5DUKA

N-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
DTRREIYKHIVKSPGLHERQLAKELDVPLSTLVYHLHYLERRELIMMKSDERYARYYATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative DNA binding protein
publication title N-terminal structure of putative DNA binding transcription factor from Thermoplasmatales archaeon SCGC AB-539-N05
rcsb
source organism Thermoplasmatales archaeon scgc ab-539-n05
molecule tags Transcription
total genus 15
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dukA00
2F5CA 2HYFA 5HLHA 1XSDA 4GXOA 3QP5A 3M8FA 1ZG5A 1JE8A 2PEXA 2IA1A 3I71A 2Z3YA 1SFUA 1IXCA 4MQ9F 2HKOA 1CF7B 4NB5A 4RB0A 2XIGA 4ENMA 2P4WA 4IRGA 4IVNA 1UCRA 2D1HA 2HWVA 4I02A 2D1VA 4LB6B 3IWZA 2NRAC 1R5HA 1U3EM 2FU4A 5DCMA 2VBWA 2HDCA 2GA2A 3GLXA 1YW8A 2K86A 2ZNZA 2JT1A 4EM0B 4ZH4F 5BMZA 4AIKA 1QGPA 3T8RA 3LWFA 3F22A 4ZZLA 3J81K 1MZBA 1F1ZA 1OMIA 1YFHA 1LDJA 3LQQA 2ELHA 1T2KA 1K7AA 3V8KA 4KNYA 5ILVA 5D5UB 4XRFA 1JHHA 2VXZA 5BQTA 3P7NA 1W7PB 4I01A 2FNPA 2V9VA 3EYYA 2K4BA 3PQKA 1TNSA 4LLGF 1G3YA 3PFIA 3GYHX 4A5MA 3J80K 1MDMB 1FBQA 3REOA 5CVUA 1LEBA 1WWXA 1Z7UA 2MD5A 1HKQA 4D0PA 2KJCA 3L09A 4NQWA 3E3VA 4LK1F 4ZYGA 5D5XB 1O3QA 1UHMA 1ZLKA 4LG0B 2DI3A 5F1RA 1ZGJA 3KETA 5LBQA 1ULYA 3I58A 1JGSA 3WGGA 4UV8A 1ZHFA 1GVJA 1QPMA 3BY6A 3OOPA 5DCMB 2X0LA 2WTEA 3H3ZA 3MAJA 1OYIA 1OR7A 1T38A 1USTA 1BIAA 3M7GA 2FXAA 3WG9A 1YYVA 1KYWA 1BN5A 2GZWA 4N0BA 4ETSA 2O3FA 2D45A 3ECOA 1B4AA 5CVJA 2HFHA 1ZG3A 2MH9A 2V79A 3LAPA 1KA8A 2PI0A 2HQRA 1ZRCA 1SD5A 2F5DA 4PCQA 3C7JA 4KA4A 1T0FA 2EA2A 2RNJA 3KEQA 1YIOA 2QWWA 4CO8A 4HQMA 4G8XA 1VTNC 2V1DA 1QO0D 2PMHA 2RV8A 5LEJA 4CXFA 4ESBA 3CLOA 4EJTA 2EFQA 4I98B 1ZARA 4AIHA 3CUOA 2DQRA 4A0YA 4I0BA 2RGVA 3WODF 3ZMUA 4P9UA 2V6CA 4Q48A 2IP2A 3ABTA 4P5OA 3OV8A 1U5TC 3FM3A 2ZBKA 2CG4A 3QRFF 2CGPA 1U5TA 4EM2A 2EV5A 3QPHA 4HW0A 4G6DA 1KQ9A 3KLNA 3QAHA 2IA2A 5CLSA 4G7OF 2DW4A 4XLNF 3R0JA 4N9IA 3QU6A 4EGYA 1XSVA 2JTVA 2DK8A 2RKHA 1U2WA 1FWZA 3DKWA 1KU2A 1HXDA 2Q0OA 3V7CA 5K5OA 1B59A 1TNTA 4EJVA 3F72A 3GFLA 4BAYA 4KIFA 1ZREA 1G6NA 2A3SA 3CDHA 3COAC 3MCZA 3E5QA 1UHWA 3VEPA 3E6BA 3BZ6A 1KQ8A 3M1EA 2HEOA 2L4MA 2OQGA 5D4SA 3F8CA 1USSA 2L02A 3R61A 4HF0A 5L3GA 1E17A 2QQAA 1PDNC 4JK1X 2NS0A 5BPIA 2G9WA 3F8NA 4WWCA 1FBSA 4HDVA 2LF7A 4I7HA 4GYIA 3IRRA 4LFUA 1ZH5A 4UHTA 1FOKA 3NQOA 1GXPA 1IW7F 2K27A 2YU3A 3I59B 4R1HA 3WU0A 2UXNA 3TOBA 4IHSA 2A07F 2DBBA 3SFZA 3DQVC 2MBFA 1IZ1A 2Z99A 3C18A 4MEYF 3GZ6A 4IJAA 4CGZA 4BQAA 3DFGA 3EUHA 4A2UA 4L18B 2E1NA 4YFNF 1IN7A 5CJ9A 4CZZA 2RQPA 2FBHA 2LNBA 3HTUA 2CQKA 2VBZA 2VBXA 5H6QA 1B1BA 1LDDA 3JSPA 5E8GA 3HRTA 4R8HA 2UXXA 5LHIA 4KYWA 5ICEA 1MJAA 4HAMA 2FEZA 3GO5A 4XBFA 4XSZF 2EV0A 3DPLC 4HX7A 4A6DA 2KIUA 4A6EA 4N9HA 3ISPA 5D6EA 2O0YA 3WU1B 2HTJA 1BJAA 1BOAA 6PAXA 5DDGA 2KKOA 1IAWA 3F6VA 2ZMEA 1X3UA 2QLZA 4GCVA 5BPDA 1Z91A 4ENJA 5E18F 1V3FA 2LF8A 2W57A 5DCFA 1PP8F 4MNUA 4OIQF 4RGXA 1FY7A 2KIMA 1BIBA 4RGUA 3D0SA 2FF4A 4LD5A 5LGTA 2QVOA 1ZN2A 2VT3A 4F7ZA 2VT2A 5DD8A 5ICGA 5K5QA 3ZMDA 4KN4X 3TQNA 1BI2A 1P4WA 2QUFA 3KE2A 5D6FA 2W25A 4WXDA 4RAZA 4PZJA 2VONA 1FYLA 3LQRA 1S6LA 5ICCA 3EYIA 1SMYF 1J5YA 2OU2A 1XD7A 4EGZA 2DT5A 1WQ2A 2Y48A 2L01A 5ICFA 1B9NA 3S2WA 1S7AA 3K0LA 3V8JA 2IVMA 2COMA 3P9KA 4YG2F 2ZFWA 3F8BA 2CW0F 1Z1DA 4EMSA 2PJPA 1SFEA 4WX9A 1P2FA 5K1YA 1RUNA 2FE3A 2ZMEB 4WK8F 1FSHA 1QZYA 3DV8A 1IN5A 5HS7A 4HX8A 2M8EA 3K2ZA 1RIOH 3SXYA 4ZYEA 2FMYA 4KIBA 1J7KA 1LNWA 3FZVA 3AAFA 3HOTA 1MJ9A 1R1UA 5LRRA 2DFIA 2QBYB 4UV9A 5HDKA 1ON2A 1R1TA 5LHGA 4ENNA 4O5VA 1XDSA 3KP2A 4M6YA 2ZO4A 5DUKA 5J8CA 5CVRA 1FX7A 2PMUA 3BOQA 2BE5F 3H3UA 3GFJA 3V7SA 3WTSC 4QLCU 4M72A 5A2QZ 3I0TA 3HUGA 4KMUX 4IPAA 4YFXF 3BP8A 1O3RA 4NHJA 5DEQA 1T39A 2XAHA 3BJ6A 2XV4S 2L4AA 1BM9A 4I0AA 2CYYA 3MZYA 2STTA 3RKXA 1DUXC 3T1BA 3WE3A 1TLHB 3NRVA 2A61A 4BYYA 4AD9A 4RB2C 3O2PE 1RUOA 3P9IA 3HIFA 5E8IA 1O3TA 3DP7A 4A12A 2R3SA 5F64A 2HS5A 4M9XA 3T0YA 3GFMA 5IT9K 4P9FA 2LSOA 4O3MA 1FC3A 1Z05A 4ZYHA 4GO1A 3GW2A 2ESNA 4S04A 1R36A 2VOOA 3K1PA 4G9YA 2ZCWA 4U0WA 1PUEE 1IRFA 3GWZA 1R5GA 3U2RA 2A68F 5EEHA 3TKYA 3IHUA 5HS8A 5J8FA 3FM5A 2FQ3A 2L3DA 1GXQA 2QQ9A 2QZ8A 1LB2A 1TBXA 4L9NA 2HQNA 2PFBA 3V4GA 1HSJA 3PQJA 1TQPA 2O8XA 1H0MA 4M6XA 3KZZA 1W7PD 5E17F 4L9VA 3GF2A 1ONVA 1R58A 5TJJA 4M9SA 3Q5FA 2J5OA 4E70A 1FYMA 5HDNA 2DU9A 4A0ZA 3VODA 2H6CA 1ZG1A 3U1DA 4EM1A 4Y15A 2BBYA 3E97A 4HV5A 4G7ZF 2P5KA 5E1ZB 3CO6C 3TO7A 1HSTA 2P6SA 2NYXA 5FD5A 2VODA 3CUQC 2F2EA 3CUQA 5TRDA 4CYDA 5DV5A 3D5LA 4MGRA 1GHCA 1FNNA 1QQIA 3ML6A 2Z33A 3ULQB 1L0OC 2FNAA 4RS8A 2ZJ2A 3JSOA 1YQAA 4RAYA 2ZKZA 1R23A 5FFXA 2Q8KA 5E20A 4HBLA 2WWYA 4KN7X 3QOPA 3FMQA 2PG4A 1S29A 2EFWA 4RB1A 4CDGA 2H27A 3CO7C 5A2QK 5E1XA 2ISYA 4HZFA 3RKYA 2YPRA 3HHGA 3HSFA 1ZYRF 4Y17A 1IUYA 3GZ5A 1AOYA 3BPVA 1JXSA 4M74A 3ERED 4WF2A 2RDPA 3ZQ7A 4LK0F 2BEOA 5L3FA 4CHUA 1IRGA 1XGNA 2UWMA 2KRFA 3MZHA 3IKTA 3ABUA 4EJWA 4L5IA 3I4PA 3SZTA 2FBKA 3B73A 5JHUA 1H9GA 1T98A 4KFCA 2CSOA 2ADUA 3FF5A 4K2EA 3LA3A 1HW1A 1SFXA 1TW2A 3VFZA 5D4RA 5LGUA 3I54A 4YIIA 3B02A 3IC7A 5JI6A 3O3KA 2A6HF 3TO6A 1KU3A 5LRSA 1Z9CA 4Q47A 1XCVA 4KMFA 4AVPA 2YSRA 4HLYA 3BDDA 3K9TA 1KQ0A 4ESFA 1XGSA 5JR3A 2JPBA 4I2OA 2DO7A 1OYWA 2XKOA 1SD4A 3GXOA 2RN7A 3CTAA 3R0AA 2OQRA 3LAJA 1ODDA 1QZZA 1U5TB 3QU3A 5H6RA 3F3XA 3MQ0A 4FT8A 3WGHA 4EJOA 2VE8A 4MHGA 1YS6A 2JSCA 2XAQA 2EFNA 3TDZC 1FYKA 2IPQX 2MC3A 2V1XA 2W85A 1MJBA 2O03A 1YS7A 4YIFA 3JTGA 1EH8A 3K1MA 1G3TA 2P5VA 2XGXA 1R00A 4MEXF 3RKWA 2VOPA 5L3BA 3ZN1A 1AWCA 3FHZA 4ESJA 3I5UA 1UB9A 5IT9Z 1HBXG 3N4MA 4GYGA 4FHTA 3HSRA 3KP6A 2O61A 4UNOA 1FPQA 3N97A 3SZPA 1LEAA 1I1SA 4OMZA 2GWRA 3JTHA 1BC8C 1I1GA 1XMKA 1B6AA 3WTUC 1YTYA 4HOBA 3L7WA 5FB2A 4OOIA 4IRHA 2OAZA 1FSEA 2ZNYA 1R22A 1XN7A 4UUVA 3I53A 1I27A 1EH7A 1YLFA 2KJBA 2AXLA 1A04A 1FLIA 2IRFG 4ASNA 5BS6A 1ZLJA 1OKRA 3L2CA 2QYOA 1YG2A 4HA8A 1O3SA 1MKMA 4AWXB 3E5UA 4BH9A 2DK5A 2STWA 1W4MA 2A5YB 3RPQA 5HVQC 2IT0A 2P7CB 2GQQA 3HYIA 2JZYA 3RTRA 1FP2A 3C1DA 1K79A 3E6DA 4XLPF 2NAZA 1S7OA 3EQLF 1KYZA 1WRJA 1SD6A 2M30A 1G4DA 3ECHA 5KK1A 1D5VA 4OU0A 1P4AA 1U6GA 4ON0A 4L9JA 3RJPA 1IXRC 3KP3A 1LQ1A 4HF2A 5AIPA 4M73A 2PBIA 1CGPA 1XGMA 3WTYC 1CF7A 3DXJF 1J59A 3DPTA 4KT5C 1FBUA 2NNNA 2XASA 1F4KA 4KIGA 1IXSB 2E7WA 1QBJA 4OMYA 3KP4A 3NEUA 1D8JA 2PLYA 1G3WA 3O6BB 3F21A 2OA4A 2EFOA 3RYRA 1H9TA 3ZMVA 3BJAA 2OD5A 1OYYA 5LGNA 3BROA 1HW5A 4Q5SF 3RIRA 5L3DA 3ROUA 5DUIA 5HOOA 1W5TA 2Y75A 4UVAA 1W7PA 2VC1A 4PGGA 2X4HA 5K5RA 1R1VA 3JW4A 2H6BA 4P55A 2EB7A 2ZXJA 2HR3A 4OIRF 4H0EA 3CJNA 1MDMA 3RI4A 4I09A 2XVCA 1Z6TA 3JAMZ 1IF1A 1W5SA 2GA1A 2UZKA 3KCCA 1TTYA 2K02A 1WI9A 2DAOA 4IRIA 4LG0A 2JPCA 2XAJA 5HLGA 1STZA 4S05A 4WCGA 3T5XA 2QENA 3GUDA 4HF1A 2A6EF 5HS9A 3T8TA 1HW2A 1WKMA 1I5ZA 3IKVA 4TV7A 3FXQA 3WE2A 2Z5UA 5DYMA 2HKXA 2VN2A 4A5NA 3LA7A 2G7HA 3RPUA 3F6OA 5E1WA 3H92A 2OZ6A 1OPCA 1U78A 5L3CA 2WV0A 4YFKF 5D5VB 2FRHA 1KU7A 4XSXF 1DPRA 1IN6A 1ON1A 5CYVA 2FMLA 3WTTC 4ENKA 3IRQA 1Q1HA 3TGNA 2Q2EA 3KZYA 5ILUA 5FO5A 3TDUC 2XROA 2EA4A 4WXCA 2DLLA 1RI7A 4L0YB 1TQMA 2GIVA 2FOKA 3I64A 1DPUA 3E6MA 5FGMA 4U88A 2FSWA 1P4XA 3BJOA 1KGSA 3HRSA 3SHFA 4HYEA 5FD6A 2ACJA 3ZP5A 2Y0MA 1BI3A 4IHTA 2LKPA 4PGHA 4UVCA 4EV0A 5BOXA 2D2WA 5IT3A 2ISZA 1TQIA 2BYVE 4LLNA 5J6XA 1NHAA 1C0WA 3RDIA 3HRMA 4L5JA 3LSTA 4ZZDA 3HOSA 1DDNA 1F5TA 4UXNA 3WTXC 1BBYA 4MQVA 1O7LA 2RC4A 4JBAA 4U7BA 1REPC 2CO5A 2W84A 1P92A 4L9TA 2R7FA 3W6KB 3G3ZA 5DD4A 3K69A 3P9CA 5ED4A 1J75A 2JRTA 1WSUA 1HQCA 2ESHA 2YR2A 2A69F 2PN6A 3V8LA 2GXBA 2DTRA 2H09A 4LLLA 4HQEA 1SD7A 2RVCA 3KFWX 2E1CA 4U0YA 2EWNA 4DQ2A 2V1UA 4RB3C 4OIOF 3R6SA 3U9GA 4HV6A 4BXUA 3E5XA 5JFRA 2YX7A 3HSEA 1FZPB 1T6SA 5FFZA 1D8KA 4UVBA 2K4JA 3F8MA 2DQLA 1EV7A 4G6QA 1XCBA 3HRUA 4Q4ZF 2WC2A 4EQQA 3FXUA 2EFPA 2TDXA 4MTEA 1FT9A 3VB2A 1MGTA 1K6OA 4U7DA 2IW5A 3FXRA 2QM3A 3WTVC 3VOEA 1S3JA 4KUMA 4BNCA 1QNTA 3IL2A 2CFXA 3I59A 1JHFA 3CUQB 5L3EA 2NNYA 2BGCA 2M45A 4DNCA 3JAMK 2CWEA 2XHKA 4QWQA 5FLXZ 1EH6A 1ZRDA 2F5FA 2GXGA 5D8LB 1E2XA 2DPUA 4LMYA 2XUBA 2W24A 1LJ9A 2HTSA 2FA5A 4LJZF 1RZ4A 5HDGA 1U8RA 3EETA 3L00A 5CVIA 2K7LA 3V7RA 3DF8A 1SAXA 2HYGD 1S8NA 4BHCA 4EJUA 1ZAOA 4BHBA 2P7VB 3Q9SA 5AIQA 3M8EA 4B8XA 3Q9VA 1D3YA 1TW3A 3TO9A 4EVIA 3SQNA 3E6CC 2HZTA 1P6RA 2AS5F 3L9FA 1XSXA 2QQBA 3HTSB 4Z2YA 1LVAA 3RYPA 3QP6A 2MLKA 1I6XA 5LLQA 1J0RA 3HHHA 4OIPF 3GEZA 5D8KB 3FMSA 4U0VA 4G7HF 3ZMSA 2VBYA 3KEOA 4M9ZA 4AIJA 1Z6RA 2XKPA 4KICA 2VE9A 3LFKA 1KU9A 2R7DA 4FX4A 3MEXA 5AONA 1SMTA 3TOAA 1ZRFA 1BI1A 3FMRA 2P5LC 1MD0A 1K78A 3GVAA 4HLXA 4P96A 3C3WA 3K1NA 3J7AO 3WTWC 3BWGA 1YW9A 2MH2A 2G7UA 2B0LA 2J5PA 5D5WB 3W6JB 4O6JA 2OZUA 4LGWA 1XGOA 2Z9OA 2MA3A 4JQFA 1B9MA 4RGRA 1LDKB 2P8TA 2MLGA 1PP7U 1F9NA 3ZMZA 5KVRA 4IXAA 3J81Z 1IN8A 1G3SA 4M71A 1J9IA 3KLOA 1HKTA 3ZMTA 1R7JA 4RGSA 3WGIA 2PQ8A 3MFKA 2IJLA 4GGGA 2IA0A 3M9AA 2OBPA 4IF4A 5LHHA 2M1BA 2VC0A 5LEKA 2QBYA 3ZN0A 2YX4A 1BI0A 4LB5A 3DEUA 3FX3A 3J80Z 4A0XA 1O7FA 2ETHA 4Y13A 3ZPLA 1XMAA 1UFMA 2HGCA 2M87A 2EJRA 1FP1D 4R79A 2HOEA 2XAFA 1K78B 4CICA 2XRNA 4WXHA 2DPDA 4HDUA 3IWFA 1ZGAA 5H20A 5FLXK 3KP5A 3FWEA 1BC7C 4MTDA 1YW7A 4BHPA 2P6TA 2F5EA 3G73A 3BPXA 1XB4A 1V4RA 2XAGA 1J2XA 3F8FA 3R4KA 2O6GE 2EV6A 3ELKA 4PDKA 1IN4A 2H94A 3GX4X 2E7XA 4L0ZB 4OINF 2KIFA 4KDPA 5EEGA 2L54A 5F6FA 5CVVA 5JVTA 4HX4A 3F23A 2C6YA 1L3LA 3KP7A 5ILSA 3EDPA 4B09A 1Y0UA 5HLIA 1XDUA 2LDUA 4FX0A 4G94A 2GAUA 3R60A 4ZYDA 3GFIA 2BV6A 1YO5C 3QPTA 2EK5A 1HKSA 1RNLA 1O57A 2FBIA 3MWMA 3LA2A 3WTZA 2M5WA 1DP7P 5ERIA
chains in the Genus database with same CATH superfamily
3ZQCA 5FKNA 4AIDA 3BG7A 2LTPA 2VKDA 5HLTA 3OYNA 2F5CA 1DGWY 1T33A 2HYFA 1WZ2A 5F08A 2GOXB 5HLHA 3M4OJ 1XSDA 2H8WA 3QP5A 4GXOA 3M8FA 4NNJA 1ZG5A 1JE8A 1K6YA 2IA1A 2PEXA 3I71A 3O8HA 2Z3YA 1OCZH 1W5CC 1SFUA 1IXCA 3SEQA 3CMAI 3K4JA 1MH3A 4MQ9F 2HKOA 2WAQA 1ACIA 1CF7B 4NB5A 2R4GA 4RB0A 1GVDA 3LSIA 2GIZA 2XIGA 3GTGJ 4ENMA 2P4WA 1ETVA 3HB9A 5F0FA 4IRGA 4M3DA 4IVNA 1UCRA 2D1HA 2HWVA 2K3PA 2A05A 4I02A 2XGEA 2D1VA 4LB6B 3VYTB 3IWZA 4C2MJ 2NRAC 4BY7J 1R5HA 3EUKL 1U3EM 2FU4A 5DCMA 2VBWA 2HDCA 2GA2A 2BY0A 3GLXA 1YW8A 2K86A 2ZNZA 5J1UA 2JT1A 2CW8A 4EM0B 4ZH4F 5BMZA 4AIKA 2ZSIB 1BW6A 4E7HA 1QGPA 2DMTA 3KEYA 3OYJA 3T8RA 4N4NB 3LWFA 2YS9A 2DDAA 4I76A 3F22A 3Q0UA 4ZZLA 2HVSA 2IGKA 3J81K 1MZBA 3UNGC 2M0CA 1F1ZA 3HOZJ 1OMIA 3A1YA 2JUGA 1YFHA 2JA8J 4RLFA 2CMPA 1LDJA 3LQQA 2ELHA 1T2KA 1X1CA 1K7AA 4JOMA 4BDZA 3V8KA 2KHMA 4KNYA 5ILVA 4XM3A 5D5UB 1VI0A 4JP0A 3D5SC 3U1KA 4XRFA 1JHHA 2VXZA 5BQTA 3P7NA 1W7PB 4HSTA 1A35A 4I01A 2FNPA 4B4CA 1ERDA 2V9VA 3EYYA 2LREA 1Y8QB 2FQ4A 3CP2A 2K4BA 4UUSA 3PQKA 1PUFB 1ZR2A 1TNSA 4LLGF 1G3YA 4B3AA 3IP4B 3PFIA 3GYHX 4A5MA 1YX3A 3J80K 1MDMB 1FBQA 3REOA 2P0WA 5CVUA 5IOZA 1LEBA 1WWXA 1Z7UA 3S2HJ 2MD5A 4E7SA 1VQ4I 1HKQA 4D0PA 3H9JA 2KJCA 3CMYA 4DGWB 3L09A 4B43A 4NQWA 1YJNI 3E3VA 4LK1F 2NVTJ 4ZYGA 3ZQQA 5D5XB 1O3QA 1UHMA 1ZLKA 4LG0B 2DI3A 5F1RA 1ZGJA 3KETA 1XMXA 3FXOA 5LBQA 1W0UA 1ULYA 1F36A 1JGSA 3I58A 3G4SI 2X6WA 3WGGA 2OUMA 2GXAA 2L9SA 1VQKI 1I6HJ 4ZTFA 2KP6A 4E4HA 1ZHFA 1GVJA 1QPMA 4UV8A 5GAHJ 3BY6A 3OOPA 4RAGA 5DCMB 3H5RA 2X0LA 2V6EA 1N78A 2K85A 3GTQJ 2HOTA 2WTEA 3H3ZA 5J3LA 1OR7C 3MAJA 2A5WA 1OYIA 5B1BH 1D0XA 2XSJC 1OR7A 1T38A 1USTA 1BIAA 3M7GA 1FTTA 2CQNA 2FXAA 3WG9A 1YYVA 2AXTC 1KYWA 3RZOJ 3SDBA 1BN5A 2GZWA 3HKZN 4N0BA 3OYHA 1IRZA 2HOAA 2MD0A 4ETSA 2O3FA 2MABA 1FOWA 4Y52J 2D45A 1LFBA 2Q2EB 3DU5A 3ECOA 3I4MJ 1B4AA 5CVJA 1IGNA 1LE8B 2M7AA 2HFHA 2QCOA 1ZG3A 4CCOA 1QVTA 2R5YA 2MH9A 2V79A 3LAPA 2VUMJ 1MMNA 1KA8A 1ZR4A 2E19A 2PI0A 2HQRA 1IO2A 2EZKA 1ZRCA 1SD5A 2F5DA 4PCQA 3HGGA 3C7JA 2G0EA 3QPLA 4KA4A 1BW5A 1T0FA 2EA2A 3OWTA 1B72A 2RNJA 3KEQA 1YIOA 2QWWA 4XQFA 1NH3A 4C30A 4CO8A 1A5JA 4HQMA 3OY9A 3DLLF 