1R1TA

Crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor smtB
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transcription repressor
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1tA00
5ICCA 2RQPA 1IZ1A 4NHJA 4QLCU 4AVPA 3NEUA 5HDKA 3EYIA 3KP6A 5CLSA 1SAXA 5CJ9A 1LVAA 3JAMK 3C7JA 4OIOF 2XKOA 1F9NA 4XSXF 1FP2A 2FA5A 4KDPA 4XSZF 1UB9A 3E5XA 4MNUA 3ULQB 2ZJ2A 1YIOA 4U0WA 2DFIA 1W5TA 4ESFA 1TQMA 4M74A 4LLNA 2JRTA 4GGGA 4I02A 3F72A 4CYDA 1K78B 3ECHA 5E8IA 3TOAA 2HFHA 3JSPA 1LQ1A 4EGZA 1T6SA 3R0AA 5LBQA 2DK8A 1B9MA 1O3RA 4S04A 4IPAA 4HF2A 2DQLA 1R22A 3K0LA 5CVRA 1O3TA 2PFBA 3RIRA 4IRIA 1IRGA 4EVIA 1OYWA 1BOAA 1HSTA 2EA2A 4L0YB 4A0XA 3P9KA 3ZPLA 4RGRA 4R1HA 4RB2C 2X0LA 1R7JA 1DPUA 2H94A 4UV9A 1BN5A 2OAZA 4JBAA 4NB5A 3KLOA 3F3XA 3HSRA 1MJBA 2O3FA 5L3DA 4RB1A 3N97A 3C18A 2EV6A 3CTAA 5CVUA 4EM1A 5LEKA 1FBQA 2XHKA 3ELKA 1QO0D 5LHHA 1VTNC 3FM3A 1JGSA 5ICGA 3FM5A 5IT3A 2IA1A 1S29A 2KJCA 1J75A 4EJTA 2L01A 4RB3C 5KK1A 3I53A 4UV8A 2HOEA 2XAGA 1GHCA 4O5VA 4WXDA 5JVTA 2VE9A 3I59A 1RZ4A 2QBYA 3R6SA 2PQ8A 2BV6A 3ZMVA 3RPUA 1HKSA 4YIFA 3F8NA 1UHWA 1CF7A 2PN6A 2K4BA 3RPQA 4MEYF 3ZMZA 5JI6A 2HQRA 4RS8A 1ZARA 3M8FA 1WKMA 5LRSA 1B4AA 4I0AA 3ZMTA 2JZYA 1TNSA 1DP7P 1P6RA 3ISPA 5LGNA 2OBPA 3KLNA 1HW2A 3E6BA 1ZLKA 5F6FA 4HV5A 4Y15A 2QYOA 1D8JA 3V8JA 1FSEA 3JSOA 2O6GE 2HTJA 1BC8C 1USTA 1KQ8A 3GX4X 3WGGA 3KETA 3V8LA 4MEXF 1IAWA 2FMLA 1P4AA 4ZH4F 2D2WA 1QQIA 2K02A 3PFIA 5FFXA 1FP1D 3F8CA 4Q47A 4GYGA 1U78A 2D45A 2A68F 1J7KA 4XRFA 1P92A 1BBYA 1D8KA 2HTSA 5TRDA 3V7CA 1CGPA 3WE3A 3FZVA 3RYPA 2YU3A 4EJVA 2IP2A 2ZNZA 4HOBA 1UCRA 4AIHA 1O57A 2O0YA 1FLIA 2HWVA 3COAC 4KYWA 3FF5A 5JR3A 3U1DA 3RKYA 5CVIA 4M9XA 3E5UA 2E7XA 2YX7A 5FLXK 5D5WB 3KZZA 4A6DA 1U5TC 2A5YB 2A69F 1FY7A 4HF0A 2VBYA 1G3SA 1LDJA 2QQBA 3ZN1A 2LF8A 4Q48A 4GYIA 4HX8A 4KA4A 3GW2A 2Z9OA 3F8FA 3IHUA 2VOOA 2LSOA 2UXNA 1L3LA 3HUGA 4ESBA 1IN5A 1HSJA 1QZYA 2DAOA 3JTHA 2Z3YA 5J8CA 2DBBA 5FD5A 5H6QA 3BWGA 3Q5FA 1BI1A 4G6DA 4ZYHA 3DQVC 4IXAA 1T39A 1ZRDA 1JXSA 2L4MA 5JHUA 5HLGA 5FGMA 3HTUA 4A5NA 2IA2A 4OIRF 4L0ZB 1ON1A 3CUQA 1F1ZA 4M9SA 3MAJA 1TW3A 1I27A 2XKPA 4HZFA 2KRFA 2AS5F 4P96A 4N9HA 3IC7A 5D6EA 2KIFA 2P7CB 1UFMA 1J2XA 4PGHA 2D1VA 2YSRA 5E18F 2HEOA 4AIKA 4PCQA 3DXJF 4AD9A 4EV0A 3QPTA 1OKRA 3GEZA 4R79A 3D0SA 4CICA 2KIMA 2PG4A 1ZN2A 4EJUA 4AIJA 1HW1A 2D1HA 2MLKA 2G7HA 1LJ9A 2BBYA 2F5CA 3RDIA 2ZNYA 5LRRA 1F4KA 1W7PA 5BQTA 3QP5A 1SMYF 1TTYA 2JPBA 3BJOA 5E8GA 1MDMA 1PP8F 1RUNA 3DPLC 1PUEE 4FX0A 2XUBA 3WTVC 3LQRA 1JHFA 3E6MA 2IRFG 2DQRA 1FNNA 1Z05A 4MTEA 5E1WA 1S7OA 2L54A 3K1NA 1XGNA 5DCFA 5ILVA 4MGRA 1GXQA 1U6GA 4TV7A 1FZPB 3I0TA 3BPVA 1I5ZA 1BC7C 2JPCA 3MCZA 1B9NA 1YYVA 2CSOA 3R0JA 2DPDA 5HDNA 2EFOA 4JQFA 4EMSA 1D3YA 2BE5F 2G9WA 1HBXG 2IPQX 4B8XA 4EM2A 5IT9Z 2A3SA 4BHCA 3FMSA 2K4JA 4KMFA 4O6JA 2GIVA 2XASA 1KGSA 3J80Z 4I01A 3L7WA 4ENKA 1LDKB 3I5UA 2ISYA 2QZ8A 3RYRA 4RGUA 2V1UA 1IRFA 1BM9A 2MH2A 2RDPA 2RV8A 1YO5C 1EV7A 5CVVA 3N4MA 1KA8A 3IRRA 2PLYA 3ZP5A 3GUDA 3FWEA 1TW2A 1TBXA 4HBLA 3IKVA 2Z99A 3QRFF 1EH7A 1HQCA 3B73A 2W24A 1XN7A 2Z33A 3BDDA 4A0ZA 3R60A 2R7FA 3SQNA 3V7RA 1S7AA 4L9JA 5DUKA 3RI4A 4OU0A 4G7ZF 1H9TA 4FHTA 2A6EF 2FRHA 3ROUA 2DW4A 4Z2YA 5BPIA 3GO5A 1Z6TA 3RJPA 1G3WA 3KP7A 5E1XA 1A04A 1IW7F 3T1BA 5DD4A 2VODA 2XAHA 2ZFWA 1K78A 2P6SA 1QPMA 3EQLF 4HQMA 2J5OA 2FXAA 4E70A 2GWRA 1ZYRF 4ETSA 1AOYA 2MBFA 2GZWA 3F6VA 5CYVA 5FB2A 5A2QK 4KUMA 2OD5A 4I98B 3I54A 3MEXA 5HS8A 1NHAA 4UVCA 5BPDA 4NQWA 3V8KA 3KP2A 2MC3A 2HGCA 3WODF 2VT3A 3C1DA 1ON2A 4MTDA 1BI2A 4ZZLA 1XB4A 4OINF 4Y13A 4G8XA 1IF1A 1TQIA 3DF8A 4BHBA 4IRHA 4U7DA 1XSDA 4ZZDA 1Z1DA 2WTEA 2NNYA 4A12A 2UWMA 1LB2A 3WTYC 1BIAA 5DD8A 4BYYA 3O6BB 3I71A 3G73A 2Y0MA 4M72A 4HX7A 2H09A 3K2ZA 2QVOA 3SXYA 5D5XB 3TGNA 4A6EA 3ZN0A 1OYYA 1SMTA 3O3KA 1B1BA 2Q8KA 1MJAA 3CO6C 2HYGD 2JT1A 3E5QA 1F5TA 3KP5A 4RGSA 4DNCA 3MWMA 4S05A 2L4AA 4ESJA 4UNOA 3F22A 4EQQA 3J81Z 2F2EA 3GF2A 2XROA 4HV6A 4RAYA 3AAFA 4ZYGA 3WTXC 4N0BA 3CUQC 1BIBA 3HRUA 2ZCWA 1FWZA 1KU3A 4UUVA 1ZG5A 1STZA 2OZUA 2ISZA 3WTTC 1ZHFA 5F64A 4IF4A 2CW0F 1KQ0A 2MH9A 3T8RA 5E20A 2GAUA 3RKXA 1Z7UA 1T98A 4I7HA 2K7LA 1XDSA 5ILSA 5L3FA 4LB6B 1BI3A 2RVCA 2IW5A 4UVAA 2ADUA 1IN8A 3JTGA 3CLOA 1R58A 2HYFA 2Z5UA 3HIFA 3OV8A 1K6OA 3DP7A 3KP4A 2O8XA 1ZGJA 5HVQC 2OZ6A 2PBIA 1KYWA 4ASNA 2VE8A 2HKOA 2L02A 3MZHA 2M87A 2VOPA 4MQ9F 2PMHA 2CO5A 1ZH5A 1KU9A 3RTRA 3KCCA 3JAMZ 4N9IA 5F1RA 3VEPA 2NAZA 1R1UA 4KN4X 4PGGA 4ENMA 3KFWX 2QLZA 1I1SA 3FX3A 3WGHA 1G6NA 3P9IA 3C3WA 3GFMA 2WWYA 3O2PE 4PDKA 1LEBA 1RUOA 2QUFA 4KICA 2RGVA 1ZG3A 2VBWA 1IN4A 2DPUA 2NYXA 2F5DA 5E1ZB 3CJNA 2LF7A 3ZQ7A 1YG2A 2O03A 1RNLA 3VFZA 4YFKF 2YR2A 2FBKA 3G3ZA 1Z91A 3VOEA 5DYMA 3FXRA 3LA3A 3W6JB 1P4WA 1SD4A 3ZMDA 2K27A 4WWCA 3IWFA 5J8FA 4LK0F 2O61A 3HHHA 4L5JA 2VXZA 2RKHA 3WTWC 3ABTA 2NRAC 1Z6RA 5L3EA 4YIIA 4FT8A 1YS7A 2CQKA 4RGXA 2VBZA 5D8KB 5H20A 4KNYA 1FPQA 2KIUA 4BH9A 3E6CC 2XAQA 2A6HF 3K69A 2FNAA 1IUYA 5EEGA 3FXUA 2TDXA 3OOPA 2FOKA 3GYHX 2XRNA 1UHMA 3SZPA 5EEHA 1LNWA 4OMYA 3BY6A 3GWZA 3EETA 2MD5A 2M8EA 1HXDA 2DLLA 2EWNA 4AWXB 1WRJA 4HA8A 1T0FA 4LFUA 3WTUC 1QNTA 2GXGA 4LD5A 1B59A 2RC4A 5D8LB 4KIBA 3LAPA 1YTYA 4LLLA 1U3EM 4GO1A 3ZMSA 1C0WA 1XMKA 3QAHA 4H0EA 2PMUA 3VB2A 4HQEA 4WCGA 1GXPA 3HYIA 2ACJA 4G7HF 2VBXA 1MJ9A 3R61A 5JFRA 3WG9A 2RNJA 2XVCA 1BI0A 3DV8A 3WGIA 1G3YA 3TDZC 4RAZA 4KIFA 3B02A 2HZTA 3T0YA 2HS5A 2Y75A 2ZMEB 1OR7A 2IA0A 2DK5A 1G4DA 1V3FA 2BYVE 2R7DA 5ICEA 1XDUA 2W84A 2EV0A 2IT0A 2BEOA 1W4MA 3U2RA 1U8RA 5DDGA 3EYYA 2CYYA 3E3VA 1J0RA 4IVNA 3TDUC 1W5SA 3R4KA 4YFNF 4A2UA 2OA4A 1PP7U 5J6XA 2CG4A 4ENNA 3IWZA 2P8TA 3MQ0A 4HX4A 2X4HA 3HTSB 3GFLA 3GFIA 5K1YA 2QQAA 1V4RA 2PEXA 1J59A 4KMUX 1O7LA 1I6XA 1R23A 2HKXA 4XLPF 4CXFA 2FNPA 1XCBA 4ZYDA 4A0YA 5FLXZ 3V4GA 3P7NA 4L18B 3P9CA 4U0YA 5D6FA 5K5OA 1J5YA 2F5EA 2OU2A 2LKPA 1IXSB 1SD7A 1XGSA 2Q0OA 4QWQA 3F21A 2UZKA 2QM3A 1TQPA 1YS6A 5TJJA 1DDNA 4IRGA 3PQJA 5HLHA 1ZRCA 3SFZA 4LG0B 1RI7A 1R36A 2ZKZA 1ZREA 2ZBKA 2FSWA 3I64A 1Z9CA 1IN6A 1E17A 1USSA 3BOQA 1I1GA 1FX7A 1T2KA 2P6TA 1FBSA 1FYMA 1Q1HA 3TO9A 2P5VA 2CGPA 1WI9A 3K1MA 4L9NA 4HLXA 4I0BA 4KFCA 2L3DA 2P5LC 3BJ6A 4PZJA 3FHZA 1U5TB 6PAXA 4DQ2A 5D4RA 3I4PA 3LAJA 1MD0A 3K1PA 5L3BA 3I58A 3BPXA 1KU7A 4M6XA 5AIQA 4U88A 1LEAA 3HRSA 3LSTA 2EFNA 3M9AA 5ERIA 2Y48A 5DCMB 5KVRA 3E97A 3ERED 1R5HA 3VODA 5HS7A 2HDCA 1W7PD 2WV0A 3L09A 3ML6A 4Y17A 3F8BA 1H0MA 5DEQA 3CDHA 3SHFA 3T8TA 4HLYA 5DUIA 3WU0A 3SZTA 3F6OA 5H6RA 2F5FA 4KIGA 1HKTA 2P7VB 2H6BA 1H9GA 3LQQA 4G6QA 4WXCA 4M71A 4BXUA 2M1BA 1MZBA 4O3MA 4KN7X 2GA2A 4WF2A 3DFGA 1MKMA 3T5XA 2MLGA 2QWWA 4CHUA 4GCVA 1L0OC 5L3CA 2E1NA 1TLHB 3LA7A 1ONVA 1LDDA 3H3UA 2FU4A 2EJRA 2GXBA 1XGOA 1R1TA 3KEQA 2ZXJA 3NQOA 5HDGA 1XSXA 4OOIA 4IJAA 2JSCA 1R00A 4P5OA 3HOTA 3L9FA 5DV5A 2M5WA 2EA4A 2LNBA 1J9IA 1S8NA 4UHTA 4A5MA 3LWFA 5FD6A 3BZ6A 5LGTA 4BQAA 1XMAA 3LFKA 4MHGA 3BJAA 2J5PA 1ZGAA 1OYIA 2M30A 2FEZA 1OMIA 1S3JA 1ZRFA 4ENJA 3BP8A 1ULYA 3WTSC 3MZYA 2EFQA 2PJPA 1WQ2A 4U7BA 4M6YA 3W6KB 2KKOA 3KP3A 4EGYA 2E1CA 4Q5SF 1YW9A 2YX4A 3FMRA 5CVJA 3I59B 2ETHA 2QBYB 2UXXA 1SFXA 4JK1X 3REOA 2DT5A 4P55A 1FYKA 5BMZA 4B09A 1ZG1A 3IL2A 1CF7B 3GLXA 2HQNA 2IJLA 1SFUA 1MGTA 2A61A 3FXQA 4HF1A 1QBJA 3QP6A 3DPTA 2ESHA 1P2FA 4ZYEA 1KU2A 2GA1A 4LMYA 1SD6A 2VONA 5D5UB 5A2QZ 4EJOA 4IHSA 3Q9SA 4ON0A 4P9UA 3U9GA 3GZ6A 4Q4ZF 1K7AA 4EJWA 2COMA 1E2XA 1OPCA 3F23A 4M73A 1DPRA 1X3UA 3MFKA 1SD5A 4XBFA 1FT9A 3GVAA 4G94A 2E7WA 2PI0A 5K5RA 5ILUA 2FQ3A 4CGZA 1IN7A 2FBHA 2LDUA 2OQRA 4MQVA 5D5VB 2A07F 4L5IA 2ELHA 4I2OA 4RB0A 2M45A 1FC3A 4CO8A 1R5GA 3NRVA 3EDPA 3E6DA 4UXNA 4OMZA 2DU9A 3TKYA 5LHIA 2EV5A 1QZZA 3DKWA 1P4XA 3M1EA 5LEJA 3J7AO 2FBIA 2QQ9A 4HYEA 2WC2A 3QOPA 2FF4A 3CO7C 2XV4S 2DI3A 4R8HA 3KZYA 3RKWA 2EFPA 1G3TA 3WTZA 2NS0A 4HW0A 2R3SA 3HRMA 4M9ZA 5IT9K 3M7GA 2XAJA 1YW8A 3K9TA 2C6YA 2EB7A 3WU1B 1R1VA 2JTVA 4FX4A 4HAMA 3GXOA 3Q9VA 5D4SA 3J80K 1AWCA 1D5VA 2K86A 4UVBA 4CZZA 4BAYA 2BGCA 4I09A 5K5QA 3HSFA 1O3QA 1ODDA 4P9FA 4CDGA 4LLGF 1S6LA 1TNTA 1XGMA 3HRTA 2DTRA 2ZMEA 4WX9A 1O3SA 1ZAOA 4OIQF 4LJZF 3QU6A 3QPHA 2VC1A 2W57A 4IHTA 1XD7A 1K79A 5ICFA 2V6CA 3HHGA 2FMYA 2P5KA 4YFXF 5E17F 5LHGA 4WK8F 3IKTA 3ABUA 3D5LA 5HOOA 3WE2A 4BHPA 3CUQB 3F8MA 1QGPA 3H3ZA 1Y0UA 3TO7A 3JW4A 1YW7A 4YG2F 4BNCA 4XLNF 4LGWA 4WXHA 1HW5A 2HR3A 2STWA 2NNNA 2V1DA 5AIPA 2G7UA 3IRQA 2RN7A 4LB5A 5L3GA 4D0PA 1FSHA 5BS6A 1RIOH 2H6CA 1IXRC 5HLIA 2XGXA 2B0LA 3KEOA 5BOXA 3ECOA 1EH8A 1IXCA 2VC0A 2YPRA 3V7SA 5LGUA 3HOSA 3TO6A 5FO5A 2OQGA 3M8EA 1W7PB 4KT5C 2V9VA 2V1XA 2DO7A 2EFWA 3FMQA 4L9TA 2Q2EA 1MDMB 4GXOA 2ESNA 1U2WA 2GQQA 1JE8A 2ZO4A 2MA3A 5HS9A 2IVMA 3QU3A 3KE2A 1PDNC 2XAFA 4G9YA 4LG0A 1B6AA 1FYLA 2AXLA 2V79A 1GVJA 1EH6A 1WSUA 1SFEA 5FFZA 1FOKA 1YLFA 1FBUA 1ZLJA 2VT2A 1JHHA 3CUOA 3TOBA 1T38A 4HDVA 3J81K 2CWEA 1HKQA 2QENA 2FE3A 1XCVA 4U0VA 4G7OF 2EK5A 1BJAA 4EM0B 2W25A 3EUHA 4L9VA 2XIGA 1YFHA 3DEUA 1O7FA 1KQ9A 3HSEA 1KYZA 1U5TA 3L00A 3S2WA 1XSVA 2W85A 2VN2A 3BROA 3GFJA 2P4WA 3ZMUA 3TQNA 4OIPF 5LLQA 3PQKA 4LK1F 2STTA 3H92A 5DCMA 2CFXA 5AONA 3L2CA 4HDUA 3GZ5A 4F7ZA 3LA2A 2KJBA 1REPC 1YQAA 5ED4A 2H27A 1WWXA 1DUXC 4K2EA
chains in the Genus database with same CATH superfamily
5ICCA 4D5CA 5M5YJ 3G4SI 2RQPA 2VQGA 1IZ1A 4NHJA 3K2AA 4QLCU 2X51A 4AVPA 3NEUA 5HDKA 3EYIA 3KP6A 3ABKH 5CLSA 4DYRA 1SAXA 5CJ9A 1LVAA 1G2HA 1TWAJ 5DS9A 4XONA 3JAMK 1QZEA 3C7JA 3NWSA 2XKOA 4OIOF 1F9NA 2LFBA 3HKZN 4B48A 4XSXF 3DEWA 1FP2A 2UV1A 2FA5A 5M5XJ 5TISC 2GLOA 4KDPA 3GBGA 1UB9A 4XSZF 3E5XA 5B5EC 4F92B 1N78A 4MNUA 3ULQB 2ZJ2A 3ZQFA 4BJTA 1YIOA 4U0WA 2DFIA 2ID3A 1XX5A 1W5TA 4ESFA 1TQMA 2JA8J 4M74A 4LLNA 2JRTA 2BZTA 4GGGA 4I02A 3F72A 4PJMA 3TL4X 4CYDA 4Y3OA 3D5RC 4E7SA 3S2DJ 2JA2A 2LKSA 1K78B 3ABLH 3ECHA 5E8IA 2B9SA 3TOAA 1H88C 2HFHA 3JSPA 1LQ1A 4EGZA 1YJNI 1T6SA 2ZSIB 3R0AA 2GOXB 4BEHB 2O9LA 3ZQHA 5LBQA 4BE1A 3DBLB 2DK8A 1B9MA 4ZC3A 1O3RA 4S04A 4IPAA 4HF2A 1Y1VJ 1QVUA 1R22A 1X4OA 2DQLA 3K0LA 3D5SC 3L2RA 2JWTA 5CVRA 1MBHA 3L1PA 4CCJA 1O3TA 2PFBA 3RIRA 4IRIA 1IRGA 4EVIA 1OYWA 1BOAA 1HSTA 5DTDA 2A6TA 2EA2A 4L0YB 1YOVB 4A0XA 4RAGA 3K4JA 3P9KA 3ZPLA 3JREA 1VQNI 4NQWB 4IZZA 4RGRA 4R1HA 4RB2C 2X0LA 4XL9A 3BG7A 1R7JA 2IAIA 2E34A 1APLC 1DPUA 3VSKA 2H94A 2V7FA 5IPAA 3DCFA 2IGKA 4UV9A 4IHXA 2MW8A 4GRIA 1BN5A 2EIJH 2OAZA 3OMYA 5IYBJ 2QSHX 3RZDJ 4XN3A 1FOWA 4JBAA 4NB5A 5FLMJ 4FASD 3KLOA 3F3XA 4A3GJ 3HSRA 1MJBA 3P5JA 2O3FA 5L3DA 4RB1A 2MFZA 3C18A 4DJAA 3N97A 2BHYA 1JT0A 1MSEC 1J09A 2XPVA 2EV6A 1V5GA 2VPLA 1ENHA 3VYSB 3CTAA 4XKBA 5CVUA 4EM1A 5LEKA 3PFYA 4J00A 1FBQA 3ZOBA 1GUUA 2XHKA 4A3CJ 3ELKA 1QO0D 4OAYA 2R7QA 3S3OA 2VJ4A 2V1NA 5FRMA 1FJLA 3PL8A 1OCCH 5LHHA 1VTNC 4LG3A 3OIPA 3FM3A 1JGSA 3BR1A 5ICGA 2DTZA 2XB5A 3FM5A 5IT3A 1TT5B 1FOYA 3FKJA 2NOGA 2DMQA 3OYLA 2IA1A 4V2FA 5FROA 1V5EA 1S29A 3QYFA 5EDNA 2ZMEC 2KJCA 1J75A 3AG4H 1XS9A 1AA7A 3AG2H 4EJTA 3CCQI 1MMNA 2L01A 4RB3C 1Y6IA 5KK1A 1TWHJ 2CMPA 4IL6C 3I53A 4UV8A 1JJ8C 2HOEA 2XAGA 1GHCA 2V9KA 4O5VA 4WXDA 3LSHA 4FQGA 3I59A 5JVTA 2VE9A 1RZ4A 2QBYA 1X1PA 4KT6A 3CLQA 2PQ8A 2BV6A 3R6SA 3ZMVA 3RPUA 4YRVA 1HKSA 4YIFA 2DA7A 3F8NA 2EPFA 3H9JA 1OR7C 3A2KA 3QQAA 1UHWA 1CF7A 2YU9J 2PN6A 2K4BA 3RPQA 5FKMA 2LBFB 4MEYF 3ZMZA 3A0BC 5JI6A 3CJQB 2HQRA 1UHSA 3QYBA 4RS8A 1S9HA 1ZARA 3M8FA 1WKMA 2E36A 4HPQA 5LRSA 1X1CA 1YJ9I 2M9HA 1B4AA 2NS7A 4I0AA 3ZMTA 3A0HC 2JZYA 4QTRA 1JGGA 1TNSA 5GAGJ 1DP7P 1P6RA 2OTJI 3ISPA 1ZGWA 1D5YA 5LGNA 2OBPA 3KLNA 2PX9A 4P1WA 9ANTA 2DYRH 1LVKA 1SEUA 3HOYJ 1HDPA 1HW2A 1GLNA 3E6BA 1ZLKA 4A93J 1U9OA 5F6FA 4HV5A 4Y15A 2HXOA 2QYOA 3EUAA 1D8JA 3S1QJ 1Y56A 3HKZA 4BQNA 1IRXA 3V8JA 3CCLI 1A35A 1FSEA 3JSOA 2O6GE 4RLFA 2HTJA 