1R1TA

Crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transcription repressor
molecule keywords Transcriptional repressor smtB
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1tA00
5IT9K 2WV0A 4L5IA 1PP8F 3HRMA 3LA7A 4GYIA 5K5QA 4OIQF 4CXFA 2HFHA 2QUFA 1XD7A 2FXAA 4QWQA 2JRTA 1J5YA 2CYYA 3K1MA 2ZCWA 5BMZA 4RB2C 2ISYA 4G94A 1KU3A 3K0LA 3KCCA 3D0SA 4P96A 5HDKA 2AS5F 4GXOA 4ZZDA 2GAUA 5J8FA 1HXDA 2GWRA 3ERED 1O3RA 2CFXA 2EK5A 5AIPA 4BAYA 5ICFA 2O03A 3G3ZA 3CJNA 4LK1F 5D6FA 4H0EA 1D3YA 1FYKA 3F6OA 1XMKA 1BI2A 1T2KA 2P6TA 5E1ZB 4EM2A 4LFUA 2PFBA 3E5UA 2KJBA 3N4MA 3E5XA 1ZLKA 3HSRA 2A6HF 3Q5FA 4O6JA 5CYVA 1TQMA 2IRFG 1NHAA 1KA8A 2XROA 1J75A 5FFXA 5HDNA 3H3ZA 1XSVA 1BOAA 1UCRA 3QP6A 3LFKA 1P92A 4Y17A 3SZTA 2H6BA 3I54A 4KYWA 2M45A 3ZMVA 1SAXA 4LB6B 3GFJA 2DPDA 1H0MA 3AAFA 2DK8A 3WTUC 1HKQA 3BROA 1ZGAA 4A0XA 2W57A 3EETA 1FP1D 3DFGA 3Q9VA 2VXZA 4ON0A 3FMRA 4PZJA 1U8RA 3TOBA 4OMZA 4G8XA 1O7FA 2ESHA 5K1YA 4EJVA 3KP2A 2Q2EA 1USSA 4Q4ZF 1TW3A 2QVOA 1KYZA 5E8GA 1DPUA 3WE3A 4LD5A 2GA2A 3MEXA 4I02A 1XGNA 4BNCA 1YLFA 5FO5A 2CG4A 1PP7U 2JZYA 4OINF 1V4RA 2GQQA 2DAOA 4KIBA 4LB5A 3M7GA 5K5OA 2LKPA 4CHUA 6PAXA 4HQMA 1UB9A 5HOOA 2UZKA 2NYXA 2IA0A 3F21A 4I01A 1S29A 1YTYA 2PMHA 1Z6RA 2A68F 2DI3A 3LA3A 3GYHX 1RIOH 1ON1A 1TNTA 4KUMA 2XKPA 1UHMA 5HLIA 2NS0A 2ZBKA 4ESFA 2C6YA 2FBHA 1IF1A 3FX3A 1EH7A 2VN2A 3VEPA 4PGHA 1RZ4A 3G73A 2VONA 5LGTA 2MBFA 3BZ6A 2RC4A 1FBQA 4RS8A 4ZYHA 1P6RA 2ELHA 4RB1A 3I59A 2K86A 2QENA 1ODDA 5H6QA 4ZH4F 1FT9A 4NHJA 1LDKB 2BE5F 3GWZA 3E6CC 4Y15A 1FBUA 5JI6A 2D1VA 1BC8C 4BQAA 2FEZA 3HRSA 4P55A 2NNYA 5D4SA 3LAPA 3BJAA 2ZO4A 4KDPA 4RB3C 2BYVE 2O61A 2JPCA 3P9IA 1WKMA 3JSPA 1Z6TA 4KT5C 3JTGA 3GFIA 3IHUA 3VOEA 3L2CA 5HDGA 3DF8A 1Z91A 4L9NA 3GLXA 5KK1A 2EWNA 3T8TA 4EJOA 3GEZA 1RUNA 2V1UA 5D8KB 2QQAA 2VBZA 4HDVA 2JSCA 4QLCU 1J0RA 2LF7A 2E1NA 3ABUA 1F1ZA 2DTRA 5EEGA 3RDIA 5EEHA 4E70A 4XSXF 3R6SA 2VT3A 4KN7X 3V8KA 4YIFA 3QAHA 1YYVA 3M8EA 4GYGA 4Y13A 3GVAA 2QQ9A 4IXAA 1IZ1A 2J5PA 2A6EF 1K78B 5H6RA 2BBYA 3C18A 5LRSA 3ZN1A 1HW5A 2LDUA 3O6BB 3CUOA 1FZPB 1EH6A 2ZMEB 2R7DA 4CO8A 5BPIA 5LRRA 2IPQX 3P9CA 1ZHFA 2WWYA 5CVRA 1QBJA 3GFMA 2ZFWA 5J8CA 5LGUA 3LWFA 4IHSA 4AIJA 3PQJA 2BEOA 1CF7A 1T98A 3RKYA 4OMYA 1FPQA 2R3SA 2OA4A 3H3UA 4ENNA 1XN7A 2W84A 2DPUA 5HS8A 2L3DA 2FMYA 3WGHA 3FXQA 1W5SA 4A6DA 5D5UB 3KP6A 3R0AA 1HSJA 3DPLC 2Z9OA 1BI3A 2LNBA 1MKMA 1HQCA 3RKWA 5BS6A 4S05A 3WTWC 5DUIA 3MCZA 2A5YB 4IF4A 3WU1B 3L7WA 1FYLA 1IW7F 2YX4A 2XAHA 3BP8A 3C3WA 3LQRA 1IRFA 3I53A 5DD4A 3N97A 2V6CA 3V7SA 1QGPA 2F5FA 1IN5A 1U5TB 1XCVA 3HHGA 1XGSA 3QPHA 3HOTA 1QZZA 2MH9A 1OKRA 4ZYGA 2KJCA 2DLLA 4EJWA 3BWGA 4UVCA 1RUOA 1IN6A 5HLHA 1WQ2A 3V8JA 4KIFA 5ED4A 1MDMB 2MA3A 4M6YA 1YS6A 1R5HA 5HS9A 5D6EA 1U5TA 2W85A 5DD8A 1P4AA 1BJAA 2PLYA 4I09A 4S04A 2DO7A 4CYDA 3RJPA 3JTHA 3IC7A 2HDCA 2IT0A 3GO5A 3KZYA 5L3BA 3WGGA 1ZG3A 1C0WA 4M9SA 2VC1A 5H20A 5DEQA 1R00A 1O57A 4HW0A 3DEUA 2XAJA 3F8NA 3KP4A 4EV0A 1SD6A 2IP2A 3KFWX 3K9TA 1CGPA 1W7PB 2L54A 3TQNA 2VBWA 1VTNC 3R60A 2P7VB 2ETHA 1MDMA 1FC3A 2GXBA 1XSXA 4LMYA 4KICA 2TDXA 1YFHA 5E20A 2R7FA 3ABTA 2FMLA 2HEOA 4K2EA 2F5EA 2EV0A 2P5KA 4EQQA 1KYWA 1Z05A 1ONVA 1JHHA 1W7PD 3C7JA 2XAQA 4UV9A 3ZN0A 2G7UA 5JVTA 1MGTA 3KLNA 4OOIA 4U88A 4ZYDA 2J5OA 1D8KA 2P8TA 4U0YA 1W7PA 5LEJA 2L4AA 3CUQB 3SQNA 3J81K 4M73A 3GXOA 4L18B 2ZNZA 2EV5A 5AONA 3DP7A 3JW4A 2FRHA 2IW5A 4R1HA 3SXYA 3WTYC 3KE2A 4PCQA 2XAGA 2LF8A 3TOAA 1ZLJA 3DQVC 2VE9A 4ESJA 4IRIA 1I5ZA 2E7XA 1KGSA 2BV6A 3BJ6A 1ZAOA 4CICA 3BY6A 4GCVA 2EV6A 1ZRCA 3D5LA 4NQWA 4ENJA 2CW0F 3F8CA 3FMQA 3O2PE 2IA1A 3SHFA 1KQ8A 1OMIA 2DQLA 2HWVA 4U0VA 4O5VA 1TTYA 4JQFA 4MEYF 1HSTA 3BPVA 2COMA 1SD4A 3IKTA 1HBXG 4I2OA 2L02A 3MZYA 3E6BA 1DPRA 4B8XA 1MJ9A 3CO6C 4R79A 3HSFA 4HA8A 2RDPA 2XAFA 1SFUA 3F72A 2PG4A 5CVVA 5AIQA 4LJZF 5ICGA 2MLGA 4Q47A 4YIIA 1RNLA 3E6DA 4G7OF 3WTTC 4M72A 1ZARA 3WODF 1BIAA 1XGMA 3GW2A 2H27A 5LBQA 1I6XA 5TJJA 4WWCA 1B59A 1YW8A 3H92A 5JR3A 2RKHA 3CTAA 2Y75A 2XIGA 3DKWA 2Q8KA 3FF5A 4MTDA 2CGPA 1LDDA 2KIMA 4BYYA 3WTZA 4CGZA 1JXSA 3MFKA 2XHKA 1DUXC 3JSOA 5D5WB 3U9GA 3T8RA 5LEKA 2D45A 3J7AO 2FBKA 1TBXA 4B09A 2IA2A 4N9HA 4HF1A 3F3XA 1CF7B 3FMSA 2FNPA 4GGGA 4OIRF 1G3SA 2Y0MA 2RVCA 2O8XA 1P2FA 1YO5C 4I98B 1L3LA 5CVUA 1EV7A 1ZH5A 5JFRA 1P4WA 1HKSA 2D1HA 3FXUA 4L5JA 5FD6A 3ZP5A 5J6XA 2NAZA 1R22A 4I7HA 5A2QZ 1E17A 2UXNA 4P9FA 2DT5A 1LJ9A 3SZPA 1S8NA 1ZYRF 1ZREA 3REOA 1FSEA 4D0PA 2E7WA 3F8FA 4HYEA 1FX7A 1B4AA 4ESBA 3TGNA 1IXSB 5DUKA 3CUQC 2RV8A 1WRJA 4XLNF 1T6SA 1Z7UA 5DDGA 4ENKA 4EJTA 3FXRA 4TV7A 2EFWA 2K4JA 4YFXF 2VODA 1MD0A 4FT8A 5LHGA 1OYYA 2PN6A 2QM3A 4JK1X 1BI0A 1GVJA 3W6JB 2GA1A 2EFNA 3QU3A 1STZA 1XDUA 1SFEA 2CQKA 4A12A 3J81Z 3HSEA 1K78A 2JTVA 4HQEA 3R61A 3K1NA 4P5OA 4ZZLA 2GZWA 3F8BA 2V79A 5LHIA 3IWFA 5ICCA 4AWXB 2P5VA 1FY7A 2VT2A 4YG2F 4U7BA 4Q48A 3U2RA 4G7ZF 2V9VA 2O0YA 2X0LA 5BPDA 3WTXC 4AIKA 1UHWA 3K1PA 3OV8A 2ZNYA 1P4XA 2XRNA 2ZXJA 1G3TA 3KP3A 2M1BA 4PGGA 1FYMA 4UVBA 4HLYA 3EYYA 3W6KB 4P9UA 1TLHB 1AWCA 4HLXA 1T39A 4L9TA 4BHCA 2EJRA 2K7LA 2Z5UA 3IKVA 3VODA 1IN7A 4LLNA 2P4WA 5FD5A 1KU9A 4HOBA 1S7AA 2NNNA 3MWMA 1GXPA 1SD5A 1KU7A 2EA2A 2FA5A 3QPTA 1F4KA 3CLOA 1OYIA 4Q5SF 3WU0A 1QNTA 4FX0A 1LEAA 2PBIA 2STWA 2VOPA 3I64A 5E1XA 5E8IA 3ECOA 2ZJ2A 5ILUA 1G3YA 1B6AA 2IVMA 4MHGA 4FHTA 4RGSA 4F7ZA 1QO0D 3I71A 1S6LA 4U0WA 4KMFA 1ULYA 1HW1A 1W5TA 1TQPA 2RNJA 4MQ9F 2F5CA 1SMTA 2PMUA 2P7CB 2DU9A 2W24A 4CDGA 1LB2A 5FGMA 1A04A 1Y0UA 4DQ2A 4MTEA 1U6GA 4EGZA 1DDNA 5JHUA 2RN7A 3QU6A 1R1TA 2WTEA 3DXJF 3RYPA 1U2WA 3GFLA 1ZRDA 1E2XA 2MC3A 4HV5A 4OU0A 2DFIA 4WCGA 1J9IA 2K4BA 2JPBA 1PUEE 1K6OA 4L0ZB 1G6NA 2HKOA 4XRFA 3TKYA 3L09A 2RGVA 3F8MA 2HGCA 1T0FA 2CWEA 3BJOA 4AVPA 5FLXK 3Q9SA 3E6MA 4MQVA 5CVJA 4EMSA 1LVAA 4U7DA 3ZMSA 2Z3YA 1B9MA 1IN4A 2XV4S 1LDJA 4LLGF 4KMUX 1OPCA 3TDUC 1O3TA 2HYGD 2HYFA 3IL2A 2FE3A 2V1XA 2PI0A 4R8HA 4XBFA 4KIGA 2A69F 2HZTA 2Y48A 5BQTA 5HLGA 3T1BA 1XB4A 3RYRA 3V7RA 2OZUA 4AIHA 4WXDA 1IAWA 1AOYA 5DV5A 4AD9A 4WX9A 1LNWA 3ZMUA 5F64A 1KQ9A 1ZG1A 4A0YA 3HRTA 2EFOA 4EGYA 3KETA 4M6XA 4M9ZA 4NB5A 1D5VA 3I5UA 4A0ZA 2HKXA 3RIRA 4RAZA 2MLKA 2O3FA 2YPRA 2E1CA 2KIFA 3E5QA 2QYOA 2FBIA 1USTA 1K79A 3VB2A 3COAC 2KRFA 4BH9A 4DNCA 4ETSA 1GHCA 2QZ8A 5BOXA 1I1SA 3ZMTA 3F22A 1DP7P 3K69A 3R4KA 3GX4X 2HQNA 4IHTA 3EDPA 1SMYF 1WWXA 2CO5A 3KZZA 4L9JA 1Q1HA 2VBYA 4WXHA 3TO6A 5D5VB 1OYWA 1LQ1A 2VOOA 5CLSA 2ESNA 2GXGA 2Z33A 1KQ0A 4BHPA 2XVCA 3KP5A 2YX7A 4LK0F 1FLIA 1J7KA 3I59B 2EB7A 4N9IA 5CVIA 3M9AA 3B73A 4BHBA 3ZQ7A 3GUDA 2HOEA 4YFNF 1WI9A 2ADUA 3WTVC 1R23A 4UUVA 1JHFA 4HX4A 1R5GA 2DBBA 1XGOA 1HKTA 3LQQA 4OIOF 4Z2YA 3T5XA 3NRVA 2G7HA 4IRGA 2KIUA 1UFMA 2FQ3A 4IJAA 2FOKA 2ACJA 1QQIA 1ZN2A 4OIPF 1FSHA 1ZG5A 3V8LA 3M1EA 4FX4A 2LSOA 5F1RA 2KKOA 3HHHA 2YU3A 2QLZA 5A2QK 2UWMA 3NEUA 2NRAC 2BGCA 1IUYA 1BM9A 1XCBA 3K2ZA 1S3JA 4EJUA 1WSUA 3CDHA 4LG0B 3FM5A 5LHHA 5ILSA 3GZ6A 1BIBA 1B9NA 2B0LA 3E97A 2HTJA 3RPUA 3O3KA 2DQRA 3BDDA 2QQBA 2M87A 2EFQA 2PJPA 3CO7C 4UHTA 3GZ5A 2UXXA 1O7LA 3V7CA 1TQIA 5F6FA 4O3MA 1H9TA 1K7AA 5IT9Z 1FP2A 3ECHA 5HVQC 2MD5A 3HTUA 1SD7A 1YG2A 4LGWA 4G7HF 1QPMA 2EA4A 4A5MA 1REPC 3CUQA 1U3EM 3HIFA 1G3WA 2OAZA 3TO9A 5TRDA 2FU4A 2EFPA 2HTSA 2XASA 3V4GA 2VE8A 2P5LC 1YIOA 4G9YA 1G4DA 1XSDA 2HQRA 1ON2A 3FHZA 2AXLA 2ISZA 3I4PA 1V3FA 1FNNA 2RQPA 4HV6A 1D8JA 1BC7C 3WG9A 4RB0A 1BBYA 1R1VA 2V1DA 2HS5A 1ZRFA 3GF2A 1YW9A 3PFIA 1XMAA 3ELKA 5DYMA 3J80K 2Q0OA 1S7OA 2CSOA 2FF4A 5KVRA 4CZZA 4HBLA 4UVAA 2OQGA 3OOPA 2L01A 3F23A 5L3GA 5LGNA 1H9GA 5D8LB 2FNAA 5HS7A 2L4MA 2F2EA 5FB2A 1FBSA 2MH2A 3T0YA 3E3VA 4IPAA 3FM3A 5E17F 4WK8F 4HX8A 5L3CA 4JBAA 3L9FA 3EQLF 1YQAA 3WTSC 3MZHA 3RI4A 2OD5A 3U1DA 5FLXZ 4IVNA 5DCFA 3I0TA 2VC0A 4A6EA 4YFKF 3R0JA 4WXCA 3IWZA 1FWZA 4EM0B 2PQ8A 2YR2A 2P6SA 2O6GE 3EYIA 4HX7A 3IRQA 1J59A 5FFZA 1GXQA 2A61A 5L3EA 4L0YB 4UV8A 4LLLA 5D5XB 5D4RA 3RKXA 2OZ6A 4KA4A 3QOPA 4XLPF 1SFXA 2ZMEA 1W4MA 2QBYB 4GO1A 1BN5A 5E1WA 1IN8A 3QP5A 3L00A 2H09A 3HRUA 1R36A 1YS7A 1Z9CA 2F5DA 2Z99A 3LSTA 1IXRC 3P7NA 3ZPLA 3B02A 4RAYA 1T38A 2FSWA 3DPTA 4BXUA 4HZFA 2OU2A 2OQRA 4RGUA 2GIVA 2QBYA 3TDZC 2PEXA 4I0BA 3KP7A 1BI1A 4A2UA 3WE2A 5ERIA 3MQ0A 1IXCA 4MNUA 4A5NA 2JT1A 2XGXA 2XUBA 3RTRA 3HOSA 4HF2A 2STTA 4IRHA 2VBXA 1YW7A 1L0OC 3M8FA 2YSRA 1O3QA 4EVIA 3ML6A 1U78A 2H94A 3PQKA 4HDUA 1O3SA 1QZYA 4ENMA 1MZBA 1JGSA 1IRGA 1ZGJA 3ULQB 1TW2A 1I1GA 3HTSB 3JAMK 1R58A 3LA2A 2X4HA 4EM1A 3SFZA 1KU2A 1I27A 2XKOA 4KN4X 1F9NA 1X3UA 3ZMZA 1Z1DA 2DK5A 5L3DA 2K02A 3S2WA 1R1UA 1PDNC 3J80Z 1J2XA 4PDKA 3HYIA 4N0BA 5CJ9A 4KFCA 4L9VA 4G6DA 4LG0A 4RGRA 2A07F 3FWEA 4HAMA 3HUGA 3KEOA 4RGXA 3QRFF 1R7JA 3ISPA 4ASNA 3C1DA 5ILVA 3ROUA 5L3FA 3LAJA 5ICEA 4UNOA 3TO7A 1OR7A 2A3SA 3MAJA 4ZYEA 2D2WA 1JE8A 2QWWA 5K5RA 3KLOA 3RPQA 4MEXF 3DV8A 3KEQA 1RI7A 3BOQA 3I58A 4XSZF 1LEBA 4G6QA 1B1BA 1XDSA 3JAMZ 1HW2A 4M9XA 3P9KA 2K27A 3BPXA 4M74A 2H6CA 1FOKA 2M5WA 2OBPA 2WC2A 4MGRA 5DCMB 5E18F 4UXNA 5DCMA 2W25A 4WF2A 2HR3A 3NQOA 3IRRA 2IJLA 4KNYA 3VFZA 1MJBA 4I0AA 5LLQA 3F6VA 2DW4A 3EUHA 1F5TA 1U5TC 5IT3A 2M8EA 2ZKZA 1TNSA 3FZVA 4HF0A 1MJAA 2M30A 1EH8A 3ZMDA 3WGIA 2G9WA 4M71A
chains in the Genus database with same CATH superfamily
5IT9K 3DLLF 3JR9A 2WV0A 4L5IA 1PP8F 3JRAA 4ZDLA 3S1MJ 3HRMA 3LA7A 4C3IJ 1LFPA 3BG5A 3HOXJ 2DA6A 4GYIA 5K5QA 1EKEA 4OIQF 4CXFA 2HFHA 2QUFA 1XD7A 2FXAA 4QWQA 2BY3A 2V1NA 3ZQHA 2JRTA 1J5YA 2CYYA 3K1MA 2ZCWA 4M3DA 4RB2C 5BMZA 1H88C 4UUSB 2ISYA 4G94A 2JUGA 1KU3A 5BNGA 3K0LA 3E7LA 3KCCA 3A01B 1GLNA 3D0SA 2KIQA 3DU5A 2B9SA 4P96A 4IQJA 1X3ZB 3DTKA 5HDKA 2AS5F 4Y33A 4GXOA 4II2A 3IH4A 4ZZDA 2GAUA 2MD0A 1XS9A 3IAS2 5J8FA 2WADA 4NDLA 4JOMA 1LFUP 1HXDA 2GWRA 3ERED 2V4JC 4YIRX 1O3RA 2ZC2A 2CFXA 4PJMA 1QPIA 2KT0A 2KPMA 2EK5A 1LKXA 4HNTA 2HYJA 3BR2A 5AIPA 2QF7A 4BE0A 4BAYA 5ICFA 2O03A 1IO2A 3G3ZA 3CJNA 4LK1F 5D6FA 4H0EA 3A0BC 1D3YA 3K4BA 1FYKA 1K83J 3FK6A 3F6OA 3LMMA 1XMKA 4XOTA 3JRBA 1OFCX 2E19A 1BI2A 4JX5A 2P6TA 1T2KA 3OS1A 5E1ZB 4EM2A 4LFUA 2PFBA 4UUTA 2Y30A 3E5UA 1SANA 2X6YA 2KJBA 1YX5A 2GIZA 3N4MA 3E5XA 1ZLKA 2A6TA 1JKRC 1ORKA 3HSRA 2A6HF 3Q5FA 4O6JA 5CYVA 5EYRA 5FKNA 1SC7A 2DA7A 1TQMA 2IRFG 3CCMI 1NHAA 1KA8A 2R0QC 4E7HA 2XROA 1J75A 5FFXA 5HDNA 1JI8A 3H3ZA 1XSVA 3HPHA 4V19K 1BOAA 4D1QA 2DA4A 2VJIA 5H2FC 1UCRA 2KISA 3QP6A 3LFKA 1P92A 4Y17A 3SZTA 5M5XJ 2EIMH 2H6BA 3I54A 4KYWA 1T95A 2M45A 1I3AA 3ZMVA 4CZCA 4F52A 1SAXA 3LSKA 4LIVA 4LB6B 3GFJA 3DWLE 2DPDA 3AL0B 3K4LA 2VIXA 1H0MA 4CA0A 3AAFA 2VPLA 5KAFC 2DK8A 1K6YA 4B3XA 3WTUC 2R93J 2ECBA 2DJNA 1HKQA 2BW3A 2JJ7A 5C4XJ 3BROA 1ZGAA 2W48A 4F55A 1YI2I 1X58A 2W57A 4A0XA 2R7QA 1TWGJ 3EETA 1ERDA 1FP1D 1WH7A 3DFGA 3Q9VA 3QYBA 2VXZA 4IEJA 4ON0A 3FMRA 4CCJA 2W1OA 4PZJA 4RDUA 1U8RA 3TOBA 2QSGX 4OMZA 3HOYJ 4G8XA 3CESA 1O7FA 2ELKA 2M9HA 4IQ4A 2ESHA 4CCLA 2DMPA 3CJRB 5K1YA 3TW7A 4EJVA 3ERMA 3KP2A 2Q2EA 1USSA 4Q4ZF 1TW3A 2QVOA 1YRNB 4BBRJ 2KP6A 1W36D 1KYZA 1P7JA 2L9SA 2RNGA 5E8GA 2XF5A 1DPUA 3WE3A 4LD5A 2GA2A 2P81A 3H1CA 1OR7C 2K40A 2WAQN 3MEXA 4I02A 1XGNA 3I3LA 4BNCA 3OYKA 1YLFA 5FO5A 3ONQA 3I55I 2CG4A 1W36C 1BL0A 1PP7U 5GADJ 2NVYJ 2JZYA 1FJLA 1XMXA 4OINF 1V4RA 1HC8A 2GQQA 2DAOA 3L2RA 4KIBA 1IC8A 3VWBA 4LB5A 3M7GA 3TEDA 5K5OA 2LKPA 4CHUA 1QHGA 2OF7A 6PAXA 4HQMA 5FRMA 2H1KA 1UB9A 1UHSA 2EIKH 3K10A 5HOOA 2VI6A 3J7AY 2UZKA 2R5ZA 2NYXA 2IA0A 4C2MJ 3F21A 4PUSA 4HG2A 2GXAA 4I01A 4RLQA 1RKTA 1S29A 2NVTJ 1X1AA 2PMHA 2WBMA 2BY1A 1YTYA 3GTOJ 3AG1H 4GRIA 1Z6RA 2E34A 2A68F 1FEXA 2DI3A 2MYSA 2Y31A 3LA3A 1KZHA 4E7SA 3GYHX 1RIOH 2I5UA 2KRHA 1ZK8A 1ON1A 4ZJZA 1BR1A 5FLMJ 1SFOJ 1TNTA 2DJIA 4ABZA 1A31A 2LLKA 2B63J 3PSFA 1S7EA 2WY7Q 4KUMA 4IHVA 2XKPA 3EUHC 3PUBA 4YELA 