4KT6A

High-resolution crystal structure streptococcus pyogenes beta-nad+ glycohydrolase in complex with its endogenous inhibitor ifs reveals a water-rich interface
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
GNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotine adenine dinucleotide glycohydrolase
publication title High-resolution crystal structure of Streptococcus pyogenes beta-NAD(+) glycohydrolase in complex with its endogenous inhibitor IFS reveals a highly water-rich interface
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 87
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1660 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4kt6A01
3PNTA 4KT6A
chains in the Genus database with same CATH superfamily
2DA1A 3DKYA 1BN5A 1ZYRF 2W82A 3LA3A 5ERIA 3SZTA 4XN0A 4XM3A 5LHHA 2VBWA 5CLSA 4MFDA 5IOZA 3W2AA 4L9NA 2OA4A 3OYAA 3FK7A 3TBIA 3LFKA 2QLZA 1YJ9I 1WKMA 2VOOA 4E7HA 4U7DA 2BY1A 2F4IA 2CU7A 2Q2EA 2PJRA 1BI3A 2F5EA 2ISYA 1SMYF 3HG9A 4RAYA 5JVTA 3KFWX 2RQQA 5EG0B 4C2MJ 2L7MP 2JT1A 2DBBA 1MGTA 4KMUX 2EH3A 2K5CA 3QPTA 4PJJA 1YO5C 4Q48A 1L0OC 4A12A 3HZJA 5K7FA 3P9KA 2VC1A 1SD7A 3RDIA 2ISZA 3FX3A 5L3DA 3VFZA 4BY1J 4HF2A 2GLOA 2NNYA 5FKOA 1Z6TA 2I8DA 2X6WA 5GPCA 4Q5SF 4G12A 1RPWA 2MA3A 4MEYF 3GCMA 3OY9A 4FQGA 1Z77A 2W57A 4UHTA 1ZAOA 1HW2A 1FSHA 2RGVA 2H1LA 3CO6C 5AIPA 5IP7J 4BHPA 4KT6A 5C3EJ 2EILH 1P9QC 5JR3A 4A0ZA 4G7OF 1BIBA 1J09A 3ZN1A 1MBHA 2EZKA 3OS2A 1EH6A 1QPMA 1YLFA 4BACA 3K10A 2NNNA 2OBPA 5EZGA 2E5ZA 2L01A 3CP8A 2ZMEB 4UV9A 3A01B 1Z91A 3S2HJ 1ZHFA 2AXTC 3FXRA 2F5FA 2DQRA 4UNOA 1UMQA 3RZDJ 1S29A 3IHUA 1WSUA 1R23A 3KP7A 3DCFA 2GA1A 2CQQA 2VBZA 2HQ5A 2KIFA 2RC4A 3ZQHA 5ILVA 4CCLA 3FMSA 3HOYJ 5FKLA 2OUMA 1BJAA 3TKYA 2HYFA 1IF1A 4K2EA 2VQLA 1P4WA 1YIOA 1VQKI 5J3LA 2MLKA 5J4VA 3SXYA 3CUOA 4YG2F 5F0FA 1ONVA 1U9OA 5JHUA 3QYFA 1YRNB 2NVXJ 4DZPA 4PDKA 4UY8I 3PSFA 3KCCA 2HOSA 5EEAA 1BIAA 1D8KA 2V1UA 3DEWA 4KFCA 2X51A 4D9JA 2A6HF 1XGNA 3IWFA 3RKWA 1ZG1A 1VQ6I 2M2EA 3S15J 4AYBA 1TP4A 1YG2A 4M3GA 4F92B 1VQNI 3C18A 3S8PA 3QRFF 1ORKA 2HQRA 2AS5F 3X2QH 3NAUA 3DLLF 3AG4H 3OYNA 2HS5A 2FOKA 5DEQA 1A31A 3CCRI 3A1YA 4JBAA 3DTIA 3VPRA 2VT3A 1TW3A 2CGPA 4XBFA 3HGYA 3L9FA 1YJWI 2EV5A 5K7ZA 4G94A 4UXNA 3FF5A 3TP0A 4WCGA 4B8XA 3OYBA 1SFOJ 4HDUA 1IN5A 2OV7A 2XKOA 3Q0UA 2V9PA 4BE0A 1X3WB 2EZIA 4CYCB 3BZKA 1MMAA 4P96A 3ROUA 3CCEI 5B1BH 3R6SA 4L5JA 4ABZA 1NG7A 2DT5A 3C1DA 1ETWA 1UG0A 2LNBA 3ELKA 4XLHA 1MW7A 4QPQA 2JN6A 2MGQA 3WU2C 4CCMA 1MNDA 2FRHA 1SANA 3FXLA 1Y1WJ 4IOCF 1E3OC 3V7CA 5EF6A 3CDHA 1J9IA 2KISA 1U8BA 3BDDA 3OS0A 4I09A 2R7FA 1Y0NA 1OR7C 2JJ7A 3GW2A 2HDDA 2H94A 2XF5A 2QEXI 3S1RJ 2KQRA 1IG7A 3L2VA 4D7NA 4J00A 4IRGA 3QP6A 2E71A 2Q8KA 4E4HA 2O61A 1ZLJA 3HIFA 3O2PE 4OAZA 1VFCA 3L2CA 1BR1A 1EF4A 2Y30A 4PSWA 2HOEA 1GUUA 3HEFA 5EJCA 1ZQ3P 1I3QJ 2KPMA 2XAGA 3I71A 3DEEA 4BHBA 1RIOH 5LFAA 2JUGA 2J5OA 4XKWA 3OYKA 3W2WA 1EJ9A 5HDGA 2PG4A 2DJNA 1V55H 4XLPF 2VQGA 1OMIA 1TQMA 4J19A 1S3JA 4HX4A 1R4MB 5H20A 4PGHA 4HQEA 2P5KA 2FXAA 5D5UB 2KIUA 3ZMVA 3WTYC 2WV0A 5KHDA 5F64A 3QU3A 1Z3XA 2OZUA 1JHFA 4DIQA 4AIJA 1MBKA 2NVYJ 2XUBA 4AIHA 1OPCA 2DAOA 1MMSA 5IT9Z 1BC8C 1OR7A 3S14J 5HDNA 3ECHA 2VONA 2R5YB 2IS6A 4EJTA 1E0EA 4L9TA 3U9GA 2OJED 1X1PA 1V4RA 3VEPA 1YW8A 2KHMA 1SC7A 2XIGA 4XSZF 2LREA 1YI2I 4EM1A 5DV5A 2HNHA 1IV8A 1G2HA 1OISA 4P1WA 4EEFG 3F8BA 1MNEA 1VI0A 1QVUA 4IHXA 2JVGA 3AL0B 2K85A 3UNGC 2CFOA 4LIUA 1MZBA 3K1PA 4FT8A 1TBXA 2E2IJ 3T1BA 4I01A 1FOXA 1SFKA 3CCMI 4HDVA 1R5ID 3WGHA 1B1BA 3GTLJ 2XRNA 1WJFA 4RDUA 5DD8A 3C2HA 3QOEA 4QTRA 4NQWA 4RB1A 1A36A 1KQ0A 4HSTA 1GLNA 3RJPA 4O5VA 1PP8F 3CUQB 5KNLA 4ESBA 3JCUC 3RI4A 2OD5A 3K6GA 1P6RA 3M8EA 3BT9A 4JX5A 1CF7B 3EYIA 2IA0A 5LGUA 2QSFX 3GWZA 2VE9A 2IS1A 3P9IA 4HLXA 4QLCU 5DUIA 1OCCH 2MW8A 2CUEA 5A2QZ 2JK3A 3BJAA 3H9GA 3REOA 3E6CC 3JRDA 1WZ2A 2FNPA 3KP4A 2ZJRF 4BE2A 3TOBA 3TDUC 5FFXA 3WE2A 3PNTA 1VQOI 4XIDA 2CG4A 3A4CA 5F08A 1HA8A 1I6HJ 1UFMA 2EK5A 2XF6A 4R79A 1QNTA 3ZCOA 3OYIA 3P7NA 1LKXA 4XLCA 3VYTB 2WBMA 3GTGJ 4IQ4A 4OIOF 2FMYA 3MFKA 2CQNA 5EZHA 1HBXG 1WH5A 3I9V2 1TNSA 4C3HJ 2IT0A 4IRHA 3H3VK 1WI9A 1ETXA 3ZQIA 5BS6A 2QBYB 3H5NA 2CSOA 2L7ZA 3EUAA 1Y8RB 2LF7A 4XKCA 2LF8A 2X6OA 1UELB 5M5WJ 2PI0A 4E7ZA 1IDZA 1FOWA 4FETA 3LA2A 2K9SA 2CQKA 2HTSA 4HBLA 4KICA 3OYFA 2CYYA 4S05A 1XC5A 3DPTA 2BZTA 3GTQJ 1DPUA 4C30A 3B02A 5FGMA 1G6NA 2JRTA 2M30A 3TW6A 1T98A 2ZJPF 4MO7A 2DMPA 1HW5A 1YYVA 3O8GA 4A0XA 2QQ9A 1DPRA 4C3IJ 2ZNZA 3FM5A 4CH7A 1R49A 2P7VB 1H0MA 4E7SA 5ICCA 5J1UA 4Z6YA 3TEDA 1IRXA 1KU3A 5TISC 1WWXA 5J1RA 5L3BA 1GT0C 1X58A 3F9KA 2QM3A 5F27A 2V4JC 1RUOA 3G1OA 1HXDA 1R1UA 4M9SA 2KMUA 3RKXA 2RNGA 1HW1A 3S2WA 1BR4A 1YOVB 3ZMDA 2JA7J 1O3TA 1IN6A 1HSTA 2IJLA 3BTCA 2KT0A 3W6JB 4F91B 3WG7H 2O6GE 1R00A 1JKOC 3DTEA 3HHGA 5E1XA 1KU2A 5IT3A 2HPIA 3HOZJ 4WX9A 1TWGJ 3OYHA 2Y9ZA 5J8CA 2DN0A 1QZZA 3J7ZI 1T95A 1X19A 2JMWA 2QKMB 3CCVI 1Y39A 2EFQA 2W7NA 2H1KA 2KRHA 1O4XA 2VB6A 1O57A 2DXIA 3CJRB 4KN7X 3PFYA 1BI0A 2DYSH 3F23A 4JQFA 3F21A 1ON2A 4M6XA 3K4LA 5EYRA 4EVIA 1LQ1A 1PVEA 2DDBA 2CQ7A 3EETA 3MKLA 3PIOF 2DPUA 4BAYA 3LOCA 1G59A 2DA4A 2W00A 3K4KA 4NC7A 2EINH 3BWGA 4X6AJ 1D3YA 3OOPA 4YEJA 1RZ4A 2MC4A 5FLXZ 3LAPA 2O3FA 3COAC 1JKRC 1S5LC 2CS3A 3CDIA 1O3RA 1HKTA 4RAGA 1E2XA 1D0ZA 3K4CA 1IUYA 4F93B 1DGWY 1DQUA 3E5UA 2KJCA 3DKWA 2HGCA 3LFUA 2JA8J 2NXNB 1GXPA 1WJBA 3G1MA 1QZYA 2L54A 1TWCJ 3CC4I 3IRQA 3H3UA 3HTUA 2E2HJ 4KN4X 1SMTA 1IDYA 3LSRA 1DGRM 1FZPB 2F48A 3H5RA 1ZGJA 1AOYA 5CYVA 2IEKA 3SFIA 1U0JA 2ZXWH 2VPLA 2ZFWA 2JPCA 1LEAA 4LITA 3EDPA 4KITB 4GGGA 2OC6A 1Y8QB 1ZK8A 1A6QA 4FISA 3BP8A 3O8HA 2J5PA 3HL2A 4UVAA 1W1WE 3BR3A 4Q47A 3F0CA 3Q0VA 1SFEA 3JRCA 5F0HA 2WAEA 2BW3A 3IWZA 4YFXF 5JLXA 4IZZA 2L9RA 1ZLKA 2W4SA 4EQQA 5DDGA 2HR3A 2ZCWA 4PSXA 2LH9A 3JRHA 3GFIA 4MLOA 4NUBA 1XG1A 3GF2A 5J40A 2NAZA 1G4DA 1IO2A 1F4KA 4E6KG 2ZC2A 4LLGF 4LFUA 3GO5A 4YFNF 1FIAA 2XB5A 3CO7C 3F8MA 1FJLA 5IYDJ 4XOPA 1O3SA 3H92A 4KIFA 2CFXA 4A3IJ 2V9VA 3BR5A 4A3EJ 3CMAI 2VLAA 1BW6A 2QZ8A 2CW0F 2ZXJA 1SAUA 2EFNA 2GXGA 2F5VA 4M3FA 1R36A 2NS8A 4B4CA 1YIJI 1SVOA 2JZYA 1QHHD 4U88A 2IP2A 2ME6A 3H1CA 1ZN2A 1R58A 3I54A 4U7BA 4NHJA 2K7LA 1EV7A 2M4GA 1UCRA 4BQOA 4IHSA 1XSVA 2E19A 5LD2C 3S2DJ 1YX3A 1I50J 3FK6A 2QQ8A 3PL8A 2L2OA 5JI6A 3ASOH 1FP1D 3K4JA 2MBFA 1CQTA 4Y52J 2LP0A 3IRRA 2YU3A 3MAJA 5EGOA 4RBOA 3I4MJ 4I7HA 3GFJA 3CCLI 1FBQA 1PUFB 2PMZN 3CJTB 5ICFA 1NTCA 5FRNA 2E1CA 1USTA 4TV7A 3MKZA 2KRFA 3FKJA 1XTAA 5F0CA 2EFWA 1JXSA 1Z7LA 3OWTA 3L1PA 4ON0A 4HF1A 4A3CJ 1V5EA 2GBYA 3MD2A 2STTA 4CHUA 1HQCA 1LEBA 3TGNA 2XPVA 1KU7A 5GAGJ 1AU7A 3A02A 1MH3A 3BROA 1I3AA 2GOMA 2NS0A 3I0TA 4XL9A 3IKTA 4G7HF 2ZMEC 3CZ6A 2I10A 2R7DA 2KIQA 1WVRA 2CRGA 2MG4A 2KIMA 4N0BA 3MVPA 3L2RA 5TRDA 1EH7A 4CICA 3ZP5A 5CKTA 5IYBJ 4G7ZF 3CCUI 2IXSA 1Z05A 2CUJA 2YSRA 2DA5A 4ENMA 2YU9J 4GXOA 3FXQA 2F2EA 1SFUA 4D5FA 5K5RA 1T0FC 4IXAA 3PNVA 3UKGA 3VWBA 3TP3A 1B4AA 2X85A 2G0EA 3CCYA 3GZ5A 4MFEA 4XRMA 4B09A 2IGOA 5BPIA 2IS2A 2XV4S 3S93A 2JRMA 1GHCA 2LKPA 5E3MA 5LEKA 1F1ZA 3J7AO 4BDYA 5IT9K 1X1BA 1D0YA 2DOEA 3GXOA 1J75A 4IHWA 3K1NA 1OCPA 3HGGA 4BEHA 1AKHB 2XC7A 5D4RA 2JQ7A 1BA5A 2ZO4A 1MJAA 1YITI 2Q1ZB 2LD5A 2Y69H 2K3PA 3DLAA 4CDGA 3J7YJ 2ZMEA 1ETYA 3KLNA 1VTNC 2W48A 4PFPA 3JRGA 1TWFJ 3H35A 4GYIA 4PJ0C 1FYLA 1QPIA 2EFOA 4R1HA 2YPRA 3BG9A 2EFPA 2TCTA 5HS7A 1FSEA 3LSHA 2L9NA 5FO5A 1FWZA 5J6XA 3IP4B 1T6SA 2A6EF 2R7OA 4BQQA 5JVGF 1RKWA 4LOCA 3EQLF 3S3NA 4RGUA 3U1KA 4PJLA 4BQNA 2I5UA 4PFOA 