1R1TA

Crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription repressor
molecule keywords Transcriptional repressor smtB
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1tA00
2BBYA 2VOOA 3QPTA 3ZMZA 3Q9VA 3W6KB 5HDNA 3W6JB 5E20A 3RDIA 4BQAA 1R00A 3GX4X 4CDGA 1TNTA 1R5HA 1YFHA 3HTSB 1FBQA 3MZHA 3WTYC 2QVOA 2DO7A 5TRDA 1JXSA 2DLLA 4Y17A 2DBBA 2JTVA 3LQQA 2DU9A 2FA5A 2QENA 3E5QA 4GXOA 3KLNA 2DI3A 1T0FA 3PFIA 5K5OA 4XBFA 5F1RA 1GVJA 1V4RA 3QAHA 2V1UA 1T38A 5ILSA 3P9IA 4ETSA 2EB7A 1G3YA 3OV8A 2G7HA 1Q1HA 1D8KA 5DD8A 2MLGA 1QPMA 2HKOA 1YW9A 1OKRA 1IN8A 3DPLC 4I0BA 2G7UA 4GYIA 5E1ZB 4LG0A 3GO5A 2DPUA 1U8RA 5K5QA 1ZLKA 2FMYA 5CVJA 2P5VA 1OYYA 1ULYA 1L0OC 2HR3A 4CICA 5BPDA 1PP7U 4HF2A 3JSOA 5L3CA 2LSOA 1E17A 4BHPA 4UXNA 1YS6A 3K1PA 3F21A 3WGIA 3HOTA 1YLFA 4LGWA 3COAC 2DQRA 4PZJA 2HFHA 1XB4A 2QQAA 2Y48A 1T98A 4LB5A 1FT9A 2R7DA 3C1DA 3BDDA 1CF7B 3ZMDA 2NYXA 1S29A 4ZYEA 4WXCA 5CVUA 4ZYDA 1LEAA 5D5UB 5ILUA 3DF8A 5LHGA 3CLOA 3S2WA 4GO1A 3H3ZA 3CUOA 1G6NA 1W7PD 3HSFA 1T39A 4HX7A 4OOIA 2WC2A 1FX7A 2L02A 1J9IA 1KA8A 3I5UA 2JT1A 2UXXA 1YQAA 2MH9A 5LEJA 2FE3A 3ZMTA 1SAXA 4N0BA 1SMTA 2XV4S 3WTZA 5BQTA 4ENJA 5FLXK 4UUVA 1R1TA 2AS5F 4PDKA 2FBHA 4HAMA 2IT0A 4K2EA 2FQ3A 1IXCA 2UXNA 5DYMA 2FNAA 3CUQA 1B9MA 3IRQA 1B1BA 1SD7A 4PGGA 1O3TA 1XSDA 5FGMA 5LHHA 1BI0A 1XGOA 3F72A 4QLCU 4LG0B 3K1NA 1K78A 2OQRA 4HV5A 5H6QA 2VODA 5A2QZ 2GZWA 3IRRA 4A0YA 3J81K 2YU3A 3V8LA 3KETA 5ILVA 4EVIA 3QPHA 5CVVA 5DUIA 4M9SA 3LAPA 1G3WA 1JHHA 3FXRA 3O2PE 3ABUA 4L9JA 1XSVA 1LJ9A 5HS7A 3RYPA 1FP2A 2P5LC 3KZZA 3LSTA 4EGYA 4HA8A 1U5TA 1XN7A 5E1XA 4EJWA 4HZFA 4S05A 2XVCA 2PJPA 1KYZA 1U3EM 2CG4A 3SQNA 2AXLA 4G7HF 1TBXA 4Q47A 2GA1A 5LGUA 4FX0A 4KT5C 2QBYB 5CYVA 2M5WA 3J7AO 1ZG5A 5IT9Z 4CO8A 5HOOA 3MFKA 3BROA 1MD0A 5TJJA 1WSUA 2CQKA 4HBLA 1GXQA 4L5JA 3WTTC 2ZXJA 4MTEA 1LEBA 4IF4A 2RGVA 1SFXA 3L7WA 2VC0A 3PQKA 4KIGA 3TO6A 3WTUC 3GLXA 2DK5A 4A6DA 3IL2A 1X3UA 4ENMA 2YX7A 1YYVA 2A68F 3U1DA 3CUQB 2PMHA 2L3DA 1E2XA 4QWQA 3CO7C 4RB2C 4JK1X 3DV8A 5CVRA 3SFZA 1RUOA 2OAZA 1IXSB 1RUNA 4EJVA 2QZ8A 5KK1A 2RV8A 1W7PA 3KE2A 5LGTA 1LDKB 3TDUC 1U2WA 5BS6A 1I1GA 3OOPA 2GAUA 1BIAA 3GFLA 5HS9A 5DDGA 2F5FA 1BBYA 4I2OA 2X4HA 4WXDA 1FSEA 1D5VA 4CHUA 1R1VA 1B6AA 1H9GA 1U5TB 1T6SA 5LLQA 2UZKA 4OU0A 3BZ6A 1VTNC 4LK0F 3B02A 3LA2A 3KEQA 3F22A 1FYKA 3ERED 1STZA 2PN6A 3EETA 3VODA 5FB2A 1MJBA 4EM2A 4LB6B 3L9FA 5D8LB 1R36A 1J59A 2ZFWA 4KFCA 2NAZA 2EJRA 2GXBA 1DP7P 1YW7A 4EJUA 4IHTA 2OZUA 4HOBA 2L01A 5AONA 3T0YA 3TOAA 2HKXA 1U6GA 3JW4A 2VT2A 5D8KB 2F2EA 2XKOA 1O7LA 4MQ9F 4KDPA 4ESFA 1TTYA 2FBKA 4NHJA 3MZYA 4UV8A 2XAHA 4L5IA 3FX3A 5DD4A 2M8EA 2XRNA 4NQWA 2A61A 3ROUA 2DK8A 3EDPA 5JFRA 2KRFA 1W7PB 2PLYA 2LNBA 1G4DA 3GWZA 3J80Z 4HDVA 1ZHFA 2JZYA 1WQ2A 2ACJA 4HF0A 2E7XA 1R58A 2ESHA 4ZZDA 4Z2YA 4KYWA 1FWZA 3GFMA 2CO5A 2VE9A 5L3GA 2OD5A 2GQQA 2J5OA 4CGZA 2EWNA 1TQIA 3R60A 2Y0MA 2D45A 4A5MA 2O61A 2EFPA 1MDMA 2O0YA 5LEKA 1IRFA 2QM3A 2D1VA 3HRUA 2UWMA 4XSXF 4WF2A 4UNOA 3P7NA 5KVRA 1QQIA 1I1SA 4RB1A 1R1UA 2PQ8A 4H0EA 3WTXC 3TGNA 2EK5A 1ON1A 1WI9A 5E8GA 3FF5A 3IWFA 3F6OA 4FHTA 2M45A 3MCZA 1XGNA 2EA4A 1Z05A 4I02A 2Y75A 2BV6A 1USTA 1I6XA 4MHGA 4CYDA 2XIGA 2W25A 4OINF 3VEPA 3ZMSA 4RGXA 5L3FA 2MD5A 2IPQX 5LBQA 1IZ1A 1T2KA 4FX4A 2FU4A 3DXJF 3DPTA 1SD4A 5J8CA 2Z3YA 3RJPA 2XUBA 4IHSA 4ENKA 5K5RA 3E5UA 1IW7F 3CJNA 1LB2A 1H0MA 1RIOH 3M9AA 2QUFA 4GCVA 4R79A 4MEYF 3Q9SA 3HHGA 1ZLJA 1HSJA 4GGGA 1TNSA 4RS8A 4ZYGA 4LFUA 2F5EA 5D6FA 5ICFA 1FBSA 3BJOA 3T5XA 4AIKA 1KU2A 2CFXA 3JTHA 4EGZA 2M30A 1J2XA 1MDMB 1YS7A 2L4MA 3V8JA 1KGSA 3HRSA 1O3RA 4IRHA 3WTVC 3CUQC 4ESBA 4O3MA 2J5PA 1PDNC 4N9IA 3GFIA 3DP7A 2FEZA 1USSA 5FFZA 4LMYA 4RB0A 1HXDA 2H09A 2HS5A 4G8XA 3WTSC 2QLZA 3I71A 3HIFA 2L4AA 1NHAA 4HLXA 3BOQA 1W5SA 2EA2A 2EV0A 1AWCA 3ECOA 2Q2EA 5CVIA 2XAQA 2QYOA 3JAMK 4BNCA 5J8FA 2DT5A 3O6BB 2JPCA 2KJCA 2R3SA 1HW1A 2XAFA 3DQVC 2QBYA 3R0JA 2XASA 1SFEA 3GYHX 3SXYA 2VC1A 5LHIA 1P4AA 2A3SA 4UVAA 4HQMA 1JE8A 1U5TC 4U0VA 2O8XA 5JI6A 3SZTA 1I5ZA 5E8IA 5H20A 3I59A 2HWVA 4G6QA 3QP6A 5L3BA 4HV6A 4M6YA 2VBYA 4I7HA 3NQOA 4A2UA 3HUGA 3BWGA 2EV5A 2KKOA 3G73A 4YFKF 1F1ZA 3C3WA 1KQ9A 4HF1A 1TQPA 4AIHA 4XRFA 3WGHA 1BOAA 5EEHA 2H94A 1J75A 3TO7A 1FSHA 1FOKA 3RKYA 2BEOA 2RKHA 1CGPA 2GXGA 3ZMUA 1FYMA 3GVAA 4OMYA 5BPIA 2VXZA 4KMFA 5DCFA 4EV0A 3BY6A 4YFXF 5HDGA 1F5TA 1JGSA 2P7CB 4KIFA 5K1YA 1XMKA 3I54A 3ZN0A 2IRFG 2ZJ2A 1J7KA 4KN7X 2FXAA 2ADUA 3B73A 5HS8A 1UCRA 4Y13A 1ZG3A 1S6LA 3F6VA 4KIBA 4AVPA 3SHFA 4BXUA 3TQNA 4BH9A 3HSEA 4U88A 5DUKA 4YG2F 4M74A 4WXHA 1V3FA 1UHMA 2WV0A 4EMSA 2Z33A 4O6JA 2MC3A 2CWEA 3IKVA 3WE3A 1DUXC 4WCGA 5D5XB 2WTEA 5FLXZ 4ESJA 4LLGF 2OQGA 2E1NA 4R8HA 1XMAA 2C6YA 1IXRC 1BC8C 4U0WA 2HQNA 1P92A 2H6CA 1Z9CA 3V8KA 1HSTA 5D4SA 1QNTA 2IJLA 2EFNA 3I59B 1HKTA 1KU3A 3R0AA 2QQ9A 5HLIA 3LAJA 2DFIA 1YG2A 3RPQA 3M1EA 3U9GA 3WE2A 4RB3C 3J81Z 2BE5F 4RAZA 2B0LA 2DQLA 1K79A 4OIOF 5DCMA 4DNCA 4UHTA 2DW4A 4BHCA 1IN7A 1MJ9A 1SD6A 1REPC 3LFKA 2ELHA 1DPRA 1EH8A 2IA1A 2EFWA 1P2FA 1K6OA 3WG9A 3RPUA 1W4MA 2ZNZA 4L9VA 3M7GA 2XROA 2DPDA 1Z91A 1UHWA 4YIFA 1BIBA 4OIQF 4Y15A 5FD5A 1EH7A 3D5LA 2WWYA 2A6HF 1YIOA 2V6CA 4G7ZF 1R7JA 2HYGD 3MWMA 5HLGA 3EYYA 3GUDA 1HBXG 3F8NA 3KP6A 4G94A 1TW2A 1F9NA 1QZYA 3LA7A 4MQVA 1ZN2A 2HZTA 2W85A 2YSRA 1YO5C 3N4MA 4LLNA 3E97A 1LNWA 3FM3A 3WU1B 5JHUA 1BJAA 1KYWA 3R4KA 2ZBKA 2VOPA 1IF1A 4ENNA 1AOYA 2LKPA 4PCQA 3I64A 2EFOA 1B9NA 1FNNA 3V7SA 3NRVA 4MEXF 2V1XA 2HEOA 2ISYA 3BJAA 4IXAA 3FWEA 2H27A 6PAXA 3RI4A 2A6EF 2LF7A 2CW0F 2FRHA 3FXUA 4XLPF 3GXOA 4OMZA 5L3EA 2IA0A 4R1HA 5HLHA 1TLHB 3JSPA 3QU6A 2HDCA 1ZREA 3FMSA 5DCMB 1H9TA 3CO6C 1LDJA 2M87A 3KP2A 2E7WA 3GZ5A 2RNJA 4PGHA 3WU0A 2ISZA 1SD5A 2OBPA 2M1BA 5HDKA 5FD6A 4LK1F 3RKXA 2FOKA 4G6DA 3V4GA 1ZRFA 1IRGA 4M71A 4HDUA 1MZBA 2P5KA 2YX4A 3EYIA 4ZH4F 4LLLA 4IRIA 3T1BA 1P4XA 2ZMEA 4NB5A 2W57A 2NNNA 2FSWA 2VE8A 3JTGA 5D4RA 2D2WA 4AIJA 1RZ4A 4P5OA 4N9HA 4M9ZA 2JRTA 4FT8A 3M8EA 2HQRA 1LQ1A 4M73A 2IW5A 1O3QA 4WX9A 3ELKA 1ZGAA 4EM1A 4KNYA 2XGXA 3ML6A 1XGMA 1J5YA 3G3ZA 1ZRDA 2P7VB 2HTJA 1BI1A 1PUEE 5JR3A 2FF4A 1ZARA 2VBXA 2IVMA 3WGGA 2STTA 5E1WA 4LD5A 1ON2A 1YW8A 1S7OA 2O6GE 2BGCA 1ZH5A 1RNLA 1QGPA 4ZYHA 2E1CA 3KP7A 3MQ0A 1ZG1A 2ZNYA 1OPCA 1FBUA 5AIQA 3TO9A 3HOSA 5ED4A 4I0AA 1XGSA 4UVBA 2HGCA 1MGTA 1O57A 2YR2A 1OYWA 4U7DA 5AIPA 2MH2A 2G9WA 1XSXA 1F4KA 2IA2A 3QU3A 2K4JA 1OMIA 4G7OF 4S04A 4U0YA 1HKSA 2V1DA 3VFZA 4B09A 1KQ8A 1GXPA 3RIRA 2VT3A 1G3TA 3GEZA 2KJBA 1FPQA 3RKWA 1FYLA 1ODDA 5CLSA 3FMQA 4IVNA 2V9VA 3CDHA 2ZMEB 3KZYA 3HRTA 2Z99A 1ZAOA 3MAJA 3M8FA 4RAYA 3EUHA 4KICA 2PI0A 2LDUA 2VBZA 3DEUA 3DFGA 3V7CA 1S7AA 5FFXA 2Z9OA 3L09A 3E5XA 3F8FA 4A12A 1LDDA 2CYYA 4IRGA 4G9YA 4I98B 1HKQA 1ZGJA 3VB2A 2EV6A 1QBJA 5A2QK 3KEOA 1UFMA 3BPVA 3KP3A 3EQLF 4BAYA 1IN6A 3QRFF 3FMRA 1P6RA 1XDUA 1KU9A 3WODF 2X0LA 1QZZA 3E6CC 3E6BA 1RI7A 2D1HA 2P6TA 4YIIA 1WWXA 3KFWX 1BM9A 5EEGA 2P4WA 1BC7C 2K02A 4XSZF 2FBIA 4P9FA 2OZ6A 1Z1DA 3HHHA 1DPUA 2KIFA 2ESNA 4BHBA 4L0ZB 4GYGA 4EM0B 4ON0A 2HOEA 1QO0D 5LRRA 4RGRA 1FC3A 4HQEA 1BI2A 2GA2A 2KIUA 2OU2A 3K9TA 2GIVA 3KCCA 5ERIA 3H3UA 5DV5A 4HW0A 5E17F 5D5VB 5IT9K 5J6XA 1YTYA 1R22A 3CTAA 4F7ZA 5ICEA 1EV7A 4JBAA 3TKYA 1J0RA 2FNPA 2K86A 3HYIA 4UVCA 3ZPLA 3HRMA 1EH6A 1SMYF 3I4PA 2PG4A 4E70A 2F5DA 5IT3A 3SZPA 3F8MA 2OA4A 2NRAC 4Q5SF 2FMLA 2XHKA 2MLKA 4IPAA 3FHZA 1S8NA 3F8CA 4CXFA 3JAMZ 4ASNA 3U2RA 2W24A 2A69F 4MTDA 2K4BA 4P96A 1OR7A 2CSOA 4A6EA 1BN5A 3K69A 3I53A 1XCBA 3IHUA 2RN7A 3FXQA 2F5CA 3FZVA 3GF2A 3ECHA 1MKMA 4M9XA 2PEXA 2V79A 1FY7A 1HQCA 4AD9A 1SFUA 4LJZF 1PP8F 1IAWA 3I0TA 1B59A 2W84A 1C0WA 1L3LA 1XD7A 1KU7A 1GHCA 2PFBA 1XDSA 1Z7UA 3C7JA 2VONA 1FLIA 1XCVA 1IN5A 4TV7A 5FO5A 3IWZA 3K1MA 3D0SA 4EQQA 2LF8A 3E3VA 2K7LA 4ZZLA 3Q5FA 3QP5A 3ZN1A 2A07F 2Q0OA 1TW3A 3GFJA 4WWCA 2BYVE 5ICGA 1R5GA 4I09A 4EJTA 2O03A 2JPBA 2JSCA 3E6DA 4M6XA 4WK8F 3KLOA 1G3SA 5F6FA 3RYRA 2PMUA 1P4WA 3K2ZA 2ZO4A 3L00A 1Z6RA 2L54A 3F23A 3HTUA 4KMUX 3L2CA 3WTWC 1W5TA 1KQ0A 2DTRA 1K78B 5LGNA 3P9KA 1IN4A 3NEUA 1A04A 3RTRA 2R7FA 1MJAA 2DAOA 4CZZA 5LRSA 5D6EA 2Z5UA 3VOEA 4HLYA 4OIPF 2ZCWA 2XAJA 5HVQC 2STWA 2RVCA 4P55A 4L18B 3J80K 4MNUA 3IC7A 3H92A 2NNYA 1FZPB 1HW5A 2QWWA 2RDPA 2MA3A 3C18A 2A5YB 2VN2A 2EFQA 3GZ6A 1HW2A 4KUMA 5DEQA 3K0LA 3T8TA 3ZP5A 1O3SA 2TDXA 3ULQB 5ICCA 4OIRF 3FM5A 3BPXA 3IKTA 3E6MA 3I58A 1D8JA 1WKMA 3LA3A 1BI3A 2H6BA 3HSRA 3ISPA 3T8RA 3QOPA 1D3YA 3V7RA 3N97A 4Q4ZF 4A5NA 5D5WB 4A0XA 2KIMA 4B8XA 3TOBA 4I01A 1I27A 4RGUA 4KN4X 4EJOA 4BYYA 1U78A 2XKPA 1JHFA 5BOXA 3ZMVA 3KP5A 4D0PA 1OYIA 2O3FA 3R61A 4MGRA 3LQRA 2Q8KA 4HYEA 1B4AA 5BMZA 2HTSA 1R23A 4YFNF 4L0YB 4L9TA 2RQPA 1LVAA 3KP4A 4KA4A 2ZKZA 1Y0UA 3O3KA 4AWXB 1ZYRF 4HX4A 1UB9A 1K7AA 1WRJA 5H6RA 2PBIA 1ZRCA 5CJ9A 2COMA 1Z6TA 4HX8A 3REOA 2XAGA 4M72A 2CGPA 1O7FA 5E18F 2NS0A 4P9UA 4RGSA 2K27A 3ABTA 2MBFA 4DQ2A 4L9NA 3BP8A 1IUYA 4Q48A 1FP1D 4XLNF 2RC4A 3P9CA 2GWRA 3DKWA 4U7BA 2HYFA 2QQBA 1TQMA 4IJAA 1S3JA 4UV9A 3TDZC 2VBWA 4JQFA 3F8BA 2IP2A 3F3XA 5L3DA 3GW2A 3R6SA 5JVTA 1DDNA 4O5VA 3AAFA 2YPRA 3MEXA 3PQJA 2ETHA 2P6SA 3ZQ7A 5F64A 3LWFA 1ONVA 2P8TA 1CF7A 4A0ZA 3BJ6A
chains in the Genus database with same CATH superfamily
2BBYA 2X6WA 4PK4A 3QPTA 2VOOA 2JUCA 3ZMZA 3Q9VA 3W6KB 3DTKA 2E2IJ 3EUHC 5F0HA 5HDNA 3W6JB 4A3KJ 5E20A 2DMNA 3RDIA 3PNVA 2KHMA 1K4TA 2R7ZJ 4BQAA 1R00A 3WU2C 2DA1A 3OYNA 3GX4X 4CDGA 1V5FA 2KZVA 3AFHA 2R5ZA 1TNTA 1R5HA 3HL2A 1YFHA 1Q1VA 3ZXSA 2ZC2A 4CH7A 3HTSB 3OYCA 1FBQA 1BL0A 3HG9A 3MZHA 2CV1A 1OJLA 4B44A 2LYCA 2L9RA 3WTYC 2QVOA 3OS0A 2DO7A 2EZHA 5TRDA 3I3LA 1JXSA 2DLLA 1Y0NA 4Y17A 2DBBA 1XC5A 2H1LA 3B6AA 2JTVA 3LQQA 3SDBA 3CCRI 2KISA 2OCEA 3TW6A 5E3NA 2DU9A 2EILH 2FA5A 2QENA 3E5QA 4GXOA 3KLNA 2DI3A 4XLFA 1T0FA 3PFIA 5K5OA 4XBFA 2ICWG 1TT0A 1GVJA 5F1RA 1V4RA 3QAHA 2V1UA 1T38A 4C2UA 5ILSA 4BQQA 3P9IA 4ETSA 4BEHA 3HGYA 2HDDA 2EB7A 3W6VA 2WAQA 3PO3J 1DU6A 1G3YA 3OV8A 4M3DA 2G7HA 4II3A 3JRGA 1Q1HA 1D8KA 3LOCA 5DD8A 4A3FJ 1JI8A 5EG0B 2MLGA 1QPMA 2HKOA 1YW9A 4B43A 1OKRA 2L7KA 1IN8A 3DPLC 4I0BA 2G7UA 4GYIA 5E1ZB 4LG0A 3GO5A 3JRDA 3CCQI 2DPUA 1U8RA 4XNFA 2LY2A 3FXJA 4PUSA 5K5QA 2QKLB 1ZLKA 2FMYA 4PJNA 5CVJA 4NC6A 2P5VA 1OYYA 1ULYA 1L0OC 3G4SI 5E3LA 2HR3A 1I39A 2KLOA 4Y33A 4CICA 2L0KA 3JSOA 5BPDA 1PP7U 4HF2A 5L3CA 1SANA 5GAGJ 5B66C 3CMMA 3M3YJ 2LSOA 4LOCA 1E17A 3OL3A 4BHPA 4UXNA 1MNEA 1YS6A 3K1PA 3OL4A 1RR7A 3WGIA 3F21A 3HOTA 3S32A 1VQ5I 1YLFA 3OYDA 2A5WA 4LGWA 2JJ7A 4MLOA 3COAC 3OMYA 2IS6A 3GBGA 3RZOJ 3G1LA 2DQRA 3KYCB 2VJIA 4PZJA 2HFHA 1XB4A 2QQAA 2Y48A 1T98A 4LB5A 1TT5B 1FT9A 2R7DA 3C1DA 3BDDA 1CF7B 3ZMDA 2NYXA 2QGUA 3FHNA 2NS8A 1S29A 4ZDLA 4ZYEA 2KPMA 3EUKL 4WXCA 5CVUA 4ZYDA 3JRHA 2H8WA 5FLMJ 2V6EA 4PJ0C 1LEAA 5D5UB 1LE8A 4FETA 5ILUA 2IGOA 3DF8A 1WJ5A 5LHGA 3CLOA 3S2WA 1MMDA 4GO1A 3H3ZA 3CUOA 1G6NA 1W7PD 3HSFA 1UJ8A 1T39A 4HX7A 4CA0A 1P7IA 2R5ZB 4OOIA 3A2KA 3PFYA 3S3MA 3S14J 3I4NJ 4M3EA 2WC2A 5KNLA 3HBLA 3GMEA 1FX7A 1MIJA 2L02A 2XF5A 1J9IA 4M3GA 3CCEI 4J01A 1A5JA 4W97A 4IHWA 1KA8A 3I5UA 4U87A 2JT1A 2DDAA 2O8KA 3NAUA 2UXXA 1OR7C 3I55I 3QPLA 1YQAA 2MH9A 3VSLA 5LEJA 2FE3A 3ZMTA 1SAXA 2XRLA 3A1YA 1IRZA 2RAEA 4N0BA 1XTAA 1SMTA 2XV4S 2RQQA 3WTZA 5BQTA 1ZELA 2W4SA 4F93B 4ENJA 1WJAA 1SFKA 5FLXK 4XK4A 4UUVA 1R1TA 3JRFA 2AS5F 4PDKA 2FBHA 1VQ4I 4HAMA 5TGTA 4BEHB 4II2A 2HVSA 2IT0A 4K2EA 3OY9A 2FQ3A 3CC7I 1IXCA 3CMEI 2UXNA 4BJTA 4E7IA 5DYMA 2FNAA 3CUQA 1B9MA 3HM5A 2EZLA 1B1BA 3IRQA 1QPIA 1K83J 1SD7A 4PGGA 4AYBA 2ZSIB 2X85A 1G2HA 1O3TA 1XSDA 5FGMA 5LHHA 1BI0A 2F5VA 2XC7A 1XGOA 3K7AJ 4AM3A 3F72A 3NWTA 4RA2A 3SDGA 4QLCU 1JTXA 4LG0B 1H88C 4BE1A 3K1NA 4XN3A 1K78A 2K85A 4BUPA 2OQRA 3JCUC 4HV5A 5H6QA 