3BP8A

Crystal structure of mlc/eiib complex
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
396
structure length
381
Chain Sequence
DQIKQTNAGAVYRLIDQLGPVSRIDLSRLAQLAPASITKIVREMLEAHLVQELEVGLVVETEAWHYLSLRISRGEIFLALRDLSSKLVVEESQELALKDDSPLLDRIISHIDQFFIRHQKKLERLTSIAITLPGIIDTENGIVHRMPFYEDVKEMPLGEALEQHTGVPVYIQHDISAWTMAEALFGASRGARDVIQVVIDHNVGAGVITDGHLLHAGSSSLVEIGHTQVDPYGKRCYCGNHGCLETIASVDSILELAQLRLNQSMHGQPLTVDSLCQAALRGDLLAKDIITGVGAHVGRILAIMVNLFNPQKILIGSPLSKAADILFPVISDSIRQQALPAYSQHISVESTQFSNQGTMAGAALVKDAMYNGSLLIRLLQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analyses of Mlc-IIBGlc interaction and a plausible molecular mechanism of Mlc inactivation by membrane sequestration
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Putative NAGC-like transcriptional regulator
total genus 103
structure length 381
sequence length 396
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00480 ROK ROK family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bp8A01
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A02
3.30.420.40 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3bp8A03
1B59A 3BDDA 3O6BB 1PP7U 1O3RA 4FWLA 3T0YA 5EOYA 5ADXA 4A12A 3EQLF 5JVTA 3V4GA 3I64A 1WOQA 2FF4A 3O3KA 1Y64A 1FYLA 3FXRA 3QB0A 3TDZC 3VEYA 3H3ZA 4FX0A 4ZYEA 3WGIA 1GHCA 2OANA 1QNTA 4M7XA 2A42A 3VEXA 2QWRA 4CHUA 2VC0A 4HF0A 2GWRA 2KIMA 2Q36A 3NQOA 1U8RA 4FWKA 1GLJO 2XAQA 4A0XA 1NM1A 5AQPA 3PQJA 4BR2A 4FWOA 4HX7A 5ILUA 1W7PB 1G3SA 3FM3A 2IA2A 4TV7A 4FPBA 3L2CA 1W7PD 5AQFA 4WX9A 3IKVA 4MQ9F 2XHKA 2A5YB 3BEXA 1Z9CA 2FXAA 2QVOA 4I2OA 2XIGA 4UUVA 2R7FA 4FX4A 2D4WA 4FWMA 5BPLA 2BGCA 1D4XA 2O0YA 1ONVA 5KPZA 4B1WB 4AIHA 3WE3A 3C3WA 2L4MA 5JICA 2PBIA 3ZN1A 1D5VA 4CZKA 2EFNA 1XSXA 5HOOA 4ASNA 4P5OA 3HUGA 3A5NC 2DQLA 5AFUA 1U5TB 5LEJA 4KICA 2L3DA 2W40A 4FWSA 3RYRA 3RPUA 2HDCA 4EJVA 2LF8A 1FSEA 2DAOA 1TUUA 1H9TA 3CLOA 1BDGA 2FLOA 3ZMSA 3QDKA 3K1MA 3F22A 4ISEA 4LJZF 3L7WA 2C6YA 4IZ9A 2EV5A 4D0PA 4FPAA 1HX1A 3HTSB 1P2FA 4IPAA 1R1VA 4ISFA 4ENKA 3JTGA 3H3UA 1V3FA 3VB2A 1TQMA 4EV0A 4CXFA 4XLPF 2GXGA 1ZRCA 2IPQX 2RN7A 1XQSC 1DKGD 1EV7A 4RGUA 3R6MA 3FMSA 4YG2F 1GLAG 4P55A 1F1ZA 3RYPA 1MZBA 3MAJA 4BHPA 2DT5A 2K4JA 1RDWX 2RQPA 1ZG5A 1SZ2A 4GYGA 1YW8A 2FMYA 4I09A 2DFIA 3E6MA 3LDLA 1IJJA 4IRIA 2V9VA 1XMKA 1YIOA 2CYYA 1BM9A 3U8XA 1T98A 4B1VA 3L00A 3QBXA 2GELA 5KPTA 2Q97A 5AQGA 3BPXA 1MA9B 3M1EA 2OBPA 1FBQA 2HR3A 2MC3A 3WE2A 1LDJA 1PDNC 2P9LB 3OV8A 4K42A 4A6EA 3BF1A 1BI0A 1DPRA 5ED4A 2P6SA 4RTFD 1FPQA 4L3QA 4HTLA 1WUAA 4KFCA 4R8HA 4EAHD 3DKWA 3ZMTA 3GXOA 1YTYA 5LJVA 3Q5FA 3TQNA 5JI6A 3LAJA 1ZGJA 4UVAA 3TOBA 1MD0A 4IWVA 1YYVA 3IRQA 1I1GA 3FF5A 5E1XA 2AA4A 4BR5A 4EFHA 5LGTA 3I54A 3O5BA 3B02A 3H3OB 5EXWA 3WXIA 3T8TA 3VERA 2RNJA 3FXQA 3KP7A 2PJPA 2PMUA 2Q0RA 4XH4A 1B9NA 5BN9A 2OAZA 4M7YA 3CQXA 2JPCA 2HKOA 2K27A 1FBUA 1TUYA 1CGPA 1R22A 1TNSA 2HQRA 3C7JA 1JCFA 4CGZA 2JRTA 2F5FA 2Q2RA 1CZAN 1NMDA 2M1BA 4FWQA 3WTVC 4CI6A 1BC7C 3VFZA 1TTYA 4L0YB 3QBWA 2IRFG 2F9TA 2ASOA 2UXNA 2Y75A 4OMZA 3CI5A 2P9NA 3HRUA 4KMUX 3LA2A 3J80Z 4LC9B 2VC1A 3KE2A 3I71A 3ENOA 3EZWA 2FOKA 5E17F 2P9IB 1FYKA 3GL1A 1XGMA 4G7HF 3TO7A 1OYWA 4QS7A 1HKQA 1FLIA 3R61A 1F4KA 2A68F 5LHGA 2HFHA 4LFUA 1JGSA 4WXHA 1YVNA 2DI3A 1J0RA 2HMPA 1R1UA 4IF4A 5CLSA 4HX8A 1IN5A 1K8KB 3Q9VA 1I6XA 1BC8C 2R7DA 3C7NA 2FBHA 1X9JA 3FMRA 1TQIA 4U0VA 2CH6A 1J5YA 2AS5F 4IO8A 4DHYA 3WGGA 4N0BA 2E7WA 1Z6RA 3WXLA 2P9KB 1RI7A 2GWKA 3KLNA 1USTA 2L4AA 3L4IA 2LKPA 4RAYA 1U2VB 2I7PA 4HF2A 3UKRB 3CETA 2MD5A 4MTDA 4L9TA 3ERED 1FP1D 3LFKA 2RKHA 3AARA 2J4RA 3GFMA 2EWNA 4CBWA 4UHTA 5HLIA 1B9MA 4WWCA 4H0OA 1C0WA 2HF4A 2V1XA 4I01A 3LDPA 3GZ5A 1O3SA 1I5ZA 4K2EA 5EVZA 1LDDA 4BRQA 3MN7A 5LRSA 3DPTA 4BHCA 5K5QA 4FSVA 5BPNA 3I0TA 2V7ZA 1ATNA 1U3EM 4L9JA 3C18A 5FO5A 2X0LA 2A41A 3M8FA 3JSOA 5D5WB 2PG4A 1HQCA 4GCVA 1T39A 3DXKA 5BREA 3WODF 1V4SA 1L0OC 3QICA 4EM0B 3KZYA 2FNAA 2ZCWA 1J7KA 2QWNA 2FF6A 5EX5A 2W25A 2MA3A 1V4RA 3O1WA 1WKMA 4K43A 4YFXF 3K2ZA 4HA8A 4MNUA 2QWQA 3GEZA 1XCVA 2G7HA 3ECHA 1G3YA 3ZMDA 5FB2A 1SFXA 2DK8A 5FD5A 1NGIA 2BUPA 1QPMA 4AIJA 3IWZA 3CJ1A 4H0XB 3SMSA 1YS6A 4JD2B 4QLCU 5DD8A 1YLFA 4J8FA 1XSDA 3RTRA 4O5VA 3M1FA 2HOEA 2O8XA 2E88A 1YW7A 4UV9A 5CVRA 5BS6A 2CH5A 3LA7A 4CD1A 2Z99A 4JNEA 4BC2A 1SQKA 1IN6A 4KNYA 3UKUB 3WTYC 3R9PA 2KIUA 3BF3A 3WGHA 2NRHA 1UFMA 3TKYA 5L3FA 1DGKN 3O1BA 2JTVA 5FPMA 1ZRFA 1GLFO 4AM7A 5CVJA 3ZETB 5LGNA 2X4HA 3FHZA 4EJOA 3REOA 2VCPA 5AZJA 5EY4A 4PKHA 3SQNA 1R36A 3GOIA 3EN9A 2HS5A 2CQKA 4IXCA 3UKUA 2AXLA 4G9YA 1ZN2A 1J75A 3DWLA 2RVCA 2E2QA 2YHYA 2EA2A 3A5MC 5BRHA 2QQBA 5LJWA 3P7NA 4G7OF 3QAHA 1NGHA 4KYWA 4CZGA 4GY2B 2EWSA 3GE1A 2MLKA 2E2NA 4IXAA 2HQNA 2XUBA 2P9KA 4H0YB 3F9MA 4WXDA 1KYZA 2Z33A 1OMIA 3HM8A 2ZXJA 3UB5A 1RIOH 1BIBA 3AAPA 1LEBA 1U2VA 3W3DA 5AZIA 2EJRA 4XH1A 1NLVA 3J81Z 3MK6A 4L9VA 4IHTA 1TLHB 1FZPB 5A2QK 4KA4A 5B8HA 2E1ZA 1IAWA 3BWGA 4WQ4C 4UV8A 4A0YA 3LL3A 2EFPA 1IRFA 2ZMEB 5BQTA 1O7FA 3D7EO 4BAYA 3J7AO 3ELKA 1UHWA 3VGKA 3HTVA 1SAZA 2EV0A 3BJOA 3I33A 3WTTC 4BVOA 5FGMA 3GYHX 4Y17A 4CZFA 5ICGA 3WTXC 3HHHA 3R8EA 4A62A 2H6CA 4LLNA 1DP7P 4AWXB 2XV4S 3L09A 1GLDG 1KU9A 3SMPA 