2ZFUA

Structure of the methyltransferase-like domain of nucleomethylin
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
212
structure length
212
Chain Sequence
AQRLDGARFRYLNEQLYSGPSSAAQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNPVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFCLSLMGTNIRDFLEEANRVLKPGGLLKVAEVSSRFEDVRTFLRAVTKLGFKIVSKDLTNSHFFLFDFQKTGPPLVGPKAQLSGLQLQPCLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Nuclear protein
molecule keywords Cerebral protein 1
publication title Epigenetic control of rDNA loci in response to intracellular energy status
pubmed doi rcsb
source organism Homo sapiens
total genus 70
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2150 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2zfuA01
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 2zfuA02
1ZGJA 4M37A 5EIWA 4AUKA 2C7RA 1YZHA 2H00A 4OQEA 4RVDA 2WA1A 3HCDA 2UYOA 4PCLA 3FTCA 3UWPA 3BKXA 4G56A 4RTRA 3B5IA 4P7FA 1Z3CA 5FADA 5K0CA 1TW3A 3M6UA 4X41A 4BLUA 3BWCA 1PRYA 2B9EA 2H11A 4RYLA 3X0DA 3VSEA 5LQKA 2GAFA 3DUWA 3UJAA 3V8VA 2ZFUA 1YZ3A 3HA7A 1R00A 4GQBA 4ER3A 4UOEA 1INLA 5HIKA 2OBFA 4GOLD 2ORED 1L3BA 3KPYA 5ICEA 3OCJA 5CCXA 2H1RA 3HCCA 2A14A 2EX4A 2P7HA 4RTNA 5DTQA 3THRA 5KYGA 4E70A 3KPJA 4R05A 5FQNA 1VIDA 1BKYA 3CJQA 1D2HA 3KQQA 1NW7A 4AZWA 3GCZA 3LSTA 1SUSA 2XVMA 3AXTA 5B1SA 5K05A 4B17A 3LDFA 3LHDA 1EAMA 3P71T 4CXMA 3AJDA 1MJFA 3C3YA 4DA4A 4HGZA 3B3GA 4MWZA 5GIPE 2AVNA 3KHKA 1ZGAA 5ICFA 5EC8A 5CIYA 3MTIA 1IM8A 1WG8A 1X19A 5E9JA 2GH1A 1DL5A 3UJ9A 3EVAA 1WXXA 4PGGA 2Y1WA 4KW7A 4RWZA 5E1MA 3CC8A 4CKCA 1RJDA 2AN5A 2DULA 3OZTA 4C05A 3IYLW 1R74A 3DULA 3EVBA 2CL5A 2EFJA 3KU1A 3P9KA 5D1HA 5GM2A 4QPNA 2ZWAA 5HILA 3ELWA 4ER7A 3JWJA 5FCDA 3R24A 3EPPA 4GUAA 1R8YA 4FT4A 4U7TB 3UJ8A 2AOUA 4C04A 2GS9A 2FK8A 3FTDA 3SSOA 3FTFA 3Q7EA 3UA3A 5EHIA 2VS1A 4PNEA 3LDGA 1RI4A 3DMGA 1DCTA 2R3SA 2P1DA 3C6KA 1FP1D 4PYKA 4RTJA 4CWAA 3LBFA 3M33A 4HH4A 3R6TA 3PLAE 4JXJA 3DP7A 1BHJA 4LWOA 3OE5A 4QVKA 1UWVA 2WA2A 3LKZA 1M0EA 2PJDA 4OQDA 5GIOE 5DSXA 9MHTA 4DM3A 1KPIA 3KPUA 1X1CA 1KR5A 3SSMA 4V0QA 4C06A 2EJUA 3GRZA 3HCBA 1SVUA 3MERA 3G5LA 1WS6A 2PXCA 1VPTA 2ZWVA 2PVCA 5GWXA 5DM0A 3G2OA 5K01A 3UJDA 5DRYA 2ONZA 5K0GA 4HTFB 3FUVA 4AZVA 2IBSA 1RI1A 3HNRA 4KDCA 4HTFA 5BW4A 2JHCA 5IKMA 3REOA 3A27A 4GC9A 2PXXA 5EPEA 4PWYA 3SXJA 4DQ0A 4ER6A 3EVFA 1JG3A 2GB4A 1JG1A 3BWBA 4GOMD 4M36A 4YUXA 4QQKA 2V74B 5EOVA 5BXYA 4AX8A 4ER0A 4XUCA 4P7GA 2FCAA 3FZGA 2OKCA 2P3LA 3A4TA 2BZGA 3HVIA 2PKWA 3FRIA 3C3PA 4IWNA 3THSA 3KQTA 2CMHA 2QRVB 2PV0A 4KVZA 1EJ0A 2ZLBA 4Y30A 4C07A 1NBIA 3TQSA 1Q0SA 3E8SA 5HIMA 5CM2Z 5DM2A 1BC5A 5LQCA 3PFGA 3DLIA 5C1IA 3GO4A 3NVMB 3K0BA 3KR2A 5KS2A 3FPHA 4O29A 3FRHA 2I9KA 3KQSA 3LBYA 3FPGA 5K0FA 2PY6A 2V7EA 1UFKA 4KDRA 3KQWA 2YXDA 2IH4A 5BP7A 1EG2A 2NYUA 3LCUA 3R3HA 5EKXA 3CCFA 1F3LA 3ID6C 3DXXA 7MHTA 4DF3A 1NW8A 3EVZA 4DMGA 5FHQA 3DR5A 1JTFA 3FTEA 3B89A 1BOOA 3QV2A 2PSSA 1VP9A 2NXEA 4FZVA 4X60A 1QYRA 1XDSA 5ICCA 5CD1A 4PYIA 1AQIA 3DH0A 5EEHA 4DCGA 1X1BA 1NT2A 5T67A 1NV8A 4E31A 1VLMA 3KQPA 3KQYA 2OPBA 3JWIA 1WY7A 4E2WA 4F85A 3EEOA 1XDZA 2JH8A 2F8LA 3I53A 3NW9A 3GU3A 4HSGA 2P7IA 5HIJA 3P8ZA 4PIPA 3ELUA 1VL5A 1G8AA 5KQSA 5KVAA 1ZQ9A 1M6EX 4XUEA 2P40A 1FBNA 4FSXA 1EIZA 4MTLA 1AF7A 3NVKI 3UFBA 1NW5A 2FK7A 3H2BA 4QTTB 3ER8A 4QQNA 2HWKA 1O9HA 1ZG3A 5DX1A 5F2OA 3E23A 1XDUA 3S68A 3P9IA 4PYQA 2PX8A 3I9FA 4EK9A 2VDWA 5LR6A 1YF3A 3G2PA 3NWBA 3LCCA 3P2KA 3SMQA 3KQOA 5GINE 1KYZA 2P3QA 4LG1A 3UA4A 3HA3A 3ME5A 5MHTA 2AOTB 1YFJA 1QZZA 2AR0A 2ONYA 2NP6A 2ESRA 3BZBA 3MCZA 3M6VA 4QTUB 1ZKDA 3A7DA 1RJGA 3HA5A 4QDJA 4H0NA 3UJBA 2C7PA 2CKDA 4GBED 1RJEA 3LL7A 3CBGA 3B3FA 5FTWA 3BT7A 4GC5A 4R6WA 5LQJA 3TFWA 2ZIFA 1RI2A 2Q41A 2JHPA 2O57A 3MQ2A 2BM8A 4X61A 2PT6A 3G89A 3PB3A 3KR1A 2HR1A 5T6BA 3G8BA 4C08A 2C7QA 1I1NA 5K0EA 2BM9A 4QVGA 3G2MA 1JSXA 3SM3A 4E2XA 4YMGA 4U7PB 1RI3A 4XUDA 2IH5A 3MB5A 2G1PA 2PLWA 3ELYA 5F2NA 4BLWA 3QOXA 3GRUA 3M70A 5JR3A 4RVHA 3IEIA 3BGIA 5FQOA 2ZVJA 1NE2A 1UIRA 2EG5A 3KPWA 2P35A 2QE6A 5HOQA 4RTMA 2DPMA 4R6XA 3NJRA 2AN4A 2YUIA 3TLJA 1L1EA 4K6MA 5LSAA 2Z6UA 5H02A 2IDJA 2NP7A 5DX0A 3KR0A 3OPNA 5DX8A 4KWCA 5F2KA 4YUZA 3BWYA 2B3TA 2BR4A 2YVLA 3HEMA 2PBFA 3KQMA 2PWYA 3LKDA 4HG2A 5E8RA 4RTSA 4Z2YA 4EKGA 4M7RA 5D1NA 2HNKA 4MIKA 5GOZA 4X63A 4CKBA 5IH3A 1N7IA 1T43A 1RJFA 4A6EA 3NWEA 5EMKA 3LGAA 2ZW9A 3GWZA 3ORHA 4LWPA 1Q0TA 5K03A 2I7CA 1R18A 3MGGA 4GOND 4A6DA 3AY0A 3LDUA 2YX1A 3P9NA 2ZTHA 3HVHA 5E1BA 2AOVA 1JG4A 2ZSUA 3I64A 3T7RA 4XCXA 5FWDA 3PFHA 5CVEA 4CTJA 4OX9Y 5P8WA 1JQ3A 1YUBA 2VP3A 5CCBA 4YMHA 3EEYA 3DTNA 3E7PA 3G88A 5GP1A 2OYRA 3R9XB 3M4XA 4YV1A 1WXWA 2XVAA 4GOOD 5GM1A 2ZCJA 5EGSA 5DRTA 2VDVE 2XYVA 3SGLA 1EQAA 4IKPA 1B42A 3CJTA 2FPOA 2B2CA 3K6RA 5HFJA 3T7SA 3TM5A 3G8AA 1XCJA 2ZIGA 1QAOA 3M6WA 3PX3A 4ER5A 1P39A 3EVCA 1JTEA 1KPGA 1KYWA 4PYLA 2G71A 2QRVA 5EMMA 1ZHFA 5E2AA 3TR6A 1FP2A 2G8NA 2O06A 5CVUA 1WZNA 5EZSA 5HIIA 2NXCA 2I6GA 2N47A 4RVFA 5C9ZA 4CTKA 3BKWA 5K0LA 1D2CA 2OY0A 2JHAA 3B3JA 3EGEA 2IGTA 1SKMA 1JQEA 2OB1A 3GJYA 2HTEA 2QY6A 3HVKA 4E33A 3FPJA 3GRYA 1IY9A 1F38A 1QAQA 3P9CA 