3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
2Y48A 1YAGA 1TLHB 1HKGA 3H1QA 1NGGA 4CBWA 2FF3B 4H5RA 1UFMA 1V4TA 2KIFA 1R00A 4PKGA 2FBKA 5HLGA 2GA2A 3WTWC 4O5FA 4IRHA 4CZEA 4FWQA 3T1BA 2KIMA 2WUSA 3LDOA 4K41A 3ZX0A 1Z9CA 3FMSA 4BRDA 1HKBA 4G9YA 5DCMA 1J6ZA 4LG0A 2KRFA 1TUUA 4RAZA 3P9IA 5I9EB 1WWXA 1GXQA 1OR7A 1XGOA 2P9NB 3RI4A 1D4XA 3WG9A 2ZF5O 3L09A 1R1UA 3KLNA 2EB7A 3QU6A 3FLCO 1X3UA 3KP7A 3EN9A 5JMVA 1RIOH 4I98B 4E70A 4LLGF 4EJUA 2QWMA 3WUHA 1WRJA 5HS9A 1KGSA 3REOA 5EEGA 2MH2A 1P6RA 4NB5A 1NGJA 4FWPA 2G7UA 3R0JA 3K69A 4L9JA 5BPIA 2VBZA 4KYWA 2A40A 3U4LA 1ZBSA 1CF7B 3F21A 1NGHA 4PKHA 3D2FB 3M8FA 4LB6B 2XAFA 4BGAA 5ED4A 4CYDA 2K7LA 2CYYA 3D2EB 1LB2A 4KA4A 1ATSA 2XRNA 4Q5SF 1U2VB 1KAXA 4BRIA 2GWRA 3TKYA 3BROA 1ZGJA 4K25A 1YS6A 5E17F 3QU3A 2J5OA 1R1TA 1Y0UA 3WGIA 1USSA 4MEXF 5E8IA 2LSOA 3RDIA 2HYFA 3FGUA 3HHGA 2HQNA 2QXLA 5AQJA 2DI3A 2PMHA 2D1KA 3WU0A 2GIVA 5D4RA 5J6XA 4BRAA 2P5VA 4G8XA 1BDGA 2HOEA 3CLOA 3QFPA 2HKOA 2Z33A 2DK8A 2RC4A 1V4SA 1BC8C 4HV5A 1K78A 1FYKA 3DWLA 3KEQA 3ULEA 1ON2A 2L02A 3F8CA 4ENMA 1S22A 4HBLA 1ZARA 4WQ5A 3QBWA 2GQQA 2FRHA 1J75A 2G9WA 2OAZA 3ZX2A 3LA7A 2P8TA 3TOBA 3FFKB 1GLFO 4UVCA 2UXXA 3KP5A 4KUMA 2FEZA 2MC3A 1ZH5A 1MA9B 1ZRCA 2IT0A 3R6MA 4WWCA 1HBXG 3ZETB 5D8KB 2FF6A 3K2ZA 2V51B 1FLIA 4M6XA 3EETA 3Q5FA 2BTFA 2E88A 5ILVA 1XMAA 3CQYA 4A12A 4I02A 1ESVA 2CGJA 1FZPB 5DCFA 4O5VA 3WXLA 4Q4ZF 1W4MA 1DKGD 4EHTA 4M9XA 2ZNYA 1KU7A 2ISYA 4GGGA 1UHMA 2D1HA 2EFOA 2RQPA 2VT2A 2R7DA 3LAPA 4GCVA 3BZ6A 1S6LA 5K5OA 4MO5A 4WQ5C 4MHGA 3EL2A 4DQ8A 4K2EA 4L0YB 4CI6A 3RYPA 4UXNA 2D45A 2F5EA 4CZGA 5DCMB 1E17A 4LG0B 3ZQ7A 4JNEA 4LFUA 3ENOA 4B1WB 4YFKF 4FL9A 4EJOA 2KHOA 2Q2RA 2GAUA 3EYIA 5DUIA 5JLHA 2VE8A 3MK6A 3CDHA 3KZBA 5E1WA 1REPC 4FOEA 1ZREA 5AZIA 3Q9SA 4E1JA 3ZMVA 4HV6A 3D7EO 3O1WA 1T44A 3PQJA 2QM1A 1LNWA 1O3QA 4DQ2A 5JHUA 3PFIA 4ON0A 1DP7P 1U2WA 4HLYA 4YG2F 1XGNA 1F1ZA 4A6DA 1O3TA 4AIJA 4U7DA 2JPBA 3WQUA 3T5XA 1R7JA 4A2BA 2Q1NA 2ZKZA 3QBXA 1JCEA 4EJTA 5L3BA 4FPBA 4XH5A 1YTYA 4A2UA 2V9VA 2DT5A 4EAHD 5AQOA 2Q97A 4L3QA 4FO0A 3NQOA 4JN4A 1O3RA 4UUVA 5K1YA 1I5ZA 2TDXA 4EVIA 3ZP5A 3SQNA 2EA2A 1ONVA 3BF3A 1ZAOA 2KKOA 1RUOA 2G7HA 3O2PE 4EJVA 3AY9A 2L4AA 2X0LA 1K78B 2QVOA 2CGLA 3ATVA 1IN6A 3LL3A 2WC2A 4FWKA 3VF6A 3ULEB 2A6AA 3JSOA 2AA4A 3ELKA 1I1GA 4FWLA 3GX4X 1O7FA 3RKXA 1C0GA 3WT0A 2FSJA 2OQGA 1DPUA 3KEOA 1FBQA 3TDUC 2PJPA 4Y15A 3BP8A 4WQ4A 1LVAA 5FPDA 3UKRB 2ASOA 4EHUA 5LJWA 4O6JA 2Q31A 2IVMA 1QGPA 3LDQA 1C0FA 3VEZA 1ZGAA 1TBXA 1RUNA 4M9ZA 5FD5A 1BC7C 2A6HF 5E8GA 2E2OA 3VOEA 3C7NA 2MD5A 1FOKA 2VE9A 1L3LA 1WI9A 3KP3A 3FR0A 1YYVA 1SD7A 1EH7A 1HQCA 3QP6A 4HQEA 3G73A 1LOTB 1QQIA 3QFUA 3SFZA 1EH8A 3SXYA 3H3OB 1ON1A 1EH6A 2W24A 5HLHA 4UVAA 1QO0D 1J9IA 5D5VB 2ZWHA 1U3EM 2RNJA 2IIRA 4ISFA 3VEVA 4MTEA 4BC4A 4WQ4C 5AFUA 1F4KA 5D4SA 4GO1A 3BJOA 4RGXA 2H09A 1K8KA 5F2RA 3DXMA 5JLFA 4LD5A 5D6FA 1I27A 2FMLA 3FMRA 3L7WA 3L2CA 5AZIB 3GE1A 5BPLA 3QPHA 3KVGA 5HS8A 1GLBG 4CGZA 2P9UA 3BPVA 3FZHA 1R22A 3M1FA 5L3GA 2HGCA 2F9TA 5CVIA 4PL7A 2FXUA 2EV5A 4H5NA 4JD2A 1AWCA 3L0QA 4AWXB 5AQWA 3DQVC 3MWMA 4LK0F 1IXSB 1LQ1A 2YHWA 2HTSA 1B9NA 3V4GA 1W7PA 3N97A 4L0ZB 4BRQA 3E3VA 3GYHX 5EX5A 1XGSA 2VT3A 3SZPA 3GFIA 3A5NC 3ABUA 3U9ZA 2ZXJA 4RGSA 4P96A 1QBJA 3UKUA 3M3ZA 4CZLA 1HSJA 4B8XA 2H27A 3WTXC 2RN7A 4N9HA 2AXLA 2C6YA 1MWMA 1TQIA 1S7OA 2XV4S 3K0LA 3ML6A 4U88A 2NLXA 1AOYA 2XHKA 3M7GA 4LGWA 1QPMA 1PDNC 5AQGA 2CFXA 5DDGA 1T98A 3HRSA 3VEYA 2DAOA 5AQQA 2DPDA 3NRVA 1MWKA 2P9NA 4CHUA 3HRMA 2V1DA 1SFXA 3HRUA 1YG2A 3HTUA 5TJJA 2HF4A 4TV7A 2FNAA 4U0WA 4CICA 1QQNA 5BRDA 3ZPLA 5E18F 1DPRA 3IUCA 5AQZA 3DV8A 5HDKA 4B9QA 2QZ8A 4IO8A 5L3FA 4DNCA 1YUWA 4ZZDA 2FSNA 2QM3A 3A5OC 1IZ1A 2Q0RA 2CQKA 1BU6O 3FZMA 1XCVA 2IJLA 3OOPA 1S7AA 3BY6A 5KPZA 2QWOA 4MNUA 3FXUA 3RPQA 1XD7A 1GLJO 2HS5A 2H6BA 4QS7A 1JCGA 2GTDA 5AQTA 4H0VB 3TU5A 2M45A 5JR3A 1ZRFA 1U2VA 2ZGZA 3R61A 4FHTA 3UB5A 1JCFA 4BC3A 1FSHA 2XIGA 3C7NB 1CZAN 2DU9A 4P9FA 1DEJA 1O3SA 4L18B 4BNCA 3E6BA 3LDNA 5D6EA 1OMIA 4BRHA 2PFBA 4L5IA 2GXBA 1KAZA 2ACJA 3HOSA 2L54A 3WQTA 1LDDA 4FWMA 2P9IA 3HTSB 4Y17A 3E6CC 5ADXA 3FHZA 1FSEA 3J81K 1ZG1A 5E1ZB 4UV9A 4ZYHA 1MZBA 1IG8A 1XDUA 2I7NA 3WE2A 2A69F 3CETA 2CO5A 2XROA 2VOPA 2W85A 1GLAG 1HX1A 2BBYA 3M6GA 1KU3A 3F9MA 1P92A 1R59O 2MLGA 4HDVA 2MH9A 1E2XA 1OYYA 2GELA 4HAMA 4KNYA 3DFGA 4IF4A 3ZETA 3WTUC 1FWZA 3CJ1A 4JD2B 3ZX3A 4KN4X 4HWIA 3GO5A 4HF0A 1FBSA 4QWQA 1ATRA 4RTFD 2P6SA 1W7PB 5BS6A 2A5XA 2VODA 5BQTA 4NHJA 4HZFA 5AQKA 3O08A 3CERA 4KMFA 4BR4A 3UKUB 3H45C 3MZHA 4WYBA 1UB9A 1KU2A 4BR7A 3I58A 3MAJA 1NGIA 2L01A 5EEHA 2ZGYA 3VEOA 1R58A 2FBIA 2FSWA 3WE3A 4EM2A 1LDJA 3COAC 4CZJA 4FT8A 2CSOA 1J2XA 1ZG5A 4LMYA 3KFWX 4ESBA 1BI3A 3FMQA 1HKTA 3CJCA 2B0LA 4G7HF 1BBYA 2V52B 4Q48A 1EQYA 4R79A 1H9GA 3UE5A 1STZA 3EUHA 4XLPF 5BPMA 3ZMSA 2W41A 4OIQF 5D5UB 1FPQA 5IT3A 5BN9A 2V1XA 4HX8A 1KXPA 3CO6C 5FFXA 2YHXA 2M5WA 2FLOA 4I6MB 1J59A 4IXAA 2K86A 3GZ6A 4HDUA 2YHYA 3EZWA 2HKXA 4QLCU 5L3EA 3ZMDA 3HSFA 3J7AO 1Q1HA 1P2FA 4OIPF 3WTVC 3IKVA 