3S14J 1MBKA 2E60A 3GTMJ 3OYEA 4L5EA 1K4TA 1UHMA 2R7RA 5HLIA 2X1CA 3SYTA 2NS0A 4KT6A 2BVMA 2ZBKA 1YJ9I 4GFBA 3MZ8A 3QWLA 3S1QJ 4ESFA 2C6YA 2FBHA 1IF1A 3FX3A 1EH7A 2VN2A 3QPLA 1ETKA 2KFDA 3VEPA 3WG7H 4ZYAA 4PGHA 1RZ4A 2BW3B 3G73A 1BR4A 2ZMEC 2VONA 2CQNA 5LGTA 2HDWA 1WJBA 2JA6J 4RM2A 3SZGA 3BTLA 2MBFA 3BZ6A 1T8IA 3Q0VA 2RAEA 2RC4A 1DU6A 1FBQA 2GOXB 4RS8A 4ZYHA 1P6RA 2ELHA 4RB1A 5TGTA 3I59A 5J4VA 2K86A 2QENA 3H36A 2TCTA 1ODDA 5H6QA 4MIMA 4ZH4F 1FT9A 1SVMA 4NHJA 4J00A 2WA0A 1LDKB 2BE5F 2CQ7A 3GWZA 3E6CC 3QQAA 4Y15A 1FBUA 2KHMA 2LBFB 5JI6A 2UUZA 2LC2A 2D1VA 1BA5A 1I6HJ 1Z3XA 2ZXWH 1BC8C 3ZQIA 4E6KG 2EPFA 4PFPA 1UELB 4BQAA 3JRGA 2FEZA 1D1BA 3HRSA 4P55A 5D4SA 2NNYA 3LAPA 3RPUD 3BJAA 5K7ZA 2ZO4A 4NQWB 2ECCA 4KDPA 5FROA 1Y8QB 4RB3C 1OCZH 3RKQA 2BYVE 1TL8A 2O61A 2JPCA 1PUFB 3P9IA 1WKMA 3RQIA 2M4GA 3JSPA 3FKIJ 1SAUA 3HDDA 1Z6TA 2E1OA 3W6VA 4KT5C 3IHUA 3RCOA 2KMUA 3JTGA 3GFIA 3S15J 3VOEA 3L2CA 1GDTA 5HDGA 3DF8A 1Z91A 4L9NA 3GLXA 5KK1A 1GUUA 2EWNA 2JK3A 4H4KC 4RM3A 3T8TA 3GEZA 2L7ZA 3WHCA 4EJOA 4BJTA 1G2HA 1RUNA 4KISA 2V1UA 5GTHC 5D8KB 3IAM2 4U87A 5F0CA 2MW8A 2QQAA 1MMNA 3AL0C 2VBZA 4HDVA 2JSCA 4ANJA 4QLCU 1S9HA 1J0RA 3SFIA 2O8KA 2N8GA 2LF7A 2E1NA 1M1EB 2XGEA 3ABUA 1FOXA 1F1ZA 2FX0A 3CCUI 1XG1A 2DTRA 3FXJA 2ZB9A 1MNEA 4HEA2 5EEGA 3RDIA 3CMAI 2ZJPF 5EEHA 4E70A 4XSXF 3R6SA 2VT3A 3DBHB 4FQGA 3ABLH 4KN7X 2M0CA 1RR8C 3V8KA 4YIFA 2DA1A 2DT6A 3QAHA 1YYVA 3M8EA 2R4GA 4GYGA 4Y13A 3GVAA 1SEUA 1I3QJ 2QQ9A 2ZJQF 4IXAA 1IZ1A 2J5PA 2NS7A 2A6EF 1K78B 5H6RA 2BBYA 3C18A 4OWRB 3JRDA 3LSHA 2OCEA 2M8GX 3ZN1A 5LRSA 1HW5A 2R7XA 1N77A 4XRSG 2LDUA 3O6BB 2V6EA 4A3LJ 3CUOA 1FZPB 1R6RA 1EH6A 2ZMEB 3G1OA 1N78A 2R7DA 2K3FA 2HOAA 4CO8A 5BPIA 5LRRA 2IPQX 3P9CA 4M3EA 2CW7A 1ZHFA 2WWYA 5CVRA 2VASA 3HOVJ 3CD6I 1QBJA 3HEFA 1X2NA 3GFMA 3EUKL 2ZFWA 5J8CA 1VQOI 5LGUA 3HKZA 3LWFA 4DZJA 4IHSA 4AIJA 3PQJA 2BEOA 1CF7A 1T98A 3RKYA 4OMYA 1FPQA 1LVKA 2EZKA 2R3SA 2OA4A 3H3UA 4ENNA 5GPAA 1XN7A 2EQRA 2E2JJ 2W84A 2DPUA 5HS8A 2L3DA 2FMYA 3WGHA 1RKWA 3FXQA 4AYBN 1W5SA 4A6DA 5D5UB 4KITB 1VFCA 3KP6A 2WAFA 3OYCA 3R0AA 1HSJA 1QRYA 3DPLC 3LFUA 2W82A 2Z9OA 1BI3A 2LNBA 1U9NA 1IGNA 1LFBA 1MKMA 1HQCA 3RKWA 5BS6A 5DUIA 4S05A 3WTWC 2RREA 3MCZA 2A5YB 4IF4A 1XC5A 3WU1B 2XF6A 3L7WA 1FYLA 1IW7F 1RESA 3HB9A 2YX4A 2XAHA 2DOFA 2IGKA 3BP8A 3C3WA 3BCBA 1D1CA 3ZOBA 3LQRA 4CCOA 1IRFA 3I53A 4ZDPA 3DPUA 2NOGA 3CCYA 5DD4A 1D1AA 3N97A 2V6CA 2JWTA 2E5NA 3V7SA 4DW6A 2HI3A 5JLWA 1QGPA 1W0TA 4A3KJ 2F5FA 1IN5A 1VQNI 1U5TB 1XCVA 3HHGA 5M5WJ 1XGSA 3QPHA 3HOTA 3ZQCA 4IZZA 1QZZA 2MH9A 2HOTA 1OKRA 1YRNA 1R71A 4IHXA 3JCUC 3S17J 4M3FA 4DYCA 4ZYGA 1ZR2A 3ABMH 2KJCA 2DLLA 4EJWA 3BWGA 5F1JA 1V5GA 4UVCA 1RUOA 2K3PA 4YRVA 2A05A 5IOYA 3CZ6A 3PSIA 4ZTJA 1PYVA 1IN6A 1OISA 1WJDA 3JRFA 2O5RA 2BY2A 5HLHA 1K4SA 5C4JJ 4BJ6C 2LOOA 1WQ2A 2HZDA 2K9NA 3OYAA 3V8JA 4D5FA 1GVDA 3HOZJ 1F43A 4KIFA 5ED4A 1MDMB 2MA3A 4M6YA 5TISC 5JVGF 3O8HA 1YS6A 1R5HA 5HS9A 5D6EA 1U5TA 3DEWA 2W85A 1TWAJ 1WJCA 3A02A 5DD8A 4AM3A 1P4AA 1QA6A 2X85A 3L1PA 3K4NA 2XSJC 1BJAA 3DTEA 2PLYA 2PJRA 2DODA 2F4OB 4I09A 4C3JJ 5E3MA 5J1RA 1YJNI 1VQPI 4PJ0C 1LE8A 3GTLJ 4A3DJ 4S04A 2DO7A 4CYDA 1EA3A 2V9PA 3RJPA 5IP7J 5B1AH 3JTHA 3IC7A 4FE7A 3I9V2 2JA2A 2CV1A 2EZIA 2HDCA 1R4MB 4BXXJ 3L2QA 1RETA 3OYMA 1I39A 2M0MA 2IT0A 2VL8A 3GO5A 1AU7A 3KZYA 3H3VK 2MG4A 2IS6A 3PFYA 5L3BA 2IXSA 3CCSI 3WGGA 1ZG3A 1C0WA 3DKYA 1NG7A 3OSGA 4M9SA 2R5ZB 3JRHA 3HL2A 4CYCA 2VC1A 5H20A 5DEQA 1R00A 3V42A 1O57A 4HW0A 3SEZA 1APLC 1T0FC 2OCCH 5EZGA 3DEUA 1FTTA 2XAJA 2BZTA 3HGGA 3MKWB 3F8NA 2DFEA 4F91B 1FTZA 2M7BA 3KP4A 4EV0A 4J01A 2XB5A 2DCEA 4Y4RA 1SD6A 2IP2A 2PMZN 3KFWX 2DOAA 3K9TA 3NWSA 3HOUJ 2LR8A 1CGPA 5E3OA 1FIAA 5M3MJ 2MC4A 3CCRI 3PNTA 2YUSA 1W7PB 1WJEA 2L54A 3TQNA 2VBWA 3KYCB 1VTNC 2FJ1A 4I99C 3R60A 2P7VB 1JKPC 2ETHA 1MDMA 1FC3A 2CV2A 2LY9A 1B72B 3ZR8X 2GXBA 3CF5F 4BY7J 1HLVA 1W5CC 1XSXA 4LMYA 4KICA 2TDXA 4E7JA 1YFHA 2LBFA 2ZXHA 5E20A 4AVZA 2R7FA 2VB6A 3W3CA 3ABTA 3CMYA 1N75A 3DBRB 1WHUA 1Z7LA 3G6EI 2FMLA 4CH7A 2IEKA 2X48A 1O4XA 2JVGA 2HEOA 4PK4A 4F93B 4K2EA 2F5EA 2EV0A 2WV1A 3DBLB 2P5KA 1HDDC 2QSHX 2X6OA 4EQQA 1KYWA 1Z05A 1ONVA 1JHHA 3OSFA 1ITYA 3HG9A 4QSHA 3CMEI 2ID3A 1W7PD 3C7JA 3FKJA 4RAFA 3TP0A 4LITA 2XAQA 4UV9A 5B1BH 5J1YA 1TZLA 5FKLA 5K7HA 2IAIA 4BE2A 2I8DA 3ZN0A 5JLXA 2EINH 2G7UA 4B1RA 1VQ9I 3LSMA 4DBQA 4IOAF 4BU2A 5JVTA 4NUBA 1NK3P 1MGTA 3KLNA 5HNFA 4OOIA 4BBSJ 1FOWA 4U88A 4ZYDA 3GTKJ 2J5OA 1D8KA 2P8TA 4U0YA 1D5YA 1W7PA 1GV5A 5LEJA 2AQFA 2L4AA 3GLLA 4IHYA 1NG6A 3CUQB 4B44A 3SQNA 3X2QH 3J81K 3H0GJ 4M73A 3GXOA 4L18B 3OYNA 5M3FJ 1Z3YA 2ZNZA 2EV5A 3HUGB 4BGDA 2KQRA 5AONA 3DP7A 3JW4A 2FRHA 2IW5A 5F0FA 4R1HA 3SXYA 3WTYC 2NVXJ 3KE2A 4PCQA 1KONA 4A3GJ 2XAGA 1Y56A 2LF8A 2F6CA 3TOAA 1MW7A 1ZLJA 4XRSA 1RR7A 3DQVC 2VE9A 3LSPA 4ESJA 1YJWI 4IRIA 1I5ZA 3DEEA 3WU2C 2E7XA 1ZR4A 3LSJA 2M7AA 1KGSA 2R92J 2W00A 3KZIC 2BV6A 3BJ6A 2O7OA 1ZAOA 1JKOC 4CICA 3BY6A 4D5CA 5GTIC 4GCVA 2PMZA 1S72I 2EV6A 1ZRCA 3D5LA 3CCEI 2X6XA 3S32A 4NQWA 4ENJA 1D0ZA 3GBGA 1H89C 3BCAA 2M4KA 2CW0F 3F8CA 3FMQA 3O2PE 3HKZN 2BHZA 1PJRA 2IA1A 2LKSA 3SHFA 1KQ8A 1OMIA 2DQLA 2HWVA 4U0VA 4O5VA 2JA8J 1TTYA 4JQFA 4MEYF 1ETYA 2L5QA 1HSTA 3FXLA 2Q2EB 2DFFA 3CJTB 2X51A 3BPVA 2COMA 1SD4A 1NH3A 3IKTA 1HBXG 4I2OA 2CQQA 2L02A 3MZYA 3S16J 3E6BA 1DPRA 2EBIA 1MJ9A 4B8XA 2R5YB 2VPRA 3CO6C 3HZJA 2X9DA 2ZSHB 4R79A 2XF7A 3HSFA 4HA8A 2RDPA 5EEAA 4IOCF 2XAFA 3OYLA 2E35A 1SFUA 5K7FA 3F72A 2PG4A 1TP4A 5J47A 3S3NA 3HM5A 3VYRB 5CVVA 4XLEA 5AIQA 4LJZF 5ICGA 2MLGA 4Q47A 4YIIA 1RNLA 3E6DA 4G7OF 1D0YA 3WTTC 3ZQLA 3FIWA 1JUSA 4M72A 1ZARA 3WODF 3LNQA 4A3CJ 4QIWN 1BIAA 1XGMA 3GW2A 2H27A 1VQ8I 3DCFA 1G59A 2IBDA 4Y3OA 2QSFX 5LBQA 1I6XA 5TJJA 4WWCA 1B59A 1YW8A 3H92A 2QA4I 5JR3A 2RKHA 3CTAA 2Y75A 2XRLA 2XIGA 1CQTA 3DKWA 2I10A 4W1UA 1POGA 2R5YA 2M34A 4PJNA 2Q8KA 1RC9A 2DOEA 3FF5A 4A93J 1FOYA 3AG4H 3GCMA 4MTDA 3S3MA 2CGPA 1FMWA 2LMDA 5GAGJ 1LDDA 2KIMA 4BYYA 3WTZA 4CGZA 1OCTC 3SDGA 5IP6A 5FKOA 3MFKA 3PJRA 1JXSA 2XHKA 3G2BA 3M8JA 1DUXC 4HPQA 1Q1VA 5JHFA 1B8IA 1V5FA 2Y2ZA 3GTGJ 2GM4A 4XK4A 2VJ5A 4XLCA 3OS2A 3JSOA 5D5WB 3U9GA 3T8RA 5LEKA 2D45A 2LG4A 3J7AO 2FBKA 2KZGA 4F92B 1TBXA 1WJ5A 5J4YA 4II3A 4B09A 2IA2A 4N9HA 5HODA 1B72A 3FXMA 3M07A 1FMVA 4HF1A 3F3XA 3FMSA 4GGGA 2FNPA 1CF7B 2HXIA 4AC0A 4QTRA 2OTLI 1P9QC 3OL3A 1G3SA 3N05A 2Y0MA 4OIRF 2RVCA 3E1SA 2IS4A 1X19A 2O8XA 1P2FA 1MNDA 2FUG2 4ZC3A 1YO5C 4I98B 1L3LA 3M4OJ 5CVUA 1VI0A 1EV7A 1ZH5A 2LVSA 5JFRA 3FDYA 1MBEA 4BS9A 1P4WA 1VQ4I 3FK7A 1HKSA 2D1HA 3FXUA 4L5JA 5FD6A 3ZP5A 5J6XA 1QVTA 2NAZA 1R22A 4I7HA 2ZXIA 4HNVA 3FBNB 5A2QZ 5LD2C 1E17A 1NTCA 2UXNA 4P9FA 2DT5A 1LJ9A 3SZPA 1S8NA 1ZYRF 2HQAA 2HNHA 1ZREA 3REOA 1FSEA 2DXIA 4D0PA 2E7WA 3F8FA 1IRXA 2HDDA 3S1NJ 4HYEA 2VKVA 5C3EJ 1FX7A 4BACA 1B4AA 1BR2A 4ESBA 3TGNA 1F36A 2YU9J 3CMMA 1IUFA 1T08B 2XPVA 1X3WB 1IXSB 4W97A 5DUKA 3CUQC 2RV8A 1WRJA 4XLNF 4CCNA 2F4IA 1T6SA 3ZXSA 3BR3A 2JUCA 1Z7UA 3GZNB 5DDGA 4ENKA 1QHHD 4EJTA 3FXRA 4TV7A 2EFWA 2K4JA 3IUOA 4YFXF 1B8IB 2VODA 1MD0A 3GMEA 4FT8A 5LHGA 2CFOA 1OYYA 2PN6A 2QM3A 4JK1X 1BI0A 1GVJA 3W6JB 2GA1A 3K70C 2EFNA 3QU3A 1STZA 5J1UA 1XDUA 1SFEA 4UB6C 2CQKA 4A12A 5FKMA 2RQQA 3KX2A 3J81Z 2L9VA 1ZELA 3HSEA 1MMDA 1K78A 2JTVA 1OJLA 4HQEA 2M3AA 3R61A 3K1NA 2VKHA 4P5OA 4ZZLA 4A3FJ 2GZWA 3F8BA 2V79A 2F5VA 2VJJA 5LHIA 3IWFA 5ICCA 4AWXB 2P5VA 1FY7A 2VT2A 4XOPA 2LKXA 4YG2F 4U7BA 3F0CA 3OYBA 4Q48A 3QYEA 3BT9A 3EPZA 1Y0NA 3U2RA 1TC3C 2G0EA 4G7ZF 5KHDA 2V9VA 2HU9A 2O0YA 2X0LA 2TRTA 5BPDA 3WTXC 2Y69H 4AIKA 1UHWA 1XPXA 3K1PA 1S5LC 3OV8A 2ZNYA 1P4XA 1A6IA 2X1DA 3VPRA 2XRNA 2ZXJA 3H9QA 1G3TA 3ESWB 3KP3A 4MLOA 5FJ8J 3OL4A 3F9KA 2M1BA 4PGGA 1XTAA 3ZQQA 1FYMA 4UVBA 3B6AA 4HLYA 3EYYA 3W6KB 5DTDA 2ICWG 4RBOA 2VKEA 1ACIA 4P9UA 1TLHB 3PO2J 1AWCA 1TT0A 1Z77A 4HLXA 4E4HA 1T39A 2EIJH 4L9TA 3VYUB 4BHCA 2EJRA 3NARA 2K7LA 2DT7B 4PFOA 2Z5UA 3IKVA 3VODA 1IN7A 2V7FA 4LLNA 2P4WA 5FD5A 1KU9A 3A0HC 1NK2P 4HOBA 2HPMA 1S7AA 2CU7A 2NNNA 3L2VA 2ZJRF 1HCRA 3MWMA 4X6AJ 1GXPA 2LFBA 3ZQGA 5IOZA 2L0KA 1SD5A 1KU7A 3ABKH 3S8PA 4XKBA 3G1MA 3CCJI 2HQ5A 3HGYA 2EA2A 2FA5A 3QPTA 3A03A 1RRJA 4C3HJ 4XKCA 3LSIA 1UG0A 1F4KA 3CLOA 2D5VA 1UMQA 1OYIA 3QYFA 4Q5SF 3WU0A 3RSNA 1QNTA 4FX0A 1LEAA 2IGMA 2PBIA 2STWA 3I64A 2VOPA 4DJAA 2LH9A 5E1XA 5E8IA 3ECOA 2ZJ2A 5ILUA 1G3YA 2E2HJ 1B6AA 2Y9ZA 2IVMA 2DA5A 2LREA 4MHGA 4FHTA 4RGSA 4F7ZA 4RLFA 3D5SC 1QO0D 3I71A 4UB8C 3U21A 2F4MB 1S6LA 4U0WA 4EATA 2IS1A 4XKVA 3BTJA 1AKHA 4KMFA 1ULYA 9ANTA 1X4PA 1JGGA 4N4OB 1HW1A 1W5TA 1ZGWA 1TQPA 2RNJA 3I4NJ 4MQ9F 2F5CA 1IV6A 1SMTA 2PMUA 3OYHA 2P7CB 2DU9A 2W24A 3FXOA 3CDLA 4CDGA 3BG6A 1LB2A 5FGMA 1A04A 1Y0UA 2VQLA 2VQGA 4DQ2A 4MTEA 1U6GA 4EGZA 1DDNA 4CSWA 1MNMC 5JHUA 2RN7A 3KYDB 3QU6A 1R1TA 2WTEA 1MBFA 2K9LA 3DXJF 3RYPA 4IKFA 1U2WA 2JVHA 3RQ4A 1HDPA 3GFLA 5FLVA 1ZRDA 2XSDC 4G6TB 2AQEA 1E2XA 4ITVA 2MC3A 2CW8A 2AXTC 4HV5A 4OU0A 2WAQA 3PL8A 2DFIA 2ME6A 5B66C 4WCGA 2HVRA 2EILH 4XORA 1J9IA 2K4BA 3K4JA 2JA5J 2JPBA 2DDAA 3OS0A 1PUEE 3IH2A 1K6OA 4L0ZB 1G6NA 2HKOA 2L7MP 4NC6A 4XRFA 3BG7A 3TKYA 3L09A 1X1DA 2RGVA 5HLTA 3M3YJ 3F8MA 2HGCA 4AYBA 5KAIC 1T0FA 2CWEA 2BXYA 3BJOA 3C2GA 4AVPA 5GAHJ 2DN0A 5FLXK 3AFHA 5J3LA 2WY8Q 3Q0UA 3Q9SA 3E6MA 4S0HB 4MQVA 5CVJA 4B4CA 3LSGA 1J09A 4EMSA 1IG7A 1LVAA 3HXLA 4U7DA 2XAUA 3ZMSA 4M3BA 1WI3A 1MSFC 2Z3YA 1B9MA 3MKYB 1IN4A 2XPUA 2XV4S 2HVQA 1LDJA 4LLGF 4KMUX 1OPCA 3K6GA 3S93A 3TDUC 2HYGD 1O3TA 2HYFA 3MVPA 3IL2A 2FE3A 2V1XA 2PI0A 1R49A 1YHQI 1VQ7I 4R8HA 1EJ9A 4DGWB 4JX6A 4BEHB 4XBFA 4KIGA 1IRZA 2A69F 2HZTA 2Y48A 2VUMJ 5BQTA 5HLGA 1JTXA 2XGDA 3T1BA 1XB4A 4BKXA 2JMWA 1Z67A 3RYRA 3L2UA 3V7RA 2OZUA 4AIHA 4WXDA 3UR3C 1IAWA 1AOYA 5CKTA 2EH3A 3DLAA 5DV5A 4AD9A 5EDNA 4BE1A 2X6WA 4WX9A 1LNWA 3ZMUA 5F64A 1WZ2A 1KQ9A 1ZG1A 3PM1A 4A0YA 3CCLI 3HRTA 2EFOA 3A2KA 3CP8A 4EGYA 3KETA 2CUEA 3ZGKA 3H0DA 2V9KA 4M6XA 2R7SA 3G71I 4M9ZA 2DYSH 4AIDA 1TWFJ 4NB5A 1D5VA 3I5UA 4B3AA 1WVRA 1JUPA 2HKXA 2L9NA 4A0ZA 1YX3A 5CQEA 3RIRA 1DP3A 3Q0WA 1QVUA 4RAZA 2MLKA 1FIPA 3PIOF 2BXZA 2O3FA 2R7VA 2YPRA 4P1WA 2LTPA 2E1CA 2KIFA 3E5QA 2QYOA 2DMNA 2FBIA 3BTCA 4UUSA 1USTA 1K79A 3VB2A 2R7UA 1DGRM 1MIJA 2QKMB 3COAC 2KRFA 3HC7A 1ETXA 2O9LA 4BH9A 4DNCA 3K2AA 1U0JA 4ETSA 1GHCA 2QZ8A 5BOXA 4C2TA 1DQUA 4X1EA 4CCMA 4DZPA 3ZMTA 3JRIA 1I1SA 3F22A 2B7EA 2W4SA 1DP7P 3K69A 3R4KA 3GX4X 2HQNA 1OQYA 2BY0A 5IYCJ 3CCVI 4IHTA 1JUMA 3EDPA 5EZHA 4XL9A 3FISA 1SMYF 1WWXA 1MBHA 2CO5A 3KZZA 3PNVA 4L9JA 3S1RJ 2IGNA 1Q1HA 1R4NB 4N4NB 2VBYA 2X1EA 5EG0A 4HRIA 4WXHA 3TO6A 5D5VB 3OMYA 1OYWA 1LQ1A 4B43A 2VOOA 2AHQA 4MFDA 5CLSA 1JKQC 1ZTRA 2LYCA 2CRGA 2L9RA 3OYFA 2ESNA 3I4MJ 2GXGA 2ME0A 3OR1C 2Z33A 2MGQA 2OV7A 4E7ZA 1KQ0A 4BHPA 2XVCA 1E3HA 2EZLA 3KP5A 2YX7A 4LK0F 1FLIA 2Y0SA 1J7KA 2E36A 4BL0B 3DKXA 3I59B 3UKGA 3FBIB 2EB7A 3P5JA 1YITI 3OR2C 4FETA 4N9IA 5CVIA 3M9AA 3B73A 4BHBA 4FE4A 3ZQ7A 1UG2A 4A3IJ 3GUDA 3BC8A 2HOEA 4YFNF 1WI9A 2ADUA 4JP0A 3WTVC 1R23A 4UUVA 2HOSA 1JHFA 3OIOA 5B5EC 4HX4A 3HOWJ 2FD5A 1R5GA 3MKZA 2COBA 2DBBA 4E7IA 1WGXA 1XGOA 5FRNA 1HKTA 1LE8B 4LG3A 3LQQA 4Z2YA 4OIOF 3T5XA 1V5EA 3NRVA 2G7HA 4IRGA 2KIUA 1UFMA 2DFHA 2FQ3A 1X2MA 4IJAA 2FOKA 2E5ZA 3BTIA 4AUXA 1H8AC 1HF0A 4BY1J 4FTHA 2ACJA 1QQIA 4D7MA 1ZN2A 4OIPF 1FSHA 2AO9A 1ZG5A 3BLYA 3BR0A 3V8LA 4EEFG 1VZ0A 5J40A 1MMAA 1Z0XA 4OAZA 1Y6IA 3HJEA 3M1EA 4FX4A 4GDFA 1W1WE 3CQZJ 2LSOA 5F1RA 2KKOA 3HHHA 3LOCA 2YU3A 4G12A 2QLZA 5A2QK 1ZQ3P 4DOZA 2UWMA 4XLHA 3NEUA 2NRAC 3G1LA 2BGCA 4F3QA 1BM9A 1IUYA 1TWHJ 1XCBA 2W7NA 3K2ZA 1S3JA 5CPRB 4EJUA 1WSUA 3CDHA 4D9JA 1X4OA 1ENHA 4LG0B 4XLFA 2KRCA 2K9MA 3FM5A 5LHHA 3BR6A 1WH5A 5F27A 1MSEC 2KDZA 4M6VA 5ILSA 3GZ6A 3H9JA 2KL4A 1UAAA 