1P9QC 2JUCA 1BC8C 3I4MJ 1USTA 5C44J 1KQ8A 1ITYA 3GX4X 3WGGA 3KETA 3V8LA 3K4KA 5IYDJ 3BR0A 4BGDA 4MEXF 1IAWA 2FMLA 3OYIA 1P4AA 4A3IJ 2DMPA 4ZH4F 2EZHA 2R7VA 2D2WA 3ASNH 2R4GA 1QQIA 2K02A 3PFIA 5FFXA 1FP1D 3BG5A 5C4XJ 3F8CA 4Q47A 4GYGA 4E7ZA 4BXXJ 1U78A 4M3DA 1ETQA 2Y69H 1R5ID 2D45A 2EZKA 4PSXA 4IQ4A 2A68F 1J7KA 1HCRA 1W36D 1HC8A 2PMZN 4XRFA 3S1NJ 2X6WA 1P92A 3MN2A 1BBYA 2BW3A 4II2A 1JKPC 1D8KA 2HTSA 3PUBA 5TRDA 3V7CA 3DTKA 1CGPA 2JUGA 5GTHC 5EYRA 2IS1A 3WE3A 3FZVA 5C3EJ 1QVTA 3LSIA 3HZJA 3RYPA 2YU3A 1O4XA 4EJVA 5M5WJ 2G0EA 2W4SA 2IP2A 2ZNZA 4HOBA 1UCRA 4AIHA 1O57A 3DTEA 2O0YA 3D1NI 2LC2A 1FLIA 3ASOH 2HWVA 3COAC 3H9QA 1P7JA 3QODA 4KYWA 1XMXA 5FKKA 2M34A 4GFBA 1BR1A 1MH3A 3FF5A 4LITA 1KZHA 1ETWA 2X1EA 3U1DA 5JR3A 5EGOB 2KQRA 2IGNA 2W1OA 3LSJA 3QPLA 3RKYA 3U21A 1DU6A 5CVIA 4FETA 3CCYA 4M9XA 3E5UA 2E7XA 3EUHC 1B8IB 1E3HA 2YX7A 3G1OA 4YEJA 2ZJQF 5FLXK 4KJZA 4CCOA 3LNQA 2R7RA 1A36A 5D5WB 3KZZA 4A69C 4X0GA 5B66C 4A6DA 1U5TC 3GMEA 2LVSA 3A03A 2A5YB 1ACIA 4A3DJ 3ERMA 2A69F 1FY7A 4HF0A 2VBYA 1G3SA 3BQYA 1LDJA 2QQBA 3ZN1A 1F43A 2LF8A 4Q48A 2TCTA 4GYIA 5E3OA 4HX8A 4KA4A 3GW2A 4IHYA 2Z9OA 2OPTA 3F8FA 3IHUA 4HSRA 2VL8A 4CCMA 2LLKA 2LSOA 2VOOA 2UXNA 1L3LA 3HUGA 2R5YB 3ZQLA 4J19A 4HNVA 4ESBA 1IJWC 3DLLF 1IN5A 3OL3A 3BTIA 1HSJA 1QZYA 2DAOA 2KLOA 3JTHA 3PIOF 2MYSA 2X48A 2Z3YA 4XRSG 5J8CA 4NUBA 3H36A 2ME6A 4M3FA 3JRCA 4IOCF 2DBBA 1RRJA 2GXAA 5FD5A 5H6QA 3BWGA 4A3EJ 3Q5FA 4ABZA 1D0ZA 1BI1A 5GAHJ 4G6DA 1JTYA 2R7TA 4ZYHA 1V55H 3DQVC 4IXAA 1T39A 1ZRDA 1JXSA 1JUMA 2L4MA 1TL8A 5JHUA 4Z6YA 5FGMA 5HLGA 3HTUA 3GZNB 4A5NA 5B1BH 3CCUI 2IA2A 4OIRF 4IHVA 4L0ZB 1W5CC 2IS2A 3W2AA 2HU9A 3U1KA 3O8HA 2DA1A 2XB0X 1ON1A 3CUQA 1F1ZA 2VKDA 1JKOC 4E7HA 4BE2A 4NBQA 4M9SA 4XKWA 2JJ7A 1PJRA 4PJJA 3MAJA 1TW3A 3DEEA 1I27A 2K9LA 1SVLA 2XKPA 2MD0A 1EF4A 2B7EA 2CW8A 4HZFA 3ZRGA 4UUSA 2KRFA 1JI8A 2AS5F 4P96A 4N9HA 5K7HA 4CUGA 3IC7A 5D6EA 1YIJI 2KIFA 2P7CB 1UFMA 4LOCA 1J2XA 4PGHA 4ANJA 2D1VA 2DOFA 2YSRA 5E18F 2R5ZB 4AIKA 2IXSA 2W7NA 1NK2P 3FXOA 4PCQA 2HEOA 3DXJF 4AD9A 2K9SA 4EV0A 3PO2J 2R7OA 3QPTA 1OKRA 2VB6A 3GEZA 1S7EA 4R79A 3D0SA 3HJEA 3OS2A 4CICA 2KIMA 3A02A 2PG4A 2L0KA 1ZN2A 4EJUA 4AIJA 1HW1A 2D1HA 2MLKA 4Y33A 2G7HA 1LJ9A 4E7IA 2BBYA 2F5CA 1PUFB 3A01B 3H9GA 2ZNYA 3RDIA 5LRRA 1UJ8A 1JTXA 2YS9A 1F4KA 1W7PA 5BQTA 3W2VA 3QP5A 1S72I 1VNDA 2R7ZJ 1SMYF 2PMZA 1U0JA 1TTYA 2JPBA 3BJOA 3VPRA 1MMGA 2E5ZA 2H1LA 5E8GA 2XGCA 1DQUA 3CMEI 4BJ5C 1MDMA 1PP8F 1RUNA 2A05A 3DPLC 1BOBA 2I10A 1PUEE 2K40A 4FX0A 1X19A 1FIPA 2XUBA 3WTVC 3LQRA 1JHFA 4G12A 3E6MA 2IRFG 1UZCA 3DLAA 1VI0A 3S93A 2DQRA 1FNNA 1Z05A 4ITVA 4MTEA 2VKHA 4BQOA 2JQ7A 5E1WA 1S7OA 2DJNA 3X2QH 2L54A 1V5FA 1XGNA 3K1NA 4XRMA 3BR2A 5DCFA 5ILVA 4MGRA 3ESWB 1GXQA 2DMUA 1IG7A 4ZDOA 1U6GA 2FX0A 1E3OC 4TV7A 1FZPB 3I0TA 2GOMA 3BG6A 3BPVA 1I5ZA 1BA5A 1BC7C 4QSHA 2JPCA 2PJRA 3MCZA 1B9NA 1HLVA 1AU7A 1YYVA 4LIVA 2CSOA 3R0JA 2O5RA 2DPDA 4XLFA 1CQTA 5HDNA 2EFOA 2K3FA 2R0QC 2FJ1A 4JQFA 4EMSA 3Q0VA 3I9V2 4B43A 1D3YA 2BE5F 2G9WA 1HBXG 2IPQX 3KPHA 4B8XA 1DP3A 1MW7A 4EM2A 2QSGX 3OSGA 2NXNB 3I4NJ 3FXMA 3PNTA 3OYBA 2JSPA 3S32A 1NG7A 5EG0B 5IT9Z 3DKYA 2A3SA 1WI3A 3HM5A 2E1MB 4BHCA 2VQHA 3FMSA 2K4JA 4KMFA 4O6JA 2KDZA 2GIVA 2XASA 3ZXSA 1KGSA 3J80Z 4I01A 4DBRA 3L7WA 2ELKA 1LDKB 3I5UA 4ENKA 2CQ7A 5IP6A 2ISYA 4JX5A 1FTZA 2QZ8A 3RYRA 4XK4A 4RGUA 2V1UA 1IRFA 1BM9A 1LE8A 2KT0A 2MH2A 2RDPA 2RV8A 2Z16A 4J01A 1YO5C 1EV7A 5CVVA 3N4MA 3J7AY 1KA8A 1RETA 3IRRA 4IQJA 3BG3A 4HNTA 2HNHA 2DCEA 5E3NA 2PLYA 3ZP5A 2JA6J 3GUDA 3FWEA 1QPIA 3E0JB 1TW2A 3KYLA 2HVQA 1TBXA 3JRIA 4HBLA 3IKVA 2Z99A 2ECCA 1VQ5I 1I3QJ 4AC0A 3QRFF 1EH7A 1HQCA 3B73A 2W24A 3AKZA 1XN7A 2BY0A 2WBMA 1WJ5A 2Q1ZB 2Z33A 3HOZJ 3BDDA 5FJ8J 4A0ZA 3R60A 2R7FA 3SQNA 1JJ6C 3V7RA 3GCMA 3S16J 4JX4A 4A3BJ 1S7AA 4L9JA 4RBOA 1UMQA 5DUKA 3RI4A 4OU0A 4G7ZF 2VJ5A 1H9TA 3VYRB 4FHTA 4M6VA 2A6EF 2FRHA 3ROUA 2DW4A 3OS0A 4Z2YA 5BPIA 1XC5A 3DTIA 3GO5A 1Z6TA 3RJPA 1G3WA 3KP7A 5E1XA 1A04A 1IW7F 2CQXA 3LSMA 3T1BA 1WCMJ 5DD4A 2HPMA 2XAHA 2ZFWA 2VODA 3TW6A 1K78A 2P6SA 5J1RA 1QPMA 3GTQJ 1MMAA 5F04A 5KNLA 3EQLF 4HQMA 2J5OA 3IAM2 3BLYA 2KRCA 4QIWN 4BEHA 2M3AA 3CCVI 2FXAA 4E70A 2GWRA 1JUPA 3H3VK 1ZYRF 4BL0B 4ETSA 4QPOA 1AOYA 2MBFA 2GZWA 1OJLA 3F6VA 1I6HJ 1WJFA 4BY1J 3S3MA 2ECBA 5CYVA 5FB2A 5A2QK 4KUMA 2M4KA 2OD5A 2Y9YA 4I98B 3A4CA 1VQLI 3MZ8A 3I54A 3MEXA 5HS8A 3CCMI 1NHAA 2WAEA 4UVCA 5BPDA 3RKQA 4NQWA 3AL0B 1WH5A 3V8KA 3KP2A 2MC3A 3M4OJ 3IUOA 1MMDA 2DMTA 2HGCA 3WODF 2VT3A 3UKGA 1R71A 2AQEA 3GTKJ 3C1DA 1ON2A 3WHCA 4MTDA 2X1CA 1BI2A 2EZLA 1EA3A 4CZCA 4ZZLA 2K5CA 2DOEA 3C2GA 1E0EA 1XB4A 3G1MA 5JVGF 4OINF 3S14J 5EZGA 1IRZA 4BY7J 3H5AA 4Y13A 4G8XA 3RSNA 4CH7A 2O7OA 5GPCA 2FOWA 1IF1A 1TQIA 1AKHB 3DF8A 4BHBA 3OS1A 4IRHA 4XRSA 4U7DA 1XSDA 2DA3A 4ZZDA 1Z1DA 2WTEA 2NNYA 4A12A 1ETXA 2UWMA 1LB2A 2Y30A 3SDGA 5F0CA 3WTYC 2K9MA 1BIAA 5DD8A 3CC2I 4BYYA 3O6BB 3M1CA 3I71A 3G73A 2Y0MA 4AU7A 3K4LA 4M72A 4HX7A 2H09A 5J3LA 3K2ZA 2QVOA 4EATA 3SXYA 5D5XB 4DZPA 3TGNA 4A6EA 3ZN0A 1OYYA 1SMTA 5IP9J 3O3KA 2DDAA 2LR8A 1B1BA 2Q8KA 1MJAA 1U9NA 3CO6C 4BKXA 2MABA 1Y1WJ 3LOCA 2HYGD 1V54H 2DT6A 2JT1A 3E5QA 3SEQA 1F5TA 3KP5A 4RGSA 3VWBA 4DNCA 1PVEA 3VSLA 3MWMA 4S05A 2L4AA 4XKCA 2VLAA 4ESJA 3B6CA 3G6EI 2FD5A 4UNOA 3F22A 4EQQA 3J81Z 3JCUC 2F2EA 1R9TJ 4RAFA 4FCYA 2VQCA 3GF2A 4LIUA 4RMNA 2XROA 4HV6A 2F4OB 4RAYA 4BACA 3DBHB 3I3LA 2LREA 3AAFA 4G6TB 1LUJB 1X4PA 1Z77A 4ZYGA 3WTXC 2LYCA 2VQLA 1WGXA 2GBYA 3H5NA 4N0BA 3VYUB 3CUQC 4S0HB 1BIBA 3HOVJ 3HRUA 2EIKH 1E3PA 3J7ZI 2ZCWA 1FWZA 1KU3A 2W00A 5B3SH 2CH0A 4UUVA 3ONQA 1ZG5A 3H5RA 3IV5A 1STZA 2OZUA 4PUSA 1R4MB 2ISZA 3WTTC 1N75A 1ZHFA 1MNEA 5F64A 2MC4A 4IF4A 2CW0F 1KQ0A 3LMMA 2MH9A 3T8RA 5E20A 1RR8C 2GAUA 3RKXA 3BZCA 1Z7UA 1RC9A 4XLEA 1T98A 4I7HA 2K7LA 1XDSA 3LSRA 1T08B 5EEAA 5ILSA 5L3FA 2VASA 4LB6B 2NVQJ 3MVPA 1BI3A 2RVCA 1VQ7I 2IW5A 4XICA 2BXZA 4UVAA 2ADUA 3OYJA 1IN8A 3JTGA 3CLOA 1R58A 2HYFA 2Z5UA 1IC8A 4PJNA 3HIFA 3OV8A 1K6OA 1XTAA 3DP7A 3KP4A 2O8XA 1ZGJA 5KAIC 5HVQC 2OZ6A 2PBIA 1KYWA 1Z21A 2VE8A 4ASNA 2HKOA 2L02A 2E2HJ 3MZHA 1WZ2A 4ZDPA 2IGOA 4EEFG 3HEFA 2M87A 3JRBA 2VOPA 2RNGA 4MQ9F 2PMHA 2CO5A 4CYCB 2M0MA 1ZH5A 3ZGKA 1KU9A 3RTRA 5K7ZA 3KCCA 3K7AJ 3JAMZ 4N9IA 2OV7A 5F1RA 3VEPA 2NAZA 2HPIA 1R1UA 2TRTA 5FKOA 4KN4X 5IOZA 4PGGA 4ENMA 3KFWX 4NNJA 4AYBN 2HZDA 4E7JA 3BCAA 1I50J 4OWRB 3ZQQA 4L5EA 2QLZA 1I1SA 3FX3A 3G71I 3WGHA 4FISA 3CDIA 1G6NA 3P9IA 3C3WA 2E1OA 3GFMA 2WWYA 3O2PE 4AM3A 4PDKA 3DKXA 1Y0NA 1LEBA 1RUOA 2QUFA 4KICA 2RGVA 1ZG3A 2E35A 2VBWA 1IN4A 2BXYA 2DPUA 2NYXA 1X1BA 3JRDA 1TT0A 2F5DA 1X3WB 3TBIA 5E1ZB 4F52A 3S2HJ 4CCLA 3CJNA 2LF7A 4RM3A 4IHWA 2E2IJ 3ZQ7A 4XLAA 2LOOA 3AFHA 1YG2A 2O03A 3OR2C 1RNLA 3VFZA 4PK4A 4YFKF 5CKTA 2YR2A 2KMUA 2WAQN 2FBKA 3V42A 1UAAA 3G3ZA 1UELB 1Z91A 2E2JJ 3VOEA 2EZIA 5IY5H 5DYMA 3S8PA 3OYDA 3FXRA 4XLCA 1Y8QB 1MSFC 2DYSH 3LA3A 3PSFA 3FHNA 5EGOA 3W6JB 3MMYB 3OYAA 2F48A 1P4WA 2R7UA 1MBFA 1B8IA 5J40A 1SD4A 3ZMDA 2K27A 4IO9F 1QHGA 4WWCA 3TEDA 3IWFA 5J8FA 1ZELA 4LK0F 1YX3A 1U8BA 2X9DA 3CDLA 2O61A 4C3IJ 4A3JJ 3HHHA 1WJCA 2VXZA 3H35A 4L5JA 1VQ8I 3B6AA 2RKHA 3WTWC 3ABTA 3HOWJ 4XNFA 3KX2A 2ZJRF 2NRAC 1Z6RA 1T95A 5L3EA 1QRYA 4YIIA 3CMMA 4FT8A 2ZXWH 2BOLA 3RZOJ 1YS7A 2B63J 2CQKA 4RGXA 2GM4A 4MFEA 1K6YA 2VBZA 5D8KB 1POGA 5FRNA 2Y2ZA 3SYTA 5H20A 2R5YA 4KNYA 1FPQA 1QU3A 2CQNA 3CQZJ 2EH3A 2LH9A 1MBEA 3FXKA 2M4GA 2KIUA 3L2WA 3RCOA 4BH9A 1HF0A 4X6AJ 3E6CC 2XAQA 2A6HF 2K9NA 3K69A 2WY7Q 2FNAA 1IUYA 1IDZA 5EEGA 3FXUA 2L7MP 1DU0A 2TDXA 5DM6F 3OOPA 2FOKA 2NVYJ 3CP2A 2R92J 3GYHX 2XRNA 4B47A 3HOXJ 1UHMA 1OCTC 3SZPA 3RPUD 3OYEA 5EEHA 1LNWA 4OMYA 3BY6A 3GWZA 3EETA 3DBRB 2MD5A 5E79C 2WV1A 2M8EA 3M07A 2OTLI 3IH2A 1HXDA 2DLLA 4BBSJ 3QPSA 2EWNA 4AWXB 2DFEA 4DYQA 3F0CA 3FK6A 1WRJA 2QKLB 4HA8A 1T0FA 2L2OA 4LFUA 3WTUC 2JVHA 3SZGA 2X6XA 1QNTA 2ICWG 3WHBA 2GXGA 4HNUA 3OYCA 2HDWA 3TP0A 3S1MJ 4D7MA 4LD5A 1MBJA 1B59A 2RC4A 2YUSA 5D8LB 4KIBA 3LAPA 1YTYA 3HL2A 1UG0A 4LLLA 4YIRX 1U3EM 1FMWA 4GO1A 1TP4A 3ZMSA 1C0WA 1XG1A 3GLLA 1XMKA 3QAHA 3LSPA 1K4SA 2WAFA 4H0EA 2P0WA 2PMUA 3VB2A 3K10A 3QOEA 2R5ZA 5CQGA 4HQEA 4V19K 4WCGA 4GDFA 4ZTFA 1GXPA 3HYIA 2ACJA 1T8IA 2NS8A 3LL7A 4G7HF 4N4OB 2VBXA 3OL4A 1TZLA 3L2VA 3GTMJ 2XGEA 1MJ9A 3R61A 5JFRA 1YJWI 1LFUP 4Y52J 2KZVA 3WG9A 3L2QA 2RNJA 1WJAA 2LY2A 2XVCA 1FMVA 1BI0A 3DV8A 3WGIA 4PFPA 3WU2C 1G3YA 2MG4A 4RAZA 3TDZC 3ZQCA 4AYBA 4KIFA 3B02A 2HZTA 2E60A 3T0YA 2HS5A 2LY1A 1HA8A 2Y75A 2LP0A 2ZMEB 1PUFA 1OR7A 3W3CA 3A01A 2VKVA 3KYDB 2IA0A 2DK5A 4PFOA 1RKWA 2D5VA 5FKNA 1G4DA 1V3FA 2BYVE 2R7DA 3RQ4A 4CCNA 5ICEA 2XDVA 3IAS2 1XDUA 4OAZA 2W84A 4U87A 2HQAA 3PSIA 2EV0A 2F6CA 3BC8A 2R7XA 2IT0A 2QCOA 2BEOA 2VKEA 2DA6A 1W4MA 2DFFA 2W82A 3M3YJ 1MH4A 3U2RA 1U8RA 1TC3C 1OISA 1YE9A 2WAQA 3QWLA 5DDGA 2L9SA 3EYYA 5E3LA 2CYYA 3E3VA 3FBNB 5IP7J 1PYVA 4C30A 3PO3J 1J0RA 4IVNA 3TDUC 3CC7I 1W5SA 1DGRM 4UB8C 1SFOJ 1OCRH 3C2HA 3R4KA 3ZCOA 4Y7NJ 4YFNF 3KZIC 1VQPI 2JA5J 4BU2A 4A2UA 1A6QA 5DM7F 1ZTRA 1P7IA 2OA4A 3BR6A 3BT9A 2M8GX 3JRHA 1Z0XA 5J6XA 1PP7U 1WJEA 2CG4A 4ENNA 2CQQA 4JOMA 3IWZA 1AHDP 2P8TA 3MQ0A 4HX4A 3HOUJ 1Y8RB 2X4HA 1W1WE 3HTSB 1B72B 3CP8A 3GFLA 3S17J 3GFIA 5K1YA 2QQAA 5IOYA 1V4RA 2PEXA 5EG0A 1J59A 4KMUX 2XC7A 1O7LA 1I6XA 1ETVA 1R23A 2HKXA 4XLPF 1SAUA 2ELJA 1VQ6I 4CXFA 1ZKGA 2FNPA 1XCBA 4ZYDA 5F08A 4A0YA 5FLXZ 3V4GA 2QEXI 3CCJI 3P7NA 3FKIJ 2AXTC 4L18B 1T56A 3P9CA 4U0YA 5D6FA 3BR3A 1EKEA 3S1RJ 1FOXA 2XSDC 5K5OA 1J5YA 3HBLA 2DT7B 4BDYA 4MFDA 2DXIA 2L7KA 3KYCB 1GT0C 1LFPA 3ZQGA 3S3NA 2F5EA 2OU2A 3HB9A 3JR9A 3CMAI 2Q2EB 2LKPA 1ZR2A 1IXSB 1SD7A 1XGSA 1Y39A 2Q0OA 3CCSI 2IGMA 2CS3A 4MIMA 4QWQA 4UUTA 3F21A 2UZKA 1X1AA 2QM3A 1TQPA 3O8GA 3HPHA 1YS6A 5TJJA 1DDNA 4IRGA 2VXDA 3PQJA 5HLHA 1ZRCA 3SFZA 4DBQA 2ZXHA 2LD5A 4LG0B 3AG3H 1RI7A 1SVMA 1R36A 2ZKZA 4BE0A 1ERDA 1ZREA 2WB1N 4D9JA 2ZBKA 2FSWA 3I64A 1TWFJ 1EJ9A 1Z9CA 1IN6A 3JRFA 4C2MJ 1E17A 2OJED 2DODA 2Y0SN 1YRNB 1USSA 3BOQA 3OYMA 1I39A 2M2EA 4B4CA 4F93B 1I1GA 1VZ0A 2V26A 1FX7A 4RA2A 5GADJ 4CA0A 2LY9A 2LTPA 3K4BA 4XORA 1T2KA 2P6TA 1FBSA 1W0TA 1FYMA 2CFOA 1D1CA 2MSYA 1Q1HA 3TO9A 2P5VA 2QSFX 3PM1A 3S15J 2CGPA 1WI9A 5J4YA 3K1MA 4L9NA 1OLTA 3CF5F 4HLXA 4I0BA 4KFCA 1MMSA 4AVZA 2L3DA 2P5LC 3OR1C 3BJ6A 4PZJA 3FHZA 1Z3YA 3MKWB 2X6YA 1U5TB 2CUJA 1K61A 3KEYA 4PJLA 4DQ2A 6PAXA 2CW7A 4NDLA 5D4RA 3I4PA 2AQFA 1WFXA 3JRGA 3LAJA 1MD0A 3K1PA 2HQ5A 1BL0A 2XRLA 5L3BA 2H8RA 3I58A 3SEZA 3BPXA 1KU7A 1NG6A 4M6XA 5AIQA 4E6KG 1MIJA 1BJZA 5JLWA 4U88A 2NVXJ 3H0DA 1LEAA 1MNDA 3HRSA 4JP0A 3LSTA 2EFNA 3M9AA 5ERIA 2Y48A 5DCMB 5KVRA 3E97A 2LKXA 3OWTA 3FISA 4BUPA 3ERED 1VFCA 1R5HA 2FQ4A 3VODA 5HS7A 4B44A 4CSWA 5EF6A 2HDCA 1W7PD 2WV0A 3L09A 3ML6A 4Y17A 3F8BA 1H0MA 5DEQA 2OC6A 1S5LC 1LKXA 3CDHA 1OFCX 3LSKA 4BDZA 2BY3A 3SHFA 3BTLA 1Z3XA 3T8TA 4HLYA 5DUIA 3WU0A 3SZTA 3GTJJ 4XQFA 3PNVA 4JX6A 3FK7A 1H8AC 3NWTA 3F6OA 4B3AA 1AKHA 2OUMA 5H6RA 2F5FA 3MD2A 4KIGA 1YHQI 1HKTA 2OF7A 5J1UA 5FKLA 3Q0WA 3L2UA 1NH3A 2R93J 2P7VB 2QKMB 4BQQA 3K70C 3H1CA 2M7BA 2ZC2A 2H6BA 1H9GA 5J47A 3RQIA 3LQQA 4G6QA 1RPWA 4WXCA 1XPXA 4IEJA 2COBA 4CCKA 4M71A 2DA4A 4BXUA 1FTTA 4YELA 2M1BA 4PSWA 1MZBA 2VJIA 4O3MA 4KN7X 2GA2A 4XLHA 4WF2A 1X1DA 3DFGA 1MKMA 3BTJA 3T5XA 4DW6A 3CCRI 5F27A 3UNGC 2MLGA 3ABMH 2QWWA 2W48A 3IH3A 2DDBA 4HEA2 5K7FA 2EIMH 2HI3A 4CHUA 4GCVA 1LPQA 3CCEI 1L0OC 2CUEA 1RKTA 5L3CA 4RDUA 1M1EB 2E1NA 1TLHB 5BNGA 3LA7A 4D1QA 2O8KA 1R4NB 4FE4A 5B1AH 1ONVA 2XGDA 2Z1DA 3NARA 1LDDA 2K3PA 2ZB9A 4FTHA 4V2GA 3H3UA 5E3MA 5HNHA 2JK3A 4H4KC 3GTLJ 2FU4A 3DU5A 2EJRA 4AIDA 4E4HA 1XGOA 2GXBA 2IBDA 4NC7A 2VJJA 4IX7A 2HVRA 1R1TA 2XF5A 3PJRA 3KEQA 1T0FC 2ZXJA 3BR5A 4HRIA 3NQOA 5IYCJ 4A3MJ 