3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
1EH7A 2K86A 5BR9A 5DCFA 3MK6A 4EJVA 1GLJO 4EGZA 1O7FA 3MFKA 3E5UA 4ENNA 1ZG5A 1H0MA 1GLFO 3UKUB 3ZMUA 2Q2EA 2QLZA 1K8KB 3MQ0A 1EH6A 3VESA 4M71A 3VEPA 3CO7C 5DD8A 4LMYA 4YG2F 3HUGA 4EGYA 1LB2A 3J8AA 4MQ9F 2OBPA 3WODF 1G99A 1JXSA 4I02A 1K78A 1D5VA 4IF4A 5AQKA 2YSRA 2FQ3A 3AY9A 3RPQA 3L09A 4XLNF 2NAZA 3VF6A 2IVOA 3CUQA 1YTYA 4CICA 1BI3A 1T44A 3R61A 2DK8A 1TW2A 1W4MA 2H09A 3FXUA 3D2EB 1H1VA 5JI6A 1FX7A 3EQLF 3IFRA 4LG0A 5ICGA 1YS7A 1NMDA 4RS8A 3LDNA 5J8CA 3AARA 4OU0A 2GWJA 2V7YA 4A2UA 2DO7A 2GWRA 2AXLA 3CUQC 1IW7F 4LB5A 3GF2A 4E1JA 3EKSA 4PGHA 3LA7A 2AP1A 5AQQA 4U0VA 2YX7A 4UVAA 5D8KB 1MJBA 5ICCA 3GEZA 1KU9A 3QPHA 4MNUA 3FR0A 1LQ1A 1HSJA 3VERA 1QPMA 5AR0A 3KHYA 4M9XA 4IVNA 2P7VB 2P4WA 5L3BA 4EMSA 1H9GA 3HZ6A 3V8LA 4DQ2A 5IT9K 2YJFA 1T98A 2D2WA 3Q9SA 3F72A 2HQRA 3COAC 4NO7A 1E17A 3SMPA 3KEOA 2P9UB 4G8XA 1T0FA 3FF5A 2EFOA 1Z6RA 1NGEA 2DLLA 2EFPA 2L02A 2O0YA 4IHSA 4G7OF 1I1GA 2O3FA 3GBTA 3KP5A 2WTEA 5CLSA 2P9LA 3A5OC 1TUUA 1TYQB 4EHTA 5HS9A 4H5RA 2NNNA 3EKUA 1IXSB 5AQNA 4KFCA 3QP6A 2E20A 4XBFA 4M9SA 4F9OA 3JTGA 4A6EA 2BTFA 4FWSA 3WGHA 4G6DA 1SMTA 1LDDA 4R1HA 4MHGA 1K79A 4A5NA 1DDNA 2Z9OA 3KE2A 1IAWA 5FPMA 4PGGA 1YIOA 1XUPO 4UVBA 2QYOA 4HTLA 5LEKA 3K2ZA 4LB6B 4ZYGA 1R58A 1ESVA 4FOEA 1ATRA 3WG9A 4ZYDA 2EB7A 1GXQA 1CZAN 2J4RA 4CZFA 2BUPA 4H5NA 1O3SA 3WU1B 3RJPA 3H1VX 2A69F 2XVCA 1USSA 2L4MA 1P4XA 1MWKA 3SZPA 2DQRA 2X4HA 3T8RA 3VENA 1ZXOA 1B6AA 3H3NO 4PCQA 2PFBA 4GCVA 1ULYA 1KQ9A 2XROA 3HTUA 1U6GA 2E1NA 2IVMA 1YO5C 3RI4A 4LD5A 2VC0A 3C18A 2XKOA 4R8HA 3OHRA 2QBYB 2LSOA 3SMSA 3GLXA 1S7AA 2VWBA 2P9NA 5KK1A 3T0YA 3T5XA 4WWCA 4BQLA 3VB2A 5ICFA 3CJ7A 1ZBSA 3BDDA 3WTUC 3GFIA 3HBTA 4Q48A 2LF8A 1WSUA 2DQLA 3OOPA 4GY2B 4RGXA 5BN8A 2BBYA 3RDIA 5HLGA 2DBBA 3F8NA 4ISFA 4D0PA 3R6MA 3U2RA 1FP1D 4ON0A 3ULQB 5IT9Z 1FLIA 4WXHA 3J7AO 2EWSA 1BA1A 2WC2A 3M1EA 3LAJA 4CYDA 4G94A 1JCEA 3KETA 5LRSA 3CUQB 3KP3A 1IRFA 2PMUA 1GVJA 2HF3A 1SFUA 3WTYC 3JW4A 1BG3A 5FFXA 4BAYA 4LG0B 2MH9A 4BH9A 3GX4X 3ZX3A 1SD7A 2XAFA 4L9NA 4BREA 1KAXA 1Z05A 4KUMA 5AQSA 4RWTA 1U8RA 2PEXA 4JNEA 4XRFA 5DV5A 4BVPA 2Q0OA 1SMYF 5CVVA 4WF2A 3GWZA 1IF1A 3TO9A 3HOTA 1RI7A 4BRIA 1SD6A 4BR0A 2ZO4A 1RNLA 3QBWA 2W41A 2YCHA 2HQNA 2PI0A 4H0OA 5AQRA 1BI1A 3ZPLA 1BO5O 2FE3A 1HKCA 2D4WA 5AQFA 2TDXA 3FZHA 1D3YA 5LLQA 1TBXA 3IC7A 2YU3A 3K1MA 3N97A 3TO7A 4EJOA 5L3DA 2VT2A 5BQTA 2GZWA 4CZMA 2XAGA 1C0FA 1OYYA 2H6BA 2FMYA 2HEOA 3L6QA 3CO6C 2B0LA 2CGJA 3LM2A 1RDWX 4TV7A 3WU0A 5D8LB 3HYIA 3HSFA 3V8JA 4WK8F 4BRHA 1WWXA 3BEXA 4I09A 1LEBA 1ZG1A 4CBUA 3ENHA 1EQYA 3R0AA 3IRRA 3J80Z 4H03B 1V4SA 1D8JA 4O5VA 1TQMA 5L3FA 5KPRA 2EFWA 3WQUA 4L9JA 2YHXA 2KIUA 1HW2A 4WQ5A 3UKUA 1P2FA 2YI1A 1R00A 4WXCA 3WEEA 4LGWA 4M9ZA 1DKGD 4XLPF 4A12A 2V1DA 5H6RA 2ZXJA 4HW0A 4L5JA 3BJOA 4JHDB 3WXJA 4EAHD 1HKGA 3RYPA 5J6XA 5E84A 1WKMA 3I58A 1T38A 2COMA 3C7JA 3MN6A 4CZZA 2IVPA 3T8TA 3DXMA 5AQMA 4WQ5C 1NGJA 1NGIA 2EV5A 2CO5A 4H0PA 3HSRA 3WTSC 2L4AA 2WV0A 2HFHA 5E20A 3REOA 3GO5A 4XH4A 4WXDA 2RV8A 4OMYA 1RIOH 4A2BA 4U7DA 1XMAA 2XGXA 3S2WA 2QWPA 1ZRCA 1C0WA 4XH5A 3FMRA 4HWIA 3ERED 2V9VA 1CF7A 1S7OA 4AVPA 4IZ9A 3JSOA 3TO6A 2PJPA 4EVIA 3ZN0A 5LY3A 2ESNA 2FBIA 4ESFA 1B59A 3ROUA 1UCRA 2V51B 3FZKA 1ZAOA 4YFKF 4GXOA 3MN5A 4MLEA 4FSVA 4CZHA 3D0SA 4OIPF 2O6GE 1ATNA 2RGVA 4JBAA 1FZPB 4UV8A 2ISYA 4FWMA 4B8XA 4BRPA 3LDQA 4BGAA 5BN9A 1HQCA 2H6CA 4WYBA 3IWZA 2FRHA 3I53A 1ZYRF 4H0EA 4OOIA 1OKRA 3LA3A 2PQ8A 2P9UA 2MH2A 1J6ZA 3I5UA 3A5NC 3DEUA 3MMVA 5F2RA 2FMLA 1X9JA 2VE9A 1QBJA 4QS8A 1FSEA 5L3EA 2D1VA 2YR2A 3W6KB 2EFQA 2J5PA 5DDGA 2F5EA 4FWKA 1R5HA 2QWRA 1J5YA 2YJEA 2J5OA 2EV0A 4HA8A 2OD5A 2K4BA 3O3KA 1TLHB 3E5XA 4AIKA 4G9YA 5F6FA 4CZIA 1FOKA 5E1WA 1R59O 4CO8A 1P4AA 3J81K 1DGKN 1I6XA 3WTTC 5BPNA 1GLAG 3VODA 4MO4A 2M30A 3RIRA 1B1BA 2O03A 2UZKA 2FSKA 5FFZA 5DD4A 3K9TA 2EJRA 4GYGA 2A6HF 1STZA 4MLHA 1DP7P 2A61A 1WRJA 2GA2A 3SQNA 4EM1A 1KU7A 3QFPA 3HOSA 2KRFA 2OAZA 1RGIA 2VBYA 4CBWA 3HSEA 4K2EA 2IA0A 4IJNA 4WCGA 4YIIA 3BROA 3ZX0A 4UV9A 1OYIA 1MDUB 2F9WA 3FZLA 2YX4A 2QWLA 4EHUA 2P7CB 1J9IA 4DHYA 3ZMVA 1XDSA 4FWPA 2AA4A 3RSEA 4MEYF 5K5QA 2QENA 1D4XA 3ECOA 2O61A 2QWMA 3F8MA 3UB5A 2W24A 2JTVA 3WQTA 3LM9A 1G3WA 4B1UB 2QBYA 3IWFA 5AQGA 4ISEA 3L4IA 4DB3A 3FXRA 4P96A 2E2OA 2LF7A 4BRKA 2LKPA 3VGLA 1YW8A 1Z1DA 3BF1A 1KAZA 2DW4A 3VEVA 2JZYA 1RUOA 1YW7A 4HDVA 1Q1HA 2FXAA 1U5TC 3DXJF 1C0GA 4B1VA 1KU2A 3D5LA 3CQXA 3O2PE 4UNOA 3WEEB 4G7HF 2QQBA 2DPDA 2QVOA 4PL8A 1IRGA 4H5WA 4YFNF 3LDOA 1NWKA 4LFUA 2V7ZA 5AQWA 4A61A 1USTA 4JD2A 4DCHA 2A3SA 2JPCA 3HRMA 4BRMA 5HS8A 3BPVA 4CD3A 1IN6A 4AIHA 3RKXA 1HW1A 4FPBA 3RTRA 3P9CA 1NGAA 4CZEA 4BR2A 2XAQA 3DXMB 3L2CA 1NBWA 2P9PA 1TNSA 3VEXA 2JSCA 5JICA 3A5LC 3DFGA 1NGCA 1D8KA 2IA1A 4M73A 4Z94A 2V1UA 5DYMA 1S3JA 4RGSA 3GFMA 1FYLA 2QW9A 3KP4A 4H0TB 3L7WA 2HWVA 1NM1A 2CH6A 4P5OA 1HJOA 1S22A 1L0OC 4L0YB 3O6BB 2DAOA 4JN4A 5A2QK 2FBKA 4PKIA 4O8KA 2Y48A 2DPNA 5ERIA 1CF7B 3J81Z 4ENKA 2E2NA 3E6BA 1EH8A 2VBWA 3BY6A 3R8EA 1KYZA 2HMPA 2PBIA 