2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Cerebral protein 1
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
3O4FA 1ZGAA 4FZVA 1H1DA 1L9KA 4FS8A 5D1HA 1MJFA 2CL5A 4PINA 3KPWA 4RVFA 4EKIA 4RTNA 1R00A 3S68A 1NW8A 4DMGA 5FULA 5GP1A 4XCXA 5JR3A 3B7PA 3I53A 2VDWA 5K0FA 1R8XA 2PT9A 3ELYA 2AOVA 1JQ3A 1SUIA 3PX3A 3FUWA 4RVDA 5CM2Z 5DM4A 3QV2A 2B2CA 1L3BA 4YV2A 2ZZMA 2QY6A 4NECA 5EIFA 5DXAA 1TW3A 5K0CA 2XYQA 5E1DA 4POOA 3PFGA 5GIPE 4EKGA 3KPUA 3NWBA 5EGSA 5LQKA 3SVZA 3SM3A 1AQJA 3G2PA 3LBYA 5DM2A 3M6UA 4FP9A 1NW7A 3LGAA 3DTNA 4AZSA 4OX9Y 2EFJA 1KHHA 1HMYA 4PIMA 3EVEA 2ONZA 2ERCA 4HTFA 4M38A 4GF5A 3SSMA 4YV0A 1T43A 4GBED 4H0NA 1QANA 5FQOA 5HEKA 5EMMA 2QRVB 3G2MA 4CKCA 5LQCA 2LD4A 3I5UA 3PT9A 1JSXA 1KXZA 3GO4A 3GNLA 1WY7A 5EQJB 3DP7A 2GS9A 3DMGA 2AR0A 4LWPA 1WXWA 4E31A 3AY0A 3EEOA 3MCZA 3LX6A 1AF7A 2BM8A 5E2AA 5LQRA 2B9EA 1FBNA 3BUSA 5DM0A 2QE6A 2IPXA 4X60A 5CVUA 2GA9A 5DTRA 5GIOE 4RTJA 2QYOA 3BZBA 5HIIA 2PVCA 3GRVA 3SGLA 1I4WA 1XXLA 4BLWA 5FCDA 2OB1A 3NMUF 5E1BA 2JHPA 2ZVJA 3DR5A 4U7TB 4MWZA 3SX0A 4BP3A 3FPHA 3PS9A 2P40A 4P7JA 2OB2A 3D2LA 1SKMA 1P1BA 2EJTA 2AZTA 2Z6AA 4DCGA 3ME5A 4EVIA 3G8AA 2EG5A 2NXJA 2PKWA 4CKBA 4R05A 3HM2A 5E1OA 2HWKA 5DPMA 5DTQA 4BLVA 1YF3A 3A25A 3JWJA 4OQEA 3TR6A 1M6EX 2Q41A 3LDUA 5DSTA 1G60A 2PV0A 2HV9A 4KVZA 1L3CA 3JWGA 3HNRA 3C0KA 2OKCA 3G7UA 2ZZNA 3OFJA 3QOXA 2V7EA 1INLA 3P9KA 3OCJA 4QQNA 2O57A 4OBWA 4RWZA 3IYLW 2ZBRA 5HIJA 4GUAA 3RW9A 5LQUA 1NV9A 4R6XA 2ZULA 3FUVA 5CUQA 1Y8CA 2VZ9A 2KW5A 5K03A 3T7RA 3CJQA 4ATNA 5FA8A 4RTPA 2P35A 3GRZA 4IKPA 5DWQA 2GH1A 3GRUA 1R18A 2EX4A 2PX8A 3PFHA 5FHRA 2WK1A 3SR4A 4BP1A 4UOEA 4CTKA 5K0GA 2ESRA 4RTOA 1SQFA 3LDGA 1HNNA 2G8NA 2P8JA 2P7HA 3EGVA 3ER8A 4ER7A 5DRYA 5EEGA 4DKJA 1PRYA 4HC4A 1IXKA 2AOUA 3UJ8A 4PYJA 2EJUA 3G5LA 2CMGA 2AS0A 1P91A 3CCFA 4AZTA 2QRVA 3B5IA 4C03A 4RV9A 1R6AA 2B3TA 4F86A 2FHPA 3KQOA 1RI4A 2PJDA 3KQTA 3KPYA 4EK9A 2AN3A 2OO3A 2UYCA 1G38A 1X1DA 3FTFA 5E9JA 3M6VA 3OPNA 2JG3A 2I7CA 2O07A 3G89A 1SUSA 1DL5A 4PYMA 4X63A 5EPEA 3TPZA 4C05A 3LBFA 2NYUA 5EIWA 4EMSA 1IY9A 3HCEA 4HTFB 1L1EA 2P1DA 3I9FA 1WZNA 3KQMA 5K0JA 1YZHA 3EVAA 4R8SA 1WG8A 4C04A 2XVMA 4KDRA 5BW4A 3TM4A 2PT6A 4GOOD 3ELUA 4XUCA 2ZIEA 3F4KA 4OBXA 3HCBA 2PX5A 3FPEA 3BWMA 3R3HA 4PONA 3G2OA 3MAGA 2YR0A 5HZMA 5EG5A 1QAQA 3GWZA 2QM3A 2YXEA 3KPVA 4QDKA 5FADA 3VC2A 3R6TA 3KR0A 2P3LA 3O31A 5HILA 2GLUA 5EHIA 1KR5A 3GJYA 2P7IA 3B89A 2JHAA 3A27A 5LQNA 1B42A 1NKVA 3EMBA 1XDSA 1FPQA 5EOVA 2HTEA 4V0RA 1YUBA 3QOWA 3HA3A 2AOTA 5D1NA 1O9HA 3TOSA 3X0DA 3BT7A 4FT2A 2P3OA 4HRAA 5K0NA 5E9WA 1G6Q1 2FPOA 3I64A 5C0OE 2NXCA 4Y2HA 3ER9A 2GAFA 3TRKA 5HIMA 5EKUA 1Q0TA 3OE5A 3HCAA 4LECA 5F2NA 1QZZA 1R8YA 4HH4A 4KIFA 5DTMA 2ZFUA 2H00A 5LQAA 1RJDA 3EVFA 3FPFA 5CD1A 4KRGA 4C08A 3LKZA 5K0BA 3PLAE 3MTIA 3PX2A 5E8RA 5T6BA 3TKAA 1YFJA 3A26A 3M70A 3T7SA 2C7QA 5K09A 4QVGA 4AZWA 1JR4A 5HFJA 4M37A 2P41A 1KPHA 3KQWA 2HR1A 5FUBA 1JSZA 4PIPA 4RVHA 4RYLA 2IP2A 1O9GA 3B3JA 3E8SA 3KQQA 2VS1A 3LPMA 4F84A 4RTSA 3VC1A 1O54A 2ORED 1U2ZA 3FPJA 2OXTA 1D2HA 3VYWA 5EHGA 3P9NA 4QVKA 5EMKA 3E05A 4PWYA 3UZUA 3GDHA 1FP1D 5GINE 5KQRA 3MTEA 4RX1A 5DM1A 3BGVA 2PY6A 1G8SA 1QAOA 4KDCA 2G72A 3CGGA 4FR0A 4KWCA 5ICGA 2UYOA 3UA4A 3HEMA 1JG4A 1KIAA 5DSXA 3B3FA 3RIEA 1FJXA 4PYQA 1ZGJA 4PNEA 4G56A 2Z6QA 3MHTA 2AOUB 2GPYA 1AV6A 3NVMB 3P2KA 3JWHA 3UJCA 2YX1A 2BR3A 3AWIA 2R3SA 3E7PA 3NDJA 2PXCA 3KQPA 3P97A 4GC9A 5EVJA 3MB5A 3R9XB 2F8LA 3MQ2A 3AXTA 2JH8A 3JWIA 3M6XA 3HCFA 4L7VA 4RSRA 2IH5A 3KR9A 1BKYA 5KS2A 3DOUA 3O7WA 4X61A 3KPJA 2JHCA 4PGHA 3THSA 1RI5A 4GOLD 1EJ0A 5GWXA 4C07A 5KYGA 1N7JA 3KQVA 2PWYA 5FQNA 2PSSA 3ID6C 4MHTA 2ONYA 2B78A 3DLCA 4DZRA 5K05A 5KQSA 1ORHA 3U81A 4HSGA 4IWNA 3EGEA 1RJGA 4XUDA 4R8RA 4DF3A 4YUZA 1XDUA 3GGDA 1KYZA 3H2BA 2OZVA 5EKXA 2FCAA 2ZTHA 5IKMA 4M36A 2WA2A 4OQDA 3UJ6A 3UA3A 3KHKA 4QTUB 2NP7A 4JXJA 1FP2A 1OR8A 3ORHA 4YMHA 3SSNA 4DCMA 3KU1A 5HOQA 3KQYA 2V74B 2VDVE 3EGIA 4FT4A 2BR5A 4X41A 4YUYA 1YFLA 2H1RA 2XVAA 2PBFA 3FRHA 5K8VA 1KPIA 2A14A 3OE4A 3LCCA 1PJZA 1L3IA 2XBMA 2UZ4A 5GM2A 1AQIA 1N2XA 4QQKA 4E33A 4HGZA 1Q0SA 3EPPA 4KIGA 3FUXA 1X1CA 1R74A 4FGZA 4GEKA 4HG2A 4ZTBA 3SMQA 1NE2A 2ZIGA 5ICCA 1VP9A 3EVDA 8MHTA 2ZBQA 4IV0A 4PYOA 3AXSA 3LL7A 3T0IA 3FRIA 3G2QA 2WA1A 3GRYA 3M33A 5E8JA 5CCBA 3M6WA 2AN5A 4U7PB 3UJBA 4C06A 5G02A 3MERA 3UFBA 2NXNA 3EMDA 4QPPA 2ZW9A 4GOND 3DLIA 3C6KA 5CVVA 1VIDA 4CKEA 2ZBPA 3FTCA 4K6MA 5BXYA 1N7IA 1XVAA 1VBFA 4RTRA 2IDJA 3LECA 1BHJA 5ICEA 3GRRA 5M5BA 1EG2A 5FWAA 5CIYA 3C3PA 2UYHA 2ZWVA 1BOOA 3KR2A 1XTPA 1JQDA 1VP3A 1JQEA 5FA5A 1JG3A 4LWOA 5DT2A 4AZVA 2HNKA 1NV8A 1NW3A 4P58A 2Z6UA 3HVIA 4E30A 5CVEA 2OBFA 3MCTA 4QTTB 3GCZA 5MHTA 1EJ6A 2BR4A 5HIKA 2G71A 3HVHA 2AOWA 2IDKA 2N47A 2ZSUA 2ADMA 3WSTA 2VDUE 5EEHA 4AX8A 1WXXA 4YUXA 1KP9A 3CBGA 2P3QA 4V0QA 1VL5A 3BKWA 3EEYA 1EIZA 2PGXA 3BXOA 5DX1A 5FHQA 2IBTA 5EC8A 3GU3A 3IEIA 4X1OA 1MHTA 2FK8A 1M6YA 1BC5A 3TKYA 3P8ZA 4MQ4A 1XJ5A 3IV6A 3NJRA 1NBHA 1X19A 3B3GA 5ICFA 2CKDA 3KR1A 1P1CA 3DXZA 1F38A 5CVJA 1TW2A 4Y30A 2BZGA 3EVGA 3HCDA 