2KIUA 2EWSA 1IXRC 3GWZA 3EDPA 2GUPA 5AZJB 3QICA 3BJAA 4DHYA 2UXNA 2HMPA 2NRHA 4A0YA 1PP7U 1QQOA 5BREA 2EA4A 1RDWX 3DKWA 5F1XA 1YLFA 2D0PA 1HUXA 2ITMA 4JK1X 1U8RA 3O6BB 2QWWA 4A0ZA 3VFZA 5AQIA 4PZJA 1TNTA 2P9IB 3TO7A 2ETHA 3CO7C 1G6NA 5HLIA 5EY4A 4XSZF 1DDNA 1FT9A 1HW2A 2HWVA 3HI0A 4MQ9F 4Z94A 5JVTA 2Q36A 1QZ6A 2DQRA 1J0RA 2LDUA 3I0TA 4D0PA 3VF4A 2E2QA 3AAQA 2PG4A 3EKSA 4F7ZA 4M74A 1E4FT 5LRSA 4FX0A 5BOXA 3JW4A 4FWOA 2YR2A 3CJ9A 3QP5A 4P55A 1BIAA 2A42A 1BWFO 2FU4A 3SLCA 3FZVA 2EFNA 2F5DA 5CVVA 4BQAA 2RVCA 3HOTA 4BRPA 4G6QA 1F5TA 3IRQA 2VOOA 3UKRA 2A3ZA 2VYPA 2XAJA 3VOVA 1I1SA 1WUAA 1BA1A 3H1VX 3TQNA 4M9SA 4BQZA 3AARA 3ZMUA 3JAMK 1ZLKA 4O3MA 4B1ZA 4FWRA 3SMPA 1BOAA 2QWPA 2QQ9A 4BHCA 3KZYA 5L3CA 2ZO4A 5AQXA 1YW7A 1GLCG 3MN7A 3WTYC 1DGKN 1KYZA 2P9PB 1R36A 3VEXA 1FP1D 3TOAA 1YXQA 1NGCA 3I8BA 5LGUA 2P5KA 3E5XA 5CVUA 1BUPA 4KFCA 4BREA 3GXOA 3GUDA 2MLKA 2HF3A 3IC7A 1LCUA 2VBYA 1XSVA 1PP8F 1IN7A 2WWYA 1ZHFA 2E1YA 2GZWA 2VWBA 2OZ6A 5TRDA 2QW9A 4BGBA 1R5HA 4BXUA 2HDCA 2D1VA 1SMTA 3MEXA 1V4RA 1WKMA 4UVBA 1OPCA 5FO5A 2H94A 4CZZA 5HDNA 3LM2A 3HSRA 3RPUA 2QWRA 3RYRA 2A61A 4P5OA 2Y0MA 2Z3YA 3GBTA 4OIOF 1SQKA 3ZMZA 2DPNA 4MTDA 1K79A 4CZMA 3GF2A 3I71A 1ZYRF 3K1NA 5LHHA 3G25A 4ENJA 3Q9VA 3D0SA 2IW5A 1UHWA 2HTJA 3VENA 3IRRA 4RB0A 3DJCA 1IN5A 1S29A 1HKQA 4FWSA 5BN8A 5LLQA 4IXCA 5AQPA 4MLEA 1EV7A 4BAYA 4HF2A 4AD9A 2JZYA 4CZKA 1BM9A 1RZ4A 4IPAA 4H0TB 3F8MA 1KA8A 2FE3A 3J81Z 2NRAC 4C23A 3ENHA 2VC0A 3W6KB 1WQ2A 1BG3A 4HX7A 4G7ZF 4BROA 3J80K 1ZRDA 2LNBA 1CGPA 5AQFA 5A2QZ 2IA1A 3T8TA 2I7PA 3ROUA 1SAZA 2BEOA 4M6YA 4F9OA 3CUQA 2GEMA 1GXPA 3IMXA 2LF7A 2VXZA 3B02A 2YSRA 4IJAA 3CHWA 5DV5A 2ESHA 3F72A 4CO8A 3TPQA 3QPTA 3LWFA 3H6EA 2HZTA 2QQBA 1TYQB 1QZYA 2VBWA 3VERA 3T0YA 3DP7A 2QQAA 2EV0A 3V7RA 4CZIA 5KK1A 5DYMA 5F0XA 3WEEB 1JGSA 4RGUA 5BR9A 4OOIA 1T2KA 1G4DA 2BE5F 1HXDA 3DPLC 4M7XA 3MFKA 2Z99A 4XH4A 2JSCA 4I09A 4U0VA 5LRRA 3U9DA 3CUQC 3F8NA 3B8AX 2CW0F 1IXCA 1MJ9A 1KYWA 2F2EA 1MKMA 4MO4A 3IWZA 3P9KA 1FYLA 2D0OA 3E6DA 1IAWA 3QMLA 1E4GT 3L4IA 1J7KA 3I59A 3O3KA 3LDLA 3GLXA 3F22A 2P9LB 2O8XA 2HQRA 4YFXF 1OYIA 3IL2A 2P9KA 2A68F 3BDDA 3KP6A 1QNTA 1BI1A 1TW2A 1VTNC 4BR0A 1IN8A 4CDGA 2FOKA 3DAWA 1ZLJA 4A6EA 4EQQA 4PGHA 2HYGD 4GYGA 4P9UA 5B8HA 1BN5A 2BYVE 1V3FA 2UYTA 2Q0UA 3WTZA 2O6GE 5FPNA 3FXQA 3E97A 3N4MA 3WTTC 1GLLO 4ESJA 4B09A 2BUPA 4FSVA 3KCCA 4JHDA 5IT9K 5LEJA 2FA5A 3S2WA 1U5TA 2YX4A 3S41A 1O7LA 2YI1A 2QLZA 2IVOA 4NB4A 2FBHA 3ECOA 3A5MC 4A5MA 2QBYB 4FWNA 3VETA 2QENA 3CJ7A 1P4AA 2VONA 3PQKA 3WODF 2PQ8A 4ENKA 4RWTA 1G99A 4NQWA 4OINF 3GL1A 2W84A 4L9VA 2IPQX 3FX3A 4U7BA 5ICCA 1Z91A 3VPZA 5H6QA 4BRKA 1U6ZA 4I01A 4LLNA 2PI0A 2R7FA 1ZN2A 3JS6A 3BWGA 4OIRF 1U5TC 5D5XB 4GNIA 2W40A 3CUQB 5AQHA 2ZMEA 3BJ6A 2F9WA 5AIPA 1BA0A 5BRFA 2MA3A 3F8BA 3A5LC 4A2AA 3GEZA 4I6MA 1SFEA 2YU3A 3WGGA 1FBUA 3O80A 1BIBA 2KJBA 3OHRA 1MDMA 1MJBA 2STTA 2EK5A 2Y75A 1H0MA 4HYEA 3V7SA 1YIOA 1YS7A 2NAZA 4UV8A 4M63C 5AR0A 5EVZA 5K5QA 2V1UA 4AIKA 5FPEA 1QZ5A 1J5YA 3GOIA 2W57A 3H46O 5FPMA 4YDUA 5AZJA 4ZYEA 3FM3A 1FX7A 4JQFA 5KVRA 2UZKA 1UCRA 4CBXA 1XQSC 1HPMA 3D5LA 2R3SA 2XAQA 4LLLA 3EKUA 3VGLA 4EGZA 1KQ8A 4EGYA 3VESA 5CE3A 2EJRA 4LC9B 3M1EA 2E20A 3I64A 1SFUA 1GLDG 5CVRA 3LQRA 3GFJA 4H5TA 4EJWA 2QWLA 2PAVA 3I59B 1B4AA 3M8EA 4BR2A 4YIFA 5KPRA 3BUZB 3ULQB 3K1PA 1W5SA 5BMZA 2XUBA 2P9KB 1IUYA 3IDHA 3VGMA 2XGXA 2IA2A 4MGRA 2PBIA 3W6JB 4BRFA 4YDUC 1BJAA 1BO5O 2XKPA 4H0EA 2VBXA 2X4HA 5AQLA 1NGBA 4CZFA 3R4KA 4HW0A 5FGMA 1QQMA 1NBWA 2YX7A 4Y13A 5F6FA 4CJ7A 4HQMA 2PMUA 3FXRA 2YCHA 1T6DA 4JHDB 2NYXA 2CH6A 1HKSA 1U5TB 2M8EA 2ADUA 4BRCA 2DBBA 5KQDA 3C1DA 2OANA 4BH9A 4BHBA 4CXFA 2E1ZA 3O1BA 4O8KA 4H5VA 1XC3A 3ISPA 1D3YA 1S3XA 4FPAA 3FZFA 3KLOA 1JE8A 4KIBA 2FQ3A 4Z2YA 3C7JA 6PAXA 1MGTA 5LBQA 2P9PA 3DXKA 2LF8A 4OMYA 1JXSA 3O8MA 1HW5A 1U78A 1K7AA 1WOQA 3U8XA 5ILSA 2EFWA 1BI2A 1R5GA 4LK1F 1X3NA 3V8KA 1JHHA 2NNNA 3I33A 5AQMA 3R9PA 2DTRA 3VEWA 5FFZA 1R1VA 3J80Z 3JTHA 3QDKA 1G3SA 1T6SA 5FLXK 1FNNA 4EIAA 1T0FA 1G3WA 1IN4A 3MCZA 1G3YA 2ZMEB 2A41A 3HSCA 3WU1B 4R1HA 2W25A 2P7VB 3IWFA 1T38A 4NO7A 3HHHA 1ULYA 2CG4A 3C18A 3FZLA 3OV8A 3LA2A 4YFNF 3ZN1A 3ZN0A 1XGMA 1X3MA 1R23A 1XMKA 1MDMB 3W3DA 2P9SA 1TQPA 4BR5A 4EM1A 2M30A 2P6TA 3ERED 3H3NO 4WK8F 1NGEA 1B59A 2E7WA 2CGPA 2E7XA 3GZ5A 2Q2EA 2E2PA 5J8CA 2O03A 2EWNA 4WXDA 1YQAA 5LGTA 2XKOA 4H5WA 4A0XA 2DLLA 4G6DA 2XAHA 2MBFA 1HKCA 4AM7A 2M1BA 5BRHA 3R8EA 3LSTA 5F64A 4JAXA 2ZCWA 3R0AA 4I2OA 1HLUA 3HZ6A 3LM9A 4B1XB 2YJEA 1HW1A 3LAJA 2OZUA 5AQVA 4L5JA 1SZ2A 3L00A 1ODDA 3GG4A 3RKYA 2Q8KA 5JI6A 3FWEA 4PDKA 1Y64A 3WTSC 1P4WA 3KE2A 1HJOA 2K27A 1GVJA 1YW9A 1Z7UA 4ESFA 2VN2A 3LFKA 5ERIA 1H9TA 4GY2B 4N9IA 2RKHA 5L3DA 1BI0A 2O0YA 4HLXA 2CGKA 3U2RA 4IWVA 2JTVA 4XLNF 1S8NA 3SZTA 4IRGA 1Z1DA 3ABTA 2DW4A 1TYQA 3GVAA 4KIFA 2CWEA 3MMVA 3HUGA 4XSXF 5AFUH 2STWA 1X9JA 4AIHA 5IT9Z 5DD4A 3CJNA 1BOTO 2CH5A 2DPUA 4RS8A 1NGFA 2ZBKA 5DUKA 3WEEA 2FXAA 2EFQA 2K02A 2HEOA 1B1BA 2HFHA 1W5TA 5E1XA 4CD3A 4DCHA 2YJFA 4ISEA 3MDQA 4I0AA 3TO6A 3A8YA 2GXGA 