1UHMA 1IW7F 3O4WA 3F8CA 2DQRA 1U6GA 4BC3A 2GXBA 4P9FA 1NBWA 3F6VA 5F0XA 2FA5A 1BBYA 5LRRA 4IJAA 2P4WA 2GIVA 1I27A 1T44A 1HKSA 2IJLA 1BG3A 3LM9A 4L5JA 3W6KB 3L9FA 5H6QA 4HQEA 1ZAOA 3CDHA 5ILVA 3H46O 1Z7UA 5AQJA 4H0VB 3JAMZ 3BUZB 3CHWA 5BRFA 3CJ7A 2E7XA 1ZYRF 4LK1F 1R5HA 4ETSA 2A3ZA 2E2PA 2D0OA 3H92A 4Y0WA 1S7AA 2HYFA 1BA1A 3MMVA 4RS8A 1GXQA 3IFRA 3P9KA 2EFOA 1Z1DA 3C1DA 2F2EA 3JS6A 2FBIA 4BRDA 3I58A 2ZKZA 2YJEA 1FBSA 2Q0OA 1YS7A 1P6RA 3ZPLA 2K86A 1BIAA 2PQ8A 3ATVA 1QZ5A 5FFXA 3L0QA 1P4AA 3FZFA 2QQ9A 4DQ8A 3SZPA 1IF1A 1MDMB 1TW3A 4CZHA 4RCHA 3F8MA 1GVJA 4DB3A 1JXSA 2VT2A 1TQPA 2MLGA 3H3NO 4BXUA 5LHHA 4ENJA 1REPC 5L3GA 3E5QA 1K79A 2FE3A 2K02A 2D1HA 2O3FA 1STZA 2Z3YA 3MCZA 3FE1A 5BPMA 2QWPA 2NAZA 3CJNA 4A5NA 5E84A 4WK8F 1BUPA 5KQDA 5K1YA 2CO5A 4B09A 3K0LA 4EHUA 3G73A 2QWLA 4GYIA 2P5LC 4LLLA 1G3WA 2HZTA 1B1BA 3CIPA 5L3CA 2IVNA 5DYMA 1O57A 3VPZA 3JSPA 4KDPA 2STTA 3VODA 1QGPA 2E8AA 3DQVC 1J9IA 1NGBA 1QZ6A 3GO5A 2DPUA 4FT8A 3E6CC 4JQFA 1JHFA 1ZC6A 3V7CA 1Y0UA 2ZO4A 1HSJA 4LLGF 5BRDA 3BOQA 3P9IA 5D4SA 2Q31A 5JMVA 3RKYA 1O3TA 1C0GA 2OA4A 4EJTA 2GEMA 1P8ZA 3GF2A 1PUEE 2E1YA 4HX4A 3ZP5A 5AQOA 3DXMA 2WTEA 1XGSA 1E2XA 3O6WA 4BR9A 3LQRA 4ESJA 3VEOA 4JBAA 2P9SB 5L3DA 2ZJ2A 5HS7A 1BJAA 5E1ZB 4B1XB 1FSHA 3ID8A 2VBYA 2YU3A 4U0WA 2QM3A 2KHOA 2Q0UA 1IXCA 1DEJA 3ABTA 2WC2A 3ZEUA 1ATRA 1TBXA 2FF3B 1SFEA 2AP1A 2P9UB 5AQIA 1YXQA 2P7CB 5DV5A 2QBYA 4DNCA 3BZ6A 2Q1NA 5ICFA 4ESFA 1QQIA 5FPNA 3CJ9A 3E5XA 2IA0A 1LNWA 2UWMA 3WTSC 1NGEA 4CDGA 2D45A 2OZ6A 2FSNA 4CJ7A 2D1KA 3EETA 4G7ZF 4QS8A 5F64A 1EH7A 4H5RA 1IRGA 4CD3A 4YIIA 5FLXZ 4MO4A 1XCBA 4XH5A 2BTFA 3CJAA 4EVIA 3SK3A 3WEEB 4ZYGA 5K5OA 1LJ9A 2H3GX 4WCGA 5D6FA 4HF1A 1E4GT 1K8KA 2IA1A 4BREA 3IWFA 3DXKB 3QOPA 3V8KA 4ENMA 3IL2A 5AR0A 2Y0MA 3WEEA 3S2WA 1OR7A 2W84A 2PBDA 1R1TA 3GG4A 2M45A 1KAXA 3SLCA 3ZETA 4FO0A 4MLEA 3CUQC 4M73A 2YSRA 1RNLA 5CJ9A 2M87A 2GA1A 4HLYA 4PL8A 2FXUA 2UXXA 1XB4A 3U9GA 2NYXA 4OINF 3D2EA 4GNIA 4Z94A 4P96A 1YFHA 4I7HA 3T8RA 3LQQA 1XGOA 2VXZA 4S05A 4IHSA 3J80K 2A69F 4YFNF 3MZYA 2ISZA 4I0BA 2RV8A 3EYYA 1SAXA 1J2XA 4CZLA 3OHRA 3F8NA 2HGCA 2RC4A 2STWA 1FX7A 2FSJA 3KETA 1R00A 1QZZA 3GW2A 3MQ0A 5LLQA 2QENA 1MGTA 1U5TA 2V6CA 3E6DA 4BRIA 3W0LA 2E1NA 4MO5A 3T1BA 2VBXA 5ICEA 3DEUA 5LY3A 1KQ9A 3EL2A 3DJCA 1B4AA 4YDUC 2KIFA 5D8KB 2E1CA 1HXDA 4ZH4F 1GLLO 4R79A 4CZZA 4N9HA 3O80A 3RSEB 3L6QA 4PKIA 3D5LA 4U7DA 3LDOA 2A5XA 2CG4A 3K9TA 5BR9A 2MH9A 2MH2A 4CICA 1GLBG 2HTSA 4RGXA 4H5VA 4JAXA 3C0BA 2ESHA 3VEPA 1NGFA 2PEXA 4G6QA 4PGGA 3KZBA 4A2AA 5HDKA 2DBBA 2WV0A 5F1RA 4FOIA 2EK5A 3R0JA 2P9UA 1KGSA 1K78B 3BJ6A 5AQVA 4LG0B 4BC4A 4ZYHA 5LBQA 3HRSA 2YI1A 2YJFA 1ULYA 1ON2A 2VOOA 4A2BA 3AAFA 3BY6A 4B1ZA 1QBJA 1HKCA 5ICCA 2CGPA 3ZN0A 4KUMA 4FL9A 2Q8KA 4HBLA 3DP7A 3IDHA 4P9UA 3KP6A 4I6MB 4BR7A 5ILSA 4O3MA 1S29A 3A5OC 1GLCG 4BRFA 3ZMVA 3RJPA 2Z9OA 3FX3A 5IT9K 4HV6A 4BG8A 3HSEA 5CVVA 3BP8A 2IP2A 3LSTA 1TYQB 2ASMA 3GFIA 2A6HF 3VEZA 4EGYA 1DUXC 1IZ1A 3QU6A 2NNNA 4H0PA 2NS0A 2OZUA 2ZBKA 3TO6A 2COMA 1KA8A 4PGHA 5HDGA 5CYVA 3LM2A 1U6ZA 2ELHA 3HOSA 5AQKA 1J6ZA 2QWWA 1BOTO 3DFGA 4M9ZA 3CUQA 5ELZA 3CQYA 2FNPA 3HZ6A 4HLXA 4IVNA 4H0EA 5E8IA 4M9SA 2XROA 3HSCA 4A2UA 1KAZA 3ISPA 4IJNA 3PQKA 4G94A 3QP6A 1QZYA 4FWNA 5E20A 2ZGYA 1SD6A 1BN5A 1IG8A 4NO7A 4HYEA 2ZNYA 1G6NA 1R58A 5BN8A 4B1YB 2EV6A 2M30A 4IRHA 3EYIA 3F72A 4CYDA 4ENNA 2HTJA 1V4TA 5AQRA 2YHWA 2KJBA 1UB9A 1RUNA 3WQTA 1HLUA 2K7LA 2W85A 1HKTA 2L01A 3LA3A 1XC3A 5TJJA 1AOYA 5AQHA 4BR4A 1OKRA 3VF4A 1FNNA 2V1DA 4AD9A 1LVAA 3IKTA 1YQAA 1OYIA 2M5WA 3P4IA 1TW2A 4YDUA 5AQXA 5FPEA 1VTNC 5F6FA 4BVPA 2QQAA 1BOAA 5DUKA 3MWMA 1YW9A 1BA0A 3ROUA 2XAGA 3QFPA 3W6JB 4M6XA 5AFUH 4MEYF 2P9SA 2OQGA 1H9GA 4G8XA 4A6DA 4KN4X 1MDMA 1HW2A 2VBWA 4F7ZA 4CZEA 1RUOA 2O6GE 5J8CA 1T6CA 1HW5A 3F8BA 5DEQA 2P9NB 3VEWA 4KIGA 2H6BA 5H20A 3O2PE 4XBFA 5H6RA 3VGMA 4A61A 3EO3A 4F9OA 1NWKA 3J8AA 2EB7A 1MWKA 3I53A 2YX4A 1ZBSA 5D5UB 2EFWA 1X3MA 2XKOA 1ZH5A 1MKMA 5FPDA 4PCQA 1CF7A 4U7BA 3FZHA 5IT3A 4M9XA 3LAPA 3DF8A 4HW0A 4E70A 1AWCA 3E5UA 1S3JA 2TDXA 2LSOA 3MDQA 3O08A 3MEXA 4Y13A 2XAJA 2V7YA 2CFXA 2QW9A 5AQMA 3RKXA 4H5WA 4M6YA 4UVBA 2VYPA 5KQ8A 2VT3A 3QMLA 4RWTA 2DPDA 3HI0A 1H0MA 4QS9A 4MLHA 1MDUB 1KQ0A 4Q48A 1L3LA 2UYTA 3U1DA 3I5UA 1SD7A 5JHUA 3F6OA 3KP4A 5CE3A 2DTRA 4LGWA 2Q2EA 4MTEA 4I98B 3ZMUA 3CTAA 2NRAC 1ZRDA 2HEOA 4HV5A 1GXPA 2LNBA 2ZGZA 4BH9A 3FGUA 1ZLJA 5K5RA 2VONA 1Z6TA 2XVCA 1ZHFA 4XLNF 4CZIA 1XN7A 2YHXA 5AIQA 3R60A 2VOPA 4OOIA 5E1WA 1T6SA 5IT9Z 4Y15A 3HIFA 3COAC 3IMXA 2DO7A 2ZF5O 3ENHA 5A2QZ 4BQZA 5AQWA 1ATSA 3HSRA 3WTWC 3HRTA 3C7NB 3FXUA 2CGKA 2QLZA 3H45C 1SD5A 1F5TA 5AQUA 5AQNA 4KBOA 3ECOA 1ZXOA 5AQQA 2P9IA 2CSOA 3KLOA 4WXCA 3V7SA 4QWQA 1OKJA 3SJHA 1LCUA 4M74A 1B6AA 3ZMZA 2KRFA 4EQQA 3MFKA 1DDNA 1D8KA 4BROA 1Z05A 1YO5C 2O61A 2ZFWA 3E6BA 3T5XA 2PLYA 3ZEUB 2VE8A 4O5FA 4I02A 5I9EB 3GDQA 1Z91A 2NNYA 3N4MA 2GZWA 4RB1A 3A8YA 3KEQA 3FZMA 4NHJA 3ML6A 1HJOA 2BYVE 2Z5UA 1IXSB 3FMQA 2DLLA 3U4LA 1BI1A 3HSFA 4EJUA 1U2WA 5FFZA 3RPQA 4HWIA 1FC3A 2GTDA 3WU1B 1C0FA 4OIPF 1W5TA 4LD5A 4XSXF 1XSVA 1LQ1A 2A40A 3SFZA 1U5TC 1K78A 1R23A 4GXOA 4MHGA 1YUWA 4H5TA 4K41A 1FP2A 3K1PA 2YX7A 2JSCA 1KXPA 