3NWEA 1NW5A 3HVKA 4YMGA 5BW5A 3UBTA 4QDJA 2Y1XA 1P39A 3HP7A 1UFKA 3V8VA 1JTFA 3R24A 3GXOA 5DRTA 3G88A 4AUKA 3PVCA 1EAMA 5GOZA 3EVBA 3OFKA 2E5WA 2ZIFA 1EQAA 1NBIA 3PTAA 3DXYA 4B17A 1X1BA 5K0LA 5LSAA 2AN4A 2I62A 4ER5A 3C6MA 5EZSA 3ELDA 3K0BA 3NDIA 4OA8A 2BH2A 4DM3A 3FUTA 4P7KA 5DX8A 1D2CA 5F2OA 3SXJA 3FYCA 2CWWA 5DX0A 5KVAA 4ISCA 4M7RA 3UJ7A 1QYRA 3CC8A 5EMLA 1D2GA 4RTLA 5K0EA 1M0EA 2AVNA 2OPBA 7MHTA 3SSOA 3I58A 2OY0A 4P7FA 1G55A 3A7EA 3OZRA 4E70A 5C9ZA 5DLYA 1YZ3A 2O06A 3TFWA 4BY9E 5JUWA 3FZGA 3DUWA 1NW6A 1SQGA 1IM8A 1RJFA 1ZKDA 2ZWAA 3EVZA 3HVJA 2C7OA 1ZG3A 2I9KA 3DULA 4P7GA 1JTEA 5E2BA 3ANXA 3AJDA 3PB3A 3TLJA 3TM5A 4CTJA 3HA7A 4HGYA 2IIPA 5CCXA 3BKXA 2CMHA 3LCUA 5C1IA 3Q87B 3OU7A 1ZQ9A 5E1MA 3LDFA 4XUEA 1RI1A 1QAMA 2BM9A 2Y1WA 3L8DA 4ER6A 2R6ZA 3UWPA 3FUUA 3HTXA 3BWBA 2JH9A 2ZLBA 3DMHA 3OU2A 3R0QA 4E2ZA 2NNWB 4E2YA 2PXXA 5P8WA 4YUWA 2C7RA 4FSDA 1ZHFA 3UJ9A 2PX2A 2O0LA 4PYLA 4A6EA 1VLMA 1XCJA 5E9QA 4QPNA 1NT2A 2AOXA 3A7DA 5T67A 2HMYB 3TMAA 5K01A 3T7TA 3CJTA 2PXAA 2DPMA 3UJDA 1DCTA 1RI3A 4PGGA 1UIRA 1RJEA 5GM1A 1VE3A 2FRXA 3GIWA 3P71T 2AOTB 1F3LA 2B25A 5IH3A 3FTEA 3NVKI 3FPGA 3BGDA 2PLWA 3FYDA 3UJAA 4R6WA 2YQZA 4RTKA 4PYNA 4A6DA 3M4XA 4EQZA 2G1PA 2YXDA 5F2KA 1JG2A 4PYKA 3IHTA 3ERCA 3BWCA 2ZZKA 4ER3A 1XCLA 2YVLA 1Z3CA 4PCLA 3LCVB 1SVUA 2O05A 3BWYA 3MGGA 4RTMA 3P9CA 1DUSA 3P2EA 3CKKA 4CWAA 2FYTA 4KW7A 5FTWA 2G70A 5LQJA 4OA5A 2IH4A 2IH2A 2VP3A 4O29A 4YV1A 3DH0A 4C4AA 3KQSA 4MTLA 2YTZA 2DULA 3KKZA 1X1AA 5EZQA 3HA5A 3TQSA 4DA4A 3LSTA 1SG9A 4YUVA 1ORIA 4E2XA 3OU6A 3A4TA 4RTQA 2IBSA 9MHTA 2XYVA 10MHA 2ZCJA 5U4XA 1V39A 3LKDA 3E23A 3VSEA 1RI2A 2IFTA 2JJQA 1VPTA 5LR6A 3CVOA 1KPGA 4MIKA 5ERGB 2H11A 2C7PA 3K6RA 2PX4A 3CJRA 3DXXA 3LHDA 3DMFA 4GC5A 4LG1A 5DXJA 2OYRA 3REOA 3V97A 4F85A 2UYQA 4GOMD 1JG1A 2GB4A 5T64A 2XYRA 4ER0A 1XDZA 3BGIA 3THRA 1VQ1A 1TPYA 2K4MA 1UWVA 3G8BA 3OZSA 2IGTA 2YXLA 4GQBA 5EMJA 2NXEA 3NW9A 3NTVA 5CVDA 5FWDA 1I9GA 2AVDA 3EVCA 4CXMA 2PWPA 4IV8A 4Z2YA 4WVLA 3P9IA 4BLUA 3ELWA 4DQ0A 4PCAA 4E2WA 1I1NA 4RVGA 4E32A 4WXHA 3FTDA 3G5TA 3P2IA 5B1SA 2YUIA 5H02A 3OZTA 2FK7A 3HCCA 1WS6A 5BP7A 3RODA 1KYWA 4FSXA 3Q7EA 4PYIA 3C3YA 1YB2A 1G8AA 2NP6A 2I6GA
chains in the Genus database with same CATH superfamily
2WYWA 2VSYA 4QWMA 4MJ3A 2G6TA 1KEEB 1UMKA 2B82A 3WTVC 3MJCA 1N3LA 3PQDA 2Y77A 5EF6A 2OQVA 1FDWA 1Z91A 1CUDA 1GNVA 1U1IA 3BWEA 3DFMA 4FE4A 1X80B 2J5QA 2P9EA 4XLCA 4PV7A 3DJYA 2L2OA 5FYQA 4G85A 2WUDA 4FJ2A 3G2BA 3H2YA 5LZ9A 4CBVA 3ELYA 5E8IA 2BJWA 3PX3A 2CV0A 4HXYA 1GRVA 2JIZA 4LYAA 2A33A 1WUIS 3R8XA 3NIDB 2CVZA 2BTQA 4C0BA 1RLTA 1M8FA 1WCIB 3VKUA 5J58A 3IRRA 2MSWA 2XA2A 3HUEA 5E1DA 3FYSA 3HB9A 2H2DA 4PU0A 5JTUA 1WM1A 2R8ZA 4DCGA 2WJIA 2AR9A 1YX5A 2V6JA 3B78A 3F6PA 5PNTA 2YINC 3IILA 1UBGA 1XTAA 1B0ZA 2AW5A 4GXNA 1LTQA 1OYYA 5HGXA 2LWIA 4YRVA 4QOGA 2EFJA 1UBRS 1A9YA 1R6BX 1U7UA 5KHOC 1NUAA 1NWCA 4RGYA 4RLSA 1HFWA 1EFAA 4UNOA 2FZKA 3X2FA 1Q0LA 4ZT2A 3MKZA 2VSQA 2DA5A 5C4XJ 1VBKA 2C57A 2HKXA 3DMDA 4YFKF 3CCMI 4XSZF 4S12A 1N2GA 4ZQEA 5FFFA 2ODAA 1V43A 4PO3X 2PUEA 1YSCA 4E7IA 2PLYA 4I1PA 4NE7A 1NRXA 2NAFA 1M74A 4CH7A 3DAYA 2FOXA 4ZCRA 3DFKA 4ESVA 3CEHA 3HL4A 1FK8A 3KZOA 3ESAA 3MCZA 5E2AA 4IFIA 4C1BA 4L18B 2HB6A 4CI0B 2ZT6A 3OCCA 5DM0A 4MVJD 3WICA 1M2JA 2MG4A 4JSRA 4MIEA 5KWVA 5GIOE 5HIIA 3IWFA 3FCAA 3RSQA 1DARA 4YDHB 1J0BA 4ZANA 1QHSA 2HOTA 4LC0A 4HWGA 2EP5A 3JCZA 3SDBA 4N7MA 3SX0A 5JYBA 3RYFB 1DWOA 1Z4OA 3FPHA 1AK9A 3PS9A 5I51A 2QGUA 3GV0A 1Z0SA 4ASNA 4BJ6A 1NVAA 4P2GA 2I1LA 3BDAA 3OYLA 1CQJB 4G09A 3H0KA 1ICIA 4JSTA 1PQ4A 4F1JA 1BS9A 3I73A 2K9MA 4U7BA 2GKOA 5FLYA 5IJXA 5DD4A 3GGPA 3OQJA 2PYIA 4MV0A 4UBJA 2V3WA 1G5PA 3WGGA 3Q0TA 4LPSA 2RG7A 3KKKA 1ENOA 1RBYA 3MBKA 4NICA 4DLTA 4G1CA 4KVZA 3D1VA 3KOXA 1DI0A 1LGYA 2CEKA 2OGSA 1UXGA 3ABQB 1X74A 3RHZA 1YQTA 2CK3D 3LUBA 3RVBA 3GLHB 1SM4A 2D7DA 2KIUA 2KE5A 3OZUA 5KYYA 3U9GA 1AUPA 1A9OA 3PXBA 4I1SA 4DT1B 4QXPA 3IYLW 4KISA 1EVLA 4D3FA 2F5FA 5HXAA 2V7UA 3BOQA 4LOIA 4Q7QA 1C3OB 3DPIA 3C3EA 2IV2X 1G3RA 3DLPX 4ZWNA 5T8KA 4L8GA 5IJ0B 5J4KA 4Q4HB 4XH9B 2A5JA 4LCJA 2DU8A 3MBOA 3S1LA 4DA9A 2IOYA 2FF4A 1Z06A 3BJAA 1A50B 1JDUA 2O2ZA 4X8MA 1ZJ5A 5CT8A 1TZLA 1QYCA 3BULA 4OYLA 4HSTA 2CBGA 1DXHA 1U11A 1QV7A 2JIMA 2ZSKA 5H3CA 3WAGA 1PWHA 1UKBA 2DETA 2KPMA 3AEXA 3AHHA 2OV3A 3JALB 1WDLA 2XF5A 3S3MA 2E6UX 1ZUHA 4JN6B 1AB5A 3BRWD 4C7OB 4K8OA 4JLVA 3TCKA 3CNNA 4N4NB 1T1EA 4YLGA 1R9JA 1X77A 4NESA 1N2JA 1OLTA 2AS0A 1SCDA 2QRVA 4ZYAA 2FX3A 3JW4A 2ME6A 4PZ0A 2WA0A 4V03A 1WVMA 3W04A 2FHPA 3KQOA 3PHJA 5K1ZA 2P2ZA 1TX4B 3LC7O 5AKXA 3S1AB 4DCSA 4MR8A 2G88A 4MQEA 2WB1N 3CY6A 1YL7A 1DSSG 1RYZA 2Z43A 2IZ5A 4D9HA 4EQQA 5ILVA 1ZL2A 2GJ8A 4UC0A 5F0HA 4U63A 4X63A 2Q4BA 4EI8A 2WTUA 1J59A 2F2TA 5ALIA 2REQA 3TX2A 1BI1A 3HCEA 2P1DA 1E1CB 1D6MA 1EPUA 1Z35A 1XRMA 1RKTA 3DZKA 5K0JA 1FJHA 2AEMA 2ZYGA 2B1RA 1P2BA 2W0SA 5FKMA 1CPYA 1KAQA 2XIQA 3TM4A 3ZHOA 3ZHQA 1J2TA 4OBXA 2E1PA 1KEEA 4DIOA 4OHYA 4GYGA 4MVXA 4RD2A 4QGHA 4NCXA 4UATA 2VIXA 1DXOA 1MT3A 2ACKA 2AMYA 3H0DA 4KBFA 5EG5A 4F3QA 3PWZA 1EX1A 2NSHA 