1YS6A 3ELKA 4BVOA 4QS7A 1U6ZA 3EN9A 3SJHA 3EYIA 1W5SA 2EWNA 3I54A 5E18F 3W0LA 5D5XB 3ZMZA 1YAGA 4IO8A 3K1PA 2OA4A 3M7GA 1LNWA 4KNYA 3CQYA 1YQAA 2KIFA 2VOOA 5LGUA 1TQPA 2M8EA 3CJAA 3VETA 2ZF5O 4BXUA 5K1YA 3FWEA 3A8YA 2ZNZA 2W84A 1V3FA 2Y0MA 4J8FA 1SQKA 5HLHA 4A62A 1KYWA 1PP8F 4KT5C 3BZ6A 3MDQA 3M8FA 3ULEB 4MQVA 5JVTA 1GLEG 4L5IA 3FLCO 4HX4A 3VOVA 2FLOA 3GUDA 2K27A 2ELHA 2RKHA 1HSTA 4L9VA 1KU3A 3FFKB 2KHOA 3T1BA 1XSVA 4RCHA 3SZTA 1PP7U 3HTSB 4RB3C 2R7DA 1FYKA 4BRQA 4JAXA 4IXCA 3OV8A 2GEMA 4CZLA 3WGGA 1FBUA 1KA8A 4BNCA 1IUYA 3GW2A 4OIRF 2QUFA 5E26A 3E6DA 2YHYA 3QFUA 2OQGA 2A07F 5ILUA 5FO5A 5BPDA 1LVAA 2W57A 4I01A 1LOTB 4JHDA 2OZUA 4YDUC 5EY4A 1OKJA 1XSXA 1ODDA 3KEQA 2VYPA 2EA4A 1UHMA 1FPQA 3C1DA 2A68F 2HTSA 3QMLA 1P6RA 5F64A 1QQIA 2ZGYA 5AQOA 5AIQA 4A0XA 1BIAA 5D6FA 1ZH5A 5BREA 2CWEA 1T6DA 4IWVA 1L3LA 5BS6A 1UHWA 1JE8A 2HKXA 3AAPA 1QQOA 2PN6A 1B9MA 4XEIA 3KP2A 3D2FA 1HXDA 3RSEB 4MTDA 2FSNA 1NHAA 1LCUA 1U5TB 2VBXA 4NB5A 4B09A 2IW5A 4A0YA 1ATSA 2A41A 3BP8A 1ON1A 3EUHA 1HKTA 3C0BA 1LDKB 1G3YA 2HTJA 5A2QZ 2M87A 3GYHX 4I0BA 2E2QA 3F9MA 4ESJA 5FB2A 1DUXC 5BPMA 4CZGA 3RPUA 4M7YA 4XH1A 2QM1A 3VGKA 3W6JB 4IRIA 4EJTA 1NLVA 2LNBA 1YG2A 4CI6A 1AWCA 3QDKA 4HF2A 4BGBA 2OQRA 3U8XA 3DV8A 3W3DA 4O3MA 4KIGA 4H0VB 4JD2B 1WI9A 4M6YA 1S29A 1P92A 1W7PB 2DT5A 4PDKA 3M8EA 3VOEA 3JS6A 2HDCA 1BUPA 3TOBA 4EJUA 3MN7A 2P9PB 3SFZA 5CJ9A 5KQ8A 4FWRA 3EDPA 1IXCA 4RGRA 2P6TA 3JTHA 2I7PA 3WXLA 3ZN1A 3IRQA 3A5MC 3IUCA 4BQZA 2L54A 1B9NA 3FXQA 4CBXA 4AWXB 3B02A 2DK5A 3E3VA 4HV6A 5D5UB 2STWA 1F9NA 3UKRB 2XHKA 2Z99A 4FHTA 4FT8A 2E1CA 1HKSA 4CZKA 1TQIA 1I1SA 5HDKA 4KDPA 2A3ZA 4PL7A 3G73A 1TW3A 3EYYA 4Y0WA 1ZGJA 3CJBA 3FMSA 2PG4A 2EFNA 5KPTA 4Z2YA 2ZMEB 1ZHFA 1O3QA 3G25A 2STTA 4LJZF 1XGOA 3MCPA 3IKTA 1X3UA 5K5RA 2ZBKA 5LRRA 2GXGA 3LQRA 1ON2A 1FBSA 3CTAA 3WE3A 5AQUA 1HKBA 4HOBA 3F8BA 5ADXA 3VEYA 2QXLA 4H5TA 2K02A 3O1WA 3QICA 5F0XA 3R6SA 1QQNA 4BRDA 2ACJA 2P9IB 5AQXA 3GVAA 3JXUA 3O8MA 2H94A 5L3CA 4EM2A 3B8AX 2QQAA 1ZRDA 1QZ5A 2IRFG 5E1ZB 4B1ZA 3QAHA 3ZMTA 1U78A 1XQSC 3FZMA 4XSZF 1FSHA 1B4AA 2BGCA 4I2OA 2NLXA 1TNTA 4HX8A 1QZYA 3KP6A 1KGSA 2V79A 2IP2A 1G4DA 2XASA 3VPZA 3WUHA 4LLNA 2GUPA 4WQ4A 2QZ8A 5LBQA 5E8GA 3WTVC 4BRAA 3WTZA 1PUEE 1O3TA 2PMHA 2IVNA 4O5FA 1HBXG 4E70A 1V4RA 2M5WA 5ED4A 1XMKA 2UWMA 3KZBA 1K6OA 3MEXA 3U9DA 2ZFWA 4BG9A 1BOTO 4KBOA 4WQ4C 2DU9A 3KZZA 3H46O 2HR3A 3HTVA 3F6OA 1R23A 5F1XA 3U1DA 3TPQA 3L00A 4GYIA 5AQYA 5JLFA 1MGTA 2EK5A 3BUZB 2FOKA 2DI3A 3Q5FA 1YLFA 3BWGA 5CVJA 3ATVA 4U7BA 3L0QA 4FX0A 5LHGA 3D7EO 2G9WA 3HHGA 1DEJA 2HF4A 3K0LA 5BPIA 1NGFA 2GXBA 3KLNA 5AZIB 5E8IA 3QP5A 3E6CC 2Z3YA 2CQKA 4Y17A 3D2FB 3MCZA 1QZZA 4YFXF 1NGGA 4M72A 3BOQA 5D4SA 3HIFA 4BG8A 3WXKA 2P6SA 3ZETB 4M74A 5D6EA 3CUOA 4P9FA 4L18B 1LEAA 2V6CA 2W85A 1JGSA 4BR4A 1IJJA 4RTFD 3FGUA 5E1XA 5CE3A 3TDZC 2F5FA 2VXZA 1QGPA 2FNAA 3LDLA 1ONVA 4BRNA 3QB0A 2A5YB 4DQ8A 1MWMA 3O08A 2E1ZA 3ULEA 1G3SA 1X3NA 5CVUA 5BMZA 2Q2RA 2NS0A 1E2XA 1BM9A 1GLLO 4FL9A 1R7JA 1TTYA 3U4LA 4U0YA 3RYRA 2HZTA 4ETSA 2NZTA 3GE1A 3BJ6A 2QWNA 2G7UA 3P4IA 1GLDG 1WUAA 3MWMA 3HHHA 3AAFA 2Q31A 4M6XA 1MDMA 2OANA 1SZ2A 1YUWA 4S05A 1SFEA 2OU2A 4Q47A 4A0ZA 2E1YA 3CJ9A 5KQDA 4LK0F 3WE2A 2CH5A 4JQFA 2GAUA 4IXAA 4R79A 2LDUA 3LFKA 1Y64A 2F2EA 5CVIA 4P55A 4BROA 1W7PD 1R5GA 1T6SA 5DCMB 3GFLA 2E88A 5LGNA 5HOOA 2IPQX 3TOAA 3DQVC 4N0BA 3CI5A 3FZFA 5LHHA 4H0XB 4L3QA 1UFMA 2A6EF 4BRCA 3U9GA 4EJWA 5AQPA 3ABTA 3G3ZA 1RZ4A 3SHFA 4HYEA 1RUNA 4B1XB 3WGIA 1U5TA 1BI0A 3EO3A 3DKWA 3LA2A 3MAJA 5ICEA 3LL3A 1QNTA 1QZ6A 3HM8A 3QOPA 4Q5SF 1P8ZA 3LQQA 1HLUA 3KCCA 2D0OA 1S3XA 5HDGA 3V7SA 2MLGA 4KICA 3MN9A 1SD5A 4OINF 2XKPA 2D45A 4PKGA 1YYVA 2OZ6A 4UXNA 5AQJA 3M1FA 5JMVA 2Q8KA 1HPMA 3CERA 3IKVA 2HYGD 3H6EA 2BYVE 4CZJA 4DNCA 4LLGF 1NGDA 3KFWX 4ENMA 4I7HA 1PDNC 4LC9B 4XSXF 1Z6TA 5DUKA 3ZEUA 2WWYA 4I98B 3ZMSA 5KPZA 3ISPA 4A5MA 4EM0B 4L9TA 1YFHA 2E2PA 3FM5A 4HF0A 2VONA 3H3OB 5BRHA 4AM6A 1Z9CA 3O6WA 1W7PA 1J2XA 2R3SA 4UHTA 3FX3A 1S8NA 3I59A 3E97A 4I6MA 5BRDA 2FF4A 3AAQA 5AQZA 1E4GT 1NGHA 3VF2A 2CG4A 3TGNA 1QO0D 1IN7A 5EOYA 4AIJA 4AM7A 2MBFA 3DJCA 3BJAA 3IL2A 4HLYA 2GELA 2NRHA 1F4KA 4KMUX 5AFUA 1JHFA 4NQWA 1BN5A 2KJBA 5FGMA 3V4GA 5JFRA 3GG4A 1MD0A 4BC4A 1G3TA 3UKRA 3ZP5A 2MC3A 3GXOA 2DFIA 2C6YA 4HZFA 4BR9A 5EVZA 2X0LA 1T39A 2AS5F 5JHUA 4BHCA 3O1BA 2A40A 2NNYA 2RDPA 5H6QA 5EXWA 2A5XA 3P7NA 2DPUA 1FY7A 3M6GA 2ZMEA 4HV5A 3FM3A 3QU3A 5KVRA 1Z91A 2EV6A 5LHIA 1GLBG 3DWLA 5F1RA 2QM3A 3H45C 3GDQA 2FEZA 4EFHA 4O6JA 3R9PA 2UXXA 1J0RA 4BHPA 4L0ZB 3U9ZA 4I0AA 5HDNA 3WXIA 4BR5A 3VEWA 1OYWA 2WUSA 5AQVA 5D4RA 5ILVA 4G7ZF 1F5TA 2VODA 5DUIA 1GXPA 2ISZA 5ELZA 1XGNA 3QRFF 2P9IA 1IN8A 3FE1A 3WTWC 3ENOA 4FWQA 2P5LC 2D1HA 1T2KA 2XV4S 2L01A 3M9AA 3E6MA 2O8XA 2GA1A 3GZ5A 4RB2C 1V4TA 3ZQ7A 3FHZA 2E8AA 4YDUA 5AQLA 3RKYA 5DEQA 4MO5A 4S04A 4EV0A 4FWLA 3QBXA 1U2VB 4FPAA 3FZVA 1MDMB 1F1ZA 3C7NA 2GQQA 3DXKA 3FMQA 1SAXA 4BC2A 2M45A 1BDGA 3DP7A 3PQJA 2A42A 4IRHA 3TU5A 3HRUA 4N9IA 1WQ2A 3Q9VA 1ZLKA 2ASMA 2RQPA 1FNNA 4BC3A 1SAZA 