5IT9Z

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
AKHAVVLDQDKFDRIMKEAPTYRYVSVSVLVDRFKLGGSLARVALRHLENEGIIKPVSKHSKQAIYTRAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2016-03-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5it9Z00
2R7FA 1CF7A 3H92A 3LA3A 1YS7A 5F64A 4I09A 3L09A 3QP6A 1ONVA 1AWCA 1SMYF 3K1PA 4BHCA 3QU6A 2CO5A 1B9MA 1FP1D 5IT9Z 5BPDA 1TQPA 1TLHB 4Q5SF 2V1DA 1DDNA 2FNPA 5HLHA 2F2EA 3MFKA 4HZFA 4LB5A 4UVAA 1OYWA 3ZN0A 3BJOA 2L02A 2K4JA 1SD7A 1XMKA 1QNTA 4KMFA 1G3YA 1FY7A 3CUQC 3Q9SA 3GFJA 4WWCA 3BJAA 2PI0A 2A5YB 1OR7A 2HS5A 1V4RA 2M30A 4M9ZA 3R0AA 4NQWA 2R7DA 5HDGA 2IW5A 3K69A 1RUOA 1ZGAA 4K2EA 4O6JA 5LGTA 1KGSA 5LBQA 4MEYF 3REOA 2ZO4A 1R00A 2P5LC 1UHWA 4PDKA 2QUFA 4ENJA 1O7LA 2NNNA 4I0AA 2P8TA 3QAHA 3JAMZ 1HXDA 2MBFA 5KK1A 1G3TA 3E6DA 3LQRA 4ZYDA 1XB4A 5D5XB 5FD5A 5CVJA 1T2KA 2FQ3A 1WKMA 2BE5F 2W24A 4HF1A 3C3WA 2X4HA 1W5TA 2RV8A 1KQ8A 5L3EA 2K27A 4AIKA 1J59A 3P7NA 3BDDA 5LGUA 2V6CA 1S7OA 2O8XA 3E5QA 2ZKZA 3WODF 4WXDA 3GX4X 2ELHA 3QPTA 1X3UA 1IF1A 4ESJA 2ZXJA 4EVIA 4CZZA 1XGMA 2G9WA 2MD5A 4ESFA 3RJPA 2XRNA 4CO8A 3IKTA 2C6YA 4IHTA 1TW2A 1P6RA 5D4RA 4LK0F 3DPTA 1SD4A 5KVRA 3ZMSA 5ICEA 1BIBA 3V8KA 3F8BA 2BYVE 5CLSA 2CGPA 4AIJA 2RN7A 3WTXC 5CVRA 1XSDA 4FX4A 3EYYA 4EM0B 3TOBA 3L7WA 2ZBKA 5D5WB 3E97A 2J5PA 3E6BA 5CVVA 4LLNA 4LG0A 3KFWX 3DPLC 3MWMA 3N97A 1Z7UA 2BGCA 3CUOA 1OYYA 5DCMB 3WE3A 5E20A 1IUYA 2YR2A 5L3DA 5CVUA 3F6OA 2VE9A 5IT9K 4WXCA 3RKYA 2ESNA 4S04A 3HHHA 2L54A 2Z33A 2P5KA 4HX7A 3G3ZA 2O6GE 4MNUA 1XCVA 2EV6A 2M87A 2QZ8A 3O3KA 4PZJA 4R1HA 2DO7A 3B73A 2JRTA 1PP7U 4RGXA 4OINF 1R23A 2LF7A 1B6AA 4Y17A 2OA4A 2OQRA 2GIVA 2VONA 2HFHA 4HOBA 4LMYA 4LLGF 2VBZA 1P4XA 4N0BA 3CUQA 1ZAOA 2PEXA 5JVTA 2B0LA 1FSHA 2YSRA 2PQ8A 1XDUA 5CVIA 3I5UA 4BH9A 3WTTC 3HIFA 2STTA 2VODA 5LRSA 1H9TA 5FFXA 1W7PB 2ZNZA 5E1ZB 4XBFA 4KNYA 3BP8A 4ETSA 4G7ZF 1IN8A 3M8FA 5DUIA 4IRHA 2PMHA 1R1UA 3FWEA 1QZZA 3L2CA 1S6LA 3V7CA 1TW3A 2ISZA 3BWGA 3JTGA 1T38A 3WTZA 6PAXA 3PFIA 5K5OA 2GXGA 4ZYGA 1RZ4A 1QBJA 3F8FA 4HX8A 3F23A 3ECOA 2DQRA 3RIRA 3GVAA 3GF2A 4KT5C 2K7LA 1S3JA 2EFWA 2KJCA 4IPAA 2W25A 4HQEA 1UFMA 4OIQF 2FEZA 1I1SA 4EQQA 3VOEA 2RQPA 2MH2A 1GXPA 4UXNA 3IHUA 4P5OA 3RPQA 1BI3A 3VODA 2RVCA 2F5DA 1W5SA 1SD5A 1P2FA 2HGCA 2XKOA 3KEOA 2NRAC 3SQNA 3SHFA 1S7AA 1HBXG 4L9JA 4HLYA 2QQBA 4A6DA 1IXCA 2F5FA 1DP7P 4IXAA 2V79A 5K5QA 5J8CA 1J9IA 1D5VA 2ZNYA 4EM1A 3H3UA 1L0OC 1QPMA 2A6HF 1F5TA 3I59A 4M72A 3L9FA 2QQ9A 4G9YA 1WSUA 1REPC 3RKXA 1FT9A 4GXOA 2O3FA 2P7CB 1LJ9A 3COAC 3KZYA 4ENNA 1XGOA 2D45A 2VN2A 2CW0F 2IPQX 4KFCA 4KIBA 2RKHA 5K5RA 2ISYA 4HDVA 3Q9VA 1YW9A 2FBKA 3TKYA 3ABUA 1IN5A 3IWFA 1U6GA 4RB3C 2Q0OA 4KUMA 3J81K 1ZREA 2EFNA 2L3DA 3TGNA 3GXOA 2ADUA 3FXUA 2FOKA 4EM2A 3K1NA 3T0YA 1LDKB 1MDMB 2P4WA 1LEAA 1E2XA 4OMYA 2DW4A 1BJAA 4O5VA 2FRHA 3WTYC 2ESHA 5E18F 2DU9A 3PQKA 5HS9A 3WG9A 2RNJA 1TBXA 2VOPA 2JT1A 4ESBA 1JXSA 4CICA 1R1TA 4MTEA 3W6KB 2HQNA 4P96A 1ZGJA 1MD0A 4I7HA 5AIQA 5H6QA 4G6DA 5FD6A 3IRRA 3DEUA 3LA2A 4H0EA 4JQFA 4XLPF 2MC3A 1I27A 3TQNA 2XAQA 4I98B 3V7SA 1D3YA 2MLGA 1T39A 3E6MA 3O2PE 2M5WA 2XIGA 4HAMA 3ZMDA 4G6QA 1D8KA 1Z05A 4L0YB 2LSOA 1YFHA 2XVCA 4IHSA 3KEQA 1IAWA 5FB2A 4RGUA 3C7JA 2NNYA 3RTRA 5E1WA 3M8EA 2JZYA 4M6YA 3LWFA 4KMUX 1PDNC 2R3SA 3NRVA 3MQ0A 4ZYHA 4A0ZA 1LVAA 4OIOF 2HYFA 3KLNA 2A68F 1ZRDA 4RAZA 1U8RA 3L00A 1TNSA 4P9UA 2OU2A 2H94A 5AONA 4QWQA 4HQMA 1T98A 1F1ZA 2W85A 1K78A 5LHHA 1ODDA 2D1HA 1ZG1A 1ZRCA 1ZARA 3KP2A 3CJNA 2F5EA 4WXHA 1XCBA 3HYIA 4ZZDA 2E1NA 5L3BA 2YU3A 1LB2A 1O57A 4DNCA 2AS5F 2ZMEA 2IT0A 4CHUA 3P9CA 4LFUA 5L3FA 4A0XA 3SFZA 3S2WA 1KQ9A 4Z2YA 3I0TA 1Z9CA 4MEXF 2HTSA 3BPXA 3R61A 3EYIA 2QWWA 2QLZA 1ZG3A 4DQ2A 1U5TB 1Z1DA 4LLLA 1IXRC 3TO9A 2GQQA 3HSRA 4F7ZA 1GHCA 2Z3YA 2DTRA 4U7DA 3FXRA 5DD8A 3I59B 2DBBA 1H9GA 2GA1A 4S05A 2RC4A 1SAXA 3FMQA 2PN6A 2DAOA 3V4GA 2PG4A 4FT8A 2EA2A 2NS0A 3SXYA 1ZG5A 4M71A 1F9NA 3DV8A 1UHMA 3EETA 2IA2A 3KCCA 4L9NA 2BEOA 1LEBA 1IN6A 2OBPA 1FSEA 3ABTA 4PCQA 1BBYA 3HRSA 3RKWA 4WK8F 1FBSA 2DPDA 4A6EA 1BM9A 3AAFA 1FC3A 4A2UA 1MKMA 3DQVC 1V3FA 4RB1A 3T8RA 2QM3A 3JTHA 2EWNA 3JW4A 3HSEA 3O6BB 1KYZA 3VEPA 4FX0A 1H0MA 4E70A 3GEZA 2PLYA 2CG4A 2OZ6A 1FYMA 3LAPA 2UXNA 2UWMA 2YX7A 1R1VA 2XUBA 2Y0MA 3QU3A 2EB7A 1LNWA 4HLXA 4HW0A 2NYXA 2HZTA 1KU3A 3JSOA 2X0LA 3M9AA 1KYWA 4MHGA 4UUVA 2IVMA 4KA4A 4ENMA 3HRUA 3DF8A 1DUXC 4M6XA 2WC2A 1R5GA 1PP8F 1T6SA 3BPVA 3ELKA 3EQLF 2GWRA 4CGZA 5DV5A 2XAGA 3RPUA 2GXBA 5L3CA 4YIFA 5CJ9A 4EJWA 2NAZA 1XN7A 3ML6A 1MJ9A 3J81Z 3I4PA 4HF2A 3LQQA 4RB0A 1MJAA 5LHIA 3PQJA 2K02A 2G7HA 3B02A 5FLXK 5IT3A 3FM5A 5DUKA 2CWEA 1FYKA 5ILSA 1CF7B 5E8GA 2Z9OA 1L3LA 4ON0A 1FWZA 1FBUA 1Y0UA 3KP3A 1F4KA 3MZHA 2O03A 4L5IA 1RIOH 2HWVA 3NQOA 2EFQA 5CYVA 4U7BA 1QQIA 3M1EA 4BQAA 4FHTA 3TDZC 5DDGA 1GVJA 2CSOA 4BYYA 1SFEA 4A0YA 2TDXA 2PBIA 1K78B 2MLKA 2J5OA 4ZYEA 4LK1F 2V1UA 1R58A 3MAJA 1I5ZA 2KIUA 1U3EM 2YPRA 2VC0A 2XASA 1FBQA 2ZMEB 1Q1HA 1P4WA 2EFOA 3LA7A 2D2WA 3KP5A 5BQTA 3RYRA 2P7VB 1BC7C 4JK1X 2EV5A 3DFGA 2IP2A 5JR3A 2EFPA 1YQAA 4OMZA 1W4MA 5H6RA 1XD7A 5D5VB 2Q2EA 3RDIA 2QQAA 1TQMA 1U2WA 4L0ZB 1JE8A 5DCFA 4Q48A 1B4AA 3HOSA 1ZYRF 3C18A 3ZPLA 3HUGA 1KA8A 3V8JA 2IA0A 1A04A 3WE2A 1R7JA 2XV4S 2KRFA 1FYLA 1IZ1A 4XSXF 4Q47A 1XSXA 1QGPA 3T1BA 2P5VA 5F1RA 2W57A 5LLQA 4EGZA 1Z91A 2QVOA 4G7OF 2M1BA 5HS7A 3ZMVA 1UCRA 3FHZA 3DKWA 1IRGA 2CQKA 3WU0A 2COMA 1LDJA 1XGSA 3FF5A 4CXFA 2V9VA 3P9IA 1I6XA 2HYGD 3GZ5A 3SZPA 1MJBA 1G6NA 3WTVC 4G7HF 4OIPF 4P55A 5ED4A 3U1DA 2HKOA 3D5LA 3IC7A 4YFNF 1EH7A 3E5UA 4YFKF 2FSWA 3BOQA 3ROUA 1SFXA 2FE3A 1OYIA 3HTSB 4NB5A 2UZKA 2P6TA 5A2QK 1BOAA 2Z5UA 1XSVA 2DPUA 3GUDA 4OIRF 2K86A 4O3MA 2VE8A 3N4MA 2OAZA 4LG0B 1TNTA 1J2XA 2Y48A 1O3TA 5BPIA 4M9XA 1SFUA 3GFMA 4MQVA 3R6SA 4I0BA 1G4DA 4WCGA 3F3XA 1W7PD 1YLFA 3WGIA 1C0WA 5K1YA 4PGHA 1BI2A 2L4AA 5FGMA 3GZ6A 2KKOA 3T5XA 5EEHA 2ZCWA 2XROA 3R0JA 2IJLA 1ZN2A 1FPQA 5HDNA 1FNNA 3E3VA 2HTJA 3HTUA 3ZMUA 3F21A 2DQLA 3U9GA 4BHPA 2KIFA 4L18B 3K1MA 1RNLA 2XKPA 4BXUA 2M45A 3CUQB 4ZH4F 3RI4A 3ISPA 2LF8A 2CFXA 1ULYA 5ICGA 4XLNF 2OD5A 2XAJA 3CO7C 5TRDA 1O3RA 4Y13A 5F6FA 2EA4A 3VFZA 3SZTA 4HV6A 1IXSB 5D4SA 2L01A 5TJJA 1USTA 1QO0D 1BI1A 4AVPA 4GYGA 1OPCA 5ICCA 4LJZF 2DI3A 4EJVA 4L9VA 1HW5A 1HSJA 1STZA 4MQ9F 3HOTA 4N9HA 2W84A 2JSCA 2FXAA 5ICFA 5H20A 2A07F 3FZVA 4M74A 5E1XA 3F72A 1HSTA 2FMYA 2VXZA 3T8TA 2HQRA 3WTWC 2GZWA 5J8FA 5J6XA 2A61A 5FLXZ 1W7PA 3WU1B 2WTEA 2PJPA 1B59A 1HW2A 2E7XA 5HLIA 2VBYA 2IRFG 4HYEA 3IRQA 1FOKA 1MZBA 3NEUA 5E8IA 3J80K 2XAFA 4EV0A 1ZLJA 4KN7X 2BV6A 5AIPA 2H6CA 5ILUA 2FMLA 4A5MA 2UXXA 3CO6C 1K7AA 3CLOA 3IWZA 3QP5A 3KP7A 2LKPA 1KU7A 1XDSA 3P9KA 4RGRA 4YG2F 2CYYA 1UB9A 2HEOA 1FP2A 3BJ6A 2FF4A 4BAYA 1LDDA 1O3QA 4HF0A 1ON1A 1EH8A 3H3ZA 1J75A 1DPUA 5DD4A 4U88A 1Z6RA 4I02A 1E17A 3HSFA 5HS8A 2QENA 5D6EA 3FMSA 4HA8A 3ECHA 5FO5A 1KU9A 3QOPA 4IRIA 4B8XA 1D8JA 1KQ0A 4N9IA 2L4MA 5HOOA 2H09A 3GFLA 5D8LB 2DK8A 2VT3A 2ZFWA 3ZMTA 1B9NA 2AXLA 2K4BA 2EK5A 4D0PA 3I58A 2XHKA 3F8CA 3GW2A 2FA5A 5HVQC 3EUHA 2OZUA 4A12A 1ON2A 1HKQA 3TO7A 4UV9A 2MH9A 2DK5A 3OOPA 3BROA 5D5UB 3FX3A 3KZZA 2HKXA 1U5TC 1VTNC 3CDHA 4RS8A 3FXQA 4GO1A 5E17F 4EMSA 1MGTA 4ENKA 2ETHA 2HR3A 2O0YA 4XSZF 2RGVA 3G73A 3ULQB 3I71A 4BNCA 5JI6A 3TO6A 1BIAA 2PMUA 1XMAA 1J0RA 4YFXF 2PFBA 1SD6A 4BHBA 4L9TA 2H6BA 2ZJ2A 2LNBA 3GLXA 3R4KA 4Y15A 2E7WA 2Q8KA 5HLGA 3KP4A 1HW1A 1MDMA 5BOXA 3V8LA 2E1CA 4HBLA 1KU2A 2O61A 3HHGA 3Q5FA 3DP7A 1HKSA 5LRRA 1ZHFA 3RYPA 1JHHA 4KYWA 5ILVA 2QBYA 1K79A 1EV7A 2DFIA 2A6EF 4EJUA 5EEGA 5A2QZ 2WWYA 2VC1A 4LB6B 1G3WA 4EJTA 2EV0A 4XRFA 2V1XA 4RGSA 2OQGA 3F22A 4OU0A 3LFKA 1OMIA 1AOYA 1YW7A 4TV7A 1OKRA 2GAUA 2KIMA 3M7GA 1G3SA 5DEQA 3TOAA 1R22A 4RAYA 4G8XA 3WTUC 1YTYA 4NHJA 4MTDA 2LDUA 3LSTA 1R36A 1GXQA 1BC8C 1WI9A 4LD5A 1FX7A 4Q4ZF 2IA1A 4YIIA 3VB2A 4AIHA 4CYDA 1DPRA 1I1GA 1USSA 3JAMK 5FFZA 3HRTA 4U0WA 1IN4A 3MZYA 1RI7A 3WGHA 3IL2A 1QZYA 2DLLA 2WV0A 1SMTA 3F8NA 1XGNA 1IN7A 3CTAA 4HDUA 3QRFF 1RUNA 2JPCA 3FM3A 3F8MA 5L3GA 1ZRFA 1BI0A 3KP6A 2H27A 1FZPB 2FNAA 1YIOA 3GO5A 3LAJA 4U0VA 2FBHA 3MEXA 4UHTA 3KLOA 4M9SA 2XAHA 4R8HA 4I2OA 4CDGA 3HRMA 4KN4X 3W6JB 4A5NA 4WX9A 2JTVA 2M8EA 2HDCA 3R60A 3F6VA 3EDPA 3KETA 2QYOA 5D8KB 4I01A 2A69F 1NHAA 3KE2A 4UVBA 3ZP5A 3E5XA 1PUEE 1U5TA 4OOIA 1S29A 2F5CA 5JFRA 4PGGA 5LGNA 3BZ6A 5HDKA 1S8NA 1B1BA 5D6FA 3GFIA 4ASNA 1R5HA 2YX4A 3C1DA 3IKVA 1ZH5A 4IVNA 2VBXA 5BMZA 4EJOA 4QLCU 3ZMZA 3J80Z 4JBAA 2VOOA 3MCZA 2VBWA 4GCVA 3GWZA 2JPBA 4LGWA 4HX4A 4R79A 2MA3A 4AWXB 3ZQ7A 2STWA 3BY6A 3JSPA 1WWXA 3K9TA 3K2ZA 1J7KA 4UNOA 1JGSA 4L5JA 2ACJA 3V7RA 2FBIA 1YW8A 3DXJF 5LHGA 3GYHX 3I64A 1TTYA 3E6CC 3I54A 1IW7F 2EJRA 3OV8A 2GA2A 3U2RA 1JHFA 5BS6A 1WQ2A 1HQCA 4KICA 4RB2C 2Z99A 5JHUA 4EGYA 1BN5A 1YS6A 4M73A 1EH6A 4MGRA 5LEKA 4G94A 1HKTA 1WRJA 1YG2A 4KIFA 5ERIA 4GGGA 3WGGA 5DYMA 2QBYB 4WF2A 3ERED 4AD9A 1P4AA 2HOEA 3TDUC 1O7FA 2P6SA 4U0YA 1YO5C 1TQIA 3J7AO 3FMRA 5DCMA 3ZN1A 4IRGA 4GYIA 4KIGA 4UVCA 1FLIA 3K0LA 1U78A 3I53A 2VT2A 1ZLKA 4ZZLA 2DT5A 4P9FA 3QPHA 4IF4A 2D1VA 1CGPA 1K6OA 4KDPA 1Z6TA 1LQ1A 4UV8A 4HV5A 4B09A 2A3SA 1T0FA 2G7UA 5LEJA 2XGXA 2Y75A 3WTSC 2FU4A 4IJAA 1O3SA 2BBYA 1YYVA 1P92A 2RDPA 2KJBA 1J5YA 1IRFA 3D0SA
chains in the Genus database with same CATH superfamily
2R7FA 2DMQA 1WGXA 2ZSHB 4PSWA 1IO2A 1CF7A 2LY1A 3H92A 3K4NA 1YS7A 3LA3A 2W7NA 5F64A 3FXOA 2L2OA 2XAUA 4I09A 1Z7LA 3L09A 2BW3B 3D5RC 3QP6A 1ONVA 1AWCA 1W36D 1SMYF 2ZJQF 4UB6C 2KL4A 3K1PA 2CQNA 3VSLA 4BHCA 3GCMA 1BJZA 5DM7F 3QU6A 1I39A 1QRYA 2IGKA 1AHDP 2CO5A 1B9MA 5M5XJ 1FP1D 1K4TA 3BTLA 5BPDA 5IT9Z 3LNQA 1TQPA 1RKTA 1TLHB 4W1UA 3PIPF 4Q5SF 2DTZA 2V1DA 1DDNA 3HOXJ 2NVXJ 2FNPA 5HLHA 2F2EA 3HKZN 5GADJ 3MFKA 3JRGA 4HZFA 4LB5A 4B47A 1Z67A 4EEFG 3JRFA 4D1QA 4UVAA 2XGDA 1OYWA 1K6YA 1LFPA 3ZN0A 2M7BA 4PUSA 2CW7A 3BJOA 2L02A 3O8GA 2Q2EB 3MKWB 2K4JA 2IXSA 1SD7A 1XMKA 1QNTA 4KMFA 1G3YA 3CF5F 1FY7A 3CUQC 3Q9SA 1EKEA 3GFJA 4WWCA 3H5NA 2K5CA 3BJAA 4BJTA 2PI0A 2A5YB 3ONQA 1OR7A 1E3OC 2HS5A 1V4RA 2M30A 4M9ZA 3R0AA 3HUGB 4NQWA 3QYEA 2LMDA 2R7VA 2R7DA 3KYDB 5HDGA 2IW5A 3K69A 2HI3A 2MGQA 3S3MA 1ZGAA 4K2EA 4O6JA 3MMYB 1RUOA 5LGTA 3KIOA 3NAUA 3ASNH 2CQ7A 1KGSA 2X6XA 4FASD 5LBQA 3LSIA 4MEYF 1YJNI 3H5RA 1TP4A 3REOA 3ZXSA 2ZO4A 1R00A 5B1AH 2P5LC 2IS2A 1UHWA 4PDKA 2QUFA 3RCOA 3CCEI 4ENJA 1O7LA 2NNNA 4I0AA 2P8TA 3QAHA 1IUFA 3JAMZ 4FQGA 1HXDA 2X85A 4A3KJ 1W0UA 2E2HJ 2MBFA 5KK1A 1G3TA 2NS8A 1SC7A 3E6DA 3LQRA 2ME0A 2WY7Q 2KRHA 1RR7A 4E7ZA 4ZYDA 2OCEA 4HRIA 1D0YA 2VQHA 1XB4A 5D5XB 2O9LA 2X6YA 3W2AA 5FD5A 5CVJA 1GT0C 1OCOH 3M4OJ 2NVYJ 1T2KA 3OMYA 1N75A 2FQ3A 4X1EA 2IGNA 1WKMA 2BE5F 2W24A 4HF1A 3CCYA 1WHUA 3C3WA 3W2WA 2X4HA 2X48A 1W5TA 3MVPA 2RV8A 3OWTA 5H2FC 3OYFA 3QPSA 4M6VA 1X3ZB 1S72I 1KQ8A 1ZKGA 5C44J 5L3EA 2K27A 3OYMA 4AIKA 3BZKA 4PJMA 3KZIC 3ABLH 1I3QJ 1J59A 3H0GJ 3P7NA 2F4IA 3BDDA 2V6CA 5LGUA 1S7OA 1ZTRA 2AQEA 3C2GA 3DTKA 4PJJA 2O8XA 2OV7A 3E5QA 5KNLA 2ZKZA 3WODF 3CCRI 3Q0WA 1UG2A 4WXDA 3DBLB 1KZHA 4ZDPA 3GX4X 2ELHA 3QPTA 2X6OA 2Z16A 1X3UA 5EYRA 1IF1A 4ESJA 2ZXJA 4EVIA 4CZZA 3JRIA 1XGMA 4HSRA 2G9WA 2MD5A 3RQIA 4B48A 4ESFA 2V9PA 2X1EA 3RJPA 2XRNA 4CO8A 5J1YA 3IKTA 5FJ8J 3J7YJ 2C6YA 3S32A 4F52A 4IHTA 2R7TA 2GXAA 1LE8B 2L5QA 2M4KA 3S2HJ 1TW2A 1P6RA 4CYCA 3BG6A 5HNHA 2L9NA 2OTLI 5FRMA 5D4RA 4LK0F 3DPTA 5IPAA 1EJ9A 1SD4A 5KVRA 2NVUB 4C3JJ 1UJ8A 3VWBA 3ZMSA 4AC0A 1S5LC 5ICEA 1BIBA 4UUSA 3V8KA 3F8BA 5J1UA 3EUAA 1X58A 3J7ZI 4A3CJ 2L0KA 2BYVE 5CLSA 2CGPA 2LG4A 4CA0A 2BOLA 3CP2A 4I6ZA 5HLTA 3HBLA 4AIJA 2RN7A 1VQKI 2X9DA 4RM3A 3WTXC 1F43A 5CVRA 1XSDA 2A5WA 2QSFX 4FX4A 3DKXA 3EYYA 2R7WA 2XB0X 4EM0B 3TOBA 3L7WA 2Q1ZB 2ZBKA 5D5WB 3E97A 1XTAA 2J5PA 1UMQA 