3TEDA

Crystal structure of the chd1 dna-binding domain in complex with a dna duplex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
229
Chain Sequence
DMDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA-binding domain of Chd1 in complex with a DNA duplex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
molecule keywords Chromo domain-containing protein 1
total genus 83
structure length 229
sequence length 261
ec nomenclature ec 3.6.4.-:
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3tedA02
1A5JA 2YS9A 4L5EA 3NAUA 1AKHA 5DTDA 3WHBA 4M3DA 2R5ZB 2E2HJ 2FJ1A 3C2BA 2LK2A 3Q0UA 1JGGA 2Y2ZA 2FD5A 1EF4A 5J1RA 2JWTA 4BKXA 1FIPA 2H1KA 3JRFA 1WH7A 4UUTA 3D1NI 2K9SA 2L7FP 1CQTA 1ETWA 3TW6A 1IDZA 5GPCA 3CDLA 3TEDA 1BW6A 1U9NA 3HGYA 4A3FJ 4G12A 2E19A 3UKGA 4M3BA 2DMQA 3FKIJ 1MBGA 1JT6A 3CQZJ 1UHSA 4X1EA 1R9TJ 2MGQA 2YUSA 2TRTA 3ZOBA 4W97A 2NS8A 1B8IA 1JKQC 4MFDA 2XRLA 3LSGA 1BL0A 5E3OA 1OJLA 1HDDC 1Q1VA 4IEJA 1DU6A 2M34A 5J3LA 4C2MJ 1HOMA 1S7EA 1IDYA 4DZJA 5FKLA 2NVXJ 3BTCA 5IOYA 3I4NJ 1MBHA 2HQ5A 2DMUA 3GTOJ 4D5FA 2EZLA 3G1LA 4XRSA 2Y0SN 1MH3A 3PM1A 1T33A 4A3EJ 2R5YB 5JLWA 3JREA 4IHXA 4A3BJ 2YU9J 2LKXA 2CJJA 3BQYA 2EBIA 1WH5A 5IYBJ 3JRGA 1MSEC 1VI0A 1U9OA 3BR3A 5F0FA 4JX4A 2LTPA 2B63J 3GTMJ 3OSFA 5F0CA 5K7ZA 2DTZA 2O9LA 4I76A 1F43A 2G0EA 4CYCB 1U8BA 2LY9A 1JKOC 1AHDP 1X2NA 1JKRC 1T56A 2NVYJ 1A6IA 1JTYA 5EYRA 2QF7A 1VNDA 3S1NJ 4A3GJ 2M2EA 4A3CJ 3O8HA 2HDDA 1ENHA 2P81A 1H89C 2DA6A 4BXXJ 4IHWA 5FJ8J 4A69C 4XICA 2RAEA 5C44J 1ETXA 1K83J 2Y30A 4QIWN 4S0HB 2JA7J 2HI3A 2EZKA 5IP7J 3S1MJ 2DN0A 1ETYA 1P7IA 1POGA 1JUSA 1TWFJ 2XPVA 4QTRA 1DU0A 3BG3A 1BW5A 2JK3A 2NOGA 4FISA 3HOYJ 3A01A 1HCRA 2PMZN 3O8GA 1TWHJ 3K7AJ 2E2IJ 2XGCA 4B4CA 4Y7NJ 3ZQGA 2FX0A 1TWCJ 1AKHB 2Y9YA 5EG0B 4DYCA 5GPAA 3MVPA 2DMNA 2WAQN 2XPUA 1JKPC 2CQQA 2HOSA 3OOUA 5E3MA 3DEWA 2O7OA 1UG2A 2DA5A 2K9QA 3S15J 1WCMJ 5J1YA 2WV1A 1U78A 1GDTA 4IHYA 1JTXA 3CMYA 5IYDJ 3G1OA 5EGOA 1ETKA 2XB0X 1IUFA 4J19A 1GVDA 3S17J 4BBRJ 2LFBA 3OIOA 2QCOA 3F0CA 3S1QJ 1B72A 1H88C 2ID3A 5EEAA 2HXIA 3S16J 3W6VA 5IP6A 3LSPA 1Y1WJ 4MLOA 3CCYA 4JX5A 4M6VA 2XGDA 4AYBN 1IGNA 3JRIA 3JRCA 4LOCA 3ZQHA 3HOZJ 3VPRA 2DMPA 5FKNA 3M3YJ 2IEKA 3M4OJ 3BQZA 3ZQLA 2EZHA 2R7ZJ 2K40A 2LP0A 4D7NA 5C3EJ 2KT0A 2TCTA 5K7HA 1IRZA 3JRHA 1I6HJ 2DA1A 1VF9A 5M5YJ 2R5ZA 2DJNA 1BJZA 2ID6A 4MO7A 1P7JA 2OPTA 3QPSA 2ECCA 4X6AJ 2ELKA 3GTPJ 4A3IJ 3MKLA 4V2FA 1XC5A 3DCFA 2X9DA 1MBEA 1MSFC 5FKMA 4MIMA 1PUFA 1MBJA 1ZK8A 4EEFG 2L0KA 5M3MJ 3BR6A 2AO9A 2CUFA 1MNMC 2XPWA 2IAIA 2W48A 4FTHA 5F08A 2N8GA 1RESA 5EG0A 1JT0A 4JX6A 3JR9A 5IP9J 2X6OA 4FE7A 2HXOA 2GBYA 3GTQJ 1VFCA 3BR0A 1QVTA 2DA7A 1XG1A 5HODA 3OSGA 4A3LJ 5K7FA 4FCYA 1MBKA 1JUMA 2ME6A 2R93J 4DW6A 4UUSB 3JRAA 1I3QJ 1NK3P 3HEFA 1ZTRA 1XS9A 2VPRA 5JLXA 2L7MP 4V2GA 4B3AA 3BTJA 1HLVA 1RPWA 3BTIA 3NARA 4A3MJ 2EH3A 4BY7J 1WGXA 4BY1J 1IJWC 1ETOA 1GV2A 2LD5A 1JJ6C 1X58A 5DS9A 3GTKJ 1RKWA 3G1MA 2COBA 1W0UA 2HYJA 3B6AA 1NTCA 3GBGA 2NVTJ 3QQAA 1OCPA 2M8GX 3ZQCA 1OCTC 3BT9A 3JRDA 1IG7A 4DYRA 3HKZN 3BR1A 5M5XJ 1LE8B 5C4XJ 3S2HJ 1OFCX 4MFEA 3PO2J 3FISA 2D5VA 3Q0WA 5EZGA 4BBSJ 1ZQ3P 1SANA 1FTTA 1X2MA 3JRBA 3IH2A 1IC8A 4C3JJ 3PO3J 3MN2A 5F1JA 2VKVA 4FE4A 4CYCA 3FIWA 1MH4A 2ECBA 1AU7A 3GTLJ 3FK6A 3S1RJ 4A3JJ 2GLOA 2Y9ZA 5EDNA 1FJLA 2IBDA 1RKTA 1RR7A 2JA8J 1E3OC 1GUUA 4XRSG 4A3KJ 2VKEA 2MG4A 4XIDA 3RQIA 2CUEA 1GV5A 4M3EA 3IV5A 5J1UA 5FKOA 1QVUA 4RBOA 2DA4A 4JP0A 2DA3A 2M0CA 3HM5A 3L1PA 4D7MA 3TP0A 5FKKA 3HOWJ 2HOTA 1ZKGA 2JA6J 2WB1N 3LSJA 1APLC 2CRGA 1Z0XA 2R92J 2CQXA 3HOUJ 2JMWA 1QPIA 5F0HA 2DMTA 5M5WJ 4JYKA 4C3HJ 4D5CA 3ZQIA 3B6CA 3BTLA 3RZDJ 1JUPA 4Y52J 2X48A 1LFBA 1O4XA 5F27A 1K61A 2ZB9A 2E1OA 1UMQA 5FLMJ 4XK4A 3HOVJ 4AC0A 1WPKA 3HOXJ 5FLVA 2OF7A 2M9HA 2LR8A 4QSHA 3RKQA 4A3DJ 1HDPA 2LVSA 2XGEA 2I10A 1NK2P 3IH3A 3BG5A 2NS7A 2JA5J 2KDZA 5E3NA 3LSRA 3TW7A 3WHCA 3H0GJ 3BR5A 5E3LA 1YRNB 3TP3A 1BA5A 3RZOJ 4DYQA 2DA2A 4UUSA 4DZPA 1ZR4A 2MW8A 1SFOJ 5GP9A 4ABZA 5C4JJ 5IYCJ 2AHQA 3BR2A 1FIAA 1GT0C 2HOAA 1JJ8C 1FTZA 4AUXA 5F04A 1RETA 2JJ7A 4IHVA 4A93J 2EQRA 2CU7A 3IH4A 1YRNA 1TWAJ 2L9RA 5EF6A 1FEXA 3H3VK 3GTJJ 2O8KA 1G2HA 1ZGWA 3FK7A 3I4MJ 3Q3SA 3SJMA 4M3GA 3SFIA 9ANTA 3A02A 1ETQA 5IPAA 1D5YA 1ETVA 2Y31A 3HB9A 2H8RA 4W1UA 3A01B 3QPLA 5BNGA 3Q0VA 3K2AA 3ZQFA 3S2DJ 1WI3A 1I50J 3E7LA 1LE8A 1W0TA 1ITYA 1PUFB 1LFUP 2VI6A 1ZR2A 5M3FJ 4B1RA 3HGGA 1TC3C 1Z77A 1B8IB 2E2JJ 5IOZA 3S14J 1QRYA 3HBLA 2GM4A 4M3FA 3LOCA 2VUMJ 2L7ZA 4XRMA 5EGOB 3SDGA 2XSDC 1ORKA 4GFBA 2MSYA 4I6ZA 1B72B 1MBFA 5EZHA 2NVQJ 1HF0A 1Y1VJ 4NDLA 1TWGJ 2JN6A 2XB5A 4C3IJ 4RDUA 2K9NA 2LLKA 1H8AC 3A03A 4HNVA 2R5YA 1IV6A 1F36A 2EZIA 3BG9A 2R0QC 3GTGJ 3LNQA 2FQ4A 2ME0A 3HDDA
chains in the Genus database with same CATH superfamily
1YYVA 1A5JA 2YS9A 5L3DA 1R36A 2V1DA 3WHBA 2IT0A 2DTRA 4M3DA 1YITI 1G3SA 4IF4A 3ZQQA 3FBIB 1FP1D 3Q0UA 2EV6A 4G7OF 3HPGA 1XMAA 5J1RA 4JOMA 1OMIA 1S8NA 3KLNA 4UUTA 4PJJA 5E1ZB 3D1NI 3GLLA 2RNJA 1ETWA 3TW6A 1XMKA 4HF1A 4ZYDA 4AVZA 2VL8A 2A61A 4XOPA 3LAPA 3GZNB 3HGYA 2PFBA 5LFAA 2KZGA 3ZN1A 1WWXA 3H5AA 4G12A 2E19A 3CZ6A 5FD6A 5IT9K 2D45A 1R6RA 1T95A 1R1VA 3KP7A 2ZMEC 2MGQA 1V5GA 1XCBA 2TRTA 2YX7A 3E5QA 4W97A 3ZOBA 1FOWA 3LFKA 2O8XA 3CCEI 3CP8A 4XQFA 2XRLA 1UELB 1MDMB 4O5VA 1BIBA 1REPC 3E3VA 2VJ5A 1NG7A 3K6GA 1W7PB 2A05A 1MMNA 5TRDA 3W2AA 1OJLA 1R1TA 3LWFA 3L2CA 3HUGB 1HDDC 1MJAA 3CC2I 1FSHA 2MD0A 2CUJA 2FA5A 4CCKA 2R7RA 4ENNA 2XAQA 3OYMA 4CA0A 4J01A 4N9HA 1HKSA 2K3FA 1ZGAA 2ZBKA 1S3JA 4DZJA 3QPHA 5D4SA 2LC2A 5IOYA 2BVMA 3I64A 2EA4A 1FPQA 3LSMA 3LA7A 1OISA 1HC8A 1BC8C 2W57A 4I99C 2K7LA 4RMNA 4IHXA 5JLWA 2VT2A 5CVJA 2Y75A 3ECOA 1YTYA 2LKXA 2QSHX 2CJJA 4ZYEA 1T2KA 2EBIA 3O2PE 5DYMA 1YG2A 4ZYAA 5HNHA 1GLNA 4F3QA 1UFMA 3BR3A 3GFMA 3BOQA 3OSFA 5CLSA 2VT3A 4U87A 4FT8A 2O6GE 2CYYA 2O9LA 3H1CA 4I76A 2NYXA 1W7PA 4BE0A 4AD9A 3CO7C 1PP7U 1FWZA 2E1CA 2XF5A 3TKYA 1I39A 1JKOC 2LH9A 3VFZA 1H9TA 2R7TA 3FMSA 3WTTC 4KITB 1AHDP 1JKRC 5KK1A 2NVYJ 3FX3A 1FBQA 2BY1A 2QF7A 1KYZA 3F8CA 3R0AA 4BACA 5IT9Z 2VC0A 2EFPA 2GQQA 2RDPA 1MMGA 2PN6A 3ABUA 2ZJPF 1N25A 1GXQA 1H89C 3TDZC 2RAEA 2CO5A 5C44J 1FBUA 1ERDA 4G94A 4QIWN 2JA7J 2HI3A 4H0EA 3RI4A 3S1MJ 1MKMA 1TW2A 4KUMA 1POGA 1TWFJ 3NRVA 1BW5A 2XF7A 3H36A 4MHGA 4IOCF 3I5UA 5FB2A 3H3ZA 5LD2C 2VONA 3HSFA 3OYDA 3BP8A 5J4YA 3HL2A 5D5VB 2IP2A 4Y7NJ 3ZQGA 5EG0B 1ON1A 3MVPA 5JHUA 3K4KA 1BI0A 1S5LC 4CCNA 4II3A 1JKPC 1LJ9A 4AWXB 2DU9A 2HOSA 2OBPA 5E3MA 2O7OA 4A2UA 2PMHA 4OOIA 3R6SA 3IL2A 4OIRF 2QGUA 2VOPA 3ABMH 1D0YA 1GVDA 2FF4A 3FWEA 3F0CA 1DP3A 3W3CA 3Q9SA 5HLHA 1I3AA 2DOFA 3W6VA 2HR3A 2E60A 3LA2A 1Y1WJ 4LFUA 2R7OA 1R1UA 1T08B 3EUHC 3JRCA 2IS2A 1R7JA 1Y56A 2BE5F 1Z7UA 3VPRA 3DV8A 4D0PA 3CF2A 2LY1A 3K70D 1G4DA 3OL4A 1HSTA 2LP0A 3L00A 1QNTA 1TL8A 2BGCA 2WAFA 3VYSB 3S2WA 3J7ZI 3QP6A 3A4CA 5F6FA 5LRSA 4Q5SF 2DLLA 3CUQB 3GFIA 3L2QA 4X6AJ 3KYLA 1ACIA 1YW7A 3BWGA 5D8LB 4Q48A 3GTPJ 1WSUA 2IGKA 2QWWA 2V9VA 2XROA 2K4JA 2EK5A 1MBEA 2X9DA 2XVCA 3S32A 3CMMA 5FKMA 2IRFG 4MIMA 4AYBA 1PUFA 2OC6A 3OL3A 2YR2A 5JFRA 4HQMA 3VEPA 5HS9A 2XGXA 4GYIA 2AO9A 1MNMC 2R7UA 2IAIA 2W48A 5J47A 4B3XA 1FYMA 1VQ6I 1JT0A 4JX6A 5E8GA 2CGPA 2X6OA 3J80Z 3MKWB 5F64A 5HOOA 3GTQJ 3D0SA 4HX8A 3BR0A 1QVTA 3OIPA 5HODA 3OSGA 4EVIA 2R93J 2RQPA 3JRAA 5DM6F 1I3QJ 1NK3P 1ZTRA 2VPRA 2HWVA 4V2GA 5JLXA 3VDXA 4B3AA 3DTKA 1SD7A 3BTIA 1HLVA 1LUJB 4RAGA 4BY7J 4GRIA 1D3YA 2E5NA 3WU1B 1ZN2A 3KFWX 4BH9A 3KZYA 1ETOA 1GV2A 1IJWC 1JJ6C 1HBXG 5DS9A 1B9MA 2COBA 2HYJA 3B6AA 2ZXWH 3DTEA 1O7LA 3QQAA 2M8GX 4UY8I 3BPXA 2B9SA 2W82A 3EYYA 4PSXA 1UB9A 3JRDA 1LE8B 3HKZN 2DW4A 2H6BA 1OFCX 2XASA 2FBIA 2VN2A 2WV0A 3FISA 4HPQA 3S2HJ 3FXKA 1O3SA 2V1UA 2HPMA 5F1RA 1FTTA 2R7QA 1KGSA 3DEUA 4I7HA 1IC8A 3KZZA 3MN2A 1OYYA 1J0RA 3PSIA 3H9QA 2DT7B 2NNYA 1AU7A 2NRAC 3O3KA 3GTLJ 5HVQC 1O3TA 4A3JJ 2GLOA 1FC3A 3AG3H 3TO7A 4LG0B 3K2ZA 3KP3A 1U5TA 4L0ZB 3LL7A 2HZDA 4A3KJ 4V19K 2JA2A 5DD4A 4M9ZA 3RQIA 2VKHA 2ELJA 4C2TA 1VQ8I 2J5PA 4WWCA 4JP0A 3HM5A 5E79C 2WC2A 4D7MA 5IY5H 3N97A 1E2XA 3LAJA 2K4BA 4UVCA 2GXBA 1I27A 2QQAA 3AKZA 2FQ3A 2JA6J 2WB1N 4BE1A 1APLC 2CV2A 3EYIA 2HDWA 2CUZA 2OV7A 2CQXA 3HOUJ 3DXJF 3F8BA 3CCJI 2M5WA 3CUOA 4ETSA 4C3HJ 4D5CA 5D5XB 4R8HA 4J00A 3K1NA 4PGGA 3ZQIA 3BTLA 3RZDJ 2Y69H 1LFBA 1QZYA 2OCEA 3M8EA 1UMQA 3OS2A 2F4IA 4XK4A 5FLVA 3HOXJ 1LFPA 3AL0B 1JHHA 1B1BA 3VOEA 4C9YA 5ICCA 3F8FA 1HDPA 1EV7A 2LVSA 2K9MA 3SYTA 2L9VA 4OWRB 4HV6A 3ZQ7A 4HDVA 1OCRH 1BIAA 3K1PA 2AXTC 2HVQA 4KYWA 1Z67A 3QOEA 1RNLA 2HDCA 4GGGA 2VBXA 3QYBA 1I1SA 1D0XA 1XGMA 3GVAA 2JA5J 3K4CA 3G4SI 2KDZA 3RYRA 2QLZA 3SDBA 1MJBA 1BR1A 4PZJA 2HU9A 2WBMA 3HXLA 3M07A 1IUYA 3H0GJ 4NC6A 4Y3OA 2BXZA 2IJLA 2VJ4A 3TOAA 5GTIC 4DYQA 5CVRA 1BC7C 1XSVA 