4FASD 2VODA 4E6KG 5A2QZ 2GZWA 4A0YA 3IRRA 2EZIA 2YU3A 3DBHB 2TRTA 3J81K 3V8LA 3KETA 2Y31A 1UG2A 5ILVA 4EVIA 2GLOA 2HU9A 3QPHA 5CVVA 5DUIA 4M9SA 1VQNI 4DOZA 5FKKA 3LAPA 1G3WA 3JRAA 1GDTA 1GT0C 1AU7A 1JHHA 4OAZA 1WJFA 2E5ZA 3FXRA 3O2PE 3QODA 3ABUA 4L9JA 4F91B 4ZTFA 4C2TA 2E35A 1XSVA 1LJ9A 3HKZN 2JA6J 5HS7A 3RYPA 1FP2A 2M7BA 2P5LC 3KZZA 3LSTA 4EGYA 4HA8A 1U5TA 2JWTA 2IS2A 3OYKA 1XN7A 4PFPA 5E1XA 2NVUB 4EJWA 3M4OJ 3BTIA 1SAUA 4HZFA 4DIQA 4S05A 1T95A 4UUSA 4IX7A 1I6HJ 2XVCA 2PJPA 1KYZA 3FKIJ 5IYBJ 1U3EM 2CG4A 3H5NA 3SQNA 1JUPA 1R4NB 5EEAA 2AXLA 4PFOA 3S16J 4G7HF 1TBXA 4Q47A 2GA1A 2WA0A 5LGUA 1VQ9I 1PUFA 4FX0A 4KT5C 4NC8A 5C4XJ 4JYKA 1W5CC 2EH3A 2QBYB 5CYVA 2M5WA 4BXFA 2WV1A 4YELA 3J7AO 1ZG5A 1RRJA 5HNHA 5IT9Z 4CO8A 5HOOA 3MFKA 3BROA 1MD0A 2F6CA 3ZQLA 5TJJA 2W82A 1ZR2A 1WSUA 2CQKA 2EZKA 4HBLA 1GXQA 2CUZA 3A02A 4L5JA 3WTTC 1NH3A 1Y1WJ 1XS9A 2ZXJA 4MTEA 1LEBA 2JVHA 3Q0UA 2R5YA 2GOXB 4IF4A 2RGVA 1SFXA 3L7WA 2VC0A 1X2NA 2DJNA 1LFUP 2H8RA 3PQKA 3Q0WA 4KIGA 3LSGA 4XLHA 3TO6A 3WTUC 5GPAA 3GLXA 2DK5A 4A6DA 1TZLA 3IL2A 1X3UA 3KYLA 4ENMA 4XORA 2YX7A 1FTTA 2W7NA 2KIQA 3CF2A 1YYVA 2ECBA 2VKEA 3DKXA 1S72I 2Y30A 2A68F 3U1DA 3CUQB 2PMHA 2WADA 2L3DA 1E2XA 2Q1ZB 4QWQA 3CO7C 4RB2C 1MMNA 4JK1X 2K9NA 3BCBA 3DV8A 2ME6A 3U21A 5CVRA 3SFZA 3S3OA 2KQRA 1RUOA 3BG9A 4LIVA 2OAZA 3ZQGA 1I3AA 1IXSB 4JX5A 3SYTA 4EJVA 1RUNA 2QZ8A 2NVYJ 2RV8A 5KK1A 3IH2A 2XPWA 4HNVA 1W7PA 3KE2A 3IAM2 5LGTA 1LDKB 3TDUC 1WI3A 1U2WA 2LVSA 5BS6A 1I1GA 1TWFJ 3BG6A 3OOPA 2GAUA 4BY1J 1BIAA 3BQYA 4KITB 3GFLA 5HS9A 1SVLA 5K7FA 1MBGA 2DMUA 2KFDA 2E36A 5DDGA 2F5FA 1BBYA 4C3IJ 1J09A 2OPTA 2H1KA 4I2OA 2X4HA 1DU0A 2MG4A 3OYBA 4AVZA 2JN6A 4WXDA 1FSEA 1D5VA 1JJ8C 1K6YA 3I4MJ 1VQLI 3L2QA 3IP4B 2VQCA 5EZHA 4CHUA 1R1VA 4C2MJ 1B6AA 3AKZA 3CJQB 2CJJA 3ZQIA 1H9GA 1U5TB 1T6SA 4P1WA 5LLQA 2UZKA 3HPGA 2NVQJ 4OU0A 3BZ6A 3NARA 2W48A 3RQ4A 4LK0F 3TEDA 1VTNC 1RETA 3B02A 3LA2A 5EJCA 5GADJ 3KEQA 3F22A 1FYKA 3ERED 1STZA 5IP6A 2PN6A 4HPQA 2HNHA 3EETA 3K4BA 1GLNA 4DBRA 3VODA 3LSMA 2I8DA 5FB2A 1MJBA 4EM2A 4LB6B 1A6QA 5CKTA 1U9OA 3L9FA 5D8LB 1R36A 4I76A 2I10A 3LSPA 1J59A 1OCCH 2X48A 2WB1N 2DFHA 4J19A 3SZGA 3OSFA 3J7AY 2ZFWA 2XGCA 4YEJA 1A31A 4KFCA 2NAZA 2EJRA 2GXBA 4OAYA 5F27A 2ZFUA 3OR2C 2DOEA 1DP7P 2YU9J 1YW7A 4MFEA 2DTZA 1SVOA 1W1WE 4EJUA 2OTJI 2IAIA 4IHTA 3GTGJ 2OZUA 4HOBA 4Y4RA 2L01A 5AONA 3T0YA 2KP6A 3TOAA 1W36C 2DN0A 2HKXA 3CCLI 1U6GA 2M9HA 3JW4A 1FJLA 4DZJA 2VT2A 3C2HA 5D8KB 2L2OA 2W1OA 2F2EA 2XKOA 1Y1VJ 3HEFA 5K7ZA 1O7LA 2L7FP 2R5YB 1N25A 4MQ9F 1NG6A 4KDPA 4ESFA 1TTYA 4GDFA 2KRHA 2KZGA 4BE0A 2FBKA 4BACA 4NHJA 3D5RC 1ITYA 4RMNA 1FOXA 1QZEA 3MZYA 4UV8A 3PSFA 2CS3A 2XAHA 2E34A 4L5IA 3FBNB 2JK3A 3FX3A 5DD4A 2M3AA 3OYGA 2M8EA 2XRNA 4NQWA 1U0JA 2A61A 3RZDJ 2DMQA 2EIKH 3ROUA 2DK8A 2B63J 3EDPA 5JFRA 1H89C 1MNMC 2KRFA 2WAEA 1W7PB 1T33A 1HDDC 1V5EA 3MKZA 5B1BH 1VQOI 2PLYA 2LNBA 2HPIA 4FCYA 1G4DA 2RREA 5EG0A 3GWZA 3J80Z 4HDVA 2IGMA 1OCOH 3DU5A 5EF6A 4XL9A 1ZHFA 1PYVA 2JZYA 5IOYA 1WQ2A 2DJIA 2ACJA 5EGOA 4HF0A 2E7XA 1N75A 1R58A 2ESHA 3CJRB 5F0FA 3A0BC 2R7SA 5EYRA 4ZZDA 4Z2YA 4KYWA 4X6AJ 1FWZA 3U1KA 5F08A 3GFMA 2CO5A 2F48A 4LG3A 3OS1A 3DPUA 1QHHD 2VE9A 5L3GA 2OD5A 3M07A 4XKVA 1JT6A 2DA4A 2GQQA 2J5OA 2CQ7A 3OYMA 4CGZA 5FLVA 2EWNA 1TQIA 4HNTA 3R60A 2Y0MA 2D45A 3CP2A 2Y2ZA 2WY8Q 2OF7A 2LR8A 4A5MA 2O61A 5DS9A 2EFPA 3VYRB 1MDMA 2CQQA 2O0YA 5LEKA 2AQEA 1OCTC 1IRFA 3KPHA 2QM3A 1HDPA 2HZDA 5LFAA 2D1VA 4XLEA 1GVDA 1VF9A 3HRUA 2UWMA 2JUGA 3H1CA 1DGWY 1ZQ3P 4A3MJ 4XSXF 1S5LC 2OJED 4WF2A 4UNOA 2KL4A 3MKLA 3P7NA 5KVRA 4XKBA 1QQIA 4QTRA 1I1SA 2V4JC 3IH4A 4RB1A 1DP3A 4JOMA 2KMUA 2LREA 2CUEA 1R1UA 2UUZA 3PNYA 1YHQI 3FXLA 2PQ8A 3AG4H 4H0EA 3A4CA 3WTXC 3K4MA 1BW5A 2O9LA 3TGNA 2EK5A 4C9YA 1ON1A 4XM3A 1WI9A 5E8GA 4A3LJ 2Z2SB 3FF5A 3K6GA 3H3VK 2ELJA 3IWFA 5HNFA 3F6OA 1WHUA 4FHTA 2B9SA 2M45A 1WGXA 3MCZA 3AG3H 1XGNA 2EA4A 2X9DA 3EPZA 3HKZA 4UB8C 4FTHA 1Z05A 1IDYA 2NS7A 2Y75A 4I02A 3K70C 1Z77A 3DEEA 2AO9A 2BV6A 3BLYA 2G0EA 3C2BA 2R7OA 1W0TA 1USTA 2WY7Q 1I6XA 4I6ZA 1HA8A 4MHGA 4CYDA 4QIWN 5FJ8J 2GOMA 2XIGA 2W25A 3FBIB 4OINF 3LNQA 3JRIA 2R92J 3PIPF 1VQ6I 1R49A 1U8BA 3VEPA 3ZMSA 4RGXA 5L3FA 2MD5A 2IPQX 5LBQA 1IZ1A 1T2KA 1NTCA 3FKJA 5F04A 2FU4A 4FX4A 5M5YJ 4ZDPA 3DXJF 3DPTA 4XONA 1SD4A 5J8CA 3S15J 3KYDB 2Z3YA 1X3WB 4NQWB 3CQZJ 3RJPA 2XUBA 2EIJH 4IHSA 3LSKA 1WJEA 4ENKA 5K5RA 3E5UA 1IW7F 3DLLF 1JTYA 4BE2A 2QSHX 3S1MJ 3CJNA 1LB2A 3LMMA 4A3IJ 1H0MA 2JMWA 1RIOH 3M9AA 3BTJA 4E7HA 2QUFA 4GCVA 4R79A 3X2QH 2CU7A 5EGOB 2V26A 3SJMA 4MEYF 3Q9SA 3HHGA 3OS2A 1ZLJA 1HSJA 2BY2A 4GGGA 2OC6A 2ZXWH 1TNSA 1LPQA 3LFUA 5JHFA 2VJ4A 4RS8A 2DXIA 1GV5A 4ZYGA 3F9KA 4LFUA 1JKPC 1ZTRA 2F5EA 3H0GJ 3K4CA 4FE4A 5D6FA 5ICFA 3OYAA 4XRSA 2EQRA 4H4KC 3FISA 1HCRA 1VQ7I 3WHCA 1FBSA 3GTPJ 3GZNB 1E0EA 4D1QA 3BG5A 3BJOA 3T5XA 4AIKA 1KU2A 2CFXA 3JTHA 4EGZA 4CUGA 4D5FA 3TP3A 1YRNB 3OYIA 2A05A 2M30A 1J2XA 2HOTA 1Z67A 1MDMB 2K40A 1VQMI 1YS7A 2L4MA 2MD0A 3V8JA 2M34A 1KGSA 1V5GA 2N8GA 3HRSA 1O3RA 4IRHA 5K7HA 3WTVC 1OCZH 2HQAA 2LFBA 4EATA 5F1JA 3CUQC 4ESBA 1A6IA 4A3JJ 4O3MA 3CDLA 2J5PA 1TC3C 5JLWA 1PDNC 4N9IA 4B1RA 4CZCA 2X6YA 3GFIA 3DP7A 1AA7A 2K3PA 2FEZA 3S8PA 2JA5J 1USSA 5FFZA 2MYSA 4LMYA 4RB0A 1HXDA 5IP9J 2H09A 2HS5A 4G8XA 3WTSC 2QLZA 2R7UA 5IYDJ 1SEUA 2RNGA 3I71A 3PNTA 3HIFA 2CW8A 1NHAA 2L4AA 1K61A 3ASOH 4HLXA 2VLAA 4ITVA 2BW3B 3BOQA 5J1YA 1W5SA 3D5SC 3ZQFA 2EA2A 2LC2A 3D1NI 2EV0A 1MSEC 4V19K 2ECCA 1AWCA 1WFXA 3ECOA 2Q2EA 3OYJA 5CVIA 4IOAF 2XAQA 2QYOA 3JAMK 4BNCA 3LSHA 2QKMB 5J8FA 2DT5A 2LG4A 3H5RA 2PJRA 3O6BB 2JPCA 2ID6A 2KJCA 2R3SA 1HW1A 2XAFA 3DQVC 2QBYA 3R0JA 2P81A 3BTLA 3Q3SA 2FX0A 4MIMA 1SFOJ 2XASA 2L7ZA 1SFEA 3GYHX 1F43A 3RPUD 3SXYA 2VC1A 5LHIA 1P4AA 1TL8A 1Y8RB 3PL8A 4YRVA 2A3SA 3BR3A 4UVAA 3L2WA 2LKSA 4HQMA 2VI6A 1JE8A 3ABMH 2GXAA 1Z3YA 1RKWA 1U5TC 4U0VA 4XR6A 1UZCA 3HPHA 1CQTA 2O8XA 5JI6A 3SZTA 1I5ZA 5E8IA 1EF4A 2L7MP 1IV8A 2VASA 2IS1A 4KT6A 3I59A 5H20A 2HWVA 3JRBA 3TL4X 4G6QA 3WHBA 3QP6A 5L3BA 1T08B 3BZKA 2X6XA 3DBRB 2WB1A 4HV6A 4M6YA 2X51A 2BVLA 2VBYA 4I7HA 3NQOA 4A2UA 3J7ZI 2XSJC 2K9QA 3HUGA 3BWGA 4Y7NJ 4GFBA 2EV5A 2KKOA 4BXXJ 3DLAA 3G73A 4YFKF 1F1ZA 4V2FA 3C3WA 2CH0A 1KQ9A 4HF1A 2DA3A 1TQPA 4NC7A 2CW7A 4AIHA 3BG7A 2E19A 2PMZN 4XRFA 3WGHA 1BOAA 1YJ9I 3BR5A 2H94A 5EEHA 4B47A 1J75A 3TO7A 1I50J 4QSHA 1FSHA 1FOKA 1YE9A 3ASNH 2JRMA 3RKYA 3HOUJ 4XLAA 4QPQA 1ZKGA 5M3FJ 4E7ZA 2BEOA 5J1RA 4NUBA 3FXKA 2FOWA 2GM4A 1MBFA 2RKHA 1CGPA 1HC8A 1RC9A 2GXGA 3ZMUA 5HLTA 1TP4A 1FYMA 3GVAA 4HG2A 3ONQA 4OMYA 4B48A 2CQXA 2V7FA 5BPIA 2VXZA 3FK6A 5GPCA 2OTLI 3H35A 4FQGA 1UG0A 4KMFA 3H0DA 3BZCA 1TWHJ 1EA3A 1YOVB 5DCFA 3KIOA 3E0JB 4EV0A 4GRIA 1MW7A 2CFOA 3K4KA 4EEFG 3BY6A 3FK7A 4YFXF 2PX9A 5HDGA 1ORKA 3TBIA 1F5TA 1JGSA 3S1NJ 2P7CB 2VXDA 2L5QA 4KIFA 3SFIA 5K1YA 1NK3P 2IS4A 1XMKA 3I54A 2HI3A 3MMYB 3ZN0A 2IRFG 1X4OA 2ZJ2A 1ETWA 4D9JA 4ZYAA 1J7KA 3OR1C 3FIWA 3CF5F 4KN7X 2FXAA 3I9V2 2ADUA 3B73A 5HS8A 1R4MB 4RLQA 2VKDA 1UCRA 4Y13A 3OYLA 3MVPA 1ZG3A 1S6LA 3F6VA 4KIBA 4AVPA 2VPRA 3SHFA 4BXUA 4DYCA 3TQNA 4M3FA 4BH9A 3HSEA 2X1CA 4U88A 5KHDA 5DUKA 4YG2F 4M74A 3DTEA 1R6RA 4WXHA 1WH5A 2M0CA 1V3FA 1UHMA 2R93J 3ZRGA 2Q2EB 3OIQA 2WV0A 4EMSA 4HRIA 2Z33A 4O6JA 1A36A 2MC3A 1MMAA 2CWEA 2DFEA 3IKVA 3WE3A 1DUXC 2PJRB 1JKOC 4WCGA 2QEXI 5D5XB 2WTEA 4B3XA 5FLXZ 4ESJA 4LLGF 2OQGA 4BDZA 2VIXA 2M4KA 4RM3A 2E1NA 4R8HA 4BJ6C 4G6TB 3CJTB 1XMAA 4DYRA 2C6YA 5CQEA 1IXRC 3CCMI 1BC8C 3PUBA 4U0WA 2HQNA 5EZGA 1P92A 2H6CA 4CSWA 1Z9CA 2LY9A 3CLQA 2V1NA 1HOMA 2HQ5A 3V8KA 1HSTA 2Z1DA 5D4SA 1QNTA 2B7EA 2EFNA 2IJLA 3I59B 1IC8A 1KU3A 1HKTA 3R0AA 3IV5A 2QQ9A 5HLIA 2XSDC 2QSGX 4UUTA 2CQNA 3LAJA 2NOGA 1LVKA 2DFIA 2F4MB 4A3CJ 2BHZA 1YG2A 2COBA 1BR4A 3HUGB 3PSIA 1ERDA 2F4OB 3G71I 3RPQA 4IZZA 4L5EA 3DBLB 2X1DA 2DOFA 3M1EA 4BS9A 1IUFA 3N05A 3U9GA 3WE2A 4RB3C 4C30A 2BE5F 2VQGA 2OCCH 3J81Z 2R7XA 4RAZA 2B0LA 1MBKA 2DQLA 3ZR8X 5DM7F 3QQAA 1K79A 4OIOF 2WBMA 5DCMA 3RCOA 4DNCA 1MNDA 3ZOBA 3VYSB 5E3OA 1UELB 2AXTC 3ERMA 4UHTA 2DW4A 4BHCA 5C4JJ 3CMYA 1IN7A 3HOWJ 1MJ9A 3GTJJ 1SD6A 3JRCA 3VDXA 3QYFA 1F36A 1REPC 2VKVA 1RPWA 3LFKA 2ELHA 3OOUA 1DPRA 3CD6I 1EH8A 2IA1A 2EFWA 1P2FA 1K6OA 3RPUA 3WG9A 1W4MA 4J00A 4ZJZA 3VYUB 2ZNZA 4L9VA 3M7GA 5FKNA 2EPFA 5JLXA 2XROA 3KX2A 1MBJA 2NOJB 1BJZA 2VQLA 3DEWA 2M8GX 4DGWB 2DPDA 4IHYA 9ANTA 1Z91A 1UHWA 4YIFA 3P5JA 1BIBA 4OIQF 2YS9A 4Y15A 2Y0SN 1EH7A 2X1EA 3D5LA 5FD5A 2WWYA 1B8IA 2A6HF 1YIOA 2V6CA 4PJMA 4JP0A 1WVRA 4G7ZF 1R7JA 5LD2C 2HYGD 3MWMA 5HLGA 3EYYA 3GUDA 3GLLA 1HBXG 2K3FA 1BOBA 3F8NA 3KP6A 4G94A 1TW2A 2CV2A 1F9NA 1QZYA 3ZQQA 3LA7A 4DW6A 2ZJQF 4MQVA 1ZN2A 1JUMA 1OLTA 4UUSB 2HZTA 2VB6A 2W85A 2M4GA 2YSRA 3MN2A 3CC4I 1ENHA 4IHVA 4FISA 2Z16A 1YO5C 3N4MA 2TCTA 1LUJB 4LLNA 1XG1A 1LNWA 3E97A 3FM3A 3I56I 3WU1B 5JHUA 1BJAA 1KYWA 3R4KA 4X1EA 5IPAA 1TWAJ 2ZBKA 2VOPA 1IF1A 4AIDA 4ENNA 1AOYA 2LKPA 5J4VA 2XAUA 4PCQA 1D5YA 1Y56A 3I64A 2EFOA 1B9NA 3S2DJ 2HVQA 1FNNA 3BR0A 5FKMA 1QA6A 1R5ID 2MSYA 2DCEA 1GUUA 3V7SA 3NRVA 3L2VA 4MEXF 4A3DJ 2VJJA 2V1XA 2AQFA 2HEOA 3BQZA 5GAHJ 5FRNA 2ISYA 3BJAA 1P9QC 1X1BA 1X1AA 4IHXA 2DOAA 2XDVA 4IXAA 3FWEA 5FKOA 2R7RA 3HXLA 2H27A 6PAXA 2O5RA 4YIRX 1W0UA 3RI4A 2A6EF 2KRCA 1MH4A 2LF7A 2Y9YA 1YIJI 3KZIC 2CW0F 2LOOA 4NDLA 4G12A 3KEYA 2FRHA 3FXUA 4XLPF 2JVGA 3W2WA 1UHSA 3GXOA 4OMZA 5L3EA 2IA0A 1NK2P 4R1HA 2NVXJ 2FQ4A 5GTIC 2FD5A 1LFBA 3NWSA 4XIDA 2ZSHB 4AU7A 5HLHA 1TLHB 3JSPA 3G2BA 1QRYA 2DA2A 3QU6A 2HDCA 1ZREA 4A3EJ 2ID3A 4F92B 2KT0A 3L2UA 3FMSA 2LK2A 5KAFC 2FUG2 2M0MA 1ZK8A 5DCMB 3HOVJ 1H9TA 3CO6C 2DT7B 1LDJA 2M87A 2BXZA 3KP2A 2E7WA 3GZ5A 3K4JA 2RNJA 1YITI 4PGHA 3BC8A 2UV1A 3WU0A 3CMAI 2ISZA 5FKLA 1SD5A 1TWCJ 2OBPA 2R0QC 2M1BA 5HDKA 3EUAA 5FD6A 2LP0A 4LK1F 1PJRA 3RKXA 2FOKA 4G6DA 3V4GA 1ZRFA 1IRGA 4CYCA 3K4NA 4M71A 4HDUA 3IUOA 2W00A 1MZBA 2P5KA 4Z6YA 1B8IB 4CCNA 1PVEA 2YX4A 4D7MA 1X1CA 4ZH4F 3EYIA 1N78A 4LLLA 4IRIA 3VWBA 3T1BA 1P4XA 2ZMEA 4NB5A 2W57A 1YRNA 2NNNA 2FSWA 2VQHA 5B1AH 2LKXA 1OFCX 2VE8A 1BW6A 2CMPA 2K9SA 4IEJA 4BL0B 5HODA 5D4RA 2D2WA 3JTGA 2L9NA 1EKEA 4AIJA 1RZ4A 4P5OA 1B72A 1U9NA 4N9HA 3S17J 4M9ZA 3K10A 2JRTA 2LD5A 4FT8A 3M8EA 2HQRA 4PSXA 2PMZA 3DKYA 4B3AA 2VPLA 1LQ1A 4M73A 3HZJA 2IW5A 1O3QA 4WX9A 1MBEA 1ZGAA 3ELKA 3MZ8A 4EM1A 4KNYA 2XGXA 3ML6A 2CUFA 1XGMA 3BG3A 2BY3A 1J5YA 3G3ZA 1ZRDA 2P7VB 3CCUI 4PJLA 2HTJA 1BI1A 1PUEE 2IXSA 1X1DA 1X19A 2HPMA 3VPRA 5JR3A 3PJRA 2FF4A 1ZARA 2VBXA 5DTDA 2BW3A 2IVMA 3WGGA 1LFPA 2XB5A 2STTA 1DQUA 3LSJA 5E1WA 4LD5A 1FIAA 2K9LA 1ON2A 1YW8A 1O4XA 1S7OA 2DA6A 2O6GE 2LBFA 1APLC 3M8JA 3CDIA 2BGCA 1KZHA 1ZH5A 1Y6IA 5C44J 1RNLA 4DYQA 3PO2J 5EDNA 1WJDA 2GBYA 1QGPA 1V54H 1ACIA 1UAAA 4ZYHA 3Q0VA 2E1CA 3KP7A 3MQ0A 1ZG1A 3GCMA 4XRSG 2ZNYA 5GTHC 4UB6C 1OPCA 5JVGF 1FBUA 3BR6A 5AIQA 3TO9A 3HOSA 5ED4A 3ZQHA 4I0AA 1A35A 1XGSA 3HDDA 5CQGA 1ETYA 4E7LA 3BT9A 2MFZA 3QWLA 4PJJA 4QPOA 4XKWA 4UVBA 1ETOA 1Z7LA 3QYEA 4F55A 4CCLA 4UY8I 2ELKA 4DJAA 2NXNB 2HGCA 3OYEA 2DMTA 1YX5A 2HYJA 3AG2H 1MGTA 1O57A 2YR2A 4B4CA 2HVRA 1OYWA 4U7DA 3H9QA 3HOZJ 4X0GA 5AIPA 1LKXA 1DGRM 3BTCA 2LRDA 3CC2I 2ZJPF 2MH2A 1P7JA 2G9WA 1XSXA 5E3MA 3S1RJ 1VZ0A 1FMVA 3W2VA 3H5AA 3BR2A 1F4KA 2IBDA 3JR9A 3HJEA 4ZC3A 5J1UA 2IA2A 3QU3A 2K4JA 1OMIA 4G7OF 4S04A 2JSPA 2MW8A 5IOZA 4U0YA 1HKSA 2V1DA 3VFZA 3OWTA 2BZTA 4B09A 1GXPA 3RIRA 1KQ8A 1SVMA 1BR1A 2F4IA 2VT3A 2OUMA 2E2HJ 1G3TA 3GEZA 4CYCB 1AKHA 5GP9A 2VUMJ 2KJBA 3C2GA 1FPQA 3RKWA 5BNGA 1HF0A 3A01B 1ODDA 5CLSA 1FYLA 2E71A 2XPVA 3FMQA 4JX6A 3W3CA 4IVNA 2V9VA 2KDZA 2EINH 3CDHA 3O8HA 4C3JJ 2ZMEB 3KZYA 3HRTA 2Z99A 1ZAOA 3MAJA 2K9MA 3M8FA 4RAYA 2V9PA 4RAFA 1ETQA 4XOPA 3EUHA 4ANJA 2E60A 2JA8J 1Y8QB 4KICA 1B72B 