5JLXA 4G8XA 1VTNC 2V1DA 1ETXA 1NK2P 1QO0D 5EEAA 2PMHA 2DYSH 3OR2C 2RV8A 1RC9A 5LEJA 4A3LJ 4CXFA 5EZHA 4ESBA 3CLOA 5EG0A 3S1NJ 4EJTA 2EFQA 4I98B 3IAM2 1ZARA 4AIHA 4NC8A 3CUOA 2DQRA 4A0YA 4I0BA 3S3NA 3AG4H 2RGVA 2WAFA 3MD2A 3WODF 3ZMUA 4P9UA 2V6CA 2P81A 2M7BA 2IP2A 3ABTA 4Q48A 1JKRC 4P5OA 3OV8A 2LY1A 3TMOA 1U5TC 3EUAA 1OCOH 3FM3A 2ZBKA 2CG4A 3CCUI 3QRFF 2CGPA 1CQTA 3S1RJ 1U5TA 4EM2A 2EV5A 3CMMA 3QPHA 4HW0A 4G6DA 5K7HA 1Q1VA 1KQ9A 2DMQA 3KLNA 3QAHA 2IA2A 4NUBA 5CLSA 4AU7A 2XGDA 1A6QA 2V1NA 2DJNA 4G7OF 4PJLA 1ETYA 2DW4A 4IHYA 4XLNF 3JRCA 2NVXJ 3R0JA 4N9IA 3QU6A 3X2QH 4EGYA 1XSVA 1P7IA 5E3OA 1VQ8I 4KISA 4IEJA 2JTVA 1T08B 1BR1A 2DK8A 2RKHA 1U2WA 1FWZA 3IH2A 3DKWA 3ZCOA 3JRDA 1KU2A 1WHUA 4DBQA 2IXSA 1WI3A 1HXDA 1MNDA 2MSYA 2Q0OA 3V7CA 5K5OA 1B59A 2CUZA 1TNTA 4F93B 1VQPI 4EJVA 3F72A 4F91B 1MBGA 1GUUA 4RDUA 1QPIA 3GFLA 1EA3A 4BAYA 4KIFA 4F52A 3K70C 1R4MB 1ZREA 1G6NA 2KMUA 2A3SA 3CDHA 4M3BA 3COAC 2E1MC 2EINH 3MCZA 4IQJA 3E5QA 1UHWA 2WA0A 3E6BA 3VEPA 2QSFX 2Z2SB 2E2HJ 4GRIA 1X1DA 3BZ6A 1KQ8A 3M1EA 4CYCA 1B8IB 2HEOA 3HOYJ 5IYDJ 1ETWA 3OIOA 2L4MA 4BJ5C 2OQGA 3F0CA 4FETA 2XSDC 1D1AA 5D4SA 3F8CA 2Z1DA 2BXYA 1USSA 2L02A 3R61A 4HF0A 5B66C 5L3GA 4QSHA 2QQAA 1PDNC 1E17A 4HNVA 4JK1X 2NS0A 5BPIA 1FMWA 5EG0B 2G9WA 1IC8A 2X85A 3F8NA 3W2VA 5E3MA 4WWCA 1FBSA 2O9LA 4HDVA 2LF7A 4I7HA 4GYIA 4Z6YA 3IRRA 1WH5A 2NOJB 2OC6A 4LFUA 1ZH5A 1S9HA 4UHTA 1FOKA 3NQOA 5FKMA 1JGGA 1GXPA 1IW7F 4XNFA 2K27A 4FTHA 3MZ8A 2R7VA 3CF2A 2I5UA 2YU3A 4AUXA 3I59B 4R1HA 1BR4A 3WU0A 3FK6A 2UXNA 3TOBA 4IHSA 2E35A 2DBBA 2A07F 3ASOH 4HEA2 3CCJI 3DBHB 2IGMA 3SFZA 3JRGA 5GPCA 3DQVC 3G1LA 2MBFA 1IZ1A 2Z99A 3C18A 2PJRA 4BY1J 1V55H 5GAGJ 2JN6A 1JJ6C 5CKTA 4MEYF 2HDDA 3GZ6A 4IJAA 3EUHC 3CC4I 4CGZA 5DM6F 4BQAA 3DFGA 3EUHA 4A2UA 4L18B 2E1NA 4YFNF 3LMMA 1IN7A 5CJ9A 4IHXA 3HEFA 4CZZA 2RQPA 2FBHA 4HNTA 4G6TB 2LNBA 3HTUA 2CQKA 2VBZA 2X1EA 1RR8C 1DGRM 2OF7A 2VBXA 2XPWA 5H6QA 1B1BA 1LDDA 3JSPA 3LSPA 5E8GA 3HRTA 4R8HA 2UXXA 3BG9A 5FRMA 3SJMA 5FKOA 2WBMA 1YOVB 2L7FP 5LHIA 1MBHA 4KYWA 3LSMA 4XKCA 3OIPA 2VPRA 3AG3H 1WH7A 1QVUA 1MJAA 3NWSA 4CA0A 5ICEA 1K4SA 4HAMA 4ZC3A 2FEZA 3GO5A 2HOSA 4XBFA 3E7LA 1W36D 1OCCH 2X48A 1XC5A 2AQEA 3K4MA 2EV0A 4NC7A 4XSZF 4GDFA 3DPLC 3G71I 4HX7A 1RR7A 4A6DA 2KIUA 4A6EA 2ECBA 4N9HA 3ISPA 4II2A 2KT0A 5D6EA 2O0YA 3WU1B 2HTJA 4J00A 2BHZA 1DQUA 3OOUA 2DFHA 2NXNB 1BJAA 1BOAA 6PAXA 5DDGA 2KKOA 1IAWA 4P1WA 3F6VA 1P9QC 2ZMEA 5B1AH 1X3UA 3FXMA 2HPIA 2QLZA 4GCVA 5BPDA 4E7JA 3GBGA 1Z91A 4ENJA 1FEXA 5E18F 4HG2A 1V3FA 2LF8A 3PL8A 4Y7NJ 2X51A 4NC6A 2W57A 5DCFA 3TEDA 1PP8F 1YRNA 4MNUA 4OIQF 4RGXA 1FY7A 2JRMA 4J19A 4D9JA 4DJAA 2KIMA 3E1SA 1BIBA 3OSFA 2CFOA 2CJJA 4RGUA 3BR5A 5E3LA 3D0SA 4OAYA 5IYBJ 2FF4A 2PJRB 4LD5A 5LGTA 2QVOA 5GPAA 1ZN2A 2O8KA 2VT3A 4F7ZA 2VT2A 4X6AJ 5DD8A 1VFCA 5ICGA 2EQRA 5K5QA 5BNGA 3ZMDA 4KN4X 3AL0B 3TQNA 1BI2A 3K2AA 3O8GA 1P4WA 3MVPA 1P7JA 2QUFA 3KE2A 5D6FA 2ZSHB 4XIDA 2QGUA 2W25A 3HOUJ 4WXDA 3MMYB 4RAZA 4A3CJ 4PZJA 1OJLA 2VONA 1FYLA 2E34A 3LQRA 1S6LA 2CV2A 2HU9A 4C3JJ 5ICCA 3EYIA 1SMYF 1YJ9I 1J5YA 2OU2A 1XD7A 1WVRA 4EGZA 2DT5A 1WQ2A 2Y48A 3K4BA 2L01A 5ICFA 1B9NA 2HQ5A 2IGNA 2DMNA 1A36A 3ZOBA 1KZHA 3S2WA 1S7AA 3K0LA 3V8JA 4YRVA 1WJ5A 2N8GA 2IVMA 4B1RA 2COMA 3VSKA 3P9KA 1G8XA 2ZFWA 4CUGA 3F8BA 4YG2F 3TBIA 2CW0F 1Z1DA 4EMSA 1LPQA 2PJPA 1LUJB 1D0YA 4BJTA 1SFEA 4WX9A 5FROA 5J4VA 1E3PA 2IS1A 1P2FA 4JX6A 5K1YA 2MGQA 4Y4RA 1RUNA 4B44A 2FE3A 2ZMEB 4WK8F 1FSHA 1QZYA 3DV8A 1IN5A 5HS7A 4HX8A 2CRGA 3JR9A 3HPHA 2E1OA 1PYVA 2M8EA 2FX0A 3K2ZA 2DT7B 1RIOH 3SXYA 2M8GX 3PJRA 4ZYEA 2DA3A 2FMYA 3ERMA 4KIBA 1J7KA 1LNWA 3FZVA 3AAFA 3HOTA 1YRNB 4RMNA 2EZLA 2X1DA 2VPLA 1MJ9A 4MIMA 3WG7H 2HXOA 2LK2A 1R1UA 3VYSB 2V4JC 4BDYA 4A3GJ 4PJMA 1UG2A 2LG4A 5LRRA 2DFIA 1A31A 2W4SA 3K7AJ 2HNHA 2QBYB 1RKTA 3OYIA 1WCMJ 4UV9A 3HC7A 4DZPA 5HDKA 1ON2A 1WJDA 5GADJ 4A3EJ 1R1TA 1U9NA 5LHGA 4ENNA 2HYJA 3RZDJ 2IS2A 4BU2A 2LVSA 4O5VA 5C4JJ 4XRSG 1OCPA 4CSWA 2GBYA 1XDSA 3KP2A 4M6YA 2ZO4A 5DUKA 5J8CA 5CVRA 2TCTA 1FX7A 2ID3A 1EJ9A 2DODA 2NVYJ 2PMUA 3BOQA 4IKFA 1QU3A 4X1EA 1X4PA 2BE5F 3H3UA 2LFBA 3GFJA 5CQEA 2JA5J 3V7SA 3WTSC 2DMPA 4QLCU 4M72A 1Z67A 2R5ZA 5A2QZ 1U9OA 2MC4A 3I0TA 1HC8A 3HUGA 3HXLA 4KMUX 4IPAA 4YFXF 3CCEI 3UKGA 2K9MA 1Z77A 2ZJQF 1Z7LA 3BP8A 3A01B 1O3RA 4M3FA 2ELKA 4NHJA 3DWLE 5DEQA 1T39A 1Z0XA 2XAHA 4XRSA 4I99C 1BOBA 2LMDA 3BJ6A 3W3CA 2XV4S 2L4AA 3FISA 1FOXA 1BM9A 4I0AA 4FCYA 1FMVA 2CYYA 2ZXIA 3MZYA 2STTA 1X1AA 3RKXA 1DUXC 3S3MA 3T1BA 1X4OA 3WE3A 3CCYA 1TLHB 3NRVA 3CCMI 2A61A 4FISA 2XF6A 1VQ9I 2LR8A 4BYYA 2WY7Q 1UJ8A 4AD9A 1S72I 1NG6A 2JWTA 3W2AA 4RB2C 3O2PE 2BW3A 5J40A 4RM2A 2JK3A 4LOCA 1RUOA 4E7IA 4BE2A 3CC7I 5B3SH 2BVLA 3P9IA 1XS9A 3HIFA 3TP0A 5E8IA 4BEHA 4IZZA 1O3TA 3DP7A 1QHGA 4A12A 1NG7A 2R3SA 5F64A 1R9TJ 2HS5A 2LD5A 4M9XA 3T0YA 3C2GA 1ZKGA 3J7AY 3GFMA 5FRNA 5IT9K 4P9FA 3PNTA 2LSOA 3KYDB 4O3MA 4C3HJ 3I56I 1FC3A 5GAEJ 4H4KC 1Z05A 4ZYHA 3TP3A 3HOXJ 1OFCX 4XKBA 4FE4A 4A3KJ 4GO1A 3G6EI 2VQHA 5F04A 3GW2A 4AYBN 2KPMA 1MMDA 4IQ4A 3DPUA 1N25A 4QPQA 4PSWA 2B7EA 3NAUA 1QRYA 2ESNA 4S04A 1R36A 1AKHB 1E3OC 2VOOA 1XX5A 2V7FA 2VJ5A 3K1PA 1I50J 2WY8Q 3BQYA 4G9YA 2ZCWA 4U0WA 1PUEE 3RSNA 1IRFA 3OYEA 1Y6IA 3GWZA 1K61A 1R5GA 3U2RA 2IS4A 2A68F 5EEHA 3TKYA 5J1YA 3IHUA 4PJJA 1ZK8A 5HS8A 2VQCA 2LH9A 2XC7A 5J8FA 4OWRB 1BA5A 3N05A 5KAIC 2XF7A 3FM5A 1TZLA 2FQ3A 2L5QA 1TT0A 2L3DA 1ETKA 3FXJA 1GXQA 2QQ9A 2QZ8A 1X2MA 1LB2A 1X19A 4AC0A 1TBXA 4KITB 3S93A 1U0JA 4BQNA 4L9NA 2HQNA 2PFBA 3V4GA 1HSJA 3PQJA 1TQPA 2O8XA 1H0MA 4M6XA 3BTLA 3F9KA 3A0BC 5E79C 3SYTA 3KZZA 1W7PD 5FKKA 5IP7J 5E17F 1F43A 4L9VA 3GF2A 4PJNA 1ONVA 1R58A 5TJJA 4M9SA 4IX7A 3Q5FA 2Y9YA 4J01A 3OYBA 2J5OA 4E70A 1FYMA 4FQGA 4I6ZA 2GLOA 3SFIA 4UB6C 1MBJA 4D1QA 5HDNA 1O4XA 3CJRB 1Y0NA 4ZJZA 3S14J 2DU9A 4A0ZA 3VODA 1WJCA 2CUFA 4ANJA 2H6CA 4XK4A 3JREA 4XKWA 3AG2H 1NK3P 4BEHB 2WV1A 4XL9A 2OTLI 1ZG1A 3U1DA 5C44J 3B6CA 4EM1A 3MKLA 4Y15A 4D7NA 3IH4A 2CQQA 2BBYA 3E97A 4HV5A 4G7ZF 2P5KA 3CJQB 4C2TA 4DZJA 5E1ZB 3CO6C 4B48A 4D5FA 3TO7A 4AVZA 1HSTA 2M2EA 2PX9A 2P6SA 2NYXA 2JVGA 5FD5A 2VODA 2O5RA 4GFBA 3CUQC 2F2EA 2DDBA 3BTJA 5KHDA 2COBA 3ZRGA 3CUQA 2DTZA 3KYLA 2LYCA 2LLKA 3LFUA 5TRDA 4CYDA 1RESA 5DV5A 2XGCA 1JUPA 3D5LA 4MGRA 1GHCA 1FNNA 5IYCJ 1QQIA 3ML6A 2Z33A 3CJTB 3ULQB 1L0OC 3JRBA 2KLOA 4M6VA 3ABLH 2FNAA 4RS8A 4XONA 3RPUD 3M1CA 4PFOA 1S7EA 3HJEA 3I9V2 2ZJ2A 1JT0A 3JSOA 1X1BA 1YQAA 2DT6A 3CCSI 4RAYA 4W1UA 2ZKZA 5EGOA 1R23A 1XG1A 1Y56A 5FFXA 2Q8KA 4UUSB 1D0ZA 5E20A 4E7LA 3CLQA 4HBLA 2WWYA 2VJ4A 4KN7X 3QOPA 2X1CA 3FMQA 2PG4A 2WB1N 2DA5A 4CCMA 1GDTA 1S29A 3HDDA 3MKWB 1TWGJ 2I8DA 2L9NA 2EFWA 4RB1A 2VXDA 2KZVA 3L2VA 4CDGA 2LBFA 2H27A 4NQWB 2JVHA 3DTEA 1ENHA 1RRJA 2UV1A 3OR1C 3H9QA 3LSGA 3CO7C 5A2QK 3BT9A 3QYEA 5E1XA 2ISYA 4HZFA 1DU0A 3RKYA 2YPRA 3PM1A 3HHGA 3IUOA 4ZDOA 2NVUB 3HSFA 3DTKA 1ZYRF 4Y17A 1IUYA 1FIPA 1N77A 4B47A 3GZ5A 2KDZA 1AOYA 4A3IJ 2XB0X 3CP8A 3SEZA 2VQLA 3BPVA 1SEUA 1JXSA 4AYBA 3HBLA 2F4OB 4BBRJ 4M74A 3ERED 4BJ6C 4WF2A 4D7MA 2CU7A 2RDPA 3ZQ7A 2DA7A 3VSLA 4LK0F 2BEOA 2ME0A 3M8JA 5L3FA 3FXLA 2R7SA 4CHUA 1IRGA 1XGNA 2UWMA 2KRFA 3MZHA 4PUSA 3IKTA 3ABUA 2QA4I 5F1JA 3J7ZI 4EJWA 4L5IA 3I4PA 2M4GA 2PMZN 3SZTA 2FBKA 3H1CA 4A93J 3B73A 2L7KA 2FD5A 3QYFA 5JHUA 1H9GA 1T98A 5EYRA 4DYCA 4KFCA 2CH0A 2CSOA 3H5NA 3MN2A 4D5CA 2ADUA 2CS3A 3FF5A 4K2EA 3LA3A 4HRIA 4PJ0C 1YHQI 1HW1A 1SFXA 2R5YB 1TW2A 3VFZA 5D4RA 4W97A 5LGUA 5F0HA 3I54A 2CW7A 2DOEA 2Y31A 5EGOB 2D5VA 2H1KA 2DA2A 4YIIA 3B02A 3IC7A 1W36C 3S2DJ 5JI6A 3O3KA 2A6HF 2EH3A 5DTDA 4XN3A 3TO6A 1KU3A 5LRSA 2CQ7A 3GCMA 1B72B 1Z9CA 4Q47A 2M3AA 1XCVA 2OCCH 4KMFA 4C3IJ 4AVPA 3G1MA 2LRDA 4ZDLA 2LC2A 2DN0A 1FIAA 3D1NI 2YSRA 3BTIA 3GTLJ 2E60A 4HLYA 2R7ZJ 3BDDA 3BG3A 2OV7A 3K4KA 3GTMJ 3K9TA 1KQ0A 4ESFA 3OYKA 2K40A 1MSFC 1XGSA 3LOCA 5JR3A 2JPBA 1MBFA 1Z3YA 4I2OA 2DO7A 4RA2A 1OYWA 2XKOA 1SD4A 3GXOA 2RN7A 3CTAA 2FJ1A 3R0AA 2OQRA 4MLOA 3LAJA 2MFZA 2IBDA 5KNLA 1ODDA 2BVMA 5TISC 2ZC2A 2F5VA 1QZZA 1U5TB 1UHSA 3GLLA 1ITYA 3QU3A 3ABMH 2LY2A 5H6RA 3F3XA 4ABZA 2DA1A 3MQ0A 4FT8A 3WGHA 4EJOA 1DP3A 2VE8A 4MHGA 1VQ7I 1YS6A 3HKZA 1HDPA 2JSCA 3QOEA 2XAQA 2EFNA 3TDZC 3CCRI 1FYKA 2IPQX 4AM3A 2MC3A 2V1XA 1JUMA 2W85A 2E2IJ 4CCKA 1MJBA 2O03A 2RREA 3Q3SA 1YS7A 4YIFA 3JTGA 1YE9A 1EH8A 3K1MA 1G3TA 1SAUA 2P5VA 1M1EB 2XGXA 1R00A 5EDNA 3RKWA 4MEXF 1BJZA 2H8RA 2VOPA 5L3BA 2VI6A 3ZN1A 2R7RA 1MNEA 3QYBA 3IV5A 3I4NJ 2EZHA 1AWCA 4BL0B 3FHZA 4ESJA 4ITVA 1IJWC 3BR2A 3FKIJ 3I5UA 2DA6A 4FE7A 1UB9A 4OAZA 5IT9Z 2DFFA 2E1MB 1HBXG 3N4MA 5JLWA 4CYCB 2E5ZA 4YEJA 2XDVA 1MMSA 4GYGA 2CQXA 1APLC 4FHTA 1WJBA 3HSRA 3KP6A 2O61A 1JUSA 4JX4A 3FBIB 4UNOA 1FPQA 1VQ5I 4CCLA 3K4LA 3N97A 5IP9J 4IHWA 3SZPA 1LEAA 2K9LA 1V5FA 1I1SA 4OMZA 2GWRA 2LKSA 4HPQA 4B3XA 2L9RA 3FKJA 3AG1H 3JTHA 5IY5H 1BC8C 1QZEA 1EF4A 1I1GA 1LVKA 1XMKA 2YUSA 1B6AA 4NDLA 3WTUC 1YTYA 1X3ZB 3LSHA 4HOBA 5HNFA 1TC3C 3L7WA 1JKOC 5FB2A 1Y1VJ 5FKLA 4OOIA 4IRHA 1WJFA 1SVOA 2OAZA 3BZCA 4Y33A 1HCRA 1FSEA 3BQZA 2ZNYA 1R5ID 3PNYA 5M5YJ 1R22A 1XN7A 4HSRA 1WJAA 2PMZA 1IUFA 3IAS2 1FOYA 3H36A 4UUVA 3I53A 2BY2A 3VPRA 1WGXA 3OSGA 4QPOA 1I27A 1EH7A 3CDIA 3BR0A 1UZCA 1V5GA 5IPAA 1ZELA 2ELJA 1YLFA 2KJBA 3KYCB 2AXLA 3HZJA 3QWLA 1MNMC 1A04A 1FLIA 2IRFG 4ASNA 1JKQC 5BS6A 1ZLJA 1OKRA 3U21A 5J47A 3L2CA 2VKEA 2W48A 2KZGA 2GOMA 3RQ4A 2ZJRF 2QYOA 1YG2A 3BG5A 3BR6A 4HA8A 1O3SA 4BQQA 3TW7A 1MKMA 4AWXB 2HVRA 2JSPA 3E5UA 4BH9A 3DLAA 2DK5A 4F3QA 2STWA 1W4MA 2A5YB 3CZ6A 5J4YA 4UB8C 3RPQA 5HVQC 2IT0A 2P7CB 2GQQA 3HYIA 4PSXA 2IS6A 2AO9A 2JZYA 5CQGA 3CCLI 3RTRA 2X6OA 1FP2A 2L0KA 3C1DA 1ETOA 1K79A 2K9NA 5KAFC 3E6DA 4XLPF 1IV6A 2W1OA 2NAZA 1S7OA 5EZGA 3EQLF 1KYZA 1WRJA 1SD6A 1TT5B 1Y8RB 2M30A 1LFPA 3RQIA 1G4DA 3VYUB 3ECHA 5KK1A 3ZQGA 1D5VA 2HI3A 4OU0A 4BGDA 1P4AA 1U6GA 2K3FA 2ZXHA 4ON0A 4L9JA 4A3BJ 5TGTA 3RJPA 5JHFA 1IXRC 1I3QJ 3KP3A 4U87A 1LQ1A 4HF2A 1IG7A 3KX2A 5J1RA 5AIPA 4M73A 2PBIA 1CGPA 1XGMA 2K9SA 4RM3A 3WTYC 4RBOA 3Q0VA 1CF7A 3DXJF 3HOWJ 3WHCA 1J59A 3DPTA 2M34A 3JCUC 2FOWA 4KT5C 1FBUA 4UY8I 2NNNA 2E36A 1AHDP 2XASA 1F4KA 4KIGA 1JT6A 2EZIA 1IXSB 2RAEA 2E7WA 1QBJA 3LSRA 3ZQLA 2JJ7A 3K6GA 1EKEA 4OMYA 3FK7A 3PSIA 2DOAA 3KP4A 3DU6A 3NEUA 1D8JA 2Z16A 3DEEA 2KFDA 2PLYA 1G3WA 3O6BB 3DCFA 3F21A 1YIJI 1Y1WJ 2M9HA 2OA4A 2EPFA 5GTHC 2EFOA 3RYRA 4E6KG 1H9TA 3ZMVA 1RKWA 3BJAA 2OD5A 1OYYA 2LOOA 5LGNA 3PFYA 3BROA 2M0MA 3M3YJ 1HW5A 2MW8A 4Q5SF 3S1QJ 2KIQA 3RIRA 5L3DA 3ZXSA 3ROUA 5DUIA 5HOOA 1W5TA 2Y75A 1MMAA 3WU2C 4UVAA 1W7PA 2VC1A 2Y0SN 1POGA 4PGGA 1OQYA 2X4HA 5K5RA 1R1VA 3JW4A 1OCRH 2BZTA 2H6BA 2L2OA 4P55A 2CV0A 2EB7A 1BL0A 2ZXJA 3DBRB 1TWHJ 2HR3A 1WJEA 4JX5A 1PUFA 4M3GA 3W2WA 1OLTA 4BQOA 2R0QC 4OIRF 4H0EA 3CJNA 2QQ8A 1MDMA 3RI4A 4I09A 1TP4A 3PUFA 4YIRX 2XVCA 1Z6TA 3JAMZ 1IF1A 4E7ZA 5M5XJ 1W5SA 2GA1A 3OIQA 3ZQHA 2UZKA 3KCCA 3S1MJ 3DEWA 1TTYA 4X0GA 3OS0A 3HPGA 2K02A 1WI9A 2DAOA 4IRIA 4LG0A 5M5WJ 2JPCA 3L2WA 3P5JA 4L5EA 2XAJA 2BOLA 1QHHD 1X3WB 2W00A 3SDGA 5HLGA 1STZA 4S05A 4WCGA 3T5XA 2QENA 2R7OA 3GUDA 4F92B 4HF1A 1A6IA 2A6EF 1JTXA 5HS9A 3T8TA 1RETA 3CC2I 3D5RC 1K4TA 1TWCJ 2XAUA 1HW2A 1WKMA 4FASD 1I5ZA 3IKVA 4PK4A 4TV7A 2I10A 3FXQA 3OYMA 3WE2A 2EILH 2Z5UA 1SFKA 3CCQI 2K9QA 5DYMA 2HKXA 2VN2A 4A5NA 1V54H 3LA7A 4LIVA 2G7HA 3RPUA 4HNUA 2DFEA 3F6OA 2CV1A 3J7YJ 2NOGA 2R5ZB 5E1WA 4DW6A 1G59A 3H92A 3ASNH 3BLYA 2OZ6A 1OPCA 3HUGB 5M3MJ 1U78A 2KRCA 5L3CA 2WV0A 2OTJI 3HM5A 3L1PA 4YFKF 2AQFA 2FRHA 5D5VB 1KU7A 3LSJA 4XSXF 1DPRA 2QSGX 1IN6A 4QTRA 1ON1A 5HNHA 3LNQA 2BXZA 1T8IA 5CYVA 2IGOA 2FMLA 3WTTC 3L2RA 4ENKA 3IRQA 1Q1HA 2V9KA 3TGNA 2Q2EA 3KZYA 1LE8A 3B6AA 1MSEC 1ZQ3P 2E5NA 5ILUA 1IDZA 5FO5A 3TDUC 2XROA 2EA4A 4WXCA 4CCNA 3RKQA 1W1WE 2DLLA 1RI7A 4L0YB 