2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords Cerebral protein 1
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
5KYGA 3I53A 3EVAA 4R8SA 3UJ6A 3BKXA 4DKJA 4KIGA 3M33A 4PYOA 5HIJA 5CD1A 2FYTA 5T67A 2PXAA 4PCLA 2NXNA 4PYLA 1EG2A 5E1DA 2OPBA 4E2WA 1WXXA 3C3YA 5DM2A 3B3FA 2C7RA 3FUXA 3ER8A 3FUUA 2PBFA 5DPMA 1QAOA 3KQWA 3KQPA 2P40A 1MJFA 3PB3A 4GEKA 3M6UA 1SG9A 5IH3A 3UZUA 1G38A 3HCAA 5D1NA 2QY6A 2F8LA 3EVGA 1AQIA 1SQGA 5CVVA 4O29A 4GBED 1X1AA 2WA1A 3CCFA 5LQRA 1YFJA 1Y8CA 3DR5A 3KR2A 3G5TA 1KIAA 2IDJA 3HCBA 3LBYA 1OR8A 3TMAA 1BHJA 5GWXA 5CIYA 4PWYA 4CKEA 5CCXA 4MHTA 4G56A 3HTXA 3JWGA 5FHRA 3ELDA 3Q87B 4AZVA 3NJRA 2VZ9A 3KPWA 3REOA 4EQZA 3LCCA 3SSMA 1V39A 3TM4A 4P7JA 3LKZA 4QQNA 2CWWA 3M6WA 1VP9A 3AWIA 5JUWA 2BH2A 4KW7A 4QPNA 5DLYA 2ZWVA 3DMHA 1SUSA 3C6MA 2AR0A 5E9QA 1NBIA 2YVLA 2Y1XA 1ORHA 4HRAA 5BW4A 1KR5A 1NW6A 1G55A 2AOUB 2O0LA 4RSRA 4E32A 4E70A 1VPTA 2PV0A 2UZ4A 2BR3A 3MHTA 2AN4A 2P3QA 2QRVB 2NNWB 2NXEA 2ZULA 1ZGAA 5GP1A 3P8ZA 3RODA 1BOOA 2EJUA 3IV6A 5KQSA 1QAQA 4LWOA 5HFJA 3MCZA 2GAFA 4X61A 4U7TB 1R8XA 5EHIA 3E7PA 2PXXA 3HA3A 1NW8A 4E2XA 1QYRA 5EKXA 2QRVA 2IH2A 4MWZA 2PVCA 5EMLA 1P91A 5CUQA 2JJQA 2WK1A 3BWCA 3PT9A 1P1CA 2PX8A 5K05A 1SKMA 3LDFA 3IEIA 3NDJA 5LQKA 3BUSA 5FQOA 4ER6A 1VBFA 3PX3A 4KDCA 1N2XA 2VP3A 3H2BA 2HTEA 2PX5A 2ZBRA 3SSOA 1YUBA 5DX1A 3GRYA 3KPUA 2IDKA 1NW3A 4LWPA 4PYNA 5DWQA 3EEYA 3UJCA 5KQRA 5FWAA 4M7RA 4EK9A 2AVNA 3G2PA 4GOOD 1EJ0A 3OE4A 4PYMA 2P3OA 3EGVA 4DCMA 4YV1A 3CJTA 3HCCA 2I9KA 2PLWA 3QOWA 2JHCA 1EIZA 2PKWA 5CM2Z 3OPNA 5K0LA 5HZMA 1WG8A 2R6ZA 3KR1A 1M0EA 5ICFA 3OZSA 5B1SA 3EVBA 4BLVA 4P7FA 3SM3A 2E5WA 5DTRA 8MHTA 5C0OE 3ID6C 3FYDA 2BR5A 4PGHA 3GIWA 4PIMA 3T0IA 3WSTA 4BLWA 4C05A 1QAMA 4JXJA 1FPQA 1XCLA 4BLUA 3V97A 4POOA 5DSTA 4OBWA 3UA4A 4RYLA 3K0BA 2ZIFA 3LSTA 2DULA 3THRA 4DA4A 3I5UA 3UJ8A 3DMFA 4RVGA 2DPMA 2AOUA 1G6Q1 3FPGA 3G8AA 3KKZA 4XUEA 2PY6A 3FRHA 5FWDA 4YUWA 2HV9A 4ER3A 2YUIA 1XVAA 5GOZA 2ZLBA 4AZWA 5K0BA 2C7PA 3MB5A 3HVIA 3SX0A 2IPXA 4HSGA 2B3TA 2XYQA 2QE6A 4X41A 5DT2A 5HEKA 3BZBA 1KYWA 3LDUA 4RV9A 3U81A 4RTMA 5CVEA 3BWYA 3C6KA 3AXSA 3UFBA 3EMDA 3O7WA 4RTKA 1YZ3A 2P35A 4AX8A 2AVDA 5DTQA 4FSDA 2I62A 4E2ZA 1KPGA 1TW3A 4HGZA 3NWEA 1RI2A 3KQSA 4PYQA 4GOLD 4RVFA 5E1BA 4AZTA 2P1DA 3ORHA 5T6BA 2EG5A 3NTVA 1P1BA 4ER5A 2ZZMA 3BWMA 4M36A 5ICCA 2AOTB 4F84A 3KPVA 4E30A 4KRGA 1M6YA 1G8AA 5DTMA 1L3CA 5EZSA 1L9KA 4FT4A 4P7GA 3RIEA 5ICEA 5IKMA 5K09A 3OU2A 1I4WA 2OB1A 3HVJA 4GC5A 4IV0A 1QANA 3FRIA 3GNLA 3NDIA 5D1HA 4H0NA 3FPEA 4PIPA 5EMJA 3TM5A 4PNEA 5JR3A 2YR0A 3GWZA 5DSXA 3CVOA 5EVJA 5H02A 2PGXA 3GRRA 5E1MA 2FK8A 4L7VA 4QDJA 4FR0A 3DULA 2IBSA 1ZGJA 1YZHA 4RTJA 3L8DA 1RI5A 4GQBA 3GXOA 3CKKA 3TRKA 4CTKA 2YXLA 2FK7A 3G2QA 3IHTA 3P9CA 5K0GA 2AN5A 3V8VA 3D2LA 2OZVA 3B3GA 3I9FA 5FTWA 2VDWA 4YMGA 2YTZA 3OCJA 4FGZA 4XUDA 5ERGB 2HNKA 1KPHA 3B89A 4A6EA 1KYZA 3FUTA 2ZVJA 3A25A 1DUSA 1N7JA 4MIKA 4FP9A 1AV6A 3THSA 4CXMA 1JTFA 1T43A 3QV2A 3DOUA 1BKYA 3E23A 5LQAA 5DX8A 1R6AA 2YXDA 3G2MA 4Y2HA 4B17A 3OZTA 4E31A 3EPPA 3PFHA 3HVKA 3P9NA 3SXJA 1MHTA 3PVCA 1JQEA 1B42A 3FPHA 3C3PA 4OQEA 3TPZA 3CBGA 2AN3A 3EVEA 4C03A 3LPMA 1HNNA 5F2KA 1RI1A 3JWIA 3Q7EA 4F86A 3K6RA 2ZCJA 2OY0A 3I58A 1R8YA 4AZSA 3SR4A 3SSNA 2OBFA 3KPJA 1FJXA 3CC8A 2IBTA 2NXJA 2OO3A 2BM9A 2HWKA 2XVMA 2ZBPA 3M6XA 4YMHA 5DRYA 1X1BA 2ZFUA 3MTEA 3EVFA 5DXJA 4A6DA 5BP7A 1D2CA 2B2CA 2V74B 2ZZKA 1FP2A 3EVCA 1ZHFA 4C4AA 5LR6A 3GRZA 3LX6A 1NT2A 2EJTA 3P2KA 3GJYA 3R6TA 4IWNA 4BP1A 3A7EA 2AZTA 2PXCA 1XDUA 2ZWAA 2N47A 1XDZA 3KQMA 2NP7A 2AOXA 3EGIA 3G88A 5CVDA 5GM1A 3ME5A 1EJ6A 1XDSA 2NP6A 2BZGA 4RTRA 5KVAA 3TLJA 3BT7A 4GOND 1NV8A 2AS0A 4QQKA 5C9ZA 4QPPA 3GRVA 5DM1A 5HIIA 3M6VA 2G8NA 3SMQA 3HA5A 4X60A 1SQFA 2VS1A 5GM2A 2P7IA 4E2YA 2NXCA 3GCZA 1NV9A 5EGSA 4GOMD 2H00A 2Z6QA 3MQ2A 3NVKI 4PCAA 1L1EA 4P7KA 4ER7A 2B25A 4M38A 4F85A 3FPJA 3VC1A 3EMBA 1R74A 3P2EA 4WXHA 1O9HA 3P9KA 4BP3A 4HTFA 5LSAA 1XTPA 3P71T 1NW5A 3O4FA 5MHTA 2G70A 1UFKA 3G2OA 5EEGA 2JH8A 1JG2A 4FS8A 1P39A 4PONA 4DF3A 4RTLA 2YXEA 3HVHA 3UA3A 5BW5A 4PYJA 1L3IA 4QTUB 2CL5A 4RTOA 3TKAA 3UBTA 4U7PB 3LKDA 4YUVA 5CVUA 1H1DA 2IFTA 5CVJA 2HR1A 2Z6UA 3LCUA 5HILA 3IYLW 3X0DA 2PX4A 4MTLA 5EKUA 4C07A 4QVGA 5FUBA 3TFWA 5C1IA 2G1PA 2G72A 2P41A 3DLCA 2ESRA 3FTCA 4R6XA 3KQTA 4RTPA 3G8BA 3LL7A 4ATNA 4QTTB 1EQAA 5CCBA 1D2HA 4DQ0A 2XYVA 2HMYB 3UJBA 1DCTA 4HGYA 5KS2A 2O06A 4LG1A 1WY7A 3A7DA 3G89A 3HCDA 3NMUF 1KP9A 3P2IA 4EMSA 5K0EA 5M5BA 1Q0SA 2GA9A 2ERCA 3BXOA 3GGDA 4RVHA 4V0RA 1JSXA 2GH1A 3F4KA 4WVLA 2CMGA 10MHA 2XBMA 3M4XA 1YFLA 5E1OA 4KDRA 5FCDA 5E2AA 4V0QA 2P3LA 2ONZA 5EMKA 2G71A 2OXTA 1RJFA 3DLIA 4OX9Y 1XXLA 5BXYA 3KQVA 1F38A 3BKWA 1KPIA 3QOXA 4PYIA 1ZKDA 3UJAA 1QZZA 2KW5A 1O9GA 4YUYA 3EEOA 1O54A 2GB4A 5K8VA 5DM4A 5EPEA 1NW7A 3OFKA 1AF7A 2FHPA 3HCEA 3R9XB 1JG4A 3OFJA 4YV0A 3ER9A 2ZW9A 5DX0A 1UWVA 2OKCA 2CMHA 3LDGA 1IM8A 4AUKA 1NBHA 3PFGA 5HIKA 3C0KA 4FSXA 1VP3A 3UWPA 1X19A 2BR4A 5K0JA 5K03A 1YB2A 2A14A 2GPYA 4IV8A 2ZIEA 3AJDA 3HM2A 5EIFA 1SVUA 3OZRA 5G02A 3FUWA 1KHHA 1TW2A 