1R1TA

Crystal structure of the cyanobacterial metallothionein repressor smtb in the apo-form
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
98
structure length
98
Chain Sequence
ELQAIAPEVAQSLAEFFAVLADPNRLRLLSLLARSELCVGDLAQAIGVSESAVSHQLRSLRNLRLVSYRKQGRHVYYQLQDHHIVALYQNALDHLQEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor smtB
publication title A metal-ligand-mediated intersubunit allosteric switch in related SmtB/ArsR zinc sensor proteins.
pubmed doi rcsb
source organism Synechococcus elongatus pcc 7942
molecule tags Transcription repressor
total genus 28
structure length 98
sequence length 98
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01022 HTH_5 Bacterial regulatory protein, arsR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1r1tA00
5D5VB 5LLQA 3KP5A 3QP6A 2P4WA 4LG0A 5EEGA 2V6CA 4HYEA 1E2XA 2Z33A 1KYWA 2NYXA 2E7WA 3C3WA 2BE5F 3PFIA 4G9YA 1OKRA 4PGHA 4KYWA 3RYPA 3Q9VA 1BC8C 4KN4X 3CO7C 5CVRA 2QENA 3J80K 5FD6A 3FHZA 1JXSA 4A0XA 1ZRDA 1UHWA 4N0BA 1KYZA 3R61A 2TDXA 3GFLA 1TNTA 2BEOA 2OBPA 3I53A 5DUIA 4I0BA 4RB2C 2JPBA 4IHTA 3ML6A 2L4MA 3U2RA 1SFEA 2VODA 5DCMB 2A5YB 3T8TA 2FE3A 4NQWA 2D1VA 2ZNYA 3F8MA 2RV8A 1B6AA 2LDUA 2IW5A 2WWYA 1J59A 4ASNA 5A2QZ 4EM1A 3V8KA 4XLNF 4Y15A 2KRFA 4HF1A 2NRAC 4D0PA 1J5YA 4MTEA 4HBLA 3QOPA 3HRTA 1UCRA 2V1UA 2P7VB 1O7FA 3COAC 4FX4A 2VBWA 3FX3A 1B9MA 4BHBA 4L0ZB 4UUVA 1TW2A 1O3TA 3F8BA 2GIVA 2QQAA 3WTVC 2UZKA 5JVTA 3I0TA 3M7GA 4I02A 1TLHB 3TDUC 3HRSA 3ROUA 3WGHA 1DPUA 4R79A 4LK1F 1R1VA 1WSUA 2V9VA 4BH9A 4U0VA 3RPQA 4EM0B 3LWFA 3ZPLA 4I09A 1GXQA 1KGSA 1CGPA 4RGSA 4ZYGA 1FBQA 3ECOA 1XSXA 2NNNA 1BI0A 2EFQA 4M9XA 2MLKA 1FYMA 3I59B 4HAMA 4B09A 4ZYDA 4YFNF 2ESHA 2FEZA 1K78B 2ZMEA 2F2EA 3EUHA 2IA1A 4AIKA 2PMHA 1S7AA 3HHHA 4YIFA 3T5XA 1CF7B 4YG2F 2VXZA 4HF0A 3BWGA 4GYGA 1IUYA 2H09A 3I5UA 5D5XB 1KQ8A 1XMAA 5DDGA 2L02A 3TKYA 1B9NA 2UXXA 2HOEA 2V79A 2YPRA 1G3TA 1O3SA 2HFHA 2DK5A 2EV0A 4O6JA 3F23A 3BJ6A 2XUBA 1J9IA 1HSJA 2BBYA 5D5WB 2DK8A 3DF8A 5HDKA 4HDUA 3K69A 4G7OF 2G7HA 3HOSA 3L2CA 4G7ZF 3ZMTA 4Q5SF 5TRDA 2AXLA 4JBAA 2QQBA 3E3VA 3DXJF 5ILSA 3MZHA 3GX4X 3LA7A 3H3UA 1QBJA 2MLGA 2DT5A 1OR7A 1HXDA 4I7HA 4E70A 2LF7A 2PBIA 2FBIA 4IRGA 4MHGA 1ULYA 1WWXA 1HKTA 1IN4A 2RKHA 3V4GA 4O3MA 1U78A 1R1UA 4L9NA 3D0SA 2ZCWA 2VC0A 4EJTA 4A12A 1R23A 5E8GA 4OU0A 2FNPA 4XLPF 4UVCA 1JHHA 1QNTA 4Q48A 3I54A 1J75A 1ZG1A 4FHTA 1FBSA 2L4AA 2D1HA 2XRNA 1G4DA 2NS0A 4H0EA 1YYVA 1MDMB 1DUXC 2IRFG 3VB2A 2E1NA 5FB2A 5HS7A 3WGGA 2Z9OA 3R4KA 2OD5A 1W7PD 2O0YA 2Y75A 1B1BA 2JZYA 1R5HA 4F7ZA 2DTRA 2HTSA 2P6SA 4KDPA 2JSCA 3IWZA 1FT9A 3KP4A 4P96A 2EFOA 4WWCA 2D45A 2VBXA 5H20A 3BDDA 3NQOA 1HW5A 3HSRA 3MCZA 4ENMA 1S29A 2JTVA 2P6TA 4LK0F 1P4AA 3GW2A 3BY6A 1UFMA 2STWA 3BP8A 3VOEA 1DDNA 2GA2A 1QPMA 3R0JA 4EMSA 2XIGA 1R5GA 2P5LC 3TDZC 2XAJA 2W84A 1BM9A 3ZN1A 3U9GA 1ZAOA 4Z2YA 3F8CA 5ICGA 1XD7A 3Q5FA 2HWVA 2HEOA 5DYMA 2A07F 3J80Z 2XROA 5IT9K 2G9WA 2Q2EA 2HYGD 4CXFA 1KU3A 1IZ1A 4EGYA 4U7DA 5DD8A 4Q4ZF 3BJAA 3FM5A 2FMLA 2GZWA 3HRMA 1XSVA 3MQ0A 3CO6C 1LNWA 1KQ0A 1S3JA 2VE8A 4A5NA 1W7PB 1FP1D 3P9KA 5LHHA 3I59A 2ZMEB 3DP7A 3WTSC 2PJPA 3WTTC 3H3ZA 5DV5A 4EJOA 2ACJA 2UWMA 3JW4A 3MWMA 3WGIA 5DEQA 1U5TA 1WI9A 5FFZA 1XB4A 5EEHA 3JAMZ 5JI6A 4AIHA 3F22A 1IXRC 2XVCA 4OOIA 3LA2A 2ZO4A 5F64A 2ZBKA 5K1YA 2P7CB 4TV7A 4KMUX 1SFUA 1IN8A 1ZHFA 4FX0A 3RIRA 2KIFA 3ZMVA 3WODF 4XBFA 3FMQA 3SQNA 4CHUA 4MEXF 5J8CA 2DI3A 3WE2A 1G3WA 2A6HF 2FRHA 3GYHX 3QP5A 2GA1A 3FMRA 1TQIA 4O5VA 4HV5A 2E7XA 3RJPA 1YW7A 4L9VA 3LAJA 3J81K 1V4RA 2IVMA 2PEXA 2YX7A 1BN5A 2KJBA 4U0WA 4S04A 3HOTA 4ON0A 3O2PE 2K4BA 3DPTA 4G6DA 3MAJA 3TGNA 4G7HF 1HQCA 5AIPA 1MD0A 3GWZA 2FQ3A 4XSZF 4U7BA 2R3SA 1YQAA 3F72A 3EQLF 1FBUA 1J2XA 1LB2A 1OPCA 3FMSA 2M8EA 1Z6RA 2GXGA 3N97A 3E5UA 2M30A 1JHFA 1ZYRF 4UV9A 4KN7X 3K1MA 1U3EM 4M6XA 1RI7A 1PUEE 2FU4A 3FXRA 3REOA 1AWCA 3V7RA 1BOAA 1ODDA 4L18B 4KNYA 3HTUA 1H9GA 3LSTA 4M9ZA 5FLXZ 2M5WA 3ABTA 3L9FA 3V7SA 4FT8A 3I58A 1RUOA 2F5FA 1MDMA 1T39A 2DU9A 5HDNA 2EA4A 2Y48A 5AONA 3GXOA 3RYRA 3TO9A 4HW0A 2CG4A 4S05A 1AOYA 1Y0UA 3ZN0A 4MEYF 1QGPA 3HSFA 1I6XA 1ZLJA 4RAYA 1R36A 3EYIA 2CSOA 3MEXA 2KIMA 4YFKF 4WXCA 1BIAA 6PAXA 3WG9A 2CYYA 3TQNA 4IXAA 4KIBA 3KP6A 3J7AO 2F5CA 1J0RA 1XN7A 5E18F 2BYVE 2EV5A 1RZ4A 4BYYA 3BZ6A 2EB7A 1E17A 4HX8A 1FX7A 4G94A 1FZPB 3E97A 2FOKA 3IL2A 5BPDA 1ZG3A 3EDPA 2O8XA 1LEAA 5D6FA 2OA4A 1MGTA 1MJAA 4PDKA 1OMIA 1P2FA 5E17F 4HQMA 5JFRA 2IT0A 2XKOA 1XSDA 1MJ9A 3TO6A 1ZGAA 4I01A 2VOPA 4IVNA 2EV6A 5L3CA 2E1CA 1U2WA 4BHCA 4ESJA 1W7PA 4I2OA 1YLFA 2W57A 2RC4A 3K9TA 1U5TB 4LB5A 1BI1A 3ZMSA 2QBYB 5K5QA 4WX9A 2OAZA 2W25A 3HUGA 5DD4A 4IHSA 3IWFA 1DP7P 3H92A 2R7FA 1U5TC 1REPC 3TOAA 2ELHA 4LLLA 3D5LA 3FF5A 2GQQA 2JT1A 2VBZA 1LDJA 3N4MA 1YW9A 1A04A 2ZXJA 3NRVA 4UVBA 3KP3A 2FXAA 3DEUA 1RNLA 3K2ZA 2K27A 1EH8A 4HA8A 4WK8F 3ECHA 1IN5A 3F3XA 3SHFA 1EV7A 4AD9A 3V8LA 1D5VA 1XMKA 3FXUA 2K86A 4AIJA 4U88A 3K0LA 5HS9A 5IT9Z 2FSWA 2P8TA 3SFZA 5LHGA 2QQ9A 3L00A 4A5MA 2VE9A 4U0YA 1PP7U 2X0LA 1YO5C 2CQKA 4RB0A 4EJWA 2DFIA 3E5XA 4A6EA 3WTWC 2MC3A 4IRIA 1OYYA 1ZREA 5A2QK 2XAQA 2QM3A 1U6GA 1KU9A 4BHPA 5D4SA 2CWEA 2IPQX 2A68F 2A69F 4JQFA 4PGGA 1IN6A 4L0YB 3WTZA 1Z7UA 4EM2A 1YG2A 1I27A 5DUKA 1HW1A 4OINF 1SAXA 1GXPA 4RB3C 3GVAA 3HIFA 1USSA 2C6YA 1T38A 5FFXA 2M45A 4LGWA 2AS5F 3ZMUA 5E1ZB 2L01A 2H94A 1SD6A 3PQJA 2BGCA 1L0OC 2W85A 2V1DA 3R0AA 1IRGA 3KP2A 1BBYA 2ESNA 1P4WA 2VT2A 2QUFA 3FZVA 2FBKA 3BROA 4BNCA 1SMTA 2FBHA 5D8KB 1LDDA 3ABUA 4HX4A 1FYLA 3JTHA 1FYKA 1K79A 2CGPA 1XCBA 2CO5A 5JR3A 3IC7A 3BJOA 5LHIA 2EFPA 4DNCA 2QZ8A 1FC3A 4XRFA 3NEUA 1FY7A 1EH7A 4Y17A 4OIPF 2RGVA 3OV8A 1WKMA 3DQVC 2YR2A 4IF4A 2XGXA 3SZPA 2XHKA 3P7NA 3FWEA 2Q0OA 2YU3A 5F1RA 5HLGA 2GAUA 3WU0A 5FGMA 2BV6A 2FA5A 1HKQA 3F6OA 4WCGA 1R7JA 1XGSA 3VFZA 1IXCA 4Q47A 2VT3A 1ZGJA 4Y13A 3C18A 3CUOA 5DCFA 4WF2A 3G3ZA 4IPAA 2VN2A 5CVUA 1LJ9A 2DBBA 3KFWX 4HDVA 3F8NA 5J6XA 3BPVA 5ERIA 1I5ZA 1WRJA 3P9CA 1PDNC 1ONVA 2XKPA 2DPUA 3ZMZA 1PP8F 2HTJA 3KEOA 4M6YA 2HR3A 3QPTA 1P92A 1SFXA 5KK1A 5HVQC 5LRRA 1B4AA 1BIBA 4ESFA 4CO8A 2ZKZA 4R1HA 1HW2A 2L54A 3S2WA 5D6EA 3LFKA 1I1GA 2QBYA 1MKMA 4ZZDA 1LDKB 4HLYA 1FPQA 3CTAA 4HQEA 4XSXF 2LNBA 2WC2A 3M8FA 3RI4A 1C0WA 2DQRA 5FD5A 1RUNA 2IP2A 2IA2A 1I1SA 4CGZA 3CJNA 1IXSB 3W6JB 1Z1DA 1P6RA 2VC1A 5CVIA 3GZ5A 3VEPA 3KZYA 3T8RA 3LQRA 1WQ2A 1R58A 3HTSB 4KA4A 1GVJA 2NNYA 5E20A 4QWQA 1FP2A 2IA0A 2GWRA 2RVCA 1Z6TA 5HS8A 3G73A 3GFIA 2EA2A 4ZH4F 2KJCA 5LEKA 2M87A 1MZBA 2HQRA 3GO5A 1OYIA 4L5JA 1BI3A 2RN7A 2KKOA 2B0LA 4CZZA 5AIQA 1P4XA 3RTRA 5L3DA 2PFBA 1R00A 4KIGA 3GEZA 1FSHA 2MH2A 3KP7A 5L3GA 1LQ1A 5KVRA 4IJAA 5CVJA 4I0AA 5LRSA 5ED4A 3MFKA 3WU1B 4OMYA 2QYOA 1HBXG 4BAYA 4HF2A 1VTNC 4GXOA 2FMYA 5HLHA 3E6CC 4I98B 1XGOA 2EK5A 5K5OA 3FM3A 4N9IA 4LJZF 2F5EA 2NAZA 2WV0A 5LGNA 4AWXB 1R22A 5CVVA 1ZLKA 4UXNA 2P5KA 3KLOA 1MJBA 2JPCA 3PQKA 4MQ9F 4M71A 4M9SA 1NHAA 1W4MA 1SD4A 1FOKA 1UHMA 1XGNA 3CUQB 4OIRF 2JRTA 5LEJA 3O3KA 4P55A 4ESBA 1F5TA 5ILUA 2HYFA 5D5UB 3CUQC 4P9UA 4MGRA 3O6BB 3M1EA 4ENNA 3QU3A 1KU2A 1YTYA 4OIOF 1QZYA 5HOOA 2MH9A 5LGTA 2CFXA 3RDIA 5ILVA 5HDGA 3SXYA 2Z99A 4MTDA 4L5IA 1KQ9A 2CW0F 1T0FA 1LVAA 3C1DA 5ICCA 1JE8A 4L9TA 5ICEA 4RB1A 3JAMK 2W24A 4ZYHA 4CDGA 2DQLA 1TTYA 2MD5A 3ZP5A 2HS5A 4A2UA 4GGGA 2OU2A 4LD5A 4ETSA 3L7WA 2ZFWA 2Z3YA 1T2KA 5TJJA 2GXBA 1EH6A 3V8JA 4RS8A 1JGSA 5J8FA 4K2EA 4JK1X 1BJAA 2PG4A 2QWWA 2MA3A 1USTA 4DQ2A 2A3SA 3BPXA 5E8IA 2HDCA 1IAWA 4KFCA 2A6EF 1K6OA 2G7UA 2Y0MA 1ON2A 1R1TA 4EQQA 3F6VA 2R7DA 3IKTA 5LGUA 3TOBA 4YIIA 1TW3A 1SMYF 2O61A 1W5TA 3QAHA 1D8KA 1YS6A 2RNJA 2ISYA 4B8XA 2F5DA 3Q9SA 3I4PA 3QPHA 4QLCU 4HZFA 4WXHA 3ISPA 4LB6B 4MQVA 1Z05A 1IN7A 2DAOA 2HQNA 3GFMA 3R60A 4R8HA 4HOBA 3RPUA 3F21A 4KIFA 5L3EA 3AAFA 4M72A 3E6DA 5BMZA 2PMUA 4HX7A 1DPRA 3W6KB 2DLLA 4N9HA 2PLYA 5H6QA 3T0YA 1T6SA 3EYYA 3JSPA 1QQIA 5JHUA 2VONA 4CICA 2J5PA 1S8NA 2K02A 5E1XA 3GF2A 2Z5UA 5FLXK 4CYDA 2L3DA 2XAHA 1QZZA 3F8FA 1Q1HA 4ZZLA 2PI0A 4GO1A 2YX4A 2XASA 1YW8A 1H9TA 1IRFA 1ZG5A 1F1ZA 3JSOA 3B02A 5D4RA 2K7LA 1Z91A 1S6LA 2HKOA 1D3YA 3CLOA 2COMA 3KETA 4KUMA 2RQPA 2UXNA 1OYWA 3IRRA 2EFNA 3V7CA 1HSTA 1J7KA 2ZNZA 2O6GE 3K1NA 3M8EA 4LG0B 2RDPA 3L09A 2DW4A 3ZMDA 1F9NA 2ISZA 4LLNA 2ZJ2A 5FO5A 3QRFF 2DPDA 3QU6A 4EV0A 4NB5A 1L3LA 2K4JA 3VODA 1YIOA 4ENJA 1RIOH 2H6BA 1BI2A 1O3RA 1YFHA 3DKWA 4KICA 2MBFA 3IRQA 3GLXA 4G8XA 3GZ6A 3DFGA 4EGZA 1UB9A 2YSRA 3OOPA 2PQ8A 3KE2A 1KU7A 3CUQA 2QVOA 4A0YA 4M74A 5HLIA 1YS7A 3M9AA 2OZ6A 4PZJA 2P5VA 4A6DA 1ZN2A 3I64A 1FWZA 3J81Z 2VOOA 3FXQA 1TBXA 3HYIA 4EVIA 2HKXA 4UV8A 3R6SA 1ZARA 3IKVA 1B59A 3LAPA 2A61A 4HLXA 5CYVA 1XGMA 4KMFA 5DCMA 2FNAA 5BPIA 1Z9CA 2EJRA 4RGRA 3T1BA 2EWNA 3HRUA 4P5OA 3HSEA 1IW7F 1XCVA 2XAGA 1V3FA 3TO7A 3RKYA 3CDHA 2LKPA 3E5QA 3SZTA 3WE3A 3ULQB 2VBYA 1GHCA 4RGXA 1TQPA 1SD7A 3KLNA 2KIUA 1FLIA 2ETHA 4ZYEA 3U1DA 3BOQA 5CLSA 4EJVA 3KEQA 4UHTA 3WTYC 1HKSA 2OQGA 2LF8A 3GFJA 2WTEA 4PCQA 1O7LA 2Q8KA 1D8JA 2OZUA 4NHJA 1G3YA 5ICFA 1SD5A 2H6CA 3E6MA 5CJ9A 2DO7A 3WTXC 4YFXF 3DPLC 3K1PA 2LSOA 2X4HA 2M1BA 1TNSA 4LLGF 1O3QA 1TQMA 5BQTA 4WXDA 3WTUC 1H0MA 4OIQF 5H6RA 5LBQA 3I71A 1STZA 1XDUA 5F6FA 1G6NA 5L3BA 5E1WA 1G3SA 3ZQ7A 2XAFA 4IRHA 3ERED 1BC7C 1QO0D 3LQQA 4ENKA 3GUDA 2O03A 4GCVA 2PN6A 2HZTA 4AVPA 1W5SA 1K78A 1KA8A 1LEBA 5IT3A 2XV4S 3KZZA 2O3FA 4EJUA 1ON1A 3RKWA 3MZYA 3RKXA 2QLZA 5BOXA 1FSEA 5D8LB 1CF7A 1S7OA 1ZRCA 2OQRA 1F4KA 2ADUA 1T98A 2FF4A 3HHGA 3DV8A 2IJLA 1X3UA 1K7AA 1ZRFA 4A0ZA 1U8RA 2EFWA 4G6QA 1ZH5A 4L9JA 2V1XA 4KT5C 3KCCA 4RGUA 1IF1A 2H27A 4M73A 3ELKA 1O57A 4LMYA 4P9FA 5K5RA 4UNOA 1XDSA 5BS6A 3LA3A 4BXUA 3E6BA 3P9IA 5L3FA 4OMZA 4RAZA 4UVAA 2J5OA 4MNUA 4BQAA 4LFUA 2HGCA 3B73A 4GYIA 3IHUA 4HV6A 1FNNA 2D2WA 3EETA 2STTA 3C7JA 3JTGA
chains in the Genus database with same CATH superfamily
1UHSA 1FTZA 5D5VB 3RCOA 4MLOA 4CCKA 5LLQA 5B5EC 3KP5A 3QP6A 3I9V2 1FTTA 3MZ8A 2P4WA 4MFDA 4XOPA 5EEGA 4LG0A 2V6CA 4E7HA 4HYEA 1I3QJ 1E2XA 3MMYB 1KYWA 3BR1A 2NYXA 4XOTA 2Z33A 2EZIA 2E7WA 1AHDP 3C3WA 2BE5F 4B1RA 2QKMB 4BUPA 1WJCA 1YE9A 3PFIA 4G9YA 1H8AC 2E2JJ 2CQQA 1J09A 1WJFA 1OKRA 2WBMA 3CDLA 1HCRA 4PGHA 4KYWA 2IGNA 2BZTA 3RYPA 3Q9VA 1BC8C 3BR0A 1VQ4I 4KN4X 2M8GX 4PJJA 3CO7C 5CVRA 3VWBA 2QENA 3J80K 5FD6A 3FHZA 4BBRJ 3GTQJ 1JXSA 4A0XA 1ZRDA 1VQKI 4IQ4A 3PNYA 1UHWA 4N0BA 1KYZA 3CP2A 2YU9J 1X1DA 1HC8A 1TP4A 3R61A 2DODA 2TDXA 3GFLA 1TNTA 2BEOA 3CCRI 1WJAA 2ZJQF 2OBPA 3I53A 4D5FA 5DUIA 4I0BA 2R7WA 1ZTRA 4RB2C 4M3DA 2JPBA 4IHTA 2Z2SB 3ML6A 3K6GA 2L4MA 3U2RA 1SFEA 2M34A 1MMDA 2LLKA 2VODA 5DCMB 1X1BA 1Q1VA 2A5YB 2LH9A 1D0YA 2E1MB 3DU5A 3T8TA 4GRIA 4Y3OA 2FE3A 1WVRA 2CU7A 2D1VA 2ZNYA 3AFHA 3OMYA 3F8MA 4NQWA 2PMZN 2RV8A 3BG6A 1B6AA 1RR7A 2LDUA 1D5YA 4E4HA 2IW5A 4V2GA 2WWYA 3CDIA 3CCSI 1J59A 4ASNA 5A2QZ 1NTCA 4EM1A 3V8KA 2E1MC 3H5NA 4XLNF 4Y15A 2KRFA 4HF1A 3OSFA 2NRAC 3S2DJ 4D0PA 3JTGA 1J5YA 2DT6A 3ZQIA 2LFBA 2K9NA 4MTEA 1JT0A 4HBLA 3QOPA 4RMNA 4YELA 2ME6A 3VPRA 1Z3YA 3HRTA 1OJLA 1UCRA 2V1UA 2ZXHA 3LNQA 2P7VB 2L7MP 1O7FA 3COAC 4FX4A 3EUKL 2VBWA 1Y6IA 2VQLA 4BEHA 3CCUI 2GLOA 1OCCH 3FX3A 2HVSA 1B9MA 2I10A 4BHBA 3OWTA 2PX9A 4L0ZB 4UUVA 3VSLA 1TW2A 1O3TA 3F8BA 3QOEA 1X2MA 1Y8QB 2E19A 2GIVA 2QQAA 4XKCA 3A4CA 3WTVC 2R5ZA 2UZKA 2HQ5A 5JVTA 3I0TA 1W36C 3JCUC 4DJAA 2QKLB 3M7GA 1TLHB 4I02A 5EF6A 4NC6A 1JJ8C 2GOXB 1AKHA 2JA5J 1B8IB 3OL4A 3TDUC 3HRSA 3ROUA 2R7TA 2DDAA 3WGHA 1DPUA 4R79A 4LK1F 1IDZA 4J19A 1QZEA 1R1VA 2Q2EB 1WSUA 1MMGA 2V9VA 4ITVA 4BH9A 4U0VA 3LMMA 2L9VA 4E7JA 2R5YA 2L9SA 3RPQA 1OCRH 2QA4I 1IGNA 2DA6A 3HPGA 4EM0B 3LWFA 3JRGA 3ZPLA 4I09A 3VYRB 4J00A 1GXQA 1KGSA 1CGPA 2R7QA 4RGSA 4ZYGA 1FBQA 4AVZA 3ECOA 2IGOA 1XSXA 2PJRA 3OR2C 1UJ8A 2NNNA 1BI0A 3IAS2 2EFQA 5J1UA 4M9XA 1GDTA 2MLKA 