3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
2QYOA 5HS7A 1F1ZA 2FSWA 1PDNC 1J6ZA 4OMYA 1MJAA 1WSUA 1DPRA 5F0XA 3IHUA 2QUFA 1F9NA 1SAZA 3D0SA 2O3FA 2F5EA 3L00A 3DKWA 1FSEA 4EM2A 2YJFA 2OD5A 1T6CA 4LLGF 1TQIA 1NGBA 3KEQA 4E70A 3ECOA 2P8TA 3NEUA 1Q18A 4ZH4F 2WTEA 1RDWX 3HUGA 3QBWA 3WG9A 2RQPA 3ULEA 2QWMA 3QP5A 1W7PB 4ZZLA 1NGJA 5CVIA 2P9LA 3I8BA 1DKGD 1XGMA 3E6BA 2XVCA 4NQWA 3VF4A 1KYZA 4MQVA 3FXUA 5J8FA 1JCFA 5TJJA 2FOKA 4XSZF 4KT5C 5E1XA 2E2PA 4M9XA 2EA4A 2A3SA 2BGCA 3JAMK 3H92A 2GTDA 3MK6A 5HVQC 5JICA 3U9GA 3QPTA 2KRFA 3KP6A 2FA5A 3MN5A 5BN9A 3F8NA 3R60A 3RDIA 1P4XA 4LLLA 1R1TA 3RI4A 1KXPA 5AIPA 2EA2A 1XC3A 4MHGA 2LF8A 2RV8A 3DFGA 3PQJA 1TQMA 1AOYA 1ULYA 3I4PA 3FR0A 4BVOA 4L9TA 2DW4A 3GG4A 4LGWA 1RNLA 2K4BA 2QENA 5IT9Z 3R6MA 2L3DA 2K27A 4RB0A 4YIFA 1MWKA 3OV8A 5AR0A 3D7EO 5AZJA 3V8KA 1RFQA 4WXDA 3VPZA 1BOTO 4CBXA 3KZYA 4HQMA 1I1SA 1L0OC 3O8MA 3V7RA 2GWRA 4M63C 5AQJA 2KJCA 3VOEA 3VEWA 2K7LA 4BROA 4EGYA 4A5MA 4ZYHA 5H6RA 1BI2A 4FWSA 4NO7A 1S7AA 5AQPA 3FXQA 5LHHA 5LRRA 1BJAA 4QLCU 3HTVA 2NNNA 3FXRA 3K1PA 4BC3A 2P6TA 4FWQA 1T44A 3ZMZA 4CZLA 2ZNYA 1C0GA 3WTZA 4HYEA 1TUYA 3CQYA 5EY4A 2ISZA 4I7HA 1J7KA 5FLXK 3U1DA 4EM0B 4BRIA 3F8FA 3W6JB 2HYFA 2BTFA 3IFRA 3VESA 4Y13A 3EQLF 1Z05A 1T0FA 6PAXA 3I0TA 2DI3A 3F72A 4M74A 2GAUA 2QM1A 3MEXA 5DCFA 5FFZA 4L0ZB 3WTWC 2IJLA 5IT3A 1R59O 2FXUA 1J9IA 1B1BA 5E84A 2FF4A 4ENJA 2EWSA 2KJBA 3ENOA 4HA8A 1ESVA 5LGUA 3D2EA 2P5KA 2CGLA 4BGAA 1HPMA 2VONA 2OQRA 3QDKA 4JQFA 2K02A 2PLYA 1BN5A 5AQWA 4O3MA 5DDGA 4OU0A 2CH5A 1HKSA 5CVUA 4P9UA 1BBYA 2D0PA 2DU9A 1NBWA 1YVNA 4B1WB 2A6HF 4RTFD 2GZWA 2MA3A 5BRHA 2R7FA 5KQ8A 4PL7A 4P55A 1S3XA 2W40A 3KE2A 1BI0A 3UKUB 2Q97A 3E97A 3IDHA 4BR5A 3GYHX 1P4WA 4YG2F 2CFXA 1Z6TA 1Y0UA 3KZBA 3HI0A 4NB4A 4XH5A 3C7NB 5A2QK 4IVNA 1K7AA 1YAGA 1NGCA 5D4SA 1RUNA 2E7WA 2MC3A 4DNCA 4ZYDA 1FOKA 2JPBA 4D0PA 4BREA 3WTSC 3E6DA 4K42A 1KU7A 2P7VB 2HQNA 2P9IA 2V51B 4KBOA 2P9PA 5JLFA 1FBUA 1IXSB 3ZQ7A 3VEXA 2IP2A 1SD6A 1LNWA 3H6EA 3D5LA 2R7DA 1GLLO 4A0YA 2A3ZA 2XIGA 4N9IA 1P6RA 1RIOH 2FE3A 2E1YA 5TRDA 4M9SA 1D5VA 2PMHA 3WTUC 1H9GA 3BEXA 3F8CA 5AQUA 3O80A 2DPNA 4HWIA 3RSEB 5BPNA 5LGNA 5LEJA 4PZJA 1S29A 4C23A 4RGRA 1LDJA 5FD6A 4LK0F 2AA4A 3KEOA 3KP4A 1LCUA 4CZJA 2XAHA 3ATUA 1B4AA 3SXYA 3BP8A 3V7CA 4UNOA 5L3FA 3JSPA 2NRAC 3C0BA 3WE3A 3FZLA 3D2FA 4ESFA 5LHIA 2LF7A 3HRMA 5ICFA 5BPMA 1FC3A 3AY9A 4WXHA 1SAXA 3RYPA 1GLEG 1X3UA 5AONA 1KQ9A 1KGSA 4BXUA 2GWKA 4ZYEA 5FGMA 5BPDA 4WF2A 4CBUA 3FMSA 3GFIA 4M6YA 4ISFA 2DFIA 2QWRA 4DCHA 2L01A 3FE1A 1U5TC 4MLHA 1S6LA 4XEIA 3J80Z 3F3XA 4CYDA 4EJVA 3DXMA 3KP5A 3W3DA 1OYYA 5BPIA 2GXBA 3IL2A 3H3OB 1LJ9A 1J5YA 3O08A 4YIIA 1QQOA 4WQ4C 4A0XA 4BC2A 4CXFA 2HR3A 4A6EA 1T98A 2HOEA 1O3QA 2XGXA 3TQNA 2ESNA 2QWLA 2EK5A 4BC4A 2A6EF 4LG0B 3CJBA 4KYWA 3PQKA 2EB7A 2J5PA 3T8RA 3WTTC 5F2RA 2L02A 3TDZC 1GLCG 3E5QA 3BUZB 1O7FA 4JD2B 2FBHA 1IN5A 4KN4X 5EX5A 2GELA 5L3BA 2P9SB 1Q1HA 1TW3A 3HSEA 1XMAA 3L2CA 1G3TA 2ADUA 1ATSA 3TOAA 4M72A 2A61A 1U8RA 1NHAA 1U6GA 1GLDG 4HX4A 3HSCA 5E1ZB 4RWTA 2EFQA 3I58A 3WEEB 3C3WA 2YHXA 1IXCA 3H46O 2FSJA 3IWFA 4AVPA 3VB2A 1NLVA 2HEOA 3EKUA 2EV0A 1UHMA 2NS0A 1HKGA 2Z3YA 1RI7A 3GF2A 3R61A 4KIFA 2RNJA 1STZA 3FX3A 1PUEE 3LA2A 1J75A 1NGIA 2JPCA 4U88A 2WUSA 1NGAA 3UKRA 4G94A 1CF7B 3HYIA 3QMLA 5DCMB 3CUOA 5BOXA 1QNTA 1YG2A 2V1XA 2P7CB 4XH1A 4RGSA 3VEYA 3IWZA 2ZMEB 2E88A 3F6VA 4CICA 1HX1A 1IG8A 4BRQA 1QQNA 2D2WA 2ELHA 2IPQX 2CW0F 1I27A 3I64A 4FWPA 2H6BA 2EV5A 3KHYA 4ZZDA 2DT5A 1B59A 3BPXA 1RZ4A 2MD5A 1DUXC 3ZMDA 3E6CC 2W25A 3WQTA 2QVOA 3G25A 3KVGA 3HZ6A 1QO0D 2BE5F 2CO5A 1Y64A 2Q2RA 2E1ZA 1KA8A 4ENNA 2YPRA 4MGRA 4HV6A 2EWNA 3BWGA 1HXDA 2RC4A 1HW2A 2STWA 3GBTA 3R9PA 2AS5F 3JXUA 1NM1A 1KU3A 3ML6A 4PKIA 5ED4A 5DD4A 2EV6A 4FWOA 3O6BB 4O8KA 2QQ9A 1FZPB 3ROUA 3CUQC 4H0TB 5BMZA 5BRFA 4B1VA 2ASOA 1T6DA 3ZN0A 2O61A 2ETHA 5KPTA 1ZAOA 2IVNA 2F5CA 2QWOA 2QQBA 4BRLA 5CLSA 2NZTA 2IT0A 3JW4A 2OZ6A 3BJAA 4WCGA 4H5WA 3B73A 3V8LA 4DB3A 1QGPA 1FYLA 3R4KA 2Y48A 1NGEA 4MO4A 1G3SA 2O0YA 3L9FA 2FMLA 1K8KA 1XGSA 5E1WA 2P9KA 4BRDA 1R7JA 4YFXF 5EEHA 1Z91A 3SMSA 2ZGZA 3ZETA 1ZRDA 2W57A 4Q5SF 3GZ5A 2I7PA 1V3FA 3O2PE 2R3SA 5HDKA 1IF1A 3QFPA 2PQ8A 1G3WA 3J81K 3CIPA 3A5OC 2YHYA 5AQIA 3ZMUA 4H5VA 3FM3A 2QWQA 1BI1A 3H3NO 1FBQA 3GDQA 5BREA 2OANA 4ENMA 3BY6A 4OMZA 1EV7A 2H6CA 3V8JA 1VTNC 2DPUA 1TYQB 2RDPA 4JK1X 1IAWA 3DXKA 3QOPA 3IRQA 4QS8A 3DV8A 3GFLA 3AARA 4A61A 4EFHA 3GO5A 1ZLJA 2D45A 1P4AA 2ZBKA 2GWJA 4IXCA 2Q0RA 4XRFA 5LJWA 3LDLA 2KIUA 3EUHA 3F8BA 5HS9A 2X4HA 3VEPA 5AQGA 1EQYA 3FZVA 2JSCA 4IRIA 2V9VA 5AQOA 2O03A 1YW7A 2YCHA 5CVRA 2DBBA 2Q8KA 3ULEB 3P9CA 2P9LB 4ENKA 3CI5A 3VEVA 4JAXA 3LSTA 1IXRC 4BHCA 5D8KB 3VGKA 3WXIA 3L6QA 2D1KA 3WGGA 2FRHA 3S2WA 2P9NA 1SD5A 2CGJA 2E8AA 3F9MA 4HV5A 1H9TA 4H0YB 4HF0A 4BRMA 5AZIA 4UVAA 1H1VA 2HZTA 3QFUA 4BRCA 4B1XB 3GL1A 4IPAA 4OIRF 2OBPA 1JXSA 3U8XA 2FBIA 2LSOA 3CJNA 3ULQB 1FP2A 2XAFA 5D5XB 4UUVA 5KVRA 4BC5A 3VEZA 4LD5A 3DPLC 4BRAA 4M7YA 3BOQA 3Q5FA 3EN9A 1T39A 4IHTA 2FF6A 2GUPA 3WXJA 1ATRA 