1X1DA 3PS9A 3PTAA 3UJ7A 3ER9A 4PIMA 2YXLA 3DLCA 3FUTA 1KXZA 1O9GA 3EVGA 1HMYA 1ORIA 4RX1A 2E5WA 2ZIEA 2JJQA 4EVIA 5BW5A 3TKAA 2BR5A 3HVJA 4MQ4A 2CWWA 1KIAA 4V0RA 3FPEA 3RODA 2IH2A 1SQFA 3NTVA 2AOXA 2YR0A 3CJRA 1DUSA 2G72A 5DM1A 4Y2HA 2AOWA 1XCLA 5FA8A 2AVDA 4DCMA 2EJTA 4PCAA 3O7WA 1SQGA 2QM3A 1NW3A 3EGVA 3HTXA 4PYJA 4E2YA 2AS0A 3FUUA 1JSZA 5E1OA 5HEKA 5C0OE 3V97A 4EQZA 4OBWA 3DMHA 5CVDA 3IV6A 1MHTA 2OO3A 2UZ4A 5G02A 3CGGA 2IDKA 1R6AA 2P3OA 3M6XA 3PVCA 1NV9A 4QDKA 1G38A 3VC2A 5ERGB 2UYQA 3T0IA 4HC4A 1RI5A 3T7TA 2GPYA 3VYWA 2O05A 3A26A 2ZZMA 3FYDA 4EMSA 4FT2A 4M38A 1X1AA 1KHHA 2ADMA 4GEKA 3NDJA 4ISCA 1P1CA 4R8RA 1IXKA 2IIPA 1L3CA 3Q87B 4QPPA 1JR4A 2P41A 3B7PA 2PWPA 3LX6A 3FYCA 1TW2A 2PXAA 4LECA 4OA8A 3U81A 2AOTA 3F4KA 1H1DA 3TOSA 1VQ1A 3GDHA 3L8DA 4RTOA 4PINA 3ERCA 3NMUF 2KW5A 3PT9A 1AQJA 1NW6A 1NKVA 3G5TA 3P2IA 1G55A 5DT2A 1NBHA 2FRXA 2ERCA 3GRRA 4E2ZA 4BY9E 3KPVA 3LPMA 5K0NA 2P8JA 2QYOA 4PYMA 5DPMA 3BXOA 3OU7A 4YUYA 2ZULA 4FS8A 3EVEA 3SR4A 1AV6A 3KKZA 3BUSA 3D2LA 1U2ZA 4F84A 4YUWA 1M6YA 2ZZKA 2C7OA 2ZBRA 5K0BA 5EIFA 5EMLA 2PX2A 5DXJA 4RTPA 5EG5A 2O0LA 4IV0A 5E2BA 3WSTA 3G7UA 5CVVA 3BGVA 3DOUA 2Z6QA 5K0JA 2HMYB 3OU6A 4PONA 1I9GA 3ELDA 1XXLA 5FWAA 1O54A 2K4MA 3GRVA 1VE3A 4CKEA 3DMFA 5E1DA 3PX2A 5DLYA 5U4XA 4C4AA 1FJXA 3FUWA 1V39A 3C0KA 2VZ9A 2NXNA 3MTEA 2NNWB 1TPYA 4NECA 1KPHA 5HZMA 2Z6AA 3GXOA 5DM4A 5EQJB 1G6Q1 2WK1A 3IHTA 3EMDA 2PX4A 3AXSA 3MAGA 1R8XA 2I62A 2G70A 5FULA 2LD4A 3G2QA 4IV8A 5DTRA 5K8VA 3HM2A 2AOUB 1PJZA 3CVOA 2PGXA 3EVDA 3GGDA 2O07A 1JG2A 3VC1A 2UYHA 3OFJA 4ZTBA 5EVJA 1HNNA 1G8SA 5E9WA 1KP9A 2OZVA 3CKKA 4HRAA 4R8SA 3TMAA 4KRGA 4DKJA 10MHA 3JWHA 4FP9A 4YUVA 1I4WA 3OZRA 3HCAA 3OZSA 1YB2A 2ZBQA 5KQRA 3SVZA 3UJCA 2AN3A 3AWIA 4C03A 4RVGA 3SSNA 4OBXA 4DZRA 4WXHA 2XYRA 2AZTA 5EHGA 4BP1A 4E32A 2JH9A 2VDUE 5FA5A 4RSRA 3RIEA 1N2XA 2GLUA 1OR8A 3EMBA 5K09A 4ATNA 5FUBA 1XJ5A 3I5UA 2ZBPA 1ORHA 5CUQA 5E8JA 5LQAA 5JUWA 3C6MA 4MHTA 1VP3A 4PGHA 2B25A 4KIFA 3UJ6A 1VBFA 4PYNA 5EEGA 4RTQA 3TM4A 5EKUA 2XBMA 1SUIA 2BR3A 3FUXA 3R0QA 4F86A 1G60A 2OXTA 4YV0A 4P7JA 2BH2A 2YQZA 3BWMA 2R6ZA 3DXZA 1QAMA 3NDIA 3LECA 3RW9A 4BLVA 4EKIA 4P58A 4RTLA 5M5BA 3HP7A 3UZUA 2GA9A 4OA5A 5CVJA 1Y8CA 3ANXA 3P2EA 1D2GA 3JWGA 3GIWA 4P7KA 4FGZA 3OU2A 3E05A 1FPQA 3FPFA 2OB2A 3KQVA 5DSTA 5E9QA 5FHRA 4RTKA 2B78A 2FYTA 2HV9A 5LQUA 3O4FA 2Y1XA 5LQRA 2JG3A 1P1BA 3DXYA 5DWQA 2IP2A 3OE4A 3I58A 2IFTA 5DTMA 4BP3A 2FHPA 3LCVB 5EMJA 3KR9A 3TRKA 3P97A 2PX5A 2UYCA 4HGYA 1EJ6A 2CMGA 3GNLA 4X1OA 3TPZA 3EGIA 5ICGA 2IBTA 4PYOA 5LQNA 4GF5A 3HCFA 2NXJA 5EZQA 3A7EA 4POOA 4RV9A 4WVLA 1L9KA 4AZSA 8MHTA 1L3IA 4KIGA 5DXAA 4E30A 4L7VA 1P91A 3OFKA 3QOWA 3MCTA 4FR0A 1XVAA 5T64A 1N7JA 4FSDA 4YV2A 3A25A 2YTZA 3BGDA 3O31A 3TKYA 1QANA 2YXEA 3HCEA 2ZZNA 1SG9A 3SX0A 3MHTA 1YFLA 1JQDA 2XYQA 3UBTA 2IPXA 4AZTA 1XTPA 2PT9A
chains in the Genus database with same CATH superfamily
3EBOA 4UXJA 3ZEIA 3WLTA 4P7FA 4RTRA 4KOAA 2B4QA 3BHMA 1J42A 2FJPA 4LVNA 3H1GA 1IWOA 1MABB 4U3JB 4C4PA 4GOLD 3RHZA 1XDBA 3UBMA 3UR3C 1MC4A 2EX4A 3PXCX 4ECAA 3QLUA 4QUDA 4B17A 1ENPA 4HBGA 2XUKA 3IQDB 4WZBB 3X1MA 1RCUA 4A0SA 4HDRA 4AVYA 3P94A 1Q7TA 2C2KA 2OKGA 3WV4A 1R7JA 2P4EA 4CDGA 3JQAB 2F2TA 4G5RA 2WBMA 2MWMA 1L8AA 2PS9A 1MENA 4Q9HA 5BR8B 3FDFA 2H8RA 3PCRB 4PNEA 3GWGA 1O0CA 1FIAA 1GV5A 2WAYA 2IOFK 2QV7A 3N4MA 3C4VA 3IAFA 1RXVA 4PHTA 4YX9A 2FEMA 2WB2A 1DI0A 3SEAA 2ACWA 1M3SA 5LCXA 4E5YA 2NMVA 4MO9A 4JHLA 2GOYA 2EBWA 1J24A 3RSGA 2GXQA 1BAPA 3JZMA 3CLHA 3VAYA 2OUKA 4OMYA 3C1DA 3ZG6A 4KXLA 3JYLA 3SR3A 2HWUA 4YPVA 4HB0A 2L18A 3FPGA 2JBAB 2AJCA 2CUZA 5C8ZA 4H3VA 4O2AB 4Y9TA 1ILWA 3N2YA 4BVAA 1VA4A 2DUWA 3O8RA 3AJRA 1JEYA 1RKBA 2KZGA 3KQPA 3JY6A 1C50A 4B4UA 3NG1A 3BDAA 3CA8A 2OK7A 2JCBA 1G21B 3EZ9A 5DDIP 2GYYA 4LV8B 5C8YF 1S7CA 4IFIA 2IGBA 5AW2A 3UA4A 1K3UB 1I4EB 4WNCA 4OGKA 4KVGA 4XGQA 5IASA 1CUAA 1KSFX 3JSXA 3OL3A 5FNVB 3ZVNA 2COMA 2FSVC 3K8YA 4KXFB 5BN3A 1JR3A 5KYYB 1EGQA 3I32A 4HG2A 2PWYA 3TO7A 4OQLA 1WO8A 4BE1A 3PUXA 3P26A 1NDUA 1NQ5A 4N40A 2WIDA 2YBEA 4MVJP 4Q1AA 4B4WA 3S17J 2FMIA 2M6RA 4AF8A 1HKUA 4OXKA 3GUYA 2QD4A 5KAPA 5F33A 5FD6A 4PX3A 5IS2A 1KQNA 4E5NA 1SUFA 2GYUA 2N1MA 3G1UA 4I3GA 3LLCA 4ZMSA 1NFRA 1DBVO 3FOZA 2WAQN 5CLFA 1HSJA 1FW8A 1VGRA 1F1JA 1W8IA 4LMPA 2CLSA 1OR7C 3BQMB 5B6IA 1J1ZA 1CRZA 1G3MA 3TL3A 5JPDA 2Q8PA 3JQQA 2J9XB 2AF4C 4IEIA 3E9RA 2XE8A 4YK7A 3CRRA 4ASUA 4PPGA 3ZV5A 1UK7A 5HRCA 1G291 5IJ0A 1QO0D 1P1RA 3Q88A 1NN3A 5C1DA 5E7JA 2F6CA 1KSHA 2WOJA 2ZJFA 3JQCA 4Y0AA 1GL6A 4OGFA 1E4EB 2P6TA 3MIZA 3V7UA 3KDPA 4UREA 4N48A 1TF2A 1C29B 1CY1A 2JAXA 3OZRA 2XTNA 1ZX1A 2BSXA 1PNRA 1KO8A 4OBXA 3A4CA 4XDYA 1NU8A 4LGVA 4MVXA 1NF2A 2WADA 3QQ5A 2JAPA 3DV0A 4PSVA 1C2TA 4O4JB 3HDTA 4NDLA 5JWOA 5JAMA 3HE3A 1FP4A 3HVUA 3BWXA 3L6BA 3PF8A 4V0KA 5LFAA 1WIWA 3VPHA 3QKSB 2ATEA 4XIJA 2FZWA 4R2MA 3O73A 1SK8A 3W3CA 4EA6A 1N8NA 1UP7A 1H94A 1FYLA 3O91A 5LA6B 3I04A 5I8PA 1ZN9A 4MICA 4AZSA 3D0OA 4TUYB 4YACA 1TK9A 3PR2B 4ERXA 3ISTA 2BLNA 2P0AA 1XTPA 1CG6A 1F20A 1EWYA 3FWZA 4LPKA 5DMXA 4BUCA 1HLPA 1VBMA 3FTCA 5TXGA 1E3OC 3ZD6A 3C3AA 2EKDA 3C14C 3ZR8X 4WBNB 2IZ1A 1OXBB 3ET4A 4C1BA 2ZYGA 3LLUA 