JA 4J0IA 4EDHA 4ENWA 1K0UA 1IN6A 1TFUA 4MHOA 3KBBA 4EM2A 4K6OA 1DQNA 1GKLA 4H18A 2EJBA 3C14C 1XTVA 1A4XA 1NASA 3U3RA 2JUGA 4OHOA 2BGGA 1F0PA 4NC9A 1JNXX 3EF3A 1TC3C 1X0XA 3JYOA 1CUVA 5I3CA 2Z5GA 3VUEA 5E1DA 2LFBA 3GRCA 2AZ4A 1EDOA 2XIQA 2OORA 3K30A 2VIIA 2AXTC 1X3WB 4YCMA 3RPUA 1LBSA 3PHCA 3VR6D 1TZMA 4QYTA 4NMXB 3NHZA 2QTTA 4MUHA 4JH0A 4LVNA 3KQVA 2KPMA 2KIUA 1RKWA 3BIWA 1I2ZA 1WUTA 2EEZA 4JMPA 1EDBA 2D0PB 3K2QA 2FDRA 1L5NA 1IB0A 3IMGA 1AGPA 5LFAA 3MRVA 3ZLBA 4BX9A 2GTPA 2IUSA 1OWMA 1TPZA 1XRSB 5J59A 3S8EA 4A0QA 1WRJA 4RTRA 4UOQA 5KREA 2ZPAA 3FDYA 4RUKA 3QU7A 1X80A 3E5NA 2YNMA 3EPHA 1AKYA 3CZAA 1UKZA 4X1KB 4Q9JA 3REOA 1QAOA 3L0IB 5C3MA 3GVAA 1FVHA 3B1JA 2PXAA 3UNXA 2A9QA 2CV2A 4ZP1A 3FYDA 4DUGA 4X93A 1G3RA 2REXB 4XCVA 1XSEA 1UJ6A 4KOAA 1OLUB 1QLHA 1MJ9A 3G79A 2ZYUX 2HPVA 4IMPA 4ON9A 3VVMA 3OOEA 1FWZA 1JWAB 4JGGA 3DKRA 2F1KA 1ANKA 4ZOCA 4WEOA 4B73A 1TJPB 2CE7A 4FMDF 4X3PA 4LB5A 1ABFA 1ICEA 4JUCA 2PZFA 3OU2A 1EFRA 1AU9A 2XE6A 4OMFG 1F1ZA 4HL6A 4J6EA 2FWJA 5ABPA 4NBLA 2NXJA 2HRCA 3I3OA 2E2IJ 2OO5C 4MAMA 1G18A 4GX2A 4DCSA 2NAPA 2M98A 5TMDA 4P83A 4DLKA 5HZGA 2IYFA 4LE2A 3KDAA 4V0ME 1ZNWA 1JEYA 2CLCX 3IIKA 1VL2A 3FFXA 3WLQA 2DWCA 1KU9A 1OQAA 1C9NA 2VE9A 2B0CA 3M2PA 3ZZMA 4AVYA 4HQNA 3L8ZA 3IGFA 2RHDA 4RMIA 3LFTA 2ORED 5C8YA 1K0FA 4KIGA 1MDBA 2AGVA 3BR0A 1O97C 4JROA 3RSZA 4IZIA 3SYRA 4XDHA 3DWIA 3UM9A 1BX1A 1FSPA 3MPUA 4G1FA 1IHUA 4BU2A 5C1PA 5KMGA 2FOLA 4LIUA 4ZAGA 1NUPA 3BSWA 4DWJA 3KAKA 2STTA 4RB3C 1Z29A 1S2LA 1GRNA 4YJDA 1NRJB 1W8IA 2REOA 2QENA 5ALQA 5HKKD 1PSZA 2FNPA 5A6SB 2HJWA 2XGEA 3VXKA 3L1KA 2YJZA 4ARZB 1WPGA 3FLAA 4HS4A 5AI8A 5DCLA 3S1MJ 3A1DA 3B6AA 1L1QA 2KM1A 4MW5A 2XTAA 4ZFNA 1CNMA 1C4WA 4ZHQF 5CVTA 3WGHA 4Q4AB 5JR3A 4FISA 1L3BA 1NN3A 1U3UA 4DV6B 2I2FA 4LY6A 4Y9DA 1UPTA 3BIFA 3UN1A 2NU6B 1BDJA 3D2BA 4GP6A 2E4WA 4TV9B 2Q2EA 3Q9UA 4CCYA 3Q41A 2NU7A 5HIIA 4JNKA 4BY7J 4L5CA 1OBHA 2VI6A 3WTZA 3G9TA 4ZC8A 1ETYA 3N2EA 3ENKA 2P4EA 3LNCA 2VBIA 2YL2A 5GOTA 4UUVA 4G9YA 2ETHA 1ATZA 5ESDA 3R3ZA 3TTXA 4I8DA 1BD3A 1LVGA 3V4GA 2XGOA 3ZDCA 2DPLA 1OX4B 4N12A 2Z3VA 2AG5A 5ELMA 3BGOS 3DGEC 3BWYA 3HL4A 4H08A 4FKMA 2PJZA 3ZJ4A 1PDNC 1E4YA 4GGMX 