2F5FA 4I02A 4N9HA 1BI3A 4IRGA 4I0AA 4FWKA 1W7PD 5AZJB 3E5UA 3VERA 1Z6RA 3VETA 4MLEA 3HOTA 5D5VB 1EH7A 2J5OA 1B9NA 2ZGYA 2ISYA 1ZREA 4BRGA 4HAMA 5LRSA 4LB5A 1FNNA 1PP8F 3FZKA 4L5JA 4WK8F 4AWXB 3VOVA 3WXLA 3I59A 4B1YB 4EJWA 2IVPA 3BZ6A 4RCHA 1HUXA 4PCQA 2DAOA 4RGUA 2FBKA 2V79A 2GIVA 2DPDA 4HLYA 5F6FA 2XRNA 1IUYA 1TQPA 1XB4A 1I5ZA 2VBWA 3M7GA 3J8AA 2ZJ2A 1TUUA 1O57A 1BC7C 1I1GA 2CGPA 2GEMA 4WXCA 2FF3B 5J8CA 3VGMA 4GO1A 5HLGA 2W84A 4UVBA 2KHOA 2WWYA 4XBFA 3FMRA 4BR0A 1R5HA 1YIOA 3HBTA 4BQAA 4CGZA 4BGBA 3GXOA 5JHUA 3TO9A 3DWLA 4BRKA 2CWEA 5D6EA 2EFWA 4FWNA 3UE5A 4LMYA 2QZ8A 3TKYA 2NRHA 4KMUX 3IC7A 2PG4A 2K4JA 3MFKA 4MTEA 2FLOA 5ICCA 1MD0A 2ZKZA 1DDNA 3T8TA 3D2EB 4F7ZA 3JS6A 3WQUA 3ZX2A 3MZYA 4HX7A 3I71A 4ESJA 1USSA 5AQVA 5CVVA 3E3VA 2QQAA 1GXPA 3GOIA 2OQGA 1IN7A 5AQKA 1REPC 3ATVA 5AQHA 1ZHFA 4G8XA 2E7XA 2P5LC 1NGHA 1MJBA 3HOSA 4BR2A 5AFUA 1BUPA 1D8KA 4M73A 3DXJF 1GLFO 3H1VX 1QQMA 4ESBA 3HHHA 3NQOA 1IW7F 2CQKA 2PMUA 3M9AA 2FU4A 3REOA 2A42A 3CLOA 2MLGA 1SFEA 2YHWA 3EL2A 1OKJA 4B1ZA 3CJ1A 5HDNA 1O3SA 4QS9A 4P5OA 1K79A 3B02A 4XH4A 1LOTB 2W41A 3VENA 4ON0A 5LLQA 1IRFA 3HTUA 3S41A 1QQIA 4FX4A 5JLHA 4CD1A 3U9DA 5JR3A 3R8EA 4HBLA 3CHWA 4RAYA 3TO6A 2VT2A 4BAYA 1S8NA 1ZBSA 1YO5C 2EFNA 3JAMZ 2YJEA 1R36A 5KPZA 3GFMA 1XGOA 2P9IB 1BA0A 2P9PB 4FX0A 5DUKA 1WWXA 3MN7A 5ADXH 5E20A 1LEBA 4BQLA 5ILSA 2MBFA 3BJOA 3HRSA 1RUOA 2V52B 3F23A 2KKOA 1FYKA 2Q31A 5E26A 2IA2A 3ABTA 1ZRCA 3FLCO 1U5TA 3LWFA 5ILVA 3LQRA 3IRRA 3ZP5A 2JTVA 4EM1A 3HTSB 4A0ZA 1SFUA 4G7HF 1SD7A 1XDUA 1G3YA 1T6SA 1YUWA 4HF2A 5EVZA 1R5GA 4L9JA 3RJPA 2EJRA 5FPMA 4WQ4A 2L4MA 5FD5A 2P9UA 3VEOA 5FPDA 2KIFA 2FNAA 4FOIA 2V1DA 2GQQA 4EMSA 1G99A 3D2FB 4BNCA 1IRGA 1B9MA 1YQAA 4UXNA 4IJAA 3L7WA 4H5NA 1A04A 2NNYA 3H3ZA 5HLIA 2ACJA 3LDNA 3AAQA 1XCVA 2G7UA 5DUIA 3SZTA 4OOIA 5FLXZ 1ON2A 2HTSA 2DK5A 4CHUA 5BRDA 3SQNA 5KPRA 4CZIA 3SHFA 2Q0OA 3DXMB 4FPAA 2XAJA 2MLKA 3LDPA 5D5UB 4I6MA 4F9OA 2VOPA 2QWPA 2ZNZA 3W0LA 5ERIA 4JHDA 4I98B 1ODDA 2XKOA 2XAQA 2OAZA 3GEZA 1F5TA 2Z9OA 5F64A 1S3JA 3LFKA 5AQTA 2V1UA 2QLZA 3COAC 5AQFA 2HF3A 2L4AA 4ISEA 2P4WA 4FL9A 3Q9VA 4GYGA 1LEAA 2I7NA 3GLXA 3LM9A 3CQXA 5CYVA 1IZ1A 1YFHA 2FMYA 3DAWA 2HKOA 2Y75A 2D0OA 1OKRA 4Z94A 3RIRA 1MDMA 1U6ZA 4L5IA 4CZFA 3H1QA 1NGDA 5B8HA 4FO0A 3WU1B 2Q36A 4BRPA 5HLHA 3ZEUB 4BG9A 2CG4A 4HTLA 2D4WA 3VF2A 4Z2YA 2VC0A 1BWFO 2RGVA 5FB2A 3SFZA 3O6WA 2RKHA 1C0WA 4DQ2A 2FXAA 1WRJA 4Q48A 1ZN2A 4GY2B 1XSXA 3KLNA 2FEZA 1G6NA 2BUPA 1MDUB 5A2QZ 2XAGA 2FNPA 4UHTA 3WU0A 2GA2A 3U2RA 3I53A 3UKRB 5K5OA 4PKHA 4Y15A 4S05A 2XHKA 3RTRA 1BO5O 3UB5A 3P4IA 3MQ0A 5ICGA 1HLUA 1QBJA 4DQ8A 2HTJA 2NAZA 4LLNA 5DEQA 4UV9A 1YS6A 1BIAA 2DLLA 3CUQA 5AQRA 3FFKB 5AQZA 2STTA 2H94A 4O6JA 2V7YA 5LY3A 4LB6B 4MEYF 5D8LB 1Z9CA 3AAPA 5FPNA 4FPBA 1PP7U 1HW1A 1BIBA 5BPLA 3WUHA 4CZMA 5J6XA 1X3MA 4LC9B 1GLBG 3K9TA 1R22A 4G7OF 1WOQA 1BM9A 3EDPA 2W85A 2EFOA 4NB5A 1ZARA 2UXXA 5FPEA 4L9VA 3RPUA 3LQQA 5K5RA 3FMQA 4L9NA 2YR2A 1JCGA 5LGTA 2YX4A 5DV5A 5F1RA 1KU9A 2WC2A 4WYBA 1W4MA 3KFWX 4A12A 2IIRA 1LDDA 5IT9K 2E2NA 2JRTA 2XKPA 3K69A 5D4RA 1W5SA 2FQ3A 4R79A 4RS8A 3AAFA 1K78A 3LL3A 2LDUA 5BQTA 1CZAN 3QP6A 1KAYA 2VCPA 1XMKA 1ZXOA 1R00A 2ZF5O 4KIBA 1HKTA 5TKYA 5AQNA 1TNSA 2RVCA 2HWVA 1J0RA 5ICEA 4OIOF 2OZUA 3EETA 4KIGA 4OINF 5JVTA 4TV7A 1FX7A 1YLFA 2G9WA 1DPUA 3LDQA 4O5FA 2VWBA 1K8KB 2P9KB 4I0BA 4L0YB 3ZMTA 3ABUA 1X9JA 3QPHA 4CDGA 5DD8A 1H0MA 3I54A 4I01A 1BOAA 3I33A 3ZETB 2XUBA 1WKMA 2E1NA 1J59A 1P2FA 4O5VA 3DJCA 1YW9A 1HKCA 3H3UA 2QBYA 4G6QA 4WQ5C 3SLCA 1T2KA 1UB9A 1QZ6A 4E1JA 1LVAA 1DEJA 1ZLKA 2PBDA 2A40A 4RB1A 1V4TA 4BG8A 1NGFA 1BG3A 3SJHA 3VODA 2V6CA 1J2XA 4G9YA 1LB2A 4AIHA 4FOEA 4QS7A 3P9IA 1ZH5A 4HLXA 1E4FT 3M8FA 5E17F 5F1XA 4UV8A 3ID8A 3DXKB 1USTA 3ZMVA 1R1VA 2HQRA 1JE8A 2DO7A 1U2VA 4GNIA 3KP3A 5EEGA 1ZG5A 4EHUA 4LJZF 4HQEA 1MZBA 5AQQA 1ZGJA 1FWZA 1S7OA 4P9FA 4PGGA 2NYXA 1X3NA 4HW0A 2DQLA 3L0QA 3ENHA 4CI6A 2AXLA 4EJOA 4PL8A 2Z5UA 3VF6A 4BRNA 1YW8A 2GXGA 4KICA 3R6SA 2YX7A 3FM5A 3ERED 3O1BA 1LDKB 4CD3A 1XSVA 2A68F 1BDGA 3M1FA 2O8XA 3QU3A 3P7NA 1FYMA 2DK8A 5HOOA 2O6GE 1E4GT 5LEKA 3QICA 2LKPA 1W7PA 4EVIA 2P9NB 4IHSA 4JBAA 1ON1A 5AZIB 4CZKA 3CO6C 2A07F 3A5MC 4HX8A 3DEUA 3BJ6A 3KP2A 4OIQF 1GLJO 4DHYA 4IRHA 4U0WA 4B1UB 4GGGA 5ILUA 2PJPA 2BYVE 1IJJA 3MAJA 3HSRA 2H27A 3IKTA 1XCBA 4AM6A 3KP7A 4H0XB 4LFUA 1HSJA 3A8YA 1HQCA 4HOBA 1JGSA 1UHWA 1ZG1A 1V4SA 2E2QA 4BRHA 4PKGA 4BYYA 2UXNA 1TW2A 3DPTA 5L3CA 2VT3A 3FGUA 4AIJA 2VBXA 2E20A 2BEOA 1IN6A 3CETA 4KFCA 1DGKN 3F6OA 3I59B 1YS7A 1MWMA 3QB0A 3RKYA 1OPCA 4P96A 1YTYA 3ZX3A 3WXKA 4KNYA 3TGNA 1L3LA 3GW2A 2QXLA 1HKQA 2M1BA 1ONVA 4KN7X 5K1YA 5HS8A 4G6DA 3MN6A 2HMPA 3GWZA 3M8EA 5LHGA 3W6KB 3A0IX 3TO7A 4G7ZF 4M9ZA 4YFKF 3EO3A 4M7XA 4CBWA 3O4WA 1Z1DA 3VGLA 4Y17A 2QM3A 5CJ9A 4CZZA 1CGPA 1U2WA 3DP7A 3KZZA 2ASMA 1QPMA 3DF8A 3FHZA 2PN6A 3J80K 1WUAA 4KMFA 3CJ9A 3G3ZA 4UVCA 3MWMA 1JCEA 1TLHB 2XV4S 1HJOA 2L54A 1QZ5A 4RAZA 1BU6O 2IVOA 3FZFA 4H0PA 3J81Z 2VN2A 3FF5A 1SZ2A 1YYVA 4L18B 2IW5A 4M71A 4CZGA 3R0AA 4L3QA 