1XZFA 3RR2A 2W82A 3FFWA 5EHIA 3SJ7A 4LHZA 3QJGA 4C0XA 4LCEA 5FOQA 1GV5A 2A30A 5FFZA 4CCYA 3G1LA 4BVJA 1NQUA 1SU7A 3HA3A 4NABA 5D1NA 5DN6A 1PR6A 4O2AF 4ALJA 1X0VA 5CLQA 2Q3MA 2STTA 1OV4A 3AEZA 1S9DA 3H92A 1OASA 4M7WA 3ENZA 5JC8A 3F97A 5KI6A 4EHDA 3NPAA 3D8TA 4KLNA 3HPGA 1T5HX 1MXFA 3HU2A 1QZZA 1XLVA 2W90A 4I7HA 3KYDA 5HFAA 2HIHA 4EKDA 3DE5X 5IVKA 4QBFA 2BBOA 1RJDA 1YZNA 4BKOA 5DBGA 4HFNA 4XNFA 5EJGA 4B2IA 4C08A 5TXGA 3B1JA 1IB6A 1U0RA 1PLLA 3A4NA 4QBHA 5A4IS 3PLAE 3RPEA 1NBME 3T8YA 3QBDA 5C81A 1L4MA 2FDXA 2YWGA 5F3RA 4UCWA 2C7QA 1U3FA 5BN5B 5AM0A 1T0HB 2DTDA 5LXTF 3CCYA 1DC4A 4J07A 3K70B 1EFCA 2LP0A 3EYIA 1BKSB 1O9GA 2WYIA 3E8SA 2C29D 3COWA 3GPBA 3I04A 1UM8A 2HLPA 2HU8A 4KGVA 5ALJA 1K78A 1U04A 4KRYA 5EIOA 3VC1A 2KISA 1WI9A 1CUIA 4E09A 2QHXA 2NTNA 1X1RA 4AVZA 1U3GA 1TF5A 1MOPA 1DKRA 2QIPA 4NBVA 4U7FA 1QH8A 2IHUA 1XZQA 4PWYA 1GU7A 1LKXA 3H05A 1D8JA 3OT1B 4D6YA 5K8UA 2QROA 5GINE 5K3FB 2OCDA 2EKQA 5GV7A 1MP0A 3P4YA 1G8SA 4I81A 3URKA 3DU6A 5B3JC 2QMUA 3HEMA 3HB5X 1A5BB 3NM6B 4FMPA 5K8JB 5KEIA 2DQ4A 2JJ2D 2B69A 4G56A 1ULTA 4LGVA 4WESA 3E03A 3MHTA 3C74A 3NVMB 1GA1A 2JC3A 2JJMA 2WPDA 1PK9A 1RQRA 1MBZA 2BWJA 2BR3A 4GUDA 2R3SA 1SCBA 1UQUA 3DDZX 4X1IA 5D3MB 4IVNA 3VJLA 2WFZA 3TLBA 3ZE2B 4YRCA 3AXTA 1UPBA 1W5AA 3HXQA 1CRZA 5HWSA 2A4KA 3DYIA 3M6XA 3NHSA 3OD1A 3RIXA 2IH5A 3X43A 3Q8MA 5FI5A 1ZGBA 2YJNA 1RI5A 1PWXA 2PMKA 2BGCA 1P72A 3AMVA 4DRZA 4XX0B 2E85A 1TDJA 3RWBA 1R3UA 4PC3A 4P4GA 3V4PB 2X85A 2B78A 1T38A 1CD5A 4JEHA 1K06A 3LI2A 4EYGA 5JS8A 1B8VA 4OG2A 3TRDA 1XTBA 4EJSB 4KIUA 3HM9A 2RHLA 2BP7A 2MOKA 2GAAA 1ORKA 1IOZA 1AE1A 1AXEA 1BRMA 4HPJB 2WVGA 1M5RA 2FPIA 3L04A 2ERYA 4LYGA 1IK6A 3AI3A 4OQDA 1BN7A 3AM4A 4KE9A 1YZFA 3RVPA 3FPKA 4BE2A 1SHLA 4Y2PA 3WC4A 2XYPA 3BK1A 4GLFA 1YJQA 2BHLA 2O2IA 1EDDA 2L5QA 2KJQA 3KQYA 2O3RA 4KWTA 5FPKA 3BCAA 3F6YA 1YFLA 1US8A 1LNWA 3CCVI 3QF4B 4HRYA 1IE3A 1KPIA 4HNVA 1JB1A 2CMDA 3LCCA 1E7SA 3TLXA 3N2LA 3RUEA 4HAUA 1MJGM 1VPLA 4Q12A 3QX8A 4M4SA 1VJRA 3PHIA 4Y6OA 2WSIA 3U7GA 3S1AA 4CHUA 2JK0A 3BGSA 1QGAA 3SMQA 2QD1A 2W6ID 1JU4A 1NE2A 1JV2B 1QIFA 2G4CA 4PC2A 1G6HA 1VP9A 3S40A 5L3SB 3Q98A 3IQZA 4G9YA 2E82A 2BW0A 2OA0A 3ZTTA 5L4LA 3W5DA 4CGYA 3R7AA 2CFXA 2E60A 1DUVG 2D7CA 1KK3A 3EARA 4AJHA 3MT9A 1OGJA 3IIIA 3C39A 3PGMA 4N9IA 5FFMA 5ERYA 4E6PA 4RCYA 2HTFA 4BO4A 3A6JA 5SZHB 4Z0TA 4EJSC 4AFNA 4L5IA 1RZ3A 3RVLA 1WHSB 1WUKS 4XM3A 1ZN8A 2EHJA 4LHSA 4HN9A 4JEUA 3WWPA 3WGNA 1MOSA 2VKQA 3L8ZA 3GLHE 4DUPA 4EBBA 4R2XA 5A4KA 4RDIA 2AWNA 3UAWA 2YV3A 3UGKA 1JG3A 4JWKA 1Y9AA 3PNBA 4WH0A 3OQOA 4Y98A 4IS3A 5CVEA 1QQTA 2PBLA 2OBFA 4CTNA 5JISA 4GT1A 2J45A 4J1QA 3B1FA 3BZWA 4NH4A 4Y2GA 4HYEA 1HSTA 1C2YA 1PW5A 2GCGA 3D02A 4CETA 5DM6F 1T3TA 2Q8PA 5DEOA 5LHHA 3R6LA 3ZIUA 5DLQC 5TQ2B 4BFXA 2N47A 4R2LA 2YWJA 1CFZA 1VA4A 3DL4A 5D6NA 3GEMA 1T15A 2F17A 4ZYVA 1RJ9B 2DC1A 2Z2ZA 3WMWA 1J7JA 2M0MA 1C81A 1DMRA 2R0QC 5LOVA 4BBRJ 1QCYA 1QYWA 2LF7A 1A9QA 1PE0A 3AJAA 4BWYA 2XOKA 2QW0X 3COZA 4JYKA 2VI6A 2XUPA 3E8XA 2CRGA 3HDTA 4G1UC 4GNRA 2QQFA 3E9EA 4LRSB 3WLJA 4B5KA 2AQHA 1GZDA 2D1YA 3KJNA 3L02A 4K40A 2B30A 4D4KA 4BRUA 3FOFC 1Q7BA 3L7DA 4L50A 3UUWA 2K27A 2DY0A 3ZEAA 1P5FA 1I4OA 2UUZA 3EVGA 4LRWA 2JI9A 3BAZA 3F7NA 4OJNA 5CCDA 2H7VA 4TQGA 3RPQA 3A6ZA 5HKKA 2X1EA 1GQYA 1QDUA 2NNYA 1U8XX 1T36B 2Q4OA 2WAOA 4M3GA 1SB9A 1S6LA 3WLHA 2INGX 3WQBA 1SVIA 3UYKA 2QTVB 1G3UA 3PR2B 3EFOB 2EGUA 1DPFA 3PJDA 2D2EA 3T15A 5E3HA 4HUTA 2WHPB 2AB0A 4KPUB 4MGEA 3EVBA 3EQLF 2EF0A 3DKVA 5JJ5A 3I30X 4QGFA 3ZZNA 3BZKA 4BX2A 1P1IA 2PGDA 1UMDA 4HUJA 3ZHXA 4B45A 1EDZA 4MGIR 4B17A 4FFDA 4PGFA 4TWZA 3HHGA 3IPXA 1E92A 3C7TA 3P2YA 4CZZA 4FOLA 4DR4B 3QHQA 1Q5PA 1C1DA 1UJBA 1CC1S 2XLBA 3TMYA 1AMUA 2OZKA 3IBYA 4CDMA 1WX1A 2E35A 1JILA 2DH6A 3EQ2A 2BHYA 3AGPA 2DUUA 4M7PA 4RFSA 1GG8A 4Y6SA 4Z6KA 2E4YA 4BV8A 2IHBA 1ZIDA 2AA3A 2IZZA 3RSOA 1Y9EA 2HCJB 2ZDHA 3LQFA 4G2TA 4TRJA 4JT2A 4UM8B 3LKBA 5AK4A 3ZJVA 2FFRA 2PUHA 3FHTA 4P7FA 3O0DA 4FYVA 3OZRA 1X1QA 1X7XB 5THKA 5JUWA 3GLIA 2M2EA 2BMAA 2ATCA 1NW6A 5GTIC 1SQGA 3DDWA 3BMXA 3JQBA 3OCVA 4G6TB 1YUMA 2FEWB 2VCYA 2W11A 4R3WA 5E2BA 5EA2A 3EPZA 4OO3A 2A1UA 1U6JA 2WU4A 1NQXA 4PX9A 1OXUA 3C4QA 4IG4A 2CMHA 1FTNA 4CV0A 5EHXA 1GGNA 2BM1A 3HYNA 3AG3H 3AYZB 4RQTA 3UT6A 1R27A 4RB0A 4L78A 4G4GA 1MQAA 1Y1SA 1YCDA 2JJ1D 2Y1WA 2WDPA 3RRJA 4D8WA 4PN3A 1P1FA 3ZGOA 3GZTB 4DC1A 3PI7A 1W0UA 2FQWA 1OI7A 4Y6RA 3F47A 3VHRA 1T9KA 1TPZA 3FFAA 2O0LA 5K6AC 1JXSA 5HE8A 4A6EA 1ODLA 1Y4ZA 5E9QA 2WJ3A 3SXUB 1QHYA 1IXSB 3CPSA 4DTCA 5K01A 4LGWA 4L15A 3AG5A 3T7TA 3RARA 3Q9UA 3WA6A 5F9HA 2YJ3A 4E07A 4GKJB 3AP2A 4B3GA 4B3BA 4XD7A 3PXGA 4HDUA 4QASA 1H0RA 4L0ZB 1LEAA 3WXMA 5L8VA 3WTCA 1X87A 2JAQA 1G6OA 1KSHA 1PJLA 3FYDA 3LLMA 1S1CA 2YQZA 1L5WA 3QVTA 1SQSA 3HA2A 2KIMA 1U7XA 1W0CA 3QLUA 1QG4A 2YZMA 3FF1A 3VOTA 3SYMA 3VZRA 1NK2P 4MI1A 3S5UA 1JAYA 3KP4A 1EUCB 5K51A 2IU0A 4AY5A 1G6KA 1RM3A 5G40A 2UU9B 3E3LA 2NVQJ 1KTVA 2ZAYA 4KQXA 4AW9A 2VF4X 1AT1A 1AGRA 1P18A 3TW8A 4ZYEA 3WQHA 4FTHA 4PLWA 1DUSA 2C9DA 2ZRMA 1EH6A 2ESHA 3WDSA 5AM2A 2XOKD 2DA3A 2Z33A 3QKRA 