3E6BA 1WJEA 5CVVA 3PSFA 3SEQA 4LLNA 2JA7J 4LG0A 3KFWX 3BR5A 2WB1A 1TT5B 3DPLC 2L7FP 3H3VK 4CCOA 3MWMA 2F4OB 3N97A 2VQCA 4A3FJ 3DTIA 2F48A 1Z7UA 2BGCA 4KJZA 3CUOA 1OYYA 2KHMA 5DCMB 4N4OB 3WE3A 1GLNA 2QSGX 5E20A 1WH7A 3DLAA 1QVTA 1IUYA 1Y1WJ 3WG7H 2YR2A 1AKHA 3CJRB 5L3DA 4RM2A 3BTIA 3A0BC 5CVUA 3DU5A 3F6OA 2VE9A 3JRDA 5IT9K 3OYHA 2V6EA 4WXCA 3RKYA 1BOBA 2ESNA 2R5YB 3SZGA 3CF2A 4S04A 3HHHA 2L54A 1VQ8I 2Z33A 2FOWA 4HNTA 2P5KA 1SVOA 2X51A 3S1NJ 4HX7A 1OFCX 3G3ZA 3QPLA 2O6GE 4MNUA 3AL0C 2K9QA 1XCVA 2EV6A 2M87A 2QZ8A 2F4MB 3O3KA 4NC6A 1HLVA 4PZJA 4R1HA 1QA6A 2DO7A 4DZJA 4RLQA 4BKXA 3B73A 2JRTA 3GLLA 1PP7U 4RGXA 3O8HA 2KRCA 4BEHB 4OINF 3K10A 1R23A 2LF7A 4AYBA 1B6AA 4Y17A 2OA4A 3BTCA 1K83J 1ZK8A 2OQRA 3HG9A 2GIVA 2Y0SN 2UUZA 5E3MA 2VONA 2HFHA 2BY1A 1I50J 4HOBA 4LMYA 1NTCA 3E0JB 4LLGF 2VBZA 3K2AA 3CMYA 1P4XA 1QPIA 4N0BA 3CUQA 3H5AA 1LUJB 1N77A 1ZAOA 1VZ0A 2PEXA 1VNDA 2B0LA 4CCNA 5JVTA 2HVRA 2VUMJ 2KMUA 2YSRA 1FSHA 2PQ8A 1XDUA 5CVIA 4QIWN 3I5UA 4DYCA 2HNHA 4W97A 4ZDOA 1W5CC 3DTEA 3CJTB 2R7QA 4BH9A 3WTTC 2WB1N 4A3LJ 3K70C 4J19A 3HIFA 2QGUA 2STTA 3LSJA 2DDAA 5IP9J 3AG3H 2VODA 4AM3A 2R5ZB 3CCSI 2HXIA 5KCMA 2DT6A 5LRSA 4A3DJ 2BY2A 1H9TA 5FFXA 1W7PB 2ZNZA 5E1ZB 4XBFA 3E7LA 4KNYA 3OYEA 2DODA 1PVEA 2HQ5A 3BP8A 4ETSA 1IN8A 4G7ZF 3M8FA 4IRHA 5DUIA 3ZQHA 5E3LA 2PMHA 1R1UA 3FWEA 1QZZA 1MMGA 3L2CA 1S6LA 2DA1A 3V7CA 1TW3A 3G4SI 2ISZA 3BWGA 3CMAI 3JTGA 2JRMA 1T38A 3WTZA 6PAXA 1QVUA 2BVMA 2K9LA 3PFIA 5K5OA 2GXGA 4ZYGA 1RZ4A 1FJLA 5GAEJ 4YIRX 1NG7A 2O8KA 1QBJA 1MMDA 3F8FA 4HX8A 3F23A 1MNMC 3ECOA 2DQRA 3RIRA 1SAUA 3GVAA 1ETKA 1BW6A 3GF2A 4KT5C 2K7LA 1S3JA 2EFWA 1FTTA 3RKQA 3TP3A 2KJCA 4IPAA 4AYBN 5M3MJ 2W25A 4HQEA 3N05A 3ZQLA 2K40A 2DMTA 2JA6J 1UFMA 1ETXA 2DDBA 5F0HA 4OIQF 1V55H 2FEZA 1I1SA 4EQQA 3SEZA 3VOEA 2GOMA 2RQPA 3GTOJ 2MH2A 5GTIC 1GXPA 1YX5A 2CUEA 4UXNA 2EZKA 3IHUA 4P5OA 3RPQA 3S15J 1BI3A 3QWLA 2HDWA 2KZGA 5M5WJ 1MBHA 3OL3A 3K7AJ 3VODA 2RVCA 2F5DA 3IAM2 1W5SA 4JX6A 1SD5A 3G1LA 1P2FA 2HGCA 1S7EA 2XKOA 3KEOA 1JJ6C 2PJRA 2NRAC 3SQNA 3SHFA 1S7AA 4ANJA 4S0HB 1HBXG 4L9JA 4HLYA 1W1WE 2QQBA 4A6DA 1IXCA 2F5FA 4I99C 2DA3A 3BTJA 4LITA 2KISA 2LYCA 1DP7P 4IXAA 3K70D 2V79A 3G1MA 5K5QA 3S16J 5J8CA 3K4BA 5CQGA 1J9IA 5J1RA 4CSWA 1D5VA 2ZNYA 3H3UA 4EM1A 3H9GA 1IRZA 1L0OC 1QPMA 2A6HF 1F5TA 1WPKA 3I59A 1AU7A 1WZ2A 4M72A 2HOTA 2DA4A 5J4YA 3L9FA 2QQ9A 4G9YA 1WSUA 1VQ7I 1YRNB 1REPC 3RKXA 1FT9A 3IH4A 2PMZA 3FKIJ 4XOTA 5KAIC 4GXOA 2V4JC 4CZCA 4Y4RA 4ZDLA 2O3FA 5K7FA 4C9YA 1S9HA 2P7CB 5J40A 1LJ9A 3COAC 2Z1DA 3UR3C 1BR1A 3KZYA 3MZ8A 4ENNA 2XGCA 1XGOA 1Y1VJ 4CYCB 2D45A 2VN2A 3HB9A 1X19A 2VLAA 2R7UA 2CW0F 4XR6A 4C2UA 2IPQX 4KFCA 4C2MJ 4KIBA 3LSRA 2L9VA 2RKHA 3Q0UA 5K5RA 1D0ZA 3GTJJ 2ISYA 4UUSB 3QOEA 2DFEA 4HDVA 3Q9VA 1YW9A 2FBKA 2DMNA 3TKYA 3ABUA 1IN5A 3IWFA 4F93B 3OYDA 1U6GA 4RB3C 2Q0OA 3JRBA 4KUMA 3J81K 2VQLA 1ZREA 2EFNA 2L3DA 2LREA 4XKCA 1GV5A 3TGNA 3GXOA 5EEAA 2ADUA 3S3OA 1JKQC 3FXUA 2E34A 2FOKA 1IJWC 4EM2A 3K1NA 4II2A 1VQ6I 4Y33A 1VQOI 1IDYA 3LSGA 3T0YA 1LDKB 1MDMB 3CD6I 4XQFA 4FCYA 2P4WA 3BR6A 3D5SC 1LEAA 3A02A 1E2XA 4OMYA 3HZJA 2DW4A 1BJAA 4O5VA 2FRHA 3WTYC 4XK4A 5M3FJ 1SEUA 1D1BA 2ESHA 4XLAA 5E18F 1OQYA 2DU9A 3PQKA 5HS9A 3WG9A 2EZIA 2RNJA 3OSGA 2R0QC 1TBXA 2PMZN 2VOPA 2JT1A 4ESBA 2CFOA 2A6TA 2V7FA 1YX3A 1JXSA 4FE4A 4CICA 1R1TA 4MTEA 4M3GA 3W6KB 2ICWG 2HQNA 3VYTB 4P96A 2W1OA 2ME6A 1ZGJA 1TC3C 1MD0A 4I7HA 5AIQA 4F3QA 5IYCJ 4BDYA 2QKMB 5H6QA 4G6DA 1MSFC 4HG2A 5FD6A 5K7ZA 3IRRA 2HZDA 2HPIA 4B44A 3DEUA 3LA2A 1WVRA 4H0EA 4JQFA 4XLPF 1DGWY 2MC3A 1I27A 2HOSA 3TQNA 2XAQA 4I98B 1H89C 3V7SA 2DMPA 1D3YA 2LR8A 4BUPA 5HODA 2NS7A 1XG1A 2MLGA 5E3OA 1T39A 3E6MA 3O2PE 2M5WA 1Z21A 4QSHA 3JRCA 2XIGA 2R7OA 4HAMA 3ZMDA 5FKKA 4LOCA 3L1PA 1IC8A 4G6QA 1YJ9I 1D8KA 1Z05A 4L0YB 2LSOA 1YFHA 1FIAA 3S17J 1I3AA 2XVCA 1IG7A 4IHSA 1H8AC 2TCTA 3KEQA 3PL8A 2DJIA 2WADA 4BDZA 1X4PA 3MD2A 1GVDA 1IAWA 4IX7A 1LPQA 5FB2A 1T33A 1Y8RB 4RGUA 2EBIA 3C7JA 3E1SA 4A3JJ 2NNYA 2LY9A 3RTRA 5E1WA 3ZRGA 3M8EA 2JZYA 4M6YA 2E1MC 5GTHC 1Y39A 3LWFA 2LOOA 4KMUX 1PDNC 2BXZA 1JUMA 3MKYB 1VQ4I 2R3SA 3NRVA 3MQ0A 4ZYHA 3HM5A 4A0ZA 1LVAA 4OIOF 2HYFA 3KLNA 2A68F 1B8IA 1ETWA 5GP9A 1ZRDA 4RAZA 1U8RA 4JX5A 3L00A 2AHQA 3KX2A 2V1NA 3W6VA 1TNSA 3ZR8X 4P9UA 2OU2A 2H94A 5AONA 4QWQA 4HQMA 1ZR2A 1APLC 3CESA 1T98A 3HXLA 5GAHJ 2GLOA 1F1ZA 3A1YA 2W85A 1K78A 1GV2A 3VSKA 5LHHA 1ODDA 2D1HA 1ZG1A 1SVMA 1ZRCA 2CV2A 1ZARA 3KP2A 4D5CA 3PO3J 1MH4A 2E5ZA 3CJNA 2F5EA 3LSKA 3OYAA 1X2NA 2QCOA 1HC8A 4WXHA 1XCBA 2H8WA 3HYIA 4ZZDA 2E1NA 5L3BA 2YU3A 2QSHX 3H1CA 1LB2A 1G59A 1O57A 4DNCA 2EQRA 2BY0A 2JWTA 2AS5F 2ZMEA 4XKBA 2IT0A 4A3GJ 4CHUA 3P9CA 4LFUA 5L3FA 4A0XA 3SFZA 3IV5A 4LIUA 3S2WA 1KQ9A 4NBQA 2YUSA 4Z2YA 3I0TA 1LVKA 1RETA 1Z9CA 3GTLJ 4CUGA 2XC7A 5B5EC 4MEXF 3AG2H 2HTSA 4LIVA 3BPXA 5F0FA 4ZTJA 3R61A 3EYIA 3LL7A 2IS4A 1UAAA 2IS1A 1RESA 2QWWA 2AO9A 2QLZA 1ZG3A 4DQ2A 4YRVA 4XRMA 1U5TB 1Z1DA 2HOAA 1IXRC 2RQQA 4LLLA 5IY5H 3TO9A 4BQNA 2GQQA 3HSRA 4F7ZA 3X2QH 1TWAJ 1SVLA 1IRXA 4IHYA 1GHCA 2Z3YA 3I3LA 2JMWA 3NWSA 4CH7A 3OL4A 2DTRA 1WJAA 1TWHJ 2LKSA 4U7DA 3FXRA 5DD8A 3I59B 2DBBA 4BJ5C 1H9GA 2GA1A 3RPUD 2RC4A 4G6TB 3FMQA 4S05A 3CCLI 1SAXA 2PN6A 2DAOA 3A01A 3V4GA 1WI3A 2PG4A 4FT8A 1Z0XA 2EA2A 1MMAA 2NS0A 1QHHD 3S8PA 3SXYA 1ZG5A 4M71A 2GM4A 1F9NA 1HCRA 4IZZA 3DV8A 5FLMJ 1QU3A 1UHMA 4PJLA 2LC2A 1SFKA 3EETA 2ECBA 2IA2A 2X1DA 3FHNA 3KCCA 4L9NA 2WV1A 2BEOA 1LEBA 1IN6A 2OBPA 3ABTA 1FSEA 4PCQA 1BBYA 4HSTA 3GTQJ 5FKLA 3HRSA 5IOZA 1U9OA 5J4VA 3RKWA 5DTDA 2HYJA 3VYSB 2MG4A 4QPOA 3ESWB 1R4NB 2LTPA 4WK8F 1FBSA 3TW7A 2DPDA 4RDUA 3I4MJ 4A6EA 3FIWA 2E2JJ 1YOVB 4M3BA 1BM9A 3FK6A 1BR4A 3AAFA 1FC3A 1X2MA 4A2UA 1IV8A 4C3IJ 1BA5A 2CU7A 1MKMA 3P5JA 3OYIA 3DQVC 2R92J 4J00A 1V3FA 4RB1A 3T8RA 2QM3A 4UUTA 3JTHA 2EIKH 2EWNA 3BG9A 3HSEA 1V5GA 3JW4A 1ZGWA 3O6BB 1KYZA 3VEPA 4FX0A 3JREA 1H0MA 4E70A 3GEZA 2PLYA 2CG4A 3HDDA 4Y3OA 2OZ6A 1FYMA 3LAPA 2UXNA 2BHZA 3IH2A 2UWMA 2Y0SA 1R71A 3JCUC 2JJ7A 2AQFA 2CQXA 2DOEA 2YX7A 1R1VA 1MMSA 1U8BA 4XLFA 2IS6A 2XUBA 2Y0MA 4B4CA 4JX4A 4AUXA 3QU3A 2EB7A 1LNWA 3PFYA 1F36A 2W48A 4HLXA 3FXLA 2NYXA 4HW0A 4OWRB 1E0EA 2HZTA 1BR2A 1MNEA 5HNFA 1A35A 2E1OA 1T08B 1KU3A 1HDPA 2X0LA 3FBIB 3JSOA 2B63J 3M9AA 2JA2A 2VJ4A 1VQ5I 1KYWA 2KPMA 1OLTA 4MHGA 4UUVA 2P0WA 2IVMA 4F55A 4KA4A 4ENMA 3HRUA 2HDDA 1Q1VA 2QEXI 3DF8A 1DUXC 4M6XA 2ZFUA 2WC2A 1R5GA 4DOZA 1VFCA 1SFOJ 1ETQA 3K4JA 1PP8F 1T6SA 4X6AJ 4UY8I 3BPVA 3ELKA 4D5FA 2BZTA 3EQLF 4XMYA 4FETA 2GWRA 4CGZA 2CMPA 5DV5A 3DKYA 4RAFA 2R7SA 4AVZA 2OTJI 2XAGA 3RPUA 2GXBA 2E36A 2DOAA 3ABKH 5FROA 5L3CA 5CQEA 3ZQIA 3G1OA 4YIFA 1ETVA 2CUJA 5CJ9A 4EJWA 3BR2A 2NAZA 1XN7A 3ML6A 3Q0VA 1MJ9A 2BXYA 3I4PA 3J81Z 4HF2A 3G2BA 4BL0B 3SDBA 3LQQA 4RB0A 1MJAA 3OS2A 5LHIA 3PQJA 2K02A 2G7HA 3B02A 5FLXK 5IT3A 1GDTA 2Y30A 1R9TJ 1A31A 3FM5A 1TZLA 5DUKA 5EGOB 2CWEA 2QA4I 4GFBA 3ZGKA 3QYFA 1ITYA 3LOCA 4HEA2 5ILSA 1FYKA 5E8GA 1CF7B 5TGTA 3KYCB 2DA7A 2Z9OA 1L3LA 4ON0A 5F27A 1FWZA 1FBUA 1Y0UA 3KP3A 1F4KA 3SJMA 3MZHA 4IEJA 2O03A 1RKWA 4BU2A 4L5IA 2WA0A 3V42A 1RIOH 1DGRM 2HWVA 3NQOA 2EFQA 3L2WA 3UNGC 4V2FA 3M1EA 1QQIA 2TRTA 5CYVA 5FKOA 4U7BA 4BQAA 4DW6A 3G6EI 4E4HA 4BACA 1OCCH 4FHTA 3TDZC 5DDGA 1GVJA 2VIXA 4RBOA 4D9JA 2M4GA 2CSOA 2JA8J 3MKZA 1V54H 4XL9A 4BYYA 1SFEA 2H8RA 3CP8A 4A0YA 4ABZA 2TDXA 3HOZJ 2PBIA 2K3FA 2KZVA 2MYSA 3L2QA 3HOUJ 2R7XA 4V2GA 4ZC3A 1K78B 2MLKA 3PNTA 1P7JA 1WJFA 2E60A 4BE0A 2WBMA 2ELJA 2X6WA 2CH0A 4IOAF 2J5OA 4ZYEA 4PFOA 1B72A 3BG3A 3LSMA 4LK1F 1OCRH 4PSXA 2VKHA 2V1UA 3TW6A 1R58A 3BQYA 3MAJA 1I5ZA 1R5ID 2KIUA 5FLVA 1U3EM 3U1KA 2LRDA 2YPRA 3M8JA 2M8GX 2VC0A 2CUFA 1JUPA 3K6GA 4FE7A 4NQWB 4E7HA 2XASA 1FBQA 2ZMEB 1Q1HA 2LY2A 1P4WA 3L2RA 2CV0A 1FEXA 2EFOA 4J01A 3WHBA 3LA7A 2D2WA 3KP5A 3BR0A 2QF7A 4E7KA 3S3NA 1ACIA 5BQTA 3TEDA 1ZR4A 3RYRA 2P7VB 3DEEA 1JTXA 1BC7C 4JK1X 2EV5A 1UELB 2M7AA 4ZJZA 2IBDA 3DFGA 1D1CA 4A3MJ 1H88C 2IP2A 5JR3A 5DS9A 5JLWA 1ZQ3P 2EFPA 4DJAA 3K4MA 4M3DA 4I76A 4X0GA 2HU9A 1YQAA 4OMZA 3S1QJ 4G12A 1W4MA 1A6QA 5H6RA 1YE9A 4A69C 1XD7A 5D5VB 2Q2EA 3RDIA 2ELKA 2LFBA 1OCTC 4BQOA 2QQAA 2K85A 1TQMA 1U2WA 4L0ZB 3VDXA 4BBRJ 1JE8A 1D5YA 2DYRH 2W4SA 5DCFA 4Q48A 1B4AA 3C2HA 3HOSA 1ZYRF 3PM1A 3C18A 3ZPLA 2DMUA 3HUGA 1KA8A 3V8JA 2IA0A 1VQLI 1A04A 5KHDA 2BHYA 2V9KA 3WE2A 2KDZA 1OJLA 1XS9A 1R7JA 2XDVA 2XV4S 4QTRA 1RR8C 3BCBA 4XONA 2DYSH 2KRFA 1XPXA 1FYLA 5KAFC 1IZ1A 4XSXF 4Q47A 1XSXA 1QGPA 5EJCA 3T1BA 2P5VA 5F1RA 2W57A 5LLQA 1M1EB 4EGZA 4IHWA 1T56A 1Z91A 2QVOA 2CJJA 2M1BA 4G7OF 1EF4A 4BXXJ 5HS7A 3ZMVA 5TISC 1UCRA 3FHZA 3DKWA 1IRGA 2CQKA 3WU0A 2COMA 2JSPA 1LDJA 2M9HA 1XGSA 3FF5A 2VL8A 4CXFA 2V9VA 1PUFA 1TL8A 1Y0NA 2CV1A 2I8DA 3P9IA 1KONA 1MIJA 1BL0A 1I6XA 2HYGD 3GZ5A 2M0MA 3SZPA 1MJBA 2L7MP 4HNVA 2VJIA 3GTMJ 1G6NA 3WTVC 1MBJA 4G7HF 4OIPF 4P55A 1O4XA 5FKNA 3ERMA 2VJJA 5ED4A 1ERDA 1Y8QB 3U1DA 5B66C 1U0JA 2HKOA 3D5LA 2KLOA 1LKXA 3IC7A 4YFNF 4OAYA 1JJ8C 1EH7A 3E5UA 4YFKF 1WJDA 1VI0A 2ZSIB 2EZLA 1LFBA 3OS1A 3S1MJ 1VF9A 2JA5J 2XF7A 4E7IA 2FSWA 3BOQA 3VYUB 1R49A 1YI2I 3ROUA 1SFXA 3CJQB 2FE3A 1OYIA 3HTSB 1PJRA 4NB5A 2UZKA 2P6TA 1UHSA 4DYQA 3OIOA 5A2QK 1BOAA 2Z5UA 1XSVA 2DPUA 3BQZA 2VKVA 2W82A 4CCKA 3GUDA 4OIRF 2K86A 4XRSG 4O3MA 2R93J 4DGWB 2VKDA 2VE8A 3N4MA 1R6RA 1WCMJ 2OAZA 3CCQI 4LG0B 4M3FA 3F0CA 5EG0A 2KIQA 1TNTA 4LG3A 1J2XA 2Y48A 2XGEA 3FISA 1O3TA 5BPIA 2UV1A 4M9XA 1SFUA 3GFMA 4JOMA 4MQVA 3DLLF 2O7OA 3R6SA 1QHGA 4I0BA 5CKTA 5E79C 1G4DA 4WCGA 2ZC2A 2ID3A 1W7PD 2WAEA 1YLFA 3F3XA 1AKHB 2NVTJ 2GOXB 2RAEA 3WGIA 1C0WA 4NC8A 4V19K 3A2KA 5K1YA 2DOFA 2NXNB 3EUHC 3MN2A 4AIDA 4PGHA 1BI2A 4RMNA 4H4KC 1ENHA 2L4AA 5FGMA 4XLCA 3GZ6A 2KKOA 3T5XA 4XM3A 3PSIA 5EEHA 4BQQA 2E5NA 1Z3XA 2ZCWA 4GRIA 1VQNI 2XROA 4XKWA 3TBIA 4XORA 3DBHB 3R0JA 5B3SH 4UB8C 2IJLA 4NC7A 1ZN2A 4E7SA 1FPQA 5HDNA 2Y9YA 4PK4A 3HOYJ 1FNNA 1UG0A 2JUGA 3E3VA 2HTJA 3HTUA 3ZMUA 3F9KA 5IYDJ 3F21A 2DQLA 5JLXA 1E3HA 3U9GA 2JK3A 3ZQCA 3ABMH 3OS0A 4BHPA 5JVGF 2KIFA 4L18B 2OF7A 3K1MA 1RNLA 1ZELA 2XKPA 2M45A 4HPQA 2KDOA 4BXUA 3L2UA 3MKLA 1Z77A 3CUQB 3BCAA 4ZH4F 3WHCA 3RI4A 3ISPA 2LF8A 2R5YA 2CFXA 1DU0A 1ULYA 5ICGA 2YU9J 2L7KA 3BC8A 4XLNF 4BE1A 2Y9ZA 3SDGA 5F0CA 2OD5A 1U9NA 2XAJA 3CO7C 5TRDA 1NH3A 1O3RA 4JP0A 1X3WB 4Y13A 5F6FA 3KPHA 2EA4A 1G8XA 3VFZA 3SZTA 4HV6A 5GPCA 2WAQN 2CUZA 4AU7A 4B43A 3SYTA 2K9MA 3U21A 4Y7NJ 4XRSA 1IXSB 3TP0A 5LD2C 3FXMA 3A03A 3VYRB 5D4SA 2L01A 5TJJA 1USTA 1QO0D 3EPZA 3EUKL 1FOXA 1BI1A 2EIJH 3HPGA 4AVPA 1X1DA 4GYGA 1OPCA 1PYVA 5ICCA 4LJZF 2DI3A 3OR1C 4EJVA 4L9VA 4KITB 4IKFA 1HW5A 4RA2A 1HSJA 4CCLA 1STZA 4MQ9F 3HOTA 3H0DA 2IGOA 2ZXHA 2WY8Q 4N9HA 4M3EA 1GUUA 2W84A 2JSCA 2FXAA 2VJ5A 5H20A 5ICFA 2IEKA 5GPAA 3FDYA 2HQAA 3DEWA 2A07F 3FZVA 2VI6A 2W00A 5EZHA 1QZEA 4M74A 4NDLA 5E1XA 3GZNB 3OYBA 3F72A 1HSTA 2FMYA 1OISA 2VXZA 3S1RJ 3T8TA 2KP6A 2R5ZA 2HQRA 2N8GA 3WTWC 3IP4B 3PUFA 2GZWA 2DA5A 5J8FA 5J6XA 3AFHA 2A61A 3CZ6A 5FLXZ 1W7PA 3WU1B 4A3EJ 3M3YJ 1I6HJ 2FJ1A 3GTPJ 2WTEA 3OOUA 2PJPA 1B59A 5C3EJ 2OC6A 3KYLA 2MFZA 3HOWJ 5FKMA 1R4MB 3OIQA 1HW2A 2E7XA 5HLIA 3JRHA 2VBYA 1XX5A 2IRFG 4HYEA 3IRQA 1FOKA 1MZBA 3NEUA 5E8IA 3J80K 2XAFA 4EV0A 1ZLJA 3ZQQA 4KN7X 3W3CA 1JKOC 2H1KA 2BV6A 5AIPA 3CMMA 3I55I 1LFUP 2QQ8A 2PJRB 2H6CA 5ILUA 2FMLA 1XC5A 4C3HJ 4A5MA 2UXXA 3CO6C 1K7AA 3CLOA 3H9QA 3IWZA 1ETOA 3K4KA 3QP5A 3KP7A 2LKPA 1KU7A 1XDSA 4C30A 3P9KA 4RGRA 3HPHA 4YG2F 2CYYA 1UB9A 1MNDA 4N4NB 2XPVA 2H1LA 2HEOA 1FP2A 3BJ6A 2FF4A 3HGGA 4BAYA 1JT0A 1LDDA 1O3QA 4HF0A 1ON1A 3OR2C 1EH8A 3H3ZA 2HXOA 4MO7A 4U87A 1J75A 1DPUA 3H36A 2MW8A 5DD4A 4U88A 5JHFA 1Z6RA 1PUFB 4I02A 1E17A 3HSFA 3DWLE 4DIQA 5HS8A 2QENA 3DU6A 5D6EA 3FMSA 2NOJB 4HA8A 4P1WA 3ECHA 5B1BH 5FO5A 