1KQ0A 1R23A 3EYIA 2E2OA 1O3RA 2M5WA 2Y0MA 5L3GA 2IVMA 1D4XA 3A5LC 4B8XA 3GX4X 3IUCA 4K41A 3KETA 3JTHA 2VBZA 5CE3A 2HDCA 4ASNA 2F2EA 2JZYA 4GCVA 2F9TA 1FBSA 4MO5A 3GFJA 3Q9SA 4A6DA 3RYRA 3EKSA 4Q47A 4FWRA 3TDUC 3H45C 1XN7A 3WTXC 2A41A 3LA7A 1NGGA 4BQZA 1MA9B 2B0LA 2J4RA 2H09A 2QWNA 3K1MA 3E5XA 2D1HA 3F22A 3V4GA 1FLIA 4JN4A 3U9ZA 3O5BA 2Q1NA 4H0VB 3KCCA 1Z7UA 1HBXG 3UKUA 4PGHA 5FFXA 2YU3A 3LAJA 3WTYC 4AM7A 4IO8A 4BRFA 1TNTA 2W24A 3MCZA 5BS6A 4U0YA 2Z33A 3JTGA 3C7NA 3F21A 1D8JA 3O3KA 4AD9A 4I09A 4OIPF 1KYWA 4H03B 3MN9A 1WI9A 4FWMA 3HRUA 2VE9A 1KU2A 4U0VA 3C7JA 4FSVA 2VYPA 2UWMA 1XD7A 5FO5A 2C6YA 2PEXA 1HKBA 1SMYF 1GHCA 2M45A 3HM8A 1FY7A 4IJNA 1U5TB 4KDPA 3P9KA 2UZKA 2ZCWA 1UCRA 1D3YA 3QU6A 3M6GA 1ZRFA 3T5XA 2YSRA 4EHTA 3DQVC 3G73A 5EXWA 1B6AA 2XASA 3FZMA 3FWEA 3WGHA 1E2XA 4EAHD 1R1UA 5K5QA 4A62A 4IWVA 1U78A 5BR9A 2P9UB 3RSEA 4A5NA 2ZO4A 2LNBA 4CZEA 2QWWA 3SK3A 3BF3A 3WGIA 3HHGA 3J7AO 1FT9A 3ECHA 4MNUA 3T1BA 2MH9A 4EQQA 4EV0A 3RKXA 2UYTA 4K43A 1TTYA 1ZGAA 3BPVA 4BR7A 5JI6A 3OHRA 3ISPA 3V7SA 3RPQA 4A2BA 1ATNA 1IN4A 1W5TA 1QZZA 5AIQA 5I9EB 4AIKA 4Q4ZF 2JT1A 1MKMA 4B09A 4GXOA 4EGZA 3CDHA 3JSOA 1O3TA 5L3DA 3HIFA 1EH6A 4I6MB 3ZMSA 1BC8C 3GUDA 3OOPA 4RGXA 3CJCA 1S22A 4I2OA 1AWCA 2ZFWA 5D5WB 3KLOA 4JHDB 1ZC6A 5EOYA 1BA1A 2Q2EA 4EJUA 3LDOA 4WX9A 4HF1A 1O7LA 3ZPLA 2DTRA 4H0OA 4KA4A 1EH8A 4CJ7A 4U7DA 5E8IA 4K25A 2AP1A 2CH6A 3A5NC 5AQMA 1K6OA 4LG0A 1XQSC 3TOBA 4N0BA 1SD4A 2HS5A 3ZN1A 2IA1A 3SMPA 2ASPA 1SFXA 3ZX0A 4JD2A 3PFIA 2M30A 4FHTA 2PI0A 2P9SA 3TU5A 4FWLA 2ZWHA 3CTAA 1MDMB 3RKWA 2P5VA 4RB2C 1P8ZA 3T0YA 1GLAG 2Q0UA 3M1EA 3CERA 3WE2A 3I5UA 1TBXA 2TDXA 4KUMA 3WEEA 2GA1A 3L4IA 3EYYA 3LAPA 4MEXF 4H5RA 2HYGD 3CJ7A 2XROA 1XSDA 3ZEUA 4ZYGA 2ESHA 5AQSA 4H0EA 5AQYA 3K0LA 2VBYA 4XLNF 3LA3A 4QWQA 4YDUA 2BV6A 1XDSA 2F5DA 4B9QA 1DP7P 2K86A 2A5XA 3NRVA 1SMTA 5H20A 1UFMA 1F4KA 2RN7A 3WODF 4BHPA 1QZYA 2COMA 5L3EA 3MMVA 3M3ZA 2A5YB 3K2ZA 1OR7A 1CF7A 5HDGA 5DCMA 1NMDA 3F8MA 3BROA 1T38A 3CUQB 2HKXA 2WV0A 2ZMEA 4Y0WA 4R8HA 5AQLA 1SQKA 1FSHA 2HGCA 1FPQA 4ISGA 3CJAA 2YI1A 3LM2A 4BR4A 2E1CA 2A69F 5E18F 2DQRA 2G7HA 4ETSA 1IN8A 2VODA 1JHFA 3WTVC 1KQ8A 2HF4A 3K1NA 3SZPA 1JHHA 5KK1A 3BDDA 4YDUC 3IMXA 2OU2A 3B8AX 2QW9A 1GXQA 4M6XA 3HSFA 3EZWA 5ADXA 1YXQA 4XSXF 3ELKA 1R58A 4IF4A 1QHAA 4CO8A 2VC1A 2VOOA 5ELZA 5JMVA 3N4MA 1MGTA 2FSNA 4FT8A 4A2UA 2ITMA 3BF1A 2CYYA 2PFBA 2H3GX 2CSOA 1ZYRF 3E6MA 4WQ5A 2MH2A 5DYMA 1K78B 4U7BA 5LBQA 4BVPA 1KAXA 2F9WA 1P92A 4LK1F 4YFNF 3QRFF 3GE1A 2Z99A 3VFZA 2VE8A 4R1HA 1XUPO 2CGKA 5AQXA 4BHBA 5E8GA 3C1DA 4GYIA 2EFPA 2IRFG 1GVJA 1I6XA 2FSKA 3MDQA 1G4DA 4HDVA 2PBIA 2D1VA 1V4RA 4K2EA 5LJVA 1U3EM 2A6AA 4PDKA 4HZFA 2KIMA 2NLXA 3TPQA 2P6SA 4XLPF 2M8EA 5H6QA 4EIAA 3FZHA 5D6FA 4EJTA 3QBXA 4CZHA 3HRTA 4MQ9F 2OA4A 2QBYB 3CO7C 4JNEA 1E17A 3GVAA 1OYWA 4J8FA 5AFUH 2HFHA 2ZXJA 4BH9A 3MCPA 3IKVA 3MZHA 5KQDA 3U4LA 4A2AA 5JFRA 4MTDA 1FP1D 1OMIA 2IA0A 1XGNA 1LQ1A 4BR9A 5BN8A 2M87A 1OYIA 3O1WA 1WQ2A 5CVJA 4HDUA 3R0JA 3L09A 3N97A 3QAHA 4WWCA 1HSTA 1KAZA 1U2VB 2PAVA 2X0LA 2V7ZA 1HW5A 4IZ9A 4H5TA 3C18A 1MJ9A 1C0FA 2VXZA 1TYQA 4RB3C 1RGIA 4NHJA 4IXAA 1NWKA 1ZG3A 3GZ6A 3WT0A 4S04A 2BBYA
chains in the Genus database with same CATH superfamily
1PDNC 3DLBA 1F9NA 1W0TA 1SAZA 3L00A 3DKWA 1WBDA 3ECOA 1OH6A 2WTEA 3JAMO 4JI4K 1Z25A 3AVLA 3ULEA 1W7PB 1NGJA 1XGMA 1KYZA 1D9DA 4B9MA 4JV5K 2HDDA 4YOUA 1TL8A 2GTDA 3PIOF 5JS2A 3OSFA 2KRFA 1L3UA 3EUHC 3F8NA 1VQ7N 1P4XA 1FOWA 4TSXA 1EJ9A 4MHGA 1D0XA 4KH6A 3QEWA 1AOYA 4MLOA 3I4PA 3KD5E 3GG4A 4AF1A 4YIFA 3OV8A 1FEXA 3LSIA 1S6PA 2W4SA 4WXDA 1WHUA 4CBXA 3PX0A 3PJRA 1L0OC 4M63C 3UR3C 5FLXO 2K7LA 4BROA 4C3IJ 1MBHA 2WAEA 5H6RA 1BI2A 4FWSA 5GAGJ 3NH2A 5LHHA 5LRRA 2QTDA 2JK3A 4BC3A 4FWQA 3VN5A 3KIOA 5EY4A 2ISZA 1J7KA 3U1DA 4EM0B 2M9HA 4BRIA 3W6JB 2HYFA 3P31A 2W6KA 5EGOA 3VESA 4Y13A 3EQLF 1Z05A 3EPZA 3B6OA 2GAUA 2E2JJ 5FFZA 3WTWC 2DMNA 2KISA 1SUQA 5LGUA 1SC7A 4BGAA 3ASOH 4D7MA 2OQRA 2DY4A 3SPYA 2ZJQL 2K02A 5DDGA 2OTJI 1NJWA 3DLLL 3NGZA 2KL4A 4OAYA 3PV8A 5A2QO 1TL1A 4XICA 4UUSB 5BRHA 3MCAB 4PL7A 4MFDA 3KE2A 2PJRB 3GYHX 4BXXJ 2F7TA 4LSLA 2H1LA 2HOTA 4XH5A 1OCZH 2E2HJ 1Y8QB 1QA6A 3I56I 4IVNA 4RM3A 2E7WA 3HL8A 3DBRB 3E6DA 4F2SA 1WZ2A 1HNZK 1KU7A 2P7VB 2V51B 1HDDC 2P9PA 1ZKGA 5DM7F 1FBUA 1IXSB 3H6EA 4ICLA 3CZ6A 3CCLN 2E1YA 5TRDA 4M9SA 2BANA 2PMHA 1H9GA 3CMAN 2M2EA 1FOXA 3O80A 2VWKA 2CH0A 3RSEB 1M1EB 1ETKA 3DTIA 2ICWG 1LVKA 4C23A 4BQQA 4LK0F 3TAGA 2AA4A 5SZTA 3KEOA 2Z2SB 4CK2A 2XAHA 3V7CA 5FROA 3JSPA 3C0BA 3WE3A 1WJBA 3D2FA 5LHIA 2LF7A 4KH4A 3ZT3A 4ZYEA 4FLTA 4M6YA 2DFIA 4E7HA 4JKAA 1U5TC 2OPRA 1S6LA 4XEIA 3F3XA 1S1TA 4CYDA 3DXMA 2IS2A 3KP5A 1VRUA 3W3DA 3IRXA 4ID1A 2UXBK 1QQOA 4WQ4C 5GINA 2PMZN 2XGXA 2EK5A 4LG0B 1D8YA 2EB7A 1J5EK 2KHMA 3ZT2A 3CF2A 3WTTC 4W1UA 3QETA 5HODA 3EEQA 2DA4A 1O7FA 1IN5A 1N6QA 3T69A 2ZXWH 3MEDA 4CYCA 3O4NA 1X9WA 3L2CA 4ILJA 1G3TA 1YHQI 3TOAA 1Q82O 4FJMA 1VQOI 3CCEN 2OPQA 2VPLA 5GAGP 3EKUA 3HP6A 3GF2A 3R61A 1OCOH 1JTYA 2O8DB 1NK9A 2VPRA 5KGXA 2WUSA 4OAZA 1JKPC 