1X3ZB 2PI0A 2LDUA 2VBZA 3DEUA 3DFGA 1OCPA 4I99C 3PM1A 3V7CA 1S7AA 5FFXA 2Z9OA 4KJZA 3L09A 4V2GA 4CCOA 3E5XA 4LIUA 2DODA 3F8FA 1ZGWA 4NBQA 4A12A 1LDDA 1FEXA 2CYYA 2VL8A 4IRGA 2R7WA 4G9YA 4I98B 4XN0A 4XQFA 4Y52J 1HKQA 1ZGJA 3VB2A 2EV6A 1EJ9A 1QBJA 4IKFA 3UR3C 3QYBA 3VSKA 5A2QK 3ESWB 3KEOA 3BR1A 1UFMA 3BPVA 1BA5A 2VJ5A 3KP3A 4BQOA 2HDWA 2BVMA 3SEZA 3EQLF 4BAYA 4BY7J 1IN6A 3QRFF 2LBFB 1RR8C 1VQ8I 3FMRA 2HOSA 2Y0SA 1FOYA 1D0XA 1P6RA 3F0CA 2XGDA 1VQKI 1XDUA 1KU9A 3WODF 2X0LA 1QZZA 1FMWA 3V42A 1YI2I 3E6CC 2XPUA 2YUSA 3E6BA 5KCMA 2QCOA 1RI7A 2D1HA 2P6TA 4YIIA 3OIOA 1WWXA 3KFWX 4XRMA 1BM9A 2L9VA 5EEGA 4CCJA 4A3GJ 1QVUA 2P4WA 1BC7C 2K02A 1JKQC 2QF7A 4XSZF 2FBIA 1N77A 1OQYA 4P9FA 4XMYA 2OZ6A 2BHYA 3AL0B 4AUXA 1Z1DA 2ZB9A 3HHHA 4DZPA 2OV7A 1DPUA 2KIFA 2Y9ZA 2E2JJ 3OSGA 2ESNA 2R7QA 4F52A 3CESA 3ZCOA 4BHBA 4L0ZB 4GYGA 4EM0B 2V9KA 4ON0A 1G8XA 2HOEA 1QO0D 2MGQA 5LRRA 4RGRA 1FC3A 4IOCF 4HQEA 1BI2A 2GA2A 2KIUA 2OU2A 2WAFA 3K9TA 2GIVA 3IH3A 3GTMJ 3KCCA 5ERIA 3H3UA 4A3BJ 1WH7A 4M6VA 5DV5A 4HW0A 5J47A 5E17F 1MBHA 2IGNA 1AHDP 1JGGA 4HEA2 4XLCA 4RAGA 5D5VB 5IT9K 1G59A 1QHGA 5FROA 3MKWB 4PSWA 2IEKA 1Y39A 1X1PA 5J6XA 1YTYA 1IRXA 1R22A 3CTAA 4M3BA 4F7ZA 1QU3A 4E7KA 1IG7A 5ICEA 2E1MB 3DTIA 1H8AC 1EV7A 1KONA 4JBAA 2M7AA 2DA7A 1AKHB 3TKYA 1J0RA 2FNPA 2EBIA 5B3SH 3RKQA 1D1CA 2K86A 3HYIA 2DYSH 4UVCA 3ZPLA 2GIZA 3DU6A 3HRMA 1EH6A 2JA2A 3E7LA 1SMYF 3I4PA 1ZR4A 4ZDOA 2PG4A 3TW7A 1MMSA 4E70A 2F5DA 5IT3A 3SZPA 3F8MA 2OA4A 2BXYA 2NRAC 1FTZA 3QPSA 4Q5SF 2FMLA 3RQIA 5E79C 3JREA 4MFDA 3FDYA 2XHKA 4HNUA 4NNJA 3MD2A 2MLKA 4IPAA 3G1OA 3FHZA 2XF6A 4LITA 4CCMA 1S8NA 1Z3XA 3H9GA 3F8CA 1ETKA 4CXFA 2XGEA 3JAMZ 3W2AA 4ASNA 3CZ6A 3U2RA 1HLVA 2W24A 2A69F 4FE7A 5M3MJ 4MTDA 2K4BA 1E3PA 4P96A 1OR7A 2CSOA 5M5XJ 4A6EA 1YJNI 1BN5A 3HB9A 3K69A 2MC4A 3I53A 3GTKJ 1XCBA 3IHUA 5IYCJ 2NVTJ 2BY1A 3VYTB 2RN7A 1XPXA 3FXQA 4BDYA 2F5CA 1D1BA 2Y69H 1ETXA 3FZVA 3IAS2 1X4PA 2DFFA 2JQ7A 3CP8A 3GF2A 4BBRJ 2LMDA 3ECHA 1MKMA 1LE8B 4M9XA 4IQJA 2PEXA 3GTLJ 4A69C 2V79A 1FY7A 1HQCA 3H9JA 1MH3A 3H36A 1SC7A 4AD9A 3B6CA 1RKTA 1M1EB 2DT6A 1SFUA 4LJZF 1PP8F 3CCVI 1E3HA 1IV6A 2XF7A 3I0TA 3WG7H 1IAWA 1B59A 2W84A 3S3NA 1C0WA 3ZGKA 2R7VA 1L3LA 1XD7A 2WAQN 1KU7A 1UMQA 2ME0A 2K5CA 1GHCA 2PFBA 1XDSA 1Z7UA 1VI0A 3C7JA 2VONA 1FLIA 1XCVA 3G6EI 4OWRB 4D5CA 1IN5A 4TV7A 5FO5A 3IWZA 1IO2A 3K1MA 3D0SA 4EQQA 2LF8A 4HSRA 3E3VA 3A03A 4W1UA 1JUSA 2QA4I 1R71A 2K7LA 4ZZLA 3Q5FA 3QP5A 3ZN1A 3CCYA 4DBQA 1W36D 2D5VA 2A07F 2LY1A 1GV2A 2Q0OA 3FXOA 1TW3A 3GFJA 4BKXA 3SEQA 4WWCA 1VQPI 2BYVE 2ZJRF 5FRMA 5ICGA 1R5GA 4E7JA 4I09A 4EJTA 2HXOA 2O03A 2JPBA 2CRGA 3PIOF 1D0YA 1QVTA 1T56A 2JSCA 3O8GA 5CPRB 3M1CA 1T8IA 3E6DA 3G1MA 4M6XA 4WK8F 3KLOA 1G3SA 2ZXHA 5F6FA 3RYRA 4D7NA 2PMUA 1NG7A 1P4WA 2M2EA 3DCFA 3K2ZA 4RLFA 2HOAA 2ZO4A 4IL6C 3L00A 1Z6RA 2L54A 4BU2A 5J3LA 5C3EJ 3F23A 2R4GA 2I5UA 3HTUA 3L2RA 3LL7A 4KMUX 3L2CA 3L1PA 4N4NB 3WTWC 1W5TA 1KQ0A 2DTRA 3HOXJ 1K78B 5LGNA 2R7TA 3P9KA 4KISA 1IN4A 3NEUA 1A04A 3RTRA 4S0HB 4A93J 2R7FA 4AC0A 1MJAA 2DAOA 4CZZA 2KDOA 5LRSA 5D6EA 2Z5UA 3VOEA 4HLYA 1WJCA 1S9HA 2DMPA 3QOEA 3UKGA 1VNDA 4OIPF 4F3QA 2ZCWA 2XAJA 3HC7A 1VFCA 3TMOA 1TWGJ 5HVQC 3BCAA 4BJ5C 2STWA 1RESA 4RM2A 2RVCA 4P55A 4L18B 2VKHA 3J80K 1FIPA 4MNUA 3S93A 2AHQA 3IC7A 1IGNA 3H92A 1JJ6C 2NNYA 1FZPB 3HOYJ 1HW5A 2QWWA 5M5WJ 3E1SA 2RDPA 2MA3A 5IP7J 3LSRA 1V55H 3C18A 1YX3A 2A5YB 2VN2A 2EFQA 4RDUA 2CV0A 3GZ6A 2L9SA 1HW2A 4KUMA 2CUJA 2X6OA 5DEQA 1X58A 3K0LA 3J7YJ 3GTOJ 1X2MA 3T8TA 3ZP5A 2XB0X 2TDXA 1O3SA 3ULQB 5ICCA 4OIRF 1K4SA 3FM5A 3BPXA 3IKTA 3E6MA 4IO9F 3I58A 4N4OB 1WKMA 1D8JA 3K2AA 1ETVA 3LA3A 3S2HJ 1BI3A 2H6BA 2DDBA 3HSRA 5KAIC 2ZMEC 3ISPA 3T8RA 3QOPA 1D3YA 3V7RA 3N97A 4Q4ZF 3GTQJ 2JA7J 2E5NA 4A5NA 3MKYB 1PUFB 3ABKH 1E3OC 5D5WB 1D0ZA 3K4LA 4A0XA 2KIMA 4B8XA 3TOBA 1JKRC 4I01A 1I27A 4RGUA 4AYBN 4KN4X 4EJOA 5F0CA 4BYYA 2LTPA 4CCKA 1U78A 2XKPA 3OIPA 4IQ4A 4XOTA 1JHFA 5BOXA 1MSFC 3ZMVA 2O7OA 4Y3OA 3KP5A 4D0PA 1MMGA 1OYIA 2O3FA 3R61A 4MGRA 3LQRA 2Q8KA 1WPKA 4HYEA 2A6TA 2IGKA 1B4AA 2QSFX 2MABA 3OYHA 3K70D 2HTSA 5BMZA 1R23A 3A0HC 4YFNF 4L0YB 3OYFA 1FOWA 4L9TA 2RQPA 2BY0A 1LVAA 3KP4A 2EIMH 4KA4A 2FJ1A 4BQNA 3CCSI 2ZKZA 1Y0UA 3O3KA 4AWXB 1ZYRF 2ZXIA 4HX4A 1UB9A 1K7AA 1WRJA 5H6RA 1YJWI 4MO7A 2PBIA 1ZRCA 2DA5A 1S7EA 2LH9A 1XMXA 5CJ9A 1JT0A 2COMA 1Z6TA 2HXIA 4HX8A 3REOA 3S1QJ 4E4HA 1WJBA 2LLKA 2XAGA 1WZ2A 2QQ8A 4M72A 3LSIA 2CGPA 1O7FA 3ABLH 4RBOA 5E18F 3A01A 3AL0C 2NS0A 4JX4A 1D1AA 1I3QJ 4P9UA 3PUFA 4RGSA 2K27A 3ABTA 2MBFA 4DQ2A 4L9NA 5B5EC 3HGGA 5H2FC 3ZQCA 3BP8A 1IUYA 4Q48A 4XICA 4BGDA 3RSNA 5J4YA 1FP1D 4XLNF 2RC4A 3P9CA 4XKCA 3CCJI 3FXMA 2GWRA 3DKWA 4U7BA 2HYFA 2QQBA 5J40A 5DM6F 1TQMA 5TISC 4IJAA 1BR2A 3DWLE 1S3JA 4UV9A 3AG1H 4E7SA 4BBSJ 5IY5H 2E1OA 1Z21A 2VBWA 2P0WA 4JQFA 3TDZC 3F8BA 4HSTA 1T0FC 2IP2A 3F3XA 5L3DA 3GW2A 3R6SA 5JVTA 1DDNA 5GAEJ 1Z0XA 4O5VA 3AAFA 3TP0A 2YPRA 1OISA 3MEXA 1XX5A 1WCMJ 2E1MC 4ABZA 3UNGC 1R9TJ 1IDZA 4C3HJ 3PQJA 2ETHA 2P6SA 3ZQ7A 2BOLA 1POGA 5F64A 3LWFA 1ONVA 2P8TA 1IJWC 1CF7A 4A0ZA 3BJ6A 2DYRH 4ZTJA 1OCRH
chains in the Genus database with same CATH topology
2BBYA 2VOOA 3QPTA 3ZMZA 3Q9VA 3W6KB 5HDNA 3W6JB 5E20A 3RDIA 4BQAA 1R00A 3GX4X 4CDGA 1TNTA 1R5HA 1YFHA 3HTSB 1FBQA 3MZHA 3WTYC 2QVOA 2DO7A 5TRDA 1JXSA 2DLLA 4Y17A 2DBBA 2JTVA 3LQQA 2DU9A 2FA5A 2QENA 3E5QA 4GXOA 3KLNA 2DI3A 1T0FA 3PFIA 5K5OA 4XBFA 5F1RA 1GVJA 1V4RA 3QAHA 2V1UA 1T38A 5ILSA 3P9IA 4ETSA 2EB7A 1G3YA 3OV8A 2G7HA 1Q1HA 1D8KA 5DD8A 2MLGA 1QPMA 2HKOA 1YW9A 1OKRA 1IN8A 3DPLC 4I0BA 2G7UA 4GYIA 5E1ZB 4LG0A 3GO5A 2DPUA 1U8RA 5K5QA 1ZLKA 2FMYA 5CVJA 2P5VA 1OYYA 1ULYA 1L0OC 2HR3A 4CICA 5BPDA 1PP7U 4HF2A 3JSOA 5L3CA 2LSOA 1E17A 4BHPA 4UXNA 1YS6A 3K1PA 3F21A 3WGIA 3HOTA 1YLFA 4LGWA 3COAC 2DQRA 4PZJA 2HFHA 1XB4A 2QQAA 2Y48A 1T98A 4LB5A 1FT9A 2R7DA 3C1DA 3BDDA 1CF7B 3ZMDA 2NYXA 1S29A 4ZYEA 4WXCA 5CVUA 4ZYDA 1LEAA 5D5UB 5ILUA 3DF8A 5LHGA 3CLOA 3S2WA 4GO1A 3H3ZA 3CUOA 1G6NA 1W7PD 3HSFA 1T39A 4HX7A 4OOIA 2WC2A 1FX7A 2L02A 1J9IA 1KA8A 3I5UA 2JT1A 2UXXA 1YQAA 2MH9A 5LEJA 2FE3A 3ZMTA 1SAXA 4N0BA 1SMTA 2XV4S 3WTZA 5BQTA 4ENJA 5FLXK 4UUVA 1R1TA 2AS5F 4PDKA 2FBHA 4HAMA 2IT0A 4K2EA 2FQ3A 1IXCA 2UXNA 5DYMA 2FNAA 3CUQA 1B9MA 3IRQA 1B1BA 1SD7A 4PGGA 1O3TA 1XSDA 5FGMA 5LHHA 1BI0A 1XGOA 3F72A 4QLCU 4LG0B 3K1NA 1K78A 2OQRA 4HV5A 5H6QA 2VODA 5A2QZ 2GZWA 3IRRA 4A0YA 3J81K 2YU3A 3V8LA 3KETA 5ILVA 4EVIA 3QPHA 5CVVA 5DUIA 4M9SA 3LAPA 1G3WA 1JHHA 3FXRA 3O2PE 3ABUA 4L9JA 1XSVA 1LJ9A 5HS7A 3RYPA 1FP2A 2P5LC 3KZZA 3LSTA 4EGYA 4HA8A 1U5TA 1XN7A 5E1XA 4EJWA 4HZFA 4S05A 2XVCA 2PJPA 1KYZA 1U3EM 2CG4A 3SQNA 2AXLA 4G7HF 1TBXA 4Q47A 2GA1A 5LGUA 4FX0A 4KT5C 2QBYB 5CYVA 2M5WA 3J7AO 1ZG5A 5IT9Z 4CO8A 5HOOA 3MFKA 3BROA 1MD0A 5TJJA 1WSUA 2CQKA 4HBLA 1GXQA 4L5JA 3WTTC 2ZXJA 4MTEA 1LEBA 4IF4A 2RGVA 1SFXA 3L7WA 2VC0A 3PQKA 4KIGA 3TO6A 3WTUC 3GLXA 2DK5A 4A6DA 3IL2A 1X3UA 4ENMA 2YX7A 1YYVA 2A68F 3U1DA 3CUQB 2PMHA 2L3DA 1E2XA 4QWQA 3CO7C 4RB2C 4JK1X 3DV8A 5CVRA 3SFZA 1RUOA 2OAZA 1IXSB 1RUNA 4EJVA 2QZ8A 5KK1A 2RV8A 1W7PA 3KE2A 5LGTA 1LDKB 3TDUC 1U2WA 5BS6A 1I1GA 3OOPA 2GAUA 1BIAA 3GFLA 5HS9A 5DDGA 2F5FA 1BBYA 4I2OA 2X4HA 4WXDA 1FSEA 1D5VA 4CHUA 1R1VA 1B6AA 1H9GA 1U5TB 1T6SA 5LLQA 2UZKA 4OU0A 3BZ6A 1VTNC 4LK0F 3B02A 3LA2A 3KEQA 3F22A 1FYKA 3ERED 1STZA 2PN6A 3EETA 3VODA 5FB2A 1MJBA 4EM2A 4LB6B 3L9FA 5D8LB 1R36A 1J59A 2ZFWA 4KFCA 2NAZA 2EJRA 2GXBA 1DP7P 1YW7A 4EJUA 4IHTA 2OZUA 4HOBA 2L01A 5AONA 3T0YA 3TOAA 2HKXA 1U6GA 3JW4A 2VT2A 5D8KB 2F2EA 2XKOA 1O7LA 4MQ9F 4KDPA 4ESFA 1TTYA 2FBKA 4NHJA 3MZYA 4UV8A 2XAHA 4L5IA 3FX3A 5DD4A 2M8EA 2XRNA 4NQWA 2A61A 3ROUA 2DK8A 3EDPA 5JFRA 2KRFA 1W7PB 2PLYA 2LNBA 1G4DA 3GWZA 3J80Z 4HDVA 1ZHFA 2JZYA 1WQ2A 2ACJA 4HF0A 2E7XA 1R58A 2ESHA 4ZZDA 4Z2YA 4KYWA 1FWZA 3GFMA 2CO5A 2VE9A 5L3GA 2OD5A 2GQQA 2J5OA 4CGZA 2EWNA 1TQIA 3R60A 2Y0MA 2D45A 4A5MA 2O61A 2EFPA 1MDMA 2O0YA 5LEKA 1IRFA 2QM3A 2D1VA 3HRUA 2UWMA 4XSXF 4WF2A 4UNOA 3P7NA 5KVRA 1QQIA 1I1SA 4RB1A 1R1UA 2PQ8A 4H0EA 3WTXC 3TGNA 2EK5A 1ON1A 1WI9A 5E8GA 3FF5A 3IWFA 3F6OA 4FHTA 2M45A 3MCZA 1XGNA 2EA4A 1Z05A 4I02A 2Y75A 2BV6A 1USTA 1I6XA 4MHGA 4CYDA 2XIGA 2W25A 4OINF 3VEPA 3ZMSA 4RGXA 5L3FA 2MD5A 2IPQX 5LBQA 1IZ1A 1T2KA 4FX4A 2FU4A 3DXJF 3DPTA 1SD4A 5J8CA 2Z3YA 3RJPA 2XUBA 4IHSA 4ENKA 5K5RA 3E5UA 1IW7F 3CJNA 1LB2A 1H0MA 1RIOH 3M9AA 2QUFA 4GCVA 4R79A 4MEYF 3Q9SA 3HHGA 1ZLJA 1HSJA 4GGGA 1TNSA 4RS8A 4ZYGA 4LFUA 2F5EA 5D6FA 5ICFA 1FBSA 3BJOA 3T5XA 4AIKA 1KU2A 2CFXA 3JTHA 4EGZA 2M30A 1J2XA 1MDMB 1YS7A 2L4MA 3V8JA 1KGSA 3HRSA 1O3RA 4IRHA 3WTVC 3CUQC 4ESBA 4O3MA 2J5PA 1PDNC 4N9IA 3GFIA 3DP7A 2FEZA 1USSA 5FFZA 4LMYA 4RB0A 1HXDA 2H09A 2HS5A 4G8XA 3WTSC 2QLZA 3I71A 3HIFA 2L4AA 1NHAA 4HLXA 3BOQA 1W5SA 2EA2A 2EV0A 1AWCA 3ECOA 2Q2EA 5CVIA 2XAQA 2QYOA 3JAMK 4BNCA 5J8FA 2DT5A 3O6BB 2JPCA 2KJCA 2R3SA 1HW1A 2XAFA 3DQVC 2QBYA 3R0JA 2XASA 1SFEA 3GYHX 3SXYA 2VC1A 5LHIA 1P4AA 2A3SA 4UVAA 4HQMA 1JE8A 1U5TC 4U0VA 2O8XA 5JI6A 3SZTA 1I5ZA 5E8IA 5H20A 3I59A 2HWVA 4G6QA 3QP6A 5L3BA 4HV6A 4M6YA 2VBYA 4I7HA 3NQOA 4A2UA 3HUGA 3BWGA 2EV5A 2KKOA 3G73A 4YFKF 1F1ZA 3C3WA 1KQ9A 4HF1A 1TQPA 4AIHA 4XRFA 3WGHA 1BOAA 5EEHA 2H94A 1J75A 3TO7A 1FSHA 1FOKA 3RKYA 2BEOA 2RKHA 1CGPA 2GXGA 3ZMUA 1FYMA 3GVAA 4OMYA 5BPIA 2VXZA 4KMFA 5DCFA 4EV0A 3BY6A 4YFXF 5HDGA 1F5TA 1JGSA 2P7CB 4KIFA 5K1YA 1XMKA 3I54A 3ZN0A 2IRFG 2ZJ2A 1J7KA 4KN7X 2FXAA 2ADUA 3B73A 5HS8A 1UCRA 4Y13A 1ZG3A 1S6LA 3F6VA 4KIBA 4AVPA 3SHFA 4BXUA 3TQNA 4BH9A 3HSEA 4U88A 5DUKA 4YG2F 4M74A 4WXHA 1V3FA 1UHMA 2WV0A 4EMSA 2Z33A 4O6JA 2MC3A 2CWEA 3IKVA 3WE3A 1DUXC 4WCGA 5D5XB 2WTEA 5FLXZ 4ESJA 4LLGF 2OQGA 2E1NA 4R8HA 1XMAA 2C6YA 1IXRC 1BC8C 4U0WA 2HQNA 1P92A 2H6CA 1Z9CA 3V8KA 1HSTA 5D4SA 1QNTA 2IJLA 2EFNA 3I59B 1HKTA 1KU3A 3R0AA 2QQ9A 5HLIA 3LAJA 2DFIA 1YG2A 3RPQA 3M1EA 3U9GA 3WE2A 4RB3C 3J81Z 2BE5F 4RAZA 2B0LA 2DQLA 1K79A 4OIOF 5DCMA 4DNCA 4UHTA 2DW4A 4BHCA 1IN7A 1MJ9A 1SD6A 1REPC 3LFKA 2ELHA 1DPRA 1EH8A 2IA1A 2EFWA 1P2FA 1K6OA 3WG9A 3RPUA 1W4MA 2ZNZA 4L9VA 3M7GA 2XROA 2DPDA 1Z91A 1UHWA 4YIFA 1BIBA 4OIQF 4Y15A 5FD5A 1EH7A 3D5LA 2WWYA 2A6HF 1YIOA 2V6CA 4G7ZF 1R7JA 2HYGD 3MWMA 5HLGA 3EYYA 3GUDA 1HBXG 3F8NA 3KP6A 4G94A 1TW2A 1F9NA 1QZYA 3LA7A 4MQVA 1ZN2A 2HZTA 2W85A 2YSRA 1YO5C 3N4MA 4LLNA 3E97A 1LNWA 3FM3A 3WU1B 5JHUA 1BJAA 1KYWA 3R4KA 2ZBKA 2VOPA 1IF1A 4ENNA 1AOYA 2LKPA 4PCQA 3I64A 2EFOA 1B9NA 1FNNA 3V7SA 3NRVA 4MEXF 2V1XA 2HEOA 2ISYA 3BJAA 4IXAA 3FWEA 2H27A 6PAXA 3RI4A 2A6EF 2LF7A 2CW0F 2FRHA 3FXUA 4XLPF 3GXOA 4OMZA 5L3EA 2IA0A 4R1HA 5HLHA 1TLHB 3JSPA 3QU6A 2HDCA 1ZREA 3FMSA 5DCMB 1H9TA 3CO6C 1LDJA 2M87A 3KP2A 2E7WA 3GZ5A 2RNJA 4PGHA 3WU0A 2ISZA 1SD5A 2OBPA 2M1BA 5HDKA 5FD6A 4LK1F 3RKXA 2FOKA 4G6DA 3V4GA 1ZRFA 1IRGA 4M71A 4HDUA 1MZBA 2P5KA 2YX4A 3EYIA 4ZH4F 4LLLA 4IRIA 3T1BA 1P4XA 2ZMEA 4NB5A 2W57A 2NNNA 2FSWA 2VE8A 3JTGA 5D4RA 2D2WA 4AIJA 1RZ4A 4P5OA 4N9HA 4M9ZA 2JRTA 4FT8A 3M8EA 2HQRA 1LQ1A 4M73A 2IW5A 1O3QA 4WX9A 3ELKA 1ZGAA 4EM1A 4KNYA 2XGXA 3ML6A 1XGMA 1J5YA 3G3ZA 1ZRDA 2P7VB 2HTJA 1BI1A 1PUEE 5JR3A 2FF4A 1ZARA 2VBXA 2IVMA 3WGGA 2STTA 5E1WA 4LD5A 1ON2A 1YW8A 1S7OA 2O6GE 2BGCA 1ZH5A 1RNLA 1QGPA 4ZYHA 2E1CA 3KP7A 3MQ0A 1ZG1A 2ZNYA 1OPCA 1FBUA 5AIQA 3TO9A 3HOSA 5ED4A 4I0AA 1XGSA 4UVBA 2HGCA 1MGTA 1O57A 2YR2A 1OYWA 4U7DA 5AIPA 2MH2A 2G9WA 1XSXA 1F4KA 2IA2A 3QU3A 2K4JA 1OMIA 4G7OF 4S04A 4U0YA 1HKSA 2V1DA 3VFZA 4B09A 1KQ8A 1GXPA 3RIRA 2VT3A 1G3TA 3GEZA 2KJBA 1FPQA 3RKWA 1FYLA 1ODDA 5CLSA 3FMQA 4IVNA 2V9VA 3CDHA 2ZMEB 3KZYA 3HRTA 2Z99A 1ZAOA 3MAJA 3M8FA 4RAYA 3EUHA 4KICA 2PI0A 2LDUA 2VBZA 3DEUA 3DFGA 3V7CA 1S7AA 5FFXA 2Z9OA 3L09A 3E5XA 3F8FA 4A12A 1LDDA 2CYYA 