5HDGA 1XSXA 4OOIA 4I76A 4IJAA 5TGTA 1TWCJ 2JSCA 1R00A 4P5OA 3HOTA 2OCCH 3L9FA 1Z7LA 5DV5A 5H2FC 2M5WA 3MKYB 2EA4A 2LNBA 1J9IA 1S8NA 2RQQA 2DA5A 3TP3A 4UHTA 4A5MA 2VIXA 3CC4I 2LBFA 3LWFA 1SVOA 5FD6A 4B1RA 3BZ6A 5LGTA 4BQAA 2DN0A 1XMAA 5CPRB 3LFKA 4MHGA 2QGUA 3BJAA 2J5PA 1ZGAA 1VQKI 2WB1A 1OYIA 3E7LA 2M30A 2FEZA 1OMIA 1S3JA 4M3GA 1WJBA 3HC7A 2DOAA 2MGQA 1ZRFA 2Y0SA 2QF7A 4ENJA 3BP8A 1ULYA 1ZK8A 2RAEA 4C3HJ 5C4JJ 2P81A 4MO7A 5EZHA 5HLTA 3WTSC 3MKLA 3MZYA 2EFQA 2PJPA 1WQ2A 4U7BA 4M6YA 3W6KB 4CYCA 1H89C 2KKOA 2KDOA 3KP3A 5GPAA 1SC7A 1JT6A 4N4NB 4EGYA 1T33A 2E1CA 4Q5SF 1D1BA 2VPRA 1YW9A 2YX4A 3FMRA 3Q3SA 3PNYA 1SANA 5CVJA 1VQ4I 2WA0A 3I59B 2ETHA 2V4JC 2UXXA 1GVDA 1SFXA 1QA6A 2QBYB 4JK1X 3REOA 2DT5A 4P55A 3HXLA 2QA4I 2V6EA 2Z2SB 1FYKA 2KPMA 5BMZA 4XN0A 4B09A 1A31A 2JA7J 4DYCA 2E5NA 1ZG1A 3IL2A 1CF7B 4QPQA 3OYFA 1OQYA 3MKZA 3GLXA 2KL4A 2GIZA 3K6GA 2HQNA 3FXJA 3OOUA 3KIOA 1BW5A 2IJLA 1SFUA 1MGTA 2A61A 3FXQA 2CV2A 2H1KA 4HF1A 1YX5A 1QBJA 2BHZA 2DA2A 2XPWA 3Q0UA 3QP6A 3DPTA 2ESHA 1P2FA 4ZYEA 3I56I 2UUZA 1KONA 3W6VA 1KU2A 4C3JJ 2GA1A 4LMYA 3CMYA 1SD6A 2VONA 3ZR8X 5D5UB 5A2QZ 4EJOA 3G1LA 4IHSA 3Q9SA 3CD6I 2CRGA 2CU7A 4ON0A 4BXFA 4P9UA 3U9GA 3GZ6A 4Q4ZF 1K7AA 4EJWA 2COMA 1E2XA 1OPCA 1LFBA 5EJCA 3F23A 4M73A 1DPRA 1X3UA 4X1EA 4XR6A 4A3LJ 3MFKA 1SD5A 4E7KA 3OYHA 4XBFA 1FT9A 2ZXIA 3CJTB 2HOTA 1FIAA 3GVAA 4E7LA 4G94A 2E7WA 2PI0A 1BR4A 5K5RA 2KFDA 1ETYA 5ILUA 2L9NA 3K4CA 2FQ3A 3GTOJ 4CGZA 1IN7A 2FBHA 2E1MC 2LDUA 2OQRA 4MQVA 5D5VB 2A07F 4RM2A 4L5IA 4NC6A 2ELHA 2K85A 4I2OA 1IDYA 5GTIC 4RB0A 2M45A 4Y4RA 5J4VA 1FC3A 3VYTB 2DMNA 2EQRA 4CO8A 1R5GA 3NRVA 2WADA 3EDPA 2M7AA 2X6OA 3E6DA 1IV6A 3OSFA 4I99C 4UXNA 4OMZA 2IEKA 2DU9A 5LD2C 2XAUA 3TKYA 5LHIA 2HDDA 1YITI 1VF9A 3SFIA 1Z67A 2EV5A 2KP6A 2L7ZA 1QZZA 3DKWA 3FIWA 2I5UA 2JVGA 3OYGA 5KAFC 3G2BA 2R7SA 4ZTJA 1P4XA 3M1EA 3HPGA 5LEJA 4I6ZA 2Y9ZA 1G8XA 3OY9A 2BW3B 3J7AO 2FBIA 2QQ9A 4HYEA 5F1JA 1RR7A 4UY8I 1ZQ3P 2WC2A 3QOPA 2FF4A 3CO7C 4W1UA 3DU6A 3QYEA 1GV5A 2XV4S 4F3QA 2DI3A 4DIQA 4R8HA 2XF7A 2WY8Q 3EPZA 3KZYA 3OYNA 3RKWA 2EFPA 2OCEA 1G3TA 3WTZA 2NS0A 3OIQA 3DPUA 1MBGA 2BVMA 3GTGJ 4HW0A 2R3SA 3HRMA 2JN6A 4M9ZA 2KRHA 2EILH 1HDDC 5IT9K 3M7GA 2LRDA 2XAJA 1YW8A 3H0GJ 4UB6C 1OCOH 1JKQC 1IGNA 3K9TA 2C6YA 4DZJA 2EB7A 3E1SA 3WU1B 1GDTA 2ME0A 4XOPA 1R1VA 2JTVA 3DWLE 3BCBA 4FX4A 4HAMA 4HG2A 3GXOA 3Q9VA 5D4SA 3J80K 2HVSA 2CUZA 3OYKA 1AWCA 3PUFA 5FLVA 2XF6A 1A6IA 2CV1A 1D5VA 2CV0A 2K86A 4UVBA 4F91B 4CZZA 4XM3A 2DJIA 2V9PA 4BAYA 1Q1VA 2F4MB 3FBIB 2NVUB 2R7WA 2BGCA 2IS4A 4I09A 5K5QA 3HSFA 1O3QA 1ODDA 1WJDA 4P9FA 3HUGB 4CDGA 4LLGF 2F4IA 1S6LA 2M0CA 1TNTA 3AL0C 3SDBA 3NAUA 1XGMA 3UR3C 3HRTA 2DTRA 5LFAA 4NC8A 1I3AA 4IOAF 2ZMEA 1RESA 4WX9A 4A3FJ 1O3SA 4A3KJ 2CUFA 1R49A 1ZAOA 4OIQF 4LJZF 3QU6A 1R6RA 1GV2A 4BBRJ 3HGGA 3QPHA 2VC1A 5KCMA 2ZJPF 3CZ6A 4II3A 2W57A 3HDDA 2E71A 4IHTA 1XD7A 1K79A 5ICFA 2V6CA 3HHGA 2AO9A 2FMYA 2L9VA 2P5KA 2FUG2 3K4MA 4PJ0C 3FDYA 4YFXF 4M3BA 5LHGA 5E17F 1FEXA 1IUFA 3EUKL 3M8JA 1UG2A 4WK8F 1VQ9I 3IKTA 4KITB 3ABUA 3D5LA 4C2UA 5HOOA 3WE2A 1IV8A 2N8GA 4ZDLA 4D7NA 2NOJB 4BHPA 2KISA 2X85A 3CUQB 1QGPA 3F8MA 3W2WA 3TMOA 3H3ZA 1Y0UA 4ZJZA 1D1AA 3N05A 3TO7A 3JW4A 1JKRC 1YW7A 4YG2F 4BNCA 3BZKA 4XLNF 5GAEJ 4LGWA 4WXHA 1HW5A 2LMDA 2HR3A 4UUSB 4RLQA 3WG7H 1WH7A 2NNNA 2V1DA 2STWA 5AIPA 4B3XA 3LSGA 2G7UA 3VDXA 3GTPJ 4D5FA 3IRQA 2XPUA 1IO2A 1ORKA 1MBKA 2RN7A 5JHFA 3C2BA 4LB5A 1W36C 5L3GA 2EBIA 5CQEA 1BR2A 1VQMI 4D0PA 1D0YA 2I8DA 3I55I 1FSHA 1NTCA 5M3FJ 3SJMA 2KIQA 5BS6A 1RIOH 4ZYAA 1X58A 2H6CA 1B72A 1IXRC 4XMYA 2KHMA 1WPKA 5HLIA 1YI2I 5F0FA 2XGXA 2ID6A 2B0LA 1N77A 3KEOA 5BOXA 1VQOI 3ECOA 2BY2A 4JYKA 1EH8A 1ETOA 1IXCA 2VC0A 3K70D 2YPRA 2F5VA 3V7SA 5LGUA 3HOSA 2HXIA 3TO6A 5FO5A 1HOMA 2LG4A 2OQGA 3M8EA 2X1DA 1W7PB 3HGYA 2BY1A 4KT5C 4DGWB 1WHUA 2V9VA 5HNFA 2V1XA 2DO7A 2EFWA 3FMQA 4L9TA 2NVTJ 2HYJA 2Q2EA 2ZFUA 1MDMB 3F9KA 4GXOA 5GP9A 2VUMJ 2IS6A 2ESNA 1NK3P 2E19A 1U2WA 1DGWY 2GQQA 1JE8A 2H8WA 2ZO4A 2MA3A 5HS9A 2IVMA 1TWGJ 3QU3A 1WVRA 3KE2A 1PDNC 2XAFA 4G9YA 1SFKA 4LG0A 2JRMA 2Y31A 1B6AA 3CF2A 2DFHA 2AXLA 2V79A 1GVJA 1FYLA 2AHQA 3A1YA 1EH6A 1JUSA 5KHDA 3BTCA 2A5WA 1K4TA 2HOAA 3JRAA 1WSUA 1SFEA 5FFZA 1FOKA 2HOSA 4FE7A 2XSJC 4C9YA 1X2NA 1YRNA 1YLFA 3K4NA 1FBUA 2PJRB 4C2TA 1ZLJA 2VT2A 1JHHA 3CUOA 3TOBA 2L7FP 1T38A 1A5JA 4HDVA 1OCPA 3J81K 1X2MA 1K83J 2CJJA 4W97A 2CWEA 3IH4A 1D0XA 3OIOA 1MNMC 2ZSHB 1HKQA 2QENA 2FE3A 3LFUA 1XCVA 4U0VA 1OCZH 3BG9A 4G7OF 2EK5A 3TW7A 1BJAA 4EM0B 2W25A 3EUHA 5HODA 3IP4B 5F0HA 4L9VA 4XOTA 2XIGA 1YFHA 3DEUA 3HG9A 1O7FA 1KQ9A 3HSEA 1KYZA 1U5TA 4XKVA 4DOZA 4M3EA 3L00A 3S2WA 1XSVA 3BQZA 2W85A 3J7YJ 1G59A 1BW6A 2EINH 5J1YA 5M3MJ 4XIDA 4KISA 2L9RA 4IKFA 3AG1H 1F36A 2VN2A 2LK2A 2K9QA 3BROA 3GFJA 3ZQIA 1QHHD 2P4WA 1X3ZB 2QQ8A 2L5QA 4BJ6C 3ZMUA 2RREA 5JLXA 3TQNA 4OIPF 5LLQA 3PQKA 4LK1F 3CESA 2STTA 3H92A 4MLOA 5DCMA 3PIPF 4HSTA 2CFXA 1LE8B 5AONA 3L2CA 2BVLA 4F55A 3FXLA 2JMWA 4HDUA 3GZ5A 4F7ZA 3LA2A 1N25A 2KZGA 2KJBA 1ZR4A 1REPC 1YQAA 1ETKA 5ED4A 4BS9A 4AUXA 2H27A 1WWXA 1DUXC 2VI6A 4K2EA 1W0UA 3CJRB
chains in the Genus database with same CATH topology
5ICCA 2RQPA 1IZ1A 4NHJA 4QLCU 4AVPA 3NEUA 5HDKA 3EYIA 3KP6A 5CLSA 1SAXA 5CJ9A 1LVAA 3JAMK 3C7JA 4OIOF 2XKOA 1F9NA 4XSXF 1FP2A 2FA5A 4KDPA 4XSZF 1UB9A 3E5XA 4MNUA 3ULQB 2ZJ2A 1YIOA 4U0WA 2DFIA 1W5TA 4ESFA 1TQMA 4M74A 4LLNA 2JRTA 4GGGA 4I02A 3F72A 4CYDA 1K78B 3ECHA 5E8IA 3TOAA 2HFHA 3JSPA 1LQ1A 4EGZA 1T6SA 3R0AA 5LBQA 2DK8A 1B9MA 1O3RA 4S04A 4IPAA 4HF2A 2DQLA 1R22A 3K0LA 5CVRA 1O3TA 2PFBA 3RIRA 4IRIA 1IRGA 4EVIA 1OYWA 1BOAA 1HSTA 2EA2A 4L0YB 4A0XA 3P9KA 3ZPLA 4RGRA 4R1HA 4RB2C 2X0LA 1R7JA 1DPUA 2H94A 4UV9A 1BN5A 2OAZA 4JBAA 4NB5A 3KLOA 3F3XA 3HSRA 1MJBA 2O3FA 5L3DA 4RB1A 3N97A 3C18A 2EV6A 3CTAA 5CVUA 4EM1A 5LEKA 1FBQA 2XHKA 3ELKA 1QO0D 5LHHA 1VTNC 3FM3A 1JGSA 5ICGA 3FM5A 5IT3A 2IA1A 1S29A 2KJCA 1J75A 4EJTA 2L01A 4RB3C 5KK1A 3I53A 4UV8A 2HOEA 2XAGA 1GHCA 4O5VA 4WXDA 5JVTA 2VE9A 3I59A 1RZ4A 2QBYA 3R6SA 2PQ8A 2BV6A 3ZMVA 3RPUA 1HKSA 4YIFA 3F8NA 1UHWA 1CF7A 2PN6A 2K4BA 3RPQA 4MEYF 3ZMZA 5JI6A 2HQRA 4RS8A 1ZARA 3M8FA 1WKMA 5LRSA 1B4AA 4I0AA 3ZMTA 2JZYA 1TNSA 1DP7P 1P6RA 3ISPA 5LGNA 2OBPA 3KLNA 1HW2A 3E6BA 1ZLKA 5F6FA 4HV5A 4Y15A 2QYOA 1D8JA 3V8JA 1FSEA 3JSOA 2O6GE 2HTJA 1BC8C 1USTA 1KQ8A 3GX4X 3WGGA 3KETA 3V8LA 4MEXF 1IAWA 2FMLA 1P4AA 4ZH4F 2D2WA 1QQIA 2K02A 3PFIA 5FFXA 1FP1D 3F8CA 4Q47A 4GYGA 1U78A 2D45A 2A68F 1J7KA 4XRFA 1P92A 1BBYA 1D8KA 2HTSA 5TRDA 3V7CA 1CGPA 3WE3A 3FZVA 3RYPA 2YU3A 4EJVA 2IP2A 2ZNZA 4HOBA 1UCRA 4AIHA 1O57A 2O0YA 1FLIA 2HWVA 3COAC 4KYWA 3FF5A 5JR3A 3U1DA 3RKYA 5CVIA 4M9XA 3E5UA 2E7XA 2YX7A 5FLXK 5D5WB 3KZZA 4A6DA 1U5TC 2A5YB 2A69F 1FY7A 4HF0A 2VBYA 1G3SA 1LDJA 2QQBA 3ZN1A 2LF8A 4Q48A 4GYIA 4HX8A 4KA4A 3GW2A 2Z9OA 3F8FA 3IHUA 2VOOA 2LSOA 2UXNA 1L3LA 3HUGA 4ESBA 1IN5A 1HSJA 1QZYA 2DAOA 3JTHA 2Z3YA 5J8CA 2DBBA 5FD5A 5H6QA 3BWGA 3Q5FA 1BI1A 4G6DA 4ZYHA 3DQVC 4IXAA 1T39A 1ZRDA 1JXSA 2L4MA 5JHUA 5HLGA 5FGMA 3HTUA 4A5NA 2IA2A 4OIRF 4L0ZB 1ON1A 3CUQA 1F1ZA 4M9SA 3MAJA 1TW3A 1I27A 2XKPA 4HZFA 2KRFA 2AS5F 4P96A 4N9HA 3IC7A 5D6EA 2KIFA 2P7CB 1UFMA 1J2XA 4PGHA 2D1VA 2YSRA 5E18F 2HEOA 4AIKA 4PCQA 3DXJF 4AD9A 4EV0A 3QPTA 1OKRA 3GEZA 4R79A 3D0SA 4CICA 2KIMA 2PG4A 1ZN2A 4EJUA 4AIJA 1HW1A 2D1HA 2MLKA 2G7HA 1LJ9A 2BBYA 2F5CA 3RDIA 2ZNYA 5LRRA 1F4KA 1W7PA 5BQTA 3QP5A 1SMYF 1TTYA 2JPBA 3BJOA 5E8GA 1MDMA 1PP8F 1RUNA 3DPLC 1PUEE 4FX0A 2XUBA 3WTVC 3LQRA 1JHFA 3E6MA 2IRFG 2DQRA 1FNNA 1Z05A 4MTEA 5E1WA 1S7OA 2L54A 3K1NA 1XGNA 5DCFA 5ILVA 4MGRA 1GXQA 1U6GA 4TV7A 1FZPB 3I0TA 3BPVA 1I5ZA 1BC7C 2JPCA 3MCZA 1B9NA 1YYVA 2CSOA 3R0JA 2DPDA 5HDNA 2EFOA 4JQFA 4EMSA 1D3YA 2BE5F 2G9WA 1HBXG 2IPQX 4B8XA 4EM2A 5IT9Z 2A3SA 4BHCA 3FMSA 2K4JA 4KMFA 4O6JA 2GIVA 2XASA 1KGSA 3J80Z 4I01A 3L7WA 4ENKA 1LDKB 3I5UA 2ISYA 2QZ8A 3RYRA 4RGUA 2V1UA 1IRFA 1BM9A 2MH2A 2RDPA 2RV8A 1YO5C 1EV7A 5CVVA 3N4MA 1KA8A 3IRRA 2PLYA 3ZP5A 3GUDA 3FWEA 1TW2A 1TBXA 4HBLA 3IKVA 2Z99A 3QRFF 1EH7A 1HQCA 3B73A 2W24A 1XN7A 2Z33A 3BDDA 4A0ZA 3R60A 2R7FA 3SQNA 3V7RA 1S7AA 4L9JA 5DUKA 3RI4A 4OU0A 4G7ZF 1H9TA 4FHTA 2A6EF 2FRHA 3ROUA 2DW4A 4Z2YA 5BPIA 3GO5A 1Z6TA 3RJPA 1G3WA 3KP7A 5E1XA 1A04A 1IW7F 3T1BA 5DD4A 2VODA 2XAHA 2ZFWA 1K78A 2P6SA 1QPMA 3EQLF 4HQMA 2J5OA 2FXAA 4E70A 2GWRA 1ZYRF 4ETSA 1AOYA 2MBFA 2GZWA 3F6VA 5CYVA 5FB2A 5A2QK 4KUMA 2OD5A 4I98B 3I54A 3MEXA 5HS8A 1NHAA 4UVCA 5BPDA 4NQWA 3V8KA 3KP2A 2MC3A 2HGCA 3WODF 2VT3A 3C1DA 1ON2A 4MTDA 1BI2A 4ZZLA 1XB4A 4OINF 4Y13A 4G8XA 1IF1A 1TQIA 3DF8A 4BHBA 4IRHA 4U7DA 1XSDA 4ZZDA 1Z1DA 2WTEA 2NNYA 4A12A 2UWMA 1LB2A 3WTYC 1BIAA 5DD8A 4BYYA 3O6BB 3I71A 3G73A 2Y0MA 4M72A 4HX7A 2H09A 3K2ZA 2QVOA 3SXYA 5D5XB 3TGNA 4A6EA 3ZN0A 1OYYA 1SMTA 3O3KA 1B1BA 2Q8KA 1MJAA 3CO6C 2HYGD 2JT1A 3E5QA 1F5TA 3KP5A 4RGSA 4DNCA 3MWMA 4S05A 2L4AA 4ESJA 4UNOA 3F22A 4EQQA 3J81Z 2F2EA 3GF2A 2XROA 4HV6A 4RAYA 3AAFA 4ZYGA 3WTXC 4N0BA 3CUQC 1BIBA 3HRUA 2ZCWA 1FWZA 1KU3A 4UUVA 1ZG5A 1STZA 2OZUA 2ISZA 3WTTC 1ZHFA 5F64A 4IF4A 2CW0F 1KQ0A 2MH9A 3T8RA 5E20A 2GAUA 3RKXA 1Z7UA 1T98A 4I7HA 2K7LA 1XDSA 5ILSA 5L3FA 4LB6B 1BI3A 2RVCA 2IW5A 4UVAA 2ADUA 1IN8A 3JTGA 3CLOA 1R58A 2HYFA 2Z5UA 3HIFA 3OV8A 1K6OA 3DP7A 3KP4A 2O8XA 1ZGJA 5HVQC 2OZ6A 2PBIA 1KYWA 4ASNA 2VE8A 2HKOA 2L02A 3MZHA 2M87A 2VOPA 4MQ9F 2PMHA 2CO5A 1ZH5A 1KU9A 3RTRA 3KCCA 3JAMZ 4N9IA 5F1RA 3VEPA 2NAZA 1R1UA 4KN4X 4PGGA 4ENMA 3KFWX 2QLZA 1I1SA 3FX3A 3WGHA 1G6NA 3P9IA 3C3WA 3GFMA 2WWYA 3O2PE 4PDKA 1LEBA 1RUOA 2QUFA 4KICA 2RGVA 1ZG3A 2VBWA 1IN4A 2DPUA 2NYXA 2F5DA 5E1ZB 3CJNA 2LF7A 3ZQ7A 1YG2A 2O03A 1RNLA 3VFZA 4YFKF 2YR2A 2FBKA 3G3ZA 1Z91A 3VOEA 5DYMA 3FXRA 3LA3A 3W6JB 1P4WA 1SD4A 3ZMDA 2K27A 4WWCA 3IWFA 5J8FA 4LK0F 2O61A 3HHHA 4L5JA 2VXZA 2RKHA 3WTWC 3ABTA 2NRAC 1Z6RA 5L3EA 4YIIA 4FT8A 1YS7A 2CQKA 4RGXA 2VBZA 5D8KB 5H20A 4KNYA 1FPQA 2KIUA 4BH9A 3E6CC 2XAQA 2A6HF 3K69A 2FNAA 1IUYA 5EEGA 3FXUA 2TDXA 3OOPA 2FOKA 3GYHX 2XRNA 1UHMA 3SZPA 5EEHA 1LNWA 4OMYA 3BY6A 3GWZA 3EETA 2MD5A 2M8EA 1HXDA 2DLLA 2EWNA 4AWXB 1WRJA 4HA8A 1T0FA 4LFUA 3WTUC 1QNTA 2GXGA 4LD5A 1B59A 2RC4A 5D8LB 4KIBA 3LAPA 1YTYA 4LLLA 1U3EM 4GO1A 3ZMSA 1C0WA 1XMKA 3QAHA 4H0EA 2PMUA 3VB2A 4HQEA 4WCGA 1GXPA 3HYIA 2ACJA 4G7HF 2VBXA 1MJ9A 3R61A 5JFRA 3WG9A 2RNJA 2XVCA 1BI0A 3DV8A 3WGIA 1G3YA 3TDZC 4RAZA 4KIFA 3B02A 2HZTA 3T0YA 2HS5A 2Y75A 2ZMEB 1OR7A 2IA0A 2DK5A 1G4DA 1V3FA 2BYVE 2R7DA 5ICEA 1XDUA 2W84A 2EV0A 2IT0A 2BEOA 1W4MA 3U2RA 1U8RA 5DDGA 3EYYA 2CYYA 3E3VA 1J0RA 4IVNA 3TDUC 1W5SA 3R4KA 4YFNF 4A2UA 2OA4A 1PP7U 5J6XA 2CG4A 4ENNA 3IWZA 2P8TA 3MQ0A 4HX4A 2X4HA 3HTSB 3GFLA 3GFIA 5K1YA 2QQAA 1V4RA 2PEXA 1J59A 4KMUX 1O7LA 1I6XA 1R23A 2HKXA 4XLPF 4CXFA 2FNPA 1XCBA 4ZYDA 4A0YA 5FLXZ 3V4GA 3P7NA 4L18B 3P9CA 4U0YA 5D6FA 5K5OA 1J5YA 2F5EA 2OU2A 2LKPA 1IXSB 1SD7A 1XGSA 2Q0OA 4QWQA 3F21A 2UZKA 2QM3A 1TQPA 1YS6A 5TJJA 1DDNA 4IRGA 3PQJA 5HLHA 1ZRCA 3SFZA 4LG0B 1RI7A 1R36A 2ZKZA 1ZREA 2ZBKA 2FSWA 3I64A 1Z9CA 1IN6A 1E17A 1USSA 3BOQA 1I1GA 1FX7A 1T2KA 2P6TA 1FBSA 1FYMA 1Q1HA 3TO9A 2P5VA 2CGPA 1WI9A 3K1MA 4L9NA 4HLXA 4I0BA 4KFCA 2L3DA 2P5LC 3BJ6A 4PZJA 3FHZA 1U5TB 6PAXA 4DQ2A 5D4RA 3I4PA 3LAJA 1MD0A 3K1PA 5L3BA 3I58A 3BPXA 1KU7A 4M6XA 5AIQA 4U88A 1LEAA 3HRSA 3LSTA 2EFNA 3M9AA 5ERIA 2Y48A 5DCMB 5KVRA 3E97A 3ERED 1R5HA 3VODA 5HS7A 2HDCA 1W7PD 2WV0A 3L09A 3ML6A 4Y17A 3F8BA 1H0MA 5DEQA 3CDHA 3SHFA 3T8TA 4HLYA 5DUIA 3WU0A 3SZTA 3F6OA 5H6RA 2F5FA 4KIGA 1HKTA 2P7VB 2H6BA 1H9GA 3LQQA 4G6QA 4WXCA 4M71A 4BXUA 2M1BA 1MZBA 4O3MA 4KN7X 2GA2A 4WF2A 3DFGA 1MKMA 3T5XA 2MLGA 2QWWA 4CHUA 4GCVA 1L0OC 5L3CA 2E1NA 1TLHB 3LA7A 1ONVA 1LDDA 3H3UA 2FU4A 2EJRA 2GXBA 