3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Putative NAGC-like transcriptional regulator
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
5A2QZ 4RS8A 1I5ZA 1FWZA 2WWYA 3UB5A 2VT3A 3VGMA 1Z91A 2Q0UA 2VXZA 3GW2A 3V8KA 3WQUA 4IZ9A 3H1QA 3RYPA 4RGXA 3GZ5A 4M7YA 3R6SA 5IT3A 3F22A 2W40A 3LQQA 3HZ6A 3WODF 2E1YA 1ONVA 4A5MA 5JFRA 1ULYA 1C0WA 1FT9A 3VESA 4BC5A 1ZG5A 4CZMA 5FPNA 2W25A 2FOKA 3CETA 3E5QA 4CZEA 4RGSA 1C0GA 1AOYA 1QGPA 1HKGA 4UVCA 2IIRA 2FNAA 2QVOA 4BREA 3KP4A 5ICCA 2RNJA 4H0VB 4GCVA 4Y15A 1BOAA 5AFUA 3HOSA 3QP5A 3CUOA 1J75A 1BI2A 3HSEA 3V7SA 3D0SA 1QHAA 5E8GA 3WG9A 1F4KA 4FT8A 4BG9A 1XC3A 5D5WB 5LLQA 2YHXA 5ICGA 2CW0F 1MZBA 3JAMZ 1GVJA 4BR4A 1IJJA 3ML6A 4AIKA 3KEQA 4LD5A 5AQSA 1USSA 4M74A 1EQYA 5JR3A 3WXKA 1YIOA 5CVJA 3WTZA 4KFCA 1O3QA 5CVVA 1LDKB 1SD4A 3IFRA 2GTDA 3C0BA 4BRCA 3CJ9A 4HX7A 3FMSA 3R8EA 2PI0A 1S7AA 4I01A 2BBYA 4FPAA 1R1VA 1ZREA 2J5OA 4HQMA 2HR3A 1TYQA 5CVUA 4UVBA 2K02A 4KUMA 4LB5A 5FLXK 1KQ0A 2ZF5O 1T44A 2VOOA 1H1VA 4HF2A 2P4WA 3EETA 3HSFA 3DXJF 4HZFA 2EV0A 1ZC6A 1Z6RA 3ZX3A 5D6EA 1YG2A 3O4WA 4OINF 4CZLA 1XMKA 1U3EM 4CICA 2V7ZA 1J6ZA 4WQ4C 1XGMA 2QWMA 1I1SA 4MQVA 4FSVA 4KT5C 5AQXA 5AQGA 2FF4A 1SD7A 1MJ9A 3DJCA 3IDHA 4IJNA 4A6EA 2NS0A 4MGRA 1LVAA 4ETSA 1YYVA 5B8HA 1WWXA 3LFKA 3KCCA 3ABUA 2CGPA 1V4SA 3QU3A 5CE3A 2PG4A 1XUPO 1KQ8A 3G25A 4FWNA 4BVPA 2G9WA 2UXXA 3ZMZA 3MQ0A 3VPZA 1SFUA 2IA2A 2IVPA 2VC0A 2F9TA 3K69A 1E2XA 1JXSA 1BU6O 4MEXF 2PLYA 2P9SA 3QOPA 1P6RA 4ZYEA 3T8TA 1E17A 3MK6A 5E1WA 1R5HA 1CZAN 3VEXA 3T0YA 2JSCA 2L4MA 1YS7A 3NEUA 2GA1A 3U8XA 2YJEA 4BRNA 1FY7A 1U5TA 1D5VA 5BOXA 3RPUA 4RGUA 4U7DA 1RDWX 3EKSA 1BIAA 3U9DA 3KZBA 2Z33A 1G3WA 1NGCA 4LB6B 4G6DA 4GO1A 3AARA 2FNPA 4EIAA 3KHYA 5LEKA 4TV7A 3KFWX 3V8JA 1U6GA 3L00A 1EH6A 4MTEA 2HQNA 1YW9A 4A2AA 3Q9VA 2CYYA 5L3DA 4U0WA 2K86A 5FPDA 1P4XA 3O6BB 1HKQA 5D4SA 2NZTA 4HBLA 1WKMA 3A8YA 1F1ZA 4M9XA 2P9PA 1P4AA 1GLBG 2M8EA 2GWJA 4I0BA 3VEYA 1S29A 1RIOH 2L3DA 3P4IA 4IXAA 1P2FA 3JSOA 1S3JA 1RUNA 1OR7A 3TPQA 1H9GA 1R5GA 2HQRA 4JBAA 2AP1A 3C7NB 2ITMA 3IWZA 3AAPA 5CVRA 1K78A 2JRTA 3I59B 2DQRA 3NQOA 1FOKA 3R6MA 2EA4A 2XROA 3K2ZA 3GFLA 3C18A 2TDXA 2FQ3A 2OU2A 3M3ZA 4KNYA 2KHOA 3R0JA 3J80K 1T98A 3WQTA 4ENKA 4FWPA 1SAXA 5BPIA 2OBPA 2DU9A 2XAGA 3BP8A 2ETHA 3PQJA 5FB2A 1JCFA 3EKUA 4FWSA 3EDPA 3H92A 1IRGA 3MWMA 3E5XA 2EK5A 4WXCA 4P9FA 3HBTA 4CJ7A 4BAYA 3E6BA 2IJLA 5DUIA 5BN9A 1B59A 2KJBA 2CSOA 3ZMDA 1P4WA 3R60A 2GXBA 1ZH5A 1LNWA 1NGJA 1NGAA 4ESJA 4CD3A 2EB7A 1ZHFA 2IP2A 1T6CA 4BHCA 2L4AA 2A5XA 2YCHA 2PBIA 3U9GA 1XSDA 2KRFA 2QZ8A 3S41A 4KN7X 1R22A 3KP5A 2VT2A 3WTWC 3ATVA 5AIPA 4A0YA 5EVZA 3GWZA 4AVPA 1RNLA 3ATUA 3GE1A 3U9ZA 3TO7A 1U6ZA 4WK8F 2ESNA 2XAJA 4BH9A 2Y75A 3WGIA 2O61A 1T0FA 3BY6A 2WV0A 4IRHA 3GEZA 3RYRA 2UZKA 1SAZA 3FGUA 2P9PB 3H45C 5AQTA 2ZGYA 1W7PA 3GUDA 4HWIA 2FMLA 1DP7P 1OKRA 4BROA 1O7FA 3HI0A 2RN7A 3F23A 5A2QK 4L0ZB 3AAQA 5DYMA 3O08A 2ZMEB 4RGRA 2EFPA 2ZBKA 4HDVA 3EN9A 3F8NA 1WSUA 4K43A 2MA3A 3F6VA 3TOAA 4Q5SF 2EFOA 4GNIA 4I02A 5ADXA 4BR7A 3LA7A 2L01A 4HTLA 3RSEB 1TW3A 1O3SA 1KQ9A 1BM9A 4LG0B 1BI1A 3L9FA 1O3TA 1O3RA 2IVOA 3T1BA 4O5VA 5AQWA 2E2QA 2Y0MA 4B1YB 1YXQA 3F21A 3HRSA 4HYEA 3L2CA 3KLOA 3N97A 3SMPA 2ISYA 2FLOA 2K4BA 2COMA 4P5OA 2ZCWA 1GLFO 3IKTA 3SQNA 4CBUA 1LCUA 1KYZA 4EVIA 5JICA 3GF2A 3UKUB 4FOIA 2UXNA 5AQJA 2J5PA 3CJNA 3ENHA 5AR0A 2DFIA 5D8LB 2FA5A 3VOEA 3C7NA 5KPZA 2K7LA 4PGGA 1CF7B 2FE3A 4BC4A 3VOVA 3MZYA 4XRFA 4JN4A 3MMVA 4IVNA 2QBYA 2IA1A 1VTNC 5FO5A 1JCEA 3RJPA 4B9QA 1B6AA 4JK1X 3MCZA 1RFQA 1S22A 3Q5FA 2A42A 1O57A 3WU0A 4EQQA 3D2EA 3F3XA 4LFUA 3H3ZA 3TOBA 1X3MA 1KU2A 1TNTA 3LM2A 2RC4A 4AIJA 1ODDA 2E1CA 5BPDA 1QPMA 5BMZA 4BHPA 5AFUH 1IN4A 1HQCA 4K2EA 4BRQA 1ZYRF 4KA4A 4WX9A 1FSEA 1NM1A 1BOTO 3D7EO 2D0OA 1HKSA 4H5RA 5F2RA 3SK3A 3ULQB 3BOQA 3OOPA 3VB2A 2M1BA 2DW4A 1JCGA 4A2UA 3FM3A 2ZGZA 2EWNA 1TNSA 1HXDA 1U2WA 3E97A 2V6CA 4CDGA 4FO0A 1JGSA 1Z7UA 4CI6A 3LWFA 5HDGA 1Z1DA 2A6AA 3FX3A 1IXSB 4B1XB 4FOEA 3HSRA 4MNUA 2KIMA 5KPRA 2CWEA 3WEEA 1QQMA 2BGCA 2Q0RA 3LAJA 3GDQA 2BEOA 3A5OC 3GFMA 5LBQA 1SD5A 1GLDG 3RSEA 2AXLA 5AZJA 3SMSA 4AIHA 3VENA 4UVAA 1C0FA 3E3VA 5EOYA 5IT9Z 5LGTA 5L3GA 5JLFA 3HRTA 2HYGD 3FM5A 4RAYA 3V7CA 3R0AA 1U78A 1IN7A 4Q47A 5E84A 1UFMA 3LQRA 4ESFA 3DP7A 2CQKA 2QENA 3RTRA 1BG3A 4BGBA 2GELA 1XGOA 4H0XB 3CDHA 3F8MA 3VEPA 3BUZB 1U2VB 4WQ5A 2H09A 5KK1A 4K42A 5EX5A 2DPDA 4R1HA 4MHGA 3R9PA 3A5MC 3ZMTA 4N9HA 3KE2A 3KEOA 2OANA 5CLSA 3FXQA 1GLJO 4WXDA 1TQPA 5AQHA 4LC9B 1CF7A 4NB4A 2XKOA 4CO8A 4MLEA 2ZNZA 5AQYA 1XGNA 4HX4A 2QWLA 3VFZA 5FD5A 2LKPA 1YAGA 4CZKA 4XH4A 3MN5A 1E4GT 5J8CA 5EY4A 4OIRF 2VWBA 1G6NA 4EMSA 1IXCA 4FWQA 2W24A 2QM1A 1TQIA 3H6EA 1IUYA 4BVOA 5AONA 2QQBA 3U4LA 1HUXA 2R7FA 4QWQA 4NB5A 2EJRA 4KIFA 2H94A 1ZRDA 2P9UA 3GFIA 4LK1F 2O0YA 1QZZA 4C23A 5D4RA 1GLEG 3T5XA 3COAC 3JAMK 4FPBA 2A41A 2E2OA 2E88A 3ZMUA 2ZO4A 2FU4A 1SQKA 4BG8A 1FSHA 3B73A 2LNBA 2VBZA 2HKXA 3KZZA 3IC7A 2UWMA 5ILUA 3HYIA 2H27A 3QPHA 1KU7A 1XD7A 2E7WA 5H20A 4Y0WA 2ZMEA 2E1NA 2P6SA 4ISEA 3WU1B 4FWOA 4GY2B 