5DUKA

N-terminal structure of putative dna binding transcription factor from thermoplasmatales archaeon scgc ab-539-n05
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
60
structure length
60
Chain Sequence
DTRREIYKHIVKSPGLHERQLAKELDVPLSTLVYHLHYLERRELIMMKSDERYARYYATK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords putative DNA binding protein
publication title N-terminal structure of putative DNA binding transcription factor from Thermoplasmatales archaeon SCGC AB-539-N05
rcsb
source organism Thermoplasmatales archaeon scgc ab-539-n05
total genus 15
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dukA00
4I0AA 1ULYA 1IRGA 4IRHA 5E1XA 5FGMA 3JTHA 1F4KA 3L7WA 4ESFA 4G6QA 2Z33A 1EV7A 2FMLA 2JZYA 5D8KB 2OZ6A 2HYGD 4HAMA 1Y0UA 1DUXC 5IT9Z 2J5OA 3E6BA 1T2KA 1XD7A 2O8XA 5TJJA 1IXCA 5E8IA 4MGRA 4KFCA 2E7WA 3HYIA 4Q4ZF 4I02A 5AONA 2A3SA 4HLYA 3C1DA 3V7RA 1QZYA 3PFIA 3GWZA 4CXFA 3FWEA 2CO5A 5DUKA 2M45A 4WCGA 2BBYA 2XROA 3R61A 4MTEA 5IT3A 1YW9A 3L2CA 1KYZA 2HS5A 5DCMA 5L3DA 3BDDA 1DDNA 2W84A 2M8EA 1F5TA 4EJVA 2AXLA 2GIVA 1FYMA 4G94A 5CJ9A 1XSVA 2IJLA 3E6CC 1FP1D 3BJ6A 1R5GA 2JT1A 4I01A 4GYIA 5DV5A 4LFUA 4O3MA 3IKVA 1B9MA 2XHKA 1RUOA 5JFRA 5ICGA 2BV6A 3DKWA 1P2FA 2VXZA 3FXQA 2QYOA 2FEZA 3TDUC 1XCBA 2M87A 3DFGA 3MFKA 1B59A 1SFUA 3P7NA 1P4AA 5ICFA 4A6EA 3I71A 1XGNA 5J8FA 3KE2A 3M1EA 1DP7P 3JW4A 1MDMA 3M8EA 5L3CA 1T0FA 5HVQC 1W7PA 1K78A 3ZP5A 1G4DA 2EFWA 1IW7F 4S04A 1R23A 2QBYB 3IWZA 1GXPA 4MTDA 4ZZDA 2F5FA 3GF2A 3DF8A 5TRDA 4LGWA 1Z9CA 3L00A 1X3UA 3DQVC 3QAHA 2G7UA 3HSRA 2EA4A 5HLGA 3FHZA 1SMYF 3Q5FA 2QZ8A 4G8XA 3RKXA 3D5LA 4AIHA 1L0OC 5L3EA 4LG0B 1S3JA 3FX3A 2NAZA 1KYWA 2F2EA 1XGMA 2ZCWA 5ICCA 4GGGA 3HSFA 4IVNA 1GHCA 5D4SA 1D3YA 4ENJA 1FPQA 1LQ1A 3JTGA 1J5YA 3SQNA 2XKOA 1S7AA 1TQPA 2V79A 4CYDA 4M73A 2OQRA 5FFXA 2DU9A 3RYRA 3QU3A 4I0BA 4LK1F 2YX7A 2P7VB 3TQNA 3RPUA 1K6OA 3RPQA 3ZMUA 1LVAA 4A12A 2PN6A 4L5JA 5JVTA 5CVUA 4U7DA 2LKPA 3MCZA 5CLSA 5HLIA 2ISYA 5D5XB 1YW7A 2DT5A 2GXBA 3WTSC 4AIKA 5FO5A 3FXRA 4WWCA 4HV5A 4XLNF 1KQ0A 1LJ9A 3FMQA 5HDGA 3WGHA 3J7AO 2MLGA 1P4WA 2HYFA 5LGTA 3F8NA 2P5LC 3P9CA 4M6YA 2DAOA 3H3UA 5DEQA 2CW0F 2PBIA 5ICEA 3V8LA 3KETA 3HUGA 5JHUA 4BHCA 1O7LA 2EV0A 3JSPA 2P4WA 2D2WA 1FYLA 2LF8A 3LSTA 1Z05A 2QQBA 3ZQ7A 2EB7A 3I64A 2HKXA 1U5TA 2HFHA 2QWWA 3I59A 4NQWA 3HTSB 1OMIA 1TNSA 4CDGA 1ZLJA 5A2QZ 4BYYA 4YIFA 1PUEE 5BS6A 3I58A 3W6JB 5ED4A 2PI0A 1RUNA 3I5UA 4OU0A 1NHAA 2HKOA 3LWFA 1T39A 1QNTA 4AVPA 2HQNA 2ZNYA 2PMHA 1YTYA 1JXSA 2EFNA 2IPQX 3GXOA 5HS7A 4BHBA 3KCCA 2H6BA 5HOOA 2Q8KA 4PGHA 1LEAA 2ISZA 1U2WA 3MAJA 2XASA 3V7SA 4QLCU 4IPAA 5A2QK 5D5UB 2K02A 3WE2A 1LB2A 4OOIA 5CVRA 4RB3C 4ZYEA 2OAZA 5K5QA 1TW3A 3CUOA 1A04A 2HTJA 4O6JA 2CFXA 2A5YB 3V8KA 2Z9OA 4A0ZA 3WU1B 1O3QA 5DCMB 3DPLC 4Z2YA 4G7HF 3KP7A 1AOYA 1USTA 3TDZC 2KKOA 3T0YA 5D8LB 4HF0A 3TOBA 4KMUX 4P5OA 2W24A 4RB0A 3KFWX 1XGSA 1UFMA 2L4MA 1BI1A 1R36A 3RKYA 1G3WA 3KLOA 1I27A 4JQFA 1XSXA 5F1RA 2L01A 1MKMA 4LMYA 4PDKA 3K9TA 4EVIA 5D5WB 1YIOA 3GFJA 1Z91A 1BI0A 2BE5F 1I5ZA 3LA3A 3FF5A 1U8RA 1RIOH 4LLLA 2A07F 2FOKA 3BP8A 2EFPA 2VBWA 3M7GA 3GZ6A 4HZFA 3ISPA 1K7AA 2V1DA 2IA1A 1MDMB 3F22A 1W4MA 5DYMA 4QWQA 3VODA 2UZKA 4L9NA 1HW5A 1E2XA 4YG2F 2FBKA 2MLKA 1ZARA 4ETSA 2FA5A 3GZ5A 2LSOA 3OOPA 4BH9A 2P6TA 1R58A 3E5UA 2VBYA 2Z3YA 2ZO4A 1W5SA 4KT5C 3MZHA 4WXDA 1GVJA 3U2RA 3RIRA 4KICA 4KIFA 3LQQA 1KQ9A 2FSWA 3T8RA 4Q48A 2XAJA 1ZRDA 2A61A 2CQKA 1IN5A 5E17F 1FNNA 4YFNF 4M72A 1FBUA 3FM5A 2D1HA 2MH2A 1LNWA 3D0SA 4CHUA 3DP7A 4HOBA 3VB2A 4RGRA 3P9IA 2R7DA 3BPVA 4HV6A 4G9YA 3DXJF 2XV4S 3KZZA 3FZVA 4MQ9F 1J2XA 2IVMA 3K69A 1QPMA 4HX4A 2EFOA 3BJAA 2BEOA 2H6CA 1REPC 2GZWA 3W6KB 2K4BA 1FBSA 3E5XA 4RAYA 3M9AA 2COMA 3KLNA 2DK5A 5BMZA 3ZPLA 4L0YB 4RB1A 5H6RA 1SMTA 3G3ZA 1IN7A 3O2PE 2JRTA 1HKSA 4P55A 4EJUA 1TLHB 2HZTA 1STZA 2G9WA 3ML6A 5DDGA 3QU6A 4IF4A 4HF1A 5CYVA 4ZZLA 3BOQA 1IAWA 2ZFWA 4RB2C 4WX9A 5L3BA 1EH8A 2W25A 3E6DA 1V3FA 4L5IA 3U9GA 1HSJA 3WGIA 2ESNA 3GFLA 3RDIA 1H9GA 3KP6A 1CGPA 3RTRA 3EYYA 2XAGA 5FB2A 3EQLF 3TO9A 2Q0OA 1U5TB 2ZBKA 1LEBA 2B0LA 2CYYA 3I4PA 1XN7A 1EH7A 3V4GA 4ENNA 4MQVA 5AIQA 4MEXF 1U5TC 1YYVA 4GCVA 2V6CA 2M30A 3CTAA 3MQ0A 2YPRA 3R60A 3F3XA 3AAFA 2Z5UA 3QP6A 5ILVA 2CSOA 4HLXA 4XBFA 4KDPA 4N0BA 1QQIA 2DW4A 2IP2A 4UVBA 3EYIA 2L4AA 2P5KA 3SFZA 2E7XA 1P6RA 2NNYA 2ZMEB 1KA8A 2C6YA 3SXYA 4AIJA 1BM9A 1H0MA 2P7CB 3HOTA 1XB4A 2JSCA 4EGYA 2ADUA 4RGUA 2HOEA 3BROA 3CJNA 4A5NA 1J75A 1UHWA 2VE9A 5J6XA 2DI3A 4OMZA 4ESJA 1W7PD 3K1NA 2A6EF 2FQ3A 3T8TA 3EDPA 5FD5A 2VBXA 5E8GA 2RNJA 2R7FA 1UCRA 4ZYGA 4GYGA 2O3FA 2OD5A 3ECOA 2VN2A 4PCQA 2VONA 3CUQA 2AS5F 2A6HF 2XUBA 1ZG5A 1GXQA 2VC0A 1LDDA 1TW2A 5ILSA 1L3LA 1USSA 1G3TA 1R1VA 4L9JA 1OYYA 3NEUA 5EEHA 3JAMZ 3WTYC 3LAPA 3LQRA 3J81Z 4KN7X 2JTVA 4E70A 2W57A 4M9ZA 3WTZA 1ZYRF 3ZMZA 5LGUA 4FX4A 4S05A 4OIRF 1TNTA 3U1DA 3WTWC 1SD7A 2RGVA 2D1VA 4CICA 3T5XA 1O7FA 3KZYA 2MD5A 1G3YA 2H09A 3KP4A 3PQJA 3JAMK 3N4MA 5F64A 5D4RA 3J81K 4F7ZA 3SHFA 5H6QA 2O0YA 4OIPF 2XAHA 4U0YA 1KU7A 1PP7U 5BOXA 4RS8A 2Q2EA 3WTXC 4M9SA 1JE8A 1JHHA 3GUDA 2FNPA 1G3SA 4IXAA 3ULQB 5FD6A 2P8TA 2DTRA 1HW2A 1Z6TA 1SFXA 3BWGA 3Q9SA 2W85A 1XMAA 3CDHA 3L09A 1FOKA 4LJZF 1IXRC 3VFZA 4YIIA 2EFQA 3TO6A 4DQ2A 5H20A 4HQMA 2XAQA 2IA0A 3GLXA 1Z6RA 2X0LA 4WF2A 5LGNA 4PGGA 3S2WA 4YFXF 1HBXG 1C0WA 3NRVA 1ZH5A 3R6SA 2O61A 4EV0A 3KP2A 1T38A 1KGSA 1S8NA 1FWZA 3E6MA 3REOA 2EV6A 2OQGA 2K4JA 3RYPA 1B6AA 3F8MA 3R0JA 4R1HA 4Y15A 3G73A 4Q5SF 2D45A 2HEOA 2GA2A 2EK5A 3WTUC 4U7BA 1B4AA 3LA7A 1WQ2A 1HW1A 1D8KA 1XGOA 1BI2A 4UVCA 3HRTA 1P4XA 4A0YA 2DQRA 2HWVA 3M8FA 4EMSA 2IRFG 4R79A 1ON2A 3LFKA 1IUYA 3J80Z 1PP8F 2QUFA 2YU3A 1FC3A 2CGPA 4UHTA 1D5VA 1JHFA 1XCVA 2ESHA 3IRQA 1IF1A 2MC3A 4O5VA 3COAC 3F23A 4NHJA 3HTUA 4ZH4F 3IL2A 4NB5A 1DPUA 2G7HA 2NYXA 4KUMA 1R1UA 2WC2A 4L9TA 4MHGA 4LG0A 2TDXA 1BJAA 4A6DA 1TQIA 4RGXA 1J7KA 1KU3A 3J80K 1BN5A 1ZGAA 5LHHA 1P92A 4ENMA 3C18A 4EM1A 2M1BA 5E20A 5L3GA 2KJCA 2VT2A 3FM3A 5D6FA 4IJAA 1YFHA 1ZRFA 3SZTA 2GXGA 4U0WA 1ZLKA 4RGSA 1CF7A 3BJOA 1XSDA 4I2OA 3F6VA 3CO6C 2FNAA 1W7PB 1R00A 4FHTA 1K78B 4JK1X 5LEKA 5DUIA 2FE3A 5HS8A 2HGCA 3F8FA 1ZREA 1QBJA 1FBQA 3QRFF 4ZYDA 3TO7A 2WV0A 1BC8C 4EM2A 2L3DA 4IHSA 4M71A 3FMRA 4OMYA 2R3SA 5L3FA 3IC7A 3CO7C 3B73A 3KP3A 4IRGA 2RKHA 2H94A 5CVVA 2OU2A 2HTSA 2PJPA 3E3VA 1IN6A 3GW2A 1ZN2A 2FBHA 4TV7A 2VBZA 1O57A 2FRHA 5E1WA 4ON0A 2RVCA 1SAXA 2QVOA 2RDPA 1QZZA 1IXSB 3IHUA 1SD6A 2ZJ2A 5K5OA 1SD4A 3C3WA 4FT8A 2OBPA 2DPUA 1WKMA 3F21A 3V8JA 3ZMVA 2OZUA 3HHHA 4UUVA 5LRRA 3KEQA 1MJ9A 3V7CA 2RV8A 4R8HA 4HW0A 1H9TA 4A2UA 1WSUA 1QO0D 1R1TA 2LF7A 5HDNA 2PMUA 1RNLA 1U78A 1TBXA 5E18F 2J5PA 3RKWA 4LD5A 4ENKA 4KN4X 2KRFA 3P9KA 1SD5A 3F72A 4P96A 1I1GA 2DLLA 2STTA 1T98A 2F5DA 2GQQA 5BQTA 2V1XA 2QENA 4HX7A 4BQAA 3HOSA 1FSEA 3BZ6A 2PLYA 3I53A 3WTVC 4JBAA 4LLNA 2EV5A 1AWCA 3DEUA 3HRUA 2QQ9A 1TQMA 2DQLA 3GEZA 3RI4A 1MZBA 1ON1A 3GO5A 1WI9A 2BYVE 1OKRA 4B8XA 4IHTA 1SFEA 1LDKB 5BPIA 1B1BA 4ASNA 2QQAA 3H3ZA 4KIBA 3F6OA 3I59B 1WRJA 3F8BA 1ZAOA 1OYWA 4OIQF 2P6SA 3GYHX 1F1ZA 4CO8A 5IT9K 5D6EA 1BI3A 4XSZF 3VEPA 2FF4A 3ROUA 2VOPA 1RI7A 1BOAA 2HDCA 1V4RA 2VC1A 4LB5A 3HRMA 2H27A 1XMKA 3E5QA 3IWFA 2EWNA 2WTEA 2VE8A 4EQQA 5DD4A 1FZPB 1U6GA 2XRNA 2Y48A 1HXDA 2NNNA 5J8CA 1HQCA 2O03A 3DV8A 3ZMSA 1OPCA 2IW5A 2F5EA 2HR3A 4B09A 3MZYA 1Z7UA 4AD9A 2MH9A 2PEXA 4WXHA 4YFKF 2K7LA 2CG4A 2E1CA 1ODDA 5BPDA 1D8JA 3I0TA 1XDUA 4HF2A 1O3SA 4G7OF 1HKTA 1IN4A 3LAJA 1FY7A 2KIUA 2XGXA 2YR2A 1YW8A 3I54A 2K27A 3RJPA 2DK8A 3GFIA 2ZXJA 2BGCA 2XVCA 4KYWA 1ZHFA 3KP5A 2PQ8A 4XRFA 3ABTA 1S6LA 1ZGJA 2ACJA 2A68F 2RC4A 4M74A 1E17A 4GO1A 4ESBA 2Y0MA 5JR3A 3HHGA 1CF7B 4M6XA 2XAFA 1FLIA 5K5RA 4EJWA 2GWRA 2YSRA 3Q9VA 1OYIA 1YG2A 3QPTA 2M5WA 2HQRA 3EUHA 3E97A 4FX0A 2FBIA 4KA4A 5E1ZB 2O6GE 1ZG3A 5DD8A 3R0AA 2V1UA 4EGZA 4I7HA 4L9VA 3EETA 1R5HA 3WGGA 5DCFA 4MNUA 2VOOA 2L54A 4UNOA 2NS0A 1JGSA 1ZG1A 4CZZA 1FT9A 5LRSA 3B02A 4AWXB 1G6NA 4LLGF 3K2ZA 1IN8A 3TGNA 3KEOA 1FX7A 1J0RA 3T1BA 3WODF 4P9FA 4ZYHA 4BAYA 1KU2A 5LHGA 1QGPA 2FU4A 2VT3A 5HDKA 4U0VA 2P5VA 4LB6B 2JPCA 3GVAA 3GX4X 2IT0A 2ZNZA 3SZPA 1T6SA 4I09A 2YX4A 5ILUA 3MWMA 4CGZA 3IRRA 3TKYA 1HKQA 3WG9A 1IZ1A 2WWYA 5LEJA 2ZKZA 4HA8A 1BC7C 4PZJA 4Y17A 1ONVA 1BIBA 2V9VA 2RQPA 1BBYA 5JI6A 3N97A 2E1NA 4GXOA 4UV9A 3WE3A 4G6DA 1MGTA 3DPTA 1Z1DA 4L0ZB 2ETHA 1B9NA 1YS7A 3F8CA 6PAXA 2KIFA 2UXNA 4OIOF 3ZN1A 3ABUA 2ZMEA 3CLOA 1KU9A 1S7OA 4HYEA 4HQEA 3ZMTA 5FLXZ 1DPRA 3ECHA 3HRSA 3JSOA 2DPDA 4XSXF 4RAZA 1J59A 4A5MA 4UV8A 2QBYA 1O3TA 5LLQA 3HIFA 4LK0F 4BNCA 2L02A 5K1YA 2MA3A 5CVJA 1KQ8A 4HBLA 1UHMA 5KK1A 2STWA 2Y75A 1BIAA 1OR7A 4KMFA 1O3RA 3K1PA 4A0XA 4Y13A 3R4KA 4UXNA 3K1MA 2LNBA 4N9IA 3HSEA 1YQAA 1R7JA 5D5VB 2QM3A 4WXCA 1YS6A 4HDVA 1UB9A 5KVRA 4KIGA 1I1SA 1ZRCA 5FLXK 4KNYA 3H92A 2Z99A 3VOEA 5AIPA 1W5TA 4BXUA 3C7JA 3QP5A 2NRAC 4EM0B 1MJBA 2UWMA 3IKTA 4DNCA 4WK8F 4MEYF 1FSHA 1FP2A 5EEGA 3TOAA 1I6XA 3QOPA 3OV8A 4HX8A 3FMSA 2LDUA 2DO7A 4L18B 1S29A 1R22A 4UVAA 2FMYA 4Q47A 1U3EM 3GFMA 4U88A 4OINF 1FYKA 3BY6A 2JPBA 1LDJA 2EA2A 3ZMDA 4K2EA 2K86A 4P9UA 1F9NA 2FXAA 1K79A 2X4HA 4I98B 4M9XA 4EJTA 3WU0A 3BPXA 2A69F 3WTTC 2ELHA 1TTYA 2MBFA 5FFZA 3CUQB 2F5CA 2GAUA 2PG4A 3LA2A 1EH6A 1IRFA 1VTNC 1J9IA 5F6FA 3FXUA 3O6BB 3ZN0A 2VODA 2PFBA 4D0PA 5HLHA 3CUQC 3QPHA 3ELKA 1Q1HA 5HS9A 3MEXA 5ERIA 2DFIA 1MJAA 3NQOA 2KJBA 4H0EA 3ERED 4N9HA 2XKPA 4HDUA 4IRIA 3PQKA 2IA2A 4EJOA 5CVIA 1XDSA 2CWEA 2UXXA 3L9FA 2QLZA 1RZ4A 4XLPF 2KIMA 2GA1A 2XIGA 2DBBA 5LBQA 1YO5C 2OA4A 1PDNC 4BHPA 1MD0A 1YLFA 2EJRA 2RN7A 5LHIA 4G7ZF 1HSTA 3O3KA 1WWXA 3K0LA
chains in the Genus database with same CATH superfamily
4CA0A 3CC2I 4I0AA 1ULYA 3BLYA 4NDLA 2W1OA 1UZCA 4XICA 1IRGA 1N78A 1OJLA 4IRHA 5E1XA 5FGMA 1N77A 3JTHA 1F4KA 3L7WA 4LOCA 3OYAA 1GV5A 4ESFA 2VLAA 4G6QA 5F0FA 5EG0B 2Z33A 3EUHC 4XL9A 1EV7A 3OYNA 3HOVJ 4A3LJ 3BTLA 4U87A 2F4OB 1YITI 1X1PA 1ETQA 2FMLA 2JZYA 5D8KB 5KNLA 2OZ6A 3LOCA 3GTLJ 2HYGD 4HAMA 1Y0UA 1DUXC 5IT9Z 2J5OA 3E6BA 1T2KA 1D0YA 3AFHA 2Q2EB 1XD7A 2O8XA 1R4MB 5TJJA 1IC8A 5IOZA 1IXCA 5JLWA 2XAUA 5E8IA 4A3MJ 4MGRA 3MKWB 4L5EA 4KFCA 2E7WA 3HYIA 4Q4ZF 2CV1A 1P9QC 4I02A 1B72B 4BBRJ 2LK2A 1MW7A 4IL6C 5AONA 2A3SA 4HLYA 4IHYA 3KYDB 2O8KA 3C1DA 3E7LA 3V7RA 1T8IA 2DFFA 3W2WA 3DPUA 1QZYA 3PFIA 1XC5A 3GWZA 4CXFA 1AKHB 1DGRM 3FWEA 1YI2I 1OCCH 4D5FA 5FROA 2CO5A 5DUKA 2M45A 3BG6A 4WCGA 1MSEC 2BBYA 2XROA 3R61A 1H89C 4MTEA 5IT3A 3BC8A 1YW9A 2GBYA 3L2CA 1W36D 5B3SH 1KYZA 4ANJA 2QQ8A 2HS5A 3KEYA 1LPQA 1A6QA 5DCMA 5L3DA 3BDDA 1DDNA 2W84A 2M8EA 1F36A 2XDVA 4BJ6C 1JUSA 2V7FA 1F5TA 3I4NJ 4EJVA 2AXLA 1A36A 3GTMJ 2GIVA 2ECBA 1FYMA 4G94A 4DW6A 5CJ9A 1XSVA 2IJLA 3E6CC 1FP1D 3CQZJ 1LFPA 3BJ6A 3BQYA 1R5GA 2JT1A 4I01A 3K4JA 3S8PA 2R5YA 4GYIA 2E1MB 5M5WJ 5DV5A 4LFUA 4O3MA 2R93J 3IKVA 4BJTA 2K9QA 1B9MA 2XHKA 1SVMA 1RUOA 4XLEA 5JFRA 5ICGA 2BV6A 1BJZA 1IUFA 4BEHA 2L7KA 1I3AA 3DKWA 1P2FA 1MBKA 1VF9A 2E60A 2VXZA 1S7EA 2E1MC 2DA5A 3D5RC 1TT5B 3CCMI 1JKOC 2M9HA 3DBRB 3H9QA 2R7TA 3SZGA 3FXQA 5EEAA 1J09A 2QYOA 3K70C 2E2IJ 2DDBA 1WHUA 3OY9A 2FEZA 3TDUC 3HOUJ 1XCBA 2M87A 3DFGA 3MFKA 4F93B 1B59A 2VIXA 1SFUA 4RMNA 2K40A 3P7NA 1P4AA 3LFUA 5ICFA 2BXZA 4A6EA 3I71A 3CCLI 3DTKA 1XGNA 5J8FA 5JLXA 3KE2A 3M1EA 2BY1A 1DP7P 1LUJB 3JW4A 1MDMA 2LBFB 3M8EA 5KAFC 5L3CA 1HA8A 2DN0A 1T0FA 2CQXA 4FTHA 5HVQC 2XRLA 3PO3J 1W7PA 1K78A 2NVXJ 1G8XA 3ZQFA 3ZP5A 1VQOI 1X2NA 1OLTA 1MMGA 1G4DA 2V1NA 3M8JA 1IW7F 2EFWA 4HNUA 4S04A 1R23A 2QBYB 3OS2A 3IWZA 2WADA 4A69C 1GXPA 3GTPJ 4MTDA 1QVTA 1ETWA 1YHQI 4ZZDA 3S3NA 2EZLA 5B5EC 1SANA 1BW6A 2F5FA 4UB6C 3GF2A 3DF8A 4LGWA 5TRDA 1Z9CA 3L00A 1HOMA 4E7LA 1X3UA 3DQVC 4HNVA 3QAHA 3CMMA 3JRHA 2G7UA 3HSRA 2EA4A 5HLGA 3FHZA 