4KT6A

High-resolution crystal structure streptococcus pyogenes beta-nad+ glycohydrolase in complex with its endogenous inhibitor ifs reveals a water-rich interface
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
GNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nicotine adenine dinucleotide glycohydrolase
publication title High-resolution crystal structure of Streptococcus pyogenes beta-NAD(+) glycohydrolase in complex with its endogenous inhibitor IFS reveals a highly water-rich interface
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 87
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1660 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4kt6A01
4KT6A 3PNTA
chains in the Genus database with same CATH superfamily
3LA3A 2ZJPF 3R0AA 2W84A 2EZLA 3RKQA 1I50J 3OY9A 2M34A 3WHCA 1PP8F 2PX9A 1A35A 4A0ZA 3JREA 1NTCA 3BOQA 3NEUA 5EJCA 1UHMA 2QSHX 2EA4A 3S1NJ 5J4VA 3JRGA 2PMZN 3OYMA 2DPUA 1V5FA 3V7CA 4MEXF 5C4JJ 1BR1A 3JTGA 1G3SA 1ZGJA 2DT5A 3WU0A 2L54A 2XAFA 3M1CA 4D7MA 4FX4A 3H5NA 2QLZA 2Q8KA 2JT1A 4PJNA 3LSGA 2XPWA 4DBRA 4MQ9F 3GFIA 2ZNYA 4DNCA 1KA8A 1PUFA 1E3PA 1YX5A 4N4NB 4AU7A 2EV0A 1MBEA 1ETQA 3ASNH 3FM3A 5E17F 5E8IA 3ROUA 1WPKA 2XVCA 1F5TA 2A6HF 3H3VK 4G6QA 2CQQA 3CO6C 4IRIA 3GO5A 2KIMA 4AUXA 4AVZA 2UWMA 3OYDA 3G4SI 3ZGKA 4BHBA 2K3PA 2K27A 4EGZA 1TZLA 2LSOA 2ZMEA 2CSOA 2OPTA 2V1DA 5L3GA 3S15J 3C2HA 1IRZA 5A2QK 2BEOA 4RGXA 3HL2A 2IBDA 1Z7LA 2DN0A 4WXCA 2VJ5A 1X3UA 3E3VA 5JVTA 2DOAA 4CDGA 2HKXA 2G7UA 4CXFA 3E6BA 4CZZA 1KQ0A 4BJ6C 1LFPA 1G3WA 4XSZF 3LAJA 1FYLA 1AKHA 5FKNA 2OTLI 4M71A 4HRIA 1ZLKA 4DYCA 4ESBA 3J7YJ 3BR6A 1XG1A 4XOTA 2DMQA 2XF5A 1HSJA 1R4NB 2ZNZA 3FHNA 4P9UA 3N97A 4LMYA 4HSRA 1OPCA 5F6FA 2JWTA 1BC8C 3A1YA 1USTA 4LIVA 1Y39A 4RB1A 2L2OA 3GTGJ 1ZR4A 3BCAA 1U0JA 4F92B 2K9SA 4LOCA 4M6YA 3FISA 4AIHA 4CCKA 5K7ZA 2LKXA 4BH9A 1C0WA 2QM3A 5D5VB 3H9QA 5K7HA 3OYAA 3DKXA 2DA3A 1BI3A 3EDPA 4XKWA 5JLWA 3AFHA 3H5AA 3AAFA 1YOVB 4E7ZA 4G7HF 4PCQA 1SMYF 2M4KA 5HLGA 1BIBA 2BVMA 4WXDA 1XSDA 1KQ8A 1V5EA 6PAXA 2WA0A 4NC8A 3H0DA 5D5XB 4UXNA 1EH6A 3Q9SA 3MKYB 4N9HA 4E7KA 4Q5SF 3ZQ7A 4IHVA 3GFLA 2PN6A 3E1SA 4BE2A 4S05A 1LKXA 1WGXA 4XBFA 3HRTA 4N4OB 2MH9A 2XAHA 3TGNA 4B4CA 4UUSB 3BG6A 2KDZA 3DLLF 2ZJRF 1W0TA 2B63J 4CCJA 4P96A 3JRCA 1ULYA 3WTZA 3HTSB 3BCBA 3CD6I 2PMUA 5GAGJ 4HPQA 1VQ8I 2E36A 3KEYA 5E3NA 2X4HA 5E3MA 3JRHA 2EH3A 3C7JA 4LK0F 1A04A 2K9QA 4J19A 4BUPA 3EETA 2Y31A 3ESWB 3H9GA 2WB1A 3TOAA 5K5OA 1FLIA 2PJRA 4FE7A 2OBPA 1HOMA 3IHUA 2CQNA 5TGTA 3P9IA 2F5VA 4A5MA 3UKGA 2RKHA 2HDCA 3S17J 4ENNA 5GTIC 2NS8A 2PI0A 2JRMA 2HTJA 1TWHJ 1FOWA 1WKMA 2GAUA 2IW5A 3G1MA 1IDZA 5HLIA 2I10A 3O8HA 4XLFA 3ULQB 2DBBA 2HVQA 2X1EA 2DK5A 2Y75A 1T2KA 3V42A 2MSYA 4ZZDA 3GZNB 5CVJA 1P7IA 1R1VA 4C2TA 1RUOA 2L7KA 1FSEA 1FEXA 1RIOH 2A6EF 1SFOJ 4HX8A 4CYCB 1VQPI 5HODA 1VQLI 1JUMA 2PFBA 3KP5A 2HI3A 2LF8A 2QBYB 2EZKA 3BTLA 1B8IA 4I2OA 3H92A 3H5RA 4BQOA 1EKEA 5FLMJ 4C30A 2EIKH 4IHYA 4M72A 4NB5A 4KMFA 2G9WA 2DT7B 1ZRFA 1G59A 5IP6A 3HEFA 2R3SA 3W3CA 3M9AA 3DBHB 3RYPA 3V8LA 2MFZA 4HV5A 5J8FA 2DOFA 1Z05A 1X19A 1IAWA 4EM2A 2DFFA 2JZYA 5B1AH 5E79C 5IT3A 2HDWA 2YX7A 2XSDC 1VFCA 4A3JJ 3HGGA 4E7SA 2X48A 2HQNA 1E17A 2LG4A 1ETXA 1ZTRA 3ASOH 1S7OA 1OCRH 1USSA 3GCMA 1W36C 1HXDA 2OUMA 4B3AA 3K4CA 2VQCA 3NWTA 4CCMA 2V9KA 2V7FA 1DQUA 3CLQA 3OMYA 3ZR8X 3MKLA 1Y6IA 3IP4B 4M9SA 4PJLA 5BNGA 3ZQIA 4BS9A 2LOOA 1HLVA 3VWBA 3LSPA 2DFHA 1EJ9A 1FTZA 3BLYA 4QLCU 5F1JA 4BY1J 1V54H 3CF2A 2VJ4A 3P9CA 3IH4A 2LY9A 3SZGA 4IQJA 2XRLA 3BR3A 1YS6A 5LD2C 2EIMH 3E5UA 1WJCA 1U3EM 3ZMDA 4U0WA 3E6CC 3WG9A 5F08A 4NBQA 3KZIC 1IRXA 4HQMA 2PMHA 3ZP5A 3C1DA 5ICFA 2XB0X 2L02A 3KLOA 5M3FJ 4OOIA 4M73A 2NYXA 1H0MA 1V4RA 2E2HJ 3A0HC 1ZAOA 4R8HA 1GHCA 2X6YA 1FZPB 1I1SA 3KX2A 3U1DA 1WCMJ 2A68F 4KT5C 4MHGA 4CCLA 3FXJA 4UUSA 3WTSC 1SFXA 5K1YA 4L9TA 1IXCA 1O3SA 4EATA 1MBHA 2D2WA 4Y4RA 3CCLI 1KU7A 5DUKA 2K02A 2OCCH 5JHUA 2ME6A 2EJRA 3DV8A 3N05A 2VKDA 3H36A 1RKWA 3R6SA 3MVPA 1YG2A 2MBFA 2H6BA 2JA8J 1P4XA 3HOSA 4A3CJ 4KN7X 4A3FJ 2GWRA 2FQ3A 3CCYA 3WTTC 1RI7A 2IXSA 1WZ2A 5F04A 4HDUA 5JFRA 2E5NA 5E1ZB 4FHTA 1QZZA 1WRJA 3F3XA 3NRVA 3HOTA 3IUOA 4CCNA 2AXTC 4XLEA 1HC8A 5GAEJ 3DU5A 3RPQA 2Y48A 1ONVA 1IGNA 1SVLA 5E18F 1W5CC 2CW8A 2Q2EB 1N75A 4ASNA 5K7FA 1J0RA 3CCJI 4NUBA 2VQGA 5CVVA 4KICA 3JTHA 3KEOA 3F8FA 1R6RA 3HG9A 1T38A 2ID3A 3MAJA 2L3DA 5GP9A 1T08B 2LMDA 4CYCA 2WADA 3VYUB 3L2VA 1MJAA 1S72I 2AHQA 1T39A 1W7PB 2UV1A 1SFEA 3EQLF 2DA6A 4M3BA 2QBYA 4XQFA 4BBRJ 2V1UA 2NNYA 2Y0SA 3FBNB 3KLNA 1VQ4I 4LLLA 4V2FA 5LEKA 4IHXA 4PSWA 4YIRX 1ZG3A 2IGKA 3LMMA 5J3LA 4IRHA 1ZR2A 2CFXA 1T56A 4Q4ZF 4BQAA 2QKLB 3PJRA 3J80K 3LSRA 2EV5A 3TMOA 4I02A 4G6DA 3BDDA 4G8XA 3LNQA 1XTAA 3WGHA 3WHBA 4YFNF 4B44A 1B59A 4IEJA 3SFIA 4RM3A 2XSJC 2BXYA 3SYTA 1GUUA 2COBA 3PFIA 1U8RA 2VBYA 3I4PA 5FD6A 2EILH 3RTRA 5J1YA 1SD5A 2BY0A 2QQBA 1FMWA 4O5VA 3KCCA 4OINF 1IN7A 4NHJA 3A03A 2DI3A 2HQRA 1FOXA 1XGNA 2JPCA 2WV0A 1TWCJ 2DFIA 3S2HJ 4JYKA 2O5RA 2Y2ZA 2LKSA 4MIMA 2EZIA 2VL8A 1OMIA 3V7RA 1LDJA 3TBIA 3MN2A 2R5YA 2QYOA 3A0BC 4KISA 2BZTA 5DDGA 3MKZA 1GLNA 3IH3A 3ZMVA 4XRSG 5BQTA 3R60A 1NH3A 5KCMA 2K4JA 3QYBA 4IX7A 2D5VA 3A4CA 3SXYA 1WH5A 2OC6A 4DZPA 1MMAA 1FMVA 5IOZA 1G3TA 3I54A 2FEZA 2M45A 2BBYA 3ZQGA 3LL7A 2ZFUA 4C3HJ 1SANA 2MGQA 1OJLA 3L2RA 3SFZA 1W1WE 3DU6A 4ZYEA 2HXIA 1O7LA 4MLOA 1YRNB 1YW8A 2FJ1A 1LVKA 2XPUA 4A6DA 3H3UA 2QQAA 1MMDA 2TCTA 3FXMA 3BPXA 3I64A 3I53A 3GTMJ 3S93A 4CICA 2MD5A 4L18B 2K5CA 5HLHA 2HTSA 2KIFA 3J81K 1ZK8A 2CJJA 2WAQN 1YHQI 3CDLA 2BW3B 1UFMA 3K4LA 1KGSA 2W7NA 3JR9A 2GA2A 2EBIA 2L7FP 4LLNA 2NVTJ 3AL0C 2ECCA 3NAUA 5L3FA 3KPHA 1SD4A 1LJ9A 4ZTFA 1JGSA 4U0YA 2Z33A 5E3OA 4CGZA 4EM1A 2VQLA 2BE5F 1XSXA 5JR3A 1I6XA 4R79A 4DIQA 1IN5A 3BJOA 1MSFC 1QNTA 1O3QA 2CV1A 5CJ9A 2MABA 4RA2A 5FRNA 4R1HA 3WG7H 2AS5F 2HOTA 3CO7C 3BZ6A 3DKYA 1RRJA 1WJBA 2WAFA 4XKVA 1Z6TA 2EQRA 4C2MJ 3G6EI 1IJWC 1Z3YA 1QGPA 2DA2A 4YFKF 1Y1WJ 3EUKL 3KYLA 2NVQJ 4F52A 2ICWG 3GBGA 4A3KJ 2V4JC 1LEAA 1XCVA 4KJZA 2JSCA 4OIOF 1DUXC 5ILSA 1XD7A 3T1BA 3DCFA 2HS5A 3QOEA 4HNUA 4ZYGA 5HNHA 3R61A 1XMXA 3WTXC 2JVGA 4XICA 3HSRA 3HOYJ 5F0HA 1UB9A 2Q2EA 3QYFA 1O3TA 2GOMA 3S1RJ 2ELJA 1MZBA 2DA1A 1JI8A 2WWYA 4I98B 2H6CA 1ZYRF 4PJ0C 2TRTA 1BIAA 2Z3YA 5TJJA 2VUMJ 1S3JA 2ESHA 1FBSA 4M3GA 1IXRC 1W7PA 3VEPA 3HOZJ 3V4GA 1TL8A 2FUG2 1OYIA 4ANJA 1TNSA 2W24A 4GCVA 2VB6A 1KONA 2Z5UA 2GM4A 3CF5F 2FU4A 1U9OA 3VYTB 1TWGJ 1QZYA 1AWCA 2E2JJ 3TO6A 3VFZA 4JX6A 4FE4A 3GYHX 1IW7F 4A2UA 2F5EA 1D1AA 2BV6A 2F4MB 3D5LA 3ZN1A 3M3YJ 3QPHA 2O3FA 3Q0WA 2O61A 3DEEA 1R1TA 1CQTA 1TWFJ 2QQ8A 1MNMC 3K10A 3Q0UA 1CF7B 1QU3A 2OF7A 1TT5B 4J01A 4C3IJ 1Y56A 4BDZA 2LD5A 5AIQA 1NK2P 4FASD 3MZ8A 4BAYA 3CC4I 3QP5A 2HYGD 3HC7A 3CCQI 3CMMA 4HX4A 4I7HA 4B1RA 1MMGA 3IRRA 1MDMB 3SQNA 3D0SA 3GLXA 2OU2A 1ZLJA 4KITB 5J6XA 3I9V2 4PJJA 2XAQA 2PEXA 1JTXA 3Q0VA 1QHGA 1XX5A 4BNCA 3OYLA 3NWSA 5KHDA 4HV6A 4QTRA 4ESFA 3A01B 1P2FA 3OSFA 3QYEA 1R23A 4HNTA 4Y13A 2KDOA 1SC7A 3I55I 3K4BA 1T95A 5FD5A 2HPMA 4IO9F 4E7HA 3J7AO 4RB3C 1GDTA 1XGSA 3DLAA 3LFUA 5DS9A 3AG2H 4A3BJ 1QRYA 3QRFF 3V8KA 1UJ8A 1P9QC 3ECOA 5LEJA 1YRNA 4HQEA 1BW5A 4L5EA 4BYYA 1B1BA 1LUJB 4U88A 5HS7A 2F4IA 2YU3A 4A93J 4IZZA 4ZDOA 4XK4A 4CUGA 2STTA 1B72B 1AOYA 1YO5C 1A31A 2V9PA 2CQ7A 5HVQC 4RGUA 2BW3A 3C2BA 1FBQA 1V3FA 1S9HA 2X6OA 2OZ6A 2DQLA 3HUGB 1ZHFA 4HSTA 4LGWA 4AM3A 1GXPA 5D4RA 3P5JA 2GIVA 2F5FA 3JW4A 1S7EA 1RR8C 2HQ5A 1MBFA 2K9MA 4A3DJ 5CVIA 4G94A 4XLNF 1UG0A 2W82A 