3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
b'DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative NAGC-like transcriptional regulator
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
1T0FA 3SZPA 3FMRA 3CJBA 5B8HA 3T1BA 1RUNA 2EFQA 2MBFA 4EV0A 2MH2A 1KAZA 4N9IA 5E1XA 2NNYA 3OV8A 5EY4A 3CUQB 4HDVA 3GBTA 1P8ZA 3L0QA 1NGCA 2H6CA 3H1VX 1WQ2A 4JQFA 1J75A 1RNLA 2W41A 2YR2A 2P9LA 5AQHA 3AAQA 2HTJA 3TOAA 2RVCA 2QWLA 1ZC6A 3SLCA 3CETA 4IVNA 5ICEA 2CH5A 3CJCA 1RI7A 4ENKA 4IZ9A 2VBYA 2J5PA 2QZ8A 3HBTA 5BMZA 1Z7UA 3VETA 5JLHA 2XAFA 2EWNA 3E6DA 1KYZA 1HW2A 1O3TA 3QDKA 1HKSA 1MWKA 3DFGA 4HDUA 4I98B 4EHTA 4EJOA 2R7DA 1S3JA 1U6GA 1XCBA 4EJUA 1YAGA 2NRAC 1XSXA 4LGWA 5E8GA 2EWSA 5AQNA 4Q5SF 4B9QA 3A5NC 4CI6A 4FOEA 1HUXA 2G7UA 3VF6A 3O6WA 2VYPA 4F7ZA 1K7AA 1BI1A 5J6XA 5CLSA 3ROUA 4HW0A 4EJVA 4CGZA 4MO5A 3T0YA 3LDPA 2IP2A 4OIPF 5BPLA 5AQZA 4BRIA 3FR0A 3V8LA 5AFUH 4LK1F 3J7AO 2EB7A 4YDUA 1NGIA 4Q4ZF 2X4HA 6PAXA 4Y0WA 3EN9A 2P6TA 2P9PB 1T6SA 4OMZA 1REPC 4A2UA 4F9OA 5DV5A 3WTXC 4ON0A 2LF7A 3ZMVA 5E26A 3GFJA 5AQQA 3QPTA 4FWOA 2XRNA 1BI3A 4U0VA 2RV8A 4I09A 5LHHA 1S22A 3QP5A 2QUFA 1U2WA 4XH4A 3LWFA 1Z91A 2E7XA 1ON2A 2RQPA 4RS8A 1QQOA 5E1WA 3J8AA 3KVGA 1USTA 1F9NA 4YFXF 3F22A 4MQVA 1Z9CA 5LRSA 2DPUA 2BBYA 2LNBA 2E2OA 4KFCA 1QGPA 2M5WA 3HM8A 5AQSA 4M72A 1O3SA 2P9NA 1UB9A 5LBQA 1MDMA 3EDPA 2W25A 1NWKA 3WUHA 2A69F 3RSEB 5AZIA 3BF3A 4UVAA 5AQVA 1LCUA 3D2EB 4EMSA 2WWYA 3FXUA 3LDOA 1HJOA 1P4AA 2F9WA 3J81K 1V4RA 1E4FT 1T98A 1QZYA 3CERA 3LQRA 3W6JB 4BRCA 2NZTA 1YFHA 3BWGA 1JCFA 2A3SA 3R8EA 4B1UB 4CZZA 1J5YA 3WXIA 1XCVA 1D5VA 1IN7A 2LKPA 4ISGA 5AQRA 4EM2A 2H94A 4L5JA 4B1YB 5DD4A 5FB2A 2W57A 4ASNA 1R5HA 5E18F 1LB2A 5CYVA 2BE5F 3MFKA 2TDXA 1JCEA 1O3QA 4BG8A 3I8BA 3U9GA 4HLYA 5AQMA 1SZ2A 2XIGA 1G3SA 2P9SB 3FZKA 3MK6A 1E2XA 1T39A 1RUOA 1IXRC 2WUSA 2CSOA 5CVRA 2EA4A 1F4KA 2ASPA 2YCHA 4BC3A 2P5LC 1FYMA 1MD0A 2ESHA 3RKYA 3LM2A 4LJZF 1SFXA 2ZF5O 3EETA 3ZX2A 4QS8A 4KIBA 4UV9A 3R4KA 1TYQA 5CJ9A 1XMKA 1T6DA 2Y75A 4YIFA 2VBZA 3DKWA 2P5KA 1HKCA 4H5WA 1BI0A 2M87A 3KFWX 5JICA 1P2FA 3GW2A 3I33A 2JZYA 2CWEA 2FEZA 3L6QA 3O80A 2VODA 3A5MC 3GDQA 4BREA 4RB1A 4ISEA 4O5FA 5ILSA 3T8TA 4CZKA 2VONA 1BOTO 2NNNA 3I5UA 2DI3A 5KK1A 1ZN2A 1FP1D 1ONVA 3SZTA 4BQLA 3CHWA 2V79A 2FMLA 5AQOA 1SD7A 1TNTA 2RNJA 4A2AA 1J7KA 4M7XA 4YFNF 4S04A 2ACJA 3CQXA 2F5EA 3F9MA 3KE2A 1LVAA 2DAOA 2D45A 4ZYGA 4XLNF 5DUIA 1MJAA 4AD9A 3VGMA 3MQ0A 4I6MB 2EV6A 1XMAA 3WGHA 3QP6A 2FRHA 5J8FA 3AAFA 1PUEE 4IHSA 2XAQA 1F1ZA 2VE9A 1SMYF 2FNAA 3HHHA 1GLEG 2Q2RA 3P9KA 4BHPA 4WQ4A 2HS5A 3KP6A 1QZ5A 1SQKA 4CZJA 2ELHA 4BXUA 2OQRA 2Z9OA 5AQFA 4KIFA 5D6EA 2GA1A 1HW1A 5DCFA 1XB4A 3ZMSA 4YDUC 3E5XA 1TUUA 2FBKA 4UXNA 2FSWA 1HKQA 3CTAA 5FLXK 1GXPA 3R6SA 1U6ZA 4H5VA 4B1XB 3M9AA 3H92A 3ATVA 2ZFWA 3FXQA 5AQPA 2LF8A 3DXMA 1KXPA 2LSOA 3M6GA 2I7PA 3L7WA 5DD8A 1K6OA 2IJLA 3LQQA 4E70A 3CO7C 3KHYA 2BTFA 3MAJA 2E1CA 5BN8A 1MJ9A 2ADUA 4CBUA 3RPQA 3AAPA 4M74A 4XH1A 1L0OC 2CGKA 3SMSA 3RKWA 5ED4A 4R1HA 3MN7A 2JRTA 3TO9A 2HOEA 3V4GA 1YO5C 3IWZA 1NGDA 1W5TA 4CZLA 1UHMA 4ZZDA 3TQNA 3ZP5A 2OD5A 3D2FB 3H45C 1WI9A 1K8KB 1NLVA 1FYLA 2A6EF 3VEPA 4BRGA 4MTEA 3MWMA 5AQUA 3VEYA 2FF4A 3ECOA 5BRHA 5BN9A 1Z6RA 2KIMA 4HLXA 3EZWA 1HW5A 1D4XA 3EL2A 5D8KB 1R00A 4FPBA 1R36A 2Z99A 4BRMA 1J59A 2CGPA 1W7PA 3JTGA 4YIIA 1QZ6A 4RGSA 3VF4A 3ZETB 2YI1A 1IUYA 1NBWA 1OYWA 5FFZA 3FGUA 3I54A 5BPNA 4UHTA 3L00A 1BO5O 3GLXA 1K79A 2FSNA 1IAWA 3ENOA 1WOQA 4IXCA 1X3MA 1IZ1A 3FMQA 3DP7A 3FMSA 1W7PD 3IRQA 3O08A 1D3YA 5L3BA 2C6YA 4M9XA 4UNOA 3KP3A 4BHBA 2P9UA 3TU5A 5D4SA 2QBYB 1F5TA 3HRMA 4BRAA 3W0LA 1EV7A 1ODDA 3V7SA 2A6AA 1D8JA 4UVCA 1X3NA 1LDDA 1P4WA 1WUAA 4Q48A 2QLZA 4Z94A 3DAWA 1OKRA 2VOOA 4PKHA 1IRFA 4L9JA 3O1WA 1FOKA 1SAXA 4BR4A 3L9FA 2VE8A 4LK0F 4G7HF 3WTWC 3ID8A 1YQAA 1IXSB 3V7RA 4JNEA 4B1WB 3BJOA 2OZ6A 2HF3A 1FBUA 5DYMA 1ZHFA 3ZN0A 3WODF 3MMVA 1KQ9A 1YW9A 4ZYEA 5L3FA 2ZMEA 1U5TB 3QB0A 5ICGA 3WTTC 1ZRDA 4H5TA 2FQ3A 2ZNYA 2DK8A 3C7JA 4A61A 2GIVA 2OU2A 2VBXA 2HR3A 1GVJA 3GL1A 2QQAA 4HYEA 3CQYA 2PQ8A 5BOXA 5AZJB 5ADXA 2CG4A 3WG9A 1FLIA 4AM6A 2O61A 1BC7C 3GG4A 4MNUA 3KCCA 4JAXA 3L09A 4BRDA 4O8KA 5D6FA 1QHAA 1XGNA 3WTYC 4G8XA 3HRTA 3B02A 1U78A 3DV8A 2QQ9A 3FX3A 3ABUA 3RPUA 4FT8A 3ATUA 4U88A 4LB5A 3KLOA 3IWFA 4XSXF 3VGLA 3BDDA 3DJCA 3R61A 1PP7U 3NRVA 5CE3A 4P9UA 3KP4A 4A6DA 4WXDA 5LRRA 2EFNA 4WQ4C 1FBQA 3E6BA 2OBPA 1EH8A 3J81Z 3E3VA 1XD7A 3SK3A 3HRSA 5KPTA 3RSEA 2DPNA 4YFKF 2Q0UA 3FM3A 4EGZA 3QRFF 2UZKA 4PKGA 4LG0B 2RN7A 4EGYA 1KU2A 1OMIA 1V3FA 2D1VA 1GXQA 3GYHX 3A5LC 1B9NA 1XDSA 1TQIA 2PAVA 3H3NO 2Y48A 3UKRB 2QW9A 4KT5C 3P4IA 3TDUC 2P5VA 4K43A 5AQGA 4GXOA 5KQDA 3O2PE 3F21A 5L3CA 5D5UB 2YX4A 1Y0UA 4YG2F 5A2QK 5AQJA 1FZPB 1KAYA 1CF7B 1TUYA 3S41A 1VTNC 1QQIA 2GQQA 1SFUA 5EEGA 1R58A 5H6QA 3IKVA 5D5VB 1WSUA 3WGIA 4BRPA 1HLUA 3O8MA 4ZYHA 1U3EM 3FFKB 4FWNA 1HKTA 2PFBA 3LM9A 2QWWA 2OA4A 1XGMA 2FBIA 1SMTA 4M73A 5BR9A 2Z33A 1KU3A 4CD1A 4CYDA 5TKYA 3KEOA 1SD4A 4GYGA 2M45A 4JHDB 5K5QA 2KHOA 4FWLA 4JN4A 4H0TB 4FWQA 1S7OA 3U2RA 