3TEDA

Crystal structure of the chd1 dna-binding domain in complex with a dna duplex
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
261
structure length
229
Chain Sequence
b'DMDSIGESEVRALYKAILKFGNLKEILDELIADGTLPVKSFEKYGETYDEMMEAAKDCVHEEEKNRKEILEKLEKHATAYRAKLKSGEIKAENQPKDNPLTRLSLKKREKKAVLFNFKGVKSLNAESLLSRVEDLKYLKNLINSNYKDDPLKFSLGNNTPKPVQNWSSNWTKEEDEKLLIGVFKYGYGSWTQIRDDPFLGITDKIFLKKVPGAIHLGRRVDYLLSFLRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromo domain-containing protein 1
publication title DNA-binding domain of Chd1 in complex with a DNA duplex
rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein/dna
total genus 83
structure length 229
sequence length 261
ec nomenclature ec 3.6.4.-:
pdb deposition date 2011-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18196 Cdh1_DBD_1 Chromodomain helicase DNA-binding domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3tedA02
5J1RA 1K83J 4A3KJ 2O8KA 3TP3A 4QTRA 4A3DJ 3S1MJ 2FD5A 2YS9A 2DA7A 2EQRA 3TW6A 1ORKA 3BG9A 3OOUA 3LNQA 1XG1A 2JA5J 2R92J 3M4OJ 3JRIA 1GT0C 2HI3A 1JUMA 1OCPA 4RBOA 1ZTRA 3JRGA 1B8IA 3WHCA 2LK2A 2YUSA 3D1NI 1P7JA 5GP9A 1JKPC 5IP6A 4UUSA 1GVDA 1MBEA 2TRTA 1H89C 4XRSA 4A69C 1IGNA 2LP0A 4CYCB 4DW6A 1A6IA 4XICA 2PMZN 3HGGA 4A93J 1XS9A 4M3BA 2VKEA 4BBSJ 1LFBA 2HQ5A 3G1LA 2LVSA 1RESA 4DYCA 2KDZA 4MLOA 3BG3A 3HB9A 2JA8J 2O7OA 1IC8A 4QIWN 3TW7A 1ETYA 2ID3A 4A3IJ 2NVQJ 5EYRA 1X2MA 1HCRA 1PUFB 3PM1A 5C4XJ 4Y7NJ 2IEKA 3H3VK 3GTLJ 1IDYA 1MSFC 1ETKA 1WGXA 4X1EA 2VKVA 1WPKA 3CMYA 3GTQJ 2HXOA 1UMQA 5FKOA 4LOCA 1H8AC 3FK7A 2Y31A 2GM4A 2KT0A 2G0EA 3ZQIA 4HNVA 2M34A 5FJ8J 2Y9ZA 3UKGA 3GBGA 2K9QA 3OIOA 3PO2J 5DS9A 3HOVJ 5E3MA 4BXXJ 2M2EA 3BR2A 5BNGA 2K40A 1MNMC 2K9SA 2K9NA 4MIMA 1WI3A 4XK4A 5C44J 3Q0VA 3JRDA 4C3IJ 1JTXA 3F0CA 2LD5A 1OFCX 4FE4A 5F0FA 3GTPJ 1ZKGA 3HOZJ 4A3CJ 1Y1WJ 2JK3A 3LSGA 1HDDC 1QPIA 2R7ZJ 1A5JA 3BQZA 1JGGA 1TWFJ 1F43A 2X48A 2JA6J 3GTJJ 4A3BJ 3L1PA 3HEFA 4NDLA 2I10A 3NARA 5EZHA 2LLKA 3CQZJ 1ETVA 1IJWC 4EEFG 3BR0A 3A01B 2LTPA 2OF7A 4RDUA 3OSFA 2FQ4A 5GPCA 1RETA 1U78A 2XB5A 2AHQA 5E3LA 5EEAA 5M5YJ 2IBDA 2XPVA 1IDZA 2NVXJ 3HOXJ 3W6VA 4JYKA 5C4JJ 4XIDA 3S1NJ 2XPWA 2XGEA 1DU0A 2JWTA 1TWGJ 2TCTA 5JLWA 1O4XA 5F1JA 5IP9J 5IYCJ 3RZOJ 1DU6A 5F04A 3NAUA 3MVPA 3HDDA 3CDLA 3MKLA 1LE8B 2LY9A 5M5WJ 1LFUP 1NK2P 1MBKA 3BTJA 5F0HA 5F27A 5F08A 2NOGA 2XSDC 2E2JJ 1HOMA 1SANA 2EZLA 1TWHJ 2DMNA 1JUSA 1VNDA 2E1OA 3ZQCA 2ECCA 1BA5A 2DMQA 4JX6A 2ELKA 1AKHA 1B72A 1I3QJ 2O9LA 3SJMA 1U8BA 1POGA 3HM5A 2QF7A 1UHSA 1MBGA 2VPRA 2Y0SN 2LKXA 4A3EJ 1Z77A 1P7IA 3A02A 2L7MP 4D5FA 2L7ZA 1NTCA 2DA3A 3MN2A 1ZGWA 1NK3P 3BQYA 4C2MJ 5DTDA 4M3GA 2H8RA 2JA7J 2OPTA 3JRBA 2VUMJ 1X2NA 1I50J 1YRNB 2NS7A 2D5VA 1R9TJ 1Q1VA 2AO9A 1OCTC 3BTCA 3E7LA 4FE7A 4B3AA 3HKZN 4A3MJ 2ME0A 1UG2A 4G12A 3RQIA 3OSGA 1MH3A 2DA2A 3LSRA 2HOSA 2WAQN 1FIPA 3HOWJ 1TC3C 2EH3A 1LE8A 1AHDP 3PO3J 3LSJA 1WH5A 4MFEA 2M9HA 4AUXA 3ZQHA 4AYBN 1IG7A 2XB0X 1BJZA 3G1OA 3BT9A 1GV2A 4V2GA 4W97A 1ETQA 5M3MJ 1GDTA 4M3FA 2DA1A 5JLXA 2ZB9A 2MG4A 2R0QC 3GTMJ 3FISA 1MSEC 4CYCA 3HOYJ 1U9NA 2QCOA 1ITYA 5C3EJ 2L0KA 3QPSA 5FKKA 1FJLA 1ENHA 2CUEA 3A03A 3IH4A 3DEWA 2DMTA 1MBHA 2DA5A 1CQTA 4A3FJ 2X9DA 3FK6A 1YRNA 3GTGJ 1WCMJ 3JRAA 2CJJA 1JT6A 4FISA 3BTIA 2E19A 1ZR2A 2DMUA 5J1UA 1ETWA 1PUFA 5M3FJ 3BR5A 3K2AA 4XRSG 2R5ZB 4DZJA 2LR8A 2EZHA 1ETOA 2XGCA 2XRLA 1GV5A 2HOTA 3QQAA 2E2HJ 1JKRC 3JR9A 1I6HJ 1GUUA 3VPRA 2CRGA 3FIWA 1ZK8A 3C2BA 3I4MJ 4DZPA 2XGDA 2CUFA 5EZGA 2M8GX 1B8IB 4XRMA 1F36A 5HODA 3JRCA 1RKWA 2JMWA 4IHVA 4I76A 5EGOB 3BG5A 1QVUA 2DTZA 4BY7J 3S2HJ 1JJ8C 3S1RJ 1SFOJ 4B1RA 4V2FA 5E3OA 4UUTA 4J19A 4FCYA 2HDDA 4MFDA 3JRFA 2FX0A 2DJNA 1Y1VJ 1JTYA 1OJLA 2RAEA 1MBFA 2P81A 3CCYA 3BR3A 5IOZA 3JREA 2DN0A 2HOAA 1XC5A 3JRHA 3O8HA 3S16J 3Q0WA 3LOCA 1RKTA 1T56A 3WHBA 4FTHA 2EBIA 2NVYJ 2W48A 3LSPA 1FTZA 4ABZA 3SDGA 3A01A 3IH3A 1JT0A 2R5ZA 3DCFA 4M3DA 5M5XJ 4D7NA 1BW5A 5IYBJ 5EDNA 4AC0A 5IPAA 3M3YJ 3BR1A 2XPUA 2Y30A 2DA4A 5FLVA 1X58A 1WH7A 2L9RA 3RKQA 3S15J 3B6AA 4A3GJ 1QRYA 9ANTA 1AU7A 4BBRJ 1QVTA 3IH2A 2Y2ZA 4S0HB 4IHYA 5EGOA 2CQXA 5IOYA 1BW6A 4Y52J 3TP0A 5FKMA 4A3LJ 4L5EA 1E3OC 5IYDJ 2WV1A 1VFCA 2EZKA 1FEXA 1ETXA 5EG0B 1T33A 2JN6A 4IHWA 3GTOJ 2MSYA 2ECBA 5FKNA 4D5CA 4DYQA 1HLVA 1VI0A 4C3HJ 5J1YA 2N8GA 5FLMJ 1JJ6C 2IAIA 1EF4A 1MBJA 2NVTJ 1Z0XA 3K7AJ 2DMPA 3Q3SA 1JKQC 2FJ1A 4D7MA 2CQQA 3ZOBA 2GBYA 4BY1J 1JKOC 1D5YA 4JX5A 2MGQA 1JUPA 5K7HA 2WB1N 1IRZA 3HOUJ 2HYJA 2M0CA 2R5YB 4BKXA 2L7FP 3ZQGA 5F0CA 1ZQ3P 2DA6A 5EF6A 1W0UA 3ZQLA 2ME6A 1FIAA 1K61A 1RPWA 4JX4A 2JJ7A 1IV6A 3ZQFA 3S14J 3Q0UA 3SFIA 3S17J 1TWAJ 3QPLA 4IHXA 3GTKJ 3IV5A 4M3EA 1MH4A 1BL0A 2HXIA 4M6VA 5EG0A 1ZR4A 2X6OA 1W0TA 1FTTA 5FKLA 1AKHB 3O8GA 1B72B 3H0GJ 4C3JJ 4UUSB 5E3NA 3S2DJ 2CU7A 1VF9A 2VI6A 1RR7A 2NS8A 3HGYA 4DYRA 2R93J 3B6CA 1H88C 1HF0A 4X6AJ 2ID6A 3BTLA 4GFBA 2LFBA 2EZIA 5GPAA 2MW8A 2Y9YA 1TWCJ 3RZDJ 4MO7A 3G1MA 1IUFA 3TEDA 3I4NJ 1U9OA 4QSHA 1APLC 1G2HA 4JP0A 1S7EA 4IEJA 3BR6A 2B63J 4B4CA 5IP7J 5K7FA 2COBA 4W1UA 4I6ZA 1HDPA 3S1QJ 2YU9J 2H1KA 2R5YA 3HBLA 2GLOA 4A3JJ 5J3LA 3FKIJ 5K7ZA 2E2IJ
chains in the Genus database with same CATH superfamily
1I1GA 1K83J 1Q1HA 4IO9F 1VQLI 4A3DJ 1X1BA 1MMSA 2EQRA 3O6BB 3BG9A 3OOUA 3VEPA 1VQMI 1OR7A 2XRNA 4L5IA 2DK5A 3M4OJ 5K1YA 1B1BA 1MMGA 1OCPA 4EVIA 1YJNI 2FRHA 4OIPF 1B8IA 2LK2A 3B73A 2ZMEB 2WWYA 2O0YA 1WJ5A 4HQMA 4UVCA 3IRRA 5DD4A 5H20A 3SFZA 4A69C 4F92B 4XRSA 1IGNA 1KA8A 2RREA 3N97A 1XSVA 2L7KA 3EQLF 1A04A 5D6FA 2VKEA 4HEA2 2R7QA 4CCJA 2KDZA 3BLYA 2VE8A 3HB9A 2LKPA 3HOTA 2NNNA 4IF4A 3M07A 3RQ4A 3TQNA 1IC8A 5DCMA 2KPMA 1ETYA 2ID3A 2NVQJ 1Z91A 1HCRA 4PFPA 2X6XA 3PM1A 3I9V2 2LY1A 4HDVA 2BY3A 4HX7A 3I0TA 3C1DA 1U8RA 1Z7UA 1QA6A 1IDYA 3RYRA 3GTLJ 4GCVA 4F3QA 1WHUA 2VKVA 5CVVA 2UWMA 4EGZA 2EK5A 1WI9A 3KP7A 1W5TA 3PIOF 1ZH5A 4A5NA 4AWXB 4KISA 3FK7A 4WXCA 3H9GA 4XQFA 2KT0A 1KQ8A 1TQIA 1IXRC 3AL0B 3PNTA 1P4WA 2MC4A 4BE2A 1DGRM 1MJBA 3OIOA 3PO2J 5E3MA 2EILH 3MZYA 4BXXJ 1IN5A 2HDWA 2K9SA 2V1DA 5HLGA 2YSRA 3L7WA 4MIMA 1G8XA 1WI3A 3BWGA 4XK4A 4KIGA 4C3IJ 2A6HF 3H3ZA 4ENNA 4KJZA 1E0EA 1ZKGA 2G9WA 2HNHA 2CV0A 4CGZA 4L9TA 3LSGA 3KFWX 3KP6A 1U5TA 1YOVB 3WGIA 2FBKA 3G3ZA 2VT3A 1S3JA 2PBIA 4OMZA 1NHAA 4OIRF 5ILVA 4CZCA 4XKWA 2CFOA 5DCFA 3L1PA 4B48A 3OMYA 4HAMA 2XGXA 3J80Z 4E7HA 1FPQA 2LLKA 4D9JA 3GEZA 2FNAA 1WJBA 1W1WE 2BXYA 4B3XA 5KK1A 2FOKA 2V7FA 4MNUA 3SXYA 2R4GA 3P5JA 2RVCA 1NG6A 2MD5A 1X1CA 5M5YJ 3TO7A 5KAFC 2IBDA 3K0LA 4Y33A 2KDOA 2XPVA 1MMDA 2RC4A 1YS7A 4RGRA 1MMAA 4XIDA 2HVSA 3OIQA 2XF7A 2XGEA 2TCTA 3HIFA 2IS1A 1DDNA 2DO7A 2FXAA 3PUFA 4KMUX 3KPHA 5E1ZB 5F1JA 5IYCJ 2KIQA 2VPLA 3V7RA 3HDDA 4CSWA 3CDLA 1LE8B 1EA3A 1MMNA 4MQ9F 5M5WJ 1FY7A 2FF4A 1NK2P 2QSHX 3ELKA 1V5FA 1D1CA 1LFPA 3J7ZI 2E2JJ 2NOGA 1I39A 2VQLA 1QZYA 1EH7A 3M9AA 4RAYA 2LREA 3I53A 3WTSC 3ZQCA 2DOFA 2OAZA 4XN0A 2ECCA 1WJFA 5E8GA 4UVBA 2W57A 1R22A 2HU9A 4HA8A 1B72A 2D2WA 3IWZA 2ELHA 5KVRA 2ISZA 1IW7F 2O9LA 1FC3A 1RI7A 1X3WB 4BH9A 3QP6A 2A68F 2KKOA 2IPQX 1VQNI 1P7IA 3A02A 1HKSA 4LB6B 2K4JA 1NTCA 1DP3A 3BQYA 1YX5A 4C2MJ 3F9KA 3BJOA 1Z6RA 2E1NA 3RPQA 4X0GA 3PSIA 3ZP5A 3CCVI 2OPTA 3PFYA 1G6NA 2D5VA 1FSEA 1R9TJ 2O03A 2V6EA 1I6XA 4XMYA 2ZSHB 2YR2A 1FYLA 4YIFA 2BV6A 3VSKA 2P8TA 1SAXA 2VT2A 3CC7I 2HGCA 4XKVA 4B3AA 2PLYA 2BGCA 2ME0A 5D5XB 2WAEA 1YW8A 3A2KA 3VSLA 3OSGA 4HYEA 3LFKA 5J40A 1QHHD 3CCLI 3OYGA 2HOSA 3KYDB 2EH3A 3H35A 3O3KA 3I58A 3LSJA 1TNSA 1W7PD 2FOWA 1Z3XA 3ZQQA 1YJ9I 5LGTA 5K5OA 4ZYGA 1HW5A 3ZQHA 4CUGA 4ZJZA 3IKVA 3KZIC 4HX4A 3S2WA 2Y0MA 1F5TA 2VL8A 1ZLKA 4LIUA 4NBQA 2Z3YA 2DA1A 3FX3A 3L2VA 2PQ8A 2A6EF 1R4MB 1FMVA 1KYZA 3ECOA 3KIOA 2STWA 1ZG1A 2B0LA 1U9NA 3CDHA 4G6TB 3F8MA 2P6SA 1ITYA 3GCMA 1JHFA 1PYVA 5C3EJ 4UY8I 1FJLA 1MDMB 2RQPA 3A03A 3IH4A 3DEWA 1E2XA 1XGSA 2ZO4A 2RN7A 1FOXA 2X9DA 1YRNA 1O7FA 2LY2A 3VWBA 2L9SA 4CHUA 4NC7A 4FISA 2UV1A 2VC0A 2E1MB 2WAFA 4E7ZA 3L09A 2DMUA 1ZR2A 2LMDA 2DI3A 2JT1A 3K2AA 2LR8A 3DBLB 2XGCA 1B6AA 1GV5A 3RJPA 1VQ4I 2E2HJ 4M72A 1BR4A 1JKRC 1X1DA 4E7IA 2PMUA 3FIWA 1ZK8A 2K9MA 3LA3A 3FDYA 4IJAA 2M8GX 4EMSA 1F36A 1QZZA 3JRCA 4XLEA 2IGOA 3K4KA 3TOBA 3LSHA 3SYTA 4IHVA 3K4LA 2CW8A 2DOAA 1QVUA 4MTEA 2NXNB 2EFOA 1JJ8C 1ZRCA 4DQ2A 1ZGAA 2F5FA 1LPQA 2LKSA 1YW9A 4MFDA 2DYRH 2WC2A 3D5LA 4GYGA 1JTYA 3OYBA 3LL7A 3UNGC 2P81A 2I5UA 3PSFA 4AVPA 2JZYA 2O6GE 4FHTA 2DFFA 4HNUA 4ENJA 3H9QA 3K1PA 2HOAA 4M73A 5D6EA 4AD9A 1WVRA 1HW1A 5LLQA 1ZYRF 3S16J 1NH3A 1K6YA 2JVHA 1T56A 4FTHA 3RCOA 2CUJA 2NVYJ 2W48A 3LSPA 1OMIA 2IA2A 3CCUI 3F8NA 1C0WA 4Y3OA 3IH3A 3GF2A 2R5ZA 3Q5FA 2ZNZA 1T6SA 2ADUA 2AXTC 3KZZA 3ABTA 4JBAA 1H9GA 1R1VA 4HBLA 4PJMA 3V7SA 5JFRA 5IPAA 3L2RA 3M3YJ 1QU3A 2ZBKA 2E7XA 3CUQB 1MJ9A 2XAGA 2DA4A 3ROUA 1ZARA 3JW4A 3K4MA 5FLVA 2UZKA 4PSXA 