2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cerebral protein 1
publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
3HM2A 1L3CA 3ELDA 3E8SA 1I4WA 2ZBRA 2ZVJA 2BR3A 2I9KA 3EVCA 2IIPA 1FP1D 4OQDA 4KDRA 5HFJA 1TW2A 1JG1A 3BWCA 4DCMA 2AVNA 4HH4A 2VDVE 3KPUA 4M37A 4RSRA 5FWDA 3SSNA 2IPXA 3BXOA 3TR6A 4DZRA 3DLIA 3FUVA 3KKZA 4GC9A 3LBYA 5HOQA 2IFTA 3X0DA 3KU1A 4RVFA 4RVHA 4DKJA 3FYDA 1JSZA 2FK7A 2F8LA 5E1DA 3GU3A 5K0GA 1PJZA 2BM8A 2OZVA 1R8XA 3A7EA 3UFBA 3FUWA 3EMDA 4OBWA 4HSGA 3CC8A 3PFGA 2YR0A 5GM1A 4OX9Y 1BOOA 2VDWA 5FHRA 3UJCA 1BC5A 1O9HA 4CTKA 3BWMA 4X63A 5EEHA 3SGLA 3A4TA 4R05A 4AZTA 5DSXA 3KQOA 2C7OA 3HCEA 2UZ4A 4C03A 1AQJA 4PYNA 2VS1A 3PFHA 1QAQA 4RV9A 5CCBA 3ID6C 5H02A 3HCFA 3OFJA 5DTQA 3C3YA 1X19A 3DTNA 4L7VA 4C4AA 1UFKA 2YXLA 4CKBA 3HVHA 2FPOA 3FTEA 2G70A 1DL5A 1M6EX 3G88A 5K0NA 4AZSA 4E2XA 5KQRA 3VC1A 4X60A 4A6EA 2PGXA 5LQJA 3UJ6A 5HZMA 3LCUA 3LCVB 2UYQA 4U7TB 2UYHA 1FP2A 2NP7A 3GDHA 3KPVA 5DPMA 4PGHA 2I62A 3OE5A 3HNRA 3ER8A 3G7UA 3JWJA 1SUSA 5KS2A 3NWBA 4DA4A 3TM4A 2GB4A 1L3BA 3KHKA 5FTWA 2BH2A 2FRXA 3OU7A 1YUBA 2O07A 2BR5A 4QDJA 4C04A 3MHTA 3B3GA 4G56A 3NDJA 3HCAA 4WXHA 4UOEA 3RIEA 3KQWA 2DPMA 3GO4A 3L8DA 3T7SA 7MHTA 3IV6A 5CVUA 5C1IA 2XYVA 2YTZA 2R6ZA 2B78A 3FUTA 2JHAA 3JWIA 4JXJA 4KRGA 1X1BA 3TFWA 3HVIA 3LECA 1X1CA 2PXXA 5LQKA 3CJTA 3P9NA 2PLWA 2IH5A 5K03A 4RTSA 5EHIA 1Q0TA 2ZSUA 1JTFA 2ZWAA 5ICGA 1FBNA 2P3QA 3I9FA 4GUAA 3B3FA 1RI3A 2OPBA 2OYRA 1G60A 3BGVA 1RJGA 3EVGA 1VL5A 2K4MA 2PX2A 2PWYA 2H1RA 4GOLD 4HTFB 3O7WA 5CVDA 3FPFA 3FPGA 3M6UA 1UIRA 1KYWA 3ELWA 4KVZA 1NT2A 3QOWA 4Y2HA 3S68A 2EJUA 5HIKA 5GIPE 4RVDA 2QE6A 4LG1A 1ZHFA 1X1AA 3C0KA 4PYIA 4ATNA 2VDUE 1IXKA 2G72A 4YUVA 1KXZA 3HA7A 3K6RA 3C6KA 3MGGA 3G2MA 2ZZMA 4CKCA 5HIIA 2AOWA 1TW3A 5EKXA 3NW9A 1NW8A 4RTPA 2P41A 3UWPA 3G2PA 4XUDA 3HA3A 4P58A 1KPIA 1AQIA 5DX1A 2ADMA 4RTMA 2NP6A 5E1BA 3BWBA 3GRZA 4GOND 4DF3A 2JG3A 2PX4A 3M6XA 3MERA 4RTQA 4MWZA 1EIZA 1EJ6A 3KR2A 3SSMA 4OQEA 1L9KA 2PVCA 5CUQA 3Q87B 5KYGA 1XCLA 1HNNA 1VE3A 2O06A 3DUWA 2PXAA 3G8AA 1QAOA 4C07A 4EKGA 1ZKDA 1XJ5A 1RJEA 2V7EA 3TQSA 2BR4A 2OY0A 4IV0A 3KQYA 3SVZA 3ERCA 5BW5A 3KR0A 4C05A 4FT2A 8MHTA 3M6VA 4OBXA 3IYLW 1NW7A 4AZVA 3GRVA 2ZCJA 5P8WA 3UZUA 3PX2A 2ORED 4HTFA 1D2CA 4HGZA 3DMGA 4R8RA 3THRA 5DWQA 3I64A 1EJ0A 3U81A 3UBTA 3PS9A 4WVLA 2OO3A 5ICFA 4V0QA 5DXAA 5LQCA 5KQSA 4GOMD 3NWEA 3EEOA 1O54A 2LD4A 3SSOA 5FA8A 2FK8A 2AN5A 3CJQA 5EIWA 3G8BA 3CVOA 3LX6A 2QY6A 5FUBA 2JHCA 2AOUB 4BP1A 3T0IA 1XXLA 5GOZA 3KQMA 2ZIFA 2Y1WA 4EK9A 4RTRA 4KW7A 4A6DA 1B42A 2BM9A 5K09A 1D2GA 3OZSA 4E30A 4E2ZA 3EVDA 4RTLA 5K05A 3TM5A 5BW4A 1AV6A 3KPJA 2FCAA 1SQGA 3E7PA 2P7HA 4RVGA 1RI1A 5F2KA 5FQNA 1RJFA 2O57A 5DTRA 1R18A 3VC2A 9MHTA 5E8RA 3TRKA 2BZGA 2IP2A 1XCJA 3A7DA 5EMJA 3EVFA 3KR1A 5K0JA 2NXJA 5CIYA 5HEKA 3E05A 2NYUA 3TPZA 3R0QA 4F84A 2XBMA 5FA5A 2AVDA 2CL5A 4QQKA 3I53A 3EGIA 10MHA 1SVUA 5CVEA 2ERCA 2AOXA 4O29A 3VYWA 4KIFA 4QTTB 3EEYA 2G71A 3P2EA 5E1OA 3FPJA 3R3HA 1EAMA 4RTJA 4QQNA 3G5LA 2ZBQA 5FHQA 1KHHA 3TLJA 1YFJA 5K0LA 3DXXA 3O4FA 4H0NA 5EQJB 1V39A 1NBIA 1YZ3A 3E23A 5CVJA 5DM2A 2OXTA 2H11A 2NXNA 3R6TA 5DM0A 3EVZA 4ZTBA 5K0FA 2ESRA 3P8ZA 4KIGA 5DTMA 2AOUA 5DM1A 4E2YA 4YUZA 5C9ZA 3DULA 3OCJA 5GINE 5CD1A 2XYRA 5DXJA 2GLUA 4P7FA 5GP1A 4ER3A 2I6GA 3ELYA 4X41A 5EG5A 4PIMA 5EOVA 1RI5A 3JWHA 3KPYA 3NMUF 1JG2A 2WA1A 1JTEA 3OE4A 2DULA 2PT6A 3OU6A 1M0EA 2CWWA 3KQQA 5D1HA 5DM4A 1SQFA 4PWYA 5T6BA 5DRYA 2ONYA 1O9GA 3TOSA 1M6YA 4YUYA 5EMLA 3T7RA 4EQZA 4MQ4A 2AN3A 4X61A 4DM3A 2HR1A 5LSAA 2PBFA 1JQDA 2P40A 3B3JA 4BLVA 1U2ZA 5CCXA 1VPTA 4ISCA 4QPPA 2OB1A 3LHDA 3DMFA 3VSEA 3D2LA 3LSTA 5C0OE 5F2NA 4CKEA 4KWCA 5GM2A 4ER7A 3EVEA 2A14A 4KDCA 4LECA 3TKYA 3TMAA 4ER6A 1INLA 3PT9A 4GQBA 1NW6A 1NV9A 2QYOA 3T7TA 3FPHA 4PCLA 2C7QA 3DR5A 4XUEA 1KPGA 2O05A 1WG8A 2P7IA 3THSA 4RTOA 5K0BA 5K8VA 3C6MA 1NBHA 5E2BA 1WXWA 2ZTHA 4PYLA 3ER9A 3AJDA 4BLUA 3SR4A 1G38A 2ZZKA 1R6AA 4YV2A 5EMMA 1WZNA 2PXCA 3ANXA 3B89A 3FYCA 2PX8A 1F38A 3GWZA 3UJDA 1ZG3A 2ZZNA 3OFKA 3PVCA 3K0BA 5ERGB 4FZVA 1PRYA 2EFJA 2PSSA 2YXDA 3LDGA 4R6WA 2Z6QA 4E31A 1KIAA 4PYQA 3O31A 4QVKA 5FADA 5LR6A 5LQRA 5K0EA 1KPHA 2Y1XA 3AY0A 3GXOA 1I9GA 2I7CA 4YMGA 1SG9A 3G5TA 4C06A 4YUWA 3OZRA 2G1PA 3B7PA 3P2IA 3DOUA 2C7RA 4AZWA 1P91A 1YFLA 2QRVB 2V74B 2ZULA 4PYKA 3HCBA 4IV8A 1R8YA 3P9IA 3UJ7A 4PYMA 3FZGA 3MQ2A 2O0LA 3BWYA 4HG2A 2PWPA 4EVIA 5K0CA 2GH1A 3CKKA 3FTFA 4CTJA 3OPNA 3A25A 1YB2A 4MIKA 3BGDA 3FUXA 4QTUB 5DLYA 3PLAE 4HC4A 1P39A 1JG3A 1MJFA 5E9WA 2CKDA 2AN4A 3MCZA 3V97A 4PNEA 5U4XA 4P7JA 1L1EA 5EPEA 3BKXA 3LDFA 4BP3A 1BKYA 4IWNA 4GEKA 4LWPA 2R3SA 1Q0SA 2AOTA 4MHTA 5IH3A 1NKVA 3G2OA 2PY6A 3HVKA 1RI2A 3P97A 1IY9A 2UYCA 4FSXA 3SXJA 1G8SA 1N7JA 3HVJA 3BT7A 1P1BA 2N47A 1DUSA 3EVBA 3OU2A 1XDUA 1L3IA 2HV9A 5FWAA 3GGDA 3H2BA 3LKDA 4PIPA 5K01A 4P7KA 4OA5A 3EGEA 4HGYA 4PONA 4V0RA 3AXSA 3ORHA 1HMYA 4K6MA 3LPMA 4BY9E 1XDZA 2OB2A 2P3OA 2PKWA 3AXTA 2AR0A 2YXEA 3PB3A 4PYOA 3UA3A 4B17A 3KR9A 1Z3CA 2QRVA 2AOVA 4PYJA 5FCDA 3DLCA 2IDJA 4M7RA 3FPEA 1JSXA 1RJDA 4GOOD 