3IFRA 2DW4A 3F8FA 5HS8A 3O6BB 2VCPA 3DQVC 4G9YA 2YSRA 4R79A 1EQYA 3U8XA 2W84A 2QWNA 3QAHA 4A0YA 1BA0A 4N0BA 1GLLO 3BF1A 2CYYA 4JK1X 3RYRA 3SQNA 3DXKA 2MH9A 4ESBA 2V9VA 5HVQC 4FO0A 3JW4A 3P9CA 3S2WA 3UKUA 5CVVA 2HDCA 1QNTA 2Y0MA 1G99A 2L4AA 3CDHA 4XH5A 3CO6C 1AOYA 4CBXA 1K78A 3B73A 3HTSB 1KU9A 4NB5A 3JSPA 3WE2A 4FWRA 4BGBA 1U8RA 4EM1A 4IRGA 3ZEUA 4XRFA 1FC3A 3REOA 1ZRCA 3TOBA 2VWBA 1ZGAA 2IA2A 4H0OA 2XAGA 1TQMA 2CW0F 4BC2A 3LA3A 5F64A 3G25A 2QQBA 1W5SA 4OINF 3F8CA 4EM0B 1X9JA 4IPAA 1EH6A 1BC8C 4FPAA 3ELKA 3GZ6A 2D1HA 2PG4A 3WGGA 3HZ6A 4EIAA 1JHHA 3Q9SA 1SFEA 1USSA 4S05A 2ITMA 1QZZA 3SFZA 4H03B 3WTSC 3AY9A 3WXKA 4PCQA 3ZMTA 1TNSA 5FLXZ 2OANA 4FSVA 3VEVA 2V7ZA 3GUDA 5K1YA 1S6LA 3K0LA 4DHYA 3IMXA 2KJCA 2L01A 2VOPA 3C18A 2K02A 2FOKA 3TO6A 4U7BA 4OIRF 4B1VA 3FLCO 4H0EA 5FPNA 4RB3C 3F3XA 3I0TA 3PQJA 5L3DA 2V51B 1MWMA 1BG3A 4GYIA 2QWMA 3C7NB 4KIGA 5FO5A 1Y64A 3CJAA 3P7NA 1Q1HA 4H5NA 3G3ZA 3FM5A 5K5OA 3GFMA 3VEWA 1GLDG 2HEOA 4KN7X 4P55A 2BYVE 1GLBG 2AA4A 3K9TA 3C1DA 3VEZA 2P9LB 5CVIA 5D8LB 5F2RA 4ISFA 1MGTA 3BEXA 5DDGA 5F1RA 3M3ZA 3HSEA 1ZG5A 1DP7P 1MA9B 5IT9Z 2MA3A 1JGSA 2QENA 3CJ9A 5FPEA 3IL2A 2D2WA 3NQOA 4ENMA 3WQUA 5BS6A 3ML6A 3VGKA 1NGAA 3KP7A 3W6KB 1GLJO 3ZETA 2IRFG 2Z3YA 2ZXJA 2X0LA 3BPXA 3ZX3A 4ZYDA 1H9GA 1ZRFA 4QWQA 1C0FA 3VOVA 5DCMB 3F8NA 2ZNZA 3F6OA 4M6XA 3E5QA 4L0YB 4HF1A 3JAMK 5J8CA 5HOOA 4BC5A 2XKPA 4K2EA 5EEHA 4DNCA 4FX4A 2PI0A 1IW7F 1FX7A 4L9VA 4BR7A 2W85A 4N9HA 1XN7A 2UYTA 2E7WA 1NM1A 3EQLF 1YYVA 2VBWA 3F8BA 2QWOA 1YS7A 3WE3A 4K42A 1R22A 3EO3A 4JD2A 3GVAA 4IXAA 2P4WA 5HS7A 3I71A 2CQKA 4HF2A 2QVOA 2NAZA 5EVZA 3WT0A 2DBBA 4U0YA 3UB5A 3MCPA 4RWTA 4BC4A 2GELA 2P9KA 2R7FA 1R1VA 1YUWA 2Q1NA 4BR9A 3A5OC 5EX5A 3KP2A 2WC2A 4LFUA 2VC0A 3HTUA 1U5TA 4A5MA 2DPDA 2PLYA 2J5OA 4FWSA 2FMYA 3ZMDA 2YHWA 1RDWX 1MDMB 2VT3A 1GLFO 1T38A 1OKJA 3PFIA 3QBXA 5AZIB 3ZMZA 1DPUA 3WEEA 3TPQA 2ISYA 3M8FA 1L3LA 1BA1A 2HQNA 3ULEA 2GXGA 3K1NA 4HWIA 3MDQA 1QPMA 4BAYA 3GE1A 5KPRA 2FXUA 1HKGA 3HUGA 1R59O 2DO7A 3NEUA 4L9NA 4RGUA 2P9IB 3VENA 3FZLA 4H5RA 3MEXA 3ZQ7A 2ZCWA 2XAJA 4WF2A 2H27A 4M9SA 2HYGD 3J80Z 5ILVA 3LA2A 4UVBA 3LDNA 1B4AA 1BN5A 1HQCA 3D0SA 4WWCA 2IVNA 4OMYA 2DQLA 4BNCA 1J6ZA 3DPLC 3KETA 4OOIA 2ZWHA 3R9PA 2V6CA 1P6RA 2A6HF 3VODA 5BQTA 4CICA 3HTVA 4PGHA 3KZZA 1TW2A 4BRLA 5HLGA 1XC3A 2RDPA 5LEJA 5LGTA 2GEMA 2O3FA 5AQKA 5I9EB 1Z1DA 2XGXA 1JCGA 3BOQA 1OR7A 5H6RA 1FT9A 3DEUA 5JHUA 2BUPA 4M6YA 3CUQA 2A68F 1YW8A 2XAHA 3MZYA 5ILUA 2CH6A 4A0XA 1KAXA 3ABTA 2HYFA 3K2ZA 4RGXA 3O5BA 2GAUA 1QQMA 4QS9A 4CZGA 3COAC 1HBXG 2KKOA 1TW3A 2WV0A 1TYQB 2BEOA 2FNPA 1BU6O 4K41A 1KQ0A 2GA2A 2IVOA 4H0PA 3KZBA 3LAPA 1X3UA 1S3XA 5HLHA 4BGAA 2GWKA 3K69A 5F6FA 2ZGYA 4CJ7A 2L4MA 4MLEA 4CZFA 4P5OA 3F23A 3O3KA 3MZHA 1IN8A 4B09A 1NGHA 2EV0A 3M8EA 1R7JA 3V8KA 2UXNA 2FF3B 2FBHA 1S29A 4JHDA 2GWJA 1TBXA 1XGSA 3G73A 1I6XA 2STTA 5HDKA 4NQWA 5AQWA 2K7LA 3CUOA 4H0YB 1UCRA 2A41A 4IO8A 4KN4X 1XQSC 2IVPA 3CI5A 4HA8A 1G3YA 2V1XA 4FOIA 5FD5A 3FE1A 5ICCA 3HI0A 1ZG3A 4BRQA 1NGJA 3QU6A 5AQYA 1XUPO 1RZ4A 5LJWA 4FWMA 4BQZA 3FZMA 1O57A 1IN4A 4XSZF 1LOTB 2P9PA 2EFPA 2GWRA 4Q47A 1BWFO 5LGUA 4M9ZA 3TO7A 4KYWA 3E6MA 3A8YA 3VERA 2RC4A 3SJHA 3F72A 4LD5A 3EUHA 4LLLA 2A5XA 1HSJA 1G3WA 3HIFA 1FSEA 1IJJA 2D0PA 1KU7A 4A6EA 2HFHA 3GXOA 4AWXB 1E4GT 5H20A 4KNYA 2P7VB 4CHUA 2QYOA 1LDJA 2FSJA 4IRHA 3R60A 4ENJA 2R3SA 1XGOA 1H1VA 1SAZA 3H46O 2M8EA 1E17A 4CZMA 5JFRA 3GWZA 2L54A 2Q0RA 3BZ6A 3U9DA 3O1BA 1KQ8A 5E84A 3BROA 4O6JA 3R0AA 4ZZLA 3U1DA 1BI2A 5JLFA 2BV6A 3GFLA 4PKIA 3WXJA 1C0WA 3C0BA 3I58A 2CGJA 5L3EA 5HDNA 1HSTA 3FHZA 1WKMA 2FU4A 2VT2A 1I1GA 2YX7A 3MCZA 4B8XA 3D2EA 2ASMA 5CVUA 1P4XA 1YIOA 1ULYA 2UXXA 1HX1A 4IJAA 3RTRA 1DKGD 2E2NA 1J0RA 2H6BA 3VEOA 2HF4A 2ISZA 3CLOA 1DPRA 3HYIA 2KRFA 4G6QA 4BYYA 5AFUA 5KVRA 4ETSA 1QQNA 3C3WA 4KUMA 1ZREA 3LDQA 4WQ5A 2DT5A 1ZARA 4I0AA 4GNIA 3MN9A 5TJJA 4GY2B 4GGGA 4L9TA 3C7NA 2DK5A 2P6SA 3HOSA 3KZYA 4EVIA 1LQ1A 1KGSA 2HKXA 3VB2A 3QMLA 2G9WA 4A5NA 3V7CA 3BY6A 4RB2C 3L2CA 1G4DA 2K4BA 4HV5A 4BRNA 1GLCG 3AARA 2RGVA 1W7PB 2P9SA 1R5GA 2Q0OA 2NRHA 5JVTA 2E1NA 3IRRA 2Q97A 1SD5A 5ADXH 2E8AA 4HV6A 2P7CB 5AIPA 4CXFA 1T6CA 4CZIA 1O7LA 2H3GX 4AIJA 4D0PA 3EYIA 3LL3A 1BIAA 3T8RA 4I2OA 2Q2EA 4M71A 3RYPA 4I02A 1Q18A 5L3GA 1V4SA 5LEKA 4Y15A 3QICA 4IWVA 4LMYA 2MD5A 3SHFA 3JSOA 4BQAA 2P9UB 3OOPA 1PP8F 3ZN1A 3QFUA 1O7FA 4AM7A 1YTYA 3CUQC 3IDHA 4CO8A 3IKTA 3CJ1A 1BJAA 3LAJA 4QS7A 1A04A 3GF2A 4DQ2A 4DCHA 4P96A 1ZBSA 2GZWA 1OPCA 1BIBA 2OAZA 3JAMZ 3WTZA 3DWLA 5JI6A 3ECHA 1H0MA 5F0XA 2E20A 5DCMA 4EJTA 2F5FA 3HHGA 4AIHA 4KA4A 2XVCA 1BM9A 3HSRA 3I59B 3RDIA 3ZMUA 1ZLKA 2F2EA 4NO7A 4U7DA 5AIQA 3BPVA 1IXCA 4CD3A 4GCVA 2FF6A 3WTUC 3GEZA 3Q5FA 4EAHD 5ICFA 4BROA 1B9MA 2ZMEB 1QBJA 4AIKA 1DUXC 4HX8A 3E6CC 1WWXA 3LDLA 3FF5A 4FWKA 4AVPA 1B59A 3ERED 3HSFA 4CZEA 1FYKA 5IT3A 5DUKA 4PDKA 2PEXA 4I6MA 1FY7A 4KBOA 5HS9A 4FX0A 3BJAA 2QXLA 2CGLA 5K5RA 1EH7A 2DLLA 4QLCU 2QWQA 3VESA 2FLOA 2YPRA 2PBDA 3ZX0A 4Y17A 2A3ZA 3WU0A 4L18B 2NS0A 4WX9A 1ESVA 2IA1A 4IF4A 4ENNA 4MGRA 2HMPA 5FPMA 