2OXEA 2JGJA 1UDRA 2J0VA 1VZ0A 2GFHA 5DX1A 3FKSA 16PKA 4ER6A 4LXYA 1A82A 2IPLA 4HVAA 3UWSA 3UJ9A 5BQTA 2IPOA 2EYQA 1J2XA 3G2OA 2Y1WA 4M9CA 3P2IA 3PO3J 3HFJA 4FJ0A 3ZIDA 1NXOA 4JENA 5HP4A 2H1WA 3JQBC 1Z88A 2B5VA 3NUGA 3VJMA 1YFKA 4P7JA 4B2PA 2BFAA 2GZAA 4BMPB 2V45A 5EUMA 3CMYA 2P4WA 4AMGA 4NCJA 1OLOA 2LIVA 1M10A 4YV2A 4MEYF 3H9QA 2YMLA 2NUAB 3NT2A 4KWIA 1E9AA 2H3HA 3U9LA 2WDPA 1RTTA 1IRFA 4CF3A 2II6A 3RUIA 1MJ5A 4MTLA 4CL2A 2M7BA 2BGUA 3NNDA 3T9AA 1W0UA 3F6CA 3S4YA 1LNZA 1ZD1A 1UPAA 1BAPA 1NVTA 4M83A 1RVV1 5CR9A 2J48A 3PYXA 1ZK3A 4AZWA 3GCDA 1VXOA 2CUTA 2BI4A 1Z8DA 3U13A 4NMLA 4PQGA 3LX8A 3MIIA 1E7SA 1I4EB 3GVCA 3MMZA 4CA0A 4M3GA 1W30A 1UG2A 5L45A 3M3HA 2JHGA 2PV0A 4R54A 5AOAA 3RRFA 1XWFA 1R5ID 2Q0OA 3WO0A 1UAAA 2XKJE 4MWGA 4IPTA 3PCRB 1TA9A 3TIFA 1JHRA 3NHYA 3OHPA 4PO3X 1AMOA 1LRLA 2VJDA 2VQFB 4G3XA 3TSYA 3VNBA 1ODFA 3AF2A 3CO0S 5EKDA 4NABA 2A0XA 3PENA 4MV6A 3UJDA 2JRTA 2ZTSA 1SUAA 3TGLA 1U5TA 2OZUA 4KO2S 3OUUA 1XR3A 1FMTA 2CFXA 4WW0A 2PXXA 1IRZA 1U7ZA 3UGQA 1AV6A 5JFGA 4DRYA 4AUMA 3DUFB 1TUIA 4KT5C 3L2RA 5DTMA 4LUCA 3WLLA 1RVDA 1RBMA 4ARCA 3L9XA 2I6TA 2GILA 3T7JA 1HR0B 3L84A 4DTIA 5B58C 4P2BA 3HJBA 2JFVA 1HDPA 5JCPA 2FEKA 2ID7A 2B3DA 2J3HA 1N5JA 4MPTA 2PPLA 4LX0A 1X15A 1QRSA 3DBHA 3ILVA 4G56A 4MWTA 4NDNE 3ZV7A 1GVNB 4JDPA 1QG6A 1P5FA 1F4LA 2IEGA 5BV0A 1BEEA 2PBRA 3TW6A 1YJNI 2QLFA 5JSFA 4RDXA 2ZRIA 2OK7A 5FBLB 3VH3A 2BZ1A 4JYPA 1HQDA 4AU1A 1UAGA 2O4UX 1GPDG 2O8NA 1UQUA 3DVAA 1SXJE 2ZKLA 4YRTA 2H2GA 1LDJA 1XL1A 2FRVA 2JBHA 2GT1A 5B3JA 3I4LA 4R5HA 1LDDA 3EIEA 4C2BA 4LPKA 1V5FA 2FQ4A 4KTTE 1QBJA 2VT2A 1NXQA 4EUSA 4KP7A 4WZZA 1JNYA 2NO9A 4JLDA 4Z4IA 3IHKA 1JT2A 2FMIA 1XE3A 3BJIC 4K0KB 3RCOA 5JAQA 4U6QA 2RGDA 5BSVA 2VA9A 1Y6FA 2X4GA 1W4AA 1XMJA 1TD9A 2RJOA 3OJEA 4FZVA 5EWMA 1I33A 3QKRB 1SUSA 1YCGA 5JXJA 1F0YA 4S1VA 4YT4A 5IP6A 2QVYX 3CJTA 4ZIRA 4XYLA 2LW7A 1GTSA 3IIEA 2AKAB 1TVKB 1SXGA 3KEMA 4RSHA 3SQDA 5EKSA 3ZMVA 4EG1A 2D1FA 4EM0B 1LLUA 3IMFA 4PRKA 2CJPA 3LCJA 3JQGB 1TT5A 4FI3F 1XGNA 3GW2A 5D3ZA 5FKMA 4NQWA 2Q5OA 1Z6XA 2J3DA 3VNVA 1Q7CA 4PZZA 1ISMA 3GUVA 4DCPA 3RYCB 3TEDA 2WMNB 3SJCA 2VPLA 4RAGA 2HLPA 2YQ4A 4V3BA 2FTKE 3MZYA 1FP4B 1EEHA 