1INLA 1XCJA 1I1NA 2B9EA 3E05A 3KPYA 4HH4A 3HP7A 4E33A 5GIPE 3ELWA 2AOVA 5ICGA 5EIWA 3LBFA 1Q0TA 5EC8A 1F3LA 3T7SA 3OE5A 2FPOA 1JQ3A 2IH4A 5FADA 2R3SA 2NYUA 2PSSA 1VE3A 3EVZA 3HEMA 2EX4A 2C7QA 4XUCA 1JQDA 4CWAA 1D2GA 5EHGA 3A27A 5FHQA 3P97A 3B7PA 1VLMA 3HCFA 3GO4A 1RJEA 2YX1A 1FBNA 2Q41A 2IIPA 1WXWA 3NWBA 4C08A 2PJDA 3MAGA 2ZBQA 2IGTA 2V7EA 3O31A 3GRUA 2UYHA 4YUXA 2Z6AA 3R0QA 2AOWA 3MERA 1R18A 2ZSUA 3UJ7A 2UYCA 4YV2A 4RVDA 1YF3A 1ORIA 4CTJA 2LD4A 3BWBA 2JH9A 3G7UA 3BGVA 3JWJA 5HOQA 2ONYA 3GDHA 4R05A 1JG1A 1FP1D 1VL5A 3ELYA 3RW9A 3LGAA 3SGLA 2GLUA 4R8RA 2H1RA 3PTAA 1AQJA 4PGGA 1PJZA 1ZQ9A 5T64A 3A4TA 4X1OA 3T7RA 2JHAA 3KU1A 3P9IA 4MQ4A 4XCXA 1RJDA 5E2BA 4OQDA 3PLAE 3TKYA 1TPYA 4RTQA 4X63A 1IXKA 5EEHA 3VC2A 4OA8A 4EVIA 1PRYA 1L3BA 3KHKA 3KQOA 4P58A 5E9WA 1WZNA 2FCAA 2ZIGA 3AXTA 2Y1WA 5E9JA 3S68A 3BGDA 3HNRA 3TQSA 4FZVA 4DCGA 4HG2A 1JR4A 2O05A 3UJ9A 3FUVA 5LQNA 1JTEA 4RTNA 3EVDA 4Y30A 3MGGA 2PWPA 5K0NA 3CJRA 5F2NA 4C04A 2P8JA 4DM3A 1X1DA 4PYKA 4KWCA 4NECA 1VQ1A 3JWHA 2AOTA 1KXZA 4EKGA 1M6EX 5FA8A 2BM8A 3E8SA 3KQQA 4DZRA 4BY9E 4OA5A 5GINE 2ADMA 1WS6A 3MTIA 3TR6A 3AY0A 5K0FA 4PINA 4KVZA 3HA7A 5F2OA 3CJQA 2XYRA 1JG3A 2IH5A 3FTFA 3EGEA 3ERCA 1R00A 1RI3A 3DTNA 2CKDA 1BC5A 4UOEA 5LQUA 1U2ZA 4QDKA 3LHDA 4R6WA 3VYWA 5K0CA 5DRTA 5E8JA 2FRXA 2C7OA 3FTEA 3NW9A 5EG5A 3FPFA 3KR0A 3KQYA 5DXAA 3DH0A 2JHPA 2WA2A 3UJDA 4GF5A 2UYQA 2H11A 4RTSA 3R24A 4IKPA 2K4MA 3DXZA 1G8SA 3BGIA 3KR9A 3G5LA 4QVKA 4C06A 2VDVE 3DXXA 2ORED 4FT2A 5FULA 7MHTA 3SVZA 4DMGA 1EAMA 4Z2YA 1IY9A 3I64A 1I9GA 3GU3A 3M70A 4YUZA 5GIOE 5EQJB 2PX2A 1Z3CA 2IP2A 1NE2A 3PS9A 3FTDA 3R3HA 4CKBA 2PWYA 3DUWA 4CKCA 1XJ5A 1G60A 2XVAA 3DP7A 2PT6A 3ELUA 2O57A 2I6GA 5LQJA 4HC4A 1HMYA 2YQZA 3ANXA 5HIMA 1DL5A 5LQCA 5E8RA 5EOVA 5K01A 2ZZNA 1RI4A 3PX2A 2B78A 2EFJA 1X1CA 3OU7A 4HTFB 2VDUE 2QYOA 4K6MA 4KIFA 5U4XA 2QM3A 1ZG3A 4GUAA 4LECA 5EZQA 3T7TA 5EMMA 2OYRA 1JSZA 2UYOA 2ZTHA 4OBXA 4ISCA 1RJGA 4RWZA 3LECA 3TOSA 4EKIA 1UIRA 1SUIA 2I7CA 2O07A 2OB2A 3MCTA 3DXYA 5DM0A 4ZTBA 1N7IA 5FQNA 3VSEA 3FYCA 3FZGA 4M37A 5FA5A 3A26A 3B5IA 4ER0A 3DMGA 3LCVB 2PT9A 3NVMB 3OU6A 2GS9A 4RX1A 3B3JA 2JG3A 5P8WA 3CGGA 9MHTA 4GC9A 1NKVA 1VIDA 2P7HA
chains in the Genus database with same CATH superfamily
4REQB 1YJ9I 1VCOA 3I3SR 3GTPJ 2WKSA 1XRLA 5IX8A 5E4TA 3R75A 3PVSA 4JDUA 4RH3A 4JVMA 2DDAA 3L2QA 1JAXA 1L7EA 3LDAA 3M6IA 5KQMA 1FMJA 4YJ2B 4CIWA 2NUTA 2FWPA 3W3AD 3OPYI 1MPTA 4R2LA 1P3Y1 5D5HA 1O7FA 2DI3A 2OPBA 1FXWF 1OAKA 2XE7A 2M6KA 3ZJYA 3FUXA 1SFKA 3GWGA 4XSHA 1F8UA 3V7NA 1U0TA 1IBLB 4UVEA 5T57A 4QRIA 5I7HA 2HYIC 2W6NA 4EEZA 3UZUA 4ERXA 3A31A 4UV9A 1T2DA 5SV2A 4TT3D 1MDMA 3HL4A 2JCXA 5FNVA 5A6SA 2BRUA 1ORRA 3FW1A 3GLLA 2DA1A 4P3XA 1VBNA 3K9TA 3G0BA 1EDZA 3RSOA 2CXUA 5TMDA 4NJMA 4RKEA 3LAJA 1EP1B 4HAVA 1TJ4A 4EATA 3IVAA 2JAQA 2I4OA 4IIBA 1TM4E 4P4SA 5LBIA 3W4JA 4ZZLA 2ECFA 4WLUA 2I2DA 3RTBA 3WG7H 4MPDA 4WASA 1NVAA 1NF3A 1MJ9A 2QF7A 1JZQA 3OMWA 5LMZA 4ITRC 4Y3OA 1R8JA 1M74A 3C1UA 3PNKA 2E5ZA 1Y6JA 3D6UA 4TV9F 4P81A 5EWMA 3K1MA 4DRYA 4EHJA 2H9YA 2CWWA 2QMYA 2V3WA 4EG6A 3HDDA 3D1VA 2JFOA 1HTWA 1UJ4A 1U9JA 1EV7A 1LJUA 1OU0A 2NS0A 2QRPA 3FVRA 4UHCA 2L42A 4G07A 2H48A 5BN4A 2I8AA 2BE7A 2WVHA 4DA9A 4B8ZA 1NW6A 1W0UA 3HFGA 3DVQX 3MS2A 4XVCA 4JGBA 5AW8A 5E3MA 1KAHA 4S0HB 1AN0A 5DK6A 2V7QA 2VTDA 1JIKA 1XMKA 3UR3C 1FA9A 2BP7B 3EQZA 4FPXA 1YFKA 2O6LA 4L57A 5AW7A 1GQ2A 2REQB 2ZULA 2ZETA 4M9ZA 3AKDA 3PV0A 4PSCA 3EDCA 3HN2A 1M2HA 4J0EA 4MKFA 4ZDWA 1QAQA 4XWTA 5L3SA 2I33A 1WXQA 1IXYA 1Q84A 3L6UA 3LSHA 4YRNA 3HZHA 2B3DA 4HFMA 4MUMA 3PO3J 3B38A 4L95C 5HNFA 1ADYA 4YP1A 3QKUA 2W6PA 3QU7A 2ZBFA 3SCZA 4L18B 2FE4A 1DDNA 3AF0A 1NKSA 4DBZA 1DWOA 4W7IA 1R7RA 1ZIOA 2LG4A 3QQ5A 1M2WA 2PNFA 3PT9A 5TPWB 5K05A 1GV0A 3L3BA 4XGRA 4Y2YA 4FLMA 1F8GA 2BI8A 2CBGA 4NMMA 1BA2A 1H9AA 2WP8J 5AKXA 1P72A 1NSFA 4YH1A 4U8HA 5FJJA 1QRUA 1KJ8A 2VF2A 2OVFA 3M8JA 4QGAA 1Y1SA 2VF7A 4WLFA 4L8WB 1HOMA 4Z9BA 3LOUA 4WXMA 3O0TA 1M8PA 2YRXA 3HMKA 1G5QA 4WACA 3W8RA 4HH3C 5DYGA 3UJCA 5BUZA 1OGIA 1EFUA 2BUCA 1T6BY 3I2IA 4M7RA 4N01A 4Q1VA 3W06A 4LWZA 4OXKA 4AN1A 4H17A 3EF0A 1M2VA 4GM0A 5EF6A 4ZZ0A 1OI2A 4XLPF 1OLUB 2WSYB 2PLWA 4MKRA 4OQMA 5BV8A 1U9NA 2VZLA 2JLCA 1TZMA 1IC6A 3MIZA 5DYWA 5K0LA 1ZARA 5GMOA 1WLSA 3FOCA 4UXIA 1OE0A 1ECFA 2MYNA 4DWOA 1ZK3A 3BDIA 4ZK2A 5CFOA 3BULA 2J5RA 4R68A 4LF4B 1HSTA 2UXNA 1KI1A 1UIMA 4MGZR 3QPAA 3V2GA 3SYKA 4F1KA 3DYIA 3QELB 3QLVA 4CCYB 3S27A 5HKOA 3S32A 1WJGA 4JP1A 3N8KA 4BLUA 5LL6P 1ESMA 4C9YA 1XZNA 3A4VA 1ZN8A 2P67A 3IPAA 3UA4A 4AJJA 4B4VA 2UXBB 5ALWA 2BSXA 3JQAA 4IGEA 4R7TA 2H5IA 5BWLA 1T2NA 3RYCA 3EPKA 5A5EA 4BMDA 4HKTA 4IQFA 1XWWA 2YNMA 3H1TA 1W0CA 3O4HA 4S2UA 4D5EA 5KKAA 2HW8A 3RSQA 3PSAA 4G5HA 3CBQA 4F04A 5IWAB 2APJA 3LUPA 4EG5A 1WEKA 4KU4A 1VYHA 4FE7A 2I3GA 4HQEA 1JKIA 2IPXA 2FEMA 1DJNA 5DD4A 1QWOA 4FTWA 4Q3LA 3HABA 1VMAA 1OI3A 1PZEA 1UPBA 2OV7A 2BEVA 4XSXF 3KYCB 2GTIA 2O2IA 2XITA 2IQ5A 2HDHA 4IOAF 3GLHE 1E32A 4RV9A 3MWJA 3AYZB 3QMMA 3FX3A 5DCMB 4M8KA 2BTQA 2JCYA 4NX2A 5FI3A 3UFBA 4BPBA 3MBKA 1OYWA 1S9HA 