2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cerebral protein 1
publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
3DUWA 2R3SA 4U7TB 4OBXA 3UFBA 2YXLA 2WK1A 5HFJA 2ESRA 4RV9A 5CCBA 1H1DA 4C03A 3EVGA 1FPQA 2Z6UA 3EGVA 3T7TA 3H2BA 3KR1A 4PYNA 3UJ9A 3LSTA 3TLJA 4DCMA 2AR0A 3FZGA 2CMHA 3ME5A 2XYVA 1G8SA 3MCTA 2YR0A 1NW5A 3Q7EA 5K0NA 1HMYA 3OE4A 3RODA 3SM3A 4F85A 3A7EA 4DQ0A 3C6KA 2FCAA 4OQDA 2EX4A 4CKCA 3LPMA 4QPPA 3OU7A 3ELDA 3M6WA 4KRGA 3KR0A 2PY6A 5DXAA 5IKMA 1NW3A 4ER5A 1VE3A 2GLUA 3P2KA 5FULA 3UJAA 1AQJA 3GRUA 2O0LA 5F2NA 2P41A 3B89A 3LECA 2PX5A 2IDKA 3LX6A 3UJCA 3BT7A 2HTEA 3FUTA 4GQBA 2PXAA 3CJQA 5DSTA 4HRAA 2AN5A 3EEOA 4P58A 3TRKA 2P3QA 3NVMB 3HCFA 1EJ0A 4R8SA 3CKKA 3OCJA 5LSAA 2YVLA 3IV6A 3GRYA 1R6AA 3LHDA 2CWWA 3A7DA 5DRTA 4RX1A 3LCCA 4PYJA 1L3BA 3DH0A 3E7PA 4GOLD 4RTOA 3ELUA 2C7RA 4EK9A 1KPHA 2XVAA 4YMHA 1RJEA 4PNEA 1KP9A 1N2XA 2O06A 2ZULA 1IXKA 3I64A 2PXCA 5KQRA 1M6YA 3L8DA 3DLIA 2GAFA 1FBNA 3KKZA 3M70A 1PJZA 1IY9A 3A27A 1NV8A 4RTQA 3ANXA 5CIYA 3G8AA 5FHRA 3SR4A 3FUWA 5DTQA 3G2QA 2N47A 2P3OA 2FK8A 2OO3A 2Z6AA 1QAMA 3G7UA 4GF5A 4X1OA 3PFGA 3LBYA 5E8RA 1FP2A 3MAGA 3HCAA 4E2ZA 1QYRA 3G8BA 4FT4A 5LQNA 4F86A 2HWKA 2C7OA 1TPYA 4RTMA 4Y30A 3MERA 4GC9A 1XTPA 3EVAA 4AZSA 5E1DA 1NT2A 1YZHA 1N7IA 1WXWA 3PX2A 3FUXA 3G2OA 3KQVA 1JG4A 3M4XA 4P7FA 4QVKA 1WXXA 3DMHA 3AWIA 4WXHA 5EMMA 4E2XA 1L3CA 3R24A 5H02A 3TMAA 4FR0A 1UFKA 1L1EA 2VP3A 2IH5A 3D2LA 1JTEA 2AOUA 2IFTA 3MTIA 4CKBA 3I53A 3FTDA 5HEKA 4YMGA 1WZNA 5EGSA 3I58A 2ZCJA 2ONYA 3C0KA 1ZGJA 3E23A 3GCZA 2NNWB 3G89A 3LL7A 4MTLA 1DCTA 3GJYA 4M37A 2PV0A 4PGHA 1T43A 2AVDA 3IHTA 4NECA 1O9GA 3SXJA 3B7PA 3ERCA 3TR6A 3P2IA 5DLYA 2ZTHA 3ELYA 2PKWA 3MB5A 1EAMA 1D2GA 3KQPA 1NW7A 4HGYA 4RTJA 3WSTA 7MHTA 3DULA 3R6TA 5LR6A 2UZ4A 3EVEA 2UYHA 3PLAE 4RVDA 2ZBQA 2IH2A 3T7RA 4H0NA 3DXYA 3K6RA 5MHTA 4KDRA 4RTLA 2P3LA 3SSNA 3DXZA 2NP7A 2QY6A 5KYGA 1RI5A 1I1NA 1WY7A 4EVIA 4EKIA 3ORHA 1MHTA 4BY9E 3HTXA 5EKXA 2NYUA 5CUQA 4R6XA 5FUBA 3NJRA 5K0CA 3B3JA 5FWAA 1BC5A 4E2WA 4LWOA 4U7PB 1AQIA 1JG2A 4AZWA 4E32A 4EKGA 2BR4A 1ORIA 1KXZA 3A26A 1XXLA 3AJDA 4XUCA 4FT2A 4JXJA 5EEGA 4CTJA 4RTSA 1D2CA 2OB1A 4BLUA 3OFJA 1YZ3A 4PCLA 5EC8A 3EGIA 3UJ6A 4B17A 1VL5A 5KQSA 2AS0A 3BUSA 3HM2A 3UWPA 1VP3A 4AZTA 4RTKA 3BZBA 4BP1A 2OZVA 3KPVA 5C9ZA 2OY0A 4OQEA 3GU3A 2KW5A 2PX8A 1WG8A 2V74B 3R0QA 5DT2A 4QDKA 3T0IA 1R8XA 1NW8A 5DRYA 5ERGB 2OKCA 4R6WA 3EVZA 4PYKA 3DMGA 5FQOA 2I62A 4BLVA 4E70A 4C05A 2B3TA 3K0BA 10MHA 2ZWVA 1JQEA 3S68A 3P9NA 3RW9A 3LKDA 5K0JA 4RTRA 3KQWA 2CL5A 1P39A 5U4XA 4CXMA 3SX0A 2ADMA 4PIPA 5KVAA 1KHHA 3FPHA 2OBFA 5LQAA 3O7WA 3OZSA 5FADA 5EVJA 3AXSA 5GM1A 5P8WA 4XUEA 3UJ8A 4EQZA 3GWZA 1I4WA 3R3HA 2AOWA 3IEIA 5DXJA 3G5LA 4DCGA 3FPGA 4OA8A 3TM5A 3PTAA 3BKWA 3KQMA 2P7HA 3HA7A 4XUDA 1X1BA 3OZTA 3VC2A 1O54A 3DP7A 3GRVA 5CVDA 2WA1A 3OZRA 4EMSA 5CVVA 5EIWA 3LCUA 3DOUA 4QTTB 1NE2A 4AZVA 3HA5A 2ZZMA 3GXOA 3FYDA 5EQJB 3JWHA 3KPJA 4AX8A 4A6EA 4RWZA 3GO4A 4OX9Y 2UYCA 3RIEA 5K8VA 2BM9A 3CCFA 5T6BA 2Y1XA 3G2PA 1ZG3A 1JR4A 2ZFUA 5FWDA 5IH3A 3TOSA 5BW5A 4HTFA 1PRYA 4QVGA 5K03A 1P1CA 2XYRA 5ICGA 3LCVB 3FRIA 4YUXA 9MHTA 3KQSA 2Z6QA 5K0EA 4CWAA 1XJ5A 3O31A 5ICCA 5G02A 1RI2A 2PWYA 2B2CA 3F4KA 3M6XA 2E5WA 5DPMA 5EMKA 4CKEA 2VDWA 4L7VA 1G38A 1N7JA 2PJDA 1KR5A 3P71T 4KIGA 3JWGA 2P40A 3KPYA 4M38A 4PINA 5GM2A 2NXEA 1SG9A 3BWBA 5GIPE 4GOMD 4CTKA 1M6EX 1SUSA 5FCDA 3REOA 2NXCA 3FPJA 3KQOA 2QRVA 3AXTA 4HGZA 2BH2A 2C7QA 4F84A 3HVHA 3HA3A 2EJUA 3BWMA 1JTFA 3PX3A 4ER0A 3KQTA 4RSRA 2I9KA 5CCXA 3FTEA 2VS1A 5T67A 3NDIA 1L3IA 4C06A 1ORHA 3GIWA 2IPXA 3HCBA 3M33A 4PYOA 5HIMA 1YF3A 3LDFA 4BP3A 5FA8A 3B3FA 4DKJA 2FRXA 5EOVA 3UA3A 4ISCA 1EQAA 2PBFA 1ZGAA 1EG2A 2IGTA 2UYQA 4YV0A 3BWCA 3GNLA 2AZTA 4X41A 3EMBA 4GUAA 3FRHA 5ICFA 3CVOA 3SSMA 2P8JA 4M7RA 2BR5A 1IM8A 3BXOA 2AOUB 4R8RA 3UJBA 2A14A 4YUVA 5K05A 2IBSA 2H1RA 4RVFA 3NVKI 1MJFA 2PT9A 1YB2A 3NDJA 2FPOA 1AV6A 4P7GA 5DM0A 4C08A 4E2YA 2IBTA 1P1BA 4C04A 1NBIA 1RJDA 1Q0TA 2H11A 2DPMA 2PX4A 2ERCA 1JG1A 2G71A 1B42A 2GPYA 2HMYB 3OU6A 1NKVA 3DR5A 4HSGA 5K0FA 4POOA 5C0OE 1NW6A 4PGGA 4E30A 3FYCA 4KIFA 3T7SA 5BW4A 3G5TA 3PT9A 1EIZA 2ZWAA 2GA9A 2JJQA 5GP1A 2P35A 2R6ZA 5GWXA 1R18A 3GRRA 3BGVA 3KU1A 1DL5A 2HNKA 4A6DA 5K09A 2ZIGA 5DWQA 3EMDA 1RI4A 3EVDA 3PS9A 5CM2Z 1FP1D 4QTUB 3TKAA 3VC1A 5EEHA 1QAOA 2P1DA 3KPUA 3B3GA 5K0LA 5BXYA 4MWZA 3KQYA 4KW7A 5DTRA 2BM8A 5LQKA 2YXEA 3PFHA 4PCAA 5FQNA 5GIOE 3Q87B 2AN3A 2P7IA 2Q41A 5HIIA 3TQSA 3A4TA 2XVMA 5E9JA 5T64A 1VP9A 5E1OA 3E8SA 4UOEA 2WA2A 2CMGA 2G8NA 3CC8A 4P7KA 2AOTA 3FUUA 4R05A 5EIFA 2PT6A 2QYOA 4GC5A 3PB3A 3KR9A 3B5IA 1BOOA 5EZQA 2VDVE 4G56A 2JHAA 2UYOA 2YX1A 4X61A 5DM2A 2IDJA 5E2AA 4RTPA 5EKUA 2ONZA 2AOTB 1O9HA 5HILA 4PYMA 1X1AA 1KIAA 3SGLA 2PLWA 4XCXA 2K4MA 3OE5A 4PYLA 5DX1A 3CJRA 4FZVA 3V8VA 2VZ9A 2ZZNA 1P91A 2JG3A 3GDHA 2XBMA 3NWEA 1TW2A 5D1NA 3M6UA 4RYLA 1HNNA 1UIRA 1Y8CA 5E1MA 3UA4A 1AF7A 4GEKA 4C07A 3E05A 4PWYA 3MQ2A 2G72A 5EHGA 2HR1A 2ZW9A 5E1BA 4GOOD 1SQFA 3HEMA 2ZSUA 2BZGA 5DSXA 5E8JA 3HCDA 4DF3A 5LQJA 3HVJA 