1H9TA 5E1WA 1A6IA 2VONA 1I3AA 2IA0A 2YR2A 1T8IA 2H8RA 4KUMA 3RPUA 2CV0A 4U7BA 2IGMA 1BN5A 2RREA 5C44J 5K5QA 2XDVA 3OYCA 1VTNC 3D5RC 5J4YA 1ZH5A 2K86A 3MCZA 1YI2I 4E7JA 3H0GJ 4IPAA 1W7PD 3DQVC 3I71A 4GRIA 3AKZA 1X1PA 2DA4A 3IH2A 4RDUA 4N0BA 1OCOH 1HDDC 3OWTA 3C3WA 3ZQHA 2Z1DA 3TDUC 1A36A 4GXOA 2IEKA 1J59A 1Z21A 4XORA 3CMEI 5KAFC 5H2FC 3GF2A 3CUQB 4BXFA 2KISA 2KZVA 3LSHA 1WSUA 2L0KA 5CKTA 2EINH 1FBUA 3K4MA 1X4PA 3DWLE 3K4KA 3PO3J 3ZQFA 1XS9A 3PIOF 1P6RA 3KP4A 5ILVA 4EM0B 4QWQA 1TW2A 4II3A 3HTUA 1R5ID 1ZRDA 4AIJA 3CUQC 3M7GA 4JQFA 5KNLA 4BGDA 4YG2F 1BJAA 2BHYA 2E1MB 4KDPA 5IYDJ 3F8NA 4P9FA 4XLAA 4MFDA 4E6KG 4XR6A 3PQKA 2VJJA 5B3SH 1R1UA 3PQJA 1ZQ3P 4JX5A 4YEJA 4EJUA 1MMNA 2JUGA 1R22A 1I39A 1P4WA 2IVMA 2QF7A 3RJPA 1HF0A 2IPQX 4KIGA 2MC3A 4M9ZA 2ELKA 2WC2A 2E1MC 1JUSA 4UV9A 3IWFA 1CF7A 3K70C 2VQHA 1BI0A 1AA7A 1H9GA 4MQVA 2EPFA 2BGCA 3CCEI 4PUSA 3OIOA 3F23A 1YTYA 1JGGA 2M8GX 1SEUA 3ABUA 3BR5A 4A0XA 2ECBA 2XGDA 1IG7A 4IKFA 2RNGA 3O2PE 1MDMA 3W6VA 3CC7I 4B8XA 1WJEA 2OZUA 1IC8A 4DYQA 2GIZA 2R7SA 1B9NA 3F8CA 3FKIJ 5J47A 4X1EA 2VBWA 2ZBKA 4E7IA 4B43A 2XRNA 2LF7A 1JJ6C 5CQGA 3KYCB 3A01A 1TNTA 2ZXJA 3W6KB 1STZA 3QQAA 4Y15A 4PSXA 1XMKA 3BR0A 3OYFA 1GV2A 4RM2A 2Y9ZA 1X2NA 1VQ6I 2R7OA 1TQMA 2L4MA 2JTVA 2HZTA 2R7XA 4JBAA 4EJTA 1HQCA 1JHHA 4F93B 4II2A 1PYVA 3G1LA 3MQ0A 4PJMA 3SZTA 3PL8A 1JT0A 2UXNA 2H1KA 2QKMB 4JOMA 2EFWA 3MD2A 1MH4A 1K61A 4UB6C 5BS6A 4AYBA 2P5LC 1V5GA 2ELHA 2JPBA 3GTQJ 2I8DA 3EPZA 3LSIA 4D5CA 3F0CA 4WX9A 3RPUD 2AO9A 3BTIA 3FIWA 3RQ4A 5KAIC 3K0LA 1T0FC 1B72A 3F6OA 1IV6A 2IRFG 4ZJZA 2CRGA 5ICGA 5DCMB 3D1NI 2RN7A 5E8GA 4XRSA 5GADJ 4M6VA 2QQ9A 1JUPA 3HUGA 4YIFA 4B48A 4PDKA 4X0GA 4EMSA 1K83J 2A5WA 3HIFA 2PMZA 5D8LB 3K69A 3S3OA 2E34A 4ESJA 1KYZA 4PFOA 3GTPJ 2V26A 3OYKA 5GPAA 1HKSA 4IOAF 5AONA 4D1QA 4RS8A 2DYRH 4DJAA 2B7EA 1QPIA 2ZSIB 3REOA 1ETWA 4FISA 1E3OC 1DU0A 2BXZA 2V1NA 4QSHA 3S1QJ 4A3LJ 2KIQA 3H1CA 5JHFA 5DUIA 3CCUI 1B6AA 4A0YA 1JXSA 3BG9A 3GLLA 3CP8A 1A5JA 1J09A 4BHPA 1OCZH 4IF4A 5M5WJ 3LSMA 5LHIA 2TDXA 4I0BA 5IYCJ 2VASA 3PSFA 5CYVA 3H9JA 4YFXF 1G4DA 4QIWN 2ZXIA 2W57A 3M4OJ 2IAIA 3CC2I 4KA4A 1POGA 3HRUA 4LFUA 2HYFA 2ZB9A 2DDBA 5GAHJ 3TP3A 3CUQA 1SVMA 2JN6A 2NOGA 1O57A 2CH0A 1WHUA 5FKOA 2LTPA 1LDKB 1K4TA 1K79A 2LRDA 1ACIA 2HVSA 1E0EA 3U1KA 2HQAA 3ZMZA 2DO7A 3I5UA 3B6CA 3TP0A 3I56I 2HEOA 4RBOA 1K7AA 1DDNA 1XMAA 2XC7A 1YX3A 3KP6A 2L7ZA 2KKOA 4BDYA 4LB5A 3VOEA 2XROA 3FXOA 3BWGA 2HFHA 3KETA 5DD8A 2PBIA 5D8KB 4E7LA 2IS6A 4XIDA 3GEZA 2DYSH 4HLYA 2R7UA 1XN7A 2P5VA 3HOVJ 2DW4A 3MKWB 2CGPA 5FJ8J 4UHTA 5D4SA 2KIUA 3VB2A 1E2XA 1N25A 1NG7A 4OWRB 1O3RA 1H88C 2E7XA 3EYIA 4ITVA 3BG3A 2DA5A 4HBLA 3E6MA 1HSTA 4KN4X 2ZJ2A 4EJVA 3CCRI 2O6GE 3TEDA 5LGUA 5HS9A 2E1CA 1TP4A 2E35A 1R49A 4OIPF 3BPVA 3CJTB 3DP7A 3FF5A 3K1PA 1FJLA 2QENA 1YIJI 2B0LA 2VKHA 3N4MA 1F36A 3NQOA 2K7LA 3PO2J 1GT0C 4GO1A 1I3QJ 2FOWA 2JUCA 1XB4A 1FY7A 2GXBA 5EEGA 1YE9A 4NC6A 4AC0A 1HA8A 2VC0A 3TKYA 3PIPF 1ZG1A 1IN4A 1X1BA 3DPUA 2A05A 4K2EA 1DPUA 1Y8RB 3FXRA 4AIDA 5B5EC 3WGGA 5DM7F 4M3DA 1D1BA 5IP7J 2HPIA 4RB2C 2XGXA 4BQNA 3FBIB 1N78A 3GFJA 2WBMA 5K5RA 3CCSI 2R0QC 1TQIA 4ENJA 4HEA2 3ZMTA 1BJZA 4AWXB 2HOEA 2R92J 3RZOJ 2CUEA 2JVHA 3G71I 4HX7A 1Q1VA 3Q5FA 1D8JA 4BU2A 3U9GA 2NVUB 1L0OC 5DCMA 3U2RA 3OS2A 3P9KA 3DEWA 2LDUA 2ZXWH 4RAFA 4MTEA 4ZDPA 2JRTA 2FNPA 5IP9J 1APLC 3GW2A 2DMNA 3LFKA 3WE3A 4CYDA 2ACJA 1ORKA 5EZGA 5CLSA 4CA0A 1UAAA 3FXUA 4MTDA 3JSOA 5FROA 1GVJA 1X58A 1Z3XA 2CG4A 3F6VA 4DQ2A 1BR4A 4WWCA 2RNJA 1NHAA 3S3MA 2VIXA 2UUZA 3DF8A 1T98A 2DFEA 5FLVA 4GYGA 3OIPA 1X4OA 3J7ZI 2E1OA 4BKXA 2CQKA 2GOXB 2E2IJ 3HDDA 4HF2A 3ERMA 4BACA 3CUOA 3WTUC 5EEHA 2KMUA 2O03A 4XKBA 3GXOA 3CP2A 1F9NA 3K70D 3LSKA 3HB9A 5B1BH 1BL0A 2LP0A 3ZQCA 3S2DJ 3OIQA 4BBSJ 4D7NA 2FNAA 2IGNA 5KVRA 4OMZA 4RAZA 3O3KA 2P4WA 2COMA 3K2AA 5BMZA 2IS4A 3L09A 1U2WA 5EF6A 2W00A 1TT0A 1Y0NA 1SFKA 1KQ9A 5FRMA 4LK1F 5TISC 3TW6A 1D3YA 4ZYDA 4Z6YA 4FTHA 2IGOA 3ONQA 4A5NA 1VQ5I 2ZFWA 3K6GA 4W1UA 2X9DA 3W2VA 1Y0UA 2QZ8A 4ZYHA 4B3XA 3FWEA 5LFAA 5ICCA 2OD5A 2DCEA 1QPMA 1D0XA 1ENHA 1MW7A 2D1VA 3SHFA 5E1XA 1GVDA 1OYYA 3K7AJ 3M07A 1I27A 3MEXA 3S32A 3VYRB 5J8CA 4I76A 5D5WB 2ZC2A 3FXQA 4BJ5C 2Y30A 3ZQLA 1D0YA 1ZELA 3AL0B 2QGUA 4L5JA 1FX7A 2LH9A 2FBIA 3BT9A 1QO0D 1OCPA 3BTJA 4H4KC 3BQYA 2IP2A 2Q0OA 2UXXA 1XPXA 2E71A 4LG3A 5J40A 3I59B 5H20A 1J9IA 3C2GA 3CJRB 3FZVA 5CVUA 1F1ZA 3QP6A 4XLPF 3CJNA 3S2WA 4I0AA 4DW6A 4KMUX 1WH7A 1TLHB 3OSGA 1RZ4A 2KJCA 2XB5A 3CTAA 2EFPA 2DMTA 4PFPA 2R7RA 4CCOA 2VE8A 2JK3A 3FMRA 2LFBA 3K9TA 4I6ZA 3CJQB 1QVTA 1X1CA 2YS9A 2E5ZA 3L2UA 3GVAA 3ZXSA 1YJWI 3RCOA 2CU7A 4QPQA 3E97A 3ECHA 4F7ZA 2LY1A 4A3GJ 1FP2A 1R7JA 2MG4A 3T0YA 4HF1A 1BW6A 2HKOA 2QVOA 3HYIA 3K2ZA 2R5ZB 4A3MJ 4XMYA 3OYNA 3H35A 4BY7J 3LSJA 2BYVE 2LR8A 2Z16A 3U21A 1WWXA 1D0ZA 2LC2A 3GZ5A 1VQ9I 1Z77A 2AQFA 3HHHA 2CWEA 3VYSB 4RB0A 4Z2YA 1MBGA 2HOAA 3R0JA 4P5OA 4AD9A 4BHCA 3GZ6A 2VLAA 2CS3A 1QQIA 1QHHD 5HDNA 1PVEA 1JE8A 2OAZA 5F0CA 4RLQA 3VDXA 3DFGA 3WU1B 2MLKA 2YUSA 3EUAA 4X6AJ 2MC4A 2A07F 2NRAC 1P92A 3AG4H 4MEYF 3S1MJ 4B47A 3K1NA 4ZZLA 1WJFA 1W36D 2DLLA 3SZPA 5ERIA 1VNDA 1T6SA 2VE9A 2R7TA 3JRFA 3CZ6A 1S5LC 1S29A 2Z9OA 2A3SA 1LEBA 1OQYA 2M5WA 1DPRA 3HOWJ 3RIRA 1F43A 2PJPA 4RMNA 2LVSA 1WFXA 3ZOBA 4MNUA 2RV8A 5F27A 1ODDA 1PP7U 3OR2C 3T5XA 2NNNA 3DTKA 2FBHA 2VJIA 2IJLA 3CQZJ 1FPQA 2XF7A 3LA2A 4M6XA 1BM9A 1FYMA 1RKTA 1Z0XA 1HKTA 3S14J 3IAS2 4HW0A 4MGRA 1FIPA 1OLTA 2FOKA 4ENKA 3DXJF 3WTWC 2CQXA 5LRSA 1R5GA 2WY7Q 2YU9J 3ZMUA 4YRVA 5HOOA 1H8AC 2OTJI 4HZFA 5ILUA 4Y7NJ 2H1LA 2ISZA 1Z67A 3IAM2 1YITI 4HAMA 2CW0F 4D0PA 2EV6A 3CESA 3FMQA 2EB7A 1UHSA 3LAPA 2XGCA 2NOJB 1BI2A 1MIJA 3DPLC 5IYBJ 5BPIA 3ZPLA 2HR3A 2K9LA 5CPRB 1XGMA 3FM5A 3BC8A 3CDIA 1HBXG 1UG2A 1ON1A 2RC4A 1X3WB 4BXXJ 4XNFA 4D5FA 4A3IJ 2WB1N 4NNJA 2P6TA 4IRGA 1MSEC 1ZG5A 2VI6A 5AIPA 3IRQA 4MO7A 1D5VA 2A5YB 3QU3A 2KHMA 3V8JA 5L3CA 5A2QZ 2LKPA 2W25A 1W4MA 2J5OA 4QPOA 3TO9A 2JA5J 3L1PA 2V79A 1Y8QB 1BOBA 2FMYA 4XLHA 1ZGWA 1S6LA 3QOPA 2A6TA 4LB6B 1JKPC 2XHKA 3I59A 2FA5A 2M1BA 2HNHA 3PM1A 5B66C 1WVRA 2B9SA 2C6YA 1VZ0A 1ZKGA 2YX4A 3I3LA 2A61A 2HU9A 2DA7A 1BR2A 3E5XA 5C3EJ 2XAGA 3HHGA 3ABLH 3TDZC 3ERED 1XCBA 4PGHA 2KLOA 1IO2A 1K6YA 1EH8A 4KYWA 2ZXHA 2X6XA 4XN3A 4G7OF 2WAQA 3F72A 4Q48A 4OMYA 1UZCA 1NK3P 3DEUA 1SD6A 2CMPA 4MFEA 2DQRA 2EFQA 4JX4A 2R5ZA 1QA6A 2DJNA 3HSEA 2QWWA 3RZDJ 1WI3A 5H6RA 4L0ZB 1R36A 1F4KA 2NAZA 1DGWY 3HOUJ 2VOPA 3HPHA 1B8IB 1AHDP 3VSKA 3SJMA 2EIJH 5FFXA 3IC7A 3PFYA 4YIIA 3G2BA 5DEQA 4UY8I 2QEXI 4ZYAA 3L2WA 2NVYJ 2E7WA 2E60A 3T8TA 5HLTA 4HOBA 5HS8A 1MBJA 3WTVC 1YJ9I 1J2XA 4AIKA 2BVLA 4CZCA 4RGSA 1FTTA 4BXUA 2L4AA 3HPGA 4UVCA 5FB2A 1EV7A 4IVNA 2VBXA 4HDVA 1SAXA 1IV8A 4FCYA 5HDGA 3TW7A 1H89C 4LD5A 5FKMA 1AU7A 4Y3OA 2X6WA 4YELA 1PDNC 4B09A 4UUVA 3VSLA 5EYRA 1YIOA 2K3FA 1JKOC 4IHWA 2NVXJ 3RKWA 1BBYA 2F5DA 4HNVA 2V6EA 1GV5A 2OV7A 4Y17A 4BE0A 4XM3A 5FO5A 1MJ9A 3CCMI 3OOPA 3F8MA 3Q9VA 3IWZA 5DTDA 2EA2A 1YS7A 4I99C 3OYGA 1LFBA 1HW2A 5DM6F 1Z1DA 3BG5A 2HWVA 1LDDA 4L9NA 1WJAA 2Z99A 1FIAA 1WJDA 1J5YA 3ZCOA 3OYEA 1MKMA 4XONA 2M9HA 4A12A 2UZKA 3BR2A 4CH7A 2L9SA 3TL4X 3KP3A 1WJ5A 2XAJA 3W6JB 1CGPA 2LY2A 3IV5A 4M9XA 3GFMA 1ERDA 3JSPA 2JJ7A 4BE1A 2ESNA 1RESA 4OU0A 2ZCWA 4ZH4F 1SFUA 3BP8A 3T8RA 2VBZA 5FKKA 4DOZA 4RAYA 2LBFB 2Y9YA 1FWZA 1G3YA 2WAEA 2R7VA 2MA3A 2RGVA 1TTYA 2RQPA 3LOCA 1ETVA 1ZARA 3V7SA 2L7MP 3BY6A 5EG0B 1ON2A 2VXDA 3HBLA 2M30A 1SMTA 3E6DA 2CUFA 3ABMH 3M8FA 4GFBA 4L0YB 3E5QA 4H0EA 1LQ1A 