1KU9A 3QOPA 4IRIA 4B8XA 1W0TA 1D8JA 1KQ0A 2EINH 4N9IA 1VQ9I 2L4MA 4E6KG 5EZGA 5HOOA 2H09A 3VPRA 3GFLA 4RLFA 2D5VA 1MMNA 5D8LB 5IOYA 4XICA 1WJ5A 2DK8A 2XRLA 3ZQFA 4B3XA 3H35A 3Q3SA 2VT3A 1Z3YA 2KT0A 2ZFWA 3ZMTA 3GTKJ 2OJED 1B9NA 2AXLA 4A93J 2K4BA 2EK5A 4D0PA 3OIPA 2XSJC 3I58A 4OAZA 1MBEA 3CCVI 5CPRB 2XHKA 3F8CA 3GW2A 2FA5A 2M2EA 5HVQC 2GBYA 1YRNA 3BLYA 5E3NA 3EUHA 2OZUA 1MBKA 3DCFA 3S2DJ 1P9QC 2JQ7A 3FK7A 4A12A 4II3A 1ON2A 3I4NJ 1HKQA 3TO7A 4UV9A 1FOYA 2MH9A 2DK5A 3QQAA 1HDDC 3OOPA 3BROA 5D5UB 4IL6C 3FX3A 2YS9A 1A6IA 3KZZA 2HKXA 3OYJA 1U5TC 1TWGJ 3AL0B 5EG0B 1VTNC 4Z6YA 3CDHA 4RS8A 3M1CA 3FXQA 4GO1A 3HGYA 5E17F 4EMSA 1MGTA 3HJEA 2ETHA 5J47A 4FTHA 4ENKA 1MH3A 3IH3A 1K4SA 2CRGA 5FRNA 2HR3A 2LP0A 3CCMI 2O0YA 4XSZF 4E7LA 2RGVA 3ULQB 3G73A 1FTZA 3I71A 4BNCA 5JI6A 3IAS2 3TO6A 1BIAA 2PMUA 3SFIA 1XMAA 1J0RA 3BZCA 4DBRA 4D7NA 3CDIA 4YFXF 2HVQA 2PFBA 2RREA 1SD6A 4BJ6C 2DCEA 4BHBA 3L2VA 4L9TA 2H6BA 2ZJ2A 4DYRA 2LNBA 4IQ4A 3GLXA 3R4KA 4Y15A 2LKXA 2EPFA 2E7WA 4KT6A 2LLKA 4XKVA 2Q8KA 2LBFA 2M3AA 5HLGA 3KP4A 3AG1H 2MD0A 3PUBA 2L9RA 1HW1A 1MDMA 2ZB9A 5BOXA 3V8LA 1JUSA 4KISA 2XF6A 2P81A 2E1CA 4HBLA 1KU2A 4NUBA 2DT7B 1Y56A 2O61A 4PJNA 4IHXA 3HHGA 4C2TA 3Q5FA 3RQ4A 3DP7A 3CCUI 1HKSA 4ZTFA 2EIMH 3PNVA 2VQGA 1OCZH 1WFXA 5LRRA 1ZHFA 3RYPA 1JHHA 2I5UA 1N78A 1SANA 4KYWA 1YJWI 2BY3A 1X1CA 5ILVA 3OYNA 2ZXIA 2QBYA 1K79A 1EV7A 2DFIA 2LD5A 2A6EF 2RNGA 4EJUA 5EEGA 5A2QZ 5IYBJ 3UKGA 2WWYA 2VC1A 1JGGA 2DN0A 1UZCA 4LB6B 1G3WA 3WU2C 4EJTA 2DXIA 2EZHA 2EV0A 4XRFA 2V1XA 4QPQA 4RGSA 2OQGA 3F22A 4OU0A 3LFKA 4HNUA 1VQPI 2JUCA 4MIMA 3GMEA 2R4GA 1OMIA 1AOYA 1YW7A 4TV7A 1OKRA 2IAIA 3ZQGA 2GAUA 3RSNA 2KIMA 1HF0A 2E35A 3M7GA 3FXJA 4IHVA 2L9SA 2FUG2 4XN3A 1G3SA 5DEQA 3TOAA 3CC7I 4MLOA 1R22A 2R7ZJ 4RAYA 4ZYAA 1RPWA 4G8XA 3WTUC 1YTYA 4NHJA 4MTDA 2OPTA 1XMXA 2Z2SB 1CQTA 2FX0A 1B8IB 2LDUA 3LSTA 4PFPA 1V5EA 3J7AY 1R36A 2G0EA 1GXQA 2BVLA 5M5YJ 1BC8C 1WI9A 2XF5A 4GDFA 4LD5A 5IP7J 2MABA 2MSYA 1FX7A 3H9JA 4Q4ZF 4B3AA 2IA1A 5EF6A 3OY9A 4YIIA 2KQRA 1DP3A 3VB2A 2JVGA 4AIHA 4CYDA 9ANTA 2M34A 1DPRA 1I1GA 3TL4X 2VB6A 1G2HA 1USSA 3JAMK 5LFAA 5FFZA 3HRTA 2Y31A 1IN4A 3K4CA 4U0WA 2K9NA 2VXDA 3MZYA 1RI7A 3WGHA 3IL2A 2X1CA 2EH3A 2DFFA 1QZYA 2HVSA 2BW3A 2DLLA 3BR3A 2WV0A 2E19A 1SMTA 1X1AA 3QODA 1JTYA 4XIDA 2JVHA 3JRAA 1JI8A 4XOPA 3F8NA 3BG7A 1XGNA 1T0FC 1IN7A 3CTAA 4HDUA 1FMWA 1EA3A 3QRFF 1RUNA 3ASOH 4D7MA 3RZDJ 2EILH 2ZJRF 2JPCA 3DBRB 3D1NI 3FM3A 3B6CA 2Y69H 5EDNA 3F8MA 5L3GA 3BR1A 4IO9F 1ZRFA 1BI0A 1WH5A 1D0XA 4FISA 4RAGA 1WJBA 3KP6A 2H27A 1FZPB 2FNAA 1YIOA 1T8IA 2NOGA 3GO5A 3FXKA 3LAJA 4U0VA 2FBHA 3MEXA 4UHTA 4BGDA 3KLOA 3C2BA 4M9SA 2B7EA 1FMVA 2XAHA 4R8HA 3AKZA 4BXFA 4I2OA 2B9SA 3CLQA 4F91B 3PIOF 4IOCF 4CDGA 3HRMA 3CMEI 4KN4X 1DQUA 3CDLA 3W6JB 4A5NA 1D1AA 4WX9A 3GTGJ 2JTVA 2M8EA 2HDCA 5F1JA 1NK2P 4CCJA 1HA8A 1IDZA 3PNYA 3GBGA 3A01B 1X4OA 2A05A 2DFHA 3R60A 5BNGA 2DA6A 3TMOA 1NK3P 3F6VA 3EDPA 3KETA 1ETYA 3CC2I 4DZPA 2QYOA 3QYBA 1ORKA 4XN0A 5D8KB 3KEYA 4I01A 1V5FA 2A69F 3OYLA 2E71A 3A4CA 3B6AA 1RRJA 1E3PA 2WAFA 3LSHA 1NHAA 1YITI 1TT0A 3KE2A 4UVBA 2ZJPF 3ZP5A 3LSPA 3E5XA 1PUEE 1U5TA 4OOIA 1S29A 2F5CA 5JFRA 4PGGA 3NARA 5LGNA 3OYCA 3BZ6A 5HDKA 1NG6A 1IGNA 2VKEA 1MBGA 1S8NA 4YELA 1B1BA 4XLEA 5D6FA 1BW5A 3GFIA 3RZOJ 1WJCA 3OYKA 4ASNA 1R5HA 1OR7C 1Y6IA 2YX4A 3C1DA 4BY1J 3IKVA 3JR9A 1ZH5A 4IVNA 2JN6A 2ID6A 2VBXA 2ZMEC 5BMZA 2FQ4A 3LMMA 4EJOA 1MBFA 4QLCU 3ZMZA 1JKPC 5IP6A 3J80Z 2MC4A 4JBAA 1T95A 3MCZA 4BY7J 4BS9A 2VOOA 2VBWA 4GCVA 3GWZA 3LFUA 2JPBA 4LGWA 4HX4A 4R79A 2MA3A 3PJRA 4AWXB 1J09A 4ITVA 3ZQ7A 4E7JA 3BY6A 2STWA 3JSPA 3HL2A 1WWXA 1N25A 3S14J 3K9TA 5GAGJ 1OCPA 4A3BJ 1TWCJ 2VPLA 4XNFA 1JT6A 2DA2A 3K2ZA 5K7HA 4A3IJ 4BBSJ 2LVSA 1J7KA 4UNOA 1JGSA 4EATA 3I9V2 4B1RA 4L5JA 4PJ0C 3FKJA 2ACJA 3CQZJ 3V7RA 1MW7A 2FBIA 1YW8A 3DXJF 2XSDC 5LHGA 1LE8A 2CQQA 3GYHX 1X1BA 3I64A 2FD5A 1TTYA 5J3LA 3E6CC 2I10A 3ZOBA 4F92B 3W2VA 2HPMA 3I54A 2F6CA 3K4LA 1IW7F 1IV6A 2K9SA 2EJRA 1X1PA 5C4XJ 2KFDA 3OV8A 2WAQA 2GA2A 3U2RA 1JHFA 5BS6A 1A36A 1WQ2A 1FIPA 2COBA 2LBFB 1HQCA 4KICA 4RB2C 1TWFJ 3IUOA 2Z99A 5JHUA 3AG4H 1RC9A 4IQJA 1P7IA 4MFEA 5F08A 4EGYA 2E2IJ 2XB5A 3HOVJ 1BN5A 1JKRC 1W36C 1YS6A 3BT9A 4M73A 1EH6A 2GIZA 3HC7A 4MGRA 4DBQA 4G94A 5LEKA 1VQMI 1MSEC 1HKTA 1WRJA 1YHQI 2E1MB 1K61A 1YG2A 4JYKA 2VPRA 4KIFA 1YIJI 5ERIA 4GGGA 2F5VA 2L7ZA 3WGGA 2ECCA 5DYMA 4MFDA 2QBYB 4WF2A 3ERED 2O5RA 4AD9A 1P4AA 3HEFA 1AA7A 3I56I 2HOEA 3TDUC 3CCJI 2CS3A 1O7FA 2P6SA 4U0YA 2R7RA 1YO5C 2LH9A 1TQIA 3J7AO 3FMRA 3NWTA 2DJNA 2NVQJ 3M07A 5DCMA 3ZN1A 2V26A 2OCCH 3BG5A 3HKZA 3OSFA 3ZCOA 4IRGA 4GYIA 4KIGA 4UVCA 1FLIA 2PX9A 3K0LA 1U78A 3I53A 2VT2A 2IGMA 5F04A 2QKLB 3S93A 4ZZLA 1ZLKA 2DT5A 2XPUA 2M0CA 1A5JA 5C4JJ 4P9FA 4YEJA 1DU6A 3QPHA 2Y2ZA 4L5EA 5DM6F 4IF4A 2D1VA 1CGPA 1FOWA 2XPWA 1K6OA 3PO2J 4KDPA 1Z6TA 1LQ1A 3A0HC 4Y52J 3FBNB 3DPUA 4UV8A 4HV5A 4B09A 2VASA 2LK2A 2A3SA 2OUMA 1T0FA 1HOMA 2G7UA 5LEJA 3OYGA 2XGXA 4NNJA 2Y75A 3WTSC 2CW8A 2AXTC 2FU4A 4IJAA 3G71I 2BBYA 1O3SA 3CC4I 4BEHA 1YYVA 4XLHA 4CCMA 1P92A 2RDPA 2K3PA 2KJBA 4BE2A 1J5YA 1POGA 1IRFA 5EGOA 3D0SA 1B72B 2ZXWH
chains in the Genus database with same CATH topology
2R7FA 1CF7A 3H92A 3LA3A 1YS7A 5F64A 4I09A 3L09A 3QP6A 1ONVA 1AWCA 1SMYF 3K1PA 4BHCA 3QU6A 2CO5A 1B9MA 1FP1D 5IT9Z 5BPDA 1TQPA 1TLHB 4Q5SF 2V1DA 1DDNA 2FNPA 5HLHA 2F2EA 3MFKA 4HZFA 4LB5A 4UVAA 1OYWA 3ZN0A 3BJOA 2L02A 2K4JA 1SD7A 1XMKA 1QNTA 4KMFA 1G3YA 1FY7A 3CUQC 3Q9SA 3GFJA 4WWCA 3BJAA 2PI0A 2A5YB 1OR7A 2HS5A 1V4RA 2M30A 4M9ZA 3R0AA 4NQWA 2R7DA 5HDGA 2IW5A 3K69A 1RUOA 1ZGAA 4K2EA 4O6JA 5LGTA 1KGSA 5LBQA 4MEYF 3REOA 2ZO4A 1R00A 2P5LC 1UHWA 4PDKA 2QUFA 4ENJA 1O7LA 2NNNA 4I0AA 2P8TA 3QAHA 3JAMZ 1HXDA 2MBFA 5KK1A 1G3TA 3E6DA 3LQRA 4ZYDA 1XB4A 5D5XB 5FD5A 5CVJA 1T2KA 2FQ3A 1WKMA 2BE5F 2W24A 4HF1A 3C3WA 2X4HA 1W5TA 2RV8A 1KQ8A 5L3EA 2K27A 4AIKA 1J59A 3P7NA 3BDDA 5LGUA 2V6CA 1S7OA 2O8XA 3E5QA 2ZKZA 3WODF 4WXDA 3GX4X 2ELHA 3QPTA 1X3UA 1IF1A 4ESJA 2ZXJA 4EVIA 4CZZA 1XGMA 2G9WA 2MD5A 4ESFA 3RJPA 2XRNA 4CO8A 3IKTA 2C6YA 4IHTA 1TW2A 1P6RA 5D4RA 4LK0F 3DPTA 1SD4A 5KVRA 3ZMSA 5ICEA 1BIBA 3V8KA 3F8BA 2BYVE 5CLSA 2CGPA 4AIJA 2RN7A 3WTXC 5CVRA 1XSDA 4FX4A 3EYYA 4EM0B 3TOBA 3L7WA 2ZBKA 5D5WB 3E97A 2J5PA 3E6BA 5CVVA 4LLNA 4LG0A 3KFWX 3DPLC 3MWMA 3N97A 1Z7UA 2BGCA 3CUOA 1OYYA 5DCMB 3WE3A 5E20A 1IUYA 2YR2A 5L3DA 5CVUA 3F6OA 2VE9A 5IT9K 4WXCA 3RKYA 2ESNA 4S04A 3HHHA 2L54A 2Z33A 2P5KA 4HX7A 3G3ZA 2O6GE 4MNUA 1XCVA 2EV6A 2M87A 2QZ8A 3O3KA 4PZJA 4R1HA 2DO7A 3B73A 2JRTA 1PP7U 4RGXA 4OINF 1R23A 2LF7A 1B6AA 4Y17A 2OA4A 2OQRA 2GIVA 2VONA 2HFHA 4HOBA 4LMYA 4LLGF 2VBZA 1P4XA 4N0BA 3CUQA 1ZAOA 2PEXA 5JVTA 2B0LA 1FSHA 2YSRA 2PQ8A 1XDUA 5CVIA 3I5UA 4BH9A 3WTTC 3HIFA 2STTA 2VODA 5LRSA 1H9TA 5FFXA 1W7PB 2ZNZA 5E1ZB 4XBFA 4KNYA 3BP8A 4ETSA 4G7ZF 1IN8A 3M8FA 5DUIA 4IRHA 2PMHA 1R1UA 3FWEA 1QZZA 3L2CA 1S6LA 3V7CA 1TW3A 2ISZA 3BWGA 3JTGA 1T38A 3WTZA 6PAXA 3PFIA 5K5OA 2GXGA 4ZYGA 1RZ4A 1QBJA 3F8FA 4HX8A 3F23A 3ECOA 2DQRA 3RIRA 3GVAA 3GF2A 4KT5C 2K7LA 1S3JA 2EFWA 2KJCA 4IPAA 2W25A 4HQEA 1UFMA 4OIQF 2FEZA 1I1SA 4EQQA 3VOEA 2RQPA 2MH2A 1GXPA 4UXNA 3IHUA 4P5OA 3RPQA 1BI3A 3VODA 2RVCA 2F5DA 1W5SA 1SD5A 1P2FA 2HGCA 2XKOA 3KEOA 2NRAC 3SQNA 3SHFA 1S7AA 1HBXG 4L9JA 4HLYA 2QQBA 4A6DA 1IXCA 2F5FA 1DP7P 4IXAA 2V79A 5K5QA 5J8CA 1J9IA 1D5VA 2ZNYA 4EM1A 3H3UA 1L0OC 1QPMA 2A6HF 1F5TA 3I59A 4M72A 3L9FA 2QQ9A 4G9YA 1WSUA 1REPC 3RKXA 1FT9A 4GXOA 2O3FA 2P7CB 1LJ9A 3COAC 3KZYA 4ENNA 1XGOA 2D45A 2VN2A 2CW0F 2IPQX 4KFCA 4KIBA 2RKHA 5K5RA 2ISYA 4HDVA 3Q9VA 1YW9A 2FBKA 3TKYA 3ABUA 1IN5A 3IWFA 1U6GA 4RB3C 2Q0OA 4KUMA 3J81K 1ZREA 2EFNA 2L3DA 3TGNA 3GXOA 2ADUA 3FXUA 2FOKA 4EM2A 3K1NA 3T0YA 1LDKB 1MDMB 2P4WA 1LEAA 1E2XA 4OMYA 2DW4A 1BJAA 4O5VA 2FRHA 3WTYC 2ESHA 5E18F 2DU9A 3PQKA 5HS9A 3WG9A 2RNJA 1TBXA 2VOPA 2JT1A 4ESBA 1JXSA 4CICA 1R1TA 4MTEA 3W6KB 2HQNA 4P96A 1ZGJA 1MD0A 4I7HA 5AIQA 5H6QA 4G6DA 5FD6A 3IRRA 3DEUA 3LA2A 4H0EA 4JQFA 4XLPF 2MC3A 1I27A 3TQNA 2XAQA 4I98B 3V7SA 1D3YA 2MLGA 1T39A 3E6MA 3O2PE 2M5WA 2XIGA 4HAMA 3ZMDA 4G6QA 1D8KA 1Z05A 4L0YB 2LSOA 1YFHA 2XVCA 4IHSA 3KEQA 1IAWA 5FB2A 4RGUA 3C7JA 2NNYA 3RTRA 5E1WA 3M8EA 2JZYA 4M6YA 3LWFA 4KMUX 1PDNC 2R3SA 3NRVA 3MQ0A 4ZYHA 4A0ZA 1LVAA 4OIOF 2HYFA 3KLNA 2A68F 1ZRDA 4RAZA 1U8RA 3L00A 1TNSA 4P9UA 2OU2A 2H94A 5AONA 4QWQA 4HQMA 1T98A 1F1ZA 2W85A 1K78A 5LHHA 1ODDA 2D1HA 1ZG1A 1ZRCA 1ZARA 3KP2A 3CJNA 2F5EA 4WXHA 1XCBA 3HYIA 4ZZDA 2E1NA 5L3BA 2YU3A 1LB2A 1O57A 4DNCA 2AS5F 2ZMEA 2IT0A 4CHUA 3P9CA 4LFUA 5L3FA 4A0XA 3SFZA 3S2WA 1KQ9A 4Z2YA 3I0TA 1Z9CA 4MEXF 2HTSA 3BPXA 3R61A 3EYIA 2QWWA 2QLZA 1ZG3A 4DQ2A 1U5TB 1Z1DA 4LLLA 1IXRC 3TO9A 2GQQA 3HSRA 4F7ZA 1GHCA 2Z3YA 2DTRA 4U7DA 3FXRA 5DD8A 3I59B 2DBBA 1H9GA 2GA1A 4S05A 2RC4A 1SAXA 3FMQA 2PN6A 2DAOA 3V4GA 2PG4A 4FT8A 2EA2A 2NS0A 3SXYA 1ZG5A 4M71A 1F9NA 3DV8A 1UHMA 3EETA 2IA2A 3KCCA 4L9NA 2BEOA 1LEBA 1IN6A 2OBPA 1FSEA 3ABTA 4PCQA 1BBYA 3HRSA 3RKWA 4WK8F 1FBSA 2DPDA 4A6EA 1BM9A 3AAFA 1FC3A 4A2UA 1MKMA 3DQVC 1V3FA 4RB1A 3T8RA 2QM3A 3JTHA 2EWNA 3JW4A 3HSEA 3O6BB 1KYZA 3VEPA 4FX0A 1H0MA 4E70A 3GEZA 2PLYA 2CG4A 2OZ6A 1FYMA 3LAPA 2UXNA 2UWMA 2YX7A 1R1VA 2XUBA 2Y0MA 3QU3A 2EB7A 1LNWA 4HLXA 4HW0A 2NYXA 2HZTA 1KU3A 3JSOA 2X0LA 3M9AA 1KYWA 4MHGA 4UUVA 2IVMA 4KA4A 4ENMA 3HRUA 3DF8A 1DUXC 4M6XA 2WC2A 1R5GA 1PP8F 1T6SA 3BPVA 3ELKA 3EQLF 2GWRA 4CGZA 5DV5A 2XAGA 3RPUA 2GXBA 5L3CA 4YIFA 5CJ9A 4EJWA 2NAZA 1XN7A 3ML6A 1MJ9A 3J81Z 3I4PA 4HF2A 3LQQA 4RB0A 1MJAA 5LHIA 3PQJA 2K02A 2G7HA 3B02A 5FLXK 5IT3A 3FM5A 5DUKA 2CWEA 1FYKA 5ILSA 1CF7B 5E8GA 2Z9OA 1L3LA 4ON0A 1FWZA 1FBUA 1Y0UA 3KP3A 1F4KA 3MZHA 2O03A 4L5IA 1RIOH 2HWVA 3NQOA 2EFQA 5CYVA 4U7BA 1QQIA 3M1EA 4BQAA 4FHTA 3TDZC 5DDGA 1GVJA 2CSOA 4BYYA 1SFEA 4A0YA 2TDXA 2PBIA 1K78B 2MLKA 2J5OA 4ZYEA 4LK1F 2V1UA 1R58A 3MAJA 1I5ZA 2KIUA 1U3EM 2YPRA 2VC0A 2XASA 1FBQA 2ZMEB 1Q1HA 1P4WA 2EFOA 3LA7A 2D2WA 3KP5A 5BQTA 3RYRA 2P7VB 1BC7C 4JK1X 2EV5A 3DFGA 2IP2A 5JR3A 2EFPA 1YQAA 4OMZA 1W4MA 5H6RA 1XD7A 5D5VB 2Q2EA 3RDIA 2QQAA 1TQMA 1U2WA 4L0ZB 1JE8A 5DCFA 4Q48A 1B4AA 3HOSA 1ZYRF 3C18A 3ZPLA 3HUGA 1KA8A 3V8JA 2IA0A 1A04A 3WE2A 1R7JA 2XV4S 2KRFA 1FYLA 1IZ1A 4XSXF 4Q47A 1XSXA 1QGPA 3T1BA 2P5VA 5F1RA 2W57A 5LLQA 4EGZA 1Z91A 2QVOA 4G7OF 2M1BA 5HS7A 3ZMVA 1UCRA 3FHZA 3DKWA 1IRGA 2CQKA 3WU0A 2COMA 1LDJA 1XGSA 3FF5A 4CXFA 2V9VA 3P9IA 1I6XA 2HYGD 3GZ5A 3SZPA 1MJBA 1G6NA 3WTVC 4G7HF 4OIPF 4P55A 5ED4A 3U1DA 2HKOA 3D5LA 3IC7A 4YFNF 1EH7A 3E5UA 4YFKF 2FSWA 3BOQA 3ROUA 1SFXA 2FE3A 1OYIA 3HTSB 4NB5A 2UZKA 2P6TA 5A2QK 1BOAA 2Z5UA 1XSVA 2DPUA 3GUDA 4OIRF 2K86A 4O3MA 2VE8A 3N4MA 2OAZA 4LG0B 1TNTA 1J2XA 2Y48A 1O3TA 5BPIA 4M9XA 1SFUA 3GFMA 4MQVA 3R6SA 4I0BA 1G4DA 4WCGA 3F3XA 1W7PD 1YLFA 3WGIA 1C0WA 5K1YA 4PGHA 1BI2A 2L4AA 5FGMA 3GZ6A 2KKOA 3T5XA 5EEHA 2ZCWA 2XROA 3R0JA 2IJLA 1ZN2A 1FPQA 5HDNA 1FNNA 3E3VA 2HTJA 3HTUA 3ZMUA 3F21A 2DQLA 3U9GA 4BHPA 2KIFA 4L18B 3K1MA 1RNLA 2XKPA 4BXUA 2M45A 3CUQB 4ZH4F 3RI4A 3ISPA 2LF8A 2CFXA 1ULYA 5ICGA 4XLNF 2OD5A 2XAJA 3CO7C 5TRDA 1O3RA 4Y13A 5F6FA 2EA4A 3VFZA 3SZTA 4HV6A 1IXSB 5D4SA 2L01A 5TJJA 1USTA 1QO0D 1BI1A 4AVPA 4GYGA 1OPCA 5ICCA 4LJZF 2DI3A 4EJVA 4L9VA 1HW5A 1HSJA 1STZA 4MQ9F 3HOTA 4N9HA 2W84A 2JSCA 2FXAA 5ICFA 5H20A 2A07F 3FZVA 4M74A 5E1XA 3F72A 1HSTA 2FMYA 2VXZA 3T8TA 2HQRA 3WTWC 2GZWA 5J8FA 5J6XA 2A61A 5FLXZ 1W7PA 3WU1B 2WTEA 2PJPA 1B59A 1HW2A 2E7XA 5HLIA 2VBYA 2IRFG 4HYEA 3IRQA 1FOKA 1MZBA 3NEUA 5E8IA 3J80K 2XAFA 4EV0A 1ZLJA 4KN7X 2BV6A 5AIPA 2H6CA 5ILUA 2FMLA 4A5MA 2UXXA 3CO6C 1K7AA 3CLOA 3IWZA 3QP5A 3KP7A 2LKPA 1KU7A 1XDSA 3P9KA 4RGRA 4YG2F 2CYYA 1UB9A 2HEOA 1FP2A 3BJ6A 2FF4A 4BAYA 1LDDA 