1VQ6I 3HL2A 1YJNI 1NGAA 3TANA 2VG5A 3QMLA 3BTLA 5BOXA 4W5QA 2V1XA 2ZMEB 5J2MA 1LPQA 2OPTA 2QK9A 4BRQA 2VJ4A 2FD5A 1YF5L 4FLYA 4FWPA 2JVGA 4ZZDA 1NJZA 2DT5A 1B59A 3DTKA 3BPXA 3ZMDA 2JQ7A 2O7OA 2XB0X 2CO5A 3V42A 4ENNA 1NG6A 4HV6A 3BWGA 1NK8A 1HW2A 2STWA 1VSJA 2F4VK 3C95A 1NM1A 4KRFA 3ML6A 5ED4A 5DD4A 2EV6A 2IOCA 3O6BB 3SFIA 2IGKA 4B43A 3W2WA 3HG9A 2ASOA 1VAZA 5HRSA 2QWOA 1O4XA 2QQBA 4RW9A 3BR1A 5CLSA 1JKOC 1SV5A 2L0KA 2OZ6A 3BJAA 2WB1A 2BXYA 2JUCA 1QGPA 1NGEA 2Y48A 3J81O 2FMLA 4YFXF 1Z91A 3NF8A 3WNFA 1VI0A 4E7JA 1VQ5N 2E35A 2B6AA 2Q3SA 3UKGA 1V3FA 3ZT4A 1TK8A 4FCYA 2ETJA 1TC3C 4CJFA 3LSPA 1KFDA 3HJFA 1ETOA 4C2MJ 2YHYA 3ZMUA 3QQAA 1CQTA 3OR1C 1I3QJ 3FM3A 2QWQA 1LV5A 1FBQA 1WAFA 4PK4A 1TYQB 1ETVA 2RDPA 1IAWA 3QOPA 2CQQA 3GO5A 4CZCA 1NH3A 1ZLJA 2GWJA 5LJWA 4Z4IA 1BCMA 3EUHA 2VQGA 4QPOA 2OJED 2KW4A 4C2UA 1U4BA 4F52A 2X4HA 5DTDA 1YTAA 3U3YA 1EQYA 3NVMA 3FZVA 1MMGA 2O03A 3HUGB 2YCHA 2Q8KA 4ITVA 4JAXA 4M45A 3CMMA 4CH7A 3L6QA 2EZIA 2D1KA 1T08B 2V4JC 2CGJA 4HV5A 4AHSA 3HVTA 3QFUA 4PJLA 4BRCA 4IPAA 4OIRF 1JXSA 3U8XA 3CJNA 4WFAL 4UUVA 5KVRA 2NRRA 4UB6C 3BOQA 2DOEA 4IHTA 4W5OA 3T3FA 2OPSA 3AG3H 3CPWM 2YV0X 3RVCA 3CCUN 4DR2K 3TSPA 1RBSA 5E41A 1VQKN 5D5VB 2J5OA 2DXIA 4HAMA 5LRSA 1FNNA 3EZ5A 4ZYAA 4DBRA 2RKIA 2X6WA 4L5JA 3WXLA 2A1RA 2QKKA 2LK2A 3BZ6A 3MXJA 4BDPA 3P83D 2V79A 4XK4A 2M4KA 4CHQA 1XB4A 3M7GA 4DV6K 1BC7C 2GEMA 4WXCA 1ZQ3P 2NUBA 3AO3A 3LANA 5HLGA 4B3TK 5JHFA 3VQBA 3CMEN 3J7AP 4KT6A 4FWNA 4J2DA 2CQ7A 1E3OC 1HCRA 4FJ7A 3MFKA 3VQ7A 1MD0A 2ZKZA 3WQUA 4FW1A 1YI2N 3ZX2A 3MZYA 4HX7A 4ESJA 1FOYA 4E7SA 1GXPA 4N4NB 4WFNL 4KHNA 3GOIA 2OQGA 1ZYQA 5AQKA 1REPC 2A1SA 5AQHA 4JKCA 1MJBA 1BUPA 2X9DA 3I0RA 2P81A 1D8KA 4KHWA 1WH7A 3DXJF 1GLFO 2XO7A 3NARA 2BH1A 3CCQN 1IW7F 2PMUA 4J2BA 3CLOA 2MLGA 1SFEA 4B1ZA 3CJ1A 3K5OA 1O3SA 4QS9A 1K79A 4XH4A 4GKJK 4BY7J 4A5BA 1NTCA 3FXJA 3HXMA 4DV0K 3CHWA 3CG7A 4EEFG 3JAMZ 1R36A 2Y1IA 3WU2C 2P9IB 1QRYA 1HRHA 3ABKH 4M3GA 4FQGA 1TKDA 2WAQA 1TWAJ 5E20A 4BQLA 5ILSA 3CCRN 4Z4HA 3CYMA 2V52B 3SUOA 3HOUJ 5M1FA 2KTQA 3QIPA 1U5TA 5B3SH 4ZDOA 3KLEA 3HK2A 1DGRM 1UZCA 1SFUA 1Y97A 1XDUA 2LC2A 4XOTA 1FKPA 4L9JA 3RJPA 4LF6K 5FPMA 3ZYYX 4WQ4A 5FD5A 3LWMA 2P9UA 3V1OA 2KIFA 2GQQA 1Y0NA 4BNCA 5E3MA 1YITI 1IRGA 3L7WA 4H5NA 4B9UA 1JJ2M 1A04A 2NNYA 3LDNA 2ZJRL 4MDAA 4CK3A 5DUIA 4OOIA 5FLXZ 1ON2A 4AYBN 5KPRA 4CZIA 3SHFA 1U49A 3VMFB 3SYZA 2JWKA 5D5UB 3BZCA 1D5YA 3OIPA 2ZNZA 4Z4FA 1SKWA 4JHDA 2XF5A 2H1KA 2XKOA 1TK0A 1D1BA 1F5TA 5F64A 1S3JA 3VPRA 1NK6A 5AQTA 1A35A 2V1UA 2QLZA 2HF3A 4FL9A 4GYGA 2I7NA 2GIZA 4NC6A 3LM9A 3CQXA 4RW4A 3PO3J 2HKOA 3RIRA 3PIOL 3WU1B 5HLHA 2MSYA 3B6AA 3RRHA 2LY1A 4KI6A 2RGVA 5FB2A 1C0WA 1FMWA 2VGNA 1MNMC 4XLFA 2NOJB 2FEZA 5A2QZ 1C1AA 1YOVB 3H1CA 4C2TA 3RTRA 1V54H 4MFEA 2QF7A 1BO5O 1ZK8A 4DQ8A 3CJRB 2VQFK 5B66C 4LB6B 3ZQGA 5DM6F 3ISNC 5FPNA 1PP7U 4CF8A 3ASMA 5BPLA 1Q7YO 1A31A 2W85A 1RDUA 2UXXA 4XLCA 5FPEA 4IEJA 4L9VA 5K5RA 4CJPA 4XQFA 5DV5A 3VYUB 2WC2A 3KFWX 4F8RA 2YKNA 5KNLA 1D0ZA 5IT9K 4OPKA 2E2NA 2JRTA 2KFNA 4A5AA 2XKPA 2ZMEC 5D4RA 4DS4A 3BDPA 4R79A 4RS8A 1SFOJ 1CZAN 1REVA 4CJQA 3PUFA 2ZF5O 5TKYA 1XX5A 3EETA 4GKKK 1YLFA 3K70D 1JT6A 2CUFA 4CF1A 2OV7A 5DD8A 4E7ZA 3I54A 4I01A 3UIQA 2OTLN 3ZETB 3MZ8A 1P2FA 1YW9A 4CUGA 4WQ5C 1QZ6A 4CHOA 5GTIC 3KK7A 3AVFA 1X1BA 1BG3A 3M07A 1J2XA 2CV2A 3DOKA 4QAGA 1NK0A 1R1VA 2GBYA 5DM7L 3KP3A 2VUMJ 5CR4A 2QCOA 1MZBA 2DN0A 1X3NA 1JTXA 1ZELA 2DQLA 3L0QA 3ENHA 4JOMA 4V19K 1T8IA 2Z5UA 3OYMA 4BRNA 1YW8A 4KICA 1WJCA 1BDGA 2O8XA 3HP9A 3VSLA 1A5WA 2PY5A 5KGWA 1WGXA 5HOOA 4DW6A 2LKPA 1W7PA 5GP9A 4EVIA 3MXMA 4ZHRA 2X1EA 1R9TJ 2A07F 4XR6A 3DEUA 2NS7A 4YOWA 3SBTA 3DRSA 2EHGA 5KAIC 4HUEA 4F3QA 5ILUA 2BYVE 4CJWA 2OUMA 3ZRGA 2H27A 3IKTA 4F3OA 3G71N 1A5JA 3PL8A 4DKWA 3A8YA 2EQRA 1JGSA 1UHWA 1ZG1A 4CJLA 2WB1N 3FGUA 4AIJA 1F36A 2E20A 3CETA 4KFCA 3I59B 4DQSA 5C24A 3QB0A 2LSNA 3RKYA 3I4NJ 4P96A 1YTYA 1OH8A 2M1BA 3WXMB 1ONVA 1HNVA 1NG7A 4A3JJ 1VSDA 3LOCA 3CMAI 3G4SI 1BIUA 1NNEA 3M8EA 3TARA 2MYSA 3Q7BA 3W6KB 3TO7A 3HB9A 4YFKF 3EO3A 3BR2A 1MMSA 4M7XA 3DEWA 5CJ9A 5KHDA 1RBUA 1T8EA 4DUYK 4HPQA 4KMFA 4KFBA 3G3ZA 2XV4S 2DYSH 4H0PA 1N36K 3J81Z 3SV3A 2QEXI 2IW5A 1KVCA 1OQYA 4M71A 1S5LC 4L3QA 3G1MA 3EYIA 2E2OA 2M5WA 4A3IJ 2ZFUA 5L3GA 3A5LC 3E66A 5CE3A 3QLHA 4ASNA 2F2EA 4OPAA 4FVMA 1FBSA 1EWQA 1DTTA 4FWRA 1LKXA 4Q47A 3TDUC 1XN7A 1QVTA 1BR4A 4BQZA 1MA9B 9ANTA 3V9WA 3M1CA 5E3NA 4DSEA 1B92A 1RDBA 2QWNA 2DFEA 3LDSA 4B9LA 3V4GA 1FLIA 4UUSA 1I6HJ 4JN4A 3CP2A 4QCLA 4CEBA 1LWFA 2Q1NA 1HC8A 2PJRA 3ITHA 2DCEA 1TNTA 2W24A 1C6VA 2CRGA 2LR8A 1B8IB 1D8JA 1QVFM 3TW7A 3MN9A 2VE9A 5HLTA 2VJIA 3C7JA 1OVYA 5FO5A 3LNQA 2PYJA 3TABA 2HSTA 1RKTA 4IJNA 4KDPA 2BY1A 2HVIA 2UZKA 3M6GA 3T5XA 4CCKA 4I99C 3CD6N 3DQVC 3G73A 4NLCA 1B6AA 2WV1A 5C2DA 4B3OA 4FLWA 4A62A 4IG0A 2QA4N 3RSEA 4A5NA 3AGKA 2LNBA 4CZEA 2QWWA 4ZTJA 3HHGA 3PM1A 4Z4EA 4U87A 2MH9A 2XRLA 1TTYA 1FK9A 2KQ2A 4AC0A 1NK2P 5JI6A 3V7SA 3RPQA 2VKVA 1ATNA 1ZBUA 4DYRA 4YRVA 1S72I 1TWFJ 2X6YA 1MKMA 3RMBA 3QIOA 2QI2A 4X0GA 1O3TA 1TP4A 