2QRMA 2OP0A 2O8CA 2VRBA 5D5QA 1B8UA 4U63A 1J8DA 2B98A 2KIQA 3I9LA 3LO8A 4RVFA 2FUG1 3NAUA 2D2FA 4M3FA 1PNVA 3JPYA 1KYXA 3W3CA 2G7MC 2JGEA 3N8HA 4LHZA 4MR7A 3OKPA 3K0CA 4P31A 5ICCA 3OCYA 3RFUA 4F84A 4E30A 1TD9A 5E4FA 2GLOA 3QU4A 3RRXA 5F4BA 2HWVA 3V4VB 3IV9A 3HPQA 3QFHA 3MGKA 4BEJA 4I50F 2JLVA 4PFPA 1U81A 1WKVA 4KX5A 3FRIA 3GTGJ 5D1HA 4KTTE 4YIIA 2E36A 3E9NA 1V41E 2WR8A 3F6YA 4ZV9A 1ENOA 2J6HA 4E21A 1II8A 3WA6A 5DYNA 5LVAA 1YVEI 4CA0A 4HVTA 1U8TA 2ZP1A 2IOHA 1YOVB 1ITZA 1ZZEA 1HKSA 4RTJA 3Q7QA 4RSHA 1WV1A 1NZJA 3CZ5A 3EWNA 4YMSA 4II3A 1DBPA 2ECBA 2CD9A 2R5WA 3AIOA 2UZ3A 3ZCPA 1K8XB 3ENNA 3FSJX 2OWDA 4PO3X 2DWOA 3LA6A 3MWGA 2CUJA 2CNWA 1KWKA 2XNKA 1N75A 1TA0A 2B7BA 5A7FA 1Z3XA 5HDQA 1E3MA 4E51A 1R2QA 3TNJA 4QELA 2QDXA 1WUTA 1HZJA 2CUTA 4J16A 1AV6A 4KWHA 3WP1B 4H3SA 4Z86A 4NH0A 9ABPA 4Y2HA 1JWLA 3SFZA 1PUIA 2IVMA 1Z4MA 4C2AA 3LSMA 1BWQA 1K7XB 1L7VC 4LJ7A 1GFIA 4M1MA 5DWVA 4S1WA 5HQ3A 5L3FA 1S5LC 1SXJB 4MSUA 4BFWA 3N75A 3WRXC 1T2AA 1XU7A 2W2NA 3PQ5A 4FKMA 4I5IA 5KSPA 2ZYTX 3F74A 3OZCA 3BCRA 3KPJA 4C3HJ 4E4RA 2NXJA 4XRMA 2X5NA 3KT8A 3WLRA 5FI5A 5G0SA 1S4QA 3HSEA 3RG2A 4AVPA 5IJWA 2FSVA 3TP3A 4ZTJA 3HRSA 4M53A 4PANA 1TIBA 2RE8A 4B5LA 1EUQA 5LD2C 4J0FA 2DCEA 1I3MA 1D8AA 2HA7A 1AKMA 4Q37A 3R6TA 1I13A 1UM9B 2XADA 4BP1A 2RFLA 4TYYA 2V6FA 2NP7A 4LQCA 1QOZA 4OAQA 3ME5A 1EJ6A 4ESBA 5FKNA 3IUOA 2MSNA 1K83J 3MMNA 1C9YA 3GUYA 4P08A 2ZJOA 1X2MA 4ILEA 4KCGA 1NV8A 2Y2ZA 2CQ7A 4HV5A 1JHUA 1XXHB 2VXBA 2AS0A 1NR1A 2MYTA 1BH6A 4BDTA 2HGSA 4IEFB 4J4TA 1VLLA 3TSOA 1PQYA 2OC9A 2YL2A 3VU9A 3VTZA 4RB0A 1RYHA 3WSVA 3HXMA 3I01M 3L7OA 4OYHA 4YMWA 2PLFA 3WIBA 3KETA 1C1YA 1QUEA 1S9DA 1KH3A 3DPSA 1ZNZA 3NO4A 1IRXA 3OQ6A 4KIUA 2Q6TA 5TMEA 1MUUA 1C9EA 1V9CA 2LVBA 4KDPA 1OKRA 3HY3A 2OD2A 1RQXA 4L75A 4JC8A 4Q82A 5EQDA 1WBJB 2IWRA 3JW8A 4ENVA 1PEYA 2RJNA 1DCKA 4DREA 1B8IA 1KC3A 2JAPA 4Q4JA 1X7HA 3MT9A 1AMNA 1Q3TA 3STHA 3JD4A 2I29A 1E1CB 1NW5A 1U80A 1OC4A 1ML4A 4EW6A 2QNIA 3EDOA 3TMKA 3B82A 4Y15A 1J75A 1MN6A 1JB9A 2GCGA 1JKPC 2INGX 2YOGA 3EJ6A 1PQ4A 3MTGA 1STOA 1VMEA 3QJYA 4TV8B 5KINB 3HVHA 3N2GB 5JS1A 4NYMQ 1TQIA 1Y7LA 5A5GA 3U19A 1TEZA 4U7PB 3CDHA 5BPIA 3DE7X 3QGMA 3W5SA 3HB5X 1RPTA 3T5CA 3CNBA 5K0ZA 1Z6AA 2AFIB 3VNQA 1OX4B 2G72A 1LKZA 3LCJA 5I9SA 1ZH6A 1NI3A 2JSPA 4NXNB 1MENA 3AQIA 2E19A 2C3OA 5CCBA 1EQAA 1PZNA 2VDJA 2X2EA 2I3BA 3LWFA 1D2HA 3OR2C 1EFPA 3KKNA 3UAZA 4DQ0A 4DJAA 1J8QA 4DL9A 2NAZA 1AGRA 2O4UX 2V6BA 4CM9A 2HUNA 5DHAA 2YWFA 1JEJA 4O4JA 3UMVA 5JI3E 1A76A 4G85A 1KGSA 1TM2A 3OL4A 1IJFA 1ZGGA 2A30A 4UNQA 3V4LA 2VUSA 2GH1A 2CMGA 2NAFA 5FUXA 4LBWA 4HFNA 3I42A 2D2EA 2VLIA 3OTGA 1YFLA 2A3SA 3QUQA 2WTUA 5E79C 2YU3A 3ERMA 2IIVA 3DF9A 1A9PA 1XXLA 4TMKA 3NFYA 4M0UA 1FW8A 1YKFA 1YL5A 9ATCA 2FGKA 2WKWA 5DLDA 3REQB 4BVLA 3CJQB 4INZA 3RC7A 5HLIA 5C2JB 1N5DA 1SO8A 4Q9AA 2FHPA 1B15A 2RGDA 4ZOQI 5EZHA 1QYXA 1FVHA 4UVHA 3FHTA 5KAFC 4X93A 1NOKA 5AVQA 3ANMA 5I4CA 3DPTA 4CZCA 3TFQA 1NG6A 1T33A 1A6QA 4QM7A 2QLMA 1D2EA 2SHKA 3F5DA 3QTTA 2H1LA 1Q0RA 2Q4EA 5CR9A 3TSCA 5F23A 1J7KA 2H29A 4LGMA 4MGKR 5E9AA 2OHXA 6ADHA 4I4TA 4KI0A 2JZNA 4ROSA 1E2XA 3A6GA 1NXQA 2G08A 2K3FA 1RM4A 2ODNA 2QVCA 2NYXA 1CT9A 1NQVA 2F6RA 2EFYA 4N3CA 2WTAA 1B4AA 2ILTA 3EARA 2CV1A 2ELHA 1QYIA 3HACA 1XEWY 2AOVA 3PXAA 4A69C 3COSA 4RD2A 4DV6B 1IN1A 3MNFA 4IICA 1TNTA 1EVLA 2BGIA 1TMYA 4KO3S 2P5LC 4OJYA 1AHNA 2OCBA 2XUAA 3TSAA 3CESA 2PD6A 1JQ3A 1IN7A 4HX4A 1PV1A 3EY4A 3R3SA 1C1XA 2Z9BA 4R1MA 1D1BA 4Y6QA 5IUKC 3ZE8A 4M98A 5FYDA 3WWCA 2PSEA 4B5KA 4DM4A 1FNCA 1R88A 3ENWA 1IB6A 4C2UA 1CR4A 4K9MA 5KAMA 4KICA 1HK7A 4FCTA 2GRAA 3LW7A 3D3WB 3EEIA 4KXUA 4C4SA 3OZDA 4EG4A 1JQBA 2Z1NA 3C4JA 4X66B 4CYDA 3FZQA 1T4BA 1EQ2A 2VE9A 1F1BA 1II8B 2B35A 4KLCA 2O8DA 2OCEA 1Y7PA 3BMCB 1CY0A 1WUKS 2EZLA 1ISGA 3OOEA 1FYXA 3S5JA 3UJ7A 4B6PA 5LWQA 1GNQA 3DQVC 1J2UA 3V7CA 4OIPF 1FY7A 4BQAA 1CR1A 2XRFA 3BE6A 3O83A 4O0MA 4DLNA 2WYUA 3AKZA 2A9OA 4G2TA 4LRQA 4M6WA 5TY0A 1SUFA 2QPOA 1MXHA 3WGYA 5CITA 5IDQA 1LKXA 3WTVC 4AJIA 4A92A 5FROA 2FFJA 2HU5A 2P30A 2WIGA 4OXXA 5A06A 3TKYA 3IEKA 2XEXA 1UG2A 2AMVA 3LPAA 3MJEA 4X63A 3SJ7A 2REBA 3SOZA 4NCBA 1Z21A 2I78A 5T5QA 2WU1A 4LSWA 2DLDA 3GJ4A 3H11B 2Y31A 1ZW1A 1G3QA 4BJ1A 5E9WA 4F0JA 4Z7QB 3CXRA 3G17A 5DCMA 3DDNA 5DBIA 5TB5A 3EPLA 2IEDA 2V6CA 5FF9A 1FOWA 1W29A 2A1TS 4PLTA 3S2GA 1JTEA 2QRLA 3C45A 4R16A 4Y30A 3HI6A 4CMCA 4HT3B 3RHSA 3H1GA 4QAJA 1CZNA 5LRSA 2F1RA 1FFXA 2W58A 4JVNA 4TOIA 2QL6A 2X6XA 4G6DA 4LW8A 3MSCA 3KOZA 4Y6SA 4ARAA 1WKBA 3UKJA 3BY6A 2Z95A 1K2WA 4F8EA 4I6JA 1XGNA 3L0SA 4J2HA 4MGYR 3VR3D 4JJKA 1URPA 3ULQB 3KQQA 3NHJA 1C2YA 1AU9A 5EI5A 1A3CA 4LXQA 4FW8A 1BXGA 1JR3E 1R64A 1DSSG 2H0AA 2QTGA 4A3DJ 1VZ0A 4PINA 4RNDB 2VC1A 3BIWA 1MIHA 4B3SB 1KI3A 2Z43A 4IYRA 3W6PA 2CKDA 2WG2A 3WGOA 3ADKA 4HRXA 5LQUA 2IW5A 4ZYHA 2XMZA 3LHDA 2M6SA 4AYBA 4KXWA 5FL7D 1JBKA 4GPBA 4PDKA 4A8HA 4EP1A 3OCVA 1EVYA 2HF8A 4JX9A 1VKJA 5JPIA 3T5XA 4K6FA 3DH0A 2RB4A 3FLMA 4DBLE 1BKSB 1EBFA 2OAGA 6PFKA 1A2QA 1GILA 1JSRA 1KJWA 3H19A 1CQXA 1JEYB 5EZ5A 3FNQA 1EA3A 4QVKA 4PFOA 3CZCA 3G5LA 4OJNA 