4OBWA 5F2OA 1UWVA 5DM4A 3KPWA 3VYWA 4LWPA 1F38A 1XCLA 4ER3A 3I5UA 4X63A 3BGDA 3OPNA 1R74A 3UBTA 2GS9A 3P97A 3ID6C 3BWYA 4IWNA 5DM1A 4FS8A 4C4AA 5GOZA 2B25A 4GBED 4YUZA 4Y2HA 2VDUE 1X19A 1G55A 5F2KA 1QAQA 5K01A 4WVLA 5CVEA 4ZTBA 1KPIA 4YUWA 2JH8A 1VPTA 3C3YA 3R9XB 1JQDA 3TPZA 3LGAA 5K0GA 5HIJA 5E9QA 5LQRA 4ER6A 5CD1A 1ZHFA 3FTCA 2OPBA 3ER9A 3GRZA 2QM3A 2ZLBA 3ELWA 3HVIA 4BLWA 2IIPA 3CGGA 2Y1WA 2ZBRA 3HCEA 4IV0A 4HTFB 1ZKDA 2I7CA 1NV9A 1ZQ9A 2AN4A 2ZIEA 1JSXA 3FPFA 4O29A 3ER8A 1SVUA 1X1CA 2PWPA 5FHQA 2ORED 2EG5A 2BR3A 1INLA 5FA5A 1VIDA 2B9EA 4DM3A 4YV2A 4FSDA 1QZZA 5C1IA 2PVCA 5M5BA 3SVZA 5LQCA 1R8YA 1Z3CA 1XCJA 1OR8A 1Q0SA 3LBFA 4V0QA 5FTWA 3C3PA 3UZUA 4KVZA 3FPEA 2ZZKA 3HCCA 4KWCA 1XDSA 3OFKA 2OYRA 3X0DA 1JG3A 1RI1A 3FUVA 1RJFA 2CKDA 3LDGA 3G2MA 4QDJA 5K0BA 2NP6A 2QRVB 4QPNA 3VSEA 1VQ1A 2GB4A 2IP2A 4OA5A 1NBHA 1I9GA 1RJGA 2ZVJA 1BKYA 2HV9A 1D2HA 2AVNA 3I9FA 2B78A 1DUSA 2PSSA 3A25A 5CVJA 2ZBPA 4RTNA 3SSOA 2NXNA 1QANA 4MQ4A 4DMGA 1WS6A 5EMLA 3P9CA 5DTMA 3THRA 1XVAA 4LG1A 1FJXA 2I6GA 1YFJA 3GGDA 3C6MA 3HP7A 2YTZA 3BGIA 3EVCA 4PIMA 5JR3A 2JHCA 4HH4A 2C7PA 2YQZA 4MHTA 2YXDA 3MCZA 2PGXA 5DX8A 1TW3A 3EVBA 1L9KA 2H00A 4Z2YA 2FYTA 3TKYA 2OB2A 3P8ZA 5D1HA 5LQUA 3NW9A 3O4FA 1G60A 3QOXA 4RVGA 4ATNA 1V39A 3MHTA 4RVHA 3EGEA 4DZRA 3TM4A 3P9KA 1G6Q1 3NMUF 2O57A 2O05A 5CVUA 2FHPA 2AOXA 2QE6A 3LKZA 4FP9A 3QOWA 2FK7A 4PONA 3KHKA 5DX0A 2V7EA 3KR2A 5HIKA 3DXXA 5GINE 1JQ3A 1SUIA 8MHTA 3HNRA 3LDUA 5JUWA 5HZMA 3EPPA 4MIKA 2PXXA 1SQGA 2JH9A 2XYQA 5E9WA 3UJDA 3JWIA 4FGZA 5HOQA 4YUYA 2GH1A 4IKPA 5EPEA 5EG5A 2OXTA 4PYQA 5E2BA 4KDCA 5EHIA 5KS2A 3HVKA 3DLCA 2G70A 1XDUA 4HC4A 1VBFA 4E31A 1M0EA 4LECA 5B1SA 1R00A 3CBGA 3P9IA 4PYIA 3CJTA 2YUIA 1KPGA 1X1DA 1VLMA 4ER7A 3DMFA 3SMQA 4QQNA 4IV8A 3MGGA 2LD4A 1KYZA 2DULA 4X60A 5ICEA 1YFLA 3FTFA 1SKMA 4V0RA 4DA4A 2EJTA 2F8LA 3M6VA 3TFWA 1RI3A 1YUBA 1KYWA 2EFJA 3OU2A 2AOVA 3QV2A 4YV1A 3BKXA 1U2ZA 1F3LA 4HG2A 4QQKA 3NWBA 4P7JA 4K6MA 3THSA 2G1PA 3PVCA 2NXJA 3AY0A 3EVFA 1BHJA 3JWJA 4FSXA 4GOND 5EMJA 5EZSA 3UJ7A 4M36A 2JHPA 3EEYA 4E33A 2PX2A 5BP7A 3U81A 3V97A 3IYLW 1JSZA 1XDZA 3KQQA 3MTEA 2O07A 3DTNA 3NTVA 1EJ6A 2IH4A 2ZIFA 1G8AA 4AUKA 3P2EA 3G88A
chains in the Genus database with same CATH superfamily
1JILA 3OOUA 4U7FA 3GYHX 1KKLA 4UHEA 2Z6UA 5JMWA 3PUFA 4KPFC 4IDAA 4TKMA 3EZXA 4M0KA 4K6OA 1A2BA 4LIPD 2HOTA 3OBIA 3LKVA 1JTYA 4OQZA 4M4SA 2C4NA 4QRDA 2GILA 1LRLA 4U7DA 4M8IA 1TLHB 4ZT4A 5LN1A 1MD9A 3K9QO 2XKKA 1PVOA 4DPKA 1ADBA 3ABLH 1Z75A 3ZXUB 1F5TA 1QH0A 1N6RA 2FZLA 3O91A 5I9BA 1K0FA 2O2SA 4PICA 2WMOB 2DA6A 4MYCA 3A1CA 1A98A 1LJUA 3HDDA 4J16A 1TNTA 1IZZA 1Z4PX 3N0VA 3A70A 3B2NA 3ZJ5A 2VRBA 1ZGJA 2OO5A 2R8PA 1DPGA 2WZDA 4KRFA 1SURA 4GAEA 3G71I 3T4XA 4OYHA 2NACA 2VP9A 1QP0A 2HPMA 2JMWA 2NZUG 4IIDA 4IRUB 1DQNA 2ZB2A 1R22A 3A01B 2X8JA 1M1EB 1NHGA 3CNNA 3NONA 3WRVA 2X1LA 3RRNA 4XIIA 5IAKA 1FSFA 1PWZA 4YRRA 1AZLA 4A0FA 1GZSA 2B8JA 3B1JA 1KVSA 3BH7A 4HNHA 5D84A 1R6VA 3P9NA 3RVJA 3JQAB 5CT6A 2H4JA 1EK2A 3E2PA 4O2LA 5EVJA 4HXFB 3ZQ4A 2JK0A 4GT1A 1JQKA 2WA1A 4EA7A 3UO8B 3G2PA 4BTEA 2AO9A 4NE9A 3KB1A 3B73A 4GWLA 3N2GA 3RJMA 2E5WA 2H1CA 3FDXA 4X93A 2H63A 2GASA 1TM3E 3RVRA 2P9TA 2EP5A 3UPDA 1SAYA 4H77A 1X1EA 4RCYA 1HW2A 3A1YA 1ENHA 5B3JC 1UKBA 3QTLA 5H0IA 4YS6A 3PYLA 1NPTO 4MNUA 5DK4A 3F21A 7REQA 4GSLA 1EVJA 5JRDS 4FZJA 4KT6A 1SMYF 1NG7A 3JYNA 3V2HA 3T5PA 3GTJJ 2FG5A 5FNZA 4K28A 1NJ2A 1AE1A 1SIUA 3QP5A 3V7RA 1QG2A 2ZRDA 2CQKA 5B2EA 4HDNB 4QYSA 1PV1A 1D1SA 3WL8A 4LYDA 2VR1A 4CEJB 2VOJA 3I28A 5L3QB 3CFYA 3UVEA 2AOTB 2JA6J 3J7AY 2NTYC 2CV1A 2X6TA 5FFMA 4DDKA 4R41A 2FDXA 3A3YA 4HRVA 3K5WA 4LE2A 4HQLA 1S2IA 3I12A 1BMTA 1GU7A 1WQ3A 4DBQA 3FF1A 2VHJA 4H2DA 1R6BX 4HAMA 1CDEA 2IYZA 3RVKA 2QCOA 3FF5A 1FFXB 3C87A 3CKLA 3TUIC 4ACAA 2FETA 2OMEA 3PQFA 3L6CA 1OVMA 1IRFA 1E7SA 1P5RA 3AKEA 3GFOA 4BFUA 2WTMA 3BE8A 2GERA 4UD6A 1K06A 4DKXA 2J0EA 1JHVA 2GJSA 4KXQA 5EZYA 1M1XB 3W3AA 3JW8A 1YK1A 2QL6A 2Q2OA 1E4OA 1EVZA 1DUSA 1F8UA 4KYTA 5KNBD 3IVGA 4C4ZA 4L74A 4H59A 2G08A 3DW3X 3M4ZA 4BP8A 1C1DB 4I7HA 1WLSA 1KDRA 1QYWA 4R1LA 4LJ5A 2J67A 2I6XA 1RRVA 3NR2A 5D7NA 3EYAA 4JB0A 3WGZA 2BV6A 1WCIB 1TZ2A 4FP9A 1GL9B 1XC7A 1POGA 3FFAA 4MIKA 5EGOA 3I8OA 1YQTA 1PTJA 3QFHA 2QTLA 5AVRA 4G3XA 5E6SA 3OZEA 4C2MJ 4N7BA 2CXTA 1OV6A 2CEKA 1S8OA 3CJTA 2R2AA 3UXHA 1MXHA 4I9UA 1BJKA 3VR4A 2AZDA 2AOVA 3GZNB 4ZAXA 1P1RA 4YEDA 4RIEA 5HSGA 3ZKWB 4OI0A 1NVVR 4BE1A 1S4QA 4CM1A 2R7TA 1ZZGA 1RYBA 1PU2A 4KAXA 3DFKA 2XZPA 1LW6E 3BY6A 2VP5A 2X3UA 1LZLA 2AEFA 3DFUA 3F3YA 4ZI3A 3PDCA 3K32A 2OYCA 3MT9A 4Y2TA 3MMSA 2FRDC 3OOPA 1TNDA 2CK3D 1NF9A 2JFWA 4WL0A 4V0SA 1PUIA 1Z6PA 1E9DA 2XUOA 1YHYA 3OCJA 4L72A 4BH9A 4QODA 5JSHA 5JECA 1XMAA 3SEQA 1KA8A 2W8ZA 3DV0B 3O3NB 1ZLKA 3SQMA 1UK9A 3PIIA 1LDJA 3KUXA 2Q4DA 1NG1A 2WFLA 2A3RA 3IV9A 1AGNA 5K7ZA 4YDSA 4P4NA 1GM5A 4V2IA 4XX0B 3OIQA 2OO3A 4ZEMA 2P67A 1H89C 4RD1A 4PX2A 1UQUA 1YZHA 1TRHA 3G2OA 2YINC 3E9ZA 1SC4A 2JFPA 2OHGA 3DO5A 2QTHA 3KQUA 1TMYA 4YMGA 2ZKZA 3A0BC 3IAAA 1VQ4I 3JD2A 4XRFA 2FW9A 1FFSA 5D5WB 1GR0A 2OCAA 