2XAFA 2Y48A 2MLKA 5C4JJ 4G7ZF 4LK0F 2NVUB 4NB5A 2A6HF 4AIJA 2AHQA 2LOOA 2W85A 4DOZA 4LB5A 1GT0C 2CMPA 1JJ8C 3QRFF 3KP4A 3RCOA 3CCRI 4PDKA 4MEYF 2HTSA 1RETA 2W00A 2JJ7A 1FMVA 1LEAA 5FD5A 3ZMTA 1SD6A 2D1VA 2XHKA 2ZMEA 1X1BA 3S3MA 3KEQA 3LA3A 4HF0A 2UZKA 2DFEA 1FEXA 1OQYA 2KRCA 2KP6A 1P4XA 1G2HA 4XNFA 3MWMA 3AG1H 1K4SA 4UV8A 4OINF 5L3CA 3A02A 1WHUA 1ETQA 3ISPA 4E4HA 1ZRFA 1ZYRF 3BZ6A 3BJAA 3QPLA 3RTRA 4OU0A 3GO5A 3ZQFA 2BY2A 1P9QC 2LDUA 5DCMA 1LE8A 2VASA 1W0TA 4AVPA 1QHGA 3E5XA 1PUFB 1T8IA 1OCZH 2VI6A 1ZR2A 2LKSA 3HGGA 4PJLA 2FBKA 2ETHA 3BG6A 2VQCA 2L9SA 3SEZA 2DDAA 3BJOA 2ZKZA 3V7RA 1J59A 1SVMA 2B0LA 3HBLA 4II2A 2GXAA 3TO6A 3FBNB 5JVTA 4HNTA 1R58A 3EPZA 4BS9A 4BAYA 2F4OB 2MSYA 3WU0A 3A0BC 2BXYA 3AG4H 4YIIA 5LLQA 1E0EA 2JN6A 1O7FA 2JT1A 4HA8A 3L2UA 1VQPI 4C3IJ 4WXCA 5LHGA 4RDUA 4CZCA 3A03A 4HZFA 3I59A 4Y15A 4HX7A 5FLXK 3QP5A 2EZIA 5E1WA 3OYFA 2OTLI 2KHMA 1SFXA 4KIFA 2MYSA 4XSXF 1IXCA 3NAUA 4NHJA 1MMSA 2A5WA 3HOTA 2HFHA 1WJ5A 2V26A 5JHFA 1P4AA 5CVVA 3ROUA 1JGGA 3I59B 2W1OA 4BQQA 1ZRCA 1TTYA 1FIPA 2H1KA 2OUMA 3ECHA 3H9JA 4M9XA 2K9SA 2L7FP 1YX3A 5KCMA 2V79A 1BW6A 3CD6I 2ISZA 3UKGA 1V55H 4M3BA 3ZPLA 3FKIJ 1MBGA 2MC3A 3V8LA 1LDKB 3F3XA 4KN4X 3PFIA 1WRJA 4XKBA 2YUSA 3N05A 3ULQB 1Z3XA 4XLCA 2NS8A 2L7KA 4XMYA 4MFDA 2XKOA 5DEQA 3E6CC 3G71I 3KEOA 1XX5A 5E3OA 5HDGA 2GA2A 2BW3A 2RN7A 3VYRB 1ZH5A 3F22A 4NQWA 2DDBA 3E6MA 5J3LA 2NS0A 3EUHA 4C2MJ 2VOOA 3ESWB 3CC4I 1IDYA 1S72I 2DPUA 5FKLA 3ZN0A 3BTCA 2NVXJ 1MW7A 3BJ6A 3CCMI 3I4NJ 1MBHA 2HQ5A 2P5KA 2DMUA 2MA3A 4D5FA 1H9GA 3BG7A 4RB3C 2DT5A 3COAC 3G1LA 3IAM2 1SC7A 3HJEA 1DUXC 4IKFA 1MH3A 4HV5A 3FXQA 3GLXA 2FRHA 3QPTA 1R4NB 3JREA 2YU9J 3WE2A 3RYPA 1WH5A 3WGIA 1MSEC 1V3FA 1FSEA 5CJ9A 2LTPA 1O3RA 2B63J 3F8MA 5F0CA 2ZMEB 4UV9A 2X4HA 2G9WA 5H6RA 2DTZA 3L09A 5JI6A 3L2VA 5A2QZ 3WTZA 3L2WA 3NWSA 1T98A 1F43A 1QZEA 4CYCB 4WK8F 2LY9A 4C2UA 2KPMA 5E18F 1A6IA 3OV8A 1JTYA 2OZUA 3F23A 3J81K 1GXPA 3WU2C 3S1NJ 1XSXA 2XAJA 2X6WA 3H5NA 2M2EA 2K3PA 4EM0B 5BPDA 1R23A 2RKHA 2V4JC 2MD5A 2L5QA 3O8HA 1R4MB 4A3CJ 2CQ7A 3LSKA 4F55A 1X4OA 1MD0A 4CXFA 4BXXJ 3OYHA 4A69C 2FU4A 3DF8A 4RM3A 2DBBA 4ANJA 1P92A 1S7OA 3BCAA 1Z1DA 2KMUA 3KP5A 3GW2A 4L9NA 4CYDA 2IGMA 2FOKA 3I55I 1HKTA 2RVCA 1B59A 2KJBA 4M9SA 1K4TA 5IP7J 4L5JA 1ETYA 1P7IA 2BHYA 5J4VA 1JUSA 5DV5A 5ED4A 4XKCA 2BBYA 3TMOA 3BG3A 1STZA 2NOGA 2CV1A 5LBQA 1G3WA 2DFFA 1VTNC 2H94A 1IRFA 3HKZA 4A0ZA 3O8GA 5ILUA 3GWZA 2E2IJ 2EV5A 1SD5A 4B4CA 2EFNA 4EGYA 2QSGX 2QYOA 3RJPA 1AKHB 3A0HC 4DYCA 3GCMA 1YHQI 3W6JB 1WJBA 2V1NA 3JTGA 1LNWA 4P55A 5CYVA 4I0BA 2WY8Q 2M30A 3KCCA 2K9QA 1WCMJ 2VXDA 2NNNA 2WV1A 1MNDA 3FXRA 1YJ9I 1U78A 4CCLA 3CMYA 4IHYA 1P6RA 1TP4A 1OR7A 3B73A 1TLHB 2LFBA 2QVOA 3OIOA 2QCOA 1QHHD 3ZMZA 2ID3A 4CCJA 1B72A 3S16J 5IP6A 5CQEA 3LSPA 3CMEI 2QQ8A 4U88A 1BM9A 4JX5A 1DPRA 2XGDA 4A0YA 1LQ1A 3KYDB 3P7NA 2JUCA 3JRIA 4FHTA 2CFXA 4LOCA 2IS1A 5HLGA 3HOZJ 1YS6A 2DMPA 2PEXA 2IEKA 3M4OJ 3QOPA 5ERIA 2O0YA 3E97A 1T38A 1UCRA 4LK1F 2R7ZJ 1X1AA 2DCEA 2RNGA 2VLAA 2K40A 1X19A 3F72A 4XLFA 4M71A 3DPTA 1I1GA 1P4WA 2DA1A 5M5YJ 2R5ZA 1FOYA 2E34A 1XPXA 3IC7A 3PUBA 3QPSA 2FXAA 2JZYA 2OPTA 4IZZA 2WAEA 3BC8A 1BOAA 4OIPF 2WY7Q 4EJWA 2V7FA 4G6TB 1K79A 2B7EA 3MKZA 3RKXA 2WA0A 5LHHA 2F4MB 3DCFA 5GAGJ 1MSFC 4KISA 3PUFA 2P8TA 1W5TA 1X3UA 5JVGF 1ZK8A 1YE9A 2L0KA 4BQNA 5M3MJ 4U7BA 2CUFA 1Z6RA 1IN8A 4FTHA 1B4AA 4P1WA 1D1CA 1H0MA 1E17A 5IP9J 2GBYA 2A6TA 4KMUX 1SMYF 2DODA 1VFCA 2DA7A 4XLAA 2FMYA 1DP7P 2JSCA 2BW3B 2XV4S 2UXNA 3BDDA 4UUSB 4IQJA 4DJAA 1ODDA 4ZC3A 1R5HA 3QAHA 2CG4A 1FT9A 3BTJA 5LGNA 1D8KA 1RPWA 3NARA 3KZIC 4A6EA 2V6CA 2EH3A 2QQBA 2LMDA 4A3MJ 2IVMA 1TNSA 2ZJQF 4HAMA 3U1KA 3CTAA 2JTVA 4YEJA 1RKWA 3C3WA 1OLTA 4BNCA 2EIKH 2G7HA 3GBGA 2NVTJ 2JQ7A 3ZQCA 3WE3A 1OCTC 3M7GA 2GXGA 4DYRA 3L9FA 3BR1A 5M5XJ 1UJ8A 3ABTA 1QZZA 3ZR8X 3J7AY 3U21A 4YFKF 1L3LA 1X1PA 1V54H 4IVNA 2D5VA 2Z9OA 5EZGA 2M7BA 3FKJA 3JAMZ 4EJVA 5D5WB 4M6XA 5F1JA 3BZCA 2VKVA 4CYCA 1LDDA 3FIWA 1ZELA 3CJTB 2ECBA 3WTUC 1HW2A 2Y9ZA 4UXNA 3ZGKA 4BJTA 4AIKA 1RR7A 2H27A 2JA8J 1VQ4I 2W25A 2L9NA 4XRSG 1FP2A 5DUIA 4XLPF 2LF7A 3CUQC 5DDGA 2CUEA 1MDMA 4M3EA 2KJCA 4PFOA 1QVUA 4RBOA 2DA4A 4LMYA 2DA3A 3FZVA 1SVLA 2GZWA 2XUBA 3L1PA 2ZXIA 3AFHA 3W2VA 1N77A 1FOKA 3HOWJ 3DTIA 2HOTA 1YOVB 1KA8A 1XSDA 3PQKA 4YELA 1LVAA 3FXMA 2X85A 4A5MA 5J6XA 2R92J 3OYGA 1KU3A 2H09A 2JMWA 3E6BA 4I2OA 1IN5A 1TQPA 5M5WJ 2HVSA 1T0FC 1Z21A 2AXLA 2EB7A 1A04A 4MTDA 1RIOH 1JUPA 1Y6IA 2X48A 1SAXA 3DBLB 2E71A 4XORA 1N78A 1LDJA 5FLMJ 4ON0A 3HOVJ 1PJRA 4AC0A 2NAZA 1O57A 2OJED 1YIOA 2HYGD 2EA2A 2IW5A 3HC7A 4XONA 4MGRA 3K0LA 4HYEA 3GX4X 5BS6A 2XGEA 4L9JA 1TBXA 3V8JA 1QBJA 3CJRB 2ZFWA 1DQUA 1L0OC 4L9VA 1NK2P 3IAS2 1LB2A 2P5VA 1UZCA 5AIQA 3R61A 4AIHA 3WGHA 3CCSI 4ZZLA 2R7VA 5E3LA 1BA5A 2KIMA 3TP3A 2E1MB 2DA2A 1T0FA 4DZPA 4YRVA 1FYLA 3U9GA 4P9FA 4B47A 4YFXF 4XLHA 3M9AA 1VQKI 2RREA 3E0JB 1U2WA 2XAGA 1XD7A 1FIAA 3DFGA 2HOAA 4CCOA 3MKYB 3FXOA 4Y13A 5BPIA 3T5XA 5F04A 3U2RA 4HSRA 3S3OA 4A93J 1M1EB 2EQRA 2PMZA 3SEQA 3FHZA 1YRNA 1TWAJ 3WTXC 2L9RA 5EF6A 4RM2A 2X1CA 5CKTA 4DIQA 1FNNA 2M7AA 4IHSA 3Q3SA 3SJMA 5EJCA 1RZ4A 5DCFA 1WQ2A 3A1YA 3QODA 1D5YA 2H8RA 3PIOF 3A01B 4CICA 1FBSA 4KIBA 3Q0VA 3SZGA 3RPQA 1S6LA 3V7CA 3O6BB 3E7LA 4B48A 2LBFB 1WJAA 2M3AA 5ICGA 1CF7B 1ITYA 1E3PA 2BY3A 2LREA 5M3FJ 1HA8A 2BZTA 5D4RA 1B8IB 1TC3C 1USTA 5LRRA 2V9PA 2ZNYA 2DPDA 5IOZA 4HX4A 3S14J 4RAFA 4DQ2A 2O03A 2VUMJ 2CH0A 2WTEA 2ZJRF 3CJNA 1WFXA 2KRHA 5E20A 2XDVA 1KYWA 2K85A 5EGOB 1SFEA 1W4MA 1BI2A 4KA4A 1G8XA 1SVOA 2XSDC 3L7WA 3DU6A 3ELKA 3UR3C 2JPCA 2NVQJ 1SD4A 2CW0F 1PUEE 1TWGJ 4BQAA 2XB5A 3JTHA 3TBIA 2V9KA 2ZJ2A 3HG9A 5FROA 1MMDA 4KN7X 4D9JA 4EMSA 4I09A 4HG2A 3K4NA 4PUSA 2MBFA 3HZJA 4CCMA 1IV6A 1F36A 1QU3A 1KU7A 3PNVA 1LVKA 2DYRH 4RB1A 5TISC 4ZH4F 3HDDA 4RGSA 1Y0NA 4L5EA 1AKHA 4ENMA 3RPUA 2KZVA 5H6QA 4XM3A 3HIFA 4BU2A 4EGZA 4NBQA 2FJ1A 4LG3A 2ACJA 2XC7A 2E2HJ 2Y2ZA 4RS8A 2J5OA 3D5SC 1J5YA 1EF4A 4BKXA 4PJMA 1X3WB 2MLGA 3JRFA 1WH7A 2STWA 4U0YA 1CQTA 3K10A 2YX4A 4Y4RA 2ZXHA 3PQJA 1MZBA 3CDLA 3X2QH 3TEDA 3K70C 2ESNA 4ZZDA 3K4LA 5K5OA 5E8IA 4A3FJ 3R4KA 4GXOA 2ELHA 4F52A 2P6TA 1JT6A 3E1SA 1I6XA 3CQZJ 1A6QA 3DU5A 4X1EA 4M72A 1R9TJ 4CHUA 1WJCA 5ICFA 3REOA 2KIFA 5LHIA 2CW8A 2IPQX 3T0YA 3IKVA 3C1DA 2VJJA 3G73A 3HRUA 4KDPA 2HNHA 1X1DA 3DBRB 2IXSA 3V7SA 4E70A 1A36A 3SXYA 4P5OA 4IO9F 5HS8A 1QPMA 2A68F 3LSGA 1NH3A 1Z05A 1W36C 1BL0A 2BVLA 1Q1VA 3P9KA 4IHTA 4BHCA 4LD5A 5GAHJ 1R22A 3IKTA 1HOMA 5BMZA 2GOMA 4AIDA 1VZ0A 2PLYA 2CWEA 4LJZF 3GTOJ 2EZLA 4IOAF 2L02A 2CW7A 2Y0SN 4DBRA 3PM1A 2STTA 1T33A 1IRGA 4A3EJ 2R5YB 4HSTA 4FASD 4H4KC 3BQYA 3R60A 4E6KG 3GFLA 3J7YJ 5IYBJ 2K27A 1VI0A 2KDOA 3ML6A 3IP4B 1QA6A 5F0FA 4JX4A 2OU2A 5E1XA 1UG0A 3GTMJ 3OYNA 1KONA 2A6EF 4ZDOA 2L3DA 3GEZA 3TO9A 2QKLB 1YI2I 4GYGA 3ERMA 4HW0A 2F5DA 2G0EA 1U8BA 2DK8A 2ISYA 1X2NA 1FZPB 1T56A 3ZMDA 5KVRA 1EKEA 1XTAA 5EYRA 3I58A 2P7VB 3AL0C 1VNDA 4A3GJ 1JXSA 3WTSC 3I56I 2DYSH 2EPFA 1XGSA 1WVRA 1J75A 3KE2A 2HEOA 2RV8A 1ENHA 3VB2A 1YFHA 4HNUA 1EJ9A 1V5FA 2CQKA 2DA6A 2EINH 3CLOA 4IHWA 3LSTA 4HBLA 3SQNA 4XICA 1TQMA 2ZXJA 3LSIA 4HEA2 4PJ0C 1ETXA 1K83J 2HS5A 2Y30A 1U0JA 4KT5C 4KICA 5BOXA 4ZDLA 5L3BA 3HHHA 2EZKA 1BJAA 2DN0A 2QZ8A 4MQVA 1G6NA 4LLLA 4QTRA 2XPVA 1DU0A 1R5ID 3T1BA 2DT6A 2JK3A 2A69F 2DXIA 4FISA 2AQEA 3HOYJ 4UVAA 3FXJA 3A01A 5CVUA 3CESA 3F6VA 1HCRA 2PMZN 4IQ4A 2I5UA 2RC4A 3K7AJ 3I71A 3GMEA 2XGCA 4LLGF 1K6OA 5K1YA 1QO0D 2FX0A 2Y9YA 3CCQI 4RGXA 5LEKA 3KP2A 2DMNA 3G6EI 4TV7A 4FX4A 2CQQA 2Q1ZB 3KLOA 1Y39A 1Y8QB 3OOUA 1ZRDA 3D5RC 2RQQA 4BUPA 4WX9A 1ZAOA 4OMZA 1NG6A 4UHTA 1ZG5A 3VYTB 4HQEA 1GDTA 1JTXA 2E36A 2KISA 2UV1A 5EGOA 4R79A 4XN3A 2CV0A 1Q1HA 4L18B 4CZZA 1F1ZA 4XL9A 2QBYB 1T39A 3S1QJ 3QU6A 1HKQA 2KRFA 1ZG1A 2JVHA 1IN7A 2Z33A 4G6QA 4MLOA 1Y0UA 3FM3A 5KNLA 4PSWA 1KZHA 3VWBA 1WZ2A 4DBQA 3BQZA 1S7AA 2BEOA 3HHGA 2EZHA 3K9TA 3ERED 4PGHA 2VQLA 2KLOA 2R7WA 4XN0A 4IRIA 2L54A 3JRHA 1D1AA 1I6HJ 3H35A 2QSFX 6PAXA 5DUKA 2DJNA 1BJZA 4YG2F 2TDXA 3JAMK 4BHPA 1WJDA 3OY9A 3GF2A 4ESFA 4MO7A 1P7JA 1Z9CA 1OCCH 4LIVA 1VQLI 3S8PA 1YS7A 4ESBA 3HUGA 1RUNA 1IO2A 1J9IA 4A3IJ 1FY7A 4Q4ZF 4V2FA 2F5EA 5FFXA 2IS6A 3DBHB 5TGTA 2Z3YA 2HGCA 4BXUA 2QUFA 1MBJA 1W7PD 2FEZA 3F6OA 2ZNZA 4EEFG 5B1AH 2OA4A 2XRNA 2K02A 4B09A 3GZ6A 3TGNA 1ULYA 3TL4X 3WGGA 5EG0A 3JR9A 3BCBA 1JE8A 2HXOA 5GAEJ 1FOXA 2BV6A 4A3LJ 3CCLI 1MBKA 1JUMA 4FCYA 4DW6A 2UXXA 2OTJI 3OYKA 2L7MP 4MEXF 4EJUA 2DFHA 2HYFA 3DKWA 4HF2A 3KIOA 3SFZA 3OYEA 1GHCA 3I53A 3CDHA 3VODA 1OCOH 3KYCB 2A5YB 1W5SA 2WADA 4U0WA 5HDKA 3GTKJ 1TQIA 4E7KA 1BI3A 3AG2H 5K5RA 1OCPA 5BQTA 3W2WA 2CS3A 3ZCOA 4CUGA 1U3EM 4IL6C 2Z1DA 1ZGJA 2OZ6A 4NNJA 3GFJA 5GADJ 3C18A 4HLYA 4MFEA 4Z2YA 3VSKA 1VQ9I 1W1WE 