5DUKA

N-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
DTRREIYKHIVKSPGLHERQLAKELDVPLSTLVYHLHYLERRELIMMKSDERYARYYATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative DNA binding protein
publication title N-terminal structure of putative DNA binding transcription factor from Thermoplasmatales archaeon SCGC AB-539-N05
rcsb
source organism Thermoplasmatales archaeon scgc ab-539-n05
molecule tags Transcription
total genus 15
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dukA00
5FFZA 4M6XA 4O5VA 5A2QZ 5CVRA 1SAXA 2F5DA 4HF0A 1FYMA 4AIJA 5AIPA 1XGOA 3M9AA 2M1BA 5BS6A 1QZZA 1J59A 2VBYA 1O3SA 1SFEA 4L0ZB 4ZH4F 2A5YB 1YW8A 3GYHX 1YG2A 4M9XA 4S05A 1J9IA 1WKMA 4HA8A 5JHUA 3LWFA 1YLFA 3DEUA 4L18B 4L9NA 1R58A 1JHHA 1G6NA 4G7OF 2ELHA 4I0AA 4A5NA 3Q9VA 4WK8F 1I1SA 2QLZA 3H3UA 1ZLKA 3ECHA 2PQ8A 4KYWA 1GXPA 5DCMB 3HYIA 4JQFA 5CLSA 2KIUA 1XCVA 2DFIA 2IW5A 3RDIA 3FM5A 1HQCA 4HBLA 4A0ZA 4L5JA 4L9TA 5TRDA 6PAXA 1KYWA 4A12A 3KLOA 5JI6A 1LQ1A 4ON0A 4EQQA 3RIRA 1C0WA 2JRTA 3DFGA 3T0YA 1Z91A 2MLGA 1HKTA 1QPMA 1W5TA 2FNAA 3IHUA 4MTDA 4MEXF 1QGPA 4HX8A 1MJAA 3DKWA 1ZG1A 2VBXA 2KJCA 5BPIA 1U6GA 3GFIA 2RNJA 2UZKA 3PQKA 4IF4A 1F9NA 3MEXA 2XVCA 3F72A 3FMQA 4KNYA 3C18A 4EJUA 2XAJA 5D5VB 2DBBA 2A6HF 2EFWA 2PMUA 2GWRA 5AIQA 2PFBA 3V8KA 4E70A 2XAHA 2ZXJA 1CF7B 2LKPA 4OOIA 2D1VA 2HDCA 4A6EA 1OYYA 3TKYA 1QZYA 1ZAOA 4ENKA 1BIAA 1IRFA 4EJVA 2Y48A 4BH9A 2YPRA 2ESHA 3ZMSA 1UFMA 1OR7A 1T38A 3CUQC 3HRUA 1P92A 4LK1F 3HHHA 1Z05A 3J80Z 1CF7A 5J8CA 1Z9CA 4BAYA 1W4MA 1XD7A 2MD5A 1SFUA 1FC3A 4UVBA 2Z5UA 5L3DA 4EM1A 1DDNA 1HBXG 1V4RA 1XMKA 3M7GA 1D8KA 1ZHFA 2JPCA 3HIFA 2NYXA 4Y15A 1R1TA 2NNNA 4I02A 1WWXA 4HQEA 3ZMTA 4ASNA 4ENNA 4DNCA 4HW0A 3ZPLA 2LF8A 1MGTA 1ZRCA 1D5VA 4M71A 4IHTA 2FBKA 3KFWX 3TO9A 3SZPA 2JTVA 5BOXA 3I54A 2P5LC 1HKSA 1PP7U 2L54A 4G9YA 1ULYA 3RKYA 2Z9OA 1I6XA 4BYYA 4XBFA 2GAUA 2UWMA 4IRIA 3CLOA 2Z99A 4UXNA 2K4JA 1XMAA 2PLYA 4LLNA 1HSTA 2RGVA 3D0SA 3MCZA 3I4PA 3RYRA 4HAMA 5IT3A 5D5UB 3QAHA 4N9HA 4MHGA 3ZP5A 3ZMDA 1O3RA 3K1NA 4M6YA 1T98A 3ECOA 4WX9A 1GVJA 4LJZF 4IRHA 1I27A 1YS6A 4Y17A 4ESBA 4RGSA 2RDPA 3G73A 5H6RA 1KU9A 4EM0B 2FMYA 3BPVA 3I0TA 4ENJA 4UNOA 3L9FA 4RGXA 4IJAA 1H9TA 4Q5SF 1SMTA 3ABTA 4BXUA 3B02A 4LB6B 4XRFA 3FF5A 1MDMB 3RKXA 3CDHA 1R23A 3SQNA 5HS8A 2FE3A 4N0BA 3LFKA 1HW5A 1K6OA 1PDNC 4A6DA 1WQ2A 3L09A 1W7PA 2P5VA 1G3TA 5ILSA 4H0EA 2MH9A 5F6FA 3R60A 5FB2A 1AWCA 5D6EA 1RNLA 4OIQF 3E6MA 4I98B 1TBXA 1WSUA 1LDDA 2E1NA 4L5IA 4KIBA 4GYIA 4EJWA 1TNTA 2H09A 3HSRA 1KU7A 4M72A 4OU0A 4Q48A 1S7AA 2OA4A 2RV8A 5ILVA 3SHFA 4RB1A 2J5PA 3R4KA 4YFXF 3ULQB 4HOBA 4IHSA 3BY6A 2VE8A 1ON2A 1FLIA 2XKPA 3I64A 2ZBKA 3F6VA 3HUGA 3MQ0A 4MEYF 2OD5A 2W84A 2XAQA 3M1EA 2DTRA 1XB4A 2HTJA 3Q5FA 2R7FA 4O3MA 3GZ6A 2HKOA 2QUFA 3WTTC 1B6AA 4YIFA 2HEOA 3KZYA 3KLNA 2QZ8A 1FBQA 3ML6A 2LSOA 4CHUA 4HLYA 1XCBA 2KKOA 2IT0A 3T5XA 4I01A 2ZO4A 1OPCA 1R36A 3EDPA 3LAJA 1QO0D 4R1HA 3JW4A 1BI1A 4KIGA 5J8FA 2OQRA 2DT5A 3GZ5A 5LHHA 2IA0A 4KMFA 2HZTA 4ZZDA 1F5TA 2M8EA 1RUOA 4Q4ZF 2UXNA 2PMHA 2JT1A 1AOYA 1O3TA 2P6SA 1IXCA 2HOEA 2WWYA 3NEUA 3LSTA 3WODF 1G3SA 4HYEA 2GIVA 3CTAA 2FRHA 2F5EA 2FMLA 2EJRA 3LA3A 1KQ0A 1IN6A 2ESNA 1VTNC 4HF1A 2VT2A 2KIFA 4AD9A 2VBWA 5L3BA 2ZMEA 1Z6RA 3BJ6A 4LGWA 2W24A 2CWEA 3BWGA 1IAWA 2YU3A 3TQNA 1J75A 2HTSA 5LRRA 3W6KB 1ZRFA 3U1DA 2UXXA 5E1WA 3I59A 3V7SA 3CO7C 4I0BA 5HLGA 2ISZA 3ZN1A 2L4MA 1XGNA 3EYYA 3O2PE 2TDXA 1K78A 5LLQA 2O3FA 2QENA 4P9FA 3GFMA 1OYWA 3ZN0A 3GWZA 3V8LA 3WG9A 4EJOA 3DXJF 4UVCA 2K86A 4N9IA 2P8TA 1FY7A 5D8KB 1QNTA 1LB2A 4OMZA 4FX0A 1P2FA 3CO6C 2VN2A 4BHPA 2QBYA 2FA5A 5LEKA 2RC4A 4U0YA 4RAYA 2K4BA 2LF7A 3G3ZA 2EV5A 3GEZA 1H9GA 2FF4A 3FXUA 3IL2A 2RVCA 1SD6A 1U78A 1KQ9A 5CVVA 5D4RA 4HLXA 2EK5A 4JK1X 2OU2A 4OINF 1L3LA 2ADUA 4BHCA 4KFCA 4RB2C 3LA2A 4XLPF 4WF2A 3P7NA 3KP5A 2XRNA 2G9WA 3DPLC 1IN7A 2DAOA 5D4SA 4I7HA 4EM2A 5J6XA 2NNYA 3KP7A 4LB5A 2HR3A 2GQQA 3KE2A 3KP6A 1P4AA 3C7JA 3QRFF 4AWXB 5IT9K 3FWEA 4WXHA 4FHTA 4NQWA 4IRGA 4HZFA 4P9UA 3E5UA 2MA3A 4CDGA 1S6LA 3RJPA 1L0OC 4XSXF 4ESFA 2Q0OA 3IKVA 2IJLA 2H6CA 2ZJ2A 2FSWA 1RZ4A 1BI3A 3LQQA 4BHBA 3IKTA 4U88A 3SZTA 3RI4A 3OOPA 2QYOA 1EH7A 3GUDA 2VC1A 4R8HA 5AONA 4GYGA 4A0XA 1FX7A 5H6QA 1FT9A 4ZYEA 4QLCU 2A69F 3AAFA 1MJBA 2HGCA 1CGPA 4G6QA 1ZARA 3P9IA 5DCFA 3TDUC 2FEZA 3F3XA 2XKOA 2X0LA 3GFLA 3DP7A 2IA1A 1TNSA 1R00A 2O03A 1YW9A 2XUBA 2M30A 4MQ9F 5EEGA 3WGHA 3ERED 1E17A 1DPRA 1XDUA 4IXAA 1B4AA 4Y13A 4M74A 1LDKB 2L4AA 1F1ZA 2WV0A 1T6SA 2HQRA 3N4MA 3LQRA 4U7DA 2NS0A 3KP3A 4CO8A 1FWZA 3L2CA 4KN4X 1V3FA 5DUKA 4M73A 2XAGA 3M8EA 3BROA 4WXDA 4RB0A 4HX7A 3SFZA 3N97A 3BP8A 3JSPA 3K0LA 4S04A 2A68F 4YFKF 2K7LA 4NB5A 4OIRF 5E1XA 4A0YA 5FD6A 3P9KA 4CGZA 1O57A 4L9VA 5CYVA 5E17F 3MFKA 2Z3YA 1MJ9A 5KK1A 4HDUA 4AIHA 1ZG5A 1J5YA 1SFXA 1BI2A 2PI0A 2W85A 3HHGA 1TLHB 3E5XA 1S3JA 4MTEA 3TOBA 4WCGA 2GXBA 5D5XB 4OMYA 4ENMA 5FLXK 3WTZA 4UV8A 1XSDA 1IN4A 3NQOA 2Z33A 3JAMK 1FPQA 1R5GA 3QU3A 1QQIA 3L00A 1MD0A 3HOSA 1R1VA 4KDPA 2BV6A 1H0MA 1IW7F 3GX4X 4EGYA 2ZNYA 1OKRA 1BM9A 1ZH5A 4LFUA 2R3SA 1K7AA 2D1HA 2V9VA 3EYIA 4G8XA 4WXCA 4F7ZA 3BPXA 5TJJA 4ETSA 4GO1A 2FOKA 2WC2A 1OMIA 4HX4A 3MZYA 3QU6A 3CUQA 2A07F 2FXAA 3KZZA 2VC0A 1W7PB 2RQPA 4LG0A 2PG4A 3GVAA 1XGSA 4GGGA 5K5OA 5ICEA 1YFHA 1USTA 1REPC 4KN7X 5DD4A 1TW3A 5HOOA 1TQMA 5HS7A 1J2XA 3V7RA 3K9TA 1J0RA 1RIOH 2DU9A 1ONVA 1YQAA 2DW4A 5LGTA 5E8IA 1ZYRF 1FBSA 3JAMZ 1ODDA 3R6SA 5E1ZB 4PCQA 2H27A 4HDVA 1KU3A 1W7PD 3HRSA 2COMA 1ZGAA 2OZUA 3VOEA 1LDJA 4EMSA 1ZREA 3ABUA 2KIMA 1FYLA 2MBFA 2D45A 3HTSB 3K2ZA 2NAZA 1YTYA 3F6OA 2P7CB 5LHGA 4YG2F 1KU2A 3O6BB 1P6RA 4P55A 1UB9A 3GXOA 3IRQA 3IWZA 5LHIA 2Q2EA 2IA2A 3R0JA 1K79A 1ON1A 2IPQX 1LEBA 2CG4A 4HQMA 4OIOF 2XV4S 1KGSA 1EV7A 4KIFA 1XSXA 1I5ZA 5DUIA 2A6EF 5D8LB 4R79A 1YO5C 1TQIA 4HV5A 2P7VB 1IZ1A 4M9SA 1MKMA 1RUNA 2FBHA 3C1DA 5CJ9A 5FFXA 3FXQA 3ISPA 1XDSA 2J5OA 1Z6TA 4Z2YA 3TOAA 3WTWC 1JE8A 3SXYA 4A5MA 2KRFA 4EVIA 2BE5F 3ZMVA 4WWCA 3WGIA 4CICA 3CUOA 2ACJA 5L3CA 1O7FA 4EGZA 2D2WA 1YIOA 4FT8A 2EFPA 1R22A 2EFOA 1SD4A 1USSA 2ZMEB 2VOPA 4AVPA 5E18F 1Z7UA 1IN8A 2ZNZA 2STWA 3P9CA 5LGUA 2CW0F 1O7LA 2G7HA 3I59B 3RKWA 3JTGA 2E7XA 2X4HA 3HSEA 3VODA 2DO7A 2DK8A 1BC7C 3HSFA 5DEQA 1B9MA 2HKXA 3FX3A 2V6CA 3GF2A 1K78B 3I53A 5LRSA 1U5TA 1TW2A 2A3SA 5A2QK 4G6DA 2VT3A 2R7DA 2IVMA 4RGUA 1D8JA 4RB3C 1E2XA 1BJAA 3WTYC 5HDKA 2JSCA 2O8XA 4KICA 2CSOA 2GA2A 2QBYB 5BMZA 4AIKA 1P4WA 1Q1HA 3F23A 4MQVA 3VEPA 1XSVA 3F8MA 2RKHA 5F1RA 3FMRA 3GO5A 5CVJA 3H92A 2XIGA 2L3DA 3E6DA 4QWQA 4G7HF 3WGGA 4U7BA 3T1BA 5FO5A 1BBYA 3TDZC 3MAJA 3WE3A 3I5UA 3M8FA 2QVOA 1B1BA 2IRFG 3K1PA 3DPTA 3IRRA 1WI9A 4RAZA 2YX4A 3IC7A 3B73A 3FXRA 3QP5A 2HFHA 2Q8KA 2NRAC 4M9ZA 2VBZA 2E7WA 3HTUA 2V1XA 2MH2A 2QQAA 2QM3A 2FNPA 1EH8A 5BPDA 2HWVA 5ED4A 2AS5F 2PJPA 2FU4A 2DQLA 2M45A 1JXSA 3PFIA 1KQ8A 3I71A 5JVTA 4LLGF 2EWNA 3COAC 2ISYA 2AXLA 2CYYA 4P5OA 5HVQC 2LNBA 1FZPB 1UHMA 1WRJA 2MC3A 2FBIA 2HYFA 4RGRA 3EETA 3F8NA 5EEHA 4CYDA 2OBPA 3BZ6A 4UUVA 3LA7A 3F8FA 5ILUA 2IP2A 1T39A 1O3QA 5FGMA 3Q9SA 2XASA 2JPBA 3V8JA 1MZBA 1S8NA 3W6JB 3RPUA 2EA2A 2YR2A 1D3YA 2DK5A 1SMYF 5JFRA 3BJAA 3F8BA 3MZHA 5HLIA 2EFQA 3QOPA 1F4KA 2CGPA 5DYMA 2V1UA 3KETA 3E6CC 1EH6A 3J80K 1ZN2A 2ZCWA 4LLLA 3R61A 1G4DA 3PQJA 4TV7A 3RPQA 5DCMA 4IPAA 5E20A 4IVNA 4PGGA 4KMUX 5IT9Z 1UHWA 1HW2A 1FP2A 2M5WA 3S2WA 4EJTA 2K02A 5F64A 4B09A 3FZVA 1TQPA 3KCCA 3MWMA 2BGCA 2DQRA 3GLXA 1BC8C 1R5HA 1S7OA 2DPUA 2VE9A 3WTXC 1T2KA 5D5WB 2Y75A 2XHKA 3QPHA 2MLKA 4MNUA 1JHFA 2HQNA 4YIIA 1RI7A 5ICCA 2P5KA 4BQAA 2H94A 5CVUA 1BIBA 5HDGA 1XN7A 5CVIA 3QPTA 1DP7P 2G7UA 2QQ9A 2HYGD 1GXQA 1ZGJA 2JZYA 2E1CA 5ICFA 2XGXA 4FX4A 1ZG3A 1LJ9A 4ZYDA 4UV9A 2K27A 2F5FA 2GXGA 3U2RA 4NHJA 1FSHA 1I1GA 5ERIA 2B0LA 2BYVE 1SD5A 1FYKA 4P96A 3HOTA 4BNCA 4GXOA 3U9GA 1DUXC 1ZRDA 3BDDA 1J7KA 2YX7A 4OIPF 5K5QA 2OAZA 3JSOA 1YS7A 3WTUC 1IXSB 5DD8A 1HW1A 4PGHA 3E6BA 2ZFWA 4L9JA 3T8RA 4L0YB 3I58A 4PDKA 2F5CA 2O0YA 3TO6A 1GHCA 2EA4A 5D6FA 5JR3A 5HDNA 2EV6A 1JGSA 3CUQB 4LD5A 1B59A 2P4WA 5LBQA 4LG0B 5K5RA 2BBYA 4CZZA 1R1UA 5ICGA 3RYPA 3R0AA 2PEXA 4GCVA 1U3EM 5L3GA 2VONA 3J7AO 4K2EA 4G94A 3RTRA 3WTVC 3GFJA 3KP2A 3DF8A 3WU1B 1FSEA 1SD7A 1PP8F 5LGNA 2LDUA 3ZMZA 4ZZLA 1ZLJA 4D0PA 2PBIA 3VB2A 3FM3A 2FQ3A 3LAPA 3T8TA 2VODA 2BEOA 5FLXZ 2PN6A 1KYZA 2KJBA 4U0WA 4U0VA 3DV8A 1FP1D 1IUYA 3F8CA 2QQBA 2V1DA 3OV8A 4I2OA 5K1YA 4Q47A 5HLHA 2P6TA 2F2EA 4A2UA 2Y0MA 4XSZF 4MGRA 4UHTA 1U5TC 3K1MA 1B9NA 1BN5A 1MDMA 4DQ2A 1UCRA 3FHZA 1NHAA 1IN5A 4ESJA 1A04A 5BQTA 5HS9A 2CO5A 2DI3A 4G7ZF 2EB7A 1QBJA 3IWFA 1IF1A 3DQVC 2L02A 4O6JA 1LNWA 2W25A 2OQGA 1G3WA 2O61A 4KT5C 1XGMA 3V4GA 2DLLA 5L3FA 4LK0F 5L3EA 4KUMA 2L01A 1T0FA 1U8RA 3D5LA 3WE2A 4YFNF 1YW7A 4JBAA 3BJOA 2C6YA 1STZA 3J81K 1BOAA 3TO7A 1HKQA 2M87A 2WTEA 3F22A 2HS5A 2CFXA 3FMSA 1IRGA 2RN7A 2EFNA 1LEAA 3VFZA 5DV5A 3L7WA 4EV0A 1G3YA 4CXFA 2STTA 1U5TB 3F21A 1X3UA 5LEJA 3ZMUA 1PUEE 2QWWA 3E3VA 1R7JA 3KEOA 2ETHA 2W57A 3TGNA 1W5SA 5E8GA 5H20A 2ZKZA 3HRMA 1OYIA 1KA8A 4I09A 3EQLF 3H3ZA 2GZWA 2XROA 1HSJA 4HV6A 4HF2A 3WTSC 4B8XA 1S29A 2O6GE 2GA1A 2CQKA 5DDGA 2H6BA 4UVAA 3CJNA 5FD5A 1Y0UA 4PZJA 3ELKA 2XAFA 1BI0A 3O3KA 1DPUA 3KP4A 3J81Z 3HRTA 1P4XA 1YYVA 1FBUA 2YSRA 2DPDA 3JTHA 4XLNF 3WU0A 4KA4A 3ZQ7A 1HXDA 3K69A 3BOQA 1Z1DA 1TTYA 1FNNA 3E5QA 3NRVA 1LVAA 2VOOA 4ZYHA 1FOKA 3V7CA 3KEQA 2V79A 3EUHA 2A61A 4LMYA 2OZ6A 1IXRC 1U2WA 3ROUA 3E97A 4RS8A 5KVRA 3GW2A 2EV0A 2VXZA 3REOA 3C3WA 4ZYGA 3QP6A
chains in the Genus database with same CATH superfamily
2VJIA 1E3PA 2V9PA 4XKCA 5FFZA 1AHDP 3JRDA 4ZDOA 1JKPC 4M6XA 4IL6C 3QODA 4O5VA 1TP4A 1MMNA 5A2QZ 5CKTA 5CVRA 1KZHA 2F5DA 4HF0A 1SAXA 1FYMA 4AIJA 5AIPA 2VQHA 1XGOA 3M9AA 3CMEI 2DJNA 2AQEA 2M1BA 2BY3A 4AM3A 1UG0A 2R7WA 1W36C 4Y33A 3ABMH 5BS6A 1D1BA 1QZZA 3QOEA 3OSGA 1J59A 3AG2H 3JRGA 1LE8B 2VBYA 1VQ5I 1O3SA 3W2AA 1SFEA 4L0ZB 3S1MJ 4ZH4F 1X1AA 2A5YB 4FETA 1YW8A 4PUSA 3GYHX 1YG2A 1HCRA 4M9XA 4S05A 5B1BH 1J9IA 1YI2I 3N05A 2R92J 1WKMA 1PUFA 4HA8A 5JHUA 3LWFA 1VFCA 1YLFA 3DEUA 2Y2ZA 3DBHB 4L18B 1U0JA 4L9NA 1R58A 1JHHA 1G6NA 1LE8A 4G7OF 2ELHA 2W4SA 4DYQA 4I0AA 5F27A 4A5NA 3I3LA 2XGDA 3M1CA 3Q9VA 4WK8F 2WADA 3OYDA 3BQYA 1I1SA 2QSFX 2QLZA 3H3UA 1ZLKA 3ECHA 1ZGWA 4V19K 3SEZA 2PQ8A 1ETQA 3GTKJ 2K5CA 2BW3A 4GDFA 4DBRA 1E3OC 3KZIC 2GLOA 4KYWA 3GCMA 3DKYA 4FE4A 1GXPA 4IHVA 3HYIA 4JQFA 5CLSA 5DCMB 2KIUA 4M3DA 1XCVA 1N75A 2DFIA 2IW5A 3RDIA 3FM5A 1TWAJ 2VASA 1B72B 1HQCA 4HBLA 4A0ZA 2KT0A 2BVLA 4L5JA 4L9TA 1D5YA 4C30A 5TRDA 1KYWA 4A12A 1TC3C 1A36A 6PAXA 4M3EA 3KLOA 1E0EA 5JI6A 1LQ1A 1FJLA 1N25A 4ON0A 5EDNA 3K6GA 4EQQA 3RIRA 1C0WA 2JRTA 4LG3A 4LIUA 1K61A 3DFGA 3T0YA 1Z91A 1X2NA 2MLGA 1HKTA 1QPMA 1JKQC 1W5TA 2FNAA 1X4PA 1A6IA 1WH7A 1S9HA 1VQNI 2HVQA 2LY9A 3IHUA 2IEKA 2R7TA 4MTDA 4MEXF 1QGPA 2F6CA 2DFHA 4HX8A 1MJAA 3DKWA 1ZG1A 1JGGA 5FKLA 2VBXA 2KJCA 4CUGA 3QQAA 5BPIA 1W0TA 3AKZA 1VZ0A 2CQQA 2N8GA 4XQFA 1U6GA 3GFIA 1X3ZB 2BHZA 3W3CA 2L7MP 2I10A 2TRTA 1T33A 3CD6I 2RNJA 3K4NA 2UZKA 3B6CA 3PQKA 4IF4A 1F9NA 3MEXA 4C3IJ 2XVCA 2LKSA 2HPMA 3GLLA 3F72A 3FMQA 4KNYA 1U8BA 3C18A 3CCUI 4DYCA 4EJUA 1N77A 4BEHA 1DU0A 2XAJA 5D5VB 2DBBA 2A6HF 2EFWA 1W0UA 2PMUA 2GWRA 2JA5J 5AIQA 4V2FA 1W36D 1T56A 2PFBA 3V8KA 4CCLA 4E70A 1B8IA 5J47A 2XAHA 2ZXJA 3MKYB 1CF7B 4C2MJ 4NDLA 5TGTA 1FOWA 4NNJA 1VQ6I 2LKPA 4OOIA 2D1VA 1Y6IA 2HDCA 1I50J 1RETA 1FTZA 4E7HA 1Y8RB 1SANA 4A6EA 1OYYA 3TKYA 1QZYA 4NBQA 1ZAOA 4ENKA 1BIAA 1IRFA 5FROA 2Y48A 4BH9A 2YPRA 4EJVA 4E4HA 2ESHA 3M4OJ 4XIDA 3ZMSA 1P7IA 1UFMA 1VQ7I 2ME6A 2L9NA 1OR7A 2LTPA 1T38A 4S0HB 3CUQC 3H5RA 1P92A 3HRUA 2HDDA 3RKQA 1P7JA 4LK1F 3HHHA 1Z05A 3J80Z 4XLAA 1YJ9I 5J8CA 1CF7A 2EILH 1Z9CA 5EGOA 3G1OA 4CCMA 2ELJA 