3DXKB 4BR9A 5AQRA 2K4JA 4N0BA 1OYWA 3H3UA 3LDPA 2VCPA 5AQNA 4J8FA 2QUFA 4PL8A 4I0BA 4U0YA 1S3JA 3I5UA 5D8LB 5HS7A 5AONA 2V79A 4ASNA 4H0XB 4RB3C 2IRFG 1Z05A 2P9LA 2ASPA 3CIPA 3MCPA 2UWMA 2M87A 4ZYGA 4AVPA 1WSUA 2XVCA 3HM8A 4L9TA 4WCGA 3FM5A 1I6XA 3F8FA 2E1NA 1LJ9A 3I53A 3C3WA 3H92A 3C0BA 1IRFA 3RJPA 5J8FA 5FD6A 3MN5A 2P9SB 4BYYA 2FMYA 4MLHA 4FOIA 2F5FA 1SD6A 4K42A 3HSEA 3RIRA 3EO3A 3BOQA 3EQLF 5JICA 1U6GA 1IW7F 3VEPA 3DPTA 4S04A 1XUPO 4CD1A 1W7PD 4H03B 2GA1A 1MJAA 3EYYA 5CJ9A 4OMZA 4BVOA 3HBTA 4IJNA 4KBOA 2ASMA 4ZYDA 2QBYA 5ELZA 4MEYF 1OKJA 4UHTA 4BC2A 2ISZA 4B1UB 3P9CA 2K4BA 3E5QA 3BEXA 1NWKA 1KQ0A 4EM0B 4ENNA 3WXKA 4WXHA 3HYIA 3O4WA 1Z6TA 4EV0A 2PN6A 4RB2C 2JT1A 2DFIA 3KHYA 3VGKA 1B9MA 1NMDA 3KZZA 5AQUA 4A61A 4AM6A 3U1DA 1YO5C 5BPNA 1D5VA 2E8AA 4KICA 4FX4A 4HTLA 4CZHA 5KQ8A 5DEQA 4IVNA 5LGNA 4UNOA 3CI5A 4K43A 3FZKA 1USTA 2ESNA 4S05A 1D8JA 3IKTA 1RFQA 2XAGA 4RB1A 4DB3A 2Q0OA 4BRMA 4B1VA 3F3XA 1XSDA 1K6OA 3WXJA 2PLYA 1XB4A 1MDUB 4ZH4F 4IHTA 5E20A 5EOYA 3IFRA 4BG8A 4BVPA 3TO9A 1P8ZA 2VC1A 4BHPA 5ADXH 4WF2A 5LY3A 1KAYA 5FB2A 2V7ZA 2QYOA 4XBFA 2LKPA 2QWNA 2O61A 1KQ9A 4KN7X 4XEIA 3DEUA 1IF1A 5ICGA 3HIFA 2J5PA 2WTEA 5ILUA 2ZJ2A 4XRFA 4WX9A 4LB5A 3GFLA 4H0YB 1KU9A 3VB2A 1PUEE 3V8LA 3RSEA 1XDSA 2H6CA 4BRNA 2PEXA 5BPDA 4BG9A 3T8RA 4M71A 3WGHA 5ICFA 3GW2A 2F5CA 3V8JA 3QOPA 4MQVA 4PGGA 1GLEG 3HRTA 2JPCA 4KMUX 2NS0A 5EXWA 3AAFA 5HDGA 3O5BA 3RKWA 2NNYA 3TDZC 3CQXA 5LHGA 3B73A 1YW8A 4YIIA 1NGAA 1G3TA 4BRGA 3SK3A 2A07F 3JSPA 2E2NA 3P4IA 1SD4A 5K5RA 5FLXZ 3A0IX 3M9AA 1LEAA 3ZEUA 3WXIA 1QZZA 1NGDA 1RI7A 1SAXA 3L6QA 5AIQA 5E26A 2D2WA 3GFMA 3LQQA 2E1CA 3JTGA 2OBPA 2J4RA 1ZXOA 3I4PA 3V7CA 3MN9A 3ZMTA 2V6CA 3W0LA 4HA8A 1ZG3A 3H3ZA 2HR3A 3E5UA 4I7HA 4KDPA 4Q47A 5D5WB 2RGVA 3TGNA 4ETSA 1FP2A 3LA3A 3SHFA 2OA4A 1YFHA 1OKRA 2AS5F 1HSTA 4M7YA 2EV6A 3ECHA 4B1YB 4M73A 1NM1A 2Z5UA 4A5NA 5H20A 1JHFA 3MZYA 4GYIA 1FY7A 1MD0A 1T6CA 4LJZF 1TNSA 2IVPA 4RAYA 5JFRA 1B6AA 4IHSA 3MQ0A 1SMYF 3CUOA 3ID8A 3VF2A 3KP2A 3K1MA 3J8AA 2A6EF 2P7CB 2COMA 1TQMA 2RV8A 2D4WA 4JBAA 2ZFWA 1IJJA 4IZ9A 2L4MA 4WXCA 5AQYA 1XCBA 1IRGA 3SMSA 3CTAA 1FC3A 5CYVA 5HVQC 4QS9A 3BPXA 4RCHA 3F6OA 1RNLA 3R60A 2YPRA 4EFHA 4IRIA 4H0PA 3KP4A 4GXOA 2BV6A 2IVNA 3R6SA 3HTVA 4PCQA 3AAPA 4QS8A 3FF5A 3U9GA 4XH1A 3IHUA 3ATUA 2EFPA 1XN7A 1SD5A 2ZNZA 2A5YB 4BRLA 5LHIA 2H3GX 2V7YA 5H6RA 2OU2A 3BF1A 4PKIA 3F23A 1CF7A 2WV0A 1O57A 3NEUA 2GWKA 3FE1A 2A3SA 1ATNA 4A62A 3JAMZ 3D2FA 2OD5A 4Y0WA 3F6VA 3QRFF 1RGIA 3D2EA 2RDPA 2Z9OA 2IA0A 5E84A 3E6MA 2FSKA 3RSEB 1F9NA 2DK5A 1C0WA 1NLVA 3K9TA 1ZC6A 2NZTA 4R8HA 4L9NA 4HOBA 4G94A 1FYMA 1Z6RA 1GHCA 4BQLA 3KETA 2GWJA 2OQRA 2P4WA 2FNPA 4CBUA 3QAHA 2L3DA 1NHAA 2QWQA 3MN6A 1L0OC 1Q18A 3ZEUB 1DUXC 5DD8A 1K8KB 1TW3A 4KT5C 4M72A 3DXMB 3G3ZA 1H1VA 5TKYA 4ISGA 1TTYA 3JXUA 3L9FA 3VODA 1A04A 3QB0A 5A2QK 3CJAA 2ELHA 2DO7A 5CVJA 1YVNA 3P7NA 2AP1A 2P5LC 2P9UB 1P4XA 4EMSA 5LEKA 2FF4A 4H0OA 5LJVA 4HX4A 4ZZLA 5ICEA 3I54A 1XSXA 5KPTA 5F1RA 3CJBA 4G7OF 4BC5A 2JRTA 2O3FA 2KJCA 3DXJF 3GDQA 2IP2A 3SJHA 2PBDA 4KIGA 1LDKB 2BGCA 2XASA 5HOOA 1T39A 5AQSA 1LEBA 1QHAA 4RGRA 4HF1A 5CLSA 4OU0A 2DQLA 1TUYA 1D8KA 3DF8A 3O6WA 3RTRA
chains in the Genus database with same CATH superfamily
2Y48A 3BR2A 4CEEA 2FC0A 4H5RA 1KLMA 2DOAA 4PKGA 2Z1IA 2JGUA 2RHKA 4XKWA 2KIMA 4KHWA 4LG0A 1WWXA 1OR7A 1XGOA 3H1CA 2X78A 5JMVA 2OC6A 3PIOL 1AHDP 1NK5A 1VQ7N 5EEGA 1P6RA 4E19A 4NB5A 1NGJA 4FWPA 2G7UA 3R0JA 3WXMB 1CF7B 3FXOA 3D2FB 3CM5A 3SQ2A 2K7LA 4HUEA 2CYYA 2KZZA 1LB2A 1QS4A 1B8IA 2TCTA 1ATSA 3C2GA 1RT5A 1KAXA 1X1BA 5E17F 2M7BA 2J5OA 3WGIA 4MLOA 2DA2A 5E8IA 3HHGA 2QXLA 4OPJA 5E3LA 1HJRA 1C6VA 3CF2A 1DQUA 3WU0A 2GIVA 4BRAA 2P5VA 3QFPA 2B6AA 4LF6K 2OCCH 1JKPC 1V4SA 3GTJJ 3TAGA 1VRTA 3ULEA 4ENMA 4B9TA 1RBSA 2V9PA 3QBWA 3JRGA 1J75A 4S0HB 2G9WA 2OAZA 3GTGJ 2P8TA 1GLFO 2LK2A 1MA9B 1ILYA 1IKXA 4WWCA 2AXTC 1HBXG 2ZJRL 1MMAA 1FLIA 2BTFA 3Q5FA 4AU7A 2HHVA 4A12A 4I02A 1BISA 2ZJRF 1DKGD 1W4MA 2BY2A 3OIOA 4M9XA 1KU7A 3HOZJ 4CJKA 2YKNA 5DM6F 2EFOA 5C3EJ 2RQPA 4KH4A 3LAPA 4GCVA 4MHGA 2DYRH 4DQ8A 3LSPA 3BCBA 2D45A 4CZGA 4F55A 4KJZA 1EWRA 3ZQ7A 2JWKA 3ENOA 3P5JA 4FL9A 1SVOA 5HRPA 4IQ4A 4JP0A 3CDHA 3KZBA 4BACA 4FOEA 1ZREA 3Q9SA 2KFZA 3O1WA 4YRVA 4DSJA 4ON0A 4HLYA 3HRGA 2X6SA 1KD1O 4A6DA 1O3TA 4U7DA 4AF1A 3CC2N 3T5XA 1U8BA 3W3CA 2Q1NA 2XSDC 2WB1A 1JCEA 4FPBA 1U47A 3SUOA 1P9QC 1BA5A 4JI2K 5AQOA 1YT3A 1NK8A 4UUVA 5K1YA 4PUSA 2TDXA 2DODA 5I3UA 1D0XA 5KNLA 2ZJQL 2MW8A 3AY9A 2WFBA 1W1WE 2L4AA 1YJWI 1K78B 2QVOA 2ZJQF 1IN6A 2WC2A 4KAZA 4N41A 1I1GA 3GX4X 5J2QA 2Y31A 3VA0A 2PJRA 2VPLA 1MBJA 2JA2A 5C24A 2OQGA 4IZZA 3GZNB 1T95A 2UU9K 3BP8A 4WQ4A 5IP7J 4F52A 4EHUA 4LFAK 1TBXA 1TKTA 1BC7C 2A6HF 5E8GA 2Y2ZA 3VOEA 1L3LA 1EH7A 4IFYA 3G73A 3QFUA 3H3OB 1ON1A 4F91B 1EH6A 4DZJA 3CCMI 2ZWHA 3VQ5A 4FQGA 2IIRA 4DLGA 3VEVA 4W5RA 5EYRA 3U6FA 1JT0A 5JLFA 5D6FA 3AO3A 2FMLA 1Y97A 1T33A 2HHQA 5AZIB 2IAIA 4CJTA 4AC0A 4NYNA 2BY0A 5JLWA 4CGJA 3BPVA 1GLNA 3FZHA 1I94K 1R22A 2F9TA 5CVIA 4PL7A 2XY5A 1AWCA 3MWMA 