3IHTA 4C08A 4RTNA 3GRYA 3LCCA 1JR4A 4IKPA 4E70A 1T43A 2JH9A 3NTVA 4MTLA 1KP9A 4ER5A 1WY7A 4M36A 4QVGA 3FTDA 4YMHA 3LL7A 1XVAA 4YUXA 1UWVA 4FR0A 1I1NA 2E5WA 4OA8A 3GCZA 5GIOE 1BHJA 3Q7EA 2H00A 5B1SA 3I58A 2G8NA 3NDIA 3GJYA 4AUKA 5LQUA 3M4XA 3QV2A 3CGGA 2ZLBA 4U7PB 4QDKA 5EZSA 1JG4A 2AS0A 1JQ3A 2GS9A 4DMGA 1SKMA 5E2AA 5D1NA 1VBFA 2ZWVA 4PGGA 5LQAA 2Z6AA 4BLWA 2ZIGA 3BZBA 3KQSA 5EC8A 1YF3A 1N2XA 2IBSA 3FUUA 3HCCA 3IEIA 2UYOA 3GRRA 3QOXA 4YV1A 2IH4A 3MAGA 5HIJA 5DX0A 2IBTA 4EMSA 5KVAA 1X1DA 2CMGA 3EGVA 2ZFUA 4PINA 4R6XA 2GA9A 2ZIEA 4GF5A 1VP9A 3ELUA 3LGAA 5CVVA 2Z6UA 3HCDA 3MB5A 4DQ0A 1Y8CA 3RW9A 1KYZA 1FPQA 4GC5A 3UA4A 2HMYB 4ER0A 3KPWA 1AF7A 1H1DA 1VQ1A 5M5BA 2YX1A 4QPNA 3MTIA 5E1MA 3KQPA 4FSDA 2XVAA 3P2KA 1ORIA 2C7PA 1YZHA 4F85A 1JQEA 1F3LA 1D2HA 1QANA 5E9JA 3P9KA 3G89A 3M33A 4E32A 2VP3A 3HTXA 4GBED 3AWIA 5G02A 3LKZA 1OR8A 3TKAA 1NV8A 1NE2A 3M6WA 2B2CA 4FS8A 2PV0A 2Q41A 3KQVA 2HTEA 2NXCA 3SMQA 4RX1A 5EZQA 2WK1A 2IDKA 4FGZA 2P35A 5EVJA 3CCFA 5EKUA 2AOTB 4PCAA 1P1CA 2NNWB 3FRHA 3HP7A 1WXXA 2PX5A 3C3PA 5EEGA 5JR3A 4AX8A 3EVAA 3B5IA 3LBFA 4NECA 1TPYA 2FHPA 5GWXA 1KR5A 2IGTA 3DP7A 3DXYA 2B3TA 2GAFA 3G2QA 2PJDA 2EG5A 2QM3A 2B9EA 1SUIA 4X1OA 2XYQA 4P7GA 4XCXA 3LDUA 1VP3A 3R9XB 3CJRA 3MCTA 3OZTA 1G55A 2ZW9A 3M70A 3R24A 4RYLA 5T67A 2CMHA 5BP7A 1ZQ9A 3P9CA 2YVLA 5FULA 4CWAA 3PX3A 2XVMA 3FTCA 4Y30A 1ORHA 2JHPA 2JH8A 2NXEA 2ZBPA 3GIWA 3UJ8A 5EMKA 1VIDA 2OKCA 4RWZA 3SX0A 2P3LA 2IH2A 2P1DA 5DSTA 5DRTA 5E9QA 3HEMA 3BKWA 3WSTA 4POOA 1FJXA 1R74A 3HA5A 1N7IA 3DMHA 2EJTA 4DCGA 5MHTA 2JJQA 4HRAA 2ONZA 1ZGAA 3KQTA 5E8JA 5FQOA 4E33A 4F86A 3BUSA 3EPPA 4YV0A 4LWOA 4XUCA 1RI4A 5CM2Z 2YUIA 3CBGA 1WS6A 5EHGA 5T64A 5F2OA 2HNKA 3UJBA 4RTKA 3GRUA 1XDSA 3F4KA 3SM3A 2YQZA 2PT9A 1VLMA 3EMBA 3JWGA 4Z2YA 4M38A 5JUWA 1QYRA 1NW3A 3ME5A 2KW5A 3I5UA 5ICEA 1MHTA 3P71T 2OBFA 2B25A 1IM8A 1EQAA 1QAMA 1G6Q1 3UJAA 4CXMA 1R00A 3REOA 1QZZA 4R8SA 4EKIA 5IKMA 3NVKI 2FYTA 3FRIA 3DH0A 3V8VA 2HWKA 1XTPA 1ZGJA 2P8JA 5BXYA 3BGIA 2VZ9A 5EIFA 2WA2A 3A26A 5EGSA 3UJ9A 3NJRA 4FP9A 1G8AA 2GPYA 3A27A 3NVMB 5HIMA 3RODA 3GNLA 4E2WA 3PTAA 1DCTA 3MTEA 5ICCA 2AZTA 5DT2A 1EG2A 5LQNA 1NW5A 2EX4A 3DXZA 4FT4A 5DX8A 5HILA
chains in the Genus database with same CATH superfamily
3E8SA 2JIPA 2VK2A 5JBQA 3TTUA 3NTXA 2Y92A 2F8LA 1Z4QA 3MMPA 4H4CA 3K70B 4LJYA 4AIHA 2HJHA 1NRWA 3AR5A 1JKFA 4QAQA 4CXFA 4UEJA 4MGEA 4AG6A 3WGGA 2TCTA 4R05A 4YP1A 4FONA 4CBVA 1LWOA 2V6MA 3QE2A 1VCHA 4LG0B 1UBOS 1H3EA 3E3VA 2X76A 1HUQA 1DL5A 2IGOA 3LPAA 3P5BA 4NP6A 5JQGF 1V1MA 4G8CA 3UQYS 5JCZA 2OAEA 4EHJA 5EE9A 1E9DA 1FFDA 2OUMA 3DONA 1I7PA 4A8JC 3KZXA 1FSPA 2XUOA 2Z04A 4LDRA 2PYIA 3FBGA 4M0EA 2IIBA 2FN3A 3CCEI 5HCNA 5HA5A 3S55A 1DX6A 4OXKA 5H9VA 1GAQA 2DDBA 2HV8A 2VDLB 3ZY6A 1EXVA 1P4JA 1XTUA 3FWEA 1Q0RA 8AT1A 1HXDA 1Z5ZA 1TM7E 4Z9FA 3HADA 3KZIC 5G4KB 1K4MA 2ZQ5A 3PNMA 1YS6A 5DHUA 4PQRA 4QDZA 3M6XA 4R1QA 4LDNA 2SCUA 5JECA 1SQ0A 2WT4A 3W2TA 2O2HA 5ICSA 2ELHA 3VAYA 5AKIA 3TRDA 1FE8A 4MS4A 4UCFA 1J9IA 4KA4A 1BOFA 4AZVA 1LA2A 4XPIB 1NBEA 2WG1A 1RHUA 3PS9A 4HMQA 5DXAA 1K2VN 1AOYA 5KYWA 3VYRB 1GTSA 1AOXA 2EZ8A 5EKDA 1U6GA 4B44A 5FUBA 4F1KA 4G0YA 3WB2A 4AM8A 3F7MA 3MJSA 1TLTA 2AK3A 2J45A 3RVQA 4IRMA 1SIOA 3ZQGA 1WY5A 1ZG5A 5U1PA 4F8JA 1W36C 2VH2A 5FA5A 3H83A 2MMCA 5KQMA 1OLUB 3HEAA 3O8QA 1J20A 4ACAA 4D41A 2I80A 1RWXA 2FZEA 4QIWN 5ALQA 3B1XA 4Z7OB 4WESB 5FFZA 5LKAA 4GPBA 5BS6A 4O4JB 2HK7A 3DCJA 3L4SO 2LGJA 2I6GA 2G9NA 5K3FB 2X2EA 2X1HA 1J5XA 4X61A 2A69F 3KEQA 1NKTA 4J0JA 1UL1X 2FDXA 4MWSA 4AN4A 2IHKA 4KI0A 3IODA 1WZUA 4A2QA 1P5HA 1I0IA 1UP7A 1TZMA 2W25A 1PUEE 3T94A 2P7IA 1MTOA 4X44A 3I52A 3L7CA 2Y1GA 3DUFB 1R6RA 4ZVTA 1V8ZA 3ZY5A 3ZZTA 4UFNA 1O8BA 4Z7JA 4ZV4A 1SUAA 3PTLA 4AMGA 2HKOA 5AD1A 1UDXA 4WRRA 3EQ6A 3I6BA 1H66A 3AY0A 1GEGA 1QOPB 3FWZA 4AP5A 5C52B 2G1PA 3N8KA 2RKOA 3VSKA 3ZDDA 1LPAB 1UKAA 3KJIA 3RPQA 3CKKA 1X39A 5FYQA 2VNSA 4MRRA 1V11B 2VL7A 3AU9A 5U4XA 1ZGWA 5LYYA 4LWPA 4BWVA 1KMIY 2H0QA 4A82A 3VR1A 4DJDC 4C76A 1NZJA 4S3MA 1RI2A 1LF5A 2YMMA 2N8GA 2ID9A 4DMMA 3A0BC 2GRJA 2QAGB 3QVLA 1LEHA 2P9FA 3UGKA 1PUIA 4IF6A 2ATVA 5C7IO 1EFCA 1Y5MA 1XGKA 4PCUA 2LF8A 1Q7RA 1WB4A 1YMVA 3V7YA 5GONA 4O6VA 5AUQA 4ZAYA 1GU0A 3O26A 3PFKA 1FTZA 5AUNB 1PNRA 1OCEA 1FF9A 1EA7A 4PK4A 4FHCA 3PHCA 7ABPA 5EC8A 1G8PA 4H3KB 2O8EA 3HB0A 1OU0A 3MZ0A 4ONEA 3H9CA 1FYXA 1BMFD 1FVXA 5KSWB 2HXSA 3DNMA 3PLNA 5J3LA 3OD1A 4DLVA 4X3CA 1YZHA 2OCLA 1IZYA 3WJ7A 3P9KA 4TTSA 1NJSA 1UPUA 3PUFA 1U1EA 2Q41A 2NXCA 3L6RA 3S1MJ 1PF7E 1I2DA 4IJVA 3OV8A 1QQTA 1RAAA 2Q27A 4FCCA 1MG0A 5DNCA 4ZVNA 3IIIA 4OQPA 1XSVA 4ZRDA 1BGVA 3VU9B 5IOYA 1YRHA 4JBGA 4IICA 3MJEA 5F7OA 2YUIA 5F2OA 3SKXA 4E7ZA 4KXMA 3H4VA 5LKRA 4B31A 4QUBA 5JUWA 1FFHA 1RQ7A 3GFPA 4RBNA 1ZEJA 4DLZA 3AR6A 5I7AA 3FFBA 1VE5A 3LA3A 2CNLA 3QLJA 4NBUA 4EHFA 4KXYA 1CP3A 1SBTA 1Z5NA 4ARAA 3ON5A 1XX5A 3OT1A 3QVOA 3Q6NA 5DP2A 1USIA 5BY2A 4YTEA 4A8HA 5LQDA 1JAZA 4DV7B 2XUBA 3RNLA 3ABRB 2P1RA 2OZVA 4MQ6A 1FZTA 2WTAA 2OCIA 4MCIA 1PG0A 2FW0A 5EP2A 3LT5A 4XPIA 5DFAA 4TV8B 4QULA 3O0TA 5BYBA 3PUIA 