4L5IA 2Q8KA 2FA5A 1S7AA 2L3DA 3HRUA 1U2VB 1C0GA 2YHXA 4NB4A 1UHWA 1BDGA 1RIOH 4L3QA 3EKSA 4LLNA 2P8TA 2QM3A 5ERIA 5F1XA 5D4RA 1QO0D 2DFIA 2DQRA 1T2KA 1CGPA 2MLGA 3QU3A 3FZVA 3R6MA 5FGMA 4CZHA 2KIFA 3H1QA 3DPTA 2AS5F 4WXHA 1PDNC 1FBSA 2AP1A 1R23A 3HSCA 4BRHA 3RJPA 2E88A 2M1BA 3MN5A 2Z5UA 4M63C 4RAZA 5LY3A 2K86A 2H09A 2P9IA 2XUBA 1YVNA 4G6DA 4I01A 3BP8A 2JPBA 5EOYA 4O3MA 1LJ9A 2O0YA 4TV7A 3JTHA 1YS6A 2NLXA 3A0IX 4BHCA 5KPZA 3D2FA 1K8KA 4H0XB 3V8JA 3FZHA 2QM1A 3BUZB 1MJBA 1RFQA 1WRJA 1YW7A 3QFPA 2JPCA 1FP2A 3RI4A 5BREA 3TKYA 4WCGA 4IRIA 3FWEA 4DQ8A 1NGEA 2QWPA 3ENHA 2YU3A 1DDNA 1IN5A 4A0ZA 1JHFA 4WQ5C 4EHUA 4L0ZB 1MDUB 3WQTA 1LEBA 3IC7A 4IHTA 2PMUA 2K27A 2F9TA 2V1UA 3I64A 4MO4A 4BRKA 1S8NA 3VOEA 5FPDA 4U0WA 1ATSA 3WU1B 2E2QA 3LFKA 2HWVA 4ESFA 3DXKB 4ZH4F 1R1TA 3E97A 2HTSA 1XSVA 3HOTA 2PJPA 3UE5A 3UKUB 4CDGA 3GOIA 3I4PA 1K78B 2QBYA 2V52B 5LLQA 4KICA 2Q31A 2IA0A 3P9IA 2BGCA 2M30A 4OIQF 1FWZA 4PL7A 3VFZA 1KYWA 2A5YB 3BJ6A 2WTEA 3RIRA 5LHIA 1MZBA 4HX4A 4WK8F 3ZEUB 4RCHA 5TRDA 3GFIA 1ZG1A 4MEXF 2RKHA 1IN6A 4MTDA 4RGRA 4A2BA 5JMVA 2PMHA 2XASA 2PN6A 4G7ZF 1V4TA 5D5WB 3VPZA 1NHAA 4HQMA 4RTFD 2ZO4A 2KJBA 4OU0A 2HQRA 2E1YA 3T5XA 2MLKA 1ZGJA 1J2XA 5AQXA 2A07F 3GX4X 2YJFA 1LDKB 4JBAA 1NGFA 2NYXA 1GHCA 3EYYA 2YJEA 1J9IA 3W3DA 1BOAA 2ZJ2A 3TGNA 2YHYA 2A40A 2F5DA 4CBWA 4BR5A 4Z2YA 2L02A 4MLHA 2P9NB 2EA2A 1P92A 5HLIA 4HF0A 2V7YA 4HAMA 4FL9A 4OIOF 2IIRA 4FWPA 2AXLA 5DEQA 5LGNA 3LSTA 5AZJA 3CJ7A 2DU9A 1Z6TA 2K4JA 1KA8A 2COMA 2D0OA 5AR0A 1ATNA 3H3ZA 2VN2A 5KQ8A 3LA7A 2Q36A 1D8KA 1O3RA 4HBLA 2FSKA 2UWMA 1OYYA 1NMDA 2CO5A 2XKOA 4J8FA 4XEIA 2V1DA 4I0BA 5AONA 4HZFA 3ISPA 3PQKA 4PGGA 4G7OF 1AWCA 3F8MA 4UUVA 1ZXOA 5AQLA 1UFMA 2IT0A 1H9TA 4BRFA 1W4MA 1ZLJA 2EFOA 3H6EA 1BUPA 3KLNA 2I7NA 3N97A 1NGBA 2ZKZA 3F6VA 4LG0A 3IUCA 4RAYA 3VF2A 4XBFA 4O5VA 2F5CA 4WXCA 3RKXA 4LC9B 1MKMA 1CZAN 3VEXA 3KP5A 1ZH5A 1GLAG 1ZYRF 2E1ZA 4A62A 3UKRA 4MQ9F 2B0LA 4MHGA 4K25A 5A2QZ 3Q9VA 4BVOA 4HX7A 1FSHA 3IHUA 4BH9A 4A12A 2HGCA 1T44A 4EFHA 1JXSA 1HPMA 1CF7A 5BPDA 5IT9K 3QPHA 3R0JA 3L4IA 2XHKA 2STWA 4UV8A 4XLPF 1LEAA 4DB3A 5EXWA 1YG2A 2IW5A 5JR3A 2KIUA 4Y13A 4R8HA 4RB0A 4M7YA 4H0VB 1NGGA 4EJWA 2FE3A 2ASOA 1I27A 4EQQA 3ZPLA 2O03A 3TDZC 4BG9A 4HTLA 4KMFA 5BRFA 4B1ZA 4LLGF 4C23A 3WTVC 4MEYF 2LDUA 4BVPA 4I7HA 2CFXA 1JE8A 3K1PA 2A42A 3MN6A 4KDPA 1HXDA 3M1EA 4BR2A 2E2PA 2EFWA 3O4WA 1TLHB 3FXRA 5HDGA 2VXZA 5BRDA 3E5UA 2D4WA 5D5XB 1TQPA 3SXYA 3U9ZA 2GXBA 3JXUA 1Z05A 2ESNA 3K1MA 1IF1A 2JSCA 4PZJA 3I53A 5FFXA 3GO5A 3H3UA 4NHJA 4KMUX 1STZA 2OQGA 1G6NA 3ULQB 4JD2B 4HQEA 3U4LA 2ZGZA 5FD6A 2JT1A 1IG8A 2W40A 5E20A 1R1UA 1ATRA 1LNWA 2FXAA 5BPMA 3DXJF 3B8AX 5ELZA 1B6AA 3KEQA 1ON1A 2EK5A 2IPQX 1FNNA 3I59A 4HOBA 3SMPA 3DF8A 1TTYA 1ZAOA 2P9KB 1I1SA 1YLFA 1FPQA 5LJVA 4PL8A 3OHRA 2J4RA 2A61A 1I5ZA 3QBWA 1DGKN 4GO1A 3N4MA 2O6GE 4P9FA 4BR0A 1YXQA 2EJRA 2PBIA 1BBYA 5E17F 3WXLA 2G7HA 3CJNA 1IRGA 2GTDA 3WEEB 5LHGA 3D7EO 3JS6A 3DXMB 2MC3A 5E8IA 4FHTA 2GUPA 4IJNA 1XDUA 3ULEB 4WYBA 2IVMA 1HKBA 3QOPA 3H3OB 2HZTA 3GZ5A 5E1ZB 4ESJA 5AQIA 2JTVA 4E1JA 1OYIA 1RGIA 2O8XA 3D5LA 2ETHA 1B1BA 2W24A 2XROA 1DEJA 2HKOA 2XV4S 5AQTA 3FZFA 5CVJA 1U2VA 3M7GA 1U5TC 2ZBKA 2D1KA 5BPIA 4LB6B 3J80K 1XSDA 4G94A 1SD6A 2OZUA 2QWRA 2DTRA 3CIPA 3M1FA 3EKUA 1G3TA 2EV5A 2VC1A
chains in the Genus database with same CATH superfamily
1VQ6N 3CM6A 2F8SA 5FLVA 4NDLA 4LSLA 3PO2J 4FE7A 5B8HA 3FK6A 2EFQA 5IP6A 1T3VA 3OW2M 3OJSA 3OV8A 5EY4A 4DG1A 1JJ6C 4WCEL 1NGCA 3D6RA 4PY5A 2HBLA 3SJJA 3P38A 5E3NA 2P9LA 3CMMA 4OPHA 3AAQA 1F36A 4F55A 1TK8A 1ZC6A 4N4OB 3JRAA 1RI7A 2JMWA 4ENKA 1REVA 4IZ9A 4NCGA 2D0AA 1BQNA 1EWQA 1HW2A 2LK2A 1MWKA 1Y1WJ 4I98B 2M7AA 3CP2A 4DF8A 4CJ3A 4EEFG 2L2OA 1XCBA 3SZ2A 1YAGA 2ZSIB 4Q5SF 4NQWB 2RREA 4PSXA 4JS4A 2G7UA 1MBGA 2VYPA 4HUGA 1BI1A 4CHYA 5CLSA 4HW0A 1J5EK 3ABMH 2IP2A 5IWAK 2R7OA 1SL0A 1HR0K 3J7AO 4YDUA 4Q4ZF 6PAXA 4Y0WA 1T6SA 4G6TB 4LF5K 3U3YA 5E26A 1S5LC 4IEEA 1Y8QB 4CESA 4FWOA 4CF9A 1VSFA 1HLVA 1U2WA 4XH4A 2E7XA 4RS8A 4PK4A 4FYDA 5E1WA 3KVGA 1USTA 3NH1A 1RT7A 4YFXF 3F22A 5J4VA 3TAQA 5LRSA 3VQBA 2BXYA 1QGPA 2M5WA 1NJYA 2P9NA 2AQFA 3L2WA 1MDMA 3EDPA 1NWKA 3RSEB 3BF3A 3RSNA 1KRPA 1P4AA 3J81K 3QESA 1RBTA 2NZTA 3QIOA 4RBOA 1BW5A 4B1UB 4C1NK 4CZZA 3QQAA 1J5YA 4FM1A 4ISGA 3A02A 3J81O 1S1WA 4KH4A 2H94A 4B1YB 3G10A 3O9QA 1YT3A 2HNYA 2UXBK 1X1DA 4BG8A 4GDFA 4CCLA 1U47A 1G3SA 2P9SB 3FZKA 3MK6A 1T39A 4F3QA 1IXRC 1MMGA 2WUSA 2CSOA 2ASPA 3H0DA 1QHHD 1SV5A 4CJPA 4ID5A 1MD0A 3RKYA 2VB6A 2ME6A 3VWBA 3Q0VA 2LKSA 1SFXA 4Q0BA 1T0FC 5FLMJ 4UV9A 3R4KA 5C3EJ 5CJ9A 2PZSA 1XMOK 3AVGA 2HVRA 4YIFA 4Z4GA 1VQ4N 1HKCA 4H5WA 1BI0A 1P2FA 2GV9A 2JZYA 1FJLA 2RF2A 2VODA 3IAS2 1P7JA 4IOAF 3T8TA 4CZKA 3CCRN 2NNNA 2YUSA 5FKOA 3SZTA 3CHWA 3NGYA 1SD7A 1TNTA 1E3MA 2RNJA 3CQ8A 3SNNA 4KFBA 3M8SA 4WF9L 2F5EA 3KE2A 1L3VA 4ZYGA 4M3ZA 4AD9A 2ZJQL 3VPRA 4DYCA 5J4YA 3MX5A 3QP6A 2VE9A 2Q2RA 3P9KA 4B3TK 3PUBA 4RW8A 4BHPA 1ASWA 3KP6A 1SQKA 5H2FC 2ELHA 2EIKH 1X3ZB 4KIFA 5D6EA 2I10A 1D1BA 4O44A 1TUUA 4UXNA 1S9EA 4ELUA 4B1XB 3HM5A 