4QPOA 4DLEA 2OCEA 2HI3A 1W7PA 4L0ZB 4O8UA 1AKHB 5EX5A 3A5NC 2ZXJA 4RGSA 3M3ZA 1HSJA 3SUQA 3U21A 5C4XJ 3RR8A 2RN7A 2AXLA 3K0LA 3ML6A 1VFCA 4GVEA 4FJKA 3TBIA 3OJSA 4RW6A 1JKQC 2NVYJ 2V1NA 3LP3A 1YG2A 1ZKGA 2JUCA 4CICA 4V19K 3NMUA 1QQNA 5BRDA 2EZKA 3MCAB 2PYLA 1XX5A 1K73O 3DV8A 3VQ7A 4LFCK 1YUWA 2HNDA 4DNCA 3HM5A 4E7HA 3VQQA 1IZ1A 2Q0RA 5F0HA 2CU7A 1XCVA 4E1NA 3M3YJ 2IJLA 5KPZA 3J7ZO 5FLXO 3CF5L 2H6BA 1JCGA 2GTDA 2X6OA 1S7EA 1ZBFA 5JR3A 1ZBUA 1YVUA 1Q9YA 3CF5F 2GV9A 2CV1A 2NUBA 4Z6YA 3SYZA 2DU9A 1DEJA 1O3SA 3HBLA 3E6BA 3LDNA 1ASUA 3KZIC 3NF8A 2PMZN 4L5IA 3VYSB 2KRCA 4LOCA 3WQTA 4FWMA 3DTIA 3VQ6A 1XS9A 4Y17A 2AQEA 2VKEA 4FLYA 1FSEA 5E1ZB 5GAHJ 1IG8A 1JXEA 1LW2A 3OBWA 3CETA 4F8RA 2CO5A 5EZHA 2VOPA 1GLAG 1R59O 4NCBA 4IO9L 3FISA 4HDVA 1E2XA 1OYYA 5M1FA 3WTUC 1WSGA 4BDZA 4IO9F 4HWIA 3GO5A 5BS6A 2A5XA 4NHJA 1W2BM 3I8DA 3CERA 3O9SA 3MZHA 3C65A 2X1EA 5GP9A 1NGIA 2L01A 5EEHA 2ZGYA 3WE3A 3COAC 2CSOA 5C4JJ 1ZG5A 2WONA 1LV5A 1BIZA 4PK4A 1Y8QB 1BI3A 4RLFA 1HKTA 2JA8J 3RQIA 3NGZA 4G7HF 2QA4I 4CJFA 4Q48A 1HNZK 1EQYA 1H9GA 1STZA 1BR4A 1WFXA 2NS7A 2W41A 4OIQF 5D5UB 5J40A 2V1XA 1KXPA 2M5WA 2FLOA 4I6MB 2YHYA 5J1RA 2LMDA 3B6PA 1U48A 3HM9A 5IP6A 1RTIA 4HCBA 1HRHA 2K5CA 5AZJB 3M1CA 3EE8A 1PP7U 1QQOA 4CECA 4FJIA 2R5ZB 4FZXC 2A05A 5F1XA 5JLXA 2D0PA 4IHXA 4JK1X 2QWWA 4A0ZA 1Q1VA 4PZJA 3DKYA 3CO7C 1G6NA 3T1AA 1FT9A 1HW2A 1ACIA 4MQ9F 2Q36A 1J0RA 4CK2A 2QK9A 3AAQA 4F7ZA 4D7NA 4DFJA 4FWOA 4UY8O 1WSJA 2CUJA 1JLEA 5J1EA 3QP5A 2A42A 2F4IA 1QRYA 3SLCA 1YTAA 4CF9A 3NF9A 4BQAA 2FJ1A 2RVCA 2E6MA 2VYPA 3H5RA 1B9DA 2MYSA 1A6IA 3HT3A 3L2WA 4DU1A 4O3MA 2ZO4A 1NKEA 3MN7A 3THYA 2P9PB 4BDYA 2XF6A 5KAFC 3TOAA 3CCUN 3I8BA 1XC5A 5LGUA 3G1LA 1BUPA 1LVKA 4KFCA 3ONQA 3GUDA 3IC7A 3T1HK 2VBYA 3O3GA 1XSVA 2FBYA 2WWYA 1P7IA 2K9SA 1BQNA 4BQOA 2L9RA 4E7IA 3TTCA 3TI0A 4AYBA 3MEXA 1YX3A 1V4RA 1WKMA 2KFNA 4XICA 2GM4A 3G2BA 3PSIA 5HDNA 3LM2A 2P81A 4AQYK 3CM6A 4Y7NJ 1ZBLA 1SQKA 3MN2A 3K7AJ 1S1XA 1K79A 4CZMA 4A3BJ 3NDKA 3K1NA 3G25A 3Q9VA 4PSXA 3D0SA 3IRRA 4RB0A 2QKKA 3KJVA 1PUFB 3DLAA 4IXCA 4MLEA 1EV7A 4HF2A 2G8VA 5DMRA 2NVXJ 1RZ4A 1KA8A 2FE3A 2VC0A 3W6KB 4DTUA 4HX7A 3J80K 5E3MA 5AQFA 2IA1A 2I7PA 3DTKA 2BGGA 3O6WA 5GTHC 1V55H 3CUQA 1CXUA 1YIJN 2VXZA 4DMNA 2G8IA 1BCMA 3S2DJ 2UV1A 4JKEA 2LG4A 4BS9A 3IS9A 5DV5A 3F72A 3LWFA 4FJJA 3H6EA 4I99C 1QSYA 4CGDA 2QQAA 2EV0A 4CZIA 4JYKA 4RA2A 1BL3A 1IGNA 5BR9A 1VQLI 1T2KA 1G4DA 3VMFB 2D5RA 3E9LA 3DPLC 1ETOA 1VQ6I 2I5UA 5K7HA 2JSCA 5LRRA 2KZVA 2XRLA 1RR7A 2F2EA 3P9KA 3VPRA 4XLAA 4JKBA 2D0OA 4KO0A 4RG8A 4YFXF 2P9KA 1BI1A 2BXZA 4BR0A 1V5EA 1IN8A 3S1QJ 1JUPA 1KTQA 2BYVE 1V3FA 3WTZA 1YITN 4DTRA 2KRHA 3DRSA 1MBGA 3WTTC 5DTDA 3KCCA 5KAIC 3TW7A 3S2WA 3AG3H 2QLZA 3K10A 2IVOA 3I9V2 3LSJA 3A5MC 2HBLA 4JRPA 1EO1A 4LFBK 4W97A 1BW6A 2VONA 3PQKA 1XWLA 2O8FA 4ENKA 3P38A 4BQQA 3GL1A 3FX3A 2DYSH 3CJRB 4EZ6A 1U45A 4BRKA 2RNGA 4I01A 4LLNA 3DMJA 4B47A 4PFOA 4YFUA 2DN0A 1X1AA 2HXIA 2UUAK 3GEZA 4I6MA 1BIBA 2K3FA 2JVHA 3OHRA 2EK5A 1YIOA 2NAZA 4UV8A 4XNFA 5MLCQ 2V1UA 3QYFA 3GOIA 2LY2A 2W57A 2HHWA 3WG7H 5AZJA 5TISC 4C8MA 2ICWG 1N36K 2UZKA 3ZSQA 4OJRA 5FKOA 3THXA 3CZ6A 3ZRGA 4LH4A 3QETA 4IEJA 4DSLA 4DV0K 3JRDA 4LLLA 3EKUA 2EX3A 4EGYA 2KP6A 2EJRA 5CPRB 4LC9B 2E20A 3E7LA 3THWA 3CCEN 3GFJA 4M42A 2KKZA 1XMQK 2XUBA 4FM1A 4CJWA 4GDFA 2VKVA 1U9OA 1W97L 4YDUC 2XKPA 4QPQA 2X4HA 3AG2H 4H8KA 5AQLA 2ME6A 3R4KA 3DU6A 3LP1A 4CJ7A 4HQMA 5J47A 2DFFA 4CJLA 2CH6A 1U5TB 2M8EA 2E1MC 2CUEA 4BHBA 1YE9A 4CXFA 5AJ3K 4X0GA 4FXDA 1VQMN 3ISPA 1S3XA 3KLOA 4KIBA 1MGTA 4KTWA 2P9PA 4XLCA 4FK2A 2HVRA 1K7AA 4NLCA 3G71I 1L3SA 3HOVJ 1W5CC 1Q8IA 2F7TA 1R5GA 4LK1F 3V8KA 3OYHA 1VQKN 5EU7A 2QQ8A 1LKXA 3O3FA 5EG0B 1Z26A 2LTPA 3QDKA 4AHUA 1FNNA 2CQQA 4OPAA 3A2FA 3MCZA 2ZMEB 2W25A 2P7VB 2LD5A 3SDGA 1XGMA 4HNUA 4YOTA 2LOOA 3ERED 4LG3A 2E7WA 3LWLA 3S16J 2X1DA 2E2JJ 4IG3A 2BVLA 1YQAA 2MD0A 5LGTA 4ZDPA 5B66C 3NF6A 4AHRA 4G6DA 4XMYA 2XAHA 2MBFA 1RTJA 4AM7A 2UUCK 5BRHA 3U1KA 3KYLA 1PUFA 4KFBA 5C25A 4CEOA 2ZCWA 4B1XB 1BGXT 1HW1A 3LAJA 3KLEA 1T3VA 1Y8RB 5AQVA 3I56I 1K83J 3DBHB 3RKYA 5JI6A 4X1EA 2O8EA 3CCVN 2YNHA 3WTSC 3KE2A 1HJOA 2JN6A 3CQ8A 3LFKA 4N4OB 1H9TA 3M8RA 1N75A 4N9IA 3RR7A 2O0YA 4XLNF 1Z1DA 2DW4A 2QTDA 3VQ8A 2CWEA 4OO1J 4NDLA 2QSHX 3J80O 2CH5A 2DPUA 4RS8A 2LRDA 2ZBKA 5DUKA 2VKDA 2IOCA 1DGRM 3VYRB 4GFBA 1HCRA 3TARA 3K4MA 4ISEA 4I0AA 2L7KA 3DXKB 3DWLE 1OYWA 2K9NA 2VQFK 4DTXA 5JS2A 1WI3A 3I5UA 4KHUA 1FJGK 2VGNA 5AONA 2V79A 4H0XB 3C6AA 3CXCM 2AHQA 4MFEA 2GBZA 4ZYGA 4DQQA 4WCGA 3HP6A 4E0DA 2ELJA 2HVIA 3L1PA 3E66A 5BR8K 1LJ9A 1E0EA 3F0CA 4N47A 2QKMB 4MLHA 3KKSA 2F5FA 3HSEA 3AVLA 3RIRA 4CE9A 3BZKA 2Q2EB 4FVMA 5CJ9A 4CCLA 2NXNB 4ZYDA 3BTLA 4UHTA 1NJWA 4NNJA 3ZT1A 3HYIA 5M1PA 3MD2A 3W2WA 1HDDC 3KHYA 1LPQA 1NMDA 4IBNA 3KZZA 4JKHA 1U9NA 4B8AB 4FX4A 4FJNA 4HTLA 4CZHA 5DEQA 3QLHA 1A5XA 5JHFA 2ESNA 1RFQA 3KYCB 4B1VA 3PY8A 3WXJA 2PLYA 1XB4A 1QHHD 4BG8A 3IFRA 1VQ9N 4BHPA 2LKPA 1ENHA 3O8GA 2O61A 1KQ9A 4KN7X 3AO2A 2WTEA 4CGHA 4WX9A 1RBUA 1V5FA 3QPSA 3LSIA 4YHHK 3V8LA 3RSEA 