3TEDA

Crystal structure of the chd1 dna-binding domain in complex with a dna duplex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
229
Chain Sequence
DMDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromo domain-containing protein 1
publication title DNA-binding domain of Chd1 in complex with a DNA duplex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 83
structure length 229
sequence length 261
ec nomenclature ec 3.6.4.-:
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3tedA02
3BR3A 1A5JA 3GTGJ 3TP3A 3O8GA 1MBGA 3JRAA 1QVTA 4M3EA 5M5XJ 2GBYA 3GTOJ 2LKXA 5EG0B 5IYDJ 3ZQCA 1DU6A 1ZK8A 1GVDA 2CJJA 3WHCA 3M3YJ 4LOCA 1T56A 4C3IJ 2R92J 5J1RA 4IHWA 2MG4A 3PM1A 4J19A 5J3LA 2FQ4A 2NVQJ 4AYBN 2K9NA 5M5WJ 1RR7A 1HDDC 3IV5A 4QIWN 3TW6A 3Q0UA 3UKGA 1WH5A 1GDTA 5J1YA 1H89C 3PO2J 2ECCA 1P7IA 2LK2A 2Y9ZA 3RZOJ 3JRCA 4IHYA 1WI3A 2R5ZB 2L0KA 3FIWA 1BA5A 5IYBJ 3JRDA 3FKIJ 2O7OA 2Y30A 2H8RA 3D1NI 2HQ5A 1AHDP 2WV1A 2HXOA 2XGCA 2HOTA 2JJ7A 2R7ZJ 5IOYA 5F27A 3K7AJ 2XPUA 3GTJJ 1Q1VA 3BG9A 2Y9YA 3Q3SA 4NDLA 1F43A 2E1OA 4V2FA 2VKEA 3S1RJ 3FK7A 1IG7A 1BW5A 2D5VA 4A3MJ 3BTIA 1MBHA 2R0QC 1F36A 2JA5J 2X9DA 1IDYA 3BTJA 4QTRA 4V2GA 4GFBA 1WH7A 2XSDC 1ITYA 1TWGJ 3Q0WA 2B63J 4C3HJ 1TWCJ 1GUUA 3BR6A 4A3CJ 3SDGA 4C2MJ 1ZTRA 1MSFC 3JR9A 1U8BA 5FLMJ 3GTKJ 2ELKA 3GTMJ 3B6AA 3HOZJ 1NTCA 3ZQGA 4M6VA 4UUSB 1YRNB 5F1JA 2W48A 3MN2A 1T33A 1VNDA 1APLC 2CQXA 2R93J 2FX0A 2HOAA 5C4XJ 2Y0SN 3E7LA 1MBEA 3WHBA 5EF6A 1W0UA 1UHSA 3H3VK 4X6AJ 1NK3P 1A6IA 4S0HB 4B1RA 5M3MJ 1LE8A 4A3KJ 3HGGA 1RKTA 3JRBA 1Z77A 5JLXA 3RZDJ 1IDZA 3H0GJ 1G2HA 1IGNA 3CQZJ 3MVPA 5HODA 4A3FJ 2GM4A 1ZKGA 3O8HA 1XS9A 2H1KA 4BKXA 4DYQA 3QPLA 2DMUA 2E2HJ 2EBIA 2VKVA 3IH4A 4CYCA 1MNMC 3BR2A 4AUXA 3HEFA 1MBJA 2QF7A 2HOSA 4M3DA 4DYCA 3FISA 5K7FA 2JMWA 1AKHA 3HOVJ 2XB5A 3MKLA 1HLVA 1B72B 2DMPA 1ETQA 3ZQFA 2M34A 3G1LA 1ORKA 1UG2A 4JX4A 2XB0X 2TRTA 4XRSA 5F0FA 1QRYA 3G1OA 2HDDA 2L7FP 3S1NJ 4DW6A 2KDZA 4M3GA 2HYJA 2DA5A 4IHVA 3JREA 2EZIA 1IJWC 2NVXJ 1JT6A 1HDPA 1QVUA 2NS7A 2WB1N 4Y52J 2I10A 3A02A 3TEDA 5IP7J 1K61A 4C3JJ 1TC3C 4RBOA 2ME6A 2XGEA 5GP9A 1K83J 3ZOBA 2L7ZA 3QQAA 1P7JA 3OOUA 3CMYA 2DA4A 3BR0A 1AU7A 5M3FJ 4RDUA 2R5YB 2M9HA 1NK2P 4XICA 3A01A 3C2BA 4JX5A 2WAQN 2M2EA 2MSYA 3GTQJ 3HM5A 2FJ1A 4UUTA 2FD5A 1PUFA 2COBA 3K2AA 1VI0A 3HGYA 2JA7J 1MBKA 5K7HA 3JRFA 1UMQA 1WPKA 2N8GA 4EEFG 3HOXJ 3HOUJ 5FKNA 9ANTA 1BW6A 3I4NJ 2DA7A 4IEJA 2MGQA 3IH2A 3BQYA 1LFBA 1IUFA 1H8AC 3GTPJ 2RAEA 4W1UA 3S1MJ 5EYRA 4FE4A 2ZB9A 2JA6J 3ZQHA 2P81A 3IH3A 3ZQLA 2MW8A 1WCMJ 3BTLA 1XG1A 4BY7J 2EH3A 2DA1A 3NARA 4M3FA 4DZPA 5FKLA 3ZQIA 1ZQ3P 3JRGA 2ID3A 3HOWJ 3S2DJ 1EF4A 4MFEA 1ETVA 3A03A 3HB9A 5J1UA 4I6ZA 4D7MA 1ZGWA 1Y1VJ 2DA3A 2K9QA 5EGOA 3VPRA 3GTLJ 3BQZA 1RETA 3BR5A 1H88C 4BBSJ 4BBRJ 5GPCA 5FKKA 4M3BA 4FISA 2XPVA 2YU9J 2YUSA 2Y31A 3F0CA 2QCOA 3S1QJ 1RPWA 1B8IA 1VFCA 2E2IJ 4G12A 2LFBA 3OSFA 5F08A 1HOMA 5IP6A 4X1EA 3OIOA 4I76A 5BNGA 4MO7A 1TWHJ 4A3EJ 2CUFA 2CQQA 1S7EA 1ZR4A 3S15J 2G0EA 4DYRA 2X6OA 1ENHA 4BXXJ 2LVSA 2ME0A 1E3OC 1BJZA 1MH4A 1HCRA 2TCTA 1JJ6C 5E3LA 2CU7A 2DMTA 1O4XA 1JT0A 2DN0A 2DJNA 5FLVA 2LD5A 5EG0A 5DS9A 3LSRA 2EZHA 1SANA 5F04A 4ABZA 3LNQA 1LE8B 1ETYA 4MLOA 1MBFA 3LSPA 3TP0A 4W97A 1JJ8C 1JKQC 2PMZN 3FK6A 5JLWA 3CCYA 4QSHA 1MH3A 4FTHA 1FIAA 2AO9A 2R5YA 2OF7A 4B4CA 4A3DJ 3DCFA 4CYCB 3W6VA 1X58A 2KT0A 2DMNA 1FTTA 1JTYA 2LY9A 1GT0C 3BTCA 4A93J 2EZKA 3TW7A 4AC0A 1ZR2A 1AKHB 4A69C 1JUPA 3M4OJ 2NVYJ 3HBLA 3HKZN 2R5ZA 1Y1WJ 3CDLA 3HOYJ 4FE7A 4DZJA 4JP0A 4XRMA 2K9SA 1U9NA 1I6HJ 2IAIA 3BG3A 5C4JJ 3S16J 2XRLA 3GBGA 4XRSG 2E19A 3LOCA 1TWAJ 1POGA 1OJLA 3PO3J 5IOZA 5E3MA 1IV6A 2NOGA 2LP0A 1VF9A 2DA6A 5E3NA 2NVTJ 4A3JJ 1JKRC 1OCPA 5F0HA 4D5CA 1OFCX 1FIPA 5EEAA 2K40A 2DA2A 1ETKA 2IBDA 2DTZA 4FCYA 1SFOJ 1IC8A 2CRGA 5K7ZA 3L1PA 1RESA 3QPSA 1RKWA 1ETOA 3A01B 5DTDA 5IP9J 3LSGA 1GV5A 1X2NA 5F0CA 1HF0A 5EZHA 2XGDA 4D7NA 2OPTA 4UUSA 1YRNA 2LR8A 1PUFB 5C44J 1OCTC 3SJMA 1JUMA 1I50J 1XC5A 2HXIA 3S14J 1MSEC 2E2JJ 4JX6A 2LLKA 2YS9A 1ETWA 1FTZA 2VUMJ 1JKOC 5EDNA 2ID6A 1LFUP 2JA8J 5IPAA 1WGXA 3OSGA 4XK4A 2M8GX 3S2HJ 4B3AA 1D5YA 2VPRA 2JK3A 4A3IJ 4A3BJ 5FKMA 5FJ8J 3JRHA 4Y7NJ 1GV2A 2M0CA 3HDDA 1U78A 3B6CA 1IRZA 1FEXA 3BT9A 2IEKA 3DEWA 4MFDA 4L5EA 2VI6A 1BL0A 2X48A 1U9OA 1JKPC 3BG5A 5C3EJ 1B72A 3G1MA 3RQIA 5EZGA 5EGOB 4A3GJ 1FJLA 1TWFJ 2NS8A 1I3QJ 2LTPA 1JTXA 3JRIA 2ECBA 2HI3A 3RKQA 4BY1J 2EZLA 2AHQA 3NAUA 2L9RA 4D5FA 5M5YJ 2O9LA 2L7MP 5E3OA 1ETXA 1JGGA 4MIMA 1W0TA 2JWTA 2GLOA 5IYCJ 1X2MA 3SFIA 2DMQA 1B8IB 1DU0A 3LSJA 3BR1A 2JN6A 2CUEA 4IHXA 4XIDA 3Q0VA 5GPAA 3I4MJ 1CQTA 1Z0XA 2EQRA 2Y2ZA 2O8KA 4A3LJ 5FKOA 1QPIA 1JUSA 4HNVA 1R9TJ 2XPWA 4JYKA 3S17J
chains in the Genus database with same CATH superfamily
4XRFA 2DT6A 2E7WA 3TQNA 1HW2A 2DXIA 3VYTB 1QVTA 4PSWA 4M9ZA 3HHGA 3FXLA 2QZ8A 4G6QA 5M5XJ 2GBYA 3DTIA 1Z91A 3K69A 4U88A 5EG0B 2OCEA 4G7HF 2DJIA 3ZQCA 2E35A 3DEUA 3DQVC 2K7LA 2XKOA 1MGTA 2H94A 4U0WA 1ZK8A 1TZLA 3VYSB 5F1RA 3MKYB 3WHCA 2X6XA 4C3IJ 1TP4A 5H6RA 2XRNA 4G6DA 4AWXB 1U6GA 1RR7A 4RM2A 3ELKA 2R7TA 4KT5C 1R58A 3OOPA 1WH5A 2QSFX 1ZG1A 3VWBA 3PO2J 2ECCA 2XUBA 2LK2A 5JI6A 4HW0A 2Y9ZA 1OCCH 1WI3A 4HSRA 1TQPA 3FIWA 3GCMA 2R7WA 4LG0A 2VONA 2F4OB 2Y30A 3HC7A 2V1NA 3D1NI 4M6YA 4LK1F 3R4KA 1T0FA 2XF7A 4ESFA 2OUMA 4KJZA 1T38A 2R7ZJ 5E20A 5F27A 3TGNA 2X6YA 4CCKA 4IL6C 1SVOA 3BG9A 1Y39A 3WTYC 3Q3SA 3ABMH 1MMNA 2VKEA 2BW3B 2HDCA 5CVJA 2BHYA 4XSXF 4DIQA 2CQKA 2EV5A 1MBHA 2DK5A 4G7ZF 1F36A 2JA5J 3BTJA 2EJRA 4V2GA 2M5WA 4XBFA 1CF7A 3VB2A 1XD7A 4OOIA 4ZYAA 3HOTA 3ERED 4XKBA 2DTRA 4C3HJ 1TWCJ 5LFAA 3DFGA 4LFUA 2EB7A 1ZTRA 1MSFC 3JR9A 3WTTC 1LDDA 5FLMJ 3HL2A 3GTKJ 5J6XA 4IHSA 2VC1A 1CGPA 2CWEA 1RZ4A 2WA0A 4UUSB 3LQQA 3X2QH 5IT3A 1T33A 3KIOA 4RAFA 3TMOA 5H2FC 3KYCB 4IF4A 2O03A 2ZKZA 4CCMA 3E7LA 4GO1A 2K3PA 3H3VK 4NNJA 5B1AH 3LFKA 3TO7A 3RZDJ 3H9QA 1IDZA 3F3XA 3HYIA 4KMFA 2LY2A 2LBFA 2ADUA 1WJ5A 1ZLKA 5TISC 2J5PA 2KLOA 1TW3A 1ZKGA 2H1KA 2ZNYA 3QPLA 2DMUA 3RPUA 3HRTA 5CPRB 4AD9A 1XGNA 2EBIA 1IRFA 2STWA 2ETHA 3KP6A 4CYCA 3J80K 3WG7H 4Q48A 5LD2C 2E5NA 3HEFA 1MBJA 2QF7A 5L3DA 2KISA 1Z7UA 2ZJRF 3FISA 5K7FA 2JMWA 4L0ZB 4PJLA 1N78A 4NC6A 3VDXA 1AA7A 5E1ZB 1WZ2A 4OWRB 2DMPA 1ETQA 2F2EA 4LK0F 3G1LA 2VXDA 1QQIA 4DBQA 3K10A 3ABKH 4JK1X 2DCEA 2E1MC 5BS6A 3DP7A 3V7RA 3FM3A 2HDDA 2K85A 1HXDA 2L7FP 3KP4A 3QYBA 3K70C 3C2HA 3T0YA 2A68F 3QU3A 3B73A 1HKTA 5F6FA 1DPRA 1IJWC 3I71A 2NVXJ 2HDWA 1FYLA 2I10A 1E17A 4FHTA 1K61A 4M74A 4BGDA 1MMDA 2UV1A 4EQQA 1K83J 3DPTA 3ZOBA 1WJBA 3QQAA 1MNEA 4S04A 3MZ8A 1XSDA 4I2OA 5M3FJ 4IQJA 1W4MA 2M9HA 2W25A 3LSTA 1USSA 4B3XA 2DQLA 2K4JA 1OYWA 3ONQA 3F8FA 4QWQA 5TGTA 2I5UA 4HV6A 2OQGA 3L09A 4HOBA 4CSWA 2RQQA 2ZXIA 1J2XA 3DBLB 3HGYA 3CJQB 4ESBA 1KQ9A 4KFCA 3HOXJ 4AIDA 2HNHA 2VJ4A 2LDUA 4ENKA 1LFBA 1H8AC 1EH6A 4W1UA 4FE4A 1YX5A 1X3WB 4YELA 4BU2A 2FSWA 3ZQHA 3F21A 2KP6A 2EWNA 1QBJA 2IT0A 2OTJI 2M8EA 4UB8C 3H92A 4P9FA 2ZJ2A 1XG1A 2EH3A 2LKSA 4M6XA 3FXOA 1TQMA 4QPQA 1R00A 1Z1DA 5FKLA 3S2DJ 3ZMDA 3WG9A 2VE8A 1ZRFA 3A03A 2IS2A 2LOOA 3DPUA 2EFQA 3KP2A 3HSRA 4LJZF 1ERDA 1Y1VJ 2DA3A 4CO8A 3JAMZ 3VPRA 1NG7A 2RKHA 3BQZA 4LG0B 1RETA 5EEHA 3RDIA 1FC3A 2OZUA 4OAZA 3L2UA 1D1BA 5HLHA 5HLTA 2QM3A 3BP8A 1PP8F 4HAMA 2XHKA 1H88C 3BG7A 3RKWA 2HTJA 2MLGA 2Z16A 1SAXA 2FOWA 2AXLA 1HW1A 2KPMA 4PFOA 2EFWA 4ENMA 4ZDPA 4ZTFA 4Q47A 1IO2A 4FISA 1LPQA 1R7JA 4E7JA 1K4SA 2Y31A 2JUGA 4HQEA 3J7YJ 3F0CA 1G4DA 4EMSA 3KEQA 3A0HC 2DO7A 3S1QJ 3MQ0A 1MKMA 4ANJA 2M30A 1J7KA 1R1UA 4G12A 3FXUA 2IXSA 3HZJA 4X1EA 3OIOA 5CVIA 4MO7A 2XAHA 4XM3A 4A0XA 4DGWB 2CQQA 4E7LA 2G0EA 2XROA 4DYRA 2Z33A 4BXXJ 3C2GA 3AAFA 1E3OC 1MH4A 1HCRA 4L0YB 4NC7A 1JJ6C 5E3LA 2CU7A 4GXOA 2DMTA 2CSOA 1T95A 2WAQA 3F9KA 1XSVA 3HPHA 3WTSC 1O4XA 4BQAA 2DN0A 5FLVA 5FROA 3FXRA 3E5XA 2G9WA 3IKTA 4ABZA 5ICFA 5D4RA 5D6FA 1MBFA 2LBFB 1JJ8C 2P6SA 4PGGA 3OYCA 4E6KG 1Z6RA 3R60A 3IHUA 1N25A 3CCYA 2FQ3A 1GXPA 2XAFA 3DWLE 4E7KA 1X19A 1MW7A 4FTHA 2R5YA 3CF5F 4B4CA 4A3DJ 2V1DA 4CYCB 3W6VA 1FTTA 1QPMA 3ZN0A 1DGWY 3BZKA 3VYRB 2VC0A 4M9XA 3JAMK 2LY9A 1XDUA 5AIQA 3BTCA 3KPHA 4A93J 3KE2A 1GXQA 3P9IA 1ZR2A 4U0YA 2EFOA 3HBLA 1ZAOA 3CO7C 1F9NA 4J01A 3M8JA 1U5TC 4JP0A 4Z6YA 2V6EA 3CUQC 4BXFA 3F8NA 3S16J 1XX5A 3GBGA 3IWFA 4CA0A 4XRSG 3ULQB 1TWAJ 2DU9A 2R7SA 4H4KC 1POGA 3PO3J 2IGKA 1UG0A 4RS8A 3AG4H 5E3MA 2L2OA 2L4MA 2LP0A 1SMYF 4B48A 5E3NA 1FBQA 5A2QK 1JKRC 5F0HA 4GGGA 2HGCA 1A6QA 3FDYA 4YIRX 1K79A 3L2CA 4FCYA 2IBDA 1IC8A 3K4NA 3LL7A 3PUFA 2VQCA 3QOPA 4XKCA 1I27A 2CRGA 1BC7C 3L2WA 1RESA 1FYMA 2A6HF 2R7QA 4LB6B 4F52A 4UUVA 4EGZA 1ETOA 2VB6A 5DTDA 5IP9J 3I55I 4IPAA 1G3YA 4HQMA 5EZHA 2DQRA 2XGDA 5FB2A 1YRNA 3K4JA 3J7ZI 2CW0F 2CW7A 1W5TA 1YW9A 2HU9A 5DV5A 