4NBKA 4HUJA 3TQSA 4BZPA 4HRAA 4JYZA 3DBLB 3EEIA 1BS1A 4KXYA 1WMFA 5TVKA 5EJMA 4IRMA 1SKYB 4CICA 4I8IA 4RQUA 2CXSA 5KQRA 4J3JA 4RA6B 2O1XA 2UXCB 1W4ZA 5HDGA 1D0SA 4ZAZA 2GX6A 3DZHA 3E22A 2XKBA 5FPPA 2BTEA 3IWFA 2EKZA 2WFZA 3UB2A 1C80A 1ZN7A 2GH1A 4QPPA 2XLCA 1FDUA 1H8HA 3KYLA 4Y2QA 1P19A 3VMFA 4ALLA 3BWEA 1RKBA 2X9GA 2GA9A 3AF3A 3AQIA 4WXDA 1KZ6A 1Z13A 2W83A 1ZGAA 5EKUA 3T9FA 2QG9A 3IBSA 3ZCVA 3EBOA 1B72A 2YS7A 1A8HA 1RP1A 4JA2A 1NDQA 4RPIA 3I55I 3SDGA 3L49A 3DAOA 3PNYA 1B00A 2AZTA 1YS7A 2H6BA 1UEJA 3H5IA 3DU6A 2HQBA 2VPTA 5DM2A 2G0NA 2Y4NA 3VSDA 3WP0A 1TP4A 4BEHA 5FO1A 3UJ8A 4TS1A 1DCMA 3R7LA 1QX3A 1DKOA 3TQOA 1YOBA 4PG6A 3QUQA 5E3NA 3ADOA 3ZMSA 2WB2A 4PTYA 3R0QA 3IX7A 3MINB 1U28A 1V47A 1QWOA 5JQGA 4G8JA 3RSCA 3HRKA 5F08A 2WU4A 2ZRHA 4V39A 4YP6A 2V6GA 1RHMA 4G5GA 4DNFA 2WQ7A 4YASA 2IS6A 5BOSA 3RHZA 1BC8C 5BSHA 3FOCA 2DFNA 1W4RA 1NXSA 1JECA 4LW8A 3I2IA 1GKUB 4CKBB 4YRIA 4B4OA 3AI7A 4MGEA 3SXPA 3D0RA 3TKAA 1TEHA 2ZRAA 2BC9A 1XB4A 4PUSA 3AAFA 1P9NA 4YJGB 5LP6F 3B60A 2RE8A 3CLTC 1B59A 3AUTA 2HMYB 3A9RA 5EXTA 1JKRC 4KN9S 4QKQA 4R3UC 2PMCA 5FWYA 4YMLA 4TL8A 4TWBA 2C42A 4CG2A 1UXHA 5IYZA 4FQ5A 2C2YA 2R7KA 4RNDB 2NZJA 3MTDA 1HK7A 3X1YA 2F64A 4I5EA 3B5EA 3NYWA 2OO5A 3GT3A 3M4YA 3K4HA 2XA2A 4QAQA 4Z9FA 4B6FA 1ZYUA 4I4TA 3U6KA 5IJ0B 2V74B 3BEOA 3KYDB 2AJDA 4LISA 4DLLA 1OILA 3QU9A 5ALUA 2OZVA 4IUBS 4F1WA 4KHZA 5CGZA 2J67A 3KLOA 4NQRA 4MK4A 2F4NA 1AKWA 3OLZA 4HEJA 1YX5A 2F48A 1KQPA 1IZ8A 4EG0A 3ECOA 3F0TA 3ANLA 3H2SA 3OMLA 5L95A 1RYZA 1VOTA 1KOLA 5IRCD 5I8ZA 1PX2A 4DJTA 3B7WA 2GD0A 2VYCA 2G40A 4C08A 5F6FA 2Y0MA 1TU4A 4MEBA 2HMSA 1SPXA 2QRVA 2ODBA 3LSYA 4KN6A 4BMYA 2AG1A 2NSYA 2O9LA 4JV5B 1ST2A 1H1LB 2ORVA 4MWSA 5I7SA 5AJYA 4YPFA 1EWQA 3HQ4O 3F6BX 4IMJB 4RK4A 4Y2VA 2UU9B 3VO9A 1O95D 2H7CA 2IA2A 3KPJA 1DG3A 2RHRA 4K6KA 1QTQA 1PFYA 2XJ4A 4B7CA 2HI0A 3JQAB 1KDVA 2E7ZA 1UKEA 2Y48A 2NUPA 2BFDB 4OYLA 4XGIA 1WJCA 1LTQA 2GSWA 4BAYA 2ZI6A 3EOAI 3B1VA 4MQVA 4DPKA 1YSCA 3JQRA 1BQEA 3TO6A 1OCEA 4JI0B 4KQ1A 3GHHA 1H66A 2O8CB 5J4VA 2JIRA 4L4XA 3QVWA 3VJLA 5AJTA 3NCHA 2HF7A 5D6OA 3UT0A 3DWEX 2CNWA 1JUMA 1GADO 3D5RC 3UXHA 4JWTA 1QAMA 5JAPA 3KQWA 4RZUA 1SXJB 2LV8A 