4KT6A

High-resolution crystal structure streptococcus pyogenes beta-nad+ glycohydrolase in complex with its endogenous inhibitor ifs reveals a water-rich interface
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
GNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of Streptococcus pyogenes beta-NAD(+) glycohydrolase in complex with its endogenous inhibitor IFS reveals a highly water-rich interface
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Nicotine adenine dinucleotide glycohydrolase
total genus 87
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1660 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4kt6A01
3PNTA 4KT6A
chains in the Genus database with same CATH superfamily
1O3TA 1IXSB 1XD7A 2WV1A 5DEQA 3J80K 2GAUA 3ABTA 4NC8A 3L2UA 1A04A 1EH8A 5L3DA 5HDNA 4G7HF 4HZFA 1S5LC 5CPRB 2VE9A 1YJ9I 1YIOA 4A0ZA 3ERMA 1KZHA 1RETA 3GMEA 3BZ6A 4U87A 1X2MA 1OCPA 3KEYA 2E7WA 3R4KA 3S17J 1PP8F 1YTYA 2DT7B 1R4MB 3VSKA 2HZDA 3I53A 4ENJA 5A2QZ 1ZRCA 2R7RA 1MGTA 3OIQA 2QKMB 2ZFUA 5KAIC 5DUKA 3EETA 1F43A 2BY1A 3LSPA 3KP5A 1EA3A 3A0BC 1PVEA 1BIAA 1MBFA 1ZGAA 2CYYA 1UZCA 3I3LA 2K9MA 3PQKA 2I5UA 4D1QA 4O5VA 5C4XJ 5GPAA 2COBA 1STZA 2JSPA 5H2FC 1PJRA 4C30A 1CF7A 3GTKJ 3PIPF 3QWLA 1ZN2A 4XSXF 1UAAA 2F4IA 1RPWA 1B72B 3EUAA 4M9SA 4CCMA 3VYTB 4AVPA 2LSOA 1S7EA 4PUSA 3HIFA 1RC9A 2XAGA 4MTDA 4WK8F 1MZBA 3VPRA 4EV0A 2EPFA 4QPOA 3WGIA 4KIFA 4RB1A 5L3BA 4AC0A 2J5PA 2NXNB 3HG9A 2X48A 2LY1A 4LJZF 2Q2EB 2MD5A 1U5TA 2NS0A 2HU9A 5F04A 4D5CA 2R92J 5IT3A 3Q0UA 2FEZA 2FQ4A 3H9JA 4GFBA 3B73A 1ZG3A 3GYHX 3L2VA 4LD5A 2BY2A 2QQBA 5EYRA 1W7PA 3OYKA 1MNEA 3JRBA 2L9RA 3D5LA 4XNFA 1XTAA 4H4KC 2Y0MA 2OCEA 3V8LA 2K5CA 1RI7A 2VXDA 2HOSA 1U2WA 2QBYA 2PMUA 2BXYA 3BG6A 4HAMA 4K2EA 4R8HA 3BR3A 2BXZA 4M3EA 4HQEA 1DDNA 4ZDPA 1D1CA 4KDPA 5D6EA 1JHHA 3PL8A 1APLC 2KKOA 2V4JC 4A6EA 3I5UA 5KK1A 1R6RA 2DU9A 2LREA 2VKDA 2W48A 3QPTA 2L01A 1T33A 1E3HA 5EEAA 2MLKA 3DKYA 4XM3A 1T6SA 5LRRA 4HQMA 2OC6A 4OINF 3CDHA 4CYDA 4BXFA 2DW4A 4ITVA 3TEDA 1T08B 5HNFA 1I3QJ 2VKVA 1BOBA 4XRSG 4MO7A 1USSA 5EZGA 2F5DA 2KJBA 3F8NA 4R1HA 1ERDA 3OYJA 2IGMA 1LVKA 5FRNA 2DPDA 3GUDA 2BV6A 1A5JA 2P6SA 3I64A 4G7ZF 1WRJA 4A12A 1HKTA 5FD5A 3TO6A 5TRDA 1YS7A 4XORA 1Y56A 1DU0A 1Z05A 2A5WA 2X1DA 2HDDA 1X3UA 3I59A 2NVYJ 3OYMA 1FYLA 2OJED 4HV5A 1FSHA 1VQ5I 5IYBJ 1XDSA 1O4XA 5D4RA 1G4DA 2EZKA 4UVCA 3FM5A 2CG4A 2X6WA 3E7LA 2EV0A 3OYGA 2Y48A 2KPMA 1XGOA 3MZYA 4A3GJ 1B1BA 4CDGA 1IJWC 4ZH4F 3K1PA 3CCQI 3MKZA 1IXCA 3LQQA 4ESFA 2D1HA 1SMTA 1JT0A 1ETVA 1AOYA 3QYBA 2HS5A 3KIOA 4DNCA 2XRLA 2FQ3A 3G4SI 1T56A 3GEZA 2ME6A 3CQZJ 3M07A 3V8KA 3T8RA 3BWGA 2BEOA 4Q5SF 5J40A 4BAYA 1GUUA 2XPVA 2R5YB 1IGNA 1YIJI 4RGUA 3OS1A 5K1YA 1QU3A 2HYFA 3GW2A 3CMAI 1ZH5A 5J1YA 2DA3A 1UCRA 3LA2A 2QKLB 4WCGA 5JHUA 4OMYA 4IHYA 2FBIA 5GAHJ 3Q3SA 1YQAA 1D1AA 1OR7A 3CESA 1SFUA 4A0XA 1BI3A 4PSXA 2VBYA 3BCBA 2EH3A 2LFBA 3IWZA 5C3EJ 3N97A 5IT9Z 2K02A 3CP8A 3M1CA 3L2RA 5IYDJ 3KP3A 2QGUA 3W2WA 1R1UA 1RKWA 1TWAJ 4BNCA 4EGYA 2IS4A 1J9IA 1OCCH 3TQNA 2FOWA 4DYRA 1SD6A 3ISPA 3ABMH 3HGYA 4XN3A 4A3DJ 3FXKA 2RNGA 3DEEA 1T0FA 2LD5A 2Y2ZA 3HXLA 4XL9A 2IS2A 1ETWA 2VBZA 3KLNA 4N9IA 1BW5A 3CD6I 3RTRA 2CQ7A 1R58A 3GZNB 1Y1WJ 3K4NA 2ZO4A 3D5SC 3H0GJ 3H5NA 3F0CA 3GWZA 5CVJA 3FIWA 1SANA 1VTNC 2VC1A 1IXRC 2ZJ2A 3IH3A 1XMAA 2E5NA 3OYLA 3S1NJ 4GCVA 3AG2H 1BIBA 2IGNA 3BCAA 1S9HA 2ZNZA 5FO5A 3TMOA 4ZTJA 5BOXA 3NRVA 5JLXA 2ELKA 2O6GE 4F52A 