5ILVA 1ULYA 3CLOA 3SEQA 1YI2I 1WJEA 1OCTC 1I50J 4I0AA 1XC5A 4NHJA 3ZMZA 2OV7A 4XONA 3S14J 1MSEC 3CTAA 1KQ0A 2MC3A 1ETWA 4HLXA 3GLXA 4BHBA 5B66C 2VUMJ 3IC7A 4F55A 1JKOC 1LFUP 3PL8A 2HYGD 4G94A 2VN2A 3L00A 2A05A 3NWSA 3AL0B 2Z9OA 1HSTA 2KZVA 3CF2A 1SFKA 3FM5A 1FOWA 2JK3A 2IA2A 2UUZA 2JRTA 3JRHA 3I58A 4L9NA 2IS4A 4CDGA 4H0EA 3ZN1A 1IRZA 3FBIB 3T8TA 2IEKA 3DEWA 3G2BA 4L5EA 3EUKL 2V4JC 3DTKA 1U9OA 3P5JA 1REPC 1JXSA 1IN6A 5C3EJ 2RNJA 1JE8A 2H27A 3G1MA 1FJLA 4TV7A 1K7AA 1J0RA 1TWFJ 1I3QJ 4KMUX 4CHUA 3RKXA 1LDKB 2DOAA 2HR3A 2P7CB 3JRIA 3HKZA 2X4HA 3U9GA 3OV8A 1D8KA 4IVNA 2F5CA 3QU6A 4R8HA 1DDNA 2NNYA 1ETXA 3RYPA 4ZZLA 1W0TA 1IN4A 4XKVA 1K6OA 4CYDA 5IYCJ 4P55A 1O3QA 1BN5A 3OYNA 2HTSA 2JN6A 2CUEA 2EA4A 3FXMA 5DDGA 1AOYA 2Y2ZA 5FKOA 4Y4RA 2NOJB 1SFUA 3J81K 1R9TJ 1DUXC 3ZMSA 4A6EA 3EUHC 3DEEA 4XN0A 2VJ5A 5HS8A 5ICGA 2VE9A 2MFZA 3O8GA 1MBGA 3JRAA 2HZDA 3FX3A 3PFYA 1EKEA 4M3EA 2COMA 4B8XA 2Z3YA 1LDJA 3GWZA 5TRDA 2PI0A 3MD2A 3MZHA 3O3KA 1GVDA 3HSFA 5E17F 3OR2C 2R92J 5J1RA 4IHWA 3W3CA 4C2TA 2DT7B 2E71A 2FQ4A 4E7SA 1K6YA 2NVQJ 4M73A 2ZSHB 1X1AA 1HDDC 3EETA 3IV5A 2ZXJA 2IS6A 1WKMA 1Y0UA 5CQGA 5HVQC 1XMXA 3UKGA 1OCRH 3DTEA 4GRIA 2XC7A 3FHNA 3W6KB 3JRCA 2BY3A 2BVLA 2ZO4A 2RV8A 4BQOA 4EJOA 1T08B 1FNNA 5CKTA 2VL8A 4FASD 3FMQA 3WTVC 3LSHA 2JJ7A 5D5UB 1K78A 3CCJI 3QPHA 2XPUA 4RB3C 2ZNZA 2XAQA 3I3LA 4PJMA 3FZVA 4E70A 2DOEA 3FK7A 5FLXK 2PQ8A 2D5VA 4A3MJ 3QP5A 3BTIA 2R0QC 2G7HA 1IDYA 4B09A 2O8XA 1LNWA 3BWGA 4ZJZA 2XSDC 2B63J 1EH8A 2D2WA 1YW8A 3SDGA 4C2MJ 1MDMA 4HZFA 2PJRA 1FMWA 2ELKA 3ABTA 3LQRA 1KZHA 1QHHD 2ZMEA 3ZQGA 2ACJA 2JTVA 1PDNC 1YRNB 1APLC 1MMGA 5GAEJ 2IGMA 2YX4A 4PDKA 2QGUA 2M1BA 2HOAA 2CFXA 1R36A 3WHBA 1UHSA 5DM7F 1C0WA 2OBPA 1NK3P 1W7PB 1Z3XA 4B1RA 5M3MJ 4OMZA 3JRBA 1FSHA 5GTHC 3H0GJ 1IGNA 4PK4A 2A61A 2DDBA 3MVPA 4BJ5C 4PGHA 4ZDLA 4DQ2A 3DBRB 3RJPA 2KRFA 3O8HA 1IUYA 2ESNA 3PIOF 3U21A 5E1XA 4BKXA 3V7CA 2BVMA 2CH0A 4A6DA 2E2HJ 1VQ9I 5JHUA 4RB0A 5LBQA 1VTNC 2E7XA 3BR2A 1WQ2A 2E60A 4RM3A 4DYCA 3FXJA 3L9FA 4NB5A 1J75A 4ETSA 3E6DA 1UELB 5FFXA 2PEXA 4GYGA 2L7KA 3ZQFA 2D1HA 2NNNA 5D5WB 1UG2A 4JX4A 3MKZA 2XB0X 4P1WA 2O5RA 2TRTA 2L9NA 5F0FA 4BACA 1EJ9A 3KLNA 2MYSA 4DW6A 2KDZA 1YE9A 2JPCA 4M3GA 2EA2A 2DA5A 2QBYA 5DD8A 4BH9A 4WXDA 1OYIA 1QVUA 2NS7A 1Y8RB 2ZXWH 3HPGA 3TEDA 1BBYA 5IP7J 1TC3C 4UNOA 4BDYA 3PQJA 2IRFG 4F3QA 5FD6A 5E8IA 4HF2A 3PIPF 3DLLF 2HKXA 1P7JA 3OOUA 2IP2A 3OYJA 2MH9A 3CMYA 1O3TA 2DA4A 3BR0A 5KVRA 2FNAA 3OIQA 4RDUA 1NK2P 2YPRA 5JHFA 2IS1A 5L3FA 4XICA 4IQ4A 3A01A 3C2BA 3RKYA 2EV6A 2WAQN 5D5XB 4LD5A 1ON2A 2FU4A 4KIFA 4WCGA 2M3AA 1ZRCA 5D8KB 1FP2A 3WU0A 3U2RA 1UAAA 3K2AA 1VI0A 2JA7J 2KJCA 3K4KA 5BPIA 1F5TA 1UFMA 2N8GA 3KZZA 2E5ZA 1R5GA 9ANTA 3E6MA 4IEJA 3WTZA 3IH2A 5L3GA 1FT9A 1T0FC 1IUFA 2PX9A 1YHQI 2RAEA 3GTPJ 1VQ7I 5EYRA 2X1EA 2M45A 4UB6C 1OMIA 2CG4A 2ZB9A 1B9NA 2A5YB 4WK8F 3TO6A 4M71A 2XAGA 2MBFA 2MW8A 1WCMJ 2HFHA 4JQFA 1N75A 4BY7J 3IRQA 2C6YA 4HEA2 1WRJA 4L5JA 1BC8C 3IAM2 3CLQA 3RYRA 4ZYDA 3E5QA 3WE3A 1R1TA 2P5KA 2E1CA 3HOWJ 4MFEA 1EF4A 4LITA 1MIJA 4D7MA 4BAYA 2LYCA 2K9QA 4CICA 2VQLA 1Y56A 1U2WA 4KN7X 3MCZA 1N77A 2WC2A 2QEXI 2DPDA 2KJBA 1FYKA 1ZARA 3N05A 2LF7A 1WI9A 1W36C 2P4WA 1I5ZA 3EDPA 4BBRJ 1K78B 1W5CC 3K1PA 4UV9A 5GPCA 4G6TB 5FKKA 5K5QA 4MNUA 3VFZA 3CC7I 5E8GA 2XPVA 2ZFUA 1ACIA 4IOAF 1FZPB 2QCOA 3E6BA 3PUBA 1B8IA 1UHWA 2JSPA 4G9YA 2LFBA 2W82A 2WB1A 4XSZF 2CUJA 3BDDA 2NRAC 5FRMA 4HV5A 1MDMB 3FXKA 3S15J 3ECHA 2PJRB 2ELJA 1S3JA 1B4AA 3SZGA 2ZMEB 4C9YA 2WAEA 1BJZA 2IGNA 1SC7A 2VBZA 2VKDA 2TCTA 1KQ8A 3KFWX 2BYVE 2WWYA 3CC4I 3OYMA 2XDVA 3V8LA 3A4CA 4UY8I 2LD5A 2L9VA 2WY8Q 3HHHA 5DS9A 3J7AY 2GXBA 3DKYA 2RREA 3V4GA 1ETYA 1JI8A 1FY7A 1QNTA 3ZMVA 1JKQC 3LSKA 5CVRA 3FK6A 5FGMA 1ZELA 3R6SA 5JLWA 4M72A 4QSHA 2HPIA 4HRIA 3PQKA 4BS9A 2VQHA 2BY1A 2CO5A 5GAHJ 2IVMA 5FD5A 4PCQA 3GLLA 4PUSA 1X58A 2KT0A 1YFHA 1QHGA 5FRNA 1I1SA 1GT0C 2VXZA 2P7VB 2YR2A 4LMYA 5IT9Z 4AC0A 1KGSA 1S7OA 3IL2A 2R5ZA 3HKZN 1LEBA 2AQFA 3CDLA 3ROUA 2PFBA 3REOA 1OCOH 2K9SA 4XRMA 1G3SA 4EM2A 2GA2A 2DFIA 5DUKA 5HNFA 2EK5A 4J00A 4AIJA 1P2FA 1ZLJA 3LOCA 2NXNB 2R3SA 1T8IA 2QBYB 4FETA 1OJLA 4XLAA 5J8CA 1IF1A 2VLAA 1MD0A 2V6CA 2Y48A 3ASOH 2Y69H 3LAPA 2RDPA 3MKWB 2DA6A 3ZCOA 4A3JJ 1OR7C 5D5VB 2ZXHA 4YFNF 2F4IA 1ZH5A 3BG6A 1ONVA 3VYUB 1BOAA 5CJ9A 4A5NA 5EEAA 2K40A 3LFUA 3I53A 5LGUA 1Z21A 2DTZA 1A36A 3AL0C 2JVGA 2WADA 5K7ZA 2FUG2 3L1PA 2JSCA 2K5CA 1RKWA 2FBHA 3M7GA 3V7SA 2EIMH 1V5FA 3A01B 3FKJA 2OZ6A 3T5XA 4MTDA 2X1CA 2OPTA 2A3SA 3L7WA 2OQRA 1R5HA 5LHGA 3N4MA 4NQWA 2EIKH 4XLCA 2ZCWA 4HSTA 1PYVA 1M1EB 1XSXA 2CS3A 2M7BA 3E3VA 3Q9VA 3CCRI 1F4KA 3EYIA 1R22A 3HSEA 3SJMA 3CCUI 1OCZH 3KCCA 3QRFF 4YG2F 5TJJA 4BQQA 4YFKF 2E2JJ 4JX6A 1R4NB 2HQAA 2V9PA 1V3FA 5K5OA 5ICEA 3SQNA 3GFLA 4NUBA 5IPAA 3IAS2 4OMYA 3S93A 2M8GX 4P9UA 2MA3A 3H3ZA 1H9TA 1D5YA 2VPRA 2HEOA 4CCJA 2CUZA 2RNGA 2H1LA 5DUIA 3MWMA 3CD6I 4Y7NJ 3HDDA 3OYBA 3ABLH 2ESHA 3B6CA 1CF7B 1FEXA 5H20A 3BT9A 4CCLA 4MFDA 2HOEA 2VI6A 2QQAA 2RC4A 3BG5A 2KDOA 3KZIC 1B72A 1QO0D 4EJWA 2P6TA 3GZ6A 4S05A 2LTPA 1IZ1A 2R4GA 4XKWA 2IPQX 3C18A 3BLYA 4EVIA 3RKQA 3SYTA 2AHQA 3VSLA 1JHFA 2L9RA 4RAZA 3ESWB 4FX4A 5M5YJ 1LJ9A 2O9LA 2XF6A 5E3OA 2Z5UA 1JGGA 1G3TA 1FMVA 2HVQA 2P8TA 4MIMA 4PFPA 2H8WA 2V1UA 3PSFA 1H0MA 1BI2A 2GLOA 4XMYA 1MJ9A 3IRRA 2BEOA 2Q1ZB 2YX7A 1B8IB 3DU5A 1DU0A 3LSJA 4RB1A 4G8XA 5GPAA 1Z67A 5J8FA 3I4MJ 1D3YA 2ZSIB 2KIMA 2HKOA 2H6BA 1FBSA 3PJRA 3MAJA 4A3LJ 1JUSA 2DLLA 2JPBA 2VQGA 5LHIA 5ED4A 1UZCA 1FP1D 4CGZA 3CCSI 3JSOA 4IOCF 2QENA 3OYGA 5BOXA 3S17J 3BR3A 5BQTA 1A5JA 4M9SA 5LGTA 3GTGJ 2UZKA 3TP3A 3Q9SA 2OTLI 3WGGA 2P5LC 3M9AA 3G6EI 5K1YA 2F6CA 1ZGJA 3DKXA 4MQ9F 1Y6IA 3A1YA 5D4SA 1DU6A 1FPQA 3HTSB 5KK1A 2FA5A 2DDAA 2IJLA 3S8PA 3M3YJ 1T56A 3OYIA 4UVBA 2MG4A 1LUJB 3PM1A 2J5OA 5J3LA 4LB5A 4LG3A 3PFIA 1LEAA 5M5WJ 2W1OA 1IRXA 5B1BH 4OAYA 4QIWN 4HX8A 3TW6A 2AS5F 1G3WA 1U5TA 4AIHA 4B44A 4E7HA 3I59A 1GDTA 1TLHB 2L9SA 5J1YA 1H89C 2B9SA 1DP7P 2VBYA 3KZYA 5CVUA 2KKOA 1MMSA 3CUQA 2GAUA 1J5YA 3CP2A 2E1MB 1JGSA 1HKSA 3S2WA 2R5ZB 3BOQA 5HDKA 1BA5A 5IYBJ 2DYRH 5K5RA 3JRDA 2O7OA 3FWEA 3H0DA 5DYMA 1VQMI 3W2WA 4XN3A 1KYZA 2HQ5A 1D0XA 2HXOA 4FX0A 1XDSA 5EJCA 2PLYA 4BL0B 2XGCA 2HOTA 2XVCA 5IOYA 3K7AJ 5KHDA 2EFPA 2MH2A 1WWXA 2BZTA 3CDHA 4EJUA 2Y9YA 1TL8A 2A69F 4IRHA 3R0JA 3KEYA 2E1OA 4XLFA 2GOXB 1F43A 4V2FA 3H5RA 1W5SA 3S1RJ 4PZJA 4RGSA 3TL4X 3GUDA 3H9JA 4QTRA 3CO6C 2V79A 1E3PA 3EYYA 3G4SI 2QVOA 1YX3A 2IA0A 3BR6A 3GF2A 4XLHA 4A3CJ 4YEJA 2XIGA 4II2A 5LEKA 2Q0OA 3GTMJ 3HOZJ 1NTCA 2OD5A 2K27A 4M6VA 5LRRA 4FQGA 3MN2A 3ZQ7A 4E7ZA 3ABUA 3LWFA 3FMRA 4I09A 4IKFA 4NQWB 2R93J 1SD6A 4HDVA 1YIJI 2QQ9A 2FX0A 3WTXC 2KQRA 3K4LA 4U0VA 4GDFA 2PMHA 1MBEA 3H36A 3CMMA 3UR3C 4Z2YA 3WU2C 4AVZA 1A6IA 3CCLI 1YW7A 3LSIA 4A3KJ 2W84A 1Z77A 5JLXA 4KIGA 4LLGF 3CQZJ 4AM3A 3P9CA 2RGVA 2V7FA 3M07A 2CYYA 3T8RA 1X3ZB 4K2EA 4XLEA 3VOEA 4A3FJ 3ISPA 1XS9A 1R23A 1RUNA 2UXXA 1YJ9I 1YO5C 4I7HA 3OL3A 4I98B 4KN4X 3IH4A 1TT5B 1BIBA 1SAUA 2STTA 4ENJA 1XB4A 4C30A 4AYBA 1FWZA 4A0YA 3I54A 5JVTA 1AKHA 5DEQA 1P4WA 2V26A 4KDPA 2XB5A 1HLVA 1B72B 2GZWA 1R71A 4HBLA 2QQ8A 3I9V2 2DFHA 2LREA 2M34A 4EV0A 4ITVA 1HKQA 2GWRA 3F8BA 4PSXA 2UWMA 1WSUA 4EJVA 2ISZA 3G1OA 2EILH 4RAGA 3WGIA 3S1NJ 2MD0A 3V8JA 5J4VA 1VQ4I 2BHZA 2KRHA 2EZIA 1V5GA 3GVAA 1E2XA 1G8XA 2WB1N 3CZ6A 3A02A 3RTRA 1WVRA 1MJBA 2PMUA 4ASNA 5B3SH 4C3JJ 4LIUA 1NG6A 4RBOA 2LF8A 3GFMA 1J09A 4B43A 2DAOA 1WJFA 2V9VA 1Y0NA 3M1CA 1AU7A 1XN7A 2R5YB 1OLTA 1HA8A 1XCVA 2W85A 3WU1B 4JX5A 1ZGAA 2VOOA 3WTWC 5AIPA 3GTQJ 2Z99A 2VKHA 3HM5A 3JSPA 1HC8A 4XL9A 5KCMA 3RPQA 2FD5A 1AWCA 2GIZA 1PUFA 3KP5A 1Z9CA 3KP3A 1MBKA 2W57A 5K7HA 1UMQA 3I56I 4EEFG 2NYXA 3HOUJ 1D0ZA 1VQKI 2V1XA 3BQYA 3H5AA 3S1MJ 2Y0SA 3NEUA 3BCAA 3BC8A 3GFJA 2JA6J 4II3A 3QAHA 5HLGA 2P81A 3ZQLA 2CV2A 1BI0A 2IW5A 4GCVA 4CCOA 5ILUA 1YLFA 2K9LA 3GYHX 2R7UA 2DA1A 3NARA 1YQAA 1Q1HA 4M3FA 1R6RA 4A0ZA 4RLFA 2W7NA 3K4MA 1ZQ3P 3JRGA 2ID3A 4Q5SF 3I59B 5AONA 2H09A 3HB9A 5J1UA 2JZYA 3CUQB 4ZC3A 1ZGWA 1XMAA 3BCBA 1W36D 3KX2A 4HPQA 1QU3A 3G3ZA 5EGOA 3GO5A 1FOYA 4G7OF 1P6RA 2ZMEC 5KAIC 1VZ0A 1L3LA 2FXAA 1UCRA 3FMSA 4OINF 5HOOA 3Q5FA 3KEOA 3O6BB 5L3EA 1BJAA 3V8KA 2L54A 1B9MA 4M3BA 1EH7A 3BJ6A 2JVHA 1BR4A 4PJ0C 2GOMA 5LHHA 2YU9J 2YUSA 4WXCA 3RPUD 2BXYA 4EGYA 4D9JA 2KMUA 4WX9A 1FLIA 1NHAA 4IZZA 2EPFA 2OA4A 3OMYA 1E0EA 1EV7A 5IY5H 3CUOA 3OSFA 1F1ZA 5F08A 1ZG5A 4I76A 4CUGA 3OYLA 3M8FA 4A3EJ 2CUFA 1S7EA 3CP8A 1FOKA 2NS0A 3I0TA 3B02A 3WODF 3ASNH 4X0GA 4XR6A 1ENHA 2F4MB 2ME0A 2XGXA 2L02A 1SVLA 2E36A 3KP7A 3KLOA 5JVGF 5CYVA 3O2PE 5FFZA 3C3WA 2Q8KA 4IJAA 1BM9A 1ZG3A 3LMMA 1JT0A 1YJWI 3HUGA 3H35A 5ILSA 1SANA 3MFKA 5F04A 1TW2A 1S7AA 4MLOA 2K3FA 6PAXA 4HF0A 3LSPA 