4OIQF 4XSXF 5FD6A 2P7VB 1USTA 1ZLKA 1FP1D 1TLHB 1O7LA 4H5WA 4LJZF 1J5YA 5BREA 2NRHA 3LDNA 2IA0A 4YFKF 1PP8F 2A68F 3WTYC 2L02A 3HSCA 3W0LA 2YHWA 2LF7A 1Y64A 4DQ8A 2RQPA 3FF5A 4MEYF 4PL7A 2VBYA 3AY9A 5FFXA 3G3ZA 3QRFF 3WE3A 2P8TA 4BRIA 5HS8A 2Q97A 4YDUC 4Z2YA 4M72A 3JXUA 5TKYA 3CO7C 3GLXA 2W57A 5F6FA 2XVCA 2ELHA 1P8ZA 1HSJA 1CGPA 1T6DA 1GXPA 3CTAA 2DI3A 4H0PA 2H6BA 4BC3A 3M6GA 5AQPA 3RKYA 3WGGA 3L09A 4B1VA 4ZYDA 3LDPA 2ASPA 2XUBA 3QMLA 5KQ8A 2K27A 2XHKA 1BI0A 2XAQA 1GHCA 4KICA 3M1FA 1DEJA 3I58A 3GYHX 1BUPA 2QXLA 2D45A 4BQLA 5HDKA 1V4RA 2FRHA 3WXLA 4YG2F 3DQVC 3I53A 2P9NA 2A3ZA 3DAWA 1D8KA 1LQ1A 5AQIA 3D2EB 4UNOA 1S7OA 2F2EA 1BN5A 4GYIA 2Q2EA 2EV5A 1BI3A 3DXMB 4BRPA 2BYVE 1YFHA 2EFNA 2F9WA 1EH7A 5K1YA 1YLFA 2DTRA 2L54A 2MD5A 2DAOA 4I7HA 5CYVA 2Z5UA 3ZQ7A 1PP7U 4JNEA 1ON1A 5AQUA 4CXFA 3FZFA 5KQDA 3E6CC 4JD2B 4K41A 1J7KA 2OZ6A 1ATSA 1LJ9A 3P7NA 4B09A 4BC2A 4LLNA 4B1ZA 3FZVA 2XIGA 4JHDA 2I7PA 3REOA 4ASNA 1ZRCA 4BRMA 3IKVA 1NLVA 4PGHA 1YQAA 3WGHA 4FWLA 4AM7A 2PFBA 3CJBA 4XEIA 2VBWA 2STTA 4HLXA 4OU0A 4XLNF 4HQEA 4FHTA 1U5TB 1G4DA 2D1KA 3JTGA 1L0OC 1DKGD 2B0LA 2JT1A 3B8AX 3ENOA 3I71A 2KKOA 2ACJA 4R79A 2F5CA 2P6TA 4NHJA 1B1BA 2DLLA 3CLOA 4BGAA 3ECOA 1FZPB 3QBWA 3PFIA 1R1UA 3QFUA 1OYYA 5AQOA 3GVAA 5L3CA 3UKUA 4BRKA 1QNTA 4A5NA 4M71A 2QQAA 2M87A 2CG4A 5DCFA 4R8HA 3BF3A 3EQLF 1R59O 3C7JA 3EZWA 3LA2A 4KYWA 4P96A 3RIRA 2MC3A 5LGNA 4RTFD 2XRNA 3BJAA 2VE8A 4KBOA 2V51B 2HTJA 3KP6A 4P55A 3VF2A 2F5DA 2V79A 2E8AA 4L9NA 4BR0A 4G9YA 1ZARA 3KZYA 3KP3A 4D0PA 2DT5A 2RV8A 1I6XA 5JMVA 4RAZA 5K5QA 3QDKA 4KN4X 4IHTA 1FYMA 2ZWHA 3J7AO 1WUAA 3J8AA 5BPLA 3FZHA 1YW7A 3H3UA 4G7ZF 3ZP5A 1ZN2A 3F72A 2QYOA 3ECHA 1Z6TA 3LDQA 3MCPA 5TRDA 2ZJ2A 4K25A 4S04A 3GBTA 4I09A 4CZHA 1KYWA 4BHBA 4JD2A 2P5LC 1MJAA 3C3WA 1WOQA 3FXUA 4GYGA 3CQXA 4RWTA 2HF4A 5ERIA 4FWMA 1GLAG 1NGEA 4L9VA 4YDUA 4Y17A 2BUPA 4WQ4A 1QBJA 2MBFA 5HLGA 4A2BA 1G3SA 3N4MA 2HTSA 2VYPA 5HLIA 2YHYA 3DPTA 2FSJA 4H0OA 4CZGA 4MO4A 3ZX0A 5J6XA 5BRHA 4BRAA 3MZHA 1JHFA 1WQ2A 2HF3A 3L6QA 3F6OA 1SMYF 2FF3B 2CO5A 4A6DA 4IJAA 4HF1A 4BRGA 4YFXF 5D5VB 1U2VA 2XAFA 4A61A 2X4HA 4BNCA 3SZPA 4QS9A 4O5FA 3R61A 2IT0A 1NHAA 2MLKA 2JZYA 4CZZA 1LEBA 1J59A 4NQWA 3CUQB 1W5SA 4E70A 4ZZLA 4ENJA 5BRDA 1T39A 1K7AA 2EFWA 4HA8A 1TYQB 1D4XA 3HRMA 1DDNA 3I5UA 2G7HA 2QWOA 4O6JA 3F9MA 1H0MA 5EEGA 5K5OA 1ESVA 4L18B 1IRFA 3WTXC 4DB3A 5BRFA 3BPVA 5ILVA 4UUVA 1XQSC 2CGJA 2FXAA 2JPCA 3I33A 2GQQA 4OOIA 2GWRA 4ISGA 1R00A 2W84A 4JQFA 4U88A 4LLLA 1IF1A 3UE5A 2Y48A 2VOPA 5F0XA 1BIBA 3LSTA 1UHMA 1XCBA 4UV8A 4EAHD 5L3FA 2PQ8A 1SMTA 1JE8A 2P9KA 3DEUA 1SD6A 3L7WA 3ZX2A 2P9UB 3O8MA 3E5UA 2OAZA 3DKWA 3DPLC 3EYIA 3QFPA 2RGVA 5JI6A 5I9EB 5DD8A 4BRLA 3FZMA 1QO0D 3A5LC 1J2XA 4EJUA 5DV5A 1SFXA 3ID8A 1IXRC 3H3OB 5HLHA 3O1BA 1K8KB 4M7XA 4DNCA 1AWCA 1JHHA 1Q1HA 3DFGA 1FYLA 2P9SB 3MDQA 1MGTA 5ICFA 4HV6A 2V7YA 1MDUB 1K6OA 4GGGA 1W4MA 5BN8A 4ZH4F 1ZXOA 1HLUA 5KPTA 5H6RA 2W41A 2LDUA 3FFKB 2OD5A 5L3EA 3LL3A 2OZUA 2A6HF 1XCVA 2MH9A 3VEZA 1SFEA 1F5TA 1TBXA 4HAMA 5AQVA 2FSKA 2E2PA 3D2FA 3QP6A 1HX1A 5AQQA 4AWXB 3W3DA 2IW5A 4Q4ZF 2QBYB 1MA9B 5HS7A 2MLGA 2PBDA 2O6GE 1FP2A 1DPRA 1UB9A 5FLXZ 4H5TA 2KIFA 2R3SA 5J8FA 5HOOA 3SFZA 2BE5F 5EXWA 4ZZDA 1W7PD 3P9IA 5AZIA 1B9NA 2WTEA 1RI7A 1OPCA 4OIPF 1EV7A 2FMYA 2FXUA 3VODA 1UCRA 5LEJA 1R7JA 5E1XA 5E26A 5L3BA 4CBXA 4L5JA 2C6YA 2M5WA 5JVTA 4EM2A 2VCPA 2QW9A 4Y13A 2GUPA 1QQIA 4ESBA 3C1DA 5E18F 1XDSA 3QICA 3LAPA 4U7BA 2FSNA 5F64A 1V3FA 1LOTB 2YJFA 2OA4A 2V1UA 2P5KA 3WTUC 4FX4A 3GX4X 4GXOA 4ZYGA 2Q8KA 4M73A 2W85A 4MLHA 1NWKA 2VE9A 3RKWA 4L9JA 2D1VA 4M6XA 2Q0OA 2P9KB 2O3FA 3E6DA 2M45A 5JLHA 4ON0A 4I0AA 3Q9SA 2QUFA 4IXCA 2A3SA 2HGCA 2CH5A 4UV9A 4XLPF 1RGIA 3K1NA 4BXUA 2PAVA 1U5TC 2P9NB 1ATRA 3FR0A 4WQ5C 4EJTA 2AA4A 4PZJA 3GOIA 6PAXA 3D5LA 3I4PA 4PKGA 2QWWA 4HLYA 1X3NA 3UKRA 1HKTA 4M9ZA 2CGKA 1HBXG 3V4GA 3ZPLA 2O8XA 4I6MB 3CJCA 3RDIA 2QLZA 3J80Z 2V1DA 2HZTA 1WRJA 5E17F 2FBKA 4OMZA 4BQZA 4EHUA 5DCMB 2YU3A 1WI9A 1XGSA 2Q36A 1MJBA 3ROUA 1KU3A 1E4FT 5E20A 3TGNA 4FWRA 2JTVA 3OV8A 1ZGJA 2GZWA 2FEZA 4XH5A 4N0BA 4WYBA 5E8IA 1KA8A 2Z3YA 4CHUA 2QQ9A 3P9CA 1FBSA 1PUEE 5ICEA 2HEOA 3CJ7A 4Q48A 2GA2A 5LGUA 4BQAA 4RB1A 2A61A 3IL2A 3B02A 1QZ6A 2CGLA 3IUCA 3G73A 1I1GA 2RVCA 3FWEA 1RZ4A 4G8XA 3IRQA 4MTDA 4J8FA 4G6QA 3MN7A 4I2OA 1NGDA 4G7HF 3VEWA 3HRUA 4QLCU 2D1HA 5ADXH 4EJOA 5LJWA 2O03A 1KXPA 1LDDA 3I54A 2IPQX 2HYFA 1IG8A 3TO6A 1V4TA 1YVNA 1L3LA 3ZETA 4EM0B 4HV5A 4WF2A 3EL2A 3CJAA 1BO5O 4PDKA 2FSWA 3ELKA 2QWRA 3ZEUB 2P9IA 2FBHA 2XGXA 1W5TA 1DUXC 2XKPA 3KP2A 4ENMA 4QS8A 1U8RA 1YW8A 3CHWA 3O3KA 1LEAA 2PJPA 2YI1A 3TKYA 4B1WB 3HHGA 2J4RA 3FZLA 2ASMA 1OYWA 4HX8A 2Z9OA 2MH2A 3HIFA 1REPC 4L9TA 1MDMB 1B4AA 4A12A 1HW5A 1NGGA 5H6QA 3W6KB 4KIGA 2BTFA 2ZFWA 4WXHA 3FLCO 3T8RA 5TJJA 3P9KA 4CGZA 2Z99A 3FZKA 1HJOA 1NGIA 4OIOF 1BC8C 2IVMA 2D2WA 3CQYA 1FYKA 4L5IA 2PMUA 4RB3C 5AQMA 3HM8A 2XASA 1HKBA 1QZ5A 3TDUC 3BPXA 3IRRA 3CUQC 4KMUX 2YX4A 4CBWA 1TQMA 5ED4A 2KIUA 3JTHA 3JS6A 1Z9CA 3MN6A 3EUHA 3WTSC 4L0YB 4PKHA 3LDOA 1DPUA 2GXGA 