2HTJA 2AO9A 3VSLA 4DZJA 1Y1VJ 2R5ZB 2FUG2 3BG3A 2VJIA 3E97A 3K4BA 5M3MJ 1IXSB 1RETA 4BJ6C 5A2QK 2HDWA 1RR8C 3VYRB 4MTDA 2HZDA 1STZA 3KP5A 2PBIA 4ZYDA 1S7OA 1TQIA 3RTRA 4C2TA 3HDDA 3JSOA 4W97A 1POGA 3M7GA 1D1BA 4U87A 2HPMA 1P7JA 2BBYA 1SD5A 2DA7A 2Z1DA 2CMPA 4HW0A 1B9NA 2ICWG 4QSHA 5EEGA 1WJAA 3U21A 4AWXB 4RB2C 2MC3A 1NHAA 1BL0A 2NVUB 3SZGA 2BY3A 1YS7A 2M5WA 2W84A 3GLXA 3FIWA 2E7WA 2IGKA 4KNYA 3BC8A 3ZR8X 5B66C 4A3KJ 2ID6A 1Z9CA 2V1NA 4UVBA 4EM2A 3HOSA 4AYBN 2RQPA 1A35A 5C4XJ 3LSPA 4DBRA 4AIKA 5KCMA 5IPAA 1WCMJ 2JSPA 2M7BA 3IH2A 4FX4A 2WAFA 4ZYHA 2B7EA 4XK4A 3HUGB 1K79A 2CV1A 3RSNA 1BJZA 2Y9YA 5IOYA 5H6RA 2K02A 3F6OA 1U78A 2PN6A 4XN3A 1MKMA 3IV5A 3Q3SA 3HPHA 3K70C 1APLC 1TT0A 4OMYA 4D7MA 1E3HA 4CCNA 3JRAA 3E6DA 2LFBA 4IEJA 2ELJA 1ETVA 3VB2A 4B44A 2O0YA 3RPUA 3A2KA 4NBQA 3T8RA 2Y0MA 5DCMA 2XSJC 3LNQA 2K86A 2PX9A 4LIVA 3GZ6A 4ETSA 2R7ZJ 1MBEA 3CJQB 1YE9A 2Z3YA 3HHHA 4QIWN 1FEXA 4N4NB 1HLVA 3G3ZA 1J7KA 2VUMJ 3OYLA 2BV6A 5CVRA 1XB4A 5DM7F 4UUSB 3CCSI 1DUXC 1DDNA 1N25A 3GYHX 5LGNA 3JSPA 3JRFA 2IS4A 2MD5A 4G6TB 5HNHA 1XPXA 4I76A 5LRSA 2E1MB 1ZTRA 2R4GA 2WB1A 1R1TA 4BH9A 1SAXA 1VNDA 3FBIB 3OR2C 2PJRB 2P4WA 2AQEA 3R0AA 5DYMA 1S6LA 4HF0A 5DCFA 4ESJA 2F4OB 4UVCA 4E7KA 3AKZA 2PMHA 3OR1C 3SQNA 1JKPC 3FMQA 4WF2A 3S1NJ 3WODF 4EJOA 2R5YA 3DTKA 5CVIA 3E3VA 2A05A 5IYCJ 3QWLA 2BHYA 1LDKB 1X1CA 1VZ0A 2P5LC 3TO6A 2Q0OA 1B8IB 4XSXF 5CVJA 3RYRA 4YIFA 5FLXK 2A3SA 2LKXA 2QSGX 3WTWC 1FBSA 3FM3A 5E1WA 2LLKA 5FLMJ 4I99C 4IRIA 3DU5A 3TQNA 1I5ZA 1ZRCA 5AONA 2CW7A 1I1GA 2NOJB 3PQKA 1F43A 5F1JA 2BVLA 3BTJA 4U0WA 1RNLA 4RAZA 1IGNA 3DV8A 4JYKA 4RA2A 1LFUP 1RKTA 2DI3A 4LK0F 4M74A 4UB6C 2OTLI 2WTEA 4XLEA 2MABA 4DGWB 3ZQLA 1HF0A 2Y2ZA 5KAFC 2N8GA 3TL4X 3B73A 2DOFA 4HV5A 1FX7A 1PUEE 2GIZA 2FEZA 1MIJA 4GRIA 4YFKF 2UUZA 1QQIA 3KZZA 1GDTA 4M3EA 3I59A 3S3OA 1KA8A 1JT0A 1ZREA 1E17A 2KZVA 2H09A 3OIPA 3WU1B 1R6RA 1IXRC 1OCRH 3AFHA 1A04A 4B48A 3H9JA 1BI2A 2HXIA 3WTXC 3HB9A 1WJ5A 2WV1A 3J81K 3I56I 2FBKA 3VYSB 3DWLE 3KEOA 3KX2A 3B6AA 2K27A 1V5GA 3F8NA 3SJMA 2OCCH 3ZOBA 3WTZA 2STWA 3LSGA 2BE5F 5DD4A 3K2AA 4PZJA 1Y56A 3O3KA 4W1UA 2D1VA 4EGZA 1X4OA 2NVQJ 2ESHA 3ZMTA 4HX7A 2JA6J 4M3DA 2RNJA 3VSKA 4AUXA 1V5FA 1QRYA 1K4SA 3HSFA 3BY6A 1P7IA 3QPSA 3TO9A 4XLFA 1Z3YA 1W7PB 2PJPA 3JREA 1TT5B 5KAIC 4DOZA 3NARA 2VKEA 4L0ZB 2UXXA 2JWTA 3SFZA 1W36C 2LBFB 4II2A 2IA2A 2BXYA 3CLQA 2XPWA 3S17J 2XAFA 4FX0A 2PFBA 2HI3A 4CCJA 3OIOA 4I0BA 3MKWB 4N4OB 3G1LA 2PMUA 3ASNH 3DPLC 2G7HA 3TDZC 3CESA 1SD6A 4BUPA 5M5YJ 2RV8A 3M4OJ 2V7FA 2L02A 4GYGA 2LDUA 3MZ8A 1FIPA 5JFRA 1D1CA 3KE2A 5HOOA 5CQGA 1SD4A 4NC8A 3CCQI 1GV2A 3I64A 5GP9A 4BXFA 1CGPA 3DEUA 3BR6A 3J7AY 3M07A 1ERDA 2G7UA 5D6EA 1IUFA 1XGMA 3CMEI 4MQVA 3J80Z 3PIPF 2UZKA 4RGXA 2LTPA 1JUSA 1K7AA 2W1OA 3FZVA 2EBIA 4BQAA 3LQRA 5B3SH 5BQTA 2BYVE 3GTPJ 1P4AA 3D5RC 2X0LA 1WJCA 5F6FA 1MD0A 3I55I 4IHTA 2E34A 4MGRA 3MKYB 3A03A 2DA3A 2FE3A 1YTYA 3TW7A 2P81A 1ON1A 4DYQA 2E1NA 4RGSA 2E2JJ 2A5YB 1UG2A 3C7JA 2V1DA 5L3EA 4I02A 1LJ9A 4HSRA 1WGXA 2FMLA 3VYUB 3L2QA 3VOEA 4L5IA 2VKDA 2WADA 2MSYA 4JOMA 2P5VA 1ZELA 3ABKH 3OL4A 2M87A 3BG5A 3W2VA 3QPLA 3BOQA 3HKZN 1VQMI 4BJTA 2ESNA 2FSWA 3WG9A 1FNNA 4RLQA 1D0XA 4Y33A 2VPRA 1Y0UA 1VF9A 4A5NA 1MDMA 1VQ4I 3BLYA 1TC3C 1H89C 2VKVA 1FOKA 1WRJA 2XAQA 2X1EA 5GPAA 1W5SA 1S72I 3MCZA 2EA4A 2XPUA 2M34A 1HSJA 3PUFA 3S1MJ 2DOAA 4IX7A 4HNVA 2CV0A 4A93J 3HSEA 4N9HA 3T8TA 2HVQA 4Q4ZF 1Z0XA 3CDLA 2AHQA 3SEQA 4ITVA 3IAS2 3JAMK 1I27A 5HVQC 2XB0X 3KEQA 3Q5FA 3IKVA 2ZFUA 3H3ZA 2H27A 1IC8A 1R1VA 1ITYA 2H6BA 2HYJA 1V54H 3N05A 3ZQFA 3DU6A 2HOTA 1ETOA 3LWFA 1FYKA 2KJBA 4HQMA 4XLNF 3ABTA 4EJWA 3HOVJ 2DMQA 1G3SA 1RC9A 3OL3A 4DNCA 2CO5A 3K9TA 1O3QA 1K61A 5K5QA 4BNCA 3LSTA 2LKSA 3MEXA 2KFDA 5GADJ 3OSFA 1RRJA 2X4HA 3K0LA 3D5SC 2VODA 1ZG5A 5LRRA 2XGXA 4NQWB 3V7SA 5B1AH 2GA2A 1VQPI 3PJRA 2FBHA 2KRCA 3ABLH 2DFFA 2XGDA 1KQ8A 2F5DA 5JHFA 4BE1A 2A69F 3BR0A 4AC0A 5E8IA 3A0BC 4PK4A 1HCRA 3T5XA 3DP7A 2B9SA 4LMYA 4OU0A 5HS8A 1MMNA 3RPUD 2DFHA 3DBRB 3ZMSA 5ICEA 2E36A 5J4YA 1U9NA 4AVZA 1MMDA 4CO8A 1UHWA 3G6EI 1MBGA 3RZOJ 2RREA 4XONA 1VQ9I 1A6IA 1GV5A 3TOAA 4P9UA 3BPVA 4BBSJ 2RAEA 3E6BA 2M8GX 1OYIA 4RLFA 4ENJA 3EUHC 1ETQA 2GM4A 4XRFA 1X2MA 2IAIA 2UXNA 4IVNA 4HLYA 2KKOA 5HLTA 2MH9A 3OYGA 1MNMC 3RQ4A 3DQVC 1LFBA 4DQ2A 4AD9A 3ZN0A 1R4NB 3L2UA 1TL8A 2WA0A 3FXKA 1ZRDA 2D1HA 3M3YJ 3WTVC 2PQ8A 2IGMA 2L4MA 5J8FA 3CMMA 1JI8A 2ZXIA 5BMZA 4CUGA 1K4TA 4M73A 2FBIA 2ZBKA 3WGGA 2XDVA 1RUNA 4Y15A 2V26A 4IPAA 3S1QJ 3DXJF 3ZMUA 2TDXA 3QQAA 4WWCA 4U0YA 1KYWA 3DKXA 3RKQA 4KMFA 3JTGA 5BPDA 1LE8B 1NK3P 3V8LA 1I6XA 4BXUA 3RPQA 1WH7A 2L7FP 3N97A 4OIPF 4N9IA 4EM0B 5FJ8J 2CJJA 2HDCA 4V2GA 4GFBA 1D5YA 2JPBA 5IP9J 1G8XA 1KYZA 3TO7A 5IP6A 1RR7A 3J81Z 4A6EA 4YELA 1TW2A 2P0WA 3FWEA 1DU0A 2CW8A 3NQOA 2M1BA 1ZARA 2WAQA 2O5RA 1P92A 5K1YA 2F4MB 3FHZA 2W24A 3HBLA 4HNTA 1VQ7I 5IY5H 1U5TB 2X48A 3HPGA 3WE3A 3OS1A 3MZYA 2PEXA 1FTTA 2ZNYA 1AKHA 2UV1A 5L3GA 2WWYA 3HRTA 1SEUA 2DTZA 5D4SA 5E3NA 4CSWA 1B72A 2A68F 2ZKZA 2GQQA 1Q1VA 1FMWA 3DPUA 1RESA 2VXZA 5CVUA 1IW7F 3SYTA 3T0YA 4BS9A 5TGTA 1LB2A 2D5VA 4M9XA 1VQ8I 1MMGA 1J2XA 4MTEA 1D1AA 1MSEC 3NRVA 4RMNA 3SZPA 3H5AA 1IV6A 2VE8A 4S04A 4KDPA 1JTYA 4WXDA 4LG0B 2VIXA 2VKHA 1G3YA 3E6MA 1BM9A 5E79C 1UAAA 1XD7A 3E1SA 4ZDPA 5EEHA 2E5NA 2VBYA 4LJZF 1JHHA 4H4KC 4FASD 3FISA 3LSKA 1W5CC 1AA7A 5EG0A 4ZYGA 2VASA 2IGNA 2EQRA 2F6CA 3MQ0A 2R5ZA 3HOWJ 2JSCA 2BGCA 3ABMH 4ZDOA 5GAEJ 3WTUC 5D8KB 2V6CA 1HC8A 3FHNA 4L18B 1EKEA 1SVMA 3KZIC 2F5CA 4RS8A 3ZXSA 4F55A 3Q9VA 1P2FA 1OCTC 2Y0SA 4PJMA 4PUSA 4E7JA 1FP2A 2W85A 3GEZA 5E20A 2LK2A 2RVCA 2X1CA 4EGYA 4P9FA 1QO0D 3OOUA 1B9MA 2PLYA 3Q0WA 1BI1A 3M8JA 4I0AA 5DUKA 4KJZA 4A3LJ 2JTVA 1K6YA 2LSOA 3V8JA 2B63J 1W0UA 2R7WA 3HM5A 2QCOA 5C44J 4WXCA 3K4MA 1VQLI 4WXHA 2ZB9A 1P4XA 5ILUA 3BQYA 2VJ5A 1FT9A 2BW3B 3GTMJ 1WJEA 4HPQA 2P7CB 1IJWC 5E8GA 2GOXB 1U6GA 2R7XA 1ENHA 4HV6A 2WY8Q 5HLGA 3A01A 1XDUA 2ZXHA 4B43A 4PGGA 2E1MC 5C4JJ 3EYYA 2YS9A 5CPRB 1OCZH 2DT7B 4XRSA 2OQRA 4HG2A 2M0CA 2OTJI 3U2RA 3LA7A 1W36D 3PSIA 4XNFA 4XKBA 3MWMA 4OIRF 4HZFA 5FKNA 3CMYA 2R7RA 4ZZLA 2DMUA 1T0FA 2HFHA 4HEA2 2AQFA 3E5XA 1H8AC 2L9SA 3GLLA 2VOPA 4LD5A 5FRMA 1WHUA 4AM3A 4ZH4F 1O7FA 1KONA 3K7AJ 2KZGA 4UB8C 2HKOA 2K3FA 3FMRA 3R60A 4CXFA 3KLOA 5FKKA 3JAMZ 4BDZA 4UUVA 3J80K 2R7UA 1H9TA 5CVVA 3KP2A 1IRZA 4UUSA 1QU3A 1IN7A 3QYEA 4M71A 1YRNA 3WHBA 2HVSA 2ID3A 3IAM2 2KP6A 4PCQA 5EGOB 2EIJH 4X1EA 1JUPA 2XF7A 5J1YA 2FQ3A 2HKXA 4D5CA 4JX6A 3CTAA 1LNWA 4C9YA 4L5EA 4O6JA 3DBLB 1U8RA 1XN7A 4LK1F 2DO7A 3MN2A 2V6EA 1LDJA 3K4NA 3BCBA 2QENA 3E0JB 2NVTJ 4Y13A 1UHMA 2CQXA 2L7KA 5E1ZB 3BQZA 2Z16A 2QYOA 2DT6A 3BG6A 5KVRA 4E7IA 4B47A 3CQZJ 3R4KA 1XSDA 3H0DA 1AHDP 2H8RA 3PUBA 1QVTA 4E70A 3P9CA 3BR1A 2VQHA 5CQEA 1X3UA 2LG4A 6PAXA 2WB1N 1G3TA 1B8IA 1XGOA 3HTSB 2FJ1A 5KK1A 4EATA 1YHQI 1IXCA 4IQJA 1OYYA 1R5HA 1XGSA 1I39A 2MFZA 1HDPA 4CGZA 3HSRA 4CYCA 4YRVA 3M8FA 3GTOJ 1X4PA 4BKXA 4KIBA 2JUCA 3N4MA 1F9NA 3LSJA 4RB0A 3Q9SA 4J01A 4QPOA 4KIGA 1JGGA 1XX5A 5HDKA 2G9WA 1NG6A 4D0PA 9ANTA 1XMKA 2LR8A 1X3ZB 1SFXA 2JVHA 4D1QA 1T38A 3KP6A 1OQYA 4ZC3A 1K78B 5EDNA 2DPDA 1ZR2A 1R7JA 4LLLA 3U1DA 2M45A 1FOYA 4BEHB 1S7AA 4ZDLA 3V4GA 1FTZA 4C3JJ 2R3SA 1ODDA 3K1MA 4MQ9F 4G6QA 4Y17A 2GZWA 4XMYA 4L0YB 2LY2A 1U2WA 1BW5A 3I53A 2L0KA 2EWNA 1BBYA 4GDFA 2Y75A 2GAUA 3JW4A 2DMNA 3KZYA 4A3DJ 2DODA 1JUMA 1HDDC 1IRFA 1OLTA 3L7WA 5DM6F 2DFEA 3V42A 3ULQB 2K4JA 3AL0C 5FD5A 3SDBA 3FXMA 4CCKA 4Y7NJ 2QQAA 3F72A 2KDZA 4DW6A 