2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Cerebral protein 1
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
4RTRA 1SUSA 3DULA 3P97A 5CUQA 3FRIA 4PCAA 1G8AA 2I7CA 4C04A 2P35A 3A4TA 3A26A 4PYJA 2IDJA 5JUWA 1EAMA 1NW8A 2A14A 2P1DA 2XYVA 3G2QA 2OPBA 3RODA 2UYQA 3TLJA 1YZHA 1Y8CA 3R3HA 4CWAA 1D2GA 2IPXA 4YUVA 1FJXA 2Z6QA 2C7OA 1Q0SA 5CVJA 2GA9A 5T67A 1X1CA 3LPMA 1QAOA 4EVIA 3UBTA 5CM2Z 3CCFA 2C7RA 4E2XA 1G38A 2YXDA 1IM8A 1R8XA 3HCFA 4X1OA 1BKYA 4FGZA 5DM2A 5DRTA 5C0OE 2G71A 1VIDA 3DR5A 3P71T 3P9KA 4QQKA 4EKIA 4YUYA 5K09A 2Z6AA 5KVAA 5F2KA 4WVLA 3P8ZA 3TFWA 2P3QA 1RI2A 4EK9A 1N7IA 3OZRA 5HOQA 3GRRA 1SQFA 1XCJA 3LL7A 1T43A 3HM2A 3GWZA 4QTUB 3FZGA 3NVMB 1F3LA 1V39A 2ZZMA 4AZTA 5LQJA 5DXAA 3MHTA 1KYZA 3PX2A 1O9HA 2PWYA 4C4AA 1R8YA 3TM4A 3HA5A 2EFJA 1RJEA 3KR1A 5BW5A 3REOA 2ZTHA 3SSNA 3PB3A 5DT2A 3NDJA 3BKXA 3SVZA 3CGGA 1JQ3A 4RSRA 4CKBA 3FPHA 4RYLA 4GOND 2ZIFA 3NTVA 4FS8A 3ELYA 2QM3A 5E9WA 3KKZA 3A7EA 2AOUB 5GM1A 4BLWA 1R18A 1NW7A 2DULA 3KHKA 3OU6A 4ER0A 3HVKA 1M6EX 4PCLA 3SXJA 3I58A 1NBHA 3BGIA 3LCVB 5EPEA 2YVLA 4YUWA 1YFLA 5DTQA 1M6YA 5K0CA 5DX0A 2AOXA 2EX4A 2PXXA 3PFHA 4ER5A 4QQNA 4E70A 2AOWA 1ZHFA 2BR4A 5K0NA 3KPJA 1NV9A 2O05A 2UZ4A 4GF5A 2G8NA 5GIPE 3EVZA 3LCUA 2PT9A 4HTFA 3R0QA 3DMFA 4R6WA 1RJGA 4JXJA 3PLAE 5GWXA 4B17A 1KHHA 3P9CA 4RTMA 4GOOD 2ZIGA 4FT2A 2YXLA 4RVFA 5E1BA 4KDCA 4R8RA 5DWQA 1JG1A 3JWJA 4DMGA 2JHAA 5E9JA 5K0LA 3NVKI 3D2LA 3S68A 4PYOA 4RVDA 1KPGA 4A6DA 4RTPA 1YZ3A 2AR0A 2VDVE 2AVDA 3C3PA 3G5LA 3CBGA 3HCAA 2ZWAA 3HVJA 3M6UA 5FWDA 4C08A 5IKMA 1JG2A 1ZQ9A 4IV8A 2PJDA 4PINA 3T7RA 2B9EA 2C7PA 1FP1D 1NV8A 2ZULA 5ICFA 3AXSA 1N2XA 3DMHA 2JHPA 4R8SA 3I53A 2FPOA 2EJTA 2G72A 3KQTA 5GOZA 2AOTA 2HNKA 2NP7A 1G60A 2IGTA 3EVBA 5DSXA 4WXHA 5BXYA 3UWPA 1KYWA 1ORIA 2ZBRA 3HVIA 3VC2A 4CTJA 1WXWA 3DMGA 4RTOA 2GB4A 3DOUA 4LWOA 5E1DA 5HIKA 1JG4A 2BM8A 3MQ2A 3ANXA 1L1EA 2YTZA 1D2HA 4QDJA 1NBIA 5ICCA 3NWBA 3I64A 1YFJA 2FCAA 2IH4A 5DM1A 3LDGA 1YB2A 3GJYA 2ZW9A 3ER8A 1RI4A 3NDIA 3L8DA 5DLYA 4V0QA 3JWGA 3T7TA 4U7PB 4GOLD 3SSOA 1KIAA 2OZVA 2PX4A 3OCJA 3SR4A 3MAGA 2VP3A 4HH4A 5H02A 1PRYA 3V8VA 5MHTA 1HNNA 2Q41A 3DXZA 4OA5A 4CKCA 3HTXA 3G8BA 4YV0A 3HCEA 3IYLW 2V7EA 2B25A 1XVAA 2Y1WA 4O29A 4PIMA 1XDSA 2CL5A 2OO3A 3BGDA 3LHDA 5D1HA 8MHTA 4HC4A 2XYQA 2WA1A 3DXXA 1RJFA 3MCTA 3GRYA 3M6VA 3GU3A 4QPNA 5D1NA 2O0LA 3LDFA 5T64A 4RTJA 1YF3A 5FA5A 2FRXA 2ZZNA 4EKGA 4K6MA 4PNEA 1AF7A 3TQSA 2P7IA 3HNRA 1EQAA 1L3CA 5DX8A 2C7QA 4FR0A 3EVGA 2ZBPA 4AZSA 4IKPA 1JQDA 4HGZA 5DX1A 3VYWA 5LSAA 2BZGA 4POOA 2ZVJA 3CJRA 3OZSA 5HFJA 3TOSA 3O31A 1G55A 1VBFA 3DUWA 2ZZKA 3G2OA 3EMDA 1O9GA 4OQDA 1MJFA 4P7JA 3IEIA 2QRVA 3HCDA 3B3JA 3B7PA 4M37A 4ATNA 3LX6A 1VPTA 4GUAA 4ZTBA 4R05A 3THRA 3PX3A 2HR1A 1XXLA 3G7UA 3ID6C 4YUXA 2AS0A 1FPQA 2NXCA 5EC8A 5IH3A 3E8SA 3FUVA 2ERCA 4H0NA 3OU2A 3M4XA 5B1SA 1OR8A 2BR3A 3EEYA 4KIFA 5E8JA 1VQ1A 4OA8A 3TMAA 4C05A 2BR5A 1P91A 4X41A 3BGVA 5DSTA 1XTPA 4P7KA 1HMYA 2R3SA 3NJRA 3LBFA 1U2ZA 2PLWA 3CJQA 2GPYA 3ELUA 2NNWB 3R6TA 3UZUA 5EKUA 3M70A 3EVDA 1X19A 4YMHA 1L3IA 1MHTA 1BC5A 1ZGJA 3GRZA 4GC5A 2JHCA 2I62A 3FPJA 1SG9A 3KQOA 3PT9A 2H00A 2YQZA 5EIFA 3KQSA 1NW5A 3Q7EA 3T7SA 5FA8A 2ZCJA 5K8VA 2UYCA 2PBFA 5EMKA 3AXTA 2IH5A 1NW6A 4M36A 2PSSA 3B5IA 5CVEA 4BP3A 3VC1A 3BKWA 4E30A 2CKDA 4ER6A 4F84A 2ZLBA 1G8SA 1NE2A 1TW2A 2IBTA 1X1DA 5BP7A 3NWEA 2ZIEA 1VP3A 2AOTB 4PYLA 4Y30A 3TRKA 3LKZA 4MTLA 2ESRA 5LQKA 3P2EA 1WXXA 4X60A 3UA3A 4OX9Y 3P9IA 2NYUA 2UYOA 1VE3A 4KDRA 4ER7A 3VSEA 4GEKA 3UJCA 3C6KA 2ADMA 2KW5A 1M0EA 1WZNA 3G8AA 3EVFA 2I9KA 3DLIA 3FUXA 5U4XA 2ZFUA 1VL5A 4LECA 3PTAA 2FHPA 3BT7A 4PYKA 1JSZA 3B3GA 2K4MA 2YXEA 5LQUA 4AUKA 3GO4A 2PY6A 4BLUA 1BHJA 3HEMA 4Z2YA 4P7GA 5ICGA 1Q0TA 1AV6A 2OYRA 3OPNA 2HV9A 1QANA 4NECA 3KQWA 2V74B 4L7VA 3UJAA 4QDKA 4UOEA 4LWPA 3ERCA 3GXOA 4HG2A 5E2AA 4PONA 4MHTA 1L9KA 3FUWA 2XBMA 3KQQA 2N47A 3FTDA 1I9GA 2I6GA 1R6AA 1ZG3A 3KQYA 4DKJA 3HCCA 1RI5A 3EGIA 3KQVA 4V0RA 1DUSA 3ELDA 2B78A 1KR5A 1ZKDA 3I5UA 5E2BA 4E32A 4A6EA 3QOXA 3BWMA 5FCDA 1P1CA 2AOVA 1Z3CA 2EG5A 3KPYA 3LECA 5EQJB 5K01A 5LQNA 4FSXA 1RI3A 4PWYA 2P3LA 4KRGA 4YUZA 3HP7A 3R24A 3FRHA 2NXJA 4KW7A 2AN3A 1JTFA 3TKAA 3ORHA 3EEOA 3F4KA 1H1DA 1WG8A 10MHA 3G88A 3KR2A 2FK7A 2IDKA 3HA7A 5P8WA 2O06A 4AX8A 5K0JA 5G02A 1XDUA 3C6MA 1WS6A 2EJUA 2XYRA 3AWIA 3GGDA 3GIWA 3KQMA 4KVZA 3UJ6A 4AZVA 2B3TA 1FBNA 3AY0A 2NXEA 2PX5A 5LQCA 2IBSA 3R9XB 7MHTA 5EZSA 3LDUA 4CXMA 4RTKA 5DPMA 3JWIA 5K0EA 1JQEA 5GIOE 3FUTA 4E2YA 2QE6A 2QY6A 2PVCA 1NT2A 3OFKA 2O57A 3CVOA 3FYCA 1XJ5A 4AZWA 2XVMA 4P58A 4F85A 3PVCA 3ELWA 2JJQA 2ZSUA 2WK1A 1KP9A 1X1BA 2YX1A 4Y2HA 3EVAA 3P2KA 3ME5A 3GDHA 3IV6A 4R6XA 3UA4A 1L3BA 3KU1A 4PGGA 3A7DA 4GBED 4XCXA 3V97A 4E2ZA 1IY9A 2P7HA 5HILA 3UJ8A 4IWNA 2AZTA 4FSDA 1JTEA 5EHGA 5CCBA 1G6Q1 1YUBA 5LR6A 4PGHA 3JWHA 2VDWA 5KQRA 1EG2A 5EKXA 2FYTA 3K0BA 3B3FA 2VZ9A 4DA4A 2YR0A 3G2PA 1O54A 5CVVA 2P41A 1ORHA 3HA3A 2F8LA 3GNLA 5EGSA 5FHQA 2Z6UA 3P2IA 4EMSA 3NW9A 2R6ZA 4KWCA 3M6XA 3QV2A 1N7JA 3BUSA 3CKKA 5E1MA 1R74A 3EVEA 1P1BA 4FT4A 3FPFA 