1LDKB 1LEBA 5KCMA 9ANTA 5TISC 1EH6A 4BBRJ 1W4MA 3K6GA 1FWZA 1F1ZA 3WU2C 5EGOA 2CQXA 2W00A 1FP1D 2QLZA 2YX7A 3LWFA 2IA1A 2UUZA 4WXDA 4KYWA 3GLLA 5CVJA 2EZKA 4DNCA 4PJJA 4IRIA 2IXSA 1ETXA 3CUOA 5EG0B 2JN6A 4YIRX 3OYIA 5A2QZ 4G7HF 2MSYA 3CF2A 5FO5A 2ZJRF 3QPTA 4MGRA 1LKXA 4AM3A 4ZDPA 1VI0A 1IN7A 1I1SA 3H92A 2XC7A 2VOOA 1DQUA 2IAIA 4F7ZA 5J4YA 4RGSA 2R7UA 2CW0F 4I0AA 4NQWA 2ZNYA 2F4MB 2L4MA 1QZEA 3HG9A 2CWEA 4NNJA 4OIOF 1TW2A 4L18B 2WA0A 5CJ9A 4F52A 3DFGA 1YW7A 2ZCWA 2LSOA 4E6KG 3OYNA 2P5LC 2GBYA 4BY1J 5DYMA 4JK1X 1XTAA 1SD7A 1AOYA 4JX5A 2MGQA 4H0EA 1JUPA 2FMLA 1YTYA 2QQBA 2H27A 5L3GA 1IRZA 1IF1A 2KLOA 2ZJ2A 3VYTB 5LGUA 2OCEA 4ZYDA 2L7FP 2L3DA 2QM3A 5F0CA 2QQAA 3BG7A 3ML6A 2DFIA 1W0UA 5LRRA 4GGGA 3HSRA 2Z33A 1KU2A 2J5OA 2ME6A 4CYDA 2GXGA 3M8JA 2XSJC 2NAZA 2Q1ZB 3MAJA 3HXLA 5LRSA 4BHBA 3S17J 4DOZA 3GTKJ 5J47A 4CA0A 2IVMA 1X19A 3W6KB 4N9HA 2DYSH 4BDYA 1PDNC 3EUHA 2IS6A 2BY2A 2V6CA 3AFHA 3E5XA 4DIQA 1OYYA 1YQAA 3OYKA 1RNLA 4ASNA 2KJCA 2MC3A 4CCKA 3AKZA 1BC8C 3KYLA 3S2DJ 2QKLB 3DU5A 2NS8A 4JOMA 4Q48A 5FFXA 2OA4A 3CTAA 3F6OA 3RYPA 3B6CA 3IAM2 1OQYA 1HF0A 1SMTA 1Y39A 1SD5A 3BTLA 3MWMA 4N4NB 2ZJQF 4NHJA 4U0VA 1LVAA 5GPAA 1WJDA 4M9ZA 1TWCJ 3W2AA 3RZDJ 3G1MA 5DCMB 3E6CC 5L3CA 2LF7A 2HS5A 4RM3A 2R7VA 3WTZA 2ISYA 4IEJA 2HQAA 5HNHA 1HKQA 1R5ID 4I6ZA 3PQKA 4M74A 2DOEA 3FHNA 4HPQA 2XROA 4HQEA 3HBLA 2ZFUA 4G8XA 4KN7X 3Q9VA 1GXQA 3QU3A 5CYVA 1JI8A 2FQ3A 2G7UA 5K7ZA 2E2IJ 4GYIA 4BXFA 2DA7A 2E60A 3DEEA 3F3XA 3N05A 4LK1F 2V9VA 2A5WA 1ORKA 3TO9A 1HC8A 3LNQA 2CUZA 3GFJA 2JA5J 4EJVA 1IUYA 4RLFA 1GT0C 3ZMVA 1JUMA 1ZHFA 3KX2A 1P7JA 5GP9A 1H0MA 1JKPC 2HFHA 4KT6A 3D5SC 4KICA 2JQ7A 2TRTA 1H89C 3LA7A 4LG0A 2QVOA 2R7OA 4PCQA 4IKFA 4K2EA 5AIPA 1U5TB 3L2QA 4XLFA 2FUG2 1XS9A 2D1VA 2V4JC 1LFBA 2HQ5A 3G1LA 2LVSA 1RESA 3T5XA 1YIOA 2A07F 4O3MA 2PI0A 3BG3A 4GXOA 2JA8J 2EIMH 3DPTA 4CXFA 1Y0UA 2FBIA 4YFKF 3H1CA 2NRAC 2YPRA 4XSXF 4BDZA 3R6SA 3H3VK 5KNLA 1MSFC 3M7GA 1ETKA 3DQVC 1WGXA 5H2FC 2MH9A 1WPKA 1BIAA 4BEHB 4BHCA 3T8RA 3LFUA 1UMQA 3HUGB 4ITVA 2G7HA 1H8AC 2I8DA 1FBSA 5H6QA 5HLIA 3U1DA 2Y31A 2VJ5A 3I3LA 4PGGA 3HYIA 2WY7Q 3JCUC 1GVJA 2VONA 4HNVA 3NRVA 2M34A 3GZ6A 1TQPA 5FJ8J 5GTHC 3GBGA 4OAYA 3N4MA 2JUCA 2JVGA 2JPBA 2XKPA 2MBFA 5FROA 3H36A 1MNMC 1D8JA 3RKXA 2ELJA 2K9NA 4KFCA 4HF2A 2M5WA 4LB5A 1XMKA 3Q0VA 2VN2A 4FE4A 5F0FA 2HPIA 3VFZA 4WWCA 3HOZJ 2DODA 2JK3A 4A12A 1ZRDA 1QPIA 3WODF 3F6VA 3J7AO 2KIUA 3CP8A 1JGGA 1TWFJ 5ICEA 2O61A 2X48A 3CJNA 1OKRA 1DPRA 3LAPA 4C2TA 1S7OA 3GTJJ 4A2UA 4P1WA 2XF5A 1TBXA 2BXZA 2EV5A 5BMZA 4L9VA 4WX9A 2I10A 5EZHA 3VODA 2VIXA 4KUMA 1IJWC 4XORA 1QO0D 3BR0A 1XMXA 4KITB 2M7AA 4RDUA 5GPCA 3BC8A 3DPLC 5EEAA 1R58A 3PL8A 2NVXJ 2KP6A 3HOXJ 3W6VA 5C4JJ 3EYYA 2OV7A 4KIFA 3C2HA 4ENMA 4UB8C 4AU7A 1DU0A 2HVRA 4UV8A 4AIKA 2DJIA 3V4GA 3FXLA 4KMFA 1O4XA 4HLXA 1TLHB 3RZOJ 4PUSA 3ESWB 3K10A 2BW3A 3MVPA 3HRUA 2BY1A 1LNWA 2CSOA 1LFUP 2F6CA 4OMYA 5F0HA 2LOOA 1XGNA 4QLCU 2W25A 2MH2A 3RKWA 2XSDC 2M4GA 1HOMA 1SANA 3IL2A 2EZLA 3GXOA 1BM9A 1IV8A 4II3A 4II2A 4M9SA 3FXOA 2E1OA 4D0PA 2XAQA 2OZ6A 1UFMA 2GA2A 4D1QA 1I3QJ 3DWLE 2DQLA 3H9JA 1WJCA 2KIMA 4A0ZA 3S3OA 1U8BA 3JAMK 3HM5A 1QBJA 1Z05A 3TBIA 2HQNA 1MBGA 3ABUA 4O5VA 4UNOA 1OYWA 2HDCA 2IGMA 4D5FA 1R36A 3IAS2 2A69F 2DA3A 3OYJA 1ZGWA 3MKYB 3A1YA 5DTDA 1SD6A 2Y48A 3GYHX 1XCBA 3JRBA 3FXKA 1P9QC 4Y15A 1FMWA 1IRGA 4BJ5C 3U21A 1YRNB 4KIBA 2OC6A 1DUXC 2EJRA 3REOA 3RPUA 5K5QA 3GLXA 3BTCA 3E7LA 3GWZA 4FE7A 2V1NA 3HKZN 2KQRA 4G12A 2R7WA 2X4HA 1T95A 1MH3A 2JA2A 3FBIB 5E1XA 1D5VA 3HOWJ 3PO3J 1ZGJA 2DCEA 3NWSA 1Z67A 4OWRB 2A05A 2Y69H 4QPQA 1D1BA 1IG7A 2PN6A 4L5JA 3TDUC 4B8XA 3CCJI 2KISA 3CLOA 4V2GA 1TW3A 2VKDA 2ZKZA 3WU0A 1YG2A 5JLXA 4U0WA 3E1SA 2LNBA 2BEOA 2HZDA 5E79C 3FISA 3MZHA 1MSEC 2K3FA 1FYMA 5FD5A 2W24A 1S6LA 1ZLJA 3I5UA 1VZ0A 5FKKA 2RGVA 5B5EC 2DMTA 2P5KA 1G3SA 1MBHA 2DA5A 4ZDLA 1SFKA 4A3FJ 2MD0A 1CQTA 1WCMJ 2COMA 5D8LB 3FKJA 4BYYA 2X51A 4WXHA 1FLIA 5J1UA 1ETWA 1KYWA 3R61A 4XRSG 3S3MA 2R5ZB 3G73A 3JTHA 4AIDA 5JVTA 1SFXA 2HOTA 5IT9K 5JI6A 3QQAA 1ACIA 4BEHA 3HUGA 1O3RA 3F22A 3C2BA 1R49A 4DZPA 5JR3A 1V54H 1I27A 4Q5SF 2WY8Q 2CW7A 2JMWA 2ZXJA 4LK0F 1UB9A 3KLOA 4ESBA 5EGOB 2B7EA 1J9IA 3BG5A 4BY7J 1FX7A 4ZYHA 3S1RJ 4B1RA 4V2FA 5E3OA 1ZRFA 4UUTA 4J19A 5IT3A 4HV5A 4PK4A 1Y1VJ 3FBNB 2CFXA 5DM7F 4XOTA 1MW7A 4XKBA 2EA4A 3CC4I 5H6RA 2ZJPF 4F93B 2LRDA 3EUKL 3JRHA 4ZC3A 3GMEA 4PJ0C 1J59A 4NQWB 3BG6A 3WHBA 4EV0A 1FT9A 4PSWA 1S8NA 4ZYEA 1O3SA 4GO1A 1Y0NA 2W4SA 2STTA 1BJAA 1BW5A 1VQ8I 2L4AA 2IT0A 4NC8A 5IYBJ 5EDNA 4AC0A 2PJRA 3BR1A 2Y30A 3H5RA 2HPMA 5LD2C 2JPCA 3BZCA 3D0SA 2HEOA 4P9FA 4HF0A 2RNJA 1UZCA 2K86A 4A0YA 2HQRA 4U0YA 3B6AA 1QRYA 4U7DA 1J75A 3KCCA 4BAYA 3FXJA 5J8FA 2K85A 3FF5A 4Y52J 5FKMA 2EFNA 4M6YA 1R5HA 1E3OC 2ESHA 5DV5A 2XV4S 2KJBA 3CP2A 2A5YB 3UR3C 1FEXA 4V19K 2KIFA 3E6MA 1T33A 2PX9A 1ERDA 5B1AH 2OQGA 3U9GA 3S32A 4MTDA 3HJEA 4D5CA 3HRTA 4EQQA 2YX4A 4WCGA 3DLAA 3WTWC 3MD2A 4H4KC 3JAMZ 1D1AA 2KMUA 2VE9A 3W6JB 2VJJA 2H6BA 2L02A 3JSPA 3QYEA 4N9IA 3I64A 2W1OA 2VQHA 2VASA 3M8EA 1JGSA 3BOQA 4D7MA 2CQQA 3J81K 5D8KB 4HNTA 1OLTA 2WADA 3HPGA 3MEXA 2RQQA 4LIVA 5HLTA 5CQEA 2DT7B 1E3PA 5CVUA 1TP4A 3DBRB 3KLNA 5F6FA 5ICCA 3NQOA 1A31A 3ZQGA 5BOXA 4ETSA 2VXDA 1ZQ3P 2DA6A 3K2ZA 4G6QA 5LGNA 2WAQA 3DKYA 3KZYA 3LAJA 1B9NA 1RPWA 2DU9A 2XUBA 1HBXG 2JJ7A 2MA3A 3DLLF 3CO6C 4ZYAA 3J7YJ 1IAWA 1VQOI 5D5WB 3CD6I 3JSOA 3FXUA 4HRIA 4IHXA 2EFWA 2L2OA 2P6TA 4QPOA 3R0JA 4PFOA 1V3FA 1K6OA 1OYIA 2EIJH 4M6VA 2X6OA 1U0JA 4GRIA 2H1LA 5ERIA 1YJWI 1X4PA 3BJ6A 4A6DA 3A0BC 3OOPA 2IGKA 4YG2F 5HS8A 1R00A 3H0GJ 5BQTA 1T0FC 2NNYA 4LG0B 1VQKI 4ANJA 2BHYA 4IOCF 1PP7U 2FEZA 1G3WA 1GLNA 1HKTA 1TT0A 5B3SH 1G3YA 2LFBA 3QYBA 3F8FA 3ISPA 3X2QH 3T0YA 5GTIC 2MW8A 4BE0A 1IO2A 5AONA 2VQGA 1R1UA 2XAUA 3CDIA 2XVCA 4L0YB 4CCOA 1OCZH 2W7NA 1U9OA 3ZPLA 1G2HA 4JP0A 3GZ5A 2B63J 4ZTFA 5BPDA 4B4CA 5K7FA 2QBYA 2COBA 4W1UA 3S1QJ 3K69A 4QWQA 2YU9J 4RB0A 4I98B 2R5YA 1TNTA 4A3JJ 5IT9Z 4ON0A 1N75A 5J3LA 4CCLA 3FKIJ 3IC7A 3GUDA 2XAJA 5J1RA 2O8KA 5GADJ 3LSMA 3TP3A 2VB6A 3ABMH 3S1MJ 1J0RA 2FD5A 1LDDA 1E17A 4BQAA 3FM3A 4BS9A 4ZH4F 1XG1A 2R92J 4FQGA 3AG2H 3DKWA 4L0ZB 1PP8F 4RBOA 1ZTRA 3CMEI 1X1PA 3RTRA 4PJNA 5IP6A 5LHHA 3Q9SA 4UUSA 2FBHA 1W5CC 2LP0A 4C30A 4DW6A 4I09A 3QODA 1P6RA 2GOXB 2QKMB 4A93J 1MGTA 1ON2A 3HTUA 4IXAA 4LG3A 4DYCA 2K7LA 5HDNA 2JSPA 2VBYA 3BCBA 4MLOA 4LLNA 5DM6F 5KAIC 1W7PA 2OJED 2TDXA 2O7OA 2F4IA 3JTGA 2LC2A 4QIWN 3TW7A 2O8XA 4Y7NJ 4KT5C 3OYEA 5JHFA 3F72A 3R60A 4PDKA 4CO8A 1DP7P 2XHKA 1N25A 1HQCA 3TDZC 5GAGJ 2PMHA 3CMYA 3GTQJ 1M1EB 2EA2A 3IWFA 4LFUA 2DDBA 2DQRA 3DF8A 2MABA 2L9VA 4EM0B 3CMMA 3E97A 4Q47A 4E7LA 1UCRA 3ZQIA 2Z16A 1SAUA 4M71A 2Y9ZA 5LFAA 3LSIA 2K9QA 2EB7A 4JQFA 4CH7A 5DS9A 3HOVJ 2M2EA 2J5PA 3HRMA 2K40A 3I59B 4ZDOA 3VYUB 4RS8A 5LEJA 4HSTA 2BW3B 2JTVA 3JRDA 3H5AA 2LD5A 3F0CA 4J00A 1V5EA 1RC9A 1OFCX 2AXLA 3LA2A 4HF1A 4A0XA 1O3QA 3CESA 2OCCH 1R4NB 1XSXA 1D3YA 1RZ4A 2EIKH 2OD5A 1ZG3A 1Y1WJ 1JXSA 3FZVA 3S93A 1HDDC 3LQQA 4XBFA 5JHUA 4AYBA 1RUNA 1KU3A 3KEQA 2BVMA 3AG3H 3FMQA 1KGSA 2F48A 4XLNF 1RRJA 3CCEI 2JA6J 4TV7A 1UHWA 3AG1H 4A3BJ 1WJEA 4FX0A 2RDPA 1T0FA 5ILSA 2HVQA 4NDLA 2FSWA 3CQZJ 5J6XA 5E17F 3IKTA 3BCAA 3H3UA 4EEFG 3A01B 4IVNA 2OF7A 3SEQA 3J81Z 4E7KA 3EUAA 1RETA 2CQNA 1U78A 2E7WA 2FNPA 2AHQA 2JSCA 4B09A 4IHTA 3SDBA 5GAHJ 4N0BA 1IDZA 1FNNA 2MLGA 3HRSA 3S1NJ 1T08B 2XPWA 3T8TA 1K78B 1FYKA 2JWTA 2GZWA 4IPAA 4I2OA 1R23A 5TJJA 3DTKA 1QNTA 2PEXA 5JLWA 1EH8A 1U3EM 2R7DA 3MZ8A 3S8PA 3GX4X 5TRDA 1DU6A 3NAUA 2HR3A 3TGNA 2DPDA 1TT5B 2NS0A 2X6YA 2LY9A 2DT6A 3R4KA 5E20A 1KONA 3BTJA 2M1BA 2B9SA 4KDPA 4IZZA 2ZC2A 5F08A 5K5RA 3DKXA 1IRXA 1TWHJ 5HVQC 4RB3C 2BHZA 5HDKA 4P96A 2DMNA 1JUSA 1ONVA 1BA5A 4RAGA 1IN8A 2DMQA 4JX6A 2M3AA 4Z2YA 3ERED 4EM2A 3SJMA 2EWNA 2QQ9A 3KE2A 2QEXI 3FXMA 3CCQI 1ZN2A 2QWWA 3VB2A 5ED4A 2LKXA 1P92A 2L7MP 2MFZA 2GXBA 3MN2A 4LITA 1D0ZA 2P0WA 4IQJA 4I99C 3SZTA 1X4OA 4M3GA 2JA7J 4NB5A 2VUMJ 1X2NA 1FOWA 1I50J 2DFHA 3OYHA 1IN4A 3CF5F 2R7SA 3CZ6A 5L3BA 4ZZDA 4FETA 2AO9A 4CCMA 2F5VA 2XAHA 1X3ZB 1XX5A 3M1CA 3ZGKA 1R5GA 5HS9A 2UXNA 2W85A 3E6BA 3K70D 3KP4A 3RQIA 2CG4A 5BS6A 1MZBA 2VKHA 2E71A 1FIPA 5KHDA 1TC3C 1AHDP 2GAUA 1WH5A 1MJAA 4UVAA 3K70C 2XF6A 3F21A 4AIJA 1MNDA 2Q2EA 3WGHA 4L9JA 1BI0A 4RA2A 4AYBN 1BI3A 2XB0X 2ETHA 1UAAA 2CGPA 1GV2A 4W97A 1ETQA 2FE3A 2L9NA 4M3FA 3RDIA 4XNFA 2F5EA 3GTMJ 2VQCA 1YI2I 2OU2A 3HOYJ 4HSRA 1IXCA 1REPC 2LDUA 2QCOA 1B59A 3SZGA 3P9KA 2L0KA 2PJPA 3QPSA 1ENHA 3QPHA 2OBPA 3FK6A 4RLQA 2E5ZA 3JRAA 1R1TA 2GA1A 4BU2A 3LSTA 3QP5A 4B43A 3BTIA 2KZVA 2E19A 2QQ8A 1EJ9A 3TO6A 1S5LC 4B47A 1JHHA 1U6GA 3VYSB 3K4CA 3BR5A 4AVZA 3IRQA 5M3FJ 1YIJI 2XRLA 2HOEA 1W36D 2Z1DA 1YS6A 3VYRB 1HA8A 4YEJA 5IY5H 2PJRB 2IS2A 2WB1A 2DXIA 1IXSB 1GUUA 