3AG2H 3I59B 4YRVA 4E7LA 2DYSH 2LMDA 4HAMA 2X6WA 1FYMA 4B09A 1H89C 4ZYDA 2AQFA 3D5SC 1TT5B 4YFNF 1MH4A 2ESHA 2FEZA 1SVMA 1K78B 2ZB9A 5DTDA 1G8XA 3W2WA 2ZMEA 2F2EA 2WAQA 3EUHA 2IA1A 4AIKA 2LY1A 2WY7Q 2IGKA 2PMHA 1S7AA 1OLTA 5FROA 3HHHA 4YIFA 1ORKA 2VKEA 5FKMA 3T5XA 1B72A 1I39A 1IDYA 1CF7B 2DOFA 4FETA 4YG2F 3OYKA 2VXZA 4H4KC 4HF0A 1ETOA 2ZSHB 3BWGA 3K4NA 4GYGA 3I55I 2H09A 1IUYA 3I5UA 4X1EA 5D5XB 2HDDA 1Y0NA 1KQ8A 1XMAA 5DDGA 3LL7A 3HG9A 2L02A 1HF0A 3TKYA 1MNEA 1B9NA 2HI3A 2UXXA 3JRFA 2HOEA 2V79A 2YPRA 1G3TA 1FJLA 1O3SA 3ASNH 2LK2A 3HGGA 2HFHA 9ANTA 2DK5A 4YIRX 1HOMA 2EV0A 2XSJC 1YHQI 3H9QA 5F04A 3SZGA 1VQ5I 4O6JA 3F23A 3GTJJ 1NK2P 3BJ6A 3JR9A 2XUBA 5LD2C 4ZC3A 4IHXA 1J9IA 1HSJA 2BBYA 2FUG2 5D5WB 2DK8A 2EZLA 3DF8A 3O8GA 5HDKA 4HDUA 3PO2J 3K69A 3ONQA 4G7OF 2G7HA 5F27A 2ELJA 3HOSA 4QSHA 4PJNA 3L2CA 1RR8C 5BNGA 1MBJA 1JKQC 2E5ZA 2BW3B 2NVTJ 2IAIA 3IH2A 4CYCA 4G7ZF 3GMEA 3ZMTA 4Q5SF 3M8JA 4XLAA 1VZ0A 4RLFA 5GAHJ 5TRDA 2AXLA 1FOYA 2QQBA 3B6AA 2XB0X 4JBAA 3E3VA 2GBYA 3H36A 3OL3A 4M6VA 3DXJF 5ILSA 3MZHA 3UNGC 3GX4X 3LA7A 3WHBA 1UMQA 2XPWA 4PJ0C 1MMSA 3C2HA 3H3UA 3OOUA 3OS0A 5FRMA 3K4LA 1QBJA 2MLGA 2DT5A 2JVHA 1OR7A 4XORA 2Z1DA 1HXDA 4UB6C 4F52A 3K70D 1R4MB 4I7HA 1DP3A 2CQXA 1G59A 2EILH 4E70A 2RNGA 2LF7A 2PBIA 2FBIA 3F0CA 4IRGA 4P1WA 2W1OA 4MHGA 1ULYA 1K61A 3RSNA 1WWXA 1HKTA 1IN4A 1JTYA 2RKHA 3V4GA 4C2TA 4O3MA 3BTIA 2R4GA 3IH3A 3DPUA 5F0FA 1E3PA 1U78A 3I3LA 1R1UA 4L9NA 3D0SA 2ZCWA 2KP6A 2F4OB 2VC0A 4EJTA 4A12A 1Z3XA 1R23A 2X6YA 5E8GA 2CQNA 4OU0A 2FNPA 4BL0B 1LPQA 2V6EA 2R93J 2K9SA 5E3LA 4XLPF 2ID3A 4UVCA 2BXZA 2CFOA 1JHHA 1QNTA 2ZJPF 4LIVA 2ICWG 4UY8I 4RAGA 4Q48A 4A3CJ 4E7IA 5GPCA 3I54A 4V19K 1J75A 1YX3A 1ZG1A 3FBNB 4XN0A 1NG6A 1O4XA 4CCNA 1QU3A 4FHTA 1FBSA 2L4AA 2D1HA 2XRNA 4CUGA 1G4DA 1ZR2A 2NS0A 4H0EA 1YYVA 1MDMB 2KRHA 3QYBA 5E3OA 1DUXC 1OCPA 2IRFG 3VB2A 2E1NA 5FB2A 5HS7A 3WGGA 3SJMA 1BR4A 3DTKA 2Z9OA 3Q0WA 3R4KA 2OD5A 1W7PD 3DBRB 4RM2A 3K4CA 3E1SA 2O0YA 2Y75A 1B1BA 1WHUA 2JZYA 1R5HA 4NQWB 2HVRA 4F7ZA 2DTRA 2HTSA 2P6SA 4NBQA 2LBFA 3S2HJ 3L2VA 3FBIB 3I4MJ 2K9QA 1PJRA 2JSCA 3IWZA 1FT9A 2X1DA 4KDPA 2EQRA 3KP4A 4P96A 2EFOA 2L2OA 4WWCA 2FX0A 2D45A 1IRXA 1VI0A 1F43A 2VBXA 5H20A 4XRMA 3BQYA 3BDDA 1TT0A 3H1CA 4XR6A 3NQOA 1HW5A 2EPFA 1T56A 3HSRA 3ZRGA 3MCZA 1PUFA 2X6OA 4S0HB 2X51A 4ENMA 2XF7A 1S29A 2JTVA 2P6TA 4LK0F 2P81A 1P4AA 3GW2A 1BJZA 2VJIA 4C2MJ 3AG1H 3BY6A 2Z16A 5EZHA 5IP9J 1UFMA 4X0GA 2STWA 2KDZA 3BP8A 3VOEA 4BEHB 2WAFA 3OIOA 1DDNA 2GA2A 1QPMA 3R0JA 4EMSA 2IS2A 1MSEC 4IOAF 2XIGA 2L9RA 1R5GA 3LSIA 3P5JA 3H9GA 2P5LC 4F92B 3TDZC 2XAJA 4LITA 2W84A 1YI2I 3IV5A 2R5ZB 3CCYA 1XMXA 1BM9A 3ZN1A 2FQ4A 3W3CA 3U9GA 2R92J 1ZAOA 2IGMA 4Z2YA 3OYIA 2GOMA 2LKXA 1A5JA 3F8CA 1IV8A 3KYCB 2YS9A 1S7EA 3MD2A 5ICGA 2M4KA 3DBHB 1XD7A 3Q5FA 4QPOA 2HWVA 1X3WB 2AXTC 5J1RA 3FHNA 3OYMA 2HEOA 3PNTA 2R5YB 1DU0A 5DYMA 4E7SA 1HDDC 2A07F 3J80Z 1SAUA 3KPHA 4C9YA 2XROA 5IT9K 2G9WA 4ZYAA 2Q2EA 2L7KA 2HYGD 2AHQA 1LFPA 4CXFA 4IHVA 1KU3A 1IZ1A 1JUMA 4IHYA 5F1JA 3HOXJ 2WAQN 4U7DA 4EGYA 2KL4A 5DD8A 4Q4ZF 3BJAA 3FM5A 2DA2A 1OFCX 1NK3P 3H5RA 2FMLA 2GZWA 3HRMA 3A02A 1XSVA 3FXOA 1P7IA 4BY7J 5EDNA 1E3OC 2QSGX 3MQ0A 2CS3A 1LNWA 4KJZA 1MBEA 5CQEA 1KQ0A 2DMTA 3WG7H 3CO6C 1S3JA 2VE8A 1MNDA 3L2WA 4A5NA 4ZTFA 1W7PB 4BDYA 1FP1D 3WHCA 3P9KA 1ETVA 3LSJA 4UUTA 3I59A 2ZMEB 3DP7A 5LHHA 3WTSC 3WTTC 2PJPA 5IYDJ 3H3ZA 2VQCA 5DV5A 4EJOA 2ACJA 3Q3SA 1ZK8A 2UWMA 2QCOA 3HBLA 2M0MA 3JW4A 3JRHA 3BR2A 3MWMA 2Y30A 3WGIA 1MNMC 5DEQA 1U5TA 2GXAA 1WI9A 3HUGB 5FFZA 4DYQA 2HZDA 1B72B 1XB4A 1N75A 5H2FC 5EEHA 3JAMZ 2ZMEC 4XLHA 5JI6A 3EUHC 4AIHA 3F22A 1IXRC 2XVCA 3S16J 4OOIA 2LTPA 4XMYA 2EZKA 3LA2A 2ZO4A 5F64A 1GT0C 2ZBKA 5K1YA 1HLVA 2P7CB 4TV7A 4KMUX 1SFUA 1IN8A 1ZHFA 4FX0A 3RIRA 3HJEA 2L9NA 2KIFA 3ZMVA 3WODF 4XBFA 5GP9A 1OCOH 2KZGA 2JA2A 4A3JJ 3FMQA 3FXJA 3SQNA 4BY1J 4MEXF 3CLQA 4CHUA 3DTIA 2CV0A 4XIDA 2VJ5A 5J8CA 2DI3A 3WE2A 1G3WA 2A6HF 2FRHA 5K7ZA 3GYHX 2HDWA 2FJ1A 4XK4A 3PUBA 5IY5H 5FJ8J 3QP5A 3HOYJ 2GA1A 3VYUB 3FMRA 5J1YA 1TQIA 4O5VA 4HV5A 2DA5A 4DOZA 2ECCA 2E7XA 3RJPA 2VLAA 1YW7A 3BTCA 1X1AA 4L9VA 5J40A 3LAJA 2W4SA 4CYCB 3J81K 1V4RA 2IVMA 2PEXA 2YX7A 3JRIA 4XONA 2QQ8A 4C2UA 1BW6A 1BN5A 2KJBA 4U0WA 3H9JA 4S04A 4PSWA 3HOTA 2DMUA 3O2PE 4ON0A 3HOUJ 4PSXA 1ETKA 2K4BA 3DPTA 5JLXA 2R7XA 3QYFA 4G6DA 3LOCA 4B47A 1ERDA 3MAJA 3TGNA 2IS1A 4G7HF 1HQCA 5GAEJ 5AIPA 1MD0A 2CH0A 3GWZA 4HPQA 3HOVJ 2FQ3A 4XSZF 4U7BA 1OCZH 2OTLI 3PNVA 4D1QA 2R3SA 2EIJH 5F0HA 1YQAA 3F72A 3AL0B 3EQLF 1FBUA 1J2XA 2DA3A 2DA1A 3HKZN 4JOMA 4EATA 1LB2A 1T95A 4II3A 1OPCA 1OR7C 2RREA 3FMSA 4CSWA 2M8EA 1EJ9A 1Z6RA 4G6TB 3HDDA 2R7VA 2GXGA 2W7NA 3N97A 3PO3J 3E5UA 2M30A 1JHFA 1ZYRF 4M3BA 4UV9A 1E0EA 4KN7X 2DTZA 3E0JB 3K1MA 4HEA2 1U3EM 4M6XA 2IXSA 3AL0C 4QTRA 4AU7A 1IJWC 2K9MA 1RI7A 2M9HA 3OYEA 1PUEE 2FU4A 1ZGWA 3FXRA 3REOA 1AWCA 3IH4A 5KNLA 3V7RA 1MIJA 2QF7A 2XF6A 2KPMA 1BOAA 1ODDA 1WI3A 4M3FA 3L1PA 1JUSA 4XN3A 4XLEA 3HC7A 1FOWA 2NVYJ 3G71I 4KNYA 4L18B 1VQ6I 3HTUA 1H9GA 3LSTA 5GPAA 2HQAA 1WH5A 4M9ZA 4JX5A 4AC0A 1MBHA 5FLXZ 2M5WA 3ABTA 3L9FA 3V7SA 4XICA 3QYEA 2DMQA 3PM1A 4FT8A 1ZKGA 4C3IJ 3I58A 1RUOA 2F5FA 1MDMA 1Y56A 3PFYA 5HLTA 1T39A 3J7ZI 1NG7A 2DU9A 1A6QA 4NNJA 1S9HA 1X4OA 5HDNA 4DZJA 2KRCA 2EA4A 1SANA 1BR1A 2Y48A 5AONA 5FKOA 4OAZA 3GXOA 2LBFB 3RYRA 2E36A 2E1OA 2NVXJ 2AQEA 3TO9A 4HW0A 2X48A 4B4CA 5GAGJ 1EF4A 2CG4A 4S05A 1RETA 2VPRA 3K4JA 2LD5A 1AOYA 1Y0UA 3ZN0A 3SEQA 4MEYF 1QGPA 1I3AA 3HSFA 3SFIA 1I6XA 1ZLJA 4I76A 4HNVA 1PUFB 2IBDA 4RAYA 1R36A 3PJRA 3EYIA 2EINH 2CSOA 3MEXA 2KIMA 3DEEA 3OYLA 2ELKA 1XG1A 4DYCA 4YFKF 4WXCA 1BIAA 6PAXA 3M1CA 5E3NA 2BY0A 3WG9A 3QPLA 2CYYA 3X2QH 4BE0A 3TQNA 2XGDA 3HXLA 3LSGA 1VQ9I 3D1NI 1IV6A 1JKPC 3S1NJ 4IXAA 4KIBA 3KP6A 2NOGA 3Q0UA 3J7AO 2F5CA 3B6CA 1J0RA 1OQYA 4DZPA 3ABLH 2LC2A 1XN7A 2VJJA 5E18F 2BYVE 3DBLB 2EV5A 1RZ4A 3A1YA 4N4OB 4BYYA 1V55H 3HEFA 1X2NA 1QPIA 3BZ6A 2CUZA 3CCEI 4M3EA 2EB7A 2KZVA 4QPQA 1E17A 2XRLA 2M7BA 4EEFG 4CCOA 4HX8A 1FX7A 4G94A 2I5UA 1FZPB 3E97A 2FOKA 2NXNB 3IL2A 1ZG3A 3EDPA 5BPDA 3CC4I 2O8XA 1BOBA 3EUAA 3S3NA 2G0EA 1LEAA 3AKZA 5D6FA 4HNUA 1BA5A 3EPZA 2OA4A 1XS9A 1MGTA 1MJAA 4ZTJA 2H1KA 4PDKA 1OMIA 3D5RC 1P2FA 5E17F 4HQMA 5JFRA 1DQUA 2IT0A 5JLWA 4Z6YA 2K5CA 1N78A 1Y1WJ 2RAEA 3H0GJ 2XKOA 1XSDA 1MJ9A 4GDFA 5EGOA 3TO6A 1WCMJ 1OCTC 1ZGAA 5IP7J 1R4NB 3MKLA 4I01A 3OY9A 2VOPA 4IVNA 2EV6A 2MC4A 2CQ7A 1MBGA 3CF5F 2DMNA 5L3CA 3H35A 4AIDA 2XPVA 2E1CA 1U2WA 4BHCA 4ESJA 1W7PA 4I2OA 4I99C 2L0KA 1MSFC 1YLFA 4ZDOA 3CZ6A 2W57A 2VKHA 3H3VK 2RC4A 3K9TA 1UG2A 1U5TB 4LB5A 5KAIC 1BI1A 3ZMSA 1ACIA 2HOAA 2X6XA 2QBYB 4D7NA 5K5QA 3A2KA 4MO7A 1UAAA 3BZKA 4Y52J 4WX9A 2OAZA 2X1CA 2W25A 3HUGA 5DD4A 4IHSA 2R7ZJ 3IP4B 1JUPA 3IWFA 4G12A 4MIMA 2XC7A 1YJNI 1IRZA 1GV5A 1DP7P 3H92A 1LUJB 2R7FA 2X85A 2XAUA 4A3LJ 1MMAA 1U5TC 2W82A 4XKWA 1REPC 1YRNB 3TOAA 2ELHA 3JREA 4LLLA 4LOCA 3D5LA 3FF5A 2GQQA 2JT1A 2MFZA 2VBZA 1LDJA 3CJTB 3N4MA 2OUMA 1YW9A 1EA3A 1A04A 1V5EA 2ZXJA 1T08B 3NRVA 4UVBA 1ENHA 3OIQA 3KP3A 2FXAA 3DEUA 1RNLA 2DMPA 3GTMJ 1FOXA 3K2ZA 2CMPA 3IUOA 4A69C 1WPKA 2K27A 2ZXWH 1EH8A 4HA8A 1RKWA 2CRGA 2IS4A 5F08A 4WK8F 3ECHA 3HGYA 3J7AY 2VQHA 1IN5A 3F3XA 4A3GJ 1YIJI 3SHFA 2LRDA 1EV7A 1GUUA 4AD9A 2F4IA 3V8LA 3GTKJ 1D5VA 1XMKA 2OPTA 2K86A 3FXUA 4V2FA 1H88C 4AIJA 4IEJA 4D7MA 5J3LA 4U88A 4RLQA 1R9TJ 3K0LA 4JX4A 5HS9A 5IT9Z 2E5NA 4XLFA 2FSWA 2P8TA 3K7AJ 3OYGA 3SFZA 3O8HA 2M2EA 3K2AA 3CMYA 3BG9A 5LHGA 2V9KA 2QQ9A 3ABKH 3L00A 2OCCH 4A5MA 4CCLA 2VE9A 3U21A 5LFAA 4U0YA 1PP7U 2X0LA 1YO5C 2CQKA 2BY2A 3NWTA 4RB0A 1JI8A 4EJWA 5IOYA 4E7ZA 2DFIA 3E5XA 5FKNA 4A6EA 3OS1A 3WTWC 2MC3A 4IRIA 1OYYA 1ZREA 2WB1A 5A2QK 2M3AA 2XDVA 2XAQA 5EG0B 2QM3A 1U6GA 1KU9A 5M5YJ 1X58A 4BHPA 5D4SA 2M7AA 2O9LA 2EIKH 3MVPA 2CWEA 2IPQX 3S3OA 2CV2A 3RZDJ 2A68F 4HG2A 2A69F 4JQFA 4PGGA 4F55A 3A01B 1IN6A 4XNFA 4L0YB 3ESWB 3WTZA 4FISA 3SYTA 3CCJI 1FEXA 1U9NA 1Z7UA 4EM2A 1D0ZA 4BXXJ 1YG2A 2MW8A 1I27A 5DUKA 1HW1A 2XB5A 3A03A 1ZQ3P 4OINF 2XGCA 3PIPF 1SAXA 1GXPA 4RB3C 2HOSA 2E2IJ 2Y2ZA 3GVAA 3HIFA 1USSA 2C6YA 1T38A 5FFXA 2M45A 2LR8A 2JN6A 4JYKA 4LGWA 3DTEA 2AS5F 1VQNI 3ZMUA 2E71A 5E1ZB 2L01A 2H94A 3CMEI 1SD6A 1K83J 3HL2A 3PQJA 2VB6A 2BGCA 1L0OC 4ZDLA 4RA2A 4HNTA 4GFBA 2W85A 2V1DA 3R0AA 1K4TA 1YITI 1IRGA 4B43A 4A3BJ 3W6VA 1XX5A 1QRYA 2VI6A 3KP2A 1BBYA 4BGDA 1V5GA 2ESNA 3CESA 1GVDA 1P4WA 2VT2A 2QUFA 3FZVA 3KZIC 2FBKA 5KAFC 3KIOA 3BROA 4BNCA 5JHFA 2DFFA 1SMTA 2FBHA 2ZXIA 5D8KB 1LDDA 3GCMA 2VKVA 1UELB 1K4SA 3ABUA 2JK3A 4HX4A 1FYLA 3JTHA 4XL9A 1FYKA 1K79A 2CGPA 3A0BC 1XCBA 2CO5A 2Q1ZB 2VIXA 1VQLI 5JR3A 3IC7A 3BJOA 3VSKA 5LHIA 4LIUA 3RPUD 2R7SA 1CQTA 2Y31A 3S1MJ 2EFPA 2JWTA 4DNCA 1QHHD 2QZ8A 2F5VA 1FC3A 4XRFA 2VJ4A 2VASA 3NEUA 1BL0A 2BY3A 1FY7A 3ABMH 3BCAA 1EH7A 1NH3A 4Y17A 4OIPF 2RGVA 3MKZA 3OV8A 5FLVA 5DS9A 1WKMA 1IC8A 1TWCJ 3DQVC 2M0CA 3E7LA 2YR2A 4IF4A 3BC8A 5DM7F 2B9SA 2XGXA 3C2GA 3FXKA 1YOVB 2XHKA 3P7NA 3SZPA 3UKGA 1MW7A 2HNHA 2JJ7A 3FWEA 4FASD 3J7YJ 3JRAA 2Q0OA 2YU3A 3ZXSA 5F1RA 3H0DA 5J47A 5M5WJ 3DEWA 5HLGA 2DXIA 2GAUA 3WU0A 3S17J 3K70C 5FGMA 3HZJA 3FDYA 2BV6A 5FKLA 2FA5A 1HKQA 3F6OA 4WCGA 1R7JA 3A0HC 1XGSA 3VFZA 1WJBA 3MKWB 1VQ8I 3S3MA 1IXCA 3LSHA 4Q47A 2F48A 2VT3A 1ZGJA 4Y13A 3C18A 3CUOA 3DLLF 5DCFA 1A6IA 4WF2A 3G3ZA 2V9PA 3BTJA 2B7EA 4IPAA 3KEYA 2VN2A 5CVUA 3PSIA 1LJ9A 3AG4H 2DBBA 3KFWX 4HDVA 3F8NA 5EGOB 2VKDA 5J6XA 4XM3A 3BPVA 5ERIA 4PFPA 1I5ZA 1WRJA 1Z77A 4A3KJ 4PJLA 3P9CA 5F0CA 2BY1A 1PDNC 1ONVA 2XKPA 2DPUA 3ZMZA 2H8WA 1PP8F 3I4NJ 2HTJA 3LSKA 3KEOA 1AA7A 4M6YA 4A3FJ 4PK4A 3ASOH 3CCLI 3OYFA 2HR3A 1T8IA 3QPTA 1P92A 3K10A 1SFXA 1WJEA 5KK1A 5HVQC 1UG0A 1APLC 5LRRA 1B4AA 1BIBA 3CD6I 4ESFA 4CO8A 2H1LA 2ZKZA 2FD5A 4R1HA 2DJNA 1HW2A 3SDBA 2L54A 3H5AA 5KCMA 3S2WA 1P9QC 3BR5A 3LFKA 4NUBA 5D6EA 1I1GA 4CCMA 2QBYA 4BS9A 1MKMA 4ZZDA 2A6TA 1LDKB 3DKXA 3CMMA 4HLYA 2NS8A 1FPQA 3LSMA 3OSGA 3CTAA 4HQEA 2IS6A 4XSXF 2LNBA 2WC2A 3M8FA 3RI4A 1C0WA 2DFEA 5GTHC 1YRNA 2DQRA 5FD5A 1RUNA 2IP2A 1ETQA 1JKOC 2L5QA 2IA2A 3DU6A 4IZZA 1I1SA 3S1RJ 3CJNA 2NVUB 4CGZA 1IXSB 2Y0SA 2R0QC 3W6JB 1Z1DA 2WAEA 1P6RA 2VC1A 5CVIA 3GZ5A 3VEPA 4PFOA 3TMOA 3KZYA 3T8RA 3LQRA 3KYDB 1A35A 1RC9A 1WQ2A 1D0XA 4FE4A 1R58A 4JP0A 5GADJ 2Y9YA 3MN2A 2LOOA 2DOAA 3HTSB 1I6HJ 1U8BA 4B48A 4KA4A 4IO9F 1GVJA 3ZQCA 2QSFX 2NNYA 2TCTA 1TWFJ 5E20A 5IP6A 5HNFA 4QWQA 1FP2A 4DW6A 2IA0A 2GWRA 1I50J 1Y8RB 2RVCA 1OISA 1Z6TA 2V4JC 2W48A 1RPWA 5HS8A 3G73A 3GFIA 2WB1N 4HSTA 3G6EI 2EA2A 4ZH4F 1KONA 2KJCA 4XRSG 5LEKA 4ANJA 5TISC 2M87A 1LFUP 2HQRA 1MZBA 3GO5A 1OYIA 4L5JA 1BI3A 1JT6A 1D1BA 2RN7A 4DYRA 2KKOA 4A93J 1FIAA 2B0LA 4CZZA 5AIQA 2OV7A 1P4XA 3RTRA 5IPAA 1IUFA 5L3DA 4BE2A 4BU2A 2PFBA 4B44A 1R00A 4KIGA 3GEZA 1FSHA 3CMAI 2MH2A 1R49A 3KP7A 1BW5A 2E2HJ 5L3GA 1LQ1A 5KVRA 4NC8A 4IJAA 5K7FA 5CVJA 2CUJA 4I0AA 1WH7A 5LRSA 3ZCOA 4C3JJ 3S8PA 5ED4A 2N8GA 3MFKA 2IEKA 4KITB 2MABA 4F91B 3WU1B 4OMYA 2BHZA 3KX2A 5EG0A 2HVQA 2L7FP 2DJIA 2QYOA 2WADA 2ZJRF 1HBXG 2DT7B 4BAYA 3L2RA 4HF2A 1VTNC 4GXOA 2FMYA 3TW7A 5HLHA 3E6CC 1R6RA 3BCBA 4I98B 1W36D 1XGOA 2XSDC 2EK5A 5K5OA 3FM3A 3U1KA 3VYTB 4N9IA 1BR2A 2TRTA 4LJZF 2F5EA 2JRMA 3RZOJ 3A01A 5EYRA 2NAZA 2WV0A 4F93B 5LGNA 4AWXB 2GIZA 1R22A 5CVVA 4DBRA 2CUEA 1ZLKA 4UXNA 2AO9A 2CUFA 3NWSA 4BQQA 3CJQB 2JUCA 2P5KA 3KLOA 4MFEA 1ETYA 1Z7LA 2E34A 1MJBA 2JPCA 3OYBA 3MKYB 2BHYA 3PQKA 4MQ9F 1POGA 4M71A 2CW7A 3OIPA 4M9SA 1NHAA 1W4MA 1SD4A 3PUFA 1FOKA 1UHMA 1XGNA 3CUQB 4OIRF 2JRTA 5LEJA 3O3KA 2DYRH 2KHMA 4U87A 4P55A 3G4SI 4LG3A 3GZNB 2DA4A 5TGTA 4RM3A 4ESBA 2BVMA 3HOZJ 2YUSA 1HA8A 1MMNA 2HOTA 1F5TA 1YJ9I 3S93A 5ILUA 1A36A 3ZQHA 1DGWY 2HYFA 3OYDA 2JQ7A 5D5UB 4D5CA 3CUQC 4Y7NJ 4P9UA 4MGRA 1F36A 3NARA 3O6BB 3M1EA 4ENNA 5FRNA 3QU3A 1KU2A 