3OR2C 4BBSJ 4BDZA 1ZG3A 1SANA 2VQHA 3CJQB 1SFUA 1LPQA 2C6YA 3IH2A 3Q9VA 4C3JJ 1R5GA 4FE4A 4IJAA 1F4KA 3IRRA 2A3SA 2HTJA 4HLXA 1KU9A 2Z16A 3FK6A 3S1RJ 4ZTJA 2UUZA 5H20A 4GO1A 5EDNA 2E35A 4ZYGA 1FJLA 2IBDA 1HW1A 2MFZA 3D5LA 3MEXA 3FF5A 1JGSA 1D8JA 1CGPA 5AONA 4BHBA 1E3OC 2D1HA 2PBIA 4I02A 5KAIC 1DDNA 5B5EC 2VKEA 1LKXA 4ITVA 4XIDA 2PI0A 4Y33A 4PJNA 1GV5A 3IV5A 5J1UA 5FKOA 4OIOF 3RIRA 2OQRA 2VE9A 3M1EA 2VJIA 2ZSIB 3K4JA 3V8KA 1U5TB 2OQGA 4P96A 5FKKA 1XGOA 2JRMA 3CF5F 4NUBA 2KL4A 2P7CB 5JR3A 3PNTA 2CRGA 3EETA 2YPRA 2M87A 1HW5A 3DWLE 1QPIA 1V4RA 4JYKA 2GA1A 5L3FA 2QEXI 4NC8A 2F5CA 1OYWA 2O5RA 3OYJA 4Y52J 2YU3A 1K61A 2ZB9A 2E1NA 5B1BH 3BPVA 3AAFA 3RKWA 4BJ5C 2M9HA 2LR8A 2ESHA 3G2BA 2YSRA 3M8JA 4QSHA 4F93B 3RKQA 2JVGA 1R49A 2FUG2 5FO5A 1KU2A 1AOYA 1Z7LA 2QBYA 2I10A 2KFDA 3KEYA 4QPOA 3BG5A 4E7ZA 4MNUA 2VODA 3LSRA 3TW7A 2KQRA 4EJOA 3S3NA 1IZ1A 2HQNA 3I54A 3RQ4A 4JQFA 4UUSA 2MW8A 2XF6A 1SFOJ 1W5CC 4ABZA 1Z6TA 4IRHA 2P0WA 3E5UA 4B43A 3PIPF 3BR2A 1UHWA 4DGWB 4JK1X 4AM3A 5D6FA 1FTZA 3L2RA 2LF8A 3M8FA 4CGZA 2X0LA 5EEHA 2CU7A 3IH4A 1VQMI 1XN7A 4I0AA 2VC1A 1OYIA 5J40A 3H3VK 2V6EA 3GTJJ 3CLQA 2O8KA 3VSLA 4X0GA 2PJRB 3FK7A 1J2XA 1B9NA 3HSEA 2LKPA 3K4MA 3RDIA 9ANTA 2DOEA 2VXZA 5IPAA 3WG9A 2Y31A 4MTEA 1BBYA 4B8XA 4UUVA 4ASNA 1J7KA 5D5UB 3FMQA 5BNGA 1P2FA 3J80K 2EIMH 2VBYA 4WXHA 1ON2A 2WWYA 2OCCH 1I50J 1OKRA 1MJ9A 1WJFA 1DGRM 1F9NA 3MFKA 2K5CA 2VKDA 2W7NA 3IWZA 3H92A 4B1RA 2Z2SB 1RI7A 1Z77A 4GCVA 1WJEA 4RA2A 2E1MC 5FLXZ 2JPBA 4O6JA 4N4NB 1QRYA 3H9GA 3EUAA 4M3FA 4BL0B 2DAOA 4CDGA 4ENJA 1K78A 2Z99A 3H5RA 3JCUC 1IW7F 2HQAA 2OD5A 4E7SA 3CCUI 3LMMA 1IRXA 1U8RA 1B72B 1MBFA 4FX0A 1Y1VJ 4N9IA 4NDLA 1EH7A 1S9HA 2CFOA 3DPUA 1FLIA 5FRMA 1KQ8A 3NEUA 4ZTFA 3LFUA 2LLKA 2K9LA 2Q2EA 3K4BA 1H8AC 2DJIA 1HSJA 3Q5FA 1MGTA 2FSWA 3IWFA 4B44A 3BG9A 2P4WA 1YIJI 5FRNA 3GTGJ 2FQ4A 2X6XA 2ME0A 2F48A 1JKQC 2X1DA 3C2HA 4LIUA 5DTDA 4BGDA 5KAFC 3I9V2 2FE3A 2G7UA 2KKOA 2R5ZB 4WF2A 2H1LA 5HLIA 3C2BA 2LK2A 2ZFUA 1ZHFA 1SFKA 2FD5A 3KETA 2Q2EB 3PSFA 1R00A 2JWTA 1PYVA 3LQRA 5CQGA 3PL8A 3PJRA 2JRTA 3KPHA 1RUOA 4U7DA 1IDZA 3OYCA 2R7SA 4D1QA 5GPCA 4CH7A 1A35A 2IGOA 1U9NA 2XKPA 4BEHB 1OR7C 2OAZA 4HDUA 1YJWI 1IN6A 2DMQA 1UHSA 3MMYB 3ZMUA 4ZYHA 3KX2A 3ASOH 2F5FA 3WTYC 2HVRA 3MAJA 1B8IA 4M73A 3HRMA 4EM2A 1BOBA 2IA1A 2VE8A 2D2WA 2R4GA 1K6YA 3FXUA 1OPCA 2LG4A 4IEJA 3UNGC 4A5NA 3EQLF 1TW3A 1DU6A 2M34A 1VQ7I 3BROA 1F5TA 2LBFA 1S7EA 3IRQA 1YJNI 3DEEA 1E3HA 4EM1A 3QU3A 2ZCWA 2GIVA 2X1EA 1BN5A 4XRSA 2W84A 1UAAA 4A3BJ 2Y0MA 4Z6YA 1U5TC 2HPIA 5D6EA 1B6AA 2FMLA 3JRGA 1U9OA 2EV0A 4OMYA 3V4GA 1G3YA 5K7ZA 1FYKA 3BLYA 3RSNA 5D8KB 3JSPA 5H2FC 1LEBA 3TDUC 1ZLJA 4NQWB 2DFIA 1BI1A 2WB1A 3ONQA 1X3ZB 1X4PA 4N4OB 1YQAA 3DP7A 2WAQA 2XSJC 4EJTA 4DNCA 3QYEA 3CUQA 3RKYA 1YX5A 4YIRX 2NOJB 2HDDA 2PJPA 4KJZA 4RGRA 2L4AA 3P5JA 1JHFA 3MD2A 2P81A 4UB6C 5HDNA 2Y0SA 3I4PA 1O3QA 3ZMSA 4BJ6C 5FJ8J 3K69A 3B02A 1U6GA 2MH9A 1R71A 4L9TA 1D0ZA 3NWTA 2VBZA 4A0XA 4S0HB 4IXAA 2A07F 2EFWA 3LSHA 4RAYA 2DK5A 1SAUA 4HRIA 5DCMB 3DKXA 4M6YA 3P9IA 2V1XA 1RRJA 2M1BA 2L01A 3K1MA 2UWMA 1VQNI 3P9CA 1XMXA 4BE2A 4RGUA 1TWHJ 2VBWA 2COMA 3FXLA 2E5ZA 5A2QK 4KFCA 2GWRA 3OWTA 4MQ9F 1TWCJ 2XIGA 3OYLA 1IXSB 5GPAA 2HOEA 3SZPA 2P5LC 1IN4A 2WAQN 4G8XA 4U0VA 1IF1A 1ZREA 2XPUA 3NQOA 4XLEA 4UVBA 3DEWA 1UG2A 2DA5A 3S15J 5J1YA 2M8EA 5AIPA 3TOBA 5IYDJ 3G1OA 1UHMA 5HS7A 1ETKA 4RB2C 2XB0X 3HPHA 4ENKA 1IUFA 4J19A 1RR8C 3S17J 4BBRJ 1T6SA 3OS0A 1RC9A 1H88C 5EEAA 2HXIA 2M0MA 2DQRA 2GIZA 1W36D 1MIJA 2I8DA 3CCYA 4PCQA 4XR6A 4M6VA 4AYBN 2PX9A 3JSOA 3WTWC 1IGNA 3ZQHA 1DPUA 1GVJA 2FNPA 5FKNA 5B66C 3M3YJ 2FNAA 3ZQLA 4RAZA 2QA4I 3SZTA 2EFQA 3V42A 3DLAA 1AWCA 3OMYA 4D7NA 4R1HA 5C3EJ 2BHZA 2KT0A 2TCTA 3BY6A 4PK4A 4P9UA 5K7HA 4RLQA 1IRZA 2VIXA 4LGWA 1VQOI 1VF9A 2ADUA 5FFZA 2ID6A 4EV0A 2VPLA 2FBHA 5HNFA 3GZ5A 3C2GA 3WG7H 3CCVI 3T8RA 4XOTA 1MNEA 4KNYA 2ECCA 4E7LA 1Z3YA 2QENA 2O3FA 4LLNA 4A12A 1VQ5I 2ELKA 2H6CA 4XSZF 2QM3A 3JW4A 1YLFA 3DQVC 2BYVE 1NHAA 3MKLA 2JSPA 1XC5A 2QKMB 1PVEA 2R7XA 4FQGA 3J7AO 3GUDA 5ICEA 1C0WA 4I98B 1IV8A 2F5VA 3BR6A 2XPWA 2IA0A 4JBAA 5F08A 2N8GA 4QPQA 1RESA 2MABA 5LGUA 3HTUA 3ZMVA 4FE7A 2LNBA 4XLNF 4OAYA 2ICWG 5DD8A 2XAUA 3DPLC 4LB6B 3BZKA 3KP6A 1XG1A 4F7ZA 3EUKL 1G59A 5K7FA 2ME6A 3PNYA 4PFPA 3HEFA 5ILSA 1XS9A 2EJRA 4M74A 2AQFA 1BR2A 2Q0OA 4EQQA 1YW8A 3HOSA 1WGXA 1KQ0A 5J8CA 4LITA 3N4MA 4BY1J 2LYCA 5LEJA 4AU7A 2LD5A 1X58A 3OYIA 2HKXA 3G1MA 4BXFA 1W0UA 5TJJA 1NTCA 1SMTA 1EH8A 1X1CA 1WI9A 2L2OA 4OAZA 1FMWA 5FGMA 1N75A 2X51A 4FETA 2EILH 2ZSHB 3BT9A 4YFNF 3QYFA 4G7HF 4K2EA 1IAWA 4OIQF 1IG7A 2O61A 3QWLA 4BYYA 3OS1A 3HTSB 3I0TA 4YIFA 2IA2A 5C4XJ 2CSOA 3PO2J 4F91B 3OOPA 4G6DA 3Q0WA 5L3EA 2EWNA 3CC7I 2XAHA 1ZQ3P 2W4SA 1K7AA 4ESJA 1X2MA 2LSOA 3JRBA 3PO3J 1Y8RB 4GDFA 4E7JA 3ZRGA 3U1DA 1MH4A 4QWQA 1A31A 4BDYA 4XKVA 1RKTA 4IX7A 3TQNA 2LRDA 1HXDA 3MZHA 1G3TA 1GUUA 2IS4A 5LGTA 1TT5B 2MG4A 1YO5C 4WXDA 1D1BA 4L5IA 4Y17A 4WCGA 3J81Z 4A6DA 2PG4A 3M1CA 1IXRC 4IPAA 4O3MA 5J8FA 2KIQA 1D5VA 2M0CA 2PMUA 3HSRA 4XRFA 1BR4A 3PFYA 1PP8F 2RGVA 3TP0A 2K86A 2DO7A 3HRSA 1ZKGA 2BY0A 2HZTA 3LSJA 5ILVA 4IRGA 5DM7F 1Z0XA 1JI8A 1XDUA 2ZC2A 2X6YA 5F0HA 2DMTA 3IUOA 1HQCA 4S05A 4E7HA 5B3SH 3LQQA 1ZLKA 1EH6A 1USSA 2MC4A 3B6CA 3T8TA 1ONVA 1O4XA 3HYIA 2L4MA 3EDPA 3G3ZA 5F27A 2E1OA 3F21A 3DKYA 2EFOA 4F92B 1WPKA 1I5ZA 5L3GA 2VB6A 1KQ9A 2OF7A 4A3DJ 3I3LA 1K78B 2DOAA 3ZXSA 2E7XA 4G9YA 4XBFA 1XB4A 1TZLA 2JUGA 3CDIA 3OR1C 1FX7A 1XGNA 3MCZA 3IHUA 1TNTA 1MMAA 2GAUA 2LY2A 2KIUA 3IH3A 1S29A 2NS7A 2PJRA 4BEHA 3DLLF 5E3NA 3FM5A 1XCVA 4ZDPA 3WHCA 1Z91A 2MH2A 3BR5A 4C30A 1YRNB 1SEUA 3RZOJ 1ZR4A 2HQRA 2M4KA 4N0BA 5GP9A 1AA7A 1QGPA 4RB0A 3ABKH 5IYCJ 1PDNC 4LG0A 2QQ9A 1V5EA 1ZARA 1TT0A 3ZP5A 4AUXA 3WTVC 4QLCU 4IHVA 5CVIA 4KMFA 3H0DA 3OYBA 2CQNA 2GOXB 2F6CA 4S04A 3VYUB 5IT3A 2BOLA 2M45A 3S93A 3ASNH 5KHDA 1ZGWA 3I4MJ 4UNOA 2R3SA 4RLFA 4M3GA 3SFIA 2ZO4A 4NC7A 4CSWA 5HLTA 2AS5F 3FHNA 1ETVA 3HB9A 3WODF 2NXNB 2E7WA 2PQ8A 1J09A 4W1UA 3F9KA 5K5QA 3RPUD 3C7JA 3K2AA 3S2DJ 1DGWY 1WI3A 3H3UA 1XDSA 2P6SA 3CO6C 4XKWA 1QQIA 2VQGA 1LFUP 4EATA 2IGNA 2W24A 4I01A 4UB8C 3GYHX 4BQOA 2E2JJ 4E7IA 3MZ8A 5E17F 3HRTA 2R7FA 4Q47A 2GM4A 1EA3A 5GTHC 3E6DA 4KIGA 3F8NA 3LOCA 4KT6A 2Z5UA 2L7ZA 1YW9A 2M4GA 4XRMA 3SDGA 5CPRB 1ORKA 4HOBA 4GFBA 2DQLA 3GXOA 4I6ZA 2H8WA 2R7DA 3R0JA 2DI3A 3OIQA 3MZYA 5EZHA 2Q8KA 4CO8A 2F2EA 3FMRA 3CMAI 1HF0A 4L0YB 5EEGA 3W6KB 1WKMA 3OYAA 3FDYA 2K9NA 3CP2A 3ABLH 3MQ0A 1CF7A 2FOWA 4HNVA 2HKOA 2R5YA 3A2KA 2R0QC 2EIJH 3LNQA 3SHFA 4ZJZA
chains in the Genus database with same CATH topology
1A5JA 2YS9A 4L5EA 3NAUA 1AKHA 5DTDA 3WHBA 4M3DA 2R5ZB 2E2HJ 2FJ1A 3C2BA 2LK2A 3Q0UA 1JGGA 2Y2ZA 2FD5A 1EF4A 5J1RA 2JWTA 4BKXA 1FIPA 2H1KA 3JRFA 1WH7A 4UUTA 3D1NI 2K9SA 2L7FP 1CQTA 1ETWA 3TW6A 1IDZA 5GPCA 3CDLA 3TEDA 1BW6A 1U9NA 3HGYA 4A3FJ 4G12A 2E19A 3UKGA 4M3BA 2DMQA 3FKIJ 1MBGA 1JT6A 3CQZJ 1UHSA 4X1EA 1R9TJ 2MGQA 2YUSA 2TRTA 3ZOBA 4W97A 2NS8A 1B8IA 1JKQC 4MFDA 2XRLA 3LSGA 1BL0A 5E3OA 1OJLA 1HDDC 1Q1VA 4IEJA 1DU6A 2M34A 5J3LA 4C2MJ 1HOMA 1S7EA 1IDYA 4DZJA 5FKLA 2NVXJ 3BTCA 5IOYA 3I4NJ 1MBHA 2HQ5A 2DMUA 3GTOJ 4D5FA 2EZLA 3G1LA 4XRSA 2Y0SN 1MH3A 3PM1A 1T33A 4A3EJ 2R5YB 5JLWA 3JREA 4IHXA 4A3BJ 2YU9J 2LKXA 2CJJA 3BQYA 2EBIA 1WH5A 5IYBJ 3JRGA 1MSEC 1VI0A 1U9OA 3BR3A 5F0FA 4JX4A 2LTPA 2B63J 3GTMJ 3OSFA 5F0CA 5K7ZA 2DTZA 2O9LA 4I76A 1F43A 2G0EA 4CYCB 1U8BA 2LY9A 1JKOC 1AHDP 1X2NA 1JKRC 1T56A 2NVYJ 1A6IA 1JTYA 5EYRA 2QF7A 1VNDA 3S1NJ 4A3GJ 2M2EA 4A3CJ 3O8HA 2HDDA 1ENHA 2P81A 1H89C 2DA6A 4BXXJ 4IHWA 5FJ8J 4A69C 4XICA 2RAEA 5C44J 1ETXA 1K83J 2Y30A 4QIWN 4S0HB 2JA7J 2HI3A 2EZKA 5IP7J 3S1MJ 2DN0A 1ETYA 1P7IA 1POGA 1JUSA 1TWFJ 2XPVA 4QTRA 1DU0A 3BG3A 1BW5A 2JK3A 2NOGA 4FISA 3HOYJ 3A01A 1HCRA 2PMZN 3O8GA 1TWHJ 3K7AJ 2E2IJ 2XGCA 4B4CA 4Y7NJ 3ZQGA 2FX0A 1TWCJ 1AKHB 2Y9YA 5EG0B 4DYCA 5GPAA 3MVPA 2DMNA 2WAQN 2XPUA 1JKPC 2CQQA 2HOSA 3OOUA 5E3MA 3DEWA 2O7OA 1UG2A 2DA5A 2K9QA 3S15J 1WCMJ 5J1YA 2WV1A 1U78A 1GDTA 4IHYA 1JTXA 3CMYA 5IYDJ 3G1OA 5EGOA 1ETKA 2XB0X 1IUFA 4J19A 1GVDA 3S17J 4BBRJ 2LFBA 3OIOA 2QCOA 3F0CA 3S1QJ 1B72A 1H88C 2ID3A 5EEAA 2HXIA 3S16J 3W6VA 5IP6A 3LSPA 1Y1WJ 4MLOA 3CCYA 4JX5A 4M6VA 2XGDA 4AYBN 1IGNA 3JRIA 3JRCA 4LOCA 3ZQHA 3HOZJ 3VPRA 2DMPA 5FKNA 3M3YJ 2IEKA 3M4OJ 3BQZA 3ZQLA 2EZHA 2R7ZJ 2K40A 2LP0A 4D7NA 5C3EJ 2KT0A 2TCTA 5K7HA 1IRZA 3JRHA 1I6HJ 2DA1A 1VF9A 5M5YJ 2R5ZA 2DJNA 1BJZA 2ID6A 4MO7A 1P7JA 2OPTA 3QPSA 2ECCA 4X6AJ 2ELKA 3GTPJ 4A3IJ 3MKLA 4V2FA 1XC5A 3DCFA 2X9DA 1MBEA 1MSFC 5FKMA 4MIMA 1PUFA 1MBJA 1ZK8A 4EEFG 2L0KA 5M3MJ 3BR6A 2AO9A 2CUFA 1MNMC 2XPWA 2IAIA 2W48A 4FTHA 5F08A 2N8GA 1RESA 5EG0A 1JT0A 4JX6A 3JR9A 5IP9J 2X6OA 4FE7A 2HXOA 2GBYA 3GTQJ 