4HW0A 4MQVA 2R7ZJ 2DFHA 1R7JA 1L3LA 2KP6A 3EUHA 1R5HA 4LB6B 5K7ZA 2H6CA 5M3FJ 3CCMI 1DUXC 4HOBA 1FIAA 1QO0D 3WG7H 1S72I 2AS5F 2P8TA 1X1CA 3KEQA 2Z99A 1D3YA 2QLZA 3OWTA 3LSRA 5ICGA 4M6VA 3O3KA 2COMA 1QRYA 2M8GX 5K5RA 1OISA 1TNSA 2LH9A 3LSHA 4ZZDA 5ICCA 2LKXA 1ZR4A 3H92A 4V2FA 3IKTA 4HRIA 2BYVE 2VI6A 2JPBA 3K6GA 1IUYA 3IRQA 4FT8A 2L02A 3CCVI 1IN5A 2LYCA 4DOZA 1IRFA 3F21A 1TWGJ 3HOYJ 5LHGA 4WX9A 3ZMUA 1IAWA 2HOEA 5J4VA 3ZMVA 4GRIA 1FY7A 3DP7A 3JRAA 1MH4A 2DT6A 4L5JA 3K0LA 4HG2A 3A02A 5FKLA 4EVIA 1OLTA 3HC7A 1JTYA 2FMYA 1T2KA 5DCFA 4X6AJ 5J6XA 4CCKA 1W5TA 3I4MJ 3TO7A 3MQ0A 4NUBA 4RMNA 4CYCB 2NVQJ 3P7NA 2MG4A 3GZ5A 5LGUA 3GX4X 2OU2A 4I09A 4ZYDA 1QZYA 1U9NA 1LNWA 3PQJA 1AKHA 1YW9A 3MFKA 1I1GA 2YR2A 1XDUA 3FXUA 3FXMA 1ZG5A 1TQMA 2VQCA 2NNNA 3BR1A 3GFIA 1Y0NA 2XV4S 1H0MA 5FKMA 3CMYA 2HDWA 3RKXA 1IV6A 4KT6A 1I3AA 2IT0A 4A3EJ 4IHSA 4GGGA 3WODF 4WWCA 1U0JA 2ZXIA 1E2XA 1FBUA 3R61A 3V7RA 1TW2A 1PUFA 3VYUB 3K70D 5KHDA 4DBQA 1RUNA 4PGHA 2CQKA 2XB0X 2STTA 1VI0A 1XSVA 2V9VA 4KMUX 2FJ1A 4PJNA 1MDMA 3HL2A 2IJLA 5CVUA 4KYWA 2BBYA 1ZK8A 4UNOA 1X3ZB 3FBIB 3GXOA 3E5UA 2JA7J 2R0QC 5AIPA 4D7MA 2VJJA 3EYIA 4A69C 3UR3C 4G94A 1FYMA 5E17F 3GBGA 4PGGA 2V9PA 1BN5A 3CJQB 3E6BA 2KZGA 3GTJJ 1R23A 4LK0F 1FZPB 1K4SA 4KIGA 4XOTA 4EGZA 4FISA 4AM3A 3RZOJ 1UMQA 3L9FA 2K4JA 2EA4A 1NTCA 2R7SA 1NHAA 4A2UA 3LWFA 3QYEA 4V2GA 3WTYC 3MCZA 3HPHA 5F6FA 1T98A 1TZLA 2P81A 3BQYA 1XS9A 1VQKI 1R22A 1G3SA 2DT5A 1TWCJ 2ZJQF 4UB8C 3JRHA 1EV7A 1XG1A 2HR3A 3AG1H 2MC4A 5GADJ 1VFCA 1W36C 5HNHA 1IRXA 2JTVA 2O8XA 3K2AA 3U2RA 3U21A 2H8RA 2HOTA 5H6RA 4AD9A 1O57A 3ECOA 1Z77A 5CJ9A 5TGTA 3KETA 2WAQN 2AXTC 1D1BA 2PEXA 5E18F 1E3OC 3QPHA 3WTUC 4BEHA 2LC2A 2VKEA 3PNTA 5DCMB 4ETSA 1LEBA 1OCOH 5FJ8J 1V55H 1BI2A 1CF7B 1BI1A 2R7UA 1SVLA 3K4MA 3WGGA 2UWMA 3DKXA 2KRCA 3LSTA 5FGMA 1RKTA 2VJIA 1K78B 2QCOA 5LGTA 1HA8A 2PBIA 2KIMA 2P0WA 2FOKA 3HTSB 4I01A 5BQTA 3HOXJ 3WTVC 4OOIA 4UHTA 3F8MA 5CVVA 2BHZA 4C3HJ 1LFPA 2ADUA 4I0BA 3CC4I 1VQ4I 3VB2A 2UUZA 2KL4A 4AYBA 4MNUA 1J2XA 4JP0A 3TW6A 2BVMA 2I10A 2M8EA 2TRTA 2IAIA 4U0YA 1ZG1A 4S0HB 3K10A 2XGEA 3DU6A 4GDFA 2VONA 3MMYB 1ZLJA 3AAFA 1JE8A 1EF4A 1XCVA 4Q48A 1LEAA 4L0ZB 4IRIA 3W6JB 9ANTA 2XAQA 1OPCA 1ZELA 3JSPA 2CWEA 1FMWA 3FXLA 1MJBA 1IZ1A 1SFEA 4UY8I 4XICA 2Y30A 4B3XA 2Y9ZA 4B8XA 3HKZN 4BH9A 3OOPA 5HS8A 2JRMA 3L1PA 3JRDA 1GVJA 2P7CB 3OIPA 3IAM2 2OD5A 1W7PB 3HHHA 1OYWA 2V7FA 3V7CA 2IBDA 1TQPA 3OS0A 4AIJA 1B8IB 4IHVA 3RKWA 2KISA 2BZTA 5E3LA 1D5VA 2HQRA 1J09A 1WI9A 2GZWA 2I8DA 3J7AY 2CUZA 1RRJA 1G3YA 3WTSC 2M2EA 2W4SA 1ZAOA 1TW3A 2P5LC 1KQ0A 3W6KB 1QPIA 2HVRA 4DYQA 1B8IA 4EMSA 2MD0A 3HEFA 3WG9A 2E36A 3WE2A 2QVOA 2XHKA 4JX4A 5HS9A 3JW4A 5DDGA 2Z9OA 5CQGA 1K7AA 1Y0UA 4BHPA 2HI3A 1JTXA 2F4MB 3FXJA 5E1WA 2PMZN 5IP9J 4P5OA 4ZDLA 4RBOA 4QSHA 4MGRA 4CICA 2HTJA 2M5WA 2P7VB 3JRCA 2ID6A 2JA2A 1A36A 1QBJA 2HQ5A 2NS8A 1S7AA 3LFKA 4E7LA 2WY8Q 4ESJA 3K7AJ 2EZHA 2OUMA 4U7DA 5IOZA 4A3FJ 2DQLA 2E2HJ 4IJAA 4FTHA 3CC7I 3M1EA 2DAOA 3BP8A 3IP4B 1P4WA 2H8WA 1XSDA 3LQRA 3Q0VA 4M71A 4PJLA 2H27A 1WJBA 2LKSA 5LEKA 5F0CA 3FK6A 3JREA 1VF9A 1ZTRA 2BY3A 1ETYA 2EFNA 2M87A 2QQ9A 2O7OA 3J81Z 2A5YB 4YFNF 2Q1ZB 2E1MB 1LDJA 2GA1A 4RGRA 2LRDA 3OL4A 1X58A 3D5RC 3AFHA 2EFOA 3N05A 4PJJA 2FF4A 3F72A 3HM5A 3V8JA 1VQ9I 2EK5A 1FTZA 1GVDA 2AO9A 1TWHJ 1SD7A 3SYTA 5HODA 1IDYA 3EUKL 3WTZA 4HNTA 1G3TA 5E1ZB 2DFIA 3RDIA 3HUGB 2KMUA 5JVTA 4A3MJ 2XSJC 1ZLKA 2X1CA 5FKNA 3TBIA 1XMKA 3TP3A 