1O3QA 4HF0A 1ON1A 1EH8A 3H3ZA 1J75A 1DPUA 5DD4A 4U88A 1Z6RA 4I02A 1E17A 3HSFA 5HS8A 2QENA 5D6EA 3FMSA 4HA8A 3ECHA 5FO5A 1KU9A 3QOPA 4IRIA 4B8XA 1D8JA 1KQ0A 4N9IA 2L4MA 5HOOA 2H09A 3GFLA 5D8LB 2DK8A 2VT3A 2ZFWA 3ZMTA 1B9NA 2AXLA 2K4BA 2EK5A 4D0PA 3I58A 2XHKA 3F8CA 3GW2A 2FA5A 5HVQC 3EUHA 2OZUA 4A12A 1ON2A 1HKQA 3TO7A 4UV9A 2MH9A 2DK5A 3OOPA 3BROA 5D5UB 3FX3A 3KZZA 2HKXA 1U5TC 1VTNC 3CDHA 4RS8A 3FXQA 4GO1A 5E17F 4EMSA 1MGTA 4ENKA 2ETHA 2HR3A 2O0YA 4XSZF 2RGVA 3G73A 3ULQB 3I71A 4BNCA 5JI6A 3TO6A 1BIAA 2PMUA 1XMAA 1J0RA 4YFXF 2PFBA 1SD6A 4BHBA 4L9TA 2H6BA 2ZJ2A 2LNBA 3GLXA 3R4KA 4Y15A 2E7WA 2Q8KA 5HLGA 3KP4A 1HW1A 1MDMA 5BOXA 3V8LA 2E1CA 4HBLA 1KU2A 2O61A 3HHGA 3Q5FA 3DP7A 1HKSA 5LRRA 1ZHFA 3RYPA 1JHHA 4KYWA 5ILVA 2QBYA 1K79A 1EV7A 2DFIA 2A6EF 4EJUA 5EEGA 5A2QZ 2WWYA 2VC1A 4LB6B 1G3WA 4EJTA 2EV0A 4XRFA 2V1XA 4RGSA 2OQGA 3F22A 4OU0A 3LFKA 1OMIA 1AOYA 1YW7A 4TV7A 1OKRA 2GAUA 2KIMA 3M7GA 1G3SA 5DEQA 3TOAA 1R22A 4RAYA 4G8XA 3WTUC 1YTYA 4NHJA 4MTDA 2LDUA 3LSTA 1R36A 1GXQA 1BC8C 1WI9A 4LD5A 1FX7A 4Q4ZF 2IA1A 4YIIA 3VB2A 4AIHA 4CYDA 1DPRA 1I1GA 1USSA 3JAMK 5FFZA 3HRTA 4U0WA 1IN4A 3MZYA 1RI7A 3WGHA 3IL2A 1QZYA 2DLLA 2WV0A 1SMTA 3F8NA 1XGNA 1IN7A 3CTAA 4HDUA 3QRFF 1RUNA 2JPCA 3FM3A 3F8MA 5L3GA 1ZRFA 1BI0A 3KP6A 2H27A 1FZPB 2FNAA 1YIOA 3GO5A 3LAJA 4U0VA 2FBHA 3MEXA 4UHTA 3KLOA 4M9SA 2XAHA 4R8HA 4I2OA 4CDGA 3HRMA 4KN4X 3W6JB 4A5NA 4WX9A 2JTVA 2M8EA 2HDCA 3R60A 3F6VA 3EDPA 3KETA 2QYOA 5D8KB 4I01A 2A69F 1NHAA 3KE2A 4UVBA 3ZP5A 3E5XA 1PUEE 1U5TA 4OOIA 1S29A 2F5CA 5JFRA 4PGGA 5LGNA 3BZ6A 5HDKA 1S8NA 1B1BA 5D6FA 3GFIA 4ASNA 1R5HA 2YX4A 3C1DA 3IKVA 1ZH5A 4IVNA 2VBXA 5BMZA 4EJOA 4QLCU 3ZMZA 3J80Z 4JBAA 2VOOA 3MCZA 2VBWA 4GCVA 3GWZA 2JPBA 4LGWA 4HX4A 4R79A 2MA3A 4AWXB 3ZQ7A 2STWA 3BY6A 3JSPA 1WWXA 3K9TA 3K2ZA 1J7KA 4UNOA 1JGSA 4L5JA 2ACJA 3V7RA 2FBIA 1YW8A 3DXJF 5LHGA 3GYHX 3I64A 1TTYA 3E6CC 3I54A 1IW7F 2EJRA 3OV8A 2GA2A 3U2RA 1JHFA 5BS6A 1WQ2A 1HQCA 4KICA 4RB2C 2Z99A 5JHUA 4EGYA 1BN5A 1YS6A 4M73A 1EH6A 4MGRA 5LEKA 4G94A 1HKTA 1WRJA 1YG2A 4KIFA 5ERIA 4GGGA 3WGGA 5DYMA 2QBYB 4WF2A 3ERED 4AD9A 1P4AA 2HOEA 3TDUC 1O7FA 2P6SA 4U0YA 1YO5C 1TQIA 3J7AO 3FMRA 5DCMA 3ZN1A 4IRGA 4GYIA 4KIGA 4UVCA 1FLIA 3K0LA 1U78A 3I53A 2VT2A 1ZLKA 4ZZLA 2DT5A 4P9FA 3QPHA 4IF4A 2D1VA 1CGPA 1K6OA 4KDPA 1Z6TA 1LQ1A 4UV8A 4HV5A 4B09A 2A3SA 1T0FA 2G7UA 5LEJA 2XGXA 2Y75A 3WTSC 2FU4A 4IJAA 1O3SA 2BBYA 1YYVA 1P92A 2RDPA 2KJBA 1J5YA 1IRFA 3D0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  1CF7 A;  3H92 A;  3LA3 A;  1YS7 A;  5F64 A;  4I09 A;  3L09 A;  3QP6 A;  1ONV A;  1AWC A;  1SMY F;  3K1P A;  4BHC A;  3QU6 A;  2CO5 A;  1B9M A;  1FP1 D;  5IT9 Z;  5BPD A;  1TQP A;  1TLH B;  4Q5S F;  2V1D A;  1DDN A;  2FNP A;  5HLH A;  2F2E A;  3MFK A;  4HZF A;  4LB5 A;  4UVA A;  1OYW A;  3ZN0 A;  3BJO A;  2L02 A;  2K4J A;  1SD7 A;  1XMK A;  1QNT A;  4KMF A;  1G3Y A;  1FY7 A;  3CUQ C;  3Q9S A;  3GFJ A;  4WWC A;  3BJA A;  2PI0 A;  2A5Y B;  1OR7 A;  2HS5 A;  1V4R A;  2M30 A;  4M9Z A;  3R0A A;  4NQW A;  2R7D A;  5HDG A;  2IW5 A;  3K69 A;  1RUO A;  1ZGA A;  4K2E A;  4O6J A;  5LGT A;  1KGS A;  5LBQ A;  4MEY F;  3REO A;  2ZO4 A;  1R00 A;  2P5L C;  1UHW A;  4PDK A;  2QUF A;  4ENJ A;  1O7L A;  2NNN A;  4I0A A;  2P8T A;  3QAH A;  3JAM Z;  1HXD A;  2MBF A;  5KK1 A;  1G3T A;  3E6D A;  3LQR A;  4ZYD A;  1XB4 A;  5D5X B;  5FD5 A;  5CVJ A;  1T2K A;  2FQ3 A;  1WKM A;  2BE5 F;  2W24 A;  4HF1 A;  3C3W A;  2X4H A;  1W5T A;  2RV8 A;  1KQ8 A;  5L3E A;  2K27 A;  4AIK A;  1J59 A;  3P7N A;  3BDD A;  5LGU A;  2V6C A;  1S7O A;  2O8X A;  3E5Q A;  2ZKZ A;  3WOD F;  4WXD A;  3GX4 X;  2ELH A;  3QPT A;  1X3U A;  1IF1 A;  4ESJ A;  2ZXJ A;  4EVI A;  4CZZ A;  1XGM A;  2G9W A;  2MD5 A;  4ESF A;  3RJP A;  2XRN A;  4CO8 A;  3IKT A;  2C6Y A;  4IHT A;  1TW2 A;  1P6R A;  5D4R A;  4LK0 F;  3DPT A;  1SD4 A;  5KVR A;  3ZMS A;  5ICE A;  1BIB A;  3V8K A;  3F8B A;  2BYV E;  5CLS A;  2CGP A;  4AIJ A;  2RN7 A;  3WTX C;  5CVR A;  1XSD A;  4FX4 A;  3EYY A;  4EM0 B;  3TOB A;  3L7W A;  2ZBK A;  5D5W B;  3E97 A;  2J5P A;  3E6B A;  5CVV A;  4LLN A;  4LG0 A;  3KFW X;  3DPL C;  3MWM A;  3N97 A;  1Z7U A;  2BGC A;  3CUO A;  1OYY A;  5DCM B;  3WE3 A;  5E20 A;  1IUY A;  2YR2 A;  5L3D A;  5CVU A;  3F6O A;  2VE9 A;  5IT9 K;  4WXC A;  3RKY A;  2ESN A;  4S04 A;  3HHH A;  2L54 A;  2Z33 A;  2P5K A;  4HX7 A;  3G3Z A;  2O6G E;  4MNU A;  1XCV A;  2EV6 A;  2M87 A;  2QZ8 A;  3O3K A;  4PZJ A;  4R1H A;  2DO7 A;  3B73 A;  2JRT A;  1PP7 U;  4RGX A;  4OIN F;  1R23 A;  2LF7 A;  1B6A A;  4Y17 A;  2OA4 A;  2OQR A;  2GIV A;  2VON A;  2HFH A;  4HOB A;  4LMY A;  4LLG F;  2VBZ A;  1P4X A;  4N0B A;  3CUQ A;  1ZAO A;  2PEX A;  5JVT A;  2B0L A;  1FSH A;  2YSR A;  2PQ8 A;  1XDU A;  5CVI A;  3I5U A;  4BH9 A;  3WTT C;  3HIF A;  2STT A;  2VOD A;  5LRS A;  1H9T A;  5FFX A;  1W7P B;  2ZNZ A;  5E1Z B;  4XBF A;  4KNY A;  3BP8 A;  4ETS A;  4G7Z F;  1IN8 A;  3M8F A;  5DUI A;  4IRH A;  2PMH A;  1R1U A;  3FWE A;  1QZZ A;  3L2C A;  1S6L A;  3V7C A;  1TW3 A;  2ISZ A;  3BWG A;  3JTG A;  1T38 A;  3WTZ A;  6PAX A;  3PFI A;  5K5O A;  2GXG A;  4ZYG A;  1RZ4 A;  1QBJ A;  3F8F A;  4HX8 A;  3F23 A;  3ECO A;  2DQR A;  3RIR A;  3GVA A;  3GF2 A;  4KT5 C;  2K7L A;  1S3J A;  2EFW A;  2KJC A;  4IPA A;  2W25 A;  4HQE A;  1UFM A;  4OIQ F;  2FEZ A;  1I1S A;  4EQQ A;  3VOE A;  2RQP A;  2MH2 A;  1GXP A;  4UXN A;  3IHU A;  4P5O A;  3RPQ A;  1BI3 A;  3VOD A;  2RVC A;  2F5D A;  1W5S A;  1SD5 A;  1P2F A;  2HGC A;  2XKO A;  3KEO A;  2NRA C;  3SQN A;  3SHF A;  1S7A A;  1HBX G;  4L9J A;  4HLY A;  2QQB A;  4A6D A;  1IXC A;  2F5F A;  1DP7 P;  4IXA A;  2V79 A;  5K5Q A;  5J8C A;  1J9I A;  1D5V A;  2ZNY A;  4EM1 A;  3H3U A;  1L0O C;  1QPM A;  2A6H F;  1F5T A;  3I59 A;  4M72 A;  3L9F A;  2QQ9 A;  4G9Y A;  1WSU A;  1REP C;  3RKX A;  1FT9 A;  4GXO A;  2O3F A;  2P7C B;  1LJ9 A;  3COA C;  3KZY A;  4ENN A;  1XGO A;  2D45 A;  2VN2 A;  2CW0 F;  2IPQ X;  4KFC A;  4KIB A;  2RKH A;  5K5R A;  2ISY A;  4HDV A;  3Q9V A;  1YW9 A;  2FBK A;  3TKY A;  3ABU A;  1IN5 A;  3IWF A;  1U6G A;  4RB3 C;  2Q0O A;  4KUM A;  3J81 K;  1ZRE A;  2EFN A;  2L3D A;  3TGN A;  3GXO A;  2ADU A;  3FXU A;  2FOK A;  4EM2 A;  3K1N A;  3T0Y A;  1LDK B;  1MDM B;  2P4W A;  1LEA A;  1E2X A;  4OMY A;  2DW4 A;  1BJA A;  4O5V A;  2FRH A;  3WTY C;  2ESH A;  5E18 F;  2DU9 A;  3PQK A;  5HS9 A;  3WG9 A;  2RNJ A;  1TBX A;  2VOP A;  2JT1 A;  4ESB A;  1JXS A;  4CIC A;  1R1T A;  4MTE A;  3W6K B;  2HQN A;  4P96 A;  1ZGJ A;  1MD0 A;  4I7H A;  5AIQ A;  5H6Q A;  4G6D A;  5FD6 A;  3IRR A;  3DEU A;  3LA2 A;  4H0E A;  4JQF A;  4XLP F;  2MC3 A;  1I27 A;  3TQN A;  2XAQ A;  4I98 B;  3V7S A;  1D3Y A;  2MLG A;  1T39 A;  3E6M A;  3O2P E;  2M5W A;  2XIG A;  4HAM A;  3ZMD A;  4G6Q A;  1D8K A;  1Z05 A;  4L0Y B;  2LSO A;  1YFH A;  2XVC A;  4IHS A;  3KEQ A;  1IAW A;  5FB2 A;  4RGU A;  3C7J A;  2NNY A;  3RTR A;  5E1W A;  3M8E A;  2JZY A;  4M6Y A;  3LWF A;  4KMU X;  1PDN C;  2R3S A;  3NRV A;  3MQ0 A;  4ZYH A;  4A0Z A;  1LVA A;  4OIO F;  2HYF A;  3KLN A;  2A68 F;  1ZRD A;  4RAZ A;  1U8R A;  3L00 A;  1TNS A;  4P9U A;  2OU2 A;  2H94 A;  5AON A;  4QWQ A;  4HQM A;  1T98 A;  1F1Z A;  2W85 A;  1K78 A;  5LHH A;  1ODD A;  2D1H A;  1ZG1 A;  1ZRC A;  1ZAR A;  3KP2 A;  3CJN A;  2F5E A;  4WXH A;  1XCB A;  3HYI A;  4ZZD A;  2E1N A;  5L3B A;  2YU3 A;  1LB2 A;  1O57 A;  4DNC A;  2AS5 F;  2ZME A;  2IT0 A;  4CHU A;  3P9C A;  4LFU A;  5L3F A;  4A0X A;  3SFZ A;  3S2W A;  1KQ9 A;  4Z2Y A;  3I0T A;  1Z9C A;  4MEX F;  2HTS A;  3BPX A;  3R61 A;  3EYI A;  2QWW A;  2QLZ A;  1ZG3 A;  4DQ2 A;  1U5T B;  1Z1D A;  4LLL A;  1IXR C;  3TO9 A;  2GQQ A;  3HSR A;  4F7Z A;  1GHC A;  2Z3Y A;  2DTR A;  4U7D A;  3FXR A;  5DD8 A;  3I59 B;  2DBB A;  1H9G A;  2GA1 A;  4S05 A;  2RC4 A;  1SAX A;  3FMQ A;  2PN6 A;  2DAO A;  3V4G A;  2PG4 A;  4FT8 A;  2EA2 A;  2NS0 A;  3SXY A;  1ZG5 A;  4M71 A;  1F9N A;  3DV8 A;  1UHM A;  3EET A;  2IA2 A;  3KCC A;  4L9N A;  2BEO A;  1LEB A;  1IN6 A;  2OBP A;  1FSE A;  3ABT A;  4PCQ A;  1BBY A;  3HRS A;  3RKW A;  4WK8 F;  1FBS A;  2DPD A;  4A6E A;  1BM9 A;  3AAF A;  1FC3 A;  4A2U A;  1MKM A;  3DQV C;  1V3F A;  4RB1 A;  3T8R A;  2QM3 A;  3JTH A;  2EWN A;  3JW4 A;  3HSE A;  3O6B B;  1KYZ A;  3VEP A;  4FX0 A;  1H0M A;  4E70 A;  3GEZ A;  2PLY A;  2CG4 A;  2OZ6 A;  1FYM A;  3LAP A;  2UXN A;  2UWM A;  2YX7 A;  1R1V A;  2XUB A;  2Y0M A;  3QU3 A;  2EB7 A;  1LNW A;  4HLX A;  4HW0 A;  2NYX A;  2HZT A;  1KU3 A;  3JSO A;  2X0L A;  3M9A A;  1KYW A;  4MHG A;  4UUV A;  2IVM A;  4KA4 A;  4ENM A;  3HRU A;  3DF8 A;  1DUX C;  4M6X A;  2WC2 A;  1R5G A;  1PP8 F;  1T6S A;  3BPV A;  3ELK A;  3EQL F;  2GWR A;  4CGZ A;  5DV5 A;  2XAG A;  3RPU A;  2GXB A;  5L3C A;  4YIF A;  5CJ9 A;  4EJW A;  2NAZ A;  1XN7 A;  3ML6 A;  1MJ9 A;  3J81 Z;  3I4P A;  4HF2 A;  3LQQ A;  4RB0 A;  1MJA A;  5LHI A;  3PQJ A;  2K02 A;  2G7H A;  3B02 A;  5FLX K;  5IT3 A;  3FM5 A;  5DUK A;  2CWE A;  1FYK A;  5ILS A;  1CF7 B;  5E8G A;  2Z9O A;  1L3L A;  4ON0 A;  1FWZ A;  1FBU A;  1Y0U A;  3KP3 A;  1F4K A;  3MZH A;  2O03 A;  4L5I A;  1RIO H;  2HWV A;  3NQO A;  2EFQ A;  5CYV A;  4U7B A;  1QQI A;  3M1E A;  4BQA A;  4FHT A;  3TDZ C;  5DDG A;  1GVJ A;  2CSO A;  4BYY A;  1SFE A;  4A0Y A;  2TDX A;  2PBI A;  1K78 B;  2MLK A;  2J5O A;  4ZYE A;  4LK1 F;  2V1U A;  1R58 A;  3MAJ A;  1I5Z A;  2KIU A;  1U3E M;  2YPR A;  2VC0 A;  2XAS A;  1FBQ A;  2ZME B;  1Q1H A;  1P4W A;  2EFO A;  3LA7 A;  2D2W A;  3KP5 A;  5BQT A;  3RYR A;  2P7V B;  1BC7 C;  4JK1 X;  2EV5 A;  3DFG A;  2IP2 A;  5JR3 A;  2EFP A;  1YQA A;  4OMZ A;  1W4M A;  5H6R A;  1XD7 A;  5D5V B;  2Q2E A;  3RDI A;  2QQA A;  1TQM A;  1U2W A;  4L0Z B;  1JE8 A;  5DCF A;  4Q48 A;  1B4A A;  3HOS A;  1ZYR F;  3C18 A;  3ZPL A;  3HUG A;  1KA8 A;  3V8J A;  2IA0 A;  1A04 A;  3WE2 A;  1R7J A;  2XV4 S;  2KRF A;  1FYL A;  1IZ1 A;  4XSX F;  4Q47 A;  1XSX A;  1QGP A;  3T1B A;  2P5V A;  5F1R A;  2W57 A;  5LLQ A;  4EGZ A;  1Z91 A;  2QVO A;  4G7O F;  2M1B A;  5HS7 A;  3ZMV A;  1UCR A;  3FHZ A;  3DKW A;  1IRG A;  2CQK A;  3WU0 A;  2COM A;  1LDJ A;  1XGS A;  3FF5 A;  4CXF A;  2V9V A;  3P9I A;  1I6X A;  2HYG D;  3GZ5 A;  3SZP A;  1MJB A;  1G6N A;  3WTV C;  4G7H F;  4OIP F;  4P55 A;  5ED4 A;  3U1D A;  2HKO A;  3D5L A;  3IC7 A;  4YFN F;  1EH7 A;  3E5U A;  4YFK F;  2FSW A;  3BOQ A;  3ROU A;  1SFX A;  2FE3 A;  1OYI A;  3HTS B;  4NB5 A;  2UZK A;  2P6T A;  5A2Q K;  1BOA A;  2Z5U A;  1XSV A;  2DPU A;  3GUD A;  4OIR F;  2K86 A;  4O3M A;  2VE8 A;  3N4M A;  2OAZ A;  4LG0 B;  1TNT A;  1J2X A;  2Y48 A;  1O3T A;  5BPI A;  4M9X A;  1SFU A;  3GFM A;  4MQV A;  3R6S A;  4I0B A;  1G4D A;  4WCG A;  3F3X A;  1W7P D;  1YLF A;  3WGI A;  1C0W A;  5K1Y A;  4PGH A;  1BI2 A;  2L4A A;  5FGM A;  3GZ6 A;  2KKO A;  3T5X A;  5EEH A;  2ZCW A;  2XRO A;  3R0J A;  2IJL A;  1ZN2 A;  1FPQ A;  5HDN A;  1FNN A;  3E3V A;  2HTJ A;  3HTU A;  3ZMU A;  3F21 A;  2DQL A;  3U9G A;  4BHP A;  2KIF A;  4L18 B;  3K1M A;  1RNL A;  2XKP A;  4BXU A;  2M45 A;  3CUQ B;  4ZH4 F;  3RI4 A;  3ISP A;  2LF8 A;  2CFX A;  1ULY A;  5ICG A;  4XLN F;  2OD5 A;  2XAJ A;  3CO7 C;  5TRD A;  1O3R A;  4Y13 A;  5F6F A;  2EA4 A;  3VFZ A;  3SZT A;  4HV6 A;  1IXS B;  5D4S A;  2L01 A;  5TJJ A;  1UST A;  1QO0 D;  1BI1 A;  4AVP A;  4GYG A;  1OPC A;  5ICC A;  4LJZ F;  2DI3 A;  4EJV A;  4L9V A;  1HW5 A;  1HSJ A;  1STZ A;  4MQ9 F;  3HOT A;  4N9H A;  2W84 A;  2JSC A;  2FXA A;  5ICF A;  5H20 A;  2A07 F;  3FZV A;  4M74 A;  5E1X A;  3F72 A;  1HST A;  2FMY A;  