2XB5A 1VZ0A 3KZIC 1TQMA 1JKPC 3S8PA 2GIVA 3I55I 2FOKA 3H35A 3I64A 2O7OA 3V42A 1FJLA 1DPUA 2F4MB 1ORKA 3E6MA 5FGMA 2RNGA 4UUTA 4U88A 2DJIA 4DIQA 1AA7A 3DBLB 1P4XA 2BW3B 2FSWA 3BJOA 5E3NA 1X1PA 1DU6A 1KGSA 3HRSA 3UR3C 3SHFA 1H8AC 1XTAA 1Y39A 2BY1A 4HYEA 4V2GA 3CD6I 5FD6A 3BG6A 2ACJA 1Z21A 3ZP5A 3PNVA 2ID6A 4DBRA 2Y0MA 3DKXA 2AHQA 3FIWA 4ZYAA 1BI3A 4N4OB 2NVQJ 4JYKA 4IHTA 2ICWG 2R7XA 1LKXA 2LKPA 4PGHA 4UVCA 4EV0A 5BOXA 2ZJPF 2D2WA 5IT3A 2ISZA 1TQIA 2BYVE 4BBSJ 3NARA 4LLNA 3A0HC 5J6XA 3PIOF 3MKYB 1NHAA 3CMEI 1C0WA 3RDIA 3K4NA 3HRMA 4BS9A 4L5JA 2KDOA 3LSTA 4ZZDA 3CQZJ 3HOSA 3ZQFA 1DDNA 3C2BA 4UXNA 1F5TA 1SANA 3WTXC 1BBYA 4MQVA 1O7LA 4XKVA 3L2QA 3OYGA 2MG4A 2RC4A 4JBAA 4U7BA 3FHNA 1REPC 2CO5A 2W84A 1P92A 3OYDA 1I3AA 3IH3A 4L9TA 2R7FA 2K5CA 3K10A 3W6KB 2EIJH 3PSFA 2JA7J 2V26A 3G3ZA 5DD4A 1GV5A 2B63J 4QIWN 3K69A 2RQQA 3P9CA 1UELB 3HGYA 5ED4A 4A69C 2HQAA 3BR1A 1J75A 2JRTA 1WSUA 1HQCA 3GTPJ 3GMEA 2ESHA 2YR2A 2L7ZA 1MBKA 2A69F 2PN6A 3V8LA 2GXBA 2Y0SA 2DTRA 3GZNB 2H09A 4LLLA 4HQEA 2ZFUA 1SD7A 2RVCA 3KFWX 2E1CA 2NS7A 4U0YA 2EBIA 2EWNA 4DQ2A 1VQLI 3KIOA 2OCEA 2R7QA 3K4CA 2V1UA 4RB3C 4OIOF 3R6SA 3PO2J 3U9GA 2TRTA 4HV6A 4BXUA 1MBEA 3E5XA 1VQNI 5JFRA 4KT6A 2JUCA 4A3DJ 2YX7A 2HPMA 1T0FC 5B5EC 3HSEA 1FZPB 1T6SA 5FFZA 1D8KA 4UVBA 3RCOA 2W7NA 2K4JA 3F8MA 3ZQIA 2DQLA 1EV7A 1B8IA 4G6QA 1XCBA 3SZGA 2WAEA 3HRUA 4Q4ZF 2WADA 3OYLA 2WC2A 4EQQA 4V19K 3FXUA 2EFPA 5IOYA 1V5EA 2TDXA 5K7ZA 1SC7A 4IHVA 4MTEA 3NWTA 4G12A 2QKLB 2R7UA 1FT9A 3VB2A 1MGTA 1YI2I 1K6OA 4RLQA 4U7DA 5KCMA 2IW5A 3FXRA 2QM3A 1AU7A 1MH4A 2Y69H 5FJ8J 2R7TA 1D5YA 3WTVC 2XF5A 3VOEA 1S3JA 4KUMA 4BNCA 1T95A 1QNTA 3IL2A 2JMWA 1W0TA 9ANTA 2CFXA 3I59A 3JRAA 1JHFA 4A3FJ 3CUQB 1MW7A 5L3EA 2NNYA 3ZGKA 4XOTA 2BGCA 2BHYA 1WFXA 5DS9A 2M45A 4DNCA 4BXFA 2CWEA 3JAMK 2XHKA 4QWQA 1PVEA 5FLXZ 4CCJA 4A3JJ 2V9PA 4S0HB 1EH6A 1ZRDA 2F5FA 4IO9F 2GXGA 5D8LB 1JTYA 1E2XA 2DPUA 1LFUP 4LMYA 2XUBA 2W24A 1LJ9A 3H5AA 3JRIA 1HF0A 5FLMJ 2JA2A 4IOAF 5C4XJ 3JRHA 1HDDC 2HTSA 2FA5A 4LJZF 1RZ4A 3VWBA 1D1BA 1UG0A 1VQOI 5HDGA 1U8RA 2L7MP 3EETA 1J09A 3L00A 4XORA 5LFAA 3KPHA 2JQ7A 5CVIA 3ESWB 2E71A 4CZCA 4YELA 2K7LA 2LBFB 1GT0C 4XLEA 3V7RA 3FXKA 3CF5F 3DF8A 4ZTJA 1KONA 1TL8A 1SAXA 4LG3A 4V2FA 2HYGD 1X2NA 5K7FA 1S8NA 1U8BA 4BHCA 4EJUA 1ZAOA 4NBQA 4BHBA 2P7VB 4DOZA 5GP9A 2CUJA 3Q9SA 3S17J 5AIQA 3HOVJ 1HA8A 3M8EA 4B8XA 1VF9A 3Q9VA 2VJJA 1D3YA 1TW3A 3BZKA 3TO9A 4EVIA 4BKXA 3SQNA 1SVLA 3E6CC 2HZTA 1MMGA 4XOPA 3H0DA 1P6RA 2AS5F 3L9FA 3FDYA 4LIUA 1XSXA 3CCVI 3BCBA 2QQBA 4KJZA 3HTSB 1Z3XA 2Y30A 4Z2YA 5GTIC 1VNDA 3OMYA 1ETQA 1LVAA 3TL4X 3RYPA 3QP6A 1R49A 2MLKA 1I6XA 2R93J 5LLQA 1J0RA 3HHHA 4OIPF 5FLVA 2XPUA 3GEZA 3OYCA 5D8KB 3FMSA 4U0VA 4G7HF 3ZMSA 2KISA 4XMYA 1JJ8C 4BE1A 2VBYA 3KEOA 2DYRH 5LD2C 1HLVA 3BR3A 1OISA 4M9ZA 3QPSA 2VB6A 3AKZA 4AIJA 3AL0C 1Z6RA 3BC8A 2IAIA 4MO7A 1GLNA 3GTKJ 4E7KA 2XKPA 4KICA 2VE9A 2MYSA 3LFKA 3ONQA 1KU9A 2A6TA 2R7DA 2WB1A 4FX4A 3MEXA 5AONA 1SMTA 3TOAA 1ZRFA 1BI1A 3FMRA 1S5LC 1I39A 2Q1ZB 5CPRB 2P5LC 2F4IA 1MD0A 1K78A 3GVAA 4HLXA 4P96A 3QQAA 3C3WA 3G1OA 4XN0A 1D1CA 3K1NA 3PUBA 3J7AO 2XRLA 5JVGF 3PO3J 3WTWC 2UUZA 2H1LA 2HVQA 4DYRA 3DKYA 1IRXA 3BWGA 3M07A 1YW9A 1H89C 2MH2A 3WHBA 2L9VA 3K70D 2G7UA 2B0LA 2J5PA 5D5WB 3W6JB 2W82A 4O6JA 3HL2A 1YITI 5HODA 2OZUA 1SVMA 4LGWA 1XGOA 3HG9A 2Z9OA 2MA3A 2X6YA 4JQFA 1B9MA 2KRHA 2LP0A 2X9DA 4RGRA 1LDKB 1T56A 2P8TA 2MLGA 1PP7U 4ZDPA 1F9NA 3S32A 3ZMZA 5EF6A 5KVRA 3OS2A 1YJWI 2QEXI 4IXAA 2XPVA 1E0EA 2ZMEC 3J81Z 1IN8A 4XLHA 1XPXA 1G3SA 2B9SA 2VL8A 3OS1A 4M71A 2F6CA 3L2UA 2R92J 2IEKA 1N75A 1J9IA 1YX5A 2BY3A 3DTIA 2WAQN 1TWAJ 3KLOA 3S16J 2Y9ZA 1HKTA 3C2HA 3ZMTA 1R7JA 4RGSA 3WGIA 3A02A 2PQ8A 3MFKA 2IJLA 3MKZA 4GGGA 2VKHA 2IA0A 3M9AA 4CH7A 4C2UA 2GM4A 2OBPA 4IF4A 5LHHA 2M1BA 4EEFG 2VC0A 3LSKA 5LEKA 1WPKA 3A4CA 1FTZA 2QBYA 3OL3A 2YU9J 3ZN0A 2YX4A 4XR6A 1BI0A 3I3LA 1IV8A 3DEUA 4LITA 4LB5A 2VQGA 3FX3A 3J80Z 2CUEA 4A0XA 1O7FA 2ETHA 4Y13A 4XRMA 1XMAA 4IOCF 3ZPLA 1UFMA 2HGCA 3GTJJ 3AFHA 3EPZA 4XLCA 4BUPA 2M87A 3TW6A 2LY9A 2EJRA 4BE0A 1TWFJ 2QSHX 3CESA 3PIPF 1FP1D 4R79A 2HOEA 2XAFA 3VYRB 2DMUA 1K78B 1PJRA 4CICA 3G2BA 2XRNA 4WXHA 1BR2A 3H3VK 2DPDA 2DOFA 2ME6A 4HDUA 5DM7F 3W6VA 3IWFA 1ZGAA 4M3EA 4EATA 3LL7A 3A01A 4BACA 2ECCA 5H20A 5FLXK 3KP5A 2VASA 4IL6C 3FWEA 2KQRA 2LKXA 1BC7C 2VLAA 4MTDA 1YW7A 2HZDA 5IP6A 2NS8A 4BHPA 4BXXJ 1R71A 2P6TA 3A03A 1SFOJ 3OYFA 2E2JJ 1K83J 2F5EA 2OPTA 2Y2ZA 5F0CA 3G73A 3BPXA 3FBNB 1NTCA 4A3MJ 1XB4A 1V4RA 1R4NB 2FUG2 2XAGA 1J2XA 3F8FA 2OJED 3R4KA 2O6GE 3H0GJ 4PFPA 3BTCA 5M3FJ 4XLAA 2QKMB 1ZGWA 4DYQA 2EV6A 3ELKA 4PDKA 3CDLA 3OYAA 3OL4A 2ZXWH 1IN4A 4MFDA 1HOMA 3H9GA 2H94A 3GX4X 2HXIA 2E7XA 2QF7A 4L0ZB 3ABKH 4OINF 1OCTC 2KIFA 3QODA 2JA6J 4KDPA 4Y3OA 5EEGA 1VQMI 5C3EJ 2L54A 5F6FA 3Q0WA 2VIXA 1G2HA 5CVVA 4XICA 5JVTA 1ZTRA 2KL4A 4HX4A 1UMQA 2X6XA 3F23A 4F55A 2C6YA 1L3LA 3KP7A 5ILSA 3EDPA 3VDXA 4B09A 2EIMH 1VQ6I 1Y0UA 5HLIA 2DXIA 1XDUA 2VKVA 2LDUA 2ZB9A 3JRFA 2EIKH 4FX0A 4G94A 3S3OA 4C9YA 1IDYA 5EJCA 1H88C 1AKHA 2GAUA 3A2KA 2DCEA 3R60A 4II3A 1GV2A 2M4KA 1QA6A 1UAAA 4ZYDA 2F48A 3GFIA 3ZR8X 3GTOJ 2BV6A 1YO5C 3QPTA 2EK5A 1HKSA 1RNLA 2VJIA 1O57A 2FBIA 1R6RA 2HDWA 3BCAA 4XLFA 3MWMA 3LA2A 4RAFA 1JI8A 3E0JB 4MFEA 2R7WA 1MIJA 2DA4A 3WTZA 3S15J 2M5WA 1X58A 5ERIA 1RPWA 5F27A 1E3HA 1DP7P 5H2FC
chains in the Genus database with same CATH topology
2F5CA 2HYFA 5HLHA 1XSDA 4GXOA 3QP5A 3M8FA 1ZG5A 1JE8A 2PEXA 2IA1A 3I71A 2Z3YA 1SFUA 1IXCA 4MQ9F 2HKOA 1CF7B 4NB5A 4RB0A 2XIGA 4ENMA 2P4WA 4IRGA 4IVNA 1UCRA 2D1HA 2HWVA 4I02A 2D1VA 4LB6B 3IWZA 2NRAC 1R5HA 1U3EM 2FU4A 5DCMA 2VBWA 2HDCA 2GA2A 3GLXA 1YW8A 2K86A 2ZNZA 2JT1A 4EM0B 4ZH4F 5BMZA 4AIKA 1QGPA 3T8RA 3LWFA 3F22A 4ZZLA 3J81K 1MZBA 1F1ZA 1OMIA 1YFHA 1LDJA 3LQQA 2ELHA 1T2KA 1K7AA 3V8KA 4KNYA 5ILVA 5D5UB 4XRFA 1JHHA 2VXZA 5BQTA 3P7NA 1W7PB 4I01A 2FNPA 2V9VA 3EYYA 2K4BA 3PQKA 1TNSA 4LLGF 1G3YA 3PFIA 3GYHX 4A5MA 3J80K 1MDMB 1FBQA 3REOA 5CVUA 1LEBA 1WWXA 1Z7UA 2MD5A 1HKQA 4D0PA 2KJCA 3L09A 4NQWA 3E3VA 4LK1F 4ZYGA 5D5XB 1O3QA 1UHMA 1ZLKA 4LG0B 2DI3A 5F1RA 1ZGJA 3KETA 5LBQA 1ULYA 3I58A 1JGSA 3WGGA 4UV8A 1ZHFA 1GVJA 1QPMA 3BY6A 3OOPA 5DCMB 2X0LA 2WTEA 3H3ZA 3MAJA 1OYIA 1OR7A 1T38A 1USTA 1BIAA 3M7GA 2FXAA 3WG9A 1YYVA 1KYWA 1BN5A 2GZWA 4N0BA 4ETSA 2O3FA 2D45A 3ECOA 1B4AA 5CVJA 2HFHA 1ZG3A 2MH9A 2V79A 3LAPA 1KA8A 2PI0A 2HQRA 1ZRCA 1SD5A 2F5DA 4PCQA 3C7JA 4KA4A 1T0FA 2EA2A 2RNJA 3KEQA 1YIOA 2QWWA 4CO8A 4HQMA 4G8XA 1VTNC 2V1DA 1QO0D 2PMHA 2RV8A 5LEJA 4CXFA 4ESBA 3CLOA 4EJTA 2EFQA 4I98B 1ZARA 4AIHA 3CUOA 2DQRA 4A0YA 4I0BA 2RGVA 3WODF 3ZMUA 4P9UA 2V6CA 4Q48A 2IP2A 3ABTA 4P5OA 3OV8A 1U5TC 3FM3A 2ZBKA 2CG4A 3QRFF 2CGPA 1U5TA 4EM2A 2EV5A 3QPHA 4HW0A 4G6DA 1KQ9A 3KLNA 3QAHA 2IA2A 5CLSA 4G7OF 2DW4A 4XLNF 3R0JA 4N9IA 3QU6A 4EGYA 1XSVA 2JTVA 2DK8A 2RKHA 1U2WA 1FWZA 3DKWA 1KU2A 1HXDA 2Q0OA 3V7CA 5K5OA 1B59A 1TNTA 4EJVA 3F72A 3GFLA 4BAYA 4KIFA 1ZREA 1G6NA 2A3SA 3CDHA 3COAC 3MCZA 3E5QA 1UHWA 3VEPA 3E6BA 3BZ6A 1KQ8A 3M1EA 2HEOA 2L4MA 2OQGA 5D4SA 3F8CA 1USSA 2L02A 3R61A 4HF0A 5L3GA 1E17A 2QQAA 1PDNC 4JK1X 2NS0A 5BPIA 2G9WA 3F8NA 4WWCA 1FBSA 4HDVA 2LF7A 4I7HA 4GYIA 3IRRA 4LFUA 1ZH5A 4UHTA 1FOKA 3NQOA 1GXPA 1IW7F 2K27A 2YU3A 3I59B 4R1HA 3WU0A 2UXNA 3TOBA 4IHSA 2A07F 2DBBA 3SFZA 3DQVC 2MBFA 1IZ1A 2Z99A 3C18A 4MEYF 3GZ6A 4IJAA 4CGZA 4BQAA 3DFGA 3EUHA 4A2UA 4L18B 2E1NA 4YFNF 1IN7A 5CJ9A 4CZZA 2RQPA 2FBHA 2LNBA 3HTUA 2CQKA 2VBZA 2VBXA 5H6QA 1B1BA 1LDDA 3JSPA 5E8GA 3HRTA 4R8HA 2UXXA 5LHIA 4KYWA 5ICEA 1MJAA 4HAMA 2FEZA 3GO5A 4XBFA 4XSZF 2EV0A 3DPLC 4HX7A 4A6DA 2KIUA 4A6EA 4N9HA 3ISPA 5D6EA 2O0YA 3WU1B 2HTJA 1BJAA 1BOAA 6PAXA 5DDGA 2KKOA 1IAWA 3F6VA 2ZMEA 1X3UA 2QLZA 4GCVA 5BPDA 1Z91A 4ENJA 5E18F 1V3FA 2LF8A 2W57A 5DCFA 1PP8F 4MNUA 4OIQF 4RGXA 1FY7A 2KIMA 1BIBA 4RGUA 3D0SA 2FF4A 4LD5A 5LGTA 2QVOA 1ZN2A 2VT3A 4F7ZA 2VT2A 5DD8A 5ICGA 5K5QA 3ZMDA 4KN4X 3TQNA 1BI2A 1P4WA 2QUFA 3KE2A 5D6FA 2W25A 4WXDA 4RAZA 4PZJA 2VONA 1FYLA 3LQRA 1S6LA 5ICCA 3EYIA 1SMYF 1J5YA 2OU2A 1XD7A 4EGZA 2DT5A 1WQ2A 2Y48A 2L01A 5ICFA 1B9NA 3S2WA 1S7AA 3K0LA 3V8JA 2IVMA 2COMA 3P9KA 4YG2F 2ZFWA 3F8BA 2CW0F 1Z1DA 4EMSA 2PJPA 1SFEA 4WX9A 1P2FA 5K1YA 1RUNA 2FE3A 2ZMEB 4WK8F 1FSHA 1QZYA 3DV8A 1IN5A 5HS7A 4HX8A 2M8EA 3K2ZA 1RIOH 3SXYA 4ZYEA 2FMYA 4KIBA 1J7KA 1LNWA 3FZVA 3AAFA 3HOTA 1MJ9A 1R1UA 5LRRA 2DFIA 2QBYB 4UV9A 5HDKA 1ON2A 1R1TA 5LHGA 4ENNA 4O5VA 1XDSA 3KP2A 4M6YA 2ZO4A 5DUKA 5J8CA 5CVRA 1FX7A 2PMUA 3BOQA 2BE5F 3H3UA 3GFJA 3V7SA 3WTSC 4QLCU 4M72A 5A2QZ 3I0TA 3HUGA 4KMUX 4IPAA 4YFXF 3BP8A 1O3RA 4NHJA 5DEQA 1T39A 2XAHA 3BJ6A 2XV4S 2L4AA 1BM9A 4I0AA 2CYYA 3MZYA 2STTA 3RKXA 1DUXC 3T1BA 3WE3A 1TLHB 3NRVA 2A61A 4BYYA 4AD9A 4RB2C 3O2PE 1RUOA 3P9IA 3HIFA 5E8IA 1O3TA 3DP7A 4A12A 2R3SA 5F64A 2HS5A 4M9XA 3T0YA 3GFMA 5IT9K 4P9FA 2LSOA 4O3MA 1FC3A 1Z05A 4ZYHA 4GO1A 3GW2A 2ESNA 4S04A 1R36A 2VOOA 3K1PA 4G9YA 2ZCWA 4U0WA 1PUEE 1IRFA 3GWZA 1R5GA 3U2RA 2A68F 5EEHA 3TKYA 3IHUA 5HS8A 5J8FA 3FM5A 2FQ3A 2L3DA 1GXQA 2QQ9A 2QZ8A 1LB2A 1TBXA 4L9NA 2HQNA 2PFBA 3V4GA 1HSJA 3PQJA 1TQPA 2O8XA 1H0MA 4M6XA 3KZZA 1W7PD 5E17F 4L9VA 3GF2A 1ONVA 1R58A 5TJJA 4M9SA 3Q5FA 2J5OA 4E70A 1FYMA 5HDNA 2DU9A 4A0ZA 3VODA 2H6CA 1ZG1A 3U1DA 4EM1A 4Y15A 2BBYA 3E97A 4HV5A 4G7ZF 2P5KA 5E1ZB 3CO6C 3TO7A 1HSTA 2P6SA 2NYXA 5FD5A 2VODA 3CUQC 2F2EA 3CUQA 5TRDA 4CYDA 5DV5A 3D5LA 4MGRA 1GHCA 1FNNA 1QQIA 3ML6A 2Z33A 3ULQB 1L0OC 2FNAA 4RS8A 2ZJ2A 3JSOA 1YQAA 4RAYA 2ZKZA 1R23A 5FFXA 2Q8KA 5E20A 4HBLA 2WWYA 4KN7X 3QOPA 3FMQA 2PG4A 1S29A 2EFWA 4RB1A 4CDGA 2H27A 3CO7C 5A2QK 5E1XA 2ISYA 4HZFA 3RKYA 2YPRA 3HHGA 3HSFA 1ZYRF 4Y17A 1IUYA 3GZ5A 1AOYA 3BPVA 1JXSA 4M74A 3ERED 4WF2A 2RDPA 3ZQ7A 4LK0F 2BEOA 5L3FA 4CHUA 1IRGA 1XGNA 2UWMA 2KRFA 3MZHA 3IKTA 3ABUA 4EJWA 4L5IA 3I4PA 3SZTA 2FBKA 3B73A 5JHUA 1H9GA 1T98A 4KFCA 2CSOA 2ADUA 3FF5A 4K2EA 3LA3A 1HW1A 1SFXA 1TW2A 3VFZA 5D4RA 5LGUA 3I54A 4YIIA 3B02A 3IC7A 5JI6A 3O3KA 2A6HF 3TO6A 1KU3A 5LRSA 1Z9CA 4Q47A 1XCVA 4KMFA 4AVPA 2YSRA 4HLYA 3BDDA 3K9TA 1KQ0A 4ESFA 1XGSA 5JR3A 2JPBA 4I2OA 2DO7A 1OYWA 2XKOA 1SD4A 3GXOA 2RN7A 3CTAA 3R0AA 2OQRA 3LAJA 1ODDA 1QZZA 1U5TB 3QU3A 5H6RA 3F3XA 3MQ0A 4FT8A 3WGHA 4EJOA 2VE8A 4MHGA 1YS6A 2JSCA 2XAQA 2EFNA 3TDZC 1FYKA 2IPQX 2MC3A 2V1XA 2W85A 1MJBA 2O03A 1YS7A 4YIFA 3JTGA 1EH8A 3K1MA 1G3TA 2P5VA 2XGXA 1R00A 4MEXF 3RKWA 2VOPA 5L3BA 3ZN1A 1AWCA 3FHZA 4ESJA 3I5UA 1UB9A 5IT9Z 1HBXG 3N4MA 4GYGA 4FHTA 3HSRA 3KP6A 2O61A 4UNOA 1FPQA 3N97A 3SZPA 1LEAA 1I1SA 4OMZA 2GWRA 3JTHA 1BC8C 1I1GA 1XMKA 1B6AA 3WTUC 1YTYA 4HOBA 3L7WA 5FB2A 4OOIA 4IRHA 2OAZA 1FSEA 2ZNYA 1R22A 1XN7A 4UUVA 3I53A 1I27A 1EH7A 1YLFA 2KJBA 2AXLA 1A04A 1FLIA 2IRFG 4ASNA 5BS6A 1ZLJA 1OKRA 3L2CA 2QYOA 1YG2A 4HA8A 1O3SA 1MKMA 4AWXB 3E5UA 4BH9A 2DK5A 2STWA 1W4MA 2A5YB 3RPQA 5HVQC 2IT0A 2P7CB 2GQQA 3HYIA 2JZYA 3RTRA 1FP2A 3C1DA 1K79A 3E6DA 4XLPF 2NAZA 1S7OA 3EQLF 1KYZA 1WRJA 1SD6A 2M30A 1G4DA 3ECHA 5KK1A 1D5VA 4OU0A 1P4AA 1U6GA 4ON0A 4L9JA 3RJPA 1IXRC 3KP3A 1LQ1A 4HF2A 5AIPA 4M73A 2PBIA 1CGPA 1XGMA 3WTYC 1CF7A 3DXJF 1J59A 3DPTA 4KT5C 1FBUA 2NNNA 2XASA 1F4KA 4KIGA 1IXSB 2E7WA 1QBJA 4OMYA 3KP4A 3NEUA 1D8JA 2PLYA 1G3WA 3O6BB 3F21A 2OA4A 2EFOA 3RYRA 1H9TA 3ZMVA 3BJAA 2OD5A 1OYYA 5LGNA 3BROA 1HW5A 4Q5SF 3RIRA 5L3DA 3ROUA 5DUIA 5HOOA 1W5TA 2Y75A 4UVAA 1W7PA 2VC1A 4PGGA 2X4HA 5K5RA 1R1VA 3JW4A 2H6BA 4P55A 2EB7A 2ZXJA 2HR3A 4OIRF 4H0EA 3CJNA 1MDMA 3RI4A 4I09A 2XVCA 1Z6TA 3JAMZ 1IF1A 1W5SA 2GA1A 2UZKA 3KCCA 1TTYA 2K02A 1WI9A 2DAOA 4IRIA 4LG0A 2JPCA 2XAJA 5HLGA 1STZA 4S05A 4WCGA 3T5XA 2QENA 3GUDA 4HF1A 2A6EF 5HS9A 3T8TA 1HW2A 1WKMA 1I5ZA 3IKVA 4TV7A 3FXQA 3WE2A 2Z5UA 5DYMA 2HKXA 2VN2A 4A5NA 3LA7A 2G7HA 3RPUA 3F6OA 5E1WA 3H92A 