3BPXA 2VCPA 2FSWA 1BJAA 1MJ9A 5AQTA 3CHWA 2D0PA 5FD5A 4ESBA 1G6NA 4HDUA 3VGMA 2PLYA 1JHHA 4ASNA 4BYYA 1MA9B 1T6CA 2ESHA 3GOIA 3DPTA 2H3GX 1JCFA 4KN7X 5E17F 2I7NA 5AZIA 2P9SA 3LWFA 3KP7A 2ZJ2A 5EEGA 1FP2A 4K43A 3P9IA 2XUBA 4RAYA 1BIBA 3ABUA 1IZ1A 2K7LA 2KKOA 1U2WA 2CGLA 5FLXK 3LDPA 5B8HA 2BV6A 2A6AA 1HW5A 3S41A 5K5OA 5TJJA 3LSTA 2P5KA 1EV7A 3DF8A 3ZETA 5BRFA 3DPLC 3NEUA 1SFXA 1RFQA 2QWOA 4BRFA 2Y75A 3WT0A 4K41A 3V7CA 4H5VA 2IA2A 4BR7A 2PAVA 4QWQA 1KAYA 2F9TA 4OMZA 1BC7C 3J80K 3ZMDA 2UXNA 2P9KA 2CYYA 1IN5A 4BHBA 3ZEUB 5J8FA 3VEZA 4ZYHA 4KMFA 2FU4A 5HVQC 1Y0UA 4FWOA 3WTXC 3H3ZA 2W25A 3A0IX 4U88A 1REPC 1XCVA 1BC8C 3CJNA 1R36A 3IHUA 3HI0A 4Q4ZF 2MLKA 5FPDA 2VN2A 5FPEA 4CGZA 4HQEA 4K25A 3I59B 2JRTA 2M1BA 4I6MB 2F5CA 2KJCA 1J75A 2F5DA 5D5VB 3I8BA 3IMXA 3SLCA 1TUYA 4FWNA 5ADXH 4M63C 3MZYA 4M7XA 4IPAA 3R4KA 1K78B 3O4WA 2W40A 1X3MA 1XGMA 2L3DA 3CIPA 1ZLJA 4KN4X 2JT1A 4NB4A 2ADUA 4EQQA 2HYFA 1HKQA 2P5VA 2Q1NA 1O57A 1ZN2A 1P4WA 2GWKA 3EL2A 4GGGA 2DTRA 4QLCU 1ZARA 5AZJA 1KQ0A 3LAPA 5FPNA 4FO0A 4ZYEA 5DCMA 6PAXA 4GNIA 1WOQA 4KA4A 2ZGZA 2RNJA 3JAMK 2E7XA 3F3XA 1FC3A 5TRDA 3VFZA 1O3RA 2QWQA 2ASPA 3CDHA 3ID8A 3PQKA 1IG8A 4B1WB 1XN7A 4ENJA 1BA0A 2JPBA 3SK3A 2EA2A 4ISGA 2Q0UA 3CLOA 2CSOA 3C3WA 3GZ6A 2VBZA 2VE8A 5FD6A 2ZCWA 1GLCG 4CHUA 2R7FA 2V52B 4HF1A 1IXRC 4RB1A 1UB9A 3GFJA 4BC5A 3TKYA 3V8KA 2FSJA 4LK1F 3N4MA 3RKWA 5FLXZ 4IRGA 1U3EM 5JLHA 1OR7A 1HUXA 1XD7A 3MZHA 1FT9A 1KXPA 3QPTA 4IJAA 2XRNA 3C7NB 3V7RA 4PKHA 5TKYA 3DXKB 2P9LB 5LJVA 4Y15A 3TQNA 4HLXA 2G7HA 4LLLA 5D5WB 4NHJA 3F8FA 1W5TA 2VC1A 4YIFA 4B1YB 4KIFA 4UVCA 2ZKZA 1BWFO 1J7KA 3BF3A 1MKMA 1OMIA 1YXQA 2PBDA 3NQOA 5BPLA 3K69A 1NGBA 2FBHA 5IT3A 1FWZA 2QQ9A 2HS5A 4JK1X 4FX4A 2Q36A 5LGTA 4MGRA 3HSCA 1JCGA 1K8KA 2ITMA 1HX1A 2Q0RA 3VEOA 1FYMA 1E4FT 3O80A 5HS7A 4MEXF 2MD5A 2RC4A 4ZZLA 3ZX2A 1R1UA 3HRTA 2CGPA 3E5QA 3CJCA 4HX7A 2Z33A 2P9SB 1SD4A 2FF6A 2BEOA 4Y13A 3IDHA 2XAHA 3ML6A 4U0WA 3D2EA 5LJWA 5BOXA 4KYWA 2D1KA 2GTDA 1XB4A 2XIGA 4CD1A 2RN7A 2HKOA 1XSDA 1XC3A 2KIMA 5CVRA 1VTNC 1ZG3A 2HGCA 3F8CA 5HLIA 2XAJA 4WX9A 4HAMA 3R60A 2V1XA 2P9KB 3K1NA 4A6DA 4QS9A 2IJLA 1IN4A 1S6LA 3P9KA 2ETHA 2K4JA 4AD9A 3JAMZ 3B73A 2P9NB 3CJ1A 4OIOF 3EETA 1Z7UA 5H20A 1XGSA 2FXUA 3GL1A 1ZRFA 2FNPA 3O5BA 4GO1A 4A2AA 2E7WA 2UYTA 3I33A 4N9HA 4P9UA 4K42A 2YHWA 4CXFA 1R1VA 3DAWA 1Q18A 4HQMA 2IT0A 4CJ7A 1A04A 3KVGA 3PFIA 1U2VA 3R0JA 4RGUA 4EIAA 4B9QA 1DPUA 3KZYA 3F23A 2Z5UA 3M3ZA 2FA5A 1CGPA 3TDUC 1TYQA 2VOPA 5CYVA 4RB0A 5AQIA 2CFXA 5I9EB 4BQAA 1K7AA 2P8TA 5AZJB 3VF4A 3F6VA 4MTEA 4PZJA 3ECHA 1AOYA 1XCBA 3HRSA 3H92A 1QHAA 5ILSA 5AQHA 2BE5F 5EEHA 3F22A 1ZREA 1J59A 1MJAA 2ZWHA 4OIQF 1GHCA 3L9FA 1BU6O 2CW0F 4C23A 5LEJA 5AIPA 2ZNYA 5L3GA 1KQ8A 2NYXA 2MA3A 4IHTA 2YPRA 3I64A 4KIBA 3H3UA 4FOIA 1OPCA 4UUVA 4BRLA 1LJ9A 2ASOA 5AONA 4HBLA 1BBYA 1O7LA 1I27A 1QQMA 3I0TA 2HOEA 3SXYA 4BRGA 2GIVA 4ZH4F 3I71A 3F21A 2QWWA 4G6QA 3NRVA 2IIRA 3UE5A 2VT3A 1LDJA 1DPRA 3EZWA 2H27A 4F7ZA 1R1TA 5EX5A 5JR3A 1ZC6A 4CDGA 2FF3B 5AFUH 3H1QA 4H0YB 3QU6A 1R22A 1YVNA 3JSPA 1H9TA 3CETA 3ATUA 3KLOA 4ZZDA 2CGKA 1BI2A 3I4PA 2NRAC 1MZBA 1XDUA 1ZGAA 2RVCA 1FBQA 1I5ZA 4RAZA 2Q97A 1YW9A 1BOAA
chains in the Genus database with same CATH superfamily
1EH7A 1ITYA 3MK6A 1RCHA 4EGZA 4H4MA 1ZG5A 3E5UA 1H0MA 3UKUB 1KVCA 4M71A 3VEPA 5DD8A 4X65K 1LE8A 1DTQA 1NK6A 1G99A 1K78A 5AQKA 2YSRA 3BT9A 3GTGJ 3RPQA 3L09A 3HGYA 4CCJA 2IVOA 4BXFA 3CUQA 3AVJA 1TW2A 2H09A 3VQ5A 4LF6K 1H1VA 3AA5X 2QGUA 3EQLF 3HB9A 3IFRA 1K83J 1NMDA 2WAEA 5J8CA 2V7YA 3PY8A 2DO7A 2AXLA 3CUQC 2JJ7A 1W7AA 1IW7F 3EKSA 4F2SA 5IP7J 1RKTA 4U0VA 4FM2A 5D8KB 3GEZA 1JJ8C 3QPHA 1LQ1A 4NC6A 2V26A 3RCOA 3JRGA 4RW9A 3KHYA 1HR0K 4CEZA 1EWRA 4IVNA 3V8LA 4DQ2A 5IT9K 1AKHB 2YJFA 3Q9SA 3COAC 1RTHA 3KEOA 2P9UB 1BHLA 3H5AA 1NGEA 3G10A 2DOFA 3NHGA 3L3VA 2L02A 1RT7A 4IHSA 3HKZA 3VDXA 3H9QA 5CLSA 3NBPA 2QSFX 4W5QA 3BQYA 3A5OC 1TYQB 4JKGA 2NNNA 3G6EN 3J7ZI 3EKUA 1IXSB 2XC7A 1QS4A 1HF0A 3QP6A 4F9OA 4FWSA 4B3OA 3KK3A 5HODA 2VIXA 1DDNA 1IAWA 1YIOA 2D0BA 4HTLA 2WAFA 3I55N 3K2ZA 2DN0A 2GBYA 2VI6A 5M1PA 2YKNA 1T08B 4RG8A 4ZYDA 2KZMA 1GXQA 4JI3K 3CC2I 2A69F 3AO1A 1YT3A 1IV6A 5EDNA 1OCTC 3T8RA 5DM7F 1ZXOA 5DM6L 4BJTA 4GCVA 4C3HJ 5IP6A 3GBGA 1U6GA 1J5OA 4M42A 2IVMA 1YO5C 3AG3H 3RI4A 3VMFB 1UELB 2VC0A 4JYKA 4JX4A 2CQQA 3GLXA 4Y4RA 2XAUA 1S7AA 5C12A 4BQLA 4WWCA 3V81A 3VB2A 3CJ7A 4K8ZA 3HBTA 3VYRB 5B1BH 1WSUA 2DQLA 3DLEA 4JOMA 2VQCA 2VL8A 3SPYA 4RGXA 3NF6A 2NVQJ 1WH7A 3R6MA 3U2RA 3ULQB 5T7BA 1HNZK 3WNHA 2WC2A 4DTPA 2A5WA 2MD0A 4C8LA 5F27A 3SUNA 2X1DA 1RR7A 1GVJA 1SFUA 3OYAA 4LG0B 4DV4K 2BY3A 1Z05A 5AQSA 4QCLA 2HHHK 4XRFA 5DV5A 4BVPA 1SVMA 4WF2A 1MMSA 3CC4I 3NAEA 4BR0A 2ZO4A 1RNLA 3QBWA 3PIPL 3CQZJ 2LY1A 1XS9A 2TDXA 2E4LA 1XTAA 1VQ6N 3N97A 5EGOA 3TO7A 4EJOA 1WSEA 2VT2A 4CZMA 5CYMA 4IG0A 3VA0A 3LWMA 1OH5A 1OCOH 2XGDA 3U6FA 2H6BA 2FMYA 1R6RA 3L6QA 4FJXA 4NLBA 1RDWX 4F52A 2KFDA 5D8LB 3V8JA 1IDZA 4FVMA 2E19A 4BQQA 4I76A 1EQYA 1VI0A 3GTLJ 3FK7A 2X6XA 1TQMA 4FTHA 4RBOA 3K2PA 1RT1A 5JLXA 1KD1O 