3TP0A 1T39A 2M9HA 3T1BA 1GLNA 2B7EA 2K3FA 2ZC2A 2K3PA 3S32A 2QM3A 1I39A 5E8GA 2X4HA 5LHHA 5D6FA 4XR6A 3ZMTA 1TC3C 3H3UA 4AUXA 4HDUA 3I0TA 2G0EA 2WC2A 2NNYA 1HBXG 1EKEA 1T0FC 2KHMA 3M3YJ 2V6CA 4GXOA 4UV9A 3CCJI 3F23A 5EZHA 1NK2P 2L9NA 2CS3A 3I4PA 3TDUC 2LVSA 1YX3A 2W85A 2RC4A 3SXYA 3HOSA 3NQOA 3C2BA 3KFWX 5HDGA 2Y31A 2VJ5A 3PUFA 1FT9A 4OIPF 1FOWA 3IRRA 3ESWB 2XAFA 5FROA 2JSCA 4HV6A 3E3VA 4YIIA 4KITB 2BW3B 5D4SA 1UG2A 2VC0A 3AG3H 2BOLA 4Q4ZF 4DW6A 2F4OB 4U0VA 1V5EA 3HPGA 3LFUA 2QZ8A 4KIBA 1PP7U 1BW6A 1USTA 2V1DA 3PNVA 3F9KA 3FMRA 2CGPA 2K9LA 1OR7C 3GTOJ 5ERIA 5C44J 2HWVA 1SD4A 2MLGA 1X1AA 2NAZA 4G6DA 2TDXA 1GDTA 4BBSJ 3DBLB 5LBQA 2IP2A 1LFUP 1CQTA 2CV1A 5LRSA 1QNTA 3VFZA 2L4AA 1GHCA 4A3IJ 4ENKA 4RS8A 3KX2A 1YW7A 4RLFA 2OCCH 2HYJA 3BPVA 2DA5A 2H09A 3ML6A 4I2OA 4MEXF 5F08A 1Z0XA 2ESHA 3PIOF 2A6EF 4KISA 1A6IA 4Y33A 2VB6A 3GLXA 5FD6A 5LGNA 2KQRA 1G3WA 1B9NA 1IRZA 4II2A 2ZMEA 1IO2A 2NVTJ 2FE3A 3EYYA 2A6HF 5TISC 3CF5F 1JJ6C 5DS9A 1ZR2A 2VQLA 3OR2C 5M5WJ 3H35A 5JHFA 5LFAA 2VODA 1XPXA 2DMNA 1BBYA 1ON2A 5EG0B 4NBQA 3RKQA 4LLGF 2XDVA 4BQAA 4L9TA 2O8KA 1Z6TA 3FHZA 1VQPI 3F6OA 5HS7A 2JUCA 2KJCA 3PUBA 1K83J 3J7YJ 1GV2A 3TOAA 1FP2A 4LB5A 3A0HC 1W0TA 5FRMA 3VSLA 3CF2A 4OWRB 3GO5A 4IPAA 4LLLA 4P9FA 2V79A 2CQNA 2YX4A 4CA0A 3GZ6A 3N4MA 3BROA 1MJ9A 4OIRF 5DUIA 4E6KG 2OQRA 2DO7A 4J01A 2V1UA 1WI3A 2J5OA 5EEHA 4BY1J 1JT6A 1Q1HA 2LG4A 2OAZA 3OL3A 2MABA 3MKYB 1SAXA 2GIZA 1ACIA 2G9WA 4B4CA 1BR1A 3JTHA 4Z6YA 2NOJB 4YFKF 1LDDA 3U9GA 1YX5A 4ZJZA 4RGXA 5J4YA 1KU9A 2HTSA 2A68F 3L00A 4YG2F 5KVRA 3BZCA 3KE2A 3QP6A 3WTXC 4CGZA 3FXOA 2VOOA 2EIMH 3RPUA 3PFYA 3L2WA 1LE8A 4NQWA 1Y39A 3QPSA 2MFZA 1FTTA 2DFEA 2YU3A 2ZSIB 2L9SA 2GOMA 3CCUI 1FBQA 5D5UB 4RAZA 5EG0A 3LL7A 4M9ZA 3SFIA 4V19K 2JUGA 3WE3A 3MZHA 2E71A 2F5FA 2KLOA 3NWTA 2ZB9A 5D5VB 4RM3A 1H9TA 4BS9A 3BG9A 3CUOA 1WJFA 1GV5A 5LEJA 3CMEI 3IWFA 1ZREA 4B44A 2M1BA 2E60A 4QPQA 2LNBA 2QSGX 3H9QA 2R7DA 3ZQFA 4G9YA 2Z33A 4UUVA 1DU6A 1MIJA 2IW5A 2XKPA 4RDUA 3CLOA 5FLMJ 2OA4A 1OQYA 2WA0A 4KN4X 1BR4A 3G6EI 2CV0A 1Y6IA 3EQLF 2LY9A 5J8CA 2OBPA 3CTAA 1TL8A 5DV5A 4NHJA 4HX8A 4HF2A 2LBFA 3DF8A 3ECHA 4XLCA 2LKPA 2EIJH 1TP4A 3RCOA 4EJUA 3J81K 3BOQA 4UUSA 1R49A 3GTLJ 2IA0A 5K7FA 3LA3A 3I56I 3S1RJ 3KP4A 4RA2A 1XGMA 3FZVA 3MEXA 2F48A 2R7QA 4BL0B 5JI6A 2K86A 2XRNA 4C2TA 3QPLA 3CP2A 1U5TB 4Z2YA 2VIXA 4IQJA 1IRGA 5K7HA 3RYPA 3FKJA 3AL0B 1VNDA 4NDLA 1HOMA 2OV7A 4ZDOA 5LHIA 1YFHA 4BHCA 1PUEE 2KIQA 2PI0A 2CFXA 2A3SA 1O7FA 4EM1A 4L18B 2VN2A 2ZMEC 2OZUA 4BQOA 1BC7C 2QENA 3FWEA 1WSUA 2Y69H 3IUOA 3K1NA 2UZKA 1I6XA 2HNHA 3DU5A 4XRMA 1J7KA 3NAUA 1R5GA 4CUGA 3M8EA 3QODA 3G1LA 3S93A 2VPLA 4KUMA 5KAFC 2R7FA 1NG7A 3K2ZA 3F6VA 3JRFA 2EINH 2QWWA 3SHFA 2NVUB 4HSTA 1LKXA 2BVLA 2M7AA 1VQ7I 2IRFG 3PJRA 2WTEA 1IF1A 3CO7C 1UG0A 5BNGA 1G2HA 2F5CA 4C2UA 2LMDA 4M72A 3BT9A 2XSDC 4BXXJ 3ZRGA 1W36D 4O6JA 4L9NA 4MTEA 4KMFA 2CQXA 4LFUA 1J59A 3WU0A 2JN6A 1HSJA 2EFQA 1YG2A 2QQAA 2CH0A 2JWTA 4QTRA 2CU7A 2GXGA 3A01B 2CW8A 2ZXWH 2X6XA 4AIKA 2CRGA 4FETA 2VJ4A 3TL4X 1RIOH 2QBYB 2W57A 3CMMA 1BJAA 1O3RA 1FMVA 4OMZA 2ZXHA 5M5XJ 2CUEA 2ZMEB 5CVIA 2IXSA 2GIVA 4GYGA 3RKYA 5GTHC 6PAXA 1Z21A 2X1EA 1E0EA 3T0YA 2MH2A 4EM2A 1U3EM 4FCYA 3BR5A 3ZMZA 2LY2A 2Q2EA 1YLFA 2OZ6A 3V4GA 3WU1B 2EV6A 2HKOA 3VYRB 2VXZA 1P2FA 3SDGA 1EJ9A 4IOAF 5EDNA 2DMTA 3I4NJ 1Z3YA 3BQZA 3SQNA 1NK3P 5DD8A 2K85A 1JXSA 4FX0A 1AA7A 5JFRA 3FM3A 4PFOA 3KZYA 1W4MA 2K9NA 4CZZA 3KP2A 3COAC 