4OWRB 4NP6A 2LIPA 3DFFA 2RI6A 4KYVA 4RH1A 2ZIXA 3WB9A 2VJNA 2UVDA 3AG6A 2D2WA 1JQJC 1ZK8A 1XTSA 3L77A 4C3IJ 2Z4RA 3HA5A 3OUTA 2HOAA 3E5QA 3OR2C 4FXPA 4DA4A 1DQYA 3VVCA 4DV7B 2ZXJA 2V9VA 1TQ6A 2Q2WA 2V6BA 4MVJF 3SCZA 2PE5A 4ZYTA 1NXWA 3KM0A 5DNEA 5EE9A 5FPYA 3VNAA 10MHA 3DNPA 2LOOA 4U7DA 1E6UA 4OI2A 2OESA 1SC4A 4TL8A 3PSFA 2R7DA 1Z6YA 3L6DA 2KKOA 1KIMA 2ONCA 5F76A 3FXKA 4WCFB 3V8JA 3E1KA 3CP8A 1V1JA 4HRXA 4RW0A 3U7IA 1YI1A 3B3AA 2AEJA 4QQFA 4BNVA 4ZI7F 5LKRA 2H54A 4DJEC 3V1NA 4B3SB 3AJ8A 3C3XA 4RHTA 2GBLA 3GUDA 1J9ZA 2HPZA 3KJFA 3SEQA 3OZSA 2XNDD 4MV9A 2BDUA 4NK5A 2LPMA 2C5GA 4BWFB 2D3TA 2GQQA 2L7FP 2ZE6A 1DC6A 4IV8A 1MLDA 2JVIA 1V16A 3K7EA 3FIJA 4JI1B 2P9ZA 2W2MA 4LE1A 3VHQA 5H4GA 3KSAC 4X8OA 1A69A 1ZIPA 2WYOA 3DGFC 3O83A 4AM3A 4EUHA 1GWNA 4WXHA 1M2EA 2Y2ZA 1U0SY 1XSXA 1M66A 1I7NA 1P4HA 1LPOA 1T9DA 3QPTA 3P9PA 4JASB 1XGKA 3EH2A 5DHRA 3GTOJ 1ECBA 4YRDA 3RYHA 2BGKA 3QWBA 3RODA 1RSZA 2ZUVA 5DD8A 3AIIA 2Y9YA 3V8KA 2YSRA 3H8VA 3QPVA 4UPDA 3KVYA 4IO9F 4NRDA 3ZV6A 3T12A 1KQGA 1V6CA 2BZSA 1CEYA 4XYLA 4RVFA 4RETA 4L4YA 3TNLA 2F6CA 3UATA 2BZ1A 2IJGX 1LDKB 1Y37A 2IYWA 3CLHA 4MTCA 3F78A 5CLLA 4F5ZA 1M10A 4MPPA 3IJ5A 5HJ2A 4JZYA 2HQRA 3TOXA 1KYQA 3LDHA 1DAKA 4NONA 1SUIA 3L00A 3DTYA 3FUWA 2IEYA 5AVKA 4N4OB 3GG2A 5A5VA 1I32A 2CDAA 2G04A 3K0FA 5HKLA 2GA2A 4WN3A 1GA6A 4ARZB 3HWRA 4Q4CA 1G0OA 2YS6A 4JYAB 4BMOB 5LEKA 4KRXA 1VQ9I 2HHHB 1UZLA 5JXHA 5GIPE 3NIWA 3TLGB 2XGEA 2H6BA 4NNOA 4A92A 2I1WA 1TT5B 1LTHR 2DF8A 3OM8A 5EGSA 1KOLA 1NOKA 1Y34E 1MNMC 3FWPA 3G0DA 2OP1A 4TSKA 1OXSC 2GZSA 5FOSA 1MBFA 1WZUA 3PC8A 2OAEA 3UENA 5DF1A 3RF6A 5L3EA 2OO5C 2YX4A 1L8LA 2ZO4A 2QORA 3D6FA 1XEXB 3MUEA 5FIUA 4RTSA 2YBDA 5HEKA 1QANA 2DFLA 3ABTA 3AONB 2TCTA 1H8HA 1ZIXA 3IESA 3HFRA 2YZKA 4F46A 3ZLUA 1AUQA 4RZ2A 3EG9A 1JSXA 2XB4A 3N2NA 4QUKA 2LE0A 5CB4B 1TO6A 1O08A 2IPNA 4JY7A 4UEJA 3Q3GE 4W8HA 4AIRA 5JDCA 1ZWLA 1QF7A 4MV5A 2DJ5A 3T1OA 5JQGB 2O3SA 4WZBB 5LZ5A 2VN8A 2HEGA 1MC4A 1AA9A 2B9EA 2C00A 1QA6A 3L18A 4UPVA 3TAXA 4XKWA 4RF5A 3KEYA 3N8GA 2W6OA 4D8VA 4J7AA 1K92A 4L5JA 2ENUA 3BSFA 2YJ5A 1U4NA 4ZCTA 4KREA 1X8KA 1HW5A 1Y4DE 3RSCA 4BP3A 2VA8A 1OH5A 1Z4IA 4RPCA 5KPJA 5GV8A 3OJFA 1QMGA 2ZBVA 4GXQA 4CYMA 2R1TB 4O02B 1L4KA 1ZHOA 1M5UA 3C1DA 1DU0A 1SZDA 1VL8A 1PQYA 2YY7A 5I3CA 4BL0B 3ME5A 4LDZA 2IGOA 4BNCA 2PKQO 4URFA 3ROMA 2E7WA 1BC7C 3DAOA 4IIVA 1CRWG 2H18A 5D87A 4B0PA 1YR7A 5D4RA 1DX9A 1S0UA 5KNLA 1YZLA 2CXHA 3OCUA 4PLFA 1RZ4A 1O5TA 3OYNA 1H5NA 5TJJA 2Q5LA 3K35A 2Q41A 4OQEA 1J2UA 4Y2UA 1ZJ4A 2C42A 5CCEA 3THWA 5NULA 3M0EA 4NJMB 3UJBA 3H1CA 2MLKA 2PMBA 1Y7LA 2UYYA 2OQRA 3AOEC 2OZUA 2R1UA 2Y9PB 2X6WA 3K2QA 3E61A 3QPSA 4BAYA 1JLMA 1GZ5A 1TEHA 1C3XA 2VLIA 2VSFA 4KDFA 4PSUA 2YMPA 4ZVKA 2OORA 1JG7A 3OCJA 4EUEA 1BXKA 1O1YA 1KVQA 2C9OA 5ED0A 1RABA 4DV3B 3U7QA 4XUGB 3NM4A 4NFHA 3ABSB 1WD7A 4L0QA 1E9CA 4JC5A 2OFWA 2O3TA 3IQEA 1KDTA 3EFEA 1K4KA 2EJBA 4CF4A 1IBRA 1PZHA 2G63A 2L7ZA 2NVYJ 3QLVA 4D8UA 1MBGA 1UZAA 2HYFA 2PAFA 1FNMA 4D3ZA 1SC3A 1DFIA 3E53A 1RQPA 2XTMA 1N77A 3RWOA 4UOEA 2FZ5A 3I2KA 5G4KA 3G7SA 3ZQFA 3DKRA 5DHQA 3LDGA 2HTSA 1P7WA 4UOZA 3V4LA 3EGVA 3RQ4A 1D09A 5JXWA 3HBNA 5DRYA 4HZGA 5AHWA 4AY6A 4EG0A 2XEDA 4K2HA 4DA8A 5BOVA 3EY9A 4L9JA 1SUEA 2EJUA 3GJSA 3ISJA 4BTVA 4PYJA 2JIZD 1K1EA 4EEFG 2PSDA 1O8BA 2JGNA 3KL4A 2H1FA 3D6NB 4R9VA 4QXAA 1U4SA 4TS3A 1JGGA 1R6AA 2QI9F 2A1TS 3HZOA 1A6IA 3CR3C 2QN8A 4ZCSA 1LVKA 4PM4A 3QV1A 3E9CA 5C4GB 3SM9A 1V16B 1NX9A 1OE0A 4COKA 4MWEA 2EP8A 3ADBA 2YFQA 4GPAA 1VL6A 3FGZA 4ZVOA 3T5GA 2QAJA 4OMUA 2JG3A 4PYMA 3GGGA 4D97A 4OHBA 1ISGA 2ZRIA 3OIDA 4GQIA 1M1YE 3N7AA 3E9YA 1UUFA 3E6DA 2W83A 3O8LA 4PZCA 1CRLA 4WKCA 1T0JB 2RIPA 3F98A 3KEOA 3PQ3A 3GLVA 5BNZA 4IVPA 4R8SA 2OFOA 1DIOB 4KDRA 1GAEO 2AEFA 3HB7A 1ZD1A 3JWEA 4DCCA 3I72A 1BJKA 3BERA 4PONA 1I1GA 1VE1A 4NMHA 4OAYA 3U0VA 3WL5A 1O0SA 3WWZA 4BUCA 1I50J 3EY4A 3PUJA 3GJ0A 4KR2A 5HPYB 4XICA 2WSMA 3PGLA 4NCBA 4P32A 5BMVB 3GMDA 4N8EA 4PZPA 2HWUA 3ZS9A 3RCBA 4FYJA 2BV6A 3VU9B 1XDSA 1FPQA 5EOVA 1YI2I 1CUGA 3O8BA 2AOTA 4II2A 5CLFA 3A1EA 2IVZA 4NC9A 3TB6A 4OIPF 1SXIA 2P3OA 2FRHA 1CETA 1U2SA 2MSCB 4IQ0A 3B1ZA 4J94A 1LU9A 1G6Q1 3S1MJ 5I9NA 3JSXA 2NXCA 1Q0HA 4LCBA 2YOHA 1C4KA 4KUGA 5EKUA 5FPPA 2RCNA 2VAMA 1U1FA 4DEVA 3KTAB 4QO8A 3RVRA 2PUWA 5CNMA 1PDWA 2EW1A 4MI9A 3C85A 5E4YA 3DO5A 3PRJA 1NR1A 3FTNA 5KJEA 2Z3YA 2FW0A 5SZKB 3EVFA 4LISA 3V7FA 1LSOA 1TA0A 1JEYB 2NQ2C 5HDKA 1LBSA 1IN6A 1FNCA 3PX2A 5FLKA 4EPWA 3TKAA 2WV9A 5K0BA 4EJ0A 3BTOA 4QELA 1P6QA 3IQHX 4NZPA 4LF6B 1M2VB 1QE0A 1ZZEA 1YRWA 2AJCA 4JFAA 4K5QA 4U2BA 4EABA 2LBFA 2JFGA 3QAHA 1JT6A 1ZRFA 1IUPA 3MNFA 2Q4TA 1UP4A 4YIKA 4ZRNA 3VISA 4MVWA 3JQDA 2D0PB 3CURA 4YJ3F 2V98A 1BW5A 2XMRA 4HDOB 4OFXA 1JI8A 4F84A 4ZMRA 1PF7E 5BQFA 5DGXA 5BV1A 1ETXA 3HV2A 3UWSA 3HKCA 1GNTA 4CV3A 2C9BA 3PNPA 3WGKA 1B0PA 2V7PA 1X7ZA 2IYQA 5AKEA 5AOCA 4AJLA 5HOEA 2YN0A 5KJ1A 1W5SA 3U4DA 5KQRA 2OLEA 4TQ9A 1U9NA 1FF9A 4N40A 4P84A 3GJ8A 5TS2A 4Q3OA 1JTVA 2Q2NA 3IUMA 3NHAA 1XNRB 1EFRD 1T0UA 3OT1A 3W06A 1E2HA 5KNDA 3N0RA 2F1IA 2HQBA 2CXRA 3DE6X 3CVYA 2ZKLA 