3LL7A 1BIBA 2WB1A 2PJRB 3CDIA 1A6QA 1B9NA 2B0LA 3E97A 2HTJA 3RPUA 2H8WA 3MKLA 5E3LA 3S2HJ 1UZCA 2E71A 2XGCA 2H8RA 3O3KA 4IX7A 2DQRA 3BDDA 2QQBA 2M87A 2CMPA 2EFQA 2XB0X 2PJPA 3CO7C 4UHTA 3GTJJ 3GZ5A 2UXXA 3BR1A 4LIUA 4C9YA 2CQXA 1ETOA 1O7LA 3V7CA 4KJZA 2LD5A 1TQIA 3PO3J 2NXNB 4FASD 1LPQA 5F6FA 5GPCA 3U1KA 4O3MA 2BHYA 1H9TA 1K7AA 5EGOA 5IT9Z 1FP2A 3OOUA 3ECHA 1OCPA 4XN3A 3SDBA 4Z6YA 5HVQC 4RMNA 2MD5A 2QKLB 2CUFA 3HTUA 4MO7A 1PUFA 1SD7A 1YG2A 4LGWA 1OCRH 1V55H 2CS3A 4JYKA 4G7HF 1VF9A 5GAEJ 1QPMA 2V26A 1YE9A 2EA4A 4A5MA 3OYJA 3K7AJ 4NC7A 1REPC 2F48A 3CUQA 3D1NI 1U3EM 3HIFA 1G3WA 2ELJA 5E3NA 4XIDA 4BEHA 2OAZA 4A3EJ 3TO9A 5FKKA 1X1BA 5TRDA 2A5WA 3W2AA 2XDVA 3C2HA 2FU4A 2EFPA 2HTSA 2XASA 3V4GA 1GT0C 2VE8A 3BG9A 1E3OC 2P5LC 1YIOA 2H1LA 4G9YA 3SJMA 2E2IJ 1G4DA 4ZDOA 1WJAA 1XSDA 1WFXA 2HQRA 3H5NA 2DMUA 1ON2A 3FHZA 2AXLA 2NOJB 2GLOA 2ISZA 3I4PA 1V3FA 2WAEA 3G4SI 1FNNA 5KNLA 2RQPA 2GBYA 2KDOA 2XPWA 3C2BA 1D0XA 2K5CA 4HV6A 1D8JA 1BC7C 3BG3A 3WG9A 4XQFA 4RB0A 4B47A 4DYQA 2JRMA 1BBYA 1R1VA 2V1DA 1VQLI 2HS5A 5HNHA 2K85A 1ZRFA 1R9TJ 1MBGA 1ETWA 3WHBA 3GF2A 3S3OA 4PSWA 1LUJB 1YW9A 4NC8A 3PFIA 3GTQJ 1XMAA 3ELKA 2CUJA 2DMTA 1I50J 5DYMA 3H9GA 1E0EA 1OCOH 3J80K 2Q0OA 3VYTB 1S7OA 3BR5A 1X1CA 1T33A 2CSOA 2FF4A 2VQHA 5KVRA 3UNGC 3KIOA 4CZZA 4HBLA 4XKWA 3NAUA 4M3GA 3CF2A 2WB1N 5E79C 4UVAA 2OQGA 2OUMA 3K4MA 1BOBA 3OOPA 4V2GA 1N25A 4BQQA 2L01A 3A01A 2ZFUA 1JTYA 2LP0A 2QGUA 3OYGA 1Z21A 3F23A 4RA2A 5L3GA 5LGNA 1BW6A 1H9GA 5D8LB 2FNAA 3OIPA 4XONA 5HS7A 2L4MA 2F2EA 4BQNA 3SEQA 5FB2A 1FBSA 4XRMA 2MH2A 1R5ID 3T0YA 3E3VA 4IPAA 4BQOA 3W2WA 3FM3A 3VYSB 3ZRGA 4BDZA 5EF6A 5E17F 4WK8F 2VKDA 3BQYA 4HX8A 4D7NA 2JSPA 1A5JA 1HOMA 1SVLA 5L3CA 3D5RC 3L9FA 4JBAA 1MBJA 1GV2A 3EQLF 1YQAA 3WTSC 3MZHA 3CP2A 4NBQA 2VXDA 1QU3A 2K9QA 3RI4A 1MH4A 2XC7A 2OD5A 3U1DA 5FLXZ 4HNUA 4IVNA 3OY9A 5DCFA 3I0TA 1G8XA 2VC0A 4A6EA 4YFKF 3QODA 3R0JA 3CLQA 4WXCA 3IWZA 1FWZA 3O8GA 4QPOA 2PQ8A 4EM0B 3AG2H 1K61A 2YR2A 2P6SA 2O6GE 3EYIA 1VNDA 4HX7A 1A36A 4IL6C 3IRQA 3CC2I 1J59A 5FFZA 1QZEA 4FISA 4HSTA 3W2VA 2KLOA 1GXQA 2A61A 5B3SH 5L3EA 2M2EA 3M1CA 1YOVB 1XX5A 2QQ8A 4L0YB 4UV8A 2P0WA 2ZSIB 1WCMJ 3RZDJ 1PVEA 3DTIA 4LLLA 1W0UA 5D5XB 5D4RA 5F04A 2FOWA 2OZ6A 3RKXA 4J19A 4KA4A 3QOPA 4XLPF 1TWCJ 1IJWC 1SFXA 2ZMEA 2PX9A 3GTPJ 1W4MA 2QBYB 2ID6A 1MMGA 2Z1DA 3ZQFA 2UV1A 4GO1A 1IDYA 1BN5A 5E1WA 1YIJI 3KPHA 4XN0A 1IN8A 2JN6A 3BZKA 3QP5A 3L00A 2H09A 5F08A 3HRUA 1R36A 3MD2A 1YS7A 2VLAA 1Z9CA 2F5DA 2Z99A 3LSTA 3H5AA 1IXRC 3P7NA 3PNYA 2QCOA 4A3JJ 3JREA 2CUZA 5IY5H 3ZPLA 3B02A 4IHWA 2R7ZJ 4BJ5C 2HPIA 4RAYA 4DYRA 1T38A 4A3BJ 3IP4B 3B6CA 2FQ4A 2FSWA 4CYCB 3DPTA 1T56A 4BXUA 4HZFA 3PUFA 2OU2A 2OQRA 4IO9F 3CJQB 1MH3A 4RGUA 2BOLA 2GIVA 4XR6A 2QBYA 2YS9A 3QOEA 3TDZC 3VDXA 2PEXA 2Q1ZB 4I0BA 5DS9A 1AKHB 5KCMA 3KP7A 1BI1A 4A2UA 3WE2A 1X1PA 5EGOB 4C2UA 5ERIA 3MQ0A 1IXCA 2NVQJ 1OCCH 4RAGA 3IV5A 4MNUA 4XMYA 4V2FA 4A5NA 2JT1A 2XGXA 3AG3H 3IH3A 1IDZA 2L2OA 3A1YA 3EUAA 2R7OA 1EF4A 3PIPF 1A35A 1ZKGA 4I76A 2XUBA 3RTRA 5IYBJ 3HOSA 4HF2A 5M5YJ 2STTA 4IRHA 1Y8RB 2VBXA 1YW7A 1L0OC 2E1MB 3M8FA 2JQ7A 2YSRA 1O3QA 1WJFA 4XNFA 4EVIA 3BQZA 3ML6A 5IP9J 1U78A 4FCYA 5DM6F 2H94A 3DU6A 4BXFA 3PQKA 4HDUA 4DIQA 1O3SA 1QZYA 4ENMA 3ASNH 1MZBA 4Y7NJ 4BDYA 1HA8A 3VSLA 2KZVA 3OYDA 1JGSA 1IRGA 5LFAA 2OJED 2MFZA 2R7TA 2R7WA 1MMSA 1P7IA 1ZGJA 3ULQB 4PJJA 1TW2A 1I1GA 3HTSB 1SVOA 3K70D 3J7ZI 3JAMK 3I56I 3TW6A 3HPGA 3CCQI 2Y0SN 3OYIA 1R58A 3S2DJ 1RPWA 4C30A 3LA2A 2X4HA 4EM1A 1JJ8C 1BJZA 3SFZA 4YEJA 5C44J 1U9OA 4MFEA 2LRDA 2VJ4A 2EZHA 3H5RA 3L2WA 1KU2A 1I27A 3CC4I 2NS8A 1SFKA 2XKOA 2HVSA 3ZCOA 4KN4X 3FXKA 1AA7A 1F9NA 2Y9YA 4CCKA 1X3UA 1DU0A 2DDBA 3J7YJ 2E1MC 3ZMZA 1Z1DA 2DK5A 3A4CA 5L3DA 1U8BA 2K02A 3S2WA 1R1UA 4DBRA 3J80Z 1PDNC 1J2XA 2OPTA 2LK2A 4PDKA 3HYIA 4N0BA 5CJ9A 1JJ6C 4KFCA 4L9VA 2LY1A 4G6DA 4LG0A 5F0HA 3K4KA 4RGRA 2A07F 5IYDJ 4CUGA 3FWEA 2CV0A 4AU7A 1TT5B 4HAMA 5IPAA 3TBIA 1Y39A 1Y1VJ 3HUGA 3KEOA 4RGXA 4LOCA 3QRFF 2K9SA 2LY2A 1R7JA 3Q3SA 1VQMI 4OAYA 3ISPA 2VQCA 3C1DA 4ASNA 3LSRA 4XM3A 5ILVA 3ASOH 3NWTA 3ROUA 5L3FA 3LAJA 5ICEA 2OC6A 1OLTA 4UNOA 3TO7A 1OR7A 2A3SA 3MAJA 2DA3A 4ZYEA 3TL4X 2D2WA 3BZCA 1JE8A 2QWWA 4I6ZA 5K5RA 3KLOA 2DYRH 3RPQA 4XLAA 4MEXF 3DV8A 2CH0A 4X0GA 2HXOA 2CJJA 2GOMA 3KEQA 1ETVA 1E3PA 1RI7A 3BOQA 3I58A 4XSZF 1LEBA 3HBLA 3OWTA 5EG0B 3MN2A 4A3MJ 4G6QA 5CQGA 2L7FP 1B1BA 3KYLA 3K4CA 1XDSA 1JT0A 3JAMZ 3E0JB 5EJCA 1HW2A 4M9XA 3P9KA 2K27A 3BPXA 2DMQA 4A69C 3AKZA 4M74A 1UJ8A 2DA2A 1ETQA 4Y52J 2H6CA 2M5WA 2OBPA 1FOKA 2WC2A 4MGRA 5DCMB 5E18F 4UXNA 5DCMA 2MSYA 2W25A 1AHDP 4WF2A 2HR3A 3NQOA 1JT6A 3IRRA 1Y1WJ 4NNJA 2IJLA 5DM7F 1VQKI 4KNYA 5GP9A 4PSXA 3VFZA 1MJBA 3RZOJ 1BW5A 3JRCA 4HSRA 4I0AA 5LLQA 3FHNA 1VQ5I 2BVLA 3F6VA 4PJLA 2DW4A 2IGOA 3EUHA 2NVUB 1F5TA 1U5TC 5IT3A 3CC7I 4UY8I 2JA7J 2Z2SB 2MABA 2M8EA 4BUPA 3TP3A 3OIQA 2ZKZA 1VQ6I 1DGWY 2IS2A 1WPKA 1TNSA 3FZVA 4HF0A 4XICA 1MJAA 2M30A 4E7LA 2OTJI 3MMYB 4QPQA 1EH8A 2L7KA 3QPSA 1IV8A 4ZTFA 2Z16A 2DTZA 3H35A 2QEXI 3ZMDA 3KEYA 4B48A 3WGIA 2G9WA 4JX4A 4E7KA 3VSKA 3TMOA 1V54H 4M71A
chains in the Genus database with same CATH topology
5IT9K 2WV0A 4L5IA 1PP8F 3HRMA 3LA7A 4GYIA 5K5QA 4OIQF 4CXFA 2HFHA 2QUFA 1XD7A 2FXAA 4QWQA 2JRTA 1J5YA 2CYYA 3K1MA 2ZCWA 5BMZA 4RB2C 2ISYA 4G94A 1KU3A 3K0LA 3KCCA 3D0SA 4P96A 5HDKA 2AS5F 4GXOA 4ZZDA 2GAUA 5J8FA 1HXDA 2GWRA 3ERED 1O3RA 2CFXA 2EK5A 5AIPA 4BAYA 5ICFA 2O03A 3G3ZA 3CJNA 4LK1F 5D6FA 4H0EA 1D3YA 1FYKA 3F6OA 1XMKA 1BI2A 1T2KA 2P6TA 5E1ZB 4EM2A 4LFUA 2PFBA 3E5UA 2KJBA 3N4MA 3E5XA 1ZLKA 3HSRA 2A6HF 3Q5FA 4O6JA 5CYVA 1TQMA 2IRFG 1NHAA 1KA8A 2XROA 1J75A 5FFXA 5HDNA 3H3ZA 1XSVA 1BOAA 1UCRA 3QP6A 3LFKA 1P92A 4Y17A 3SZTA 2H6BA 3I54A 4KYWA 2M45A 3ZMVA 1SAXA 4LB6B 3GFJA 2DPDA 1H0MA 3AAFA 2DK8A 3WTUC 1HKQA 3BROA 1ZGAA 4A0XA 2W57A 3EETA 1FP1D 3DFGA 3Q9VA 2VXZA 4ON0A 3FMRA 4PZJA 1U8RA 3TOBA 4OMZA 4G8XA 1O7FA 2ESHA 5K1YA 4EJVA 3KP2A 2Q2EA 1USSA 4Q4ZF 1TW3A 2QVOA 1KYZA 5E8GA 1DPUA 3WE3A 4LD5A 2GA2A 3MEXA 4I02A 1XGNA 4BNCA 1YLFA 5FO5A 2CG4A 1PP7U 2JZYA 4OINF 1V4RA 2GQQA 2DAOA 4KIBA 4LB5A 3M7GA 5K5OA 2LKPA 4CHUA 6PAXA 4HQMA 1UB9A 5HOOA 2UZKA 2NYXA 2IA0A 3F21A 4I01A 1S29A 1YTYA 2PMHA 1Z6RA 2A68F 2DI3A 3LA3A 3GYHX 1RIOH 1ON1A 1TNTA 4KUMA 2XKPA 1UHMA 5HLIA 2NS0A 2ZBKA 4ESFA 2C6YA 2FBHA 1IF1A 3FX3A 1EH7A 2VN2A 3VEPA 4PGHA 1RZ4A 3G73A 2VONA 5LGTA 2MBFA 3BZ6A 2RC4A 1FBQA 4RS8A 4ZYHA 1P6RA 2ELHA 4RB1A 3I59A 2K86A 2QENA 1ODDA 5H6QA 4ZH4F 1FT9A 4NHJA 1LDKB 2BE5F 3GWZA 3E6CC 4Y15A 1FBUA 5JI6A 2D1VA 1BC8C 4BQAA 2FEZA 3HRSA 4P55A 2NNYA 5D4SA 3LAPA 3BJAA 2ZO4A 4KDPA 4RB3C 2BYVE 2O61A 2JPCA 3P9IA 1WKMA 3JSPA 1Z6TA 4KT5C 3JTGA 3GFIA 3IHUA 3VOEA 3L2CA 5HDGA 3DF8A 1Z91A 4L9NA 3GLXA 5KK1A 2EWNA 3T8TA 4EJOA 3GEZA 1RUNA 2V1UA 5D8KB 2QQAA 2VBZA 4HDVA 2JSCA 4QLCU 1J0RA 2LF7A 2E1NA 3ABUA 1F1ZA 2DTRA 5EEGA 3RDIA 5EEHA 4E70A 4XSXF 3R6SA 2VT3A 4KN7X 3V8KA 4YIFA 3QAHA 1YYVA 3M8EA 4GYGA 4Y13A 3GVAA 2QQ9A 4IXAA 1IZ1A 2J5PA 2A6EF 1K78B 5H6RA 2BBYA 3C18A 5LRSA 3ZN1A 1HW5A 2LDUA 3O6BB 3CUOA 1FZPB 1EH6A 2ZMEB 2R7DA 4CO8A 5BPIA 5LRRA 2IPQX 3P9CA 1ZHFA 2WWYA 5CVRA 1QBJA 3GFMA 2ZFWA 5J8CA 5LGUA 3LWFA 4IHSA 4AIJA 3PQJA 2BEOA 1CF7A 1T98A 3RKYA 4OMYA 1FPQA 2R3SA 2OA4A 3H3UA 4ENNA 1XN7A 2W84A 2DPUA 5HS8A 2L3DA 2FMYA 3WGHA 3FXQA 1W5SA 4A6DA 5D5UB 3KP6A 3R0AA 1HSJA 3DPLC 2Z9OA 1BI3A 2LNBA 1MKMA 1HQCA 3RKWA 5BS6A 4S05A 3WTWC 5DUIA 3MCZA 2A5YB 4IF4A 3WU1B 3L7WA 1FYLA 1IW7F 2YX4A 2XAHA 3BP8A 3C3WA 3LQRA 1IRFA 3I53A 5DD4A 3N97A 2V6CA 3V7SA 1QGPA 2F5FA 1IN5A 1U5TB 1XCVA 3HHGA 1XGSA 3QPHA 3HOTA 1QZZA 2MH9A 1OKRA 4ZYGA 2KJCA 2DLLA 4EJWA 3BWGA 4UVCA 1RUOA 1IN6A 5HLHA 1WQ2A 3V8JA 4KIFA 5ED4A 1MDMB 2MA3A 4M6YA 1YS6A 1R5HA 5HS9A 5D6EA 1U5TA 2W85A 5DD8A 1P4AA 1BJAA 2PLYA 4I09A 4S04A 2DO7A 4CYDA 3RJPA 3JTHA 3IC7A 2HDCA 2IT0A 3GO5A 3KZYA 5L3BA 3WGGA 1ZG3A 1C0WA 4M9SA 2VC1A 5H20A 5DEQA 1R00A 1O57A 4HW0A 3DEUA 2XAJA 3F8NA 3KP4A 4EV0A 1SD6A 2IP2A 3KFWX 3K9TA 1CGPA 1W7PB 2L54A 3TQNA 2VBWA 1VTNC 3R60A 2P7VB 2ETHA 1MDMA 1FC3A 2GXBA 1XSXA 4LMYA 4KICA 2TDXA 1YFHA 5E20A 2R7FA 3ABTA 2FMLA 2HEOA 4K2EA 2F5EA 2EV0A 2P5KA 4EQQA 1KYWA 1Z05A 1ONVA 1JHHA 1W7PD 3C7JA 2XAQA 4UV9A 3ZN0A 2G7UA 5JVTA 1MGTA 3KLNA 4OOIA 4U88A 4ZYDA 2J5OA 1D8KA 2P8TA 4U0YA 1W7PA 5LEJA 2L4AA 3CUQB 3SQNA 3J81K 4M73A 3GXOA 4L18B 2ZNZA 2EV5A 5AONA 3DP7A 3JW4A 2FRHA 2IW5A 4R1HA 3SXYA 3WTYC 3KE2A 4PCQA 2XAGA 2LF8A 3TOAA 1ZLJA 3DQVC 2VE9A 4ESJA 4IRIA 1I5ZA 2E7XA 1KGSA 2BV6A 3BJ6A 1ZAOA 4CICA 3BY6A 4GCVA 2EV6A 1ZRCA 3D5LA 4NQWA 4ENJA 2CW0F 3F8CA 3FMQA 3O2PE 2IA1A 3SHFA 1KQ8A 1OMIA 2DQLA 2HWVA 4U0VA 4O5VA 1TTYA 4JQFA 4MEYF 1HSTA 3BPVA 2COMA 1SD4A 3IKTA 1HBXG 4I2OA 2L02A 3MZYA 3E6BA 1DPRA 4B8XA 1MJ9A 3CO6C 4R79A 3HSFA 4HA8A 2RDPA 2XAFA 1SFUA 3F72A 2PG4A 5CVVA 5AIQA 4LJZF 5ICGA 2MLGA 4Q47A 4YIIA 1RNLA 3E6DA 4G7OF 3WTTC 4M72A 1ZARA 3WODF 1BIAA 1XGMA 3GW2A 2H27A 5LBQA 1I6XA 5TJJA 4WWCA 1B59A 1YW8A 3H92A 5JR3A 2RKHA 3CTAA 2Y75A 2XIGA 3DKWA 2Q8KA 3FF5A 4MTDA 2CGPA 1LDDA 2KIMA 4BYYA 3WTZA 4CGZA 1JXSA 3MFKA 2XHKA 1DUXC 3JSOA 5D5WB 3U9GA 3T8RA 5LEKA 2D45A 3J7AO 2FBKA 1TBXA 4B09A 2IA2A 4N9HA 4HF1A 3F3XA 1CF7B 3FMSA 2FNPA 4GGGA 4OIRF 1G3SA 2Y0MA 2RVCA 2O8XA 1P2FA 1YO5C 4I98B 1L3LA 5CVUA 1EV7A 1ZH5A 5JFRA 1P4WA 1HKSA 2D1HA 3FXUA 4L5JA 5FD6A 3ZP5A 5J6XA 2NAZA 1R22A 4I7HA 5A2QZ 1E17A 2UXNA 4P9FA 2DT5A 1LJ9A 3SZPA 1S8NA 1ZYRF 1ZREA 3REOA 1FSEA 4D0PA 2E7WA 3F8FA 4HYEA 1FX7A 1B4AA 4ESBA 3TGNA 1IXSB 5DUKA 3CUQC 2RV8A 1WRJA 4XLNF 1T6SA 1Z7UA 5DDGA 4ENKA 4EJTA 3FXRA 4TV7A 2EFWA 2K4JA 4YFXF 2VODA 1MD0A 4FT8A 5LHGA 1OYYA 2PN6A 2QM3A 4JK1X 1BI0A 1GVJA 3W6JB 2GA1A 2EFNA 3QU3A 1STZA 1XDUA 1SFEA 2CQKA 4A12A 3J81Z 3HSEA 1K78A 2JTVA 4HQEA 3R61A 3K1NA 4P5OA 4ZZLA 2GZWA 3F8BA 2V79A 5LHIA 3IWFA 5ICCA 4AWXB 2P5VA 1FY7A 2VT2A 4YG2F 4U7BA 4Q48A 3U2RA 4G7ZF 2V9VA 2O0YA 2X0LA 5BPDA 3WTXC 4AIKA 1UHWA 3K1PA 3OV8A 2ZNYA 1P4XA 2XRNA 2ZXJA 1G3TA 3KP3A 2M1BA 4PGGA 1FYMA 4UVBA 4HLYA 3EYYA 3W6KB 4P9UA 1TLHB 1AWCA 4HLXA 1T39A 4L9TA 4BHCA 2EJRA 2K7LA 2Z5UA 3IKVA 3VODA 1IN7A 4LLNA 2P4WA 5FD5A 1KU9A 4HOBA 1S7AA 2NNNA 3MWMA 1GXPA 1SD5A 1KU7A 2EA2A 2FA5A 3QPTA 1F4KA 3CLOA 1OYIA 4Q5SF 3WU0A 1QNTA 4FX0A 1LEAA 2PBIA 2STWA 2VOPA 3I64A 5E1XA 5E8IA 3ECOA 2ZJ2A 5ILUA 1G3YA 1B6AA 2IVMA 4MHGA 4FHTA 4RGSA 4F7ZA 1QO0D 3I71A 1S6LA 4U0WA 4KMFA 1ULYA 1HW1A 1W5TA 1TQPA 2RNJA 4MQ9F 2F5CA 1SMTA 2PMUA 2P7CB 2DU9A 2W24A 4CDGA 1LB2A 5FGMA 1A04A 1Y0UA 4DQ2A 4MTEA 1U6GA 4EGZA 1DDNA 5JHUA 2RN7A 3QU6A 1R1TA 2WTEA 3DXJF 3RYPA 1U2WA 3GFLA 1ZRDA 1E2XA 2MC3A 4HV5A 4OU0A 2DFIA 4WCGA 1J9IA 2K4BA 2JPBA 1PUEE 1K6OA 4L0ZB 1G6NA 2HKOA 4XRFA 3TKYA 3L09A 2RGVA 3F8MA 2HGCA 1T0FA 2CWEA 3BJOA 4AVPA 5FLXK 3Q9SA 3E6MA 4MQVA 5CVJA 4EMSA 1LVAA 4U7DA 3ZMSA 2Z3YA 1B9MA 1IN4A 2XV4S 1LDJA 4LLGF 4KMUX 1OPCA 3TDUC 1O3TA 2HYGD 2HYFA 3IL2A 2FE3A 2V1XA 2PI0A 4R8HA 4XBFA 4KIGA 2A69F 2HZTA 2Y48A 5BQTA 5HLGA 3T1BA 1XB4A 3RYRA 3V7RA 2OZUA 4AIHA 4WXDA 1IAWA 1AOYA 5DV5A 4AD9A 4WX9A 1LNWA 3ZMUA 5F64A 1KQ9A 1ZG1A 4A0YA 3HRTA 2EFOA 4EGYA 3KETA 4M6XA 4M9ZA 4NB5A 1D5VA 3I5UA 4A0ZA 2HKXA 3RIRA 4RAZA 2MLKA 2O3FA 2YPRA 2E1CA 2KIFA 3E5QA 2QYOA 2FBIA 1USTA 1K79A 3VB2A 3COAC 2KRFA 4BH9A 4DNCA 4ETSA 1GHCA 2QZ8A 5BOXA 1I1SA 3ZMTA 3F22A 1DP7P 3K69A 3R4KA 3GX4X 2HQNA 4IHTA 3EDPA 1SMYF 1WWXA 2CO5A 3KZZA 4L9JA 1Q1HA 2VBYA 4WXHA 3TO6A 5D5VB 1OYWA 1LQ1A 2VOOA 5CLSA 2ESNA 2GXGA 2Z33A 1KQ0A 4BHPA 2XVCA 3KP5A 2YX7A 4LK0F 1FLIA 1J7KA 3I59B 2EB7A 4N9IA 5CVIA 3M9AA 3B73A 4BHBA 3ZQ7A 3GUDA 2HOEA 4YFNF 1WI9A 2ADUA 3WTVC 1R23A 4UUVA 1JHFA 4HX4A 1R5GA 2DBBA 1XGOA 1HKTA 3LQQA 4OIOF 4Z2YA 3T5XA 3NRVA 2G7HA 4IRGA 2KIUA 1UFMA 2FQ3A 4IJAA 