3WHCA 2QWWA 1J5YA 1N78A 4I2OA 2MYSA 5DTDA 3NEUA 4CYDA 2Q2EB 1Y6IA 2ADUA 4Y4RA 2K4BA 1B59A 2XROA 1T08B 2COBA 5HODA 2CV2A 4U0VA 5JLWA 2HVRA 2FU4A 1YS6A 4LGWA 2GWRA 3WU0A 3G73A 3CUQC 1TWAJ 2JA2A 1USSA 1Z1DA 4UUTA 3ZMZA 3GVAA 4OAYA 3RQIA 2V79A 3HRSA 1WQ2A 3QOPA 3K69A 1W7PA 1Z6RA 2EZLA 2H6CA 2MH2A 2BEOA 4MEXF 2FX0A 3W6KB 5H2FC 3ONQA 1BC7C 3S16J 2VJJA 4B1RA 1OFCX 3BZCA 3OMYA 4BBRJ 3B6CA 2LBFA 2L9VA 1GVJA 4EV0A 2HEOA 1QZEA 1XSXA 2ECCA 1WJDA 1TTYA 2ZSHB 2K9LA 2DTRA 4OIQF 3I4NJ 3V7RA 3G4SI 1U3EM 4B3AA 4EMSA 4F3QA 1R71A 4G6DA 3OV8A 4X0GA 4CZZA 1DP3A 2HWVA 3UR3C 4H0EA 4Y3OA 3RYPA 1ZKGA 4AU7A 4LLNA 2YX4A 1X1DA 2CH0A 1J0RA 5ICGA 3CUQA 3FXUA 5LLQA 3ECOA 3OYDA 4HRIA 4II3A 1CF7A 1XDSA 4JP0A 3QPHA 5B5EC 2R93J 1D8JA 3BJ6A 3D0SA 1YW7A 3LMMA 1KZHA 1ZH5A 3M1EA 3LSMA 5DS9A 2QA4I 1LFPA 2IA1A 4KA4A 2R0QC 1T2KA 3I3LA 1IAWA 3JTHA 3OSGA 3PQJA 3G2BA 1TZLA 2Z99A 3GX4X 1JJ8C 5LGTA 5LEJA 1NH3A 1TWHJ 2LYCA 4RGRA 4MNUA 1S7EA 3IUOA 5DCMB 5LHGA 1PP7U 3WTTC 3BCAA 3NWTA 1J59A 4RM3A 5K7HA 4HX8A 4A0YA 1XS9A 3LL7A 2L3DA 1R5GA 4OWRB 2WY7Q 4NC6A 5HNFA 2FNAA 2R7QA 2P8TA 4G9YA 1ZR4A 3HOUJ 3SEZA 1JTXA 4YIRX 2QBYA 2VT2A 5AIQA 1KGSA 3VODA 2DK5A 3BG7A 1W0TA 2Y31A 3O6BB 4QWQA 3MZHA 1DP7P 4G8XA 3M1CA 1H9GA 4HYEA 5F04A 1UJ8A 3GMEA 2XAUA 1BR2A 3GBGA 3L2WA 4R8HA 1LVAA 4BXXJ 1PJRA 3AG3H 4RAFA 2QGUA 2HZTA 3ERED 2AXLA 2O8KA 2RN7A 3SHFA 1V3FA 2LC2A 2CUZA 3D1NI 1OKRA 1YW9A 2DYRH 3OIQA 5D5XB 2DFIA 4ENKA 2ZSIB 5E17F 3BJOA 2VN2A 4ZYEA 2K40A 3F8CA 4KUMA 4XOTA 3ZGKA 5ED4A 3AG1H 1ULYA 4Z2YA 4A69C 3RKYA 4FE4A 3OYJA 4BHCA 2HU9A 1LPQA 1YFHA 2VQCA 2HQAA 2XAHA 5E3OA 3L00A 1FLIA 2DQLA 1UZCA 5LHIA 2DLLA 5GTHC 3FBNB 2MD0A 1W4MA 3ISPA 5FB2A 2KLOA 3HJEA 1GXQA 1FPQA 1LVKA 4BU2A 2VI6A 1G3WA 3HOTA 4A3GJ 1EA3A 4A3JJ 2M7AA 1GVDA 5HLIA 2QF7A 2X6XA 4UV8A 2LVSA 3ZQGA 5M5XJ 3CP2A 1ZGAA 4JX4A 1K83J 3I59B 4NDLA 1MJ9A 2M3AA 5D5VB 1A5JA 3ESWB 3HRUA 2NS7A 4L9JA 4A3FJ 1N77A 1WPKA 2LMDA 4BL0B 2JA5J 2VC0A 3KEYA 4XR6A 2DDAA 1JGSA 2XAJA 1I1SA 4DJAA 4M72A 1N75A 4GO1A 3IC7A 1XCBA 3C3WA 4P5OA 5CJ9A 4XQFA 3KETA 2D2WA 2FD5A 3ZQQA 3R0JA 4HAMA 2Y48A 4KYWA 4A3BJ 4EJVA 2HOAA 1DU6A 3BPXA 4ZJZA 1ETKA 5BOXA 2A61A 4DYCA 3I58A 2OAZA 5LBQA 1FYMA 2EZHA 1FMVA 2IRFG 3KYDB 4FHTA 4E7LA 1T8IA 4OOIA 2B0LA 1WI3A 1TQPA 3FKIJ 2IW5A 3QP5A 3TMOA 2COMA 2LOOA 2Z2SB 2VXDA 1JJ6C 2L4AA 1U5TC 1Z67A 3DF8A 3GFMA 5GAHJ 1IRGA 2L5QA 3PFIA 2EPFA 2EB7A 2ECBA 3E7LA 3RIRA 2K9MA 1IZ1A 2W25A 3W6VA 3DFGA 3GFLA 4A2UA 1XMXA 3IL2A 1Q1HA 3E5QA 2QSHX 1OCOH 2A6TA 4LB5A 2A5WA 4OINF 2XASA 1PDNC 1PYVA 4M3BA 2EIMH 4ZTJA 3IH4A 1LE8A 3FDYA 2X9DA 3AAFA 1O7LA 3F3XA 5K5OA 3AG2H 3ZRGA 3I4PA 2QKLB 3KP3A 2GXBA 3QYBA 2R7SA 2FOWA 2M9HA 4A6DA 3H0GJ 4CA0A 2Z9OA 2GXAA 3CC2I 1HKSA 4O3MA 2OZ6A 4IKFA 4MHGA 3F6VA 1U5TA 4ZTFA 1YQAA 2BVMA 2K9QA 2FQ4A 4XKVA 2ZJQF 3KIOA 4BY7J 2XGCA 3PO2J 4ZZDA 1QA6A 1X1AA 4C2UA 2R7VA 5FD6A 3C2BA 3GZNB 1YX5A 4XORA 1FC3A 4V2FA 5FKMA 1OJLA 4M6YA 3H9QA 4CCOA 3EUKL 3GUDA 3GTJJ 3VDXA 1C0WA 3KYCB 4DYRA 3HKZA 4ANJA 2O7OA 4HOBA 3ABUA 4IOAF 2NYXA 1Z21A 2E35A 3JR9A 3BZ6A 1QGPA 2VL8A 2WAQN 2KDOA 2E7XA 2DA2A 4RB3C 2DMTA 4BGDA 3JRIA 3CF2A 3C2GA 2RKHA 3OYMA 3JRBA 1HKQA 1REPC 1E3PA 2EV0A 4KISA 2YR2A 1UB9A 4LB6B 1IN8A 1PUFA 1OYWA 4YIIA 2VBXA 4A3MJ 4AIDA 2XKPA 4LG0A 4ENNA 1Z7UA 3QAHA 2E60A 4IJAA 2O03A 4L9VA 1RI7A 4P55A 2DW4A 4M6VA 3CCJI 3K70D 3ZQCA 3V8KA 3R61A 2BHZA 3KYLA 3OYCA 4XRSG 5HLHA 1BOAA 3K2ZA 4ASNA 3GTKJ 2X1DA 1JT6A 3CF5F 4FCYA 1X2NA 2XRLA 3BTIA 3HXLA 5F1RA 1MDMB 3S3MA 1VQ5I 3IH3A 3G71I 1F36A 3PNYA 1W7PD 2K9NA 2M4KA 3HYIA 2IVMA 5E18F 3QU6A 2OF7A 4IHVA 1B6AA 1JE8A 1HOMA 1ACIA 1KQ9A 1WFXA 3FXOA 3HRMA 4IL6C 4JK1X 3EUHA 1MJBA 1FY7A 2ETHA 1ZGWA 3BR2A 2NRAC 5ILSA 2D45A 3KPHA 5FLVA 4WK8F 2LY9A 3P5JA 2NOGA 3OYEA 4S0HB 5BNGA 5E3LA 3WGIA 5D8LB 2BOLA 1MBJA 2BY2A 1K6OA 2Y0SN 4MIMA 2XHKA 1JKQC 4PJNA 4DBQA 2BXZA 2LY1A 3F8FA 2KL4A 2ME0A 4F7ZA 3I5UA 2V9KA 4F52A 2R92J 2DCEA 4CZCA 2BY0A 4BYYA 1MSFC 2XSDC 2ELHA 3ZQ7A 1TLHB 3A0HC 2ELKA 2QQBA 4XLAA 5L3FA 1S9HA 1LDDA 3H36A 2OQGA 5J47A 2HXOA 1L3LA 4NNJA 2YX7A 2IPQX 4NB5A 2EA2A 1ZRFA 4GCVA 3NWSA 1MBFA 5H6QA 4FE7A 3W3CA 3L09A 3DBHB 2R7TA 2Z33A 4I6ZA 1H88C 3M9AA 3QODA 1IN4A 2P6TA 2M0MA 2LRDA 2EIKH 3FXJA 1R22A 2XVCA 3ERMA 5L3CA 3LAJA 2ACJA 2M8EA 4BJ5C 2QUFA 1NK2P 2DA6A 3ML6A 1AWCA 4AVPA 5M3FJ 4FTHA 1S8NA 2FA5A 1F5TA 1XMAA 5D5WB 2E1OA 3BTLA 5D6FA 2EV6A 2DU9A 1W5TA 1UHSA 2MLGA 2FF4A 2O8XA 2O9LA 1MH4A 4IF4A 5HS9A 1BOBA 1T33A 5FFZA 3RCOA 1ZG3A 5GTIC 5TJJA 2CUFA 2TRTA 4IO9F 3CLOA 2QVOA 1FBUA 3LQQA 1TNTA 2X6YA 1KU9A 1T56A 2DJIA 2CWEA 3S32A 1QBJA 2UWMA 3ZPLA 4RM2A 1YJNI 2EJRA 2H8WA 2V1XA 4ESFA 2A07F 3PM1A 3WTSC 4IHYA 1T39A 4HA8A 3HUGA 2YUSA 2C6YA 1XCVA 2Z5UA 4M9ZA 2HQNA 1SVLA 2VJ4A 4KT5C 4OMZA 4ZYAA 4EJUA 3CD6I 3CC7I 2DK8A 4LG3A 3F22A 1K78A 2XGEA 4V19K 1QHGA 3CJNA 2OPTA 2GIVA 3HC7A 2ZJ2A 2OCEA 4HNUA 3EPZA 2RDPA 2HYGD 4B3XA 3HOXJ 2PMZA 3MMYB 4A5MA 3SDGA 2OU2A 2P6SA 3LSIA 1B72B 3PO3J 5FROA 4I98B 2IBDA 1D5VA 1LUJB 1R9TJ 1EH8A 3D5LA 2WC2A 4XICA 1M1EB
chains in the Genus database with same CATH topology
2OC6A 3DKYA 2W82A 4HSRA 1WJDA 3HL2A 4XN0A 2ZSHB 2K9LA 4XM3A 3VYUB 3L2QA 4IZZA 2WAEA 2BW3A 2VKDA 2WADA 4JOMA 3W2AA 3OYAA 4F3QA 3TBIA 1ZELA 3OL4A 2W4SA 4X0GA 1DP3A 3UR3C 3W2VA 4Y3OA 4PSXA 2LH9A 4E7HA 4AU7A 4BJTA 4MLOA 4NUBA 1X1DA 2CH0A 2F4IA 2PJRA 4RLQA 1D0XA 3HG9A 4Y33A 3OYDA 4E6KG 4HRIA 2RQQA 4II3A 3BLYA 3LMMA 4XOPA 3LSMA 2X1EA 1LFPA 3I3LA 2K5CA 2VLAA 4PJJA 2DOAA 4IX7A 2CV0A 3G2BA 1TZLA 1SAUA 2HVQA 2F5VA 3SEQA 4ITVA 1QHHD 3IAS2 2LYCA 4U7BA 5HVQC 2I8DA 2X6WA 3IUOA 2M4GA 4BQOA 3OY9A 3BCAA 2ZFUA 3NWTA 4RM3A 5LD2C 1YX3A 3N05A 3PL8A 3DU6A 2L2OA 3LL7A 3K4JA 4OWRB 2WY7Q 3OL3A 5HNFA 2R7QA 4KT6A 3SEZA 5FRNA 1P9QC 3MKZA 3D5SC 3FKJA 3BG7A 1J09A 1Z7LA 3OWTA 4NQWB 1V5EA 3PJRA 3OS2A 3MD2A 4BACA 2KRCA 3M1CA 3K10A 2E5ZA 2XAUA 1BR2A 3CP8A 3GBGA 3L2WA 5JHFA 4BE1A 1PJRA 2GOMA 4XL9A 4PK4A 3CZ6A 3L2RA 1MMNA 3RPUD 2LC2A 5CKTA 2CUZA 2IXSA 4CCLA 4AVZA 2CUJA 3OIQA 2OUMA 1MMDA 2ZSIB 4XOTA 3ZGKA 2RREA 4XONA 1T0FC 2VQLA 3PNVA 3VWBA 3OYJA 2X85A 4RLFA 2IS2A 2IGOA 3EUHC 3S93A 2HU9A 2VQCA 2HQAA 5HLTA 3QYFA 3OYGA 3RQ4A 3DQVC 4BDYA 1X1BA 1D0YA 3FBNB 3L2UA 2MD0A 3PSFA 2WA0A 4BEHA 2XC7A 2KLOA 2IGMA 2X51A 4D9JA 1LVKA 2Q1ZB 4BU2A 2K3PA 3DLAA 3CMMA 1JI8A 3HOTA 2ZXIA 1EA3A 4AYBA 2M7AA 4CUGA 2X6XA 4F92B 2XDVA 4PFPA 2V26A 3S8PA 3H35A 3CP2A 3DKXA 2M3AA 3LSHA 1N77A 3OYNA 4BL0B 3KEYA 3A1YA 2L9NA 3DTIA 4XR6A 4DJAA 3IP4B 1N75A 2R7OA 4BQQA 1G8XA 3OYBA 4P5OA 2OV7A 4XQFA 4YELA 3ZQQA 3S3NA 4BE0A 4ZJZA 1MMAA 2P0WA 4PJLA 2CW8A 4BQNA 4PFOA 1NG7A 2O5RA 4XLHA 2WAQA 1UG0A 3VSLA 1MW7A 1FMVA 4QPQA 4HNTA 2FUG2 2VJIA 3K4BA 4CCMA 4E7LA 3HPGA 3OS1A 4BJ6C 1MNDA 2HDWA 3TMOA 3VYRB 2LOOA 2Z2SB 2HZDA 2UV1A 2VXDA 3RTRA 4C2TA 2L5QA 3OS0A 4U87A 1D1BA 4CSWA 2HPMA 2K9MA 3DPUA 1FMWA 1OR7C 2A6TA 2A5WA 2CMPA 2Z1DA 2XF5A 2VXZA 1WJAA 3U21A 3SYTA 2KQRA 1PYVA 3L2VA 4J00A 4ZTJA 4BS9A 5TGTA 3FDYA 4E4HA 3SZGA 4OAZA 1MMGA 1BR1A 1D1AA 4PSWA 3ZRGA 4RMNA 3H5AA 2IGKA 2QKLB 2KPMA 3BC8A 3DEEA 3QYBA 2VIXA 3ZR8X 2VKHA 1UAAA 2V1NA 3HOSA 5LFAA 3E1SA 2JUGA 2R7SA 4XKWA 4ZDPA 3OYKA 2E5NA 3W2WA 4DBRA 5KCMA 4H4KC 4CA0A 4FASD 2JSPA 2M7BA 2VQGA 3LSKA 2WAFA 1AA7A 2VASA 2IGNA 3HUGB 4IKFA 2CV1A 2F6CA 3RSNA 5KHDA 4ZTFA 4ZDOA 2BVMA 4XKVA 1Z3XA 4XN3A 4DIQA 1X1AA 4C2UA 2R7VA 3HPHA 4XORA 3K70C 1TT0A 1YX5A 3FHNA 3H9QA 3ZXSA 4CCOA 3EUKL 4F55A 1E0EA 2IS6A 4CCNA 3VDXA 2Y0SA 4PJMA 4PUSA 4E7JA 2KHMA 4B44A 2ELJA 3HKZA 4ANJA 2X1CA 3A2KA 2LREA 2HNHA 3OOUA 