1EGAA 2MIIA 3HNPA 5BPDA 2YS9A 4XIIA 2DBBA 4RF5A 4P92A 1T9BA 4I50F 4D0SA 2NO1A 2PAFA 1YCHA 1H9CA 2ZSEA 2EOAA 1Y80A 2RAFA 3F8WA 1T39A 3IV7A 2LIPA 3FWPA 4S1NA 3I39X 1VBNA 2LH9A 3HXKA 4TLCA 4A0GA 4PPGA 3AEKA 3M9LA 3HEBA 5K3EA 4NLLA 2H1RA 2WNIA 1FBQA 5M3FJ 1QYVA 2WAFA 2FZ5A 4WFIA 1MBKA 1V4NA 3V2HA 3DE6X 1MHTA 1ZN8A 4UBJA 2WV7A 2JZYA 1Z5VA 1EM8A 4EUHA 5FUMA 1VTNC 3P4YA 1VL5A 5KNBH 3ZE8A 5J1YA 4ZO6A 2BYTA 4R05A 3ZR4B 2ZJPF 2NO5A 1OH7A 4YIIA 1Y3AA 2JIZA 4KQ2A 1PR5A 2P9YA 1G6KA 4I0WB 3FF1A 2VUUA 4AIJA 2WJGA 4IPAA 4BNDB 3MKWB 5E2BA 1UAYA 3BDDA 2G9RA 3CVOA 2PRJA 3H19A 1CUAA 4A93J 4PTZA 5IWCA 4AY2A 2J9ZB 2QGFA 8GPBA 4UBMA 3FTNA 1JR3D 3JVEA 4CIWA 4J9UE 2I7CA 1QU2A 4IRIA 4TYYA 4KMFA 1KYXA 1MFPA 2PBZA 3TIIA 1Q2XA 4FT4A 2JFXA 4MKZA 1MORA 1QZTA 4M7RA 5IY5H 2R4TA 4ENQA 4NJMA 1T5OA 2V4MA 4R9VA 1Z7WA 3SSMA 3HJEA 1E2NA 3NORA 3U1TA 3QPTA 1I80A 2LY2A 4L9TA 5K9ZA 1OAKA 4TTVA 2IHJA 1ESDA 4ZALA 2QE6A 2ZRJA 3CJNA 3AP2A 5EA2A 2QSYA 3FXAA 4JJ8A 4OKSA 2P27A 4C0QC 3H2JA 1C0LA 5CT6A 3TBKA 4MKIA 4DZZA 4GYGA 1ZJ4A 2NU9B 1NJ8A 1X39A 1A4RA 4G86A 4JZYA 1QHHB 2FSGA 1N5DA 1XT6A 4CEJA 4F7DA 5FJ8J 2NTYC 3KD3A 4PZ9A 3MK31 1BVUA 4ZKEA 1RDFA 3CNBA 3LGSA 1U9NA 4AJ4A 2Q7XA 3HOVJ 2POQX 3MBOA 4ZRNA 1V8OA 4F8JA 3BZBA 4MP6A 1G8PA 2AVNA 2YWFA 3UKJA 1NI4B 4ESBA 4ENTA 2J46A 3CF5F 3OFNA 3S5JA 4D9HA 3TNYA 3D5TA 4LK1F 3J81A 5F12A 3IQFA 3RPUD 3K5WA 5HJ7A 3UMGA 4KUEA 3LKZA 1E0JA 4X63A 3AM3A 2WJ3A 2XQGA 3GGPA 3NC4A 4NR0A 3IFSA 1FMFA 4FCYA 1XVIA 4FSDA 2VOPA 1D0ZA 5CA0F 3KKKA 2TRTA 4XIJA 1AHPA 4DDTA 5HCNA 1TWCJ 3Q8XB 3WGOA 1BVRA 4DR4B 3PPWA 3CZMA 5KWSA 1J5EB 2I5PO 3D3EA 3EUEA 4RULA 4JXKA 2YNMD 1ZRMA 4IQ8A 2P91A 2Q6VA 3BG7A 4X62B 1VHJA 2EX4A 4ZVLA 2XAFA 3NOVA 3F4BA 4U8HA 2VFAA 3ETGA 3UAWA 2ZG6A 3OOHA 4D82A 3KTAA 2GAAA 3CD6I 3WDLA 4DUGD 2VIXA 3HXOA 3ZGLA 2D5CA 3WGUA 4XM0A 4X0GA 1ZJ6A 2GJ4A 3UC5A 2DMNA 2ZVQX 5REQA 1GQSA 1H1TA 2AQIA 1E0AA 4XUEA 4M0CA 3TDUC 1E6LA 1UFKA 5JXHA 2CXNA 2FA5A 1FUIA 2A6TA 5CFMA 1KZGB 5EZ6B 3HZHA 1JZSA 4ZDPA 2EV9A 2FP3A 3WYFA 5HFNA 2X3UA 2JUCA 1CVRA 2R6GA 5ERXA 1EFRD 4QGSA 2MD0A 2O8BB 3GW8A 1A7UA 4PG7A 1PEKE 3WC4A 4OA5A 4I1PA 2QLZA 4BVLA 3DOFA 5E6UA 5L3QA 4KN7X 3NWSA 1CUJA 