3MWFA 4JUIA 3WNDA 2B34A 3TIIA 4M8LA 1O9BA 3PL8A 1VPEA 2C77A 4DL9A 5K7FA 3KYIB 1ZK4A 4A0RA 3ESDA 3EXEA 2Q29A 1U9CA 2DGDA 1BR4A 1VQLI 4BJ1A 3G0HA 4JIGA 1Q77A 3WL8A 4YHHB 4A8JB 3KHTA 1JT9A 4N5IX 4RCVA 1QF9A 5KBYA 2YN4A 5K05A 4PQYA 2HYIC 4X44A 2NGRA 3QF7A 3RSLA 1KU3A 4HBLA 1K86A 2J5XA 3O1HB 1R2QA 2J7KA 3F49S 3GQVA 4MVJA 1WQ3A 3ZQQA 1Q0ZA 2WF5A 3P20A 1OI3A 4Q7LA 3RJ5A 3DZIA 1RM0A 2WM3A 1GPYA 3ITKA 4NZOA 2HXIA 3LFKA 2FCAA 4M9SA 2HJVA 4PANA 3R4CA 1NC3A 3K9FC 2QL6A 2PL1A 1YJ9I 3ML1A 5AJUA 3IUQA 1L6RA 2JAUA 1P4RA 3AUAA 3TRIA 3I9JA 5BV7A 1DEHA 4TS4A 1JALA 3M9WA 1XZIA 1NJ1A 4U0YA 1ZRHA 3JZIA 2XPVA 4PXAA 5F5XA 4JQCA 4ZHQB 4D4MA 1C41A 1FEXA 3DMYA 2B9VA 1IQPA 3A4VA 3FRHA 1UKCA 4S1WA 3HGMA 4L95C 1AZTA 4FLEA 4CMAA 4DKXA 1S3IA 4HDQB 1S2NA 4GO1A 3AFHA 5EINA 5HZGA 4ZTBA 5CT9A 2C82A 4MQFA 1QGPA 1GADO 3KT8A 3R7SA 3JYHA 1IXYA 2ZJQF 2QBYB 4F04A 3RNLA 4IV0A 3GJ4A 3QMPA 3FRIA 4MQLA 2QZSA 3M33A 4U3JB 5CFNA 2HDOA 4LV5B 3OIGA 1KJQA 2R86A 3GA5A 3F21A 2NV2B 3MERA 3QOYA 1C0WA 1QPMA 2VYCA 4O8ZA 3GNSA 1CY1A 1E0KA 1C3EA 3H84A 4S0XA 1S8OA 4F12A 1MGTA 3LLCA 1ONSA 3I5MA 2TRTA 3D8BA 2XA9A 1APLC 1ZMTA 2BEKA 1BHJA 2BISA 3OYAA 3IKLA 5JMPA 3UCEA 3QVVA 4TL6A 4UHTA 1PR2A 2WI8A 4Q3LA 3BPSA 4ARBA 5IAOA 1TQ4A 2KJCA 2K7FA 2J3EA 1OH7A 5CFLA 1DWUA 3DOHA 1JQEA 4UDXX 4YMIA 2CUEA 4HGNA 1BFUA 2W4SA 2EINH 4HPQA 2CFSA 2GTPA 2Z3WA 4JDUA 1G21A 4ZO8A 3RRYA 2I54A 4JBAA 1O6CA 1H2EA 2EK5A 2XMSA 3D7SA 1ECJA 1O94A 5IPAA 3A6FA 3I9V6 3MLAA 2P7VB 4QTTB 1ZLKA 4RA9A 1YQUA 4UXJA 3UMBA 1SIBE 2X8BA 4RKWA 4TYNA 3WTUC 2DBQA 3S5JA 2ME0A 4CL8A 2Y68A 1C30B 3QSYA 2IDKA 1YJNI 1ZW1A 3I6ZA 4I4LA 4D4HA 3ADOA 4BACA 5C35A 3H9JA 3CBGA 4DJAA 3A3KA 4H1UA 5DI9A 1W19A 2UXCB 4CR7A 1GU0A 4NDLA 4AF8A 1ZRCA 2GHRA 2EIKH 3T61A 2H2IA 4N5HX 4R3UC 1OYWA 3PIPF 1EIZA 1JHOA 1YKGA 3GDWA 3Q12A 5EC8A 5HS8A 2R87A 3LLUA 4DNCA 1FXWA 3EGWA 4YAOA 5LIRA 5BYAA 1TRHA 1WMFA 2HUNA 3AC0A 3UKDA 4MQ4A 2IOHA 3ZQ4A 3NEJA 2V0GA 4O4LF 1OYIA 3OSUA 3VKFA 2V4UA 2CMFA 2QZ8A 4OAQA 2BZGA 2KMUA 3WKBA 4ND8A 1OWNA 2LBFB 5ALUA 3STTA 2W5UA 2YHSA 1IUOA 2MSDB 2TDXA 4MLCA 1Z8DA 4UVDA 4N41A 2PN6A 2O6GE 5JXJA 4HATA 1UBUS 2SCUB 5LLQA 1X1TA 3KFLA 4P31A 4C6TB 2BFWA 3GBSA 5C1DA 2YZ2A 1NNUA 2XDQB 2NU6A 2VBYA 1MBEA 3C5WP 1W4ZA 4FQ7A 1OX4B 4J3JA 1PNRA 1XN1A 3ZV4A 4AZ3B 3GEZA 1X1BA 5LSAA 2I62A 2TMDA 1H89C 2FMLA 3EFBA 4NHEA 4QBGB 3CVJA 3NPMA 3CSSA 3C6MA 4WD3A 3ZBUA 3SVLA 4RESA 1K8XB 2K2WA 4N48A 4Q9LA 4Z7QB 2WYVA 1KC1A 1IRFA 4DM3A 4F97A 4YRKA 1W75A 3L1KA 5CBPB 4C29A 4FONA 4ISCA 1LPAB 1FB5A 2G4LA 5EXEA 3NNDA 1TMOA 1RP1A 3KTFA 3UJ7A 3E1GA 5I5EA 4LMBA 1RDFA 2AX4A 4D02A 2AVNA 2ZSIB 2I8LA 4YAEA 3U7JA 3PHCA 3B6CA 5CU7A 5DEIA 2ZCVA 2QX4A 2ZIXB 4JK1X 4RD4A 2XZPA 3T8RA 2BE7A 3GPIA 3BG9A 3R0IA 1JJ6C 4BKXA 2ZB3A 3BJIC 1UPXA 3PIRA 2DWCA 4PRLA 3RLIA 2H7XA 2ZWAA 5LQMA 3JASB 3RBXA 1RRPA 2WWXA 4ESEA 3FSGD 2AJ8A 2VDMB 1N2OA 3AJDA 3ANXA 3L06A 4S3MA 3TM5A 3FKQA 5DNVA 3F9KA 4IJVA 4A3FJ 2EW8A 1RLUA 4HAVA 4N6OA 4MWBA 4OP2A 2DLLA 1T4MA 3VTZA 4DQUA 5JYDA 4I50A 2F3RA 2OFPA 2W71A 4ITRC 1NMSA 2B1JA 4FGWA 2F3QA 4LXXA 3ND7A 4MRMA 3BQZA 5DIZA 1XU4A 2Z6VA 2Q46A 4EATA 3D1JA 2BEUB 4JYPA 2B6NA 5A4JA 3JRDA 4R8MA 4KQWA 3F8CA 2GFIA 2PXXA 5D5UB 4R84A 5P8WA 1I6WA 2ZI5A 2QVGA 3OIYA 1CZHA 2PX2A 4W7IA 2ZBFA 4EEKA 4PYLA 4EZBA 4R1SA 2BN4A 2HQAA 1FLVA 3HUDA 3TQNA 1RBQA 2L0XA 2HA3A 1XP8A 3IDFA 1MB2A 3QVGB 5CDFA 1IYZA 4YPVA 1MV8A 1JFVA 2PXAA 1F4PA 3B6EA 4J00A 4O4IA 1GZUA 2JANA 2IYXA 4M0MA 1PW7A 3K6JA 1ZMBA 3T94A 3W5JA 2C1XA 1R6VA 2EEPA 2HSZA 4C2MJ 1DTSA 2QQGA 2VBFA 4N8SA 4CLRA 1QIJA 1GZ4A 1ZR4A 3ETEA 4P3KA 2B25A 3GMEA 2NZ2A 3ML6A 2X6RA 2ZRCA 3D4IA 1QUFA 3LVQE 4KZKA 1HR0B 4RGUA 1CJBA 4HEA6 2OAZA 4YCAA 1YQAA 4LF4B 1DOZA 2P2SA 2JAWA 2P9BA 4KO3S 3RZOJ 1SUDA 4IDFA 2VPYA 2RCYA 2ZZKA 3REFA 2E19A 1SAXA 1KFCB 2BD0A 1EGHA 2GESA 4JT8A 2HFKA 5FBQB 3ZCXA 4EHAA 4R71A 3GPCA 4CG3A 4NL4H 2PMZN 1G291 3UV3A 4BVBA 4E14A 2XQKA 4BV3A 1GTG1 3H11B 1J5YA 1H05A 3OM1A 6ADHA 4UHJA 2HNHA 1E3WB 3VDMA 2YHIB 2CC2A 4NCHA 3QLVC 4UBIA 5EQTA 4EDHA 1ZC3A 3TTVA 2WPNA 3L82B 3NGXA 1XLWA 1X1AA 3OFND 2Y0MA 2YPRA 3PT5A 4XIJA 5D2CA 2BYTA 4U4AA 1PFWA 4RSHA 3OJEA 1TQ2A 5FUYA 4DIQA 1VRVA 4XOUA 1TM2A 1N5RA 3OQIA 2WC2A 2LKCA 2V7FA 2QLTA 3VSEA 1CNFA 3E23A 5EJAA 1RI2A 2IFTA 5DGTA 5IH7A 1R22A 2M8GX 3NWTA 1FMWA 4ZTZB 2JIRA 4AX4A 4B34A 2J5OA 1CG6A 1DBSA 1UBLS 5ED4A 3A1TA 3ONQA 1A71A 3AI1A 5BWMA 5E7QA 2M6RA 3EWSA 2UYQA 2YV2A 2FNPA 4HDNA 5KYKA 4MV7A 1PD0A 3T3DA 1FMCA 3ONFA 4X65B 4EI2A 3Q0UA 4YWHA 4FYIA 1ZSNA 3AF4A 1Y1LA 4IX1A 4O6VA 3FVRA 4KN5A 2Q28A 2CQQA 4L5YA 3AM3A 1ETOA 5K7HA 2VP9A 1K0FA 1BQ3A 2A58A 4E4TA 2LUOA 5IKXA 1V8DA 3HU1A 1T5OA 4GYKA 3RTRA 3Q15C 3FWKA 5DGIA 5J8CA 1V45E 4HFJA 2CE2X 1WDMA 2BZ0A 4OK6A 4YJGB 3VR4A 2EIJH 4BMXA 4F6CA 3CNOA 2Z16A 1WNTA 3OAAD 3P2OA 4FGUA 4KMRA 1XRRA 1O6FA 3FDZA 4C5AA 4D9CA 2Z1DA 2BGIA 3ZQIA 3Q3VA 2XZTA 5DGDA 3Q7EA 5F78A 2WV1A 4UVBA 3TGNA 3NHRA 4G37A 2V4MA 1HRDA 4FS8A 1R5NA 2B0CA 2FR8A 4CT5A 1UM9A 2F9FA 4QGSA 2FW1A 5T7BA 4RAQA 4ZALA 1P0FA 1LK7A 3OKCA 3LUKA 1QK5A 3W2FA 5JD4A 2ZXWH 2PV7A 4DR2B 1X1PA 