1Z21A 2XSJC 2VL8A 2KDOA 3M8JA 4LIVA 4P1WA 4KJZA 3CJQB 4BGDA 1MNEA 1YE9A 1K6YA 3AL0B 2JVGA 3CF2A 3C2GA 4N4NB 3OYMA 2R7WA 3UNGC 2CFOA 4LIUA 3OYLA 3K4MA 4KISA 2VJ5A 1SFKA 2BW3B 2IS4A 1WJEA 4HPQA 4G6TB 1WJFA 2E60A 5HNHA 3C2HA 3QOEA 2E1MB 2R4GA 3K70D 2GOXB 4HSTA 1GLNA 2WB1A 3KYLA 2R7XA 3OYCA 2WY8Q 3FBIB 3OR2C 2PJRB 4B43A 2ZXHA 2X1DA 5KNLA 2E1MC 3K6GA 2AQEA 3HXLA 5CPRB 3S3MA 2DT7B 2IS1A 4HG2A 4E7KA 3PNYA 3OR1C 3AKZA 2M4KA 1W36D 3PSIA 4XNFA 4XKBA 2R7RA 3DTKA 4HEA2 1WFXA 2AQFA 3H9GA 2L9SA 1LDKB 1X1CA 5FRMA 1VZ0A 4BE2A 1KONA 3PNTA 3A4CA 1HA8A 3DU5A 4BDZA 2XF6A 2CW7A 3ZCOA 4R79A 2R7UA 3OYIA 2NOJB 1LKXA 4XLCA 1QU3A 3VYTB 3QYEA 2BVLA 2WBMA 3OYEA 4IQ4A 2HVSA 3IAM2 2KP6A 2BOLA 3I9V2 2XF7A 3H5NA 4PJNA 4XLEA 4DBQA 2MABA 3EUAA 4DGWB 2LY1A 4C9YA 2KL4A 4XKCA 1UELB 2V6EA 2V9KA 3TL4X 4F52A 4E7ZA 2DCEA 4CZCA 3K4NA 4FETA 3BCBA 4GRIA 3E0JB 2UUZA 2L7KA 3S3OA 4XLAA 3OYFA 1S9HA 2Z16A 2DT6A 3BG6A 4E7IA 4B47A 2KZVA 3H0DA 3OIPA 1R6RA 3DPTA 3PUBA 4NNJA 3AFHA 4C30A 4B48A 3H9JA 2VQHA 3NWSA 5CQEA 3W3CA 1WJ5A 2LG4A 3VYSB 3DWLE 3KX2A 4EATA 2R7TA 4CH7A 4IQJA 1V5GA 4E7SA 3QODA 2MFZA 1IRXA 3LSGA 4YRVA 1X4PA 2M0MA 2LRDA 1Y56A 1X4OA 3F9KA 4J01A 4QPOA 4BJ5C 3VSKA 2V4JC 1NG6A 1V5FA 4D1QA 2JVHA 2KMUA 4ZC3A 2RNGA 1BR4A 4BEHB 4ZDLA 4XLFA 1Z3YA 4F91B 4XMYA 2LY2A 3DTEA 4DOZA 2HPIA 1BOBA 3OYHA 1W36C 2LBFB 1T95A 1X19A 2QKMB 3RCOA 4II2A 2W7NA 2KRHA 2VB6A 2DXIA 3CJRB 3PFYA 1OLTA 4CCJA 4JQFA 2X6YA 3K4LA 3V42A 3MKWB 2DJIA 4N4OB 3AL0C 3S32A 3DPLC 4BUPA 3CESA 3SDBA 4CCKA 2UWMA 2V7FA 4RM2A 1D1CA 1G59A 5HOOA 1N78A 5CQGA 4NC8A 2MYSA 3K4KA 2W00A 4NC7A 4BXFA 2Q2EB 4YEJA 1Y6IA 2MC4A 4Y4RA 3J7AY 2CS3A 1ERDA 1D0ZA 3K4CA 2VJ4A 4ZYAA 2CV2A 2HVRA 4F93B 4LG3A 1DGWY 1DQUA 3LFUA 2JA2A 1QHGA 1WJBA 3HC7A 2W1OA 4HNUA 3EPZA 4B3XA 2PMZA 4OAYA 3MMYB 3D5RC 3LSIA 1DGRM 1WJCA 5FROA 3ONQA 3MKYB 3H5RA 2VJJA 2VPLA 1U0JA 3OMYA 3D5LA 2LBFA 4LITA 4KITB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNT A;  4KT6 A; 
#chains in the Genus database with same CATH topology
 2DA1 A;  3DKY A;  1BN5 A;  1ZYR F;  2W82 A;  3LA3 A;  5ERI A;  3SZT A;  4XN0 A;  4XM3 A;  5LHH A;  2VBW A;  5CLS A;  4MFD A;  5IOZ A;  3W2A A;  4L9N A;  2OA4 A;  3OYA A;  3FK7 A;  3TBI A;  3LFK A;  2QLZ A;  1YJ9 I;  1WKM A;  2VOO A;  4E7H A;  4U7D A;  2BY1 A;  2F4I A;  2CU7 A;  2Q2E A;  2PJR A;  1BI3 A;  2F5E A;  2ISY A;  1SMY F;  3HG9 A;  4RAY A;  5JVT A;  3KFW X;  2RQQ A;  5EG0 B;  4C2M J;  2L7M P;  2JT1 A;  2DBB A;  1MGT A;  4KMU X;  2EH3 A;  2K5C A;  3QPT A;  4PJJ A;  1YO5 C;  4Q48 A;  1L0O C;  4A12 A;  3HZJ A;  5K7F A;  3P9K A;  2VC1 A;  1SD7 A;  3RDI A;  2ISZ A;  3FX3 A;  5L3D A;  3VFZ A;  4BY1 J;  4HF2 A;  2GLO A;  2NNY A;  5FKO A;  1Z6T A;  2I8D A;  2X6W A;  5GPC A;  4Q5S F;  4G12 A;  1RPW A;  2MA3 A;  4MEY F;  3GCM A;  3OY9 A;  4FQG A;  1Z77 A;  2W57 A;  4UHT A;  1ZAO A;  1HW2 A;  1FSH A;  2RGV A;  2H1L A;  3CO6 C;  5AIP A;  5IP7 J;  4BHP A;  4KT6 A;  5C3E J;  2EIL H;  1P9Q C;  5JR3 A;  4A0Z A;  4G7O F;  1BIB A;  1J09 A;  3ZN1 A;  1MBH A;  2EZK A;  3OS2 A;  1EH6 A;  1QPM A;  1YLF A;  4BAC A;  3K10 A;  2NNN A;  2OBP A;  5EZG A;  2E5Z A;  2L01 A;  3CP8 A;  2ZME B;  4UV9 A;  3A01 B;  1Z91 A;  3S2H J;  1ZHF A;  2AXT C;  3FXR A;  2F5F A;  2DQR A;  4UNO A;  1UMQ A;  3RZD J;  1S29 A;  3IHU A;  1WSU A;  1R23 A;  3KP7 A;  3DCF A;  2GA1 A;  2CQQ A;  2VBZ A;  2HQ5 A;  2KIF A;  2RC4 A;  3ZQH A;  5ILV A;  4CCL A;  3FMS A;  3HOY J;  5FKL A;  2OUM A;  1BJA A;  3TKY A;  2HYF A;  1IF1 A;  4K2E A;  2VQL A;  1P4W A;  1YIO A;  1VQK I;  5J3L A;  2MLK A;  5J4V A;  3SXY A;  3CUO A;  4YG2 F;  5F0F A;  1ONV A;  1U9O A;  5JHU A;  3QYF A;  1YRN B;  2NVX J;  4DZP A;  4PDK A;  4UY8 I;  3PSF A;  3KCC A;  2HOS A;  5EEA A;  1BIA A;  1D8K A;  2V1U A;  3DEW A;  4KFC A;  2X51 A;  4D9J A;  2A6H F;  1XGN A;  3IWF A;  3RKW A;  1ZG1 A;  1VQ6 I;  2M2E A;  3S15 J;  4AYB A;  1TP4 A;  1YG2 A;  4M3G A;  4F92 B;  1VQN I;  3C18 A;  3S8P A;  3QRF F;  1ORK A;  2HQR A;  2AS5 F;  3X2Q H;  3NAU A;  3DLL F;  3AG4 H;  3OYN A;  2HS5 A;  2FOK A;  5DEQ A;  1A31 A;  3CCR I;  3A1Y A;  4JBA A;  3DTI A;  3VPR A;  2VT3 A;  1TW3 A;  2CGP A;  4XBF A;  3HGY A;  3L9F A;  1YJW I;  2EV5 A;  5K7Z A;  4G94 A;  4UXN A;  3FF5 A;  3TP0 A;  4WCG A;  4B8X A;  3OYB A;  1SFO J;  4HDU A;  1IN5 A;  2OV7 A;  2XKO A;  3Q0U A;  2V9P A;  4BE0 A;  1X3W B;  2EZI A;  4CYC B;  3BZK A;  1MMA A;  4P96 A;  3ROU A;  3CCE I;  5B1B H;  3R6S A;  4L5J A;  4ABZ A;  1NG7 A;  2DT5 A;  3C1D A;  1ETW A;  1UG0 A;  2LNB A;  3ELK A;  4XLH A;  1MW7 A;  4QPQ A;  2JN6 A;  2MGQ A;  3WU2 C;  4CCM A;  1MND A;  2FRH A;  1SAN A;  3FXL A;  1Y1W J;  4IOC F;  1E3O C;  3V7C A;  5EF6 A;  3CDH A;  1J9I A;  2KIS A;  1U8B A;  3BDD A;  3OS0 A;  4I09 A;  2R7F A;  1Y0N A;  1OR7 C;  2JJ7 A;  3GW2 A;  2HDD A;  2H94 A;  2XF5 A;  2QEX I;  3S1R J;  2KQR A;  1IG7 A;  3L2V A;  4D7N A;  4J00 A;  4IRG A;  3QP6 A;  2E71 A;  2Q8K A;  4E4H A;  2O61 A;  1ZLJ A;  3HIF A;  3O2P E;  4OAZ A;  1VFC A;  3L2C A;  1BR1 A;  1EF4 A;  2Y30 A;  4PSW A;  2HOE A;  1GUU A;  3HEF A;  5EJC A;  1ZQ3 P;  1I3Q J;  2KPM A;  2XAG A;  3I71 A;  3DEE A;  4BHB A;  1RIO H;  5LFA A;  2JUG A;  2J5O A;  4XKW A;  3OYK A;  3W2W A;  1EJ9 A;  5HDG A;  2PG4 A;  2DJN A;  1V55 H;  4XLP F;  2VQG A;  1OMI A;  1TQM A;  4J19 A;  1S3J A;  4HX4 A;  1R4M B;  5H20 A;  4PGH A;  4HQE A;  2P5K A;  2FXA A;  5D5U B;  2KIU A;  3ZMV A;  3WTY C;  2WV0 A;  5KHD A;  5F64 A;  3QU3 A;  1Z3X A;  2OZU A;  1JHF A;  4DIQ A;  4AIJ A;  1MBK A;  2NVY J;  2XUB A;  4AIH A;  1OPC A;  2DAO A;  1MMS A;  5IT9 Z;  1BC8 C;  1OR7 A;  3S14 J;  5HDN A;  3ECH A;  2VON A;  2R5Y B;  2IS6 A;  4EJT A;  1E0E A;  4L9T A;  3U9G A;  2OJE D;  1X1P A;  1V4R A;  3VEP A;  1YW8 A;  2KHM A;  1SC7 A;  2XIG A;  4XSZ F;  2LRE A;  1YI2 I;  4EM1 A;  5DV5 A;  2HNH A;  1IV8 A;  1G2H A;  1OIS A;  4P1W A;  4EEF G;  3F8B A;  1MNE A;  1VI0 A;  1QVU A;  4IHX A;  2JVG A;  3AL0 B;  2K85 A;  3UNG C;  2CFO A;  4LIU A;  1MZB A;  3K1P A;  4FT8 A;  1TBX A;  2E2I J;  3T1B A;  4I01 A;  1FOX A;  1SFK A;  3CCM I;  4HDV A;  1R5I D;  3WGH A;  1B1B A;  3GTL J;  2XRN A;  1WJF A;  4RDU A;  5DD8 A;  3C2H A;  3QOE A;  4QTR A;  4NQW A;  4RB1 A;  1A36 A;  1KQ0 A;  4HST A;  1GLN A;  3RJP A;  4O5V A;  1PP8 F;  3CUQ B;  5KNL A;  4ESB A;  3JCU C;  3RI4 A;  2OD5 A;  3K6G A;  1P6R A;  3M8E A;  3BT9 A;  4JX5 A;  1CF7 B;  3EYI A;  2IA0 A;  5LGU A;  2QSF X;  3GWZ A;  2VE9 A;  2IS1 A;  3P9I A;  4HLX A;  4QLC U;  5DUI A;  1OCC H;  2MW8 A;  2CUE A;  5A2Q Z;  2JK3 A;  3BJA A;  3H9G A;  3REO A;  3E6C C;  3JRD A;  1WZ2 A;  2FNP A;  3KP4 A;  2ZJR F;  4BE2 A;  3TOB A;  3TDU C;  5FFX A;  3WE2 A;  3PNT A;  1VQO I;  4XID A;  2CG4 A;  3A4C A;  5F08 A;  1HA8 A;  1I6H J;  1UFM A;  2EK5 A;  2XF6 A;  4R79 A;  1QNT A;  3ZCO A;  3OYI A;  3P7N A;  1LKX A;  4XLC A;  3VYT B;  2WBM A;  3GTG J;  4IQ4 A;  4OIO F;  2FMY A;  3MFK A;  2CQN A;  5EZH A;  1HBX G;  1WH5 A;  3I9V 2;  1TNS A;  4C3H J;  2IT0 A;  4IRH A;  3H3V K;  1WI9 A;  1ETX A;  3ZQI A;  5BS6 A;  2QBY B;  3H5N A;  2CSO A;  2L7Z A;  3EUA A;  1Y8R B;  2LF7 A;  4XKC A;  2LF8 A;  2X6O A;  1UEL B;  5M5W J;  2PI0 A;  4E7Z A;  1IDZ A;  1FOW A;  4FET A;  3LA2 A;  2K9S A;  2CQK A;  2HTS A;  4HBL A;  4KIC A;  3OYF A;  2CYY A;  4S05 A;  1XC5 A;  3DPT A;  2BZT A;  3GTQ J;  1DPU A;  4C30 A;  3B02 A;  5FGM A;  1G6N A;  2JRT A;  2M30 A;  3TW6 A;  1T98 A;  2ZJP