1IJWC 4BAYA 4BDYA 1W4MA 4ZYAA 3JRIA 1WVRA 2B9SA 3K4MA 2AHQA 1XD7A 2MD5A 2Y0SA 1SFUA 3JREA 1FC3A 2DA2A 1MBEA 2O5RA 2Z5UA 3ASNH 4UVBA 5L3DA 4EM1A 1DDNA 1HC8A 3PFYA 1HBXG 1V4RA 4ZC3A 4MIMA 1XMKA 4PFOA 3HB9A 3M7GA 1D8KA 4JX5A 1ZHFA 2JPCA 3HIFA 2NYXA 4Y15A 1R1TA 1XX5A 2NNNA 4I02A 3PM1A 1WWXA 4HQEA 4M3GA 3UR3C 3ZMTA 4ASNA 4ENNA 4DNCA 4I6ZA 2Y31A 1MMGA 1UJ8A 1WHUA 4HW0A 1RKWA 3ZPLA 4IQ4A 4N4NB 4Z6YA 2WB1N 2LF8A 1JT6A 4DW6A 1OISA 1JJ6C 1OCOH 1MGTA 2CMPA 3TW7A 2M3AA 4IX7A 1ZRCA 2CUZA 2EINH 3FXKA 4JOMA 5F0CA 3PNVA 1R5ID 4M71A 4IHTA 1D5VA 2FBKA 3KFWX 1A31A 3TO9A 3PIOF 1K4SA 1FMVA 3SZPA 2JTVA 3W2VA 5BOXA 2PJRB 3I54A 2P5LC 3HOWJ 2HI3A 1RR7A 1HKSA 1PP7U 2L54A 4G9YA 1POGA 4XOPA 2NVTJ 1ULYA 3RKYA 2Z9OA 1I6XA 4FASD 4BYYA 4XBFA 5FJ8J 3J7YJ 1SEUA 2GAUA 1QPIA 2UWMA 3K10A 4IRIA 3CLOA 3QYBA 2Z99A 1HDPA 3OIOA 3IV5A 3L2VA 4UXNA 2EIJH 1XMAA 2K4JA 2PLYA 1YRNB 3TL4X 2LC2A 4LLNA 1HSTA 2RGVA 2X6XA 2LFBA 5K7HA 2M9HA 3A2KA 4BBSJ 3DLAA 4U87A 4D5CA 3D0SA 1YE9A 3ZGKA 3MCZA 2LY2A 1R4MB 3I4PA 3RYRA 4HAMA 5IT3A 5D5UB 3QAHA 1V5EA 4N9HA 4MHGA 3ZP5A 4XKBA 2XPUA 3ZMDA 1O3RA 3K1NA 4M6YA 3OIPA 3S3MA 5LFAA 1T98A 1ETXA 3HKZN 3ECOA 3PUFA 4WX9A 1SFKA 1GVJA 4LJZF 3OYHA 4IRHA 3FK6A 1I27A 1YS6A 4Y17A 2BOLA 1SVLA 3BTIA 3LSMA 4F93B 4ESBA 2VKDA 4RGSA 4HRIA 1K4TA 2GBYA 4CYCA 3S3NA 2HVRA 3VSKA 2RDPA 3HOXJ 4E7KA 3HOYJ 3G73A 5H6RA 2R5YB 1KU9A 4EM0B 2FMYA 3BPVA 3I0TA 5IY5H 3VSLA 3IP4B 1ORKA 4ENJA 3B6AA 4UNOA 3L9FA 4RGXA 4IJAA 1H9TA 4Q5SF 1SMTA 3ABTA 4BXUA 3B02A 1RR8C 4ZTFA 2WBMA 4LB6B 4XRFA 3JRBA 3FF5A 3L1PA 1MDMB 3RKXA 2QSHX 2VPLA 3CDHA 3CCRI 2KZGA 4DZPA 1R23A 3SQNA 5HS8A 2FE3A 4N0BA 3LFKA 1HW5A 1K6OA 1YX3A 1PDNC 4A6DA 2Y9ZA 1WQ2A 3L09A 4C9YA 1W7PA 2P5VA 3OL3A 1G3TA 3JCUC 3CC2I 5ILSA 4H0EA 3F9KA 2MH9A 5F6FA 3R60A 5FB2A 1AWCA 5D6EA 4OAZA 4YRVA 1RNLA 1BR4A 3G1MA 2A5WA 4OIQF 2MG4A 3I9V2 2CRGA 3E6MA 5IOYA 1E3HA 2NVYJ 3O8HA 4J00A 2Z2SB 3OYCA 4I98B 1TBXA 1WSUA 1LDDA 2E1NA 4L5IA 4KIBA 3J7ZI 4GYIA 5BNGA 1WH5A 4EJWA 1TNTA 2H09A 1DU6A 2CW8A 1UHSA 3HSRA 1KU7A 4M72A 4OU0A 2M7AA 1S7AA 4Q48A 4BJ6C 4BL0B 1AKHA 2JN6A 2KP6A 1Z3YA 4BKXA 2OA4A 2RV8A 5ILVA 4A3DJ 3SHFA 4RB1A 1Z0XA 2VJJA 3MZ8A 2J5PA 3R4KA 2EIMH 3RQIA 4YFXF 1NH3A 1VNDA 3ULQB 4HOBA 1Y8QB 4IHSA 3S16J 2CH0A 3BY6A 4PJNA 2VE8A 2VL8A 1ON2A 1FLIA 2XKPA 2KRHA 3I64A 3FXOA 2ZBKA 3F6VA 3HUGA 4PSXA 3MQ0A 4MEYF 2OD5A 2W84A 2XAQA 4KITB 4A3FJ 4A3EJ 1SAUA 1WI3A 2EZLA 3M1EA 2DTRA 2DA4A 1XB4A 2HTJA 2XSDC 5HLTA 3Q5FA 3ABLH 2R7FA 4O3MA 3AL0C 2JA2A 2HOAA 3GZ6A 2HKOA 2QUFA 4XNFA 4EEFG 3WTTC 2XC7A 1B6AA 4YIFA 2HEOA 3CMYA 2FJ1A 3KZYA 3KLNA 5J3LA 2QZ8A 1FBQA 3ML6A 2LSOA 4LIVA 3GTOJ 4CHUA 4HLYA 2KFDA 2A6TA 4AC0A 1XCBA 2KKOA 2IT0A 3T5XA 4I01A 2CUEA 2ZO4A 1OPCA 1R36A 3EDPA 5FKNA 4DGWB 3LAJA 1QO0D 2MSYA 4R1HA 3JW4A 1BI1A 4KIGA 2EZHA 5J8FA 5C44J 2OQRA 2R4GA 1XG1A 2VKEA 2LVSA 2DT5A 3GZ5A 2WAQN 2ID3A 5LHHA 1NK2P 2IA0A 4KMFA 2KIQA 5GADJ 1IGNA 3S1QJ 5IOZA 2IS4A 1R9TJ 2HZTA 4ZZDA 4A3GJ 1F5TA 2RQQA 2M8EA 4ZJZA 3OR1C 3BG9A 4E7JA 2R7QA 2F4OB 1RUOA 4Q4ZF 2UXNA 2PMHA 2JT1A 1AOYA 1O3TA 3BR6A 3ABKH 2P6SA 3L2UA 1IXCA 2HOEA 2WWYA 3EUAA 3NEUA 3LSTA 3WODF 1TWHJ 4RM2A 3KIOA 2O7OA 2JUGA 4GRIA 4RA2A 1G3SA 4HYEA 1SC7A 1IRXA 3LOCA 2GIVA 3A02A 3CTAA 2FRHA 1WJBA 2F5EA 2FMLA 2EJRA 4BQQA 1BL0A 3DWLE 3LA3A 4QTRA 1KQ0A 1IN6A 2ESNA 3H5AA 5JVGF 1VTNC 3OYLA 4HF1A 4HG2A 3OS0A 2VT2A 2KIFA 4AD9A 2VBWA 4A3IJ 5L3BA 2EIKH 2ZMEA 1Z6RA 5IYDJ 3BJ6A 3L2WA 4LGWA 2W24A 2CWEA 3BWGA 3H9GA 4NC7A 2YU3A 3TQNA 1IAWA 1J75A 3GTQJ 2HTSA 2E1OA 5LRRA 4M3FA 2JQ7A 3KX2A 4CCNA 3W6KB 1ZRFA 2YS9A 4YEJA 2KQRA 4CCJA 3U1DA 2UXXA 5E1WA 3I59A 3V7SA 3CO7C 2OUMA 4I0BA 5HLGA 2ISZA 3ZN1A 2L4MA 2JSPA 2CQNA 1XTAA 3G1LA 5J1UA 1XGNA 4HNTA 3EYYA 3O2PE 4B47A 2TDXA 1K78A 3CDLA 5LLQA 2CU7A 5DM7F 2O3FA 3MVPA 2QENA 5H2FC 4P9FA 2ZC2A 4IHYA 3GFMA 5JLWA 2NVUB 1OYWA 2M2EA 3ZN0A 3S2HJ 3GWZA 3V8LA 3WG9A 2M7BA 4IHWA 4EJOA 3MKZA 1FTTA 2NS8A 1KONA 3A0HC 3CP8A 2KL4A 4Y4RA 3S8PA 3DXJF 1H89C 4UVCA 2K86A 4N9IA 4CA0A 4PJJA 2P8TA 2L9VA 1FY7A 5D8KB 1QNTA 1LB2A 4OMZA 4FX0A 2RAEA 2R7VA 3U21A 1P2FA 3FDYA 1ETVA 1QA6A 3CO6C 2VLAA 2VN2A 1J09A 1Z77A 3ZQQA 2TCTA 2D5VA 4N4OB 4BHPA 2QBYA 2VUMJ 1YITI 4RMNA 3LSHA 2BXZA 2FA5A 2RC4A 4RAYA 5EZGA 5LEKA 4U0YA 2K4BA 2LF7A 3G3ZA 2EV5A 4L5EA 3GEZA 1U9OA 5FRMA 1ZELA 1H9GA 2FF4A 3FXUA 4E7SA 3H36A 3IL2A 1UZCA 5B3SH 2RVCA 1SD6A 2R7UA 1U78A 1KQ9A 1QVUA 3FKJA 5CVVA 5D4RA 4CZCA 1WJCA 4HLXA 1PUFB 1DQUA 2JA8J 3FBNB 1VQLI 2EK5A 3HKZA 3GBGA 1HLVA 4JK1X 2OU2A 5B1AH 4OINF 1OCRH 4C3HJ 2BY0A 1L3LA 2ADUA 4BHCA 3A03A 4KFCA 4RB2C 3LA2A 4XN3A 4XLPF 3M8JA 4E7ZA 3H35A 4WF2A 3BTJA 3FXLA 3P7NA 3KP5A 1MBKA 2XRNA 1ZR4A 2G9WA 3DPLC 4PJ0C 1IN7A 4XORA 2LR8A 2V4JC 2VQLA 2DAOA 4XONA 5D4SA 5K7ZA 4I7HA 2BW3B 4EM2A 5J6XA 2NNYA 3KP7A 2O9LA 3S1RJ 4LB5A 2HR3A 2GQQA 3KE2A 3D5SC 3KP6A 4FE7A 3OYJA 4BE1A 3VDXA 3CJTB 4KISA 1LFBA 5KAFC 1MW7A 1P4AA 3C7JA 4IQJA 4AWXB 3QRFF 5IT9K 3FWEA 1UAAA 4WXHA 1OR7C 3ZQIA 3OYEA 4XRSA 3FIWA 4FHTA 3TW6A 4NQWA 3ZR8X 3CLQA 4IRGA 2DCEA 4MFEA 4HZFA 4B4CA 1WJDA 3GTPJ 3RSNA 2DA7A 4P9UA 3E5UA 2MA3A 5FKKA 4CDGA 1S6LA 3RJPA 1L0OC 4XSXF 4ESFA 1JI8A 1TZLA 3JRFA 3OS1A 2Q0OA 4PJLA 4MO7A 2R7XA 2IS2A 3RPUD 2OPTA 3HC7A 2HU9A 3IKVA 4G6TB 1QRYA 2IJLA 1JKOC 1RESA 2H6CA 3A4CA 2XGCA 5FKMA 2M4KA 2ZJ2A 2DFEA 2XF7A 2DDBA 2FSWA 1OFCX 4RAFA 4F92B 3SJMA 1YJWI 1RZ4A 1BI3A 1H8AC 2EZIA 3P5JA 3LQQA 3BR1A 2BXYA 4BHBA 3IKTA 4U88A 4XRSG 4XLEA 3BR0A 3SZTA 1WPKA 3QPLA 4DOZA 3RI4A 2HPIA 3OOPA 2QYOA 3FHNA 2R7ZJ 1EH7A 1MSEC 3GUDA 3SDGA 5FLVA 2IBDA 2VC1A 4R8HA 5AONA 4BEHB 2FOWA 2Y9YA 4GYGA 4A0XA 5EG0A 1FX7A 5H6QA 3OSFA 1FT9A 4ZYEA 4QLCU 2B7EA 4UY8I 2A69F 3AAFA 1MJBA 2HGCA 3ZQCA 4XM3A 1CGPA 5GTIC 5GPAA 4G6QA 1VQ9I 1ZARA 1X1CA 1EA3A 3P9IA 1B8IB 4IO9F 3BR3A 5DCFA 3TDUC 3K70C 1EF4A 3BG5A 4PK4A 2FEZA 4A3MJ 3F3XA 2O8KA 3KPHA 2XKOA 2X0LA 3GFLA 3NWSA 5M3FJ 1XPXA 3DP7A 3BZCA 5IPAA 2EH3A 2IA1A 1Q1VA 2K9LA 4XRMA 4I76A 1TNSA 4IKFA 1R00A 2O03A 3VYUB 2ZXWH 1YW9A 2WAEA 2XUBA 2M30A 3QYFA 4BE0A 1VI0A 2JUCA 4MQ9F 1O4XA 1A6QA 5EEGA 3WGHA 3ERED 5KAIC 1E17A 5EGOB 3RZOJ 1DPRA 1LFPA 3CCJI 2NVQJ 4QSHA 1XDUA 4IXAA 2A05A 1B4AA 4Y13A 4M74A 5HODA 1LDKB 2L4AA 2DTZA 2AQFA 2WV0A 1F1ZA 4E7LA 3FISA 2L9RA 1T6SA 2HQRA 2IS1A 3N4MA 3DTEA 3LQRA 4U7DA 2NS0A 3DBLB 3KP3A 2IAIA 1FWZA 3BCAA 2WY7Q 1R6RA 4CO8A 3L2CA 1F43A 4KN4X 1V3FA 5DUKA 2WAQA 4M73A 2XAGA 3M8EA 3BROA 1PJRA 4WXDA 4RB0A 4BY1J 3BG6A 4OWRB 4HX7A 3SFZA 3LSRA 3N97A 3D5RC 4BXXJ 2MYSA 2X6WA 2LYCA 3BP8A 2HQ5A 4FQGA 3NWTA 3JSPA 3K0LA 4S04A 2A68F 2X6OA 1Z3XA 4CH7A 2F4MB 4YFKF 2QSGX 3TP0A 4BQNA 3CC7I 1GLNA 2K7LA 2LREA 3GTLJ 2ZB9A 3S17J 4NB5A 4OIRF 5E1XA 3SZGA 4A0YA 1UG2A 5FD6A 3BG7A 3P9KA 3K4KA 3CF5F 4CCKA 4CGZA 1VQ8I 1O57A 2DOAA 4L9VA 1FOXA 2R5ZA 5CYVA 1VQKI 5E17F 1Z21A 3MFKA 3DBRB 2Z3YA 2HOTA 2VKVA 1MJ9A 5KK1A 2E34A 4HDUA 3FXMA 3PNYA 3Q0VA 1TT0A 3ZQGA 4AIHA 1Y1WJ 4BE2A 1ZG5A 1D0ZA 2E2IJ 2W82A 1J5YA 1SFXA 1BI2A 2PI0A 3CC4I 2W85A 3C2BA 3HHGA 1TLHB 3E5XA 3K2AA 1S3JA 5FKOA 4MTEA 3TOBA 4WCGA 2CW7A 4PJMA 2GXBA 5D5XB 1G59A 4OMYA 1ETYA 2IXSA 4D5FA 4ENMA 2X51A 3S93A 5FLXK 3PUBA 3WTZA 4UV8A 1XSDA 2X6YA 1IN4A 3NQOA 2Z33A 3EPZA 3JAMK 3K70D 1MMSA 3M3YJ 1FPQA 1JUSA 1R5GA 3CCMI 3MKLA 5E79C 2OV7A 4E6KG 3QU3A 1QQIA 3KEYA 3G6EI 2FD5A 3L00A 2I5UA 1I6HJ 1MD0A 3HOSA 1OCPA 1R1VA 3ZXSA 2VIXA 4KDPA 3G4SI 3F0CA 5IP6A 2BV6A 1H0MA 2IGMA 3ZOBA 1IW7F 3GX4X 5IYCJ 2XDVA 3I4NJ 4II3A 4EGYA 4BBRJ 4CYCB 3DTIA 2ZNYA 1OKRA 1BM9A 1ZH5A 1IV6A 4LFUA 4JX4A 2R3SA 3OY9A 3KYCB 1K7AA 3O8GA 2D1HA 3SEQA 4BQOA 2V9VA 1T0FC 3EYIA 4G8XA 3DPUA 3QYEA 4WXCA 3HOVJ 4F7ZA 4ZDLA 1IV8A 3BPXA 5TJJA 3BTCA 4A93J 5C4JJ 1WJ5A 4XK4A 4ETSA 4M6VA 5JLXA 2OCEA 2DT6A 4NC6A 4B48A 4GO1A 2FOKA 3HZJA 2WC2A 1OMIA 3E1SA 4HX4A 1Z67A 5TISC 3MZYA 3CCQI 3QU6A 3CUQA 2DN0A 1OCZH 2K85A 2A07F 2XAUA 2E60A 2XF5A 3PIPF 2FXAA 3KZZA 2VC0A 1W7PB 2RQPA 4LG0A 2PG4A 3NARA 3GVAA 1XGSA 1Y56A 4GGGA 1MMAA 5K5OA 5ICEA 4UUSA 1YFHA 1USTA 1REPC 4KN7X 2X48A 5DD4A 2XSJC 2QA4I 1Y1VJ 1TW3A 5HOOA 2XB5A 1TQMA 5HS7A 4KT6A 1J2XA 3BLYA 1K6YA 2K40A 3V7RA 3K9TA 1J0RA 1FOYA 1RIOH 2DU9A 1ONVA 1YQAA 1GV5A 2RNGA 3E0JB 2DW4A 3UKGA 3UNGC 1BW5A 5LGTA 5E8IA 1ZYRF 1FBSA 4QPOA 3JAMZ 1EKEA 2DMNA 3OWTA 5HNFA 1JT0A 5F1JA 3OYBA 1ODDA 3R6SA 1I39A 1T08B 1WGXA 4ANJA 1AKHB 5E1ZB 4PCQA 2H27A 1YJNI 2YU9J 1V5GA 3BTLA 2M8GX 4XICA 2BZTA 4HDVA 4A3LJ 1KU3A 1W7PD 3HRSA 2COMA 1W1WE 1ZGAA 2OZUA 2ZXHA 3HM5A 3VOEA 1LDJA 4EMSA 4Y7NJ 3ABUA 2KIMA 1ZREA 1FYLA 2MBFA 2D45A 3HTSB 1IDZA 3K2ZA 1PYVA 2R7RA 1MBJA 2VQCA 3C2GA 2NAZA 4LITA 3MMYB 1YTYA 3F6OA 2NOJB 1QHHD 2P7CB 5LHGA 3ZQFA 1X1DA 4XR6A 3JRAA 3HUGB 4YG2F 1KU2A 3O6BB 1P6RA 2DT7B 4P55A 2W48A 3H1CA 3PJRA 2HYJA 1UB9A 3GXOA 2DMPA 5KCMA 3IRQA 1QVTA 3IWZA 5LHIA 2Q2EA 2VB6A 2IA2A 3R0JA 1P9QC 1K79A 1QHGA 1ON1A 2GXAA 1OCTC 3ESWB 2IPQX 2Q1ZB 1U9NA 1LEBA 2CG4A 3ERMA 3HG9A 4HQMA 4OIOF 2XV4S 2BVMA 2KRCA 1KGSA 1EV7A 2COBA 4KIFA 2LKXA 1XSXA 2KDOA 1I5ZA 5DUIA 2R93J 1WCMJ 1I3QJ 2A6EF 2OF7A 3DU5A 1IO2A 5D8LB 4R79A 2Z16A 1ITYA 1YO5C 1OLTA 1TQIA 4HV5A 2P7VB 1IZ1A 2MC4A 4A3KJ 4RDUA 4M9SA 1MKMA 1RUNA 2FBHA 3C1DA 5CJ9A 5FFXA 2NVXJ 3FXQA 2X9DA 3IH4A 1XDSA 2J5OA 3ISPA 3OYNA 2QKMB 1XS9A 3S2DJ 5C4XJ 5IP9J 3CJRB 3Q3SA 2M0CA 3EUHC 1Z6TA 4Z2YA 3TOAA 3WTWC 5LD2C 1JE8A 3SXYA 1D0YA 4A5MA 4B3AA 2EBIA 3IH2A 3HBLA 2KRFA 4EVIA 2CUJA 4IHXA 2BE5F 4P1WA 1ACIA 4RLQA 3ZMVA 2X85A 4WWCA 3A01A 3WGIA 3PL8A 3AG3H 4BXFA 3WHBA 3H5NA 1S5LC 4CICA 3CUOA 3CP2A 2IGKA 2ACJA 3HDDA 5J4VA 1FIPA 1I3AA 5L3CA 1O7FA 3K4BA 4JP0A 2DOFA 2YUSA 4XLHA 4EGZA 2DXIA 1ERDA 2D2WA 1YIOA 4BUPA 2CV1A 4RAGA 1TWGJ 4FT8A 2EFPA 1R22A 2EFOA 5J4YA 1SD4A 1USSA 2ZMEB 2VOPA 3GTGJ 2CQ7A 4AVPA 3OL4A 5E18F 1Z7UA 2GIZA 2VKHA 5F0FA 1IN8A 2ZNZA 2STWA 3P9CA 5LGUA 5F08A 2CUFA 3GZNB 2IS6A 2CW0F 3FK7A 2E36A 2Y30A 1O7LA 2G7HA 1VF9A 1MSFC 3I59B 3RKWA 2ZXIA 3JTGA 1IDYA 2E7XA 2X4HA 1FIAA 3HSEA 3VODA 2DO7A 3OR2C 2DK8A 2VQGA 1BC7C 1HA8A 3HSFA 5DEQA 2LBFA 1B9MA 2HKXA 3FX3A 3JRHA 3CESA 3K7AJ 2V6CA 5M5WJ 2G0EA 3GF2A 1K78B 3I53A 5LRSA 1MBGA 1U5TA 1BOBA 1NTCA 1TW2A 3AG4H 3HEFA 3HGYA 5E3OA 2QQ8A 2A3SA 3TEDA 3BCBA 5A2QK 4Y52J 1FEXA 1Y39A 3HL2A 2PMZN 2W00A 5EYRA 4G6DA 1MNMC 1YOVB 2VT3A 3NAUA 2R7DA 2IVMA 3VWBA 4RGUA 3S14J 3KYLA 5CQGA 5GPCA 3W6VA 1D8JA 3OYGA 4RB3C 1E2XA 2WB1A 1T95A 1BJAA 3WTYC 1MNEA 2CFOA 2L7ZA 2JRMA 5HDKA 2JSCA 2O8XA 4CCOA 2L5QA 5HNHA 3H3VK 4KICA 4E7IA 5JHFA 2CSOA 2WAFA 3FXJA 2GA2A 3JR9A 2CV2A 2QBYB 4DJAA 5BMZA 3CQZJ 4AIKA 2QCOA 5GAEJ 1P4WA 5EEAA 1OCCH 3E7LA 1Q1HA 4BJ5C 2VJ4A 4XKWA 3F23A 1IC8A 4MQVA 3VEPA 5J1RA 3H9JA 1XSVA 1APLC 1IRZA 3F8MA 2RKHA 2JVGA 3FMRA 5F1RA 2JMWA 3GO5A 5CVJA 2ICWG 1OQYA 3H92A 3TP3A 1LKXA 2XRLA 1R71A 2NXNB 4D7NA 4BDZA 2XIGA 2L3DA 3E6DA 3HXLA 4QWQA 3I56I 4D7MA 3GTMJ 4G7HF 1ZTRA 2KHMA 3WGGA 4U7BA 3T1BA 1TWFJ 2HOSA 1ZKGA 5FO5A 1NK3P 2LG4A 1BBYA 3TDZC 3MAJA 3WE3A 3FKIJ 3BR5A 4W1UA 1GVDA 3I5UA 3M8FA 2QVOA 1B1BA 2IRFG 3K1PA 4HNUA 3DPTA 5KHDA 5M5YJ 1WI9A 4RAZA 3IRRA 2YX4A 3IC7A 3B73A 3FXRA 2LMDA 3IH3A 2HFHA 3QP5A 4B44A 2Q8KA 2DA1A 2VPRA 2NRAC 1W5CC 4M9ZA 3IUOA 2VBZA 2E7WA 3HTUA 2V1XA 5E3LA 2MH2A 2QQAA 3OYAA 9ANTA 1S72I 2QM3A 2E5ZA 5DTDA 5C3EJ 3PSIA 5KNLA 2FNPA 2RREA 1EH8A 3OIQA 3PO3J 3WU2C 2FX0A 2HWVA 5ED4A 5BPDA 2AS5F 2PJPA 2FU4A 1SFOJ 2VXDA 2DQLA 2M45A 3HPGA 1Y0NA 4NQWB 1JXSA 3PFIA 2LK2A 1BR2A 1KQ8A 3I71A 5M3MJ 2R7OA 4C3JJ 4RLFA 5JVTA 4XL9A 4LLGF 3L2RA 2EWNA 2GOXB 4AUXA 4IEJA 3COAC 2ISYA 2AXLA 2CYYA 4P5OA 5HVQC 2LNBA 1FZPB 1ETKA 1UHMA 2LD5A 1WRJA 2MC3A 2BY2A 1LFUP 2FBIA 2HYFA 2ECCA 2ZSIB 1BA5A 2P0WA 4RGRA 2ZFUA 3EETA 3F8NA 2LY1A 2DJIA 5EEHA 4CYDA 1V5FA 2X1DA 2OBPA 3BZ6A 2KDZA 3DTKA 2E71A 2BY1A 3ONQA 4UUVA 4XMYA 3LA7A 3F8FA 2R7SA 4F3QA 5ILUA 4C2UA 2IP2A 1T39A 3DKXA 3WHCA 2OC6A 1F36A 