2E7XA 4QIWN 3F8BA 4OAYA 1FPQA 2XKOA 4F93B 3I55I 4QLCU 4BQQA 2HVSA 1UHWA 4GYIA 1WJCA 2WB1N 3GFLA 3CUQC 1FYKA 1DP7P 2BY0A 2QSHX 2YUSA 1WHUA 2GOXB 2MGQA 3BJOA 2K27A 3CUQA 2MC3A 4JX6A 1TQIA 2DOAA 2P5VA 2B63J 4XLAA 2H6BA 2Y0SN 1FNNA 1YI2I 2VOPA 5EJCA 4EJOA 3Q5FA 4MEYF 2DQRA 4UXNA 3DXJF 4XKWA 1L0OC 3CCYA 3BR2A 5H6QA 2DMQA 4G8XA 1E3PA 1IN6A 3HHGA 2XF6A 3OR1C 5M3MJ 2OF7A 3L09A 4BGDA 1Y8RB 3DFGA 1ZRFA 3ABLH 1SVMA 1WZ2A 2LOOA 4L5EA 2EILH 1U9OA 2DA4A 1P9QC 3S8PA 1A6QA 2WAFA 3CLQA 2F5EA 3OYIA 2BGCA 3OV8A 4ANJA 2GLOA 2IPQX 2KIUA 3GTQJ 5DM6F 1J0RA 3OYNA 2ESNA 3G1MA 4XKBA 4XQFA 3K4LA 5IPAA 5E3MA 2JK3A 3NARA 4LG0A 2OQGA 3R6SA 3R60A 3HB9A 4AVZA 1ZYRF 2OPTA 3Q9SA 4HLXA 3VDXA 5BS6A 5J8FA 4LIUA 2M3AA 4MLOA 5KCMA 2ECBA 4RAFA 5D8KB 1FOXA 1O7LA 2DA6A 2VKHA 5ILUA 1D5YA 4W97A 3M8JA 2M0CA 3HRTA 4P55A 3H36A 4KA4A 3VODA 1P7JA 2QSFX 1JKOC 1ZKGA 3MAJA 1FLIA 3F3XA 3K4CA 1K78A 4JBAA 4Y4RA 5EGOB 4X0GA 5IYCJ 3A2KA 3PO2J 3KZIC 4LLNA 2YS9A 2E35A 4KICA 5IY5H 4MQ9F 1Z1DA 2HQNA 4AU7A 3HJEA 5IP6A 3QQAA 1D0ZA 1WKMA 4DQ2A 3WU2C 4PSWA 2HXIA 1HKSA 4WXHA 3F8FA 2P6TA 3PM1A 5FLXK 2JJ7A 1OYIA 3CCEI 1TBXA 4U88A 4NNJA 2FBHA 3HRMA 4PK4A 4E4HA 2E5ZA 2RV8A 2AHQA 2VL8A 5ICEA 3GFJA 2ETHA 5FLVA 4CYCA 1GT0C 2ZFWA 4BBRJ 2HGCA 4C9YA 2Z16A 1DGWY 1MMNA 2OTLI 2MA3A 3OYCA 3QRFF 1LJ9A 4B47A 1GXQA 4P96A 1WJEA 3JAMZ 4ESBA 1OFCX 2NVXJ 3DQVC 2KIFA 3BTCA 3NEUA 1ITYA 1WCMJ 4PFPA 1HDPA 4YRVA 5B1BH 1R9TJ 3HBLA 3OYHA 4FHTA 5DM7F 5GP9A 2DTRA 3UNGC 1SEUA 2K9QA 1KU3A 1IG7A 3ZQCA 2STWA 4IXAA 1W1WE 4M3BA 3KCCA 1R00A 4L9JA 3QOPA 1T95A 2Y75A 3GVAA 2GQQA 5J1RA 2XB5A 3DBRB 3JSOA 5JLWA 3ZMDA 5DD4A 2FRHA 2B0LA 1PUFB 2M30A 3BG5A 2LDUA 3MWMA 1B59A 1MMGA 5HLHA 2M34A 3OSGA 5B1AH 2ZBKA 3BDDA 2EJRA 2O3FA 1WPKA 2E19A 2HVQA 4I0AA 4D0PA 1FIPA 2GWRA 2BE5F 4IHWA 2LTPA 3OMYA 1A35A 2MBFA 3G71I 4HX7A 1HSTA 1OCRH 4BJ6C 1Z9CA 1WH7A 5CKTA 5IP7J 2EFWA 3FHNA 1PYVA 3F8CA 2GM4A 2X85A 2L7FP 2W1OA 1FC3A 2DMPA 4L5IA 2O5RA 2HYGD 2P4WA 4X1EA 1MJAA 4L9VA 1WFXA 2HKXA 3G2BA 2ZXJA 3C3WA 3R0JA 1VZ0A 3OOUA 2WAQA 1IC8A 3KLOA 4FQGA 2HPMA 2EQRA 3DPTA 3KP6A 3HOWJ 2KT0A 1F4KA 2CSOA 2W00A 4O3MA 1R4NB 5J47A 2CO5A 3JRIA 3A1YA 1MH3A 3P9CA 4H0EA 4F7ZA 2QEXI 1QZEA 5HDKA 4KN7X 5E3OA 4G7OF 3E97A 3DPUA 1JJ8C 2E2IJ 2R7TA 2DA7A 4LGWA 1ETKA 1W5CC 3K9TA 1TTYA 2E34A 3DLLF 1DP3A 1JKPC 1WWXA 3LSMA 2G7UA 4AYBN 2QYOA 4CH7A 2NS7A 3IKVA 1S29A 3PO3J 1ULYA 1KGSA 1Z67A 1B6AA 3CCLI 2HXOA 1H89C 4UV8A 2ACJA 4F55A 2DA2A 4HBLA 1P7IA 2DK8A 4JOMA 1FP1D 4EJVA 2PQ8A 2H94A 2L7MP 3IL2A 1S3JA 3FISA 4HPQA 4D9JA 4DIQA 3H3ZA 1MMDA 2X51A 2Z3YA 1I27A 4N0BA 1VQLI 1SFKA 1LDKB 1IV8A 3L2QA 2DOEA 4B43A 5D5WB 3LAJA 4BACA 1AKHB 4HDVA 2X0LA 4HX4A 2WADA 3GCMA 3G73A 3TW7A 2D1VA 4BJ5C 3HRUA 5A2QK 4CCOA 3LAPA 3JTGA 3MN2A 4C3IJ 3FK7A 1VQNI 2H1KA 1VQMI 2M0MA 4N4NB 5F1RA 3WHCA 3S2HJ 4MHGA 2EFPA 3SJMA 2AQEA 4ZYEA 4UUSB 2R5ZB 1T38A 4U7BA 2JVHA 2QQ8A 4WXCA 3VOEA 1BA5A 1IN7A 1S8NA 2PMZA 2O61A 2UV1A 3HSFA 2ZJRF 3HOUJ 1YYVA 2LK2A 1YE9A 2M7BA 3BC8A 1DGRM 3RJPA 3RPQA 1SD5A 3E5XA 3MVPA 4ZC3A 2L2OA 4MIMA 4XONA 5B66C 4XRSA 3GLLA 2EWNA 5JVGF 1VQ8I 3OYAA 2YU9J 2ID3A 3DWLE 3FDYA 4HEA2 1LPQA 1DPRA 2DA1A 3LSIA 3T5XA 3K4BA 2F2EA 3KZZA 4PZJA 4ASNA 3DBHB 4A0YA 4E7KA 4KNYA 3QP5A 3V7SA 2UXXA 3AG4H 2X6OA 4QWQA 1R36A 5K5QA 3A4CA 5D8LB 2EA2A 4M3DA 3FXQA 1HXDA 1POGA 3CC2I 5DTDA 1N77A 2LP0A 1XN7A 1J5YA 1BM9A 4M73A 2XF5A 1D8JA 2W82A 2WV0A 4Y3OA 3JRGA 1JUSA 4HNVA 5L3GA 1UB9A 3G3ZA 2ICWG 2VPRA 4EQQA 