5DTQA 3HPHA 4LY6A 6PAXA 2BFFA 2WWIA 3KCNA 2JGRA 3P71T 3NRVA 1VQKI 5GIPE 2BHSA 1A8PA 3OPYB 1Z2PX 4D0SA 2X9LA 4ZFNA 4RAQA 2C77A 1E5TA 3PSHA 4TYWA 1K97A 4DM7A 1R15A 3RDIA 2BZTA 2IYYA 3TL6A 1MJ9A 3HUDA 3QVGB 4KB5A 4MQUA 1CHNA 4DARA 3O8HA 3JZFA 3QAHA 3TXXA 1QGPA 3JAMK 2VWQA 4GOMD 3CRZA 5EJAA 3NCTA 2HXYA 1PVVA 1M1ZA 1WZ2A 4ZD6A 2QVGA 1XJQA 3AO0B 5AI9A 5EZYA 2ZROA 5AUPB 2C8LA 1QCCA 5FKJA 2Z8YA 4ANJA 2QQAA 3KQWA 1RIFA 2COKA 2CFRA 2EHJA 5IZCA 2OT3B 2E9SA 2FG6C 1WV0A 4NEQA 2YNMC 3IH2A 4XCVA 1JZTA 2V54A 3PFWO 3N28A 1YJNI 5JS8A 4FHDA 1RESA 1GA1A 1SMTA 3BMCB 1P9OA 1E2KA 3Q5DA 3RCBA 1CEYA 3T9EA 1V6AA 3ZHZA 5BMVB 1I2MA 1IF1A 3H4IA 4EEFG 3OL4A 5GINE 4NYIQ 4GBJA 1TRKA 1SC7A 4WVFA 2QU7A 3I6YA 5FV7A 3BJ6A 1SQ5A 4BXOB 3O90A 2LK2A 3I2KA 3DE1X 1I2ZA 2IEKA 1UMDB 5JMPA 3BR3A 4JLBA 2VUTA 2YWDA 3U61B 3RI4A 2WOOA 3N6XA 4EA7A 1N2OA 4LF8B 4OMDA 4RTMA 2E5ZA 3R8FA 4GP6A 1P77A 3QLJA 4QGFA 4ZT6A 3L18A 1Z45A 2OVBA 3RASA 2IU0A 3OH8A 1KS9A 3TRIA 5GOZA 3AUKA 3PFFA 1GUFA 2QMOA 5C4MA 4AWXA 1MT3A 4I02A 1U28A 3R5XA 4FYMA 4YLYA 2POQX 3STHA 1SPXA 3P2MA 1IN8A 4EQ6A 1JALA 3RIGA 1UT6A 3TP0A 2E1PA 3K2ZA 2V98A 1IE3A 4EGYA 1I36A 3QMWA 1PYDA 3EGCA 4EPWA 5HF9A 4ZRNA 1MJGA 5F76A 1OCTC 3RVQA 4KR9A 5IT9K 1RIOH 4RV5A 4Y2SA 4RESA 2DF8A 2DWOA 3D7LA 2AFIE 5FL7D 3U3DA 4LYJA 5B1EA 3HA2A 3IAM2 1CR6A 3CF2A 1T24A 5BQPA 1OWNA 4JP1A 1MHTA 3VBEA 2RH9B 2TCTA 3N8DA 2EFNA 2VSXA 1QE5A 3NDJA 5AJHA 4BE0A 2UUBB 2ZAGA 3I6IA 4FMDF 3O2QB 4JSRA 4G81A 1RWBA 1N5LA 4MWOA 4JBLA 4JUCA 2AMJA 1ZMXA 4L4RA 3PL8A 3ZOBA 3R6WA 3C3XA 5KSYA 2O8DB 3F6PA 2WNIA 1KRXA 1YBHA 1KP9A 4BNCA 4OQFA 2I4IA 2I6QA 3M9AA 2WMNB 3UCFA 2XYRA 2HCRA 2Q8NA 3F9CA 2W8BB 3L1JA 3D8HA 2FMHA 2B25A 4COKA 2QTZA 3IHKA 2X0DA 1D2EA 1I8TA 4ZAYA 3CPSA 3QWAA 3KWJA 4MR9B 1PR3A 4IXMA 2RARA 5M5BA 2GBIA 4RJ2A 3DT6A 5BR7A 3JWGA 5DGIA 3K0SA 4D44A 4EATA 4JVSB 1RKQA 4XOIA 2VVTA 4YQZA 3C43A 521PA 2Q3MA 4DSOA 4BNUA 5FYQA 4R1LA 1KU2A 2EJBA 5EUQB 4DLAA 3ZIAD 1HORA 2LW7A 3B60A 1KTIA 2BDTA 3UV3A 1DXYA 3OIDA 1EFPB 1E69A 3HOVJ 4TWBA 1Y89A 4FR2A 4JNKA 2GZRA 4UHDA 1LQ2A 2FKNA 3IIMA 4CCOA 1LPSA 2DGDA 3NAZA 1ZIDA 3MWYW 2VHVA 2XH8A 2K40A 4IRIA 5ICEA 2FUG2 3TRFA 2F1RA 1QGAA 2CJPA 1BYUA 5C5IA 4NC8A 1T29A 3SYTA 1JEAA 3QXGA 4JJKA 4XCQA 4CTNA 3FHJA 4NOMA 4CKCA 3AG2H 2YXNA 4H6XA 4WXRA 2DJIA 3EUKL 2P27A 4BB0A 2K7LA 4RJIA 2J5QA 4IUCS 5HLGA 1EVEA 3M3HA 1ZHOA 2XTZA 4YEJA 2XZOA 1W7PB 4PSUA 3ZBUA 3G1WA 4HNTA 1KR5A 1DQRA 1VB5A 5CLJA 3EZ2A 2WWWA 3KB2A 3IE2A 4QXRA 4WQMA 2ZBGA 5AVUA 1ETWA 4IIEA 3OCVA 4UZFA 1UJ5A 2FZKA 1MIJA 1J2JA 1I7NA 2J1LA 2C98A 2PPVA 3KLBA 2DO7A 3SX2A 3AJ8A 4ZO8A 2C9CA 1DDOA 5CM2Z 1WBJB 1VL1A 1GAWA 5ENDA 4LXGA 3ND6A 1Y3DE 2NAPA 1MX3A 3LUBA 3HZHA 1TNSA 5EJFA 1QZXA 3TNDA 2AEMA 4K6KA 1R58A 1U7PA 4KGZA 1L4KA 4FB4A 1XJWA 1L5WA 4B3FX 4XWWA 1Y82A 3A31A 3JZDA 5CA1F 5BNWA 4ZQIA 2CXRA 2J5KA 5KQSA 1VIMA 2M6KA 3K70C 2MJLA 5JHFA 1YU9A 2R47A 3ROQA 1FVFA 1CZHA 1MNMC 4MV1A 5A5EA 3CISA 2BGKA 4CCJA 4HNQA 1NQVA 2DVMA 5JBQA 1DCFA 2KMUA 1CUHA 2GFHA 5EIXA 1T8UA 3EH1A 3U6BA 4F5DA 4R6WA 4Q39A 4F38A 2UUAB 5CLIA 4I9HA 3MJVA 2HX1A 2O2DA 1GYPA 2BM9A 4XDZA 1RI3A 2I6XA 3THWB 2GM3A 2VHEA 2AE1A 2HIHA 4II7A 4B7CA 2DPLA 4IXTA 1L5NA 2JFVA 1YRLA 3ZCSA 1H0KA 3NEJA 1CJVC 4ZYEA 4LFCB 3KG2A 3A10A 2QTVA 2GEBA 4QRIA 2AN9A 3VNRA 3RC8A 3ETNA 5FKMA 1QKIA 1VL2A 3A58B 3BXZA 1UL1X 4MI6A 2R86A 3ICQB 3LP5A 3EDOA 1TTQB 4PLWA 3GLVA 4D9JA 2HZBA 3A6JA 3K6GA 4DDHA 4RS4A 1V95A 5DE3A 3K73O 4ZVNA 5IUKC 5AKLA 2W6IA 2WFAA 3WKEA 3WZLA 4F97A 4HDUA 4TMXA 3IH4A 2PUCA 1WRBA 1IMOA 2PHZA 3HCOA 3QNWA 1GPAA 1NFQA 1J59A 1JDSA 3IUJA 1HBJA 2CS3A 2RGYA 5CT8A 4KQ2A 4IGIA 1V5EA 4AC0A 4OIOF 1B14A 2AF3C 1PGPA 2GARA 4MDEA 4XIYA 1UJ6A 1TT0A 5HK9A 5DH9A 3QOYA 3E9EA 5CYOA 5TF4A 3TRHA 1YTYA 1ICEA 1VQ1A 3ZQ7A 1YCDA 1YUNA 5DGXA 1KI8A 1UMBB 1JA1A 4LYFA 1VI0A 3S2YA 1JHFA 2FKAA 4L5JA 1I9GA 1XXLA 2WIGA 5J2UF 5DBEX 4FNAA 4AO8A 2HMTA 1JDTA 4D3FA 1EYZA 3E6CC 1R8XA 4DIEA 4PHHA 4KRGA 2XI4A 1ZD1A 2DH5A 5ALNA 1G41A 2LGJA 5CK5A 1T98A 3AAFA 4UU1A 4F2DA 5KJ1A 4ZVKA 4QVIA 5DEIA 1AGXA 3DDCA 4A6PA 2YQZA 5FWXA 3E1KA 1IUPA 5EYPA 3IR6A 5E9QA 5CLSA 2HV9A 2Z16A 1PG5A 1YGPA 3FYUA 3UMBA 4A5NA 4Y52J 1DAKA 1BWPA 4CHTA 3BHNA 1KJNA 2A3SA 3M1LA 1QP0A 4DIBA 2X8JA 1MJNA 3QE2A 4M71A 3PD1A 1K8ZB 3ESDA 1YWGO 2QLTA 1LEBA 4DWJA 4PSKA 4WNAB 5LGUA 4ENKA 2J4DA 1CLUA 2PTHA 3ZS8A 1JT2A 1QGED 3FPSA 1Z4JA 4AD8A 4FFSA 1Z6XA 1RE1A 3CE6A 3UH0A 2H1HA 1T4CA 5PGMA 3QEOA 4UVCA 3OZCA 1CBUA 1XRQA 2C57A 3EVBA 2VBCA 2Q5JA 4KSBA 5DEQA 5KYWA 3RUHA 1CB7A 2X6RA 4H3KB 2D3WA 1TZJA 1JTVA 4EZIA 4DCNA 4BE2A 2LCIA 1FMJA 3WJ7A 2VXCA 4I6ZA 5IVDA 4RKWA 4CU2A 2ZIUB 4FVTA 1WW2A 3IDSA 4R0VA 1FXSA 1K78A 3AEKB 1ST2A 1SFXA 4MRVA 2NOJB 3OS0A 1CY2A 2W4MA 1Q1QA 1NNLA 1P7IA 4PF1A 4MNTA 4YDQA 2KQRA 2P6UA 4DJDC 3THYA 1PZHA 2PRJA 2ATVA 3QQAA 3M4OJ 5TPWA 4ZOAA 4QM7A 2DLLA 2C54A 1MAVA 3W4JA 4RK1A 3ZQGA 2HY7A 3EVZA 4KBYA 3B89A 5TDHA 4HAOA 4ECEA 1GAEO 5EEHA 3DH0A 4Q9KA 4PLFA 3G1OA 4EG6A 1C30A 4JNCA 1N33B 3EN0A 4H1HA 4HXGA 4INZA 3LCCA 1V4BA 5EG0A 3H8JA 3EGDA 1E3WA 3KALA 1K27A 4O2LA 2A30A 1SHTX 3OBIA 1ISGA 3KK0A 3I4CA 3WK7A 3BMNB 2NYRA 1L1RA 1U1EA 4I8XA 1OT5A 1EHCA 2QNBA 2EJWA 1WKMA 