3B7PA 3QW4B 3BTSA 1GFWA 2WJWA 4BLPA 3FF4A 1V8DA 2IAIA 4RK7A 3OHPA 2VJ4A 2OGWA 4DYDA 4BBSJ 2OE2A 3JSOA 1SELA 1USSA 3HXKA 2P65A 3JRFA 2C1XA 2W93A 4ZC3A 4E5YA 4R54A 4BP1A 1L8OA 4CG0A 3K09A 4BS9A 4XSZF 4PYKA 2LRDA 1LFUP 3BTIA 4HVCA 5I6DA 2K7LA 1WKMA 4CQMD 3R75A 3VR5D 3NWOA 2AKYA 4KO4S 3FRJA 2XAAA 2WMNB 1I5RA 2JLCA 1QOQB 1X8JA 4C3HJ 1OX6A 5AJWA 5JAHA 4ZVKA 1SWWA 3KYIB 1PFKA 1IC6A 4YMSA 2UYYA 4XWTA 3HGMA 4KXVA 2WOOA 3B1FA 3ZGYA 4ZMRA 1CLUA 4OM7A 5DGHA 1O5TA 2BZ0A 4OLJA 1G20E 1FX1A 3CH6A 3CZPA 5DHUA 5A9TA 2A7XA 2ZETA 1AU9A 4H7EA 5A4FS 1N6OA 2JGAA 2NU6A 3ZV5A 3SBEA 5KBYA 2IHTA 2CDBA 3PNMA 4QDOA 1L6RA 3D4BA 2GZMA 5HM6A 2CHFA 1IMJA 3EMBA 3B82A 4GZ5A 3A2KA 2CSXA 1J5PA 3B12A 3D7SA 4XWOA 4UEWA 1JWLA 3CZ9A 4IAOA 3IRQA 4DQXA 3ZJTA 4KIFA 1JB9A 1D0YA 5GV8A 1W47A 2OGSA 3T6KA 2PFGA 3B1XA 1AH2A 2VDKB 5LOVB 1JKRC 2P81A 3OLCX 4PY2A 4MCAA 4HSRA 1RPTA 2QTNA 3JQEA 2V98A 2UUAB 1K86A 3SI7A 1X6VA 2CMGA 2ZYIA 1G98A 2UYOA 3CDHA 4AO8A 1XMPA 4EY3A 4DWOA 1IBLB 2R1TA 3QYBA 2P3SA 3WOVA 1AF7A 2B8EA 3BL8A 4MGYR 3UANA 4KR9A 3LVRE 4G4IA 3L7CA 3CUQA 4OHOA 3MLBA 3RAJA 3CGWA 5K8CA 2J85A 1SVKA 2ZYUX 1PWXA 2JARA 1D4FA 1UBUS 4OL9A 4WVLA 1DAFA 2YVKA 1U8YA 5LWQA 4G9EA 4KE6A 4KPEC 2NQ2C 2R1VB 1T4CA 4MWTA 1KI9A 4YUAA 2JI7A 1M7HA 2DFKB 4A0QA 2WT9A 5K3CA 2ONKA 2B78A 1AKHA 1W8DA 3RSFA 3WRYA 3GAFA 3SP1A 3QOEA 1VGRA 3ZW7A 2CFOA 2CO5A 2WP8J 3UT5A 4RHCA 1A6IA 4NL4H 3UTDA 4FU0A 1SKAA 2ZE7A 5EINA 2I78A 3O3CA 2IHJA 3DL2A 2D8AA 3R7LA 3T1BA 3SR0A 2V79A 1KS9A 2ZJ3A 4E6PA 2ZJPF 5IAEA 2TS1A 2F4OB 3RFCA 3BGOS 3ILHA 3IH2A 5JH7A 5TR9A 1CZUA 2Q2EA 4M98A 5G53C 5GONB 1IG7A 4Q03A 4QQNA 3DEKA 1YFLA 5HCUA 3FTFA 2IU0A 3DNMA 3HGYA 3OU2A 4TQAA 5ED0A 1QU2A 1XZNA 4LQCA 4XXHA 3I76A 1AGRA 5AWFC 3A6FA 2VJQA 4L8WB 1Z38A 1XDZA 5E4JA 5JO9A 5CVIA 5KX5F 1XZQA 1B0ZA 5J1SB 4R9NA 3REFA 5CCBA 4BN0A 2RKBA 1UBOS 2AW3A 2W5UA 1HEUA 1H9BA 4N4AA 1HTWA 3UWKA 3TXXA 3FZNA 5LJLA 2C31A 1TAUA 2PY6A 1EFLA 5IKMA 1J75A 3JZMA 4CYCA 2P41A 4RE5A 4HRAA 3JQ9C 2XKAA 2GN4A 1W36B 4C0KA 4RX1A 5L7WA 2BY1A 4J1QA 4E7OA 4ZAVA 4F5DA 4UTXA 3AP1A 3O3OB 2VAWA 4NFYA 1CQWA 4AZ3B 4B4UA 3IP5A 5EUMA 3SSAA 3LBYA 3TRDA 2XNHA 2MOKA 1MAUA 3WQQA 4IDDA 1TJ5A 2HOEA 3DG9A 3G0HA 2PT5A 1H05A 1O97D 1DS6A 1Z5UA 3VO2A 1CS0A 2ZTVA 3KT0A 1DSSG 1NRIA 1WMSA 4NP6A 4OQQA 1OBHA 4IV5A 1H4QA 1Q0RA 2VQCA 5AHOA 2OBXA 5GADJ 1NFFA 3W2EA 2O8DB 4UM7A 4MQMA 3IKJA 4UBJA 2GIZA 1P4XA 3IAM1 4ZJZA 4UM9D 3OFJA 2DO7A 1UB9A 3PKIA 2JSCA 2W2KA 3RSQA 3P9PA 5DP2A 2BEUA 4N0PA 3SJZA 3SLGA 2WM9B 2HU7A 1D5WA 3K0CC 3K2IA 4HNAB 3HKCA 2REQA 1HOMA 3HCOA 1G2QA 1KYTA 2HA7A 4E1BA 3BXEA 2DOAA 1BX0A 5TT1A 2JASA 3V4ZA 1E5XA 2R87A 2VT6A 4YT5A 2XRFA 4P81A 3I9V1 2EFQA 2PWYA 3QK7A 4Z7OB 5C18A 5KTKA 1CG6A 3R20A 1X7GA 5CPRB 4XB2A 421PA 2NSJA 3H7AA 4P3XA 1DX4A 4GMFA 5EE9A 1WCWA 4G25A 1UMDA 3EIQA 1S89A 4ARCA 2QMYA 2OP1A 1JKMA 4CMIA 2WJZB 4I36A 2CV0A 3PQCA 1ENPA 3H11B 1NBMA 2QT9A 1ZL2A 5AVXA 4IRXA 2RNJA 1RS0A 3GK3A 1HW5A 2H7VA 5CVRA 3L9WA 1F8FA 3TQTA 2NV6A 1MX1A 2JFVA 5C8YB 3EDPA 3MS7A 3JX9A 1G6NA 1TJYA 1E69A 1YITI 5AK4A 2XVMA 3B3QA 1BX1A 2C92A 3M1EA 4IIHA 4ZVMA 3EXAA 1RKUA 1LDGA 3T3OA 3MT7A 1ACLA 1VA5A 4FZVA 4Z51A 2HGZA 3WGVA 2D5AA 3GDHA 1IEVA 3UOAB 1P4HA 4F6RB 1DBPA 1GVJA 5HS9A 4Q18A 1JJFA 3H1BA 3LTNC 3WLLA 3X2EA 1ONSA 1A8IA 3QLVC 3OF3A 3P97A 2WNSA 4UTZA 3Q3IA 1K6MA 3VKGA 3TCKA 5EZHA 3TIGA 1Z6QA 1DLJA 1XTSA 1WSUA 4KQ9A 5I9SA 1PD0A 4UVIA 2ICAA 2VTDA 4Y2PA 4KXFB 1T10A 4ZEXA 3KL4A 4YCAA 3SYNA 5HE8A 3DLBA 2DFHA 5AW6A 1R0BA 2JIMA 3QP9A 4F8YA 2HZDA 1I14A 3W5UA 1LK0A 4FONA 5JALA 3F9KA 5H7XA 5H3CA 2XXAB 1ZU5A 1GUYA 3U4DA 3P7NA 2BE9A 3HNPA 1XTQA 4NBRA 1XEXA 5IVDA 4X64B 4YRTA 3PQ8A 5JUWA 1SWVA 2ZSDA 1E32A 3CMEI 4XONA 1BDJA 1O3YA 5KKNB 1NYQA 1LK7A 5LNK1 3AGPA 1ORRA 4KK3A 4G5HA 4MJXA 2GBYA 4CPDA 5E6RB 1QRAA 2DFDA 3WG7H 1JSZA 2R7MA 3KAPA 3AFMA 5EQFA 4D3XA 2FSSA 1Z2NX 2QE7A 3GOHA 1WDLA 2J6CA 3B7GA 3BTLA 2CD9A 5GV7A 2QVCA 5JJBA 3F9IA 2O1EA 1U9OA 2X9LA 1GGKA 4YAUA 1CB7A 4LC0A 1Y5RA 1R9NA 3LPMA 2W6OA 3HDVA 4UD2A 1A9ZA 1WB4A 2XB6A 1FTYA 5H8WA 5CDHA 2JAXA 1QHHA 4E08A 5JTTA 4OHMA 2QQFA 4KFTA 1T5SA 1EP1B 1E9EA 1O89A 4R2JA 1Z06A 3WIUA 1U2WA 1K78A 2BTOA 2D00A 1YB7A 1OQAA 1WBBA 2VE9A 4BXFA 2WAMA 4HADA 4E2XA 4MRVA 1I39A 1LDDA 1VJCA 2C4HA 4NC8A 3LVBA 2QD2A 2ZCJA 3H3JA 2ZYHA 4CF3A 4ITUA 5EPOA 3NIGB 4ND6A 1C5KA 3TYXA 1MX3A 4BRUA 4RTJA 1NBWB 3GBGA 2ODTX 4PE5B 1KP3A 3ND9A 4B5LA 2CE2X 2WTBA 3KHTA 2HOSA 1WDWB 3SICE 4ZZ0A 3LXMA 4BY9E 4EG3A 1XELA 3OLZA 1IGNA 1CEXA 1DEHA 1XEWX 4RW0A 1Z22A 4ETWA 1XAJA 2QBYA 1ELOA 1VHWA 1NMXA 4C3ZA 2QYSA 4O3MA 2ZAIA 4AS2A 4DLXA 5DIZA 2Z95A 1CYDA 5C44J 5ES3A 3A14A 5ER9A 5L3DA 1E89A 2QWXA 1KWGA 3BKWA 4F11A 4YR7A 3PHLA 1NNLA 3U3RA 1YULA 4CU2A 4A6EA 5GY7A 2YXNA 4A1OA 2VUIB 3WYDA 2B92A 2WJAA 3TD2A 1FU8A 4O2AA 1RLUA 3E8XA 1KO4A 3R9KA 1DXQA 2HGCA 1EK1A 3QENA 3ZGVA 3RBVA 3OAAA 3O3MB 4E5MA 2IPXA 1CF9A 1WA5A 5EP3A 2DTEA 2QKYA 4WH0A 2H3HA 1KYYA 4HYTA 4AP6A 3DFMA 1OFHA 2AOUB 2HKIA 5H59A 4ZCSA 4G5OA 3L1IA 3ECOA 1PK7A 1P8AA 1C8BA 4C04A 2J31A 3L6UA 1KFBB 1NKVA 1X7WA 2YJ4A 4CM3A 3PT9A 5FIUA 2XRYA 