4L8RB 2EFWA 3WQUA 2YHXA 4IOAL 4M9ZA 4XONA 3BJOA 2E35A 3WXMB 1JKQC 1HKGA 5J6XA 3P5JA 3OYLA 2HHVA 2COMA 4BWJA 5GADP 1NJXA 2IVPA 4O4GA 1NGIA 2I10A 2WV0A 1WVRA 5E20A 1HLVA 3GTMJ 2DOAA 3GO5A 3S3OA 1Z3YA 4XH4A 4WXDA 1RIOH 1IGNA 2F4OB 1C0WA 4XH5A 2LRDA 4FJ8A 2VQFK 1Z21A 4IZ9A 3KLGA 4G1QA 3TO6A 2E34A 5LY3A 2FBIA 4A3MJ 3ROUA 3M3YJ 2M8GX 4YFKF 4MLEA 1Q9YA 1BGXT 4OIPF 3H1CA 1ATNA 5LD2C 2ISYA 4FWMA 3LDQA 3H3VK 5BN9A 4JRPA 1S1WA 4BE0A 1ERDA 1SEUA 1TP4A 4H0EA 2CRGA 4Q5VA 3FISA 5IYBJ 1J6ZA 3DEUA 2RPIA 1XC9A 2CH0A 5F2RA 1X9JA 2DA6A 1FSEA 3MVPA 2J5PA 5DDGA 5F0HA 2F5EA 5GAGP 5J1YA 3H0DA 2YJEA 3ID6A 1YVUA 4UB6C 3O3KA 4OKJA 4XRSG 2X48A 3G71I 1R59O 3L8BA 5M3FJ 1P4AA 4XICA 1DGKN 1I6XA 1GLAG 4N76A 2K3FA 5FFZA 2V1NA 2EJRA 2Z1DA 3J7YP 3ZR8X 1DP7P 1WRJA 1S6QA 1GV5A 1QHTA 4EM1A 1NK8A 2OAZA 1RGIA 1T8IA 2VBYA 3RKQA 4K2EA 4CF1A 3GCMA 4AILC 3ZX0A 3JRCA 3L2QA 2P7CB 1J9IA 3CDIA 5J2PA 4FWPA 2AA4A 1D4XA 1NK9A 2QENA 3D6RA 2OTJI 2W24A 3LM9A 4IQJA 3ZSZA 3HPOA 4ISEA 2NS7A 3VGLA 1YW8A 2ID3A 2DW4A 3VEVA 2HI3A 3O9TA 1X4OA 4X6AJ 4KTZA 2ZSHB 1C0GA 3S8PA 1UA1A 3HM9A 4WFNL 2R7RA 2VXDA 2R7XA 3H08A 3WEEB 2DPDA 1KSPA 1IRGA 1D0XA 1NWKA 5AQWA 5KRSA 4IHYA 1USTA 2A3SA 1AHDP 1NG7A 3AVKA 1XPXA 1NGAA 2XAQA 3DXMB 3CFPA 3L2CA 1BW5A 4B3XA 5D3GA 4YORA 2WB1N 2JSCA 3CD6N 3PO4A 2WY7Q 3AFHA 3A5LC 1D8KA 4Z94A 2V1UA 4CF8A 5DYMA 4RGSA 3GFMA 1FYLA 4KH6A 4P5OA 1HJOA 4Z4CA 3O6BB 3A01A 3TBIA 4JN4A 5A2QK 4F92B 4PKIA 1BQMA 2DPNA 5ERIA 3ASMA 3CC2N 3G1MA 1FKPA 4ENKA 4E0DA 3RR7A 1EH8A 3BY6A 3ZT3A 2HMPA 1ETKA 1YS6A 3ELKA 4BVOA 4QS7A 1U6ZA 3O9RA 4HRIA 2EWNA 2RKIA 5E18F 3W0LA 2Q3SA 1V54H 3ZMZA 2OA4A 1W9HA 4ITVA 3O4QA 1YQAA 2KIFA 2VOOA 5LGUA 2V9PA 4BGDA 3CJAA 4BXUA 5K1YA 2ZNZA 4BY9C 4IEEA 4PJJA 1Z0XA 5DM7L 1P90A 4FLUA 4J8FA 4PHTX 5HLHA 1KYWA 1VSDA 1YRNA 2O8DA 3M8FA 4HX4A 3K4CA 1HSTA 2HOSA 2KHOA 1Q81O 3KWIA 2B7EA 2HNZA 3QNNA 4HNUA 2R7DA 4KHQA 4JAXA 4IXCA 1S1UA 1X1BA 1IUYA 2CV1A 4OKKA 3QFUA 5ILUA 5BPDA 4KTWA 4I01A 4CJUA 5EY4A 3MX2A 3SYTA 2O8KA 4PJMA 5KRTA 2EA4A 1SL0A 3C1DA 1FW6A 4GKKK 3CC4N 5D6FA 5BREA 3FBNB 2MG4A 3OMYA 5BS6A 2HKXA 3C95A 1B9MA 2WBNA 4XEIA 4A3GJ 1HNWK 4DV6K 2WADA 2NOGA 1HXDA 4MTDA 2YNFA 1U5TB 3BP8A 1KQSM 3C0BA 2G0EA 3DEEA 4ESJA 2E1MB 1L3VA 3RPUA 3GTOJ 4FE7A 3VGKA 2DCEA 3BTIA 2LNBA 2VWJA 1RILA 4LSNA 2R7QA 4BGBA 4HNTA 2OQRA 2TCTA 5JHFA 3L2WA 2XRIA 4KIGA 4H0VB 4JD2B 3KYLA 2GOXB 4DFKA 1A6IA 1VSKA 5CJ9A 2UUAK 2ZSIB 3EDPA 3FXOA 1IXCA 2P6TA 1GOBA 3ZN1A 2JWTA 4BQZA 1TK8A 4AWXB 4XM3A 4HV6A 2HVIA 1ZBFA 1QVTA 5EZHA 3TANA 2Z99A 4FHTA 1ETWA 2E1CA 1HKSA 1LFBA 2HVRA 5HDKA 2A3ZA 1NJIO 3G73A 3BG5A 3EYYA 4Y0WA 4HHTA 5KPTA 2EFNA 4IFEA 3LZJA 3NDKA 3JRBA 3G25A 2STTA 3MCPA 1YHQI 2RHKA 2WAQA 2ZBKA 5LRRA 2GXGA 4GMJB 3LQRA 1ON2A 3CTAA 3WE3A 5ADXA 2QXFA 2QXLA 2E2HJ 1QQNA 2DDAA 3RMBA 2P9IB 1TWGJ 1R9TJ 3B8AX 3NE6A 4M3TA 3EUAA 5HRNA 3QAHA 1N78A 1WAJA 3FZMA 3K70D 1IV8A 1YI2I 2ICWG 1S72N 2M2EA 4WQ4A 2PMHA 2IVNA 2WOMA 4DSEA 3BZCA 1X1DA 3LNQA 1K6OA 3CC7I 3U9DA 3G71N 4CZCA 2H8RA 4WQ4C 4NXMK 4J00A 3KZZA 3H46O 1YOVB 3A02A 3TPQA 4GYIA 5AQYA 3GTQJ 3BUZB 2EIJH 2CFOA 5CVJA 1T03A 3D7EO 4E7HA 2HVQA 3KLNA 5E8IA 3QP5A 4YFXF 3BOQA 3HIFA 1JUPA 3DLKA 2HVHA 4M74A 4V2GA 4XRMA 5FROA 3B6AA 1P7JA 1PVEA 3ISNC 1ETVA 1JGSA 5B5EC 3TDZC 2F5FA 2VXZA 3LDLA 3C65A 4BRNA 1HDDC 3O08A 5GAEP 4QPOA 3O3HA 2GM4A 1G3SA 1X3NA 5CVUA 5BMZA 1YITN 2HZTA 2NZTA 2OCCH 3OS1A 2IS6A 3H0GJ 4J2AA 4B9MA 3HHHA 1NG9A 2Q31A 3EE9A 1FMVA 3OA9A 1SZ2A 4Q47A 2OU2A 1TL3A 2EILH 2E1YA 4LK0F 2GAUA 1RKWA 5AJ3K 3DLBA 1FOWA 1VQLI 5CVIA 2Y9ZA 2L7MP 4HTUA 1T6SA 5LGNA 2IPQX 3FZFA 3R1XA 4L3QA 2GX9A 1UFMA 9ANTA 4BRCA 4EP4A 2ME6A 3ABTA 4OLAA 3P83D 4HYEA 3VQ9A 1BI0A 3EO3A 5CY4A 1BOBA 3BDPA 1NK0A 1QZ6A 2WC9A 3QOPA 1HLUA 1S3XA 3K5OA 5CQGA 2D45A 1YYVA 3PX0A 4CJSA 3M1FA 5JMVA 3HT3A 3CERA 2A1RA 4B47A 4XSXF 4E1MA 1C0UA 1VQKI 1YFHA 5J1UA 2KMUA 5FLMJ 2F48A 4C1NK 1SFKA 3CP2A 1B92A 3H3OB 1W7PA 1EJ9A 4UHTA 3FX3A 2FF4A 3AAQA 1D8YA 3GTKJ 3PNTA 4FE4A 3CLQA 3N4PA 3DJCA 3BJAA 4HLYA 3AA3A 3EY1A 3QETA 3V4GA 1TT0A 3GG4A 1B8IA 4X0GA 4AYBA 3H35A 1G3TA 3UKRA 5TKWA 1YTAA 3RZOJ 4M3YA 4HZFA 4BR9A 4DW6A 2AS5F 3OS0A 3JRIA 4BHCA 5H6QA 3P7NA 3IAS2 2ZMEA 3CJRB 3FM3A 3SEQA 2YHBA 5KVRA 4RMNA 1UOCA 5E41A 3C6AA 2FEZA 2FJ1A 4EFHA 4BHPA 3IH3A 5HDNA 4DJAA 4FJ5A 2R5YB 5E79C 3ZT2A 4FJKA 3DLHA 1XGNA 3OYMA 4IHWA 1KC8O 3WTWC 3ENOA 4FWQA 1ETXA 1U9NA 1VQMI 2LMDA 3GZ5A 3FDYA 1LW0A 3RKYA 3NWTA 4S04A 4CF9A 3QBXA 2HNYA 3OYIA 2RQQA 2GQQA 2XGCA 3FMQA 2M45A 5HNFA 3PQJA 4A69C 1PUFA 4N9IA 1ZLKA 3DLGA 4A3FJ 2GUIA 3AO5A 4LITA 4BJ6C 4FLYA 2D0PA 1TZLA 4B3SK 1G6NA 5J40A 2W48A 1HA8A 1E3MA 4HSRA 4DTRA 4C3JJ 4ASNA 4BYYA 1MA9B 2ESHA 1GOAA 3QQAA 3MKZA 5E17F 5AZIA 2P9SA 2ZJ2A 2YS9A 2XUBA 1YHQN 4RAYA 4CVNE 2L7ZA 3VQDA 4C2UA 1A5WA 3LDPA 3AGRA 2DA1A 4DU4A 2LVSA 3S41A 5TJJA 1IV0A 2CUJA 5BRFA 3NEUA 2QWOA 5M1QA 4BRFA 2Y75A 2HB5A 4BR7A 4XKVA 2O8BA 2PAVA 3JRFA 3THYA 2UXNA 4Z4EA 1HQUA 3ZT1A 3VEZA 4FWOA 3LSJA 3EYZA 3ZXSA 1YI2N 2LBFA 4CEQA 1XMXA 3IHUA 3HI0A 4GFBA 2Q2EB 3ZT4A 1J75A 2YU9J 4ELTA 2HVSA 3CC7N 