4V2GA 1OISA 2AQEA 2L01A 2L5QA 3PUFA 1R71A 2P5KA 2L9NA 3CMAI 1FNNA 1LPQA 1I6HJ 1TC3C 1KU9A 4DYRA 4EV0A 1LE8B 1OKRA 2EK5A 1YFHA 4F91B 1U5TB 2F4OB 2H94A 2ISYA 4G12A 4RGRA 3OYHA 1YJNI 1OCTC 2MYSA 2Y69H 4LITA 3M8EA 4ZC3A 5E20A 3BR1A 4M3FA 4A3EJ 3F22A 1ZREA 1KZHA 2O8KA 2VPRA 5D6EA 5IY5H 2VXZA 4CO8A 3R4KA 4EJOA 2DODA 1J75A 2BOLA 1OYWA 4EQQA 2GZWA 2EFOA 4G9YA 4ZDLA 1D5YA 2CW7A 2FF4A 1U5TC 4O3MA 3OYBA 2Y0SN 3H3ZA 4WCGA 2IS1A 3KP2A 4W97A 1FP1D 3L7WA 1RUNA 1ZGAA 5D5UB 1IUFA 2HVRA 3ABTA 1YW9A 3AG1H 2ZJQF 2F2EA 2FMLA 4OAZA 1KYWA 4LLGF 2LYCA 2MW8A 2VOOA 2JA7J 4DGWB 3PNTA 4Y52J 3TO7A 2XIGA 5EEAA 3OL4A 1UMQA 4P55A 1ITYA 2JQ7A 2PLYA 3ABKH 4FETA 2KRCA 5FKLA 5C4XJ 3ZRGA 1P7JA 3OV8A 4OIQF 5GTHC 3I58A 3QPLA 3DTEA 4JK1X 1KU2A 1G2HA 3O6BB 2H8WA 4HF0A 3M1EA 1DU6A 4FT8A 2MD0A 4L5IA 2V6CA 2OQRA 2QSGX 2O8XA 2M87A 5DV5A 1W5SA 2STWA 4LJZF 1IXSB 2DJIA 5IOYA 4NDLA 3OOUA 3BJ6A 1NG6A 4WK8F 2YSRA 2ETHA 3I4NJ 3HM5A 2XASA 2P6SA 4JP0A 4UVAA 2P8TA 4PZJA 2WY8Q 1U9NA 3HXLA 2R5YB 1RR7A 2Q1ZB 2V9VA 2LNBA 3KZZA 1R5HA 1IRGA 3OYIA 5DCFA 1YLFA 4UUTA 3KFWX 4S0HB 1S7AA 1QZEA 4IQ4A 3JRAA 1K78B 3B73A 1UCRA 5F1RA 1OR7C 2DT6A 4IHSA 2CUZA 2W1OA 1WI9A 5FFZA 2GLOA 1S8NA 4NQWB 3JCUC 3QAHA 2DPDA 3HRMA 4M74A 3KE2A 3COAC 3A02A 2GXGA 3SEZA 4EEFG 2CV2A 2JA6J 3KEQA 4F3QA 2FRHA 3KP7A 2GQQA 1ETYA 2M7AA 2R7DA 5ICEA 1RETA 2KZGA 2LBFA 3EYYA 2F48A 4IXAA 3CLOA 4KFCA 3QU6A 1HKQA 3FKJA 4WXHA 1KU3A 3S8PA 1VI0A 2VKVA 3LWFA 4XN0A 2WTEA 2IA1A 4LIUA 4ZTJA 4C2UA 1JKQC 4EVIA 5EDNA 3O8GA 4CHUA 4N9IA 5EG0A 2R7QA 1VQ7I 1Z9CA 1K6OA 1SVOA 3GX4X 2FE3A 1IRFA 2J5PA 2R93J 2XKOA 4TV7A 4F55A 2BY1A 3MMYB 3F9KA 2VODA 1T0FA 3J80Z 1J7KA 2RDPA 2X0LA 1UHWA 1K4SA 2CO5A 3M8JA 5HDKA 1Z6RA 4Y33A 4BJTA 2V1XA 2MH2A 3OS0A 1IF1A 5IPAA 4XLCA 1R00A 2JMWA 3G1OA 4E70A 3I4MJ 4C9YA 1ZN2A 4G7ZF 2IA2A 3FHZA 3AG3H 2M0CA 4XKCA 4LG0B 2ADUA 5JLXA 3OYJA 1LE8A 4EGYA 1T33A 2OQGA 2VN2A 4XRMA 5D6FA 2R7FA 4D9JA 2PG4A 4L9JA 3J7AY 1U5TA 4OIRF 5IT9Z 2VT2A 2KRFA 1VF9A 2W4SA 1TW3A 3LA7A 4M3EA 2E19A 4P1WA 5J1UA 9ANTA 2CYYA 2R7ZJ 2DAOA 4PGGA 1D1CA 4ENMA 1MNEA 1YW7A 2X1CA 4Q47A 5LGNA 4E4HA 3JRIA 3QPSA 1M1EB 3MFKA 2DMPA 1BA5A 1IDYA 1G8XA 1QVUA 1U8BA 3L00A 1V55H 3K4JA 2JSPA 4KT6A 2N8GA 2YPRA 3KIOA 5F64A 3VODA 1X1DA 3MWMA 5TRDA 3FMSA 1Z91A 4FQGA 1VQNI 3QWLA 2D45A 1FOYA 1D8KA 3PUBA 5GPCA 1MH3A 3K1MA 1R4MB 2KQRA 3FK7A 3RQIA 2M0MA 3BTCA 4U87A 5FGMA 1DP7P 3IKTA 1EH7A 3RDIA 1XDSA 3WU2C 1R58A 2O7OA 3SDGA 2R4GA 3EUHC 2IS2A 3GUDA 4A6EA 2LK2A 3WODF 3F21A 1SD7A 3FDYA 2FX0A 3GTLJ 2ZKZA 2P7VB 4KIFA 5LRRA 3VPRA 5M3MJ 2KL4A 2NXNB 3MZHA 2H09A 3J81Z 2DTZA 3DBRB 1VQMI 4RLFA 2GA1A 1JT6A 1LFUP 4KIBA 1TBXA 1I5ZA 4OAYA 5ED4A 3W2AA 5H6QA 1LNWA 3PNYA 4ETSA 1OCCH 2XKPA 2HZDA 1Q1HA 3PNVA 2X51A 1W0UA 3MZYA 1X3ZB 4IOCF 1SAUA 3RSNA 3CMYA 3B6AA 2M2EA 1HW5A 4I09A 3QPTA 2QA4I 1IN8A 5IT9K 4HG2A 1FOKA 3DBLB 1BC7C 4S04A 2L9RA 3HKZN 3X2QH 2E1NA 1VQOI 1QBJA 2XV4S 2DMUA 2KT0A 2BHZA 2VC1A 1OR7A 3OR1C 2DXIA 1IZ1A 2KFDA 3CDHA 5L3BA 4C3JJ 2NS0A 2XF6A 1Y1VJ 2LREA 4UB8C 4UVBA 3BROA 4NC7A 4BEHB 1JKRC 1MNDA 2HXOA 5DD4A 2L9VA 1PUEE 5EGOB 1K78A 4HLXA 3F8BA 3IL2A 1DGRM 1XDUA 3TQNA 1X1AA 3HZJA 3OS1A 4NQWA 3RKYA 3JAMZ 2K9NA 1ETOA 3HOXJ 2FXAA 3RYRA 3JRDA 5JI6A 1B9MA 1JTYA 1JJ8C 2D1HA 3GTJJ 3S16J 2PQ8A 4O6JA 3DPTA 1FC3A 5LBQA 3DKWA 1GXQA 3WGIA 1RC9A 4IJAA 2M8EA 1UELB 4XSXF 4BL0B 2K85A 5JVGF 2FBKA 2KJBA 1FT9A 3G3ZA 2X1DA 1BI1A 4WF2A 2XPVA 2BY3A 1BOAA 2NS7A 4V19K 3ELKA 2P7CB 3ISPA 3BZKA 2OJED 1EA3A 2LLKA 2FQ4A 1WQ2A 4HA8A 4DZJA 1PUFB 2DDAA 4GGGA 2P0WA 3A2KA 4UNOA 1MBKA 2DTRA 2X85A 3WE2A 2RQQA 1YQAA 5M5YJ 4G6TB 3HRSA 3BZCA 3ML6A 1TWAJ 2RAEA 4HYEA 2QCOA 2Y0MA 2CUJA 2JA2A 5DYMA 5LHGA 5J1RA 1PJRA 3NARA 3IKVA 3KZYA 3SEQA 4LG0A 2FD5A 4XRFA 2QSFX 3FXLA 3D5SC 3L2QA 3HJEA 2KPMA 2QUFA 2K40A 1TQPA 3TOBA 2ZMEB 3BG7A 3ZN0A 1W5TA 3SDBA 4J00A 2EFNA 4L9VA 1P4AA 2AXLA 2ME0A 2M7BA 1G6NA 2FSWA 5E3LA 3JRBA 5KK1A 4XL9A 2O0YA 2I5UA 4BQQA 4IHTA 2OCEA 4AVPA 1X2MA 1Z7UA 3GTOJ 2G0EA 3PSIA 2M4GA 1N77A 2HGCA 2W85A 5FLXZ 3FK6A 1U78A 1AKHB 4FX0A 2MLGA 5CQEA 4IL6C 1E3HA 1JHFA 2ZMEC 1B4AA 3JAMK 2WV1A 2HOSA 1RNLA 3LQQA 2GXAA 2EWNA 3ZMSA 1LVAA 1FYKA 3EUHA 1O7FA 1VQKI 3B02A 4A69C 1LB2A 3GWZA 4GDFA 1RPWA 3UR3C 2GBYA 1IN6A 1XC5A 5BPDA 2XUBA 3E7LA 4KNYA 5L3DA 2OA4A 2EZHA 2G7HA 2XAUA 3FXKA 3GMEA 4GYIA 1IUYA 2F5CA 3HGYA 5EZHA 3UNGC 2RVCA 3L9FA 5L3EA 2Z2SB 5CVRA 3L2CA 1XSVA 4PK4A 2DK8A 4XOPA 3G73A 3BQZA 4EJWA 5LGTA 2ZSHB 1ZRCA 1FSHA 2HYJA 5LLQA 1L3LA 1R9TJ 2VPLA 1HW1A 4DBQA 1YYVA 2BY2A 3P7NA 2F6CA 2O9LA 1A6QA 5BOXA 1XGOA 2VKEA 2H27A 2CFOA 4UV8A 3LQRA 2DOEA 2ID6A 2IT0A 2R7WA 3S3NA 1MMSA 1O4XA 1ETKA 1MGTA 3FX3A 3OL3A 4CSWA 1OFCX 3HSFA 3WTYC 1HDPA 4U7DA 1REPC 2HDDA 2DU9A 1MD0A 2K4BA 3RI4A 2XGEA 2P81A 4I01A 2KRHA 5FLXK 3W2WA 3C18A 1MJBA 3QODA 1DP3A 3KYDB 3CCVI 2ZO4A 3ZQQA 3RKXA 1U6GA 4U0VA 2M3AA 3I0TA 4ON0A 4RAGA 1HCRA 2A69F 3E0JB 5HNFA 3HKZA 2W48A 4BEHA 3GTKJ 1EF4A 2PJRB 5M5XJ 5LHHA 5EGOA 2VT3A 3BJAA 5F0FA 3Q3SA 4AYBN 3DTIA 2KP6A 1I1GA 3K4NA 3LSTA 4ABZA
chains in the Genus database with same CATH topology
2BW3B 2AQEA 2L5QA 3K4LA 2W7NA 1YE9A 3OY9A 2L9NA 1HA8A 3AL0C 4ZTFA 1X1BA 3DPUA 2VQLA 4R79A 3OYMA 1D1BA 1V5FA 4DIQA 2HPIA 1BR1A 4F91B 4BQNA 2CV1A 3FBIB 1N78A 2MABA 2WBMA 5FRNA 3OYHA 3M1CA 4HEA2 2MYSA 3H5NA 3DKYA 4LITA 1WJBA 4ZC3A 2WAFA 4XKVA 4PJNA 3LSGA 2JVHA 4DBRA 1Z3YA 2VXZA 2BOLA 3EUKL 3KYLA 4ZDLA 4F52A 1YX5A 2CW7A 4N4NB 4AU7A 4BU2A 3GBGA 2V4JC 3OYBA 3OS2A 4KJZA 4ZDPA 2IS1A 3QOEA 4HNUA 5HNHA 2JVGA 3QYFA 4AVZA 2HVRA 2UWMA 3OYDA 2GOMA 4CA0A 3ZGKA 1UAAA 2ELJA 2K3PA 5FROA 1TZLA 4OAZA 1Z3XA 2LYCA 1JI8A 3C2HA 4DGWB 1BR4A 3HL2A 3PNTA 1Z7LA 3S3MA 3OL4A 2VJ5A 2DOAA 2VIXA 2UUZA 4FETA 2KRCA 3ZRGA 4BJ6C 2FUG2 1LFPA 4ANJA 3OIPA 1X4OA 2VB6A 3DTEA 4HRIA 2GOXB 1KONA 4XOTA 2MD0A 2XF5A 4BACA 3FHNA 3VYTB 4HSRA 3A1YA 4LIVA 2KMUA 1D1AA 2L2OA 3D5LA 4XKBA 3BCAA 3CP2A 1U0JA 2DJIA 3K70D 3LSKA 4F92B 3OOUA 3DEEA 4CCKA 1NG6A 3OIQA 1QU3A 3K10A 3H9QA 4J01A 3OYAA 2IGNA 3DKXA 1Y56A 4BDZA 2IS4A 2WY8Q 4FASD 4XKWA 3HXLA 2W00A 1TT0A 2Q1ZB 3HC7A 3AFHA 3CMMA 3H5AA 1SFKA 5FRMA 4E7ZA 2IGOA 1MMGA 2M4KA 3OYIA 3ONQA 2BVMA 3K6GA 3W2VA 1V5EA 2WA0A 4NC8A 4IQ4A 5LFAA 4B3XA 4KITB 3H0DA 3I9V2 4PJJA 2DCEA 1QHGA 1D0XA 1OR7C 2DT6A 3MKYB 1MW7A 4E7KA 2CUZA 2W1OA 3OYLA 3NWSA 5KHDA 4NQWB 4BE2A 3E1SA 3QYEA 1LKXA 4HNTA 4N4OB 3S32A 3VYRB 2KDOA 4BJ5C 3SEZA 2CV2A 3BG6A 1D0YA 3K4BA 1ZELA 3AL0B 1T95A 4F3QA 2LH9A 4CCJA 2HPMA 2M7AA 4H4KC 2LBFA 4E7HA 4LG3A 3BCBA 3C2GA 3CJRB 3DLAA 4HPQA 3LFUA 3FKJA 3S8PA 3KEYA 4XN0A 4LIUA 4ZTJA 4C2UA 1P9QC 2R7QA 4BUPA 3H9GA 2WB1A 4F55A 4PFPA 2R7RA 2PJRA 3MMYB 4CCOA 2F4IA 4IZZA 3F9KA 3CJQB 3L2UA 1X1CA 5TGTA 2E5ZA 4CUGA 4ZDOA 3ZXSA 2F5VA 3RCOA 4QPQA 3M8JA 2LY1A 4Y33A 4BJTA 5HVQC 2BW3A 3OS0A 1S9HA 4XLCA 3HUGB 4XMYA 3OYNA 3H35A 4HSTA 4C9YA 4XKCA 2Z16A 3U21A 4XLFA 3OYJA 2K9MA 1D0ZA 2HVQA 2LC2A 2X1EA 1UG0A 2W82A 4D9JA 3V42A 2AQFA 3J7AY 4C2TA 3VYSB 2L7KA 2CV0A 4P5OA 2W4SA 4U7BA 2IGMA 2RREA 2VLAA 2CS3A 4P1WA 1QHHD 2XDVA 3OYCA 3D5RC 1D1CA 4RLQA 3VDXA 1MNEA 3EUAA 2X1CA 4E4HA 2MC4A 4E7JA 3H5RA 4BQOA 3DQVC 4B47A 1G8XA 4GRIA 1WJFA 3AKZA 1W36D 4C30A 3K4JA 2JSPA 4KT6A 3OWTA 2R7TA 3CZ6A 1X1DA 2DT7B 1G59A 2Z1DA 3W3CA 1Z21A 4XORA 3PUBA 2MFZA 2KQRA 4RMNA 4BXFA 2M0MA 1WFXA 1X19A 2KZVA 3LSHA 4U87A 5CKTA 3K4MA 1X4PA 3DWLE 2R4GA 3EUHC 2HDWA 3K4KA 2IS2A 4E7SA 3OR2C 2LG4A 3DTKA 3FDYA 2VJIA 1W36C 4II3A 2KL4A 2OUMA 2XF7A 4JQFA 5KNLA 3K4CA 4BGDA 2VQCA 3IAS2 4RLFA 2E1MB 3NWTA 4XLAA 4CCMA 2V9KA 2V7FA 