4RHUA 1MV5A 3WDLA 2COUA 2XRNA 2JJ2A 4EPWA 1K75A 1Z82A 4O2LA 4RD6A 4XD7A 2DJNA 2W84A 2DODA 1PT8A 3AT1A 3HG7A 4I6GA 3D8HA 2HIGA 3TDUC 4TGLA 2WRZA 4DM7A 4AS3A 1R15A 1U7HA 3PNTA 1YE3A 1KORA 3M6MD 4RK7A 1NP3A 1DXYA 1N5MA 5FOTA 4LIVA 1ODFA 1TYDE 2GVNA 4MRSA 2PT6A 1B8PA 1VCNA 2I9PA 3LE8A 3RJZA 5CGQB 4CN8A 5M3BA 3VVCA 4C0WA 4L9RA 1DL5A 3ISPA 1OW3B 1EX9A 1YA4A 4IKEA 1R4NB 4NZ9A 5TT1A 3PUKA 3TGNA 5L53A 1R5GA 4HYTA 5LQCA 1FEXA 1FFDA 1LJ8A 2GN1A 2QYOA 4I7HA 2GR9A 2VDUE 1E5VA 4M8SA 4X7PA 1Y42X 2MLKA 1DOHA 1X15A 4OUDA 3USES 4CCAA 5B30A 2EV9A 3OJFA 5AFSA 1WTAA 2GAAA 3E6MA 4QXAA 2WM2A 2AMJA 1NBAA 1Y0UA 4NHEA 5F73A 2XQKA 3CMYA 2YHBA 5ENVA 2B99A 1EB8A 4BC1A 1O08A 3H5TA 5EDNA 4B0OA 3W6OA 3A3OA 1UIRA 4CKWB 3IKVA 1GTSA 3QEKA 3TZ6A 3EZ2A 5I7EA 5K99A 4F91B 3FYCA 3CCYA 3M07A 3BG7A 1VKZA 4QYXA 4PC7A 2UVDA 5CLSA 4R3UC 1I7DA 2C8LA 1PR5A 3PPWA 3SG0A 3F8SA 4IDBA 2F3RA 4MLCA 5KYNA 2Z5UA 2P7HA 3HYRA 1L5HB 4IL5A 4M8NE 4FQ8A 4QOEA 1K79A 5HDGA 3GTLJ 3B6KA 3DQZA 4XCVA 4PPNA 2X15A 5DGHA 3TWOA 4A10A 4Z51A 5KMGB 1P2BA 3TOBA 1Z0XA 1BXGB 4WLEA 5EPUA 3RVBA 3Q5FA 4RPIA 7GPBA 2OOSA 1UODA 2J9FB 3AI1A 3DPIA 3MUNA 3PC7A 2GJ8A 3S1AA 1P5ZB 2EFCB 4FKZA 4E2WA 4DV2B 4KRFA 4MULA 2VXCA 3ANLA 2RARA 3JYOA 4E5PA 3GMTA 5CIQA 4E94A 1RPNA 2PZGA 4RIEA 3DQPA 3MYYA 4ME6A 4S12A 3VHLB 4C87A 2IX3A 1CZLA 4YAGA 1X7XB 2QY6A 4EI9A 2C7GA 4HUJA 1E3LA 2VUTA 1FDUA 3L1KA 5TX7A 1O5TA 1YQWA 2J3MA 1XTKA 1YDEA 2HH9A 2CNBA 3BHNA 3GCDA 2OCCH 3P4UA 4DMRA 3ETNA 3ZBQA 3OQNA 1DGWY 3LQKA 5JIBA 2Y1EA 3O90A 1VL2A 3NWTA 1VQ7I 2B8WA 2WJZB 3HU5A 3OIOA 1Z38A 3HVUA 4Q1AA 5F3WB 4YGYA 4NK5A 3OPYB 4O2BF 4C2BA 1R66A 3QWIA 3X1ZA 1DJPA 2QN9A 5D8DA 3EX7C 1ZIDA 4OHFA 3L6OO 3HJBA 4H0CA 1SQ5A 2LDBA 4MAAA 4YLEA 2HQOA 4WN3A 5KYXB 3B36A 1RYBA 3IHUA 2XDQB 3M6LA 4BWFB 1VKNA 3LKZA 4WFJA 2PN6A 3MFKA 1HKQA 2CLOB 2VYCA 3I0NA 4NQZA 3R7NA 4ARZA 1GPWB 4QPNA 4CF5A 5AJUA 2BH2A 4RGXA 1L5SA 3PFCA 4PRLA 2XB9A 4P4GA 3G6WA 3MMPA 1LPAB 1PS8A 4N9WA 2QJTA 5E7MA 1LE8A 3BRSA 3CCCA 3MWYW 2DVMA 4WK0B 3B6MA 4K0RA 4YHBA 4DMKA 1F9AA 2UZAA 3VR6A 1SUCA 4BTLA 4E1VA 1K6XA 2HJGA 2QRVB 2Y8EA 4NYMR 1G20A 5MGBA 4OHXA 4MICA 5BR7A 1V0JA 1UJ8A 1J5YA 1MLDA 1SBHA 3HKBB 5GP1A 4B3GA 1BOOA 1HM5A 2V3VA 2OZEA 1W34A 3AVQA 4IVPA 5IJ0B 5B66C 4NDLA 1MMSA 5ICMA 4RKRA 1ENYA 3T34A 2VN8A 2RIRA 3ZLJA 4Z8XA 4E6PA 1H0MA 3ZD7A 2NU7A 1MQ8B 1ENHA 2G4VA 2LCFA 3CNQS 5L51A 3MVPA 5CUQA 1U65A 2XI4A 3H2ZA 4G94A 1VHTA 5JJCA 3DL4A 1OYIA 4LBYA 1TMKA 2L4MA 4BYGA 4KEAA 4QYIA 2HGZA 3BUSA 5LQKA 1K6YA 1VBFA 4U7GA 2HF2A 3FIJA 3RJMA 1XU9A 1E3SA 3DHEA 1T8RA 4N47A 5HRAA 2WAQN 4D7NA 3WIEA 2IYTA 4M0KA 3ZNOA 1PAUA 4AIIA 3KZMA 3K1ZA 1ZBDA 3LC2O 3HDHA 3W78A 4MVJA 2PDAA 2EERA 1Q7EA 2O9JA 3NYWA 4AO8A 1W36D 1VB3A 1EDEA 1P0FA 5L3CA 3CJTA 4LHYA 4ES6A 2CF5A 1EXWA 4PG8A 5HW0A 3K1TA 2JHCA 2VHEA 4ZJUA 1XJCA 4WCFC 3J7TA 6LDHA 5HZMA 4K05A 1AKNA 2ZNYA 2XMQA 4L28A 4DIDA 3QLUA 5ICFA 4CCKA 1G5HA 1KETA 4MEBA 3IIIA 2LP4Y 3UEOA 4BJHB 3SM3A 5BYBA 1S6LA 5JTTA 2WAXA 1V47A 4HAXA 3T0IA 4UQOA 5HQJA 5CCEA 1D5CA 1I39A 1A2OA 1LVKA 2BEOA 2LOOA 4CGZA 1JPJA 1YR1A 2D4AA 1H9GA 2B4KA 3V97A 2JL1A 4RSGA 4IFEA 1CUJA 1R37A 2IXBA 2P9EA 4UVIA 3WIOA 3ZI7A 4JT9A 2VLBA 4C4OA 4D0NA 1ZJJA 5DCUA 3PT5A 5FV7A 2OQVA 4EF5A 4MWSA 4TV9A 4ZJYA 2C8KA 3R6GA 3U9GA 4PU0A 4DHEA 1JE8A 3CVYA 1AA6A 3FPGA 1GWNA 3WGTA 5LYJB 3IEPA 4FNAA 2BTEA 3KB8A 2YUIA 4RQUA 4C22A 2C7PA 2QSGX 2OTCA 4QYWA 2XY4A 3CMEI 3MB5A 3QYJA 5ARBA 5C8YB 3SX0A 2CHUA 1KONA 1MC4A 3C3CA 4IZ6A 1H8HD 2ZRKA 4FMDF 1R5OA 2D0PB 5K4GA 3N1UA 4JBAA 1PGNA 1US8A 3MBIA 5INTA 1IXRC 4QBHA 1T13A 4Q4HA 4GEGA 4PG5A 2VPRA 1OX4A 5E3OA 1Z28A 4N0PA 4Z0HO 2ZXUA 4BEHB 4GDMA 4WN9A 4UB6C 4N3AA 1K0UA 3FNGA 3P9ZA 3KEOA 5C44J 1V7PC 1XR3A 2GQ0A 3A9CA 1SCNE 2G1UA 2ZRFA 1ZH4A 3N59A 4RJJA 2DDBA 3ORRA 3GFBA 3HOYJ 3I72A 5FWXA 3TTWA 4M46A 4H3VA 2DTEA 3FGOA 4CT4B 3ADDA 2BGJA 2SCUA 2GF0A 1KXJA 2H09A 3Q0TA 1TCUA 1ZELA 3IPRA 1RACA 4L4ZA 3W2HA 3IAXA 2GJAA 4D9MA 4D9BA 1OMOA 3DEWA 1I4WA 3PXUA 4GC5A 4P35A 3UV3A 3IP7A 1YONA 1Z5WA 3ZR4B 4IXDA 4X1IB 2LBFB 1BOAA 2OO7A 4D8VA 3RRYA 4LZLA 1K6OA 1EFDN 1L7QA 4XPIA 1ID1A 1U7UA 2YH2A 3L6DA 3KP6A 1T9CA 5EVJA 1S2LA 1XZ8A 3PWSA 3WNQA 4WWHA 1JT6A 2AFHE 2JFQA 1JHAA 1DG3A 1LK7A 3B8HA 1FUUA 1L8AA 1MRSA 4KQCA 1JLKA 5BNGA 4MQLA 5JCOC 5ALLA 3ILHA 4OATA 1CJVC 1K88A 1M5UA 5G3ZA 2OGUA 3EETA 3AEQB 4ZT6A 4UDNA 3TRKA 1RWWA 3FYUB 1NULA 3PTZA 3RC8A 2CBZA 3V8VA 2AO9A 1EUCB 4G4SO 2ICAA 2E1MB 1EE2A 1RU3A 3IBCA 3AHFA 5ERGB 1RKUA 3GGPA 3MD9A 1N57A 3A58B 3N8NA 4OLBA 3RU9A 2ZI9A 2NO6A 3GYHX 3SKYA 2GPJA 2ZBUA 4MVWA 1GLGA 4Q34A 2E87A 1HE5A 4AIJA 4OMUA 3O8GA 4PHCA 4CMKA 2Q2QA 4KNYA 1LY1A 3C85A 1BOFA 1POXA 1P0CA 3IIJA 3EPPA 5BOXA 4ZEWA 4EEKA 4UVAA 3PFHA 4PS0A 4PX9A 2DK5A 4F3YA 4YASA 3WO1A 3ER9A 3FPHA 4NE9A 4BFLA 1EFCA 2HHAA 2V1DA 4X1EA 2HLPA 4UZSA 2ID3A 1R9GA 2R8XA 2EIMH 3V7RA 3C8UA 3EVEA 4G5GA 4HDAA 5F04A 3BGOS 3HDGA 2KPOA 3MJDA 4MO2A 3AY6A 4M88A 2I99A 3U61B 2XE4A 1FFYA 1T9ZA 4NZZA 2A5FA 3JQRA 3DVAA 4DIFA 3KAPA 4BEHA 4UVGA 1JJ8C 4LVCA 1EDDA 3KKKA 1BDJA 3R6DA 1OH8A 2IRFG 1ISRA 3EYYA 1CNMA 4PRYA 4EYQA 