2VXZ A;  3T8T A;  2HQR A;  3WTW C;  2GZW A;  5J8F A;  5J6X A;  2A61 A;  5FLX Z;  1W7P A;  3WU1 B;  2WTE A;  2PJP A;  1B59 A;  1HW2 A;  2E7X A;  5HLI A;  2VBY A;  2IRF G;  4HYE A;  3IRQ A;  1FOK A;  1MZB A;  3NEU A;  5E8I A;  3J80 K;  2XAF A;  4EV0 A;  1ZLJ A;  4KN7 X;  2BV6 A;  5AIP A;  2H6C A;  5ILU A;  2FML A;  4A5M A;  2UXX A;  3CO6 C;  1K7A A;  3CLO A;  3IWZ A;  3QP5 A;  3KP7 A;  2LKP A;  1KU7 A;  1XDS A;  3P9K A;  4RGR A;  4YG2 F;  2CYY A;  1UB9 A;  2HEO A;  1FP2 A;  3BJ6 A;  2FF4 A;  4BAY A;  1LDD A;  1O3Q A;  4HF0 A;  1ON1 A;  1EH8 A;  3H3Z A;  1J75 A;  1DPU A;  5DD4 A;  4U88 A;  1Z6R A;  4I02 A;  1E17 A;  3HSF A;  5HS8 A;  2QEN A;  5D6E A;  3FMS A;  4HA8 A;  3ECH A;  5FO5 A;  1KU9 A;  3QOP A;  4IRI A;  4B8X A;  1D8J A;  1KQ0 A;  4N9I A;  2L4M A;  5HOO A;  2H09 A;  3GFL A;  5D8L B;  2DK8 A;  2VT3 A;  2ZFW A;  3ZMT A;  1B9N A;  2AXL A;  2K4B A;  2EK5 A;  4D0P A;  3I58 A;  2XHK A;  3F8C A;  3GW2 A;  2FA5 A;  5HVQ C;  3EUH A;  2OZU A;  4A12 A;  1ON2 A;  1HKQ A;  3TO7 A;  4UV9 A;  2MH9 A;  2DK5 A;  3OOP A;  3BRO A;  5D5U B;  3FX3 A;  3KZZ A;  2HKX A;  1U5T C;  1VTN C;  3CDH A;  4RS8 A;  3FXQ A;  4GO1 A;  5E17 F;  4EMS A;  1MGT A;  4ENK A;  2ETH A;  2HR3 A;  2O0Y A;  4XSZ F;  2RGV A;  3G73 A;  3ULQ B;  3I71 A;  4BNC A;  5JI6 A;  3TO6 A;  1BIA A;  2PMU A;  1XMA A;  1J0R A;  4YFX F;  2PFB A;  1SD6 A;  4BHB A;  4L9T A;  2H6B A;  2ZJ2 A;  2LNB A;  3GLX A;  3R4K A;  4Y15 A;  2E7W A;  2Q8K A;  5HLG A;  3KP4 A;  1HW1 A;  1MDM A;  5BOX A;  3V8L A;  2E1C A;  4HBL A;  1KU2 A;  2O61 A;  3HHG A;  3Q5F A;  3DP7 A;  1HKS A;  5LRR A;  1ZHF A;  3RYP A;  1JHH A;  4KYW A;  5ILV A;  2QBY A;  1K79 A;  1EV7 A;  2DFI A;  2A6E F;  4EJU A;  5EEG A;  5A2Q Z;  2WWY A;  2VC1 A;  4LB6 B;  1G3W A;  4EJT A;  2EV0 A;  4XRF A;  2V1X A;  4RGS A;  2OQG A;  3F22 A;  4OU0 A;  3LFK A;  1OMI A;  1AOY A;  1YW7 A;  4TV7 A;  1OKR A;  2GAU A;  2KIM A;  3M7G A;  1G3S A;  5DEQ A;  3TOA A;  1R22 A;  4RAY A;  4G8X A;  3WTU C;  1YTY A;  4NHJ A;  4MTD A;  2LDU A;  3LST A;  1R36 A;  1GXQ A;  1BC8 C;  1WI9 A;  4LD5 A;  1FX7 A;  4Q4Z F;  2IA1 A;  4YII A;  3VB2 A;  4AIH A;  4CYD A;  1DPR A;  1I1G A;  1USS A;  3JAM K;  5FFZ A;  3HRT A;  4U0W A;  1IN4 A;  3MZY A;  1RI7 A;  3WGH A;  3IL2 A;  1QZY A;  2DLL A;  2WV0 A;  1SMT A;  3F8N A;  1XGN A;  1IN7 A;  3CTA A;  4HDU A;  3QRF F;  1RUN A;  2JPC A;  3FM3 A;  3F8M A;  5L3G A;  1ZRF A;  1BI0 A;  3KP6 A;  2H27 A;  1FZP B;  2FNA A;  1YIO A;  3GO5 A;  3LAJ A;  4U0V A;  2FBH A;  3MEX A;  4UHT A;  3KLO A;  4M9S A;  2XAH A;  4R8H A;  4I2O A;  4CDG A;  3HRM A;  4KN4 X;  3W6J B;  4A5N A;  4WX9 A;  2JTV A;  2M8E A;  2HDC A;  3R60 A;  3F6V A;  3EDP A;  3KET A;  2QYO A;  5D8K B;  4I01 A;  2A69 F;  1NHA A;  3KE2 A;  4UVB A;  3ZP5 A;  3E5X A;  1PUE E;  1U5T A;  4OOI A;  1S29 A;  2F5C A;  5JFR A;  4PGG A;  5LGN A;  3BZ6 A;  5HDK A;  1S8N A;  1B1B A;  5D6F A;  3GFI A;  4ASN A;  1R5H A;  2YX4 A;  3C1D A;  3IKV A;  1ZH5 A;  4IVN A;  2VBX A;  5BMZ A;  4EJO A;  4QLC U;  3ZMZ A;  3J80 Z;  4JBA A;  2VOO A;  3MCZ A;  2VBW A;  4GCV A;  3GWZ A;  2JPB A;  4LGW A;  4HX4 A;  4R79 A;  2MA3 A;  4AWX B;  3ZQ7 A;  2STW A;  3BY6 A;  3JSP A;  1WWX A;  3K9T A;  3K2Z A;  1J7K A;  4UNO A;  1JGS A;  4L5J A;  2ACJ A;  3V7R A;  2FBI A;  1YW8 A;  3DXJ F;  5LHG A;  3GYH X;  3I64 A;  1TTY A;  3E6C C;  3I54 A;  1IW7 F;  2EJR A;  3OV8 A;  2GA2 A;  3U2R A;  1JHF A;  5BS6 A;  1WQ2 A;  1HQC A;  4KIC A;  4RB2 C;  2Z99 A;  5JHU A;  4EGY A;  1BN5 A;  1YS6 A;  4M73 A;  1EH6 A;  4MGR A;  5LEK A;  4G94 A;  1HKT A;  1WRJ A;  1YG2 A;  4KIF A;  5ERI A;  4GGG A;  3WGG A;  5DYM A;  2QBY B;  4WF2 A;  3ERE D;  4AD9 A;  1P4A A;  2HOE A;  3TDU C;  1O7F A;  2P6S A;  4U0Y A;  1YO5 C;  1TQI A;  3J7A O;  3FMR A;  5DCM A;  3ZN1 A;  4IRG A;  4GYI A;  4KIG A;  4UVC A;  1FLI A;  3K0L A;  1U78 A;  3I53 A;  2VT2 A;  1ZLK A;  4ZZL A;  2DT5 A;  4P9F A;  3QPH A;  4IF4 A;  2D1V A;  1CGP A;  1K6O A;  4KDP A;  1Z6T A;  1LQ1 A;  4UV8 A;  4HV5 A;  4B09 A;  2A3S A;  1T0F A;  2G7U A;  5LEJ A;  2XGX A;  2Y75 A;  3WTS C;  2FU4 A;  4IJA A;  1O3S A;  2BBY A;  1YYV A;  1P92 A;  2RDP A;  2KJB A;  1J5Y A;  1IRF A;  3D0S A; 
#chains in the Genus database with same CATH topology
 2R7F A;  2DMQ A;  1WGX A;  2ZSH B;  4PSW A;  1IO2 A;  1CF7 A;  2LY1 A;  3H92 A;  3K4N A;  1YS7 A;  3LA3 A;  2W7N A;  5F64 A;  3FXO A;  2L2O A;  2XAU A;  4I09 A;  1Z7L A;  3L09 A;  2BW3 B;  3D5R C;  3QP6 A;  1ONV A;  1AWC A;  1W36 D;  1SMY F;  2ZJQ F;  4UB6 C;  2KL4 A;  3K1P A;  2CQN A;  3VSL A;  4BHC A;  3GCM A;  1BJZ A;  5DM7 F;  3QU6 A;  1I39 A;  1QRY A;  2IGK A;  1AHD P;  2CO5 A;  1B9M A;  5M5X J;  1FP1 D;  1K4T A;  3BTL A;  5BPD A;  5IT9 Z;  3LNQ A;  1TQP A;  1RKT A;  1TLH B;  4W1U A;  3PIP F;  4Q5S F;  2DTZ A;  2V1D A;  1DDN A;  3HOX J;  2NVX J;  2FNP A;  5HLH A;  2F2E A;  3HKZ N;  5GAD J;  3MFK A;  3JRG A;  4HZF A;  4LB5 A;  4B47 A;  1Z67 A;  4EEF G;  3JRF A;  4D1Q A;  4UVA A;  2XGD A;  1OYW A;  1K6Y A;  1LFP A;  3ZN0 A;  2M7B A;  4PUS A;  2CW7 A;  3BJO A;  2L02 A;  3O8G A;  2Q2E B;  3MKW B;  2K4J A;  2IXS A;  1SD7 A;  1XMK A;  1QNT A;  4KMF A;  1G3Y A;  3CF5 F;  1FY7 A;  3CUQ C;  3Q9S A;  1EKE A;  3GFJ A;  4WWC A;  3H5N A;  2K5C A;  3BJA A;  4BJT A;  2PI0 A;  2A5Y B;  3ONQ A;  1OR7 A;  1E3O C;  2HS5 A;  1V4R A;  2M30 A;  4M9Z A;  3R0A A;  3HUG B;  4NQW A;  3QYE A;  2LMD A;  2R7V A;  2R7D A;  3KYD B;  5HDG A;  2IW5 A;  3K69 A;  2HI3 A;  2MGQ A;  3S3M A;  1ZGA A;  4K2E A;  4O6J A;  3MMY B;  1RUO A;  5LGT A;  3KIO A;  3NAU A;  3ASN H;  2CQ7 A;  1KGS A;  2X6X A;  4FAS D;  5LBQ A;  3LSI A;  4MEY F;  1YJN I;  3H5R A;  1TP4 A;  3REO A;  3ZXS A;  2ZO4 A;  1R00 A;  5B1A H;  2P5L C;  2IS2 A;  1UHW A;  4PDK A;  2QUF A;  3RCO A;  3CCE I;  4ENJ A;  1O7L A;  2NNN A;  4I0A A;  2P8T A;  3QAH A;  1IUF A;  3JAM Z;  4FQG A;  1HXD A;  2X85 A;  4A3K J;  1W0U A;  2E2H J;  2MBF A;  5KK1 A;  1G3T A;  2NS8 A;  1SC7 A;  3E6D A;  3LQR A;  2ME0 A;  2WY7 Q;  2KRH A;  1RR7 A;  4E7Z A;  4ZYD A;  2OCE A;  4HRI A;  1D0Y A;  2VQH A;  1XB4 A;  5D5X B;  2O9L A;  2X6Y A;  3W2A A;  5FD5 A;  5CVJ A;  1GT0 C;  1OCO H;  3M4O J;  2NVY J;  1T2K A;  3OMY A;  1N75 A;  2FQ3 A;  4X1E A;  2IGN A;  1WKM A;  2BE5 F;  2W24 A;  4HF1 A;  3CCY A;  1WHU A;  3C3W A;  3W2W A;  2X4H A;  2X48 A;  1W5T A;  3MVP A;  2RV8 A;  3OWT A;  5H2F C;  3OYF A;  3QPS A;  4M6V A;  1X3Z B;  1S72 I;  1KQ8 A;  1ZKG A;  5C44 J;  5L3E A;  2K27 A;  3OYM A;  4AIK A;  3BZK A;  4PJM A;  3KZI C;  3ABL H;  1I3Q J;  1J59 A;  3H0G J;  3P7N A;  2F4I A;  3BDD A;  2V6C A;  5LGU A;  1S7O A;  1ZTR A;  2AQE A;  3C2G A;  3DTK A;  4PJJ A;  2O8X A;  2OV7 A;  3E5Q A;  5KNL A;  2ZKZ A;  3WOD F;  3CCR I;  3Q0W A;  1UG2 A;  4WXD A;  3DBL B;  1KZH A;  4ZDP A;  3GX4 X;  2ELH A;  3QPT A;  2X6O A;  2Z16 A;  1X3U A;  5EYR A;  1IF1 A;  4ESJ A;  2ZXJ A;  4EVI A;  4CZZ A;  3JRI A;  1XGM A;  4HSR A;  2G9W A;  2MD5 A;  3RQI A;  4B48 A;  4ESF A;  2V9P A;  2X1E A;  3RJP A;  2XRN A;  4CO8 A;  5J1Y A;  3IKT A;  5FJ8 J;  3J7Y J;  2C6Y A;  3S32 A;  4F52 A;  4IHT A;  2R7T A;  2GXA A;  1LE8 B;  2L5Q A;  2M4K A;  3S2H J;  1TW2 A;  1P6R A;  4CYC A;  3BG6 A;  5HNH A;  2L9N A;  2OTL I;  5FRM A;  5D4R A;  4LK0 F;  3DPT A;  5IPA A;  1EJ9 A;  1SD4 A;  5KVR A;  2NVU B;  4C3J J;  1UJ8 A;  3VWB A;  3ZMS A;  4AC0 A;  1S5L C;  5ICE A;  1BIB A;  4UUS A;  3V8K A;  3F8B A;  5J1U A;  3EUA A;  1X58 A;  3J7Z I;  4A3C J;  2L0K A;  2BYV E;  5CLS A;  2CGP A;  2LG4 A;  4CA0 A;  2BOL A;  3CP2 A;  4I6Z A;  5HLT A;  3HBL A;  4AIJ A;  2RN7 A;  1VQK I;  2X9D A;  4RM3 A;  3WTX C;  1F43 A;  5CVR A;  1XSD A;  2A5W A;  2QSF X;  4FX4 A;  3DKX A;  3EYY A;  2R7W A;  2XB0 X;  4EM0 B;  3TOB A;  3L7W A;  2Q1Z B;  2ZBK A;  5D5W B;  3E97 A;  1XTA A;  2J5P A;  1UMQ A;  3E6B A;  1WJE A;  5CVV A;  3PSF A;  3SEQ A;  4LLN A;  2JA7 J;  4LG0 A;  3KFW X;  3BR5 A;  2WB1 A;  1TT5 B;  3DPL C;  2L7F P;  3H3V K;  4CCO A;  3MWM A;  2F4O B;  3N97 A;  2VQC A;  4A3F J;  3DTI A;  2F48 A;  1Z7U A;  2BGC A;  4KJZ A;  3CUO A;  1OYY A;  2KHM A;  5DCM B;  4N4O B;  3WE3 A;  1GLN A;  2QSG X;  5E20 A;  1WH7 A;  3DLA A;  1QVT A;  1IUY A;  1Y1W J;  3WG7 H;  2YR2 A;  1AKH A;  3CJR B;  5L3D A;  4RM2 A;  3BTI A;  3A0B C;  5CVU A;  3DU5 A;  3F6O A;  2VE9 A;  3JRD A;  5IT9 K;  3OYH A;  2V6E A;  4WXC A;  3RKY A;  1BOB A;  2ESN A;  2R5Y B;  3SZG A;  3CF2 A;  4S04 A;  3HHH A;  2L54 A;  1VQ8 I;  2Z33 A;  2FOW A;  4HNT A;  2P5K A;  1SVO A;  2X51 A;  3S1N J;  4HX7 A;  1OFC X;  3G3Z A;  3QPL A;  2O6G E;  4MNU A;  3AL0 C;  2K9Q A;  1XCV A;  2EV6 A;  2M87 A;  2QZ8 A;  2F4M B;  3O3K A;  4NC6 A;  1HLV A;  4PZJ A;  4R1H A;  1QA6 A;  2DO7 A;  4DZJ A;  4RLQ A;  4BKX A;  3B73 A;  2JRT A;  3GLL A;  1PP7 U;  4RGX A;  3O8H A;  2KRC A;  4BEH B;  4OIN F;  3K10 A;  1R23 A;  2LF7 A;  4AYB A;  1B6A A;  4Y17 A;  2OA4 A;  3BTC A;  1K83 J;  1ZK8 A;  2OQR A;  3HG9 A;  2GIV A;  2Y0S N;  2UUZ A;  5E3M A;  2VON A;  2HFH A;  2BY1 A;  1I50 J;  4HOB A;  4LMY A;  1NTC A;  3E0J B;  4LLG F;  2VBZ A;  3K2A A;  3CMY A;  1P4X A;  1QPI A;  4N0B A;  3CUQ A;  3H5A A;  1LUJ B;  1N77 A;  1ZAO A;  1VZ0 A;  2PEX A;  1VND A;  2B0L A;  4CCN A;  5JVT A;  2HVR A;  2VUM J;  2KMU A;  2YSR A;  1FSH A;  2PQ8 A;  1XDU A;  5CVI A;  4QIW N;  3I5U A;  4DYC A;  2HNH A;  4W97 A;  4ZDO A;  1W5C C;  3DTE A;  3CJT B;  2R7Q A;  4BH9 A;  3WTT C;  2WB1 N;  4A3L J;  3K70 C;  4J19 A;  3HIF A;  2QGU A;  2STT A;  3LSJ A;  2DDA A;  5IP9 J;  3AG3 H;  2VOD A;  4AM3 A;  2R5Z B;  3CCS I;  2HXI A;  5KCM A;  2DT6 A;  5LRS A;  4A3D J;  2BY2 A;  1H9T A;  5FFX A;  1W7P B;  2ZNZ A;  5E1Z B;  4XBF A;  3E7L A;  4KNY A;  3OYE A;  2DOD A;  1PVE A;  2HQ5 A;  3BP8 A;  4ETS A;  1IN8 A;  4G7Z F;  3M8F A;  4IRH A;  5DUI A;  3ZQH A;  5E3L A;  2PMH A;  1R1U A;  3FWE A;  1QZZ A;  1MMG A;  3L2C A;  1S6L A;  2DA1 A;  3V7C A;  1TW3 A;  3G4S I;  2ISZ A;  3BWG A;  3CMA I;  3JTG A;  2JRM A;  1T38 A;  3WTZ A;  6PAX A;  1QVU A;  2BVM A;  2K9L A;  3PFI A;  5K5O A;  2GXG A;  4ZYG A;  1RZ4 A;  1FJL A;  5GAE J;  4YIR X;  1NG7 A;  2O8K A;  1QBJ A;  1MMD A;  3F8F A;  4HX8 A;  3F23 A;  1MNM C;  3ECO A;  2DQR A;  3RIR A;  1SAU A;  3GVA A;  1ETK A;  1BW6 A;  3GF2 A;  4KT5 C;  2K7L A;  1S3J A;  2EFW A;  1FTT A;  3RKQ A;  3TP3 A;  2KJC A;  4IPA A;  4AYB N;  5M3M J;  2W25 A;  4HQE A;  3N05 A;  3ZQL A;  2K40 A;  2DMT A;  2JA6 J;  1UFM A;  1ETX A;  2DDB A;  5F0H A;  4OIQ F;  1V55 H;  2FEZ A;  1I1S A;  4EQQ A;  3SEZ A;  3VOE A;  2GOM A;  2RQP A;  3GTO J;  2MH2 A;  5GTI C;  1GXP A;  1YX5 A;  2CUE A;  4UXN A;  2EZK A;  3IHU A;  4P5O A;  3RPQ A;  3S15 J;  1BI3 A;  3QWL A;  2HDW A;  2KZG A;  5M5W J;  1MBH A;  3OL3 A;  3K7A J;  3VOD A;  2RVC A;  2F5D A;  3IAM 2;  1W5S A;  4JX6 A;  1SD5 A;  3G1L A;  1P2F A;  2HGC A;  1S7E A;  2XKO A;  3KEO A;  1JJ6 C;  2PJR A;  2NRA C;  3SQN A;  3SHF A;  1S7A A;  4ANJ A;  4S0H B;  1HBX G;  4L9J A;  4HLY A;  1W1W E;  2QQB A;  4A6D A;  1IXC A;  2F5F A;  4I99 C;  2DA3 A;  3BTJ A;  4LIT A;  2KIS A;  2LYC A;  1DP7 P;  4IXA A;  3K70 D;  2V79 A;  3G1M A;  5K5Q A;  3S16 J;  5J8C A;  3K4B A;  5CQG A;  1J9I A;  5J1R A;  4CSW A;  1D5V A;  2ZNY A;  3H3U A;  4EM1 A;  3H9G A;  1IRZ A;  1L0O C;  1QPM A;  2A6H F;  1F5T A;  1WPK A;  3I59 A;  1AU7 A;  1WZ2 A;  4M72 A;  2HOT A;  2DA4 A;  5J4Y A;  3L9F A;  2QQ9 A;  4G9Y A;  1WSU A;  1VQ7 I;  1YRN B;  1REP C;  3RKX A;  1FT9 A;  3IH4 A;  2PMZ A;  3FKI J;  4XOT A;  5KAI C;  4GXO A;  2V4J C;  4CZC A;  4Y4R A;  