5FADA 5E1OA 4M38A 2BM9A 3QOWA 3SMQA 4GC9A 2GAFA 2ZWVA 2OY0A 1UWVA 3GRVA 5CIYA 3AJDA 2BH2A 2P8JA 9MHTA 3ER9A 3A27A 4XUEA 3TKYA 2VDUE 2IFTA 3OFJA 4OBXA 3A25A 3RIEA 4E33A 1SQGA 4MIKA 1SUIA 5GM2A 1B42A 3BXOA 5CVUA 3EPPA 5CVDA 1EJ6A 2JG3A 3FTEA 3EGEA 4F86A 5DTRA 1D2CA 1JR4A 1UFKA 1TPYA 2CMGA 3BWYA 5DTMA 4XUDA 5KS2A 2O07A 1EJ0A 4BP1A 4HGYA 3C0KA 1RI1A 3DH0A 3EGVA 1VLMA 3G2MA 5EIWA 1FP2A 3DP7A 3IHTA 2FK8A 2LD4A 4DQ0A 5K0GA 3EVCA 4QPPA 1AQIA 3E23A 4YV2A 4HRAA 3SM3A 3THSA 3FPGA 2ZBQA 3OE5A 3LKDA 1PJZA 3TM5A 4RWZA 2OB2A 4ER3A 3GCZA 3SGLA 3KR9A 2AN4A 4RTSA 4RV9A 4MWZA 2QYOA 3UJDA 3PS9A 1QAQA 5K05A 3MTEA 4P7FA 3CC8A 2H11A 3O4FA 3T0IA 4G56A 4X63A 3EMBA 2GS9A 2CWWA 5EMJA 1TW3A 2DPMA 5EEGA 2JH9A 3UJ7A 5FULA 5FQNA 4PIPA 3MCZA 4M7RA 5ICEA 2YUIA 1QZZA 3BZBA 2OBFA 1QYRA 2GH1A 4LG1A 5E9QA 4XUCA 4BY9E 3UFBA 3DTNA 5HEKA 4CTKA 3FYDA 2HMYB 3I9FA 5HZMA 4YMGA 2H1RA 3H2BA 4QTTB 2PT6A 3KR0A 1SVUA 4RTQA 5GP1A 3MERA 5E8RA 1BOOA 4QVKA 5K0BA 2G1PA 3K6RA 3WSTA 3O7WA 3B89A 5EVJA 3GRUA 2UYHA 4DM3A 2PX2A 5FQOA 4C06A 2IIPA 4EQZA 5DM0A 5LQRA 1R00A 1JG3A 1SKMA 2IH2A 5F2OA 4RVHA 2JH8A 2WA2A 1DL5A 1I4WA 2XVAA 2PV0A 3LGAA 5T6BA 5EMMA 3E05A 2QRVB 4CKEA 1VP9A 3G5TA 3LSTA 5KYGA 3FPEA 4PYIA 2OKCA 4RTNA 2AOUA 3MB5A 2GLUA 3SX0A 2PXCA 1ZGAA 1NKVA 2HTEA 2P3OA 1WY7A 3KPVA 3KQPA 4OBWA 5DXJA 3MGGA 5EHIA 5HIIA 3X0DA 4OQEA 4RTLA 1AQJA 1NW3A 2PGXA 4RVGA 1QAMA 3OZTA 5EG5A 1INLA 5K0FA 2E5WA 4E31A 1IXKA 3DLCA 4ISCA 4FP9A 4KIGA 5DRYA 1I1NA 3TPZA 2Y1XA 1UIRA 3OE4A 4DF3A 5ERGB 4DZRA 2CMHA 5LQAA 3BWCA 2AN5A 5K03A 2B2CA 3LCCA 4HTFB 3SSMA 2HWKA 5FHRA 3G89A 3KPWA 2PX8A 2ONYA 4YV1A 5EEHA 3UJ9A 5FWAA 3BWBA 3FTCA 3LBYA 3OU7A 4C07A 5FTWA 5KQSA 1KPHA 3FTFA 3HCBA 3Q87B 3KPUA 3P9NA 5FUBA 3NMUF 1RJDA 2PWPA 2P40A 5EZQA 5HIMA 4C03A 1F38A 5C1IA 3UJBA 5CD1A 2G70A 2OXTA 3U81A 1X1AA 3DXYA 3CJTA 4GOMD 4PYQA 4U7TB 1EIZA 4E2WA 5JR3A 2ORED 4X61A 3PFGA 5F2NA 4RX1A 4HSGA 3E7PA 5C9ZA 4DCMA 3M6WA 2OB1A 1KXZA 2VS1A 4IV0A 4PYNA 4BLVA 1DCTA 1JSXA 2NP6A 5EOVA 5EMLA 5M5BA 2AVNA 1XDZA 2PXAA 1KPIA 2IP2A 3HVHA 3M33A 4MQ4A 5DM4A 3RW9A 4DCGA 5BW4A 3TR6A 1XCLA 3MTIA 1P39A 3FUUA 5HIJA 2ONZA 2NXNA 2PKWA 3C3YA 4QVGA 4GQBA 4FZVA 5GINE 5CCXA 4PYMA
chains in the Genus database with same CATH superfamily
3KKPA 2MLGA 1KZGB 2Q5EA 4E6PA 2D0OB 1E6UA 1WL8A 4JEUA 4KMRA 1IRFA 5D86A 1DO8A 3OZXA 2ODTX 4U6SA 2IY7A 2P35A 1RLMA 2QTLA 2H6EA 2XH8A 4GMKA 3OUTA 4NYMQ 2NUPA 4ZOAA 1ZL0A 4NNPA 4ECAA 5EJIA 3JQPA 2VYVD 4TLBA 1P73A 4P9NA 2MDTA 2PO7A 2UYQA 2X3UA 5LP6B 1LB1B 4G5YA 2Y1DA 5FGMA 3EG9B 2O0MA 5KX5F 1KFCB 1BCRA 4S2UA 1KE1A 4BPBA 4XFJA 3I6QA 2GA9A 2G07A 3UG7A 3BXEA 4H4DA 4MS3A 4MFDA 4YMLA 4HQKA 2FBHA 2A58A 1FLDA 3RANA 3LCMA 5GAEJ 4P3NA 1UXOA 1E6KA 3FPSA 4CF3A 3FPAA 5AI8A 4E46A 3JRFA 2BMDA 1UEXC 1G0NA 4F5WA 3Q0UA 2EK5A 1TADA 5DTDA 1QYDA 3EDRA 1U11A 2AQFA 1JXMA 2BEVB 3IILA 4I50A 1GHCA 4O0LA 1ZAYA 1CQIB 3JSPA 4A1OA 5LN1A 4W1SA 3QOYA 1BNCA 4MLZA 3FJOA 3T0YA 3I83A 4NZYA 4GYIA 2JLVA 3IE0A 2BI7A 2Q29A 4RCVA 2PS9A 1USIA 3U4QA 1RXCA 1LD3A 1MO3A 3PX2A 3AYXB 4HXEB 1SKAA 4JT9A 5KNLA 5FWXA 4P5DA 2XB2A 5AUNB 3HWX1 5F27A 3UGKA 4EQQA 3G13A 1KBQA 3JVEA 4ZRNA 4IOAF 1W2GA 1LVKA 3EYYA 4TL9A 1UK8A 4JLSA 5CT6A 1P4XA 4LF9B 1PL6A 4DREA 1I7NA 5DI3A 3UO8B 2ZIFA 4K9SA 4UZEA 2IXEA 1UC8A 4BNUA 4E5DA 3H16A 3WLJA 2YNMD 2C8JA 3OCXA 4FHCA 2W85A 2CVHA 1JIXA 4PYRA 5H70A 2BHSA 3CCQI 2AH5A 3DDWA 1V35A 1FXWA 4KIUA 1EM8A 2R7UA 4OK5A 4UV8A 4Y2PA 5HF8A 3ZVRA 2Y92A 3LUCA 2LDUA 4IOCF 2O50A 2MHCA 5ARDA 1GZ7A 1M6YA 2PUGA 3U1BA 2UV1A 2AOXA 1E9CA 4TLLB 3JTHA 3DXJF 4ER5A 3T9FA 4E70A 4LFAB 2P0EA 3KZCA 4FD3A 2I6SA 2VZ0A 2J0UA 5HJ5A 3BMOA 1GLVA 2IF2A 3OE7A 1G3MA 3G5UA 3DMFA 4I1PA 3SG0A 1SM4A 3HLTA 1TO1E 2G17A 3IMKA 1ZJZA 3L49A 4Y7CA 4C0AC 1GA6A 2HIMA 5E1BA 4IG9A 4DMGA 2QR2A 1Q91A 4LMBA 1Y3FE 3IXLA 3S68A 4PYOA 3ASOH 2K2WA 4RVDA 2YW2A 4KQGA 4ZJYA 2FQ3A 1EGAA 1GV5A 3G17A 4IFBA 1NUTA 3F7TA 4CZCA 3H2YA 1I6HJ 2HX1A 1Z75A 1DTWA 2NAPA 1H4VB 2YDYA 1X7DA 4BNJA 2ACEA 2E2WA 3LBNA 4FOTA 1PYVA 1ZQ9A 2X9QA 1DDIA 2DUUA 3C8ZA 2ZIXA 3L4EA 3N0VA 1P4AA 4L5IA 4JBXA 4YBZA 4GX2A 1SFOJ 1RKXA 4RK1A 3V1MA 4F3CA 3DMHA 2CXNA 2QX8A 5GOZA 4ZCRA 2C95A 2G80A 1IJEA 3IGFA 2CD7A 1PNOA 2LCFA 2OZ6A 4YP0A 5HRUA 1OV4A 1EFHA 2IT1A 2W0SA 3I9V2 1NU8A 4DUYB 1T2KA 3DQPA 2J3KA 1KJNA 2XRFA 3R3YA 4LI0A 2HFJA 3PQ2A 1G7SA 4AVYA 3W3AA 3SBDA 4NBSA 5TDHA 5CA0B 3RK0A 4ZVNA 4HGRA 2QMQA 4IQJA 2Q3EA 3TO7A 1II0A 5ICCA 1RAEA 3IMCA 4I4IA 4JI5B 1ENYA 4D98A 2HFHA 3W6JB 2CE2X 4GH5A 3ADPA 3STHA 5BMVB 3A1TA 3IELA 3PR2B 4RMNA 1TWFJ 1RIFA 4CKXA 4F6RB 4J7UA 1Y1RA 3I01M 4YA6A 1JV2B 2B3DA 2IGNA 5FKNA 4HH4A 4ND8B 2CXQA 5DSZA 1N0IA 1JHHA 1VF9A 2BHRA 1MW9X 3E82A 4R71A 3MJHA 4EI8A 4K9LA 1UDWA 3CNEA 2BBSA 3PFIA 1YDGA 2Y1WA 4JH0A 3NONA 1FMFA 5HQJA 4RZ2A 4HOBA 2WAMA 1B0PA 3AFIA 2EJRA 2N1MA 4HC4A 5IUKC 2I2AA 3CUQC 2XYQA 4HO1X 5A6SA 3KSRA 4DA7A 2RAEA 2A9VA 5T4HA 4WF2A 3QU3A 2H0AA 3F0TA 3IBYA 1RIIA 1QFYA 3O4VA 3WWCA 3QE2A 5AOAA 4AMVA 5LHIA 1DX6A 1U7UA 3RFVA 1WKCA 1EP9A 3ZQGA 2HB6A 2JIBA 3KB6A 4QOJA 5CH3A 5GONB 3WDMA 5B4TA 2GJ4A 2GCOB 