1O3QA 4G12A 2P81A 2DOEA 5FGMA 1LUJB 3Q9SA 2V7FA 2XASA 2JPBA 3V8JA 1MZBA 5EG0B 1S8NA 3W6JB 3RPUA 3K4CA 2V1NA 2GM4A 2EA2A 2YR2A 1D3YA 2V26A 1Z7LA 2DK5A 1SMYF 2ECBA 3PSFA 3LMMA 3BJAA 5JFRA 2CV0A 2QEXI 3CDIA 1MNDA 3F8BA 3MZHA 2NS7A 5HLIA 2EFQA 1A5JA 2HXIA 2L0KA 3K4JA 3QOPA 5M5XJ 1F4KA 3KYDB 2CGPA 2H1KA 2CS3A 5DYMA 3HOUJ 1X1BA 2DYSH 2I8DA 2V1UA 2E35A 3KETA 1D1AA 3E6CC 1X58A 4UUTA 1EH6A 3J80K 1ZN2A 2ZCWA 4LLLA 3H9QA 5DM6F 3R61A 2F48A 3LSKA 3CZ6A 1G4DA 4LOCA 4DZJA 1ZQ3P 2DMTA 3PQJA 1AU7A 4TV7A 4I99C 3RPQA 5DCMA 4B43A 4AVZA 3IAS2 4IPAA 1B72A 3HOZJ 5E20A 4J01A 2AO9A 2XB0X 4IVNA 1VQPI 2JA6J 4PGGA 2JWTA 4KMUX 5IT9Z 1UHWA 1ETOA 4F55A 2K3FA 2CJJA 2UV1A 1HW2A 3PO2J 1SVOA 4XKVA 2HQAA 1FP2A 1G2HA 2F4IA 2F5VA 2M5WA 2KISA 3S2WA 3CCYA 4EJTA 2K02A 5F64A 1M1EB 4B09A 3FZVA 1TQPA 1H88C 3GMEA 1NG7A 3H0GJ 3KCCA 3K4LA 3MWMA 1BR1A 2BGCA 3HJEA 3S32A 2DQRA 2M34A 4X6AJ 1DP3A 3GLXA 4HSTA 2JJ7A 4HPQA 4RM3A 1BC8C 1R5HA 4XOTA 1S7OA 5GAGJ 1A35A 2DPUA 4ZDPA 1AA7A 4H4KC 2VE9A 2OCCH 2EPFA 3WTXC 1T2KA 5D5WB 3HPHA 1RRJA 2Y75A 2XHKA 2R5ZB 3QPHA 2HNHA 3OMYA 2MLKA 2K9QA 3TBIA 4FCYA 4MNUA 1JHFA 2HQNA 2L9SA 4YIIA 1RI7A 2R0QC 3OYIA 5ICCA 2P5KA 4BQAA 1WZ2A 2H94A 2LP0A 3G71I 1VQMI 4XLCA 4QPQA 5CVUA 3IAM2 3ZRGA 1BIBA 5HDGA 1XN7A 5DS9A 3S15J 2MW8A 5CVIA 4A3JJ 4F52A 5J40A 4W97A 1ETWA 1D0XA 3QPTA 3S1NJ 4OAYA 2HZDA 1DP7P 3CMAI 2G7UA 5FLMJ 2DMQA 4ZTJA 1IUFA 1HF0A 4C2TA 2PX9A 2QQ9A 4AYBN 2HYGD 2DYRH 1GXQA 2H8RA 1ZGJA 2JZYA 2L7FP 2E1CA 5ICFA 2XGXA 4FX4A 4X0GA 2NOGA 2XGEA 4FISA 3VYRB 1G8XA 5FRNA 1ZG3A 2DA6A 3MKWB 1LJ9A 1GUUA 3LSIA 4ZYDA 4UV9A 2K27A 3D1NI 2F5FA 2GXGA 3U2RA 4NHJA 3VPRA 2GOMA 3I55I 4X1EA 1FSHA 1RKTA 1I1GA 2PMZA 5ERIA 3LSGA 3W2WA 1PVEA 2B0LA 2BYVE 1SD5A 1YIJI 1FYKA 2ZJQF 4P96A 3HOTA 4BJTA 2KLOA 4GXOA 3U9GA 4J19A 2OTLI 4BNCA 1DUXC 1ZRDA 3BDDA 4NC8A 4F91B 1J7KA 2EZKA 4PFPA 2YX7A 4OIPF 1UELB 3BG3A 4XN0A 3L2QA 1X3WB 5K5QA 3AG1H 2QGUA 4ABZA 3QWLA 1MMDA 4A3BJ 2OAZA 3JSOA 1YS7A 3WTUC 1IXSB 5DD8A 1GDTA 1HW1A 3WG7H 3AFHA 4PGHA 2VI6A 3TMOA 3OYFA 3LSJA 3OS2A 3E6BA 2ZFWA 1JTXA 4L9JA 3T8RA 1GV2A 4L0YB 3SYTA 4D1QA 3I58A 4PDKA 2IGNA 3CCSI 4V2GA 2F5CA 2O0YA 2JK3A 3TO6A 1GHCA 1ENHA 4Y3OA 2EA4A 5D6FA 5JR3A 5HDNA 2EV6A 1XC5A 1JGSA 3CUQB 4GFBA 4LD5A 1B59A 2P4WA 4BACA 2OJED 2PJRA 1TL8A 4B1RA 2XPVA 4RBOA 3MN2A 2WV1A 5LBQA 4ITVA 1HOMA 4LG0B 5K5RA 5CPRB 2E2HJ 4UUSB 2BBYA 4CZZA 4HEA2 1R1UA 5ICGA 3RYPA 1QZEA 2PEXA 3R0AA 4II2A 5EF6A 4AIDA 4GCVA 4NUBA 1U3EM 3CCEI 5L3GA 2VONA 3J7AO 3A0BC 4K2EA 4G94A 1BW6A 3RTRA 3WTVC 3GFJA 1YRNA 2DODA 3KP2A 3DF8A 2KMUA 4CSWA 1MIJA 2W7NA 1UMQA 3WU1B 3A1YA 1FSEA 2V9KA 2MD0A 1SD7A 1PP8F 1DGWY 1QU3A 2KPMA 2LDUA 5LGNA 2HVSA 3ZMZA 4IOCF 4ZZLA 1ZLJA 2LOOA 1YX5A 2MABA 4D0PA 2PBIA 5F04A 3VB2A 4QIWN 4UB6C 3OOUA 3FBIB 4PSWA 3FM3A 2FQ3A 3LAPA 1JTYA 4HNVA 3T8TA 2VODA 2BEOA 1WJFA 2H8WA 5FLXZ 2X1CA 1RPWA 1X1PA 4FTHA 1V55H 2DFFA 2PN6A 1CQTA 2V6EA 1KYZA 2KJBA 4U0WA 3OYKA 1T8IA 4U0VA 3DV8A 2E19A 2LH9A 1VQOI 5IYBJ 1WJEA 1FP1D 5GTHC 1IUYA 3F8CA 1EJ9A 2LLKA 4IOAF 1S7EA 2QQBA 2Q2EB 2V1DA 3OV8A 4I2OA 5K1YA 3SFIA 2EQRA 1K83J 2R5YA 2IGOA 2LRDA 2UUZA 1OJLA 3BQZA 2WA0A 4Q47A 2H1LA 5HLHA 2P6TA 1R49A 2HXOA 2F2EA 4EATA 4A3CJ 2ZMEC 4A2UA 2Y0MA 4BS9A 1VQ4I 4MLOA 4XSZF 4MGRA 4UHTA 1U5TC 3K1MA 5GAHJ 3GTJJ 1B9NA 1BN5A 1MDMA 4DQ2A 1UCRA 1HDDC 3DEEA 3FHZA 2OTJI 1NHAA 2VJ5A 1IN5A 3Q0UA 4ESJA 1A04A 2JA7J 2K3PA 5BQTA 5HS9A 1RC9A 4JYKA 4DIQA 2CO5A 2DI3A 5CQEA 1X4OA 1X2MA 4G7ZF 2EB7A 1QBJA 2DA3A 2L2OA 3H0DA 3DU6A 2K9MA 2BHYA 1IG7A 3IWFA 3JRCA 2ELKA 3LFUA 1LVKA 1IF1A 3DQVC 2L02A 5GP9A 2B63J 4O6JA 1LNWA 2W25A 1MH3A 3A01B 3LNQA 2OQGA 1G3WA 2W1OA 4KT5C 2O61A 1XGMA 1GT0C 3I4MJ 3QPSA 3V4GA 2DLLA 2XF6A 5L3FA 3CJQB 4LK0F 1R4NB 5L3EA 2M4GA 1BJZA 4KUMA 2L01A 4YELA 2QKLB 1T0FA 1U8RA 2MFZA 3BZKA 3D5LA 3WE2A 4YFNF 1YW7A 4JBAA 3ZCOA 3BJOA 2C6YA 3SDBA 1STZA 3J81K 2DMUA 2Y69H 3CMMA 1BOAA 5EZHA 3TO7A 3ASOH 1MBHA 1ZR2A 2ZSHB 1HKQA 1TWCJ 2M87A 2WTEA 3DCFA 3F22A 2HS5A 2CFXA 3FMSA 3ZQLA 2E5NA 2E1MC 1IRGA 2RN7A 2EFNA 3VYTB 1LEAA 3BC8A 3VFZA 4YIRX 2ID6A 1JUMA 2MGQA 2AXTC 5DV5A 2LBFB 3HGGA 3L7WA 3Q0WA 4AU7A 1ZK8A 4EV0A 3DEWA 1D1CA 3MD2A 4BY7J 1G3YA 1NG6A 5E3MA 4CXFA 2STTA 1U5TB 3F21A 1X3UA 3U1KA 5LEJA 3ZMUA 1PUEE 3VYSB 2QWWA 3E3VA 1R7JA 2ZJPF 2WY8Q 3KEOA 2ETHA 2W57A 5E3NA 3TGNA 1W5SA 1WFXA 1JUPA 5EJCA 5E8GA 5H20A 2ZKZA 3HRMA 2QF7A 4D9JA 1OYIA 2L7KA 2Y0SN 1WJAA 4DYRA 3RCOA 1KA8A 4I09A 2ME0A 3EQLF 3BR2A 1X19A 3PNTA 2KZVA 2GZWA 3H3ZA 4UB8C 1SVMA 5F0HA 2XROA 4BGDA 1HSJA 4HV6A 4IZZA 3X2QH 4HF2A 3WTSC 4B8XA 1S29A 5B66C 2O6GE 2GA1A 3V42A 3CCVI 2CQKA 5DDGA 2H6BA 3M07A 4AYBA 2E2JJ 4UVAA 3CJNA 4KJZA 4DBQA 5FD5A 2JVHA 2DA5A 1DGRM 1Y0UA 4B3XA 3LSPA 4PZJA 2K9SA 3ELKA 2XAFA 2K9NA 3EUKL 1YHQI 1N78A 1BI0A 3O3KA 2M0MA 4JX6A 3J7AY 4M3BA 2HDWA 3AL0B 2FQ4A 1DPUA 3C2HA 3KP4A 3J81Z 3HRTA 3G2BA 1P4XA 1YYVA 1FBUA 1V54H 2YSRA 2DPDA 3S3OA 3JTHA 4XLNF 3WU0A 4BU2A 2Z1DA 1TT5B 5J1YA 4KA4A 3ZQ7A 3CF2A 2E1MB 1HXDA 2FUG2 3RZDJ 3K69A 3BOQA 1Z1DA 1TTYA 2XPWA 1FNNA 3RQ4A 1MH4A 3E5QA 3CCLI 3NRVA 1LVAA 2VOOA 4HSRA 2ZJRF 4ZYHA 1FOKA 3ZQHA 1MBFA 2DDAA 3LL7A 4A69C 3BT9A 1LPQA 3DLLF 3V7CA 5B5EC 2CQXA 3OYMA 3KEQA 2V79A 3EUHA 4MFDA 1JJ8C 2A61A 4LMYA 2OZ6A 1IXRC 1FMWA 1U2WA 3ROUA 3E97A 4RS8A 5KVRA 4XLFA 1XMXA 2X1EA 3GW2A 1JKRC 2EV0A 2VXZA 5IP7J 3REOA 5K7FA 3C3WA 4ZYGA 3QP6A
chains in the Genus database with same CATH topology
5FFZA 4M6XA 4O5VA 5A2QZ 5CVRA 1SAXA 2F5DA 4HF0A 1FYMA 4AIJA 5AIPA 1XGOA 3M9AA 2M1BA 5BS6A 1QZZA 1J59A 2VBYA 1O3SA 1SFEA 4L0ZB 4ZH4F 2A5YB 1YW8A 3GYHX 1YG2A 4M9XA 4S05A 1J9IA 1WKMA 4HA8A 5JHUA 3LWFA 1YLFA 3DEUA 4L18B 4L9NA 1R58A 1JHHA 1G6NA 4G7OF 2ELHA 4I0AA 4A5NA 3Q9VA 4WK8F 1I1SA 2QLZA 3H3UA 1ZLKA 3ECHA 2PQ8A 4KYWA 1GXPA 5DCMB 3HYIA 4JQFA 5CLSA 2KIUA 1XCVA 2DFIA 2IW5A 3RDIA 3FM5A 1HQCA 4HBLA 4A0ZA 4L5JA 4L9TA 5TRDA 6PAXA 1KYWA 4A12A 3KLOA 5JI6A 1LQ1A 4ON0A 4EQQA 3RIRA 1C0WA 2JRTA 3DFGA 3T0YA 1Z91A 2MLGA 1HKTA 1QPMA 1W5TA 2FNAA 3IHUA 4MTDA 4MEXF 1QGPA 4HX8A 1MJAA 3DKWA 1ZG1A 2VBXA 2KJCA 5BPIA 1U6GA 3GFIA 2RNJA 2UZKA 3PQKA 4IF4A 1F9NA 3MEXA 2XVCA 3F72A 3FMQA 4KNYA 3C18A 4EJUA 2XAJA 5D5VB 2DBBA 2A6HF 2EFWA 2PMUA 2GWRA 5AIQA 2PFBA 3V8KA 4E70A 2XAHA 2ZXJA 1CF7B 2LKPA 4OOIA 2D1VA 2HDCA 4A6EA 1OYYA 3TKYA 1QZYA 1ZAOA 4ENKA 1BIAA 1IRFA 4EJVA 2Y48A 4BH9A 2YPRA 2ESHA 3ZMSA 1UFMA 1OR7A 1T38A 3CUQC 3HRUA 1P92A 4LK1F 3HHHA 1Z05A 3J80Z 1CF7A 5J8CA 1Z9CA 4BAYA 1W4MA 1XD7A 2MD5A 1SFUA 1FC3A 4UVBA 2Z5UA 5L3DA 4EM1A 1DDNA 1HBXG 1V4RA 1XMKA 3M7GA 1D8KA 1ZHFA 2JPCA 3HIFA 2NYXA 4Y15A 1R1TA 2NNNA 4I02A 1WWXA 4HQEA 3ZMTA 4ASNA 4ENNA 4DNCA 4HW0A 3ZPLA 2LF8A 1MGTA 1ZRCA 1D5VA 4M71A 4IHTA 2FBKA 3KFWX 3TO9A 3SZPA 2JTVA 5BOXA 3I54A 2P5LC 1HKSA 1PP7U 2L54A 4G9YA 1ULYA 3RKYA 2Z9OA 1I6XA 4BYYA 4XBFA 2GAUA 2UWMA 4IRIA 3CLOA 2Z99A 4UXNA 2K4JA 1XMAA 2PLYA 4LLNA 1HSTA 2RGVA 3D0SA 3MCZA 3I4PA 3RYRA 4HAMA 5IT3A 5D5UB 3QAHA 4N9HA 4MHGA 3ZP5A 3ZMDA 1O3RA 3K1NA 4M6YA 1T98A 3ECOA 4WX9A 1GVJA 4LJZF 4IRHA 1I27A 1YS6A 4Y17A 4ESBA 4RGSA 2RDPA 3G73A 5H6RA 1KU9A 4EM0B 2FMYA 3BPVA 3I0TA 4ENJA 4UNOA 3L9FA 4RGXA 4IJAA 1H9TA 4Q5SF 1SMTA 3ABTA 4BXUA 3B02A 4LB6B 4XRFA 3FF5A 1MDMB 3RKXA 3CDHA 1R23A 3SQNA 5HS8A 2FE3A 4N0BA 3LFKA 1HW5A 1K6OA 1PDNC 4A6DA 1WQ2A 3L09A 1W7PA 2P5VA 1G3TA 5ILSA 4H0EA 2MH9A 5F6FA 3R60A 5FB2A 1AWCA 5D6EA 1RNLA 4OIQF 3E6MA 4I98B 1TBXA 1WSUA 1LDDA 2E1NA 4L5IA 4KIBA 4GYIA 4EJWA 1TNTA 2H09A 3HSRA 1KU7A 4M72A 4OU0A 4Q48A 1S7AA 2OA4A 2RV8A 5ILVA 3SHFA 4RB1A 2J5PA 3R4KA 4YFXF 3ULQB 4HOBA 4IHSA 3BY6A 2VE8A 1ON2A 1FLIA 2XKPA 3I64A 2ZBKA 3F6VA 3HUGA 3MQ0A 4MEYF 2OD5A 2W84A 2XAQA 3M1EA 2DTRA 1XB4A 2HTJA 3Q5FA 2R7FA 4O3MA 3GZ6A 2HKOA 2QUFA 3WTTC 1B6AA 4YIFA 2HEOA 3KZYA 3KLNA 2QZ8A 1FBQA 3ML6A 2LSOA 4CHUA 4HLYA 1XCBA 2KKOA 2IT0A 3T5XA 4I01A 2ZO4A 1OPCA 1R36A 3EDPA 3LAJA 1QO0D 4R1HA 3JW4A 1BI1A 4KIGA 5J8FA 2OQRA 2DT5A 3GZ5A 5LHHA 2IA0A 4KMFA 2HZTA 4ZZDA 1F5TA 2M8EA 1RUOA 4Q4ZF 2UXNA 2PMHA 2JT1A 1AOYA 1O3TA 2P6SA 1IXCA 2HOEA 2WWYA 3NEUA 3LSTA 3WODF 1G3SA 4HYEA 2GIVA 3CTAA 2FRHA 2F5EA 2FMLA 2EJRA 3LA3A 1KQ0A 1IN6A 2ESNA 1VTNC 4HF1A 2VT2A 2KIFA 4AD9A 2VBWA 5L3BA 2ZMEA 1Z6RA 3BJ6A 4LGWA 2W24A 2CWEA 3BWGA 1IAWA 2YU3A 3TQNA 1J75A 2HTSA 5LRRA 3W6KB 1ZRFA 3U1DA 2UXXA 5E1WA 3I59A 3V7SA 3CO7C 4I0BA 5HLGA 2ISZA 3ZN1A 2L4MA 1XGNA 3EYYA 3O2PE 2TDXA 1K78A 5LLQA 2O3FA 2QENA 4P9FA 3GFMA 1OYWA 3ZN0A 3GWZA 3V8LA 3WG9A 4EJOA 3DXJF 4UVCA 2K86A 4N9IA 2P8TA 1FY7A 5D8KB 1QNTA 1LB2A 4OMZA 4FX0A 1P2FA 3CO6C 2VN2A 4BHPA 2QBYA 2FA5A 5LEKA 2RC4A 4U0YA 4RAYA 2K4BA 2LF7A 3G3ZA 2EV5A 3GEZA 1H9GA 2FF4A 3FXUA 3IL2A 2RVCA 1SD6A 1U78A 1KQ9A 5CVVA 5D4RA 4HLXA 2EK5A 4JK1X 2OU2A 4OINF 1L3LA 2ADUA 4BHCA 4KFCA 4RB2C 3LA2A 4XLPF 4WF2A 3P7NA 3KP5A 2XRNA 2G9WA 3DPLC 1IN7A 2DAOA 5D4SA 4I7HA 4EM2A 5J6XA 2NNYA 3KP7A 4LB5A 2HR3A 2GQQA 3KE2A 3KP6A 1P4AA 3C7JA 3QRFF 4AWXB 5IT9K 3FWEA 4WXHA 4FHTA 4NQWA 4IRGA 4HZFA 4P9UA 3E5UA 2MA3A 4CDGA 1S6LA 3RJPA 1L0OC 4XSXF 4ESFA 2Q0OA 3IKVA 2IJLA 2H6CA 2ZJ2A 2FSWA 1RZ4A 1BI3A 3LQQA 4BHBA 3IKTA 4U88A 3SZTA 3RI4A 3OOPA 2QYOA 1EH7A 3GUDA 2VC1A 4R8HA 5AONA 4GYGA 4A0XA 1FX7A 5H6QA 1FT9A 4ZYEA 4QLCU 2A69F 3AAFA 1MJBA 2HGCA 1CGPA 4G6QA 1ZARA 3P9IA 5DCFA 3TDUC 2FEZA 3F3XA 2XKOA 2X0LA 3GFLA 3DP7A 2IA1A 1TNSA 1R00A 2O03A 1YW9A 2XUBA 2M30A 4MQ9F 5EEGA 3WGHA 3ERED 1E17A 1DPRA 1XDUA 4IXAA 1B4AA 4Y13A 4M74A 1LDKB 2L4AA 1F1ZA 2WV0A 1T6SA 2HQRA 3N4MA 3LQRA 4U7DA 2NS0A 3KP3A 4CO8A 1FWZA 3L2CA 4KN4X 1V3FA 5DUKA 4M73A 2XAGA 3M8EA 3BROA 4WXDA 4RB0A 4HX7A 3SFZA 3N97A 3BP8A 3JSPA 3K0LA 4S04A 2A68F 4YFKF 2K7LA 4NB5A 4OIRF 5E1XA 4A0YA 5FD6A 3P9KA 4CGZA 1O57A 4L9VA 5CYVA 5E17F 3MFKA 2Z3YA 1MJ9A 5KK1A 4HDUA 4AIHA 1ZG5A 1J5YA 1SFXA 1BI2A 2PI0A 2W85A 3HHGA 1TLHB 3E5XA 1S3JA 4MTEA 3TOBA 4WCGA 2GXBA 5D5XB 4OMYA 4ENMA 5FLXK 3WTZA 4UV8A 1XSDA 1IN4A 3NQOA 2Z33A 3JAMK 1FPQA 1R5GA 3QU3A 1QQIA 3L00A 1MD0A 3HOSA 1R1VA 4KDPA 2BV6A 1H0MA 1IW7F 3GX4X 4EGYA 2ZNYA 1OKRA 1BM9A 1ZH5A 4LFUA 2R3SA 1K7AA 2D1HA 2V9VA 3EYIA 4G8XA 4WXCA 4F7ZA 3BPXA 5TJJA 4ETSA 4GO1A 2FOKA 2WC2A 1OMIA 4HX4A 3MZYA 3QU6A 3CUQA 2A07F 2FXAA 3KZZA 2VC0A 1W7PB 2RQPA 4LG0A 2PG4A 3GVAA 1XGSA 4GGGA 5K5OA 5ICEA 1YFHA 1USTA 1REPC 4KN7X 5DD4A 1TW3A 5HOOA 1TQMA 5HS7A 1J2XA 3V7RA 3K9TA 1J0RA 1RIOH 2DU9A 1ONVA 1YQAA 2DW4A 5LGTA 5E8IA 1ZYRF 1FBSA 3JAMZ 1ODDA 3R6SA 5E1ZB 4PCQA 2H27A 4HDVA 1KU3A 1W7PD 3HRSA 2COMA 1ZGAA 2OZUA 3VOEA 1LDJA 4EMSA 1ZREA 3ABUA 2KIMA 1FYLA 2MBFA 2D45A 3HTSB 3K2ZA 2NAZA 1YTYA 3F6OA 2P7CB 5LHGA 4YG2F 1KU2A 3O6BB 1P6RA 4P55A 1UB9A 3GXOA 3IRQA 3IWZA 5LHIA 2Q2EA 2IA2A 3R0JA 1K79A 1ON1A 2IPQX 1LEBA 2CG4A 4HQMA 4OIOF 2XV4S 1KGSA 1EV7A 4KIFA 1XSXA 1I5ZA 5DUIA 2A6EF 5D8LB 4R79A 1YO5C 1TQIA 4HV5A 2P7VB 1IZ1A 4M9SA 1MKMA 1RUNA 2FBHA 3C1DA 5CJ9A 5FFXA 3FXQA 3ISPA 1XDSA 2J5OA 1Z6TA 4Z2YA 3TOAA 3WTWC 1JE8A 3SXYA 4A5MA 2KRFA 4EVIA 2BE5F 3ZMVA 4WWCA 3WGIA 4CICA 3CUOA 2ACJA 5L3CA 1O7FA 4EGZA 2D2WA 1YIOA 4FT8A 2EFPA 1R22A 2EFOA 1SD4A 1USSA 2ZMEB 2VOPA 4AVPA 5E18F 1Z7UA 1IN8A 2ZNZA 2STWA 3P9CA 5LGUA 2CW0F 1O7LA 2G7HA 3I59B 3RKWA 3JTGA 2E7XA 2X4HA 3HSEA 3VODA 2DO7A 2DK8A 1BC7C 3HSFA 5DEQA 1B9MA 2HKXA 3FX3A 2V6CA 3GF2A 1K78B 3I53A 5LRSA 1U5TA 1TW2A 2A3SA 5A2QK 4G6DA 2VT3A 2R7DA 2IVMA 4RGUA 1D8JA 4RB3C 1E2XA 1BJAA 3WTYC 5HDKA 2JSCA 2O8XA 4KICA 2CSOA 2GA2A 2QBYB 5BMZA 4AIKA 1P4WA 1Q1HA 3F23A 4MQVA 3VEPA 1XSVA 3F8MA 2RKHA 5F1RA 3FMRA 3GO5A 5CVJA 3H92A 2XIGA 2L3DA 3E6DA 4QWQA 4G7HF 3WGGA 4U7BA 3T1BA 5FO5A 1BBYA 3TDZC 3MAJA 3WE3A 3I5UA 3M8FA 2QVOA 1B1BA 2IRFG 3K1PA 3DPTA 3IRRA 1WI9A 4RAZA 2YX4A 3IC7A 3B73A 3FXRA 3QP5A 2HFHA 2Q8KA 2NRAC 4M9ZA 2VBZA 2E7WA 3HTUA 2V1XA 2MH2A 2QQAA 2QM3A 2FNPA 1EH8A 5BPDA 2HWVA 5ED4A 2AS5F 2PJPA 2FU4A 2DQLA 2M45A 