1CJUC 2YU3A 4GPD1 3T7IA 3EG5A 3LQFA 2XOKA 5I3ZA 2K27A 4OSOA 5C5CA 3JWEA 4HLUA 2C2WA 4YR7A 1YBMA 4K9LA 3KFLA 3SJMA 4DW6A 5J1SB 1AT1A 1NLMA 3FMOB 2PO5A 1OLUA 3Q8LA 1XA3A 1W94A 4NC9A 4NE9A 2JFUA 2P2ZA 5ICGA 1GCAA 1VL5A 4DR7B 1Y8AA 4LKRA 4EG3A 4GGPA 1A77A 2JA6J 1WPXA 5JXHA 5K3FA 4NHJA 4OM8A 5DXFA 3QXHA 4BEHA 2HMVA 1FJHA 1NYRA 4RH3A 1I4LD 3TLXA 4GOND 5E1XA 4FS3A 3AHCA 5GTDA 1E1DA 5E9AA 4Q24A 4JEIA 4IHKA 1XU4A 3GMEA 1HQKA 2OV1A 1P17A 3S2EA 2ZRCA 2HWXA 4UBOA 2OLKA 3MJFA 4MV9A 3DUFA 3DAPA 4HB3A 2KDZA 3ORQA 2M8GX 2GOYA 3DHVA 1JT0A 4JA2A 5AW0A 1JKJB 1G64A 1MAAA 1D03A 1CVLA 2IYNA 4KXNA 5GJVC 3OZSA 1JEAA 2GHTA 2AUTA 3NRCA 3CNOA 1POXA 2O14A 4D80A 4L76A 1YO5C 1R9GA 2NYUA 1EPUA 2QN1A 4CN8A 4A16A 1TM5E 1YFJA 3WNZA 4J91A 3M1AA 3VGJA 3SG0A 3L9FA 2QAGA 4L07A 5E7JA 4O3MA 5BV2P 1TF7A 1Z8FA 1XO1A 1ZN2A 3IH4A 3H92A 2ZUTA 5IJWA 2HJVA 1MSEC 2PRYA 3GF4A 2JJ8A 1J21A 4GPZA 1ON1A 1CUHA 5C44J 4OGKA 3F8WA 4CKEA 1Y1PA 4AMVA 4F46A 4N0DA 4KYUA 5BSUA 2MG4A 4PPFA 3KB8A 2JGDA 5CFNA 1IBLB 4F56A 4JUFA 2BVNA 1PGPA 4PPYA 1F12A 2WQZA 1ETWA 2W24A 5BMOA 4ASNA 2VDRB 1PZHA 3D6MA 4DYRA 1M2HA 1QBGA 3DBLB 2HBQA 5CFPA 4WKGA 2FRDA 1LPOA 3ZE1B 3EJ6A 4Y1RB 5CDFE 4QRDA 3O8LA 4JP3A 1GUAA 4W5JA 4BV9A 4BP3A 2QUJA 3EF1A 4I99A 2RQPA 4EI7A 4KR3A 4MWCA 1KXJA 3DOHA 3OG9A 3H2BA 4AS2A 1JQLB 2GJ4A 4A5MA 1Z6YA 2XMPA 4XGRA 4E5DA 2AR0A 1HEUA 3R0VA 3FMRA 3ZW8A 2HQBA 1Z39A 3NHWA 5FUWA 1T43A 3C5EA 4M7WA 1U4NA 1KP2A 5T57A 1JUPA 3OE1A 2FG6C 4F4FA 2CSOA 2I1WA 2VJAA 3TUJC 2XASA 3AM3A 1J5YA 3OPYA 1M1NA 3SKVA 2KWIA 4DAEA 3RGWS 2V6JA 1VBFA 2FG5A 4DR3B 1XTJA 3HCCA 2ZUFA 2XCOA 2W7TA 2BISA 2VJPA 2J33A 3ZXSA 1Z06A 4D81A 2EA2A 1MIHA 4I9HA 2VTKA 1WSDA 4EPRA 3DGEC 3WLOA 2PGOA 3IJRA 3H2KA 4ALIA 3VBEA 3PNSA 1MAHA 1DARA 1SKYE 4QWWA 2JGIA 4M60A 5GWXA 2GCPA 1R4NA 4NCAA 2C99A 4CLHA 4MR7B 3N76A 2RSLA 3O9MA 4JX5A 5H3HA 1NRXA 4HN2A 2C4MA 1ZVQA 2WWVD 1MZPA 2IXAA 1EWTA 4WFJA 3RREA 4E33A 3HV2A 2DSTA 1JDJA 5JNLA 4Z2YA 1UBEA 2EJRA 3ABMH 3TD6A 1Z82A 3RI3A 1T2CA 3OYCA 2G0NA 1FSFA 1O5TA 4WSOA 1IJBA 2P27A 2AKYA 1LBEA 3DXZA 2VBGA 3B6MA 3P9QA 1ECFA 3QUBA 3C6BA 4HWSA 1LFDB 3D7LA 2CCGA 4G5RA 1MABA 3ESWB 5C4XJ 3DOJA 2AFHE 3WLFA 3TLEA 4JP5A 3COPA 3A6GA 1E2EA 3RK4A 4HXYA 2PX0A 4KMOA 3ZK7A 2L5QA 2Q1UA 2CXUA 5I8PA 2E4YA 1FTWA 3TZEA 4HQ6A 2EP5A 5JMPA 2JDID 5JTUA 2E2WA 3FXUA 1SUDA 4M1WA 1JGGA 1CKEA 1LNSA 3H04A 3FBIB 3N6XA 2FMYA 3JYHA 4KV9A 4QPCA 1ECGA 2QG6A 4KCGA 5HXAA 1AGPA 1Q17A 2B1QA 2CFXA 1E3EA 1L7MA 3RF6A 1AGYA 2FZLA 1AQ6A 3L41A 3VR2A 4KVZA 4TZ6A 2PX6A 4LZOA 3JVVA 1HTWA 1FFBA 2X48A 5K6RA 4CT4B 2QEXI 3KBOA 1DRVA 3GBSA 2AG8A 5FLXK 3L1VA 4H2DA 3ZMDA 3II6X 1J2EA 5F04A 2WHYA 1MIOA 2QMZA 2RI0A 3V8BA 1CUUA 3WRWA 2V4MA 1H3FA 3JAMZ 4REOA 1ONOA 1Y7PA 4OK6A 5AK5A 2VOEA 1HZZC 2ODPA 2VJJA 3LXMA 4UBNA 2R6JA 1JIQA 1D6SA 4DQ2A 1HZJA 4ZO6A 5FO0A 3BDAA 4J75A 3R4CA 5JR3A 2P7HA 4P9UA 1RXUA 5AUOB 2VKVA 1CIVA 2BCEA 2M4KA 4J00A 4TT3D 3RJZA 4GI2A 4Z4HA 4F5DA 4CZ2A 5CA1F 2Y6VA 4JCOA 2Q2VA 1KYYA 1LB2A 2AR7A 1LEBA 3TZKA 4JGBA 5B57C 5EQJB 3TDKA 1EFPA 3MKYB 3CH6A 2A2ZA 4QUGA 1E9VA 5JI6A 1PJLA 4IRGA 5HBGA 2TRTA 4H6PA 1F9NA 1CUGA 3L49A 1J8VA 5AXBA 1G5HA 1VHQA 2B4RO 3OMXA 4BN0A 5IAAA 3D2LA 1YK0A 1EFKA 4EM6A 1C2TA 3WLRA 2QYOA 3H4MA 1TX4B 2KLBA 1T9BA 1DPUA 1WG8A 3THSA 3NRVA 1JZSA 4L9AA 1XROA 2PE5A 1TZJA 2CHGA 4YLEA 4ENTA 3IUMA 4HYEA 3JAWB 1ISPA 2AUMA 4YREA 1W7PB 3AG6A 2ODBA 3WTVC 1YFLA 3ZUPA 1RBZA 3WRYA 2QKMB 2VZLA 3WK6A 2EZTA 3WXMA 3OSGA 3WLQA 3BPVA 1IJFA 2O48X 4LV5B 2G36A 3ND5A 1LD3A 3ZZNA 1E2PA 1TAUA 1ODLA 2GBYA 3CMYA 3WJAA 3WWZA 1QU3A 3HN7A 3GFOA 1V43A 1K7YA 4MR7A 1PS0A 2J6BA 3CC2I 3W6OA 5D5QA 4OHMA 2WABA 3CX7A 4N3GA 1APBA 4F3QA 3PWZA 1D2AA 3AOEA 4OL9A 4MB6A 4M8KA 2L4AA 2G8NA 3S8EA 2O7OA 1M1ZA 3IRQA 4Q7JB 3WLTA 1J2YA 2QRZA 3R60A 1AN0A 2ZJ7A 4FDLA 4QGFA 3J7AC 1W4CA 4ES6A 5FRNA 1Z45A 1OR7A 2NZUG 3LQ4A 2YX1A 3DOOA 2FMLA 1U9OA 4RK7A 1ECPA 4GDMA 3ZH9B 4ARZA 1EVEA 1DJOA 1FMCA 1FP4B 4JQSA 3U7QA 2WMYA 1G291 2KIMA 2ISSD 2F2EA 1EXDA 2ZJPF 1IN5A 4N9HA 3V8QA 4J0DA 2V6GA 5ALEA 2R4QA 2E1MC 2XC7A 4IHJF 1T13A 3SHTA 1UXJA 3UJBA 1VJTA 3RYTC 2Z9BA 5B1IA 2EBUA 3ED1A 3ZQFA 4PTYA 5TPZA 2OQ2A 3PDJA 2IEDA 4IILA 3PGJA 1J42A 5EQFA 2FZVA 4RIIA 2IAIA 3DMTC 2RGXA 4IW3B 1ZK1A 3OQJA 4DUPA 1JHFA 4CLEA 2DUNA 4QT0A 4E2FA 1J2JA 2ETXA 2GPAA 1U8XX 4FASD 3DDHA 5FBQB 2VXYA 3GZJA 1K4KA 3TNFA 4TQGA 1YK1A 3WLLA 1OXBB 1DRUA 1FBSA 1U3DA 5DISB 2G1JA 2AJBA 3OESA 2J3IA 2PZFA 3HOVJ 3UWOA 4BMPB 4KE9A 4O2BB 3G6EI 2OC6A 1XTZA 2HRZA 2YS7A 2PWZA 2SBTA 1ZM9A 1T6NA 3OZ7A 3C3DA 3C3AA 4TN5A 3FN4A 3F3KA 4BVFA 4TKUB 2IODA 4MCHA 1DOZA 4QAJA 1D1SA 2NUPB 5EF6A 1KYWA 3K09A 2OQRA 1ORKA 1IAVA 4OMZA 2HLPA 2CVZA 4QGGA 2X0FA 1TLHB 4QOFA 2IIQA 4R7TA 2EYQA 2GEFA 3AJRA 3L8CA 3BWBA 1DIOB 5B4TA 3NEJA 5ED4A 3I9V1 3ML1A 3EQZA 4WVLA 1GVDA 3JAWA 3O3KA 4AO6A 2J41A 5BURA 2I1LA 2CXTA 3IDFA 5HMMA 1GV1A 4RTRA 2AG0A 1HLDA 4CO8A 5CHEA 4DDWA 1U3TA 2RGRA 3UUFA 2VATA 2X5OA 1W0UA 3REQA 1QR2A 4KU4A 4BFSA 4Q19A 3E3MA 4NOLA 4TMYA 3LC2O 1I7SB 4G8BA 5B1YA 4JJ4A 4Y13A 4DPMA 3CB2A 1VPTA 3BMXA 1J23A 4KDCA 5I4CA 2R93J 4EFKA 