2A69F 1ZG1A 3QPTA 4IRIA 3WXIA 2NNYA 4XSZF 1ZLJA 2BV6A 4M9SA 1Z05A 2KJCA 2YX7A 1BWFO 4RCHA 3WXJA 3BDDA 3HUGA 1KAYA 1I27A 3I64A 3M8FA 2P7CB 1QQNA 3M9AA 2F5EA 4WWCA 3J81K 4FWKA 3ULEB 1NMDA 5D6FA 1KAZA 2RDPA 2EWSA 3D2FB 4LGWA 2QWQA 3MN9A 4A0XA 5D5UB 3QAHA 3F8CA 3LDLA 1G99A 1ZBSA 2ISZA 5AQZA 1IZ1A 1KU9A 2H3GX 1T2KA 3IMXA 3R4KA 5AIQA 5ILSA 3DV8A 2QWPA 4KIBA 5JHUA 5HS9A 2QM3A 3DXKA 2VONA 1UHWA 5FFZA 2NYXA 3O1WA 2EV6A 1FNNA 5DDGA 1BBYA 2DO7A 5CJ9A 4BR2A 1BC7C 2DPNA 1T38A 3WUHA 4N9IA 3DWLA 2GWKA 4IPAA 1XN7A 5BS6A 4U0YA 1HPMA 4O8KA 3WTVC 2Q2RA 4BYYA 3SXYA 4LMYA 2HMPA 1G3TA 4F7ZA 4OMYA 4AD9A 4H0TB 2CFXA 2K4JA 4EJVA 3SHFA 4EM1A 1MWKA 3BZ6A 3NRVA 4BRHA 4BR5A 5IT9K 1P92A 3SLCA 3O2PE 1MKMA 3CUQA 4KMFA 4M63C 4PL8A 3HHHA 3ISPA 5HDNA 2XV4S 1EH8A 4H03B 3K9TA 4UXNA 2FBIA 2V1XA 1IAWA 5AQFA 2AS5F 4FL9A 2P9IB 4IRGA 5BPMA 1X9JA 1YO5C 4DCHA 5AZIB 4Z94A 3MEXA 3GZ6A 1IN6A 3LA3A 2JPBA 4XBFA 3WTTC 2STWA 1HSTA 3WEEB 3BJ6A 3ZN0A 1F9NA 2NNNA 2ZNYA 3CI5A 5BR9A 4EHTA 4BR9A 1IW7F 1OYIA 4PKIA 2V52B 3O6WA 4O3MA 2E20A 1D8JA 1TTYA 2CH6A 5LHGA 1IN5A 2D0PA 1Y0UA 3HTVA 1HW2A 3BROA 3K0LA 1A04A 3BEXA 2R7DA 4B8XA 3AAFA 2QWNA 3CO6C 5FGMA 1S8NA 3TO9A 1NBWA 4BRFA 1RUOA 4ISFA 4EJWA 1SZ2A 2X0LA 1J9IA 1K8KA 1KAXA 2VC1A 2UYTA 4L3QA 5LRRA 5LY3A 1IN8A 1W7PB 4CZFA 3HTUA 2Q1NA 1XB4A 3VEOA 1D3YA 4G7OF 4RB2C 5AQNA 1R23A 3RI4A 3TQNA 3I0TA 1GLCG 4XH1A 1X3UA 3VGLA 5DD4A 4FX0A 1GXQA 3HOTA 3SJHA 5LHIA 1QQOA 3IWFA 3JW4A 3RKXA 3CIPA 3A0IX 1R36A 2Q31A 1S6LA 3BF1A 4S05A 2ZKZA 3KETA 3KVGA 3BJOA 5BQTA 1OKJA 2OQGA 1MWMA 4H5NA 2OQRA 3KLNA 5DEQA 3V8LA 1QZYA 4CYDA 2EA2A 2XAHA 1ZGAA 3ZEUA 2M30A 1FC3A 2VBXA 1TUYA 3ZMVA 3SZTA 4IWVA 3K1PA 2NAZA 4HW0A 2HDCA 2A07F 3VF6A 3WT0A 2GEMA 1BA1A 2YR2A 3HTSB 2F5FA 3ZMSA 1YUWA 5CVIA 5DCMA 3H3NO 3FXRA 3CJ1A 5K5RA 1XMAA 4B1UB 3I59A 1T6SA 2HWVA 1LB2A 2ADUA 3JSPA 3RPQA 4DQ2A 5AZJB 2A5YB 5EEHA 3VETA 4MQ9F 1FLIA 3UKRB 2P9LB 5E1ZB 1BA0A 3FE1A 2LSOA 4IHSA 3QB0A 1Q18A 1HW1A 2HFHA 2EFQA 3U1DA 3V7RA 2YPRA 2A6EF 2IRFG 2GAUA 3M7GA 3O5BA 1XSXA 4BRDA 4YFNF 4DHYA 1NGHA 1BDGA 2LF8A 1K79A 3F8BA 2DPUA 2H6CA 5D8KB 4HDUA 2VODA 4EGYA 3L4IA 5AQLA 4CZJA 3GXOA 3DF8A 4LLGF 3CERA 1HKCA 3M1EA 3QU6A 4ZYHA 2RKHA 2E2NA 3EO3A 4NO7A 3QBXA 5FPMA 3VEVA 4I6MA 3FMRA 3O80A 5AQRA 4JAXA 4EV0A 2I7NA 3WE2A 2IVNA 4I98B 3ABTA 1K78B 4JHDB 3GFJA 4LK0F 3MFKA 1MDMA 2GIVA 3A5NC 1S3XA 4A62A 2WUSA 1YTYA 4E1JA 3ERED 2YSRA 1NGFA 1MD0A 4IO8A 3PQKA 3EYYA 4EFHA 4P9UA 1R58A 3TU5A 3FMQA 4U0VA 5KVRA 3ULEA 3U2RA 3KP7A 3VERA 5F1RA 5LHHA 1LDJA 1XDUA 2G7UA 3I8BA 5ELZA 3E6MA 5LRSA 2DK5A 1J0RA 1OMIA 1YS6A 2WC2A 3DXMA 3L0QA 4ENNA 1TUUA 4G94A 3GO5A 4YIIA 1NGBA 4H5VA 3VGKA 5D5XB 1FX7A 3H1VX 5FPEA 4PCQA 3F8FA 2E7XA 2P9LA 3GG4A 3M8EA 1STZA 3J81Z 4EGZA 1FBUA 2FF6A 4YIFA 4M6YA 4CZIA 1TW2A 2V9VA 4QS7A 2E1ZA 3W6JB 2HOEA 3LM9A 3OHRA 2PMHA 2PEXA 2NRAC 2DBBA 2A40A 1ATNA 4AM6A 1ZG3A 3BWGA 3H46O 2VN2A 2NLXA 3ZETB 5BPNA 1FPQA 1GLLO 5DUKA 1FBQA 4UHTA 4MO5A 3GL1A 1PDNC 4H0EA 5LJVA 3FHZA 2HS5A 1ZAOA 1ON2A 3MAJA 3ZN1A 3S2WA 1ZRFA 2DK8A 4H0YB 3K1MA 2PN6A 2ASOA 1R1TA 3TDZC 4F9OA 4HOBA 4CD1A 5AQKA 1G3YA 1KGSA 4HF0A 2HKOA 1DGKN 4WCGA 2D4WA 4RB0A 3DXKB 1B9MA 5HVQC 3IHUA 4KDPA 4IF4A 2DQLA 4LG0A 1H9TA 5F1XA 1BJAA 2ESHA 4A0ZA 1XSVA 2P5VA 3VF4A 2ZXJA
chains in the Genus database with same CATH superfamily
4F3QA 4JK7A 5A2QZ 4RS8A 1I5ZA 2KRCA 1DGRM 4A3DJ 1FWZA 2RE2A 3CESA 2WWYA 2KQ2A 2VT3A 1XS9A 2YX6A 3UB5A 3VGMA 1LKXA 1QZEA 1Z91A 1K4TA 2Q0UA 2VXZA 2YHAA 5IWAK 2ZJPL 3GW2A 3V8KA 3CD6N 3AO5A 1H89C 4BXXJ 4IQ4A 4IZ9A 3I3LA 3FK6A 2MW8A 3H1QA 3WNHA 3RYPA 3SZ2A 2IGOA 4MO7A 2K9NA 3GZ5A 4RGXA 4CZCA 3BZKA 1RRJA 1K4SA 1ACIA 3QINA 3ABKH 4M7YA 5FLXO 2DJNA 1NG7A 1XMOK 4B9VA 3P83D 1YITI 3R6SA 1K8AO 1IC8A 5IT3A 4MIMA 3F22A 3LP1A 4I9LA 2DY4A 3HK2A 4NDLA 3LQQA 1Q1VA 3WODF 1LW0A 1ONVA 2E1YA 3HXLA 2W40A 3HZ6A 5DK5A 2CRGA 4A5MA 5B1AH 2KFZA 5JFRA 1ULYA 1C0WA 1AA7A 1FT9A 3VESA 4BC5A 1ZG5A 3O9SA 4CZMA 4DLEA 1D9FA 5FPNA 4K8ZA 2W25A 1KQSM 1Z3XA 2FOKA 1VFCA 3CETA 3E5QA 3JRCA 4CZEA 4RGSA 1C0GA 3T1YK 3AA4A 1AOYA 1QGPA 1HKGA 4UVCA 5IP9J 2IIRA 3CCSI 2FNAA 2QVOA 1EJ9A 3LP2A 4BREA 3KP4A 5IYCJ 4JK9A 4II2A 2V9PA 4DBRA 1CZ9A 4B3MK 3ITHA 1K6YA 5KCMA 5ICCA 2RNJA 3ENBA 4H0VB 3V9ZA 4GCVA 4IG0A 4Y15A 1MSFC 3OBYA 1BOAA 4NCBA 5AFUA 2Y1JA 3HOSA 4FZXC 4N56A 2GM4A 3BG6A 2ZMEC 4B9TA 3PX6A 2ELJA 4F4KA 3OIQA 3QP5A 3CUOA 1J75A 1LWEA 4O5BA 3NAEA 1V55H 1BI2A 3DBRB 3HSEA 3T7ZA 3V7SA 4KO0A 2Z2SB 3D0SA 1QHAA 5E8GA 3WG9A 4CGHA 4M3EA 5DM6L 3HP6A 3IH2A 1F4KA 1HYSA 4FT8A 4BG9A 3G1OA 1XC3A 5D5WB 3HO1A 1CXUA 3AVCA 5LLQA 2YHXA 5ICGA 2CW0F 1MZBA 2ID3A 1GVJA 3PNTA 3CDLA 2TCTA 3JAMZ 4KITB 3N4QA 4BR4A 4BE1A 4CHNA 3OTOK 1YIJN 2G8WA 4CEFA 3CCEN 4LF9K 2DMTA 1IJJA 4JI8K 2BOLA 5HNHA 3ML6A 4AIKA 5TGTA 3EYZA 3KEQA 4LD5A 3NFAA 5AQSA 5EF6A 1JL1A 1USSA 4M74A 4BL0B 1EQYA 5JR3A 2QKKA 1WHUA 3WXKA 1YIOA 3RQ4A 1LW2A 5HBMA 3VQEA 3VPRA 3G6EI 5CVJA 2X6XA 3V1QA 3WTZA 4FK2A 1FOWA 5JLWA 4KFCA 3PX0A 1JKOC 1BQNA 2KFNA 1O3QA 3PLAA 5CVVA 3I0SA 1LDKB 2CQNA 4X64K 2D0BA 1SD4A 3IFRA 5A2QO 2X48A 4YIRX 