1T95A 3Q5FA 3LPCA 1LFDB 4WK6A 4JJAA 1R10A 3AJEA 4QFMA 4TLDA 4Y1EA 3THWB 3ERMA 3SHTA 1FQOA 3SMVA 1UT6A 3V2UA 2B2CA 3QFFA 4QAQA 4AECA 4MULA 1TJNA 5GTHC 4ECAA 2TMYA 5B2EA 1W73A 5IM5A 2AHQA 3GN2A 3NKVA 2JLAA 1T0FA 3QG1A 4HBZA 1J1ZA 1KDPA 3PFGA 4V2UA 5EHNA 3MSXA 1Z05A 2G1JA 4BNIA 4WKNA 1IBSA 4FDMA 4EYKA 1IUKA 4TKVB 5BVGA 3SQWA 3NWBA 4JP2A 5PGMA 4DY4A 5LQKA 2GN2A 1B6GA 3UMYA 3M6UA 1ZJYA 3MA0A 3OZWA 3T7KA 5D6OA 4JI6B 1QUEA 4GKAA 4WBNF 1ZMXA 4MCIA 3RHFA 3OF3A 2C5AA 2FSFA 1KHHA 3CCLI 1QO0D 4K3UA 4WFJA 1CUWA 1Z7EA 2ZCUA 1QORA 1W76A 4XSVA 2G67A 4EM0B 1FFBA 1XR3A 2X23A 4IJQA 5G4KB 3HYIA 4BAUA 4W5RA 1RKQA 2P2GA 4LZJA 3CESA 3O8NA 1G1AA 4E12A 2VWGA 3BJMA 4GR4A 3CN7A 3ZKAA 1COWA 3Q9VA 2ZE8A 4GPBA 1KAMA 1J2XA 1U98A 2RGUA 1P1JA 4MAMA 2FUCA 3C7KA 4AJPA 1OR7A 1G0NA 3OLZA 5H70A 3V2IA 1E4VA 4PC1A 3BC8A 3EFHA 1QGED 5K0TA 1K6OA 1NHWA 4L74A 1I4WA 1MVNA 2J6HA 3GCXA 3V1YA 3M8JA 2ZSAA 3PCXA 1PTJC 5E1BA 3ZTYA 1D0VA 2XQVA 2F43A 3N39C 4MWZA 1D2NA 3SIRA 1XDWA 4BU1A 2AYZA 2XE8A 3N0VA 5AXDA 5A5FA 4M8IA 1TJ3A 3L8EA 4A73A 2FI1A 2PKWA 1H0HA 2K86A 2Q07A 4K03A 3R76A 3U4CA 3VR2A 4B40A 5JRZA 1TEZA 3QFTA 2IS1A 3U7FB 3A25A 1R7JA 2OHFA 2PUTA 2WWTA 2X8JA 1ZWKA 3ZU4A 3LA8A 5F27A 4CQMB 3WQQA 3Q7IA 1UWKA 2JZNA 4LJ6A 2IHVA 1O4VA 2HVQA 1AKMA 2ZYTX 4B4WA 5IDXA 1IC8A 2JEZA 3DDSA 1R0KA 1D4OA 3WMEA 5GAEJ 1OU0A 5AMXA 4KR7A 3GBGA 4WXMA 3P5SA 4RWZA 1YW7A 2GPAA 4H08A 2BCGY 3PUWA 2NTJA 4UUMA 1YR3A 1MO4A 3G0BA 4URHA 5HLHA 1CY8A 1QX3A 1JLHA 2QNIA 2W4QA 2AW3A 1GKKA 2OGWA 2P78A 2ZJ5A 3GGJA 3MINB 2Y48A 4ODIA 4ZEOA 2RGNA 2PGLA 3HRTA 5B7QA 3AR4A 1I10A 2IP4A 2R62A 3C6YA 1BS1A 4AP5A 1WXEA 1Y7IA 2KHMA 2OD9A 3W6ZA 2V59A 1Z5NA 2LXNA 2PX8A 3NHYA 5JJBA 3RSNA 5AW6A 2RHTA 4U7WA 2JDIA 1EVQA 1TZBA 3ROFA 1E2BA 5CYVA 3T4UA 2BT4A 5FO1A 1BWPA 1YVDA 3O4JA 4N5MA 4HXEB 4K8RB 5JJLA 4YI5A 3CCSI 1VXRA 4KYIB 1X70A 3ZZ0A 4XA8A 4BCCA 4C6HA 1T25A 3M82A 4UDNA 2YR2A 4L5AA 4CE6A 2QRHA 3WL3A 4ERXA 3A1NA 1RP7A 2PRYA 1GFSA 1PNVA 5ALSA 4JD5A 1X7WA 1XI2A 1U5TA 4MWGA 2O8XA 2GJ9A 1YT5A 4CIAA 5EJ4A 4D5FA 3U31A 2HLHA 2P0AA 2QLMA 4TVKA 1FUYB 4ACBA 4BRSA 1Y89A 1HMPA 3UWOA 1G38A 5FDFA 3BMQA 2ZNYA 4IBOA 3FTFA 4OX9B 1SH7A 3L0YA 2QZJA 3LZCA 1X86B 4JLNA 4RGVA 3TPZA 4BU0A 1M0WA 1PJ8A 4IJKA 2M98A 2NYUA 1VFCA 1E1DA 4HVTA 1IJBA 1M6NA 5JFRA 2ET6A 2IXGA 3L7LA 4RYDA 4EYOA 2VEOA 2Y27A 4JWTA 1L5FA 4X97A 3TDKA 4MP3A 4EWLA 2K85A 4AQ7A 5IYDJ 5AUQA 1PYOA 4MIYA 2VLAA 2CSOA 4M55A 3AOEA 3A02A 2YZNA 3PKJA 3G2OA 2PLFA 3MAGA 3MYYA 2FQ3A 1E5XA 3OYDA 1S3JA 2QJRA 3AI7A 3ETHA 4R8LA 1JHHA 2Q2EB 3ZQ6A 1BIAA 1BU8A 2EX0A 2NU9A 1KR5A 2PRKA 3MD0A 4FNOA 1FTGA 4M6VA 4D74A 5AW7A 1MJ9A 1CUJA 2PQ8A 5HRCA 4WUVA 1DZIA 4DYCA 5LDHA 3BZ6A 2QDKA 2VOJA 1S8NA 4C3HJ 1YUBA 2ZYSA 3QUBA 5J8FA 2E48A 4TLAA 3R7DA 2XUOA 4OLFA 3ZZ1A 4COOA 5IOYA 1E59A 2YIVX 1A4UA 1GKLA 1P5JA 4L22A 4R98A 2UUPA 1N2ZA 3GGOA 3GFRA 3CUEF 4WXRA 3GIDA 1NOIA 2GQ0A 4KI7A 4X9XA 5ALWA 5EE5B 4EUFA 2XPWA 5JLXA 4Q24A 4BO3A 3AHGA 1QO9A 4Z8XA 4D0SA 2KPOA 1RRJA 4NSNA 4Q01A 4KT6A 2BGLA 4HH4A 4EM2A 4XPIB 1AKEA 4F06A 2ZFUA 3I39X 4JYBA 4RF4A 2QN3A 3T5BA 2B98A 3QSGA 4AVYA 4ZYZA 2Q62A 1D1SA 3LKZA 4L6CA 5BVHB 2E5NA 3GB9A 3JRWA 1IHUA 2W2NA 3HSYA 3GZ5A 4FMCB 4I50F 4MO9A 3TQOA 5CFOA 5FD8A 1AQNA 2PMZA 4A3JJ 1JJVA 4KPFC 3UAVA 3VNQA 3W78A 1Q0QA 3PO2J 4M37A 1TTTA 2ISSD 4FFOA 2GSDA 5DCLA 1DEOA 1JSZA 3QZUA 4GZLA 3H9BA 4KFSA 1C7ZA 2Q5EA 3E48A 2PWZA 4IUYA 3WIUA 4EGYA 3W4IA 3TTWA 4LRXA 4YEJA 2ECBA 4WX9A 2R6GA 1L7NA 3L7MA 2OVBA 4DM4A 2FD5A 2Z8ZA 2V7BA 3GUVA 4IXMA 4JR2A 4K9QA 4E7SA 2VF8A 1KO4A 1K3FA 1E18A 2A5FA 4MUHA 4HQ6A 4TKZA 4V0SA 1OH6A 1DKPA 5EYRA 3ZE9A 4LY9A 1WJ5A 3MTEA 2EQRA 4RELA 3TZ6A 2PJRB 4HNAA 3ECSA 4JXXA 5JECA 3NOQA 3TP3A 2ZJPF 4A8HA 3HBFA 1E6MA 2OK8A 3LYUA 4U0JA 3VHLB 2BBSA 1LDEA 1CQWA 5JHFA 3IO5A 3QRWA 3KFXA 2OENG 1HEUA 1ZK1A 1NATA 1HO3A 2VF7A 3F4LA 3HQ4O 1HE5A 3P97A 1QE3A 5EVJA 3ZNOA 3GRCA 1SPXA 2Q1YA 2HPVA 1JWLA 4KP7A 1T56A 5J63A 2QLBA 4KITB 1NX6A 3KR9A 3FDIA 4IMRA 4Q6WA 2J08A 4FOSA 1JWBB 1HYGA 4GOLD 3RTAA 2FN9A 2G17A 3E9ZA 1EJ0A 3PQ4A 4XAQA 3VAAA 5KYGA 2BXYA 2CXUA 5B58C 5ETJA 4LYYA 2E1OA 3MHPA 4M1EA 3G2LA 3WLLA 4ERNA 5JLWA 3W3ZB 3I4LA 3CLVA 4XARA 1UPFA 2I10A 3TBHA 4UD2A 1W9HA 5KC9A 5KNDH 5DB4A 2VQFB 4I0WB 2EIHA 1ENHA 2W84A 1ZOPA 5D3KA 5IAAA 2LKSA 1DC5A 4XVCA 4EJSA 4M9QA 3N70A 1JFSA 3EEQA 4DLPA 4E51A 5KC8A 2A0YA 2NP7A 2D59A 2EFEB 2ODTX 4WY8A 1FP2A 2C5LA 1YI8A 2V7VA 2O7SA 2ZG6A 3DZJA 2NYAA 3HSRA 2NZVG 2YWBA 1QFZA 2Q0XA 3N75A 2QZ4A 4L02A 3SX4A 3V80A 4TWIA 5HOQA 1WWKA 2FOIA 2GAIA 4OBBA 5DOVA 4ZYWA 5C53B 1M34E 2CLCX 3NKFA 5K8VA 1IHPA 2A14A 4KACA 2Q7OE 3QKTA 4C0SA 4GPIB 1SC1A 2XBMA 4YRMA 4UUTA 2I22A 3HKEA 2BOLA 2OAGA 1LPQA 3ESBA 3IODA 1H8ED 2MGQA 1C9MA 2V1UA 1B9MA 3CUQC 4GEKA 1D0IA 5F51A 4P0PB 3SJAA 1DQRA 3OPMA 4BFZA 4PYOA 2YWEA 2IH2A 3LL7A 1YK0A 2PM8A 2HAEA 3FLEA 2DPHA 1T5BA 2AH5A 3SP1A 3FLAA 4HQLA 3Q7QA 4PS1A 3T9AA 4EPXA 4QPDA 2NXNA 3FJYA 3IAM6 4IQ4A 1OB5A 2HA0A 1HKTA 2ZW9A 2W2KA 4GOND 4ZO4A 3VI4B 5K99A 1NUUA 4CM3A 3NWPA 3PI6A 1CJVC 2Q1WA 3C8ZA 5BURA 4BDZA 4PZEA 1XVAA 3H7AA 3HE3A 5JHGB 