1SMYF 3Q5FA 2QZ8A 4G8XA 3RKXA 5HNFA 3GLLA 1LFBA 3D5LA 4AIHA 1E0EA 1L0OC 4MIMA 5L3EA 1T95A 3GTOJ 4LG0B 1S3JA 3FX3A 2WY8Q 4DYRA 1XMXA 2NAZA 1KYWA 3L2WA 2F2EA 2UV1A 2R7SA 1OR7C 1PUFB 1XGMA 3OYIA 2ZCWA 4Y4RA 1R4NB 2BW3A 4GGGA 4ZC3A 5ICCA 3HSFA 4IVNA 3A01A 1GHCA 5D4SA 1D3YA 3OYCA 2A5WA 4ENJA 3OMYA 1FPQA 1K83J 1LQ1A 4JP0A 3JTGA 1J5YA 4BL0B 3SQNA 2AQEA 2XKOA 3L2QA 3TW6A 3OWTA 5GPAA 4GDFA 1S7AA 1TQPA 2V79A 3PNVA 4CYDA 4XIDA 4M73A 3FKJA 1YIJI 2OQRA 5FFXA 2DU9A 3RYRA 3QU3A 4I0BA 2HI3A 4AVZA 2W00A 3AG1H 4LK1F 1Y1WJ 2YX7A 5E3OA 2HYJA 2P7VB 4G6TB 3TQNA 3VWBA 3RPUA 2EILH 4PSWA 3CESA 1ENHA 4V2GA 3CJTB 3RPQA 1K6OA 1MBGA 4X0GA 3ZMUA 1LVAA 4A12A 2PN6A 2L5QA 2LY2A 3JCUC 3MD2A 4L5JA 5JVTA 5CVUA 4U7DA 2LKPA 3MCZA 5CLSA 3BCBA 1CQTA 2I8DA 5HLIA 3PL8A 3OYFA 3O8GA 2ISYA 3K4CA 2BHZA 1POGA 1R9TJ 2L9SA 2WY7Q 2KISA 5D5XB 1G2HA 1WJFA 1YW7A 3FHNA 3S14J 3FXMA 4QPQA 2DT5A 3CF2A 4B44A 2GXBA 3WTSC 4AIKA 1NK2P 5FO5A 3FXRA 2DMUA 2VKDA 2NS8A 4WWCA 4HV5A 4XLNF 1KQ0A 1LJ9A 1MBHA 3FMQA 2CV0A 5HDGA 4PUSA 5EZHA 3WGHA 3J7AO 2MLGA 1P4WA 2HYFA 5LGTA 3K4LA 3GTQJ 3F8NA 2P5LC 3S3MA 3P9CA 4KITB 4M6YA 2DAOA 3H3UA 3UR3C 4DZPA 5DEQA 1BR1A 3DTIA 3U1KA 2CW0F 2PBIA 4KISA 4F3QA 5B66C 5ICEA 3V8LA 1Y39A 1QA6A 1HC8A 3KETA 3HUGA 1HF0A 3ASNH 3PUBA 4YRVA 5JHUA 2KDOA 1A35A 4IHVA 4BHCA 1MMDA 1O7LA 2EV0A 3JSPA 2P4WA 4XNFA 2D2WA 2IBDA 1FYLA 1ZTRA 3I3LA 2LF8A 1GVDA 2DJNA 3LSTA 2XF5A 2BVLA 2E2JJ 1Z05A 3X2QH 2QQBA 3JRAA 3ZQ7A 3BR2A 1AA7A 1A6IA 2EB7A 3I64A 1FTZA 2HKXA 3K6GA 2WAEA 1U5TA 2AO9A 2MABA 2HFHA 2V4JC 4B3AA 2QWWA 4CCMA 3I59A 4NQWA 3HTSB 1OMIA 4BE2A 3S1RJ 1TNSA 4CDGA 1ZLJA 2OC6A 3OIQA 2ZC2A 5A2QZ 3RQ4A 4BYYA 4YIFA 1PUEE 1WH7A 2CW8A 2H8WA 5BS6A 5DM6F 1X1AA 3K4MA 2VASA 3I58A 3W6JB 2JA5J 1GV2A 5IP6A 4IO9F 4AC0A 2IGKA 2JVHA 4D5CA 3BTCA 5ED4A 3BR1A 3LSHA 2PI0A 2QSFX 1RUNA 3QODA 3I5UA 4OU0A 1QRYA 3K70D 1NHAA 2HKOA 2R7VA 3SDGA 4UB8C 3LWFA 1T39A 2EIKH 3VYTB 1QNTA 2GOMA 4AVPA 2HQNA 1Y56A 2ZNYA 2PMHA 2DFEA 1YTYA 1JXSA 2EFNA 2IPQX 3GXOA 5HS7A 4BHBA 3EUKL 3KCCA 2H6BA 4XLFA 5HOOA 3CJRB 4PGHA 2Q8KA 1LEAA 2ISZA 1U2WA 3PNYA 3VSKA 3MAJA 2LYCA 1PYVA 1TWHJ 2XASA 3FXOA 1IDZA 3V7SA 4RM2A 4QLCU 2O7OA 4IPAA 4QIWN 2CMPA 1VQ6I 1FEXA 5A2QK 1SFOJ 1ZELA 5D5UB 2K02A 2WBMA 3WE2A 1LB2A 4OOIA 5CVRA 3TP3A 4RB3C 2GM4A 1HLVA 3VSLA 5HLTA 4ZYEA 1WJ5A 2OAZA 5K5QA 2L7ZA 1TWAJ 1TW3A 3CUOA 1OCZH 1A04A 5IOYA 2HTJA 4O6JA 2CFXA 1GT0C 3CC7I 2A5YB 3S16J 1X4OA 3V8KA 3S15J 2Z9OA 2MD0A 4A0ZA 3WU1B 1FMWA 1W36C 1PJRA 1O3QA 1TP4A 3WHCA 1I6HJ 5DCMB 1ETOA 3DPLC 4Z2YA 5TISC 3MZ8A 4G7HF 2OUMA 3KP7A 1AOYA 1USTA 5C4XJ 3TDZC 4RDUA 2KKOA 2A05A 5E3MA 3T0YA 5D8LB 1HDDC 3OYMA 2DCEA 4HF0A 3OL3A 3TOBA 4KMUX 1Z77A 4P5OA 2W24A 4RB0A 4HEA2 2JVGA 1IRXA 3KFWX 2QKMB 4IQJA 2FJ1A 2WV1A 2DT6A 2XPWA 1XGSA 1UFMA 2L4MA 2IS4A 1BI1A 1R36A 3RKYA 1G3WA 3KLOA 3TW7A 2YS9A 1MNMC 1I27A 3FXJA 3FBIB 3LNQA 4UUTA 2JN6A 2LP0A 4JQFA 1XSXA 4HG2A 2ME0A 4BEHB 5F1RA 4CYCA 2L01A 3PFYA 1MKMA 3I4MJ 4CCNA 1DQUA 3QYFA 4LMYA 4PDKA 3K9TA 3ERMA 4XR6A 3FKIJ 4EVIA 5D5WB 1YIOA 3GFJA 3KZIC 1YOVB 2XF6A 1Z91A 1BI0A 2BE5F 1I5ZA 3LA3A 5EZGA 3FF5A 3S17J 1U8RA 1RIOH 4LLLA 2I10A 3PNTA 2A07F 5EJCA 2FOKA 3BP8A 4PSXA 4B48A 2EFPA 2VBWA 3M7GA 3GZ6A 2VQGA 3UNGC 3Q0WA 3EUAA 4HZFA 2NVTJ 3ISPA 3RQIA 1K7AA 2V1DA 2IA1A 1MDMB 3E1SA 2ID6A 3F22A 1W4MA 5DYMA 4QWQA 3VODA 2UZKA 4L9NA 4DZJA 1HW5A 3PIOF 3S1QJ 1IRZA 1E2XA 4YG2F 2FBKA 5CKTA 2MLKA 4D7MA 1ZARA 3ESWB 3BG5A 4ETSA 2FA5A 5IP7J 3OR2C 3GZ5A 2LSOA 3OOPA 4BH9A 2P6TA 3CC4I 1R58A 3E5UA 2AQFA 2VBYA 1JGGA 2BHYA 3S3OA 2DOFA 3QWLA 2Z3YA 2ZO4A 3F9KA 3ZOBA 1W5SA 2ECCA 3A1YA 4KT5C 2W4SA 2QSGX 4I76A 3MZHA 4WXDA 1WJEA 3UKGA 3SJMA 2DMQA 3OYLA 1RESA 3JRGA 1GVJA 3U2RA 3RIRA 1Z0XA 4KICA 4KIFA 3LQQA 1KQ9A 2FSWA 3T8RA 4DOZA 1NG6A 1X19A 2XAJA 4OAZA 4Q48A 2O5RA 4A3CJ 5IYCJ 1ZRDA 2A61A 2EIJH 2CQKA 2W48A 4XLHA 1IN5A 4ZDLA 4A3KJ 5E17F 3IAM2 3A4CA 1MH4A 3J7ZI 1FNNA 2L0KA 4YFNF 1K4TA 4M72A 2F48A 3ZQQA 5FKMA 3CZ6A 1ETXA 3W3CA 1FBUA 1JI8A 2NVQJ 3SEQA 4UY8I 4PFPA 3FM5A 2D1HA 2MH2A 3A0BC 1XTAA 1LNWA 3D0SA 2HXIA 4CHUA 4ZDPA 3DP7A 1X1CA 4HOBA 1YRNA 2DT7B 3VB2A 4RGRA 3P9IA 2R7DA 3BPVA 2VPRA 3A2KA 3KX2A 4HV6A 2LD5A 2EZHA 3DXJF 4G9YA 2XV4S 2XC7A 1F43A 2KT0A 3KZZA 2RAEA 3FZVA 4DYCA 4MQ9F 1J2XA 2IVMA 3K69A 3HOXJ 2EPFA 1QPMA 4BE1A 4YELA 3IV5A 4A93J 2OPTA 4HX4A 2EFOA 4ZYAA 4M3FA 3BJAA 3CCRI 2BEOA 4XLCA 2H6CA 2KRHA 1ERDA 1REPC 2GZWA 3W6KB 2K4BA 2ZXHA 4A3EJ 1FBSA 2R5ZA 3JREA 3E5XA 2NVYJ 1RETA 4RAYA 3M9AA 1VQ9I 1ETVA 2KPMA 2COMA 2M7BA 3KLNA 4W1UA 4HNTA 4RAGA 2E35A 2HQAA 2DK5A 2ZXIA 5BMZA 3CCQI 3I55I 3RZOJ 2ZB9A 3K4NA 3IP4B 3ZXSA 1H8AC 3ZPLA 4L0YB 4BU2A 3JR9A 2CQNA 2V9PA 4W97A 3RCOA 4RB1A 5H6RA 3FBNB 4XKBA 1SMTA 3G3ZA 1IN7A 3O2PE 1OFCX 2Z1DA 5F1JA 2JRTA 1HKSA 4P55A 4EJUA 1I50J 1SC7A 1TLHB 2OJED 2M3AA 2VQCA 2HZTA 1STZA 2G9WA 4J01A 3ML6A 1Z21A 5DDGA 3DWLE 3QU6A 3M07A 3BG7A 4IF4A 4II3A 3VYRB 5J3LA 3LSRA 4HF1A 4PJLA 1JKPC 5CYVA 4ZZLA 4E6KG 3L2RA 3D5SC 1Z3YA 3BOQA 1IAWA 1T08B 2ZFWA 2VKVA 4RB2C 3L2UA 4WX9A 4CCOA 3HUGB 5L3BA 1EH8A 1LE8A 2W25A 3E6DA 1V3FA 4GRIA 4L5IA 3U9GA 1HSJA 3WGIA 2ESNA 4PJJA 3GFLA 3RDIA 1H9GA 2WB1A 2R7XA 2DTZA 2GOXB 3KP6A 4I6ZA 1CGPA 3NWSA 3RTRA 5HNHA 3EYYA 2XAGA 3J7YJ 3O8HA 5FB2A 1V5EA 3EQLF 3DLLF 3TO9A 2Q0OA 2OF7A 2V9KA 1U5TB 1AHDP 2ZBKA 1LEBA 2B0LA 2CYYA 2DMNA 3I4PA 4E4HA 1MMAA 1Y0NA 1XN7A 2UUZA 1EH7A 1A5JA 3V4GA 4ENNA 1JT6A 4A3JJ 3OL4A 4MQVA 5AIQA 4MEXF 1U5TC 1ZR4A 4CUGA 1YYVA 2MW8A 4GCVA 5J1YA 4A3FJ 2V6CA 2ZJPF 4BXFA 2M30A 2ELJA 3CTAA 3MQ0A 4FASD 2YPRA 3FK7A 3R60A 3F3XA 2VJ4A 3AAFA 2Z5UA 3QP6A 5ILVA 4UUSB 2CSOA 4HLXA 4XBFA 3S2HJ 3H0DA 4KDPA 1B8IB 3HOZJ 4N0BA 1QQIA 3RKQA 2E19A 2DW4A 4BDYA 3IUOA 3OIPA 2IP2A 4M3GA 1OISA 4UVBA 3EYIA 2L4AA 2P5KA 2OTLI 1WJBA 3SFZA 5EGOA 2E7XA 2EIMH 3K4BA 2CQ7A 1P6RA 1IG7A 2EZKA 4F92B 2NNYA 5CQEA 4Y52J 2ZMEB 1KA8A 2C6YA 1P7IA 3ABMH 3SXYA 2PJRB 4B4CA 4AIJA 4XRSG 2KFDA 2VI6A 4NNJA 1BM9A 1D0XA 1H0MA 2HPIA 2P7CB 1SVLA 1XB4A 3HOTA 2JSCA 4EGYA 4AU7A 2ADUA 4RGUA 3HBLA 2HOEA 2VJ5A 1VQ8I 1ETYA 2BY0A 3BROA 2FOWA 3CJNA 4A5NA 4EATA 3JRIA 1J75A 1MMSA 2ZMEC 1UHWA 2VE9A 1YJ9I 4E7HA 5J6XA 5E3LA 1W5CC 2DI3A 2R92J 4OMZA 4ESJA 1W7PD 1VQKI 1QHGA 4BUPA 5J47A 3K1NA 3GTGJ 1D0ZA 2A6EF 2FQ3A 1RR8C 3T8TA 1X1DA 3EDPA 5FD5A 3MVPA 4FCYA 1OQYA 2AXTC 2PX9A 2VBXA 5E8GA 4C2UA 1MBEA 2RNJA 5F08A 2R7FA 1UCRA 4ZYGA 1TWCJ 1JT0A 4GYGA 2O3FA 2OD5A 5IYDJ 3M4OJ 3ECOA 4ZJZA 1DGWY 4RLQA 3M3YJ 2XF7A 2VN2A 4PCQA 5F27A 2VONA 3CUQA 1P7JA 2AS5F 2JMWA 5EF6A 2A6HF 2XUBA 5K7FA 1ZG5A 3HG9A 1GXQA 2VC0A 2N8GA 1LDDA 5F0HA 1TW2A 2KP6A 3CP2A 2KHMA 1K4SA 3G1LA 5ILSA 2L7MP 1USSA 1L3LA 4XORA 3ZCOA 1G3TA 1R1VA 4L9JA 1OYYA 2DMPA 3FK6A 1IJWC 4ITVA 1R49A 3NEUA 5EEHA 4F52A 3JAMZ 3WTYC 3LAPA 4A3GJ 2H1KA 3LQRA 2JUCA 3J81Z 2ZXWH 4KN7X 4MLOA 4HSRA 2CH0A 3BR3A 5B1BH 2M4KA 1X58A 2COBA 2JTVA 4E70A 5IPAA 2W57A 2QA4I 4M9ZA 3WTZA 1ZYRF 1MMNA 1I3QJ 2DXIA 1M1EB 5J4YA 3ZMZA 2JA8J 5LGUA 2CU7A 2TRTA 1JUMA 4FX4A 3HJEA 1UMQA 4C3IJ 4OIRF 4S05A 2M0MA 3NARA 2JA2A 5C44J 1TNTA 3U1DA 3I56I 3WTWC 2RREA 1ZKGA 4QSHA 3GZNB 2WB1N 4C3HJ 4ZTJA 1U0JA 1SD7A 2RGVA 2D1VA 5KAIC 4CICA 5BNGA 3T5XA 3ZQGA 1O7FA 3KZYA 2MD5A 3H3VK 1WCMJ 3F0CA 1G3YA 2LRDA 2VB6A 2H09A 3KP4A 3PQJA 3JAMK 3N4MA 5F64A 4IHWA 5D4RA 3C2HA 3J81K 5JHFA 4F7ZA 1JJ8C 2E2HJ 3SHFA 4B43A 5H6QA 2O0YA 2LFBA 3B6CA 3HOYJ 4OIPF 2XAHA 4U0YA 1KU7A 1PP7U 5BOXA 5GTIC 1D1BA 2QKLB 4RS8A 2P0WA 2Q2EA 1YX5A 2DA4A 4G12A 2DYRH 4E7JA 3WTXC 4M9SA 3HB9A 1JE8A 3ZQLA 4HSTA 1JHHA 1IV8A 1QPIA 2FD5A 2FNPA 1G3SA 2LC2A 3GUDA 4LG3A 4RAFA 4IXAA 3H35A 3ULQB 5FD6A 2P8TA 2JUGA 2DTRA 1HW2A 1Z6TA 1SFXA 3PUFA 3BWGA 3Q9SA 3K4KA 2W85A 4XK4A 4PK4A 1XMAA 3CDHA 3VDXA 4NUBA 3HZJA 3L09A 3CJQB 2ID3A 1AKHA 1FOKA 4LJZF 1IXRC 1FJLA 3VFZA 4YIIA 2EFQA 3G1OA 3TO6A 1FOYA 1WPKA 1BOBA 4DQ2A 5H20A 4HQMA 2XAQA 4NC8A 3HKZA 4XLAA 2DA7A 2IA0A 2B63J 1SFKA 3GLXA 1Z6RA 2X0LA 3DBLB 4WF2A 5LGNA 1R5ID 4PGGA 3DU5A 3S2WA 4YFXF 3HL2A 1HBXG 2JQ7A 4DBRA 2PMZA 3CCEI 1H88C 2R5ZB 1C0WA 2WA0A 1W0UA 1WJDA 2Y30A 3NRVA 4RBOA 3VPRA 4B1RA 2CW7A 3BZCA 2DOEA 1ZH5A 3OSFA 4PJ0C 5FKNA 3R6SA 2O61A 1SEUA 4EV0A 3N05A 1BW5A 2DFHA 3ZGKA 3KP2A 2B9SA 1T38A 1IDYA 5FKOA 1KGSA 2IEKA 2JWTA 1S8NA 4AYBA 4CCLA 2XPVA 2CS3A 1FWZA 3E6MA 3P5JA 2EV6A 2OQGA 2K4JA 3REOA 3RYPA 1B6AA 3F8MA 3R0JA 4R1HA 3K2AA 4Y15A 3G73A 4Q5SF 2QCOA 3OYGA 2D45A 2HEOA 2G0EA 2K3PA 4M3DA 2GA2A 2EK5A 3WTUC 4U7BA 1JTYA 1Z67A 4IX7A 4AIDA 1B4AA 3LA7A 1WQ2A 3OOUA 2LMDA 2KDZA 1V5GA 1TC3C 3G2BA 1HW1A 2IXSA 4CSWA 1LKXA 1D8KA 2K3FA 1XGOA 1BI2A 4UVCA 3HRTA 4FISA 1EF4A 1P4XA 4A0YA 5KHDA 5FKKA 2DQRA 1HCRA 2HWVA 4KT6A 3M8FA 2IS2A 1EKEA 4EMSA 4CCKA 2GXAA 2LG4A 4BS9A 4R79A 2IRFG 3S1MJ 3I9V2 1ON2A 2FUG2 1UJ8A 4B47A 2Z2SB 3DBHB 3LFKA 1IUYA 3J80Z 1JKQC 4HRIA 3W2AA 1PP8F 2QUFA 2YU3A 1FC3A 2CGPA 4UHTA 2HNHA 3FISA 1D5VA 2QGUA 3GMEA 4DGWB 1JHFA 1XCVA 2ESHA 3L1PA 3IRQA 1IF1A 3BR0A 2MC3A 3JRFA 1U8BA 1E3OC 4O5VA 4DBQA 2MG4A 1LVKA 3COAC 3F23A 1K6YA 3PSFA 4NHJA 2K9MA 2Z16A 3HTUA 4ZH4F 3IL2A 2O9LA 1OCTC 3DTEA 2R5YB 4NB5A 3L2VA 1X3WB 1DPUA 3CDIA 2G7HA 2Y2ZA 3DEEA 2NYXA 4X1EA 4KUMA 1ZR2A 1R1UA 2WC2A 4JX6A 4LITA 3AG4H 4L9TA 4AUXA 2HVRA 2JA6J 1VQLI 2LTPA 4MHGA 4LG0A 1NG7A 2BZTA 3QYBA 2TDXA 1BJAA 4A6DA 1TQIA 4RGXA 3TEDA 3TMOA 1J7KA 1KU3A 5DS9A 3J80K 1BN5A 1VI0A 1ZGAA 5LHHA 1P92A 4AM3A 4ENMA 2L7FP 2VJIA 3C18A 2M7AA 2W7NA 3IH2A 2M1BA 4EM1A 4XQFA 1AU7A 3MKZA 3JRBA 2OCCH 5E20A 5L3GA 2KJCA 2VT2A 3FM3A 5D6FA 3GBGA 4IJAA 4C2MJ 1YFHA 2Y31A 1ZRFA 2IGOA 3SZTA 2GXGA 5J4VA 2Y0SA 3Q3SA 4U0WA 3ABKH 1ZLKA 4RGSA 1CF7A 2LVSA 3BJOA 1XSDA 2I5UA 4I2OA 4ZTFA 3F6VA 3DEWA 2FNAA 1W7PB 1R00A 4FHTA 4OWRB 3TBIA 3CO6C 1K78B 4BY1J 4JK1X 1U9OA 3H5AA 4XKVA 5M3MJ 5LEKA 5DUIA 1SVOA 2FE3A 4RLFA 3LSJA 2E5ZA 3PM1A 5HS8A 1ETKA 2HGCA 3F8FA 1ZREA 3Q0VA 4X6AJ 1QBJA 1Z7LA 1FBQA 3QRFF 5E79C 4ZYDA 1T0FC 3TO7A 3WG7H 1ZGWA 2WV0A 3TP0A 1BC8C 4EM2A 2L3DA 4IHSA 4M71A 3FMRA 2X85A 1VFCA 2VKHA 3PO2J 4OMYA 3H1CA 2R3SA 2XGCA 5L3FA 3IC7A 3CO7C 2X1DA 3B73A 3KP3A 3CCVI 4IRGA 4PJNA 2RKHA 2H94A 3HKZN 4DJAA 5CVVA 2CUJA 2OU2A 2HTSA 2PJPA 3D1NI 3E3VA 1TL8A 2DOAA 4BE0A 2IAIA 1IN6A 3GW2A 3TL4X 1ZN2A 2FBHA 4A3DJ 2PMZN 4RA2A 4TV7A 2VBZA 4PFOA 1APLC 1O57A 1RRJA 1BR2A 2FRHA 5E1WA 4ON0A 2BW3B 3A01B 2EZIA 2RVCA 2LH9A 1SAXA 2QVOA 3H5RA 4FQGA 2RDPA 2VL8A 1E3PA 1ORKA 1QZZA 2M34A 3S93A 1IXSB 2GLOA 3VYSB 3IHUA 1SD6A 2ZJ2A 4AYBN 1FIPA 1SD4A 3C3WA 4FT8A 5K5OA 3G6EI 2ME6A 2OBPA 1VQPI 2DPUA 1WKMA 3KPHA 3QPSA 3F21A 2LY9A 3V8JA 3BR6A 1IV6A 4MO7A 3ZMVA 4IOCF 2OZUA 3HHHA 4UUVA 2F4MB 4IQ4A 2VKEA 5LRRA 2F6CA 2R7QA 3KEQA 1MJ9A 2HVSA 3V7CA 2RV8A 4R8HA 2R7ZJ 4HW0A 1H9TA 3Q0UA 4A2UA 3HM5A 3U21A 3BQZA 1WSUA 2Y9ZA 4DIQA 1QO0D 1X4PA 1ITYA 4E7IA 2H8RA 1R1TA 1S5LC 2LF7A 4FE7A 3WHBA 4XOTA 5HDNA 2CUEA 4MFDA 2PMUA 1RNLA 1U78A 1TBXA 3CMYA 5E18F 1S9HA 2J5PA 3RKWA 5EDNA 4LD5A 4XKCA 4ENKA 3ZR8X 2HVQA 3W2VA 2DA1A 4BQOA 4KN4X 1VQ7I 2KRFA 3P9KA 1SD5A 2K9SA 2Q1ZB 3F72A 1Z3XA 2A6TA 1WZ2A 3CDLA 4P96A 5JVGF 2IS1A 5M5YJ 1I1GA 2DLLA 2R7OA 2STTA 1RPWA 3OR1C 5KCMA 2LR8A 2JA7J 1T98A 4C30A 2F5DA 2NOGA 2M4GA 2CJJA 4HPQA 4EEFG 5K7ZA 5GAGJ 2GQQA 5BQTA 2V1XA 2QENA 4HX7A 2AHQA 1XPXA 4BQAA 4IHXA 3HOSA 4M6VA 1FSEA 3BZ6A 5GADJ 3KIOA 3HOWJ 2PLYA 2XPUA 3I53A 3WTVC 4JBAA 3AG2H 2KZGA 3K10A 4LLNA 2EV5A 2MGQA 5IY5H 1XX5A 1AWCA 3DEUA 1VZ0A 3HRUA 2QQ9A 2XGDA 5TGTA 3LSGA 1TQMA 1D1AA 2DQLA 5GP9A 3GEZA 3RI4A 2QSHX 1MZBA 1ON1A 3GO5A 1WI9A 2KQRA 2DA2A 1WJAA 2BYVE 3DCFA 1OKRA 4B8XA 4IHTA 2R7UA 3FIWA 3NAUA 1SFEA 1S72I 1YJNI 2TCTA 1WVRA 3GCMA 1LDKB 5BPIA 1B1BA 2OCEA 1VQ5I 1V5FA 2W82A 4ASNA 5LFAA 3A03A 2L2OA 5CQGA 2QQAA 4IZZA 4CCJA 3H3ZA 4KIBA 3F6OA 3I59B 4NQWB 1WRJA 2BXYA 1V54H 2Y0SN 5F04A 2DA3A 3DU6A 4J19A 4E7KA 3F8BA 1Y6IA 2HDWA 3S32A 1ZAOA 2E34A 1OYWA 