3OYHA 1YTYA 4OIOF 1QZYA 5HOOA 3DKYA 2MH9A 4BQOA 4IHWA 1M1EB 5LGTA 2CFXA 4W1UA 5C4XJ 3RDIA 3ZGKA 2HXOA 5ILVA 2BXYA 5HDGA 3SXYA 3GBGA 1VQPI 2LYCA 2MSYA 2Z99A 1WGXA 4MTDA 3OS2A 2Y69H 2W00A 4L5IA 1KQ9A 2CW0F 1T0FA 2DOEA 4FQGA 4BE1A 3IAM2 3N05A 1LVAA 4B3XA 3C1DA 5ICCA 1QA6A 5B1BH 4BXFA 2NOJB 1JE8A 4L9TA 5ICEA 4IQJA 3QODA 4RB1A 3JAMK 2W24A 1GLNA 4ZYHA 3JRCA 4CDGA 1RESA 4IOCF 2DQLA 1TTYA 1MBFA 2MD5A 3ZP5A 4XLCA 2HS5A 4A2UA 4GGGA 4ABZA 2OTJI 2RQQA 2OU2A 4W97A 4LD5A 4ETSA 3L7WA 2LY9A 2ZFWA 2Z3YA 1T2KA 4DIQA 2DFHA 3TL4X 5TJJA 4Y4RA 2GXBA 2XGEA 1LKXA 3PSFA 2HPIA 1EH6A 1U0JA 3BQZA 2F6CA 1LVKA 3V8JA 4RS8A 5EZGA 5E3MA 1JGSA 2WV1A 5J8FA 3JRDA 4K2EA 2NS7A 4JK1X 4BJTA 1VQOI 1BJAA 2BVLA 2PG4A 3QQAA 2QWWA 3ZQGA 2OJED 2MA3A 1XPXA 2GM4A 2KIQA 3ZR8X 2X9DA 1SVOA 3ZOBA 5CKTA 1ZR4A 2JMWA 4CCJA 1USTA 4DQ2A 1SC7A 2A3SA 3BPXA 1XTAA 5E8IA 2O5RA 5C44J 2HDCA 1IAWA 1VF9A 4KFCA 2A6EF 1LE8B 1K6OA 2G7UA 3K4BA 4FTHA 4II2A 2D5VA 2Y0MA 1ON2A 1R1TA 4EQQA 1TWGJ 3F6VA 2R7DA 2L7ZA 1SVLA 3SEZA 5LGUA 3IKTA 4BKXA 1Z0XA 2M4GA 3RQ4A 3TOBA 1R71A 2VPLA 4YIIA 1TW3A 3W2AA 1SMYF 2O61A 1X19A 1W5TA 3QAHA 5IYBJ 5EJCA 5J4VA 1D8KA 1S72I 1YS6A 1WJDA 2RNJA 3ERMA 3CCMI 2ISYA 4B8XA 2F5DA 1Z21A 3Q9SA 2Y0SN 3I4PA 1TWAJ 3QPHA 4QLCU 1JKRC 2QEXI 2JA6J 5EEAA 4A3IJ 4HZFA 4WXHA 3ISPA 4LB6B 1V5FA 3S1QJ 4MQVA 1Z05A 4KT6A 1SFOJ 4IX7A 1IN7A 1U9OA 2DAOA 2HQNA 3GFMA 4UUSA 2HXIA 3VDXA 4AYBA 3R60A 3BZCA 1RKTA 4R8HA 2HU9A 2O8KA 2ME0A 3BG5A 4C30A 4HOBA 1QVUA 2MGQA 3RPUA 3ZQLA 3F21A 4KIFA 5L3EA 3AAFA 1VFCA 4M72A 3E6DA 2LP0A 5BMZA 2PMUA 3OYNA 2CV1A 4DGWB 2K40A 2COBA 2KLOA 4HX7A 1DPRA 3W6KB 4E7KA 2DLLA 1PYVA 4N9HA 5KHDA 5GTIC 5B3SH 4L5EA 2PLYA 5H6QA 3T0YA 1T6SA 3EYYA 1Y39A 3JSPA 1QQIA 5JHUA 2ZSIB 3BR6A 2VONA 4CICA 5FKKA 2J5PA 2LVSA 1S8NA 1LFBA 2K02A 3FXMA 5E1XA 4C3HJ 3GF2A 2Z5UA 1AU7A 2E60A 2R7OA 5FLXK 3GTPJ 4CYDA 2L3DA 2K9LA 2EZHA 3FXLA 2MG4A 2XAHA 1QZZA 3F8FA 1Q1HA 4CA0A 4I6ZA 1E3HA 4ZZLA 2PI0A 4GO1A 2YX4A 3OR1C 2XASA 1MBKA 2H8RA 3HOWJ 2V7FA 5B1AH 1YW8A 2EBIA 1IRFA 1H9TA 1ZG5A 1F1ZA 2JA7J 2K3PA 3L2QA 3JSOA 2HYJA 3B02A 3TEDA 1YJWI 2DDBA 4IL6C 2VL8A 5D4RA 2LY2A 2XF5A 3G1OA 4AM3A 2VQGA 1DGRM 2K7LA 3W2VA 1Z91A 1S6LA 2HKOA 4CH7A 1D3YA 3CLOA 5IOZA 2COMA 3KETA 3VYSB 4CZCA 1D1CA 4KUMA 3ZQFA 3CC7I 2RQPA 2UXNA 4XRSA 1OYWA 3IRRA 2EFNA 1FMWA 3V7CA 1HSTA 4J01A 4UB8C 1J7KA 2ZNZA 2O6GE 1ITYA 3F9KA 3CJRB 3K1NA 3M8EA 4LG0B 2F4MB 1W1WE 4XKVA 2RDPA 3L09A 2DW4A 3ZMDA 3NAUA 3TP3A 1F9NA 2ISZA 4LLNA 2ZJ2A 4E6KG 5FO5A 3QRFF 2DPDA 1JJ6C 3QU6A 4EV0A 3ZQQA 4NB5A 2CJJA 5B66C 1L3LA 3AG3H 5HODA 2K4JA 1ETWA 2KISA 3QPSA 3VODA 4HRIA 5C3EJ 1YIOA 1TWHJ 4ENJA 1RIOH 3BG7A 2H6BA 1BI2A 2UV1A 1O3RA 4BJ5C 3FIWA 1YFHA 3DKWA 2KQRA 2ECBA 4KICA 2MBFA 3IRQA 3GLXA 3GTLJ 2VXDA 4G8XA 3GZ6A 3DFGA 4EGZA 1UB9A 1TL8A 5E79C 3V42A 2YSRA 3OOPA 2EIMH 2PQ8A 3HKZA 3TW6A 3KE2A 1Y1VJ 1KU7A 3CUQA 1SFKA 3PIOF 2QVOA 4FE7A 4ZDPA 1WJ5A 4A0YA 4BBSJ 1JTXA 2JUGA 4M74A 4HSRA 5HLIA 1YS7A 3M9AA 3K4KA 1PVEA 2OZ6A 2JA8J 4PZJA 2P5VA 4A6DA 2I8DA 1ZN2A 3I64A 1X1PA 1FWZA 3BTLA 1VQMI 3J81Z 2K85A 4KISA 2VOOA 3FXQA 1TBXA 5FLMJ 1D1AA 3HYIA 4EVIA 5M3FJ 2ID6A 3M07A 1XC5A 5K7HA 2HKXA 2DA7A 4UV8A 1YX5A 1V54H 3R6SA 1IO2A 1ZARA 3IKVA 1B59A 3LAPA 2A61A 2MD0A 4HLXA 3S14J 5CYVA 1XGMA 1JGGA 1SEUA 4KMFA 1X3ZB 2HPMA 1GV2A 3FKJA 4NC7A 5DCMA 2FNAA 5BPIA 3FKIJ 1Z9CA 4A3MJ 3G1LA 4X6AJ 4XKBA 1R5ID 1VNDA 2K3FA 3M3YJ 2EJRA 3CCVI 1A31A 3CF2A 2V1NA 5M5XJ 4RGRA 3T1BA 2EWNA 3HRUA 3PL8A 3SDGA 4P5OA 3HSEA 1ETXA 1IW7F 1HDPA 1XCVA 2DN0A 1P7JA 4QIWN 2XAGA 1T0FC 1V3FA 4IKFA 3TO7A 3RKYA 3CDHA 2LKPA 3E5QA 3SZTA 1X1CA 3WE3A 4B3AA 3FK6A 3FISA 3K4MA 3ULQB 4RDUA 3TBIA 2A05A 2VBYA 2PMZA 1GHCA 2WY8Q 1TQPA 4RGXA 1TC3C 3BLYA 1SD7A 1EKEA 3KLNA 4YEJA 1DU6A 1UZCA 2KIUA 5J4YA 1FLIA 2ETHA 4ZYEA 3U1DA 3BOQA 3CP8A 5CLSA 4EJVA 1IG7A 2KMUA 3KEQA 4XQFA 2LG4A 4UHTA 3L2UA 3WTYC 1HKSA 2OQGA 1WFXA 2KT0A 3GTGJ 2LF8A 3GFJA 2WTEA 4PCQA 1ZELA 1QHGA 2X1EA 3M4OJ 1O7LA 2Q8KA 2KFDA 1D8JA 2OZUA 4FCYA 4NHJA 3BR3A 1G3YA 5IYCJ 2MYSA 5ICFA 3OYAA 3TP0A 1SD5A 2H6CA 3E6MA 5CJ9A 1AKHB 2DO7A 2ZC2A 3WTXC 5HNHA 4BQNA 4YFXF 3DPLC 3K1PA 2LSOA 2X4HA 3FK7A 2M1BA 1TNSA 4LLGF 1W0TA 4N4NB 1O3QA 2P0WA 3UR3C 1TQMA 2JVGA 3RQIA 1B8IA 2WA0A 4BJ6C 5BQTA 4WXDA 3WTUC 1H0MA 1X4PA 2OC6A 4OIQF 3WU2C 1LE8A 5H6RA 5LBQA 4AYBN 4RAFA 3I71A 2PJRB 2VUMJ 4AUXA 1STZA 3CC2I 3S32A 2BOLA 4BACA 3CCQI 4M3GA 1FMVA 1XDUA 2LREA 5F6FA 1G6NA 1VQ7I 1TZLA 5L3BA 3OYJA 5E1WA 3LSPA 2Y9ZA 2XPUA 1G3SA 3ZQ7A 2XAFA 4IRHA 3CQZJ 3ERED 2QGUA 5C4JJ 2CW8A 1BC7C 1QO0D 3C2BA 3LQQA 2OF7A 4BDZA 4UUSB 4ENKA 3GUDA 2O03A 4GCVA 1S5LC 2V26A 3GLLA 2PN6A 2HZTA 2A5WA 5CPRB 4AVPA 1W5SA 5M3MJ 3OYCA 3HB9A 4JX6A 4A3DJ 1K78A 3S15J 1KA8A 1WZ2A 2EH3A 1LEBA 5IT3A 1KZHA 1FIPA 2XV4S 3KZZA 2O3FA 4EJUA 1ON1A 2ZFUA 3LFUA 4DBQA 3GTOJ 4F3QA 3RKWA 3MZYA 3RKXA 2QLZA 5BOXA 2OCEA 1FSEA 5D8LB 1CF7A 2R7UA 1S7OA 1ZRCA 1MH3A 2OQRA 2UUZA 2DCEA 1F4KA 2ADUA 4D9JA 1K6YA 1T98A 2FF4A 3HHGA 3DV8A 2IJLA 1X3UA 1K7AA 1N25A 2KDOA 1ZRFA 2LKSA 4A0ZA 4Y33A 3KYLA 1U8RA 2EFWA 4G6QA 4OAYA 1ZH5A 4L9JA 3DCFA 2V1XA 4KT5C 1RRJA 1N77A 3RKQA 3KCCA 4RGUA 2FOWA 3LSRA 1IF1A 4PUSA 2H27A 2QSHX 1W5CC 3I56I 4M73A 3ELKA 1O57A 4A3EJ 2NVQJ 4LMYA 4OWRB 4NDLA 4P9FA 5DM6F 5K5RA 4UNOA 1XDSA 5BS6A 3LA3A 4BXUA 3E6BA 3P9IA 3BT9A 5JVGF 5L3FA 1G2HA 2B63J 4OMZA 1Z67A 3DWLE 4RAZA 5CQGA 3Q0VA 1T33A 4UVAA 3G2BA 2J5OA 4MNUA 3QWLA 2BW3A 2O7OA 3JRBA 2R7RA 4BQAA 4ZJZA 4LFUA 2HGCA 3HPHA 2JSPA 4RBOA 3B73A 4GYIA 3IHUA 3HM5A 2E35A 4HV6A 3BG3A 1FNNA 2D2WA 3EETA 3G1MA 2STTA 3C7JA 4PJMA 1QVTA 1W0UA 3DLAA
chains in the Genus database with same CATH topology
5D5VB 5LLQA 3KP5A 3QP6A 2P4WA 4LG0A 5EEGA 2V6CA 4HYEA 1E2XA 2Z33A 1KYWA 2NYXA 2E7WA 3C3WA 2BE5F 3PFIA 4G9YA 1OKRA 4PGHA 4KYWA 3RYPA 3Q9VA 1BC8C 4KN4X 3CO7C 5CVRA 2QENA 3J80K 5FD6A 3FHZA 1JXSA 4A0XA 1ZRDA 1UHWA 4N0BA 1KYZA 3R61A 2TDXA 3GFLA 1TNTA 2BEOA 2OBPA 3I53A 5DUIA 4I0BA 4RB2C 2JPBA 4IHTA 3ML6A 2L4MA 3U2RA 1SFEA 2VODA 5DCMB 2A5YB 3T8TA 2FE3A 4NQWA 2D1VA 2ZNYA 3F8MA 2RV8A 1B6AA 2LDUA 2IW5A 2WWYA 1J59A 4ASNA 5A2QZ 4EM1A 3V8KA 4XLNF 4Y15A 2KRFA 4HF1A 2NRAC 4D0PA 1J5YA 4MTEA 4HBLA 3QOPA 3HRTA 1UCRA 2V1UA 2P7VB 1O7FA 3COAC 4FX4A 2VBWA 3FX3A 1B9MA 4BHBA 4L0ZB 4UUVA 1TW2A 1O3TA 3F8BA 2GIVA 2QQAA 3WTVC 2UZKA 5JVTA 3I0TA 3M7GA 4I02A 1TLHB 3TDUC 3HRSA 3ROUA 3WGHA 1DPUA 4R79A 4LK1F 1R1VA 1WSUA 2V9VA 4BH9A 4U0VA 3RPQA 4EM0B 3LWFA 3ZPLA 4I09A 1GXQA 1KGSA 1CGPA 4RGSA 4ZYGA 1FBQA 3ECOA 1XSXA 2NNNA 1BI0A 2EFQA 4M9XA 2MLKA 1FYMA 3I59B 4HAMA 4B09A 4ZYDA 4YFNF 2ESHA 2FEZA 1K78B 2ZMEA 2F2EA 3EUHA 2IA1A 4AIKA 2PMHA 1S7AA 3HHHA 4YIFA 3T5XA 1CF7B 4YG2F 2VXZA 4HF0A 3BWGA 4GYGA 1IUYA 2H09A 3I5UA 5D5XB 1KQ8A 1XMAA 5DDGA 2L02A 3TKYA 1B9NA 2UXXA 2HOEA 2V79A 2YPRA 1G3TA 1O3SA 2HFHA 2DK5A 2EV0A 4O6JA 3F23A 3BJ6A 2XUBA 1J9IA 1HSJA 2BBYA 5D5WB 2DK8A 3DF8A 5HDKA 4HDUA 3K69A 4G7OF 2G7HA 3HOSA 3L2CA 4G7ZF 3ZMTA 4Q5SF 5TRDA 2AXLA 4JBAA 2QQBA 3E3VA 3DXJF 5ILSA 3MZHA 3GX4X 3LA7A 3H3UA 1QBJA 2MLGA 2DT5A 1OR7A 1HXDA 4I7HA 4E70A 2LF7A 2PBIA 2FBIA 4IRGA 4MHGA 1ULYA 1WWXA 1HKTA 1IN4A 2RKHA 3V4GA 4O3MA 1U78A 1R1UA 4L9NA 3D0SA 2ZCWA 2VC0A 4EJTA 4A12A 1R23A 5E8GA 4OU0A 2FNPA 4XLPF 4UVCA 1JHHA 1QNTA 4Q48A 3I54A 1J75A 1ZG1A 4FHTA 1FBSA 2L4AA 2D1HA 2XRNA 1G4DA 2NS0A 4H0EA 1YYVA 1MDMB 1DUXC 2IRFG 3VB2A 2E1NA 5FB2A 5HS7A 3WGGA 2Z9OA 3R4KA 2OD5A 1W7PD 2O0YA 2Y75A 1B1BA 2JZYA 1R5HA 4F7ZA 2DTRA 2HTSA 2P6SA 4KDPA 2JSCA 3IWZA 1FT9A 3KP4A 4P96A 2EFOA 4WWCA 2D45A 2VBXA 5H20A 3BDDA 3NQOA 1HW5A 3HSRA 3MCZA 4ENMA 1S29A 2JTVA 2P6TA 4LK0F 1P4AA 3GW2A 3BY6A 1UFMA 2STWA 3BP8A 3VOEA 1DDNA 2GA2A 1QPMA 3R0JA 4EMSA 2XIGA 1R5GA 2P5LC 3TDZC 2XAJA 2W84A 1BM9A 3ZN1A 3U9GA 1ZAOA 4Z2YA 3F8CA 5ICGA 1XD7A 3Q5FA 2HWVA 2HEOA 5DYMA 2A07F 3J80Z 2XROA 5IT9K 2G9WA 2Q2EA 2HYGD 4CXFA 1KU3A 1IZ1A 4EGYA 4U7DA 5DD8A 4Q4ZF 3BJAA 3FM5A 2FMLA 2GZWA 3HRMA 1XSVA 3MQ0A 3CO6C 1LNWA 1KQ0A 1S3JA 2VE8A 4A5NA 1W7PB 1FP1D 3P9KA 5LHHA 3I59A 2ZMEB 3DP7A 3WTSC 2PJPA 3WTTC 3H3ZA 5DV5A 4EJOA 2ACJA 2UWMA 3JW4A 3MWMA 3WGIA 5DEQA 1U5TA 1WI9A 5FFZA 1XB4A 5EEHA 3JAMZ 5JI6A 4AIHA 3F22A 1IXRC 2XVCA 4OOIA 3LA2A 2ZO4A 5F64A 2ZBKA 5K1YA 2P7CB 4TV7A 4KMUX 1SFUA 1IN8A 1ZHFA 4FX0A 3RIRA 2KIFA 3ZMVA 3WODF 4XBFA 3FMQA 3SQNA 4CHUA 4MEXF 5J8CA 2DI3A 3WE2A 1G3WA 2A6HF 2FRHA 3GYHX 3QP5A 2GA1A 3FMRA 1TQIA 4O5VA 4HV5A 2E7XA 3RJPA 1YW7A 4L9VA 3LAJA 3J81K 1V4RA 2IVMA 2PEXA 2YX7A 1BN5A 2KJBA 4U0WA 4S04A 3HOTA 4ON0A 3O2PE 2K4BA 3DPTA 4G6DA 3MAJA 3TGNA 4G7HF 1HQCA 5AIPA 1MD0A 3GWZA 2FQ3A 4XSZF 4U7BA 2R3SA 1YQAA 3F72A 3EQLF 1FBUA 1J2XA 1LB2A 1OPCA 3FMSA 2M8EA 1Z6RA 2GXGA 3N97A 3E5UA 2M30A 1JHFA 1ZYRF 4UV9A 4KN7X 3K1MA 1U3EM 4M6XA 1RI7A 1PUEE 2FU4A 3FXRA 3REOA 1AWCA 3V7RA 1BOAA 1ODDA 4L18B 4KNYA 3HTUA 1H9GA 3LSTA 4M9ZA 5FLXZ 2M5WA 3ABTA 3L9FA 3V7SA 4FT8A 3I58A 1RUOA 2F5FA 1MDMA 1T39A 2DU9A 5HDNA 2EA4A 2Y48A 5AONA 3GXOA 3RYRA 3TO9A 4HW0A 2CG4A 4S05A 1AOYA 1Y0UA 3ZN0A 4MEYF 1QGPA 3HSFA 1I6XA 1ZLJA 4RAYA 1R36A 3EYIA 2CSOA 3MEXA 2KIMA 4YFKF 4WXCA 1BIAA 6PAXA 3WG9A 2CYYA 3TQNA 4IXAA 4KIBA 3KP6A 3J7AO 2F5CA 1J0RA 1XN7A 5E18F 2BYVE 2EV5A 1RZ4A 4BYYA 3BZ6A 2EB7A 1E17A 4HX8A 1FX7A 4G94A 1FZPB 3E97A 2FOKA 3IL2A 5BPDA 1ZG3A 3EDPA 2O8XA 1LEAA 5D6FA 2OA4A 1MGTA 1MJAA 4PDKA 1OMIA 1P2FA 5E17F 4HQMA 5JFRA 2IT0A 2XKOA 1XSDA 1MJ9A 3TO6A 1ZGAA 4I01A 2VOPA 4IVNA 2EV6A 5L3CA 2E1CA 1U2WA 4BHCA 4ESJA 1W7PA 4I2OA 1YLFA 2W57A 2RC4A 3K9TA 1U5TB 4LB5A 1BI1A 3ZMSA 2QBYB 5K5QA 4WX9A 2OAZA 2W25A 3HUGA 5DD4A 4IHSA 3IWFA 1DP7P 3H92A 2R7FA 1U5TC 1REPC 3TOAA 2ELHA 4LLLA 3D5LA 3FF5A 2GQQA 2JT1A 2VBZA 1LDJA 3N4MA 1YW9A 1A04A 2ZXJA 3NRVA 4UVBA 3KP3A 2FXAA 3DEUA 1RNLA 3K2ZA 2K27A 1EH8A 4HA8A 4WK8F 3ECHA 1IN5A 3F3XA 3SHFA 1EV7A 4AD9A 3V8LA 1D5VA 1XMKA 3FXUA 2K86A 4AIJA 4U88A 3K0LA 5HS9A 5IT9Z 2FSWA 2P8TA 3SFZA 5LHGA 2QQ9A 3L00A 4A5MA 2VE9A 4U0YA 1PP7U 2X0LA 1YO5C 2CQKA 4RB0A 4EJWA 2DFIA 3E5XA 4A6EA 3WTWC 2MC3A 4IRIA 1OYYA 1ZREA 5A2QK 2XAQA 2QM3A 1U6GA 1KU9A 4BHPA 5D4SA 2CWEA 2IPQX 2A68F 2A69F 4JQFA 4PGGA 1IN6A 4L0YB 3WTZA 1Z7UA 4EM2A 1YG2A 1I27A 5DUKA 1HW1A 4OINF 1SAXA 1GXPA 4RB3C 3GVAA 3HIFA 1USSA 2C6YA 1T38A 5FFXA 2M45A 4LGWA 2AS5F 3ZMUA 5E1ZB 2L01A 2H94A 1SD6A 3PQJA 2BGCA 1L0OC 2W85A 2V1DA 3R0AA 1IRGA 3KP2A 1BBYA 2ESNA 1P4WA 2VT2A 2QUFA 3FZVA 2FBKA 3BROA 4BNCA 1SMTA 2FBHA 5D8KB 1LDDA 3ABUA 4HX4A 1FYLA 3JTHA 1FYKA 1K79A 2CGPA 1XCBA 2CO5A 5JR3A 3IC7A 3BJOA 5LHIA 2EFPA 4DNCA 2QZ8A 1FC3A 4XRFA 3NEUA 1FY7A 1EH7A 4Y17A 4OIPF 2RGVA 3OV8A 1WKMA 3DQVC 2YR2A 4IF4A 2XGXA 3SZPA 2XHKA 3P7NA 3FWEA 2Q0OA 2YU3A 5F1RA 5HLGA 2GAUA 3WU0A 5FGMA 2BV6A 2FA5A 1HKQA 3F6OA 4WCGA 1R7JA 1XGSA 3VFZA 1IXCA 4Q47A 2VT3A 1ZGJA 4Y13A 3C18A 3CUOA 5DCFA 4WF2A 3G3ZA 4IPAA 2VN2A 5CVUA 1LJ9A 2DBBA 3KFWX 4HDVA 3F8NA 5J6XA 3BPVA 5ERIA 1I5ZA 1WRJA 3P9CA 1PDNC 1ONVA 2XKPA 2DPUA 3ZMZA 1PP8F 2HTJA 3KEOA 4M6YA 2HR3A 3QPTA 1P92A 1SFXA 5KK1A 5HVQC 5LRRA 1B4AA 1BIBA 4ESFA 4CO8A 2ZKZA 4R1HA 1HW2A 2L54A 3S2WA 5D6EA 3LFKA 1I1GA 2QBYA 1MKMA 4ZZDA 1LDKB 4HLYA 1FPQA 3CTAA 4HQEA 4XSXF 2LNBA 2WC2A 3M8FA 3RI4A 1C0WA 2DQRA 5FD5A 1RUNA 2IP2A 2IA2A 1I1SA 4CGZA 3CJNA 1IXSB 3W6JB 1Z1DA 1P6RA 2VC1A 5CVIA 3GZ5A 3VEPA 3KZYA 3T8RA 3LQRA 1WQ2A 1R58A 3HTSB 4KA4A 1GVJA 2NNYA 5E20A 4QWQA 1FP2A 2IA0A 2GWRA 2RVCA 1Z6TA 5HS8A 3G73A 3GFIA 2EA2A 4ZH4F 2KJCA 5LEKA 2M87A 1MZBA 2HQRA 3GO5A 1OYIA 4L5JA 1BI3A 2RN7A 2KKOA 2B0LA 4CZZA 5AIQA 1P4XA 3RTRA 5L3DA 2PFBA 1R00A 4KIGA 3GEZA 1FSHA 2MH2A 3KP7A 5L3GA 1LQ1A 5KVRA 4IJAA 5CVJA 4I0AA 5LRSA 5ED4A 3MFKA 3WU1B 4OMYA 2QYOA 1HBXG 4BAYA 4HF2A 1VTNC 4GXOA 2FMYA 5HLHA 3E6CC 4I98B 1XGOA 2EK5A 5K5OA 3FM3A 4N9IA 4LJZF 2F5EA 2NAZA 2WV0A 5LGNA 4AWXB 1R22A 5CVVA 1ZLKA 4UXNA 2P5KA 3KLOA 1MJBA 2JPCA 3PQKA 4MQ9F 4M71A 4M9SA 1NHAA 1W4MA 1SD4A 