1JXSA 3PFIA 1KQ8A 3I71A 5JVTA 4LLGF 2EWNA 3COAC 2ISYA 2AXLA 2CYYA 4P5OA 5HVQC 2LNBA 1FZPB 1UHMA 1WRJA 2MC3A 2FBIA 2HYFA 4RGRA 3EETA 3F8NA 5EEHA 4CYDA 2OBPA 3BZ6A 4UUVA 3LA7A 3F8FA 5ILUA 2IP2A 1T39A 1O3QA 5FGMA 3Q9SA 2XASA 2JPBA 3V8JA 1MZBA 1S8NA 3W6JB 3RPUA 2EA2A 2YR2A 1D3YA 2DK5A 1SMYF 5JFRA 3BJAA 3F8BA 3MZHA 5HLIA 2EFQA 3QOPA 1F4KA 2CGPA 5DYMA 2V1UA 3KETA 3E6CC 1EH6A 3J80K 1ZN2A 2ZCWA 4LLLA 3R61A 1G4DA 3PQJA 4TV7A 3RPQA 5DCMA 4IPAA 5E20A 4IVNA 4PGGA 4KMUX 5IT9Z 1UHWA 1HW2A 1FP2A 2M5WA 3S2WA 4EJTA 2K02A 5F64A 4B09A 3FZVA 1TQPA 3KCCA 3MWMA 2BGCA 2DQRA 3GLXA 1BC8C 1R5HA 1S7OA 2DPUA 2VE9A 3WTXC 1T2KA 5D5WB 2Y75A 2XHKA 3QPHA 2MLKA 4MNUA 1JHFA 2HQNA 4YIIA 1RI7A 5ICCA 2P5KA 4BQAA 2H94A 5CVUA 1BIBA 5HDGA 1XN7A 5CVIA 3QPTA 1DP7P 2G7UA 2QQ9A 2HYGD 1GXQA 1ZGJA 2JZYA 2E1CA 5ICFA 2XGXA 4FX4A 1ZG3A 1LJ9A 4ZYDA 4UV9A 2K27A 2F5FA 2GXGA 3U2RA 4NHJA 1FSHA 1I1GA 5ERIA 2B0LA 2BYVE 1SD5A 1FYKA 4P96A 3HOTA 4BNCA 4GXOA 3U9GA 1DUXC 1ZRDA 3BDDA 1J7KA 2YX7A 4OIPF 5K5QA 2OAZA 3JSOA 1YS7A 3WTUC 1IXSB 5DD8A 1HW1A 4PGHA 3E6BA 2ZFWA 4L9JA 3T8RA 4L0YB 3I58A 4PDKA 2F5CA 2O0YA 3TO6A 1GHCA 2EA4A 5D6FA 5JR3A 5HDNA 2EV6A 1JGSA 3CUQB 4LD5A 1B59A 2P4WA 5LBQA 4LG0B 5K5RA 2BBYA 4CZZA 1R1UA 5ICGA 3RYPA 3R0AA 2PEXA 4GCVA 1U3EM 5L3GA 2VONA 3J7AO 4K2EA 4G94A 3RTRA 3WTVC 3GFJA 3KP2A 3DF8A 3WU1B 1FSEA 1SD7A 1PP8F 5LGNA 2LDUA 3ZMZA 4ZZLA 1ZLJA 4D0PA 2PBIA 3VB2A 3FM3A 2FQ3A 3LAPA 3T8TA 2VODA 2BEOA 5FLXZ 2PN6A 1KYZA 2KJBA 4U0WA 4U0VA 3DV8A 1FP1D 1IUYA 3F8CA 2QQBA 2V1DA 3OV8A 4I2OA 5K1YA 4Q47A 5HLHA 2P6TA 2F2EA 4A2UA 2Y0MA 4XSZF 4MGRA 4UHTA 1U5TC 3K1MA 1B9NA 1BN5A 1MDMA 4DQ2A 1UCRA 3FHZA 1NHAA 1IN5A 4ESJA 1A04A 5BQTA 5HS9A 2CO5A 2DI3A 4G7ZF 2EB7A 1QBJA 3IWFA 1IF1A 3DQVC 2L02A 4O6JA 1LNWA 2W25A 2OQGA 1G3WA 2O61A 4KT5C 1XGMA 3V4GA 2DLLA 5L3FA 4LK0F 5L3EA 4KUMA 2L01A 1T0FA 1U8RA 3D5LA 3WE2A 4YFNF 1YW7A 4JBAA 3BJOA 2C6YA 1STZA 3J81K 1BOAA 3TO7A 1HKQA 2M87A 2WTEA 3F22A 2HS5A 2CFXA 3FMSA 1IRGA 2RN7A 2EFNA 1LEAA 3VFZA 5DV5A 3L7WA 4EV0A 1G3YA 4CXFA 2STTA 1U5TB 3F21A 1X3UA 5LEJA 3ZMUA 1PUEE 2QWWA 3E3VA 1R7JA 3KEOA 2ETHA 2W57A 3TGNA 1W5SA 5E8GA 5H20A 2ZKZA 3HRMA 1OYIA 1KA8A 4I09A 3EQLF 3H3ZA 2GZWA 2XROA 1HSJA 4HV6A 4HF2A 3WTSC 4B8XA 1S29A 2O6GE 2GA1A 2CQKA 5DDGA 2H6BA 4UVAA 3CJNA 5FD5A 1Y0UA 4PZJA 3ELKA 2XAFA 1BI0A 3O3KA 1DPUA 3KP4A 3J81Z 3HRTA 1P4XA 1YYVA 1FBUA 2YSRA 2DPDA 3JTHA 4XLNF 3WU0A 4KA4A 3ZQ7A 1HXDA 3K69A 3BOQA 1Z1DA 1TTYA 1FNNA 3E5QA 3NRVA 1LVAA 2VOOA 4ZYHA 1FOKA 3V7CA 3KEQA 2V79A 3EUHA 2A61A 4LMYA 2OZ6A 1IXRC 1U2WA 3ROUA 3E97A 4RS8A 5KVRA 3GW2A 2EV0A 2VXZA 3REOA 3C3WA 4ZYGA 3QP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFZ A;  4M6X A;  4O5V A;  5A2Q Z;  5CVR A;  1SAX A;  2F5D A;  4HF0 A;  1FYM A;  4AIJ A;  5AIP A;  1XGO A;  3M9A A;  2M1B A;  5BS6 A;  1QZZ A;  1J59 A;  2VBY A;  1O3S A;  1SFE A;  4L0Z B;  4ZH4 F;  2A5Y B;  1YW8 A;  3GYH X;  1YG2 A;  4M9X A;  4S05 A;  1J9I A;  1WKM A;  4HA8 A;  5JHU A;  3LWF A;  1YLF A;  3DEU A;  4L18 B;  4L9N A;  1R58 A;  1JHH A;  1G6N A;  4G7O F;  2ELH A;  4I0A A;  4A5N A;  3Q9V A;  4WK8 F;  1I1S A;  2QLZ A;  3H3U A;  1ZLK A;  3ECH A;  2PQ8 A;  4KYW A;  1GXP A;  5DCM B;  3HYI A;  4JQF A;  5CLS A;  2KIU A;  1XCV A;  2DFI A;  2IW5 A;  3RDI A;  3FM5 A;  1HQC A;  4HBL A;  4A0Z A;  4L5J A;  4L9T A;  5TRD A;  6PAX A;  1KYW A;  4A12 A;  3KLO A;  5JI6 A;  1LQ1 A;  4ON0 A;  4EQQ A;  3RIR A;  1C0W A;  2JRT A;  3DFG A;  3T0Y A;  1Z91 A;  2MLG A;  1HKT A;  1QPM A;  1W5T A;  2FNA A;  3IHU A;  4MTD A;  4MEX F;  1QGP A;  4HX8 A;  1MJA A;  3DKW A;  1ZG1 A;  2VBX A;  2KJC A;  5BPI A;  1U6G A;  3GFI A;  2RNJ A;  2UZK A;  3PQK A;  4IF4 A;  1F9N A;  3MEX A;  2XVC A;  3F72 A;  3FMQ A;  4KNY A;  3C18 A;  4EJU A;  2XAJ A;  5D5V B;  2DBB A;  2A6H F;  2EFW A;  2PMU A;  2GWR A;  5AIQ A;  2PFB A;  3V8K A;  4E70 A;  2XAH A;  2ZXJ A;  1CF7 B;  2LKP A;  4OOI A;  2D1V A;  2HDC A;  4A6E A;  1OYY A;  3TKY A;  1QZY A;  1ZAO A;  4ENK A;  1BIA A;  1IRF A;  4EJV A;  2Y48 A;  4BH9 A;  2YPR A;  2ESH A;  3ZMS A;  1UFM A;  1OR7 A;  1T38 A;  3CUQ C;  3HRU A;  1P92 A;  4LK1 F;  3HHH A;  1Z05 A;  3J80 Z;  1CF7 A;  5J8C A;  1Z9C A;  4BAY A;  1W4M A;  1XD7 A;  2MD5 A;  1SFU A;  1FC3 A;  4UVB A;  2Z5U A;  5L3D A;  4EM1 A;  1DDN A;  1HBX G;  1V4R A;  1XMK A;  3M7G A;  1D8K A;  1ZHF A;  2JPC A;  3HIF A;  2NYX A;  4Y15 A;  1R1T A;  2NNN A;  4I02 A;  1WWX A;  4HQE A;  3ZMT A;  4ASN A;  4ENN A;  4DNC A;  4HW0 A;  3ZPL A;  2LF8 A;  1MGT A;  1ZRC A;  1D5V A;  4M71 A;  4IHT A;  2FBK A;  3KFW X;  3TO9 A;  3SZP A;  2JTV A;  5BOX A;  3I54 A;  2P5L C;  1HKS A;  1PP7 U;  2L54 A;  4G9Y A;  1ULY A;  3RKY A;  2Z9O A;  1I6X A;  4BYY A;  4XBF A;  2GAU A;  2UWM A;  4IRI A;  3CLO A;  2Z99 A;  4UXN A;  2K4J A;  1XMA A;  2PLY A;  4LLN A;  1HST A;  2RGV A;  3D0S A;  3MCZ A;  3I4P A;  3RYR A;  4HAM A;  5IT3 A;  5D5U B;  3QAH A;  4N9H A;  4MHG A;  3ZP5 A;  3ZMD A;  1O3R A;  3K1N A;  4M6Y A;  1T98 A;  3ECO A;  4WX9 A;  1GVJ A;  4LJZ F;  4IRH A;  1I27 A;  1YS6 A;  4Y17 A;  4ESB A;  4RGS A;  2RDP A;  3G73 A;  5H6R A;  1KU9 A;  4EM0 B;  2FMY A;  3BPV A;  3I0T A;  4ENJ A;  4UNO A;  3L9F A;  4RGX A;  4IJA A;  1H9T A;  4Q5S F;  1SMT A;  3ABT A;  4BXU A;  3B02 A;  4LB6 B;  4XRF A;  3FF5 A;  1MDM B;  3RKX A;  3CDH A;  1R23 A;  3SQN A;  5HS8 A;  2FE3 A;  4N0B A;  3LFK A;  1HW5 A;  1K6O A;  1PDN C;  4A6D A;  1WQ2 A;  3L09 A;  1W7P A;  2P5V A;  1G3T A;  5ILS A;  4H0E A;  2MH9 A;  5F6F A;  3R60 A;  5FB2 A;  1AWC A;  5D6E A;  1RNL A;  4OIQ F;  3E6M A;  4I98 B;  1TBX A;  1WSU A;  1LDD A;  2E1N A;  4L5I A;  4KIB A;  4GYI A;  4EJW A;  1TNT A;  2H09 A;  3HSR A;  1KU7 A;  4M72 A;  4OU0 A;  4Q48 A;  1S7A A;  2OA4 A;  2RV8 A;  5ILV A;  3SHF A;  4RB1 A;  2J5P A;  3R4K A;  4YFX F;  3ULQ B;  4HOB A;  4IHS A;  3BY6 A;  2VE8 A;  1ON2 A;  1FLI A;  2XKP A;  3I64 A;  2ZBK A;  3F6V A;  3HUG A;  3MQ0 A;  4MEY F;  2OD5 A;  2W84 A;  2XAQ A;  3M1E A;  2DTR A;  1XB4 A;  2HTJ A;  3Q5F A;  2R7F A;  4O3M A;  3GZ6 A;  2HKO A;  2QUF A;  3WTT C;  1B6A A;  4YIF A;  2HEO A;  3KZY A;  3KLN A;  2QZ8 A;  1FBQ A;  3ML6 A;  2LSO A;  4CHU A;  4HLY A;  1XCB A;  2KKO A;  2IT0 A;  3T5X A;  4I01 A;  2ZO4 A;  1OPC A;  1R36 A;  3EDP A;  3LAJ A;  1QO0 D;  4R1H A;  3JW4 A;  1BI1 A;  4KIG A;  5J8F A;  2OQR A;  2DT5 A;  3GZ5 A;  5LHH A;  2IA0 A;  4KMF A;  2HZT A;  4ZZD A;  1F5T A;  2M8E A;  1RUO A;  4Q4Z F;  2UXN A;  2PMH A;  2JT1 A;  1AOY A;  1O3T A;  2P6S A;  1IXC A;  2HOE A;  2WWY A;  3NEU A;  3LST A;  3WOD F;  1G3S A;  4HYE A;  2GIV A;  3CTA A;  2FRH A;  2F5E A;  2FML A;  2EJR A;  3LA3 A;  1KQ0 A;  1IN6 A;  2ESN A;  1VTN C;  4HF1 A;  2VT2 A;  2KIF A;  4AD9 A;  2VBW A;  5L3B A;  2ZME A;  1Z6R A;  3BJ6 A;  4LGW A;  2W24 A;  2CWE A;  3BWG A;  1IAW A;  2YU3 A;  3TQN A;  1J75 A;  2HTS A;  5LRR A;  3W6K B;  1ZRF A;  3U1D A;  2UXX A;  5E1W A;  3I59 A;  3V7S A;  3CO7 C;  4I0B A;  5HLG A;  2ISZ A;  3ZN1 A;  2L4M A;  1XGN A;  3EYY A;  3O2P E;  2TDX A;  1K78 A;  5LLQ A;  2O3F A;  2QEN A;  4P9F A;  3GFM A;  1OYW A;  3ZN0 A;  3GWZ A;  3V8L A;  3WG9 A;  4EJO A;  3DXJ F;  4UVC A;  2K86 A;  4N9I A;  2P8T A;  1FY7 A;  5D8K B;  1QNT A;  1LB2 A;  4OMZ A;  4FX0 A;  1P2F A;  3CO6 C;  2VN2 A;  4BHP A;  2QBY A;  2FA5 A;  5LEK A;  2RC4 A;  4U0Y A;  4RAY A;  2K4B A;  2LF7 A;  3G3Z A;  2EV5 A;  3GEZ A;  1H9G A;  2FF4 A;  3FXU A;  3IL2 A;  2RVC A;  1SD6 A;  1U78 A;  1KQ9 A;  5CVV A;  5D4R A;  4HLX A;  2EK5 A;  4JK1 X;  2OU2 A;  4OIN F;  1L3L A;  2ADU A;  4BHC A;  4KFC A;  4RB2 C;  3LA2 A;  4XLP F;  4WF2 A;  3P7N A;  3KP5 A;  2XRN A;  2G9W A;  3DPL C;  1IN7 A;  2DAO A;  5D4S A;  4I7H A;  4EM2 A;  5J6X A;  2NNY A;  3KP7 A;  4LB5 A;  2HR3 A;  2GQQ A;  3KE2 A;  3KP6 A;  1P4A A;  3C7J A;  3QRF F;  4AWX B;  5IT9 K;  3FWE A;  4WXH A;  4FHT A;  4NQW A;  4IRG A;  4HZF A;  4P9U A;  3E5U A;  2MA3 A;  4CDG A;  1S6L A;  3RJP A;  1L0O C;  4XSX F;  4ESF A;  2Q0O A;  3IKV A;  2IJL A;  2H6C A;  2ZJ2 A;  2FSW A;  1RZ4 A;  1BI3 A;  3LQQ A;  4BHB A;  3IKT A;  4U88 A;  3SZT A;  3RI4 A;  3OOP A;  2QYO A;  1EH7 A;  3GUD A;  2VC1 A;  4R8H A;  5AON A;  4GYG A;  4A0X A;  1FX7 A;  5H6Q A;  1FT9 A;  4ZYE A;  4QLC U;  2A69 F;  3AAF A;  1MJB A;  2HGC A;  1CGP A;  4G6Q A;  1ZAR A;  3P9I A;  5DCF A;  3TDU C;  2FEZ A;  3F3X A;  2XKO A;  2X0L A;  3GFL A;  3DP7 A;  2IA1 A;  1TNS A;  1R00 A;  2O03 A;  1YW9 A;  2XUB A;  2M30 A;  4MQ9 F;  5EEG A;  3WGH A;  3ERE D;  1E17 A;  1DPR A;  1XDU A;  4IXA A;  1B4A A;  4Y13 A;  4M74 A;  1LDK B;  2L4A A;  1F1Z A;  2WV0 A;  1T6S A;  2HQR A;  3N4M A;  3LQR A;  4U7D A;  2NS0 A;  3KP3 A;  4CO8 A;  1FWZ A;  3L2C A;  4KN4 X;  1V3F A;  5DUK A;  4M73 A;  2XAG A;  3M8E A;  3BRO A;  4WXD A;  4RB0 A;  4HX7 A;  3SFZ A;  3N97 A;  3BP8 A;  3JSP A;  3K0L A;  4S04 A;  2A68 F;  4YFK F;  2K7L A;  4NB5 A;  4OIR F;  5E1X A;  4A0Y A;  5FD6 A;  3P9K A;  4CGZ A;  1O57 A;  4L9V A;  5CYV A;  5E17 F;  3MFK A;  2Z3Y A;  1MJ9 A;  5KK1 A;  4HDU A;  4AIH A;  1ZG5 A;  1J5Y A;  1SFX A;  1BI2 A;  2PI0 A;  2W85 A;  3HHG A;  1TLH B;  3E5X A;  1S3J A;  4MTE A;  3TOB A;  4WCG A;  2GXB A;  5D5X B;  4OMY A;  4ENM A;  5FLX K;  3WTZ A;  4UV8 A;  1XSD A;  1IN4 A;  3NQO A;  2Z33 A;  3JAM K;  1FPQ A;  1R5G A;  3QU3 A;  1QQI A;  3L00 A;  1MD0 A;  3HOS A;  1R1V A;  4KDP A;  2BV6 A;  1H0M A;  1IW7 F;  3GX4 X;  4EGY A;  2ZNY A;  1OKR A;  1BM9 A;  1ZH5 A;  4LFU A;  2R3S A;  1K7A A;  2D1H A;  2V9V A;  3EYI A;  4G8X A;  4WXC A;  4F7Z A;  3BPX A;  5TJJ A;  4ETS A;  4GO1 A;  2FOK A;  2WC2 A;  1OMI A;  4HX4 A;  3MZY A;  3QU6 A;  3CUQ A;  2A07 F;  2FXA A;  3KZZ A;  2VC0 A;  1W7P B;  2RQP A;  4LG0 A;  2PG4 A;  3GVA A;  1XGS A;  4GGG A;  5K5O A;  5ICE A;  1YFH A;  1UST A;  1REP C;  4KN7 X;  5DD4 A;  1TW3 A;  5HOO A;  1TQM A;  5HS7 A;  1J2X A;  3V7R A;  3K9T A;  1J0R A;  1RIO H;  2DU9 A;  1ONV A;  1YQA A;  2DW4 A;  5LGT A;  5E8I A;  1ZYR F;  1FBS A;  3JAM Z;  1ODD A;  3R6S A;  5E1Z B;  4PCQ A;  2H27 A;  4HDV A;  1KU3 A;  1W7P D;  3HRS A;  2COM A;  1ZGA A;  2OZU A;  3VOE A;  1LDJ A;  4EMS A;  1ZRE A;  3ABU A;  2KIM A;  1FYL A;  2MBF A;  2D45 A;  3HTS B;  3K2Z A;  2NAZ A;  1YTY A;  3F6O A;  2P7C B;  5LHG A;  4YG2 F;  1KU2 A;  3O6B B;  1P6R A;  4P55 A;  1UB9 A;  3GXO A;  3IRQ A;  3IWZ A;  5LHI A;  2Q2E A;  2IA2 A;  3R0J A;  1K79 A;  1ON1 A;  2IPQ X;  1LEB A;  2CG4 A;  4HQM A;  4OIO F;  2XV4 S;  1KGS A;  1EV7 A;  4KIF A;  1XSX A;  1I5Z A;  5DUI A;  2A6E F;  5D8L B;  4R79 A;  1YO5 C;  1TQI A;  4HV5 A;  2P7V B;  1IZ1 A;  4M9S A;  1MKM A;  1RUN A;  2FBH A;  3C1D A;  5CJ9 A;  5FFX A;  3FXQ A;  3ISP A;  1XDS A;  2J5O A;  1Z6T A;  4Z2Y A;  3TOA A;  3WTW C;  1JE8 A;  3SXY A;  4A5M A;  2KRF A;  4EVI A;  2BE5 F;  3ZMV A;  4WWC A;  3WGI A;  4CIC A;  3CUO A;  2ACJ A;  5L3C A;  1O7F A;  4EGZ A;  2D2W A;  1YIO A;  4FT8 A;  2EFP A;  1R22 A;  2EFO A;  1SD4 A;  1USS A;  2ZME B;  2VOP A;  4AVP A;  5E18 F;  1Z7U A;  1IN8 A;  2ZNZ A;  2STW A;  3P9C A;  5LGU A;  2CW0 F;  1O7L A;  2G7H A;  3I59 B;  3RKW A;  3JTG A;  2E7X A;  2X4H A;  3HSE A;  3VOD A;  2DO7 A;  2DK8 A;  1BC7 C;  3HSF A;  5DEQ A;  1B9M A;  2HKX A;  3FX3 A;  2V6C A;  3GF2 A;  1K78 B;  3I53 A;  5LRS A;  1U5T A;  1TW2 A;  2A3S A;  5A2Q K;  4G6D A;  2VT3 A;  2R7D A;  2IVM A;  4RGU A;  1D8J A;  4RB3 C;  1E2X A;  1BJA A;  3WTY C;  5HDK A;  2JSC A;  2O8X A;  4KIC A;  2CSO A;  2GA2 A;  2QBY B;  5BMZ A;  4AIK A;  1P4W A;  1Q1H A;  3F23 A;  4MQV A;  3VEP A;  1XSV A;  3F8M A;  2RKH A;  5F1R A;  3FMR A;  3GO5 A;  5CVJ A;  3H92 A;  2XIG A;  2L3D A;  3E6D A;  