4WV3A 3KZMA 3COSA 3BIOA 5ER9A 1YNSA 1E9SA 2WD8A 1UOOA 1JPJA 3LSKA 3N07A 2ZM6B 1XJ0A 4Q4AA 3CDLA 5GAJA 2XXAA 2Z6QA 1G5FA 1N2ZA 1QPMA 1E7SA 2VP5A 3HBMA 2G9QA 2P4UA 2KYRA 3LP5A 5FOTA 4QTUB 1XVIA 1ADYA 2LFBA 2EBFX 4TRMA 3BFPA 3OHSX 1Z68A 1CXZA 4CDNA 4OAOA 4LMRA 5H80A 1YI8A 1A76A 4TWJA 4E7HA 3PDUA 3THWB 3X1ZA 2C8JA 5EQTA 4ZPJA 3LPMA 1UANA 4OP1A 3BTJA 1XDZA 4U0KA 4MO2A 5B5SA 2AKEA 4OIMA 1H2RS 3GB9A 2DA6A 3AR4A 3EDQA 2P2GA 4GOOD 2WWWA 1W88B 1LNZA 3DO5A 4C0QC 4WT7A 1Q77A 3EMKA 4B48A 4NOKA 3IESA 5B1SA 4RSGA 1L5FA 3ZE6A 4WLOA 2R44A 2O8VA 5EIBC 1N2SA 3BZBA 1CVIA 3F6SA 1ORWA 4DRXA 1YXMA 1ZJ4A 5CT6A 4DZJA 4FFPA 1Z2PX 5HF9A 2X9VA 4KVFA 4DNXA 3ZV5A 1OC4A 3P26A 3AUXA 5HVQC 1W25A 2IUFA 1L1FA 4GBED 3GLGE 4MUMA 3UAWA 3EAGA 1II8B 1MT3A 5TT0A 1Z62A 5I48A 3HL4A 2I34A 4R1UA 2AOTB 2RK3A 1EA3A 2R65A 1H93A 1MX1A 3MS7A 3S2SA 1U0LA 3URMA 3IJ5A 3ZJYA 2REQB 3GYGA 3H9EO 1Y3CE 4F0JA 1MC4A 4UXIA 4HEA1 4RULA 2DG2A 3TZQA 1A9ZA 4IQ4A 4CUGA 4JQYA 2I2BA 4JI2B 1YZUA 2X58A 5GP9A 4FWBA 3NEPX 4UE3S 1RWPA 3H2ZA 1R00A 1QZZA 4PLWA 4TKUA 1N6RA 2OECA 2ZIWB 3TFOA 3DPSA 3WYEA 1WZCA 2NUPA 3NJRA 1E3DA 4A3MJ 1MBKA 1NOIA 2CLHB 1K7CA 1TQDA 5KCZA 3KPUA 4RA9B 3SSNA 3LBYA 3V4GA 3KWMA 1VDZA 2I6XA 3LMKA 1CJBA 1QFXA 2IJLA 3D0QA 4CVNA 3DZGA 2PDAA 2ZSIA 1V4RA 1GPBA 3VB2A 3F9RA 2OK8A 1M2EA 3SCZA 1EGQA 1ZIOA 2ZAIA 1ST3A 2VWHA 5CEEA 1W0TA 4JU8A 2C0PA 1P7VA 4ZT6A 1KK2A 5J2TB 2GDZA 1XSXA 1RPNA 1CNFA 3G7UA 3NBUA 3IOEA 1D2RA 4FHGA 3FXJA 2A78A 4G9GA 3OOUA 4WFQA 2GF9A 1M34B 1JHZA 3ABQB 4R41A 2Q50A 3P9NA 5KPDA 3VKFA 5F98A 4UHJA 5CVCA 5ALLA 2XQJA 4A3EJ 3S68A 4RVOA 3N5KA 1KDYA 5IAOA 2XZDA 3EYYA 2ZZMA 2IP1A 4OBEA 3ROZA 2C1XA 3N97A 2Q2QA 1H0SA 2A0YA 5BMVB 3R5JA 3BY6A 2XDWA 4C0AC 4QYWA 1TE2A 3IERA 5AOCA 2IXFA 5M04A 1CQTA 4ME6A 5CA0B 2GSWA 3N2EA 1QMGA 3MC1A 3HHPA 1T91A 1L4KA 4ALNA 8ATCA 2ATXA 2DMNA 1J0RA 2BFCA 5ALSA 2XUFA 1LQUA 4TWZA 3V42A 3KJZA 2Q99A 2WBLC 4EEFG 5C32A 5AWFC 4V03A 2VXCA 1JHOA 2XHZA 1B6GA 1F5SA 3EUFA 3VZSA 3KSZO 4YAKA 3PXCX 2ATIA 1NZDA 2G71A 5IK2D 2ZATA 4QQNA 1WRBA 5CNIA 4JL6A 5HS8A 3H9GA 1NFFA 2J3DA 4TWAA 2NXWA 1SC1A 1RZRD 1XFAA 3NTQA 3GV0A 3JWHA 2IVMA 4WZAA 3AHDA 1EDBA 4WKPA 4N8SA 2C5AA 4GYJA 4P4TA 4YUYA 5EMLA 1P7YA 4R98A 2DH5A 4DW8A 3EVEA 4BASA 4W5QA 1KEVA 1FJGB 5K3CA 4XIFA 5M5YJ 3ZU5A 4MW6A 2LVBA 4UJ3A 2QPLA 5LA6F 4EIWA 4C3OB 3SDSA 3K0BA 4OB6A 5ESRA 1VTKA 2OGTA 2Z2JA 1SG9A 4MYTA 5GADl 4XWWA 2KZVA 1Y3IA 2R8ZA 3QVVA 4CDGA 3AEUA 4X62B 3KP4A 3CMMA 3OPNA 3KYIB 2VPPA 1II8A 2FEZA 3QMVA 1N7GA 1GZ5A 3OM9A 2AOTA 2IYFA 4MHTA 2PLNA 3UWMA 3EDCA 3BZKA 3BQNB 1HDZA 5A6SB 3E35A 4ZU3A 3PCXA 1ZH6A 2VT2A 4QQFA 2REQA 5TS3A 3PSFA 2BM1A 3HJEA 1PWYE 1NN1A 2E34A 3TQHA 1RTTA 4G84A 2VBWA 4TLEA 4F96A 4FX4A 3K9LA 4KAJA 4RELA 1GA1A 5L95A 3CBQA 2ZJQF 2ZRIA 3I3OA 3GK3A 1JRLA 3PQ3A 5G40A 2VI5A 1ZAYA 4UUOA 3LDHA 2FD5A 2J5KA 3LK6A 3QLUA 4NDLA 4OHRA 4N5LA 2QM8A 2ZBKA 2FEPA 4RM2A 1K63A 3GJ8A 2ZSKA 4RA9A 5CXSA 4EW2A 4C0LA 3H0GJ 3CF0A 4FI3C 4BNMA 3TKAA 2C4NA 4NBRA 4MPJA 4OOEA 2ONKA 1L7PA 4RX1A 3C8MA 5DKFA 4D5GA 5LZ5A 3H11B 3OLCX 4LRQA 2ZCWA 2HBRA 4TROA 4CIXA 2L02A 4DYQA 3JQCA 2P4HX 3Q8KA 3LDUA 3GLIB 3R24A 5KU7A 4GLLA 2NZWA 4EPTA 1P7JA 2FVYA 5ECWA 1B8NA 4A3BJ 5J2TA 1ZZGA 5E8JA 1U0GA 4GI1A 4Y3OA 1I27A 2OZKA 2NO7A 3V7SA 2L0KA 1OJ7A 4AY4A 2ADUA 5EP1A 2FVXA 4FEAA 3TVTA 4IIJB 1KQFA 2RONA 3GTQJ 4HZUB 1TKCA 2PV7A 4DB2A 2WHEA 2BLNA 2JUCA 1B7GO 2OCYC 3DU6A 4MR9A 3KP7A 4LJKA 1EUCB 3FHTA 2Z09A 5HE9A 1JQKA 3D81A 1KBQA 4RSRA 1VNDA 1XFDA 4DZRA 4X5OA 4BYMA 1ZXBA 4RVHA 2IY9A 1UG2A 1HDDC 4KWIA 2BBOA 1S0UA 3NYRA 1BOOA 1LZKA 2E6KA 1HORA 4O2AB 2YXLA 3X1KA 1Z74A 3R0ZA 3AV0B 1ZG1A 2WIFA 4X95A 2WFZA 3DHYA 1VJDA 3TLMA 4TYPA 3OA2A 3ZNQA 1E2XA 3ANTA 3GLHB 2JVHA 3MNFA 1JUDA 1YS1X 2QKYA 1KVTA 4WL0A 1RFLA 4F5ZA 1I6WA 1FBUA 1DINA 3C6KA 1WULS 3PLRA 1TW3A 1ISJA 1FMJA 3KUDA 4OHUA 3H5AA 3GJRA 5J4VA 4DF3A 3WE2A 2CSXA 2Q7DA 4KEAA 4P55A 2YR2A 1MQ9A 2ELJA 3TL2A 2OR3A 5DK6A 2IHVA 2QTWB 4D44A 1GG8A 4MV7A 2WKPA 3LIPA 2LD4A 2V96A 4LWZA 2UXNA 3GFSA 2CE7A 2BM0A 2DOFA 1GO2A 1OZFA 3DT8A 4E30A 1ZW1A 5JO0A 1JIKA 1KZ4A 3N0WA 5JAOA 2Q4RA 3EPJA 4C0HA 4YXWD 5CTJA 1P9NA 1E62A 3WHPA 4AKGA 5BSRA 4RGVA 4QOSA 5LHHA 5A6SA 4HF1A 3CZ5A 2PMBA 2A05A 3E6CC 4M2LA 3RU9A 2DFKB 3ZQQA 3E0JB 2B2XA 3MF4A 4C4XA 1V25A 4PWYA 3Q0TA 1P5ZB 2XNJA 3RVPA 3T7RA 1O3RA 4DM3A 1VI6A 5KNDH 3H65A 1N6IA 2JIDA 1EP1B 4TT3A 4U9HS 3N2IA 4RGYA 2L2QA 5ALWA 2MOKA 1R0BA 3QEOA 3EARA 1GA6A 5K51A 4ER6A 1IDYA 2ZSAA 2FPIA 1OUMA 2PIDA 3LZ6A 3TVYA 4BO4A 3H5TA 2RB5A 4B47A 5EUCA 2XBLA 2XPCA 5D3MB 2Q62A 2V74B 4UTRA 4WHMA 4HO1X 4BQRA 4MB0A 2LRDA 3IB6A 2PM8A 3M6LA 1RWWA 1LPSA 4XICA 1T9KA 4DNOA 2JFXA 4TMKA 3WDSA 1E2DA 3ZLBA 5L3FA 1G3IA 3K6KA 2F3UA 5IH3A 2UUOA 1A50B 1N0WA 3T3DA 5GZ3A 1I5EA 3HL2A 4PTLA 2RH9B 3GLIA 3H6KA 4HYYA 2TSYB 4GXNA 2ZXHA 5JZBA 1PQPA 1J22A 4U7JA 2ECPA 2WYVA 1P19A 5AKJA 2GZMA 4MQEB 1FXSA 1CZRA 2W6NA 1I3KA 4X6XA 4YROA 1Z7GA 3TSYA 5L3DA 1I5ZA 4YV1A 4HZUA 3OKAA 1KMHA 1RP7A 2E5NA 5SYMA 3Q0EA 3FVVA 4PINA 4E7SA 4RJTA 4UOQA 1EUCA 2FU4A 2GD0A 1IONA 4II3A 3DCYA 3IMFA 3FNQA 4ENVA 