2CRGA 3ZMUA 2XGDA 2CUFA 1U5TC 1Z9CA 3PJRA 4XRMA 5HODA 1Z1DA 1K79A 2D45A 1ZELA 5D4SA 4UUVA 1J5YA 3WTUC 5L3EA 2YU3A 5CPRB 2K02A 2Z5UA 3SHFA 1R71A 4FX4A 1Z3YA 4MEXF 3I59A 3CJRB 3ECHA 1HSTA 2HDDA 5LEKA 3L2UA 1J2XA 1OJLA 4P55A 4Q4ZF 5L3DA 1F9NA 3CCYA 4HV6A 4WF2A 3OS0A 3BR3A 1Z21A 1YFHA 3G6EI 1XC5A 5AIQA 3DPUA 1ON1A 5EEHA 2AQEA 3AAFA 2VBZA 3VDXA 4M6XA 3EYIA 3DV8A 3LOCA 3Q0WA 1S29A 3WTVC 1RR8C 2EBIA 1OCRH 1OPCA 2X1DA 2KZGA 3ZRGA 1S72I 2Q0OA 4UXNA 1FTZA 3OIPA 1JT0A 3A01A 1WKMA 4CICA 4RGUA 2K4BA 3BZ6A 5M5XJ 1H9TA 1P4AA 2ZXIA 4BUPA 2XPUA 2X1CA 2BVLA 3CCRI 1X58A 4G94A 3BPVA 3OV8A 1SVLA 1SVMA 1CGPA 1WH7A 1Y6IA 2XIGA 4RB2C 4XSZF 2GIZA 3KP2A 4GDFA 1AU7A 4U88A 4S0HB 3IH2A 1K78A 5FRMA 3OYFA 4XONA 1BW6A 3BDDA 3TP0A 2L54A 4L5EA 4A3LJ 3OYCA 3A4CA 4HZFA 2WV1A 1VFCA 1NG7A 1OISA 4IHWA 5FLXK 2CH0A 2VJ4A 5TGTA 1HLVA 3BJAA 1FP2A 5FFZA 4C3HJ 1XB4A 2CYYA 2N8GA 4DBRA 5ICFA 5FLMJ 4I01A 2OQRA 4E4HA 2VBWA 2W82A 3NEUA 2DBBA 4EJOA 2DAOA 3OWTA 2M87A 3L2CA 2PMZA 3QU6A 1EF4A 1MBJA 3V42A 3H0DA 1Z0XA 1T98A 1BOBA 4FASD 1ZG5A 4LD5A 2FJ1A 3ONQA 3WE3A 3ZOBA 5GAEJ 4B44A 4BE1A 4J01A 3G4SI 1Y8RB 3DXJF 1KU7A 2QBYB 2P5VA 5CQGA 5K7HA 2WB1N 3HOUJ 2AQFA 3DEUA 4HLYA 2CV2A 4IL6C 4L9NA 2HTJA 3I54A 3PNVA 2R5YB 4BKXA 3WTXC 1SC7A 5EF6A 2VLAA 1B9MA 1YX3A 2XAFA 2FMYA 2WBMA 4JX4A 3LMMA 5ILUA 4KN4X 1WRJA 2ZMEC 3U2RA 3MQ0A 3SFIA 1J09A 2IA0A 3HOSA 5EEGA 3QPLA 4BNCA 3EETA 5DUKA 5CKTA 1HXDA 2QZ8A 2CQ7A 1BL0A 2LYCA 3HSEA 3IP4B 2K9LA 2M30A 1GXPA 3OL3A 3RSNA 2V1UA 2Z99A 1AKHB 1HW2A 1R7JA 3C3WA 3ZMSA 2OTJI 2NVUB 3ULQB 4UUSB 3V8JA 5E3NA 3SZPA 3L2WA 3COAC 2VI6A 1RR7A 3HGYA 4DYRA 5HNFA 4CZZA 3OR2C 2E36A 2VXZA 2HWVA 1H88C 4X6AJ 2ID6A 2V1XA 4GFBA 2NYXA 4IOAF 3A0HC 5DEQA 2DTRA 2Y9YA 1W7PB 1DPUA 2RNGA 3W3CA 1ULYA 4NC6A 3MKZA 1APLC 3ZMZA 3WTTC 1S7EA 3K4BA 2BE5F 3BR6A 5FB2A 5IP7J 2DW4A 2ACJA 1K4SA 4G9YA 2QYOA 2E35A 2W84A 3AL0C 4E7JA 2GLOA 2Y75A 2KL4A 2O3FA 2P7VB 2BOLA 3HHGA 2CQKA 2CV1A 4XR6A 1HSJA 4A3KJ 3ASOH 3DBHB 1T38A 1O3TA 4C2UA 5FGMA 4QTRA 1LEAA 1YYVA 2YS9A 3F23A 3TW6A 1VTNC 3FHZA 1B4AA 3FXQA 1QHGA 2KFDA 1SEUA 1N77A 2ZXWH 3L9FA 4RAFA 3ZMTA 1CF7B 3RKYA 2E1CA 4G7OF 5A2QK 3JRIA 4YFXF 2HI3A 1T2KA 3M1EA 4BXUA 3JRGA 3WHCA 2YUSA 3D1NI 1XDSA 2DLLA 1A6QA 2GIVA 2O5RA 3PUBA 4NUBA 1V5GA 4XM3A 2QUFA 1TZLA 1GVDA 1MBEA 3C7JA 4U87A 4XLPF 1PVEA 2C6YA 1BOAA 4CYCB 1A6IA 4XICA 2F2EA 2PMZN 2K27A 3HGGA 1I5ZA 4M3BA 5D4RA 4BBSJ 1XCVA 2R7RA 2QSGX 1WSUA 4R79A 1UHMA 3IHUA 4Y13A 2IW5A 2Q8KA 4BHPA 1WWXA 1SD4A 3BPXA 3QYFA 4HOBA 2EV0A 4XLAA 3WG7H 4DGWB 4A3IJ 5EYRA 1X2MA 4RAZA 3CJTB 1KQ9A 1PUFB 2AS5F 5C4XJ 6PAXA 2Y0SA 2IEKA 2M7BA 3OYAA 3PFIA 1VQ7I 1UELB 3CO7C 1XSDA 3OY9A 3WTYC 4EJUA 1YLFA 3C18A 3DTEA 4X1EA 1WQ2A 1EKEA 2HXOA 5FKOA 2XDVA 2HKXA 4LOCA 2GM4A 1BI2A 1IRFA 2WV0A 4CCNA 2G0EA 4IRGA 3BZKA 1UJ8A 2K5CA 3B02A 4BJTA 2LG4A 2X1EA 3UKGA 1G59A 3G71I 1V4RA 3W2VA 5BNGA 3BR2A 4OIQF 4MQVA 2ZMEA 1AA7A 5C44J 3HC7A 5E18F 4PJLA 3W2WA 1JTXA 1R6RA 3ZXSA 3GTPJ 1Y8QB 4A3CJ 1K7AA 2KHMA 4N4OB 2VODA 4F91B 3KP5A 2X85A 3L00A 5FLXZ 1XGMA 4P5OA 5CVIA 2R7ZJ 3DTIA 4E70A 1A5JA 3BQZA 1SFEA 1G4DA 1A35A 1F43A 1RIOH 4YIIA 2GOMA 2OZUA 4EJWA 5HLHA 4IQ4A 3SEZA 5HDGA 2LF8A 3HEFA 4F55A 2V26A 1YITI 3NARA 2M0MA 1XD7A 4EGYA 4XN3A 1ETVA 1VQPI 2ESNA 1P2FA 4U7BA 5L3FA 1VQ5I 5CVRA 2LTPA 3OSFA 3GVAA 2FQ4A 4O6JA 1I3AA 1EV7A 2RKHA 4MHGA 3P9IA 2XB5A 5E3LA 3LSKA 4YFNF 3WU1B 1K4TA 2BYVE 3WE2A 5E8IA 2IGNA 4EM1A 3GFLA 4M9XA 1XMAA 3KP3A 5LBQA 4JYKA 4FT8A 4PZJA 2L01A 3EUHC 3FM5A 4LGWA 1TWGJ 3QOPA 3E0JB 3FXRA 3CC2I 3BP8A 2E5NA 5IP9J 5F04A 3WG9A 1VQ9I 1SFUA 3F8CA 3MKLA 1Z6TA 5J4VA 1MBKA 3TKYA 2DDAA 2Q2EB 2GXAA 5F27A 3CCSI 1D8KA 3S3NA 3K4NA 5JVGF 3ABLH 3HL2A 4ZZLA 1MKMA 1TTYA 3F8BA 1XDUA 1VNDA 2UXXA 3BROA 1X3UA 4WK8F 3ZMDA 3OS1A 2ELKA 3GFIA 1S7AA 1P4XA 1AKHA 2H09A 1POGA 2QF7A 1UHSA 1QQIA 2VPRA 2GQQA 2A3SA 2A6TA 2Y0SN 4A3EJ 1Z77A 4IHSA 1WJAA 2FU4A 1W5SA 1DGWY 2L7ZA 2E1MC 1NK3P 2LH9A 3BY6A 1IN6A 2H8RA 1D0XA 2NS7A 4EJTA 1LDJA 2L5QA 1OCCH 2VC1A 3KEYA 2LBFB 1Q1VA 2HTSA 1OCTC 3HSFA 4RM2A 3OYLA 2P7CB 4CDGA 1LUJB 3KEOA 2H8WA 4A3MJ 1BI1A 3T1BA 2M8EA 2VBXA 3C2GA 4R8HA 3NWTA 4XL9A 1UG2A 1O57A 3ZCOA 5FRNA 2DA2A 3LSRA 3RI4A 2WAQN 4BQQA 1LE8A 2MLKA 1OCOH 1XN7A 1N78A 4MFEA 1MIJA 3GW2A 1FZPB 2M9HA 4ENKA 4AUXA 3K1MA 3QOEA 3TOAA 2E34A 1PJRA 3DP7A 1UG0A 4P9UA 3KETA 1BJZA 1CF7A 1STZA 3G1OA 3QWLA 4Z6YA 2KRCA 3BT9A 3FMSA 3GZNB 3K1NA 5M3MJ 1SMYF 1GDTA 5DUIA 2CS3A 2X6WA 2ZB9A 3CMAI 2MG4A 2V9KA 2R0QC 2ZXHA 4R1HA 1KZHA 3EDPA 4CYCA 3CLQA 2F5CA 1AWCA 3K4JA 3ZN0A 4Y4RA 5BPIA 4A6EA 4G6DA 2VOPA 1KQ0A 2CUEA 2IS4A 1ODDA 2V79A 3E5QA 3GTGJ 3EPZA 2M45A 4XKCA 3RIRA 2R7XA 4BJ6C 5ICGA 1BC7C 2CJJA 2H94A 3CUQC 1JT6A 4UB6C 5B66C 4C9YA 3I56I 4OAZA 1PUFA 3MFKA 1GHCA 4HW0A 4AIHA 4DZJA 1X1AA 2EPFA 2EZHA 1ETOA 3K9TA 3QAHA 2DT5A 4UHTA 1J7KA 2R3SA 4I0BA 3JR9A 1S9HA 1I6HJ 2HYFA 2CO5A 2FA5A 4LMYA 3VPRA 1LB2A 3I4MJ 4S04A 3AG4H 5EZGA 1USTA 3IUOA 1PUEE 4YELA 1B8IB 1BR2A 1QPMA 2QSFX 4BACA 1SVOA 2DFEA 4MEYF 1RKWA 2IRFG 3P9CA 5HOOA 3O2PE 1WZ2A 4I76A 2ZFWA 4UV9A 4BQNA 4IX7A 1L3LA 2ZSIB 3HTSB 2DTZA 3S2HJ 5F1RA 3V8LA 1SFOJ 1KU9A 4G7ZF 1FBQA 2VJIA 2HKOA 2JRMA 5D5UB 3OYDA 4FCYA 2RV8A 2PFBA 1IZ1A 2X0LA 3JRFA 1XPXA 2FX0A 4I7HA 2DJNA 4S05A 2RAEA 1MBFA 5IOZA 3JREA 2OTLI 3V7CA 2DN0A 2MYSA 1U2WA 3E5UA 4YRVA 4RB1A 3R0AA 4RGXA 3FWEA 3OYMA 3E3VA 1TL8A 3DU6A 1TQMA 2K3PA 3G2BA 3O8HA 1MDMA 4EATA 4XOPA 2DK8A 3E6DA 4I02A 2F5DA 1RKTA 1E3HA 3KYCB 4XLHA 5D5VB 4XRFA 4OU0A 2EINH 1MNEA 4KA4A 3ERMA 4KNYA 2XKOA 2WTEA 4ABZA 3SDGA 2BBYA 4ZTJA 3DCFA 4M3DA 3HPHA 4A5MA 4D7NA 1JE8A 1BN5A 2GWRA 4HDUA 1FBUA 1WFXA 4E7SA 1LQ1A 1F4KA 3P7NA 1OR7C 2L9RA 3RKQA 3S15J 1MD0A 4Y17A 1YE9A 4A3GJ 1FSHA 1QVTA 2Y2ZA 3OR1C 4IHYA 5IOYA 1USSA 2XASA 5IYDJ 3PQJA 2QA4I 3V8KA 2BY0A 4IRHA 1VQ6I 5DD8A 1XGOA 2JRTA 5F64A 3GTOJ 3GFMA 2ECBA 1BBYA 5FKNA 1T8IA 5B1BH 3MKWB 1BR1A 4DYQA 3RPUD 3ASNH 3HZJA 1LVKA 5J1YA 1FOYA 2JUGA 4HG2A 3ABKH 2H6CA 1JJ6C 3ZR8X 5E1WA 4OINF 2M4KA 1Y56A 3MMYB 2NVTJ 3J80K 5LHIA 5HS7A 3FMRA 3GO5A 1ZAOA 3K7AJ 2DMPA 3Q3SA 1JKQC 2Z2SB 1ZREA 3J7AY 1RUOA 2IJLA 2QGUA 4DBQA 4DJAA 1JKOC 1D5YA 3HHHA 2V9PA 3CUQA 3U1KA 2KRFA 3HKZA 2HYJA 1YHQI 3LQRA 5J8CA 1G3TA 2M0CA 3WGGA 2Z9OA 1FOKA 2IP2A 4BL0B 2NOJB 2LBFA 3ZQLA 4XLCA 4ESFA 1O7LA 3PIPF 1FIAA 1K61A 5DDGA 4LJZF 5FD6A 1IV6A 3VOEA 3ZQFA 4LLLA 4PGHA 3S14J 3Q0UA 2PG4A 1TWAJ 1V55H 4RMNA 1T39A 3IV5A 4M3EA 2D1HA 1BIBA 1MH4A 5LHGA 1QGPA 1Z7LA 2BZTA 2HXIA 5EG0A 1ZR4A 1W0TA 2EFPA 1FTTA 3TL4X 5FKLA 3MCZA 1W36C 4BQOA 3O8GA 1B72B 2DPUA 2EFQA 4C3JJ 3OL4A 3CCMI 2CU7A 1VF9A 3OS2A 4BGDA 2EV6A 3D5RC 3I55I 3I71A 2QENA 2R93J 1L0OC 3H5NA 3M8FA 4OOIA 3CJQB 1D0YA 2R7FA 2R7TA 4LLGF 2ICWG 5CLSA 2A61A 2HZTA 2EZIA 2P4WA 2OUMA 4ESJA 4MO7A 1YO5C 1IUFA 2CMPA 3ZQ7A 3TEDA 3TMOA 3I4NJ 4QSHA 3ZN1A 2HYGD 3QRFF 2KRHA 2F4OB 1A36A 1HDPA 1LJ9A 2H1KA 3SQNA 4HX8A 3I4PA 5EJCA 3PNYA
chains in the Genus database with same CATH topology
5J1RA 1K83J 4A3KJ 2O8KA 3TP3A 4QTRA 4A3DJ 3S1MJ 2FD5A 2YS9A 2DA7A 2EQRA 3TW6A 1ORKA 3BG9A 3OOUA 3LNQA 1XG1A 2JA5J 2R92J 3M4OJ 3JRIA 1GT0C 2HI3A 1JUMA 1OCPA 4RBOA 1ZTRA 3JRGA 1B8IA 3WHCA 2LK2A 2YUSA 3D1NI 1P7JA 5GP9A 1JKPC 5IP6A 4UUSA 1GVDA 1MBEA 2TRTA 1H89C 4XRSA 4A69C 1IGNA 2LP0A 4CYCB 4DW6A 1A6IA 4XICA 2PMZN 3HGGA 4A93J 1XS9A 4M3BA 2VKEA 4BBSJ 1LFBA 2HQ5A 3G1LA 2LVSA 1RESA 4DYCA 2KDZA 4MLOA 3BG3A 3HB9A 2JA8J 2O7OA 1IC8A 4QIWN 3TW7A 1ETYA 2ID3A 4A3IJ 2NVQJ 5EYRA 1X2MA 1HCRA 1PUFB 3PM1A 5C4XJ 4Y7NJ 2IEKA 3H3VK 3GTLJ 1IDYA 1MSFC 1ETKA 1WGXA 4X1EA 2VKVA 1WPKA 3CMYA 3GTQJ 2HXOA 1UMQA 5FKOA 4LOCA 1H8AC 3FK7A 2Y31A 2GM4A 2KT0A 2G0EA 3ZQIA 4HNVA 2M34A 5FJ8J 2Y9ZA 3UKGA 3GBGA 2K9QA 3OIOA 3PO2J 5DS9A 3HOVJ 5E3MA 4BXXJ 2M2EA 3BR2A 5BNGA 2K40A 1MNMC 2K9SA 2K9NA 4MIMA 1WI3A 4XK4A 5C44J 3Q0VA 3JRDA 4C3IJ 1JTXA 3F0CA 2LD5A 1OFCX 4FE4A 5F0FA 3GTPJ 1ZKGA 3HOZJ 4A3CJ 1Y1WJ 2JK3A 3LSGA 1HDDC 1QPIA 2R7ZJ 1A5JA 3BQZA 1JGGA 1TWFJ 1F43A 2X48A 2JA6J 3GTJJ 4A3BJ 3L1PA 3HEFA 4NDLA 2I10A 3NARA 5EZHA 2LLKA 3CQZJ 1ETVA 1IJWC 4EEFG 3BR0A 3A01B 2LTPA 2OF7A 4RDUA 3OSFA 2FQ4A 5GPCA 1RETA 1U78A 2XB5A 2AHQA 5E3LA 5EEAA 5M5YJ 2IBDA 2XPVA 1IDZA 2NVXJ 3HOXJ 3W6VA 4JYKA 5C4JJ 4XIDA 3S1NJ 2XPWA 2XGEA 1DU0A 2JWTA 1TWGJ 2TCTA 5JLWA 1O4XA 5F1JA 5IP9J 5IYCJ 3RZOJ 1DU6A 5F04A 3NAUA 3MVPA 3HDDA 3CDLA 3MKLA 1LE8B 2LY9A 5M5WJ 1LFUP 1NK2P 1MBKA 3BTJA 5F0HA 5F27A 5F08A 2NOGA 2XSDC 2E2JJ 1HOMA 1SANA 2EZLA 1TWHJ 2DMNA 1JUSA 1VNDA 2E1OA 3ZQCA 2ECCA 1BA5A 2DMQA 4JX6A 2ELKA 1AKHA 1B72A 1I3QJ 2O9LA 3SJMA 1U8BA 1POGA 3HM5A 2QF7A 1UHSA 1MBGA 2VPRA 2Y0SN 2LKXA 4A3EJ 1Z77A 1P7IA 3A02A 2L7MP 4D5FA 2L7ZA 1NTCA 2DA3A 3MN2A 1ZGWA 1NK3P 3BQYA 4C2MJ 5DTDA 4M3GA 2H8RA 2JA7J 2OPTA 3JRBA 2VUMJ 1X2NA 1I50J 1YRNB 2NS7A 2D5VA 1R9TJ 1Q1VA 2AO9A 1OCTC 3BTCA 3E7LA 4FE7A 4B3AA 3HKZN 4A3MJ 