3JAMK 1D0YA 4LMYA 2E1CA 2O9LA 1P4AA 3ZN1A 2KRFA 1SFOJ 2YX7A 1HLVA 1LFBA 2XAHA 1X1BA 1F5TA 2K4BA 1XC5A 3R0AA 4HLYA 2E2JJ 3SEZA 2K7LA 4XIDA 3BG7A 4XK4A 3H5AA 3TGNA 4LG0B 5H20A 3WHBA 2IS1A 4EJWA 4A3CJ 4B1RA 3S3MA 2VE8A 4EM0B 2O03A 3FMSA 3HSEA 4LOCA 1MW7A 1FJLA 4IHXA 2V9KA 1V54H 3AL0C 3H0DA 5HLGA 3ABKH 1JI8A 3DTIA 3M9AA 3TO9A 4XBFA 1X4OA 5FKKA 3L7WA 4YEJA 4I02A 2RKHA 2FX0A 2CMPA 3O6BB 4F3QA 3DEWA 2L7ZA 2M45A 3KYLA 2QUFA 5FFXA 1HCRA 1IN8A 2L9VA 2PJRA 2RNJA 2FSWA 1MKMA 4RGSA 3RI4A 1R1VA 5E8IA 2XAUA 4XLEA 3EUHC 1LUJB 3O2PE 2Q8KA 4CHUA 4EJTA 2WBMA 4BDYA 1U6GA 2CQQA 2R5YA 4IX7A 4BYYA 4RB2C 2XGDA 4XLHA 4B48A 5B3SH 4DBRA 5CQEA 3K70C 4NB5A 1ZHFA 2XGCA 1W7PD 1WQ2A 1SFXA 1R1TA 4NC6A 2XF7A 2W84A 4F91B 4UVAA 5ED4A 4DZJA 2VQHA 2NYXA 1X19A 1RNLA 2W25A 2XPWA 1U5TC 2A61A 2DI3A 3K69A 3LSKA 4JK1X 3RQ4A 3MZ8A 1Q1VA 2JMWA 3BJAA 4I98B 3CCSI 1HC8A 3ZQHA 3AKZA 2V26A 3CDLA 1ETOA 3BPXA 3S2DJ 3BTIA 4L0YB 1RR7A 2FUG2 3ZP5A 3S1QJ 3OYEA 2L4MA 2M4KA 3B02A 3I71A 1H9GA 3IAS2 3VYSB 5GPCA 3J7ZI 3UKGA 5FFZA 2ZSHB 3HRSA 3K4JA 1DPUA 1J75A 3ERED 3RIRA 1P6RA 4RAGA 3TDZC 3J80Z 3EPZA 3IV5A 1VQ6I 1BJZA 2E1NA 2DMUA 3HOVJ 4I7HA 2KDOA 2DBBA 3ZPLA 5D5XB 4HYEA 2DODA 4W1UA 2WAEA 3KYDB 3QU3A 3QAHA 2KZVA 2R7VA 3GF2A 2IEKA 5DYMA 3OYFA 2ISYA 3OS2A 1I6HJ 2HZTA 4BE0A 4S05A 1ZGJA 3WGHA 4D5FA 2UXNA 2XVCA 3ONQA 1H88C 1KU7A 3HUGA 1ON1A 3E0JB 4OIOF 1TNTA 1XMXA 2FA5A 2V6EA 3M8FA 3A03A 1BI0A 1S7OA 4CXFA 2FD5A 4M74A 3U1KA 3H1CA 1H8AC 1R71A 2RQQA 4Y52J 1JUPA 2VBXA 3BTLA 4XSZF 1WJ5A 3WTWC 4XLNF 4RM2A 5EGOA 4YIFA 4JQFA 4A3JJ 3QYFA 1FWZA 4UUTA 5CVRA 2G7HA 2XASA 3C18A 1JHFA 4CCLA 4XLFA 1QA6A 1REPC 3FXRA 4Y15A 4F92B 2BHYA 3B6AA 3OY9A 4IHTA 3EDPA 3SDBA 5AIQA 1KQ9A 1QZZA 3KEOA 4BJTA 1Z7UA 5CLSA 1RR8C 1LVAA 4HNUA 3E6DA 1B4AA 4C2MJ 2DDBA 2F6CA 5BPIA 2LF7A 3ZQ7A 1X4PA 3DTEA 4HSRA 4FX4A 1IN4A 1KA8A 2JRTA 4R79A 1S6LA 4II3A 2IGKA 2W7NA 4ENNA 2DLLA 3GFMA 1NH3A 4YELA 2HPIA 4DJAA 3E6MA 3S2WA 1ZQ3P 2Q0OA 3CZ6A 4IRGA 1WGXA 2HOAA 4A93J 4IF4A 4Y7NJ 4XOPA 2EIKH 5F64A 3SZPA 1RESA 3VWBA 3C1DA 1PDNC 1V5FA 2DYSH 3E5QA 1KU2A 3FKIJ 3OYDA 4PDKA 4BU2A 1QPMA 3IH4A 3TKYA 5LD2C 1YS6A 1IW7F 5E1XA 3HZJA 5DCMA 1C0WA 4HF1A 3M4OJ 4BEHB 1X1PA 1F9NA 2DTZA 2V1NA 3ABUA 3FF5A 2GA2A 3HTUA 4IVNA 3KPHA 4M9XA 4WXDA 2VT3A 1YOVB 1YW8A 2K9SA 4IO9F 3PNYA 2ELHA 3B6CA 4P9UA 1FSEA 2DPUA 2JT1A 2ME0A 3ZR8X 2ZKZA 1LB2A 2MH9A 1ORKA 3HOZJ 1HF0A 2A07F 2WB1A 3JR9A 1M1EB 1E17A 4M6XA 3E6CC 3S1MJ 4J19A 4BE1A 1HQCA 1F1ZA 3Q0WA 1BC8C 2L5QA 4I99C 4E70A 4KJZA 4PCQA 2XROA 2NOGA 2VLAA 3I54A 2YSRA 4XRFA 5BPDA 2CJJA 1I50J 4OAZA 2EB7A 5TJJA 1Z91A 1MDMB 1JGSA 4DZPA 4XLPF 1T8IA 2OTJI 3BLYA 4A5NA 2L3DA 4BE2A 3QOEA 2ZJPF 2JZYA 3CUQB 2IA1A 3ZQGA 3W2VA 3KP7A 3M7GA 3ZN0A 3U1DA 3PSFA 4E7JA 3K4KA 5L3CA 3Q9VA 1SVOA 3S14J 2DN0A 2FU4A 3JCUC 2XAJA 4BXUA 2PG4A 1K6YA 4Q47A 2C6YA 1YRNB 2WY7Q 3W2AA 4CCJA 4DGWB 3H3VK 1NG6A 2ZCWA 1OKRA 2DYRH 1K4TA 4RAYA 3S3OA 2HEOA 3CJNA 3BG3A 3ZGKA 2CUFA 3IH2A 1KONA 1ZRDA 1ODDA 2PLYA 1TT5B 1AU7A 5F27A 3DEUA 2XC7A 4HF0A 2DFFA 4ON0A 2JA5J 5ICFA 5EF6A 2E1MC 3REOA 1FX7A 2GBYA 1UFMA 2TCTA 1MMAA 2R93J 2LR8A 2L7KA 5J1UA 1IDZA 1W5SA 1G6NA 3X2QH 3HKZA 1KYZA 3NWSA 4ZTFA 4RLQA 2F5VA 4LG3A 2IS6A 2VASA 5CYVA 2XIGA 3A01A 1JKQC 1HW2A 4LK1F 4AIDA 1MSEC 2CW0F 2RAEA 3H9GA 3DTKA 3SEQA 1RUOA 1AWCA 1BL0A 5J3LA 1YJNI 2AQFA 1OJLA 2FNAA 1ONVA 1UHSA 2JQ7A 3LSJA 3DCFA 2O0YA 2B9SA 1ZGWA 2CUJA 3ZCOA 1XX5A 3MKWB 4I6ZA 1FBSA 1V4RA 2YPRA 2EV5A 4M6YA 