1DLOA 5TKWA 2GTDA 3C0BA 4AHVA 4BRCA 3CJ9A 2O8CA 3OBWA 4HX7A 3FMSA 3R8EA 2PI0A 3V9SA 4OLAA 1S7AA 4I01A 2FBYA 1IGNA 2BBYA 4ZDPA 4FPAA 1R1VA 2OPSA 4EP5A 3QEXA 4C8OA 1ZREA 2J5OA 1NK9A 1IBLK 4HQMA 2HR3A 4C8MA 2IEKA 4NNJA 1J9AA 1TYQA 3VQ9A 4A3BJ 5CVUA 4RMNA 2GUIA 4HEA2 3AVJA 2JJ7A 4UVBA 1FKPA 2K02A 1GDTA 1MIJA 4KUMA 3V42A 1AU7A 1BI4A 2GV9A 1S72N 4Z4GA 5F1JA 4LB5A 2QQ8A 4DLGA 3ZSOA 5FLXK 2R4GA 4YELA 4PJ0C 4Z4HA 3PO5A 1KQ0A 2OCCH 3IAM2 2R5YB 1QHTA 2B6AA 4YHHK 2ZF5O 1ZBIA 2K9MA 1T44A 5J1RA 2VOOA 2O8FB 1Y8QB 1H1VA 1FKOA 3VQPA 4HF2A 1UWBA 2P4WA 2LTPA 4IZZA 3EETA 1V5FA 1K73O 3J81O 3HSFA 3KZIC 3DXJF 4HZFA 4OKJA 1OH5A 1JI8A 2EV0A 3NGZA 1IDZA 1Z6RA 4BXFA 1ZC6A 1B92A 1EX4A 3ZX3A 3CMEN 4J00A 3G1LA 1VZ0A 1YG2A 5D6EA 4B3OA 3BQYA 1F43A 3X2QH 4IHVA 3O4WA 4CJSA 2MFZA 4OINF 5E3OA 4CZLA 5H2FC 1X58A 1XMKA 1U3EM 3O9TA 2JRMA 4Z4CA 5EYRA 4CICA 4FJJA 2V7ZA 1J6ZA 2BE2A 4OVLA 4WQ4C 1XGMA 3PUFA 2QWMA 1I1SA 2ATQA 2K85A 4MQVA 4FSVA 1RBVA 4KT5C 3RSNA 2HBLA 3WNEA 5AQXA 4IEEA 5AQGA 4M45A 3K10A 3BG5A 4RBOA 3CFPA 2FF4A 1SD7A 1LWCA 4IOXA 3ABLH 1MJ9A 3KX2A 3DJCA 3IDHA 1TVRA 1JTXA 4O44A 4JX6A 3K5NA 2WY8Q 4IJNA 4AHSA 1R9TJ 4A6EA 4GV6A 2NS0A 4MGRA 4PSXA 2VWKA 2HHUA 4YOVA 1LVAA 4ETSA 1YYVA 1IG7A 5B8HA 5I3UA 1WWXA 4AQYK 3P31A 1BJZA 3KLHA 3BG3A 3LFKA 3CFRA 3KCCA 2LKSA 4PUSA 3ABUA 4D7NA 5FKLA 5GAGJ 4AHRA 4A5AA 2CGPA 3FIWA 4CECA 1V4SA 1R71A 3QU3A 5CE3A 2PG4A 1XUPO 2KZZA 1KQ8A 3G25A 1U48A 4FWNA 4FM1A 4DUZK 4BVPA 2G9WA 1W9HA 4CW7B 3AVNA 2UXXA 4WFNL 1FEXA 3ZMZA 3MQ0A 3QERA 3VPZA 1TP4A 4CK3A 3SDBA 4AUXA 1SFUA 3DEWA 3DTKA 2IA2A 4BWMA 2IVPA 4U87A 1WSEA 2VC0A 2F9TA 3K69A 1E2XA 1JXSA 1TT0A 1BU6O 4MEXF 2PLYA 3OR1C 2P9SA 3QOPA 1HOMA 4FK0A 2IS6A 2VASA 1IRZA 1P6RA 1SFKA 4ZYEA 5EG0A 3T8TA 1E17A 3H5NA 3AA5X 2LBFA 3CF2A 5E1WA 1FTTA 3MK6A 3P1GA 2UUAK 4DS4A 1R5HA 1CZAN 3LP0A 3VEXA 3RR7A 5C10A 4FLUA 3RMAA 3T0YA 2JSCA 2L4MA 2ZE2A 4M3BA 1YS7A 3NEUA 5IP7J 3K70D 3CC2I 4HHTA 1LV5A 4OO1J 2GA1A 4FM0A 4PFOA 4DSFA 3MMYB 1KONA 2E2IJ 2BY3A 2XF6A 1KVCA 3U8XA 2YJEA 2L9VA 4BRNA 1LE8B 1FY7A 3S32A 2NVTJ 1U5TA 2H8WA 1D5VA 5BOXA 3RPUA 4RGUA 4U7DA 1RDWX 2KLOA 3EKSA 3KLIA 5FDLA 3VQ8A 1BIAA 2VXDA 3SAGA 4DV5K 3U9DA 4DR6K 3KZBA 2Z33A 1G3WA 1NGCA 4LB6B 1QU3A 2OPRA 5IOZA 3JRAA 3CMAN 4FASD 4G6DA 4GO1A 2HBJA 5IYDJ 5M5WJ 3AARA 3SUNA 3TP3A 1ERDA 2FNPA 1S1UA 3F5TA 5CYMA 3K5MA 3CCLN 1G59A 1S6QA 3JAMO 4FLYA 3CCVI 5HL7L 3NVMA 1G2HA 2LY1A 3HJEA 1BW6A 4BY7J 4QTRA 1APLC 2HBKA 4JI1K 4EIAA 3DBLB 3CJQB 3DM2A 3KHYA 2X78A 4D9JA 4TV7A 5LEKA 2PYLA 3KFWX 3PFYA 4B9LA 3V8JA 5C2FA 3H3VK 1U6GA 3L00A 1EH6A 4MTEA 1NKCA 2HQNA 1YW9A 4A2AA 2YV0X 4FETA 3Q9VA 2CYYA 4DSJA 1FXXA 2NRZA 5L3DA 4U0WA 2K86A 3UNGC 5FPDA 2WAEA 1S9GA 2EX3A 1P4XA 2WB1N 3O6BB 3CQZJ 2WA0A 4CCMA 3QEWA 2FQ4A 2V7FA 1HKQA 5D4SA 2NZTA 1Q7YO 1NG6A 4HBLA 1W0TA 1WKMA 1BA5A 4ILJA 1WFXA 3A8YA 5KRTA 1F1ZA 4M9XA 5B1BH 3GTOJ 2P9PA 1MH3A 1P4AA 1RTHA 1GLBG 2M8EA 2GWJA 4I0BA 3THWB 2WFBA 3VEYA 1ZBFA 1S29A 3FHNA 1RTIA 3LSGA 1RIOH 2L3DA 3A02A 3LSMA 1S1VA 4IXAA 3P4IA 1P2FA 3JSOA 4NCAA 1IV6A 1S3JA 2E5NA 2XF5A 4J01A 3BG9A 1OR7A 3JRBA 3ZQCA 1Y1WJ 2R5YA 1RUNA 3TPQA 1H9GA 4KPYA 2PMZN 3CPEA 4FJ7A 2AXTC 2O8BB 1R5GA 2HQRA 4JBAA 2AP1A 3C7NB 3N05A 1A5VA 2ITMA 3IWZA 2JUGA 2G0EA 3OYNA 3AAPA 3CCVN 2BW3A 5CVRA 2RHKA 3NF9A 1NJZA 4GV9A 3ZQGA 1YRNB 1K78A 2OYQA 2JRTA 3I59B 1IKXA 5J2PA 1SL1A 1UG0A 2DQRA 3FKIJ 2PX9A 4NUBA 3LSIA 3NQOA 1FOKA 3R6MA 2EA4A 2BVLA 1X3ZB 4QPQA 3K2ZA 2XROA 3VMFB 2E6LA 3GFLA 2GBYA 3C18A 4IEIA 2TDXA 2FQ3A 2OU2A 2V26A 3BR1A 4PJMA 5GAHJ 3M3ZA 1OQYA 2X51A 1KVBA 4KNYA 1YI2N 2KHOA 2LK2A 2ECBA 3Q7CA 1Y0NA 3ZQLA 1LE8A 1KLNA 3IG1A 4HSRA 1VQ7I 4JV5K 3R0JA 3TL4X 1T98A 3J80K 3WQTA 4ENKA 1SVLA 1SAXA 5C4XJ 1BCOA 4FWPA 5BPIA 4X62K 2OBPA 3BTCA 2DU9A 2L2OA 2NVYJ 2Y0SA 1PJRA 4XLFA 2XAGA 4IQJA 4HNUA 2H1KA 4LY7A 3BP8A 2QGUA 2ETHA 3PJRA 1XTAA 3PQJA 5FB2A 1JCFA 3EKUA 4FWSA 3EDPA 3H92A 4PY5A 1IRGA 3MWMA 4X1EA 1I50J 3E5XA 2NS8A 4RG8A 4HTUA 2EK5A 1IRXA 4P9FA 4WXCA 3B6PA 3HBTA 1XNRK 5HRNA 4FLWA 4CJ7A 3LSPA 4BAYA 3E6BA 2P0WA 4A3CJ 2IJLA 4E1NA 5F08A 5DUIA 5BN9A 2HYJA 1B59A 2KJBA 1FIPA 2CSOA 1P4WA 3ZMDA 3R60A 1GT0C 2GXBA 4M3UA 3Q3SA 1ZH5A 1LNWA 3G10A 3LALA 3O8HA 1NGJA 1NGAA 4ESJA 3RMBA 5IPAA 1GUUA 3T69A 1RETA 4CD3A 2KKZA 2JLEA 2EB7A 3CMAI 4LG3A 1ZHFA 4GKJK 1UMQA 1UZCA 2IP2A 4CF9A 5T7BA 2OTJN 4AF1A 3VQQA 4ANJA 1T6CA 4LF8K 4H8KA 4BHCA 2L4AA 3B6CA 2A5XA 3QYFA 2X74A 4W97A 1KLMA 1S1TA 2PBIA 2YCHA 1S9HA 3U9GA 2V4JC 1XSDA 2WB1A 2KRFA 2QZ8A 3S9HA 1HJRA 3L3UA 3S41A 4KN7X 2DA3A 2HQAA 1R22A 3KP5A 5J1UA 1DGWY 2VT2A 2L9NA 3WTWC 3M3YJ 1VSIA 3ATVA 2Y69H 3V9UA 4FJXA 1RPWA 5AIPA 4A0YA 5M5XJ 2ZJPF 5EVZA 2ZJRF 2LH9A 2E2JJ 3GWZA 4DTNA 1NOYA 2E5ZA 2GLOA 4AVPA 1RNLA 3ATUA 3GE1A 3U9ZA 5J2QA 3EPZA 2KZVA 3LFUA 3TO7A 1U6ZA 4G12A 2JVGA 1MMSA 3WG7H 4WK8F 2ESNA 3L1PA 4FE7A 2XAJA 4BH9A 2F4OB 5KGXA 2Y75A 3DRPA 2HHQA 4BE0A 3U1KA 3A0BC 5M3FJ 3WGIA 3ZR8X 1VQKN 2O61A 2KIQA 1T0FA 2LKXA 3BY6A 2DFFA 2NUBA 3MEGA 2WV0A 4IRHA 4UUTA 4LFAK 3GEZA 2VGMA 4II3A 3RYRA 2CV1A 2UZKA 1SAZA 1IV0A 3FGUA 3JCUC 1JJ8C 