2P5YA 3KOUA 3I73A 3JYPA 3W6NA 2ZJYA 4H1TA 2NU9B 2IEKA 3CV3A 4X3OA 5FOQA 1K4SA 3AHFA 2JKVA 2VQLA 3GW2A 4X90A 4OGGA 5BYAA 3WXBA 2I34A 1COWA 1Q7RA 2B5OA 3A10A 2D5VA 1LS6A 1R6XA 4N5MA 4OL9A 4B71A 1HRDA 1YIOA 3L2QA 1Y3DE 1KDOA 2VPXA 3E3LA 3EZXA 4ND7A 5A05A 3EMKA 1DTEA 3VZSA 1RQLA 2DPYA 1HE8B 4GUAA 2A5YB 4R05A 3QUQA 3W5VA 4EB8A 4ZC3A 2O2HA 4YV7A 1XXLA 3G7UA 1YL7A 2LVBA 5HUJA 3H8WA 2HLHA 5CFOA 3P2OA 3FWYA 3GFVA 2Z2KA 4KEAA 1JDNA 2WVAA 1MW7A 3SZGA 4RKRA 4PC2A 3GX4X 2PUJA 3EZNA 4NAHA 1AVTA 4QNNA 3UUGA 2XRLA 4Z6YA 1LK5A 2XQFA 3ICPA 1C4KA 4PVDA 1GPLA 3UAYA 3ZJYA 3D7NA 4ZIRB 2HU7A 4W8GA 3AR7A 2Y05A 3B9QA 1AU7A 1CP3A 1TQDA 3ZJ4A 5JD4A 3WYDA 1DEKA 3MOIA 5ED4A 1WI9A 1D8AA 3ANYB 3MWEB 2G04A 3JALB 4GI1A 5IAGA 3AT1A 4DYDA 1KRXA 4R0NA 3HIFA 2OBMA 3I3LA 3AU9A 4HF0A 3JS5A 2WR8A 2ZC2A 2UKDA 2WFAA 3DHYA 4WGGA 1PFKA 3KQOA 2VJKA 1SUEA 2OAP1 3GDOA 2YQZA 1JW9B 1JE8A 5EIFA 4LRSB 5HJ2A 1D4FA 1QIKA 1Q0LA 2PBFA 3RJMA 2QVGA 4HATA 4KXMA 4LHSA 2GNOA 1WCIA 3E9RA 4RB1A 3IV9A 5CVEA 5ALUA 3TDZC 3CZPA 4F12A 3C18A 3DE0X 4NH0A 4X92A 1D6MA 1SKQA 2P9CA 4C3OB 4EF4A 5KINB 3AVTA 1CEEA 1BMTA 5CT5A 3LKZA 4LXHA 2C61A 3ZHBA 4ZCIA 1IL0A 1M54A 1OZFA 4RVOA 2PEZA 2JKYA 1MMDA 3F3XA 1AO3A 3K5HA 5SYNA 3TE6A 1LV7A 3UWSA 4EGAA 1OH5A 2VVTA 4G4IA 2QN3A 3UJCA 3E3VA 4KXQA 2Q2EB 1ODCA 2NW6A 5JJ5A 1WH5A 4URUR 3A6EA 5HCUA 3O91A 4DXDA 4RK6A 5FO0A 3KWFA 5JSFA 1Z15A 3R4CA 5EJCA 3BYZA 3FB4A 1K0UA 1YQDA 2X9NA 1JBQA 3JQFA 2HVRA 4CMIB 2BIFA 2HPIA 4NRDA 1G8XA 1W36C 5KHOC 4S1PA 5YASA 5FLXA 1U5BB 2DQZA 2EHDA 3M0EA 5EMNA 5GQSA 4A3GJ 3V3KA 2ISYA 2CXHA 3ANMA 4BYGA 3INTA 3LWBA 5ECYA 3IR6A 4EUEA 1SAXA 4D9GA 4ZV4A 5CGQB 2TMYA 4JQYA 2TRTA 4D9BA 2XGXA 2GLOA 5IWAB 1MSFC 2HA5A 1FFXB 4PONA 3A3NA 4RHUA 1Q84A 3A9VA 4X1YB 4AUNA 3E9DA 3LPDA 1HL7A 4R2MA 3ZQQA 1P7CA 2PMKA 5D4SA 1R6AA 3LXMA 4UASA 3RS5A 5HKOA 3AOGA 3I5UA 4K0RA 1P9NA 2C42A 4R8HA 1P1CA 3IFSA 1YCFA 4YBRA 3HKZN 2F55A 1Z8DA 3CUTA 3VDNB 5IKXA 2ZXIA 4HPQA 4HV6A 2P3LA 5A2QK 4HAIA 4HWRA 4KSCA 1YI2I 4KGZA 3R8XA 3TZCA 5KSYA 1PZEA 1DV2A 1UBLS 3GLXA 1WXFA 2XD9A 3BTJA 4ASUD 2QORA 2HJWA 1Z47A 2FK7A 3ILYA 3BPSA 3Q3IA 2PGOA 4ZGGA 3RVJA 2BLNA 1HDDC 2Q5CA 3C6MA 4F4CA 4H6PA 1NVBA 3V4PB 2JBAA 5IASA 3WNZA 3F8CA 3EXIB 4BFXA 1DRUA 4FZ5A 2CEAA 6ABPA 2IAIA 1KEKA 1LDMA 5AW6A 1PUFA 1QPIA 1UT5A 2EWNA 3AILA 3ONEA 4GT1A 1IIRA 3ZWVA 3U44B 4KV9A 3GTOJ 4DTIA 5KSWB 4YAGA 4G0ZA 4EWLA 4RIEA 2QD3A 1W1WE 2J33A 3C41J 3L7AA 5B2EA 4JJIA 1G9XA 4J1TC 2JLXA 1QCCA 1Z33A 2JCYA 5LEKA 1XLUA 4G6QA 1T6XA 3ZP5A 1YR2A 2X3YA 4KO8A 4JLVA 2WQZA 1BN6A 4N7RA 4WJZA 3HU1A 2M6LA 2OPHA 1J1IA 1SVNA 4ETSA 2BELA 3EZ9A 4ZOLA 3BL8A 1ISJA 4YNBA 4PJMA 5D87A 1XNQB 2BGUA 2B82A 1PV4A 2GOMA 2CDAA 3B1WA 4WH0A 4E4HA 2RGAA 2W98A 5I9NA 4G01B 4XRGA 4BV2A 2R0QC 3OECA 5DP2A 1MJ5A 4JX8A 1UEIA 1B1CA 1FPMA 5IU6A 2KLHA 4I55A 2G6BA 3I5MA 1KMNA 1SC3A 3GNLA 3QEKA 2DHEA 4TTTS 4EMSA 4MQEB 4TTSA 2R6ZA 4ZCSA 1NJ1A 2WWTA 3R5JA 4FUTA 3WJ2A 4KICA 1A8HA 1VLVA 1YJ9I 3HKDA 2V58A 3OOEA 4TRMA 1LF5A 4IHVA 2YZNA 2QTTA 3MVPA 2ZETA 4UM8B 4CZ2A 1ZNWA 4BJ1A 1M5UA 1ZIDA 1OLXB 1D07A 4BNGA 3QX3A 2W6JA 5FKLA 2LD5A 1GA4A 1HDCA 1VKNA 4XPIB 4HZGA 2Z3ZA 3RPEA 4QC2A 1FLVA 1E4EA 3OIUA 5AR1A 4LSZA 4BPRA 1K86A 2ZBGA 3DFFA 3ER9A 1A69A 4KH0A 4MEBA 3V00A 4L22A 5IN5A 3TI9A 3UK7A 4P0PB 4KDPA 5L3SA 4TV8A 2CHFA 4RD1A 4TLAA 3TGLA 1SIBE 1UFKA 4TYQA 5BV2P 4G1UC 4JELA 3WL6A 2CG4A 2WG0A 3K1TA 4LCBA 3FMVA 3LYUA 2XUDA 4RAOA 4YJFB 5FNZA 3D5SC 2FK8A 1ACJA 2HBQA 1AQIA 4QD3A 1SCQA 4JCCA 1E61A 3FNEA 3QBJA 4BJ3A 1UZAA 3CUVA 2NZXA 2IITA 2LUOA 1ISPA 2DVMA 5JASA 3CPSA 1RR6A 3OFVA 2VSXA 3K5IA 1ZCBA 3D8UA 1OCZH 2IYVA 2YU3A 2X9GA 1QLHA 3DVAA 3FMPB 4KVFA 4PLGA 4UHDA 4YMIA 4BNIA 5F0CA 3IVRA 2CJYA 3Q3GE 2FUCA 1UL1X 3IQIX 3QXXA 3PYXA 5ILUA 2H1LA 1EVKA 1H8HA 5B5EC 1ZESA 1PI3A 1U6IA 2Z95A 4JB3A 1TTPB 2XB0X 3KAJA 4LJ6A 3WIUA 2DPMA 1ZREA 2PL9A 4GFDA 3UJ7A 2GZ3A 1S8FA 5FQNA 1OTHA 2UXBB 4EJSC 1DZIA 1OYIA 1XCOA 4K05A 1GG5A 3I2GA 1KU9A 3C70A 2H48A 4GBJA 1G6NA 3G1LA 1SGWA 4QX6A 1E32A 3I9FA 3EDQA 4CEJA 2O0JA 3EFEA 4FFSA 4XQFA 2WM3A 4OLFA 2IC5A 4P3XA 5CK4A 2XF6A 1GTL1 1RU3A 2JIMA 2P4EA 2Z04A 3BRSA 4FHFA 5AONA 4MROA 1DBVO 3KS9A 3WRYA 1ENZA 1P17A 2A4MA 4D9IA 2UXNA 2W5UA 1L2TA 1DAHA 3WU1B 2VJBA 2KRFA 1GVDA 2D1VA 5GTIC 1Y7IA 1Z0AA 1XDWA 2A5DA 3CY6A 3Q1KA 5LQDA 5ULLA 5L3VA 2CZGA 4UJ3A 3REGA 1V6AA 1ZNZA 3BS4A 2O2IA 4EVQA 2P62A 2I3AA 1QPGA 2Z56A 3AZQA 5EE0A 3BWDD 3ZWKA 1QP0A 3WGMA 2DA3A 1I13A 5JCJA 2GHIA 1TE2A 3I32A 3U61B 3ZVKA 3BH6A 3C1OA 5G3YA 3I9NA 3I3SR 3KDAA 4MVJA 2H1KA 3AR9A 1JIVA 1L7RA 5EWJB 3PKZA 4U3JA 4Q05A 3QE0A 4UEJA 2ENUA 4XVUA 2POQX 1KU7A 1V9CA 5C8YA 3VPDA 4BXOB 4KO1S 3UV7A 1X38A 2ES4A 4TV9F 5AI6A 2FVYA 1ZUNB 3HQ4O 3PGKA 4OQEA 1I8TA 4V02A 5D00A 5JAIA 4L18B 3OZTA 4WK8F 2XAHA 2UVDA 1MJNA 4ZDIA 4MR7A 3CTAA 1A35A 3RT1A 1YJBA 1N5MA 2EKDA 3MFQA 2CQKA 3K4CA 2Z99A 3LL4A 3MINB 3TZEA 5JALA 4YLEA 2LIVA 4PLCA 2Y93A 5DLQC 2QX4A 2VN8A 3U17A 5BY2A 2NMVA 4NEHB 1NXVA 4Z6KA 2XWPA 1ORTA 4R2LA 4PGFA 1OAKA 2FW9A 2P4HX 4M1OA 1AB6A 1QQTA 1YGYA 3GPBA 4B3RB 2QU7A 5EHQA 3VO1A 1ARZA 3LO8A 