2FOKA 2ACJA 1QQIA 1ZN2A 4OIPF 1FSHA 1ZG5A 3V8LA 3M1EA 4FX4A 2LSOA 5F1RA 2KKOA 3HHHA 2YU3A 2QLZA 5A2QK 2UWMA 3NEUA 2NRAC 2BGCA 1IUYA 1BM9A 1XCBA 3K2ZA 1S3JA 4EJUA 1WSUA 3CDHA 4LG0B 3FM5A 5LHHA 5ILSA 3GZ6A 1BIBA 1B9NA 2B0LA 3E97A 2HTJA 3RPUA 3O3KA 2DQRA 3BDDA 2QQBA 2M87A 2EFQA 2PJPA 3CO7C 4UHTA 3GZ5A 2UXXA 1O7LA 3V7CA 1TQIA 5F6FA 4O3MA 1H9TA 1K7AA 5IT9Z 1FP2A 3ECHA 5HVQC 2MD5A 3HTUA 1SD7A 1YG2A 4LGWA 4G7HF 1QPMA 2EA4A 4A5MA 1REPC 3CUQA 1U3EM 3HIFA 1G3WA 2OAZA 3TO9A 5TRDA 2FU4A 2EFPA 2HTSA 2XASA 3V4GA 2VE8A 2P5LC 1YIOA 4G9YA 1G4DA 1XSDA 2HQRA 1ON2A 3FHZA 2AXLA 2ISZA 3I4PA 1V3FA 1FNNA 2RQPA 4HV6A 1D8JA 1BC7C 3WG9A 4RB0A 1BBYA 1R1VA 2V1DA 2HS5A 1ZRFA 3GF2A 1YW9A 3PFIA 1XMAA 3ELKA 5DYMA 3J80K 2Q0OA 1S7OA 2CSOA 2FF4A 5KVRA 4CZZA 4HBLA 4UVAA 2OQGA 3OOPA 2L01A 3F23A 5L3GA 5LGNA 1H9GA 5D8LB 2FNAA 5HS7A 2L4MA 2F2EA 5FB2A 1FBSA 2MH2A 3T0YA 3E3VA 4IPAA 3FM3A 5E17F 4WK8F 4HX8A 5L3CA 4JBAA 3L9FA 3EQLF 1YQAA 3WTSC 3MZHA 3RI4A 2OD5A 3U1DA 5FLXZ 4IVNA 5DCFA 3I0TA 2VC0A 4A6EA 4YFKF 3R0JA 4WXCA 3IWZA 1FWZA 4EM0B 2PQ8A 2YR2A 2P6SA 2O6GE 3EYIA 4HX7A 3IRQA 1J59A 5FFZA 1GXQA 2A61A 5L3EA 4L0YB 4UV8A 4LLLA 5D5XB 5D4RA 3RKXA 2OZ6A 4KA4A 3QOPA 4XLPF 1SFXA 2ZMEA 1W4MA 2QBYB 4GO1A 1BN5A 5E1WA 1IN8A 3QP5A 3L00A 2H09A 3HRUA 1R36A 1YS7A 1Z9CA 2F5DA 2Z99A 3LSTA 1IXRC 3P7NA 3ZPLA 3B02A 4RAYA 1T38A 2FSWA 3DPTA 4BXUA 4HZFA 2OU2A 2OQRA 4RGUA 2GIVA 2QBYA 3TDZC 2PEXA 4I0BA 3KP7A 1BI1A 4A2UA 3WE2A 5ERIA 3MQ0A 1IXCA 4MNUA 4A5NA 2JT1A 2XGXA 2XUBA 3RTRA 3HOSA 4HF2A 2STTA 4IRHA 2VBXA 1YW7A 1L0OC 3M8FA 2YSRA 1O3QA 4EVIA 3ML6A 1U78A 2H94A 3PQKA 4HDUA 1O3SA 1QZYA 4ENMA 1MZBA 1JGSA 1IRGA 1ZGJA 3ULQB 1TW2A 1I1GA 3HTSB 3JAMK 1R58A 3LA2A 2X4HA 4EM1A 3SFZA 1KU2A 1I27A 2XKOA 4KN4X 1F9NA 1X3UA 3ZMZA 1Z1DA 2DK5A 5L3DA 2K02A 3S2WA 1R1UA 1PDNC 3J80Z 1J2XA 4PDKA 3HYIA 4N0BA 5CJ9A 4KFCA 4L9VA 4G6DA 4LG0A 4RGRA 2A07F 3FWEA 4HAMA 3HUGA 3KEOA 4RGXA 3QRFF 1R7JA 3ISPA 4ASNA 3C1DA 5ILVA 3ROUA 5L3FA 3LAJA 5ICEA 4UNOA 3TO7A 1OR7A 2A3SA 3MAJA 4ZYEA 2D2WA 1JE8A 2QWWA 5K5RA 3KLOA 3RPQA 4MEXF 3DV8A 3KEQA 1RI7A 3BOQA 3I58A 4XSZF 1LEBA 4G6QA 1B1BA 1XDSA 3JAMZ 1HW2A 4M9XA 3P9KA 2K27A 3BPXA 4M74A 2H6CA 1FOKA 2M5WA 2OBPA 2WC2A 4MGRA 5DCMB 5E18F 4UXNA 5DCMA 2W25A 4WF2A 2HR3A 3NQOA 3IRRA 2IJLA 4KNYA 3VFZA 1MJBA 4I0AA 5LLQA 3F6VA 2DW4A 3EUHA 1F5TA 1U5TC 5IT3A 2M8EA 2ZKZA 1TNSA 3FZVA 4HF0A 1MJAA 2M30A 1EH8A 3ZMDA 3WGIA 2G9WA 4M71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 K;  2WV0 A;  4L5I A;  1PP8 F;  3HRM A;  3LA7 A;  4GYI A;  5K5Q A;  4OIQ F;  4CXF A;  2HFH A;  2QUF A;  1XD7 A;  2FXA A;  4QWQ A;  2JRT A;  1J5Y A;  2CYY A;  3K1M A;  2ZCW A;  5BMZ A;  4RB2 C;  2ISY A;  4G94 A;  1KU3 A;  3K0L A;  3KCC A;  3D0S A;  4P96 A;  5HDK A;  2AS5 F;  4GXO A;  4ZZD A;  2GAU A;  5J8F A;  1HXD A;  2GWR A;  3ERE D;  1O3R A;  2CFX A;  2EK5 A;  5AIP A;  4BAY A;  5ICF A;  2O03 A;  3G3Z A;  3CJN A;  4LK1 F;  5D6F A;  4H0E A;  1D3Y A;  1FYK A;  3F6O A;  1XMK A;  1BI2 A;  1T2K A;  2P6T A;  5E1Z B;  4EM2 A;  4LFU A;  2PFB A;  3E5U A;  2KJB A;  3N4M A;  3E5X A;  1ZLK A;  3HSR A;  2A6H F;  3Q5F A;  4O6J A;  5CYV A;  1TQM A;  2IRF G;  1NHA A;  1KA8 A;  2XRO A;  1J75 A;  5FFX A;  5HDN A;  3H3Z A;  1XSV A;  1BOA A;  1UCR A;  3QP6 A;  3LFK A;  1P92 A;  4Y17 A;  3SZT A;  2H6B A;  3I54 A;  4KYW A;  2M45 A;  3ZMV A;  1SAX A;  4LB6 B;  3GFJ A;  2DPD A;  1H0M A;  3AAF A;  2DK8 A;  3WTU C;  1HKQ A;  3BRO A;  1ZGA A;  4A0X A;  2W57 A;  3EET A;  1FP1 D;  3DFG A;  3Q9V A;  2VXZ A;  4ON0 A;  3FMR A;  4PZJ A;  1U8R A;  3TOB A;  4OMZ A;  4G8X A;  1O7F A;  2ESH A;  5K1Y A;  4EJV A;  3KP2 A;  2Q2E A;  1USS A;  4Q4Z F;  1TW3 A;  2QVO A;  1KYZ A;  5E8G A;  1DPU A;  3WE3 A;  4LD5 A;  2GA2 A;  3MEX A;  4I02 A;  1XGN A;  4BNC A;  1YLF A;  5FO5 A;  2CG4 A;  1PP7 U;  2JZY A;  4OIN F;  1V4R A;  2GQQ A;  2DAO A;  4KIB A;  4LB5 A;  3M7G A;  5K5O A;  2LKP A;  4CHU A;  6PAX A;  4HQM A;  1UB9 A;  5HOO A;  2UZK A;  2NYX A;  2IA0 A;  3F21 A;  4I01 A;  1S29 A;  1YTY A;  2PMH A;  1Z6R A;  2A68 F;  2DI3 A;  3LA3 A;  3GYH X;  1RIO H;  1ON1 A;  1TNT A;  4KUM A;  2XKP A;  1UHM A;  5HLI A;  2NS0 A;  2ZBK A;  4ESF A;  2C6Y A;  2FBH A;  1IF1 A;  3FX3 A;  1EH7 A;  2VN2 A;  3VEP A;  4PGH A;  1RZ4 A;  3G73 A;  2VON A;  5LGT A;  2MBF A;  3BZ6 A;  2RC4 A;  1FBQ A;  4RS8 A;  4ZYH A;  1P6R A;  2ELH A;  4RB1 A;  3I59 A;  2K86 A;  2QEN A;  1ODD A;  5H6Q A;  4ZH4 F;  1FT9 A;  4NHJ A;  1LDK B;  2BE5 F;  3GWZ A;  3E6C C;  4Y15 A;  1FBU A;  5JI6 A;  2D1V A;  1BC8 C;  4BQA A;  2FEZ A;  3HRS A;  4P55 A;  2NNY A;  5D4S A;  3LAP A;  3BJA A;  2ZO4 A;  4KDP A;  4RB3 C;  2BYV E;  2O61 A;  2JPC A;  3P9I A;  1WKM A;  3JSP A;  1Z6T A;  4KT5 C;  3JTG A;  3GFI A;  3IHU A;  3VOE A;  3L2C A;  5HDG A;  3DF8 A;  1Z91 A;  4L9N A;  3GLX A;  5KK1 A;  2EWN A;  3T8T A;  4EJO A;  3GEZ A;  1RUN A;  2V1U A;  5D8K B;  2QQA A;  2VBZ A;  4HDV A;  2JSC A;  4QLC U;  1J0R A;  2LF7 A;  2E1N A;  3ABU A;  1F1Z A;  2DTR A;  5EEG A;  3RDI A;  5EEH A;  4E70 A;  4XSX F;  3R6S A;  2VT3 A;  4KN7 X;  3V8K A;  4YIF A;  3QAH A;  1YYV A;  3M8E A;  4GYG A;  4Y13 A;  3GVA A;  2QQ9 A;  4IXA A;  1IZ1 A;  2J5P A;  2A6E F;  1K78 B;  5H6R A;  2BBY A;  3C18 A;  5LRS A;  3ZN1 A;  1HW5 A;  2LDU A;  3O6B B;  3CUO A;  1FZP B;  1EH6 A;  2ZME B;  2R7D A;  4CO8 A;  5BPI A;  5LRR A;  2IPQ X;  3P9C A;  1ZHF A;  2WWY A;  5CVR A;  1QBJ A;  3GFM A;  2ZFW A;  5J8C A;  5LGU A;  3LWF A;  4IHS A;  4AIJ A;  3PQJ A;  2BEO A;  1CF7 A;  1T98 A;  3RKY A;  4OMY A;  1FPQ A;  2R3S A;  2OA4 A;  3H3U A;  4ENN A;  1XN7 A;  2W84 A;  2DPU A;  5HS8 A;  2L3D A;  2FMY A;  3WGH A;  3FXQ A;  1W5S A;  4A6D A;  5D5U B;  3KP6 A;  3R0A A;  1HSJ A;  3DPL C;  2Z9O A;  1BI3 A;  2LNB A;  1MKM A;  1HQC A;  3RKW A;  5BS6 A;  4S05 A;  3WTW C;  5DUI A;  3MCZ A;  2A5Y B;  4IF4 A;  3WU1 B;  3L7W A;  1FYL A;  1IW7 F;  2YX4 A;  2XAH A;  3BP8 A;  3C3W A;  3LQR A;  1IRF A;  3I53 A;  5DD4 A;  3N97 A;  2V6C A;  3V7S A;  1QGP A;  2F5F A;  1IN5 A;  1U5T B;  1XCV A;  3HHG A;  1XGS A;  3QPH A;  3HOT A;  1QZZ A;  2MH9 A;  1OKR A;  4ZYG A;  2KJC A;  2DLL A;  4EJW A;  3BWG A;  4UVC A;  1RUO A;  1IN6 A;  5HLH A;  1WQ2 A;  3V8J A;  4KIF A;  5ED4 A;  1MDM B;  2MA3 A;  4M6Y A;  1YS6 A;  1R5H A;  5HS9 A;  5D6E A;  1U5T A;  2W85 A;  5DD8 A;  1P4A A;  1BJA A;  2PLY A;  4I09 A;  4S04 A;  2DO7 A;  4CYD A;  3RJP A;  3JTH A;  3IC7 A;  2HDC A;  2IT0 A;  3GO5 A;  3KZY A;  5L3B A;  3WGG A;  1ZG3 A;  1C0W A;  4M9S A;  2VC1 A;  5H20 A;  5DEQ A;  1R00 A;  1O57 A;  4HW0 A;  3DEU A;  2XAJ A;  3F8N A;  3KP4 A;  4EV0 A;  1SD6 A;  2IP2 A;  3KFW X;  3K9T A;  1CGP A;  1W7P B;  2L54 A;  3TQN A;  2VBW A;  1VTN C;  3R60 A;  2P7V B;  2ETH A;  1MDM A;  1FC3 A;  2GXB A;  1XSX A;  4LMY A;  4KIC A;  2TDX A;  1YFH A;  5E20 A;  2R7F A;  3ABT A;  2FML A;  2HEO A;  4K2E A;  2F5E A;  2EV0 A;  2P5K A;  4EQQ A;  1KYW A;  1Z05 A;  1ONV A;  1JHH A;  1W7P D;  3C7J A;  2XAQ A;  4UV9 A;  3ZN0 A;  2G7U A;  5JVT A;  1MGT A;  3KLN A;  4OOI A;  4U88 A;  4ZYD A;  2J5O A;  1D8K A;  2P8T A;  4U0Y A;  1W7P A;  5LEJ A;  2L4A A;  3CUQ B;  3SQN A;  3J81 K;  4M73 A;  3GXO A;  4L18 B;  2ZNZ A;  2EV5 A;  5AON A;  3DP7 A;  3JW4 A;  2FRH A;  2IW5 A;  4R1H A;  3SXY A;  3WTY C;  3KE2 A;  4PCQ A;  2XAG A;  2LF8 A;  3TOA A;  1ZLJ A;  3DQV C;  2VE9 A;  4ESJ A;  4IRI A;  1I5Z A;  2E7X A;  1KGS A;  2BV6 A;  3BJ6 A;  1ZAO A;  4CIC A;  3BY6 A;  4GCV A;  2EV6 A;  1ZRC A;  3D5L A;  4NQW A;  4ENJ A;  2CW0 F;  3F8C A;  3FMQ A;  3O2P E;  2IA1 A;  3SHF A;  1KQ8 A;  1OMI A;  2DQL A;  2HWV A;  4U0V A;  4O5V A;  1TTY A;  4JQF A;  4MEY F;  1HST A;  3BPV A;  2COM A;  1SD4 A;  3IKT A;  1HBX G;  4I2O A;  2L02 A;  3MZY A;  3E6B A;  1DPR A;  4B8X A;  1MJ9 A;  3CO6 C;  4R79 A;  3HSF A;  4HA8 A;  2RDP A;  2XAF A;  1SFU A;  3F72 A;  2PG4 A;  5CVV A;  5AIQ A;  4LJZ F;  5ICG A;  2MLG A;  4Q47 A;  4YII A;  1RNL A;  3E6D A;  4G7O F;  3WTT C;  4M72 A;  1ZAR A;  3WOD F;  1BIA A;  1XGM A;  3GW2 A;  2H27 A;  5LBQ A;  1I6X A;  5TJJ A;  4WWC A;  1B59 A;  1YW8 A;  3H92 A;  5JR3 A;  2RKH A;  3CTA A;  2Y75 A;  2XIG A;  3DKW A;  2Q8K A;  3FF5 A;  4MTD A;  2CGP A;  1LDD A;  2KIM A;  4BYY A;  3WTZ A;  4CGZ A;  1JXS A;  3MFK A;  2XHK A;  1DUX C;  3JSO A;  5D5W B;  3U9G A;  3T8R A;  5LEK A;  2D45 A;  3J7A O;  2FBK A;  1TBX A;  4B09 A;  2IA2 A;  4N9H A;  4HF1 A;  3F3X A;  1CF7 B;  3FMS A;  2FNP A;  4GGG A;  4OIR F;  1G3S A;  2Y0M A;  2RVC A;  2O8X A;  1P2F A;  1YO5 C;  4I98 B;  1L3L A;  5CVU A;  1EV7 A;  1ZH5 A;  5JFR A;  1P4W A;  1HKS A;  2D1H A;  3FXU A;  4L5J A;  5FD6 A;  3ZP5 A;  5J6X A;  2NAZ A;  1R22 A;  4I7H A;  5A2Q Z;  1E17 A;  2UXN A;  4P9F A;  2DT5 A;  1LJ9 A;  3SZP A;  1S8N A;  1ZYR F;  1ZRE A;  3REO A;  1FSE A;  4D0P A;  2E7W A;  3F8F A;  4HYE A;  1FX7 A;  1B4A A;  4ESB A;  3TGN A;  1IXS B;  5DUK A;  3CUQ C;  2RV8 A;  1WRJ A;  4XLN F;  1T6S A;  1Z7U A;  5DDG A;  4ENK A;  4EJT A;  3FXR A;  4TV7 A;  2EFW A;  2K4J A;  4YFX F;  2VOD A;  1MD0 A;  4FT8 A;  5LHG A;  1OYY A;  2PN6 A;  2QM3 A;  4JK1 X;  1BI0 A;  1GVJ A;  3W6J B;  2GA1 A;  2EFN A;  3QU3 A;  1STZ A;  1XDU A;  1SFE A;  2CQK A;  4A12 A;  3J81 Z;  3HSE A;  1K78 A;  2JTV A;  4HQE A;  3R61 A;  3K1N A;  4P5O A;  4ZZL A;  2GZW A;  3F8B A;  2V79 A;  5LHI A;  3IWF A;  5ICC A;  4AWX B;  2P5V A;  1FY7 A;  2VT2 A;  4YG2 F;  4U7B A;  4Q48 A;  3U2R A;  4G7Z F;  2V9V A;  2O0Y A;  2X0L A;  5BPD A;  3WTX C;  4AIK A;  1UHW A;  3K1P A;  3OV8 A;  2ZNY A;  1P4X A;  2XRN A;  2ZXJ A;  1G3T A;  3KP3 A;  2M1B A;  4PGG A;  1FYM A;  4UVB A;  4HLY A;  3EYY A;  3W6K B;  4P9U A;  1TLH B;  1AWC A;  4HLX A;  1T39 A;  4L9T A;  4BHC A;  2EJR A;  2K7L A;  2Z5U A;  3IKV A;  3VOD A;  1IN7 A;  4LLN A;  2P4W A;  5FD5 A;  1KU9 A;  4HOB A;  1S7A A;  2NNN A;  3MWM A;  1GXP A;  1SD5 A;  1KU7 A;  2EA2 A;  2FA5 A;  3QPT A;  1F4K A;  3CLO A;  1OYI A;  4Q5S F;  3WU0 A;  1QNT A;  4FX0 A;  1LEA A;  2PBI A;  2STW A;  2VOP A;  3I64 A;  5E1X A;  5E8I A;  3ECO A;  2ZJ2 A;  5ILU A;  1G3Y A;  1B6A A;  2IVM A;  4MHG A;  4FHT A;  4RGS A;  4F7Z A;  1QO0 D;  3I71 A;  1S6L A;  4U0W A;  4KMF A;  1ULY A;  1HW1 A;  1W5T A;  1TQP A;  2RNJ A;  4MQ9 F;  2F5C A;  1SMT A;  2PMU A;  2P7C B;  2DU9 A;  2W24 A;  4CDG A;  1LB2 A;  5FGM A;  1A04 A;  1Y0U A;  4DQ2 A;  4MTE A;  1U6G A;  4EGZ A;  1DDN A;  5JHU A;  2RN7 A;  3QU6 A;  1R1T A;  2WTE A;  3DXJ F;  3RYP A;  1U2W A;  3GFL A;  1ZRD A;  1E2X A;  2MC3 A;  4HV5 A;  4OU0 A;  2DFI A;  4WCG A;  1J9I A;  2K4B A;  2JPB A;  1PUE E;  1K6O A;  4L0Z B;  1G6N A;  2HKO A;  4XRF A;  3TKY A;  3L09 A;  2RGV A;  3F8M A;  2HGC A;  1T0F A;  2CWE A;  3BJO A;  4AVP A;  5FLX K;  3Q9S A;  3E6M A;  4MQV A;  5CVJ A;  4EMS A;  1LVA A;  4U7D A;  3ZMS A;  2Z3Y A;  1B9M A;  1IN4 A;  2XV4 S;  1LDJ A;  4LLG F;  4KMU X;  1OPC A;  3TDU C;  1O3T A;  2HYG D;  2HYF A;  3IL2 A;  2FE3 A;  2V1X A;  2PI0 A;  4R8H A;  4XBF A;  4KIG A;  2A69 F;  2HZT A;  2Y48 A;  5BQT A;  5HLG A;  3T1B A;  1XB4 A;  3RYR A;  3V7R A;  2OZU A;  4AIH A;  4WXD A;  1IAW A;  1AOY A;  5DV5 A;  4AD9 A;  4WX9 A;  1LNW A;  3ZMU A;  5F64 A;  1KQ9 A;  1ZG1 A;  4A0Y A;  3HRT A;  2EFO A;  4EGY A;  3KET A;  4M6X A;  4M9Z A;  4NB5 A;  1D5V A;  3I5U A;  4A0Z A;  2HKX A;  3RIR A;  4RAZ A;  2MLK A;  2O3F A;  2YPR A;  2E1C A;  2KIF A;  3E5Q A;  2QYO A;  2FBI A;  1UST A;  1K79 A;  3VB2 A;  3COA C;  2KRF A;  4BH9 A;  4DNC A;  4ETS A;  1GHC A;  2QZ8 A;  5BOX A;  1I1S A;  3ZMT A;  3F22 A;  1DP7 P;  3K69 A;  3R4K A;  3GX4 X;  2HQN A;  4IHT