3RUAA 3CO0S 1P7IA 2HI0A 3IERA 4TMFA 1TTTA 1WH7A 1B2LA 1S2GA 2GVZC 1O95A 2YXEA 3G5MA 4DV3B 4FDVA 1Y1VJ 1DPUA 1CYEA 3RHZA 4FQ8A 4CKWB 3BMNA 4DV0B 4ODIA 4Q4CA 3P2JA 5A9SA 3CLRC 1BMFA 2HIGA 5LGUA 4RYLA 3VYUB 5E1MA 3KUDA 4AL4A 3EZNA 2P90A 5DBEX 2PFKA 3KUUA 5K5QA 2I1LA 2X1VA 4FINA 3F90A 1FYLA 1PFQA 3QWBA 2VBWA 1QR6A 3GDFA 1E2QA 4X3OA 3X1ZA 2YJNA 1WL8A 3KSBC 4W5TA 2QJOA 2HLNA 3H7IA 4LJ7A 4WK8F 4IZ6A 3TDKA 1NX9A 2FR1A 2AGVA 4GZ6A 1ZKDA 3NANA 3ASZA 4OIPF 4NX2A 2HVRA 3OSZA 3REGA 1G8JA 4ZQGA 4LCEA 4OU4A 3GJRA 4F1JA 1V7PC 4LNUA 1S2MA 2E1MB 2EBFX 4WXEA 2CHUA 1N8TA 3G1TA 1Y4DE 2GSWA 2HCBA 3DAOA 3CZ5A 4C2BA 4GLBA 3LNQA 1QUFA 3G2HA 1LA2A 2F1JA 3C2QA 1OH8A 2KIUA 4Z86A 3E1KA 3T7DA 4A23A 2HA2A 1R8QA 2NX2A 5C3MA 4OMUA 1UINA 2JH9A 1JDUA 3GZ5A 4IDNA 1E2DA 1R4AA 2RHWA 1IZYA 2H27A 3JARB 5CT5A 4JC8A 1SFKA 1SNYA 3L1HA 1KYWA 3IIKA 4LDAA 3NYIA 2VKEA 1P9NA 1UZCA 4J90A 1O58A 4A10A 4J6EA 2CY0A 2ONCA 5IPFA 2OM6A 2ZI9A 4BDSA 1A8QA 4ZO6A 3TW8B 4RYDA 1T0HB 2ESRA 3EVGA 5CGQB 1ZEJA 4KN9S 4WFIA 4GBGA 1J07A 3UAXA 3RS4A 3OZDA 2Q5OA 3PTLA 4UUMA 1NW3A 4M8KA 3U80A 3WLTA 2ZJYA 3MGKA 2JHFA 4O4LA 4ZCRA 1X0XA 3K70C 3SMVA 2CV2A 1KJNA 3JQ8A 4AD9A 4G65A 5KMGA 4U63A 4EG6A 1IQUA 5CDUA 1OIVA 4OIRF 3FIUA 2P0AA 4DDVA 4KC0A 2B4AA 4TZTA 4DT1B 1L1FA 3TOAA 1YBHA 1W8IA 1ZJJA 5BR8B 3I2GA 3NEUA 3DP9A 2BOVA 1QP8A 2ELKA 4MIOA 3MCUA 2ZSKA 1MXFA 2NTJA 1P6XA 1W0JD 3O4IA 2FWPA 5F4ZA 3PLAE 5AUOB 3UMJA 3K2ZA 4CKZA 2O0YA 4PRZA 2IWHA 2R4GA 4X6UA 4ZH4F 1UXKA 2WM3A 3F8MA 3FMPB 4HAWA 5IANA 2YFQA 1L5VA 4OU5A 5C34B 2PMZA 4G4GA 2JPCA 5D6NA 3OKCA 4YI5A 1M2WA 3OETA 1NXTA 1JL3A 3W6KB 1D6JA 2PJZA 3EC1A 3B8HA 4IEJA 2C0QA 2H65A 3ROFA 2CC2A 2ADMA 2JZNA 2VQDA 1TCBA 3CNBA 3MSCA 3M9AA 3PUIA 2JVGA 4MWCA 1W5AA 4JCOA 1VRVA 4NYMQ 3QEJA 2TMKA 2PZ8A 2DDAA 2ZRPA 3R9XA 3EQ7A 2XVCA 4A69C 1P1CA 1XRJA 2I2AA 1KZ1A 2BFEA 2A5GA 4G5SA 1NM5A 4JX4A 3JWGA 1TE2A 4FFWA 4P9UA 1L5NA 5B1YA 2B3DA 4KMRA 1BA3A 4NULA 5ILSA 2IU3A 2ODAA 5JVDB 4EPTA 1RQRA 3ECCA 2VKHA 3TLBA 1SAXA 2J5OA 3L4KA 2VL7A 4M8NE 3SVLA 2MC4A 2DI3A 2FKAA 4UCXA 5DM0A 3BGWA 5CX4A 4ILKA 5JNLA 4QXQA 4BNYA 4X94A 2ASVA 1P75A 4WZBE 1QO0D 1AXEA 3KU1A 2QL5A 5ENDA 1X94A 1J9IA 2TMDA 4JI7B 1KGSA 1PZEA 1L7OA 3M7GA 2Y31A 1TMKA 3VU1A 1OYYA 4O1HA 1C7FA 1SUAA 3PLNA 3CCEI 5FKMA 3QPSA 1QFXA 2PZMA 2Y30A 4LISA 4CF5A 3I01A 4QWWA 1TF2A 4B7XA 4ZXFA 3ROQA 4IHQA 4XPIB 1M3SA 5J2TF 3EZYA 1L5LA 4DEYA 4G24A 1DEKA 3ROZA 5LXTB 2JIRA 3HHGA 5FAXA 3D3NA 2OPBA 2B6HA 1AA6A 3MKLA 1CFJA 1TQMA 5J8FA 3NRBA 2XVYA 4AS1A 1OR7C 4BVJA 3Q40A 5HFAA 2GXBA 1VCHA 2OXFA 3I09A 5M04A 1UOPA 5JI3E 4M21A 1V5EA 1M2KA 4OA5A 4B5KA 1RJGA 3WTZA 3FK6A 1PS0A 4UNNA 2ZYTX 3L4BC 5F4BA 3FCSB 3ZK8A 4HLUC 5LEJA 2C9YA 4C22A 1HKTA 2VCEA 1NQOA 4XW2A 1K61A 3BFJA 1RZVA 4MGIR 5KYYB 1Q1HA 4GE0A 2PTGA 1J0DA 4Y7DA 1G64A 4RNCA 2JJ2D 2QNIA 4D1QA 3AUUA 3R7NA 1YDGA 4E4TA 1YB6A 3CT6A 2AH5A 3HR4A 1MQSA 1ZIDA 1RLIA 2WHQA 1F9AA 2QHXA 4ZP1A 2INGX 3AFNA 3PC2A 3KKQA 2DA3A 5DSZA 5A5FA 3RSOA 2XUGA 1AZTA 2ZWOA 1AS2A 4AY2A 3ETHA 1A7AA 5HQJA 4KQ2A 1W52X 4D5GA 5I7SA 1XF9A 3Q7QA 4BBAA 2Y1KA 2QRMA 2K7FA 1QZXA 4EHIA 3WX0A 4MWSA 1DKPA 1GVDA 2EQBA 4MEAA 5DM70 1O8CA 3K9TA 1WKCA 4MYDA 3T0GA 1CIPA 3ZPLA 3QELB 1CF2O 4UNIA 3LIPA 1U3EM 1ZK2A 1LK5A 2XMSA 1VI2A 4LYJA 3NP9A 2R5FA 4IY1A 3A27A 3U7QA 1XGMA 1GY8A 3D6MA 1F17A 5TJ9A 1WXQA 3IODA 2Z6AA 1MR3F 3PCXA 3LFTA 2W6PA 5F78A 5JZBA 3ZVLA 4BQFA 3ZU3A 3UMFA 2V7QD 3R24A 4QYXA 3D5SC 3NOXA 4WQMA 5FYQA 5CDYA 2N8GA 4FHFA 3P2IA 4UVDA 5I9TA 4AY6A 3CLOA 3B7WA 4GLOA 3GC6A 2QTAA 5JYCA 5CJJA 2BKXA 2O0MA 2ZBDA 4M6VA 1AA7A 1OPRA 1NXPA 2D5CA 2JANA 3B3JA 3OOWA 2FQYA 4U7PB 1I3MA 1LDYA 4RTSA 1XXLA 3E1GA 5AMXA 3IEMA 1K6YA 4XKVA 5EAIA 4OGGA 1VYVA 2XNDA 5HJ2A 2PEYA 4CU5A 4Z4FA 1ISPA 2FPSA 3CYFA 1C80A 3M8EA 3GLGE 3CCUI 4HCJA 3A0HC 4B75A 4RH3A 4JI5B 5DMHA 1ZQ3P 4D46A 1GAWA 3FPHA 5IXYA 4UBMA 4MVWA 2KPMA 3ANTA 4RZIA 4BO4A 1UELB 2G1JA 4OOEA 5L4LA 1YW9A 3FYDA 3GO4A 2XGOA 1MIOB 2CW8A 3RC7A 5TGDA 3OYIA 9ABPA 5EIOA 3EB9A 1T8UA 4L1KA 3AF3A 2VH5R 4Z4GA 1VYTA 4D7NA 2XB0X 5LBTA 3W2FA 5A5VA 1U2GC 2HUPA 2FRDA 2EW8A 3DC7A 3OMXA 4EHJA 4I55A 4GLLA 1JTVA 3GLVA 2I4RA 2YDYA 1MJGM 4M89A 3OYGA 1VBMA 4M7RA 1TQ4A 3FLMA 4DQLA 4JBHA 4WCFC 4WA8A 3DLTA 3TDMA 2DK5A 4E30A 4MHSA 3LWZA 4D79A 1JEOA 2DWQA 2FPRA 4AO6A 3PV0A 1L4NA 3NRVA 2CUJA 4EVRA 2A4MA 3IOEA 5CT8A 4IEEA 3TQSA 2H0AA 2FN7A 3EFHA 5FX2A 2IPNA 2PT6A 1JSRA 1R5BA 1KIAA 1CF7A 1XNGA 4C6TA 3FGPA 2W2LA 3UAWA 2XAFA 1Z12A 2M2IA 1TVKB 3DDCA 3BWEA 3EETA 1AQYA 1ENOA 1KU3A 3UMVA 4UBOA 3FOCA 3OPYB 5F2OA 1NI4A 1L7BA 3U19A 3EEFA 3GARA 4L76A 5IJ9A 1TEXA 1GQQA 3G23A 4HI0E 1OASA 2PIAA 1H6AA 4CYMA 3V34A 4AYTA 2EJWA 3SK0A 4DA6A 3HCEA 4MTCA 3M8KA 1BS1A 2I2DA 4X20B 5E7MA 4CUKA 2GHTA 1P6QA 3X1YA 2P5SA 4R2MA 5JXIA 2PZGA 2WHEA 5E8GA 4LGCA 2OUMA 1IUOA 2JFXA 2AVNA 3LA7A 3QRFF 2HX1A 2YIVX 1S1MA 5HM8A 1I50J 3TEJA 1UJ8A 3B8EA 1WJEA 3CNEA 1A8HA 4E1AA 3Q1KA 4PPFA 4PF1A 4HDMB 2RKOA 2GWHA 4BC1A 1QE0A 3IEXA 3OZIA 2R7LA 3NXSA 1IFXA 4O08A 1VL6A 4CIYA 3CEAA 3QMPA 1S3FA 4ZFNA 5KVCA 2QVBA 4TGLA 2DRIA 1H2FA 2NV2B 1J9GA 2W24A 