1DQUA 3OMYA 4XR6A 3ZR8X 4E6KG 2VJJA 1OLTA 1Y6IA 3IP4B 4OAYA 4PJLA 3W2AA 4BS9A 3PNYA 2LOOA 2HZDA 2WY7Q 3VWBA 3PNVA 2X51A 1MMNA 4YEJA 2JUGA 1SAUA 3RSNA 3BLYA 4YRVA 5HOOA 3CF2A 2VJ4A 2E1MC 4HG2A 3SZGA 4IQJA 3K70C 2VQHA 3IAM2 1AA7A 5LD2C 3CESA 1WJCA 4PUSA 3OR1C 2DXIA 2NOJB 3DPLC 1IRXA 2XF6A 2K9LA 2LREA 2RNGA 5CPRB 4IKFA 3BC8A 4NC7A 1WJEA 4BEHB 1MNDA 2R7SA 4XNFA 4NNJA 1DGRM 4E7IA 4B43A 1X1AA 2X6YA 5CQGA 3OS1A 3KX2A 4CCLA 2KHMA 4PSXA 3OYFA 4RM2A 4QPOA 2R7OA 3DPTA 4EATA 4Y4RA 1BOBA 4BL0B 2R7XA 1UELB 4F93B 4XLHA 4II2A 1PYVA 2A6TA 3N05A 4PJMA 2VKDA 2X1DA 3PL8A 2HNHA 2QKMB 4JOMA 3MD2A 3HOSA 1VZ0A 3I3LA 4AYBA 1V5GA 2HU9A 1BR2A 2I8DA 3EPZA 1EA3A 3LSIA 2IXSA 2KLOA 1K6YA 3RPUD 2ZXHA 2X6XA 4XN3A 3RQ4A 2WAQA 2E5NA 1T0FC 3A2KA 2P0WA 3HOTA 3IUOA 2X85A 4CCNA 4ZJZA 2CMPA 2RQQA 4XLEA 3DU5A 4G6TB 4B48A 4X0GA 2CUJA 2JA2A 2A5WA 1PJRA 2PMZA 2CW8A 1DGWY 2Q2EB 3SEQA 1N75A 3S3OA 3HPHA 3L2QA 3D5SC 4NUBA 2KPMA 2VQGA 4PFOA 3VSKA 2V26A 3OYKA 3PFYA 3BG7A 1R6RA 3HG9A 3SDBA 4J00A 2M7BA 3G2BA 4D1QA 4DJAA 4XL9A 4ZYAA 3L2WA 2ZSIB 4BQQA 2WADA 2E60A 3VYUB 3L2VA 2V1NA 3PSIA 2M4GA 5HLTA 1N77A 2UV1A 4XQFA 5JHFA 2BVLA 5CQEA 4CZCA 2Y0SA 3FBNB 3HPGA 3CP8A 1J09A 4PSWA 2IGKA 3LSMA 3LMMA 4Y3OA 2VASA 2X6WA 3PSFA 3H9JA 4YELA 3VSLA 2QKLB 2ZXIA 3PJRA 3UR3C 3TMOA 2XAUA 2V6EA 2OV7A 4BE0A 4XM3A 3UNGC 4B44A 2CH0A 2Z2SB 4RM3A 2XSJC 3SYTA 1LDKB 4PK4A 2LRDA 4XOPA 3OYGA 3RTRA 2HVSA 2ZSHB 1E0EA 1FMWA 2HQAA 1WJAA 2VPLA 4DBQA 1WJDA 3ZCOA 2F6CA 3OYEA 4XONA 2XC7A 1YX3A 4CH7A 2O5RA 2L9SA 4BDYA 2VL8A 3TL4X 2CFOA 1WJ5A 3TBIA 4KISA 2LY2A 3MKZA 2R7WA 3S3NA 4E7LA 1GLNA 2IS6A 1ERDA 3OL3A 2R7UA 4BE1A 5KCMA 4CSWA 3QYBA 3MKWB 4IX7A 3A4CA 2OC6A 1MMAA 1FMVA 4DOZA 1NG7A 2LBFB 4OWRB 4ITVA 3LL7A 2KRHA 2ZFUA 2WAEA 3W2WA 3L2RA 2R7VA 3DU6A 3QODA 4MLOA 1DP3A 3ZQQA 1LVKA 2M3AA 3E0JB 5HNFA 3HKZA 4BEHA 1MMDA 2VXDA 2PJRB 3DTIA 2VKHA 2KP6A 3K4NA 3S93A 2K5CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT6 A;  3PNT A; 
#chains in the Genus database with same CATH topology
 3LA3 A;  2ZJP F;  3R0A A;  2W84 A;  2EZL A;  3RKQ A;  1I50 J;  3OY9 A;  2M34 A;  3WHC A;  1PP8 F;  2PX9 A;  1A35 A;  4A0Z A;  3JRE A;  1NTC A;  3BOQ A;  3NEU A;  5EJC A;  1UHM A;  2QSH X;  2EA4 A;  3S1N J;  5J4V A;  3JRG A;  2PMZ N;  3OYM A;  2DPU A;  1V5F A;  3V7C A;  4MEX F;  5C4J J;  1BR1 A;  3JTG A;  1G3S A;  1ZGJ A;  2DT5 A;  3WU0 A;  2L54 A;  2XAF A;  3M1C A;  4D7M A;  4FX4 A;  3H5N A;  2QLZ A;  2Q8K A;  2JT1 A;  4PJN A;  3LSG A;  2XPW A;  4DBR A;  4MQ9 F;  3GFI A;  2ZNY A;  4DNC A;  1KA8 A;  1PUF A;  1E3P A;  1YX5 A;  4N4N B;  4AU7 A;  2EV0 A;  1MBE A;  1ETQ A;  3ASN H;  3FM3 A;  5E17 F;  5E8I A;  3ROU A;  1WPK A;  2XVC A;  1F5T A;  2A6H F;  3H3V K;  4G6Q A;  2CQQ A;  3CO6 C;  4IRI A;  3GO5 A;  2KIM A;  4AUX A;  4AVZ A;  2UWM A;  3OYD A;  3G4S I;  3ZGK A;  4BHB A;  2K3P A;  2K27 A;  4EGZ A;  1TZL A;  2LSO A;  2ZME A;  2CSO A;  2OPT A;  2V1D A;  5L3G A;  3S15 J;  3C2H A;  1IRZ A;  5A2Q K;  2BEO A;  4RGX A;  3HL2 A;  2IBD A;  1Z7L A;  2DN0 A;  4WXC A;  2VJ5 A;  1X3U A;  3E3V A;  5JVT A;  2DOA A;  4CDG A;  2HKX A;  2G7U A;  4CXF A;  3E6B A;  4CZZ A;  1KQ0 A;  4BJ6 C;  1LFP A;  1G3W A;  4XSZ F;  3LAJ A;  1FYL A;  1AKH A;  5FKN A;  2OTL I;  4M71 A;  4HRI A;  1ZLK A;  4DYC A;  4ESB A;  3J7Y J;  3BR6 A;  1XG1 A;  4XOT A;  2DMQ A;  2XF5 A;  1HSJ A;  1R4N B;  2ZNZ A;  3FHN A;  4P9U A;  3N97 A;  4LMY A;  4HSR A;  1OPC A;  5F6F A;  2JWT A;  1BC8 C;  3A1Y A;  1UST A;  4LIV A;  1Y39 A;  4RB1 A;  2L2O A;  3GTG J;  1ZR4 A;  3BCA A;  1U0J A;  4F92 B;  2K9S A;  4LOC A;  4M6Y A;  3FIS A;  4AIH A;  4CCK A;  5K7Z A;  2LKX A;  4BH9 A;  1C0W A;  2QM3 A;  5D5V B;  3H9Q A;  5K7H A;  3OYA A;  3DKX A;  2DA3 A;  1BI3 A;  3EDP A;  4XKW A;  5JLW A;  3AFH A;  3H5A A;  3AAF A;  1YOV B;  4E7Z A;  4G7H F;  4PCQ A;  1SMY F;  2M4K A;  5HLG A;  1BIB A;  2BVM A;  4WXD A;  1XSD A;  1KQ8 A;  1V5E A;  6PAX A;  2WA0 A;  4NC8 A;  3H0D A;  5D5X B;  4UXN A;  1EH6 A;  3Q9S A;  3MKY B;  4N9H A;  4E7K A;  4Q5S F;  3ZQ7 A;  4IHV A;  3GFL A;  2PN6 A;  3E1S A;  4BE2 A;  4S05 A;  1LKX A;  1WGX A;  4XBF A;  3HRT A;  4N4O B;  2MH9 A;  2XAH A;  3TGN A;  4B4C A;  4UUS B;  3BG6 A;  2KDZ A;  3DLL F;  2ZJR F;  1W0T A;  2B63 J;  4CCJ A;  4P96 A;  3JRC A;  1ULY A;  3WTZ A;  3HTS B;  3BCB A;  3CD6 I;  2PMU A;  5GAG J;  4HPQ A;  1VQ8 I;  2E36 A;  3KEY A;  5E3N A;  2X4H A;  5E3M A;  3JRH A;  2EH3 A;  3C7J A;  4LK0 F;  1A04 A;  2K9Q A;  4J19 A;  4BUP A;  3EET A;  2Y31 A;  3ESW B;  3H9G A;  2WB1 A;  3TOA A;  5K5O A;  1FLI A;  2PJR A;  4FE7 A;  2OBP A;  1HOM A;  3IHU A;  2CQN A;  5TGT A;  3P9I A;  2F5V A;  4A5M A;  3UKG A;  2RKH A;  2HDC A;  3S17 J;  4ENN A;  5GTI C;  2NS8 A;  2PI0 A;  2JRM A;  2HTJ A;  1TWH J;  1FOW A;  1WKM A;  2GAU A;  2IW5 A;  3G1M A;  1IDZ A;  5HLI A;  2I10 A;  3O8H A;  4XLF A;  3ULQ B;  2DBB A;  2HVQ A;  2X1E A;  2DK5 A;  2Y75 A;  1T2K A;  3V42 A;  2MSY A;  4ZZD A;  3GZN B;  5CVJ A;  1P7I A;  1R1V A;  4C2T A;  1RUO A;  2L7K A;  1FSE A;  1FEX A;  1RIO H;  2A6E F;  1SFO J;  4HX8 A;  4CYC B;  1VQP I;  5HOD A;  1VQL I;  1JUM A;  2PFB A;  3KP5 A;  2HI3 A;  2LF8 A;  2QBY B;  2EZK A;  3BTL A;  1B8I A;  4I2O A;  3H92 A;  3H5R A;  4BQO A;  1EKE A;  5FLM J;  4C30 A;  2EIK H;  4IHY A;  4M72 A;  4NB5 A;  4KMF A;  2G9W A;  2DT7 B;  1ZRF A;  1G59 A;  5IP6 A;  3HEF A;  2R3S A;  3W3C A;  3M9A A;  3DBH B;  3RYP A;  3V8L A;  2MFZ A;  4HV5 A;  5J8F A;  2DOF A;  1Z05 A;  1X19 A;  1IAW A;  4EM2 A;  2DFF A;  2JZY A;  5B1A H;  5E79 C;  5IT3 A;  2HDW A;  2YX7 A;  2XSD C;  1VFC A;  4A3J J;  3HGG A;  4E7S A;  2X48 A;  2HQN A;  1E17 A;  2LG4 A;  1ETX A;  1ZTR A;  3ASO H;  1S7O A;  1OCR H;  1USS A;  3GCM A;  1W36 C;  1HXD A;  2OUM A;  4B3A A;  3K4C A;  2VQC A;  3NWT A;  4CCM A;  2V9K A;  2V7F A;  1DQU A;  3CLQ A;  3OMY A;  3ZR8 X;  3MKL A;  1Y6I A;  3IP4 B;  4M9S A;  4PJL A;  5BNG A;  3ZQI A;  4BS9 A;  2LOO A;  1HLV A;  3VWB A;  3LSP A;  2DFH A;  1EJ9 A;  1FTZ A;  3BLY A;  4QLC U;  5F1J A;  4BY1 J;  1V54 H;  3CF2 A;  2VJ4 A;  3P9C A;  3IH4 A;  2LY9 A;  3SZG A;  4IQJ A;  2XRL A;  3BR3 A;  1YS6 A;  5LD2 C;  2EIM H;  3E5U A;  1WJC A;  1U3E M;  3ZMD A;  4U0W A;  3E6C C;  3WG9 A;  5F08 A;  4NBQ A;  3KZI C;  1IRX A;  4HQM A;  2PMH A;  3ZP5 A;  3C1D A;  5ICF A;  2XB0 X;  2L02 A;  3KLO A;  5M3F J;  4OOI A;  4M73 A;  2NYX A;  1H0M A;  1V4R A;  2E2H J;  3A0H C;  1ZAO A;  4R8H A;  1GHC A;  2X6Y A;  1FZP B;  1I1S A;  3KX2 A;  3U1D A;  1WCM J;  2A68 F;  4KT5 C;  4MHG A;  4CCL A;  3FXJ A;  4UUS A;  3WTS C;  1SFX A;  5K1Y A;  4L9T A;  1IXC A;  1O3S A;  4EAT A;  1MBH A;  2D2W A;  4Y4R A;  3CCL I;  1KU7 A;  5DUK A;  2K02 A;  2OCC H;  5JHU A;  2ME6 A;  2EJR A;  3DV8 A;  3N05 A;  2VKD A;  3H36 A;  1RKW A;  3R6S A;  3MVP A;  1YG2 A;  2MBF A;  2H6B A;  2JA8 J;  1P4X A;  3HOS A;  4A3C J;  4KN7 X;  4A3F J;  2GWR A;  2FQ3 A;  3CCY A;  3WTT C;  1RI7 A;  2IXS A;  1WZ2 A;  5F04 A;  4HDU A;  5JFR A;  2E5N A;  5E1Z B;  4FHT A;  1QZZ A;  1WRJ A;  3F3X A;  3NRV A;  3HOT A;  3IUO A;  4CCN A;  2AXT C;  4XLE A;  1HC8 A;  5GAE J;  3DU5 A;  3RPQ A;  2Y48 A;  1ONV A;  1IGN A;  1SVL A;  5E18 F;  1W5C C;  2CW8 A;  2Q2E B;  1N75 A;  4ASN A;  5K7F A;  1J0R A;  3CCJ I;  4NUB A;  2VQG A;  5CVV A;  4KIC A;  3JTH A;  3KEO A;  3F8F A;  1R6R A;  3HG9 A;  1T38 A;  2ID3 A;  3MAJ A;  2L3D A;  5GP9 A;  1T08 B;  2LMD A;  4CYC A;  2WAD A;  