3OU7A 4O2RA 1GRVA 5IYDJ 2WMNB 1Z4JA 5CHYA 1GYPA 3FTFA 4A8JC 3R5XA 1XMSA 4A3FJ 1O96B 3DAGA 5EZQA 1Z7UA 1RKWA 2RHBA 4L28A 2LY9A 1Y89A 1GEEA 4JJAA 5K0NA 1KJIA 2G4LA 4C2BA 5ADVA 2DDBA 2R4GA 2Q50A 1B59A 3L6EA 4XQGA 3R1IA 3C7DB 3M3YJ 5FTKA 3ZJVA 1GGVA 1MIJA 1DWQA 5DYYA 1YKSA 1L5FA 3GVPA 4U7PB 3IAFA 3O8HA 5K5OA 1JSXA 8ATCA 1TWAJ 3HGMA 1RIOH 2RMKA 3UK1A 1G5QA 4EYQA 1T36B 1XDZA 4PAGA 1KPIA 4Y2SA 4ZDWA 4O8ZA 3EB9A 3LC0A 4YX9A 3AR4A 5JS6A 6ADHA 1AKHB 3FH0A 3IBGA 4NBKA 4Q5IA 3TH5A 4HQFA 4U5QA 1X4OA 3FUUA 3VR2A 5JRJA 2HGCA 2VBYA 1ABFA 4OYHA 2NXNA 3HMKA 1RYDA 1CR4A 2H7YA 2L82A 3ZZ0A 6CHYA 2QLBA 1QPBA 2J1LA 4WIAA 3TKLA 3R40A 3W9SA 2YOGA 3OWOA 3LWFA 4DDMA 4M8SA 1ODLA 3L93A 1PR9A 3L18A 3RVNA 1TK2A 4YRTA 4AT1A 3TLJA 2OPBA 1XZBA 2Z2ZA 4XPZA 4KO4S 4KQMA 1P0FA 1KI1A 2D1TA 3Q9UA 2JAWA 4M8LA 3V6LA 3NNSA 3U7HB 2Z6QA 2MFZA 4B80A 4D9KA 3SX2A 4NCBA 4ZTZB 3FK6A 3H2HA 3N4MA 3EETA 4YCJA 4CL0A 2PV7A 1MD0A 1KZ1A 2FOLA 2GWHA 1R23A 2ZRAA 4QFCA 4IP0A 1W9HA 1UBTS 2VPIA 3RQ4A 3E9MA 1D9ZA 1XQWA 2QUIA 3DFIA 3I59A 3IODA 4MV8A 4LJRA 1ZMRA 1E1KA 1N7IA 3K7EA 5LMCA 2OORC 2OZLB 2QMUA 1U4NA 3I05A 5M5XJ 2Q7XA 2Q5JA 3GZNA 4QOIA 3SDZA 4HGOA 3WGJA 1ZELA 3HJRA 2BJVA 3I59B 1KU3A 2KP6A 1CULC 3PLRA 4ZDJA 4YDQA 5HBGA 3MHTA 2NWQA 3JYNA 3ITKA 3KT3A 3UNGC 3OX2A 3ZGXA 1BE8A 2EFWA 1NUUA 1MVNA 4PSAA 1FBSA 3T8RA 2NUAB 4KH1A 2J9FA 1IATA 5CT8A 3UMVA 2PVSA 1BH6A 3NHSA 4HBZA 3SEFA 2PSFA 4IZ6A 3VX4A 2ATXA 1JZSA 1IXYA 1GSOA 2A30A 5AVRA 2HIGA 3FXKA 1YJXA 1NFFA 2R7KA 3ELYA 2XGCA 1D5YA 4X20A 2CUNA 3QKUA 3MS7A 2D2WA 3G8DA 1H0MA 5DCLA 4IHQA 4NCIA 2CNNA 2JJ7A 2HRQA 4WZAE 2RHOA 1IZ8A 5FD6A 3AR3A 3D1LA 3DO6A 3G68A 1U8TA 1G2PA 1KY3A 2HT6A 2YVLA 5A9SB 1A9PA 2I10A 2PPVA 1U2DA 5CCDA 1J33A 2I3DA 3ZU5A 3O74A 1EUCA 3JQ6A 4OFXA 3DWFA 2QV7A 2O6HA 1Q57A 1SA0A 1TU3A 2FOXA 4EDHA 2GVDC 2XPVA 2ZSIB 1K4TA 3FHNA 3GEHA 4ALJA 4MQFA 3PNOA 4HTFA 5AK4A 4ZVKA 5C18A 2VCYA 3PQCA 4RPKA 4AJ1A 5C52B 4G65A 1JU3A 4QJBA 1Y98A 2Y1LA 2WG2A 3O21A 5A0FA 3U48A 1LY1A 1J5YA 3OSFA 3Q72A 4R0VA 2RVCA 2PJRA 1BX3A 4KDCA 4AO6A 4LITA 3E7WA 4O02B 1JKFA 4MV1A 5ALGA 3AAFA 3IAM1 3O82A 121PA 4V0ME 2HQ5A 4TN1A 3S2YA 2I6QA 5KPDA 2ZAOA 1Z91A 3IP6A 1G2HA 2AR0A 4AKGA 2O8VA 1KZ9A 5BPFA 5IBCA 4QM6A 2X4GA 1QTIA 4ROSA 4KV7A 4M73A 2ZJBA 4F04A 3E8MA 2GCOA 3K9HA 1FP1D 1R1VA 2Q0OA 2D2VA 3IJPA 4IMRA 4OJKA 2CV1A 2C5FA 4L74A 5CEJA 3WTVC 4MRNA 4ASUA 3BG3A 1BX0A 3HOUJ 2IHKA 1E7WA 4XR6A 2PFSA 1TNSA 4GOKA 4IX9A 3ERMA 1XHLA 3TDMA 4HT3B 1EEXB 2Z8XA 2G9UA 3EVBA 4FE3A 3SMVA 4OJYA 5C5EA 2D3WA 3QXHA 4QZVA 2JA7J 1LFDB 1DAFA 1EGVB 2RI6A 3P0IA 4NAUA 3O8LA 3WBFA 3N1UA 2NYVA 4URHA 3NEPX 3ORYA 2BGJA 3CRRA 3TECE 2HW8A 4HL6A 2L2OA 5CPFA 4Z3DA 1PQUA 2L18A 3NH9A 4YDRA 4F4JA 3KEFA 5HDGA 1YLFA 1PR5A 3NGMA 4NONA 3U0BA 4C4ZA 2ZW9A 4FXPA 1XRPA 2PH1A 4OBEA 1T2CA 3PUYA 1I7LA 1X77A 2FEAA 2W2VA 3SAJA 1JFSA 1CJVC 3GZ6A 3PXUA 1OT5A 4DY6A 3E97A 4RS4A 3KKNA 1A5SB 3QMWA 1CRLA 2PA3A 4MYHA 4BRSA 2V0GA 3NIFB 3L7LA 4MS3B 2XCSB 4MNUA 1G19A 2IS4A 1ZK1A 2HQOA 2I1WA 4DWWA 4G7OF 3GXBA 3NHZA 2V7EA 3IOBA 4Y8VA 5DW0A 4IGKA 1T6ZA 4YI5A 1K1EA 4ZZ0A 5IT4A 2P6RA 5JJKA 1PZNA 5K3OA 5IY5H 2XSJC 1SD1A 2WD9A 3LHDA 5A2QZ 1VPLA 4FYJA 4BMPB 1HKHA 3ZD8A 1L5GB 5KWVA 1KJ9A 5CXXA 1ZGCA 1SFUA 5DJ5A 2JFFA 4J2OA 4JYBA 3IP7A 2ZYDA 1H93A 3K16A 4EB3A 4K6MA 4ZEOA 3KD3A 3HGQA 2BBYA 3HV0A 5A4IS 1WBJB 3M2PA 2HLDA 3LYHA 1IVYA 3UR3C 4CYDA 1B6TA 1A9RA 1M2NA 3HH8A 3KOOA 3QYAA 5LZ5A 1L3CA 2CBGA 1AKQA 2W90A 2LYCA 1TZCA 3HN7A 2GR9A 3DZGA 3L8CA 4LF8B 1LDEA 3LP5A 3OCZA 3ZLBA 1JDVA 2QXUA 3NR2A 4W1PA 5FNVA 1FIPA 4UAUA 1V8PA 4DCNA 1VBFA 3DUWA 3NBKA 4IRXA 4BQRA 2B0LA 2WD7A 5ALKA 4M6WA 3SR0A 4L2IA 2EIKH 1QQ5A 3UMMA 3LA3A 4TQGA 5MGBA 4RABA 4R3NA 1XZDA 1NMEA 5AW9A 4DXAA 2RGNC 4FN5A 1N9GB 1QHIA 2HWUA 3OBBA 1NIPA 7ABPA 4L3VA 3WWYA 4J2TA 5EC8A 1FPQA 2VTBA 1G5IA 2WJIA 1UJ8A 5JNSA 1O6CA 5AM3A 1K8YB 1XDBA 1FC0A 3ABSB 4II3A 4MRSA 1F9EA 1HR0B 4RW0A 5IYZB 4C05A 3A1VA 4I55B 4HMPA 5CB8A 4KFRA 1PJRA 3Q1LA 3Q6IA 4LC1A 4WLEA 2ADOA 4HNRA 4G0QA 2FMUA 1A9XB 3CIFA 3T7JA 1DI0A 3EPKA 4TM7A 3J7AO 4ECEA 1Z0IA 5E9AA 2EZHA 4LZAA 2HIHA 2E18A 3AKEA 4INJA 4RPIA 4BQPA 1VJDA 2W2LD 3RWBA 3FVRA 2PVPA 1Y42X 2QTBA 3OX3A 4W5WA 4JFAA 3H83A 3IPAA 2XOXA 1OXUA 2O4CA 3NYWA 4XPIA 1OXSC 1BWPA 1Z5OA 2I62A 1NC1A 4HDMA 3WNCA 1YT5A 1A0OA 4Y2XA 1CY1A 3QODA 1M33A 1SJ9A 2LR0A 1T9CA 2W6ID 4G9GA 4MW7A 1R8SA 3I34X 2HDNB 3TWOA 4D8WA 1SXJD 2QX9A 3CLUD 4ZJPA 1W0KA 1AQ6A 3AXTA 3ESDA 5AM2A 3HJHA 1PT8A 1VBKA 2EKPA 3GFQA 5CP8A 3ZK7A 1KZ7B 1PEAA 3ZTYA 3AUYA 3B1FA 3WADA 4R9UC 1WD7A 3I9JA 3JRHA 1BQEA 1XX6A 2VDKB 4R1NA 1ETQA 3ZXIA 3IUOA 3VPFA 1G1AA 3BA1A 1CQWA 1XQ6A 4U87A 2QSUA 3BE5A 1J7KA 4JC8A 4XGQA 5F1OA 3ADCA 1W35A 1QV6A 3VSEA 1L4YA 3ZDZB 7MDHA 4AMYA 3OZAA 1M6NA 1R5GA 2W0MA 3HUFA 3K6JA 3ND7A 1UQRA 2NV6A 2Y71A 2BY0A 3AY7A 1RNLA 4PE5B 4J0HA 4YYZA 2WB4A 2HCTA 2F5DA 2PSEA 2GCEA 1WXQA 4DBLE 4BACA 2H9YA 1SPBS 1EZ4A 1NRIA 1WP4A 3H5OA 2JLWA 4CH7A 3HJGA 4ND2A 4R1OA 4F9EA 1C1YA 1O3YA 3OLWA 2PM8A 1R15A 2OESA 4KWTA 4R8LA 3ZWAA 2PX0A 3OPQA 4UVEA 4B9EA 3WAJA 2RGRA 3SJAA 3RC8A 1TK9A 