1TL3A 2ICWG 5E3LA 1KXPA 1AHDP 3M6GA 2IS4A 2I7PA 3NCIA 5DD8A 3LQQA 1I3QJ 2FBVA 2Z1HA 3OYBA 2DDBA 3OYDA 2YKNA 4RW6A 1A35A 3MN7A 2OYQA 2O8DA 3TO9A 3V4GA 4F3OA 3IWZA 2HHSA 4CZLA 4ZZDA 3TQNA 3FXOA 3ZP5A 4HG2A 5LD2C 2BY3A 3H45C 4CF1A 1GV2A 3CCJI 3CFPA 3NVMA 2A6EF 4BRGA 3BTLA 2HSTA 1VQ9N 3VEYA 2FF4A 5BRHA 5BN9A 5I42A 3P5JA 1TWAJ 1WNSA 5DM7F 2Z99A 3HGGA 4BRMA 1HOMA 2E2JJ 5EZGA 3DLRA 3TBIA 2A05A 3LOCA 4L5EA 2YI1A 1NBWA 5FFZA 3FGUA 2F48A 4UHTA 1X1PA 1K9MO 3CCQN 1IAWA 4BY7J 1X3MA 1W7PD 3TAEA 4XICA 5L3BA 4IHWA 2C6YA 4FLTA 4BHBA 1F5TA 3HRMA 1A5WA 2VPRA 1X1CA 2A6AA 1X3NA 4AVZA 4Q48A 1JKQC 4PKHA 4L9JA 2I8DA 1SAXA 4JLHA 3L9FA 4XORA 1IXSB 1U0JA 3SYZA 1FBUA 1ZHFA 1RDUA 1SKSA 1YW9A 2E2HJ 4NYFA 5L3FA 3MX2A 1U5TB 1TK0A 5ICGA 2DFEA 3WTTC 2FQ3A 2ZNYA 2HBMA 2VG6A 1A6IA 2HHTA 1S6QA 1T8EA 5GAEP 5BOXA 4UUSB 5ADXA 2ZE2A 3CC4I 1FLIA 1WSEA 1BC7C 2VIXA 3WTYC 2BY0A 2L7MP 3C94A 3B02A 1U78A 3NARA 4KHWA 4A3GJ 4RAGA 4U88A 3KLOA 5M3MJ 2QK9A 3KP4A 1G8XA 1LAWA 1XX5A 3V4IA 5LRRA 4WQ4C 2EHGA 2LR8A 3E6BA 3CMEI 5FROA 2CJJA 3J81Z 2NRWA 5GIOA 3RPUD 4IFYA 3RSEA 2Q0UA 2KFZA 4EGZA 3QRFF 5E3OA 1OFCX 4EGYA 1TK5A 2QKLB 3GYHX 4K8XA 4X64K 3H3NO 3UKRB 2QW9A 4KT5C 3TDUC 2P5VA 1HYZA 3F21A 3M3YJ 5L3CA 5J2QA 3QNNA 5DM6L 1IDYA 1KAYA 1TUYA 1VTNC 2F4MB 1QVTA 1QQIA 4G12A 1YIJN 4KV8A 1I3AA 4ICLA 5EEGA 1R58A 2F4VK 1NU0A 4OPJA 4B3OA 4FLUA 1U3EM 1Z25A 1HKTA 2PFBA 2OA4A 2P5GA 2LRDA 2PYJA 1OCRH 1VRTA 1SD4A 4GYGA 3SUPA 2M45A 4DTRA 4B9LA 4IQJA 2L5QA 3DCFA 3KLEA 4W1UA 3A0BC 4OAZA 4J2EA 4R79A 1EQYA 2W84A 1WSHA 2CQXA 4DFKA 3FXKA 3RR7A 1M90O 3VQ5A 1X1AA 3OYLA 2V9VA 4JI8K 3JW4A 4PFPA 2M34A 3BR3A 5HRRA 1QNTA 2Y0MA 2L4AA 5KAFC 3LPUA 3B73A 1KU9A 4JKFA 4X62K 3AA4A 4BGBA 4A3KJ 4CJ4A 1XS9A 3ZEUA 4XRFA 2Z16A 2VWBA 3J7YJ 3HP6A 2F4OB 5DTDA 3CCSI 2QQBA 1ETYA 3AFHA 4CZCA 2LY9A 1EH6A 3HM9A 4RG8A 4EIAA 1JHHA 1ZK8A 4S05A 2W82A 4JI2K 3IG1A 3SFZA 4H03B 1C0MA 1IBKK 4FSVA 3CJTB 1RETA 1WFXA 4LY7A 4W5QA 4UB8C 3Q0WA 2ZMEC 4G9ZA 2V7ZA 5K1YA 3K0LA 4CGHA 4U7BA 4B1VA 5FPNA 2UXDK 2R7TA 3D1NI 3F3XA 1MWMA 1BG3A 4GYIA 4Y4RA 1WCMJ 5FO5A 1Y64A 1RNHA 3P7NA 3AO1A 4FTHA 3E0JB 4DTJA 4BXFA 2BYVE 3ISNC 3K9TA 3C1DA 3VEZA 2WAQN 2QKKA 2Q1ZB 5GINA 1MGTA 5IT9Z 2ZC2A 4WFNL 3OWTA 4KTWA 4BQNA 1I39A 2MA3A 4DU4A 1JGSA 5JVGL 5B66C 2CUJA 2QENA 3CJ9A 1RBRA 2LLKA 4CEAA 3WQUA 3AA3A 1ASVA 1JL1A 4H8KA 2E71A 4B08A 1GLJO 4BJTA 1NMNA 2CMPA 2X0LA 4ILJA 4KB1A 4QWQA 3VOVA 5DCMB 3MKLA 1C6VA 4L0YB 4HF1A 3RQ4A 3JAMK 5HOOA 4W97A 5EEHA 4JP0A 2DJNA 4RAFA 4L9VA 2W85A 3F5TA 3K4BA 3MKZA 1XHZA 1NM1A 4XLEA 1OLTA 2VBWA 3JAMO 3F8BA 2QWOA 2WADA 2X6OA 4QTRA 4LIVA 1KZHA 1VNDA 3DBHB 4JEPA 3I71A 2CQKA 2JLEA 4HF2A 5EVZA 3WT0A 3A0HC 4ZJZA 4XM3A 3TWHA 3W3CA 1NG7A 3O9RA 3UB5A 2X1EA 3H5AA 4E19A 3TR8A 2ZJPL 4BR9A 2Q1NA 4BWJA 3KP2A 2WC2A 2EIJH 1U5TA 4PJ0C 1FOXA 2G8IA 2FMYA 2YHWA 2QGUA 1GLFO 1T38A 2UXCK 3K7AJ 2BOLA 3ZMZA 3DTKA 2ISYA 4AM3A 1L3LA 1BA1A 1JLGA 4JKAA 4ZTJA 4M3DA 3OYGA 2IS1A 3MDQA 4BAYA 3GE1A 3CCVI 1HKGA 5K7ZA 2NUBA 3HUGA 3VA0A 1JTXA 4Z6YA 1ZBIA 3NEUA 3MEXA 2H27A 2HYGD 1RBSA 5ILVA 3LA2A 1UMQA 3O3HA 1B4AA 1BN5A 4BE0A 4IO9F 4A5BA 4BNCA 2DOFA 3DPLC 2OPPA 3R9PA 1YJWI 3VODA 1H89C 3FFIA 2FOWA 5HLGA 5LEJA 2O3FA 5AQKA 4JI4K 1LVKA 3LL7A 3DEUA 1TKDA 2X6NA 1X4PA 2A68F 2LFBA 4E7SA 4A0XA 1KAXA 3S3OA 2NXNB 4QS9A 3COAC 3HBLA 1HBXG 2KKOA 1KQ0A 4H0PA 3NHGA 3CCJN 2LREA 2X6SA 2ZGYA 4CJ7A 2L4MA 1P7IA 1W36D 2QQ8A 2M4GA 1IN8A 1HNVA 3V8KA 2FBHA 2JA8J 3PFYA 2GWJA 1TBXA 1XGSA 3G73A 4CH7A 1VFCA 5AQWA 3KLHA 2K7LA 1LWFA 4H0YB 1G15A 1JKHA 4HA8A 4DW6A 2EH3A 2V1XA 3FE1A 3BG7A 2DYSH 1RC9A 3SAFA 3LAKA 4BQZA 2Y1JA 3FZMA 1IN4A 1BWFO 5LGUA 2R93J 3E6MA 1T56A 3TW7A 3F72A 4CJTA 4CK3A 4AWXB 2NVUB 4KNYA 2UUAK 4O0IA 3OVNA 3R60A 4ENJA 2R3SA 1H1VA 3H46O 3CMYA 2AXTC 3C2GA 3GWZA 1KQ8A 2KTQA 5E84A 4O6JA 3JRGA 1W7AA 3QODA 4CJQA 4JK9A 3FHZA 4JOMA 3ZQCA 3RRGA 1H8AC 1UAXA 3D2EA 5HODA 5CY4A 1P4XA 1ULYA 1HX1A 4LH5A 4IJAA 3CC4N 2E2NA 1J0RA 1NTCA 3CLOA 3V9XA 5K14A 3C3WA 3GZNB 1WZ2A 4WQ5A 4I0AA 2HYJA 2GOXB 3PIPL 4GGGA 3BG5A 4L9TA 4JK7A 2EZKA 2Y9YA 3KZYA 1KGSA 3QMLA 2OZMA 2G9WA 3CMEN 4A5NA 3BT9A 4BRNA 2LMDA 2F96A 1VSHA 5JVTA 2Q97A 1SD5A 5ADXH 2XPUA 3CJRB 4GV6A 2P7CB 5AIPA 3P83D 3RWUA 4CXFA 3P1GA 3LL3A 4CEQA 2HHWA 4I02A 4NXMK 5L3GA 3QICA 4IWVA 3U21A 2BH1A 1OR7C 4BQAA 2R7SA 3OOPA 3ZN1A 2PJRA 4J2BA 2KLOA 3CUQC 3TP0A 4CO8A 3IKTA 3CJ1A 1GVDA 1A04A 4ZDPA 4DQ2A 4Z4EA 2L9NA 4P96A 3LSRA 1ZBSA 3JAMZ 2OAZA 5C0YA 5F0XA 4A3MJ 5DCMA 2E20A 4N41A 2XVCA 3I59B 1JXEA 5AIQA 1VQPN 4FJ9A 2G8HA 3A1YA 3ASMA 3RKQA 3GEZA 3Q5FA 4DR4K 3MKWB 2ZMEB 1N77A 4CIEA 3I9V2 4OKKA 1DLOA 4AVPA 1B59A 1AU7A 2PEXA 1RTHA 2M0CA 1BIZA 3WHBA 5K5RA 1ZGWA 3AVMA 4QLCU 1N6QA 5FJ8J 4CEEA 4Y17A 1AA7A 1FOYA 3WU0A 3ZSYA 3K0SA 1ESVA 3HZJA 3UR3C 4ENNA 2HMPA 2Q8KA 2L3DA 3SJMA 1U2VB 4NB4A 3SUOA 2WAFA 3CDLA 4DOZA 1U9NA 3P39A 2M9HA 2V9KA 3CCSN 3Q7CA 2HVQA 5ERIA 5F1XA 5D4RA 2DQRA 1DU6A 3FZVA 3R6MA 2AS5F 5J40A 5CYQA 3RJPA 1WHUA 3MMYB 2HQ5A 1FJGK 4LFBK 4G6DA 1IC8A 3BP8A 2ELJA 4O3MA 3M8QA 1ITYA 3FXLA 4BHCA 3D2FA 4H0XB 4FJGA 2QM1A 1RFQA 2I5JA 2DMTA 