1XGOA 1R1TA 3KEQA 2ZXJA 3NQOA 5HDGA 1XSXA 4OOIA 4IJAA 2JSCA 1R00A 4P5OA 3HOTA 3L9FA 5DV5A 2M5WA 2EA4A 2LNBA 1J9IA 1S8NA 4UHTA 4A5MA 3LWFA 5FD6A 3BZ6A 5LGTA 4BQAA 1XMAA 3LFKA 4MHGA 3BJAA 2J5PA 1ZGAA 1OYIA 2M30A 2FEZA 1OMIA 1S3JA 1ZRFA 4ENJA 3BP8A 1ULYA 3WTSC 3MZYA 2EFQA 2PJPA 1WQ2A 4U7BA 4M6YA 3W6KB 2KKOA 3KP3A 4EGYA 2E1CA 4Q5SF 1YW9A 2YX4A 3FMRA 5CVJA 3I59B 2ETHA 2QBYB 2UXXA 1SFXA 4JK1X 3REOA 2DT5A 4P55A 1FYKA 5BMZA 4B09A 1ZG1A 3IL2A 1CF7B 3GLXA 2HQNA 2IJLA 1SFUA 1MGTA 2A61A 3FXQA 4HF1A 1QBJA 3QP6A 3DPTA 2ESHA 1P2FA 4ZYEA 1KU2A 2GA1A 4LMYA 1SD6A 2VONA 5D5UB 5A2QZ 4EJOA 4IHSA 3Q9SA 4ON0A 4P9UA 3U9GA 3GZ6A 4Q4ZF 1K7AA 4EJWA 2COMA 1E2XA 1OPCA 3F23A 4M73A 1DPRA 1X3UA 3MFKA 1SD5A 4XBFA 1FT9A 3GVAA 4G94A 2E7WA 2PI0A 5K5RA 5ILUA 2FQ3A 4CGZA 1IN7A 2FBHA 2LDUA 2OQRA 4MQVA 5D5VB 2A07F 4L5IA 2ELHA 4I2OA 4RB0A 2M45A 1FC3A 4CO8A 1R5GA 3NRVA 3EDPA 3E6DA 4UXNA 4OMZA 2DU9A 3TKYA 5LHIA 2EV5A 1QZZA 3DKWA 1P4XA 3M1EA 5LEJA 3J7AO 2FBIA 2QQ9A 4HYEA 2WC2A 3QOPA 2FF4A 3CO7C 2XV4S 2DI3A 4R8HA 3KZYA 3RKWA 2EFPA 1G3TA 3WTZA 2NS0A 4HW0A 2R3SA 3HRMA 4M9ZA 5IT9K 3M7GA 2XAJA 1YW8A 3K9TA 2C6YA 2EB7A 3WU1B 1R1VA 2JTVA 4FX4A 4HAMA 3GXOA 3Q9VA 5D4SA 3J80K 1AWCA 1D5VA 2K86A 4UVBA 4CZZA 4BAYA 2BGCA 4I09A 5K5QA 3HSFA 1O3QA 1ODDA 4P9FA 4CDGA 4LLGF 1S6LA 1TNTA 1XGMA 3HRTA 2DTRA 2ZMEA 4WX9A 1O3SA 1ZAOA 4OIQF 4LJZF 3QU6A 3QPHA 2VC1A 2W57A 4IHTA 1XD7A 1K79A 5ICFA 2V6CA 3HHGA 2FMYA 2P5KA 4YFXF 5E17F 5LHGA 4WK8F 3IKTA 3ABUA 3D5LA 5HOOA 3WE2A 4BHPA 3CUQB 3F8MA 1QGPA 3H3ZA 1Y0UA 3TO7A 3JW4A 1YW7A 4YG2F 4BNCA 4XLNF 4LGWA 4WXHA 1HW5A 2HR3A 2STWA 2NNNA 2V1DA 5AIPA 2G7UA 3IRQA 2RN7A 4LB5A 5L3GA 4D0PA 1FSHA 5BS6A 1RIOH 2H6CA 1IXRC 5HLIA 2XGXA 2B0LA 3KEOA 5BOXA 3ECOA 1EH8A 1IXCA 2VC0A 2YPRA 3V7SA 5LGUA 3HOSA 3TO6A 5FO5A 2OQGA 3M8EA 1W7PB 4KT5C 2V9VA 2V1XA 2DO7A 2EFWA 3FMQA 4L9TA 2Q2EA 1MDMB 4GXOA 2ESNA 1U2WA 2GQQA 1JE8A 2ZO4A 2MA3A 5HS9A 2IVMA 3QU3A 3KE2A 1PDNC 2XAFA 4G9YA 4LG0A 1B6AA 1FYLA 2AXLA 2V79A 1GVJA 1EH6A 1WSUA 1SFEA 5FFZA 1FOKA 1YLFA 1FBUA 1ZLJA 2VT2A 1JHHA 3CUOA 3TOBA 1T38A 4HDVA 3J81K 2CWEA 1HKQA 2QENA 2FE3A 1XCVA 4U0VA 4G7OF 2EK5A 1BJAA 4EM0B 2W25A 3EUHA 4L9VA 2XIGA 1YFHA 3DEUA 1O7FA 1KQ9A 3HSEA 1KYZA 1U5TA 3L00A 3S2WA 1XSVA 2W85A 2VN2A 3BROA 3GFJA 2P4WA 3ZMUA 3TQNA 4OIPF 5LLQA 3PQKA 4LK1F 2STTA 3H92A 5DCMA 2CFXA 5AONA 3L2CA 4HDUA 3GZ5A 4F7ZA 3LA2A 2KJBA 1REPC 1YQAA 5ED4A 2H27A 1WWXA 1DUXC 4K2EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICC A;  2RQP A;  1IZ1 A;  4NHJ A;  4QLC U;  4AVP A;  3NEU A;  5HDK A;  3EYI A;  3KP6 A;  5CLS A;  1SAX A;  5CJ9 A;  1LVA A;  3JAM K;  3C7J A;  4OIO F;  2XKO A;  1F9N A;  4XSX F;  1FP2 A;  2FA5 A;  4KDP A;  4XSZ F;  1UB9 A;  3E5X A;  4MNU A;  3ULQ B;  2ZJ2 A;  1YIO A;  4U0W A;  2DFI A;  1W5T A;  4ESF A;  1TQM A;  4M74 A;  4LLN A;  2JRT A;  4GGG A;  4I02 A;  3F72 A;  4CYD A;  1K78 B;  3ECH A;  5E8I A;  3TOA A;  2HFH A;  3JSP A;  1LQ1 A;  4EGZ A;  1T6S A;  3R0A A;  5LBQ A;  2DK8 A;  1B9M A;  1O3R A;  4S04 A;  4IPA A;  4HF2 A;  2DQL A;  1R22 A;  3K0L A;  5CVR A;  1O3T A;  2PFB A;  3RIR A;  4IRI A;  1IRG A;  4EVI A;  1OYW A;  1BOA A;  1HST A;  2EA2 A;  4L0Y B;  4A0X A;  3P9K A;  3ZPL A;  4RGR A;  4R1H A;  4RB2 C;  2X0L A;  1R7J A;  1DPU A;  2H94 A;  4UV9 A;  1BN5 A;  2OAZ A;  4JBA A;  4NB5 A;  3KLO A;  3F3X A;  3HSR A;  1MJB A;  2O3F A;  5L3D A;  4RB1 A;  3N97 A;  3C18 A;  2EV6 A;  3CTA A;  5CVU A;  4EM1 A;  5LEK A;  1FBQ A;  2XHK A;  3ELK A;  1QO0 D;  5LHH A;  1VTN C;  3FM3 A;  1JGS A;  5ICG A;  3FM5 A;  5IT3 A;  2IA1 A;  1S29 A;  2KJC A;  1J75 A;  4EJT A;  2L01 A;  4RB3 C;  5KK1 A;  3I53 A;  4UV8 A;  2HOE A;  2XAG A;  1GHC A;  4O5V A;  4WXD A;  5JVT A;  2VE9 A;  3I59 A;  1RZ4 A;  2QBY A;  3R6S A;  2PQ8 A;  2BV6 A;  3ZMV A;  3RPU A;  1HKS A;  4YIF A;  3F8N A;  1UHW A;  1CF7 A;  2PN6 A;  2K4B A;  3RPQ A;  4MEY F;  3ZMZ A;  5JI6 A;  2HQR A;  4RS8 A;  1ZAR A;  3M8F A;  1WKM A;  5LRS A;  1B4A A;  4I0A A;  3ZMT A;  2JZY A;  1TNS A;  1DP7 P;  1P6R A;  3ISP A;  5LGN A;  2OBP A;  3KLN A;  1HW2 A;  3E6B A;  1ZLK A;  5F6F A;  4HV5 A;  4Y15 A;  2QYO A;  1D8J A;  3V8J A;  1FSE A;  3JSO A;  2O6G E;  2HTJ A;  1BC8 C;  1UST A;  1KQ8 A;  3GX4 X;  3WGG A;  3KET A;  3V8L A;  4MEX F;  1IAW A;  2FML A;  1P4A A;  4ZH4 F;  2D2W A;  1QQI A;  2K02 A;  3PFI A;  5FFX A;  1FP1 D;  3F8C A;  4Q47 A;  4GYG A;  1U78 A;  2D45 A;  2A68 F;  1J7K A;  4XRF A;  1P92 A;  1BBY A;  1D8K A;  2HTS A;  5TRD A;  3V7C A;  1CGP A;  3WE3 A;  3FZV A;  3RYP A;  2YU3 A;  4EJV A;  2IP2 A;  2ZNZ A;  4HOB A;  1UCR A;  4AIH A;  1O57 A;  2O0Y A;  1FLI A;  2HWV A;  3COA C;  4KYW A;  3FF5 A;  5JR3 A;  3U1D A;  3RKY A;  5CVI A;  4M9X A;  3E5U A;  2E7X A;  2YX7 A;  5FLX K;  5D5W B;  3KZZ A;  4A6D A;  1U5T C;  2A5Y B;  2A69 F;  1FY7 A;  4HF0 A;  2VBY A;  1G3S A;  1LDJ A;  2QQB A;  3ZN1 A;  2LF8 A;  4Q48 A;  4GYI A;  4HX8 A;  4KA4 A;  3GW2 A;  2Z9O A;  3F8F A;  3IHU A;  2VOO A;  2LSO A;  2UXN A;  1L3L A;  3HUG A;  4ESB A;  1IN5 A;  1HSJ A;  1QZY A;  2DAO A;  3JTH A;  2Z3Y A;  5J8C A;  2DBB A;  5FD5 A;  5H6Q A;  3BWG A;  3Q5F A;  1BI1 A;  4G6D A;  4ZYH A;  3DQV C;  4IXA A;  1T39 A;  1ZRD A;  1JXS A;  2L4M A;  5JHU A;  5HLG A;  5FGM A;  3HTU A;  4A5N A;  2IA2 A;  4OIR F;  4L0Z B;  1ON1 A;  3CUQ A;  1F1Z A;  4M9S A;  3MAJ A;  1TW3 A;  1I27 A;  2XKP A;  4HZF A;  2KRF A;  2AS5 F;  4P96 A;  4N9H A;  3IC7 A;  5D6E A;  2KIF A;  2P7C B;  1UFM A;  1J2X A;  4PGH A;  2D1V A;  2YSR A;  5E18 F;  2HEO A;  4AIK A;  4PCQ A;  3DXJ F;  4AD9 A;  4EV0 A;  3QPT A;  1OKR A;  3GEZ A;  4R79 A;  3D0S A;  4CIC A;  2KIM A;  2PG4 A;  1ZN2 A;  4EJU A;  4AIJ A;  1HW1 A;  2D1H A;  2MLK A;  2G7H A;  1LJ9 A;  2BBY A;  2F5C A;  3RDI A;  2ZNY A;  5LRR A;  1F4K A;  1W7P A;  5BQT A;  3QP5 A;  1SMY F;  1TTY A;  2JPB A;  3BJO A;  5E8G A;  1MDM A;  1PP8 F;  1RUN A;  3DPL C;  1PUE E;  4FX0 A;  2XUB A;  3WTV C;  3LQR A;  1JHF A;  3E6M A;  2IRF G;  2DQR A;  1FNN A;  1Z05 A;  4MTE A;  5E1W A;  1S7O A;  2L54 A;  3K1N A;  1XGN A;  5DCF A;  5ILV A;  4MGR A;  1GXQ A;  1U6G A;  4TV7 A;  1FZP B;  3I0T A;  3BPV A;  1I5Z A;  1BC7 C;  2JPC A;  3MCZ A;  1B9N A;  1YYV A;  2CSO A;  3R0J A;  2DPD A;  5HDN A;  2EFO A;  4JQF A;  4EMS A;  1D3Y A;  2BE5 F;  2G9W A;  1HBX G;  2IPQ X;  4B8X A;  4EM2 A;  5IT9 Z;  2A3S A;  4BHC A;  3FMS A;  2K4J A;  4KMF A;  4O6J A;  2GIV A;  2XAS A;  1KGS A;  3J80 Z;  4I01 A;  3L7W A;  4ENK A;  1LDK B;  3I5U A;  2ISY A;  2QZ8 A;  3RYR A;  4RGU A;  2V1U A;  1IRF A;  1BM9 A;  2MH2 A;  2RDP A;  2RV8 A;  1YO5 C;  1EV7 A;  5CVV A;  3N4M A;  1KA8 A;  3IRR A;  2PLY A;  3ZP5 A;  3GUD A;  3FWE A;  1TW2 A;  1TBX A;  4HBL A;  3IKV A;  2Z99 A;  3QRF F;  1EH7 A;  1HQC A;  3B73 A;  2W24 A;  1XN7 A;  2Z33 A;  3BDD A;  4A0Z A;  3R60 A;  2R7F A;  3SQN A;  3V7R A;  1S7A A;  4L9J A;  5DUK A;  3RI4 A;  4OU0 A;  4G7Z F;  1H9T A;  4FHT A;  2A6E F;  2FRH A;  3ROU A;  2DW4 A;  4Z2Y A;  5BPI A;  3GO5 A;  1Z6T A;  3RJP A;  1G3W A;  3KP7 A;  5E1X A;  1A04 A;  1IW7 F;  3T1B A;  5DD4 A;  2VOD A;  2XAH A;  2ZFW A;  1K78 A;  2P6S A;  1QPM A;  3EQL F;  4HQM A;  2J5O A;  2FXA A;  4E70 A;  2GWR A;  1ZYR F;  4ETS A;  1AOY A;  2MBF A;  2GZW A;  3F6V A;  5CYV A;  5FB2 A;  5A2Q K;  4KUM A;  2OD5 A;  4I98 B;  3I54 A;  3MEX A;  5HS8 A;  1NHA A;  4UVC A;  5BPD A;  4NQW A;  3V8K A;  3KP2 A;  2MC3 A;  2HGC A;  3WOD F;  2VT3 A;  3C1D A;  1ON2 A;  4MTD A;  1BI2 A;  4ZZL A;  1XB4 A;  4OIN F;  4Y13 A;  4G8X A;  1IF1 A;  1TQI A;  3DF8 A;  4BHB A;  4IRH A;  4U7D A;  1XSD A;  4ZZD A;  1Z1D A;  2WTE A;  2NNY A;  4A12 A;  2UWM A;  1LB2 A;  3WTY C;  1BIA A;  5DD8 A;  4BYY A;  3O6B B;  3I71 A;  3G73 A;  2Y0M A;  4M72 A;  4HX7 A;  2H09 A;  3K2Z A;  2QVO A;  3SXY A;  5D5X B;  3TGN A;  4A6E A;  3ZN0 A;  1OYY A;  1SMT A;  3O3K A;  1B1B A;  2Q8K A;  1MJA A;  3CO6 C;  2HYG D;  2JT1 A;  3E5Q A;  1F5T A;  3KP5 A;  4RGS A;  4DNC A;  3MWM A;  4S05 A;  2L4A A;  4ESJ A;  4UNO A;  3F22 A;  4EQQ A;  3J81 Z;  2F2E A;  3GF2 A;  2XRO A;  4HV6 A;  4RAY A;  3AAF A;  4ZYG A;  3WTX C;  4N0B A;  3CUQ C;  1BIB A;  3HRU A;  2ZCW A;  1FWZ A;  1KU3 A;  4UUV A;  1ZG5 A;  1STZ A;  2OZU A;  2ISZ A;  3WTT C;  1ZHF A;  5F64 A;  4IF4 A;  2CW0 F;  1KQ0 A;  2MH9 A;  3T8R A;  5E20 A;  2GAU A;  3RKX A;  1Z7U A;  1T98 A;  4I7H A;  2K7L A;  1XDS A;  5ILS A;  5L3F A;  4LB6 B;  1BI3 A;  2RVC A;  2IW5 A;  4UVA A;  2ADU A;  1IN8 A;  3JTG A;  3CLO A;  1R58 A;  2HYF A;  2Z5U A;  3HIF A;  3OV8 A;  1K6O A;  3DP7 A;  3KP4 A;  2O8X A;  1ZGJ A;  5HVQ C;  2OZ6 A;  2PBI A;  1KYW A;  4ASN A;  2VE8 A;  2HKO A;  2L02 A;  3MZH A;  2M87 A;  2VOP A;  4MQ9 F;  2PMH A;  2CO5 A;  1ZH5 A;  1KU9 A;  3RTR A;  3KCC A;  3JAM Z;  4N9I A;  5F1R A;  3VEP A;  2NAZ A;  1R1U A;  4KN4 X;  4PGG A;  4ENM A;  3KFW X;  2QLZ A;  1I1S A;  3FX3 A;  3WGH A;  1G6N A;  3P9I A;  3C3W A;  3GFM A;  2WWY A;  3O2P E;  4PDK A;  1LEB A;  1RUO A;  2QUF A;  4KIC A;  2RGV A;  1ZG3 A;  2VBW A;  1IN4 A;  2DPU A;  2NYX A;  2F5D A;  5E1Z B;  3CJN A;  2LF7 A;  3ZQ7 A;  1YG2 A;  2O03 A;  1RNL A;  3VFZ A;  4YFK F;  2YR2 A;  2FBK A;  3G3Z A;  1Z91 A;  3VOE A;  5DYM A;  3FXR A;  3LA3 A;  3W6J B;  1P4W A;  1SD4 A;  3ZMD A;  2K27 A;  4WWC A;  3IWF A;  5J8F A;  4LK0 F;  2O61 A;  3HHH A;  4L5J A;  2VXZ A;  2RKH A;  3WTW C;  3ABT A;  2NRA C;  1Z6R A;  5L3E A;  4YII A;  4FT8 A;  1YS7 A;  2CQK A;  4RGX A;  2VBZ A;  5D8K B;  5H20 A;  4KNY A;  1FPQ A;  2KIU A;  4BH9 A;  3E6C C;  2XAQ A;  2A6H F;  3K69 A;  2FNA A;  1IUY A;  5EEG A;  3FXU A;  2TDX A;  3OOP A;  2FOK A;  3GYH X;  2XRN A;  1UHM A;  3SZP A;  5EEH A;  1LNW A;  4OMY A;  3BY6 A;  3GWZ A;  3EET A;  2MD5 A;  2M8E A;  1HXD A;  2DLL A;  2EWN A;  4AWX B;  1WRJ A;  4HA8 A;  1T0F A;  4LFU A;  3WTU C;  1QNT A;  2GXG A;  4LD5 A;  1B59 A;  2RC4 A;  5D8L B;  4KIB A;  3LAP A;  1YTY A;  4LLL A;  1U3E M;  4GO1 A;  3ZMS A;  1C0W A;  1XMK A;  3QAH A;  4H0E A;  2PMU A;  3VB2 A;  4HQE A;  4WCG A;  1GXP A;  3HYI A;  2ACJ A;  4G7H F;  2VBX A;  1MJ9 A;  3R61 A;  5JFR A;  3WG9 A;  2RNJ A;  2XVC A;  1BI0 A;  3DV8 A;  3WGI A;  1G3Y A;  3TDZ C;  4RAZ A;  4KIF A;  3B02 A;  2HZT A;  3T0Y A;  2HS5 A;  2Y75 A;  2ZME B;  1OR7 A;  2IA0 A;  2DK5 A;  1G4D A;  1V3F A;  2BYV E;  2R7D A;  5ICE A;  1XDU A;  2W84 A;  2EV0 A;  2IT0 A;  2BEO A;  1W4M A;  3U2R A;  1U8R A;  5DDG A;  3EYY A;  2CYY A;  3E3V A;  1J0R A;  4IVN A;  3TDU C;  1W5S A;  3R4K A;  4YFN F;  4A2U A;  2OA4 A;  1PP7 U;  5J6X A;  2CG4 A;  4ENN A;  3IWZ A;  2P8T A;  3MQ0 A;  4HX4 A;  2X4H A;  3HTS B;  3GFL A;  3GFI A;  5K1Y A;  2QQA A;  1V4R A;  2PEX A;  1J59 A;  4KMU X;  1O7L A;  1I6X A;  1R23 A;  2HKX A;  4XLP F;  4CXF A;  2FNP A;  1XCB A;  4ZYD A;  4A0Y A;  5FLX Z;  3V4G A;  3P7N A;  4L18 B;  3P9C A;  4U0Y A;  5D6F A;  5K5O A;  1J5Y A;  2F5E A;  2OU2 A;  2LKP A;  1IXS B;  1SD7 A;  1XGS A;  2Q0O A;  4QWQ A;  3F21 A;  2UZK A;  2QM3 A;  1TQP A;  1YS6 A;  5TJJ A;  1DDN A;  4IRG A;  3PQJ A;  5HLH A;  1ZRC A;  3SFZ A;  4LG0 B;  1RI7 A;  1R36 A;  2ZKZ A;  1ZRE A;  2ZBK A;  2FSW A;  3I64 A;  1Z9C A;  1IN6 A;  1E17 A;  1USS A;  3BOQ A;  1I1G A;  1FX7 A;  1T2K A;  2P6T A;  1FBS A;  1FYM A;  1Q1H A;  3TO9 A;  2P5V A;  2CGP A;  1WI9 A;  3K1M A;  4L9N A;  4HLX A;  4I0B A;  4KFC A;  2L3D A;  2P5L C;  3BJ6 A;  4PZJ A;  3FHZ A;  1U5T B;  6PAX A;  4DQ2 A;  5D4R A;  3I4P A;  3LAJ A;  1MD0 A;  3K1P A;  5L3B A;  3I58 A;  3BPX A;  1KU7 A;  4M6X A;  5AIQ A;  4U88 A;  1LEA A;  3HRS A;  3LST A;  2EFN A;  3M9A A;  5ERI A;  2Y48 A;  5DCM