A;  3EDP A;  1SMY F;  1WWX A;  2CO5 A;  3KZZ A;  4L9J A;  1Q1H A;  2VBY A;  4WXH A;  3TO6 A;  5D5V B;  1OYW A;  1LQ1 A;  2VOO A;  5CLS A;  2ESN A;  2GXG A;  2Z33 A;  1KQ0 A;  4BHP A;  2XVC A;  3KP5 A;  2YX7 A;  4LK0 F;  1FLI A;  1J7K A;  3I59 B;  2EB7 A;  4N9I A;  5CVI A;  3M9A A;  3B73 A;  4BHB A;  3ZQ7 A;  3GUD A;  2HOE A;  4YFN F;  1WI9 A;  2ADU A;  3WTV C;  1R23 A;  4UUV A;  1JHF A;  4HX4 A;  1R5G A;  2DBB A;  1XGO A;  1HKT A;  3LQQ A;  4OIO F;  4Z2Y A;  3T5X A;  3NRV A;  2G7H A;  4IRG A;  2KIU A;  1UFM A;  2FQ3 A;  4IJA A;  2FOK A;  2ACJ A;  1QQI A;  1ZN2 A;  4OIP F;  1FSH A;  1ZG5 A;  3V8L A;  3M1E A;  4FX4 A;  2LSO A;  5F1R A;  2KKO A;  3HHH A;  2YU3 A;  2QLZ A;  5A2Q K;  2UWM A;  3NEU A;  2NRA C;  2BGC A;  1IUY A;  1BM9 A;  1XCB A;  3K2Z A;  1S3J A;  4EJU A;  1WSU A;  3CDH A;  4LG0 B;  3FM5 A;  5LHH A;  5ILS A;  3GZ6 A;  1BIB A;  1B9N A;  2B0L A;  3E97 A;  2HTJ A;  3RPU A;  3O3K A;  2DQR A;  3BDD A;  2QQB A;  2M87 A;  2EFQ A;  2PJP A;  3CO7 C;  4UHT A;  3GZ5 A;  2UXX A;  1O7L A;  3V7C A;  1TQI A;  5F6F A;  4O3M A;  1H9T A;  1K7A A;  5IT9 Z;  1FP2 A;  3ECH A;  5HVQ C;  2MD5 A;  3HTU A;  1SD7 A;  1YG2 A;  4LGW A;  4G7H F;  1QPM A;  2EA4 A;  4A5M A;  1REP C;  3CUQ A;  1U3E M;  3HIF A;  1G3W A;  2OAZ A;  3TO9 A;  5TRD A;  2FU4 A;  2EFP A;  2HTS A;  2XAS A;  3V4G A;  2VE8 A;  2P5L C;  1YIO A;  4G9Y A;  1G4D A;  1XSD A;  2HQR A;  1ON2 A;  3FHZ A;  2AXL A;  2ISZ A;  3I4P A;  1V3F A;  1FNN A;  2RQP A;  4HV6 A;  1D8J A;  1BC7 C;  3WG9 A;  4RB0 A;  1BBY A;  1R1V A;  2V1D A;  2HS5 A;  1ZRF A;  3GF2 A;  1YW9 A;  3PFI A;  1XMA A;  3ELK A;  5DYM A;  3J80 K;  2Q0O A;  1S7O A;  2CSO A;  2FF4 A;  5KVR A;  4CZZ A;  4HBL A;  4UVA A;  2OQG A;  3OOP A;  2L01 A;  3F23 A;  5L3G A;  5LGN A;  1H9G A;  5D8L B;  2FNA A;  5HS7 A;  2L4M A;  2F2E A;  5FB2 A;  1FBS A;  2MH2 A;  3T0Y A;  3E3V A;  4IPA A;  3FM3 A;  5E17 F;  4WK8 F;  4HX8 A;  5L3C A;  4JBA A;  3L9F A;  3EQL F;  1YQA A;  3WTS C;  3MZH A;  3RI4 A;  2OD5 A;  3U1D A;  5FLX Z;  4IVN A;  5DCF A;  3I0T A;  2VC0 A;  4A6E A;  4YFK F;  3R0J A;  4WXC A;  3IWZ A;  1FWZ A;  4EM0 B;  2PQ8 A;  2YR2 A;  2P6S A;  2O6G E;  3EYI A;  4HX7 A;  3IRQ A;  1J59 A;  5FFZ A;  1GXQ A;  2A61 A;  5L3E A;  4L0Y B;  4UV8 A;  4LLL A;  5D5X B;  5D4R A;  3RKX A;  2OZ6 A;  4KA4 A;  3QOP A;  4XLP F;  1SFX A;  2ZME A;  1W4M A;  2QBY B;  4GO1 A;  1BN5 A;  5E1W A;  1IN8 A;  3QP5 A;  3L00 A;  2H09 A;  3HRU A;  1R36 A;  1YS7 A;  1Z9C A;  2F5D A;  2Z99 A;  3LST A;  1IXR C;  3P7N A;  3ZPL A;  3B02 A;  4RAY A;  1T38 A;  2FSW A;  3DPT A;  4BXU A;  4HZF A;  2OU2 A;  2OQR A;  4RGU A;  2GIV A;  2QBY A;  3TDZ C;  2PEX A;  4I0B A;  3KP7 A;  1BI1 A;  4A2U A;  3WE2 A;  5ERI A;  3MQ0 A;  1IXC A;  4MNU A;  4A5N A;  2JT1 A;  2XGX A;  2XUB A;  3RTR A;  3HOS A;  4HF2 A;  2STT A;  4IRH A;  2VBX A;  1YW7 A;  1L0O C;  3M8F A;  2YSR A;  1O3Q A;  4EVI A;  3ML6 A;  1U78 A;  2H94 A;  3PQK A;  4HDU A;  1O3S A;  1QZY A;  4ENM A;  1MZB A;  1JGS A;  1IRG A;  1ZGJ A;  3ULQ B;  1TW2 A;  1I1G A;  3HTS B;  3JAM K;  1R58 A;  3LA2 A;  2X4H A;  4EM1 A;  3SFZ A;  1KU2 A;  1I27 A;  2XKO A;  4KN4 X;  1F9N A;  1X3U A;  3ZMZ A;  1Z1D A;  2DK5 A;  5L3D A;  2K02 A;  3S2W A;  1R1U A;  1PDN C;  3J80 Z;  1J2X A;  4PDK A;  3HYI A;  4N0B A;  5CJ9 A;  4KFC A;  4L9V A;  4G6D A;  4LG0 A;  4RGR A;  2A07 F;  3FWE A;  4HAM A;  3HUG A;  3KEO A;  4RGX A;  3QRF F;  1R7J A;  3ISP A;  4ASN A;  3C1D A;  5ILV A;  3ROU A;  5L3F A;  3LAJ A;  5ICE A;  4UNO A;  3TO7 A;  1OR7 A;  2A3S A;  3MAJ A;  4ZYE A;  2D2W A;  1JE8 A;  2QWW A;  5K5R A;  3KLO A;  3RPQ A;  4MEX F;  3DV8 A;  3KEQ A;  1RI7 A;  3BOQ A;  3I58 A;  4XSZ F;  1LEB A;  4G6Q A;  1B1B A;  1XDS A;  3JAM Z;  1HW2 A;  4M9X A;  3P9K A;  2K27 A;  3BPX A;  4M74 A;  2H6C A;  1FOK A;  2M5W A;  2OBP A;  2WC2 A;  4MGR A;  5DCM B;  5E18 F;  4UXN A;  5DCM A;  2W25 A;  4WF2 A;  2HR3 A;  3NQO A;  3IRR A;  2IJL A;  4KNY A;  3VFZ A;  1MJB A;  4I0A A;  5LLQ A;  3F6V A;  2DW4 A;  3EUH A;  1F5T A;  1U5T C;  5IT3 A;  2M8E A;  2ZKZ A;  1TNS A;  3FZV A;  4HF0 A;  1MJA A;  2M30 A;  1EH8 A;  3ZMD A;  3WGI A;  2G9W A;  4M71 A; 
#chains in the Genus database with same CATH topology
 5IT9 K;  3DLL F;  3JR9 A;  2WV0 A;  4L5I A;  1PP8 F;  3JRA A;  4ZDL A;  3S1M J;  3HRM A;  3LA7 A;  4C3I J;  1LFP A;  3BG5 A;  3HOX J;  2DA6 A;  4GYI A;  5K5Q A;  1EKE A;  4OIQ F;  4CXF A;  2HFH A;  2QUF A;  1XD7 A;  2FXA A;  4QWQ A;  2BY3 A;  2V1N A;  3ZQH A;  2JRT A;  1J5Y A;  2CYY A;  3K1M A;  2ZCW A;  4M3D A;  4RB2 C;  5BMZ A;  1H88 C;  4UUS B;  2ISY A;  4G94 A;  2JUG A;  1KU3 A;  5BNG A;  3K0L A;  3E7L A;  3KCC A;  3A01 B;  1GLN A;  3D0S A;  2KIQ A;  3DU5 A;  2B9S A;  4P96 A;  4IQJ A;  1X3Z B;  3DTK A;  5HDK A;  2AS5 F;  4Y33 A;  4GXO A;  4II2 A;  3IH4 A;  4ZZD A;  2GAU A;  2MD0 A;  1XS9 A;  3IAS 2;  5J8F A;  2WAD A;  4NDL A;  4JOM A;  1LFU P;  1HXD A;  2GWR A;  3ERE D;  2V4J C;  4YIR X;  1O3R A;  2ZC2 A;  2CFX A;  4PJM A;  1QPI A;  2KT0 A;  2KPM A;  2EK5 A;  1LKX A;  4HNT A;  2HYJ A;  3BR2 A;  5AIP A;  2QF7 A;  4BE0 A;  4BAY A;  5ICF A;  2O03 A;  1IO2 A;  3G3Z A;  3CJN A;  4LK1 F;  5D6F A;  4H0E A;  3A0B C;  1D3Y A;  3K4B A;  1FYK A;  1K83 J;  3FK6 A;  3F6O A;  3LMM A;  1XMK A;  4XOT A;  3JRB A;  1OFC X;  2E19 A;  1BI2 A;  4JX5 A;  2P6T A;  1T2K A;  3OS1 A;  5E1Z B;  4EM2 A;  4LFU A;  2PFB A;  4UUT A;  2Y30 A;  3E5U A;  1SAN A;  2X6Y A;  2KJB A;  1YX5 A;  2GIZ A;  3N4M A;  3E5X A;  1ZLK A;  2A6T A;  1JKR C;  1ORK A;  3HSR A;  2A6H F;  3Q5F A;  4O6J A;  5CYV A;  5EYR A;  5FKN A;  1SC7 A;  2DA7 A;  1TQM A;  2IRF G;  3CCM I;  1NHA A;  1KA8 A;  2R0Q C;  4E7H A;  2XRO A;  1J75 A;  5FFX A;  5HDN A;  1JI8 A;  3H3Z A;  1XSV A;  3HPH A;  4V19 K;  1BOA A;  4D1Q A;  2DA4 A;  2VJI A;  5H2F C;  1UCR A;  2KIS A;  3QP6 A;  3LFK A;  1P92 A;  4Y17 A;  3SZT A;  5M5X J;  2EIM H;  2H6B A;  3I54 A;  4KYW A;  1T95 A;  2M45 A;  1I3A A;  3ZMV A;  4CZC A;  4F52 A;  1SAX A;  3LSK A;  4LIV A;  4LB6 B;  3GFJ A;  3DWL E;  2DPD A;  3AL0 B;  3K4L A;  2VIX A;  1H0M A;  4CA0 A;  3AAF A;  2VPL A;  5KAF C;  2DK8 A;  1K6Y A;  4B3X A;  3WTU C;  2R93 J;  2ECB A;  2DJN A;  1HKQ A;  2BW3 A;  2JJ7 A;  5C4X J;  3BRO A;  1ZGA A;  2W48 A;  4F55 A;  1YI2 I;  1X58 A;  2W57 A;  4A0X A;  2R7Q A;  1TWG J;  3EET A;  1ERD A;  1FP1 D;  1WH7 A;  3DFG A;  3Q9V A;  3QYB A;  2VXZ A;  4IEJ A;  4ON0 A;  3FMR A;  4CCJ A;  2W1O A;  4PZJ A;  4RDU A;  1U8R A;  3TOB A;  2QSG X;  4OMZ A;  3HOY J;  4G8X A;  3CES A;  1O7F A;  2ELK A;  2M9H A;  4IQ4 A;  2ESH A;  4CCL A;  2DMP A;  3CJR B;  5K1Y A;  3TW7 A;  4EJV A;  3ERM A;  3KP2 A;  2Q2E A;  1USS A;  4Q4Z F;  1TW3 A;  2QVO A;  1YRN B;  4BBR J;  2KP6 A;  1W36 D;  1KYZ A;  1P7J A;  2L9S A;  2RNG A;  5E8G A;  2XF5 A;  1DPU A;  3WE3 A;  4LD5 A;  2GA2 A;  2P81 A;  3H1C A;  1OR7 C;  2K40 A;  2WAQ N;  3MEX A;  4I02 A;  1XGN A;  3I3L A;  4BNC A;  3OYK A;  1YLF A;  5FO5 A;  3ONQ A;  3I55 I;  2CG4 A;  1W36 C;  1BL0 A;  1PP7 U;  5GAD J;  2NVY J;  2JZY A;  1FJL A;  1XMX A;  4OIN F;  1V4R A;  1HC8 A;  2GQQ A;  2DAO A;  3L2R A;  4KIB A;  1IC8 A;  3VWB A;  4LB5 A;  3M7G A;  3TED A;  5K5O A;  2LKP A;  4CHU A;  1QHG A;  2OF7 A;  6PAX A;  4HQM A;  5FRM A;  2H1K A;  1UB9 A;  1UHS A;  2EIK H;  3K10 A;  5HOO A;  2VI6 A;  3J7A Y;  2UZK A;  2R5Z A;  2NYX A;  2IA0 A;  4C2M J;  3F21 A;  4PUS A;  4HG2 A;  2GXA A;  4I01 A;  4RLQ A;  1RKT A;  1S29 A;  2NVT J;  1X1A A;  2PMH A;  2WBM A;  2BY1 A;  1YTY A;  3GTO J;  3AG1 H;  4GRI A;  1Z6R A;  2E34 A;  2A68 F;  1FEX A;  2DI3 A;  2MYS A;  2Y31 A;  3LA3 A;  1KZH A;  4E7S A;  3GYH X;  1RIO H;  2I5U A;  2KRH A;  1ZK8 A;  1ON1 A;  4ZJZ A;  1BR1 A;  5FLM J;  1SFO J;  1TNT A;  2DJI A;  4ABZ A;  1A31 A;  2LLK A;  2B63 J;  3PSF A;  1S7E A;  2WY7 Q;  4KUM A;  4IHV A;  2XKP A;  3EUH C;  3PUB A;  4YEL A;  3S14 J;  1MBK A;  2E60 A;  3GTM J;  3OYE A;  4L5E A;  1K4T A;  1UHM A;  2R7R A;  5HLI A;  2X1C A;  3SYT A;  2NS0 A;  4KT6 A;  2BVM A;  2ZBK A;  1YJ9 I;  4GFB A;  3MZ8 A;  3QWL A;  3S1Q J;  4ESF A;  2C6Y A;  2FBH A;  1IF1 A;  3FX3 A;  1EH7 A;  2VN2 A;  3QPL A;  1ETK A;  2KFD A;  3VEP A;  3WG7 H;  4ZYA A;  4PGH A;  1RZ4 A;  2BW3 B;  3G73 A;  1BR4 A;  2ZME C;  2VON A;  2CQN A;  5LGT A;  2HDW A;  1WJB A;  2JA6 J;  4RM2 A;  3SZG A;  3BTL A;  2MBF A;  3BZ6 A;  1T8I A;  3Q0V A;  2RAE A;  2RC4 A;  1DU6 A;  1FBQ A;  2GOX B;  4RS8 A;  4ZYH A;  1P6R A;  2ELH A;  4RB1 A;  5TGT A;  3I59 A;  5J4V A;  2K86 A;  2QEN A;  3H36 A;  2TCT A;  1ODD A;  5H6Q A;  4MIM A;  4ZH4 F;  1FT9 A;  1SVM A;  4NHJ A;  4J00 A;  2WA0 A;  1LDK B;  2BE5 F;  2CQ7 A;  3GWZ A;  3E6C C;  3QQA A;  4Y15 A;  1FBU A;  2KHM A;  2LBF B;  5JI6 A;  2UUZ A;  2LC2 A;  2D1V A;  1BA5 A;  1I6H J;  1Z3X A;  2ZXW H;  1BC8 C;  3ZQI A;  4E6K G;  2EPF A;  4PFP A;  1UEL B;  4BQA A;  3JRG A;  2FEZ A;  1D1B A;  3HRS A;  4P55 A;  5D4S A;  2NNY A;  3LAP A;  3RPU D;  3BJA A;  5K7Z A;  2ZO4 A;  4NQW B;  2ECC A;  4KDP A;  5FRO A;  1Y8Q B;  4RB3 C;  1OCZ H;  3RKQ A;  2BYV E;  1TL8 A;  2O61 A;  2JPC A;  1PUF B;  3P9I A;  1WKM A;  3RQI A;  2M4G A;  3JSP A;  3FKI J;  1SAU A;  3HDD A;  1Z6T A;  2E1O A;  3W6V A;  4KT5 C;  3IHU A;  3RCO A;  2KMU A;  3JTG A;  3GFI A;  3S15 J;  3VOE A;  3L2C A;  1GDT A;  5HDG A;  3DF8 A;  1Z91 A;  4L9N A;  3GLX A;  5KK1 A;  1GUU A;  2EWN A;  2JK3 A;  4H4K C;  4RM3 A;  3T8T A;  3GEZ A;  2L7Z A;  3WHC A;  4EJO A;  4BJT A;  1G2H A;  1RUN A;  4KIS A;  2V1U A;  5GTH C;  5D8K B;  3IAM 2;  4U87 A;  5F0C A;  2MW8 A;  2QQA A;  1MMN A;  3AL0 C;  2VBZ A;  4HDV A;  2JSC A;  4ANJ A;  4QLC U;  1S9H A;  1J0R A;  3SFI A;  2O8K A;  2N8G A;  2LF7 A;  2E1N A;  1M1E B;  2XGE A;  3ABU A;  1FOX A;  1F1Z A;  2FX0 A;  3CCU I;  1XG1 A;  2DTR A;  3FXJ A;  2ZB9 A;  1MNE A;  4HEA 2;  5EEG A;  3RDI A;  3CMA I;  2ZJP F;  5EEH A;  4E70 A;  4XSX F;  3R6S A;  2VT3 A;  3DBH B;  4FQG A;  3ABL H;  4KN7 X;  2M0C A;  1RR8 C;  3V8K A;  4YIF A;  2DA1 A;  2DT6 A;  3QAH A;  1YYV A;  3M8E A;  2R4G A;  4GYG A;  4Y13 A;  3GVA A;  1SEU A;  1I3Q J;  2QQ9 A;  2ZJQ F;  4IXA A;  1IZ1 A;  2J5P A;  2NS7 A;  2A6E F;  1K78 B;  5H6R A;  2BBY A;  3C18 A;  4OWR B;  3JRD A;  3LSH A;  2OCE A;  2M8G X;  3ZN1 A;  5LRS A;  1HW5 A;  2R7X A;  1N77 A;  4XRS G;  2LDU A;  3O6B B;  2V6E A;  4A3L J;  3CUO A;  1FZP B;  1R6R A;  1EH6 A;  2ZME B;  3G1O A;  1N78 A;  2R7D A;  2K3F A;  2HOA A;  4CO8 A;  5BPI A;  5LRR A;  2IPQ X;  3P9C A;  4M3E A;  2CW7 A;  1ZHF A;  2WWY A;  5CVR A;  2VAS A;  3HOV J;  3CD6 I;  1QBJ A;  3HEF A;  1X2N A;  3GFM A;  3EUK L;  2ZFW A;  5J8C A;  1VQO I;  5LGU A;  3HKZ A;  3LWF A;  4DZJ A;  4IHS A;  4AIJ A;  3PQJ A;  2BEO A;  1CF7 A;  1T98 A;  3RKY A;  4OMY A;  1FPQ A;  1LVK A;  2EZK A;  2R3S A;  2OA4 A;  3H3U A;  4ENN A;  5GPA A;  1XN7 A;  2EQR A;  2E2J J;  2W84 A;  2DPU A;  5HS8 A;  2L3D A;  2FMY A;  3WGH A;  1RKW A;  3FXQ A;  4AYB N;  1W5S A;  4A6D A;  5D5U B;  4KIT B;  1VFC A;  3KP6 A;  2WAF A;  3OYC A;  3R0A A;  1HSJ A;  1QRY A;  3DPL C;  3LFU A;  2W82 A;  2Z9O A;  1BI3 A;  2LNB A;  1U9N A;  1IGN A;  1LFB A;  1MKM A;  1HQC A;  3RKW A;  5BS6 A;  5DUI A;  4S05 A;  3WTW C;  2RRE A;  3MCZ A;  2A5Y B;  4IF4 A;  1XC5 A;  3WU1 B;  2XF6 A;  3L7W A;  1FYL A;  1IW7 F;  1RES A;  3HB9 A;  2YX4 A;  2XAH A;  2DOF A;  2IGK A;  3BP8 A;  3C3W A;  3BCB A;  1D1C A;  3ZOB A;  3LQR A;  4CCO A;  1IRF A;  3I53 A;  4ZDP A;  3DPU A;  2NOG A;  3CCY A;  5DD4 A;  1D1A A;  3N97 A;  2V6C A;  2JWT A;  2E5N A;  