4N5NA 2AJ8A 3BR3A 2QX4A 2Z8ZA 4JP1A 3F1LA 3LC2O 4Y17A 1CUIA 3EA0A 2H1IA 3T9BA 1QHIA 3G88A 3HHPA 3DE4X 4M3NA 3KIPA 3DMPA 3T5CA 4FILA 2REBA 2JA2A 1Q0QA 1RWMA 4BB0A 3PEFA 5TISC 2OCDA 3OR2C 3VI4B 2G9QA 2XUQA 2RAVA 5DYMA 3GN2A 1B1BA 3FHOA 1RXIA 1N6HA 4MRSA 2MR6A 5B3LA 4HWOA 2D2WA 1MG5A 2XVAA 4EGSA 4LYAA 3N87A 3CU5A 4QEZA 4CI9A 4K1XA 3ANXA 2RDMA 5BYAA 2OV1A 4JJGA 2PD4A 2PBIA 1LQ2A 3IL2A 5EE3A 1Z3IX 4Q3KA 1QPZA 3OTQA 2C7OA 2X6YA 2W00A 3DEZA 2O2JA 1N7IA 4IUCS 2ETVA 2XLBA 3D2LA 1H1LA 1FYMA 2WPNA 2HCRA 2F8TA 1YS1X 1TMGE 2M45A 4QJ4A 1IU9A 1WSAA 2YRWA 4IJWA 5JI6A 3UGJA 3PC3A 2GNOA 2E9SA 1W93A 3ESRA 3U1TA 3KE2A 1ZELA 3R9WA 1COZA 2X0KA 4ZYEA 1T9HA 2B7EA 3N0WA 2WQ6A 3RC2A 6ABPA 2D54A 4DIFA 4WECA 3BRWA 3VKVA 3ZV4A 5CW2A 1K83J 1NDUA 2F4NA 2ETHA 5KYVA 1QLHA 1J00A 3TDNA 1XZKA 1CVIA 2F43A 4ZVUA 3VZDA 4ALLA 3KD2A 2HNHA 4ZYWA 2A6EF 3EDYA 2TDXA 3A10A 4JLKA 4TN5A 5ED4A 1D5VA 1IN6A 2PMZN 4OPMA 1PCXA 3BZWA 1DG9A 4CMAA 2CLDX 5K8VA 2ZJAA 2QV0A 3SG0A 4KODA 5CG2A 4M87A 1P6UA 3FRIA 2VXZA 1XK6A 4F12A 1HL7A 2Q28A 1GT91 5JD6A 1II8B 3T3GA 5ALSA 2Q1YA 2QRKA 3RG8A 2M34A 2PSFA 4C7MA 3HKDB 5BWLA 2VQHA 2QLFA 3HLYA 3UCFA 2IVFA 5F1JA 4RUKA 1BN6A 5CK4A 2ZRGA 4K2AA 2BMVA 4EHBA 2RH8A 1D6MA 4BNNA 4D0RA 3JQ9A 3KJNA 3OESA 3R3YA 5BMVA 5HLGA 2ACJA 3U4HA 1THGA 2J7PA 1BJAA 2DPMA 2G71A 4G84A 4DRZA 2P75A 1HQYE 1GILA 1K5DA 1TWCJ 3LYLA 2CXQA 4BUZA 1J4AA 4LHVA 1NR5A 1KC3A 2VYNA 3HPHA 4I09A 4NI5A 4HQRA 1GWNA 3WU0A 3ASNH 3TZEA 3BFXA 1ZX1A 2WM8A 1C1YA 1HXHA 1JNXX 4RZXA 3RHTA 4R1OA 3CF5F 3QTTA 4LG3A 1LSSA 1BU8A 1ORWA 1Z7YA 5IT9K 3EIWA 3IR5A 1Y33E 1BDIA 3HQ4O 3K4BA 1KAOA 4JS0A 4F4UA 4M1SA 2N42A 1I0ZA 2ZXEA 3ZCVA 1JYEA 4BAGA 3HDGA 3ZU6A 2VYCA 2V7FA 4XQEA 1KDOA 3L2QA 3Q41A 4CQNA 3I4FA 3UB3A 3D1VA 5G0UA 3IIJA 3JTEA 1GT0C 4IGIA 1MB9A 2I2WA 1ODIA 1U2QA 4D8UA 2RG7A 1A69A 3EJWA 5BOSA 1Z8DA 3RROA 1IMOA 1WZEA 3FAKA 1BI3A 4IRMA 2I8LA 4JJ7A 4QFCA 5DTMA 4PIMA 3E58A 2FYTA 2FHSA 5D1HA 3EVNA 5T4BA 4FS3A 3P9KA 3ZP5A 4AY3A 4LRYA 4MFEA 1TC3C 1VMEA 3INNA 2PN1A 2H7CA 4IJUA 3L1KA 2J45A 3ZWBA 3TP0A 3Q5FA 4FGZA 3ROMA 5E2BA 4BDYA 3R6LA 5EJ2A 1NVTA 3LUFA 3GJ7A 1DC5A 3HKBB 4YO8A 4X60A 1KEWA 4A3FJ 5IRCD 4EB8A 4AJJA 3GUUA 3EXIA 4RHFA 4AJIA 1AWCA 4M0UA 2KZVA 1IJFA 1XRNA 2YXBA 3SYLA 1W5TA 4J0EA 4RULA 3A4IA 2C07A 1P0MA 2XUKA 4U7TB 3H97A 4UEJA 5JAMA 5KAIC 1SC1A 2SCUB 1WUKS 1P62B 3WRXC 1RPAA 2QRGA 2VPTA 5ALGA 3EBPA 4LY0A 4KB5A 4QBHA 3WLFA 3VISA 4BE4A 3PTZA 3OD5A 1QGUA 4B8WA 4JYMA 4REQA 3TUJC 5JNWA 5KAFC 4BNZA 2W7NA 3ROGA 4NBTA 2COMA 3A11A 3MN1A 2E5ZA 4IQJA 3FY4A 4WZBA 1OZAA 2Y9MB 2B83A 1VSBA 2PYIA 2E34A 2K02A 1IDZA 1N6KA 3O8GA 3F71A 1FOXA 2CF5A 1M2FA 4A6XA 8ADHA 3OYCA 4EJVA 4BRSA 2OTJI 4I9GA 1USUA 4BU0A 3QLVA 4GYWA 2QJTA 3VO8A 4EM6A 2YHSA 3GMTA 4IHYA 3HRTA 4PLTA 3VPAA 4RD3A 4I9FA 1WCV1 3HOWJ 3DPLC 2C2KA 2HQRA 4DJ5X 1HDRA 3PSHA 3UR3C 1NVGA 2DXIA 3MB5A 5AVSA 1E2GA 4B3SB 2OC6A 3BTCA 1DAMA 2QYTA 3H1TA 3BJEA 4L3OA 3THYA 3GZTB 3N74A 1R6RA 2Q4OA 3UJ6A 1REPC 2JD2A 2H29A 2VSYA 3U6BA 2GM5A 1VG8A 5FTJA 2VRCD 2XQIA 1HT3A 1ZH6A 5HODA 3AR4A 1LEBA 4BWVA 5JCJA 1T5IA 1GPYA 2JZOA 4QICA 1CUGA 2W42A 4A1FA 1X80B 3S1RJ 5IDYA 5BQPA 5HE9A 3D5RC 2ZT5A 4YQFA 4GKKB 4LK1F 1RAEA 1VPVA 4TTAA 1OFUX 1Q16A 2JIPA 3R5JA 4F8EA 5C53B 3ZU5A 1DUXC 4E11A 1SUSA 5KNCD 2HZBA 3IEUA 3B48A 4UHCA 3UFXB 2DUWA 1XRQA 4G6QA 3OYKA 2ZE8A 3ETGA 1GEEA 2HRDA 3Q9NA 2OCCH 5HPYB 1QLJA 2XSZD 3M2TA 3H4VA 2PPLA 4FX4A 3VV2A 5LBQA 3L5KA 4KV7A 4RAYA 3OYMA 3QBVA 5KINB 3HV2A 2R5ZA 1LPAB 4LXHA 1VXOA 2QB5A 2ONJA 2R1UA 3EIEA 4N0DA 3OIFA 1CETA 3R4KA 4QTUB 3O0TA 1WP4A 1TZBA 4C89A 1MO6A 5EN4A 1KMNA 4CIXA 1ZZEA 4CQLB 3G0GA 3CTPA 3DZIA 1NNEA 1XTJA 2VKTA 3OQVA 4D1YA 2FSVC 5EKUA 4JP3A 1DNPA 4EPWA 4XSHA 4P4TA 1A6QA 4AK9A 5KHOC 5FOTA 4L6IA 2VAXA 5E8JA 4BVHA 1JXSA 1CRZA 1HLFA 4AC9A 2QVOA 4LLLA 5LU9A 3AESA 3LLCA 4GBED 2RFLA 2WYOA 3F9RA 5CVEA 5HIJA 3TPFA 1UHSA 1D0XA 2DT5A 1F5SA 1EK6A 1F8XA 3RJ5A 2VC0A 4Q21A 5CJ9A 1PBNA 3KB6A 3X0DA 3BX1A 4N0QA 2WTNA 3TLCA 4EKNB 1QDUA 4R68A 2LY1A 2P5TB 2Z2JA 5A2GA 1ONBA 1KGDA 5C8VA 1ADGA 4XVCA 1AKRA 2NUAA 3TMYA 5J23A 2O59A 4DZJA 4J49A 3WIDA 5KB3A 4M3GA 4ZJYA 3NBKA 3EVBA 4FYPA 4ZD6A 2ZJ5A 4NMMA 1IY0A 1GNRA 1QNLA 4MXDA 1XI2A 1U3CA 2ESNA 3GLGA 3Q11A 4Z3OA 3DXXA 3MBOA 1AA9A 3BZ6A 4Z6KA 3ZR4B 3NM6B 4NZOA 1KH3A 4IIVA 2FPKA 1KU7A 1I4LD 4YDQA 3QFRA 1YQQA 2EINH 2C96A 3M0EA 5JLJA 1BN7A 4BY7J 2ELHA 4WN9A 5IYBJ 2IPOA 4WY5A 4AX4A 3VZRA 4DJEC 3HCPA 4C1NA 2Z5LA 4EA6A 4LDQA 2AJTA 2HF2A 1O6GA 1QZUA 1DQUA 3WDLA 2PMKA 3WISA 5C4GB 1T1JA 1PUFB 1BXGB 5T3YA 3PL8A 1H5NA 1W2HA 3N53A 5T7BA 1ISRA 3FWHA 2GPWA 3O38A 4OJNA 3LUAA 2E0IA 3E22A 3KWFA 2WUDA 4UBIA 1YIJI 3DLIA 1M2JA 4HGQA 1PYDA 4DMRA 1SFXA 1RHRA 1LKXA 3MAGA 1M74A 3NQOA 3ESZA 3PQKA 4DLRA 2X8BA 1H6DA 4NBVA 3EPJA 1AOXA 4UVHA 4ZYAA 4YCSA 2PV0A 1W76A 2AVDA 1QGOA 2WFAA 5FBHA 3AIOA 1IH8A 2QZSA 1I1NA 5ULLA 1ODLA 1JE1A 2FQ1A 5FWAA 2EFHB 1BDBA 2P68A 4H16A 1SPXA 4AMGA 3JYOA 4PCLA 3EIXA 2C5LA 4JVSB 5AM0A 3S99A 3E3AA 2ZVDA 1JBEA 3L0DA 3OCXA 3U7IA 3W8FA 3S81A 3I3SR 4TXMA 3VR3D 2EEPA 1T0FA 4CT4B 4FZ3A 5DXJA 1U8XX 