1FKOA 3SLCA 4M63C 3MZYA 3R4KA 2W40A 1ZLJA 4NB4A 1N75A 3L2UA 1HKQA 1DP3A 1JLBA 1K73O 2P5VA 2QTDA 4I9LA 4AF1A 4QLCU 1Q86O 5AZJA 1KQ0A 3AL0C 3CCYA 3FXJA 2VGMA 4KA4A 2ZGZA 5TRDA 2ASPA 3ID8A 2ZB9A 3BCBA 1U04A 5M3MJ 2OPSA 4H4KC 4ENJA 2CV0A 1EA3A 3CLOA 2CSOA 1WBDA 2ZCWA 3NGZA 3FXKA 2BW3B 1TL8A 1N25A 3S17J 3GFJA 3TKYA 4AHCA 1SKWA 2K5CA 4G9ZA 1FXXA 4IRGA 5JLHA 3CM6A 3QPTA 4GV3A 2L9RA 3C7NB 4PKHA 1CXQA 5TKYA 2P9LB 5LJVA 3DRRA 1NK2P 5D5WB 2CW8A 1W5TA 2VC1A 4B1YB 1MKMA 1YXQA 1UG0A 3NQOA 1NGBA 2FBHA 1FWZA 5FJ8J 4KITB 4JK1X 4M3ZA 4MGRA 3VEOA 1K8KA 2ITMA 1E4FT 1R5ID 1BCOA 4MEXF 4ZZLA 1R1UA 4BE2A 1Z77A 4M3FA 4MFEA 4EZ6A 4Y1CA 3J7AP 4C2MJ 3ONQA 1LWCA 4NYNA 4HX7A 1XMOK 1SD4A 1LV5A 2JA8J 3D2EA 2E6LA 4B3AA 2OZSA 2GTDA 3LSMA 1XB4A 2XIGA 4CD1A 3CJQB 2KIMA 4D7MA 1ZG3A 4JI6K 3DBHB 4HAMA 4A6DA 4QS9A 3BR3A 1IN4A 1S6LA 3P9KA 4H8KA 4MIMA 2W1OA 3V4IA 5FKLA 3CF5F 1CQTA 1ZRFA 3GL1A 2FNPA 4GO1A 4A2AA 2UYTA 4JS5A 4N9HA 4K42A 1NK3P 1F21A 1R1VA 1TGOA 4A3CJ 3DAWA 2X6SA 2IT0A 4CJ7A 3EUKL 4KH4A 2KKZA 3KVGA 4CEBA 1XHXA 3KZYA 1Q7YO 3F23A 1KLNA 3MCAB 2PX9A 2X85A 2ECCA 4B9SA 1SAUA 1SKRA 4DZJA 4CJEA 4PZJA 3KYCB 1FTTA 1REVA 4PJ0C 4B3MK 1QHAA 5ILSA 3MZ8A 2UXDK 4E1NA 1J59A 1MJAA 2X6NA 1QSLA 1GHCA 3DWLE 1BI4B 3A4CA 3AG1H 4CGGA 1VQ5I 1IG7A 4KIBA 3H3UA 4CGFA 4X66K 1LJ9A 2PJRA 2ASOA 5EF6A 4BRGA 2GIVA 3F21A 2QWWA 1I3QJ 4UQGA 3OIPA 3G1OA 1SL2A 1S9EA 1LDJA 4CDGA 4M3UA 1R22A 1H9TA 4DV7K 2NRAC 1VQMN 3OY9A 4MDAA 1XDUA 3KK2A 1VSHA 4I6ZA 4IOXA 4FCYA 1FBQA 3CZ6A 5GP9A 1W2BM 2Q97A 2OC6A 5DCFA 2H8WA 4EJVA 5HLFA 1GLJO 3ZMUA 5EZGA 2QLZA 3TP3A 4DS5A 3VESA 4M3DA 2X6YA 3HUGA 4EGYA 1LB2A 1K61A 4HCCA 2CW7A 4I02A 1D5VA 2W00A 4RM2A 1Q82O 3S32A 1WSHA 3VF6A 1UWBA 2P0WA 1I94K 4CICA 2EZKA 2WFBA 1ZK8A 3R61A 3VYUB 3FXUA 3L3UA 4P1WA 3HOUJ 1FX7A 3ENBA 4OPKA 2IAIA 4JKHA 3AARA 2QSHX 3HOZJ 2GWRA 2Y1IA 2LD5A 3BG6A 1Y56A 4PGHA 3C6HA 5AQQA 3WG7H 5ICCA 3K4BA 1MH3A 1Y97A 4KKOA 5AR0A 4FM1A 2V6EA 4M9XA 4B9TA 2P7VB 4CJWA 2P4WA 5L3BA 1H9GA 2WV1A 4UUSA 3VQEA 4JKBA 2L5QA 3VSLA 3FFIA 3FF5A 2EFOA 2DLLA 3HO1A 2EFPA 2O0YA 2VJ4A 3S15J 4CYCB 2O3FA 1OISA 3TAGA 4RW6A 5AQNA 1BJZA 4LF8K 4XBFA 2HHTA 3JTGA 4DTXA 5C2FA 1LFUP 1RBTA 4G6DA 4B08A 2E1OA 3QYFA 3SQ2A 5GAHJ 3LSRA 2PY5A 5LEKA 4D5CA 5FLXO 4ILJA 1OH7A 4ZYGA 2WA0A 3IRXA 2BUPA 4H5NA 3BQZA 3RJPA 3H1VX 2KZVA 4OVLA 1L5UA 3V1QA 4BKXA 3I4MJ 3VENA 4JI1K 2PFBA 3AO3A 1Q1VA 2XROA 3JR9A 2E1NA 4RLFA 3MAQA 4LG3A 3C18A 2E36A 3Q7CA 2EIMH 2PYJA 1ZBSA 4FLVA 2IGOA 2LF8A 1G15A 3ZQHA 1WSIA 3HSTB 5BN8A 4M45A 3RDIA 2DBBA 3F8NA 1J53A 4BACA 3K5NA 2K85A 4FLXA 2XRLA 4CCLA 1FP1D 1FLIA 4WXHA 3J7AO 2EWSA 3TARA 2AXTC 3LAJA 3PO3J 4CYDA 2MYSA 3KETA 3I56I 3CUQB 3KP3A 1R0AA 3OIQA 3WTYC 1JJ6C 1BR2A 1BG3A 5JS2A 1EO1A 4AU7A 4CFDA 3ZX3A 1SD7A 2XAFA 4E7ZA 1W0HA 1KAXA 4BREA 4CFAA 1RT6A 2PEXA 4Z4GA 5GADJ 5CVVA 4II2A 1IF1A 3HOTA 1QQCA 1VQ8I 4BRIA 3LAMA 4UY8I 5HRSA 2W41A 4ZJZA 1QA6A 3AG4H 5AQRA 2QI2A 3ZPLA 3UKGA 5AQFA 2XY8A 1HKCA 2F8TA 3FZHA 2P5GA 1VF9A 3K1MA 1TWFJ 5L3DA 5BQTA 2GZWA 1FTZA 1C0FA 2CGJA 1RESA 3WU0A 4F93B 3HSFA 2KZGA 5J1EA 3QERA 2DMTA 4WK8F 4K0KK 4B48A 4I09A 2R5ZA 4DWIA 1WFXA 4JKGB 3R0AA 4H03B 3TAEA 3QINA 1RDCA 5M5XJ 3IAYA 4KAZA 2BVLA 4O5VA 5L3FA 4CW7B 3CF5L 3IKMA 2HOTA 4L9JA 1KVAA 3UKUA 1P2FA 1R00A 3QO9A 4F55A 4LGWA 3AO4A 4XLPF 5GAGJ 2V1DA 3SJMA 5H6RA 4DSIA 1FIAA 2L9VA 1T33A 4EAHD 3RYPA 4BEHB 3I58A 1T38A 1W97L 4ILHA 2HQ5A 4CJTA 3MN6A 4CZZA 3J7ZO 3QESA 1TKZA 1NGJA 2CO5A 4H0PA 2BY0A 4X1EA 1S7EA 3AG2H 2HFHA 4PA1A 4RAGA 5KAIC 1VQ5N 2LKSA 2RV8A 4U7DA 4XIUA 5MLCQ 3J7YJ 3RWUA 4HWIA 4KO0A 1CF7A 1S7OA 3SI6A 3D0PA 1KZHA 1U4BA 1X58A 4EVIA 3ZN0A 4ESFA 4KHNA 2HPMA 1AA7A 4A93J 4M3GA 2F8SA 4BRPA 3U3GA 4LH5A 2H6CA 2Y31A 1I50J 2FRHA 2FQ4A 2P9UA 2KFZA 4DTOA 3SV3A 3MMVA 2ZE2A 1QBJA 4QS8A 2D1VA 4FJIA 1UMQA 3ZQQA 2VJ5A 1G59A 3BY5A 4XK4A 2EV0A 3PNYA 1SUQA 2OD5A 1TLHB 3E5XA 5E1WA 4BDZA 3QIOA 3J81K 2DA5A 4CGDA 1Z25A 2IXSA 3VODA 3RIRA 3HGGA 1JTYA 2X1CA 3NH1A 1B1BA 3K9TA 4E4HA 4MLHA 5B1AH 1KU7A 3W2WA 4B9NA 3HSEA 5EGOB 4O5BA 2O5RA 1WSJA 4Y33A 3OYFA 4WCGA 3ZSRA 4YIIA 3BROA 3DEWA 1OYIA 1MDUB 2QWLA 4EHUA 4DHYA 1B9DA 3ZMVA 4WFBL 1XDSA 1J09A 4MEYF 5K5QA 2O61A 3LPTA 3UB5A 2JTVA 3WQTA 1G3WA 4B1UB 3FXRA 1VQ7I 4P96A 4BRKA 4AM3A 1KAZA 1YW7A 4UNOA 1EKEA 3HK2A 5GPCA 3ZOBA 4LF4K 4IHXA 3FIWA 4PL8A 4H5WA 2V7ZA 4LFUA 1JUMA 4DCHA 4BRMA 3D5SC 5HS8A 4CD3A 3RKXA 1HW1A 4DG1A 4BL0B 3RTRA 3P9CA 5J2NA 4CZEA 1HYSA 2K9LA 2P9PA 1NBWA 4F3TA 4IEJA 3VEXA 5IOZA 2JVHA 3DRPA 4HUEA 2YNGA 2IGMA 1NGCA 4M73A 2BHYA 4KV8A 1NM1A 2AHQA 4J01A 2FBKA 3E66A 1H89C 4IL6C 2PMZN 5EJCA 2BHZA 1UAXA 3AVAA 3E6BA 2VBWA 5IT9O 3R8EA 4OJRA 2UUBK 3SJHA 5D5XB 3HL8A 1YAGA 1LNWA 5E3LA 3K4JA 3OOUA 3A8YA 2O4GA 1ZBLA 1XC5A 4RLQA 2M7BA 3JRHA 3MDQA 2MGQA 3ULEB 5JVTA 1GLEG 4L5IA 3BG3A 4C30A 4CGHA 2FLOA 2K27A 3N4QA 2VG5A 3FFKB 4CJFA 1YF5L 3T1BA 1XSVA 2K9QA 1XMQK 1JL2A 1PP7U 3W2VA 4RB3C 4GW6A 3PL8A 4B44A 2GEMA 3V1OA 3G0ZA 5KGXA 3WGGA 4CZLA 2OV7A 1FBUA 1KA8A 4DR6K 3TTFA 5E26A 2RAEA 3LSGA 4YDUC 2OZUA 3PV8A 1XSXA 1ODDA 4Z4HA 1UHMA 