1FOKA 1UHMA 1XGNA 3CUQB 4OIRF 2JRTA 5LEJA 3O3KA 4P55A 4ESBA 1F5TA 5ILUA 2HYFA 5D5UB 3CUQC 4P9UA 4MGRA 3O6BB 3M1EA 4ENNA 3QU3A 1KU2A 1YTYA 4OIOF 1QZYA 5HOOA 2MH9A 5LGTA 2CFXA 3RDIA 5ILVA 5HDGA 3SXYA 2Z99A 4MTDA 4L5IA 1KQ9A 2CW0F 1T0FA 1LVAA 3C1DA 5ICCA 1JE8A 4L9TA 5ICEA 4RB1A 3JAMK 2W24A 4ZYHA 4CDGA 2DQLA 1TTYA 2MD5A 3ZP5A 2HS5A 4A2UA 4GGGA 2OU2A 4LD5A 4ETSA 3L7WA 2ZFWA 2Z3YA 1T2KA 5TJJA 2GXBA 1EH6A 3V8JA 4RS8A 1JGSA 5J8FA 4K2EA 4JK1X 1BJAA 2PG4A 2QWWA 2MA3A 1USTA 4DQ2A 2A3SA 3BPXA 5E8IA 2HDCA 1IAWA 4KFCA 2A6EF 1K6OA 2G7UA 2Y0MA 1ON2A 1R1TA 4EQQA 3F6VA 2R7DA 3IKTA 5LGUA 3TOBA 4YIIA 1TW3A 1SMYF 2O61A 1W5TA 3QAHA 1D8KA 1YS6A 2RNJA 2ISYA 4B8XA 2F5DA 3Q9SA 3I4PA 3QPHA 4QLCU 4HZFA 4WXHA 3ISPA 4LB6B 4MQVA 1Z05A 1IN7A 2DAOA 2HQNA 3GFMA 3R60A 4R8HA 4HOBA 3RPUA 3F21A 4KIFA 5L3EA 3AAFA 4M72A 3E6DA 5BMZA 2PMUA 4HX7A 1DPRA 3W6KB 2DLLA 4N9HA 2PLYA 5H6QA 3T0YA 1T6SA 3EYYA 3JSPA 1QQIA 5JHUA 2VONA 4CICA 2J5PA 1S8NA 2K02A 5E1XA 3GF2A 2Z5UA 5FLXK 4CYDA 2L3DA 2XAHA 1QZZA 3F8FA 1Q1HA 4ZZLA 2PI0A 4GO1A 2YX4A 2XASA 1YW8A 1H9TA 1IRFA 1ZG5A 1F1ZA 3JSOA 3B02A 5D4RA 2K7LA 1Z91A 1S6LA 2HKOA 1D3YA 3CLOA 2COMA 3KETA 4KUMA 2RQPA 2UXNA 1OYWA 3IRRA 2EFNA 3V7CA 1HSTA 1J7KA 2ZNZA 2O6GE 3K1NA 3M8EA 4LG0B 2RDPA 3L09A 2DW4A 3ZMDA 1F9NA 2ISZA 4LLNA 2ZJ2A 5FO5A 3QRFF 2DPDA 3QU6A 4EV0A 4NB5A 1L3LA 2K4JA 3VODA 1YIOA 4ENJA 1RIOH 2H6BA 1BI2A 1O3RA 1YFHA 3DKWA 4KICA 2MBFA 3IRQA 3GLXA 4G8XA 3GZ6A 3DFGA 4EGZA 1UB9A 2YSRA 3OOPA 2PQ8A 3KE2A 1KU7A 3CUQA 2QVOA 4A0YA 4M74A 5HLIA 1YS7A 3M9AA 2OZ6A 4PZJA 2P5VA 4A6DA 1ZN2A 3I64A 1FWZA 3J81Z 2VOOA 3FXQA 1TBXA 3HYIA 4EVIA 2HKXA 4UV8A 3R6SA 1ZARA 3IKVA 1B59A 3LAPA 2A61A 4HLXA 5CYVA 1XGMA 4KMFA 5DCMA 2FNAA 5BPIA 1Z9CA 2EJRA 4RGRA 3T1BA 2EWNA 3HRUA 4P5OA 3HSEA 1IW7F 1XCVA 2XAGA 1V3FA 3TO7A 3RKYA 3CDHA 2LKPA 3E5QA 3SZTA 3WE3A 3ULQB 2VBYA 1GHCA 4RGXA 1TQPA 1SD7A 3KLNA 2KIUA 1FLIA 2ETHA 4ZYEA 3U1DA 3BOQA 5CLSA 4EJVA 3KEQA 4UHTA 3WTYC 1HKSA 2OQGA 2LF8A 3GFJA 2WTEA 4PCQA 1O7LA 2Q8KA 1D8JA 2OZUA 4NHJA 1G3YA 5ICFA 1SD5A 2H6CA 3E6MA 5CJ9A 2DO7A 3WTXC 4YFXF 3DPLC 3K1PA 2LSOA 2X4HA 2M1BA 1TNSA 4LLGF 1O3QA 1TQMA 5BQTA 4WXDA 3WTUC 1H0MA 4OIQF 5H6RA 5LBQA 3I71A 1STZA 1XDUA 5F6FA 1G6NA 5L3BA 5E1WA 1G3SA 3ZQ7A 2XAFA 4IRHA 3ERED 1BC7C 1QO0D 3LQQA 4ENKA 3GUDA 2O03A 4GCVA 2PN6A 2HZTA 4AVPA 1W5SA 1K78A 1KA8A 1LEBA 5IT3A 2XV4S 3KZZA 2O3FA 4EJUA 1ON1A 3RKWA 3MZYA 3RKXA 2QLZA 5BOXA 1FSEA 5D8LB 1CF7A 1S7OA 1ZRCA 2OQRA 1F4KA 2ADUA 1T98A 2FF4A 3HHGA 3DV8A 2IJLA 1X3UA 1K7AA 1ZRFA 4A0ZA 1U8RA 2EFWA 4G6QA 1ZH5A 4L9JA 2V1XA 4KT5C 3KCCA 4RGUA 1IF1A 2H27A 4M73A 3ELKA 1O57A 4LMYA 4P9FA 5K5RA 4UNOA 1XDSA 5BS6A 3LA3A 4BXUA 3E6BA 3P9IA 5L3FA 4OMZA 4RAZA 4UVAA 2J5OA 4MNUA 4BQAA 4LFUA 2HGCA 3B73A 4GYIA 3IHUA 4HV6A 1FNNA 2D2WA 3EETA 2STTA 3C7JA 3JTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5D5V B;  5LLQ A;  3KP5 A;  3QP6 A;  2P4W A;  4LG0 A;  5EEG A;  2V6C A;  4HYE A;  1E2X A;  2Z33 A;  1KYW A;  2NYX A;  2E7W A;  3C3W A;  2BE5 F;  3PFI A;  4G9Y A;  1OKR A;  4PGH A;  4KYW A;  3RYP A;  3Q9V A;  1BC8 C;  4KN4 X;  3CO7 C;  5CVR A;  2QEN A;  3J80 K;  5FD6 A;  3FHZ A;  1JXS A;  4A0X A;  1ZRD A;  1UHW A;  4N0B A;  1KYZ A;  3R61 A;  2TDX A;  3GFL A;  1TNT A;  2BEO A;  2OBP A;  3I53 A;  5DUI A;  4I0B A;  4RB2 C;  2JPB A;  4IHT A;  3ML6 A;  2L4M A;  3U2R A;  1SFE A;  2VOD A;  5DCM B;  2A5Y B;  3T8T A;  2FE3 A;  4NQW A;  2D1V A;  2ZNY A;  3F8M A;  2RV8 A;  1B6A A;  2LDU A;  2IW5 A;  2WWY A;  1J59 A;  4ASN A;  5A2Q Z;  4EM1 A;  3V8K A;  4XLN F;  4Y15 A;  2KRF A;  4HF1 A;  2NRA C;  4D0P A;  1J5Y A;  4MTE A;  4HBL A;  3QOP A;  3HRT A;  1UCR A;  2V1U A;  2P7V B;  1O7F A;  3COA C;  4FX4 A;  2VBW A;  3FX3 A;  1B9M A;  4BHB A;  4L0Z B;  4UUV A;  1TW2 A;  1O3T A;  3F8B A;  2GIV A;  2QQA A;  3WTV C;  2UZK A;  5JVT A;  3I0T A;  3M7G A;  4I02 A;  1TLH B;  3TDU C;  3HRS A;  3ROU A;  3WGH A;  1DPU A;  4R79 A;  4LK1 F;  1R1V A;  1WSU A;  2V9V A;  4BH9 A;  4U0V A;  3RPQ A;  4EM0 B;  3LWF A;  3ZPL A;  4I09 A;  1GXQ A;  1KGS A;  1CGP A;  4RGS A;  4ZYG A;  1FBQ A;  3ECO A;  1XSX A;  2NNN A;  1BI0 A;  2EFQ A;  4M9X A;  2MLK A;  1FYM A;  3I59 B;  4HAM A;  4B09 A;  4ZYD A;  4YFN F;  2ESH A;  2FEZ A;  1K78 B;  2ZME A;  2F2E A;  3EUH A;  2IA1 A;  4AIK A;  2PMH A;  1S7A A;  3HHH A;  4YIF A;  3T5X A;  1CF7 B;  4YG2 F;  2VXZ A;  4HF0 A;  3BWG A;  4GYG A;  1IUY A;  2H09 A;  3I5U A;  5D5X B;  1KQ8 A;  1XMA A;  5DDG A;  2L02 A;  3TKY A;  1B9N A;  2UXX A;  2HOE A;  2V79 A;  2YPR A;  1G3T A;  1O3S A;  2HFH A;  2DK5 A;  2EV0 A;  4O6J A;  3F23 A;  3BJ6 A;  2XUB A;  1J9I A;  1HSJ A;  2BBY A;  5D5W B;  2DK8 A;  3DF8 A;  5HDK A;  4HDU A;  3K69 A;  4G7O F;  2G7H A;  3HOS A;  3L2C A;  4G7Z F;  3ZMT A;  4Q5S F;  5TRD A;  2AXL A;  4JBA A;  2QQB A;  3E3V A;  3DXJ F;  5ILS A;  3MZH A;  3GX4 X;  3LA7 A;  3H3U A;  1QBJ A;  2MLG A;  2DT5 A;  1OR7 A;  1HXD A;  4I7H A;  4E70 A;  2LF7 A;  2PBI A;  2FBI A;  4IRG A;  4MHG A;  1ULY A;  1WWX A;  1HKT A;  1IN4 A;  2RKH A;  3V4G A;  4O3M A;  1U78 A;  1R1U A;  4L9N A;  3D0S A;  2ZCW A;  2VC0 A;  4EJT A;  4A12 A;  1R23 A;  5E8G A;  4OU0 A;  2FNP A;  4XLP F;  4UVC A;  1JHH A;  1QNT A;  4Q48 A;  3I54 A;  1J75 A;  1ZG1 A;  4FHT A;  1FBS A;  2L4A A;  2D1H A;  2XRN A;  1G4D A;  2NS0 A;  4H0E A;  1YYV A;  1MDM B;  1DUX C;  2IRF G;  3VB2 A;  2E1N A;  5FB2 A;  5HS7 A;  3WGG A;  2Z9O A;  3R4K A;  2OD5 A;  1W7P D;  2O0Y A;  2Y75 A;  1B1B A;  2JZY A;  1R5H A;  4F7Z A;  2DTR A;  2HTS A;  2P6S A;  4KDP A;  2JSC A;  3IWZ A;  1FT9 A;  3KP4 A;  4P96 A;  2EFO A;  4WWC A;  2D45 A;  2VBX A;  5H20 A;  3BDD A;  3NQO A;  1HW5 A;  3HSR A;  3MCZ A;  4ENM A;  1S29 A;  2JTV A;  2P6T A;  4LK0 F;  1P4A A;  3GW2 A;  3BY6 A;  1UFM A;  2STW A;  3BP8 A;  3VOE A;  1DDN A;  2GA2 A;  1QPM A;  3R0J A;  4EMS A;  2XIG A;  1R5G A;  2P5L C;  3TDZ C;  2XAJ A;  2W84 A;  1BM9 A;  3ZN1 A;  3U9G A;  1ZAO A;  4Z2Y A;  3F8C A;  5ICG A;  1XD7 A;  3Q5F A;  2HWV A;  2HEO A;  5DYM A;  2A07 F;  3J80 Z;  2XRO A;  5IT9 K;  2G9W A;  2Q2E A;  2HYG D;  4CXF A;  1KU3 A;  1IZ1 A;  4EGY A;  4U7D A;  5DD8 A;  4Q4Z F;  3BJA A;  3FM5 A;  2FML A;  2GZW A;  3HRM A;  1XSV A;  3MQ0 A;  3CO6 C;  1LNW A;  1KQ0 A;  1S3J A;  2VE8 A;  4A5N A;  1W7P B;  1FP1 D;  3P9K A;  5LHH A;  3I59 A;  2ZME B;  3DP7 A;  3WTS C;  2PJP A;  3WTT C;  3H3Z A;  5DV5 A;  4EJO A;  2ACJ A;  2UWM A;  3JW4 A;  3MWM A;  3WGI A;  5DEQ A;  1U5T A;  1WI9 A;  5FFZ A;  1XB4 A;  5EEH A;  3JAM Z;  5JI6 A;  4AIH A;  3F22 A;  1IXR C;  2XVC A;  4OOI A;  3LA2 A;  2ZO4 A;  5F64 A;  2ZBK A;  5K1Y A;  2P7C B;  4TV7 A;  4KMU X;  1SFU A;  1IN8 A;  1ZHF A;  4FX0 A;  3RIR A;  2KIF A;  3ZMV A;  3WOD F;  4XBF A;  3FMQ A;  3SQN A;  4CHU A;  4MEX F;  5J8C A;  2DI3 A;  3WE2 A;  1G3W A;  2A6H F;  2FRH A;  3GYH X;  3QP5 A;  2GA1 A;  3FMR A;  1TQI A;  4O5V A;  4HV5 A;  2E7X A;  3RJP A;  1YW7 A;  4L9V A;  3LAJ A;  3J81 K;  1V4R A;  2IVM A;  2PEX A;  2YX7 A;  1BN5 A;  2KJB A;  4U0W A;  4S04 A;  3HOT A;  4ON0 A;  3O2P E;  2K4B A;  3DPT A;  4G6D A;  3MAJ A;  3TGN A;  4G7H F;  1HQC A;  5AIP A;  1MD0 A;  3GWZ A;  2FQ3 A;  4XSZ F;  4U7B A;  2R3S A;  1YQA A;  3F72 A;  3EQL F;  1FBU A;  1J2X A;  1LB2 A;  1OPC A;  3FMS A;  2M8E A;  1Z6R A;  2GXG A;  3N97 A;  3E5U A;  2M30 A;  1JHF A;  1ZYR F;  4UV9 A;  4KN7 X;  3K1M A;  1U3E M;  4M6X A;  1RI7 A;  1PUE E;  2FU4 A;  3FXR A;  3REO A;  1AWC A;  3V7R A;  1BOA A;  1ODD A;  4L18 B;  4KNY A;  3HTU A;  1H9G A;  3LST A;  4M9Z A;  5FLX Z;  2M5W A;  3ABT A;  3L9F A;  3V7S A;  4FT8 A;  3I58 A;  1RUO A;  2F5F A;  1MDM A;  1T39 A;  2DU9 A;  5HDN A;  2EA4 A;  2Y48 A;  5AON A;  3GXO A;  3RYR A;  3TO9 A;  4HW0 A;  2CG4 A;  4S05 A;  1AOY A;  1Y0U A;  3ZN0 A;  4MEY F;  1QGP A;  3HSF A;  1I6X A;  1ZLJ A;  4RAY A;  1R36 A;  3EYI A;  2CSO A;  3MEX A;  2KIM A;  4YFK F;  4WXC A;  1BIA A;  6PAX A;  3WG9 A;  2CYY A;  3TQN A;  4IXA A;  4KIB A;  3KP6 A;  3J7A O;  2F5C A;  1J0R A;  1XN7 A;  5E18 F;  2BYV E;  2EV5 A;  1RZ4 A;  4BYY A;  3BZ6 A;  2EB7 A;  1E17 A;  4HX8 A;  1FX7 A;  4G94 A;  1FZP B;  3E97 A;  2FOK A;  3IL2 A;  5BPD A;  1ZG3 A;  3EDP A;  2O8X A;  1LEA A;  5D6F A;  2OA4 A;  1MGT A;  1MJA A;  4PDK A;  1OMI A;  1P2F A;  5E17 F;  4HQM A;  5JFR A;  2IT0 A;  2XKO A;  1XSD A;  1MJ9 A;  3TO6 A;  1ZGA A;  4I01 A;  2VOP A;  4IVN A;  2EV6 A;  5L3C A;  2E1C A;  1U2W A;  4BHC A;  4ESJ A;  1W7P A;  4I2O A;  1YLF A;  2W57 A;  2RC4 A;  3K9T A;  1U5T B;  4LB5 A;  1BI1 A;  3ZMS A;  2QBY B;  5K5Q A;  4WX9 A;  2OAZ A;  2W25 A;  3HUG A;  5DD4 A;  4IHS A;  3IWF A;  1DP7 P;  3H92 A;  2R7F A;  1U5T C;  1REP C;  3TOA A;  2ELH A;  4LLL A;  3D5L A;  3FF5 A;  2GQQ A;  2JT1 A;  2VBZ A;  1LDJ A;  3N4M A;  1YW9 A;  1A04 A;  2ZXJ A;  3NRV A;  4UVB A;  3KP3 A;  2FXA A;  3DEU A;  1RNL A;  3K2Z A;  2K27 A;  1EH8 A;  4HA8 A;  4WK8 F;  3ECH A;  1IN5 A;  3F3X A;  3SHF A;  1EV7 A;  4AD9 A;  3V8L A;  1D5V A;  1XMK A;  3FXU A;  2K86 A;  4AIJ A;  4U88 A;  3K0L A;  5HS9 A;  5IT9 Z;  2FSW A;  2P8T A;  3SFZ A;  5LHG A;  2QQ9 A;  3L00 A;  4A5M A;  2VE9 A;  4U0Y A;  1PP7 U;  2X0L A;  1YO5 C;  2CQK A;  4RB0 A;  4EJW A;  2DFI A;  3E5X A;  4A6E A;  3WTW C;  2MC3 A;  4IRI A;  1OYY A;  1ZRE A;  5A2Q K;  2XAQ A;  2QM3 A;  1U6G A;  1KU9 A;  4BHP A;  5D4S A;  2CWE A;  2IPQ X;  2A68 F;  2A69 F;  4JQF A;  4PGG A;  1IN6 A;  4L0Y B;  3WTZ A;  1Z7U A;  4EM2 A;  1YG2 A;  1I27 A;  5DUK A;  1HW1 A;  4OIN F;  1SAX A;  1GXP A;  4RB3 C;  3GVA A;  3HIF A;  1USS A;  2C6Y A;  1T38 A;  5FFX A;  2M45 A;  4LGW A;  2AS5 F;  3ZMU A;  5E1Z B;  2L01 A;  2H94 A;  1SD6 A;  3PQJ A;  2BGC A;  1L0O C;  2W85 A;  2V1D A;  3R0A A;  1IRG A;  3KP2 A;  1BBY A;  2ESN A;  1P4W A;  2VT2 A;  2QUF A;  3FZV A;  2FBK A;  3BRO A;  4BNC A;  1SMT A;  2FBH A;  5D8K B;  1LDD A;  3ABU A;  4HX4 A;  1FYL A;  3JTH A;  1FYK A;  1K79 A;  2CGP A;  1XCB A;  2CO5 A;  5JR3 A;  3IC7 A;  3BJO A;  5LHI A;  2EFP A;  4DNC A;  2QZ8 A;  1FC3 A;  4XRF A;  3NEU A;  1FY7 A;  1EH7 A;  4Y17 A;  4OIP F;  2RGV A;  3OV8 A;  1WKM A;  3DQV C;  2YR2 A;  4IF4 A;  2XGX A;  3SZP A;  2XHK A;  3P7N A;  3FWE A;  2Q0O A;  2YU3 A;  5F1R A;  5HLG A;  2GAU A;  3WU0 A;  5FGM A;  2BV6 A;  2FA5 A;  1HKQ A;  3F6O A;  4WCG A;  1R7J A;  1XGS A;  3VFZ A;  1IXC A;  4Q47 A;  2VT3 A;  1ZGJ A;  4Y13 A;  3C18 A;  3CUO A;  5DCF A;  4WF2 A;  3G3Z A;  4IPA A;  2VN2 A;  5CVU A;  1LJ9 A;  2DBB A;  3KFW X;  4HDV A;  3F8N A;  5J6X A;  3BPV A;  5ERI A;  1I5Z A;  1WRJ A;  3P9C A;  1PDN C;  1ONV A;  2XKP A;  2DPU A;  3ZMZ A;  1PP8 F;  2HTJ A;  3KEO A;  4M6Y A;  2HR3 A;  3QPT A;  1P92 A;  1SFX A;  5KK1 A;  5HVQ C;  5LRR A;  1B4A A;  1BIB A;  4ESF A;  4CO8 A;  2ZKZ A;  4R1H A;  1HW2 A;  2L54 A;  3S2W A;  5D6E A;  3LFK A;  1I1G A;  2QBY A;  1MKM A;  4ZZD A;  1LDK B;  4HLY A;  1FPQ A;  3CTA A;  4HQE A;  4XSX F;  2LNB A;  2WC2 A;  3M8F A;  3RI4 A;  1C0W A;  2DQR A;  5FD5 A;  1RUN A;  2IP2 A;  2IA2 A;  1I1S A;  4CGZ A;  3CJN A;  1IXS B;  3W6J B;  1Z1D A;  1P6R A;  2VC1 A;  5CVI A;  3GZ5 A;  3VEP A;  3KZY A;  3T8R A;  3LQR A;  1WQ2 A;  1R58 A;  3HTS B;  4KA4 A;  1GVJ A;  2NNY A;  5E20 A;  4QWQ A;  1FP2 A;  2IA0 A;  2GWR A;  2RVC A;  1Z6T A;  5HS8 A;  3G73 A;  3GFI A;  2EA2 A;  4ZH4 F;  2KJC A;  5LEK A;  2M87 A;  1MZB A;  2HQR A;  3GO5 A;  1OYI A;  4L5J A;  1BI3 A;  2RN7 A;  2KKO A;  2B0L A;  4CZZ A;  5AIQ A;  1P4X A;  3RTR A;  5L3D A;  2PFB A;  1R00 A;  4KIG A;  3GEZ A;  1FSH A;  2MH2 A;  3KP7 A;  5L3G A;  1LQ1 A;  5KVR A;  4IJA A;  5CVJ A;  4I0A A;  5LRS A;  5ED4 A;  3MFK A;  3WU1 B;  4OMY A;  2QYO A;  1HBX G;  4BAY A;  4HF2 