4IRGA 4G9YA 4I98B 1HKQA 1ZGJA 3VB2A 2EV6A 1QBJA 5A2QK 3KEOA 1UFMA 3BPVA 3KP3A 3EQLF 4BAYA 1IN6A 3QRFF 3FMRA 1P6RA 1XDUA 1KU9A 3WODF 2X0LA 1QZZA 3E6CC 3E6BA 1RI7A 2D1HA 2P6TA 4YIIA 1WWXA 3KFWX 1BM9A 5EEGA 2P4WA 1BC7C 2K02A 4XSZF 2FBIA 4P9FA 2OZ6A 1Z1DA 3HHHA 1DPUA 2KIFA 2ESNA 4BHBA 4L0ZB 4GYGA 4EM0B 4ON0A 2HOEA 1QO0D 5LRRA 4RGRA 1FC3A 4HQEA 1BI2A 2GA2A 2KIUA 2OU2A 3K9TA 2GIVA 3KCCA 5ERIA 3H3UA 5DV5A 4HW0A 5E17F 5D5VB 5IT9K 5J6XA 1YTYA 1R22A 3CTAA 4F7ZA 5ICEA 1EV7A 4JBAA 3TKYA 1J0RA 2FNPA 2K86A 3HYIA 4UVCA 3ZPLA 3HRMA 1EH6A 1SMYF 3I4PA 2PG4A 4E70A 2F5DA 5IT3A 3SZPA 3F8MA 2OA4A 2NRAC 4Q5SF 2FMLA 2XHKA 2MLKA 4IPAA 3FHZA 1S8NA 3F8CA 4CXFA 3JAMZ 4ASNA 3U2RA 2W24A 2A69F 4MTDA 2K4BA 4P96A 1OR7A 2CSOA 4A6EA 1BN5A 3K69A 3I53A 1XCBA 3IHUA 2RN7A 3FXQA 2F5CA 3FZVA 3GF2A 3ECHA 1MKMA 4M9XA 2PEXA 2V79A 1FY7A 1HQCA 4AD9A 1SFUA 4LJZF 1PP8F 1IAWA 3I0TA 1B59A 2W84A 1C0WA 1L3LA 1XD7A 1KU7A 1GHCA 2PFBA 1XDSA 1Z7UA 3C7JA 2VONA 1FLIA 1XCVA 1IN5A 4TV7A 5FO5A 3IWZA 3K1MA 3D0SA 4EQQA 2LF8A 3E3VA 2K7LA 4ZZLA 3Q5FA 3QP5A 3ZN1A 2A07F 2Q0OA 1TW3A 3GFJA 4WWCA 2BYVE 5ICGA 1R5GA 4I09A 4EJTA 2O03A 2JPBA 2JSCA 3E6DA 4M6XA 4WK8F 3KLOA 1G3SA 5F6FA 3RYRA 2PMUA 1P4WA 3K2ZA 2ZO4A 3L00A 1Z6RA 2L54A 3F23A 3HTUA 4KMUX 3L2CA 3WTWC 1W5TA 1KQ0A 2DTRA 1K78B 5LGNA 3P9KA 1IN4A 3NEUA 1A04A 3RTRA 2R7FA 1MJAA 2DAOA 4CZZA 5LRSA 5D6EA 2Z5UA 3VOEA 4HLYA 4OIPF 2ZCWA 2XAJA 5HVQC 2STWA 2RVCA 4P55A 4L18B 3J80K 4MNUA 3IC7A 3H92A 2NNYA 1FZPB 1HW5A 2QWWA 2RDPA 2MA3A 3C18A 2A5YB 2VN2A 2EFQA 3GZ6A 1HW2A 4KUMA 5DEQA 3K0LA 3T8TA 3ZP5A 1O3SA 2TDXA 3ULQB 5ICCA 4OIRF 3FM5A 3BPXA 3IKTA 3E6MA 3I58A 1D8JA 1WKMA 3LA3A 1BI3A 2H6BA 3HSRA 3ISPA 3T8RA 3QOPA 1D3YA 3V7RA 3N97A 4Q4ZF 4A5NA 5D5WB 4A0XA 2KIMA 4B8XA 3TOBA 4I01A 1I27A 4RGUA 4KN4X 4EJOA 4BYYA 1U78A 2XKPA 1JHFA 5BOXA 3ZMVA 3KP5A 4D0PA 1OYIA 2O3FA 3R61A 4MGRA 3LQRA 2Q8KA 4HYEA 1B4AA 5BMZA 2HTSA 1R23A 4YFNF 4L0YB 4L9TA 2RQPA 1LVAA 3KP4A 4KA4A 2ZKZA 1Y0UA 3O3KA 4AWXB 1ZYRF 4HX4A 1UB9A 1K7AA 1WRJA 5H6RA 2PBIA 1ZRCA 5CJ9A 2COMA 1Z6TA 4HX8A 3REOA 2XAGA 4M72A 2CGPA 1O7FA 5E18F 2NS0A 4P9UA 4RGSA 2K27A 3ABTA 2MBFA 4DQ2A 4L9NA 3BP8A 1IUYA 4Q48A 1FP1D 4XLNF 2RC4A 3P9CA 2GWRA 3DKWA 4U7BA 2HYFA 2QQBA 1TQMA 4IJAA 1S3JA 4UV9A 3TDZC 2VBWA 4JQFA 3F8BA 2IP2A 3F3XA 5L3DA 3GW2A 3R6SA 5JVTA 1DDNA 4O5VA 3AAFA 2YPRA 3MEXA 3PQJA 2ETHA 2P6SA 3ZQ7A 5F64A 3LWFA 1ONVA 2P8TA 1CF7A 4A0ZA 3BJ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BBY A;  2VOO A;  3QPT A;  3ZMZ A;  3Q9V A;  3W6K B;  5HDN A;  3W6J B;  5E20 A;  3RDI A;  4BQA A;  1R00 A;  3GX4 X;  4CDG A;  1TNT A;  1R5H A;  1YFH A;  3HTS B;  1FBQ A;  3MZH A;  3WTY C;  2QVO A;  2DO7 A;  5TRD A;  1JXS A;  2DLL A;  4Y17 A;  2DBB A;  2JTV A;  3LQQ A;  2DU9 A;  2FA5 A;  2QEN A;  3E5Q A;  4GXO A;  3KLN A;  2DI3 A;  1T0F A;  3PFI A;  5K5O A;  4XBF A;  5F1R A;  1GVJ A;  1V4R A;  3QAH A;  2V1U A;  1T38 A;  5ILS A;  3P9I A;  4ETS A;  2EB7 A;  1G3Y A;  3OV8 A;  2G7H A;  1Q1H A;  1D8K A;  5DD8 A;  2MLG A;  1QPM A;  2HKO A;  1YW9 A;  1OKR A;  1IN8 A;  3DPL C;  4I0B A;  2G7U A;  4GYI A;  5E1Z B;  4LG0 A;  3GO5 A;  2DPU A;  1U8R A;  5K5Q A;  1ZLK A;  2FMY A;  5CVJ A;  2P5V A;  1OYY A;  1ULY A;  1L0O C;  2HR3 A;  4CIC A;  5BPD A;  1PP7 U;  4HF2 A;  3JSO A;  5L3C A;  2LSO A;  1E17 A;  4BHP A;  4UXN A;  1YS6 A;  3K1P A;  3F21 A;  3WGI A;  3HOT A;  1YLF A;  4LGW A;  3COA C;  2DQR A;  4PZJ A;  2HFH A;  1XB4 A;  2QQA A;  2Y48 A;  1T98 A;  4LB5 A;  1FT9 A;  2R7D A;  3C1D A;  3BDD A;  1CF7 B;  3ZMD A;  2NYX A;  1S29 A;  4ZYE A;  4WXC A;  5CVU A;  4ZYD A;  1LEA A;  5D5U B;  5ILU A;  3DF8 A;  5LHG A;  3CLO A;  3S2W A;  4GO1 A;  3H3Z A;  3CUO A;  1G6N A;  1W7P D;  3HSF A;  1T39 A;  4HX7 A;  4OOI A;  2WC2 A;  1FX7 A;  2L02 A;  1J9I A;  1KA8 A;  3I5U A;  2JT1 A;  2UXX A;  1YQA A;  2MH9 A;  5LEJ A;  2FE3 A;  3ZMT A;  1SAX A;  4N0B A;  1SMT A;  2XV4 S;  3WTZ A;  5BQT A;  4ENJ A;  5FLX K;  4UUV A;  1R1T A;  2AS5 F;  4PDK A;  2FBH A;  4HAM A;  2IT0 A;  4K2E A;  2FQ3 A;  1IXC A;  2UXN A;  5DYM A;  2FNA A;  3CUQ A;  1B9M A;  3IRQ A;  1B1B A;  1SD7 A;  4PGG A;  1O3T A;  1XSD A;  5FGM A;  5LHH A;  1BI0 A;  1XGO A;  3F72 A;  4QLC U;  4LG0 B;  3K1N A;  1K78 A;  2OQR A;  4HV5 A;  5H6Q A;  2VOD A;  5A2Q Z;  2GZW A;  3IRR A;  4A0Y A;  3J81 K;  2YU3 A;  3V8L A;  3KET A;  5ILV A;  4EVI A;  3QPH A;  5CVV A;  5DUI A;  4M9S A;  3LAP A;  1G3W A;  1JHH A;  3FXR A;  3O2P E;  3ABU A;  4L9J A;  1XSV A;  1LJ9 A;  5HS7 A;  3RYP A;  1FP2 A;  2P5L C;  3KZZ A;  3LST A;  4EGY A;  4HA8 A;  1U5T A;  1XN7 A;  5E1X A;  4EJW A;  4HZF A;  4S05 A;  2XVC A;  2PJP A;  1KYZ A;  1U3E M;  2CG4 A;  3SQN A;  2AXL A;  4G7H F;  1TBX A;  4Q47 A;  2GA1 A;  5LGU A;  4FX0 A;  4KT5 C;  2QBY B;  5CYV A;  2M5W A;  3J7A O;  1ZG5 A;  5IT9 Z;  4CO8 A;  5HOO A;  3MFK A;  3BRO A;  1MD0 A;  5TJJ A;  1WSU A;  2CQK A;  4HBL A;  1GXQ A;  4L5J A;  3WTT C;  2ZXJ A;  4MTE A;  1LEB A;  4IF4 A;  2RGV A;  1SFX A;  3L7W A;  2VC0 A;  3PQK A;  4KIG A;  3TO6 A;  3WTU C;  3GLX A;  2DK5 A;  4A6D A;  3IL2 A;  1X3U A;  4ENM A;  2YX7 A;  1YYV A;  2A68 F;  3U1D A;  3CUQ B;  2PMH A;  2L3D A;  1E2X A;  4QWQ A;  3CO7 C;  4RB2 C;  4JK1 X;  3DV8 A;  5CVR A;  3SFZ A;  1RUO A;  2OAZ A;  1IXS B;  1RUN A;  4EJV A;  2QZ8 A;  5KK1 A;  2RV8 A;  1W7P A;  3KE2 A;  5LGT A;  1LDK B;  3TDU C;  1U2W A;  5BS6 A;  1I1G A;  3OOP A;  2GAU A;  1BIA A;  3GFL A;  5HS9 A;  5DDG A;  2F5F A;  1BBY A;  4I2O A;  2X4H A;  4WXD A;  1FSE A;  1D5V A;  4CHU A;  1R1V A;  1B6A A;  1H9G A;  1U5T B;  1T6S A;  5LLQ A;  2UZK A;  4OU0 A;  3BZ6 A;  1VTN C;  4LK0 F;  3B02 A;  3LA2 A;  3KEQ A;  3F22 A;  1FYK A;  3ERE D;  1STZ A;  2PN6 A;  3EET A;  3VOD A;  5FB2 A;  1MJB A;  4EM2 A;  4LB6 B;  3L9F A;  5D8L B;  1R36 A;  1J59 A;  2ZFW A;  4KFC A;  2NAZ A;  2EJR A;  2GXB A;  1DP7 P;  1YW7 A;  4EJU A;  4IHT A;  2OZU A;  4HOB A;  2L01 A;  5AON A;  3T0Y A;  3TOA A;  2HKX A;  1U6G A;  3JW4 A;  2VT2 A;  5D8K B;  2F2E A;  2XKO A;  1O7L A;  4MQ9 F;  4KDP A;  4ESF A;  1TTY A;  2FBK A;  4NHJ A;  3MZY A;  4UV8 A;  2XAH A;  4L5I A;  3FX3 A;  5DD4 A;  2M8E A;  2XRN A;  4NQW A;  2A61 A;  3ROU A;  2DK8 A;  3EDP A;  5JFR A;  2KRF A;  1W7P B;  2PLY A;  2LNB A;  1G4D A;  3GWZ A;  3J80 Z;  4HDV A;  1ZHF A;  2JZY A;  1WQ2 A;  2ACJ A;  4HF0 A;  2E7X A;  1R58 A;  2ESH A;  4ZZD A;  4Z2Y A;  4KYW A;  1FWZ A;  3GFM A;  2CO5 A;  2VE9 A;  5L3G A;  2OD5 A;  2GQQ A;  2J5O A;  4CGZ A;  2EWN A;  1TQI A;  3R60 A;  2Y0M A;  2D45 A;  4A5M A;  2O61 A;  2EFP A;  1MDM A;  2O0Y A;  5LEK A;  1IRF A;  2QM3 A;  2D1V A;  3HRU A;  2UWM A;  4XSX F;  4WF2 A;  4UNO A;  3P7N A;  5KVR A;  1QQI A;  1I1S A;  4RB1 A;  1R1U A;  2PQ8 A;  4H0E A;  3WTX C;  3TGN A;  2EK5 A;  1ON1 A;  1WI9 A;  5E8G A;  3FF5 A;  3IWF A;  3F6O A;  4FHT A;  2M45 A;  3MCZ A;  1XGN A;  2EA4 A;  1Z05 A;  4I02 A;  2Y75 A;  2BV6 A;  1UST A;  1I6X A;  4MHG A;  4CYD A;  2XIG A;  2W25 A;  4OIN F;  3VEP A;  3ZMS A;  4RGX A;  5L3F A;  2MD5 A;  2IPQ X;  5LBQ A;  1IZ1 A;  1T2K A;  4FX4 A;  2FU4 A;  3DXJ F;  3DPT A;  1SD4 A;  5J8C A;  2Z3Y A;  3RJP A;  2XUB A;  4IHS A;  4ENK A;  5K5R A;  3E5U A;  1IW7 F;  3CJN A;  1LB2 A;  1H0M A;  1RIO H;  3M9A A;  2QUF A;  4GCV A;  4R79 A;  4MEY F;  3Q9S A;  3HHG A;  1ZLJ A;  1HSJ A;  4GGG A;  1TNS A;  4RS8 A;  4ZYG A;  4LFU A;  2F5E A;  5D6F A;  5ICF A;  1FBS A;  3BJO A;  3T5X A;  4AIK A;  1KU2 A;  2CFX A;  3JTH A;  4EGZ A;  2M30 A;  1J2X A;  1MDM B;  1YS7 A;  2L4M A;  3V8J A;  1KGS A;  3HRS A;  1O3R A;  4IRH A;  3WTV C;  3CUQ C;  4ESB A;  4O3M A;  2J5P A;  1PDN C;  4N9I A;  3GFI A;  3DP7 A;  2FEZ A;  1USS A;  5FFZ A;  4LMY A;  4RB0 A;  1HXD A;  2H09 A;  2HS5 A;  4G8X A;  3WTS C;  2QLZ A;  3I71 A;  3HIF A;  2L4A A;  1NHA A;  4HLX A;  3BOQ A;  1W5S A;  2EA2 A;  2EV0 A;  1AWC A;  3ECO A;  2Q2E A;  5CVI A;  2XAQ A;  2QYO A;  3JAM K;  4BNC A;  5J8F A;  2DT5 A;  3O6B B;  2JPC A;  2KJC A;  2R3S A;  1HW1 A;  2XAF A;  3DQV C;  2QBY A;  3R0J A;  2XAS A;  1SFE A;  3GYH X;  3SXY A;  2VC1 A;  5LHI A;  1P4A A;  2A3S A;  4UVA A;  4HQM A;  1JE8 A;  1U5T C;  4U0V A;  2O8X A;  5JI6 A;  3SZT A;  1I5Z A;  5E8I A;  5H20 A;  3I59 A;  2HWV A;  4G6Q A;  3QP6 A;  5L3B A;  4HV6 A;  4M6Y A;  2VBY A;  4I7H A;  3NQO A;  4A2U A;  3HUG A;  3BWG A;  2EV5 A;  2KKO A;  3G73 A;  4YFK F;  1F1Z A;  3C3W A;  1KQ9 A;  4HF1 A;  1TQP A;  4AIH A;  4XRF A;  3WGH A;  1BOA A;  5EEH A;  2H94 A;  1J75 A;  3TO7 A;  1FSH A;  1FOK A;  3RKY A;  2BEO A;  2RKH A;  1CGP A;  2GXG A;  3ZMU A;  1FYM A;  3GVA A;  4OMY A;  5BPI A;  2VXZ A;  4KMF A;  5DCF A;  4EV0 A;  3BY6 A;  4YFX F;  5HDG A;  1F5T A;  1JGS A;  2P7C B;  4KIF A;  5K1Y A;  1XMK A;  3I54 A;  3ZN0 A;  2IRF G;  2ZJ2 A;  1J7K A;  4KN7 X;  2FXA A;  2ADU A;  3B73 A;  5HS8 A;  1UCR A;  4Y13 A;  1ZG3 A;  1S6L A;  3F6V A;  4KIB A;  4AVP A;  3SHF A;  4BXU A;  3TQN A;  4BH9 A;  3HSE A;  4U88 A;  5DUK A;  4YG2 F;  4M74 A;  4WXH A;  1V3F A;  1UHM A;  2WV0 A;  4EMS A;  2Z33 A;  4O6J A;  2MC3 A;  2CWE A;  3IKV A;  3WE3 A;  1DUX C;  4WCG A;  5D5X B;  2WTE A;  5FLX Z;  4ESJ A;  4LLG F;  2OQG A;  2E1N A;  4R8H A;  1XMA A;  2C6Y A;  1IXR C;  1BC8 C;  4U0W A;  2HQN A;  1P92 A;  2H6C A;  1Z9C A;  3V8K A;  1HST A;  5D4S A;  1QNT A;  2IJL A;  2EFN A;  3I59 B;  1HKT A;  1KU3 A;  3R0A A;  2QQ9 A;  5HLI A;  3LAJ A;  2DFI A;  1YG2 A;  3RPQ A;  3M1E A;  3U9G A;  3WE2 A;  4RB3 C;  3J81 Z;  2BE5 F;  4RAZ A;  2B0L A;  2DQL A;  1K79 A;  4OIO F;  5DCM A;  4DNC A;  4UHT A;  2DW4 A;  4BHC A;  1IN7 A;  1MJ9 A;  1SD6 A;  1REP C;  3LFK A;  2ELH A;  1DPR A;  1EH8 A;  2IA1 A;  2EFW A;  1P2F A;  1K6O A;  3WG9 A;  3RPU A;  1W4M A;  2ZNZ A;  4L9V A;  3M7G A;  2XRO A;  2DPD A;  1Z91 A;  1UHW A;  4YIF A;  1BIB A;  4OIQ F;  4Y15 A;  5FD5 A;  1EH7 A;  3D5L A;  2WWY A;  2A6H F;  1YIO A;  2V6C A;  4G7Z F;  1R7J A;  2HYG D;  3MWM A;  5HLG A;  3EYY A;  3GUD A;  1HBX G;  3F8N A;  3KP6 A;  4G94 A;  1TW2 A;  1F9N A;  1QZY A;  3LA7 A;  4MQV A;  1ZN2 A;  2HZT A;  2W85 A;  2YSR A;  1YO5 C;  3N4M A;  4LLN A;  3E97 A;  1LNW A;  3FM3 A;  3WU1 B;  5JHU A;  1BJA A;  1KYW A;  3R4K A;  2ZBK A;  2VOP A;  1IF1 A;  4ENN A;  1AOY A;  2LKP A;  4PCQ A;  3I64 A;  2EFO A;  1B9N A;  1FNN A;  3V7S A;  3NRV A;  4MEX F;  2V1X A;  2HEO A;  2ISY A;  3BJA A;  4IXA A;  3FWE A;  2H27 A;  6PAX A;  3RI4 A;  2A6E F;  2LF7 A;  2CW0 F;  2FRH A;  3FXU A;  4XLP F;  3GXO A;  4OMZ A;  5L3E A;  2IA0 A;  4R1H A;  5HLH A;  1TLH B;  3JSP A;  3QU6 A;  2HDC A;  1ZRE A;  3FMS A;  5DCM B;  1H9T A;  3CO6 C;  1LDJ A;  2M87 A;  3KP2 A;  2E7W A;  3GZ5 A;  2RNJ A;  4PGH A;  3WU0 A;  2ISZ A;  1SD5 A;  2OBP A;  2M1B A;  5HDK A;  5FD6 A;  4LK1 F;  3RKX A;  2FOK A;  4G6D A;  3V4G A;  1ZRF A;  1IRG A;  4M71 A;  4HDU A;  1MZB A;  2P5K A;  2YX4 A;  3EYI A;  4ZH4 F;  4LLL A;  4IRI A;  3T1B A;  1P4X A;  2ZME A;  4NB5 A;  2W57 A;  2NNN A;  2FSW A;  2VE8 A;  3JTG A;  5D4R A;  2D2W A;  4AIJ A;  1RZ4 A;  4P5O A;  4N9H A;  4M9Z A;  2JRT A;  4FT8 A;  3M8E A;  2HQR A;  1LQ1 A;  4M73 A;  2IW5 A;  1O3Q A;  4WX9 A;  3ELK A;  1ZGA A;  4EM1 A;  4KNY A;  2XGX A;  3ML6 A;  1XGM A;  1J5Y A;  3G3Z A;  1ZRD A;  2P7V B;  2HTJ A;  1BI1 A;  1PUE E;  5JR3 A;  2FF4 A;  1ZAR A;  2VBX A;  2IVM A;  3WGG A;  2STT A;  5E1W A;  4LD5 A;  1ON2 A;  1YW8 A;  1S7O A;  2O6G E;  2BGC A;  1ZH5 A;  1RNL A;  1QGP A;  4ZYH A;  2E1C A;  3KP7 A;  3MQ0 A;  1ZG1 A;  2ZNY A;  1OPC A;  1FBU A;  5AIQ A;  3TO9 A;  3HOS A;  5ED4 A;  4I0A A;  1XGS A;  4UVB A;  2HGC A;  1MGT A;  1O57 A;  2YR2 A;  1OYW A;  4U7D A;  5AIP A;  2MH2 A;  2G9W A;  1XSX A;  1F4K A;  2IA2 A;  3QU3 A;  2K4J A;  1OMI A;  4G7O F;  4S04 A;  4U0Y A;  1HKS A;  2V1D A;  3VFZ A;  4B09 A;  1KQ8 A;  1GXP A;  3RIR A;  2VT3 A;  1G3T A;  3GEZ A;  2KJB A;  1FPQ A;  3RKW A;  1FYL A;  1ODD A;  5CLS A;  3FMQ A;  4IVN A;  2V9V A;  3CDH A;  2ZME B;  3KZY A;  3HRT A;  2Z99 A;  1ZAO A;  3MAJ A;  3M8F A;  4RAY A;  3EUH A;  4KIC A;  2PI0 A;  2LDU A;  2VBZ A;  3DEU A;  3DFG A;  3V7C A;  1S7A A;  5FFX A;  2Z9O A;  3L09 A;  3E5X A;  3F8F A;  4A12 A;  1LDD A;  2CYY A;  4IRG A;  4G9Y A;  4I98 B;  1HKQ A;  1ZGJ A;  3VB2 A;  2EV6 A;  1QBJ A;  5A2Q K;  3KEO A;  1UFM A;  3BPV A;  3KP3 A;  3EQL F;  4BAY A;  1IN6 A;  3QRF F;  3FMR A;  1P6R A;  1XDU A;  1KU9 A;  3WOD F;  2X0L A;  1QZZ A;  3E6C C;  3E6B A;  1RI7 A;  2D1H A;  2P6T A;  4YII A;  1WWX A;  3KFW X;  1BM9 A;  5EEG A;  2P4W A;  1BC7 C;  2K02 A;  4XSZ F;  2FBI A;  4P9F A;  2OZ6 A;  1Z1D A;  3HHH A;  1DPU A;  2KIF A;  2ESN A;  4BHB A;  4L0Z B;  4GYG A;  4EM0 B;  4ON0 A;  2HOE A;  1QO0 D;  5LRR A;  4RGR A;  1FC3 A;  4HQE A;  1BI2 A;  2GA2 A;  2KIU A;  2OU2 A;  3K9T A;  2GIV A;  3KCC A;  5ERI A;  3H3U A;  5DV5 A;  4HW0 A;  5E17 F;  5D5V B;  5IT9 K;  5J6X A;  1YTY A;  1R22 A;  3CTA A;  4F7Z A;  5ICE A;  1EV7 A;  4JBA A;  3TKY A;  1J0R A;  2FNP A;  2K86 A;  3HYI A;  4UVC A;  3ZPL A;  3HRM A;  1EH6 A;  1SMY F;  3I4P A;  2PG4 A;  4E70 A;  2F5D A;  5IT3 A;  3SZP A;  3F8M A;  2OA4 A;  2NRA C;  4Q5S F;  2FML A;  2XHK A;  2MLK A;  4IPA A;  3FHZ A;  1S8N A;  3F8C A;  4CXF A;  3JAM Z;  4ASN A;  3U2R A;  2W24 A;  2A69 F;  4MTD A;  2K4B A;  4P96 A;  1OR7 A;  2CSO A;  4A6E A;  1BN5 A;  3K69 A;  3I53 A;  1XCB A;  3IHU A;  2RN7 A;  3FXQ A;  2F5C A;  3FZV A;  3GF2 A;  3ECH A;  1MKM A;  4M9X A;  2PEX A;  2V79 A;  1FY7 A;  1HQC A;  4AD9 A;  1SFU A;  4LJZ F;  1PP8 F;  1IAW A;  3I0T A;  1B59 A;  2W84 A;  1C0W A;  1L3L A;  1XD7 A;  1KU7 A;  1GHC A;  2PFB A;  1XDS A;  1Z7U A;  3C7J A;  2VON A;  1FLI A;  1XCV A;  1IN5 A;  4TV7 A;  5FO5 A;  3IWZ A;  3K1M A;  3D0S A;  4EQQ A;  2LF8 A;  3E3V A;  2K7L A;  4ZZL A;  3Q5F A;  3QP5 A;  3ZN1 A;  2A07 F;  2Q0O A;  1TW3 A;  3GFJ A;  4WWC A;  2BYV E;  5ICG A;  1R5G A;  4I09 A;  4EJT A;  2O03 A;  2JPB A;  2JSC A;  3E6D A;  4M6X A;  4WK8 F;  3KLO A;  1G3S A;  5F6F A;  3RYR A;  2PMU A;  1P4W A;  3K2Z A;  2ZO4 A;  3L00 A;  1Z6R A;  2L54 A;  3F23 A;  3HTU A;  4KMU X;  3L2C A;  3WTW C;  1W5T A;  1KQ0 A;  2DTR A;  1K78 B;  5LGN A;  3P9K A;  1IN4 A;  3NEU A;  1A04 A;  3RTR A;  2R7F A;  1MJA A;  2DAO A;  4CZZ A;  5LRS A;  5D6E A;  2Z5U A;  3VOE A;  4HLY A;  4OIP F;  2ZCW A;  2XAJ A;  5HVQ C;  2STW A;  2RVC A;  4P55 A;  4L18 B;  3J80 K;  4MNU A;  3IC7 A;  3H92 A;  2NNY A;  1FZP B;  1HW5 A;  2QWW A;  2RDP A;  2MA3 A;  3C18 A;  2A5Y B;  2VN2 A;  2EFQ A;  3GZ6 A;  1HW2 A;  4KUM A;  5DEQ A;  3K0L A;  3T8T A;  3ZP5 A;  1O3S A;  2TDX A;  3ULQ B;  5ICC A;  4OIR F;  3FM5 A;  3BPX A;  3IKT A;  3E6M A;  3I58 A;  1D8J A;  1WKM A;  3LA3 A;  1BI3 A;  2H6B A;  3HSR A;  3ISP A;  3T8R A;  3QOP A;  1D3Y A;  3V7R A;  3N97 A;  4Q4Z F;  4A5N A;  5D5W B;  4A0X A;  2KIM A;  4B8X A;  3TOB A;  4I01 A;  1I27 A;  4RGU A;  4KN4 X;  4EJO A;  4BYY A;  1U78 A;  2XKP A;  1JHF A;  5BOX A;  3ZMV A;  3KP5 A;  4D0P A;  1OYI A;  2O3F A;  3R61 A;  4MGR A;  3LQR A;  2Q8K A;  4HYE A;  1B4A A;  5BMZ A;  2HTS A;  1R23 A;  4YFN F;  4L0Y B;  4L9T A;  2RQP A;  1LVA A;  3KP4 A;  4KA4 A;  2ZKZ A;  1Y0U A;  3O3K A;  4AWX B;  1ZYR F;  4HX4 A;  1UB9 A;  1K7A A;  1WRJ A;  5H6R A;  2PBI A;  1ZRC A;  5CJ9 A;  2COM A;  1Z6T A;  4HX8 A;  3REO A;  2XAG A;  4M72 A;  2CGP A;  1O7F A;  5E18 F;  2NS0 A;  4P9U A;  4RGS A;  2K27 A;  3ABT A;  2MBF A;  4DQ2 A;  4L9N A;  3BP8 A;  1IUY A;  4Q48 A;  1FP1 D;  4XLN F;  2RC4 A;  3P9C A;  2GWR A;  3DKW A;  4U7B A;  2HYF A;  2QQB A;  1TQM A;  4IJA A;  1S3J A;  4UV9 A;  3TDZ C;  2VBW A;  4JQF A;  3F8B A;  2IP2 A;  3F3X A;  5L3D A;  3GW2 A;  3R6S A;  5JVT A;  1DDN A;  4O5V A;  3AAF A;  2YPR A;  3MEX A;  3PQJ A;  2ETH A;  2P6S A;  3ZQ7 A;  5F64 A;  3LWF A;  1ONV A;  2P8T A;  1CF7 A;  4A0Z A;  3BJ6 A; 
#chains in the Genus database with same CATH topology
 2BBY A;  2X6W A;  4PK4 A;  3QPT A;  2VOO A;  2JUC A;  3ZMZ A;  3Q9V A;  3W6K B;  3DTK A;  2E2I J;  3EUH C;  5F0H A;  5HDN A;  3W6J B;  4A3K J;  5E20 A;  2DMN A;  3RDI A;  3PNV A;  2KHM A;  1K4T A;  2R7Z J;  4BQA A;  1R00 A;  3WU2 C;  2DA1 A;  3OYN A;  3GX4 X;  4CDG A;  1V5F A;  2KZV A;  3AFH A;  2R5Z A;  1TNT A;  1R5H A;  3HL2 A;  1YFH A;  1Q1V A;  3ZXS A;  2ZC2 A;  4CH7 A;  3HTS B;  3OYC A;  1FBQ A;  1BL0 A;  3HG9 A;  3MZH A;  2CV1 A;  1OJL A;  4B44 A;  2LYC A;  2L9R A;  3WTY C;  2QVO A;  3OS0 A;  2DO7 A;  2EZH A;  5TRD A;  3I3L A;  1JXS A;  2DLL A;  1Y0N A;  4Y17 A;  2DBB A;  1XC5 A;  2H1L A;  3B6A A;  2JTV A;  3LQQ A;  3SDB A;  3CCR I;  2KIS A;  2OCE A;  3TW6 A;  5E3N A;  2DU9 A;  2EIL H;  2FA5 A;  2QEN A;  3E5Q A;  4GXO A;  3KLN A;  2DI3 A;  4XLF A;  1T0F A;  3PFI A;  5K5O A;  4XBF A;  2ICW G;  1TT0 A;  1GVJ A;  5F1R A;  1V4R A;  3QAH A;  2V1U A;  1T38 A;  4C2U A;  5ILS A;  4BQQ A;  3P9I A;  4ETS A;  4BEH A;  3HGY A;  2HDD A;  2EB7 A;  3W6V A;  2WAQ A;  3PO3 J;  1DU6 A;  1G3Y A;  3OV8 A;  4M3D A;  2G7H A;  4II3 A;  3JRG A;  1Q1H A;  1D8K A;  3LOC A;  5DD8 A;  4A3F J;  1JI8 A;  5EG0 B;  2MLG A;  1QPM A;  2HKO A;  1YW9 A;  4B43 A;  1OKR A;  2L7K A;  1IN8 A;  3DPL C;  4I0B A;  2G7U A;  4GYI A;  5E1Z B;  4LG0 A;  3GO5 A;  3JRD A;  3CCQ I;  2DPU A;  1U8R A;  4XNF A;  2LY2 A;  3FXJ A;  4PUS A;  5K5Q A;  2QKL B;  1ZLK A;  2FMY A;  4PJN A;  5CVJ A;  4NC6 A;  2P5V A;  1OYY A;  1ULY A;  1L0O C;  3G4S I;  5E3L A;  2HR3 A;  1I39 A;  2KLO A;  4Y33 A;  4CIC A;  2L0K A;  3JSO A;  5BPD A;  1PP7 U;  4HF2 A;  5L3C A;  1SAN A;  5GAG J;  5B66 C;  3CMM A;  3M3Y J;  2LSO A;  4LOC A;  1E17 A;  3OL3 A;  4BHP A;  4UXN A;  1MNE A;  1YS6 A;  3K1P A;  3OL4 A;  1RR7 A;  3WGI A;  3F21 A;  3HOT A;  3S32 A;  1VQ5 I;  1YLF A;  3OYD A;  2A5W A;  4LGW A;  2JJ7 A;  4MLO A;  3COA C;  3OMY A;  2IS6 A;  3GBG A;  3RZO J;  3G1L A;  2DQR A;  3KYC B;  2VJI A;  4PZJ A;  2HFH A;  1XB4 A;  2QQA A;  2Y48 A;  1T98 A;  4LB5 A;  1TT5 B;  1FT9 A;  2R7D A;  3C1D A;  3BDD A;  1CF7 B;  3ZMD A;  2NYX A;  2QGU A;  3FHN A;  2NS8 A;  1S29 A;  4ZDL A;  4ZYE A;  2KPM A;  3EUK L;  4WXC A;  5CVU A;  4ZYD A;  3JRH A;  2H8W A;  5FLM J;  2V6E A;  4PJ0 C;  1LEA A;  5D5U B;  1LE8 A;  4FET A;  5ILU A;  2IGO A;  3DF8 A;  1WJ5 A;  5LHG A;  3CLO A;  3S2W A;  1MMD A;  4GO1 A;  3H3Z A;  3CUO A;  1G6N A;  1W7P D;  3HSF A;  1UJ8 A;  1T39 A;  4HX7 A;  4CA0 A;  1P7I A;  2R5Z B;  4OOI A;  3A2K A;  3PFY A;  3S3M A;  3S14 J;  3I4N J;  4M3E A;  2WC2 A;  5KNL A;  3HBL A;  3GME A;  1FX7 A;  1MIJ A;  2L02 A;  2XF5 A;  1J9I A;  4M3G A;  3CCE I;  4J01 A;  1A5J A;  4W97 A;  4IHW A;  1KA8 A;  3I5U A;  4U87 A;  2JT1 A;  2DDA A;  2O8K A;  3NAU A;  2UXX A;  1OR7 C;  3I55 I;  3QPL A;  1YQA A;  2MH9 A;  3VSL A;  5LEJ A;  2FE3 A;  3ZMT A;  1SAX A;  2XRL A;  3A1Y A;  1IRZ A;  2RAE A;  4N0B A;  1XTA A;  1SMT A;  2XV4 S;  2RQQ A;  3WTZ A;  5BQT A;  1ZEL A;  2W4S A;  4F93 B;  4ENJ A;  1WJA A;  1SFK A;  5FLX K;  4XK4 A;  4UUV A;  1R1T A;  3JRF A;  2AS5 F;  4PDK A;  2FBH A;  1VQ4 I;  4HAM A;  5TGT A;  4BEH B;  4II2 A;  2HVS A;  2IT0 A;  4K2E A;  3OY9 A;  2FQ3 A;  3CC7 I;  1IXC A;  3CME I;  2UXN A;  4BJT A;  4E7I A;  5DYM A;  2FNA A;  3CUQ A;  1B9M A;  3HM5 A;  2EZL A;  1B1B A;  3IRQ A;  1QPI A;  1K83 J;  1SD7 A;  4PGG A;  4AYB A;  2ZSI B;  2X85 A;  1G2H A;  1O3T A;  1XSD A;  5FGM A;  5LHH A;  1BI0 A;  2F5V A;  2XC7 A;  1XGO A;  3K7A J;  4AM3 A;  3F72 A;  3NWT A;  4RA2 A;  3SDG A;  4QLC U;  1JTX A;  4LG0 B;  1H88 C;  4BE1 A;  3K1N A;  4XN3 A;  1K78 A;  2K85 A;  4BUP A;  2OQR A;  3JCU C;  4HV5 A;  5H6Q A;  4FAS D;  2VOD A;  4E6K G;  5A2Q Z;  2GZW A;  4A0Y A;  3IRR A;  2EZI A;  2YU3 A;  3DBH B;  2TRT A;  3J81 K;  3V8L A;  3KET A;  2Y31 A;  1UG2 A;  5ILV A;  4EVI A;  2GLO A;  2HU9 A;  3QPH A;  5CVV A;  5DUI A;  4M9S A;  1VQN I;  4DOZ A;  5FKK A;  3LAP A;  1G3W A;  3JRA A;  1GDT A;  1GT0 C;  1AU7 A;  1JHH A;  4OAZ A;  1WJF A;  2E5Z A;  3FXR A;  3O2P E;  3QOD A;  3ABU A;  4L9J A;  4F91 B;  4ZTF A;  4C2T A;  2E35 A;  1XSV A;  1LJ9 A;  3HKZ N;  2JA6 J;  5HS7 A;  3RYP A;  1FP2 A;  2M7B A;  2P5L C;  3KZZ A;  3LST A;  4EGY A;  4HA8 A;  1U5T A;  2JWT A;  2IS2 A;  3OYK A;  1XN7 A;  4PFP A;  5E1X A;  2NVU B;  4EJW A;  3M4O J;  3BTI A;  1SAU A;  4HZF A;  4DIQ A;  4S05 A;  1T95 A;  4UUS A;  4IX7 A;  1I6H J;  2XVC A;  2PJP A;  1KYZ A;  3FKI J;  5IYB J;  1U3E M;  2CG4 A;  3H5N A;  3SQN A;  1JUP A;  1R4N B;  5EEA A;  2AXL A;  4PFO A;  3S16 J;  4G7H F;  1TBX A;  4Q47 A;  2GA1 A;  2WA0 A;  5LGU A;  1VQ9 I;  1PUF A;  4FX0 A;  4KT5 C;  4NC8 A;  5C4X J;  4JYK A;  1W5C C;  2EH3 A;  2QBY B;  5CYV A;  2M5W A;  4BXF A;  2WV1 A;  4YEL A;  3J7A O;  1ZG5 A;  1RRJ A;  5HNH A;  5IT9 Z;  4CO8 A;  5HOO A;  3MFK A;  3BRO A;  1MD0 A;  2F6C A;  3ZQL A;  5TJJ A;  2W82 A;  1ZR2 A;  1WSU A;  2CQK A;  2EZK A;  4HBL A;  1GXQ A;  2CUZ A;  3A02 A;  4L5J A;  3WTT C;  1NH3 A;  1Y1W J;  1XS9 A;  2ZXJ A;  4MTE A;  1LEB A;  2JVH A;  3Q0U A;  2R5Y A;  2GOX B;  4IF4 A;  2RGV A;  1SFX A;  3L7W A;  2VC0 A;  1X2N A;  2DJN A;  1LFU P;  2H8R A;  3PQK A;  3Q0W A;  4KIG A;  3LSG A;  4XLH A;  3TO6 A;  3WTU C;  5GPA A;  3GLX A;  2DK5 A;  4A6D A;  1TZL A;  3IL2 A;  1X3U A;  3KYL A;  4ENM A;  4XOR A;  2YX7 A;  1FTT A;  2W7N A;  2KIQ A;  3CF2 A;  1YYV A;  2ECB A;  2VKE A;  3DKX A;  1S72 I;  2Y30 A;  2A68 F;  3U1D A;  3CUQ B;  2PMH A;  2WAD A;  2L3D A;  1E2X A;  2Q1Z B;  4QWQ A;  3CO7 C;  4RB2 C;  1MMN A;  4JK1 X;  2K9N A;  3BCB A;  3DV8 A;  2ME6 A;  3U21 A;  5CVR A;  3SFZ A;  3S3O A;  2KQR A;  1RUO A;  3BG9 A;  4LIV A;  2OAZ A;  3ZQG A;  1I3A A;  1IXS B;  4JX5 A;  3SYT A;  4EJV A;  1RUN A;  2QZ8 A;  2NVY J;  2RV8 A;  5KK1 A;  3IH2 A;  2XPW A;  4HNV A;  1W7P A;  3KE2 A;  3IAM 2;  5LGT A;  1LDK B;  3TDU C;  1WI3 A;  1U2W A;  2LVS A;  5BS6 A;  1I1G A;  1TWF J;  3BG6 A;  3OOP A;  2GAU A;  4BY1 J;  1BIA A;  3BQY A;  4KIT B;  3GFL A;  5HS9 A;  1SVL A;  5K7F A;  1MBG A;  2DMU A;  2KFD A;  2E36 A;  5DDG A;  2F5F A;  1BBY A;  4C3I J;  1J09 A;  2OPT A;  2H1K A;  4I2O A;  2X4H A;  1DU0 A;  2MG4 A;  3OYB A;  4AVZ A;  2JN6 A;  4WXD A;  1FSE A;  1D5V A;  1JJ8 C;  1K6Y A;  3I4M J;  1VQL I;  3L2Q A;  3IP4 B;  2VQC A;  5EZH A;  4CHU A;  1R1V A;  4C2M J;  1B6A A;  3AKZ A;  3CJQ B;  2CJJ A;  3ZQI A;  1H9G A;  1U5T B;  1T6S A;  4P1W A;  5LLQ A;  2UZK A;  3HPG A;  2NVQ J;  4OU0 A;  3BZ6 A;  3NAR A;  2W48 A;  3RQ4 A;  4LK0 F;  3TED A;  1VTN C;  1RET A;  3B02 A;  3LA2 A;  5EJC A;  5GAD J;  3KEQ A;  3F22 A;  1FYK A;  3ERE D;  1STZ A;  5IP6 A;  2PN6 A;  4HPQ A;  2HNH A;  3EET A;  3K4B A;  1GLN A;  4DBR A;  3VOD A;  3LSM A;  2I8D A;  5FB2 A;  1MJB A;  4EM2 A;  4LB6 B;  1A6Q A;  5CKT A;  1U9O A;  3L9F A;  5D8L B;  1R36 A;  4I76 A;  2I10 A;  3LSP A;  1J59 A;  1OCC H;  2X48 A;  2WB1 N;  2DFH A;  4J19 A;  3SZG A;  3OSF A;  3J7A Y;  2ZFW A;  2XGC A;  4YEJ A;  1A31 A;  4KFC A;  2NAZ A;  2EJR A;  2GXB A;  4OAY A;  5F27 A;  2ZFU A;  3OR2 C;  2DOE A;  1DP7 P;  2YU9 J;  1YW7 A;  4MFE A;  2DTZ A;  1SVO A;  1W1W E;  4EJU A;  2OTJ I;  2IAI A;  4IHT A;  3GTG J;  2OZU A;  4HOB A;  4Y4R A;  2L01 A;  5AON A;  3T0Y A;  2KP6 A;  3TOA A;  1W36 C;  2DN0 A;  2HKX A;  3CCL I;  1U6G A;  2M9H A;  