1VFCA 3BR0A 1QVTA 2DA7A 1XG1A 5HODA 3OSGA 4A3LJ 5K7FA 4FCYA 1MBKA 1JUMA 2ME6A 2R93J 4DW6A 4UUSB 3JRAA 1I3QJ 1NK3P 3HEFA 1ZTRA 1XS9A 2VPRA 5JLXA 2L7MP 4V2GA 4B3AA 3BTJA 1HLVA 1RPWA 3BTIA 3NARA 4A3MJ 2EH3A 4BY7J 1WGXA 4BY1J 1IJWC 1ETOA 1GV2A 2LD5A 1JJ6C 1X58A 5DS9A 3GTKJ 1RKWA 3G1MA 2COBA 1W0UA 2HYJA 3B6AA 1NTCA 3GBGA 2NVTJ 3QQAA 1OCPA 2M8GX 3ZQCA 1OCTC 3BT9A 3JRDA 1IG7A 4DYRA 3HKZN 3BR1A 5M5XJ 1LE8B 5C4XJ 3S2HJ 1OFCX 4MFEA 3PO2J 3FISA 2D5VA 3Q0WA 5EZGA 4BBSJ 1ZQ3P 1SANA 1FTTA 1X2MA 3JRBA 3IH2A 1IC8A 4C3JJ 3PO3J 3MN2A 5F1JA 2VKVA 4FE4A 4CYCA 3FIWA 1MH4A 2ECBA 1AU7A 3GTLJ 3FK6A 3S1RJ 4A3JJ 2GLOA 2Y9ZA 5EDNA 1FJLA 2IBDA 1RKTA 1RR7A 2JA8J 1E3OC 1GUUA 4XRSG 4A3KJ 2VKEA 2MG4A 4XIDA 3RQIA 2CUEA 1GV5A 4M3EA 3IV5A 5J1UA 5FKOA 1QVUA 4RBOA 2DA4A 4JP0A 2DA3A 2M0CA 3HM5A 3L1PA 4D7MA 3TP0A 5FKKA 3HOWJ 2HOTA 1ZKGA 2JA6J 2WB1N 3LSJA 1APLC 2CRGA 1Z0XA 2R92J 2CQXA 3HOUJ 2JMWA 1QPIA 5F0HA 2DMTA 5M5WJ 4JYKA 4C3HJ 4D5CA 3ZQIA 3B6CA 3BTLA 3RZDJ 1JUPA 4Y52J 2X48A 1LFBA 1O4XA 5F27A 1K61A 2ZB9A 2E1OA 1UMQA 5FLMJ 4XK4A 3HOVJ 4AC0A 1WPKA 3HOXJ 5FLVA 2OF7A 2M9HA 2LR8A 4QSHA 3RKQA 4A3DJ 1HDPA 2LVSA 2XGEA 2I10A 1NK2P 3IH3A 3BG5A 2NS7A 2JA5J 2KDZA 5E3NA 3LSRA 3TW7A 3WHCA 3H0GJ 3BR5A 5E3LA 1YRNB 3TP3A 1BA5A 3RZOJ 4DYQA 2DA2A 4UUSA 4DZPA 1ZR4A 2MW8A 1SFOJ 5GP9A 4ABZA 5C4JJ 5IYCJ 2AHQA 3BR2A 1FIAA 1GT0C 2HOAA 1JJ8C 1FTZA 4AUXA 5F04A 1RETA 2JJ7A 4IHVA 4A93J 2EQRA 2CU7A 3IH4A 1YRNA 1TWAJ 2L9RA 5EF6A 1FEXA 3H3VK 3GTJJ 2O8KA 1G2HA 1ZGWA 3FK7A 3I4MJ 3Q3SA 3SJMA 4M3GA 3SFIA 9ANTA 3A02A 1ETQA 5IPAA 1D5YA 1ETVA 2Y31A 3HB9A 2H8RA 4W1UA 3A01B 3QPLA 5BNGA 3Q0VA 3K2AA 3ZQFA 3S2DJ 1WI3A 1I50J 3E7LA 1LE8A 1W0TA 1ITYA 1PUFB 1LFUP 2VI6A 1ZR2A 5M3FJ 4B1RA 3HGGA 1TC3C 1Z77A 1B8IB 2E2JJ 5IOZA 3S14J 1QRYA 3HBLA 2GM4A 4M3FA 3LOCA 2VUMJ 2L7ZA 4XRMA 5EGOB 3SDGA 2XSDC 1ORKA 4GFBA 2MSYA 4I6ZA 1B72B 1MBFA 5EZHA 2NVQJ 1HF0A 1Y1VJ 4NDLA 1TWGJ 2JN6A 2XB5A 4C3IJ 4RDUA 2K9NA 2LLKA 1H8AC 3A03A 4HNVA 2R5YA 1IV6A 1F36A 2EZIA 3BG9A 2R0QC 3GTGJ 3LNQA 2FQ4A 2ME0A 3HDDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A5J A;  2YS9 A;  4L5E A;  3NAU A;  1AKH A;  5DTD A;  3WHB A;  4M3D A;  2R5Z B;  2E2H J;  2FJ1 A;  3C2B A;  2LK2 A;  3Q0U A;  1JGG A;  2Y2Z A;  2FD5 A;  1EF4 A;  5J1R A;  2JWT A;  4BKX A;  1FIP A;  2H1K A;  3JRF A;  1WH7 A;  4UUT A;  3D1N I;  2K9S A;  2L7F P;  1CQT A;  1ETW A;  3TW6 A;  1IDZ A;  5GPC A;  3CDL A;  3TED A;  1BW6 A;  1U9N A;  3HGY A;  4A3F J;  4G12 A;  2E19 A;  3UKG A;  4M3B A;  2DMQ A;  3FKI J;  1MBG A;  1JT6 A;  3CQZ J;  1UHS A;  4X1E A;  1R9T J;  2MGQ A;  2YUS A;  2TRT A;  3ZOB A;  4W97 A;  2NS8 A;  1B8I A;  1JKQ C;  4MFD A;  2XRL A;  3LSG A;  1BL0 A;  5E3O A;  1OJL A;  1HDD C;  1Q1V A;  4IEJ A;  1DU6 A;  2M34 A;  5J3L A;  4C2M J;  1HOM A;  1S7E A;  1IDY A;  4DZJ A;  5FKL A;  2NVX J;  3BTC A;  5IOY A;  3I4N J;  1MBH A;  2HQ5 A;  2DMU A;  3GTO J;  4D5F A;  2EZL A;  3G1L A;  4XRS A;  2Y0S N;  1MH3 A;  3PM1 A;  1T33 A;  4A3E J;  2R5Y B;  5JLW A;  3JRE A;  4IHX A;  4A3B J;  2YU9 J;  2LKX A;  2CJJ A;  3BQY A;  2EBI A;  1WH5 A;  5IYB J;  3JRG A;  1MSE C;  1VI0 A;  1U9O A;  3BR3 A;  5F0F A;  4JX4 A;  2LTP A;  2B63 J;  3GTM J;  3OSF A;  5F0C A;  5K7Z A;  2DTZ A;  2O9L A;  4I76 A;  1F43 A;  2G0E A;  4CYC B;  1U8B A;  2LY9 A;  1JKO C;  1AHD P;  1X2N A;  1JKR C;  1T56 A;  2NVY J;  1A6I A;  1JTY A;  5EYR A;  2QF7 A;  1VND A;  3S1N J;  4A3G J;  2M2E A;  4A3C J;  3O8H A;  2HDD A;  1ENH A;  2P81 A;  1H89 C;  2DA6 A;  4BXX J;  4IHW A;  5FJ8 J;  4A69 C;  4XIC A;  2RAE A;  5C44 J;  1ETX A;  1K83 J;  2Y30 A;  4QIW N;  4S0H B;  2JA7 J;  2HI3 A;  2EZK A;  5IP7 J;  3S1M J;  2DN0 A;  1ETY A;  1P7I A;  1POG A;  1JUS A;  1TWF J;  2XPV A;  4QTR A;  1DU0 A;  3BG3 A;  1BW5 A;  2JK3 A;  2NOG A;  4FIS A;  3HOY J;  3A01 A;  1HCR A;  2PMZ N;  3O8G A;  1TWH J;  3K7A J;  2E2I J;  2XGC A;  4B4C A;  4Y7N J;  3ZQG A;  2FX0 A;  1TWC J;  1AKH B;  2Y9Y A;  5EG0 B;  4DYC A;  5GPA A;  3MVP A;  2DMN A;  2WAQ N;  2XPU A;  1JKP C;  2CQQ A;  2HOS A;  3OOU A;  5E3M A;  3DEW A;  2O7O A;  1UG2 A;  2DA5 A;  2K9Q A;  3S15 J;  1WCM J;  5J1Y A;  2WV1 A;  1U78 A;  1GDT A;  4IHY A;  1JTX A;  3CMY A;  5IYD J;  3G1O A;  5EGO A;  1ETK A;  2XB0 X;  1IUF A;  4J19 A;  1GVD A;  3S17 J;  4BBR J;  2LFB A;  3OIO A;  2QCO A;  3F0C A;  3S1Q J;  1B72 A;  1H88 C;  2ID3 A;  5EEA A;  2HXI A;  3S16 J;  3W6V A;  5IP6 A;  3LSP A;  1Y1W J;  4MLO A;  3CCY A;  4JX5 A;  4M6V A;  2XGD A;  4AYB N;  1IGN A;  3JRI A;  3JRC A;  4LOC A;  3ZQH A;  3HOZ J;  3VPR A;  2DMP A;  5FKN A;  3M3Y J;  2IEK A;  3M4O J;  3BQZ A;  3ZQL A;  2EZH A;  2R7Z J;  2K40 A;  2LP0 A;  4D7N A;  5C3E J;  2KT0 A;  2TCT A;  5K7H A;  1IRZ A;  3JRH A;  1I6H J;  2DA1 A;  1VF9 A;  5M5Y J;  2R5Z A;  2DJN A;  1BJZ A;  2ID6 A;  4MO7 A;  1P7J A;  2OPT A;  3QPS A;  2ECC A;  4X6A J;  2ELK A;  3GTP J;  4A3I J;  3MKL A;  4V2F A;  1XC5 A;  3DCF A;  2X9D A;  1MBE A;  1MSF C;  5FKM A;  4MIM A;  1PUF A;  1MBJ A;  1ZK8 A;  4EEF G;  2L0K A;  5M3M J;  3BR6 A;  2AO9 A;  2CUF A;  1MNM C;  2XPW A;  2IAI A;  2W48 A;  4FTH A;  5F08 A;  2N8G A;  1RES A;  5EG0 A;  1JT0 A;  4JX6 A;  3JR9 A;  5IP9 J;  2X6O A;  4FE7 A;  2HXO A;  2GBY A;  3GTQ J;  1VFC A;  3BR0 A;  1QVT A;  2DA7 A;  1XG1 A;  5HOD A;  3OSG A;  4A3L J;  5K7F A;  4FCY A;  1MBK A;  1JUM A;  2ME6 A;  2R93 J;  4DW6 A;  4UUS B;  3JRA A;  1I3Q J;  1NK3 P;  3HEF A;  1ZTR A;  1XS9 A;  2VPR A;  5JLX A;  2L7M P;  4V2G A;  4B3A A;  3BTJ A;  1HLV A;  1RPW A;  3BTI A;  3NAR A;  4A3M J;  2EH3 A;  4BY7 J;  1WGX A;  4BY1 J;  1IJW C;  1ETO A;  1GV2 A;  2LD5 A;  1JJ6 C;  1X58 A;  5DS9 A;  3GTK J;  1RKW A;  3G1M A;  2COB A;  1W0U A;  2HYJ A;  3B6A A;  1NTC A;  3GBG A;  2NVT J;  3QQA A;  1OCP A;  2M8G X;  3ZQC A;  1OCT C;  3BT9 A;  3JRD A;  1IG7 A;  4DYR A;  3HKZ N;  3BR1 A;  5M5X J;  1LE8 B;  5C4X J;  3S2H J;  1OFC X;  4MFE A;  3PO2 J;  3FIS A;  2D5V A;  3Q0W A;  5EZG A;  4BBS J;  1ZQ3 P;  1SAN A;  1FTT A;  1X2M A;  3JRB A;  3IH2 A;  1IC8 A;  4C3J J;  3PO3 J;  3MN2 A;  5F1J A;  2VKV A;  4FE4 A;  4CYC A;  3FIW A;  1MH4 A;  2ECB A;  1AU7 A;  3GTL J;  3FK6 A;  3S1R J;  4A3J J;  2GLO A;  2Y9Z A;  5EDN A;  1FJL A;  2IBD A;  1RKT A;  1RR7 A;  2JA8 J;  1E3O C;  1GUU A;  4XRS G;  4A3K J;  2VKE A;  2MG4 A;  4XID A;  3RQI A;  2CUE A;  1GV5 A;  4M3E A;  3IV5 A;  5J1U A;  5FKO A;  1QVU A;  4RBO A;  2DA4 A;  4JP0 A;  2DA3 A;  2M0C A;  3HM5 A;  3L1P A;  4D7M A;  3TP0 A;  5FKK A;  3HOW J;  2HOT A;  1ZKG A;  2JA6 J;  2WB1 N;  3LSJ A;  1APL C;  2CRG A;  1Z0X A;  2R92 J;  2CQX A;  3HOU J;  2JMW A;  1QPI A;  5F0H A;  2DMT A;  5M5W J;  4JYK A;  4C3H J;  4D5C A;  3ZQI A;  3B6C A;  3BTL A;  3RZD J;  1JUP A;  4Y52 J;  2X48 A;  1LFB A;  1O4X A;  5F27 A;  1K61 A;  2ZB9 A;  2E1O A;  1UMQ A;  5FLM J;  4XK4 A;  3HOV J;  4AC0 A;  1WPK A;  3HOX J;  5FLV A;  2OF7 A;  2M9H A;  2LR8 A;  4QSH A;  3RKQ A;  4A3D J;  1HDP A;  2LVS A;  2XGE A;  2I10 A;  1NK2 P;  3IH3 A;  3BG5 A;  2NS7 A;  2JA5 J;  2KDZ A;  5E3N A;  3LSR A;  3TW7 A;  3WHC A;  3H0G J;  3BR5 A;  5E3L A;  1YRN B;  3TP3 A;  1BA5 A;  3RZO J;  4DYQ A;  2DA2 A;  4UUS A;  4DZP A;  1ZR4 A;  2MW8 A;  1SFO J;  5GP9 A;  4ABZ A;  5C4J J;  5IYC J;  2AHQ A;  3BR2 A;  1FIA A;  1GT0 C;  2HOA A;  1JJ8 C;  1FTZ A;  4AUX A;  5F04 A;  1RET A;  2JJ7 A;  4IHV A;  4A93 J;  2EQR A;  2CU7 A;  3IH4 A;  1YRN A;  1TWA J;  2L9R A;  5EF6 A;  1FEX A;  3H3V K;  3GTJ J;  2O8K A;  1G2H A;  1ZGW A;  3FK7 A;  3I4M J;  3Q3S A;  3SJM A;  4M3G A;  3SFI A;  9ANT A;  3A02 A;  1ETQ A;  5IPA A;  1D5Y A;  1ETV A;  2Y31 A;  3HB9 A;  2H8R A;  4W1U A;  3A01 B;  3QPL A;  5BNG A;  3Q0V A;  3K2A A;  3ZQF A;  3S2D J;  1WI3 A;  1I50 J;  3E7L A;  1LE8 A;  1W0T A;  1ITY A;  1PUF B;  1LFU P;  2VI6 A;  1ZR2 A;  5M3F J;  4B1R A;  3HGG A;  1TC3 C;  1Z77 A;  1B8I B;  2E2J J;  5IOZ A;  3S14 J;  1QRY A;  3HBL A;  2GM4 A;  4M3F A;  3LOC A;  2VUM J;  2L7Z A;  4XRM A;  5EGO B;  3SDG A;  2XSD C;  1ORK A;  4GFB A;  2MSY A;  4I6Z A;  1B72 B;  1MBF A;  5EZH A;  2NVQ J;  1HF0 A;  1Y1V J;  4NDL A;  1TWG J;  2JN6 A;  2XB5 A;  4C3I J;  4RDU A;  2K9N A;  2LLK A;  1H8A C;  3A03 A;  4HNV A;  2R5Y A;  1IV6 A;  1F36 A;  2EZI A;  3BG9 A;  2R0Q C;  3GTG J;  3LNQ A;  2FQ4 A;  2ME0 A;  3HDD A; 
#chains in the Genus database with same CATH topology