2OZ6A 1OPCA 1U78A 5L3CA 2WV0A 4YFKF 5D5VB 2FRHA 1KU7A 4XSXF 1DPRA 1IN6A 1ON1A 5CYVA 2FMLA 3WTTC 4ENKA 3IRQA 1Q1HA 3TGNA 2Q2EA 3KZYA 5ILUA 5FO5A 3TDUC 2XROA 2EA4A 4WXCA 2DLLA 1RI7A 4L0YB 1TQMA 2GIVA 2FOKA 3I64A 1DPUA 3E6MA 5FGMA 4U88A 2FSWA 1P4XA 3BJOA 1KGSA 3HRSA 3SHFA 4HYEA 5FD6A 2ACJA 3ZP5A 2Y0MA 1BI3A 4IHTA 2LKPA 4PGHA 4UVCA 4EV0A 5BOXA 2D2WA 5IT3A 2ISZA 1TQIA 2BYVE 4LLNA 5J6XA 1NHAA 1C0WA 3RDIA 3HRMA 4L5JA 3LSTA 4ZZDA 3HOSA 1DDNA 1F5TA 4UXNA 3WTXC 1BBYA 4MQVA 1O7LA 2RC4A 4JBAA 4U7BA 1REPC 2CO5A 2W84A 1P92A 4L9TA 2R7FA 3W6KB 3G3ZA 5DD4A 3K69A 3P9CA 5ED4A 1J75A 2JRTA 1WSUA 1HQCA 2ESHA 2YR2A 2A69F 2PN6A 3V8LA 2GXBA 2DTRA 2H09A 4LLLA 4HQEA 1SD7A 2RVCA 3KFWX 2E1CA 4U0YA 2EWNA 4DQ2A 2V1UA 4RB3C 4OIOF 3R6SA 3U9GA 4HV6A 4BXUA 3E5XA 5JFRA 2YX7A 3HSEA 1FZPB 1T6SA 5FFZA 1D8KA 4UVBA 2K4JA 3F8MA 2DQLA 1EV7A 4G6QA 1XCBA 3HRUA 4Q4ZF 2WC2A 4EQQA 3FXUA 2EFPA 2TDXA 4MTEA 1FT9A 3VB2A 1MGTA 1K6OA 4U7DA 2IW5A 3FXRA 2QM3A 3WTVC 3VOEA 1S3JA 4KUMA 4BNCA 1QNTA 3IL2A 2CFXA 3I59A 1JHFA 3CUQB 5L3EA 2NNYA 2BGCA 2M45A 4DNCA 3JAMK 2CWEA 2XHKA 4QWQA 5FLXZ 1EH6A 1ZRDA 2F5FA 2GXGA 5D8LB 1E2XA 2DPUA 4LMYA 2XUBA 2W24A 1LJ9A 2HTSA 2FA5A 4LJZF 1RZ4A 5HDGA 1U8RA 3EETA 3L00A 5CVIA 2K7LA 3V7RA 3DF8A 1SAXA 2HYGD 1S8NA 4BHCA 4EJUA 1ZAOA 4BHBA 2P7VB 3Q9SA 5AIQA 3M8EA 4B8XA 3Q9VA 1D3YA 1TW3A 3TO9A 4EVIA 3SQNA 3E6CC 2HZTA 1P6RA 2AS5F 3L9FA 1XSXA 2QQBA 3HTSB 4Z2YA 1LVAA 3RYPA 3QP6A 2MLKA 1I6XA 5LLQA 1J0RA 3HHHA 4OIPF 3GEZA 5D8KB 3FMSA 4U0VA 4G7HF 3ZMSA 2VBYA 3KEOA 4M9ZA 4AIJA 1Z6RA 2XKPA 4KICA 2VE9A 3LFKA 1KU9A 2R7DA 4FX4A 3MEXA 5AONA 1SMTA 3TOAA 1ZRFA 1BI1A 3FMRA 2P5LC 1MD0A 1K78A 3GVAA 4HLXA 4P96A 3C3WA 3K1NA 3J7AO 3WTWC 3BWGA 1YW9A 2MH2A 2G7UA 2B0LA 2J5PA 5D5WB 3W6JB 4O6JA 2OZUA 4LGWA 1XGOA 2Z9OA 2MA3A 4JQFA 1B9MA 4RGRA 1LDKB 2P8TA 2MLGA 1PP7U 1F9NA 3ZMZA 5KVRA 4IXAA 3J81Z 1IN8A 1G3SA 4M71A 1J9IA 3KLOA 1HKTA 3ZMTA 1R7JA 4RGSA 3WGIA 2PQ8A 3MFKA 2IJLA 4GGGA 2IA0A 3M9AA 2OBPA 4IF4A 5LHHA 2M1BA 2VC0A 5LEKA 2QBYA 3ZN0A 2YX4A 1BI0A 4LB5A 3DEUA 3FX3A 3J80Z 4A0XA 1O7FA 2ETHA 4Y13A 3ZPLA 1XMAA 1UFMA 2HGCA 2M87A 2EJRA 1FP1D 4R79A 2HOEA 2XAFA 1K78B 4CICA 2XRNA 4WXHA 2DPDA 4HDUA 3IWFA 1ZGAA 5H20A 5FLXK 3KP5A 3FWEA 1BC7C 4MTDA 1YW7A 4BHPA 2P6TA 2F5EA 3G73A 3BPXA 1XB4A 1V4RA 2XAGA 1J2XA 3F8FA 3R4KA 2O6GE 2EV6A 3ELKA 4PDKA 1IN4A 2H94A 3GX4X 2E7XA 4L0ZB 4OINF 2KIFA 4KDPA 5EEGA 2L54A 5F6FA 5CVVA 5JVTA 4HX4A 3F23A 2C6YA 1L3LA 3KP7A 5ILSA 3EDPA 4B09A 1Y0UA 5HLIA 1XDUA 2LDUA 4FX0A 4G94A 2GAUA 3R60A 4ZYDA 3GFIA 2BV6A 1YO5C 3QPTA 2EK5A 1HKSA 1RNLA 1O57A 2FBIA 3MWMA 3LA2A 3WTZA 2M5WA 1DP7P 5ERIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5C A;  2HYF A;  5HLH A;  1XSD A;  4GXO A;  3QP5 A;  3M8F A;  1ZG5 A;  1JE8 A;  2PEX A;  2IA1 A;  3I71 A;  2Z3Y A;  1SFU A;  1IXC A;  4MQ9 F;  2HKO A;  1CF7 B;  4NB5 A;  4RB0 A;  2XIG A;  4ENM A;  2P4W A;  4IRG A;  4IVN A;  1UCR A;  2D1H A;  2HWV A;  4I02 A;  2D1V A;  4LB6 B;  3IWZ A;  2NRA C;  1R5H A;  1U3E M;  2FU4 A;  5DCM A;  2VBW A;  2HDC A;  2GA2 A;  3GLX A;  1YW8 A;  2K86 A;  2ZNZ A;  2JT1 A;  4EM0 B;  4ZH4 F;  5BMZ A;  4AIK A;  1QGP A;  3T8R A;  3LWF A;  3F22 A;  4ZZL A;  3J81 K;  1MZB A;  1F1Z A;  1OMI A;  1YFH A;  1LDJ A;  3LQQ A;  2ELH A;  1T2K A;  1K7A A;  3V8K A;  4KNY A;  5ILV A;  5D5U B;  4XRF A;  1JHH A;  2VXZ A;  5BQT A;  3P7N A;  1W7P B;  4I01 A;  2FNP A;  2V9V A;  3EYY A;  2K4B A;  3PQK A;  1TNS A;  4LLG F;  1G3Y A;  3PFI A;  3GYH X;  4A5M A;  3J80 K;  1MDM B;  1FBQ A;  3REO A;  5CVU A;  1LEB A;  1WWX A;  1Z7U A;  2MD5 A;  1HKQ A;  4D0P A;  2KJC A;  3L09 A;  4NQW A;  3E3V A;  4LK1 F;  4ZYG A;  5D5X B;  1O3Q A;  1UHM A;  1ZLK A;  4LG0 B;  2DI3 A;  5F1R A;  1ZGJ A;  3KET A;  5LBQ A;  1ULY A;  3I58 A;  1JGS A;  3WGG A;  4UV8 A;  1ZHF A;  1GVJ A;  1QPM A;  3BY6 A;  3OOP A;  5DCM B;  2X0L A;  2WTE A;  3H3Z A;  3MAJ A;  1OYI A;  1OR7 A;  1T38 A;  1UST A;  1BIA A;  3M7G A;  2FXA A;  3WG9 A;  1YYV A;  1KYW A;  1BN5 A;  2GZW A;  4N0B A;  4ETS A;  2O3F A;  2D45 A;  3ECO A;  1B4A A;  5CVJ A;  2HFH A;  1ZG3 A;  2MH9 A;  2V79 A;  3LAP A;  1KA8 A;  2PI0 A;  2HQR A;  1ZRC A;  1SD5 A;  2F5D A;  4PCQ A;  3C7J A;  4KA4 A;  1T0F A;  2EA2 A;  2RNJ A;  3KEQ A;  1YIO A;  2QWW A;  4CO8 A;  4HQM A;  4G8X A;  1VTN C;  2V1D A;  1QO0 D;  2PMH A;  2RV8 A;  5LEJ A;  4CXF A;  4ESB A;  3CLO A;  4EJT A;  2EFQ A;  4I98 B;  1ZAR A;  4AIH A;  3CUO A;  2DQR A;  4A0Y A;  4I0B A;  2RGV A;  3WOD F;  3ZMU A;  4P9U A;  2V6C A;  4Q48 A;  2IP2 A;  3ABT A;  4P5O A;  3OV8 A;  1U5T C;  3FM3 A;  2ZBK A;  2CG4 A;  3QRF F;  2CGP A;  1U5T A;  4EM2 A;  2EV5 A;  3QPH A;  4HW0 A;  4G6D A;  1KQ9 A;  3KLN A;  3QAH A;  2IA2 A;  5CLS A;  4G7O F;  2DW4 A;  4XLN F;  3R0J A;  4N9I A;  3QU6 A;  4EGY A;  1XSV A;  2JTV A;  2DK8 A;  2RKH A;  1U2W A;  1FWZ A;  3DKW A;  1KU2 A;  1HXD A;  2Q0O A;  3V7C A;  5K5O A;  1B59 A;  1TNT A;  4EJV A;  3F72 A;  3GFL A;  4BAY A;  4KIF A;  1ZRE A;  1G6N A;  2A3S A;  3CDH A;  3COA C;  3MCZ A;  3E5Q A;  1UHW A;  3VEP A;  3E6B A;  3BZ6 A;  1KQ8 A;  3M1E A;  2HEO A;  2L4M A;  2OQG A;  5D4S A;  3F8C A;  1USS A;  2L02 A;  3R61 A;  4HF0 A;  5L3G A;  1E17 A;  2QQA A;  1PDN C;  4JK1 X;  2NS0 A;  5BPI A;  2G9W A;  3F8N A;  4WWC A;  1FBS A;  4HDV A;  2LF7 A;  4I7H A;  4GYI A;  3IRR A;  4LFU A;  1ZH5 A;  4UHT A;  1FOK A;  3NQO A;  1GXP A;  1IW7 F;  2K27 A;  2YU3 A;  3I59 B;  4R1H A;  3WU0 A;  2UXN A;  3TOB A;  4IHS A;  2A07 F;  2DBB A;  3SFZ A;  3DQV C;  2MBF A;  1IZ1 A;  2Z99 A;  3C18 A;  4MEY F;  3GZ6 A;  4IJA A;  4CGZ A;  4BQA A;  3DFG A;  3EUH A;  4A2U A;  4L18 B;  2E1N A;  4YFN F;  1IN7 A;  5CJ9 A;  4CZZ A;  2RQP A;  2FBH A;  2LNB A;  3HTU A;  2CQK A;  2VBZ A;  2VBX A;  5H6Q A;  1B1B A;  1LDD A;  3JSP A;  5E8G A;  3HRT A;  4R8H A;  2UXX A;  5LHI A;  4KYW A;  5ICE A;  1MJA A;  4HAM A;  2FEZ A;  3GO5 A;  4XBF A;  4XSZ F;  2EV0 A;  3DPL C;  4HX7 A;  4A6D A;  2KIU A;  4A6E A;  4N9H A;  3ISP A;  5D6E A;  2O0Y A;  3WU1 B;  2HTJ A;  1BJA A;  1BOA A;  6PAX A;  5DDG A;  2KKO A;  1IAW A;  3F6V A;  2ZME A;  1X3U A;  2QLZ A;  4GCV A;  5BPD A;  1Z91 A;  4ENJ A;  5E18 F;  1V3F A;  2LF8 A;  2W57 A;  5DCF A;  1PP8 F;  4MNU A;  4OIQ F;  4RGX A;  1FY7 A;  2KIM A;  1BIB A;  4RGU A;  3D0S A;  2FF4 A;  4LD5 A;  5LGT A;  2QVO A;  1ZN2 A;  2VT3 A;  4F7Z A;  2VT2 A;  5DD8 A;  5ICG A;  5K5Q A;  3ZMD A;  4KN4 X;  3TQN A;  1BI2 A;  1P4W A;  2QUF A;  3KE2 A;  5D6F A;  2W25 A;  4WXD A;  4RAZ A;  4PZJ A;  2VON A;  1FYL A;  3LQR A;  1S6L A;  5ICC A;  3EYI A;  1SMY F;  1J5Y A;  2OU2 A;  1XD7 A;  4EGZ A;  2DT5 A;  1WQ2 A;  2Y48 A;  2L01 A;  5ICF A;  1B9N A;  3S2W A;  1S7A A;  3K0L A;  3V8J A;  2IVM A;  2COM A;  3P9K A;  4YG2 F;  2ZFW A;  3F8B A;  2CW0 F;  1Z1D A;  4EMS A;  2PJP A;  1SFE A;  4WX9 A;  1P2F A;  5K1Y A;  1RUN A;  2FE3 A;  2ZME B;  4WK8 F;  1FSH A;  1QZY A;  3DV8 A;  1IN5 A;  5HS7 A;  4HX8 A;  2M8E A;  3K2Z A;  1RIO H;  3SXY A;  4ZYE A;  2FMY A;  4KIB A;  1J7K A;  1LNW A;  3FZV A;  3AAF A;  3HOT A;  1MJ9 A;  1R1U A;  5LRR A;  2DFI A;  2QBY B;  4UV9 A;  5HDK A;  1ON2 A;  1R1T A;  5LHG A;  4ENN A;  4O5V A;  1XDS A;  3KP2 A;  4M6Y A;  2ZO4 A;  5DUK A;  5J8C A;  5CVR A;  1FX7 A;  2PMU A;  3BOQ A;  2BE5 F;  3H3U A;  3GFJ A;  3V7S A;  3WTS C;  4QLC U;  4M72 A;  5A2Q Z;  3I0T A;  3HUG A;  4KMU X;  4IPA A;  4YFX F;  3BP8 A;  1O3R A;  4NHJ A;  5DEQ A;  1T39 A;  2XAH A;  3BJ6 A;  2XV4 S;  2L4A A;  1BM9 A;  4I0A A;  2CYY A;  3MZY A;  2STT A;  3RKX A;  1DUX C;  3T1B A;  3WE3 A;  1TLH B;  3NRV A;  2A61 A;  4BYY A;  4AD9 A;  4RB2 C;  3O2P E;  1RUO A;  3P9I A;  3HIF A;  5E8I A;  1O3T A;  3DP7 A;  4A12 A;  2R3S A;  5F64 A;  2HS5 A;  4M9X A;  3T0Y A;  3GFM A;  5IT9 K;  4P9F A;  2LSO A;  4O3M A;  1FC3 A;  1Z05 A;  4ZYH A;  4GO1 A;  3GW2 A;  2ESN A;  4S04 A;  1R36 A;  2VOO A;  3K1P A;  4G9Y A;  2ZCW A;  4U0W A;  1PUE E;  1IRF A;  3GWZ A;  1R5G A;  3U2R A;  2A68 F;  5EEH A;  3TKY A;  3IHU A;  5HS8 A;  5J8F A;  3FM5 A;  2FQ3 A;  2L3D A;  1GXQ A;  2QQ9 A;  2QZ8 A;  1LB2 A;  1TBX A;  4L9N A;  2HQN A;  2PFB A;  3V4G A;  1HSJ A;  3PQJ A;  1TQP A;  2O8X A;  1H0M A;  4M6X A;  3KZZ A;  1W7P D;  5E17 F;  4L9V A;  3GF2 A;  1ONV A;  1R58 A;  5TJJ A;  4M9S A;  3Q5F A;  2J5O A;  4E70 A;  1FYM A;  5HDN A;  2DU9 A;  4A0Z A;  3VOD A;  2H6C A;  1ZG1 A;  3U1D A;  4EM1 A;  4Y15 A;  2BBY A;  3E97 A;  4HV5 A;  4G7Z F;  2P5K A;  5E1Z B;  3CO6 C;  3TO7 A;  1HST A;  2P6S A;  2NYX A;  5FD5 A;  2VOD A;  3CUQ C;  2F2E A;  3CUQ A;  5TRD A;  4CYD A;  5DV5 A;  3D5L A;  4MGR A;  1GHC A;  1FNN A;  1QQI A;  3ML6 A;  2Z33 A;  3ULQ B;  1L0O C;  2FNA A;  4RS8 A;  2ZJ2 A;  3JSO A;  1YQA A;  4RAY A;  2ZKZ A;  1R23 A;  5FFX A;  2Q8K A;  5E20 A;  4HBL A;  2WWY A;  4KN7 X;  3QOP A;  3FMQ A;  2PG4 A;  1S29 A;  2EFW A;  4RB1 A;  4CDG A;  2H27 A;  3CO7 C;  5A2Q K;  5E1X A;  2ISY A;  4HZF A;  3RKY A;  2YPR A;  3HHG A;  3HSF A;  1ZYR F;  4Y17 A;  1IUY A;  3GZ5 A;  1AOY A;  3BPV A;  1JXS A;  4M74 A;  3ERE D;  4WF2 A;  2RDP A;  3ZQ7 A;  4LK0 F;  2BEO A;  5L3F A;  4CHU A;  1IRG A;  1XGN A;  2UWM A;  2KRF A;  3MZH A;  3IKT A;  3ABU A;  4EJW A;  4L5I A;  3I4P A;  3SZT A;  2FBK A;  3B73 A;  5JHU A;  1H9G A;  1T98 A;  4KFC A;  2CSO A;  2ADU A;  3FF5 A;  4K2E A;  3LA3 A;  1HW1 A;  1SFX A;  1TW2 A;  3VFZ A;  5D4R A;  5LGU A;  3I54 A;  4YII A;  3B02 A;  3IC7 A;  5JI6 A;  3O3K A;  2A6H F;  3TO6 A;  1KU3 A;  5LRS A;  1Z9C A;  4Q47 A;  1XCV A;  4KMF A;  4AVP A;  2YSR A;  4HLY A;  3BDD A;  3K9T A;  1KQ0 A;  4ESF A;  1XGS A;  5JR3 A;  2JPB A;  4I2O A;  2DO7 A;  1OYW A;  2XKO A;  1SD4 A;  3GXO A;  2RN7 A;  3CTA A;  3R0A A;  2OQR A;  3LAJ A;  1ODD A;  1QZZ A;  1U5T B;  3QU3 A;  5H6R A;  3F3X A;  3MQ0 A;  4FT8 A;  3WGH A;  4EJO A;  2VE8 A;  4MHG A;  1YS6 A;  2JSC A;  2XAQ A;  2EFN A;  3TDZ C;  1FYK A;  2IPQ X;  2MC3 A;  2V1X A;  2W85 A;  1MJB A;  2O03 A;  1YS7 A;  4YIF A;  3JTG A;  1EH8 A;  3K1M A;  1G3T A;  2P5V A;  2XGX A;  1R00 A;  4MEX F;  3RKW A;  2VOP A;  5L3B A;  3ZN1 A;  1AWC A;  3FHZ A;  4ESJ A;  3I5U A;  1UB9 A;  5IT9 Z;  1HBX G;  3N4M A;  4GYG A;  4FHT A;  3HSR A;  3KP6 A;  2O61 A;  4UNO A;  1FPQ A;  3N97 A;  3SZP A;  1LEA A;  1I1S A;  4OMZ A;  2GWR A;  3JTH A;  1BC8 C;  1I1G A;  1XMK A;  1B6A A;  3WTU C;  1YTY A;  4HOB A;  3L7W A;  5FB2 A;  4OOI A;  4IRH A;  2OAZ A;  1FSE A;  2ZNY A;  1R22 A;  1XN7 A;  4UUV A;  3I53 A;  1I27 A;  1EH7 A;  1YLF A;  2KJB A;  2AXL A;  1A04 A;  1FLI A;  2IRF G;  4ASN A;  5BS6 A;  1ZLJ A;  1OKR A;  3L2C A;  2QYO A;  1YG2 A;  4HA8 A;  1O3S A;  1MKM A;  4AWX B;  3E5U A;  4BH9 A;  2DK5 A;  2STW A;  1W4M A;  2A5Y B;  3RPQ A;  5HVQ C;  2IT0 A;  2P7C B;  2GQQ A;  3HYI A;  2JZY A;  3RTR A;  1FP2 A;  3C1D A;  1K79 A;  3E6D A;  4XLP F;  2NAZ A;  1S7O A;  3EQL F;  1KYZ A;  1WRJ A;  1SD6 A;  2M30 A;  1G4D A;  3ECH A;  5KK1 A;  1D5V A;  4OU0 A;  1P4A A;  1U6G A;  4ON0 A;  4L9J A;  3RJP A;  1IXR C;  3KP3 A;  1LQ1 A;  4HF2 A;  5AIP A;  4M73 A;  2PBI A;  1CGP A;  1XGM A;  3WTY C;  1CF7 A;  3DXJ F;  1J59 A;  3DPT A;  4KT5 C;  1FBU A;  2NNN A;  2XAS A;  1F4K A;  4KIG A;  1IXS B;  2E7W A;  1QBJ A;  4OMY A;  3KP4 A;  3NEU A;  1D8J A;  2PLY A;  1G3W A;  3O6B B;  3F21 A;  2OA4 A;  2EFO A;  3RYR A;  1H9T A;  3ZMV A;  3BJA A;  2OD5 A;  1OYY A;  5LGN A;  3BRO A;  1HW5 A;  4Q5S F;  3RIR A;  5L3D A;  3ROU A;  5DUI A;  5HOO A;  1W5T A;  2Y75 A;  4UVA A;  1W7P A;  2VC1 A;  4PGG A;  2X4H A;  5K5R A;  1R1V A;  3JW4 A;  2H6B A;  4P55 A;  2EB7 A;  2ZXJ A;  2HR3 A;  4OIR F;  4H0E A;  3CJN A;  1MDM A;  3RI4 A;  