4NF2A 3M6WA 3MTBA 4CV1A 1JHMA 2AK2A 2I3BA 3FA2A 3DQVC 2COUA 2HVQA 4DTIA 4YIFA 4ZDWA 3RYIA 4HUTA 2I8LA 3O2QB 1ZQ9A 3GIWA 2P6RA 1UFRA 2FB9A 5L45A 2D06A 5BN3A 4PLCA 2WJWA 5BN5B 4N5IX 3MGAA 3ZQJA 1U9JA 3C3XA 4D2IA 3GLHA 2JLYA 2ZJ6A 2MMGA 2FSPA 2ID4A 3BTCA 4RPLA 4PZJA 5DW0A 3KEYA 3CUQC 1MMFB 2CKMA 1J2TA 1IHUA 3GQBA 3EUHA 1CRQA 3I0MA 3E82A 2XWQA 4MIEA 5FNVF 5C1OA 4NFHA 2VJOA 2DSNA 3R2JA 4RE6A 1V1MB 1TVMA 1Z4MA 3HWX1 4TXLA 1W30A 3Q5DA 3UWDA 1ULHA 1IUKA 1SD7A 2VAVA 4WXPA 1JI8A 3D1NI 1QE0A 3EK2A 2IGBA 2DYKA 1JEDA 3ZCQA 2I4RA 1G3MA 5FOVA 2FUG1 4OU5A 5A9TA 2CF6A 1UMQA 2PRIA 4YR9A 1I01A 1CJVC 3JCUC 2J6CA 3RS5A 4FDUA 3W1EA 3WTXC 2Q7OE 4HXGA 1CULC 2H0RA 1SXJC 3TO9A 1UJMA 5HS4A 3ES9A 2O4UX 4WCVA 2XYVA 4KQGA 2SCUB 3VNVA 4ON9A 4X7BA 1OTHA 4MS4B 4NABA 3RTGA 1EJBA 1LUAA 1YE9A 4B2LA 2WV9A 1V4NA 1H8HA 1Y8QB 3VOSA 5KYWB 2EXXA 1JXAA 1T3LA 4YUVA 4YCMA 2I0FA 4Q7QA 2GHIA 3ENVA 2Y48A 4OMUA 2WSSA 3I01M 3K0CC 5I7RA 3D8UA 3G85A 1B8OA 3NASA 2CNDA 4PLHA 1E8DA 3IAM1 3O8QB 4DV1B 1WSAA 3S81A 3VNBA 5JSUA 1PT9A 2P6UA 4IGAA 2UKDA 4FUTA 2DTRA 4XX1A 1DQSA 2VTDA 5IVHA 5BNZA 4GMGA 4Q4DA 3PKIA 4K9MA 5GPBA 3ESQA 5D3MA 3IS3A 3FETA 4K0KB 4DNQA 3NT2A 2B8TA 3E48A 3TPZA 3TG2A 3QPSA 4RCVA 5K4GA 2E36A 4MRAA 1JFTA 1YR3A 1M5UA 4BNWA 1JV2B 2OU2A 1V39A 1UAGA 4URVR 1SCJA 4DCCA 2I78A 3DF7A 1P61B 5EWJA 4UUAA 2X1LA 1MFPA 2PBFA 2VRBA 1I4TD 1UC5B 1RQXA 4DJFC 3LHDA 5IVIA 5E3IA 2WE8A 4P5OA 2PMCA 1QHHD 1EJ2A 5AJVB 5I4BA 4JI4B 4JOBA 1NMXA 3D31A 3I1JA 4NCXA 4R8LA 3ZWAA 5TX7A 2G82A 1FQKA 4G5GA 4PO1A 3SBEA 4NNPA 4OHCA 4E31A 4H08A 1T5TA 2BEWB 3LX8A 4ZVPA 3DT9A 1Z38A 1FU8A 4AURA 1Q2XA 3ZHUA 3UWSA 2C2OA 3W3CA 1NGSA 3BXEA 3EGOA 1ITZA 4F3TA 5BR8B 1AA9A 3PR2B 5D4RA 1H42A 4IDEA 2AG5A 3SXJA 3PL8A 2B8EA 5JXIA 2O0HA 3TWOA 2O8EB 2BKVA 3DMPA 4IUDS 4B3JA 4UU1A 1ZY2A 3HXOA 1MEEA 1F2DA 4BWFB 3S1LA 4HQ0A 2HCJB 4CF4A 1WSBA 5BN5A 1CJSA 2GFHA 4U2BA 2V6CA 1DEXA 3LVQE 5F64A 4P82A 5AK0A 5L3GA 3MAGA 4AJPA 3M4NA 5E7MA 2C07A 1KYZA 3UA4A 3UENA 1QB8A 2RJNA 1P92A 1P4SA 3N5CA 2COEA 3MLBA 4D4IA 3JZIA 2HIHA 2VJQA 5ALYA 1JGSA 3KVVA 3R6LA 2BMWA 3HYLA 3TS1A 2QX7A 5MDHA 2P6TA 1SKUA 3BFXA 2WWRA 3EVNA 3CRMA 3N75A 1NUQA 5LBQA 4JYMA 1MORA 3LW7A 3WKCA 1DZIA 2IUYA 1DV2A 2JNWA 2VN2A 3NGLA 2PUHA 4XM0A 1Q57A 1KZ1A 4JI7B 1E6WA 4F06A 3Q0UA 2FP3A 4JT2A 4RWZA 1VQ6I 4NZNA 1T56A 3OT1B 4IIYA 3ESZA 4H3VA 3RKSA 5JASA 1E1NA 3ESDA 2JL1A 3AKYA 3BB4A 2B99A 2VOOA 4BMXA 4UFPA 1DG9A 2BKEA 3BJIC 2PYDA 4ZEVA 2CQXA 4PG7A 3IHLA 2EOAA 1IATA 4M6YA 4B3GA 1TK2A 1Y8QA 2BEVA 4F8YA 1S2GA 3HRMA 8ABPA 3RC8A 2QQEA 1XZIA 5K2OA 5BUQA 4A0RA 3WHIA 4N5MA 1FRQA 4PFSA 2YYYA 4O8CA 4HSGA 3ZQCA 2PUCA 4AKEA 4EUKA 5BPFA 4DMHA 4B43A 1WHSB 1FNCA 2IOYA 1SB9A 2WYWA 4ETNA 1SXHA 4PE5B 3I0TA 4UMEA 4JBIA 2C8LA 5E0OA 2PRZA 3RSQA 5GAHJ 1DDNA 5KWJA 3VMFA 1CJCA 1DLIA 2PUDA 4AWXA 2YZKA 2XMDA 4WBSA 4BEHB 5F9MA 3JQFA 4QTXA 1KEKA 5G4LA 4ZCMA 3KEGA 2B78A 1R23A 4NR0A 2NVOA 3BJRA 2GTHA 1Q5PA 5B7GA 3DEEA 2IU0A 3Q0IA 4WASA 3LBAA 1WD5A 1B1AA 5KWVA 3O7WA 1PP8F 2BFAA 4NONA 4DR4B 2ACWA 2JG3A 3WGJA 2XGXA 4TLCA 1PWXA 1CRLA 2I54A 3OJOA 3RRYA 1NW8A 5KQLA 2I5PO 2FPUA 1WKVA 2A0XA 4BO6A 1I2MA 1E1CA 1IY2A 3C24A 1HFWA 1Z4IA 2OHFA 4ZJYA 2H2GA 1P6RA 1XZLA 2F4MB 1L0BA 5EYRA 2BSQA 2WZCA 3AR9A 1T4MA 4OXXA 2RHLA 3IXLA 5P8WA 5C51B 3NT4A 1PW5A 1KU9A 4X54A 4ENWA 4DDMA 4A91A 2BEWA 5DYYA 1MMGA 4FZ5A 2O8FA 1BU8A 1UFMA 3MTJA 4LY0A 4CFSA 1U6JA 1RI1A 5E4YA 1XRPA 4ZQFA 3ASYA 3ZXIA 2DLNA 4BZZA 4CKEB 1YZNA 2FJPA 4CTNA 3HGMA 4BXFA 3JAMK 1V41E 1NBIA 1W8IA 2JGDB 4PX5A 4YUAA 3IP6A 3VR6H 2ESRA 2ZI3A 4IMJB 1TT7A 3DB2A 1VOTA 2ZR7A 1RI5A 5T6BA 4AS1A 4UU0A 3CSUA 3KXDA 1CCWA 3AVQA 1JX6A 5C18A 3OIYA 3NAGA 3NOXA 5F2NA 2AHQA 1J9GA 3WP0A 4F92B 3VA7A 2PS1A 5JI2E 4D26A 2WNHA 1NX6A 4DY6A 1YR9A 3MTQA 2O5RA 2YYSA 2JIQA 1TMOA 2BHNA 1RZRA 3LDGA 1VFNA 3CQ9A 1H23A 3U4IA 2CXSA 5AW4A 2HHHB 1JP7A 2A4KA 3NVAA 1Y4UA 4EVIA 4X94A 4L0QA 4ZYYA 2DE0X 3NYWA 1X7DA 1WU8A 1Y1TA 2ZAMA 5HDGA 3OPYB 5CVRA 1M1NB 4CU5A 1G4HA 3EWSA 4MVCA 3D7KA 4NULA 5FD6A 4NAUA 4X6YA 3FTQA 1OWNA 4BE0A 2BI4A 3FKIJ 2ATCA 4F21A 3D9QX 1X0VA 1EVKA 3DE3X 3W1VA 1KO7A 4BE9A 2A3RA 3ZHCA 1QHIA 1OZAA 3TW6A 2H7CA 4X3OA 4TTPA 2QMUA 5ED0A 3D8HA 2Z6AA 4FI3F 4QDTA 2G04A 1R4NB 4NMLA 4JYPA 3LGAA 1BDIA 4WXCA 1VXRA 2Y05A 4C0JA 4GR4A 4M1YA 5AVTA 3GYHX 2CZCA 3L07A 4RF5A 1ZP6A 1HEYA 2XZOA 5SZHB 2YV5A 3DE5X 4CLDA 1HSJA 5DUIA 6PFKA 2XEXA 1BVYF 1GGHA 2ISZA 2QMYA 3UHFA 1WHSA 5B4VA 3Q8XB 3RG8A 2I2XB 5K7FA 2Z2ZA 2EAUA 2F5VA 4X1OA 1VBMA 4IH4A 4HNTA 4KPFC 3ZHRA 1WPRA 1DWUA 5K5RA 5THQA 5DCYA 1XZKA 2WUWE 2VF4X 3W04A 3ZE9A 3I4NJ 4IH1A 5EYPA 3EETA 1XMOB 2EFDB 1V9SA 8OHMA 3CP2A 1V5EA 2GDJA 3T6KA 1VIMA 3ANSA 4AQDA 1MABB 1V1JA 2NZVG 2XHEA 1D5YA 2DMTA 5EZGA 1YVRA 3REOA 2Z99A 5BT8A 1ZGJA 5JHFA 3QPTA 5ANRB 4H6WA 2STWA 3D5EA 5EZYA 3ELDA 3OCYA 3CF4G 5IFKA 2IIPA 2M1BA 2EK5A 3BWGA 1GHTA 2BFPA 2IEBA 3FDIA 5E7IA 4QGAA 1FFGA 4PW0A 3QKIA 5FLMJ 3L8GA 2IYUA 3W2AA 4JUIA 4PO8A 7AT1A 4B34A 4DJTA 1YIJI 4L5CA 2Q2EA 2L54A 4QT4A 5FWNA 1DEAA 1NW4A 4QUEA 1NR5A 1RRJA 2FQ4A 4QHYA 2H1VA 2GBGA 3DKKA 2JSCA 1XQ9A 