1QSYA 1QQIA 2ZGYA 5AQOA 1IBKK 1BIAA 1VQ8N 3J80O 1VNDA 3S2DJ 4KH5A 1L3LA 1JE8A 1X9MA 2G8KA 1WJCA 3TMOA 4AC0A 3KLFA 2YKMA 1NHAA 4NB5A 4A0YA 2R0QC 3TI0A 1ON1A 5TISC 3EUHA 4A3IJ 4ZC3A 2DTZA 1LDKB 2HTJA 2M87A 2VJJA 4I0BA 3GYHX 2E2QA 1VQNI 3CXCM 1DUXC 4EJTA 2EINH 1I3AA 3EUHC 3QDKA 4M41A 1HMVA 3U8XA 3H5RA 5I3UA 1TV6A 1WI9A 5HRPA 2DT5A 3VOEA 4JI2K 4EJUA 5K14A 5KQ8A 4FWRA 2CV2A 2BY1A 3V9ZA 3E1YA 3JCUC 3VSKA 3IRQA 1R4MB 1TKDA 1VSLA 3E3VA 1F9NA 2ZQBA 2JQ7A 3S3MA 4FW1A 1N6QA 3HPGA 1X19A 1Z3XA 2BANA 1TW3A 1ZGJA 3FMSA 4ABZA 2BY2A 4LJZF 3IKTA 1X3UA 5K5RA 4BQNA 3SUPA 1HKBA 1H88C 1I6HJ 2K02A 3O1WA 3QICA 3U3YA 4BRDA 1YRNB 4EM2A 4FZXC 3K10A 2QQAA 1ZRDA 4HG2A 1QZ5A 2IRFG 5E1ZB 3THXA 3ZMTA 3JREA 1QZEA 1IBLK 1B4AA 4HX8A 1QZYA 4IBNA 4PK4A 2K40A 1C1CA 2IP2A 4FASD 2XASA 3VPZA 3WUHA 2DY4A 2QZ8A 1U0JA 5E8GA 4OLBA 4BRAA 1PUEE 5GAEJ 1A5JA 2L7FP 4O5FA 1HBXG 1XNQK 4YRVA 4IFYA 4IHVA 5ED4A 2JWKA 5EG0A 2R7SA 2UWMA 3KZBA 3C6UA 3MEXA 1LAVA 2ZFWA 1WJAA 4KHUA 4HSTA 1IO2A 4KBOA 4D9JA 2HR3A 1K8AO 4JP0A 3U1DA 3L00A 3CMMA 4JV5K 3SAGA 3CF2A 1VQ4I 3Q5FA 1YLFA 2LH9A 1BCMA 3ATVA 4FX0A 5LHGA 3K0LA 1NGFA 1VAZA 3NF7A 1TL1A 2Z3YA 2CQKA 4XKBA 3MCZA 1QZZA 1VFCA 4YOUA 1WAFA 3OWTA 1BL3A 3LP2A 3WXKA 2P6SA 2R4GA 4AUXA 1LAWA 4KREA 4FXDA 2B63J 1IJJA 4GKJK 5CE3A 1V5EA 2FNAA 4CA0A 2O8CA 3BR1A 4DQ8A 1MWMA 2E1ZA 2HU9A 2G8UA 5CPRB 2Q2RA 4PFOA 1E2XA 2G8FA 4FJGA 4JS4A 4ETSA 3B6OA 1HPZA 4ID1A 3BJ6A 2P51A 2G7UA 4JX6A 1GLDG 1OLTA 3AAFA 4M6XA 1MDMA 2E5LK 2OANA 3KJVA 4A0ZA 5KQDA 1X4PA 4IXAA 2QKMB 4JKDA 1F43A 3KPHA 4EEFG 4P55A 4BROA 3BC8A 3GFLA 1Y8QB 2E88A 3DU5A 3DLRA 3TOAA 3DQVC 3CI5A 1DLOA 3KEYA 4H0XB 2A6EF 3BTJA 4MDBA 2Z1HA 1N33K 4DQSA 5EEAA 4XQFA 4B1XB 5H2FC 1U5TA 3QYEA 1GDTA 5ICEA 1QNTA 2K9NA 1S6PA 1P8ZA 3KCCA 5IPAA 3V7SA 4Y3OA 2MLGA 2Z16A 4KICA 4DOZA 4J19A 1NMNA 5AQJA 2Q8KA 1HPMA 2BYVE 3S2HJ 1NKBA 1Y1WJ 2KRHA 3KFWX 1PDNC 1Z6TA 3ZEUA 4I98B 2LYCA 3ISPA 2QK9A 2CUZA 4ZTFA 3MWPA 5IOYA 1R49A 3FM5A 2E2PA 3BR6A 2QKLB 3O9UA 3O6WA 1J2XA 2X74A 4CHPA 3I59A 3OYNA 5BRDA 4I6MA 5H1SQ 1JXEA 5AQZA 1NGHA 3VF2A 2CG4A 5A2QO 3OBWA 4E89A 1QO0D 2CQNA 3RQIA 2MBFA 2Y1JA 4DV2K 3IL2A 4XIDA 3DPUA 3V9WA 3HBLA 4FJ7A 4BC4A 4N4OB 3GXOA 1CLQA 5EVZA 1T39A 3BG9A 5C15A 1FY7A 4AHTA 3QU3A 1WJ5A 1RR8C 4XLCA 1GLBG 5F1RA 1MMDA 4RW7A 1IKVA 1POGA 3SAFA 4YY3K 1UJ8A 3QPSA 1VQNN 4BR5A 3VEWA 1GOCA 3OJUA 5AQVA 1F5TA 2BE2A 1GXPA 3V42A 5ELZA 2P9IA 3FE1A 3NF9A 3ZSVA 2JGUA 2P5LC 2D1HA 2L01A 2HHUA 3LALA 3FHZA 5AQLA 4W5NA 2DXIA 1VRUA 4FWLA 4XLAA 4YIRX 1U2VB 3RPUD 4BE1A 3FKJA 4HPQA 4BC2A 2RREA 1BDGA 4OPAA 3GLLA 3HRUA 1WQ2A 2ASMA 4DS4A 1BOAA 3BPXA 2VCPA 1SVLA 4BS9A 1ZTRA 1MJ9A 5J4YA 4JKEA 3CHWA 5FD5A 3M4OJ 4WE1A 4BWMA 3VGMA 1JHHA 1NJYA 4DU1A 5JS1A 2HHQA 2KDZA 2I7NA 3KP7A 1T3VA 2VGNA 3P9IA 1BIBA 2E5ZA 2K7LA 2CJJA 1JKRC 4YFUA 3PX4A 2OTLI 1RFQA 5LMUK 3WT0A 3SJJA 3FHNA 1FEXA 3LPUA 4OMZA 3V9SA 4CE9A 5CKTA 3J80K 3MECA 3ZMDA 5M1FA 3QEWA 1SS6A 5J8FA 2FU4A 5CHIA 3FXLA 4LOCA 1RBVA 3WTXC 1X2MA 4AIDA 4U88A 1REPC 1BC8C 4JI4K 1R36A 3W3CA 4CJVA 3CFOA 4HQEA 2M1BA 1OCCH 4W1UA 2HBMA 3IMXA 3K59A 4LF9K 3KK7A 3R3LA 2JT1A 2XSJC 2UXCK 3UIQA 2KLAA 2GLOA 2Q1NA 2VASA 1O57A 1ZN2A 1YJWI 1ZARA 2NRWA 3T1YK 5IP9J 4GNIA 4XN3A 2RNJA 3JAMK 3F3XA 3AVIA 2JA5J 4NXNK 3VFZA 2ID6A 3PQKA 1IG8A 3C3WA 3E1SA 2KPMA 3MKLA 3DBRB 3LP1A 4CHUA 2FBTA 2V52B 3CESA 1D1CA 1IXRC 4RB1A 2ECBA 4BC5A 2YX6A 3SDBA 3PSIA 5FLXZ 2PZSA 4I99C 3AGKA 5GINA 1KVBA 1OR7A 1HUXA 1XD7A 4CGIA 3MZHA 1FT9A 4IJAA 4DUZK 2XF7A 1MNDA 1MH4A 4Y15A 4LLLA 1PUFB 4YIFA 1E3PA 1BWFO 2ZKZA 1J7KA 3BF3A 2LREA 4NDLA 1OR7C 2M34A 1VZ0A 3NVMA 2A05A 1N34K 2QQ9A 2W82A 2Q36A 3VQ4A 3HSCA 1HX1A 3O80A 3WU2C 5FKKA 3CCEI 2MD5A 3VQCA 3ZX2A 4V19S 2CGPA 3CJCA 1BA5A 1RTIA 3ABMH 4LIVA 2ZJQF 2P9SB 3VQ8A 5I42A 1QPIA 2QKKA 3IDHA 1BISA 1X9WA 3MWTA 2XAHA 3ML6A 3LANA 2VKVA 5BOXA 2D1KA 3M1CA 2O8EA 4DMNA 5F0FA 1XSDA 2O8BB 3BCAA 3F8CA 5HLIA 1JKHA 4HNVA 2X6WA 3R60A 4M6VA 3HJEA 1LKXA 4XN0A 2IJLA 4CCOA 5KAFC 4AD9A 2K4JA 1K4TA 2P9NB 4YHHK 3CJ1A 4OIOF 3GZNB 2FXUA 4B9VA 1S1TA 2YHWA 4HQMA 1NU0A 3AL0B 4CFCA 3BR0A 4JLHA 1Q8IA 2Z5UA 3WHCA 1B72A 4QOZB 4FJJA 3G4SI 2UU9K 1IG9A 3X2QH 4RB0A 2XF5A 3DCFA 3MXMA 4BQAA 5JLWA 2P8TA 3A1YA 5AZJB 3F6VA 1A5XA 2QQ8A 1HCRA 1AOYA 4CECA 1YTUA 1VHXA 4JKCA 2JSPA 2JN6A 2ZWHA 4OIQF 2M0CA 3L9FA 2XO7A 1LUJB 1BU6O 2HHWA 5LEJA 5AIPA 2ZNYA 3CPWM 1KQ8A 2MA3A 2YPRA 3I64A 4Z4FA 2P1JA 4B4CA 4UUVA 1Z26A 5AONA 1O7LA 3I0TA 3SXYA 3ZQLA 2LSNA 4ZH4F 1HRHA 2IIRA 4PY5A 2RN2A 2O4IA 1DPRA 3EZWA 2H27A 1R1TA 5EX5A 1ZC6A 4A3DJ 5AFUH 2DFFA 3CETA 4BBSJ 4DIQA 4QSHA 2A1SA 4ZTJA 1MZBA 1MSFC 1GV2A 4CHNA 3TAMA 1YIJI 4RAZA 5BR9A 1TT5B 1GUUA 4A57A 1GLFO 2QA4I 2Q2EA 1K8KB 3MQ0A 1EH6A 2N8GA 1CXUA 2X51A 4YG2F 3J8AA 5SWMA 4MQ9F 1TK0A 1JXSA 4KHWA 4XORA 2FQ3A 1HJRA 3AY9A 3K58A 2NAZA 1T44A 2DK8A 3D2EB 3HJFA 2IS4A 3HXLA 5ICGA 1NK4A 1YS7A 1VSMA 3LDNA 4X62K 3SBTA 2NS8A 2GWJA 4A2UA 3K5LA 3GF2A 4E1JA 3TEDA 2OCEA 3V6DA 3WNFA 2YX7A 4BJ5C 4UVAA 1MJBA 3GTPJ 4A3KJ 4F3QA 3HZ6A 1JT6A 4FZZA 2HSTA 2EBIA 2D2WA 5HL7L 4DV3K 3F72A 4NO7A 