4OIQF 2P6SA 3GYHX 1F1ZA 4CO8A 5IT9K 5M5XJ 2OTJI 4F55A 5D6EA 5E3NA 1BI3A 4XSZF 3VEPA 2FF4A 3LSKA 1G59A 3ROUA 2VOPA 1DU6A 1RI7A 1BOAA 2HDCA 2DODA 1V4RA 2VC1A 4LB5A 3RSNA 5IYBJ 4D7NA 3HRMA 2E71A 3CMAI 2H27A 1XMKA 3E5QA 3IWFA 2EWNA 4LIVA 2WTEA 2VE8A 4ABZA 4EQQA 5DD4A 1FZPB 1U6GA 5J1UA 2E36A 2XRNA 4BQNA 3WU2C 2VJJA 3AG3H 2F5VA 2Y48A 4OAYA 1E3HA 1HXDA 1NTCA 2NNNA 2KL4A 4FE4A 4CZCA 1XS9A 5J8CA 3M1CA 1HQCA 2O03A 3DV8A 3ZMSA 3CF5F 2KZVA 2BOLA 2M2EA 4XKWA 1ACIA 1OPCA 2K9LA 4N4NB 2X1EA 2IW5A 3OYHA 2F5EA 5GPCA 1BA5A 3BT9A 2HR3A 4B09A 2E1OA 3MZYA 1Z7UA 2Y9YA 4AD9A 4C3JJ 2RQQA 3HC7A 2MH9A 1TZLA 2BVMA 2IGNA 2K5CA 2PEXA 4WXHA 4YFKF 2K7LA 5GAEJ 3LSPA 4PJMA 3H0GJ 3AL0B 2CG4A 1NK3P 1O4XA 2V6EA 5B1AH 5FJ8J 2E1CA 1KONA 1ODDA 3H9GA 3ZQCA 5BPDA 1RR7A 1D8JA 3I0TA 4E7ZA 2NOJB 1XDUA 4HF2A 3HDDA 1O3SA 4BQQA 4G7OF 1HKTA 1IN4A 1QU3A 3AL0C 3LAJA 3CCYA 1TWFJ 2CQQA 1FY7A 2KRCA 2XB5A 4XN3A 2KIUA 1VNDA 2XGXA 1Y8RB 4N4OB 3SDBA 2QF7A 2YR2A 1YW8A 3I54A 1MSFC 4M3BA 2M8GX 3H5NA 2K27A 3RJPA 3OIOA 1SAUA 2FQ4A 2DK8A 4A3IJ 3GFIA 4II2A 2HDDA 3CCUI 5FRMA 3IH4A 2VQHA 2ZXJA 4CYCB 1ZK8A 2BGCA 1JKRC 2XVCA 3BG3A 3QYEA 3MKYB 4KYWA 1ZHFA 3KP5A 2CUZA 2PQ8A 4M3EA 2X6XA 4XRFA 1TWGJ 1S6LA 3ABTA 1ZGJA 5K7HA 2ACJA 1HDPA 2VUMJ 2A68F 2RC4A 4M74A 3PIPF 4XONA 1JUPA 1T56A 4S0HB 1E17A 3CD6I 4GO1A 1T33A 4ESBA 1VQNI 2R7WA 2XSJC 2Y0MA 3CLQA 4Y33A 5JR3A 3HHGA 1CF7B 4M6XA 2XAFA 4A3BJ 1YX3A 2ZSHB 1FLIA 3RPUD 5K5RA 2K9NA 4EJWA 2GWRA 3B6AA 1X3ZB 2YSRA 1FTTA 3Q9VA 1OYIA 1YG2A 3QPTA 5FLVA 2M5WA 2HQRA 3EUHA 3E97A 2EH3A 4FX0A 2FBIA 2V26A 4NC6A 1D1CA 4QTRA 4KA4A 4B3XA 4FETA 5E1ZB 2O6GE 3OYEA 2HOTA 1LFUP 2CFOA 4LIUA 1ZG3A 4V2FA 5M3FJ 5DD8A 1UELB 1WJCA 2EBIA 3R0AA 2V1UA 1XG1A 3S1NJ 2KMUA 5EG0A 2EQRA 1MNDA 5CPRB 4EGZA 3FXKA 4I7HA 4L9VA 3EETA 1R5HA 3WGGA 5DCFA 4NC7A 3CCSI 1IGNA 1DP3A 3A0HC 4MNUA 2VOOA 1K61A 2L54A 4UNOA 2NS0A 2XB0X 1JGSA 1ZG1A 2MYSA 4CZZA 1FT9A 5LRSA 4BKXA 2R7RA 1U9NA 3B02A 4AWXB 2K85A 1G6NA 2WAQA 4LLGF 3K2ZA 1IN8A 3TGNA 4IEJA 1B72A 3KEOA 1FX7A 1J0RA 2HOAA 3ZQHA 1PVEA 3T1BA 3WODF 2R0QC 2X51A 4P9FA 4ZYHA 4BAYA 1GLNA 1KU2A 5LHGA 3IAS2 4J00A 1QGPA 2FU4A 2VT3A 3W6VA 2BY2A 2LOOA 5HDKA 3S2DJ 1YRNB 3HPGA 4U0VA 3G1MA 3RZDJ 2P5VA 2VPLA 4LB6B 2D5VA 1FIAA 2JPCA 3GVAA 3GX4X 2IT0A 2DMTA 3CP8A 2ZNZA 2CRGA 1FMVA 1QVUA 3SZPA 1T6SA 2LREA 4IKFA 3E0JB 1YJWI 5C3EJ 4I09A 1TT0A 2YX4A 2MFZA 5ILUA 3LSMA 4V19K 3LMMA 4RM3A 1Y8QB 3MWMA 4CGZA 3IRRA 1X2MA 2IGMA 2YUSA 3TKYA 1A31A 2R4GA 3OS0A 1HKQA 3WG9A 2X1CA 1IZ1A 2WWYA 5LEJA 2HOSA 3BG9A 2NS7A 4DYQA 5GAHJ 2ZKZA 2BY3A 4HA8A 4BGDA 3OSGA 3PSIA 1BC7C 1BL0A 4PZJA 4XRMA 4Y17A 1JJ6C 1ONVA 1BIBA 2LKXA 3CCJI 2V9VA 2RQPA 1BBYA 1EJ9A 5JI6A 4IOAF 3N97A 2E1NA 2X6OA 4GXOA 1YE9A 5EYRA 4KJZA 4JX5A 4UV9A 2HQ5A 3WE3A 1FOXA 4G6DA 4BBSJ 4UUSA 1MGTA 1B8IA 3DPTA 2ZJQF 1Z1DA 1NH3A 3OS1A 3ABLH 4L0ZB 1UHSA 2ETHA 3KYLA 1B9NA 1YS7A 3CMEI 3BTJA 5H2FC 3F8CA 4C2TA 6PAXA 3A02A 2KIFA 2UXNA 3LL7A 1W0TA 3ZN1A 4OIOF 5FKLA 2XGEA 2ZJRF 1DU0A 3ABUA 2ZMEA 2KLOA 3CLOA 1VQ4I 1KU9A 2PJRA 1S7OA 1LE8B 2CV2A 4JX4A 2LBFA 4HYEA 1WGXA 4HQEA 3ZMTA 1ZQ3P 2HXOA 1EA3A 5FLXZ 3DKXA 1DPRA 3ECHA 3HRSA 3GTKJ 3HEFA 3JSOA 2DPDA 3QOEA 5GTHC 1D5YA 4XSXF 2NVUB 3EPZA 4RAZA 1J59A 4ZDOA 4A5MA 3H36A 2LY1A 4UV8A 2QBYA 1MH3A 3DLAA 1O3TA 5LLQA 1OCPA 2M0CA 3BR5A 3HIFA 4LK0F 4BNCA 2L02A 2ZFUA 5K1YA 2MA3A 4XMYA 3MKLA 5CVJA 1KQ8A 4HBLA 1UHMA 2MC4A 3VYUB 3MN2A 4H4KC 3BCAA 2X6WA 2Y69H 5KK1A 2STWA 3ZRGA 2LKSA 3FDYA 2Y75A 1BIAA 1OR7A 1R6RA 4KMFA 1O3RA 3K1PA 4P1WA 4XN0A 4A0XA 5HODA 4Y13A 3R4KA 3SFIA 4UXNA 4BACA 3K1MA 1GDTA 2ICWG 2LNBA 5C4JJ 4N9IA 3HSEA 4QPOA 1X1BA 1YQAA 2EINH 1R7JA 3C2GA 5D5VB 2QM3A 4CH7A 2YU9J 4WXCA 4BY7J 1YS6A 1GUUA 2NXNB 2X9DA 1JTXA 4JYKA 3C2BA 4HDVA 1VQMI 1PUFA 1UB9A 1WH5A 3ZQIA 4BDZA 3OYBA 4D9JA 3GTJJ 5KVRA 2VXDA 4KIGA 2JRMA 1I1SA 1ZRCA 5FLXK 1UG2A 1V55H 2L9NA 4KNYA 3H92A 1QHHD 2Z99A 1MIJA 3VOEA 5AIPA 1W5TA 4BXUA 3JRCA 3C7JA 3BZKA 3QP5A 2NRAC 3SEZA 4EM0B 1MJBA 2X6YA 2JJ7A 3QQAA 2UWMA 3IKTA 4DNCA 5J40A 1R71A 4WK8F 3BTIA 1Y1VJ 2IS6A 4MEYF 1FSHA 1FP2A 5EGOB 4Y3OA 5EEGA 3TOAA 1I6XA 3QOPA 4BJ5C 3OV8A 4HX8A 3FMSA 2LDUA 2DO7A 4E7SA 3OYKA 2P81A 4I99C 3G71I 5F0CA 1UAAA 4L18B 1S29A 2QEXI 3K7AJ 1R22A 4MFEA 4UVAA 2WAQN 3DKYA 2GIZA 2XSDC 1MBFA 2LLKA 2FMYA 4Q47A 4F91B 3J7AY 2RNGA 1U3EM 2DDAA 3QPLA 2L9VA 2HZDA 3GFMA 1I39A 4YEJA 5DM7F 3FXLA 4Z6YA 4U88A 4OINF 1FYKA 3BY6A 5FRNA 3SYTA 2JPBA 1N75A 1LDJA 1MNEA 2EA2A 2DA6A 1BR4A 1MBJA 4C9YA 3ZMDA 3JRDA 4K2EA 2K86A 2VQLA 4P9UA 2JSPA 3IH3A 2B7EA 1F9NA 2FXAA 5J1RA 3LSIA 3NWTA 1K79A 2X4HA 3HPHA 4Y7NJ 5FLMJ 4I98B 2ZSIB 4M9XA 4EJTA 3WU0A 3BPXA 2A69F 3WTTC 4XRSA 2ELKA 2ELHA 1TTYA 2MBFA 3HGYA 2F4IA 5FFZA 3CUQB 2F5CA 2GAUA 2PG4A 3LA2A 1EH6A 2HU9A 1Q1VA 1OCRH 1IRFA 1VTNC 1QZEA 1N25A 1WFXA 1J9IA 2DYSH 5F6FA 3FXUA 2DJIA 3O6BB 3ZN0A 2VODA 2PFBA 4D0PA 5HLHA 3CUQC 3QPHA 3ELKA 1Q1HA 5HS9A 3MEXA 2E5NA 2WAFA 5ERIA 4GFBA 2DFIA 2H1LA 2L9RA 3MMYB 3HXLA 1UG0A 4XOPA 1MJAA 3V42A 5IP9J 3NQOA 2KJBA 4YIRX 3ERED 4H0EA 9ANTA 3H9JA 1RKWA 4N9HA 2HPMA 3HGGA 3G4SI 1RC9A 2XKPA 3ONQA 1IO2A 4HDUA 3PQKA 4IRIA 1OCOH 2IA2A 4BXXJ 4EJOA 2X48A 1FOWA 3ASOH 4XM3A 5CVIA 5LD2C 1RKTA 1XDSA 3AKZA 2CWEA 2MSYA 4NBQA 2UXXA 4D1QA 2JK3A 3L9FA 3KYCB 2OV7A 1RZ4A 2KIMA 2QLZA 2GA1A 2XIGA 4XLPF 2DBBA 2FX0A 5LBQA 1YO5C 4JOMA 2KIQA 1W1WE 2OA4A 1PDNC 4BHPA 1MD0A 1YLFA 2EJRA 2RN7A 3PJRA 5LHIA 4G7ZF 1HSTA 1WI3A 2CUFA 3O3KA 5DTDA 3OYJA 1WWXA 3K0LA 3OYDA 1KZHA
chains in the Genus database with same CATH topology
4I0AA 1ULYA 1IRGA 4IRHA 5E1XA 5FGMA 3JTHA 1F4KA 3L7WA 4ESFA 4G6QA 2Z33A 1EV7A 2FMLA 2JZYA 5D8KB 2OZ6A 2HYGD 4HAMA 1Y0UA 1DUXC 5IT9Z 2J5OA 3E6BA 1T2KA 1XD7A 2O8XA 5TJJA 1IXCA 5E8IA 4MGRA 4KFCA 2E7WA 3HYIA 4Q4ZF 4I02A 5AONA 2A3SA 4HLYA 3C1DA 3V7RA 1QZYA 3PFIA 3GWZA 4CXFA 3FWEA 2CO5A 5DUKA 2M45A 4WCGA 2BBYA 2XROA 3R61A 4MTEA 5IT3A 1YW9A 3L2CA 1KYZA 2HS5A 5DCMA 5L3DA 3BDDA 1DDNA 2W84A 2M8EA 1F5TA 4EJVA 2AXLA 2GIVA 1FYMA 4G94A 5CJ9A 1XSVA 2IJLA 3E6CC 1FP1D 3BJ6A 1R5GA 2JT1A 4I01A 4GYIA 5DV5A 4LFUA 4O3MA 3IKVA 1B9MA 2XHKA 1RUOA 5JFRA 5ICGA 2BV6A 3DKWA 1P2FA 2VXZA 3FXQA 2QYOA 2FEZA 3TDUC 1XCBA 2M87A 3DFGA 3MFKA 1B59A 1SFUA 3P7NA 1P4AA 5ICFA 4A6EA 3I71A 1XGNA 5J8FA 3KE2A 3M1EA 1DP7P 3JW4A 1MDMA 3M8EA 5L3CA 1T0FA 5HVQC 1W7PA 1K78A 3ZP5A 1G4DA 2EFWA 1IW7F 4S04A 1R23A 2QBYB 3IWZA 1GXPA 4MTDA 4ZZDA 2F5FA 3GF2A 3DF8A 5TRDA 4LGWA 1Z9CA 3L00A 1X3UA 3DQVC 3QAHA 2G7UA 3HSRA 2EA4A 5HLGA 3FHZA 1SMYF 3Q5FA 2QZ8A 4G8XA 3RKXA 3D5LA 4AIHA 1L0OC 5L3EA 4LG0B 1S3JA 3FX3A 2NAZA 1KYWA 2F2EA 1XGMA 2ZCWA 5ICCA 4GGGA 3HSFA 4IVNA 1GHCA 5D4SA 1D3YA 4ENJA 1FPQA 1LQ1A 3JTGA 1J5YA 3SQNA 2XKOA 1S7AA 1TQPA 2V79A 4CYDA 4M73A 2OQRA 5FFXA 2DU9A 3RYRA 3QU3A 4I0BA 4LK1F 2YX7A 2P7VB 3TQNA 3RPUA 1K6OA 3RPQA 3ZMUA 1LVAA 4A12A 2PN6A 4L5JA 5JVTA 5CVUA 4U7DA 2LKPA 3MCZA 5CLSA 5HLIA 2ISYA 5D5XB 1YW7A 2DT5A 2GXBA 3WTSC 4AIKA 5FO5A 3FXRA 4WWCA 4HV5A 4XLNF 1KQ0A 1LJ9A 3FMQA 5HDGA 3WGHA 3J7AO 2MLGA 1P4WA 2HYFA 5LGTA 3F8NA 2P5LC 3P9CA 4M6YA 2DAOA 3H3UA 5DEQA 2CW0F 2PBIA 5ICEA 3V8LA 3KETA 3HUGA 5JHUA 4BHCA 1O7LA 2EV0A 3JSPA 2P4WA 2D2WA 1FYLA 2LF8A 3LSTA 1Z05A 2QQBA 3ZQ7A 2EB7A 3I64A 2HKXA 1U5TA 2HFHA 2QWWA 3I59A 4NQWA 3HTSB 1OMIA 1TNSA 4CDGA 1ZLJA 5A2QZ 4BYYA 4YIFA 1PUEE 5BS6A 3I58A 3W6JB 5ED4A 2PI0A 1RUNA 3I5UA 4OU0A 1NHAA 2HKOA 3LWFA 1T39A 1QNTA 4AVPA 2HQNA 2ZNYA 2PMHA 1YTYA 1JXSA 2EFNA 2IPQX 3GXOA 5HS7A 4BHBA 3KCCA 2H6BA 5HOOA 2Q8KA 4PGHA 1LEAA 2ISZA 1U2WA 3MAJA 2XASA 3V7SA 4QLCU 4IPAA 5A2QK 5D5UB 2K02A 3WE2A 1LB2A 4OOIA 5CVRA 4RB3C 4ZYEA 2OAZA 5K5QA 1TW3A 3CUOA 1A04A 2HTJA 4O6JA 2CFXA 2A5YB 3V8KA 2Z9OA 4A0ZA 3WU1B 1O3QA 5DCMB 3DPLC 4Z2YA 4G7HF 3KP7A 1AOYA 1USTA 3TDZC 2KKOA 3T0YA 5D8LB 4HF0A 3TOBA 4KMUX 4P5OA 2W24A 4RB0A 3KFWX 1XGSA 1UFMA 2L4MA 1BI1A 1R36A 3RKYA 1G3WA 3KLOA 1I27A 4JQFA 1XSXA 5F1RA 2L01A 1MKMA 4LMYA 4PDKA 3K9TA 4EVIA 5D5WB 1YIOA 3GFJA 1Z91A 1BI0A 2BE5F 1I5ZA 3LA3A 3FF5A 1U8RA 1RIOH 4LLLA 2A07F 2FOKA 3BP8A 2EFPA 2VBWA 3M7GA 3GZ6A 4HZFA 3ISPA 1K7AA 2V1DA 2IA1A 1MDMB 3F22A 1W4MA 5DYMA 4QWQA 3VODA 2UZKA 4L9NA 1HW5A 1E2XA 4YG2F 2FBKA 2MLKA 1ZARA 4ETSA 2FA5A 3GZ5A 2LSOA 3OOPA 4BH9A 2P6TA 1R58A 3E5UA 2VBYA 2Z3YA 2ZO4A 1W5SA 4KT5C 3MZHA 4WXDA 1GVJA 3U2RA 3RIRA 4KICA 4KIFA 3LQQA 1KQ9A 2FSWA 3T8RA 4Q48A 2XAJA 1ZRDA 2A61A 2CQKA 1IN5A 5E17F 1FNNA 4YFNF 4M72A 1FBUA 3FM5A 2D1HA 2MH2A 1LNWA 3D0SA 4CHUA 3DP7A 4HOBA 3VB2A 4RGRA 3P9IA 2R7DA 3BPVA 4HV6A 4G9YA 3DXJF 2XV4S 3KZZA 3FZVA 4MQ9F 1J2XA 2IVMA 3K69A 1QPMA 4HX4A 2EFOA 3BJAA 2BEOA 2H6CA 1REPC 2GZWA 3W6KB 2K4BA 1FBSA 3E5XA 4RAYA 3M9AA 2COMA 3KLNA 2DK5A 5BMZA 3ZPLA 4L0YB 4RB1A 5H6RA 1SMTA 3G3ZA 1IN7A 3O2PE 2JRTA 1HKSA 4P55A 4EJUA 1TLHB 2HZTA 1STZA 2G9WA 3ML6A 5DDGA 3QU6A 4IF4A 4HF1A 5CYVA 4ZZLA 3BOQA 1IAWA 2ZFWA 4RB2C 4WX9A 5L3BA 1EH8A 2W25A 3E6DA 1V3FA 4L5IA 3U9GA 1HSJA 3WGIA 2ESNA 3GFLA 3RDIA 1H9GA 3KP6A 1CGPA 3RTRA 3EYYA 2XAGA 5FB2A 3EQLF 3TO9A 2Q0OA 1U5TB 2ZBKA 1LEBA 2B0LA 2CYYA 3I4PA 1XN7A 1EH7A 3V4GA 4ENNA 4MQVA 5AIQA 4MEXF 1U5TC 1YYVA 4GCVA 2V6CA 2M30A 3CTAA 3MQ0A 2YPRA 3R60A 3F3XA 3AAFA 2Z5UA 3QP6A 5ILVA 2CSOA 4HLXA 4XBFA 4KDPA 4N0BA 1QQIA 2DW4A 2IP2A 4UVBA 3EYIA 2L4AA 2P5KA 3SFZA 2E7XA 1P6RA 2NNYA 2ZMEB 1KA8A 2C6YA 3SXYA 4AIJA 1BM9A 1H0MA 2P7CB 3HOTA 1XB4A 2JSCA 4EGYA 2ADUA 4RGUA 2HOEA 3BROA 3CJNA 4A5NA 1J75A 1UHWA 2VE9A 5J6XA 2DI3A 4OMZA 4ESJA 1W7PD 3K1NA 2A6EF 2FQ3A 3T8TA 3EDPA 5FD5A 2VBXA 5E8GA 2RNJA 2R7FA 1UCRA 4ZYGA 4GYGA 2O3FA 2OD5A 3ECOA 2VN2A 4PCQA 2VONA 3CUQA 2AS5F 2A6HF 2XUBA 1ZG5A 1GXQA 2VC0A 1LDDA 1TW2A 5ILSA 1L3LA 1USSA 1G3TA 1R1VA 4L9JA 1OYYA 3NEUA 5EEHA 3JAMZ 3WTYC 3LAPA 3LQRA 3J81Z 4KN7X 2JTVA 4E70A 2W57A 4M9ZA 3WTZA 1ZYRF 3ZMZA 5LGUA 4FX4A 4S05A 4OIRF 1TNTA 3U1DA 3WTWC 1SD7A 2RGVA 2D1VA 4CICA 3T5XA 1O7FA 3KZYA 2MD5A 1G3YA 2H09A 3KP4A 3PQJA 3JAMK 3N4MA 5F64A 5D4RA 3J81K 4F7ZA 3SHFA 5H6QA 2O0YA 4OIPF 2XAHA 4U0YA 1KU7A 1PP7U 5BOXA 4RS8A 2Q2EA 3WTXC 4M9SA 1JE8A 1JHHA 3GUDA 2FNPA 1G3SA 4IXAA 3ULQB 5FD6A 2P8TA 2DTRA 1HW2A 1Z6TA 1SFXA 3BWGA 3Q9SA 2W85A 1XMAA 3CDHA 3L09A 1FOKA 4LJZF 1IXRC 3VFZA 4YIIA 2EFQA 3TO6A 4DQ2A 5H20A 4HQMA 2XAQA 2IA0A 3GLXA 1Z6RA 2X0LA 4WF2A 5LGNA 4PGGA 3S2WA 4YFXF 1HBXG 1C0WA 3NRVA 1ZH5A 3R6SA 2O61A 4EV0A 3KP2A 1T38A 1KGSA 1S8NA 1FWZA 3E6MA 3REOA 2EV6A 2OQGA 2K4JA 3RYPA 1B6AA 3F8MA 3R0JA 4R1HA 4Y15A 3G73A 4Q5SF 2D45A 2HEOA 2GA2A 2EK5A 3WTUC 4U7BA 1B4AA 3LA7A 1WQ2A 1HW1A 1D8KA 1XGOA 1BI2A 4UVCA 3HRTA 1P4XA 4A0YA 2DQRA 2HWVA 3M8FA 4EMSA 2IRFG 4R79A 1ON2A 3LFKA 1IUYA 3J80Z 1PP8F 2QUFA 2YU3A 1FC3A 2CGPA 4UHTA 1D5VA 1JHFA 1XCVA 2ESHA 3IRQA 1IF1A 2MC3A 4O5VA 3COAC 3F23A 4NHJA 3HTUA 4ZH4F 3IL2A 4NB5A 1DPUA 2G7HA 2NYXA 4KUMA 1R1UA 2WC2A 4L9TA 4MHGA 4LG0A 2TDXA 1BJAA 4A6DA 1TQIA 4RGXA 1J7KA 1KU3A 3J80K 1BN5A 1ZGAA 5LHHA 1P92A 4ENMA 3C18A 4EM1A 2M1BA 5E20A 5L3GA 2KJCA 2VT2A 3FM3A 5D6FA 4IJAA 1YFHA 1ZRFA 3SZTA 2GXGA 4U0WA 1ZLKA 4RGSA 1CF7A 3BJOA 1XSDA 4I2OA 3F6VA 3CO6C 2FNAA 1W7PB 1R00A 4FHTA 1K78B 4JK1X 5LEKA 5DUIA 2FE3A 5HS8A 2HGCA 3F8FA 1ZREA 1QBJA 1FBQA 3QRFF 4ZYDA 3TO7A 2WV0A 1BC8C 4EM2A 2L3DA 4IHSA 4M71A 3FMRA 4OMYA 2R3SA 5L3FA 3IC7A 3CO7C 3B73A 3KP3A 4IRGA 2RKHA 2H94A 5CVVA 2OU2A 2HTSA 2PJPA 3E3VA 1IN6A 3GW2A 1ZN2A 2FBHA 4TV7A 2VBZA 1O57A 2FRHA 5E1WA 4ON0A 2RVCA 1SAXA 2QVOA 2RDPA 1QZZA 1IXSB 3IHUA 1SD6A 2ZJ2A 5K5OA 1SD4A 3C3WA 4FT8A 2OBPA 2DPUA 1WKMA 3F21A 3V8JA 3ZMVA 2OZUA 3HHHA 4UUVA 5LRRA 3KEQA 1MJ9A 3V7CA 2RV8A 4R8HA 4HW0A 1H9TA 4A2UA 1WSUA 1QO0D 1R1TA 2LF7A 5HDNA 2PMUA 1RNLA 1U78A 1TBXA 5E18F 2J5PA 3RKWA 4LD5A 4ENKA 4KN4X 2KRFA 3P9KA 1SD5A 3F72A 4P96A 1I1GA 2DLLA 2STTA 1T98A 2F5DA 2GQQA 5BQTA 2V1XA 2QENA 4HX7A 4BQAA 3HOSA 1FSEA 3BZ6A 2PLYA 3I53A 3WTVC 4JBAA 4LLNA 2EV5A 1AWCA 3DEUA 