4I09 A;  2XVC A;  1Z6T A;  3JAM Z;  1IF1 A;  1W5S A;  2GA1 A;  2UZK A;  3KCC A;  1TTY A;  2K02 A;  1WI9 A;  2DAO A;  4IRI A;  4LG0 A;  2JPC A;  2XAJ A;  5HLG A;  1STZ A;  4S05 A;  4WCG A;  3T5X A;  2QEN A;  3GUD A;  4HF1 A;  2A6E F;  5HS9 A;  3T8T A;  1HW2 A;  1WKM A;  1I5Z A;  3IKV A;  4TV7 A;  3FXQ A;  3WE2 A;  2Z5U A;  5DYM A;  2HKX A;  2VN2 A;  4A5N A;  3LA7 A;  2G7H A;  3RPU A;  3F6O A;  5E1W A;  3H92 A;  2OZ6 A;  1OPC A;  1U78 A;  5L3C A;  2WV0 A;  4YFK F;  5D5V B;  2FRH A;  1KU7 A;  4XSX F;  1DPR A;  1IN6 A;  1ON1 A;  5CYV A;  2FML A;  3WTT C;  4ENK A;  3IRQ A;  1Q1H A;  3TGN A;  2Q2E A;  3KZY A;  5ILU A;  5FO5 A;  3TDU C;  2XRO A;  2EA4 A;  4WXC A;  2DLL A;  1RI7 A;  4L0Y B;  1TQM A;  2GIV A;  2FOK A;  3I64 A;  1DPU A;  3E6M A;  5FGM A;  4U88 A;  2FSW A;  1P4X A;  3BJO A;  1KGS A;  3HRS A;  3SHF A;  4HYE A;  5FD6 A;  2ACJ A;  3ZP5 A;  2Y0M A;  1BI3 A;  4IHT A;  2LKP A;  4PGH A;  4UVC A;  4EV0 A;  5BOX A;  2D2W A;  5IT3 A;  2ISZ A;  1TQI A;  2BYV E;  4LLN A;  5J6X A;  1NHA A;  1C0W A;  3RDI A;  3HRM A;  4L5J A;  3LST A;  4ZZD A;  3HOS A;  1DDN A;  1F5T A;  4UXN A;  3WTX C;  1BBY A;  4MQV A;  1O7L A;  2RC4 A;  4JBA A;  4U7B A;  1REP C;  2CO5 A;  2W84 A;  1P92 A;  4L9T A;  2R7F A;  3W6K B;  3G3Z A;  5DD4 A;  3K69 A;  3P9C A;  5ED4 A;  1J75 A;  2JRT A;  1WSU A;  1HQC A;  2ESH A;  2YR2 A;  2A69 F;  2PN6 A;  3V8L A;  2GXB A;  2DTR A;  2H09 A;  4LLL A;  4HQE A;  1SD7 A;  2RVC A;  3KFW X;  2E1C A;  4U0Y A;  2EWN A;  4DQ2 A;  2V1U A;  4RB3 C;  4OIO F;  3R6S A;  3U9G A;  4HV6 A;  4BXU A;  3E5X A;  5JFR A;  2YX7 A;  3HSE A;  1FZP B;  1T6S A;  5FFZ A;  1D8K A;  4UVB A;  2K4J A;  3F8M A;  2DQL A;  1EV7 A;  4G6Q A;  1XCB A;  3HRU A;  4Q4Z F;  2WC2 A;  4EQQ A;  3FXU A;  2EFP A;  2TDX A;  4MTE A;  1FT9 A;  3VB2 A;  1MGT A;  1K6O A;  4U7D A;  2IW5 A;  3FXR A;  2QM3 A;  3WTV C;  3VOE A;  1S3J A;  4KUM A;  4BNC A;  1QNT A;  3IL2 A;  2CFX A;  3I59 A;  1JHF A;  3CUQ B;  5L3E A;  2NNY A;  2BGC A;  2M45 A;  4DNC A;  3JAM K;  2CWE A;  2XHK A;  4QWQ A;  5FLX Z;  1EH6 A;  1ZRD A;  2F5F A;  2GXG A;  5D8L B;  1E2X A;  2DPU A;  4LMY A;  2XUB A;  2W24 A;  1LJ9 A;  2HTS A;  2FA5 A;  4LJZ F;  1RZ4 A;  5HDG A;  1U8R A;  3EET A;  3L00 A;  5CVI A;  2K7L A;  3V7R A;  3DF8 A;  1SAX A;  2HYG D;  1S8N A;  4BHC A;  4EJU A;  1ZAO A;  4BHB A;  2P7V B;  3Q9S A;  5AIQ A;  3M8E A;  4B8X A;  3Q9V A;  1D3Y A;  1TW3 A;  3TO9 A;  4EVI A;  3SQN A;  3E6C C;  2HZT A;  1P6R A;  2AS5 F;  3L9F A;  1XSX A;  2QQB A;  3HTS B;  4Z2Y A;  1LVA A;  3RYP A;  3QP6 A;  2MLK A;  1I6X A;  5LLQ A;  1J0R A;  3HHH A;  4OIP F;  3GEZ A;  5D8K B;  3FMS A;  4U0V A;  4G7H F;  3ZMS A;  2VBY A;  3KEO A;  4M9Z A;  4AIJ A;  1Z6R A;  2XKP A;  4KIC A;  2VE9 A;  3LFK A;  1KU9 A;  2R7D A;  4FX4 A;  3MEX A;  5AON A;  1SMT A;  3TOA A;  1ZRF A;  1BI1 A;  3FMR A;  2P5L C;  1MD0 A;  1K78 A;  3GVA A;  4HLX A;  4P96 A;  3C3W A;  3K1N A;  3J7A O;  3WTW C;  3BWG A;  1YW9 A;  2MH2 A;  2G7U A;  2B0L A;  2J5P A;  5D5W B;  3W6J B;  4O6J A;  2OZU A;  4LGW A;  1XGO A;  2Z9O A;  2MA3 A;  4JQF A;  1B9M A;  4RGR A;  1LDK B;  2P8T A;  2MLG A;  1PP7 U;  1F9N A;  3ZMZ A;  5KVR A;  4IXA A;  3J81 Z;  1IN8 A;  1G3S A;  4M71 A;  1J9I A;  3KLO A;  1HKT A;  3ZMT A;  1R7J A;  4RGS A;  3WGI A;  2PQ8 A;  3MFK A;  2IJL A;  4GGG A;  2IA0 A;  3M9A A;  2OBP A;  4IF4 A;  5LHH A;  2M1B A;  2VC0 A;  5LEK A;  2QBY A;  3ZN0 A;  2YX4 A;  1BI0 A;  4LB5 A;  3DEU A;  3FX3 A;  3J80 Z;  4A0X A;  1O7F A;  2ETH A;  4Y13 A;  3ZPL A;  1XMA A;  1UFM A;  2HGC A;  2M87 A;  2EJR A;  1FP1 D;  4R79 A;  2HOE A;  2XAF A;  1K78 B;  4CIC A;  2XRN A;  4WXH A;  2DPD A;  4HDU A;  3IWF A;  1ZGA A;  5H20 A;  5FLX K;  3KP5 A;  3FWE A;  1BC7 C;  4MTD A;  1YW7 A;  4BHP A;  2P6T A;  2F5E A;  3G73 A;  3BPX A;  1XB4 A;  1V4R A;  2XAG A;  1J2X A;  3F8F A;  3R4K A;  2O6G E;  2EV6 A;  3ELK A;  4PDK A;  1IN4 A;  2H94 A;  3GX4 X;  2E7X A;  4L0Z B;  4OIN F;  2KIF A;  4KDP A;  5EEG A;  2L54 A;  5F6F A;  5CVV A;  5JVT A;  4HX4 A;  3F23 A;  2C6Y A;  1L3L A;  3KP7 A;  5ILS A;  3EDP A;  4B09 A;  1Y0U A;  5HLI A;  1XDU A;  2LDU A;  4FX0 A;  4G94 A;  2GAU A;  3R60 A;  4ZYD A;  3GFI A;  2BV6 A;  1YO5 C;  3QPT A;  2EK5 A;  1HKS A;  1RNL A;  1O57 A;  2FBI A;  3MWM A;  3LA2 A;  3WTZ A;  2M5W A;  1DP7 P;  5ERI A; 
#chains in the Genus database with same CATH topology
 3ZQC A;  5FKN A;  4AID A;  3BG7 A;  2LTP A;  2VKD A;  5HLT A;  3OYN A;  2F5C A;  1DGW Y;  1T33 A;  2HYF A;  1WZ2 A;  5F08 A;  2GOX B;  5HLH A;  3M4O J;  1XSD A;  2H8W A;  3QP5 A;  4GXO A;  3M8F A;  4NNJ A;  1ZG5 A;  1JE8 A;  1K6Y A;  2IA1 A;  2PEX A;  3I71 A;  3O8H A;  2Z3Y A;  1OCZ H;  1W5C C;  1SFU A;  1IXC A;  3SEQ A;  3CMA I;  3K4J A;  1MH3 A;  4MQ9 F;  2HKO A;  2WAQ A;  1ACI A;  1CF7 B;  4NB5 A;  2R4G A;  4RB0 A;  1GVD A;  3LSI A;  2GIZ A;  2XIG A;  3GTG J;  4ENM A;  2P4W A;  1ETV A;  3HB9 A;  5F0F A;  4IRG A;  4M3D A;  4IVN A;  1UCR A;  2D1H A;  2HWV A;  2K3P A;  2A05 A;  4I02 A;  2XGE A;  2D1V A;  4LB6 B;  3VYT B;  3IWZ A;  4C2M J;  2NRA C;  4BY7 J;  1R5H A;  3EUK L;  1U3E M;  2FU4 A;  5DCM A;  2VBW A;  2HDC A;  2GA2 A;  2BY0 A;  3GLX A;  1YW8 A;  2K86 A;  2ZNZ A;  5J1U A;  2JT1 A;  2CW8 A;  4EM0 B;  4ZH4 F;  5BMZ A;  4AIK A;  2ZSI B;  1BW6 A;  4E7H A;  1QGP A;  2DMT A;  3KEY A;  3OYJ A;  3T8R A;  4N4N B;  3LWF A;  2YS9 A;  2DDA A;  4I76 A;  3F22 A;  3Q0U A;  4ZZL A;  2HVS A;  2IGK A;  3J81 K;  1MZB A;  3UNG C;  2M0C A;  1F1Z A;  3HOZ J;  1OMI A;  3A1Y A;  2JUG A;  1YFH A;  2JA8 J;  4RLF A;  2CMP A;  1LDJ A;  3LQQ A;  2ELH A;  1T2K A;  1X1C A;  1K7A A;  4JOM A;  4BDZ A;  3V8K A;  2KHM A;  4KNY A;  5ILV A;  4XM3 A;  5D5U B;  1VI0 A;  4JP0 A;  3D5S C;  3U1K A;  4XRF A;  1JHH A;  2VXZ A;  5BQT A;  3P7N A;  1W7P B;  4HST A;  1A35 A;  4I01 A;  2FNP A;  4B4C A;  1ERD A;  2V9V A;  3EYY A;  2LRE A;  1Y8Q B;  2FQ4 A;  3CP2 A;  2K4B A;  4UUS A;  3PQK A;  1PUF B;  1ZR2 A;  1TNS A;  4LLG F;  1G3Y A;  4B3A A;  3IP4 B;  3PFI A;  3GYH X;  4A5M A;  1YX3 A;  3J80 K;  1MDM B;  1FBQ A;  3REO A;  2P0W A;  5CVU A;  5IOZ A;  1LEB A;  1WWX A;  1Z7U A;  3S2H J;  2MD5 A;  4E7S A;  1VQ4 I;  1HKQ A;  4D0P A;  3H9J A;  2KJC A;  3CMY A;  4DGW B;  3L09 A;  4B43 A;  4NQW A;  1YJN I;  3E3V A;  4LK1 F;  2NVT J;  4ZYG A;  3ZQQ A;  5D5X B;  1O3Q A;  1UHM A;  1ZLK A;  4LG0 B;  2DI3 A;  5F1R A;  1ZGJ A;  3KET A;  1XMX A;  3FXO A;  5LBQ A;  1W0U A;  1ULY A;  1F36 A;  1JGS A;  3I58 A;  3G4S I;  2X6W A;  3WGG A;  2OUM A;  2GXA A;  2L9S A;  1VQK I;  1I6H J;  4ZTF A;  2KP6 A;  4E4H A;  1ZHF A;  1GVJ A;  1QPM A;  4UV8 A;  5GAH J;  3BY6 A;  3OOP A;  4RAG A;  5DCM B;  3H5R A;  2X0L A;  2V6E A;  1N78 A;  2K85 A;  3GTQ J;  2HOT A;  2WTE A;  3H3Z A;  5J3L A;  1OR7 C;  3MAJ A;  2A5W A;  1OYI A;  5B1B H;  1D0X A;  2XSJ C;  1OR7 A;  1T38 A;  1UST A;  1BIA A;  3M7G A;  1FTT A;  2CQN A;  2FXA A;  3WG9 A;  1YYV A;  2AXT C;  1KYW A;  3RZO J;  3SDB A;  1BN5 A;  2GZW A;  3HKZ N;  4N0B A;  3OYH A;  1IRZ A;  2HOA A;  2MD0 A;  4ETS A;  2O3F A;  2MAB A;  1FOW A;  4Y52 J;  2D45 A;  1LFB A;  2Q2E B;  3DU5 A;  3ECO A;  3I4M J;  1B4A A;  5CVJ A;  1IGN A;  1LE8 B;  2M7A A;  2HFH A;  2QCO A;  1ZG3 A;  4CCO A;  1QVT A;  2R5Y A;  2MH9 A;  2V79 A;  3LAP A;  2VUM J;  1MMN A;  1KA8 A;  1ZR4 A;  2E19 A;  2PI0 A;  2HQR A;  1IO2 A;  2EZK A;  1ZRC A;  1SD5 A;  2F5D A;  4PCQ A;  3HGG A;  3C7J A;  2G0E A;  3QPL A;  4KA4 A;  1BW5 A;  1T0F A;  2EA2 A;  3OWT A;  1B72 A;  2RNJ A;  3KEQ A;  1YIO A;  2QWW A;  4XQF A;  1NH3 A;  4C30 A;  4CO8 A;  1A5J A;  4HQM A;  3OY9 A;  3DLL F;  5JLX A;  4G8X A;  1VTN C;  2V1D A;  1ETX A;  1NK2 P;  1QO0 D;  5EEA A;  2PMH A;  2DYS H;  3OR2 C;  2RV8 A;  1RC9 A;  5LEJ A;  4A3L J;  4CXF A;  5EZH A;  4ESB A;  3CLO A;  5EG0 A;  3S1N J;  4EJT A;  2EFQ A;  4I98 B;  3IAM 2;  1ZAR A;  4AIH A;  4NC8 A;  3CUO A;  2DQR A;  4A0Y A;  4I0B A;  3S3N A;  3AG4 H;  2RGV A;  2WAF A;  3MD2 A;  3WOD F;  3ZMU A;  4P9U A;  2V6C A;  2P81 A;  2M7B A;  2IP2 A;  3ABT A;  4Q48 A;  1JKR C;  4P5O A;  3OV8 A;  2LY1 A;  3TMO A;  1U5T C;  3EUA A;  1OCO H;  3FM3 A;  2ZBK A;  2CG4 A;  3CCU I;  3QRF F;  2CGP A;  1CQT A;  3S1R J;  1U5T A;  4EM2 A;  2EV5 A;  3CMM A;  3QPH A;  4HW0 A;  4G6D A;  5K7H A;  1Q1V A;  1KQ9 A;  2DMQ A;  3KLN A;  3QAH A;  2IA2 A;  4NUB A;  5CLS A;  4AU7 A;  2XGD A;  1A6Q A;  2V1N A;  2DJN A;  4G7O F;  4PJL A;  1ETY A;  2DW4 A;  4IHY A;  4XLN F;  3JRC A;  2NVX J;  3R0J A;  4N9I A;  3QU6 A;  3X2Q H;  4EGY A;  1XSV A;  1P7I A;  5E3O A;  1VQ8 I;  4KIS A;  4IEJ A;  2JTV A;  1T08 B;  1BR1 A;  2DK8 A;  2RKH A;  1U2W A;  1FWZ A;  3IH2 A;  3DKW A;  3ZCO A;  3JRD A;  1KU2 A;  1WHU A;  4DBQ A;  2IXS A;  1WI3 A;  1HXD A;  1MND A;  2MSY A;  2Q0O A;  3V7C A;  5K5O A;  1B59 A;  2CUZ A;  1TNT A;  4F93 B;  1VQP I;  4EJV A;  3F72 A;  4F91 B;  1MBG A;  1GUU A;  4RDU A;  1QPI A;  3GFL A;  1EA3 A;  4BAY A;  4KIF A;  4F52 A;  3K70 C;  1R4M B;  1ZRE A;  1G6N A;  2KMU A;  2A3S A;  3CDH A;  4M3B A;  3COA C;  2E1M C;  2EIN H;  3MCZ A;  4IQJ A;  3E5Q A;  1UHW A;  2WA0 A;  3E6B A;  3VEP A;  2QSF X;  2Z2S B;  2E2H J;  4GRI A;  1X1D A;  3BZ6 A;  1KQ8 A;  3M1E A;  4CYC A;  1B8I B;  2HEO A;  3HOY J;  5IYD J;  1ETW A;  3OIO A;  2L4M A;  4BJ5 C;  2OQG A;  3F0C A;  4FET A;  2XSD C;  1D1A A;  5D4S A;  3F8C A;  2Z1D A;  2BXY A;  1USS A;  2L02 A;  3R61 A;  4HF0 A;  5B66 C;  5L3G A;  4QSH A;  2QQA A;  1PDN C;  1E17 A;  4HNV A;  4JK1 X;  2NS0 A;  5BPI A;  1FMW A;  5EG0 B;  2G9W A;  1IC8 A;  2X85 A;  3F8N A;  3W2V A;  5E3M A;  4WWC A;  1FBS A;  2O9L A;  4HDV A;  2LF7 A;  4I7H A;  4GYI A;  4Z6Y A;  3IRR A;  1WH5 A;  2NOJ B;  2OC6 A;  4LFU A;  1ZH5 A;  1S9H A;  4UHT A;  1FOK A;  3NQO A;  5FKM A;  1JGG A;  1GXP A;  1IW7 F;  4XNF A;  2K27 A;  4FTH A;  3MZ8 A;  2R7V A;  3CF2 A;  2I5U A;  2YU3 A;  4AUX A;  3I59 B;  4R1H A;  1BR4 A;  3WU0 A;  3FK6 A;  2UXN A;  3TOB A;  4IHS A;  2E35 A;  2DBB A;  2A07 F;  3ASO H;  4HEA 2;  3CCJ I;  3DBH B;  2IGM A;  3SFZ A;  3JRG A;  5GPC A;  3DQV C;  3G1L A;  2MBF A;  1IZ1 A;  2Z99 A;  3C18 A;  2PJR A;  4BY1 J;  1V55 H;  5GAG J;  2JN6 A;  1JJ6 C;  5CKT A;  4MEY F;  2HDD A;  3GZ6 A;  4IJA A;  3EUH C;  3CC4 I;  4CGZ A;  5DM6 F;  4BQA A;  3DFG A;  3EUH A;  4A2U A;  4L18 B;  2E1N A;  4YFN F;  3LMM A;  1IN7 A;  5CJ9 A;  4IHX A;  3HEF A;  4CZZ A;  2RQP A;  2FBH A;  4HNT A;  4G6T B;  2LNB A;  3HTU A;  2CQK A;  2VBZ A;  2X1E A;  1RR8 C;  1DGR M;  2OF7 A;  2VBX A;  2XPW A;  5H6Q A;  1B1B A;  1LDD A;  3JSP A;  3LSP A;  5E8G A;  3HRT A;  4R8H A;  2UXX A;  3BG9 A;  5FRM A;  3SJM A;  5FKO A;  2WBM A;  1YOV B;  2L7F P;  5LHI A;  1MBH A;  4KYW A;  3LSM A;  4XKC A;  3OIP A;  2VPR A;  3AG3 H;  1WH7 A;  1QVU A;  1MJA A;  3NWS A;  4CA0 A;  5ICE A;  1K4S A;  4HAM A;  4ZC3 A;  2FEZ A;  3GO5 A;  2HOS A;  4XBF A;  3E7L A;  1W36 D;  1OCC H;  2X48 A;  1XC5 A;  2AQE A;  3K4M A;  2EV0 A;  4NC7 A;  4XSZ F;  4GDF A;  3DPL C;  3G71 I;  4HX7 A;  1RR7 A;  4A6D A;  2KIU A;  4A6E A;  2ECB A;  4N9H A;  3ISP A;  4II2 A;  2KT0 A;  5D6E A;  2O0Y A;  3WU1 B;  2HTJ A;  4J00 A;  2BHZ A;  1DQU A;  3OOU A;  2DFH A;  2NXN B;  1BJA A;  1BOA A;  6PAX A;  5DDG A;  2KKO A;  1IAW A;  4P1W A;  3F6V A;  1P9Q C;  2ZME A;  5B1A H;  1X3U A;  3FXM A;  2HPI A;  2QLZ A;  4GCV A;  5BPD A;  4E7J A;  3GBG A;  1Z91 A;  4ENJ A;  1FEX A;  5E18 F;  4HG2 A;  1V3F A;  2LF8 A;  3PL8 A;  4Y7N J;  2X51 A;  4NC6 A;  2W57 A;  5DCF A;  3TED A;  1PP8 F;  1YRN A;  4MNU A;  4OIQ F;  4RGX A;  1FY7 A;  2JRM A;  4J19 A;  