B;  5KVR A;  3E97 A;  3ERE D;  1R5H A;  3VOD A;  5HS7 A;  2HDC A;  1W7P D;  2WV0 A;  3L09 A;  3ML6 A;  4Y17 A;  3F8B A;  1H0M A;  5DEQ A;  3CDH A;  3SHF A;  3T8T A;  4HLY A;  5DUI A;  3WU0 A;  3SZT A;  3F6O A;  5H6R A;  2F5F A;  4KIG A;  1HKT A;  2P7V B;  2H6B A;  1H9G A;  3LQQ A;  4G6Q A;  4WXC A;  4M71 A;  4BXU A;  2M1B A;  1MZB A;  4O3M A;  4KN7 X;  2GA2 A;  4WF2 A;  3DFG A;  1MKM A;  3T5X A;  2MLG A;  2QWW A;  4CHU A;  4GCV A;  1L0O C;  5L3C A;  2E1N A;  1TLH B;  3LA7 A;  1ONV A;  1LDD A;  3H3U A;  2FU4 A;  2EJR A;  2GXB A;  1XGO A;  1R1T A;  3KEQ A;  2ZXJ A;  3NQO A;  5HDG A;  1XSX A;  4OOI A;  4IJA A;  2JSC A;  1R00 A;  4P5O A;  3HOT A;  3L9F A;  5DV5 A;  2M5W A;  2EA4 A;  2LNB A;  1J9I A;  1S8N A;  4UHT A;  4A5M A;  3LWF A;  5FD6 A;  3BZ6 A;  5LGT A;  4BQA A;  1XMA A;  3LFK A;  4MHG A;  3BJA A;  2J5P A;  1ZGA A;  1OYI A;  2M30 A;  2FEZ A;  1OMI A;  1S3J A;  1ZRF A;  4ENJ A;  3BP8 A;  1ULY A;  3WTS C;  3MZY A;  2EFQ A;  2PJP A;  1WQ2 A;  4U7B A;  4M6Y A;  3W6K B;  2KKO A;  3KP3 A;  4EGY A;  2E1C A;  4Q5S F;  1YW9 A;  2YX4 A;  3FMR A;  5CVJ A;  3I59 B;  2ETH A;  2QBY B;  2UXX A;  1SFX A;  4JK1 X;  3REO A;  2DT5 A;  4P55 A;  1FYK A;  5BMZ A;  4B09 A;  1ZG1 A;  3IL2 A;  1CF7 B;  3GLX A;  2HQN A;  2IJL A;  1SFU A;  1MGT A;  2A61 A;  3FXQ A;  4HF1 A;  1QBJ A;  3QP6 A;  3DPT A;  2ESH A;  1P2F A;  4ZYE A;  1KU2 A;  2GA1 A;  4LMY A;  1SD6 A;  2VON A;  5D5U B;  5A2Q Z;  4EJO A;  4IHS A;  3Q9S A;  4ON0 A;  4P9U A;  3U9G A;  3GZ6 A;  4Q4Z F;  1K7A A;  4EJW A;  2COM A;  1E2X A;  1OPC A;  3F23 A;  4M73 A;  1DPR A;  1X3U A;  3MFK A;  1SD5 A;  4XBF A;  1FT9 A;  3GVA A;  4G94 A;  2E7W A;  2PI0 A;  5K5R A;  5ILU A;  2FQ3 A;  4CGZ A;  1IN7 A;  2FBH A;  2LDU A;  2OQR A;  4MQV A;  5D5V B;  2A07 F;  4L5I A;  2ELH A;  4I2O A;  4RB0 A;  2M45 A;  1FC3 A;  4CO8 A;  1R5G A;  3NRV A;  3EDP A;  3E6D A;  4UXN A;  4OMZ A;  2DU9 A;  3TKY A;  5LHI A;  2EV5 A;  1QZZ A;  3DKW A;  1P4X A;  3M1E A;  5LEJ A;  3J7A O;  2FBI A;  2QQ9 A;  4HYE A;  2WC2 A;  3QOP A;  2FF4 A;  3CO7 C;  2XV4 S;  2DI3 A;  4R8H A;  3KZY A;  3RKW A;  2EFP A;  1G3T A;  3WTZ A;  2NS0 A;  4HW0 A;  2R3S A;  3HRM A;  4M9Z A;  5IT9 K;  3M7G A;  2XAJ A;  1YW8 A;  3K9T A;  2C6Y A;  2EB7 A;  3WU1 B;  1R1V A;  2JTV A;  4FX4 A;  4HAM A;  3GXO A;  3Q9V A;  5D4S A;  3J80 K;  1AWC A;  1D5V A;  2K86 A;  4UVB A;  4CZZ A;  4BAY A;  2BGC A;  4I09 A;  5K5Q A;  3HSF A;  1O3Q A;  1ODD A;  4P9F A;  4CDG A;  4LLG F;  1S6L A;  1TNT A;  1XGM A;  3HRT A;  2DTR A;  2ZME A;  4WX9 A;  1O3S A;  1ZAO A;  4OIQ F;  4LJZ F;  3QU6 A;  3QPH A;  2VC1 A;  2W57 A;  4IHT A;  1XD7 A;  1K79 A;  5ICF A;  2V6C A;  3HHG A;  2FMY A;  2P5K A;  4YFX F;  5E17 F;  5LHG A;  4WK8 F;  3IKT A;  3ABU A;  3D5L A;  5HOO A;  3WE2 A;  4BHP A;  3CUQ B;  3F8M A;  1QGP A;  3H3Z A;  1Y0U A;  3TO7 A;  3JW4 A;  1YW7 A;  4YG2 F;  4BNC A;  4XLN F;  4LGW A;  4WXH A;  1HW5 A;  2HR3 A;  2STW A;  2NNN A;  2V1D A;  5AIP A;  2G7U A;  3IRQ A;  2RN7 A;  4LB5 A;  5L3G A;  4D0P A;  1FSH A;  5BS6 A;  1RIO H;  2H6C A;  1IXR C;  5HLI A;  2XGX A;  2B0L A;  3KEO A;  5BOX A;  3ECO A;  1EH8 A;  1IXC A;  2VC0 A;  2YPR A;  3V7S A;  5LGU A;  3HOS A;  3TO6 A;  5FO5 A;  2OQG A;  3M8E A;  1W7P B;  4KT5 C;  2V9V A;  2V1X A;  2DO7 A;  2EFW A;  3FMQ A;  4L9T A;  2Q2E A;  1MDM B;  4GXO A;  2ESN A;  1U2W A;  2GQQ A;  1JE8 A;  2ZO4 A;  2MA3 A;  5HS9 A;  2IVM A;  3QU3 A;  3KE2 A;  1PDN C;  2XAF A;  4G9Y A;  4LG0 A;  1B6A A;  1FYL A;  2AXL A;  2V79 A;  1GVJ A;  1EH6 A;  1WSU A;  1SFE A;  5FFZ A;  1FOK A;  1YLF A;  1FBU A;  1ZLJ A;  2VT2 A;  1JHH A;  3CUO A;  3TOB A;  1T38 A;  4HDV A;  3J81 K;  2CWE A;  1HKQ A;  2QEN A;  2FE3 A;  1XCV A;  4U0V A;  4G7O F;  2EK5 A;  1BJA A;  4EM0 B;  2W25 A;  3EUH A;  4L9V A;  2XIG A;  1YFH A;  3DEU A;  1O7F A;  1KQ9 A;  3HSE A;  1KYZ A;  1U5T A;  3L00 A;  3S2W A;  1XSV A;  2W85 A;  2VN2 A;  3BRO A;  3GFJ A;  2P4W A;  3ZMU A;  3TQN A;  4OIP F;  5LLQ A;  3PQK A;  4LK1 F;  2STT A;  3H92 A;  5DCM A;  2CFX A;  5AON A;  3L2C A;  4HDU A;  3GZ5 A;  4F7Z A;  3LA2 A;  2KJB A;  1REP C;  1YQA A;  5ED4 A;  2H27 A;  1WWX A;  1DUX C;  4K2E A; 
#chains in the Genus database with same CATH topology
 5ICC A;  4D5C A;  5M5Y J;  3G4S I;  2RQP A;  2VQG A;  1IZ1 A;  4NHJ A;  3K2A A;  4QLC U;  2X51 A;  4AVP A;  3NEU A;  5HDK A;  3EYI A;  3KP6 A;  3ABK H;  5CLS A;  4DYR A;  1SAX A;  5CJ9 A;  1LVA A;  1G2H A;  1TWA J;  5DS9 A;  4XON A;  3JAM K;  1QZE A;  3C7J A;  3NWS A;  2XKO A;  4OIO F;  1F9N A;  2LFB A;  3HKZ N;  4B48 A;  4XSX F;  3DEW A;  1FP2 A;  2UV1 A;  2FA5 A;  5M5X J;  5TIS C;  2GLO A;  4KDP A;  3GBG A;  1UB9 A;  4XSZ F;  3E5X A;  5B5E C;  4F92 B;  1N78 A;  4MNU A;  3ULQ B;  2ZJ2 A;  3ZQF A;  4BJT A;  1YIO A;  4U0W A;  2DFI A;  2ID3 A;  1XX5 A;  1W5T A;  4ESF A;  1TQM A;  2JA8 J;  4M74 A;  4LLN A;  2JRT A;  2BZT A;  4GGG A;  4I02 A;  3F72 A;  4PJM A;  3TL4 X;  4CYD A;  4Y3O A;  3D5R C;  4E7S A;  3S2D J;  2JA2 A;  2LKS A;  1K78 B;  3ABL H;  3ECH A;  5E8I A;  2B9S A;  3TOA A;  1H88 C;  2HFH A;  3JSP A;  1LQ1 A;  4EGZ A;  1YJN I;  1T6S A;  2ZSI B;  3R0A A;  2GOX B;  4BEH B;  2O9L A;  3ZQH A;  5LBQ A;  4BE1 A;  3DBL B;  2DK8 A;  1B9M A;  4ZC3 A;  1O3R A;  4S04 A;  4IPA A;  4HF2 A;  1Y1V J;  1QVU A;  1R22 A;  1X4O A;  2DQL A;  3K0L A;  3D5S C;  3L2R A;  2JWT A;  5CVR A;  1MBH A;  3L1P A;  4CCJ A;  1O3T A;  2PFB A;  3RIR A;  4IRI A;  1IRG A;  4EVI A;  1OYW A;  1BOA A;  1HST A;  5DTD A;  2A6T A;  2EA2 A;  4L0Y B;  1YOV B;  4A0X A;  4RAG A;  3K4J A;  3P9K A;  3ZPL A;  3JRE A;  1VQN I;  4NQW B;  4IZZ A;  4RGR A;  4R1H A;  4RB2 C;  2X0L A;  4XL9 A;  3BG7 A;  1R7J A;  2IAI A;  2E34 A;  1APL C;  1DPU A;  3VSK A;  2H94 A;  2V7F A;  5IPA A;  3DCF A;  2IGK A;  4UV9 A;  4IHX A;  2MW8 A;  4GRI A;  1BN5 A;  2EIJ H;  2OAZ A;  3OMY A;  5IYB J;  2QSH X;  3RZD J;  4XN3 A;  1FOW A;  4JBA A;  4NB5 A;  5FLM J;  4FAS D;  3KLO A;  3F3X A;  4A3G J;  3HSR A;  1MJB A;  3P5J A;  2O3F A;  5L3D A;  4RB1 A;  2MFZ A;  3C18 A;  4DJA A;  3N97 A;  2BHY A;  1JT0 A;  1MSE C;  1J09 A;  2XPV A;  2EV6 A;  1V5G A;  2VPL A;  1ENH A;  3VYS B;  3CTA A;  4XKB A;  5CVU A;  4EM1 A;  5LEK A;  3PFY A;  4J00 A;  1FBQ A;  3ZOB A;  1GUU A;  2XHK A;  4A3C J;  3ELK A;  1QO0 D;  4OAY A;  2R7Q A;  3S3O A;  2VJ4 A;  2V1N A;  5FRM A;  1FJL A;  3PL8 A;  1OCC H;  5LHH A;  1VTN C;  4LG3 A;  3OIP A;  3FM3 A;  1JGS A;  3BR1 A;  5ICG A;  2DTZ A;  2XB5 A;  3FM5 A;  5IT3 A;  1TT5 B;  1FOY A;  3FKJ A;  2NOG A;  2DMQ A;  3OYL A;  2IA1 A;  4V2F A;  5FRO A;  1V5E A;  1S29 A;  3QYF A;  5EDN A;  2ZME C;  2KJC A;  1J75 A;  3AG4 H;  1XS9 A;  1AA7 A;  3AG2 H;  4EJT A;  3CCQ I;  1MMN A;  2L01 A;  4RB3 C;  1Y6I A;  5KK1 A;  1TWH J;  2CMP A;  4IL6 C;  3I53 A;  4UV8 A;  1JJ8 C;  2HOE A;  2XAG A;  1GHC A;  2V9K A;  4O5V A;  4WXD A;  3LSH A;  4FQG A;  3I59 A;  5JVT A;  2VE9 A;  1RZ4 A;  2QBY A;  1X1P A;  4KT6 A;  3CLQ A;  2PQ8 A;  2BV6 A;  3R6S A;  3ZMV A;  3RPU A;  4YRV A;  1HKS A;  4YIF A;  2DA7 A;  3F8N A;  2EPF A;  3H9J A;  1OR7 C;  3A2K A;  3QQA A;  1UHW A;  1CF7 A;  2YU9 J;  2PN6 A;  2K4B A;  3RPQ A;  5FKM A;  2LBF B;  4MEY F;  3ZMZ A;  3A0B C;  5JI6 A;  3CJQ B;  2HQR A;  1UHS A;  3QYB A;  4RS8 A;  1S9H A;  1ZAR A;  3M8F A;  1WKM A;  2E36 A;  4HPQ A;  5LRS A;  1X1C A;  1YJ9 I;  2M9H A;  1B4A A;  2NS7 A;  4I0A A;  3ZMT A;  3A0H C;  2JZY A;  4QTR A;  1JGG A;  1TNS A;  5GAG J;  1DP7 P;  1P6R A;  2OTJ I;  3ISP A;  1ZGW A;  1D5Y A;  5LGN A;  2OBP A;  3KLN A;  2PX9 A;  4P1W A;  9ANT A;  2DYR H;  1LVK A;  1SEU A;  3HOY J;  1HDP A;  1HW2 A;  1GLN A;  3E6B A;  1ZLK A;  4A93 J;  1U9O A;  5F6F A;  4HV5 A;  4Y15 A;  2HXO A;  2QYO A;  3EUA A;  1D8J A;  3S1Q J;  1Y56 A;  3HKZ A;  4BQN A;  1IRX A;  3V8J A;  3CCL I;  1A35 A;  1FSE A;  3JSO A;  2O6G E;  4RLF A;  2HTJ A;  1P9Q C;  2JUC A;  1BC8 C;  3I4M J;  1UST A;  5C44 J;  1KQ8 A;  1ITY A;  3GX4 X;  3WGG A;  3KET A;  3V8L A;  3K4K A;  5IYD J;  3BR0 A;  4BGD A;  4MEX F;  1IAW A;  2FML A;  3OYI A;  1P4A A;  4A3I J;  2DMP A;  4ZH4 F;  2EZH A;  2R7V A;  2D2W A;  3ASN H;  2R4G A;  1QQI A;  2K02 A;  3PFI A;  5FFX A;  1FP1 D;  3BG5 A;  5C4X J;  3F8C A;  4Q47 A;  4GYG A;  4E7Z A;  4BXX J;  1U78 A;  4M3D A;  1ETQ A;  2Y69 H;  1R5I D;  2D45 A;  2EZK A;  4PSX A;  4IQ4 A;  2A68 F;  1J7K A;  1HCR A;  1W36 D;  1HC8 A;  2PMZ N;  4XRF A;  3S1N J;  2X6W A;  1P92 A;  3MN2 A;  1BBY A;  2BW3 A;  4II2 A;  1JKP C;  1D8K A;  2HTS A;  3PUB A;  5TRD A;  3V7C A;  3DTK A;  1CGP A;  2JUG A;  5GTH C;  5EYR A;  2IS1 A;  3WE3 A;  3FZV A;  5C3E J;  1QVT A;  3LSI A;  3HZJ A;  3RYP A;  2YU3 A;  1O4X A;  4EJV A;  5M5W J;  2G0E A;  2W4S A;  2IP2 A;  2ZNZ A;  4HOB A;  1UCR A;  4AIH A;  1O57 A;  3DTE A;  2O0Y A;  3D1N I;  2LC2 A;  1FLI A;  3ASO H;  2HWV A;  3COA C;  3H9Q A;  1P7J A;  3QOD A;  4KYW A;  1XMX A;  5FKK A;  2M34 A;  4GFB A;  1BR1 A;  1MH3 A;  3FF5 A;  4LIT A;  1KZH A;  1ETW A;  2X1E A;  3U1D A;  5JR3 A;  5EGO B;  2KQR A;  2IGN A;  2W1O A;  3LSJ A;  3QPL A;  3RKY A;  3U21 A;  1DU6 A;  5CVI A;  4FET A;  3CCY A;  4M9X A;  3E5U A;  2E7X A;  3EUH C;  1B8I B;  1E3H A;  2YX7 A;  3G1O A;  4YEJ A;  2ZJQ F;  5FLX K;  4KJZ A;  4CCO A;  3LNQ A;  2R7R A;  1A36 A;  5D5W B;  3KZZ A;  4A69 C;  4X0G A;  5B66 C;  4A6D A;  1U5T C;  3GME A;  2LVS A;  3A03 A;  2A5Y B;  1ACI A;  4A3D J;  3ERM A;  2A69 F;  1FY7 A;  4HF0 A;  2VBY A;  1G3S A;  3BQY A;  1LDJ A;  2QQB A;  3ZN1 A;  1F43 A;  2LF8 A;  4Q48 A;  2TCT A;  4GYI A;  5E3O A;  4HX8 A;  4KA4 A;  3GW2 A;  4IHY A;  2Z9O A;  2OPT A;  3F8F A;  3IHU A;  4HSR A;  2VL8 A;  4CCM A;  2LLK A;  2LSO A;  2VOO A;  2UXN A;  1L3L A;  3HUG A;  2R5Y B;  3ZQL A;  4J19 A;  4HNV A;  4ESB A;  1IJW C;  3DLL F;  1IN5 A;  3OL3 A;  3BTI A;  1HSJ A;  1QZY A;  2DAO A;  2KLO A;  3JTH A;  3PIO F;  2MYS A;  2X48 A;  2Z3Y A;  4XRS G;  5J8C A;  4NUB A;  3H36 A;  2ME6 A;  4M3F A;  3JRC A;  4IOC F;  2DBB A;  1RRJ A;  2GXA A;  5FD5 A;  5H6Q A;  3BWG A;  4A3E J;  3Q5F A;  4ABZ A;  1D0Z A;  1BI1 A;  5GAH J;  4G6D A;  1JTY A;  2R7T A;  4ZYH A;  1V55 H;  3DQV C;  4IXA A;  1T39 A;  1ZRD A;  1JXS A;  1JUM A;  2L4M A;  1TL8 A;  5JHU A;  4Z6Y A;  5FGM A;  5HLG A;  3HTU A;  3GZN B;  4A5N A;  5B1B H;  3CCU I;  2IA2 A;  4OIR F;  4IHV A;  4L0Z B;  1W5C C;  2IS2 A;  3W2A A;  2HU9 A;  3U1K A;  3O8H A;  2DA1 A;  2XB0 X;  1ON1 A;  3CUQ A;  1F1Z A;  2VKD A;  1JKO C;  4E7H A;  4BE2 A;  4NBQ A;  4M9S A;  4XKW A;  2JJ7 A;  1PJR A;  4PJJ A;  3MAJ A;  1TW3 A;  3DEE A;  1I27 A;  2K9L A;  1SVL A;  2XKP A;  2MD0 A;  1EF4 A;  2B7E A;  2CW8 A;  4HZF A;  3ZRG A;  4UUS A;  2KRF A;  1JI8 A;  2AS5 F;  4P96 A;  4N9H A;  5K7H A;  4CUG A;  3IC7 A;  5D6E A;  1YIJ I;  2KIF A;  2P7C B;  1UFM A;  4LOC A;  1J2X A;  4PGH A;  4ANJ A;  2D1V A;  2DOF A;  2YSR A;  5E18 F;  2R5Z B;  4AIK A;  2IXS A;  2W7N A;  1NK2 P;  3FXO A;  4PCQ A;  2HEO A;  3DXJ F;  4AD9 A;  2K9S A;  4EV0 A;  3PO2 J;  2R7O A;  3QPT A;  1OKR A;  2VB6 A;  3GEZ A;  1S7E A;  4R79 A;  3D0S A;  3HJE A;  3OS2 A;  4CIC A;  2KIM A;  3A02 A;  2PG4 A;  2L0K A;  1ZN2 A;  4EJU A;  4AIJ A;  1HW1 A;  2D1H A;  2MLK A;  4Y33 A;  2G7H A;  1LJ9 A;  4E7I A;  2BBY A;  2F5C A;  1PUF B;  3A01 B;  3H9G A;  2ZNY A;  3RDI A;  5LRR A;  1UJ8 A;  1JTX A;  2YS9 A;  1F4K A;  1W7P A;  5BQT A;  3W2V A;  3QP5 A;  1S72 I;  1VND A;  2R7Z J;  1SMY F;  2PMZ A;  1U0J A;  1TTY A;  2JPB A;  3BJO A;  3VPR A;  1MMG A;  2E5Z A;  2H1L A;  5E8G A;  2XGC A;  1DQU A;  3CME