3JW4 A;  1FJL A;  4DZJ A;  2VT2 A;  3C2H A;  5D8K B;  2L2O A;  2W1O A;  2F2E A;  2XKO A;  1Y1V J;  3HEF A;  5K7Z A;  1O7L A;  2L7F P;  2R5Y B;  1N25 A;  4MQ9 F;  1NG6 A;  4KDP A;  4ESF A;  1TTY A;  4GDF A;  2KRH A;  2KZG A;  4BE0 A;  2FBK A;  4BAC A;  4NHJ A;  3D5R C;  1ITY A;  4RMN A;  1FOX A;  1QZE A;  3MZY A;  4UV8 A;  3PSF A;  2CS3 A;  2XAH A;  2E34 A;  4L5I A;  3FBN B;  2JK3 A;  3FX3 A;  5DD4 A;  2M3A A;  3OYG A;  2M8E A;  2XRN A;  4NQW A;  1U0J A;  2A61 A;  3RZD J;  2DMQ A;  2EIK H;  3ROU A;  2DK8 A;  2B63 J;  3EDP A;  5JFR A;  1H89 C;  1MNM C;  2KRF A;  2WAE A;  1W7P B;  1T33 A;  1HDD C;  1V5E A;  3MKZ A;  5B1B H;  1VQO I;  2PLY A;  2LNB A;  2HPI A;  4FCY A;  1G4D A;  2RRE A;  5EG0 A;  3GWZ A;  3J80 Z;  4HDV A;  2IGM A;  1OCO H;  3DU5 A;  5EF6 A;  4XL9 A;  1ZHF A;  1PYV A;  2JZY A;  5IOY A;  1WQ2 A;  2DJI A;  2ACJ A;  5EGO A;  4HF0 A;  2E7X A;  1N75 A;  1R58 A;  2ESH A;  3CJR B;  5F0F A;  3A0B C;  2R7S A;  5EYR A;  4ZZD A;  4Z2Y A;  4KYW A;  4X6A J;  1FWZ A;  3U1K A;  5F08 A;  3GFM A;  2CO5 A;  2F48 A;  4LG3 A;  3OS1 A;  3DPU A;  1QHH D;  2VE9 A;  5L3G A;  2OD5 A;  3M07 A;  4XKV A;  1JT6 A;  2DA4 A;  2GQQ A;  2J5O A;  2CQ7 A;  3OYM A;  4CGZ A;  5FLV A;  2EWN A;  1TQI A;  4HNT A;  3R60 A;  2Y0M A;  2D45 A;  3CP2 A;  2Y2Z A;  2WY8 Q;  2OF7 A;  2LR8 A;  4A5M A;  2O61 A;  5DS9 A;  2EFP A;  3VYR B;  1MDM A;  2CQQ A;  2O0Y A;  5LEK A;  2AQE A;  1OCT C;  1IRF A;  3KPH A;  2QM3 A;  1HDP A;  2HZD A;  5LFA A;  2D1V A;  4XLE A;  1GVD A;  1VF9 A;  3HRU A;  2UWM A;  2JUG A;  3H1C A;  1DGW Y;  1ZQ3 P;  4A3M J;  4XSX F;  1S5L C;  2OJE D;  4WF2 A;  4UNO A;  2KL4 A;  3MKL A;  3P7N A;  5KVR A;  4XKB A;  1QQI A;  4QTR A;  1I1S A;  2V4J C;  3IH4 A;  4RB1 A;  1DP3 A;  4JOM A;  2KMU A;  2LRE A;  2CUE A;  1R1U A;  2UUZ A;  3PNY A;  1YHQ I;  3FXL A;  2PQ8 A;  3AG4 H;  4H0E A;  3A4C A;  3WTX C;  3K4M A;  1BW5 A;  2O9L A;  3TGN A;  2EK5 A;  4C9Y A;  1ON1 A;  4XM3 A;  1WI9 A;  5E8G A;  4A3L J;  2Z2S B;  3FF5 A;  3K6G A;  3H3V K;  2ELJ A;  3IWF A;  5HNF A;  3F6O A;  1WHU A;  4FHT A;  2B9S A;  2M45 A;  1WGX A;  3MCZ A;  3AG3 H;  1XGN A;  2EA4 A;  2X9D A;  3EPZ A;  3HKZ A;  4UB8 C;  4FTH A;  1Z05 A;  1IDY A;  2NS7 A;  2Y75 A;  4I02 A;  3K70 C;  1Z77 A;  3DEE A;  2AO9 A;  2BV6 A;  3BLY A;  2G0E A;  3C2B A;  2R7O A;  1W0T A;  1UST A;  2WY7 Q;  1I6X A;  4I6Z A;  1HA8 A;  4MHG A;  4CYD A;  4QIW N;  5FJ8 J;  2GOM A;  2XIG A;  2W25 A;  3FBI B;  4OIN F;  3LNQ A;  3JRI A;  2R92 J;  3PIP F;  1VQ6 I;  1R49 A;  1U8B A;  3VEP A;  3ZMS A;  4RGX A;  5L3F A;  2MD5 A;  2IPQ X;  5LBQ A;  1IZ1 A;  1T2K A;  1NTC A;  3FKJ A;  5F04 A;  2FU4 A;  4FX4 A;  5M5Y J;  4ZDP A;  3DXJ F;  3DPT A;  4XON A;  1SD4 A;  5J8C A;  3S15 J;  3KYD B;  2Z3Y A;  1X3W B;  4NQW B;  3CQZ J;  3RJP A;  2XUB A;  2EIJ H;  4IHS A;  3LSK A;  1WJE A;  4ENK A;  5K5R A;  3E5U A;  1IW7 F;  3DLL F;  1JTY A;  4BE2 A;  2QSH X;  3S1M J;  3CJN A;  1LB2 A;  3LMM A;  4A3I J;  1H0M A;  2JMW A;  1RIO H;  3M9A A;  3BTJ A;  4E7H A;  2QUF A;  4GCV A;  4R79 A;  3X2Q H;  2CU7 A;  5EGO B;  2V26 A;  3SJM A;  4MEY F;  3Q9S A;  3HHG A;  3OS2 A;  1ZLJ A;  1HSJ A;  2BY2 A;  4GGG A;  2OC6 A;  2ZXW H;  1TNS A;  1LPQ A;  3LFU A;  5JHF A;  2VJ4 A;  4RS8 A;  2DXI A;  1GV5 A;  4ZYG A;  3F9K A;  4LFU A;  1JKP C;  1ZTR A;  2F5E A;  3H0G J;  3K4C A;  4FE4 A;  5D6F A;  5ICF A;  3OYA A;  4XRS A;  2EQR A;  4H4K C;  3FIS A;  1HCR A;  1VQ7 I;  3WHC A;  1FBS A;  3GTP J;  3GZN B;  1E0E A;  4D1Q A;  3BG5 A;  3BJO A;  3T5X A;  4AIK A;  1KU2 A;  2CFX A;  3JTH A;  4EGZ A;  4CUG A;  4D5F A;  3TP3 A;  1YRN B;  3OYI A;  2A05 A;  2M30 A;  1J2X A;  2HOT A;  1Z67 A;  1MDM B;  2K40 A;  1VQM I;  1YS7 A;  2L4M A;  2MD0 A;  3V8J A;  2M34 A;  1KGS A;  1V5G A;  2N8G A;  3HRS A;  1O3R A;  4IRH A;  5K7H A;  3WTV C;  1OCZ H;  2HQA A;  2LFB A;  4EAT A;  5F1J A;  3CUQ C;  4ESB A;  1A6I A;  4A3J J;  4O3M A;  3CDL A;  2J5P A;  1TC3 C;  5JLW A;  1PDN C;  4N9I A;  4B1R A;  4CZC A;  2X6Y A;  3GFI A;  3DP7 A;  1AA7 A;  2K3P A;  2FEZ A;  3S8P A;  2JA5 J;  1USS A;  5FFZ A;  2MYS A;  4LMY A;  4RB0 A;  1HXD A;  5IP9 J;  2H09 A;  2HS5 A;  4G8X A;  3WTS C;  2QLZ A;  2R7U A;  5IYD J;  1SEU A;  2RNG A;  3I71 A;  3PNT A;  3HIF A;  2CW8 A;  1NHA A;  2L4A A;  1K61 A;  3ASO H;  4HLX A;  2VLA A;  4ITV A;  2BW3 B;  3BOQ A;  5J1Y A;  1W5S A;  3D5S C;  3ZQF A;  2EA2 A;  2LC2 A;  3D1N I;  2EV0 A;  1MSE C;  4V19 K;  2ECC A;  1AWC A;  1WFX A;  3ECO A;  2Q2E A;  3OYJ A;  5CVI A;  4IOA F;  2XAQ A;  2QYO A;  3JAM K;  4BNC A;  3LSH A;  2QKM B;  5J8F A;  2DT5 A;  2LG4 A;  3H5R A;  2PJR A;  3O6B B;  2JPC A;  2ID6 A;  2KJC A;  2R3S A;  1HW1 A;  2XAF A;  3DQV C;  2QBY A;  3R0J A;  2P81 A;  3BTL A;  3Q3S A;  2FX0 A;  4MIM A;  1SFO J;  2XAS A;  2L7Z A;  1SFE A;  3GYH X;  1F43 A;  3RPU D;  3SXY A;  2VC1 A;  5LHI A;  1P4A A;  1TL8 A;  1Y8R B;  3PL8 A;  4YRV A;  2A3S A;  3BR3 A;  4UVA A;  3L2W A;  2LKS A;  4HQM A;  2VI6 A;  1JE8 A;  3ABM H;  2GXA A;  1Z3Y A;  1RKW A;  1U5T C;  4U0V A;  4XR6 A;  1UZC A;  3HPH A;  1CQT A;  2O8X A;  5JI6 A;  3SZT A;  1I5Z A;  5E8I A;  1EF4 A;  2L7M P;  1IV8 A;  2VAS A;  2IS1 A;  4KT6 A;  3I59 A;  5H20 A;  2HWV A;  3JRB A;  3TL4 X;  4G6Q A;  3WHB A;  3QP6 A;  5L3B A;  1T08 B;  3BZK A;  2X6X A;  3DBR B;  2WB1 A;  4HV6 A;  4M6Y A;  2X51 A;  2BVL A;  2VBY A;  4I7H A;  3NQO A;  4A2U A;  3J7Z I;  2XSJ C;  2K9Q A;  3HUG A;  3BWG A;  4Y7N J;  4GFB A;  2EV5 A;  2KKO A;  4BXX J;  3DLA A;  3G73 A;  4YFK F;  1F1Z A;  4V2F A;  3C3W A;  2CH0 A;  1KQ9 A;  4HF1 A;  2DA3 A;  1TQP A;  4NC7 A;  2CW7 A;  4AIH A;  3BG7 A;  2E19 A;  2PMZ N;  4XRF A;  3WGH A;  1BOA A;  1YJ9 I;  3BR5 A;  2H94 A;  5EEH A;  4B47 A;  1J75 A;  3TO7 A;  1I50 J;  4QSH A;  1FSH A;  1FOK A;  1YE9 A;  3ASN H;  2JRM A;  3RKY A;  3HOU J;  4XLA A;  4QPQ A;  1ZKG A;  5M3F J;  4E7Z A;  2BEO A;  5J1R A;  4NUB A;  3FXK A;  2FOW A;  2GM4 A;  1MBF A;  2RKH A;  1CGP A;  1HC8 A;  1RC9 A;  2GXG A;  3ZMU A;  5HLT A;  1TP4 A;  1FYM A;  3GVA A;  4HG2 A;  3ONQ A;  4OMY A;  4B48 A;  2CQX A;  2V7F A;  5BPI A;  2VXZ A;  3FK6 A;  5GPC A;  2OTL I;  3H35 A;  4FQG A;  1UG0 A;  4KMF A;  3H0D A;  3BZC A;  1TWH J;  1EA3 A;  1YOV B;  5DCF A;  3KIO A;  3E0J B;  4EV0 A;  4GRI A;  1MW7 A;  2CFO A;  3K4K A;  4EEF G;  3BY6 A;  3FK7 A;  4YFX F;  2PX9 A;  5HDG A;  1ORK A;  3TBI A;  1F5T A;  1JGS A;  3S1N J;  2P7C B;  2VXD A;  2L5Q A;  4KIF A;  3SFI A;  5K1Y A;  1NK3 P;  2IS4 A;  1XMK A;  3I54 A;  2HI3 A;  3MMY B;  3ZN0 A;  2IRF G;  1X4O A;  2ZJ2 A;  1ETW A;  4D9J A;  4ZYA A;  1J7K A;  3OR1 C;  3FIW A;  3CF5 F;  4KN7 X;  2FXA A;  3I9V 2;  2ADU A;  3B73 A;  5HS8 A;  1R4M B;  4RLQ A;  2VKD A;  1UCR A;  4Y13 A;  3OYL A;  3MVP A;  1ZG3 A;  1S6L A;  3F6V A;  4KIB A;  4AVP A;  2VPR A;  3SHF A;  4BXU A;  4DYC A;  3TQN A;  4M3F A;  4BH9 A;  3HSE A;  2X1C A;  4U88 A;  5KHD A;  5DUK A;  4YG2 F;  4M74 A;  3DTE A;  1R6R A;  4WXH A;  1WH5 A;  2M0C A;  1V3F A;  1UHM A;  2R93 J;  3ZRG A;  2Q2E B;  3OIQ A;  2WV0 A;  4EMS A;  4HRI A;  2Z33 A;  4O6J A;  1A36 A;  2MC3 A;  1MMA A;  2CWE A;  2DFE A;  3IKV A;  3WE3 A;  1DUX C;  2PJR B;  1JKO C;  4WCG A;  2QEX I;  5D5X B;  2WTE A;  4B3X A;  5FLX Z;  4ESJ A;  4LLG F;  2OQG A;  4BDZ A;  2VIX A;  2M4K A;  4RM3 A;  2E1N A;  4R8H A;  4BJ6 C;  4G6T B;  3CJT B;  1XMA A;  4DYR A;  2C6Y A;  5CQE A;  1IXR C;  3CCM I;  1BC8 C;  3PUB A;  4U0W A;  2HQN A;  5EZG A;  1P92 A;  2H6C A;  4CSW A;  1Z9C A;  2LY9 A;  3CLQ A;  2V1N A;  1HOM A;  2HQ5 A;  3V8K A;  1HST A;  2Z1D A;  5D4S A;  1QNT A;  2B7E A;  2EFN A;  2IJL A;  3I59 B;  1IC8 A;  1KU3 A;  1HKT A;  3R0A A;  3IV5 A;  2QQ9 A;  5HLI A;  2XSD C;  2QSG X;  4UUT A;  2CQN A;  3LAJ A;  2NOG A;  1LVK A;  2DFI A;  2F4M B;  4A3C J;  2BHZ A;  1YG2 A;  2COB A;  1BR4 A;  3HUG B;  3PSI A;  1ERD A;  2F4O B;  3G71 I;  3RPQ A;  4IZZ A;  4L5E A;  3DBL B;  2X1D A;  2DOF A;  3M1E A;  4BS9 A;  1IUF A;  3N05 A;  3U9G A;  3WE2 A;  4RB3 C;  4C30 A;  2BE5 F;  2VQG A;  2OCC H;  3J81 Z;  2R7X A;  4RAZ A;  2B0L A;  1MBK A;  2DQL A;  3ZR8 X;  5DM7 F;  3QQA A;  1K79 A;  4OIO F;  2WBM A;  5DCM A;  3RCO A;  4DNC A;  1MND A;  3ZOB A;  3VYS B;  5E3O A;  1UEL B;  2AXT C;  3ERM A;  4UHT A;  2DW4 A;  4BHC A;  5C4J J;  3CMY A;  1IN7 A;  3HOW J;  1MJ9 A;  3GTJ J;  1SD6 A;  3JRC A;  3VDX A;  3QYF A;  1F36 A;  1REP C;  2VKV A;  1RPW A;  3LFK A;  2ELH A;  3OOU A;  1DPR A;  3CD6 I;  1EH8 A;  2IA1 A;  2EFW A;  1P2F A;  1K6O A;  3RPU A;  3WG9 A;  1W4M A;  4J00 A;  4ZJZ A;  3VYU B;  2ZNZ A;  4L9V A;  3M7G A;  5FKN A;  2EPF A;  5JLX A;  2XRO A;  3KX2 A;  1MBJ A;  2NOJ B;  1BJZ A;  2VQL A;  3DEW A;  2M8G X;  4DGW B;  2DPD A;  4IHY A;  9ANT A;  1Z91 A;  1UHW A;  4YIF A;  3P5J A;  1BIB A;  4OIQ F;  2YS9 A;  4Y15 A;  2Y0S N;  1EH7 A;  2X1E A;  3D5L A;  5FD5 A;  2WWY A;  1B8I A;  2A6H F;  1YIO A;  2V6C A;  4PJM A;  4JP0 A;  1WVR A;  4G7Z F;  1R7J A;  5LD2 C;  2HYG D;  3MWM A;  5HLG A;  3EYY A;  3GUD A;  3GLL A;  1HBX G;  2K3F A;  1BOB A;  3F8N A;  3KP6 A;  4G94 A;  1TW2 A;  2CV2 A;  1F9N A;  1QZY A;  3ZQQ A;  3LA7 A;  4DW6 A;  2ZJQ F;  4MQV A;  1ZN2 A;  1JUM A;  1OLT A;  4UUS B;  2HZT A;  2VB6 A;  2W85 A;  2M4G A;  2YSR A;  3MN2 A;  3CC4 I;  1ENH A;  4IHV A;  4FIS A;  2Z16 A;  1YO5 C;  3N4M A;  2TCT A;  1LUJ B;  4LLN A;  1XG1 A;  1LNW A;  3E97 A;  3FM3 A;  3I56 I;  3WU1 B;  5JHU A;  1BJA A;  1KYW A;  3R4K A;  4X1E A;  5IPA A;  1TWA J;  2ZBK A;  2VOP A;  1IF1 A;  4AID A;  4ENN A;  1AOY A;  2LKP A;  5J4V A;  2XAU A;  4PCQ A;  1D5Y A;  1Y56 A;  3I64 A;  2EFO A;  1B9N A;  3S2D J;  2HVQ A;  1FNN A;  3BR0 A;  5FKM A;  1QA6 A;  1R5I D;  2MSY A;  2DCE A;  1GUU A;  3V7S A;  3NRV A;  3L2V A;  4MEX F;  4A3D J;  2VJJ A;  2V1X A;  2AQF A;  2HEO A;  3BQZ A;  5GAH J;  5FRN A;  2ISY A;  3BJA A;  1P9Q C;  1X1B A;  1X1A A;  4IHX A;  2DOA A;  2XDV A;  4IXA A;  3FWE A;  5FKO A;  2R7R A;  3HXL A;  2H27 A;  6PAX A;  2O5R A;  4YIR X;  1W0U A;  3RI4 A;  2A6E F;  2KRC A;  1MH4 A;  2LF7 A;  2Y9Y A;  1YIJ I;  3KZI C;  2CW0 F;  2LOO A;  4NDL A;  4G12 A;  3KEY A;  2FRH A;  3FXU A;  4XLP F;  2JVG A;  3W2W A;  1UHS A;  3GXO A;  4OMZ A;  5L3E A;  2IA0 A;  1NK2 P;  4R1H A;  2NVX J;  2FQ4 A;  5GTI C;  2FD5 A;  1LFB A;  3NWS A;  4XID A;  2ZSH B;  4AU7 A;  5HLH A;  1TLH B;  3JSP A;  3G2B A;  1QRY A;  2DA2 A;  3QU6 A;  2HDC A;  1ZRE A;  4A3E J;  2ID3 A;  4F92 B;  2KT0 A;  3L2U A;  3FMS A;  2LK2 A;  5KAF C;  2FUG 2;  2M0M A;  1ZK8 A;  5DCM B;  3HOV J;  1H9T A;  3CO6 C;  2DT7 B;  1LDJ A;  2M87 A;  2BXZ A;  3KP2 A;  2E7W A;  3GZ5 A;  3K4J A;  2RNJ A;  1YIT I;  4PGH A;  3BC8 A;  2UV1 A;  3WU0 A;  3CMA I;  2ISZ A;  5FKL A;  1SD5 A;  1TWC J;  2OBP A;  2R0Q C;  2M1B A;  5HDK A;  3EUA A;  5FD6 A;  2LP0 A;  4LK1 F;  1PJR A;  3RKX A;  2FOK A;  4G6D A;  3V4G A;  1ZRF A;  1IRG A;  4CYC A;  3K4N A;  4M71 A;  4HDU A;  3IUO A;  2W00 A;  1MZB A;  2P5K A;  4Z6Y A;  1B8I B;  4CCN A;  1PVE A;  2YX4 A;  4D7M A;  1X1C A;  4ZH4 F;  3EYI A;  1N78 A;  4LLL A;  4IRI A;  3VWB A;  3T1B A;  1P4X A;  2ZME A;  4NB5 A;  2W57 A;  1YRN A;  2NNN A;  2FSW A;  2VQH A;  5B1A H;  2LKX A;  1OFC X;  2VE8 A;  1BW6 A;  2CMP A;  2K9S A;  4IEJ A;  4BL0 B;  5HOD A;  5D4R A;  2D2W A;  3JTG A;  2L9N A;  1EKE A;  4AIJ A;  1RZ4 A;  4P5O A;  1B72 A;  1U9N A;  4N9H A;  3S17 J;  4M9Z A;  3K10 A;  2JRT A;  2LD5 A;  4FT8 A;  3M8E A;  2HQR A;  4PSX A;  2PMZ A;  3DKY A;  4B3A A;  2VPL A;  1LQ1 A;  4M73 A;  3HZJ A;  2IW5 A;  1O3Q A;  4WX9 A;  