1Y39A 4Q03A 3L2QA 3JALA 3FZYA 2G9VA 4EZIA 3LQYA 5K4HA 3JR9A 1EG2A 3EQ7A 2PX9A 3QFSA 4WY2A 3C3PA 2IA0A 5FTMA 1N33B 2Z95A 2WZQA 2Y92A 1E2NA 3H99A 1HI9A 1Y5NA 5KSPA 1KAGA 3MWDA 4E4HA 3H8SA 1PUXA 1QJ4A 1GVNB 3ZWPA 1N2CE 1CB7A 4X54A 4QOHA 3GLKA 3OL3A 2X8WA 1XKQA 4AS2A 1IPFA 3RRBA 4UMEA 5IFKA 1S2LA 2ZVQX 1FU4A 1Q7CA 1QHIA 3I0NA 1XZLA 2I1VB 5BR4A 5IFLA 2WLSA 3IC5A 2YMQA 3EZNA 2GNPA 1PS0A 3IJEB 3K1YA 2I8DA 3PDIA 4JBGA 4AIKA 4HYTA 4LXUA 5DYYA 2QGNA 3HTUA 2CEAA 3C2QA 2VRCD 4MUGA 1Y9JA 4JC8A 2M7AA 3FIUA 3HBLA 3TZBA 5JZMA 4BS9A 1DKNA 5BUSA 3IEIA 4IRUB 1JHYA 2FK8A 2XXBA 4X64B 5JJKA 3FVTA 3DPTA 1U6IA 3CCBA 1Y3IA 1FS5A 3DEJA 1WO8A 3OOPA 2HY7A 3D0KA 3K2EA 4BVKA 5MGBA 2LBPA 2QY9A 5TRTA 3NWEA 5DHPA 4XOTA 1VLZA 3OCZA 4KVAA 4DQXA 5A05A 5IXJA 1DAHA 3B6KA 5A9TA 3GT7A 2Y1XA 1G6NA 5FB2A 3W6KB 1FY7A 1TVCA 3F5FA 3GELA 1OQYA 4QHYA 3VSCA 1RKWA 1HYHA 4D7AA 3ZQKA 4ZMSA 4FWTA 1X7YA 3V48A 4JL5A 3J80K 2IW3A 4BFCA 4C0JA 1VGVA 1QVTA 3D7LA 2C95A 2FPGA 2GPJA 2L17A 5FEMA 1RYBA 3CX8A 2I7XA 1JHPA 3M4YA 3AF5A 5J2TB 4BO6A 3MT0A 4UXNA 1XQVA 1NVBA 2OV8A 4FNGA 1VGQA 3GGSA 2FG5A 3WDMA 3WYEA 4NXNB 1L8XA 2G9WA 1K5HA 3VNRA 1I51A 4YRSA 3UJNA 1QB8A 1XB2A 2C2OA 2ZWIA 2PX0A 4RBOA 1FRNA 1R4ZA 3ESXA 4YRTA 3WBFA 3WE7A 4FC6A 4YRAA 2AL7A 2P9QA 1T5TA 3ANSA 4RF2A 5K0EA 3MJSA 3BFKA 5LQDA 2IX3A 1M0EA 2VO1A 3FHCB 1KDYA 4Y0NA 2EZUA 2OY0A 3H7IA 4O4HF 3ZK9A 4MOWA 2D8AA 2XKPA 2UWMA 3UPTA 1L4HA 2JGLA 5FBHA 3WAKA 2JGMA 2QTMA 4R1LA 1RIOH 3KJQA 5KMGB 4XKVA 1EEXB 3AT1A 4R9UC 1UOQA 3WBKA 4BB0A 1FW6A 2DI3A 4KFTA 4QIHA 5CFZA 3U7HB 5CHEA 1G4HA 2W57A 2ECQA 2NVUA 2WQ6A 4XUEA 5CYPA 4EA9A 4EJ2A 4PPNA 1OB2A 3GHHA 2R6ZA 1MORA 1XQXA 3WGOA 5JYEA 4HOYA 1RWVA 4XLFA 4ZVPA 3K2IA 4P08A 4DR1B 3OIWA 4ZOQI 5DS9A 4WY5A 2YW2A 4FU0A 2M4GA 3DPUA 4UHBA 3TBIA 1NIJA 1P3DA 3OPXA 1SD5A 3WGIA 2W6QA 3FCEA 5CXSA 2CLKB 5T67A 4D9IA 2ZYVX 4JJIA 2DEUA 3LIPA 1CRPA 1G5RA 3G02A 3S1RJ 2VZ8A 2GZ1A 1I33A 3KEFA 4MMYB 2BE9A 2NSYA 3WHCA 1RJEA 3AP1A 1A31A 1MC5A 2QAGA 4XXHA 5KDLA 3TW0A 4BAZA 1D04A 1U8FO 4NARA 3SZTA 1OBCA 1KORA 1XMKA 1MD9A 2F9LA 3ASOH 3BILA 1BI2A 4D3DA 2G1PA 4HNUA 3FOAA 2IZ7A 2ZJBA 3M4XA 1UMBA 3K1AB 3X2SA 5JD5A 3FZEA 3BM5A 4BBSJ 4GBGA 3CIFA 1GTMA 2GN6A 1ESDA 3JQ8B 5B2ZA 4KFRA 5IC6A 3GO5A 3J7YJ 1XCLA 2IPAB 4YCDA 4TLCA 1LX6A 2FBIA 3U44B 2X0NA 1JNYA 5BYJA 2EZHA 2HXSA 1XJCA 2EZTA 1USKA 1XAIA 1U1CA 3ITEA 2DFKB 4EYSA 4ZQBA 5FTWA 1SMYF 3FXQA 5BQ5A 4DMRA 1JEDA 4J2HA 3WU2C 3VPXA 3A9WA 1CDZA 5G1OA 4KL8S 1T9GR 2JCBA 3CLKA 2EC5A 1H42A 1WV0A 2X13A 4UVIA 3D8UA 1WJCA 3HS3A 3ADPA 4ZCLA 4U8GA 2CVFA 4E7OA 1Z15A 4OYHA 5ANRB 2I2AA 5FL7A 4EO4A 3WRWA 2IBSA 4I55F 3MWEA 4WXDA 1KAOA 4I6JA 1KYVA 3IHLA 1JHMA 3BTIA 3G49A 2NU6B 3KFVA 3DXJF 3T5DA 3I4CA 1ID8A 3GUZA 1A8QA 1G3MA 2JFZA 3K8ZA 1JT0A 4PNEA 4QBTA 2GXBA 1DV1A 3O9VA 3MM4A 5JANA 4AQDA 2BFOA 4OL0A 1N25A 3S3OA 2ZR8A 5IAGA 3VR5H 5IU6A 2JBWA 3U4MA 3ZIAA 4V0NA 4GC5A 1I1QB 2ZFWA 1X3WB 2HSJA 4GOMD 4UTPA 4W5NA 2X7JA 1EU1A 4Q3NA 3TO9A 1H94A 1PG2A 4ENMA 1TPYA 3PDUA 2ZYRA 1LK5A 3UV6A 2YU9J 4XONA 1JB9A 1XZMA 4IUBS 3T7SA 3V32A 1P1KA 3NTVA 2YY6A 4EB3A 2BMDA 2DLDA 3KV1A 5K8TA 3RCOA 2JAPA 1E62A 3NORA 4MW2A 2A3NA 5EIEA 3LNCA 2IKSA 2SNIE 5LBTA 4PHHA 4TT3D 3M34A 3ADCA 4TMKA 3HG7A 3C4VA 3IB6A 1ZU5A 1O97D 4E32A 3H5RA 2ZTUA 2HM7A 2II6A 1HE1C 3EIUA 2A9FA 4XDGA 4A0GA 2CQXA 1GSOA 2CHEA 2YQ5A 3LF2A 4YYEA 4CIDA 1Z88A 7REQA 3INNA 1L4FA 9LDBA 3OZAA 4A26A 1KYWA 1E20A 1CZLA 1I4LD 3NCTA 3LTEA 2NP6A 2N42A 2J0SA 1F2TB 1ZTRA 3BWDD 3RRNA 4CLEA 1H4QA 1H1DA 3GVIA 3BTLA 3HHEA 2H07A 1E7WA 3BOSA 3OJOA 4TOIA 4TQAA 4PAGA 4AICA 3HN7A 1LVAA 5FULA 4AUNA 4HNGA 3ZE8A 2CF6A 4GIBA 4H3SA 1MC8A 1YDWA 2R60A 2V7XA 4PAQA 1JQ3A 2BXZA 1WSUA 5CM2Z 3M6IA 4ZYGA 4F1KA 1N8SA 1WHTA 4GOXA 1Z8HA 3PC7A 1NXSA 3RTGA 4D56A 1Z6TA 2CJJA 1PI3A 4O5VA 1CE8B 1JLLA 4CF7A 3JYNA 3NOVA 5DWDA 1L7PA 3IPCA 3IR5A 5A4DA 721PA 5L6MB 1T36A 1HYBA 3WGHA 3CO0S 1P74A 2X3YA 1G17A 3QWHA 5DXFA 4IRGA 4N7JA 2L3DA 3HWX1 3QWAA 5KKCA 2GNOA 3PICA 3PIOF 3IOMA 4BTEA 3U7RA 3CB2A 1BCSB 1OUMA 3PPYA 3PZBA 3K4LA 4LMRA 2V65A 4EX6A 1Z33A 3IEKA 1UMDB 1E94E 2ONZA 2Y93A 3IEPA 3SSMA 4YV0A 5CMLA 1PEDA 1E2GA 2IWRA 3I9NA 1D4AA 4LWZA 5AXAA 5LQCA 2LD4A 3I5UA 4NENB 1QXSA 3R7WA 3QU6A 4R1NA 4AUEA 3GNLA 3D8RA 3NHUA 4JA0A 2EYUA 1XTZA 3U4HA 3ADDA 1U90A 1W5FA 2J9ZB 3MUFA 1PNQA 3I28A 2XKAA 3VPGA 2AR0A 3K1NA 4E94A 3F8FA 2E4WA 5L95A 1MH4A 1DJPA 2Q0SA 5EJ7A 3CISA 3IAS1 2HK8A 1RHJA 2HPMA 5JVGF 1UANA 2XHEA 1BR2A 2PU7A 3EDOA 2EEZA 3G1UA 1ZGCA 5CVUA 2QE6A 4M7OA 2ZB7A 4DCNA 1KFBB 3S44A 3OYCA 3ILYA 5HKAA 3LA2A 4BLWA 5ICMA 1IQUA 1EBBA 1UEIA 2J09A 2XE7A 2X1VA 3BMQB 3IRUA 1X4PA 4G24A 4FASD 4AN4A 2DB3A 2F8MA 3GZ6A 1L5SA 1WEHA 3R5TA 2FR8C 2GRUA 4D25A 1KJ8A 1YS7A 1SOUA 4NJEA 3T34A 4Q6BA 3RIGA 3KXPA 4CW7A 2D8MA 1Y8RB 1P0CA 4GXTA 5E2IA 5IULC 2XZLA 3DUFA 1A7KA 3VPFA 5AONA 4CKBA 1N32B 4WXYB 5DTQA 4D0LB 3Q2IA 1YF3A 2OGZA 3T7DA 3TGPA 1M6EX 5AK6A 3OEHA 4AO7A 1Y4AE 1G60A 4E6KG 3AIMA 2CL6X 1A36A 2CCJA 2YJZA 3PGJA 3HU5A 4L4SA 3A2LA 3L8HA 1XNJA 2OKCA 1NUQA 1QRDA 2ZJRF 2EJWA 2X15A 4KPYA 1FMFA 1EVYA 2OCKA 1PZEA 1WRJA 