3VYU B;  3L2V A;  1MJA A;  1S72 I;  2AHQ A;  1T39 A;  1W7P B;  2UV1 A;  1SFE A;  3EQL F;  2DA6 A;  4M3B A;  2QBY A;  4XQF A;  4BBR J;  2V1U A;  2NNY A;  2Y0S A;  3FBN B;  3KLN A;  1VQ4 I;  4LLL A;  4V2F A;  5LEK A;  4IHX A;  4PSW A;  4YIR X;  1ZG3 A;  2IGK A;  3LMM A;  5J3L A;  4IRH A;  1ZR2 A;  2CFX A;  1T56 A;  4Q4Z F;  4BQA A;  2QKL B;  3PJR A;  3J80 K;  3LSR A;  2EV5 A;  3TMO A;  4I02 A;  4G6D A;  3BDD A;  4G8X A;  3LNQ A;  1XTA A;  3WGH A;  3WHB A;  4YFN F;  4B44 A;  1B59 A;  4IEJ A;  3SFI A;  4RM3 A;  2XSJ C;  2BXY A;  3SYT A;  1GUU A;  2COB A;  3PFI A;  1U8R A;  2VBY A;  3I4P A;  5FD6 A;  2EIL H;  3RTR A;  5J1Y A;  1SD5 A;  2BY0 A;  2QQB A;  1FMW A;  4O5V A;  3KCC A;  4OIN F;  1IN7 A;  4NHJ A;  3A03 A;  2DI3 A;  2HQR A;  1FOX A;  1XGN A;  2JPC A;  2WV0 A;  1TWC J;  2DFI A;  3S2H J;  4JYK A;  2O5R A;  2Y2Z A;  2LKS A;  4MIM A;  2EZI A;  2VL8 A;  1OMI A;  3V7R A;  1LDJ A;  3TBI A;  3MN2 A;  2R5Y A;  2QYO A;  3A0B C;  4KIS A;  2BZT A;  5DDG A;  3MKZ A;  1GLN A;  3IH3 A;  3ZMV A;  4XRS G;  5BQT A;  3R60 A;  1NH3 A;  5KCM A;  2K4J A;  3QYB A;  4IX7 A;  2D5V A;  3A4C A;  3SXY A;  1WH5 A;  2OC6 A;  4DZP A;  1MMA A;  1FMV A;  5IOZ A;  1G3T A;  3I54 A;  2FEZ A;  2M45 A;  2BBY A;  3ZQG A;  3LL7 A;  2ZFU A;  4C3H J;  1SAN A;  2MGQ A;  1OJL A;  3L2R A;  3SFZ A;  1W1W E;  3DU6 A;  4ZYE A;  2HXI A;  1O7L A;  4MLO A;  1YRN B;  1YW8 A;  2FJ1 A;  1LVK A;  2XPU A;  4A6D A;  3H3U A;  2QQA A;  1MMD A;  2TCT A;  3FXM A;  3BPX A;  3I64 A;  3I53 A;  3GTM J;  3S93 A;  4CIC A;  2MD5 A;  4L18 B;  2K5C A;  5HLH A;  2HTS A;  2KIF A;  3J81 K;  1ZK8 A;  2CJJ A;  2WAQ N;  1YHQ I;  3CDL A;  2BW3 B;  1UFM A;  3K4L A;  1KGS A;  2W7N A;  3JR9 A;  2GA2 A;  2EBI A;  2L7F P;  4LLN A;  2NVT J;  3AL0 C;  2ECC A;  3NAU A;  5L3F A;  3KPH A;  1SD4 A;  1LJ9 A;  4ZTF A;  1JGS A;  4U0Y A;  2Z33 A;  5E3O A;  4CGZ A;  4EM1 A;  2VQL A;  2BE5 F;  1XSX A;  5JR3 A;  1I6X A;  4R79 A;  4DIQ A;  1IN5 A;  3BJO A;  1MSF C;  1QNT A;  1O3Q A;  2CV1 A;  5CJ9 A;  2MAB A;  4RA2 A;  5FRN A;  4R1H A;  3WG7 H;  2AS5 F;  2HOT A;  3CO7 C;  3BZ6 A;  3DKY A;  1RRJ A;  1WJB A;  2WAF A;  4XKV A;  1Z6T A;  2EQR A;  4C2M J;  3G6E I;  1IJW C;  1Z3Y A;  1QGP A;  2DA2 A;  4YFK F;  1Y1W J;  3EUK L;  3KYL A;  2NVQ J;  4F52 A;  2ICW G;  3GBG A;  4A3K J;  2V4J C;  1LEA A;  1XCV A;  4KJZ A;  2JSC A;  4OIO F;  1DUX C;  5ILS A;  1XD7 A;  3T1B A;  3DCF A;  2HS5 A;  3QOE A;  4HNU A;  4ZYG A;  5HNH A;  3R61 A;  1XMX A;  3WTX C;  2JVG A;  4XIC A;  3HSR A;  3HOY J;  5F0H A;  1UB9 A;  2Q2E A;  3QYF A;  1O3T A;  2GOM A;  3S1R J;  2ELJ A;  1MZB A;  2DA1 A;  1JI8 A;  2WWY A;  4I98 B;  2H6C A;  1ZYR F;  4PJ0 C;  2TRT A;  1BIA A;  2Z3Y A;  5TJJ A;  2VUM J;  1S3J A;  2ESH A;  1FBS A;  4M3G A;  1IXR C;  1W7P A;  3VEP A;  3HOZ J;  3V4G A;  1TL8 A;  2FUG 2;  1OYI A;  4ANJ A;  1TNS A;  2W24 A;  4GCV A;  2VB6 A;  1KON A;  2Z5U A;  2GM4 A;  3CF5 F;  2FU4 A;  1U9O A;  3VYT B;  1TWG J;  1QZY A;  1AWC A;  2E2J J;  3TO6 A;  3VFZ A;  4JX6 A;  4FE4 A;  3GYH X;  1IW7 F;  4A2U A;  2F5E A;  1D1A A;  2BV6 A;  2F4M B;  3D5L A;  3ZN1 A;  3M3Y J;  3QPH A;  2O3F A;  3Q0W A;  2O61 A;  3DEE A;  1R1T A;  1CQT A;  1TWF J;  2QQ8 A;  1MNM C;  3K10 A;  3Q0U A;  1CF7 B;  1QU3 A;  2OF7 A;  1TT5 B;  4J01 A;  4C3I J;  1Y56 A;  4BDZ A;  2LD5 A;  5AIQ A;  1NK2 P;  4FAS D;  3MZ8 A;  4BAY A;  3CC4 I;  3QP5 A;  2HYG D;  3HC7 A;  3CCQ I;  3CMM A;  4HX4 A;  4I7H A;  4B1R A;  1MMG A;  3IRR A;  1MDM B;  3SQN A;  3D0S A;  3GLX A;  2OU2 A;  1ZLJ A;  4KIT B;  5J6X A;  3I9V 2;  4PJJ A;  2XAQ A;  2PEX A;  1JTX A;  3Q0V A;  1QHG A;  1XX5 A;  4BNC A;  3OYL A;  3NWS A;  5KHD A;  4HV6 A;  4QTR A;  4ESF A;  3A01 B;  1P2F A;  3OSF A;  3QYE A;  1R23 A;  4HNT A;  4Y13 A;  2KDO A;  1SC7 A;  3I55 I;  3K4B A;  1T95 A;  5FD5 A;  2HPM A;  4IO9 F;  4E7H A;  3J7A O;  4RB3 C;  1GDT A;  1XGS A;  3DLA A;  3LFU A;  5DS9 A;  3AG2 H;  4A3B J;  1QRY A;  3QRF F;  3V8K A;  1UJ8 A;  1P9Q C;  3ECO A;  5LEJ A;  1YRN A;  4HQE A;  1BW5 A;  4L5E A;  4BYY A;  1B1B A;  1LUJ B;  4U88 A;  5HS7 A;  2F4I A;  2YU3 A;  4A93 J;  4IZZ A;  4ZDO A;  4XK4 A;  4CUG A;  2STT A;  1B72 B;  1AOY A;  1YO5 C;  1A31 A;  2V9P A;  2CQ7 A;  5HVQ C;  4RGU A;  2BW3 A;  3C2B A;  1FBQ A;  1V3F A;  1S9H A;  2X6O A;  2OZ6 A;  2DQL A;  3HUG B;  1ZHF A;  4HST A;  4LGW A;  4AM3 A;  1GXP A;  5D4R A;  3P5J A;  2GIV A;  2F5F A;  3JW4 A;  1S7E A;  1RR8 C;  2HQ5 A;  1MBF A;  2K9M A;  4A3D J;  5CVI A;  4G94 A;  4XLN F;  1UG0 A;  2W82 A;  1H9T A;  5E1W A;  1A6I A;  2VON A;  1I3A A;  2IA0 A;  2YR2 A;  1T8I A;  2H8R A;  4KUM A;  3RPU A;  2CV0 A;  4U7B A;  2IGM A;  1BN5 A;  2RRE A;  5C44 J;  5K5Q A;  2XDV A;  3OYC A;  1VTN C;  3D5R C;  5J4Y A;  1ZH5 A;  2K86 A;  3MCZ A;  1YI2 I;  4E7J A;  3H0G J;  4IPA A;  1W7P D;  3DQV C;  3I71 A;  4GRI A;  3AKZ A;  1X1P A;  2DA4 A;  3IH2 A;  4RDU A;  4N0B A;  1OCO H;  1HDD C;  3OWT A;  3C3W A;  3ZQH A;  2Z1D A;  3TDU C;  1A36 A;  4GXO A;  2IEK A;  1J59 A;  1Z21 A;  4XOR A;  3CME I;  5KAF C;  5H2F C;  3GF2 A;  3CUQ B;  4BXF A;  2KIS A;  2KZV A;  3LSH A;  1WSU A;  2L0K A;  5CKT A;  2EIN H;  1FBU A;  3K4M A;  1X4P A;  3DWL E;  3K4K A;  3PO3 J;  3ZQF A;  1XS9 A;  3PIO F;  1P6R A;  3KP4 A;  5ILV A;  4EM0 B;  4QWQ A;  1TW2 A;  4II3 A;  3HTU A;  1R5I D;  1ZRD A;  4AIJ A;  3CUQ C;  3M7G A;  4JQF A;  5KNL A;  4BGD A;  4YG2 F;  1BJA A;  2BHY A;  2E1M B;  4KDP A;  5IYD J;  3F8N A;  4P9F A;  4XLA A;  4MFD A;  4E6K G;  4XR6 A;  3PQK A;  2VJJ A;  5B3S H;  1R1U A;  3PQJ A;  1ZQ3 P;  4JX5 A;  4YEJ A;  4EJU A;  1MMN A;  2JUG A;  1R22 A;  1I39 A;  1P4W A;  2IVM A;  2QF7 A;  3RJP A;  1HF0 A;  2IPQ X;  4KIG A;  2MC3 A;  4M9Z A;  2ELK A;  2WC2 A;  2E1M C;  1JUS A;  4UV9 A;  3IWF A;  1CF7 A;  3K70 C;  2VQH A;  1BI0 A;  1AA7 A;  1H9G A;  4MQV A;  2EPF A;  2BGC A;  3CCE I;  4PUS A;  3OIO A;  3F23 A;  1YTY A;  1JGG A;  2M8G X;  1SEU A;  3ABU A;  3BR5 A;  4A0X A;  2ECB A;  2XGD A;  1IG7 A;  4IKF A;  2RNG A;  3O2P E;  1MDM A;  3W6V A;  3CC7 I;  4B8X A;  1WJE A;  2OZU A;  1IC8 A;  4DYQ A;  2GIZ A;  2R7S A;  1B9N A;  3F8C A;  3FKI J;  5J47 A;  4X1E A;  2VBW A;  2ZBK A;  4E7I A;  4B43 A;  2XRN A;  2LF7 A;  1JJ6 C;  5CQG A;  3KYC B;  3A01 A;  1TNT A;  2ZXJ A;  3W6K B;  1STZ A;  3QQA A;  4Y15 A;  4PSX A;  1XMK A;  3BR0 A;  3OYF A;  1GV2 A;  4RM2 A;  2Y9Z A;  1X2N A;  1VQ6 I;  2R7O A;  1TQM A;  2L4M A;  2JTV A;  2HZT A;  2R7X A;  4JBA A;  4EJT A;  1HQC A;  1JHH A;  4F93 B;  4II2 A;  1PYV A;  3G1L A;  3MQ0 A;  4PJM A;  3SZT A;  3PL8 A;  1JT0 A;  2UXN A;  2H1K A;  2QKM B;  4JOM A;  2EFW A;  3MD2 A;  1MH4 A;  1K61 A;  4UB6 C;  5BS6 A;  4AYB A;  2P5L C;  1V5G A;  2ELH A;  2JPB A;  3GTQ J;  2I8D A;  3EPZ A;  3LSI A;  4D5C A;  3F0C A;  4WX9 A;  3RPU D;  2AO9 A;  3BTI A;  3FIW A;  3RQ4 A;  5KAI C;  3K0L A;  1T0F C;  1B72 A;  3F6O A;  1IV6 A;  2IRF G;  4ZJZ A;  2CRG A;  5ICG A;  5DCM B;  3D1N I;  2RN7 A;  5E8G A;  4XRS A;  5GAD J;  4M6V A;  2QQ9 A;  1JUP A;  3HUG A;  4YIF A;  4B48 A;  4PDK A;  4X0G A;  4EMS A;  1K83 J;  2A5W A;  3HIF A;  2PMZ A;  5D8L B;  3K69 A;  3S3O A;  2E34 A;  4ESJ A;  1KYZ A;  4PFO A;  3GTP J;  2V26 A;  3OYK A;  5GPA A;  1HKS A;  4IOA F;  5AON A;  4D1Q A;  4RS8 A;  2DYR H;  4DJA A;  2B7E A;  1QPI A;  2ZSI B;  3REO A;  1ETW A;  4FIS A;  1E3O C;  1DU0 A;  2BXZ A;  2V1N A;  4QSH A;  3S1Q J;  4A3L J;  