4KMFA 2A61A 2QPTA 5H02A 1DQUA 2E6UX 4YWJA 3D7MA 2A78A 4LHVA 4YV7A 2I7CA 1N5JA 5IP6A 2R25B 4MULA 4O2BF 1M1UA 4WK2B 4A3SA 2ZKZA 1ODLA 4OMUA 2QD3A 1JQKA 2QN3A 2VDVE 1TWAJ 3FWKA 2ZUDA 4QYTA 4N7JA 3PXDA 4CHUA 3RF7A 1FP2A 5AONA 2PO7A 4ONEA 2O06A 3OOPA 3O7MA 2PQ2A 4HLQB 2HBQA 2E2HJ 4PIMA 3LKBA 1PT5A 4BNNA 2ZR9A 3RSCA 3RVSA 1MAAA 2A92A 4GRAA 1AA9A 5ALSA 1VKHA 2P5UA 5EWMB 1KJWA 3Q3IA 2ODWA 3BQ9A 4KR7A 4LJ9A 2VXOA 4OYRA 4FONA 3M7IA 3R76A 4EV0A 4J0CA 1ECFA 1EM8A 2QPOA 4M8NE 4ZQBA 3N05A 1H9GA 2JFWA 3QXCA 3OF5A 3PGVA 2IS2A 4UQLA 3V32A 4HF1A 3IPRA 1MD0A 3JYNA 2OU2A 4CZZA 3PT5A 5AXCA 2HJRA 5THXA 4DIFA 1TD1A 3MB8A 3C3CA 5KTPA 1VFPA 5G4KB 1P45A 3RSFA 1SU8A 1ZXBA 3MUFA 3LIPA 3QXXA 3F0TA 1GT0C 1KO1A 4GMHA 1W4RA 3CH7A 4M1YA 4NBQA 1NI4A 3ED5A 1ZK4A 2RGAA 4N7RA 1JKFA 4LB5A 4DSZA 4KO1S 4XDGA 3TIFA 4CMEC 2O5CA 4LOHA 4PGHA 2L02A 1GHCA 3QYJA 4BKOA 2XXJA 5B64A 4ZVOA 4K9OA 4TGLA 3B5JA 2PH3A 5EKUA 1MDFA 4B3SB 4YMIA 3K5HA 3KJGA 3ZWYA 1KQPA 2OD5A 4ZP1A 4LDQA 2B78A 2ZTVA 4HAIA 2A6EF 5C1BA 4WUTA 2IP2A 2M4GA 4EUHA 2NOGA 1R5HA 1Y1WJ 4D5EA 1RKWA 2VPQA 5GOTA 4D57A 2DMNA 1CX9B 3BXPA 4V0OA 5BN1A 2EDCA 3COAC 1WL8A 2I55A 4RCYA 3TVYA 3GFIA 2ID7A 4L8VA 4QAQA 4FQ5A 4WXYB 3JARB 4LZAA 2FPXA 4RDIA 2QUZA 5F1PA 1TZCA 1PG2A 4E7ZA 4BKMA 4DIMA 4DBRA 3L2VA 2IOHA 4D4KA 3B3GA 2Q2VA 1X19A 3HTSB 5DT9A 4IIUA 1MZVA 1SEPA 3AILA 1X7ZA 5D1HA 1ZD4A 4EHLA 2A7QA 2LY1A 4Z0PA 1T0PA 1E3MA 3L6EA 3HCPA 1XKQA 1OJLA 3A9VA 3QF4B 4ZANA 3VH2A 1O58A 2HHLA 3ISVA 1H6BA 3DD5A 3JW4A 3TLKA 2BEUA 4ZOLA 2VNJA 1CUSA 4K6FA 2P2SA 3QPDA 2JD2A 1P7WA 4ITUA 2PBRA 3DZBA 1MMAA 1TU0A 4MTEA 2LIVA 3ZPLA 2QRVB 1XXHB 3ZU3A 4XM0A 4H7PA 5DM2A 4OQZA 3TB4A 3DFIA 3DE2X 3H8SA 3GOQA 2BBOA 4UVDA 4GBMA 3VZBA 2F3RA 4GYKA 5IYZF 2XUAA 4IXNA 2DMPA 3QV2A 3KB6A 5AW0A 2Q62A 1A76A 1WF3A 2XMGA 3C4QA 3R3VA 4KQIA 2AXNA 4B85A 1O97C 3TQFA 3WSVA 2ZUSA 2JFZA 5FBHA 3LY5A 2HRDA 3FSGD 4MW1A 5G1OA 3U1KA 1Z2NX 3I9FA 4ZEWA 3QPSA 3JQ7A 4TLLB 4C22A 3DLAA 2R7SA 2AR9A 2NUPA 1DXQA 4BY7J 4NONA 1NXTA 1RJEA 1WKBA 2FVYA 4KGDA 3T3PB 3RFVA 2YJ4A 2EF1A 1OBCA 4M46A 1JVSA 2DFLA 4JBXA 3GRUA 3IAM6 3JR9A 4C0SA 1MOSA 1O5OA 3ONVA 3FDYA 4I09A 5JLWA 1E98A 1W5EA 4U00A 1X1PA 4RK7A 1YFZA 1Q1BA 1P6QA 2Q4DA 2EFWA 5IH3A 4AT1A 1Q0TA 1W0TA 3T7RA 1CYDA 4BQAA 4E0BA 2B5WA 1WXWA 5IARA 2JB9A 2FZ5A 1GSHA 1B42A 3MYRA 4RH3A 1L5YA 3JRAA 4G1UC 5JH7A 3IAEA 4A0FA 1XELA 4XW2A 1TM2A 1MQ9A 2VXDA 1DC6A 1ZMBA 1THZA 1UXKA 1H2BA 1GGVA 3ETJA 1PS0A 1WU8A 4LVCA 2B7CA 3DWLE 5I7UA 3FK7A 1SK9A 4INAA 4IDAA 4RIIA 5KMGA 3GRKA 4BAUA 1FQJA 4FGKA 4EQZA 5FUVA 5D4RA 3DMTC 4GRDA 2PG3A 1E0KA 5M3FJ 4XJVA 4E5SA 3PNQA 2IBMA 1GA6A 5KNCD 1XVTA 1XQVA 1ZUIA 1M2VA 2IZ0A 2JA2A 1JBQA 2JVKA 3ZCRA 2FDCA 4NE7A 1V71A 4UUSB 3RSHA 5I5GA 1W94A 1BX0A 1VECA 5AW7A 2VJLA 2H7CA 5HZHA 2ZBEA 2PBIA 2NV6A 2WD8A 3IOMA 2HQOA 1U8EA 5EXEA 3DLPX 2O03A 3HRKA 4FZJA 2MR5A 2PX4A 1ZS9A 2O3JA 4PCVA 2YU9J 3NHFA 1BHQ1 3HXLA 3HYSA 4FX2A 5ECYA 2WUEA 1SOVA 2ALJA 1DFHA 1IQPA 4DLNA 2R4UA 3MWJA 1YO6A 4CGYA 4Q1EA 4XLFA 2MA3A 4WTOA 2O2JA 4A5MA 3OYGA 4Q9DA 2G09A 2XBMA 4PEVA 2OO5A 4Q01A 1AKTA 3G6EI 1ZNQO 2CZQA 4B2LA 3TFOA 3AV3A 3SDZA 3WYCA 5FHRA 4CCLA 2FWIA 4RTKA 1LX7A 1A9OA 1E2EA 2VTVA 1JQAA 3N3BC 4EGSA 5EMJA 5CAEB 2BSQA 4O3MA 1Y6IA 3LPCA 1KJQA 3RVMA 1JG6A 4J16C 4PPFA 1T9BA 2BBWA 1R4MA 5DXAA 4YC7A 2ZB7A 2OO7A 2V7VA 3QOWA 4PXSA 5L6LB 3TQCA 2F7SA 2X9DA 3V1UA 1OSNA 3BWGA 4D9FA 3INNA 5GJWC 3E82A 3BPVA 1TJ3A 3LI2A 3ZW7A 2PT9A 2W6NA 2NO5A 3QFSA 2ERYA 3LD9A 4GS5A 3NM6B 5B1AH 4ZO6A 3DV2A 5JMWA 2G0EA 4JP5A 1Z3IX 4QOHA 3VJMA 1QV6A 3DTEA 3V7SA 3WLAA 3IQFA 2ECOA 4OHXA 1U63A 1IL0A 4WLOA 3WOVA 2Z1NA 1GGJA 2QD1A 4J1TC 4DLWA 3QHAA 3PFBA 2LPMA 4IIDA 2HWYA 2AEJA 3MRXA 2BRUA 1JW9B 1GSOA 3HSKA 1KF0A 4J2HA 4I55B 3JRBA 2QGNA 4C04A 4FM9A 3ROEA 3CVXA 2BZSA 3T95A 4C3VA 3JZIA 5IPFA 4IJVA 1A4UA 3VKWA 3UAVA 3AHCA 3KEYA 1OTHA 2RKWA 4DA8A 3MTGA 4EPXA 3NAUA 3CC4I 3FHLA 2W9XA 2VJOA 4TS1A 2WP8J 3P96A 2VODA 4RGUA 2PGLA 4CDMA 1FMVA 1BX1A 4R83A 3B13B 3GI1A 4JI8B 2JJ7A 3CEHA 1TVKB 2EATA 4M83A 1E32A 1M2KA 1WXDA 2DQYA 2WYIA 4GI7A 1NLZA 1XKXA 2CW0F 2GXUA 1ZY2A 1M83A 4FZVA 1MQSA 4B83A 5AJWA 2DOAA 3KNZA 4GH5A 3OIOA 3GLXA 2ZRPA 5J47A 5DBGA 3DFUA 5JD6A 1TA9A 2ZVQX 4IHKA 1A9TA 4LN1A 3I73A 5D3MA 4IJKA 2Q21A 5BWCA 1KDPA 2XYHA 3OQOA 1DARA 1KFEB 3HBLA 3BZKA 4JENA 3C7CB 3VJLA 3WKAA 2CDAA 3NUQA 3L6OO 2VQGA 5KQMA 4RY2A 4A2WA 1XHEA 5GZ6A 2HA2A 2QE6A 1QQ6A 3VPCA 1L1EA 2C29D 4L28A 2OQ2A 3L92A 2KIMA 2WLSA 1ITYA 3PUKA 4G5FA 1AKUA 3OOHA 1K6EA 1MMSA 5CEEA 5F78A 4MQLA 4XD7A 4DQKA 5IXJA 3QMPA 2QS9A 2KPOA 4EJSB 3KRTA 4AN1A 3G4SI 3OIQA 4S1TA 4YCBA 3VR5H 5H68A 3WFIA 1DELA 3K5IA 3EETA 3FKSD 3CX7A 4FOOA 1FNDA 1SUDA 2G17A 5CVUA 2WTAA 3L0SA 2I6GA 2N47A 3GHHA 4KN4X 4F6LA 1D3AA 3OEHD 3BG3A 1VB3A 1J0BA 2QI9C 3V8QA 1ULHA 3JRWA 4ETMA 1RS0A 3E8MA 4EB6A 5BW5A 3FHTA 2KLOA 4CIDA 7YASA 2VPYA 1RCFA 3TL2A 1B72B 4E22A 3K4PA 2O61A 3FUUA 3CN9A 2AXQA 3FCUB 3ZVRA 3D3EA 1HBXG 1HSTA 3WL7A 4LMYA 3ASYA 1FOYA 3PA6A 3SDGA 1I3AA 2QQ9A 3E1GA 4ZC3A 3TQHA 2CXOA 2H29A 1W19A 1X1SA 2ZRAA 4AS1A 1ZELA 1U3FA 1VBNA 2W98A 4MZXA 2JD1A 4PSXA 2VF4X 1V8DA 3C1OA 1U8BA 4DT1B 4B7XA 1YI2I 4JS0A 4S2UA 1WOYA 5IEBA 