1QHSA 2QZZA 2NS7A 5ITZA 2GGSA 2MSEB 4U2DA 4UCQA 3UZUA 3RRNA 2C3OA 4BP1A 1TI7A 4CBVA 3LX5A 1TX4B 4NRDA 3M82A 3B3FA 4QNRA 4UE6A 1WKBA 5K6TA 4MGIR 5YASA 2C94A 3EC7A 1YZKA 1XMOB 2BY1A 2A67A 4CTOA 3FHNA 1DADA 1W0KA 4PR3A 3LXXA 1XMPA 3N7TA 1ISIA 3PFFA 2KIQA 2J3JA 1SEPA 3IEVA 5IF3A 3E1GA 1RLOA 3FPBA 1PL6A 5GV7A 5FFNA 3GJRA 4DA4A 1LF5A 1Q1AA 2HRRA 4YJ2B 1KEPA 4M72A 2OXFA 1T6ZA 3E27A 2FBHA 3KC2A 1EVLA 4RVHA 4N9IA 1DLJA 1HL7A 3K8YA 3KB2A 3E7DA 5JCOC 1GGNA 4UEKA 4MKFA 1JLSA 2FEPA 3NV7A 4E21A 4LZPA 1RLUA 2E7WA 3FWYA 1TYCA 5LLQA 4UASA 2AIRA 4JMLA 1QK3A 5JUWA 1N6KA 3KSUA 3DHVA 3EZFA 3DDSA 3EPJA 3DYBA 3KNZA 2QYOA 3OS2A 1H69A 3JWGA 3BHJA 3LUFA 3X1KA 3RAEC 5LUAA 2EBIA 1QO7A 4ZH4F 4CUGA 3CWCA 3WX0A 5J2TB 4GCVA 1FFBA 2ZSDA 3DKPA 4HQOA 3T0FA 2DULA 1EKEA 2BGTA 1SAUA 1SD2A 3RC7A 3EIUA 4EPYA 1XWWA 3B53X 2ZYTX 3W7AA 4JBGA 3ZJVA 1M7GA 1XZCA 2ISSD 1JW9B 1MRNA 4WXHA 5TPZA 1L5OA 1N6IA 1HMYA 4Y3OA 4E5DA 2XGXA 1P2UA 3ASVA 1LFAA 3IH4A 1L7RA 2QEQA 1I7QB 1YB1A 4FEAA 3FKSD 3LIIA 2BFEB 3HA5A 1NMZA 4PSWA 3RSNA 3C0KA 1XZEA 3CY6A 4NBTA 1N5IA 1I51A 4CKEB 1MZPA 2GBLA 3SVLA 1Z08A 2H1HA 2ZRLA 1IQRA 3DVSX 3JATA 2XDQB 3V8PA 1L4MA 4RU1A 4FOTA 4NEQA 1QIGA 1XZHA 3HDHA 3EBLA 4KODA 3RSGA 1TQMA 3VA7A 5IT9Z 3RV4A 4F91B 2BEOA 2R6AA 5AYVA 3OZBA 3X2EA 3OJLA 4INJA 4XOTA 1WV1A 3ZIAA 2QSHX 2BP7A 3CG0A 3L04A 1RM4A 2CS3A 3LBNA 4FYIA 4Q7KA 1ZH5A 5INTA 2BE9A 3EX7C 4FCCA 4IGAA 3H5RA 4PCUA 4BHCA 2OAQ1 2QVOA 2WYUA 3KLPX 2SICE 1VKJA 3PZBA 2ZRDA 4HAZA 3E7LA 1U2PA 3Q11A 1RXUA 2ATEA 2H1OA 5FPHA 5F1YA 4IDQA 3K0HA 4IG4A 2B2NA 3EAFA 3GTQJ 5JU6A 2JLQA 5HK8A 5BPFA 4Q4JA 2Y2UA 3G3EA 3S16J 2FOKA 1FTWA 2I66A 2AUMA 1N2ZA 4IIEA 4B47A 2EG9A 3ZWAA 1LFUP 4JHLA 1O96B 1FTQA 3ZDFA 3D0QA 4Z99A 1R18A 2WTUA 1JHXA 1SBCA 1YRNB 5IP5A 1LVKA 4NXMB 3WIUA 4GPAA 5HW0A 3LFKA 4KDRA 3B7PA 1I1NA 1NVWQ 3HN2A 2D5AA 1N6HA 3V1NA 3E9RA 1YVUA 4FWBA 4BPBA 3UQYS 1JKPC 5ALVA 4UB8C 2GF2A 2QOEA 3H05A 1QHYA 2A5LA 5GVRA 3AOEC 2VPYA 3C8ZA 4XR6A 4I6EA 3DCJA 4YI5A 3TXXA 3AX6A 3ZRGA 2OUKA 2N9UA 3ISVA 3IAXA 3S3OA 4ND8A 4Z8XA 2M32A 3ABIA 3TGWA 1DC5A 1Z2OX 4DVGA 4ANJA 1PUFB 3E6CC 3RABA 3KJNA 4M0MA 3NAUA 5F7ZA 1XP8A 2VJJA 3DE7X 3FPHA 5FI0B 1TU0A 4UZFA 