2ME0A 1UG2A 4G12A 3RQIA 3OSGA 1MH3A 2DA2A 3LSRA 2HOSA 2WAQN 1FIPA 3HOWJ 1TC3C 2EH3A 1LE8A 1AHDP 3PO3J 3LSJA 1WH5A 4MFEA 2M9HA 4AUXA 3ZQHA 4AYBN 1IG7A 2XB0X 1BJZA 3G1OA 3BT9A 1GV2A 4V2GA 4W97A 1ETQA 5M3MJ 1GDTA 4M3FA 2DA1A 5JLXA 2ZB9A 2MG4A 2R0QC 3GTMJ 3FISA 1MSEC 4CYCA 3HOYJ 1U9NA 2QCOA 1ITYA 5C3EJ 2L0KA 3QPSA 5FKKA 1FJLA 1ENHA 2CUEA 3A03A 3IH4A 3DEWA 2DMTA 1MBHA 2DA5A 1CQTA 4A3FJ 2X9DA 3FK6A 1YRNA 3GTGJ 1WCMJ 3JRAA 2CJJA 1JT6A 4FISA 3BTIA 2E19A 1ZR2A 2DMUA 5J1UA 1ETWA 1PUFA 5M3FJ 3BR5A 3K2AA 4XRSG 2R5ZB 4DZJA 2LR8A 2EZHA 1ETOA 2XGCA 2XRLA 1GV5A 2HOTA 3QQAA 2E2HJ 1JKRC 3JR9A 1I6HJ 1GUUA 3VPRA 2CRGA 3FIWA 1ZK8A 3C2BA 3I4MJ 4DZPA 2XGDA 2CUFA 5EZGA 2M8GX 1B8IB 4XRMA 1F36A 5HODA 3JRCA 1RKWA 2JMWA 4IHVA 4I76A 5EGOB 3BG5A 1QVUA 2DTZA 4BY7J 3S2HJ 1JJ8C 3S1RJ 1SFOJ 4B1RA 4V2FA 5E3OA 4UUTA 4J19A 4FCYA 2HDDA 4MFDA 3JRFA 2FX0A 2DJNA 1Y1VJ 1JTYA 1OJLA 2RAEA 1MBFA 2P81A 3CCYA 3BR3A 5IOZA 3JREA 2DN0A 2HOAA 1XC5A 3JRHA 3O8HA 3S16J 3Q0WA 3LOCA 1RKTA 1T56A 3WHBA 4FTHA 2EBIA 2NVYJ 2W48A 3LSPA 1FTZA 4ABZA 3SDGA 3A01A 3IH3A 1JT0A 2R5ZA 3DCFA 4M3DA 5M5XJ 4D7NA 1BW5A 5IYBJ 5EDNA 4AC0A 5IPAA 3M3YJ 3BR1A 2XPUA 2Y30A 2DA4A 5FLVA 1X58A 1WH7A 2L9RA 3RKQA 3S15J 3B6AA 4A3GJ 1QRYA 9ANTA 1AU7A 4BBRJ 1QVTA 3IH2A 2Y2ZA 4S0HB 4IHYA 5EGOA 2CQXA 5IOYA 1BW6A 4Y52J 3TP0A 5FKMA 4A3LJ 4L5EA 1E3OC 5IYDJ 2WV1A 1VFCA 2EZKA 1FEXA 1ETXA 5EG0B 1T33A 2JN6A 4IHWA 3GTOJ 2MSYA 2ECBA 5FKNA 4D5CA 4DYQA 1HLVA 1VI0A 4C3HJ 5J1YA 2N8GA 5FLMJ 1JJ6C 2IAIA 1EF4A 1MBJA 2NVTJ 1Z0XA 3K7AJ 2DMPA 3Q3SA 1JKQC 2FJ1A 4D7MA 2CQQA 3ZOBA 2GBYA 4BY1J 1JKOC 1D5YA 4JX5A 2MGQA 1JUPA 5K7HA 2WB1N 1IRZA 3HOUJ 2HYJA 2M0CA 2R5YB 4BKXA 2L7FP 3ZQGA 5F0CA 1ZQ3P 2DA6A 5EF6A 1W0UA 3ZQLA 2ME6A 1FIAA 1K61A 1RPWA 4JX4A 2JJ7A 1IV6A 3ZQFA 3S14J 3Q0UA 3SFIA 3S17J 1TWAJ 3QPLA 4IHXA 3GTKJ 3IV5A 4M3EA 1MH4A 1BL0A 2HXIA 4M6VA 5EG0A 1ZR4A 2X6OA 1W0TA 1FTTA 5FKLA 1AKHB 3O8GA 1B72B 3H0GJ 4C3JJ 4UUSB 5E3NA 3S2DJ 2CU7A 1VF9A 2VI6A 1RR7A 2NS8A 3HGYA 4DYRA 2R93J 3B6CA 1H88C 1HF0A 4X6AJ 2ID6A 3BTLA 4GFBA 2LFBA 2EZIA 5GPAA 2MW8A 2Y9YA 1TWCJ 3RZDJ 4MO7A 3G1MA 1IUFA 3TEDA 3I4NJ 1U9OA 4QSHA 1APLC 1G2HA 4JP0A 1S7EA 4IEJA 3BR6A 2B63J 4B4CA 5IP7J 5K7FA 2COBA 4W1UA 4I6ZA 1HDPA 3S1QJ 2YU9J 2H1KA 2R5YA 3HBLA 2GLOA 4A3JJ 5J3LA 3FKIJ 5K7ZA 2E2IJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J1R A;  1K83 J;  4A3K J;  2O8K A;  3TP3 A;  4QTR A;  4A3D J;  3S1M J;  2FD5 A;  2YS9 A;  2DA7 A;  2EQR A;  3TW6 A;  1ORK A;  3BG9 A;  3OOU A;  3LNQ A;  1XG1 A;  2JA5 J;  2R92 J;  3M4O J;  3JRI A;  1GT0 C;  2HI3 A;  1JUM A;  1OCP A;  4RBO A;  1ZTR A;  3JRG A;  1B8I A;  3WHC A;  2LK2 A;  2YUS A;  3D1N I;  1P7J A;  5GP9 A;  1JKP C;  5IP6 A;  4UUS A;  1GVD A;  1MBE A;  2TRT A;  1H89 C;  4XRS A;  4A69 C;  1IGN A;  2LP0 A;  4CYC B;  4DW6 A;  1A6I A;  4XIC A;  2PMZ N;  3HGG A;  4A93 J;  1XS9 A;  4M3B A;  2VKE A;  4BBS J;  1LFB A;  2HQ5 A;  3G1L A;  2LVS A;  1RES A;  4DYC A;  2KDZ A;  4MLO A;  3BG3 A;  3HB9 A;  2JA8 J;  2O7O A;  1IC8 A;  4QIW N;  3TW7 A;  1ETY A;  2ID3 A;  4A3I J;  2NVQ J;  5EYR A;  1X2M A;  1HCR A;  1PUF B;  3PM1 A;  5C4X J;  4Y7N J;  2IEK A;  3H3V K;  3GTL J;  1IDY A;  1MSF C;  1ETK A;  1WGX A;  4X1E A;  2VKV A;  1WPK A;  3CMY A;  3GTQ J;  2HXO A;  1UMQ A;  5FKO A;  4LOC A;  1H8A C;  3FK7 A;  2Y31 A;  2GM4 A;  2KT0 A;  2G0E A;  3ZQI A;  4HNV A;  2M34 A;  5FJ8 J;  2Y9Z A;  3UKG A;  3GBG A;  2K9Q A;  3OIO A;  3PO2 J;  5DS9 A;  3HOV J;  5E3M A;  4BXX J;  2M2E A;  3BR2 A;  5BNG A;  2K40 A;  1MNM C;  2K9S A;  2K9N A;  4MIM A;  1WI3 A;  4XK4 A;  5C44 J;  3Q0V A;  3JRD A;  4C3I J;  1JTX A;  3F0C A;  2LD5 A;  1OFC X;  4FE4 A;  5F0F A;  3GTP J;  1ZKG A;  3HOZ J;  4A3C J;  1Y1W J;  2JK3 A;  3LSG A;  1HDD C;  1QPI A;  2R7Z J;  1A5J A;  3BQZ A;  1JGG A;  1TWF J;  1F43 A;  2X48 A;  2JA6 J;  3GTJ J;  4A3B J;  3L1P A;  3HEF A;  4NDL A;  2I10 A;  3NAR A;  5EZH A;  2LLK A;  3CQZ J;  1ETV A;  1IJW C;  4EEF G;  3BR0 A;  3A01 B;  2LTP A;  2OF7 A;  4RDU A;  3OSF A;  2FQ4 A;  5GPC A;  1RET A;  1U78 A;  2XB5 A;  2AHQ A;  5E3L A;  5EEA A;  5M5Y J;  2IBD A;  2XPV A;  1IDZ A;  2NVX J;  3HOX J;  3W6V A;  4JYK A;  5C4J J;  4XID A;  3S1N J;  2XPW A;  2XGE A;  1DU0 A;  2JWT A;  1TWG J;  2TCT A;  5JLW A;  1O4X A;  5F1J A;  5IP9 J;  5IYC J;  3RZO J;  1DU6 A;  5F04 A;  3NAU A;  3MVP A;  3HDD A;  3CDL A;  3MKL A;  1LE8 B;  2LY9 A;  5M5W J;  1LFU P;  1NK2 P;  1MBK A;  3BTJ A;  5F0H A;  5F27 A;  5F08 A;  2NOG A;  2XSD C;  2E2J J;  1HOM A;  1SAN A;  2EZL A;  1TWH J;  2DMN A;  1JUS A;  1VND A;  2E1O A;  3ZQC A;  2ECC A;  1BA5 A;  2DMQ A;  4JX6 A;  2ELK A;  1AKH A;  1B72 A;  1I3Q J;  2O9L A;  3SJM A;  1U8B A;  1POG A;  3HM5 A;  2QF7 A;  1UHS A;  1MBG A;  2VPR A;  2Y0S N;  2LKX A;  4A3E J;  1Z77 A;  1P7I A;  3A02 A;  2L7M P;  4D5F A;  2L7Z A;  1NTC A;  2DA3 A;  3MN2 A;  1ZGW A;  1NK3 P;  3BQY A;  4C2M J;  5DTD A;  4M3G A;  2H8R A;  2JA7 J;  2OPT A;  3JRB A;  2VUM J;  1X2N A;  1I50 J;  1YRN B;  2NS7 A;  2D5V A;  1R9T J;  1Q1V A;  2AO9 A;  1OCT C;  3BTC A;  3E7L A;  4FE7 A;  4B3A A;  3HKZ N;  4A3M J;  2ME0 A;  1UG2 A;  4G12 A;  3RQI A;  3OSG A;  1MH3 A;  2DA2 A;  3LSR A;  2HOS A;  2WAQ N;  1FIP A;  3HOW J;  1TC3 C;  2EH3 A;  1LE8 A;  1AHD P;  3PO3 J;  3LSJ A;  1WH5 A;  4MFE A;  2M9H A;  4AUX A;  3ZQH A;  4AYB N;  1IG7 A;  2XB0 X;  1BJZ A;  3G1O A;  3BT9 A;  1GV2 A;  4V2G A;  4W97 A;  1ETQ A;  5M3M J;  1GDT A;  4M3F A;  2DA1 A;  5JLX A;  2ZB9 A;  2MG4 A;  2R0Q C;  3GTM J;  3FIS A;  1MSE C;  4CYC A;  3HOY J;  1U9N A;  2QCO A;  1ITY A;  5C3E J;  2L0K A;  3QPS A;  5FKK A;  1FJL A;  1ENH A;  2CUE A;  3A03 A;  3IH4 A;  3DEW A;  2DMT A;  1MBH A;  2DA5 A;  1CQT A;  4A3F J;  2X9D A;  3FK6 A;  1YRN A;  3GTG J;  1WCM J;  3JRA A;  2CJJ A;  1JT6 A;  4FIS A;  3BTI A;  2E19 A;  1ZR2 A;  2DMU A;  5J1U A;  1ETW A;  1PUF A;  5M3F J;  3BR5 A;  3K2A A;  4XRS G;  2R5Z B;  4DZJ A;  2LR8 A;  2EZH A;  1ETO A;  2XGC A;  2XRL A;  1GV5 A;  2HOT A;  3QQA A;  2E2H J;  1JKR C;  3JR9 A;  1I6H J;  1GUU A;  3VPR A;  2CRG A;  3FIW A;  1ZK8 A;  3C2B A;  3I4M J;  4DZP A;  2XGD A;  2CUF A;  5EZG A;  2M8G X;  1B8I B;  4XRM A;  1F36 A;  5HOD A;  3JRC A;  1RKW A;  2JMW A;  4IHV A;  4I76 A;  5EGO B;  3BG5 A;  1QVU A;  2DTZ A;  4BY7 J;  3S2H J;  1JJ8 C;  3S1R J;  1SFO J;  4B1R A;  4V2F A;  5E3O A;  4UUT A;  4J19 A;  4FCY A;  2HDD A;  4MFD A;  3JRF A;  2FX0 A;  2DJN A;  1Y1V J;  1JTY A;  1OJL A;  2RAE A;  1MBF A;  2P81 A;  3CCY A;  3BR3 A;  5IOZ A;  3JRE A;  2DN0 A;  2HOA A;  1XC5 A;  3JRH A;  3O8H A;  3S16 J;  3Q0W A;  3LOC A;  1RKT A;  1T56 A;  3WHB A;  4FTH A;  2EBI A;  2NVY J;  2W48 A;  3LSP A;  1FTZ A;  4ABZ A;  3SDG A;  3A01 A;  3IH3 A;  1JT0 A;  2R5Z A;  3DCF A;  4M3D A;  5M5X J;  4D7N A;  1BW5 A;  5IYB J;  5EDN A;  4AC0 A;  5IPA A;  3M3Y J;  3BR1 A;  2XPU A;  2Y30 A;  2DA4 A;  5FLV A;  1X58 A;  1WH7 A;  2L9R A;  3RKQ A;  3S15 J;  3B6A A;  4A3G J;  1QRY A;  9ANT A;  1AU7 A;  4BBR J;  1QVT A;  3IH2 A;  2Y2Z A;  4S0H B;  4IHY A;  5EGO A;  2CQX A;  5IOY A;  1BW6 A;  4Y52 J;  3TP0 A;  5FKM A;  4A3L J;  4L5E A;  1E3O C;  5IYD J;  2WV1 A;  1VFC A;  2EZK A;  1FEX A;  1ETX A;  5EG0 B;  1T33 A;  2JN6 A;  4IHW A;  3GTO J;  2MSY A;  2ECB A;  5FKN A;  4D5C A;  4DYQ A;  1HLV A;  1VI0 A;  4C3H J;  5J1Y A;  2N8G A;  5FLM J;  1JJ6 C;  2IAI A;  1EF4 A;  1MBJ A;  2NVT J;  1Z0X A;  3K7A J;  2DMP A;  3Q3S A;  1JKQ C;  2FJ1 A;  4D7M A;  2CQQ A;  3ZOB A;  2GBY A;  4BY1 J;  1JKO C;  1D5Y A;  4JX5 A;  2MGQ A;  1JUP A;  5K7H A;  2WB1 N;  1IRZ A;  3HOU J;  2HYJ A;  2M0C A;  2R5Y B;  4BKX A;  2L7F P;  3ZQG A;  5F0C A;  1ZQ3 P;  2DA6 A;  5EF6 A;  1W0U A;  3ZQL A;  2ME6 A;  1FIA A;  1K61 A;  1RPW A;  4JX4 A;  2JJ7 A;  1IV6 A;  3ZQF A;  3S14 J;  3Q0U A;  3SFI A;  3S17 J;  1TWA J;  3QPL A;  4IHX A;  3GTK J;  3IV5 A;  4M3E A;  1MH4 A;  1BL0 A;  2HXI A;  4M6V A;  5EG0 A;  1ZR4 A;  2X6O A;  1W0T A;  1FTT A;  5FKL A;  1AKH B;  3O8G A;  1B72 B;  3H0G J;  4C3J J;  4UUS B;  5E3N A;  3S2D J;  2CU7 A;  1VF9 A;  2VI6 A;  1RR7 A;  2NS8 A;  3HGY A;  4DYR A;  2R93 J;  3B6C A;  1H88 C;  1HF0 A;  4X6A J;  2ID6 A;  3BTL A;  4GFB A;  2LFB A;  2EZI A;  5GPA A;  2MW8 A;  2Y9Y A;  1TWC J;  3RZD J;  4MO7 A;  3G1M A;  1IUF A;  3TED A;  3I4N J;  1U9O A;  4QSH A;  1APL C;  1G2H A;  4JP0 A;  1S7E A;  4IEJ A;  3BR6 A;  2B63 J;  4B4C A;  5IP7 J;  5K7F A;  2COB A;  4W1U A;  4I6Z A;  1HDP A;  3S1Q J;  2YU9 J;  2H1K A;  2R5Y A;  3HBL A;  2GLO A;  4A3J J;  5J3L A;  3FKI J;  5K7Z A;  2E2I J; 
#chains in the Genus database with same CATH topology