4CSWA 2PJRB 2H1LA 1WJDA 2XPUA 4JYKA 2DXIA 4LITA 1BOAA 2VT2A 3RSNA 2L0KA 4DYCA 3O8GA 3RZDJ 5FLXZ 4EEFG 2VBWA 4A6DA 4XN0A 3W3CA 1R5ID 3IHUA 1V3FA 2A69F 2Z5UA 4UVBA 3WTTC 2V1XA 4PJ0C 4IL6C 4IEJA 3OIOA 2D2WA 5KNLA 4N9HA 2QA4I 2R4GA 3ZQLA 4BUPA 1MNMC 2GXAA 1KQ8A 1XGSA 1ENHA 2QF7A 5GAGJ 4RB0A 1X3WB 2ELJA 5ILVA 4I76A 2R7WA 4HA8A 4XMYA 5FB2A 3BR6A 4XKVA 1MBEA 2RVCA 1Z7LA 5HOOA 5F0FA 2P5KA 2RREA 5C4JJ 2DOFA 1WJAA 3SFZA 4BKXA 1HDDC 3GTMJ 2RN7A 4EATA 1FEXA 1XB4A 2IGOA 2Y9YA 4BY7J 3ZQIA 3DV8A 3ZOBA 3E1SA 3P9KA 4KFCA 4OIQF 3GTGJ 3I59B 3C2HA 4WF2A 2Z2SB 2MYSA 1XGNA 2N8GA 2JA8J 5HLIA 5F1JA 1JGGA 3K1MA 2DK5A 1BR2A 1FOYA 4UB6C 1Y1VJ 1I5ZA 4IQ4A 1Z6RA 5LLQA 3GTPJ 1Z3XA 3CO6C 1TWFJ 1HW5A 2A05A 2NRAC 1UHMA 1WH5A 2KFDA 2E1OA 5FKOA 1LQ1A 4YIRX 4PJMA 3O8HA 1WVRA 1Y8QB 1U8BA 3L2CA 1X2NA 1MD0A 3MD2A 4G6TB 3FMQA 2CW7A 2HFHA 3I58A 1QGPA 3S3NA 3RPUD 1UJ8A 1G8XA 3BY6A 4A3KJ 2EZLA 2KDZA 2IA2A 3ZQQA 1GXPA 3LMMA 2ZNYA 1ETQA 1SMYF 4JX5A 4U0WA 5L3EA 4IKFA 4Y13A 4IOCF 1JUMA 2EZIA 3IC7A 4CZCA 2WWYA 2A6TA 1O3QA 4BHBA 3PFIA 1SAUA 4ZZLA 4CCNA 1YITI 3ELKA 3P5JA 1A31A 4NQWB 1OCTC 4FE7A 1ETXA 4MFDA 1JKRC 4S04A 4ZYAA 2X6YA 4G6QA 2ISZA 1MSFC 3ZMSA 1TT0A 5B5EC 3W6VA 3DLAA 3C2GA 3ZXSA 1AHDP 2PMHA 3CDIA 3HOTA 2PJPA 2MW8A 3RYRA 1YO5C 3T8TA 2DJIA 3DPLC 1QHGA 4KT5C 1HKQA 1MBKA 1N25A 4J00A 1CGPA 2M4GA 3BZKA 3H5RA 1VQOI 4YFXF 4Y17A 4ENMA 1K6OA 1OYYA 3C7JA 5GAEJ 2CFOA 2VUMJ 2FXAA 5HLTA 4E7HA 1K61A 3LNQA 2HDCA 4ABZA 2CV2A 2K40A 2VQGA 3TOBA 1OMIA 2DCEA 1YJWI 3J7AO 1P4XA 5AONA 4FASD 4ZYHA 1YRNA 3RQIA 3LSGA 2W24A 1MBGA 4A3LJ 2JVGA 1U78A 1FOKA 3HGGA 4A3BJ 4NC7A 2LLKA 3BJ6A 4M3FA 1KYWA 5GTIC 1OCZH 1U8RA 3DKWA 1I1SA 3PSIA 3ASOH 3D0SA 1MMSA 2RGVA 3FX3A 5BMZA 2AXLA 3G1OA 2LBFB 1RZ4A 3F22A 4IZZA 1QHHD 1XCBA 4MFEA 2ECCA 2PX9A 5IT9K 5M5YJ 3LA7A 1HW1A 3BR0A 3CJRB 3ASNH 2FNPA 2R3SA 3MKLA 3SZGA 1N75A 5K5OA 5L3FA 3S15J 3S16J 2LF8A 3OSFA 3KYCB 1MBHA 1W0UA 1MNDA 3SZTA 3ULQB 1SC7A 2R5ZA 2L54A 4B09A 1MBJA 4P1WA 5E20A 1D0XA 3VEPA 1TLHB 2GXBA 2HQAA 1ZARA 1IUFA 2PN6A 1UELB 1EH6A 2DJNA 2DDAA 3ROUA 1X1DA 3BTJA 1YHQI 1K79A 2R7XA 1F36A 2Y0SA 3FBNB 5E3NA 1QVUA 1LE8B 3CCRI 3LOCA 2XUBA 3V42A 1D8KA 1QQIA 2RDPA 3CJTB 5EEGA 1O3SA 2JA6J 2FMLA 2D5VA 2RQPA 4A5MA 2MSYA 1EH7A 3OYBA 1N78A 2FBKA 4GO1A 2PFBA 2X9DA 5F0HA 1P92A 4TV7A 4XKCA 4E7SA 4D7NA 2JPCA 1B9MA 3P9IA 2KRHA 4B3AA 4AWXB 4N4OB 3HSRA 2IVMA 1B72A 4AIHA 4BQNA 1G59A 1DQUA 4CO8A 4ZYGA 5IOYA 4FE4A 2BW3A 3D1NI 4M3GA 4E7IA 4C3JJ 5ILSA 3QU6A 3HYIA 5JR3A 4BDZA 1QVTA 3HDDA 4OU0A 1XSXA 4LIVA 4RB3C 2D45A 2Z1DA 5HVQC 2XGXA 3I9V2 5E79C 4E7ZA 2EBIA 1V5GA 4G12A 4IRHA 2R7OA
chains in the Genus database with same CATH topology
3EPZA 1ZELA 1FMWA 2KDOA 4NC8A 3L2UA 4XKWA 2WAEA 4B3XA 2KZVA 5CPRB 2R7VA 2XF6A 3OYFA 3OIPA 3IAM2 3OR1C 3OS2A 2V7FA 3OS0A 4BE0A 4BGDA 4U87A 3ONQA 2LOOA 1J09A 1P9QC 2I8DA 3S8PA 2CUZA 3J7AY 2WAFA 3KEYA 3E0JB 3OYIA 2V6EA 2DT7B 3VSKA 4ANJA 2HZDA 2W4SA 2RQQA 2HVRA 2R7RA 1WJ5A 3OYNA 3OIQA 2MD0A 4RM2A 4JQFA 4XKBA 2QKMB 2ZFUA 3K4LA 3QYFA 4XQFA 5CQGA 4CCLA 4XLFA 4F92B 4AVZA 3VDXA 3OY9A 1EA3A 4P5OA 4ZDLA 3SDBA 4BJTA 3I3LA 4LIUA 2M3AA 4MLOA 5KCMA 2K9MA 4D1QA 4HNUA 2JSPA 2JA2A 1PJRA 2VKHA 4C30A 2F6CA 3M8JA 1X4PA 4E7LA 2WY8Q 1UAAA 2F4IA 2OUMA 3DTEA 3EUAA 4HSRA 3VYTB 4CCMA 4PUSA 4R79A 3K4CA 4II3A 2IGKA 3IP4B 2W7NA 4X0GA 4Y4RA 3A2KA 4PJLA 4YELA 2HPIA 4DJAA 4QPOA 1WJBA 3CZ6A 4AU7A 3HG9A 2LY1A 2Q2EB 1D0ZA 2HU9A 4PSWA 2Q1ZB 4XOPA 2E1MB 3H9JA 