2KIQ A;  3H1C A;  5JHF A;  5DUI A;  3CCU I;  1B6A A;  4A0Y A;  1JXS A;  3BG9 A;  3GLL A;  3CP8 A;  1A5J A;  1J09 A;  4BHP A;  1OCZ H;  4IF4 A;  5M5W J;  3LSM A;  5LHI A;  2TDX A;  4I0B A;  5IYC J;  2VAS A;  3PSF A;  5CYV A;  3H9J A;  4YFX F;  1G4D A;  4QIW N;  2ZXI A;  2W57 A;  3M4O J;  2IAI A;  3CC2 I;  4KA4 A;  1POG A;  3HRU A;  4LFU A;  2HYF A;  2ZB9 A;  2DDB A;  5GAH J;  3TP3 A;  3CUQ A;  1SVM A;  2JN6 A;  2NOG A;  1O57 A;  2CH0 A;  1WHU A;  5FKO A;  2LTP A;  1LDK B;  1K4T A;  1K79 A;  2LRD A;  1ACI A;  2HVS A;  1E0E A;  3U1K A;  2HQA A;  3ZMZ A;  2DO7 A;  3I5U A;  3B6C A;  3TP0 A;  3I56 I;  2HEO A;  4RBO A;  1K7A A;  1DDN A;  1XMA A;  2XC7 A;  1YX3 A;  3KP6 A;  2L7Z A;  2KKO A;  4BDY A;  4LB5 A;  3VOE A;  2XRO A;  3FXO A;  3BWG A;  2HFH A;  3KET A;  5DD8 A;  2PBI A;  5D8K B;  4E7L A;  2IS6 A;  4XID A;  3GEZ A;  2DYS H;  4HLY A;  2R7U A;  1XN7 A;  2P5V A;  3HOV J;  2DW4 A;  3MKW B;  2CGP A;  5FJ8 J;  4UHT A;  5D4S A;  2KIU A;  3VB2 A;  1E2X A;  1N25 A;  1NG7 A;  4OWR B;  1O3R A;  1H88 C;  2E7X A;  3EYI A;  4ITV A;  3BG3 A;  2DA5 A;  4HBL A;  3E6M A;  1HST A;  4KN4 X;  2ZJ2 A;  4EJV A;  3CCR I;  2O6G E;  3TED A;  5LGU A;  5HS9 A;  2E1C A;  1TP4 A;  2E35 A;  1R49 A;  4OIP F;  3BPV A;  3CJT B;  3DP7 A;  3FF5 A;  3K1P A;  1FJL A;  2QEN A;  1YIJ I;  2B0L A;  2VKH A;  3N4M A;  1F36 A;  3NQO A;  2K7L A;  3PO2 J;  1GT0 C;  4GO1 A;  1I3Q J;  2FOW A;  2JUC A;  1XB4 A;  1FY7 A;  2GXB A;  5EEG A;  1YE9 A;  4NC6 A;  4AC0 A;  1HA8 A;  2VC0 A;  3TKY A;  3PIP F;  1ZG1 A;  1IN4 A;  1X1B A;  3DPU A;  2A05 A;  4K2E A;  1DPU A;  1Y8R B;  3FXR A;  4AID A;  5B5E C;  3WGG A;  5DM7 F;  4M3D A;  1D1B A;  5IP7 J;  2HPI A;  4RB2 C;  2XGX A;  4BQN A;  3FBI B;  1N78 A;  3GFJ A;  2WBM A;  5K5R A;  3CCS I;  2R0Q C;  1TQI A;  4ENJ A;  4HEA 2;  3ZMT A;  1BJZ A;  4AWX B;  2HOE A;  2R92 J;  3RZO J;  2CUE A;  2JVH A;  3G71 I;  4HX7 A;  1Q1V A;  3Q5F A;  1D8J A;  4BU2 A;  3U9G A;  2NVU B;  1L0O C;  5DCM A;  3U2R A;  3OS2 A;  3P9K A;  3DEW A;  2LDU A;  2ZXW H;  4RAF A;  4MTE A;  4ZDP A;  2JRT A;  2FNP A;  5IP9 J;  1APL C;  3GW2 A;  2DMN A;  3LFK A;  3WE3 A;  4CYD A;  2ACJ A;  1ORK A;  5EZG A;  5CLS A;  4CA0 A;  1UAA A;  3FXU A;  4MTD A;  3JSO A;  5FRO A;  1GVJ A;  1X58 A;  1Z3X A;  2CG4 A;  3F6V A;  4DQ2 A;  1BR4 A;  4WWC A;  2RNJ A;  1NHA A;  3S3M A;  2VIX A;  2UUZ A;  3DF8 A;  1T98 A;  2DFE A;  5FLV A;  4GYG A;  3OIP A;  1X4O A;  3J7Z I;  2E1O A;  4BKX A;  2CQK A;  2GOX B;  2E2I J;  3HDD A;  4HF2 A;  3ERM A;  4BAC A;  3CUO A;  3WTU C;  5EEH A;  2KMU A;  2O03 A;  4XKB A;  3GXO A;  3CP2 A;  1F9N A;  3K70 D;  3LSK A;  3HB9 A;  5B1B H;  1BL0 A;  2LP0 A;  3ZQC A;  3S2D J;  3OIQ A;  4BBS J;  4D7N A;  2FNA A;  2IGN A;  5KVR A;  4OMZ A;  4RAZ A;  3O3K A;  2P4W A;  2COM A;  3K2A A;  5BMZ A;  2IS4 A;  3L09 A;  1U2W A;  5EF6 A;  2W00 A;  1TT0 A;  1Y0N A;  1SFK A;  1KQ9 A;  5FRM A;  4LK1 F;  5TIS C;  3TW6 A;  1D3Y A;  4ZYD A;  4Z6Y A;  4FTH A;  2IGO A;  3ONQ A;  4A5N A;  1VQ5 I;  2ZFW A;  3K6G A;  4W1U A;  2X9D A;  3W2V A;  1Y0U A;  2QZ8 A;  4ZYH A;  4B3X A;  3FWE A;  5LFA A;  5ICC A;  2OD5 A;  2DCE A;  1QPM A;  1D0X A;  1ENH A;  1MW7 A;  2D1V A;  3SHF A;  5E1X A;  1GVD A;  1OYY A;  3K7A J;  3M07 A;  1I27 A;  3MEX A;  3S32 A;  3VYR B;  5J8C A;  4I76 A;  5D5W B;  2ZC2 A;  3FXQ A;  4BJ5 C;  2Y30 A;  3ZQL A;  1D0Y A;  1ZEL A;  3AL0 B;  2QGU A;  4L5J A;  1FX7 A;  2LH9 A;  2FBI A;  3BT9 A;  1QO0 D;  1OCP A;  3BTJ A;  4H4K C;  3BQY A;  2IP2 A;  2Q0O A;  2UXX A;  1XPX A;  2E71 A;  4LG3 A;  5J40 A;  3I59 B;  5H20 A;  1J9I A;  3C2G A;  3CJR B;  3FZV A;  5CVU A;  1F1Z A;  3QP6 A;  4XLP F;  3CJN A;  3S2W A;  4I0A A;  4DW6 A;  4KMU X;  1WH7 A;  1TLH B;  3OSG A;  1RZ4 A;  2KJC A;  2XB5 A;  3CTA A;  2EFP A;  2DMT A;  4PFP A;  2R7R A;  4CCO A;  2VE8 A;  2JK3 A;  3FMR A;  2LFB A;  3K9T A;  4I6Z A;  3CJQ B;  1QVT A;  1X1C A;  2YS9 A;  2E5Z A;  3L2U A;  3GVA A;  3ZXS A;  1YJW I;  3RCO A;  2CU7 A;  4QPQ A;  3E97 A;  3ECH A;  4F7Z A;  2LY1 A;  4A3G J;  1FP2 A;  1R7J A;  2MG4 A;  3T0Y A;  4HF1 A;  1BW6 A;  2HKO A;  2QVO A;  3HYI A;  3K2Z A;  2R5Z B;  4A3M J;  4XMY A;  3OYN A;  3H35 A;  4BY7 J;  3LSJ A;  2BYV E;  2LR8 A;  2Z16 A;  3U21 A;  1WWX A;  1D0Z A;  2LC2 A;  3GZ5 A;  1VQ9 I;  1Z77 A;  2AQF A;  3HHH A;  2CWE A;  3VYS B;  4RB0 A;  4Z2Y A;  1MBG A;  2HOA A;  3R0J A;  4P5O A;  4AD9 A;  4BHC A;  3GZ6 A;  2VLA A;  2CS3 A;  1QQI A;  1QHH D;  5HDN A;  1PVE A;  1JE8 A;  2OAZ A;  5F0C A;  4RLQ A;  3VDX A;  3DFG A;  3WU1 B;  2MLK A;  2YUS A;  3EUA A;  4X6A J;  2MC4 A;  2A07 F;  2NRA C;  1P92 A;  3AG4 H;  4MEY F;  3S1M J;  4B47 A;  3K1N A;  4ZZL A;  1WJF A;  1W36 D;  2DLL A;  3SZP A;  5ERI A;  1VND A;  1T6S A;  2VE9 A;  2R7T A;  3JRF A;  3CZ6 A;  1S5L C;  1S29 A;  2Z9O A;  2A3S A;  1LEB A;  1OQY A;  2M5W A;  1DPR A;  3HOW J;  3RIR A;  1F43 A;  2PJP A;  4RMN A;  2LVS A;  1WFX A;  3ZOB A;  4MNU A;  2RV8 A;  5F27 A;  1ODD A;  1PP7 U;  3OR2 C;  3T5X A;  2NNN A;  3DTK A;  2FBH A;  2VJI A;  2IJL A;  3CQZ J;  1FPQ A;  2XF7 A;  3LA2 A;  4M6X A;  1BM9 A;  1FYM A;  1RKT A;  1Z0X A;  1HKT A;  3S14 J;  3IAS 2;  4HW0 A;  4MGR A;  1FIP A;  1OLT A;  2FOK A;  4ENK A;  3DXJ F;  3WTW C;  2CQX A;  5LRS A;  1R5G A;  2WY7 Q;  2YU9 J;  3ZMU A;  4YRV A;  5HOO A;  1H8A C;  2OTJ I;  4HZF A;  5ILU A;  4Y7N J;  2H1L A;  2ISZ A;  1Z67 A;  3IAM 2;  1YIT I;  4HAM A;  2CW0 F;  4D0P A;  2EV6 A;  3CES A;  3FMQ A;  2EB7 A;  1UHS A;  3LAP A;  2XGC A;  2NOJ B;  1BI2 A;  1MIJ A;  3DPL C;  5IYB J;  5BPI A;  3ZPL A;  2HR3 A;  2K9L A;  5CPR B;  1XGM A;  3FM5 A;  3BC8 A;  3CDI A;  1HBX G;  1UG2 A;  1ON1 A;  2RC4 A;  1X3W B;  4BXX J;  4XNF A;  4D5F A;  4A3I J;  2WB1 N;  4NNJ A;  2P6T A;  4IRG A;  1MSE C;  1ZG5 A;  2VI6 A;  5AIP A;  3IRQ A;  4MO7 A;  1D5V A;  2A5Y B;  3QU3 A;  2KHM A;  3V8J A;  5L3C A;  5A2Q Z;  2LKP A;  2W25 A;  1W4M A;  2J5O A;  4QPO A;  3TO9 A;  2JA5 J;  3L1P A;  2V79 A;  1Y8Q B;  1BOB A;  2FMY A;  4XLH A;  1ZGW A;  1S6L A;  3QOP A;  2A6T A;  4LB6 B;  1JKP C;  2XHK A;  3I59 A;  2FA5 A;  2M1B A;  2HNH A;  3PM1 A;  5B66 C;  1WVR A;  2B9S A;  2C6Y A;  1VZ0 A;  1ZKG A;  2YX4 A;  3I3L A;  2A61 A;  2HU9 A;  2DA7 A;  1BR2 A;  3E5X A;  5C3E J;  2XAG A;  3HHG A;  3ABL H;  3TDZ C;  3ERE D;  1XCB A;  4PGH A;  2KLO A;  1IO2 A;  1K6Y A;  1EH8 A;  4KYW A;  2ZXH A;  2X6X A;  4XN3 A;  4G7O F;  2WAQ A;  3F72 A;  4Q48 A;  4OMY A;  1UZC A;  1NK3 P;  3DEU A;  1SD6 A;  2CMP A;  4MFE A;  2DQR A;  2EFQ A;  4JX4 A;  2R5Z A;  1QA6 A;  2DJN A;  3HSE A;  2QWW A;  3RZD J;  1WI3 A;  5H6R A;  4L0Z B;  1R36 A;  1F4K A;  2NAZ A;  1DGW Y;  3HOU J;  2VOP A;  3HPH A;  1B8I B;  1AHD P;  3VSK A;  3SJM A;  2EIJ H;  5FFX A;  3IC7 A;  3PFY A;  4YII A;  3G2B A;  5DEQ A;  4UY8 I;  2QEX I;  4ZYA A;  3L2W A;  2NVY J;  2E7W A;  2E60 A;  3T8T A;  5HLT A;  4HOB A;  5HS8 A;  1MBJ A;  3WTV C;  1YJ9 I;  1J2X A;  4AIK A;  2BVL A;  4CZC A;  4RGS A;  1FTT A;  4BXU A;  2L4A A;  3HPG A;  4UVC A;  5FB2 A;  1EV7 A;  4IVN A;  2VBX A;  4HDV A;  1SAX A;  1IV8 A;  4FCY A;  5HDG A;  3TW7 A;  1H89 C;  4LD5 A;  5FKM A;  1AU7 A;  4Y3O A;  2X6W A;  4YEL A;  1PDN C;  4B09 A;  4UUV A;  3VSL A;  5EYR A;  1YIO A;  2K3F A;  1JKO C;  4IHW A;  2NVX J;  3RKW A;  1BBY A;  2F5D A;  4HNV A;  2V6E A;  1GV5 A;  2OV7 A;  4Y17 A;  4BE0 A;  4XM3 A;  5FO5 A;  1MJ9 A;  3CCM I;  3OOP A;  