4D9J A;  4DJA A;  2KIM A;  3E1S A;  1BIB A;  3OSF A;  2CFO A;  2CJJ A;  4RGU A;  3BR5 A;  5E3L A;  3D0S A;  4OAY A;  5IYB J;  2FF4 A;  2PJR B;  4LD5 A;  5LGT A;  2QVO A;  5GPA A;  1ZN2 A;  2O8K A;  2VT3 A;  4F7Z A;  2VT2 A;  4X6A J;  5DD8 A;  1VFC A;  5ICG A;  2EQR A;  5K5Q A;  5BNG A;  3ZMD A;  4KN4 X;  3AL0 B;  3TQN A;  1BI2 A;  3K2A A;  3O8G A;  1P4W A;  3MVP A;  1P7J A;  2QUF A;  3KE2 A;  5D6F A;  2ZSH B;  4XID A;  2QGU A;  2W25 A;  3HOU J;  4WXD A;  3MMY B;  4RAZ A;  4A3C J;  4PZJ A;  1OJL A;  2VON A;  1FYL A;  2E34 A;  3LQR A;  1S6L A;  2CV2 A;  2HU9 A;  4C3J J;  5ICC A;  3EYI A;  1SMY F;  1YJ9 I;  1J5Y A;  2OU2 A;  1XD7 A;  1WVR A;  4EGZ A;  2DT5 A;  1WQ2 A;  2Y48 A;  3K4B A;  2L01 A;  5ICF A;  1B9N A;  2HQ5 A;  2IGN A;  2DMN A;  1A36 A;  3ZOB A;  1KZH A;  3S2W A;  1S7A A;  3K0L A;  3V8J A;  4YRV A;  1WJ5 A;  2N8G A;  2IVM A;  4B1R A;  2COM A;  3VSK A;  3P9K A;  1G8X A;  2ZFW A;  4CUG A;  3F8B A;  4YG2 F;  3TBI A;  2CW0 F;  1Z1D A;  4EMS A;  1LPQ A;  2PJP A;  1LUJ B;  1D0Y A;  4BJT A;  1SFE A;  4WX9 A;  5FRO A;  5J4V A;  1E3P A;  2IS1 A;  1P2F A;  4JX6 A;  5K1Y A;  2MGQ A;  4Y4R A;  1RUN A;  4B44 A;  2FE3 A;  2ZME B;  4WK8 F;  1FSH A;  1QZY A;  3DV8 A;  1IN5 A;  5HS7 A;  4HX8 A;  2CRG A;  3JR9 A;  3HPH A;  2E1O A;  1PYV A;  2M8E A;  2FX0 A;  3K2Z A;  2DT7 B;  1RIO H;  3SXY A;  2M8G X;  3PJR A;  4ZYE A;  2DA3 A;  2FMY A;  3ERM A;  4KIB A;  1J7K A;  1LNW A;  3FZV A;  3AAF A;  3HOT A;  1YRN B;  4RMN A;  2EZL A;  2X1D A;  2VPL A;  1MJ9 A;  4MIM A;  3WG7 H;  2HXO A;  2LK2 A;  1R1U A;  3VYS B;  2V4J C;  4BDY A;  4A3G J;  4PJM A;  1UG2 A;  2LG4 A;  5LRR A;  2DFI A;  1A31 A;  2W4S A;  3K7A J;  2HNH A;  2QBY B;  1RKT A;  3OYI A;  1WCM J;  4UV9 A;  3HC7 A;  4DZP A;  5HDK A;  1ON2 A;  1WJD A;  5GAD J;  4A3E J;  1R1T A;  1U9N A;  5LHG A;  4ENN A;  2HYJ A;  3RZD J;  2IS2 A;  4BU2 A;  2LVS A;  4O5V A;  5C4J J;  4XRS G;  1OCP A;  4CSW A;  2GBY A;  1XDS A;  3KP2 A;  4M6Y A;  2ZO4 A;  5DUK A;  5J8C A;  5CVR A;  2TCT A;  1FX7 A;  2ID3 A;  1EJ9 A;  2DOD A;  2NVY J;  2PMU A;  3BOQ A;  4IKF A;  1QU3 A;  4X1E A;  1X4P A;  2BE5 F;  3H3U A;  2LFB A;  3GFJ A;  5CQE A;  2JA5 J;  3V7S A;  3WTS C;  2DMP A;  4QLC U;  4M72 A;  1Z67 A;  2R5Z A;  5A2Q Z;  1U9O A;  2MC4 A;  3I0T A;  1HC8 A;  3HUG A;  3HXL A;  4KMU X;  4IPA A;  4YFX F;  3CCE I;  3UKG A;  2K9M A;  1Z77 A;  2ZJQ F;  1Z7L A;  3BP8 A;  3A01 B;  1O3R A;  4M3F A;  2ELK A;  4NHJ A;  3DWL E;  5DEQ A;  1T39 A;  1Z0X A;  2XAH A;  4XRS A;  4I99 C;  1BOB A;  2LMD A;  3BJ6 A;  3W3C A;  2XV4 S;  2L4A A;  3FIS A;  1FOX A;  1BM9 A;  4I0A A;  4FCY A;  1FMV A;  2CYY A;  2ZXI A;  3MZY A;  2STT A;  1X1A A;  3RKX A;  1DUX C;  3S3M A;  3T1B A;  1X4O A;  3WE3 A;  3CCY A;  1TLH B;  3NRV A;  3CCM I;  2A61 A;  4FIS A;  2XF6 A;  1VQ9 I;  2LR8 A;  4BYY A;  2WY7 Q;  1UJ8 A;  4AD9 A;  1S72 I;  1NG6 A;  2JWT A;  3W2A A;  4RB2 C;  3O2P E;  2BW3 A;  5J40 A;  4RM2 A;  2JK3 A;  4LOC A;  1RUO A;  4E7I A;  4BE2 A;  3CC7 I;  5B3S H;  2BVL A;  3P9I A;  1XS9 A;  3HIF A;  3TP0 A;  5E8I A;  4BEH A;  4IZZ A;  1O3T A;  3DP7 A;  1QHG A;  4A12 A;  1NG7 A;  2R3S A;  5F64 A;  1R9T J;  2HS5 A;  2LD5 A;  4M9X A;  3T0Y A;  3C2G A;  1ZKG A;  3J7A Y;  3GFM A;  5FRN A;  5IT9 K;  4P9F A;  3PNT A;  2LSO A;  3KYD B;  4O3M A;  4C3H J;  3I56 I;  1FC3 A;  5GAE J;  4H4K C;  1Z05 A;  4ZYH A;  3TP3 A;  3HOX J;  1OFC X;  4XKB A;  4FE4 A;  4A3K J;  4GO1 A;  3G6E I;  2VQH A;  5F04 A;  3GW2 A;  4AYB N;  2KPM A;  1MMD A;  4IQ4 A;  3DPU A;  1N25 A;  4QPQ A;  4PSW A;  2B7E A;  3NAU A;  1QRY A;  2ESN A;  4S04 A;  1R36 A;  1AKH B;  1E3O C;  2VOO A;  1XX5 A;  2V7F A;  2VJ5 A;  3K1P A;  1I50 J;  2WY8 Q;  3BQY A;  4G9Y A;  2ZCW A;  4U0W A;  1PUE E;  3RSN A;  1IRF A;  3OYE A;  1Y6I A;  3GWZ A;  1K61 A;  1R5G A;  3U2R A;  2IS4 A;  2A68 F;  5EEH A;  3TKY A;  5J1Y A;  3IHU A;  4PJJ A;  1ZK8 A;  5HS8 A;  2VQC A;  2LH9 A;  2XC7 A;  5J8F A;  4OWR B;  1BA5 A;  3N05 A;  5KAI C;  2XF7 A;  3FM5 A;  1TZL A;  2FQ3 A;  2L5Q A;  1TT0 A;  2L3D A;  1ETK A;  3FXJ A;  1GXQ A;  2QQ9 A;  2QZ8 A;  1X2M A;  1LB2 A;  1X19 A;  4AC0 A;  1TBX A;  4KIT B;  3S93 A;  1U0J A;  4BQN A;  4L9N A;  2HQN A;  2PFB A;  3V4G A;  1HSJ A;  3PQJ A;  1TQP A;  2O8X A;  1H0M A;  4M6X A;  3BTL A;  3F9K A;  3A0B C;  5E79 C;  3SYT A;  3KZZ A;  1W7P D;  5FKK A;  5IP7 J;  5E17 F;  1F43 A;  4L9V A;  3GF2 A;  4PJN A;  1ONV A;  1R58 A;  5TJJ A;  4M9S A;  4IX7 A;  3Q5F A;  2Y9Y A;  4J01 A;  3OYB A;  2J5O A;  4E70 A;  1FYM A;  4FQG A;  4I6Z A;  2GLO A;  3SFI A;  4UB6 C;  1MBJ A;  4D1Q A;  5HDN A;  1O4X A;  3CJR B;  1Y0N A;  4ZJZ A;  3S14 J;  2DU9 A;  4A0Z A;  3VOD A;  1WJC A;  2CUF A;  4ANJ A;  2H6C A;  4XK4 A;  3JRE A;  4XKW A;  3AG2 H;  1NK3 P;  4BEH B;  2WV1 A;  4XL9 A;  2OTL I;  1ZG1 A;  3U1D A;  5C44 J;  3B6C A;  4EM1 A;  3MKL A;  4Y15 A;  4D7N A;  3IH4 A;  2CQQ A;  2BBY A;  3E97 A;  4HV5 A;  4G7Z F;  2P5K A;  3CJQ B;  4C2T A;  4DZJ A;  5E1Z B;  3CO6 C;  4B48 A;  4D5F A;  3TO7 A;  4AVZ A;  1HST A;  2M2E A;  2PX9 A;  2P6S A;  2NYX A;  2JVG A;  5FD5 A;  2VOD A;  2O5R A;  4GFB A;  3CUQ C;  2F2E A;  2DDB A;  3BTJ A;  5KHD A;  2COB A;  3ZRG A;  3CUQ A;  2DTZ A;  3KYL A;  2LYC A;  2LLK A;  3LFU A;  5TRD A;  4CYD A;  1RES A;  5DV5 A;  2XGC A;  1JUP A;  3D5L A;  4MGR A;  1GHC A;  1FNN A;  5IYC J;  1QQI A;  3ML6 A;  2Z33 A;  3CJT B;  3ULQ B;  1L0O C;  3JRB A;  2KLO A;  4M6V A;  3ABL H;  2FNA A;  4RS8 A;  4XON A;  3RPU D;  3M1C A;  4PFO A;  1S7E A;  3HJE A;  3I9V 2;  2ZJ2 A;  1JT0 A;  3JSO A;  1X1B A;  1YQA A;  2DT6 A;  3CCS I;  4RAY A;  4W1U A;  2ZKZ A;  5EGO A;  1R23 A;  1XG1 A;  1Y56 A;  5FFX A;  2Q8K A;  4UUS B;  1D0Z A;  5E20 A;  4E7L A;  3CLQ A;  4HBL A;  2WWY A;  2VJ4 A;  4KN7 X;  3QOP A;  2X1C A;  3FMQ A;  2PG4 A;  2WB1 N;  2DA5 A;  4CCM A;  1GDT A;  1S29 A;  3HDD A;  3MKW B;  1TWG J;  2I8D A;  2L9N A;  2EFW A;  4RB1 A;  2VXD A;  2KZV A;  3L2V A;  4CDG A;  2LBF A;  2H27 A;  4NQW B;  2JVH A;  3DTE A;  1ENH A;  1RRJ A;  2UV1 A;  3OR1 C;  3H9Q A;  3LSG A;  3CO7 C;  5A2Q K;  3BT9 A;  3QYE A;  5E1X A;  2ISY A;  4HZF A;  1DU0 A;  3RKY A;  2YPR A;  3PM1 A;  3HHG A;  3IUO A;  4ZDO A;  2NVU B;  3HSF A;  3DTK A;  1ZYR F;  4Y17 A;  1IUY A;  1FIP A;  1N77 A;  4B47 A;  3GZ5 A;  2KDZ A;  1AOY A;  4A3I J;  2XB0 X;  3CP8 A;  3SEZ A;  2VQL A;  3BPV A;  1SEU A;  1JXS A;  4AYB A;  3HBL A;  2F4O B;  4BBR J;  4M74 A;  3ERE D;  4BJ6 C;  4WF2 A;  4D7M A;  2CU7 A;  2RDP A;  3ZQ7 A;  2DA7 A;  3VSL A;  4LK0 F;  2BEO A;  2ME0 A;  3M8J A;  5L3F A;  3FXL A;  2R7S A;  4CHU A;  1IRG A;  1XGN A;  2UWM A;  2KRF A;  3MZH A;  4PUS A;  3IKT A;  3ABU A;  2QA4 I;  5F1J A;  3J7Z I;  4EJW A;  4L5I A;  3I4P A;  2M4G A;  2PMZ N;  3SZT A;  2FBK A;  3H1C A;  4A93 J;  3B73 A;  2L7K A;  2FD5 A;  3QYF A;  5JHU A;  1H9G A;  1T98 A;  5EYR A;  4DYC A;  4KFC A;  2CH0 A;  2CSO A;  3H5N A;  3MN2 A;  4D5C A;  2ADU A;  2CS3 A;  3FF5 A;  4K2E A;  3LA3 A;  4HRI A;  4PJ0 C;  1YHQ I;  1HW1 A;  1SFX A;  2R5Y B;  1TW2 A;  3VFZ A;  5D4R A;  4W97 A;  5LGU A;  5F0H A;  3I54 A;  2CW7 A;  2DOE A;  2Y31 A;  5EGO B;  2D5V A;  2H1K A;  2DA2 A;  4YII A;  3B02 A;  3IC7 A;  1W36 C;  3S2D J;  5JI6 A;  3O3K A;  2A6H F;  2EH3 A;  5DTD A;  4XN3 A;  3TO6 A;  1KU3 A;  5LRS A;  2CQ7 A;  3GCM A;  1B72 B;  1Z9C A;  4Q47 A;  2M3A A;  1XCV A;  2OCC H;  4KMF A;  4C3I J;  4AVP A;  3G1M A;  2LRD A;  4ZDL A;  2LC2 A;  2DN0 A;  1FIA A;  3D1N I;  2YSR A;  3BTI A;  3GTL J;  2E60 A;  4HLY A;  2R7Z J;  3BDD A;  3BG3 A;  2OV7 A;  3K4K A;  3GTM J;  3K9T A;  1KQ0 A;  4ESF A;  3OYK A;  2K40 A;  1MSF C;  1XGS A;  3LOC A;  5JR3 A;  2JPB A;  1MBF A;  1Z3Y A;  4I2O A;  2DO7 A;  4RA2 A;  1OYW A;  2XKO A;  1SD4 A;  3GXO A;  2RN7 A;  3CTA A;  2FJ1 A;  3R0A A;  2OQR A;  4MLO A;  3LAJ A;  2MFZ A;  2IBD A;  5KNL A;  1ODD A;  2BVM A;  5TIS C;  2ZC2 A;  2F5V A;  1QZZ A;  1U5T B;  1UHS A;  3GLL A;  1ITY A;  3QU3 A;  3ABM H;  2LY2 A;  5H6R A;  3F3X A;  4ABZ A;  2DA1 A;  3MQ0 A;  4FT8 A;  3WGH A;  4EJO A;  1DP3 A;  2VE8 A;  4MHG A;  1VQ7 I;  1YS6 A;  3HKZ A;  1HDP A;  2JSC A;  3QOE A;  2XAQ A;  2EFN A;  3TDZ C;  3CCR I;  1FYK A;  2IPQ X;  4AM3 A;  2MC3 A;  2V1X A;  1JUM A;  2W85 A;  2E2I J;  4CCK A;  1MJB A;  2O03 A;  2RRE A;  3Q3S A;  1YS7 A;  4YIF A;  3JTG A;  1YE9 A;  1EH8 A;  3K1M A;  1G3T A;  1SAU A;  2P5V A;  1M1E B;  2XGX A;  1R00 A;  5EDN A;  3RKW A;  4MEX F;  1BJZ A;  2H8R A;  2VOP A;  5L3B A;  2VI6 A;  3ZN1 A;  2R7R A;  1MNE A;  3QYB A;  3IV5 A;  3I4N J;  2EZH A;  1AWC A;  4BL0 B;  3FHZ A;  4ESJ A;  4ITV A;  1IJW C;  3BR2 A;  3FKI J;  3I5U A;  2DA6 A;  4FE7 A;  1UB9 A;  4OAZ A;  5IT9 Z;  2DFF A;  2E1M B;  1HBX G;  3N4M A;  5JLW A;  4CYC B;  2E5Z A;  4YEJ A;  2XDV A;  1MMS A;  4GYG A;  2CQX A;  1APL C;  4FHT A;  1WJB A;  3HSR A;  3KP6 A;  2O61 A;  1JUS A;  4JX4 A;  3FBI B;  4UNO A;  1FPQ A;  1VQ5 I;  4CCL A;  3K4L A;  3N97 A;  5IP9 J;  4IHW A;  3SZP A;  1LEA A;  2K9L A;  1V5F A;  1I1S A;  4OMZ A;  2GWR A;  2LKS A;  4HPQ A;  4B3X A;  2L9R A;  3FKJ A;  3AG1 H;  3JTH A;  5IY5 H;  1BC8 C;  1QZE A;  1EF4 A;  1I1G A;  1LVK A;  1XMK A;  2YUS A;  1B6A A;  4NDL A;  3WTU C;  1YTY A;  1X3Z B;  3LSH A;  4HOB A;  5HNF A;  1TC3 C;  3L7W A;  1JKO C;  5FB2 A;  1Y1V J;  5FKL A;  4OOI A;  4IRH A;  1WJF A;  1SVO A;  2OAZ A;  3BZC A;  4Y33 A;  1HCR A;  1FSE A;  3BQZ A;  2ZNY A;  1R5I D;  3PNY A;  5M5Y J;  1R22 A;  1XN7 A;  4HSR A;  1WJA A;  2PMZ A;  1IUF A;  3IAS 2;  1FOY A;  3H36 A;  4UUV A;  3I53 A;  2BY2 A;  3VPR A;  1WGX A;  3OSG A;  4QPO A;  1I27 A;  1EH7 A;  3CDI A;  3BR0 A;  1UZC A;  1V5G A;  5IPA A;  1ZEL A;  2ELJ A;  1YLF A;  2KJB A;  3KYC B;  2AXL A;  3HZJ A;  3QWL A;  1MNM C;  1A04 A;  1FLI A;  2IRF G;  4ASN A;  1JKQ C;  5BS6 A;  1ZLJ A;  1OKR A;  3U21 A;  5J47 A;  3L2C A;  2VKE A;  2W48 A;  2KZG A;  2GOM A;  3RQ4 A;  2ZJR F;  2QYO A;  1YG2 A;  3BG5 A;  3BR6 A;  4HA8 A;  1O3S A;  4BQQ A;  3TW7 A;  1MKM A;  4AWX B;  2HVR A;  2JSP A;  3E5U A;  4BH9 A;  3DLA A;  2DK5 A;  4F3Q A;  2STW A;  1W4M A;  2A5Y B;  3CZ6 A;  5J4Y A;  4UB8 C;  3RPQ A;  5HVQ C;  2IT0 A;  2P7C B;  2GQQ A;  3HYI A;  4PSX A;  2IS6 A;  2AO9 A;  2JZY A;  5CQG A;  3CCL I;  3RTR A;  2X6O A;  1FP2 A;  2L0K A;  3C1D A;  1ETO A;  1K79 A;  2K9N A;  5KAF C;  3E6D A;  4XLP F;  1IV6 A;  2W1O A;  2NAZ A;  1S7O A;  5EZG A;  3EQL F;  1KYZ A;  1WRJ A;  1SD6 A;  1TT5 B;  1Y8R B;  2M30 A;  1LFP A;  3RQI A;  1G4D A;  3VYU B;  3ECH A;  5KK1 A;  3ZQG A;  1D5V A;  2HI3 A;  4OU0 A;  4BGD A;  1P4A A;  1U6G A;  2K3F A;  2ZXH A;  4ON0 A;  4L9J A;  4A3B J;  5TGT A;  3RJP A;  5JHF A;  1IXR C;  1I3Q J;  3KP3 A;  4U87 A;  1LQ1 A;  4HF2 A;  1IG7 A;  3KX2 A;  5J1R A;  5AIP A;  4M73 A;  2PBI A;  1CGP A;  1XGM A;  2K9S A;  4RM3 A;  3WTY C;  4RBO A;  3Q0V A;  1CF7 A;  3DXJ F;  3HOW J;  3WHC A;  1J59 A;  3DPT A;  2M34 A;  3JCU C;  2FOW A;  4KT5 C;  1FBU A;  4UY8 I;  2NNN A;  2E36 A;  1AHD P;  2XAS A;  1F4K A;  4KIG A;  1JT6 A;  2EZI A;  1IXS B;  2RAE A;  2E7W A;  1QBJ A;  3LSR A;  3ZQL A;  2JJ7 A;  3K6G A;  1EKE A;  4OMY A;  3FK7 A;  3PSI A;  2DOA A;  3KP4 A;  3DU6 A;  3NEU A;  1D8J A;  2Z16 A;  3DEE A;  2KFD A;  2PLY A;  1G3W A;  3O6B B;  3DCF A;  3F21 A;  1YIJ I;  1Y1W J;  2M9H A;  2OA4 A;  2EPF A;  5GTH C;  2EFO A;  3RYR A;  4E6K G;  1H9T A;  3ZMV A;  1RKW A;  3BJA A;  2OD5 A;  1OYY A;  2LOO A;  5LGN A;  3PFY A;  3BRO A;  2M0M A;  3M3Y J;  1HW5 A;  2MW8 A;  4Q5S F;  3S1Q J;  2KIQ A;  3RIR A;  5L3D A;  3ZXS A;  3ROU A;  5DUI A;  5HOO A;  1W5T