4FJXA 2OC6A 3RI4A 5BREA 3PM1A 3AVJA 1VI0A 3THWB 1KC8O 4I9LA 4BEHA 2E5LK 4L0ZB 2IOCA 4XLFA 3VQCA 4LF8K 1YTAA 5C2DA 1C0UA 3DBRB 2VLAA 3WU1B 1ATSA 3L2RA 1QSSA 4ESFA 3DXKB 4YIRX 2A5WA 2B5JA 3HOTA 1BI4B 3UE5A 3N4QA 3CG7A 1IKWA 4BKXA 5F1JA 2Q31A 2BGCA 5KRTA 4FZYA 4PL7A 5M1KA 1MBKA 4E7ZA 4RCHA 5M5WJ 4C9YA 1QRYA 3GFIA 3OIQA 1ZG1A 1I94K 4D9JA 2X1CA 1Y0NA 2WA0A 2BGGA 3T1AA 4KO0A 4RTFD 2KJBA 3T5XA 2MLKA 1ZGJA 1KD1O 3CPWM 4JBAA 4OX9K 3EYYA 1YVUA 1BOAA 3TGNA 1ETVA 1X2NA 3CCLI 4CBWA 4XOTA 4BR5A 2L02A 5HLIA 2V7YA 4FJJA 4M3GA 5LGNA 1G59A 5AZJA 2H1LA 1EKEA 2K4JA 1KA8A 1S6PA 1QHGA 4HNTA 5HRPA 4HBLA 2UWMA 4CIFA 1NMDA 2CO5A 2XKOA 2ECBA 4I0BA 2KZVA 1QZEA 1AWCA 2X74A 1S72I 2IAJA 2IT0A 3A03A 1W4MA 1L3UA 4JI6K 2O8CB 3HOYJ 4CGFA 3N97A 1IKXA 1LV5A 3F6VA 3MEEA 4LG0A 1NK4A 3THYB 1WPKA 4XBFA 4O5VA 3ZT1A 4WXCA 1YX3A 3S1NJ 1N75A 3KP5A 2KZZA 4Z4HA 1DGRM 3CCVN 1JLBA 1NKEA 4RW7A 4BH9A 2HGCA 2W6LA 5KAIC 3QPHA 2WONA 2G8VA 2STWA 1RCHA 4DB3A 3AO3A 1HNIA 1YJWN 4RB0A 4M7YA 4H0VB 2ASOA 3EY1A 3ZPLA 3EUKL 3SEZA 4KMFA 3ZQFA 4DTNA 4B1ZA 3M8JA 1VHXA 4C23A 1OVYA 4CECA 3WTVC 4MEYF 3K1PA 2A42A 1HXDA 5FKLA 2E2PA 2COBA 4BBSJ 3SXYA 2XF7A 3I3LA 2GXBA 1Z05A 2JUCA 4KMUX 2D5RA 2WC9A 4FLWA 4EZ6A 3TTCA 4DS4A 4JD2B 2VGMA 4JS5A 2ZGZA 5FD6A 5BPMA 1EA3A 2XPVA 2EK5A 2IAIA 3I59A 1JTYA 5FKNA 4PHTX 1WJBA 1YLFA 3SBGA 3HDDA 2LH9A 3TARA 1FPQA 2DDAA 2ZJQF 3OHRA 2A61A 1I5ZA 3QBWA 4B3MK 4GO1A 3BR1A 3WNFA 5E17F 5GAEJ 1IRGA 3WEEB 5E8IA 1RR7A 1XDUA 3ULEB 2DTUA 4WYBA 2BE2A 3S32A 1DP3A 4A3BJ 2CRGA 2RHKA 4ESJA 5AQIA 2JTVA 2R7QA 2RAEA 2HKOA 1U2VA 2O8FB 3LAMA 3QYEA 1WGXA 4LB6B 3J80K 1XSDA 4BU2A 1SD6A 4F92B 3M1FA 2O8EB 2VC1A 5C24A 3CJBA 2EBIA 1RUNA 4AHCA 3J80O 5E1XA 3CUQB 4HDVA 2BY2A 3PV8A 3M4OJ 3L0QA 4IHVA 3OYMA 1S7EA 1E3HA 1ACIA 4JQFA 1BL0A 3NH2A 1RNLA 2PFUA 3BQZA 3TSUA 3J7ZO 5AQHA 1XTAA 3FKJA 3TOAA 3H36A 1WBDA 5ICEA 1KCFA 4Z4FA 3LP1A 2L9VA 4CCHA 2VBYA 4FISA 1R71A 2GBYA 1Z7UA 2EWNA 3E6DA 2M8GX 4CA0A 1O3TA 1E3OC 3QDKA 1HKSA 3DFGA 4HDUA 2R7DA 3BG3A 1U6GA 2NRAC 1XSXA 4YOTA 3A5NC 4CI6A 3E7LA 2R5YB 4F7ZA 3K5OA 3MECA 3SQ1A 2LY1A 5AQZA 4BRIA 3FR0A 3V8LA 4LK1F 3G4SI 1YTUA 3DYAA 2YNGA 5GADP 1N8RO 3EN9A 2R7WA 1OCOH 2P9PB 1VSLA 5E79C 2DT7B 1FTZA 4ON0A 3CC2I 5D3GA 3S15J 4KTZA 3HPOA 1H88C 1VSDA 2QXFA 2XRNA 5JLXA 4I09A 3PO3J 5LHHA 1S22A 4LF4K 3QP5A 4OGEA 3LWFA 4XRSA 4JKGB 4O55A 4LD0A 1Z91A 3A4CA 4CGDA 2OTLI 2JSPA 3J8AA 1C1AA 4LH4A 1F9NA 2QKMB 5M1OA 3HSTB 2LBFB 1DTQA 1VQ5I 1TV6A 2BBYA 3K6GA 3HM8A 5AQSA 4M72A 1O3SA 1TC3C 3LWMA 5LBQA 2WOMA 1BL3A 2W25A 5AZIA 2OTJI 2WWYA 3LDOA 3FXUA 3DRSA 5C42A 1T98A 1D9FA 1RDAA 3OL3A 2DXIA 1XCVA 4XNFA 2LKPA 3RZOJ 2NRTA 5AQRA 4L5JA 4B9NA 1W0UA 2VKHA 5FB2A 2W57A 1WJDA 2M7BA 5E18F 3MFKA 1S1TA 2ID3A 1TP4A 2LSNA 3U9GA 5IYBJ 4NC6A 2O8BA 1SZ2A 3OYHA 3C6TA 3ZQQA 1MMSA 5DM6F 1WSGA 1IV0A 2OZSA 1FYMA 1JUMA 4LJZF 3EETA 4N47A 3ZX2A 5EGOA 2BVLA 1EO1A 2DMNA 2A1RA 1V5EA 4AQYK 1T6DA 2GUIA 2HOAA 2VBZA 2P5KA 1Q86O 3KYCB 1U8BA 3I33A 2CWEA 3O80A 2YV0X 4PJNA 4ISEA 4O5FA 2DFFA 5ILSA 2VONA 1BOTO 5KK1A 3ZSQA 1ZELA 3LZIA 2WBMA 2V79A 4II2A 4M7XA 4YFNF 4S04A 2ACJA 2HOSA 2YNFA 3E01A 2O4GA 5HLTA 4YHHK 2HDDA 5DUIA 1SVLA 2HI3A 3WGHA 2FRHA 5HRSA 2XAQA 1F1ZA 3QO9A 2FNAA 3HHHA 2HB5A 2HS5A 4CZJA 3BTCA 4BXUA 4AILC 4BJ5C 2GA1A 2R0QC 3ZMSA 4YDUC 3E5XA 3SV3A 2FBKA 1NK2P 3CTAA 1ENHA 5GAGJ 4H5VA 3G0ZA 4ILGB 3ATVA 3FXQA 4HEA2 4GVEA 5AQPA 2LF8A 4OO1J 2LSOA 4FVMA 2DYRH 1B92A 3NVKA 3ZT0A 3L7WA 1K6OA 1Z26A 1IBLK 2IJLA 4E70A 3CO7C 3KHYA 3MAJA 2E1CA 1MJ9A 2ADUA 4CBUA 3CCLN 1D1CA 2CGKA 2KFNA 5ED4A 3NFAA 5C2FA 2JRTA 1YO5C 2O8FA 3PIOL 1T8IA 2L7KA 4N4NB 1VQLI 3E66A 1WI9A 1NLVA 1FYLA 2XY5A 2PY5A 4AIDA 3VEPA 4OKEA 3DTEA 4MTEA 5AQUA 2KRCA 1S72N 1Z6RA 2KIMA 4HLXA 3J7AY 2XRLA 1HW5A 3EL2A 4CHPA 4J2AA 1CXQA 2HXIA 1N34K 1W7PA 4YIIA 4B8AB 4CCKA 4Q5VA 3F73A 3TMOA 3I54A 5BPNA 1BO5O 3L00A 1BJZA 4DZJA 5JVGF 1TAQA 2X9DA 2OCCH 2KLAA 1XG1A 4UNOA 3KP3A 2QSGX 1EV7A 4ABZA 1D8JA 4UVCA 1WUAA 2K9NA 3DAWA 1OKRA 1VQON 4BR4A 2HMIA 3HB9A 3S17J 3KD1E 2R7RA 1ETXA 4JNEA 2G8KA 2HF3A 3OIOA 5DYMA 3EPZA 3NMUA 3WODF 2VQLA 4ZYEA 4XN0A 3QB0A 1ZRDA 1KVBA 2DK8A 3C7JA 1RPWA 2VBXA 2OU2A 1GVJA 3HPGA 4HYEA 2PQ8A 3WG9A 1T08B 2ZJPF 3MEDA 4MFDA 2O61A 3GG4A 4MNUA 3KCCA 4D7NA 4JAXA 1NK3P 4HTUA 4BDPA 5D6FA 1QHAA 1XGNA 2XF5A 4CGJA 3RPUA 3GTLJ 4DLGA 4I6ZA 1AKHA 1VQ6I 4B43A 3BDDA 1OISA 1IBMK 4B9SA 4FLVA 2EFNA 2EIMH 1MMNA 1OJLA 1XD7A 5KPTA 1JJ2M 2UZKA 2N8GA 3I4NJ 3QPSA 1GXQA 1SVMA 1TQIA 3P4IA 1L3SA 3O2PE 3SV4A 4BWMA 3RCOA 3VSKA 1Y0UA 2CV0A 5A2QK 1FZPB 1CF7B 1WBBA 3CF2A 2GQQA 3K9KA 1OCZH 4KT6A 3VYTB 3CF5L 4DR3K 5A2QO 1VAZA 3HOZJ 3ZT4A 3NWTA 3FFKB 1Z21A 2QWWA 3ONQA 1XGMA 2Z33A 4CD1A 5TKYA 1Y39A 3RQIA 2KHOA 3CQZJ 4IDKA 3CCYA 2MD0A 4FWQA 1R4MB 2VCPA 1OVQA 4G9YA 2HBKA 4DQIA 3U8XA 3VDXA 3QAHA 4A0YA 3QETA 4N0BA 4M3TA 1NH3A 4UUTA 5JVHL 3SQNA 4FO0A 1D0XA 1KVCA 2A1SA 1V55H 4F3TA 3LWLA 1SVOA 4NB5A 3JSPA 3WE2A 2V6EA 3HK2A 4FWRA 3CXCM 1U8RA 3IKMA 4IRGA 1FC3A 3REOA 3M8RA 2XAGA 1XPXA 3UKGA 3LSKA 5TGTA 4PJJA 1HNWK 4BC2A 1MBEA 3LA3A 3JYTA 4AU7A 1W5SA 2I5UA 4FJ7A 