1QE1A 2P9PB 3H45C 5AQTA 2R7XA 2ZGYA 4M3ZA 1FTZA 1W7PA 1BHLA 4DSEA 3KK2A 1AKHA 3GUDA 4DWIA 4DQIA 4HWIA 1I3QJ 2FMLA 1DP7P 1OKRA 3J7ZI 4BROA 1O7FA 3HI0A 1OR7C 2RN7A 4B3SK 4AU7A 3WHCA 2VKHA 3F23A 2H8RA 4CJWA 5A2QK 4L0ZB 1P9QC 3AAQA 5DYMA 3O08A 3OYCA 1TKDA 2ZMEB 2YNIA 4RGRA 3F2KA 3A2KA 3VTIA 1MBGA 2EFPA 2ZBKA 4HDVA 3HOZJ 1O13A 1MBEA 2ETJA 1Z0XA 3AO4A 2HVRA 4XQFA 3EN9A 3F8NA 4HNTA 2K3FA 2W1OA 3RCOA 1WSUA 2FBVA 4K43A 2MA3A 1IH7A 3F6VA 2VUMJ 4F92B 1VHXA 4M3WA 3Q0VA 3TOAA 4Q5SF 1OCOH 2EFOA 3L8BA 4GNIA 3VN5A 4I02A 3ESWB 5ADXA 4XM3A 1VQ4I 4H4MA 4BR7A 3LA7A 3FXMA 3A5NC 2L01A 3T3FA 4HTLA 3QNNA 3PO4A 4L5EA 5FLVA 3ZT4A 4DSKA 5LL6Z 3RSEB 1TW3A 2CW7A 4W5RA 4HUFA 3QYEA 3THVA 4FVUA 1O3SA 3M8SA 4BBRJ 1KQ9A 1DU6A 4XKVA 4DTPA 3SPYA 4AILC 1BM9A 5HRRA 4LG0B 1X1DA 1BI1A 4JKHA 4HPQA 3L9FA 4PJJA 1O3TA 2EZHA 1O3RA 2HDDA 3T1BA 2IVOA 1Q82O 4O5VA 5AQWA 3KD5E 4J2AA 2E2QA 1W5CC 4DMNA 2LREA 2Y0MA 2XGCA 3CJRB 1TC3C 5B66C 1FK9A 2D0AA 1ZELA 4B1YB 3MAQA 2KTQA 3PIOL 2CQXA 3K4BA 1O1WA 1YXQA 5KNLA 3F21A 2PJRA 1QVGM 3HRSA 4HYEA 3PSFA 3L2CA 4RW7A 3KLOA 3N97A 3W6VA 3SMPA 2ISYA 2XB0X 5CQEA 4F3TA 4JKGB 3GTKJ 1NNEA 2FLOA 3LANA 2K4BA 3SDGA 2COMA 1C1CA 4OGEA 1WJEA 2FJ1A 4E7JA 4P5OA 3S1MJ 2F48A 2ZCWA 1ETWA 1FIAA 3IKTA 1GLFO 3LAKA 1U49A 3SQNA 1RT3A 3LSHA 1LCUA 4CBUA 1KYZA 4ZDLA 3OYHA 4EVIA 5JICA 2EIJH 2KZGA 3GF2A 3TEDA 3GTMJ 1XWLA 3UKUB 3GTJJ 4FOIA 2P5OA 1OJLA 3S2HJ 2UXNA 5JLXA 3IRXA 5SZTA 1PVEA 5AQJA 1WVRA 2J5PA 3DU6A 3AA3A 1YI2I 4XKWA 4W5QA 2Z1HA 3CJNA 2X9DA 3ENHA 1Z7LA 4Y33A 2YHBA 5AR0A 2DFIA 4C3HJ 2O4IA 5D8LB 2FA5A 3VOEA 3C7NA 5KPZA 3ZCMA 5J3LA 2K7LA 3SEQA 4PGGA 4YOYA 5FKKA 3HL2A 3LZIA 3W2WA 1CF7B 2FE3A 1JL2A 4BC4A 3VOVA 3JRFA 4WFBL 3MZYA 4XRFA 1VQLI 3W2VA 4JN4A 3TTCA 3MMVA 3V9WA 1ZBHA 4IVNA 2LSNA 4HCBA 2QBYA 2IA1A 1VQKI 5HRSA 2WC9A 2VKDA 2XY5A 5EZHA 2ZC2A 1VTNC 2YUSA 4KISA 2AQEA 5J47A 5GAHP 1ZR2A 1OCRH 3D1NI 3QOEA 5FO5A 4YORA 4IKFA 1JCEA 1J53A 5J1EA 2IGNA 3RJPA 5M1QA 2XAUA 1NJYA 2LRDA 4B9QA 3KIOA 1B6AA 4JK1X 2VL8A 3MCZA 2X6SA 3DRSA 2NOGA 1KVAA 1RFQA 1S22A 3Q5FA 4C2TA 1EXQA 2A42A 4WFAL 1RKTA 2ZM6K 3EZ5A 1O57A 4JKBA 3WU0A 4EQQA 3D2EA 5EZGA 3F3XA 2NXNB 3HUGB 4CHYA 4LFUA 4LIVA 3H3ZA 2Q2EB 4Y7NJ 4B9NA 2XY6A 3TOBA 1X3MA 1KU2A 2DOAA 2R5ZA 5KGWA 2OZSA 1TNTA 1RC9A 2EIKH 3LM2A 3H1CA 4BQNA 2RC4A 4AIJA 1DU0A 1ODDA 2E1CA 2NVQJ 3HSTB 4DTXA 2KT0A 1G8XA 1QPMA 3ZQQA 5BMZA 5BPDA 1J54A 4D7MA 4BHPA 5AFUH 1IN4A 1HQCA 4K2EA 1BR1A 5FJ8J 1BI4B 4C1NK 4BKXA 4BRQA 4CFCA 1ZYRF 4F2SA 4KHWA 4KA4A 4WX9A 1Y39A 1FSEA 1NM1A 1BOTO 3UR3C 3D7EO 2D0OA 4K8XA 1GLNA 1HKSA 2OJED 1E3PA 3MVPA 3B6AA 4H5RA 5F2RA 3G4SN 3SK3A 4IOCL 2DT7B 3BOQA 3BQZA 3ULQB 2QKLB 5H1SQ 2B4JA 1E3HA 3CMYA 3OOPA 1D5YA 1RT5A 3C2GA 3VB2A 4XICA 4FK4A 2M1BA 2DW4A 4Y1CA 2VKVA 2XPUA 4A2UA 1JCGA 5GP9A 3AVHA 4JKFA 5MLCQ 4B47A 3FM3A 2ZXIA 3RTVA 2ZGZA 1TNSA 2EWNA 3MECA 2F96A 1HXDA 1R4NB 1U2WA 3E97A 3BTIA 5C0YA 2V6CA 2E60A 2BANA 4CDGA 4FO0A 4O55A 1JGSA 2E6MA 1T0FC 3LZJA 1Z7UA 4CI6A 3TANA 1VSHA 2PZSA 3LWFA 5HDGA 4FZZA 4B3TK 1Z1DA 2A6AA 3S15J 1J09A 3FX3A 5EGOA 1IXSB 4JLHA 4B1XB 1XX5A 1HNVA 4FOEA 4QSHA 4XRSG 3HSRA 1WB9A 4PK4A 4MNUA 2KIMA 1J5EK 4N76A 5KPRA 4MFBA 2CWEA 2LVSA 3WEEA 1QQMA 4E1MA 2KPMA 3OOUA 3OY9A 3G1MA 3QODA 2BGCA 3O9RA 5GIOA 2Q0RA 4YOXA 4DV1K 2BZTA 3CF5L 3FFIA 3WNFA 4UY8O 3LAJA 3GDQA 3GTQJ 1Y97A 4RAGA 2BEOA 3E1YA 3A5OC 2A1SA 2M8GX 3MKWB 1QPIA 3K4LA 3HT3A 3DPUA 3AG4H 3GFMA 5LBQA 3OVNA 4ELTA 4CCOA 3K70C 4JEPA 1SD5A 1GLDG 2XRIA 3RSEA 2AXLA 3V1OA 1C0UA 5AZJA 1MMNA 3SMSA 4AIHA 3VENA 4CYCA 4OAZA 3HOUJ 4UVAA 1OCPA 2O8DB 4CVNE 1C0FA 3E3VA 5EOYA 5IT9Z 5F0HA 5LGTA 5L3GA 5JLFA 3SCXA 3HRTA 3OWTA 2HYGD 3FM5A 4RAYA 3V7CA 5KAFC 3KK1A 3WNGA 3R0AA 3QPSA 2BW3B 1IN7A 1U78A 4Q47A 1U45A 2QKMB 5C15A 3THXB 4Q0BA 2O9LA 1EA3A 2PJRB 5E84A 1UFMA 3LQRA 4ESFA 4NC7A 1WPKA 3DP7A 2CQKA 3KKSA 2HXIA 2QENA 3BR0A 3RTRA 1BG3A 2KW4A 1L3UA 5GPAA 4AYBA 4BGBA 2JWTA 2GELA 2Z1GA 2CQ7A 3E0JB 2LOOA 1XGOA 2XY8A 4H0XB 3CDHA 4DYRA 5J4VA 3F8MA 3VEPA 4XIDA 1U2VB 3BUZB 4WQ5A 4CEZA 2H09A 3NBPA 1JKQC 3RZOJ 2EZIA 4ZTJA 5KK1A 2X6NA 4K42A 4MQ3A 2DPDA 4R1HA 5EX5A 4MHGA 3R9PA 1OH6A 1VQPI 2HXOA 3B6OA 3A5MC 4D5FA 2QSHX 3ZMTA 4DR3K 1VQPN 1OH8A 4Z6YA 2DOEA 4N9HA 3AL0B 3KE2A 3O3FA 2DA2A 3KEOA 3M4OJ 2B63J 3I56N 2VPLA 2K3PA 2OANA 5CLSA 4A93J 3FXQA 1MBJA 2VPRA 1YT3A 1NK4A 1EF4A 1GLJO 1P7JA 4WXDA 1RDDA 3PL8A 1TQPA 2W4SA 5K7ZA 3HRGA 5AQHA 4LC9B 3CCLI 1CF7A 1SAUA 3KYDB 3CCQI 4NB4A 1X4PA 2XKOA 3CF5F 4CO8A 3IH4A 3M07A 5K14A 3TTFA 4MLEA 2ZNZA 1N77A 5AQYA 1DTTA 2TRTA 1XGNA 5EEAA 4HX4A 4CIGA 2BHZA 1ASVA 5CZ2A 4JKGA 3LWLA 2QWLA 2D5VA 3VFZA 5FD5A 2LKPA 1YAGA 3AV9A 4CZKA 4XH4A 2BDPA 5LMUK 1NK5A 3MN5A 1QSLA 1ETXA 1HR0K 1JKPC 2M3AA 4A3MJ 1E4GT 4FTHA 2QSGX 2NS7A 3HEFA 5J8CA 5EY4A 4OIRF 2JA2A 2VWBA 1G6NA 1VQ8N 1TZLA 4EMSA 4DSIA 1IXCA 4H4OA 1IUFA 4FWQA 3KD1E 3OSFA 2LG4A 2W24A 1TQIA 3K4MA 2QM1A 3H6EA 1CLQA 2IS2A 1VSLA 1IUYA 4ZYAA 2R7UA 2RAEA 3MEEA 3FXOA 4BVOA 3J7AP 5AONA 2QQBA 3Q0UA 3U4LA 3QEVA 1HUXA 2R7FA 1T95A 2HB5A 2IAJA 1YJWN 4D5CA 4QWQA 4NB5A 4DZJA 3OYMA 2EJRA 4KIFA 