 1I1G A;  1K83 J;  1Q1H A;  4IO9 F;  1VQL I;  4A3D J;  1X1B A;  1MMS A;  2EQR A;  3O6B B;  3BG9 A;  3OOU A;  3VEP A;  1VQM I;  1OR7 A;  2XRN A;  4L5I A;  2DK5 A;  3M4O J;  5K1Y A;  1B1B A;  1MMG A;  1OCP A;  4EVI A;  1YJN I;  2FRH A;  4OIP F;  1B8I A;  2LK2 A;  3B73 A;  2ZME B;  2WWY A;  2O0Y A;  1WJ5 A;  4HQM A;  4UVC A;  3IRR A;  5DD4 A;  5H20 A;  3SFZ A;  4A69 C;  4F92 B;  4XRS A;  1IGN A;  1KA8 A;  2RRE A;  3N97 A;  1XSV A;  2L7K A;  3EQL F;  1A04 A;  5D6F A;  2VKE A;  4HEA 2;  2R7Q A;  4CCJ A;  2KDZ A;  3BLY A;  2VE8 A;  3HB9 A;  2LKP A;  3HOT A;  2NNN A;  4IF4 A;  3M07 A;  3RQ4 A;  3TQN A;  1IC8 A;  5DCM A;  2KPM A;  1ETY A;  2ID3 A;  2NVQ J;  1Z91 A;  1HCR A;  4PFP A;  2X6X A;  3PM1 A;  3I9V 2;  2LY1 A;  4HDV A;  2BY3 A;  4HX7 A;  3I0T A;  3C1D A;  1U8R A;  1Z7U A;  1QA6 A;  1IDY A;  3RYR A;  3GTL J;  4GCV A;  4F3Q A;  1WHU A;  2VKV A;  5CVV A;  2UWM A;  4EGZ A;  2EK5 A;  1WI9 A;  3KP7 A;  1W5T A;  3PIO F;  1ZH5 A;  4A5N A;  4AWX B;  4KIS A;  3FK7 A;  4WXC A;  3H9G A;  4XQF A;  2KT0 A;  1KQ8 A;  1TQI A;  1IXR C;  3AL0 B;  3PNT A;  1P4W A;  2MC4 A;  4BE2 A;  1DGR M;  1MJB A;  3OIO A;  3PO2 J;  5E3M A;  2EIL H;  3MZY A;  4BXX J;  1IN5 A;  2HDW A;  2K9S A;  2V1D A;  5HLG A;  2YSR A;  3L7W A;  4MIM A;  1G8X A;  1WI3 A;  3BWG A;  4XK4 A;  4KIG A;  4C3I J;  2A6H F;  3H3Z A;  4ENN A;  4KJZ A;  1E0E A;  1ZKG A;  2G9W A;  2HNH A;  2CV0 A;  4CGZ A;  4L9T A;  3LSG A;  3KFW X;  3KP6 A;  1U5T A;  1YOV B;  3WGI A;  2FBK A;  3G3Z A;  2VT3 A;  1S3J A;  2PBI A;  4OMZ A;  1NHA A;  4OIR F;  5ILV A;  4CZC A;  4XKW A;  2CFO A;  5DCF A;  3L1P A;  4B48 A;  3OMY A;  4HAM A;  2XGX A;  3J80 Z;  4E7H A;  1FPQ A;  2LLK A;  4D9J A;  3GEZ A;  2FNA A;  1WJB A;  1W1W E;  2BXY A;  4B3X A;  5KK1 A;  2FOK A;  2V7F A;  4MNU A;  3SXY A;  2R4G A;  3P5J A;  2RVC A;  1NG6 A;  2MD5 A;  1X1C A;  5M5Y J;  3TO7 A;  5KAF C;  2IBD A;  3K0L A;  4Y33 A;  2KDO A;  2XPV A;  1MMD A;  2RC4 A;  1YS7 A;  4RGR A;  1MMA A;  4XID A;  2HVS A;  3OIQ A;  2XF7 A;  2XGE A;  2TCT A;  3HIF A;  2IS1 A;  1DDN A;  2DO7 A;  2FXA A;  3PUF A;  4KMU X;  3KPH A;  5E1Z B;  5F1J A;  5IYC J;  2KIQ A;  2VPL A;  3V7R A;  3HDD A;  4CSW A;  3CDL A;  1LE8 B;  1EA3 A;  1MMN A;  4MQ9 F;  5M5W J;  1FY7 A;  2FF4 A;  1NK2 P;  2QSH X;  3ELK A;  1V5F A;  1D1C A;  1LFP A;  3J7Z I;  2E2J J;  2NOG A;  1I39 A;  2VQL A;  1QZY A;  1EH7 A;  3M9A A;  4RAY A;  2LRE A;  3I53 A;  3WTS C;  3ZQC A;  2DOF A;  2OAZ A;  4XN0 A;  2ECC A;  1WJF A;  5E8G A;  4UVB A;  2W57 A;  1R22 A;  2HU9 A;  4HA8 A;  1B72 A;  2D2W A;  3IWZ A;  2ELH A;  5KVR A;  2ISZ A;  1IW7 F;  2O9L A;  1FC3 A;  1RI7 A;  1X3W B;  4BH9 A;  3QP6 A;  2A68 F;  2KKO A;  2IPQ X;  1VQN I;  1P7I A;  3A02 A;  1HKS A;  4LB6 B;  2K4J A;  1NTC A;  1DP3 A;  3BQY A;  1YX5 A;  4C2M J;  3F9K A;  3BJO A;  1Z6R A;  2E1N A;  3RPQ A;  4X0G A;  3PSI A;  3ZP5 A;  3CCV I;  2OPT A;  3PFY A;  1G6N A;  2D5V A;  1FSE A;  1R9T J;  2O03 A;  2V6E A;  1I6X A;  4XMY A;  2ZSH B;  2YR2 A;  1FYL A;  4YIF A;  2BV6 A;  3VSK A;  2P8T A;  1SAX A;  2VT2 A;  3CC7 I;  2HGC A;  4XKV A;  4B3A A;  2PLY A;  2BGC A;  2ME0 A;  5D5X B;  2WAE A;  1YW8 A;  3A2K A;  3VSL A;  3OSG A;  4HYE A;  3LFK A;  5J40 A;  1QHH D;  3CCL I;  3OYG A;  2HOS A;  3KYD B;  2EH3 A;  3H35 A;  3O3K A;  3I58 A;  3LSJ A;  1TNS A;  1W7P D;  2FOW A;  1Z3X A;  3ZQQ A;  1YJ9 I;  5LGT A;  5K5O A;  4ZYG A;  1HW5 A;  3ZQH A;  4CUG A;  4ZJZ A;  3IKV A;  3KZI C;  4HX4 A;  3S2W A;  2Y0M A;  1F5T A;  2VL8 A;  1ZLK A;  4LIU A;  4NBQ A;  2Z3Y A;  2DA1 A;  3FX3 A;  3L2V A;  2PQ8 A;  2A6E F;  1R4M B;  1FMV A;  1KYZ A;  3ECO A;  3KIO A;  2STW A;  1ZG1 A;  2B0L A;  1U9N A;  3CDH A;  4G6T B;  3F8M A;  2P6S A;  1ITY A;  3GCM A;  1JHF A;  1PYV A;  5C3E J;  4UY8 I;  1FJL A;  1MDM B;  2RQP A;  3A03 A;  3IH4 A;  3DEW A;  1E2X A;  1XGS A;  2ZO4 A;  2RN7 A;  1FOX A;  2X9D A;  1YRN A;  1O7F A;  2LY2 A;  3VWB A;  2L9S A;  4CHU A;  4NC7 A;  4FIS A;  2UV1 A;  2VC0 A;  2E1M B;  2WAF A;  4E7Z A;  3L09 A;  2DMU A;  1ZR2 A;  2LMD A;  2DI3 A;  2JT1 A;  3K2A A;  2LR8 A;  3DBL B;  2XGC A;  1B6A A;  1GV5 A;  3RJP A;  1VQ4 I;  2E2H J;  4M72 A;  1BR4 A;  1JKR C;  1X1D A;  4E7I A;  2PMU A;  3FIW A;  1ZK8 A;  2K9M A;  3LA3 A;  3FDY A;  4IJA A;  2M8G X;  4EMS A;  1F36 A;  1QZZ A;  3JRC A;  4XLE A;  2IGO A;  3K4K A;  3TOB A;  3LSH A;  3SYT A;  4IHV A;  3K4L A;  2CW8 A;  2DOA A;  1QVU A;  4MTE A;  2NXN B;  2EFO A;  1JJ8 C;  1ZRC A;  4DQ2 A;  1ZGA A;  2F5F A;  1LPQ A;  2LKS A;  1YW9 A;  4MFD A;  2DYR H;  2WC2 A;  3D5L A;  4GYG A;  1JTY A;  3OYB A;  3LL7 A;  3UNG C;  2P81 A;  2I5U A;  3PSF A;  4AVP A;  2JZY A;  2O6G E;  4FHT A;  2DFF A;  4HNU A;  4ENJ A;  3H9Q A;  3K1P A;  2HOA A;  4M73 A;  5D6E A;  4AD9 A;  1WVR A;  1HW1 A;  5LLQ A;  1ZYR F;  3S16 J;  1NH3 A;  1K6Y A;  2JVH A;  1T56 A;  4FTH A;  3RCO A;  2CUJ A;  2NVY J;  2W48 A;  3LSP A;  1OMI A;  2IA2 A;  3CCU I;  3F8N A;  1C0W A;  4Y3O A;  3IH3 A;  3GF2 A;  2R5Z A;  3Q5F A;  2ZNZ A;  1T6S A;  2ADU A;  2AXT C;  3KZZ A;  3ABT A;  4JBA A;  1H9G A;  1R1V A;  4HBL A;  4PJM A;  3V7S A;  5JFR A;  5IPA A;  3L2R A;  3M3Y J;  1QU3 A;  2ZBK A;  2E7X A;  3CUQ B;  1MJ9 A;  2XAG A;  2DA4 A;  3ROU A;  1ZAR A;  3JW4 A;  3K4M A;  5FLV A;  2UZK A;  4PSX A;  1LDK B;  1LEB A;  5KCM A;  9ANT A;  5TIS C;  1EH6 A;  4BBR J;  1W4M A;  3K6G A;  1FWZ A;  1F1Z A;  3WU2 C;  5EGO A;  2CQX A;  2W00 A;  1FP1 D;  2QLZ A;  2YX7 A;  3LWF A;  2IA1 A;  2UUZ A;  4WXD A;  4KYW A;  3GLL A;  5CVJ A;  2EZK A;  4DNC A;  4PJJ A;  4IRI A;  2IXS A;  1ETX A;  3CUO A;  5EG0 B;  2JN6 A;  4YIR X;  3OYI A;  5A2Q Z;  4G7H F;  2MSY A;  3CF2 A;  5FO5 A;  2ZJR F;  3QPT A;  4MGR A;  1LKX A;  4AM3 A;  4ZDP A;  1VI0 A;  1IN7 A;  1I1S A;  3H92 A;  2XC7 A;  2VOO A;  1DQU A;  2IAI A;  4F7Z A;  5J4Y A;  4RGS A;  2R7U A;  2CW0 F;  4I0A A;  4NQW A;  2ZNY A;  2F4M B;  2L4M A;  1QZE A;  3HG9 A;  2CWE A;  4NNJ A;  4OIO F;  1TW2 A;  4L18 B;  2WA0 A;  5CJ9 A;  4F52 A;  3DFG A;  1YW7 A;  2ZCW A;  2LSO A;  4E6K G;  3OYN A;  2P5L C;  2GBY A;  4BY1 J;  5DYM A;  4JK1 X;  1XTA A;  1SD7 A;  1AOY A;  4JX5 A;  2MGQ A;  4H0E A;  1JUP A;  2FML A;  1YTY A;  2QQB A;  2H27 A;  5L3G A;  1IRZ A;  1IF1 A;  2KLO A;  2ZJ2 A;  3VYT B;  5LGU A;  2OCE A;  4ZYD A;  2L7F P;  2L3D A;  2QM3 A;  5F0C A;  2QQA A;  3BG7 A;  3ML6 A;  2DFI A;  1W0U A;  5LRR A;  4GGG A;  3HSR A;  2Z33 A;  1KU2 A;  2J5O A;  2ME6 A;  4CYD A;  2GXG A;  3M8J A;  2XSJ C;  2NAZ A;  2Q1Z B;  3MAJ A;  3HXL A;  5LRS A;  4BHB A;  3S17 J;  4DOZ A;  3GTK J;  5J47 A;  4CA0 A;  2IVM A;  1X19 A;  3W6K B;  4N9H A;  2DYS H;  4BDY A;  1PDN C;  3EUH A;  2IS6 A;  2BY2 A;  2V6C A;  3AFH A;  3E5X A;  4DIQ A;  1OYY A;  1YQA A;  3OYK A;  1RNL A;  4ASN A;  2KJC A;  2MC3 A;  4CCK A;  3AKZ A;  1BC8 C;  3KYL A;  3S2D J;  2QKL B;  3DU5 A;  2NS8 A;  4JOM A;  4Q48 A;  5FFX A;  2OA4 A;  3CTA A;  3F6O A;  3RYP A;  3B6C A;  3IAM 2;  1OQY A;  1HF0 A;  1SMT A;  1Y39 A;  1SD5 A;  3BTL A;  3MWM A;  4N4N B;  2ZJQ F;  4NHJ A;  4U0V A;  1LVA A;  5GPA A;  1WJD A;  4M9Z A;  1TWC J;  3W2A A;  3RZD J;  3G1M A;  5DCM B;  3E6C C;  5L3C A;  2LF7 A;  2HS5 A;  4RM3 A;  2R7V A;  3WTZ A;  2ISY A;  4IEJ A;  2HQA A;  5HNH A;  1HKQ A;  1R5I D;  4I6Z A;  3PQK A;  4M74 A;  2DOE A;  3FHN A;  4HPQ A;  2XRO A;  4HQE A;  3HBL A;  2ZFU A;  4G8X A;  4KN7 X;  3Q9V A;  1GXQ A;  3QU3 A;  5CYV A;  1JI8 A;  2FQ3 A;  2G7U A;  5K7Z A;  2E2I J;  4GYI A;  4BXF A;  2DA7 A;  2E60 A;  3DEE A;  3F3X A;  3N05 A;  4LK1 F;  2V9V A;  2A5W A;  1ORK A;  3TO9 A;  1HC8 A;  3LNQ A;  2CUZ A;  3GFJ A;  2JA5 J;  4EJV A;  1IUY A;  4RLF A;  1GT0 C;  3ZMV A;  1JUM A;  1ZHF A;  3KX2 A;  1P7J A;  5GP9 A;  1H0M A;  1JKP C;  2HFH A;  4KT6 A;  3D5S C;  4KIC A;  2JQ7 A;  2TRT A;  1H89 C;  3LA7 A;  4LG0 A;  2QVO A;  2R7O A;  4PCQ A;  4IKF A;  4K2E A;  5AIP A;  1U5T B;  3L2Q A;  4XLF A;  2FUG 2;  1XS9 A;  2D1V A;  2V4J C;  1LFB A;  2HQ5 A;  3G1L A;  2LVS A;  1RES A;  3T5X A;  1YIO A;  2A07 F;  4O3M A;  2PI0 A;  3BG3 A;  4GXO A;  2JA8 J;  2EIM H;  3DPT A;  4CXF A;  1Y0U A;  2FBI A;  4YFK F;  3H1C A;  2NRA C;  2YPR A;  4XSX F;  4BDZ A;  3R6S A;  3H3V K;  5KNL A;  1MSF C;  3M7G A;  1ETK A;  3DQV C;  1WGX A;  5H2F C;  2MH9 A;  1WPK A;  1BIA A;  4BEH B;  4BHC A;  3T8R A;  3LFU A;  1UMQ A;  3HUG B;  4ITV A;  2G7H A;  1H8A C;  2I8D A;  1FBS A;  5H6Q A;  5HLI A;  3U1D A;  2Y31 A;  2VJ5 A;  3I3L A;  4PGG A;  3HYI A;  2WY7 Q;  3JCU C;  1GVJ A;  2VON A;  4HNV A;  3NRV A;  2M34 A;  3GZ6 A;  1TQP A;  5FJ8 J;  5GTH C;  3GBG A;  4OAY A;  3N4M A;  2JUC A;  2JVG A;  2JPB A;  2XKP A;  2MBF A;  5FRO A;  3H36 A;  1MNM C;  1D8J A;  3RKX A;  2ELJ A;  2K9N A;  4KFC A;  4HF2 A;  2M5W A;  4LB5 A;  1XMK A;  