2LH9A 3HIFA 4JEPA 2V9KA 4RGXA 3CJCA 1S22A 4I2OA 4XLHA 4KAZA 2ZFWA 5D5WB 5EOYA 3CP8A 1B72B 2IS4A 4WX9A 4CA0A 5IOZA 2HZDA 4WFBL 4CJ7A 3PX4A 4K25A 5C0YA 1Y1VJ 3A5NC 3CCMI 4LG0A 1XQSC 3TOBA 1TAUA 4OO1J 3BC8A 4GFBA 3G6EI 1SFXA 3ZX0A 1K61A 3TU5A 5IP6A 2ZWHA 1MDMB 2L7FP 3T19A 3H36A 1P8ZA 1GLAG 2Q0UA 3WE2A 2LTPA 4DQIA 3QPSA 4KUMA 3GLLA 2GA1A 3LAPA 4MEXF 4H5RA 2HYGD 1XSDA 2WAQN 1V5EA 1XMXA 2ESHA 5AQSA 2HHTA 4XLNF 2CS3A 2O8DA 2O8EB 1UFMA 2RN7A 5L3EA 4JKHA 3M3ZA 2A5YB 2HVSA 1JL1A 2HHHK 2JSPA 2ZMEA 3HGYA 1WSIA 2EZKA 1RTIA 5AQLA 2DA1A 1FSHA 1QZEA 4ISGA 2YI1A 3LM2A 4BR4A 1IG9A 2CQXA 3K6GA 4CFAA 3OL4A 1IN8A 1JHFA 4AU7A 3K1NA 3MD2A 4KISA 3HOXJ 4CCLA 4YDUC 3B8AX 2QW9A 3CCJI 3EZWA 1YXQA 3ELKA 5M3MJ 1QHAA 4BJ6C 5HP1A 1P9QC 2VC1A 2HVRA 1IRXA 1MGTA 2FSNA 4FT8A 4O55A 3SQ1A 3ZSVA 5EF6A 2CSOA 3THWB 5IYDJ 2KT0A 4WQ5A 1K78B 4XORA 2F9WA 4DFMA 3VFZA 2CGKA 5AQXA 4BHBA 2HNYA 4NCGA 1GVJA 2GM4A 2FSKA 1G4DA 4DFPA 2NRWA 2XY5A 1X9SA 2LBFB 5LJVA 2K3PA 1U3EM 1M90O 2MGQA 1VQKI 2UUAK 2NLXA 2P6SA 1DTQA 5D6FA 3QBXA 3HRTA 3D45A 4JNEA 1TWHJ 3GVAA 5AFUH 2ZXJA 4J00A 4EZ6A 4A2AA 2ELJA 5BN8A 4XOPA 4KITB 3O1WA 2D0CA 3QAHA 1OVQA 4KHPK 1W0HA 4H5TA 1TYQA 3HVRA 5IYCJ 1J6ZA 1F1ZA 4CERA 5F0XA 5EZGA 5GAHJ 3MEGA 5F0HA 2F5EA 2YJFA 4KHYA 2OD5A 1T6CA 1ERDA 4E70A 4DZJA 3NEUA 1Q18A 1GOAA 5EZHA 1RDWX 3P38A 3LSHA 3HUGA 2RQPA 4CEZA 4ZZLA 4RAGA 2R7RA 5CVIA 3C6TA 3S32A 3LP2A 1WAJA 4M41A 2FOKA 3CCQI 2E2PA 4IOAF 5E1XA 4M9XA 3MK6A 1KONA 4QTRA 4I9LA 5HVQC 1I94K 1ZTRA 3U9GA 2XRIA 4PA1A 2HBJA 3R60A 5C4JJ 4LLLA 3TTDA 1R1TA 1KXPA 1T7PA 1SVOA 3DFGA 2RV8A 4BVOA 1VQNN 1UG2A 2QENA 1X4OA 4F4KA 2L3DA 1Z3XA 1MWKA 1RFQA 2F5VA 1BOTO 2HHWA 3CCRI 3KZYA 4HQMA 2HHSA 3AL0B 3VOEA 3VEWA 5T7BA 4CF0A 5B1AH 3AVCA 2JRMA 4ZYHA 1RT4A 5AQPA 3FXQA 1WBBA 5J2QA 3HTVA 1J09A 2P6TA 2ZNYA 3WTZA 1VQLI 3CQYA 3DWLE 2BTFA 3NGIA 1RRJA 2ZSIB 6PAXA 2DI3A 4M74A 5DCFA 4HRIA 3IAM2 2DA2A 2IJLA 1R59O 4IHVA 2G8IA 2FF4A 3QYBA 4FLUA 3OYLA 4HA8A 1ESVA 3VYSB 4AIDA 2CGLA 4D9JA 2VONA 4Y4RA 4DU1A 4KTQA 3QDKA 3BZKA 2ZE2A 1BN5A 3BR0A 1HKSA 5DM6L 1S6QA 5KAFC 2DU9A 3DYAA 1L3TA 5EJCA 5JS1A 2GZWA 3BQZA 5GTHC 3CCSI 2R7FA 1P90A 2I8DA 2W40A 1BI0A 3JREA 1VQPI 2DA5A 2Q97A 1X2NA 4GV3A 1BI4B 1VRTA 2CFXA 4M3EA 1N75A 4LFCK 4GMJB 1K7AA 3DBHB 3DLRA 4KI4A 4FZYA 2LREA 4ZYDA 4I76A 5GPAA 5EU7A 4D0PA 4E7KA 4K42A 2P9IA 4ILHA 1EKEA 4B3AA 4E4HA 1MMDA 4PHTX 4K0KK 3ZT0A 4GVEA 2R7DA 1JI8A 4B3RK 4A0YA 3GTQJ 2XIGA 3LFUA 2FE3A 2KRCA 4FISA 5EEAA 1U48A 3QO9A 5C3EJ 1QS4A 2DPNA 4HWIA 3ABLH 3LZJA 5BPNA 5LGNA 5EDNA 2Y9ZA 1RTJA 5GAHP 4RGRA 3OW2M 2QXFA 4O5BA 1X1PA 3KEYA 4NYNA 1LCUA 3NAUA 3ZXSA 4ELVA 3ATUA 1PUFB 3TSQA 2NRAC 1RPWA 5TKWA 5ICFA 3AY9A 3QNNA 1XHZA 5BPDA 2QWRA 1VSEA 3M8PA 1XMOK 4FASD 4AM3A 3HC7A 4WF9L 3C6UA 3ZLJA 3E1YA 3CC2N 4A0XA 4B44A 2HR3A 4A6EA 3BTCA 4CJSA 2HNDA 3K4CA 4KYWA 2BZTA 3T8RA 1YJ9N 1X3WB 1GLCG 3E5QA 2FBHA 1YX5A 5EX5A 2GELA 5L3BA 2O8KA 5LL6Z 2ADUA 5J47A 3K9JA 1NHAA 1U6GA 2WFBA 4HX4A 2OC6A 4ILGB 4RWTA 2EFQA 3I58A 2YHXA 2FSJA 3IWFA 4GV9A 2XB5A 1SL1A 2Z3YA 1RI7A 2YNFA 2RNJA 4JX5A 2P0WA 2JPCA 4U88A 4NLBA 4BBSJ 3CC4N 3B6CA 2WADA 4FE7A 4G94A 3DKXA 5DCMB 3CUOA 2P7CB 4HEA2 3IWZA 1HJRA 2M7BA 4YELA 4CICA 4C30A 5GIOA 1IG8A 1HLVA 2ELHA 4YOXA 4LSNA 2QQ8A 2IPQX 1U47A 3IH4A 3PNYA 3HPHA 3F2KA 4LF5K 2H6BA 3T1YK 3DLLF 1IUFA 2Z1HA 3QERA 1RZ4A 1DUXC 3E6CC 4DTSA 3E9OA 3G25A 3K0SA 1HNIA 2X85A 4DTMA 1Y64A 2E1ZA 2YPRA 2EWNA 1HXDA 3GBTA 1KU3A 4PKIA 1LFBA 2E6LA 3ZSZA 2OF7A 3E7LA 2LFBA 3KWGA 5BMZA 5BRFA 4B1VA 4CJ3A 5KPTA 2IVNA 2X1CA 3TEDA 4BRLA 4JKDA 3OS2A 2HXIA 2NZTA 2IT0A 1QSSA 3ZQLA 4WCGA 3HOYJ 4H5WA 3B73A 3A01A 4DR3K 3R4KA 4MO4A 1G3SA 5CHIA 5CZ2A 3K9KA 2ZGZA 2IS6A 3ZETA 2W57A 3GZ5A 3ZSRA 2R3SA 1V5GA 1IF1A 2PQ8A 1SFKA 3CIPA 1YJWI 4DGWB 1RDCA 3VQEA 4ENMA 4OMZA 3SUNA 4BQOA 1WSGA 2H6CA 3V8JA 4A3KJ 1N33K 1LWCA 3L1PA 4JK1X 3T7ZA 3K4LA 4A61A 4EFHA 2D45A 4C3HJ 2E1MB 4IXCA 2Q0RA 3FBNB 4XRFA 2L9NA 3LDLA 3F8BA 2Z1IA 1NK3P 5AQGA 4DTPA 3GTOJ 1H89C 5E3LA 4IRIA 2V9VA 5AQOA 4EP5A 3DLHA 1YW7A 5CVRA 2W6LA 2P9LB 4G12A 3AVNA 1IXRC 1MSEC 5GPCA 3RMDA 2H8RA 2X78A 3S2WA 3I4MJ 4OWRB 3F9MA 4FJXA 4H0YB 4HF0A 4BRMA 3EY1A 1XNQK 4UVAA 2HZTA 4CJ5A 4IOCF 3ALYA 2UUBK 3LWLA 3PO4A 2EINH 3DCFA 4BC5A 3VEZA 3DPLC 2WY7Q 1T39A 2XDVA 3EYZA 4LF8K 2O4GA 3WXJA 1ATRA 3BT9A 4I02A 2K9LA 4FWKA 4XKVA 3O8GA 2ZB9A 5AZJB 3E5UA 5BR8K 1B9NA 4BRGA 4LB5A 1K4SA 4A3FJ 1PP8F 3FZKA 4AWXB 3I59A 2IVPA 2VQHA 4PCQA 4RGUA 2FBKA 2GIVA 2CV0A 1IKXA 1TQPA 4N4OB 2VBWA 2ZJ2A 1TUUA 3L8BA 3ENBA 5J8CA 4KO0A 3VGMA 3FXOA 2IC3A 2QA4I 3ERMA 3AG2H 2KHOA 2WWYA 3H5AA 1J53A 1R5HA 3M5RA 3AKZA 1Q9XA 4BQAA 4BGBA 3GXOA 5JHUA 4BRKA 2CWEA 2E71A 2L9RA 4V2FA 2K4JA 4JK7A 3HT3A 3HYFA 4CGJA 4MTEA 2A5WA 1Z3YA 3AL0C 4BDYA 1JKRC 4JRPA 3T8TA 3D2EB 1RBTA 3I71A 1MBJA 3E3VA 3I8DA 1PYVA 4NBQA 2G8UA 1ZHFA 5J2PA 2OPPA 2E7XA 3MXIA 3KD1E 3CJTB 3F73A 3H1VX 5KCMA 3ID6A 4N47A 5C4XJ 2PMZA 3M9AA 2CQKA 2LYCA 4Y52J 1OKJA 3A0BC 2M0CA 1ASVA 3M8RA 3TAQA 4HCCA 2ZC2A 4C8LA 1IRFA 2FBVA 4LITA 2X6SA 4CD1A 5JR3A 3R8EA 4RAYA 2VT2A 1YO5C 