I;  4BJ5 C;  1MDM A;  1PP8 F;  1RUN A;  2A05 A;  3DPL C;  1BOB A;  2I10 A;  1PUE E;  2K40 A;  4FX0 A;  1X19 A;  1FIP A;  2XUB A;  3WTV C;  3LQR A;  1JHF A;  4G12 A;  3E6M A;  2IRF G;  1UZC A;  3DLA A;  1VI0 A;  3S93 A;  2DQR A;  1FNN A;  1Z05 A;  4ITV A;  4MTE A;  2VKH A;  4BQO A;  2JQ7 A;  5E1W A;  1S7O A;  2DJN A;  3X2Q H;  2L54 A;  1V5F A;  1XGN A;  3K1N A;  4XRM A;  3BR2 A;  5DCF A;  5ILV A;  4MGR A;  3ESW B;  1GXQ A;  2DMU A;  1IG7 A;  4ZDO A;  1U6G A;  2FX0 A;  1E3O C;  4TV7 A;  1FZP B;  3I0T A;  2GOM A;  3BG6 A;  3BPV A;  1I5Z A;  1BA5 A;  1BC7 C;  4QSH A;  2JPC A;  2PJR A;  3MCZ A;  1B9N A;  1HLV A;  1AU7 A;  1YYV A;  4LIV A;  2CSO A;  3R0J A;  2O5R A;  2DPD A;  4XLF A;  1CQT A;  5HDN A;  2EFO A;  2K3F A;  2R0Q C;  2FJ1 A;  4JQF A;  4EMS A;  3Q0V A;  3I9V 2;  4B43 A;  1D3Y A;  2BE5 F;  2G9W A;  1HBX G;  2IPQ X;  3KPH A;  4B8X A;  1DP3 A;  1MW7 A;  4EM2 A;  2QSG X;  3OSG A;  2NXN B;  3I4N J;  3FXM A;  3PNT A;  3OYB A;  2JSP A;  3S32 A;  1NG7 A;  5EG0 B;  5IT9 Z;  3DKY A;  2A3S A;  1WI3 A;  3HM5 A;  2E1M B;  4BHC A;  2VQH A;  3FMS A;  2K4J A;  4KMF A;  4O6J A;  2KDZ A;  2GIV A;  2XAS A;  3ZXS A;  1KGS A;  3J80 Z;  4I01 A;  4DBR A;  3L7W A;  2ELK A;  1LDK B;  3I5U A;  4ENK A;  2CQ7 A;  5IP6 A;  2ISY A;  4JX5 A;  1FTZ A;  2QZ8 A;  3RYR A;  4XK4 A;  4RGU A;  2V1U A;  1IRF A;  1BM9 A;  1LE8 A;  2KT0 A;  2MH2 A;  2RDP A;  2RV8 A;  2Z16 A;  4J01 A;  1YO5 C;  1EV7 A;  5CVV A;  3N4M A;  3J7A Y;  1KA8 A;  1RET A;  3IRR A;  4IQJ A;  3BG3 A;  4HNT A;  2HNH A;  2DCE A;  5E3N A;  2PLY A;  3ZP5 A;  2JA6 J;  3GUD A;  3FWE A;  1QPI A;  3E0J B;  1TW2 A;  3KYL A;  2HVQ A;  1TBX A;  3JRI A;  4HBL A;  3IKV A;  2Z99 A;  2ECC A;  1VQ5 I;  1I3Q J;  4AC0 A;  3QRF F;  1EH7 A;  1HQC A;  3B73 A;  2W24 A;  3AKZ A;  1XN7 A;  2BY0 A;  2WBM A;  1WJ5 A;  2Q1Z B;  2Z33 A;  3HOZ J;  3BDD A;  5FJ8 J;  4A0Z A;  3R60 A;  2R7F A;  3SQN A;  1JJ6 C;  3V7R A;  3GCM A;  3S16 J;  4JX4 A;  4A3B J;  1S7A A;  4L9J A;  4RBO A;  1UMQ A;  5DUK A;  3RI4 A;  4OU0 A;  4G7Z F;  2VJ5 A;  1H9T A;  3VYR B;  4FHT A;  4M6V A;  2A6E F;  2FRH A;  3ROU A;  2DW4 A;  3OS0 A;  4Z2Y A;  5BPI A;  1XC5 A;  3DTI A;  3GO5 A;  1Z6T A;  3RJP A;  1G3W A;  3KP7 A;  5E1X A;  1A04 A;  1IW7 F;  2CQX A;  3LSM A;  3T1B A;  1WCM J;  5DD4 A;  2HPM A;  2XAH A;  2ZFW A;  2VOD A;  3TW6 A;  1K78 A;  2P6S A;  5J1R A;  1QPM A;  3GTQ J;  1MMA A;  5F04 A;  5KNL A;  3EQL F;  4HQM A;  2J5O A;  3IAM 2;  3BLY A;  2KRC A;  4QIW N;  4BEH A;  2M3A A;  3CCV I;  2FXA A;  4E70 A;  2GWR A;  1JUP A;  3H3V K;  1ZYR F;  4BL0 B;  4ETS A;  4QPO A;  1AOY A;  2MBF A;  2GZW A;  1OJL A;  3F6V A;  1I6H J;  1WJF A;  4BY1 J;  3S3M A;  2ECB A;  5CYV A;  5FB2 A;  5A2Q K;  4KUM A;  2M4K A;  2OD5 A;  2Y9Y A;  4I98 B;  3A4C A;  1VQL I;  3MZ8 A;  3I54 A;  3MEX A;  5HS8 A;  3CCM I;  1NHA A;  2WAE A;  4UVC A;  5BPD A;  3RKQ A;  4NQW A;  3AL0 B;  1WH5 A;  3V8K A;  3KP2 A;  2MC3 A;  3M4O J;  3IUO A;  1MMD A;  2DMT A;  2HGC A;  3WOD F;  2VT3 A;  3UKG A;  1R71 A;  2AQE A;  3GTK J;  3C1D A;  1ON2 A;  3WHC A;  4MTD A;  2X1C A;  1BI2 A;  2EZL A;  1EA3 A;  4CZC A;  4ZZL A;  2K5C A;  2DOE A;  3C2G A;  1E0E A;  1XB4 A;  3G1M A;  5JVG F;  4OIN F;  3S14 J;  5EZG A;  1IRZ A;  4BY7 J;  3H5A A;  4Y13 A;  4G8X A;  3RSN A;  4CH7 A;  2O7O A;  5GPC A;  2FOW A;  1IF1 A;  1TQI A;  1AKH B;  3DF8 A;  4BHB A;  3OS1 A;  4IRH A;  4XRS A;  4U7D A;  1XSD A;  2DA3 A;  4ZZD A;  1Z1D A;  2WTE A;  2NNY A;  4A12 A;  1ETX A;  2UWM A;  1LB2 A;  2Y30 A;  3SDG A;  5F0C A;  3WTY C;  2K9M A;  1BIA A;  5DD8 A;  3CC2 I;  4BYY A;  3O6B B;  3M1C A;  3I71 A;  3G73 A;  2Y0M A;  4AU7 A;  3K4L A;  4M72 A;  4HX7 A;  2H09 A;  5J3L A;  3K2Z A;  2QVO A;  4EAT A;  3SXY A;  5D5X B;  4DZP A;  3TGN A;  4A6E A;  3ZN0 A;  1OYY A;  1SMT A;  5IP9 J;  3O3K A;  2DDA A;  2LR8 A;  1B1B A;  2Q8K A;  1MJA A;  1U9N A;  3CO6 C;  4BKX A;  2MAB A;  1Y1W J;  3LOC A;  2HYG D;  1V54 H;  2DT6 A;  2JT1 A;  3E5Q A;  3SEQ A;  1F5T A;  3KP5 A;  4RGS A;  3VWB A;  4DNC A;  1PVE A;  3VSL A;  3MWM A;  4S05 A;  2L4A A;  4XKC A;  2VLA A;  4ESJ A;  3B6C A;  3G6E I;  2FD5 A;  4UNO A;  3F22 A;  4EQQ A;  3J81 Z;  3JCU C;  2F2E A;  1R9T J;  4RAF A;  4FCY A;  2VQC A;  3GF2 A;  4LIU A;  4RMN A;  2XRO A;  4HV6 A;  2F4O B;  4RAY A;  4BAC A;  3DBH B;  3I3L A;  2LRE A;  3AAF A;  4G6T B;  1LUJ B;  1X4P A;  1Z77 A;  4ZYG A;  3WTX C;  2LYC A;  2VQL A;  1WGX A;  2GBY A;  3H5N A;  4N0B A;  3VYU B;  3CUQ C;  4S0H B;  1BIB A;  3HOV J;  3HRU A;  2EIK H;  1E3P A;  3J7Z I;  2ZCW A;  1FWZ A;  1KU3 A;  2W00 A;  5B3S H;  2CH0 A;  4UUV A;  3ONQ A;  1ZG5 A;  3H5R A;  3IV5 A;  1STZ A;  2OZU A;  4PUS A;  1R4M B;  2ISZ A;  3WTT C;  1N75 A;  1ZHF A;  1MNE A;  5F64 A;  2MC4 A;  4IF4 A;  2CW0 F;  1KQ0 A;  3LMM A;  2MH9 A;  3T8R A;  5E20 A;  1RR8 C;  2GAU A;  3RKX A;  3BZC A;  1Z7U A;  1RC9 A;  4XLE A;  1T98 A;  4I7H A;  2K7L A;  1XDS A;  3LSR A;  1T08 B;  5EEA A;  5ILS A;  5L3F A;  2VAS A;  4LB6 B;  2NVQ J;  3MVP A;  1BI3 A;  2RVC A;  1VQ7 I;  2IW5 A;  4XIC A;  2BXZ A;  4UVA A;  2ADU A;  3OYJ A;  1IN8 A;  3JTG A;  3CLO A;  1R58 A;  2HYF A;  2Z5U A;  1IC8 A;  4PJN A;  3HIF A;  3OV8 A;  1K6O A;  1XTA A;  3DP7 A;  3KP4 A;  2O8X A;  1ZGJ A;  5KAI C;  5HVQ C;  2OZ6 A;  2PBI A;  1KYW A;  1Z21 A;  2VE8 A;  4ASN A;  2HKO A;  2L02 A;  2E2H J;  3MZH A;  1WZ2 A;  4ZDP A;  2IGO A;  4EEF G;  3HEF A;  2M87 A;  3JRB A;  2VOP A;  2RNG A;  4MQ9 F;  2PMH A;  2CO5 A;  4CYC B;  2M0M A;  1ZH5 A;  3ZGK A;  1KU9 A;  3RTR A;  5K7Z A;  3KCC A;  3K7A J;  3JAM Z;  4N9I A;  2OV7 A;  5F1R A;  3VEP A;  2NAZ A;  2HPI A;  1R1U A;  2TRT A;  5FKO A;  4KN4 X;  5IOZ A;  4PGG A;  4ENM A;  3KFW X;  4NNJ A;  4AYB N;  2HZD A;  4E7J A;  3BCA A;  1I50 J;  4OWR B;  3ZQQ A;  4L5E A;  2QLZ A;  1I1S A;  3FX3 A;  3G71 I;  3WGH A;  4FIS A;  3CDI A;  1G6N A;  3P9I A;  3C3W A;  2E1O A;  3GFM A;  2WWY A;  3O2P E;  4AM3 A;  4PDK A;  3DKX A;  1Y0N A;  1LEB A;  1RUO A;  2QUF A;  4KIC A;  2RGV A;  1ZG3 A;  2E35 A;  2VBW A;  1IN4 A;  2BXY A;  2DPU A;  2NYX A;  1X1B A;  3JRD A;  1TT0 A;  2F5D A;  1X3W B;  3TBI A;  5E1Z B;  4F52 A;  3S2H J;  4CCL A;  3CJN A;  2LF7 A;  4RM3 A;  4IHW A;  2E2I J;  3ZQ7 A;  4XLA A;  2LOO A;  3AFH A;  1YG2 A;  2O03 A;  3OR2 C;  1RNL A;  3VFZ A;  4PK4 A;  4YFK F;  5CKT A;  2YR2 A;  2KMU A;  2WAQ N;  2FBK A;  3V42 A;  1UAA A;  3G3Z A;  1UEL B;  1Z91 A;  2E2J J;  3VOE A;  2EZI A;  5IY5 H;  5DYM A;  3S8P A;  3OYD A;  3FXR A;  4XLC A;  1Y8Q B;  1MSF C;  2DYS H;  3LA3 A;  3PSF A;  3FHN A;  5EGO A;  3W6J B;  3MMY B;  3OYA A;  2F48 A;  1P4W A;  2R7U A;  1MBF A;  1B8I A;  5J40 A;  1SD4 A;  3ZMD A;  2K27 A;  4IO9 F;  1QHG A;  4WWC A;  3TED A;  3IWF A;  5J8F A;  1ZEL A;  4LK0 F;  1YX3 A;  1U8B A;  2X9D A;  3CDL A;  2O61 A;  4C3I J;  4A3J J;  3HHH A;  1WJC A;  2VXZ A;  3H35 A;  4L5J A;  1VQ8 I;  3B6A A;  2RKH A;  3WTW C;  3ABT A;  3HOW J;  4XNF A;  3KX2 A;  2ZJR F;  2NRA C;  1Z6R A;  1T95 A;  5L3E A;  1QRY A;  4YII A;  3CMM A;  4FT8 A;  2ZXW H;  2BOL A;  3RZO J;  1YS7 A;  2B63 J;  2CQK A;  4RGX A;  2GM4 A;  4MFE A;  1K6Y A;  2VBZ A;  5D8K B;  1POG A;  5FRN A;  2Y2Z A;  3SYT A;  5H20 A;  2R5Y A;  4KNY A;  1FPQ A;  1QU3 A;  2CQN A;  3CQZ J;  2EH3 A;  2LH9 A;  1MBE A;  3FXK A;  2M4G A;  2KIU A;  3L2W A;  3RCO A;  4BH9 A;  1HF0 A;  4X6A J;  3E6C C;  2XAQ A;  2A6H F;  2K9N A;  3K69 A;  2WY7 Q;  2FNA A;  1IUY A;  1IDZ A;  5EEG A;  3FXU A;  2L7M P;  1DU0 A;  2TDX A;  5DM6 F;  3OOP A;  2FOK A;  2NVY J;  3CP2 A;  2R92 J;  3GYH X;  2XRN A;  4B47 A;  3HOX J;  1UHM A;  1OCT C;  3SZP A;  3RPU D;  3OYE A;  5EEH A;  1LNW A;  4OMY A;  3BY6 A;  3GWZ A;  3EET A;  3DBR B;  2MD5 A;  5E79 C;  2WV1 A;  2M8E A;  3M07 A;  2OTL I;  3IH2 A;  1HXD A;  2DLL A;  4BBS J;  3QPS A;  2EWN A;  4AWX B;  2DFE A;  4DYQ A;  3F0C A;  3FK6 A;  1WRJ A;  2QKL B;  4HA8 A;  1T0F A;  2L2O A;  4LFU A;  3WTU C;  2JVH A;  3SZG A;  2X6X A;  1QNT A;  2ICW G;  3WHB A;  2GXG A;  4HNU A;  3OYC A;  2HDW A;  3TP0 A;  3S1M J;  4D7M A;  4LD5 A;  1MBJ A;  1B59 A;  2RC4 A;  2YUS A;  5D8L B;  4KIB A;  3LAP A;  1YTY A;  3HL2 A;  1UG0 A;  4LLL A;  4YIR X;  1U3E M;  1FMW A;  4GO1 A;  1TP4 A;  3ZMS A;  1C0W A;  1XG1 A;  3GLL A;  1XMK A;  3QAH A;  3LSP A;  1K4S A;  2WAF A;  4H0E A;  2P0W A;  2PMU A;  3VB2 A;  3K10 A;  3QOE A;  2R5Z A;  5CQG A;  4HQE A;  4V19 K;  4WCG A;  4GDF A;  4ZTF A;  1GXP A;  3HYI A;  2ACJ A;  1T8I A;  2NS8 A;  3LL7 A;  4G7H F;  4N4O B;  2VBX A;  3OL4 A;  1TZL A;  3L2V A;  3GTM J;  2XGE A;  1MJ9 A;  3R61 A;  5JFR A;  1YJW I;  1LFU P;  4Y52 J;  2KZV A;  3WG9 A;  3L2Q A;  2RNJ A;  1WJA A;  2LY2 A;  2XVC A;  1FMV A;  1BI0 A;  3DV8 A;  3WGI A;  4PFP A;  3WU2 C;  1G3Y A;  2MG4 A;  4RAZ A;  3TDZ C;  3ZQC A;  4AYB A;  4KIF A;  3B02 A;  2HZT A;  2E60 A;  3T0Y A;  2HS5 A;  2LY1 A;  1HA8 A;  2Y75 A;  2LP0 A;  2ZME B;  1PUF A;  1OR7 A;  3W3C A;  3A01 A;  2VKV A;  3KYD B;  2IA0 A;  2DK5 A;  4PFO A;  1RKW A;  2D5V A;  5FKN A;  1G4D A;  1V3F A;  2BYV E;  2R7D A;  3RQ4 A;  4CCN A;  5ICE A;  2XDV A;  3IAS 2;  1XDU A;  4OAZ A;  2W84 A;  4U87 A;  2HQA A;  3PSI A;  2EV0 A;  2F6C A;  3BC8 A;  2R7X A;  2IT0 A;  2QCO A;  2BEO A;  2VKE A;  2DA6 A;  1W4M A;  2DFF A;  2W82 A;  3M3Y J;  1MH4 A;  3U2R A;  1U8R A;  1TC3 C;  1OIS A;  1YE9 A;  2WAQ A;  3QWL A;  5DDG A;  2L9S A;  3EYY A;  5E3L A;  2CYY A;  3E3V A;  3FBN B;  5IP7 J;  1PYV A;  4C30 A;  3PO3 J;  1J0R A;  4IVN A;  3TDU C;  3CC7 I;  1W5S A;  1DGR M;  4UB8 C;  1SFO J;  1OCR H;  3C2H A;  3R4K A;  3ZCO A;  4Y7N J;  4YFN F;  3KZI C;  1VQP I;  2JA5 J;  4BU2 A;  4A2U A;  1A6Q A;  5DM7 F;  1ZTR A;  1P7I A;  2OA4 A;  3BR6 A;  3BT9 A;  2M8G X;  3JRH A;  1Z0X A;  5J6X A;  1PP7 U;  1WJE A;  2CG4 A;  4ENN A;  2CQQ A;  4JOM A;  3IWZ A;  1AHD P;  2P8T A;  3MQ0 A;  4HX4 A;  3HOU J;  1Y8R B;  2X4H A;  1W1W E;  3HTS B;  1B72 B;  3CP8 A;  3GFL A;  3S17 J;  3GFI A;  5K1Y A;  2QQA A;  5IOY A;  1V4R A;  2PEX A;  5EG0 A;  1J59 A;  4KMU X;  2XC7 A;  1O7L A;  1I6X A;  1ETV A;  1R23 A;  2HKX A;  4XLP F;  1SAU A;  2ELJ A;  1VQ6 I;  4CXF A;  1ZKG A;  2FNP A;  1XCB A;  4ZYD A;  5F08 A;  4A0Y A;  5FLX Z;  3V4G A;  2QEX I;  3CCJ I;  3P7N A;  3FKI J;  2AXT C;  4L18 B;  1T56 A;  3P9C A;  4U0Y A;  5D6F A;  3BR3 A;  1EKE A;  3S1R J;  1FOX A;  2XSD C;  5K5O A;  1J5Y A;  3HBL A;  2DT7 B;  4BDY A;  4MFD A;  2DXI A;  2L7K A;  3KYC B;  1GT0 C;  1LFP A;  3ZQG A;  3S3N A;  2F5E A;  2OU2 A;  3HB9 A;  3JR9 A;  3CMA I;  2Q2E B;  2LKP A;  1ZR2 A;  1IXS B;  1SD7 A;  1XGS A;  1Y39 A;  2Q0O A;  3CCS I;  2IGM A;  2CS3 A;  4MIM A;  4QWQ A;  4UUT A;  3F21 A;  2UZK A;  1X1A A;  2QM3 A;  1TQP A;  3O8G A;  3HPH A;  1YS6 A;  5TJJ A;  1DDN A;  4IRG A;  2VXD A;  3PQJ A;  5HLH A;  1ZRC A;  3SFZ A;  4DBQ A;  2ZXH A;  2LD5 A;  4LG0 B;  3AG3 H;  1RI7 A;  1SVM A;  1R36 A;  2ZKZ A;  4BE0 A;  1ERD A;  1ZRE A;  2WB1 N;  4D9J A;  2ZBK A;  2FSW A;  3I64 A;  1TWF J;  1EJ9 A;  1Z9C A;  1IN6 A;  3JRF A;  4C2M J;  1E17 A;  2OJE D;  2DOD A;  2Y0S N;  1YRN B;  1USS A;  3BOQ A;  3OYM A;  1I39 A;  2M2E A;  4B4C A;  4F93 B;  1I1G A;  1VZ0 A;  2V26 A;  1FX7 A;  4RA2 A;  5GAD J;  4CA0 A;  2LY9 A;  2LTP A;  3K4B A;  4XOR A;  1T2K A;  2P6T A;  1FBS A;  1W0T A;  1FYM A;  2CFO A;  1D1C A;  2MSY A;  1Q1H A;  3TO9 A;  2P5V A;  2QSF X;  3PM1 A;  3S15 J;  2CGP A;  1WI9 A;  5J4Y A;  3K1M A;  4L9N A;  1OLT A;  3CF5 F;  4HLX A;  4I0B A;  4KFC A;  1MMS A;  4AVZ A;  2L3D A;  2P5L C;  3OR1 C;  3BJ6 A;  4PZJ A;  3FHZ A;  1Z3Y A;  3MKW B;  2X6Y A;  1U5T B;  2CUJ A;  1K61 A;  3KEY A;  4PJL A;  4DQ2 A;  6PAX A;  2CW7 A;  4NDL A;  5D4R A;  3I4P A;  2AQF A;  1WFX A;  3JRG A;  3LAJ A;  1MD0 A;  3K1P A;  2HQ5 A;  1BL0 A;  2XRL A;  5L3B A;  2H8R A;  3I58 A;  3SEZ A;  3BPX A;  1KU7 A;  1NG6 A;  4M6X A;  5AIQ A;  4E6K G;  1MIJ A;  1BJZ A;  5JLW A;  4U88 A;  2NVX J;  3H0D A;  1LEA A;  1MND A;  3HRS A;  4JP0 A;  3LST A;  2EFN A;  3M9A A;  5ERI A;  2Y48 A;  5DCM B;  5KVR A;  3E97 A;  2LKX A;  3OWT A;  3FIS A;  4BUP A;  3ERE D;  1VFC A;  1R5H A;  2FQ4 A;  3VOD A;  5HS7 A;  4B44 A;  4CSW A;  5EF6 A;  2HDC A;  1W7P D;  2WV0 A;  3L09 A;  3ML6 A;  4Y17 A;  3F8B A;  1H0M A;  5DEQ A;  2OC6 A;  1S5L C;  1LKX A;  3CDH A;  1OFC X;  3LSK A;  4BDZ A;  2BY3 A;  3SHF A;  3BTL A;  1Z3X A;  3T8T A;  4HLY A;  5DUI A;  3WU0 A;  3SZT A;  3GTJ J;  4XQF A;  3PNV A;  4JX6 A;  3FK7 A;  1H8A C;  3NWT A;  3F6O A;  4B3A A;  1AKH A;  2OUM A;  5H6R A;  2F5F A;  3MD2 A;  4KIG A;  1YHQ I;  1HKT A;  2OF7 A;  5J1U A;  5FKL A;  3Q0W A;  3L2U A;  1NH3 A;  2R93 J;  2P7V B;  2QKM B;  4BQQ A;  3K70 C;  3H1C A;  2M7B A;  2ZC2 A;  2H6B A;  1H9G A;  5J47 A;  3RQI A;  3LQQ A;  4G6Q A;  1RPW A;  4WXC A;  1XPX A;  4IEJ A;  2COB A;  4CCK A;  4M71 A;  2DA4 A;  4BXU A;  1FTT A;  4YEL A;  2M1B A;  4PSW A;  1MZB A;  2VJI A;  4O3M A;  4KN7 X;  2GA2 A;  4XLH A;  4WF2 A;  1X1D A;  3DFG A;  1MKM A;  3BTJ A;  3T5X A;  4DW6 A;  3CCR I;  5F27 A;  3UNG C;  2MLG A;  3ABM H;  2QWW A;  2W48 A;  3IH3 A;  2DDB A;  4HEA 2;  5K7F A;  2EIM H;  2HI3 A;  4CHU A;  4GCV A;  1LPQ A;  3CCE I;  1L0O C;  2CUE A;  1RKT A;  5L3C A;  4RDU A;  1M1E B;  2E1N A;  1TLH B;  5BNG A;  3LA7 A;  4D1Q A;  2O8K A;  1R4N B;  4FE4 A;  5B1A H;  1ONV A;  2XGD A;  2Z1D A;  3NAR A;  1LDD A;  2K3P A;  2ZB9 A;  4FTH A;  4V2G A;  3H3U A;  5E3M A;  5HNH A;  2JK3 A;  4H4K C;  3GTL J;  2FU4 A;  3DU5 A;  2EJR A;  4AID A;  4E4H A;  1XGO A;  2GXB A;  2IBD A;  4NC7 A;  2VJJ A;  4IX7 A;  2HVR A;  1R1T A;  2XF5 A;  3PJR A;  3KEQ A;  1T0F C;  2ZXJ A;  3BR5 A;  4HRI A;  3NQO A;  5IYC J;  4A3M J;  5HDG A;  1XSX A;  4OOI A;  4I76 A;  4IJA A;  5TGT A;  1TWC J;  2JSC A;  1R00 A;  4P5O A;  3HOT A;  2OCC H;  3L9F A;  1Z7L A;  5DV5 A;  5H2F C;  2M5W A;  3MKY B;  2EA4 A;  2LNB A;  1J9I A;  1S8N A;  2RQQ A;  2DA5 A;  3TP3 A;  4UHT A;  4A5M A;  2VIX A;  3CC4 I;  2LBF A;  3LWF A;  1SVO A;  5FD6 A;  4B1R A;  3BZ6 A;  5LGT A;  4BQA A;  2DN0 A;  1XMA A;  5CPR B;  3LFK A;  4MHG A;  2QGU A;  3BJA A;  2J5P A;  1ZGA A;  1VQK I;  2WB1 A;  1OYI A;  3E7L A;  2M30 A;  2FEZ A;  1OMI A;  1S3J A;  4M3G A;  1WJB A;  3HC7 A;  2DOA A;  2MGQ A;  1ZRF A;  2Y0S A;  2QF7 A;  4ENJ A;  3BP8 A;  1ULY A;  1ZK8 A;  2RAE A;  4C3H J;  5C4J J;  2P81 A;  4MO7 A;  5EZH A;  5HLT A;  3WTS C;  3MKL A;  3MZY A;  2EFQ A;  2PJP A;  1WQ2 A;  4U7B A;  4M6Y A;  3W6K B;  4CYC A;  1H89 C;  2KKO A;  2KDO A;  3KP3 A;  5GPA A;  1SC7 A;  1JT6 A;  4N4N B;  4EGY A;  1T33 A;  2E1C A;  4Q5S F;  1D1B A;  2VPR A;  1YW9 A;  2YX4 A;  3FMR A;  3Q3S A;  3PNY A;  1SAN A;  5CVJ A;  1VQ4 I;  2WA0 A;  3I59 B;  2ETH A;  2V4J C;  2UXX A;  1GVD A;  1SFX A;  1QA6 A;  2QBY B;  4JK1 X;  3REO A;  2DT5 A;  4P55 A;  3HXL A;  2QA4 I;  2V6E A;  2Z2S B;  1FYK A;  2KPM A;  5BMZ A;  4XN0 A;  4B09 A;  1A31 A;  2JA7 J;  4DYC A;  2E5N A;  1ZG1 A;  3IL2 A;  1CF7 B;  4QPQ A;  3OYF A;  1OQY A;  3MKZ A;  3GLX A;  2KL4 A;  2GIZ A;  3K6G A;  2HQN A;  3FXJ A;  3OOU A;  3KIO A;  1BW5 A;  2IJL A;  1SFU A;  1MGT A;  2A61 A;  3FXQ A;  2CV2 A;  2H1K A;  4HF1 A;  1YX5 A;  1QBJ A;  2BHZ A;  2DA2 A;  2XPW A;  3Q0U A;  3QP6 A;  3DPT A;  2ESH A;  1P2F A;  4ZYE A;  3I56 I;  2UUZ A;  1KON A;  3W6V A;  1KU2 A;  4C3J J;  2GA1 A;  4LMY A;  3CMY A;  1SD6 A;  2VON A;  3ZR8 X;  5D5U B;  5A2Q Z;  4EJO A;  3G1L A;  4IHS A;  3Q9S A;  3CD6 I;  2CRG A;  2CU7 A;  4ON0 A;  4BXF A;  4P9U A;  3U9G A;  3GZ6 A;  4Q4Z F;  1K7A A;  4EJW A;  2COM A;  1E2X A;  1OPC A;  1LFB A;  5EJC A;  3F23 A;  4M73 A;  1DPR A;  1X3U A;  4X1E A;  4XR6 A;  4A3L J;  3MFK A;  1SD5 A;  4E7K A;  3OYH A;  4XBF A;  1FT9 A;  2ZXI A;  3CJT B;  2HOT A;  1FIA A;  3GVA A;  4E7L A;  4G94 A;  2E7W A;  2PI0 A;  1BR4 A;  5K5R A;  2KFD A;  1ETY A;  5ILU A;  2L9N A;  3K4C A;  2FQ3 A;  3GTO J;  4CGZ A;  1IN7 A;  2FBH A;  2E1M C;  2LDU A;  2OQR A;  4MQV A;  5D5V B;  2A07 F;  4RM2 A;  4L5I A;  4NC6 A;  2ELH A;  2K85 A;  4I2O A;  1IDY A;  5GTI C;  4RB0 A;  2M45 A;  4Y4R A;  5J4V A;  1FC3 A;  3VYT B;  2DMN A;  2EQR A;  4CO8 A;  1R5G A;  3NRV A;  2WAD A;  3EDP A;  2M7A A;  2X6O A;  3E6D A;  1IV6 A;  3OSF A;  4I99 C;  4UXN A;  4OMZ A;  2IEK A;  2DU9 A;  5LD2 C;  2XAU A;  3TKY A;  5LHI A;  2HDD A;  1YIT I;  1VF9 A;  3SFI A;  1Z67 A;  2EV5 A;  2KP6 A;  2L7Z A;  1QZZ A;  3DKW A;  3FIW A;  2I5U A;  2JVG A;  3OYG A;  5KAF C;  3G2B A;  2R7S A;  4ZTJ A;  1P4X A;  3M1E A;  3HPG A;  5LEJ A;  4I6Z A;  2Y9Z A;  1G8X A;  3OY9 A;  2BW3 B;  3J7A O;  2FBI A;  2QQ9 A;  4HYE A;  5F1J A;  1RR7 A;  4UY8 I;  1ZQ3 P;  2WC2 A;  3QOP A;  2FF4 A;  3CO7 C;  4W1U A;  3DU6 A;  3QYE A;  1GV5 A;  2XV4 S;  4F3Q A;  2DI3 A;  4DIQ A;  4R8H A;  2XF7 A;  2WY8 Q;  3EPZ A;  3KZY A;  3OYN A;  3RKW A;  2EFP A;  2OCE A;  1G3T A;  3WTZ A;  2NS0 A;  3OIQ A;  3DPU A;  1MBG A;  2BVM A;  3GTG J;  4HW0 A;  2R3S A;  3HRM A;  2JN6 A;  4M9Z A;  2KRH A;  2EIL H;  1HDD C;  5IT9 K;  3M7G A;  2LRD A;  2XAJ A;  1YW8 A;  3H0G J;  4UB6 C;  1OCO H;  1JKQ C;  1IGN A;  3K9T A;  2C6Y A;  4DZJ A;  2EB7 A;  3E1S A;  3WU1 B;  1GDT A;  2ME0 A;  4XOP A;  1R1V A;  2JTV A;  3DWL E;  3BCB A;  4FX4 A;  4HAM A;  4HG2 A;  3GXO A;  3Q9V A;  5D4S A;  3J80 K;  2HVS A;  2CUZ A;  3OYK A;  1AWC A;  3PUF A;  5FLV A;  2XF6 A;  1A6I A;  2CV1 A;  1D5V A;  2CV0 A;  2K86 A;  4UVB A;  4F91 B;  4CZZ A;  4XM3 A;  2DJI A;  2V9P A;  4BAY A;  1Q1V A;  2F4M B;  3FBI B;  2NVU B;  2R7W A;  2BGC A;  2IS4 A;  4I09 A;  5K5Q A;  3HSF A;  1O3Q A;  1ODD A;  1WJD A;  4P9F A;  3HUG B;  4CDG A;  4LLG F;  2F4I A;  1S6L A;  2M0C A;  1TNT A;  3AL0 C;  3SDB A;  3NAU A;  1XGM A;  3UR3 C;  3HRT A;  2DTR A;  5LFA A;  4NC8 A;  1I3A A;  4IOA F;  2ZME A;  1RES A;  4WX9 A;  4A3F J;  1O3S A;  4A3K J;  2CUF A;  1R49 A;  1ZAO A;  4OIQ F;  4LJZ F;  3QU6 A;  1R6R A;  1GV2 A;  4BBR J;  3HGG A;  3QPH A;  2VC1 A;  5KCM A;  2ZJP F;  3CZ6 A;  4II3 A;  2W57 A;  3HDD A;  2E71 A;  4IHT A;  1XD7 A;  1K79 A;  5ICF A;  2V6C A;  3HHG A;  2AO9 A;  2FMY A;  2L9V A;  2P5K A;  2FUG 2;  3K4M A;  4PJ0 C;  3FDY A;  4YFX F;  4M3B A;  5LHG A;  5E17 F;  1FEX A;  1IUF A;  3EUK L;  3M8J A;  1UG2 A;  4WK8 F;  1VQ9 I;  3IKT A;  4KIT B;  3ABU A;  3D5L A;  4C2U A;  5HOO A;  3WE2 A;  1IV8 A;  2N8G A;  4ZDL A;  4D7N A;  2NOJ B;  4BHP A;  2KIS A;  2X85 A;  3CUQ B;  1QGP A;  3F8M A;  3W2W A;  3TMO A;  3H3Z A;  1Y0U A;  4ZJZ A;  1D1A A;  3N05 A;  3TO7 A;  3JW4 A;  1JKR C;  1YW7 A;  4YG2 F;  4BNC A;  3BZK A;  4XLN F;  5GAE J;  4LGW A;  4WXH A;  1HW5 A;  2LMD A;  2HR3 A;  4UUS B;  4RLQ A;  3WG7 H;  1WH7 A;  2NNN A;  2V1D A;  2STW A;  5AIP A;  4B3X A;  3LSG A;  2G7U A;  3VDX A;  3GTP J;  4D5F A;  3IRQ A;  2XPU A;  1IO2 A;  1ORK A;  1MBK A;  2RN7 A;  5JHF A;  3C2B A;  4LB5 A;  1W36 C;  5L3G A;  2EBI A;  5CQE A;  1BR2 A;  1VQM I;  4D0P A;  1D0Y A;  2I8D A;  3I55 I;  1FSH A;  1NTC A;  5M3F J;  3SJM A;  2KIQ A;  5BS6 A;  1RIO H;  4ZYA A;  1X58 A;  2H6C A;  1B72 A;  1IXR C;  4XMY A;  2KHM A;  1WPK A;  5HLI A;  1YI2 I;  5F0F A;  2XGX A;  2ID6 A;  2B0L A;  1N77 A;  3KEO A;  5BOX A;  1VQO I;  3ECO A;  2BY2 A;  4JYK A;  1EH8 A;  1ETO A;  1IXC A;  2VC0 A;  3K70 D;  2YPR A;  2F5V A;  3V7S A;  5LGU A;  3HOS A;  2HXI A;  3TO6 A;  5FO5 A;  1HOM A;  2LG4 A;  2OQG A;  3M8E A;  2X1D A;  1W7P B;  3HGY A;  2BY1 A;  4KT5 C;  4DGW B;  1WHU A;  2V9V A;  5HNF A;  2V1X A;  2DO7 A;  2EFW A;  3FMQ A;  4L9T A;  2NVT J;  2HYJ A;  2Q2E A;  2ZFU A;  1MDM B;  3F9K A;  4GXO A;  5GP9 A;  2VUM J;  2IS6 A;  2ESN A;  1NK3 P;  2E19 A;  1U2W A;  1DGW Y;  2GQQ A;  1JE8 A;  2H8W A;  2ZO4 A;  2MA3 A;  5HS9 A;  2IVM A;  1TWG J;  3QU3 A;  1WVR A;  3KE2 A;  1PDN C;  2XAF A;  4G9Y A;  1SFK A;  4LG0 A;  2JRM A;  2Y31 A;  1B6A A;  3CF2 A;  2DFH A;  2AXL A;  2V79 A;  1GVJ A;  1FYL A;  2AHQ A;  3A1Y A;  1EH6 A;  1JUS A;  5KHD A;  3BTC A;  2A5W A;  1K4T A;  2HOA A;  3JRA A;  1WSU A;  1SFE A;  5FFZ A;  1FOK A;  2HOS A;  4FE7 A;  2XSJ C;  4C9Y A;  1X2N A;  1YRN A;  1YLF A;  3K4N A;  1FBU A;  2PJR B;  4C2T A;  1ZLJ A;  2VT2 A;  1JHH A;  3CUO A;  3TOB A;  2L7F P;  1T38 A;  1A5J A;  4HDV A;  1OCP A;  3J81 K;  1X2M A;  1K83 J;  2CJJ A;  4W97 A;  2CWE A;  3IH4 A;  1D0X A;  3OIO A;  1MNM C;  2ZSH B;  1HKQ A;  2QEN A;  2FE3 A;  3LFU A;  1XCV A;  4U0V A;  1OCZ H;  3BG9 A;  4G7O F;  2EK5 A;  3TW7 A;  1BJA A;  4EM0 B;  2W25 A;  3EUH A;  5HOD A;  3IP4 B;  5F0H A;  4L9V A;  4XOT A;  2XIG A;  1YFH A;  3DEU A;  3HG9 A;  1O7F A;  1KQ9 A;  3HSE A;  1KYZ A;  1U5T A;  4XKV A;  4DOZ A;  4M3E A;  3L00 A;  3S2W A;  1XSV A;  3BQZ A;  2W85 A;  3J7Y J;  1G59 A;  1BW6 A;  2EIN H;  5J1Y A;  5M3M J;  4XID A;  4KIS A;  2L9R A;  4IKF A;  3AG1 H;  1F36 A;  2VN2 A;  2LK2 A;  2K9Q A;  3BRO A;  3GFJ A;  3ZQI A;  1QHH D;  2P4W A;  1X3Z B;  2QQ8 A;  2L5Q A;  4BJ6 C;  3ZMU A;  2RRE A;  5JLX A;  3TQN A;  4OIP F;  5LLQ A;  3PQK A;  4LK1 F;  3CES A;  2STT A;  3H92 A;  4MLO A;  5DCM A;  3PIP F;  4HST A;  2CFX A;  1LE8 B;  5AON A;  3L2C A;  2BVL A;  4F55 A;  3FXL A;  2JMW A;  4HDU A;  3GZ5 A;  4F7Z A;  3LA2 A;  1N25 A;  2KZG A;  2KJB A;  1ZR4 A;  1REP C;  1YQA A;  1ETK A;  5ED4 A;  4BS9 A;  4AUX A;  2H27 A;  1WWX A;  1DUX C;  2VI6 A;  4K2E A;  1W0U A;  3CJR B; 
#chains in the Genus database with same CATH homology
 5ICC A;  2RQP A;  1IZ1 A;  4NHJ A;  4QLC U;  4AVP A;  3NEU A;  5HDK A;  3EYI A;  3KP6 A;  5CLS A;  1SAX A;  5CJ9 A;  1LVA A;  3JAM K;  3C7J A;  4OIO F;  2XKO A;  1F9N A;  4XSX F;  1FP2 A;  2FA5 A;  4KDP A;  4XSZ F;  1UB9 A;  3E5X A;  4MNU A;  3ULQ B;  2ZJ2 A;  1YIO A;  4U0W A;  2DFI A;  1W5T A;  4ESF A;  1TQM A;  4M74 A;  4LLN A;  2JRT A;  4GGG A;  4I02 A;  3F72 A;  4CYD A;  1K78 B;  3ECH A;  5E8I A;  3TOA A;  2HFH A;  3JSP A;  1LQ1 A;  4EGZ A;  1T6S A;  3R0A A;  5LBQ A;  2DK8 A;  1B9M A;  1O3R A;  4S04 A;  4IPA A;  4HF2 A;  2DQL A;  1R22 A;  3K0L A;  5CVR A;  1O3T A;  2PFB A;  3RIR A;  4IRI A;  1IRG A;  4EVI A;  1OYW A;  1BOA A;  1HST A;  2EA2 A;  4L0Y B;  4A0X A;  3P9K A;  3ZPL A;  4RGR A;  4R1H A;  4RB2 C;  2X0L A;  1R7J A;  1DPU A;  2H94 A;  4UV9 A;  1BN5 A;  2OAZ A;  4JBA A;  4NB5 A;  3KLO A;  3F3X A;  3HSR A;  1MJB A;  2O3F A;  5L3D A;  4RB1 A;  3N97 A;  3C18 A;  2EV6 A;  3CTA A;  5CVU A;  4EM1 A;  5LEK A;  1FBQ A;  2XHK A;  3ELK A;  1QO0 D;  5LHH A;  1VTN C;  3FM3 A;  1JGS A;  5ICG A;  3FM5 A;  5IT3 A;  2IA1 A;  1S29 A;  2KJC A;  1J75 A;  4EJT A;  2L01 A;  4RB3 C;  5KK1 A;  3I53 A;  4UV8 A;  2HOE A;  2XAG A;  1GHC A;  4O5V A;  4WXD A;  5JVT A;  2VE9 A;  3I59 A;  1RZ4 A;  2QBY A;  3R6S A;  2PQ8 A;  2BV6 A;  3ZMV A;  3RPU A;  1HKS A;  4YIF A;  3F8N A;  1UHW A;  1CF7 A;  2PN6 A;  2K4B A;  3RPQ A;  4MEY F;  3ZMZ A;  5JI6 A;  2HQR A;  4RS8 A;  1ZAR A;  3M8F A;  1WKM A;  5LRS A;  1B4A A;  4I0A A;  3ZMT A;  2JZY A;  1TNS A;  1DP7 P;  1P6R A;  3ISP A;  5LGN A;  2OBP A;  3KLN A;  1HW2 A;  3E6B A;  1ZLK A;  5F6F A;  4HV5 A;  4Y15 A;  2QYO A;  1D8J A;  3V8J A;  1FSE A;  3JSO A;  2O6G E;  2HTJ A;  1BC8 C;  1UST A;  1KQ8 A;  3GX4 X;  3WGG A;  3KET A;  3V8L A;  4MEX