4ZDL A;  2O3F A;  5K7F A;  4C9Y A;  1S9H A;  2P7C B;  5J40 A;  1LJ9 A;  3COA C;  2Z1D A;  3UR3 C;  1BR1 A;  3KZY A;  3MZ8 A;  4ENN A;  2XGC A;  1XGO A;  1Y1V J;  4CYC B;  2D45 A;  2VN2 A;  3HB9 A;  1X19 A;  2VLA A;  2R7U A;  2CW0 F;  4XR6 A;  4C2U A;  2IPQ X;  4KFC A;  4C2M J;  4KIB A;  3LSR A;  2L9V A;  2RKH A;  3Q0U A;  5K5R A;  1D0Z A;  3GTJ J;  2ISY A;  4UUS B;  3QOE A;  2DFE A;  4HDV A;  3Q9V A;  1YW9 A;  2FBK A;  2DMN A;  3TKY A;  3ABU A;  1IN5 A;  3IWF A;  4F93 B;  3OYD A;  1U6G A;  4RB3 C;  2Q0O A;  3JRB A;  4KUM A;  3J81 K;  2VQL A;  1ZRE A;  2EFN A;  2L3D A;  2LRE A;  4XKC A;  1GV5 A;  3TGN A;  3GXO A;  5EEA A;  2ADU A;  3S3O A;  1JKQ C;  3FXU A;  2E34 A;  2FOK A;  1IJW C;  4EM2 A;  3K1N A;  4II2 A;  1VQ6 I;  4Y33 A;  1VQO I;  1IDY A;  3LSG A;  3T0Y A;  1LDK B;  1MDM B;  3CD6 I;  4XQF A;  4FCY A;  2P4W A;  3BR6 A;  3D5S C;  1LEA A;  3A02 A;  1E2X A;  4OMY A;  3HZJ A;  2DW4 A;  1BJA A;  4O5V A;  2FRH A;  3WTY C;  4XK4 A;  5M3F J;  1SEU A;  1D1B A;  2ESH A;  4XLA A;  5E18 F;  1OQY A;  2DU9 A;  3PQK A;  5HS9 A;  3WG9 A;  2EZI A;  2RNJ A;  3OSG A;  2R0Q C;  1TBX A;  2PMZ N;  2VOP A;  2JT1 A;  4ESB A;  2CFO A;  2A6T A;  2V7F A;  1YX3 A;  1JXS A;  4FE4 A;  4CIC A;  1R1T A;  4MTE A;  4M3G A;  3W6K B;  2ICW G;  2HQN A;  3VYT B;  4P96 A;  2W1O A;  2ME6 A;  1ZGJ A;  1TC3 C;  1MD0 A;  4I7H A;  5AIQ A;  4F3Q A;  5IYC J;  4BDY A;  2QKM B;  5H6Q A;  4G6D A;  1MSF C;  4HG2 A;  5FD6 A;  5K7Z A;  3IRR A;  2HZD A;  2HPI A;  4B44 A;  3DEU A;  3LA2 A;  1WVR A;  4H0E A;  4JQF A;  4XLP F;  1DGW Y;  2MC3 A;  1I27 A;  2HOS A;  3TQN A;  2XAQ A;  4I98 B;  1H89 C;  3V7S A;  2DMP A;  1D3Y A;  2LR8 A;  4BUP A;  5HOD A;  2NS7 A;  1XG1 A;  2MLG A;  5E3O A;  1T39 A;  3E6M A;  3O2P E;  2M5W A;  1Z21 A;  4QSH A;  3JRC A;  2XIG A;  2R7O A;  4HAM A;  3ZMD A;  5FKK A;  4LOC A;  3L1P A;  1IC8 A;  4G6Q A;  1YJ9 I;  1D8K A;  1Z05 A;  4L0Y B;  2LSO A;  1YFH A;  1FIA A;  3S17 J;  1I3A A;  2XVC A;  1IG7 A;  4IHS A;  1H8A C;  2TCT A;  3KEQ A;  3PL8 A;  2DJI A;  2WAD A;  4BDZ A;  1X4P A;  3MD2 A;  1GVD A;  1IAW A;  4IX7 A;  1LPQ A;  5FB2 A;  1T33 A;  1Y8R B;  4RGU A;  2EBI A;  3C7J A;  3E1S A;  4A3J J;  2NNY A;  2LY9 A;  3RTR A;  5E1W A;  3ZRG A;  3M8E A;  2JZY A;  4M6Y A;  2E1M C;  5GTH C;  1Y39 A;  3LWF A;  2LOO A;  4KMU X;  1PDN C;  2BXZ A;  1JUM A;  3MKY B;  1VQ4 I;  2R3S A;  3NRV A;  3MQ0 A;  4ZYH A;  3HM5 A;  4A0Z A;  1LVA A;  4OIO F;  2HYF A;  3KLN A;  2A68 F;  1B8I A;  1ETW A;  5GP9 A;  1ZRD A;  4RAZ A;  1U8R A;  4JX5 A;  3L00 A;  2AHQ A;  3KX2 A;  2V1N A;  3W6V A;  1TNS A;  3ZR8 X;  4P9U A;  2OU2 A;  2H94 A;  5AON A;  4QWQ A;  4HQM A;  1ZR2 A;  1APL C;  3CES A;  1T98 A;  3HXL A;  5GAH J;  2GLO A;  1F1Z A;  3A1Y A;  2W85 A;  1K78 A;  1GV2 A;  3VSK A;  5LHH A;  1ODD A;  2D1H A;  1ZG1 A;  1SVM A;  1ZRC A;  2CV2 A;  1ZAR A;  3KP2 A;  4D5C A;  3PO3 J;  1MH4 A;  2E5Z A;  3CJN A;  2F5E A;  3LSK A;  3OYA A;  1X2N A;  2QCO A;  1HC8 A;  4WXH A;  1XCB A;  2H8W A;  3HYI A;  4ZZD A;  2E1N A;  5L3B A;  2YU3 A;  2QSH X;  3H1C A;  1LB2 A;  1G59 A;  1O57 A;  4DNC A;  2EQR A;  2BY0 A;  2JWT A;  2AS5 F;  2ZME A;  4XKB A;  2IT0 A;  4A3G J;  4CHU A;  3P9C A;  4LFU A;  5L3F A;  4A0X A;  3SFZ A;  3IV5 A;  4LIU A;  3S2W A;  1KQ9 A;  4NBQ A;  2YUS A;  4Z2Y A;  3I0T A;  1LVK A;  1RET A;  1Z9C A;  3GTL J;  4CUG A;  2XC7 A;  5B5E C;  4MEX F;  3AG2 H;  2HTS A;  4LIV A;  3BPX A;  5F0F A;  4ZTJ A;  3R61 A;  3EYI A;  3LL7 A;  2IS4 A;  1UAA A;  2IS1 A;  1RES A;  2QWW A;  2AO9 A;  2QLZ A;  1ZG3 A;  4DQ2 A;  4YRV A;  4XRM A;  1U5T B;  1Z1D A;  2HOA A;  1IXR C;  2RQQ A;  4LLL A;  5IY5 H;  3TO9 A;  4BQN A;  2GQQ A;  3HSR A;  4F7Z A;  3X2Q H;  1TWA J;  1SVL A;  1IRX A;  4IHY A;  1GHC A;  2Z3Y A;  3I3L A;  2JMW A;  3NWS A;  4CH7 A;  3OL4 A;  2DTR A;  1WJA A;  1TWH J;  2LKS A;  4U7D A;  3FXR A;  5DD8 A;  3I59 B;  2DBB A;  4BJ5 C;  1H9G A;  2GA1 A;  3RPU D;  2RC4 A;  4G6T B;  3FMQ A;  4S05 A;  3CCL I;  1SAX A;  2PN6 A;  2DAO A;  3A01 A;  3V4G A;  1WI3 A;  2PG4 A;  4FT8 A;  1Z0X A;  2EA2 A;  1MMA A;  2NS0 A;  1QHH D;  3S8P A;  3SXY A;  1ZG5 A;  4M71 A;  2GM4 A;  1F9N A;  1HCR A;  4IZZ A;  3DV8 A;  5FLM J;  1QU3 A;  1UHM A;  4PJL A;  2LC2 A;  1SFK A;  3EET A;  2ECB A;  2IA2 A;  2X1D A;  3FHN A;  3KCC A;  4L9N A;  2WV1 A;  2BEO A;  1LEB A;  1IN6 A;  2OBP A;  3ABT A;  1FSE A;  4PCQ A;  1BBY A;  4HST A;  3GTQ J;  5FKL A;  3HRS A;  5IOZ A;  1U9O A;  5J4V A;  3RKW A;  5DTD A;  2HYJ A;  3VYS B;  2MG4 A;  4QPO A;  3ESW B;  1R4N B;  2LTP A;  4WK8 F;  1FBS A;  3TW7 A;  2DPD A;  4RDU A;  3I4M J;  4A6E A;  3FIW A;  2E2J J;  1YOV B;  4M3B A;  1BM9 A;  3FK6 A;  1BR4 A;  3AAF A;  1FC3 A;  1X2M A;  4A2U A;  1IV8 A;  4C3I J;  1BA5 A;  2CU7 A;  1MKM A;  3P5J A;  3OYI A;  3DQV C;  2R92 J;  4J00 A;  1V3F A;  4RB1 A;  3T8R A;  2QM3 A;  4UUT A;  3JTH A;  2EIK H;  2EWN A;  3BG9 A;  3HSE A;  1V5G A;  3JW4 A;  1ZGW A;  3O6B B;  1KYZ A;  3VEP A;  4FX0 A;  3JRE A;  1H0M A;  4E70 A;  3GEZ A;  2PLY A;  2CG4 A;  3HDD A;  4Y3O A;  2OZ6 A;  1FYM A;  3LAP A;  2UXN A;  2BHZ A;  3IH2 A;  2UWM A;  2Y0S A;  1R71 A;  3JCU C;  2JJ7 A;  2AQF A;  2CQX A;  2DOE A;  2YX7 A;  1R1V A;  1MMS A;  1U8B A;  4XLF A;  2IS6 A;  2XUB A;  2Y0M A;  4B4C A;  4JX4 A;  4AUX A;  3QU3 A;  2EB7 A;  1LNW A;  3PFY A;  1F36 A;  2W48 A;  4HLX A;  3FXL A;  2NYX A;  4HW0 A;  4OWR B;  1E0E A;  2HZT A;  1BR2 A;  1MNE A;  5HNF A;  1A35 A;  2E1O A;  1T08 B;  1KU3 A;  1HDP A;  2X0L A;  3FBI B;  3JSO A;  2B63 J;  3M9A A;  2JA2 A;  2VJ4 A;  1VQ5 I;  1KYW A;  2KPM A;  1OLT A;  4MHG A;  4UUV A;  2P0W A;  2IVM A;  4F55 A;  4KA4 A;  4ENM A;  3HRU A;  2HDD A;  1Q1V A;  2QEX I;  3DF8 A;  1DUX C;  4M6X A;  2ZFU A;  2WC2 A;  1R5G A;  4DOZ A;  1VFC A;  1SFO J;  1ETQ A;  3K4J A;  1PP8 F;  1T6S A;  4X6A J;  4UY8 I;  3BPV A;  3ELK A;  4D5F A;  2BZT A;  3EQL F;  4XMY A;  4FET A;  2GWR A;  4CGZ A;  2CMP A;  5DV5 A;  3DKY A;  4RAF A;  2R7S A;  4AVZ A;  2OTJ I;  2XAG A;  3RPU A;  2GXB A;  2E36 A;  2DOA A;  3ABK H;  5FRO A;  5L3C A;  5CQE A;  3ZQI A;  3G1O A;  4YIF A;  1ETV A;  2CUJ A;  5CJ9 A;  4EJW A;  3BR2 A;  2NAZ A;  1XN7 A;  3ML6 A;  3Q0V A;  1MJ9 A;  2BXY A;  3I4P A;  3J81 Z;  4HF2 A;  3G2B A;  4BL0 B;  3SDB A;  3LQQ A;  4RB0 A;  1MJA A;  3OS2 A;  5LHI A;  3PQJ A;  2K02 A;  2G7H A;  3B02 A;  5FLX K;  5IT3 A;  1GDT A;  2Y30 A;  1R9T J;  1A31 A;  3FM5 A;  1TZL A;  5DUK A;  5EGO B;  2CWE A;  2QA4 I;  4GFB A;  3ZGK A;  3QYF A;  1ITY A;  3LOC A;  4HEA 2;  5ILS A;  1FYK A;  5E8G A;  1CF7 B;  5TGT A;  3KYC B;  2DA7 A;  2Z9O A;  1L3L A;  4ON0 A;  5F27 A;  1FWZ A;  1FBU A;  1Y0U A;  3KP3 A;  1F4K A;  3SJM A;  3MZH A;  4IEJ A;  2O03 A;  1RKW A;  4BU2 A;  4L5I A;  2WA0 A;  3V42 A;  1RIO H;  1DGR M;  2HWV A;  3NQO A;  2EFQ A;  3L2W A;  3UNG C;  4V2F A;  3M1E A;  1QQI A;  2TRT A;  5CYV A;  5FKO A;  4U7B A;  4BQA A;  4DW6 A;  3G6E I;  4E4H A;  4BAC A;  1OCC H;  4FHT A;  3TDZ C;  5DDG A;  1GVJ A;  2VIX A;  4RBO A;  4D9J A;  2M4G A;  2CSO A;  2JA8 J;  3MKZ A;  1V54 H;  4XL9 A;  4BYY A;  1SFE A;  2H8R A;  3CP8 A;  4A0Y A;  4ABZ A;  2TDX A;  3HOZ J;  2PBI A;  2K3F A;  2KZV A;  2MYS A;  3L2Q A;  3HOU J;  2R7X A;  4V2G A;  4ZC3 A;  1K78 B;  2MLK A;  3PNT A;  1P7J A;  1WJF A;  2E60 A;  4BE0 A;  2WBM A;  2ELJ A;  2X6W A;  2CH0 A;  4IOA F;  2J5O A;  4ZYE A;  4PFO A;  1B72 A;  3BG3 A;  3LSM A;  4LK1 F;  1OCR H;  4PSX A;  2VKH A;  2V1U A;  3TW6 A;  1R58 A;  3BQY A;  3MAJ A;  1I5Z A;  1R5I D;  2KIU A;  5FLV A;  1U3E M;  3U1K A;  2LRD A;  2YPR A;  3M8J A;  2M8G X;  2VC0 A;  2CUF A;  1JUP A;  3K6G A;  4FE7 A;  4NQW B;  4E7H A;  2XAS A;  1FBQ A;  2ZME B;  1Q1H A;  2LY2 A;  1P4W A;  3L2R A;  2CV0 A;  1FEX A;  2EFO A;  4J01 A;  3WHB A;  3LA7 A;  2D2W A;  3KP5 A;  3BR0 A;  2QF7 A;  4E7K A;  3S3N A;  1ACI A;  5BQT A;  3TED A;  1ZR4 A;  3RYR A;  2P7V B;  3DEE A;  1JTX A;  1BC7 C;  4JK1 X;  2EV5 A;  1UEL B;  2M7A A;  4ZJZ A;  2IBD A;  3DFG A;  1D1C A;  4A3M J;  1H88 C;  2IP2 A;  5JR3 A;  5DS9 A;  5JLW A;  1ZQ3 P;  2EFP A;  4DJA A;  3K4M A;  4M3D A;  4I76 A;  4X0G A;  2HU9 A;  1YQA A;  4OMZ A;  3S1Q J;  4G12 A;  1W4M A;  1A6Q A;  5H6R A;  1YE9 A;  4A69 C;  1XD7 A;  5D5V B;  2Q2E A;  3RDI A;  2ELK A;  2LFB A;  1OCT C;  4BQO A;  2QQA A;  2K85 A;  1TQM A;  1U2W A;  4L0Z B;  3VDX A;  4BBR J;  1JE8 A;  1D5Y A;  2DYR H;  2W4S A;  5DCF A;  4Q48 A;  1B4A A;  3C2H A;  3HOS A;  1ZYR F;  3PM1 A;  3C18 A;  3ZPL A;  2DMU A;  3HUG A;  1KA8 A;  3V8J A;  2IA0 A;  1VQL I;  1A04 A;  5KHD A;  2BHY A;  2V9K A;  3WE2 A;  2KDZ A;  1OJL A;  1XS9 A;  1R7J A;  2XDV A;  2XV4 S;  4QTR A;  1RR8 C;  3BCB A;  4XON A;  2DYS H;  2KRF A;  1XPX A;  1FYL A;  5KAF C;  1IZ1 A;  4XSX F;  4Q47 A;  1XSX A;  1QGP A;  5EJC A;  3T1B A;  2P5V A;  5F1R A;  2W57 A;  5LLQ A;  1M1E B;  4EGZ A;  4IHW A;  1T56 A;  1Z91 A;  2QVO A;  2CJJ A;  2M1B A;  4G7O F;  1EF4 A;  4BXX J;  5HS7 A;  3ZMV A;  5TIS C;  1UCR A;  3FHZ A;  3DKW A;  1IRG A;  2CQK A;  3WU0 A;  2COM A;  2JSP A;  1LDJ A;  2M9H A;  1XGS A;  3FF5 A;  2VL8 A;  4CXF A;  2V9V A;  1PUF A;  1TL8 A;  1Y0N A;  2CV1 A;  2I8D A;  3P9I A;  1KON A;  1MIJ A;  1BL0 A;  1I6X A;  2HYG D;  3GZ5 A;  2M0M A;  3SZP A;  1MJB A;  2L7M P;  4HNV A;  2VJI A;  3GTM J;  1G6N A;  3WTV C;  1MBJ A;  4G7H F;  4OIP F;  4P55 A;  1O4X A;  5FKN A;  3ERM A;  2VJJ A;  5ED4 A;  1ERD A;  1Y8Q B;  3U1D A;  5B66 C;  1U0J A;  2HKO A;  3D5L A;  2KLO A;  1LKX A;  3IC7 A;  4YFN F;  4OAY A;  1JJ8 C;  1EH7 A;  3E5U A;  4YFK F;  1WJD A;  1VI0 A;  2ZSI B;  2EZL A;  1LFB A;  3OS1 A;  3S1M J;  1VF9 A;  2JA5 J;  2XF7 A;  4E7I A;  2FSW A;  3BOQ A;  3VYU B;  1R49 A;  1YI2 I;  3ROU A;  1SFX A;  3CJQ B;  2FE3 A;  1OYI A;  3HTS B;  1PJR A;  4NB5 A;  2UZK A;  2P6T A;  1UHS A;  4DYQ A;  3OIO A;  5A2Q K;  1BOA A;  2Z5U A;  1XSV A;  2DPU A;  3BQZ A;  2VKV A;  2W82 A;  4CCK A;  3GUD A;  4OIR F;  2K86 A;  4XRS G;  4O3M A;  2R93 J;  4DGW B;  2VKD A;  2VE8 A;  3N4M A;  1R6R A;  1WCM J;  2OAZ A;  3CCQ I;  4LG0 B;  4M3F A;  3F0C A;  5EG0 A;  2KIQ A;  1TNT A;  4LG3 A;  1J2X A;  2Y48 A;  2XGE A;  3FIS A;  1O3T A;  5BPI A;  2UV1 A;  4M9X A;  1SFU A;  3GFM A;  4JOM A;  4MQV A;  3DLL F;  2O7O A;  3R6S A;  1QHG A;  4I0B A;  5CKT A;  5E79 C;  1G4D A;  4WCG A;  2ZC2 A;  2ID3 A;  1W7P D;  2WAE A;  1YLF A;  3F3X A;  1AKH B;  2NVT J;  2GOX B;  2RAE A;  3WGI A;  1C0W A;  4NC8 A;  4V19 K;  3A2K A;  5K1Y A;  2DOF A;  2NXN B;  3EUH C;  3MN2 A;  4AID A;  4PGH A;  1BI2 A;  4RMN A;  4H4K C;  1ENH A;  2L4A A;  5FGM A;  4XLC A;  3GZ6 A;  2KKO A;  3T5X A;  4XM3 A;  3PSI A;  5EEH A;  4BQQ A;  2E5N A;  1Z3X A;  2ZCW A;  4GRI A;  1VQN I;  2XRO A;  4XKW A;  3TBI A;  4XOR A;  3DBH B;  3R0J A;  5B3S H;  4UB8 C;  2IJL A;  4NC7 A;  1ZN2 A;  4E7S A;  1FPQ A;  5HDN A;  2Y9Y A;  4PK4 A;  3HOY J;  1FNN A;  1UG0 A;  2JUG A;  3E3V A;  2HTJ A;  3HTU A;  3ZMU A;  3F9K A;  5IYD J;  3F21 A;  2DQL A;  5JLX A;  1E3H A;  3U9G A;  2JK3 A;  3ZQC A;  3ABM H;  3OS0 A;  4BHP A;  5JVG F;  2KIF A;  4L18 B;  2OF7 A;  3K1M A;  1RNL A;  1ZEL A;  2XKP A;  2M45 A;  4HPQ A;  2KDO A;  4BXU A;  3L2U A;  3MKL A;  1Z77 A;  3CUQ B;  3BCA A;  4ZH4 F;  3WHC A;  3RI4 A;  3ISP A;  2LF8 A;  2R5Y A;  2CFX A;  1DU0 A;  1ULY A;  5ICG A;  2YU9 J;  2L7K A;  3BC8 A;  4XLN F;  4BE1 A;  2Y9Z A;  3SDG A;  5F0C A;  2OD5 A;  1U9N A;  2XAJ A;  3CO7 C;  5TRD A;  1NH3 A;  1O3R A;  4JP0 A;  1X3W B;  4Y13 A;  5F6F A;  3KPH A;  2EA4 A;  1G8X A;  3VFZ A;  3SZT A;  4HV6 