3SMPA 4G8XA 1Z6RA 4CEEA 1VQ9I 2ZJPF 1I1GA 2WTEA 3WNEA 3P31A 4NCBA 2P9LA 5F1JA 4EHTA 1MU2A 3T1AA 2G8VA 4KFCA 3VQPA 1U47A 3IP4B 2Y2ZA 4A6EA 2DT6A 3WGHA 1SMTA 4R1HA 5F08A 1K79A 3IS9A 4A5NA 2Z9OA 4JRQA 5FPMA 4PGGA 1XUPO 1YJWN 1FIPA 4OGEA 3AVBA 2VB6A 3CQ8A 1R58A 1XG1A 4BY1J 2KFNA 3WG9A 1IUFA 3AO2A 2R92J 2EB7A 2J4RA 3S14J 1B9FA 2XVCA 1USSA 4NNJA 1MWKA 1KCFA 5FKMA 3S16J 2CU7A 3H3NO 1ULYA 3HTUA 3K57A 1WNSA 4LD5A 4R8HA 1IKWA 3OHRA 3RMAA 3ZSOA 2QBYB 3PIOF 2KISA 1NOYA 3T0YA 3T5XA 2A6TA 2WONA 5C25A 3BDDA 3WTUC 1VQPI 2F6CA 2L9NA 3M8RA 1CZ9A 4GY2B 1A5VA 2JVGA 4I2PA 4PJNA 2Q1ZB 2JK3A 4ISFA 3G6EI 2HW3A 3ITHA 4ON0A 5IT9Z 1DGWY 1BA1A 5HLTA 3I9V2 1VK0A 1X1PA 1N32K 1JCEA 1RTJA 3IH4A 3OYBA 3CCEN 2IBDA 1PYVA 2HF3A 4DR3K 4I7FA 4BAYA 2MH9A 4BH9A 4EATA 3GX4X 4L9NA 4RWTA 1Y6IA 4JNEA 3KTQA 4CERA 4DU3A 3CCQI 2X9DA 2B4JA 4C8MA 3ZSQA 2F4MB 4DR2K 3TO9A 3L2VA 2LOOA 4F91B 1SD6A 1BI4A 2FOWA 3S1RJ 5B66C 1Z67A 3SZGA 2HQNA 1BI1A 1BO5O 1K4SA 1KRPA 4PFPA 3W2AA 2NVUB 4NC8A 5LLQA 2QSGX 3IV5A 2YU3A 2HNHA 5IYCJ 4UUSB 4I9QA 1OYYA 2FX0A 3LM2A 4BRHA 1LEBA 1ZG1A 2FBYA 3ENHA 3SV4A 3J7AY 4DQRA 3J80Z 1V4SA 3DYAA 1QSSA 3UR3C 1BR4A 2KIUA 3G4SN 3JRAA 3OS2A 1JLEA 1DKGD 2ZXJA 3JYTA 1Y1VJ 4HW0A 4JHDB 3WXJA 4X64K 5E84A 2WAQN 4F8RA 3WNGA 2EV5A 1GT0C 4S0HB 3NAUA 3SQ1A 3KD5E 2L4AA 3ESWB 4UB8C 3O3FA 3A2FA 1KONA 2KRCA 4OMYA 4A2BA 2CUEA 1XMAA 3S2WA 2QWPA 1ZRCA 3T7ZA 5C3EJ 2MSYA 2ZC2A 3ZQFA 4AVPA 3JSOA 3AVNA 1UCRA 2JA6J 2V51B 3FZKA 3SUQA 1ZAOA 4GXOA 4CZHA 4LD0A 1HNVA 2NVXJ 2OTJN 2NUBA 2O6GE 4RW4A 1NTCA 4UV8A 1A35A 3IWZA 1UAAA 1ZYRF 1YIJN 4OOIA 2EZIA 3I8DA 3LA3A 2PQ8A 2FMLA 1RBRA 2VE9A 4OAZA 2DA3A 2DYRH 1QU3A 3W6KB 2EFQA 2ZXWH 5J47A 2QA4N 3Q0UA 4FWKA 4DTSA 1R5HA 2QWRA 2QEXI 2J5OA 1QRYA 1H8AC 3S93A 2IC3A 2K4BA 4KPYA 3S1QJ 3ZRGA 5DMRA 4B3RK 5F6FA 2AJQA 3B6PA 1LW2A 3WTTC 3DMJA 3SFIA 3CCVI 1JLGA 2M30A 2XPVA 1S9GA 3IAM2 1APLC 3AV9A 3HXMA 2UZKA 2FSKA 3LOCA 4GYGA 2A6HF 1STZA 3SQNA 2IS1A 3VQBA 2ETJA 3HOSA 1A31A 2KRFA 1RT4A 2UUZA 3OYEA 3LP3A 4W5RA 4CBWA 4EZ9A 4KB0A 2IA0A 4IJNA 2F9WA 3FZLA 2YX4A 4CF0A 1DU6A 2FC0A 1LWFA 3RSEA 3ECOA 3M8QA 4E7IA 5FDLA 1IKYA 2R5ZB 4DB3A 3SUOA 2E2OA 2LF7A 3P38A 1Z1DA 1RUOA 2WBMA 5FKOA 4E7KA 1VQ9N 1Q1HA 4E7SA 4CHOA 3DXJF 3HM5A 1J54A 1E3OC 2V4JC 3D5LA 3EZ5A 5GIPA 2NNWA 2QQBA 4G12A 4A61A 2JPCA 3BPVA 2ZJPL 1W0TA 4ILGB 1MSEC 4BR2A 1W1WE 3EE8A 3DFGA 3RSNA 1SL1A 2IA1A 1S3JA 2QW9A 3KP4A 4H0TB 2HWVA 2CH6A 1S22A 1L0OC 1S1XA 4ZDOA 2DAOA 1BW6A 5J2MA 2M9HA 2Y48A 1CF7B 3HRGA 3THWB 2EQRA 1MBFA 1D0ZA 3S3NA 5IY5H 3EN9A 1T8EA 3EYIA 1W5SA 3I54A 1TWHJ 2BDPA 5J3LA 4KNYA 4CGJA 1E3HA 4YOVA 1TQPA 3VETA 4RM3A 2K3PA 3C94A 3NCIA 1D1AA 5BR8K 1V3FA 3PNVA 1SQKA 2ZMEC 1VQPN 1PP8F 4KT5C 4MQVA 2OPRA 3FLCO 1NK5A 2QCOA 1WHUA 1MMAA 5JVGF 1WBBA 3PIOL 1AU7A 1TK5A 3EPZA 3K9JA 2ELHA 3CMAI 4L9VA 1S1VA 4MFDA 1KU3A 4AYBN 2OPQA 4RCHA 3HTSB 1MW7A 3LWLA 1FYKA 4J2DA 4BRQA 3OV8A 2KIQA 2X6OA 1P7IA 4BNCA 2I8DA 3GW2A 2ME0A 1SVOA 3E6DA 2YHYA 4Y1DA 2A07F 4A5AA 5FO5A 1RBSA 5HROA 3CD6I 1OKJA 1L3UA 4BEHA 4CCMA 2BH1A 3KEQA 1TKXA 3CCQN 1FPQA 2HTSA 4M3XA 1P6RA 2VPLA 4D1QA 4W5OA 4A0XA 1ZH5A 2CWEA 2M7AA 4IWVA 1UHWA 3RMDA 3AAPA 2PN6A 3VQ6A 4XRSA 4E6KG 3IG1A 2OF7A 4CEOA 3D2FA 1LCUA 3KLEA 2IW5A 1HDPA 5A2QZ 2ZD1A 2M3AA 4FK2A 1V5FA 5FB2A 3TAFA 2I5UA 4XH1A 2QM1A 5KNLA 4IRIA 2XDVA 1NLVA 2H1LA 2F5VA 4WF9L 4CI6A 3BTLA 1YJNI 1RT2A 3CMEI 3QPLA 4HF2A 1QVGM 3V1RA 1NKEA 3DV8A 4DFMA 2MABA 4FZYA 4CHYA 1P92A 4PDKA 1X1AA 5GAHP 2P9PB 1ZKGA 2YNHA 5DK5A 2JRMA 4RGRA 2I7PA 3L1PA 3WXLA 1L3SA 3LMMA 3FXQA 2DA2A 2DK5A 4NQWB 5D5UB 2STWA 3F9KA 4FT8A 3SPZA 4CZKA 3QEVA 1I1SA 3KIOA 4PL7A 2XHBA 1DTTA 3D1NI 4AHSA 4Z2YA 3NH2A 1ZHFA 1O3QA 3K4NA 1XGOA 1RRJA 4E19A 3MKYB 3AA4A 1RDDA 2IGNA 4IZZA 1HQEA 4LH4A 3VEYA 4H5TA 5F0XA 2ACJA 3GVAA 3JXUA 2JUCA 3O8MA 2R7VA 4C3IJ 4D5FA 3C2GA 1U78A 2Z1IA 1XQSC 4XSZF 3LSHA 3KP6A 1KGSA 2V79A 1G4DA 3K2AA 4LLNA 2GUPA 4DV0K 2QEXN 1TAUA 4E70A 1E0EA 2M5WA 1XMKA 4JKAA 4FLTA 2UXBK 3CCVN 3S1MJ 4FYDA 2PYLA 1R23A 1SANA 1ZBHA 2NRZA 4CEFA 3BWGA 1VQLN 3L0QA 3HHGA 1DEJA 4G6TB 2W7NA 5BPIA 2GXBA 1MNEA 3E6CC 2DFHA 4M72A 2Z1JA 4Z0UA 2ZM6K 5D4SA 3RRHA 1ETQA 3T69A 3ZETB 2VLAA 1RT5A 2MFZA 5D6EA 3CUOA 4L18B 3OYCA 3CCUI 1RT3A 1LEAA 2V6CA 4DBQA 4BR4A 3O3GA 4RTFD 1OCRH 3K4LA 1ONVA 4FVUA 4XMYA 1SFOJ 2A5YB 2XY7A 1S72I 2NXNB 3ULEA 2NS0A 3J81O 1BM9A 4CIGA 1VQKN 3HP9A 1TTYA 3U4LA 3GE1A 1KFSA 4O55A 4XKCA 2G8HA 4NUBA 2QWNA 2CQXA 3P4IA 1WUAA 3MWMA 3LSPA 4ZDPA 4FLZA 1OFCX 1YUWA 4S05A 4NC7A 3BZKA 3WE2A 2ATQA 2CH5A 4JQFA 2X1EA 1DU0A 3LFKA 2F2EA 1R5GA 2D5RA 5DCMB 3BGRA 3VYSB 3Q7BA 5HOOA 4N0BA 3OVNA 3DKYA 3F0CA 2OZMA 3TSUA 2Y30A 5AQPA 1JLAA 2WB1A 3G3ZA 1RZ4A 2ZXHA 3SHFA 3CPEA 1Z7LA 1RUNA 5FRNA 3D5RC 1R4NB 3NVKA 3C2BA 3MAJA 1OCZH 1R71A 3HM8A 4Q5SF 3THXB 5HDGA 1X3ZB 3ZCOA 1JGGA 2DOEA 3MN9A 4OINF 3LSIA 1G2HA 3IKVA 3E01A 2HYGD 5F0CA 3A2KA 2DA4A 4CZJA 5TGTA 2EZHA 4DNCA 1NGDA 4ENMA 4LC9B 4I7HA 5KPZA 1YITI 4L9TA 3D45A 3CMAN 4ZHRA 1SC7A 4DFPA 5EG0B 2VONA 4F4KA 4M3BA 2YNIA 3SNNA 2O8FB 2R3SA 4HUGA 3QODA 4UUTA 2HDWA 2BZTA 