1MBE A;  1ZGA A;  3ELK A;  3MZ8 A;  4EM1 A;  4KNY A;  2XGX A;  3ML6 A;  2CUF A;  1XGM A;  3BG3 A;  2BY3 A;  1J5Y A;  3G3Z A;  1ZRD A;  2P7V B;  3CCU I;  4PJL A;  2HTJ A;  1BI1 A;  1PUE E;  2IXS A;  1X1D A;  1X19 A;  2HPM A;  3VPR A;  5JR3 A;  3PJR A;  2FF4 A;  1ZAR A;  2VBX A;  5DTD A;  2BW3 A;  2IVM A;  3WGG A;  1LFP A;  2XB5 A;  2STT A;  1DQU A;  3LSJ A;  5E1W A;  4LD5 A;  1FIA A;  2K9L A;  1ON2 A;  1YW8 A;  1O4X A;  1S7O A;  2DA6 A;  2O6G E;  2LBF A;  1APL C;  3M8J A;  3CDI A;  2BGC A;  1KZH A;  1ZH5 A;  1Y6I A;  5C44 J;  1RNL A;  4DYQ A;  3PO2 J;  5EDN A;  1WJD A;  2GBY A;  1QGP A;  1V54 H;  1ACI A;  1UAA A;  4ZYH A;  3Q0V A;  2E1C A;  3KP7 A;  3MQ0 A;  1ZG1 A;  3GCM A;  4XRS G;  2ZNY A;  5GTH C;  4UB6 C;  1OPC A;  5JVG F;  1FBU A;  3BR6 A;  5AIQ A;  3TO9 A;  3HOS A;  5ED4 A;  3ZQH A;  4I0A A;  1A35 A;  1XGS A;  3HDD A;  5CQG A;  1ETY A;  4E7L A;  3BT9 A;  2MFZ A;  3QWL A;  4PJJ A;  4QPO A;  4XKW A;  4UVB A;  1ETO A;  1Z7L A;  3QYE A;  4F55 A;  4CCL A;  4UY8 I;  2ELK A;  4DJA A;  2NXN B;  2HGC A;  3OYE A;  2DMT A;  1YX5 A;  2HYJ A;  3AG2 H;  1MGT A;  1O57 A;  2YR2 A;  4B4C A;  2HVR A;  1OYW A;  4U7D A;  3H9Q A;  3HOZ J;  4X0G A;  5AIP A;  1LKX A;  1DGR M;  3BTC A;  2LRD A;  3CC2 I;  2ZJP F;  2MH2 A;  1P7J A;  2G9W A;  1XSX A;  5E3M A;  3S1R J;  1VZ0 A;  1FMV A;  3W2V A;  3H5A A;  3BR2 A;  1F4K A;  2IBD A;  3JR9 A;  3HJE A;  4ZC3 A;  5J1U A;  2IA2 A;  3QU3 A;  2K4J A;  1OMI A;  4G7O F;  4S04 A;  2JSP A;  2MW8 A;  5IOZ A;  4U0Y A;  1HKS A;  2V1D A;  3VFZ A;  3OWT A;  2BZT A;  4B09 A;  1GXP A;  3RIR A;  1KQ8 A;  1SVM A;  1BR1 A;  2F4I A;  2VT3 A;  2OUM A;  2E2H J;  1G3T A;  3GEZ A;  4CYC B;  1AKH A;  5GP9 A;  2VUM J;  2KJB A;  3C2G A;  1FPQ A;  3RKW A;  5BNG A;  1HF0 A;  3A01 B;  1ODD A;  5CLS A;  1FYL A;  2E71 A;  2XPV A;  3FMQ A;  4JX6 A;  3W3C A;  4IVN A;  2V9V A;  2KDZ A;  2EIN H;  3CDH A;  3O8H A;  4C3J J;  2ZME B;  3KZY A;  3HRT A;  2Z99 A;  1ZAO A;  3MAJ A;  2K9M A;  3M8F A;  4RAY A;  2V9P A;  4RAF A;  1ETQ A;  4XOP A;  3EUH A;  4ANJ A;  2E60 A;  2JA8 J;  1Y8Q B;  4KIC A;  1B72 B;  1X3Z B;  2PI0 A;  2LDU A;  2VBZ A;  3DEU A;  3DFG A;  1OCP A;  4I99 C;  3PM1 A;  3V7C A;  1S7A A;  5FFX A;  2Z9O A;  4KJZ A;  3L09 A;  4V2G A;  4CCO A;  3E5X A;  4LIU A;  2DOD A;  3F8F A;  1ZGW A;  4NBQ A;  4A12 A;  1LDD A;  1FEX A;  2CYY A;  2VL8 A;  4IRG A;  2R7W A;  4G9Y A;  4I98 B;  4XN0 A;  4XQF A;  4Y52 J;  1HKQ A;  1ZGJ A;  3VB2 A;  2EV6 A;  1EJ9 A;  1QBJ A;  4IKF A;  3UR3 C;  3QYB A;  3VSK A;  5A2Q K;  3ESW B;  3KEO A;  3BR1 A;  1UFM A;  3BPV A;  1BA5 A;  2VJ5 A;  3KP3 A;  4BQO A;  2HDW A;  2BVM A;  3SEZ A;  3EQL F;  4BAY A;  4BY7 J;  1IN6 A;  3QRF F;  2LBF B;  1RR8 C;  1VQ8 I;  3FMR A;  2HOS A;  2Y0S A;  1FOY A;  1D0X A;  1P6R A;  3F0C A;  2XGD A;  1VQK I;  1XDU A;  1KU9 A;  3WOD F;  2X0L A;  1QZZ A;  1FMW A;  3V42 A;  1YI2 I;  3E6C C;  2XPU A;  2YUS A;  3E6B A;  5KCM A;  2QCO A;  1RI7 A;  2D1H A;  2P6T A;  4YII A;  3OIO A;  1WWX A;  3KFW X;  4XRM A;  1BM9 A;  2L9V A;  5EEG A;  4CCJ A;  4A3G J;  1QVU A;  2P4W A;  1BC7 C;  2K02 A;  1JKQ C;  2QF7 A;  4XSZ F;  2FBI A;  1N77 A;  1OQY A;  4P9F A;  4XMY A;  2OZ6 A;  2BHY A;  3AL0 B;  4AUX A;  1Z1D A;  2ZB9 A;  3HHH A;  4DZP A;  2OV7 A;  1DPU A;  2KIF A;  2Y9Z A;  2E2J J;  3OSG A;  2ESN A;  2R7Q A;  4F52 A;  3CES A;  3ZCO A;  4BHB A;  4L0Z B;  4GYG A;  4EM0 B;  2V9K A;  4ON0 A;  1G8X A;  2HOE A;  1QO0 D;  2MGQ A;  5LRR A;  4RGR A;  1FC3 A;  4IOC F;  4HQE A;  1BI2 A;  2GA2 A;  2KIU A;  2OU2 A;  2WAF A;  3K9T A;  2GIV A;  3IH3 A;  3GTM J;  3KCC A;  5ERI A;  3H3U A;  4A3B J;  1WH7 A;  4M6V A;  5DV5 A;  4HW0 A;  5J47 A;  5E17 F;  1MBH A;  2IGN A;  1AHD P;  1JGG A;  4HEA 2;  4XLC A;  4RAG A;  5D5V B;  5IT9 K;  1G59 A;  1QHG A;  5FRO A;  3MKW B;  4PSW A;  2IEK A;  1Y39 A;  1X1P A;  5J6X A;  1YTY A;  1IRX A;  1R22 A;  3CTA A;  4M3B A;  4F7Z A;  1QU3 A;  4E7K A;  1IG7 A;  5ICE A;  2E1M B;  3DTI A;  1H8A C;  1EV7 A;  1KON A;  4JBA A;  2M7A A;  2DA7 A;  1AKH B;  3TKY A;  1J0R A;  2FNP A;  2EBI A;  5B3S H;  3RKQ A;  1D1C A;  2K86 A;  3HYI A;  2DYS H;  4UVC A;  3ZPL A;  2GIZ A;  3DU6 A;  3HRM A;  1EH6 A;  2JA2 A;  3E7L A;  1SMY F;  3I4P A;  1ZR4 A;  4ZDO A;  2PG4 A;  3TW7 A;  1MMS A;  4E70 A;  2F5D A;  5IT3 A;  3SZP A;  3F8M A;  2OA4 A;  2BXY A;  2NRA C;  1FTZ A;  3QPS A;  4Q5S F;  2FML A;  3RQI A;  5E79 C;  3JRE A;  4MFD A;  3FDY A;  2XHK A;  4HNU A;  4NNJ A;  3MD2 A;  2MLK A;  4IPA A;  3G1O A;  3FHZ A;  2XF6 A;  4LIT A;  4CCM A;  1S8N A;  1Z3X A;  3H9G A;  3F8C A;  1ETK A;  4CXF A;  2XGE A;  3JAM Z;  3W2A A;  4ASN A;  3CZ6 A;  3U2R A;  1HLV A;  2W24 A;  2A69 F;  4FE7 A;  5M3M J;  4MTD A;  2K4B A;  1E3P A;  4P96 A;  1OR7 A;  2CSO A;  5M5X J;  4A6E A;  1YJN I;  1BN5 A;  3HB9 A;  3K69 A;  2MC4 A;  3I53 A;  3GTK J;  1XCB A;  3IHU A;  5IYC J;  2NVT J;  2BY1 A;  3VYT B;  2RN7 A;  1XPX A;  3FXQ A;  4BDY A;  2F5C A;  1D1B A;  2Y69 H;  1ETX A;  3FZV A;  3IAS 2;  1X4P A;  2DFF A;  2JQ7 A;  3CP8 A;  3GF2 A;  4BBR J;  2LMD A;  3ECH A;  1MKM A;  1LE8 B;  4M9X A;  4IQJ A;  2PEX A;  3GTL J;  4A69 C;  2V79 A;  1FY7 A;  1HQC A;  3H9J A;  1MH3 A;  3H36 A;  1SC7 A;  4AD9 A;  3B6C A;  1RKT A;  1M1E B;  2DT6 A;  1SFU A;  4LJZ F;  1PP8 F;  3CCV I;  1E3H A;  1IV6 A;  2XF7 A;  3I0T A;  3WG7 H;  1IAW A;  1B59 A;  2W84 A;  3S3N A;  1C0W A;  3ZGK A;  2R7V A;  1L3L A;  1XD7 A;  2WAQ N;  1KU7 A;  1UMQ A;  2ME0 A;  2K5C A;  1GHC A;  2PFB A;  1XDS A;  1Z7U A;  1VI0 A;  3C7J A;  2VON A;  1FLI A;  1XCV A;  3G6E I;  4OWR B;  4D5C A;  1IN5 A;  4TV7 A;  5FO5 A;  3IWZ A;  1IO2 A;  3K1M A;  3D0S A;  4EQQ A;  2LF8 A;  4HSR A;  3E3V A;  3A03 A;  4W1U A;  1JUS A;  2QA4 I;  1R71 A;  2K7L A;  4ZZL A;  3Q5F A;  3QP5 A;  3ZN1 A;  3CCY A;  4DBQ A;  1W36 D;  2D5V A;  2A07 F;  2LY1 A;  1GV2 A;  2Q0O A;  3FXO A;  1TW3 A;  3GFJ A;  4BKX A;  3SEQ A;  4WWC A;  1VQP I;  2BYV E;  2ZJR F;  5FRM A;  5ICG A;  1R5G A;  4E7J A;  4I09 A;  4EJT A;  2HXO A;  2O03 A;  2JPB A;  2CRG A;  3PIO F;  1D0Y A;  1QVT A;  1T56 A;  2JSC A;  3O8G A;  5CPR B;  3M1C A;  1T8I A;  3E6D A;  3G1M A;  4M6X A;  4WK8 F;  3KLO A;  1G3S A;  2ZXH A;  5F6F A;  3RYR A;  4D7N A;  2PMU A;  1NG7 A;  1P4W A;  2M2E A;  3DCF A;  3K2Z A;  4RLF A;  2HOA A;  2ZO4 A;  4IL6 C;  3L00 A;  1Z6R A;  2L54 A;  4BU2 A;  5J3L A;  5C3E J;  3F23 A;  2R4G A;  2I5U A;  3HTU A;  3L2R A;  3LL7 A;  4KMU X;  3L2C A;  3L1P A;  4N4N B;  3WTW C;  1W5T A;  1KQ0 A;  2DTR A;  3HOX J;  1K78 B;  5LGN A;  2R7T A;  3P9K A;  4KIS A;  1IN4 A;  3NEU A;  1A04 A;  3RTR A;  4S0H B;  4A93 J;  2R7F A;  4AC0 A;  1MJA A;  2DAO A;  4CZZ A;  2KDO A;  5LRS A;  5D6E A;  2Z5U A;  3VOE A;  4HLY A;  1WJC A;  1S9H A;  2DMP A;  3QOE A;  3UKG A;  1VND A;  4OIP F;  4F3Q A;  2ZCW A;  2XAJ A;  3HC7 A;  1VFC A;  3TMO A;  1TWG J;  5HVQ C;  3BCA A;  4BJ5 C;  2STW A;  1RES A;  4RM2 A;  2RVC A;  4P55 A;  4L18 B;  2VKH A;  3J80 K;  1FIP A;  4MNU A;  3S93 A;  2AHQ A;  3IC7 A;  1IGN A;  3H92 A;  1JJ6 C;  2NNY A;  1FZP B;  3HOY J;  1HW5 A;  2QWW A;  5M5W J;  3E1S A;  2RDP A;  2MA3 A;  5IP7 J;  3LSR A;  1V55 H;  3C18 A;  1YX3 A;  2A5Y B;  2VN2 A;  2EFQ A;  4RDU A;  2CV0 A;  3GZ6 A;  2L9S A;  1HW2 A;  4KUM A;  2CUJ A;  2X6O A;  5DEQ A;  1X58 A;  3K0L A;  3J7Y J;  3GTO J;  1X2M A;  3T8T A;  3ZP5 A;  2XB0 X;  2TDX A;  1O3S A;  3ULQ B;  5ICC A;  4OIR F;  1K4S A;  3FM5 A;  3BPX A;  3IKT A;  3E6M A;  4IO9 F;  3I58 A;  4N4O B;  1WKM A;  1D8J A;  3K2A A;  1ETV A;  3LA3 A;  3S2H J;  1BI3 A;  2H6B A;  2DDB A;  3HSR A;  5KAI C;  2ZME C;  3ISP A;  3T8R A;  3QOP A;  1D3Y A;  3V7R A;  3N97 A;  4Q4Z F;  3GTQ J;  2JA7 J;  2E5N A;  4A5N A;  3MKY B;  1PUF B;  3ABK H;  1E3O C;  5D5W B;  1D0Z A;  3K4L A;  4A0X A;  2KIM A;  4B8X A;  3TOB A;  1JKR C;  4I01 A;  1I27 A;  4RGU A;  4AYB N;  4KN4 X;  4EJO A;  5F0C A;  4BYY A;  2LTP A;  4CCK A;  1U78 A;  2XKP A;  3OIP A;  4IQ4 A;  4XOT A;  1JHF A;  5BOX A;  1MSF C;  3ZMV A;  2O7O A;  4Y3O A;  3KP5 A;  4D0P A;  1MMG A;  1OYI A;  2O3F A;  3R61 A;  4MGR A;  3LQR A;  2Q8K A;  1WPK A;  4HYE A;  2A6T A;  2IGK A;  1B4A A;  2QSF X;  2MAB A;  3OYH A;  3K70 D;  2HTS A;  5BMZ A;  1R23 A;  3A0H C;  4YFN F;  4L0Y B;  3OYF A;  1FOW A;  4L9T A;  2RQP A;  2BY0 A;  1LVA A;  3KP4 A;  2EIM H;  4KA4 A;  2FJ1 A;  4BQN A;  3CCS I;  2ZKZ A;  1Y0U A;  3O3K A;  4AWX B;  1ZYR F;  2ZXI A;  4HX4 A;  1UB9 A;  1K7A A;  1WRJ A;  5H6R A;  1YJW I;  4MO7 A;  2PBI A;  1ZRC A;  2DA5 A;  1S7E A;  2LH9 A;  1XMX A;  5CJ9 A;  1JT0 A;  2COM A;  1Z6T A;  2HXI A;  4HX8 A;  3REO A;  3S1Q J;  4E4H A;  1WJB A;  2LLK A;  2XAG A;  1WZ2 A;  2QQ8 A;  4M72 A;  3LSI A;  2CGP A;  1O7F A;  3ABL H;  4RBO A;  5E18 F;  3A01 A;  3AL0 C;  2NS0 A;  4JX4 A;  1D1A A;  1I3Q J;  4P9U A;  3PUF A;  4RGS A;  2K27 A;  3ABT A;  2MBF A;  4DQ2 A;  4L9N A;  5B5E C;  3HGG A;  5H2F C;  3ZQC A;  3BP8 A;  1IUY A;  4Q48 A;  4XIC A;  4BGD A;  3RSN A;  5J4Y A;  1FP1 D;  4XLN F;  2RC4 A;  3P9C A;  4XKC A;  3CCJ I;  3FXM A;  2GWR A;  3DKW A;  4U7B A;  2HYF A;  2QQB A;  5J40 A;  5DM6 F;  1TQM A;  5TIS C;  4IJA A;  1BR2 A;  3DWL E;  1S3J A;  4UV9 A;  3AG1 H;  4E7S A;  4BBS J;  5IY5 H;  2E1O A;  1Z21 A;  2VBW A;  2P0W A;  4JQF A;  3TDZ C;  3F8B A;  4HST A;  1T0F C;  2IP2 A;  3F3X A;  5L3D A;  3GW2 A;  3R6S A;  5JVT A;  1DDN A;  5GAE J;  1Z0X A;  4O5V A;  3AAF A;  3TP0 A;  2YPR A;  1OIS A;  3MEX A;  1XX5 A;  1WCM J;  2E1M C;  4ABZ A;  3UNG C;  1R9T J;  1IDZ A;  4C3H J;  3PQJ A;  2ETH A;  2P6S A;  3ZQ7 A;  2BOL A;  1POG A;  5F64 A;  3LWF A;  1ONV A;  2P8T A;  1IJW C;  1CF7 A;  4A0Z A;  3BJ6 A;  2DYR H;  4ZTJ A;  1OCR H; 
#chains in the Genus database with same CATH homology
 2BBY A;  2VOO A;  3QPT A;  3ZMZ A;  3Q9V A;  3W6K B;  5HDN A;  3W6J B;  5E20 A;  3RDI A;  4BQA A;  1R00 A;  3GX4 X;  4CDG A;  1TNT A;  1R5H A;  1YFH A;  3HTS B;  1FBQ A;  3MZH A;  3WTY C;  2QVO A;  2DO7 A;  5TRD A;  1JXS A;  2DLL A;  4Y17 A;  2DBB A;  2JTV A;  3LQQ A;  2DU9 A;  2FA5 A;  2QEN A;  3E5Q A;  4GXO A;  3KLN A;  2DI3 A;  1T0F A;  3PFI A;  5K5O A;  4XBF A;  5F1R A;  1GVJ A;  1V4R A;  3QAH A;  2V1U A;  1T38 A;  5ILS A;  3P9I A;  4ETS A;  2EB7 A;  1G3Y A;  3OV8 A;  2G7H A;  1Q1H A;  1D8K A;  5DD8 A;  2MLG A;  1QPM A;  2HKO A;  1YW9 A;  1OKR A;  1IN8 A;  3DPL C;  4I0B A;  2G7U A;  4GYI A;  5E1Z B;  4LG0 A;  3GO5 A;  2DPU A;  1U8R A;  5K5Q A;  1ZLK A;  2FMY A;  5CVJ A;  2P5V A;  1OYY A;  1ULY A;  1L0O C;  2HR3 A;  4CIC A;  5BPD A;  1PP7 U;  4HF2 A;  3JSO A;  5L3C A;  2LSO A;  1E17 A;  4BHP A;  4UXN A;  1YS6 A;  3K1P A;  3F21 A;  3WGI A;  3HOT A;  1YLF A;  4LGW A;  3COA C;  2DQR A;  4PZJ A;  2HFH A;  1XB4 A;  2QQA A;  2Y48 A;  1T98 A;  4LB5 A;  1FT9 A;  2R7D A;  3C1D A;  3BDD A;  1CF7 B;  3ZMD A;  2NYX A;  1S29 A;  4ZYE A;  4WXC A;  5CVU A;  4ZYD A;  1LEA A;  5D5U B;  5ILU A;  3DF8 A;  5LHG A;  3CLO A;  3S2W A;  4GO1 A;  3H3Z A;  3CUO A;  1G6N A;  1W7P D;  3HSF A;  1T39 A;  4HX7 A;  4OOI A;  2WC2 A;  1FX7 A;  2L02 A;  1J9I A;  1KA8 A;  3I5U A;  2JT1 A;  2UXX A;  1YQA A;  2MH9 A;  5LEJ A;  2FE3 A;  3ZMT A;  1SAX A;  4N0B A;  1SMT A;  2XV4 S;  3WTZ A;  5BQT A;  4ENJ A;  5FLX K;  4UUV A;  1R1T A;  2AS5 F;  4PDK A;  2FBH A;  4HAM A;  2IT0 A;  4K2E A;  2FQ3 A;  1IXC A;  2UXN A;  5DYM A;  2FNA A;  3CUQ A;  1B9M A;  3IRQ A;  1B1B A;  1SD7 A;  4PGG A;  1O3T A;  1XSD A;  5FGM A;  5LHH A;  1BI0 A;  1XGO A;  3F72 A;  4QLC U;  4LG0 B;  3K1N A;  1K78 A;  2OQR A;  4HV5 