3TO9A 4FHTA 3MN6A 1HBXG 2HF3A 3CJCA 5DCFA 2HWVA 4CZMA 1IN8A 3KP3A 2FSWA 1T0FA 5AIPA 4EHTA 4BRMA 3EKUA 3BROA 2ZNZA 4RB2C 3KP5A 2RGVA 4U88A 2G7UA 4JN4A 4BG9A 2I7NA 3M8EA 1FWZA 5JLHA 4B8XA 2D1VA 1TNTA 4WQ5C 3K1NA 4A5MA 3FLCO 2VN2A 5DD4A 1RGIA 3VESA 5EEHA 3I8BA 4JD2A 2JT1A 3DXMB 3F23A 2P6TA 1E17A 2VBZA 4BHBA 5BPIA 1F9NA 2QBYB 3UE5A 4ZZDA 2JZYA 3WUHA 1MJBA 3U9DA 2W41A 2DW4A 4BRPA 3HHGA 3V7RA 1HKBA 2IIRA 5AQZA 4C23A 5FLXK 2UZKA 3U2RA 1DPUA 5AQYA 2JPBA 5LHIA 4EGZA 3IUCA 4AM6A 1TYQA 4ZZLA 2G9WA 4FWPA 1ZARA 1R59O 3AY9A 4MGRA 2V1UA 1R7JA 2XRNA 4FOEA 1HUXA 3CUQB 2ITMA 3WT0A 1ZREA 1MJ9A 3VOEA 4UNOA 1FYMA 4BGBA 3VOVA 4DCHA 2FSKA 1IN7A 3ZX3A 4YIFA 4LK0F 2NLXA 4BRLA 1R5GA 4U0YA 2PAVA 4O6JA 5F1XA 1W4MA 3R4KA 3ULQB 4EM1A 1JCGA 3M3ZA 3EUHA 2P9LA 5AZIB 1NGGA 3RIRA 1KQ8A 1RFQA 3HOTA 2CGJA 5JLFA 4AIKA 3N97A 4MEXF 2K4BA 3ABUA 4O8KA 1X3UA 4HQMA 2VODA 1FT9A 5TRDA 1MWMA 3CERA 3D0SA 4CO8A 2CWEA 2IT0A 3PFIA 2HYGD 3G25A 1A04A 4Q4ZF 2A3SA 4H5NA 2J5PA 3M6GA 3TU5A 1OPCA 1W7PA 3F21A 2QWOA 4S04A 5HDNA 3KEOA 2GQQA 2QUFA 3ZX0A 5AQLA 5TKYA 1QQMA 2QM1A 1XD7A 3GLXA 5L3BA 5D8LB 3IHUA 5D5VB 1KAYA 3GFLA 5JFRA 3GWZA 4PKGA 3I4PA 3I59B 1SD4A 3VF2A 2E20A 2XGXA 1S8NA 5EEGA 3WU0A 1RZ4A 1HPMA 3VGLA 1ZG3A 4CBXA 4M63C 1O7LA 3G3ZA 1QQNA 3FFKB 4BRAA 3ZQ7A 1W5SA 3D2EB 1LB2A 3JXUA 2QWMA 2ISYA 3QRFF 5BOXA 1QQOA 4OU0A 3QU3A 3GBTA 1NGDA 1IXRC 2GA2A 2W57A 3RI4A 3ULEA 3WXKA 1BI2A 3F3XA 3JTHA 1ON1A 1WQ2A 4IRGA 4KIFA 3FZKA 3P9CA 1K6OA 5KVRA 1U78A 5F2RA 5KK1A 3WG9A 2PN6A 5KPRA 3CO7C 1T6DA 3DAWA 3TPQA 4GGGA 2IVOA 1HSTA 1ZGAA 3K69A 1Q1HA 3V8LA 1S3XA 2KJCA 2FMLA 3VF6A 2E2OA 3AAQA 4NQWA 3KVGA 1JCEA 2A61A 2H94A 2L02A 3WTUC 3M9AA 2H27A 1NGAA 3LWFA 4NB5A 4RB3C 4BRNA 1T38A 2OQRA 4BRHA 2V51B 5HLHA 4BYYA 4WF2A 4XRFA 2M8EA 2D2WA 1LOTB 2WWYA 3JW4A 4E1JA 3OOPA 3R0AA 3VEVA 5AONA 3H1VX 1O3QA 2KKOA 2IVPA 1EH8A 1P4XA 5BMZA 3NRVA 2WUSA 1G99A 2GWJA 2F5EA 1KU7A 4I0AA 4LG0A 4NB4A 2FQ3A 2EA4A 3J81K 3HBTA 4K25A 2F5CA 4BRGA 4RB0A 1NGCA 3GFJA 2A6EF 3MZHA 4CZJA 1MJAA 3S41A 4BRKA 2ZWHA 1SMTA 1P4WA 4KIBA 2OD5A 5E8GA 3F8FA 3VENA 2ADUA 3MN5A 2LF7A 1BO5O 1XDSA 2DPNA 4XSZF 4ISGA 1BWFO 1QHAA 3A0IX 5FD6A 1OYYA 3R6SA 3O8MA 2FRHA 1KU2A 3GVAA 4B9QA 3FZLA 2BV6A 2MBFA 3EKSA 2XKPA 4BR0A 4M72A 4WYBA 4Q5SF 4B1UB 3CO6C 3V8JA 1XDUA 2P9PA 5ADXH 1S6LA 4L9NA 2J5OA 5HS9A 4PDKA 3RKWA 1EH6A 1PP8F 2R3SA 4HDVA 1CF7B 4WQ4A 5D6EA 5J8FA 1JHHA 1J59A 3FWEA 3MN9A 1S22A 5HS8A 4ESBA 2A07F 2CGLA 2QXLA 5ERIA 3KFWX 4BQLA 1FOKA 2ACJA 2P8TA 4BC5A 3I59A 1YG2A 2DK5A 1X3NA 5J6XA 1SMYF 4CBUA 2NZTA 1USSA 4G6DA 3M7GA 1FY7A 3TOAA 3HRMA 2F5DA 5LEKA 3QPTA 3H6EA 1E4FT 3CUOA 2P9PB 1S7OA 4RGRA 1D3YA 5AQTA 1WI9A 3JAMK 5HLGA 3FZVA 2DU9A 4HDUA 3RDIA 4ZYDA 2H09A 4L18B 3H1QA 2IW5A 4BGAA 3ZX2A 1K7AA 1G4DA 2ESNA 4LMYA 4EMSA 3ULEB 5AQSA 3B8AX 3U9ZA 2O03A 4Z2YA 3LDQA 4UVCA 4FWRA 3KCCA 2FEZA 3D2FB 3KHYA 4JK1X 1I1SA 1YAGA 2ASPA 3KZZA 3BJAA 2PFBA 4DQ2A 4BNCA 4OMYA 3RSEA 2BE5F 3GUDA 3VETA 3BPVA 4OIQF 4OIOF 2W24A 2V52B 2OU2A 3E3VA 1P92A 4M71A 4KT5C 2P5KA 5CVIA 1Q18A 2PI0A 2B0LA 4KMFA 3DXJF 4HZFA 5BPDA 3HYIA 2FU4A 3SHFA 4HAMA 5L3EA 3MCPA 4RGSA 5DCMA 4EJWA 3LDNA 2XAFA 3QP5A 1H1VA 4H03B 2BBYA 5CVUA 3D2FA 5DDGA 4LB5A 1WWXA 2GAUA 4RAZA 1GLEG 1WRJA 1KU3A 2BEOA 3SXYA 1LDKB 3DPLC 4BRCA 3IRRA 3UKRA 4I6MA 1ODDA 3TDUC 1WSUA 4XEIA 1NGJA 1IN4A 2YCHA 4WQ5A 2QYOA 2YPRA 4HOBA 3GZ6A 3IC7A 5JR3A 1ZG1A 1KYWA 1XGNA 3WXJA 2L54A 4BQAA 1JE8A 2F9WA 3WQUA 3NEUA 5D4RA 3ATUA 2FBKA 2EFQA 6PAXA 2HKXA 3CJBA 5HVQC 5DCMB 1G3TA 4R1HA 4YFKF 2VWBA 1QO0D 4OIRF 2V79A 2XASA 2P7VB 2YR2A 4KN7X 4EIAA 1NHAA 5LGUA 1BU6O 4MQVA 3HTUA 4L5IA 1XUPO 4H0TB 4UXNA 1D8JA 4PZJA 3QFUA 2XAHA 4EM2A 3E97A 1ESVA 1IUYA 5E18F 4PL7A 1LEAA 2P5VA 3B73A 3SZTA 4Q47A 3QPHA 3FR0A 4AVPA 5D5XB 4JHDA 2IVMA 2QZ8A 3FM5A 1BI3A 4LB6B 1SFUA 2D0PA 1UCRA 3Q9SA 2GUPA 1EQYA 3EDPA 2LDUA 2VE9A 2CW0F 2Y48A 1XMAA 2PMHA 1ZLKA 1HKGA 3GX4X 5DUIA 4N9IA 2ETHA 3KP2A 4A0ZA 3TGNA 4JHDB 1T2KA 4GO1A 3A5LC 3WTZA 2RDPA 2ZMEA 4ON0A 1HW1A 3DV8A 5E26A 5AZJB 4L0ZB 2A6AA
chains in the Genus database with same CATH superfamily
4LF9K 1B59A 1UMQA 1RBRA 3BDDA 1XC9A 3O6BB 1PP7U 5F0FA 2JUCA 1O3RA 3J7ZI 4FWLA 2WADA 3T0YA 2K9LA 4ILGB 5EOYA 3NFAA 4CGGA 1S9GA 4A12A 3GMEA 2KKZA 5ADXA 2HMIA 3EQLF 2A1SA 3VQ8A 1MNEA 2CUEA 5JVTA 3AG4H 3V4GA 3CMYA 3PO5A 3G4SN 4JI0K 3I64A 4PJLA 2DXIA 2FF4A 2WAQA 3O3KA 1WOQA 4PFPA 1Y64A 5KPTA 3O3HA 5KRTA 5JVGL 2GXAA 1FYLA 4DBQA 3FXRA 1GVDA 4K0KK 4DFKA 1BW6A 3QB0A 3SUQA 3TDZC 3VEYA 1J53A 2V9KA 2QA4N 4DBRA 2DMUA 3QODA 3H3ZA 2XF6A 4FX0A 4ZYEA 3CF5F 3WGIA 1GHCA 2OANA 4EZ6A 4C2MJ 1IBLK 4ID1A 2LH9A 3PNTA 1QNTA 3CD6I 1ASWA 3ZSVA 1AKHA 5JVGF 1A31A 4M7XA 2A42A 2RPIA 3VEXA 5C44J 2QWRA 2ZM6K 1X2NA 4CHUA 2GOMA 2VC0A 4HF0A 2GWRA 2KIMA 3AG2H 4KHUA 3S17J 2Q36A 1HNZK 3NQOA 1C6VA 3DRSA 1U8RA 4FWKA 1GLJO 1QSLA 4WFBL 2XAQA 4A0XA 1C0UA 1NM1A 5AQPA 3PQJA 4Y1DA 3SCXA 4Z4EA 4BR2A 4FWOA 1WJFA 2N8GA 3TW6A 1R0AA 1YHQI 4HX7A 4XRSA 3EEQA 1NTCA 1W7PB 4OAZA 5ILUA 1G3SA 3FM3A 4X0GA 2IA2A 4TV7A 4FPBA 1HCRA 2V1NA 3L2CA 3A1YA 4BGDA 2LD5A 1W7PD 3KK3A 3DTEA 4YNQA 3DM2A 2Z1DA 4NUBA 4WX9A 3NF8A 5AQFA 2F4VK 3IKVA 4MQ9F 2XHKA 3CC2N 4DF8A 2A5YB 1OCCH 3BEXA 1QHGA 