 1YYV A;  1A5J A;  2YS9 A;  5L3D A;  1R36 A;  2V1D A;  3WHB A;  2IT0 A;  2DTR A;  4M3D A;  1YIT I;  1G3S A;  4IF4 A;  3ZQQ A;  3FBI B;  1FP1 D;  3Q0U A;  2EV6 A;  4G7O F;  3HPG A;  1XMA A;  5J1R A;  4JOM A;  1OMI A;  1S8N A;  3KLN A;  4UUT A;  4PJJ A;  5E1Z B;  3D1N I;  3GLL A;  2RNJ A;  1ETW A;  3TW6 A;  1XMK A;  4HF1 A;  4ZYD A;  4AVZ A;  2VL8 A;  2A61 A;  4XOP A;  3LAP A;  3GZN B;  3HGY A;  2PFB A;  5LFA A;  2KZG A;  3ZN1 A;  1WWX A;  3H5A A;  4G12 A;  2E19 A;  3CZ6 A;  5FD6 A;  5IT9 K;  2D45 A;  1R6R A;  1T95 A;  1R1V A;  3KP7 A;  2ZME C;  2MGQ A;  1V5G A;  1XCB A;  2TRT A;  2YX7 A;  3E5Q A;  4W97 A;  3ZOB A;  1FOW A;  3LFK A;  2O8X A;  3CCE I;  3CP8 A;  4XQF A;  2XRL A;  1UEL B;  1MDM B;  4O5V A;  1BIB A;  1REP C;  3E3V A;  2VJ5 A;  1NG7 A;  3K6G A;  1W7P B;  2A05 A;  1MMN A;  5TRD A;  3W2A A;  1OJL A;  1R1T A;  3LWF A;  3L2C A;  3HUG B;  1HDD C;  1MJA A;  3CC2 I;  1FSH A;  2MD0 A;  2CUJ A;  2FA5 A;  4CCK A;  2R7R A;  4ENN A;  2XAQ A;  3OYM A;  4CA0 A;  4J01 A;  4N9H A;  1HKS A;  2K3F A;  1ZGA A;  2ZBK A;  1S3J A;  4DZJ A;  3QPH A;  5D4S A;  2LC2 A;  5IOY A;  2BVM A;  3I64 A;  2EA4 A;  1FPQ A;  3LSM A;  3LA7 A;  1OIS A;  1HC8 A;  1BC8 C;  2W57 A;  4I99 C;  2K7L A;  4RMN A;  4IHX A;  5JLW A;  2VT2 A;  5CVJ A;  2Y75 A;  3ECO A;  1YTY A;  2LKX A;  2QSH X;  2CJJ A;  4ZYE A;  1T2K A;  2EBI A;  3O2P E;  5DYM A;  1YG2 A;  4ZYA A;  5HNH A;  1GLN A;  4F3Q A;  1UFM A;  3BR3 A;  3GFM A;  3BOQ A;  3OSF A;  5CLS A;  2VT3 A;  4U87 A;  4FT8 A;  2O6G E;  2CYY A;  2O9L A;  3H1C A;  4I76 A;  2NYX A;  1W7P A;  4BE0 A;  4AD9 A;  3CO7 C;  1PP7 U;  1FWZ A;  2E1C A;  2XF5 A;  3TKY A;  1I39 A;  1JKO C;  2LH9 A;  3VFZ A;  1H9T A;  2R7T A;  3FMS A;  3WTT C;  4KIT B;  1AHD P;  1JKR C;  5KK1 A;  2NVY J;  3FX3 A;  1FBQ A;  2BY1 A;  2QF7 A;  1KYZ A;  3F8C A;  3R0A A;  4BAC A;  5IT9 Z;  2VC0 A;  2EFP A;  2GQQ A;  2RDP A;  1MMG A;  2PN6 A;  3ABU A;  2ZJP F;  1N25 A;  1GXQ A;  1H89 C;  3TDZ C;  2RAE A;  2CO5 A;  5C44 J;  1FBU A;  1ERD A;  4G94 A;  4QIW N;  2JA7 J;  2HI3 A;  4H0E A;  3RI4 A;  3S1M J;  1MKM A;  1TW2 A;  4KUM A;  1POG A;  1TWF J;  3NRV A;  1BW5 A;  2XF7 A;  3H36 A;  4MHG A;  4IOC F;  3I5U A;  5FB2 A;  3H3Z A;  5LD2 C;  2VON A;  3HSF A;  3OYD A;  3BP8 A;  5J4Y A;  3HL2 A;  5D5V B;  2IP2 A;  4Y7N J;  3ZQG A;  5EG0 B;  1ON1 A;  3MVP A;  5JHU A;  3K4K A;  1BI0 A;  1S5L C;  4CCN A;  4II3 A;  1JKP C;  1LJ9 A;  4AWX B;  2DU9 A;  2HOS A;  2OBP A;  5E3M A;  2O7O A;  4A2U A;  2PMH A;  4OOI A;  3R6S A;  3IL2 A;  4OIR F;  2QGU A;  2VOP A;  3ABM H;  1D0Y A;  1GVD A;  2FF4 A;  3FWE A;  3F0C A;  1DP3 A;  3W3C A;  3Q9S A;  5HLH A;  1I3A A;  2DOF A;  3W6V A;  2HR3 A;  2E60 A;  3LA2 A;  1Y1W J;  4LFU A;  2R7O A;  1R1U A;  1T08 B;  3EUH C;  3JRC A;  2IS2 A;  1R7J A;  1Y56 A;  2BE5 F;  1Z7U A;  3VPR A;  3DV8 A;  4D0P A;  3CF2 A;  2LY1 A;  3K70 D;  1G4D A;  3OL4 A;  1HST A;  2LP0 A;  3L00 A;  1QNT A;  1TL8 A;  2BGC A;  2WAF A;  3VYS B;  3S2W A;  3J7Z I;  3QP6 A;  3A4C A;  5F6F A;  5LRS A;  4Q5S F;  2DLL A;  3CUQ B;  3GFI A;  3L2Q A;  4X6A J;  3KYL A;  1ACI A;  1YW7 A;  3BWG A;  5D8L B;  4Q48 A;  3GTP J;  1WSU A;  2IGK A;  2QWW A;  2V9V A;  2XRO A;  2K4J A;  2EK5 A;  1MBE A;  2X9D A;  2XVC A;  3S32 A;  3CMM A;  5FKM A;  2IRF G;  4MIM A;  4AYB A;  1PUF A;  2OC6 A;  3OL3 A;  2YR2 A;  5JFR A;  4HQM A;  3VEP A;  5HS9 A;  2XGX A;  4GYI A;  2AO9 A;  1MNM C;  2R7U A;  2IAI A;  2W48 A;  5J47 A;  4B3X A;  1FYM A;  1VQ6 I;  1JT0 A;  4JX6 A;  5E8G A;  2CGP A;  2X6O A;  3J80 Z;  3MKW B;  5F64 A;  5HOO A;  3GTQ J;  3D0S A;  4HX8 A;  3BR0 A;  1QVT A;  3OIP A;  5HOD A;  3OSG A;  4EVI A;  2R93 J;  2RQP A;  3JRA A;  5DM6 F;  1I3Q J;  1NK3 P;  1ZTR A;  2VPR A;  2HWV A;  4V2G A;  5JLX A;  3VDX A;  4B3A A;  3DTK A;  1SD7 A;  3BTI A;  1HLV A;  1LUJ B;  4RAG A;  4BY7 J;  4GRI A;  1D3Y A;  2E5N A;  3WU1 B;  1ZN2 A;  3KFW X;  4BH9 A;  3KZY A;  1ETO A;  1GV2 A;  1IJW C;  1JJ6 C;  1HBX G;  5DS9 A;  1B9M A;  2COB A;  2HYJ A;  3B6A A;  2ZXW H;  3DTE A;  1O7L A;  3QQA A;  2M8G X;  4UY8 I;  3BPX A;  2B9S A;  2W82 A;  3EYY A;  4PSX A;  1UB9 A;  3JRD A;  1LE8 B;  3HKZ N;  2DW4 A;  2H6B A;  1OFC X;  2XAS A;  2FBI A;  2VN2 A;  2WV0 A;  3FIS A;  4HPQ A;  3S2H J;  3FXK A;  1O3S A;  2V1U A;  2HPM A;  5F1R A;  1FTT A;  2R7Q A;  1KGS A;  3DEU A;  4I7H A;  1IC8 A;  3KZZ A;  3MN2 A;  1OYY A;  1J0R A;  3PSI A;  3H9Q A;  2DT7 B;  2NNY A;  1AU7 A;  2NRA C;  3O3K A;  3GTL J;  5HVQ C;  1O3T A;  4A3J J;  2GLO A;  1FC3 A;  3AG3 H;  3TO7 A;  4LG0 B;  3K2Z A;  3KP3 A;  1U5T A;  4L0Z B;  3LL7 A;  2HZD A;  4A3K J;  4V19 K;  2JA2 A;  5DD4 A;  4M9Z A;  3RQI A;  2VKH A;  2ELJ A;  4C2T A;  1VQ8 I;  2J5P A;  4WWC A;  4JP0 A;  3HM5 A;  5E79 C;  2WC2 A;  4D7M A;  5IY5 H;  3N97 A;  1E2X A;  3LAJ A;  2K4B A;  4UVC A;  2GXB A;  1I27 A;  2QQA A;  3AKZ A;  2FQ3 A;  2JA6 J;  2WB1 N;  4BE1 A;  1APL C;  2CV2 A;  3EYI A;  2HDW A;  2CUZ A;  2OV7 A;  2CQX A;  3HOU J;  3DXJ F;  3F8B A;  3CCJ I;  2M5W A;  3CUO A;  4ETS A;  4C3H J;  4D5C A;  5D5X B;  4R8H A;  4J00 A;  3K1N A;  4PGG A;  3ZQI A;  3BTL A;  3RZD J;  2Y69 H;  1LFB A;  1QZY A;  2OCE A;  3M8E A;  1UMQ A;  3OS2 A;  2F4I A;  4XK4 A;  5FLV A;  3HOX J;  1LFP A;  3AL0 B;  1JHH A;  1B1B A;  3VOE A;  4C9Y A;  5ICC A;  3F8F A;  1HDP A;  1EV7 A;  2LVS A;  2K9M A;  3SYT A;  2L9V A;  4OWR B;  4HV6 A;  3ZQ7 A;  4HDV A;  1OCR H;  1BIA A;  3K1P A;  2AXT C;  2HVQ A;  4KYW A;  1Z67 A;  3QOE A;  1RNL A;  2HDC A;  4GGG A;  2VBX A;  3QYB A;  1I1S A;  1D0X A;  1XGM A;  3GVA A;  2JA5 J;  3K4C A;  3G4S I;  2KDZ A;  3RYR A;  2QLZ A;  3SDB A;  1MJB A;  1BR1 A;  4PZJ A;  2HU9 A;  2WBM A;  3HXL A;  3M07 A;  1IUY A;  3H0G J;  4NC6 A;  4Y3O A;  2BXZ A;  2IJL A;  2VJ4 A;  3TOA A;  5GTI C;  4DYQ A;  5CVR A;  1BC7 C;  1XSV A;  2XAF A;  2Y48 A;  2MLK A;  5C4J J;  4G7Z F;  4LK0 F;  2NVU B;  4NB5 A;  2A6H F;  4AIJ A;  2AHQ A;  2LOO A;  2W85 A;  4DOZ A;  4LB5 A;  1GT0 C;  2CMP A;  1JJ8 C;  3QRF F;  3KP4 A;  3RCO A;  3CCR I;  4PDK A;  4MEY F;  2HTS A;  1RET A;  2W00 A;  2JJ7 A;  1FMV A;  1LEA A;  5FD5 A;  3ZMT A;  1SD6 A;  2D1V A;  2XHK A;  2ZME A;  1X1B A;  3S3M A;  3KEQ A;  3LA3 A;  4HF0 A;  2UZK A;  2DFE A;  1FEX A;  1OQY A;  2KRC A;  2KP6 A;  1P4X A;  1G2H A;  4XNF A;  3MWM A;  3AG1 H;  1K4S A;  4UV8 A;  4OIN F;  5L3C A;  3A02 A;  1WHU A;  1ETQ A;  3ISP A;  4E4H A;  1ZRF A;  1ZYR F;  3BZ6 A;  3BJA A;  3QPL A;  3RTR A;  4OU0 A;  3GO5 A;  3ZQF A;  2BY2 A;  1P9Q C;  2LDU A;  5DCM A;  1LE8 A;  2VAS A;  1W0T A;  4AVP A;  1QHG A;  3E5X A;  1PUF B;  1T8I A;  1OCZ H;  2VI6 A;  1ZR2 A;  2LKS A;  3HGG A;  4PJL A;  2FBK A;  2ETH A;  3BG6 A;  2VQC A;  2L9S A;  3SEZ A;  2DDA A;  3BJO A;  2ZKZ A;  3V7R A;  1J59 A;  1SVM A;  2B0L A;  3HBL A;  4II2 A;  2GXA A;  3TO6 A;  3FBN B;  5JVT A;  4HNT A;  1R58 A;  3EPZ A;  4BS9 A;  4BAY A;  2F4O B;  2MSY A;  3WU0 A;  3A0B C;  2BXY A;  3AG4 H;  4YII A;  5LLQ A;  1E0E A;  2JN6 A;  1O7F A;  2JT1 A;  4HA8 A;  3L2U A;  1VQP I;  4C3I J;  4WXC A;  5LHG A;  4RDU A;  4CZC A;  3A03 A;  4HZF A;  3I59 A;  4Y15 A;  4HX7 A;  5FLX K;  3QP5 A;  2EZI A;  5E1W A;  3OYF A;  2OTL I;  2KHM A;  1SFX A;  4KIF A;  2MYS A;  4XSX F;  1IXC A;  3NAU A;  4NHJ A;  1MMS A;  2A5W A;  3HOT A;  2HFH A;  1WJ5 A;  2V26 A;  5JHF A;  1P4A A;  5CVV A;  3ROU A;  1JGG A;  3I59 B;  2W1O A;  4BQQ A;  1ZRC A;  1TTY A;  1FIP A;  2H1K A;  2OUM A;  3ECH A;  3H9J A;  4M9X A;  2K9S A;  2L7F P;  1YX3 A;  5KCM A;  2V79 A;  1BW6 A;  3CD6 I;  2ISZ A;  3UKG A;  1V55 H;  4M3B A;  3ZPL A;  3FKI J;  1MBG A;  2MC3 A;  3V8L A;  1LDK B;  3F3X A;  4KN4 X;  3PFI A;  1WRJ A;  4XKB A;  2YUS A;  3N05 A;  3ULQ B;  1Z3X A;  4XLC A;  2NS8 A;  2L7K A;  4XMY A;  4MFD A;  2XKO A;  5DEQ A;  3E6C C;  3G71 I;  3KEO A;  1XX5 A;  5E3O A;  5HDG A;  2GA2 A;  2BW3 A;  2RN7 A;  3VYR B;  1ZH5 A;  3F22 A;  4NQW A;  2DDB A;  3E6M A;  5J3L A;  2NS0 A;  3EUH A;  4C2M J;  2VOO A;  3ESW B;  3CC4 I;  1IDY A;  1S72 I;  2DPU A;  5FKL A;  3ZN0 A;  3BTC A;  2NVX J;  1MW7 A;  3BJ6 A;  3CCM I;  3I4N J;  1MBH A;  2HQ5 A;  2P5K A;  2DMU A;  2MA3 A;  4D5F A;  1H9G A;  3BG7 A;  4RB3 C;  2DT5 A;  3COA C;  3G1L A;  3IAM 2;  1SC7 A;  3HJE A;  1DUX C;  4IKF A;  1MH3 A;  4HV5 A;  3FXQ A;  3GLX A;  2FRH A;  3QPT A;  1R4N B;  3JRE A;  2YU9 J;  3WE2 A;  3RYP A;  1WH5 A;  3WGI A;  1MSE C;  1V3F A;  1FSE A;  5CJ9 A;  2LTP A;  1O3R A;  2B63 J;  3F8M A;  5F0C A;  2ZME B;  4UV9 A;  2X4H A;  2G9W A;  5H6R A;  2DTZ A;  3L09 A;  5JI6 A;  3L2V A;  5A2Q Z;  3WTZ A;  3L2W A;  3NWS A;  1T98 A;  1F43 A;  1QZE A;  4CYC B;  4WK8 F;  2LY9 A;  4C2U A;  2KPM A;  5E18 F;  1A6I A;  3OV8 A;  1JTY A;  2OZU A;  3F23 A;  3J81 K;  1GXP A;  3WU2 C;  3S1N J;  1XSX A;  2XAJ A;  2X6W A;  3H5N A;  2M2E A;  2K3P A;  4EM0 B;  5BPD A;  1R23 A;  2RKH A;  2V4J C;  2MD5 A;  2L5Q A;  3O8H A;  1R4M B;  4A3C J;  