1VQ5I 1A6QA 4JI2K 1SFOJ 2GIZA 5C42A 2H94A 3FDYA 1ZRDA 1UOCA 2P9UA 3GFIA 1IKYA 1F21A 3TAFA 3EE8A 4LK1F 4ELVA 4OPAA 4OKKA 1HQEA 2O0YA 1QZZA 4DTJA 4C23A 4A57A 1Z67A 4B1RA 5D4RA 1GLEG 2HOAA 1RT7A 3T5XA 5IYBJ 3COAC 3JAMK 3DRRA 4FPBA 3WQUA 1X9SA 3V81A 2A41A 2E2OA 3RVCA 4DTUA 2E88A 3ZMUA 2ZO4A 2FU4A 4BY9C 2E4LA 2UXBK 1SQKA 1EP4A 4BG8A 3CC4I 3DLAA 3T19A 2WBNA 5JVHL 3L2UA 5K7HA 1FSHA 3B73A 4JS5A 3HB9A 2Y0SN 4LF7K 2RNGA 5M1PA 2ME0A 3SQ4A 2LNBA 2VBZA 2HKXA 3KZZA 2MC4A 3IC7A 3OYIA 2UWMA 5ILUA 3HYIA 3TAQA 2H27A 3SQ1A 3QPHA 2VQFK 2HPIA 1KU7A 3HOWJ 1XD7A 4DJAA 2E7WA 5JVGL 1OH7A 1QVUA 3OJUA 3AG1H 1KZHA 2X1DA 5H20A 4JKDA 4Y0WA 4JS4A 2HHTA 2XPWA 2B5JA 1Z21A 2ZMEA 2OUMA 4W1UA 2E1NA 2P6SA 4ISEA 2M0MA 3WU1B 4BDYA 4NC6A 1YTAA 4FWOA 4KTZA 4GY2B 3HGYA 4OIQF 2R7SA 4AH9A 1SL0A 4XSXF 3CCRN 4FJ5A 5FD6A 2P7VB 1USTA 1ZLKA 2CUZA 5M1NA 2VJJA 1FP1D 1TLHB 4XOTA 1SKSA 1O7LA 3AKZA 2O8CB 1E3OC 2EZLA 3ISNC 5C2DA 4DFMA 3VDXA 5J2MA 4H5WA 3L2VA 4LJZF 3Q7BA 4JX4A 1TL8A 1J5YA 4XORA 4RW4A 4JI4K 4YRVA 1QSYA 1JLQA 2HMIA 4E7LA 3HOYJ 3SI6A 1ITGA 5BREA 4BU2A 2DN0A 1H88C 3VSLA 1RT1A 1WJFA 2NRHA 4IFVA 4LF5K 2XSDC 3S3MA 3LDNA 4YOUA 2IA0A 2E19A 4YFKF 3MN2A 1PP8F 5GADJ 1OVYA 2A68F 5J1YA 2L02A 3WTYC 4A3EJ 4HNVA 1HYZA 4XONA 4CH7A 1Z77A 4DTOA 3HSCA 3W0LA 2YHWA 3ZSXA 4KB1A 2LF7A 2Z16A 1X1PA 1Y64A 2YS9A 2CUJA 4AVZA 3KJVA 1X1BA 1VK0A 4DQ8A 4DV0K 4DFJA 2RQPA 3FF5A 4MEYF 1OCZH 4OX9K 4PL7A 4RM3A 3DLRA 4KKOA 1FOXA 4IO9F 2VBYA 2ZJQL 4Z4IA 2E1MB 1Y8RB 5FFXA 3AY9A 1TAUA 5FLMJ 3G3ZA 2VI6A 1N25A 3IH3A 1LVKA 3LNQA 4C2UA 3QRFF 1X19A 4CUGA 3WE3A 1BISA 3S8PA 2P8TA 4BRIA 5HS8A 2Q97A 4YDUC 4Z2YA 2W48A 4M72A 5FRMA 5JS2A 4CJ4A 4M3FA 3JXUA 5TKYA 4KHSA 3HL8A 3CO7C 3I4NJ 1W7AA 2X6YA 3L2QA 3A1YA 2W57A 3GLXA 5F6FA 2XC7A 9ANTA 2IOCA 2XVCA 3FXJA 2ELHA 3S1NJ 1P8ZA 3SAHA 1SVOA 1HSJA 1CGPA 1T6DA 2VG6A 1L5UA 2UUCK 1GXPA 5DMRA 3CTAA 2DI3A 4DTRA 1SEUA 4H0PA 2H6BA 3OYFA 4BC3A 3M6GA 5AQPA 3RKYA 3WGGA 4IOCF 1S5JA 3L09A 3G6EN 4UUSB 1A36A 3ASOH 2XB5A 1RR8C 4ZYDA 3VQ7A 4B1VA 2UU9K 3LDPA 2EILH 2F8SA 2HI3A 1UAAA 1MNDA 3BR6A 1NU0A 2XUBA 2ASPA 3C95A 3H08A 2A1RA 3QMLA 4B48A 3TW6A 3TSPA 2K27A 5KQ8A 4O0IA 2PMZA 2XHKA 3VYUB 1BI0A 2XAQA 5J40A 1GHCA 3NGIA 4KICA 1N8RO 3LP3A 1M1KO 1ZKGA 2KRHA 3M1FA 2M34A 2JA7J 1JXBA 1DEJA 1POGA 3I58A 3GYHX 1BUPA 2QXLA 1GV2A 1DTQA 3GCMA 5HP1A 2D45A 4BQLA 2VQHA 5HDKA 4CHZA 1V4RA 2JSPA 4KFBA 2FRHA 4BEHB 2MSYA 2OTLI 3WXLA 2BY0A 4YG2F 2XO7A 3DQVC 3EUHC 3ZXSA 4UUSA 3I53A 3V9XA 3E66A 2P9NA 2A3ZA 3DAWA 5C12A 1D8KA 1LQ1A 3RR8A 1A6IA 5AQIA 3D2EB 1BW5A 4UNOA 1S7OA 2F2EA 4FE4A 1BN5A 4GYIA 1TKTA 2Q2EA 1ZBUA 2EV5A 3K4CA 1BI3A 3DXMB 3M8JA 4BRPA 1VQ4N 3BR2A 1N5YA 2BYVE 2PY5A 1S1WA 2LR8A 3AVGA 3M8RA 1NJXA 1SKWA 1WJBA 2AO9A 1QS4A 1YFHA 3DYAA 2EFNA 1TV6A 3WXMB 4B4CA 2F9WA 4DV7K 3PUBA 1EH7A 4H4KC 5K1YA 1YLFA 1T33A 2DTRA 1XC5A 4AHCA 2R7RA 2L54A 2MD5A 2DAOA 3Q0WA 3K7AJ 2Z5UA 4I7HA 5CYVA 3ZQ7A 3PIOF 1PP7U 3HOXJ 2O8KA 1ON1A 4JNEA 4CXFA 3FZFA 5AQUA 5KQDA 1VSMA 3E6CC 4JD2B 4K41A 4A3JJ 3SUPA 4OPHA 1J7KA 2OZ6A 4JKEA 2JA5J 5EU7A 1ATSA 1JLFA 1LJ9A 2HZDA 3P7NA 4B09A 4DGWB 4BC2A 1X1AA 4LLNA 4B1ZA 4ZHRA 3FZVA 2M9HA 1SS6A 2DTZA 2XIGA 2JGUA 2N8GA 3VQBA 2QEXN 1DQUA 2VQLA 3A01B 4JHDA 2I7PA 3REOA 1TT5B 2CFOA 4HVJA 4BJTA 4IOAF 2GX9A 4ASNA 2M7BA 1ZRCA 4BRMA 3IKVA 3OS0A 1NLVA 4PGHA 1TK0A 1YQAA 1RKWA 3WGHA 1RDBA 4FWLA 4AM7A 2PFBA 1WSJA 3CJBA 4XEIA 2VBWA 2STTA 4HLXA 4OU0A 4XLNF 4HQEA 4FHTA 3CCYA 4XL9A 4Z0UA 2D0CA 4FCYA 4PJNA 3HDDA 1U5TB 4BS9A 3RKQA 1G4DA 3JTGA 2D1KA 5FRNA 4CEQA 1L0OC 3KYLA 2B0LA 1DKGD 1VQLN 2JT1A 4JHDB 3B8AX 3ENOA 2V9KA 1CXQA 4QAGA 3I71A 2KKOA 2NVUB 2ACJA 4WE1A 3S3NA 4YNQA 4OPKA 4R79A 2XGDA 2F5CA 1NTCA 2ZB9A 3CZ6A 4GFBA 2P6TA 2BH1A 3AVAA 4NHJA 1B1BA 4IX7A 1C6VA 4ID1A 3BR3A 1WSFA 2DLLA 2D5RA 3CLOA 4BGAA 2EINH 3ECOA 1FZPB 3LOCA 2QSFX 3MZ8A 3QBWA 3PFIA 2NVXJ 3KLFA 1R1UA 3QFUA 1OYYA 2WY7Q 4DV3K 5HODA 1Y6IA 2EZKA 2LLKA 1C1BA 5AQOA 3GVAA 4MFEA 2OZMA 4A59A 4DYCA 1HLVA 5L3CA 3UKUA 4BRKA 1QNTA 4A5NA 2HHHK 2F5VA 4M71A 2QQAA 2KFDA 3H9GA 2M87A 2QTDA 1B8IB 2CG4A 3CCJN 5DCFA 4R8HA 3BF3A 3JSMA 3WEEB 4DQQA 2UUZA 4RM2A 5KI6A 3CC2N 3EQLF 4G1QA 1R59O 2Y30A 3C7JA 1MU2A 3EZWA 3LA2A 4KYWA 3TAMA 4CFDA 3NCIA 4DV6K 4P96A 4DG1A 4C8NA 4QOZB 4RA2A 3RIRA 2MC3A 2HOSA 4I76A 5LGNA 4RTFD 2XRNA 4JKCA 3BJAA 1YJWI 2VE8A 2DCEA 4XLEA 4KBOA 2V51B 4DF8A 1TKXA 2UXDK 2HTJA 3KP6A 3DCFA 1A31A 2DMPA 4P55A 1A35A 3VF2A 2F5DA 4DTMA 2V79A 3FKJA 4L9NA 2R5ZB 4G9YA 2E8AA 4BR0A 5HLFA 4KRFA 1ZARA 2MGQA 3KZYA 1VF9A 2ECCA 1VSEA 4DV2K 3L2RA 4GRIA 3KP3A 4D0PA 1NG9A 2DT5A 3IUOA 3K9KA 3NF7A 4LOCA 3AGRA 3BT9A 2RV8A 2LYCA 2BY2A 3GZNB 3R1XA 5F0FA 4CCNA 5GPCA 3T1AA 4CCJA 1X9WA 4JYAK 1U0JA 3D5RC 3DLGA 1I6XA 5JMVA 4RAZA 5JHFA 5K5QA 3QDKA 4KN4X 4IHTA 1WSGA 3HZJA 2G8IA 1FYMA 2ZWHA 3DI6A 3J7AO 1WUAA 3ID6A 2VGNA 3J8AA 5BPLA 3C6AA 4IDKA 3FZHA 3DMJA 1YW7A 1K9MO 2MG4A 3H3UA 4G7ZF 3M8QA 2ITGA 4XLAA 4F55A 3TARA 1L3VA 3VQ5A 3ZP5A 1X3WB 1ZN2A 3F72A 1RBUA 3TWHA 2HVIA 2EIMH 4M3GA 4CK1A 2QYOA 2I8DA 3ECHA 1Z6TA 4BQQA 1Q8IA 3LDQA 3FK7A 3HC7A 3MCPA 3EUAA 