5E1DA 1BHO1 3G17A 3TQRA 5KEIA 3KOUA 2MYSA 4KXYA 5HZMA 2KLBA 1D2MA 1GZ6A 4MUEA 2WJVA 1GDDA 3R3YA 4TL6A 1G8SA 2XB6A 1MEEA 4NKRA 2JANA 1SCJA 5C44J 5E3HA 1FYKA 1X6VA 4B9EA 4MYHA 3NTXA 2AS5F 2FD5A 3OJ0A 3C6MA 4GP9A 3OYEA 3B1XA 3CUYA 3A03A 1KEZA 3QPAA 1WSBA 1LNQA 3BWMA 2RC5A 1VQNI 4YJHA 1II8B 2BAGA 3ICEA 1M2HA 2QMEA 5JFRA 3BQNB 4PQFA 2JGDA 4CT5A 1N2BA 3DKIA 1RJ9B 1L1QA 3M4ZA 3KWLA 4TV8B 2IXGA 4NH0A 4A0RA 1XA3A 4OAQA 1T0FA 3TN7A 5KVVA 4O5AA 4S12A 4LJ5A 2IA0A 2VJIA 2C8VA 4YRFA 2FWMX 4LGYA 4O4IA 3ZK9A 3F3YA 2C96A 2R4TA 2GPSA 3AINA 1FQOA 3QVXA 4NZOA 4MWEA 3K31A 3S2FA 4ISBA 1Q77A 1L3BA 1SC4A 4JR1A 5J1YA 5CCXA 2F67A 2OCPA 5CHEA 3CJQA 1D1SA 2C84A 4BKRA 1KORA 1FX0B 3EDPA 3FG9A 2P5SA 4MS4B 3GTPJ 1UPXA 3I59B 3T1TA 3IYLW 4AM3A 4AYBA 4ER7A 4JYAB 4PU0A 4DCUA 1CV2A 3FUCA 5LP6F 5E3IA 2R1ZA 3F46A 4ZDLA 1BA3A 5ERXA 2W2KB 3GZ5A 4Q12A 2NO0A 3KP5A 3RUIA 2VQ6A 3MGAA 3G8YA 1KI9A 3RYCB 3KHSA 4CKBB 3EQLF 4DJEC 5AOBA 3MMYB 2QTCA 1Q1AA 1COZA 5F3WB 2G76A 2G07A 2JHCA 4PLZA 4JXKA 1P2BA 2HLNA 2VSQA 1EUZA 2PKWA 4MW4A 2NYAA 4E88A 1TC2A 4PZYA 3QWBA 2ZE5A 1E3SA 1GQRA 2A0WA 5BURA 2HSEA 3P0JA 3BCUA 5KYXB 2C7VA 3EUWA 7MHTA 4LB6B 2NXEA 3INRA 3UQYS 5BWNA 4U9HS 3LVQE 3I9LA 2QBYA 1LLQA 2WYHA 3BRQA 3O26A 4KE7A 1SXIA 3S99A 2G1JA 5FPYA 1X9IA 3KAPA 1EX1A 4KICA 4I6JA 2JA1A 4M8SA 1ETQA 4AQ7A 3OHPA 1Q91A 1YW9A 1O3QA 3EC7A 1U98A 3HR7A 4IF6A 3DWGA 1M2OA 5CB0A 5K7ZA 1NE7A 1MQAA 2B69A 1QC5B 2Q7XA 3BPSA 1HTBA 4BO8A 2P2YA 5CYPA 4NABA 3SM3A 4U7PB 4X20B 3MB5A 1AVTA 1XD9A 1J6UA 3TNJA 2Y9PB 2YMLA 4WI1A 5B5SA 5BUSA 2VBWA 2ATXA 3AVYA 2JGEA 5BQ5A 4KCGA 1XPXA 4Y17A 4KWCA 2YVLA 4QEKA 1JMVA 3ITEA 4FINA 1MH3A 2LUOA 3OI7A 3QKRA 2GPAA 3BMQB 3A6KA 4JH0A 4CCAA 4TTIA 1XSVA 3V2GA 1MXFA 3HI4A 3CZPA 3LF1A 4RL4A 4BLOA 1PGOA 1BS2A 1F8YA 3REFA 1QO7A 4DA0A 3GLSA 1BWSA 1SUPA 2RK4A 4BAYA 1VRVA 3DGFC 2R7ZJ 4JI3B 2HJ9A 5CG2A 1QMGA 3OMLA 1S7AA 3H5OA 5BNZA 5LYJF 2GYWA 4MQ4A 3K7EA 5ABPA 2FVXA 4GLJA 5F77A 1C9KA 1IOWA 3WWCA 3I1YA 5ALDA 4O4HB 1NK2P 4ZGWA 3TQTA 3WGHA 3VNQA 2J8ZA 4HLCA 2ZRMA 3T7TA 3QRFF 2HU7A 1A2KC 1VZ2A 1WJ5A 1YI1A 3GLFE 2BEOA 1L5ZA 2B4YA 2HRRA 1JE8A 1GPNA 4WOJA 1IJEA 1EVLA 4X3PA 5MFPA 3H6GA 5E3JA 2ZBRA 5E2BA 3TLCA 2ZWOA 4YCDA 5DLYA 2QTLA 2KB0A 3BAFA 2BV6A 3V1TC 1CQWA 4UUPA 3FH0A 3EODA 3FDIA 1FZQA 5D8KB 1W4CA 3IOYA 4F55A 4A9AA 2P91A 4UBJA 2WFLA 4EM2A 3FXQA 1BIAA 2IS1A 2NGRA 2Q7OE 1V1RB 5DM6F 1VJ5A 4QA9A 1FTWA 1SELA 4ZMRA 3U39A 3N5CA 4UC0A 4Z9YA 3KIOA 1KSJA 3LA7A 2XMRA 2Z2XA 5EE0A 3I09A 2MDTA 3IWFA 3MOGA 2ZTMA 3CLVA 1EGVB 1XMSA 4TLEA 4X3CA 3TQNA 4NCXA 1W8DA 2GEVA 2WYWA 1PJ3A 4GVXA 3ITDA 3T3IA 1H42A 2K2WA 2Y92A 3PUYA 1TK2A 3GFMA 5TNXA 1QOPB 3URKA 1J5XA 1T2UA 3A0BC 4ENQA 1SH7A 4R1UA 4BVJA 4W97A 5IZ4A 1FSHA 4ENWA 4BB6A 1KEUA 1WR8A 3EDYA 1XBTA 1KAGA 1W73A 2XYQA 1TMOA 1X8KA 2KRCA 2X8BA 4BN4A 2XA2A 3HCDA 2FR0A 4IX1A 4JDPA 5FUYA 2J5OA 3W7AA 3LPNA 4CQMD 1NR5A 3ESWB 2VL8A 4U6SA 2XKAA 3GN1A 4NG5A 2HA6A 4QT4A 2P7VB 4JL6A 3F23A 4YCSA 4Z3DA 3NM4A 1RBYA 4O5OA 4PW0A 2D62A 4RMGA 3IBCA 5GMOA 4P38A 3AJ9A 3U4IA 5AK0A 2E36A 4EFLA 5ICSA 3BCHA 3U9SA 4E7HA 1L5HA 3MD9A 5I9NA 1UWVA 3L1IA 1OLXA 5ALKA 4H1WA 4DG5A 4QIHA 2PSFA 4P22A 1U2EA 4P1WA 3CUWA 3E22B 1S8FA 2H92A 5JCXA 4M36A 4YUXA 3MMPA 4F5EA 1CF7B 4IUBS 4AI6A 2A9OA 4WXPA 1HDGO 4OL0A 1Y42X 4O8CA 3AESA 1XSDA 1CQJA 4PFJA 1TC1A 3GEGA 1QA6A 3SQMA 1N32B 2GWHA 3R60A 3Q8XB 2EKLA 2ZS9A 1LZKA 4IR7A 1MBJA 4AS3A 2GHQA 4JLKA 2XUBA 3KP7A 4HMPA 1OC4A 5IP9J 1E2BA 2O7RA 5BNFA 2Q1UA 2BD0A 4G1VA 1GJRA 4EPRA 1YZUA 3KZOA 3I5MA 2XXAA 5HXAA 2NSYA 3CIFA 3CC2I 1H0MA 3QFCA 2VSYA 2C03A 4CHGA 1V6SA 1SD4A 3WMFA 4OUKX 3WDLA 4GQAA 1YF3A 3H3XA 5HP4A 3MCZA 2IC5A 4O1MA 3BY6A 2Z3WA 3BBLA 4F04A 2YFQA 4UCXA 1RACA 3E3AA 4W5TA 1M7GA 3I1JA 4G41A 3IMKA 2QRUA 4ND6A 3C39A 4HV6A 2EFPA 2PSEA 5E2IA 1H2RS 1NE2A 4URHA 3RKXA 5AXDA 1UJBA 4RA6B 3MD0A 2E2JJ 2VKTA 3TBKA 3UEOA 2JIOA 1MGPA 4MEXF 2H0RA 2XIQA 2WJAA 2PQ8A 4TMKA 1K08A 4WERA 2ZNZA 3NAGA 4ARCA 3C8ZA 1QP7A 3GUVA 3KSUA 3TGLA 5HRAA 3C98A 1E1CB 2HZ7A 4DXDA 4LSZA 4S05A 1GZVA 2CT8A 3VKUA 4HB4A 3VRHA 2F6RA 1UM9A 2PEZA 5EJMA 3F6CA 5IAJA 3HI6A 3EVGA 1UK9A 4FHGA 1SHJA 4OLBA 3MVPA 3WRYC 5HTOA 2MCFA 1DTWA 4FFBA 2BBSA 3D6HA 4MAAA 3TQQA 4A1FA 1VKRA 3UW3A 1VI2A 1CEQA 2H1OA 2HU8A 1MTZA 3VKVA 4U0YA 3D02A 1QHYA 1Z2DA 1RYFA 3NC0C 1IXKA 2C2OA 3DF8A 5E4FA 3W2AA 4K6OA 4P3NA 2FNAA 1KYQA 3O4HA 3K2QA 1XMAA 1THMA 1WSAA 5HWSA 4RA9B 3UWSA 3V4VB 3LSMA 4PJLA 4WLEA 2GEKA 4D0GA 1J8QA 4AU1A 1OFIA 2JGLA 3EC2A 2WU8A 3IRQA 1WB5A 5THKA 2CN1A 3NTQA 5JCJD 4HV5A 4FEGA 1SZPA 4MUFA 1GNTA 2JGAA 3BD8A 1FUYB 1LRKA 4TQ9A 2AK3A 4H7DA 3HYIA 4MUAA 5DCMA 4R8SA 3IKMB 1ETUA 1Z16A 3PO3J 1UMCB 1DWUA 4ZCMA 2VBIA 3RWMB 4LD5A 5B2EA 3JQ9C 1SD7A 4URFA 4EF4A 3REGA 1KEKA 1B2LA 2W6JD 1UBLS 2EF0A 4WESB 3JVUA 4B3AA 3DXZA 1EEXB 2X6YA 4QUHA 2FRVA 4HQ0A 3EY4A 2W85A 2PCLA 3HOXJ 3ZJ5A 3COJA 2UUZA 1NIJA 5G0WA 3R6GA 2JWTA 4BATA 3GJ3A 3RVOA 3KPHA 3TF5A 5KTSA 1WWXA 3T1QA 3D7NA 4KIGA 1USKA 1UAGA 2HMSA 4XDHA 4BVGA 4JLJA 4FR0A 1IYZA 2G25A 4L0CA 16PKA 1A2QA 2VBYA 3OSUA 3I1FA 5E9AA 1GZDA 3RVDA 4QWQA 2I4LA 1ISHA 5I8WA 3KXLA 2IYWA 1A9XB 1EFVA 3DEEA 3ET5A 2C2XA 3C3DA 3QJGA 2O14A 3VSEA 1Q0LA 4DB2A 