4EEFG 2FXAA 1Z9CA 1N77A 3KD5E 2QVOA 4I2OA 2XIGA 4UUVA 1ITYA 1V5EA 2R7FA 3TR8A 3CCJN 2WFBA 3SAHA 3HKZA 4FX4A 2X78A 2D4WA 2XC7A 3JAMO 4FWMA 2VQCA 5BPLA 2BGCA 2JUGA 4Z6YA 4IZZA 1D4XA 2XO7A 2O0YA 3A03A 1ONVA 2LLKA 1WAFA 4HEA2 1WI3A 2XF5A 5KPZA 2K40A 1VZ0A 3WE3A 3C3WA 2L4MA 4AIHA 4B1WB 4CJ4A 5JICA 3H5AA 5AJ3K 2PBIA 3O3GA 4CCHA 3ZN1A 1D5VA 1A5WA 4CZKA 4PA1A 3M3YJ 3V1RA 2EFNA 1ETWA 1XSXA 3ZGKA 5HOOA 4X62K 2MFZA 4ASNA 4P5OA 1UAAA 1SV5A 3I0SA 5IYDJ 1JT6A 3HUGA 5FKKA 2DQLA 3A5NC 4OVLA 1LAWA 2B7EA 3BY5A 5AFUA 2GBYA 1U5TB 5LEJA 1WSFA 4KICA 5J2MA 3AVJA 3NF6A 5LFAA 4M3TA 5H2FC 2L3DA 2W40A 4N4NB 1R49A 4FWSA 1YJNN 3RYRA 1U45A 5FLVA 1MH3A 3QINA 2L2OA 3RPUA 3OYBA 1LW2A 3CCLN 2HDCA 2ME0A 4EJVA 2LF8A 4C1NI 1FSEA 1Y6IA 2DAOA 3OYIA 1TUUA 5M1OA 2DN0A 1H9TA 3CLOA 5GAEJ 3ISNC 3MXIA 5EZGA 1BDGA 5HP1A 2FLOA 4CE9A 3ZMSA 3QDKA 3K1MA 4AC0A 2NUBA 3HOUJ 2OUMA 3F22A 4ISEA 4LJZF 3RRGA 2XGCA 1RTJA 3L7WA 1XS9A 2C6YA 4IZ9A 2UUCK 4LF8K 3BTLA 2EV5A 1VI0A 4D0PA 2ZJPF 3RMDA 4FPAA 1HX1A 3R8EA 3HTSB 5M1FA 2ATQA 3LSKA 3TAMA 1P2FA 4IPAA 1R1VA 1RT6A 4ISFA 4ENKA 3JTGA 3H3UA 2IS2A 1V3FA 5TISC 3TP3A 3VB2A 1TQMA 3BG3A 3AKZA 4RA2A 1Y8QB 3I55I 4EV0A 4CXFA 3NGIA 4XLPF 2GXGA 1WSGA 2O8BA 1ZRCA 2IPQX 2RN7A 5HNFA 1DKGD 1XQSC 1EV7A 5JS2A 1TT0A 3TWHA 3O4NA 2M0MA 4RGUA 3R6MA 3FMSA 3AO3A 4CCNA 4DR1K 4FLXA 4ILHA 4YG2F 5DM7F 1GLAG 2D0CA 4P55A 3J7ZO 4XKCA 1F1ZA 3PY8A 2JMWA 3RYPA 1MZBA 5FJ8J 3MAJA 4LFCK 3TW7A 4BHPA 2DT5A 2EZHA 3LFUA 2K4JA 1RDWX 3T19A 4BKXA 2RQPA 3TEDA 1ZG5A 1SZ2A 2EZIA 4GYGA 4DS5A 3K5OA 1VQ9N 1HLVA 3SDGA 3ZQCA 1HYSA 1VFCA 1YW8A 3N4PA 2FMYA 4I09A 1OISA 2DFIA 3TSQA 3E6MA 4DSKA 4DJAA 2RNGA 1IJJA 3ABKH 4IRIA 3LDLA 3SUOA 4FJXA 3AVHA 2HHHK 3SJJA 2V9VA 3K6GA 4F9OA 3K5MA 4W5NA 1XMKA 1YIOA 2CYYA 4M3RA 1BM9A 5J1EA 3U8XA 2HHTA 1T98A 4B1VA 3J81O 1K83J 3L00A 4ITVA 4BUPA 2GELA 4AU7A 2Q97A 3QBXA 5AQGA 1JT0A 3BPXA 3DKXA 4NBQA 4BL0B 1MA9B 3M1EA 2OBPA 4O55A 1W7AA 2DMPA 1FBQA 3ZT1A 2HR3A 4MFBA 2MC3A 3WE2A 1LDJA 4PJ0C 2BY2A 1YITI 3DLAA 4KFBA 1PDNC 2P9LB 2F8SA 3OV8A 4K42A 4A6EA 1WN7A 3BF1A 1BI0A 3GCMA 1DPRA 4ZC3A 5ED4A 2P6SA 3BG6A 5T7BA 4RTFD 1FPQA 5C4JJ 3H9JA 4L3QA 1ETYA 4FCYA 5J4VA 2LR8A 2L9RA 4HTLA 1TKTA 2QF7A 1WUAA 3K10A 5CQEA 4KFCA 4FZXC 4R8HA 4EAHD 3DKWA 1SFKA 3ZMTA 4QOZB 3GXOA 3DLLL 1YTYA 3OY9A 2G8WA 1YX3A 5LJVA 2AO9A 2B4JA 3VYSB 2I8DA 3Q5FA 3C2HA 1EJ9A 3TQNA 1RBVA 5JI6A 3J7YP 3N05A 3JRHA 1JLGA 1ZGJA 3BCAA 4UVAA 3TOBA 1MD0A 3LAJA 1YYVA 5E3NA 4IWVA 3IRQA 1WBDA 1E3HA 3U3YA 2NNWA 3KEYA 1I1GA 3CF5L 3FF5A 4JX4A 5E1XA 2AA4A 4LF6K 4J01A 4BR5A 5FRMA 1VQNN 2HW3A 4KHSA 4OO1J 4LFBK 4EFHA 2BHYA 5LGTA 2F8TA 4D5FA 3I54A 1RNHA 2WBMA 2XRLA 3O5BA 2GV9A 1W2BM 2O7OA 3B02A 4FJIA 3IAS2 3H3OB 5EXWA 3WXIA 3LAMA 3T8TA 5E41A 1BIZA 3PO2J 2RNJA 3VERA 3FXQA 3KP7A 2PJPA 2VPRA 3GTKJ 2PMUA 2RE2A 2Q0RA 3PO4A 4XH4A 1B9NA 5BN9A 2OAZA 2A05A 1EX4A 1EETA 4M7YA 3CQXA 2JPCA 4E6KG 4CF1A 3OSGA 3V9SA 1DU0A 1JUSA 4ZDPA 1KVAA 2HKOA 3VA0A 2R5ZB 3THYA 3S93A 2F96A 4I2PA 2K27A 2HYJA 3BC8A 1FBUA 1TUYA 3EUAA 3SAFA 1CGPA 1DTQA 1R22A 4BQOA 1E3OC 1HNVA 1TNSA 2HQRA 3C7JA 1JCFA 2A1RA 4FJ8A 3CDLA 3OYJA 1VQON 1WZ2A 4CGZA 3AVFA 2JRTA 3K59A 2F5FA 2Q2RA 3DLEA 4DS4A 2Z2SB 4Y52J 4RAFA 2M1BA 1CZAN 3WTVC 1NMDA 4FWQA 4CI6A 1XI1A 4DV5K 1BC7C 3VFZA 1M90O 1TTYA 2DOEA 3S3NA 2IRFG 4L0YB 3QBWA 1K6YA 2ASOA 1MBFA 1PVEA 2UXNA 2F9TA 3FXKA 2Y75A 3RCOA 2YS9A 4OMZA 4NNJA 2P9NA 3E1SA 3ERMA 3HRUA 4KMUX 3LA2A 2IBDA 3J80Z 3CI5A 4I9LA 4LC9B 2VC1A 3K5LA 3KE2A 3IRXA 3I71A 4CIFA 3ENOA 3B6CA 3ZLJA 2XPUA 4UUSB 1RPWA 2FOKA 3EZWA 2GM4A 5E17F 5C25A 2P9IB 1FYKA 3W2AA 3GL1A 1XGMA 4G7HF 3TO7A 2KZVA 1OYWA 1VSIA 4I2QA 4QS7A 1HKQA 1YE9A 3NE6A 2B9SA 1FLIA 5J2QA 4DZJA 5J1UA 3R61A 4O44A 3KLEA 2NVQJ 1F4KA 2A68F 3LNQA 4KKOA 5LHGA 3L2QA 5FRNA 1Z21A 2HFHA 4WF9L 1RDBA 4LFUA 2ZJPL 1JGSA 2E5NA 4WXHA 3ZQHA 1YVNA 4CECA 2DI3A 4DQQA 5LL6Z 3ZSYA 1J0RA 2HMPA 1R1UA 4IF4A 5CLSA 4LD0A 4HX8A 4DV6K 1EWQA 1IN5A 1K8KB 1WSJA 3Q9VA 2KZZA 1I6XA 1BC8C 4IOAL 2XRIA 4DTJA 2R7DA 3OS1A 2YKNA 4MFEA 3C7NA 1X9WA 2FBHA 1NNEA 3K4KA 1X9JA 2FBTA 2F5VA 1TQIA 2GOXB 3FMRA 4FASD 3ENBA 4U0VA 2CH6A 2H8RA 1J5YA 2XPVA 2AS5F 3C6AA 3MWPA 4IO8A 4CHQA 3CCRI 1TKZA 3QEXA 5GP9A 4DHYA 3L3VA 1P7JA 3ESWB 2O4IA 3N4QA 2XAUA 3WGGA 2ITGA 4N0BA 1VQ5I 2E7WA 4NC7A 3D5RC 3RKQA 1Z6RA 3WXLA 3QEPA 1UA1A 2P9KB 5SWMA 1RI7A 4V2FA 2GWKA 2DYRH 3BT9A 4XQFA 2G8KA 5I42A 3KLNA 1USTA 2L4AA 3L4IA 5MLCQ 3C2GA 4OPKA 2LKPA 3KYDB 4RAYA 1U2VB 2I7PA 3CC7N 4HF2A 5K7FA 3CETA 3UKRB 2MD5A 4MTDA 1ZBLA 4L9TA 4BEHB 3Q7BA 3ERED 4V2GA 1EKEA 1IRZA 1DQUA 1FP1D 3LFKA 2M3AA 2RKHA 3AARA 2X6YA 2WOMA 2J4RA 2RKIA 3BCBA 3GFMA 3KJVA 2EWNA 2DOFA 2L0KA 1VSLA 4CBWA 4DMNA 3AVBA 4IG0A 2AHQA 2HBJA 3G1MA 4F55A 2LC2A 1SEUA 4DTRA 1B72A 3TANA 4F4KA 4PJNA 3VQPA 4IO9L 2W48A 2O8KA 4I9QA 3JRIA 4UHTA 4ZTFA 5HLIA 1B9MA 5J47A 4WWCA 4H0OA 3AVCA 1C0WA 4FYDA 3DBLB 2HF4A 2ID3A 4A3CJ 4N76A 2V1XA 3V81A 2X6XA 2VG5A 3RQ4A 3CQ8A 1ZTRA 2HSTA 4I01A 3LDPA 2HVQA 4M3FA 1Y1VJ 3GZ5A 2W42A 1O3SA 1I5ZA 4K2EA 1B9DA 5EVZA 5LD2C 1LDDA 5F0CA 2HVSA 4BRQA 1V54H 1RR7A 2H8WA 4II2A 4J00A 1ASUA 5LRSA 3ZQLA 3MN7A 2XSJC 3DPTA 4BHCA 5K5QA 4FSVA 3I0TA 2X74A 5BPNA 2V7ZA 1ATNA 4YORA 1U3EM 3MXJA 1U0JA 