A;  5H6Q A;  2VOD A;  5A2Q Z;  2GZW A;  3IRR A;  4A0Y A;  3J81 K;  2YU3 A;  3V8L A;  3KET A;  5ILV A;  4EVI A;  3QPH A;  5CVV A;  5DUI A;  4M9S A;  3LAP A;  1G3W A;  1JHH A;  3FXR A;  3O2P E;  3ABU A;  4L9J A;  1XSV A;  1LJ9 A;  5HS7 A;  3RYP A;  1FP2 A;  2P5L C;  3KZZ A;  3LST A;  4EGY A;  4HA8 A;  1U5T A;  1XN7 A;  5E1X A;  4EJW A;  4HZF A;  4S05 A;  2XVC A;  2PJP A;  1KYZ A;  1U3E M;  2CG4 A;  3SQN A;  2AXL A;  4G7H F;  1TBX A;  4Q47 A;  2GA1 A;  5LGU A;  4FX0 A;  4KT5 C;  2QBY B;  5CYV A;  2M5W A;  3J7A O;  1ZG5 A;  5IT9 Z;  4CO8 A;  5HOO A;  3MFK A;  3BRO A;  1MD0 A;  5TJJ A;  1WSU A;  2CQK A;  4HBL A;  1GXQ A;  4L5J A;  3WTT C;  2ZXJ A;  4MTE A;  1LEB A;  4IF4 A;  2RGV A;  1SFX A;  3L7W A;  2VC0 A;  3PQK A;  4KIG A;  3TO6 A;  3WTU C;  3GLX A;  2DK5 A;  4A6D A;  3IL2 A;  1X3U A;  4ENM A;  2YX7 A;  1YYV A;  2A68 F;  3U1D A;  3CUQ B;  2PMH A;  2L3D A;  1E2X A;  4QWQ A;  3CO7 C;  4RB2 C;  4JK1 X;  3DV8 A;  5CVR A;  3SFZ A;  1RUO A;  2OAZ A;  1IXS B;  1RUN A;  4EJV A;  2QZ8 A;  5KK1 A;  2RV8 A;  1W7P A;  3KE2 A;  5LGT A;  1LDK B;  3TDU C;  1U2W A;  5BS6 A;  1I1G A;  3OOP A;  2GAU A;  1BIA A;  3GFL A;  5HS9 A;  5DDG A;  2F5F A;  1BBY A;  4I2O A;  2X4H A;  4WXD A;  1FSE A;  1D5V A;  4CHU A;  1R1V A;  1B6A A;  1H9G A;  1U5T B;  1T6S A;  5LLQ A;  2UZK A;  4OU0 A;  3BZ6 A;  1VTN C;  4LK0 F;  3B02 A;  3LA2 A;  3KEQ A;  3F22 A;  1FYK A;  3ERE D;  1STZ A;  2PN6 A;  3EET A;  3VOD A;  5FB2 A;  1MJB A;  4EM2 A;  4LB6 B;  3L9F A;  5D8L B;  1R36 A;  1J59 A;  2ZFW A;  4KFC A;  2NAZ A;  2EJR A;  2GXB A;  1DP7 P;  1YW7 A;  4EJU A;  4IHT A;  2OZU A;  4HOB A;  2L01 A;  5AON A;  3T0Y A;  3TOA A;  2HKX A;  1U6G A;  3JW4 A;  2VT2 A;  5D8K B;  2F2E A;  2XKO A;  1O7L A;  4MQ9 F;  4KDP A;  4ESF A;  1TTY A;  2FBK A;  4NHJ A;  3MZY A;  4UV8 A;  2XAH A;  4L5I A;  3FX3 A;  5DD4 A;  2M8E A;  2XRN A;  4NQW A;  2A61 A;  3ROU A;  2DK8 A;  3EDP A;  5JFR A;  2KRF A;  1W7P B;  2PLY A;  2LNB A;  1G4D A;  3GWZ A;  3J80 Z;  4HDV A;  1ZHF A;  2JZY A;  1WQ2 A;  2ACJ A;  4HF0 A;  2E7X A;  1R58 A;  2ESH A;  4ZZD A;  4Z2Y A;  4KYW A;  1FWZ A;  3GFM A;  2CO5 A;  2VE9 A;  5L3G A;  2OD5 A;  2GQQ A;  2J5O A;  4CGZ A;  2EWN A;  1TQI A;  3R60 A;  2Y0M A;  2D45 A;  4A5M A;  2O61 A;  2EFP A;  1MDM A;  2O0Y A;  5LEK A;  1IRF A;  2QM3 A;  2D1V A;  3HRU A;  2UWM A;  4XSX F;  4WF2 A;  4UNO A;  3P7N A;  5KVR A;  1QQI A;  1I1S A;  4RB1 A;  1R1U A;  2PQ8 A;  4H0E A;  3WTX C;  3TGN A;  2EK5 A;  1ON1 A;  1WI9 A;  5E8G A;  3FF5 A;  3IWF A;  3F6O A;  4FHT A;  2M45 A;  3MCZ A;  1XGN A;  2EA4 A;  1Z05 A;  4I02 A;  2Y75 A;  2BV6 A;  1UST A;  1I6X A;  4MHG A;  4CYD A;  2XIG A;  2W25 A;  4OIN F;  3VEP A;  3ZMS A;  4RGX A;  5L3F A;  2MD5 A;  2IPQ X;  5LBQ A;  1IZ1 A;  1T2K A;  4FX4 A;  2FU4 A;  3DXJ F;  3DPT A;  1SD4 A;  5J8C A;  2Z3Y A;  3RJP A;  2XUB A;  4IHS A;  4ENK A;  5K5R A;  3E5U A;  1IW7 F;  3CJN A;  1LB2 A;  1H0M A;  1RIO H;  3M9A A;  2QUF A;  4GCV A;  4R79 A;  4MEY F;  3Q9S A;  3HHG A;  1ZLJ A;  1HSJ A;  4GGG A;  1TNS A;  4RS8 A;  4ZYG A;  4LFU A;  2F5E A;  5D6F A;  5ICF A;  1FBS A;  3BJO A;  3T5X A;  4AIK A;  1KU2 A;  2CFX A;  3JTH A;  4EGZ A;  2M30 A;  1J2X A;  1MDM B;  1YS7 A;  2L4M A;  3V8J A;  1KGS A;  3HRS A;  1O3R A;  4IRH A;  3WTV C;  3CUQ C;  4ESB A;  4O3M A;  2J5P A;  1PDN C;  4N9I A;  3GFI A;  3DP7 A;  2FEZ A;  1USS A;  5FFZ A;  4LMY A;  4RB0 A;  1HXD A;  2H09 A;  2HS5 A;  4G8X A;  3WTS C;  2QLZ A;  3I71 A;  3HIF A;  2L4A A;  1NHA A;  4HLX A;  3BOQ A;  1W5S A;  2EA2 A;  2EV0 A;  1AWC A;  3ECO A;  2Q2E A;  5CVI A;  2XAQ A;  2QYO A;  3JAM K;  4BNC A;  5J8F A;  2DT5 A;  3O6B B;  2JPC A;  2KJC A;  2R3S A;  1HW1 A;  2XAF A;  3DQV C;  2QBY A;  3R0J A;  2XAS A;  1SFE A;  3GYH X;  3SXY A;  2VC1 A;  5LHI A;  1P4A A;  2A3S A;  4UVA A;  4HQM A;  1JE8 A;  1U5T C;  4U0V A;  2O8X A;  5JI6 A;  3SZT A;  1I5Z A;  5E8I A;  5H20 A;  3I59 A;  2HWV A;  4G6Q A;  3QP6 A;  5L3B A;  4HV6 A;  4M6Y A;  2VBY A;  4I7H A;  3NQO A;  4A2U A;  3HUG A;  3BWG A;  2EV5 A;  2KKO A;  3G73 A;  4YFK F;  1F1Z A;  3C3W A;  1KQ9 A;  4HF1 A;  1TQP A;  4AIH A;  4XRF A;  3WGH A;  1BOA A;  5EEH A;  2H94 A;  1J75 A;  3TO7 A;  1FSH A;  1FOK A;  3RKY A;  2BEO A;  2RKH A;  1CGP A;  2GXG A;  3ZMU A;  1FYM A;  3GVA A;  4OMY A;  5BPI A;  2VXZ A;  4KMF A;  5DCF A;  4EV0 A;  3BY6 A;  4YFX F;  5HDG A;  1F5T A;  1JGS A;  2P7C B;  4KIF A;  5K1Y A;  1XMK A;  3I54 A;  3ZN0 A;  2IRF G;  2ZJ2 A;  1J7K A;  4KN7 X;  2FXA A;  2ADU A;  3B73 A;  5HS8 A;  1UCR A;  4Y13 A;  1ZG3 A;  1S6L A;  3F6V A;  4KIB A;  4AVP A;  3SHF A;  4BXU A;  3TQN A;  4BH9 A;  3HSE A;  4U88 A;  5DUK A;  4YG2 F;  4M74 A;  4WXH A;  1V3F A;  1UHM A;  2WV0 A;  4EMS A;  2Z33 A;  4O6J A;  2MC3 A;  2CWE A;  3IKV A;  3WE3 A;  1DUX C;  4WCG A;  5D5X B;  2WTE A;  5FLX Z;  4ESJ A;  4LLG F;  2OQG A;  2E1N A;  4R8H A;  1XMA A;  2C6Y A;  1IXR C;  1BC8 C;  4U0W A;  2HQN A;  1P92 A;  2H6C A;  1Z9C A;  3V8K A;  1HST A;  5D4S A;  1QNT A;  2IJL A;  2EFN A;  3I59 B;  1HKT A;  1KU3 A;  3R0A A;  2QQ9 A;  5HLI A;  3LAJ A;  2DFI A;  1YG2 A;  3RPQ A;  3M1E A;  3U9G A;  3WE2 A;  4RB3 C;  3J81 Z;  2BE5 F;  4RAZ A;  2B0L A;  2DQL A;  1K79 A;  4OIO F;  5DCM A;  4DNC A;  4UHT A;  2DW4 A;  4BHC A;  1IN7 A;  1MJ9 A;  1SD6 A;  1REP C;  3LFK A;  2ELH A;  1DPR A;  1EH8 A;  2IA1 A;  2EFW A;  1P2F A;  1K6O A;  3WG9 A;  3RPU A;  1W4M A;  2ZNZ A;  4L9V A;  3M7G A;  2XRO A;  2DPD A;  1Z91 A;  1UHW A;  4YIF A;  1BIB A;  4OIQ F;  4Y15 A;  5FD5 A;  1EH7 A;  3D5L A;  2WWY A;  2A6H F;  1YIO A;  2V6C A;  4G7Z F;  1R7J A;  2HYG D;  3MWM A;  5HLG A;  3EYY A;  3GUD A;  1HBX G;  3F8N A;  3KP6 A;  4G94 A;  1TW2 A;  1F9N A;  1QZY A;  3LA7 A;  4MQV A;  1ZN2 A;  2HZT A;  2W85 A;  2YSR A;  1YO5 C;  3N4M A;  4LLN A;  3E97 A;  1LNW A;  3FM3 A;  3WU1 B;  5JHU A;  1BJA A;  1KYW A;  3R4K A;  2ZBK A;  2VOP A;  1IF1 A;  4ENN A;  1AOY A;  2LKP A;  4PCQ A;  3I64 A;  2EFO A;  1B9N A;  1FNN A;  3V7S A;  3NRV A;  4MEX F;  2V1X A;  2HEO A;  2ISY A;  3BJA A;  4IXA A;  3FWE A;  2H27 A;  6PAX A;  3RI4 A;  2A6E F;  2LF7 A;  2CW0 F;  2FRH A;  3FXU A;  4XLP F;  3GXO A;  4OMZ A;  5L3E A;  2IA0 A;  4R1H A;  5HLH A;  1TLH B;  3JSP A;  3QU6 A;  2HDC A;  1ZRE A;  3FMS A;  5DCM B;  1H9T A;  3CO6 C;  1LDJ A;  2M87 A;  3KP2 A;  2E7W A;  3GZ5 A;  2RNJ A;  4PGH A;  3WU0 A;  2ISZ A;  1SD5 A;  2OBP A;  2M1B A;  5HDK A;  5FD6 A;  4LK1 F;  3RKX A;  2FOK A;  4G6D A;  3V4G A;  1ZRF A;  1IRG A;  4M71 A;  4HDU A;  1MZB A;  2P5K A;  2YX4 A;  3EYI A;  4ZH4 F;  4LLL A;  4IRI A;  3T1B A;  1P4X A;  2ZME A;  4NB5 A;  2W57 A;  2NNN A;  2FSW A;  2VE8 A;  3JTG A;  5D4R A;  2D2W A;  4AIJ A;  1RZ4 A;  4P5O A;  4N9H A;  4M9Z A;  2JRT A;  4FT8 A;  3M8E A;  2HQR A;  1LQ1 A;  4M73 A;  2IW5 A;  1O3Q A;  4WX9 A;  3ELK A;  1ZGA A;  4EM1 A;  4KNY A;  2XGX A;  3ML6 A;  1XGM A;  1J5Y A;  3G3Z A;  1ZRD A;  2P7V B;  2HTJ A;  1BI1 A;  1PUE E;  5JR3 A;  2FF4 A;  1ZAR A;  2VBX A;  2IVM A;  3WGG A;  2STT A;  5E1W A;  4LD5 A;  1ON2 A;  1YW8 A;  1S7O A;  2O6G E;  2BGC A;  1ZH5 A;  1RNL A;  1QGP A;  4ZYH A;  2E1C A;  3KP7 A;  3MQ0 A;  1ZG1 A;  2ZNY A;  1OPC A;  1FBU A;  5AIQ A;  3TO9 A;  3HOS A;  5ED4 A;  4I0A A;  1XGS A;  4UVB A;  2HGC A;  1MGT A;  1O57 A;  2YR2 A;  1OYW A;  4U7D A;  5AIP A;  2MH2 A;  2G9W A;  1XSX A;  1F4K A;  2IA2 A;  3QU3 A;  2K4J A;  1OMI A;  4G7O F;  4S04 A;  4U0Y A;  1HKS A;  2V1D A;  3VFZ A;  4B09 A;  1KQ8 A;  1GXP A;  3RIR A;  2VT3 A;  1G3T A;  3GEZ A;  2KJB A;  1FPQ A;  3RKW A;  1FYL A;  1ODD A;  5CLS A;  3FMQ A;  4IVN A;  2V9V A;  3CDH A;  2ZME B;  3KZY A;  3HRT A;  2Z99 A;  1ZAO A;  3MAJ A;  3M8F A;  4RAY A;  3EUH A;  4KIC A;  2PI0 A;  2LDU A;  2VBZ A;  3DEU A;  3DFG A;  3V7C A;  1S7A A;  5FFX A;  2Z9O A;  3L09 A;  3E5X A;  3F8F A;  4A12 A;  1LDD A;  2CYY A;  4IRG A;  4G9Y A;  4I98 B;  1HKQ A;  1ZGJ A;  3VB2 A;  2EV6 A;  1QBJ A;  5A2Q K;  3KEO A;  1UFM A;  3BPV A;  3KP3 A;  3EQL F;  4BAY A;  1IN6 A;  3QRF F;  3FMR A;  1P6R A;  1XDU A;  1KU9 A;  3WOD F;  2X0L A;  1QZZ A;  3E6C C;  3E6B A;  1RI7 A;  2D1H A;  2P6T A;  4YII A;  1WWX A;  3KFW X;  1BM9 A;  5EEG A;  2P4W A;  1BC7 C;  2K02 A;  4XSZ F;  2FBI A;  4P9F A;  2OZ6 A;  1Z1D A;  3HHH A;  1DPU A;  2KIF A;  2ESN A;  4BHB A;  4L0Z B;  4GYG A;  4EM0 B;  4ON0 A;  2HOE A;  1QO0 D;  5LRR A;  4RGR A;  1FC3 A;  4HQE A;  1BI2 A;  2GA2 A;  2KIU A;  2OU2 A;  3K9T A;  2GIV A;  3KCC A;  5ERI A;  3H3U A;  5DV5 A;  4HW0 A;  5E17 F;  5D5V B;  5IT9 K;  5J6X A;  1YTY A;  1R22 A;  3CTA A;  4F7Z A;  5ICE A;  1EV7 A;  4JBA A;  3TKY A;  1J0R A;  2FNP A;  2K86 A;  3HYI A;  4UVC A;  3ZPL A;  3HRM A;  1EH6 A;  1SMY F;  3I4P A;  2PG4 A;  4E70 A;  2F5D A;  5IT3 A;  3SZP A;  3F8M A;  2OA4 A;  2NRA C;  4Q5S F;  2FML A;  2XHK A;  2MLK A;  4IPA A;  3FHZ A;  1S8N A;  3F8C A;  4CXF A;  3JAM Z;  4ASN A;  3U2R A;  2W24 A;  2A69 F;  4MTD A;  2K4B A;  4P96 A;  1OR7 A;  2CSO A;  4A6E A;  1BN5 A;  3K69 A;  3I53 A;  1XCB A;  3IHU A;  2RN7 A;  3FXQ A;  2F5C A;  3FZV A;  3GF2 A;  3ECH A;  1MKM A;  4M9X A;  2PEX A;  2V79 A;  1FY7 A;  1HQC A;  4AD9 A;  1SFU A;  4LJZ F;  1PP8 F;  1IAW A;  3I0T A;  1B59 A;  2W84 A;  1C0W A;  1L3L A;  1XD7 A;  1KU7 A;  1GHC A;  2PFB A;  1XDS A;  1Z7U A;  3C7J A;  2VON A;  1FLI A;  1XCV A;  1IN5 A;  4TV7 A;  5FO5 A;  3IWZ A;  3K1M A;  3D0S A;  4EQQ A;  2LF8 A;  3E3V A;  2K7L A;  4ZZL A;  3Q5F A;  3QP5 A;  3ZN1 A;  2A07 F;  2Q0O A;  1TW3 A;  3GFJ A;  4WWC A;  2BYV E;  5ICG A;  1R5G A;  4I09 A;  4EJT A;  2O03 A;  2JPB A;  2JSC A;  3E6D A;  4M6X A;  4WK8 F;  3KLO A;  1G3S A;  5F6F A;  3RYR A;  2PMU A;  1P4W A;  3K2Z A;  2ZO4 A;  3L00 A;  1Z6R A;  2L54 A;  3F23 A;  3HTU A;  4KMU X;  3L2C A;  3WTW C;  1W5T A;  1KQ0 A;  2DTR A;  1K78 B;  5LGN A;  3P9K A;  1IN4 A;  3NEU A;  1A04 A;  3RTR A;  2R7F A;  1MJA A;  2DAO A;  4CZZ A;  5LRS A;  5D6E A;  2Z5U A;  3VOE A;  4HLY A;  4OIP F;  2ZCW A;  2XAJ A;  5HVQ C;  2STW A;  2RVC A;  4P55 A;  4L18 B;  3J80 K;  4MNU A;  3IC7 A;  3H92 A;  2NNY A;  1FZP B;  1HW5 A;  2QWW A;  2RDP A;  2MA3 A;  3C18 A;  2A5Y B;  2VN2 A;  2EFQ A;  3GZ6 A;  1HW2 A;  4KUM A;  5DEQ A;  3K0L A;  3T8T A;  3ZP5 A;  1O3S A;  2TDX A;  3ULQ B;  5ICC A;  4OIR F;  3FM5 A;  3BPX A;  3IKT A;  3E6M A;  3I58 A;  1D8J A;  1WKM A;  3LA3 A;  1BI3 A;  2H6B A;  3HSR A;  3ISP A;  3T8R A;  3QOP A;  1D3Y A;  3V7R A;  3N97 A;  4Q4Z F;  4A5N A;  5D5W B;  4A0X A;  2KIM A;  4B8X A;  3TOB A;  4I01 A;  1I27 A;  4RGU A;  4KN4 X;  4EJO A;  4BYY A;  1U78 A;  2XKP A;  1JHF A;  5BOX A;  3ZMV A;  3KP5 A;  4D0P A;  1OYI A;  2O3F A;  3R61 A;  4MGR A;  3LQR A;  2Q8K A;  4HYE A;  1B4A A;  5BMZ A;  2HTS A;  1R23 A;  4YFN F;  4L0Y B;  4L9T A;  2RQP A;  1LVA A;  3KP4 A;  4KA4 A;  2ZKZ A;  1Y0U A;  3O3K A;  4AWX B;  1ZYR F;  4HX4 A;  1UB9 A;  1K7A A;  1WRJ A;  5H6R A;  2PBI A;  1ZRC A;  5CJ9 A;  2COM A;  1Z6T A;  4HX8 A;  3REO A;  2XAG A;  4M72 A;  2CGP A;  1O7F A;  5E18 F;  2NS0 A;  4P9U A;  4RGS A;  2K27 A;  3ABT A;  2MBF A;  4DQ2 A;  4L9N A;  3BP8 A;  1IUY A;  4Q48 A;  1FP1 D;  4XLN F;  2RC4 A;  3P9C A;  2GWR A;  3DKW A;  4U7B A;  2HYF A;  2QQB A;  1TQM A;  4IJA A;  1S3J A;  4UV9 A;  3TDZ C;  2VBW A;  4JQF A;  3F8B A;  2IP2 A;  3F3X A;  5L3D A;  3GW2 A;  3R6S A;  5JVT A;  1DDN A;  4O5V A;  3AAF A;  2YPR A;  3MEX A;  3PQJ A;  2ETH A;  2P6S A;  3ZQ7 A;  5F64 A;  3LWF A;  1ONV A;  2P8T A;  1CF7 A;  4A0Z A;  3BJ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...