2BFCB 2F4VB 1EZ4A 3U6KA 1SUCA 3KPJA 3MUOA 5ULLA 1MRZA 1FBQA 2R48A 4ZCQA 2WRZA 4NU5A 2CB9A 1ZVVA 1F7VA 2P6MA 3QI2A 1EFTA 1BXGB 1YL7A 1YSCA 5C32A 3CUVA 5EMNA 2KRFA 2CEAA 2J3KA 5J5AA 1B9NA 3L1UA 1BDBA 1NAIA 3R6TA 4RDUA 5BYAA 2EJVA 4ZYDA 2PSJA 4EY4A 2AMYA 2OM2A 4EL5A 1SZCA 4J03A 4AKGA 3PPXA 1Z1DA 1KZHA 2C8JA 4TV9F 2Q1WA 3R0VA 3RG2A 1B0UA 3G9UA 2OE2A 1R4NB 3M7GA 1EJ0A 5EJGA 1N3LA 1LBHA 2PZMA 3EIUA 1KQ9A 2ID3A 2FZCA 1JUMA 2R8EA 3UXYA 4BZZA 3WP0A 3LC0A 1UG2A 3WISA 4C9YA 3LV8A 1JLRA 1AURA 1ZGHA 3Q3EA 4HOBA 3I4MJ 5I7OA 5E6SB 4TVOA 1VKJA 2JH8A 3DPIA 1AUXA 1OAAA 4LY9A 4DBZA 3EA5A 3FZNA 1KAOA 1LY1A 2O2GA 2YMPA 3HACA 3SIWA 2OG2A 1H5QA 2P9GA 4N5MA 4DLPA 1G0NA 5AP9A 1ZTRA 3V4LA 4FASD 4Y33A 2C5SA 3CF4G 2G0TA 1UPTA 3USCS 4NJOA 4DQ2A 1Z68A 2YVAA 2ZIFA 1VG1A 3KR1A 5JLXA 3ZEAA 2ZB4A 2WG2A 2LC2A 4XIGS 5AVTA 2BC9A 2X19A 3GVHA 1JSXA 3EYIA 1CR1A 1QHIA 2Q46A 5LZ4A 3R6SA 4U8GA 2X48A 1PF7E 4BFSA 1SUAA 4HNAB 4PGAA 2LKSA 2FI1A 2V7BA 1OBHA 3OHSX 2IDJA 3VI4B 3AT1A 4MKRA 4OB6A 5BSHA 2INGX 1JB9A 1V45E 4UKDA 421PA 4DMHA 4QDXA 2BTQA 3CCYA 4NESA 4WN9A 4XLZA 5COBA 3S1QJ 3ETGA 3K09A 2A5LA 2EFHB 2FAXA 2HJVA 4ZVVA 5FEMA 3EFOA 4LRSB 2O1WA 1QQIA 1H2YA 5C8VA 4MUMA 3R40A 2J48A 3UC5A 4OXXA 1IY9A 4CL8A 1T1RA 4V03A 1ABBA 3UTCA 3TXAA 1PGJA 2JCGA 2C00A 1JDZA 5HNFA 1KBOA 1U4OA 4REOA 2G1UA 3B8EA 2GBCA 5G02A 3WRXA 4JIMA 2WAMA 4R1SA 1Z06A 3ZDYB 4LQ4A 5CGQB 4Y18A 4LSWA 3T12A 1J8YF 3JQGB 1Y6QA 4RZHA 1IN6A 3U26A 2R7TA 2Y68A 1A4IA 1NXOA 2TRTA 1TQ2A 3IP3A 2ZWPA 4IX7A 3P5BA 3AVOA 4NJMA 1TP4A 1CJKC 3G0GA 4B5LA 5C7LO 2QTNA 3PVZA 3L9FA 3IWZA 5B2ZA 1QO0A 5EG5A 1EMDA 4HTAA 1D1CA 2VPZA 3NIFB 3ZQIA 5IT3A 2YHIB 4DTIA 1EDBA 4P96A 3H2JA 1P92A 1EJ2A 1PFUA 1I4LD 4L4ZA 3RK1A 1PJZA 2UYHA 4RD2A 5FH9A 2FOLA 5BSEA 3HCAA 3LWNA 3OQIB 2VDUE 4NNPA 3GUDA 2JGNA 1HDEA 1OPCA 5FUBA 3X1XA 4Q19A 1Z8DA 4WOPA 3MWGA 3R0QA 1SXJB 3WDMA 1L5OA 1FLVA 3EHEA 3L43A 1T8RA 3VTKA 4G67A 5ALYA 1HKSA 3BQZA 3R9WA 2IFTA 2X6TA 1C7EA 2FHPA 4JBYA 1EJ6A 5L95A 2VC0A 4YVFA 3DU6A 2H6EA 4Q48A 4INOA 3JQ8B 1FOEB 4XIIA 1P91A 4BGEA 1ZFNA 4C20A 1NULA 3E61A 2GCPA 5LD2B 2IUSA 3QIAA 1BKSB 2K9QA 1RQLA 3CXUA 3DAHA 1Q57A 1RLIA 5F21A 2HQAA 4UHBA 3PBKA 1Z4KA 4R9SA 1EWRA 4IH9A 1PWZA 5GADl 4XGRA 2IHBA 3MN1A 1JBEA 1YS2X 4AQYB 3HCCA 3FFWA 1E1LA 2VXZA 1OFTA 1NUUA 3BICA 3F97A 4DUYB 3MTIA 2VUSA 2O3TA 5JYEA 2JIZD 3L7MA 2WAAA 3AEQA 3S1MJ 2Q0HA 2N1BA 1JPNA 2WIFA 2A7XA 2OZEA 2P1ZA 3HYRA 1RRFA 3K10A 2ECCA 5EHIA 2QG4A 1RRMA 3PF9A 1ZAYA 1AKEA 4GOXA 1EFCA 1V8BA 3GLGE 1TXGA 2EJUA 2J41A 3L0ZA 4H35A 3A6PC 1LJ8A 5K0GA 1GV2A 4CLHA 4UDYX 3LA3A 3R20A 3MCUA 4BJ6A 1BROA 4G7OF 1Z0IA 3AG3H 4GMDA 3DXFA 5H1YA 3RKRA 1TLTA 3D1LA 2OHGA 2XQGA 3ZXSA 5M34A 1R1TA 5DBHX 3LJKA 2CVZA 4ARVA 5HODA 1WMFA 1ONBA 1TYDE 1Q50A 4AF6A 2FSGA 1RYYA 5L7WA 1OASA 3KS9A 2Z08A 4NAHA 3OM1A 3ZTWA 1B4DA 3A9SA 2X3YA 1MB4A 4G3XA 2UV8A 1W4AA 4QTRA 4EYQA 1R1UA 4OATA 5LWHA 3J7AC 4GIBA 4JBAA 2FXVA 1QBJA 2Q6KA 5H70A 2FFJA 5G0TA 3H9CA 3GCMA 5AI4A 3IEIA 3KPWA 4MHSA 1K8RA 2YUIA 1P0QA 4MNUA 4ZI2A 6ABPA 4JXZA 4LLLA 1F1BA 4LVUA 4HQOA 1XMKA 3I39X 2W84A 1DRVA 1QX4A 4D82A 5F64A 1KGDA 4ZT2A 5FA6A 3GLFA 3WFZA 4UU7A 1G42A 1QFJA 1UPUA 4P5OA 5ENVA 1FNSA 1T8YA 2C99A 3L6CA 4Q3LA 2QCOA 3KXPA 3ZP5A 1WZNA 1IZ1A 3TTVA 1PUJA 4KYUA 3I5YA 1W9HA 4PJ0C 3RROA 3HVKA 3GBSA 3GYHX 2O8CA 3WAKA 2R00A 2IHYA 3RVJA 1XCLA 4F11A 5F0FA 4L27A 5FL7A 1HY3A 4RM2A 3S2EA 3PSFA 3ZU4A 2ZPUA 3QLUC 4HQFA 3GCGA 4MW0A 3G49A 4JX5A 1R3UA 1XGOA 1L4LA 1U2WA 3Q87B 2YVKA 2CD9A 1N3YA 2HVQA 4LIPD 1SCUA 1T2KA 3P4XA 3F0CA 1RRVA 4TYNA 3HJEA 4EYGA 2B1IA 1RWNA 3H5LA 4BV9A 5LBTA 3KKZA 4F93B 3A1VA 2DFHA 4HDKB 2W25A 3MS7A 3NM5A 2RCYA 1OF1A 3G8CA 1BYIA 1B8IA 1PVOA 2H1LA 4DNPA 1Z7YA 1PX0A 4M9UA 4ZO7A 3J7AO 1W88B 1HCRA 2YIVX 2HTSA 3RSLA 3T4XA 3E5MA 2B8JA 3NGMA 1XZMA 1GPBA 3PD7A 1RKVA 3DEAA 3EPJA 2DQRA 4DUZB 4M3EA 5A0VA 4Q7JB 2D5VA 4O4LB 4FNMA 5E0OA 2WWGA 3IPAA 4KPFC 5J9FA 2V1UA 3L0PA 3F73A 4X1KA 1V47A 3TEMA 5EXSA 1GGMA 3LYUA 1MR3F 3VDXA 3QYAA 3D8TA 2IXFA 2BW0A 4FWTA 4B3JA 4PNHA 2HMWA 1YKSA 4TLCA 3I0NA 5DBIA 5CXXA 5LM3A 2EIHA 2CNWD 4OXRA 2JLSA 4GWGA 1HFEL 3FCYA 4V0MA 1KS2A 3KYBA 1HW5A 3ZIAA 1M73E 1TQIA 3M4NA 1JQDA 3VKGA 3TLXA 1YZHA 2HQ5A 4I4TF 1JSCA 5I7RA 4HUQA 3UJAA 3ML1A 3NT2A 2IVMA 3WG9A 3J7ZI 5IJ9A 4BIIA 4UXIA 2IAIA 5TQ0B 4R1TA 1M6WA 3IELA 5FFZA 1KQOA 4CXFA 2M98A 3WYEA 2PLNA 2QN8A 3NONA 4XXHA 4OK5A 2IIBA 4YI5A 1PD0A 1G3SA 4LX0A 3VU8A 4DNOA 2IF2A 1HQKA 2VCYA 4MDFA 4JEIA 3LFKA 5CQEA 5KYNA 4YWHA 2KE5A 4DW8A 2PZKA 2AWNA 5I47A 1LRJA 3IDQA 4F4JA 4HAYA 3HJRA 3FPLA 1FUUA 5YASA 4D25A 3S2DJ 2WT8A 1BC8C 2FPPB 4IDOA 3IHUA 1GRNA 1JXAA 3O0DA 1GA4A 4G4SO 3JD1A 2D5CA 1XA4A 4EJMA 4ZJPA 3EDQA 4RJLA 4X94A 3KYCB 4HQMA 3H2SA 2XC7A 2EFDB 1J5EB 4TL9A 1WUYA 4PFQA 3DHEA 3E9CA 4NENA 3GT3A 1G2OA 4RWEA 4H7IA 4BL5A 4WH0A 2MD0A 1W48A 4X8OA 3L7DA 2I2CA 2C04A 4QHYA 2M8EA 1LSUA 5TMPA 1EFLA 4F4UA 4DCGA 3Q2IA 1NTOA 5DI3A 2Y71A 2JRTA 3RRBA 5CB4F 2X9GA 4FCTA 1YR8A 4MTLA 3I2GA 1P4RA 1FUIA 4KYVA 4DLYA 4XQ9A 3FW1A 1OZHA 3O8CA 4E4RA 4B2PA 2H8WA 1ORRA 2APJA 3NOVA 4QYWA 1RZ3A 5K20A 3MT8A 2W2LD 3P9XA 1NQOA 2RQQA 4HDSB 1SOWA 2GKGA 3AM5A 3AMVA 4IG9A 3T7AA 4ILKA 3PUJA 1HEYA 