4DQSA 2ZFUA 1EETA 1X9JA 4IPAA 3KYLA 3K2PA 3G4SN 4FPAA 2JQ7A 1RBVA 1O13A 4PUOA 3SYTA 2PG4A 1USSA 3BDPA 2E1OA 2BDPA 3CC2N 3WTSC 3AY9A 3WXKA 4PCQA 2KIQA 1ZQ3P 2OANA 2JRMA 2DA6A 1X3WB 5FKMA 4DHYA 2XB5A 2YKMA 2KJCA 3G1OA 1JLQA 1QQCA 1T03A 4DTUA 2VQCA 2MG4A 2OTLN 1TWFJ 2K9QA 3CFOA 1HMVA 2BW3A 3MAQA 4EZ9A 1VQ5N 1RDCA 3WNGA 4DV4K 5IOZA 3CJAA 1Q1HA 2ZXWH 3GFMA 4MFEA 3K57A 3VEWA 1ZKGA 2OTJN 1MMDA 4JX5A 3TP3A 2E36A 2AA4A 3VQEA 2P9LB 3PIPF 1KVAA 3BEXA 4YORA 5F1RA 2WY8Q 2W42A 3HSEA 2QI2A 3GTMJ 3TAMA 2Q2EB 1C0TA 3LSIA 2OPQA 1M1KO 4C8LA 3IL2A 4CEFA 4ENMA 5BS6A 3VGKA 1JUPA 1NGAA 1FMVA 2IRFG 4L8RB 4IFEA 2R7YA 4CJVA 2B9SA 1C0FA 3HJFA 2ZNZA 3F6OA 1U4BA 2PI0A 1FX7A 4BR7A 3VN5A 1YYVA 1YJNN 1YS7A 3PUFA 3K5LA 4HPQA 4CFBA 4IXAA 2P4WA 3ZSOA 4DF4A 2QVOA 2HU9A 3DWLE 4U0YA 2LP0A 2K9SA 2Q3SA 4BC4A 2R5ZA 1KLNA 2P9KA 3K58A 2CW7A 3QEVA 1YUWA 5E3MA 3A5OC 2VC0A 2YU9J 2DODA 2J5OA 3AVKA 1L5UA 1RDWX 1MDMB 2VT3A 4DSFA 3HOXJ 3M8FA 3K1NA 1QPMA 1R59O 2DO7A 1IJWC 3H9QA 3VENA 2QSFX 2XAJA 4CF0A 3K10A 4UVBA 3GTKJ 4WWCA 4OMYA 2DQLA 2ZWHA 1TL1A 4GRIA 3TTFA 2V6CA 4FJ5A 4PGHA 3AKZA 4BRLA 1CLQA 3LSGA 5I9EB 2XGXA 3DRRA 3BOQA 5B5EC 1FT9A 1NJXA 4E3SA 1GV5A 3B6OA 4B9TA 2EQRA 3ABTA 2HYFA 2CW8A 4AF1A 1QQMA 1X58A 2BEOA 2GA2A 2IVOA 4DTOA 3O9SA 4DV5K 1VQLN 5HLHA 2XY8A 3ZGKA 4P5OA 4E0DA 3MZHA 1NGHA 1R7JA 2WY7Q 1BGXT 2UXNA 2FF3B 1NOZA 2JVGA 2OA8A 3BTIA 2IS2A 5HDKA 2HPIA 5TISC 2A41A 4IO8A 1XQSC 3CI5A 2RKIA 3AVAA 2KZGA 4KITB 2B6AA 2K9LA 1ZG3A 1XC9A 1NGJA 2YS9A 3QU6A 5AQYA 2G8WA 2VJ5A 1K73O 1LOTB 3WNEA 3K70D 3OIPA 3TO7A 4KYWA 4LD5A 1S5JA 3EUHA 1HSJA 3HIFA 1FSEA 3I56I 5H20A 1IKVA 2P7VB 3GCMA 1VQ8I 5F0HA 2QYOA 1XGOA 2M8EA 4M3EA 4V19S 1QU3A 4Z0UA 5JFRA 1FKOA 2Y69H 3BROA 3R0AA 3AGRA 3DM2A 3GFLA 2VQEK 4PKIA 1JGGA 1QHTA 3I58A 3NF8A 2CGJA 3M5RA 3AL0C 5H1SQ 2FU4A 2JA6J 4C1NI 2KZMA 1W0TA 4M3WA 2O8DB 2UXXA 2H6BA 3VEOA 2HF4A 2ISZA 3HYIA 1DQUA 4G6QA 4BYYA 1QQNA 2DT5A 3G71N 1X4OA 5TJJA 4UQGA 4CJSA 2DK5A 1R0AA 2HKXA 1LFPA 1LAVA 3V7CA 3BY6A 1G4DA 2K4BA 4HV5A 2UUCK 1GLCG 3AARA 4FQGA 4Y7NJ 3IRRA 4NBQA 4DIQA 2E8AA 1K4SA 1BIAA 4A3IJ 4I2OA 2Q2EA 2IDOA 4CCOA 2VQGA 2ETJA 1FKPA 1PP8F 1IGNA 3QFUA 3KK7A 3IDHA 4NUBA 3KLFA 3LAJA 1EX4A 4QS7A 5C25A 2WFBA 1OPCA 4CK1A 1JI8A 4HCBA 3DWLA 1C1BA 1H0MA 3PL8A 2F5FA 3HHGA 1CZ9A 2LC2A 4NO7A 1IXCA 1DTTA 4CD3A 3UIQA 2FF6A 4JYKA 5GADJ 4BE1A 4AIKA 2ITGA 1JJ8C 1WWXA 3SUNA 1D1AA 3FF5A 2RE2A 4XLAA 1RTDA 1BR1A 5M5XJ 4JI1K 1BHLA 1TZLA 4I6MA 1FY7A 5HS9A 3LMMA 2QWQA 4I76A 2YPRA 2PBDA 3A01B 3I0SA 2QCOA 4BUPA 2NS0A 1QSYA 2IA1A 4MGRA 1XMQK 2FA5A 1TVRA 2HHXA 1C0GA 2YHXA 5IY5H 4DV1K 3H0GJ 1RIOH 4P1WA 3CCUI 3EKSA 4LLNA 2Y30A 2HBJA 4CFAA 3DLLL 2DFIA 2NVQJ 1T2KA 2MLGA 4HSTA 4A69C 2W6KA 4DSLA 3NAUA 2AP1A 3KLGA 4E1NA 4BRHA 3HL8A 4MDAA 4GW6A 4DJAA 3MN5A 2Z5UA 4M63C 5GAHJ 4RAZA 4I7FA 1YVNA 1MSEC 4I01A 3C6UA 4O4GA 5EOYA 4TV7A 3AA5X 3JTHA 1YS6A 3R1XA 4FW2A 2KQRA 1K8KA 1NG6A 3BUZB 1WI3A 2UUZA 1JKRC 2K9MA 4XRSG 1YOVB 3TKYA 1XNQK 1DDNA 4W5NA 4A0ZA 3ZSWA 2MGQA 4WQ5C 4UY8O 3KYDB 4EHUA 2BY1A 1MDUB 1LEBA 2L7ZA 5E41A 2V1UA 3I64A 4MO4A 4NYNA 4BRKA 1S8NA 3RZDJ 2E2QA 3OL4A 3LFKA 3CJQB 1VRUA 1XSVA 3MXMA 4CW7B 1NJIO 5IYDJ 2QSHX 4RW4A 2QBYA 1S1VA 2V52B 5F04A 4NLCA 2YX6A 2X1DA 2IA0A 2M30A 4OIQF 1WAJA 3QLHA 5CHIA 3HVTA 4HX4A 4DTPA 3AVHA 3ZEUB 5TRDA 3DLGA 4RGRA 1NK5A 3Q3SA 4A2BA 5JMVA 3BZCA 3U6FA 1V4TA 5D5WB 3RMBA 3VPZA 1WH5A 5J1UA 4OU0A 1LDKB 2K85A 1NGFA 4CJKA 3LP3A 2VWJA 1S1UA 2ZJ2A 4YOVA 3KK3A 2GM4A 2A40A 2F5DA 4Z2YA 2E5NA 2EA2A 4MLOA 4B9UA 4HAMA 2ZB9A 4H4OA 2Y1IA 1A5JA 1X9MA 1X19A 1X1BA 3OYIA 5AR0A 3CC7I 3JRHA 1VQMI 3N4PA 2Q36A 3BY5A 1MH4A 2FSKA 2P81A 2V1DA 2OJED 2WB1N 5AONA 3ISPA 4PGGA 4H4KC 5AQLA 1UFMA 1ZLJA 1IO2A 2JWKA 2P51A 3H6EA 3KLNA 4A3DJ 1PUFA 3ZQLA 2KMUA 4M3FA 5EU7A 4RAYA 4DR2K 4CCJA 4YELA 3OYFA 4XRMA 1ZH5A 2CQ7A 3MWPA 1MBHA 1GOBA 4BBRJ 4XKWA 2Z1GA 4BVOA 1FSHA 3IHUA 4DSIA 3H5NA 4EFHA 1HPMA 5IT9K 1T95A 3R0JA 3L4IA 1TWCJ 1RT2A 2XHKA 3PY8A 3W2AA 1C1CA 5DK5A 1MIJA 3FK7A 4R8HA 1JT0A 1NGGA 1I27A 4EQQA 5IT9O 2O03A 3TDZC 4KKOA 5BRFA 4W5OA 2LDUA 4S0HB 4I7HA 2CFXA 2DMQA 3CM5A 3MN6A 2H1KA 2CQNA 4E7LA 4BR2A 3V9SA 1POGA 5HDGA 5D5XB 4F52A 1OH8A 2ESNA 3EE8A 2JSCA 3I53A 5HNHA 2UU9K 4DV6K 4F2SA 3D5RC 4D7MA 4A59A 2OQGA 3O4NA 4BDYA 4FZXC 3AA2A 4HQEA 3U4LA 2IBDA 1UELB 4KRFA 1R1UA 2FXAA 3DXJF 3B8AX 3CCMI 1B6AA 3KEQA 1UZCA 3ZT3A 3SMPA 3AL0B 1FOWA 1HNZK 2EILH 4O5BA 2GIZA 1Q9YA 2EX3A 4PL8A 3PO5A 2E2IJ 2R4GA 3N4MA 3DKXA 4FCYA 3HVRA 4DQPA 4AHSA 4JKEA 1Y8RB 1BBYA 3WXLA 2G7HA 2F6CA 3TAPA 2K3FA 3D7EO 4B48A 1E3PA 4IJNA 5F0CA 4M41A 4XQFA 3QYBA 3A01A 3CZ6A 3TSQA 3H3OB 2HZTA 1WSFA 3HUGB 3B6AA 1B1BA 5GIPA 3I56N 3FZFA 3TTDA 4CJUA 3M7GA 2ZBKA 3P31A 3WNHA 4AYBN 1VQ8N 2B4JA 4G94A 4AHRA 4F4KA 3EKUA 2EV5A 3J7AP 2LVSA 2Z1JA 3SZPA 4JK8A 3DLBA 3T1BA 4CE9A 3PIOF 2MH2A 4N9IA 2NNYA 3GBTA 4IDHA 4ZYAA 1WQ2A 2X6YA 3G2BA 1J75A 2W41A 1VQ7I 5LFAA 4ELTA 2HTJA 1CXUA 2RVCA 3SLCA 3CETA 3C65A 3CJCA 1MW7A 3S93A 5K7HA 2J5PA 2QZ8A 3VETA 4DR7K 1KYZA 2BHYA 4DBQA 1D0YA 1SFOJ 4EJOA 4B3XA 3OOUA 1R9TJ 1VQPI 5E8GA 4B9QA 2XPWA 