2O8EA 3AX6A 4UUTA 1XC5A 4XI9A 2O3QA 2QSJA 3EVFA 3OM1A 2W0MA 3VDXA 4FZJA 1VFNA 4NBKA 2A7QA 4NBSA 4R31A 4Y2TA 4DLSA 2KMLA 1G1MA 3V7YA 2I6TA 5LR6A 1GQFA 4G9GA 2C31A 4ESOA 1V8OA 3OEED 3VFZA 4NLLA 2AA3A 2QYHA 5BV7A 1CY6A 2X19A 2N47A 3DMTC 1QGPA 3OWXA 3L02A 1ST2A 4RAOA 3OZXA 1WZIA 4K40A 5T6MA 1SB8A 4XCQA 3C3AA 3Q41A 1APBA 2VL7A 4WUTA 4BZZA 4UBLA 4O1HA 4O8CA 5FP0A 4KISA 4M74A 3KT0A 2OCPA 3EQLF 4QWMA 5U9CA 1DX4A 1U5BA 1KL7A 2FG6C 5JJBA 3L8FA 2MU1A 2RGGA 3H3UA 2NTVA 2WHXA 1N2ZA 3JQEA 2XUDA 4PXAA 2JJ1A 1Z25A 3AF1A 4QXPA 3NORA 4Q6BA 4PCQA 1ZMRA 3GB9A 1I3OA 5IANA 3P9YA 1DC7A 4COOA 5KX5F 5LXTB 1E1QA 4F85A 5JI2E 3HN7A 4KLRA 1YJ5A 2I6UA 2EHDA 2ZJ7A 4KK3A 2PLYA 4U0VA 5GAGJ 1RR6A 2OBLA 5F7XA 4S3MA 3HZZA 3OF2A 4L51A 1H9BA 1PFQA 1P2GA 2CZCA 4RZXA 2P1ZA 3WWDA 1ECCA 3RKQA 4MUFA 4W1RA 3LRXA 1QZUA 4RW0A 5CHYA 1X8LA 2OKGA 3IEUA 1HDRA 1YCHA 3L04A 1EE9A 4GI3A 4QU0A 4EJSC 1GKUB 1YFZA 2JRCA 4G8BA 4UCFA 2R7XA 5JC1A 2NMVA 1J2XA 3RIMA 4D5CA 1CFJA 1C30A 4TTSA 5L3RA 3RVDA 4CLEA 4HPQA 4YT8A 4BASA 3L2CA 1E2GA 2X58A 3JQ7A 4A0SA 1OBOA 5FUWA 3QX7A 2P41A 3UH1A 3GHYA 3K70C 1ZYUA 2HQRA 4WCDA 1KQ0A 3LL7A 4ANFA 6Q21A 3G0CA 1ODJA 4BNGA 4DC9A 4RABA 4GXRA 3QW4B 4W82A 5JRJA 1XQ1A 2ZJYA 4MGEA 2BPOA 1WMBA 1YJBA 3GXBA 5KS2A 3PR1A 1WY7A 4IYJA 3RVLA 1VCIA 3V1LA 3PFWO 2DHQA 4P0QB 4EEFG 2NGRA 3FOWA 1ORVA 4ENSA 1DXHA 2DUUA 4MZDA 1UFMA 2J3EA 2R751 2Q27A 3HPRA 4K46A 3FETA 2HOSA 1BW5A 2FR8C 1JDZA 3P32A 4WBSA 1DC4A 3QWLA 1P4RA 4P33A 5CPBA 2AYYA 3VU1A 3A1NA 1SHLA 3IJRA 3OYGA 2QD4A 3WQHA 3JQBA 1UPCA 2BY4A 1Y89A 3HKZA 4NQWA 1A5JA 2HC9A 3DLIA 3PWZA 3LSIA 3QYFA 2JLAA 2PGOA 2I4TA 3BKWA 3G1UA 2CE2X 3M4ZA 4MA4A 2KW5A 2PKXA 1GO2A 2V65A 2ZRAA 4IGKA 4XYEA 4TTAA 3EEOA 1ML3A 1KYQA 3OFKA 1FIAA 2P9QA 2IU3A 4WXRA 1JG4A 1R0ZA 3E5QA 1NNSA 4RJ2A 2ZSAA 3WB9A 3AUSA 5HTOA 3R0ZA 1UWVA 1CRQA 4HD8A 4XX1A 3LVBA 1R1DA 2CL0X 1IJWC 5M3FJ 1JHRA 1HDIA 3B6AA 1P45A 1VP3A 4Y0AA 4YFXF 2JJ2D 1MIJA 3U7JA 2IHNA 2AB0A 4ZVSA 1QE3A 5K3SA 5CX1B 3EMKA 1O96B 3QPBA 4N0DA 2RQPA 2OQIA 3E48A 3FXMA 3GQVA 1LBEA 4ZV4A 3G3EA 2WWVD 3NBYC 1PK8A 2XBUA 1ES9A 1JDPA 2GUGA 4KPUB 1JEOA 1V8ZA 2ZYWX 4KRYA 5F5XA 5KSOA 1DADA 1Y3DE 3K4CA 3WAKA 3UGQA 1UDAA 1H8HA 1V5GA 5CAEA 3OQVA 5DS9A 1T8TA 2AXQA 4FXOA 3M9WA 2FPOA 4PSXA 2P91A 3TFOA 2BWJA 2WZCA 4QPZA 2VUUA 1ITYA 1N3YA 1QGYA 2QLNA 1J59A 1NLYA 1SMYF 4R8HA 2HF9A 3H7AA 4TXLA 2C7QA 2PUAA 1C4KA 1U98A 2RHTA 2NO7A 3PQEA 1LFAA 3R5JA 4WOCA 1JXOA 5J2UA 5BN3B 1LC0A 1R49A 3ZHCA 5K7FA 3HCFA 3TOVA 1BI1A 4XMYA 2CF6A 3SZMA 2QL5A 3TI7A 1JDUA 1E3PA 1UCFA 3FMSA 4YONB 3DMPA 5D2CA 1Z63A 4FN4A 3HI4A 2WE8A 4MUJA 3ZE2B 3GRUA 3NNNA 4X1YA 1DGQA 1EP2B 3FNIA 1VF9A 4YROA 2IGNA 4LK3A 3SHWA 4CCYA 2BHTA 3DOIA 1RAGA 4J1TC 5ALEA 5HOQA 2QQAA 2VQSA 3WO0A 3I2YX 7ADHA 4FGLA 2BIFA 1M0TA 4Q7EA 2Q1TA 1AH2A 1TLTA 4WY2A 2XSJC 3AL0B 2E5NA 2GLUA 1NM5A 2G80A 3J81Z 4TXMA 4LDQA 4B81A 5D84A 4UY8I 2VT2A 1WCV1 1LVUA 1WJAA 1Z75A 3BCSA 3CLHA 3WR5A 2GAJA 2BY3A 3AYXB 3FKQA 2VYVA 3OIVA 3LKVA 4JX8A 4DCUA 1ZOIA 3L7CA 3RV3A 4V38A 1XFAA 2HLHA 1CD5A 2YV2A 4WXEA 2H1SA 3CLVA 4DUGA 4D0SA 5EJ7A 5AICA 4AMUA 1RWPA 2X3YA 3DKXA 3EUHA 4I1SA 1RKBA 5ALDA 3HNRA 5HP4A 4K2EA 2PMDA 3OKCA 1Y3AA 2WTBA 2ECPA 2FPRA 1M7BA 3MB8A 5JO9A 3I59B 3HY6A 4C7JA 5K0NA 4BLRA 1ZN9A 2RHJA 3F71A 2GNPA 2DLCX 3KZYA 2P8JA 4W1QA 4FJ0A 3TZHA 2K9SA 3K10A 2OEPA 4BFZA 3AL2A 5IDWA 5GONA 2A9QA 3MZ0A 4EECA 2XYPA 2GZSA 4KXMA 4DQLA 1X87A 1M66A 3OQMA 4BV9A 1Y80A 4GMFA 4OKNA 4C43A 2PUHA 2ALJA 2BMFA 5LBUA 1BFDA 3ZQ7A 3DDOA 4AURA 2ECKA 1SVLA 3DEFA 2NQ2C 4DCTA 5L6LB 1GQQA 4D5FA 4H1HA 1R5HA 2R6CA 3WFIA 3GFGA 1Z37A 5CTAA 3F6RA 1ZUNB 4WEOA 3F9IA 1U1DA 4RGRA 4BMVA 1BJRE 1M1XB 1CQJA 1XHLA 2Z8XA 1H9TA 1NSTA 1SD2A 1SKBA 2R86A 4H27A 2ODEA 1K6JA 1CZHA 3PUFA 1YIJI 3P1JA 3QVJA 1GA1A 4L4YA 2YWCA 1T1IA 3VZSA 2VQEB 3FPAA 3I39X 5CCDA 1KH1A 3KHTA 2MGQA 1I7NA 4GGPA 4EHBA 1GL7A 2AR9A 4FMCB 3HJAA 1PFUA 4YP9A 5KIAA 1XK7A 1LD3A 1KY5A 3M70A 2X5KO 3G1MA 4R1PA 1DQUA 2R00C 2WT9A 1YU6A 4UXHA 1KWGA 4P5OA 2ZDGA 2R6GA 1NE2A 1ZXLA 4TTTS 1OPCA 5JSYA 1T5OA 1EWTA 2D0OB 1F4VA 2E6UX 2AC7A 3E0QA 4FMDB 4QWWA 5EZYB 4JBWA 4D6YA 3ILVA 2VP0A 2PGNA 3NV7A 1ABFA 2DGDA 5IJAA 4MV5A 2B7LA 3UXHA 3VU8A 1Z29A 4HQKA 5K0BA 3U60B 2SKCA 2YQZA 2JGKA 1X2NA 4JUCA 4TUYB 5AJXA 5GADl 4CEHA 2B69A 2P75A 1PV2A 1DRVA 1X8KA 5DN6A 1DKLA 1I2AA 3IAHA 5CH5A 4EYOA 3K4BA 3L84A 3KM0A 3QEJA 3SQDA 3HSKA 1CP2A 1UJBA 2CJXA 3R9KA 1R1VA 2FVXA 3OUTA 3PNSA 4ZO4A 1WF6A 4YP7A 4YEDA 1GZ7A 3CX8A 4UULA 3U9TA 3VX4A 2Q3CA 4ZZ3A 4TYNA 2VJQA 2C03A 2X86A 2AJLI 2R4TA 2PYIA 3IUQA 3RKRA 3UT5A 3ZV5A 1WQ2A 3A1TA 4B71A 4KPGA 4NH4A 3VNUA 3WJ7A 2HQBA 2HVRA 1L1RA 3IP9A 4XRRA 1JFFA 1QPGA 5IAKA 3W6UA 5ES4B 2DWQA 1Y3BE 5J59A 5JNWA 1IY2A 4V24A 5BSEA 3F7TA 1ZH8A 4C6SA 5A3QA 1F5TA 1RQPA 5JJIA 1NXPA 3DBRA 1NONA 2ZSKA 4CCJA 4XORA 2C7BA 3L1HA 3VISA 1JEDA 5JEEA 3KWJA 2HV8A 1I2DA 3DVSX 4TQAA 4Z4HA 2LLKA 5BMOA 4HP8A 3X1DA 4A0XA 2NPIA 2WDZA 1KBOA 1G291 3OPXA 2OBBA 4M1ZA 5AKKA 4YX9A 4MVJF 3F3XA 4UPEA 4RD1A 2X9QA 1EXNA 1TF2A 2W2VA 4US1R 3OIFA 3RIGA 3CW9A 3TW7A 3EPRA 4F71A 3EGWA 3RUIA 