A;  2Y75 A;  1MMA A;  3WU2 C;  4UVA A;  1W7P A;  2VC1 A;  2Y0S N;  1POG A;  4PGG A;  1OQY A;  2X4H A;  5K5R A;  1R1V A;  3JW4 A;  1OCR H;  2BZT A;  2H6B A;  2L2O A;  4P55 A;  2CV0 A;  2EB7 A;  1BL0 A;  2ZXJ A;  3DBR B;  1TWH J;  2HR3 A;  1WJE A;  4JX5 A;  1PUF A;  4M3G A;  3W2W A;  1OLT A;  4BQO A;  2R0Q C;  4OIR F;  4H0E A;  3CJN A;  2QQ8 A;  1MDM A;  3RI4 A;  4I09 A;  1TP4 A;  3PUF A;  4YIR X;  2XVC A;  1Z6T A;  3JAM Z;  1IF1 A;  4E7Z A;  5M5X J;  1W5S A;  2GA1 A;  3OIQ A;  3ZQH A;  2UZK A;  3KCC A;  3S1M J;  3DEW A;  1TTY A;  4X0G A;  3OS0 A;  3HPG A;  2K02 A;  1WI9 A;  2DAO A;  4IRI A;  4LG0 A;  5M5W J;  2JPC A;  3L2W A;  3P5J A;  4L5E A;  2XAJ A;  2BOL A;  1QHH D;  1X3W B;  2W00 A;  3SDG A;  5HLG A;  1STZ A;  4S05 A;  4WCG A;  3T5X A;  2QEN A;  2R7O A;  3GUD A;  4F92 B;  4HF1 A;  1A6I A;  2A6E F;  1JTX A;  5HS9 A;  3T8T A;  1RET A;  3CC2 I;  3D5R C;  1K4T A;  1TWC J;  2XAU A;  1HW2 A;  1WKM A;  4FAS D;  1I5Z A;  3IKV A;  4PK4 A;  4TV7 A;  2I10 A;  3FXQ A;  3OYM A;  3WE2 A;  2EIL H;  2Z5U A;  1SFK A;  3CCQ I;  2K9Q A;  5DYM A;  2HKX A;  2VN2 A;  4A5N A;  1V54 H;  3LA7 A;  4LIV A;  2G7H A;  3RPU A;  4HNU A;  2DFE A;  3F6O A;  2CV1 A;  3J7Y J;  2NOG A;  2R5Z B;  5E1W A;  4DW6 A;  1G59 A;  3H92 A;  3ASN H;  3BLY A;  2OZ6 A;  1OPC A;  3HUG B;  5M3M J;  1U78 A;  2KRC A;  5L3C A;  2WV0 A;  2OTJ I;  3HM5 A;  3L1P A;  4YFK F;  2AQF A;  2FRH A;  5D5V B;  1KU7 A;  3LSJ A;  4XSX F;  1DPR A;  2QSG X;  1IN6 A;  4QTR A;  1ON1 A;  5HNH A;  3LNQ A;  2BXZ A;  1T8I A;  5CYV A;  2IGO A;  2FML A;  3WTT C;  3L2R A;  4ENK A;  3IRQ A;  1Q1H A;  2V9K A;  3TGN A;  2Q2E A;  3KZY A;  1LE8 A;  3B6A A;  1MSE C;  1ZQ3 P;  2E5N A;  5ILU A;  1IDZ A;  5FO5 A;  3TDU C;  2XRO A;  2EA4 A;  4WXC A;  4CCN A;  3RKQ A;  1W1W E;  2DLL A;  1RI7 A;  4L0Y B;  2XB5 A;  1VZ0 A;  3KZI C;  1TQM A;  1JKP C;  3S8P A;  2GIV A;  3I55 I;  2FOK A;  3H35 A;  3I64 A;  2O7O A;  3V42 A;  1FJL A;  1DPU A;  2F4M B;  1ORK A;  3E6M A;  5FGM A;  2RNG A;  4UUT A;  4U88 A;  2DJI A;  4DIQ A;  1AA7 A;  3DBL B;  1P4X A;  2BW3 B;  2FSW A;  3BJO A;  5E3N A;  1X1P A;  1DU6 A;  1KGS A;  3HRS A;  3UR3 C;  3SHF A;  1H8A C;  1XTA A;  1Y39 A;  2BY1 A;  4HYE A;  4V2G A;  3CD6 I;  5FD6 A;  3BG6 A;  2ACJ A;  1Z21 A;  3ZP5 A;  3PNV A;  2ID6 A;  4DBR A;  2Y0M A;  3DKX A;  2AHQ A;  3FIW A;  4ZYA A;  1BI3 A;  4N4O B;  2NVQ J;  4JYK A;  4IHT A;  2ICW G;  2R7X A;  1LKX A;  2LKP A;  4PGH A;  4UVC A;  4EV0 A;  5BOX A;  2ZJP F;  2D2W A;  5IT3 A;  2ISZ A;  1TQI A;  2BYV E;  4BBS J;  3NAR A;  4LLN A;  3A0H C;  5J6X A;  3PIO F;  3MKY B;  1NHA A;  3CME I;  1C0W A;  3RDI A;  3K4N A;  3HRM A;  4BS9 A;  4L5J A;  2KDO A;  3LST A;  4ZZD A;  3CQZ J;  3HOS A;  3ZQF A;  1DDN A;  3C2B A;  4UXN A;  1F5T A;  1SAN A;  3WTX C;  1BBY A;  4MQV A;  1O7L A;  4XKV A;  3L2Q A;  3OYG A;  2MG4 A;  2RC4 A;  4JBA A;  4U7B A;  3FHN A;  1REP C;  2CO5 A;  2W84 A;  1P92 A;  3OYD A;  1I3A A;  3IH3 A;  4L9T A;  2R7F A;  2K5C A;  3K10 A;  3W6K B;  2EIJ H;  3PSF A;  2JA7 J;  2V26 A;  3G3Z A;  5DD4 A;  1GV5 A;  2B63 J;  4QIW N;  3K69 A;  2RQQ A;  3P9C A;  1UEL B;  3HGY A;  5ED4 A;  4A69 C;  2HQA A;  3BR1 A;  1J75 A;  2JRT A;  1WSU A;  1HQC A;  3GTP J;  3GME A;  2ESH A;  2YR2 A;  2L7Z A;  1MBK A;  2A69 F;  2PN6 A;  3V8L A;  2GXB A;  2Y0S A;  2DTR A;  3GZN B;  2H09 A;  4LLL A;  4HQE A;  2ZFU A;  1SD7 A;  2RVC A;  3KFW X;  2E1C A;  2NS7 A;  4U0Y A;  2EBI A;  2EWN A;  4DQ2 A;  1VQL I;  3KIO A;  2OCE A;  2R7Q A;  3K4C A;  2V1U A;  4RB3 C;  4OIO F;  3R6S A;  3PO2 J;  3U9G A;  2TRT A;  4HV6 A;  4BXU A;  1MBE A;  3E5X A;  1VQN I;  5JFR A;  4KT6 A;  2JUC A;  4A3D J;  2YX7 A;  2HPM A;  1T0F C;  5B5E C;  3HSE A;  1FZP B;  1T6S A;  5FFZ A;  1D8K A;  4UVB A;  3RCO A;  2W7N A;  2K4J A;  3F8M A;  3ZQI A;  2DQL A;  1EV7 A;  1B8I A;  4G6Q A;  1XCB A;  3SZG A;  2WAE A;  3HRU A;  4Q4Z F;  2WAD A;  3OYL A;  2WC2 A;  4EQQ A;  4V19 K;  3FXU A;  2EFP A;  5IOY A;  1V5E A;  2TDX A;  5K7Z A;  1SC7 A;  4IHV A;  4MTE A;  3NWT A;  4G12 A;  2QKL B;  2R7U A;  1FT9 A;  3VB2 A;  1MGT A;  1YI2 I;  1K6O A;  4RLQ A;  4U7D A;  5KCM A;  2IW5 A;  3FXR A;  2QM3 A;  1AU7 A;  1MH4 A;  2Y69 H;  5FJ8 J;  2R7T A;  1D5Y A;  3WTV C;  2XF5 A;  3VOE A;  1S3J A;  4KUM A;  4BNC A;  1T95 A;  1QNT A;  3IL2 A;  2JMW A;  1W0T A;  9ANT A;  2CFX A;  3I59 A;  3JRA A;  1JHF A;  4A3F J;  3CUQ B;  1MW7 A;  5L3E A;  2NNY A;  3ZGK A;  4XOT A;  2BGC A;  2BHY A;  1WFX A;  5DS9 A;  2M45 A;  4DNC A;  4BXF A;  2CWE A;  3JAM K;  2XHK A;  4QWQ A;  1PVE A;  5FLX Z;  4CCJ A;  4A3J J;  2V9P A;  4S0H B;  1EH6 A;  1ZRD A;  2F5F A;  4IO9 F;  2GXG A;  5D8L B;  1JTY A;  1E2X A;  2DPU A;  1LFU P;  4LMY A;  2XUB A;  2W24 A;  1LJ9 A;  3H5A A;  3JRI A;  1HF0 A;  5FLM J;  2JA2 A;  4IOA F;  5C4X J;  3JRH A;  1HDD C;  2HTS A;  2FA5 A;  4LJZ F;  1RZ4 A;  3VWB A;  1D1B A;  1UG0 A;  1VQO I;  5HDG A;  1U8R A;  2L7M P;  3EET A;  1J09 A;  3L00 A;  4XOR A;  5LFA A;  3KPH A;  2JQ7 A;  5CVI A;  3ESW B;  2E71 A;  4CZC A;  4YEL A;  2K7L A;  2LBF B;  1GT0 C;  4XLE A;  3V7R A;  3FXK A;  3CF5 F;  3DF8 A;  4ZTJ A;  1KON A;  1TL8 A;  1SAX A;  4LG3 A;  4V2F A;  2HYG D;  1X2N A;  5K7F A;  1S8N A;  1U8B A;  4BHC A;  4EJU A;  1ZAO A;  4NBQ A;  4BHB A;  2P7V B;  4DOZ A;  5GP9 A;  2CUJ A;  3Q9S A;  3S17 J;  5AIQ A;  3HOV J;  1HA8 A;  3M8E A;  4B8X A;  1VF9 A;  3Q9V A;  2VJJ A;  1D3Y A;  1TW3 A;  3BZK A;  3TO9 A;  4EVI A;  4BKX A;  3SQN A;  1SVL A;  3E6C C;  2HZT A;  1MMG A;  4XOP A;  3H0D A;  1P6R A;  2AS5 F;  3L9F A;  3FDY A;  4LIU A;  1XSX A;  3CCV I;  3BCB A;  2QQB A;  4KJZ A;  3HTS B;  1Z3X A;  2Y30 A;  4Z2Y A;  5GTI C;  1VND A;  3OMY A;  1ETQ A;  1LVA A;  3TL4 X;  3RYP A;  3QP6 A;  1R49 A;  2MLK A;  1I6X A;  2R93 J;  5LLQ A;  1J0R A;  3HHH A;  4OIP F;  5FLV A;  2XPU A;  3GEZ A;  3OYC A;  5D8K B;  3FMS A;  4U0V A;  4G7H F;  3ZMS A;  2KIS A;  4XMY A;  1JJ8 C;  4BE1 A;  2VBY A;  3KEO A;  2DYR H;  5LD2 C;  1HLV A;  3BR3 A;  1OIS A;  4M9Z A;  3QPS A;  2VB6 A;  3AKZ A;  4AIJ A;  3AL0 C;  1Z6R A;  3BC8 A;  2IAI A;  4MO7 A;  1GLN A;  3GTK J;  4E7K A;  2XKP A;  4KIC A;  2VE9 A;  2MYS A;  3LFK A;  3ONQ A;  1KU9 A;  2A6T A;  2R7D A;  2WB1 A;  4FX4 A;  3MEX A;  5AON A;  1SMT A;  3TOA A;  1ZRF A;  1BI1 A;  3FMR A;  1S5L C;  1I39 A;  2Q1Z B;  5CPR B;  2P5L C;  2F4I A;  1MD0 A;  1K78 A;  3GVA A;  4HLX A;  4P96 A;  3QQA A;  3C3W A;  3G1O A;  4XN0 A;  1D1C A;  3K1N A;  3PUB A;  3J7A O;  2XRL A;  5JVG F;  3PO3 J;  3WTW C;  2UUZ A;  2H1L A;  2HVQ A;  4DYR A;  3DKY A;  1IRX A;  3BWG A;  3M07 A;  1YW9 A;  1H89 C;  2MH2 A;  3WHB A;  2L9V A;  3K70 D;  2G7U A;  2B0L A;  2J5P A;  5D5W B;  3W6J B;  2W82 A;  4O6J A;  3HL2 A;  1YIT I;  5HOD A;  2OZU A;  1SVM A;  4LGW A;  1XGO A;  3HG9 A;  2Z9O A;  2MA3 A;  2X6Y A;  4JQF A;  1B9M A;  2KRH A;  2LP0 A;  2X9D A;  4RGR A;  1LDK B;  1T56 A;  2P8T A;  2MLG A;  1PP7 U;  4ZDP A;  1F9N A;  3S32 A;  3ZMZ A;  5EF6 A;  5KVR A;  3OS2 A;  1YJW I;  2QEX I;  4IXA A;  2XPV A;  1E0E A;  2ZME C;  3J81 Z;  1IN8 A;  4XLH A;  1XPX A;  1G3S A;  2B9S A;  2VL8 A;  3OS1 A;  4M71 A;  2F6C A;  3L2U A;  2R92 J;  2IEK A;  1N75 A;  1J9I A;  1YX5 A;  2BY3 A;  3DTI A;  2WAQ N;  1TWA J;  3KLO A;  3S16 J;  2Y9Z A;  1HKT A;  3C2H A;  3ZMT A;  1R7J A;  4RGS A;  3WGI A;  3A02 A;  2PQ8 A;  3MFK A;  2IJL A;  3MKZ A;  4GGG A;  2VKH A;  2IA0 A;  3M9A A;  4CH7 A;  4C2U A;  2GM4 A;  2OBP A;  4IF4 A;  5LHH A;  2M1B A;  4EEF G;  2VC0 A;  3LSK A;  5LEK A;  1WPK A;  3A4C A;  1FTZ A;  2QBY A;  3OL3 A;  2YU9 J;  3ZN0 A;  2YX4 A;  4XR6 A;  1BI0 A;  3I3L A;  1IV8 A;  3DEU A;  4LIT A;  4LB5 A;  2VQG A;  3FX3 A;  3J80 Z;  2CUE A;  4A0X A;  1O7F A;  2ETH A;  4Y13 A;  4XRM A;  1XMA A;  4IOC F;  3ZPL A;  1UFM A;  2HGC A;  3GTJ J;  3AFH A;  3EPZ A;  4XLC A;  4BUP A;  2M87 A;  3TW6 A;  2LY9 A;  2EJR A;  4BE0 A;  1TWF J;  2QSH X;  3CES A;  3PIP F;  1FP1 D;  4R79 A;  2HOE A;  2XAF A;  3VYR B;  2DMU A;  1K78 B;  1PJR A;  4CIC A;  3G2B A;  2XRN A;  4WXH A;  1BR2 A;  3H3V K;  2DPD A;  2DOF A;  2ME6 A;  4HDU A;  5DM7 F;  3W6V A;  3IWF A;  1ZGA A;  4M3E A;  4EAT A;  3LL7 A;  3A01 A;  4BAC A;  2ECC A;  5H20 A;  5FLX K;  3KP5 A;  2VAS A;  4IL6 C;  3FWE A;  2KQR A;  2LKX A;  1BC7 C;  2VLA A;  4MTD A;  1YW7 A;  2HZD A;  5IP6 A;  2NS8 A;  4BHP A;  4BXX J;  1R71 A;  2P6T A;  3A03 A;  1SFO J;  3OYF A;  2E2J J;  1K83 J;  2F5E A;  2OPT A;  2Y2Z A;  5F0C A;  3G73 A;  3BPX A;  3FBN B;  1NTC A;  4A3M J;  1XB4 A;  1V4R A;  1R4N B;  2FUG 2;  2XAG A;  1J2X A;  3F8F A;  2OJE D;  3R4K A;  2O6G E;  3H0G J;  4PFP A;  3BTC A;  5M3F J;  4XLA A;  2QKM B;  1ZGW A;  4DYQ A;  2EV6 A;  3ELK A;  4PDK A;  3CDL A;  3OYA A;  3OL4 A;  2ZXW H;  1IN4 A;  4MFD A;  1HOM A;  3H9G A;  2H94 A;  3GX4 X;  2HXI A;  2E7X A;  2QF7 A;  4L0Z B;  3ABK H;  4OIN F;  1OCT C;  2KIF A;  3QOD A;  2JA6 J;  4KDP A;  4Y3O A;  5EEG A;  1VQM I;  5C3E J;  2L54 A;  5F6F A;  3Q0W A;  2VIX A;  1G2H A;  5CVV A;  4XIC A;  5JVT A;  1ZTR A;  2KL4 A;  4HX4 A;  1UMQ A;  2X6X A;  3F23 A;  4F55 A;  2C6Y A;  1L3L A;  3KP7 A;  5ILS A;  3EDP A;  3VDX A;  4B09 A;  2EIM H;  1VQ6 I;  1Y0U A;  5HLI A;  2DXI A;  1XDU A;  2VKV A;  2LDU A;  2ZB9 A;  3JRF A;  2EIK H;  4FX0 A;  4G94 A;  3S3O A;  4C9Y A;  1IDY A;  5EJC A;  1H88 C;  1AKH A;  2GAU A;  3A2K A;  2DCE A;  3R60 A;  4II3 A;  1GV2 A;  2M4K A;  1QA6 A;  1UAA A;  4ZYD A;  2F48 A;  3GFI A;  3ZR8 X;  3GTO J;  2BV6 A;  1YO5 C;  3QPT A;  2EK5 A;  1HKS A;  1RNL A;  2VJI A;  1O57 A;  2FBI A;  1R6R A;  2HDW A;  3BCA A;  4XLF A;  3MWM A;  3LA2 A;  4RAF A;  1JI8 A;  3E0J B;  4MFE A;  2R7W A;  1MIJ A;  2DA4 A;  3WTZ A;  3S15 J;  2M5W A;  1X58 A;  5ERI A;  1RPW A;  5F27 A;  1E3H A;  1DP7 P;  5H2F C; 
#chains in the Genus database with same CATH homology
 2F5C A;  2HYF A;  5HLH A;  1XSD A;  4GXO A;  3QP5 A;  3M8F A;  1ZG5 A;  1JE8 A;  2PEX A;  2IA1 A;  3I71 A;  2Z3Y A;  1SFU A;  1IXC A;  4MQ9 F;  2HKO A;  1CF7 B;  4NB5 A;  4RB0 A;  2XIG A;  4ENM A;  2P4W A;  4IRG A;  4IVN A;  1UCR A;  2D1H A;  2HWV A;  4I02 A;  2D1V A;  4LB6 B;  3IWZ A;  2NRA C;  1R5H A;  1U3E M;  2FU4 A;  5DCM A;  2VBW A;  2HDC A;  2GA2 A;  3GLX A;  1YW8 A;  2K86 A;  2ZNZ A;  2JT1 A;  4EM0 B;  4ZH4 F;  5BMZ A;  4AIK A;  1QGP A;  3T8R A;  3LWF A;  3F22 A;  4ZZL A;  3J81 K;  1MZB A;  1F1Z A;  1OMI A;  1YFH A;  1LDJ A;  3LQQ A;  2ELH A;  1T2K A;  1K7A A;  3V8K A;  4KNY A;  5ILV A;  5D5U B;  4XRF A;  1JHH A;  2VXZ A;  5BQT A;  3P7N A;  1W7P B;  4I01 A;  2FNP A;  2V9V A;  3EYY A;  2K4B A;  3PQK A;  1TNS A;  4LLG F;  1G3Y A;  3PFI A;  3GYH X;  4A5M A;  3J80 K;  1MDM B;  1FBQ A;  3REO A;  5CVU A;  1LEB A;  1WWX A;  1Z7U A;  2MD5 A;  1HKQ A;  4D0P A;  2KJC A;  3L09 A;  4NQW A;  3E3V A;  4LK1 F;  4ZYG A;  5D5X B;  1O3Q A;  1UHM A;  1ZLK A;  4LG0 B;  2DI3 A;  5F1R A;  1ZGJ A;  3KET A;  5LBQ A;  1ULY A;  3I58 A;  1JGS A;  3WGG A;  4UV8 A;  1ZHF A;  1GVJ A;  1QPM A;  3BY6 A;  3OOP A;  5DCM B;  2X0L A;  2WTE A;  3H3Z A;  3MAJ A;  1OYI A;  1OR7 A;  1T38 A;  1UST A;  1BIA A;  3M7G A;  2FXA A;  3WG9 A;  1YYV A;  1KYW A;  1BN5 A;  2GZW A;  4N0B A;  4ETS A;  2O3F A;  2D45 A;  3ECO A;  1B4A A;  5CVJ A;  2HFH A;  1ZG3 A;  2MH9 A;  2V79 A;  3LAP A;  1KA8 A;  2PI0 A;  2HQR A;  1ZRC A;  1SD5 A;  2F5D A;  4PCQ A;  3C7J A;  4KA4 A;  1T0F A;  2EA2 A;  2RNJ A;  3KEQ A;  1YIO A;  2QWW A;  4CO8 A;  4HQM A;  4G8X A;  1VTN C;  2V1D A;  1QO0 D;  2PMH A;  2RV8 A;  5LEJ A;  4CXF A;  4ESB A;  3CLO A;  4EJT A;  2EFQ A;  4I98 B;  1ZAR A;  4AIH