A;  1VTN C;  4GXO A;  2FMY A;  5HLH A;  3E6C C;  4I98 B;  1XGO A;  2EK5 A;  5K5O A;  3FM3 A;  4N9I A;  4LJZ F;  2F5E A;  2NAZ A;  2WV0 A;  5LGN A;  4AWX B;  1R22 A;  5CVV A;  1ZLK A;  4UXN A;  2P5K A;  3KLO A;  1MJB A;  2JPC A;  3PQK A;  4MQ9 F;  4M71 A;  4M9S A;  1NHA A;  1W4M A;  1SD4 A;  1FOK A;  1UHM A;  1XGN A;  3CUQ B;  4OIR F;  2JRT A;  5LEJ A;  3O3K A;  4P55 A;  4ESB A;  1F5T A;  5ILU A;  2HYF A;  5D5U B;  3CUQ C;  4P9U A;  4MGR A;  3O6B B;  3M1E A;  4ENN A;  3QU3 A;  1KU2 A;  1YTY A;  4OIO F;  1QZY A;  5HOO A;  2MH9 A;  5LGT A;  2CFX A;  3RDI A;  5ILV A;  5HDG A;  3SXY A;  2Z99 A;  4MTD A;  4L5I A;  1KQ9 A;  2CW0 F;  1T0F A;  1LVA A;  3C1D A;  5ICC A;  1JE8 A;  4L9T A;  5ICE A;  4RB1 A;  3JAM K;  2W24 A;  4ZYH A;  4CDG A;  2DQL A;  1TTY A;  2MD5 A;  3ZP5 A;  2HS5 A;  4A2U A;  4GGG A;  2OU2 A;  4LD5 A;  4ETS A;  3L7W A;  2ZFW A;  2Z3Y A;  1T2K A;  5TJJ A;  2GXB A;  1EH6 A;  3V8J A;  4RS8 A;  1JGS A;  5J8F A;  4K2E A;  4JK1 X;  1BJA A;  2PG4 A;  2QWW A;  2MA3 A;  1UST A;  4DQ2 A;  2A3S A;  3BPX A;  5E8I A;  2HDC A;  1IAW A;  4KFC A;  2A6E F;  1K6O A;  2G7U A;  2Y0M A;  1ON2 A;  1R1T A;  4EQQ A;  3F6V A;  2R7D A;  3IKT A;  5LGU A;  3TOB A;  4YII A;  1TW3 A;  1SMY F;  2O61 A;  1W5T A;  3QAH A;  1D8K A;  1YS6 A;  2RNJ A;  2ISY A;  4B8X A;  2F5D A;  3Q9S A;  3I4P A;  3QPH A;  4QLC U;  4HZF A;  4WXH A;  3ISP A;  4LB6 B;  4MQV A;  1Z05 A;  1IN7 A;  2DAO A;  2HQN A;  3GFM A;  3R60 A;  4R8H A;  4HOB A;  3RPU A;  3F21 A;  4KIF A;  5L3E A;  3AAF A;  4M72 A;  3E6D A;  5BMZ A;  2PMU A;  4HX7 A;  1DPR A;  3W6K B;  2DLL A;  4N9H A;  2PLY A;  5H6Q A;  3T0Y A;  1T6S A;  3EYY A;  3JSP A;  1QQI A;  5JHU A;  2VON A;  4CIC A;  2J5P A;  1S8N A;  2K02 A;  5E1X A;  3GF2 A;  2Z5U A;  5FLX K;  4CYD A;  2L3D A;  2XAH A;  1QZZ A;  3F8F A;  1Q1H A;  4ZZL A;  2PI0 A;  4GO1 A;  2YX4 A;  2XAS A;  1YW8 A;  1H9T A;  1IRF A;  1ZG5 A;  1F1Z A;  3JSO A;  3B02 A;  5D4R A;  2K7L A;  1Z91 A;  1S6L A;  2HKO A;  1D3Y A;  3CLO A;  2COM A;  3KET A;  4KUM A;  2RQP A;  2UXN A;  1OYW A;  3IRR A;  2EFN A;  3V7C A;  1HST A;  1J7K A;  2ZNZ A;  2O6G E;  3K1N A;  3M8E A;  4LG0 B;  2RDP A;  3L09 A;  2DW4 A;  3ZMD A;  1F9N A;  2ISZ A;  4LLN A;  2ZJ2 A;  5FO5 A;  3QRF F;  2DPD A;  3QU6 A;  4EV0 A;  4NB5 A;  1L3L A;  2K4J A;  3VOD A;  1YIO A;  4ENJ A;  1RIO H;  2H6B A;  1BI2 A;  1O3R A;  1YFH A;  3DKW A;  4KIC A;  2MBF A;  3IRQ A;  3GLX A;  4G8X A;  3GZ6 A;  3DFG A;  4EGZ A;  1UB9 A;  2YSR A;  3OOP A;  2PQ8 A;  3KE2 A;  1KU7 A;  3CUQ A;  2QVO A;  4A0Y A;  4M74 A;  5HLI A;  1YS7 A;  3M9A A;  2OZ6 A;  4PZJ A;  2P5V A;  4A6D A;  1ZN2 A;  3I64 A;  1FWZ A;  3J81 Z;  2VOO A;  3FXQ A;  1TBX A;  3HYI A;  4EVI A;  2HKX A;  4UV8 A;  3R6S A;  1ZAR A;  3IKV A;  1B59 A;  3LAP A;  2A61 A;  4HLX A;  5CYV A;  1XGM A;  4KMF A;  5DCM A;  2FNA A;  5BPI A;  1Z9C A;  2EJR A;  4RGR A;  3T1B A;  2EWN A;  3HRU A;  4P5O A;  3HSE A;  1IW7 F;  1XCV A;  2XAG A;  1V3F A;  3TO7 A;  3RKY A;  3CDH A;  2LKP A;  3E5Q A;  3SZT A;  3WE3 A;  3ULQ B;  2VBY A;  1GHC A;  4RGX A;  1TQP A;  1SD7 A;  3KLN A;  2KIU A;  1FLI A;  2ETH A;  4ZYE A;  3U1D A;  3BOQ A;  5CLS A;  4EJV A;  3KEQ A;  4UHT A;  3WTY C;  1HKS A;  2OQG A;  2LF8 A;  3GFJ A;  2WTE A;  4PCQ A;  1O7L A;  2Q8K A;  1D8J A;  2OZU A;  4NHJ A;  1G3Y A;  5ICF A;  1SD5 A;  2H6C A;  3E6M A;  5CJ9 A;  2DO7 A;  3WTX C;  4YFX F;  3DPL C;  3K1P A;  2LSO A;  2X4H A;  2M1B A;  1TNS A;  4LLG F;  1O3Q A;  1TQM A;  5BQT A;  4WXD A;  3WTU C;  1H0M A;  4OIQ F;  5H6R A;  5LBQ A;  3I71 A;  1STZ A;  1XDU A;  5F6F A;  1G6N A;  5L3B A;  5E1W A;  1G3S A;  3ZQ7 A;  2XAF A;  4IRH A;  3ERE D;  1BC7 C;  1QO0 D;  3LQQ A;  4ENK A;  3GUD A;  2O03 A;  4GCV A;  2PN6 A;  2HZT A;  4AVP A;  1W5S A;  1K78 A;  1KA8 A;  1LEB A;  5IT3 A;  2XV4 S;  3KZZ A;  2O3F A;  4EJU A;  1ON1 A;  3RKW A;  3MZY A;  3RKX A;  2QLZ A;  5BOX A;  1FSE A;  5D8L B;  1CF7 A;  1S7O A;  1ZRC A;  2OQR A;  1F4K A;  2ADU A;  1T98 A;  2FF4 A;  3HHG A;  3DV8 A;  2IJL A;  1X3U A;  1K7A A;  1ZRF A;  4A0Z A;  1U8R A;  2EFW A;  4G6Q A;  1ZH5 A;  4L9J A;  2V1X A;  4KT5 C;  3KCC A;  4RGU A;  1IF1 A;  2H27 A;  4M73 A;  3ELK A;  1O57 A;  4LMY A;  4P9F A;  5K5R A;  4UNO A;  1XDS A;  5BS6 A;  3LA3 A;  4BXU A;  3E6B A;  3P9I A;  5L3F A;  4OMZ A;  4RAZ A;  4UVA A;  2J5O A;  4MNU A;  4BQA A;  4LFU A;  2HGC A;  3B73 A;  4GYI A;  3IHU A;  4HV6 A;  1FNN A;  2D2W A;  3EET A;  2STT A;  3C7J A;  3JTG A; 
#chains in the Genus database with same CATH topology
 1UHS A;  1FTZ A;  5D5V B;  3RCO A;  4MLO A;  4CCK A;  5LLQ A;  5B5E C;  3KP5 A;  3QP6 A;  3I9V 2;  1FTT A;  3MZ8 A;  2P4W A;  4MFD A;  4XOP A;  5EEG A;  4LG0 A;  2V6C A;  4E7H A;  4HYE A;  1I3Q J;  1E2X A;  3MMY B;  1KYW A;  3BR1 A;  2NYX A;  4XOT A;  2Z33 A;  2EZI A;  2E7W A;  1AHD P;  3C3W A;  2BE5 F;  4B1R A;  2QKM B;  4BUP A;  1WJC A;  1YE9 A;  3PFI A;  4G9Y A;  1H8A C;  2E2J J;  2CQQ A;  1J09 A;  1WJF A;  1OKR A;  2WBM A;  3CDL A;  1HCR A;  4PGH A;  4KYW A;  2IGN A;  2BZT A;  3RYP A;  3Q9V A;  1BC8 C;  3BR0 A;  1VQ4 I;  4KN4 X;  2M8G X;  4PJJ A;  3CO7 C;  5CVR A;  3VWB A;  2QEN A;  3J80 K;  5FD6 A;  3FHZ A;  4BBR J;  3GTQ J;  1JXS A;  4A0X A;  1ZRD A;  1VQK I;  4IQ4 A;  3PNY A;  1UHW A;  4N0B A;  1KYZ A;  3CP2 A;  2YU9 J;  1X1D A;  1HC8 A;  1TP4 A;  3R61 A;  2DOD A;  2TDX A;  3GFL A;  1TNT A;  2BEO A;  3CCR I;  1WJA A;  2ZJQ F;  2OBP A;  3I53 A;  4D5F A;  5DUI A;  4I0B A;  2R7W A;  1ZTR A;  4RB2 C;  4M3D A;  2JPB A;  4IHT A;  2Z2S B;  3ML6 A;  3K6G A;  2L4M A;  3U2R A;  1SFE A;  2M34 A;  1MMD A;  2LLK A;  2VOD A;  5DCM B;  1X1B A;  1Q1V A;  2A5Y B;  2LH9 A;  1D0Y A;  2E1M B;  3DU5 A;  3T8T A;  4GRI A;  4Y3O A;  2FE3 A;  1WVR A;  2CU7 A;  2D1V A;  2ZNY A;  3AFH A;  3OMY A;  3F8M A;  4NQW A;  2PMZ N;  2RV8 A;  3BG6 A;  1B6A A;  1RR7 A;  2LDU A;  1D5Y A;  4E4H A;  2IW5 A;  4V2G A;  2WWY A;  3CDI A;  3CCS I;  1J59 A;  4ASN A;  5A2Q Z;  1NTC A;  4EM1 A;  3V8K A;  2E1M C;  3H5N A;  4XLN F;  4Y15 A;  2KRF A;  4HF1 A;  3OSF A;  2NRA C;  3S2D J;  4D0P A;  3JTG A;  1J5Y A;  2DT6 A;  3ZQI A;  2LFB A;  2K9N A;  4MTE A;  1JT0 A;  4HBL A;  3QOP A;  4RMN A;  4YEL A;  2ME6 A;  3VPR A;  1Z3Y A;  3HRT A;  1OJL A;  1UCR A;  2V1U A;  2ZXH A;  3LNQ A;  2P7V B;  2L7M P;  1O7F A;  3COA C;  4FX4 A;  3EUK L;  2VBW A;  1Y6I A;  2VQL A;  4BEH A;  3CCU I;  2GLO A;  1OCC H;  3FX3 A;  2HVS A;  1B9M A;  2I10 A;  4BHB A;  3OWT A;  2PX9 A;  4L0Z B;  4UUV A;  3VSL A;  1TW2 A;  1O3T A;  3F8B A;  3QOE A;  1X2M A;  1Y8Q B;  2E19 A;  2GIV A;  2QQA A;  4XKC A;  3A4C A;  3WTV C;  2R5Z A;  2UZK A;  2HQ5 A;  5JVT A;  3I0T A;  1W36 C;  3JCU C;  4DJA A;  2QKL B;  3M7G A;  1TLH B;  4I02 A;  5EF6 A;  4NC6 A;  1JJ8 C;  2GOX B;  1AKH A;  2JA5 J;  1B8I B;  3OL4 A;  3TDU C;  3HRS A;  3ROU A;  2R7T A;  2DDA A;  3WGH A;  1DPU A;  4R79 A;  4LK1 F;  1IDZ A;  4J19 A;  1QZE A;  1R1V A;  2Q2E B;  1WSU A;  1MMG A;  2V9V A;  4ITV A;  4BH9 A;  4U0V A;  3LMM A;  2L9V A;  4E7J A;  2R5Y A;  2L9S A;  3RPQ A;  1OCR H;  2QA4 I;  1IGN A;  2DA6 A;  3HPG A;  4EM0 B;  3LWF A;  3JRG A;  3ZPL A;  4I09 A;  3VYR B;  4J00 A;  1GXQ A;  1KGS A;  1CGP A;  2R7Q A;  4RGS A;  4ZYG A;  1FBQ A;  4AVZ A;  3ECO A;  2IGO A;  1XSX A;  2PJR A;  3OR2 C;  1UJ8 A;  2NNN A;  1BI0 A;  3IAS 2;  2EFQ A;  5J1U A;  4M9X A;  1GDT A;  2MLK A;  3AG2 H;  3I59 B;  4YRV A;  4E7L A;  2DYS H;  2LMD A;  4HAM A;  2X6W A;  1FYM A;  4B09 A;  1H89 C;  4ZYD A;  2AQF A;  3D5S C;  1TT5 B;  4YFN F;  1MH4 A;  2ESH A;  2FEZ A;  1SVM A;  1K78 B;  2ZB9 A;  5DTD A;  1G8X A;  3W2W A;  2ZME A;  2F2E A;  2WAQ A;  3EUH A;  2IA1 A;  4AIK A;  2LY1 A;  2WY7 Q;  2IGK A;  2PMH A;  1S7A A;  1OLT A;  5FRO A;  3HHH A;  4YIF A;  1ORK A;  2VKE A;  5FKM A;  3T5X A;  1B72 A;  1I39 A;  1IDY A;  1CF7 B;  2DOF A;  4FET A;  4YG2 F;  3OYK A;  2VXZ A;  4H4K C;  4HF0 A;  1ETO A;  2ZSH B;  3BWG A;  3K4N A;  4GYG A;  3I55 I;  2H09 A;  1IUY A;  3I5U A;  4X1E A;  5D5X B;  2HDD A;  1Y0N A;  1KQ8 A;  1XMA A;  5DDG A;  3LL7 A;  3HG9 A;  2L02 A;  1HF0 A;  3TKY A;  1MNE A;  1B9N A;  2HI3 A;  2UXX A;  3JRF A;  2HOE A;  2V79 A;  2YPR A;  1G3T A;  1FJL A;  1O3S A;  3ASN H;  2LK2 A;  3HGG A;  2HFH A;  9ANT A;  2DK5 A;  4YIR X;  1HOM A;  2EV0 A;  2XSJ C;  1YHQ I;  3H9Q A;  5F04 A;  3SZG A;  1VQ5 I;  4O6J A;  3F23 A;  3GTJ J;  1NK2 P;  3BJ6 A;  3JR9 A;  2XUB A;  5LD2 C;  4ZC3 A;  4IHX A;  1J9I A;  1HSJ A;  2BBY A;  2FUG 2;  5D5W B;  2DK8 A;  2EZL A;  3DF8 A;  3O8G A;  5HDK A;  4HDU A;  3PO2 J;  3K69 A;  3ONQ A;  4G7O F;  2G7H A;  5F27 A;  2ELJ A;  3HOS A;  4QSH A;  4PJN A;  3L2C A;  1RR8 C;  5BNG A;  1MBJ A;  1JKQ C;  2E5Z A;  2BW3 B;  2NVT J;  2IAI A;  3IH2 A;  4CYC A;  4G7Z F;  3GME A;  3ZMT A;  4Q5S F;  3M8J A;  4XLA A;  1VZ0 A;  4RLF A;  5GAH J;  5TRD A;  2AXL A;  1FOY A;  2QQB A;  3B6A A;  2XB0 X;  4JBA A;  3E3V A;  2GBY A;  3H36 A;  3OL3 A;  4M6V A;  3DXJ F;  5ILS A;  3MZH A;  3UNG C;  3GX4 X;  3LA7 A;  3WHB A;  1UMQ A;  2XPW A;  4PJ0 C;  1MMS A;  3C2H A;  3H3U A;  3OOU A;  3OS0 A;  5FRM A;  3K4L A;  1QBJ A;  2MLG A;  2DT5 A;  2JVH A;  1OR7 A;  4XOR A;  2Z1D A;  1HXD A;  4UB6 C;  4F52 A;  3K70 D;  1R4M B;  4I7H A;  1DP3 A;  2CQX A;  1G59 A;  2EIL H;  4E70 A;  2RNG A;  2LF7 A;  2PBI A;  2FBI A;  3F0C A;  4IRG A;  4P1W A;  2W1O A;  4MHG A;  1ULY A;  1K61 A;  3RSN A;  1WWX A;  1HKT A;  1IN4 A;  1JTY A;  2RKH A;  3V4G A;  4C2T A;  4O3M A;  3BTI A;  2R4G A;  3IH3 A;  3DPU A;  5F0F A;  1E3P A;  1U78 A;  3I3L A;  1R1U A;  4L9N A;  3D0S A;  2ZCW A;  2KP6 A;  2F4O B;  2VC0 A;  4EJT A;  4A12 A;  1Z3X A;  1R23 A;  2X6Y A;  5E8G A;  2CQN A;  4OU0 A;  2FNP A;  4BL0 B;  1LPQ A;  2V6E A;  2R93 J;  2K9S A;  5E3L A;  4XLP F;  2ID3 A;  4UVC A;  2BXZ A;  2CFO A;  1JHH A;  1QNT A;  2ZJP F;  4LIV A;  2ICW G;  4UY8 I;  4RAG A;  4Q48 A;  4A3C J;  4E7I A;  5GPC A;  3I54 A;  4V19 K;  1J75 A;  1YX3 A;  1ZG1 A;  3FBN B;  4XN0 A;  1NG6 A;  1O4X A;  4CCN A;  1QU3 A;  4FHT A;  1FBS A;  2L4A A;  2D1H A;  2XRN A;  4CUG A;  1G4D A;  1ZR2 A;  2NS0 A;  4H0E A;  1YYV A;  1MDM B;  2KRH A;  3QYB A;  5E3O A;  1DUX C;  1OCP A;  2IRF G;  3VB2 A;  2E1N A;  5FB2 A;  5HS7 A;  3WGG A;  3SJM A;  1BR4 A;  3DTK A;  2Z9O A;  3Q0W A;  3R4K A;  2OD5 A;  1W7P D;  3DBR B;  4RM2 A;  3K4C A;  3E1S A;  2O0Y A;  2Y75 A;  1B1B A;  1WHU A;  2JZY A;  1R5H A;  4NQW B;  2HVR A;  4F7Z A;  2DTR A;  2HTS A;  2P6S A;  4NBQ A;  2LBF A;  3S2H J;  3L2V A;  3FBI B;  3I4M J;  2K9Q A;  1PJR A;  2JSC A;  3IWZ A;  1FT9 A;  2X1D A;  4KDP A;  2EQR A;  3KP4 A;  4P96 A;  2EFO A;  2L2O A;  4WWC A;  2FX0 A;  2D45 A;  1IRX A;  1VI0 A;  1F43 A;  2VBX A;  5H20 A;  4XRM A;  3BQY A;  3BDD A;  1TT0 A;  3H1C A;  4XR6 A;  3NQO A;  1HW5 A;  2EPF A;  1T56 A;  3HSR A;  3ZRG A;  3MCZ A;  1PUF A;  2X6O A;  4S0H B;  2X51 A;  4ENM A;  2XF7 A;  1S29 A;  2JTV A;  2P6T A;  4LK0 F;  2P81 A;  1P4A A;  3GW2 A;  1BJZ A;  2VJI A;  4C2M J;  3AG1 H;  3BY6 A;  2Z16 A;  5EZH A;  5IP9 J;  1UFM A;  4X0G A;  2STW A;  2KDZ A;  3BP8 A;  3VOE A;  4BEH B;  2WAF A;  3OIO A;  1DDN A;  2GA2 A;  1QPM A;  3R0J A;  4EMS A;  2IS2 A;  1MSE C;  4IOA F;  2XIG A;  2L9R A;  1R5G A;  3LSI A;  3P5J A;  3H9G A;  2P5L C;  4F92 B;  3TDZ C;  2XAJ A;  4LIT A;  2W84 A;  1YI2 I;  3IV5 A;  2R5Z B;  3CCY A;  1XMX A;  1BM9 A;  3ZN1 A;  2FQ4 A;  3W3C A;  3U9G A;  2R92 J;  1ZAO A;  2IGM A;  4Z2Y A;  3OYI A;  2GOM A;  2LKX A;  1A5J A;  3F8C A;  1IV8 A;  3KYC B;  2YS9 A;  1S7E A;  3MD2 A;  5ICG A;  2M4K A;  3DBH B;  1XD7 A;  3Q5F A;  4QPO A;  2HWV A;  1X3W