3Q0V A;  2VN2 A;  4FE4 A;  5F0F A;  2HPI A;  3VFZ A;  4WWC A;  3HOZ J;  2DOD A;  2JK3 A;  4A12 A;  1ZRD A;  1QPI A;  3WOD F;  3F6V A;  3J7A O;  2KIU A;  3CP8 A;  1JGG A;  1TWF J;  5ICE A;  2O61 A;  2X48 A;  3CJN A;  1OKR A;  1DPR A;  3LAP A;  4C2T A;  1S7O A;  3GTJ J;  4A2U A;  4P1W A;  2XF5 A;  1TBX A;  2BXZ A;  2EV5 A;  5BMZ A;  4L9V A;  4WX9 A;  2I10 A;  5EZH A;  3VOD A;  2VIX A;  4KUM A;  1IJW C;  4XOR A;  1QO0 D;  3BR0 A;  1XMX A;  4KIT B;  2M7A A;  4RDU A;  5GPC A;  3BC8 A;  3DPL C;  5EEA A;  1R58 A;  3PL8 A;  2NVX J;  2KP6 A;  3HOX J;  3W6V A;  5C4J J;  3EYY A;  2OV7 A;  4KIF A;  3C2H A;  4ENM A;  4UB8 C;  4AU7 A;  1DU0 A;  2HVR A;  4UV8 A;  4AIK A;  2DJI A;  3V4G A;  3FXL A;  4KMF A;  1O4X A;  4HLX A;  1TLH B;  3RZO J;  4PUS A;  3ESW B;  3K10 A;  2BW3 A;  3MVP A;  3HRU A;  2BY1 A;  1LNW A;  2CSO A;  1LFU P;  2F6C A;  4OMY A;  5F0H A;  2LOO A;  1XGN A;  4QLC U;  2W25 A;  2MH2 A;  3RKW A;  2XSD C;  2M4G A;  1HOM A;  1SAN A;  3IL2 A;  2EZL A;  3GXO A;  1BM9 A;  1IV8 A;  4II3 A;  4II2 A;  4M9S A;  3FXO A;  2E1O A;  4D0P A;  2XAQ A;  2OZ6 A;  1UFM A;  2GA2 A;  4D1Q A;  1I3Q J;  3DWL E;  2DQL A;  3H9J A;  1WJC A;  2KIM A;  4A0Z A;  3S3O A;  1U8B A;  3JAM K;  3HM5 A;  1QBJ A;  1Z05 A;  3TBI A;  2HQN A;  1MBG A;  3ABU A;  4O5V A;  4UNO A;  1OYW A;  2HDC A;  2IGM A;  4D5F A;  1R36 A;  3IAS 2;  2A69 F;  2DA3 A;  3OYJ A;  1ZGW A;  3MKY B;  3A1Y A;  5DTD A;  1SD6 A;  2Y48 A;  3GYH X;  1XCB A;  3JRB A;  3FXK A;  1P9Q C;  4Y15 A;  1FMW A;  1IRG A;  4BJ5 C;  3U21 A;  1YRN B;  4KIB A;  2OC6 A;  1DUX C;  2EJR A;  3REO A;  3RPU A;  5K5Q A;  3GLX A;  3BTC A;  3E7L A;  3GWZ A;  4FE7 A;  2V1N A;  3HKZ N;  2KQR A;  4G12 A;  2R7W A;  2X4H A;  1T95 A;  1MH3 A;  2JA2 A;  3FBI B;  5E1X A;  1D5V A;  3HOW J;  3PO3 J;  1ZGJ A;  2DCE A;  3NWS A;  1Z67 A;  4OWR B;  2A05 A;  2Y69 H;  4QPQ A;  1D1B A;  1IG7 A;  2PN6 A;  4L5J A;  3TDU C;  4B8X A;  3CCJ I;  2KIS A;  3CLO A;  4V2G A;  1TW3 A;  2VKD A;  2ZKZ A;  3WU0 A;  1YG2 A;  5JLX A;  4U0W A;  3E1S A;  2LNB A;  2BEO A;  2HZD A;  5E79 C;  3FIS A;  3MZH A;  1MSE C;  2K3F A;  1FYM A;  5FD5 A;  2W24 A;  1S6L A;  1ZLJ A;  3I5U A;  1VZ0 A;  5FKK A;  2RGV A;  5B5E C;  2DMT A;  2P5K A;  1G3S A;  1MBH A;  2DA5 A;  4ZDL A;  1SFK A;  4A3F J;  2MD0 A;  1CQT A;  1WCM J;  2COM A;  5D8L B;  3FKJ A;  4BYY A;  2X51 A;  4WXH A;  1FLI A;  5J1U A;  1ETW A;  1KYW A;  3R61 A;  4XRS G;  3S3M A;  2R5Z B;  3G73 A;  3JTH A;  4AID A;  5JVT A;  1SFX A;  2HOT A;  5IT9 K;  5JI6 A;  3QQA A;  1ACI A;  4BEH A;  3HUG A;  1O3R A;  3F22 A;  3C2B A;  1R49 A;  4DZP A;  5JR3 A;  1V54 H;  1I27 A;  4Q5S F;  2WY8 Q;  2CW7 A;  2JMW A;  2ZXJ A;  4LK0 F;  1UB9 A;  3KLO A;  4ESB A;  5EGO B;  2B7E A;  1J9I A;  3BG5 A;  4BY7 J;  1FX7 A;  4ZYH A;  3S1R J;  4B1R A;  4V2F A;  5E3O A;  1ZRF A;  4UUT A;  4J19 A;  5IT3 A;  4HV5 A;  4PK4 A;  1Y1V J;  3FBN B;  2CFX A;  5DM7 F;  4XOT A;  1MW7 A;  4XKB A;  2EA4 A;  3CC4 I;  5H6R A;  2ZJP F;  4F93 B;  2LRD A;  3EUK L;  3JRH A;  4ZC3 A;  3GME A;  4PJ0 C;  1J59 A;  4NQW B;  3BG6 A;  3WHB A;  4EV0 A;  1FT9 A;  4PSW A;  1S8N A;  4ZYE A;  1O3S A;  4GO1 A;  1Y0N A;  2W4S A;  2STT A;  1BJA A;  1BW5 A;  1VQ8 I;  2L4A A;  2IT0 A;  4NC8 A;  5IYB J;  5EDN A;  4AC0 A;  2PJR A;  3BR1 A;  2Y30 A;  3H5R A;  2HPM A;  5LD2 C;  2JPC A;  3BZC A;  3D0S A;  2HEO A;  4P9F A;  4HF0 A;  2RNJ A;  1UZC A;  2K86 A;  4A0Y A;  2HQR A;  4U0Y A;  3B6A A;  1QRY A;  4U7D A;  1J75 A;  3KCC A;  4BAY A;  3FXJ A;  5J8F A;  2K85 A;  3FF5 A;  4Y52 J;  5FKM A;  2EFN A;  4M6Y A;  1R5H A;  1E3O C;  2ESH A;  5DV5 A;  2XV4 S;  2KJB A;  3CP2 A;  2A5Y B;  3UR3 C;  1FEX A;  4V19 K;  2KIF A;  3E6M A;  1T33 A;  2PX9 A;  1ERD A;  5B1A H;  2OQG A;  3U9G A;  3S32 A;  4MTD A;  3HJE A;  4D5C A;  3HRT A;  4EQQ A;  2YX4 A;  4WCG A;  3DLA A;  3WTW C;  3MD2 A;  4H4K C;  3JAM Z;  1D1A A;  2KMU A;  2VE9 A;  3W6J B;  2VJJ A;  2H6B A;  2L02 A;  3JSP A;  3QYE A;  4N9I A;  3I64 A;  2W1O A;  2VQH A;  2VAS A;  3M8E A;  1JGS A;  3BOQ A;  4D7M A;  2CQQ A;  3J81 K;  5D8K B;  4HNT A;  1OLT A;  2WAD A;  3HPG A;  3MEX A;  2RQQ A;  4LIV A;  5HLT A;  5CQE A;  2DT7 B;  1E3P A;  5CVU A;  1TP4 A;  3DBR B;  3KLN A;  5F6F A;  5ICC A;  3NQO A;  1A31 A;  3ZQG A;  5BOX A;  4ETS A;  2VXD A;  1ZQ3 P;  2DA6 A;  3K2Z A;  4G6Q A;  5LGN A;  2WAQ A;  3DKY A;  3KZY A;  3LAJ A;  1B9N A;  1RPW A;  2DU9 A;  2XUB A;  1HBX G;  2JJ7 A;  2MA3 A;  3DLL F;  3CO6 C;  4ZYA A;  3J7Y J;  1IAW A;  1VQO I;  5D5W B;  3CD6 I;  3JSO A;  3FXU A;  4HRI A;  4IHX A;  2EFW A;  2L2O A;  2P6T A;  4QPO A;  3R0J A;  4PFO A;  1V3F A;  1K6O A;  1OYI A;  2EIJ H;  4M6V A;  2X6O A;  1U0J A;  4GRI A;  2H1L A;  5ERI A;  1YJW I;  1X4P A;  3BJ6 A;  4A6D A;  3A0B C;  3OOP A;  2IGK A;  4YG2 F;  5HS8 A;  1R00 A;  3H0G J;  5BQT A;  1T0F C;  2NNY A;  4LG0 B;  1VQK I;  4ANJ A;  2BHY A;  4IOC F;  1PP7 U;  2FEZ A;  1G3W A;  1GLN A;  1HKT A;  1TT0 A;  5B3S H;  1G3Y A;  2LFB A;  3QYB A;  3F8F A;  3ISP A;  3X2Q H;  3T0Y A;  5GTI C;  2MW8 A;  4BE0 A;  1IO2 A;  5AON A;  2VQG A;  1R1U A;  2XAU A;  3CDI A;  2XVC A;  4L0Y B;  4CCO A;  1OCZ H;  2W7N A;  1U9O A;  3ZPL A;  1G2H A;  4JP0 A;  3GZ5 A;  2B63 J;  4ZTF A;  5BPD A;  4B4C A;  5K7F A;  2QBY A;  2COB A;  4W1U A;  3S1Q J;  3K69 A;  4QWQ A;  2YU9 J;  4RB0 A;  4I98 B;  2R5Y A;  1TNT A;  4A3J J;  5IT9 Z;  4ON0 A;  1N75 A;  5J3L A;  4CCL A;  3FKI J;  3IC7 A;  3GUD A;  2XAJ A;  5J1R A;  2O8K A;  5GAD J;  3LSM A;  3TP3 A;  2VB6 A;  3ABM H;  3S1M J;  1J0R A;  2FD5 A;  1LDD A;  1E17 A;  4BQA A;  3FM3 A;  4BS9 A;  4ZH4 F;  1XG1 A;  2R92 J;  4FQG A;  3AG2 H;  3DKW A;  4L0Z B;  1PP8 F;  4RBO A;  1ZTR A;  3CME I;  1X1P A;  3RTR A;  4PJN A;  5IP6 A;  5LHH A;  3Q9S A;  4UUS A;  2FBH A;  1W5C C;  2LP0 A;  4C30 A;  4DW6 A;  4I09 A;  3QOD A;  1P6R A;  2GOX B;  2QKM B;  4A93 J;  1MGT A;  1ON2 A;  3HTU A;  4IXA A;  4LG3 A;  4DYC A;  2K7L A;  5HDN A;  2JSP A;  2VBY A;  3BCB A;  4MLO A;  4LLN A;  5DM6 F;  5KAI C;  1W7P A;  2OJE D;  2TDX A;  2O7O A;  2F4I A;  3JTG A;  2LC2 A;  4QIW N;  3TW7 A;  2O8X A;  4Y7N J;  4KT5 C;  3OYE A;  5JHF A;  3F72 A;  3R60 A;  4PDK A;  4CO8 A;  1DP7 P;  2XHK A;  1N25 A;  1HQC A;  3TDZ C;  5GAG J;  2PMH A;  3CMY A;  3GTQ J;  1M1E B;  2EA2 A;  3IWF A;  4LFU A;  2DDB A;  2DQR A;  3DF8 A;  2MAB A;  2L9V A;  4EM0 B;  3CMM A;  3E97 A;  4Q47 A;  4E7L A;  1UCR A;  3ZQI A;  2Z16 A;  1SAU A;  4M71 A;  2Y9Z A;  5LFA A;  3LSI A;  2K9Q A;  2EB7 A;  4JQF A;  4CH7 A;  5DS9 A;  3HOV J;  2M2E A;  2J5P A;  3HRM A;  2K40 A;  3I59 B;  4ZDO A;  3VYU B;  4RS8 A;  5LEJ A;  4HST A;  2BW3 B;  2JTV A;  3JRD A;  3H5A A;  2LD5 A;  3F0C A;  4J00 A;  1V5E A;  1RC9 A;  1OFC X;  2AXL A;  3LA2 A;  4HF1 A;  4A0X A;  1O3Q A;  3CES A;  2OCC H;  1R4N B;  1XSX A;  1D3Y A;  1RZ4 A;  2EIK H;  2OD5 A;  1ZG3 A;  1Y1W J;  1JXS A;  3FZV A;  3S93 A;  1HDD C;  3LQQ A;  4XBF A;  5JHU A;  4AYB A;  1RUN A;  1KU3 A;  3KEQ A;  2BVM A;  3AG3 H;  3FMQ A;  1KGS A;  2F48 A;  4XLN F;  1RRJ A;  3CCE I;  2JA6 J;  4TV7 A;  1UHW A;  3AG1 H;  4A3B J;  1WJE A;  4FX0 A;  2RDP A;  1T0F A;  5ILS A;  2HVQ A;  4NDL A;  2FSW A;  3CQZ J;  5J6X A;  5E17 F;  3IKT A;  3BCA A;  3H3U A;  4EEF G;  3A01 B;  4IVN A;  2OF7 A;  3SEQ A;  3J81 Z;  4E7K A;  3EUA A;  1RET A;  2CQN A;  1U78 A;  2E7W A;  2FNP A;  2AHQ A;  2JSC A;  4B09 A;  4IHT A;  3SDB A;  5GAH J;  4N0B A;  1IDZ A;  1FNN A;  2MLG A;  3HRS A;  3S1N J;  1T08 B;  2XPW A;  3T8T A;  1K78 B;  1FYK A;  2JWT A;  2GZW A;  4IPA A;  4I2O A;  1R23 A;  5TJJ A;  3DTK A;  1QNT A;  2PEX A;  5JLW A;  1EH8 A;  1U3E M;  2R7D A;  3MZ8 A;  3S8P A;  3GX4 X;  5TRD A;  1DU6 A;  3NAU A;  2HR3 A;  3TGN A;  2DPD A;  1TT5 B;  2NS0 A;  2X6Y A;  2LY9 A;  2DT6 A;  3R4K A;  5E20 A;  1KON A;  3BTJ A;  2M1B A;  2B9S A;  4KDP A;  4IZZ A;  2ZC2 A;  5F08 A;  5K5R A;  3DKX A;  1IRX A;  1TWH J;  5HVQ C;  4RB3 C;  2BHZ A;  5HDK A;  4P96 A;  2DMN A;  1JUS A;  1ONV A;  1BA5 A;  4RAG A;  1IN8 A;  2DMQ A;  4JX6 A;  2M3A A;  4Z2Y A;  3ERE D;  4EM2 A;  3SJM A;  2EWN A;  2QQ9 A;  3KE2 A;  2QEX I;  3FXM A;  3CCQ I;  1ZN2 A;  2QWW A;  3VB2 A;  5ED4 A;  2LKX A;  1P92 A;  2L7M P;  2MFZ A;  2GXB A;  3MN2 A;  4LIT A;  1D0Z A;  2P0W A;  4IQJ A;  4I99 C;  3SZT A;  1X4O A;  4M3G A;  2JA7 J;  4NB5 A;  2VUM J;  1X2N A;  1FOW A;  1I50 J;  2DFH A;  3OYH A;  1IN4 A;  3CF5 F;  2R7S A;  3CZ6 A;  5L3B A;  4ZZD A;  4FET A;  2AO9 A;  4CCM A;  2F5V A;  2XAH A;  1X3Z B;  1XX5 A;  3M1C A;  3ZGK A;  1R5G A;  5HS9 A;  2UXN A;  2W85 A;  3E6B A;  3K70 D;  3KP4 A;  3RQI A;  2CG4 A;  5BS6 A;  1MZB A;  2VKH A;  2E71 A;  1FIP A;  5KHD A;  