2DA7A 2LYCA 2KRHA 3O6WA 1K7AA 3Q0UA 5J6XA 2FUG2 4EJVA 3PNYA 4Y3OA 4OIPF 5BPLA 4C8KA 3HG9A 1O1WA 3S3MA 3VQ4A 2EB7A 3J7YP 2HNZA 5F08A 4OMZA 4A2UA 5EZHA 5DV5A 2KW4A 4NCAA 1LFBA 1DT9A 2E6LA 2XO7A 2LF7A 3ZMVA 2A6TA 1LKXA 2CUZA 3JSMA 3GFJA 5AQQA 4CFDA 4U0VA 1KTQA 2HXOA 2QUFA 4GV3A 4BDZA 4C8OA 3CLQA 1B72B 2E34A 1ON2A 1QQOA 4X66K 4I2PA 4XLCA 4PA1A 2JA7J 5B3SH 1LFUP 4MQVA 1Z9CA 3ZSVA 3MXJA 3V1QA 2DPUA 2QTDA 2LNBA 1U9OA 2E2OA 1UB9A 3FHNA 3U3GA 3WUHA 4CIGA 4E4HA 3D2EB 4EMSA 1HJOA 4IG0A 1E4FT 3LQRA 1YFHA 3ZXSA 3BWGA 3WXIA 4YNQA 3TEDA 2JWLA 1IN7A 3H3VK 3OS1A 1EWRA 4DQRA 5DD4A 2DOEA 2UV1A 4DS5A 4ASNA 1R5HA 3CCUN 5CYVA 2BE5F 2TDXA 1O3QA 4D5FA 3I8BA 2TRTA 2XIGA 4X0GA 2HPMA 3V9UA 1E2XA 1SC7A 1RUOA 4EP4A 2KDZA 1FXXA 1B9FA 3LM2A 4M3UA 3O3FA 3CF5F 4QS8A 1TYQA 4A3FJ 2BHZA 1XMKA 2PJRB 3O9UA 3EZ5A 3AVCA 3RMAA 2BANA 2IGNA 3DKWA 1RDDA 2ZSHB 5JICA 2FEZA 3K4CA 3A5MC 2O5RA 5KTQA 5HBMA 1ZR4A 3BR0A 1IG9A 3I5UA 2DI3A 4E7KA 1ONVA 1GLNA 2JGUA 4BQLA 2DY4A 4A2AA 1J7KA 1V5GA 3F9MA 5KI6A 1LVAA 2DAOA 2ME0A 3LSPA 3FDYA 4XLNF 1ASUA 2XSDC 3AVIA 3MQ0A 2DA4A 2EV6A 4Y1CA 3AAFA 4IHSA 3EYZA 1SMYF 3KTQA 4A3JJ 2DMPA 2KFDA 4BY9C 2Z9OA 2OQRA 4F93B 2VJJA 4LF7K 1XB4A 4FXDA 1IRZA 5DMRA 2FSWA 3ZT2A 1JT6A 3R6SA 1U6ZA 3KKSA 1QE1A 3SDGA 2ZFWA 1TKTA 3N05A 4DU1A 2L0KA 3BTJA 1F43A 3PX0A 3AAPA 4XH1A 1L0OC 3SMSA 3RKWA 1F21A 3E1SA 5LL6Z 2ELKA 3MD2A 3D2FB 3CC7N 4QCLA 5GTIC 1VQMN 3JRIA 4E1MA 5IYCJ 3SZGA 2PMZN 1HF0A 2X6WA 1WN7A 4FM2A 1S9HA 5FDLA 3L3VA 4FPBA 4N5SA 4BEHB 1J59A 2CGPA 3JTGA 2E35A 3ZETB 1IUYA 2RPIA 3LANA 3S1QJ 3S2HJ 3GLXA 1K79A 3ENOA 1WOQA 3G1MA 1IZ1A 3FMSA 4B4CA 2EZIA 1U49A 1D3YA 4M9XA 5KGWA 3IS9A 2P9UA 3TU5A 5D4SA 2DA3A 1QS4A 2WB1A 3OYAA 1LDDA 2QLZA 4Z94A 2VOOA 3O1WA 1FOKA 2VE8A 4CCMA 4LK0F 1QPIA 4G7HF 1YQAA 2Y0SN 3V7RA 4B1WB 2OZ6A 2JN6A 3ZN0A 3MMVA 1KQ9A 3VSLA 4NCBA 1IUFA 2XC7A 4H5TA 4FJLA 1BR2A 4II3A 3JR9A 1MBFA 3DOKA 2M0MA 5CZ2A 1WJAA 2HR3A 1KONA 3HT3A 5AZJB 2CG4A 3QERA 3CCMN 4M3XA 4BRDA 1T05A 4RDUA 1B72A 3HRTA 3DV8A 2QQ9A 1UWBA 4CFCA 3DTIA 4LB5A 3IWFA 1Y6IA 4XSXF 3R61A 5CE3A 4P9UA 4A6DA 1IH7A 4AC0A 1WSIA 1FBQA 4RLQA 1NK9A 3SK3A 4C30A 4PKGA 4AHVA 4CGGA 4LG0B 1KU2A 4F91B 1OMIA 1V3FA 2D1VA 3DEWA 1XDSA 3T3FA 2PAVA 2OUMA 2IC3A 3H35A 4UB6C 4GXOA 5KQDA 4DLEA 2X85A 3BZKA 5AQJA 4HVJA 3D45A 2JWTA 3KK2A 3IKVA 5D5VB 1WSUA 3WGIA 3WG7H 4B3RK 3O8MA 4ZYHA 4BACA 1LW0A 3LM9A 3OA9A 2FBIA 1SMTA 4XKCA 4M73A 5BR9A 4CYDA 2HQAA 3KEOA 3S16J 4FWLA 4JN4A 3IFRA 4LFCK 4KH5A 2QWNA 5F0FA 2XY6A 1TWGJ 2BVMA 4XOPA 1BA0A 1GLLO 1VQ7N 3BF1A 4JK1X 3FXMA 4ESBA 4X65K 3P9CA 3S2WA 3UKUA 4DYRA 4CGIA 5CVVA 4AYBA 2KPMA 2OPRA 2HDCA 3CDHA 3CO6C 1AOYA 1K78A 1KLMA 2EINH 5T7BA 3ASNH 4RW9A 3C6HA 3TOBA 2IA2A 1JLAA 1ZYQA 3BLYA 2CW0F 1VSIA 4NC7A 4ZTFA 4BS9A 4TSXA 1Q81O 4EM0B 1W97L 1HYVA 1R4NB 2LKXA 3HOWJ 1W5CC 3ELKA 3GZ6A 3WGGA 3HZ6A 1MNDA 4DSJA 5B1AH 2R7ZJ 4XIDA 1QVUA 3UNGC 3ZMTA 1TNSA 5KCMA 4OLAA 3VEVA 3W2VA 4EATA 3MZ8A 2CQQA 1W0HA 3GUDA 3FKIJ 2VOPA 3C18A 4PUSA 2K02A 2FOKA 3TO6A 4IBNA 3V9WA 4OIRF 2CV2A 5FKKA 3I0TA 4QIWN 5L3DA 5CYMA 3DU5A 3G3ZA 3FM5A 1RTJA 2HEOA 1VF9A 4KN7X 2DJIA 3VQ9A 4P55A 2NVYJ 5D8LB 2E60A 4N56A 5DDGA 1ZG5A 1B8IA 5TKWA 4CERA 1ZBUA 4V2GA 3VQDA 4Y33A 5C10A 3L2QA 3HP9A 3T1YK 2V1NA 5C4XJ 5GPCA 5KRSA 4A5AA 3W6KB 1DGWY 3ZETA 2FBXA 2ZXJA 3ZX3A 4ZYDA 3QINA 3F8NA 4M6XA 1JXBA 4PFOA 1NK0A 1V5FA 2NRXA 2DTZA 2XKPA 4K2EA 1TT5B 4FX4A 5I3UA 1IW7F 2V9PA 3V1OA 1N32K 2V26A 4N9HA 2UYTA 2E7WA 3EQLF 1I50J 3R3LA 4DTXA 3WE3A 3OJUA 1R22A 4CEBA 3NGZA 1OH6A 3FIWA 3VTHA 5HS7A 5CR4A 2NAZA 2O7OA 4C2MJ 2GELA 2H8RA 1A6QA 5M1PA 2R7FA 3LALA 2VGNA 4LFUA 4FWSA 4KI6A 3ZMDA 3QBXA 5AZIB 1TT0A 1UA0A 4IKFA 9ANTA 5KPRA 5EYRA 2W4SA 3FXJA 3HGYA 4L9NA 2W1OA 4H5RA 3ZQ7A 2ZCWA 4WF2A 3SDBA 3GTGJ 3DLLF 1CQTA 1HCRA 1MNEA 3D0SA 3VMFB 3KK1A 5HLFA 4BQQA 4IOCL 3J7ZI 4B47A 2A6HF 2CU7A 4HCCA 3CCEN 3F0CA 2OPTA 3HKZA 2O8BB 3W6VA 2GEMA 1Z1DA 1PVEA 1J54A 1JCGA 2H8WA 3PSFA 2XAHA 3QYFA 3VTIA 3HL2A 4D5CA 3O5BA 3K2ZA 2VWKA 1EF4A 5EGOB 2WV0A 4K41A 5CQGA 3KZBA 3LAPA 3TAGA 1X3UA 4FM0A 4BGAA 4FJ8A 3OYNA 3QEWA 5F6FA 1VQOI 4CZFA 4MLEA 3VQPA 4B09A 2EV0A 2Y9ZA 1D0ZA 1RT6A 1U48A 1Y56A 3VYRB 3O4QA 4FK0A 2O8KA 3ZCOA 4NQWA 1WSJA 4FLXA 4A3EJ 2IVPA 2QA4I 3JREA 5KGXA 1YE9A 2XB0X 3T69A 5FD5A 3HI0A 4BRQA 4NXNK 3RTVA 2XY7A 1XUPO 3I0RA 1O57A 4RLFA 2DMUA 2EFPA 2GWRA 2AO9A 4M9ZA 2O4IA 1Q1VA 4CK2A 2RC4A 2R7UA 3SJHA 4LLLA 2A5XA 4JKCA 2PMZA 3OBWA 1G3WA 1IJJA 1KU7A 1ZTRA 2HFHA 3GXOA 1E4GT 1IKYA 5HP1A 1LDJA 4EP5A 3GTOJ 2YNIA 2L7FP 2Q0RA 3BZ6A 1GOCA 3O1BA 3RMDA 1BI2A 3NE6A 3T1HK 3WXJA 2AJQA 3HO1A 1FMWA 3B6CA 4C2UA 3FBNB 2KISA 2VT2A 1I1GA 4OGCA 2YX7A 3MCZA 4B8XA 1QVGM 2ASMA 2CUFA 1YIOA 1YRNB 3WHCA 3RTRA 5CKTA 1DKGD 3IP4B 2E19A 4KI4A 1BA5A 2KRFA 3LDSA 4E7IA 1NOYA 5AFUA 5KVRA 4ETSA 4XKVA 4DUYK 4C3JJ 2D5VA 4FJIA 4GNIA 1SFKA 4GY2B 2Y0SA 4FE4A 3TI0A 4EVIA 5J47A 2E5ZA 2YNHA 4RB2C 2AQEA 2HHVA 1D5AA 4XLHA 2RGVA 1W7PB 1YJ9I 4ZHRA 1LUJB 1R5GA 2P9SA 2Q0OA 2NRHA 4KHSA 4IFVA 1NKCA 4LFAK 2HDWA 1T6CA 2H3GX 1V4SA 3SHFA 2MD5A 3JSOA 3V6DA 4KISA 1O7FA 4AM7A 1YTYA 2RNGA 