B;  2AXT C;  5J1R A;  3FHN A;  3OYM A;  2HEO A;  3PNT A;  2R5Y B;  1DU0 A;  5DYM A;  4E7S A;  1HDD C;  2A07 F;  3J80 Z;  1SAU A;  3KPH A;  4C9Y A;  2XRO A;  5IT9 K;  2G9W A;  4ZYA A;  2Q2E A;  2L7K A;  2HYG D;  2AHQ A;  1LFP A;  4CXF A;  4IHV A;  1KU3 A;  1IZ1 A;  1JUM A;  4IHY A;  5F1J A;  3HOX J;  2WAQ N;  4U7D A;  4EGY A;  2KL4 A;  5DD8 A;  4Q4Z F;  3BJA A;  3FM5 A;  2DA2 A;  1OFC X;  1NK3 P;  3H5R A;  2FML A;  2GZW A;  3HRM A;  3A02 A;  1XSV A;  3FXO A;  1P7I A;  4BY7 J;  5EDN A;  1E3O C;  2QSG X;  3MQ0 A;  2CS3 A;  1LNW A;  4KJZ A;  1MBE A;  5CQE A;  1KQ0 A;  2DMT A;  3WG7 H;  3CO6 C;  1S3J A;  2VE8 A;  1MND A;  3L2W A;  4A5N A;  4ZTF A;  1W7P B;  4BDY A;  1FP1 D;  3WHC A;  3P9K A;  1ETV A;  3LSJ A;  4UUT A;  3I59 A;  2ZME B;  3DP7 A;  5LHH A;  3WTS C;  3WTT C;  2PJP A;  5IYD J;  3H3Z A;  2VQC A;  5DV5 A;  4EJO A;  2ACJ A;  3Q3S A;  1ZK8 A;  2UWM A;  2QCO A;  3HBL A;  2M0M A;  3JW4 A;  3JRH A;  3BR2 A;  3MWM A;  2Y30 A;  3WGI A;  1MNM C;  5DEQ A;  1U5T A;  2GXA A;  1WI9 A;  3HUG B;  5FFZ A;  4DYQ A;  2HZD A;  1B72 B;  1XB4 A;  1N75 A;  5H2F C;  5EEH A;  3JAM Z;  2ZME C;  4XLH A;  5JI6 A;  3EUH C;  4AIH A;  3F22 A;  1IXR C;  2XVC A;  3S16 J;  4OOI A;  2LTP A;  4XMY A;  2EZK A;  3LA2 A;  2ZO4 A;  5F64 A;  1GT0 C;  2ZBK A;  5K1Y A;  1HLV A;  2P7C B;  4TV7 A;  4KMU X;  1SFU A;  1IN8 A;  1ZHF A;  4FX0 A;  3RIR A;  3HJE A;  2L9N A;  2KIF A;  3ZMV A;  3WOD F;  4XBF A;  5GP9 A;  1OCO H;  2KZG A;  2JA2 A;  4A3J J;  3FMQ A;  3FXJ A;  3SQN A;  4BY1 J;  4MEX F;  3CLQ A;  4CHU A;  3DTI A;  2CV0 A;  4XID A;  2VJ5 A;  5J8C A;  2DI3 A;  3WE2 A;  1G3W A;  2A6H F;  2FRH A;  5K7Z A;  3GYH X;  2HDW A;  2FJ1 A;  4XK4 A;  3PUB A;  5IY5 H;  5FJ8 J;  3QP5 A;  3HOY J;  2GA1 A;  3VYU B;  3FMR A;  5J1Y A;  1TQI A;  4O5V A;  4HV5 A;  2DA5 A;  4DOZ A;  2ECC A;  2E7X A;  3RJP A;  2VLA A;  1YW7 A;  3BTC A;  1X1A A;  4L9V A;  5J40 A;  3LAJ A;  2W4S A;  4CYC B;  3J81 K;  1V4R A;  2IVM A;  2PEX A;  2YX7 A;  3JRI A;  4XON A;  2QQ8 A;  4C2U A;  1BW6 A;  1BN5 A;  2KJB A;  4U0W A;  3H9J A;  4S04 A;  4PSW A;  3HOT A;  2DMU A;  3O2P E;  4ON0 A;  3HOU J;  4PSX A;  1ETK A;  2K4B A;  3DPT A;  5JLX A;  2R7X A;  3QYF A;  4G6D A;  3LOC A;  4B47 A;  1ERD A;  3MAJ A;  3TGN A;  2IS1 A;  4G7H F;  1HQC A;  5GAE J;  5AIP A;  1MD0 A;  2CH0 A;  3GWZ A;  4HPQ A;  3HOV J;  2FQ3 A;  4XSZ F;  4U7B A;  1OCZ H;  2OTL I;  3PNV A;  4D1Q A;  2R3S A;  2EIJ H;  5F0H A;  1YQA A;  3F72 A;  3AL0 B;  3EQL F;  1FBU A;  1J2X A;  2DA3 A;  2DA1 A;  3HKZ N;  4JOM A;  4EAT A;  1LB2 A;  1T95 A;  4II3 A;  1OPC A;  1OR7 C;  2RRE A;  3FMS A;  4CSW A;  2M8E A;  1EJ9 A;  1Z6R A;  4G6T B;  3HDD A;  2R7V A;  2GXG A;  2W7N A;  3N97 A;  3PO3 J;  3E5U A;  2M30 A;  1JHF A;  1ZYR F;  4M3B A;  4UV9 A;  1E0E A;  4KN7 X;  2DTZ A;  3E0J B;  3K1M A;  4HEA 2;  1U3E M;  4M6X A;  2IXS A;  3AL0 C;  4QTR A;  4AU7 A;  1IJW C;  2K9M A;  1RI7 A;  2M9H A;  3OYE A;  1PUE E;  2FU4 A;  1ZGW A;  3FXR A;  3REO A;  1AWC A;  3IH4 A;  5KNL A;  3V7R A;  1MIJ A;  2QF7 A;  2XF6 A;  2KPM A;  1BOA A;  1ODD A;  1WI3 A;  4M3F A;  3L1P A;  1JUS A;  4XN3 A;  4XLE A;  3HC7 A;  1FOW A;  2NVY J;  3G71 I;  4KNY A;  4L18 B;  1VQ6 I;  3HTU A;  1H9G A;  3LST A;  5GPA A;  2HQA A;  1WH5 A;  4M9Z A;  4JX5 A;  4AC0 A;  1MBH A;  5FLX Z;  2M5W A;  3ABT A;  3L9F A;  3V7S A;  4XIC A;  3QYE A;  2DMQ A;  3PM1 A;  4FT8 A;  1ZKG A;  4C3I J;  3I58 A;  1RUO A;  2F5F A;  1MDM A;  1Y56 A;  3PFY A;  5HLT A;  1T39 A;  3J7Z I;  1NG7 A;  2DU9 A;  1A6Q A;  4NNJ A;  1S9H A;  1X4O A;  5HDN A;  4DZJ A;  2KRC A;  2EA4 A;  1SAN A;  1BR1 A;  2Y48 A;  5AON A;  5FKO A;  4OAZ A;  3GXO A;  2LBF B;  3RYR A;  2E36 A;  2E1O A;  2NVX J;  2AQE A;  3TO9 A;  4HW0 A;  2X48 A;  4B4C A;  5GAG J;  1EF4 A;  2CG4 A;  4S05 A;  1RET A;  2VPR A;  3K4J A;  2LD5 A;  1AOY A;  1Y0U A;  3ZN0 A;  3SEQ A;  4MEY F;  1QGP A;  1I3A A;  3HSF A;  3SFI A;  1I6X A;  1ZLJ A;  4I76 A;  4HNV A;  1PUF B;  2IBD A;  4RAY A;  1R36 A;  3PJR A;  3EYI A;  2EIN H;  2CSO A;  3MEX A;  2KIM A;  3DEE A;  3OYL A;  2ELK A;  1XG1 A;  4DYC A;  4YFK F;  4WXC A;  1BIA A;  6PAX A;  3M1C A;  5E3N A;  2BY0 A;  3WG9 A;  3QPL A;  2CYY A;  3X2Q H;  4BE0 A;  3TQN A;  2XGD A;  3HXL A;  3LSG A;  1VQ9 I;  3D1N I;  1IV6 A;  1JKP C;  3S1N J;  4IXA A;  4KIB A;  3KP6 A;  2NOG A;  3Q0U A;  3J7A O;  2F5C A;  3B6C A;  1J0R A;  1OQY A;  4DZP A;  3ABL H;  2LC2 A;  1XN7 A;  2VJJ A;  5E18 F;  2BYV E;  3DBL B;  2EV5 A;  1RZ4 A;  3A1Y A;  4N4O B;  4BYY A;  1V55 H;  3HEF A;  1X2N A;  1QPI A;  3BZ6 A;  2CUZ A;  3CCE I;  4M3E A;  2EB7 A;  2KZV A;  4QPQ A;  1E17 A;  2XRL A;  2M7B A;  4EEF G;  4CCO A;  4HX8 A;  1FX7 A;  4G94 A;  2I5U A;  1FZP B;  3E97 A;  2FOK A;  2NXN B;  3IL2 A;  1ZG3 A;  3EDP A;  5BPD A;  3CC4 I;  2O8X A;  1BOB A;  3EUA A;  3S3N A;  2G0E A;  1LEA A;  3AKZ A;  5D6F A;  4HNU A;  1BA5 A;  3EPZ A;  2OA4 A;  1XS9 A;  1MGT A;  1MJA A;  4ZTJ A;  2H1K A;  4PDK A;  1OMI A;  3D5R C;  1P2F A;  5E17 F;  4HQM A;  5JFR A;  1DQU A;  2IT0 A;  5JLW A;  4Z6Y A;  2K5C A;  1N78 A;  1Y1W J;  2RAE A;  3H0G J;  2XKO A;  1XSD A;  1MJ9 A;  4GDF A;  5EGO A;  3TO6 A;  1WCM J;  1OCT C;  1ZGA A;  5IP7 J;  1R4N B;  3MKL A;  4I01 A;  3OY9 A;  2VOP A;  4IVN A;  2EV6 A;  2MC4 A;  2CQ7 A;  1MBG A;  3CF5 F;  2DMN A;  5L3C A;  3H35 A;  4AID A;  2XPV A;  2E1C A;  1U2W A;  4BHC A;  4ESJ A;  1W7P A;  4I2O A;  4I99 C;  2L0K A;  1MSF C;  1YLF A;  4ZDO A;  3CZ6 A;  2W57 A;  2VKH A;  3H3V K;  2RC4 A;  3K9T A;  1UG2 A;  1U5T B;  4LB5 A;  5KAI C;  1BI1 A;  3ZMS A;  1ACI A;  2HOA A;  2X6X A;  2QBY B;  4D7N A;  5K5Q A;  3A2K A;  4MO7 A;  1UAA A;  3BZK A;  4Y52 J;  4WX9 A;  2OAZ A;  2X1C A;  2W25 A;  3HUG A;  5DD4 A;  4IHS A;  2R7Z J;  3IP4 B;  1JUP A;  3IWF A;  4G12 A;  4MIM A;  2XC7 A;  1YJN I;  1IRZ A;  1GV5 A;  1DP7 P;  3H92 A;  1LUJ B;  2R7F A;  2X85 A;  2XAU A;  4A3L J;  1MMA A;  1U5T C;  2W82 A;  4XKW A;  1REP C;  1YRN B;  3TOA A;  2ELH A;  3JRE A;  4LLL A;  4LOC A;  3D5L A;  3FF5 A;  2GQQ A;  2JT1 A;  2MFZ A;  2VBZ A;  1LDJ A;  3CJT B;  3N4M A;  2OUM A;  1YW9 A;  1EA3 A;  1A04 A;  1V5E A;  2ZXJ A;  1T08 B;  3NRV A;  4UVB A;  1ENH A;  3OIQ A;  3KP3 A;  2FXA A;  3DEU A;  1RNL A;  2DMP A;  3GTM J;  1FOX A;  3K2Z A;  2CMP A;  3IUO A;  4A69 C;  1WPK A;  2K27 A;  2ZXW H;  1EH8 A;  4HA8 A;  1RKW A;  2CRG A;  2IS4 A;  5F08 A;  4WK8 F;  3ECH A;  3HGY A;  3J7A Y;  2VQH A;  1IN5 A;  3F3X A;  4A3G J;  1YIJ I;  3SHF A;  2LRD A;  1EV7 A;  1GUU A;  4AD9 A;  2F4I A;  3V8L A;  3GTK J;  1D5V A;  1XMK A;  2OPT A;  2K86 A;  3FXU A;  4V2F A;  1H88 C;  4AIJ A;  4IEJ A;  4D7M A;  5J3L A;  4U88 A;  4RLQ A;  1R9T J;  3K0L A;  4JX4 A;  5HS9 A;  5IT9 Z;  2E5N A;  4XLF A;  2FSW A;  2P8T A;  3K7A J;  3OYG A;  3SFZ A;  3O8H A;  2M2E A;  3K2A A;  3CMY A;  3BG9 A;  5LHG A;  2V9K A;  2QQ9 A;  3ABK H;  3L00 A;  2OCC H;  4A5M A;  4CCL A;  2VE9 A;  3U21 A;  5LFA A;  4U0Y A;  1PP7 U;  2X0L A;  1YO5 C;  2CQK A;  2BY2 A;  3NWT A;  4RB0 A;  1JI8 A;  4EJW A;  5IOY A;  4E7Z A;  2DFI A;  3E5X A;  5FKN A;  4A6E A;  3OS1 A;  3WTW C;  2MC3 A;  4IRI A;  1OYY A;  1ZRE A;  2WB1 A;  5A2Q K;  2M3A A;  2XDV A;  2XAQ A;  5EG0 B;  2QM3 A;  1U6G A;  1KU9 A;  5M5Y J;  1X58 A;  4BHP A;  5D4S A;  2M7A A;  2O9L A;  2EIK H;  3MVP A;  2CWE A;  2IPQ X;  3S3O A;  2CV2 A;  3RZD J;  2A68 F;  4HG2 A;  2A69 F;  4JQF A;  4PGG A;  4F55 A;  3A01 B;  1IN6 A;  4XNF A;  4L0Y B;  3ESW B;  3WTZ A;  4FIS A;  3SYT A;  3CCJ I;  1FEX A;  1U9N A;  1Z7U A;  4EM2 A;  1D0Z A;  4BXX J;  1YG2 A;  2MW8 A;  1I27 A;  5DUK A;  1HW1 A;  2XB5 A;  3A03 A;  1ZQ3 P;  4OIN F;  2XGC A;  3PIP F;  1SAX A;  1GXP A;  4RB3 C;  2HOS A;  2E2I J;  2Y2Z A;  3GVA A;  3HIF A;  1USS A;  2C6Y A;  1T38 A;  5FFX A;  2M45 A;  2LR8 A;  2JN6 A;  4JYK A;  4LGW A;  3DTE A;  2AS5 F;  1VQN I;  3ZMU A;  2E71 A;  5E1Z B;  2L01 A;  2H94 A;  3CME I;  1SD6 A;  1K83 J;  3HL2 A;  3PQJ A;  2VB6 A;  2BGC A;  1L0O C;  4ZDL A;  4RA2 A;  4HNT A;  4GFB A;  2W85 A;  2V1D A;  3R0A A;  1K4T A;  1YIT I;  1IRG A;  4B43 A;  4A3B J;  3W6V A;  1XX5 A;  1QRY A;  2VI6 A;  3KP2 A;  1BBY A;  4BGD A;  1V5G A;  2ESN A;  3CES A;  1GVD A;  1P4W A;  2VT2 A;  2QUF A;  3FZV A;  3KZI C;  2FBK A;  5KAF C;  3KIO A;  3BRO A;  4BNC A;  5JHF A;  2DFF A;  1SMT A;  2FBH A;  2ZXI A;  5D8K B;  1LDD A;  3GCM A;  2VKV A;  1UEL B;  1K4S A;  3ABU A;  2JK3 A;  4HX4 A;  1FYL A;  3JTH A;  4XL9 A;  1FYK A;  1K79 A;  2CGP A;  3A0B C;  1XCB A;  2CO5 A;  2Q1Z B;  2VIX A;  1VQL I;  5JR3 A;  3IC7 A;  3BJO A;  3VSK A;  5LHI A;  4LIU A;  3RPU D;  2R7S A;  1CQT A;  2Y31 A;  3S1M J;  2EFP A;  2JWT A;  4DNC A;  1QHH D;  2QZ8 A;  2F5V A;  1FC3 A;  4XRF A;  2VJ4 A;  2VAS A;  3NEU A;  1BL0 A;  2BY3 A;  1FY7 A;  3ABM H;  3BCA A;  1EH7 A;  1NH3 A;  4Y17 A;  4OIP F;  2RGV A;  3MKZ A;  3OV8 A;  5FLV A;  5DS9 A;  1WKM A;  1IC8 A;  1TWC J;  3DQV C;  2M0C A;  3E7L A;  2YR2 A;  4IF4 A;  3BC8 A;  5DM7 F;  2B9S A;  2XGX A;  3C2G A;  3FXK A;  1YOV B;  2XHK A;  3P7N A;  3SZP A;  3UKG A;  1MW7 A;  2HNH A;  2JJ7 A;  3FWE A;  4FAS D;  3J7Y J;  3JRA A;  2Q0O A;  2YU3 A;  3ZXS A;  5F1R A;  3H0D A;  5J47 A;  5M5W J;  3DEW A;  5HLG A;  2DXI A;  2GAU A;  3WU0 A;  3S17 J;  3K70 C;  5FGM A;  3HZJ A;  3FDY A;  2BV6 A;  5FKL A;  2FA5 A;  1HKQ A;  3F6O A;  4WCG A;  1R7J A;  3A0H C;  1XGS A;  3VFZ A;  1WJB A;  3MKW B;  1VQ8 I;  3S3M A;  1IXC A;  3LSH A;  4Q47 A;  2F48 A;  2VT3 A;  1ZGJ A;  4Y13 A;  3C18 A;  3CUO A;  3DLL F;  5DCF A;  1A6I A;  4WF2 A;  3G3Z A;  2V9P A;  3BTJ A;  2B7E A;  4IPA A;  3KEY A;  2VN2 A;  5CVU A;  3PSI A;  1LJ9 A;  3AG4 H;  2DBB A;  3KFW X;  4HDV A;  3F8N A;  5EGO B;  2VKD A;  5J6X A;  4XM3 A;  3BPV A;  5ERI A;  4PFP A;  1I5Z A;  1WRJ A;  1Z77 A;  4A3K J;  4PJL A;  3P9C A;  5F0C A;  2BY1 A;  1PDN C;  1ONV A;  2XKP A;  2DPU A;  3ZMZ A;  2H8W A;  1PP8 F;  3I4N J;  2HTJ A;  3LSK A;  3KEO A;  1AA7 A;  4M6Y A;  4A3F J;  4PK4 A;  3ASO H;  3CCL I;  3OYF A;  2HR3 A;  1T8I A;  3QPT A;  1P92 A;  3K10 A;  1SFX A;  1WJE A;  5KK1 A;  5HVQ C;  1UG0 A;  1APL C;  5LRR A;  1B4A A;  1BIB A;  3CD6 I;  4ESF A;  4CO8 A;  2H1L A;  2ZKZ A;  2FD5 A;  4R1H A;  2DJN A;  1HW2 A;  3SDB A;  2L54 A;  3H5A A;  5KCM A;  3S2W A;  1P9Q C;  3BR5 A;  3LFK A;  4NUB A;  5D6E A;  1I1G A;  4CCM A;  2QBY A;  4BS9 A;  1MKM A;  4ZZD A;  2A6T A;  1LDK B;  3DKX A;  3CMM A;  4HLY A;  2NS8 A;  1FPQ A;  3LSM A;  3OSG A;  3CTA A;  4HQE A;  2IS6 A;  4XSX F;  2LNB A;  2WC2 A;  3M8F A;  3RI4 A;  1C0W A;  2DFE A;  5GTH C;  1YRN A;  2DQR A;  5FD5 A;  1RUN A;  2IP2 A;  1ETQ A;  1JKO C;  2L5Q A;  2IA2 A;  3DU6 A;  4IZZ A;  1I1S A;  3S1R J;  3CJN A;  2NVU B;  4CGZ A;  1IXS B;  2Y0S A;  2R0Q C;  3W6J B;  1Z1D A;  2WAE A;  1P6R A;  2VC1 A;  5CVI A;  3GZ5 A;  3VEP A;  4PFO A;  3TMO A;  3KZY A;  3T8R A;  3LQR A;  3KYD B;  1A35 A;  1RC9 A;  1WQ2 A;  1D0X A;  4FE4 A;  1R58 A;  4JP0 A;  5GAD J;  2Y9Y A;  3MN2 A;  2LOO A;  2DOA A;  3HTS B;  1I6H J;  1U8B A;  4B48 A;  4KA4 A;  4IO9 F;  1GVJ A;  3ZQC A;  2QSF X;  2NNY A;  2TCT A;  1TWF J;  5E20 A;  5IP6 A;  5HNF A;  4QWQ A;  1FP2 A;  4DW6 A;  2IA0 A;  2GWR A;  1I50 J;  1Y8R B;  2RVC A;  1OIS A;  1Z6T A;  2V4J C;  2W48 A;  1RPW A;  5HS8 A;  3G73 A;  3GFI A;  2WB1 N;  4HST A;  3G6E I;  2EA2 A;  4ZH4 F;  1KON A;  2KJC A;  4XRS G;  5LEK A;  4ANJ A;  5TIS C;  2M87 A;  1LFU P;  2HQR A;  1MZB A;  3GO5 A;  1OYI A;  4L5J A;  1BI3 A;  1JT6 A;  1D1B A;  2RN7 A;  4DYR A;  2KKO A;  4A93 J;  1FIA A;  2B0L A;  4CZZ A;  5AIQ A;  2OV7 A;  1P4X A;  3RTR A;  5IPA A;  1IUF