1G8GA 2H1HA 4YJGB 1RJ9A 1Y6RA 4I1SA 3OTOB 1RPZA 4I5GA 2VK2A 1FSGA 4JCCA 3WDKA 3UICA 4TTJA 5C35A 5K0EA 2VE8A 1JB1A 4PLZA 1O3TA 3I4LA 4NK4A 3KPYA 3ZQQA 1BMQA 3M07A 3K0EA 4YJ3B 4Q01A 2QI9C 5E95A 3LUHA 2X1EA 1QFJA 2V1XA 2CJJA 2Q1WA 3I37X 2GF9A 3AVXA 3WL6A 1NVWQ 4O6JA 3Q0EA 2V6EA 3CKYA 3ZJVA 1YOVB 1HR0B 4EM0B 4N3BA 4EB6B 5U9CA 2JJQA 1P31A 3KWMA 4OJKA 4TKVA 3L2VA 2R7XA 3MWEB 1E77A 3NHBA 1JQ5A 3E8SA 3IC7A 2PD3A 3WNVA 4G56A 2X6WA 4TPKA 2KHMA 2CUFA 5BNIA 5BQTA 4CM8A 4PG8A 1GL6A 4FT8A 4FN5A 1K9SA 2R5WA 4MUNA 3HSRA 2GN6A 3BGSA 4EF4A 3IWZA 3LXRA 3UJPA 5KQMA 4WK6A 3UN1A 3BGDA 4TV8A 1SIOA 3P2MA 4Q9LA 4UU7A 2L54A 3BQZA 3FROA 5AKYA 2VUSA 1F7VA 1BE1A 4N6NA 5E9QA 5COBA 3GRZA 3V8MA 3ELWA 3E9MA 2Y1WA 1C9EA 3HCNA 5CT9A 1LF0A 4OHUA 4CM6A 3M81A 2H1OA 2P5LC 4GYKA 3BB1A 3JQFA 1WF6A 4DCPA 4FLFA 1ENYA 2K3FA 3RUIA 1ZUD1 4LEIA 3WU2C 3ACCA 3BR2A 3E7XA 2OM2A 1E64A 3WY9A 1YFJA 2JDID 2H94A 2D5LA 3BGIA 2JFHA 4KXNA 3TKYA 2CQQA 3C7JA 3D54D 2KZGA 4JX9A 4K6CA 3L6EA 2AOXA 2Q50A 1RABA 4M1ZA 3IOBA 2G4LA 1L5KA 4Q3NA 4JVMA 4IOAF 4O33A 3WU1B 3FZYA 3LP8A 1P2GA 4O2RA 4TXLA 2WF5A 4AP9A 2CDAA 4BLQA 1O97C 3OZWA 5ICEA 4M99A 1EFKA 4JA0A 2B9VA 2X0DA 3SNKA 2XA2A 2QSZA 4BHBA 1PGPA 3F23A 1DIRA 4NHJA 3NHAA 4AYBA 2GCEA 3KYBA 1UM8A 2A57A 3OWOA 1T4MA 1Z8HA 1FPQA 4MLZA 3ME5A 3MJHA 5KPDA 3ABSB 3ZE0B 2AC4A 4KLZA 4FNMA 5JSUA 2VKVA 4B3TB 2P7VB 3E2IA 3ZIUA 2HSEA 1DX6A 4H0CA 3KYDB 3E7PA 4AQYB 1UF9A 3GEHA 2WF8A 5JXWA 4Z53A 4FBGA 1P2VA 4IS3A 5F27A 1NV8A 1PP4A 1EGQA 3AERB 3AR9A 3ICOA 2P77A 1G8YA 2NAFA 2K3PA 2VXDA 2FMFA 2E1PA 4L6CA 1ODJA 1JZQA 4C4OA 2BPOA 3G8YA 3BWVA 3G89A 3BB4A 3BD7A 3TR6A 3AF1A 2YBDA 3AVQA 5AW9A 2I66A 1LD3A 4JR2A 1E3TA 2CXOA 2UUPA 4DR7B 3E6CC 2FWMX 4R9SA 1NT4A 4BIMA 1OYOA 2LVSA 5FUQA 1QO9A 2ZNYA 3KCCA 2YYAA 3PLRA 1L1RA 2Y3IA 1YHZA 2X4DA 2AF4C 3D6FA 1SU6A 1P33A 4RTKA 2B0LA 3RREA 1M7BA 4MJ7A 4GOXA 2LWIA 5J4YA 1F4LA 3A3NA 4Y33A 4FYJA 2BFBA 1MMAA 3EQ2A 4CDNA 2X77A 1KF0A 1JRLA 4D42A 4YCBA 3CCYA 5JNRA 1J99A 1O54A 1P92A 1NAIA 3PEWA 1HSTA 4RAZA 2K6GA 3ASVA 4EV0A 1ZVJA 3UWSA 5ALLA 3RIEA 3RCOA 2G04A 4GMXA 4LB6B 4I3HA 3ANLA 5I9IA 3WTTC 1EWYA 1W0KA 4RGQA 3OA0A 3LCVB 4J1TA 1OA0A 1K7XB 2AI1A 4LJKA 2DKOA 2J6BA 4ETNA 4CTOA 2Q3CA 2VOOA 3ET5A 5T8KA 1M1YE 2B1RA 4MR9B 1C1XB 4IIFA 4Z99A 2IIQA 2EBUA 4MW9A 1NVBA 1C3XA 3FB1A 4YFNF 4R2HA 3BYZA 1U0NA 4JMPA 4CHTA 5A0VA 1YZQA 5FNVB 1TYDE 4LE1A 4KZPA 3ZEIA 1CJBA 2O2ZA 2DFPA 1PVEA 2PX9A 1JDJA 1C1HA 4ZOLA 3BN3A 1GXQA 4QUJA 3W5JA 5AVTA 2ZMEB 5FQNA 3T1YB 1M0SA 4HSTA 4J9UE 1RZRD 3VNQA 1CT9A 1Y82A 4HPXB 1P4RA 4FMDF 1GZHB 2W6ID 5HILA 4IFEA 3VNRA 5D5XB 4JYKA 3NM4A 1VHTA 3GJTA 3O21A 4WXYB 1R5JA 1WSBA 1NNUA 1Z3XA 5ALKA 4R31A 3CW2A 2DBZA 1TYEB 5J2UA 1D3AA 4NBKA 5K01A 1ZUHA 5F5NA 2G36A 8LDHA 2I91A 4W1PA 5K0GA 3TDUC 4QLOA 4FNOA 1BQ3A 5F77A 3DOIA 4U7HA 3PNSA 2PWPA 3NIBA 1FP6A 2LKDA 4KMUX 3M1IA 3GJ6A 2WYUA 2RGRA 2OTCA 3OEHD 1YRLA 3KHSA 3V2IA 3F3MA 1YVUA 1UPUA 4HDRA 2QZ4A 1ZSNA 3HCWA 1UEJA 3F5SA 4UUOA 2EF0A 2ZTMA 1SRRA 3NMUF 3VU9B 4Q7MB 3AFIA 4HSEA 4RLHA 1M1UA 4OM8A 1AKWA 1WQ2A 2ZRNA 2Z3WA 1TUEA 1U2GA 2HO4A 1U1EA 3M5WA 4PSUA 3O95A 1ETOA 1CDOA 1A7JA 3PFIA 1YQWA 1EUQA 3I92A 3CEHA 4IIJF 1FCJA 2NXJA 3DE2X 1C7EA 3ZCQA 4WCFA 2I76A 4WLFA 2DUUA 2E5FA 4RAGA 2G88A 4UE2A 4AZTA 2V59A 1TTPB 4I14A 2HK8A 2Z1NA 4QTXA 2DT6A 1UC9A 4GWGA 2AXLA 1KU6A 1BM9A 3A7EA 5KYWA 1ZM9A 4N76A 1CZHA 4PLCA 2E5LB 3FYTA 2JI4A 4MYTA 4GQBA 5IASA 5A05A 1V1RA 4BXOA 1RKXA 2ZBGA 2UZKA 5EA2A 1TUBB 2FPMA 1WXGA 4YAIA 3DH0A 5JQGA 2VZLA 1XEWY 1MRZA 1ETXA 1CJSA 2VPIA 3S8YA 1P0CA 1WMEA 1BEUB 1ML3A 1SUEA 4E21A 4HUQA 2YHIB 1N2BA 1W9HA 3OM8A 5EKDA 2XWJI 2WTEA 4IILA 4XKJA 2D1QA 4LF8B 1YRHA 1YR3A 4V1CB 1KYIA 1LPMA 2YWCA 3EC7A 1EA7A 3T3NA 2YWFA 3CO7C 4CCYA 4J94A 4FX5A 5JS2A 5EJEA 1UQTA 1GPKA 4FCVA 2YR2A 5LR6A 4OLBA 4IMJB 2X1DA 3S3MA 3B13B 4WN3A 4MRRA 5EJFA 1P29A 4EKGA 4L50A 3MIIA 2ZUCA 2C2XA 1T8WA 1HW1A 1L0OC 4JVNA 5CB0A 4PFPA 1VP3A 2P4WA 1OZ0A 1HRKA 3I54A 1R8XA 2BUCA 4KKVA 5D8KB 1Q7EA 3Q3CA 3H4MA 4XYEA 4HRIA 2C29D 4YR9A 1SVIA 1RP1A 2C5HA 3D0QA 1HI9A 2P78A 2ALJA 4AX8A 4EL5A 1UKVY 4AICA 4HN2A 1ZR4A 2W57A 5IYDJ 1R8SA 4KUEA 4HV5A 3FSGA 3KJFA 2DA7A 4CWAA 2BEOA 5G02A 3NIFB 2ZUVA 2G8LA 5FPTA 2TECE 1XOIA 4AC0A 4S2UA 4HGZA 4Z9FA 2V7GA 1NUQA 3PJFA 3WTVC 2O8EB 4KQ1A 4KV9A 1EX7A 3BJOA 2QIPA 5REQB 3O8HA 3A3PA 2IU6A 3K9NA 1HXDA 1DC7A 3CR3C 1D2EA 4MUXA 4LOCA 3RYHB 2IHVA 3IILA 2CGEA 3ZHZA 3RVDA 4R9RA 2EPFA 3RG2A 2JGFA 3EJ6A 3KXPA 3O84A 3A3OA 2GXQA 4LDNA 1RI4A 3FGOA 1BVUA 1IK6A 2SICE 3TSAA 1EGAA 1Q15A 3AVUA 2J3QA 1SD7A 3LOPA 4AJHA 1ERDA 2QPOA 2W2VA 4HLYA 2G8NA 3KLBA 4QEDA 2FPGB 1NZFA 1XZGA 3CUWA 1OU4A 3G5UA 4JT2A 1EZ1A 3DKRA 1PYGA 3BF8A 3KXLA 3WLMA 2QD5A 3UA4A 4RD6A 2CL0X 2QUAA 3QWAA 2AFVA 4I3FA 4NCIA 4MI6A 3IQIX 3QUQA 1CQJA 1G20A 3AG4H 5H1YA 1F20A 5A4KA 1E6EA 1P45A 3I2JA 3V6MA 1MJGA 3OEWA 1YAHA 2DUNA 3HOTA 2PFBA 1T56A 2E2IJ 1ACJA 4DARA 1RRFA 5HS8A 2C4KA 2ZYGA 3RGWS 2EZHA 2STWA 2QW0X 5BWNA 4A3BJ 1ZAKA 3G8DA 5C51B 2OO7A 3HCCA 3CONA 2CKDA 5J3JA 2ZAGA 1OAKA 4NBLA 1EGHA 2VTKA 1TJPB 3Q9VA 2GPAA 1SK9A 3P9CA 