F;  4MO7 A;  2DMP A;  1HW5 A;  1YYV A;  3O8G A;  4A0X A;  2QQ9 A;  1DPR A;  4C3I J;  2ZNZ A;  3FM5 A;  4CH7 A;  1R49 A;  2P7V B;  1H0M A;  4E7S A;  5ICC A;  5J1U A;  4Z6Y A;  3TED A;  1IRX A;  1KU3 A;  5TIS C;  1WWX A;  5J1R A;  5L3B A;  1GT0 C;  1X58 A;  3F9K A;  2QM3 A;  5F27 A;  2V4J C;  1RUO A;  3G1O A;  1HXD A;  1R1U A;  4M9S A;  2KMU A;  3RKX A;  2RNG A;  1HW1 A;  3S2W A;  1BR4 A;  1YOV B;  3ZMD A;  2JA7 J;  1O3T A;  1IN6 A;  1HST A;  2IJL A;  3BTC A;  2KT0 A;  3W6J B;  4F91 B;  3WG7 H;  2O6G E;  1R00 A;  1JKO C;  3DTE A;  3HHG A;  5E1X A;  1KU2 A;  5IT3 A;  2HPI A;  3HOZ J;  4WX9 A;  1TWG J;  3OYH A;  2Y9Z A;  5J8C A;  2DN0 A;  1QZZ A;  3J7Z I;  1T95 A;  1X19 A;  2JMW A;  2QKM B;  3CCV I;  1Y39 A;  2EFQ A;  2W7N A;  2H1K A;  2KRH A;  1O4X A;  2VB6 A;  1O57 A;  2DXI A;  3CJR B;  4KN7 X;  3PFY A;  1BI0 A;  2DYS H;  3F23 A;  4JQF A;  3F21 A;  1ON2 A;  4M6X A;  3K4L A;  5EYR A;  4EVI A;  1LQ1 A;  1PVE A;  2DDB A;  2CQ7 A;  3EET A;  3MKL A;  3PIO F;  2DPU A;  4BAY A;  3LOC A;  1G59 A;  2DA4 A;  2W00 A;  3K4K A;  4NC7 A;  2EIN H;  3BWG A;  4X6A J;  1D3Y A;  3OOP A;  4YEJ A;  1RZ4 A;  2MC4 A;  5FLX Z;  3LAP A;  2O3F A;  3COA C;  1JKR C;  1S5L C;  2CS3 A;  3CDI A;  1O3R A;  1HKT A;  4RAG A;  1E2X A;  1D0Z A;  3K4C A;  1IUY A;  4F93 B;  1DGW Y;  1DQU A;  3E5U A;  2KJC A;  3DKW A;  2HGC A;  3LFU A;  2JA8 J;  2NXN B;  1GXP A;  1WJB A;  3G1M A;  1QZY A;  2L54 A;  1TWC J;  3CC4 I;  3IRQ A;  3H3U A;  3HTU A;  2E2H J;  4KN4 X;  1SMT A;  1IDY A;  3LSR A;  1DGR M;  1FZP B;  2F48 A;  3H5R A;  1ZGJ A;  1AOY A;  5CYV A;  2IEK A;  3SFI A;  1U0J A;  2ZXW H;  2VPL A;  2ZFW A;  2JPC A;  1LEA A;  4LIT A;  3EDP A;  4KIT B;  4GGG A;  2OC6 A;  1Y8Q B;  1ZK8 A;  1A6Q A;  4FIS A;  3BP8 A;  3O8H A;  2J5P A;  3HL2 A;  4UVA A;  1W1W E;  3BR3 A;  4Q47 A;  3F0C A;  3Q0V A;  1SFE A;  3JRC A;  5F0H A;  2WAE A;  2BW3 A;  3IWZ A;  4YFX F;  5JLX A;  4IZZ A;  2L9R A;  1ZLK A;  2W4S A;  4EQQ A;  5DDG A;  2HR3 A;  2ZCW A;  4PSX A;  2LH9 A;  3JRH A;  3GFI A;  4MLO A;  4NUB A;  1XG1 A;  3GF2 A;  5J40 A;  2NAZ A;  1G4D A;  1IO2 A;  1F4K A;  4E6K G;  2ZC2 A;  4LLG F;  4LFU A;  3GO5 A;  4YFN F;  1FIA A;  2XB5 A;  3CO7 C;  3F8M A;  1FJL A;  5IYD J;  4XOP A;  1O3S A;  3H92 A;  4KIF A;  2CFX A;  4A3I J;  2V9V A;  3BR5 A;  4A3E J;  3CMA I;  2VLA A;  1BW6 A;  2QZ8 A;  2CW0 F;  2ZXJ A;  1SAU A;  2EFN A;  2GXG A;  2F5V A;  4M3F A;  1R36 A;  2NS8 A;  4B4C A;  1YIJ I;  1SVO A;  2JZY A;  1QHH D;  4U88 A;  2IP2 A;  2ME6 A;  3H1C A;  1ZN2 A;  1R58 A;  3I54 A;  4U7B A;  4NHJ A;  2K7L A;  1EV7 A;  2M4G A;  1UCR A;  4BQO A;  4IHS A;  1XSV A;  2E19 A;  5LD2 C;  3S2D J;  1YX3 A;  1I50 J;  3FK6 A;  2QQ8 A;  3PL8 A;  2L2O A;  5JI6 A;  3ASO H;  1FP1 D;  3K4J A;  2MBF A;  1CQT A;  4Y52 J;  2LP0 A;  3IRR A;  2YU3 A;  3MAJ A;  5EGO A;  4RBO A;  3I4M J;  4I7H A;  3GFJ A;  3CCL I;  1FBQ A;  1PUF B;  2PMZ N;  3CJT B;  5ICF A;  1NTC A;  5FRN A;  2E1C A;  1UST A;  4TV7 A;  3MKZ A;  2KRF A;  3FKJ A;  1XTA A;  5F0C A;  2EFW A;  1JXS A;  1Z7L A;  3OWT A;  3L1P A;  4ON0 A;  4HF1 A;  4A3C J;  1V5E A;  2GBY A;  3MD2 A;  2STT A;  4CHU A;  1HQC A;  1LEB A;  3TGN A;  2XPV A;  1KU7 A;  5GAG J;  1AU7 A;  3A02 A;  1MH3 A;  3BRO A;  1I3A A;  2GOM A;  2NS0 A;  3I0T A;  4XL9 A;  3IKT A;  4G7H F;  2ZME C;  3CZ6 A;  2I10 A;  2R7D A;  2KIQ A;  1WVR A;  2CRG A;  2MG4 A;  2KIM A;  4N0B A;  3MVP A;  3L2R A;  5TRD A;  1EH7 A;  4CIC A;  3ZP5 A;  5CKT A;  5IYB J;  4G7Z F;  3CCU I;  2IXS A;  1Z05 A;  2CUJ A;  2YSR A;  2DA5 A;  4ENM A;  2YU9 J;  4GXO A;  3FXQ A;  2F2E A;  1SFU A;  4D5F A;  5K5R A;  1T0F C;  4IXA A;  3PNV A;  3UKG A;  3VWB A;  3TP3 A;  1B4A A;  2X85 A;  2G0E A;  3CCY A;  3GZ5 A;  4MFE A;  4XRM A;  4B09 A;  2IGO A;  5BPI A;  2IS2 A;  2XV4 S;  3S93 A;  2JRM A;  1GHC A;  2LKP A;  5E3M A;  5LEK A;  1F1Z A;  3J7A O;  4BDY A;  5IT9 K;  1X1B A;  1D0Y A;  2DOE A;  3GXO A;  1J75 A;  4IHW A;  3K1N A;  1OCP A;  3HGG A;  4BEH A;  1AKH B;  2XC7 A;  5D4R A;  2JQ7 A;  1BA5 A;  2ZO4 A;  1MJA A;  1YIT I;  2Q1Z B;  2LD5 A;  2Y69 H;  2K3P A;  3DLA A;  4CDG A;  3J7Y J;  2ZME A;  1ETY A;  3KLN A;  1VTN C;  2W48 A;  4PFP A;  3JRG A;  1TWF J;  3H35 A;  4GYI A;  4PJ0 C;  1FYL A;  1QPI A;  2EFO A;  4R1H A;  2YPR A;  3BG9 A;  2EFP A;  2TCT A;  5HS7 A;  1FSE A;  3LSH A;  2L9N A;  5FO5 A;  1FWZ A;  5J6X A;  3IP4 B;  1T6S A;  2A6E F;  2R7O A;  4BQQ A;  5JVG F;  1RKW A;  4LOC A;  3EQL F;  3S3N A;  4RGU A;  3U1K A;  4PJL A;  4BQN A;  2I5U A;  4PFO A;  2HTJ A;  2AO9 A;  3VSL A;  4DZJ A;  1Y1V J;  2R5Z B;  2FUG 2;  3BG3 A;  2VJI A;  3E97 A;  3K4B A;  5M3M J;  1IXS B;  1RET A;  4BJ6 C;  5A2Q K;  2HDW A;  1RR8 C;  3VYR B;  4MTD A;  2HZD A;  1STZ A;  3KP5 A;  2PBI A;  4ZYD A;  1S7O A;  1TQI A;  3RTR A;  4C2T A;  3HDD A;  3JSO A;  4W97 A;  1POG A;  3M7G A;  1D1B A;  4U87 A;  2HPM A;  1P7J A;  2BBY A;  1SD5 A;  2DA7 A;  2Z1D A;  2CMP A;  4HW0 A;  1B9N A;  2ICW G;  4QSH A;  5EEG A;  1WJA A;  3U21 A;  4AWX B;  4RB2 C;  2MC3 A;  1NHA A;  1BL0 A;  2NVU B;  3SZG A;  2BY3 A;  1YS7 A;  2M5W A;  2W84 A;  3GLX A;  3FIW A;  2E7W A;  2IGK A;  4KNY A;  3BC8 A;  3ZR8 X;  5B66 C;  4A3K J;  2ID6 A;  1Z9C A;  2V1N A;  4UVB A;  4EM2 A;  3HOS A;  4AYB N;  2RQP A;  1A35 A;  5C4X J;  3LSP A;  4DBR A;  4AIK A;  5KCM A;  5IPA A;  1WCM J;  2JSP A;  2M7B A;  3IH2 A;  4FX4 A;  2WAF A;  4ZYH A;  2B7E A;  4XK4 A;  3HUG B;  1K79 A;  2CV1 A;  3RSN A;  1BJZ A;  2Y9Y A;  5IOY A;  5H6R A;  2K02 A;  3F6O A;  1U78 A;  2PN6 A;  4XN3 A;  1MKM A;  3IV5 A;  3Q3S A;  3HPH A;  3K70 C;  1APL C;  1TT0 A;  4OMY A;  4D7M A;  1E3H A;  4CCN A;  3JRA A;  3E6D A;  2LFB A;  4IEJ A;  2ELJ A;  1ETV A;  3VB2 A;  4B44 A;  2O0Y A;  3RPU A;  3A2K A;  4NBQ A;  3T8R A;  2Y0M A;  5DCM A;  2XSJ C;  3LNQ A;  2K86 A;  2PX9 A;  4LIV A;  3GZ6 A;  4ETS A;  2R7Z J;  1MBE A;  3CJQ B;  1YE9 A;  2Z3Y A;  3HHH A;  4QIW N;  1FEX A;  4N4N B;  1HLV A;  3G3Z A;  1J7K A;  2VUM J;  3OYL A;  2BV6 A;  5CVR A;  1XB4 A;  5DM7 F;  4UUS B;  3CCS I;  1DUX C;  1DDN A;  1N25 A;  3GYH X;  5LGN A;  3JSP A;  3JRF A;  2IS4 A;  2MD5 A;  4G6T B;  5HNH A;  1XPX A;  4I76 A;  5LRS A;  2E1M B;  1ZTR A;  2R4G A;  2WB1 A;  1R1T A;  4BH9 A;  1SAX A;  1VND A;  3FBI B;  3OR2 C;  2PJR B;  2P4W A;  2AQE A;  3R0A A;  5DYM A;  1S6L A;  4HF0 A;  5DCF A;  4ESJ A;  2F4O B;  4UVC A;  4E7K A;  3AKZ A;  2PMH A;  3OR1 C;  3SQN A;  1JKP C;  3FMQ A;  4WF2 A;  3S1N J;  3WOD F;  4EJO A;  2R5Y A;  3DTK A;  5CVI A;  3E3V A;  2A05 A;  5IYC J;  3QWL A;  2BHY A;  1LDK B;  1X1C A;  1VZ0 A;  2P5L C;  3TO6 A;  2Q0O A;  1B8I B;  4XSX F;  5CVJ A;  3RYR A;  4YIF A;  5FLX K;  2A3S A;  2LKX A;  2QSG X;  3WTW C;  1FBS A;  3FM3 A;  5E1W A;  2LLK A;  5FLM J;  4I99 C;  4IRI A;  3DU5 A;  3TQN A;  1I5Z A;  1ZRC A;  5AON A;  2CW7 A;  1I1G A;  2NOJ B;  3PQK A;  1F43 A;  5F1J A;  2BVL A;  3BTJ A;  4U0W A;  1RNL A;  4RAZ A;  1IGN A;  3DV8 A;  4JYK A;  4RA2 A;  1LFU P;  1RKT A;  2DI3 A;  4LK0 F;  4M74 A;  4UB6 C;  2OTL I;  2WTE A;  4XLE A;  2MAB A;  4DGW B;  3ZQL A;  1HF0 A;  2Y2Z A;  5KAF C;  2N8G A;  3TL4 X;  3B73 A;  2DOF A;  4HV5 A;  1FX7 A;  1PUE E;  2GIZ A;  2FEZ A;  1MIJ A;  4GRI A;  4YFK F;  2UUZ A;  1QQI A;  3KZZ A;  1GDT A;  4M3E A;  3I59 A;  3S3O A;  1KA8 A;  1JT0 A;  1ZRE A;  1E17 A;  2KZV A;  2H09 A;  3OIP A;  3WU1 B;  1R6R A;  1IXR C;  1OCR H;  