3KQWA 1GV1A 3FHOA 1C29B 1QGUA 2FEAA 1BYUA 1HYEA 4EKEA 1I7QB 4MUBA 2VSXA 3F3KA 3WX0A 4R3NA 3GCWA 1KMNA 1NK3P 1HLFA 4KO8A 4YRCA 1ANKA 2O2XA 4YHHB 1V3UA 3S1AB 4JXXA 1Q0TA 1BE6A 2GDJA 3L7NA 4EKDA 1ZICA 1Z0ZA 3RYRA 1MF7A 2RGVA 3IVXA 1KIAA 5AIAA 1JBEA 5F7ZA 3QLUC 6NULA 4JR2A 3TBKA 1G21A 2ZNZA 5IP9J 1NMSA 2BEVB 4KBFA 3FGPA 4PGMA 4XR6A 3UYLA 2W2PA 1TZ2A 3F22A 4RD0A 2C77A 2ZR0A 1DAKA 2DFLA 3C4QA 3EA0A 1BVYF 1CU1A 1N2GA 1GCIA 1GGEA 1R4NA 2YINC 3ON5A 5DGXA 4BKPA 5BSTA 5ALKA 2D1QA 1V39A 1OV4A 4D57A 5EUBA 3AUJB 4C20A 2ORVA 2YC4C 4DSOA 3UMYA 2VBGA 1QFYA 4L8YA 1KSFX 3C2QA 4E13A 2HU9A 3HWRA 3VYRB 3OVMA 4ARVA 4FE3A 3L4BA 4YAIA 4RPHA 5P21A 1Q91A 5JPCA 5JNLA 1VDZA 4W9MC 4PQEA 3EZLA 1UPAA 5CH8A 2BGRA 1NUPA 1P4GA 1RYYA 2CHGA 3FG9A 3CP8A 4WCGA 2C2OA 3PFKA 4CGYA 4M0FA 4YMUA 2AN4A 3JRAA 3R76A 3OAAD 4O4JB 4Q16A 4HDQB 1E0DA 1YB4A 2HI0A 4RKYA 5CB0A 2CQNA 3O91A 4WA8A 2VDQB 4BOYA 1A82A 1XSDA 2P2GA 4TUYF 4TYPA 1QYWA 2HK9A 4KK4A 4EHDA 2R5FA 3WHIA 4BTEA 4BQOA 1DJOA 4WKNA 1YWGO 1AS0A 5B4VA 4AWXA 3H65A 2DH6A 3QMPA 1CE8A 1I2MA 4P0TA 2QZJA 4DT1A 2BZTA 1U7XA 5TPZD 5FOWA 3RAEC 1C7RA 2MYPA 1W4AA 4M21A 1SKMA 2FZ5A 4FMPA 2NXNB 3R4VA 5T41A 4KKXB 3VC7A 4TWIA 4PFQA 2YZMA 1GNPA 1L5MA 3H2BA 3ZU3A 1ZR2A 2SCUB 3BFVA 5DX1A 1ODDA 4DG8A 3PICA 2XOKD 3VZDA 3FWNA 1P2SA 1R6DA 2GEKA 5JE8A 4ZYAA 2O19A 4Q0MA 3S28A 1WUYA 2DLNA 4MRMB 1UXGA 1ESEA 2C4TA 4HNAA 4JSYA 2NPOA 4LRSB 5H2FC 2R65A 1I6MA 3B60A 1AWCA 4D4MA 5HYVA 4Q4JB 3TRHA 1QIIA 1PUFA 4UM9B 2C2BA 3PG5A 3ULKA 5A6SB 3PC3A 4MMYB 4KQMA 3IAS6 3RANA 3KYLA 3TEDA 1Z12A 2Z2SB 3D5EA 1I14A 2ZYAA 2GFQA 2XQIA 3E3OA 4JROA 1WG8A 2R6ZA 2AHQA 5M2QA 1E9EA 2HRCA 5DASA 1UEJA 2C0PA 3T1NA 4A2WA 3BFJA 4D8UA 2I91A 4M54A 3A0RB 2Q28A 1WSUA 4JYZA 4HXYA 4B80A 4B3HA 2JLWA 2F5EA 3WSTA 4E2FA 5CLQA 3GCGA 1ZSYA 2FJPA 3O94A 4MRNA 2R66A 4OH1A 3OYCA 3H5LA 4OQ4A 5DSTA 1FQJA 1PJ8A 3CHYA 4RL6A 4WOKA 5DHUA 2JW5A 3ROEA 3QUAA 3WTZA 1G6Q1 1H2WA 4MQUA 5KTNA 2GD6A 1ONVA 1TO6A 3WYAA 1OBVA 2OESA 3UC9A 4XW2A 4AZWA 3MLEA 4EMBA 1ONNA 1N4AA 1PF7E 2FWMX 4DCSA 4EGQA 5KNDA 1JVBA 1KI8A 2XDVA 1W93A 2OHOA 3DBLB 3ZU4A 4L5EA 4N82A 2QW8A 1HTTA 4LYHA 2OCGA 5D51S 1TC2A 1P92A 1E62A 3ZC3A 5J43A 2HY7A 2X0KA 4FYIA 2AVDA 2Z16A 1X94A 1UADA 2YN4A 3PCTA 3LA8A 1FDSA 3UV7A 4R40A 5F76A 1DWPA 2K85A 4PFJA 2P1DA 1NC3A 1DJLA 2AHOA 2QI9C 1E2KA 4M6VA 1OFGA 3CGWA 3NTVA 5T6BA 3BWMA 5B1IA 3FB1A 4LNUA 1XQ9A 5CDUA 3WHBA 1TQDA 1P2FA 1F12A 1NYQA 2II6A 2XD9A 4I4IA 3U7GA 2J3IA 3C3EA 3G59A 2MYUA 3M1CA 4UREA 3GLIB 1W2WB 4ZJPA 4AJ4A 3LWBA 3QU2A 2NVBA 3OLWA 4J9VA 1E3IA 5H02A 1IY0A 3TZCA 5EIXA 1QJ4A 1KP3A 3QU6A 4ISBA 4AIRA 2M4KA 3T3MB 3NBKA 1CQJB 3U4DA 4ZN6A 1BD4A 5KYYB 1RNLA 4ZPXA 1X3LA 3QBTA 4KXQA 1GPKA 3GCMA 1J2TA 1RWBA 2QXTA 3MRTA 4B79A 5B3SH 4J1TA 1CE8B 5D3MA 2DU9A 2H6BA 4PQYA 3REFA 1B6TA 3V4RA 2PMEA 3WMFA 3VGPA 2XTNA 1SVNA 1B72A 3D2LA 1B9MA 4RMNA 2VN2A 4JVSB 2Z4TA 2KLOA 4B43A 1ETHA 3KSZO 2QWXA 5JYDA 4ZU3A 1AMUA 4HV6A 1USKA 1LDBA 3RZDJ 2X0NA 1DZIA 4CM4B 4EJ0A 4AB1A 1YO6A 1QS0B 1YAHA 2Q2OA 2PYDA 3LXUX 4LC0A 3AEYA 5CJJA 5KHLB 1BKYA 3E23A 5IBQA 5FDFA 1V3QE 3DVAB 4ZI5A 4E31A 5FV4A 1TAHA 1CUSA 1FP6A 1ZM2A 3WRVA 1SUEA 4Q5SF 3IP3A 3J81A 3QXXA 5L4LA 2FW1A 3HU3A 2BLLA 5FEMA 2VDNB 1H0KA 1K9SA 4U87A 1N1MA 1U0JA 1DKUA 1EB9A 3L7MA 3PDWA 3R3JA 3LPMA 4H0FA 3SXPA 4C7OA 3L5OA 3Q7EA 3I8XA 2QAIA 3HIFA 1TK9A 4L6IA 4NDZA 5KPJA 4JMPA 1BIFA 4D9CA 1QRAA 4DUYB 2HIAA 1JKMA 1UXIA 3EGXB 5SY4A 4EJ2A 4MVYA 4RFSB 2E82A 4TKMA 2GZRA 3AEXA 3T8TA 2KDZA 1WE2A 2CLSA 2DQLA 1H93A 4K8OA 3QFSA 4Z3OA 3CCRI 2IXAA 5EIEA 3NDBB 4CNBA 4B4CA 1MOQA 1K9VF 2VKEA 3E9RA 3EVCA 3PD0A 1WA5A 4G0NA 4LJ5A 4OOFA 4X1YB 3BIXA 2OC4A 3WL4A 1XD7A 3T3DA 4F38A 2ZWOA 4DBQA 1U04A 3Q9UA 1P1JA 4TS1A 2CYYA 3BB3A 2PFKA 3ZPXA 3TCXB 2RHBA 2AOXA 4UNRA 1X1RA 2NU8A 3BT7A 1U2TA 1GGHA 2M9HA 2CW0F 2IA0A 5CNMA 2PUDA 1T91A 1T0IA 2CBXA 2YHAA 3G8YA 4EITA 1W35A 1VQNI 5HUJA 1LWOA 2DBRA 3GRVA 1GTVA 3JQDA 3GFFA 5HIIA 4JJ6A 5MDHA 2J09A 1OLSB 1RMYA 2TRSB 5JAZA 3DAGA 3HLTA 3G7SA 2OXEA 5DCLA 4KSYA 3ZI0A 1VXOA 1U8ZA 2H00A 4GSYA 3ZWOA 1T4DA 4D92A 3ZZUA 5K9ZA 5JSZA 1UWLA 3USZA 3J7ZI 2XF6A 2QE7A 3I04A 4IR7A 3ZQ4A 1RMQA 2L17A 2XX3A 3KUDA 3LIPA 5ESXA 1XEXA 4UNIA 5FBWB 2ZWIA 3A1WA 2ZT7A 3OZ7A 2ZYUX 3AZOA 1G7CA 1ZGBA 3FCEA 4HQFA 1N2CA 4ED9A 4I81A 4CHTA 5KVCA 3PGLA 5IVKA 1GZSA 1OJLA 1QKJA 1P39A 4PONA 4RVOA 1QOQB 1HNZB 3PQKA 3H9UA 3MT7A 3BWGA 1RC9A 1VIYA 4KODA 4RANA 5BW5A 5L4SA 1W5EA 3A4CA 3BDVA 4OK6A 5HCIA 5CVJA 4RLFA 3ESZA 4N0MA 2ZOSA 3I9MA 4GZ5A 2YZGA 3X0DA 4AKTA 2VF8A 5JWHA 3P26A 3VI3B 5CDGA 4AIDA 4KREA 3KJZA 1SIWA 3A9RA 2WAAA 3KUKA 3GPBA 2XPWA 1V95A 5HGXA 3EODA 2JTVA 2CXPA 2B4AA 2YWRA 1YTUA 1X3WB 4HAYA 5GTDA 3BC8A 2VDWB 5JSHA 2FMTA 3O2QB 2PX9A 4BXUA 1XQ6A 2WWIA 1TEHA 3S2WA 2VFAA 2VP5A 2ZCUA 1MBKA 4EMSA 3HCDA 5B3LA 3KALA 3F7OA 4ZZIA 2HOQA 5DM7F 4V0RA 2ERCA 3QSGA 4JJFA 4LVOA 3T41A 1FXSA 3KP5A 1HE8B 1B6GA 1MB0A 1SUPA 4YFNF 4BE7B 2D2XA 3Q12A 1O97C 4MYDA 4WUVA 5IT0A 3D7RA 5E38A 5K8IA 5AVOA 1IK6A 1PE0A 2G71A 2DA4A 3RSNA 3WWPA 2DF8A 3OYFA 1KR2A 2D7JA 3L2RA 2HMUA 1CY4A 1O5OA 1A71A 