A;  5GPC A;  2WAQ N;  2CUZ A;  4AU7 A;  4B43 A;  3SYT A;  2K9M A;  3U21 A;  4Y7N J;  4XRS A;  1IXS B;  3TP0 A;  5LD2 C;  3FXM A;  3A03 A;  3VYR B;  5D4S A;  2L01 A;  5TJJ A;  1UST A;  1QO0 D;  3EPZ A;  3EUK L;  1FOX A;  1BI1 A;  2EIJ H;  3HPG A;  4AVP A;  1X1D A;  4GYG A;  1OPC A;  1PYV A;  5ICC A;  4LJZ F;  2DI3 A;  3OR1 C;  4EJV A;  4L9V A;  4KIT B;  4IKF A;  1HW5 A;  4RA2 A;  1HSJ A;  4CCL A;  1STZ A;  4MQ9 F;  3HOT A;  3H0D A;  2IGO A;  2ZXH A;  2WY8 Q;  4N9H A;  4M3E A;  1GUU A;  2W84 A;  2JSC A;  2FXA A;  2VJ5 A;  5H20 A;  5ICF A;  2IEK A;  5GPA A;  3FDY A;  2HQA A;  3DEW A;  2A07 F;  3FZV A;  2VI6 A;  2W00 A;  5EZH A;  1QZE A;  4M74 A;  4NDL A;  5E1X A;  3GZN B;  3OYB A;  3F72 A;  1HST A;  2FMY A;  1OIS A;  2VXZ A;  3S1R J;  3T8T A;  2KP6 A;  2R5Z A;  2HQR A;  2N8G A;  3WTW C;  3IP4 B;  3PUF A;  2GZW A;  2DA5 A;  5J8F A;  5J6X A;  3AFH A;  2A61 A;  3CZ6 A;  5FLX Z;  1W7P A;  3WU1 B;  4A3E J;  3M3Y J;  1I6H J;  2FJ1 A;  3GTP J;  2WTE A;  3OOU A;  2PJP A;  1B59 A;  5C3E J;  2OC6 A;  3KYL A;  2MFZ A;  3HOW J;  5FKM A;  1R4M B;  3OIQ A;  1HW2 A;  2E7X A;  5HLI A;  3JRH A;  2VBY A;  1XX5 A;  2IRF G;  4HYE A;  3IRQ A;  1FOK A;  1MZB A;  3NEU A;  5E8I A;  3J80 K;  2XAF A;  4EV0 A;  1ZLJ A;  3ZQQ A;  4KN7 X;  3W3C A;  1JKO C;  2H1K A;  2BV6 A;  5AIP A;  3CMM A;  3I55 I;  1LFU P;  2QQ8 A;  2PJR B;  2H6C A;  5ILU A;  2FML A;  1XC5 A;  4C3H J;  4A5M A;  2UXX A;  3CO6 C;  1K7A A;  3CLO A;  3H9Q A;  3IWZ A;  1ETO A;  3K4K A;  3QP5 A;  3KP7 A;  2LKP A;  1KU7 A;  1XDS A;  4C30 A;  3P9K A;  4RGR A;  3HPH A;  4YG2 F;  2CYY A;  1UB9 A;  1MND A;  4N4N B;  2XPV A;  2H1L A;  2HEO A;  1FP2 A;  3BJ6 A;  2FF4 A;  3HGG A;  4BAY A;  1JT0 A;  1LDD A;  1O3Q A;  4HF0 A;  1ON1 A;  3OR2 C;  1EH8 A;  3H3Z A;  2HXO A;  4MO7 A;  4U87 A;  1J75 A;  1DPU A;  3H36 A;  2MW8 A;  5DD4 A;  4U88 A;  5JHF A;  1Z6R A;  1PUF B;  4I02 A;  1E17 A;  3HSF A;  3DWL E;  4DIQ A;  5HS8 A;  2QEN A;  3DU6 A;  5D6E A;  3FMS A;  2NOJ B;  4HA8 A;  4P1W A;  3ECH A;  5B1B H;  5FO5 A;  1KU9 A;  3QOP A;  4IRI A;  4B8X A;  1W0T A;  1D8J A;  1KQ0 A;  2EIN H;  4N9I A;  1VQ9 I;  2L4M A;  4E6K G;  5EZG A;  5HOO A;  2H09 A;  3VPR A;  3GFL A;  4RLF A;  2D5V A;  1MMN A;  5D8L B;  5IOY A;  4XIC A;  1WJ5 A;  2DK8 A;  2XRL A;  3ZQF A;  4B3X A;  3H35 A;  3Q3S A;  2VT3 A;  1Z3Y A;  2KT0 A;  2ZFW A;  3ZMT A;  3GTK J;  2OJE D;  1B9N A;  2AXL A;  4A93 J;  2K4B A;  2EK5 A;  4D0P A;  3OIP A;  2XSJ C;  3I58 A;  4OAZ A;  1MBE A;  3CCV I;  5CPR B;  2XHK A;  3F8C A;  3GW2 A;  2FA5 A;  2M2E A;  5HVQ C;  2GBY A;  1YRN A;  3BLY A;  5E3N A;  3EUH A;  2OZU A;  1MBK A;  3DCF A;  3S2D J;  1P9Q C;  2JQ7 A;  3FK7 A;  4A12 A;  4II3 A;  1ON2 A;  3I4N J;  1HKQ A;  3TO7 A;  4UV9 A;  1FOY A;  2MH9 A;  2DK5 A;  3QQA A;  1HDD C;  3OOP A;  3BRO A;  5D5U B;  4IL6 C;  3FX3 A;  2YS9 A;  1A6I A;  3KZZ A;  2HKX A;  3OYJ A;  1U5T C;  1TWG J;  3AL0 B;  5EG0 B;  1VTN C;  4Z6Y A;  3CDH A;  4RS8 A;  3M1C A;  3FXQ A;  4GO1 A;  3HGY A;  5E17 F;  4EMS A;  1MGT A;  3HJE A;  2ETH A;  5J47 A;  4FTH A;  4ENK A;  1MH3 A;  3IH3 A;  1K4S A;  2CRG A;  5FRN A;  2HR3 A;  2LP0 A;  3CCM I;  2O0Y A;  4XSZ F;  4E7L A;  2RGV A;  3ULQ B;  3G73 A;  1FTZ A;  3I71 A;  4BNC A;  5JI6 A;  3IAS 2;  3TO6 A;  1BIA A;  2PMU A;  3SFI A;  1XMA A;  1J0R A;  3BZC A;  4DBR A;  4D7N A;  3CDI A;  4YFX F;  2HVQ A;  2PFB A;  2RRE A;  1SD6 A;  4BJ6 C;  2DCE A;  4BHB A;  3L2V A;  4L9T A;  2H6B A;  2ZJ2 A;  4DYR A;  2LNB A;  4IQ4 A;  3GLX A;  3R4K A;  4Y15 A;  2LKX A;  2EPF A;  2E7W A;  4KT6 A;  2LLK A;  4XKV A;  2Q8K A;  2LBF A;  2M3A A;  5HLG A;  3KP4 A;  3AG1 H;  2MD0 A;  3PUB A;  2L9R A;  1HW1 A;  1MDM A;  2ZB9 A;  5BOX A;  3V8L A;  1JUS A;  4KIS A;  2XF6 A;  2P81 A;  2E1C A;  4HBL A;  1KU2 A;  4NUB A;  2DT7 B;  1Y56 A;  2O61 A;  4PJN A;  4IHX A;  3HHG A;  4C2T A;  3Q5F A;  3RQ4 A;  3DP7 A;  3CCU I;  1HKS A;  4ZTF A;  2EIM H;  3PNV A;  2VQG A;  1OCZ H;  1WFX A;  5LRR A;  1ZHF A;  3RYP A;  1JHH A;  2I5U A;  1N78 A;  1SAN A;  4KYW A;  1YJW I;  2BY3 A;  1X1C A;  5ILV A;  3OYN A;  2ZXI A;  2QBY A;  1K79 A;  1EV7 A;  2DFI A;  2LD5 A;  2A6E F;  2RNG A;  4EJU A;  5EEG A;  5A2Q Z;  5IYB J;  3UKG A;  2WWY A;  2VC1 A;  1JGG A;  2DN0 A;  1UZC A;  4LB6 B;  1G3W A;  3WU2 C;  4EJT A;  2DXI A;  2EZH A;  2EV0 A;  4XRF A;  2V1X A;  4QPQ A;  4RGS A;  2OQG A;  3F22 A;  4OU0 A;  3LFK A;  4HNU A;  1VQP I;  2JUC A;  4MIM A;  3GME A;  2R4G A;  1OMI A;  1AOY A;  1YW7 A;  4TV7 A;  1OKR A;  2IAI A;  3ZQG A;  2GAU A;  3RSN A;  2KIM A;  1HF0 A;  2E35 A;  3M7G A;  3FXJ A;  4IHV A;  2L9S A;  2FUG 2;  4XN3 A;  1G3S A;  5DEQ A;  3TOA A;  3CC7 I;  4MLO A;  1R22 A;  2R7Z J;  4RAY A;  4ZYA A;  1RPW A;  4G8X A;  3WTU C;  1YTY A;  4NHJ A;  4MTD A;  2OPT A;  1XMX A;  2Z2S B;  1CQT A;  2FX0 A;  1B8I B;  2LDU A;  3LST A;  4PFP A;  1V5E A;  3J7A Y;  1R36 A;  2G0E A;  1GXQ A;  2BVL A;  5M5Y J;  1BC8 C;  1WI9 A;  2XF5 A;  4GDF A;  4LD5 A;  5IP7 J;  2MAB A;  2MSY A;  1FX7 A;  3H9J A;  4Q4Z F;  4B3A A;  2IA1 A;  5EF6 A;  3OY9 A;  4YII A;  2KQR A;  1DP3 A;  3VB2 A;  2JVG A;  4AIH A;  4CYD A;  9ANT A;  2M34 A;  1DPR A;  1I1G A;  3TL4 X;  2VB6 A;  1G2H A;  1USS A;  3JAM K;  5LFA A;  5FFZ A;  3HRT A;  2Y31 A;  1IN4 A;  3K4C A;  4U0W A;  2K9N A;  2VXD A;  3MZY A;  1RI7 A;  3WGH A;  3IL2 A;  2X1C A;  2EH3 A;  2DFF A;  1QZY A;  2HVS A;  2BW3 A;  2DLL A;  3BR3 A;  2WV0 A;  2E19 A;  1SMT A;  1X1A A;  3QOD A;  1JTY A;  4XID A;  2JVH A;  3JRA A;  1JI8 A;  4XOP A;  3F8N A;  3BG7 A;  1XGN A;  1T0F C;  1IN7 A;  3CTA A;  4HDU A;  1FMW A;  1EA3 A;  3QRF F;  1RUN A;  3ASO H;  4D7M A;  3RZD J;  2EIL H;  2ZJR F;  2JPC A;  3DBR B;  3D1N I;  3FM3 A;  3B6C A;  2Y69 H;  5EDN A;  3F8M A;  5L3G A;  3BR1 A;  4IO9 F;  1ZRF A;  1BI0 A;  1WH5 A;  1D0X A;  4FIS A;  4RAG A;  1WJB A;  3KP6 A;  2H27 A;  1FZP B;  2FNA A;  1YIO A;  1T8I A;  2NOG A;  3GO5 A;  3FXK A;  3LAJ A;  4U0V A;  2FBH A;  3MEX A;  4UHT A;  4BGD A;  3KLO A;  3C2B A;  4M9S A;  2B7E A;  1FMV A;  2XAH A;  4R8H A;  3AKZ A;  4BXF A;  4I2O A;  2B9S A;  3CLQ A;  4F91 B;  3PIO F;  4IOC F;  4CDG A;  3HRM A;  3CME I;  4KN4 X;  1DQU A;  3CDL A;  3W6J B;  4A5N A;  1D1A A;  4WX9 A;  3GTG J;  2JTV A;  2M8E A;  2HDC A;  5F1J A;  1NK2 P;  4CCJ A;  1HA8 A;  1IDZ A;  3PNY A;  3GBG A;  3A01 B;  1X4O A;  2A05 A;  2DFH A;  3R60 A;  5BNG A;  2DA6 A;  3TMO A;  1NK3 P;  3F6V A;  3EDP A;  3KET A;  1ETY A;  3CC2 I;  4DZP A;  2QYO A;  3QYB A;  1ORK A;  4XN0 A;  5D8K B;  3KEY A;  4I01 A;  1V5F A;  2A69 F;  3OYL A;  2E71 A;  3A4C A;  3B6A A;  1RRJ A;  1E3P A;  2WAF A;  3LSH A;  1NHA A;  1YIT I;  1TT0 A;  3KE2 A;  4UVB A;  2ZJP F;  3ZP5 A;  3LSP A;  3E5X A;  1PUE E;  1U5T A;  4OOI A;  1S29 A;  2F5C A;  5JFR A;  4PGG A;  3NAR A;  5LGN A;  3OYC A;  3BZ6 A;  5HDK A;  1NG6 A;  1IGN A;  2VKE A;  1MBG A;  1S8N A;  4YEL A;  1B1B A;  4XLE A;  5D6F A;  1BW5 A;  3GFI A;  3RZO J;  1WJC A;  3OYK A;  4ASN A;  1R5H A;  1OR7 C;  1Y6I A;  2YX4 A;  3C1D A;  4BY1 J;  3IKV A;  3JR9 A;  1ZH5 A;  4IVN A;  2JN6 A;  2ID6 A;  2VBX A;  2ZME C;  5BMZ A;  2FQ4 A;  3LMM A;  4EJO A;  1MBF A;  4QLC U;  3ZMZ A;  1JKP C;  5IP6 A;  3J80 Z;  2MC4 A;  4JBA A;  1T95 A;  3MCZ A;  4BY7 J;  4BS9 A;  2VOO A;  2VBW A;  4GCV A;  3GWZ A;  3LFU A;  2JPB A;  4LGW A;  4HX4 A;  4R79 A;  2MA3 A;  3PJR A;  4AWX B;  1J09 A;  4ITV A;  3ZQ7 A;  4E7J A;  3BY6 A;  2STW A;  3JSP A;  3HL2 A;  1WWX A;  1N25 A;  3S14 J;  3K9T A;  5GAG J;  1OCP A;  4A3B J;  1TWC J;  2VPL A;  4XNF A;  1JT6 A;  2DA2 A;  3K2Z A;  5K7H A;  4A3I J;  4BBS J;  2LVS A;  1J7K A;  4UNO A;  1JGS A;  4EAT A;  3I9V 2;  4B1R A;  4L5J A;  4PJ0 C;  3FKJ A;  2ACJ A;  3CQZ J;  3V7R A;  1MW7 A;  2FBI A;  1YW8 A;  3DXJ F;  2XSD C;  5LHG A;  1LE8 A;  2CQQ A;  3GYH X;  1X1B A;  3I64 A;  2FD5 A;  1TTY A;  5J3L A;  3E6C C;  2I10 A;  3ZOB A;  4F92 B;  3W2V A;  2HPM A;  3I54 A;  2F6C A;  3K4L A;  1IW7 F;  1IV6 A;  2K9S A;  2EJR A;  1X1P A;  5C4X J;  2KFD A;  3OV8 A;  2WAQ A;  2GA2 A;  3U2R A;  1JHF A;  5BS6 A;  1A36 A;  1WQ2 A;  1FIP A;  2COB A;  2LBF B;  1HQC A;  4KIC A;  4RB2 C;  1TWF J;  3IUO A;  2Z99 A;  5JHU A;  3AG4 H;  1RC9 A;  4IQJ A;  1P7I A;  4MFE A;  5F08 A;  4EGY A;  2E2I J;  2XB5 A;  3HOV J;  1BN5 A;  1JKR C;  1W36 C;  1YS6 A;  3BT9 A;  4M73 A;  1EH6 A;  2GIZ A;  3HC7 A;  4MGR A;  4DBQ A;  4G94 A;  5LEK A;  1VQM I;  1MSE C;  1HKT A;  1WRJ A;  1YHQ I;  2E1M B;  1K61 A;  1YG2 A;  4JYK A;  2VPR A;  4KIF A;  1YIJ I;  5ERI A;  4GGG A;  2F5V A;  2L7Z A;  3WGG A;  2ECC A;  5DYM A;  4MFD A;  2QBY B;  4WF2 A;  3ERE D;  2O5R A;  4AD9 A;  1P4A A;  3HEF A;  1AA7 A;  3I56 I;  2HOE A;  3TDU C;  3CCJ I;  2CS3 A;  1O7F A;  2P6S A;  4U0Y A;  2R7R A;  1YO5 C;  2LH9 A;  1TQI A;  3J7A O;  3FMR A;  3NWT A;  2DJN A;  2NVQ J;  3M07 A;  5DCM A;  3ZN1 A;  2V26 A;  2OCC H;  3BG5 A;  3HKZ A;  3OSF A;  3ZCO A;  4IRG A;  4GYI A;  4KIG A;  4UVC A;  1FLI A;  2PX9 A;  3K0L A;  1U78 A;  3I53 A;  2VT2 A;  2IGM A;  5F04 A;  2QKL B;  3S93 A;  4ZZL A;  1ZLK A;  2DT5 A;  2XPU A;  2M0C A;  1A5J A;  5C4J J;  4P9F A;  4YEJ A;  1DU6 A;  3QPH A;  2Y2Z A;  4L5E A;  5DM6 F;  4IF4 A;  2D1V A;  1CGP A;  1FOW A;  2XPW A;  1K6O A;  3PO2 J;  4KDP A;  1Z6T A;  1LQ1 A;  3A0H C;  4Y52 J;  3FBN B;  3DPU A;  4UV8 A;  4HV5 A;  4B09 A;  2VAS A;  2LK2 A;  2A3S A;  2OUM A;  1T0F A;  1HOM A;  2G7U A;  5LEJ A;  3OYG A;  2XGX A;  4NNJ A;  2Y75 A;  3WTS C;  2CW8 A;  2AXT C;  2FU4 A;  4IJA A;  3G71 I;  2BBY A;  1O3S A;  3CC4 I;  4BEH A;  1YYV A;  4XLH A;  4CCM A;  1P92 A;  2RDP A;  2K3P A;  2KJB A;  4BE2 A;  1J5Y A;  1POG A;  1IRF A;  5EGO A;  3D0S A;  1B72 B;  2ZXW H; 
#chains in the Genus database with same CATH homology
 2R7F A;  1CF7 A;  3H92 A;  3LA3 A;  1YS7 A;  5F64 A;  4I09 A;  3L09 A;  3QP6 A;  1ONV A;  1AWC A;  1SMY F;  3K1P A;  4BHC A;  3QU6 A;  2CO5 A;  1B9M A;  1FP1 D;  5IT9 Z;  5BPD A;  1TQP A;  1TLH B;  4Q5S F;  2V1D A;  1DDN A;  2FNP A;  5HLH A;  2F2E A;  3MFK A;  4HZF A;  4LB5 A;  4UVA A;  1OYW A;  3ZN0 A;  3BJO A;  2L02 A;  2K4J A;  1SD7 A;  1XMK A;  1QNT A;  4KMF A;  1G3Y A;  1FY7 A;  3CUQ C;  3Q9S A;  3GFJ A;  4WWC A;  3BJA A;  2PI0 A;  2A5Y B;  1OR7 A;  2HS5 A;  1V4R A;  2M30 A;  4M9Z A;  3R0A A;  4NQW A;  2R7D A;  5HDG A;  2IW5 A;  3K69 A;  1RUO A;  1ZGA A;  4K2E A;  4O6J A;  5LGT A;  1KGS A;  5LBQ A;  4MEY F;  3REO A;  2ZO4 A;  1R00 A;  2P5L C;  1UHW A;  4PDK A;  2QUF A;  4ENJ A;  1O7L A;  2NNN A;  4I0A A;  2P8T A;  3QAH A;  3JAM Z;  1HXD A;  2MBF A;  5KK1 A;  1G3T A;  3E6D A;  3LQR A;  4ZYD A;  1XB4 A;  5D5X B;  5FD5 A;  5CVJ A;  1T2K A;  2FQ3 A;  1WKM A;  2BE5 F;  2W24 A;  4HF1 A;  3C3W A;  2X4H A;  1W5T A;  2RV8 A;  1KQ8 A;  5L3E A;  2K27 A;  4AIK A;  1J59 A;  3P7N A;  3BDD A;  5LGU A;  2V6C A;  1S7O A;  2O8X A;  3E5Q A;  2ZKZ A;  3WOD F;  4WXD A;  3GX4 X;  2ELH A;  3QPT A;  1X3U A;  1IF1 A;  4ESJ A;  2ZXJ A;  4EVI A;  4CZZ A;  1XGM A;  2G9W A;  2MD5 A;  4ESF A;  3RJP A;  2XRN A;  4CO8 A;  3IKT A;  2C6Y A;  4IHT A;  1TW2 A;  1P6R A;  5D4R A;  4LK0 F;  3DPT A;  1SD4 A;  5KVR A;  3ZMS A;  5ICE A;  1BIB A;  3V8K A;  3F8B A;  2BYV E;  5CLS A;  2CGP A;  4AIJ A;  2RN7 A;  3WTX C;  5CVR A;  1XSD A;  4FX4 A;  3EYY A;  4EM0 B;  3TOB A;  3L7W A;  2ZBK A;  5D5W B;  3E97 A;  2J5P A;  3E6B A;  5CVV A;  4LLN A;  4LG0 A;  3KFW X;  3DPL C;  3MWM A;  3N97 A;  1Z7U A;  2BGC A;  3CUO A;  1OYY A;  5DCM B;  3WE3 A;  5E20 A;  1IUY A;  2YR2 A;  5L3D A;  5CVU A;  3F6O A;  