2CQ7 A;  3LSK A;  4F55 A;  1X4O A;  1MD0 A;  4CXF A;  4BXX J;  3OYH A;  4A69 C;  2FU4 A;  3DF8 A;  4RM3 A;  2DBB A;  4ANJ A;  1P92 A;  1S7O A;  3BCA A;  1Z1D A;  2KMU A;  3KP5 A;  3GW2 A;  4L9N A;  4CYD A;  2IGM A;  2FOK A;  3I55 I;  1HKT A;  2RVC A;  1B59 A;  2KJB A;  4M9S A;  1K4T A;  5IP7 J;  4L5J A;  1ETY A;  1P7I A;  2BHY A;  5J4V A;  1JUS A;  5DV5 A;  5ED4 A;  4XKC A;  2BBY A;  3TMO A;  3BG3 A;  1STZ A;  2NOG A;  2CV1 A;  5LBQ A;  1G3W A;  2DFF A;  1VTN C;  2H94 A;  1IRF A;  3HKZ A;  4A0Z A;  3O8G A;  5ILU A;  3GWZ A;  2E2I J;  2EV5 A;  1SD5 A;  4B4C A;  2EFN A;  4EGY A;  2QSG X;  2QYO A;  3RJP A;  1AKH B;  3A0H C;  4DYC A;  3GCM A;  1YHQ I;  3W6J B;  1WJB A;  2V1N A;  3JTG A;  1LNW A;  4P55 A;  5CYV A;  4I0B A;  2WY8 Q;  2M30 A;  3KCC A;  2K9Q A;  1WCM J;  2VXD A;  2NNN A;  2WV1 A;  1MND A;  3FXR A;  1YJ9 I;  1U78 A;  4CCL A;  3CMY A;  4IHY A;  1P6R A;  1TP4 A;  1OR7 A;  3B73 A;  1TLH B;  2LFB A;  2QVO A;  3OIO A;  2QCO A;  1QHH D;  3ZMZ A;  2ID3 A;  4CCJ A;  1B72 A;  3S16 J;  5IP6 A;  5CQE A;  3LSP A;  3CME I;  2QQ8 A;  4U88 A;  1BM9 A;  4JX5 A;  1DPR A;  2XGD A;  4A0Y A;  1LQ1 A;  3KYD B;  3P7N A;  2JUC A;  3JRI A;  4FHT A;  2CFX A;  4LOC A;  2IS1 A;  5HLG A;  3HOZ J;  1YS6 A;  2DMP A;  2PEX A;  2IEK A;  3M4O J;  3QOP A;  5ERI A;  2O0Y A;  3E97 A;  1T38 A;  1UCR A;  4LK1 F;  2R7Z J;  1X1A A;  2DCE A;  2RNG A;  2VLA A;  2K40 A;  1X19 A;  3F72 A;  4XLF A;  4M71 A;  3DPT A;  1I1G A;  1P4W A;  2DA1 A;  5M5Y J;  2R5Z A;  1FOY A;  2E34 A;  1XPX A;  3IC7 A;  3PUB A;  3QPS A;  2FXA A;  2JZY A;  2OPT A;  4IZZ A;  2WAE A;  3BC8 A;  1BOA A;  4OIP F;  2WY7 Q;  4EJW A;  2V7F A;  4G6T B;  1K79 A;  2B7E A;  3MKZ A;  3RKX A;  2WA0 A;  5LHH A;  2F4M B;  3DCF A;  5GAG J;  1MSF C;  4KIS A;  3PUF A;  2P8T A;  1W5T A;  1X3U A;  5JVG F;  1ZK8 A;  1YE9 A;  2L0K A;  4BQN A;  5M3M J;  4U7B A;  2CUF A;  1Z6R A;  1IN8 A;  4FTH A;  1B4A A;  4P1W A;  1D1C A;  1H0M A;  1E17 A;  5IP9 J;  2GBY A;  2A6T A;  4KMU X;  1SMY F;  2DOD A;  1VFC A;  2DA7 A;  4XLA A;  2FMY A;  1DP7 P;  2JSC A;  2BW3 B;  2XV4 S;  2UXN A;  3BDD A;  4UUS B;  4IQJ A;  4DJA A;  1ODD A;  4ZC3 A;  1R5H A;  3QAH A;  2CG4 A;  1FT9 A;  3BTJ A;  5LGN A;  1D8K A;  1RPW A;  3NAR A;  3KZI C;  4A6E A;  2V6C A;  2EH3 A;  2QQB A;  2LMD A;  4A3M J;  2IVM A;  1TNS A;  2ZJQ F;  4HAM A;  3U1K A;  3CTA A;  2JTV A;  4YEJ A;  1RKW A;  3C3W A;  1OLT A;  4BNC A;  2EIK H;  2G7H A;  3GBG A;  2NVT J;  2JQ7 A;  3ZQC A;  3WE3 A;  1OCT C;  3M7G A;  2GXG A;  4DYR A;  3L9F A;  3BR1 A;  5M5X J;  1UJ8 A;  3ABT A;  1QZZ A;  3ZR8 X;  3J7A Y;  3U21 A;  4YFK F;  1L3L A;  1X1P A;  1V54 H;  4IVN A;  2D5V A;  2Z9O A;  5EZG A;  2M7B A;  3FKJ A;  3JAM Z;  4EJV A;  5D5W B;  4M6X A;  5F1J A;  3BZC A;  2VKV A;  4CYC A;  1LDD A;  3FIW A;  1ZEL A;  3CJT B;  2ECB A;  3WTU C;  1HW2 A;  2Y9Z A;  4UXN A;  3ZGK A;  4BJT A;  4AIK A;  1RR7 A;  2H27 A;  2JA8 J;  1VQ4 I;  2W25 A;  2L9N A;  4XRS G;  1FP2 A;  5DUI A;  4XLP F;  2LF7 A;  3CUQ C;  5DDG A;  2CUE A;  1MDM A;  4M3E A;  2KJC A;  4PFO A;  1QVU A;  4RBO A;  2DA4 A;  4LMY A;  2DA3 A;  3FZV A;  1SVL A;  2GZW A;  2XUB A;  3L1P A;  2ZXI A;  3AFH A;  3W2V A;  1N77 A;  1FOK A;  3HOW J;  3DTI A;  2HOT A;  1YOV B;  1KA8 A;  1XSD A;  3PQK A;  4YEL A;  1LVA A;  3FXM A;  2X85 A;  4A5M A;  5J6X A;  2R92 J;  3OYG A;  1KU3 A;  2H09 A;  2JMW A;  3E6B A;  4I2O A;  1IN5 A;  1TQP A;  5M5W J;  2HVS A;  1T0F C;  1Z21 A;  2AXL A;  2EB7 A;  1A04 A;  4MTD A;  1RIO H;  1JUP A;  1Y6I A;  2X48 A;  1SAX A;  3DBL B;  2E71 A;  4XOR A;  1N78 A;  1LDJ A;  5FLM J;  4ON0 A;  3HOV J;  1PJR A;  4AC0 A;  2NAZ A;  1O57 A;  2OJE D;  1YIO A;  2HYG D;  2EA2 A;  2IW5 A;  3HC7 A;  4XON A;  4MGR A;  3K0L A;  4HYE A;  3GX4 X;  5BS6 A;  2XGE A;  4L9J A;  1TBX A;  3V8J A;  1QBJ A;  3CJR B;  2ZFW A;  1DQU A;  1L0O C;  4L9V A;  1NK2 P;  3IAS 2;  1LB2 A;  2P5V A;  1UZC A;  5AIQ A;  3R61 A;  4AIH A;  3WGH A;  3CCS I;  4ZZL A;  2R7V A;  5E3L A;  1BA5 A;  2KIM A;  3TP3 A;  2E1M B;  2DA2 A;  1T0F A;  4DZP A;  4YRV A;  1FYL A;  3U9G A;  4P9F A;  4B47 A;  4YFX F;  4XLH A;  3M9A A;  1VQK I;  2RRE A;  3E0J B;  1U2W A;  2XAG A;  1XD7 A;  1FIA A;  3DFG A;  2HOA A;  4CCO A;  3MKY B;  3FXO A;  4Y13 A;  5BPI A;  3T5X A;  5F04 A;  3U2R A;  4HSR A;  3S3O A;  4A93 J;  1M1E B;  2EQR A;  2PMZ A;  3SEQ A;  3FHZ A;  1YRN A;  1TWA J;  3WTX C;  2L9R A;  5EF6 A;  4RM2 A;  2X1C A;  5CKT A;  4DIQ A;  1FNN A;  2M7A A;  4IHS A;  3Q3S A;  3SJM A;  5EJC A;  1RZ4 A;  5DCF A;  1WQ2 A;  3A1Y A;  3QOD A;  1D5Y A;  2H8R A;  3PIO F;  3A01 B;  4CIC A;  1FBS A;  4KIB A;  3Q0V A;  3SZG A;  3RPQ A;  1S6L A;  3V7C A;  3O6B B;  3E7L A;  4B48 A;  2LBF B;  1WJA A;  2M3A A;  5ICG A;  1CF7 B;  1ITY A;  1E3P A;  2BY3 A;  2LRE A;  5M3F J;  1HA8 A;  2BZT A;  5D4R A;  1B8I B;  1TC3 C;  1UST A;  5LRR A;  2V9P A;  2ZNY A;  2DPD A;  5IOZ A;  4HX4 A;  3S14 J;  4RAF A;  4DQ2 A;  2O03 A;  2VUM J;  2CH0 A;  2WTE A;  2ZJR F;  3CJN A;  1WFX A;  2KRH A;  5E20 A;  2XDV A;  1KYW A;  2K85 A;  5EGO B;  1SFE A;  1W4M A;  1BI2 A;  4KA4 A;  1G8X A;  1SVO A;  2XSD C;  3L7W A;  3DU6 A;  3ELK A;  3UR3 C;  2JPC A;  2NVQ J;  1SD4 A;  2CW0 F;  1PUE E;  1TWG J;  4BQA A;  2XB5 A;  3JTH A;  3TBI A;  2V9K A;  2ZJ2 A;  3HG9 A;  5FRO A;  1MMD A;  4KN7 X;  4D9J A;  4EMS A;  4I09 A;  4HG2 A;  3K4N A;  4PUS A;  2MBF A;  3HZJ A;  4CCM A;  1IV6 A;  1F36 A;  1QU3 A;  1KU7 A;  3PNV A;  1LVK A;  2DYR H;  4RB1 A;  5TIS C;  4ZH4 F;  3HDD A;  4RGS A;  1Y0N A;  4L5E A;  1AKH A;  4ENM A;  3RPU A;  2KZV A;  5H6Q A;  4XM3 A;  3HIF A;  4BU2 A;  4EGZ A;  4NBQ A;  2FJ1 A;  4LG3 A;  2ACJ A;  2XC7 A;  2E2H J;  2Y2Z A;  4RS8 A;  2J5O A;  3D5S C;  1J5Y A;  1EF4 A;  4BKX A;  4PJM A;  1X3W B;  2MLG A;  3JRF A;  1WH7 A;  2STW A;  4U0Y A;  1CQT A;  3K10 A;  2YX4 A;  4Y4R A;  2ZXH A;  3PQJ A;  1MZB A;  3CDL A;  3X2Q H;  3TED A;  3K70 C;  2ESN A;  4ZZD A;  3K4L A;  5K5O A;  5E8I A;  4A3F J;  3R4K A;  4GXO A;  2ELH A;  4F52 A;  2P6T A;  1JT6 A;  3E1S A;  1I6X A;  3CQZ J;  1A6Q A;  3DU5 A;  4X1E A;  4M72 A;  1R9T J;  4CHU A;  1WJC A;  5ICF A;  3REO A;  2KIF A;  5LHI A;  2CW8 A;  2IPQ X;  3T0Y A;  3IKV A;  3C1D A;  2VJJ A;  3G73 A;  3HRU A;  4KDP A;  2HNH A;  1X1D A;  3DBR B;  2IXS A;  3V7S A;  4E70 A;  1A36 A;  3SXY A;  4P5O A;  4IO9 F;  5HS8 A;  1QPM A;  2A68 F;  3LSG A;  1NH3 A;  1Z05 A;  1W36 C;  1BL0 A;  2BVL A;  1Q1V A;  3P9K A;  4IHT A;  4BHC A;  4LD5 A;  5GAH J;  1R22 A;  3IKT A;  1HOM A;  5BMZ A;  2GOM A;  4AID A;  1VZ0 A;  2PLY A;  2CWE A;  4LJZ F;  3GTO J;  2EZL A;  4IOA F;  2L02 A;  2CW7 A;  2Y0S N;  4DBR A;  3PM1 A;  2STT A;  1T33 A;  1IRG A;  4A3E J;  2R5Y B;  4HST A;  4FAS D;  4H4K C;  3BQY A;  3R60 A;  4E6K G;  3GFL A;  3J7Y J;  5IYB J;  2K27 A;  1VI0 A;  2KDO A;  3ML6 A;  3IP4 B;  1QA6 A;  5F0F A;  4JX4 A;  2OU2 A;  5E1X A;  1UG0 A;  3GTM J;  3OYN A;  1KON A;  2A6E F;  4ZDO A;  2L3D A;  3GEZ A;  3TO9 A;  2QKL B;  1YI2 I;  4GYG A;  3ERM A;  4HW0 A;  2F5D A;  2G0E A;  1U8B A;  2DK8 A;  2ISY A;  1X2N A;  1FZP B;  1T56 A;  3ZMD A;  5KVR A;  1EKE A;  1XTA A;  5EYR A;  3I58 A;  2P7V B;  3AL0 C;  1VND A;  4A3G J;  1JXS A;  3WTS C;  3I56 I;  2DYS H;  2EPF A;  1XGS A;  1WVR A;  1J75 A;  3KE2 A;  2HEO A;  2RV8 A;  1ENH A;  3VB2 A;  1YFH A;  4HNU A;  1EJ9 A;  1V5F A;  2CQK A;  2DA6 A;  2EIN H;  3CLO A;  4IHW A;  3LST A;  4HBL A;  3SQN A;  4XIC A;  1TQM A;  2ZXJ A;  3LSI A;  4HEA 2;  4PJ0 C;  1ETX A;  1K83 J;  2HS5 A;  2Y30 A;  1U0J A;  4KT5 C;  4KIC A;  5BOX A;  4ZDL A;  5L3B A;  3HHH A;  2EZK A;  1BJA A;  2DN0 A;  2QZ8 A;  4MQV A;  1G6N A;  4LLL A;  4QTR A;  2XPV A;  1DU0 A;  1R5I D;  3T1B A;  2DT6 A;  2JK3 A;  2A69 F;  2DXI A;  4FIS A;  2AQE A;  3HOY J;  4UVA A;  3FXJ A;  3A01 A;  5CVU A;  3CES A;  3F6V A;  1HCR A;  2PMZ N;  4IQ4 A;  2I5U A;  2RC4 A;  3K7A J;  3I71 A;  3GME A;  2XGC A;  4LLG F;  1K6O A;  5K1Y A;  1QO0 D;  2FX0 A;  2Y9Y A;  3CCQ I;  4RGX A;  5LEK A;  3KP2 A;  2DMN A;  3G6E I;  4TV7 A;  4FX4 A;  2CQQ A;  2Q1Z B;  3KLO A;  1Y39 A;  1Y8Q B;  3OOU A;  1ZRD A;  3D5R C;  2RQQ A;  4BUP A;  4WX9 A;  1ZAO A;  4OMZ A;  1NG6 A;  4UHT A;  1ZG5 A;  3VYT B;  4HQE A;  1GDT A;  1JTX A;  2E36 A;  2KIS A;  2UV1 A;  5EGO A;  4R79 A;  4XN3 A;  2CV0 A;  1Q1H A;  4L18 B;  4CZZ A;  1F1Z A;  4XL9 A;  2QBY B;  1T39 A;  3S1Q J;  3QU6 A;  1HKQ A;  2KRF A;  1ZG1 A;  2JVH A;  1IN7 A;  2Z33 A;  4G6Q A;  4MLO A;  1Y0U A;  3FM3 A;  5KNL A;  4PSW A;  1KZH A;  3VWB A;  1WZ2 A;  4DBQ A;  3BQZ A;  1S7A A;  2BEO A;  3HHG A;  2EZH A;  3K9T A;  3ERE D;  4PGH