3L84A 4CNQA 4PLZA 4B2PA 3OL4A 1ORWA 2PQ2A 1J49A 2FW0A 1J8YF 2FJPA 4XKBA 3GO5A 3PEVA 3GXOA 1FJLA 1DOHA 2GZAA 4FOPA 4DA6A 2A05A 3RBZA 3NYIA 4AY6A 4HCJA 1OISA 4C43A 4DFDA 3QQ5A 2MABA 1NLMA 1LNSA 1P7YA 2OCBA 1X9GA 2I87A 1DUSA 1IHOA 2QUKA 5ALLA 3EUHC 1BKDR 1HQKA 3G7NA 1RM5A 4XKJA 3ZYZA 2ANCA 3QOXA 1PD1A 4CM7A 2AOVA 2FF4A 4E3WA 2DFIA 3F74A 4IBOA 1QCZA 1B1AA 4OU5A 1ZP6A 2DOAA 2SBTA 4XSVA 4CM9A 3BRQA 3ASZA 4N0DA 4DR4B 2R7WA 2XKOA 1IN8A 2C2ZA 2JGIA 3AUFA 3F4KA 1ND6A 3G88A 3M83A 4FINA 3VR3A 1ON1A 1POGA 4BJ6C 1BO6A 2UUZA 2V96A 4J2HA 4ZXFA 3UKOA 3AWIA 3GIWA 3KETA 3UJ6A 1Q1NA 1NX9A 5E1ZB 1VLQA 4PRKA 2P2YA 3FKIJ 3UAOA 1EFVA 4ZO6A 4PS0A 1KFKB 3E5XA 4D9NA 4OQQA 4U6QA 1T3GA 5IG2A 2AFRA 2WAEA 3P4UA 4KI7A 4NP6A 3S28A 1APBA 1W46A 3T3OA 2PVCA 2XX3A 1E6LA 1NMQA 1XZKA 2ECOA 1Z7LA 4XJTA 4ZQGA 1HBXG 2AXNA 4M76B 3W9UA 1AHPA 1EFVB 3H5VA 5CR9A 3QU7A 3WVNA 4MVCA 1KARA 3EXAA 4UTOA 1FP4A 2HU5A 3CO0S 3EEFA 3II6X 2EJBA 3DDSA 4NCJA 4I7HA 3CMYA 4GSKA 4MUIA 3UV6A 3GP3A 1VQ5I 4E2ZA 4HX5A 3T7CA 5CYPA 3UNXA 4JLOA 1KSJA 3NHKA 1YS2X 2ZK7A 4LK3A 3VTAA 3ROUA 1JP7A 3BE8A 1FVFA 4RACA 5EHGA 3R4VA 2EP7A 1HYGA 1ZEJA 1CFZA 3PP8A 1NP7A 1M1YE 1DEXA 3GCGA 4N3BA 4FX4A 3GRAA 4RXTA 3BZUA 1PJAA 3D1VA 4U7DA 1W7PB 2P41A 1G4DA 5D6OA 1J0RA 4A0QA 1X74A 2I99A 4C04A 3F5DA 3AR8A 3Q11A 2EINH 4JBHA 4YLYA 4II7A 5L7YA 2VF2A 3CNLA 2OG1A 5KNDA 1DC7A 1WKBA 1CYEA 1R12A 3FDZA 1EESA 4WMLA 1TKBA 4NR0A 3FCAA 4DE5A 2R1VB 3ORRA 4W82A 3OQVA 3F46A 4KKVA 1WOMA 5AXAA 2XPUA 5D3KA 2ZVPX 3KEMA 4ZVOA 1OCEA 2AW3A 3ZGVA 2AXPA 1FVOA 1EM8B 1YS1X 2ISQA 3HYNA 4EG1A 3ZQ6A 2O1EA 1F8FA 3ABZA 2FSHA 4V0RA 5EERA 2J31A 1IOVA 1XWFA 2NX2A 3KYCA 1THGA 1S8NA 3IV5A 1KFJB 3A14A 1ZMXA 5JYEA 2OBNA 3BTSA 5BSMA 1B6SA 4I50B 4D46A 1IV6A 4YGXB 3G0OA 5C7OO 4HP8A 2E1MC 3PC3A 4NV1A 2O07A 1EG7A 5FP0A 4JV5B 3QWLA 3LJKA 4BQIA 2PUFA 3ZQ7A 2O8FB 2D06A 1TLHB 2LD4A 1B9NA 5G2OA 4BO7A 2SKDA 4DA4A 1UMKA 2E3JA 1IUKA 4HBGA 3SM3A 3HWSA 3VO8A 3PHIA 1XSDA 1SQ6A 2BL4A 3ANLA 5JVDA 4YJ2B 4F38A 3AJ9A 1BQ3A 2GZDA 4MI1A 1F0NA 3TM5A 3RSFA 2F6RA 4EITA 4HWTA 3ZE7A 2WI8A 3SHFA 4TTQA 3ZPXA 1TJYA 4Y4RA 2X8WA 4Q0MA 5BSKA 1FBUA 3BB3A 4Q21A 1OKKD 2PUAA 4NBWA 2YYSA 1A7KA 1CUZA 4AMBA 2R1ZA 4Q48A 4TKUB 4UDXX 4HNSA 1ZD3A 4D8VA 2XE8A 3OKFA 1YQXA 1U2DC 4Z0HO 4ZCPA 2RGVA 821PA 3U7QB 2QTWB 5C8YB 3RRXA 2NS0A 1J0CA 4P36A 1TLTA 2QX6A 5F3DA 2BCJQ 4BO4A 1V48A 1Z4NA 4B3JA 4EEZA 3NIWA 3A4CA 1Y5LA 1J2EA 2XUAA 4MS1B 4UUQA 3TD2A 1ACLA 1ACMA 1RKBA 3VZRA 2GIVA 3D6VA 3FMSA 5CLFA 3BA6A 2Q2NA 3H2BA 4G1CA 3GJ3A 1NASA 3U1TA 2D2IA 4EENA 5CYOA 3C1UA 4ZYAA 2CVOA 3NIBA 1RMTA 4A8JB 2TMDA 3BEOA 1XKXA 2LZ0A 4H7FA 2QVOA 2ACVA 3ROTA 3ANNA 4U9IS 1R0WA 1FQKA 2PJUA 3A6GA 1ZW1A 5FLXZ 3OSUA 4GWLA 3TI7A 5CBPB 4ZOLB 5GPBA 4PLYA 3JRXA 4OHYA 1N5KA 3EIHA 4R3UC 1SRQA 1NRJB 2H18A 2DFHA 2WIGA 1RRPA 4I6ZA 4R9RA 3V8PA 1JF8A 3OQ6A 4ND8A 5IJWA 1VSTA 3KYDB 1ZMBA 4KDFA 4OHRA 4CR6A 2O5EA 2OJED 2DFLA 1PR2A 1TZMA 1X8XA 2PV0A 3INGA 2Y1KA 1CDEA 4IQ0A 1XV5A 3QWIA 3W34A 2W2LA 3M5CA 2PN1A 3S2SA 2IYYA 1MMSA 4KBYA 2ECQA 4GPZA 1CQTA 2A78A 4CM4B 5CYFA 2HTJA 4PTZA 4UREA 3L1IA 1WY7A 2HLPA 3VO9A 4UHTA 1XMVA 1NVWQ 2ZJQF 3TPFA 3W2EA 5DN6D 2ODBA 1H05A 3E6BA 1K6XA 1PT7A 1XZFA 3OWTA 3CISA 3H5IA 5EI5A 1OYWA 3VVMA 1AK2A 4M3NA 1XQYA 4C30A 3DEEA 3OFNA 4ISCA 4ZREA 2D7JA 2PCJA 3V33A 3X1DA 3WGUA 3K0FA 5FB2A 4JC5A 3DTKA 1YDFA 1G3RA 5CLIA 4MMXB 3V7RA 4K9DA 1A4RA 1GTJ1 5D5PA 3TR0A 5K03A 2J59A 1RLTA 2ZIZA 2LFBA 3LQYA 3MWLA 2RGYA 3KJXA 4JEMA 4JLDA 1N2GA 1U7HA 2W2TA 3G89A 4KMSA 4MUMA 4MVJF 1J0XO 5ERXA 1N77A 1XEXA 4BV3A 4KPUA 3CEPB 1PD0A 3GVXA 1VKZA 4F5DA 1S0UA 1ZARA 1YR6A 4YLGA 4Y33A 3K9GA 3Q87B 4G8BA 3QPTA 2HDDA 3BGSA 1WUTA 4O1HA 4PVCA 4J0QA 1K75A 4BVEA 3QRWA 5ILGA 2XKAA 2WIAA 3V8EA 3H1FA 2QRZA 1AB5A 1EIZA 2GO1A 5I01A 3C16C 4AZ3A 2K27A 4XSHA 1EP3B 3RUCA 2B4AA 2CFOA 1EJBA 2K87A 4RFVA 3HJFA 5IUJC 1NG1A 1LFAA 1LH0A 3L0IB 4KDEA 4TMWA 5CA1B 1QA6A 2VS1A 1Z0FA 4JJZA 2L69A 1Z7WA 3UXMA 4AJNA 3ICCA 5C37A 2P9YA 1MPXA 3D3QA 4YFKF 3DB2A 4M1YA 4P2BA 1U31A 3J7TA 3M33A 1DADA 2DK5A 4DHWA 1KKMA 2A8YA 4XVHA 3EASA 4H18A 4LXTA 3H36A 1MKYA 4OKIA 3WL8A 4EY8A 2GPJA 1EE2A 3ROXA 3LFKA 3SZ3A 2WWWA 4ZOQI 2CFSA 4RJKA 1PU2A 3HEAA 1PWHA 3I2YX 3CCEI 3MTAA 1Z83A 4Q3NA 4EA7A 1G8AA 1Y4DE 5CW2A 1UFQA 1NE7A 4I5GA 4UM7A 3R3XA 4LXGA 2IDJA 2ZXWH 1F4VA 1PEKE 2A14A 1QDUA 2IRWA 4WOCA 2B9SA 1VB3A 3I76A 1PZFA 4WSOA 5HTKA 3DT9A 2NPFA 4JVNA 3TOVA 2CF5A 4OY3A 1E4YA 1LLQA 4HNAA 3U5ZB 1KY2A 4E22A 1EB9A 2G5PA 4LBWA 3CX3A 1O94D 1QAOA 3NPAA 3UBTA 2Q1XA 1AKYA 1AXEA 2TMKA 3GRFA 5JTTA 1NHAA 1QYWA 2IHBA 1OJLA 1VG1A 3H3FA 1NMXA 4PGMA 1RKTA 1EJ2A 3CUOA 4UU7A 1DP3A 3G5MA 1Y7HA 2HOQA 2VZLA 3N2GA 2V6EA 4UD6A 1RWPA 3DOEA 4ZI7A 1LPBB 1JKJA 4KE8A 4KQIA 2B20A 5AKEA 1N1EA 3DQVC 4PAWA 5GMOA 1FTWA 2WWYA 2E60A 1DIOB 1HFEL 1PJ4A 2GKGA 1QX4A 3CF6R 5DYNA 4AXXA 2D1SA 1KVUA 1TT0A 1TQ4A 1OOEA 4FTHA 1IDYA 2Y2ZA 1E2PA 1JHRA 3AG4H 1UMBB 3BDIA 3GPDG 4NC7A 4U88A 2J09A 3GTKJ 3O83A 3AL3A 3IUEA 2VATA 3QTLA 5GJWC 5JS2A 2PS1A 1OWPA 2A88A 2Q1UA 3HA5A 3MWJA 4U00A 4YAJA 4H3SA 1L7PA 4BMCA 3REOA 1AWCA 