1XMKA 4W97A 5ERIA 4CXFA 3GZ5A 4I02A 4C2UA 2A5WA 4HG2A 1MH3A 3AKZA 1FIAA 2AO9A 4BHCA 2B0LA 1MJAA 2RQPA 1FSEA 2LKPA 3HTUA 5D8LB 1V54H 1OISA 1D0YA 3OWTA 4AIKA 4N4NB 3PSIA 3G73A 1J59A 3CJTB 3M1EA 3TKYA 1AKHB 4ON0A 3BPVA 2AQEA 2V9KA 5DCFA 1SFXA 1Y1WJ 1E3HA 3D5SC 2ISYA 3HOYJ 4FE7A 1RIOH 4OU0A 1VQOI 2CW8A 2PBIA 1U9NA 1I6HJ 1STZA 3BG3A 3K2ZA 2KIFA 5C4JJ 4KUMA 2QKMB 1W1WE 2D45A 3BZCA 1O7FA 3NQOA 1IXCA 2A6TA 1TT0A 2DT5A 3H5NA 1Z7LA 5IOZA 1TBXA 3ZR8X 2NOGA 1KU7A 3MMYB 3CDIA 1X1CA 2NVTJ 4V19K 2B7EA 3ZGKA 1OCPA 4D5CA 4ENNA 1OFCX 4BJTA 4LGWA 2WBMA 4FT8A 1SFOJ 1ETKA 2LY1A 3F23A 4XORA 5J4YA 1I3AA 3J80Z 5GAGJ 3GZNB 3H3UA 3F22A 2HPMA 1GHCA 1LQ1A 2R7OA 4JOMA 2KL4A 1Z6TA 4LIVA 3LSGA 1X2NA 2KZGA 1HF0A 4WWCA 4D7NA 5HDNA 1QA6A 3RIRA 3VSKA 4D0PA 4D1QA 2HZTA 1PUFB 2BV6A 4MQVA 4JBAA 2JUCA 2DODA 3NRVA 1G59A 1JUMA 1X4PA 2X85A 4L5IA 4UVCA 1MMAA 1IN5A 2DFEA 2HS5A 3T1BA 3OYKA 3TOAA 1SVMA 2FOKA 5LLQA 2LLKA 5LRSA 5BPDA 2R7DA 2W4SA 3AG1H 2CV1A 2DW4A 2EIJH 1FOXA 5EDNA 2ID6A 2XV4S 2JA8J 3DXJF 1IXSB 3KYDB 3OSGA 4XK4A 3SHFA 1IN8A 4R1HA 2F48A 2PMZA 2R7VA 3OS0A 2CV0A 1ODDA 1P9QC 5FKMA 4A3BJ 3H1CA 3U1DA 1GV2A 2BXZA 2M0CA 3JTGA 4DOZA 5DM6F 4KNYA 2HVSA 1BL0A 3H9GA 2X48A 1JKPC 2VT2A 1KU3A 5EZGA 5EGOB 4BE2A 4F92B 4A3GJ 4CCNA 4ZZDA 2P5VA 3SXYA 4HNUA 4RMNA 2XASA 1BI3A 1Y8QB 1I39A 2R7RA 1JTXA 4ZYGA 3M8EA 3S3NA 2ECBA 1HQCA 1U3EM 2HI3A 2EZLA 3JCUC 3NAUA 4D5FA 4U87A 1MNDA 3DU6A 5CVVA 3TBIA 3RI4A 2FEZA 1RR8C 2I8DA 4OIRF 2O0YA 2XAJA 3R0AA 4HNTA 3GX4X 2WV0A 3PNYA 1IV8A 2JWTA 2FMLA 1S29A 1SMTA 1X2MA 3SFIA 2CQNA 3W6JB 3K4BA 2CGPA 2IA1A 1B6AA 4MEYF 1R5ID 4XIDA 4DBRA 2JRMA 4P96A 1TQIA 1X3UA 3HIFA 5FO5A 4AU7A 2O8KA 3OL4A 1QPIA 1D1CA 3BZ6A 4JYKA 2DI3A 3DLAA 1UHMA 2NVUB 2F5DA 1WHUA 2VT3A 3EPZA 1WJDA 3VEPA 4Y13A 4PJJA 3L2QA 1KA8A 5DCMA 4ZH4F 3CMEI 1IXRC 1LB2A 3GTOJ 3HUGB 1RNLA 2LKXA 1Z3YA 5IYDJ 2OJED 4XOTA 4F7ZA 4ZYHA 2X6WA 2OU2A 2A07F 5CQEA 3OS1A 4XOPA 1QZZA 3AFHA 5EEGA 2F5VA 2CJJA 4LOCA 4KYWA 4Q4ZF 2W24A 1X1DA 3CJRB 2OCCH 1VQLI 4J19A 1LVAA 1LKXA 3CCEI 3I5UA 5KAFC 1H9GA 2RN7A 4AYBN 3C1DA 2K9NA 2MLKA 4KT6A 5E79C 3S3MA 1VQPI 3TDUC 1WJAA 2FE3A 4XLNF 3MZYA 3Q0UA 4NC8A 2Z1DA 4RA2A 2CMPA 1VQNI 1P7IA 2QWWA 3RZOJ 5E1WA 4IHYA 2L0KA 3W2AA 3FKIJ 2KFDA 1V55H 2H8RA 1AHDP 3OYHA 2WV1A 1W7PD 4MEXF 1V4RA 2ZJPF 2X51A 1OR7A 3LA3A 1S8NA 4HA8A 3RSNA 3GTJJ 1Q1VA 1V5EA 3SZPA 2L4AA 3LSMA 4BEHA 5GADJ 3L2RA 4NDLA 1YITI 2M0MA 2R7XA 3NWTA 1RUOA 1IG7A 2LMDA 1BW5A 2Z2SB 3FF5A 1OYYA 3TDZC 1T39A 1O57A 2X9DA 1U8RA 3HRUA 3OYDA 4GFBA 5D6EA 1WH7A 2WAFA 1ITYA 2LRDA 3HOSA 1TWGJ 3Q0WA 1UB9A 2BOLA 1QZYA 1GUUA 4I99C 1NH3A 2P0WA 5JR3A 4CH7A 4CZCA 1U8BA 5IT9K 3QYFA 2HWVA 1U0JA 4GYIA 3B6AA 5J40A 2FF4A 3BJOA 2O6GE 5F1JA 2W48A 1VNDA 1R49A 3V42A 2CQXA 1IRGA 3U1KA 5C4XJ 1I1GA 2Y0SN 4ZTJA 5EF6A 1W0UA 4X6AJ 4S0HB 1LE8A 2K9MA 2VASA 2M4KA 3HGGA 1RKTA 4A2UA 2JQ7A 1G2HA 3VODA 3I4PA 4N4OB 4YIIA 1OQYA 2BE5F 4HX7A 5HODA 5HNHA 1O7LA 4OIOF 4ZDOA 2E1NA 2LG4A 4HYEA 2GM4A 2FNPA 1B59A 5A2QZ 2DK8A 4DYQA 5CLSA 5F64A 4KA4A 2GXGA 2VKVA 3AG3H 4HF1A 1FX7A 1MNMC 4AUXA 4BE1A 2DOFA 2HOSA 3E1SA 4M3DA 4Y15A 1A31A 3L2VA 3ZPLA 1QZEA 3HOVJ 2EFNA 2HQNA 3MKLA 1TTYA 3LAJA 1G6NA 2O61A 1ORKA 3GMEA 2IGOA 4OIPF 1P4XA 3ECOA 1K4TA 4EATA 2F5EA 4XNFA 1P4AA 4XRSA 5ICCA 3KETA 1QRYA 3K9TA 2ELHA 3EUAA 2HYJA 4QLCU 5BMZA 4IHVA 3OYAA 1BI1A 2OAZA 2VPLA 3JREA 4EM1A 4KISA 2M7AA 4KIBA 4EJTA 1JT6A 1HDPA 3ZRGA 3ZXSA 4Y52J 2XKPA 1DQUA 4UXNA 3LA2A 1DPUA 2ME6A 2XGEA 3HG9A 3QPTA 3CESA 5GP9A 3OY9A 2L7ZA 1QGPA 2KIQA 3E5UA 3WE2A 1IAWA 3ERMA 4OIQF 3SFZA 1XPXA 1BR2A 2M2EA 2MSYA 3W2VA 2XF5A 2FJ1A 5H6QA 1S9HA 4BJ6C 4RGRA 4UUTA 1IN7A 3IKVA 2VOPA 2BY2A 1FBUA 2COBA 3F8MA 4U7BA 1S72I 4AVPA 2OC6A 1IW7F 5DCMB 2EV0A 1YS6A 3DPLC 4IRGA 3JRFA 1WPKA 3J7AO 3DV8A 5FKNA 3RCOA 3K1MA 1BW6A 3I4NJ 2DA7A 1XTAA 2MGQA 2QSHX 4P5OA 4RGUA 1LVKA 5LEJA 4Y3OA 3CMAI 3F6VA 2DBBA 1UJ8A 1T2KA 1HBXG 4O6JA 3OYEA 3IH3A 4L9JA 1ZN2A 3IWZA 2TDXA 3BTLA 4YFXF 1A04A 5LGNA 1D5VA 2QKLB 2HVRA 3P9KA 3RQ4A 1RRJA 4DZPA 1PUEE 4LLLA 3ZQIA 3F6OA 2BGCA 2VBWA 2VJJA 3GXOA 4CZZA 3CCQI 3FXQA 1ETVA 4F91B 4I6ZA 2A6EF 1DGRM 1Z05A 3J81Z 1YIOA 2D1VA 3QOEA 4A5MA 3GTLJ 1B1BA 2PG4A 2Y0MA 3BR5A 1WFXA 1HW5A 4NBQA 4YRVA 4L9TA 3SEZA 3UNGC 3GEZA 4A12A 2GA1A 4LLNA 1W7PA 1VQ8I 4Y33A 4BBSJ 1O3RA 2XSJC 2RVCA 2LC2A 2BY0A 2VJIA 2L3DA 4BEHB 2UXNA 3F8CA 4RAYA 2FMYA 2WTEA 2R7FA 5L3CA 3ZQQA 3COAC 1L0OC 5KNLA 2JT1A 5HLIA 1RPWA 1VFCA 2E2IJ 4I0BA 1S5LC 1BR1A 2FBIA 1HOMA 5IP6A 4RLQA 5BNGA 1TWHJ 2CQ7A 1ZYRF 4E7IA 1ZR4A 3BY6A 1VQ5I 2L5QA 2YSRA 2Q2EA 4KITB 2X6OA 4U7DA 2LVSA 2X1DA 4HX4A 2ICWG 3TO9A 2F5FA 4RB2C 5L3BA 1KU9A 1TNSA 2WY7Q 3E97A 4BDZA 3EQLF 1R1VA 2G7UA 2DJNA 2PN6A 1KONA 4R79A 4IX7A 5EG0A 4WXHA 3FHZA 3CC2I 2X0LA 2L01A 3LSRA 2EZHA 4BQNA 3OS2A 1LE8B 3LNQA 2QLZA 4BXUA 1PJRA 4N9HA 3DBHB 1X1PA 4IO9F 3TP0A 2PMZN 3GW2A 2QQBA 3PNVA 1OPCA 1SFEA 4BE0A 1SD4A 2H6CA 3HRSA 3P7NA 5FLXZ 3CCMI 3BJAA 2VIXA 1KU2A 2LSOA 3CJNA 2O3FA 1BOBA 2OF7A 1ZRDA 4L18B 4MHGA 1P92A 3DCFA 2NAZA 4WF2A 2ZC2A 2DMNA 3F72A 4ZYEA 2KRCA 1JTYA 3EUHA 2W00A 1XGMA 2EZKA 3TW7A 1USTA 3M4OJ 4A69C 1JUPA 2GIVA 2NVYJ 3SDBA 3LA7A 1BIAA 4DZJA 1GVJA 1S6LA 3K0LA 2BBYA 2Y75A 3E0JB 1YS7A 3ZMTA 2IAIA 1WJCA 4QPOA 1RC9A 2AXTC 4KICA 3TOBA 4BUPA 2GQQA 2XRLA 3PNTA 5J47A 2XAUA 3K1NA 2E19A 4XLPF 3MEXA 2E34A 3WGHA 1YJNI 1SEUA 1YYVA 2PJPA 3A2KA 3K6GA 2BW3A 5HS9A 2VBXA 4XQFA 1IV6A 1LFPA 2MC4A 3S32A 2DFFA 1VF9A 3OIPA 3A0BC 3ZP5A 1FIPA 4MTEA 1EA3A 1JHHA 1VQ6I 3KYLA 2DA2A 1J9IA 2QA4I 3N97A 1YTYA 3I64A 3CCVI 4IXAA 1TNTA 3DF8A 3QPSA 5JFRA 2QUFA 2QYOA 1U5TB 3D5LA 3ZMUA 1GV5A 3HRMA 5F0CA 1T98A 2K4BA 5DD4A 4UUSA 5HDGA 4BNCA 2LR8A 1MZBA 4PJNA 3WTUC 2FRHA 1DP3A 4RGXA 4N0BA 5C44J 4YIFA 3OYFA 3HXLA 3SZTA 4HDUA 5E18F 2HXIA 1ZREA 2CFOA 4N9IA 3C7JA 2DYSH 2YS9A 1GLNA 1T6SA 3BPXA 3HJEA 1D1AA 2KIUA 3QODA 1FTZA 4IRIA 1XGSA 3DKWA 4L9VA 5B5EC 4I01A 3QP6A 3G71I 4UVAA 4BHPA 4Y17A 1O3SA 1WGXA 1XCBA 1A35A 4UV8A 3S2HJ 4B3AA 2ZBKA 4HLYA 2YU3A 2DPUA 1ON1A 4EM0B 4UHTA 3E6CC 4A3IJ 5FJ8J 1X4OA 2K86A 2GXAA 2LH9A 1U78A 2VODA 3D0SA 4O5VA 3ML6A 4BYYA 2M4GA 4E4HA 3S3OA 2KHMA 3RQIA 3QWLA 3AG2H 1PVEA 1PP7U 5HS7A 2NS8A 3JTHA 3FBNB 1KYWA 1SD7A 2JA2A 2K02A 2MD5A 1X1BA 4BY1J 4DNCA 4IHTA 1SD5A 3QYEA 1YG2A 2LNBA 3JW4A 3IUOA 2L7MP 3IP4B 3D5RC 4B47A 5GTIC 4MGRA 4ESJA 1I6XA 2ZJQF 3K4CA 2FBKA 1HSJA 3R61A 1R4MB 2DMQA 2QSGX 2M87A 3BR1A 1XGOA 4IHXA 1YOVB 2HYFA 3Q0VA 3GFIA 1OKRA 4DJAA 2ZFWA 3OR1C 4F93B 1Z0XA 1CQTA 2EQRA 4O3MA 3K70D 4HNVA 2EINH 2XPWA 2Q2EB 3BROA 2MABA 2HQRA 1D8JA 1ZHFA 1RI7A
chains in the Genus database with same CATH topology
3BR3A 1A5JA 3GTGJ 3TP3A 3O8GA 1MBGA 3JRAA 1QVTA 4M3EA 5M5XJ 2GBYA 3GTOJ 2LKXA 5EG0B 5IYDJ 3ZQCA 1DU6A 1ZK8A 1GVDA 2CJJA 3WHCA 3M3YJ 4LOCA 1T56A 4C3IJ 2R92J 5J1RA 4IHWA 2MG4A 3PM1A 4J19A 5J3LA 2FQ4A 2NVQJ 4AYBN 2K9NA 5M5WJ 1RR7A 1HDDC 3IV5A 4QIWN 3TW6A 3Q0UA 3UKGA 1WH5A 1GDTA 5J1YA 1H89C 3PO2J 2ECCA 1P7IA 2LK2A 2Y9ZA 3RZOJ 3JRCA 4IHYA 1WI3A 2R5ZB 2L0KA 3FIWA 1BA5A 5IYBJ 3JRDA 3FKIJ 2O7OA 2Y30A 2H8RA 3D1NI 2HQ5A 1AHDP 2WV1A 2HXOA 2XGCA 2HOTA 2JJ7A 2R7ZJ 5IOYA 5F27A 3K7AJ 2XPUA 3GTJJ 1Q1VA 3BG9A 2Y9YA 3Q3SA 4NDLA 1F43A 2E1OA 4V2FA 2VKEA 3S1RJ 3FK7A 1IG7A 1BW5A 2D5VA 4A3MJ 3BTIA 1MBHA 2R0QC 1F36A 2JA5J 2X9DA 1IDYA 3BTJA 4QTRA 4V2GA 4GFBA 1WH7A 2XSDC 1ITYA 1TWGJ 3Q0WA 2B63J 4C3HJ 1TWCJ 1GUUA 3BR6A 4A3CJ 3SDGA 4C2MJ 1ZTRA 1MSFC 3JR9A 1U8BA 5FLMJ 3GTKJ 2ELKA 3GTMJ 3B6AA 3HOZJ 1NTCA 3ZQGA 4M6VA 4UUSB 1YRNB 5F1JA 2W48A 3MN2A 1T33A 1VNDA 1APLC 2CQXA 2R93J 2FX0A 2HOAA 5C4XJ 2Y0SN 3E7LA 1MBEA 3WHBA 5EF6A 1W0UA 1UHSA 3H3VK 4X6AJ 1NK3P 1A6IA 4S0HB 4B1RA 5M3MJ 1LE8A 4A3KJ 3HGGA 1RKTA 3JRBA 1Z77A 5JLXA 3RZDJ 1IDZA 3H0GJ 1G2HA 1IGNA 3CQZJ 3MVPA 5HODA 4A3FJ 2GM4A 1ZKGA 3O8HA 1XS9A 2H1KA 4BKXA 4DYQA 3QPLA 2DMUA 2E2HJ 2EBIA 2VKVA 3IH4A 4CYCA 1MNMC 3BR2A 4AUXA 3HEFA 1MBJA 2QF7A 2HOSA 4M3DA 4DYCA 3FISA 5K7FA 2JMWA 1AKHA 3HOVJ 2XB5A 3MKLA 1HLVA 1B72B 2DMPA 1ETQA 3ZQFA 2M34A 3G1LA 1ORKA 1UG2A 4JX4A 2XB0X 2TRTA 4XRSA 5F0FA 1QRYA 3G1OA 2HDDA 2L7FP 3S1NJ 4DW6A 2KDZA 4M3GA 2HYJA 2DA5A 4IHVA 3JREA 2EZIA 1IJWC 2NVXJ 1JT6A 1HDPA 1QVUA 2NS7A 2WB1N 4Y52J 2I10A 3A02A 3TEDA 5IP7J 1K61A 4C3JJ 1TC3C 4RBOA 2ME6A 2XGEA 5GP9A 1K83J 3ZOBA 2L7ZA 3QQAA 1P7JA 3OOUA 3CMYA 2DA4A 3BR0A 1AU7A 5M3FJ 4RDUA 2R5YB 2M9HA 1NK2P 4XICA 3A01A 3C2BA 4JX5A 2WAQN 2M2EA 2MSYA 3GTQJ 3HM5A 2FJ1A 4UUTA 2FD5A 1PUFA 2COBA 3K2AA 1VI0A 3HGYA 2JA7J 1MBKA 5K7HA 3JRFA 1UMQA 1WPKA 2N8GA 4EEFG 3HOXJ 3HOUJ 5FKNA 9ANTA 1BW6A 3I4NJ 2DA7A 4IEJA 2MGQA 3IH2A 3BQYA 1LFBA 1IUFA 1H8AC 3GTPJ 2RAEA 4W1UA 3S1MJ 5EYRA 4FE4A 2ZB9A 2JA6J 3ZQHA 2P81A 3IH3A 3ZQLA 2MW8A 1WCMJ 3BTLA 1XG1A 4BY7J 2EH3A 2DA1A 3NARA 4M3FA 4DZPA 5FKLA 3ZQIA 1ZQ3P 3JRGA 2ID3A 