2VE9 A;  5IT9 K;  4WXC A;  3RKY A;  2ESN A;  4S04 A;  3HHH A;  2L54 A;  2Z33 A;  2P5K A;  4HX7 A;  3G3Z A;  2O6G E;  4MNU A;  1XCV A;  2EV6 A;  2M87 A;  2QZ8 A;  3O3K A;  4PZJ A;  4R1H A;  2DO7 A;  3B73 A;  2JRT A;  1PP7 U;  4RGX A;  4OIN F;  1R23 A;  2LF7 A;  1B6A A;  4Y17 A;  2OA4 A;  2OQR A;  2GIV A;  2VON A;  2HFH A;  4HOB A;  4LMY A;  4LLG F;  2VBZ A;  1P4X A;  4N0B A;  3CUQ A;  1ZAO A;  2PEX A;  5JVT A;  2B0L A;  1FSH A;  2YSR A;  2PQ8 A;  1XDU A;  5CVI A;  3I5U A;  4BH9 A;  3WTT C;  3HIF A;  2STT A;  2VOD A;  5LRS A;  1H9T A;  5FFX A;  1W7P B;  2ZNZ A;  5E1Z B;  4XBF A;  4KNY A;  3BP8 A;  4ETS A;  4G7Z F;  1IN8 A;  3M8F A;  5DUI A;  4IRH A;  2PMH A;  1R1U A;  3FWE A;  1QZZ A;  3L2C A;  1S6L A;  3V7C A;  1TW3 A;  2ISZ A;  3BWG A;  3JTG A;  1T38 A;  3WTZ A;  6PAX A;  3PFI A;  5K5O A;  2GXG A;  4ZYG A;  1RZ4 A;  1QBJ A;  3F8F A;  4HX8 A;  3F23 A;  3ECO A;  2DQR A;  3RIR A;  3GVA A;  3GF2 A;  4KT5 C;  2K7L A;  1S3J A;  2EFW A;  2KJC A;  4IPA A;  2W25 A;  4HQE A;  1UFM A;  4OIQ F;  2FEZ A;  1I1S A;  4EQQ A;  3VOE A;  2RQP A;  2MH2 A;  1GXP A;  4UXN A;  3IHU A;  4P5O A;  3RPQ A;  1BI3 A;  3VOD A;  2RVC A;  2F5D A;  1W5S A;  1SD5 A;  1P2F A;  2HGC A;  2XKO A;  3KEO A;  2NRA C;  3SQN A;  3SHF A;  1S7A A;  1HBX G;  4L9J A;  4HLY A;  2QQB A;  4A6D A;  1IXC A;  2F5F A;  1DP7 P;  4IXA A;  2V79 A;  5K5Q A;  5J8C A;  1J9I A;  1D5V A;  2ZNY A;  4EM1 A;  3H3U A;  1L0O C;  1QPM A;  2A6H F;  1F5T A;  3I59 A;  4M72 A;  3L9F A;  2QQ9 A;  4G9Y A;  1WSU A;  1REP C;  3RKX A;  1FT9 A;  4GXO A;  2O3F A;  2P7C B;  1LJ9 A;  3COA C;  3KZY A;  4ENN A;  1XGO A;  2D45 A;  2VN2 A;  2CW0 F;  2IPQ X;  4KFC A;  4KIB A;  2RKH A;  5K5R A;  2ISY A;  4HDV A;  3Q9V A;  1YW9 A;  2FBK A;  3TKY A;  3ABU A;  1IN5 A;  3IWF A;  1U6G A;  4RB3 C;  2Q0O A;  4KUM A;  3J81 K;  1ZRE A;  2EFN A;  2L3D A;  3TGN A;  3GXO A;  2ADU A;  3FXU A;  2FOK A;  4EM2 A;  3K1N A;  3T0Y A;  1LDK B;  1MDM B;  2P4W A;  1LEA A;  1E2X A;  4OMY A;  2DW4 A;  1BJA A;  4O5V A;  2FRH A;  3WTY C;  2ESH A;  5E18 F;  2DU9 A;  3PQK A;  5HS9 A;  3WG9 A;  2RNJ A;  1TBX A;  2VOP A;  2JT1 A;  4ESB A;  1JXS A;  4CIC A;  1R1T A;  4MTE A;  3W6K B;  2HQN A;  4P96 A;  1ZGJ A;  1MD0 A;  4I7H A;  5AIQ A;  5H6Q A;  4G6D A;  5FD6 A;  3IRR A;  3DEU A;  3LA2 A;  4H0E A;  4JQF A;  4XLP F;  2MC3 A;  1I27 A;  3TQN A;  2XAQ A;  4I98 B;  3V7S A;  1D3Y A;  2MLG A;  1T39 A;  3E6M A;  3O2P E;  2M5W A;  2XIG A;  4HAM A;  3ZMD A;  4G6Q A;  1D8K A;  1Z05 A;  4L0Y B;  2LSO A;  1YFH A;  2XVC A;  4IHS A;  3KEQ A;  1IAW A;  5FB2 A;  4RGU A;  3C7J A;  2NNY A;  3RTR A;  5E1W A;  3M8E A;  2JZY A;  4M6Y A;  3LWF A;  4KMU X;  1PDN C;  2R3S A;  3NRV A;  3MQ0 A;  4ZYH A;  4A0Z A;  1LVA A;  4OIO F;  2HYF A;  3KLN A;  2A68 F;  1ZRD A;  4RAZ A;  1U8R A;  3L00 A;  1TNS A;  4P9U A;  2OU2 A;  2H94 A;  5AON A;  4QWQ A;  4HQM A;  1T98 A;  1F1Z A;  2W85 A;  1K78 A;  5LHH A;  1ODD A;  2D1H A;  1ZG1 A;  1ZRC A;  1ZAR A;  3KP2 A;  3CJN A;  2F5E A;  4WXH A;  1XCB A;  3HYI A;  4ZZD A;  2E1N A;  5L3B A;  2YU3 A;  1LB2 A;  1O57 A;  4DNC A;  2AS5 F;  2ZME A;  2IT0 A;  4CHU A;  3P9C A;  4LFU A;  5L3F A;  4A0X A;  3SFZ A;  3S2W A;  1KQ9 A;  4Z2Y A;  3I0T A;  1Z9C A;  4MEX F;  2HTS A;  3BPX A;  3R61 A;  3EYI A;  2QWW A;  2QLZ A;  1ZG3 A;  4DQ2 A;  1U5T B;  1Z1D A;  4LLL A;  1IXR C;  3TO9 A;  2GQQ A;  3HSR A;  4F7Z A;  1GHC A;  2Z3Y A;  2DTR A;  4U7D A;  3FXR A;  5DD8 A;  3I59 B;  2DBB A;  1H9G A;  2GA1 A;  4S05 A;  2RC4 A;  1SAX A;  3FMQ A;  2PN6 A;  2DAO A;  3V4G A;  2PG4 A;  4FT8 A;  2EA2 A;  2NS0 A;  3SXY A;  1ZG5 A;  4M71 A;  1F9N A;  3DV8 A;  1UHM A;  3EET A;  2IA2 A;  3KCC A;  4L9N A;  2BEO A;  1LEB A;  1IN6 A;  2OBP A;  1FSE A;  3ABT A;  4PCQ A;  1BBY A;  3HRS A;  3RKW A;  4WK8 F;  1FBS A;  2DPD A;  4A6E A;  1BM9 A;  3AAF A;  1FC3 A;  4A2U A;  1MKM A;  3DQV C;  1V3F A;  4RB1 A;  3T8R A;  2QM3 A;  3JTH A;  2EWN A;  3JW4 A;  3HSE A;  3O6B B;  1KYZ A;  3VEP A;  4FX0 A;  1H0M A;  4E70 A;  3GEZ A;  2PLY A;  2CG4 A;  2OZ6 A;  1FYM A;  3LAP A;  2UXN A;  2UWM A;  2YX7 A;  1R1V A;  2XUB A;  2Y0M A;  3QU3 A;  2EB7 A;  1LNW A;  4HLX A;  4HW0 A;  2NYX A;  2HZT A;  1KU3 A;  3JSO A;  2X0L A;  3M9A A;  1KYW A;  4MHG A;  4UUV A;  2IVM A;  4KA4 A;  4ENM A;  3HRU A;  3DF8 A;  1DUX C;  4M6X A;  2WC2 A;  1R5G A;  1PP8 F;  1T6S A;  3BPV A;  3ELK A;  3EQL F;  2GWR A;  4CGZ A;  5DV5 A;  2XAG A;  3RPU A;  2GXB A;  5L3C A;  4YIF A;  5CJ9 A;  4EJW A;  2NAZ A;  1XN7 A;  3ML6 A;  1MJ9 A;  3J81 Z;  3I4P A;  4HF2 A;  3LQQ A;  4RB0 A;  1MJA A;  5LHI A;  3PQJ A;  2K02 A;  2G7H A;  3B02 A;  5FLX K;  5IT3 A;  3FM5 A;  5DUK A;  2CWE A;  1FYK A;  5ILS A;  1CF7 B;  5E8G A;  2Z9O A;  1L3L A;  4ON0 A;  1FWZ A;  1FBU A;  1Y0U A;  3KP3 A;  1F4K A;  3MZH A;  2O03 A;  4L5I A;  1RIO H;  2HWV A;  3NQO A;  2EFQ A;  5CYV A;  4U7B A;  1QQI A;  3M1E A;  4BQA A;  4FHT A;  3TDZ C;  5DDG A;  1GVJ A;  2CSO A;  4BYY A;  1SFE A;  4A0Y A;  2TDX A;  2PBI A;  1K78 B;  2MLK A;  2J5O A;  4ZYE A;  4LK1 F;  2V1U A;  1R58 A;  3MAJ A;  1I5Z A;  2KIU A;  1U3E M;  2YPR A;  2VC0 A;  2XAS A;  1FBQ A;  2ZME B;  1Q1H A;  1P4W A;  2EFO A;  3LA7 A;  2D2W A;  3KP5 A;  5BQT A;  3RYR A;  2P7V B;  1BC7 C;  4JK1 X;  2EV5 A;  3DFG A;  2IP2 A;  5JR3 A;  2EFP A;  1YQA A;  4OMZ A;  1W4M A;  5H6R A;  1XD7 A;  5D5V B;  2Q2E A;  3RDI A;  2QQA A;  1TQM A;  1U2W A;  4L0Z B;  1JE8 A;  5DCF A;  4Q48 A;  1B4A A;  3HOS A;  1ZYR F;  3C18 A;  3ZPL A;  3HUG A;  1KA8 A;  3V8J A;  2IA0 A;  1A04 A;  3WE2 A;  1R7J A;  2XV4 S;  2KRF A;  1FYL A;  1IZ1 A;  4XSX F;  4Q47 A;  1XSX A;  1QGP A;  3T1B A;  2P5V A;  5F1R A;  2W57 A;  5LLQ A;  4EGZ A;  1Z91 A;  2QVO A;  4G7O F;  2M1B A;  5HS7 A;  3ZMV A;  1UCR A;  3FHZ A;  3DKW A;  1IRG A;  2CQK A;  3WU0 A;  2COM A;  1LDJ A;  1XGS A;  3FF5 A;  4CXF A;  2V9V A;  3P9I A;  1I6X A;  2HYG D;  3GZ5 A;  3SZP A;  1MJB A;  1G6N A;  3WTV C;  4G7H F;  4OIP F;  4P55 A;  5ED4 A;  3U1D A;  2HKO A;  3D5L A;  3IC7 A;  4YFN F;  1EH7 A;  3E5U A;  4YFK F;  2FSW A;  3BOQ A;  3ROU A;  1SFX A;  2FE3 A;  1OYI A;  3HTS B;  4NB5 A;  2UZK A;  2P6T A;  5A2Q K;  1BOA A;  2Z5U A;  1XSV A;  2DPU A;  3GUD A;  4OIR F;  2K86 A;  4O3M A;  2VE8 A;  3N4M A;  2OAZ A;  4LG0 B;  1TNT A;  1J2X A;  2Y48 A;  1O3T A;  5BPI A;  4M9X A;  1SFU A;  3GFM A;  4MQV A;  3R6S A;  4I0B A;  1G4D A;  4WCG A;  3F3X A;  1W7P D;  1YLF A;  3WGI A;  1C0W A;  5K1Y A;  4PGH A;  1BI2 A;  2L4A A;  5FGM A;  3GZ6 A;  2KKO A;  3T5X A;  5EEH A;  2ZCW A;  2XRO A;  3R0J A;  2IJL A;  1ZN2 A;  1FPQ A;  5HDN A;  1FNN A;  3E3V A;  2HTJ A;  3HTU A;  3ZMU A;  3F21 A;  2DQL A;  3U9G A;  4BHP A;  2KIF A;  4L18 B;  3K1M A;  1RNL A;  2XKP A;  4BXU A;  2M45 A;  3CUQ B;  4ZH4 F;  3RI4 A;  3ISP A;  2LF8 A;  2CFX A;  1ULY A;  5ICG A;  4XLN F;  2OD5 A;  2XAJ A;  3CO7 C;  5TRD A;  1O3R A;  4Y13 A;  5F6F A;  2EA4 A;  3VFZ A;  3SZT A;  4HV6 A;  1IXS B;  5D4S A;  2L01 A;  5TJJ A;  1UST A;  1QO0 D;  1BI1 A;  4AVP A;  4GYG A;  1OPC A;  5ICC A;  4LJZ F;  2DI3 A;  4EJV A;  4L9V A;  1HW5 A;  1HSJ A;  1STZ A;  4MQ9 F;  3HOT A;  4N9H A;  2W84 A;  2JSC A;  2FXA A;  5ICF A;  5H20 A;  2A07 F;  3FZV A;  4M74 A;  5E1X A;  3F72 A;  1HST A;  2FMY A;  2VXZ A;  3T8T A;  2HQR A;  3WTW C;  2GZW A;  5J8F A;  5J6X A;  2A61 A;  5FLX Z;  1W7P A;  3WU1 B;  2WTE A;  2PJP A;  1B59 A;  1HW2 A;  2E7X A;  5HLI A;  2VBY A;  2IRF G;  4HYE A;  3IRQ A;  1FOK A;  1MZB A;  3NEU A;  5E8I A;  3J80 K;  2XAF A;  4EV0 A;  1ZLJ A;  4KN7 X;  2BV6 A;  5AIP A;  2H6C A;  5ILU A;  2FML A;  4A5M A;  2UXX A;  3CO6 C;  1K7A A;  3CLO A;  3IWZ A;  3QP5 A;  3KP7 A;  2LKP A;  1KU7 A;  1XDS A;  3P9K A;  4RGR A;  4YG2 F;  2CYY A;  1UB9 A;  2HEO A;  1FP2 A;  3BJ6 A;  2FF4 A;  4BAY A;  1LDD A;  1O3Q A;  4HF0 A;  1ON1 A;  1EH8 A;  3H3Z A;  1J75 A;  1DPU A;  5DD4 A;  4U88 A;  1Z6R A;  4I02 A;  1E17 A;  3HSF A;  5HS8 A;  2QEN A;  5D6E A;  3FMS A;  4HA8 A;  3ECH A;  5FO5 A;  1KU9 A;  3QOP A;  4IRI A;  4B8X A;  1D8J A;  1KQ0 A;  4N9I A;  2L4M A;  5HOO A;  2H09 A;  3GFL A;  5D8L B;  2DK8 A;  2VT3 A;  2ZFW A;  3ZMT A;  1B9N A;  2AXL A;  2K4B A;  2EK5 A;  4D0P A;  3I58 A;  2XHK A;  3F8C A;  3GW2 A;  2FA5 A;  5HVQ C;  3EUH A;  2OZU A;  4A12 A;  1ON2 A;  1HKQ A;  3TO7 A;  4UV9 A;  2MH9 A;  2DK5 A;  3OOP A;  3BRO A;  5D5U B;  3FX3 A;  3KZZ A;  2HKX A;  1U5T C;  1VTN C;  3CDH A;  4RS8 A;  3FXQ A;  4GO1 A;  5E17 F;  4EMS A;  1MGT A;  4ENK A;  2ETH A;  2HR3 A;  2O0Y A;  4XSZ F;  2RGV A;  3G73 A;  3ULQ B;  3I71 A;  4BNC A;  5JI6 A;  3TO6 A;  1BIA A;  2PMU A;  1XMA A;  1J0R A;  4YFX F;  2PFB A;  1SD6 A;  4BHB A;  4L9T A;  2H6B A;  2ZJ2 A;  2LNB A;  3GLX A;  3R4K A;  4Y15 A;  2E7W A;  2Q8K A;  5HLG A;  3KP4 A;  1HW1 A;  1MDM A;  5BOX A;  3V8L A;  2E1C A;  4HBL A;  1KU2 A;  2O61 A;  3HHG A;  3Q5F A;  3DP7 A;  1HKS A;  5LRR A;  1ZHF A;  3RYP A;  1JHH A;  4KYW A;  5ILV A;  2QBY A;  1K79 A;  1EV7 A;  2DFI A;  2A6E F;  4EJU A;  5EEG A;  5A2Q Z;  2WWY A;  2VC1 A;  4LB6 B;  1G3W A;  4EJT A;  2EV0 A;  4XRF A;  2V1X A;  4RGS A;  2OQG A;  3F22 A;  4OU0 A;  3LFK A;  1OMI A;  1AOY A;  1YW7 A;  4TV7 A;  1OKR A;  2GAU A;  2KIM A;  3M7G A;  1G3S A;  5DEQ A;  3TOA A;  1R22 A;  4RAY A;  4G8X A;  3WTU C;  1YTY A;  4NHJ A;  4MTD A;  2LDU A;  3LST A;  1R36 A;  1GXQ A;  1BC8 C;  1WI9 A;  4LD5 A;  1FX7 A;  4Q4Z F;  2IA1 A;  4YII A;  3VB2 A;  4AIH A;  4CYD A;  1DPR A;  1I1G A;  1USS A;  3JAM K;  5FFZ A;  3HRT A;  4U0W A;  1IN4 A;  3MZY A;  1RI7 A;  3WGH A;  3IL2 A;  1QZY A;  2DLL A;  2WV0 A;  1SMT A;  3F8N A;  1XGN A;  1IN7 A;  3CTA A;  4HDU A;  3QRF F;  1RUN A;  2JPC A;  3FM3 A;  3F8M A;  5L3G A;  1ZRF A;  1BI0 A;  3KP6 A;  2H27 A;  1FZP B;  2FNA A;  1YIO A;  3GO5 A;  3LAJ A;  4U0V A;  2FBH A;  3MEX A;  4UHT A;  3KLO A;  4M9S A;  2XAH A;  4R8H A;  4I2O A;  4CDG A;  3HRM A;  4KN4 X;  3W6J B;  4A5N A;  4WX9 A;  2JTV A;  2M8E A;  2HDC A;  3R60 A;  3F6V A;  3EDP A;  3KET A;  2QYO A;  5D8K B;  4I01 A;  2A69 F;  1NHA A;  3KE2 A;  4UVB A;  3ZP5 A;  3E5X A;  1PUE E;  1U5T A;  4OOI A;  1S29 A;  2F5C A;  5JFR A;  4PGG A;  5LGN A;  3BZ6 A;  5HDK A;  1S8N A;  1B1B A;  5D6F A;  3GFI A;  4ASN A;  1R5H A;  2YX4 A;  3C1D A;  3IKV A;  1ZH5 A;  4IVN A;  2VBX A;  5BMZ A;  4EJO A;  4QLC U;  3ZMZ A;  3J80 Z;  4JBA A;  2VOO A;  3MCZ A;  2VBW A;  4GCV A;  3GWZ A;  2JPB A;  4LGW A;  4HX4 A;  4R79 A;  2MA3 A;  4AWX B;  3ZQ7 A;  2STW A;  3BY6 A;  3JSP A;  1WWX A;  3K9T A;  3K2Z A;  1J7K A;  4UNO A;  1JGS A;  4L5J A;  2ACJ A;  3V7R A;  2FBI A;  1YW8 A;  3DXJ F;  5LHG A;  3GYH X;  3I64 A;  1TTY A;  3E6C C;  3I54 A;  1IW7 F;  2EJR A;  3OV8 A;  2GA2 A;  3U2R A;  1JHF A;  5BS6 A;  1WQ2 A;  1HQC A;  4KIC A;  4RB2 C;  2Z99 A;  5JHU A;  4EGY A;  1BN5 A;  1YS6 A;  4M73 A;  1EH6 A;  4MGR A;  5LEK A;  4G94 A;  1HKT A;  1WRJ A;  1YG2 A;  4KIF A;  5ERI A;  4GGG A;  3WGG A;  5DYM A;  2QBY B;  4WF2 A;  3ERE D;  4AD9 A;  1P4A A;  2HOE A;  3TDU C;  1O7F A;  2P6S A;  4U0Y A;  1YO5 C;  1TQI A;  3J7A O;  3FMR A;  5DCM A;  3ZN1 A;  4IRG A;  4GYI A;  4KIG A;  4UVC A;  1FLI A;  3K0L A;  1U78 A;  3I53 A;  2VT2 A;  1ZLK A;  4ZZL A;  2DT5 A;  4P9F A;  3QPH A;  4IF4 A;  2D1V A;  1CGP A;  1K6O A;  4KDP A;  1Z6T A;  1LQ1 A;  4UV8 A;  4HV5 A;  4B09 A;  2A3S A;  1T0F A;  2G7U A;  5LEJ A;  2XGX A;  2Y75 A;  3WTS C;  2FU4 A;  4IJA A;  1O3S A;  2BBY A;  1YYV A;  1P92 A;  2RDP A;  2KJB A;  1J5Y A;  1IRF A;  3D0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...