2TSYB 4RD6A 4KKXB 2QLTA 1A77A 5K3DA 3N0TA 1E0KA 3HCWA 4MAAA 3CO7C 4XD7D 4DQDA 3Q8XB 4GX0A 1FNBA 1QMGA 3A9WA 2F2EA 4K2HA 2A57A 4RYLA 3IOCA 3QOEA 4E94A 2VXZA 1LTQA 4NC9A 4WFKA 1OCPA 2ZYRA 4UZFA 1Q11A 1MFPA 1Z7BA 5AJTA 2AQEA 2AOUB 3FNHA 2ZUFA 3QYBA 1SQ5A 3EE6A 1TYAE 2FSFA 3RUPA 1WVRA 1HFWA 4UBNA 2NNLD 1YRHA 4BMVA 1CJKC 1XTAA 3I58A 1OKKA 4DCCA 4KYIB 2BYVE 3PRYA 5A3VA 3VPXA 1TEHA 3FOEC 4BZQA 3RPQA 5JBQA 5C7YA 3HSKA 4G0OA 2AC2A 1IHXA 2G5GX 2GRJA 1I2BA 1SD6A 2HXIA 2DHQA 2JIZA 4L8YA 4AG5A 4C4TA 2QW0X 4UQLA 3EXHA 1XELA 1XZLA 2PT9A 1ZD4A 5A1JA 3FIUA 5DHSA 3C3XA 3OZGA 1KBZA 2ODNA 4RF2A 1P1KA 1W76A 1ZI9A 4GOOD 3SQDA 3WMFA 4EA6A 5IS2A 4EG3A 3EG5A 5K3BA 3X2SA 2HYFA 4F5ZA 1VQ4I 3WHCA 4GG1A 5KYKA 3EXEA 4RORA 2JCGA 2JHAA 2CUJA 3RIGA 4ZGWA 3EAFA 3TIXB 3J80Z 2FF7A 3I42A 1YZYA 1YMVA 3L1PA 2E87A 3AG1H 4YRVA 3DV0B 3EFBA 4D5CA 3QLUC 3UAGA 3W77A 3OD1A 5C0OE 7GPBA 1OXKB 2VC1A 1WR8A 4J29A 1T5LA 4ZVTA 4HHEA 3DJFA 3T5CA 3WLRA 2E19A 3ZD7A 1F12A 4K2AA 4I4TF 4RLSA 6PAXA 1QH8A 3F22A 2BGMA 2XSZD 5JCPA 5EIBC 3IBFA 2JI7A 3DZKA 2PLAA 4OHKA 5LNK1 1B76A 4PUSA 2BGKA 4P35A 4ZZDA 4U7WA 1P4JA 5ER9A 3O8OB 4DCSA 4EARA 2WT8A 1ZH6A 4WXHA 2ID9A 1TO6A 5AKHA 1QE3A 4JI3B 2V7FA 3HCPA 3OZBA 4AYBN 4U1RA 4WESA 9ABPA 4EHBA 5I9IA 1EBUA 1OD6A 4HA8A 4OQMA 3PLNA 4FYIA 1ZKMA 4MA4A 1YZFA 2YTZA 1H6CA 1GJRA 4Y1GA 5K5RA 1WGXA 2Z4RA 4DPLA 3U4GA 3ULQB 3HXOA 4HF2A 1NXQA 3TW8B 3AI1A 4M87A 4EHJA 2O14A 5AVUA 2XHEA 1AKTA 3LSHA 3T1QA 4M21A 4XDHA 5D5WB 2G9QA 3BQ9A 4GOLD 2IUYA 2VAMA 1YKFA 1OXXK 1Z6PA 3FRJA 2WV9A 3ZDYB 4CJXA 2QLNA 2K7FA 2XF2A 1SXGA 1EI9A 1HNNA 4A23A 1Y7PA 3PIRA 2Z1MA 5FOXA 3SE0A 3ZCOA 3VPHA 4RM2A 5I7EA 2EGUA 3ENQA 3FWEA 4FDUA 4U0VA 1FYMA 1V4BA 3OJXA 4P33A 4WGFA 3NBUA 3NLLA 2EFCB 4PBRA 1RJFA 3MCTA 4JUAA 4D2IA 3P2MA 5AJYA 1ZN9A 2Q9CA 3EIOA 2G0TA 3DOCA 1EGQA 4CCYB 2ZR8A 1V5IA 4ND1A 2VJMB 4YR7A 3Q8MA 1BXKA 4C9BA 2AI3A 2CXSA 1GZUA 2FQ4A 1TC1A 2DT8A 2WUFA 4AYWA 2P7IA 5EAIA 1O9BA 1SCNE 1GPDG 2COBA 2Y8EA 3FCCA 3WI7A 3Q5FA 3HL0A 3WK4A 2C7QA 4Z4GA 1GZ4A 1CXZA 1S2OA 2WFLB 4OQ4A 4W63A 3SX0A 3TQIA 5LSAA 1ZUWA 5SZKB 3M3DA 2P75A 1VG8A 3O31A 3F8TA 3HVUA 1EUCB 1NX6A 2ZZKA 3LSYA 4JENA 4NATA 3WX0A 1O9GA 1KGSA 2Z5LA 3UC5A 3V9PA 3H6HA 1ULSA 1X6VA 2J6HA 1YG2A 4M9QA 4PR0A 4BASA 1KTVA 2VWHA 1Z2DA 4J6FA 1TRKA 1SQ0A 1FNCA 3VJMA 2W6QA 4JR0A 3S2FA 4WEQA 4ATNA 4ZK2A 5CDFE 4FMCF 3KUUA 5A5FA 1KFEB 2IYXA 4RD3A 2L3DA 1FX7A 4ETMA 1I3LA 4MQBA 3HUGA 3VOSA 1RQXA 5AUPB 2IPQX 2KJBA 3TZLA 1GY8A 4C3IJ 2R4TA 2OVBA 3IUPA 5DHPA 1T1IA 2H4FA 5AXDA 3IDFA 1HE1C 3QMMA 4V0OA 4JLAA 1K7EB 1JBKA 5E8JA 2I8AA 4KQXA 3TMAA 2BR5A 3I28A 4EJ6A 2I33A 2Q6KA 4N18A 3OL3A 4LMYA 1MO4A 2W2MA 4NYJR 4X1IA 4JBYA 5TJHA 4IJ6A 3J80A 2WQ6A 3W06A 1BCSA 2EV0A 4ZOBA 3FFAA 2C7OA 4LSMA 2AJ8A 3A9UA 1L5YA 1Z2PX 3BSFA 4FKZA 3PEWA 4G84A 1P0IA 4F21A 4JSRA 4EF5A 1ZUIA 3GRZA 1E3TA 5LBQA 5FBVB 2H2FA 3JRIA 1RWQA 2Z2IA 4E03A 3KJNA 1VJRA 2ZNYA 2WYVA 3CLVA 2IOHA 1DIAA 3QY0A 4PQYA 1RHUA 5K8VA 2J4CA 2OQGA 4RGXA 1GPJA 2R6HA 1HEYA 2H3EA 4P83A 3RJZA 1OZAA 1GTSA 4B46A 1L7DA 1X7WB 2P1RA 2H0RA 5EZYF 5AKZA 1P1RA 4ZANA 4QIWN 1YE9A 4AJ4A 1VPDA 3NHLA 4CI9A 5JMTA 4O2BB 3QH4A 3FPKA 4FMDB 4LJ7A 3RSSA 1F06A 4FWIB 2NZJA 4ZVQA 1W0JA 5JSYA 1AZSC 3AUTA 4PNHA 5DGXA 5I5EA 3K4HA 2OP1A 2WB1N 1BRMA 4NU5A 2HDHA 2Y68A 3A3OA 2HJHA 1R8QA 3CD6I 4UNIA 1JEQA 3AESB 4AIHA 2H31A 3K0HA 2IPLA 1XEWY 1IGNA 3OOYA 5COQA 3SLKA 4ZYVA 4PYKA 4EKNB 5T4FA 2QSJA 4HDRB 4BL0B 2AQ8A 4C9YA 3B1KA 3DBVO 1YQQA 2PO5A 3LGXA 3PJGA 2Y9YA 1ZGBA 3WB2A 2ZTMA 3H2ZA 1Q7BA 3CP8A 3LP8A 1KIFA 3AFHA 1EK2A 3TYXA 3DE6X 1ERDA 2VKDA 4V3BA 2HQNA 2C5HA 1VHDA 2R84A 2ID8A 3OYLA 1Y6JA 3FNFA 1E59A 3IMEA 3QENA 1M67A 5HIAA 3WTYC 1TO2E 2D4HA 1TL7C 2PK3A 4R1HA 2VP4A 3DV0A 2NT4A 4GIBA 4CUKA 2VAPA 1J2XA 2DW4A 4IHAA 3H8SA 3R7NA 4J0IA 4GI7A 2CNBA 2VEOA 2WV7A 4MV9A 4LYYA 1AGNA 4A27A 4BKRA 4DILA 1ZH5A 1HDPA 4O6VA 4ZI7F 3K15A 3LLSA 2PZLA 3CLRD 3S2GA 5JPIA 4E32A 3INRA 1JIQA 1N33B 2NU7B 2ZYVX 4RLQA 1SD7A 5EG0A 1Y4ZA 3ZHUA 3C7CB 5HM8A 3ZQJA 3IQXA 2HMSA 1N9ZA 1U1CA 4GLLA 5CA0A 4Q39A 4AW9A 3ORHA 2QTFA 4CLEA 1C9NA 4OIFA 1WG8A 1XZJA 1XXHA 1VSBA 3IKTA 2O06A 4YC7A 3FCOA 1EINA 3D2AA 1I14A 5G1NA 4ZZ1A 3WK8A 4HGPA 3SVLA 4X1KA 1SZPA 1WB4A 4L4YA 2OXRA 1T33A 2FOWA 3DPLC 4PNZA 5TRTA 5D5VB 2VUHB 4Q7JB 4US0R 3CONA 4GWKA 1MC4A 4FCTA 2MIIA 3KWLA 3OZIA 1OCCH 2AE2A 5KZMB 3ZZTA 3V4ZA 2EFGA 4KODA 1C7JA 2NIPA 1Q1AA 4D0PA 1YS7A 1SB8A 2YS9A 3D6UA 4ZODA 3OFKA 1K6IA 1E3QA 3MMZA 5DM7F 1GLNA 4FZRA 4X91A 4XDGA 2IGMA 5FXMA 3JATB 4TVBA 5JHUA 4C0JA 2ZSUA 3JD3A 3ZXUB 1J5XA 2QENA 2WK1A 3SJCA 2GTIA 4MRPA 4R98A 4HVCA 4Y15A 1OLSA 1O0SA 1CB0A 1DWUA 1GGHA 1I4DD 3GB9A 4FMPA 3WAGA 5J2UA 4IXNA 3A06A 3WY9A 1UCFA 3PX7A 2Y99A 2FP3A 2EWVA 4M88A 4UOQA 2FFHA 3QVLA 3G5AA 2I66A 2QT1A 3CMEI 3NKFA 1T8WA 1Z07A 4PPGA 3GTQJ 4RH3A 2KZVA 2JVHA 3QEMA 4E4RA 1XQXA 4H0EA 3CMMA 5D5XB 1J9IA 2ICWG 2IDMA 3AM4A 5LA6A 1Y9EA 5HFAA 2B1JA 3GL9A 1WHUA 2GJ9A 2Z5UA 1NXXA 3B13B 2DJNA 3E15A 4ND5A 4AJEA 4L0YB 2ZT5A 5JXIA 1W36B 5FHQA 4G0NA 3HJCA 4AQYB 4W5OA 3L2CA 2Q1WA 4NMWA 4Q7LA 3G2JA 1W88A 2VT6A 