1USUA 1Y1RA 2TYSB 4QTXA 4A8JB 1T56A 2WABA 3UJAA 3FVWA 3UO8B 3WGQA 2O2DA 4MQFA 4E7LA 4ND2A 3INGA 5EPEA 4DOZA 1NW7A 2CGEA 4OAZA 1VPLA 4J00A 1ZL0A 5LLDA 3G0DA 4X24A 1BEZA 2GM4A 1BO6A 1WB6A 1BMDA 1M2OB 2Q21A 2EZHA 2JAHA 5HIKA 2V5AA 2Q3HA 2FVYA 3W1VA 1YTLA 3RC3A 3ZQHA 1MH3A 1IF1A 3GA0A 4RXMA 2WIBA 4XJTA 5K0JA 1PJLA 1JHZA 4RENA 4D0RA 3SJAA 2PA0A 3UIEA 3VKUA 1ZD2P 1BG6A 1ZMTA 4G0QA 1VL8A 1YFHA 2B9EA 3DOJA 1TCVA 4G7HF 3P9XA 2C07A 3BLYA 2O7OA 1E8MA 1ZBQA 2C57A 2GK7A 3BRQA 3EW9A 3OOHA 4HHEA 4XDYA 3RRJA 5A7HA 2OV3A 1BIBA 4UXNA 2ZXFA 2J8ZA 4HLYA 2WYIA 4BBPA 4JBHA 1SC1A 3KV1A 1WKMA 3V8KA 3VYTB 3AF4A 1VQ8I 4KN7X 2O6GE 1X80B 1VE3A 2VK8A 4LAFA 5EJAA 2HA0A 5FLKA 3VFDA 3LFKA 1NXWA 2AJCA 1FX7A 2VJAA 2L3DA 4JP3A 4NZNA 4BNFA 1IDZA 4F2DA 4U6QA 1W0KA 1TQ8A 5CFZA 2JGJA 3B7PA 1BCSA 1NVWQ 3S16J 4M86A 2YX1A 5LPNA 5REQA 4R2WA 2YIMA 1C8KA 1GCOA 1X7ZB 3CW2A 2IIPA 4HSEA 4I1OA 4MCJA 5E6RA 3LYUA 3RT9A 5A1JA 5BORA 4A3MJ 4LJYA 5H20A 3IVCA 4YAEA 5FPKA 1NU6A 3K2EA 2A61A 3FSRA 3IOCA 4UM7A 5JASA 3H42B 4CYCA 3KB1A 4H7JA 4U6NA 4YV2A 2UZ0A 4EJWA 1K7EB 4IJWA 1BC7C 1KI7A 4LTNA 1G4UR 5DNEA 3RW9A 1Z62A 3E18A 2MSDB 1JEQA 3G0IA 3CLKA 7ABPA 1Y8RA 1PJZA 3PGJA 4PXSA 1LLQA 1XN4A 1LH0A 3IODA 4X1OA 3UAYA 4MROA 3DT6A 4CLHA 4DA8A 2JHAA 3KU1A 2QLLA 2ZMEC 4L85A 1RJDA 5B1EA 5I7OA 4LWQA 3PKZA 2IYUA 4LCEA 1HRDA 4PO1A 3QM1A 3U4QA 2FQWA 3NIWA 3COPA 4PLZA 2R7VA 3FF1A 1ZD9A 2DU8A 3QPTA 2VF4X 3BN3A 1GSOA 2CG4A 1O3SA 1EVZA 2VUIB 3M4NA 2OV2A 4WNIA 3REGA 2L7KA 3VSDA 1NMYA 3EZNA 2C97A 2W8ZA 2C2MA 4IXAA 2O05A 4EY3A 5DUIA 1VL0A 4ND4A 1WM1A 3RK1A 5B6IA 3OUUA 3WWYA 2AG8A 1VM6A 1QIDA 4H6VA 1L4EA 3E5MA 3JWHA 2E1RA 2ZKLA 2RDMA 5FRMA 4LJKA 1E2UA 1KXZA 2OHVA 1L5HA 3W8EA 4EKGA 5JCXA 5CU7A 1BI2A 1X7WA 4JL6A 2QGUA 1GYRA 1ZD3A 3PUXA 3RF6A 1YC5A 1GY8A 1I3NA 2AI2A 3OT1B 3Q1KA 4BN4A 1KTIA 3U7FB 3OS1A 1VCMA 5HF9A 1NI4B 1JG3A 1JIJA 1OQAA 3UCFA 1SN7A 1B14A 4EJVA 1NTOA 4JCCA 4JD5A 2WUWE 1YA6A 1HFKA 3OSZA 1QKIA 1DAPA 1NX9A 1UB9A 3NW9A 2Q0QA 3NEPX 3TW4A 1USTA 1F0PA 2WJ3A 1KZ7B 4WEQA 1MVLA 1KA8A 3FBWA 4BNTA 2BE5F 3F2IA 1LA2A 1Z5ZA 2FDRA 3BTVA 4RETA 2GNOA 3NYQA 2X5OA 1LX7A 1XDGA 3MCAA 1NUUA 2FPUA 3VZPA 2CJJA 1R71A 1PP8F 2DKOA 2XODA 3PC4A 2HAEA 2C2HA 1H0SA 2ZQ5A 3MUOA 4H15A 5DTEA 2P7VB 1X4OA 4LF7B 1AZTA 3R7WB 5EQJB 2F1HA 5KVSA 1FQKA 3HTUA 1QRDA 1PG0A 1F4PA 1RXCA 3L41A 3D3KA 4L8LA 4MVXA 2B1JA 5HFJA 3R8XA 5ANRB 4BH9A 4IRGA 4CKBA 4OOIA 2GPNA 3EGXA 2GHRA 2QSFX 4FHDA 4ZYEA 4HEA6 2G0EA 3FXKA 1LDNA 1ENZA 2J0VA 5JNVA 1KZYC 1YW7A 3ANXA 1LSSA 5A4AA 3VKHA 5E8RA 4NBQA 5GV8A 4BWYA 5JBQA 3SMVA 2BKLA 4M55A 2JEOA 1FK8A 3TQQA 4GGMX 3D0SA 1R1UA 4EJTA 3OE1A 5EUMA 4IOJA 3GT4A 4LECA 1VOTA 5IBPA 3G5MA 3ZXSA 2YCLA 1A1SA 3MGCA 3AF5A 3QOFA 1XMXA 2L54A 4II7A 5BYJA 3PD1A 1QR2A 4LVNA 4YRSA 5CYVA 4EJUA 3DZKA 4BQRA 5IT4A 3UPTA 5EJGA 3KIOA 1OBHA 2Z08A 2A33A 2CVHA 2JKYA 3ZKWB 2B1IA 2JFHA 2FN7A 3LBIA 4Y18A 4YP5A 3EC7A 4KGZA 4AG5A 3AR5A 4E3ZA 2QKLB 2D5BA 2ROQA 4GI5A 3CF4A 4K6KA 4R8SA 4DKJA 2A5JA 1BDBA 5HIJA 5TDHA 4AXBA 5FBZA 1W581 4O3MA 4IOMA 3QF4A 5DHSA 3DFMA 2M34A 2E71A 1SVKA 3R7DA 1BW9B 3HCOA 4FUTA 1U5BB 4U5QA 3R3UA 4YMLA 4GRIA 4FCYA 3IUPA 2KLHA 4D1YA 1P60A 3GMSA 1IOLA 2H1KA 1THZA 3E1SA 1CDOA 4Y4RA 4D4GA 5KC9A 2VPTA 4NUBA 2B6NA 4JR0A 3L2UA 1FDVA 4EG1A 4QKQA 5KTSA 1JJ7A 2WA1A 4Z2AA 1IW7F 1DFIA 3HRKA 4BKOA 1AGXA 2QR2A 4KVFA 1WJEA 4XAQA 3LRPA 1SJ9A 3HN6A 2B63J 1COWD 2PWZA 1FF9A 3ZHTA 5D3KA 1KMMA 2P6MA 1U5TB 4JLUA 3GVIA 3G71I 1XMJA 2DA3A 1KHTA 1V1MA 1YQ9A 3D2CA 2P2LA 3JRWA 4AZVA 4ND3A 1WBDA 1U8RA 3THXB 4LCJA 2ETXA 4UJ3A 3WYCA 2P6PA 3L0IB 2RH4A 3WGJA 2GYYA 1RDFA 3MS7A 4QUGA 3KYJB 3OEHD 4M8IA 5AUQA 3IAUA 4ALNA 4AU1A 4PN3A 3HKBA 1A9OA 3WHCA 1MEOA 1QHSA 2UKDA 3U7RA 5SYAA 1DTEA 4OY3A 5LNK1 4HRAA 1Y1KE 4H1UA 5E4JA 3KJXA 5NLLA 3WL3A 3T0YA 3TX2A 4YIHA 1W9HA 1UBLS 1XMVA 3WZLA 3JSPA 3JQ9C 3U2RA 4LJ4A 5AESA 2FEKA 1XTRA 3IMFA 3CVWA 1KZ1A 2MSLA 1B2RA 4BRWA 5A5FA 5DLEA 1LTQA 3G1OA 1H4SA 3WLMA 1L8OA 3N4MA 1XXHE 5MN4A 3EG5A 4D56A 4IFTA 4KMRA 1MTZA 2EF1A 5ALVA 3VR5D 3JRNA 5LRRA 1NW8A 2A5YB 2MD0A 4E2XA 1T5LA 1VI2A 1A8QA 3MINA 4AL4A 5HUQA 2H1CA 1QK5A 2OLKA 3W9UA 4TL9A 4EA6A 1RBYA 3BMNB 2ZUTA 3V2UA 4CIBA 4I4TB 3ZY6A 2FQXA 4HAIA 1JR3A 5JZMA 1NT4A 4WNAB 2JEYA 3VA7A 3I54A 2O8NA 1IV6A 1T0BA 4FU0A 2CB0A 2VP3A 1OCCH 1JYSA 3K1PA 2W7TA 2P8TA 2J08A 1ESZA 2FY8A 2GK4A 2CYCA 4GR5A 5ED4A 1BH2A 2VJ4A 1ZJZA 1KVSA 4R83A 3EGVA 3LT5A 4UOQA 3HU2A 1IHYA 4UMEA 1SEUA 3C3MA 2YYZA 1QPIA 1KK2A 1OFHA 1VMDA 2A2ZA 2BXZA 4UHTA 1UBSB 3DUFB 3R2JA 4FWBA 1NBEA 3QHPA 1V5FA 4X3CA 3PTAA 2VPQA 2DKFA 4ZQBA 3UKGA 4HVCA 2VL8A 2R4QA 2BVLA 4M1EA 2JLUA 2F2TA 1AV7A 1R3UA 5H80A 2IS2A 3PDIA 3TLCA 3ZWXA 2FSGA 1GYPA 4XSGA 2WWWA 4POOA 4EL5A 2XROA 4F7WA 4KIBA 1LNWA 3PJRA 1QAMA 1WCWA 2GCNA 1DNPA 2HSJA 3B9RA 3N3BC 1TAUA 1F9EA 1QX3A 2HQ1A 1N8KA 2UVQA 1ISFA 4DZZA 1DCFA 3RTRA 1A8HA 2EDCA 3Q11A 4DFDA 2IEKA 5C32A 4RH1A 1YW8A 1K89A 3R5SA 5CDSA 2I8LA 4N7JA 2HHCA 5F1YA 1O3TA 2O2HA 3VZCA 5CYOA 1X7ZA 3MMZA 5FRNA 3WTBA 1Z4KA 5GOZA 4U3JA 3H9QA 3ZOBA 2ODBA 3L7WA 1SZDA 3F5SA 4HQ6A 4JJ7A 1NQAO 4R7ZA 1PS0A 