4QWQ A;  4G7H F;  3WGG A;  4U7B A;  3T1B A;  5FO5 A;  1BBY A;  3TDZ C;  3MAJ A;  3WE3 A;  3I5U A;  3M8F A;  2QVO A;  1B1B A;  2IRF G;  3K1P A;  3DPT A;  3IRR A;  1WI9 A;  4RAZ A;  2YX4 A;  3IC7 A;  3B73 A;  3FXR A;  3QP5 A;  2HFH A;  2Q8K A;  2NRA C;  4M9Z A;  2VBZ A;  2E7W A;  3HTU A;  2V1X A;  2MH2 A;  2QQA A;  2QM3 A;  2FNP A;  1EH8 A;  5BPD A;  2HWV A;  5ED4 A;  2AS5 F;  2PJP A;  2FU4 A;  2DQL A;  2M45 A;  1JXS A;  3PFI A;  1KQ8 A;  3I71 A;  5JVT A;  4LLG F;  2EWN A;  3COA C;  2ISY A;  2AXL A;  2CYY A;  4P5O A;  5HVQ C;  2LNB A;  1FZP B;  1UHM A;  1WRJ A;  2MC3 A;  2FBI A;  2HYF A;  4RGR A;  3EET A;  3F8N A;  5EEH A;  4CYD A;  2OBP A;  3BZ6 A;  4UUV A;  3LA7 A;  3F8F A;  5ILU A;  2IP2 A;  1T39 A;  1O3Q A;  5FGM A;  3Q9S A;  2XAS A;  2JPB A;  3V8J A;  1MZB A;  1S8N A;  3W6J B;  3RPU A;  2EA2 A;  2YR2 A;  1D3Y A;  2DK5 A;  1SMY F;  5JFR A;  3BJA A;  3F8B A;  3MZH A;  5HLI A;  2EFQ A;  3QOP A;  1F4K A;  2CGP A;  5DYM A;  2V1U A;  3KET A;  3E6C C;  1EH6 A;  3J80 K;  1ZN2 A;  2ZCW A;  4LLL A;  3R61 A;  1G4D A;  3PQJ A;  4TV7 A;  3RPQ A;  5DCM A;  4IPA A;  5E20 A;  4IVN A;  4PGG A;  4KMU X;  5IT9 Z;  1UHW A;  1HW2 A;  1FP2 A;  2M5W A;  3S2W A;  4EJT A;  2K02 A;  5F64 A;  4B09 A;  3FZV A;  1TQP A;  3KCC A;  3MWM A;  2BGC A;  2DQR A;  3GLX A;  1BC8 C;  1R5H A;  1S7O A;  2DPU A;  2VE9 A;  3WTX C;  1T2K A;  5D5W B;  2Y75 A;  2XHK A;  3QPH A;  2MLK A;  4MNU A;  1JHF A;  2HQN A;  4YII A;  1RI7 A;  5ICC A;  2P5K A;  4BQA A;  2H94 A;  5CVU A;  1BIB A;  5HDG A;  1XN7 A;  5CVI A;  3QPT A;  1DP7 P;  2G7U A;  2QQ9 A;  2HYG D;  1GXQ A;  1ZGJ A;  2JZY A;  2E1C A;  5ICF A;  2XGX A;  4FX4 A;  1ZG3 A;  1LJ9 A;  4ZYD A;  4UV9 A;  2K27 A;  2F5F A;  2GXG A;  3U2R A;  4NHJ A;  1FSH A;  1I1G A;  5ERI A;  2B0L A;  2BYV E;  1SD5 A;  1FYK A;  4P96 A;  3HOT A;  4BNC A;  4GXO A;  3U9G A;  1DUX C;  1ZRD A;  3BDD A;  1J7K A;  2YX7 A;  4OIP F;  5K5Q A;  2OAZ A;  3JSO A;  1YS7 A;  3WTU C;  1IXS B;  5DD8 A;  1HW1 A;  4PGH A;  3E6B A;  2ZFW A;  4L9J A;  3T8R A;  4L0Y B;  3I58 A;  4PDK A;  2F5C A;  2O0Y A;  3TO6 A;  1GHC A;  2EA4 A;  5D6F A;  5JR3 A;  5HDN A;  2EV6 A;  1JGS A;  3CUQ B;  4LD5 A;  1B59 A;  2P4W A;  5LBQ A;  4LG0 B;  5K5R A;  2BBY A;  4CZZ A;  1R1U A;  5ICG A;  3RYP A;  3R0A A;  2PEX A;  4GCV A;  1U3E M;  5L3G A;  2VON A;  3J7A O;  4K2E A;  4G94 A;  3RTR A;  3WTV C;  3GFJ A;  3KP2 A;  3DF8 A;  3WU1 B;  1FSE A;  1SD7 A;  1PP8 F;  5LGN A;  2LDU A;  3ZMZ A;  4ZZL A;  1ZLJ A;  4D0P A;  2PBI A;  3VB2 A;  3FM3 A;  2FQ3 A;  3LAP A;  3T8T A;  2VOD A;  2BEO A;  5FLX Z;  2PN6 A;  1KYZ A;  2KJB A;  4U0W A;  4U0V A;  3DV8 A;  1FP1 D;  1IUY A;  3F8C A;  2QQB A;  2V1D A;  3OV8 A;  4I2O A;  5K1Y A;  4Q47 A;  5HLH A;  2P6T A;  2F2E A;  4A2U A;  2Y0M A;  4XSZ F;  4MGR A;  4UHT A;  1U5T C;  3K1M A;  1B9N A;  1BN5 A;  1MDM A;  4DQ2 A;  1UCR A;  3FHZ A;  1NHA A;  1IN5 A;  4ESJ A;  1A04 A;  5BQT A;  5HS9 A;  2CO5 A;  2DI3 A;  4G7Z F;  2EB7 A;  1QBJ A;  3IWF A;  1IF1 A;  3DQV C;  2L02 A;  4O6J A;  1LNW A;  2W25 A;  2OQG A;  1G3W A;  2O61 A;  4KT5 C;  1XGM A;  3V4G A;  2DLL A;  5L3F A;  4LK0 F;  5L3E A;  4KUM A;  2L01 A;  1T0F A;  1U8R A;  3D5L A;  3WE2 A;  4YFN F;  1YW7 A;  4JBA A;  3BJO A;  2C6Y A;  1STZ A;  3J81 K;  1BOA A;  3TO7 A;  1HKQ A;  2M87 A;  2WTE A;  3F22 A;  2HS5 A;  2CFX A;  3FMS A;  1IRG A;  2RN7 A;  2EFN A;  1LEA A;  3VFZ A;  5DV5 A;  3L7W A;  4EV0 A;  1G3Y A;  4CXF A;  2STT A;  1U5T B;  3F21 A;  1X3U A;  5LEJ A;  3ZMU A;  1PUE E;  2QWW A;  3E3V A;  1R7J A;  3KEO A;  2ETH A;  2W57 A;  3TGN A;  1W5S A;  5E8G A;  5H20 A;  2ZKZ A;  3HRM A;  1OYI A;  1KA8 A;  4I09 A;  3EQL F;  3H3Z A;  2GZW A;  2XRO A;  1HSJ A;  4HV6 A;  4HF2 A;  3WTS C;  4B8X A;  1S29 A;  2O6G E;  2GA1 A;  2CQK A;  5DDG A;  2H6B A;  4UVA A;  3CJN A;  5FD5 A;  1Y0U A;  4PZJ A;  3ELK A;  2XAF A;  1BI0 A;  3O3K A;  1DPU A;  3KP4 A;  3J81 Z;  3HRT A;  1P4X A;  1YYV A;  1FBU A;  2YSR A;  2DPD A;  3JTH A;  4XLN F;  3WU0 A;  4KA4 A;  3ZQ7 A;  1HXD A;  3K69 A;  3BOQ A;  1Z1D A;  1TTY A;  1FNN A;  3E5Q A;  3NRV A;  1LVA A;  2VOO A;  4ZYH A;  1FOK A;  3V7C A;  3KEQ A;  2V79 A;  3EUH A;  2A61 A;  4LMY A;  2OZ6 A;  1IXR C;  1U2W A;  3ROU A;  3E97 A;  4RS8 A;  5KVR A;  3GW2 A;  2EV0 A;  2VXZ A;  3REO A;  3C3W A;  4ZYG A;  3QP6 A; 
#chains in the Genus database with same CATH topology
 2VJI A;  1E3P A;  2V9P A;  4XKC A;  5FFZ A;  1AHD P;  3JRD A;  4ZDO A;  1JKP C;  4M6X A;  4IL6 C;  3QOD A;  4O5V A;  1TP4 A;  1MMN A;  5A2Q Z;  5CKT A;  5CVR A;  1KZH A;  2F5D A;  4HF0 A;  1SAX A;  1FYM A;  4AIJ A;  5AIP A;  2VQH A;  1XGO A;  3M9A A;  3CME I;  2DJN A;  2AQE A;  2M1B A;  2BY3 A;  4AM3 A;  1UG0 A;  2R7W A;  1W36 C;  4Y33 A;  3ABM H;  5BS6 A;  1D1B A;  1QZZ A;  3QOE A;  3OSG A;  1J59 A;  3AG2 H;  3JRG A;  1LE8 B;  2VBY A;  1VQ5 I;  1O3S A;  3W2A A;  1SFE A;  4L0Z B;  3S1M J;  4ZH4 F;  1X1A A;  2A5Y B;  4FET A;  1YW8 A;  4PUS A;  3GYH X;  1YG2 A;  1HCR A;  4M9X A;  4S05 A;  5B1B H;  1J9I A;  1YI2 I;  3N05 A;  2R92 J;  1WKM A;  1PUF A;  4HA8 A;  5JHU A;  3LWF A;  1VFC A;  1YLF A;  3DEU A;  2Y2Z A;  3DBH B;  4L18 B;  1U0J A;  4L9N A;  1R58 A;  1JHH A;  1G6N A;  1LE8 A;  4G7O F;  2ELH A;  2W4S A;  4DYQ A;  4I0A A;  5F27 A;  4A5N A;  3I3L A;  2XGD A;  3M1C A;  3Q9V A;  4WK8 F;  2WAD A;  3OYD A;  3BQY A;  1I1S A;  2QSF X;  2QLZ A;  3H3U A;  1ZLK A;  3ECH A;  1ZGW A;  4V19 K;  3SEZ A;  2PQ8 A;  1ETQ A;  3GTK J;  2K5C A;  2BW3 A;  4GDF A;  4DBR A;  1E3O C;  3KZI C;  2GLO A;  4KYW A;  3GCM A;  3DKY A;  4FE4 A;  1GXP A;  4IHV A;  3HYI A;  4JQF A;  5CLS A;  5DCM B;  2KIU A;  4M3D A;  1XCV A;  1N75 A;  2DFI A;  2IW5 A;  3RDI A;  3FM5 A;  1TWA J;  2VAS A;  1B72 B;  1HQC A;  4HBL A;  4A0Z A;  2KT0 A;  2BVL A;  4L5J A;  4L9T A;  1D5Y A;  4C30 A;  5TRD A;  1KYW A;  4A12 A;  1TC3 C;  1A36 A;  6PAX A;  4M3E A;  3KLO A;  1E0E A;  5JI6 A;  1LQ1 A;  1FJL A;  1N25 A;  4ON0 A;  5EDN A;  3K6G A;  4EQQ A;  3RIR A;  1C0W A;  2JRT A;  4LG3 A;  4LIU A;  1K61 A;  3DFG A;  3T0Y A;  1Z91 A;  1X2N A;  2MLG A;  1HKT A;  1QPM A;  1JKQ C;  1W5T A;  2FNA A;  1X4P A;  1A6I A;  1WH7 A;  1S9H A;  1VQN I;  2HVQ A;  2LY9 A;  3IHU A;  2IEK A;  2R7T A;  4MTD A;  4MEX F;  1QGP A;  2F6C A;  2DFH A;  4HX8 A;  1MJA A;  3DKW A;  1ZG1 A;  1JGG A;  5FKL A;  2VBX A;  2KJC A;  4CUG A;  3QQA A;  5BPI A;  1W0T A;  3AKZ A;  1VZ0 A;  2CQQ A;  2N8G A;  4XQF A;  1U6G A;  3GFI A;  1X3Z B;  2BHZ A;  3W3C A;  2L7M P;  2I10 A;  2TRT A;  1T33 A;  3CD6 I;  2RNJ A;  3K4N A;  2UZK A;  3B6C A;  3PQK A;  4IF4 A;  1F9N A;  3MEX A;  4C3I J;  2XVC A;  2LKS A;  2HPM A;  3GLL A;  3F72 A;  3FMQ A;  4KNY A;  1U8B A;  3C18 A;  3CCU I;  4DYC A;  4EJU A;  1N77 A;  4BEH A;  1DU0 A;  2XAJ A;  5D5V B;  2DBB A;  2A6H F;  2EFW A;  1W0U A;  2PMU A;  2GWR A;  2JA5 J;  5AIQ A;  4V2F A;  1W36 D;  1T56 A;  2PFB A;  3V8K A;  4CCL A;  4E70 A;  1B8I A;  5J47 A;  2XAH A;  2ZXJ A;  3MKY B;  1CF7 B;  4C2M J;  4NDL A;  5TGT A;  1FOW A;  4NNJ A;  1VQ6 I;  2LKP A;  4OOI A;  2D1V A;  1Y6I A;  2HDC A;  1I50 J;  1RET A;  1FTZ A;  4E7H A;  1Y8R B;  1SAN A;  4A6E A;  1OYY A;  3TKY A;  1QZY A;  4NBQ A;  1ZAO A;  4ENK A;  1BIA A;  1IRF A;  5FRO A;  2Y48 A;  4BH9 A;  2YPR A;  4EJV A;  4E4H A;  2ESH A;  3M4O J;  4XID A;  3ZMS A;  1P7I A;  1UFM A;  1VQ7 I;  2ME6 A;  2L9N A;  1OR7 A;  2LTP A;  1T38 A;  4S0H B;  3CUQ C;  3H5R A;  1P92 A;  3HRU A;  2HDD A;  3RKQ A;  1P7J A;  4LK1 F;  3HHH A;  1Z05 A;  3J80 Z;  4XLA A;  1YJ9 I;  5J8C A;  1CF7 A;  2EIL H;  1Z9C A;  5EGO A;  3G1O A;  4CCM A;  2ELJ A;  1IJW C;  4BAY A;  4BDY A;  1W4M A;  4ZYA A;  3JRI A;  1WVR A;  2B9S A;  3K4M A;  2AHQ A;  1XD7 A;  2MD5 A;  2Y0S A;  1SFU A;  3JRE A;  1FC3 A;  2DA2 A;  1MBE A;  2O5R A;  2Z5U A;  3ASN H;  4UVB A;  5L3D A;  4EM1 A;  1DDN A;  1HC8 A;  3PFY A;  1HBX G;  1V4R A;  4ZC3 A;  4MIM A;  1XMK A;  4PFO A;  3HB9 A;  3M7G A;  1D8K A;  4JX5 A;  1ZHF A;  2JPC A;  3HIF A;  2NYX A;  4Y15 A;  1R1T A;  1XX5 A;  2NNN A;  4I02 A;  3PM1 A;  1WWX A;  4HQE A;  4M3G A;  3UR3 C;  3ZMT A;  4ASN A;  4ENN A;  4DNC A;  4I6Z A;  2Y31 A;  1MMG A;  1UJ8 A;  1WHU A;  4HW0 A;  1RKW A;  3ZPL A;  4IQ4 A;  4N4N B;  4Z6Y A;  2WB1 N;  2LF8 A;  1JT6 A;  4DW6 A;  1OIS A;  1JJ6 C;  1OCO H;  1MGT A;  2CMP A;  3TW7 A;  2M3A A;  4IX7 A;  1ZRC A;  2CUZ A;  2EIN H;  3FXK A;  4JOM A;  5F0C A;  3PNV A;  1R5I D;  4M71 A;  4IHT A;  1D5V A;  2FBK A;  3KFW X;  1A31 A;  3TO9 A;  3PIO F;  1K4S A;  1FMV A;  3SZP A;  2JTV A;  3W2V A;  5BOX A;  2PJR B;  3I54 A;  2P5L C;  3HOW J;  2HI3 A;  1RR7 A;  1HKS A;  1PP7 U;  2L54 A;  4G9Y A;  1POG A;  4XOP A;  2NVT J;  1ULY A;  3RKY A;  2Z9O A;  1I6X A;  4FAS D;  4BYY A;  4XBF A;  5FJ8 J;  3J7Y J;  1SEU A;  2GAU A;  1QPI A;  2UWM A;  3K10 A;  4IRI A;  3CLO A;  3QYB A;  2Z99 A;  1HDP A;  3OIO A;  3IV5 A;  3L2V A;  4UXN A;  2EIJ H;  1XMA A;  2K4J A;  2PLY A;  1YRN B;  3TL4 X;  2LC2 A;  4LLN A;  1HST A;  2RGV A;  2X6X A;  2LFB A;  5K7H A;  2M9H A;  3A2K A;  4BBS J;  3DLA A;  4U87 A;  4D5C A;  3D0S A;  1YE9 A;  3ZGK A;  3MCZ A;  2LY2 A;  1R4M B;  3I4P A;  3RYR A;  4HAM A;  5IT3 A;  5D5U B;  3QAH A;  1V5E A;  4N9H A;  4MHG A;  3ZP5 A;  4XKB A;  2XPU A;  3ZMD A;  1O3R A;  3K1N A;  4M6Y A;  3OIP A;  3S3M A;  5LFA A;  1T98 A;  1ETX A;  3HKZ N;  3ECO A;  3PUF A;  4WX9 A;  1SFK A;  1GVJ A;  4LJZ F;  3OYH A;  4IRH A;  3FK6 A;  1I27 A;  1YS6 A;  4Y17 A;  2BOL A;  1SVL A;  3BTI A;  3LSM A;  4F93 B;  4ESB A;  2VKD A;  4RGS A;  4HRI A;  1K4T A;  2GBY A;  4CYC A;  3S3N A;  2HVR A;  3VSK A;  2RDP A;  3HOX J;  4E7K A;  3HOY J;  3G73 A;  5H6R A;  2R5Y B;  1KU9 A;  4EM0 B;  2FMY A;  3BPV A;  3I0T A;  5IY5 H;  3VSL A;  3IP4 B;  1ORK A;  4ENJ A;  3B6A A;  4UNO A;  3L9F A;  4RGX A;  4IJA A;  1H9T A;  4Q5S F;  1SMT A;  3ABT A;  4BXU A;  3B02 A;  1RR8 C;  4ZTF A;  2WBM A;  4LB6 B;  4XRF A;  3JRB A;  3FF5 A;  3L1P A;  1MDM B;  3RKX A;  2QSH X;  2VPL A;  3CDH A;  3CCR I;  2KZG A;  4DZP A;  1R23 A;  3SQN A;  5HS8 A;  2FE3 A;  4N0B A;  3LFK A;  1HW5 A;  1K6O A;  1YX3 A;  1PDN C;  4A6D A;  2Y9Z A;  1WQ2 A;  3L09 A;  4C9Y A;  1W7P A;  2P5V A;  3OL3 A;  1G3T A;  3JCU C;  3CC2 I;  5ILS A;  4H0E A;  3F9K A;  2MH9 A;  5F6F A;  3R60 A;  5FB2 A;  1AWC A;  5D6E A;  4OAZ A;  4YRV A;  1RNL A;  1BR4 A;  3G1M A;  2A5W A;  4OIQ F;  2MG4 A;  3I9V 2;  2CRG A;  3E6M A;  5IOY A;  1E3H A;  2NVY J;  3O8H A;  4J00 A;  2Z2S B;  3OYC A;  4I98 B;  1TBX A;  1WSU A;  1LDD A;  2E1N A;  4L5I A;  4KIB A;  3J7Z I;  4GYI A;  5BNG A;  1WH5 A;  4EJW A;  1TNT A;  2H09 A;  1DU6 A;  2CW8 A;  1UHS A;  3HSR A;  1KU7 A;  4M72 A;  4OU0 A;  2M7A A;  1S7A A;  4Q48 A;  4BJ6 C;  4BL0 B;  1AKH A;  2JN6 A;  2KP6 A;  1Z3Y A;  4BKX A;  2OA4 A;  2RV8 A;  5ILV A;  4A3D J;  3SHF A;  4RB1 A;  1Z0X A;  2VJJ A;  3MZ8 A;  2J5P A;  3R4K A;  2EIM H;  3RQI A;  4YFX F;  1NH3 A;  1VND A;  3ULQ B;  4HOB A;  1Y8Q B;  4IHS A;  3S16 J;  2CH0 A;  3BY6 A;  4PJN A;  2VE8 A;  2VL8 A;  1ON2 A;  1FLI A;  2XKP A;  2KRH A;  3I64 A;  3FXO A;  2ZBK A;  3F6V A;  3HUG A;  4PSX A;  3MQ0 A;  4MEY F;  2OD5 A;  2W84 A;  2XAQ A;  4KIT B;  4A3F J;  4A3E J;  1SAU A;  1WI3 A;  2EZL A;  3M1E A;  2DTR A;  2DA4 A;  1XB4 A;  2HTJ A;  2XSD C;  5HLT A;  3Q5F A;  3ABL H;  2R7F A;  4O3M A;  3AL0 C;  2JA2 A;  2HOA A;  3GZ6 A;  2HKO A;  2QUF A;  4XNF A;  4EEF G;  3WTT C;  2XC7 A;  1B6A A;  4YIF A;  2HEO A;  3CMY A;  2FJ1 A;  3KZY A;  3KLN A;  5J3L A;  2QZ8 A;  1FBQ A;  3ML6 A;  2LSO A;  4LIV A;  3GTO J;  4CHU A;  