3AO4A 1IBKK 1LW0A 1B8IA 3S3MA 3GFMA 4N41A 2M4GA 4CHNA 1WWXA 3AVJA 1LEBA 3BJOA 3HRSA 4XNFA 1K9MO 4CGDA 3F23A 3MKYB 2Q31A 1TZLA 3NVKA 1MBEA 1ZRCA 4C1NI 3LWFA 3IRRA 2JTVA 4A0ZA 4E3SA 1SD7A 1G3YA 1YUWA 4HF2A 1FJGK 3ZQIA 1R5GA 1CXUA 4FM1A 1CZBA 3CM5A 2V1DA 3H9QA 3LSJA 5CPRB 1F21A 3W2AA 1QPIA 1YQAA 1S1UA 4YNQA 3H3ZA 1H8AC 2ACJA 1DU0A 3TBIA 2G7UA 2KFDA 3SUPA 2HTSA 1IKVA 3SQNA 2W42A 2Q0OA 3ZGKA 3S2HJ 2MLKA 3LDPA 4FZXC 5K7ZA 2HBMA 4F9OA 4B08A 2QWPA 1RETA 3W0LA 1B72A 3KK2A 2XAQA 3BGRA 2AHQA 2TCTA 4G9ZA 3RCOA 3V6DA 2Z9OA 1ASUA 5C12A 4IX7A 3T1HK 2L4AA 2P4WA 3DTEA 5HL7L 1LEAA 2V9PA 3GLXA 5M1OA 2X6XA 4YOVA 4A3DJ 5CQEA 1ZGWA 3Q0VA 3DAWA 2OCCH 2Y75A 4IOAL 3NF7A 4KREA 1OCCH 1MDMA 3H1QA 3QINA 4OJRA 1BR1A 5B8HA 4BRPA 3ZEUB 3H9GA 3MWTA 2CG4A 1T33A 3SFZA 3O6WA 2RKHA 1O13A 4DQ2A 2O8FB 4JS4A 2CUJA 4DV5K 2BUPA 1OLTA 2GA2A 3I53A 2VLAA 4E19A 2O8EA 4S05A 2BW3B 3N4PA 3U1KA 1NJYA 5ICGA 1QBJA 5AJ3K 1R0AA 2LRDA 1IDZA 5AQRA 5AQZA 1TWCJ 5LY3A 4RW7A 1ETYA 4LFAK 1HW1A 1BIBA 4BWJA 4CZMA 1X3MA 1X58A 2QGUA 5IT9O 4G7OF 1N77A 1BM9A 1R6RA 3IKMA 2ID3A 4NB5A 5F0CA 4FJHA 2Z1JA 4M3RA 4DTRA 3FFIA 2GLOA 5JLWA 3FMQA 1MBKA 1W4MA 2IIRA 3OYAA 3OYBA 2FC0A 2R7ZJ 3THWA 1OH5A 1HQUA 1WH5A 1K78A 2YX6A 3LL3A 3KLGA 1KAYA 3SZ2A 3OS1A 5IP7J 4IDHA 4KIBA 3RQIA 2ZJPF 4S0HB 2HI3A 3HSTB 4J19A 3S1QJ 4E1NA 2G9WA 2LBFA 4O5FA 1K8KB 1IH7A 2VQLA 2P5GA 2P9KB 4L0YB 2GOXB 4CDGA 3K70C 5DMRA 1SL2A 1WKMA 1J59A 3H3UA 1RR7A 2O9LA 4OPJA 3EUAA 2PBDA 4RB1A 1V4TA 2FQ4A 4AIHA 4QS7A 1E4FT 5E17F 3ID8A 2ZJRF 3DXKB 3AO2A 4FJJA 1TL3A 1RESA 1JE8A 1XS9A 4EHUA 3VTIA 5AQQA 3WNEA 1NMNA 1YT3A 4PGGA 1FWZA 4NYFA 2NYXA 1A6QA 5J3LA 2BVLA 2YNGA 3O8HA 3J7YJ 4HW0A 4CI6A 3I9V2 4PL8A 3VF6A 2GXGA 5FKOA 1RTHA 4CJVA 2IBDA 2YHAA 3L2UA 1IJWC 3JSMA 4CD3A 3M1FA 1FYMA 4R5PA 2R7QA 1A5XA 4JBAA 5AZIB 4CZKA 4XRMA 3CO6C 1SEUA 4DSKA 3VYRB 2RNGA 4KHQA 4DHYA 4U0WA 3HOZJ 2E1MC 1X1DA 2VASA 3MAJA 1LE8B 4AM6A 4DMNA 4H0XB 1V4SA 4BRHA 1IBLK 4PKGA 1YIJN 3BTJA 3FKIJ 1MSFC 1Z67A 4KTZA 2BEOA 1IN6A 1R4NB 3K2AA 2AO9A 2UUCK 3GTPJ 1OPCA 3WXKA 4KNYA 2QXLA 3DKYA 2JN6A 4NXMK 5HS8A 4P1WA 3ZSWA 3MN6A 3GWZA 1IV0A 1VNDA 4II2A 4DYCA 3A0IX 1Z0XA 3X2QH 2QM3A 4PJNA 3CFPA 2ASMA 3FHZA 1WUAA 3J80K 2JWTA 4CFBA 2CUZA 1RBVA 1JCEA 1HJOA 2F4MB 4RAZA 1BU6O 2IVOA 2VN2A 3FF5A 1SZ2A 4DG1A 1YYVA 2JVHA 3ZCMA 4J01A 4QOZB 3CQ8A 4AYBA 3H08A 2BHZA 3AFHA 3JTHA 2JZYA 2K9NA 4CCMA 2F9TA 3RYRA 4LF9K 1RKWA 3WTXC 3G1LA 2A41A 2UXDK 1YJ9I 4OGEA 3F22A 1RT1A 4DWIA 3U21A 4IG3A 1IKWA 5CY4A 4AHCA 2R7YA 3JRAA 3M8QA 4H0VB 1HBXG 1BI4A 4CGGA 3DU6A 1AHDP 4BRFA 4AILC 3MCZA 1KVAA 5BNGA 4A3LJ 3PFYA 3JTGA 4AD9A 4I09A 2KZMA 4OIPF 4H03B 1QTMA 1WI9A 5M1PA 3QEPA 3HRUA 1KU2A 3IG1A 4U0VA 3CC7I 4UY8I 3V9SA 4L5EA 4Q5VA 1HKBA 1TKTA 1FY7A 4LH5A 1Z7LA 3QU6A 5FKKA 2BY3A 2YSRA 1E0EA 2X6NA 4AUXA 2WY8Q 4CE9A 2OZSA 2V26A 2DOAA 1R1UA 1RC9A 3C6HA 5BR9A 4FW2A 2ZO4A 3SDBA 3SK3A 1POGA 1WNSA 3MX2A 3J7AO 3CCVI 3J7YP 3ECHA 1UAXA 4EV0A 4I2PA 3RKXA 2DMQA 3CCYA 1HR0K 1PUFA 3BPVA 3TTCA 1FKOA 3OHRA 3ISPA 4LOCA 2WBMA 1IN4A 1QZZA 5AIQA 2HDWA 4Q4ZF 2JT1A 3BG7A 4B09A 4FYDA 4CESA 3J7ZI 3JSOA 4FJGA 3O9UA 2CMPA 2QSGX 3KLOA 1BA1A 2Q2EA 4EJUA 3LDOA 4BDZA 2IGOA 4KA4A 2AP1A 3SQ2A 2CH6A 5HNHA 3S17J 5AQMA 3NHGA 4YOYA 3SMPA 2ASPA 5FRMA 1PVEA 1QHTA 4GDFA 3S1RJ 2M30A 3ZQQA 3WNHA 4FWLA 3I56N 3N05A 2JA5J 4RB2C 3M1EA 3CERA 4IOCL 3I5UA 2O8BB 2VKEA 4I6ZA 3CF5F 2ELKA 3EYYA 3CJ7A 3THYB 4ZYGA 5J1UA 1JL2A 1Z26A 2VBYA 2BV6A 1JUSA 3G1OA 1DP7P 2K86A 4O44A 2D5RA 4YOTA 1QZYA 2BXZA 5HDGA 5DCMA 3F8MA 3BROA 1T38A 3CUQB 2HKXA 4B47A 4JKGB 4R8HA 3OYCA 1FPQA 3CJAA 1K4TA 4XONA 3OWTA 2E1CA 2A69F 4JLHA 5E18F 2DQRA 3M8SA 4BS9A 3LSGA 3WTVC 2P1JA 5KK1A 1JHHA 4KKOA 2OU2A 4M6XA 4LD0A 4IF4A 1IKYA 2KDZA 1YE9A 3D6RA 5ELZA 5JMVA 3BY5A 4OKEA 2VKHA 5IWAK 1VFCA 2ITMA 3BF1A 4CF9A 1ZYRF 3E6MA 4PJ0C 2L9SA 1RNHA 4Y1DA 5LBQA 3QNOA 5HRNA 1P92A 4YFNF 3QRFF 3OL3A 4HSRA 1XUPO 1WLJA 5IOYA 3C1DA 4GYIA 2WBNA 4B1RA 4CIGA 1W9HA 3MDQA 4JS5A 1Q86O 2PBIA 3K5MA 2N8GA 4K2EA 1IGNA 2A6AA 4PDKA 1J5OA 4HZFA 2KIMA 2D0AA 1G15A 1RCHA 1UMQA 2FBXA 1W7AA 3TPQA 3LPTA 1VQON 4XLPF 3GBGA 4EIAA 4MQ9F 2RE2A 2E6MA 1E17A 2BE2A 4YHHK 4DS5A 4DF4A 3MZHA 2CW7A 3U4LA 3HGGA 1BHLA 4WCEL 4MTDA 1OMIA 2IA0A 2JGUA 1VQ6N 1YJNN 3LZIA 5H2FC 2KFZA 5CVJA 3UNGC 4HDUA 4NCBA 1BJZA 1HSTA 2R7TA 2V7ZA 1HW5A 1NOZA 1MJ9A 4LIUA 2VXZA 4RB3C 4NHJA 1D1CA 3WT0A 4S04A 1NGHA 2BBYA 2QYOA 3ZQFA 2QUFA 2MD0A 2YNIA 2JUGA 2VIXA 2JA6J 3M4OJ 1QVGM 2JLEA 3K4MA 2XY8A 4CHPA 4LLGF 3RKQA 2BGGA 1VQMN 3KEQA 2DDAA 2XGDA 2P8TA 2Y0SA 4BY1J 3JRHA 3WG9A 2QWMA 3QP5A 2P9LA 5CYMA 4DR7K 3E6BA 2XVCA 3VF4A 4MQVA 1JCFA 5TJJA 2A3SA 4FTHA 4OKKA 2WTUA 2BGCA 3H92A 3FXMA 3HZJA 3QPTA 3S8PA 4I2QA 3KP6A 2FA5A 3MN5A 4I9QA 2FOWA 3RDIA 3O3HA 1VQ9N 5AIPA 1XC3A 4FZZA 3Q7CA 1MW7A 1JUPA 3PY8A 4DOZA 3FR0A 4DTJA 1U45A 2DW4A 1RNLA 2K4BA 5IT9Z 3R6MA 2K27A 2XSJC 3HRGA 5AR0A 3D7EO 5AZJA 3V8KA 3ULDA 1W36C 3P39A 3V7RA 5AQJA 3T1AA 3M3YJ 3F0CA 4A69C 2ECCA 4FK0A 3VTHA 1ZR4A 4NO7A 1S7AA 3IH3A 2DMUA 2NNNA 4D1QA 2R92J 4CZLA 1C0GA 2XPWA 1TUYA 1FTZA 