1MH3A 2H6CA 2IGIA 5BPDA 4BG9A 5ICFA 4WF9L 4LF7K 1OVYA 2KLOA 1GLEG 1SVMA 2JPCA 4KMUX 2WAFA 3OR1C 2NS0A 3AAFA 5HDGA 2NNYA 3AG1H 3TDZC 3B73A 1YW8A 1G3TA 3JSPA 1SD4A 3A0IX 2FBXA 1TWAJ 4RBOA 4AILC 3ZEUA 4BJ5C 1RI7A 1SAXA 2EZHA 1UZCA 1ZR4A 1W0UA 1XHXA 3JTGA 3I0SA 1XNQK 3V7CA 4W5OA 3MN9A 2V6CA 4HA8A 3H3ZA 3F2KA 2HR3A 2DA1A 1VSHA 5D5WB 1RC9A 3TGNA 1HNWK 4ETSA 2DA5A 1HSTA 2EV6A 2VB6A 4M73A 3I4MJ 3SUNA 2X1CA 5H20A 1WSHA 1MD0A 1T6CA 3D0PA 4RAYA 1ETYA 3CUOA 2HBJA 3KP2A 2DMPA 3RWUA 4O55A 1RBVA 2ZFWA 3IKMA 3CTAA 1FC3A 1WHUA 5EG0A 5HVQC 3S8PA 5GTIC 1RNLA 4JV5K 4F3OA 1GDTA 1UMQA 2BV6A 1RR8C 3QPLA 1NK7A 4C2UA 5LHIA 2H3GX 2V7YA 1GV2A 5H6RA 2IGNA 2MFZA 2DMNA 2A3SA 3BG9A 3BR5A 4Y0WA 3QRFF 2RDPA 4FE4A 2IA0A 4XRMA 3E6MA 2DK5A 1NLVA 2QEXI 4FLUA 3K9TA 1QHTA 2RREA 4G94A 1ZK8A 3DKXA 3CMYA 3KETA 3CMAN 3TMOA 2GXAA 1EJ9A 3QEWA 4BXFA 3RMCA 1NHAA 4IHYA 1L0OC 4KT5C 3G3ZA 3L9FA 1JTYA 2M0MA 2P5LC 3C2HA 4Y52J 1P4XA 1A5JA 1AA7A 4ZZLA 5ICEA 3M8SA 3HPHA 2KJCA 4E7SA 3DXJF 4U67L 3LL7A 3ENBA 2XASA 3L3UA 1MW7A 4RGRA 1ZYQA 5CLSA 1RT4A 1XMXA 4DGWB 1YAGA 1HKGA 2FF3B 3CCYA 3M8PA 1TV6A 1UFMA 1H89C 3OYDA 2CV0A 1R00A 1YJWN 3WTWC 4IRHA 4CZEA 4BRDA 3LDOA 3ZX0A 3JAMO 1Z9CA 3FMSA 1HKBA 3J7ZI 2JLEA 1I50J 4HTUA 4RAZA 2ZE2A 3P9IA 2NRTA 1WBDA 1GXQA 1S9GA 2P9NB 1OISA 1D4XA 2ZF5O 4U87A 4MDBA 1LE8B 3VSLA 3L09A 2EB7A 3QU6A 3KP7A 1RIOH 4X66K 2QWMA 3WUHA 5HS9A 4DOZA 2WAQN 2GOMA 2CV2A 1KGSA 5LD2C 3MWPA 4EEFG 1DT9A 3K69A 2VBZA 3RPUD 1L3TA 2VJ4A 2Z16A 2F4VK 3M8FA 2XAFA 5ED4A 3D2EB 1R4MB 4BEHB 4Z4EA 4Q5SF 1OR7C 3CCMN 1N77A 1ZGJA 4ILJA 3QU3A 1Y0UA 4MEXF 2LSOA 2HYFA 3OYLA 5H2FC 2ZC2A 2YV0X 2R0QC 4JKFA 1JLFA 2D1KA 5J6XA 1RT3A 1RTDA 3CLOA 1XHZA 3KEQA 1ON2A 4HBLA 3OYFA 1QA6A 3SCXA 3LP2A 2P5GA 3LA7A 3TOBA 3LWMA 3ZSVA 2PYJA 3N05A 2IT0A 4CCNA 3BC8A 2FF6A 1W36D 3EETA 2QI2A 2CGJA 2RF2A 4JI7K 3E01A 4I6ZA 5DCFA 3AL0C 2EILH 1NTCA 4KI6A 4GGGA 1UHMA 2D1HA 3S2HJ 4CF8A 1X9WA 2YNIA 2CW8A 1YHQI 3QNOA 1Q9XA 3JRAA 3HYFA 4L0YB 4PWDA 4B9NA 2F5EA 5DCMB 1I6HJ 4JNEA 1SAUA 1W0TA 3TAFA 4YFKF 4OWRB 2KHOA 2Q2RA 2GAUA 5JLHA 2VE8A 1D5YA 5E1WA 4TSXA 2WADA 4YOWA 3D7EO 1T44A 5E79C 2YKMA 1O3QA 4DQ2A 3CCSI 1GT0C 1DP7P 4M45A 2DMQA 2VIXA 1R4NB 3QODA 4B1RA 4AIJA 2WY7Q 4KHYA 3SEZA 3WQUA 1B92A 4G6TB 1R7JA 4A2BA 4FJ5A 3D6RA 1TT0A 1H88C 4A2UA 2E1OA 1BHLA 3HVTA 4FO0A 3NQOA 4F3TA 2O8CA 4JX4A 3ZP5A 4DSFA 2DT6A 2EA2A 5HRNA 4CGFA 3LPTA 3CMEI 3K4LA 1ZAOA 3LSGA 3O2PE 2IGMA 4DQPA 3VTHA 2CGLA 3LL3A 4CHPA 3VF6A 1NNEA 2FX0A 4NC7A 2AA4A 4FWLA 1O7FA 3RKXA 3WT0A 2FSJA 3LZJA 4JK9A 4QIWN 4I2QA 4XL9A 4Y4RA 1K6YA 4QCLA 2PJPA 2F4MB 3VQ4A 3IUOA 1LVAA 2ASOA 5LJWA 4A5BA 5B1AH 4CK3A 1ZGAA 4P1WA 3QYBA 5FD5A 4OKEA 1TL8A 2Y9ZA 3C7NA 3KP3A 3FR0A 3CCQI 1HQCA 4AM3A 4EP5A 2K40A 2MC4A 4E3SA 3G1OA 3IG1A 3SFZA 2QA4N 1J9IA 4M3XA 5D5VB 3DLLF 4MTEA 2BH1A 4EP4A 4BC4A 2R4GA 4WQ4C 5AFUA 4GO1A 2XSJC 4RGXA 2QGUA 2N8GA 5F2RA 4JX5A 1NK0A 2MGQA 1RCHA 3FMRA 3L7WA 3L2CA 5EZGA 3BR0A 3CP2A 3GE1A 2W42A 5BPLA 3QPHA 1VSMA 2QXFA 1GLBG 3K4BA 1TWFJ 5J4VA 2ZM6K 2ETJA 2FXUA 3KK2A 2Z1HA 1NK2P 4H5NA 2JMWA 3L0QA 4MFBA 5AQWA 4LK0F 2YHWA 3SI6A 1FOXA 1B9NA 4LIVA 3N97A 3I55N 1XGSA 4M3WA 3GFIA 3ABUA 3U9ZA 4W5NA 1VZ0A 1QBJA 4AHCA 4O0IA 3BLYA 4U88A 2XHKA 4LGWA 1UG2A 1QPMA 2BW3A 5E3NA 2E4LA 3M5RA 4UUSB 2JQ7A 3OS2A 5DDGA 3VEYA 2K9LA 4LD0A 4KITB 5B1BH 2P9NA 4CHUA 3HRMA 4TV7A 3ZQCA 1LE8A 4H4MA 4G1QA 3ZPLA 5E18F 4LF5K 3IUCA 3L4QA 2HQAA 4A3JJ 4B9QA 3P39A 2QZ8A 4PJMA 1JTXA 4FYDA 4ZZDA 2QM3A 2DA6A 3GTLJ 3ZCOA 4ZTFA 4CJEA 4D7MA 1XD7A 4DV7K 3PIPL 4BEHA 4F92B 4J2EA 2MSYA 1P90A 2ZGZA 4BC3A 3MAQA 4BNCA 2PFBA 3KLIA 1MSEC 2GXBA 3A01B 1KAZA 3HOSA 4L5EA 3WHCA 2LP0A 2ATQA 2P9IA 3O4QA 5ADXA 5CYMA 1MZBA 2B5JA 1XDUA 3T19A 2W85A 1WAFA 3M6GA 3F9MA 3K2AA 4E7ZA 3IAS2 2MH9A 1D9FA 4FJ8A 2DY4A 4HAMA 2LKXA 1TAUA 2UXCK 1FWZA 3CJ1A 1SKSA 4JD2B 3KD1E 1S1WA 3U3YA 3AA5X 4FJMA 4CESA 1FBSA 1ATRA 3EE9A 4RTFD 3QEPA 1RDDA 4E7KA 2VODA 4DR6K 5BQTA 1ETXA 3O08A 4RW8A 4BR4A 5HP1A 1SFOJ 3UKUB 4BWJA 3H45C 5HLTA 4NYFA 4WYBA 1KU2A 1EXQA 4BR7A 3U3GA 1R58A 1RBRA 4EM2A 1LDJA 4XIUA 4M6VA 4UUTA 4DR5K 4I9LA 4CZJA 4XOPA 2I8DA 3KFWX 3FMQA 2CJJA 4NCGA 3C6UA 1BBYA 1T03A 3UIQA 1QSLA 3EUHA 2K3PA 3ZMSA 5GADP 4XLFA 5IT3A 1VHXA 3S1MJ 4HDUA 5E3OA 5L3EA 4F2SA 1VQ6N 1NK3P 1Y1VJ 1P2FA 2OV7A 1FJLA 4C2TA 3CD6N 3RVCA 1Y1WJ 3GWZA 1VQPN 3DLBA 4G12A 2XF7A 1O1WA 3VDXA 3QICA 5BREA 3WNGA 3W2VA 1YLFA 1HUXA 1U8RA 2VL8A 2BXYA 3O6BB 3CCJI 4IDKA 3TO7A 2ETHA 3E9OA 5K7ZA 1N78A 2XDVA 3HGYA 3RCOA 2DQRA 4D0PA 3VF4A 2IS2A 3EKSA 5LRSA 4FX0A 2WV1A 3CJ9A 4LITA 1BIAA 3ZQHA 1SKWA 3FZVA 4K8ZA 3S1RJ 4CEAA 3CCRN 3HOTA 4G6QA 2XAJA 4B9LA 3E9PA 4B3TK 5KRSA 3TQNA 4M9SA 9ANTA 1Z0XA 1ZTRA 1D9DA 3ZMUA 3EY1A 3PNYA 1QQCA 2NVQJ 4DW6A 1BOAA 4DZPA 4BHCA 2HHHK 4OGCA 5L3CA 2ME0A 1IO2A 3WTYC 1DGKN 2O8DB 1IV0A 3ABLH 3VEXA 3PM1A 2DFHA 1WZ2A 5DM7L 2P5KA 3GXOA 4ELTA 4IOAL 3NCIA 1LAWA 5DM7F 4CEQA 1IN7A 4IOAF 1ZHFA 2GZWA 2VWBA 4BWMA 2QW9A 3AA4A 4BXUA 1SMTA 5I42A 2ZSHB 1OPCA 4ID5A 5FO5A 1CLQA 2H94A 4CZZA 1P7JA 3RRHA 2QWRA 2KHMA 2QSFX 3RYRA 2NRXA 2QF7A 