3WA6A 4L8LA 2XMCA 3VR4D 3WHPA 4Y17A 4EJ2A 1FYDA 3FPFA 3D43A 3BZWA 3A0HC 2JA2A 4ZD6A 4BGIA 4PLTA 3TFOA 5LJIA 1GVHA 3A11A 4PTYA 1MIOB 1V1RA 2QJWA 3QPLA 2UUAB 3MD2A 3TLGB 3FXRA 1F4PA 1VE1A 3NQ41 2A6HF 4Q7MB 2WJGA 1IMOA 4EB6A 4KA4A 2Q8QA 4TRRA 4TKMA 3IWFA 4MOWA 2UAGA 4Q7KA 3RC9A 3W1WA 2FE4A 1HKSA 3AQIA 3PGMA 5DTRA 2NU6B 1HFJA 5C4GB 4G24A 3I1YA 2KIUA 1Q83A 1P6UA 4FLFA 2GPSA 3VPSA 2V65A 4M1WA 2W42A 1JA1A 2LGJA 2PKEA 3C1TA 2ZXEA 4N3GA 4DSOA 2G40A 2BJHA 4A2WA 3KBBA 4DLWA 3DE5X 3THSA 3VKUA 1UDBA 2QJOA 3WOVA 4HRVA 3N3AC 4LE0A 3M2TA 1K79A 4OLHA 4S1VA 2ZYUX 4ILKA 4RHFA 3RABA 2AN4A 1I94B 3VAAA 3N97A 1DP4A 1JFRA 4E6KG 1JFLA 3BJOA 1P1FA 4WY2A 1WAMA 3IR5A 4UQPA 3QNWA 3DU6A 2BC9A 2W6OA 1JKJB 1P4SA 3MLEA 4RA9A 2W82A 2VDRB 4U6NA 2QWXA 1CG6A 1FDSA 1Z7GA 4JUFA 2JAHA 2JA1A 1IG3A 1CY6A 4P9UA 3FZNA 1XZAA 2HA4A 4GI5A 3X3HA 1BROA 4PPNA 4QRDA 3LVBA 4JX4A 4EJWA 2WF5A 4M7RA 3DLBA 3AV3A 3IT1A 1H8EA 2OLEA 5LFAA 3VISA 4I8DA 3QSGA 4JBIA 2EEZA 4MW1A 4HDSB 2WZQA 2M6KA 4I8XA 4QXMA 2WP8J 3ZV7A 4EYGA 5FUQA 3O9MA 1VQMI 3Q3CA 1ESCA 3E58A 4JN6B 2LTAA 4JLNA 4RANA 5FIUA 3WGKA 5JZBA 3HXQA 4EHHA 4Q3OA 3ZHSA 2E71A 1XAIA 4ACBA 5GVSA 3L7YA 4AY4A 4A3CJ 1D5VA 2EZLA 5C4MA 3O7WA 5LMZA 3U4AA 2Z2SB 1FFDA 4OLAA 2IVMA 3U9LA 2UYHA 1S2IA 1Z4OA 1S1MA 4LYHA 2Q2QA 1I2ZA 1JQ5A 2PQ6A 1R36A 2QB5A 3LDHA 4HAYA 1PJTA 2V6BA 5DM0A 4K9PA 1UM9B 1R00A 2P81A 1JG3A 1YOVB 1JKIA 1IAQA 2PI0A 1VYTA 2FG5A 3CR3C 4IXTA 3I62A 2BWJA 3PR1A 4BZZA 4GZ5A 2GPWA 1GQ2A 1F1BA 1RAFA 1XRMA 1JTXA 3HACA 3R6WA 3PO2J 1USWA 3G6WA 2I6TA 3L7BA 4RAGA 3B8HA 3EGDA 2DYSH 3MILA 3QWBA 3W2FA 4QU0A 4BIMA 1ZR4A 2V5AA 2WWHA 3QOWA 3QTBA 1A71A 4IQGA 1QR2A 3X0DA 4C7OA 1X4PA 2WP0A 1QAMA 2K86A 2NG1A 2GD6A 3T9DA 1IRGA 4QDXA 3S7ZA 3RG2A 3R09A 4QPQA 2DTZA 2B83A 4XCVA 2QTMA 4BEHA 2HF7A 2CJFA 2V26A 2A1UA 3LCCA 3M1LA 4MGEA 2C4KA 1EEHA 4OB6A 2NU7A 4KYWA 4UXNA 1E92A 3K35A 4MWCA 5FI5A 5K6TA 2REOA 4WCFA 1C1XA 5L3EA 3TO6A 1YR7A 1VQPI 2WAQA 3UJ9A 3FPCA 4MJ3A 5E4FA 1T0UA 3FTCA 3GQBB 3A6HA 1K3UB 3UQZA 3R0IA 5FA6A 1O97C 3P9NA 3NMUF 1ZZEA 3CWCA 4OK6A 1DFIA 1LQ1A 4MR9B 3MWDA 3QFFA 4IOLA 3PXEA 4RNDB 5JYCA 5BN4B 1Q3KA 2ZJ0A 1A9ZA 2X1CA 5K7HA 1L5NA 2DMTA 2EERA 2YWCA 3AG3H 3DMTA 3F1LA 3RJTA 1PJ8A 4RX1A 4UPEA 1M5TA 3NTOA 4YY3B 4WNCA 3KT8A 1PV2A 1ATZA 2IEAA 1NTOA 4XLNF 3MFKA 1TQ6A 3E8XA 1PT5A 4EHDA 3ZDCA 3IUSA 3KOYA 2ESNA 3SK0A 4B82A 2X42A 3FR7A 1TF5A 3ORQA 4MQ4A 5CQGA 4N9QA 2MSLA 5BW4A 2G9RA 3NH6A 3ZJTA 4OX9Y 3REQA 1WUKS 2WJPA 4RHTA 2XXAA 4A9AA 1YMUA 2YWJA 4JWKA 1LI5A 2LBFB 2PBZA 2XT6A 3BHNA 4M54A 1OWNA 4RZIA 2V7QD 5ECWA 1Z4IA 4LOJA 1MTZA 4JLKA 3IIIA 5L3SB 2I7CA 3IDAA 2AHOA 2QNIA 2E21A 2IBMA 1IQ0A 3JSOA 3G6EI 4FYKA 4L4UA 3C2BA 4WKPA 5EESA 1GQFA 1O94C 2JPCA 2NSDA 1A95A 2WWXA 1RHMA 1E20A 2YASA 4Q4HA 2GQQA 3WTWC 3HYRA 5KHAA 1DJLA 1IULA 4M3EA 2YHAA 4X65B 3THWA 3QFCA 2PJPA 1JKMA 3EQ7A 1EFKA 5CVRA 3A3KA 3EQZA 3L6RA 4YAOA 5CNJA 1XTSA 3HRHA 1QPZA 4BL5A 2A9JA 4XLAA 2JGAA 4PZYA 3VI3B 1QKKA 3R7SA 5JTUA 3E5UA 3P5SA 3K4LA 3SD7A 3QELB 1Z5NA 3PD1A 3QVSA 5U1PA 4O4HA 5K09A 3LX4A 3OP1A 1BOAA 4XRFA 2RC6A 1CE8A 1T56A 2J30A 4JROA 3K9FC 4ARZA 3TFWA 3NUQA 1B2LA 1JVNA 5E6RB 3BJAA 1ABEA 2ZXJA 5GP9A 2R5ZB 1AU9A 2VIIA 4FMDF 2HDCA 4UE3S 4RESA 1SQFA 2X1VA 4NOKA 4WV3A 5AHOA 4DT1A 4ZHQB 2GZ1A 2VASA 4DCTA 3AF3A 3QVJA 2Y9ZA 1CF2O 4PAMA 4DHEA 1ETOA 5FOVA 4FVTA 3NC1C 3WIVA 1UIMA 2Q46A 4WN9A 1L7AA 3MG9A 3X44A 4X66B 1U8YA 2OV2A 3F98A 3W1VA 4G81A 4QBHA 1LSUA 3LXRA 4ZQFA 4XONA 3VYRB 1WY5A 3DE2X 1Z39A 4XSXF 2O2JA 4NE9A 2QQ9A 5DE3A 2JFBA 1L5VA 2BP7B 2NVYJ 3MA0A 3L09A 3QHPA 3TRIA 3QYPA 1MZVA 2CXTA 1KK2A 2ZSHA 5DCYA 2M4KA 3W2HA 3VPBA 3V46A 5F7XA 5IT9A 1Q14A 2VDMB 1DJMA 1Q5PA 4FHDA 3FZQA 1GLGA 1GNPA 1PEYA 4AVPA 2FSPA 1Y8RA 4KTVE 4NAVA 4JP8A 3KKLA 2W6CX 1J23A 2CB9A 1HSZA 1DXQA 3ZW9A 4JBNA 1G6HA 4DBLC 3PICA 2PWBA 4V2FA 3RSQA 5L4NA 5ARCA 3QLUA 1E96A 4E0BA 3KPJA 1NV9A 3TJZA 1U2GA 5HKKA 4PIVA 4DZJA 4DLVA 1ZG1A 1X7GA 2KX7A 1KC3A 3IXQA 2QQ0A 1ZJ5A 2E4XA 1UT6A 4QYWA 3S40A 4Q7QA 4HNVA 1DGQA 4M60A 5DN9A 4IQ4A 1S02A 1BZYA 3DONA 3NHRA 4RVFA 5BW6B 4R8RA 4M9ZA 3RYHA 5I8PA 3TINA 3VU3A 3QE4A 5FWYB 3S1LA 1X7HA 2Z4TA 3H9QA 6Q21A 2DETA 2O8DA 1KEWA 1YZ3A 4MPDA 2HUPA 5A02A 3G5LA 3ADDA 1Q0HA 1JIJA 1EKXA 4I2VA 2HOAA 3QLJA 1UWCA 3S81A 2GLXA 2GPBA 1FF9A 2QVYX 4R54A 4IV8A 4PF1A 1IN4A 2C9OA 2LDBA 3DVAB 3O1JC 3TEJA 3H1GA 1YQTA 5HS6A 4CM1A 4H3VA 4JQSA 4ZU1X 4O5VA 5B30A 4P31A 4GPTA 2Q4RA 3KQTA 2WHPB 4UUAA 2PLNA 5EUBA 4CMBA 2ZS9A 4MX8A 2I8LA 1XU7A 1G16A 3BGOS 4HJXA 1DZ3A 5IAAA 3ON5A 3DYIA 1JT6A 4GDFA 1W29A 3H19A 4ZWNA 5C1BA 4FEAA 4JL5A 2GYVA 1M6HA 1GRNA 2AF4C 5KU1A 4TKLA 2BKAA 2F59A 1H2AS 2ZSKA 1NP3A 1VL0A 2FR8C 1Q22A 3ANXA 2XNCA 3ZE2B 1R4ZA 5HKKD 9GPBA 4BFZA 3KEQA 5E6UB 5HW0A 3I64A 1A72A 2JFNA 4H17A 1UMDA 3HSRA 1Y39A 2OFFA 2IYNA 3M8KA 3HUDA 3OC6A 1H2FA 2DA5A 2LLKA 2AMVA 1YBMA 1ETVA 5F6FA 2GCPA 3DCYA 1GQQA 1X1SA 1F5SA 1J8FA 1Y6QA 2YHIB 3CXRA 3ER6A 3IVGA 3OURA 4LTDA 4M22A 5FB3A 1WZCA 3O0TA 1T8SA 1NXPA 3RHFA 1YRNB 5FYQA 3ZVMA 2D45A 3W3ZB 2VP3A 5MHTA 1PRYA 2Q41A 3U21A 1X1EA 2IYWA 3KUDA 4WNIA 4DRZA 1GCGA 