1K6YA 4UHFA 4C0WA 1NC3A 1XPJA 3T6KA 3FTPA 3GXBA 5JY1A 2PVPA 3F21A 3FTFA 2B7LA 4J3NA 2VZEA 1ONOA 1Q84A 3FLMA 4RIFA 1V54H 4BV3A 3F0CA 1YW8A 1NYQA 1E4OA 3AT1A 2OC4A 5KKNB 4J4TA 2OHIA 4YCSA 3TDZC 3LSRA 5EJ6A 2FXIA 3HCPA 2GRUA 1OXTA 1IXCA 2AXQA 3WBJA 2C00A 3LSPA 2C5AA 2DCEA 1J1UA 2UVQA 5CT9A 3FWNA 3X1XA 2ZJ3A 3QBVA 4XLNF 3B9BA 1EEXB 3QXCA 4LRSB 1UPCA 4N5HX 4TSRA 2JRMA 2VJKA 3VUFA 5EJEA 4A23A 1T36B 2IYEA 1AMNA 5JWRA 2O3RA 4UREA 1GAQA 1BL0A 4FFMA 4NE2A 4PBTA 1KFBB 2Q6OA 4GECA 4O5AA 2PRIA 2QORA 4EI9A 4F0JA 2CLSA 2W7TA 4BNLA 1CFJA 1AMUA 4ZGWA 2XNDA 1OB5A 3OX4A 3A4YA 1FPQA 4KQKA 5DNAA 2ES4A 3FXKA 1DEOA 3SIPA 3BC1A 2XBMA 2FMLA 4LYDA 4RAFA 2EIMH 2ZYWX 3JV7A 1Q1BA 2JIBA 2EQRA 2OFWA 4O2RA 4NV3A 5IH3A 1M2WA 1JIQA 3OQIA 2XPVA 5FLVA 2F90A 4LVUA 4CMJA 3RYIB 1VECA 4ZO7A 5MHTA 4NCNA 2IDMA 2BKVA 3TZCA 5KCZA 4DZPA 1F20A 3VU1A 5K09A 4QTUB 1QZXA 4Q9LA 1MNDA 5CMLA 5CLLA 4YRZA 1JBEA 1Z18A 2LBPA 3O3CA 4Q9AA 3KHTA 3VNQA 4QIWN 4R3WA 4O4HA 4JA0A 3K0SA 4V1CI 4XRSG 5FNZA 3S8PA 3DDCA 1MH4A 3MC1A 1T0JB 2ORIA 3DEKA 1KJWA 3CW2A 1WFXA 2IW5A 4DY6A 2HHCA 2JKYA 4QJIA 2ZB2A 2R2GA 3KCCA 1CJUC 2ZPTX 2NYXA 1W9MA 2EZHA 5JC1A 4N1AA 4MNTA 3ZCXA 4IX9A 1RXVA 1L4UA 3IIMA 5DTDA 5E1XA 3MELA 2VQSA 2WWHA 5CFQA 1JJFA 4EPTA 2P69A 3ANNA 1TO2E 1LS6A 3NHUA 4V0KA 1RQGA 4IBOA 1G3SA 4KFSA 1I24A 2G7HA 1AQLA 1H8HD 4B76A 3U3OA 2DQRA 3SS7X 3KR2A 4KE9A 1EH6A 4H4EA 4C0KA 2CVQA 1Z4IA 1PRYA 1HL3A 4CG0A 1XXHB 4BLPA 1PR4A 4RGQA 4A0YA 1WMEA 5LA6A 1FQJA 4F3NA 3ZIUA 2O2EA 4KICA 2TRSB 5DWVA 2Y92A 3MUNA 2E1MC 4WNCA 1F17A 3E3LA 3B6EA 3DU5A 2E2HJ 1YJ5A 3O4IA 3UW1A 4IHSA 5LLSA 3OJOA 1E98A 1UC5B 4D9BA 4B3HA 2HXIA 2W5UA 3U5ZB 2ZSHA 2EP5A 3UNGC 1SO8A 3HWSA 2GAFA 3UJ7A 4NAVA 1G5QA 4XDZA 2CNBA 2WMYA 4JY7A 4XD2A 4GD3Q 4WA7A 2V9VA 2XEDA 1V45E 5F1JA 1BHJA 4YV7A 3I6ZA 5G0VA 3RK4A 3OZAA 5FULA 1FT9A 3N6XA 4YLGA 1V5GA 1NIJA 4DLRA 4LYEA 1FVFA 4H60A 3LDUA 1ZJZA 3GD7A 2FUG2 3GJYA 2AEEA 4KX5A 4C6RA 1R6RA 1A6QA 3KWLA 2BISA 4HLYA 1G9SA 2D0DA 4RK5A 4EBBA 5BW6B 2MWMA 2VPZA 2K87A 3V8NA 3LA8A 3MKYB 2YWHA 4FJ2A 3AM5A 1C1HA 1VL8A 1BS2A 3EMBA 3T7IA 2X1CA 3U37A 1RAAA 4KQCA 4YH1A 4JUIA 5DE3A 2CKDA 3RO7A 5IULC 3PTAA 4RD2A 3I1FA 4NMMA 5CURA 