3HRUA 2QQ9A 1TQMA 2DQLA 3GEZA 3RI4A 1MZBA 1ON1A 3GO5A 1WI9A 2BYVE 1OKRA 4B8XA 4IHTA 1SFEA 1LDKB 5BPIA 1B1BA 4ASNA 2QQAA 3H3ZA 4KIBA 3F6OA 3I59B 1WRJA 3F8BA 1ZAOA 1OYWA 4OIQF 2P6SA 3GYHX 1F1ZA 4CO8A 5IT9K 5D6EA 1BI3A 4XSZF 3VEPA 2FF4A 3ROUA 2VOPA 1RI7A 1BOAA 2HDCA 1V4RA 2VC1A 4LB5A 3HRMA 2H27A 1XMKA 3E5QA 3IWFA 2EWNA 2WTEA 2VE8A 4EQQA 5DD4A 1FZPB 1U6GA 2XRNA 2Y48A 1HXDA 2NNNA 5J8CA 1HQCA 2O03A 3DV8A 3ZMSA 1OPCA 2IW5A 2F5EA 2HR3A 4B09A 3MZYA 1Z7UA 4AD9A 2MH9A 2PEXA 4WXHA 4YFKF 2K7LA 2CG4A 2E1CA 1ODDA 5BPDA 1D8JA 3I0TA 1XDUA 4HF2A 1O3SA 4G7OF 1HKTA 1IN4A 3LAJA 1FY7A 2KIUA 2XGXA 2YR2A 1YW8A 3I54A 2K27A 3RJPA 2DK8A 3GFIA 2ZXJA 2BGCA 2XVCA 4KYWA 1ZHFA 3KP5A 2PQ8A 4XRFA 3ABTA 1S6LA 1ZGJA 2ACJA 2A68F 2RC4A 4M74A 1E17A 4GO1A 4ESBA 2Y0MA 5JR3A 3HHGA 1CF7B 4M6XA 2XAFA 1FLIA 5K5RA 4EJWA 2GWRA 2YSRA 3Q9VA 1OYIA 1YG2A 3QPTA 2M5WA 2HQRA 3EUHA 3E97A 4FX0A 2FBIA 4KA4A 5E1ZB 2O6GE 1ZG3A 5DD8A 3R0AA 2V1UA 4EGZA 4I7HA 4L9VA 3EETA 1R5HA 3WGGA 5DCFA 4MNUA 2VOOA 2L54A 4UNOA 2NS0A 1JGSA 1ZG1A 4CZZA 1FT9A 5LRSA 3B02A 4AWXB 1G6NA 4LLGF 3K2ZA 1IN8A 3TGNA 3KEOA 1FX7A 1J0RA 3T1BA 3WODF 4P9FA 4ZYHA 4BAYA 1KU2A 5LHGA 1QGPA 2FU4A 2VT3A 5HDKA 4U0VA 2P5VA 4LB6B 2JPCA 3GVAA 3GX4X 2IT0A 2ZNZA 3SZPA 1T6SA 4I09A 2YX4A 5ILUA 3MWMA 4CGZA 3IRRA 3TKYA 1HKQA 3WG9A 1IZ1A 2WWYA 5LEJA 2ZKZA 4HA8A 1BC7C 4PZJA 4Y17A 1ONVA 1BIBA 2V9VA 2RQPA 1BBYA 5JI6A 3N97A 2E1NA 4GXOA 4UV9A 3WE3A 4G6DA 1MGTA 3DPTA 1Z1DA 4L0ZB 2ETHA 1B9NA 1YS7A 3F8CA 6PAXA 2KIFA 2UXNA 4OIOF 3ZN1A 3ABUA 2ZMEA 3CLOA 1KU9A 1S7OA 4HYEA 4HQEA 3ZMTA 5FLXZ 1DPRA 3ECHA 3HRSA 3JSOA 2DPDA 4XSXF 4RAZA 1J59A 4A5MA 4UV8A 2QBYA 1O3TA 5LLQA 3HIFA 4LK0F 4BNCA 2L02A 5K1YA 2MA3A 5CVJA 1KQ8A 4HBLA 1UHMA 5KK1A 2STWA 2Y75A 1BIAA 1OR7A 4KMFA 1O3RA 3K1PA 4A0XA 4Y13A 3R4KA 4UXNA 3K1MA 2LNBA 4N9IA 3HSEA 1YQAA 1R7JA 5D5VB 2QM3A 4WXCA 1YS6A 4HDVA 1UB9A 5KVRA 4KIGA 1I1SA 1ZRCA 5FLXK 4KNYA 3H92A 2Z99A 3VOEA 5AIPA 1W5TA 4BXUA 3C7JA 3QP5A 2NRAC 4EM0B 1MJBA 2UWMA 3IKTA 4DNCA 4WK8F 4MEYF 1FSHA 1FP2A 5EEGA 3TOAA 1I6XA 3QOPA 3OV8A 4HX8A 3FMSA 2LDUA 2DO7A 4L18B 1S29A 1R22A 4UVAA 2FMYA 4Q47A 1U3EM 3GFMA 4U88A 4OINF 1FYKA 3BY6A 2JPBA 1LDJA 2EA2A 3ZMDA 4K2EA 2K86A 4P9UA 1F9NA 2FXAA 1K79A 2X4HA 4I98B 4M9XA 4EJTA 3WU0A 3BPXA 2A69F 3WTTC 2ELHA 1TTYA 2MBFA 5FFZA 3CUQB 2F5CA 2GAUA 2PG4A 3LA2A 1EH6A 1IRFA 1VTNC 1J9IA 5F6FA 3FXUA 3O6BB 3ZN0A 2VODA 2PFBA 4D0PA 5HLHA 3CUQC 3QPHA 3ELKA 1Q1HA 5HS9A 3MEXA 5ERIA 2DFIA 1MJAA 3NQOA 2KJBA 4H0EA 3ERED 4N9HA 2XKPA 4HDUA 4IRIA 3PQKA 2IA2A 4EJOA 5CVIA 1XDSA 2CWEA 2UXXA 3L9FA 2QLZA 1RZ4A 4XLPF 2KIMA 2GA1A 2XIGA 2DBBA 5LBQA 1YO5C 2OA4A 1PDNC 4BHPA 1MD0A 1YLFA 2EJRA 2RN7A 5LHIA 4G7ZF 1HSTA 3O3KA 1WWXA 3K0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0A A;  1ULY A;  1IRG A;  4IRH A;  5E1X A;  5FGM A;  3JTH A;  1F4K A;  3L7W A;  4ESF A;  4G6Q A;  2Z33 A;  1EV7 A;  2FML A;  2JZY A;  5D8K B;  2OZ6 A;  2HYG D;  4HAM A;  1Y0U A;  1DUX C;  5IT9 Z;  2J5O A;  3E6B A;  1T2K A;  1XD7 A;  2O8X A;  5TJJ A;  1IXC A;  5E8I A;  4MGR A;  4KFC A;  2E7W A;  3HYI A;  4Q4Z F;  4I02 A;  5AON A;  2A3S A;  4HLY A;  3C1D A;  3V7R A;  1QZY A;  3PFI A;  3GWZ A;  4CXF A;  3FWE A;  2CO5 A;  5DUK A;  2M45 A;  4WCG A;  2BBY A;  2XRO A;  3R61 A;  4MTE A;  5IT3 A;  1YW9 A;  3L2C A;  1KYZ A;  2HS5 A;  5DCM A;  5L3D A;  3BDD A;  1DDN A;  2W84 A;  2M8E A;  1F5T A;  4EJV A;  2AXL A;  2GIV A;  1FYM A;  4G94 A;  5CJ9 A;  1XSV A;  2IJL A;  3E6C C;  1FP1 D;  3BJ6 A;  1R5G A;  2JT1 A;  4I01 A;  4GYI A;  5DV5 A;  4LFU A;  4O3M A;  3IKV A;  1B9M A;  2XHK A;  1RUO A;  5JFR A;  5ICG A;  2BV6 A;  3DKW A;  1P2F A;  2VXZ A;  3FXQ A;  2QYO A;  2FEZ A;  3TDU C;  1XCB A;  2M87 A;  3DFG A;  3MFK A;  1B59 A;  1SFU A;  3P7N A;  1P4A A;  5ICF A;  4A6E A;  3I71 A;  1XGN A;  5J8F A;  3KE2 A;  3M1E A;  1DP7 P;  3JW4 A;  1MDM A;  3M8E A;  5L3C A;  1T0F A;  5HVQ C;  1W7P A;  1K78 A;  3ZP5 A;  1G4D A;  2EFW A;  1IW7 F;  4S04 A;  1R23 A;  2QBY B;  3IWZ A;  1GXP A;  4MTD A;  4ZZD A;  2F5F A;  3GF2 A;  3DF8 A;  5TRD A;  4LGW A;  1Z9C A;  3L00 A;  1X3U A;  3DQV C;  3QAH A;  2G7U A;  3HSR A;  2EA4 A;  5HLG A;  3FHZ A;  1SMY F;  3Q5F A;  2QZ8 A;  4G8X A;  3RKX A;  3D5L A;  4AIH A;  1L0O C;  5L3E A;  4LG0 B;  1S3J A;  3FX3 A;  2NAZ A;  1KYW A;  2F2E A;  1XGM A;  2ZCW A;  5ICC A;  4GGG A;  3HSF A;  4IVN A;  1GHC A;  5D4S A;  1D3Y A;  4ENJ A;  1FPQ A;  1LQ1 A;  3JTG A;  1J5Y A;  3SQN A;  2XKO A;  1S7A A;  1TQP A;  2V79 A;  4CYD A;  4M73 A;  2OQR A;  5FFX A;  2DU9 A;  3RYR A;  3QU3 A;  4I0B A;  4LK1 F;  2YX7 A;  2P7V B;  3TQN A;  3RPU A;  1K6O A;  3RPQ A;  3ZMU A;  1LVA A;  4A12 A;  2PN6 A;  4L5J A;  5JVT A;  5CVU A;  4U7D A;  2LKP A;  3MCZ A;  5CLS A;  5HLI A;  2ISY A;  5D5X B;  1YW7 A;  2DT5 A;  2GXB A;  3WTS C;  4AIK A;  5FO5 A;  3FXR A;  4WWC A;  4HV5 A;  4XLN F;  1KQ0 A;  1LJ9 A;  3FMQ A;  5HDG A;  3WGH A;  3J7A O;  2MLG A;  1P4W A;  2HYF A;  5LGT A;  3F8N A;  2P5L C;  3P9C A;  4M6Y A;  2DAO A;  3H3U A;  5DEQ A;  2CW0 F;  2PBI A;  5ICE A;  3V8L A;  3KET A;  3HUG A;  5JHU A;  4BHC A;  1O7L A;  2EV0 A;  3JSP A;  2P4W A;  2D2W A;  1FYL A;  2LF8 A;  3LST A;  1Z05 A;  2QQB A;  3ZQ7 A;  2EB7 A;  3I64 A;  2HKX A;  1U5T A;  2HFH A;  2QWW A;  3I59 A;  4NQW A;  3HTS B;  1OMI A;  1TNS A;  4CDG A;  1ZLJ A;  5A2Q Z;  4BYY A;  4YIF A;  1PUE E;  5BS6 A;  3I58 A;  3W6J B;  5ED4 A;  2PI0 A;  1RUN A;  3I5U A;  4OU0 A;  1NHA A;  2HKO A;  3LWF A;  1T39 A;  1QNT A;  4AVP A;  2HQN A;  2ZNY A;  2PMH A;  1YTY A;  1JXS A;  2EFN A;  2IPQ X;  3GXO A;  5HS7 A;  4BHB A;  3KCC A;  2H6B A;  5HOO A;  2Q8K A;  4PGH A;  1LEA A;  2ISZ A;  1U2W A;  3MAJ A;  2XAS A;  3V7S A;  4QLC U;  4IPA A;  5A2Q K;  5D5U B;  2K02 A;  3WE2 A;  1LB2 A;  4OOI A;  5CVR A;  4RB3 C;  4ZYE A;  2OAZ A;  5K5Q A;  1TW3 A;  3CUO A;  1A04 A;  2HTJ A;  4O6J A;  2CFX A;  2A5Y B;  3V8K A;  2Z9O A;  4A0Z A;  3WU1 B;  1O3Q A;  5DCM B;  3DPL C;  4Z2Y A;  4G7H F;  3KP7 A;  1AOY A;  1UST A;  3TDZ C;  2KKO A;  3T0Y A;  5D8L B;  4HF0 A;  3TOB A;  4KMU X;  4P5O A;  2W24 A;  4RB0 A;  3KFW X;  1XGS A;  1UFM A;  2L4M A;  1BI1 A;  1R36 A;  3RKY A;  1G3W A;  3KLO A;  1I27 A;  4JQF A;  1XSX A;  5F1R A;  2L01 A;  1MKM A;  4LMY A;  4PDK A;  3K9T A;  4EVI A;  5D5W B;  1YIO A;  3GFJ A;  1Z91 A;  1BI0 A;  2BE5 F;  1I5Z A;  3LA3 A;  3FF5 A;  1U8R A;  1RIO H;  4LLL A;  2A07 F;  2FOK A;  3BP8 A;  2EFP A;  2VBW A;  3M7G A;  3GZ6 A;  4HZF A;  3ISP A;  1K7A A;  2V1D A;  2IA1 A;  1MDM B;  3F22 A;  1W4M A;  5DYM A;  4QWQ A;  3VOD A;  2UZK A;  4L9N A;  1HW5 A;  1E2X A;  4YG2 F;  2FBK A;  2MLK A;  1ZAR A;  4ETS A;  2FA5 A;  3GZ5 A;  2LSO A;  3OOP A;  4BH9 A;  2P6T A;  1R58 A;  3E5U A;  2VBY A;  2Z3Y A;  2ZO4 A;  1W5S A;  4KT5 C;  3MZH A;  4WXD A;  1GVJ A;  3U2R A;  3RIR A;  4KIC A;  4KIF A;  3LQQ A;  1KQ9 A;  2FSW A;  3T8R A;  4Q48 A;  2XAJ A;  1ZRD A;  2A61 A;  2CQK A;  1IN5 A;  5E17 F;  1FNN A;  4YFN F;  4M72 A;  1FBU A;  3FM5 A;  2D1H A;  2MH2 A;  1LNW A;  3D0S A;  4CHU A;  3DP7 A;  4HOB A;  3VB2 A;  4RGR A;  3P9I A;  2R7D A;  3BPV A;  4HV6 A;  4G9Y A;  3DXJ F;  2XV4 S;  3KZZ A;  3FZV A;  4MQ9 F;  1J2X A;  2IVM A;  3K69 A;  1QPM A;  4HX4 A;  2EFO A;  3BJA A;  2BEO A;  2H6C A;  1REP C;  2GZW A;  3W6K B;  2K4B A;  1FBS A;  3E5X A;  4RAY A;  3M9A A;  2COM A;  3KLN A;  2DK5 A;  5BMZ A;  3ZPL A;  4L0Y B;  4RB1 A;  5H6R A;  1SMT A;  3G3Z A;  1IN7 A;  3O2P E;  2JRT A;  1HKS A;  4P55 A;  4EJU A;  1TLH B;  2HZT A;  1STZ A;  2G9W A;  3ML6 A;  5DDG A;  3QU6 A;  4IF4 A;  4HF1 A;  5CYV A;  4ZZL A;  3BOQ A;  1IAW A;  2ZFW A;  4RB2 C;  4WX9 A;  5L3B A;  1EH8 A;  2W25 A;  3E6D A;  1V3F A;  4L5I A;  3U9G A;  1HSJ A;  3WGI A;  2ESN A;  3GFL A;  3RDI A;  1H9G A;  3KP6 A;  1CGP A;  3RTR A;  3EYY A;  2XAG A;  5FB2 A;  3EQL F;  3TO9 A;  2Q0O A;  1U5T B;  2ZBK A;  1LEB A;  2B0L A;  2CYY A;  3I4P A;  1XN7 A;  1EH7 A;  3V4G A;  4ENN A;  4MQV A;  5AIQ A;  4MEX F;  1U5T C;  1YYV A;  4GCV A;  2V6C A;  2M30 A;  3CTA A;  3MQ0 A;  2YPR A;  3R60 A;  3F3X A;  3AAF A;  2Z5U A;  3QP6 A;  5ILV A;  2CSO A;  4HLX A;  4XBF A;  4KDP A;  4N0B A;  1QQI A;  2DW4 A;  2IP2 A;  4UVB A;  3EYI A;  2L4A A;  2P5K A;  3SFZ A;  2E7X A;  1P6R A;  2NNY A;  2ZME B;  1KA8 A;  2C6Y A;  3SXY A;  4AIJ A;  1BM9 A;  1H0M A;  2P7C B;  3HOT A;  1XB4 A;  2JSC A;  4EGY A;  2ADU A;  4RGU A;  2HOE A;  3BRO A;  3CJN A;  4A5N A;  1J75 A;  1UHW A;  2VE9 A;  5J6X A;  2DI3 A;  4OMZ A;  4ESJ A;  1W7P D;  3K1N A;  2A6E F;  2FQ3 A;  3T8T A;  3EDP A;  5FD5 A;  2VBX A;  5E8G A;  2RNJ A;  2R7F A;  1UCR A;  4ZYG A;  4GYG A;  2O3F A;  2OD5 A;  3ECO A;  2VN2 A;  4PCQ A;  2VON A;  3CUQ A;  2AS5 F;  2A6H F;  2XUB A;  1ZG5 A;  1GXQ A;  2VC0 A;  1LDD A;  1TW2 A;  5ILS A;  1L3L A;  1USS A;  1G3T A;  1R1V A;  4L9J A;  1OYY A;  3NEU A;  5EEH A;  3JAM Z;  3WTY C;  3LAP A;  3LQR A;  3J81 Z;  4KN7 X;  2JTV A;  4E70 A;  2W57 A;  4M9Z A;  3WTZ A;  1ZYR F;  3ZMZ A;  5LGU A;  4FX4 A;  4S05 A;  4OIR F;  1TNT A;  3U1D A;  3WTW C;  1SD7 A;  2RGV A;  2D1V A;  4CIC A;  3T5X A;  1O7F A;  3KZY A;  2MD5 A;  1G3Y A;  2H09 A;  3KP4 A;  3PQJ A;  3JAM K;  3N4M A;  5F64 A;  5D4R A;  3J81 K;  4F7Z A;  3SHF A;  5H6Q A;  2O0Y A;  4OIP F;  2XAH A;  4U0Y A;  1KU7 A;  1PP7 U;  5BOX A;  4RS8 A;  2Q2E A;  3WTX C;  4M9S A;  1JE8 A;  1JHH A;  3GUD A;  2FNP A;  1G3S A;  4IXA A;  3ULQ B;  5FD6 A;  2P8T A;  2DTR A;  1HW2 A;  1Z6T A;  1SFX A;  3BWG A;  3Q9S A;  2W85 A;  1XMA A;  3CDH A;  3L09 A;  1FOK A;  4LJZ F;  1IXR C;  3VFZ A;  4YII A;  2EFQ A;  3TO6 A;  4DQ2 A;  5H20 A;  4HQM A;  2XAQ A;  2IA0 A;  3GLX A;  1Z6R A;  2X0L A;  4WF2 A;  5LGN A;  4PGG A;  3S2W A;  4YFX F;  1HBX G;  1C0W A;  3NRV A;  1ZH5 A;  3R6S A;  2O61 A;  4EV0 A;  3KP2 A;  1T38 A;  1KGS A;  1S8N A;  1FWZ A;  3E6M A;  3REO A;  2EV6 A;  2OQG A;  2K4J A;  3RYP A;  1B6A A;  3F8M A;  3R0J A;  4R1H A;  4Y15 A;  3G73 A;  4Q5S F;  2D45 A;  2HEO A;  2GA2 A;  2EK5 A;  3WTU C;  4U7B A;  1B4A A;  3LA7 A;  1WQ2 A;  1HW1 A;  1D8K A;  1XGO A;  1BI2 A;  4UVC A;  3HRT A;  1P4X A;  4A0Y A;  2DQR A;  2HWV A;  3M8F A;  4EMS A;  2IRF G;  4R79 A;  1ON2 A;  3LFK A;  1IUY A;  3J80 Z;  1PP8 F;  2QUF A;  2YU3 A;  1FC3 A;  2CGP A;  4UHT A;  1D5V A;  1JHF A;  1XCV A;  2ESH A;  3IRQ A;  1IF1 A;  2MC3 A;  4O5V A;  3COA C;  3F23 A;  4NHJ A;  3HTU A;  4ZH4 F;  3IL2 A;  4NB5 A;  1DPU A;  2G7H A;  2NYX A;  4KUM A;  1R1U A;  2WC2 A;  4L9T A;  4MHG A;  4LG0 A;  2TDX A;  1BJA A;  4A6D A;  1TQI A;  4RGX A;  1J7K A;  1KU3 A;  3J80 K;  1BN5 A;  1ZGA A;  5LHH A;  1P92 A;  4ENM A;  3C18 A;  4EM1 A;  2M1B A;  5E20 A;  5L3G A;  2KJC A;  2VT2 A;  3FM3 A;  5D6F A;  4IJA A;  1YFH A;  1ZRF A;  3SZT A;  2GXG A;  4U0W A;  1ZLK A;  4RGS A;  1CF7 A;  3BJO A;  1XSD A;  4I2O A;  3F6V A;  3CO6 C;  2FNA A;  1W7P B;  1R00 A;  4FHT A;  1K78 B;  4JK1 X;  5LEK A;  5DUI A;  2FE3 A;  5HS8 A;  2HGC A;  3F8F A;  1ZRE A;  1QBJ A;  1FBQ A;  3QRF F;  4ZYD A;  3TO7 A;  2WV0 A;  1BC8 C;  4EM2 A;  2L3D A;  4IHS A;  4M71 A;  3FMR A;  4OMY A;  2R3S A;  5L3F A;  3IC7 A;  3CO7 C;  3B73 A;  3KP3 A;  4IRG A;  2RKH A;  2H94 A;  5CVV A;  2OU2 A;  2HTS A;  2PJP A;  3E3V A;  1IN6 A;  3GW2 A;  1ZN2 A;  2FBH A;  4TV7 A;  2VBZ A;  1O57 A;  2FRH A;  5E1W A;  4ON0 A;  2RVC A;  1SAX A;  2QVO A;  2RDP A;  1QZZ A;  1IXS B;  3IHU A;  1SD6 A;  2ZJ2 A;  5K5O A;  1SD4 A;  3C3W A;  4FT8 A;  2OBP A;  2DPU A;  1WKM A;  3F21 A;  3V8J A;  3ZMV A;  2OZU A;  3HHH A;  4UUV A;  5LRR A;  3KEQ A;  1MJ9 A;  3V7C A;  2RV8 A;  4R8H A;  4HW0 A;  1H9T A;  4A2U A;  1WSU A;  1QO0 D;  1R1T A;  