3VYTB 4JP0A 4LIUA 5TRDA 2ZJ2A 1H8AC 2DXIA 3CP8A 4BBSJ 2VIXA 4S04A 4K25A 4FLZA 3ZSRA 2DA1A 3BGRA 2O5RA 3GBTA 2DMUA 4I09A 4AHTA 4CZHA 2HDWA 3D45A 2GOXB 1KYWA 4BHBA 2HVQA 3JRIA 4JD2A 2P5LC 1MJAA 3C3WA 1Z25A 4OGCA 3PIPF 1WOQA 2VG7A 2XGEA 2QKBA 1UJ8A 3P5JA 3GBGA 4AYBN 3J7AY 3HPGA 3FXUA 1IV8A 4GYGA 3CQXA 1ETOA 3MXJA 2XRLA 2IGKA 3DBHB 2HF4A 4RWTA 5ERIA 5E3MA 4FWMA 4RW8A 1IDYA 3SFIA 3L3VA 1TWCJ 4ID5A 4J2BA 2KDOA 1GLAG 2IC3A 3TTDA 1NGEA 2FBXA 1D9DA 4L9VA 4YDUA 4CERA 1I6HJ 4Y17A 3CMMA 3MCAB 2BUPA 3ASNH 1WH7A 1VI0A 5FKOA 4V2GA 1HPZA 1U47A 4FJKA 4WQ4A 2MBFA 5HLGA 1QBJA 3NGYA 4A2BA 1G3SA 2E71A 4DS5A 3N4MA 2HTSA 1RT4A 3P39A 3ONQA 2L0KA 1TL1A 4BEHA 2VYPA 5HLIA 2YHYA 5GAEJ 4UQGA 3O9UA 3QQAA 2EPFA 3S1RJ 1TGOA 1X9MA 3DPTA 2FSJA 1GOAA 1D0YA 2O7OA 4HG2A 4BJ6C 2IGIA 3ZRGA 4H0OA 1YE9A 4CHOA 4CZGA 1QVFM 4MO4A 2HVHA 1S5LC 4JI7K 1SKRA 4CJ3A 3ZX0A 5J6XA 4OJRA 3DLEA 5BRHA 1YTUA 4KREA 1BOBA 1QA6A 2X6OA 4TSXA 4BRAA 4CIFA 3CXCM 3MZHA 1JHFA 1WQ2A 3AFHA 2HF3A 3F6OA 3L6QA 3CJTB 3I55N 3MWTA 1SMYF 1JXEA 3HP9A 2FF3B 2CO5A 4A6DA 4CJQA 1J5OA 4IJAA 4MFDA 4XRMA 4HF1A 4BRGA 4YFXF 5D5VB 1U2VA 2KL4A 2XAFA 2ICWG 1MBHA 2HSTA 2CS3A 1RDUA 4A61A 2IS3A 1TWGJ 4BE2A 2X4HA 4BNCA 3SZPA 4QS9A 4O5FA 1VQNI 2DOFA 3R61A 2Y9YA 3CP2A 4JOMA 1NHAA 2MLKA 2JZYA 3DU5A 5DTDA 4CZZA 2R7WA 2IT0A 1U04A 1LEBA 2R7QA 1J59A 4FJHA 1KRPA 4NQWA 1VQ5N 2O8DA 3CUQB 3RMDA 1W5SA 4E70A 2KMUA 4EATA 4ZZLA 4ENJA 3K5OA 3AA2A 4CJUA 5BRDA 3AG3H 1T39A 1K7AA 2EFWA 3U3GA 4Y1DA 4HA8A 1TYQB 2Z1IA 4C1NI 3NWTA 1D4XA 3HRMA 1DDNA 3J7YP 3I5UA 2G7HA 2QWOA 4O6JA 1HQUA 3F9MA 1QRYA 1H0MA 1T8IA 5EEGA 4FISA 4XRSA 2IDOA 4FM2A 1MSEC 5K5OA 1ESVA 4L18B 1IRFA 1WJCA 2P1JA 3THYA 2XDVA 3WTXC 3PV8A 2VQGA 4DB3A 5BRFA 3BPVA 5ILVA 4UUVA 1XQSC 2I5UA 2CGJA 2OA8A 1MH4A 2K9QA 2LFBA 1P7IA 2FXAA 2JPCA 5C25A 1KTQA 3I33A 4JK8A 2GQQA 2OF7A 3W3CA 4OOIA 1Z26A 3KWIA 2GWRA 1VSKA 1W97L 1R00A 4ISGA 1JT0A 4CEEA 2W84A 2Y31A 4JQFA 4U88A 4LLLA 2O8EB 1IF1A 3A4CA 5CZ1A 2OCEA 2Y48A 3UE5A 2VOPA 1CZBA 5F0XA 1BIBA 3RRHA 1UHSA 3LSTA 1WAJA 1QTMA 4DKWA 1UHMA 3PNYA 1XCBA 4DQPA 5EG0B 3K4JA 4UV8A 1YHQI 3S1QJ 1YF5L 5L3FA 2PQ8A 4JX5A 1B72A 3DTIA 1SMTA 2ZQBA 4EAHD 1JE8A 3IKMA 4KB0A 2P9KA 4NC8A 4Y52J 4CESA 3BLYA 1NKEA 2JWKA 4JI3K 4FXDA 3DEUA 1SD6A 4J19A 3L7WA 3LAMA 3ZX2A 4DR4K 2P9UB 3NH0A 3HXMA 3O8MA 3E5UA 1REVA 2OAZA 3DKWA 3DPLC 4C30A 3EYIA 2GBZA 3QFPA 1IBMK 2RGVA 5JI6A 5I9EB 5DD8A 4BRLA 1U4BA 1T8EA 5FROA 3FZMA 1QO0D 1LFPA 3A5LC 1D5AA 2DFEA 1J2XA 2FD5A 4EJUA 1V5GA 3IAS2 1WI3A 5DV5A 5B5EC 1SFXA 3ID8A 1IXRC 2OTLN 5JVGF 5HLHA 3H3OB 3O1BA 3FXKA 4GVEA 1SL2A 1K8KB 3C2HA 4DNCA 4M7XA 1ZYQA 1AWCA 1JHHA 1Q1HA 3DFGA 2QEXI 1FYLA 1EWRA 2Y9ZA 2P9SB 3MDQA 1MGTA 1JUSA 5ICFA 1XC9A 4HV6A 4BGDA 2V7YA 4JKAA 1MDUB 1K6OA 4IO9L 3OIOA 2QXFA 3KLGA 3BZCA 3CM6A 4GGGA 1W4MA 4ZTFA 5BN8A 4ZH4F 1ZXOA 5DM7F 1HLUA 5KPTA 2VB6A 5H6RA 2W41A 2LDUA 3LDSA 2Q3SA 3S2DJ 3HKZA 2OD5A 3FFKB 1HNXK 3ERMA 2BXZA 2R7OA 5F27A 2OZUA 5L3EA 1A5JA 1LWFA 2A6HF 2LY2A 3LL3A 4YOTA 1XCVA 2MD0A 2MH9A 1HA8A 3VEZA 4J2EA 1SFEA 1F5TA 3SNNA 1TBXA 2WAFA 4HAMA 5AQVA 2QF7A 5IP6A 2FSKA 2XF7A 2E2PA 1NK8A 4CGFA 3SJMA 4CFAA 4LH5A 3D2FA 3QP6A 1RBTA 4X66K 4DYQA 1HX1A 4B08A 5AQQA 3MKZA 4CGJA 4AWXB 3W3DA 3ZT0A 2IW5A 4Q4ZF 2YNHA 2QBYB 2E34A 2LD5A 1RR7A 1MA9B 5HS7A 4BWJA 2X6WA 2L9RA 2MLGA 3OYAA 5BR8K 2PBDA 2HNHA 2O6GE 1FP2A 3PNVA 1DPRA 1UB9A 4MLOA 4Y4RA 5FLXZ 3K57A 1KFSA 2V1NA 2K40A 4H5TA 2ZJQF 3TSQA 2A5WA 2KIFA 1YJNN 4E7ZA 3NAUA 1NKBA 2R3SA 5J8FA 4RDUA 4CF1A 5HOOA 2L9SA 3SFZA 1PYVA 1OCCH 2BE5F 5EXWA 4ZZDA 1I39A 3K4NA 4CJEA 3SYTA 2CUFA 2EQRA 3JYTA 1W7PD 5E41A 4N41A 1VNDA 2VQCA 4PUOA 3P9IA 2OC6A 4KHQA 4E4HA 5CR4A 4CEDA 5AZIA 1YIJI 1ETYA 1B9NA 4F91B 3CCEI 4CF2A 1MBKA 2WTEA 4XLHA 1GV5A 2FC0A 4O4GA 3OYDA 4PA1A 1RI7A 1OPCA 4OIPF 1EV7A 2FMYA 2G8VA 3FBIB 3H9QA 3HOVJ 3VODA 1W36D 1UCRA 2FXUA 5LEJA 1BIUA 1R7JA 5E1XA 4F52A 5E26A 5L3BA 2WOMA 4CBXA 3M1CA 4L5JA 4DW6A 3KKRA 1ZR4A 2C6YA 2R93J 2M5WA 1KC8O 1RTDA 5JVTA 4S0HB 4M3XA 4EM2A 2VCPA 3ZSZA 2QW9A 5M1KA 4B9MA 3G71N 2W82A 4LITA 4Y13A 1VQOI 2GUPA 2DYSH 3SYZA 1QQIA 4ESBA 3C1DA 3SZGA 5E18F 1RDCA 1WJDA 1XDSA 3VQ4A 3KK3A 4E3SA 2JQ7A 4FLTA 2DMQA 2NRTA 4XN0A 3QICA 3LAPA 3S3OA 4U7BA 3SBTA 3RMCA 2FSNA 2W42A 5F64A 1V3FA 4IL6C 1LOTB 1VSDA 2YJFA 2OA4A 2V1UA 1T08B 4IG3A 2P5KA 3WTUC 1OVQA 3E1SA 4FX4A 3GX4X 1U9OA 4GXOA 2YKNA 3U3YA 4LFCK 4ZYGA 1ETKA 2Q8KA 3LSRA 2HNYA 3U6FA 4M73A 4F93B 2W85A 4MLHA 1NWKA 2VE9A 3T1HK 3RKWA 5HLTA 3ZGKA 1ORKA 1X1CA 2D1VA 4L9JA 4PSWA 4M6XA 2Q0OA 2P9KB 3CYMA 2O3FA 3E6DA 4GDFA 2M45A 5GTHC 3BY5A 4M3DA 3OS1A 5JLHA 4ON0A 4I0AA 3Q9SA 4AC0A 1R49A 3CC4N 2QUFA 4Y3OA 3VQAA 5AJ3K 3MKYB 4IXCA 2A3SA 2HGCA 3OR2C 1VQ6I 2CH5A 4CK2A 4UV9A 4BQOA 4XLPF 1RGIA 1YX5A 4E19A 3TMOA 3K1NA 1MNMC 1MBFA 4BXUA 2JN6A 1XHXA 1U5TC 2PAVA 3H9JA 3H0DA 2P9NB 1ATRA 3FR0A 3QIPA 4WQ5C 4EJTA 3ULDA 3LSKA 2AA4A 4PZJA 3GOIA 1GVDA 6PAXA 1QVTA 1IG9A 3J7ZO 1Z3YA 3D5LA 3H35A 3K2AA 3I4PA 3E9PA 4PKGA 2W7NA 2QWWA 3AVBA 4HLYA 1R0AA 3CCUN 1X3NA 3UKRA 3QEPA 2COBA 1HKTA 1VQON 1E0EA 4M9ZA 3LMMA 1TKZA 2JMWA 