3V7S A;  4DW6 A;  2HI3 A;  5JLW A;  1QGP A;  1W0T A;  4A3K J;  2F5F A;  1IN5 A;  1VQN I;  1U5T B;  1XCV A;  3HHG A;  5M5W J;  1XGS A;  3QPH A;  3HOT A;  3ZQC A;  4IZZ A;  1QZZ A;  2MH9 A;  2HOT A;  1OKR A;  1YRN A;  1R71 A;  4IHX A;  3JCU C;  3S17 J;  4M3F A;  4DYC A;  4ZYG A;  1ZR2 A;  3ABM H;  2KJC A;  2DLL A;  4EJW A;  3BWG A;  5F1J A;  1V5G A;  4UVC A;  1RUO A;  2K3P A;  4YRV A;  2A05 A;  5IOY A;  3CZ6 A;  3PSI A;  4ZTJ A;  1PYV A;  1IN6 A;  1OIS A;  1WJD A;  3JRF A;  2O5R A;  2BY2 A;  5HLH A;  1K4S A;  5C4J J;  4BJ6 C;  2LOO A;  1WQ2 A;  2HZD A;  2K9N A;  3OYA A;  3V8J A;  4D5F A;  1GVD A;  3HOZ J;  1F43 A;  4KIF A;  5ED4 A;  1MDM B;  2MA3 A;  4M6Y A;  5TIS C;  5JVG F;  3O8H A;  1YS6 A;  1R5H A;  5HS9 A;  5D6E A;  1U5T A;  3DEW A;  2W85 A;  1TWA J;  1WJC A;  3A02 A;  5DD8 A;  4AM3 A;  1P4A A;  1QA6 A;  2X85 A;  3L1P A;  3K4N A;  2XSJ C;  1BJA A;  3DTE A;  2PLY A;  2PJR A;  2DOD A;  2F4O B;  4I09 A;  4C3J J;  5E3M A;  5J1R A;  1YJN I;  1VQP I;  4PJ0 C;  1LE8 A;  3GTL J;  4A3D J;  4S04 A;  2DO7 A;  4CYD A;  1EA3 A;  2V9P A;  3RJP A;  5IP7 J;  5B1A H;  3JTH A;  3IC7 A;  4FE7 A;  3I9V 2;  2JA2 A;  2CV1 A;  2EZI A;  2HDC A;  1R4M B;  4BXX J;  3L2Q A;  1RET A;  3OYM A;  1I39 A;  2M0M A;  2IT0 A;  2VL8 A;  3GO5 A;  1AU7 A;  3KZY A;  3H3V K;  2MG4 A;  2IS6 A;  3PFY A;  5L3B A;  2IXS A;  3CCS I;  3WGG A;  1ZG3 A;  1C0W A;  3DKY A;  1NG7 A;  3OSG A;  4M9S A;  2R5Z B;  3JRH A;  3HL2 A;  4CYC A;  2VC1 A;  5H20 A;  5DEQ A;  1R00 A;  3V42 A;  1O57 A;  4HW0 A;  3SEZ A;  1APL C;  1T0F C;  2OCC H;  5EZG A;  3DEU A;  1FTT A;  2XAJ A;  2BZT A;  3HGG A;  3MKW B;  3F8N A;  2DFE A;  4F91 B;  1FTZ A;  2M7B A;  3KP4 A;  4EV0 A;  4J01 A;  2XB5 A;  2DCE A;  4Y4R A;  1SD6 A;  2IP2 A;  2PMZ N;  3KFW X;  2DOA A;  3K9T A;  3NWS A;  3HOU J;  2LR8 A;  1CGP A;  5E3O A;  1FIA A;  5M3M J;  2MC4 A;  3CCR I;  3PNT A;  2YUS A;  1W7P B;  1WJE A;  2L54 A;  3TQN A;  2VBW A;  3KYC B;  1VTN C;  2FJ1 A;  4I99 C;  3R60 A;  2P7V B;  1JKP C;  2ETH A;  1MDM A;  1FC3 A;  2CV2 A;  2LY9 A;  1B72 B;  3ZR8 X;  2GXB A;  3CF5 F;  4BY7 J;  1HLV A;  1W5C C;  1XSX A;  4LMY A;  4KIC A;  2TDX A;  4E7J A;  1YFH A;  2LBF A;  2ZXH A;  5E20 A;  4AVZ A;  2R7F A;  2VB6 A;  3W3C A;  3ABT A;  3CMY A;  1N75 A;  3DBR B;  1WHU A;  1Z7L A;  3G6E I;  2FML A;  4CH7 A;  2IEK A;  2X48 A;  1O4X A;  2JVG A;  2HEO A;  4PK4 A;  4F93 B;  4K2E A;  2F5E A;  2EV0 A;  2WV1 A;  3DBL B;  2P5K A;  1HDD C;  2QSH X;  2X6O A;  4EQQ A;  1KYW A;  1Z05 A;  1ONV A;  1JHH A;  3OSF A;  1ITY A;  3HG9 A;  4QSH A;  3CME I;  2ID3 A;  1W7P D;  3C7J A;  3FKJ A;  4RAF A;  3TP0 A;  4LIT A;  2XAQ A;  4UV9 A;  5B1B H;  5J1Y A;  1TZL A;  5FKL A;  5K7H A;  2IAI A;  4BE2 A;  2I8D A;  3ZN0 A;  5JLX A;  2EIN H;  2G7U A;  4B1R A;  1VQ9 I;  3LSM A;  4DBQ A;  4IOA F;  4BU2 A;  5JVT A;  4NUB A;  1NK3 P;  1MGT A;  3KLN A;  5HNF A;  4OOI A;  4BBS J;  1FOW A;  4U88 A;  4ZYD A;  3GTK J;  2J5O A;  1D8K A;  2P8T A;  4U0Y A;  1D5Y A;  1W7P A;  1GV5 A;  5LEJ A;  2AQF A;  2L4A A;  3GLL A;  4IHY A;  1NG6 A;  3CUQ B;  4B44 A;  3SQN A;  3X2Q H;  3J81 K;  3H0G J;  4M73 A;  3GXO A;  4L18 B;  3OYN A;  5M3F J;  1Z3Y A;  2ZNZ A;  2EV5 A;  3HUG B;  4BGD A;  2KQR A;  5AON A;  3DP7 A;  3JW4 A;  2FRH A;  2IW5 A;  5F0F A;  4R1H A;  3SXY A;  3WTY C;  2NVX J;  3KE2 A;  4PCQ A;  1KON A;  4A3G J;  2XAG A;  1Y56 A;  2LF8 A;  2F6C A;  3TOA A;  1MW7 A;  1ZLJ A;  4XRS A;  1RR7 A;  3DQV C;  2VE9 A;  3LSP A;  4ESJ A;  1YJW I;  4IRI A;  1I5Z A;  3DEE A;  3WU2 C;  2E7X A;  1ZR4 A;  3LSJ A;  2M7A A;  1KGS A;  2R92 J;  2W00 A;  3KZI C;  2BV6 A;  3BJ6 A;  2O7O A;  1ZAO A;  1JKO C;  4CIC A;  3BY6 A;  4D5C A;  5GTI C;  4GCV A;  2PMZ A;  1S72 I;  2EV6 A;  1ZRC A;  3D5L A;  3CCE I;  2X6X A;  3S32 A;  4NQW A;  4ENJ A;  1D0Z A;  3GBG A;  1H89 C;  3BCA A;  2M4K A;  2CW0 F;  3F8C A;  3FMQ A;  3O2P E;  3HKZ N;  2BHZ A;  1PJR A;  2IA1 A;  2LKS A;  3SHF A;  1KQ8 A;  1OMI A;  2DQL A;  2HWV A;  4U0V A;  4O5V A;  2JA8 J;  1TTY A;  4JQF A;  4MEY F;  1ETY A;  2L5Q A;  1HST A;  3FXL A;  2Q2E B;  2DFF A;  3CJT B;  2X51 A;  3BPV A;  2COM A;  1SD4 A;  1NH3 A;  3IKT A;  1HBX G;  4I2O A;  2CQQ A;  2L02 A;  3MZY A;  3S16 J;  3E6B A;  1DPR A;  2EBI A;  1MJ9 A;  4B8X A;  2R5Y B;  2VPR A;  3CO6 C;  3HZJ A;  2X9D A;  2ZSH B;  4R79 A;  2XF7 A;  3HSF A;  4HA8 A;  2RDP A;  5EEA A;  4IOC F;  2XAF A;  3OYL A;  2E35 A;  1SFU A;  5K7F A;  3F72 A;  2PG4 A;  1TP4 A;  5J47 A;  3S3N A;  3HM5 A;  3VYR B;  5CVV A;  4XLE A;  5AIQ A;  4LJZ F;  5ICG A;  2MLG A;  4Q47 A;  4YII A;  1RNL A;  3E6D A;  4G7O F;  1D0Y A;  3WTT C;  3ZQL A;  3FIW A;  1JUS A;  4M72 A;  1ZAR A;  3WOD F;  3LNQ A;  4A3C J;  4QIW N;  1BIA A;  1XGM A;  3GW2 A;  2H27 A;  1VQ8 I;  3DCF A;  1G59 A;  2IBD A;  4Y3O A;  2QSF X;  5LBQ A;  1I6X A;  5TJJ A;  4WWC A;  1B59 A;  1YW8 A;  3H92 A;  2QA4 I;  5JR3 A;  2RKH A;  3CTA A;  2Y75 A;  2XRL A;  2XIG A;  1CQT A;  3DKW A;  2I10 A;  4W1U A;  1POG A;  2R5Y A;  2M34 A;  4PJN A;  2Q8K A;  1RC9 A;  2DOE A;  3FF5 A;  4A93 J;  1FOY A;  3AG4 H;  3GCM A;  4MTD A;  3S3M A;  2CGP A;  1FMW A;  2LMD A;  5GAG J;  1LDD A;  2KIM A;  4BYY A;  3WTZ A;  4CGZ A;  1OCT C;  3SDG A;  5IP6 A;  5FKO A;  3MFK A;  3PJR A;  1JXS A;  2XHK A;  3G2B A;  3M8J A;  1DUX C;  4HPQ A;  1Q1V A;  5JHF A;  1B8I A;  1V5F A;  2Y2Z A;  3GTG J;  2GM4 A;  4XK4 A;  2VJ5 A;  4XLC A;  3OS2 A;  3JSO A;  5D5W B;  3U9G A;  3T8R A;  5LEK A;  2D45 A;  2LG4 A;  3J7A O;  2FBK A;  2KZG A;  4F92 B;  1TBX A;  1WJ5 A;  5J4Y A;  4II3 A;  4B09 A;  2IA2 A;  4N9H A;  5HOD A;  1B72 A;  3FXM A;  3M07 A;  1FMV A;  4HF1 A;  3F3X A;  3FMS A;  4GGG A;  2FNP A;  1CF7 B;  2HXI A;  4AC0 A;  4QTR A;  2OTL I;  1P9Q C;  3OL3 A;  1G3S A;  3N05 A;  2Y0M A;  4OIR F;  2RVC A;  3E1S A;  2IS4 A;  1X19 A;  2O8X A;  1P2F A;  1MND A;  2FUG 2;  4ZC3 A;  1YO5 C;  4I98 B;  1L3L A;  3M4O J;  5CVU A;  1VI0 A;  1EV7 A;  1ZH5 A;  2LVS A;  5JFR A;  3FDY A;  1MBE A;  4BS9 A;  1P4W A;  1VQ4 I;  3FK7 A;  1HKS A;  2D1H A;  3FXU A;  4L5J A;  5FD6 A;  3ZP5 A;  5J6X A;  1QVT A;  2NAZ A;  1R22 A;  4I7H A;  2ZXI A;  4HNV A;  3FBN B;  5A2Q Z;  5LD2 C;  1E17 A;  1NTC A;  2UXN A;  4P9F A;  2DT5 A;  1LJ9 A;  3SZP A;  1S8N A;  1ZYR F;  2HQA A;  2HNH A;  1ZRE A;  3REO A;  1FSE A;  2DXI A;  4D0P A;  2E7W A;  3F8F A;  1IRX A;  2HDD A;  3S1N J;  4HYE A;  2VKV A;  5C3E J;  1FX7 A;  4BAC A;  1B4A A;  1BR2 A;  4ESB A;  3TGN A;  1F36 A;  2YU9 J;  3CMM A;  1IUF A;  1T08 B;  2XPV A;  1X3W B;  1IXS B;  4W97 A;  5DUK A;  3CUQ C;  2RV8 A;  1WRJ A;  4XLN F;  4CCN A;  2F4I A;  1T6S A;  3ZXS A;  3BR3 A;  2JUC A;  1Z7U A;  3GZN B;  5DDG A;  4ENK A;  1QHH D;  4EJT A;  3FXR A;  4TV7 A;  2EFW A;  2K4J A;  3IUO A;  4YFX F;  1B8I B;  2VOD A;  1MD0 A;  3GME A;  4FT8 A;  5LHG A;  2CFO A;  1OYY A;  2PN6 A;  2QM3 A;  4JK1 X;  1BI0 A;  1GVJ A;  3W6J B;  2GA1 A;  3K70 C;  2EFN A;  3QU3 A;  1STZ A;  5J1U A;  1XDU A;  1SFE A;  4UB6 C;  2CQK A;  4A12 A;  5FKM A;  2RQQ A;  3KX2 A;  3J81 Z;  2L9V A;  1ZEL A;  3HSE A;  1MMD A;  1K78 A;  2JTV A;  1OJL A;  4HQE A;  2M3A A;  3R61 A;  3K1N A;  2VKH A;  4P5O A;  4ZZL A;  4A3F J;  2GZW A;  3F8B A;  2V79 A;  2F5V A;  2VJJ A;  5LHI A;  3IWF A;  5ICC A;  4AWX B;  2P5V A;  1FY7 A;  2VT2 A;  4XOP A;  2LKX A;  4YG2 F;  4U7B A;  3F0C A;  3OYB A;  4Q48 A;  3QYE A;  3BT9 A;  3EPZ A;  1Y0N A;  3U2R A;  1TC3 C;  2G0E A;  4G7Z F;  5KHD A;  2V9V A;  2HU9 A;  2O0Y A;  2X0L A;  2TRT A;  5BPD A;  3WTX C;  2Y69 H;  4AIK A;  1UHW A;  1XPX A;  3K1P A;  1S5L C;  3OV8 A;  2ZNY A;  1P4X A;  1A6I A;  2X1D A;  3VPR A;  2XRN A;  2ZXJ A;  3H9Q A;  1G3T A;  3ESW B;  3KP3 A;  4MLO A;  5FJ8 J;  3OL4 A;  3F9K A;  2M1B A;  4PGG A;  1XTA A;  3ZQQ A;  1FYM A;  4UVB A;  3B6A A;  4HLY A;  3EYY A;  3W6K B;  5DTD A;  2ICW G;  4RBO A;  2VKE A;  1ACI A;  4P9U A;  1TLH B;  3PO2 J;  1AWC A;  1TT0 A;  1Z77 A;  4HLX A;  4E4H A;  1T39 A;  2EIJ H;  4L9T A;  3VYU B;  4BHC A;  2EJR A;  3NAR A;  2K7L A;  2DT7 B;  4PFO A;  2Z5U A;  3IKV A;  3VOD A;  1IN7 A;  2V7F A;  4LLN A;  2P4W A;  5FD5 A;  1KU9 A;  3A0H C;  1NK2 P;  4HOB A;  2HPM A;  1S7A A;  2CU7 A;  2NNN A;  3L2V A;  2ZJR F;  1HCR A;  3MWM A;  4X6A J;  1GXP A;  2LFB A;  3ZQG A;  5IOZ A;  2L0K A;  1SD5 A;  1KU7 A;  3ABK H;  3S8P A;  4XKB A;  3G1M A;  3CCJ I;  2HQ5 A;  3HGY A;  2EA2 A;  2FA5 A;  3QPT A;  3A03 A;  1RRJ A;  4C3H J;  4XKC A;  3LSI A;  1UG0 A;  1F4K A;  3CLO A;  2D5V A;  1UMQ A;  1OYI A;  3QYF A;  4Q5S F;  3WU0 A;  3RSN A;  1QNT A;  4FX0 A;  1LEA A;  2IGM A;  2PBI A;  2STW A;  3I64 A;  2VOP A;  4DJA A;  2LH9 A;  5E1X A;  5E8I A;  3ECO A;  2ZJ2 A;  5ILU A;  1G3Y A;  2E2H J;  1B6A A;  2Y9Z A;  2IVM A;  2DA5 A;  2LRE A;  4MHG A;  4FHT A;  4RGS A;  4F7Z A;  4RLF A;  3D5S C;  1QO0 D;  3I71 A;  4UB8 C;  3U21 A;  2F4M B;  1S6L A;  4U0W A;  4EAT A;  2IS1 A;  4XKV A;  3BTJ A;  1AKH A;  4KMF A;  1ULY A;  9ANT A;  1X4P A;  1JGG A;  4N4O B;  1HW1 A;  1W5T A;  1ZGW A;  1TQP A;  2RNJ A;  3I4N J;  4MQ9 F;  2F5C A;  1IV6 A;  1SMT A;  2PMU A;  3OYH A;  2P7C B;  2DU9 A;  2W24 A;  3FXO A;  3CDL A;  4CDG A;  3BG6 A;  1LB2 A;  5FGM A;  1A04 A;  1Y0U A;  2VQL A;  2VQG A;  4DQ2 A;  4MTE A;  1U6G A;  4EGZ A;  1DDN A;  4CSW A;  1MNM C;  5JHU A;  2RN7 A;  3KYD B;  3QU6 A;  1R1T A;  2WTE A;  1MBF A;  2K9L A;  3DXJ F;  3RYP A;  4IKF A;  1U2W A;  2JVH A;  3RQ4 A;  1HDP A;  3GFL A;  5FLV A;  1ZRD A;  2XSD C;  4G6T B;  2AQE A;  1E2X A;  4ITV A;  2MC3 A;  2CW8 A;  2AXT C;  4HV5 A;  4OU0 A;  2WAQ A;  3PL8 A;  2DFI A;  2ME6 A;  5B66 C;  4WCG A;  2HVR A;  2EIL H;  4XOR A;  1J9I A;  2K4B A;  3K4J A;  2JA5 J;  2JPB A;  2DDA A;  3OS0 A;  1PUE E;  3IH2 A;  1K6O A;  4L0Z B;  1G6N A;  2HKO A;  2L7M P;  4NC6 A;  4XRF A;  3BG7 A;  3TKY A;  3L09 A;  1X1D A;  2RGV A;  5HLT A;  3M3Y J;  3F8M A;  2HGC A;  4AYB A;  5KAI C;  1T0F A;  2CWE A;  2BXY A;  3BJO A;  3C2G A;  4AVP A;  5GAH J;  2DN0 A;  5FLX K;  3AFH A;  5J3L A;  2WY8 Q;  3Q0U A;  3Q9S A;  3E6M A;  4S0H B;  4MQV A;  5CVJ A;  4B4C A;  3LSG A;  1J09 A;  4EMS A;  1IG7 A;  1LVA A;  3HXL A;  4U7D A;  2XAU A;  3ZMS A;  4M3B A;  1WI3 A;  1MSF C;  2Z3Y A;  1B9M A;  3MKY B;  1IN4 A;  2XPU A;  2XV4 S;  2HVQ A;  1LDJ A;  4LLG F;  4KMU X;  1OPC A;  3K6G A;  3S93 A;  3TDU C;  2HYG D;  1O3T A;  2HYF A;  3MVP A;  3IL2 A;  2FE3 A;  2V1X A;  2PI0 A;  1R49 A;  1YHQ I;  1VQ7 I;  4R8H A;  1EJ9 A;  4DGW B;  4JX6 A;  4BEH B;  4XBF A;  4KIG A;  1IRZ A;  2A69 F;  2HZT A;  2Y48 A;  2VUM J;  5BQT A;  5HLG A;  1JTX A;  2XGD A;  3T1B A;  1XB4 A;  4BKX A;  2JMW A;  1Z67 A;  3RYR A;  3L2U A;  3V7R A;  2OZU A;  4AIH A;  4WXD A;  3UR3 C;  1IAW A;  1AOY A;  5CKT A;  2EH3 A;  3DLA A;  5DV5 A;  4AD9 A;  5EDN A;  4BE1 A;  2X6W A;  4WX9 A;  1LNW A;  3ZMU A;  5F64 A;  1WZ2 A;  1KQ9 A;  1ZG1 A;  3PM1 A;  4A0Y A;  3CCL I;  3HRT A;  2EFO A;  3A2K A;  3CP8 A;  4EGY A;  3KET A;  2CUE A;  3ZGK A;  3H0D A;  2V9K A;  4M6X A;  2R7S A;  3G71 I;  4M9Z A;  2DYS H;  4AID A;  1TWF J;  4NB5 A;  1D5V A;  3I5U A;  4B3A A;  1WVR A;  1JUP A;  2HKX A;  2L9N A;  4A0Z A;  1YX3 A;  5CQE A;  3RIR A;  1DP3 A;  3Q0W A;  1QVU A;  4RAZ A;  2MLK A;  1FIP A;  3PIO F;  2BXZ A;  2O3F A;  2R7V A;  2YPR A;  4P1W A;  2LTP A;  2E1C A;  2KIF A;  3E5Q A;  2QYO A;  2DMN A;  2FBI A;  3BTC A;  4UUS A;  1UST A;  1K79 A;  3VB2 A;  2R7U A;  1DGR M;  1MIJ A;  2QKM B;  3COA C;  2KRF A;  3HC7 A;  1ETX A;  2O9L A;  4BH9 A;  4DNC A;  3K2A A;  1U0J A;  4ETS A;  1GHC A;  