3HOWJ 3S2DJ 1EF4A 4MFEA 1ETVA 3A03A 3HB9A 5J1UA 4I6ZA 4D7MA 1ZGWA 1Y1VJ 2DA3A 2K9QA 5EGOA 3VPRA 3GTLJ 3BQZA 1RETA 3BR5A 1H88C 4BBSJ 4BBRJ 5GPCA 5FKKA 4M3BA 4FISA 2XPVA 2YU9J 2YUSA 2Y31A 3F0CA 2QCOA 3S1QJ 1RPWA 1B8IA 1VFCA 2E2IJ 4G12A 2LFBA 3OSFA 5F08A 1HOMA 5IP6A 4X1EA 3OIOA 4I76A 5BNGA 4MO7A 1TWHJ 4A3EJ 2CUFA 2CQQA 1S7EA 1ZR4A 3S15J 2G0EA 4DYRA 2X6OA 1ENHA 4BXXJ 2LVSA 2ME0A 1E3OC 1BJZA 1MH4A 1HCRA 2TCTA 1JJ6C 5E3LA 2CU7A 2DMTA 1O4XA 1JT0A 2DN0A 2DJNA 5FLVA 2LD5A 5EG0A 5DS9A 3LSRA 2EZHA 1SANA 5F04A 4ABZA 3LNQA 1LE8B 1ETYA 4MLOA 1MBFA 3LSPA 3TP0A 4W97A 1JJ8C 1JKQC 2PMZN 3FK6A 5JLWA 3CCYA 4QSHA 1MH3A 4FTHA 1FIAA 2AO9A 2R5YA 2OF7A 4B4CA 4A3DJ 3DCFA 4CYCB 3W6VA 1X58A 2KT0A 2DMNA 1FTTA 1JTYA 2LY9A 1GT0C 3BTCA 4A93J 2EZKA 3TW7A 4AC0A 1ZR2A 1AKHB 4A69C 1JUPA 3M4OJ 2NVYJ 3HBLA 3HKZN 2R5ZA 1Y1WJ 3CDLA 3HOYJ 4FE7A 4DZJA 4JP0A 4XRMA 2K9SA 1U9NA 1I6HJ 2IAIA 3BG3A 5C4JJ 3S16J 2XRLA 3GBGA 4XRSG 2E19A 3LOCA 1TWAJ 1POGA 1OJLA 3PO3J 5IOZA 5E3MA 1IV6A 2NOGA 2LP0A 1VF9A 2DA6A 5E3NA 2NVTJ 4A3JJ 1JKRC 1OCPA 5F0HA 4D5CA 1OFCX 1FIPA 5EEAA 2K40A 2DA2A 1ETKA 2IBDA 2DTZA 4FCYA 1SFOJ 1IC8A 2CRGA 5K7ZA 3L1PA 1RESA 3QPSA 1RKWA 1ETOA 3A01B 5DTDA 5IP9J 3LSGA 1GV5A 1X2NA 5F0CA 1HF0A 5EZHA 2XGDA 4D7NA 2OPTA 4UUSA 1YRNA 2LR8A 1PUFB 5C44J 1OCTC 3SJMA 1JUMA 1I50J 1XC5A 2HXIA 3S14J 1MSEC 2E2JJ 4JX6A 2LLKA 2YS9A 1ETWA 1FTZA 2VUMJ 1JKOC 5EDNA 2ID6A 1LFUP 2JA8J 5IPAA 1WGXA 3OSGA 4XK4A 2M8GX 3S2HJ 4B3AA 1D5YA 2VPRA 2JK3A 4A3IJ 4A3BJ 5FKMA 5FJ8J 3JRHA 4Y7NJ 1GV2A 2M0CA 3HDDA 1U78A 3B6CA 1IRZA 1FEXA 3BT9A 2IEKA 3DEWA 4MFDA 4L5EA 2VI6A 1BL0A 2X48A 1U9OA 1JKPC 3BG5A 5C3EJ 1B72A 3G1MA 3RQIA 5EZGA 5EGOB 4A3GJ 1FJLA 1TWFJ 2NS8A 1I3QJ 2LTPA 1JTXA 3JRIA 2ECBA 2HI3A 3RKQA 4BY1J 2EZLA 2AHQA 3NAUA 2L9RA 4D5FA 5M5YJ 2O9LA 2L7MP 5E3OA 1ETXA 1JGGA 4MIMA 1W0TA 2JWTA 2GLOA 5IYCJ 1X2MA 3SFIA 2DMQA 1B8IB 1DU0A 3LSJA 3BR1A 2JN6A 2CUEA 4IHXA 4XIDA 3Q0VA 5GPAA 3I4MJ 1CQTA 1Z0XA 2EQRA 2Y2ZA 2O8KA 4A3LJ 5FKOA 1QPIA 1JUSA 4HNVA 1R9TJ 2XPWA 4JYKA 3S17J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BR3 A;  1A5J A;  3GTG J;  3TP3 A;  3O8G A;  1MBG A;  3JRA A;  1QVT A;  4M3E A;  5M5X J;  2GBY A;  3GTO J;  2LKX A;  5EG0 B;  5IYD J;  3ZQC A;  1DU6 A;  1ZK8 A;  1GVD A;  2CJJ A;  3WHC A;  3M3Y J;  4LOC A;  1T56 A;  4C3I J;  2R92 J;  5J1R A;  4IHW A;  2MG4 A;  3PM1 A;  4J19 A;  5J3L A;  2FQ4 A;  2NVQ J;  4AYB N;  2K9N A;  5M5W J;  1RR7 A;  1HDD C;  3IV5 A;  4QIW N;  3TW6 A;  3Q0U A;  3UKG A;  1WH5 A;  1GDT A;  5J1Y A;  1H89 C;  3PO2 J;  2ECC A;  1P7I A;  2LK2 A;  2Y9Z A;  3RZO J;  3JRC A;  4IHY A;  1WI3 A;  2R5Z B;  2L0K A;  3FIW A;  1BA5 A;  5IYB J;  3JRD A;  3FKI J;  2O7O A;  2Y30 A;  2H8R A;  3D1N I;  2HQ5 A;  1AHD P;  2WV1 A;  2HXO A;  2XGC A;  2HOT A;  2JJ7 A;  2R7Z J;  5IOY A;  5F27 A;  3K7A J;  2XPU A;  3GTJ J;  1Q1V A;  3BG9 A;  2Y9Y A;  3Q3S A;  4NDL A;  1F43 A;  2E1O A;  4V2F A;  2VKE A;  3S1R J;  3FK7 A;  1IG7 A;  1BW5 A;  2D5V A;  4A3M J;  3BTI A;  1MBH A;  2R0Q C;  1F36 A;  2JA5 J;  2X9D A;  1IDY A;  3BTJ A;  4QTR A;  4V2G A;  4GFB A;  1WH7 A;  2XSD C;  1ITY A;  1TWG J;  3Q0W A;  2B63 J;  4C3H J;  1TWC J;  1GUU A;  3BR6 A;  4A3C J;  3SDG A;  4C2M J;  1ZTR A;  1MSF C;  3JR9 A;  1U8B A;  5FLM J;  3GTK J;  2ELK A;  3GTM J;  3B6A A;  3HOZ J;  1NTC A;  3ZQG A;  4M6V A;  4UUS B;  1YRN B;  5F1J A;  2W48 A;  3MN2 A;  1T33 A;  1VND A;  1APL C;  2CQX A;  2R93 J;  2FX0 A;  2HOA A;  5C4X J;  2Y0S N;  3E7L A;  1MBE A;  3WHB A;  5EF6 A;  1W0U A;  1UHS A;  3H3V K;  4X6A J;  1NK3 P;  1A6I A;  4S0H B;  4B1R A;  5M3M J;  1LE8 A;  4A3K J;  3HGG A;  1RKT A;  3JRB A;  1Z77 A;  5JLX A;  3RZD J;  1IDZ A;  3H0G J;  1G2H A;  1IGN A;  3CQZ J;  3MVP A;  5HOD A;  4A3F J;  2GM4 A;  1ZKG A;  3O8H A;  1XS9 A;  2H1K A;  4BKX A;  4DYQ A;  3QPL A;  2DMU A;  2E2H J;  2EBI A;  2VKV A;  3IH4 A;  4CYC A;  1MNM C;  3BR2 A;  4AUX A;  3HEF A;  1MBJ A;  2QF7 A;  2HOS A;  4M3D A;  4DYC A;  3FIS A;  5K7F A;  2JMW A;  1AKH A;  3HOV J;  2XB5 A;  3MKL A;  1HLV A;  1B72 B;  2DMP A;  1ETQ A;  3ZQF A;  2M34 A;  3G1L A;  1ORK A;  1UG2 A;  4JX4 A;  2XB0 X;  2TRT A;  4XRS A;  5F0F A;  1QRY A;  3G1O A;  2HDD A;  2L7F P;  3S1N J;  4DW6 A;  2KDZ A;  4M3G A;  2HYJ A;  2DA5 A;  4IHV A;  3JRE A;  2EZI A;  1IJW C;  2NVX J;  1JT6 A;  1HDP A;  1QVU A;  2NS7 A;  2WB1 N;  4Y52 J;  2I10 A;  3A02 A;  3TED A;  5IP7 J;  1K61 A;  4C3J J;  1TC3 C;  4RBO A;  2ME6 A;  2XGE A;  5GP9 A;  1K83 J;  3ZOB A;  2L7Z A;  3QQA A;  1P7J A;  3OOU A;  3CMY A;  2DA4 A;  3BR0 A;  1AU7 A;  5M3F J;  4RDU A;  2R5Y B;  2M9H A;  1NK2 P;  4XIC A;  3A01 A;  3C2B A;  4JX5 A;  2WAQ N;  2M2E A;  2MSY A;  3GTQ J;  3HM5 A;  2FJ1 A;  4UUT A;  2FD5 A;  1PUF A;  2COB A;  3K2A A;  1VI0 A;  3HGY A;  2JA7 J;  1MBK A;  5K7H A;  3JRF A;  1UMQ A;  1WPK A;  2N8G A;  4EEF G;  3HOX J;  3HOU J;  5FKN A;  9ANT A;  1BW6 A;  3I4N J;  2DA7 A;  4IEJ A;  2MGQ A;  3IH2 A;  3BQY A;  1LFB A;  1IUF A;  1H8A C;  3GTP J;  2RAE A;  4W1U A;  3S1M J;  5EYR A;  4FE4 A;  2ZB9 A;  2JA6 J;  3ZQH A;  2P81 A;  3IH3 A;  3ZQL A;  2MW8 A;  1WCM J;  3BTL A;  1XG1 A;  4BY7 J;  2EH3 A;  2DA1 A;  3NAR A;  4M3F A;  4DZP A;  5FKL A;  3ZQI A;  1ZQ3 P;  3JRG A;  2ID3 A;  3HOW J;  3S2D J;  1EF4 A;  4MFE A;  1ETV A;  3A03 A;  3HB9 A;  5J1U A;  4I6Z A;  4D7M A;  1ZGW A;  1Y1V J;  2DA3 A;  2K9Q A;  5EGO A;  3VPR A;  3GTL J;  3BQZ A;  1RET A;  3BR5 A;  1H88 C;  4BBS J;  4BBR J;  5GPC A;  5FKK A;  4M3B A;  4FIS A;  2XPV A;  2YU9 J;  2YUS A;  2Y31 A;  3F0C A;  2QCO A;  3S1Q J;  1RPW A;  1B8I A;  1VFC A;  2E2I J;  4G12 A;  2LFB A;  3OSF A;  5F08 A;  1HOM A;  5IP6 A;  4X1E A;  3OIO A;  4I76 A;  5BNG A;  4MO7 A;  1TWH J;  4A3E J;  2CUF A;  2CQQ A;  1S7E A;  1ZR4 A;  3S15 J;  2G0E A;  4DYR A;  2X6O A;  1ENH A;  4BXX J;  2LVS A;  2ME0 A;  1E3O C;  1BJZ A;  1MH4 A;  1HCR A;  2TCT A;  1JJ6 C;  5E3L A;  2CU7 A;  2DMT A;  1O4X A;  1JT0 A;  2DN0 A;  2DJN A;  5FLV A;  2LD5 A;  5EG0 A;  5DS9 A;  3LSR A;  2EZH A;  1SAN A;  5F04 A;  4ABZ A;  3LNQ A;  1LE8 B;  1ETY A;  4MLO A;  1MBF A;  3LSP A;  3TP0 A;  4W97 A;  1JJ8 C;  1JKQ C;  2PMZ N;  3FK6 A;  5JLW A;  3CCY A;  4QSH A;  1MH3 A;  4FTH A;  1FIA A;  2AO9 A;  2R5Y A;  2OF7 A;  4B4C A;  4A3D J;  3DCF A;  4CYC B;  3W6V A;  1X58 A;  2KT0 A;  2DMN A;  1FTT A;  1JTY A;  2LY9 A;  1GT0 C;  3BTC A;  4A93 J;  2EZK A;  3TW7 A;  4AC0 A;  1ZR2 A;  1AKH B;  4A69 C;  1JUP A;  3M4O J;  2NVY J;  3HBL A;  3HKZ N;  2R5Z A;  1Y1W J;  3CDL A;  3HOY J;  4FE7 A;  4DZJ A;  4JP0 A;  4XRM A;  2K9S A;  1U9N A;  1I6H J;  2IAI A;  3BG3 A;  5C4J J;  3S16 J;  2XRL A;  3GBG A;  4XRS G;  2E19 A;  3LOC A;  1TWA J;  1POG A;  1OJL A;  3PO3 J;  5IOZ A;  5E3M A;  1IV6 A;  2NOG A;  2LP0 A;  1VF9 A;  2DA6 A;  5E3N A;  2NVT J;  4A3J J;  1JKR C;  1OCP A;  5F0H A;  4D5C A;  1OFC X;  1FIP A;  5EEA A;  2K40 A;  2DA2 A;  1ETK A;  2IBD A;  2DTZ A;  4FCY A;  1SFO J;  1IC8 A;  2CRG A;  5K7Z A;  3L1P A;  1RES A;  3QPS A;  1RKW A;  1ETO A;  3A01 B;  5DTD A;  5IP9 J;  3LSG A;  1GV5 A;  1X2N A;  5F0C A;  1HF0 A;  5EZH A;  2XGD A;  4D7N A;  2OPT A;  4UUS A;  1YRN A;  2LR8 A;  1PUF B;  5C44 J;  1OCT C;  3SJM A;  1JUM A;  1I50 J;  1XC5 A;  2HXI A;  3S14 J;  1MSE C;  2E2J J;  4JX6 A;  2LLK A;  2YS9 A;  1ETW A;  1FTZ A;  2VUM J;  1JKO C;  5EDN A;  2ID6 A;  1LFU P;  2JA8 J;  5IPA A;  1WGX A;  3OSG A;  4XK4 A;  2M8G X;  3S2H J;  4B3A A;  1D5Y A;  2VPR A;  2JK3 A;  4A3I J;  4A3B J;  5FKM A;  5FJ8 J;  3JRH A;  4Y7N J;  1GV2 A;  2M0C A;  3HDD A;  1U78 A;  3B6C A;  1IRZ A;  1FEX A;  3BT9 A;  2IEK A;  3DEW A;  4MFD A;  4L5E A;  2VI6 A;  1BL0 A;  2X48 A;  1U9O A;  1JKP C;  3BG5 A;  5C3E J;  1B72 A;  3G1M A;  3RQI A;  5EZG A;  5EGO B;  4A3G J;  1FJL A;  1TWF J;  2NS8 A;  1I3Q J;  2LTP A;  1JTX A;  3JRI A;  2ECB A;  2HI3 A;  3RKQ A;  4BY1 J;  2EZL A;  2AHQ A;  3NAU A;  2L9R A;  4D5F A;  5M5Y J;  2O9L A;  2L7M P;  5E3O A;  1ETX A;  1JGG A;  4MIM A;  1W0T A;  2JWT A;  2GLO A;  5IYC J;  1X2M A;  3SFI A;  2DMQ A;  1B8I B;  1DU0 A;  3LSJ A;  3BR1 A;  2JN6 A;  2CUE A;  4IHX A;  4XID A;  3Q0V A;  5GPA A;  3I4M J;  1CQT A;  1Z0X A;  2EQR A;  2Y2Z A;  2O8K A;  4A3L J;  5FKO A;  1QPI A;  1JUS A;  4HNV A;  1R9T J;  2XPW A;  4JYK A;  3S17 J; 
#chains in the Genus database with same CATH topology