4HLY A;  2KFD A;  2A6T A;  4AC0 A;  1XCB A;  2KKO A;  2IT0 A;  3T5X A;  4I01 A;  2CUE A;  2ZO4 A;  1OPC A;  1R36 A;  3EDP A;  5FKN A;  4DGW B;  3LAJ A;  1QO0 D;  2MSY A;  4R1H A;  3JW4 A;  1BI1 A;  4KIG A;  2EZH A;  5J8F A;  5C44 J;  2OQR A;  2R4G A;  1XG1 A;  2VKE A;  2LVS A;  2DT5 A;  3GZ5 A;  2WAQ N;  2ID3 A;  5LHH A;  1NK2 P;  2IA0 A;  4KMF A;  2KIQ A;  5GAD J;  1IGN A;  3S1Q J;  5IOZ A;  2IS4 A;  1R9T J;  2HZT A;  4ZZD A;  4A3G J;  1F5T A;  2RQQ A;  2M8E A;  4ZJZ A;  3OR1 C;  3BG9 A;  4E7J A;  2R7Q A;  2F4O B;  1RUO A;  4Q4Z F;  2UXN A;  2PMH A;  2JT1 A;  1AOY A;  1O3T A;  3BR6 A;  3ABK H;  2P6S A;  3L2U A;  1IXC A;  2HOE A;  2WWY A;  3EUA A;  3NEU A;  3LST A;  3WOD F;  1TWH J;  4RM2 A;  3KIO A;  2O7O A;  2JUG A;  4GRI A;  4RA2 A;  1G3S A;  4HYE A;  1SC7 A;  1IRX A;  3LOC A;  2GIV A;  3A02 A;  3CTA A;  2FRH A;  1WJB A;  2F5E A;  2FML A;  2EJR A;  4BQQ A;  1BL0 A;  3DWL E;  3LA3 A;  4QTR A;  1KQ0 A;  1IN6 A;  2ESN A;  3H5A A;  5JVG F;  1VTN C;  3OYL A;  4HF1 A;  4HG2 A;  3OS0 A;  2VT2 A;  2KIF A;  4AD9 A;  2VBW A;  4A3I J;  5L3B A;  2EIK H;  2ZME A;  1Z6R A;  5IYD J;  3BJ6 A;  3L2W A;  4LGW A;  2W24 A;  2CWE A;  3BWG A;  3H9G A;  4NC7 A;  2YU3 A;  3TQN A;  1IAW A;  1J75 A;  3GTQ J;  2HTS A;  2E1O A;  5LRR A;  4M3F A;  2JQ7 A;  3KX2 A;  4CCN A;  3W6K B;  1ZRF A;  2YS9 A;  4YEJ A;  2KQR A;  4CCJ A;  3U1D A;  2UXX A;  5E1W A;  3I59 A;  3V7S A;  3CO7 C;  2OUM A;  4I0B A;  5HLG A;  2ISZ A;  3ZN1 A;  2L4M A;  2JSP A;  2CQN A;  1XTA A;  3G1L A;  5J1U A;  1XGN A;  4HNT A;  3EYY A;  3O2P E;  4B47 A;  2TDX A;  1K78 A;  3CDL A;  5LLQ A;  2CU7 A;  5DM7 F;  2O3F A;  3MVP A;  2QEN A;  5H2F C;  4P9F A;  2ZC2 A;  4IHY A;  3GFM A;  5JLW A;  2NVU B;  1OYW A;  2M2E A;  3ZN0 A;  3S2H J;  3GWZ A;  3V8L A;  3WG9 A;  2M7B A;  4IHW A;  4EJO A;  3MKZ A;  1FTT A;  2NS8 A;  1KON A;  3A0H C;  3CP8 A;  2KL4 A;  4Y4R A;  3S8P A;  3DXJ F;  1H89 C;  4UVC A;  2K86 A;  4N9I A;  4CA0 A;  4PJJ A;  2P8T A;  2L9V A;  1FY7 A;  5D8K B;  1QNT A;  1LB2 A;  4OMZ A;  4FX0 A;  2RAE A;  2R7V A;  3U21 A;  1P2F A;  3FDY A;  1ETV A;  1QA6 A;  3CO6 C;  2VLA A;  2VN2 A;  1J09 A;  1Z77 A;  3ZQQ A;  2TCT A;  2D5V A;  4N4O B;  4BHP A;  2QBY A;  2VUM J;  1YIT I;  4RMN A;  3LSH A;  2BXZ A;  2FA5 A;  2RC4 A;  4RAY A;  5EZG A;  5LEK A;  4U0Y A;  2K4B A;  2LF7 A;  3G3Z A;  2EV5 A;  4L5E A;  3GEZ A;  1U9O A;  5FRM A;  1ZEL A;  1H9G A;  2FF4 A;  3FXU A;  4E7S A;  3H36 A;  3IL2 A;  1UZC A;  5B3S H;  2RVC A;  1SD6 A;  2R7U A;  1U78 A;  1KQ9 A;  1QVU A;  3FKJ A;  5CVV A;  5D4R A;  4CZC A;  1WJC A;  4HLX A;  1PUF B;  1DQU A;  2JA8 J;  3FBN B;  1VQL I;  2EK5 A;  3HKZ A;  3GBG A;  1HLV A;  4JK1 X;  2OU2 A;  5B1A H;  4OIN F;  1OCR H;  4C3H J;  2BY0 A;  1L3L A;  2ADU A;  4BHC A;  3A03 A;  4KFC A;  4RB2 C;  3LA2 A;  4XN3 A;  4XLP F;  3M8J A;  4E7Z A;  3H35 A;  4WF2 A;  3BTJ A;  3FXL A;  3P7N A;  3KP5 A;  1MBK A;  2XRN A;  1ZR4 A;  2G9W A;  3DPL C;  4PJ0 C;  1IN7 A;  4XOR A;  2LR8 A;  2V4J C;  2VQL A;  2DAO A;  4XON A;  5D4S A;  5K7Z A;  4I7H A;  2BW3 B;  4EM2 A;  5J6X A;  2NNY A;  3KP7 A;  2O9L A;  3S1R J;  4LB5 A;  2HR3 A;  2GQQ A;  3KE2 A;  3D5S C;  3KP6 A;  4FE7 A;  3OYJ A;  4BE1 A;  3VDX A;  3CJT B;  4KIS A;  1LFB A;  5KAF C;  1MW7 A;  1P4A A;  3C7J A;  4IQJ A;  4AWX B;  3QRF F;  5IT9 K;  3FWE A;  1UAA A;  4WXH A;  1OR7 C;  3ZQI A;  3OYE A;  4XRS A;  3FIW A;  4FHT A;  3TW6 A;  4NQW A;  3ZR8 X;  3CLQ A;  4IRG A;  2DCE A;  4MFE A;  4HZF A;  4B4C A;  1WJD A;  3GTP J;  3RSN A;  2DA7 A;  4P9U A;  3E5U A;  2MA3 A;  5FKK A;  4CDG A;  1S6L A;  3RJP A;  1L0O C;  4XSX F;  4ESF A;  1JI8 A;  1TZL A;  3JRF A;  3OS1 A;  2Q0O A;  4PJL A;  4MO7 A;  2R7X A;  2IS2 A;  3RPU D;  2OPT A;  3HC7 A;  2HU9 A;  3IKV A;  4G6T B;  1QRY A;  2IJL A;  1JKO C;  1RES A;  2H6C A;  3A4C A;  2XGC A;  5FKM A;  2M4K A;  2ZJ2 A;  2DFE A;  2XF7 A;  2DDB A;  2FSW A;  1OFC X;  4RAF A;  4F92 B;  3SJM A;  1YJW I;  1RZ4 A;  1BI3 A;  1H8A C;  2EZI A;  3P5J A;  3LQQ A;  3BR1 A;  2BXY A;  4BHB A;  3IKT A;  4U88 A;  4XRS G;  4XLE A;  3BR0 A;  3SZT A;  1WPK A;  3QPL A;  4DOZ A;  3RI4 A;  2HPI A;  3OOP A;  2QYO A;  3FHN A;  2R7Z J;  1EH7 A;  1MSE C;  3GUD A;  3SDG A;  5FLV A;  2IBD A;  2VC1 A;  4R8H A;  5AON A;  4BEH B;  2FOW A;  2Y9Y A;  4GYG A;  4A0X A;  5EG0 A;  1FX7 A;  5H6Q A;  3OSF A;  1FT9 A;  4ZYE A;  4QLC U;  2B7E A;  4UY8 I;  2A69 F;  3AAF A;  1MJB A;  2HGC A;  3ZQC A;  4XM3 A;  1CGP A;  5GTI C;  5GPA A;  4G6Q A;  1VQ9 I;  1ZAR A;  1X1C A;  1EA3 A;  3P9I A;  1B8I B;  4IO9 F;  3BR3 A;  5DCF A;  3TDU C;  3K70 C;  1EF4 A;  3BG5 A;  4PK4 A;  2FEZ A;  4A3M J;  3F3X A;  2O8K A;  3KPH A;  2XKO A;  2X0L A;  3GFL A;  3NWS A;  5M3F J;  1XPX A;  3DP7 A;  3BZC A;  5IPA A;  2EH3 A;  2IA1 A;  1Q1V A;  2K9L A;  4XRM A;  4I76 A;  1TNS A;  4IKF A;  1R00 A;  2O03 A;  3VYU B;  2ZXW H;  1YW9 A;  2WAE A;  2XUB A;  2M30 A;  3QYF A;  4BE0 A;  1VI0 A;  2JUC A;  4MQ9 F;  1O4X A;  1A6Q A;  5EEG A;  3WGH A;  3ERE D;  5KAI C;  1E17 A;  5EGO B;  3RZO J;  1DPR A;  1LFP A;  3CCJ I;  2NVQ J;  4QSH A;  1XDU A;  4IXA A;  2A05 A;  1B4A A;  4Y13 A;  4M74 A;  5HOD A;  1LDK B;  2L4A A;  2DTZ A;  2AQF A;  2WV0 A;  1F1Z A;  4E7L A;  3FIS A;  2L9R A;  1T6S A;  2HQR A;  2IS1 A;  3N4M A;  3DTE A;  3LQR A;  4U7D A;  2NS0 A;  3DBL B;  3KP3 A;  2IAI A;  1FWZ A;  3BCA A;  2WY7 Q;  1R6R A;  4CO8 A;  3L2C A;  1F43 A;  4KN4 X;  1V3F A;  5DUK A;  2WAQ A;  4M73 A;  2XAG A;  3M8E A;  3BRO A;  1PJR A;  4WXD A;  4RB0 A;  4BY1 J;  3BG6 A;  4OWR B;  4HX7 A;  3SFZ A;  3LSR A;  3N97 A;  3D5R C;  4BXX J;  2MYS A;  2X6W A;  2LYC A;  3BP8 A;  2HQ5 A;  4FQG A;  3NWT A;  3JSP A;  3K0L A;  4S04 A;  2A68 F;  2X6O A;  1Z3X A;  4CH7 A;  2F4M B;  4YFK F;  2QSG X;  3TP0 A;  4BQN A;  3CC7 I;  1GLN A;  2K7L A;  2LRE A;  3GTL J;  2ZB9 A;  3S17 J;  4NB5 A;  4OIR F;  5E1X A;  3SZG A;  4A0Y A;  1UG2 A;  5FD6 A;  3BG7 A;  3P9K A;  3K4K A;  3CF5 F;  4CCK A;  4CGZ A;  1VQ8 I;  1O57 A;  2DOA A;  4L9V A;  1FOX A;  2R5Z A;  5CYV A;  1VQK I;  5E17 F;  1Z21 A;  3MFK A;  3DBR B;  2Z3Y A;  2HOT A;  2VKV A;  1MJ9 A;  5KK1 A;  2E34 A;  4HDU A;  3FXM A;  3PNY A;  3Q0V A;  1TT0 A;  3ZQG A;  4AIH A;  1Y1W J;  4BE2 A;  1ZG5 A;  1D0Z A;  2E2I J;  2W82 A;  1J5Y A;  1SFX A;  1BI2 A;  2PI0 A;  3CC4 I;  2W85 A;  3C2B A;  3HHG A;  1TLH B;  3E5X A;  3K2A A;  1S3J A;  5FKO A;  4MTE A;  3TOB A;  4WCG A;  2CW7 A;  4PJM A;  2GXB A;  5D5X B;  1G59 A;  4OMY A;  1ETY A;  2IXS A;  4D5F A;  4ENM A;  2X51 A;  3S93 A;  5FLX K;  3PUB A;  3WTZ A;  4UV8 A;  1XSD A;  2X6Y A;  1IN4 A;  3NQO A;  2Z33 A;  3EPZ A;  3JAM K;  3K70 D;  1MMS A;  3M3Y J;  1FPQ A;  1JUS A;  1R5G A;  3CCM I;  3MKL A;  5E79 C;  2OV7 A;  4E6K G;  3QU3 A;  1QQI A;  3KEY A;  3G6E I;  2FD5 A;  3L00 A;  2I5U A;  1I6H J;  1MD0 A;  3HOS A;  1OCP A;  1R1V A;  3ZXS A;  2VIX A;  4KDP A;  3G4S I;  3F0C A;  5IP6 A;  2BV6 A;  1H0M A;  2IGM A;  3ZOB A;  1IW7 F;  3GX4 X;  5IYC J;  2XDV A;  3I4N J;  4II3 A;  4EGY A;  4BBR J;  4CYC B;  3DTI A;  2ZNY A;  1OKR A;  1BM9 A;  1ZH5 A;  1IV6 A;  4LFU A;  4JX4 A;  2R3S A;  3OY9 A;  3KYC B;  1K7A A;  3O8G A;  2D1H A;  3SEQ A;  4BQO A;  2V9V A;  1T0F C;  3EYI A;  4G8X A;  3DPU A;  3QYE A;  4WXC A;  3HOV J;  4F7Z A;  4ZDL A;  1IV8 A;  3BPX A;  5TJJ A;  3BTC A;  4A93 J;  5C4J J;  1WJ5 A;  4XK4 A;  4ETS A;  4M6V A;  5JLX A;  2OCE A;  2DT6 A;  4NC6 A;  4B48 A;  4GO1 A;  2FOK A;  3HZJ A;  2WC2 A;  1OMI A;  3E1S A;  4HX4 A;  1Z67 A;  5TIS C;  3MZY A;  3CCQ I;  3QU6 A;  3CUQ A;  2DN0 A;  1OCZ H;  2K85 A;  2A07 F;  2XAU A;  2E60 A;  2XF5 A;  3PIP F;  2FXA A;  3KZZ A;  2VC0 A;  1W7P B;  2RQP A;  4LG0 A;  2PG4 A;  3NAR A;  3GVA A;  1XGS A;  1Y56 A;  4GGG A;  1MMA A;  5K5O A;  5ICE A;  4UUS A;  1YFH A;  1UST A;  1REP C;  4KN7 X;  2X48 A;  5DD4 A;  2XSJ C;  2QA4 I;  1Y1V J;  1TW3 A;  5HOO A;  2XB5 A;  1TQM A;  5HS7 A;  4KT6 A;  1J2X A;  3BLY A;  1K6Y A;  2K40 A;  3V7R A;  3K9T A;  1J0R A;  1FOY A;  1RIO H;  2DU9 A;  1ONV A;  1YQA A;  1GV5 A;  2RNG A;  3E0J B;  2DW4 A;  3UKG A;  3UNG C;  1BW5 A;  5LGT A;  5E8I A;  1ZYR F;  1FBS A;  4QPO A;  3JAM Z;  1EKE A;  2DMN A;  3OWT A;  5HNF A;  1JT0 A;  5F1J A;  3OYB A;  1ODD A;  3R6S A;  1I39 A;  1T08 B;  1WGX A;  4ANJ A;  1AKH B;  5E1Z B;  4PCQ A;  2H27 A;  1YJN I;  2YU9 J;  1V5G A;  3BTL A;  2M8G X;  4XIC A;  2BZT A;  4HDV A;  4A3L J;  1KU3 A;  1W7P D;  3HRS A;  2COM A;  1W1W E;  1ZGA A;  2OZU A;  2ZXH A;  3HM5 A;  3VOE A;  1LDJ A;  4EMS A;  4Y7N J;  3ABU A;  2KIM A;  1ZRE A;  1FYL A;  2MBF A;  2D45 A;  3HTS B;  1IDZ A;  3K2Z A;  1PYV A;  2R7R A;  1MBJ A;  2VQC A;  3C2G A;  2NAZ A;  4LIT A;  3MMY B;  1YTY A;  3F6O A;  2NOJ B;  1QHH D;  2P7C B;  5LHG A;  3ZQF A;  1X1D A;  4XR6 A;  3JRA A;  3HUG B;  4YG2 F;  1KU2 A;  3O6B B;  1P6R A;  2DT7 B;  4P55 A;  2W48 A;  3H1C A;  3PJR A;  2HYJ A;  1UB9 A;  3GXO A;  2DMP A;  5KCM A;  3IRQ A;  1QVT A;  3IWZ A;  5LHI A;  2Q2E A;  2VB6 A;  2IA2 A;  3R0J A;  1P9Q C;  1K79 A;  1QHG A;  1ON1 A;  2GXA A;  1OCT C;  3ESW B;  2IPQ X;  2Q1Z B;  1U9N A;  1LEB A;  2CG4 A;  3ERM A;  3HG9 A;  4HQM A;  4OIO F;  2XV4 S;  2BVM A;  2KRC A;  1KGS A;  1EV7 A;  2COB A;  4KIF A;  2LKX A;  1XSX A;  2KDO A;  1I5Z A;  5DUI A;  2R93 J;  1WCM J;  1I3Q J;  2A6E F;  2OF7 A;  3DU5 A;  1IO2 A;  5D8L B;  4R79 A;  2Z16 A;  1ITY A;  1YO5 C;  1OLT A;  1TQI A;  4HV5 A;  2P7V B;  1IZ1 A;  2MC4 A;  4A3K J;  4RDU A;  4M9S A;  1MKM A;  1RUN A;  2FBH A;  3C1D A;  5CJ9 A;  5FFX A;  2NVX J;  3FXQ A;  2X9D A;  3IH4 A;  1XDS A;  2J5O A;  3ISP A;  3OYN A;  2QKM B;  1XS9 A;  3S2D J;  5C4X J;  5IP9 J;  3CJR B;  3Q3S A;  2M0C A;  3EUH C;  1Z6T A;  4Z2Y A;  3TOA A;  3WTW C;  5LD2 C;  1JE8 A;  3SXY A;  1D0Y A;  4A5M A;  4B3A A;  2EBI A;  3IH2 A;  3HBL A;  2KRF A;  4EVI A;  2CUJ A;  4IHX A;  2BE5 F;  4P1W A;  1ACI A;  4RLQ A;  3ZMV A;  2X85 A;  4WWC A;  3A01 A;  3WGI A;  3PL8 A;  3AG3 H;  4BXF A;  3WHB A;  3H5N A;  1S5L C;  4CIC A;  3CUO A;  3CP2 A;  2IGK A;  2ACJ A;  3HDD A;  5J4V A;  1FIP A;  1I3A A;  5L3C A;  1O7F A;  3K4B A;  4JP0 A;  2DOF A;  2YUS A;  4XLH A;  4EGZ A;  2DXI A;  1ERD A;  2D2W A;  1YIO A;  4BUP A;  2CV1 A;  4RAG A;  1TWG J;  4FT8 A;  2EFP A;  1R22 A;  2EFO A;  5J4Y A;  1SD4 A;  1USS A;  2ZME B;  2VOP A;  3GTG J;  2CQ7 A;  4AVP A;  3OL4 A;  5E18 F;  1Z7U A;  2GIZ A;  2VKH A;  5F0F A;  1IN8 A;  2ZNZ A;  2STW A;  3P9C A;  5LGU A;  5F08 A;  2CUF A;  3GZN B;  2IS6 A;  2CW0 F;  3FK7 A;  2E36 A;  2Y30 A;  1O7L A;  2G7H A;  1VF9 A;  1MSF C;  3I59 B;  3RKW A;  2ZXI A;  3JTG A;  1IDY A;  2E7X A;  2X4H A;  1FIA A;  3HSE A;  3VOD A;  2DO7 A;  3OR2 C;  2DK8 A;  2VQG A;  1BC7 C;  1HA8 A;  3HSF A;  5DEQ A;  2LBF A;  1B9M A;  2HKX A;  3FX3 A;  3JRH A;  3CES A;  3K7A J;  2V6C A;  5M5W J;  2G0E A;  3GF2 A;  1K78 B;  3I53 A;  5LRS A;  1MBG A;  1U5T A;  1BOB A;  1NTC A;  1TW2 A;  3AG4 H;  3HEF A;  3HGY A;  5E3O A;  2QQ8 A;  2A3S A;  3TED A;  3BCB A;  5A2Q K;  4Y52 J;  1FEX A;  1Y39 A;  3HL2 A;  2PMZ N;  2W00 A;  5EYR A;  4G6D A;  1MNM C;  1YOV B;  2VT3 A;  3NAU A;  2R7D A;  2IVM A;  3VWB A;  4RGU A;  3S14 J;  3KYL A;  5CQG A;  5GPC A;  3W6V A;  1D8J A;  3OYG A;  4RB3 C;  1E2X A;  2WB1 A;  1T95 A;  1BJA A;  3WTY C;  1MNE A;  2CFO A;  2L7Z A;  2JRM A;  5HDK A;  2JSC A;  2O8X A;  4CCO A;  2L5Q A;  5HNH A;  3H3V K;  4KIC A;  4E7I A;  5JHF A;  2CSO A;  2WAF A;  3FXJ A;  2GA2 A;  3JR9 A;  2CV2 A;  2QBY B;  4DJA A;  5BMZ A;  3CQZ J;  4AIK A;  2QCO A;  5GAE J;  1P4W A;  5EEA A;  1OCC H;  3E7L