4WE1A 1BJAA 3GF2A 1RILA 1W36C 1IG7A 4DCHA 2GZWA 3WTZA 5JI6A 4MQ3A 4AIHA 1BM9A 2XGCA 3ZMUA 1ZLKA 2NOGA 4U7DA 3BPVA 3NGIA 4GCVA 3WTUC 3VQ7A 4EAHD 5ICFA 1B9MA 3FISA 2P0WA 3SCXA 1OQYA 2VQFK 3QPLA 1QBJA 2IGOA 4LOCA 4HX8A 4LIUA 3LSMA 3ERED 1XMXA 2LD5A 1XI1A 4CZEA 3O8HA 1JLEA 1Z3XA 5IP7J 1BCOA 1QVFM 2OPSA 5B1BH 3QNOA 4FX0A 5FRNA 3BJAA 2QXLA 3CYMA 3ULDA 2CGLA 3VESA 1XWLA 3ZX0A 3RVCA 2A3ZA 4L18B 5HRNA 3KZIC 4WX9A 3ZQHA 2LG4A 2ID6A 5JHFA 5FPMA 1AKHB 4L5IA 2JK3A 3HRUA 3WXMB 2FC0A 3OTOK 2F5VA 1BDGA 4XIUA 1HYSA 4L3QA 3EUHC 3F9KA 2P8TA 2CH0A 4KHNA 4ID1A 2P5OA 1CGPA 2NRZA 2JVHA 1VQKI 2KIFA 4CZHA 3H1QA 2BZTA 4WXHA 3KJVA 1YI2I 2GLOA 1PDNC 1FBSA 1R23A 3HSCA 2NRVA 4QPQA 2M1BA 4O0JA 2VQHA 2K86A 1TL8A 3Q7BA 1VQNI 2JPBA 1HQUA 3OMYA 3M07A 2O0YA 1FIPA 2NLXA 3A0IX 5KPZA 3V8JA 1MJBA 1WRJA 3QFPA 2HZDA 3B6PA 3QEIA 4DQ8A 2QWPA 3AO5A 3QEXA 3CFRA 4K0KK 4HRIA 1JHFA 4C8NA 4JKDA 4DSKA 4JRPA 3K4JA 3DMJA 4JV5K 1B9DA 2PMUA 5F27A 2K27A 1YJNI 4Z4IA 2WAEA 2F9TA 3VOEA 4AHTA 2IGMA 3VYUB 4DV3K 2HWVA 4ZH4F 2HTSA 3ITHA 1IV8A 2PJPA 3JCUC 3BR5A 3GOIA 3KD5E 4R5PA 5KHDA 3I4PA 5LLQA 3P9IA 4W5TA 4YOWA 5C44J 3VFZA 3BJ6A 2WTEA 2ZD1A 3RIRA 4WK8F 2NVTJ 4J19A 3JRCA 4MEXF 2RKHA 5LMNK 2OCEA 4MTDA 1XNRK 3PNVA 2PMHA 4G7ZF 4A3LJ 3ABLH 1NHAA 4HQMA 2ZO4A 2HQRA 4OPAA 1WJCA 1J2XA 4GFBA 2YJFA 5AQXA 4J00A 4IQ4A 2MYSA 2YJEA 4C3HJ 5GAGP 5EG0B 2HW3A 1P92A 5BNGA 2IGIA 4OIOF 3DPUA 2IIRA 5DEQA 3LSTA 4UUSA 3LSJA 5DS9A 3CJ7A 2DU9A 1Z6TA 3GTPJ 3H3ZA 3AVLA 2Z2SB 5KQ8A 4KHPK 3VQAA 2NRRA 1OYYA 1LE8B 4J8FA 4XEIA 4AH9A 4HZFA 3PQKA 2IEKA 2BW3B 1K8AO 1H9TA 4E89A 1SL2A 2I7NA 4MFBA 3I4MJ 3C6AA 3IUCA 2VUMJ 1YRNA 2CFOA 3RKXA 1MKMA 3KX2A 1CZAN 4QSHA 1N25A 3VEXA 1GLAG 4A62A 3UKRA 1L3TA 4MQ9F 2B0LA 2ATQA 3Q9VA 4HX7A 5K7FA 4A12A 5BPDA 2HHHK 1OCTC 4UV8A 3SEQA 1RTIA 1LEAA 1SUQA 2KKZA 2VI6A 2GOMA 4FK4A 4FLZA 4EJWA 2FE3A 4HTLA 4LLGF 4BVPA 4IOXA 4KTQA 4LSNA 4KDPA 4F8RA 3M1EA 4B3SK 3O4WA 3HXLA 1JKOC 1TLHB 5BRDA 2G0EA 3E5UA 3U9ZA 3KWGA 4PZJA 2HVIA 3GO5A 3H3UA 3EE9A 4NHJA 4CHOA 1Y97A 1STZA 1ILYA 3VA3A 1SKWA 1IG8A 2W40A 5E20A 1ATRA 2QEXI 3F2KA 5ELZA 3MWTA 2IPQX 1FNNA 3DF8A 3HOVJ 2G8UA 4IL6C 4M42A 1M1EB 2R5ZB 4CF2A 2P9KB 1I1SA 5LJVA 3RRHA 4IEJA 1D8YA 1DGKN 4CF8A 4P9FA 2QA4N 3OYJA 1S1XA 4WFBL 4YFUA 1P9QC 2EJRA 2PBIA 3THXB 3BCBA 2GTDA 4GKJK 3DXMB 3ZR8X 2MC3A 1RDBA 4FHTA 2GUPA 3OYCA 4G1QA 3IUOA 4FASD 1ETWA 3NF9A 1HKBA 4CEOA 2VG5A 4CVNE 4BXXJ 4BGDA 3G71I 1RGIA 2O8XA 3S1RJ 3D5LA 2ETHA 2FD5A 3O8GA 2LTPA 1DEJA 2XV4S 3JRFA 5AQTA 3G1LA 3PX6A 3OR2C 2ZJRL 1WJEA 5BPIA 2KHMA 1GDTA 4IG3A 3OBYA 4FJMA 1G3TA 2OF7A 1T0FA 3FMRA 3E9LA 4DFJA 4X1EA 3ZCMA 3CMAI 2MBFA 4DV0K 4EV0A 4JI7K 1KAZA 2EPFA 1P8ZA 2H6CA 3H1VX 1X2MA 1IDZA 4BQOA 3LPTA 3ZSZA 2YR2A 3DKYA 4CYCB 1ZBFA 2QWLA 4IVNA 2CH5A 2MW8A 4CHQA 4ZC3A 4FW1A 3ZLJA 4M3RA 3HBTA 5BMZA 5JLHA 2XAFA 4EHTA 3PNTA 4OPKA 1S3JA 4EJUA 1ERDA 4DMNA 4LGWA 2EWSA 5AQNA 1FK9A 4DV2K 1YJ9N 4FOEA 1HUXA 2XGEA 4ZDLA 1RR8C 3VF6A 4CJRA 4I2QA 2ZQBA 3PX4A 3ROUA 4CGZA 3V9ZA 4MO5A 3T0YA 3LDPA 3LP2A 5AFUH 1RT4A 1NGIA 2E1MC 4KAZA 2X4HA 2P6TA 5JS2A 1REPC 4F9OA 1PJRA 2QF7A 3WTXC 4CEDA 3M8PA 1FEXA 4HUFA 3H1CA 3QPTA 4FK2A 1HJRA 1BI3A 2RV8A 4DBRA 3OY9A 1ETOA 2RQPA 4ELVA 4XONA 4FETA 3NAEA 3PLAA 2PX9A 1W9HA 5EG0A 4KFCA 3TW6A 3K4LA 2PYLA 2A69F 3S2DJ 3ZSXA 4UVAA 5AQVA 1LCUA 1K4TA 2F9WA 1V4RA 3CERA 1QZYA 3W6JB 4BRCA 3HC7A 1JCFA 3AVNA 2A3SA 1UAAA 4V2FA 3OSGA 3R8EA 4CJWA 1LE8A 1D5VA 1NJWA 1GT0C 1ZR2A 4J01A 4EM2A 4MIMA 3VYSB 1RRJA 1NK6A 1KSPA 1A36A 1LB2A 3BR2A 2OV7A 1JCEA 1QSLA 3C2HA 4HLYA 3S14J 5AQMA 5HROA 3A2KA 1VQKN 5CVRA 2EA4A 2O9LA 1F4KA 2YCHA 1YI2N 4BC3A 4M3YA 2P5LC 2ESHA 4PWDA 3K9JA 2Z1IA 2ZF5O 3MKYB 3DI6A 3LNQA 1VQNN 4KIBA 4W5RA 3HEFA 1WH7A 2Y75A 5CQEA 5IPAA 2M87A 3KFWX 3PSIA 3GW2A 3L6QA 3GDQA 3ZYYX 4JRQA 4BREA 3BC8A 4RB1A 4DTMA 4XL9A 2R7VA 2FBTA 3E9OA 2VL8A 1ZN2A 1FP1D 4OJRA 3BCAA 2FMLA 5AQOA 2E6MA 1D9DA 3CQXA 3AG1H 3K5NA 4HNUA 5GTHC 1N5YA 2D45A 1UG0A 2NS7A 2L9RA 2GX9A 3BG9A 4YOUA 1MJAA 1GUUA 3VGMA 4I6MB 4IEIA 1XMAA 5J8FA 2WAQA 3IH2A 1PUEE 1GLEG 3MEGA 3CESA 4WQ4A 4FVUA 4PQUA 1QZ5A 4PSWA 5AQFA 3GTQJ 1HW1A 4KJZA 5MLCQ 5SZTA 5DCFA 3H08A 1WAFA 1HKQA 5FLXK 1GXPA 3K4MA 3M9AA 3L1PA 3H92A 4NNJA 1R49A 1T7PA 3THXA 1OH5A 3DXMA 5J3LA 3AO2A 1Z77A 4E7HA 5FLXO 2BTFA 5BN8A 3RPQA 3S8PA 4M74A 3THVA 1ETKA 2XRIA 3QEPA 4R1HA 2CV1A 2HOEA 1NGDA 1VSMA 1W5TA 1UHMA 1FIAA 2OD5A 4YY3K 1BIUA 1K8KB 2GXAA 1TKZA 2RQQA 4XR6A 3MWMA 3ECOA 4QOZB 2HVHA 3RR8A 2KP6A 2IXSA 2W7NA 3EZWA 1D4XA 1K83J 5D8KB 1R00A 4LF6K 1R36A 3V42A 5C12A 1QZ6A 3VF4A 4RGSA 4YRVA 4RMNA 2IS3A 3SAGA 4ILHA 1S9GA 3DLHA 1OYWA 2K5CA 4CYCA 4E7JA 1K61A 3O3GA 2FSNA 2VXDA 3TL4X 1SKRA 4IXCA 1MMAA 3FMQA 3DP7A 3X2QH 3BGRA 3IRQA 3O08A 3L8BA 3DEEA 1JLFA 2X78A 4B9VA 2VASA 2XSJC 2IGKA 3CD6I 4LF9K 2E4LA 5M1FA 2QBYB 4BRAA 3W0LA 1Q7YO 1ODDA 3V7SA 1O4XA 4IX7A 3IH4A 1P4WA 3NDKA 3MXIA 1IRFA 2MC4A 3WTWC 3ID8A 4I9QA 2JUGA 4U87A 3BJOA 4B9MA 4JKBA 4NLBA 2ZMEA 2KQ2A 4A61A 2GIVA 3GL1A 2QQAA 5EJCA 3CQYA 4HHTA 1Q9XA 2ECCA 4CEZA 3AG4H 4B44A 2QEXN 4AM6A 1VSJA 3H9JA 1FW6A 3ZSRA 3L09