 4XRF A;  2DT6 A;  2E7W A;  3TQN A;  1HW2 A;  2DXI A;  3VYT B;  1QVT A;  4PSW A;  4M9Z A;  3HHG A;  3FXL A;  2QZ8 A;  4G6Q A;  5M5X J;  2GBY A;  3DTI A;  1Z91 A;  3K69 A;  4U88 A;  5EG0 B;  2OCE A;  4G7H F;  2DJI A;  3ZQC A;  2E35 A;  3DEU A;  3DQV C;  2K7L A;  2XKO A;  1MGT A;  2H94 A;  4U0W A;  1ZK8 A;  1TZL A;  3VYS B;  5F1R A;  3MKY B;  3WHC A;  2X6X A;  4C3I J;  1TP4 A;  5H6R A;  2XRN A;  4G6D A;  4AWX B;  1U6G A;  1RR7 A;  4RM2 A;  3ELK A;  2R7T A;  4KT5 C;  1R58 A;  3OOP A;  1WH5 A;  2QSF X;  1ZG1 A;  3VWB A;  3PO2 J;  2ECC A;  2XUB A;  2LK2 A;  5JI6 A;  4HW0 A;  2Y9Z A;  1OCC H;  1WI3 A;  4HSR A;  1TQP A;  3FIW A;  3GCM A;  2R7W A;  4LG0 A;  2VON A;  2F4O B;  2Y30 A;  3HC7 A;  2V1N A;  3D1N I;  4M6Y A;  4LK1 F;  3R4K A;  1T0F A;  2XF7 A;  4ESF A;  2OUM A;  4KJZ A;  1T38 A;  2R7Z J;  5E20 A;  5F27 A;  3TGN A;  2X6Y A;  4CCK A;  4IL6 C;  1SVO A;  3BG9 A;  1Y39 A;  3WTY C;  3Q3S A;  3ABM H;  1MMN A;  2VKE A;  2BW3 B;  2HDC A;  5CVJ A;  2BHY A;  4XSX F;  4DIQ A;  2CQK A;  2EV5 A;  1MBH A;  2DK5 A;  4G7Z F;  1F36 A;  2JA5 J;  3BTJ A;  2EJR A;  4V2G A;  2M5W A;  4XBF A;  1CF7 A;  3VB2 A;  1XD7 A;  4OOI A;  4ZYA A;  3HOT A;  3ERE D;  4XKB A;  2DTR A;  4C3H J;  1TWC J;  5LFA A;  3DFG A;  4LFU A;  2EB7 A;  1ZTR A;  1MSF C;  3JR9 A;  3WTT C;  1LDD A;  5FLM J;  3HL2 A;  3GTK J;  5J6X A;  4IHS A;  2VC1 A;  1CGP A;  2CWE A;  1RZ4 A;  2WA0 A;  4UUS B;  3LQQ A;  3X2Q H;  5IT3 A;  1T33 A;  3KIO A;  4RAF A;  3TMO A;  5H2F C;  3KYC B;  4IF4 A;  2O03 A;  2ZKZ A;  4CCM A;  3E7L A;  4GO1 A;  2K3P A;  3H3V K;  4NNJ A;  5B1A H;  3LFK A;  3TO7 A;  3RZD J;  3H9Q A;  1IDZ A;  3F3X A;  3HYI A;  4KMF A;  2LY2 A;  2LBF A;  2ADU A;  1WJ5 A;  1ZLK A;  5TIS C;  2J5P A;  2KLO A;  1TW3 A;  1ZKG A;  2H1K A;  2ZNY A;  3QPL A;  2DMU A;  3RPU A;  3HRT A;  5CPR B;  4AD9 A;  1XGN A;  2EBI A;  1IRF A;  2STW A;  2ETH A;  3KP6 A;  4CYC A;  3J80 K;  3WG7 H;  4Q48 A;  5LD2 C;  2E5N A;  3HEF A;  1MBJ A;  2QF7 A;  5L3D A;  2KIS A;  1Z7U A;  2ZJR F;  3FIS A;  5K7F A;  2JMW A;  4L0Z B;  4PJL A;  1N78 A;  4NC6 A;  3VDX A;  1AA7 A;  5E1Z B;  1WZ2 A;  4OWR B;  2DMP A;  1ETQ A;  2F2E A;  4LK0 F;  3G1L A;  2VXD A;  1QQI A;  4DBQ A;  3K10 A;  3ABK H;  4JK1 X;  2DCE A;  2E1M C;  5BS6 A;  3DP7 A;  3V7R A;  3FM3 A;  2HDD A;  2K85 A;  1HXD A;  2L7F P;  3KP4 A;  3QYB A;  3K70 C;  3C2H A;  3T0Y A;  2A68 F;  3QU3 A;  3B73 A;  1HKT A;  5F6F A;  1DPR A;  1IJW C;  3I71 A;  2NVX J;  2HDW A;  1FYL A;  2I10 A;  1E17 A;  4FHT A;  1K61 A;  4M74 A;  4BGD A;  1MMD A;  2UV1 A;  4EQQ A;  1K83 J;  3DPT A;  3ZOB A;  1WJB A;  3QQA A;  1MNE A;  4S04 A;  3MZ8 A;  1XSD A;  4I2O A;  5M3F J;  4IQJ A;  1W4M A;  2M9H A;  2W25 A;  3LST A;  1USS A;  4B3X A;  2DQL A;  2K4J A;  1OYW A;  3ONQ A;  3F8F A;  4QWQ A;  5TGT A;  2I5U A;  4HV6 A;  2OQG A;  3L09 A;  4HOB A;  4CSW A;  2RQQ A;  2ZXI A;  1J2X A;  3DBL B;  3HGY A;  3CJQ B;  4ESB A;  1KQ9 A;  4KFC A;  3HOX J;  4AID A;  2HNH A;  2VJ4 A;  2LDU A;  4ENK A;  1LFB A;  1H8A C;  1EH6 A;  4W1U A;  4FE4 A;  1YX5 A;  1X3W B;  4YEL A;  4BU2 A;  2FSW A;  3ZQH A;  3F21 A;  2KP6 A;  2EWN A;  1QBJ A;  2IT0 A;  2OTJ I;  2M8E A;  4UB8 C;  3H92 A;  4P9F A;  2ZJ2 A;  1XG1 A;  2EH3 A;  2LKS A;  4M6X A;  3FXO A;  1TQM A;  4QPQ A;  1R00 A;  1Z1D A;  5FKL A;  3S2D J;  3ZMD A;  3WG9 A;  2VE8 A;  1ZRF A;  3A03 A;  2IS2 A;  2LOO A;  3DPU A;  2EFQ A;  3KP2 A;  3HSR A;  4LJZ F;  1ERD A;  1Y1V J;  2DA3 A;  4CO8 A;  3JAM Z;  3VPR A;  1NG7 A;  2RKH A;  3BQZ A;  4LG0 B;  1RET A;  5EEH A;  3RDI A;  1FC3 A;  2OZU A;  4OAZ A;  3L2U A;  1D1B A;  5HLH A;  5HLT A;  2QM3 A;  3BP8 A;  1PP8 F;  4HAM A;  2XHK A;  1H88 C;  3BG7 A;  3RKW A;  2HTJ A;  2MLG A;  2Z16 A;  1SAX A;  2FOW A;  2AXL A;  1HW1 A;  2KPM A;  4PFO A;  2EFW A;  4ENM A;  4ZDP A;  4ZTF A;  4Q47 A;  1IO2 A;  4FIS A;  1LPQ A;  1R7J A;  4E7J A;  1K4S A;  2Y31 A;  2JUG A;  4HQE A;  3J7Y J;  3F0C A;  1G4D A;  4EMS A;  3KEQ A;  3A0H C;  2DO7 A;  3S1Q J;  3MQ0 A;  1MKM A;  4ANJ A;  2M30 A;  1J7K A;  1R1U A;  4G12 A;  3FXU A;  2IXS A;  3HZJ A;  4X1E A;  3OIO A;  5CVI A;  4MO7 A;  2XAH A;  4XM3 A;  4A0X A;  4DGW B;  2CQQ A;  4E7L A;  2G0E A;  2XRO A;  4DYR A;  2Z33 A;  4BXX J;  3C2G A;  3AAF A;  1E3O C;  1MH4 A;  1HCR A;  4L0Y B;  4NC7 A;  1JJ6 C;  5E3L A;  2CU7 A;  4GXO A;  2DMT A;  2CSO A;  1T95 A;  2WAQ A;  3F9K A;  1XSV A;  3HPH A;  3WTS C;  1O4X A;  4BQA A;  2DN0 A;  5FLV A;  5FRO A;  3FXR A;  3E5X A;  2G9W A;  3IKT A;  4ABZ A;  5ICF A;  5D4R A;  5D6F A;  1MBF A;  2LBF B;  1JJ8 C;  2P6S A;  4PGG A;  3OYC A;  4E6K G;  1Z6R A;  3R60 A;  3IHU A;  1N25 A;  3CCY A;  2FQ3 A;  1GXP A;  2XAF A;  3DWL E;  4E7K A;  1X19 A;  1MW7 A;  4FTH A;  2R5Y A;  3CF5 F;  4B4C A;  4A3D J;  2V1D A;  4CYC B;  3W6V A;  1FTT A;  1QPM A;  3ZN0 A;  1DGW Y;  3BZK A;  3VYR B;  2VC0 A;  4M9X A;  3JAM K;  2LY9 A;  1XDU A;  5AIQ A;  3BTC A;  3KPH A;  4A93 J;  3KE2 A;  1GXQ A;  3P9I A;  1ZR2 A;  4U0Y A;  2EFO A;  3HBL A;  1ZAO A;  3CO7 C;  1F9N A;  4J01 A;  3M8J A;  1U5T C;  4JP0 A;  4Z6Y A;  2V6E A;  3CUQ C;  4BXF A;  3F8N A;  3S16 J;  1XX5 A;  3GBG A;  3IWF A;  4CA0 A;  4XRS G;  3ULQ B;  1TWA J;  2DU9 A;  2R7S A;  4H4K C;  1POG A;  3PO3 J;  2IGK A;  1UG0 A;  4RS8 A;  3AG4 H;  5E3M A;  2L2O A;  2L4M A;  2LP0 A;  1SMY F;  4B48 A;  5E3N A;  1FBQ A;  5A2Q K;  1JKR C;  5F0H A;  4GGG A;  2HGC A;  1A6Q A;  3FDY A;  4YIR X;  1K79 A;  3L2C A;  4FCY A;  2IBD A;  1IC8 A;  3K4N A;  3LL7 A;  3PUF A;  2VQC A;  3QOP A;  4XKC A;  1I27 A;  2CRG A;  1BC7 C;  3L2W A;  1RES A;  1FYM A;  2A6H F;  2R7Q A;  4LB6 B;  4F52 A;  4UUV A;  4EGZ A;  1ETO A;  2VB6 A;  5DTD A;  5IP9 J;  3I55 I;  4IPA A;  1G3Y A;  4HQM A;  5EZH A;  2DQR A;  2XGD A;  5FB2 A;  1YRN A;  3K4J A;  3J7Z I;  2CW0 F;  2CW7 A;  1W5T A;  1YW9 A;  2HU9 A;  5DV5 A;  5ILV A;  1ULY A;  3CLO A;  3SEQ A;  1YI2 I;  1WJE A;  1OCT C;  1I50 J;  4I0A A;  1XC5 A;  4NHJ A;  3ZMZ A;  2OV7 A;  4XON A;  3S14 J;  1MSE C;  3CTA A;  1KQ0 A;  2MC3 A;  1ETW A;  4HLX A;  3GLX A;  4BHB A;  5B66 C;  2VUM J;  3IC7 A;  4F55 A;  1JKO C;  1LFU P;  3PL8 A;  2HYG D;  4G94 A;  2VN2 A;  3L00 A;  2A05 A;  3NWS A;  3AL0 B;  2Z9O A;  1HST A;  2KZV A;  3CF2 A;  1SFK A;  3FM5 A;  1FOW A;  2JK3 A;  2IA2 A;  2UUZ A;  2JRT A;  3JRH A;  3I58 A;  4L9N A;  2IS4 A;  4CDG A;  4H0E A;  3ZN1 A;  1IRZ A;  3FBI B;  3T8T A;  2IEK A;  3DEW A;  3G2B A;  4L5E A;  3EUK L;  2V4J C;  3DTK A;  1U9O A;  3P5J A;  1REP C;  1JXS A;  1IN6 A;  5C3E J;  2RNJ A;  1JE8 A;  2H27 A;  3G1M A;  1FJL A;  4TV7 A;  1K7A A;  1J0R A;  1TWF J;  1I3Q J;  4KMU X;  4CHU A;  3RKX A;  1LDK B;  2DOA A;  2HR3 A;  2P7C B;  3JRI A;  3HKZ A;  2X4H A;  3U9G A;  3OV8 A;  1D8K A;  4IVN A;  2F5C A;  3QU6 A;  4R8H A;  1DDN A;  2NNY A;  1ETX A;  3RYP A;  4ZZL A;  1W0T A;  1IN4 A;  4XKV A;  1K6O A;  4CYD A;  5IYC J;  4P55 A;  1O3Q A;  1BN5 A;  3OYN A;  2HTS A;  2JN6 A;  2CUE A;  2EA4 A;  3FXM A;  5DDG A;  1AOY A;  2Y2Z A;  5FKO A;  4Y4R A;  2NOJ B;  1SFU A;  3J81 K;  1R9T J;  1DUX C;  3ZMS A;  4A6E A;  3EUH C;  3DEE A;  4XN0 A;  2VJ5 A;  5HS8 A;  5ICG A;  2VE9 A;  2MFZ A;  3O8G A;  1MBG A;  3JRA A;  2HZD A;  3FX3 A;  3PFY A;  1EKE A;  4M3E A;  2COM A;  4B8X A;  2Z3Y A;  1LDJ A;  3GWZ A;  5TRD A;  2PI0 A;  3MD2 A;  3MZH A;  3O3K A;  1GVD A;  3HSF A;  5E17 F;  3OR2 C;  2R92 J;  5J1R A;  4IHW A;  3W3C A;  4C2T A;  2DT7 B;  2E71 A;  2FQ4 A;  4E7S A;  1K6Y A;  2NVQ J;  4M73 A;  2ZSH B;  1X1A A;  1HDD C;  3EET A;  3IV5 A;  2ZXJ A;  2IS6 A;  1WKM A;  1Y0U A;  5CQG A;  5HVQ C;  1XMX A;  3UKG A;  1OCR H;  3DTE A;  4GRI A;  2XC7 A;  3FHN A;  3W6K B;  3JRC A;  2BY3 A;  2BVL A;  2ZO4 A;  2RV8 A;  4BQO A;  4EJO A;  1T08 B;  1FNN A;  5CKT A;  2VL8 A;  4FAS D;  3FMQ A;  3WTV C;  3LSH A;  2JJ7 A;  5D5U B;  1K78 A;  3CCJ I;  3QPH A;  2XPU A;  4RB3 C;  2ZNZ A;  2XAQ A;  3I3L A;  4PJM A;  3FZV A;  4E70 A;  2DOE A;  3FK7 A;  5FLX K;  2PQ8 A;  2D5V A;  4A3M J;  3QP5 A;  3BTI A;  2R0Q C;  2G7H A;  1IDY A;  4B09 A;  2O8X A;  1LNW A;  3BWG A;  4ZJZ A;  2XSD C;  2B63 J;  1EH8 A;  2D2W A;  1YW8 A;  3SDG A;  4C2M J;  1MDM A;  4HZF A;  2PJR A;  1FMW A;  2ELK A;  3ABT A;  3LQR A;  1KZH A;  1QHH D;  2ZME A;  3ZQG A;  2ACJ A;  2JTV A;  1PDN C;  1YRN B;  1APL C;  1MMG A;  5GAE J;  2IGM A;  2YX4 A;  4PDK A;  2QGU A;  2M1B A;  2HOA A;  2CFX A;  1R36 A;  3WHB A;  1UHS A;  5DM7 F;  1C0W A;  2OBP A;  1NK3 P;  1W7P B;  1Z3X A;  4B1R A;  5M3M J;  4OMZ A;  3JRB A;  1FSH A;  5GTH C;  3H0G J;  1IGN A;  4PK4 A;  2A61 A;  2DDB A;  3MVP A;  4BJ5 C;  4PGH A;  4ZDL A;  4DQ2 A;  3DBR B;  3RJP A;  2KRF A;  3O8H A;  1IUY A;  2ESN A;  3PIO F;  3U21 A;  5E1X A;  4BKX A;  3V7C A;  2BVM A;  2CH0 A;  4A6D A;  2E2H J;  1VQ9 I;  5JHU A;  4RB0 A;  5LBQ A;  1VTN C;  2E7X A;  3BR2 A;  1WQ2 A;  2E60 A;  4RM3 A;  4DYC A;  3FXJ A;  3L9F A;  4NB5 A;  1J75 A;  4ETS A;  3E6D