3KQWA 3QPDA 2QA5A 2DVMA 1MIOB 4RZ3A 1E1LA 3RAGA 4DLAA 1T5DX 2P4WA 3H7IA 4MUFA 2FW1A 1MO3A 4RZXA 4UZSA 3SN6A 1BKSB 2ECOA 1KI9A 5H4GA 1ACIA 3P32A 1VSQA 1SFRA 2XIJA 3KYBA 3GA7A 2PJRB 2AZ4A 4DSZA 1ZOIA 1H5UA 1J00A 3NUZA 4RVSA 3WL3A 3K32A 3JQBC 4D9IA 2RE8A 1IOZA 2FSWA 3GY0A 1T4GA 4L8GA 4MAFA 3F90A 4BKXA 3K5HA 3P9RA 1EFPB 1XRSB 3HN2A 3NHYA 2YQ5A 4CR8A 1UCFA 4OAQA 5GADJ 1JI0A 5DLEA 1PG2A 4NPAA 1O7JA 5K09A 3X3HA 2VODA 4OKNA 2VBIA 3HNOA 2YVUA 4XCQA 4PXSA 2ZDHA 4WN9A 2QLZA 2YU9J 1M6HA 4JT4A 5A0VA 1NIPA 1REQA 3SS7X 3JQAD 2BH9A 2L7FP 5HRCA 4L9JA 1ZD1A 2VAXA 4RXMA 1VYHA 3FPSA 4DV6B 3PNQA 1W4AA 2VK8A 2EKLA 1NG6A 4QE3A 2WY8Q 2QF7A 1AUOA 2KFDA 4EQZA 1WH5A 5AVOA 3Q3VA 3O4JA 1SUFA 3RC7A 2E2HJ 3C3MA 5FTJA 3VVLA 4YXWA 2J59A 5JFOA 1YS9A 3LTEA 5LFAA 5TQ0A 5FLKA 4EL0A 2O54A 3ZLVA 4L57A 2XMQA 4DYHA 3N2GB 2AB0A 2E5FA 4WD3A 4DA7A 4FHTA 4LXTA 1DQYA 1A96A 3ANMA 3WWEA 3EN0A 3VZDA 2GYUA 1ML3A 2ODAA 2W82A 3BMNB 3OQOA 4RK0A 2Z3ZA 4YCLA 4IHYA 1PT5A 1UJNA 4MVJH 4RY2A 2R6GA 1GL7A 4RU1A 1XGMA 3QJYA 5DTJA 1JIVA 2Q6TA 2AIRA 1QWSA 3RJ9A 4EMUA 1NE7A 4FMBB 1ZOLA 1B8PA 3B9BA 2LDUA 4P22A 2WWGA 2ZS9A 1HMYA 1PTKA 2UZKA 3O91A 1B6TA 3T4UA 2OAP1 1ISMA 4A6XA 2DFPA 4K6KA 5E1ZB 1Q7CA 4D57A 3VWBA 3JZDA 4RAYA 5IXJA 4CCOA 4OA8A 2UUZA 4NBSA 4ARZB 2FSHA 5LDGA 1MOSA 4KHZA 2AD5A 2ZSHA 4TOIA 4Z49A 3U7QB 3SIRA 3E0QA 1GL6A 3FCEA 3UMYA 4IIBA 5K5OA 4XIJA 4J1NA 5EXPA 3K10A 5KVSA 3V1YA 3T54A 3W34A 4QUDA 3U3OA 2JLWA 1EUDA 4C4YA 3B9QA 1PVDA 4MWOA 1XPRA 1BXRB 3ZQHA 3CCYA 1W5CC 2CXNA 3D5RC 5D01A 2VSXA 4P4SB 2G67A 4HLYA 1KZ9A 4C0BA 3K1ZA 1WCMJ 4TYWA 3IOBA 4RWEA 3WQQA 3BC8A 3S3MA 1UK8A 4L1KA 1Z17A 1QCCA 3IP7A 2ZYAA 4HLQB 1ULYA 1OBCA 2G7ZA 4HKTA 3NAUA 3HA5A 1R4ZA 2PNJA 3ILVA 1OILA 3OCZA 1RLMA 2XF5A 1ERDA 3M6FA 2P9TA 3E6AA 4Q1BA 3JREA 5F7ZA 4BCDA 2ZBUA 2JJ1D 3N8NA 1ETXA 2WDZA 2YNMA 3W5BA 1JEQA 4LCBA 4XA8A 1LLCA 4MCJA 2RH8A 4Z4IA 4EGFA 4CQMB 3D64A 3A6PC 3PTAA 1K6OA 1ZIYA 2XV4S 4FT4A 5HILA 5AJZA 1O6ZA 2CK3D 2QL9A 1AKQA 2Q0OA 1GGVA 3TXAA 4LHYA 3DEJA 2DEUA 2PJRA 1U2DC 3VDXA 2OYCA 1VQ7I 3FDFA 1RZ3A 2NWQA 2VHXA 3UFBA 1KO1A 4BEBA 2YFYA 5A7GA 1NM5A 3KQOA 3L7WA 4JL5A 3ZHSA 1UXHA 1MEOA 4QXQA 4JB0A 3GHYA 2V26A 5ABPA 3CLKA 1ZRMA 1KBOA 4NPHA 2PUFA 3T41A 3TLAA 1WFXA 4PQGA 1I7NA 2FRXA 1JW9B 3IIEA 1PE0A 1V3UA 4BTVA 5JD3A 3HCAA 4IIFA 3T7SA 1CUZA 1GQFA 4HS9A 3DF8A 1E94E 1AHHA 4YMLA 4U2DA 4HOBA 5FB2A 2XB0X 1OYVA 4TKZA 4ZI7A 2QTLA 2H1HA 2WNSA 3WL6A 4QTRA 3DVSX 4DA0A 4MKFA 5EMHA 2DKFA 1YQUA 2BHYA 2WJ6A 3UHOA 2HI3A 3L46A 5LOVB 5DD8A 3LUFA 5H3CA 3NRJA 1ZKDA 3OZDA 3S8YA 3WRXA 4H9GA 1IVNA 5CLFA 4NICA 3HBLA 1NBME 4PCQA 3LSIA 1ZRSA 3N2GA 3REQB 4XEHA 4C4OA 4D74A 1GFZA 4PZLA 3H87A 5GAEJ 2NO4A 5GOZA 4OLBA 4NMHA 3INRA 3I32A 3BMNA 2CVOA 5B12A 3W5SA 4UJ5A 3DR3A 3VYTB 4WX9A 2CGEA 1S7OA 4MTDA 2WSBA 2B3DA 4F5EA 1FLIA 3O4FA 3MWEB 1VLHA 1Y6JA 2CYCA 1TWGJ 3GTGJ 5LZ8A 5MN6A 2XUZA 3FLAA 1ZK4A 3A04A 4Q4AB 2OTJI 4LJAA 2XXAB 2K7FA 2QSYA 4BBJA 4KQXA 1DAKA 4IR7A 3ERED 3B3JA 4NZYA 1QO9A 3QVGB 4DCJA 1TKAA 2P9BA 2C2MA 3CO6C 4P93A 4O4IF 1B15A 1BX1A 2FDCA 3A02A 2RGNC 2P91A 4A6PA 4WBNA 1B2RA 3S1SA 4JV5B 1JSRA 2OZEA 4TVBA 3RI4A 2K87A 2NM0A 3LOUA 4FYHA 1OX4A 1U5CA 5F5LA 2EFWA 4PYKA 1BXRA 2NV0A 1UR5A 2GZWA 1YZLA 4Z7QB 1E2NA 1ODJA 2GRAA 3KKOA 3OQVA 1GJRA 1PWZA 3NNDA 1ZELA 2B98A 5FBZA 4Z4GA 3RAPR 1SZPA 5KYNA 3ZQIA 4P4SA 3NTUA 4MINA 3MJDA 4K2HA 2J32A 2BW3B 4BY9E 4DRXB 1ZD8A 3AXTA 4OHPA 3MKWB 1X3LA 3E5UA 1DG1G 3TQNA 3CESA 3LSGA 2NSYA 5J43A 3R61A 2O5EA 3LA2A 4QG3A 5ALVA 2E1CA 3BK1A 3YASA 1NJ5A 3J81A 3RHZA 2EFOA 4OHXA 5JAPA 3OO0A 5CG1A 2KIUA 4CQMA 2J0QA 1EFVB 1SGWA 1ML4A 4CI0B 4E51A 1WNTA 3G7NA 4X84A 5J3JA 2ZVPX 1WMFA 3L4JA 3SPXA 5A02A 1XQ1A 2HTEA 2P30A 3PF8A 1C0IA 4M0LA 8ADHA 4FDVA 4L74A 4IFTA 1NUAA 4BMYA 1UOPA 4WOKA 2B3TA 4U1RA 4RSHA 2CUNA 2WB4A 3PEEA 2BDEA 3F3MA 2JRCA 2JARA 1A7KA 2F48A 1L5YA 3U6KA 3IAXA 1G8MA 4OSPA 5F23A 4Q3AA 3UCXA 1IBRA 3EMBA 4FMCB 3VPRA 4EBFA 5DNYB 3DHNA 3PE3A 5J5VA 3O8CA 3PJEA 3OYIA 2VDNB 3I6MA 2WA2A 5K0ZA 4IUYA 1ZBQA 1CR4A 4EVSA 2ZSIB 4C3ZA 1VI2A 3H5IA 4QICA 3WL5A 4A0SA 5JEDA 2GXAA 4S1NA 3BWCA 1BGXT 4M37A 4G5QA 1BWSA 5LOVA 4XUGB 2CV2A 2BBSA 4DIQA 4JX8A 5AI9A 2QVCA 3A10A 3P0FA 5HLHA 5DI3B 3G8DA 3BEOA 4LUCA 4FW8A 5LGTA 5KSPA 2V55B 3P1JA 5KNCD 1VBKA 4CUZA 3MMZA 4XM3A 2FN4A 3W6JB 4LZNA 1MTZA 2XZLA 3K1TA 3BHMA 5MGNA 1QH1B 1OX5A 2RG1A 5EZHA 2FZCA 2P4QA 3O4GA 2IHBA 5FUXA 1E6KA 1NN3A 1GCGA 2HEOA 3GO5A 2AC7A 5EN4A 2F5FA 1EHCA 1HLVA 5FT9A 2EIXA 3MJVA 1AVTA 3RLFA 1KI2A 3D0SA 1NVFA 3MWEA 2WWXA 2BFCB 5IARA 1R8QA 2JKZA 3IKMB 4RZUA 1IGNA 5FLEX 1EIWA 1PK8A 1O03A 2FCRA 5JQWA 3EH1A 2ADMA 1MJGA 1R0YA 1R27A 1CDZA 3QVGA 3V5NA 1B8VA 4I1RA 1RCUA 4FYKA 1XJ5A 1J90A 2DYRH 3CA8A 1NXQA 1SOWA 3F47A 2IYLD 3SEQA 1UBRS 4IMPA 2GERA 4BP1A 5EGNA 3GTMJ 3UV6A 4WLNA 4ZYEA 4WZAB 3AP3A 4NB5A 3DEFA 3AIOA 1D5VA 4FQ5A 3RS8A 1IRIA 3EHEA 3AGPA 5B6PA 1DAOA 3IL2A 4KIFA 3ZWCA 3TUIC 4D9BA 2DAPA 4BRSA 4I02A 2WYUA 4I7HA 1VZ2A 3I6YA 2HRCA 2HXIA 3HU1A 5HZKA 4V3BA 3IV7A 4E5UA 2BW3A 2QHXA 3UK0A 3RVLA 5DM4A 1UC9A 1AMOA 2HA3A 1BD4A 3MFKA 4LLGF 3B38A 