2QZ8 A;  5BOX A;  4C2T A;  1DQU A;  4X1E A;  4CCM A;  4DZP A;  3ZMT A;  3JRI A;  1I1S A;  3F22 A;  2B7E A;  2W4S A;  1DP7 P;  3K69 A;  3R4K A;  3GX4 X;  2HQN A;  1OQY A;  2BY0 A;  5IYC J;  3CCV I;  4IHT A;  1JUM A;  3EDP A;  5EZH A;  4XL9 A;  3FIS A;  1SMY F;  1WWX A;  1MBH A;  2CO5 A;  3KZZ A;  3PNV A;  4L9J A;  3S1R J;  2IGN A;  1Q1H A;  1R4N B;  4N4N B;  2VBY A;  2X1E A;  5EG0 A;  4HRI A;  4WXH A;  3TO6 A;  5D5V B;  3OMY A;  1OYW A;  1LQ1 A;  4B43 A;  2VOO A;  2AHQ A;  4MFD A;  5CLS A;  1JKQ C;  1ZTR A;  2LYC A;  2CRG A;  2L9R A;  3OYF A;  2ESN A;  3I4M J;  2GXG A;  2ME0 A;  3OR1 C;  2Z33 A;  2MGQ A;  2OV7 A;  4E7Z A;  1KQ0 A;  4BHP A;  2XVC A;  1E3H A;  2EZL A;  3KP5 A;  2YX7 A;  4LK0 F;  1FLI A;  2Y0S A;  1J7K A;  2E36 A;  4BL0 B;  3DKX A;  3I59 B;  3UKG A;  3FBI B;  2EB7 A;  3P5J A;  1YIT I;  3OR2 C;  4FET A;  4N9I A;  5CVI A;  3M9A A;  3B73 A;  4BHB A;  4FE4 A;  3ZQ7 A;  1UG2 A;  4A3I J;  3GUD A;  3BC8 A;  2HOE A;  4YFN F;  1WI9 A;  2ADU A;  4JP0 A;  3WTV C;  1R23 A;  4UUV A;  2HOS A;  1JHF A;  3OIO A;  5B5E C;  4HX4 A;  3HOW J;  2FD5 A;  1R5G A;  3MKZ A;  2COB A;  2DBB A;  4E7I A;  1WGX A;  1XGO A;  5FRN A;  1HKT A;  1LE8 B;  4LG3 A;  3LQQ A;  4Z2Y A;  4OIO F;  3T5X A;  1V5E A;  3NRV A;  2G7H A;  4IRG A;  2KIU A;  1UFM A;  2DFH A;  2FQ3 A;  1X2M A;  4IJA A;  2FOK A;  2E5Z A;  3BTI A;  4AUX A;  1H8A C;  1HF0 A;  4BY1 J;  4FTH A;  2ACJ A;  1QQI A;  4D7M A;  1ZN2 A;  4OIP F;  1FSH A;  2AO9 A;  1ZG5 A;  3BLY A;  3BR0 A;  3V8L A;  4EEF G;  1VZ0 A;  5J40 A;  1MMA A;  1Z0X A;  4OAZ A;  1Y6I A;  3HJE A;  3M1E A;  4FX4 A;  4GDF A;  1W1W E;  3CQZ J;  2LSO A;  5F1R A;  2KKO A;  3HHH A;  3LOC A;  2YU3 A;  4G12 A;  2QLZ A;  5A2Q K;  1ZQ3 P;  4DOZ A;  2UWM A;  4XLH A;  3NEU A;  2NRA C;  3G1L A;  2BGC A;  4F3Q A;  1BM9 A;  1IUY A;  1TWH J;  1XCB A;  2W7N A;  3K2Z A;  1S3J A;  5CPR B;  4EJU A;  1WSU A;  3CDH A;  4D9J A;  1X4O A;  1ENH A;  4LG0 B;  4XLF A;  2KRC A;  2K9M A;  3FM5 A;  5LHH A;  3BR6 A;  1WH5 A;  5F27 A;  1MSE C;  2KDZ A;  4M6V A;  5ILS A;  3GZ6 A;  3H9J A;  2KL4 A;  1UAA A;  3LL7 A;  1BIB A;  2WB1 A;  2PJR B;  3CDI A;  1A6Q A;  1B9N A;  2B0L A;  3E97 A;  2HTJ A;  3RPU A;  2H8W A;  3MKL A;  5E3L A;  3S2H J;  1UZC A;  2E71 A;  2XGC A;  2H8R A;  3O3K A;  4IX7 A;  2DQR A;  3BDD A;  2QQB A;  2M87 A;  2CMP A;  2EFQ A;  2XB0 X;  2PJP A;  3CO7 C;  4UHT A;  3GTJ J;  3GZ5 A;  2UXX A;  3BR1 A;  4LIU A;  4C9Y A;  2CQX A;  1ETO A;  1O7L A;  3V7C A;  4KJZ A;  2LD5 A;  1TQI A;  3PO3 J;  2NXN B;  4FAS D;  1LPQ A;  5F6F A;  5GPC A;  3U1K A;  4O3M A;  2BHY A;  1H9T A;  1K7A A;  5EGO A;  5IT9 Z;  1FP2 A;  3OOU A;  3ECH A;  1OCP A;  4XN3 A;  3SDB A;  4Z6Y A;  5HVQ C;  4RMN A;  2MD5 A;  2QKL B;  2CUF A;  3HTU A;  4MO7 A;  1PUF A;  1SD7 A;  1YG2 A;  4LGW A;  1OCR H;  1V55 H;  2CS3 A;  4JYK A;  4G7H F;  1VF9 A;  5GAE J;  1QPM A;  2V26 A;  1YE9 A;  2EA4 A;  4A5M A;  3OYJ A;  3K7A J;  4NC7 A;  1REP C;  2F48 A;  3CUQ A;  3D1N I;  1U3E M;  3HIF A;  1G3W A;  2ELJ A;  5E3N A;  4XID A;  4BEH A;  2OAZ A;  4A3E J;  3TO9 A;  5FKK A;  1X1B A;  5TRD A;  2A5W A;  3W2A A;  2XDV A;  3C2H A;  2FU4 A;  2EFP A;  2HTS A;  2XAS A;  3V4G A;  1GT0 C;  2VE8 A;  3BG9 A;  1E3O C;  2P5L C;  1YIO A;  2H1L A;  4G9Y A;  3SJM A;  2E2I J;  1G4D A;  4ZDO A;  1WJA A;  1XSD A;  1WFX A;  2HQR A;  3H5N A;  2DMU A;  1ON2 A;  3FHZ A;  2AXL A;  2NOJ B;  2GLO A;  2ISZ A;  3I4P A;  1V3F A;  2WAE A;  3G4S I;  1FNN A;  5KNL A;  2RQP A;  2GBY A;  2KDO A;  2XPW A;  3C2B A;  1D0X A;  2K5C A;  4HV6 A;  1D8J A;  1BC7 C;  3BG3 A;  3WG9 A;  4XQF A;  4RB0 A;  4B47 A;  4DYQ A;  2JRM A;  1BBY A;  1R1V A;  2V1D A;  1VQL I;  2HS5 A;  5HNH A;  2K85 A;  1ZRF A;  1R9T J;  1MBG A;  1ETW A;  3WHB A;  3GF2 A;  3S3O A;  4PSW A;  1LUJ B;  1YW9 A;  4NC8 A;  3PFI A;  3GTQ J;  1XMA A;  3ELK A;  2CUJ A;  2DMT A;  1I50 J;  5DYM A;  3H9G A;  1E0E A;  1OCO H;  3J80 K;  2Q0O A;  3VYT B;  1S7O A;  3BR5 A;  1X1C A;  1T33 A;  2CSO A;  2FF4 A;  2VQH A;  5KVR A;  3UNG C;  3KIO A;  4CZZ A;  4HBL A;  4XKW A;  3NAU A;  4M3G A;  3CF2 A;  2WB1 N;  5E79 C;  4UVA A;  2OQG A;  2OUM A;  3K4M A;  1BOB A;  3OOP A;  4V2G A;  1N25 A;  4BQQ A;  2L01 A;  3A01 A;  2ZFU A;  1JTY A;  2LP0 A;  2QGU A;  3OYG A;  1Z21 A;  3F23 A;  4RA2 A;  5L3G A;  5LGN A;  1BW6 A;  1H9G A;  5D8L B;  2FNA A;  3OIP A;  4XON A;  5HS7 A;  2L4M A;  2F2E A;  4BQN A;  3SEQ A;  5FB2 A;  1FBS A;  4XRM A;  2MH2 A;  1R5I D;  3T0Y A;  3E3V A;  4IPA A;  4BQO A;  3W2W A;  3FM3 A;  3VYS B;  3ZRG A;  4BDZ A;  5EF6 A;  5E17 F;  4WK8 F;  2VKD A;  3BQY A;  4HX8 A;  4D7N A;  2JSP A;  1A5J A;  1HOM A;  1SVL A;  5L3C A;  3D5R C;  3L9F A;  4JBA A;  1MBJ A;  1GV2 A;  3EQL F;  1YQA A;  3WTS C;  3MZH A;  3CP2 A;  4NBQ A;  2VXD A;  1QU3 A;  2K9Q A;  3RI4 A;  1MH4 A;  2XC7 A;  2OD5 A;  3U1D A;  5FLX Z;  4HNU A;  4IVN A;  3OY9 A;  5DCF A;  3I0T A;  1G8X A;  2VC0 A;  4A6E A;  4YFK F;  3QOD A;  3R0J A;  3CLQ A;  4WXC A;  3IWZ A;  1FWZ A;  3O8G A;  4QPO A;  2PQ8 A;  4EM0 B;  3AG2 H;  1K61 A;  2YR2 A;  2P6S A;  2O6G E;  3EYI A;  1VND A;  4HX7 A;  1A36 A;  4IL6 C;  3IRQ A;  3CC2 I;  1J59 A;  5FFZ A;  1QZE A;  4FIS A;  4HST A;  3W2V A;  2KLO A;  1GXQ A;  2A61 A;  5B3S H;  5L3E A;  2M2E A;  3M1C A;  1YOV B;  1XX5 A;  2QQ8 A;  4L0Y B;  4UV8 A;  2P0W A;  2ZSI B;  1WCM J;  3RZD J;  1PVE A;  3DTI A;  4LLL A;  1W0U A;  5D5X B;  5D4R A;  5F04 A;  2FOW A;  2OZ6 A;  3RKX A;  4J19 A;  4KA4 A;  3QOP A;  4XLP F;  1TWC J;  1IJW C;  1SFX A;  2ZME A;  2PX9 A;  3GTP J;  1W4M A;  2QBY B;  2ID6 A;  1MMG A;  2Z1D A;  3ZQF A;  2UV1 A;  4GO1 A;  1IDY A;  1BN5 A;  5E1W A;  1YIJ I;  3KPH A;  4XN0 A;  1IN8 A;  2JN6 A;  3BZK A;  3QP5 A;  3L00 A;  2H09 A;  5F08 A;  3HRU A;  1R36 A;  3MD2 A;  1YS7 A;  2VLA A;  1Z9C A;  2F5D A;  2Z99 A;  3LST A;  3H5A A;  1IXR C;  3P7N A;  3PNY A;  2QCO A;  4A3J J;  3JRE A;  2CUZ A;  5IY5 H;  3ZPL A;  3B02 A;  4IHW A;  2R7Z J;  4BJ5 C;  2HPI A;  4RAY A;  4DYR A;  1T38 A;  4A3B J;  3IP4 B;  3B6C A;  2FQ4 A;  2FSW A;  4CYC B;  3DPT A;  1T56 A;  4BXU A;  4HZF A;  3PUF A;  2OU2 A;  2OQR A;  4IO9 F;  3CJQ B;  1MH3 A;  4RGU A;  2BOL A;  2GIV A;  4XR6 A;  2QBY A;  2YS9 A;  3QOE A;  3TDZ C;  3VDX A;  2PEX A;  2Q1Z B;  4I0B A;  5DS9 A;  1AKH B;  5KCM A;  3KP7 A;  1BI1 A;  4A2U A;  3WE2 A;  1X1P A;  5EGO B;  4C2U A;  5ERI A;  3MQ0 A;  1IXC A;  2NVQ J;  1OCC H;  4RAG A;  3IV5 A;  4MNU A;  4XMY A;  4V2F A;  4A5N A;  2JT1 A;  2XGX A;  3AG3 H;  3IH3 A;  1IDZ A;  2L2O A;  3A1Y A;  3EUA A;  2R7O A;  1EF4 A;  3PIP F;  1A35 A;  1ZKG A;  4I76 A;  2XUB A;  3RTR A;  5IYB J;  3HOS A;  4HF2 A;  5M5Y J;  2STT A;  4IRH A;  1Y8R B;  2VBX A;  1YW7 A;  1L0O C;  2E1M B;  3M8F A;  2JQ7 A;  2YSR A;  1O3Q A;  1WJF A;  4XNF A;  4EVI A;  3BQZ A;  3ML6 A;  5IP9 J;  1U78 A;  4FCY A;  5DM6 F;  2H94 A;  3DU6 A;  4BXF A;  3PQK A;  4HDU A;  4DIQ A;  1O3S A;  1QZY A;  4ENM A;  3ASN H;  1MZB A;  4Y7N J;  4BDY A;  1HA8 A;  3VSL A;  2KZV A;  3OYD A;  1JGS A;  1IRG A;  5LFA A;  2OJE D;  2MFZ A;  2R7T A;  2R7W A;  1MMS A;  1P7I A;  1ZGJ A;  3ULQ B;  4PJJ A;  1TW2 A;  1I1G A;  3HTS B;  1SVO A;  3K70 D;  3J7Z I;  3JAM K;  3I56 I;  3TW6 A;  3HPG A;  3CCQ I;  2Y0S N;  3OYI A;  1R58 A;  3S2D J;  1RPW A;  4C30 A;  3LA2 A;  2X4H A;  4EM1 A;  1JJ8 C;  1BJZ A;  3SFZ A;  4YEJ A;  5C44 J;  1U9O A;  4MFE A;  2LRD A;  2VJ4 A;  2EZH A;  3H5R A;  3L2W A;  1KU2 A;  1I27 A;  3CC4 I;  2NS8 A;  1SFK A;  2XKO A;  2HVS A;  3ZCO A;  4KN4 X;  3FXK A;  1AA7 A;  1F9N A;  2Y9Y A;  4CCK A;  1X3U A;  1DU0 A;  2DDB A;  3J7Y J;  2E1M C;  3ZMZ A;  1Z1D A;  2DK5 A;  3A4C A;  5L3D A;  1U8B A;  2K02 A;  3S2W A;  1R1U A;  4DBR A;  3J80 Z;  1PDN C;  1J2X A;  2OPT A;  2LK2 A;  4PDK A;  3HYI A;  4N0B A;  5CJ9 A;  1JJ6 C;  4KFC A;  4L9V A;  2LY1 A;  4G6D A;  4LG0 A;  5F0H A;  3K4K A;  4RGR A;  2A07 F;  5IYD J;  4CUG A;  3FWE A;  2CV0 A;  4AU7 A;  1TT5 B;  4HAM A;  5IPA A;  3TBI A;  1Y39 A;  1Y1V J;  3HUG A;  3KEO A;  4RGX A;  4LOC A;  3QRF F;  2K9S A;  2LY2 A;  1R7J A;  3Q3S A;  1VQM I;  4OAY A;  3ISP A;  2VQC A;  3C1D A;  4ASN A;  3LSR A;  4XM3 A;  5ILV A;  3ASO H;  3NWT A;  3ROU A;  5L3F A;  3LAJ A;  5ICE A;  2OC6 A;  1OLT A;  4UNO A;  3TO7 A;  1OR7 A;  2A3S A;  3MAJ A;  2DA3 A;  4ZYE A;  3TL4 X;  2D2W A;  3BZC A;  1JE8 A;  2QWW A;  4I6Z A;  5K5R A;  3KLO A;  2DYR H;  3RPQ A;  4XLA A;  4MEX F;  3DV8 A;  2CH0 A;  4X0G A;  2HXO A;  2CJJ A;  2GOM A;  3KEQ A;  1ETV A;  1E3P A;  1RI7 A;  3BOQ A;  3I58 A;  4XSZ F;  1LEB A;  3HBL A;  3OWT A;  5EG0 B;  3MN2 A;  4A3M J;  4G6Q A;  5CQG A;  2L7F P;  1B1B A;  3KYL A;  3K4C A;  1XDS A;  1JT0 A;  3JAM Z;  3E0J B;  5EJC A;  1HW2 A;  4M9X A;  3P9K A;  2K27 A;  3BPX A;  2DMQ A;  4A69 C;  3AKZ A;  4M74 A;  1UJ8 A;  2DA2 A;  1ETQ A;  4Y52 J;  2H6C A;  2M5W A;  2OBP A;  1FOK A;  2WC2 A;  4MGR A;  5DCM B;  5E18 F;  4UXN A;  5DCM A;  2MSY A;  2W25 A;  1AHD P;  4WF2 A;  2HR3 A;  3NQO A;  1JT6 A;  3IRR A;  1Y1W J;  4NNJ A;  2IJL A;  5DM7 F;  1VQK I;  4KNY A;  5GP9 A;  4PSX A;  3VFZ A;  1MJB A;  3RZO J;  1BW5 A;  3JRC A;  4HSR A;  4I0A A;  5LLQ A;  3FHN A;  1VQ5 I;  2BVL A;  3F6V A;  4PJL A;  2DW4 A;  2IGO A;  3EUH A;  2NVU B;  1F5T A;  1U5T C;  5IT3 A;  3CC7 I;  4UY8 I;  2JA7 J;  2Z2S B;  2MAB A;  2M8E A;  4BUP A;  3TP3 A;  3OIQ A;  2ZKZ A;  1VQ6 I;  1DGW Y;  2IS2 A;  1WPK A;  1TNS A;  3FZV A;  4HF0 A;  4XIC A;  1MJA A;  2M30 A;  4E7L A;  2OTJ I;  3MMY B;  4QPQ A;  1EH8 A;  2L7K A;  3QPS A;  1IV8 A;  4ZTF A;  2Z16 A;  2DTZ A;  3H35 A;  2QEX I;  3ZMD A;  3KEY A;  4B48 A;  3WGI A;  2G9W A;  4JX4 A;  4E7K A;  3VSK A;  3TMO A;  1V54 H;  4M71 A; 
#chains in the Genus database with same CATH homology
 5IT9 K;  2WV0 A;  4L5I A;  1PP8 F;  3HRM A;  3LA7 A;  4GYI A;  5K5Q A;  4OIQ F;  4CXF A;  2HFH A;  2QUF A;  1XD7 A;  2FXA A;  4QWQ A;  2JRT A;  1J5Y A;  2CYY A;  3K1M A;  2ZCW A;  5BMZ A;  4RB2 C;  2ISY A;  4G94 A;  1KU3 A;  3K0L A;  3KCC A;  3D0S A;  4P96 A;  5HDK A;  2AS5 F;  4GXO A;  4ZZD A;  2GAU A;  5J8F A;  1HXD A;  2GWR A;  3ERE D;  1O3R A;  2CFX A;  2EK5 A;  5AIP A;  4BAY A;  5ICF A;  2O03 A;  3G3Z A;  3CJN A;  4LK1 F;  5D6F A;  4H0E A;  1D3Y A;  1FYK A;  3F6O A;  1XMK A;  1BI2 A;  1T2K A;  2P6T A;  5E1Z B;  4EM2 A;  4LFU A;  2PFB A;  3E5U A;  2KJB A;  3N4M A;  3E5X A;  1ZLK A;  3HSR A;  2A6H F;  3Q5F A;  4O6J A;  5CYV A;  1TQM A;  2IRF G;  1NHA A;  1KA8 A;  2XRO A;  1J75 A;  5FFX A;  5HDN A;  3H3Z A;  1XSV A;  1BOA A;  1UCR A;  3QP6 A;  3LFK A;  1P92 A;  4Y17 A;  3SZT A;  2H6B A;  3I54 A;  4KYW A;  2M45 A;  3ZMV A;  1SAX A;  4LB6 B;  3GFJ A;  2DPD A;  1H0M A;  3AAF A;  2DK8 A;  3WTU C;  1HKQ A;  3BRO A;  1ZGA A;  4A0X A;  2W57 A;  3EET A;  1FP1 D;  3DFG A;  3Q9V A;  2VXZ A;  4ON0 A;  3FMR A;  4PZJ A;  1U8R A;  3TOB A;  4OMZ A;  4G8X A;  1O7F A;  2ESH A;  5K1Y A;  4EJV A;  3KP2 A;  2Q2E A;  1USS A;  4Q4Z F;  1TW3 A;  2QVO A;  1KYZ A;  5E8G A;  1DPU A;  3WE3 A;  4LD5 A;  2GA2 A;  3MEX A;  4I02 A;  1XGN A;  4BNC A;  1YLF A;  5FO5 A;  2CG4 A;  1PP7 U;  2JZY A;  4OIN F;  1V4R A;  2GQQ A;  2DAO A;  4KIB A;  4LB5 A;  3M7G A;  5K5O A;  2LKP A;  4CHU A;  6PAX A;  4HQM A;  1UB9 A;  5HOO A;  2UZK A;  2NYX A;  2IA0 A;  3F21 A;  4I01 A;  1S29 A;  1YTY A;  2PMH A;  1Z6R A;  2A68 F;  2DI3 A;  3LA3 A;  3GYH X;  1RIO H;  1ON1 A;  1TNT A;  4KUM A;  2XKP A;  1UHM A;  5HLI A;  2NS0 A;  2ZBK A;  4ESF A;  2C6Y A;  2FBH A;  1IF1 A;  3FX3 A;  1EH7 A;  2VN2 A;  3VEP A;  4PGH