3F8M A;  3Q9V A;  3IWZ A;  5DTD A;  2EA2 A;  1YS7 A;  4I99 C;  3OYG A;  1LFB A;  1HW2 A;  5DM6 F;  1Z1D A;  3BG5 A;  2HWV A;  1LDD A;  4L9N A;  1WJA A;  2Z99 A;  1FIA A;  1WJD A;  1J5Y A;  3ZCO A;  3OYE A;  1MKM A;  4XON A;  2M9H A;  4A12 A;  2UZK A;  3BR2 A;  4CH7 A;  2L9S A;  3TL4 X;  3KP3 A;  1WJ5 A;  2XAJ A;  3W6J B;  1CGP A;  2LY2 A;  3IV5 A;  4M9X A;  3GFM A;  1ERD A;  3JSP A;  2JJ7 A;  4BE1 A;  2ESN A;  1RES A;  4OU0 A;  2ZCW A;  4ZH4 F;  1SFU A;  3BP8 A;  3T8R A;  2VBZ A;  5FKK A;  4DOZ A;  4RAY A;  2LBF B;  2Y9Y A;  1FWZ A;  1G3Y A;  2WAE A;  2R7V A;  2MA3 A;  2RGV A;  1TTY A;  2RQP A;  3LOC A;  1ETV A;  1ZAR A;  3V7S A;  2L7M P;  3BY6 A;  5EG0 B;  1ON2 A;  2VXD A;  3HBL A;  2M30 A;  1SMT A;  3E6D A;  2CUF A;  3ABM H;  3M8F A;  4GFB A;  4L0Y B;  3E5Q A;  4H0E A;  1LQ1 A;  4V2G A;  1OIS A;  2AQE A;  2L01 A;  2L5Q A;  3PUF A;  1R71 A;  2P5K A;  2L9N A;  3CMA I;  1FNN A;  1LPQ A;  1I6H J;  1TC3 C;  1KU9 A;  4DYR A;  4EV0 A;  1LE8 B;  1OKR A;  2EK5 A;  1YFH A;  4F91 B;  1U5T B;  2F4O B;  2H94 A;  2ISY A;  4G12 A;  4RGR A;  3OYH A;  1YJN I;  1OCT C;  2MYS A;  2Y69 H;  4LIT A;  3M8E A;  4ZC3 A;  5E20 A;  3BR1 A;  4M3F A;  4A3E J;  3F22 A;  1ZRE A;  1KZH A;  2O8K A;  2VPR A;  5D6E A;  5IY5 H;  2VXZ A;  4CO8 A;  3R4K A;  4EJO A;  2DOD A;  1J75 A;  2BOL A;  1OYW A;  4EQQ A;  2GZW A;  2EFO A;  4G9Y A;  4ZDL A;  1D5Y A;  2CW7 A;  2FF4 A;  1U5T C;  4O3M A;  3OYB A;  2Y0S N;  3H3Z A;  4WCG A;  2IS1 A;  3KP2 A;  4W97 A;  1FP1 D;  3L7W A;  1RUN A;  1ZGA A;  5D5U B;  1IUF A;  2HVR A;  3ABT A;  1YW9 A;  3AG1 H;  2ZJQ F;  2F2E A;  2FML A;  4OAZ A;  1KYW A;  4LLG F;  2LYC A;  2MW8 A;  2VOO A;  2JA7 J;  4DGW B;  3PNT A;  4Y52 J;  3TO7 A;  2XIG A;  5EEA A;  3OL4 A;  1UMQ A;  4P55 A;  1ITY A;  2JQ7 A;  2PLY A;  3ABK H;  4FET A;  2KRC A;  5FKL A;  5C4X J;  3ZRG A;  1P7J A;  3OV8 A;  4OIQ F;  5GTH C;  3I58 A;  3QPL A;  3DTE A;  4JK1 X;  1KU2 A;  1G2H A;  3O6B B;  2H8W A;  4HF0 A;  3M1E A;  1DU6 A;  4FT8 A;  2MD0 A;  4L5I A;  2V6C A;  2OQR A;  2QSG X;  2O8X A;  2M87 A;  5DV5 A;  1W5S A;  2STW A;  4LJZ F;  1IXS B;  2DJI A;  5IOY A;  4NDL A;  3OOU A;  3BJ6 A;  1NG6 A;  4WK8 F;  2YSR A;  2ETH A;  3I4N J;  3HM5 A;  2XAS A;  2P6S A;  4JP0 A;  4UVA A;  2P8T A;  4PZJ A;  2WY8 Q;  1U9N A;  3HXL A;  2R5Y B;  1RR7 A;  2Q1Z B;  2V9V A;  2LNB A;  3KZZ A;  1R5H A;  1IRG A;  3OYI A;  5DCF A;  1YLF A;  4UUT A;  3KFW X;  4S0H B;  1S7A A;  1QZE A;  4IQ4 A;  3JRA A;  1K78 B;  3B73 A;  1UCR A;  5F1R A;  1OR7 C;  2DT6 A;  4IHS A;  2CUZ A;  2W1O A;  1WI9 A;  5FFZ A;  2GLO A;  1S8N A;  4NQW B;  3JCU C;  3QAH A;  2DPD A;  3HRM A;  4M74 A;  3KE2 A;  3COA C;  3A02 A;  2GXG A;  3SEZ A;  4EEF G;  2CV2 A;  2JA6 J;  3KEQ A;  4F3Q A;  2FRH A;  3KP7 A;  2GQQ A;  1ETY A;  2M7A A;  2R7D A;  5ICE A;  1RET A;  2KZG A;  2LBF A;  3EYY A;  2F48 A;  4IXA A;  3CLO A;  4KFC A;  3QU6 A;  1HKQ A;  3FKJ A;  4WXH A;  1KU3 A;  3S8P A;  1VI0 A;  2VKV A;  3LWF A;  4XN0 A;  2WTE A;  2IA1 A;  4LIU A;  4ZTJ A;  4C2U A;  1JKQ C;  4EVI A;  5EDN A;  3O8G A;  4CHU A;  4N9I A;  5EG0 A;  2R7Q A;  1VQ7 I;  1Z9C A;  1K6O A;  1SVO A;  3GX4 X;  2FE3 A;  1IRF A;  2J5P A;  2R93 J;  2XKO A;  4TV7 A;  4F55 A;  2BY1 A;  3MMY B;  3F9K A;  2VOD A;  1T0F A;  3J80 Z;  1J7K A;  2RDP A;  2X0L A;  1UHW A;  1K4S A;  2CO5 A;  3M8J A;  5HDK A;  1Z6R A;  4Y33 A;  4BJT A;  2V1X A;  2MH2 A;  3OS0 A;  1IF1 A;  5IPA A;  4XLC A;  1R00 A;  2JMW A;  3G1O A;  4E70 A;  3I4M J;  4C9Y A;  1ZN2 A;  4G7Z F;  2IA2 A;  3FHZ A;  3AG3 H;  2M0C A;  4XKC A;  4LG0 B;  2ADU A;  5JLX A;  3OYJ A;  1LE8 A;  4EGY A;  1T33 A;  2OQG A;  2VN2 A;  4XRM A;  5D6F A;  2R7F A;  4D9J A;  2PG4 A;  4L9J A;  3J7A Y;  1U5T A;  4OIR F;  5IT9 Z;  2VT2 A;  2KRF A;  1VF9 A;  2W4S A;  1TW3 A;  3LA7 A;  4M3E A;  2E19 A;  4P1W A;  5J1U A;  9ANT A;  2CYY A;  2R7Z J;  2DAO A;  4PGG A;  1D1C A;  4ENM A;  1MNE A;  1YW7 A;  2X1C A;  4Q47 A;  5LGN A;  4E4H A;  3JRI A;  3QPS A;  1M1E B;  3MFK A;  2DMP A;  1BA5 A;  1IDY A;  1G8X A;  1QVU A;  1U8B A;  3L00 A;  1V55 H;  3K4J A;  2JSP A;  4KT6 A;  2N8G A;  2YPR A;  3KIO A;  5F64 A;  3VOD A;  1X1D A;  3MWM A;  5TRD A;  3FMS A;  1Z91 A;  4FQG A;  1VQN I;  3QWL A;  2D45 A;  1FOY A;  1D8K A;  3PUB A;  5GPC A;  1MH3 A;  3K1M A;  1R4M B;  2KQR A;  3FK7 A;  3RQI A;  2M0M A;  3BTC A;  4U87 A;  5FGM A;  1DP7 P;  3IKT A;  1EH7 A;  3RDI A;  1XDS A;  3WU2 C;  1R58 A;  2O7O A;  3SDG A;  2R4G A;  3EUH C;  2IS2 A;  3GUD A;  4A6E A;  2LK2 A;  3WOD F;  3F21 A;  1SD7 A;  3FDY A;  2FX0 A;  3GTL J;  2ZKZ A;  2P7V B;  4KIF A;  5LRR A;  3VPR A;  5M3M J;  2KL4 A;  2NXN B;  3MZH A;  2H09 A;  3J81 Z;  2DTZ A;  3DBR B;  1VQM I;  4RLF A;  2GA1 A;  1JT6 A;  1LFU P;  4KIB A;  1TBX A;  1I5Z A;  4OAY A;  5ED4 A;  3W2A A;  5H6Q A;  1LNW A;  3PNY A;  4ETS A;  1OCC H;  2XKP A;  2HZD A;  1Q1H A;  3PNV A;  2X51 A;  1W0U A;  3MZY A;  1X3Z B;  4IOC F;  1SAU A;  3RSN A;  3CMY A;  3B6A A;  2M2E A;  1HW5 A;  4I09 A;  3QPT A;  2QA4 I;  1IN8 A;  5IT9 K;  4HG2 A;  1FOK A;  3DBL B;  1BC7 C;  4S04 A;  2L9R A;  3HKZ N;  3X2Q H;  2E1N A;  1VQO I;  1QBJ A;  2XV4 S;  2DMU A;  2KT0 A;  2BHZ A;  2VC1 A;  1OR7 A;  3OR1 C;  2DXI A;  1IZ1 A;  2KFD A;  3CDH A;  5L3B A;  4C3J J;  2NS0 A;  2XF6 A;  1Y1V J;  2LRE A;  4UB8 C;  4UVB A;  3BRO A;  4NC7 A;  4BEH B;  1JKR C;  1MND A;  2HXO A;  5DD4 A;  2L9V A;  1PUE E;  5EGO B;  1K78 A;  4HLX A;  3F8B A;  3IL2 A;  1DGR M;  1XDU A;  3TQN A;  1X1A A;  3HZJ A;  3OS1 A;  4NQW A;  3RKY A;  3JAM Z;  2K9N A;  1ETO A;  3HOX J;  2FXA A;  3RYR A;  3JRD A;  5JI6 A;  1B9M A;  1JTY A;  1JJ8 C;  2D1H A;  3GTJ J;  3S16 J;  2PQ8 A;  4O6J A;  3DPT A;  1FC3 A;  5LBQ A;  3DKW A;  1GXQ A;  3WGI A;  1RC9 A;  4IJA A;  2M8E A;  1UEL B;  4XSX F;  4BL0 B;  2K85 A;  5JVG F;  2FBK A;  2KJB A;  1FT9 A;  3G3Z A;  2X1D A;  1BI1 A;  4WF2 A;  2XPV A;  2BY3 A;  1BOA A;  2NS7 A;  4V19 K;  3ELK A;  2P7C B;  3ISP A;  3BZK A;  2OJE D;  1EA3 A;  2LLK A;  2FQ4 A;  1WQ2 A;  4HA8 A;  4DZJ A;  1PUF B;  2DDA A;  4GGG A;  2P0W A;  3A2K A;  4UNO A;  1MBK A;  2DTR A;  2X85 A;  3WE2 A;  2RQQ A;  1YQA A;  5M5Y J;  4G6T B;  3HRS A;  3BZC A;  3ML6 A;  1TWA J;  2RAE A;  4HYE A;  2QCO A;  2Y0M A;  2CUJ A;  2JA2 A;  5DYM A;  5LHG A;  5J1R A;  1PJR A;  3NAR A;  3IKV A;  3KZY A;  3SEQ A;  4LG0 A;  2FD5 A;  4XRF A;  2QSF X;  3FXL A;  3D5S C;  3L2Q A;  3HJE A;  2KPM A;  2QUF A;  2K40 A;  1TQP A;  3TOB A;  2ZME B;  3BG7 A;  3ZN0 A;  1W5T A;  3SDB A;  4J00 A;  2EFN A;  4L9V A;  1P4A A;  2AXL A;  2ME0 A;  2M7B A;  1G6N A;  2FSW A;  5E3L A;  3JRB A;  5KK1 A;  4XL9 A;  2O0Y A;  2I5U A;  4BQQ A;  4IHT A;  2OCE A;  4AVP A;  1X2M A;  1Z7U A;  3GTO J;  2G0E A;  3PSI A;  2M4G A;  1N77 A;  2HGC A;  2W85 A;  5FLX Z;  3FK6 A;  1U78 A;  1AKH B;  4FX0 A;  2MLG A;  5CQE A;  4IL6 C;  1E3H A;  1JHF A;  2ZME C;  1B4A A;  3JAM K;  2WV1 A;  2HOS A;  1RNL A;  3LQQ A;  2GXA A;  2EWN A;  3ZMS A;  1LVA A;  1FYK A;  3EUH A;  1O7F A;  1VQK I;  3B02 A;  4A69 C;  1LB2 A;  3GWZ A;  4GDF A;  1RPW A;  3UR3 C;  2GBY A;  1IN6 A;  1XC5 A;  5BPD A;  2XUB A;  3E7L A;  4KNY A;  5L3D A;  2OA4 A;  2EZH A;  2G7H A;  2XAU A;  3FXK A;  3GME A;  4GYI A;  1IUY A;  2F5C A;  3HGY A;  5EZH A;  3UNG C;  2RVC A;  3L9F A;  5L3E A;  2Z2S B;  5CVR A;  3L2C A;  1XSV A;  4PK4 A;  2DK8 A;  4XOP A;  3G73 A;  3BQZ A;  4EJW A;  5LGT A;  2ZSH B;  1ZRC A;  1FSH A;  2HYJ A;  5LLQ A;  1L3L A;  1R9T J;  2VPL A;  1HW1 A;  4DBQ A;  1YYV A;  2BY2 A;  3P7N A;  2F6C A;  2O9L A;  1A6Q A;  5BOX A;  1XGO A;  2VKE A;  2H27 A;  2CFO A;  4UV8 A;  3LQR A;  2DOE A;  2ID6 A;  2IT0 A;  2R7W A;  3S3N A;  1MMS A;  1O4X A;  1ETK A;  1MGT A;  3FX3 A;  3OL3 A;  4CSW A;  1OFC X;  3HSF A;  3WTY C;  1HDP A;  4U7D A;  1REP C;  2HDD A;  2DU9 A;  1MD0 A;  2K4B A;  3RI4 A;  2XGE A;  2P81 A;  4I01 A;  2KRH A;  5FLX K;  3W2W A;  3C18 A;  1MJB A;  3QOD A;  1DP3 A;  3KYD B;  3CCV I;  2ZO4 A;  3ZQQ A;  3RKX A;  1U6G A;  4U0V A;  2M3A A;  3I0T A;  4ON0 A;  4RAG A;  1HCR A;  2A69 F;  3E0J B;  5HNF A;  3HKZ A;  2W48 A;  4BEH A;  3GTK J;  1EF4 A;  2PJR B;  5M5X J;  5LHH A;  5EGO A;  2VT3 A;  3BJA A;  5F0F A;  3Q3S A;  4AYB N;  3DTI A;  2KP6 A;  1I1G A;  3K4N A;  3LST A;  4ABZ A; 