2LF7 A;  5HDN A;  2PMU A;  1RNL A;  1U78 A;  1TBX A;  5E18 F;  2J5P A;  3RKW A;  4LD5 A;  4ENK A;  4KN4 X;  2KRF A;  3P9K A;  1SD5 A;  3F72 A;  4P96 A;  1I1G A;  2DLL A;  2STT A;  1T98 A;  2F5D A;  2GQQ A;  5BQT A;  2V1X A;  2QEN A;  4HX7 A;  4BQA A;  3HOS A;  1FSE A;  3BZ6 A;  2PLY A;  3I53 A;  3WTV C;  4JBA A;  4LLN A;  2EV5 A;  1AWC A;  3DEU A;  3HRU A;  2QQ9 A;  1TQM A;  2DQL A;  3GEZ A;  3RI4 A;  1MZB A;  1ON1 A;  3GO5 A;  1WI9 A;  2BYV E;  1OKR A;  4B8X A;  4IHT A;  1SFE A;  1LDK B;  5BPI A;  1B1B A;  4ASN A;  2QQA A;  3H3Z A;  4KIB A;  3F6O A;  3I59 B;  1WRJ A;  3F8B A;  1ZAO A;  1OYW A;  4OIQ F;  2P6S A;  3GYH X;  1F1Z A;  4CO8 A;  5IT9 K;  5D6E A;  1BI3 A;  4XSZ F;  3VEP A;  2FF4 A;  3ROU A;  2VOP A;  1RI7 A;  1BOA A;  2HDC A;  1V4R A;  2VC1 A;  4LB5 A;  3HRM A;  2H27 A;  1XMK A;  3E5Q A;  3IWF A;  2EWN A;  2WTE A;  2VE8 A;  4EQQ A;  5DD4 A;  1FZP B;  1U6G A;  2XRN A;  2Y48 A;  1HXD A;  2NNN A;  5J8C A;  1HQC A;  2O03 A;  3DV8 A;  3ZMS A;  1OPC A;  2IW5 A;  2F5E A;  2HR3 A;  4B09 A;  3MZY A;  1Z7U A;  4AD9 A;  2MH9 A;  2PEX A;  4WXH A;  4YFK F;  2K7L A;  2CG4 A;  2E1C A;  1ODD A;  5BPD A;  1D8J A;  3I0T A;  1XDU A;  4HF2 A;  1O3S A;  4G7O F;  1HKT A;  1IN4 A;  3LAJ A;  1FY7 A;  2KIU A;  2XGX A;  2YR2 A;  1YW8 A;  3I54 A;  2K27 A;  3RJP A;  2DK8 A;  3GFI A;  2ZXJ A;  2BGC A;  2XVC A;  4KYW A;  1ZHF A;  3KP5 A;  2PQ8 A;  4XRF A;  3ABT A;  1S6L A;  1ZGJ A;  2ACJ A;  2A68 F;  2RC4 A;  4M74 A;  1E17 A;  4GO1 A;  4ESB A;  2Y0M A;  5JR3 A;  3HHG A;  1CF7 B;  4M6X A;  2XAF A;  1FLI A;  5K5R A;  4EJW A;  2GWR A;  2YSR A;  3Q9V A;  1OYI A;  1YG2 A;  3QPT A;  2M5W A;  2HQR A;  3EUH A;  3E97 A;  4FX0 A;  2FBI A;  4KA4 A;  5E1Z B;  2O6G E;  1ZG3 A;  5DD8 A;  3R0A A;  2V1U A;  4EGZ A;  4I7H A;  4L9V A;  3EET A;  1R5H A;  3WGG A;  5DCF A;  4MNU A;  2VOO A;  2L54 A;  4UNO A;  2NS0 A;  1JGS A;  1ZG1 A;  4CZZ A;  1FT9 A;  5LRS A;  3B02 A;  4AWX B;  1G6N A;  4LLG F;  3K2Z A;  1IN8 A;  3TGN A;  3KEO A;  1FX7 A;  1J0R A;  3T1B A;  3WOD F;  4P9F A;  4ZYH A;  4BAY A;  1KU2 A;  5LHG A;  1QGP A;  2FU4 A;  2VT3 A;  5HDK A;  4U0V A;  2P5V A;  4LB6 B;  2JPC A;  3GVA A;  3GX4 X;  2IT0 A;  2ZNZ A;  3SZP A;  1T6S A;  4I09 A;  2YX4 A;  5ILU A;  3MWM A;  4CGZ A;  3IRR A;  3TKY A;  1HKQ A;  3WG9 A;  1IZ1 A;  2WWY A;  5LEJ A;  2ZKZ A;  4HA8 A;  1BC7 C;  4PZJ A;  4Y17 A;  1ONV A;  1BIB A;  2V9V A;  2RQP A;  1BBY A;  5JI6 A;  3N97 A;  2E1N A;  4GXO A;  4UV9 A;  3WE3 A;  4G6D A;  1MGT A;  3DPT A;  1Z1D A;  4L0Z B;  2ETH A;  1B9N A;  1YS7 A;  3F8C A;  6PAX A;  2KIF A;  2UXN A;  4OIO F;  3ZN1 A;  3ABU A;  2ZME A;  3CLO A;  1KU9 A;  1S7O A;  4HYE A;  4HQE A;  3ZMT A;  5FLX Z;  1DPR A;  3ECH A;  3HRS A;  3JSO A;  2DPD A;  4XSX F;  4RAZ A;  1J59 A;  4A5M A;  4UV8 A;  2QBY A;  1O3T A;  5LLQ A;  3HIF A;  4LK0 F;  4BNC A;  2L02 A;  5K1Y A;  2MA3 A;  5CVJ A;  1KQ8 A;  4HBL A;  1UHM A;  5KK1 A;  2STW A;  2Y75 A;  1BIA A;  1OR7 A;  4KMF A;  1O3R A;  3K1P A;  4A0X A;  4Y13 A;  3R4K A;  4UXN A;  3K1M A;  2LNB A;  4N9I A;  3HSE A;  1YQA A;  1R7J A;  5D5V B;  2QM3 A;  4WXC A;  1YS6 A;  4HDV A;  1UB9 A;  5KVR A;  4KIG A;  1I1S A;  1ZRC A;  5FLX K;  4KNY A;  3H92 A;  2Z99 A;  3VOE A;  5AIP A;  1W5T A;  4BXU A;  3C7J A;  3QP5 A;  2NRA C;  4EM0 B;  1MJB A;  2UWM A;  3IKT A;  4DNC A;  4WK8 F;  4MEY F;  1FSH A;  1FP2 A;  5EEG A;  3TOA A;  1I6X A;  3QOP A;  3OV8 A;  4HX8 A;  3FMS A;  2LDU A;  2DO7 A;  4L18 B;  1S29 A;  1R22 A;  4UVA A;  2FMY A;  4Q47 A;  1U3E M;  3GFM A;  4U88 A;  4OIN F;  1FYK A;  3BY6 A;  2JPB A;  1LDJ A;  2EA2 A;  3ZMD A;  4K2E A;  2K86 A;  4P9U A;  1F9N A;  2FXA A;  1K79 A;  2X4H A;  4I98 B;  4M9X A;  4EJT A;  3WU0 A;  3BPX A;  2A69 F;  3WTT C;  2ELH A;  1TTY A;  2MBF A;  5FFZ A;  3CUQ B;  2F5C A;  2GAU A;  2PG4 A;  3LA2 A;  1EH6 A;  1IRF A;  1VTN C;  1J9I A;  5F6F A;  3FXU A;  3O6B B;  3ZN0 A;  2VOD A;  2PFB A;  4D0P A;  5HLH A;  3CUQ C;  3QPH A;  3ELK A;  1Q1H A;  5HS9 A;  3MEX A;  5ERI A;  2DFI A;  1MJA A;  3NQO A;  2KJB A;  4H0E A;  3ERE D;  4N9H A;  2XKP A;  4HDU A;  4IRI A;  3PQK A;  2IA2 A;  4EJO A;  5CVI A;  1XDS A;  2CWE A;  2UXX A;  3L9F A;  2QLZ A;  1RZ4 A;  4XLP F;  2KIM A;  2GA1 A;  2XIG A;  2DBB A;  5LBQ A;  1YO5 C;  2OA4 A;  1PDN C;  4BHP A;  1MD0 A;  1YLF A;  2EJR A;  2RN7 A;  5LHI A;  4G7Z F;  1HST A;  3O3K A;  1WWX A;  3K0L A; 
#chains in the Genus database with same CATH topology
 4CA0 A;  3CC2 I;  4I0A A;  1ULY A;  3BLY A;  4NDL A;  2W1O A;  1UZC A;  4XIC A;  1IRG A;  1N78 A;  1OJL A;  4IRH A;  5E1X A;  5FGM A;  1N77 A;  3JTH A;  1F4K A;  3L7W A;  4LOC A;  3OYA A;  1GV5 A;  4ESF A;  2VLA A;  4G6Q A;  5F0F A;  5EG0 B;  2Z33 A;  3EUH C;  4XL9 A;  1EV7 A;  3OYN A;  3HOV J;  4A3L J;  3BTL A;  4U87 A;  2F4O B;  1YIT I;  1X1P A;  1ETQ A;  2FML A;  2JZY A;  5D8K B;  5KNL A;  2OZ6 A;  3LOC A;  3GTL J;  2HYG D;  4HAM A;  1Y0U A;  1DUX C;  5IT9 Z;  2J5O A;  3E6B A;  1T2K A;  1D0Y A;  3AFH A;  2Q2E B;  1XD7 A;  2O8X A;  1R4M B;  5TJJ A;  1IC8 A;  5IOZ A;  1IXC A;  5JLW A;  2XAU A;  5E8I A;  4A3M J;  4MGR A;  3MKW B;  4L5E A;  4KFC A;  2E7W A;  3HYI A;  4Q4Z F;  2CV1 A;  1P9Q C;  4I02 A;  1B72 B;  4BBR J;  2LK2 A;  1MW7 A;  4IL6 C;  5AON A;  2A3S A;  4HLY A;  4IHY A;  3KYD B;  2O8K A;  3C1D A;  3E7L A;  3V7R A;  1T8I A;  2DFF A;  3W2W A;  3DPU A;  1QZY A;  3PFI A;  1XC5 A;  3GWZ A;  4CXF A;  1AKH B;  1DGR M;  3FWE A;  1YI2 I;  1OCC H;  4D5F A;  5FRO A;  2CO5 A;  5DUK A;  2M45 A;  3BG6 A;  4WCG A;  1MSE C;  2BBY A;  2XRO A;  3R61 A;  1H89 C;  4MTE A;  5IT3 A;  3BC8 A;  1YW9 A;  2GBY A;  3L2C A;  1W36 D;  5B3S H;  1KYZ A;  4ANJ A;  2QQ8 A;  2HS5 A;  3KEY A;  1LPQ A;  1A6Q A;  5DCM A;  5L3D A;  3BDD A;  1DDN A;  2W84 A;  2M8E A;  1F36 A;  2XDV A;  4BJ6 C;  1JUS A;  2V7F A;  1F5T A;  3I4N J;  4EJV A;  2AXL A;  1A36 A;  3GTM J;  2GIV A;  2ECB A;  1FYM A;  4G94 A;  4DW6 A;  5CJ9 A;  1XSV A;  2IJL A;  3E6C C;  1FP1 D;  3CQZ J;  1LFP A;  3BJ6 A;  3BQY A;  1R5G A;  2JT1 A;  4I01 A;  3K4J A;  3S8P A;  2R5Y A;  4GYI A;  2E1M B;  5M5W J;  5DV5 A;  4LFU A;  4O3M A;  2R93 J;  3IKV A;  4BJT A;  2K9Q A;  1B9M A;  2XHK A;  1SVM A;  1RUO A;  4XLE A;  5JFR A;  5ICG A;  2BV6 A;  1BJZ A;  1IUF A;  4BEH A;  2L7K A;  1I3A A;  3DKW A;  1P2F A;  1MBK A;  1VF9 A;  2E60 A;  2VXZ A;  1S7E A;  2E1M C;  2DA5 A;  3D5R C;  1TT5 B;  3CCM I;  1JKO C;  2M9H A;  3DBR B;  3H9Q A;  2R7T A;  3SZG A;  3FXQ A;  5EEA A;  1J09 A;  2QYO A;  3K70 C;  2E2I J;  2DDB A;  1WHU A;  3OY9 A;  2FEZ A;  3TDU C;  3HOU J;  1XCB A;  2M87 A;  3DFG A;  3MFK A;  4F93 B;  1B59 A;  2VIX A;  1SFU A;  4RMN A;  2K40 A;  3P7N A;  1P4A A;  3LFU A;  5ICF A;  2BXZ A;  4A6E A;  3I71 A;  3CCL I;  3DTK A;  1XGN A;  5J8F A;  5JLX A;  3KE2 A;  3M1E A;  2BY1 A;  1DP7 P;  1LUJ B;  3JW4 A;  1MDM A;  2LBF B;  3M8E A;  5KAF C;  5L3C A;  1HA8 A;  2DN0 A;  1T0F A;  2CQX A;  4FTH A;  5HVQ C;  2XRL A;  3PO3 J;  1W7P A;  1K78 A;  2NVX J;  1G8X A;  3ZQF A;  3ZP5 A;  1VQO I;  1X2N A;  1OLT A;  1MMG A;  1G4D A;  2V1N A;  3M8J A;  1IW7 F;  2EFW A;  4HNU A;  4S04 A;  1R23 A;  2QBY B;  3OS2 A;  3IWZ A;  2WAD A;  4A69 C;  1GXP A;  3GTP J;  4MTD A;  1QVT A;  1ETW A;  1YHQ I;  4ZZD A;  3S3N A;  2EZL A;  5B5E C;  1SAN A;  1BW6 A;  2F5F A;  4UB6 C;  3GF2 A;  3DF8 A;  4LGW A;  5TRD A;  1Z9C A;  3L00 A;  1HOM A;  4E7L A;  1X3U A;  3DQV C;  4HNV A;  3QAH A;  3CMM A;  3JRH A;  2G7U A;  3HSR A;  2EA4 A;  5HLG A;  3FHZ A;  1SMY F;  3Q5F A;  2QZ8 A;  4G8X A;  3RKX A;  5HNF A;  3GLL A;  1LFB A;  3D5L A;  4AIH A;  1E0E A;  1L0O C;  4MIM A;  5L3E A;  1T95 A;  3GTO J;  4LG0 B;  1S3J A;  3FX3 A;  2WY8 Q;  4DYR A;  1XMX A;  2NAZ A;  1KYW A;  3L2W A;  2F2E A;  2UV1 A;  2R7S A;  1OR7 C;  1PUF B;  1XGM A;  3OYI A;  2ZCW A;  4Y4R A;  1R4N B;  2BW3 A;  4GGG A;  4ZC3 A;  5ICC A;  3HSF A;  4IVN A;  3A01 A;  1GHC A;  5D4S A;  1D3Y A;  3OYC A;  2A5W A;  4ENJ A;  3OMY A;  1FPQ A;  1K83 J;  1LQ1 A;  4JP0 A;  3JTG A;  1J5Y A;  4BL0 B;  3SQN A;  2AQE A;  2XKO A;  3L2Q A;  3TW6 A;  3OWT A;  5GPA A;  4GDF A;  1S7A A;  1TQP A;  2V79 A;  3PNV A;  4CYD A;  4XID A;  4M73 A;  3FKJ A;  1YIJ I;  2OQR A;  5FFX A;  2DU9 A;  3RYR A;  3QU3 A;  4I0B A;  2HI3 A;  4AVZ A;  2W00 A;  3AG1 H;  4LK1 F;  1Y1W J;  2YX7 A;  5E3O A;  2HYJ A;  2P7V B;  4G6T B;  3TQN A;  3VWB A;  3RPU A;  2EIL H;  4PSW A;  3CES A;  1ENH A;  4V2G A;  3CJT B;  3RPQ A;  1K6O A;  1MBG A;  4X0G A;  3ZMU A;  1LVA A;  4A12 A;  2PN6 A;  2L5Q A;  2LY2 A;  3JCU C;  3MD2 A;  4L5J A;  5JVT A;  5CVU A;  4U7D A;  2LKP A;  3MCZ A;  5CLS A;  3BCB A;  1CQT A;  2I8D A;  5HLI A;  3PL8 A;  3OYF A;  3O8G A;  2ISY A;  3K4C A;  2BHZ A;  1POG A;  1R9T J;  2L9S A;  2WY7 Q;  2KIS A;  5D5X B;  1G2H A;  1WJF A;  1YW7 A;  3FHN A;  3S14 J;  3FXM A;  4QPQ A;  2DT5 A;  3CF2 A;  4B44 A;  2GXB A;  3WTS C;  4AIK A;  1NK2 P;  5FO5 A;  3FXR A;  2DMU A;  2VKD A;  2NS8 A;  4WWC A;  4HV5 A;  4XLN F;  1KQ0 A;  1LJ9 A;  1MBH A;  3FMQ A;  2CV0 A;  5HDG A;  4PUS A;  5EZH A;  3WGH A;  3J7A O;  2MLG A;  1P4W A;  2HYF A;  5LGT A;  3K4L A;  3GTQ J;  3F8N A;  2P5L C;  3S3M A;  3P9C A;  4KIT B;  4M6Y A;  2DAO A;  3H3U A;  3UR3 C;  4DZP A;  5DEQ A;  1BR1 A;  3DTI A;  3U1K A;  2CW0 F;  2PBI A;  4KIS A;  4F3Q A;  5B66 C;  5ICE A;  3V8L A;  1Y39 A;  1QA6 A;  1HC8 A;  3KET A;  3HUG A;  1HF0 A;  3ASN H;  3PUB A;  4YRV A;  5JHU A;  2KDO A;  1A35 A;  4IHV A;  4BHC A;  1MMD A;  1O7L A;  2EV0 A;  3JSP A;  2P4W A;  4XNF A;  2D2W A;  2IBD A;  1FYL A;  1ZTR A;  3I3L A;  2LF8 A;  1GVD A;  2DJN A;  3LST A;  2XF5 A;  2BVL A;  2E2J J;  1Z05 A;  3X2Q H;  2QQB A;  3JRA A;  3ZQ7 A;  3BR2 A;  1AA7 A;  1A6I A;  2EB7 A;  3I64 A;  1FTZ A;  2HKX A;  3K6G A;  2WAE A;  1U5T A;  2AO9 A;  2MAB A;  2HFH A;  2V4J C;  4B3A A;  2QWW A;  4CCM A;  3I59 A;  4NQW A;  3HTS B;  1OMI A;  4BE2 A;  3S1R J;  1TNS A;  4CDG A;  1ZLJ A;  2OC6 A;  3OIQ A;  2ZC2 A;  5A2Q Z;  3RQ4 A;  4BYY A;  4YIF A;  1PUE E;  1WH7 A;  2CW8 A;  2H8W A;  5BS6 A;  5DM6 F;  1X1A A;  3K4M A;  2VAS A;  3I58 A;  3W6J B;  2JA5 J;  1GV2 A;  5IP6 A;  4IO9 F;  4AC0 A;  2IGK A;  2JVH A;  4D5C A;  3BTC A;  5ED4 A;  3BR1 A;  3LSH A;  2PI0 A;  2QSF X;  1RUN A;  3QOD A;  3I5U A;  4OU0 A;  1QRY A;  3K70 D;  1NHA A;  2HKO A;  2R7V A;  3SDG A;  4UB8 C;  3LWF A;  1T39 A;  2EIK H;  3VYT B;  1QNT A;  2GOM A;  4AVP A;  2HQN A;  1Y56 A;  2ZNY A;  2PMH A;  2DFE A;  1YTY A;  1JXS A;  2EFN A;  2IPQ X;  3GXO A;  5HS7 A;  4BHB A;  3EUK L;  3KCC A;  2H6B A;  4XLF A;  5HOO A;  3CJR B;  4PGH A;  2Q8K A;  1LEA A;  2ISZ A;  1U2W A;  3PNY A;  3VSK A;  3MAJ A;  2LYC A;  1PYV A;  1TWH J;  2XAS A;  3FXO A;  1IDZ A;  3V7S A;  4RM2 A;  4QLC U;  2O7O A;  4IPA A;  4QIW N;  2CMP A;  1VQ6 I;  1FEX A;  5A2Q K;  1SFO J;  1ZEL A;  5D5U B;  2K02 A;  2WBM A;  3WE2 A;  1LB2 A;  4OOI A;  5CVR A;  3TP3 A;  4RB3 C;  2GM4 A;  1HLV A;  3VSL A;  5HLT A;  4ZYE A;  1WJ5 A;  2OAZ A;  5K5Q A;  2L7Z A;  1TWA J;  1TW3 A;  3CUO A;  1OCZ H;  1A04 A;  5IOY A;  2HTJ A;  4O6J A;  2CFX A;  1GT0 C;  3CC7 I;  2A5Y B;  3S16 J;  1X4O A;  3V8K A;  3S15 J;  2Z9O A;  2MD0 A;  4A0Z A;  3WU1 B;  1FMW A;  1W36 C;  1PJR A;  1O3Q A;  1TP4 A;  3WHC A;  1I6H J;  5DCM B;  1ETO A;  3DPL C;  4Z2Y A;  5TIS C;  3MZ8 A;  4G7H F;  2OUM A;  3KP7 A;  1AOY A;  1UST A;  5C4X J;  3TDZ C;  4RDU A;  2KKO A;  2A05 A;  5E3M A;  3T0Y A;  5D8L B;  1HDD C;  3OYM A;  2DCE A;  4HF0 A;  3OL3 A;  3TOB A;  4KMU X;  1Z77 A;  4P5O A;  2W24 A;  4RB0 A;  4HEA 2;  2JVG A;  1IRX A;  3KFW X;  2QKM B;  