A;  1Q1H A;  4BJ5 C;  2VJ4 A;  4XKW A;  3F23 A;  1IC8 A;  4MQV A;  3VEP A;  5J1R A;  3H9J A;  1XSV A;  1APL C;  1IRZ A;  3F8M A;  2RKH A;  2JVG A;  3FMR A;  5F1R A;  2JMW A;  3GO5 A;  5CVJ A;  2ICW G;  1OQY A;  3H92 A;  3TP3 A;  1LKX A;  2XRL A;  1R71 A;  2NXN B;  4D7N A;  4BDZ A;  2XIG A;  2L3D A;  3E6D A;  3HXL A;  4QWQ A;  3I56 I;  4D7M A;  3GTM J;  4G7H F;  1ZTR A;  2KHM A;  3WGG A;  4U7B A;  3T1B A;  1TWF J;  2HOS A;  1ZKG A;  5FO5 A;  1NK3 P;  2LG4 A;  1BBY A;  3TDZ C;  3MAJ A;  3WE3 A;  3FKI J;  3BR5 A;  4W1U A;  1GVD A;  3I5U A;  3M8F A;  2QVO A;  1B1B A;  2IRF G;  3K1P A;  4HNU A;  3DPT A;  5KHD A;  5M5Y J;  1WI9 A;  4RAZ A;  3IRR A;  2YX4 A;  3IC7 A;  3B73 A;  3FXR A;  2LMD A;  3IH3 A;  2HFH A;  3QP5 A;  4B44 A;  2Q8K A;  2DA1 A;  2VPR A;  2NRA C;  1W5C C;  4M9Z A;  3IUO A;  2VBZ A;  2E7W A;  3HTU A;  2V1X A;  5E3L A;  2MH2 A;  2QQA A;  3OYA A;  9ANT A;  1S72 I;  2QM3 A;  2E5Z A;  5DTD A;  5C3E J;  3PSI A;  5KNL A;  2FNP A;  2RRE A;  1EH8 A;  3OIQ A;  3PO3 J;  3WU2 C;  2FX0 A;  2HWV A;  5ED4 A;  5BPD A;  2AS5 F;  2PJP A;  2FU4 A;  1SFO J;  2VXD A;  2DQL A;  2M45 A;  3HPG A;  1Y0N A;  4NQW B;  1JXS A;  3PFI A;  2LK2 A;  1BR2 A;  1KQ8 A;  3I71 A;  5M3M J;  2R7O A;  4C3J J;  4RLF A;  5JVT A;  4XL9 A;  4LLG F;  3L2R A;  2EWN A;  2GOX B;  4AUX A;  4IEJ A;  3COA C;  2ISY A;  2AXL A;  2CYY A;  4P5O A;  5HVQ C;  2LNB A;  1FZP B;  1ETK A;  1UHM A;  2LD5 A;  1WRJ A;  2MC3 A;  2BY2 A;  1LFU P;  2FBI A;  2HYF A;  2ECC A;  2ZSI B;  1BA5 A;  2P0W A;  4RGR A;  2ZFU A;  3EET A;  3F8N A;  2LY1 A;  2DJI A;  5EEH A;  4CYD A;  1V5F A;  2X1D A;  2OBP A;  3BZ6 A;  2KDZ A;  3DTK A;  2E71 A;  2BY1 A;  3ONQ A;  4UUV A;  4XMY A;  3LA7 A;  3F8F A;  2R7S A;  4F3Q A;  5ILU A;  4C2U A;  2IP2 A;  1T39 A;  3DKX A;  3WHC A;  2OC6 A;  1F36 A;  1O3Q A;  4G12 A;  2P81 A;  2DOE A;  5FGM A;  1LUJ B;  3Q9S A;  2V7F A;  2XAS A;  2JPB A;  3V8J A;  1MZB A;  5EG0 B;  1S8N A;  3W6J B;  3RPU A;  3K4C A;  2V1N A;  2GM4 A;  2EA2 A;  2YR2 A;  1D3Y A;  2V26 A;  1Z7L A;  2DK5 A;  1SMY F;  2ECB A;  3PSF A;  3LMM A;  3BJA A;  5JFR A;  2CV0 A;  2QEX I;  3CDI A;  1MND A;  3F8B A;  3MZH A;  2NS7 A;  5HLI A;  2EFQ A;  1A5J A;  2HXI A;  2L0K A;  3K4J A;  3QOP A;  5M5X J;  1F4K A;  3KYD B;  2CGP A;  2H1K A;  2CS3 A;  5DYM A;  3HOU J;  1X1B A;  2DYS H;  2I8D A;  2V1U A;  2E35 A;  3KET A;  1D1A A;  3E6C C;  1X58 A;  4UUT A;  1EH6 A;  3J80 K;  1ZN2 A;  2ZCW A;  4LLL A;  3H9Q A;  5DM6 F;  3R61 A;  2F48 A;  3LSK A;  3CZ6 A;  1G4D A;  4LOC A;  4DZJ A;  1ZQ3 P;  2DMT A;  3PQJ A;  1AU7 A;  4TV7 A;  4I99 C;  3RPQ A;  5DCM A;  4B43 A;  4AVZ A;  3IAS 2;  4IPA A;  1B72 A;  3HOZ J;  5E20 A;  4J01 A;  2AO9 A;  2XB0 X;  4IVN A;  1VQP I;  2JA6 J;  4PGG A;  2JWT A;  4KMU X;  5IT9 Z;  1UHW A;  1ETO A;  4F55 A;  2K3F A;  2CJJ A;  2UV1 A;  1HW2 A;  3PO2 J;  1SVO A;  4XKV A;  2HQA A;  1FP2 A;  1G2H A;  2F4I A;  2F5V A;  2M5W A;  2KIS A;  3S2W A;  3CCY A;  4EJT A;  2K02 A;  5F64 A;  1M1E B;  4B09 A;  3FZV A;  1TQP A;  1H88 C;  3GME A;  1NG7 A;  3H0G J;  3KCC A;  3K4L A;  3MWM A;  1BR1 A;  2BGC A;  3HJE A;  3S32 A;  2DQR A;  2M34 A;  4X6A J;  1DP3 A;  3GLX A;  4HST A;  2JJ7 A;  4HPQ A;  4RM3 A;  1BC8 C;  1R5H A;  4XOT A;  1S7O A;  5GAG J;  1A35 A;  2DPU A;  4ZDP A;  1AA7 A;  4H4K C;  2VE9 A;  2OCC H;  2EPF A;  3WTX C;  1T2K A;  5D5W B;  3HPH A;  1RRJ A;  2Y75 A;  2XHK A;  2R5Z B;  3QPH A;  2HNH A;  3OMY A;  2MLK A;  2K9Q A;  3TBI A;  4FCY A;  4MNU A;  1JHF A;  2HQN A;  2L9S A;  4YII A;  1RI7 A;  2R0Q C;  3OYI A;  5ICC A;  2P5K A;  4BQA A;  1WZ2 A;  2H94 A;  2LP0 A;  3G71 I;  1VQM I;  4XLC A;  4QPQ A;  5CVU A;  3IAM 2;  3ZRG A;  1BIB A;  5HDG A;  1XN7 A;  5DS9 A;  3S15 J;  2MW8 A;  5CVI A;  4A3J J;  4F52 A;  5J40 A;  4W97 A;  1ETW A;  1D0X A;  3QPT A;  3S1N J;  4OAY A;  2HZD A;  1DP7 P;  3CMA I;  2G7U A;  5FLM J;  2DMQ A;  4ZTJ A;  1IUF A;  1HF0 A;  4C2T A;  2PX9 A;  2QQ9 A;  4AYB N;  2HYG D;  2DYR H;  1GXQ A;  2H8R A;  1ZGJ A;  2JZY A;  2L7F P;  2E1C A;  5ICF A;  2XGX A;  4FX4 A;  4X0G A;  2NOG A;  2XGE A;  4FIS A;  3VYR B;  1G8X A;  5FRN A;  1ZG3 A;  2DA6 A;  3MKW B;  1LJ9 A;  1GUU A;  3LSI A;  4ZYD A;  4UV9 A;  2K27 A;  3D1N I;  2F5F A;  2GXG A;  3U2R A;  4NHJ A;  3VPR A;  2GOM A;  3I55 I;  4X1E A;  1FSH A;  1RKT A;  1I1G A;  2PMZ A;  5ERI A;  3LSG A;  3W2W A;  1PVE A;  2B0L A;  2BYV E;  1SD5 A;  1YIJ I;  1FYK A;  2ZJQ F;  4P96 A;  3HOT A;  4BJT A;  2KLO A;  4GXO A;  3U9G A;  4J19 A;  2OTL I;  4BNC A;  1DUX C;  1ZRD A;  3BDD A;  4NC8 A;  4F91 B;  1J7K A;  2EZK A;  4PFP A;  2YX7 A;  4OIP F;  1UEL B;  3BG3 A;  4XN0 A;  3L2Q A;  1X3W B;  5K5Q A;  3AG1 H;  2QGU A;  4ABZ A;  3QWL A;  1MMD A;  4A3B J;  2OAZ A;  3JSO A;  1YS7 A;  3WTU C;  1IXS B;  5DD8 A;  1GDT A;  1HW1 A;  3WG7 H;  3AFH A;  4PGH A;  2VI6 A;  3TMO A;  3OYF A;  3LSJ A;  3OS2 A;  3E6B A;  2ZFW A;  1JTX A;  4L9J A;  3T8R A;  1GV2 A;  4L0Y B;  3SYT A;  4D1Q A;  3I58 A;  4PDK A;  2IGN A;  3CCS I;  4V2G A;  2F5C A;  2O0Y A;  2JK3 A;  3TO6 A;  1GHC A;  1ENH A;  4Y3O A;  2EA4 A;  5D6F A;  5JR3 A;  5HDN A;  2EV6 A;  1XC5 A;  1JGS A;  3CUQ B;  4GFB A;  4LD5 A;  1B59 A;  2P4W A;  4BAC A;  2OJE D;  2PJR A;  1TL8 A;  4B1R A;  2XPV A;  4RBO A;  3MN2 A;  2WV1 A;  5LBQ A;  4ITV A;  1HOM A;  4LG0 B;  5K5R A;  5CPR B;  2E2H J;  4UUS B;  2BBY A;  4CZZ A;  4HEA 2;  1R1U A;  5ICG A;  3RYP A;  1QZE A;  2PEX A;  3R0A A;  4II2 A;  5EF6 A;  4AID A;  4GCV A;  4NUB A;  1U3E M;  3CCE I;  5L3G A;  2VON A;  3J7A O;  3A0B C;  4K2E A;  4G94 A;  1BW6 A;  3RTR A;  3WTV C;  3GFJ A;  1YRN A;  2DOD A;  3KP2 A;  3DF8 A;  2KMU A;  4CSW A;  1MIJ A;  2W7N A;  1UMQ A;  3WU1 B;  3A1Y A;  1FSE A;  2V9K A;  2MD0 A;  1SD7 A;  1PP8 F;  1DGW Y;  1QU3 A;  2KPM A;  2LDU A;  5LGN A;  2HVS A;  3ZMZ A;  4IOC F;  4ZZL A;  1ZLJ A;  2LOO A;  1YX5 A;  2MAB A;  4D0P A;  2PBI A;  5F04 A;  3VB2 A;  4QIW N;  4UB6 C;  3OOU A;  3FBI B;  4PSW A;  3FM3 A;  2FQ3 A;  3LAP A;  1JTY A;  4HNV A;  3T8T A;  2VOD A;  2BEO A;  1WJF A;  2H8W A;  5FLX Z;  2X1C A;  1RPW A;  1X1P A;  4FTH A;  1V55 H;  2DFF A;  2PN6 A;  1CQT A;  2V6E A;  1KYZ A;  2KJB A;  4U0W A;  3OYK A;  1T8I A;  4U0V A;  3DV8 A;  2E19 A;  2LH9 A;  1VQO I;  5IYB J;  1WJE A;  1FP1 D;  5GTH C;  1IUY A;  3F8C A;  1EJ9 A;  2LLK A;  4IOA F;  1S7E A;  2QQB A;  2Q2E B;  2V1D A;  3OV8 A;  4I2O A;  5K1Y A;  3SFI A;  2EQR A;  1K83 J;  2R5Y A;  2IGO A;  2LRD A;  2UUZ A;  1OJL A;  3BQZ A;  2WA0 A;  4Q47 A;  2H1L A;  5HLH A;  2P6T A;  1R49 A;  2HXO A;  2F2E A;  4EAT A;  4A3C J;  2ZME C;  4A2U A;  2Y0M A;  4BS9 A;  1VQ4 I;  4MLO A;  4XSZ F;  4MGR A;  4UHT A;  1U5T C;  3K1M A;  5GAH J;  3GTJ J;  1B9N A;  1BN5 A;  1MDM A;  4DQ2 A;  1UCR A;  1HDD C;  3DEE A;  3FHZ A;  2OTJ I;  1NHA A;  2VJ5 A;  1IN5 A;  3Q0U A;  4ESJ A;  1A04 A;  2JA7 J;  2K3P A;  5BQT A;  5HS9 A;  1RC9 A;  4JYK A;  4DIQ A;  2CO5 A;  2DI3 A;  5CQE A;  1X4O A;  1X2M A;  4G7Z F;  2EB7 A;  1QBJ A;  2DA3 A;  2L2O A;  3H0D A;  3DU6 A;  2K9M A;  2BHY A;  1IG7 A;  3IWF A;  3JRC A;  2ELK A;  3LFU A;  1LVK A;  1IF1 A;  3DQV C;  2L02 A;  5GP9 A;  2B63 J;  4O6J A;  1LNW A;  2W25 A;  1MH3 A;  3A01 B;  3LNQ A;  2OQG A;  1G3W A;  2W1O A;  4KT5 C;  2O61 A;  1XGM A;  1GT0 C;  3I4M J;  3QPS A;  3V4G A;  2DLL A;  2XF6 A;  5L3F A;  3CJQ B;  4LK0 F;  1R4N B;  5L3E A;  2M4G A;  1BJZ A;  4KUM A;  2L01 A;  4YEL A;  2QKL B;  1T0F A;  1U8R A;  2MFZ A;  3BZK A;  3D5L A;  3WE2 A;  4YFN F;  1YW7 A;  4JBA A;  3ZCO A;  3BJO A;  2C6Y A;  3SDB A;  1STZ A;  3J81 K;  2DMU A;  2Y69 H;  3CMM A;  1BOA A;  5EZH A;  3TO7 A;  3ASO H;  1MBH A;  1ZR2 A;  2ZSH B;  1HKQ A;  1TWC J;  2M87 A;  2WTE A;  3DCF A;  3F22 A;  2HS5 A;  2CFX A;  3FMS A;  3ZQL A;  2E5N A;  2E1M C;  1IRG A;  2RN7 A;  2EFN A;  3VYT B;  1LEA A;  3BC8 A;  3VFZ A;  4YIR X;  2ID6 A;  1JUM A;  2MGQ A;  2AXT C;  5DV5 A;  2LBF B;  3HGG A;  3L7W A;  3Q0W A;  4AU7 A;  1ZK8 A;  4EV0 A;  3DEW A;  1D1C A;  3MD2 A;  4BY7 J;  1G3Y A;  1NG6 A;  5E3M A;  4CXF A;  2STT A;  1U5T B;  3F21 A;  1X3U A;  3U1K A;  5LEJ A;  3ZMU A;  1PUE E;  3VYS B;  2QWW A;  3E3V A;  1R7J A;  2ZJP F;  2WY8 Q;  3KEO A;  2ETH A;  2W57 A;  5E3N A;  3TGN A;  1W5S A;  1WFX A;  1JUP A;  5EJC A;  5E8G A;  5H20 A;  2ZKZ A;  3HRM A;  2QF7 A;  4D9J A;  1OYI A;  2L7K A;  2Y0S N;  1WJA A;  4DYR A;  3RCO A;  1KA8 A;  4I09 A;  2ME0 A;  3EQL F;  3BR2 A;  1X19 A;  3PNT A;  2KZV A;  2GZW A;  3H3Z A;  4UB8 C;  1SVM A;  5F0H A;  2XRO A;  4BGD A;  1HSJ A;  4HV6 A;  4IZZ A;  3X2Q H;  4HF2 A;  3WTS C;  4B8X A;  1S29 A;  5B66 C;  2O6G E;  2GA1 A;  3V42 A;  3CCV I;  2CQK A;  5DDG A;  2H6B A;  3M07 A;  4AYB A;  2E2J J;  4UVA A;  3CJN A;  4KJZ A;  4DBQ A;  5FD5 A;  2JVH A;  2DA5 A;  1DGR M;  1Y0U A;  4B3X A;  3LSP A;  4PZJ A;  2K9S A;  3ELK A;  2XAF A;  2K9N A;  3EUK L;  1YHQ I;  1N78 A;  1BI0 A;  3O3K A;  2M0M A;  4JX6 A;  3J7A Y;  4M3B A;  2HDW A;  3AL0 B;  2FQ4 A;  1DPU A;  3C2H A;  3KP4 A;  3J81 Z;  3HRT A;  3G2B A;  1P4X A;  1YYV A;  1FBU A;  1V54 H;  2YSR A;  2DPD A;  3S3O A;  3JTH A;  4XLN F;  3WU0 A;  4BU2 A;  2Z1D A;  1TT5 B;  5J1Y A;  4KA4 A;  3ZQ7 A;  3CF2 A;  2E1M B;  1HXD A;  2FUG 2;  3RZD J;  3K69 A;  3BOQ A;  1Z1D A;  1TTY A;  2XPW A;  1FNN A;  3RQ4 A;  1MH4 A;  3E5Q A;  3CCL I;  3NRV A;  1LVA A;  2VOO A;  4HSR A;  2ZJR F;  4ZYH A;  1FOK A;  3ZQH A;  1MBF A;  2DDA A;  3LL7 A;  4A69 C;  3BT9 A;  1LPQ A;  3DLL F;  3V7C A;  5B5E C;  2CQX A;  3OYM A;  3KEQ A;  2V79 A;  3EUH A;  4MFD A;  1JJ8 C;  2A61 A;  4LMY A;  2OZ6 A;  1IXR C;  1FMW A;  1U2W A;  3ROU A;  3E97 A;  4RS8 A;  5KVR A;  4XLF A;  1XMX A;  2X1E A;  3GW2 A;  1JKR C;  2EV0 A;  2VXZ A;  5IP7 J;  3REO A;  5K7F A;  3C3W A;  4ZYG A;  3QP6 A; 
#chains in the Genus database with same CATH homology
 5FFZ A;  4M6X A;  4O5V A;  5A2Q Z;  5CVR A;  1SAX A;  2F5D A;  4HF0 A;  1FYM A;  4AIJ A;  5AIP A;  1XGO A;  3M9A A;  2M1B A;  5BS6 A;  1QZZ A;  1J59 A;  2VBY A;  1O3S A;  1SFE A;  4L0Z B;  4ZH4 F;  2A5Y B;  1YW8 A;  3GYH X;  1YG2 A;  4M9X A;  4S05 A;  1J9I A;  1WKM A;  4HA8 A;  5JHU A;  3LWF A;  1YLF A;  3DEU A;  4L18 B;  4L9N A;  1R58 A;  1JHH A;  1G6N A;  4G7O F;  2ELH A;  4I0A A;  4A5N A;  3Q9V A;  4WK8 F;  1I1S A;  2QLZ A;  3H3U A;  1ZLK A;  3ECH A;  2PQ8 A;  4KYW A;  1GXP A;  5DCM B;  3HYI A;  4JQF A;  5CLS A;  2KIU A;  1XCV A;  2DFI A;  2IW5 A;  3RDI A;  3FM5 A;  1HQC A;  4HBL A;  4A0Z A;  4L5J A;  4L9T A;  5TRD A;  6PAX A;  1KYW A;  4A12 A;  3KLO A;  5JI6 A;  1LQ1 A;  4ON0 A;  4EQQ A;  3RIR A;  1C0W A;  2JRT A;  3DFG A;  3T0Y A;  1Z91 A;  2MLG A;  1HKT A;  1QPM A;  1W5T A;  2FNA A;  3IHU A;  4MTD A;  4MEX F;  1QGP A;  4HX8 A;  1MJA A;  3DKW A;  1ZG1 A;  2VBX A;  2KJC A;  5BPI A;  1U6G A;  3GFI A;  2RNJ A;  2UZK A;  3PQK A;  4IF4 A;  1F9N A;  3MEX A;  2XVC A;  3F72 A;  3FMQ A;  4KNY A;  3C18 A;  4EJU A;  2XAJ A;  5D5V B;  2DBB A;  2A6H F;  2EFW A;  2PMU A;  2GWR A;  5AIQ A;  2PFB A;  3V8K A;  4E70 A;  2XAH A;  2ZXJ A;  1CF7 B;  2LKP A;  4OOI A;  2D1V A;  2HDC A;  4A6E A;  1OYY A;  3TKY A;  1QZY A;  1ZAO A;  4ENK A;  1BIA A;  1IRF A;  4EJV A;  2Y48 A;  4BH9 A;  2YPR A;  2ESH A;  3ZMS A;  1UFM A;  1OR7 A;  1T38 A;  3CUQ C;  3HRU A;  1P92 A;  4LK1 F;  3HHH A;  1Z05 A;  3J80 Z;  1CF7 A;  5J8C A;  1Z9C A;  4BAY A;  1W4M A;  1XD7 A;  2MD5 A;  1SFU A;  1FC3 A;  4UVB A;  2Z5U A;  5L3D A;  4EM1 A;  1DDN A;  1HBX G;  1V4R A;  1XMK A;  3M7G A;  1D8K A;  1ZHF A;  2JPC A;  3HIF A;  2NYX A;  4Y15 A;  1R1T A;  2NNN A;  4I02 A;  1WWX