A;  1RZ4 A;  3G73 A;  2VON A;  5LGT A;  2MBF A;  3BZ6 A;  2RC4 A;  1FBQ A;  4RS8 A;  4ZYH A;  1P6R A;  2ELH A;  4RB1 A;  3I59 A;  2K86 A;  2QEN A;  1ODD A;  5H6Q A;  4ZH4 F;  1FT9 A;  4NHJ A;  1LDK B;  2BE5 F;  3GWZ A;  3E6C C;  4Y15 A;  1FBU A;  5JI6 A;  2D1V A;  1BC8 C;  4BQA A;  2FEZ A;  3HRS A;  4P55 A;  2NNY A;  5D4S A;  3LAP A;  3BJA A;  2ZO4 A;  4KDP A;  4RB3 C;  2BYV E;  2O61 A;  2JPC A;  3P9I A;  1WKM A;  3JSP A;  1Z6T A;  4KT5 C;  3JTG A;  3GFI A;  3IHU A;  3VOE A;  3L2C A;  5HDG A;  3DF8 A;  1Z91 A;  4L9N A;  3GLX A;  5KK1 A;  2EWN A;  3T8T A;  4EJO A;  3GEZ A;  1RUN A;  2V1U A;  5D8K B;  2QQA A;  2VBZ A;  4HDV A;  2JSC A;  4QLC U;  1J0R A;  2LF7 A;  2E1N A;  3ABU A;  1F1Z A;  2DTR A;  5EEG A;  3RDI A;  5EEH A;  4E70 A;  4XSX F;  3R6S A;  2VT3 A;  4KN7 X;  3V8K A;  4YIF A;  3QAH A;  1YYV A;  3M8E A;  4GYG A;  4Y13 A;  3GVA A;  2QQ9 A;  4IXA A;  1IZ1 A;  2J5P A;  2A6E F;  1K78 B;  5H6R A;  2BBY A;  3C18 A;  5LRS A;  3ZN1 A;  1HW5 A;  2LDU A;  3O6B B;  3CUO A;  1FZP B;  1EH6 A;  2ZME B;  2R7D A;  4CO8 A;  5BPI A;  5LRR A;  2IPQ X;  3P9C A;  1ZHF A;  2WWY A;  5CVR A;  1QBJ A;  3GFM A;  2ZFW A;  5J8C A;  5LGU A;  3LWF A;  4IHS A;  4AIJ A;  3PQJ A;  2BEO A;  1CF7 A;  1T98 A;  3RKY A;  4OMY A;  1FPQ A;  2R3S A;  2OA4 A;  3H3U A;  4ENN A;  1XN7 A;  2W84 A;  2DPU A;  5HS8 A;  2L3D A;  2FMY A;  3WGH A;  3FXQ A;  1W5S A;  4A6D A;  5D5U B;  3KP6 A;  3R0A A;  1HSJ A;  3DPL C;  2Z9O A;  1BI3 A;  2LNB A;  1MKM A;  1HQC A;  3RKW A;  5BS6 A;  4S05 A;  3WTW C;  5DUI A;  3MCZ A;  2A5Y B;  4IF4 A;  3WU1 B;  3L7W A;  1FYL A;  1IW7 F;  2YX4 A;  2XAH A;  3BP8 A;  3C3W A;  3LQR A;  1IRF A;  3I53 A;  5DD4 A;  3N97 A;  2V6C A;  3V7S A;  1QGP A;  2F5F A;  1IN5 A;  1U5T B;  1XCV A;  3HHG A;  1XGS A;  3QPH A;  3HOT A;  1QZZ A;  2MH9 A;  1OKR A;  4ZYG A;  2KJC A;  2DLL A;  4EJW A;  3BWG A;  4UVC A;  1RUO A;  1IN6 A;  5HLH A;  1WQ2 A;  3V8J A;  4KIF A;  5ED4 A;  1MDM B;  2MA3 A;  4M6Y A;  1YS6 A;  1R5H A;  5HS9 A;  5D6E A;  1U5T A;  2W85 A;  5DD8 A;  1P4A A;  1BJA A;  2PLY A;  4I09 A;  4S04 A;  2DO7 A;  4CYD A;  3RJP A;  3JTH A;  3IC7 A;  2HDC A;  2IT0 A;  3GO5 A;  3KZY A;  5L3B A;  3WGG A;  1ZG3 A;  1C0W A;  4M9S A;  2VC1 A;  5H20 A;  5DEQ A;  1R00 A;  1O57 A;  4HW0 A;  3DEU A;  2XAJ A;  3F8N A;  3KP4 A;  4EV0 A;  1SD6 A;  2IP2 A;  3KFW X;  3K9T A;  1CGP A;  1W7P B;  2L54 A;  3TQN A;  2VBW A;  1VTN C;  3R60 A;  2P7V B;  2ETH A;  1MDM A;  1FC3 A;  2GXB A;  1XSX A;  4LMY A;  4KIC A;  2TDX A;  1YFH A;  5E20 A;  2R7F A;  3ABT A;  2FML A;  2HEO A;  4K2E A;  2F5E A;  2EV0 A;  2P5K A;  4EQQ A;  1KYW A;  1Z05 A;  1ONV A;  1JHH A;  1W7P D;  3C7J A;  2XAQ A;  4UV9 A;  3ZN0 A;  2G7U A;  5JVT A;  1MGT A;  3KLN A;  4OOI A;  4U88 A;  4ZYD A;  2J5O A;  1D8K A;  2P8T A;  4U0Y A;  1W7P A;  5LEJ A;  2L4A A;  3CUQ B;  3SQN A;  3J81 K;  4M73 A;  3GXO A;  4L18 B;  2ZNZ A;  2EV5 A;  5AON A;  3DP7 A;  3JW4 A;  2FRH A;  2IW5 A;  4R1H A;  3SXY A;  3WTY C;  3KE2 A;  4PCQ A;  2XAG A;  2LF8 A;  3TOA A;  1ZLJ A;  3DQV C;  2VE9 A;  4ESJ A;  4IRI A;  1I5Z A;  2E7X A;  1KGS A;  2BV6 A;  3BJ6 A;  1ZAO A;  4CIC A;  3BY6 A;  4GCV A;  2EV6 A;  1ZRC A;  3D5L A;  4NQW A;  4ENJ A;  2CW0 F;  3F8C A;  3FMQ A;  3O2P E;  2IA1 A;  3SHF A;  1KQ8 A;  1OMI A;  2DQL A;  2HWV A;  4U0V A;  4O5V A;  1TTY A;  4JQF A;  4MEY F;  1HST A;  3BPV A;  2COM A;  1SD4 A;  3IKT A;  1HBX G;  4I2O A;  2L02 A;  3MZY A;  3E6B A;  1DPR A;  4B8X A;  1MJ9 A;  3CO6 C;  4R79 A;  3HSF A;  4HA8 A;  2RDP A;  2XAF A;  1SFU A;  3F72 A;  2PG4 A;  5CVV A;  5AIQ A;  4LJZ F;  5ICG A;  2MLG A;  4Q47 A;  4YII A;  1RNL A;  3E6D A;  4G7O F;  3WTT C;  4M72 A;  1ZAR A;  3WOD F;  1BIA A;  1XGM A;  3GW2 A;  2H27 A;  5LBQ A;  1I6X A;  5TJJ A;  4WWC A;  1B59 A;  1YW8 A;  3H92 A;  5JR3 A;  2RKH A;  3CTA A;  2Y75 A;  2XIG A;  3DKW A;  2Q8K A;  3FF5 A;  4MTD A;  2CGP A;  1LDD A;  2KIM A;  4BYY A;  3WTZ A;  4CGZ A;  1JXS A;  3MFK A;  2XHK A;  1DUX C;  3JSO A;  5D5W B;  3U9G A;  3T8R A;  5LEK A;  2D45 A;  3J7A O;  2FBK A;  1TBX A;  4B09 A;  2IA2 A;  4N9H A;  4HF1 A;  3F3X A;  1CF7 B;  3FMS A;  2FNP A;  4GGG A;  4OIR F;  1G3S A;  2Y0M A;  2RVC A;  2O8X A;  1P2F A;  1YO5 C;  4I98 B;  1L3L A;  5CVU A;  1EV7 A;  1ZH5 A;  5JFR A;  1P4W A;  1HKS A;  2D1H A;  3FXU A;  4L5J A;  5FD6 A;  3ZP5 A;  5J6X A;  2NAZ A;  1R22 A;  4I7H A;  5A2Q Z;  1E17 A;  2UXN A;  4P9F A;  2DT5 A;  1LJ9 A;  3SZP A;  1S8N A;  1ZYR F;  1ZRE A;  3REO A;  1FSE A;  4D0P A;  2E7W A;  3F8F A;  4HYE A;  1FX7 A;  1B4A A;  4ESB A;  3TGN A;  1IXS B;  5DUK A;  3CUQ C;  2RV8 A;  1WRJ A;  4XLN F;  1T6S A;  1Z7U A;  5DDG A;  4ENK A;  4EJT A;  3FXR A;  4TV7 A;  2EFW A;  2K4J A;  4YFX F;  2VOD A;  1MD0 A;  4FT8 A;  5LHG A;  1OYY A;  2PN6 A;  2QM3 A;  4JK1 X;  1BI0 A;  1GVJ A;  3W6J B;  2GA1 A;  2EFN A;  3QU3 A;  1STZ A;  1XDU A;  1SFE A;  2CQK A;  4A12 A;  3J81 Z;  3HSE A;  1K78 A;  2JTV A;  4HQE A;  3R61 A;  3K1N A;  4P5O A;  4ZZL A;  2GZW A;  3F8B A;  2V79 A;  5LHI A;  3IWF A;  5ICC A;  4AWX B;  2P5V A;  1FY7 A;  2VT2 A;  4YG2 F;  4U7B A;  4Q48 A;  3U2R A;  4G7Z F;  2V9V A;  2O0Y A;  2X0L A;  5BPD A;  3WTX C;  4AIK A;  1UHW A;  3K1P A;  3OV8 A;  2ZNY A;  1P4X A;  2XRN A;  2ZXJ A;  1G3T A;  3KP3 A;  2M1B A;  4PGG A;  1FYM A;  4UVB A;  4HLY A;  3EYY A;  3W6K B;  4P9U A;  1TLH B;  1AWC A;  4HLX A;  1T39 A;  4L9T A;  4BHC A;  2EJR A;  2K7L A;  2Z5U A;  3IKV A;  3VOD A;  1IN7 A;  4LLN A;  2P4W A;  5FD5 A;  1KU9 A;  4HOB A;  1S7A A;  2NNN A;  3MWM A;  1GXP A;  1SD5 A;  1KU7 A;  2EA2 A;  2FA5 A;  3QPT A;  1F4K A;  3CLO A;  1OYI A;  4Q5S F;  3WU0 A;  1QNT A;  4FX0 A;  1LEA A;  2PBI A;  2STW A;  2VOP A;  3I64 A;  5E1X A;  5E8I A;  3ECO A;  2ZJ2 A;  5ILU A;  1G3Y A;  1B6A A;  2IVM A;  4MHG A;  4FHT A;  4RGS A;  4F7Z A;  1QO0 D;  3I71 A;  1S6L A;  4U0W A;  4KMF A;  1ULY A;  1HW1 A;  1W5T A;  1TQP A;  2RNJ A;  4MQ9 F;  2F5C A;  1SMT A;  2PMU A;  2P7C B;  2DU9 A;  2W24 A;  4CDG A;  1LB2 A;  5FGM A;  1A04 A;  1Y0U A;  4DQ2 A;  4MTE A;  1U6G A;  4EGZ A;  1DDN A;  5JHU A;  2RN7 A;  3QU6 A;  1R1T A;  2WTE A;  3DXJ F;  3RYP A;  1U2W A;  3GFL A;  1ZRD A;  1E2X A;  2MC3 A;  4HV5 A;  4OU0 A;  2DFI A;  4WCG A;  1J9I A;  2K4B A;  2JPB A;  1PUE E;  1K6O A;  4L0Z B;  1G6N A;  2HKO A;  4XRF A;  3TKY A;  3L09 A;  2RGV A;  3F8M A;  2HGC A;  1T0F A;  2CWE A;  3BJO A;  4AVP A;  5FLX K;  3Q9S A;  3E6M A;  4MQV A;  5CVJ A;  4EMS A;  1LVA A;  4U7D A;  3ZMS A;  2Z3Y A;  1B9M A;  1IN4 A;  2XV4 S;  1LDJ A;  4LLG F;  4KMU X;  1OPC A;  3TDU C;  1O3T A;  2HYG D;  2HYF A;  3IL2 A;  2FE3 A;  2V1X A;  2PI0 A;  4R8H A;  4XBF A;  4KIG A;  2A69 F;  2HZT A;  2Y48 A;  5BQT A;  5HLG A;  3T1B A;  1XB4 A;  3RYR A;  3V7R A;  2OZU A;  4AIH A;  4WXD A;  1IAW A;  1AOY A;  5DV5 A;  4AD9 A;  4WX9 A;  1LNW A;  3ZMU A;  5F64 A;  1KQ9 A;  1ZG1 A;  4A0Y A;  3HRT A;  2EFO A;  4EGY A;  3KET A;  4M6X A;  4M9Z A;  4NB5 A;  1D5V A;  3I5U A;  4A0Z A;  2HKX A;  3RIR A;  4RAZ A;  2MLK A;  2O3F A;  2YPR A;  2E1C A;  2KIF A;  3E5Q A;  2QYO A;  2FBI A;  1UST A;  1K79 A;  3VB2 A;  3COA C;  2KRF A;  4BH9 A;  4DNC A;  4ETS A;  1GHC A;  2QZ8 A;  5BOX A;  1I1S A;  3ZMT A;  3F22 A;  1DP7 P;  3K69 A;  3R4K A;  3GX4 X;  2HQN A;  4IHT A;  3EDP A;  1SMY F;  1WWX A;  2CO5 A;  3KZZ A;  4L9J A;  1Q1H A;  2VBY A;  4WXH A;  3TO6 A;  5D5V B;  1OYW A;  1LQ1 A;  2VOO A;  5CLS A;  2ESN A;  2GXG A;  2Z33 A;  1KQ0 A;  4BHP A;  2XVC A;  3KP5 A;  2YX7 A;  4LK0 F;  1FLI A;  1J7K A;  3I59 B;  2EB7 A;  4N9I A;  5CVI A;  3M9A A;  3B73 A;  4BHB A;  3ZQ7 A;  3GUD A;  2HOE A;  4YFN F;  1WI9 A;  2ADU A;  3WTV C;  1R23 A;  4UUV A;  1JHF A;  4HX4 A;  1R5G A;  2DBB A;  1XGO A;  1HKT A;  3LQQ A;  4OIO F;  4Z2Y A;  3T5X A;  3NRV A;  2G7H A;  4IRG A;  2KIU A;  1UFM A;  2FQ3 A;  4IJA A;  2FOK A;  2ACJ A;  1QQI A;  1ZN2 A;  4OIP F;  1FSH A;  1ZG5 A;  3V8L A;  3M1E A;  4FX4 A;  2LSO A;  5F1R A;  2KKO A;  3HHH A;  2YU3 A;  2QLZ A;  5A2Q K;  2UWM A;  3NEU A;  2NRA C;  2BGC A;  1IUY A;  1BM9 A;  1XCB A;  3K2Z A;  1S3J A;  4EJU A;  1WSU A;  3CDH A;  4LG0 B;  3FM5 A;  5LHH A;  5ILS A;  3GZ6 A;  1BIB A;  1B9N A;  2B0L A;  3E97 A;  2HTJ A;  3RPU A;  3O3K A;  2DQR A;  3BDD A;  2QQB A;  2M87 A;  2EFQ A;  2PJP A;  3CO7 C;  4UHT A;  3GZ5 A;  2UXX A;  1O7L A;  3V7C A;  1TQI A;  5F6F A;  4O3M A;  1H9T A;  1K7A A;  5IT9 Z;  1FP2 A;  3ECH A;  5HVQ C;  2MD5 A;  3HTU A;  1SD7 A;  1YG2 A;  4LGW A;  4G7H F;  1QPM A;  2EA4 A;  4A5M A;  1REP C;  3CUQ A;  1U3E M;  3HIF A;  1G3W A;  2OAZ A;  3TO9 A;  5TRD A;  2FU4 A;  2EFP A;  2HTS A;  2XAS A;  3V4G A;  2VE8 A;  2P5L C;  1YIO A;  4G9Y A;  1G4D A;  1XSD A;  2HQR A;  1ON2 A;  3FHZ A;  2AXL A;  2ISZ A;  3I4P A;  1V3F A;  1FNN A;  2RQP A;  4HV6 A;  1D8J A;  1BC7 C;  3WG9 A;  4RB0 A;  1BBY A;  1R1V A;  2V1D A;  2HS5 A;  1ZRF A;  3GF2 A;  1YW9 A;  3PFI A;  1XMA A;  3ELK A;  5DYM A;  3J80 K;  2Q0O A;  1S7O A;  2CSO A;  2FF4 A;  5KVR A;  4CZZ A;  4HBL A;  4UVA A;  2OQG A;  3OOP A;  2L01 A;  3F23 A;  5L3G A;  5LGN A;  1H9G A;  5D8L B;  2FNA A;  5HS7 A;  2L4M A;  2F2E A;  5FB2 A;  1FBS A;  2MH2 A;  3T0Y A;  3E3V A;  4IPA A;  3FM3 A;  5E17 F;  4WK8 F;  4HX8 A;  5L3C A;  4JBA A;  3L9F A;  3EQL F;  1YQA A;  3WTS C;  3MZH A;  3RI4 A;  2OD5 A;  3U1D A;  5FLX Z;  4IVN A;  5DCF A;  3I0T A;  2VC0 A;  4A6E A;  4YFK F;  3R0J A;  4WXC A;  3IWZ A;  1FWZ A;  4EM0 B;  2PQ8 A;  2YR2 A;  2P6S A;  2O6G E;  3EYI A;  4HX7 A;  3IRQ A;  1J59 A;  5FFZ A;  1GXQ A;  2A61 A;  5L3E A;  4L0Y B;  4UV8 A;  4LLL A;  5D5X B;  5D4R A;  3RKX A;  2OZ6 A;  4KA4 A;  3QOP A;  4XLP F;  1SFX A;  2ZME A;  1W4M A;  2QBY B;  4GO1 A;  1BN5 A;  5E1W A;  1IN8 A;  3QP5 A;  3L00 A;  2H09 A;  3HRU A;  1R36 A;  1YS7 A;  1Z9C A;  2F5D A;  2Z99 A;  3LST A;  1IXR C;  3P7N A;  3ZPL A;  3B02 A;  4RAY A;  1T38 A;  2FSW A;  3DPT A;  4BXU A;  4HZF A;  2OU2 A;  2OQR A;  4RGU A;  2GIV A;  2QBY A;  3TDZ C;  2PEX A;  4I0B A;  3KP7 A;  1BI1 A;  4A2U A;  3WE2 A;  5ERI A;  3MQ0 A;  1IXC A;  4MNU A;  4A5N A;  2JT1 A;  2XGX A;  2XUB A;  3RTR A;  3HOS A;  4HF2 A;  2STT A;  4IRH A;  2VBX A;  1YW7 A;  1L0O C;  3M8F A;  2YSR A;  1O3Q A;  4EVI A;  3ML6 A;  1U78 A;  2H94 A;  3PQK A;  4HDU A;  1O3S A;  1QZY A;  4ENM A;  1MZB A;  1JGS A;  1IRG A;  1ZGJ A;  3ULQ B;  1TW2 A;  1I1G A;  3HTS B;  3JAM K;  1R58 A;  3LA2 A;  2X4H A;  4EM1 A;  3SFZ A;  1KU2 A;  1I27 A;  2XKO A;  4KN4 X;  1F9N A;  1X3U A;  3ZMZ A;  1Z1D A;  2DK5 A;  5L3D A;  2K02 A;  3S2W A;  1R1U A;  1PDN C;  3J80 Z;  1J2X A;  4PDK A;  3HYI A;  4N0B A;  5CJ9 A;  4KFC A;  4L9V A;  4G6D A;  4LG0 A;  4RGR A;  2A07 F;  3FWE A;  4HAM A;  3HUG A;  3KEO A;  4RGX A;  3QRF F;  1R7J A;  3ISP A;  4ASN A;  3C1D A;  5ILV A;  3ROU A;  5L3F A;  3LAJ A;  5ICE A;  4UNO A;  3TO7 A;  1OR7 A;  2A3S A;  3MAJ A;  4ZYE A;  2D2W A;  1JE8 A;  2QWW A;  5K5R A;  3KLO A;  3RPQ A;  4MEX F;  3DV8 A;  3KEQ A;  1RI7 A;  3BOQ A;  3I58 A;  4XSZ F;  1LEB A;  4G6Q A;  1B1B A;  1XDS A;  3JAM Z;  1HW2 A;  4M9X A;  3P9K A;  2K27 A;  3BPX A;  4M74 A;  2H6C A;  1FOK A;  2M5W A;  2OBP A;  2WC2 A;  4MGR A;  5DCM B;  5E18 F;  4UXN A;  5DCM A;  2W25 A;  4WF2 A;  2HR3 A;  3NQO A;  3IRR A;  2IJL A;  4KNY A;  3VFZ A;  1MJB A;  4I0A A;  5LLQ A;  3F6V A;  2DW4 A;  3EUH A;  1F5T A;  1U5T C;  5IT3 A;  2M8E A;  2ZKZ A;  1TNS A;  3FZV A;  4HF0 A;  1MJA A;  2M30 A;  1EH8 A;  3ZMD A;  3WGI A;  2G9W A;  4M71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...