5C44J 4CESA 1E4GT 5JVGL 4YELA 4CH7A 4E7LA 1IRXA 5EOYA 1W36C 4F3OA 1GVDA 2VQLA 1TWCJ 5AFUA 1JHFA 1BN5A 5JFRA 1X2NA 3K6GA 3O8GA 4ID5A 4KRFA 2M4GA 3RTVA 3PX6A 1OVYA 4CSWA 1V5GA 5JHUA 1JL1A 2A40A 4O8UA 5EXWA 3TP0A 2DPUA 2K9SA 4KT6A 5LHIA 3MN2A 3MX5A 3H45C 4RAFA 4JI0K 3R9PA 2UXXA 4IO9F 3F2KA 3U9ZA 3WXIA 2WUSA 4DTJA 4G7ZF 2VODA 2O8CB 2XGEA 5DUIA 2ISZA 3KD1E 3QRFF 1JI8A 3Q0WA 2F96A 2EX3A 1T05A 4A59A 3K4MA 2XV4S 1YJNN 3CMEN 2O8XA 3ASNH 4CJLA 2DMNA 4RB2C 5K7ZA 3ZQ7A 3CFRA 2E8AA 2NRTA 5DEQA 2LK2A 4EV0A 2AQFA 1MBJA 2BVMA 1ZYQA 4FPAA 3FZVA 1MDMB 1F1ZA 1JT0A 3DXKA 3DBLB 2HXIA 1SAXA 2D5VA 2JLEA 3BTCA 3TU5A 3JSMA 1ASUA 3Q9VA 3NGIA 1FNNA 4BC3A 1SAZA 3M8SA 5K7HA 3DM2A 4DTNA 2FSWA 1BJAA 5AQTA 2LKXA 4HDUA 1VSEA 3SQ4A 2VQHA 3GOIA 3DPTA 1JCFA 4DSJA 2VJIA 3LWFA 5EEGA 2NRXA 1FP2A 1JLFA 3K9KA 2HNDA 3ABUA 4KJZA 2JA2A 4QAGA 5B8HA 2BV6A 1HW5A 5J1RA 2P5KA 5K7FA 4PUSA 3DU6A 3DPLC 1QTMA 3V7CA 3SBGA 1WPKA 4H5VA 2IA2A 2LY9A 3HOVJ 1KAYA 2F9TA 1NOZA 1BQNA 4DGWB 2BXYA 2P9KA 3NH0A 4BHBA 3ZEUB 4ZYHA 4KMFA 4DQIA 5HVQC 4KB1A 1Y0UA 4CK3A 2WY8Q 3A0IX 1XCVA 1A6QA 4ZDLA 3AVFA 3CJNA 1ASVA 1G8XA 4Q4ZF 2MLKA 4FJMA 1W5CC 1UA0A 5FPEA 4CGZA 4K25A 3I59B 4I6MB 3K4KA 3BG7A 1EXQA 5D5VB 2HMIA 3I8BA 3KYDB 1TUYA 1LE8B 4FWNA 4M7XA 1K78B 5C42A 1X3MA 3CIPA 4KN4X 4EQQA 2HYFA 3A0HC 5C0YA 3K7AJ 2GWKA 3EL2A 3SQ0A 4GGGA 2FD5A 3LAPA 1PJRA 3PJRA 4IFVA 6PAXA 3DKXA 1WOQA 5M5YJ 4FM0A 3ZSYA 3ZQCA 1FC3A 1O3RA 2Y9YA 3CDHA 3OYKA 1XN7A 1IDYA 4CIFA 2E5NA 2Q0UA 3CCUN 3GZ6A 2VE8A 3SDGA 1FK9A 1RDBA 3HOWJ 1UB9A 3V8KA 3N4MA 4E7JA 4YNQA 1KXPA 3C6TA 3QWLA 3V7RA 4DR7K 2F4VK 2ELJA 3Q0VA 2ITGA 4U87A 3RMCA 2PBDA 2XY5A 3K69A 5IT3A 3TSQA 2HS5A 4FX4A 5GPAA 3N05A 1EETA 1XI1A 1D1BA 1WGXA 4FETA 3VQAA 3HRTA 1K6YA 1RTDA 3E5QA 2E2JJ 2Z33A 4Y13A 3G1LA 3HOXJ 1K9MO 1XC3A 4HCBA 1QE1A 3HL2A 5CVRA 4IKFA 4NCGA 2XAJA 4WCEL 4WX9A 3K1NA 3DLLF 5KHDA 1T95A 5IWAK 1C1AA 3B73A 5LFAA 4XLEA 3O5BA 2E7WA 1ORKA 4IG3A 2O7OA 1AKHA 4CXFA 1QHGA 4YOTA 1Q18A 1A04A 5FKNA 4K8XA 1U2VA 4BXXJ 4NBQA 4EIAA 1DPUA 3AA2A 3M3ZA 2FA5A 1CGPA 1TYQA 5CYVA 2CFXA 1U48A 2HQAA 2IDOA 1K7AA 3QEPA 1ZR4A 1XCBA 3H92A 4L5EA 3P39A 1JKOC 5AQHA 4BU2A 4KI4A 3F22A 3DI6A 4C9YA 1WCMJ 4FJLA 2KW4A 2NYXA 1WJEA 1LPQA 1OPCA 2KDOA 4BRLA 2LTPA 1I27A 1QQMA 2HOEA 3I0SA 3I71A 3NRVA 2VWKA 2CMPA 4OPJA 1KLMA 4F7ZA 3E7LA 5JR3A 2FF3B 4H0YB 3JSPA 3KLOA 4ZZDA 1BI2A 3I4PA 1ZGAA 1ENHA 4IO9L 1ACIA 4KI6A 4MQ3A 3GMEA 1IH7A 4GVEA 1I5ZA 1YW9A 3PUBA 5GTHC 2OJED 2K86A 1TVRA 4KHSA 1C6VA 1O7FA 5HNHA 3MFKA 4ENNA 3HG9A 2EIKH 3OL3A 3OSFA 4XLFA 3CO7C 4N41A 3TR8A 3HC7A 4LMYA 2OBPA 3WODF 5C4JJ 4IF4A 3MD2A 4DTUA 1DQUA 1ZQ3P 3T19A 1N36K 4XLNF 2ZXIA 1OH8A 1YTYA 1BI3A 1D5YA 3MEEA 3TABA 2Y0SN 1LVKA 4IOCF 1W4MA 2VG6A 4Y52J 5JI6A 1N77A 4LG0A 2VG7A 2O8EB 4RS8A 2R93J 4OU0A 4Z4IA 2Y69H 4XKWA 4LB5A 3E0JB 4LFCK 3O8HA 3LA7A 2AP1A 1JUSA 4EP5A 4FW2A 1KU9A 4MNUA 3FR0A 1HSJA 3VERA 1QPMA 3FXMA 4YOYA 4DR1K 1J5EK 4EMSA 4M3EA 2FBVA 4CJKA 1T98A 4BDYA 2VQEK 2HQRA 1E17A 1T0FA 3LL7A 2XB5A 5LL6Z 5M1KA 4G7OF 4DTMA 3GBTA 3KP5A 1WB9A 3M8PA 4AHRA 4LIUA 1B72B 1TUUA 3ZQGA 5HS9A 4H5RA 4B3TK 1T0FC 3AVCA 2E20A 4M9SA 3L4QA 2BTFA 3QOEA 2IGIA 3EEQA 2HHXA 1MIJA 1LDDA 3I56N 3TW6A 4MHGA 3KE2A 1OJLA 3FBIB 4UVBA 3ZT0A 2QYOA 4DF4A 4LB6B 1ESVA 1F36A 1MBHA 4FOEA 1ATRA 2G8WA 1CZAN 4CZFA 1O3SA 3WU1B 2L4MA 1P4XA 3SZPA 3ALYA 2DQRA 2X4HA 1GLNA 1B6AA 3DTIA 4PCQA 3AKZA 1KQ9A 4FK4A 2XKOA 2LSOA 3SMSA 3QYBA 5E3MA 5KI6A 2E71A 2VWBA 2P9NA 5KK1A 3LDSA 5ICFA 4OPHA 3GFIA 4Q48A 3OYGA 3NGYA 3ZGKA 2EH3A 3OOPA 2BBYA 5HLGA 4D0PA 1KTQA 1EF4A 4CCKA 3M1EA 2MW8A 4G94A 1WJFA 4DSFA 3O9SA 5LRSA 1IRFA 3SCXA 2PMUA 3JAMO 4CEAA 3VTHA 4O0JA 3JW4A 5FFXA 2NOJB 5E3OA 2ELKA 2TRTA 1O1WA 4KUMA 1U8RA 3RRGA 3A01B 1MNMC 2Q0OA 3CJTB 1SMYF 3GWZA 4C1NI 1RI7A 4LF7K 5HP1A 1ETOA 3KLIA 2YCHA 2PI0A 4H0OA 2FE3A 2D4WA 2GBZA 1D3YA 1TBXA 4KISA 3IC7A 3AVGA 1WH5A 3CP8A 3HP6A 3CCJI 2XAGA 2HZDA 3CCRI 3BLYA 1YJ9I 2HEOA 3CO6C 3CG7A 2B0LA 4GV9A 4TV7A 3HYIA 2O8DB 3DTKA 1WWXA 3BEXA 4AHVA 2Z1GA 4IDKA 4CBUA 3SAHA 5KTQA 3DLLL 2LFBA 3IRRA 1KFDA 1VQOI 4IEIA 4PSXA 1D8JA 2PFUA 5KPRA 3CYMA 2YHAA 3QLHA 1HW2A 4WQ5A 2R7WA 2YI1A 4WXCA 3WEEA 4A12A 4L5JA 3I3LA 5HRRA 1WKMA 3C7JA 2D0CA 3V9XA 1D0YA 3T8TA 3LFUA 2B6AA 3DXMA 3JRDA 5AQMA 4WQ5C 1ZGWA 3HSRA 3WTSC 1FJLA 2LY2A 4CJ5A 3REOA 5CR4A 4LFAK 1ETYA 2XGXA 2E6MA 4RDUA 3MEDA 2XPUA 3FMRA 2LC2A 1NG6A 3ERED 4D7NA 2V9VA 4BDPA 2CQ7A 2PJPA 5E3NA 2ESNA 1B59A 4DKWA 4CIEA 1JLQA 3I4NJ 3MN5A 1LFPA 4FSVA 4YOXA 3D0SA 2R7YA 4WFAL 2W6KA 2RNGA 2RGVA 2QF7A 4JBAA 1FZPB 1WSGA 4ELUA 2HXOA 4B8XA 4BGAA 5M1NA 1M1KO 1HQCA 2VUMJ 3K70C 4WYBA 1VQ7N 2BOLA 3I53A 4NYFA 3TTDA 1OKRA 4CJQA 2MH2A 3NFAA 3I5UA 3A5NC 2GOMA 3OIOA 4GRIA 3K0SA 2HOAA 5L3EA 2YR2A 5F04A 4CJPA 1M1EB 2XSDC 3OR2C 1J5YA 3KK1A 4HA8A 4AVZA 2RE2A 3F5TA 4AIKA 4G9YA 4CZIA 1FOKA 3VN5A 4CCHA 4CO8A 2HBLA 3VWBA 1HNIA 5BPNA 1C0MA 3MMYB 4DBRA 1BR1A 4MO4A 4U67L 4OO1J 5CZ1A 3QEXA 1ZELA 1WI3A 2O03A 5DD4A 5C24A 2A61A 2GA2A 1RBUA 4HVJA 3QFPA 3CMYA 3HYFA 3H5NA 4XNFA 2L7KA 4IOCL 3IH2A 2I5JA 4UV9A 5EU7A