3SCXA 3F8FA 2KZVA 3CDIA 1JLFA 4RBOA 1NKEA 3F72A 3TWHA 3FHNA 5J4YA 2QM1A 3MEXA 4IOXA 4L0ZB 3KKRA 1FXXA 5IT3A 4J2EA 4JI3K 1J9IA 1B1BA 1HQEA 4ENJA 2EWSA 2KJBA 3ENOA 1NU0A 2D0BA 4FETA 3JRCA 3D2EA 3GTMJ 2P5KA 4FJ5A 3CDLA 4JQFA 1Q1VA 2PLYA 1WSEA 2FX0A 5AQWA 4O3MA 4OU0A 2RAEA 2CH5A 1XPXA 2D0PA 4P9UA 1BBYA 1NBWA 2DA3A 4B1WB 4RTFD 3ZT1A 2MA3A 1R49A 3F5TA 3O3GA 4P55A 1S3XA 3IDHA 4BR5A 4YG2F 1KC8O 1Y0UA 2HPIA 2XC7A 3C7NB 5E79C 3S1MJ 3SJJA 1YAGA 1NGCA 5D4SA 1RUNA 4DNCA 2JPBA 2DOFA 4BREA 3WTSC 3S9HA 1A5VA 4KBOA 5JLFA 3ZQ7A 1ITGA 3BLYA 1SD6A 2ZJPL 2A3ZA 2R7UA 2Y30A 1GOBA 4N9IA 1P6RA 3AG1H 3WTUC 4M3DA 5AQUA 3M8JA 5LEJA 4DLEA 4PZJA 3C6AA 2UXCK 1LDJA 2LG4A 2DFHA 3BP8A 4C1NK 4UNOA 4ESFA 3S3NA 5BPMA 1FC3A 4WXHA 1SAXA 3RYPA 1JLEA 2IGIA 1QQCA 5M1KA 2YNHA 4CGHA 3PNVA 1T56A 2GWKA 5FGMA 4WF2A 4CBUA 3GFIA 4ISFA 4PWDA 4DCHA 2Y9YA 2L01A 4CW7B 1W1WE 2DT6A 3C2BA 1SAUA 3CPEA 3CM6A 4W5RA 1OYYA 5BPIA 1J5YA 1NG9A 3BG6A 3O08A 4BC2A 4CSWA 2W48A 2HOEA 1O3QA 3NF6A 3TQNA 2ESNA 4BC4A 2R0QC 3LAMA 3CJBA 1U0JA 4LIVA 4FLZA 5F2RA 1KLMA 1FTTA 4MIMA 4BJ5C 2EZHA 4KN4X 1S1XA 4O4GA 2P9SB 3HSEA 1XMAA 1ATSA 4M72A 4CEQA 1ZBIA 1GLDG 1W0UA 3RQ4A 3WEEB 4BXFA 1IXCA 3H46O 2JMWA 3HM5A 3VDXA 4AVPA 1A36A 4CJKA 3VB2A 1VSMA 4CJEA 3NWTA 3OOUA 1VSLA 2HEOA 1C0UA 4C9YA 1UHMA 2NS0A 1HKGA 2VXDA 1OCPA 3SAFA 2O8FA 3FX3A 1I50J 1PUEE 1SKRA 4BE2A 4C8MA 2ITGA 1J75A 3GCMA 4A3MJ 1CF7B 3OYEA 4XH1A 1OCRH 1QNTA 1YG2A 2BW3A 3VEYA 5DS9A 2E5LK 3F6VA 4B3MK 5B5EC 1HX1A 2D2WA 3VQ5A 2DTUA 3K4BA 1WVRA 4BQNA 3GTGJ 2CW0F 1ZR2A 4PSWA 4G1QA 2MD5A 2W25A 1IDYA 3WQTA 2QVOA 2ATQA 2ZQBA 4A3BJ 2KKZA 3DLEA 3HZ6A 3S1NJ 5TISC 1QO0D 1JLCA 2Q2RA 2XAUA 1AKHB 1RT2A 1L3VA 3OYFA 4MGRA 2RC4A 2NVTJ 2AS5F 1ZBLA 3RZDJ 4FWOA 2R7SA 4O8KA 4YFUA 4HNTA 2QQ9A 3ROUA 3CUQC 2VKDA 3VWBA 4DUZK 2O61A 2ETHA 1ZAOA 2F5CA 3K4NA 1VQ7I 4UQGA 3E9LA 2G8KA 4IBNA 3AO1A 1VQ8N 1FYLA 2HVQA 3ONQA 1K8KA 1XGSA 2P9KA 4BRDA 1QHHD 1R7JA 3DLGA 3KK1A 3DMJA 5CKTA 1ZRDA 5JVHL 4Q5SF 2LLKA 3KLIA 3VQ8A 2OZMA 2DJNA 3IS9A 2PFUA 3A5OC 3ASNH 5F08A 1S7EA 1OISA 3H3NO 3GDQA 3PSFA 4DTXA 1I39A 1SANA 4X62K 3DXKA 4E7IA 3IRQA 2XY7A 3DV8A 3GFLA 3AARA 1B9DA 1JXEA 2ZD1A 4ZDLA 2KIUA 2KZGA 1HNXK 1A6IA 5HS9A 3VEPA 1VQ4N 2VI6A 3HKZN 2LKSA 4DLGA 2DBBA 2LOOA 3TAEA 3P9CA 4ENKA 1JGGA 4GV6A 4NQWB 1ENHA 4BHCA 1Z21A 3WXIA 4D5FA 2BVMA 3WGGA 1Q9YA 3HEFA 2F96A 5AZIA 1H1VA 1BW6A 1YRNB 2OBPA 2FBIA 2LSOA 3TP0A 4H4KC 4C8NA 3FISA 1FP2A 4XMYA 1QU3A 4LD5A 4JKBA 4RLQA 4JYKA 3ZQHA 3Q5FA 4B48A 2EIJH 4XKCA 3S3OA 3S16J 1LE8A 2LD5A 1GV2A 1BI3A 2HHXA 3GZNB 4Z6YA 1JXBA 3VERA 3QPLA 3VETA 4CF2A 3HOTA 4F93B 2ZGYA 2ISYA 1ZREA 3AO5A 4XL9A 4WK8F 4B1YB 4V19S 4EJWA 4RCHA 1HUXA 2VQEK 2DAOA 5F27A 2DPDA 5GAEJ 4HLYA 3NF9A 5F6FA 2XRNA 3TAMA 1I5ZA 3CCLI 3E9PA 3J8AA 2ME0A 2EILH 1KTQA 3U3GA 1NKCA 1EO1A 4GO1A 1QVUA 2W84A 4UVBA 4DQQA 4AHRA 3K7AJ 4XBFA 3DEEA 3FMRA 1HA8A 3CLQA 2XPVA 3CF5L 3HBTA 4CGZA 1VSIA 2EFWA 3UE5A 2QZ8A 2NRHA 3QYEA 4O0IA 4DJAA 2F8SA 4HCBA 3DOLA 1EETA 5IY5H 4AHTA 2FLOA 5ICCA 1DDNA 5HBMA 1NOYA 4F7ZA 3JS6A 4RMNA 4A3EJ 5F0FA 1USSA 4A93J 5CVVA 1BOBA 2QQAA 3RSNA 2Y0SN 1UELB 2VGMA 3ATVA 2QKBA 4G8XA 3HOSA 5AFUA 4Y3OA 1TGOA 1N5YA 5M5YJ 4QIWN 2OYQA 3NQOA 1D9FA 5K7HA 2A42A 2MG4A 3OMYA 2YHWA 3EL2A 5HDNA 4WE1A 3B02A 3NGYA 4M3WA 5HRPA 4ON0A 2PYLA 3C2HA 5LLQA 2CW8A 4ANJA 3S41A 4FX4A 5JLHA 3U9DA 2DT7B 3TO6A 4BAYA 1ZBSA 2YJEA 5KPZA 3QWLA 1XGOA 4A59A 1BA0A 3CCEI 2M7AA 4FX0A 3F9KA 4X64K 5DUKA 5ADXH 3ZCOA 3L3VA 1RUOA 1JUMA 2Y1JA 1MBGA 3KYCB 1UG0A 2KKOA 1KD1O 1FYKA 3K5LA 5E26A 2IA2A 3FLCO 3LQRA 3G4SN 4EM1A 3HTSB 4G7HF 1WPKA 1T6SA 3RR8A 4BACA 5EVZA 2EJRA 4KV8A 2E19A 4XRSG 4RA2A 2PX9A 3VEOA 1XNRK 3A2FA 2FNAA 3KLHA 4FLVA 5J2NA 4EMSA 1G99A 4UXNA 2QEXN 4IJAA 1LUJB 4F55A 1ETQA 3H5NA 3AG4H 4HNVA 2FJ1A 4DQRA 1WSFA 3AAQA 1XCVA 4JI0K 4CFCA 3SZTA 2E34A 1RTDA 1ZBHA 5IPAA 2CV1A 4CCOA 2HW3A 4DFJA 3Q3SA 4FPAA 2XAJA 2HQ5A 5LFAA 4AHVA 4DV4K 3TP3A 2VOPA 1VSKA 4HHTA 5M5XJ 4I98B 1ODDA 2OAZA 2OA8A 1BGXT 1J9AA 2KMUA 5JLXA 1O1WA 4ISEA 1KFSA 3NE6A 3Q9VA 1QHGA 2Q1ZB 3OVNA 5C25A 2FMYA 3C94A 2D0OA 4Z94A 3GTJJ 5K14A 1GUUA 1U6ZA 1NGDA 1Q8IA 2ZXIA 1EX4A 1N8RO 4FO0A 2Q36A 4BG9A 2O8BA 5GAEP 4HTLA 2D4WA 3VF2A 4Z2YA 1VQ5I 2HU9A 2FXAA 3D0PA 1ZN2A 4M3ZA 1XSXA 3THYA 3KLNA 5I3UA 3MMYB 1MDUB 2XAGA 2FNPA 3SI6A 3WU0A 2M3AA 1Y39A 1OCTC 3U2RA 3UKRB 4ZTFA 4PKHA 2KLOA 4GW6A 3P4IA 3G0ZA 1HLUA 5FDLA 2NRZA 3BR3A 2HTJA 2HHVA 5DEQA 1BIAA 3CUQA 2IAIA 4O6JA 1GLNA 4JKGA 2V7YA 4OGCA 4MEYF 4ZJZA 4HVJA 1YTUA 3OYJA 3AAPA 3VQCA 1VQMI 5GADJ 1RT5A 2AQEA 5J6XA 4LC9B 1GLBG 2ECBA 1S72N 3EDPA 3R1XA 3Q0UA 2IEKA 3ZQCA 3V1RA 3LQQA 3AVKA 1JCGA 1KU9A 4WYBA 2Z1GA 1BISA 4A12A 1LDDA 3BCAA 3HJEA 4DTOA 1LWEA 2HMIA 2BHYA 4XIUA 3AAFA 3CCMN 5BQTA 1VQ9I 1XMKA 1TV6A 1W97L 2GUIA 3G6EN 3OIOA 4Q0BA 1TNSA 2HWVA 5ICEA 3SUQA 2OZUA 4B8AB 4OINF 5JVTA 3CCUI 1FX7A 3LDQA 2VWBA 4C8KA 3O9TA 5JVGF 3ZMTA 3ABUA 1X9JA 1BOAA 3K2PA 4CHZA 3CESA 1C0MA 2CJJA 4LG3A 4G6QA 3MX5A 2VJJA 3SLCA 1UB9A 2W82A 1DEJA 5C2FA 3PLAA 4PFOA 4UB8C 2KP6A 3VQPA 4BG8A 1NGFA 3VODA 2RHKA 2V6CA 