A;  1UEL B;  5FFX A;  2PEX A;  4GYG A;  2L7K A;  3ZQF A;  2D1H A;  2NNN A;  5D5W B;  1UG2 A;  4JX4 A;  3MKZ A;  2XB0 X;  4P1W A;  2O5R A;  2TRT A;  2L9N A;  5F0F A;  4BAC A;  1EJ9 A;  3KLN A;  2MYS A;  4DW6 A;  2KDZ A;  1YE9 A;  2JPC A;  4M3G A;  2EA2 A;  2DA5 A;  2QBY A;  5DD8 A;  4BH9 A;  4WXD A;  1OYI A;  1QVU A;  2NS7 A;  1Y8R B;  2ZXW H;  3HPG A;  3TED A;  1BBY A;  5IP7 J;  1TC3 C;  4UNO A;  4BDY A;  3PQJ A;  2IRF G;  4F3Q A;  5FD6 A;  5E8I A;  4HF2 A;  3PIP F;  3DLL F;  2HKX A;  1P7J A;  3OOU A;  2IP2 A;  3OYJ A;  2MH9 A;  3CMY A;  1O3T A;  2DA4 A;  3BR0 A;  5KVR A;  2FNA A;  3OIQ A;  4RDU A;  1NK2 P;  2YPR A;  5JHF A;  2IS1 A;  5L3F A;  4XIC A;  4IQ4 A;  3A01 A;  3C2B A;  3RKY A;  2EV6 A;  2WAQ N;  5D5X B;  4LD5 A;  1ON2 A;  2FU4 A;  4KIF A;  4WCG A;  2M3A A;  1ZRC A;  5D8K B;  1FP2 A;  3WU0 A;  3U2R A;  1UAA A;  3K2A A;  1VI0 A;  2JA7 J;  2KJC A;  3K4K A;  5BPI A;  1F5T A;  1UFM A;  2N8G A;  3KZZ A;  2E5Z A;  1R5G A;  9ANT A;  3E6M A;  4IEJ A;  3WTZ A;  3IH2 A;  5L3G A;  1FT9 A;  1T0F C;  1IUF A;  2PX9 A;  1YHQ I;  2RAE A;  3GTP J;  1VQ7 I;  5EYR A;  2X1E A;  2M45 A;  4UB6 C;  1OMI A;  2CG4 A;  2ZB9 A;  1B9N A;  2A5Y B;  4WK8 F;  3TO6 A;  4M71 A;  2XAG A;  2MBF A;  2MW8 A;  1WCM J;  2HFH A;  4JQF A;  1N75 A;  4BY7 J;  3IRQ A;  2C6Y A;  4HEA 2;  1WRJ A;  4L5J A;  1BC8 C;  3IAM 2;  3CLQ A;  3RYR A;  4ZYD A;  3E5Q A;  3WE3 A;  1R1T A;  2P5K A;  2E1C A;  3HOW J;  4MFE A;  1EF4 A;  4LIT A;  1MIJ A;  4D7M A;  4BAY A;  2LYC A;  2K9Q A;  4CIC A;  2VQL A;  1Y56 A;  1U2W A;  4KN7 X;  3MCZ A;  1N77 A;  2WC2 A;  2QEX I;  2DPD A;  2KJB A;  1FYK A;  1ZAR A;  3N05 A;  2LF7 A;  1WI9 A;  1W36 C;  2P4W A;  1I5Z A;  3EDP A;  4BBR J;  1K78 B;  1W5C C;  3K1P A;  4UV9 A;  5GPC A;  4G6T B;  5FKK A;  5K5Q A;  4MNU A;  3VFZ A;  3CC7 I;  5E8G A;  2XPV A;  2ZFU A;  1ACI A;  4IOA F;  1FZP B;  2QCO A;  3E6B A;  3PUB A;  1B8I A;  1UHW A;  2JSP A;  4G9Y A;  2LFB A;  2W82 A;  2WB1 A;  4XSZ F;  2CUJ A;  3BDD A;  2NRA C;  5FRM A;  4HV5 A;  1MDM B;  3FXK A;  3S15 J;  3ECH A;  2PJR B;  2ELJ A;  1S3J A;  1B4A A;  3SZG A;  2ZME B;  4C9Y A;  2WAE A;  1BJZ A;  2IGN A;  1SC7 A;  2VBZ A;  2VKD A;  2TCT A;  1KQ8 A;  3KFW X;  2BYV E;  2WWY A;  3CC4 I;  3OYM A;  2XDV A;  3V8L A;  3A4C A;  4UY8 I;  2LD5 A;  2L9V A;  2WY8 Q;  3HHH A;  5DS9 A;  3J7A Y;  2GXB A;  3DKY A;  2RRE A;  3V4G A;  1ETY A;  1JI8 A;  1FY7 A;  1QNT A;  3ZMV A;  1JKQ C;  3LSK A;  5CVR A;  3FK6 A;  5FGM A;  1ZEL A;  3R6S A;  5JLW A;  4M72 A;  4QSH A;  2HPI A;  4HRI A;  3PQK A;  4BS9 A;  2VQH A;  2BY1 A;  2CO5 A;  5GAH J;  2IVM A;  5FD5 A;  4PCQ A;  3GLL A;  4PUS A;  1X58 A;  2KT0 A;  1YFH A;  1QHG A;  5FRN A;  1I1S A;  1GT0 C;  2VXZ A;  2P7V B;  2YR2 A;  4LMY A;  5IT9 Z;  4AC0 A;  1KGS A;  1S7O A;  3IL2 A;  2R5Z A;  3HKZ N;  1LEB A;  2AQF A;  3CDL A;  3ROU A;  2PFB A;  3REO A;  1OCO H;  2K9S A;  4XRM A;  1G3S A;  4EM2 A;  2GA2 A;  2DFI A;  5DUK A;  5HNF A;  2EK5 A;  4J00 A;  4AIJ A;  1P2F A;  1ZLJ A;  3LOC A;  2NXN B;  2R3S A;  1T8I A;  2QBY B;  4FET A;  1OJL A;  4XLA A;  5J8C A;  1IF1 A;  2VLA A;  1MD0 A;  2V6C A;  2Y48 A;  3ASO H;  2Y69 H;  3LAP A;  2RDP A;  3MKW B;  2DA6 A;  3ZCO A;  4A3J J;  1OR7 C;  5D5V B;  2ZXH A;  4YFN F;  2F4I A;  1ZH5 A;  3BG6 A;  1ONV A;  3VYU B;  1BOA A;  5CJ9 A;  4A5N A;  5EEA A;  2K40 A;  3LFU A;  3I53 A;  5LGU A;  1Z21 A;  2DTZ A;  1A36 A;  3AL0 C;  2JVG A;  2WAD A;  5K7Z A;  2FUG 2;  3L1P A;  2JSC A;  2K5C A;  1RKW A;  2FBH A;  3M7G A;  3V7S A;  2EIM H;  1V5F A;  3A01 B;  3FKJ A;  2OZ6 A;  3T5X A;  4MTD A;  2X1C A;  2OPT A;  2A3S A;  3L7W A;  2OQR A;  1R5H A;  5LHG A;  3N4M A;  4NQW A;  2EIK H;  4XLC A;  2ZCW A;  4HST A;  1PYV A;  1M1E B;  1XSX A;  2CS3 A;  2M7B A;  3E3V A;  3Q9V A;  3CCR I;  1F4K A;  3EYI A;  1R22 A;  3HSE A;  3SJM A;  3CCU I;  1OCZ H;  3KCC A;  3QRF F;  4YG2 F;  5TJJ A;  4BQQ A;  4YFK F;  2E2J J;  4JX6 A;  1R4N B;  2HQA A;  2V9P A;  1V3F A;  5K5O A;  5ICE A;  3SQN A;  3GFL A;  4NUB A;  5IPA A;  3IAS 2;  4OMY A;  3S93 A;  2M8G X;  4P9U A;  2MA3 A;  3H3Z A;  1H9T A;  1D5Y A;  2VPR A;  2HEO A;  4CCJ A;  2CUZ A;  2RNG A;  2H1L A;  5DUI A;  3MWM A;  3CD6 I;  4Y7N J;  3HDD A;  3OYB A;  3ABL H;  2ESH A;  3B6C A;  1CF7 B;  1FEX A;  5H20 A;  3BT9 A;  4CCL A;  4MFD A;  2HOE A;  2VI6 A;  2QQA A;  2RC4 A;  3BG5 A;  2KDO A;  3KZI C;  1B72 A;  1QO0 D;  4EJW A;  2P6T A;  3GZ6 A;  4S05 A;  2LTP A;  1IZ1 A;  2R4G A;  4XKW A;  2IPQ X;  3C18 A;  3BLY A;  4EVI A;  3RKQ A;  3SYT A;  2AHQ A;  3VSL A;  1JHF A;  2L9R A;  4RAZ A;  3ESW B;  4FX4 A;  5M5Y J;  1LJ9 A;  2O9L A;  2XF6 A;  5E3O A;  2Z5U A;  1JGG A;  1G3T A;  1FMV A;  2HVQ A;  2P8T A;  4MIM A;  4PFP A;  2H8W A;  2V1U A;  3PSF A;  1H0M A;  1BI2 A;  2GLO A;  4XMY A;  1MJ9 A;  3IRR A;  2BEO A;  2Q1Z B;  2YX7 A;  1B8I B;  3DU5 A;  1DU0 A;  3LSJ A;  4RB1 A;  4G8X A;  5GPA A;  1Z67 A;  5J8F A;  3I4M J;  1D3Y A;  2ZSI B;  2KIM A;  2HKO A;  2H6B A;  1FBS A;  3PJR A;  3MAJ A;  4A3L J;  1JUS A;  2DLL A;  2JPB A;  2VQG A;  5LHI A;  5ED4 A;  1UZC A;  1FP1 D;  4CGZ A;  3CCS I;  3JSO A;  4IOC F;  2QEN A;  3OYG A;  5BOX A;  3S17 J;  3BR3 A;  5BQT A;  1A5J A;  4M9S A;  5LGT A;  3GTG J;  2UZK A;  3TP3 A;  3Q9S A;  2OTL I;  3WGG A;  2P5L C;  3M9A A;  3G6E I;  5K1Y A;  2F6C A;  1ZGJ A;  3DKX A;  4MQ9 F;  1Y6I A;  3A1Y A;  5D4S A;  1DU6 A;  1FPQ A;  3HTS B;  5KK1 A;  2FA5 A;  2DDA A;  2IJL A;  3S8P A;  3M3Y J;  1T56 A;  3OYI A;  4UVB A;  2MG4 A;  1LUJ B;  3PM1 A;  2J5O A;  5J3L A;  4LB5 A;  4LG3 A;  3PFI A;  1LEA A;  5M5W J;  2W1O A;  1IRX A;  5B1B H;  4OAY A;  4QIW N;  4HX8 A;  3TW6 A;  2AS5 F;  1G3W A;  1U5T A;  4AIH A;  4B44 A;  4E7H A;  3I59 A;  1GDT A;  1TLH B;  2L9S A;  5J1Y A;  1H89 C;  2B9S A;  1DP7 P;  2VBY A;  3KZY A;  5CVU A;  2KKO A;  1MMS A;  3CUQ A;  2GAU A;  1J5Y A;  3CP2 A;  2E1M B;  1JGS A;  1HKS A;  3S2W A;  2R5Z B;  3BOQ A;  5HDK A;  1BA5 A;  5IYB J;  2DYR H;  5K5R A;  3JRD A;  2O7O A;  3FWE A;  3H0D A;  5DYM A;  1VQM I;  3W2W A;  4XN3 A;  1KYZ A;  2HQ5 A;  1D0X A;  2HXO A;  4FX0 A;  1XDS A;  5EJC A;  2PLY A;  4BL0 B;  2XGC A;  2HOT A;  2XVC A;  5IOY A;  3K7A J;  5KHD A;  2EFP A;  2MH2 A;  1WWX A;  2BZT A;  3CDH A;  4EJU A;  2Y9Y A;  1TL8 A;  2A69 F;  4IRH A;  3R0J A;  3KEY A;  2E1O A;  4XLF A;  2GOX B;  1F43 A;  4V2F A;  3H5R A;  1W5S A;  3S1R J;  4PZJ A;  4RGS A;  3TL4 X;  3GUD A;  3H9J A;  4QTR A;  3CO6 C;  2V79 A;  1E3P A;  3EYY A;  3G4S I;  2QVO A;  1YX3 A;  2IA0 A;  3BR6 A;  3GF2 A;  4XLH A;  4A3C J;  4YEJ A;  2XIG A;  4II2 A;  5LEK A;  2Q0O A;  3GTM J;  3HOZ J;  1NTC A;  2OD5 A;  2K27 A;  4M6V A;  5LRR A;  4FQG A;  3MN2 A;  3ZQ7 A;  4E7Z A;  3ABU A;  3LWF A;  3FMR A;  4I09 A;  4IKF A;  4NQW B;  2R93 J;  1SD6 A;  4HDV A;  1YIJ I;  2QQ9 A;  2FX0 A;  3WTX C;  2KQR A;  3K4L A;  4U0V A;  4GDF A;  2PMH A;  1MBE A;  3H36 A;  3CMM A;  3UR3 C;  4Z2Y A;  3WU2 C;  4AVZ A;  1A6I A;  3CCL I;  1YW7 A;  3LSI A;  4A3K J;  2W84 A;  1Z77 A;  5JLX A;  4KIG A;  4LLG F;  3CQZ J;  4AM3 A;  3P9C A;  2RGV A;  2V7F A;  3M07 A;  2CYY A;  3T8R A;  1X3Z B;  4K2E A;  4XLE A;  3VOE A;  4A3F J;  3ISP A;  1XS9 A;  1R23 A;  1RUN A;  2UXX A;  1YJ9 I;  1YO5 C;  4I7H A;  3OL3 A;  4I98 B;  4KN4 X;  3IH4 A;  1TT5 B;  1BIB A;  1SAU A;  2STT A;  4ENJ A;  1XB4 A;  4C30 A;  4AYB A;  1FWZ A;  4A0Y A;  3I54 A;  5JVT A;  1AKH A;  5DEQ A;  1P4W A;  2V26 A;  4KDP A;  2XB5 A;  1HLV A;  1B72 B;  2GZW A;  1R71 A;  4HBL A;  2QQ8 A;  3I9V 2;  2DFH A;  2LRE A;  2M34 A;  4EV0 A;  4ITV A;  1HKQ A;  2GWR A;  3F8B A;  4PSX A;  2UWM A;  1WSU A;  4EJV A;  2ISZ A;  3G1O A;  2EIL H;  4RAG A;  3WGI A;  3S1N J;  2MD0 A;  3V8J A;  5J4V A;  1VQ4 I;  2BHZ A;  2KRH A;  2EZI A;  1V5G A;  3GVA A;  1E2X A;  1G8X A;  2WB1 N;  3CZ6 A;  3A02 A;  3RTR A;  1WVR A;  1MJB A;  2PMU A;  4ASN A;  5B3S H;  4C3J J;  4LIU A;  1NG6 A;  4RBO A;  2LF8 A;  3GFM A;  1J09 A;  4B43 A;  2DAO A;  1WJF A;  2V9V A;  1Y0N A;  3M1C A;  1AU7 A;  1XN7 A;  2R5Y B;  1OLT A;  1HA8 A;  1XCV A;  2W85 A;  3WU1 B;  4JX5 A;  1ZGA A;  2VOO A;  3WTW C;  5AIP A;  3GTQ J;  2Z99 A;  2VKH A;  3HM5 A;  3JSP A;  1HC8 A;  4XL9 A;  5KCM A;  3RPQ A;  2FD5 A;  1AWC A;  2GIZ A;  1PUF A;  3KP5 A;  1Z9C A;  3KP3 A;  1MBK A;  2W57 A;  5K7H A;  1UMQ A;  3I56 I;  4EEF G;  2NYX A;  3HOU J;  1D0Z A;  1VQK I;  2V1X A;  3BQY A;  3H5A A;  3S1M J;  2Y0S A;  3NEU A;  3BCA A;  3BC8 A;  3GFJ A;  2JA6 J;  4II3 A;  3QAH A;  5HLG A;  2P81 A;  3ZQL A;  2CV2 A;  1BI0 A;  2IW5 A;  4GCV A;  4CCO A;  5ILU A;  1YLF A;  2K9L A;  3GYH X;  2R7U A;  2DA1 A;  