A;  2VQL A;  2KLO A;  2R7W A;  4XN0 A;  4IRI A;  2L54 A;  3JRH A;  1D1A A;  1I6H J;  3H35 A;  2QSF X;  6PAX A;  5DUK A;  2DJN A;  1BJZ A;  4YG2 F;  2TDX A;  3JAM K;  4BHP A;  1WJD A;  3OY9 A;  3GF2 A;  4ESF A;  4MO7 A;  1P7J A;  1Z9C A;  1OCC H;  4LIV A;  1VQL I;  3S8P A;  1YS7 A;  4ESB A;  3HUG A;  1RUN A;  1IO2 A;  1J9I A;  4A3I J;  1FY7 A;  4Q4Z F;  4V2F A;  2F5E A;  5FFX A;  2IS6 A;  3DBH B;  5TGT A;  2Z3Y A;  2HGC A;  4BXU A;  2QUF A;  1MBJ A;  1W7P D;  2FEZ A;  3F6O A;  2ZNZ A;  4EEF G;  5B1A H;  2OA4 A;  2XRN A;  2K02 A;  4B09 A;  3GZ6 A;  3TGN A;  1ULY A;  3TL4 X;  3WGG A;  5EG0 A;  3JR9 A;  3BCB A;  1JE8 A;  2HXO A;  5GAE J;  1FOX A;  2BV6 A;  4A3L J;  3CCL I;  1MBK A;  1JUM A;  4FCY A;  4DW6 A;  2UXX A;  2OTJ I;  3OYK A;  2L7M P;  4MEX F;  4EJU A;  2DFH A;  2HYF A;  3DKW A;  4HF2 A;  3KIO A;  3SFZ A;  3OYE A;  1GHC A;  3I53 A;  3CDH A;  3VOD A;  1OCO H;  3KYC B;  2A5Y B;  1W5S A;  2WAD A;  4U0W A;  5HDK A;  3GTK J;  1TQI A;  4E7K A;  1BI3 A;  3AG2 H;  5K5R A;  1OCP A;  5BQT A;  3W2W A;  2CS3 A;  3ZCO A;  4CUG A;  1U3E M;  4IL6 C;  2Z1D A;  1ZGJ A;  2OZ6 A;  4NNJ A;  3GFJ A;  5GAD J;  3C18 A;  4HLY A;  4MFE A;  4Z2Y A;  3VSK A;  1VQ9 I;  1W1W E;  3OR2 C;  4BBS J;  4BDZ A;  1ZG3 A;  1SAN A;  2VQH A;  3CJQ B;  1SFU A;  1LPQ A;  2C6Y A;  3IH2 A;  3Q9V A;  4C3J J;  1R5G A;  4FE4 A;  4IJA A;  1F4K A;  3IRR A;  2A3S A;  2HTJ A;  4HLX A;  1KU9 A;  2Z16 A;  3FK6 A;  3S1R J;  4ZTJ A;  2UUZ A;  5H20 A;  4GO1 A;  5EDN A;  2E35 A;  4ZYG A;  1FJL A;  2IBD A;  1HW1 A;  2MFZ A;  3D5L A;  3MEX A;  3FF5 A;  1JGS A;  1D8J A;  1CGP A;  5AON A;  4BHB A;  1E3O C;  2D1H A;  2PBI A;  4I02 A;  5KAI C;  1DDN A;  5B5E C;  2VKE A;  1LKX A;  4ITV A;  4XID A;  2PI0 A;  4Y33 A;  4PJN A;  1GV5 A;  3IV5 A;  5J1U A;  5FKO A;  4OIO F;  3RIR A;  2OQR A;  2VE9 A;  3M1E A;  2VJI A;  2ZSI B;  3K4J A;  3V8K A;  1U5T B;  2OQG A;  4P96 A;  5FKK A;  1XGO A;  2JRM A;  3CF5 F;  4NUB A;  2KL4 A;  2P7C B;  5JR3 A;  3PNT A;  2CRG A;  3EET A;  2YPR A;  2M87 A;  1HW5 A;  3DWL E;  1QPI A;  1V4R A;  4JYK A;  2GA1 A;  5L3F A;  2QEX I;  4NC8 A;  2F5C A;  1OYW A;  2O5R A;  3OYJ A;  4Y52 J;  2YU3 A;  1K61 A;  2ZB9 A;  2E1N A;  5B1B H;  3BPV A;  3AAF A;  3RKW A;  4BJ5 C;  2M9H A;  2LR8 A;  2ESH A;  3G2B A;  2YSR A;  3M8J A;  4QSH A;  4F93 B;  3RKQ A;  2JVG A;  1R49 A;  2FUG 2;  5FO5 A;  1KU2 A;  1AOY A;  1Z7L A;  2QBY A;  2I10 A;  2KFD A;  3KEY A;  4QPO A;  3BG5 A;  4E7Z A;  4MNU A;  2VOD A;  3LSR A;  3TW7 A;  2KQR A;  4EJO A;  3S3N A;  1IZ1 A;  2HQN A;  3I54 A;  3RQ4 A;  4JQF A;  4UUS A;  2MW8 A;  2XF6 A;  1SFO J;  1W5C C;  4ABZ A;  1Z6T A;  4IRH A;  2P0W A;  3E5U A;  4B43 A;  3PIP F;  3BR2 A;  1UHW A;  4DGW B;  4JK1 X;  4AM3 A;  5D6F A;  1FTZ A;  3L2R A;  2LF8 A;  3M8F A;  4CGZ A;  2X0L A;  5EEH A;  2CU7 A;  3IH4 A;  1VQM I;  1XN7 A;  4I0A A;  2VC1 A;  1OYI A;  5J40 A;  3H3V K;  2V6E A;  3GTJ J;  3CLQ A;  2O8K A;  3VSL A;  4X0G A;  2PJR B;  3FK7 A;  1J2X A;  1B9N A;  3HSE A;  2LKP A;  3K4M A;  3RDI A;  9ANT A;  2DOE A;  2VXZ A;  5IPA A;  3WG9 A;  2Y31 A;  4MTE A;  1BBY A;  4B8X A;  4UUV A;  4ASN A;  1J7K A;  5D5U B;  3FMQ A;  5BNG A;  1P2F A;  3J80 K;  2EIM H;  2VBY A;  4WXH A;  1ON2 A;  2WWY A;  2OCC H;  1I50 J;  1OKR A;  1MJ9 A;  1WJF A;  1DGR M;  1F9N A;  3MFK A;  2K5C A;  2VKD A;  2W7N A;  3IWZ A;  3H92 A;  4B1R A;  2Z2S B;  1RI7 A;  1Z77 A;  4GCV A;  1WJE A;  4RA2 A;  2E1M C;  5FLX Z;  2JPB A;  4O6J A;  4N4N B;  1QRY A;  3H9G A;  3EUA A;  4M3F A;  4BL0 B;  2DAO A;  4CDG A;  4ENJ A;  1K78 A;  2Z99 A;  3H5R A;  3JCU C;  1IW7 F;  2HQA A;  2OD5 A;  4E7S A;  3CCU I;  3LMM A;  1IRX A;  1U8R A;  1B72 B;  1MBF A;  4FX0 A;  1Y1V J;  4N9I A;  4NDL A;  1EH7 A;  1S9H A;  2CFO A;  3DPU A;  1FLI A;  5FRM A;  1KQ8 A;  3NEU A;  4ZTF A;  3LFU A;  2LLK A;  2K9L A;  2Q2E A;  3K4B A;  1H8A C;  2DJI A;  1HSJ A;  3Q5F A;  1MGT A;  2FSW A;  3IWF A;  4B44 A;  3BG9 A;  2P4W A;  1YIJ I;  5FRN A;  3GTG J;  2FQ4 A;  2X6X A;  2ME0 A;  2F48 A;  1JKQ C;  2X1D A;  3C2H A;  4LIU A;  5DTD A;  4BGD A;  5KAF C;  3I9V 2;  2FE3 A;  2G7U A;  2KKO A;  2R5Z B;  4WF2 A;  2H1L A;  5HLI A;  3C2B A;  2LK2 A;  2ZFU A;  1ZHF A;  1SFK A;  2FD5 A;  3KET A;  2Q2E B;  3PSF A;  1R00 A;  2JWT A;  1PYV A;  3LQR A;  5CQG A;  3PL8 A;  3PJR A;  2JRT A;  3KPH A;  1RUO A;  4U7D A;  1IDZ A;  3OYC A;  2R7S A;  4D1Q A;  5GPC A;  4CH7 A;  1A35 A;  2IGO A;  1U9N A;  2XKP A;  4BEH B;  1OR7 C;  2OAZ A;  4HDU A;  1YJW I;  1IN6 A;  2DMQ A;  1UHS A;  3MMY B;  3ZMU A;  4ZYH A;  3KX2 A;  3ASO H;  2F5F A;  3WTY C;  2HVR A;  3MAJ A;  1B8I A;  4M73 A;  3HRM A;  4EM2 A;  1BOB A;  2IA1 A;  2VE8 A;  2D2W A;  2R4G A;  1K6Y A;  3FXU A;  1OPC A;  2LG4 A;  4IEJ A;  3UNG C;  4A5N A;  3EQL F;  1TW3 A;  1DU6 A;  2M34 A;  1VQ7 I;  3BRO A;  1F5T A;  2LBF A;  1S7E A;  3IRQ A;  1YJN I;  3DEE A;  1E3H A;  4EM1 A;  3QU3 A;  2ZCW A;  2GIV A;  2X1E A;  1BN5 A;  4XRS A;  2W84 A;  1UAA A;  4A3B J;  2Y0M A;  4Z6Y A;  1U5T C;  2HPI A;  5D6E A;  1B6A A;  2FML A;  3JRG A;  1U9O A;  2EV0 A;  4OMY A;  3V4G A;  1G3Y A;  5K7Z A;  1FYK A;  3BLY A;  3RSN A;  5D8K B;  3JSP A;  5H2F C;  1LEB A;  3TDU C;  1ZLJ A;  4NQW B;  2DFI A;  1BI1 A;  2WB1 A;  3ONQ A;  1X3Z B;  1X4P A;  4N4O B;  1YQA A;  3DP7 A;  2WAQ A;  2XSJ C;  4EJT A;  4DNC A;  3QYE A;  3CUQ A;  3RKY A;  1YX5 A;  4YIR X;  2NOJ B;  2HDD A;  2PJP A;  4KJZ A;  4RGR A;  2L4A A;  3P5J A;  1JHF A;  3MD2 A;  2P81 A;  4UB6 C;  5HDN A;  2Y0S A;  3I4P A;  1O3Q A;  3ZMS A;  4BJ6 C;  5FJ8 J;  3K69 A;  3B02 A;  1U6G A;  2MH9 A;  1R71 A;  4L9T A;  1D0Z A;  3NWT A;  2VBZ A;  4A0X A;  4S0H B;  4IXA A;  2A07 F;  2EFW A;  3LSH A;  4RAY A;  2DK5 A;  1SAU A;  4HRI A;  5DCM B;  3DKX A;  4M6Y A;  3P9I A;  2V1X A;  1RRJ A;  2M1B A;  2L01 A;  3K1M A;  2UWM A;  1VQN I;  3P9C A;  1XMX A;  4BE2 A;  4RGU A;  1TWH J;  2VBW A;  2COM A;  3FXL A;  2E5Z A;  5A2Q K;  4KFC A;  2GWR A;  3OWT A;  4MQ9 F;  1TWC J;  2XIG A;  3OYL A;  1IXS B;  5GPA A;  2HOE A;  3SZP A;  2P5L C;  1IN4 A;  2WAQ N;  4G8X A;  4U0V A;  1IF1 A;  1ZRE A;  2XPU A;  3NQO A;  4XLE A;  4UVB A;  3DEW A;  1UG2 A;  2DA5 A;  3S15 J;  5J1Y A;  2M8E A;  5AIP A;  3TOB A;  5IYD J;  3G1O A;  1UHM A;  5HS7 A;  1ETK A;  4RB2 C;  2XB0 X;  3HPH A;  4ENK A;  1IUF A;  4J19 A;  1RR8 C;  3S17 J;  4BBR J;  1T6S A;  3OS0 A;  1RC9 A;  1H88 C;  5EEA A;  2HXI A;  2M0M A;  2DQR A;  2GIZ A;  1W36 D;  1MIJ A;  2I8D A;  3CCY A;  4PCQ A;  4XR6 A;  4M6V A;  4AYB N;  2PX9 A;  3JSO A;  3WTW C;  1IGN A;  3ZQH A;  1DPU A;  1GVJ A;  2FNP A;  5FKN A;  5B66 C;  3M3Y J;  2FNA A;  3ZQL A;  4RAZ A;  2QA4 I;  3SZT A;  2EFQ A;  3V42 A;  3DLA A;  1AWC A;  3OMY A;  4D7N A;  4R1H A;  5C3E J;  2BHZ A;  2KT0 A;  2TCT A;  3BY6 A;  4PK4 A;  4P9U A;  5K7H A;  4RLQ A;  1IRZ A;  2VIX A;  4LGW A;  1VQO I;  1VF9 A;  2ADU A;  5FFZ A;  2ID6 A;  4EV0 A;  2VPL A;  2FBH A;  5HNF A;  3GZ5 A;  3C2G A;  3WG7 H;  3CCV I;  3T8R A;  4XOT A;  1MNE A;  4KNY A;  2ECC A;  4E7L A;  1Z3Y A;  2QEN A;  2O3F A;  4LLN A;  4A12 A;  1VQ5 I;  2ELK A;  2H6C A;  4XSZ F;  2QM3 A;  3JW4 A;  1YLF A;  3DQV C;  2BYV E;  1NHA A;  3MKL A;  2JSP A;  1XC5 A;  2QKM B;  1PVE A;  2R7X A;  4FQG A;  3J7A O;  3GUD A;  5ICE A;  1C0W A;  4I98 B;  1IV8 A;  2F5V A;  3BR6 A;  2XPW A;  2IA0 A;  4JBA A;  5F08 A;  2N8G A;  4QPQ A;  1RES A;  2MAB A;  5LGU A;  3HTU A;  3ZMV A;  4FE7 A;  2LNB A;  4XLN F;  4OAY A;  2ICW G;  5DD8 A;  2XAU A;  3DPL C;  4LB6 B;  3BZK A;  3KP6 A;  1XG1 A;  4F7Z A;  3EUK L;  1G59 A;  5K7F A;  2ME6 A;  3PNY A;  4PFP A;  3HEF A;  5ILS A;  1XS9 A;  2EJR A;  4M74 A;  2AQF A;  1BR2 A;  2Q0O A;  4EQQ A;  1YW8 A;  3HOS A;  1WGX A;  1KQ0 A;  5J8C A;  4LIT A;  3N4M A;  4BY1 J;  2LYC A;  5LEJ A;  4AU7 A;  2LD5 A;  1X58 A;  3OYI A;  2HKX A;  3G1M A;  4BXF A;  1W0U A;  5TJJ A;  1NTC A;  1SMT A;  1EH8 A;  1X1C A;  1WI9 A;  2L2O A;  4OAZ A;  1FMW A;  5FGM A;  1N75 A;  2X51 A;  4FET A;  2EIL H;  2ZSH B;  3BT9 A;  4YFN F;  3QYF A;  4G7H F;  4K2E A;  1IAW A;  4OIQ F;  1IG7 A;  2O61 A;  3QWL A;  4BYY A;  3OS1 A;  3HTS B;  3I0T A;  4YIF A;  2IA2 A;  5C4X J;  2CSO A;  3PO2 J;  4F91 B;  3OOP A;  4G6D A;  3Q0W A;  5L3E A;  2EWN A;  3CC7 I;  2XAH A;  1ZQ3 P;  2W4S A;  1K7A A;  4ESJ A;  1X2M A;  2LSO A;  3JRB A;  3PO3 J;  1Y8R B;  4GDF A;  4E7J A;  3ZRG A;  3U1D A;  1MH4 A;  4QWQ A;  1A31 A;  4BDY A;  4XKV A;  1RKT A;  4IX7 A;  3TQN A;  2LRD A;  1HXD A;  3MZH A;  1G3T A;  1GUU A;  2IS4 A;  5LGT A;  1TT5 B;  2MG4 A;  1YO5 C;  4WXD A;  1D1B A;  4L5I A;  4Y17 A;  4WCG A;  3J81 Z;  4A6D A;  