4X65K 2A61A 4DU4A 3MZ8A 1WBBA 4CHZA 3DTEA 4O5BA 3I71A 2Y1JA 1ZYRF 3HPGA 4ENJA 4C9YA 2IW5A 3DOLA 3VENA 3IH4A 1IBKK 1IN5A 4DYRA 2NRWA 4UUSA 3PJRA 1JKRC 2LBFA 4F93B 5JVHL 1D1BA 4AD9A 1HR0K 4CZKA 1T08B 1IKYA 4IPAA 4MIMA 3F8MA 3PV8A 2PY5A 3J81Z 5H1SQ 1BG3A 3A2KA 3NGIA 3N4PA 1U4BA 2LNBA 4F9OA 3OY9A 1GXPA 2LF7A 3OSFA 3VQCA 4M3FA 3CHWA 2ESHA 2NRVA 1VQ7I 2VBWA 3HUGB 3F9KA 3VERA 3T0YA 1L5UA 3V7RA 3M07A 5KK1A 1QVGM 5DYMA 5F0XA 3G71N 4RGUA 4AUXA 4M3GA 2BE5F 4FASD 3MFKA 1L3VA 2Z99A 1D0YA 1QSSA 4U0VA 5F04A 3CUQC 1MNMC 3ZSWA 3I0RA 2CW0F 1IXCA 2H1LA 3MXJA 5IPAA 3P31A 2V9KA 1E4GT 3L4IA 3LDLA 3GLXA 3TL4X 5CZ1A 3F22A 2HQRA 1TGOA 1OYIA 2A68F 3BDDA 1V54H 3BTJA 4CDGA 1N25A 3DAWA 2A1SA 2QSGX 4PGHA 4GYGA 1LUJB 1BCOA 2V26A 1VQ5N 2Q0UA 2O6GE 4KRFA 2JVGA 2KQRA 2W7NA 3BY5A 1S5JA 3E97A 4QAGA 3L2RA 4JHDA 2ZXWH 2D0BA 3OWTA 2DJIA 3K5OA 5A2QO 4NB4A 3B6OA 4A5MA 4CGGA 2DFEA 2QENA 3CJ7A 4B3OA 4CCJA 2W84A 4L9VA 2R7QA 4IFVA 1NKBA 1U6ZA 3K59A 1RDCA 1FEXA 2KW4A 3JS6A 1YRNB 4OIRF 1ZBIA 3FHNA 2W40A 5AQHA 3VYTB 2F9WA 3F8BA 3GTPJ 4D5CA 1SFEA 3WGGA 1FBUA 3O80A 1C0TA 4BU2A 1MDMA 1MJBA 4XKVA 4NUBA 1IC8A 4ZTJA 1VAZA 2CMPA 5T7BA 3V7SA 4M63C 1QZ5A 2VWJA 4CIFA 4ZYEA 3FM3A 4M3DA 1FX7A 4IX7A 1UCRA 5GPAA 4CBXA 1XQSC 3CC2I 3D5LA 4EGZA 1KQ8A 3KD5E 3PUFA 3M1EA 3I64A 2O9LA 4E7JA 4EJWA 3I59B 1B4AA 4BR2A 3VQEA 3VGMA 1G59A 2IA2A 3TEDA 4BRFA 4YELA 1QU3A 4JEPA 2VBXA 4KHNA 1OCOH 1SC7A 4CZFA 2GLOA 2X48A 1NBWA 2YHBA 4Y13A 3DI6A 1QVTA 4ZJZA 1RTHA 1T6DA 3PX0A 1BJZA 2ADUA 2DBBA 3C1DA 2OANA 4E4HA 1UELB 1OLTA 1D3YA 3DBLB 3FZFA 5CY4A 1JXSA 3WNEA 3PX4A 3S9HA 4CFBA 3QERA 1QPIA 1X19A 1TT5B 1IKVA 1BI2A 3I33A 1R1VA 1C1BA 5FLXK 4CCHA 1HYZA 4EIAA 1T0FA 4FVUA 5FJ8J 3WU1B 3MXIA 4C8KA 2W82A 4QOZB 2CG4A 2F8TA 3C18A 3LSHA 1CXQA 1DP3A 1XMKA 1XNRK 1TQPA 4BR5A 1YJNI 3TAMA 3IP4B 4EM1A 3CJTB 2P6TA 1LWFA 3PIOF 3GZ5A 3R1XA 3DOKA 3OR2C 1OH8A 3OTOK 2F6CA 2YU9J 2EWNA 2DOEA 2XKOA 3A0HC 2WBNA 1HKCA 1DTTA 3LSTA 1NOYA 1S9HA 2DDBA 4JAXA 4I2OA 1KC8O 4RW7A 3LM9A 2OZUA 4L5JA 3CCLN 3BCAA 1ODDA 4NBQA 3JCUC 4XKCA 4DTJA 2L7MP 2XGEA 2W48A 4IKFA 3H0GJ 1S9EA 4DFKA 1P4WA 4XONA 3UR3C 1Z7UA 4ESFA 4JX6A 3LZIA 1BI0A 5L3DA 4PJLA 3AO1A 4HLXA 4IHWA 2CGKA 2JTVA 1JGGA 2W1OA 4I2PA 2GX9A 1FIAA 3HUGA 2DTZA 1UOCA 1X9JA 4AIHA 2BDPA 5IT9Z 3CJNA 5DD4A 1BOTO 5GINA 1NGFA 2FXAA 1YJ9N 3GTQJ 2HEOA 2LVSA 3ITHA 4N56A 3MDQA 4O0JA 2ID6A 2OPTA 2TRTA 3KYDB 2E60A 4G9ZA 5AQNA 1W9HA 1X1CA 2UXDK 4U0YA 3L3VA 5D8LB 1NKCA 2IRFG 3CIPA 2UWMA 2M87A 2VKHA 4J2DA 3G6EN 3HM8A 4L9TA 3VWBA 3VQ9A 3V1RA 4II2A 1I6XA 3F8FA 3I53A 3C3WA 1CQTA 5CYQA 3DLKA 4KTZA 1IRFA 4C3JJ 3RJPA 5J8FA 5FD6A 2P9SB 1UWBA 2FMYA 3LSMA 4FOIA 4K42A 5JICA 2LKSA 4PY5A 1IW7F 3VEPA 4S04A 1ZQ3P 3ZSRA 2GA1A 1KRPA 3CC7N 3B6AA 1R9TJ 3HBTA 4IJNA 4KBOA 2ASMA 4O44A 4MEYF 1S6PA 4OVLA 4B1UB 1FTZA 3P9CA 2K4BA 1JJ8C 3BEXA 1NWKA 3WXKA 4ENNA 3AVNA 4CCMA 2DMTA 4WXHA 2H8WA 1UJ8A 4A69C 3FKJA 4CCKA 3RSNA 1B9MA 4HEA2 1YO5C 3KTQA 2HSTA 2E8AA 1YRNA 3DLGA 5EGOB 4UNOA 3CI5A 4ZC3A 1USTA 1D8JA 1DGWY 2XAGA 2LREA 4DB3A 4C30A 4BRMA 1TK8A 2LY9A 1N8RO 1MDUB 4ZH4F 4IHTA 3TO9A 2KZGA 1M90O 3CQZJ 5FB2A 4RDUA 1FOYA 1WCMJ 4XEIA 3DEUA 1IF1A 5ICGA 1TP4A 2FQ4A 4GV9A 5ILUA 2Q3SA 4LB5A 2RQQA 4UB6C 1KU9A 3VB2A 4B3MK 4BRNA 2PEXA 3T8RA 4B48A 3WGHA 4IDHA 3GW2A 1JKHA 3QOPA 5EJCA 5HRRA 2A6TA 4ZDOA 3LNQA 4DR7K 5LHGA 1NGAA 3GCMA 1JI8A 3P4IA 5K5RA 2OPSA 4JI3K 1Z21A 1E3OC 3M9AA 3FBIB 4ZHRA 1E3PA 4RW9A 3LPUA 5AIQA 3CPEA 3TP0A 5CR4A 2OTJI 3Q3SA 3X2QH 2OBPA 2J4RA 1NJXA 1X9SA 3E5UA 4I7HA 4Q47A 1R6RA 2RGVA 1GOAA 3LA3A 3SHFA 2AS5F 3ECHA 3ALYA 1JKOC 1JHFA 4KHSA 4GYIA 1YI2I 3GLLA 4F4KA 2IVPA 3ID8A 3K1MA 2COMA 1Z77A 1F36A 5BNGA 4A3FJ 2L4MA 3SMSA 5GADJ 4BE2A 3C95A 3CCUI 2OF7A 5E41A 1PJRA 4GXOA 3ASNH 2YX6A 4PCQA 3AAPA 4QS8A 1MIJA 3GMEA 2ZNZA 1BI4B 3O9QA 5SZTA 3BF1A 4K0KK 3D45A 4PKIA 4H4KC 3F23A 4DIQA 1CF7A 2WV0A 2GWKA 4XOTA 3D2FA 3F6VA 3SJJA 3FDYA 1YHQN 4K8XA 1RGIA 4A57A 3QEIA 2M4KA 3TR8A 3PO2J 1WSFA 2BY3A 5E84A 1LFBA 1F9NA 1C0WA 4R8HA 2P5OA 3CMMA 1XI1A 4B9MA 1Z6RA 1GHCA 2HOSA 2OQRA 2P4WA 3PNVA 4LH5A 4CBUA 3QAHA 1MH4A 2KT0A 4BGDA 4XQFA 3OL3A 4C1NK 3DPUA 3FFIA 3DXMB 5B3SH 3ERMA 3CCSN 2BOLA 4J00A 2O4GA 3QB0A 2ELHA 2AP1A 2P9UB 4CJQA 1YIJI 5LJVA 1XSXA 5F1RA 3CJBA 4G7OF 2O3FA 4DV3K 3GDQA 2IP2A 5M5YJ 1LDKB 4EZ9A 3V4IA 1J09A 5AQSA 4WE1A 4I7FA 4M3EA 3DF8A 1D0ZA 1VQ8N 2G8UA 1TLHB 2M7AA 3H1QA 1NGGA 1MNDA 2FBKA 5HLGA 2GA2A 4FWQA 1QE1A 4K41A 3DLRA 4G9YA 1Z3YA 2KRFA 1TUUA 4M3ZA 5I9EB 3M8QA 2LLKA 1TWCJ 5HLFA 2JSPA 3WG9A 4DTPA 1R1UA 3KLNA 3K70D 1X3UA 5CZ2A 4I98B 2Y0SN 4KT6A 4E70A 4HSTA 2I5JA 3OYIA 2PMZA 3K2PA 1JL2A 4L9JA 5BPIA 1ZBSA 3F21A 3CCQN 1NGHA 4JK7A 4LB6B 3ZQLA 2KMUA 4CYDA 1YITI 2R5YB 3WU2C 3KLHA 4DU3A 4QSHA 4KA4A 4IEIA 4R5PA 3L8BA 3MX2A 2VXDA 3SNNA 1R1TA 4JLHA 2W6LA 1WJEA 2KFDA 3RDIA 3FGUA 2JRMA 4RM2A 2DI3A 3TAEA 2PMHA 2R7VA 1TK0A 3DRRA 1TZLA 5D4RA 2RC4A 3E0JB 1WJBA 1ZELA 1K78A 1VSEA 2D0AA 5GAEP 1MU2A 2L02A 1S22A 2FUG2 2M9HA 3KIOA 2KDOA 3GTMJ 1S72I 3HOWJ 1ZARA 4WQ5A 2RE2A 2FRHA 3I4NJ 1ZGWA 3NWTA 3HK2A 4DSIA 