5J1RA 4M3TA 5CQGA 1EP4A 2M8GX 1LFUP 4FOEA 3P9IA 4HLXA 3M8FA 5F1XA 4UV8A 1IO2A 3QEIA 4DU4A 3ZMVA 4F91B 2XPUA 2LVSA 3CMEI 1ZG5A 3L3UA 3A03A 1ZGJA 4I7FA 4DR4K 3NH0A 1U04A 4DBQA 5HROA 3OJUA 4KB0A 5KRTA 4FJLA 1YI2I 3CCJN 4CGFA 3FM5A 1RILA 1LDKB 2A68F 2KIQA 3QU3A 3P7NA 4JX4A 4BWMA 3PX6A 3I55N 2O8CB 4F92B 1E4GT 3TTFA 3FK6A 5LEKA 2P9NB 3SNNA 4IHSA 1WFXA 1ON1A 4E7LA 1MMAA 1R71A 3A5MC 3OTOK 4HX8A 2X74A 1IC8A 4JI5K 2R7XA 3KP2A 1WJEA 4PUOA 1GLJO 2Z16A 1S1VA 4DU3A 3HSRA 3VQ6A 1XCBA 1L3SA 4LFUA 1QE1A 4LF4K 4HOBA 4CCNA 3W6VA 1S9EA 2UXNA 1TW2A 3DPTA 5KTQA 3SDGA 2VBXA 1W36D 2G8VA 4DTNA 1YS7A 1K6YA 2R7WA 1MWMA 4IQ4A 2GXAA 4D7NA 3TGNA 1L3LA 1MMNA 1X19A 1HKQA 1N32K 3J80O 4B3SK 2K85A 1JLQA 3AVIA 4DZPA 3Q0WA 4G7ZF 4M9ZA 1DQUA 1Z1DA 4Y17A 2TRTA 3LSRA 3AGRA 2EIMH 4CZZA 3CMYA 1CGPA 2YHBA 3DP7A 3KZZA 1QPMA 3DF8A 3FK7A 3CFRA 3CJ9A 2E2IJ 4UVCA 1VSHA 5GADP 2L54A 4G6TB 1IG7A 4CZGA 2K9SA 3RRGA 4JI1K 2HB5A 4FJIA 3NAEA 2IVMA 5FLMJ 1D4XA 4B8XA 2KZZA 3MKZA 3IUCA 1HYVA 1FIPA 4K41A 3KETA 2VBZA 4H4MA 4DSFA 1HNWK 4GCVA 4MO5A 3GFJA 4A6DA 1K8AO 3H45C 3LA7A 1NGGA 1WN7A 1HPZA 2J4RA 4M6VA 2NNWA 1T0FC 1UOCA 3K1MA 2YS9A 1BQMA 3DI6A 3OIQA 5J1YA 3OJSA 1RBRA 3KCCA 1Z7UA 2JA8J 2BY0A 5FFXA 3AVMA 4AM7A 1YVUA 4IO8A 2YUSA 1U9NA 1DT9A 1KRPA 4U0YA 1DGWY 3C7NA 2V7FA 4C3JJ 2M0MA 3PIPF 2O4IA 3NDKA 3C65A 4B9SA 1AU7A 2UWMA 2C6YA 1JKHA 4FJ9A 1SMYF 2K40A 4X66K 4LY7A 1UCRA 1D3YA 1ZRFA 4EZ9A 4EHTA 1FW6A 3ZSOA 2XASA 2WC9A 3FZMA 2MABA 3WGHA 1VQLN 2DFFA 1Y8RB 4IWVA 1U78A 2DYRH 3VQAA 4FVUA 4OPHA 4EQQA 2XHBA 1ZGAA 4KTWA 4BR7A 3GMEA 5CZ1A 1RDAA 5HNFA 1W5TA 4AIKA 5F04A 4GXOA 4EGZA 4FM0A 3RMCA 2R5ZB 2VJ5A 1EH6A 4I6MB 2IXSA 3SV4A 3GUDA 2V1NA 1ZC6A 4E89A 2VL8A 4IO9F 1Y6IA 4H0OA 2ZSHB 1S5JA 1D5AA 3CCSN 5EG0B 2IS3A 2MC4A 1VQPN 2K9MA 2HS5A 3ZN1A 2IA1A 1VQ8I 5CYQA 1ORKA 4FHTA 3H0DA 2PI0A 2P9SA 3FKJA 3CTAA 1RDDA 2P5VA 4BEHB 3T0YA 1ILYA 2TDXA 4BJTA 3WEEA 2OTLI 3L4IA 1CXQA 3VSKA 3OSGA 3QESA 2L7MP 5AQYA 3K0LA 3LA3A 4YDUA 2K5CA 1XDSA 2F5DA 4B9QA 1N25A 2A5XA 2NRTA 3NRVA 1SMTA 5H20A 1U9OA 4BHPA 3K2ZA 3JRIA 1CF7A 3O9RA 4Y0WA 2UU9K 3EE8A 2DMTA 1SQKA 1T05A 4CEAA 1UJ8A 1E3PA 3QEVA 4CJUA 3MAQA 2OCEA 4LH4A 1UWBA 4NCAA 1VQ4I 2G7HA 4ETSA 3SZPA 3WNGA 1HYZA 2HXOA 3IMXA 1N78A 5M5WJ 5M1QA 1GXQA 3TR8A 2W7NA 2B9SA 1R58A 3TI0A 3OA9A 2Z1DA 1TK5A 4CO8A 4CVNE 1AKHA 3N4MA 4KH5A 4NC8A 4A2UA 2CYYA 3AA3A 2MH2A 4U7BA 4A3GJ 4BVPA 1KAXA 2G8HA 3GE1A 4ELTA 2Z99A 1RT7A 2D5VA 4R1HA 3OBYA 2K9QA 1E3HA 1KLNA 4DSIA 3A01B 1I6XA 3IAYA 4ID5A 1MBFA 4HDVA 3G71I 1VK0A 2D1VA 1I3AA 1V4RA 1BA5A 1BQNA 3K59A 1TKXA 4FK2A 4C8OA 3W2VA 3BCBA 2M8EA 5H6QA 3HO1A 3FZHA 4EJTA 4CZHA 4X65K 2G8FA 3SAGA 2QBYB 3O4QA 2HVHA 3SAHA 2R5YB 1UA1A 1OYWA 4J8FA 5H1SQ 3MCPA 5KQDA 5LMNK 2QKMB 4OLAA 3MECA 4RW8A 1NK7A 1FP1D 4B9TA 4PJMA 3TMOA 1LQ1A 4BR9A 1OYIA 1WQ2A 4Z0UA 2AQFA 3R0JA 3FIWA 2F6CA 2HHQA 4WWCA 3V1QA 1U2VB 2HHUA 5LD2C 2NOGA 1NWKA 2V6EA 1ZG3A 3GZ6A 1VHXA 1WJAA 4ABZA 5HS7A 2FSWA 4JI6K 4OMYA 1MJAA 1WSUA 1DPRA 2DODA 3IHUA 2JJ7A 4FJ8A 3D0SA 2O3FA 4JKFA 3SEZA 1FSEA 4EM2A 2DMPA 1ETXA 4OVLA 2W00A 5HLFA 1GDTA 1TQIA 1NGBA 4CK1A 4ZH4F 3VA3A 3DU5A 1BW5A 1CZ9A 3QBWA 3SEQA 3I8BA 1DKGD 4NQWA 4HG2A 3CJQB 3FXUA 4NC7A 5J8FA 1JKQC 4XSZF 4KT5C 4JI7K 2EA4A 1Q81O 2LY9A 4EATA 3JAMK 5F1JA 5JICA 5BN9A 1YRNA 3N4QA 1P7JA 3RI4A 2EA2A 2LF8A 3PQJA 1TQMA 1ULYA 2R4GA 3ZR8X 1GOCA 4L9TA 4LGWA 2B5JA 3JRFA 4RB0A 1HOMA 2ZXHA 4LFBK 3VPZA 4CEDA 1XC9A 3BQYA 3E01A 4U67L 1I1SA 3O8MA 2GWRA 2KJCA 4DTUA 3WHBA 4EGYA 3V9XA 4A5MA 5I42A 1BJAA 4QLCU 3CD6I 1YJWN 3FXRA 4NDLA 3K1PA 3WG7H 4AH9A 5FLVA 1T44A 1MH3A 3ZMZA 4HYEA 3P1GA 1SKSA 2PZSA 1NK5A 4I7HA 1W5CC 5FLXK 3IFRA 1XC5A 3KJVA 4H4OA 1T0FA 3I0TA 1V5FA 4UUTA 3KYDB 4JI8K 3MKWB 2P5OA 4PFPA 3S93A 2FXUA 5E84A 4BGDA 3IP4B 2RPIA 4CJ4A 2W1OA 3ZSXA 1S9HA 1HPMA 3AV9A 2EBIA 4XRSA 4PUSA 2A05A 5KI6A 2CFOA 5CVUA 3K10A 1YVNA 4RG8A 2A6HF 4CIFA 1TVRA 3G2BA 5KQ8A 3UKUB 3E97A 3DLKA 1P4WA 3HXLA 1Z6TA 4A57A 3KZBA 3HI0A 1ETWA 4NB4A 4XIDA 3KKSA 5TGTA 4O8UA 4N56A 5A2QK 2WA0A 4XKWA 4FXDA 2MC3A 1FOKA 4PJJA 2HQNA 1S9GA 1HMVA 3VEXA 2IP2A 1D1AA 1LNWA 3BR6A 3D5LA 2ID6A 1GLLO 3NWSA 1RIOH 3AA5X 4JKEA 1D5VA 1EF4A 2EZLA 3BEXA 2NRXA 3F8CA 5JVGL 1KQSM 2F48A 1S29A 1DLOA 5FD6A 3KP4A 4CZJA 5M3FJ 1B4AA 3SXYA 3SZGA 5L3FA 3FZLA 5IYBJ 3HRMA 1UAAA 1GLEG 1X3UA 5AONA 2UV1A 1KQ9A 1KGSA 4BXUA 3OR2C 3FMSA 5FJ8J 3AVHA 3FE1A 4MLHA 3J80Z 1S1WA 4HNUA 4EJVA 3BG5A 1JLBA 2GXBA 4FK4A 3IL2A 3H3OB 4H8KA 1LJ9A 4XM3A 3RMAA 4YIIA 3OS0A 4CXFA 3L2WA 2ZM6K 1T98A 4Y33A 4RLFA 1XMQK 3ZSYA 2QWLA 2A6EF 4RM2A 3SYTA 4CHYA 3PQKA 2J5PA 2EX3A 4CIEA 2L02A 3TDZC 3BUZB 4JD2B 4CEOA 3AVGA 1Q1HA 1VF9A 1TW3A 1X3ZB 3NBPA 3KLFA 1T03A 4DV3K 2A61A 1U8RA 1NJXA 3RTVA 3HSCA 5E1ZB 2IS1A 3C3WA 2GV9A 4JI2K 3L2VA 1NLVA 1WB9A 2KRHA 2EV0A 3OYGA 5C15A 4KIFA 1STZA 4AQYK 3LA2A 1NGIA 4JP0A 3UKRA 3ZSQA 3HYIA 4RGSA 4ELUA 2E88A 1LFPA 1QQNA 1I27A 3I64A 3VA0A 2EV5A 3KHYA 2E36A 3HM9A 4HUFA 3BR5A 1JT0A 2HPMA 3A02A 1T95A 3KVGA 2H8WA 4J2AA 1V55H 3I55I 1DU6A 2BE5F 4AVZA 1BL0A 3NH1A 1KA8A 1NK4A 3THXB 3LSMA 2E1OA