#chains in the Genus database with same CATH homology
 2BW3 B;  2AQE A;  2L5Q A;  3K4L A;  2W7N A;  1YE9 A;  3OY9 A;  2L9N A;  1HA8 A;  3AL0 C;  4ZTF A;  1X1B A;  3DPU A;  2VQL A;  4R79 A;  3OYM A;  1D1B A;  1V5F A;  4DIQ A;  2HPI A;  1BR1 A;  4F91 B;  4BQN A;  2CV1 A;  3FBI B;  1N78 A;  2MAB A;  2WBM A;  5FRN A;  3OYH A;  3M1C A;  4HEA 2;  2MYS A;  3H5N A;  3DKY A;  4LIT A;  1WJB A;  4ZC3 A;  2WAF A;  4XKV A;  4PJN A;  3LSG A;  2JVH A;  4DBR A;  1Z3Y A;  2VXZ A;  2BOL A;  3EUK L;  3KYL A;  4ZDL A;  4F52 A;  1YX5 A;  2CW7 A;  4N4N B;  4AU7 A;  4BU2 A;  3GBG A;  2V4J C;  3OYB A;  3OS2 A;  4KJZ A;  4ZDP A;  2IS1 A;  3QOE A;  4HNU A;  5HNH A;  2JVG A;  3QYF A;  4AVZ A;  2HVR A;  2UWM A;  3OYD A;  2GOM A;  4CA0 A;  3ZGK A;  1UAA A;  2ELJ A;  2K3P A;  5FRO A;  1TZL A;  4OAZ A;  1Z3X A;  2LYC A;  1JI8 A;  3C2H A;  4DGW B;  1BR4 A;  3HL2 A;  3PNT A;  1Z7L A;  3S3M A;  3OL4 A;  2VJ5 A;  2DOA A;  2VIX A;  2UUZ A;  4FET A;  2KRC A;  3ZRG A;  4BJ6 C;  2FUG 2;  1LFP A;  4ANJ A;  3OIP A;  1X4O A;  2VB6 A;  3DTE A;  4HRI A;  2GOX B;  1KON A;  4XOT A;  2MD0 A;  2XF5 A;  4BAC A;  3FHN A;  3VYT B;  4HSR A;  3A1Y A;  4LIV A;  2KMU A;  1D1A A;  2L2O A;  3D5L A;  4XKB A;  3BCA A;  3CP2 A;  1U0J A;  2DJI A;  3K70 D;  3LSK A;  4F92 B;  3OOU A;  3DEE A;  4CCK A;  1NG6 A;  3OIQ A;  1QU3 A;  3K10 A;  3H9Q A;  4J01 A;  3OYA A;  2IGN A;  3DKX A;  1Y56 A;  4BDZ A;  2IS4 A;  2WY8 Q;  4FAS D;  4XKW A;  3HXL A;  2W00 A;  1TT0 A;  2Q1Z B;  3HC7 A;  3AFH A;  3CMM A;  3H5A A;  1SFK A;  5FRM A;  4E7Z A;  2IGO A;  1MMG A;  2M4K A;  3OYI A;  3ONQ A;  2BVM A;  3K6G A;  3W2V A;  1V5E A;  2WA0 A;  4NC8 A;  4IQ4 A;  5LFA A;  4B3X A;  4KIT B;  3H0D A;  3I9V 2;  4PJJ A;  2DCE A;  1QHG A;  1D0X A;  1OR7 C;  2DT6 A;  3MKY B;  1MW7 A;  4E7K A;  2CUZ A;  2W1O A;  3OYL A;  3NWS A;  5KHD A;  4NQW B;  4BE2 A;  3E1S A;  3QYE A;  1LKX A;  4HNT A;  4N4O B;  3S32 A;  3VYR B;  2KDO A;  4BJ5 C;  3SEZ A;  2CV2 A;  3BG6 A;  1D0Y A;  3K4B A;  1ZEL A;  3AL0 B;  1T95 A;  4F3Q A;  2LH9 A;  4CCJ A;  2HPM A;  2M7A A;  4H4K C;  2LBF A;  4E7H A;  4LG3 A;  3BCB A;  3C2G A;  3CJR B;  3DLA A;  4HPQ A;  3LFU A;  3FKJ A;  3S8P A;  3KEY A;  4XN0 A;  4LIU A;  4ZTJ A;  4C2U A;  1P9Q C;  2R7Q A;  4BUP A;  3H9G A;  2WB1 A;  4F55 A;  4PFP A;  2R7R A;  2PJR A;  3MMY B;  4CCO A;  2F4I A;  4IZZ A;  3F9K A;  3CJQ B;  3L2U A;  1X1C A;  5TGT A;  2E5Z A;  4CUG A;  4ZDO A;  3ZXS A;  2F5V A;  3RCO A;  4QPQ A;  3M8J A;  2LY1 A;  4Y33 A;  4BJT A;  5HVQ C;  2BW3 A;  3OS0 A;  1S9H A;  4XLC A;  3HUG B;  4XMY A;  3OYN A;  3H35 A;  4HST A;  4C9Y A;  4XKC A;  2Z16 A;  3U21 A;  4XLF A;  3OYJ A;  2K9M A;  1D0Z A;  2HVQ A;  2LC2 A;  2X1E A;  1UG0 A;  2W82 A;  4D9J A;  3V42 A;  2AQF A;  3J7A Y;  4C2T A;  3VYS B;  2L7K A;  2CV0 A;  4P5O A;  2W4S A;  4U7B A;  2IGM A;  2RRE A;  2VLA A;  2CS3 A;  4P1W A;  1QHH D;  2XDV A;  3OYC A;  3D5R C;  1D1C A;  4RLQ A;  3VDX A;  1MNE A;  3EUA A;  2X1C A;  4E4H A;  2MC4 A;  4E7J A;  3H5R A;  4BQO A;  3DQV C;  4B47 A;  1G8X A;  4GRI A;  1WJF A;  3AKZ A;  1W36 D;  4C30 A;  3K4J A;  2JSP A;  4KT6 A;  3OWT A;  2R7T A;  3CZ6 A;  1X1D A;  2DT7 B;  1G59 A;  2Z1D A;  3W3C A;  1Z21 A;  4XOR A;  3PUB A;  2MFZ A;  2KQR A;  4RMN A;  4BXF A;  2M0M A;  1WFX A;  1X19 A;  2KZV A;  3LSH A;  4U87 A;  5CKT A;  3K4M A;  1X4P A;  3DWL E;  2R4G A;  3EUH C;  2HDW A;  3K4K A;  2IS2 A;  4E7S A;  3OR2 C;  2LG4 A;  3DTK A;  3FDY A;  2VJI A;  1W36 C;  4II3 A;  2KL4 A;  2OUM A;  2XF7 A;  4JQF A;  5KNL A;  3K4C A;  4BGD A;  2VQC A;  3IAS 2;  4RLF A;  2E1M B;  3NWT A;  4XLA A;  4CCM A;  2V9K A;  2V7F A;  1DQU A;  3OMY A;  4XR6 A;  3ZR8 X;  4E6K G;  2VJJ A;  1OLT A;  1Y6I A;  3IP4 B;  4OAY A;  4PJL A;  3W2A A;  4BS9 A;  3PNY A;  2LOO A;  2HZD A;  2WY7 Q;  3VWB A;  3PNV A;  2X51 A;  1MMN A;  4YEJ A;  2JUG A;  1SAU A;  3RSN A;  3BLY A;  4YRV A;  5HOO A;  3CF2 A;  2VJ4 A;  2E1M C;  4HG2 A;  3SZG A;  4IQJ A;  3K70 C;  2VQH A;  3IAM 2;  1AA7 A;  5LD2 C;  3CES A;  1WJC A;  4PUS A;  3OR1 C;  2DXI A;  2NOJ B;  3DPL C;  1IRX A;  2XF6 A;  2K9L A;  2LRE A;  2RNG A;  5CPR B;  4IKF A;  3BC8 A;  4NC7 A;  1WJE A;  4BEH B;  1MND A;  2R7S A;  4XNF A;  4NNJ A;  1DGR M;  4E7I A;  4B43 A;  1X1A A;  2X6Y A;  5CQG A;  3OS1 A;  3KX2 A;  4CCL A;  2KHM A;  4PSX A;  3OYF A;  4RM2 A;  4QPO A;  2R7O A;  3DPT A;  4EAT A;  4Y4R A;  1BOB A;  4BL0 B;  2R7X A;  1UEL B;  4F93 B;  4XLH A;  4II2 A;  1PYV A;  2A6T A;  3N05 A;  4PJM A;  2VKD A;  2X1D A;  3PL8 A;  2HNH A;  2QKM B;  4JOM A;  3MD2 A;  3HOS A;  1VZ0 A;  3I3L A;  4AYB A;  1V5G A;  2HU9 A;  1BR2 A;  2I8D A;  3EPZ A;  1EA3 A;  3LSI A;  2IXS A;  2KLO A;  1K6Y A;  3RPU D;  2ZXH A;  2X6X A;  4XN3 A;  3RQ4 A;  2WAQ A;  2E5N A;  1T0F C;  3A2K A;  2P0W A;  3HOT A;  3IUO A;  2X85 A;  4CCN A;  4ZJZ A;  2CMP A;  2RQQ A;  4XLE A;  3DU5 A;  4G6T B;  4B48 A;  4X0G A;  2CUJ A;  2JA2 A;  2A5W A;  1PJR A;  2PMZ A;  2CW8 A;  1DGW Y;  2Q2E B;  3SEQ A;  1N75 A;  3S3O A;  3HPH A;  3L2Q A;  3D5S C;  4NUB A;  2KPM A;  2VQG A;  4PFO A;  3VSK A;  2V26 A;  3OYK A;  3PFY A;  3BG7 A;  1R6R A;  3HG9 A;  3SDB A;  4J00 A;  2M7B A;  3G2B A;  4D1Q A;  4DJA A;  4XL9 A;  4ZYA A;  3L2W A;  2ZSI B;  4BQQ A;  2WAD A;  2E60 A;  3VYU B;  3L2V A;  2V1N A;  3PSI A;  2M4G A;  5HLT A;  1N77 A;  2UV1 A;  4XQF A;  5JHF A;  2BVL A;  5CQE A;  4CZC A;  2Y0S A;  3FBN B;  3HPG A;  3CP8 A;  1J09 A;  4PSW A;  2IGK A;  3LSM A;  3LMM A;  4Y3O A;  2VAS A;  2X6W A;  3PSF A;  3H9J A;  4YEL A;  3VSL A;  2QKL B;  2ZXI A;  3PJR A;  3UR3 C;  3TMO A;  2XAU A;  2V6E A;  2OV7 A;  4BE0 A;  4XM3 A;  3UNG C;  4B44 A;  2CH0 A;  2Z2S B;  4RM3 A;  2XSJ C;  3SYT A;  1LDK B;  4PK4 A;  2LRD A;  4XOP A;  3OYG A;  3RTR A;  2HVS A;  2ZSH B;  1E0E A;  1FMW A;  2HQA A;  1WJA A;  2VPL A;  4DBQ A;  1WJD A;  3ZCO A;  2F6C A;  3OYE A;  4XON A;  2XC7 A;  1YX3 A;  4CH7 A;  2O5R A;  2L9S A;  4BDY A;  2VL8 A;  3TL4 X;  2CFO A;  1WJ5 A;  3TBI A;  4KIS A;  2LY2 A;  3MKZ A;  2R7W A;  3S3N A;  4E7L A;  1GLN A;  2IS6 A;  1ERD A;  3OL3 A;  2R7U A;  4BE1 A;  5KCM A;  4CSW A;  3QYB A;  3MKW B;  4IX7 A;  3A4C A;  2OC6 A;  1MMA A;  1FMV A;  4DOZ A;  1NG7 A;  2LBF B;  4OWR B;  4ITV A;  3LL7 A;  2KRH A;  2ZFU A;  2WAE A;  3W2W A;  3L2R A;  2R7V A;  3DU6 A;  3QOD A;  4MLO A;  1DP3 A;  3ZQQ A;  1LVK A;  2M3A A;  3E0J B;  5HNF A;  3HKZ A;  4BEH A;  1MMD A;  2VXD A;  2PJR B;  3DTI A;  2VKH A;  2KP6 A;  3K4N A;  3S93 A;  2K5C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...