3FFKB 2UXXA 2FEZA 2MC3A 1ZH5A 2VPRA 1ZRCA 3K2ZA 3O8HA 3QIPA 2V51B 2O7OA 1D8YA 1FMVA 1SV5A 2E88A 3CQYA 1EWQA 2XGCA 1QVUA 1BOBA 3S1NJ 1IDYA 4O5VA 1OQYA 4JOMA 2ZNYA 4JKGB 2ISYA 3SUPA 3S3OA 3TSQA 3NAEA 2VT2A 2R7DA 1S6LA 4MO5A 3DM2A 1AU7A 3EL2A 4DR3K 5HBMA 4K2EA 3RYPA 4Q5VA 4UXNA 4CW7B 4RMNA 4LG0B 4LFUA 1RRJA 3CLQA 4B1WB 4EJOA 3LSRA 3EYIA 4FZZA 3Q7CA 4B43A 1REPC 5AZIA 3UNGC 2E5ZA 2NRRA 4E1JA 3ZMVA 4HV6A 5F0FA 3PQJA 2QM1A 1LNWA 3AA2A 5JHUA 1RDAA 1U2WA 1F1ZA 1D1AA 1FOWA 2JPBA 3SBTA 1B8IB 1AKHA 2ZKZA 3QBXA 5L3BA 4XH5A 1D5AA 2E2IJ 2HZDA 2GOXB 4YOXA 4EAHD 5C2DA 4EATA 1VQMI 2Q97A 4RLQA 2L9NA 4L3QA 4JN4A 4KH6A 1I5ZA 1JLCA 1ONVA 3OYAA 3AL0B 5KI6A 4JKCA 4EJVA 3ZR8X 3HXMA 4KH5A 3OS1A 2AQFA 2NS8A 3ULEB 3A02A 1VK0A 2A6AA 2M3AA 3P1GA 2IS6A 3BTIA 1I3AA 1HA8A 3AVMA 1C0GA 4J19A 3PL8A 3KEOA 1IRZA 1FBQA 4KV8A 4CJ5A 3UKRB 4AHTA 2Q31A 2VLAA 3OOUA 3LDQA 4O4GA 4CVNE 3CDLA 1K4SA 2WBMA 2E2OA 3AKZA 4B3XA 2XPWA 2MD5A 1MBEA 2VE9A 1YYVA 3FBNB 3SQ0A 4A3DJ 2R7SA 5M3FJ 2CUZA 1LOTB 3OA9A 4ISFA 3R3LA 4GV3A 1OVQA 1F4KA 3AVAA 3BJOA 1G8XA 2H09A 3THVA 3CP8A 3DXMA 1N5YA 4FW1A 4LD5A 4FJGA 1I27A 1SEUA 3J7AY 3KVGA 4HVJA 4B8CA 3S32A 5TKWA 3L2QA 3FXKA 2P9UA 1X2NA 3SYTA 4A93J 4DKWA 5L3GA 2HGCA 4FTHA 4AWXB 3H9JA 4BBRJ 1VQ4N 1LQ1A 2HTSA 4XIDA 3SAGA 3E3VA 3GYHX 2X85A 3SZPA 2WY8Q 2JWTA 4AHSA 4P96A 2CS3A 4B8XA 2H27A 2C6YA 1X1PA 4DTOA 4Y1DA 1MWMA 2XV4S 1UHSA 3M7GA 3OYNA 2HNHA 1PDNC 5AQGA 1U04A 2CFXA 2DAOA 1BR2A 3NRVA 1MWKA 4CFDA 1SFXA 1RBTA 5TJJA 1VI0A 4U0WA 3F73A 1DPRA 5HDKA 4IO8A 5L3FA 2KDZA 1RT6A 4ZYAA 2PJRB 2HB5A 3F5TA 4F2RA 2CQXA 3A5OC 2CUFA 2CQKA 3FZMA 1S7AA 3BY6A 4MNUA 2HS5A 4QS7A 2HNZA 5AQTA 4CJUA 3ISNC 2M45A 4OGEA 3R61A 4FHTA 3SAFA 1FSHA 4CJPA 1CZAN 4P9FA 3W6VA 2X9DA 5D6EA 1OMIA 2R5ZA 4BRHA 2WAEA 1ETVA 3GTOJ 2L54A 1LDDA 1DTQA 3E6CC 2Z1GA 3FHZA 1WJDA 2IBDA 1ZG1A 2XAUA 4ZYHA 2Y69H 4AH9A 2I7NA 4DR2K 2A69F 2ZXIA 1KU3A 1P92A 2K9QA 2MLGA 2GELA 2E35A 1T8EA 3DFGA 4IF4A 3BR6A 3ZX3A 4KN4X 2ECBA 4HF0A 2VQEK 3NARA 2P6SA 1W7PB 4CUGA 2KTQA 5AQKA 4I76A 4J01A 4KMFA 2DMUA 1HQUA 2HPMA 3K4CA 1UB9A 4ILGB 4CJ4A 3I58A 3VEOA 2FSWA 2Y30A 4FJXA 3K5MA 4HNTA 1Y39A 4LMYA 4ESBA 3O9TA 4PSWA 3AVFA 4CZCA 5EDNA 1NG6A 4W1UA 4ANJA 1SL0A 4R79A 3ID6A 4E89A 5FRMA 1J53A 4XLPF 4Y33A 3OYCA 1FTTA 3GTKJ 2CFOA 2DJNA 3RRGA 1ITGA 1K9MO 5GPCA 3GZ6A 2G8KA 3JREA 4OX9K 1Q7YO 3PO3J 1PYVA 4L8RB 2XPUA 3ZMDA 2R93J 4BBSJ 3J7AO 1Q1HA 1TL3A 4OIPF 5KGWA 3IKVA 2EWSA 1IXRC 2GUPA 1RT7A 3BJAA 4DHYA 3EUHC 2EA4A 1OCPA 3DKWA 1S1VA 4XK4A 4OAZA 5AQIA 2HHTA 4A3IJ 1TK5A 5HODA 5HLIA 5EY4A 3OYEA 3L2VA 4W5TA 3HPOA 4FJLA 5EEAA 5JVTA 1VQNN 1HQEA 3I0TA 2E2QA 2WB1N 3CDIA 2PG4A 1NJIO 5FKMA 3ZQIA 5BOXA 2YR2A 4BQNA 4P55A 4H4OA 2HVQA 5KTQA 4FM2A 2B7EA 3UKRA 3VOVA 1I1SA 5DM6L 1FKOA 1HNIA 5J1YA 3AARA 1BL0A 1WH7A 3JAMK 4B1ZA 4FWRA 2QQ9A 3KZYA 5AQXA 3KPHA 3JYTA 2COBA 3N4QA 1GLCG 1M1EB 3K4NA 5FDLA 3SQ4A 4Y3OA 4LY7A 1FP1D 3HG9A 1YXQA 1NGCA 2R7YA 1VSJA 3MECA 3E5XA 3T7ZA 4BREA 3OIQA 2MLKA 5JS1A 2HF3A 1LCUA 2LH9A 1ASWA 1KONA 3CMAI 4IHVA 3JRBA 2E1YA 3HP9A 2ID3A 2OZ6A 1R5HA 3SJMA 2HDCA 3H9GA 1DLOA 4PJJA 1IKWA 2O8KA 2IS4A 1NOZA 4JKAA 1J5OA 3RPUA 3Q0WA 4P5OA 2Y0MA 4OIOF 1WSIA 1JJ2M 2DPNA 3EEQA 2PX9A 2WOMA 5LHHA 2IAJA 2K9MA 1A36A 4CH7A 2HTJA 3ZOBA 1S29A 1WNSA 4LF9K 1HKQA 4C3IJ 5BN8A 3VQAA 4JI4K 5LLQA 4V2FA 3S93A 2EIKH 2JZYA 1N33K 2ITGA 1BM9A 5IOZA 4PA1A 4H0TB 2F4OB 2NRAC 1IV8A 2XC7A 4C23A 4CEBA 1VSDA 4CERA 4BROA 5F0CA 4DQIA 1ZRDA 1KVAA 3T8TA 1SAZA 2BEOA 4M6YA 2XPVA 3SQ1A 1J9AA 4IJAA 1B9FA 2UUBK 4CO8A 1VQON 3O4NA 4E6KG 4FW2A 3DBRB 3FKIJ 3WEEB 4C3HJ 2FD5A 4OAYA 1HXDA 4M7XA 2XO7A 4ICLA 3THYB 1IBLK 3U9DA 3F8NA 4FE7A 1KYWA 1R5ID 1MKMA 2FBTA 5HNHA 1EETA 4YIRX 1IBMK 1J7KA 3T1YK 1KCFA 3IL2A 3RKQA 5FLMJ 4JI8K 1VTNC 1TW2A 1YJNN 4BXXJ 2W6KA 2FOKA 4A6EA 3JRHA 4EQQA 2HYGD 5IYDJ 4P9UA 3ABKH 5B8HA 2Z1JA 2UYTA 5FPNA 3O9UA 4OKKA 1GLLO 3KLFA 4DV6K 4B09A 1TKXA 3BQZA 2R7RA 5LEJA 1U5TA 3S41A 2WA0A 1O7LA 5M5XJ 2YI1A 3HJFA 3LALA 1HYVA 2Z1DA 4CFCA 2CRGA 3O9RA 2QBYB 4FWNA 1GUUA 3WODF 4RWTA 5IYCJ 1G99A 1YF5L 4OINF 2ELKA 2BHZA 4U7BA 2VG5A 5ICCA 4Z4CA 1E3HA 2G8HA 4YY3K 1X2MA 1C1CA 3VPZA 1J5EK 4CIEA 2PI0A 1ZN2A 1XG1A 5D5XB 1Z25A 4XLEA 3CUQB 3QIOA 5TGTA 2ZMEA 1BA0A 3A5LC 4A2AA 2YU3A 3NH0A 4D1QA 3PUBA 5JVGL 3V1QA 1H0MA 4HYEA 2DTUA 1YS7A 5DS9A 5K5QA 5JVGF 3K9JA 1JLGA 1J5YA 2YUSA 1ERDA 3H46O 5FPMA 3DLEA 4JQFA 5KVRA 1S5LC 2XAQA 2M8GX 3VGLA 3H0DA 3VESA 5GAEJ 3JSMA 1KSPA 1SFUA 1GLDG 3LQRA 4H5TA 4DF4A 2PAVA 1D1CA 1RPWA 3M8EA 4YIFA 2HHSA 3ULQB 2G8WA 1W5SA 2RN2A 2P9KB 1T7PA 1K8AO 2B9SA 2JA7J 4JYAK 2PBIA 3W6JB 1BJAA 4H0EA 2P1JA 4HW0A 5FGMA 1UAAA 1QQMA 2YX7A 3MMYB 3HOXJ 2E6LA 2PMUA 2E19A 4XM3A 3H3VK 3SZ2A 2YCHA 1UA0A 2PFUA 3KWIA 4BH9A 3K5LA 1TWGJ 2E1ZA 3O1BA 4O8KA 4H5VA 1XC3A 2OUMA 2FQ3A 4OLBA 2K85A 3C7JA 6PAXA 5LBQA 2IEKA 3DXKA 5M5WJ 3O8MA 1MMSA 2O8FB 4XR6A 1HW5A 3QQAA 1U78A 4DWIA 1WOQA 4XKBA 1W7AA 5ILSA 4PUOA 2EFWA 5CHIA 1VSIA 4ABZA 1JHHA 2NNNA 4B9SA 1JLQA 2VWKA 3R9PA 2DTRA 3VEWA 3J80Z 3K0SA 1G3SA 4Z4HA 1G3WA 2D0CA 1IN4A 1G3YA 3SEQA 2D5VA 