1C0IA 2D8MA 4LHYA 2VWGA 3BXOA 5KK1A 1RRKA 3KELA 2ARKA 3JQ7B 3LV8A 3HCRA 4B6GA 3ZN0A 3KOOA 2W85A 2EZ9A 5SYMA 3COAC 2XQKA 4D9NA 2Q29A 7GPBA 2M9HA 4Y30A 3I1IA 3T4XA 4J19A 1Q1GA 5E6SA 1YA6A 4LA4A 4IHQA 1U2GA 3CP2A 3EW9A 4AQYB 3KVNA 5BR7A 3CZPA 2R60A 2DQLA 3SX2A 1A5BB 3INYA 1KMHA 1Z28A 4QVIA 1USIA 3BHIA 1IXSB 2HTFA 4CZCA 3HG7A 4C78A 2JLBA 5JSZA 5BV2P 1P1BA 2HMVA 4IDCA 1K6MA 3FG9A 1CUBA 3PRKE 1BA3A 4J49A 5C7YA 4UD6A 1C7ZA 4EO9A 4PHTA 1I8TA 3CNQS 3OIQA 1AC5A 1HTBA 3FJYA 2BY0A 1W75A 5DI3A 1R64A 2XXBA 5JNUA 4KR9A 2RH9B 2X6RA 4UDNA 2X6OA 4MI6A 5SICE 1FU8A 3QVXA 4N6GA 3ODPA 5B3SH 4EFNA 5ENDA 4ENVA 3OC6A 4LYHA 2QQAA 4DJJA 4IIJF 5JVGF 1L0BA 3VYSB 2SKCA 4EPVA 4OQNA 2PD4A 3IVGA 5ALTA 5KVQA 3JQDA 1U11A 2EFNA 3VTFA 2AI3A 4NZMA 5JCOA 4F21A 3QFCA 4W5RA 3ZR8X 4Z2AA 5FWXB 1ZH2A 3DFFA 1EFVA 4OP1A 5HGJA 1JJAA 4GXNA 1C7QA 4FYHA 3DHEA 4UMEA 3L7AA 2EZKA 4LJ7A 3TF5A 4LJLA 2WJ4A 4YBZA 1P0CA 4YJ3A 2NG1A 1R1VA 3ZGZA 1L5GB 1E0KA 2CBZA 3PQEA 3SS8A 2EFPA 3QQAA 2GN8A 4Q4LA 1Z36A 2Q3DA 2BFCB 3PX7A 3CX6A 3BWDD 3HIFA 3O6BB 4KLRA 4D42A 4CCAA 2RARA 4L9VA 4U7BA 3KQTA 1Z3IX 3W1WA 3UJCA 4M37A 4NATA 1VCIA 2HREA 3E5MA 1NQXA 2JLAA 4ZZDA 3W8NA 3ROMA 4MYHA 2MSYA 4PLCA 3PIOF 4F5YA 1X0VA 2AMLA 3SVTA 3QOEA 3O03A 1KQFA 3MMNA 1TAQA 4K6HA 4QUBA 2NSHA 4CMHA 4RKRA 1V55H 4DGWB 3HBJA 4Y33A 4B3BA 3FR8A 4AWAA 4EJMA 2VLAA 2R4GA 4X71A 3C6MA 4KQMA 4FSHA 2BL4A 5LBIA 2DDBA 3RADC 2I0FA 4P9FA 3CLSD 3SSAA 1Z5GA 2Q5HA 1RZ4A 4BRSA 2WLTA 1OLXA 4GEKA 3R09A 2GAIA 1MD0A 3L01A 1YULA 3IR7A 3P2OA 3DV2A 4XL9A 1JAHA 1SQGA 2MABA 3O8OA 1EGVB 2JIZD 3VKHA 2KQRA 4XARA 1SEVA 2K4JA 1LZLA 1ZMTA 5C2JB 1VE3A 2OC6A 4K03A 3AY0A 4UHHA 3OHMA 4B7AA 1RWBA 3LU1A 2HLDA 4Y6RA 5AP9A 1HYEA 3LYUA 2Y0DA 4JK1X 3EEBA 3KAQA 1VCHA 2PX4A 3HBFA 1JFVA 4WBNF 1ETVA 4V0OA 1GNVA 4OKNA 4A8HA 2DQKA 5BV8A 1BIFA 3F2IA 3O47A 4XEHA 1CK4A 4GC5A 5KQGA 5DLYA 4RJTA 1MTOA 2J1LA 4BHPA 1OFTA 2B21A 3F6SA 4W7HA 2NTEA 4UTRA 5HR5A 4BL0B 2IXBA 1P7PA 1UMQA 3JAMZ 1U80A 3FMRA 2ZUBA 3KDSE 2F17A 1C7JA 3H1TA 4Z54A 4E14A 4CJXA 3V8JA 4HYQA 2AHRA 3ZDYB 1W5EA 4W63A 3ZU5A 2Z95A 2YXEA 3ZWNA 3OEYA 3TQCA 5LD2C 3EWAA 2RIRA 3PSIA 3B9RA 2QUKA 4JSRA 2FD5A 1DC8A 1UJ2A 4IHAA 3L93A 