4KQ1A 1L1RA 1ODDA 4FGWA 3AQ4A 2R48A 3DMFA 1T0UA 2ZKLA 5AKKA 3IUSA 3AEUB 1WVGA 1E4EA 1YL7A 2QT9A 1R1VA 2H94A 3P9PA 1QYDA 1KFJB 3R74A 4ENNA 4BTLA 2FN9A 4R16A 1CDEA 1I7QB 3AQIA 4G25A 1EFVA 4B3HA 1BMFA 4BFUA 3WK9A 4LN1A 2EP7A 4HOYA 1RQPA 1XMAA 4HGOA 4UXHA 1SUPA 1CY0A 3HI6A 3UW1A 4WEQA 4BAUA 1RTKA 1DMRA 2QV0A 3SOPA 1ZC3A 2R7ZJ 3FPBA 1JHRA 2YRXA 2CLLB 4ETWA 4TMZA 1THGA 4RKWA 3R6DA 1SK8A 4MUXA 2PUBA 4MDEA 4ESHA 1J8YF 2BGWA 2VUMJ 1K8RA 5FCDA 4DXHA 4ALMA 4NJMA 4C08A 4ZGWA 5H6RA 3K3PA 4QGHA 3BD7A 5I9LA 3S14J 3E6MA 2HVSA 3T9BA 2I65A 1BS9A 1RAIA 1JQ3A 2GEUA 5LQAA 3EBOA 4NENB 3IMEA 4Z5XA 4K6FA 3NRBA 3DDSA 2IHUA 5EJFA 1P1JA 4LF7B 4D9FA 1W1IA 3LQ1A 3LNTA 1DAHA 2XTAA 4FOLA 1T1EA 2IGKA 1QHXA 3AFHA 1F4VA 1FXWA 3DPTA 2QA4I 1X4OA 3G89A 1K1EA 4Q4ZF 3D4NA 1I1HA 4QLCU 2VUUA 4BNJA 1T1JA 1R0ZA 3S40A 1NIJA 2JRMA 3SF8A 2ZXWH 1LFAA 5DI3A 2K85A 4MS1A 4UHHA 3S0JA 5DH9A 4MLCA 3UPTA 4L9NA 4XRSG 1NC3A 1X8LA 4P7GA 3E9DA 1R5NA 2TMKA 3JD2A 1CZUA 1WR8A 2HQSA 1V8BA 4MR9B 1F3OA 2YUSA 1QH1A 3HEMA 2WF7A 1VL2A 2GJSA 3GPIA 1KFBB 4RBOA 2QN2A 4UDYX 1TIKA 4HTAA 1DBQA 2HWUA 4AIJA 3AUUA 5AW9A 1U5TB 2MFZA 2XSJC 4LOAA 4O5AA 1Y5LA 3O3OB 1X42A 2Q4DA 1WE2A 2A7XA 1EM8A 2HJRA 3HSYA 5AKEA 3ENNA 2BN4A 2FG7C 3DE6X 2UXCB 3MYYA 3RE1A 1R6DA 3N3BC 2WJ3A 4U7GA 1KU7A 2OQGA 4K26A 1PYVA 2WLTA 1F8YA 2VKTA 4UC0A 3BWMA 4LHEA 4AZTA 3ACCA 4F3KA 2OV4A 1FY2A 1QIJA 2RIPA 2MR6A 3JTEA 3S16J 2NAPA 4E2XA 4R40A 2IPMA 3TG8A 1MB3A 3QITA 3F0TA 3RSZA 2WB1A 2NP7A 5FIUA 3K4BA 3ER8A 3ZOBA 3ZCRA 2HT1A 3G68A 1ETYA 4BMCA 3PQ8A 4AUXA 1QQAA 1NXXA 4GLFA 4N3AA 4BO2A 2WVJA 4G97A 3EFOB 1BIFA 2CFCA 1XCVA 1NONA 3GT4A 4FZ3A 4V1CI 5BSMA 4MUJA 1UDCA 3O1HB 1WOYA 2XY4A 2Y75A 4DLTA 4EZEA 3P2JA 2R79A 3HRIA 5NULA 2VBZA 4I36A 3K70C 2JCSA 4MIOA 3ZHBA 3T52A 4A27A 4XVUA 3AR7A 1FW6A 1FFEA 3AKEA 1U0RA 1FP7A 3V1NA 3SMVA 4XLZA 3Q4GA 3L8FA 3THRA 2QOEA 4V0QA 1U1DA 4CZZA 4XFDA 2UV8A 4OXQA 4JJ8A 4F7WA 2BY3A 3H97A 3PYXA 1D2GA 3LYHA 2JIZD 2IE0A 3CLHA 3A7DA 5CIYA 3ZTWA 1VCMA 4HVCA 2VCHA 2H6EA 4NV0A 5EERA 1EAMA 3LCMA 4M83A 2LKDA 1KQ8A 3EBPA 4BFTA 2FPIB 1KFCB 4M54A 3WYAA 4EA6A 4UBIA 2DPDA 5KOYA 3OU6A 5DNWA 4B6FA 3WIEA 4BQPA 3LOQA 5DB4A 3HDVA 3COZA 2IDMA 3HZZA 1Y9ZA 4KQ9A 4NH0A 1TB4A 3KP2A 4EG5A 3ZMUA 3DBRB 4HPQA 4NENA 3QVSA 2AWOA 4RAOA 4KN6A 3SXUA 2CV1A 3L43A 2W6QA 5B6JA 4WZBE 2YJGA 3CX3A 3O31A 3RQSA 1BRTA 1Q19A 2XE8A 3U48A 5CDYA 2R7WA 2GPSA 1TAQA 2GH1A 1E0AA 1UEIA 3D0KA 3ZDRA 3OJLA 3VPBA 2FMTA 2IHYA 4V39A 3ZJUA 3N3AC 3MWGA 4PLFA 2E82A 4ED9A 4C5BA 4ETSA 2GOXB 3EGEA 5CB4F 3CUKA 3TEFA 1XZNA 2BGRA 1KMHB 2I03A 1TUEA 3LX5A 2Z98A 3SOZA 2DRIA 4FX5A 2PZJA 3C45A 3KQHA 3EY9A 4U2GA 1JDZA 4GX0A 4AKHA 2QD1A 5AT1A 4HDOB 3SZMA 1Z2OX 2HNAA 3QEMA 4OI2A 2PVPA 3F6PA 3NFRA 1WD7A 2AV6A 2A59A 4U7PB 5CR9A 4LZPA 3L6OO 3E70C 1R9MA 1U5TA 2D2WA 13PKA 3PFWO 1YCGA 4QLOA 3AUAA 3LF2A 1YB1A 5IT9A 5BV7A 2FW7A 2C9BA 3PPWA 1ISIA 1YRYE 3UH1A 2ZFUA 1L3LA 2C77A 3RYIB 4RLSA 2X0RA 2X5NA 1W1WE 2OAZA 4PU0A 4C3VA 5BN3B 2IPQX 3HJGA 2NO9A 4PRKA 3PNYA 5EVJA 2FSIA 1W4LA 1WCIB 2XPVA 1N3IA 1QRRA 5ERYA 2GXQA 3GQBB 4OBBA 2K3PA 2IKSA 2JDIA 4ZVLA 3WYDA 5EQDA 3HSSA 3FAKA 3UNGC 3ZHOA 4N0BA 3DFFA 5KJFA 1U5BB 3CBGA 3VISA 1U8AA 1BD3A 5B1HA 5HP4A 2RNGA 4BBAA 3OR1C 3WZMA 2Q0SA 5BWBA 3R9XA 5KI6A 3C1AA 5JZMA 2HQRA 3EFOA 4UNNA 4NOMA 1X7GA 3FSGD 3MTEA 3RRXA 3B73A 2AZTA 1NW5A 4BQFA 1OYIA 4CYCB 1MRNA 2HA0A 2IOQA 1JG1A 3HO8A 2VDVE 1I8TA 3K8OE 3AT1A 3X0DA 3KFWX 2X77A 5IT4A 3FKSD 3E9RA 4G37A 4CNQA 4ODIA 1IFXA 3BB3A 2ODQA 2M32A 3CMAI 3HIFA 2BKXA 4OHZA 2NAZA 4XIYA 4R2IA 3WRVA 3F6VA 3C3YA 3FI9A 1DAPA 5K0NA 5ILGA 1W52X 1X7ZA 1F8GA 2EA4A 2F1RA 1UT8A 2L9VA 3QU4A 5FORA 2G5TA 3VNSA 5LGUA 1DO8A 2OILA 1WQ4A 4UATA 4TVSA 4CYDA 1U1GA 1H0MA 2IA1A 3RFTA 1X1BA 3LECA 3LFTA 2CLSA 3ZGYA 1A97A 1L4GA 2QAIA 2C61A 1QRDA 4D0PA 2IRFG 3IALA 1RR7A 5J40A 3DL7A 4OAYA 2DOAA 2AXNA 2E6UX 4DDTA 1DBWA 1E8MA 1WSUA 2FKNA 4I0WB 5BN4A 1EDEA 3HOWJ 2PVCA 3TNLA 1GG5A 2GAIA 4L5IA 2HA7A 1Q74A 5BW5A 3DBRA 4WLUA 4RMJA 1IVYA 1Z77A 5ESWA 3TQIA 5IX8A 3V1LA 3CVOA 1NVBA 1G20E 1QP4A 5EWJB 4WJZA 1EWQA 2YZ7A 3L4KA 3GWGA 1IZ8A 2DODA 3H5WA 3QFCA 1P2UA 3I9V6 5CVEA 1FDVA 3KKNA 1U9YA 1UXGA 4J0EA 2AA3A 2QROA 3ASNH 4IQ8A 3UT5A 4ENSA 3KCQA 4B7CA 3WLKX 4YUZA 5IYZA 5GOTA 1PZMA 3KYJB 2JFFA 2BP7B 2H09A 1PKXA 4ND6A 2ZDQA 4I6EA 1A0OA 3X1MA 3PHJA 3JQ9C 4JOMA 3BPXA 1DNPA 3RS4A 2VNKA 3C4QA 2FY8A 1AKWA 4KWEA 4IH9A 4BLUA 3F96A 2WA0A 3BF8A 3ANXA 4QNMA 4I4CA 2VPZA 3PDIB 1DT3A 3TBKA 2GF0A 2X0NA 4JEHA 3P9ZA 1FIUA 4CL8A 1I9GA 4J7XA 2V0NA 2OENG 1UOQA 3V4ZA 2C82A 1LNQA 1TCUA 4BB9A 4NK5A 2PH7A 3CUTA 1LTHR 3VI3B 1CQWA 5JMWA 1WJGA 3QHAA 1R3UA 3HYRA 2GA8A 3KNZA 3VYSB 1WCIA 3JRFA 3IPAA 2DETA 3WK5A 3BX1A 4S24A 3F6BX 3REGA 4B6SA 3I3SR 4PS1A 5IT5A 2XQIA 5KVCA 3CMEI 1J33A 1AKHB 5THKA 4YMHA 1U5BA 4ZTJA 4Q4LA 4UU8A 2Q8KA 3FXAA 4I08A 3EY4A 5I7FA 5K20A 4L8VA 3HU2A 2FPSA 2XCIA 4O59O 1LQ1A 2AXQA 2J3HA 2I3DA 3U0BA 1O3YA 3I0NA 2OCDA 5F73A 3ELUA 1JPUA 4CYCA 3I8OA 3MIIA 1AF7A 1ZNYA 4DIDA 2AWNA 3DE2X 5AOAA 2VBXA 1VQOI 3HTXA 2WWHA 1MQSA 2LPMA 4KYWA 4KX5A 4ZYHA 2QSJA 3AM1A 1CRPA 