3IWFA 4NO7A 3HHHA 1ULYA 4ELUA 3LA2A 4YFNF 1R23A 3HOYJ 1S1TA 3W3DA 3JR9A 2WC9A 2IGOA 3JRIA 1X3ZB 4WK8F 1NGEA 5HL7L 2CGPA 2E7XA 2Q2EA 2E2PA 5J8CA 3UKGA 3QESA 2VASA 2DLLA 4AYBN 1T0FC 3I55I 5C42A 3THXB 2M1BA 3R8EA 4HHTA 1KLNA 3R0AA 3THWB 1SZ2A 2DA3A 2Y1IA 3GG4A 2OTJN 2Q8KA 3FWEA 2L7ZA 4Q0BA 1Y64A 1Q81O 4WFAL 1WJFA 3TTFA 1WLJA 4KB0A 1YW9A 2VN2A 1FK9A 2EHGA 5ERIA 4GY2B 2ZD1A 2RKHA 4M3YA 2L7FP 4JI1K 4IWVA 4IRGA 3ABTA 2OPQA 3A1YA 3GVAA 4ITVA 4KIFA 4XSXF 5AFUH 1YI2N 2EH3A 2STWA 3TAPA 3WEEA 2EFQA 2K02A 1I3QJ 1B1BA 2HFHA 1W5TA 5E1XA 3H35A 2L2OA 1NMNA 1SFKA 1T05A 3A8YA 2GXGA 4BR9A 3RQ4A 5AQRA 1KVBA 4KISA 2IDOA 2K4JA 3H3UA 3FIWA 2WAQA 2QUFA 3OIPA 3C6TA 1HYSA 3AGRA 4JI5K 5HS7A 4ASNA 2MABA 1Z05A 3BQYA 2ASPA 3QEXA 3D1NI 1XPXA 4II3A 1WSUA 2XVCA 3AVHA 4HUGA 1NK4A 2QCOA 4PFPA 1VSLA 1MMNA 2E1NA 3C0BA 4CEZA 3MN5A 3ZT4A 3PLAA 1MMGA 2BY1A 3DYAA 3IRXA 3V9UA 3BOQA 2KIQA 1TAQA 3DPTA 1W7PD 3ZT3A 4H03B 3KK7A 3EYYA 4HUFA 4OMZA 4DSKA 3G4SI 4CHQA 3VSKA 3BR3A 2QBYA 1OKJA 1RDUA 2VJIA 3K70C 3PO5A 1HMVA 1KQ0A 4EM0B 4NXMK 3O4WA 1Z6TA 4EV0A 2VG6A 4UY8I 3WNHA 2PN6A 4Z4GA 3W2AA 4CJVA 5J2PA 2DFIA 3G0ZA 3VGKA 2HOTA 3VQPA 4AM6A 5AQUA 2JK3A 3U1DA 3VTIA 1D5VA 4KICA 3RTVA 2O8EB 5KQ8A 4IVNA 2IXSA 5LGNA 2H1KA 4K43A 4PJNA 1MBHA 2AJQA 4S05A 4XRSA 3IKTA 2VG7A 5LL6Z 4RB1A 3NFAA 1XSDA 4KI4A 1K6OA 1C0UA 1JL1A 4DS5A 5E20A 4OLAA 5EOYA 4AVZA 2M34A 4A3EJ 5ADXH 1KAYA 4LSLA 1HC8A 2QYOA 4XBFA 5LMUK 1WH5A 3NWSA 1I39A 2JUGA 4XRFA 1X4PA 1GOCA 4H0YB 2CW7A 3CD6I 1VQPI 1XDSA 3G10A 3EYZA 4M71A 4RAFA 2F5CA 4PGGA 2WTUA 2VJ5A 5EXWA 4HCCA 4IOXA 4BRGA 3OYGA 3SK3A 2A07F 2A1RA 3NH2A 2E2NA 3PSFA 4KHQA 3D5RC 1LEAA 1HPZA 4XLHA 3WXIA 1NGDA 5J2NA 2D2WA 1OCRH 2X6NA 3I4PA 4C2MJ 3W0LA 1F21A 1ZG3A 4MFDA 3C6HA 3KWGA 4KDPA 1KZHA 1MMDA 2E36A 3CCRI 1FP2A 1SL2A 2OA4A 1R0AA 1G15A 5DK5A 4M7YA 4B1YB 4FK0A 2Z5UA 2O4IA 4A5NA 2M4GA 3TSUA 4LJZF 1TNSA 5JFRA 1B6AA 1MNEA 2X74A 4IHSA 3FXMA 3MQ0A 1KFSA 3BG5A 3VF2A 2A6EF 4IQJA 1TQMA 2RV8A 2D4WA 4JBAA 2FOWA 1IJJA 5AQYA 3VYUB 1XCBA 1SKRA 1S72N 5CYVA 3BG3A 4QS9A 3BPXA 4RCHA 3F6OA 3R60A 2P51A 2YPRA 4BKXA 4IRIA 1WGXA 4CF0A 4CF2A 4D9JA 2IVNA 3J7AP 3R6SA 2DA4A 3HTVA 3U9GA 1KVCA 3ATUA 4E7LA 1WJAA 1OJLA 4YOYA 4BRLA 1IV6A 4IOCL 2RAEA 3BZCA 3H9QA 3MKYB 1LWEA 3NEUA 4A62A 1ATNA 1U0JA 3JAMZ 4IOCF 2OD5A 4XN0A 3D2EA 3HZJA 4FLVA 2EIJH 1XMOK 3PIPF 3RSEB 4DUYK 3MVPA 1ZC6A 2NZTA 4F3QA 4HOBA 1FYMA 4Z0UA 4BQLA 3AVIA 4B4CA 2OTLI 2VQCA 2GWJA 1YX5A 2FNPA 4GRIA 3LAMA 3HDDA 4FJ7A 4C1NI 3MN6A 3ZEUB 1DUXC 5DD8A 1K8KB 1TW3A 2G0EA 4A3CJ 5TKYA 4ISGA 1TTYA 3JXUA 2O5RA 3VODA 2EIMH 3SPYA 5A2QK 3CG7A 2DO7A 2DOFA 3I3LA 4EMSA 2FF4A 4H0OA 1MBFA 1X1DA 4HX4A 4J2BA 3FK7A 3SJHA 2PBDA 2BGCA 5HOOA 4DUZK 3S15J 3NBPA 4XORA 4N5SA 3A4CA 1TUYA 2DQLA 2OYQA 4ID1A 2BZTA 1HLUA 3RTRA 2QKLB 3CPWM 4CBWA 1HLVA 1V4TA 2KIFA 4O5FA 2X6WA 2OPRA 3WNFA 3T1BA 4FM0A 3M4OJ 2WUSA 4PQUA 5DCMA 1J6ZA 3RI4A 3C2BA 2KISA 3OVNA 3ZSYA 3FLCO 3EN9A 3Q7BA 1TC3C 4V19S 4LLGF 4EJUA 1WRJA 2LC2A 3REOA 1UA1A 2MH2A 3V81A 4KYWA 2A40A 3PNTA 3U4LA 2UUZA 1VQ5I 4PKHA 1VQLN 4BGAA 3RMBA 3H36A 1T8IA 2XRNA 2XB0X 1U2VB 4BRIA 2GWRA 3TKYA 3OYJA 3BROA 4CSWA 4K25A 1YS6A 3EZ5A 3H5NA 3CC4I 4JI6K 1USSA 1KQSM 1C1AA 2E34A 1IG7A 2BHYA 4IG0A 2HQNA 3SDBA 3LP0A 5AQJA 3DEEA 1HNXK 2DDAA 1A5VA 2KLAA 3TW6A 1Y56A 4G8XA 1BDGA 2HOEA 2HKOA 2Z33A 2R7ZJ 2DK8A 3EUAA 1BC8C 4HV5A 1FYKA 3DWLA 4FLTA 3F8CA 3NAUA 2GQQA 5CQGA 3ZX2A 4GMJB 4CFAA 4UVCA 4DBQA 3KP5A 4KUMA 2ZSIB 3R6MA 4KPYA 3ZETB 5D8KB 2GBYA 4DFPA 4M6XA 5ILVA 1XMAA 1ESVA 1FZPB 3WXLA 1JT6A 4Q4ZF 1B72B 4EHTA 5J4YA 2BE2A 3V9WA 3NGYA 3GBGA 3TAQA 2LR8A 2OJED 3BZ6A 5K5OA 1IJWC 4WQ5C 2VJJA 1S6QA 4FJHA 3QO9A 1RETA 4CI6A 4CHOA 2B63J 4I9QA 1E17A 1POGA 4FLZA 2HBMA 2R92J 5DUIA 1O13A 3MK6A 2M2EA 4KREA 4N4NB 1WJCA 3S14J 3B6CA 2BANA 4NLBA 1QVFM 2VQLA 3BT9A 1BW5A 4QTRA 3PFIA 3MX5A 4YG2F 1XGNA 4NC8A 1SL1A 2F48A 4BUPA 4PJ0C 2GIZA 5IWAK 5J3LA 4DV5K 4DV2K 4EJTA 1YTYA 1X9MA 4FETA 2V9VA 4JRQA 2DT5A 3O3HA 3RMAA 4RW4A 2X6XA 1O3RA 3AVCA 2OA8A 1X4OA 2KZMA 4EVIA 1VNDA 3SQNA 4FLWA 3BF3A 4YOUA 2KKOA 1RUOA 2G7HA 2HHUA 2HDDA 4BE0A 4DYQA 1GVDA 4DG1A 4B44A 1S1UA 2X0LA 2Y9YA 2P0WA 3ATVA 4FWKA 4CCOA 3V42A 1TL1A 3JSOA 3ELKA 3V6DA 3V9ZA 1DPUA 2NNWA 3TDUC 1APLC 1ZR2A 4Y15A 1EP4A 3PX6A 5FPDA 1EF4A 2V7FA 3BG6A 3KK1A 4O6JA 4Y1CA 2IVMA 1QGPA 2HXOA 1WVRA 1C0FA 3VEZA 1RUNA 4M9ZA 4BL0B 1FOKA 1WI9A 1SD7A 1R71A 3QP6A 4GVMA 4HQEA 4B3RK 1QQIA 1EH8A 3SXYA 5M3MJ 2XHBA 2W24A 5HLHA 3KX2A 2E5NA 4UVAA 1QO0D 3A01A 2NVUB 1U3EM 2RNJA 5D4SA 3LMMA 4JS5A 4N76A 1K8KA 3CCLI 2L9VA 3QOEA 5FKNA 4CF1A 3Q0UA 3ZSOA 3ZGKA 2OPPA 5HS8A 4DV1K 4CGZA 3MKWB 3LDSA 1SS6A 3M1FA 1IUFA 4LSNA 2EV5A 4JD2A 2VQHA 3DQVC 1IXSB 4MO7A 3V4GA 4BRQA 2VT3A 4Z4IA 3UKUA 4M41A 4CK1A 1YJ9I 4CZLA 3WTXC 4N9HA 2EZIA 1TQIA 1S7OA 3I56N 5FKLA 2NLXA 1AOYA 4B3SK 2O8CB 4DQRA 2R7XA 2CQNA 1T98A 3HRSA 1Y6IA 5AQQA 2DPDA 4WFBL 1RNHA 2V1DA 3D5SC 5GAGP 3HRUA 3HTUA 3S3MA 2ZQBA 2HF4A 2FNAA 1ASVA 1LWCA 4FZYA 5AQZA 4CYCB 4DTMA 2V4JC 2LY1A 4FCYA 3G6EI 2FSNA 2R7UA 1BU6O 1BR1A 3OOPA 3SV3A 2QWOA