4S1OA 1L2TA 1YTYA 2WJGA 4RF5A 4V39A 4BNYA 1SCUA 1YLFA 2VJNA 2XUOA 4XIDA 2JAOA 4D43A 2H65A 1MAUA 1QTRA 3AC0A 2DFHA 2F3TA 1KFEB 2JPDA 2CFXA 1CQIA 1UMCB 2V0CA 4YWJA 1X8XA 1YDFA 2PSHA 2V7QD 3A2LA 4HGZA 1B00A 3P19A 2R5YA 1PP7U 4LZOA 4I76A 2I2BA 3VDQA 2J6CA 1QA6A 1XD8A 3QA3E 1Q0PA 5E1BA 1QH1A 5FI1B 1O89A 3CF2A 2MSYA 2H27A 4P92A 2CHVA 3U4GA 1M83A 1FXWA 2O3JA 4TLAA 4WNAA 2AK2A 4WV3A 3UY4A 2OC6A 1EI9A 1Y6FA 5EUCA 1DFGA 2OG1A 4OHMA 1TT5A 4UVDA 4WXDA 4OREX 5KCMA 3PK0A 5AXCA 2FEXA 3U1BA 3PF8A 4OLAA 3FWKA 4ZANA 5BR8B 3FYHA 4QFBA 4MR8A 4JFRA 2HS5A 4A3EJ 3R7AA 5KWJA 3AFMA 4O02B 4MXDA 5IVDA 1E2LA 2EEZA 3ZUPA 3TPCA 3GRRA 4MKXA 3DKVA 4KVGA 3K6SA 2JIMA 2IBSA 4HSRA 3MSXA 5BY2A 2NU7B 3QY0A 5F12A 2FMKA 4DA7A 4Z6KA 221PA 3FI0A 4TKUA 1SB9A 4OI1A 4L5JA 1ZK0A 1ZKMA 2FWRA 5LQAA 2BGTA 4WWCA 1VE9A 1CG6A 3QFCA 1FDWA 1H2XA 3DOFA 4ZIRA 1T15A 2WUGA 4R2HA 1G66A 4ETSA 1KYZA 1KOLA 1FEZA 3K8ZA 5IC4A 4K3UA 1DUSA 2JUGA 2H1HA 3BIOA 4MIKA 4UPVA 4LXTA 5EIBD 5PNTA 3A4IA 4JKOA 4RV5A 3TG8A 4JQZA 1K3FA 1U3WA 1AUPA 1RXUA 5C35A 2W2KA 1W1WE 2D5LA 3L1PA 4AMGA 1K6IA 2PUGA 5LOVF 1C3OB 4I2OA 1KO5A 1DXQA 2F4MB 1I32A 1L4UA 3IKJA 4BE0A 4TTQA 4UUAA 5JHGB 1MHTA 3ECCA 4A3KJ 1GITA 3C3PA 3JS5A 4PC1A 3M5WA 3JAMA 5D6OA 1OB2A 4UMFA 3BMOB 1OVMA 2CWEA 3WRWA 1WCMJ 4C03A 1T5BA 4QGSA 5JALA 1CTQA 3HGQA 2IEYA 4YELA 2IYEA 2R7OA 2CLDX 2OY0A 2VRCA 3K15A 3RRBA 2JQ7A 3ZXIA 4M1SA 1UOOA 2GF2A 1HEIA 4KQIA 3DBIA 1HXHA 4C1BA 2FOKA 4YMHA 5EY5B 5REQB 1QGOA 2NUPA 3EISA 3S4YA 4WFIA 4NI5A 1YX5A 1LDMA 3IUBA 4HPXB 5AIPA 3FISA 1SWVA 1DAOA 3ZK8A 4I7EA 2FFRA 3LQFA 2CT8A 1Z67A 1NT2A 1IV8A 2D45A 1C0EA 2DT6A 1N77A 4ZOLA 1JUDA 3NGMA 2R8PA 4ESJA 2IS4A 4LJRA 3R0AA 3BZCA 2AFIE 3AEZA 3EK2A 2LCQA 2XGMA 3B20A 1ISJA 3RREA 3W6NA 5IULC 2VAVA 2BZGA 3JASA 4RZSA 4C6RA 1KFKB 2EFGA 3ENZA 3S29A 1ODSA 3V4OA 1D4AA 4AY3A 3J7YJ 1QLWA 2J59A 4FEEA 1FQWA 1ZMXA 4Q3DA 3I83A 3UBMA 1P1IA 1R0YA 2JCBA 3KWMA 3KEMA 3TOCA 4X62B 3QYEA 4BGVA 3HZRA 4RAGA 4R8MA 1DHRA 1DC6A 1S0UA 2NTYC 4J3FA 5GM2A 3ZV6A 3QU5A 3HNOA 1D9XA 4NATA 1TK3A 1M2FA 2XASA 4XKCA 3OLVA 2NU6B 3K96A 1DB3A 1Q1AA 4WLVA 2NXWA 4BNJA 1EWYA 1NHAA 1NP6A 3D3EA 3EF1A 1X39A 4WY5A 4DNXA 3IOMA 3NUQA 2RGYA 4JB0A 3R6SA 2P2SA 3GPIA 4QHSA 5DVZA 3UFXA 3V2HA 1IG7A 1GTMA 1MO2A 1V7CA 1EH8A 1ACMA 2JBAA 2XAFA 4GZ3A 5DN9A 1RESA 5M3MJ 3G2OA 1ZX1A 2QEQA 4NPHA 1E1QD 4OFWA 4WLOA 4A6PA 2CNKA 2NO0A 3CUUA 4U02A 4BXOA 2E1OA 1IEVA 4IH1A 3QX3A 4EQ6A 3TLAA 5F0CA 5AM1A 3BK2A 4PYJA 1U9OA 2JGDA 2DT8A 4FYXA 4IDEA 5CK5A 4HBGA 4JP0A 1F3OA 3I0ZA 2VP4A 3IALA 3PC8A 4TLCA 5FLXZ 1JS1X 1P4JA 2GESA 4L7QA 3OZWA 4N5NA 4KWIA 4OK3A 3ZXXA 3JQ9A 5AKHA 3ZV7A 4DDTA 3NKLA 2G6TA 1NVDA 2TS1A 3C6ZA 1VA4A 5LWHA 5BWOA 1YRYE 3FK6A 4RTPA 3G8BA 1ICIA 3AETB 2PL9A 1HFEL 1E3EA 2HIHA 2I6FA 3KZXA 1R1TA 4P53A 4LZJA 3VQTA 4LG1A 2QZ9A 1WD5A 1ZVQA 3G89A 3TJRA 2F5VA 3KZVA 4M3NA 4ZHQA 2BGLA 2ZR8A 3VKGA 3RZOJ 1JHOA 1GL3A 2YJ6A 3KLBA 5ECDA 2YUSA 1FP4A 4DTCA 3D1JA 2H7YA 1EFPB 3DU5A 3D6HA 2J0UA 3M4XA 2ICWG 1KFBB 1FYEA 4N6NA 3NHKA 4V0QA 4IGFA 3RTGA 1VE7A 2BEUB 1S8FA 2XRMA 4BO9A 3PKIA 3K09A 2HCBA 5CEFA 4XOUA 3KQVA 4OP1A 2J9GA 4F92B 1KPIA 2W82A 1P0PA 3TL4X 1X70A 1YR6A 2J9XB 2Y0PA 3F1KA 3BTLA 1O54A 3L7YA 2FMHA 3JATA 3WMWA 1AK1A 4HF0A 2X40A 4LC1A 3CMMA 4BB0A 2XZOA 2XGDA 5C8XA 5LYJF 2NW6A 3G9XA 3FTNA 1RRGA 1FC0A 1O0SA 5AP9A 3G6KA 4KXXA 1JDTA 3NOQA 4N54A 1IM8A 3OQIB 4UHHA 5AJYA 4AG3A 2ZPTX 5U4QA 2Y66A 3IO3A 4UZEA 3PFBA 1OXBB 2XTJA 1NVFA 2OMKA 1GNVA 1AQYA 3NS7A 5KNBH 1YB2A 3HXLA 1WPRA 1GT91 2YKGA 3TOZA 5CVTA 1BGWA 3F2VA 1SVUA 3P7NA 3HADA 1VQKI 3RASA 2BOVA 5I9TA 1UC5B 3WBJA 5ADVA 5I9LA 2K4BA 4M72A 1VIVA 1RLIA 2Z9DA 3FBNB 5IAJA 3QX9A 3S1NJ 1I5RA 4BFYA 5BMVA 2IPQX 2G4LA 1ZYRF 2VWQA 3GGGA 3KEGA 1KS2A 1GUYA 4NICA 3CTPA 4B76A 1SHKA 4HDSA 1F6DA 4HB3A 4LIPD 4AD8A 3GD5A 1RKTA 1X86B 2ZIUB 1FMLA 3MWDA 3UWOA 5CB4A 5GAHJ 3QHAA 5JECA 4OQQA 3GMEA 2H8GA 2ZPAA 3HRTA 2ZEJA 4PLCA 4ZEXA 1U1CA 1X6VA 4IXNA 4AXXA 1P8JA 4CWAA 6REQB 2LGJA 4FR5A 5IT5A 4IXMA 4P32A 4IKOA 4CYMA 3GJ0A 3ONFA 4O25A 4HPJB 5DFAA 3TTUA 3ZGZA 2LV8A 2NZWA 4GQAA 4J4BA 3ZCSA 1D6MA 1A9YA 3IAM6 4WKBA 2E4UA 1CETA 2KWIA 2Z2IA 2PQMA 3T1VA 2AOWA 4HZIA 2O0HA 1JJIA 2UYCA 3GGSA 1UM9A 4FFVA 4MGHA 1YF3A 5CW1A 3HOSA 1Z6RA 1NVEA 3TQCA 4B32A 1N9GB 2AC2A 3WYDA 1U2SA 1P3DA 1REQA 3GZ6A 1S1MA 3EUWA 3OM8A 1LF0A 2M87A 1YACA 2Q2WA 4U6SA 3WRYA 4YJFB 1IY1A 3ICVA 3QEBZ 5JS7A 5E2BA 3JALA 2HJWA 2ASEA 1KJJA 3EZ9A 4I8IA 5I8ZA 2B9SA 1GZVA 5BURA 1HDOA 5JAIA 4DYQA 4FCCA 4P5DA 2VPYA 1TWAJ 1GRCA 4OHRA 4IJVA 3ROZA 3VC2A 4ZYWA 4MRAA 5HNHA 3SJUA 4II2A 4JITA 4IQ0A 4P58A 4XFKA 3TI9A 2CUZA 1DZ3A 4NG4A 1RHJA 2GARA 4LDAA 1IBKB 3M3DA 1E1RA 1BJTA 3CW8X 3VYSB 4RL4A 3BRWD 1NG9A 1P9QC 1YYVA 3F6OA 2EZ4A 2IYLD 4RPLA 5FB3A 1U2EA 3ABKH 3GEHA 3WKEA 3JZFA 3KUXA 1ZMBA 3CPJB 3MGGA 4S0ZA 1JT9A 1XZDA 2R60A 5IJ9B 4M9CA 4I2VA 4N12A 4PYKA 1PSDA 4KWCA 4C01A 4KQEA 4NECA 1FYDA 1MMDA 3GLTA 4Q7LA 5FI0B 1QVRA 3CG4A 2FETA 3JSAA 2I2WA 3KXDA 4AUMA 4DE5A 2F55A 3WMEA 3L0DA 5KKCA 2UXDB 3E8SA 4RPGA 3BERA 3NEAA 2JLYA 4JC0A 1V9SA 1MORA 5AMXA 1ABEA 4KWEA 5HLGA