3AFH A;  1A04 A;  4B48 A;  3H9J A;  1BI2 A;  2HXI A;  3WTX C;  3HB9 A;  1WJ5 A;  2WV1 A;  3J81 K;  3I56 I;  2FBK A;  3VYS B;  3DWL E;  3KEO A;  3KX2 A;  3B6A A;  2K27 A;  1V5G A;  3F8N A;  3SJM A;  2OCC H;  3ZOB A;  3WTZ A;  2STW A;  3LSG A;  2BE5 F;  5DD4 A;  3K2A A;  4PZJ A;  1Y56 A;  3O3K A;  4W1U A;  2D1V A;  4EGZ A;  1X4O A;  2NVQ J;  2ESH A;  3ZMT A;  4HX7 A;  2JA6 J;  4M3D A;  2RNJ A;  3VSK A;  4AUX A;  1V5F A;  1QRY A;  1K4S A;  3HSF A;  3BY6 A;  1P7I A;  3QPS A;  3TO9 A;  4XLF A;  1Z3Y A;  1W7P B;  2PJP A;  3JRE A;  1TT5 B;  5KAI C;  4DOZ A;  3NAR A;  2VKE A;  4L0Z B;  2UXX A;  2JWT A;  3SFZ A;  1W36 C;  2LBF B;  4II2 A;  2IA2 A;  2BXY A;  3CLQ A;  2XPW A;  3S17 J;  2XAF A;  4FX0 A;  2PFB A;  2HI3 A;  4CCJ A;  3OIO A;  4I0B A;  3MKW B;  4N4O B;  3G1L A;  2PMU A;  3ASN H;  3DPL C;  2G7H A;  3TDZ C;  3CES A;  1SD6 A;  4BUP A;  5M5Y J;  2RV8 A;  3M4O J;  2V7F A;  2L02 A;  4GYG A;  2LDU A;  3MZ8 A;  1FIP A;  5JFR A;  1D1C A;  3KE2 A;  5HOO A;  5CQG A;  1SD4 A;  4NC8 A;  3CCQ I;  1GV2 A;  3I64 A;  5GP9 A;  4BXF A;  1CGP A;  3DEU A;  3BR6 A;  3J7A Y;  3M07 A;  1ERD A;  2G7U A;  5D6E A;  1IUF A;  1XGM A;  3CME I;  4MQV A;  3J80 Z;  3PIP F;  2UZK A;  4RGX A;  2LTP A;  1JUS A;  1K7A A;  2W1O A;  3FZV A;  2EBI A;  4BQA A;  3LQR A;  5B3S H;  5BQT A;  2BYV E;  3GTP J;  1P4A A;  3D5R C;  2X0L A;  1WJC A;  5F6F A;  1MD0 A;  3I55 I;  4IHT A;  2E34 A;  4MGR A;  3MKY B;  3A03 A;  2DA3 A;  2FE3 A;  1YTY A;  3TW7 A;  2P81 A;  1ON1 A;  4DYQ A;  2E1N A;  4RGS A;  2E2J J;  2A5Y B;  1UG2 A;  3C7J A;  2V1D A;  5L3E A;  4I02 A;  1LJ9 A;  4HSR A;  1WGX A;  2FML A;  3VYU B;  3L2Q A;  3VOE A;  4L5I A;  2VKD A;  2WAD A;  2MSY A;  4JOM A;  2P5V A;  1ZEL A;  3ABK H;  3OL4 A;  2M87 A;  3BG5 A;  3W2V A;  3QPL A;  3BOQ A;  3HKZ N;  1VQM I;  4BJT A;  2ESN A;  2FSW A;  3WG9 A;  1FNN A;  4RLQ A;  1D0X A;  4Y33 A;  2VPR A;  1Y0U A;  1VF9 A;  4A5N A;  1MDM A;  1VQ4 I;  3BLY A;  1TC3 C;  1H89 C;  2VKV A;  1FOK A;  1WRJ A;  2XAQ A;  2X1E A;  5GPA A;  1W5S A;  1S72 I;  3MCZ A;  2EA4 A;  2XPU A;  2M34 A;  1HSJ A;  3PUF A;  3S1M J;  2DOA A;  4IX7 A;  4HNV A;  2CV0 A;  4A93 J;  3HSE A;  4N9H A;  3T8T A;  2HVQ A;  4Q4Z F;  1Z0X A;  3CDL A;  2AHQ A;  3SEQ A;  4ITV A;  3IAS 2;  3JAM K;  1I27 A;  5HVQ C;  2XB0 X;  3KEQ A;  3Q5F A;  3IKV A;  2ZFU A;  3H3Z A;  2H27 A;  1IC8 A;  1R1V A;  1ITY A;  2H6B A;  2HYJ A;  1V54 H;  3N05 A;  3ZQF A;  3DU6 A;  2HOT A;  1ETO A;  3LWF A;  1FYK A;  2KJB A;  4HQM A;  4XLN F;  3ABT A;  4EJW A;  3HOV J;  2DMQ A;  1G3S A;  1RC9 A;  3OL3 A;  4DNC A;  2CO5 A;  3K9T A;  1O3Q A;  1K61 A;  5K5Q A;  4BNC A;  3LST A;  2LKS A;  3MEX A;  2KFD A;  5GAD J;  3OSF A;  1RRJ A;  2X4H A;  3K0L A;  3D5S C;  2VOD A;  1ZG5 A;  5LRR A;  2XGX A;  4NQW B;  3V7S A;  5B1A H;  2GA2 A;  1VQP I;  3PJR A;  2FBH A;  2KRC A;  3ABL H;  2DFF A;  2XGD A;  1KQ8 A;  2F5D A;  5JHF A;  4BE1 A;  2A69 F;  3BR0 A;  4AC0 A;  5E8I A;  3A0B C;  4PK4 A;  1HCR A;  3T5X A;  3DP7 A;  2B9S A;  4LMY A;  4OU0 A;  5HS8 A;  1MMN A;  3RPU D;  2DFH A;  3DBR B;  3ZMS A;  5ICE A;  2E36 A;  5J4Y A;  1U9N A;  4AVZ A;  1MMD A;  4CO8 A;  1UHW A;  3G6E I;  1MBG A;  3RZO J;  2RRE A;  4XON A;  1VQ9 I;  1A6I A;  1GV5 A;  3TOA A;  4P9U A;  3BPV A;  4BBS J;  2RAE A;  3E6B A;  2M8G X;  1OYI A;  4RLF A;  4ENJ A;  3EUH C;  1ETQ A;  2GM4 A;  4XRF A;  1X2M A;  2IAI A;  2UXN A;  4IVN A;  4HLY A;  2KKO A;  5HLT A;  2MH9 A;  3OYG A;  1MNM C;  3RQ4 A;  3DQV C;  1LFB A;  4DQ2 A;  4AD9 A;  3ZN0 A;  1R4N B;  3L2U A;  1TL8 A;  2WA0 A;  3FXK A;  1ZRD A;  2D1H A;  3M3Y J;  3WTV C;  2PQ8 A;  2IGM A;  2L4M A;  5J8F A;  3CMM A;  1JI8 A;  2ZXI A;  5BMZ A;  4CUG A;  1K4T A;  4M73 A;  2FBI A;  2ZBK A;  3WGG A;  2XDV A;  1RUN A;  4Y15 A;  2V26 A;  4IPA A;  3S1Q J;  3DXJ F;  3ZMU A;  2TDX A;  3QQA A;  4WWC A;  4U0Y A;  1KYW A;  3DKX A;  3RKQ A;  4KMF A;  3JTG A;  5BPD A;  1LE8 B;  1NK3 P;  3V8L A;  1I6X A;  4BXU A;  3RPQ A;  1WH7 A;  2L7F P;  3N97 A;  4OIP F;  4N9I A;  4EM0 B;  5FJ8 J;  2CJJ A;  2HDC A;  4V2G A;  4GFB A;  1D5Y A;  2JPB A;  5IP9 J;  1G8X A;  1KYZ A;  3TO7 A;  5IP6 A;  1RR7 A;  3J81 Z;  4A6E A;  4YEL A;  1TW2 A;  2P0W A;  3FWE A;  1DU0 A;  2CW8 A;  3NQO A;  2M1B A;  1ZAR A;  2WAQ A;  2O5R A;  1P92 A;  5K1Y A;  2F4M B;  3FHZ A;  2W24 A;  3HBL A;  4HNT A;  1VQ7 I;  5IY5 H;  1U5T B;  2X48 A;  3HPG A;  3WE3 A;  3OS1 A;  3MZY A;  2PEX A;  1FTT A;  2ZNY A;  1AKH A;  2UV1 A;  5L3G A;  2WWY A;  3HRT A;  1SEU A;  2DTZ A;  5D4S A;  5E3N A;  4CSW A;  1B72 A;  2A68 F;  2ZKZ A;  2GQQ A;  1Q1V A;  1FMW A;  3DPU A;  1RES A;  2VXZ A;  5CVU A;  1IW7 F;  3SYT A;  3T0Y A;  4BS9 A;  5TGT A;  1LB2 A;  2D5V A;  4M9X A;  1VQ8 I;  1MMG A;  1J2X A;  4MTE A;  1D1A A;  1MSE C;  3NRV A;  4RMN A;  3SZP A;  3H5A A;  1IV6 A;  2VE8 A;  4S04 A;  4KDP A;  1JTY A;  4WXD A;  4LG0 B;  2VIX A;  2VKH A;  1G3Y A;  3E6M A;  1BM9 A;  5E79 C;  1UAA A;  1XD7 A;  3E1S A;  4ZDP A;  5EEH A;  2E5N A;  2VBY A;  4LJZ F;  1JHH A;  4H4K C;  4FAS D;  3FIS A;  3LSK A;  1W5C C;  1AA7 A;  5EG0 A;  4ZYG A;  2VAS A;  2IGN A;  2EQR A;  2F6C A;  3MQ0 A;  2R5Z A;  3HOW J;  2JSC A;  2BGC A;  3ABM H;  4ZDO A;  5GAE J;  3WTU C;  5D8K B;  2V6C A;  1HC8 A;  3FHN A;  4L18 B;  1EKE A;  1SVM A;  3KZI C;  2F5C A;  4RS8 A;  3ZXS A;  4F55 A;  3Q9V A;  1P2F A;  1OCT C;  2Y0S A;  4PJM A;  4PUS A;  4E7J A;  1FP2 A;  2W85 A;  3GEZ A;  5E20 A;  2LK2 A;  2RVC A;  2X1C A;  4EGY A;  4P9F A;  1QO0 D;  3OOU A;  1B9M A;  2PLY A;  3Q0W A;  1BI1 A;  3M8J A;  4I0A A;  5DUK A;  4KJZ A;  4A3L J;  2JTV A;  1K6Y A;  2LSO A;  3V8J A;  2B63 J;  1W0U A;  2R7W A;  3HM5 A;  2QCO A;  5C44 J;  4WXC A;  3K4M A;  1VQL I;  4WXH A;  2ZB9 A;  1P4X A;  5ILU A;  3BQY A;  2VJ5 A;  1FT9 A;  2BW3 B;  3GTM J;  1WJE A;  4HPQ A;  2P7C B;  1IJW C;  5E8G A;  2GOX B;  1U6G A;  2R7X A;  1ENH A;  4HV6 A;  2WY8 Q;  5HLG A;  3A01 A;  1XDU A;  2ZXH A;  4B43 A;  4PGG A;  2E1M C;  5C4J J;  3EYY A;  2YS9 A;  5CPR B;  1OCZ H;  2DT7 B;  4XRS A;  2OQR A;  4HG2 A;  2M0C A;  2OTJ I;  3U2R A;  3LA7 A;  1W36 D;  3PSI A;  4XNF A;  4XKB A;  3MWM A;  4OIR F;  4HZF A;  5FKN A;  3CMY A;  2R7R A;  4ZZL A;  2DMU A;  1T0F A;  2HFH A;  4HEA 2;  2AQF A;  3E5X A;  1H8A C;  2L9S A;  3GLL A;  2VOP A;  4LD5 A;  5FRM A;  1WHU A;  4AM3 A;  4ZH4 F;  1O7F A;  1KON A;  3K7A J;  2KZG A;  4UB8 C;  2HKO A;  2K3F A;  3FMR A;  3R60 A;  4CXF A;  3KLO A;  5FKK A;  3JAM Z;  4BDZ A;  4UUV A;  3J80 K;  2R7U A;  1H9T A;  5CVV A;  3KP2 A;  1IRZ A;  4UUS A;  1QU3 A;  1IN7 A;  3QYE A;  4M71 A;  1YRN A;  3WHB A;  2HVS A;  2ID3 A;  3IAM 2;  2KP6 A;  4PCQ A;  5EGO B;  2EIJ H;  4X1E A;  1JUP A;  2XF7 A;  5J1Y A;  2FQ3 A;  2HKX A;  4D5C A;  4JX6 A;  3CTA A;  1LNW A;  4C9Y A;  4L5E A;  4O6J A;  3DBL B;  1U8R A;  1XN7 A;  4LK1 F;  2DO7 A;  3MN2 A;  2V6E A;  1LDJ A;  3K4N A;  3BCB A;  2QEN A;  3E0J B;  2NVT J;  4Y13 A;  1UHM A;  2CQX A;  2L7K A;  5E1Z B;  3BQZ A;  2Z16 A;  2QYO A;  2DT6 A;  3BG6 A;  5KVR A;  4E7I A;  4B47 A;  3CQZ J;  3R4K A;  1XSD A;  3H0D A;  1AHD P;  2H8R A;  3PUB A;  1QVT A;  4E70 A;  3P9C A;  3BR1 A;  2VQH A;  5CQE A;  1X3U A;  2LG4 A;  6PAX A;  2WB1 N;  1G3T A;  1B8I A;  1XGO A;  3HTS B;  2FJ1 A;  5KK1 A;  4EAT A;  1YHQ I;  1IXC A;  4IQJ A;  1OYY A;  1R5H A;  1XGS A;  1I39 A;  2MFZ A;  1HDP A;  4CGZ A;  3HSR A;  4CYC A;  4YRV A;  3M8F A;  