A;  4HQE A;  3ZMT A;  4ASN A;  4ENN A;  4DNC A;  4HW0 A;  3ZPL A;  2LF8 A;  1MGT A;  1ZRC A;  1D5V A;  4M71 A;  4IHT A;  2FBK A;  3KFW X;  3TO9 A;  3SZP A;  2JTV A;  5BOX A;  3I54 A;  2P5L C;  1HKS A;  1PP7 U;  2L54 A;  4G9Y A;  1ULY A;  3RKY A;  2Z9O A;  1I6X A;  4BYY A;  4XBF A;  2GAU A;  2UWM A;  4IRI A;  3CLO A;  2Z99 A;  4UXN A;  2K4J A;  1XMA A;  2PLY A;  4LLN A;  1HST A;  2RGV A;  3D0S A;  3MCZ A;  3I4P A;  3RYR A;  4HAM A;  5IT3 A;  5D5U B;  3QAH A;  4N9H A;  4MHG A;  3ZP5 A;  3ZMD A;  1O3R A;  3K1N A;  4M6Y A;  1T98 A;  3ECO A;  4WX9 A;  1GVJ A;  4LJZ F;  4IRH A;  1I27 A;  1YS6 A;  4Y17 A;  4ESB A;  4RGS A;  2RDP A;  3G73 A;  5H6R A;  1KU9 A;  4EM0 B;  2FMY A;  3BPV A;  3I0T A;  4ENJ A;  4UNO A;  3L9F A;  4RGX A;  4IJA A;  1H9T A;  4Q5S F;  1SMT A;  3ABT A;  4BXU A;  3B02 A;  4LB6 B;  4XRF A;  3FF5 A;  1MDM B;  3RKX A;  3CDH A;  1R23 A;  3SQN A;  5HS8 A;  2FE3 A;  4N0B A;  3LFK A;  1HW5 A;  1K6O A;  1PDN C;  4A6D A;  1WQ2 A;  3L09 A;  1W7P A;  2P5V A;  1G3T A;  5ILS A;  4H0E A;  2MH9 A;  5F6F A;  3R60 A;  5FB2 A;  1AWC A;  5D6E A;  1RNL A;  4OIQ F;  3E6M A;  4I98 B;  1TBX A;  1WSU A;  1LDD A;  2E1N A;  4L5I A;  4KIB A;  4GYI A;  4EJW A;  1TNT A;  2H09 A;  3HSR A;  1KU7 A;  4M72 A;  4OU0 A;  4Q48 A;  1S7A A;  2OA4 A;  2RV8 A;  5ILV A;  3SHF A;  4RB1 A;  2J5P A;  3R4K A;  4YFX F;  3ULQ B;  4HOB A;  4IHS A;  3BY6 A;  2VE8 A;  1ON2 A;  1FLI A;  2XKP A;  3I64 A;  2ZBK A;  3F6V A;  3HUG A;  3MQ0 A;  4MEY F;  2OD5 A;  2W84 A;  2XAQ A;  3M1E A;  2DTR A;  1XB4 A;  2HTJ A;  3Q5F A;  2R7F A;  4O3M A;  3GZ6 A;  2HKO A;  2QUF A;  3WTT C;  1B6A A;  4YIF A;  2HEO A;  3KZY A;  3KLN A;  2QZ8 A;  1FBQ A;  3ML6 A;  2LSO A;  4CHU A;  4HLY A;  1XCB A;  2KKO A;  2IT0 A;  3T5X A;  4I01 A;  2ZO4 A;  1OPC A;  1R36 A;  3EDP A;  3LAJ A;  1QO0 D;  4R1H A;  3JW4 A;  1BI1 A;  4KIG A;  5J8F A;  2OQR A;  2DT5 A;  3GZ5 A;  5LHH A;  2IA0 A;  4KMF A;  2HZT A;  4ZZD A;  1F5T A;  2M8E A;  1RUO A;  4Q4Z F;  2UXN A;  2PMH A;  2JT1 A;  1AOY A;  1O3T A;  2P6S A;  1IXC A;  2HOE A;  2WWY A;  3NEU A;  3LST A;  3WOD F;  1G3S A;  4HYE A;  2GIV A;  3CTA A;  2FRH A;  2F5E A;  2FML A;  2EJR A;  3LA3 A;  1KQ0 A;  1IN6 A;  2ESN A;  1VTN C;  4HF1 A;  2VT2 A;  2KIF A;  4AD9 A;  2VBW A;  5L3B A;  2ZME A;  1Z6R A;  3BJ6 A;  4LGW A;  2W24 A;  2CWE A;  3BWG A;  1IAW A;  2YU3 A;  3TQN A;  1J75 A;  2HTS A;  5LRR A;  3W6K B;  1ZRF A;  3U1D A;  2UXX A;  5E1W A;  3I59 A;  3V7S A;  3CO7 C;  4I0B A;  5HLG A;  2ISZ A;  3ZN1 A;  2L4M A;  1XGN A;  3EYY A;  3O2P E;  2TDX A;  1K78 A;  5LLQ A;  2O3F A;  2QEN A;  4P9F A;  3GFM A;  1OYW A;  3ZN0 A;  3GWZ A;  3V8L A;  3WG9 A;  4EJO A;  3DXJ F;  4UVC A;  2K86 A;  4N9I A;  2P8T A;  1FY7 A;  5D8K B;  1QNT A;  1LB2 A;  4OMZ A;  4FX0 A;  1P2F A;  3CO6 C;  2VN2 A;  4BHP A;  2QBY A;  2FA5 A;  5LEK A;  2RC4 A;  4U0Y A;  4RAY A;  2K4B A;  2LF7 A;  3G3Z A;  2EV5 A;  3GEZ A;  1H9G A;  2FF4 A;  3FXU A;  3IL2 A;  2RVC A;  1SD6 A;  1U78 A;  1KQ9 A;  5CVV A;  5D4R A;  4HLX A;  2EK5 A;  4JK1 X;  2OU2 A;  4OIN F;  1L3L A;  2ADU A;  4BHC A;  4KFC A;  4RB2 C;  3LA2 A;  4XLP F;  4WF2 A;  3P7N A;  3KP5 A;  2XRN A;  2G9W A;  3DPL C;  1IN7 A;  2DAO A;  5D4S A;  4I7H A;  4EM2 A;  5J6X A;  2NNY A;  3KP7 A;  4LB5 A;  2HR3 A;  2GQQ A;  3KE2 A;  3KP6 A;  1P4A A;  3C7J A;  3QRF F;  4AWX B;  5IT9 K;  3FWE A;  4WXH A;  4FHT A;  4NQW A;  4IRG A;  4HZF A;  4P9U A;  3E5U A;  2MA3 A;  4CDG A;  1S6L A;  3RJP A;  1L0O C;  4XSX F;  4ESF A;  2Q0O A;  3IKV A;  2IJL A;  2H6C A;  2ZJ2 A;  2FSW A;  1RZ4 A;  1BI3 A;  3LQQ A;  4BHB A;  3IKT A;  4U88 A;  3SZT A;  3RI4 A;  3OOP A;  2QYO A;  1EH7 A;  3GUD A;  2VC1 A;  4R8H A;  5AON A;  4GYG A;  4A0X A;  1FX7 A;  5H6Q A;  1FT9 A;  4ZYE A;  4QLC U;  2A69 F;  3AAF A;  1MJB A;  2HGC A;  1CGP A;  4G6Q A;  1ZAR A;  3P9I A;  5DCF A;  3TDU C;  2FEZ A;  3F3X A;  2XKO A;  2X0L A;  3GFL A;  3DP7 A;  2IA1 A;  1TNS A;  1R00 A;  2O03 A;  1YW9 A;  2XUB A;  2M30 A;  4MQ9 F;  5EEG A;  3WGH A;  3ERE D;  1E17 A;  1DPR A;  1XDU A;  4IXA A;  1B4A A;  4Y13 A;  4M74 A;  1LDK B;  2L4A A;  1F1Z A;  2WV0 A;  1T6S A;  2HQR A;  3N4M A;  3LQR A;  4U7D A;  2NS0 A;  3KP3 A;  4CO8 A;  1FWZ A;  3L2C A;  4KN4 X;  1V3F A;  5DUK A;  4M73 A;  2XAG A;  3M8E A;  3BRO A;  4WXD A;  4RB0 A;  4HX7 A;  3SFZ A;  3N97 A;  3BP8 A;  3JSP A;  3K0L A;  4S04 A;  2A68 F;  4YFK F;  2K7L A;  4NB5 A;  4OIR F;  5E1X A;  4A0Y A;  5FD6 A;  3P9K A;  4CGZ A;  1O57 A;  4L9V A;  5CYV A;  5E17 F;  3MFK A;  2Z3Y A;  1MJ9 A;  5KK1 A;  4HDU A;  4AIH A;  1ZG5 A;  1J5Y A;  1SFX A;  1BI2 A;  2PI0 A;  2W85 A;  3HHG A;  1TLH B;  3E5X A;  1S3J A;  4MTE A;  3TOB A;  4WCG A;  2GXB A;  5D5X B;  4OMY A;  4ENM A;  5FLX K;  3WTZ A;  4UV8 A;  1XSD A;  1IN4 A;  3NQO A;  2Z33 A;  3JAM K;  1FPQ A;  1R5G A;  3QU3 A;  1QQI A;  3L00 A;  1MD0 A;  3HOS A;  1R1V A;  4KDP A;  2BV6 A;  1H0M A;  1IW7 F;  3GX4 X;  4EGY A;  2ZNY A;  1OKR A;  1BM9 A;  1ZH5 A;  4LFU A;  2R3S A;  1K7A A;  2D1H A;  2V9V A;  3EYI A;  4G8X A;  4WXC A;  4F7Z A;  3BPX A;  5TJJ A;  4ETS A;  4GO1 A;  2FOK A;  2WC2 A;  1OMI A;  4HX4 A;  3MZY A;  3QU6 A;  3CUQ A;  2A07 F;  2FXA A;  3KZZ A;  2VC0 A;  1W7P B;  2RQP A;  4LG0 A;  2PG4 A;  3GVA A;  1XGS A;  4GGG A;  5K5O A;  5ICE A;  1YFH A;  1UST A;  1REP C;  4KN7 X;  5DD4 A;  1TW3 A;  5HOO A;  1TQM A;  5HS7 A;  1J2X A;  3V7R A;  3K9T A;  1J0R A;  1RIO H;  2DU9 A;  1ONV A;  1YQA A;  2DW4 A;  5LGT A;  5E8I A;  1ZYR F;  1FBS A;  3JAM Z;  1ODD A;  3R6S A;  5E1Z B;  4PCQ A;  2H27 A;  4HDV A;  1KU3 A;  1W7P D;  3HRS A;  2COM A;  1ZGA A;  2OZU A;  3VOE A;  1LDJ A;  4EMS A;  1ZRE A;  3ABU A;  2KIM A;  1FYL A;  2MBF A;  2D45 A;  3HTS B;  3K2Z A;  2NAZ A;  1YTY A;  3F6O A;  2P7C B;  5LHG A;  4YG2 F;  1KU2 A;  3O6B B;  1P6R A;  4P55 A;  1UB9 A;  3GXO A;  3IRQ A;  3IWZ A;  5LHI A;  2Q2E A;  2IA2 A;  3R0J A;  1K79 A;  1ON1 A;  2IPQ X;  1LEB A;  2CG4 A;  4HQM A;  4OIO F;  2XV4 S;  1KGS A;  1EV7 A;  4KIF A;  1XSX A;  1I5Z A;  5DUI A;  2A6E F;  5D8L B;  4R79 A;  1YO5 C;  1TQI A;  4HV5 A;  2P7V B;  1IZ1 A;  4M9S A;  1MKM A;  1RUN A;  2FBH A;  3C1D A;  5CJ9 A;  5FFX A;  3FXQ A;  3ISP A;  1XDS A;  2J5O A;  1Z6T A;  4Z2Y A;  3TOA A;  3WTW C;  1JE8 A;  3SXY A;  4A5M A;  2KRF A;  4EVI A;  2BE5 F;  3ZMV A;  4WWC A;  3WGI A;  4CIC A;  3CUO A;  2ACJ A;  5L3C A;  1O7F A;  4EGZ A;  2D2W A;  1YIO A;  4FT8 A;  2EFP A;  1R22 A;  2EFO A;  1SD4 A;  1USS A;  2ZME B;  2VOP A;  4AVP A;  5E18 F;  1Z7U A;  1IN8 A;  2ZNZ A;  2STW A;  3P9C A;  5LGU A;  2CW0 F;  1O7L A;  2G7H A;  3I59 B;  3RKW A;  3JTG A;  2E7X A;  2X4H A;  3HSE A;  3VOD A;  2DO7 A;  2DK8 A;  1BC7 C;  3HSF A;  5DEQ A;  1B9M A;  2HKX A;  3FX3 A;  2V6C A;  3GF2 A;  1K78 B;  3I53 A;  5LRS A;  1U5T A;  1TW2 A;  2A3S A;  5A2Q K;  4G6D A;  2VT3 A;  2R7D A;  2IVM A;  4RGU A;  1D8J A;  4RB3 C;  1E2X A;  1BJA A;  3WTY C;  5HDK A;  2JSC A;  2O8X A;  4KIC A;  2CSO A;  2GA2 A;  2QBY B;  5BMZ A;  4AIK A;  1P4W A;  1Q1H A;  3F23 A;  4MQV A;  3VEP A;  1XSV A;  3F8M A;  2RKH A;  5F1R A;  3FMR A;  3GO5 A;  5CVJ A;  3H92 A;  2XIG A;  2L3D A;  3E6D A;  4QWQ A;  4G7H F;  3WGG A;  4U7B A;  3T1B A;  5FO5 A;  1BBY A;  3TDZ C;  3MAJ A;  3WE3 A;  3I5U A;  3M8F A;  2QVO A;  1B1B A;  2IRF G;  3K1P A;  3DPT A;  3IRR A;  1WI9 A;  4RAZ A;  2YX4 A;  3IC7 A;  3B73 A;  3FXR A;  3QP5 A;  2HFH A;  2Q8K A;  2NRA C;  4M9Z A;  2VBZ A;  2E7W A;  3HTU A;  2V1X A;  2MH2 A;  2QQA A;  2QM3 A;  2FNP A;  1EH8 A;  5BPD A;  2HWV A;  5ED4 A;  2AS5 F;  2PJP A;  2FU4 A;  2DQL A;  2M45 A;  1JXS A;  3PFI A;  1KQ8 A;  3I71 A;  5JVT A;  4LLG F;  2EWN A;  3COA C;  2ISY A;  2AXL A;  2CYY A;  4P5O A;  5HVQ C;  2LNB A;  1FZP B;  1UHM A;  1WRJ A;  2MC3 A;  2FBI A;  2HYF A;  4RGR A;  3EET A;  3F8N A;  5EEH A;  4CYD A;  2OBP A;  3BZ6 A;  4UUV A;  3LA7 A;  3F8F A;  5ILU A;  2IP2 A;  1T39 A;  1O3Q A;  5FGM A;  3Q9S A;  2XAS A;  2JPB A;  3V8J A;  1MZB A;  1S8N A;  3W6J B;  3RPU A;  2EA2 A;  2YR2 A;  1D3Y A;  2DK5 A;  1SMY F;  5JFR A;  3BJA A;  3F8B A;  3MZH A;  5HLI A;  2EFQ A;  3QOP A;  1F4K A;  2CGP A;  5DYM A;  2V1U A;  3KET A;  3E6C C;  1EH6 A;  3J80 K;  1ZN2 A;  2ZCW A;  4LLL A;  3R61 A;  1G4D A;  3PQJ A;  4TV7 A;  3RPQ A;  5DCM A;  4IPA A;  5E20 A;  4IVN A;  4PGG A;  4KMU X;  5IT9 Z;  1UHW A;  1HW2 A;  1FP2 A;  2M5W A;  3S2W A;  4EJT A;  2K02 A;  5F64 A;  4B09 A;  3FZV A;  1TQP A;  3KCC A;  3MWM A;  2BGC A;  2DQR A;  3GLX A;  1BC8 C;  1R5H A;  1S7O A;  2DPU A;  2VE9 A;  3WTX C;  1T2K A;  5D5W B;  2Y75 A;  2XHK A;  3QPH A;  2MLK A;  4MNU A;  1JHF A;  2HQN A;  4YII A;  1RI7 A;  5ICC A;  2P5K A;  4BQA A;  2H94 A;  5CVU A;  1BIB A;  5HDG A;  1XN7 A;  5CVI A;  3QPT A;  1DP7 P;  2G7U A;  2QQ9 A;  2HYG D;  1GXQ A;  1ZGJ A;  2JZY A;  2E1C A;  5ICF A;  2XGX A;  4FX4 A;  1ZG3 A;  1LJ9 A;  4ZYD A;  4UV9 A;  2K27 A;  2F5F A;  2GXG A;  3U2R A;  4NHJ A;  1FSH A;  1I1G A;  5ERI A;  2B0L A;  2BYV E;  1SD5 A;  1FYK A;  4P96 A;  3HOT A;  4BNC A;  4GXO A;  3U9G A;  1DUX C;  1ZRD A;  3BDD A;  1J7K A;  2YX7 A;  4OIP F;  5K5Q A;  2OAZ A;  3JSO A;  1YS7 A;  3WTU C;  1IXS B;  5DD8 A;  1HW1 A;  4PGH A;  3E6B A;  2ZFW A;  4L9J A;  3T8R A;  4L0Y B;  3I58 A;  4PDK A;  2F5C A;  2O0Y A;  3TO6 A;  1GHC A;  2EA4 A;  5D6F A;  5JR3 A;  5HDN A;  2EV6 A;  1JGS A;  3CUQ B;  4LD5 A;  1B59 A;  2P4W A;  5LBQ A;  4LG0 B;  5K5R A;  2BBY A;  4CZZ A;  1R1U A;  5ICG A;  3RYP A;  3R0A A;  2PEX A;  4GCV A;  1U3E M;  5L3G A;  2VON A;  3J7A O;  4K2E A;  4G94 A;  3RTR A;  3WTV C;  3GFJ A;  3KP2 A;  3DF8 A;  3WU1 B;  1FSE A;  1SD7 A;  1PP8 F;  5LGN A;  2LDU A;  3ZMZ A;  4ZZL A;  1ZLJ A;  4D0P A;  2PBI A;  3VB2 A;  3FM3 A;  2FQ3 A;  3LAP A;  3T8T A;  2VOD A;  2BEO A;  5FLX Z;  2PN6 A;  1KYZ A;  2KJB A;  4U0W A;  4U0V A;  3DV8 A;  1FP1 D;  1IUY A;  3F8C A;  2QQB A;  2V1D A;  3OV8 A;  4I2O A;  5K1Y A;  4Q47 A;  5HLH A;  2P6T A;  2F2E A;  4A2U A;  2Y0M A;  4XSZ F;  4MGR A;  4UHT A;  1U5T C;  3K1M A;  1B9N A;  1BN5 A;  1MDM A;  4DQ2 A;  1UCR A;  3FHZ A;  1NHA A;  1IN5 A;  4ESJ A;  1A04 A;  5BQT A;  5HS9 A;  2CO5 A;  2DI3 A;  4G7Z F;  2EB7 A;  1QBJ A;  3IWF A;  1IF1 A;  3DQV C;  2L02 A;  4O6J A;  1LNW A;  2W25 A;  2OQG A;  1G3W A;  2O61 A;  4KT5 C;  1XGM A;  3V4G A;  2DLL A;  5L3F A;  4LK0 F;  5L3E A;  4KUM A;  2L01 A;  1T0F A;  1U8R A;  3D5L A;  3WE2 A;  4YFN F;  1YW7 A;  4JBA A;  3BJO A;  2C6Y A;  1STZ A;  3J81 K;  1BOA A;  3TO7 A;  1HKQ A;  2M87 A;  2WTE A;  3F22 A;  2HS5 A;  2CFX A;  3FMS A;  1IRG A;  2RN7 A;  2EFN A;  1LEA A;  3VFZ A;  5DV5 A;  3L7W A;  4EV0 A;  1G3Y A;  4CXF A;  2STT A;  1U5T B;  3F21 A;  1X3U A;  5LEJ A;  3ZMU A;  1PUE E;  2QWW A;  3E3V A;  1R7J A;  3KEO A;  2ETH A;  2W57 A;  3TGN A;  1W5S A;  5E8G A;  5H20 A;  2ZKZ A;  3HRM A;  1OYI A;  1KA8 A;  4I09 A;  3EQL F;  3H3Z A;  2GZW A;  2XRO A;  1HSJ A;  4HV6 A;  4HF2 A;  3WTS C;  4B8X A;  1S29 A;  2O6G E;  2GA1 A;  2CQK A;  5DDG A;  2H6B A;  4UVA A;  3CJN A;  5FD5 A;  1Y0U A;  4PZJ A;  3ELK A;  2XAF A;  1BI0 A;  3O3K A;  1DPU A;  3KP4 A;  3J81 Z;  3HRT A;  1P4X A;  1YYV A;  1FBU A;  2YSR A;  2DPD A;  3JTH A;  4XLN F;  3WU0 A;  4KA4 A;  3ZQ7 A;  1HXD A;  3K69 A;  3BOQ A;  1Z1D A;  1TTY A;  1FNN A;  3E5Q A;  3NRV A;  1LVA A;  2VOO A;  4ZYH A;  1FOK A;  3V7C A;  3KEQ A;  2V79 A;  3EUH A;  2A61 A;  4LMY A;  2OZ6 A;  1IXR C;  1U2W A;  3ROU A;  3E97 A;  4RS8 A;  5KVR A;  3GW2 A;  2EV0 A;  2VXZ A;  3REO A;  3C3W A;  4ZYG A;  3QP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...