A;  5L3D A;  4BE2 A;  4BU2 A;  2PFB A;  4B44 A;  1R00 A;  4KIG A;  3GEZ A;  1FSH A;  3CMA I;  2MH2 A;  1R49 A;  3KP7 A;  1BW5 A;  2E2H J;  5L3G A;  1LQ1 A;  5KVR A;  4NC8 A;  4IJA A;  5K7F A;  5CVJ A;  2CUJ A;  4I0A A;  1WH7 A;  5LRS A;  3ZCO A;  4C3J J;  3S8P A;  5ED4 A;  2N8G A;  3MFK A;  2IEK A;  4KIT B;  2MAB A;  4F91 B;  3WU1 B;  4OMY A;  2BHZ A;  3KX2 A;  5EG0 A;  2HVQ A;  2L7F P;  2DJI A;  2QYO A;  2WAD A;  2ZJR F;  1HBX G;  2DT7 B;  4BAY A;  3L2R A;  4HF2 A;  1VTN C;  4GXO A;  2FMY A;  3TW7 A;  5HLH A;  3E6C C;  1R6R A;  3BCB A;  4I98 B;  1W36 D;  1XGO A;  2XSD C;  2EK5 A;  5K5O A;  3FM3 A;  3U1K A;  3VYT B;  4N9I A;  1BR2 A;  2TRT A;  4LJZ F;  2F5E A;  2JRM A;  3RZO J;  3A01 A;  5EYR A;  2NAZ A;  2WV0 A;  4F93 B;  5LGN A;  4AWX B;  2GIZ A;  1R22 A;  5CVV A;  4DBR A;  2CUE A;  1ZLK A;  4UXN A;  2AO9 A;  2CUF A;  3NWS A;  4BQQ A;  3CJQ B;  2JUC A;  2P5K A;  3KLO A;  4MFE A;  1ETY A;  1Z7L A;  2E34 A;  1MJB A;  2JPC A;  3OYB A;  3MKY B;  2BHY A;  3PQK A;  4MQ9 F;  1POG A;  4M71 A;  2CW7 A;  3OIP A;  4M9S A;  1NHA A;  1W4M A;  1SD4 A;  3PUF A;  1FOK A;  1UHM A;  1XGN A;  3CUQ B;  4OIR F;  2JRT A;  5LEJ A;  3O3K A;  2DYR H;  2KHM A;  4U87 A;  4P55 A;  3G4S I;  4LG3 A;  3GZN B;  2DA4 A;  5TGT A;  4RM3 A;  4ESB A;  2BVM A;  3HOZ J;  2YUS A;  1HA8 A;  1MMN A;  2HOT A;  1F5T A;  1YJ9 I;  3S93 A;  5ILU A;  1A36 A;  3ZQH A;  1DGW Y;  2HYF A;  3OYD A;  2JQ7 A;  5D5U B;  4D5C A;  3CUQ C;  4Y7N J;  4P9U A;  4MGR A;  1F36 A;  3NAR A;  3O6B B;  3M1E A;  4ENN A;  5FRN A;  3QU3 A;  1KU2 A;  3OYH A;  1YTY A;  4OIO F;  1QZY A;  5HOO A;  3DKY A;  2MH9 A;  4BQO A;  4IHW A;  1M1E B;  5LGT A;  2CFX A;  4W1U A;  5C4X J;  3RDI A;  3ZGK A;  2HXO A;  5ILV A;  2BXY A;  5HDG A;  3SXY A;  3GBG A;  1VQP I;  2LYC A;  2MSY A;  2Z99 A;  1WGX A;  4MTD A;  3OS2 A;  2Y69 H;  2W00 A;  4L5I A;  1KQ9 A;  2CW0 F;  1T0F A;  2DOE A;  4FQG A;  4BE1 A;  3IAM 2;  3N05 A;  1LVA A;  4B3X A;  3C1D A;  5ICC A;  1QA6 A;  5B1B H;  4BXF A;  2NOJ B;  1JE8 A;  4L9T A;  5ICE A;  4IQJ A;  3QOD A;  4RB1 A;  3JAM K;  2W24 A;  1GLN A;  4ZYH A;  3JRC A;  4CDG A;  1RES A;  4IOC F;  2DQL A;  1TTY A;  1MBF A;  2MD5 A;  3ZP5 A;  4XLC A;  2HS5 A;  4A2U A;  4GGG A;  4ABZ A;  2OTJ I;  2RQQ A;  2OU2 A;  4W97 A;  4LD5 A;  4ETS A;  3L7W A;  2LY9 A;  2ZFW A;  2Z3Y A;  1T2K A;  4DIQ A;  2DFH A;  3TL4 X;  5TJJ A;  4Y4R A;  2GXB A;  2XGE A;  1LKX A;  3PSF A;  2HPI A;  1EH6 A;  1U0J A;  3BQZ A;  2F6C A;  1LVK A;  3V8J A;  4RS8 A;  5EZG A;  5E3M A;  1JGS A;  2WV1 A;  5J8F A;  3JRD A;  4K2E A;  2NS7 A;  4JK1 X;  4BJT A;  1VQO I;  1BJA A;  2BVL A;  2PG4 A;  3QQA A;  2QWW A;  3ZQG A;  2OJE D;  2MA3 A;  1XPX A;  2GM4 A;  2KIQ A;  3ZR8 X;  2X9D A;  1SVO A;  3ZOB A;  5CKT A;  1ZR4 A;  2JMW A;  4CCJ A;  1UST A;  4DQ2 A;  1SC7 A;  2A3S A;  3BPX A;  1XTA A;  5E8I A;  2O5R A;  5C44 J;  2HDC A;  1IAW A;  1VF9 A;  4KFC A;  2A6E F;  1LE8 B;  1K6O A;  2G7U A;  3K4B A;  4FTH A;  4II2 A;  2D5V A;  2Y0M A;  1ON2 A;  1R1T A;  4EQQ A;  1TWG J;  3F6V A;  2R7D A;  2L7Z A;  1SVL A;  3SEZ A;  5LGU A;  3IKT A;  4BKX A;  1Z0X A;  2M4G A;  3RQ4 A;  3TOB A;  1R71 A;  2VPL A;  4YII A;  1TW3 A;  3W2A A;  1SMY F;  2O61 A;  1X19 A;  1W5T A;  3QAH A;  5IYB J;  5EJC A;  5J4V A;  1D8K A;  1S72 I;  1YS6 A;  1WJD A;  2RNJ A;  3ERM A;  3CCM I;  2ISY A;  4B8X A;  2F5D A;  1Z21 A;  3Q9S A;  2Y0S N;  3I4P A;  1TWA J;  3QPH A;  4QLC U;  1JKR C;  2QEX I;  2JA6 J;  5EEA A;  4A3I J;  4HZF A;  4WXH A;  3ISP A;  4LB6 B;  1V5F A;  3S1Q J;  4MQV A;  1Z05 A;  4KT6 A;  1SFO J;  4IX7 A;  1IN7 A;  1U9O A;  2DAO A;  2HQN A;  3GFM A;  4UUS A;  2HXI A;  3VDX A;  4AYB A;  3R60 A;  3BZC A;  1RKT A;  4R8H A;  2HU9 A;  2O8K A;  2ME0 A;  3BG5 A;  4C30 A;  4HOB A;  1QVU A;  2MGQ A;  3RPU A;  3ZQL A;  3F21 A;  4KIF A;  5L3E A;  3AAF A;  1VFC A;  4M72 A;  3E6D A;  2LP0 A;  5BMZ A;  2PMU A;  3OYN A;  2CV1 A;  4DGW B;  2K40 A;  2COB A;  2KLO A;  4HX7 A;  1DPR A;  3W6K B;  4E7K A;  2DLL A;  1PYV A;  4N9H A;  5KHD A;  5GTI C;  5B3S H;  4L5E A;  2PLY A;  5H6Q A;  3T0Y A;  1T6S A;  3EYY A;  1Y39 A;  3JSP A;  1QQI A;  5JHU A;  2ZSI B;  3BR6 A;  2VON A;  4CIC A;  5FKK A;  2J5P A;  2LVS A;  1S8N A;  1LFB A;  2K02 A;  3FXM A;  5E1X A;  4C3H J;  3GF2 A;  2Z5U A;  1AU7 A;  2E60 A;  2R7O A;  5FLX K;  3GTP J;  4CYD A;  2L3D A;  2K9L A;  2EZH A;  3FXL A;  2MG4 A;  2XAH A;  1QZZ A;  3F8F A;  1Q1H A;  4CA0 A;  4I6Z A;  1E3H A;  4ZZL A;  2PI0 A;  4GO1 A;  2YX4 A;  3OR1 C;  2XAS A;  1MBK A;  2H8R A;  3HOW J;  2V7F A;  5B1A H;  1YW8 A;  2EBI A;  1IRF A;  1H9T A;  1ZG5 A;  1F1Z A;  2JA7 J;  2K3P A;  3L2Q A;  3JSO A;  2HYJ A;  3B02 A;  3TED A;  1YJW I;  2DDB A;  4IL6 C;  2VL8 A;  5D4R A;  2LY2 A;  2XF5 A;  3G1O A;  4AM3 A;  2VQG A;  1DGR M;  2K7L A;  3W2V A;  1Z91 A;  1S6L A;  2HKO A;  4CH7 A;  1D3Y A;  3CLO A;  5IOZ A;  2COM A;  3KET A;  3VYS B;  4CZC A;  1D1C A;  4KUM A;  3ZQF A;  3CC7 I;  2RQP A;  2UXN A;  4XRS A;  1OYW A;  3IRR A;  2EFN A;  1FMW A;  3V7C A;  1HST A;  4J01 A;  4UB8 C;  1J7K A;  2ZNZ A;  2O6G E;  1ITY A;  3F9K A;  3CJR B;  3K1N A;  3M8E A;  4LG0 B;  2F4M B;  1W1W E;  4XKV A;  2RDP A;  3L09 A;  2DW4 A;  3ZMD A;  3NAU A;  3TP3 A;  1F9N A;  2ISZ A;  4LLN A;  2ZJ2 A;  4E6K G;  5FO5 A;  3QRF F;  2DPD A;  1JJ6 C;  3QU6 A;  4EV0 A;  3ZQQ A;  4NB5 A;  2CJJ A;  5B66 C;  1L3L A;  3AG3 H;  5HOD A;  2K4J A;  1ETW A;  2KIS A;  3QPS A;  3VOD A;  4HRI A;  5C3E J;  1YIO A;  1TWH J;  4ENJ A;  1RIO H;  3BG7 A;  2H6B A;  1BI2 A;  2UV1 A;  1O3R A;  4BJ5 C;  3FIW A;  1YFH A;  3DKW A;  2KQR A;  2ECB A;  4KIC A;  2MBF A;  3IRQ A;  3GLX A;  3GTL J;  2VXD A;  4G8X A;  3GZ6 A;  3DFG A;  4EGZ A;  1UB9 A;  1TL8 A;  5E79 C;  3V42 A;  2YSR A;  3OOP A;  2EIM H;  2PQ8 A;  3HKZ A;  3TW6 A;  3KE2 A;  1Y1V J;  1KU7 A;  3CUQ A;  1SFK A;  3PIO F;  2QVO A;  4FE7 A;  4ZDP A;  1WJ5 A;  4A0Y A;  4BBS J;  1JTX A;  2JUG A;  4M74 A;  4HSR A;  5HLI A;  1YS7 A;  3M9A A;  3K4K A;  1PVE A;  2OZ6 A;  2JA8 J;  4PZJ A;  2P5V A;  4A6D A;  2I8D A;  1ZN2 A;  3I64 A;  1X1P A;  1FWZ A;  3BTL A;  1VQM I;  3J81 Z;  2K85 A;  4KIS A;  2VOO A;  3FXQ A;  1TBX A;  5FLM J;  1D1A A;  3HYI A;  4EVI A;  5M3F J;  2ID6 A;  3M07 A;  1XC5 A;  5K7H A;  2HKX A;  2DA7 A;  4UV8 A;  1YX5 A;  1V54 H;  3R6S A;  1IO2 A;  1ZAR A;  3IKV A;  1B59 A;  3LAP A;  2A61 A;  2MD0 A;  4HLX A;  3S14 J;  5CYV A;  1XGM A;  1JGG A;  1SEU A;  4KMF A;  1X3Z B;  2HPM A;  1GV2 A;  3FKJ A;  4NC7 A;  5DCM A;  2FNA A;  5BPI A;  3FKI J;  1Z9C A;  4A3M J;  3G1L A;  4X6A J;  4XKB A;  1R5I D;  1VND A;  2K3F A;  3M3Y J;  2EJR A;  3CCV I;  1A31 A;  3CF2 A;  2V1N A;  5M5X J;  4RGR A;  3T1B A;  2EWN A;  3HRU A;  3PL8 A;  3SDG A;  4P5O A;  3HSE A;  1ETX A;  1IW7 F;  1HDP A;  1XCV A;  2DN0 A;  1P7J A;  4QIW N;  2XAG A;  1T0F C;  1V3F A;  4IKF A;  3TO7 A;  3RKY A;  3CDH A;  2LKP A;  3E5Q A;  3SZT A;  1X1C A;  3WE3 A;  4B3A A;  3FK6 A;  3FIS A;  3K4M A;  3ULQ B;  4RDU A;  3TBI A;  2A05 A;  2VBY A;  2PMZ A;  1GHC A;  2WY8 Q;  1TQP A;  4RGX A;  1TC3 C;  3BLY A;  1SD7 A;  1EKE A;  3KLN A;  4YEJ A;  1DU6 A;  1UZC A;  2KIU A;  5J4Y A;  1FLI A;  2ETH A;  4ZYE A;  3U1D A;  3BOQ A;  3CP8 A;  5CLS A;  4EJV A;  1IG7 A;  2KMU A;  3KEQ A;  4XQF A;  2LG4 A;  4UHT A;  3L2U A;  3WTY C;  1HKS A;  2OQG A;  1WFX A;  2KT0 A;  3GTG J;  2LF8 A;  3GFJ A;  2WTE A;  4PCQ A;  1ZEL A;  1QHG A;  2X1E A;  3M4O J;  1O7L A;  2Q8K A;  2KFD A;  1D8J A;  2OZU A;  4FCY A;  4NHJ A;  3BR3 A;  1G3Y A;  5IYC J;  2MYS A;  5ICF A;  3OYA A;  3TP0 A;  1SD5 A;  2H6C A;  3E6M A;  5CJ9 A;  1AKH B;  2DO7 A;  2ZC2 A;  3WTX C;  5HNH A;  4BQN A;  4YFX F;  3DPL C;  3K1P A;  2LSO A;  2X4H A;  3FK7 A;  2M1B A;  1TNS A;  4LLG F;  1W0T A;  4N4N B;  1O3Q A;  2P0W A;  3UR3 C;  1TQM A;  2JVG A;  3RQI A;  1B8I A;  2WA0 A;  4BJ6 C;  5BQT A;  4WXD A;  3WTU C;  1H0M A;  1X4P A;  2OC6 A;  4OIQ F;  3WU2 C;  1LE8 A;  5H6R A;  5LBQ A;  4AYB N;  4RAF A;  3I71 A;  2PJR B;  2VUM J;  4AUX A;  1STZ A;  3CC2 I;  3S32 A;  2BOL A;  4BAC A;  3CCQ I;  4M3G A;  1FMV A;  1XDU A;  2LRE A;  5F6F A;  1G6N A;  1VQ7 I;  1TZL A;  5L3B A;  3OYJ A;  5E1W A;  3LSP A;  2Y9Z A;  2XPU A;  1G3S A;  3ZQ7 A;  2XAF A;  4IRH A;  3CQZ J;  3ERE D;  2QGU A;  5C4J J;  2CW8 A;  1BC7 C;  1QO0 D;  3C2B A;  3LQQ A;  2OF7 A;  4BDZ A;  4UUS B;  4ENK A;  3GUD A;  2O03 A;  4GCV A;  1S5L C;  2V26 A;  3GLL A;  2PN6 A;  2HZT A;  2A5W A;  5CPR B;  4AVP A;  1W5S A;  5M3M J;  3OYC A;  3HB9 A;  4JX6 A;  4A3D J;  1K78 A;  3S15 J;  1KA8 A;  1WZ2 A;  2EH3 A;  1LEB A;  5IT3 A;  1KZH A;  1FIP A;  2XV4 S;  3KZZ A;  2O3F A;  4EJU A;  1ON1 A;  2ZFU A;  3LFU A;  4DBQ A;  3GTO J;  4F3Q A;  3RKW A;  3MZY A;  3RKX A;  2QLZ A;  5BOX A;  2OCE A;  1FSE A;  5D8L B;  1CF7 A;  2R7U A;  1S7O A;  1ZRC A;  1MH3 A;  2OQR A;  2UUZ A;  2DCE A;  1F4K A;  2ADU A;  4D9J A;  1K6Y A;  1T98 A;  2FF4 A;  3HHG A;  3DV8 A;  2IJL A;  1X3U A;  1K7A A;  1N25 A;  2KDO A;  1ZRF A;  2LKS A;  4A0Z A;  4Y33 A;  3KYL A;  1U8R A;  2EFW A;  4G6Q A;  4OAY A;  1ZH5 A;  4L9J A;  3DCF A;  2V1X A;  4KT5 C;  1RRJ A;  1N77 A;  3RKQ A;  3KCC A;  4RGU A;  2FOW A;  3LSR A;  1IF1 A;  4PUS A;  2H27 A;  2QSH X;  1W5C C;  3I56 I;  4M73 A;  3ELK A;  1O57 A;  4A3E J;  2NVQ J;  4LMY A;  4OWR B;  4NDL A;  4P9F A;  5DM6 F;  5K5R A;  4UNO A;  1XDS A;  5BS6 A;  3LA3 A;  4BXU A;  3E6B A;  3P9I A;  3BT9 A;  5JVG F;  5L3F A;  1G2H A;  2B63 J;  4OMZ A;  1Z67 A;  3DWL E;  4RAZ A;  5CQG A;  3Q0V A;  1T33 A;  4UVA A;  3G2B A;  2J5O A;  4MNU A;  3QWL A;  2BW3 A;  2O7O A;  3JRB A;  2R7R A;  4BQA A;  4ZJZ A;  4LFU A;  2HGC A;  3HPH A;  2JSP A;  4RBO A;  3B73 A;  4GYI A;  3IHU A;  3HM5 A;  2E35 A;  4HV6 A;  3BG3 A;  1FNN A;  2D2W A;  3EET A;  3G1M A;  2STT A;  3C7J A;  4PJM A;  1QVT A;  1W0U A;  3DLA A; 
#chains in the Genus database with same CATH homology