1DC4A 3FOEC 3AVQA 2GM4A 2XAFA 2UYYA 4PWZA 3WB9A 3TSZA 4NL4H 1F8UA 2CKMA 5E38A 4EM6A 2IZ7A 4Z53A 2CLEB 4EG4A 3OLVA 5CH8A 3SWWA 2CL6X 4NK4A 1EUCB 2PKCA 1A5AB 4P3OA 1ZW6A 3M1AA 2XCQA 3PFHA 3WGUA 2QPLA 2J3EA 3EF0A 1VTKA 2L01A 4CMKA 3TPCA 1R0BA 4AZ3A 3K72B 1I6MA 3FF4A 3E7LA 4GSLA 4RHXA 2IIQA 3Q3HA 5A3RA 3PO2J 2ZT8A 2BFDB 3HJGA 2O0JA 2F4MB 1EDZA 2GJKA 1N4AA 2EV5A 2IGTA 1IUKA 1VYTA 3Q8LA 1ESCA 4EO9A 3SJBA 4TTRA 3KZYA 2IS6A 1OB2A 3KAKA 4BO9A 5DLPA 4YASA 2JKZA 1FOWA 3B3AA 3GZ6A 3EZGA 4GPBA 1CUEA 5F7ZA 5JQGA 2Z33A 1XO1A 1KFJB 4JI1B 1F1ZA 2WQZA 2IDKA 3KJHA 1G16A 3T0IA 4C3UA 2G7UA 2FHSA 2WM3A 3QK7A 1KDRA 1PR4A 1BEZA 2SCUA 3ERCA 1WXQA 1EWQA 2XF7A 2V5UA 1IGNA 5CFMA 3ZNPA 1DJQA 2XPWA 3RARA 5D3QA 1D1QA 3EDCA 5FOVA 4CE6A 4GYYA 2JGFA 3A9TA 4ZXPA 1XHLA 1TT5A 2CG4A 4FCYA 4CR6A 3UJ3X 3KVNA 3EMDA 1ZNWA 5AVVA 1M33A 2J5BA 3KP1A 3MQ0A 2R65A 2NRAC 3CKKA 4AJ1A 1DP3A 2QYSA 1Y6JA 5ILQA 1R5BA 1NY6A 1RRPA 4DZRA 1WP9A 4BHTA 4ODIA 3ORRA 1XTRA 2E1RA 4FMCF 2CYYA 2R6AA 1X8LA 3OO0A 3TECE 3CV3A 4CZ2A 3BPXA 2PJPA 2BMVA 2VJMB 5IZCC 1N6HA 2YMQA 1V2GA 4WOCA 4JT4A 1NLYA 2Y99A 3OTHA 2DCMA 2JG3A 1DEAA 4GBGA 2ENWA 1EDDA 2Y1LA 1RPJA 4WEOA 1V8OA 5FPSA 2OILA 4J76A 4X1OA 1JEJA 1I4TD 1GCIA 2LVSA 1T5HX 3TWOA 2BV3A 4O59O 3WLMA 2ONKA 1EVZA 4AZTA 4D45A 1ETXA 1P5JA 1S1MA 5LGNA 3GR6A 9LDBA 3BKXA 2JFYA 4O6VA 2QY9A 3G5MA 3FTNA 3WADA 2WF7A 3CLSD 1IVYA 1FDOA 4UUAA 3V4PB 4DLUA 4ML3A 4QEZA 2XUPA 5I9LA 1L7OA 1OA0A 1VIDA 5F9HA 2XA1A 5I8ZA 1ZP6A 2RHMA 3OLXA 3RH0A 3LUFA 4R2IA 1UDWA 3ZNQA 3RT1A 1PDVA 1W85B 2LF7A 3TTWA 5E3MA 4WLNA 4H6PA 4MUHA 3D4BA 3IILA 4YRGA 2RE8A 2YJ6A 4F45A 3T34A 1FNCA 1GQ2A 3P9ZA 3TLGA 1AO3A 5THQA 2J45A 1UKZA 1A98A 1IK4A 3H5RA 1QIDA 1RMQA 2CSXA 2VRWA 2IV2X 2YRXA 1MO3A 3C4JA 1OI4A 3KHUA 2Y0SA 2QQGA 3E2IA 2AC7A 4M0MA 2LFBA 2B63J 2ZSHA 4N03A 1TRHA 1TA0A 3LCUA 5EKXA 4FYVA 5DM7F 1XZAA 1N2CB 2IPLA 1X3LA 4XVRA 5CD1A 3CXRA 4XPIA 3ADOA 4NLLA 2ASVA 3LPAA 2P7IA 4TXMA 4LDNA 2BGCA 1AKMA 5B7QA 1C4WA 3HL2A 3G2PA 1UIMA 3PRYA 4R69A 4XIDA 4O1IA 2OSBA 5U1PA 1RIIA 1WUHS 4W1PA 4A15A 4DWVA 5CX1B 3ZKWB 4YJGA 4INPA 3RYIB 4XUDA 3L7IA 2EAUA 5J2TA 2P35A 3HXKA 1VG9B 4MWGA 3R8XA 1DT5A 1XG1A 2HTJA 5IDVA 3SAJA 2P2ZA 2JH3A 4OJNA 5FTNA 3G7NA 4PSAA 3WC4A 4A6DA 4MK4A 1XCOA 2XWBF 5JT1A 1L7RA 1UJMA 4IMJB 4F3NA 4KO4S 1ZVMA 4R8MA 4LNUA 2G83A 4BMXA 2FUG6 3ILSA 1JKXA 1R3DA 1XPOA 1ZJWA 5JY1A 1AT1A 4X44A 3E6DA 1ESNA 6GPBA 1YQDA 3BT9A 4FHEA 2CLKB 2D2XA 1UBSB 4CMBA 1GAXA 5JSZA 1ZJ6A 3JTEA 3LNCA 1KEVA 2O0KA 4IILA 2F5CA 4B40A 2BJWA 3WVNA 2VPWA 2AKYA 1NG7A 2Q9UA 3T61A 5BYBA 1JWLA 4NHEA 1QWOA 4PO1A 2VBGA 3ZCUA 5HSGA 4V1CB 3ERMA 3STVA 1ITZA 3CUOA 5EAIA 2BHTA 2F5FA 5LIPA 4JY7A 1X4OA 1FFEA 5KHAA 5DPMA 1XCVA 3HRHA 4GG1A 1Z05A 4BV8A 2GLTA 4M9RA 1E8MA 2JA5J 1EINA 3FX2A 4IX9A 3QJYA 3LBHA 5JVDF 4GSYA 2XNJA 4MEAA 3IUQA 1MMFB 4WACA 1U6JA 3H9EO 3VR4H 1T5TA 3BF8A 5EQJB 4UJ5A 4LZWA 2ODEA 4QFDA 2IYZA 4G94A 4YYZA 1VZ3A 4MIEA 1GAJA 2FW6A 3GCXA 5MGBA 3G0BA 4IRXA 4EOGA 1W1IA 3L0OA 3QFFA 1JXQA 1N78A 1ZOOA 4CFZA 1EV7A 4L0DA 2Q4EA 2QLBA 4TZKA 3RW9A 2JL1A 1G63A 2EX1A 4H7HA 3L1KA 4G5XA 4Q16A 2QLJA 3SDSA 1QIHA 3DBLB 8ABPA 3NS7A 4HF7A 4EQQA 3MMNA 1KR2A 4Q6BA 4PO3X 1DQPA 4FC7A 2SKEA 3OFKA 4AMYA 3RKQA 1R12A 2IEAA 3I3LA 2WTXA 3U7EB 1Z07A 5IYDJ 3GIDA 1K68A 3OE7D 4EHBA 3GLGA 1USSA 2JLAA 4IP0A 4CCWA 2HOAA 1E18A 3K2BA 1WRJA 2DFPA 2H1CA 3DEWA 1RTTA 2I87A 4QOFA 2QQ5A 1NI5A 2DTDA 1R8QA 5KYGA 3MLBA 4A8JA 1QHHB 2OTLI 2BP7A 5C37A 4JK1X 4KN7X 3HHGA 2GHRA 1E2LA 3OCCA 3T5DA 4TRRA 2IPQX 1VE6A 3CESA 1Q1EA 5A7GA 1OCCH 3DAPA 3B02A 3ESQA 3A1FA 4DG9A 4ZDPA 3CLTD 2VJBA 1S89A 5GWXA 4G0VA 1E9CA 2GD0A 4BRZA 1DE0A 1Z62A 1V5GA 4DWOA 2PXXA 1IBRA 5F9FA 2NV2B 4QSMA 4XUCA 2RSLA 5KNBD 3UGJA 1S2DA 4HPJB 4FR5A 4ZV7A 1GL9B 1XEAA 3DR3A 1CB0A 2JIPA 3E70C 2QPAA 3OM0A 1A95A 5F7JA 3O3OB 2CU7A 5FJIA 3ID6C 2FOIA 3IEUA 1Z63A 5CGZA 2Y6UA 3CB4A 4J6FA 3MBOA 3HOZJ 3HB7A 2HCJB 2DYKA 1Q15A 1YNSA 1KBZA 3FKQA 1XAIA 4RNCA 1NW4A 4XUEA 1K83J 4K9PA 2YWXA 5IPAA 1ZCJA 2HWKA 4PUSA 5DX1A 2HXSA 3E23A 3FSGA 3T5MA 4OO3A 1WJAA 2A6TA 2BOLA 2O8NA 3BS4A 3AG5A 3H9GA 2IW3A 2AZXA 4CI9A 2ZSIB 3GH1A 1ODKA 2FUKA 1ARZA 2IUYA 1E7MA 1MRSA 3U4HA 5KYVA 2Q41A 5AHWA 3LTEA 4IYJA 1T1JA 3IVXA 4Q1DA 2XY4A 4CG3A 3A4IA 2I76A 4TZ0A 3NT4A 2FE3A 2Y2ZA 1YDHA 3NPAA 1H22A 1YZTA 1CQIB 5G0SA 1W9MA 1Q7RA 2CVFA 4KR6A 1VJGA 4K9KA 5LWQA 1ECBA 3UW1A 4IDGA 3JCUC 4DQVA 4RTSA 5AH0A 3TIIA 3IAS1 4HLYA 4K3UA 1GYQA 2L7ZA 2F1IA 2Z57A 1AXGA 3ELKA 1JNYA 4DLTA 2FMYA 4A7PA 4KLCA 2UU9B 4MINA 5CVTA 5EINA 4UBOA 5KX5B 4AJLA 1SIOA 4XZ3A 1P2VA 2FSWA 3GMIA 4P0QB 3S1SA 1GUBA 4RFSA 1OYWA 2XRMA 2FPLA 2PEXA 2M0MA 4Q4JA 3S16J 5F04A 2BR5A 2F3TA 3USES 3SZGA 2X4DA 1XNGA 1CUUA 3K15A 4OFBA 4NS4A 1ZISA 5D8DA 4Z51A 5IDXA 3DYIA 3O6BB 3HDYA 5JCOA 2FEKA 5KVSA 3IIEA 1QYWA 5KNCA 5JWRA 3KB8A 1E8DA 1KU9A 1TYBE 1YLFA 1NOJA 3GG2A 2O1XA 4ZTJA 4MMXB 4R81A 4HX4A 3LX4A 2GCOB 5F12A 1CJBA 2ID9A 2EW8A 3RM3A 1E2XA 3CZCA 3GT7A 4FGJA 2OQRA 2TRSB 2I78A 4LJKA 4CKEB 2VYFA 2KL4A 4JUAA 4Z2AA 4Y9UA 5TQ2A 1A7JA 4GUDA 2V1XA 4D9IA 3LHIA 1YIOA 2CNDA 2ZJ1A 3PNTA 3ML6A 4N0MA 1L1FA 3VGJA 1NJ1A 9GPBA 1TEHA 3SVZA 4HLUC 1XNRB 3QX3A 3AHEA 1DKLA 4B32A 3KFXA 