3VWBA 2LRDA 3OL4A 3L2VA 1V5FA 3D5RC 4NNJA 3AFHA 3N05A 4PJJA 3OYDA 4PK4A 4E4HA 3OYKA 2E5ZA 1MNEA 4BU2A 2VL8A 3D5LA 4XNFA 4H4KC 5LD2C 3SYTA 2K5CA 2VXDA 3EUKL 4BEHB 3BG6A 4HNTA 3HUGB 2KMUA 4C9YA 2XSJC 2Z16A 1DGWY 2V1NA 2X1CA 3TBIA 1MMNA 3OYCA 1GLNA 4B47A 4ZDPA 1D1CA 2K3PA 3S32A 1WJEA 3PNYA 3PL8A 2V4JC 3ZR8X 3DQVC 1R6RA 2LREA 4XR6A 2VKDA 2WB1A 3DKYA 4XM3A 4PFPA 1T0FC 2KHMA 4BE1A 2OC6A 4YRVA 2L5QA 4KJZA 4BXFA 4ITVA 2L9NA 3OYHA 2CS3A 5HNFA 2VLAA 1BOBA 1YX3A 3HOSA 3UNGC 4OAZA 2VJ5A 1ERDA 3OYJA 2IGMA 5FROA 3BLYA 4BE2A 1LVKA 3QOEA 5FRNA 1T95A 4KITB 2BW3B 3W2VA 4XORA 2BOLA 3PSFA 4E7JA 1Y56A 3K4KA 2A5WA 2X1DA 1V5EA 3OYMA 1K6YA 3HPGA 3LFUA 2WY7Q 3PNVA 3F9KA 3W2AA 4CCJA 2K9LA 1OR7C 2X6WA 4DGWB 3OYGA 2KPMA 1MMGA 1NG6A 1X1AA 3S3OA 3MKZA 2HVQA 3ZGKA 2CV1A 1KONA 3QYBA 2XC7A 3OMYA 3KX2A 4RLFA 4BJ6C 5CKTA 2E1MC 3FHNA 1PYVA 1MMAA 2X85A 2L7KA 3OS1A 1QU3A 4KISA 2W1OA 3HKZA 3NWSA 4ZTFA 2O5RA 2F5VA 4LG3A 4RLQA 2IS6A 2VASA 2QKLB 4Y33A 2VB6A 1WFXA 3G2BA 2KQRA 3H9GA 3DTKA 4II2A 3SEQA 1D1AA 1VZ0A 3CESA 3OOUA 2WAQA 2HPMA 2AQFA 4PSXA 3DPTA 2VQLA 3BCBA 3OR2C 3H35A 2W00A 2CUJA 3ZCOA 5JHFA 5LFAA 3CP8A 3M1CA 3L2RA 3MKWB 3W2WA 3A1YA 4CSWA 2IS4A 2PJRB 2XDVA 1WJDA 2DXIA 4LITA 4XN3A 3RSNA 3DPUA 2R7TA 2RNGA 3PUBA 3DEEA 4XN0A 5FRMA 3W3CA 3VSLA 3CF2A 3HXLA 4OWRB 4XL9A 2IS2A 1DP3A 3LSMA 4CA0A 4CH7A 3RTRA 4E6KG 5KNLA 2R4GA 4BUPA 4F55A 4J01A 2ELJA 3K4NA 3D5SC 2R7WA 4JOMA 4XMYA 2LG4A 3H5NA 4XKVA 3OL3A 1Z7LA 2MABA 2E5NA 5HOOA 3OYLA 3MKYB 2RREA 1BR1A 1WJAA 2NOJB 3BCAA 2IGNA 3TMOA 1S9HA 4HPQA 4ZTJA 1YX5A 4D9JA 4DIQA 4ZJZA 1MMDA 2X51A 4EATA 2IGOA 4F52A 1SFKA 3E1SA 1LDKB 3L2QA 2KP6A 3C2HA 3PFYA 4B43A 2Z2SB 2MYSA 3L2WA 4BACA 1BR2A 2WADA 1X1CA 4IQ4A 2MFZA 4BJ5C 3OWTA 4CCOA 1Z3XA 2L9SA 2ZSIB 2GOMA 3LSHA 2LH9A 3LL7A 4PJMA 2JUGA 3MD2A 2M0MA 4G6TB 4N4NB 2CW7A 3S3NA 3RPUD 1G8XA 2KLOA 3NWTA 4HRIA 2AQEA 4RM3A 4BS9A 1WJFA 3K6GA 3ZQQA 4U7BA 2JVHA 3LMMA 4B44A 2LYCA 4DOZA 4IKFA 2PMZA 2E60A 4QPQA 2UV1A 3H9QA 4CZCA 1YE9A 2M7BA 2A6TA 3BC8A 4GRIA 1SAUA 1DGRM 4CCNA 2WA0A 1BR4A 4ZC3A 2DT6A 2L2OA 4NQWB 4XONA 4HG2A 2CV0A 4ZYAA 2X6YA 1OLTA 1Y6IA 3HC7A 3OYAA 3FDYA 3DWLE 4HEA2 3LSIA 1TT0A 3DLAA 3C2GA 3ZXSA 4CCKA 3K4BA 2LBFA 4XLCA 4E7KA 3HOTA 3RCOA 4NUBA 4RMNA 3A4CA 2DJIA 3DPLC 1QHGA 4J00A 2M4GA 3H5RA 2VQCA 1N77A 2R7QA 4BL0B 2CFOA 4C2TA 5HLTA 4E7HA 3CP2A 2XF5A 2HDWA 2VIXA 4IQJA 2W82A 4KT6A 4Y3OA 3FKJA 3AL0B 2CV2A 2OV7A 4ZDOA 1U0JA 2VQGA 2ZXIA 2DCEA 4FASD 3VYUB 3K70D 5KHDA 4DBQA 3LSGA 4BQOA 2JVGA 4PJNA 1D0YA 3IUOA 4NC7A 3HL2A 2HNHA 3DU5A 1X1BA 3PSIA 3FBIB 4CUGA 3QODA 2LBFB 3S93A 2VPLA 2VJJA 1NG7A 3SEZA 3BG7A 4IZZA 1QHHD 3UR3C 3H5AA 4HSTA 1LKXA 2BVLA 2M7AA 3PJRA 2IS1A 1UG0A 3GBGA 3S3MA 3CJQB 3CJRB 4C2UA 1MW7A 2V9KA 3AL0C 3ZRGA 3H0DA 1W36D 1JI8A 3SZGA 3DTIA 1N75A 4XOTA 1X4OA 1MNDA 4YEJA 2CMPA 4F3QA 4P1WA 2R7SA 2CH0A 3KYLA 1D0XA 3QYEA 2PJRA 3HPHA 1TZLA 2HQAA 2CW8A 1UELB 2X6XA 2XAUA 4XLEA 4FETA 2VJ4A 3TL4X 3EUHC 1X1DA 2MC4A 2WBMA 3CMMA 2R7XA 2Y0SA 4BDYA 3FBNB 1W36C 5HNHA 1IRXA 3U21A 1FMVA 4IX7A 2ZXHA 4XLHA 2IXSA 4B48A 4DBRA 3V42A 5CQEA 1Z21A 2X1EA 5TGTA 1E0EA 3K70C 1D1BA 4BEHA 2LC2A 3PNTA 2LY2A 3OYBA 1N78A 2XF7A 2VXZA 3VYRB 4F91B 2R7UA 2VQHA 3K4MA 2UWMA 4XKCA 1X19A 2KRCA 3DKXA 4E7SA 2VJIA 1Z3YA 2KRHA 1HA8A 4N4OB 3LSKA 3RQ4A 2P0WA 1AA7A 4PFOA 4BQNA 3AKZA 2V26A 1G59A 1DQUA 2BW3A 4E7IA 2FUG2 1LFPA 3OYEA 2UUZA 2M4KA 2KL4A 4AYBA 4OAYA 4F93B 4BDZA 3VYSB 2BVMA 3IAS2 4BQQA 2HVSA 3K10A 1WJCA 2ZSHB 3DU6A 4LIVA 3K4JA 2Z1DA 3MMYB 5HVQC 3I9V2 2GOXB 4E7ZA 1V5GA 2DOAA 2R7OA 4XLAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNT A;  4KT6 A; 