3NAR A;  1YQA A;  1Q1H A;  4M3F A;  1R6R A;  4A0Z A;  4RLF A;  2W7N A;  3K4M A;  1ZQ3 P;  3JRG A;  2ID3 A;  4Q5S F;  3I59 B;  5AON A;  2H09 A;  3HB9 A;  5J1U A;  2JZY A;  3CUQ B;  4ZC3 A;  1ZGW A;  1XMA A;  3BCB A;  1W36 D;  3KX2 A;  4HPQ A;  1QU3 A;  3G3Z A;  5EGO A;  3GO5 A;  1FOY A;  4G7O F;  1P6R A;  2ZME C;  5KAI C;  1VZ0 A;  1L3L A;  2FXA A;  1UCR A;  3FMS A;  4OIN F;  5HOO A;  3Q5F A;  3KEO A;  3O6B B;  5L3E A;  1BJA A;  3V8K A;  2L54 A;  1B9M A;  4M3B A;  1EH7 A;  3BJ6 A;  2JVH A;  1BR4 A;  4PJ0 C;  2GOM A;  5LHH A;  2YU9 J;  2YUS A;  4WXC A;  3RPU D;  2BXY A;  4EGY A;  4D9J A;  2KMU A;  4WX9 A;  1FLI A;  1NHA A;  4IZZ A;  2EPF A;  2OA4 A;  3OMY A;  1E0E A;  1EV7 A;  5IY5 H;  3CUO A;  3OSF A;  1F1Z A;  5F08 A;  1ZG5 A;  4I76 A;  4CUG A;  3OYL A;  3M8F A;  4A3E J;  2CUF A;  1S7E A;  3CP8 A;  1FOK A;  2NS0 A;  3I0T A;  3B02 A;  3WOD F;  3ASN H;  4X0G A;  4XR6 A;  1ENH A;  2F4M B;  2ME0 A;  2XGX A;  2L02 A;  1SVL A;  2E36 A;  3KP7 A;  3KLO A;  5JVG F;  5CYV A;  3O2P E;  5FFZ A;  3C3W A;  2Q8K A;  4IJA A;  1BM9 A;  1ZG3 A;  3LMM A;  1JT0 A;  1YJW I;  3HUG A;  3H35 A;  5ILS A;  1SAN A;  3MFK A;  5F04 A;  1TW2 A;  1S7A A;  4MLO A;  2K3F A;  6PAX A;  4HF0 A;  3LSP A;  1XMK A;  4W97 A;  5ERI A;  4CXF A;  3GZ5 A;  4I02 A;  4C2U A;  2A5W A;  4HG2 A;  1MH3 A;  3AKZ A;  1FIA A;  2AO9 A;  4BHC A;  2B0L A;  1MJA A;  2RQP A;  1FSE A;  2LKP A;  3HTU A;  5D8L B;  1V54 H;  1OIS A;  1D0Y A;  3OWT A;  4AIK A;  4N4N B;  3PSI A;  3G73 A;  1J59 A;  3CJT B;  3M1E A;  3TKY A;  1AKH B;  4ON0 A;  3BPV A;  2AQE A;  2V9K A;  5DCF A;  1SFX A;  1Y1W J;  1E3H A;  3D5S C;  2ISY A;  3HOY J;  4FE7 A;  1RIO H;  4OU0 A;  1VQO I;  2CW8 A;  2PBI A;  1U9N A;  1I6H J;  1STZ A;  3BG3 A;  3K2Z A;  2KIF A;  5C4J J;  4KUM A;  2QKM B;  1W1W E;  2D45 A;  3BZC A;  1O7F A;  3NQO A;  1IXC A;  2A6T A;  1TT0 A;  2DT5 A;  3H5N A;  1Z7L A;  5IOZ A;  1TBX A;  3ZR8 X;  2NOG A;  1KU7 A;  3MMY B;  3CDI A;  1X1C A;  2NVT J;  4V19 K;  2B7E A;  3ZGK A;  1OCP A;  4D5C A;  4ENN A;  1OFC X;  4BJT A;  4LGW A;  2WBM A;  4FT8 A;  1SFO J;  1ETK A;  2LY1 A;  3F23 A;  4XOR A;  5J4Y A;  1I3A A;  3J80 Z;  5GAG J;  3GZN B;  3H3U A;  3F22 A;  2HPM A;  1GHC A;  1LQ1 A;  2R7O A;  4JOM A;  2KL4 A;  1Z6T A;  4LIV A;  3LSG A;  1X2N A;  2KZG A;  1HF0 A;  4WWC A;  4D7N A;  5HDN A;  1QA6 A;  3RIR A;  3VSK A;  4D0P A;  4D1Q A;  2HZT A;  1PUF B;  2BV6 A;  4MQV A;  4JBA A;  2JUC A;  2DOD A;  3NRV A;  1G59 A;  1JUM A;  1X4P A;  2X85 A;  4L5I A;  4UVC A;  1MMA A;  1IN5 A;  2DFE A;  2HS5 A;  3T1B A;  3OYK A;  3TOA A;  1SVM A;  2FOK A;  5LLQ A;  2LLK A;  5LRS A;  5BPD A;  2R7D A;  2W4S A;  3AG1 H;  2CV1 A;  2DW4 A;  2EIJ H;  1FOX A;  5EDN A;  2ID6 A;  2XV4 S;  2JA8 J;  3DXJ F;  1IXS B;  3KYD B;  3OSG A;  4XK4 A;  3SHF A;  1IN8 A;  4R1H A;  2F48 A;  2PMZ A;  2R7V A;  3OS0 A;  2CV0 A;  1ODD A;  1P9Q C;  5FKM A;  4A3B J;  3H1C A;  3U1D A;  1GV2 A;  2BXZ A;  2M0C A;  3JTG A;  4DOZ A;  5DM6 F;  4KNY A;  2HVS A;  1BL0 A;  3H9G A;  2X48 A;  1JKP C;  2VT2 A;  1KU3 A;  5EZG A;  5EGO B;  4BE2 A;  4F92 B;  4A3G J;  4CCN A;  4ZZD A;  2P5V A;  3SXY A;  4HNU A;  4RMN A;  2XAS A;  1BI3 A;  1Y8Q B;  1I39 A;  2R7R A;  1JTX A;  4ZYG A;  3M8E A;  3S3N A;  2ECB A;  1HQC A;  1U3E M;  2HI3 A;  2EZL A;  3JCU C;  3NAU A;  4D5F A;  4U87 A;  1MND A;  3DU6 A;  5CVV A;  3TBI A;  3RI4 A;  2FEZ A;  1RR8 C;  2I8D A;  4OIR F;  2O0Y A;  2XAJ A;  3R0A A;  4HNT A;  3GX4 X;  2WV0 A;  3PNY A;  1IV8 A;  2JWT A;  2FML A;  1S29 A;  1SMT A;  1X2M A;  3SFI A;  2CQN A;  3W6J B;  3K4B A;  2CGP A;  2IA1 A;  1B6A A;  4MEY F;  1R5I D;  4XID A;  4DBR A;  2JRM A;  4P96 A;  1TQI A;  1X3U A;  3HIF A;  5FO5 A;  4AU7 A;  2O8K A;  3OL4 A;  1QPI A;  1D1C A;  3BZ6 A;  4JYK A;  2DI3 A;  3DLA A;  1UHM A;  2NVU B;  2F5D A;  1WHU A;  2VT3 A;  3EPZ A;  1WJD A;  3VEP A;  4Y13 A;  4PJJ A;  3L2Q A;  1KA8 A;  5DCM A;  4ZH4 F;  3CME I;  1IXR C;  1LB2 A;  3GTO J;  3HUG B;  1RNL A;  2LKX A;  1Z3Y A;  5IYD J;  2OJE D;  4XOT A;  4F7Z A;  4ZYH A;  2X6W A;  2OU2 A;  2A07 F;  5CQE A;  3OS1 A;  4XOP A;  1QZZ A;  3AFH A;  5EEG A;  2F5V A;  2CJJ A;  4LOC A;  4KYW A;  4Q4Z F;  2W24 A;  1X1D A;  3CJR B;  2OCC H;  1VQL I;  4J19 A;  1LVA A;  1LKX A;  3CCE I;  3I5U A;  5KAF C;  1H9G A;  2RN7 A;  4AYB N;  3C1D A;  2K9N A;  2MLK A;  4KT6 A;  5E79 C;  3S3M A;  1VQP I;  3TDU C;  1WJA A;  2FE3 A;  4XLN F;  3MZY A;  3Q0U A;  4NC8 A;  2Z1D A;  4RA2 A;  2CMP A;  1VQN I;  1P7I A;  2QWW A;  3RZO J;  5E1W A;  4IHY A;  2L0K A;  3W2A A;  3FKI J;  2KFD A;  1V55 H;  2H8R A;  1AHD P;  3OYH A;  2WV1 A;  1W7P D;  4MEX F;  1V4R A;  2ZJP F;  2X51 A;  1OR7 A;  3LA3 A;  1S8N A;  4HA8 A;  3RSN A;  3GTJ J;  1Q1V A;  1V5E A;  3SZP A;  2L4A A;  3LSM A;  4BEH A;  5GAD J;  3L2R A;  4NDL A;  1YIT I;  2M0M A;  2R7X A;  3NWT A;  1RUO A;  1IG7 A;  2LMD A;  1BW5 A;  2Z2S B;  3FF5 A;  1OYY A;  3TDZ C;  1T39 A;  1O57 A;  2X9D A;  1U8R A;  3HRU A;  3OYD A;  4GFB A;  5D6E A;  1WH7 A;  2WAF A;  1ITY A;  2LRD A;  3HOS A;  1TWG J;  3Q0W A;  1UB9 A;  2BOL A;  1QZY A;  1GUU A;  4I99 C;  1NH3 A;  2P0W A;  5JR3 A;  4CH7 A;  4CZC A;  1U8B A;  5IT9 K;  3QYF A;  2HWV A;  1U0J A;  4GYI A;  3B6A A;  5J40 A;  2FF4 A;  3BJO A;  2O6G E;  5F1J A;  2W48 A;  1VND A;  1R49 A;  3V42 A;  2CQX A;  1IRG A;  3U1K A;  5C4X J;  1I1G A;  2Y0S N;  4ZTJ A;  5EF6 A;  1W0U A;  4X6A J;  4S0H B;  1LE8 A;  2K9M A;  2VAS A;  2M4K A;  3HGG A;  1RKT A;  4A2U A;  2JQ7 A;  1G2H A;  3VOD A;  3I4P A;  4N4O B;  4YII A;  1OQY A;  2BE5 F;  4HX7 A;  5HOD A;  5HNH A;  1O7L A;  4OIO F;  4ZDO A;  2E1N A;  2LG4 A;  4HYE A;  2GM4 A;  2FNP A;  1B59 A;  5A2Q Z;  2DK8 A;  4DYQ A;  5CLS A;  5F64 A;  4KA4 A;  2GXG A;  2VKV A;  3AG3 H;  4HF1 A;  1FX7 A;  1MNM C;  4AUX A;  4BE1 A;  2DOF A;  2HOS A;  3E1S A;  4M3D A;  4Y15 A;  1A31 A;  3L2V A;  3ZPL A;  1QZE A;  3HOV J;  2EFN A;  2HQN A;  3MKL A;  1TTY A;  3LAJ A;  1G6N A;  2O61 A;  1ORK A;  3GME A;  2IGO A;  4OIP F;  1P4X A;  3ECO A;  1K4T A;  4EAT A;  2F5E A;  4XNF A;  1P4A A;  4XRS A;  5ICC A;  3KET A;  1QRY A;  3K9T A;  2ELH A;  3EUA A;  2HYJ A;  4QLC U;  5BMZ A;  4IHV A;  3OYA A;  1BI1 A;  2OAZ A;  2VPL A;  3JRE A;  4EM1 A;  4KIS A;  2M7A A;  4KIB A;  4EJT A;  1JT6 A;  1HDP A;  3ZRG A;  3ZXS A;  4Y52 J;  2XKP A;  1DQU A;  4UXN A;  3LA2 A;  1DPU A;  2ME6 A;  2XGE A;  3HG9 A;  3QPT A;  3CES A;  5GP9 A;  3OY9 A;  2L7Z A;  1QGP A;  2KIQ A;  3E5U A;  3WE2 A;  1IAW A;  3ERM A;  4OIQ F;  3SFZ A;  1XPX A;  1BR2 A;  2M2E A;  2MSY A;  3W2V A;  2XF5 A;  2FJ1 A;  5H6Q A;  1S9H A;  4BJ6 C;  4RGR A;  4UUT A;  1IN7 A;  3IKV A;  2VOP A;  2BY2 A;  1FBU A;  2COB A;  3F8M A;  4U7B A;  1S72 I;  4AVP A;  2OC6 A;  1IW7 F;  5DCM B;  2EV0 A;  1YS6 A;  3DPL C;  4IRG A;  3JRF A;  1WPK A;  3J7A O;  3DV8 A;  5FKN A;  3RCO A;  3K1M A;  1BW6 A;  3I4N J;  2DA7 A;  1XTA A;  2MGQ A;  2QSH X;  4P5O A;  4RGU A;  1LVK A;  5LEJ A;  4Y3O A;  3CMA I;  3F6V A;  2DBB A;  1UJ8 A;  1T2K A;  1HBX G;  4O6J A;  3OYE A;  3IH3 A;  4L9J A;  1ZN2 A;  3IWZ A;  2TDX A;  3BTL A;  4YFX F;  1A04 A;  5LGN A;  1D5V A;  2QKL B;  2HVR A;  3P9K A;  3RQ4 A;  1RRJ A;  4DZP A;  1PUE E;  4LLL A;  3ZQI A;  3F6O A;  2BGC A;  2VBW A;  2VJJ A;  3GXO A;  4CZZ A;  3CCQ I;  3FXQ A;  1ETV A;  4F91 B;  4I6Z A;  2A6E F;  1DGR M;  1Z05 A;  3J81 Z;  1YIO A;  2D1V A;  3QOE A;  4A5M A;  3GTL J;  1B1B A;  2PG4 A;  2Y0M A;  3BR5 A;  1WFX A;  1HW5 A;  4NBQ A;  4YRV A;  4L9T A;  3SEZ A;  3UNG C;  3GEZ A;  4A12 A;  2GA1 A;  4LLN A;  1W7P A;  1VQ8 I;  4Y33 A;  4BBS J;  1O3R A;  2XSJ C;  2RVC A;  2LC2 A;  2BY0 A;  2VJI A;  2L3D A;  4BEH B;  2UXN A;  3F8C A;  4RAY A;  2FMY A;  2WTE A;  2R7F A;  5L3C A;  3ZQQ A;  3COA C;  1L0O C;  5KNL A;  2JT1 A;  5HLI A;  1RPW A;  1VFC A;  2E2I J;  4I0B A;  1S5L C;  1BR1 A;  2FBI A;  1HOM A;  5IP6 A;  4RLQ A;  5BNG A;  1TWH J;  2CQ7 A;  1ZYR F;  4E7I A;  1ZR4 A;  3BY6 A;  1VQ5 I;  2L5Q A;  2YSR A;  2Q2E A;  4KIT B;  2X6O A;  4U7D A;  2LVS A;  2X1D A;  4HX4 A;  2ICW G;  3TO9 A;  2F5F A;  4RB2 C;  5L3B A;  1KU9 A;  1TNS A;  2WY7 Q;  3E97 A;  4BDZ A;  3EQL F;  1R1V A;  2G7U A;  2DJN A;  2PN6 A;  1KON A;  4R79 A;  4IX7 A;  5EG0 A;  4WXH A;  3FHZ A;  3CC2 I;  2X0L A;  2L01 A;  3LSR A;  2EZH A;  4BQN A;  3OS2 A;  1LE8 B;  3LNQ A;  2QLZ A;  4BXU A;  1PJR A;  4N9H A;  3DBH B;  1X1P A;  4IO9 F;  3TP0 A;  2PMZ N;  3GW2 A;  2QQB A;  3PNV A;  1OPC A;  1SFE A;  4BE0 A;  1SD4 A;  2H6C A;  3HRS A;  3P7N A;  5FLX Z;  3CCM I;  3BJA A;  2VIX A;  1KU2 A;  2LSO A;  3CJN A;  2O3F A;  1BOB A;  2OF7 A;  1ZRD