 5D5V B;  5LLQ A;  3KP5 A;  3QP6 A;  2P4W A;  4LG0 A;  5EEG A;  2V6C A;  4HYE A;  1E2X A;  2Z33 A;  1KYW A;  2NYX A;  2E7W A;  3C3W A;  2BE5 F;  3PFI A;  4G9Y A;  1OKR A;  4PGH A;  4KYW A;  3RYP A;  3Q9V A;  1BC8 C;  4KN4 X;  3CO7 C;  5CVR A;  2QEN A;  3J80 K;  5FD6 A;  3FHZ A;  1JXS A;  4A0X A;  1ZRD A;  1UHW A;  4N0B A;  1KYZ A;  3R61 A;  2TDX A;  3GFL A;  1TNT A;  2BEO A;  2OBP A;  3I53 A;  5DUI A;  4I0B A;  4RB2 C;  2JPB A;  4IHT A;  3ML6 A;  2L4M A;  3U2R A;  1SFE A;  2VOD A;  5DCM B;  2A5Y B;  3T8T A;  2FE3 A;  4NQW A;  2D1V A;  2ZNY A;  3F8M A;  2RV8 A;  1B6A A;  2LDU A;  2IW5 A;  2WWY A;  1J59 A;  4ASN A;  5A2Q Z;  4EM1 A;  3V8K A;  4XLN F;  4Y15 A;  2KRF A;  4HF1 A;  2NRA C;  4D0P A;  1J5Y A;  4MTE A;  4HBL A;  3QOP A;  3HRT A;  1UCR A;  2V1U A;  2P7V B;  1O7F A;  3COA C;  4FX4 A;  2VBW A;  3FX3 A;  1B9M A;  4BHB A;  4L0Z B;  4UUV A;  1TW2 A;  1O3T A;  3F8B A;  2GIV A;  2QQA A;  3WTV C;  2UZK A;  5JVT A;  3I0T A;  3M7G A;  4I02 A;  1TLH B;  3TDU C;  3HRS A;  3ROU A;  3WGH A;  1DPU A;  4R79 A;  4LK1 F;  1R1V A;  1WSU A;  2V9V A;  4BH9 A;  4U0V A;  3RPQ A;  4EM0 B;  3LWF A;  3ZPL A;  4I09 A;  1GXQ A;  1KGS A;  1CGP A;  4RGS A;  4ZYG A;  1FBQ A;  3ECO A;  1XSX A;  2NNN A;  1BI0 A;  2EFQ A;  4M9X A;  2MLK A;  1FYM A;  3I59 B;  4HAM A;  4B09 A;  4ZYD A;  4YFN F;  2ESH A;  2FEZ A;  1K78 B;  2ZME A;  2F2E A;  3EUH A;  2IA1 A;  4AIK A;  2PMH A;  1S7A A;  3HHH A;  4YIF A;  3T5X A;  1CF7 B;  4YG2 F;  2VXZ A;  4HF0 A;  3BWG A;  4GYG A;  1IUY A;  2H09 A;  3I5U A;  5D5X B;  1KQ8 A;  1XMA A;  5DDG A;  2L02 A;  3TKY A;  1B9N A;  2UXX A;  2HOE A;  2V79 A;  2YPR A;  1G3T A;  1O3S A;  2HFH A;  2DK5 A;  2EV0 A;  4O6J A;  3F23 A;  3BJ6 A;  2XUB A;  1J9I A;  1HSJ A;  2BBY A;  5D5W B;  2DK8 A;  3DF8 A;  5HDK A;  4HDU A;  3K69 A;  4G7O F;  2G7H A;  3HOS A;  3L2C A;  4G7Z F;  3ZMT A;  4Q5S F;  5TRD A;  2AXL A;  4JBA A;  2QQB A;  3E3V A;  3DXJ F;  5ILS A;  3MZH A;  3GX4 X;  3LA7 A;  3H3U A;  1QBJ A;  2MLG A;  2DT5 A;  1OR7 A;  1HXD A;  4I7H A;  4E70 A;  2LF7 A;  2PBI A;  2FBI A;  4IRG A;  4MHG A;  1ULY A;  1WWX A;  1HKT A;  1IN4 A;  2RKH A;  3V4G A;  4O3M A;  1U78 A;  1R1U A;  4L9N A;  3D0S A;  2ZCW A;  2VC0 A;  4EJT A;  4A12 A;  1R23 A;  5E8G A;  4OU0 A;  2FNP A;  4XLP F;  4UVC A;  1JHH A;  1QNT A;  4Q48 A;  3I54 A;  1J75 A;  1ZG1 A;  4FHT A;  1FBS A;  2L4A A;  2D1H A;  2XRN A;  1G4D A;  2NS0 A;  4H0E A;  1YYV A;  1MDM B;  1DUX C;  2IRF G;  3VB2 A;  2E1N A;  5FB2 A;  5HS7 A;  3WGG A;  2Z9O A;  3R4K A;  2OD5 A;  1W7P D;  2O0Y A;  2Y75 A;  1B1B A;  2JZY A;  1R5H A;  4F7Z A;  2DTR A;  2HTS A;  2P6S A;  4KDP A;  2JSC A;  3IWZ A;  1FT9 A;  3KP4 A;  4P96 A;  2EFO A;  4WWC A;  2D45 A;  2VBX A;  5H20 A;  3BDD A;  3NQO A;  1HW5 A;  3HSR A;  3MCZ A;  4ENM A;  1S29 A;  2JTV A;  2P6T A;  4LK0 F;  1P4A A;  3GW2 A;  3BY6 A;  1UFM A;  2STW A;  3BP8 A;  3VOE A;  1DDN A;  2GA2 A;  1QPM A;  3R0J A;  4EMS A;  2XIG A;  1R5G A;  2P5L C;  3TDZ C;  2XAJ A;  2W84 A;  1BM9 A;  3ZN1 A;  3U9G A;  1ZAO A;  4Z2Y A;  3F8C A;  5ICG A;  1XD7 A;  3Q5F A;  2HWV A;  2HEO A;  5DYM A;  2A07 F;  3J80 Z;  2XRO A;  5IT9 K;  2G9W A;  2Q2E A;  2HYG D;  4CXF A;  1KU3 A;  1IZ1 A;  4EGY A;  4U7D A;  5DD8 A;  4Q4Z F;  3BJA A;  3FM5 A;  2FML A;  2GZW A;  3HRM A;  1XSV A;  3MQ0 A;  3CO6 C;  1LNW A;  1KQ0 A;  1S3J A;  2VE8 A;  4A5N A;  1W7P B;  1FP1 D;  3P9K A;  5LHH A;  3I59 A;  2ZME B;  3DP7 A;  3WTS C;  2PJP A;  3WTT C;  3H3Z A;  5DV5 A;  4EJO A;  2ACJ A;  2UWM A;  3JW4 A;  3MWM A;  3WGI A;  5DEQ A;  1U5T A;  1WI9 A;  5FFZ A;  1XB4 A;  5EEH A;  3JAM Z;  5JI6 A;  4AIH A;  3F22 A;  1IXR C;  2XVC A;  4OOI A;  3LA2 A;  2ZO4 A;  5F64 A;  2ZBK A;  5K1Y A;  2P7C B;  4TV7 A;  4KMU X;  1SFU A;  1IN8 A;  1ZHF A;  4FX0 A;  3RIR A;  2KIF A;  3ZMV A;  3WOD F;  4XBF A;  3FMQ A;  3SQN A;  4CHU A;  4MEX F;  5J8C A;  2DI3 A;  3WE2 A;  1G3W A;  2A6H F;  2FRH A;  3GYH X;  3QP5 A;  2GA1 A;  3FMR A;  1TQI A;  4O5V A;  4HV5 A;  2E7X A;  3RJP A;  1YW7 A;  4L9V A;  3LAJ A;  3J81 K;  1V4R A;  2IVM A;  2PEX A;  2YX7 A;  1BN5 A;  2KJB A;  4U0W A;  4S04 A;  3HOT A;  4ON0 A;  3O2P E;  2K4B A;  3DPT A;  4G6D A;  3MAJ A;  3TGN A;  4G7H F;  1HQC A;  5AIP A;  1MD0 A;  3GWZ A;  2FQ3 A;  4XSZ F;  4U7B A;  2R3S A;  1YQA A;  3F72 A;  3EQL F;  1FBU A;  1J2X A;  1LB2 A;  1OPC A;  3FMS A;  2M8E A;  1Z6R A;  2GXG A;  3N97 A;  3E5U A;  2M30 A;  1JHF A;  1ZYR F;  4UV9 A;  4KN7 X;  3K1M A;  1U3E M;  4M6X A;  1RI7 A;  1PUE E;  2FU4 A;  3FXR A;  3REO A;  1AWC A;  3V7R A;  1BOA A;  1ODD A;  4L18 B;  4KNY A;  3HTU A;  1H9G A;  3LST A;  4M9Z A;  5FLX Z;  2M5W A;  3ABT A;  3L9F A;  3V7S A;  4FT8 A;  3I58 A;  1RUO A;  2F5F A;  1MDM A;  1T39 A;  2DU9 A;  5HDN A;  2EA4 A;  2Y48 A;  5AON A;  3GXO A;  3RYR A;  3TO9 A;  4HW0 A;  2CG4 A;  4S05 A;  1AOY A;  1Y0U A;  3ZN0 A;  4MEY F;  1QGP A;  3HSF A;  1I6X A;  1ZLJ A;  4RAY A;  1R36 A;  3EYI A;  2CSO A;  3MEX A;  2KIM A;  4YFK F;  4WXC A;  1BIA A;  6PAX A;  3WG9 A;  2CYY A;  3TQN A;  4IXA A;  4KIB A;  3KP6 A;  3J7A O;  2F5C A;  1J0R A;  1XN7 A;  5E18 F;  2BYV E;  2EV5 A;  1RZ4 A;  4BYY A;  3BZ6 A;  2EB7 A;  1E17 A;  4HX8 A;  1FX7 A;  4G94 A;  1FZP B;  3E97 A;  2FOK A;  3IL2 A;  5BPD A;  1ZG3 A;  3EDP A;  2O8X A;  1LEA A;  5D6F A;  2OA4 A;  1MGT A;  1MJA A;  4PDK A;  1OMI A;  1P2F A;  5E17 F;  4HQM A;  5JFR A;  2IT0 A;  2XKO A;  1XSD A;  1MJ9 A;  3TO6 A;  1ZGA A;  4I01 A;  2VOP A;  4IVN A;  2EV6 A;  5L3C A;  2E1C A;  1U2W A;  4BHC A;  4ESJ A;  1W7P A;  4I2O A;  1YLF A;  2W57 A;  2RC4 A;  3K9T A;  1U5T B;  4LB5 A;  1BI1 A;  3ZMS A;  2QBY B;  5K5Q A;  4WX9 A;  2OAZ A;  2W25 A;  3HUG A;  5DD4 A;  4IHS A;  3IWF A;  1DP7 P;  3H92 A;  2R7F A;  1U5T C;  1REP C;  3TOA A;  2ELH A;  4LLL A;  3D5L A;  3FF5 A;  2GQQ A;  2JT1 A;  2VBZ A;  1LDJ A;  3N4M A;  1YW9 A;  1A04 A;  2ZXJ A;  3NRV A;  4UVB A;  3KP3 A;  2FXA A;  3DEU A;  1RNL A;  3K2Z A;  2K27 A;  1EH8 A;  4HA8 A;  4WK8 F;  3ECH A;  1IN5 A;  3F3X A;  3SHF A;  1EV7 A;  4AD9 A;  3V8L A;  1D5V A;  1XMK A;  3FXU A;  2K86 A;  4AIJ A;  4U88 A;  3K0L A;  5HS9 A;  5IT9 Z;  2FSW A;  2P8T A;  3SFZ A;  5LHG A;  2QQ9 A;  3L00 A;  4A5M A;  2VE9 A;  4U0Y A;  1PP7 U;  2X0L A;  1YO5 C;  2CQK A;  4RB0 A;  4EJW A;  2DFI A;  3E5X A;  4A6E A;  3WTW C;  2MC3 A;  4IRI A;  1OYY A;  1ZRE A;  5A2Q K;  2XAQ A;  2QM3 A;  1U6G A;  1KU9 A;  4BHP A;  5D4S A;  2CWE A;  2IPQ X;  2A68 F;  2A69 F;  4JQF A;  4PGG A;  1IN6 A;  4L0Y B;  3WTZ A;  1Z7U A;  4EM2 A;  1YG2 A;  1I27 A;  5DUK A;  1HW1 A;  4OIN F;  1SAX A;  1GXP A;  4RB3 C;  3GVA A;  3HIF A;  1USS A;  2C6Y A;  1T38 A;  5FFX A;  2M45 A;  4LGW A;  2AS5 F;  3ZMU A;  5E1Z B;  2L01 A;  2H94 A;  1SD6 A;  3PQJ A;  2BGC A;  1L0O C;  2W85 A;  2V1D A;  3R0A A;  1IRG A;  3KP2 A;  1BBY A;  2ESN A;  1P4W A;  2VT2 A;  2QUF A;  3FZV A;  2FBK A;  3BRO A;  4BNC A;  1SMT A;  2FBH A;  5D8K B;  1LDD A;  3ABU A;  4HX4 A;  1FYL A;  3JTH A;  1FYK A;  1K79 A;  2CGP A;  1XCB A;  2CO5 A;  5JR3 A;  3IC7 A;  3BJO A;  5LHI A;  2EFP A;  4DNC A;  2QZ8 A;  1FC3 A;  4XRF A;  3NEU A;  1FY7 A;  1EH7 A;  4Y17 A;  4OIP F;  2RGV A;  3OV8 A;  1WKM A;  3DQV C;  2YR2 A;  4IF4 A;  2XGX A;  3SZP A;  2XHK A;  3P7N A;  3FWE A;  2Q0O A;  2YU3 A;  5F1R A;  5HLG A;  2GAU A;  3WU0 A;  5FGM A;  2BV6 A;  2FA5 A;  1HKQ A;  3F6O A;  4WCG A;  1R7J A;  1XGS A;  3VFZ A;  1IXC A;  4Q47 A;  2VT3 A;  1ZGJ A;  4Y13 A;  3C18 A;  3CUO A;  5DCF A;  4WF2 A;  3G3Z A;  4IPA A;  2VN2 A;  5CVU A;  1LJ9 A;  2DBB A;  3KFW X;  4HDV A;  3F8N A;  5J6X A;  3BPV A;  5ERI A;  1I5Z A;  1WRJ A;  3P9C A;  1PDN C;  1ONV A;  2XKP A;  2DPU A;  3ZMZ A;  1PP8 F;  2HTJ A;  3KEO A;  4M6Y A;  2HR3 A;  3QPT A;  1P92 A;  1SFX A;  5KK1 A;  5HVQ C;  5LRR A;  1B4A A;  1BIB A;  4ESF A;  4CO8 A;  2ZKZ A;  4R1H A;  1HW2 A;  2L54 A;  3S2W A;  5D6E A;  3LFK A;  1I1G A;  2QBY A;  1MKM A;  4ZZD A;  1LDK B;  4HLY A;  1FPQ A;  3CTA A;  4HQE A;  4XSX F;  2LNB A;  2WC2 A;  3M8F A;  3RI4 A;  1C0W A;  2DQR A;  5FD5 A;  1RUN A;  2IP2 A;  2IA2 A;  1I1S A;  4CGZ A;  3CJN A;  1IXS B;  3W6J B;  1Z1D A;  1P6R A;  2VC1 A;  5CVI A;  3GZ5 A;  3VEP A;  3KZY A;  3T8R A;  3LQR A;  1WQ2 A;  1R58 A;  3HTS B;  4KA4 A;  1GVJ A;  2NNY A;  5E20 A;  4QWQ A;  1FP2 A;  2IA0 A;  2GWR A;  2RVC A;  1Z6T A;  5HS8 A;  3G73 A;  3GFI A;  2EA2 A;  4ZH4 F;  2KJC A;  5LEK A;  2M87 A;  1MZB A;  2HQR A;  3GO5 A;  1OYI A;  4L5J A;  1BI3 A;  2RN7 A;  2KKO A;  2B0L A;  4CZZ A;  5AIQ A;  1P4X A;  3RTR A;  5L3D A;  2PFB A;  1R00 A;  4KIG A;  3GEZ A;  1FSH A;  2MH2 A;  3KP7 A;  5L3G A;  1LQ1 A;  5KVR A;  4IJA A;  5CVJ A;  4I0A A;  5LRS A;  5ED4 A;  3MFK A;  3WU1 B;  4OMY A;  2QYO A;  1HBX G;  4BAY A;  4HF2 A;  1VTN C;  4GXO A;  2FMY A;  5HLH A;  3E6C C;  4I98 B;  1XGO A;  2EK5 A;  5K5O A;  3FM3 A;  4N9I A;  4LJZ F;  2F5E A;  2NAZ A;  2WV0 A;  5LGN A;  4AWX B;  1R22 A;  5CVV A;  1ZLK A;  4UXN A;  2P5K A;  3KLO A;  1MJB A;  2JPC A;  3PQK A;  4MQ9 F;  4M71 A;  4M9S A;  1NHA A;  1W4M A;  1SD4 A;  1FOK A;  1UHM A;  1XGN A;  3CUQ B;  4OIR F;  2JRT A;  5LEJ A;  3O3K A;  4P55 A;  4ESB A;  1F5T A;  5ILU A;  2HYF A;  5D5U B;  3CUQ C;  4P9U A;  4MGR A;  3O6B B;  3M1E A;  4ENN A;  3QU3 A;  1KU2 A;  1YTY A;  4OIO F;  1QZY A;  5HOO A;  2MH9 A;  5LGT A;  2CFX A;  3RDI A;  5ILV A;  5HDG A;  3SXY A;  2Z99 A;  4MTD A;  4L5I A;  1KQ9 A;  2CW0 F;  1T0F A;  1LVA A;  3C1D A;  5ICC A;  1JE8 A;  4L9T A;  5ICE A;  4RB1 A;  3JAM K;  2W24 A;  4ZYH A;  4CDG A;  2DQL A;  1TTY A;  2MD5 A;  3ZP5 A;  2HS5 A;  4A2U A;  4GGG A;  2OU2 A;  4LD5 A;  4ETS A;  3L7W A;  2ZFW A;  2Z3Y A;  1T2K A;  5TJJ A;  2GXB A;  1EH6 A;  3V8J A;  4RS8 A;  1JGS A;  5J8F A;  4K2E A;  4JK1 X;  1BJA A;  2PG4 A;  2QWW A;  2MA3 A;  1UST A;  4DQ2 A;  2A3S A;  3BPX A;  5E8I A;  2HDC A;  1IAW A;  4KFC A;  2A6E F;  1K6O A;  2G7U A;  2Y0M A;  1ON2 A;  1R1T A;  4EQQ A;  3F6V A;  2R7D A;  3IKT A;  5LGU A;  3TOB A;  4YII A;  1TW3 A;  1SMY F;  2O61 A;  1W5T A;  3QAH A;  1D8K A;  1YS6 A;  2RNJ A;  2ISY A;  4B8X A;  2F5D A;  3Q9S A;  3I4P A;  3QPH A;  4QLC U;  4HZF A;  4WXH A;  3ISP A;  4LB6 B;  4MQV A;  1Z05 A;  1IN7 A;  2DAO A;  2HQN A;  3GFM A;  3R60 A;  4R8H A;  4HOB A;  3RPU A;  3F21 A;  4KIF A;  5L3E A;  3AAF A;  4M72 A;  3E6D A;  5BMZ A;  2PMU A;  4HX7 A;  1DPR A;  3W6K B;  2DLL A;  4N9H A;  2PLY A;  5H6Q A;  3T0Y A;  1T6S A;  3EYY A;  3JSP A;  1QQI A;  5JHU A;  2VON A;  4CIC A;  2J5P A;  1S8N A;  2K02 A;  5E1X A;  3GF2 A;  2Z5U A;  5FLX K;  4CYD A;  2L3D A;  2XAH A;  1QZZ A;  3F8F A;  1Q1H A;  4ZZL A;  2PI0 A;  4GO1 A;  2YX4 A;  2XAS A;  1YW8 A;  1H9T A;  1IRF A;  1ZG5 A;  1F1Z A;  3JSO A;  3B02 A;  5D4R A;  2K7L A;  1Z91 A;  1S6L A;  2HKO A;  1D3Y A;  3CLO A;  2COM A;  3KET A;  4KUM A;  2RQP A;  2UXN A;  1OYW A;  3IRR A;  2EFN A;  3V7C A;  1HST A;  1J7K A;  2ZNZ A;  2O6G E;  3K1N A;  3M8E A;  4LG0 B;  2RDP A;  3L09 A;  2DW4 A;  3ZMD A;  1F9N A;  2ISZ A;  4LLN A;  2ZJ2 A;  5FO5 A;  3QRF F;  2DPD A;  3QU6 A;  4EV0 A;  4NB5 A;  1L3L A;  2K4J A;  3VOD A;  1YIO A;  4ENJ A;  1RIO H;  2H6B A;  1BI2 A;  1O3R A;  1YFH A;  3DKW A;  4KIC A;  2MBF A;  3IRQ A;  3GLX A;  4G8X A;  3GZ6 A;  3DFG A;  4EGZ A;  1UB9 A;  2YSR A;  3OOP A;  2PQ8 A;  3KE2 A;  1KU7 A;  3CUQ A;  2QVO A;  4A0Y A;  4M74 A;  5HLI A;  1YS7 A;  3M9A A;  2OZ6 A;  4PZJ A;  2P5V A;  4A6D A;  1ZN2 A;  3I64 A;  1FWZ A;  3J81 Z;  2VOO A;  3FXQ A;  1TBX A;  3HYI A;  4EVI A;  2HKX A;  4UV8 A;  3R6S A;  1ZAR A;  3IKV A;  1B59 A;  3LAP A;  2A61 A;  4HLX A;  5CYV A;  1XGM A;  4KMF A;  5DCM A;  2FNA A;  5BPI A;  1Z9C A;  2EJR A;  4RGR A;  3T1B A;  2EWN A;  3HRU A;  4P5O A;  3HSE A;  1IW7 F;  1XCV A;  2XAG A;  1V3F A;  3TO7 A;  3RKY A;  3CDH A;  2LKP A;  3E5Q A;  3SZT A;  3WE3 A;  3ULQ B;  2VBY A;  1GHC A;  4RGX A;  1TQP A;  1SD7 A;  3KLN A;  2KIU A;  1FLI A;  2ETH A;  4ZYE A;  3U1D A;  3BOQ A;  5CLS A;  4EJV A;  3KEQ A;  4UHT A;  3WTY C;  1HKS A;  2OQG A;  2LF8 A;  3GFJ A;  2WTE A;  4PCQ A;  1O7L A;  2Q8K A;  1D8J A;  2OZU A;  4NHJ A;  1G3Y A;  5ICF A;  1SD5 A;  2H6C A;  3E6M A;  5CJ9 A;  2DO7 A;  3WTX C;  4YFX F;  3DPL C;  3K1P A;  2LSO A;  2X4H A;  2M1B A;  1TNS A;  4LLG F;  1O3Q A;  1TQM A;  5BQT A;  4WXD A;  3WTU C;  1H0M A;  4OIQ F;  5H6R A;  5LBQ A;  3I71 A;  1STZ A;  1XDU A;  5F6F A;  1G6N A;  5L3B A;  5E1W A;  1G3S A;  3ZQ7 A;  2XAF A;  4IRH A;  3ERE D;  1BC7 C;  1QO0 D;  3LQQ A;  4ENK A;  3GUD A;  2O03 A;  4GCV A;  2PN6 A;  2HZT A;  4AVP A;  1W5S A;  1K78 A;  1KA8 A;  1LEB A;  5IT3 A;  2XV4 S;  3KZZ A;  2O3F A;  4EJU A;  1ON1 A;  3RKW A;  3MZY A;  3RKX A;  2QLZ A;  5BOX A;  1FSE A;  5D8L B;  1CF7 A;  1S7O A;  1ZRC A;  2OQR A;  1F4K A;  2ADU A;  1T98 A;  2FF4 A;  3HHG A;  3DV8 A;  2IJL A;  1X3U A;  1K7A A;  1ZRF A;  4A0Z A;  1U8R A;  2EFW A;  4G6Q A;  1ZH5 A;  4L9J A;  2V1X A;  4KT5 C;  3KCC A;  4RGU A;  1IF1 A;  2H27 A;  4M73 A;  3ELK A;  1O57 A;  4LMY A;  4P9F A;  5K5R A;  4UNO A;  1XDS A;  5BS6 A;  3LA3 A;  4BXU A;  3E6B A;  3P9I A;  5L3F A;  4OMZ A;  4RAZ A;  4UVA A;  2J5O A;  4MNU A;  4BQA A;  4LFU A;  2HGC A;  3B73 A;  4GYI A;  3IHU A;  4HV6 A;  1FNN A;  2D2W A;  3EET A;  2STT A;  3C7J A;  3JTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...