F;  1IAW A;  2FML A;  1P4A A;  4ZH4 F;  2D2W A;  1QQI A;  2K02 A;  3PFI A;  5FFX A;  1FP1 D;  3F8C A;  4Q47 A;  4GYG A;  1U78 A;  2D45 A;  2A68 F;  1J7K A;  4XRF A;  1P92 A;  1BBY A;  1D8K A;  2HTS A;  5TRD A;  3V7C A;  1CGP A;  3WE3 A;  3FZV A;  3RYP A;  2YU3 A;  4EJV A;  2IP2 A;  2ZNZ A;  4HOB A;  1UCR A;  4AIH A;  1O57 A;  2O0Y A;  1FLI A;  2HWV A;  3COA C;  4KYW A;  3FF5 A;  5JR3 A;  3U1D A;  3RKY A;  5CVI A;  4M9X A;  3E5U A;  2E7X A;  2YX7 A;  5FLX K;  5D5W B;  3KZZ A;  4A6D A;  1U5T C;  2A5Y B;  2A69 F;  1FY7 A;  4HF0 A;  2VBY A;  1G3S A;  1LDJ A;  2QQB A;  3ZN1 A;  2LF8 A;  4Q48 A;  4GYI A;  4HX8 A;  4KA4 A;  3GW2 A;  2Z9O A;  3F8F A;  3IHU A;  2VOO A;  2LSO A;  2UXN A;  1L3L A;  3HUG A;  4ESB A;  1IN5 A;  1HSJ A;  1QZY A;  2DAO A;  3JTH A;  2Z3Y A;  5J8C A;  2DBB A;  5FD5 A;  5H6Q A;  3BWG A;  3Q5F A;  1BI1 A;  4G6D A;  4ZYH A;  3DQV C;  4IXA A;  1T39 A;  1ZRD A;  1JXS A;  2L4M A;  5JHU A;  5HLG A;  5FGM A;  3HTU A;  4A5N A;  2IA2 A;  4OIR F;  4L0Z B;  1ON1 A;  3CUQ A;  1F1Z A;  4M9S A;  3MAJ A;  1TW3 A;  1I27 A;  2XKP A;  4HZF A;  2KRF A;  2AS5 F;  4P96 A;  4N9H A;  3IC7 A;  5D6E A;  2KIF A;  2P7C B;  1UFM A;  1J2X A;  4PGH A;  2D1V A;  2YSR A;  5E18 F;  2HEO A;  4AIK A;  4PCQ A;  3DXJ F;  4AD9 A;  4EV0 A;  3QPT A;  1OKR A;  3GEZ A;  4R79 A;  3D0S A;  4CIC A;  2KIM A;  2PG4 A;  1ZN2 A;  4EJU A;  4AIJ A;  1HW1 A;  2D1H A;  2MLK A;  2G7H A;  1LJ9 A;  2BBY A;  2F5C A;  3RDI A;  2ZNY A;  5LRR A;  1F4K A;  1W7P A;  5BQT A;  3QP5 A;  1SMY F;  1TTY A;  2JPB A;  3BJO A;  5E8G A;  1MDM A;  1PP8 F;  1RUN A;  3DPL C;  1PUE E;  4FX0 A;  2XUB A;  3WTV C;  3LQR A;  1JHF A;  3E6M A;  2IRF G;  2DQR A;  1FNN A;  1Z05 A;  4MTE A;  5E1W A;  1S7O A;  2L54 A;  3K1N A;  1XGN A;  5DCF A;  5ILV A;  4MGR A;  1GXQ A;  1U6G A;  4TV7 A;  1FZP B;  3I0T A;  3BPV A;  1I5Z A;  1BC7 C;  2JPC A;  3MCZ A;  1B9N A;  1YYV A;  2CSO A;  3R0J A;  2DPD A;  5HDN A;  2EFO A;  4JQF A;  4EMS A;  1D3Y A;  2BE5 F;  2G9W A;  1HBX G;  2IPQ X;  4B8X A;  4EM2 A;  5IT9 Z;  2A3S A;  4BHC A;  3FMS A;  2K4J A;  4KMF A;  4O6J A;  2GIV A;  2XAS A;  1KGS A;  3J80 Z;  4I01 A;  3L7W A;  4ENK A;  1LDK B;  3I5U A;  2ISY A;  2QZ8 A;  3RYR A;  4RGU A;  2V1U A;  1IRF A;  1BM9 A;  2MH2 A;  2RDP A;  2RV8 A;  1YO5 C;  1EV7 A;  5CVV A;  3N4M A;  1KA8 A;  3IRR A;  2PLY A;  3ZP5 A;  3GUD A;  3FWE A;  1TW2 A;  1TBX A;  4HBL A;  3IKV A;  2Z99 A;  3QRF F;  1EH7 A;  1HQC A;  3B73 A;  2W24 A;  1XN7 A;  2Z33 A;  3BDD A;  4A0Z A;  3R60 A;  2R7F A;  3SQN A;  3V7R A;  1S7A A;  4L9J A;  5DUK A;  3RI4 A;  4OU0 A;  4G7Z F;  1H9T A;  4FHT A;  2A6E F;  2FRH A;  3ROU A;  2DW4 A;  4Z2Y A;  5BPI A;  3GO5 A;  1Z6T A;  3RJP A;  1G3W A;  3KP7 A;  5E1X A;  1A04 A;  1IW7 F;  3T1B A;  5DD4 A;  2VOD A;  2XAH A;  2ZFW A;  1K78 A;  2P6S A;  1QPM A;  3EQL F;  4HQM A;  2J5O A;  2FXA A;  4E70 A;  2GWR A;  1ZYR F;  4ETS A;  1AOY A;  2MBF A;  2GZW A;  3F6V A;  5CYV A;  5FB2 A;  5A2Q K;  4KUM A;  2OD5 A;  4I98 B;  3I54 A;  3MEX A;  5HS8 A;  1NHA A;  4UVC A;  5BPD A;  4NQW A;  3V8K A;  3KP2 A;  2MC3 A;  2HGC A;  3WOD F;  2VT3 A;  3C1D A;  1ON2 A;  4MTD A;  1BI2 A;  4ZZL A;  1XB4 A;  4OIN F;  4Y13 A;  4G8X A;  1IF1 A;  1TQI A;  3DF8 A;  4BHB A;  4IRH A;  4U7D A;  1XSD A;  4ZZD A;  1Z1D A;  2WTE A;  2NNY A;  4A12 A;  2UWM A;  1LB2 A;  3WTY C;  1BIA A;  5DD8 A;  4BYY A;  3O6B B;  3I71 A;  3G73 A;  2Y0M A;  4M72 A;  4HX7 A;  2H09 A;  3K2Z A;  2QVO A;  3SXY A;  5D5X B;  3TGN A;  4A6E A;  3ZN0 A;  1OYY A;  1SMT A;  3O3K A;  1B1B A;  2Q8K A;  1MJA A;  3CO6 C;  2HYG D;  2JT1 A;  3E5Q A;  1F5T A;  3KP5 A;  4RGS A;  4DNC A;  3MWM A;  4S05 A;  2L4A A;  4ESJ A;  4UNO A;  3F22 A;  4EQQ A;  3J81 Z;  2F2E A;  3GF2 A;  2XRO A;  4HV6 A;  4RAY A;  3AAF A;  4ZYG A;  3WTX C;  4N0B A;  3CUQ C;  1BIB A;  3HRU A;  2ZCW A;  1FWZ A;  1KU3 A;  4UUV A;  1ZG5 A;  1STZ A;  2OZU A;  2ISZ A;  3WTT C;  1ZHF A;  5F64 A;  4IF4 A;  2CW0 F;  1KQ0 A;  2MH9 A;  3T8R A;  5E20 A;  2GAU A;  3RKX A;  1Z7U A;  1T98 A;  4I7H A;  2K7L A;  1XDS A;  5ILS A;  5L3F A;  4LB6 B;  1BI3 A;  2RVC A;  2IW5 A;  4UVA A;  2ADU A;  1IN8 A;  3JTG A;  3CLO A;  1R58 A;  2HYF A;  2Z5U A;  3HIF A;  3OV8 A;  1K6O A;  3DP7 A;  3KP4 A;  2O8X A;  1ZGJ A;  5HVQ C;  2OZ6 A;  2PBI A;  1KYW A;  4ASN A;  2VE8 A;  2HKO A;  2L02 A;  3MZH A;  2M87 A;  2VOP A;  4MQ9 F;  2PMH A;  2CO5 A;  1ZH5 A;  1KU9 A;  3RTR A;  3KCC A;  3JAM Z;  4N9I A;  5F1R A;  3VEP A;  2NAZ A;  1R1U A;  4KN4 X;  4PGG A;  4ENM A;  3KFW X;  2QLZ A;  1I1S A;  3FX3 A;  3WGH A;  1G6N A;  3P9I A;  3C3W A;  3GFM A;  2WWY A;  3O2P E;  4PDK A;  1LEB A;  1RUO A;  2QUF A;  4KIC A;  2RGV A;  1ZG3 A;  2VBW A;  1IN4 A;  2DPU A;  2NYX A;  2F5D A;  5E1Z B;  3CJN A;  2LF7 A;  3ZQ7 A;  1YG2 A;  2O03 A;  1RNL A;  3VFZ A;  4YFK F;  2YR2 A;  2FBK A;  3G3Z A;  1Z91 A;  3VOE A;  5DYM A;  3FXR A;  3LA3 A;  3W6J B;  1P4W A;  1SD4 A;  3ZMD A;  2K27 A;  4WWC A;  3IWF A;  5J8F A;  4LK0 F;  2O61 A;  3HHH A;  4L5J A;  2VXZ A;  2RKH A;  3WTW C;  3ABT A;  2NRA C;  1Z6R A;  5L3E A;  4YII A;  4FT8 A;  1YS7 A;  2CQK A;  4RGX A;  2VBZ A;  5D8K B;  5H20 A;  4KNY A;  1FPQ A;  2KIU A;  4BH9 A;  3E6C C;  2XAQ A;  2A6H F;  3K69 A;  2FNA A;  1IUY A;  5EEG A;  3FXU A;  2TDX A;  3OOP A;  2FOK A;  3GYH X;  2XRN A;  1UHM A;  3SZP A;  5EEH A;  1LNW A;  4OMY A;  3BY6 A;  3GWZ A;  3EET A;  2MD5 A;  2M8E A;  1HXD A;  2DLL A;  2EWN A;  4AWX B;  1WRJ A;  4HA8 A;  1T0F A;  4LFU A;  3WTU C;  1QNT A;  2GXG A;  4LD5 A;  1B59 A;  2RC4 A;  5D8L B;  4KIB A;  3LAP A;  1YTY A;  4LLL A;  1U3E M;  4GO1 A;  3ZMS A;  1C0W A;  1XMK A;  3QAH A;  4H0E A;  2PMU A;  3VB2 A;  4HQE A;  4WCG A;  1GXP A;  3HYI A;  2ACJ A;  4G7H F;  2VBX A;  1MJ9 A;  3R61 A;  5JFR A;  3WG9 A;  2RNJ A;  2XVC A;  1BI0 A;  3DV8 A;  3WGI A;  1G3Y A;  3TDZ C;  4RAZ A;  4KIF A;  3B02 A;  2HZT A;  3T0Y A;  2HS5 A;  2Y75 A;  2ZME B;  1OR7 A;  2IA0 A;  2DK5 A;  1G4D A;  1V3F A;  2BYV E;  2R7D A;  5ICE A;  1XDU A;  2W84 A;  2EV0 A;  2IT0 A;  2BEO A;  1W4M A;  3U2R A;  1U8R A;  5DDG A;  3EYY A;  2CYY A;  3E3V A;  1J0R A;  4IVN A;  3TDU C;  1W5S A;  3R4K A;  4YFN F;  4A2U A;  2OA4 A;  1PP7 U;  5J6X A;  2CG4 A;  4ENN A;  3IWZ A;  2P8T A;  3MQ0 A;  4HX4 A;  2X4H A;  3HTS B;  3GFL A;  3GFI A;  5K1Y A;  2QQA A;  1V4R A;  2PEX A;  1J59 A;  4KMU X;  1O7L A;  1I6X A;  1R23 A;  2HKX A;  4XLP F;  4CXF A;  2FNP A;  1XCB A;  4ZYD A;  4A0Y A;  5FLX Z;  3V4G A;  3P7N A;  4L18 B;  3P9C A;  4U0Y A;  5D6F A;  5K5O A;  1J5Y A;  2F5E A;  2OU2 A;  2LKP A;  1IXS B;  1SD7 A;  1XGS A;  2Q0O A;  4QWQ A;  3F21 A;  2UZK A;  2QM3 A;  1TQP A;  1YS6 A;  5TJJ A;  1DDN A;  4IRG A;  3PQJ A;  5HLH A;  1ZRC A;  3SFZ A;  4LG0 B;  1RI7 A;  1R36 A;  2ZKZ A;  1ZRE A;  2ZBK A;  2FSW A;  3I64 A;  1Z9C A;  1IN6 A;  1E17 A;  1USS A;  3BOQ A;  1I1G A;  1FX7 A;  1T2K A;  2P6T A;  1FBS A;  1FYM A;  1Q1H A;  3TO9 A;  2P5V A;  2CGP A;  1WI9 A;  3K1M A;  4L9N A;  4HLX A;  4I0B A;  4KFC A;  2L3D A;  2P5L C;  3BJ6 A;  4PZJ A;  3FHZ A;  1U5T B;  6PAX A;  4DQ2 A;  5D4R A;  3I4P A;  3LAJ A;  1MD0 A;  3K1P A;  5L3B A;  3I58 A;  3BPX A;  1KU7 A;  4M6X A;  5AIQ A;  4U88 A;  1LEA A;  3HRS A;  3LST A;  2EFN A;  3M9A A;  5ERI A;  2Y48 A;  5DCM B;  5KVR A;  3E97 A;  3ERE D;  1R5H A;  3VOD A;  5HS7 A;  2HDC A;  1W7P D;  2WV0 A;  3L09 A;  3ML6 A;  4Y17 A;  3F8B A;  1H0M A;  5DEQ A;  3CDH A;  3SHF A;  3T8T A;  4HLY A;  5DUI A;  3WU0 A;  3SZT A;  3F6O A;  5H6R A;  2F5F A;  4KIG A;  1HKT A;  2P7V B;  2H6B A;  1H9G A;  3LQQ A;  4G6Q A;  4WXC A;  4M71 A;  4BXU A;  2M1B A;  1MZB A;  4O3M A;  4KN7 X;  2GA2 A;  4WF2 A;  3DFG A;  1MKM A;  3T5X A;  2MLG A;  2QWW A;  4CHU A;  4GCV A;  1L0O C;  5L3C A;  2E1N A;  1TLH B;  3LA7 A;  1ONV A;  1LDD A;  3H3U A;  2FU4 A;  2EJR A;  2GXB A;  1XGO A;  1R1T A;  3KEQ A;  2ZXJ A;  3NQO A;  5HDG A;  1XSX A;  4OOI A;  4IJA A;  2JSC A;  1R00 A;  4P5O A;  3HOT A;  3L9F A;  5DV5 A;  2M5W A;  2EA4 A;  2LNB A;  1J9I A;  1S8N A;  4UHT A;  4A5M A;  3LWF A;  5FD6 A;  3BZ6 A;  5LGT A;  4BQA A;  1XMA A;  3LFK A;  4MHG A;  3BJA A;  2J5P A;  1ZGA A;  1OYI A;  2M30 A;  2FEZ A;  1OMI A;  1S3J A;  1ZRF A;  4ENJ A;  3BP8 A;  1ULY A;  3WTS C;  3MZY A;  2EFQ A;  2PJP A;  1WQ2 A;  4U7B A;  4M6Y A;  3W6K B;  2KKO A;  3KP3 A;  4EGY A;  2E1C A;  4Q5S F;  1YW9 A;  2YX4 A;  3FMR A;  5CVJ A;  3I59 B;  2ETH A;  2QBY B;  2UXX A;  1SFX A;  4JK1 X;  3REO A;  2DT5 A;  4P55 A;  1FYK A;  5BMZ A;  4B09 A;  1ZG1 A;  3IL2 A;  1CF7 B;  3GLX A;  2HQN A;  2IJL A;  1SFU A;  1MGT A;  2A61 A;  3FXQ A;  4HF1 A;  1QBJ A;  3QP6 A;  3DPT A;  2ESH A;  1P2F A;  4ZYE A;  1KU2 A;  2GA1 A;  4LMY A;  1SD6 A;  2VON A;  5D5U B;  5A2Q Z;  4EJO A;  4IHS A;  3Q9S A;  4ON0 A;  4P9U A;  3U9G A;  3GZ6 A;  4Q4Z F;  1K7A A;  4EJW A;  2COM A;  1E2X A;  1OPC A;  3F23 A;  4M73 A;  1DPR A;  1X3U A;  3MFK A;  1SD5 A;  4XBF A;  1FT9 A;  3GVA A;  4G94 A;  2E7W A;  2PI0 A;  5K5R A;  5ILU A;  2FQ3 A;  4CGZ A;  1IN7 A;  2FBH A;  2LDU A;  2OQR A;  4MQV A;  5D5V B;  2A07 F;  4L5I A;  2ELH A;  4I2O A;  4RB0 A;  2M45 A;  1FC3 A;  4CO8 A;  1R5G A;  3NRV A;  3EDP A;  3E6D A;  4UXN A;  4OMZ A;  2DU9 A;  3TKY A;  5LHI A;  2EV5 A;  1QZZ A;  3DKW A;  1P4X A;  3M1E A;  5LEJ A;  3J7A O;  2FBI A;  2QQ9 A;  4HYE A;  2WC2 A;  3QOP A;  2FF4 A;  3CO7 C;  2XV4 S;  2DI3 A;  4R8H A;  3KZY A;  3RKW A;  2EFP A;  1G3T A;  3WTZ A;  2NS0 A;  4HW0 A;  2R3S A;  3HRM A;  4M9Z A;  5IT9 K;  3M7G A;  2XAJ A;  1YW8 A;  3K9T A;  2C6Y A;  2EB7 A;  3WU1 B;  1R1V A;  2JTV A;  4FX4 A;  4HAM A;  3GXO A;  3Q9V A;  5D4S A;  3J80 K;  1AWC A;  1D5V A;  2K86 A;  4UVB A;  4CZZ A;  4BAY A;  2BGC A;  4I09 A;  5K5Q A;  3HSF A;  1O3Q A;  1ODD A;  4P9F A;  4CDG A;  4LLG F;  1S6L A;  1TNT A;  1XGM A;  3HRT A;  2DTR A;  2ZME A;  4WX9 A;  1O3S A;  1ZAO A;  4OIQ F;  4LJZ F;  3QU6 A;  3QPH A;  2VC1 A;  2W57 A;  4IHT A;  1XD7 A;  1K79 A;  5ICF A;  2V6C A;  3HHG A;  2FMY A;  2P5K A;  4YFX F;  5E17 F;  5LHG A;  4WK8 F;  3IKT A;  3ABU A;  3D5L A;  5HOO A;  3WE2 A;  4BHP A;  3CUQ B;  3F8M A;  1QGP A;  3H3Z A;  1Y0U A;  3TO7 A;  3JW4 A;  1YW7 A;  4YG2 F;  4BNC A;  4XLN F;  4LGW A;  4WXH A;  1HW5 A;  2HR3 A;  2STW A;  2NNN A;  2V1D A;  5AIP A;  2G7U A;  3IRQ A;  2RN7 A;  4LB5 A;  5L3G A;  4D0P A;  1FSH A;  5BS6 A;  1RIO H;  2H6C A;  1IXR C;  5HLI A;  2XGX A;  2B0L A;  3KEO A;  5BOX A;  3ECO A;  1EH8 A;  1IXC A;  2VC0 A;  2YPR A;  3V7S A;  5LGU A;  3HOS A;  3TO6 A;  5FO5 A;  2OQG A;  3M8E A;  1W7P B;  4KT5 C;  2V9V A;  2V1X A;  2DO7 A;  2EFW A;  3FMQ A;  4L9T A;  2Q2E A;  1MDM B;  4GXO A;  2ESN A;  1U2W A;  2GQQ A;  1JE8 A;  2ZO4 A;  2MA3 A;  5HS9 A;  2IVM A;  3QU3 A;  3KE2 A;  1PDN C;  2XAF A;  4G9Y A;  4LG0 A;  1B6A A;  1FYL A;  2AXL A;  2V79 A;  1GVJ A;  1EH6 A;  1WSU A;  1SFE A;  5FFZ A;  1FOK A;  1YLF A;  1FBU A;  1ZLJ A;  2VT2 A;  1JHH A;  3CUO A;  3TOB A;  1T38 A;  4HDV A;  3J81 K;  2CWE A;  1HKQ A;  2QEN A;  2FE3 A;  1XCV A;  4U0V A;  4G7O F;  2EK5 A;  1BJA A;  4EM0 B;  2W25 A;  3EUH A;  4L9V A;  2XIG A;  1YFH A;  3DEU A;  1O7F A;  1KQ9 A;  3HSE A;  1KYZ A;  1U5T A;  3L00 A;  3S2W A;  1XSV A;  2W85 A;  2VN2 A;  3BRO A;  3GFJ A;  2P4W A;  3ZMU A;  3TQN A;  4OIP F;  5LLQ A;  3PQK A;  4LK1 F;  2STT A;  3H92 A;  5DCM A;  2CFX A;  5AON A;  3L2C A;  4HDU A;  3GZ5 A;  4F7Z A;  3LA2 A;  2KJB A;  1REP C;  1YQA A;  5ED4 A;  2H27 A;  1WWX A;  1DUX C;  4K2E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...