1XJ5A 5EUCA 3N8IA 1NJGA 1CUVA 1MOZA 3PNOA 2NUBA 2HS5A 4AC9A 4D7MA 1AGYA 2B8EA 4QLOA 4N6GA 2GA9A 1JT0A 1QYCA 3MWEB 3GIWA 3E7WA 1WF6A 4Y3UA 3R6LA 4R4JA 3CNHA 4UOZA 4DC9A 3ISJA 2IA2A 1E5XA 3PWTA 2OPHA 1CPYA 4Y7DA 4DIUA 3EIFA 3DQQA 1TWFJ 1E2DA 2P0YA 2QE7D 3K9CA 2BWJA 4DIOA 4EARA 3LX5A 3KKNA 3LBNA 3L6UA 4BKPA 1V1JA 1PZXA 5A9SA 2DKFA 3ORYA 3GGGA 1HDXA 5E6RA 4KG7A 4Y7NJ 5LUBA 3IP1A 3DZFA 1CZRA 4IDPA 4U02A 3DYBA 1LI7A 4ZEMA 3BK2A 3AQIA 3LDFA 2FFAA 1WHTA 5CITA 5TISC 1X7WA 3FVRA 4YCNA 3U7HB 3IEKA 4NBLA 4UUTA 5HCNA 1IQRA 5K8UA 1NMXA 4MMYB 4HWKA 4G26A 2QRGA 5C80A 4EENA 4IIJF 2BI4A 3C48A 2IYSA 3MOIA 4K88A 5JISA 4U5QA 2RGNA 3TXYA 1VPTA 3G2OA 2VF2A 2MYPA 2PH5A 5D6FA 2MSLA 4TMYA 4QJ3A 4HF2A 1C41A 2C4MA 4BO5A 1ODSA 5BPFA 2V74B 3M3YJ 2PGNA 4X54A 4G1CA 1ORTA 2GF2A 1K4YA 3U2QA 3AGQA 5HIMA 3KX2A 5HYVA 3K0BA 5E6UB 2I9KA 4UAVA 1DBRA 1B7GO 4X92A 2QRZA 4D1YA 3CUEF 3E9DA 2RHTA 1OAOC 4ND5A 4RHEA 5LEJA 3WGOA 1DXHA 4RADA 4BFYA 2LBFB 3F21A 1QWSA 2Z4TA 4UPEA 2JI8A 1RETA 1RP1A 2G9ZA 3NTLA 4CVNA 3RYTC 4HAZA 3HEFA 4QDJA 5EF6A 1VLVA 5HLTA 2V5VA 2R96A 4HNHA 5AVWA 1MC8A 1Z5VA 4X00A 4BBPA 5DHTA 2TSYB 1RXSA 4RIGA 2NPOA 3IEVA 2W4SA 1AWCA 3ND7A 1KSGA 2A9KA 1W4BA 4LA4A 5K9ZA 4QBKA 1DB3A 4IJAA 3OX2A 4E94A 4UVHA 1B43A 5EXXA 4WKGA 3K9QO 4YXFA 1XB2A 1SKUA 2HB6A 2O59A 1F2TA 1Y8ZA 3FA2A 1XJCA 4YV1A 1N9KA 3GJ5A 3I8SA 2Z2KA 3DCFA 3RS5A 3DPLC 4KLRA 4RJJA 1JJVA 2WKPA 3R3SA 5KBYA 3STTA 1ZD8A 3RUAA 3H8WA 4RQBA 4PLVA 3ULQB 3FKSA 4RK6A 1QS0A 1XNJA 3TGNA 4CYDA 4J0EA 3PX7A 4MA0A 1K6XA 3JZAA 1TA4A 4ZRMA 3OEHA 1X39A 4KU4A 1T4DA 1T36B 2CK3D 2YR0A 3MKYB 1TJ4A 1W5BA 3T9CA 1KI6A 2NXWA 1JSZA 1C80A 3EZNA 3VKFA 3H97A 3V9AA 1HDZA 1G6NA 3U3ZA 3SZUA 2GUWA 2WF6A 3A26A 3TNFA 2BGTA 4Q3EA 4G5YA 2O8VA 5B6PA 4EFKA 2RHJA 3WY9A 3QVSA 4KFTA 3PNSA 1XZDA 5CQGA 5K0NA 1QOZA 2VJCA 3ZXXA 3UK7A 1S0UA 3OIVA 3G9XA 3G7UA 4GLFA 1R4AA 3OCYA 4MVWA 4RGQA 1W93A 2Z6UA 3IDFA 3QE9Y 3TQIA 1PNOA 1RQ2A 3FOWA 2O07A 3CUQA 1X3UA 4V0ME 3AVWA 4ZN6A 5B30A 1O03A 4PZAA 4RVGA 2WAQA 2P0EA 1HKTA 3UCXA 3CMYA 4ZOBA 4RD3A 3P4YA 5SYNA 2DT6A 2PMFA 5JY6A 2WD7B 2QF7A 4H17A 3SKVA 4WX2B 2XF5A 4KYIB 1ACJA 1VQ4I 3EOBI 3IHWA 1IHPA 4G6DA 1Y8QA 1EI9A 3EYWA 1GL7A 3DOJA 2Q6IA 1K79A 4IOMA 2IXSA 1FDTA 1JU3A 3CT4A 1WCYA 4B6RA 4BKUA 4DIQA 1GNSA 1O96A 1EA5A 1KDOA 1XCMA 4QGSA 2PZLA 4LSGA 1ZARA 4ZTZB 5AQEA 4E15A 1CC1S 2E49A 4GEGA 4OSOA 4JB3A 1Y7TA 1K86A 2GZHA 3VSAA 3VSKA 1SG9A 1ZNXA 2PN6A 2C5BA 2GTIA 3L7AA 4AUKA 1YR9A 5CH3A 3DO6A 3MNFA 2Y0CA 2VLIA 3N2GA 2OAQ1 1Z6TA 4U0WA 3NEUA 4F5ZA 3PKIA 4HFJA 3WTCA 2L19A 2BYTA 4BTEA 2A1UB 5DD8A 1ONPA 2QB5A 1S8AA 2XECA 4RTNA 4E70A 5FKOA 5DGCA 3HTUA 2DDBA 2BFPA 3AFIA 3L4BA 5BYKA 3CJNA 4RVSA 4UUVA 3JQAD 2WD9A 5FTLA 3MWLA 4QPNA 1WEHA 4B3TB 4GYWA 4JLNA 1O94D 1P5HA 1JP7A 1W5FA 5EZGA 4RGSA 1FP1D 4B3XA 1JHYA 5EXDA 2DY1A 1FVHA 2FMTA 2PVSA 2A0YA 3KPUA 4AECA 3VR1A 1PHRA 3ZWDA 1X74A 4M3DA 3DC7A 5K3OA 4MSUA 1NPYA 2B4AA 5JLAA 4K81B 3S1NJ 1YC2A 3GA7A 1QH1A 2WM2A 1R10A 1E2HA 2AJ8A 1TBXA 1CUZA 3RB8A 4D02A 4OGWA 4YCAA 4ZOEA 4FKBA 5BVGB 1HOXA 2Q5QA 4N4AA 3D8SA 5DM60 1S7OA 3ASOH 3HK2A 3W05A 3UV6A 1UMQA 1GPJA 2CNKA 3JQFA 2XPCA 2MIIA 4IDQA 3GFSA 5HDKA 1A0OA 4P84A 2GA2A 4M21A 3NHSA 4C6TA 1RXUA 1SC9A 1PT6A 3WODF 1OX6A 3LSGA 2JLYA 4FYJA 4PCQA 1E66A 3J81A 3N8NA 4NCKA 2X51A 2MOKA 3ZJUA 2EBHX 4PZJA 4WL0A 2VAVA 2CC2A 3WK6A 1G5IA 4M1EA 3OPYI 4E14A 3H42B 2B8WA 4X1YA 3TZ6A 3GFLA 1BE8A 2O0MA 4QARA 3A05A 4WASA 3G2MA 1KERA 4OBBA 3RAJA 4RGYA 4B0PA 3SBEA 1K4SA 2O0HA 2KBEA 2JASA 4C88A 5TIIA 1XI2A 4K6MA 4KXXA 3WMWA 3IO3A 2DBYA 1MVNA 2OO5C 4YFVA 2Q5EA 2Y05A 4JC8A 2PR2A 4CQLA 2FDRA 3MGGA 1NASA 1I6KA 1OFHA 2QMZA 1Z2EA 4C78A 4DDTA 3GAMA 2UZ1B 1U3WA 2C9BA 3EVCA 3C8MA 4N8SA 1V11B 3IUSA 4X93A 1DQYA 2ZYHA 5HIIA 2RH8A 1RBQA 1AS0A 3LK6A 1D2CA 2NUTA 5KNLA 4Q24A 2ET6A 3ZCPA 1B3RA 3GRYA 3OY7A 5DHQA 3ER9A 3IBSA 1VFNA 2DH6A 1WVGA 1ZSVA 5GONA 1XRJA 1EE1A 3P5JA 2ZB8A 1UANA 1LCIA 1ZBQA 1GEGA 1NYQA 1FXWA 2AS0A 5E1OA 3D2BA 1WCMJ 5K8TA 1SXGA 4XN3A 121PA 3F72A 2Y2VA 4HC4A 3OA2A 4PY2A 1T2AA 3VZSA 4B31A 4RYDA 2BRUC 4TTAA 2XX3A 4P36A 2IHJA 4KE9A 2VXBA 4LJ8A 2CFXA 1A35A 2GPWA 4MGKR 2ZWMA 3GVIA 4P4TA 4L6AA 2C7GA 3TEDA 2RHBA 3ZE6A 3G68A 4KHPB 3GNSA 2A3NA 1MO5A 2XWQA 4LKOA 1GNRA 4N39A 2JI9A 1LSJA 1K92A 1N8TA 2J46A 2WF5A 4AJ4A 3BA1A 1Y1PA 2WK1A 4YDRA 1L8XA 3WWZA 2ZBKA 1LF5A 3I2YX 5C4GB 2QZ4A 5DBOA 4BUJA 4XOTA 4KK3A 4I99A 3IL2A 2YJNA 1TWHJ 2FPIB 2D6FA 4KPEC 3U5ZB 3JVDA 3RTAA 3R7WA 2I6FA 3GLIB 3Q9SA 4GI1A 4GQIA 1K4TA 3TP3A 1RYMA 3L8CA 4WLVA 5MFZA 3FPAA 4OSEA 1TC3C 3GD7A 1OCOH 4DJ5X 5JVGF 3G1LA 4MI3A 1C14A 1H1TA 3REQA 1ABEA 4LDRA 4HGOA 4BP3A 4DADA 4DZZA 1EF4A 1KZ4A 2CDBA 2AH5A 3OQBA 2HGSA 1C1YA 3E81A 2HL6A 2FA5A 3OE1A 4KWHA 1MBGA 2JIDA 3QU2A 1ZGZA 3NTRA 1NQUA 1OWPA 4S1WA 2C7RA 4DLVA 4UBMA 5FR2A 2IYOA 1SCDA 1V3VA 2NTNA 2V6JA 1OOEA 4QUBA 2VE8A 3GROA 1JYFA 1R00A 2G63A 2CXTA 4CQMA 1LDDA 5JC1A 2R92J 4QUKA 1U5TC 4GT1A 5KI6A 4BASA 2LBPA 4LJLA 4NX2A 3ABSB 1IM8A 4L76A 3W1EA 1U0OC 4MI9A 5T7BA 5I3CA 3D8BA 4BCCA 4F3YA 4NC6A 2RQPA 2WNHA 1QIIA 1MC5A 4NVRA 4UNQA 3PE3A 2UXXA 2FV8A 4CM9D 1YRAA 3WNCA 1HWYA 4RTJA 1G19A 5BNTA 2QLFA 2HRCA 1QB7A 3EGOA 2WHPA 5EQDA