2DYSH 2MG4A 3C18A 2ZSHB 4L9JA 5FO5A 2X0LA 1YRNA 2A41A 3M8FA 3JSOA 4B8CA 2Y0SN 1X4OA 2PG4A 1HQCA 5D5WB 4DSLA 1EA3A 1ETKA 3CFRA 2ETJA 4JKGA 4LITA 4GCVA 1T39A 3OIOA 1HNIA 3DXKA 5BREA 1VQPI 4CFAA 3WODF 3DI6A 5LMUK 1V4SA 1L0OC 2P0WA 1RR8C 3QICA 4CIGA 4EM0B 4B8AB 1NG6A 3KZYA 4AHSA 2FNAA 2ZCWA 4BQNA 3VQEA 1N36K 1J7KA 2OV7A 2JA6J 4QPQA 2FF6A 2QWNA 5EX5A 3HOVJ 3O9TA 2CUJA 2W25A 2OPPA 1W36C 2MA3A 3HYFA 4C2UA 1NK5A 1V4RA 3O1WA 1WKMA 4K43A 4YFXF 1NJIO 4K8XA 2O9LA 5F27A 3K2ZA 4CJEA 5K14A 2UUAK 4HA8A 4MNUA 3CCVI 2QWQA 3GEZA 3VSLA 4CFCA 1XCVA 3TAQA 4KB0A 2G7HA 3ECHA 3CCVN 1G3YA 3RTVA 2MABA 4IEIA 3ZMDA 5FB2A 3T69A 1SFXA 5FKMA 2DK8A 5FD5A 4C3HJ 4F92B 1NGIA 2BUPA 1QPMA 2OCEA 4AIJA 1CZ9A 3IWZA 4Z4HA 2VXDA 2R7RA 2VG7A 4WE1A 4DUZK 4DV1K 4DWIA 3CJ1A 9ANTA 2ELKA 1OH7A 4W97A 4FE4A 4X6AJ 4H0XB 4CEDA 3U3GA 3OIPA 1JLBA 2M4GA 3SMSA 4MLOA 1YS6A 1TWHJ 3DU6A 4JD2B 4QLCU 3DMJA 3DLKA 5DD8A 4CEZA 1YLFA 4J8FA 3THVA 4B9TA 3RTRA 1XSDA 4O5VA 3EUHC 3M1FA 5M1NA 2HOEA 1Y8RB 2O8XA 2E88A 1YW7A 1SANA 4UV9A 5CVRA 5BS6A 3OYLA 2CH5A 3LA7A 1FKPA 2NRWA 2Z99A 4JNEA 4CD1A 2KHMA 5IT9O 2HBLA 1MBKA 4IEEA 4BC2A 4BS9A 4DV2K 1SQKA 1IN6A 4JYKA 4KNYA 3UKUB 3WTYC 4ZDOA 3R9PA 3GTJJ 1YRNB 2KIUA 2LSNA 3BF3A 3WGHA 2NRHA 1XMOK 1UFMA 3CYMA 3TKYA 2KLOA 4L8RB 3MEDA 5L3FA 2WAFA 4CJKA 3KPHA 4U67L 1DGKN 5J2NA 4JRPA 3TBIA 3O1BA 1Z7LA 1VQ6N 4C30A 2JTVA 3HB9A 3J7AY 1ZRFA 4DYQA 5FPMA 4W1UA 1GLFO 2K85A 2MW8A 5CVJA 5J3LA 3ZETB 4J19A 4AM7A 3C6HA 4FVMA 5CHIA 5LGNA 2X4HA 3FHZA 3ALYA 3ZSXA 4EJOA 3OL3A 3REOA 1QVFM 3H3VK 4CJWA 3V9XA 1WJCA 1RKTA 2VCPA 5AZJA 5EY4A 4JI1K 4CK3A 4DTNA 1LWCA 4PKHA 2OTJI 3SQNA 2M9HA 1R36A 3GOIA 3EN9A 2HS5A 2CQKA 1HDDC 4M41A 1LV5A 4IXCA 3UKUA 2AXLA 4G9YA 1ZN2A 4M3EA 3UKGA 1J75A 3DWLA 4A5BA 2X1EA 2RVCA 3OBYA 2E2QA 2YHYA 2KFNA 2H1KA 3VQ6A 3JREA 2EA2A 1MBGA 3A5MC 5BRHA 1X1CA 2QQBA 5LJWA 3EY1A 3P7NA 4RW9A 3FK6A 4G7OF 4DTUA 2KQ2A 3QAHA 1NGHA 4OKEA 1BCOA 1S6PA 4KYWA 2PX9A 4CZGA 2KDZA 4GY2B 1SVOA 3EE8A 1O13A 2M8GX 1S1XA 5FLMJ 4KH6A 2G8VA 3W2VA 2EWSA 3GE1A 4CFBA 2MLKA 3FXOA 4IXAA 2G0EA 2E2NA 1VQ5N 2HQNA 2WA0A 2XUBA 2P9KA 4H0YB 2O8DA 3F9MA 3A2FA 4X1EA 4WXDA 1KYZA 2Z33A 1OMIA 2DJNA 3HM8A 3KIOA 2ZXJA 1RILA 3UB5A 2DTZA 4PK4A 1RIOH 4A59A 1BIBA 2ELJA 5DMRA 3AAPA 3AVLA 1TKDA 1LEBA 1BR1A 5DM6L 1U2VA 3W3DA 5C4XJ 5AZIA 2EJRA 1D5YA 1NLVA 4XH1A 3J81Z 2DA6A 4CYCA 2R92J 1BQNA 4E7JA 3MK6A 4L9VA 3VWBA 4IHTA 3TL4X 1IKVA 2OPQA 3LPUA 3KWGA 3HL2A 1TLHB 5J1RA 1SFOJ 1FZPB 5A2QK 4DV0K 2LY9A 3I56N 4KA4A 1D1BA 2BDPA 4JX5A 2ZSIB 5B8HA 3NCIA 2E1ZA 4X66K 1IAWA 2NS7A 1XHXA 2OPRA 3BWGA 4E4HA 4UV8A 1TC3C 4A0YA 3LL3A 3MWTA 4WQ4C 1YJWN 5C15A 2EFPA 1IRFA 3NWTA 3V1QA 2ZMEB 2MD0A 1OR7C 3U21A 5BQTA 4M6VA 4BDYA 1O7FA 3D7EO 3MCAB 3RMCA 2OCCH 3LZJA 4BAYA 3J7AO 3ELKA 1UHWA 3VGKA 4YOUA 4E7ZA 3HTVA 3PX4A 4FK0A 1SAZA 3HVRA 2EV0A 3BJOA 2UUBK 3I33A 1Y1WJ 3WTTC 4BVOA 1IGNA 4IOCL 4HHTA 2F4MB 5FGMA 4BBRJ 2QXFA 2OPTA 2R5YA 3GYHX 4DKWA 4Y17A 2VJIA 1APLC 1C0TA 4CZFA 3VYRB 5ICGA 3WTXC 3HHHA 1QZEA 2ECBA 2H6CA 2LRDA 3DU5A 3LMMA 3LSIA 1GV5A 4LLNA 4OKKA 1FOYA 1DP7P 3NMUA 4AWXB 3G71I 2JA8J 2CQQA 4BY1J 3E1YA 1D5AA 2DMTA 2XV4S 1WCMJ 3L09A 1GLDG 2KLAA 1KU9A 4B48A 1UHMA 5FKOA 1PYVA 3SYTA 1JLEA 3SMPA 1IW7F 1VQOI 3O4WA 2HHSA 1DT9A 3RVCA 2F6CA 4PUSA 3HEFA 1NOZA 3F8CA 2Y2ZA 4FJGA 2DQRA 2R7OA 4OPHA 1K8AO 4CJLA 1U6GA 3CMMA 4BC3A 4FJ9A 5KGXA 2BVMA 1FKOA 1EO1A 1S9EA 1JI8A 2GXBA 1N5YA 4NCBA 4P9FA 1BR4A 3OYAA 3HPGA 3BR0A 2JLEA 1ZR4A 1NBWA 3F6VA 1VAZA 4IDHA 5F0XA 4N56A 3THWB 1NJXA 4ELUA 4KI6A 2HVHA 2FA5A 1BBYA 3GLLA 5LRRA 3C6UA 4IJAA 1ACIA 3BR1A 5H1SQ 2P4WA 2GIVA 1I27A 3CCSI 4DQRA 3AL0C 2QI2A 4G6TB 2HVRA 1T44A 2FBYA 4MDAA 1HKSA 2IJLA 2VKHA 5GAGJ 1BG3A 3LM9A 1L3VA 2ICWG 4BXXJ 4S0HB 4AUXA 1XMQK 4FK4A 3O9QA 4JV5K 4Y7NJ 4L5JA 3LANA 3W6KB 3L9FA 3P31A 2DCEA 5H6QA 3I0RA 4HQEA 1ZAOA 3CDHA 5ILVA 2KW4A 4DLEA 3H46O 1Z7UA 4DZPA 5AQJA 4H0VB 2G8HA 3JAMZ 1KLMA 4DV7K 3BUZB 2M34A 3CHWA 4IFYA 3J80O 4FVUA 5BRFA 3AA2A 4RLQA 5JMVA 3CJ7A 2W82A 3IS9A 3OBWA 4CW7B 1Q86O 2E7XA 3PNYA 2HQ5A 1A35A 1ZYRF 3SBGA 4LK1F 1R5HA 2VJJA 4ETSA 3QOEA 2A3ZA 2YNIA 4H4OA 2JWTA 4DTPA 4MIMA 2E2PA 4QAGA 2D0OA 2Y30A 2RN2A 2M2EA 3H92A 4Y0WA 3G71N 1S7AA 4UB6C 4E7IA 2EILH 2HYFA 1T8IA 1ZQ3P 1BA1A 2P81A 3CQZJ 3MMVA 1D1CA 4F3TA 2IS4A 3HBLA 5CPRB 1RT5A 3T1HK 1M1KO 4RS8A 1GXQA 3IFRA 3P9KA 3K2AA 1U47A 2O8FB 2EFOA 2G8FA 2CW7A 1Z1DA 3C1DA 2F2EA 3JS6A 2FBIA 1OCRH 3I58A 1CZBA 2ZKZA 1RT1A 1FBSA 2EZKA 2KQRA 2Q0OA 2YJEA 1YITN 1YIJN 1YS7A 4CH7A 1P6RA 3KX2A 3ZPLA 2YHBA 2K86A 1BIAA 3TI0A 2PQ8A 4IX7A 3ZSRA 3ATVA 1QZ5A 5F08A 3ONQA 5FFXA 3L0QA 4K8ZA 1P4AA 3FZFA 2QQ9A 1D0XA 4DQ8A 3H9QA 3SZPA 3P83D 1IF1A 2ZQBA 3QERA 2G8IA 1MDMB 3PSFA 1A36A 2K9NA 3W2WA 3RMAA 2XF7A 3SZGA 1TW3A 4E0DA 1MBEA 4CZHA 2IGMA 2O4GA 3FFIA 4RCHA 3F8MA 3THXB 3V6DA 3M8SA 1GVJA 2VIXA 5EEAA 3F5TA 1LUJB 3RZOJ 4DB3A 1JXSA 4CUGA 2VT2A 3I56I 3UIQA 3K9JA 1YJ9I 1TQPA 2MLGA 3H3NO 1H89C 1T95A 5GAGP 4BXUA 5LHHA 4IHVA 4ENJA 4FZYA 1REPC 5HODA 3OVNA 1SKSA 1J09A 3I3LA 3K4JA 3Q0UA 1NOYA 1QU3A 5D3GA 1I39A 3S1QJ 5L3GA 3E5QA 3TAEA 2V6EA 3P39A 3LDSA 1QSYA 4RMNA 4B44A 1TZLA 3RMBA 1K79A 1K61A 3H35A 3CJRB 1V5GA 2FE3A 2K02A 2D1HA 2O3FA 4GFBA 4JI2K 3JSMA 