4IQJ A;  2FJ1 A;  2WV1 A;  2DT6 A;  2XPW A;  1XGS A;  1UFM A;  2L4M A;  2IS4 A;  1BI1 A;  1R36 A;  3RKY A;  1G3W A;  3KLO A;  3TW7 A;  2YS9 A;  1MNM C;  1I27 A;  3FXJ A;  3FBI B;  3LNQ A;  4UUT A;  2JN6 A;  2LP0 A;  4JQF A;  1XSX A;  4HG2 A;  2ME0 A;  4BEH B;  5F1R A;  4CYC A;  2L01 A;  3PFY A;  1MKM A;  3I4M J;  4CCN A;  1DQU A;  3QYF A;  4LMY A;  4PDK A;  3K9T A;  3ERM A;  4XR6 A;  3FKI J;  4EVI A;  5D5W B;  1YIO A;  3GFJ A;  3KZI C;  1YOV B;  2XF6 A;  1Z91 A;  1BI0 A;  2BE5 F;  1I5Z A;  3LA3 A;  5EZG A;  3FF5 A;  3S17 J;  1U8R A;  1RIO H;  4LLL A;  2I10 A;  3PNT A;  2A07 F;  5EJC A;  2FOK A;  3BP8 A;  4PSX A;  4B48 A;  2EFP A;  2VBW A;  3M7G A;  3GZ6 A;  2VQG A;  3UNG C;  3Q0W A;  3EUA A;  4HZF A;  2NVT J;  3ISP A;  3RQI A;  1K7A A;  2V1D A;  2IA1 A;  1MDM B;  3E1S A;  2ID6 A;  3F22 A;  1W4M A;  5DYM A;  4QWQ A;  3VOD A;  2UZK A;  4L9N A;  4DZJ A;  1HW5 A;  3PIO F;  3S1Q J;  1IRZ A;  1E2X A;  4YG2 F;  2FBK A;  5CKT A;  2MLK A;  4D7M A;  1ZAR A;  3ESW B;  3BG5 A;  4ETS A;  2FA5 A;  5IP7 J;  3OR2 C;  3GZ5 A;  2LSO A;  3OOP A;  4BH9 A;  2P6T A;  3CC4 I;  1R58 A;  3E5U A;  2AQF A;  2VBY A;  1JGG A;  2BHY A;  3S3O A;  2DOF A;  3QWL A;  2Z3Y A;  2ZO4 A;  3F9K A;  3ZOB A;  1W5S A;  2ECC A;  3A1Y A;  4KT5 C;  2W4S A;  2QSG X;  4I76 A;  3MZH A;  4WXD A;  1WJE A;  3UKG A;  3SJM A;  2DMQ A;  3OYL A;  1RES A;  3JRG A;  1GVJ A;  3U2R A;  3RIR A;  1Z0X A;  4KIC A;  4KIF A;  3LQQ A;  1KQ9 A;  2FSW A;  3T8R A;  4DOZ A;  1NG6 A;  1X19 A;  2XAJ A;  4OAZ A;  4Q48 A;  2O5R A;  4A3C J;  5IYC J;  1ZRD A;  2A61 A;  2EIJ H;  2CQK A;  2W48 A;  4XLH A;  1IN5 A;  4ZDL A;  4A3K J;  5E17 F;  3IAM 2;  3A4C A;  1MH4 A;  3J7Z I;  1FNN A;  2L0K A;  4YFN F;  1K4T A;  4M72 A;  2F48 A;  3ZQQ A;  5FKM A;  3CZ6 A;  1ETX A;  3W3C A;  1FBU A;  1JI8 A;  2NVQ J;  3SEQ A;  4UY8 I;  4PFP A;  3FM5 A;  2D1H A;  2MH2 A;  3A0B C;  1XTA A;  1LNW A;  3D0S A;  2HXI A;  4CHU A;  4ZDP A;  3DP7 A;  1X1C A;  4HOB A;  1YRN A;  2DT7 B;  3VB2 A;  4RGR A;  3P9I A;  2R7D A;  3BPV A;  2VPR A;  3A2K A;  3KX2 A;  4HV6 A;  2LD5 A;  2EZH A;  3DXJ F;  4G9Y A;  2XV4 S;  2XC7 A;  1F43 A;  2KT0 A;  3KZZ A;  2RAE A;  3FZV A;  4DYC A;  4MQ9 F;  1J2X A;  2IVM A;  3K69 A;  3HOX J;  2EPF A;  1QPM A;  4BE1 A;  4YEL A;  3IV5 A;  4A93 J;  2OPT A;  4HX4 A;  2EFO A;  4ZYA A;  4M3F A;  3BJA A;  3CCR I;  2BEO A;  4XLC A;  2H6C A;  2KRH A;  1ERD A;  1REP C;  2GZW A;  3W6K B;  2K4B A;  2ZXH A;  4A3E J;  1FBS A;  2R5Z A;  3JRE A;  3E5X A;  2NVY J;  1RET A;  4RAY A;  3M9A A;  1VQ9 I;  1ETV A;  2KPM A;  2COM A;  2M7B A;  3KLN A;  4W1U A;  4HNT A;  4RAG A;  2E35 A;  2HQA A;  2DK5 A;  2ZXI A;  5BMZ A;  3CCQ I;  3I55 I;  3RZO J;  2ZB9 A;  3K4N A;  3IP4 B;  3ZXS A;  1H8A C;  3ZPL A;  4L0Y B;  4BU2 A;  3JR9 A;  2CQN A;  2V9P A;  4W97 A;  3RCO A;  4RB1 A;  5H6R A;  3FBN B;  4XKB A;  1SMT A;  3G3Z A;  1IN7 A;  3O2P E;  1OFC X;  2Z1D A;  5F1J A;  2JRT A;  1HKS A;  4P55 A;  4EJU A;  1I50 J;  1SC7 A;  1TLH B;  2OJE D;  2M3A A;  2VQC A;  2HZT A;  1STZ A;  2G9W A;  4J01 A;  3ML6 A;  1Z21 A;  5DDG A;  3DWL E;  3QU6 A;  3M07 A;  3BG7 A;  4IF4 A;  4II3 A;  3VYR B;  5J3L A;  3LSR A;  4HF1 A;  4PJL A;  1JKP C;  5CYV A;  4ZZL A;  4E6K G;  3L2R A;  3D5S C;  1Z3Y A;  3BOQ A;  1IAW A;  1T08 B;  2ZFW A;  2VKV A;  4RB2 C;  3L2U A;  4WX9 A;  4CCO A;  3HUG B;  5L3B A;  1EH8 A;  1LE8 A;  2W25 A;  3E6D A;  1V3F A;  4GRI A;  4L5I A;  3U9G A;  1HSJ A;  3WGI A;  2ESN A;  4PJJ A;  3GFL A;  3RDI A;  1H9G A;  2WB1 A;  2R7X A;  2DTZ A;  2GOX B;  3KP6 A;  4I6Z A;  1CGP A;  3NWS A;  3RTR A;  5HNH A;  3EYY A;  2XAG A;  3J7Y J;  3O8H A;  5FB2 A;  1V5E A;  3EQL F;  3DLL F;  3TO9 A;  2Q0O A;  2OF7 A;  2V9K A;  1U5T B;  1AHD P;  2ZBK A;  1LEB A;  2B0L A;  2CYY A;  2DMN A;  3I4P A;  4E4H A;  1MMA A;  1Y0N A;  1XN7 A;  2UUZ A;  1EH7 A;  1A5J A;  3V4G A;  4ENN A;  1JT6 A;  4A3J J;  3OL4 A;  4MQV A;  5AIQ A;  4MEX F;  1U5T C;  1ZR4 A;  4CUG A;  1YYV A;  2MW8 A;  4GCV A;  5J1Y A;  4A3F J;  2V6C A;  2ZJP F;  4BXF A;  2M30 A;  2ELJ A;  3CTA A;  3MQ0 A;  4FAS D;  2YPR A;  3FK7 A;  3R60 A;  3F3X A;  2VJ4 A;  3AAF A;  2Z5U A;  3QP6 A;  5ILV A;  4UUS B;  2CSO A;  4HLX A;  4XBF A;  3S2H J;  3H0D A;  4KDP A;  1B8I B;  3HOZ J;  4N0B A;  1QQI A;  3RKQ A;  2E19 A;  2DW4 A;  4BDY A;  3IUO A;  3OIP A;  2IP2 A;  4M3G A;  1OIS A;  4UVB A;  3EYI A;  2L4A A;  2P5K A;  2OTL I;  1WJB A;  3SFZ A;  5EGO A;  2E7X A;  2EIM H;  3K4B A;  2CQ7 A;  1P6R A;  1IG7 A;  2EZK A;  4F92 B;  2NNY A;  5CQE A;  4Y52 J;  2ZME B;  1KA8 A;  2C6Y A;  1P7I A;  3ABM H;  3SXY A;  2PJR B;  4B4C A;  4AIJ A;  4XRS G;  2KFD A;  2VI6 A;  4NNJ A;  1BM9 A;  1D0X A;  1H0M A;  2HPI A;  2P7C B;  1SVL A;  1XB4 A;  3HOT A;  2JSC A;  4EGY A;  4AU7 A;  2ADU A;  4RGU A;  3HBL A;  2HOE A;  2VJ5 A;  1VQ8 I;  1ETY A;  2BY0 A;  3BRO A;  2FOW A;  3CJN A;  4A5N A;  4EAT A;  3JRI A;  1J75 A;  1MMS A;  2ZME C;  1UHW A;  2VE9 A;  1YJ9 I;  4E7H A;  5J6X A;  5E3L A;  1W5C C;  2DI3 A;  2R92 J;  4OMZ A;  4ESJ A;  1W7P D;  1VQK I;  1QHG A;  4BUP A;  5J47 A;  3K1N A;  3GTG J;  1D0Z A;  2A6E F;  2FQ3 A;  1RR8 C;  3T8T A;  1X1D A;  3EDP A;  5FD5 A;  3MVP A;  4FCY A;  1OQY A;  2AXT C;  2PX9 A;  2VBX A;  5E8G A;  4C2U A;  1MBE A;  2RNJ A;  5F08 A;  2R7F A;  1UCR A;  4ZYG A;  1TWC J;  1JT0 A;  4GYG A;  2O3F A;  2OD5 A;  5IYD J;  3M4O J;  3ECO A;  4ZJZ A;  1DGW Y;  4RLQ A;  3M3Y J;  2XF7 A;  2VN2 A;  4PCQ A;  5F27 A;  2VON A;  3CUQ A;  1P7J A;  2AS5 F;  2JMW A;  5EF6 A;  2A6H F;  2XUB A;  5K7F A;  1ZG5 A;  3HG9 A;  1GXQ A;  2VC0 A;  2N8G A;  1LDD A;  5F0H A;  1TW2 A;  2KP6 A;  3CP2 A;  2KHM A;  1K4S A;  3G1L A;  5ILS A;  2L7M P;  1USS A;  1L3L A;  4XOR A;  3ZCO A;  1G3T A;  1R1V A;  4L9J A;  1OYY A;  2DMP A;  3FK6 A;  1IJW C;  4ITV A;  1R49 A;  3NEU A;  5EEH A;  4F52 A;  3JAM Z;  3WTY C;  3LAP A;  4A3G J;  2H1K A;  3LQR A;  2JUC A;  3J81 Z;  2ZXW H;  4KN7 X;  4MLO A;  4HSR A;  2CH0 A;  3BR3 A;  5B1B H;  2M4K A;  1X58 A;  2COB A;  2JTV A;  4E70 A;  5IPA A;  2W57 A;  2QA4 I;  4M9Z A;  3WTZ A;  1ZYR F;  1MMN A;  1I3Q J;  2DXI A;  1M1E B;  5J4Y A;  3ZMZ A;  2JA8 J;  5LGU A;  2CU7 A;  2TRT A;  1JUM A;  4FX4 A;  3HJE A;  1UMQ A;  4C3I J;  4OIR F;  4S05 A;  2M0M A;  3NAR A;  2JA2 A;  5C44 J;  1TNT A;  3U1D A;  3I56 I;  3WTW C;  2RRE A;  1ZKG A;  4QSH A;  3GZN B;  2WB1 N;  4C3H J;  4ZTJ A;  1U0J A;  1SD7 A;  2RGV A;  2D1V A;  5KAI C;  4CIC A;  5BNG A;  3T5X A;  3ZQG A;  1O7F A;  3KZY A;  2MD5 A;  3H3V K;  1WCM J;  3F0C A;  1G3Y A;  2LRD A;  2VB6 A;  2H09 A;  3KP4 A;  3PQJ A;  3JAM K;  3N4M A;  5F64 A;  4IHW A;  5D4R A;  3C2H A;  3J81 K;  5JHF A;  4F7Z A;  1JJ8 C;  2E2H J;  3SHF A;  4B43 A;  5H6Q A;  2O0Y A;  2LFB A;  3B6C A;  3HOY J;  4OIP F;  2XAH A;  4U0Y A;  1KU7 A;  1PP7 U;  5BOX A;  5GTI C;  1D1B A;  2QKL B;  4RS8 A;  2P0W A;  2Q2E A;  1YX5 A;  2DA4 A;  4G12 A;  2DYR H;  4E7J A;  3WTX C;  4M9S A;  3HB9 A;  1JE8 A;  3ZQL A;  4HST A;  1JHH A;  1IV8 A;  1QPI A;  2FD5 A;  2FNP A;  1G3S A;  2LC2 A;  3GUD A;  4LG3 A;  4RAF A;  4IXA A;  3H35 A;  3ULQ B;  5FD6 A;  2P8T A;  2JUG A;  2DTR A;  1HW2 A;  1Z6T A;  1SFX A;  3PUF A;  3BWG A;  3Q9S A;  3K4K A;  2W85 A;  4XK4 A;  4PK4 A;  1XMA A;  3CDH A;  3VDX A;  4NUB A;  3HZJ A;  3L09 A;  3CJQ B;  2ID3 A;  1AKH A;  1FOK A;  4LJZ F;  1IXR C;  1FJL A;  3VFZ A;  4YII A;  2EFQ A;  3G1O A;  3TO6 A;  1FOY A;  1WPK A;  1BOB A;  4DQ2 A;  5H20 A;  4HQM A;  2XAQ A;  4NC8 A;  3HKZ A;  4XLA A;  2DA7 A;  2IA0 A;  2B63 J;  1SFK A;  3GLX A;  1Z6R A;  2X0L A;  3DBL B;  4WF2 A;  5LGN A;  1R5I D;  4PGG A;  3DU5 A;  3S2W A;  4YFX F;  3HL2 A;  1HBX G;  2JQ7 A;  4DBR A;  2PMZ A;  3CCE I;  1H88 C;  2R5Z B;  1C0W A;  2WA0 A;  1W0U A;  1WJD A;  2Y30 A;  3NRV A;  4RBO A;  3VPR A;  4B1R A;  2CW7 A;  3BZC A;  2DOE A;  1ZH5 A;  3OSF A;  4PJ0 C;  5FKN A;  3R6S A;  2O61 A;  1SEU A;  4EV0 A;  3N05 A;  1BW5 A;  2DFH A;  3ZGK A;  3KP2 A;  2B9S A;  1T38 A;  1IDY A;  5FKO A;  1KGS A;  2IEK A;  2JWT A;  1S8N A;  4AYB A;  4CCL A;  2XPV A;  2CS3 A;  1FWZ A;  3E6M A;  3P5J A;  2EV6 A;  2OQG A;  2K4J A;  3REO A;  3RYP A;  1B6A A;  3F8M A;  3R0J A;  4R1H A;  3K2A A;  4Y15 A;  3G73 A;  4Q5S F;  2QCO A;  3OYG A;  2D45 A;  2HEO A;  2G0E A;  2K3P A;  4M3D A;  2GA2 A;  2EK5 A;  3WTU C;  4U7B A;  1JTY A;  1Z67 A;  4IX7 A;  4AID A;  1B4A A;  3LA7 A;  1WQ2 A;  3OOU A;  2LMD A;  2KDZ A;  1V5G A;  1TC3 C;  3G2B A;  1HW1 A;  2IXS A;  4CSW A;  1LKX A;  1D8K A;  2K3F A;  1XGO A;  1BI2 A;  4UVC A;  3HRT A;  4FIS A;  1EF4 A;  1P4X A;  4A0Y A;  5KHD A;  5FKK A;  2DQR A;  1HCR A;  2HWV A;  4KT6 A;  3M8F A;  2IS2 A;  1EKE A;  4EMS A;  4CCK A;  2GXA A;  2LG4 A;  4BS9 A;  4R79 A;  2IRF G;  3S1M J;  3I9V 2;  1ON2 A;  2FUG 2;  1UJ8 A;  4B47 A;  2Z2S B;  3DBH B;  3LFK A;  1IUY A;  3J80 Z;  1JKQ C;  4HRI A;  3W2A A;  1PP8 F;  2QUF A;  2YU3 A;  1FC3 A;  2CGP A;  4UHT A;  2HNH A;  3FIS A;  1D5V A;  2QGU A;  3GME A;  4DGW B;  1JHF A;  1XCV A;  2ESH A;  3L1P A;  3IRQ A;  1IF1 A;  3BR0 A;  2MC3 A;  3JRF A;  1U8B A;  1E3O C;  4O5V A;  4DBQ A;  2MG4 A;  1LVK A;  3COA C;  3F23 A;  1K6Y A;  3PSF A;  4NHJ A;  2K9M A;  2Z16 A;  3HTU A;  4ZH4 F;  3IL2 A;  2O9L A;  1OCT C;  3DTE A;  2R5Y B;  4NB5 A;  3L2V A;  1X3W B;  1DPU A;  3CDI A;  2G7H A;  2Y2Z A;  3DEE A;  2NYX A;  4X1E A;  4KUM A;  1ZR2 A;  1R1U A;  2WC2 A;  4JX6 A;  4LIT A;  3AG4 H;  4L9T A;  4AUX A;  2HVR A;  2JA6 J;  1VQL I;  2LTP A;  4MHG A;  4LG0 A;  1NG7 A;  2BZT A;  3QYB A;  2TDX A;  1BJA A;  4A6D A;  1TQI A;  4RGX A;  3TED A;  3TMO A;  1J7K A;  1KU3 A;  5DS9 A;  3J80 K;  1BN5 A;  1VI0 A;  1ZGA A;  5LHH A;  1P92 A;  4AM3 A;  4ENM A;  2L7F P;  2VJI A;  3C18 A;  2M7A A;  2W7N A;  3IH2 A;  2M1B A;  4EM1 A;  4XQF A;  1AU7 A;  3MKZ A;  3JRB A;  2OCC H;  5E20 A;  5L3G A;  2KJC A;  2VT2 A;  3FM3 A;  5D6F A;  3GBG A;  4IJA A;  4C2M J;  1YFH A;  2Y31 A;  1ZRF A;  2IGO A;  3SZT A;  2GXG A;  5J4V A;  2Y0S A;  3Q3S A;  4U0W A;  3ABK H;  1ZLK A;  4RGS A;  1CF7 A;  2LVS A;  3BJO A;  1XSD A;  2I5U A;  4I2O A;  4ZTF A;  3F6V A;  3DEW A;  2FNA A;  1W7P B;  1R00 A;  4FHT A;  4OWR B;  3TBI A;  3CO6 C;  1K78 B;  4BY1 J;  4JK1 X;  1U9O A;  3H5A A;  4XKV A;  5M3M J;  5LEK A;  5DUI A;  1SVO A;  2FE3 A;  4RLF A;  3LSJ A;  2E5Z A;  3PM1 A;  5HS8 A;  1ETK A;  2HGC A;  3F8F A;  1ZRE A;  3Q0V A;  4X6A J;  1QBJ A;  1Z7L A;  1FBQ A;  3QRF F;  5E79 C;  4ZYD A;  1T0F C;  3TO7 A;  3WG7 H;  1ZGW A;  2WV0 A;  3TP0 A;  1BC8 C;  4EM2 A;  2L3D A;  4IHS A;  4M71 A;  3FMR A;  2X85 A;  1VFC A;  2VKH A;  3PO2 J;  4OMY A;  3H1C A;  2R3S A;  2XGC A;  5L3F A;  3IC7 A;  3CO7 C;  2X1D A;  3B73 A;  3KP3 A;  3CCV I;  4IRG A;  4PJN A;  2RKH A;  2H94 A;  3HKZ N;  4DJA A;  5CVV A;  2CUJ A;  2OU2 A;  2HTS A;  2PJP A;  3D1N I;  3E3V A;  1TL8 A;  2DOA A;  4BE0 A;  2IAI A;  1IN6 A;  3GW2 A;  3TL4 X;  1ZN2 A;  2FBH A;  4A3D J;  2PMZ N;  4RA2 A;  4TV7 A;  2VBZ A;  4PFO A;  1APL C;  1O57 A;  1RRJ A;  1BR2 A;  2FRH A;  5E1W A;  4ON0 A;  2BW3 B;  3A01 B;  2EZI A;  2RVC A;  2LH9 A;  1SAX A;  2QVO A;  3H5R A;  4FQG A;  2RDP A;  2VL8 A;  1E3P A;  1ORK A;  1QZZ A;  2M34 A;  3S93 A;  1IXS B;  2GLO A;  3VYS B;  3IHU A;  1SD6 A;  2ZJ2 A;  4AYB N;  1FIP A;  1SD4 A;  3C3W A;  4FT8 A;  5K5O A;  3G6E I;  2ME6 A;  2OBP A;  1VQP I;  2DPU A;  1WKM A;  3KPH A;  3QPS A;  3F21 A;  2LY9 A;  3V8J A;  3BR6 A;  1IV6 A;  4MO7 A;  3ZMV A;  4IOC F;  2OZU A;  3HHH A;  4UUV A;  2F4M B;  4IQ4 A;  2VKE A;  5LRR A;  2F6C A;  2R7Q A;  3KEQ A;  1MJ9 A;  2HVS A;  3V7C