4KR0A 1M2OB 1BMQA 4Q1AA 4JU9A 3SVLA 1CUWA 1LDYA 2HUPA 2UXXA 3CKMA 4QU9A 2BEVB 4JZYA 1WUJS 1FJXA 2MJLA 4RMIA 5JPIA 4UV9A 3U7GA 2X5JO 3VVMA 2RC4A 1G7RA 2NPFA 3AUKA 2UUBB 2V7TA 3L40A 2JFHA 1NUPA 1XVVA 3LWNA 1EVQA 1DU6A 4AD9A 5KTRA 1ZX1A 1J99A 4HEA6 1EG2A 2JCBA 5LQNA 2XWJI 3PGVA 3WGOA 4EATA 4QOEA 3NDPA 4W9NC 5HFJA 4WH0A 2ID8A 4I19A 5AVJA 1WPQA 2E1NA 5BOSB 3EVTA 1S4MA 2OBPA 1AB6A 3LFUA 3NAMA 3KM0A 4RFVA 4YRSA 4AWXB 4KO3S 4M76B 1CUBA 3ZYZA 2XCUA 3W9YA 1X2NA 1Y0NA 5J4YA 4RY0A 3R41A 4IRIA 4OB8A 4EQQA 5DCLA 3ZK8A 2QVXX 2FPLA 2ZJRF 1W44A 4WK8F 4CE6A 4MP6A 1U7OA 4B80A 4NBTA 4AECA 4AVZA 2NIPA 3T3IA 3PXUA 3T9DA 3L05A 3OZUA 1Z05A 3GD5A 3HOZJ 3FX3A 3B3GA 4EYSA 1ONVA 1E1CB 4TV9B 3MJCA 5EE0A 5JSKA 4KPGA 3G0OA 1DAFA 3T61A 3CJTA 4TYMA 1XCBA 5HKOA 5KNCA 3RYFA 1IG3A 2LCFA 4C4ZA 2H48A 2QE6A 3K9HA 2EW1A 2Z8XA 1SHKA 2BP7A 2HDDA 2HZ7A 3G2PA 2O8FB 1SFKA 2CLIB 4R1PA 2E2JJ 3Q7SA 4MUHA 2VJMB 4DWOA 4JFAA 1N6NA 2JGJA 1OISA 4OYRA 1MO4A 1O4VA 4Y67A 1G8GA 3PDIA 2C78A 2WJGA 4DQUA 1NQWA 4ACBA 4XQFA 3T34A 4NNJA 4D9GA 2XDVA 2QVYX 4Y9TA 1T98A 2DPHA 1AMNA 1NI4A 4NMWA 1QE5A 1TNTA 4E5VA 5CJ2A 1GKUB 2R7VA 4GYGA 1NUUA 4FCTA 4LQ4A 2IYSA 4MVJM 3WLJA 1NXSA 2KLHA 4GMXA 3AI1A 2JBWA 1KHHA 1P1HA 2EW8A 5CVJA 4MDHA 1T2DA 2OWDA 3HXQA 2DR3A 5C7OO 1HSZA 4FJ1A 2VN8A 4ITRC 3RU3A 3STUA 4KGZA 1Z9CA 3BGWA 1QGPA 4GCVA 3TL6A 2C04A 1U2EA 1NF3A 2X8LA 1AKHA 3BHIA 4QPJC 1DJLA 1RFGE 1Z7LA 3UV3A 3K35A 4E3ZA 5FI3A 5FR2A 4AU7A 2QYSA 4GQBA 5AVSA 5C37A 5JROA 3OEWA 4B6QA 1O0CA 3H4TA 5KHLB 1FDOA 1TYBE 3ECCA 4BDYA 2FQ3A 1TO6A 521PA 1PFYA 2GLOA 3N53A 2O6LA 3F0CA 3JRDA 3DZJA 2PN1A 3UUEA 2PGJA 1CUJA 1BXGA 1NBWB 4LGMA 3FHJA 3VKGA 4E7KA 1NTRA 1YG2A 3WTBA 2NADA 2XYHA 3QVXA 5AQ1A 2L7ZA 1VKZA 4JN6B 1G2QA 2F6RA 3NKLA 1P1BA 3L2WA 4WMLA 2HSDA 1M2OA 3RIYA 1ZD5A 1YI2I 1T6BY 3NIBA 1W93A 1K4SA 4TL8A 3MD9A 3GEGA 2SHKA 2CNKA 1KNXA 2NV2B 1ENHA 2P2YA 1YYVA 4OH7A 1TJYA 1BHJA 1JJ8C 1UBGA 2KBEA 3P0HA 1G7TA 5IU6A 2Q5EA 4AM3A 3R6WA 3F8CA 1U28C 4B3DA 1ZN8A 2WILA 2ILVA 1FNDA 5IHPA 1QRTA 2GI4A 4ZAWA 3KUCA 2P4SA 2VDKB 1RADA 3HRTA 1O6CA 2LF7A 5BOSA 5EYPB 3ULKA 2JFZA 4AUMA 3W5VA 1MENA 5IYCJ 3A2KA 2FI1A 1GTVA 2N42A 4WFIA 1TIPA 4JSRA 2HJGA 2IEGA 5FPHA 5ILVA 5CPFA 2ZYDA 5EZYB 4JCCA 2C9MA 1H85A 4NEGA 4BKMA 3WU2C 2M87A 4TV9A 3F21A 2H5LA 1FSZA 3M8FA 4GT1A 1L4FA 4W5WA 2O59A 1PK9A 2J5QA 2PPLA 4CV3A 3TMOA 4LK0F 4YAGA 1JJ7A 3RODA 3GNLA 3EA4A 1IJWC 5LMZA 1P2TA 1N3YA 3QK7A 1N2HA 4PSCA 2HF2A 3CRNA 2Q2EB 3DF9A 2G0TA 2X15A 2LK2A 2HGSA 4YN3A 4U0VA 4YQZA 1OT3A 4GC9A 1W2GA 1D1QA 4MV4A 3D8BA 4Q93A 5GONF 3M89A 3LC1O 2FE1A 2ZYTX 4QYTA 2VJMA 1RC9A 4D56A 4I8XA 3ANLA 3PC6A 3I61A 3DLHA 4L7VA 1UQUA 1ULUA 2ACJA 2J3LA 1SEUA 3S15J 4FISA 1OH8A 2Z3YA 3S1AA 1SHZA 4CHTA 1RBMA 3GELA 1OYOA 1RYMA 3LUKA 3IIJA 1K06A 4YJ3F 4LCEA 1ZH0A 2IYXA 5IK2A 3TOBA 2WZDA 1X1EA 1XHFA 2H1RA 2QKLB 1NT2A 3SYTA 3SF0A 1RE1A 5JDIA 2HRBA 1DC6A 4IZ6A 5MN4A 1Z4PX 1KETA 5GPAA 3JSOA 2GIZA 3KOZA 2OFXA 2XPWA 1ZOOA 1EIZA 3M5CA 1IJEA 1QIEA 4Q18A 4WN9B 2HGZA 2FEWB 3PU6A 3LBHA 3TJZA 3WWDA 1BTOA 2TS1A 4PR0A 4LRTB 3HI4A 3DAOA 3ZVNA 1REQB 4MVYA 1EHYA 5IAKA 5AW3A 1L5NA 5KU1A 2QJOA 4ZZIA 4DBLE 4V1CB 2VUSA 5JANA 3CVJA 1XXHA 3VFDA 5A03A 4K2EA 5LEJA 1SVUA 3GRAA 3LLUA 2PMUA 2RBKA 2VHUA 1ZRCA 4JQOA 2B4KA 1UBSB 2AZMA 5TQ0B 1UBMS 4BB5A 3EPZA 2GCOB 3O8BA 2DMRA 3Q1LA 1S8NA 2BGMA 1PR3A 3UY4A 1BEEA 4K86A 4PG5A 2WU0A 2V6EA 5JFGA 2ZJ2A 1SKAA 2ONYA 4BDZA 3NGXA 5AJYA 3G3ZA 2O6HA 1EVIA 2P40A 2QL6A 3CRVA 1T2EA 4KVAA 3X2SA 5B64A 2DOKA 3T7AA 1NYLA 1J2UA 2ZQZA 3Q6MA 3DMDA 4I09A 4TKLA 3PQDA 1ZIXA 3AJDA 4X8OA 2NSHA 5KTTA 5AXDA 1DXYA 821PA 4E09A 3LO5A 1O3QA 5B2ZA 2C7BA 3C8HA 3KLOA 4WJLA 3CJQB 1SWVA 2BF7A 1PNOA 1H3NA 4O4JF 2IPAB 2PMKA 3WHLA 1KI8A 3GFGA 5FKNA 3JPWA 1WCYA 2JUGA 1AE1A 1OLXA 1E5XA 2AMLA 4HNRA 2CKDA 5AICA 5JWHA 4BEWA 1YR8A 3NETA 1G6KA 1MNDA 3W2WA 2ZSHB 1G8SA 3QENA 4EG4A 1NXTA 1A27A 3D6UA 1FNNA 1YDWA 2TYSB 2I22A 4ND1A 3ZWXA 2YOHA 3R5KA 3TE6A 3DWFA 1EUDB 2DERA 4L4SA 1WY7A 1I2CA 4A3GJ 1JT9A 2JA5J 1JALA 5TGTA 3ELKA 4RKQA 3OHPA 5EIHA 1G41A 4WCGA 4FU0A 1C8KA 3RCBA 3M8JA 5HIJA 1J8MF 1WOMA 3UK6A 4BJTA 2XLCA 5IEBA 5B3JA 4P0QB 2ZIZA 3PPXA 1QQ7A 2L7MP 2C57A 1X9HA 5C4JJ 5C8XA 3W5UA 3I92A 3V48A 1OFUX 4UAGA 3ZWVA 1JG7A 2O3TA 3DTVD 3PQ6A 2FX5A 4XL9A 1WPGA 2ZR0A 4Y2VA 1JEQB 5AVKA 3PRHA 5MFPA 1LFBA 4UEQA 2ZYRA 1GZ7A 4BMVA 4LE2A 4Y30A 2YW2A 2QSFX 1S3FA 4D1YA 2GKGA 3LGXA 2VP9A 2H18A 4XN0A 1BG6A 1VLMA 2HUNA 1ODIA 4MO9A 1NP7A 3BFKA 3HVRA 4K9OA 2WKRA 3JCZA 5DBGA 5JCXA 4XPZA 1I94B 4H6VA 4XQEA 4J3JA 3WK7A 1KL7A 4I50B 4FBMA 1YD7A 4HFMA 1GV5A 3KKZA 3HJHA 4XOUA 3DEYX 3ISJA 4TTQA 1OB5A 2Q46A 4WEOA 2NW6A 3QE9Y 2IA5A 3KTOA 3ZQKA 4UUVA 4UBLA 4C03A 4RL4A 4FYVA 4FQ7A 4BC1A 4ZDPA 1QK5A 1KAQA 3RQIA 1SXQA 4EF5A 3W78A 1NLFA 2V9CA 4QFCA 4MLPA 3CCVI 2I4IA 4ZI7B 2J5XA 2PGXA 4L2IB 1FP2A 2RHCA 1OC2A 1UG0A 2G9WA 4V1CA 3MHTA 2QTNA 1U6IA 2HRQA 3O3NB 4J1SA 4GZMA 2F4VB 5JAQA 2HTJA 4B8XA 3GBPA 3BJEA 2Y2VA 3SDZA 2OCKA 3LZCA 4GQIA 2FUG6 1JEOA 2GCOA 2HXOA 4M3BA 4MI9A 3M1EA 1LKXA 4HRVA 4LG1A 4H3SA 4TV8F 3I2HA 2HYFA 1GRCA 5CYOA