3V9ZA 2OC6A 4B3RK 1STZA 2Z3YA 2IC3A 1Y97A 3GTPJ 1YVUA 2RF2A 4CJ5A 5J2PA 3LZIA 3MX5A 1Q9YA 4BY9C 3MCZA 3FE1A 5BPMA 3HK2A 2QWPA 2NAZA 3CJNA 4A5NA 1LFUP 5E84A 4WK8F 3VQ7A 4B9UA 1BUPA 2FC0A 2L9SA 2GBZA 5KQDA 2WB1N 4JP0A 2NRTA 2HHQA 1S9HA 2VQHA 5K1YA 2CO5A 5C2FA 4B09A 3K0LA 4EHUA 4HCCA 2V7FA 4BXFA 3FXMA 4BDZA 2K3PA 4KITB 3G73A 2IDOA 2QWLA 4GYIA 3VA3A 3MAQA 2P5LC 3O8GA 4LLLA 5M3MJ 3CESA 4KTZA 3DBRB 1G3WA 2Y0SA 2XSDC 3HL8A 3KTQA 1HJRA 2HZTA 1B1BA 3CIPA 1ASVA 5L3CA 1KQSM 1VQLN 3OYDA 1HQUA 3OYHA 2IVNA 5DYMA 2JA2A 1O57A 3UR3C 3A02A 3CCLI 1JUPA 2BANA 3KLIA 3OWTA 3Q3SA 3JSPA 2STTA 4KDPA 3VPZA 2OTJN 3VODA 2R7UA 4CSWA 4BACA 2LK2A 1QGPA 2GLOA 2E8AA 3CCMI 3DQVC 3QEVA 2EIKH 1G2HA 1J9IA 1LPQA 1NGBA 1TKXA 1QZ6A 4IBNA 4CJFA 3NGYA 1VSFA 3GO5A 2DPUA 4CHNA 4FT8A 2R7ZJ 1FEXA 4G9ZA 4QPOA 3E6CC 3FDYA 1JHFA 3HXLA 4JQFA 3M4OJ 1ZC6A 3BR2A 3NH0A 2R93J 3THXA 3V7CA 2LKSA 1Y0UA 5C0YA 1X3ZB 2L7FP 4OGCA 2ZO4A 2ZXWH 3CM6A 1TK0A 1YT3A 4RW4A 1HSJA 4LLGF 3SYZA 2E2JJ 5BRDA 1FXXA 3JRAA 3BOQA 1NG7A 1QHHD 3P9IA 5D4SA 2Q31A 4AHUA 4XKWA 3RKYA 2VLAA 1O3TA 1JJ8C 1RBSA 1U9NA 1Z0XA 1P9QC 3FBNB 1L5UA 1C0GA 2OA4A 1U8BA 4EJTA 1P8ZA 1WSEA 1JKHA 2GEMA 4NCGA 4C1NK 3GF2A 1PUEE 2WONA 4CGIA 2E1YA 1KCFA 4HX4A 3ZP5A 2YNHA 5AQOA 4Z0UA 1J5OA 3SUPA 3DXMA 2XB5A 2WTEA 1XGSA 4M3YA 2LP0A 1E2XA 3O6WA 4BR9A 3THYB 2HXIA 4N41A 1RT7A 3EE9A 1KD1O 3LQRA 1YJ9N 4ESJA 1J5EK 5GADP 3VEOA 4JBAA 2P9SB 5L3DA 1YTUA 1BL0A 1OQYA 1NKCA 4Z4CA 3ZT0A 2K5CA 2ZJ2A 4BRDA 4FJHA 3HUGB 2X1DA 3L1PA 1WB9A 4CGDA 1YF5L 5HS7A 3AGKA 2B6AA 4QCLA 3M07A 1BJAA 2NXNB 1OCOH 2VJ5A 1JKRC 5E1ZB 1YTAA 4B1XB 1KRPA 1NK3P 4UY8O 2V4JC 2BVLA 1B8IB 1FSHA 2UU9K 4GKJK 3ID8A 2VBYA 3ULDA 1KTQA 1WJBA 1WH5A 2H1LA 2YU3A 3H36A 1LWFA 4YOTA 4U0WA 2QM3A 1G8XA 2KHOA 3LWLA 2Q0UA 1IXCA 2OZMA 1JL2A 3HOZJ 1DEJA 3MEEA 4PUOA 3ABTA 5IY5H 4E1MA 2WC2A 2Y1IA 4JS5A 3ZEUA 1ATRA 5EDNA 1TBXA 2JSPA 2DA5A 2FF3B 1SFEA 5DK5A 1JXEA 1UWBA 4X64K 2AP1A 2P9UB 3ZR8X 5AQIA 4V19K 2QKBA 2EZLA 4EATA 1YXQA 4DU4A 1TAUA 4FTHA 2P7CB 1I3AA 5DV5A 2QBYA 2R7VA 1L3TA 2MC4A 1TWGJ 1HNXK 1MMDA 3SAGA 2HU9A 4DNCA 4C8OA 4BJ6C 3BZ6A 4BQQA 1XMXA 2Q1NA 1DP3A 5ICFA 4ESFA 1IDYA 1QQIA 5FPNA 1IKXA 3CJ9A 2XPWA 1WNSA 3E5XA 3VN5A 3KYCB 3NGZA 2IA0A 1LNWA 2CUZA 4XRSG 3WTSC 3OYKA 2UWMA 3ZQFA 1NGEA 1DGWY 1R4MB 2ZFUA 3AA4A 4KT6A 4CDGA 2E71A 2QGUA 1ZK8A 2OZ6A 2D45A 2XGEA 1VK0A 2FSNA 2D1KA 3LP1A 2RREA 3EETA 4G7ZF 4CJ7A 3BLYA 1D8YA 2ZJQF 4QS8A 5F64A 3HDDA 1EH7A 1UOCA 4CGFA 4H5RA 5I3UA 2G8UA 1IRGA 4KHWA 4C3IJ 3AVKA 1KSPA 4CD3A 4YIIA 5B5EC 2PMZA 5FLXZ 2YNGA 4MO4A 2VQEK 2XY8A 3O9UA 1XCBA 1C1BA 4XH5A 5E3MA 3OTOK 2BTFA 2O8EA 2F48A 3VSKA 3WU2C 4EVIA 3CJAA 3SK3A 4HUFA 1WLJA 1A5VA 3WEEB 3U1KA 4F93B 3FK7A 1BW5A 4ZYGA 2KRHA 2EH3A 5K5OA 1LJ9A 4IDKA 2H3GX 4WCGA 5D6FA 4JI3K 4HF1A 4E7LA 1B92A 1E4GT 1K8KA 2IA1A 3DLBA 1HYZA 5FKLA 1NK9A 5F1JA 4BREA 4BEHA 3TAGA 4OGEA 1DGRM 1K73O 4A3EJ 4ELTA 3BQYA 3IWFA 1XWLA 3DXKB 3QOPA 3IUOA 3ZT2A 4CJUA 2K9MA 3V8KA 2Z16A 2BW3A 4ENMA 4JYAK 2IGNA 1BCMA 3A4CA 3M8JA 3HP6A 3F73A 1E3MA 2PYLA 3IL2A 1X9SA 4M3BA 5AR0A 2Y0MA 3WEEA 3OJUA 3S2WA 1OR7A 2W84A 1VQ8I 2PBDA 1R1TA 3GG4A 1IH7A 2M45A 4BWMA 3G6EN 1KAXA 4RM2A 1ETQA 3SLCA 3ZETA 4W5TA 3SZ2A 2BXZA 4BE0A 1OJLA 4FO0A 3VYTB 4MLEA 3G1OA 4IKFA 3CUQC 3DTIA 4M73A 2YSRA 3ZQGA 4JK8A 5FLXO 3O8HA 1RNLA 3L2VA 3AVMA 1X19A 1S5JA 4CGJA 3K7AJ 1UG0A 5CJ9A 3OYEA 2M87A 2GA1A 4HLYA 3SV4A 5IP6A 1VQ4N 4JI5K 1R9TJ 4PL8A 2FXUA 2HVIA 2UXXA 1XB4A 5B3SH 3LWMA 2JJ7A 2NVTJ 3MX2A 1WBBA 3ABLH 3HO1A 1WVRA 1PUFB 3CJTB 3U9GA 2DA7A 4QIWN 2NYXA 4HG2A 4OINF 4MDBA 1MMNA 3VQDA 2NRZA 3F2KA 3D2EA 4YOWA 4M42A 1RBTA 4GNIA 4I7FA 2ZC2A 4CEFA 4Z94A 3SQ4A 1N34K 4RBOA 4V19S 1RDDA 4P96A 4I7HA 4UUTA 3T8RA 5EGOB 1YFHA 4GV9A 1VQ4I 2YNFA 1HPZA 3LQQA 1AA7A 1XGOA 2VXZA 4S05A 4M3GA 4BE2A 4IHSA 3J80K 3AO1A 2HBMA 2M7AA 2ZMEC 2EX3A 2A69F 3K9KA 1QA6A 4JRQA 4YFNF 1JJ2M 3MZYA 2RHKA 2DDAA 5M5WJ 3LSGA 2L7KA 2ISZA 4I0BA 4B1RA 3G6EI 3S8PA 2RV8A 1QVUA 3SUNA 4LY7A 3EYYA 1SAXA 1LE8B 2PMZN 1J2XA 4CZLA 4A3IJ 3OHRA 3F8NA 4YFUA 2RC4A 2HGCA 2STWA 1FX7A 2FSJA 3KETA 4PFOA 1R00A 1CQTA 2D5VA 2Z1JA 3AVNA 1NU0A 1QZZA 5SZTA 1VQNI 3GW2A 3MQ0A 2EBIA 5LLQA 4XNFA 1BIUA 2DDBA 2QENA 4ZTJA 2PY5A 4JKCA 3H9GA 3H0GJ 1MGTA 1U5TA 2V6CA 3E6DA 3KD1E 5B1BH 4F91B 4BRIA 4QSHA 1P90A 3W0LA 4PJMA 3FISA 2E1NA 3OMYA 4DFPA 4MO5A 4DTMA 2E6LA 1HNWK 1IKWA 3OL4A 3T1BA 2VBXA 3ITHA 1Z3YA 5ICEA 3DEUA 5LY3A 2XDVA 3D45A 4CERA 1KQ9A 4WCEL 4DR6K 3EL2A 4FLUA 4O5BA 1GUUA 3DJCA 1MW7A 1YI2I 1CLQA 3PIOL 1B4AA 4FJ5A 3L2UA 3OA9A 2BY1A 1TWAJ 4YDUC 4A3MJ 1ENHA 2KIFA 5D8KB 4LSLA 3DRPA 1JXBA 1NK7A 2R7QA 4CCKA 2E1CA 1LFBA 1HXDA 4ZH4F 1FJLA 1GLLO 2NRRA 4R79A 4AHTA 1ZBHA 4CZZA 4Y4RA 3IKMA 2L7ZA 4N9HA 3O80A 3RSEB 3L6QA 4PKIA 5M3FJ 3J7YJ 1VF9A 3D5LA 1B8IA 1X1AA 3C2BA 2IGOA 1VQ6I 4AHVA 4U7DA 3LDOA 3M8PA 2A5XA 2CG4A 2QQ8A 3K9TA 2CU7A 3HJEA 5BR9A 1WSIA 2MH9A 3ZOBA 3JRFA 2MH2A 3TSUA 3T1AA 4CICA 1SKWA 1GLBG 2YU9J 4DTXA 2HTSA 4RGXA 4H5VA 2WC9A 4JAXA 1HYVA 1S1UA 3C0BA 2QKLB 2ESHA 3CC4I 1S1WA 2BXYA 1MBHA 1RTHA 2HI3A 3VEPA 2HXOA 2PEXA 4G6QA 1NGFA 3WHBA 4PGGA 3DOKA 3KZBA 4YRVA 3VQ4A 4A2AA 3BG9A 5HDKA 2DBBA 2WV0A 4NDLA 3I9V2 5F1RA 4BJ5C 1VQMI 2EK5A 3R0JA 