2PG4 A;  3M1C A;  1IXR C;  4IPA A;  4O3M A;  5J8F A;  2KIQ A;  1D5V A;  2M0C A;  2PMU A;  3HSR A;  4XRF A;  1BR4 A;  3PFY A;  1PP8 F;  2RGV A;  3TP0 A;  2K86 A;  2DO7 A;  3HRS A;  1ZKG A;  2BY0 A;  2HZT A;  3LSJ A;  5ILV A;  4IRG A;  5DM7 F;  1Z0X A;  1JI8 A;  1XDU A;  2ZC2 A;  2X6Y A;  5F0H A;  2DMT A;  3IUO A;  1HQC A;  4S05 A;  4E7H A;  5B3S H;  3LQQ A;  1ZLK A;  1EH6 A;  1USS A;  2MC4 A;  3B6C A;  3T8T A;  1ONV A;  1O4X A;  3HYI A;  2L4M A;  3EDP A;  3G3Z A;  5F27 A;  2E1O A;  3F21 A;  3DKY A;  2EFO A;  4F92 B;  1WPK A;  1I5Z A;  5L3G A;  2VB6 A;  1KQ9 A;  2OF7 A;  4A3D J;  3I3L A;  1K78 B;  2DOA A;  3ZXS A;  2E7X A;  4G9Y A;  4XBF A;  1XB4 A;  1TZL A;  2JUG A;  3CDI A;  3OR1 C;  1FX7 A;  1XGN A;  3MCZ A;  3IHU A;  1TNT A;  1MMA A;  2GAU A;  2LY2 A;  2KIU A;  3IH3 A;  1S29 A;  2NS7 A;  2PJR A;  4BEH A;  3DLL F;  5E3N A;  3FM5 A;  1XCV A;  4ZDP A;  3WHC A;  1Z91 A;  2MH2 A;  3BR5 A;  4C30 A;  1YRN B;  1SEU A;  3RZO J;  1ZR4 A;  2HQR A;  2M4K A;  4N0B A;  5GP9 A;  1AA7 A;  1QGP A;  4RB0 A;  3ABK H;  5IYC J;  1PDN C;  4LG0 A;  2QQ9 A;  1V5E A;  1ZAR A;  1TT0 A;  3ZP5 A;  4AUX A;  3WTV C;  4QLC U;  4IHV A;  5CVI A;  4KMF A;  3H0D A;  3OYB A;  2CQN A;  2GOX B;  2F6C A;  4S04 A;  3VYU B;  5IT3 A;  2BOL A;  2M45 A;  3S93 A;  3ASN H;  5KHD A;  1ZGW A;  3I4M J;  4UNO A;  2R3S A;  4RLF A;  4M3G A;  3SFI A;  2ZO4 A;  4NC7 A;  4CSW A;  5HLT A;  2AS5 F;  3FHN A;  1ETV A;  3HB9 A;  3WOD F;  2NXN B;  2E7W A;  2PQ8 A;  1J09 A;  4W1U A;  3F9K A;  5K5Q A;  3RPU D;  3C7J A;  3K2A A;  3S2D J;  1DGW Y;  1WI3 A;  3H3U A;  1XDS A;  2P6S A;  3CO6 C;  4XKW A;  1QQI A;  2VQG A;  1LFU P;  4EAT A;  2IGN A;  2W24 A;  4I01 A;  4UB8 C;  3GYH X;  4BQO A;  2E2J J;  4E7I A;  3MZ8 A;  5E17 F;  3HRT A;  2R7F A;  4Q47 A;  2GM4 A;  1EA3 A;  5GTH C;  3E6D A;  4KIG A;  3F8N A;  3LOC A;  4KT6 A;  2Z5U A;  2L7Z A;  1YW9 A;  2M4G A;  4XRM A;  3SDG A;  5CPR B;  1ORK A;  4HOB A;  4GFB A;  2DQL A;  3GXO A;  4I6Z A;  2H8W A;  2R7D A;  3R0J A;  2DI3 A;  3OIQ A;  3MZY A;  5EZH A;  2Q8K A;  4CO8 A;  2F2E A;  3FMR A;  3CMA I;  1HF0 A;  4L0Y B;  5EEG A;  3W6K B;  1WKM A;  3OYA A;  3FDY A;  2K9N A;  3CP2 A;  3ABL H;  3MQ0 A;  1CF7 A;  2FOW A;  4HNV A;  2HKO A;  2R5Y A;  3A2K A;  2R0Q C;  2EIJ H;  3LNQ A;  3SHF A;  4ZJZ A; 
#chains in the Genus database with same CATH homology
 1A5J A;  2YS9 A;  4L5E A;  3NAU A;  1AKH A;  5DTD A;  3WHB A;  4M3D A;  2R5Z B;  2E2H J;  2FJ1 A;  3C2B A;  2LK2 A;  3Q0U A;  1JGG A;  2Y2Z A;  2FD5 A;  1EF4 A;  5J1R A;  2JWT A;  4BKX A;  1FIP A;  2H1K A;  3JRF A;  1WH7 A;  4UUT A;  3D1N I;  2K9S A;  2L7F P;  1CQT A;  1ETW A;  3TW6 A;  1IDZ A;  5GPC A;  3CDL A;  3TED A;  1BW6 A;  1U9N A;  3HGY A;  4A3F J;  4G12 A;  2E19 A;  3UKG A;  4M3B A;  2DMQ A;  3FKI J;  1MBG A;  1JT6 A;  3CQZ J;  1UHS A;  4X1E A;  1R9T J;  2MGQ A;  2YUS A;  2TRT A;  3ZOB A;  4W97 A;  2NS8 A;  1B8I A;  1JKQ C;  4MFD A;  2XRL A;  3LSG A;  1BL0 A;  5E3O A;  1OJL A;  1HDD C;  1Q1V A;  4IEJ A;  1DU6 A;  2M34 A;  5J3L A;  4C2M J;  1HOM A;  1S7E A;  1IDY A;  4DZJ A;  5FKL A;  2NVX J;  3BTC A;  5IOY A;  3I4N J;  1MBH A;  2HQ5 A;  2DMU A;  3GTO J;  4D5F A;  2EZL A;  3G1L A;  4XRS A;  2Y0S N;  1MH3 A;  3PM1 A;  1T33 A;  4A3E J;  2R5Y B;  5JLW A;  3JRE A;  4IHX A;  4A3B J;  2YU9 J;  2LKX A;  2CJJ A;  3BQY A;  2EBI A;  1WH5 A;  5IYB J;  3JRG A;  1MSE C;  1VI0 A;  1U9O A;  3BR3 A;  5F0F A;  4JX4 A;  2LTP A;  2B63 J;  3GTM J;  3OSF A;  5F0C A;  5K7Z A;  2DTZ A;  2O9L A;  4I76 A;  1F43 A;  2G0E A;  4CYC B;  1U8B A;  2LY9 A;  1JKO C;  1AHD P;  1X2N A;  1JKR C;  1T56 A;  2NVY J;  1A6I A;  1JTY A;  5EYR A;  2QF7 A;  1VND A;  3S1N J;  4A3G J;  2M2E A;  4A3C J;  3O8H A;  2HDD A;  1ENH A;  2P81 A;  1H89 C;  2DA6 A;  4BXX J;  4IHW A;  5FJ8 J;  4A69 C;  4XIC A;  2RAE A;  5C44 J;  1ETX A;  1K83 J;  2Y30 A;  4QIW N;  4S0H B;  2JA7 J;  2HI3 A;  2EZK A;  5IP7 J;  3S1M J;  2DN0 A;  1ETY A;  1P7I A;  1POG A;  1JUS A;  1TWF J;  2XPV A;  4QTR A;  1DU0 A;  3BG3 A;  1BW5 A;  2JK3 A;  2NOG A;  4FIS A;  3HOY J;  3A01 A;  1HCR A;  2PMZ N;  3O8G A;  1TWH J;  3K7A J;  2E2I J;  2XGC A;  4B4C A;  4Y7N J;  3ZQG A;  2FX0 A;  1TWC J;  1AKH B;  2Y9Y A;  5EG0 B;  4DYC A;  5GPA A;  3MVP A;  2DMN A;  2WAQ N;  2XPU A;  1JKP C;  2CQQ A;  2HOS A;  3OOU A;  5E3M A;  3DEW A;  2O7O A;  1UG2 A;  2DA5 A;  2K9Q A;  3S15 J;  1WCM J;  5J1Y A;  2WV1 A;  1U78 A;  1GDT A;  4IHY A;  1JTX A;  3CMY A;  5IYD J;  3G1O A;  5EGO A;  1ETK A;  2XB0 X;  1IUF A;  4J19 A;  1GVD A;  3S17 J;  4BBR J;  2LFB A;  3OIO A;  2QCO A;  3F0C A;  3S1Q J;  1B72 A;  1H88 C;  2ID3 A;  5EEA A;  2HXI A;  3S16 J;  3W6V A;  5IP6 A;  3LSP A;  1Y1W J;  4MLO A;  3CCY A;  4JX5 A;  4M6V A;  2XGD A;  4AYB N;  1IGN A;  3JRI A;  3JRC A;  4LOC A;  3ZQH A;  3HOZ J;  3VPR A;  2DMP A;  5FKN A;  3M3Y J;  2IEK A;  3M4O J;  3BQZ A;  3ZQL A;  2EZH A;  2R7Z J;  2K40 A;  2LP0 A;  4D7N A;  5C3E J;  2KT0 A;  2TCT A;  5K7H A;  1IRZ A;  3JRH A;  1I6H J;  2DA1 A;  1VF9 A;  5M5Y J;  2R5Z A;  2DJN A;  1BJZ A;  2ID6 A;  4MO7 A;  1P7J A;  2OPT A;  3QPS A;  2ECC A;  4X6A J;  2ELK A;  3GTP J;  4A3I J;  3MKL A;  4V2F A;  1XC5 A;  3DCF A;  2X9D A;  1MBE A;  1MSF C;  5FKM A;  4MIM A;  1PUF A;  1MBJ A;  1ZK8 A;  4EEF G;  2L0K A;  5M3M J;  3BR6 A;  2AO9 A;  2CUF A;  1MNM C;  2XPW A;  2IAI A;  2W48 A;  4FTH A;  5F08 A;  2N8G A;  1RES A;  5EG0 A;  1JT0 A;  4JX6 A;  3JR9 A;  5IP9 J;  2X6O A;  4FE7 A;  2HXO A;  2GBY A;  3GTQ J;  1VFC A;  3BR0 A;  1QVT A;  2DA7 A;  1XG1 A;  5HOD A;  3OSG A;  4A3L J;  5K7F A;  4FCY A;  1MBK A;  1JUM A;  2ME6 A;  2R93 J;  4DW6 A;  4UUS B;  3JRA A;  1I3Q J;  1NK3 P;  3HEF A;  1ZTR A;  1XS9 A;  2VPR A;  5JLX A;  2L7M P;  4V2G A;  4B3A A;  3BTJ A;  1HLV A;  1RPW A;  3BTI A;  3NAR A;  4A3M J;  2EH3 A;  4BY7 J;  1WGX A;  4BY1 J;  1IJW C;  1ETO A;  1GV2 A;  2LD5 A;  1JJ6 C;  1X58 A;  5DS9 A;  3GTK J;  1RKW A;  3G1M A;  2COB A;  1W0U A;  2HYJ A;  3B6A A;  1NTC A;  3GBG A;  2NVT J;  3QQA A;  1OCP A;  2M8G X;  3ZQC A;  1OCT C;  3BT9 A;  3JRD A;  1IG7 A;  4DYR A;  3HKZ N;  3BR1 A;  5M5X J;  1LE8 B;  5C4X J;  3S2H J;  1OFC X;  4MFE A;  3PO2 J;  3FIS A;  2D5V A;  3Q0W A;  5EZG A;  4BBS J;  1ZQ3 P;  1SAN A;  1FTT A;  1X2M A;  3JRB A;  3IH2 A;  1IC8 A;  4C3J J;  3PO3 J;  3MN2 A;  5F1J A;  2VKV A;  4FE4 A;  4CYC A;  3FIW A;  1MH4 A;  2ECB A;  1AU7 A;  3GTL J;  3FK6 A;  3S1R J;  4A3J J;  2GLO A;  2Y9Z A;  5EDN A;  1FJL A;  2IBD A;  1RKT A;  1RR7 A;  2JA8 J;  1E3O C;  1GUU A;  4XRS G;  4A3K J;  2VKE A;  2MG4 A;  4XID A;  3RQI A;  2CUE A;  1GV5 A;  4M3E A;  3IV5 A;  5J1U A;  5FKO A;  1QVU A;  4RBO A;  2DA4 A;  4JP0 A;  2DA3 A;  2M0C A;  3HM5 A;  3L1P A;  4D7M A;  3TP0 A;  5FKK A;  3HOW J;  2HOT A;  1ZKG A;  2JA6 J;  2WB1 N;  3LSJ A;  1APL C;  2CRG A;  1Z0X A;  2R92 J;  2CQX A;  3HOU J;  2JMW A;  1QPI A;  5F0H A;  2DMT A;  5M5W J;  4JYK A;  4C3H J;  4D5C A;  3ZQI A;  3B6C A;  3BTL A;  3RZD J;  1JUP A;  4Y52 J;  2X48 A;  1LFB A;  1O4X A;  5F27 A;  1K61 A;  2ZB9 A;  2E1O A;  1UMQ A;  5FLM J;  4XK4 A;  3HOV J;  4AC0 A;  1WPK A;  3HOX J;  5FLV A;  2OF7 A;  2M9H A;  2LR8 A;  4QSH A;  3RKQ A;  4A3D J;  1HDP A;  2LVS A;  2XGE A;  2I10 A;  1NK2 P;  3IH3 A;  3BG5 A;  2NS7 A;  2JA5 J;  2KDZ A;  5E3N A;  3LSR A;  3TW7 A;  3WHC A;  3H0G J;  3BR5 A;  5E3L A;  1YRN B;  3TP3 A;  1BA5 A;  3RZO J;  4DYQ A;  2DA2 A;  4UUS A;  4DZP A;  1ZR4 A;  2MW8 A;  1SFO J;  5GP9 A;  4ABZ A;  5C4J J;  5IYC J;  2AHQ A;  3BR2 A;  1FIA A;  1GT0 C;  2HOA A;  1JJ8 C;  1FTZ A;  4AUX A;  5F04 A;  1RET A;  2JJ7 A;  4IHV A;  4A93 J;  2EQR A;  2CU7 A;  3IH4 A;  1YRN A;  1TWA J;  2L9R A;  5EF6 A;  1FEX A;  3H3V K;  3GTJ J;  2O8K A;  1G2H A;  1ZGW A;  3FK7 A;  3I4M J;  3Q3S A;  3SJM A;  4M3G A;  3SFI A;  9ANT A;  3A02 A;  1ETQ A;  5IPA A;  1D5Y A;  1ETV A;  2Y31 A;  3HB9 A;  2H8R A;  4W1U A;  3A01 B;  3QPL A;  5BNG A;  3Q0V A;  3K2A A;  3ZQF A;  3S2D J;  1WI3 A;  1I50 J;  3E7L A;  1LE8 A;  1W0T A;  1ITY A;  1PUF B;  1LFU P;  2VI6 A;  1ZR2 A;  5M3F J;  4B1R A;  3HGG A;  1TC3 C;  1Z77 A;  1B8I B;  2E2J J;  5IOZ A;  3S14 J;  1QRY A;  3HBL A;  2GM4 A;  4M3F A;  3LOC A;  2VUM J;  2L7Z A;  4XRM A;  5EGO B;  3SDG A;  2XSD C;  1ORK A;  4GFB A;  2MSY A;  4I6Z A;  1B72 B;  1MBF A;  5EZH A;  2NVQ J;  1HF0 A;  1Y1V J;  4NDL A;  1TWG J;  2JN6 A;  2XB5 A;  4C3I J;  4RDU A;  2K9N A;  2LLK A;  1H8A C;  3A03 A;  4HNV A;  2R5Y A;  1IV6 A;  1F36 A;  2EZI A;  3BG9 A;  2R0Q C;  3GTG J;  3LNQ A;  2FQ4 A;  2ME0 A;  3HDD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...