A;  4L18 B;  4MHG A;  1P92 A;  3DCF A;  2NAZ A;  4WF2 A;  2ZC2 A;  2DMN A;  3F72 A;  4ZYE A;  2KRC A;  1JTY A;  3EUH A;  2W00 A;  1XGM A;  2EZK A;  3TW7 A;  1UST A;  3M4O J;  4A69 C;  1JUP A;  2GIV A;  2NVY J;  3SDB A;  3LA7 A;  1BIA A;  4DZJ A;  1GVJ A;  1S6L A;  3K0L A;  2BBY A;  2Y75 A;  3E0J B;  1YS7 A;  3ZMT A;  2IAI A;  1WJC A;  4QPO A;  1RC9 A;  2AXT C;  4KIC A;  3TOB A;  4BUP A;  2GQQ A;  2XRL A;  3PNT A;  5J47 A;  2XAU A;  3K1N A;  2E19 A;  4XLP F;  3MEX A;  2E34 A;  3WGH A;  1YJN I;  1SEU A;  1YYV A;  2PJP A;  3A2K A;  3K6G A;  2BW3 A;  5HS9 A;  2VBX A;  4XQF A;  1IV6 A;  1LFP A;  2MC4 A;  3S32 A;  2DFF A;  1VF9 A;  3OIP A;  3A0B C;  3ZP5 A;  1FIP A;  4MTE A;  1EA3 A;  1JHH A;  1VQ6 I;  3KYL A;  2DA2 A;  1J9I A;  2QA4 I;  3N97 A;  1YTY A;  3I64 A;  3CCV I;  4IXA A;  1TNT A;  3DF8 A;  3QPS A;  5JFR A;  2QUF A;  2QYO A;  1U5T B;  3D5L A;  3ZMU A;  1GV5 A;  3HRM A;  5F0C A;  1T98 A;  2K4B A;  5DD4 A;  4UUS A;  5HDG A;  4BNC A;  2LR8 A;  1MZB A;  4PJN A;  3WTU C;  2FRH A;  1DP3 A;  4RGX A;  4N0B A;  5C44 J;  4YIF A;  3OYF A;  3HXL A;  3SZT A;  4HDU A;  5E18 F;  2HXI A;  1ZRE A;  2CFO A;  4N9I A;  3C7J A;  2DYS H;  2YS9 A;  1GLN A;  1T6S A;  3BPX A;  3HJE A;  1D1A A;  2KIU A;  3QOD A;  1FTZ A;  4IRI A;  1XGS A;  3DKW A;  4L9V A;  5B5E C;  4I01 A;  3QP6 A;  3G71 I;  4UVA A;  4BHP A;  4Y17 A;  1O3S A;  1WGX A;  1XCB A;  1A35 A;  4UV8 A;  3S2H J;  4B3A A;  2ZBK A;  4HLY A;  2YU3 A;  2DPU A;  1ON1 A;  4EM0 B;  4UHT A;  3E6C C;  4A3I J;  5FJ8 J;  1X4O A;  2K86 A;  2GXA A;  2LH9 A;  1U78 A;  2VOD A;  3D0S A;  4O5V A;  3ML6 A;  4BYY A;  2M4G A;  4E4H A;  3S3O A;  2KHM A;  3RQI A;  3QWL A;  3AG2 H;  1PVE A;  1PP7 U;  5HS7 A;  2NS8 A;  3JTH A;  3FBN B;  1KYW A;  1SD7 A;  2JA2 A;  2K02 A;  2MD5 A;  1X1B A;  4BY1 J;  4DNC A;  4IHT A;  1SD5 A;  3QYE A;  1YG2 A;  2LNB A;  3JW4 A;  3IUO A;  2L7M P;  3IP4 B;  3D5R C;  4B47 A;  5GTI C;  4MGR A;  4ESJ A;  1I6X A;  2ZJQ F;  3K4C A;  2FBK A;  1HSJ A;  3R61 A;  1R4M B;  2DMQ A;  2QSG X;  2M87 A;  3BR1 A;  1XGO A;  4IHX A;  1YOV B;  2HYF A;  3Q0V A;  3GFI A;  1OKR A;  4DJA A;  2ZFW A;  3OR1 C;  4F93 B;  1Z0X A;  1CQT A;  2EQR A;  4O3M A;  3K70 D;  4HNV A;  2EIN H;  2XPW A;  2Q2E B;  3BRO A;  2MAB A;  2HQR A;  1D8J A;  1ZHF A;  1RI7 A; 
#chains in the Genus database with same CATH homology
 3BR3 A;  1A5J A;  3GTG J;  3TP3 A;  3O8G A;  1MBG A;  3JRA A;  1QVT A;  4M3E A;  5M5X J;  2GBY A;  3GTO J;  2LKX A;  5EG0 B;  5IYD J;  3ZQC A;  1DU6 A;  1ZK8 A;  1GVD A;  2CJJ A;  3WHC A;  3M3Y J;  4LOC A;  1T56 A;  4C3I J;  2R92 J;  5J1R A;  4IHW A;  2MG4 A;  3PM1 A;  4J19 A;  5J3L A;  2FQ4 A;  2NVQ J;  4AYB N;  2K9N A;  5M5W J;  1RR7 A;  1HDD C;  3IV5 A;  4QIW N;  3TW6 A;  3Q0U A;  3UKG A;  1WH5 A;  1GDT A;  5J1Y A;  1H89 C;  3PO2 J;  2ECC A;  1P7I A;  2LK2 A;  2Y9Z A;  3RZO J;  3JRC A;  4IHY A;  1WI3 A;  2R5Z B;  2L0K A;  3FIW A;  1BA5 A;  5IYB J;  3JRD A;  3FKI J;  2O7O A;  2Y30 A;  2H8R A;  3D1N I;  2HQ5 A;  1AHD P;  2WV1 A;  2HXO A;  2XGC A;  2HOT A;  2JJ7 A;  2R7Z J;  5IOY A;  5F27 A;  3K7A J;  2XPU A;  3GTJ J;  1Q1V A;  3BG9 A;  2Y9Y A;  3Q3S A;  4NDL A;  1F43 A;  2E1O A;  4V2F A;  2VKE A;  3S1R J;  3FK7 A;  1IG7 A;  1BW5 A;  2D5V A;  4A3M J;  3BTI A;  1MBH A;  2R0Q C;  1F36 A;  2JA5 J;  2X9D A;  1IDY A;  3BTJ A;  4QTR A;  4V2G A;  4GFB A;  1WH7 A;  2XSD C;  1ITY A;  1TWG J;  3Q0W A;  2B63 J;  4C3H J;  1TWC J;  1GUU A;  3BR6 A;  4A3C J;  3SDG A;  4C2M J;  1ZTR A;  1MSF C;  3JR9 A;  1U8B A;  5FLM J;  3GTK J;  2ELK A;  3GTM J;  3B6A A;  3HOZ J;  1NTC A;  3ZQG A;  4M6V A;  4UUS B;  1YRN B;  5F1J A;  2W48 A;  3MN2 A;  1T33 A;  1VND A;  1APL C;  2CQX A;  2R93 J;  2FX0 A;  2HOA A;  5C4X J;  2Y0S N;  3E7L A;  1MBE A;  3WHB A;  5EF6 A;  1W0U A;  1UHS A;  3H3V K;  4X6A J;  1NK3 P;  1A6I A;  4S0H B;  4B1R A;  5M3M J;  1LE8 A;  4A3K J;  3HGG A;  1RKT A;  3JRB A;  1Z77 A;  5JLX A;  3RZD J;  1IDZ A;  3H0G J;  1G2H A;  1IGN A;  3CQZ J;  3MVP A;  5HOD A;  4A3F J;  2GM4 A;  1ZKG A;  3O8H A;  1XS9 A;  2H1K A;  4BKX A;  4DYQ A;  3QPL A;  2DMU A;  2E2H J;  2EBI A;  2VKV A;  3IH4 A;  4CYC A;  1MNM C;  3BR2 A;  4AUX A;  3HEF A;  1MBJ A;  2QF7 A;  2HOS A;  4M3D A;  4DYC A;  3FIS A;  5K7F A;  2JMW A;  1AKH A;  3HOV J;  2XB5 A;  3MKL A;  1HLV A;  1B72 B;  2DMP A;  1ETQ A;  3ZQF A;  2M34 A;  3G1L A;  1ORK A;  1UG2 A;  4JX4 A;  2XB0 X;  2TRT A;  4XRS A;  5F0F A;  1QRY A;  3G1O A;  2HDD A;  2L7F P;  3S1N J;  4DW6 A;  2KDZ A;  4M3G A;  2HYJ A;  2DA5 A;  4IHV A;  3JRE A;  2EZI A;  1IJW C;  2NVX J;  1JT6 A;  1HDP A;  1QVU A;  2NS7 A;  2WB1 N;  4Y52 J;  2I10 A;  3A02 A;  3TED A;  5IP7 J;  1K61 A;  4C3J J;  1TC3 C;  4RBO A;  2ME6 A;  2XGE A;  5GP9 A;  1K83 J;  3ZOB A;  2L7Z A;  3QQA A;  1P7J A;  3OOU A;  3CMY A;  2DA4 A;  3BR0 A;  1AU7 A;  5M3F J;  4RDU A;  2R5Y B;  2M9H A;  1NK2 P;  4XIC A;  3A01 A;  3C2B A;  4JX5 A;  2WAQ N;  2M2E A;  2MSY A;  3GTQ J;  3HM5 A;  2FJ1 A;  4UUT A;  2FD5 A;  1PUF A;  2COB A;  3K2A A;  1VI0 A;  3HGY A;  2JA7 J;  1MBK A;  5K7H A;  3JRF A;  1UMQ A;  1WPK A;  2N8G A;  4EEF G;  3HOX J;  3HOU J;  5FKN A;  9ANT A;  1BW6 A;  3I4N J;  2DA7 A;  4IEJ A;  2MGQ A;  3IH2 A;  3BQY A;  1LFB A;  1IUF A;  1H8A C;  3GTP J;  2RAE A;  4W1U A;  3S1M J;  5EYR A;  4FE4 A;  2ZB9 A;  2JA6 J;  3ZQH A;  2P81 A;  3IH3 A;  3ZQL A;  2MW8 A;  1WCM J;  3BTL A;  1XG1 A;  4BY7 J;  2EH3 A;  2DA1 A;  3NAR A;  4M3F A;  4DZP A;  5FKL A;  3ZQI A;  1ZQ3 P;  3JRG A;  2ID3 A;  3HOW J;  3S2D J;  1EF4 A;  4MFE A;  1ETV A;  3A03 A;  3HB9 A;  5J1U A;  4I6Z A;  4D7M A;  1ZGW A;  1Y1V J;  2DA3 A;  2K9Q A;  5EGO A;  3VPR A;  3GTL J;  3BQZ A;  1RET A;  3BR5 A;  1H88 C;  4BBS J;  4BBR J;  5GPC A;  5FKK A;  4M3B A;  4FIS A;  2XPV A;  2YU9 J;  2YUS A;  2Y31 A;  3F0C A;  2QCO A;  3S1Q J;  1RPW A;  1B8I A;  1VFC A;  2E2I J;  4G12 A;  2LFB A;  3OSF A;  5F08 A;  1HOM A;  5IP6 A;  4X1E A;  3OIO A;  4I76 A;  5BNG A;  4MO7 A;  1TWH J;  4A3E J;  2CUF A;  2CQQ A;  1S7E A;  1ZR4 A;  3S15 J;  2G0E A;  4DYR A;  2X6O A;  1ENH A;  4BXX J;  2LVS A;  2ME0 A;  1E3O C;  1BJZ A;  1MH4 A;  1HCR A;  2TCT A;  1JJ6 C;  5E3L A;  2CU7 A;  2DMT A;  1O4X A;  1JT0 A;  2DN0 A;  2DJN A;  5FLV A;  2LD5 A;  5EG0 A;  5DS9 A;  3LSR A;  2EZH A;  1SAN A;  5F04 A;  4ABZ A;  3LNQ A;  1LE8 B;  1ETY A;  4MLO A;  1MBF A;  3LSP A;  3TP0 A;  4W97 A;  1JJ8 C;  1JKQ C;  2PMZ N;  3FK6 A;  5JLW A;  3CCY A;  4QSH A;  1MH3 A;  4FTH A;  1FIA A;  2AO9 A;  2R5Y A;  2OF7 A;  4B4C A;  4A3D J;  3DCF A;  4CYC B;  3W6V A;  1X58 A;  2KT0 A;  2DMN A;  1FTT A;  1JTY A;  2LY9 A;  1GT0 C;  3BTC A;  4A93 J;  2EZK A;  3TW7 A;  4AC0 A;  1ZR2 A;  1AKH B;  4A69 C;  1JUP A;  3M4O J;  2NVY J;  3HBL A;  3HKZ N;  2R5Z A;  1Y1W J;  3CDL A;  3HOY J;  4FE7 A;  4DZJ A;  4JP0 A;  4XRM A;  2K9S A;  1U9N A;  1I6H J;  2IAI A;  3BG3 A;  5C4J J;  3S16 J;  2XRL A;  3GBG A;  4XRS G;  2E19 A;  3LOC A;  1TWA J;  1POG A;  1OJL A;  3PO3 J;  5IOZ A;  5E3M A;  1IV6 A;  2NOG A;  2LP0 A;  1VF9 A;  2DA6 A;  5E3N A;  2NVT J;  4A3J J;  1JKR C;  1OCP A;  5F0H A;  4D5C A;  1OFC X;  1FIP A;  5EEA A;  2K40 A;  2DA2 A;  1ETK A;  2IBD A;  2DTZ A;  4FCY A;  1SFO J;  1IC8 A;  2CRG A;  5K7Z A;  3L1P A;  1RES A;  3QPS A;  1RKW A;  1ETO A;  3A01 B;  5DTD A;  5IP9 J;  3LSG A;  1GV5 A;  1X2N A;  5F0C A;  1HF0 A;  5EZH A;  2XGD A;  4D7N A;  2OPT A;  4UUS A;  1YRN A;  2LR8 A;  1PUF B;  5C44 J;  1OCT C;  3SJM A;  1JUM A;  1I50 J;  1XC5 A;  2HXI A;  3S14 J;  1MSE C;  2E2J J;  4JX6 A;  2LLK A;  2YS9 A;  1ETW A;  1FTZ A;  2VUM J;  1JKO C;  5EDN A;  2ID6 A;  1LFU P;  2JA8 J;  5IPA A;  1WGX A;  3OSG A;  4XK4 A;  2M8G X;  3S2H J;  4B3A A;  1D5Y A;  2VPR A;  2JK3 A;  4A3I J;  4A3B J;  5FKM A;  5FJ8 J;  3JRH A;  4Y7N J;  1GV2 A;  2M0C A;  3HDD A;  1U78 A;  3B6C A;  1IRZ A;  1FEX A;  3BT9 A;  2IEK A;  3DEW A;  4MFD A;  4L5E A;  2VI6 A;  1BL0 A;  2X48 A;  1U9O A;  1JKP C;  3BG5 A;  5C3E J;  1B72 A;  3G1M A;  3RQI A;  5EZG A;  5EGO B;  4A3G J;  1FJL A;  1TWF J;  2NS8 A;  1I3Q J;  2LTP A;  1JTX A;  3JRI A;  2ECB A;  2HI3 A;  3RKQ A;  4BY1 J;  2EZL A;  2AHQ A;  3NAU A;  2L9R A;  4D5F A;  5M5Y J;  2O9L A;  2L7M P;  5E3O A;  1ETX A;  1JGG A;  4MIM A;  1W0T A;  2JWT A;  2GLO A;  5IYC J;  1X2M A;  3SFI A;  2DMQ A;  1B8I B;  1DU0 A;  3LSJ A;  3BR1 A;  2JN6 A;  2CUE A;  4IHX A;  4XID A;  3Q0V A;  5GPA A;  3I4M J;  1CQT A;  1Z0X A;  2EQR A;  2Y2Z A;  2O8K A;  4A3L J;  5FKO A;  1QPI A;  1JUS A;  4HNV A;  1R9T J;  2XPW A;  4JYK A;  3S17 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...