1TC3 C;  1AHD P;  2GAU A;  1WH5 A;  1MJA A;  4UVA A;  3K70 C;  2XF6 A;  3F21 A;  4AIJ A;  1MND A;  2Q2E A;  3WGH A;  4L9J A;  1BI0 A;  4RA2 A;  4AYB N;  1BI3 A;  2XB0 X;  2ETH A;  1UAA A;  2CGP A;  1GV2 A;  4W97 A;  1ETQ A;  2FE3 A;  2L9N A;  4M3F A;  3RDI A;  4XNF A;  2F5E A;  3GTM J;  2VQC A;  1YI2 I;  2OU2 A;  3HOY J;  4HSR A;  1IXC A;  1REP C;  2LDU A;  2QCO A;  1B59 A;  3SZG A;  3P9K A;  2L0K A;  2PJP A;  3QPS A;  1ENH A;  3QPH A;  2OBP A;  3FK6 A;  4RLQ A;  2E5Z A;  3JRA A;  1R1T A;  2GA1 A;  4BU2 A;  3LST A;  3QP5 A;  4B43 A;  3BTI A;  2KZV A;  2E19 A;  2QQ8 A;  1EJ9 A;  3TO6 A;  1S5L C;  4B47 A;  1JHH A;  1U6G A;  3VYS B;  3K4C A;  3BR5 A;  4AVZ A;  3IRQ A;  5M3F J;  1YIJ I;  2XRL A;  2HOE A;  1W36 D;  2Z1D A;  1YS6 A;  3VYR B;  1HA8 A;  4YEJ A;  5IY5 H;  2PJR B;  2IS2 A;  2WB1 A;  2DXI A;  1IXS B;  1GUU A;  2CRG A;  3ZMU A;  2XGD A;  2CUF A;  1U5T C;  1Z9C A;  3PJR A;  4XRM A;  5HOD A;  1Z1D A;  1K79 A;  2D45 A;  1ZEL A;  5D4S A;  4UUV A;  1J5Y A;  3WTU C;  5L3E A;  2YU3 A;  5CPR B;  2K02 A;  2Z5U A;  3SHF A;  1R71 A;  4FX4 A;  1Z3Y A;  4MEX F;  3I59 A;  3CJR B;  3ECH A;  1HST A;  2HDD A;  5LEK A;  3L2U A;  1J2X A;  1OJL A;  4P55 A;  4Q4Z F;  5L3D A;  1F9N A;  3CCY A;  4HV6 A;  4WF2 A;  3OS0 A;  3BR3 A;  1Z21 A;  1YFH A;  3G6E I;  1XC5 A;  5AIQ A;  3DPU A;  1ON1 A;  5EEH A;  2AQE A;  3AAF A;  2VBZ A;  3VDX A;  4M6X A;  3EYI A;  3DV8 A;  3LOC A;  3Q0W A;  1S29 A;  3WTV C;  1RR8 C;  2EBI A;  1OCR H;  1OPC A;  2X1D A;  2KZG A;  3ZRG A;  1S72 I;  2Q0O A;  4UXN A;  1FTZ A;  3OIP A;  1JT0 A;  3A01 A;  1WKM A;  4CIC A;  4RGU A;  2K4B A;  3BZ6 A;  5M5X J;  1H9T A;  1P4A A;  2ZXI A;  4BUP A;  2XPU A;  2X1C A;  2BVL A;  3CCR I;  1X58 A;  4G94 A;  3BPV A;  3OV8 A;  1SVL A;  1SVM A;  1CGP A;  1WH7 A;  1Y6I A;  2XIG A;  4RB2 C;  4XSZ F;  2GIZ A;  3KP2 A;  4GDF A;  1AU7 A;  4U88 A;  4S0H B;  3IH2 A;  1K78 A;  5FRM A;  3OYF A;  4XON A;  1BW6 A;  3BDD A;  3TP0 A;  2L54 A;  4L5E A;  4A3L J;  3OYC A;  3A4C A;  4HZF A;  2WV1 A;  1VFC A;  1NG7 A;  1OIS A;  4IHW A;  5FLX K;  2CH0 A;  2VJ4 A;  5TGT A;  1HLV A;  3BJA A;  1FP2 A;  5FFZ A;  4C3H J;  1XB4 A;  2CYY A;  2N8G A;  4DBR A;  5ICF A;  5FLM J;  4I01 A;  2OQR A;  4E4H A;  2VBW A;  2W82 A;  3NEU A;  2DBB A;  4EJO A;  2DAO A;  3OWT A;  2M87 A;  3L2C A;  2PMZ A;  3QU6 A;  1EF4 A;  1MBJ A;  3V42 A;  3H0D A;  1Z0X A;  1T98 A;  1BOB A;  4FAS D;  1ZG5 A;  4LD5 A;  2FJ1 A;  3ONQ A;  3WE3 A;  3ZOB A;  5GAE J;  4B44 A;  4BE1 A;  4J01 A;  3G4S I;  1Y8R B;  3DXJ F;  1KU7 A;  2QBY B;  2P5V A;  5CQG A;  5K7H A;  2WB1 N;  3HOU J;  2AQF A;  3DEU A;  4HLY A;  2CV2 A;  4IL6 C;  4L9N A;  2HTJ A;  3I54 A;  3PNV A;  2R5Y B;  4BKX A;  3WTX C;  1SC7 A;  5EF6 A;  2VLA A;  1B9M A;  1YX3 A;  2XAF A;  2FMY A;  2WBM A;  4JX4 A;  3LMM A;  5ILU A;  4KN4 X;  1WRJ A;  2ZME C;  3U2R A;  3MQ0 A;  3SFI A;  1J09 A;  2IA0 A;  3HOS A;  5EEG A;  3QPL A;  4BNC A;  3EET A;  5DUK A;  5CKT A;  1HXD A;  2QZ8 A;  2CQ7 A;  1BL0 A;  2LYC A;  3HSE A;  3IP4 B;  2K9L A;  2M30 A;  1GXP A;  3OL3 A;  3RSN A;  2V1U A;  2Z99 A;  1AKH B;  1HW2 A;  1R7J A;  3C3W A;  3ZMS A;  2OTJ I;  2NVU B;  3ULQ B;  4UUS B;  3V8J A;  5E3N A;  3SZP A;  3L2W A;  3COA C;  2VI6 A;  1RR7 A;  3HGY A;  4DYR A;  5HNF A;  4CZZ A;  3OR2 C;  2E36 A;  2VXZ A;  2HWV A;  1H88 C;  4X6A J;  2ID6 A;  2V1X A;  4GFB A;  2NYX A;  4IOA F;  3A0H C;  5DEQ A;  2DTR A;  2Y9Y A;  1W7P B;  1DPU A;  2RNG A;  3W3C A;  1ULY A;  4NC6 A;  3MKZ A;  1APL C;  3ZMZ A;  3WTT C;  1S7E A;  3K4B A;  2BE5 F;  3BR6 A;  5FB2 A;  5IP7 J;  2DW4 A;  2ACJ A;  1K4S A;  4G9Y A;  2QYO A;  2E35 A;  2W84 A;  3AL0 C;  4E7J A;  2GLO A;  2Y75 A;  2KL4 A;  2O3F A;  2P7V B;  2BOL A;  3HHG A;  2CQK A;  2CV1 A;  4XR6 A;  1HSJ A;  4A3K J;  3ASO H;  3DBH B;  1T38 A;  1O3T A;  4C2U A;  5FGM A;  4QTR A;  1LEA A;  1YYV A;  2YS9 A;  3F23 A;  3TW6 A;  1VTN C;  3FHZ A;  1B4A A;  3FXQ A;  1QHG A;  2KFD A;  1SEU A;  1N77 A;  2ZXW H;  3L9F A;  4RAF A;  3ZMT A;  1CF7 B;  3RKY A;  2E1C A;  4G7O F;  5A2Q K;  3JRI A;  4YFX F;  2HI3 A;  1T2K A;  3M1E A;  4BXU A;  3JRG A;  3WHC A;  2YUS A;  3D1N I;  1XDS A;  2DLL A;  1A6Q A;  2GIV A;  2O5R A;  3PUB A;  4NUB A;  1V5G A;  4XM3 A;  2QUF A;  1TZL A;  1GVD A;  1MBE A;  3C7J A;  4U87 A;  4XLP F;  1PVE A;  2C6Y A;  1BOA A;  4CYC B;  1A6I A;  4XIC A;  2F2E A;  2PMZ N;  2K27 A;  3HGG A;  1I5Z A;  4M3B A;  5D4R A;  4BBS J;  1XCV A;  2R7R A;  2QSG X;  1WSU A;  4R79 A;  1UHM A;  3IHU A;  4Y13 A;  2IW5 A;  2Q8K A;  4BHP A;  1WWX A;  1SD4 A;  3BPX A;  3QYF A;  4HOB A;  2EV0 A;  4XLA A;  3WG7 H;  4DGW B;  4A3I J;  5EYR A;  1X2M A;  4RAZ A;  3CJT B;  1KQ9 A;  1PUF B;  2AS5 F;  5C4X J;  6PAX A;  2Y0S A;  2IEK A;  2M7B A;  3OYA A;  3PFI A;  1VQ7 I;  1UEL B;  3CO7 C;  1XSD A;  3OY9 A;  3WTY C;  4EJU A;  1YLF A;  3C18 A;  3DTE A;  4X1E A;  1WQ2 A;  1EKE A;  2HXO A;  5FKO A;  2XDV A;  2HKX A;  4LOC A;  2GM4 A;  1BI2 A;  1IRF A;  2WV0 A;  4CCN A;  2G0E A;  4IRG A;  3BZK A;  1UJ8 A;  2K5C A;  3B02 A;  4BJT A;  2LG4 A;  2X1E A;  3UKG A;  1G59 A;  3G71 I;  1V4R A;  3W2V A;  5BNG A;  3BR2 A;  4OIQ F;  4MQV A;  2ZME A;  1AA7 A;  5C44 J;  3HC7 A;  5E18 F;  4PJL A;  3W2W A;  1JTX A;  1R6R A;  3ZXS A;  3GTP J;  1Y8Q B;  4A3C J;  1K7A A;  2KHM A;  4N4O B;  2VOD A;  4F91 B;  3KP5 A;  2X85 A;  3L00 A;  5FLX Z;  1XGM A;  4P5O A;  5CVI A;  2R7Z J;  3DTI A;  4E70 A;  1A5J A;  3BQZ A;  1SFE A;  1G4D A;  1A35 A;  1F43 A;  1RIO H;  4YII A;  2GOM A;  2OZU A;  4EJW A;  5HLH A;  4IQ4 A;  3SEZ A;  5HDG A;  2LF8 A;  3HEF A;  4F55 A;  2V26 A;  1YIT I;  3NAR A;  2M0M A;  1XD7 A;  4EGY A;  4XN3 A;  1ETV A;  1VQP I;  2ESN A;  1P2F A;  4U7B A;  5L3F A;  1VQ5 I;  5CVR A;  2LTP A;  3OSF A;  3GVA A;  2FQ4 A;  4O6J A;  1I3A A;  1EV7 A;  2RKH A;  4MHG A;  3P9I A;  2XB5 A;  5E3L A;  3LSK A;  4YFN F;  3WU1 B;  1K4T A;  2BYV E;  3WE2 A;  5E8I A;  2IGN A;  4EM1 A;  3GFL A;  4M9X A;  1XMA A;  3KP3 A;  5LBQ A;  4JYK A;  4FT8 A;  4PZJ A;  2L01 A;  3EUH C;  3FM5 A;  4LGW A;  1TWG J;  3QOP A;  3E0J B;  3FXR A;  3CC2 I;  3BP8 A;  2E5N A;  5IP9 J;  5F04 A;  3WG9 A;  1VQ9 I;  1SFU A;  3F8C A;  3MKL A;  1Z6T A;  5J4V A;  1MBK A;  3TKY A;  2DDA A;  2Q2E B;  2GXA A;  5F27 A;  3CCS I;  1D8K A;  3S3N A;  3K4N A;  5JVG F;  3ABL H;  3HL2 A;  4ZZL A;  1MKM A;  1TTY A;  3F8B A;  1XDU A;  1VND A;  2UXX A;  3BRO A;  1X3U A;  4WK8 F;  3ZMD A;  3OS1 A;  2ELK A;  3GFI A;  1S7A A;  1P4X A;  1AKH A;  2H09 A;  1POG A;  2QF7 A;  1UHS A;  1QQI A;  2VPR A;  2GQQ A;  2A3S A;  2A6T A;  2Y0S N;  4A3E J;  1Z77 A;  4IHS A;  1WJA A;  2FU4 A;  1W5S A;  1DGW Y;  2L7Z A;  2E1M C;  1NK3 P;  2LH9 A;  3BY6 A;  1IN6 A;  2H8R A;  1D0X A;  2NS7 A;  4EJT A;  1LDJ A;  2L5Q A;  1OCC H;  2VC1 A;  3KEY A;  2LBF B;  1Q1V A;  2HTS A;  1OCT C;  3HSF A;  4RM2 A;  3OYL A;  2P7C B;  4CDG A;  1LUJ B;  3KEO A;  2H8W A;  4A3M J;  1BI1 A;  3T1B A;  2M8E A;  2VBX A;  3C2G A;  4R8H A;  3NWT A;  4XL9 A;  1UG2 A;  1O57 A;  3ZCO A;  5FRN A;  2DA2 A;  3LSR A;  3RI4 A;  2WAQ N;  4BQQ A;  1LE8 A;  2MLK A;  1OCO H;  1XN7 A;  1N78 A;  4MFE A;  1MIJ A;  3GW2 A;  1FZP B;  2M9H A;  4ENK A;  4AUX A;  3K1M A;  3QOE A;  3TOA A;  2E34 A;  1PJR A;  3DP7 A;  1UG0 A;  4P9U A;  3KET A;  1BJZ A;  1CF7 A;  1STZ A;  3G1O A;  3QWL A;  4Z6Y A;  2KRC A;  3BT9 A;  3FMS A;  3GZN B;  3K1N A;  5M3M J;  1SMY F;  1GDT A;  5DUI A;  2CS3 A;  2X6W A;  2ZB9 A;  3CMA I;  2MG4 A;  2V9K A;  2R0Q C;  2ZXH A;  4R1H A;  1KZH A;  3EDP A;  4CYC A;  3CLQ A;  2F5C A;  1AWC A;  3K4J A;  3ZN0 A;  4Y4R A;  5BPI A;  4A6E A;  4G6D A;  2VOP A;  1KQ0 A;  2CUE A;  2IS4 A;  1ODD A;  2V79 A;  3E5Q A;  3GTG J;  3EPZ A;  2M45 A;  4XKC A;  3RIR A;  2R7X A;  4BJ6 C;  5ICG A;  1BC7 C;  2CJJ A;  2H94 A;  3CUQ C;  1JT6 A;  4UB6 C;  5B66 C;  4C9Y A;  3I56 I;  4OAZ A;  1PUF A;  3MFK A;  1GHC A;  4HW0 A;  4AIH A;  4DZJ A;  1X1A A;  2EPF A;  2EZH A;  1ETO A;  3K9T A;  3QAH A;  2DT5 A;  4UHT A;  1J7K A;  2R3S A;  4I0B A;  3JR9 A;  1S9H A;  1I6H J;  2HYF A;  2CO5 A;  2FA5 A;  4LMY A;  3VPR A;  1LB2 A;  3I4M J;  4S04 A;  3AG4 H;  5EZG A;  1UST A;  3IUO A;  1PUE E;  4YEL A;  1B8I B;  1BR2 A;  1QPM A;  2QSF X;  4BAC A;  1SVO A;  2DFE A;  4MEY F;  1RKW A;  2IRF G;  3P9C A;  5HOO A;  3O2P E;  1WZ2 A;  4I76 A;  2ZFW A;  4UV9 A;  4BQN A;  4IX7 A;  1L3L A;  2ZSI B;  3HTS B;  2DTZ A;  3S2H J;  5F1R A;  3V8L A;  1SFO J;  1KU9 A;  4G7Z F;  1FBQ A;  2VJI A;  2HKO A;  2JRM A;  5D5U B;  3OYD A;  4FCY A;  2RV8 A;  2PFB A;  1IZ1 A;  2X0L A;  3JRF A;  1XPX A;  2FX0 A;  4I7H A;  2DJN A;  4S05 A;  2RAE A;  1MBF A;  5IOZ A;  3JRE A;  2OTL I;  