3GTO J;  1X4P A;  4BKX A;  4KIB A;  2JUC A;  3N4M A;  1F9N A;  3LSJ A;  4RB0 A;  3Q9S A;  4J01 A;  4QPO A;  4KIG A;  1JGG A;  1XX5 A;  5HDK A;  2G9W A;  1NG6 A;  4D0P A;  9ANT A;  1XMK A;  2LR8 A;  1X3Z B;  1SFX A;  2JVH A;  4D1Q A;  1T38 A;  3KP6 A;  1OQY A;  4ZC3 A;  1K78 B;  5EDN A;  2DPD A;  1ZR2 A;  1R7J A;  4LLL A;  3U1D A;  2M45 A;  1FOY A;  4BEH B;  1S7A A;  4ZDL A;  3V4G A;  1FTZ A;  4C3J J;  2R3S A;  1ODD A;  3K1M A;  4MQ9 F;  4G6Q A;  4Y17 A;  2GZW A;  4XMY A;  4L0Y B;  2LY2 A;  1U2W A;  1BW5 A;  3I53 A;  2L0K A;  2EWN A;  1BBY A;  4GDF A;  2Y75 A;  2GAU A;  3JW4 A;  2DMN A;  3KZY A;  4A3D J;  2DOD A;  1JUM A;  1HDD C;  1IRF A;  1OLT A;  3L7W A;  5DM6 F;  2DFE A;  3V42 A;  3ULQ B;  2K4J A;  3AL0 C;  5FD5 A;  3SDB A;  3FXM A;  4CCK A;  4Y7N J;  2QQA A;  3F72 A;  2KDZ A;  4DW6 A;  3WHC A;  2QWW A;  1J5Y A;  1N78 A;  4I2O A;  2MYS A;  5DTD A;  3NEU A;  4CYD A;  2Q2E B;  1Y6I A;  2ADU A;  4Y4R A;  2K4B A;  1B59 A;  2XRO A;  1T08 B;  2COB A;  5HOD A;  2CV2 A;  4U0V A;  5JLW A;  2HVR A;  2FU4 A;  1YS6 A;  4LGW A;  2GWR A;  3WU0 A;  3G73 A;  3CUQ C;  1TWA J;  2JA2 A;  1USS A;  1Z1D A;  4UUT A;  3ZMZ A;  3GVA A;  4OAY A;  3RQI A;  2V79 A;  3HRS A;  1WQ2 A;  3QOP A;  3K69 A;  1W7P A;  1Z6R A;  2EZL A;  2H6C A;  2MH2 A;  2BEO A;  4MEX F;  2FX0 A;  3W6K B;  5H2F C;  3ONQ A;  1BC7 C;  3S16 J;  2VJJ A;  4B1R A;  1OFC X;  3BZC A;  3OMY A;  4BBR J;  3B6C A;  2LBF A;  2L9V A;  1GVJ A;  4EV0 A;  2HEO A;  1QZE A;  1XSX A;  2ECC A;  1WJD A;  1TTY A;  2ZSH B;  2K9L A;  2DTR A;  4OIQ F;  3I4N J;  3V7R A;  3G4S I;  1U3E M;  4B3A A;  4EMS A;  4F3Q A;  1R71 A;  4G6D A;  3OV8 A;  4X0G A;  4CZZ A;  1DP3 A;  2HWV A;  3UR3 C;  4H0E A;  4Y3O A;  3RYP A;  1ZKG A;  4AU7 A;  4LLN A;  2YX4 A;  1X1D A;  2CH0 A;  1J0R A;  5ICG A;  3CUQ A;  3FXU A;  5LLQ A;  3ECO A;  3OYD A;  4HRI A;  4II3 A;  1CF7 A;  1XDS A;  4JP0 A;  3QPH A;  5B5E C;  2R93 J;  1D8J A;  3BJ6 A;  3D0S A;  1YW7 A;  3LMM A;  1KZH A;  1ZH5 A;  3M1E A;  3LSM A;  5DS9 A;  2QA4 I;  1LFP A;  2IA1 A;  4KA4 A;  2R0Q C;  1T2K A;  3I3L A;  1IAW A;  3JTH A;  3OSG A;  3PQJ A;  3G2B A;  1TZL A;  2Z99 A;  3GX4 X;  1JJ8 C;  5LGT A;  5LEJ A;  1NH3 A;  1TWH J;  2LYC A;  4RGR A;  4MNU A;  1S7E A;  3IUO A;  5DCM B;  5LHG A;  1PP7 U;  3WTT C;  3BCA A;  3NWT A;  1J59 A;  4RM3 A;  5K7H A;  4HX8 A;  4A0Y A;  1XS9 A;  3LL7 A;  2L3D A;  1R5G A;  4OWR B;  2WY7 Q;  4NC6 A;  5HNF A;  2FNA A;  2R7Q A;  2P8T A;  4G9Y A;  1ZR4 A;  3HOU J;  3SEZ A;  1JTX A;  4YIR X;  2QBY A;  2VT2 A;  5AIQ A;  1KGS A;  3VOD A;  2DK5 A;  3BG7 A;  1W0T A;  2Y31 A;  3O6B B;  4QWQ A;  3MZH A;  1DP7 P;  4G8X A;  3M1C A;  1H9G A;  4HYE A;  5F04 A;  1UJ8 A;  3GME A;  2XAU A;  1BR2 A;  3GBG A;  3L2W A;  4R8H A;  1LVA A;  4BXX J;  1PJR A;  3AG3 H;  4RAF A;  2QGU A;  2HZT A;  3ERE D;  2AXL A;  2O8K A;  2RN7 A;  3SHF A;  1V3F A;  2LC2 A;  2CUZ A;  3D1N I;  1OKR A;  1YW9 A;  2DYR H;  3OIQ A;  5D5X B;  2DFI A;  4ENK A;  2ZSI B;  5E17 F;  3BJO A;  2VN2 A;  4ZYE A;  2K40 A;  3F8C A;  4KUM A;  4XOT A;  3ZGK A;  5ED4 A;  3AG1 H;  1ULY A;  4Z2Y A;  4A69 C;  3RKY A;  4FE4 A;  3OYJ A;  4BHC A;  2HU9 A;  1LPQ A;  1YFH A;  2VQC A;  2HQA A;  2XAH A;  5E3O A;  3L00 A;  1FLI A;  2DQL A;  1UZC A;  5LHI A;  2DLL A;  5GTH C;  3FBN B;  2MD0 A;  1W4M A;  3ISP A;  5FB2 A;  2KLO A;  3HJE A;  1GXQ A;  1FPQ A;  1LVK A;  4BU2 A;  2VI6 A;  1G3W A;  3HOT A;  4A3G J;  1EA3 A;  4A3J J;  2M7A A;  1GVD A;  5HLI A;  2QF7 A;  2X6X A;  4UV8 A;  2LVS A;  3ZQG A;  5M5X J;  3CP2 A;  1ZGA A;  4JX4 A;  1K83 J;  3I59 B;  4NDL A;  1MJ9 A;  2M3A A;  5D5V B;  1A5J A;  3ESW B;  3HRU A;  2NS7 A;  4L9J A;  4A3F J;  1N77 A;  1WPK A;  2LMD A;  4BL0 B;  2JA5 J;  2VC0 A;  3KEY A;  4XR6 A;  2DDA A;  1JGS A;  2XAJ A;  1I1S A;  4DJA A;  4M72 A;  1N75 A;  4GO1 A;  3IC7 A;  1XCB A;  3C3W A;  4P5O A;  5CJ9 A;  4XQF A;  3KET A;  2D2W A;  2FD5 A;  3ZQQ A;  3R0J A;  4HAM A;  2Y48 A;  4KYW A;  4A3B J;  4EJV A;  2HOA A;  1DU6 A;  3BPX A;  4ZJZ A;  1ETK A;  5BOX A;  2A61 A;  4DYC A;  3I58 A;  2OAZ A;  5LBQ A;  1FYM A;  2EZH A;  1FMV A;  2IRF G;  3KYD B;  4FHT A;  4E7L A;  1T8I A;  4OOI A;  2B0L A;  1WI3 A;  1TQP A;  3FKI J;  2IW5 A;  3QP5 A;  3TMO A;  2COM A;  2LOO A;  2Z2S B;  2VXD A;  1JJ6 C;  2L4A A;  1U5T C;  1Z67 A;  3DF8 A;  3GFM A;  5GAH J;  1IRG A;  2L5Q A;  3PFI A;  2EPF A;  2EB7 A;  2ECB A;  3E7L A;  3RIR A;  2K9M A;  1IZ1 A;  2W25 A;  3W6V A;  3DFG A;  3GFL A;  4A2U A;  1XMX A;  3IL2 A;  1Q1H A;  3E5Q A;  2QSH X;  1OCO H;  2A6T A;  4LB5 A;  2A5W A;  4OIN F;  2XAS A;  1PDN C;  1PYV A;  4M3B A;  2EIM H;  4ZTJ A;  3IH4 A;  1LE8 A;  3FDY A;  2X9D A;  3AAF A;  1O7L A;  3F3X A;  5K5O A;  3AG2 H;  3ZRG A;  3I4P A;  2QKL B;  3KP3 A;  2GXB A;  3QYB A;  2R7S A;  2FOW A;  2M9H A;  4A6D A;  3H0G J;  4CA0 A;  2Z9O A;  2GXA A;  3CC2 I;  1HKS A;  4O3M A;  2OZ6 A;  4IKF A;  4MHG A;  3F6V A;  1U5T A;  4ZTF A;  1YQA A;  2BVM A;  2K9Q A;  2FQ4 A;  4XKV A;  2ZJQ F;  3KIO A;  4BY7 J;  2XGC A;  3PO2 J;  4ZZD A;  1QA6 A;  1X1A A;  4C2U A;  2R7V A;  5FD6 A;  3C2B A;  3GZN B;  1YX5 A;  4XOR A;  1FC3 A;  4V2F A;  5FKM A;  1OJL A;  4M6Y A;  3H9Q A;  4CCO A;  3EUK L;  3GUD A;  3GTJ J;  3VDX A;  1C0W A;  3KYC B;  4DYR A;  3HKZ A;  4ANJ A;  2O7O A;  4HOB A;  3ABU A;  4IOA F;  2NYX A;  1Z21 A;  2E35 A;  3JR9 A;  3BZ6 A;  1QGP A;  2VL8 A;  2WAQ N;  2KDO A;  2E7X A;  2DA2 A;  4RB3 C;  2DMT A;  4BGD A;  3JRI A;  3CF2 A;  3C2G A;  2RKH A;  3OYM A;  3JRB A;  1HKQ A;  1REP C;  1E3P A;  2EV0 A;  4KIS A;  2YR2 A;  1UB9 A;  4LB6 B;  1IN8 A;  1PUF A;  1OYW A;  4YII A;  2VBX A;  4A3M J;  4AID A;  2XKP A;  4LG0 A;  4ENN A;  1Z7U A;  3QAH A;  2E60 A;  4IJA A;  2O03 A;  4L9V A;  1RI7 A;  4P55 A;  2DW4 A;  4M6V A;  3CCJ I;  3K70 D;  3ZQC A;  3V8K A;  3R61 A;  2BHZ A;  3KYL A;  3OYC A;  4XRS G;  5HLH A;  1BOA A;  3K2Z A;  4ASN A;  3GTK J;  2X1D A;  1JT6 A;  3CF5 F;  4FCY A;  1X2N A;  2XRL A;  3BTI A;  3HXL A;  5F1R A;  1MDM B;  3S3M A;  1VQ5 I;  3IH3 A;  3G71 I;  1F36 A;  3PNY A;  1W7P D;  2K9N A;  2M4K A;  3HYI A;  2IVM A;  5E18 F;  3QU6 A;  2OF7 A;  4IHV A;  1B6A A;  1JE8 A;  1HOM A;  1ACI A;  1KQ9 A;  1WFX A;  3FXO A;  3HRM A;  4IL6 C;  4JK1 X;  3EUH A;  1MJB A;  1FY7 A;  2ETH A;  1ZGW A;  3BR2 A;  2NRA C;  5ILS A;  2D45 A;  3KPH A;  5FLV A;  4WK8 F;  2LY9 A;  3P5J A;  2NOG A;  3OYE A;  4S0H B;  5BNG A;  5E3L A;  3WGI A;  5D8L B;  2BOL A;  1MBJ A;  2BY2 A;  1K6O A;  2Y0S N;  4MIM A;  2XHK A;  1JKQ C;  4PJN A;  4DBQ A;  2BXZ A;  2LY1 A;  3F8F A;  2KL4 A;  2ME0 A;  4F7Z A;  3I5U A;  2V9K A;  4F52 A;  2R92 J;  2DCE A;  4CZC A;  2BY0 A;  4BYY A;  1MSF C;  2XSD C;  2ELH A;  3ZQ7 A;  1TLH B;  3A0H C;  2ELK A;  2QQB A;  4XLA A;  5L3F A;  1S9H A;  1LDD A;  3H36 A;  2OQG A;  5J47 A;  2HXO A;  1L3L A;  4NNJ A;  2YX7 A;  2IPQ X;  4NB5 A;  2EA2 A;  1ZRF A;  4GCV A;  3NWS A;  1MBF A;  5H6Q A;  4FE7 A;  3W3C A;  3L09 A;  3DBH B;  2R7T A;  2Z33 A;  4I6Z A;  1H88 C;  3M9A A;  3QOD A;  1IN4 A;  2P6T A;  2M0M A;  2LRD A;  2EIK H;  3FXJ A;  1R22 A;  2XVC A;  3ERM A;  5L3C A;  3LAJ A;  2ACJ A;  2M8E A;  4BJ5 C;  2QUF A;  1NK2 P;  2DA6 A;  3ML6 A;  1AWC A;  4AVP A;  5M3F J;  4FTH A;  1S8N A;  2FA5 A;  1F5T A;  1XMA A;  5D5W B;  2E1O A;  3BTL A;  5D6F A;  2EV6 A;  2DU9 A;  1W5T A;  1UHS A;  2MLG A;  2FF4 A;  2O8X A;  2O9L A;  1MH4 A;  4IF4 A;  5HS9 A;  1BOB A;  1T33 A;  5FFZ A;  3RCO A;  1ZG3 A;  5GTI C;  5TJJ A;  2CUF A;  2TRT A;  4IO9 F;  3CLO A;  2QVO A;  1FBU A;  3LQQ A;  1TNT A;  2X6Y A;  1KU9 A;  1T56 A;  2DJI A;  2CWE A;  3S32 A;  1QBJ A;  2UWM A;  3ZPL A;  4RM2 A;  1YJN I;  2EJR A;  2H8W A;  2V1X A;  4ESF A;  2A07 F;  3PM1 A;  3WTS C;  4IHY A;  1T39 A;  4HA8 A;  3HUG A;  2YUS A;  2C6Y A;  1XCV A;  2Z5U A;  4M9Z A;  2HQN A;  1SVL A;  2VJ4 A;  4KT5 C;  4OMZ A;  4ZYA A;  4EJU A;  3CD6 I;  3CC7 I;  2DK8 A;  4LG3 A;  3F22 A;  1K78 A;  2XGE A;  4V19 K;  1QHG A;  3CJN A;  2OPT A;  2GIV A;  3HC7 A;  2ZJ2 A;  2OCE A;  4HNU A;  3EPZ A;  2RDP A;  2HYG D;  4B3X A;  3HOX J;  2PMZ A;  3MMY B;  4A5M A;  3SDG A;  2OU2 A;  2P6S A;  3LSI A;  1B72 B;  3PO3 J;  5FRO A;  4I98 B;  2IBD A;  1D5V A;  1LUJ B;  1R9T J;  1EH8 A;  3D5L A;  2WC2 A;  4XIC A;  1M1E B; 