2G06A 4FW9A 3HTXA 1H9TA 1S7GA 1IY2A 1XVAA 1LVGA 4BATA 3K70C 2IS6A 4YELA 3NARA 1QHHB 3SF8A 5K20A 3BGDA 1XMIA 3OEHA 5KTSA 5HS8A 4Y18A 2HTSA 4LGCA 2AEJA 2MWMA 4XASA 3FKQA 1N25A 4RDIA 2EATA 1ORVA 4O4LB 4G0WA 3S17J 1X7XB 2Q5IA 1EX1A 2I4TA 2SNIE 1QNLA 4MW0A 4RPCA 4PNEA 1IONA 1I7PA 3H7AA 1BBYA 1Y1KE 3QF4A 2OR3A 1C30B 1G41A 4I4TB 4HV4A 1E3MA 1TF2A 2X0FA 3Q2IA 3D0SA 5K0ZA 1KH2A 2XHZA 4PLFA 4J3FA 4QO8A 1LQUA 4HGZA 4ALMA 3A1WA 4BVLA 1AKVA 2WVHA 2GYWA 3R23A 1V41E 1NZFA 3HBMA 4LE1A 5F5XA 2BY3A 3EW7A 3R7AA 2C5EA 1S2DA 2P7CB 1TUGA 4LJ8A 3K0LA 2OTJI 4OQDA 4QIHA 4A3IJ 4JOSA 1IJBA 5LLTA 4MTDA 2QPAA 1R0LA 3B7PA 3IB6A 1J20A 3FK7A 4HQMA 1L8XA 4P55A 1OX4A 3LX6A 4DSUA 4QNRA 1IUNA 2NU8B 4EFNA 5G1OA 2HR1A 2H4HA 3ZOZA 2H1FA 4HDRA 2RGWA 4DB4A 5F9FA 2F1HA 4X45A 3DL0A 3E8SA 3MJFA 1DXHA 4DDKA 5KNBH 2XKKA 1ES9A 1U2QA 3ANTA 4G97A 3I0MA 1GQRA 3T4PA 2V3VA 1ZCZA 4IIHA 3TEDA 1EFCA 3S5UA 4HB3A 2RNGA 2TRSB 4YXWA 4UM5A 3H4IA 3P96A 2VLIA 1N1MA 2V7QA 2C4TA 4LOIA 3HA2A 1S2LA 2AG6A 3PHJA 4LV8B 3VGPA 4AIKA 1M83A 2JH3A 5T4BA 5EKUA 1WDLA 3HHGA 2WAOA 4UD2A 3F7OA 4Q1VA 1C14A 1JZTA 2O8XA 4RH0A 4YMHA 1DGRM 2MA3A 1UDCA 3CRQA 2Q9AA 2H5IA 1CPYA 3FSJX 1FDOA 3W2AA 4DEVA 1V5GA 3BXHA 4TRNA 4YWHA 3VUEA 2JHCA 3RSNA 1RABA 4QLOA 5H5JA 1XYVA 3VUFA 4BFTA 1UBUS 1SG9A 1UKZA 4M86A 3I61A 3MLAA 3KQSA 4JWTA 2GXQA 1X2EA 1FSEA 1DVRA 1O03A 1YIAA 2DHCA 3ETLA 1WQ4A 2DO7A 4A3KJ 1X1RA 3EWSA 3KELA 2ZSDA 4QULA 2XE6A 1E8NA 4RKYA 1QHGA 2DRIA 1VYHA 2JEOA 4LYDA 3EZ7A 2H94A 3ZN0A 1GUYA 4OSPA 4TWRA 4E30A 1MAAA 5JD6A 2H1CA 3KSAC 4EGJA 4AY3A 4GXTA 5JBNA 1S3IA 3WLTA 4DSNA 4H4EA 4DV5B 5MFZA 1S4MA 3IPRA 4LC9A 1T3ZA 1VSVA 2I03A 3RFUA 3RVBA 2L42A 2NQTA 1NP6A 1KH1A 4MGKR 4RMIA 5DBFA 5E3IA 2MSYA 1BN7A 4ZVUA 3S4YA 2XUKA 3UWKA 2KM1A 3KXLA 4MUNA 5IC6A 2HF9A 2XAFA 4WXEA 1R71A 1FDWA 3G8AA 2DR2A 3EVFA 4L9WA 1XNRB 1U0OC 1DBSA 2UZ1B 2JBWA 1UKAA 5TV2A 1QNFA 3ZE8A 1NDQA 3SIRA 2X2FA 2ICAA 1KBOA 3ASNH 5ADHA 4GSLA 5LNK6 2ZS7A 1V5FA 2EU8A 4YXWD 1AHNA 1CY0A 4QUGA 2PUVA 1BJRE 3SDSA 1KWGA 5BO5A 3BK7A 1C8BA 1ECLA 4BP8A 1YJQA 2YRFA 1Y63A 3ZDBA 3Q98A 2FPKA 4L02A 2FRDA 2NZUG 1RPTA 2XTNA 3JCZA 5T5QA 4DNPA 3OZCA 2QRKA 2FWNA 3U3XA 2W25A 1ESDA 1K6MA 4UB8C 1AQUA 1TTQB 3NYRA 5H9VA 5LDHA 2BH9A 4IJAA 3LFHA 5KJ1A 3H9BA 1L4EA 2AFIE 1ZKDA 2RGEA 5JHHB 4QPCA 1E9VA 2XOKD 4B6QA 5EIBD 1TAUA 5EJEA 3RTEA 4PZLA 2AZMA 1JR2A 4FSXA 4KLAA 3FXOA 4ZO4A 4FE7A 3IJEB 1HLGA 4F9FA 3ZDFA 2AN3A 5U4QA 1JPVA 2EDAA 3JRNA 3T06B 2BOVA 1TL8A 4EY7A 4K40A 1ULUA 5F08A 5C3EJ 1W49A 2CU7A 2XYRA 4IJVA 2WY7Q 4B7CA 4MJXA 4ZTFA 3AY0A 5A1TA 1TUBA 3VV2A 3HWRA 1NK2P 4C4XA 3R9XB 2OQIA 4U39A 4C2MJ 2QKMB 3PSHA 5HMMA 4OHOA 4BO8A 4Y1RB 5HLIA 4D0GA 4L4ZA 1CT9A 3H5LA 5B3AA 4IS2A 4AULA 4WUTA 4YJKA 2ONJA 5I3CA 2O7NA 2GILA 1NUHA 1YH3A 2HPVA 3N2LA 3ZD6A 2QVBA 4IIFA 4F8YA 2XBMA 4CEIA 4D43A 4A3SA 2WHQA 2YX1A 3LF1A 2Z33A 1ZAKA 1XZIA 2ZSEA 4BU1A 2G7UA 3GQVA 3K4NA 4IIBA 3MWFA 1H42A 3V97A 2XCUA 2JLZA 4WX9A 2NM0A 2MD5A 3G0DA 4LXQA 3ZUPA 3PNKA 2IPNA 1FS6A 3ZMDA 4U7HA 5I7HA 3WG7H 5JAPA 3B6CA 1FMTA 3TVDA 2ID3A 2C31A 2F2TA 2Q9BA 3QYJA 2HSJA 3PBKA 5HQTA 3OVMA 3PITA 1SO8A 1KK0A 2KISA 4GP6A 4E5KA 1GADO 1W93A 3DTTA 3LG2A 1MV5A 1QV9A 2R60A 1KZ6A 2ZI4A 3EUWA 3AL0B 3HA3A 3LUAA 3LVFO 4JKOA 3NW9A 3VDQA 3EPJA 1QKJA 4G8JA 2I7VA 5IZ4A 1S1CA 5AJZA 2V9KA 3ZWWA 1E7QA 4EKYA 3B36A 4XVCA 2LW7A 3OZWA 1NYTA 4FZ3A 4R3WA 3ENZA 1FYKA 5J43A 2FEWB 4HMQA 2ZU6A 3OYKA 4WZAB 2HC9A 3RREA 2G4CA 4TWIA 3OT4A 4WCDA 2F4VB 1G3UA 1TWCJ 5AKKA 4GYKA 3OLXA 1K88A 1OZ0A 4XYMA 2XV4S 4HZUA 1FJHA 1HNXB 3K05A 1UWVA 5CIYA 2JASA 3OQHA 2IGKA 4CCJA 4KCGA 4QAJA 5EUQB 3ZGNA 2OORA 2P2LA 3TKYA 1I24A 2VDUE 1W4ZA 4Y1EA 1OX4B 5LP1A 3NTQA 1MABA 1SELA 2CVFA 1BGVA 2DY0A 3EXHB 3NHYA 4TT3A 5K3SA 4KQWA 3RUDA 2HJGA 4IIEA 4RMJA 1LC3A 3E7FA 4Y9UA 3OETA 1B4DA 2P6PA 3CKLA 1BQ4A 13PKA 3EGVA 1Y1SA 5FLMJ 5FNVF 5KYUB 1LBQA 3GJ4A 2ZJ2A 3BG9A 1JPUA 1UJ2A 4DM4A 3EVCA 2BKUA 4QPPA 2HSGA 3KO8A 2IA2A 1QUFA 3M4NA 3VKHA 2H57A 2HZTA 5B66C 3BR1A 4M55A 5HHTA 2C2OA 1W75A 4KQFA 3KYCB 4ON9A 1G9SA 1KETA 1KA8A 2FY8A 3HUUA 5GADJ 3IERA 4YDSA 3WBJA 5AVWA 4IINA 2QYOA 1Y3AA 2ZRHA 4YJ2F 3CC8A 2PWZA 2Q07A 3JQCA 1WPQA 3ST7A 5H80A 3HXLA 3QTTA 1GT6A 2FXIA 4BFUA 4CMHA 3BROA 1IN7A 3ML6A 4B09A 3I2FA 4X63A 2CWWA 3RC7A 3ZQKA 5C7IO 2XMSA 3W7BA 1XD2A 2NXNB 1Z22A 1Q17A 1SCJA 4BKPA 3V42A 2VF7A 5FULA 3RIRA 3MCZA 1VGRA 3I12A 5ERIA 3OPYA 4YAKA 5JQGA 1VQ7I 1ZXXA 2XEDA 2OM2A 2I4LA 1T0BA 4MIOA 4Q03A 5ALTA 5HQ3B 4LG1A 5F9MA 3PR3A 3SWWA 1U5CA 3S2ZA 1XT6A 3C7JA 1Q7TA 1EX7A 2HKOA 3L9WA 1P31A 1SEPA 1N8TA 2PT6A 2QG6A 1P9LA 3EFOB 3KR0A 4PZCA 3O0DA 1DU6A 2EBHX 2LBPA 3PRHA 1TM7E 1U9IC 5GP1A 3RRMA 4JGGA 1QQ7A 5EVJA 4DXHA 2RBKA 3MN2A 3R5HA 4YMSA 5DV9A 4CKYA 2HT1A 4W5NA 2PMBA 4I2NA 4WCVA 5K3AA 3TOZA 3VOBA 1NK3P 2Z43A 4KNWA 5B2ZA 5FV7A 5LQRA 5CH8A 5EQFA 2ZYIA 2E5FA 1SBNE 2OCAA 3FDJA 3ML1A 3WWOA 4E5UA 2WDPA 1BYIA 4L85A 2WA2A 3EWNA 1JN0A 2OC6A 1ZITA 2IXDA 1H5QA 1QIIA 1WZEA 2BSAA 3H3JA 4IRMA 4P3OA 2M5WA 4A4DA 2PIDA 2VRWA 1A8SA 1DC5A 1F9AA 1UBEA 3PFNA 4I66A 4Q1EA 4D4JA 3B3AA 5DTJA 2P30A 4WZBE 4YN3A