3V7C A;  2DN0 A;  2MYS A;  1U2W A;  3E5U A;  4YRV A;  4RB1 A;  3R0A A;  4RGX A;  3FWE A;  3OYM A;  3E3V A;  1TL8 A;  3DU6 A;  1TQM A;  2K3P A;  3G2B A;  3O8H A;  1MDM A;  4EAT A;  4XOP A;  2DK8 A;  3E6D A;  4I02 A;  2F5D A;  1RKT A;  1E3H A;  3KYC B;  4XLH A;  5D5V B;  4XRF A;  4OU0 A;  2EIN H;  1MNE A;  4KA4 A;  3ERM A;  4KNY A;  2XKO A;  2WTE A;  4ABZ A;  3SDG A;  2BBY A;  4ZTJ A;  3DCF A;  4M3D A;  3HPH A;  4A5M A;  4D7N A;  1JE8 A;  1BN5 A;  2GWR A;  4HDU A;  1FBU A;  1WFX A;  4E7S A;  1LQ1 A;  1F4K A;  3P7N A;  1OR7 C;  2L9R A;  3RKQ A;  3S15 J;  1MD0 A;  4Y17 A;  1YE9 A;  4A3G J;  1FSH A;  1QVT A;  2Y2Z A;  3OR1 C;  4IHY A;  5IOY A;  1USS A;  2XAS A;  5IYD J;  3PQJ A;  2QA4 I;  3V8K A;  2BY0 A;  4IRH A;  1VQ6 I;  5DD8 A;  1XGO A;  2JRT A;  5F64 A;  3GTO J;  3GFM A;  2ECB A;  1BBY A;  5FKN A;  1T8I A;  5B1B H;  3MKW B;  1BR1 A;  4DYQ A;  3RPU D;  3ASN H;  3HZJ A;  1LVK A;  5J1Y A;  1FOY A;  2JUG A;  4HG2 A;  3ABK H;  2H6C A;  1JJ6 C;  3ZR8 X;  5E1W A;  4OIN F;  2M4K A;  1Y56 A;  3MMY B;  2NVT J;  3J80 K;  5LHI A;  5HS7 A;  3FMR A;  3GO5 A;  1ZAO A;  3K7A J;  2DMP A;  3Q3S A;  1JKQ C;  2Z2S B;  1ZRE A;  3J7A Y;  1RUO A;  2IJL A;  2QGU A;  4DBQ A;  4DJA A;  1JKO C;  1D5Y A;  3HHH A;  2V9P A;  3CUQ A;  3U1K A;  2KRF A;  3HKZ A;  2HYJ A;  1YHQ I;  3LQR A;  5J8C A;  1G3T A;  2M0C A;  3WGG A;  2Z9O A;  1FOK A;  2IP2 A;  4BL0 B;  2NOJ B;  2LBF A;  3ZQL A;  4XLC A;  4ESF A;  1O7L A;  3PIP F;  1FIA A;  1K61 A;  5DDG A;  4LJZ F;  5FD6 A;  1IV6 A;  3VOE A;  3ZQF A;  4LLL A;  4PGH A;  3S14 J;  3Q0U A;  2PG4 A;  1TWA J;  1V55 H;  4RMN A;  1T39 A;  3IV5 A;  4M3E A;  2D1H A;  1BIB A;  1MH4 A;  5LHG A;  1QGP A;  1Z7L A;  2BZT A;  2HXI A;  5EG0 A;  1ZR4 A;  1W0T A;  2EFP A;  1FTT A;  3TL4 X;  5FKL A;  3MCZ A;  1W36 C;  4BQO A;  3O8G A;  1B72 B;  2DPU A;  2EFQ A;  4C3J J;  3OL4 A;  3CCM I;  2CU7 A;  1VF9 A;  3OS2 A;  4BGD A;  2EV6 A;  3D5R C;  3I55 I;  3I71 A;  2QEN A;  2R93 J;  1L0O C;  3H5N A;  3M8F A;  4OOI A;  3CJQ B;  1D0Y A;  2R7F A;  2R7T A;  4LLG F;  2ICW G;  5CLS A;  2A61 A;  2HZT A;  2EZI A;  2P4W A;  2OUM A;  4ESJ A;  4MO7 A;  1YO5 C;  1IUF A;  2CMP A;  3ZQ7 A;  3TED A;  3TMO A;  3I4N J;  4QSH A;  3ZN1 A;  2HYG D;  3QRF F;  2KRH A;  2F4O B;  1A36 A;  1HDP A;  1LJ9 A;  2H1K A;  3SQN A;  4HX8 A;  3I4P A;  5EJC A;  3PNY A; 
#chains in the Genus database with same CATH homology
 5J1R A;  1K83 J;  4A3K J;  2O8K A;  3TP3 A;  4QTR A;  4A3D J;  3S1M J;  2FD5 A;  2YS9 A;  2DA7 A;  2EQR A;  3TW6 A;  1ORK A;  3BG9 A;  3OOU A;  3LNQ A;  1XG1 A;  2JA5 J;  2R92 J;  3M4O J;  3JRI A;  1GT0 C;  2HI3 A;  1JUM A;  1OCP A;  4RBO A;  1ZTR A;  3JRG A;  1B8I A;  3WHC A;  2LK2 A;  2YUS A;  3D1N I;  1P7J A;  5GP9 A;  1JKP C;  5IP6 A;  4UUS A;  1GVD A;  1MBE A;  2TRT A;  1H89 C;  4XRS A;  4A69 C;  1IGN A;  2LP0 A;  4CYC B;  4DW6 A;  1A6I A;  4XIC A;  2PMZ N;  3HGG A;  4A93 J;  1XS9 A;  4M3B A;  2VKE A;  4BBS J;  1LFB A;  2HQ5 A;  3G1L A;  2LVS A;  1RES A;  4DYC A;  2KDZ A;  4MLO A;  3BG3 A;  3HB9 A;  2JA8 J;  2O7O A;  1IC8 A;  4QIW N;  3TW7 A;  1ETY A;  2ID3 A;  4A3I J;  2NVQ J;  5EYR A;  1X2M A;  1HCR A;  1PUF B;  3PM1 A;  5C4X J;  4Y7N J;  2IEK A;  3H3V K;  3GTL J;  1IDY A;  1MSF C;  1ETK A;  1WGX A;  4X1E A;  2VKV A;  1WPK A;  3CMY A;  3GTQ J;  2HXO A;  1UMQ A;  5FKO A;  4LOC A;  1H8A C;  3FK7 A;  2Y31 A;  2GM4 A;  2KT0 A;  2G0E A;  3ZQI A;  4HNV A;  2M34 A;  5FJ8 J;  2Y9Z A;  3UKG A;  3GBG A;  2K9Q A;  3OIO A;  3PO2 J;  5DS9 A;  3HOV J;  5E3M A;  4BXX J;  2M2E A;  3BR2 A;  5BNG A;  2K40 A;  1MNM C;  2K9S A;  2K9N A;  4MIM A;  1WI3 A;  4XK4 A;  5C44 J;  3Q0V A;  3JRD A;  4C3I J;  1JTX A;  3F0C A;  2LD5 A;  1OFC X;  4FE4 A;  5F0F A;  3GTP J;  1ZKG A;  3HOZ J;  4A3C J;  1Y1W J;  2JK3 A;  3LSG A;  1HDD C;  1QPI A;  2R7Z J;  1A5J A;  3BQZ A;  1JGG A;  1TWF J;  1F43 A;  2X48 A;  2JA6 J;  3GTJ J;  4A3B J;  3L1P A;  3HEF A;  4NDL A;  2I10 A;  3NAR A;  5EZH A;  2LLK A;  3CQZ J;  1ETV A;  1IJW C;  4EEF G;  3BR0 A;  3A01 B;  2LTP A;  2OF7 A;  4RDU A;  3OSF A;  2FQ4 A;  5GPC A;  1RET A;  1U78 A;  2XB5 A;  2AHQ A;  5E3L A;  5EEA A;  5M5Y J;  2IBD A;  2XPV A;  1IDZ A;  2NVX J;  3HOX J;  3W6V A;  4JYK A;  5C4J J;  4XID A;  3S1N J;  2XPW A;  2XGE A;  1DU0 A;  2JWT A;  1TWG J;  2TCT A;  5JLW A;  1O4X A;  5F1J A;  5IP9 J;  5IYC J;  3RZO J;  1DU6 A;  5F04 A;  3NAU A;  3MVP A;  3HDD A;  3CDL A;  3MKL A;  1LE8 B;  2LY9 A;  5M5W J;  1LFU P;  1NK2 P;  1MBK A;  3BTJ A;  5F0H A;  5F27 A;  5F08 A;  2NOG A;  2XSD C;  2E2J J;  1HOM A;  1SAN A;  2EZL A;  1TWH J;  2DMN A;  1JUS A;  1VND A;  2E1O A;  3ZQC A;  2ECC A;  1BA5 A;  2DMQ A;  4JX6 A;  2ELK A;  1AKH A;  1B72 A;  1I3Q J;  2O9L A;  3SJM A;  1U8B A;  1POG A;  3HM5 A;  2QF7 A;  1UHS A;  1MBG A;  2VPR A;  2Y0S N;  2LKX A;  4A3E J;  1Z77 A;  1P7I A;  3A02 A;  2L7M P;  4D5F A;  2L7Z A;  1NTC A;  2DA3 A;  3MN2 A;  1ZGW A;  1NK3 P;  3BQY A;  4C2M J;  5DTD A;  4M3G A;  2H8R A;  2JA7 J;  2OPT A;  3JRB A;  2VUM J;  1X2N A;  1I50 J;  1YRN B;  2NS7 A;  2D5V A;  1R9T J;  1Q1V A;  2AO9 A;  1OCT C;  3BTC A;  3E7L A;  4FE7 A;  4B3A A;  3HKZ N;  4A3M J;  2ME0 A;  1UG2 A;  4G12 A;  3RQI A;  3OSG A;  1MH3 A;  2DA2 A;  3LSR A;  2HOS A;  2WAQ N;  1FIP A;  3HOW J;  1TC3 C;  2EH3 A;  1LE8 A;  1AHD P;  3PO3 J;  3LSJ A;  1WH5 A;  4MFE A;  2M9H A;  4AUX A;  3ZQH A;  4AYB N;  1IG7 A;  2XB0 X;  1BJZ A;  3G1O A;  3BT9 A;  1GV2 A;  4V2G A;  4W97 A;  1ETQ A;  5M3M J;  1GDT A;  4M3F A;  2DA1 A;  5JLX A;  2ZB9 A;  2MG4 A;  2R0Q C;  3GTM J;  3FIS A;  1MSE C;  4CYC A;  3HOY J;  1U9N A;  2QCO A;  1ITY A;  5C3E J;  2L0K A;  3QPS A;  5FKK A;  1FJL A;  1ENH A;  2CUE A;  3A03 A;  3IH4 A;  3DEW A;  2DMT A;  1MBH A;  2DA5 A;  1CQT A;  4A3F J;  2X9D A;  3FK6 A;  1YRN A;  3GTG J;  1WCM J;  3JRA A;  2CJJ A;  1JT6 A;  4FIS A;  3BTI A;  2E19 A;  1ZR2 A;  2DMU A;  5J1U A;  1ETW A;  1PUF A;  5M3F J;  3BR5 A;  3K2A A;  4XRS G;  2R5Z B;  4DZJ A;  2LR8 A;  2EZH A;  1ETO A;  2XGC A;  2XRL A;  1GV5 A;  2HOT A;  3QQA A;  2E2H J;  1JKR C;  3JR9 A;  1I6H J;  1GUU A;  3VPR A;  2CRG A;  3FIW A;  1ZK8 A;  3C2B A;  3I4M J;  4DZP A;  2XGD A;  2CUF A;  5EZG A;  2M8G X;  1B8I B;  4XRM A;  1F36 A;  5HOD A;  3JRC A;  1RKW A;  2JMW A;  4IHV A;  4I76 A;  5EGO B;  3BG5 A;  1QVU A;  2DTZ A;  4BY7 J;  3S2H J;  1JJ8 C;  3S1R J;  1SFO J;  4B1R A;  4V2F A;  5E3O A;  4UUT A;  4J19 A;  4FCY A;  2HDD A;  4MFD A;  3JRF A;  2FX0 A;  2DJN A;  1Y1V J;  1JTY A;  1OJL A;  2RAE A;  1MBF A;  2P81 A;  3CCY A;  3BR3 A;  5IOZ A;  3JRE A;  2DN0 A;  2HOA A;  1XC5 A;  3JRH A;  3O8H A;  3S16 J;  3Q0W A;  3LOC A;  1RKT A;  1T56 A;  3WHB A;  4FTH A;  2EBI A;  2NVY J;  2W48 A;  3LSP A;  1FTZ A;  4ABZ A;  3SDG A;  3A01 A;  3IH3 A;  1JT0 A;  2R5Z A;  3DCF A;  4M3D A;  5M5X J;  4D7N A;  1BW5 A;  5IYB J;  5EDN A;  4AC0 A;  5IPA A;  3M3Y J;  3BR1 A;  2XPU A;  2Y30 A;  2DA4 A;  5FLV A;  1X58 A;  1WH7 A;  2L9R A;  3RKQ A;  3S15 J;  3B6A A;  4A3G J;  1QRY A;  9ANT A;  1AU7 A;  4BBR J;  1QVT A;  3IH2 A;  2Y2Z A;  4S0H B;  4IHY A;  5EGO A;  2CQX A;  5IOY A;  1BW6 A;  4Y52 J;  3TP0 A;  5FKM A;  4A3L J;  4L5E A;  1E3O C;  5IYD J;  2WV1 A;  1VFC A;  2EZK A;  1FEX A;  1ETX A;  5EG0 B;  1T33 A;  2JN6 A;  4IHW A;  3GTO J;  2MSY A;  2ECB A;  5FKN A;  4D5C A;  4DYQ A;  1HLV A;  1VI0 A;  4C3H J;  5J1Y A;  2N8G A;  5FLM J;  1JJ6 C;  2IAI A;  1EF4 A;  1MBJ A;  2NVT J;  1Z0X A;  3K7A J;  2DMP A;  3Q3S A;  1JKQ C;  2FJ1 A;  4D7M A;  2CQQ A;  3ZOB A;  2GBY A;  4BY1 J;  1JKO C;  1D5Y A;  4JX5 A;  2MGQ A;  1JUP A;  5K7H A;  2WB1 N;  1IRZ A;  3HOU J;  2HYJ A;  2M0C A;  2R5Y B;  4BKX A;  2L7F P;  3ZQG A;  5F0C A;  1ZQ3 P;  2DA6 A;  5EF6 A;  1W0U A;  3ZQL A;  2ME6 A;  1FIA A;  1K61 A;  1RPW A;  4JX4 A;  2JJ7 A;  1IV6 A;  3ZQF A;  3S14 J;  3Q0U A;  3SFI A;  3S17 J;  1TWA J;  3QPL A;  4IHX A;  3GTK J;  3IV5 A;  4M3E A;  1MH4 A;  1BL0 A;  2HXI A;  4M6V A;  5EG0 A;  1ZR4 A;  2X6O A;  1W0T A;  1FTT A;  5FKL A;  1AKH B;  3O8G A;  1B72 B;  3H0G J;  4C3J J;  4UUS B;  5E3N A;  3S2D J;  2CU7 A;  1VF9 A;  2VI6 A;  1RR7 A;  2NS8 A;  3HGY A;  4DYR A;  2R93 J;  3B6C A;  1H88 C;  1HF0 A;  4X6A J;  2ID6 A;  3BTL A;  4GFB A;  2LFB A;  2EZI A;  5GPA A;  2MW8 A;  2Y9Y A;  1TWC J;  3RZD J;  4MO7 A;  3G1M A;  1IUF A;  3TED A;  3I4N J;  1U9O A;  4QSH A;  1APL C;  1G2H A;  4JP0 A;  1S7E A;  4IEJ A;  3BR6 A;  2B63 J;  4B4C A;  5IP7 J;  5K7F A;  2COB A;  4W1U A;  4I6Z A;  1HDP A;  3S1Q J;  2YU9 J;  2H1K A;  2R5Y A;  3HBL A;  2GLO A;  4A3J J;  5J3L A;  3FKI J;  5K7Z A;  2E2I J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...