2CGKA 2MABA 1XMXA 2CUEA 1HBXG 1I94K 4I9QA 3V4GA 3ZPLA 2O8XA 2RN2A 3CJCA 3RDIA 1ZQ3P 4I6MB 4DIQA 2QLZA 3J80Z 4ELUA 2V1DA 4PQUA 3SPZA 3BTJA 2HZTA 3BTLA 1WRJA 5E17F 2FBKA 4OMZA 4BQZA 4EHUA 5DCMB 1HNZK 4Z4EA 4G9ZA 3VWBA 2L5QA 2YU3A 4CJVA 3D0PA 1WI9A 1XGSA 2IGMA 4KHUA 2Q36A 4HSTA 1MJBA 3ROUA 1PUFA 1KU3A 1E4FT 5E20A 4DQRA 2XPVA 3TGNA 2VLAA 3M5RA 4FWRA 3VSKA 1Q9XA 1IKVA 1WLJA 1S9EA 2JTVA 4QPOA 4BDZA 1JT6A 5DS9A 1KFDA 3OV8A 1ZGJA 2GZWA 4B44A 1O4XA 2KP6A 4CF8A 3QETA 1NK6A 2HPMA 2DTUA 4DOZA 3JR9A 2FEZA 1E3MA 1YJNI 4CJFA 4XH5A 4N0BA 4WYBA 5E8IA 2F7TA 3OYLA 3AVIA 1KA8A 2NNWA 4JI6K 5KTQA 3OYEA 3KEYA 2Z3YA 3J7YJ 4CHUA 2QQ9A 3KLEA 2V6EA 1N36K 1OFCX 2F4VK 4V19K 3P9CA 1FBSA 1PUEE 3MX2A 5ICEA 1FW6A 1S1XA 2HEOA 1T05A 3CJ7A 1JKRC 2VJIA 2GA2A 4Q48A 5C24A 4EP4A 1XHZA 5LGUA 4LSNA 4BQAA 4RB1A 2F8TA 2IS1A 2A61A 2LY9A 4XKCA 3TP0A 3IL2A 3B02A 1FMWA 4CCKA 1QZ6A 3F73A 2CGLA 3CC7N 2BGGA 4RW6A 4E7IA 3IUCA 4X0GA 5M5YJ 3G73A 4ICLA 1I1GA 3SBGA 1WGXA 2RVCA 3FWEA 1YHQN 3S14J 4JI5K 3ALYA 3DLBA 1VSFA 1RZ4A 4G8XA 3IRQA 3I9V2 4MTDA 2M0CA 1W0UA 3ASMA 4J8FA 4G6QA 3MN7A 3RWUA 4E7KA 4IFEA 4I2OA 4DBQA 3RPUD 1NGDA 4G7HF 3VEWA 3OJSA 2MYSA 3HRUA 5CY4A 4QLCU 1TWAJ 4KHPK 4RW9A 5E79C 1G15A 2D1HA 4ZDOA 1EETA 2YU9J 2NRXA 5ADXH 4B3XA 2E35A 4EJOA 1LAVA 1SUQA 2O03A 1KXPA 5LJWA 2HHSA 4DTSA 1LDDA 4K0KK 3I54A 1BGXT 3S16J 2YNFA 1C0TA 2IPQX 2HYFA 1IG8A 4JYKA 4F2RA 2KZMA 2DA7A 3TO6A 1B8IA 4N4OB 1FJGK 2BHYA 1V4TA 1JUMA 3K2PA 2O8FA 1MMDA 1N33K 1YVNA 1L3LA 3ZETA 1XNQK 5EDNA 3QPLA 4EM0B 4HV5A 4WF2A 4NCGA 3EL2A 3CJAA 2P51A 1BO5O 4KHYA 2DDAA 4FLXA 2ZJRL 3LSJA 1NJWA 3PX4A 3TW7A 4PDKA 1EO1A 2FSWA 3ELKA 2QWRA 3NARA 1AHDP 2P9IA 1XPXA 4DZPA 3ZEUB 2FBHA 2XGXA 1W5TA 1DUXC 1VQMN 4KTQA 2ELKA 4PWDA 2XKPA 3KP2A 4ENMA 2QI2A 4A3KJ 4QS8A 2Y1IA 3DLKA 5C4JJ 1U8RA 1YW8A 4M6VA 3CHWA 1L3TA 3O3KA 1ENHA 5GAGP 1LEAA 2HHXA 2VQEK 3RQIA 2PJPA 2YI1A 4BUPA 1LPQA 2GOMA 3TKYA 4CYCB 4D1QA 1FJLA 1B9FA 3AGKA 4B1WB 2AJQA 5DM6F 3HHGA 3LPTA 4A3FJ 4ZC3A 2J4RA 3CD6I 2ASMA 3FZLA 2OV7A 4CE9A 1OYWA 4HX8A 2JA6J 2PYJA 3GMEA 3SUOA 2Z9OA 1OLTA 2MH2A 3HIFA 3CM5A 1REPC 4C3IJ 3A03A 1M90O 4C8KA 4L9TA 4A3IJ 4CEAA 1MDMB 2HNZA 2OTJI 1B4AA 3D6RA 4ABZA 4A12A 4LFBK 3CDIA 1HW5A 4X65K 4W5TA 2HU9A 2GXAA 3L4QA 1NGGA 4KH6A 3K0SA 5H6QA 3W6KB 2EHGA 1RNHA 3QEIA 2ZFUA 4KIGA 2BTFA 4B43A 2JK3A 2WV1A 2ZFWA 3GLLA 4WXHA 3T8RA 2HOTA 3GTLJ 1TL3A 3FLCO 4XLCA 5TJJA 4M3TA 3DOLA 2W6LA 1U8BA 3P9KA 1T03A 4CGZA 2X85A 2Z99A 3FZKA 3VQCA 2AHQA 1HJOA 2WTUA 3NMUA 1NGIA 4OIOF 1BC8C 2IVMA 2D2WA 2A6TA 1C1AA 3CQYA 1FYKA 2R7YA 2M7AA 2R0QC 1K83J 2PMUA 4L5IA 4RB3C 1JKHA 3K58A 4JRPA 3VA3A 5AQMA 4FYDA 1KD1O 1A5XA 3HM8A 1R5ID 3ZCOA 2XASA 3PO2J 1HKBA 2DT6A 1VSJA 3ZT3A 1D1AA 2XSJC 4FQGA 1QZ5A 3TDUC 1ZTRA 3OL3A 3J80O 4DR2K 2QK9A 3BPXA 3IRRA 3CUQC 1JLGA 4KMUX 2L7FP 1K61A 3DLLF 2YX4A 1SC7A 4I2PA 4CBWA 1TQMA 5ED4A 2KIUA 4ILGB 3JTHA 3JS6A 3ZT1A 1NK2P 4A5BA 1Z9CA 2QA4I 3MN6A 3MXMA 5B3SH 2WBMA 3EUHA 3WTSC 4L0YB 4O0JA 1Y1VJ 4PKHA 5LMNK 3CFOA 2R7ZJ 1HYVA 3TBIA 4E7SA 3LDOA 2UUBK 1DPUA 2QCOA 2GXGA 2RQQA 2A69F 2VJ5A 3NF8A 1ZG1A 4FW1A 3QPTA 4GVMA 4IRIA 4PHTX 1PUFB 3WXIA 2NNYA 4XSZF 1VQMI 2YKMA 3C65A 2KQRA 4CJPA 4FJ8A 3HM5A 1XG1A 1ZLJA 2BV6A 2L7MP 4M9SA 1RCHA 1Z05A 3RZDJ 2KJCA 4CGDA 2YX7A 1BWFO 4RCHA 3WXJA 4DQSA 3TI0A 2HHWA 3TR8A 3BDDA 3HUGA 3OSGA 2B9SA 1KAYA 3HPOA 1I27A 5SWMA 1ILYA 3I64A 3M8FA 2LBFB 4M42A 2UV1A 2P7CB 5HRPA 1VQ9I 1QQNA 3HJFA 3KYCB 4G6TB 4DFPA 2HW3A 4YOWA 4FJLA 4OLBA 3M9AA 2F5EA 4WWCA 3LWMA 1DT9A 3J81K 4FWKA 5C44J 3ULEB 1NMDA 5D6FA 1HRHA 4C2MJ 1KAZA 2RDPA 2EWSA 3D2FB 4LGWA 3FISA 2QWQA 1Q81O 3MN9A 2WADA 1EKEA 4A0XA 5D5UB 3CMEI 2EBIA 3QAHA 1YJ9N 1UA1A 1B72B 3V6DA 3P38A 1W2BM 3F8CA 3LDLA 1QQCA 4NQWB 4W5OA 1G99A 1ZBSA 3KTQA 3QESA 3K5LA 4LH4A 2ISZA 1JLCA 5C3EJ 3VQ6A 4M41A 5AQZA 3CPWM 1YX3A 3HKZN 1JLBA 1IZ1A 1KU9A 1NH3A 1HDPA 2KISA 1T2KA 1SV5A 2K5CA 2H3GX 3IMXA 3R4KA 4XIUA 5AIQA 5E3LA 5ILSA 3DV8A 2ZXWH 3ZQHA 2QWPA 2E36A 4KIBA 5JHUA 4C8LA 4JRQA 4GV3A 5HS9A 2QM3A 3F9KA 3DXKA 1W36C 3QWLA 2ID6A 4DR5K 2KDZA 2VONA 1UHWA 3PIPL 2I10A 5FFZA 4DF4A 2NYXA 2JVHA 4RLFA 3OYBA 3DLHA 3O1WA 2EV6A 4A3GJ 3MXIA 1FNNA 5DDGA 3OYKA 1MMGA 1BBYA 1NMNA 3HBLA 5DM7L 2DO7A 5CJ9A 4BR2A 1BC7C 2DPNA 1T38A 3WUHA 4N9IA 4DR7K 3DWLA 2GWKA 1N34K 4IPAA 1XN7A 4E0DA 2VKEA 4PFPA 3AO2A 4B3AA 5BS6A 1QHGA 4U0YA 4J2DA 2K9SA 1LAWA 2XY7A 5GIPA 3NVKA 3BC8A 5CKTA 3JREA 4X6AJ 1HPMA 1IO2A 3C6HA 4CFBA 4O8KA 3WTVC 2Q2RA 3TAPA 4BYYA 2ZXHA 3SXYA 4LMYA 2HMPA 3ZYYX 1G3TA 3F0CA 3ABMH 1DP3A 4Z4FA 4F7ZA 4OMYA 4AD9A 3HYFA 1VQ6N 4E7HA 3IS9A 4IDHA 3BG7A 4H0TB 4F8RA 4FLVA 1MNEA 2CFXA 2K4JA 3ZQFA 5FKNA 3SHFA 4EJVA 4EM1A 1RTJA 4V19S 1MWKA 2FOWA 3BZ6A 3NRVA 3O3GA 1NK7A 4BRHA 4BR5A 5CHIA 5IT9K 2CV2A 1P92A 1BCMA 2ZSIB 3CCUI 3SLCA 3O2PE 1MKMA 1GOCA 3CUQA 5K7FA 2E1OA 3MD2A 1HF0A 4KMFA 4M63C 3HHHA 4PL8A 4DR1K 1SANA 3ISPA 4W5NA 5HDNA 4DU4A 4HCCA 2XV4S 1EH8A 2PFUA 4H03B 3K9TA 4UXNA 2FBIA 2V1XA 1IAWA 3O4QA 5AQFA 4YY3K 3OW2M 1EWQA 2AS5F 4FL9A 4WCEL 2P9IB 4IRGA 3V1RA 5BPMA 1BL3A 1NJIO 1X9JA 1NOZA 3MWPA 1WBDA 2E1MC