3HYRA 3AWDA 3RNOA 6GPBA 1DAPA 3MCAA 4COOA 1TF5A 5AVVA 2OCCH 4WECA 1GXQA 2RI1A 3ZD9A 2BCEA 3GGCA 2D6FA 4AKIA 3KJGA 1XJWA 2HKIA 2ZUVA 3GHYA 2V9KA 1F51E 4HSTA 4E3ZA 1WJ5A 3BREA 3ZH9B 3OFND 3AOEA 3VKVA 1R88A 3K9WA 3X3HA 2NVXJ 4H77A 4BKMA 4X6AJ 3A31A 2XMDA 3EDOA 2KYRA 2IYTA 4EY5A 2FWRA 5IS2A 4PR0A 3CKLA 3Q3EA 1HDEA 2RKBA 4S1WA 4HEQA 3RB8A 4PIPA 1FUUA 3IE2A 3J7TA 1PJLA 1LNQA 4GXQA 4ZVPA 5DGIA 1U0OC 1TU3A 3PQKA 1TZBA 3RT7A 1NJ2A 3PL8A 2GERA 4OB7A 3FOEC 4KLNA 4UAGA 3CW9A 3IUPA 4K26A 3DMPA 1E4EB 5TMEA 1GM5A 2GCPA 1BN5A 1WSAA 4KZPA 2ALJA 1SKYE 2ECFA 4CIXA 1GQOA 1JYSA 3JALA 2AF3C 1DUSA 4J75A 2QNBA 2RK4A 3TTYA 3WIOA 5FORA 1JG6A 4O59O 4MQ9F 3U4GA 3P2EA 2R8PA 2OCIA 3F8MA 1C8BA 2W2TA 1GLNA 1OX5A 2HA5A 4JBIA 2RNJA 2QA4I 4AMZA 1BYIA 3C4QA 1P2TA 1F48A 5DK4A 2H5IA 2WY7Q 5FTWA 1QHNA 3ODGA 1FIAA 3KHKA 4RVNA 5HKLA 4OHWA 4C3UA 3VGPA 5E1ZB 4ENSA 4Q66C 2A86A 1SN7A 3N0RA 5FTJA 1PR3A 2PMBA 5CHEA 4IHWA 4EG4A 2W6PA 2QF7A 1QB8A 5HILA 4DEXA 4AIDA 1U1EA 1U0LA 4JEIA 3FPKA 3PVZA 5EJ7A 1S72I 2M0MA 1H0RA 2ODAA 1ISSA 4XWKA 4IV8A 4HH3C 2P5LC 4F93B 4X92A 1M83A 2WQ6A 1O7JA 1PZXA 1D2EA 4RK7A 3HRHA 1TWAJ 3BGIA 2VQ3A 2HSJA 2W93A 5BPHA 3QPHA 4E7LA 1Z0KA 3BCAA 5JNSA 2X4HA 2IYAA 5KOHB 3C5VA 3UH1A 2JAOA 5KEIA 2OOKA 1JJVA 2GBCA 2BZGA 1E2EA 2ZXIA 3V4VB 4E32A 4QT4A 1VE1A 4DRXB 4H1TA 4NNPA 3ESQA 4RELA 1W0KD 1N8NA 3NHAA 2QSGX 5K3SA 4D1YA 2YXNA 4GVXA 3ZQHA 1M8FA 2OYSA 4D3DA 4UUPA 4Q82A 3R76A 2WV9A 3SGLA 2UYHA 1N6LA 3ZMTA 4G85A 3NDPA 3TOZA 4JB3A 1MIOA 4HVLA 4KGDA 2VBFA 2HSZA 2VJPA 5KVCA 3U7GA 3GY0A 5JNLA 2BBSA 3F74A 2XMGA 3K0CC 1M6VA 3UBTA 4G0NA 2HWVA 1M8GA 1QF9A 4A8TA 2IY8A 4Y98A 2I3ZA 1V95A 2Z8XA 2V55B 2AXLA 3HSSA 2H09A 4CUZA 4WCFB 2D8AA 1VI6A 1E5QA 4AD9A 1L7QA 3Q1KA 1L5FA 2QG4A 3AJ9A 1ZUIA 5IPAA 4LG1A 4KVAA 4GLLA 5F78A 4ZCIA 5SYNA 4WGFA 4TV7A 1E9RA 1EK1A 1X3UA 1GUYA 4W7SA 4OL9A 2P1ZA 1CDDA 2I62A 5DLDA 4RZXA 2GYYA 4KN8A 3BDAA 3Q0TA 2MSNA 4C30A 8ATCA 1GCOA 2V6JA 5AHOA 4TTSA 1V37A 3FKIJ 1W5SA 4AO7A 3SIWA 1TAUA 3MS2A 1NP6A 3RVJA 1P9RA 2D13A 1T4BA 5EMJA 3E5RA 3JWJA 4DWOA 4RK6A 4M1WA 2DHRA 4BO5A 3PC2A 5JAIA 2QL9A 3D5QA 4O1MA 4LC1A 1DGQA 4HZUB 4YV1A 1JXOA 4BQPA 2V26A 3FDJA 1D3AA 4XQEA 4U63A