A;  2RV8 A;  4R8H A;  2R7Z J;  4HW0 A;  1H9T A;  3Q0U A;  4A2U A;  3HM5 A;  3U21 A;  3BQZ A;  1WSU A;  2Y9Z A;  4DIQ A;  1QO0 D;  1X4P A;  1ITY A;  4E7I A;  2H8R A;  1R1T A;  1S5L C;  2LF7 A;  4FE7 A;  3WHB A;  4XOT A;  5HDN A;  2CUE A;  4MFD A;  2PMU A;  1RNL A;  1U78 A;  1TBX A;  3CMY A;  5E18 F;  1S9H A;  2J5P A;  3RKW A;  5EDN A;  4LD5 A;  4XKC A;  4ENK A;  3ZR8 X;  2HVQ A;  3W2V A;  2DA1 A;  4BQO A;  4KN4 X;  1VQ7 I;  2KRF A;  3P9K A;  1SD5 A;  2K9S A;  2Q1Z B;  3F72 A;  1Z3X A;  2A6T A;  1WZ2 A;  3CDL A;  4P96 A;  5JVG F;  2IS1 A;  5M5Y J;  1I1G A;  2DLL A;  2R7O A;  2STT A;  1RPW A;  3OR1 C;  5KCM A;  2LR8 A;  2JA7 J;  1T98 A;  4C30 A;  2F5D A;  2NOG A;  2M4G A;  2CJJ A;  4HPQ A;  4EEF G;  5K7Z A;  5GAG J;  2GQQ A;  5BQT A;  2V1X A;  2QEN A;  4HX7 A;  2AHQ A;  1XPX A;  4BQA A;  4IHX A;  3HOS A;  4M6V A;  1FSE A;  3BZ6 A;  5GAD J;  3KIO A;  3HOW J;  2PLY A;  2XPU A;  3I53 A;  3WTV C;  4JBA A;  3AG2 H;  2KZG A;  3K10 A;  4LLN A;  2EV5 A;  2MGQ A;  5IY5 H;  1XX5 A;  1AWC A;  3DEU A;  1VZ0 A;  3HRU A;  2QQ9 A;  2XGD A;  5TGT A;  3LSG A;  1TQM A;  1D1A A;  2DQL A;  5GP9 A;  3GEZ A;  3RI4 A;  2QSH X;  1MZB A;  1ON1 A;  3GO5 A;  1WI9 A;  2KQR A;  2DA2 A;  1WJA A;  2BYV E;  3DCF A;  1OKR A;  4B8X A;  4IHT A;  2R7U A;  3FIW A;  3NAU A;  1SFE A;  1S72 I;  1YJN I;  2TCT A;  1WVR A;  3GCM A;  1LDK B;  5BPI A;  1B1B A;  2OCE A;  1VQ5 I;  1V5F A;  2W82 A;  4ASN A;  5LFA A;  3A03 A;  2L2O A;  5CQG A;  2QQA A;  4IZZ A;  4CCJ A;  3H3Z A;  4KIB A;  3F6O A;  3I59 B;  4NQW B;  1WRJ A;  2BXY A;  1V54 H;  2Y0S N;  5F04 A;  2DA3 A;  3DU6 A;  4J19 A;  4E7K A;  3F8B A;  1Y6I A;  2HDW A;  3S32 A;  1ZAO A;  2E34 A;  1OYW A;  4OIQ F;  2P6S A;  3GYH X;  1F1Z A;  4CO8 A;  5IT9 K;  5M5X J;  2OTJ I;  4F55 A;  5D6E A;  5E3N A;  1BI3 A;  4XSZ F;  3VEP A;  2FF4 A;  3LSK A;  1G59 A;  3ROU A;  2VOP A;  1DU6 A;  1RI7 A;  1BOA A;  2HDC A;  2DOD A;  1V4R A;  2VC1 A;  4LB5 A;  3RSN A;  5IYB J;  4D7N A;  3HRM A;  2E71 A;  3CMA I;  2H27 A;  1XMK A;  3E5Q A;  3IWF A;  2EWN A;  4LIV A;  2WTE A;  2VE8 A;  4ABZ A;  4EQQ A;  5DD4 A;  1FZP B;  1U6G A;  5J1U A;  2E36 A;  2XRN A;  4BQN A;  3WU2 C;  2VJJ A;  3AG3 H;  2F5V A;  2Y48 A;  4OAY A;  1E3H A;  1HXD A;  1NTC A;  2NNN A;  2KL4 A;  4FE4 A;  4CZC A;  1XS9 A;  5J8C A;  3M1C A;  1HQC A;  2O03 A;  3DV8 A;  3ZMS A;  3CF5 F;  2KZV A;  2BOL A;  2M2E A;  4XKW A;  1ACI A;  1OPC A;  2K9L A;  4N4N B;  2X1E A;  2IW5 A;  3OYH A;  2F5E A;  5GPC A;  1BA5 A;  3BT9 A;  2HR3 A;  4B09 A;  2E1O A;  3MZY A;  1Z7U A;  2Y9Y A;  4AD9 A;  4C3J J;  2RQQ A;  3HC7 A;  2MH9 A;  1TZL A;  2BVM A;  2IGN A;  2K5C A;  2PEX A;  4WXH A;  4YFK F;  2K7L A;  5GAE J;  3LSP A;  4PJM A;  3H0G J;  3AL0 B;  2CG4 A;  1NK3 P;  1O4X A;  2V6E A;  5B1A H;  5FJ8 J;  2E1C A;  1KON A;  1ODD A;  3H9G A;  3ZQC A;  5BPD A;  1RR7 A;  1D8J A;  3I0T A;  4E7Z A;  2NOJ B;  1XDU A;  4HF2 A;  3HDD A;  1O3S A;  4BQQ A;  4G7O F;  1HKT A;  1IN4 A;  1QU3 A;  3AL0 C;  3LAJ A;  3CCY A;  1TWF J;  2CQQ A;  1FY7 A;  2KRC A;  2XB5 A;  4XN3 A;  2KIU A;  1VND A;  2XGX A;  1Y8R B;  4N4O B;  3SDB A;  2QF7 A;  2YR2 A;  1YW8 A;  3I54 A;  1MSF C;  4M3B A;  2M8G X;  3H5N A;  2K27 A;  3RJP A;  3OIO A;  1SAU A;  2FQ4 A;  2DK8 A;  4A3I J;  3GFI A;  4II2 A;  2HDD A;  3CCU I;  5FRM A;  3IH4 A;  2VQH A;  2ZXJ A;  4CYC B;  1ZK8 A;  2BGC A;  1JKR C;  2XVC A;  3BG3 A;  3QYE A;  3MKY B;  4KYW A;  1ZHF A;  3KP5 A;  2CUZ A;  2PQ8 A;  4M3E A;  2X6X A;  4XRF A;  1TWG J;  1S6L A;  3ABT A;  1ZGJ A;  5K7H A;  2ACJ A;  1HDP A;  2VUM J;  2A68 F;  2RC4 A;  4M74 A;  3PIP F;  4XON A;  1JUP A;  1T56 A;  4S0H B;  1E17 A;  3CD6 I;  4GO1 A;  1T33 A;  4ESB A;  1VQN I;  2R7W A;  2XSJ C;  2Y0M A;  3CLQ A;  4Y33 A;  5JR3 A;  3HHG A;  1CF7 B;  4M6X A;  2XAF A;  4A3B J;  1YX3 A;  2ZSH B;  1FLI A;  3RPU D;  5K5R A;  2K9N A;  4EJW A;  2GWR A;  3B6A A;  1X3Z B;  2YSR A;  1FTT A;  3Q9V A;  1OYI A;  1YG2 A;  3QPT A;  5FLV A;  2M5W A;  2HQR A;  3EUH A;  3E97 A;  2EH3 A;  4FX0 A;  2FBI A;  2V26 A;  4NC6 A;  1D1C A;  4QTR A;  4KA4 A;  4B3X A;  4FET A;  5E1Z B;  2O6G E;  3OYE A;  2HOT A;  1LFU P;  2CFO A;  4LIU A;  1ZG3 A;  4V2F A;  5M3F J;  5DD8 A;  1UEL B;  1WJC A;  2EBI A;  3R0A A;  2V1U A;  1XG1 A;  3S1N J;  2KMU A;  5EG0 A;  2EQR A;  1MND A;  5CPR B;  4EGZ A;  3FXK A;  4I7H A;  4L9V A;  3EET A;  1R5H A;  3WGG A;  5DCF A;  4NC7 A;  3CCS I;  1IGN A;  1DP3 A;  3A0H C;  4MNU A;  2VOO A;  1K61 A;  2L54 A;  4UNO A;  2NS0 A;  2XB0 X;  1JGS A;  1ZG1 A;  2MYS A;  4CZZ A;  1FT9 A;  5LRS A;  4BKX A;  2R7R A;  1U9N A;  3B02 A;  4AWX B;  2K85 A;  1G6N A;  2WAQ A;  4LLG F;  3K2Z A;  1IN8 A;  3TGN A;  4IEJ A;  1B72 A;  3KEO A;  1FX7 A;  1J0R A;  2HOA A;  3ZQH A;  1PVE A;  3T1B A;  3WOD F;  2R0Q C;  2X51 A;  4P9F A;  4ZYH A;  4BAY A;  1GLN A;  1KU2 A;  5LHG A;  3IAS 2;  4J00 A;  1QGP A;  2FU4 A;  2VT3 A;  3W6V A;  2BY2 A;  2LOO A;  5HDK A;  3S2D J;  1YRN B;  3HPG A;  4U0V A;  3G1M A;  3RZD J;  2P5V A;  2VPL A;  4LB6 B;  2D5V A;  1FIA A;  2JPC A;  3GVA A;  3GX4 X;  2IT0 A;  2DMT A;  3CP8 A;  2ZNZ A;  2CRG A;  1FMV A;  1QVU A;  3SZP A;  1T6S A;  2LRE A;  4IKF A;  3E0J B;  1YJW I;  5C3E J;  4I09 A;  1TT0 A;  2YX4 A;  2MFZ A;  5ILU A;  3LSM A;  4V19 K;  3LMM A;  4RM3 A;  1Y8Q B;  3MWM A;  4CGZ A;  3IRR A;  1X2M A;  2IGM A;  2YUS A;  3TKY A;  1A31 A;  2R4G A;  3OS0 A;  1HKQ A;  3WG9 A;  2X1C A;  1IZ1 A;  2WWY A;  5LEJ A;  2HOS A;  3BG9 A;  2NS7 A;  4DYQ A;  5GAH J;  2ZKZ A;  2BY3 A;  4HA8 A;  4BGD A;  3OSG A;  3PSI A;  1BC7 C;  1BL0 A;  4PZJ A;  4XRM A;  4Y17 A;  1JJ6 C;  1ONV A;  1BIB A;  2LKX A;  3CCJ I;  2V9V A;  2RQP A;  1BBY A;  1EJ9 A;  5JI6 A;  4IOA F;  3N97 A;  2E1N A;  2X6O A;  4GXO A;  1YE9 A;  5EYR A;  4KJZ A;  4JX5 A;  4UV9 A;  2HQ5 A;  3WE3 A;  1FOX A;  4G6D A;  4BBS J;  4UUS A;  1MGT A;  1B8I A;  3DPT A;  2ZJQ F;  1Z1D A;  1NH3 A;  3OS1 A;  3ABL H;  4L0Z B;  1UHS A;  2ETH A;  3KYL A;  1B9N A;  1YS7 A;  3CME I;  3BTJ A;  5H2F C;  3F8C A;  4C2T A;  6PAX A;  3A02 A;  2KIF A;  2UXN A;  3LL7 A;  1W0T A;  3ZN1 A;  4OIO F;  5FKL A;  2XGE A;  2ZJR F;  1DU0 A;  3ABU A;  2ZME A;  2KLO A;  3CLO A;  1VQ4 I;  1KU9 A;  2PJR A;  1S7O A;  1LE8 B;  2CV2 A;  4JX4 A;  2LBF A;  4HYE A;  1WGX A;  4HQE A;  3ZMT A;  1ZQ3 P;  2HXO A;  1EA3 A;  5FLX Z;  3DKX A;  1DPR A;  3ECH A;  3HRS A;  3GTK J;  3HEF A;  3JSO A;  2DPD A;  3QOE A;  5GTH C;  1D5Y A;  4XSX F;  2NVU B;  3EPZ A;  4RAZ A;  1J59 A;  4ZDO A;  4A5M A;  3H36 A;  2LY1 A;  4UV8 A;  2QBY A;  1MH3 A;  3DLA A;  1O3T A;  5LLQ A;  1OCP A;  2M0C A;  3BR5 A;  3HIF A;  4LK0 F;  4BNC A;  2L02 A;  2ZFU A;  5K1Y A;  2MA3 A;  4XMY A;  3MKL A;  5CVJ A;  1KQ8 A;  4HBL A;  1UHM A;  2MC4 A;  3VYU B;  3MN2 A;  4H4K C;  3BCA A;  2X6W A;  2Y69 H;  5KK1 A;  2STW A;  3ZRG A;  2LKS A;  3FDY A;  2Y75 A;  1BIA A;  1OR7 A;  1R6R A;  4KMF A;  1O3R A;  3K1P A;  4P1W A;  4XN0 A;  4A0X A;  5HOD A;  4Y13 A;  3R4K A;  3SFI A;  4UXN A;  4BAC A;  3K1M A;  1GDT A;  2ICW G;  2LNB A;  5C4J J;  4N9I A;  3HSE A;  4QPO A;  1X1B A;  1YQA A;  2EIN H;  1R7J A;  3C2G A;  5D5V B;  2QM3 A;  4CH7 A;  2YU9 J;  4WXC A;  4BY7 J;  1YS6 A;  1GUU A;  2NXN B;  2X9D A;  1JTX A;  4JYK A;  3C2B A;  4HDV A;  1VQM I;  1PUF A;  1UB9 A;  1WH5 A;  3ZQI A;  4BDZ A;  3OYB A;  4D9J A;  3GTJ J;  5KVR A;  2VXD A;  4KIG A;  2JRM A;  1I1S A;  1ZRC A;  5FLX K;  1UG2 A;  1V55 H;  2L9N A;  4KNY A;  3H92 A;  1QHH D;  2Z99 A;  1MIJ A;  3VOE A;  5AIP A;  1W5T A;  4BXU A;  3JRC A;  3C7J A;  3BZK A;  3QP5 A;  2NRA C;  3SEZ A;  4EM0 B;  1MJB A;  2X6Y A;  2JJ7 A;  3QQA A;  2UWM A;  3IKT A;  4DNC A;  5J40 A;  1R71 A;  4WK8 F;  3BTI A;  1Y1V J;  2IS6 A;  4MEY F;  1FSH A;  1FP2 A;  5EGO B;  4Y3O A;  5EEG A;  3TOA A;  1I6X A;  3QOP A;  4BJ5 C;  3OV8 A;  4HX8 A;  3FMS A;  2LDU A;  2DO7 A;  4E7S A;  3OYK A;  2P81 A;  4I99 C;  3G71 I;  5F0C A;  1UAA A;  4L18 B;  1S29 A;  2QEX I;  3K7A J;  1R22 A;  4MFE A;  4UVA A;  2WAQ N;  3DKY A;  2GIZ A;  2XSD C;  1MBF A;  2LLK A;  2FMY A;  4Q47 A;  4F91 B;  3J7A Y;  2RNG A;  1U3E M;  2DDA A;  3QPL A;  2L9V A;  2HZD A;  3GFM A;  1I39 A;  4YEJ A;  5DM7 F;  3FXL A;  4Z6Y A;  4U88 A;  4OIN F;  1FYK A;  3BY6 A;  5FRN A;  3SYT A;  2JPB A;  1N75 A;  1LDJ A;  1MNE A;  2EA2 A;  2DA6 A;  1BR4 A;  1MBJ A;  4C9Y A;  3ZMD A;  3JRD A;  4K2E A;  2K86 A;  2VQL A;  4P9U A;  2JSP A;  3IH3 A;  2B7E A;  1F9N A;  2FXA A;  5J1R A;  3LSI A;  3NWT A;  1K79 A;  2X4H A;  3HPH A;  4Y7N J;  5FLM J;  4I98 B;  2ZSI B;  4M9X A;  4EJT A;  3WU0 A;  3BPX A;  2A69 F;  3WTT C;  4XRS A;  2ELK A;  2ELH A;  1TTY A;  2MBF A;  3HGY A;  2F4I A;  5FFZ A;  3CUQ B;  2F5C A;  2GAU A;  2PG4 A;  3LA2 A;  1EH6 A;  2HU9 A;  1Q1V A;  1OCR H;  1IRF A;  1VTN C;  1QZE A;  1N25 A;  1WFX A;  1J9I A;  2DYS H;  5F6F A;  3FXU A;  2DJI A;  3O6B B;  3ZN0 A;  2VOD A;  2PFB A;  4D0P A;  5HLH A;  3CUQ C;  3QPH A;  3ELK A;  1Q1H A;  5HS9 A;  3MEX A;  2E5N A;  2WAF A;  5ERI A;  4GFB A;  2DFI A;  2H1L A;  2L9R A;  3MMY B;  3HXL A;  1UG0 A;  4XOP A;  1MJA A;  3V42 A;  5IP9 J;  3NQO A;  2KJB A;  4YIR X;  3ERE D;  4H0E A;  9ANT A;  3H9J A;  1RKW A;  4N9H A;  2HPM A;  3HGG A;  3G4S I;  1RC9 A;  2XKP A;  3ONQ A;  1IO2 A;  4HDU A;  3PQK A;  4IRI A;  1OCO H;  2IA2 A;  4BXX J;  4EJO A;  2X48 A;  1FOW A;  3ASO H;  4XM3 A;  5CVI A;  5LD2 C;  1RKT A;  1XDS A;  3AKZ A;  2CWE A;  2MSY A;  4NBQ A;  2UXX A;  4D1Q A;  2JK3 A;  3L9F A;  3KYC B;  2OV7 A;  1RZ4 A;  2KIM A;  2QLZ A;  2GA1 A;  2XIG A;  4XLP F;  2DBB A;  2FX0 A;  5LBQ A;  1YO5 C;  4JOM A;  2KIQ A;  1W1W E;  2OA4 A;  1PDN C;  4BHP A;  1MD0 A;  1YLF A;  2EJR A;  2RN7 A;  3PJR A;  5LHI A;  4G7Z F;  1HST A;  1WI3 A;  2CUF A;  3O3K A;  5DTD A;  3OYJ A;  1WWX A;  3K0L A;  3OYD A;  1KZH A; 
#chains in the Genus database with same CATH homology