1JEJA 2PMWB 2DBRA 1Q6YA 2YQZA 3OYHA 1TK2A 3R7WA 1GKLA 3BFPA 4IL6C 4IGKA 1Z5OA 2BLLA 2O05A 2EKZA 2BHZA 4Q19A 3BCRA 1H0SA 1IL0A 3I9OA 4G5RA 2Y93A 2IUUA 2MSDB 2WG2A 4N65A 4RF3A 4RH1A 3PQ2A 5ITZB 5HS4A 1X1DA 1BGWA 4PO8A 1IJBA 1T29A 3HEFA 4PAQA 5L4SA 4BN4A 1LI7A 4XR9A 2ZB8A 3L18A 4LMBA 4CLRA 4TUYB 3VYVA 3OUZA 1IHDA 3KZ1E 4G37A 4MVJD 3D6AA 2GFHA 2RAPA 3H8VA 4DMHA 3DTNA 5DN6D 5DT9A 3VR1A 3TFOA 1GV0A 4L2IB 5DOVA 3EQ9A 3VR2A 2BBWA 4JNKA 2KIFA 3FE2A 2FCAA 2XBLA 3FBWA 5HX7A 2XKBA 3LGXA 5C8ZA 3AUJB 3JASA 2JEYA 2PXAA 5KOHB 3AYZB 1DBSA 3U26A 4PSVA 4AYBN 2H08A 2CLKB 2VP4A 2P79A 4D0LB 4JYBA 2E35A 2O06A 1BNCA 4LY9A 1OISA 1VL1A 5AVKA 5JSKA 5LCXA 3HCAA 5LQNA 1ZONA 4HLCA 5IM4A 3TGWA 5B1IA 3FI9A 5E4TA 4W1QA 2N0SA 2DJIA 3HWWA 2EGHA 1CCWA 1GDHA 2IRWA 1LB1B 4ARVA 2ZTHA 3VX3A 2G7MC 3R6TA 3B60A 1NJ8A 1KJ8A 2Z2KA 1QPMA 1RI5A 1U9CA 4NV0A 2AC7A 1QNTA 3THXB 1CUAA 5FPSA 4MYHA 1JDVA 1MNDA 3NHUA 2OMKA 2XUZA 4LN1A 5F9FA 4LGVA 1N9GA 2J4CA 3BMXA 1JUMA 2IITA 4WY8A 4TKZA 5A1TA 4DA7A 3Q3EA 2O7NA 1ZYUA 1OJLA 2WSIA 2QEXI 4G8XA 2D7JA 4F71A 1RKQA 1F6DA 2WJ6A 2FEOA 4D80A 2BSAA 4P55A 2A5WA 1NXXA 3C24A 1LS1A 3TTXA 1RBMA 2XE4A 2VASA 5DNYB 1XG1A 4KJZA 4OX9Y 3BCAA 3F2IA 2AL7A 3J7TA 3G1UA 2YY7A 2IPMA 4ND5A 4PPQA 1A5SB 1E9CA 4FGKA 5I7AA 3U17A 2GDZA 1D1AA 2FEZA 2UZ3A 4LIUA 4AMZA 1DO2A 3OCUA 5LHGA 3KQOA 2JJYA 3WRXA 1B6GA 2KIQA 1XVUA 1EBFA 3DHYA 4PN3A 3KNZA 1J23A 2ORIA 3KETA 1MC5A 2IGTA 3U1VA 2HJWA 2G09A 3BBLA 1EM8B 4O8CA 3BQNB 3K0AA 3WLAA 2GEFA 2EK5A 2GX6A 2ZP1A 5CRIA 2CNKA 3PHGA 4P4SB 3V7FA 1U4NA 2VQFB 1EQ2A 1EFTA 5J5AA 1I3AA 3B3GA 1QFSA 1J0RA 2C58A 4YJFB 4UHBA 3ZDYB 3DOFA 3W3AH 5EUCA 3R5TA 3M6LA 3WBBA 5B3JA 2QZ8A 3S5JA 4GC5A 5IC6A 4OJMX 2AF3C 4O1MA 4NJEB 4A2UA 3DU5A 1BO6A 2Y1LA 4FE4A 2KLBA 1KJWA 3HMQA 3AG3H 3WTSC 2VPZA 4BMSA 1M66A 1MVLA 4F2HA 2B36A 2VEOA 4C4PA 1N33B 1ORTA 4ZRNA 1EGVB 4X63A 4MP6A 2DX7A 1JPVA 2EH3A 3U49A 3KKKA 1ZXXA 4AURA 2VUUA 5E0KB 3EZ9A 3N2KB 4FK8A 1TCVA 2BGWA 2VSXA 1M2HA 4ZYLA 2QJWA 3EXFA 2JJ1D 2C4WA 2G9RA 2ZYRA 3VR4H 4C6RA 3HXQA 3WIVA 2DZDA 3RVQA 1A9PA 2Q8NA 4IIXA 4RKEA 2Q27A 3GGDA 4PZ9A 1SGWA 4Q4HB 3BD8A 2OBPA 1UJCA 1MCZA 2R8XA 1OHHA 4A82A 3MHTA 2EIJH 3LKZA 3OX2A 2HXSA 5CX1A 3G1MA 2WUGA 4W5OA 1GXPA 4KICA 1GFIA 5EMHA 2I99A 2F3RA 1W7PB 1Y5LA 2DY0A 4S1NA 2VJOA 1REQB 4BNDB 3H42B 1RC9A 5F1OA 1PJSA 4K6MA 1BHJA 1GGMA 3ORYA 3FYUC 4G0QA 4RAFA 3RSNA 2DU9A 4X0EA 1G8AA 2UXDB 3U4IA 3SQLA 3NTQA 3R7BA 2P6SA 1VMKA 1QTRA 2A35A 1GXSB 2JJ7A 1Z47A 4DCMA 3PC8C 1T2EA 1M1YA 4DQ0A 4TN1A 2QQ5A 1J2EA 2D62A 3RB8A 1DZ3A 2C00A 3EGOA 1FX0B 4E5SA 1LVKA 3FH0A 5CBPA 3KXDA 4X24A 5DIFA 2A07F 5TE9A 1C7RA 1I1QB 2OCIA 1DZIA 3BZUA 3BD6A 2J9RA 1X8KA 3B6ZA 3HCRA 2WLSA 4BMPB 3PXAA 5FOSA 5CEJA 3G8BA 1NR1A 2GN0A 3FMIA 3HOYJ 4DGSA 3BILA 3KQVA 2ZJ6A 2NU8A 1U3VA 2DPUA 4YMIA 4TL6A 3O5AA 1RWBA 5JAZA 3IH3A 2V7VA 4A3SA 2ZS7A 1YVEI 3FLAA 2CK3A 4O5OA 2ZUFA 3M9LA 4RAQA 4RIHA 1NW4A 4MRMB 4TQ9A 3WIEA 1TCAA 5KDOA 2JA7J 2Z9BA 5CB4B 3EG9B 1MIJA 5EG0A 2ILVA 1T1RA 3E5NA 4RK1A 3ZWNA 3N2LA 4PQYA 3LAWA 4EO4A 4S12A 1C9YA 1RZ4A 4MUHA 4BJ5C 3P0IA 1L1QA 4OJYA 4X54A 4J8PA 1NW8A 1E8DA 4DS3A 4GX1A 1EWKA 3U9LA 4KLCA 1KJZA 2EP8A 4PIPA 1JEYA 4OHVA 3B52X 4RGUA 4NCJA 5HGXA 3TM5A 1T38A 1JGSA 1P81A 2ENUA 5TV2A 1GFZA 5BT9A 1Y98A 2OZKA 2O3UA 1J5XA 1XQ9A 1NG6A 4IHJB 3DR3A 2DN0A 4LOAA 2WQZA 1QVZA 5ICMA 2XF7A 4DIOA 2FQ4A 2HUNA 4AJ9A 3IT0A 3TD9A 1GV1A 3LCJA 4L18B 4AB1A 1JHRA 3AVOA 4IFIA 4Z49A 3LPDA 1KA9H 3BL5A 3DTVD 3C7DB 3PFCA 4LDPA 4Y6PA 2QAGC 4CQMA 1E17A 3C3JA 2DR3A 6LDHA 3VR5A 4LY3A 4KVAA 1RZ3A 4BEVA 4EL0A 5IWAB 3IE1A 4BUCA 3IP6A 1J5EB 3CXUA 3HADA 4TRNA 2VHCA 4FR2A 1E1MA 1Q0HA 1Z25A 3FXRA 5KAMA 2QSUA 4JJZA 5EZYF 1DTWA 1MBFA 1KO1A 3QI7A 2XA9A 2MT9A 4XWAA 1K8QA 5HIIA 1UC8A 3P9RA 4DLBA 5LL6P 3VTFA 3MTJA 5GZ3A 4RDCA 3TQCA 1NR7A 2AS5F 1B76A 2BEWA 3G1WA 2HT6A 4ZT7A 4FW8A 4JLJA 1JH8A 1GGHA 1S7CA 1HLVA 4XWGA 2ZTLA 5FJJA 1ILWA 3CUSA 4DMCA 2VNIA 1WHSB 3PGA1 1ZYRF 1YVRA 3COAC 3DVSX 5G3ZA 3DWFA 4KO1S 1EH5A 3TOVA 1O6FA 1JQDA 4HX9A 4BX8A 4Q02A 2VNHA 1YYVA 3TL6A 1OREA 1B6AA 1JKFA 1JDPA 1I9GA 1ZM3A 2ZRIA 4KX5A 1KY3A 1PJ4A 3IAM2 1G5RA 4IR7A 4ZZDA 1TXGA 2C88A 4HH4A 5DYNA 2R5YB 3DLAA 1U8UA 3RANA 1D5YA 4XM2A 1T6NA 3MZYA 3H0CA 1CE8A 4LXIA 2ZUSA 3TIVA 1W4ZA 1Q1VA 1ZNYA 1ZUNA 2J0UA 4BV2A 3HS3A 2M30A 1SQGA 3FPSA 3RF6A 1KQ3A 5GAGJ 1QZTA 3OLWA 1A9QA 3UMMA 4D9NA 4PV7A 2G70A 4D41A 3T8YA 3ITNA 4IV8A 4ZDLA 2QTVA 3PP8A 3UMGA 4X1KB 1SQ0A 4B87A 2FX3A 4TVKA 4CGYA 3JD0A 5EMJA 2V7UA 3EEYA 5BUQA 3I9V2 4Y2SA 3W8EA 1VQKI 4YAFA 2GCOB 2JCGA 4F56A 4I9HA 1U9NA 1X74A 2R3SA 3TVTA 2WK1A 5HFJA 3L6DA 2XD4A 4OQXA 1WMDA 4KR2A 2D5BA 1TWGJ 5FTLA 6GPBA 4D8XA 2R92J 4I1VA 3CTMA 4KUMA 4NICA 3WK7A 4RA6B 5K99A 3ICWA 3C3EA 1MC1A 4UDOA 3S44A 3E53A 1F2TB 2SHKA 2AN5A 3JATA 4BWFB 1LV8A 2BZ1A 3BMOA 1VSUA 3IJEB 4FNAA 4NQRA 5JASA 2XSJC 2C1EA 4ZANA 3VJMA 4DLSA 1K88A 2OQGA 3I6QA 4BGUA 1ICEA 4PG6A 4BV3A 4LUCA 1PHRA 5JWHA 2Q3MA 1C81A 4POAA 3ZHXA 4GXOA 5DE3A 2QQGA 4IP0A 4DCNA 3P19A 1GTJ1 5D5HA 1SPBS 4LJ8A 3QF4B 4L8YA 3UAGA 1QVVA 5J4HA 1NSTA 3EUFA 1U0LA 4I1IA 3UWMA 4NCKA 