A;  3CUO A;  2DQR A;  4A0Y A;  4I0B A;  2RGV A;  3WOD F;  3ZMU A;  4P9U A;  2V6C A;  4Q48 A;  2IP2 A;  3ABT A;  4P5O A;  3OV8 A;  1U5T C;  3FM3 A;  2ZBK A;  2CG4 A;  3QRF F;  2CGP A;  1U5T A;  4EM2 A;  2EV5 A;  3QPH A;  4HW0 A;  4G6D A;  1KQ9 A;  3KLN A;  3QAH A;  2IA2 A;  5CLS A;  4G7O F;  2DW4 A;  4XLN F;  3R0J A;  4N9I A;  3QU6 A;  4EGY A;  1XSV A;  2JTV A;  2DK8 A;  2RKH A;  1U2W A;  1FWZ A;  3DKW A;  1KU2 A;  1HXD A;  2Q0O A;  3V7C A;  5K5O A;  1B59 A;  1TNT A;  4EJV A;  3F72 A;  3GFL A;  4BAY A;  4KIF A;  1ZRE A;  1G6N A;  2A3S A;  3CDH A;  3COA C;  3MCZ A;  3E5Q A;  1UHW A;  3VEP A;  3E6B A;  3BZ6 A;  1KQ8 A;  3M1E A;  2HEO A;  2L4M A;  2OQG A;  5D4S A;  3F8C A;  1USS A;  2L02 A;  3R61 A;  4HF0 A;  5L3G A;  1E17 A;  2QQA A;  1PDN C;  4JK1 X;  2NS0 A;  5BPI A;  2G9W A;  3F8N A;  4WWC A;  1FBS A;  4HDV A;  2LF7 A;  4I7H A;  4GYI A;  3IRR A;  4LFU A;  1ZH5 A;  4UHT A;  1FOK A;  3NQO A;  1GXP A;  1IW7 F;  2K27 A;  2YU3 A;  3I59 B;  4R1H A;  3WU0 A;  2UXN A;  3TOB A;  4IHS A;  2A07 F;  2DBB A;  3SFZ A;  3DQV C;  2MBF A;  1IZ1 A;  2Z99 A;  3C18 A;  4MEY F;  3GZ6 A;  4IJA A;  4CGZ A;  4BQA A;  3DFG A;  3EUH A;  4A2U A;  4L18 B;  2E1N A;  4YFN F;  1IN7 A;  5CJ9 A;  4CZZ A;  2RQP A;  2FBH A;  2LNB A;  3HTU A;  2CQK A;  2VBZ A;  2VBX A;  5H6Q A;  1B1B A;  1LDD A;  3JSP A;  5E8G A;  3HRT A;  4R8H A;  2UXX A;  5LHI A;  4KYW A;  5ICE A;  1MJA A;  4HAM A;  2FEZ A;  3GO5 A;  4XBF A;  4XSZ F;  2EV0 A;  3DPL C;  4HX7 A;  4A6D A;  2KIU A;  4A6E A;  4N9H A;  3ISP A;  5D6E A;  2O0Y A;  3WU1 B;  2HTJ A;  1BJA A;  1BOA A;  6PAX A;  5DDG A;  2KKO A;  1IAW A;  3F6V A;  2ZME A;  1X3U A;  2QLZ A;  4GCV A;  5BPD A;  1Z91 A;  4ENJ A;  5E18 F;  1V3F A;  2LF8 A;  2W57 A;  5DCF A;  1PP8 F;  4MNU A;  4OIQ F;  4RGX A;  1FY7 A;  2KIM A;  1BIB A;  4RGU A;  3D0S A;  2FF4 A;  4LD5 A;  5LGT A;  2QVO A;  1ZN2 A;  2VT3 A;  4F7Z A;  2VT2 A;  5DD8 A;  5ICG A;  5K5Q A;  3ZMD A;  4KN4 X;  3TQN A;  1BI2 A;  1P4W A;  2QUF A;  3KE2 A;  5D6F A;  2W25 A;  4WXD A;  4RAZ A;  4PZJ A;  2VON A;  1FYL A;  3LQR A;  1S6L A;  5ICC A;  3EYI A;  1SMY F;  1J5Y A;  2OU2 A;  1XD7 A;  4EGZ A;  2DT5 A;  1WQ2 A;  2Y48 A;  2L01 A;  5ICF A;  1B9N A;  3S2W A;  1S7A A;  3K0L A;  3V8J A;  2IVM A;  2COM A;  3P9K A;  4YG2 F;  2ZFW A;  3F8B A;  2CW0 F;  1Z1D A;  4EMS A;  2PJP A;  1SFE A;  4WX9 A;  1P2F A;  5K1Y A;  1RUN A;  2FE3 A;  2ZME B;  4WK8 F;  1FSH A;  1QZY A;  3DV8 A;  1IN5 A;  5HS7 A;  4HX8 A;  2M8E A;  3K2Z A;  1RIO H;  3SXY A;  4ZYE A;  2FMY A;  4KIB A;  1J7K A;  1LNW A;  3FZV A;  3AAF A;  3HOT A;  1MJ9 A;  1R1U A;  5LRR A;  2DFI A;  2QBY B;  4UV9 A;  5HDK A;  1ON2 A;  1R1T A;  5LHG A;  4ENN A;  4O5V A;  1XDS A;  3KP2 A;  4M6Y A;  2ZO4 A;  5DUK A;  5J8C A;  5CVR A;  1FX7 A;  2PMU A;  3BOQ A;  2BE5 F;  3H3U A;  3GFJ A;  3V7S A;  3WTS C;  4QLC U;  4M72 A;  5A2Q Z;  3I0T A;  3HUG A;  4KMU X;  4IPA A;  4YFX F;  3BP8 A;  1O3R A;  4NHJ A;  5DEQ A;  1T39 A;  2XAH A;  3BJ6 A;  2XV4 S;  2L4A A;  1BM9 A;  4I0A A;  2CYY A;  3MZY A;  2STT A;  3RKX A;  1DUX C;  3T1B A;  3WE3 A;  1TLH B;  3NRV A;  2A61 A;  4BYY A;  4AD9 A;  4RB2 C;  3O2P E;  1RUO A;  3P9I A;  3HIF A;  5E8I A;  1O3T A;  3DP7 A;  4A12 A;  2R3S A;  5F64 A;  2HS5 A;  4M9X A;  3T0Y A;  3GFM A;  5IT9 K;  4P9F A;  2LSO A;  4O3M A;  1FC3 A;  1Z05 A;  4ZYH A;  4GO1 A;  3GW2 A;  2ESN A;  4S04 A;  1R36 A;  2VOO A;  3K1P A;  4G9Y A;  2ZCW A;  4U0W A;  1PUE E;  1IRF A;  3GWZ A;  1R5G A;  3U2R A;  2A68 F;  5EEH A;  3TKY A;  3IHU A;  5HS8 A;  5J8F A;  3FM5 A;  2FQ3 A;  2L3D A;  1GXQ A;  2QQ9 A;  2QZ8 A;  1LB2 A;  1TBX A;  4L9N A;  2HQN A;  2PFB A;  3V4G A;  1HSJ A;  3PQJ A;  1TQP A;  2O8X A;  1H0M A;  4M6X A;  3KZZ A;  1W7P D;  5E17 F;  4L9V A;  3GF2 A;  1ONV A;  1R58 A;  5TJJ A;  4M9S A;  3Q5F A;  2J5O A;  4E70 A;  1FYM A;  5HDN A;  2DU9 A;  4A0Z A;  3VOD A;  2H6C A;  1ZG1 A;  3U1D A;  4EM1 A;  4Y15 A;  2BBY A;  3E97 A;  4HV5 A;  4G7Z F;  2P5K A;  5E1Z B;  3CO6 C;  3TO7 A;  1HST A;  2P6S A;  2NYX A;  5FD5 A;  2VOD A;  3CUQ C;  2F2E A;  3CUQ A;  5TRD A;  4CYD A;  5DV5 A;  3D5L A;  4MGR A;  1GHC A;  1FNN A;  1QQI A;  3ML6 A;  2Z33 A;  3ULQ B;  1L0O C;  2FNA A;  4RS8 A;  2ZJ2 A;  3JSO A;  1YQA A;  4RAY A;  2ZKZ A;  1R23 A;  5FFX A;  2Q8K A;  5E20 A;  4HBL A;  2WWY A;  4KN7 X;  3QOP A;  3FMQ A;  2PG4 A;  1S29 A;  2EFW A;  4RB1 A;  4CDG A;  2H27 A;  3CO7 C;  5A2Q K;  5E1X A;  2ISY A;  4HZF A;  3RKY A;  2YPR A;  3HHG A;  3HSF A;  1ZYR F;  4Y17 A;  1IUY A;  3GZ5 A;  1AOY A;  3BPV A;  1JXS A;  4M74 A;  3ERE D;  4WF2 A;  2RDP A;  3ZQ7 A;  4LK0 F;  2BEO A;  5L3F A;  4CHU A;  1IRG A;  1XGN A;  2UWM A;  2KRF A;  3MZH A;  3IKT A;  3ABU A;  4EJW A;  4L5I A;  3I4P A;  3SZT A;  2FBK A;  3B73 A;  5JHU A;  1H9G A;  1T98 A;  4KFC A;  2CSO A;  2ADU A;  3FF5 A;  4K2E A;  3LA3 A;  1HW1 A;  1SFX A;  1TW2 A;  3VFZ A;  5D4R A;  5LGU A;  3I54 A;  4YII A;  3B02 A;  3IC7 A;  5JI6 A;  3O3K A;  2A6H F;  3TO6 A;  1KU3 A;  5LRS A;  1Z9C A;  4Q47 A;  1XCV A;  4KMF A;  4AVP A;  2YSR A;  4HLY A;  3BDD A;  3K9T A;  1KQ0 A;  4ESF A;  1XGS A;  5JR3 A;  2JPB A;  4I2O A;  2DO7 A;  1OYW A;  2XKO A;  1SD4 A;  3GXO A;  2RN7 A;  3CTA A;  3R0A A;  2OQR A;  3LAJ A;  1ODD A;  1QZZ A;  1U5T B;  3QU3 A;  5H6R A;  3F3X A;  3MQ0 A;  4FT8 A;  3WGH A;  4EJO A;  2VE8 A;  4MHG A;  1YS6 A;  2JSC A;  2XAQ A;  2EFN A;  3TDZ C;  1FYK A;  2IPQ X;  2MC3 A;  2V1X A;  2W85 A;  1MJB A;  2O03 A;  1YS7 A;  4YIF A;  3JTG A;  1EH8 A;  3K1M A;  1G3T A;  2P5V A;  2XGX A;  1R00 A;  4MEX F;  3RKW A;  2VOP A;  5L3B A;  3ZN1 A;  1AWC A;  3FHZ A;  4ESJ A;  3I5U A;  1UB9 A;  5IT9 Z;  1HBX G;  3N4M A;  4GYG A;  4FHT A;  3HSR A;  3KP6 A;  2O61 A;  4UNO A;  1FPQ A;  3N97 A;  3SZP A;  1LEA A;  1I1S A;  4OMZ A;  2GWR A;  3JTH A;  1BC8 C;  1I1G A;  1XMK A;  1B6A A;  3WTU C;  1YTY A;  4HOB A;  3L7W A;  5FB2 A;  4OOI A;  4IRH A;  2OAZ A;  1FSE A;  2ZNY A;  1R22 A;  1XN7 A;  4UUV A;  3I53 A;  1I27 A;  1EH7 A;  1YLF A;  2KJB A;  2AXL A;  1A04 A;  1FLI A;  2IRF G;  4ASN A;  5BS6 A;  1ZLJ A;  1OKR A;  3L2C A;  2QYO A;  1YG2 A;  4HA8 A;  1O3S A;  1MKM A;  4AWX B;  3E5U A;  4BH9 A;  2DK5 A;  2STW A;  1W4M A;  2A5Y B;  3RPQ A;  5HVQ C;  2IT0 A;  2P7C B;  2GQQ A;  3HYI A;  2JZY A;  3RTR A;  1FP2 A;  3C1D A;  1K79 A;  3E6D A;  4XLP F;  2NAZ A;  1S7O A;  3EQL F;  1KYZ A;  1WRJ A;  1SD6 A;  2M30 A;  1G4D A;  3ECH A;  5KK1 A;  1D5V A;  4OU0 A;  1P4A A;  1U6G A;  4ON0 A;  4L9J A;  3RJP A;  1IXR C;  3KP3 A;  1LQ1 A;  4HF2 A;  5AIP A;  4M73 A;  2PBI A;  1CGP A;  1XGM A;  3WTY C;  1CF7 A;  3DXJ F;  1J59 A;  3DPT A;  4KT5 C;  1FBU A;  2NNN A;  2XAS A;  1F4K A;  4KIG A;  1IXS B;  2E7W A;  1QBJ A;  4OMY A;  3KP4 A;  3NEU A;  1D8J A;  2PLY A;  1G3W A;  3O6B B;  3F21 A;  2OA4 A;  2EFO A;  3RYR A;  1H9T A;  3ZMV A;  3BJA A;  2OD5 A;  1OYY A;  5LGN A;  3BRO A;  1HW5 A;  4Q5S F;  3RIR A;  5L3D A;  3ROU A;  5DUI A;  5HOO A;  1W5T A;  2Y75 A;  4UVA A;  1W7P A;  2VC1 A;  4PGG A;  2X4H A;  5K5R A;  1R1V A;  3JW4 A;  2H6B A;  4P55 A;  2EB7 A;  2ZXJ A;  2HR3 A;  4OIR F;  4H0E A;  3CJN A;  1MDM A;  3RI4 A;  4I09 A;  2XVC A;  1Z6T A;  3JAM Z;  1IF1 A;  1W5S A;  2GA1 A;  2UZK A;  3KCC A;  1TTY A;  2K02 A;  1WI9 A;  2DAO A;  4IRI A;  4LG0 A;  2JPC A;  2XAJ A;  5HLG A;  1STZ A;  4S05 A;  4WCG A;  3T5X A;  2QEN A;  3GUD A;  4HF1 A;  2A6E F;  5HS9 A;  3T8T A;  1HW2 A;  1WKM A;  1I5Z A;  3IKV A;  4TV7 A;  3FXQ A;  3WE2 A;  2Z5U A;  5DYM A;  2HKX A;  2VN2 A;  4A5N A;  3LA7 A;  2G7H A;  3RPU A;  3F6O A;  5E1W A;  3H92 A;  2OZ6 A;  1OPC A;  1U78 A;  5L3C A;  2WV0 A;  4YFK F;  5D5V B;  2FRH A;  1KU7 A;  4XSX F;  1DPR A;  1IN6 A;  1ON1 A;  5CYV A;  2FML A;  3WTT C;  4ENK A;  3IRQ A;  1Q1H A;  3TGN A;  2Q2E A;  3KZY A;  5ILU A;  5FO5 A;  3TDU C;  2XRO A;  2EA4 A;  4WXC A;  2DLL A;  1RI7 A;  4L0Y B;  1TQM A;  2GIV A;  2FOK A;  3I64 A;  1DPU A;  3E6M A;  5FGM A;  4U88 A;  2FSW A;  1P4X A;  3BJO A;  1KGS A;  3HRS A;  3SHF A;  4HYE A;  5FD6 A;  2ACJ A;  3ZP5 A;  2Y0M A;  1BI3 A;  4IHT A;  2LKP A;  4PGH A;  4UVC A;  4EV0 A;  5BOX A;  2D2W A;  5IT3 A;  2ISZ A;  1TQI A;  2BYV E;  4LLN A;  5J6X A;  1NHA A;  1C0W A;  3RDI A;  3HRM A;  4L5J A;  3LST A;  4ZZD A;  3HOS A;  1DDN A;  1F5T A;  4UXN A;  3WTX C;  1BBY A;  4MQV A;  1O7L A;  2RC4 A;  4JBA A;  4U7B A;  1REP C;  2CO5 A;  2W84 A;  1P92 A;  4L9T A;  2R7F A;  3W6K B;  3G3Z A;  5DD4 A;  3K69 A;  3P9C A;  5ED4 A;  1J75 A;  2JRT A;  1WSU A;  1HQC A;  2ESH A;  2YR2 A;  2A69 F;  2PN6 A;  3V8L A;  2GXB A;  2DTR A;  2H09 A;  4LLL A;  4HQE A;  1SD7 A;  2RVC A;  3KFW X;  2E1C A;  4U0Y A;  2EWN A;  4DQ2 A;  2V1U A;  4RB3 C;  4OIO F;  3R6S A;  3U9G A;  4HV6 A;  4BXU A;  3E5X A;  5JFR A;  2YX7 A;  3HSE A;  1FZP B;  1T6S A;  5FFZ A;  1D8K A;  4UVB A;  2K4J A;  3F8M A;  2DQL A;  1EV7 A;  4G6Q A;  1XCB A;  3HRU A;  4Q4Z F;  2WC2 A;  4EQQ A;  3FXU A;  2EFP A;  2TDX A;  4MTE A;  1FT9 A;  3VB2 A;  1MGT A;  1K6O A;  4U7D A;  2IW5 A;  3FXR A;  2QM3 A;  3WTV C;  3VOE A;  1S3J A;  4KUM A;  4BNC A;  1QNT A;  3IL2 A;  2CFX A;  3I59 A;  1JHF A;  3CUQ B;  5L3E A;  2NNY A;  2BGC A;  2M45 A;  4DNC A;  3JAM K;  2CWE A;  2XHK A;  4QWQ A;  5FLX Z;  1EH6 A;  1ZRD A;  2F5F A;  2GXG A;  5D8L B;  1E2X A;  2DPU A;  4LMY A;  2XUB A;  2W24 A;  1LJ9 A;  2HTS A;  2FA5 A;  4LJZ F;  1RZ4 A;  5HDG A;  1U8R A;  3EET A;  3L00 A;  5CVI A;  2K7L A;  3V7R A;  3DF8 A;  1SAX A;  2HYG D;  1S8N A;  4BHC A;  4EJU A;  1ZAO A;  4BHB A;  2P7V B;  3Q9S A;  5AIQ A;  3M8E A;  4B8X A;  3Q9V A;  1D3Y A;  1TW3 A;  3TO9 A;  4EVI A;  3SQN A;  3E6C C;  2HZT A;  1P6R A;  2AS5 F;  3L9F A;  1XSX A;  2QQB A;  3HTS B;  4Z2Y A;  1LVA A;  3RYP A;  3QP6 A;  2MLK A;  1I6X A;  5LLQ A;  1J0R A;  3HHH A;  4OIP F;  3GEZ A;  5D8K B;  3FMS A;  4U0V A;  4G7H F;  3ZMS A;  2VBY A;  3KEO A;  4M9Z A;  4AIJ A;  1Z6R A;  2XKP A;  4KIC A;  2VE9 A;  3LFK A;  1KU9 A;  2R7D A;  4FX4 A;  3MEX A;  5AON A;  1SMT A;  3TOA A;  1ZRF A;  1BI1 A;  3FMR A;  2P5L C;  1MD0 A;  1K78 A;  3GVA A;  4HLX A;  4P96 A;  3C3W A;  3K1N A;  3J7A O;  3WTW C;  3BWG A;  1YW9 A;  2MH2 A;  2G7U A;  2B0L A;  2J5P A;  5D5W B;  3W6J B;  4O6J A;  2OZU A;  4LGW A;  1XGO A;  2Z9O A;  2MA3 A;  4JQF A;  1B9M A;  4RGR A;  1LDK B;  2P8T A;  2MLG A;  1PP7 U;  1F9N A;  3ZMZ A;  5KVR A;  4IXA A;  3J81 Z;  1IN8 A;  1G3S A;  4M71 A;  1J9I A;  3KLO A;  1HKT A;  3ZMT A;  1R7J A;  4RGS A;  3WGI A;  2PQ8 A;  3MFK A;  2IJL A;  4GGG A;  2IA0 A;  3M9A A;  2OBP A;  4IF4 A;  5LHH A;  2M1B A;  2VC0 A;  5LEK A;  2QBY A;  3ZN0 A;  2YX4 A;  1BI0 A;  4LB5 A;  3DEU A;  3FX3 A;  3J80 Z;  4A0X A;  1O7F A;  2ETH A;  4Y13 A;  3ZPL A;  1XMA A;  1UFM A;  2HGC A;  2M87 A;  2EJR A;  1FP1 D;  4R79 A;  2HOE A;  2XAF A;  1K78 B;  4CIC A;  2XRN A;  4WXH A;  2DPD A;  4HDU A;  3IWF A;  1ZGA A;  5H20 A;  5FLX K;  3KP5 A;  3FWE A;  1BC7 C;  4MTD A;  1YW7 A;  4BHP A;  2P6T A;  2F5E A;  3G73 A;  3BPX A;  1XB4 A;  1V4R A;  2XAG A;  1J2X A;  3F8F A;  3R4K A;  2O6G E;  2EV6 A;  3ELK A;  4PDK A;  1IN4 A;  2H94 A;  3GX4 X;  2E7X A;  4L0Z B;  4OIN F;  2KIF A;  4KDP A;  5EEG A;  2L54 A;  5F6F A;  5CVV A;  5JVT A;  4HX4 A;  3F23 A;  2C6Y A;  1L3L A;  3KP7 A;  5ILS A;  3EDP A;  4B09 A;  1Y0U A;  5HLI A;  1XDU A;  2LDU A;  4FX0 A;  4G94 A;  2GAU A;  3R60 A;  4ZYD A;  3GFI A;  2BV6 A;  1YO5 C;  3QPT A;  2EK5 A;  1HKS A;  1RNL A;  1O57 A;  2FBI A;  3MWM A;  3LA2 A;  3WTZ A;  2M5W A;  1DP7 P;  5ERI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...