1ZR2A 2P9UA 4FOIA 1KGSA 5HRPA 1K78B 4DQSA 1K9MO 3BJ6A 4XL9A 4LG0B 5AQVA 4ZYHA 4BC4A 5LBQA 3HRSA 2YI1A 4KH5A 1I6HJ 2YJFA 5HRSA 1ULYA 1UJ8A 1ON2A 2VOOA 4YHHK 4A2BA 3AAFA 3S3MA 5J1YA 3BY6A 4MQ3A 4B1ZA 1TL1A 1QBJA 4OPJA 3OYNA 3HOWJ 1HKCA 5ICCA 3IH2A 1GDTA 2L9NA 2CGPA 3ZN0A 4KUMA 4FL9A 2Q8KA 3VTHA 4FLTA 2VQLA 4HBLA 3HG9A 3WXMB 3DP7A 1RTIA 1BJZA 1HC8A 2D0AA 3IDHA 3TAFA 4CCJA 3L2RA 3BR3A 2M7BA 4P9UA 3KP6A 4LIUA 1ETOA 4I6MB 4BR7A 1QPIA 4XOTA 5ILSA 4O3MA 1S29A 4I6ZA 4F2RA 3A5OC 4GDFA 1GLCG 2WBNA 4W5RA 4G12A 5E3OA 2VUMJ 3DLHA 4BRFA 2O8BB 3KK1A 4Z4FA 1T03A 3WNFA 1F43A 3ZMVA 3P5JA 3RJPA 2Z9OA 3H0DA 1AHDP 4RW7A 3V9UA 1ORKA 3WNGA 3FX3A 5IT9K 2XGDA 4HV6A 4BG8A 2VQGA 3HSEA 3BP8A 5CVVA 2HPIA 5B1AH 4A3BJ 2F7TA 2IP2A 5EJCA 1FTZA 4KTWA 4CEAA 3LSTA 1TYQB 2PJRB 3NHGA 2ASMA 2ZXIA 5J40A 5BNGA 1K4SA 1N32K 5IP9J 3GFIA 3HT3A 2A6HF 2BHZA 4XLFA 2VWKA 3VEZA 4EGYA 1VQPN 2PZSA 1DUXC 4GV3A 4FXDA 1IZ1A 3HZJA 1R71A 3DLGA 1VRUA 3QU6A 2DFFA 2FBVA 2NNNA 3GTQJ 1MMGA 4DV4K 1KLNA 4H0PA 2NS0A 2OZUA 2ZBKA 3TO6A 3VYUB 3C95A 2BY0A 4IFVA 5C12A 4FLWA 1QVTA 2COMA 1KA8A 4ICLA 2B63J 2VASA 2AJQA 3GTMJ 3TP0A 3NARA 1NKBA 2OF7A 1FOWA 2E1MC 4PGHA 1O1WA 3BZKA 5K7HA 3NAUA 5HDGA 5CYVA 2DA3A 2E1MB 5F04A 3E66A 1ZBUA 4FLVA 5C3EJ 3LM2A 2JRMA 3PIPL 3C6TA 4LFAK 1U6ZA 2ELHA 3HOSA 5AQKA 2R7XA 1J6ZA 2LOOA 2QWWA 1BOTO 2VKVA 3DFGA 5HL7L 3CCMN 2HB5A 4M9ZA 3CUQA 1GT0C 5ELZA 3CQYA 2FNPA 3HZ6A 4HLXA 4OKJA 4CYCB 4IVNA 2YX6A 4JI6K 3NF7A 2O8FA 4H0EA 1XX5A 1VQLI 2KIQA 4M9SA 5E8IA 2XROA 5CY4A 4BU2A 3DWLE 4B9MA 4FJKA 2ECCA 4CGHA 3HSCA 4A2UA 4KJZA 1KAZA 3ISPA 1TAQA 4IJNA 4YOYA 1OLTA 3TAPA 3PQKA 4G94A 3QP6A 4CA0A 1C0MA 1QZYA 1A6QA 3LP0A 4FWNA 2L5QA 3SQ1A 4LH4A 2LY1A 1IG9A 5E20A 3CC7I 2ZGYA 1VSMA 1SD6A 1BN5A 1IG8A 4NO7A 5GPCA 4FZZA 3QEWA 2E5ZA 3SEZA 3TSPA 4HYEA 4B08A 3QPLA 2KRCA 2ZNYA 2ME6A 1G6NA 3H5RA 1BA5A 2YKMA 4FM1A 1R58A 5BN8A 2MGQA 2EV6A 2M30A 4IRHA 3EYIA 4IL6C 4B1YB 3F72A 3H08A 5HBMA 4OLBA 4CYDA 3I4NJ 2IOCA 4ENNA 2HTJA 1V4TA 2BGGA 4FJ7A 1WJDA 2Q1ZB 3CCRN 4F8RA 4FJLA 5AQRA 4DR4K 1IO2A 2YHWA 2WAEA 3R3LA 2KJBA 3OJSA 1UB9A 1RUNA 4DLGA 1KVBA 2CS3A 4B47A 1TL8A 3H5NA 3WQTA 4XN3A 1FIAA 2X9DA 2W1OA 1HLUA 2K7LA 4HSTA 2W85A 3CC2I 4JK7A 1HKTA 4PSWA 2QK9A 2HBKA 3K70D 2L01A 3LA3A 4OWRB 2R7TA 1XC3A 5TJJA 1AOYA 3O9RA 2X6SA 1RCHA 3MECA 1IJWC 3BR5A 4KH4A 1OKRA 1JKPC 2JA7J 1FNNA 5KAFC 5AQHA 2V1DA 3VF4A 4AD9A 3Q7CA 1LVAA 3IKTA 1YQAA 3K4CA 1OYIA 3PIPF 1YHQN 2M5WA 3DYAA 1MNDA 3P4IA 5C24A 2VG6A 1TW2A 1J9AA 3W3CA 4IOAF 1BHLA 4YDUA 5AQXA 5FPEA 1VTNC 2DA2A 5F6FA 1FMWA 1IBMK 4R5PA 3NF9A 4BVPA 2QQAA 3DLRA 4KPYA 1BOAA 5DUKA 1YIJI 3KLHA 3MWMA 1SUQA 1YW9A 4P1WA 1W0HA 1BA0A 2W6LA 3ROUA 2QSHX 1MNMC 3AA3A 4OPAA 2XAGA 3QFPA 1B9FA 3W6JB 3TARA 4M6XA 5AFUH 4MEYF 2P9SA 3CXCM 4CCLA 4BWJA 2OQGA 4UUSA 4DSFA 4CVNE 1RT2A 1QSSA 1JUMA 4C8LA 4C9YA 4HRIA 4AF1A 1UELB 1H9GA 4A57A 4ZHRA 1NJWA 3B6AA 3M8RA 3S3OA 4G8XA 4A6DA 2F4OB 4KN4X 4MO7A 1SVMA 4ZYAA 5C2DA 3QNOA 3RR7A 1MDMA 3QQAA 1HW2A 2VBWA 1OCZH 1OVYA 4DR2K 1D1AA 4F7ZA 4CZEA 1T7PA 4J2EA 2FX0A 1RUOA 2O6GE 3PFYA 4EP4A 5J8CA 3G4SI 1T6CA 5M1PA 1HW5A 3F8BA 5JS1A 5DEQA 4XOPA 4XLHA 2P9NB 3VEWA 2DJIA 4KIGA 4XR6A 1IG7A 1OVQA 1U9OA 4D9JA 2H6BA 5H20A 3BR6A 3D0PA 3O2PE 3EYZA 2R4GA 4XBFA 4GRIA 5H6RA 4N5SA 3VGMA 4A61A 2B5JA 3NWSA 3VPRA 4BE1A 1NWKA 2EB7A 3EO3A 5GAHJ 3J8AA 1MWKA 4M45A 4UQGA 3I53A 2PYJA 5IP7J 2YX4A 4XRMA 5HNHA 1ZBSA 3CCSN 5D5UB 4I99C 3P1GA 2EFWA 3K2PA 4NLBA 1X3MA 2XKOA 1Q7YO 1UG2A 1ZH5A 4KI4A 3OSFA 1MKMA 1UAXA 5FPDA 1QVGM 4PCQA 1X4PA 1CF7A 2FBXA 3SPZA 4NQWB 3ZSZA 4U7BA 3FZHA 5IT3A 4GW6A 4M9XA 3LAPA 1S72I 3DF8A 4JKAA 4HW0A 4XN0A 4A3KJ 4B3OA 2OJED 4E70A 3CPWM 1AWCA 3E5UA 3RSNA 1S3JA 2ZXHA 2TDXA 2LSOA 4A3LJ 2RAEA 3MDQA 1NKEA 1IBKK 1JLFA 3O08A 3E0JB 3MEXA 4NYNA 4Y13A 1FIPA 2XAJA 2V7YA 2CFXA 2QW9A 5AQMA 3ASOH 2COBA 3RKXA 3BGRA 4H5WA 3CCUN 1W9HA 2LFBA 1GLNA 4YELA 5HRNA 1BI4A 4M6YA 3FXLA 4HNVA 4A3DJ 4CF0A 3FKJA 4UVBA 2VYPA 5CYMA 4CHOA 2VT3A 5KQ8A 3QMLA 5JLXA 2WAQN 4A3FJ 4CJVA 4RWTA 4RW8A 2R5YB 2DPDA 2Q3SA 3HI0A 1JLQA 3K57A 3V42A 3D1NI 5KNLA 1H0MA 4QS9A 4A5AA 4MLHA 1FOXA 1MDUB 1KQ0A 4Q48A 1L3LA 3C65A 2UYTA 3U1DA 3I5UA 1NMNA 2QTDA 1SD7A 3QYEA 3WNHA 5JHUA 3RZDJ 3F6OA 3KP4A 1G59A 3ZT3A 2DTRA 4JI4K 5CE3A 2JWLA 2E34A 4RM3A 4LGWA 3ZQIA 2Q2EA 4N4OB 4MTEA 4I98B 1X3WB 3CTAA 3ZMUA 2NRAC 1ZRDA 4YEJA 1YJWI 1QE1A 4AIDA 2HEOA 2P1JA 1N25A 2KISA 4HV5A 1GXPA 1H8AC 2JGUA 4IG3A 4H8KA 3ASNH 3QIOA 2E5LK 4WFAL 2LNBA 1D0YA 2ZGZA 1TV6A 4BH9A 3FGUA 5C42A 5EYRA 1ZLJA 3ZSWA 1TVRA 1QRYA 2E2HJ 5K5RA 2VONA 3QLHA 1NK6A 4FJJA 4GV6A 1VQ9I 1Z6TA 1DTTA 1RDCA 2OPSA 3M5RA 3HGYA 4CZCA 4JI7K 2XVCA 3CCEI 3K58A 1ZHFA 5GPAA 1TGOA 3RPUD 3O4QA 3QEIA 3CCQN 1Z67A 2E19A 3RRHA 4XLNF 4CZIA 1XN7A 2YHXA 1ZGWA 3FHNA 1KFDA 5AIQA 4J2BA 3R60A 3A01A 2VOPA 1NK2P 4OOIA 5DM7L 5E1WA 4KTQA 1T6SA 2KL4A 4FISA 3GBGA 3CDIA 3S1MJ 5IT9Z 2BH1A 4Y15A 3AVGA 4NLCA 1IRXA 4KISA 4HTUA 4EZ9A 3HIFA 4JKHA 5M5YJ 4JS4A 3COAC 3EUKL 3IMXA 2DO7A 2ZF5O 4FLYA 1S1VA 3ENHA 5A2QZ 4BQZA 2FOWA 5AQWA 3FKIJ 5DM6F 1TWFJ 1ATSA 2CQNA 4NXMK 3HSRA 3WTWC 3HRTA 2E2IJ 1U04A 3C7NB 3FXUA 2CGKA 2IAJA 2QLZA 3H45C 1WFXA 3DPUA 4XMYA 4F52A 2HQAA 1Z26A 2KMUA 1TL3A 3SQ2A 1T3VA 