 4I0A A;  1ULY A;  1IRG A;  4IRH A;  5E1X A;  5FGM A;  3JTH A;  1F4K A;  3L7W A;  4ESF A;  4G6Q A;  2Z33 A;  1EV7 A;  2FML A;  2JZY A;  5D8K B;  2OZ6 A;  2HYG D;  4HAM A;  1Y0U A;  1DUX C;  5IT9 Z;  2J5O A;  3E6B A;  1T2K A;  1XD7 A;  2O8X A;  5TJJ A;  1IXC A;  5E8I A;  4MGR A;  4KFC A;  2E7W A;  3HYI A;  4Q4Z F;  4I02 A;  5AON A;  2A3S A;  4HLY A;  3C1D A;  3V7R A;  1QZY A;  3PFI A;  3GWZ A;  4CXF A;  3FWE A;  2CO5 A;  5DUK A;  2M45 A;  4WCG A;  2BBY A;  2XRO A;  3R61 A;  4MTE A;  5IT3 A;  1YW9 A;  3L2C A;  1KYZ A;  2HS5 A;  5DCM A;  5L3D A;  3BDD A;  1DDN A;  2W84 A;  2M8E A;  1F5T A;  4EJV A;  2AXL A;  2GIV A;  1FYM A;  4G94 A;  5CJ9 A;  1XSV A;  2IJL A;  3E6C C;  1FP1 D;  3BJ6 A;  1R5G A;  2JT1 A;  4I01 A;  4GYI A;  5DV5 A;  4LFU A;  4O3M A;  3IKV A;  1B9M A;  2XHK A;  1RUO A;  5JFR A;  5ICG A;  2BV6 A;  3DKW A;  1P2F A;  2VXZ A;  3FXQ A;  2QYO A;  2FEZ A;  3TDU C;  1XCB A;  2M87 A;  3DFG A;  3MFK A;  1B59 A;  1SFU A;  3P7N A;  1P4A A;  5ICF A;  4A6E A;  3I71 A;  1XGN A;  5J8F A;  3KE2 A;  3M1E A;  1DP7 P;  3JW4 A;  1MDM A;  3M8E A;  5L3C A;  1T0F A;  5HVQ C;  1W7P A;  1K78 A;  3ZP5 A;  1G4D A;  2EFW A;  1IW7 F;  4S04 A;  1R23 A;  2QBY B;  3IWZ A;  1GXP A;  4MTD A;  4ZZD A;  2F5F A;  3GF2 A;  3DF8 A;  5TRD A;  4LGW A;  1Z9C A;  3L00 A;  1X3U A;  3DQV C;  3QAH A;  2G7U A;  3HSR A;  2EA4 A;  5HLG A;  3FHZ A;  1SMY F;  3Q5F A;  2QZ8 A;  4G8X A;  3RKX A;  3D5L A;  4AIH A;  1L0O C;  5L3E A;  4LG0 B;  1S3J A;  3FX3 A;  2NAZ A;  1KYW A;  2F2E A;  1XGM A;  2ZCW A;  5ICC A;  4GGG A;  3HSF A;  4IVN A;  1GHC A;  5D4S A;  1D3Y A;  4ENJ A;  1FPQ A;  1LQ1 A;  3JTG A;  1J5Y A;  3SQN A;  2XKO A;  1S7A A;  1TQP A;  2V79 A;  4CYD A;  4M73 A;  2OQR A;  5FFX A;  2DU9 A;  3RYR A;  3QU3 A;  4I0B A;  4LK1 F;  2YX7 A;  2P7V B;  3TQN A;  3RPU A;  1K6O A;  3RPQ A;  3ZMU A;  1LVA A;  4A12 A;  2PN6 A;  4L5J A;  5JVT A;  5CVU A;  4U7D A;  2LKP A;  3MCZ A;  5CLS A;  5HLI A;  2ISY A;  5D5X B;  1YW7 A;  2DT5 A;  2GXB A;  3WTS C;  4AIK A;  5FO5 A;  3FXR A;  4WWC A;  4HV5 A;  4XLN F;  1KQ0 A;  1LJ9 A;  3FMQ A;  5HDG A;  3WGH A;  3J7A O;  2MLG A;  1P4W A;  2HYF A;  5LGT A;  3F8N A;  2P5L C;  3P9C A;  4M6Y A;  2DAO A;  3H3U A;  5DEQ A;  2CW0 F;  2PBI A;  5ICE A;  3V8L A;  3KET A;  3HUG A;  5JHU A;  4BHC A;  1O7L A;  2EV0 A;  3JSP A;  2P4W A;  2D2W A;  1FYL A;  2LF8 A;  3LST A;  1Z05 A;  2QQB A;  3ZQ7 A;  2EB7 A;  3I64 A;  2HKX A;  1U5T A;  2HFH A;  2QWW A;  3I59 A;  4NQW A;  3HTS B;  1OMI A;  1TNS A;  4CDG A;  1ZLJ A;  5A2Q Z;  4BYY A;  4YIF A;  1PUE E;  5BS6 A;  3I58 A;  3W6J B;  5ED4 A;  2PI0 A;  1RUN A;  3I5U A;  4OU0 A;  1NHA A;  2HKO A;  3LWF A;  1T39 A;  1QNT A;  4AVP A;  2HQN A;  2ZNY A;  2PMH A;  1YTY A;  1JXS A;  2EFN A;  2IPQ X;  3GXO A;  5HS7 A;  4BHB A;  3KCC A;  2H6B A;  5HOO A;  2Q8K A;  4PGH A;  1LEA A;  2ISZ A;  1U2W A;  3MAJ A;  2XAS A;  3V7S A;  4QLC U;  4IPA A;  5A2Q K;  5D5U B;  2K02 A;  3WE2 A;  1LB2 A;  4OOI A;  5CVR A;  4RB3 C;  4ZYE A;  2OAZ A;  5K5Q A;  1TW3 A;  3CUO A;  1A04 A;  2HTJ A;  4O6J A;  2CFX A;  2A5Y B;  3V8K A;  2Z9O A;  4A0Z A;  3WU1 B;  1O3Q A;  5DCM B;  3DPL C;  4Z2Y A;  4G7H F;  3KP7 A;  1AOY A;  1UST A;  3TDZ C;  2KKO A;  3T0Y A;  5D8L B;  4HF0 A;  3TOB A;  4KMU X;  4P5O A;  2W24 A;  4RB0 A;  3KFW X;  1XGS A;  1UFM A;  2L4M A;  1BI1 A;  1R36 A;  3RKY A;  1G3W A;  3KLO A;  1I27 A;  4JQF A;  1XSX A;  5F1R A;  2L01 A;  1MKM A;  4LMY A;  4PDK A;  3K9T A;  4EVI A;  5D5W B;  1YIO A;  3GFJ A;  1Z91 A;  1BI0 A;  2BE5 F;  1I5Z A;  3LA3 A;  3FF5 A;  1U8R A;  1RIO H;  4LLL A;  2A07 F;  2FOK A;  3BP8 A;  2EFP A;  2VBW A;  3M7G A;  3GZ6 A;  4HZF A;  3ISP A;  1K7A A;  2V1D A;  2IA1 A;  1MDM B;  3F22 A;  1W4M A;  5DYM A;  4QWQ A;  3VOD A;  2UZK A;  4L9N A;  1HW5 A;  1E2X A;  4YG2 F;  2FBK A;  2MLK A;  1ZAR A;  4ETS A;  2FA5 A;  3GZ5 A;  2LSO A;  3OOP A;  4BH9 A;  2P6T A;  1R58 A;  3E5U A;  2VBY A;  2Z3Y A;  2ZO4 A;  1W5S A;  4KT5 C;  3MZH A;  4WXD A;  1GVJ A;  3U2R A;  3RIR A;  4KIC A;  4KIF A;  3LQQ A;  1KQ9 A;  2FSW A;  3T8R A;  4Q48 A;  2XAJ A;  1ZRD A;  2A61 A;  2CQK A;  1IN5 A;  5E17 F;  1FNN A;  4YFN F;  4M72 A;  1FBU A;  3FM5 A;  2D1H A;  2MH2 A;  1LNW A;  3D0S A;  4CHU A;  3DP7 A;  4HOB A;  3VB2 A;  4RGR A;  3P9I A;  2R7D A;  3BPV A;  4HV6 A;  4G9Y A;  3DXJ F;  2XV4 S;  3KZZ A;  3FZV A;  4MQ9 F;  1J2X A;  2IVM A;  3K69 A;  1QPM A;  4HX4 A;  2EFO A;  3BJA A;  2BEO A;  2H6C A;  1REP C;  2GZW A;  3W6K B;  2K4B A;  1FBS A;  3E5X A;  4RAY A;  3M9A A;  2COM A;  3KLN A;  2DK5 A;  5BMZ A;  3ZPL A;  4L0Y B;  4RB1 A;  5H6R A;  1SMT A;  3G3Z A;  1IN7 A;  3O2P E;  2JRT A;  1HKS A;  4P55 A;  4EJU A;  1TLH B;  2HZT A;  1STZ A;  2G9W A;  3ML6 A;  5DDG A;  3QU6 A;  4IF4 A;  4HF1 A;  5CYV A;  4ZZL A;  3BOQ A;  1IAW A;  2ZFW A;  4RB2 C;  4WX9 A;  5L3B A;  1EH8 A;  2W25 A;  3E6D A;  1V3F A;  4L5I A;  3U9G A;  1HSJ A;  3WGI A;  2ESN A;  3GFL A;  3RDI A;  1H9G A;  3KP6 A;  1CGP A;  3RTR A;  3EYY A;  2XAG A;  5FB2 A;  3EQL F;  3TO9 A;  2Q0O A;  1U5T B;  2ZBK A;  1LEB A;  2B0L A;  2CYY A;  3I4P A;  1XN7 A;  1EH7 A;  3V4G A;  4ENN A;  4MQV A;  5AIQ A;  4MEX F;  1U5T C;  1YYV A;  4GCV A;  2V6C A;  2M30 A;  3CTA A;  3MQ0 A;  2YPR A;  3R60 A;  3F3X A;  3AAF A;  2Z5U A;  3QP6 A;  5ILV A;  2CSO A;  4HLX A;  4XBF A;  4KDP A;  4N0B A;  1QQI A;  2DW4 A;  2IP2 A;  4UVB A;  3EYI A;  2L4A A;  2P5K A;  3SFZ A;  2E7X A;  1P6R A;  2NNY A;  2ZME B;  1KA8 A;  2C6Y A;  3SXY A;  4AIJ A;  1BM9 A;  1H0M A;  2P7C B;  3HOT A;  1XB4 A;  2JSC A;  4EGY A;  2ADU A;  4RGU A;  2HOE A;  3BRO A;  3CJN A;  4A5N A;  1J75 A;  1UHW A;  2VE9 A;  5J6X A;  2DI3 A;  4OMZ A;  4ESJ A;  1W7P D;  3K1N A;  2A6E F;  2FQ3 A;  3T8T A;  3EDP A;  5FD5 A;  2VBX A;  5E8G A;  2RNJ A;  2R7F A;  1UCR A;  4ZYG A;  4GYG A;  2O3F A;  2OD5 A;  3ECO A;  2VN2 A;  4PCQ A;  2VON A;  3CUQ A;  2AS5 F;  2A6H F;  2XUB A;  1ZG5 A;  1GXQ A;  2VC0 A;  1LDD A;  1TW2 A;  5ILS A;  1L3L A;  1USS A;  1G3T A;  1R1V A;  4L9J A;  1OYY A;  3NEU A;  5EEH A;  3JAM Z;  3WTY C;  3LAP A;  3LQR A;  3J81 Z;  4KN7 X;  2JTV A;  4E70 A;  2W57 A;  4M9Z A;  3WTZ A;  1ZYR F;  3ZMZ A;  5LGU A;  4FX4 A;  4S05 A;  4OIR F;  1TNT A;  3U1D A;  3WTW C;  1SD7 A;  2RGV A;  2D1V A;  4CIC A;  3T5X A;  1O7F A;  3KZY A;  2MD5 A;  1G3Y A;  2H09 A;  3KP4 A;  3PQJ A;  3JAM K;  3N4M A;  5F64 A;  5D4R A;  3J81 K;  4F7Z A;  3SHF A;  5H6Q A;  2O0Y A;  4OIP F;  2XAH A;  4U0Y A;  1KU7 A;  1PP7 U;  5BOX A;  4RS8 A;  2Q2E A;  3WTX C;  4M9S A;  1JE8 A;  1JHH A;  3GUD A;  2FNP A;  1G3S A;  4IXA A;  3ULQ B;  5FD6 A;  2P8T A;  2DTR A;  1HW2 A;  1Z6T A;  1SFX A;  3BWG A;  3Q9S A;  2W85 A;  1XMA A;  3CDH A;  3L09 A;  1FOK A;  4LJZ F;  1IXR C;  3VFZ A;  4YII A;  2EFQ A;  3TO6 A;  4DQ2 A;  5H20 A;  4HQM A;  2XAQ A;  2IA0 A;  3GLX A;  1Z6R A;  2X0L A;  4WF2 A;  5LGN A;  4PGG A;  3S2W A;  4YFX F;  1HBX G;  1C0W A;  3NRV A;  1ZH5 A;  3R6S A;  2O61 A;  4EV0 A;  3KP2 A;  1T38 A;  1KGS A;  1S8N A;  1FWZ A;  3E6M A;  3REO A;  2EV6 A;  2OQG A;  2K4J A;  3RYP A;  1B6A A;  3F8M A;  3R0J A;  4R1H A;  4Y15 A;  3G73 A;  4Q5S F;  2D45 A;  2HEO A;  2GA2 A;  2EK5 A;  3WTU C;  4U7B A;  1B4A A;  3LA7 A;  1WQ2 A;  1HW1 A;  1D8K A;  1XGO A;  1BI2 A;  4UVC A;  3HRT A;  1P4X A;  4A0Y A;  2DQR A;  2HWV A;  3M8F A;  4EMS A;  2IRF G;  4R79 A;  1ON2 A;  3LFK A;  1IUY A;  3J80 Z;  1PP8 F;  2QUF A;  2YU3 A;  1FC3 A;  2CGP A;  4UHT A;  1D5V A;  1JHF A;  1XCV A;  2ESH A;  3IRQ A;  1IF1 A;  2MC3 A;  4O5V A;  3COA C;  3F23 A;  4NHJ A;  3HTU A;  4ZH4 F;  3IL2 A;  4NB5 A;  1DPU A;  2G7H A;  2NYX A;  4KUM A;  1R1U A;  2WC2 A;  4L9T A;  4MHG A;  4LG0 A;  2TDX A;  1BJA A;  4A6D A;  1TQI A;  4RGX A;  1J7K A;  1KU3 A;  3J80 K;  1BN5 A;  1ZGA A;  5LHH A;  1P92 A;  4ENM A;  3C18 A;  4EM1 A;  2M1B A;  5E20 A;  5L3G A;  2KJC A;  2VT2 A;  3FM3 A;  5D6F A;  4IJA A;  1YFH A;  1ZRF A;  3SZT A;  2GXG A;  4U0W A;  1ZLK A;  4RGS A;  1CF7 A;  3BJO A;  1XSD A;  4I2O A;  3F6V A;  3CO6 C;  2FNA A;  1W7P B;  1R00 A;  4FHT A;  1K78 B;  4JK1 X;  5LEK A;  5DUI A;  2FE3 A;  5HS8 A;  2HGC A;  3F8F A;  1ZRE A;  1QBJ A;  1FBQ A;  3QRF F;  4ZYD A;  3TO7 A;  2WV0 A;  1BC8 C;  4EM2 A;  2L3D A;  4IHS A;  4M71 A;  3FMR A;  4OMY A;  2R3S A;  5L3F A;  3IC7 A;  3CO7 C;  3B73 A;  3KP3 A;  4IRG A;  2RKH A;  2H94 A;  5CVV A;  2OU2 A;  2HTS A;  2PJP A;  3E3V A;  1IN6 A;  3GW2 A;  1ZN2 A;  2FBH A;  4TV7 A;  2VBZ A;  1O57 A;  2FRH A;  5E1W A;  4ON0 A;  2RVC A;  1SAX A;  2QVO A;  2RDP A;  1QZZ A;  1IXS B;  3IHU A;  1SD6 A;  2ZJ2 A;  5K5O A;  1SD4 A;  3C3W A;  4FT8 A;  2OBP A;  2DPU A;  1WKM A;  3F21 A;  3V8J A;  3ZMV A;  2OZU A;  3HHH A;  4UUV A;  5LRR A;  3KEQ A;  1MJ9 A;  3V7C A;  2RV8 A;  4R8H A;  4HW0 A;  1H9T A;  4A2U A;  1WSU A;  1QO0 D;  1R1T A;  2LF7 A;  5HDN A;  2PMU A;  1RNL A;  1U78 A;  1TBX A;  5E18 F;  2J5P A;  3RKW A;  4LD5 A;  4ENK A;  4KN4 X;  2KRF A;  3P9K A;  1SD5 A;  3F72 A;  4P96 A;  1I1G A;  2DLL A;  2STT A;  1T98 A;  2F5D A;  2GQQ A;  5BQT A;  2V1X A;  2QEN A;  4HX7 A;  4BQA A;  3HOS A;  1FSE A;  3BZ6 A;  2PLY A;  3I53 A;  3WTV C;  4JBA A;  4LLN A;  2EV5 A;  1AWC A;  3DEU A;  3HRU A;  2QQ9 A;  1TQM A;  2DQL A;  3GEZ A;  3RI4 A;  1MZB A;  1ON1 A;  3GO5 A;  1WI9 A;  2BYV E;  1OKR A;  4B8X A;  4IHT A;  1SFE A;  1LDK B;  5BPI A;  1B1B A;  4ASN A;  2QQA A;  3H3Z A;  4KIB A;  3F6O A;  3I59 B;  1WRJ A;  3F8B A;  1ZAO A;  1OYW A;  4OIQ F;  2P6S A;  3GYH X;  1F1Z A;  4CO8 A;  5IT9 K;  5D6E A;  1BI3 A;  4XSZ F;  3VEP A;  2FF4 A;  3ROU A;  2VOP A;  1RI7 A;  1BOA A;  2HDC A;  1V4R A;  2VC1 A;  4LB5 A;  3HRM A;  2H27 A;  1XMK A;  3E5Q A;  3IWF A;  2EWN A;  2WTE A;  2VE8 A;  4EQQ A;  5DD4 A;  1FZP B;  1U6G A;  2XRN A;  2Y48 A;  1HXD A;  2NNN A;  5J8C A;  1HQC A;  2O03 A;  3DV8 A;  3ZMS A;  1OPC A;  2IW5 A;  2F5E A;  2HR3 A;  4B09 A;  3MZY A;  1Z7U A;  4AD9 A;  2MH9 A;  2PEX A;  4WXH A;  4YFK F;  2K7L A;  2CG4 A;  2E1C A;  1ODD A;  5BPD A;  1D8J A;  3I0T A;  1XDU A;  4HF2 A;  1O3S A;  4G7O F;  1HKT A;  1IN4 A;  3LAJ A;  1FY7 A;  2KIU A;  2XGX A;  2YR2 A;  1YW8 A;  3I54 A;  2K27 A;  3RJP A;  2DK8 A;  3GFI A;  2ZXJ A;  2BGC A;  2XVC A;  4KYW A;  1ZHF A;  3KP5 A;  2PQ8 A;  4XRF A;  3ABT A;  1S6L A;  1ZGJ A;  2ACJ A;  2A68 F;  2RC4 A;  4M74 A;  1E17 A;  4GO1 A;  4ESB A;  2Y0M A;  5JR3 A;  3HHG A;  1CF7 B;  4M6X A;  2XAF A;  1FLI A;  5K5R A;  4EJW A;  2GWR A;  2YSR A;  3Q9V A;  1OYI A;  1YG2 A;  3QPT A;  2M5W A;  2HQR A;  3EUH A;  3E97 A;  4FX0 A;  2FBI A;  4KA4 A;  5E1Z B;  2O6G E;  1ZG3 A;  5DD8 A;  3R0A A;  2V1U A;  4EGZ A;  4I7H A;  4L9V A;  3EET A;  1R5H A;  3WGG A;  5DCF A;  4MNU A;  2VOO A;  2L54 A;  4UNO A;  2NS0 A;  1JGS A;  1ZG1 A;  4CZZ A;  1FT9 A;  5LRS A;  3B02 A;  4AWX B;  1G6N A;  4LLG F;  3K2Z A;  1IN8 A;  3TGN A;  3KEO A;  1FX7 A;  1J0R A;  3T1B A;  3WOD F;  4P9F A;  4ZYH A;  4BAY A;  1KU2 A;  5LHG A;  1QGP A;  2FU4 A;  2VT3 A;  5HDK A;  4U0V A;  2P5V A;  4LB6 B;  2JPC A;  3GVA A;  3GX4 X;  2IT0 A;  2ZNZ A;  3SZP A;  1T6S A;  4I09 A;  2YX4 A;  5ILU A;  3MWM A;  4CGZ A;  3IRR A;  3TKY A;  1HKQ A;  3WG9 A;  1IZ1 A;  2WWY A;  5LEJ A;  2ZKZ A;  4HA8 A;  1BC7 C;  4PZJ A;  4Y17 A;  1ONV A;  1BIB A;  2V9V A;  2RQP A;  1BBY A;  5JI6 A;  3N97 A;  2E1N A;  4GXO A;  4UV9 A;  3WE3 A;  4G6D A;  1MGT A;  3DPT A;  1Z1D A;  4L0Z B;  2ETH A;  1B9N A;  1YS7 A;  3F8C A;  6PAX A;  2KIF A;  2UXN A;  4OIO F;  3ZN1 A;  3ABU A;  2ZME A;  3CLO A;  1KU9 A;  1S7O A;  4HYE A;  4HQE A;  3ZMT A;  5FLX Z;  1DPR A;  3ECH A;  3HRS A;  3JSO A;  2DPD A;  4XSX F;  4RAZ A;  1J59 A;  4A5M A;  4UV8 A;  2QBY A;  1O3T A;  5LLQ A;  3HIF A;  4LK0 F;  4BNC A;  2L02 A;  5K1Y A;  2MA3 A;  5CVJ A;  1KQ8 A;  4HBL A;  1UHM A;  5KK1 A;  2STW A;  2Y75 A;  1BIA A;  1OR7 A;  4KMF A;  1O3R A;  3K1P A;  4A0X A;  4Y13 A;  3R4K A;  4UXN A;  3K1M A;  2LNB A;  4N9I A;  3HSE A;  1YQA A;  1R7J A;  5D5V B;  2QM3 A;  4WXC A;  1YS6 A;  4HDV A;  1UB9 A;  5KVR A;  4KIG A;  1I1S A;  1ZRC A;  5FLX K;  4KNY A;  3H92 A;  2Z99 A;  3VOE A;  5AIP A;  1W5T A;  4BXU A;  3C7J A;  3QP5 A;  2NRA C;  4EM0 B;  1MJB A;  2UWM A;  3IKT A;  4DNC A;  4WK8 F;  4MEY F;  1FSH A;  1FP2 A;  5EEG A;  3TOA A;  1I6X A;  3QOP A;  3OV8 A;  4HX8 A;  3FMS A;  2LDU A;  2DO7 A;  4L18 B;  1S29 A;  1R22 A;  4UVA A;  2FMY A;  4Q47 A;  1U3E M;  3GFM A;  4U88 A;  4OIN F;  1FYK A;  3BY6 A;  2JPB A;  1LDJ A;  2EA2 A;  3ZMD A;  4K2E A;  2K86 A;  4P9U A;  1F9N A;  2FXA A;  1K79 A;  2X4H A;  4I98 B;  4M9X A;  4EJT A;  3WU0 A;  3BPX A;  2A69 F;  3WTT C;  2ELH A;  1TTY A;  2MBF A;  5FFZ A;  3CUQ B;  2F5C A;  2GAU A;  2PG4 A;  3LA2 A;  1EH6 A;  1IRF A;  1VTN C;  1J9I A;  5F6F A;  3FXU A;  3O6B B;  3ZN0 A;  2VOD A;  2PFB A;  4D0P A;  5HLH A;  3CUQ C;  3QPH A;  3ELK A;  1Q1H A;  5HS9 A;  3MEX A;  5ERI A;  2DFI A;  1MJA A;  3NQO A;  2KJB A;  4H0E A;  3ERE D;  4N9H A;  2XKP A;  4HDU A;  4IRI A;  3PQK A;  2IA2 A;  4EJO A;  5CVI A;  1XDS A;  2CWE A;  2UXX A;  3L9F A;  2QLZ A;  1RZ4 A;  4XLP F;  2KIM A;  2GA1 A;  2XIG A;  2DBB A;  5LBQ A;  1YO5 C;  2OA4 A;  1PDN C;  4BHP A;  1MD0 A;  1YLF A;  2EJR A;  2RN7 A;  5LHI A;  4G7Z F;  1HST A;  3O3K A;  1WWX A;  3K0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...