3MTIA 2M3AA 4CYDA 5DN9A 5JVGF 3GCZA 4RVCA 1NN3A 1R0LA 1RYHA 4M37A 2YX7A 3O2PE 3LW7A 3E5UA 1HE1C 3RIYA 4RIGA 1QIFA 4I01A 1U11A 5JCOC 1OI4A 1TLLA 2R7FA 1XN1A 3HLTA 4YLYA 1J8FA 3PUZA 5G0WA 2PCLA 4LWOA 2UZ1A 3KJIA 1GZ4A 1PUXA 1TIPA 3T7JA 1VDMA 3HA2A 2KRHA 1CZLA 1H93A 2OZLA 5A7FA 3KPVA 1ETWA 4Q7LA 1LPBB 2NU9A 2Q3JA 1EFDN 5BNTA 4DMMA 4A26A 4KTVE 3GP5A 3ROTA 1S5LC 2FSUA 3L40A 3PTAA 1OQYA 3JR7A 1JFFA 3U9GA 1IRIA 5IBRA 3N6XA 4RWZA 1HG0A 3ZPXA 3DMYA 2AEMA 2HLDD 4M9XA 4UQPA 5DNVA 3REQB 4W8OA 2C2OA 2CZQA 1N2CE 1HG1A 2DQYA 4E7PA 3TTWA 1M34B 2QRVA 2ME0A 3JQ6A 5A6VA 3FTEA 3RC8A 1O7FA 4OXRA 3K0CA 4ZN6A 2VTBA 2VF8A 4L5CA 2NOJB 4OGFA 3E35A 4OWRB 3A9SA 4IUYA 1H69A 3QVKA 2H6EA 2P4HX 4UQLA 3HIFA 4H3KB 4EI8A 3KZCA 1KJIA 3AOGA 4D92A 2HJVA 4JJIA 2XXBA 4BB9A 4KX3A 3L7DA 1QGYA 4W82A 4IDOA 1KMCA 4XORA 4R0VA 1YRAA 4X6AJ 3IIMA 3CA8A 2DK8A 1R50A 4ZPXA 3VC1A 2VQSA 3ZQ7A 3VKUA 5H82A 4D5EA 5CMLA 3C3XA 5JAPA 1C7IA 4FZRA 1A9OA 4BQOA 5A2QA 3KUKA 4R05A 3QEKA 4CUGA 2V0GA 2I34A 2UUCB 2QNBA 1CUJA 1NHAA 1QZYA 3A2MA 3PF8A 5FFNA 1ZFNA 1S3JA 2BONA 2EKDA 2WSSD 1NQVA 1FDUA 3J81A 5JPCA 3QPAA 3ZC3A 1HLGA 1P2SA 3P45A 3HCDA 5A3VA 2O2GA 4HYYA 4MP3A 4MPTA 4N5LA 2B4QA 1DC8A 5JH7F 4JEMA 2P1RA 4M54A 4DBVO 1K6OA 1FDIA 4BE7B 5CCEA 1I3KA 1US8A 2M1ZA 3ZQIA 4GIBA 3TEDA 3AR8A 4X3PA 2B5VA 6Q21A 3U40A 2AHQA 4Y3OA 3WAKA 4MHOA 2QG4A 4GGMX 2DLCX 4RORA 5H3HA 4BO3A 4OHKA 2BKVA 2CVFA 1GTG1 4IRHA 1AKEA 1ZIOA 1FEZA 1WV0A 1ZM4A 2YWXA 3ISVA 1W96A 1U7HA 3TAUA 3SYKA 2I7XA 2A5YB 4TTSA 3T1VA 2IA5A 3RBAA 1J20A 3TM4A 1DFGA 3KQHA 2FHPA 5EHQA 1DP4A 1OOEA 2YU9J 2FGKA 1XR3A 3PDWA 4E3ZA 4X0GA 3BPXA 1VLVA 2KJCA 4MUAA 2XB5A 4JB2A 3F96A 4IOJA 1A2OA 2ZYSA 5E3LA 3GDGA 3BIWA 4M1EA 1JVNA 1UFOA 4JODA 1EVLA 1KOJA 2XTJA 1UBTS 5AK3A 1B16A 3IT3A 4PZDA 3WTYC 5JNUA 1Z45A 4BKRA 3T38A 3K9HA 2R65A 3WGIA 1N0WA 1WWXA 4FM9A 2IXBA 1QLWA 1DWUA 4Y9SA 3ZQUA 2XQGA 3R6WA 3UJ9A 1CZOA 1YL7A 2YR0A 3MAJA 1PTKA 2ZXFA 1MBKA 4MDFA 4NS4A 4NOJA 4BMOB 1OBFO 3KR0A 1G8KA 3WZLA 2JTVA 4PXSA 1GUBA 2W6JD 3IP1A 4M1KA 5IJWA 1UJMA 2HV8A 3WLJA 3FPCA 2HPHA 4P96A 2IYSA 2AE2A 5FV4A 1EVYA 4GOLD 2R7VA 4P3YA 3GEIA 2O03A 3QF7A 2QW1A 1RLMA 2NZXA 5JCPA 2FUKA 3A58B 3I2IA 4JUAA 1E7WA 4R7GA 2E2JJ 1IXYA 1FRFS 2JJ8A 5EPUA 1NT2A 721PA 3T5DA 1R1VA 5EMMA 1MOQA 1SD4A 4WZZA 2O8KA 1YLFA 3HUGA 3R8XA 2UAGA 4MW7A 4G0WA 3IHTA 1E1CB 2YOFA 5ALDA 3ERMA 1DQZA 1QC5B 3CNHA 2CZCA 3V4RA 2GZWA 3F6YA 4C3VA 3TZCA 5F9HA 4TT8A 4RTLA 3CUOA 3PCTA 5IKPA 7MDHA 1QOZA 2QQ0A 3Q85A 1FBSA 2JFUA 2HXGA 1TJ3A 4FKBA 2JRTA 1A9RA 2D2EA 4LDRA 4MQEA 4MUJA 1V5FA 1JW9B 4BLUA 1XG5A 5EC8A 2ZQZA 3NHPA 2BI7A 4IWXA 4ON9A 1R1UA 2V74B 4QUGA 1S3GA 1UAGA 4HPWA 5HWSA 3DMGA 3RS9A 1XT6A 4UOQA 2ISCA 1K68A 1X2EA 1CQXA 2IYQA 2VDMB 4V0ME 4TXNA 1ZI8A 3ZU2A 2EKBA 5JIBA 1Y5NA 1QYVA 3HFRA 2QIOA 4EUEA 2H48A 3I45A 1DDOA 5EQJB 4CLDA 5FLXK 4L4SA 4BX2A 2DT8A 2UYCA 1P1KA 4MROA 5IX8A 3WWYA 1U28C 1E59A 3WLPA 3TOSA 2BWJA 4OIMA 2CW7A 1VOTA 4BFZA 3LD9A 5B66C 2ZT7A 3U44B 4TWAA 3Q0IA 5LZ8A 5BUCA 3OT1B 4E6EA 2VG8A 1BJZA 4V3CA 4K81B 3OZBA 5GIPE 5K3BA 2XGJA 4MMZB 4ENRA 3HVHA 2F9FA 1Q1EA 4PJ0C 4XLCA 4M60A 5HF6A 3UJ3X 4RH0A 1HDDC 2J0SA 4H17A 1JBKA 1ZRNA 1JI3A 4B82A 3LSYA 5J5CA 5HKLA 5KX5B 1WFXA 2NV0A 5G40A 3LPLA 3HBJA 2ERCA 4TZ0A 1HF3A 2A2ZA 4Q1AA 2ODPA 3ZQHA 1KI1A 3H1PA 2LFBA 1EIZA 2D1FA 1YZFA 4G0UA 3ERED 2JEZA 1WXEA 3ED1A 2V4UA 4NJMB 4LHEA 1QFYA 2Q6LA 2HZTA 4IRGA 4RTPA 4KE8A 2EV0A 1OPCA 1D7OA 4PX3A 3OE5A 3KFXA 2GPTA 1YI2I 3QM1A 1B72B 2QRPA 4O5AA 4C07A 3EOZA 2QMQA 4L07A 4WOKA 4YRKA 1HMPA 1AO3A 4M7OA 1U5TB 2P1ZA 2P2LA 4WBNA 1KEEB 1FDTA 1CS4C 1SVNA 3GT7A 3OJLA 4KYUA 4MWBA 4F46A 3O9ZA 1Y3AA 2GOXB 3L93A 4FFPA 2NVWA 3G7NA 4LXQA 3DDOA 1UT5A 3RUEA 1V3QE 3ZH9B 2VJYA 1LBIA 3BMCA 3TRIA 4CLOB 1JHQA 3T3HA 2BM1A 3JV7A 1VQ1A 5HCIA 3IKLA 3WAGA 1PR6A 1U3TA 4E5KA 2BFPA 1TA0A 1MQAA 1KBQA 1ORVA 1XCGB 3ONEA 3UAZA 5J2UF 3GYGA 1DEXA 2O4CA 2QKLB 1XX5A 1RIFA 3F3KA 1NA5A 4M9ZA 1PKXA 1Q1ZA 2IEAA 2OGZA 2O1XA 4ZVPA 3TGLA 3D5TA 4CKYA 3BREA 2I7VA 2I2CA 3I42A 2VPWA 2UVPB 4LTNA 3SMQA 1I1SA 3QPCA 2EZ8A 4CKXA 2H2HA 4PAOA 1USIA 1JHAA 4NBSA 1Z0SA 3A6LA 1EG7A 3WK5A 1IBSA 1QHFA 1WRJA 1KZ6A 4BGEA 5B6IA 1XYVA 1ZD5A 4KN7X 4MV4A 1M2GA 1OZFA 4YC7A 2OV6A 1PW5A 3OIDA 3WDSA 3U5TA 4TTQA 3EXHC 1NH3A 5E6UA 2YPRA 1YR7A 1M75A 3RYCB 3NTOA 3H9BA 1T35A 5BS6A 1DJLA 4JJKA 1YMQA 1YR8A 4IOLA 4RVOA 3O1IC 3ZBQA 4B47A 3CF0A 3MGCA 6PAXA 4N8EA 1O4XA 3MWDA 1K1EA 2GR9A 3H04A 1M6YA 3FVTA 5ALYA 4C7OB 2XGDA 5M29A 1VQ9I 1M1ZA 3LAJA 3IQWA 2FK8A 4JYCA 4KT5C 4CM4A 2JUGA 4C3IJ 1BEZA 4BNUA 3U9TA 2EV6A 1WW8A 2HQBA 2ZRFA 3JRXA 2ACKA 3KK0A 1N1GA 1CWUA 1MO3A 3K0FB 1KVRA 1MB2A 2WWHA 4ZRMA 3QVUA 1NN1A 1GTRA 3HNOA 4O2AF 2UZ4A 1L5OA 2C8JA 2HA6A 2FU4A 1J42A 5JBNA 3I0TA 3HTXA 3IBCA 3HN7A 3L8EA 1K66A 3ADOA 3MCWA 3F0TA 3NOQA 1JEQA 3DGFC 4Z9BA 4KPGA 3A6DA 3GI1A 2OBNA 4U5XA 1CUBA 4HAZA 1MPTA 4PQFA 4DA0A 2O54A 5C3EJ 4TM7A 4CIWA 1DGWY 2BE5F 3NAQA 3VJRA 1SUWA 3LKDA 4Y1RB 4C4XA 1LE8A 3RFVA 2JA5J 3IVMA 1ZOSA 4WZAB 3O75A 5HKAA 4FGLA 4BLOA 3MTQA 3UK7A 3SS9X 4J91A 1TI7A 1W0JA 5CA0A 1EUCA 2QGFA 4ZXPA