4CEEA 4CF8A 3O3FA 4B9SA 1SD5A 1F5TA 5AQUA 1QS4A 5AQNA 4E89A 4KBOA 3ECOA 4B3XA 5JHFA 4LH5A 4LG3A 3S14J 1ZXOA 5AQQA 2CFOA 2P9IA 1Q8IA 2FD5A 2QSGX 1S7EA 1XTAA 5IPAA 3CMAI 2CSOA 3IAYA 3NH1A 3KLOA 3SPYA 2HHVA 1W97L 1JTXA 4FETA 4WXCA 3V7SA 3NBPA 1R4NB 2KT0A 4QWQA 1OKJA 4DU1A 4KHQA 5CZ1A 3MZ8A 4B3AA 3SJHA 4I76A 1CXUA 5KI6A 1LCUA 4M74A 4C8NA 1B6AA 3ZMZA 2KRFA 4BBSJ 4GMJB 4XICA 4M3ZA 1ERDA 4EQQA 4XKBA 3MFKA 1DDNA 1BGXT 1OCTC 3VQ5A 1D8KA 4BROA 1Z05A 1FW6A 3BTCA 1YO5C 4FJNA 2O61A 4DUYK 1ZYQA 1OFCX 4OLAA 2ZFWA 3E6BA 3HC7A 3T5XA 3OR2C 2PLYA 4DSEA 3SNNA 3MKWB 4LF7K 3ZEUB 3JCUC 2WTUA 2VE8A 1LKXA 4O5FA 4I02A 4ANJA 5I9EB 3GDQA 1Z91A 5DTDA 1M1EB 2BOLA 4D7MA 2NNYA 3N4MA 2GZWA 4RB1A 4FW1A 3CCJI 3E9PA 3IG1A 4CJQA 3A8YA 3KEQA 3FZMA 4DR5K 4IEJA 1FMVA 3H1CA 3SFIA 4NHJA 1I3QJ 1IDZA 2CV1A 3ML6A 1HJOA 4HUGA 2BYVE 2IS6A 2Z5UA 3ABMH 3KK2A 1IXSB 3DKYA 2DLLA 3FMQA 4UY8I 3U4LA 4E19A 5KTQA 1BI1A 2CUFA 3HSFA 4EJUA 2DY4A 1U2WA 5FFZA 3AA5X 3LSJA 3L3UA 4DV3K 1KFSA 3RPQA 5FKNA 1HA8A 3A0HC 4O0JA 4HWIA 1FC3A 4JEPA 2D0BA 2GTDA 3WU1B 2HZDA 1C0FA 1X58A 4OIPF 4ELVA 1W5TA 4LD5A 2CQ7A 4XSXF 1XSVA 1LQ1A 3PO3J 2A40A 3SFZA 2CV0A 3R1XA 1U5TC 1K78A 1R23A 2HNDA 4ZJZA 4FW2A 4GXOA 4MHGA 1YUWA 4H5TA 4K41A 4CCMA 1FP2A 2HDDA 3K1PA 2YX7A 5HLTA 2JSCA 1KXPA 3TO9A 2FUG2 4O8UA 4FM0A 4FHTA 3MN6A 4ID5A 3BG5A 5TGTA 3CD6N 1HBXG 3SJMA 4YOVA 2HF3A 3CJCA 5DCFA 2E1OA 2HWVA 1WSHA 4CZMA 3ZSQA 1IN8A 2W00A 3KKRA 4BDPA 2YHAA 3KP3A 3GTGJ 2FSWA 1T0FA 1RT4A 1GV2A 5AIPA 3GTLJ 4EHTA 2JQ7A 5EG0B 3EKUA 4BRMA 1T0FC 4O0IA 1YX5A 3BROA 2ZNZA 1R5ID 2KPMA 4RB2C 1JKQC 3KP5A 2A5WA 2RGVA 4U88A 1A5XA 4J2DA 2G7UA 4D7NA 4JN4A 4BG9A 2I7NA 3M8EA 5CR4A 1FWZA 2HHWA 2DTUA 3OYMA 3QYBA 1WHUA 3IH4A 2D1VA 1TNTA 3QYFA 4B8XA 1EF4A 5JLHA 4CJPA 4WQ5C 1SKRA 2VGMA 1JL1A 3F9KA 3K1NA 5EZHA 4DOZA 3PIOF 4A5MA 3FLCO 3CFPA 3HPOA 2VN2A 5DD4A 1RGIA 1IUFA 1JTYA 3VESA 5EEHA 3I8BA 3DBHB 4JD2A 2JT1A 3S15J 3DXMB 4DSIA 3F23A 2X1CA 2P6TA 2HOSA 1E17A 4IOXA 2VBZA 4BHBA 5EG0A 5BPIA 2PFUA 1F9NA 2EIJH 2VJ4A 2QBYB 2GUIA 3UE5A 4ZZDA 2A6TA 3FIWA 2JZYA 3EPZA 2YV0X 2IS1A 2AQEA 3WUHA 2X6WA 1MJBA 3U9DA 2W41A 1MMAA 4ABZA 4DGWB 3G0ZA 2DW4A 4BRPA 3S1RJ 1GOAA 3PX0A 2Y1JA 2NS8A 3HHGA 1N78A 3V7RA 1HKBA 3MXMA 4LF5K 3VQQA 1T56A 4C2TA 3CFOA 2IIRA 3IH3A 3CMEN 5AQZA 3WHCA 4C3JJ 2E35A 4YY3K 4C23A 3CM5A 3E7LA 1VQKI 2KTQA 5FLXK 5F0HA 3NVMA 2UZKA 3U2RA 1DPUA 3T1YK 2ZD1A 5AQYA 2W7NA 3OW2M 2AXTC 2JPBA 1R6RA 5LHIA 4M3UA 2O8DB 4EGZA 3IUCA 4AM6A 4B3SK 1TYQA 4ZZLA 2G9WA 1MSEC 4FWPA 2Z1IA 3TTDA 4Q0BA 4JKEA 1ZARA 1R59O 3AY9A 4B9NA 3Q0VA 1V55H 3K4MA 2KZMA 4MGRA 4XIDA 4HCBA 1ILYA 2V1UA 2OYQA 1R7JA 2XRNA 2LVSA 4FOEA 3G2BA 4HPQA 1HUXA 1S72N 3CUQB 4CK2A 2R7SA 4AILC 2ITMA 1DU6A 3BG7A 1ZREA 3WT0A 1MJ9A 4NC6A 3VOEA 1Y39A 4UNOA 1FYMA 3PX6A 4JI8K 2XY5A 4BGBA 1LFPA 3LALA 5K7ZA 3HPHA 4GVEA 4DF4A 3VOVA 4DCHA 3RR8A 2FSKA 3SDBA 3BDPA 2O8CB 1IN7A 1RETA 1Y0NA 5CZ2A 3ZX3A 1T08B 4RG8A 4YIFA 1VQ7N 4LK0F 3E9OA 3QO9A 4JKGB 3S32A 1W1WE 2W4SA 2Y69H 2NLXA 4BRLA 2QCOA 3D5SC 1R5GA 3BQZA 3LSRA 4CIEA 2EQRA 4KHPK 4U0YA 3TTCA 2PAVA 4O6JA 5F1XA 3CCQI 1TT5B 4X65K 1Q9XA 1T33A 4CCOA 1W4MA 3R4KA 2M0CA 5M5XJ 3ULQB 4EM1A 5J4YA 5E79C 3MEGA 3CCEN 5GIPA 2V26A 2VKEA 4M3XA 1JCGA 4RLFA 3M3ZA 3EUHA 1NJZA 2P9LA 4DU3A 5AZIB 1NGGA 1MH4A 1KZHA 1QQCA 3RIRA 1KQ8A 1RFQA 3HOTA 2CGJA 5JLFA 4AIKA 3N97A 1E3PA 4MEXF 2K4BA 3ABUA 4E7HA 4O8KA 5M1KA 2P5GA 4GKKK 1X3UA 4HQMA 4HVJA 1SS6A 2VODA 5HROA 1FT9A 5TRDA 4AYBA 1MWMA 3D0SA 4CO8A 2E4LA 2CWEA 2IT0A 3IP4B 3CERA 3PFIA 2HYGD 4ILJA 3QNNA 3S1NJ 1WAJA 3A0BC 3MMYB 1A04A 4Q4ZF 3G25A 1OCPA 1WH7A 2A3SA 3SBTA 1Z25A 2D5RA 2IS3A 2JVGA 1E0EA 3VDXA 5DS9A 2EIMH 4H5NA 2J5PA 3M6GA 3PUFA 4KRFA 5HRRA 3TU5A 3PV8A 1OPCA 2NRVA 1W7PA 3F21A 2QWOA 4S04A 4CJTA 2JVHA 2O5RA 5HDNA 3KEOA 2GQQA 2QUFA 3ZCMA 2ID6A 5AQLA 5TKYA 3ZX0A 3HOXJ 1QQMA 1XD7A 3GLXA 5L3BA 2HOTA 2QM1A 2LY2A 5D8LB 1SL1A 3IHUA 3HP9A 5D5VB 3BTIA 1KAYA 2KP6A 3GFLA 5JFRA 3GWZA 4PKGA 4WFNL 1Q81O 2IEKA 3I4PA 3I59B 4B9LA 1SD4A 3VF2A 1JJ6C 1WPKA 2E20A 3CCUI 2XGXA 1S8NA 5EEGA 3QPSA 3AGRA 3ZCOA 5EU7A 5KGWA 1NG9A 3WU0A 1RZ4A 2LG4A 1HPMA 3VGLA 2Z1HA 1ZG3A 1JKOC 4DG1A 3L4QA 4CBXA 2KFDA 4OJRA 4M63C 1O7LA 2X85A 3G3ZA 1QQNA 3FFKB 4RAGA 5GAHP 3Q0WA 2KFZA 3E9LA 2I5UA 3VQAA 1T05A 1OH8A 4BRAA 3ZQ7A 3EZ5A 3I4MJ 1W5SA 1N75A 1X1BA 2Y9YA 4H4KC 1LB2A 3D2EB 3JXUA 4W5OA 2QWMA 2QKKA 2E60A 2ISYA 3JRCA 5GAEP 2BE2A 4II3A 2QEXI 3QRFF 1REVA 5BOXA 3MKZA 2P5OA 1BR2A 1QQOA 2R7WA 4OU0A 3QETA 3QU3A 3GBTA 5KRSA 1NGDA 3SV3A 1I50J 1HMVA 2R7YA 1IXRC 3OS2A 3O9SA 4CESA 4B3MK 1F21A 1XC5A 1IC8A 1XPXA 2GA2A 2IXSA 2WY8Q 2BY3A 2W57A 3RI4A 5HLFA 3ULEA 4JLHA 3WXKA 4B3TK 1GOCA 1BI2A 3F3XA 3JTHA 4IFEA 3PNVA 3P38A 2X6OA 3G1LA 4JKBA 1ON1A 1WQ2A 5LMNK 1IV8A 4IRGA 1FTTA 1S1TA 4KIFA 3FZKA 1MMSA 3P9CA 1K6OA 5KVRA 1U78A 5F2RA 4JOMA 5CYQA 1FJGK 5KK1A 3WG9A 1C1CA 1IV0A 2PN6A 5KPRA 3CO7C 2UXBK 1V5FA 1T6DA 4CJ3A 3K4LA 3DAWA 3TPQA 3DLLF 4GGGA 2LKXA 2IVOA 1A6IA 2QSFX 1WJ5A 1HSTA 1W36D 1ZGAA 2WV1A 3K69A 1Q1HA 3V8LA 1S3XA 4YOXA 1O4XA 4DFJA 3ZRGA 2X48A 4JX6A 1NH3A 1NK0A 3B6OA 2KJCA 2FMLA 3VF6A 4DR7K 2E2OA 3AAQA 1NK4A 4NQWA 3KVGA 2FQ4A 3WG7H 4E7SA 2A61A 2H94A 1JCEA 5IOYA 1EWRA 3OYGA 1U4BA