1LK0A 4MA5A 1Z7GA 5DCWA 3H9QA 3VM6A 1CR6A 1XTJA 4EIWA 3CMYA 3VI3B 5I7SA 3WAJA 4LVUA 5FPQA 3UOWA 1V5IA 3DQQA 3NBYC 4M46A 3CJQA 3IP7A 2UKDA 3X1WA 1ZVMA 2BHTA 2CXPA 2FLVA 3RJPA 5E18F 4D0RA 2H09A 1C9NA 2C7VA 1QO0A 4GL2A 2AF4C 5ALYA 1H4TA 1WCXA 4M76B 3JQPA 3SZRA 1J90A 5IP7J 3GA0A 1WOMA 1NKSA 2QTTA 3F5DA 2VP0A 3N0XA 1RLMA 3REQA 4FTWA 3RWMB 2NS7A 4H7FA 3ER8A 4ZQIA 2F3PA 2W7TA 1IXKA 3UJ8A 1Z39A 2DA2A 2CMGA 4F4UA 1P91A 3STXA 3LUCA 3PQFA 4MYDA 2CS3A 3ESCA 4FX0A 2B3TA 2FMHA 4Q02A 4EL5A 5E3LA 3WDLA 2L01A 2F3SA 2E0IA 2EBIA 2ZXIA 4FMBB 1Y63A 2OBYA 2IUFA 3P96A 3UAYA 1H9BA 3H6KA 2P3SA 1XSDA 1SA0A 1X8XA 3R09A 4KO1S 4L8YA 3WGVA 2FPMA 5K3OA 2NV0A 1BS2A 3D0RA 5EIWA 1M1NA 3UHFA 2RONA 5H0IA 4BLRA 5A0FA 2R8OA 3KQMA 5F08A 3I71A 1ZGWA 4WKPA 1PR1A 3LS2A 1YZHA 3PDCA 4ZVNA 3VAZA 3SSAA 4QOSA 1IQ0A 4CV1A 4F2WA 4PVCA 2XXAB 4GOOD 1OIWA 4MTEA 3D3WA 4JOCA 1J24A 2BCEA 2Z56A 2XYHA 3LT2A 4GI7A 3NZEA 3ZR4B 4Q9KA 4PX3A 3BG3A 2GILA 3QEBZ 3GLTA 3ULKA 2VOPA 1X1EA 1XXHB 2H0AA 3B70A 4H4EA 2LW7A 2QJWA 1J0AA 4H1WA 3A04A 4A8PA 1ORVA 2JHGA 4JVMA 3K0KA 5DGHA 3B89A 4X1YA 3A27A 3JY6A 3HKBA 1QTIA 2O8DB 3D2CA 2HVRA 4BJ6C 1UBNA 3ISVA 3QOWA 3T9CA 3W9UA 5BR7A 3REGA 3O4GA 5A4FS 2Q9AA 2QTFA 3IDOA 3NDRA 4QFBA 1IRXA 4RL4A 2HWXA 1H4SA 4HY3A 1TTPB 4O4HA 3BLYA 1EA3A 2OCLA 1ONOA 3NBAA 4Y2HA 4D7NA 2AC2A 2FOLA 2KM1A 5C0OE 1MJBA 2CXNA 1Q20A 1RC1A 4QULA 1E58A 3HCAA 2NTEA 3W2EA 3UC9A 4DXDA 2UXNA 1UXJA 2ZI7A 4WOJA 5TVGA 5JSZB 2HBZA 3ETCA 4MSUA 4DAOA 1RESA 1B59A 1C3OA 4M1YA 3HUTA 1YRNB 3L7KA 2HJWA 3FCOA 2VHCA 4ZAXA 1JDPA 3QU4A 4PFPA 1GUBA 4MHGA 2YFHA 3MTIA 3R6GA 1QIHA 3BIFA 4TSFD 5TV2A 1YHNA 4TZ6A 4LTDA 4FCVA 4KSCA 1RRCA 4A4DA 2CUJA 3HRIA 4B6PA 1ZHHA 1KO8A 2ZE5A 1FZQA 5CBPA 3DE4X 1DS6A 3EEFA 3U2QA 4S24A 4MO7A 1PN3A 1H8HD 2XQGA 3D3JA 2OUKA 1DO2A 2YXBA 2YXNA 2OC9A 2NM0A 1P2UA 3VO2A 4GXRA 1KQPA 3AINA 4IKFA 1B76A 3NP9A 1R12A 1O54A 2EG9A 2AZXA 1M1ZA 3FPJA 5C5DA 5KVVA 2OXTA 3VYWA 3UWDA 4TT8A 3VVBA 3ASUA 3L84A 1ML4A 2X6OA 1V95A 4YAWA 1NQVA 1J22A 4US1R 2Q5OA 3BHMA 2J6CA 4ZGGA 3I5XA 3U19A 2K9QA 4K86A 2BEWB 3HOZJ 2QUJA 4GEGA 2IY7A 2NXNB 1GDDA 5HOOA 1G8GA 1RVV1 2QM8A 4JVSB 2H06A 5CTJA 1MT0A 5A2GA 1EIWA 1R9TJ 2R7QA 2GSWA 4QEZA 5KTOA 4EBFA 4RVSA 4X24A 5D3QA 2FJUA 3JWHA 2I65A 1GKUB 4JHXA 3FHNA 4C30A 3N6XA 4GDMA 3FE2A 1CIJA 1L7DA 2R44A 2NOAA 3UPDA 3W9BA 1VBNA 3R9XB 1U5TB 3MQ2A 2EL9A 1ULBA 2VDJA 3H5LA 4O4LB 5CA0B 3D4NA 2WY2D 1HT3A 4OHKA 2B7BA 1X8LA 1F8UA 1FX1A 3EH1A 4M6WA 3G5AA 2V55B 4P98A 3IURA 3ABKH 5EKSA 1RAHA 2BL4A 4JI7B 2H4XA 2OXCA 2PQ0A 2QD3A 1JAIA 3RFXA 3X2EA 1HW2A 4JJEA 3BDIA 3T5MA 3EUHA 2DX7A 1TIPA 1JZQA 2NZXA 1RAGA 1ZD9A 4O3FA 4PFQA 2IPLA 3K5HA 2H1IA 3KL2A 4CMBA 2M6KA 3GAFA 4I55A 3W7BA 2J9FA 2JBAB 3F72A 1VSQA 1XMXA 3GT3A 4NXMB 2FQXA 1JIVA 5LGUA 2EA4A 1X9GA 4N0EA 1NG6A 4MW5A 2C4VA 4ARSA 3ZEIA 1UKAA 3KD2A 3UFXB 4I7EA 2HU2A 3EGXA 4PQEA 3SIPA 1XMOB 4LJYA 4BATA 3DNFA 3DW1X 3KFWX 3LX4A 2JF0A 2QN6A 1SFUA 2W2VA 4ETWA 4KRFA 1XWFA 2V74B 3IMFA 3QP9A 1E6WA 2NTYC 5D85A 2OF7A 2Y4NA 2HIAA 3B6IA 3GK3A 4DIDA 4TZ0A 3TNFA 2B4TO 4KMSA 5B2FA 4KYUA 2VYFA 2PQ2A 1E8DA 1R4NB 2XUFA 1DCKA 1PEKE 3DYVA 3OYFA 3DKYA 2Q6IA 3FR7A 3UXMA 2UZ4A 3FXLA 5JY1A 1C8KA 3SOPA 4RSGA 3CS3A 1C80A 4H18A 4ZT5A 2WWIA 2ZIGA 5ICCA 1VHWA 1U9JA 2BZTA 4Y7NJ 4MV4A 4ZCIA 5IX8A 3AXSA 4C7VA 2O8VA 3Q8LA 3MGAA 2XVXA 3VVMA 2O4UX 1U9IC 4U7PB 1T4CA 3BR3A 1RQGA 4EGFA 3WHIA 4J0HA 1RTTA 2ZIAA 4AN1A 1R5GA 3ZJUA 3BFJA 2GCOB 4IJ5A 2XYGA 1PGNA 2O8KA 2ZBPA 5SZIA 1U8EA 4BJ5C 5BXYA 3PFWO 5ARDA 1MB0A 4BC0A 3OZVA 1IBMB 2CG4A 4E5NA 2ID9A 1LCIA 1MAHA 2ZP1A 3DE7X 3RBVA 3R23A 3ZRGA 4CEHA 4N0BA 4U2GA 5BSTA 3KR2A 5CKTA 1SVNA 3D8NA 1VP3A 4G41A 3GUCA 4YMSA 4RAGA 3SG0A 1Y8QB 3CPJB 1TNDA 3QHAA 5A5EA 3KOMA 2Z30A 3ABMH 1YE5A 1WEKA 4C6RA 1TUGA 4P96A 4RNCA 4BMDA 5HSGA 1ZYRF 1OFCX 2NT3A 3WOHA 2X4HA 2ZB9A 1H3NA 1XPUA 3BK2A 5HJEA 4EJFA 4QAJA 3RSSA 3D31A 2NADA 3CUOA 1M34A 3UHPA 2VDUE 2SHKA 1IEXA 1EWTA 5I9TA 3HUGA 1MOZA 2UVPB 1RE1A 2O7NA 4EENA 1W0JA 4TXJA 5FAXA 2RGXA 4NEHB 4CO8A 4UEOA 5BWOA 3ZDDA 3CA8A 1K4SA 1Z4LA 3BKWA 2C2ZA 1F1JA 3DDOA 3QBJA 4RQUA 4B2YA 1G20E 4Z1MA 2ZYHA 4YCBA 4YMWA 4CQNA 3FK6A 1ES9A 1GEGA 2CLMB 2ZAIA 2CFTA 1CZKA 2GK3A 3IV6A 4FJ0A 4QARA 2VNHA 3KOUA 4OHFA 3GTMJ 4ZYXA 1ONPA 1F38A 4Y30A 1R5OA 3VH2A 5T3UA 3G2KA 2L02A 1Q21A 1O3YA 1UKZA 3CG4A 3F5SA 4M0EA 3QIAA 1EFVA 1LSJA 4TMYA 1P6UA 3TKLA 1ZH6A 4C3UA 2BSAA 3BFPA 5I5GA 4ZDJA 4ESJA 1ORWA 3FZVA 4PTYA 2R1VB 1G3TA 3DT8A 2HWWA 4BLTA 2IYTA 1S7OA 2QTHA 1W8IA 1I39A 3EXHA 1OC2A 1OZFA 1SBTA 3BRCA 3OFKA 5FOTA 1H2XA 4CA0A 1BWQA 1S01A 2F00A 2Q45A 4P4SB 3W9YA 3DEUA 3NHBA 5JADA 2R97A 3DOFA 1JSCA 3JREA 1NGSA 1P9QC 1UBSB 3KAKA 2JZCA 4W82A 1MABB 3AERB 1SCAA 3KT3A 3QI2A 2M34A 1X3ZB 1V7QA 2CWDA 1U6GA 2OV7A 3TDUC 3ELDA 4ZARA 3SR3A 1T9AA 1TYEB 1F06A 1KYXA 2NO9A 2OQ2A 4P7KA 5EYPA 5C5EA 2C2YA 3GRAA 4WK4B 4E1AA 4UREA 1KMNA 5JRDS 3FXAA 3JQEA 3TAHA 1H1LA 2XHKA 1DELA 5IAEA 4YAKA 2IW5A 2NPOA 1NR5A 1CUZA 4GMGA 4ARAA 4U87A 3R6SA 4I99C 2ZITA 4E70A 3HH8A 2C9MA 2WU8A 3IBGA 3NNNA 3PYXA 3TE6A 2XGXA 4UV8A 3ONDA 4XYEA 1OFIA 3FZGA