#chains in the Genus database with same CATH homology
 2OC6 A;  3DKY A;  2W82 A;  4HSR A;  1WJD A;  3HL2 A;  4XN0 A;  2ZSH B;  2K9L A;  4XM3 A;  3VYU B;  3L2Q A;  4IZZ A;  2WAE A;  2BW3 A;  2VKD A;  2WAD A;  4JOM A;  3W2A A;  3OYA A;  4F3Q A;  3TBI A;  1ZEL A;  3OL4 A;  2W4S A;  4X0G A;  1DP3 A;  3UR3 C;  3W2V A;  4Y3O A;  4PSX A;  2LH9 A;  4E7H A;  4AU7 A;  4BJT A;  4MLO A;  4NUB A;  1X1D A;  2CH0 A;  2F4I A;  2PJR A;  4RLQ A;  1D0X A;  3HG9 A;  4Y33 A;  3OYD A;  4E6K G;  4HRI A;  2RQQ A;  4II3 A;  3BLY A;  3LMM A;  4XOP A;  3LSM A;  2X1E A;  1LFP A;  3I3L A;  2K5C A;  2VLA A;  4PJJ A;  2DOA A;  4IX7 A;  2CV0 A;  3G2B A;  1TZL A;  1SAU A;  2HVQ A;  2F5V A;  3SEQ A;  4ITV A;  1QHH D;  3IAS 2;  2LYC A;  4U7B A;  5HVQ C;  2I8D A;  2X6W A;  3IUO A;  2M4G A;  4BQO A;  3OY9 A;  3BCA A;  2ZFU A;  3NWT A;  4RM3 A;  5LD2 C;  1YX3 A;  3N05 A;  3PL8 A;  3DU6 A;  2L2O A;  3LL7 A;  3K4J A;  4OWR B;  2WY7 Q;  3OL3 A;  5HNF A;  2R7Q A;  4KT6 A;  3SEZ A;  5FRN A;  1P9Q C;  3MKZ A;  3D5S C;  3FKJ A;  3BG7 A;  1J09 A;  1Z7L A;  3OWT A;  4NQW B;  1V5E A;  3PJR A;  3OS2 A;  3MD2 A;  4BAC A;  2KRC A;  3M1C A;  3K10 A;  2E5Z A;  2XAU A;  1BR2 A;  3CP8 A;  3GBG A;  3L2W A;  5JHF A;  4BE1 A;  1PJR A;  2GOM A;  4XL9 A;  4PK4 A;  3CZ6 A;  3L2R A;  1MMN A;  3RPU D;  2LC2 A;  5CKT A;  2CUZ A;  2IXS A;  4CCL A;  4AVZ A;  2CUJ A;  3OIQ A;  2OUM A;  1MMD A;  2ZSI B;  4XOT A;  3ZGK A;  2RRE A;  4XON A;  1T0F C;  2VQL A;  3PNV A;  3VWB A;  3OYJ A;  2X85 A;  4RLF A;  2IS2 A;  2IGO A;  3EUH C;  3S93 A;  2HU9 A;  2VQC A;  2HQA A;  5HLT A;  3QYF A;  3OYG A;  3RQ4 A;  3DQV C;  4BDY A;  1X1B A;  1D0Y A;  3FBN B;  3L2U A;  2MD0 A;  3PSF A;  2WA0 A;  4BEH A;  2XC7 A;  2KLO A;  2IGM A;  2X51 A;  4D9J A;  1LVK A;  2Q1Z B;  4BU2 A;  2K3P A;  3DLA A;  3CMM A;  1JI8 A;  3HOT A;  2ZXI A;  1EA3 A;  4AYB A;  2M7A A;  4CUG A;  2X6X A;  4F92 B;  2XDV A;  4PFP A;  2V26 A;  3S8P A;  3H35 A;  3CP2 A;  3DKX A;  2M3A A;  3LSH A;  1N77 A;  3OYN A;  4BL0 B;  3KEY A;  3A1Y A;  2L9N A;  3DTI A;  4XR6 A;  4DJA A;  3IP4 B;  1N75 A;  2R7O A;  4BQQ A;  1G8X A;  3OYB A;  4P5O A;  2OV7 A;  4XQF A;  4YEL A;  3ZQQ A;  3S3N A;  4BE0 A;  4ZJZ A;  1MMA A;  2P0W A;  4PJL A;  2CW8 A;  4BQN A;  4PFO A;  1NG7 A;  2O5R A;  4XLH A;  2WAQ A;  1UG0 A;  3VSL A;  1MW7 A;  1FMV A;  4QPQ A;  4HNT A;  2FUG 2;  2VJI A;  3K4B A;  4CCM A;  4E7L A;  3HPG A;  3OS1 A;  4BJ6 C;  1MND A;  2HDW A;  3TMO A;  3VYR B;  2LOO A;  2Z2S B;  2HZD A;  2UV1 A;  2VXD A;  3RTR A;  4C2T A;  2L5Q A;  3OS0 A;  4U87 A;  1D1B A;  4CSW A;  2HPM A;  2K9M A;  3DPU A;  1FMW A;  1OR7 C;  2A6T A;  2A5W A;  2CMP A;  2Z1D A;  2XF5 A;  2VXZ A;  1WJA A;  3U21 A;  3SYT A;  2KQR A;  1PYV A;  3L2V A;  4J00 A;  4ZTJ A;  4BS9 A;  5TGT A;  3FDY A;  4E4H A;  3SZG A;  4OAZ A;  1MMG A;  1BR1 A;  1D1A A;  4PSW A;  3ZRG A;  4RMN A;  3H5A A;  2IGK A;  2QKL B;  2KPM A;  3BC8 A;  3DEE A;  3QYB A;  2VIX A;  3ZR8 X;  2VKH A;  1UAA A;  2V1N A;  3HOS A;  5LFA A;  3E1S A;  2JUG A;  2R7S A;  4XKW A;  4ZDP A;  3OYK A;  2E5N A;  3W2W A;  4DBR A;  5KCM A;  4H4K C;  4CA0 A;  4FAS D;  2JSP A;  2M7B A;  2VQG A;  3LSK A;  2WAF A;  1AA7 A;  2VAS A;  2IGN A;  3HUG B;  4IKF A;  2CV1 A;  2F6C A;  3RSN A;  5KHD A;  4ZTF A;  4ZDO A;  2BVM A;  4XKV A;  1Z3X A;  4XN3 A;  4DIQ A;  1X1A A;  4C2U A;  2R7V A;  3HPH A;  4XOR A;  3K70 C;  1TT0 A;  1YX5 A;  3FHN A;  3H9Q A;  3ZXS A;  4CCO A;  3EUK L;  4F55 A;  1E0E A;  2IS6 A;  4CCN A;  3VDX A;  2Y0S A;  4PJM A;  4PUS A;  4E7J A;  2KHM A;  4B44 A;  2ELJ A;  3HKZ A;  4ANJ A;  2X1C A;  3A2K A;  2LRE A;  2HNH A;  3OOU A;  1Z21 A;  2XSJ C;  2VL8 A;  2KDO A;  3M8J A;  4LIV A;  4P1W A;  4KJZ A;  3CJQ B;  4BGD A;  1MNE A;  1YE9 A;  1K6Y A;  3AL0 B;  2JVG A;  3CF2 A;  3C2G A;  4N4N B;  3OYM A;  2R7W A;  3UNG C;  2CFO A;  4LIU A;  3OYL A;  3K4M A;  4KIS A;  2VJ5 A;  1SFK A;  2BW3 B;  2IS4 A;  1WJE A;  4HPQ A;  4G6T B;  1WJF A;  2E60 A;  5HNH A;  3C2H A;  3QOE A;  2E1M B;  2R4G A;  3K70 D;  2GOX B;  4HST A;  1GLN A;  2WB1 A;  3KYL A;  2R7X A;  3OYC A;  2WY8 Q;  3FBI B;  3OR2 C;  2PJR B;  4B43 A;  2ZXH A;  2X1D A;  5KNL A;  2E1M C;  3K6G A;  2AQE A;  3HXL A;  5CPR B;  3S3M A;  2DT7 B;  2IS1 A;  4HG2 A;  4E7K A;  3PNY A;  3OR1 C;  3AKZ A;  2M4K A;  1W36 D;  3PSI A;  4XNF A;  4XKB A;  2R7R A;  3DTK A;  4HEA 2;  1WFX A;  2AQF A;  3H9G A;  2L9S A;  1LDK B;  1X1C A;  5FRM A;  1VZ0 A;  4BE2 A;  1KON A;  3PNT A;  3A4C A;  1HA8 A;  3DU5 A;  4BDZ A;  2XF6 A;  2CW7 A;  3ZCO A;  4R79 A;  2R7U A;  3OYI A;  2NOJ B;  1LKX A;  4XLC A;  1QU3 A;  3VYT B;  3QYE A;  2BVL A;  2WBM A;  3OYE A;  4IQ4 A;  2HVS A;  3IAM 2;  2KP6 A;  2BOL A;  3I9V 2;  2XF7 A;  3H5N A;  4PJN A;  4XLE A;  4DBQ A;  2MAB A;  3EUA A;  4DGW B;  2LY1 A;  4C9Y A;  2KL4 A;  4XKC A;  1UEL B;  2V6E A;  2V9K A;  3TL4 X;  4F52 A;  4E7Z A;  2DCE A;  4CZC A;  3K4N A;  4FET A;  3BCB A;  4GRI A;  3E0J B;  2UUZ A;  2L7K A;  3S3O A;  4XLA A;  3OYF A;  1S9H A;  2Z16 A;  2DT6 A;  3BG6 A;  4E7I A;  4B47 A;  2KZV A;  3H0D A;  3OIP A;  1R6R A;  3DPT A;  3PUB A;  4NNJ A;  3AFH A;  4C30 A;  4B48 A;  3H9J A;  2VQH A;  3NWS A;  5CQE A;  3W3C A;  1WJ5 A;  2LG4 A;  3VYS B;  3DWL E;  3KX2 A;  4EAT A;  2R7T A;  4CH7 A;  4IQJ A;  1V5G A;  4E7S A;  3QOD A;  2MFZ A;  1IRX A;  3LSG A;  4YRV A;  1X4P A;  2M0M A;  2LRD A;  1Y56 A;  1X4O A;  3F9K A;  4J01 A;  4QPO A;  4BJ5 C;  3VSK A;  2V4J C;  1NG6 A;  1V5F A;  4D1Q A;  2JVH A;  2KMU A;  4ZC3 A;  2RNG A;  1BR4 A;  4BEH B;  4ZDL A;  4XLF A;  1Z3Y A;  4F91 B;  4XMY A;  2LY2 A;  3DTE A;  4DOZ A;  2HPI A;  1BOB A;  3OYH A;  1W36 C;  2LBF B;  1T95 A;  1X19 A;  2QKM B;  3RCO A;  4II2 A;  2W7N A;  2KRH A;  2VB6 A;  2DXI A;  3CJR B;  3PFY A;  1OLT A;  4CCJ A;  4JQF A;  2X6Y A;  3K4L A;  3V42 A;  3MKW B;  2DJI A;  4N4O B;  3AL0 C;  3S32 A;  3DPL C;  4BUP A;  3CES A;  3SDB A;  4CCK A;  2UWM A;  2V7F A;  4RM2 A;  1D1C A;  1G59 A;  5HOO A;  1N78 A;  5CQG A;  4NC8 A;  2MYS A;  3K4K A;  2W00 A;  4NC7 A;  4BXF A;  2Q2E B;  4YEJ A;  1Y6I A;  2MC4 A;  4Y4R A;  3J7A Y;  2CS3 A;  1ERD A;  1D0Z A;  3K4C A;  2VJ4 A;  4ZYA A;  2CV2 A;  2HVR A;  4F93 B;  4LG3 A;  1DGW Y;  1DQU A;  3LFU A;  2JA2 A;  1QHG A;  1WJB A;  3HC7 A;  2W1O A;  4HNU A;  3EPZ A;  4B3X A;  2PMZ A;  4OAY A;  3MMY B;  3D5R C;  3LSI A;  1DGR M;  1WJC A;  5FRO A;  3ONQ A;  3MKY B;  3H5R A;  2VJJ A;  2VPL A;  1U0J A;  3OMY A;  3D5L A;  2LBF A;  4LIT A;  4KIT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...