#chains in the Genus database with same CATH topology
 1O3T A;  1IXS B;  1XD7 A;  2WV1 A;  5DEQ A;  3J80 K;  2GAU A;  3ABT A;  4NC8 A;  3L2U A;  1A04 A;  1EH8 A;  5L3D A;  5HDN A;  4G7H F;  4HZF A;  1S5L C;  5CPR B;  2VE9 A;  1YJ9 I;  1YIO A;  4A0Z A;  3ERM A;  1KZH A;  1RET A;  3GME A;  3BZ6 A;  4U87 A;  1X2M A;  1OCP A;  3KEY A;  2E7W A;  3R4K A;  3S17 J;  1PP8 F;  1YTY A;  2DT7 B;  1R4M B;  3VSK A;  2HZD A;  3I53 A;  4ENJ A;  5A2Q Z;  1ZRC A;  2R7R A;  1MGT A;  3OIQ A;  2QKM B;  2ZFU A;  5KAI C;  5DUK A;  3EET A;  1F43 A;  2BY1 A;  3LSP A;  3KP5 A;  1EA3 A;  3A0B C;  1PVE A;  1BIA A;  1MBF A;  1ZGA A;  2CYY A;  1UZC A;  3I3L A;  2K9M A;  3PQK A;  2I5U A;  4D1Q A;  4O5V A;  5C4X J;  5GPA A;  2COB A;  1STZ A;  2JSP A;  5H2F C;  1PJR A;  4C30 A;  1CF7 A;  3GTK J;  3PIP F;  3QWL A;  1ZN2 A;  4XSX F;  1UAA A;  2F4I A;  1RPW A;  1B72 B;  3EUA A;  4M9S A;  4CCM A;  3VYT B;  4AVP A;  2LSO A;  1S7E A;  4PUS A;  3HIF A;  1RC9 A;  2XAG A;  4MTD A;  4WK8 F;  1MZB A;  3VPR A;  4EV0 A;  2EPF A;  4QPO A;  3WGI A;  4KIF A;  4RB1 A;  5L3B A;  4AC0 A;  2J5P A;  2NXN B;  3HG9 A;  2X48 A;  2LY1 A;  4LJZ F;  2Q2E B;  2MD5 A;  1U5T A;  2NS0 A;  2HU9 A;  5F04 A;  4D5C A;  2R92 J;  5IT3 A;  3Q0U A;  2FEZ A;  2FQ4 A;  3H9J A;  4GFB A;  3B73 A;  1ZG3 A;  3GYH X;  3L2V A;  4LD5 A;  2BY2 A;  2QQB A;  5EYR A;  1W7P A;  3OYK A;  1MNE A;  3JRB A;  2L9R A;  3D5L A;  4XNF A;  1XTA A;  4H4K C;  2Y0M A;  2OCE A;  3V8L A;  2K5C A;  1RI7 A;  2VXD A;  2HOS A;  1U2W A;  2QBY A;  2PMU A;  2BXY A;  3BG6 A;  4HAM A;  4K2E A;  4R8H A;  3BR3 A;  2BXZ A;  4M3E A;  4HQE A;  1DDN A;  4ZDP A;  1D1C A;  4KDP A;  5D6E A;  1JHH A;  3PL8 A;  1APL C;  2KKO A;  2V4J C;  4A6E A;  3I5U A;  5KK1 A;  1R6R A;  2DU9 A;  2LRE A;  2VKD A;  2W48 A;  3QPT A;  2L01 A;  1T33 A;  1E3H A;  5EEA A;  2MLK A;  3DKY A;  4XM3 A;  1T6S A;  5LRR A;  4HQM A;  2OC6 A;  4OIN F;  3CDH A;  4CYD A;  4BXF A;  2DW4 A;  4ITV A;  3TED A;  1T08 B;  5HNF A;  1I3Q J;  2VKV A;  1BOB A;  4XRS G;  4MO7 A;  1USS A;  5EZG A;  2F5D A;  2KJB A;  3F8N A;  4R1H A;  1ERD A;  3OYJ A;  2IGM A;  1LVK A;  5FRN A;  2DPD A;  3GUD A;  2BV6 A;  1A5J A;  2P6S A;  3I64 A;  4G7Z F;  1WRJ A;  4A12 A;  1HKT A;  5FD5 A;  3TO6 A;  5TRD A;  1YS7 A;  4XOR A;  1Y56 A;  1DU0 A;  1Z05 A;  2A5W A;  2X1D A;  2HDD A;  1X3U A;  3I59 A;  2NVY J;  3OYM A;  1FYL A;  2OJE D;  4HV5 A;  1FSH A;  1VQ5 I;  5IYB J;  1XDS A;  1O4X A;  5D4R A;  1G4D A;  2EZK A;  4UVC A;  3FM5 A;  2CG4 A;  2X6W A;  3E7L A;  2EV0 A;  3OYG A;  2Y48 A;  2KPM A;  1XGO A;  3MZY A;  4A3G J;  1B1B A;  4CDG A;  1IJW C;  4ZH4 F;  3K1P A;  3CCQ I;  3MKZ A;  1IXC A;  3LQQ A;  4ESF A;  2D1H A;  1SMT A;  1JT0 A;  1ETV A;  1AOY A;  3QYB A;  2HS5 A;  3KIO A;  4DNC A;  2XRL A;  2FQ3 A;  3G4S I;  1T56 A;  3GEZ A;  2ME6 A;  3CQZ J;  3M07 A;  3V8K A;  3T8R A;  3BWG A;  2BEO A;  4Q5S F;  5J40 A;  4BAY A;  1GUU A;  2XPV A;  2R5Y B;  1IGN A;  1YIJ I;  4RGU A;  3OS1 A;  5K1Y A;  1QU3 A;  2HYF A;  3GW2 A;  3CMA I;  1ZH5 A;  5J1Y A;  2DA3 A;  1UCR A;  3LA2 A;  2QKL B;  4WCG A;  5JHU A;  4OMY A;  4IHY A;  2FBI A;  5GAH J;  3Q3S A;  1YQA A;  1D1A A;  1OR7 A;  3CES A;  1SFU A;  4A0X A;  1BI3 A;  4PSX A;  2VBY A;  3BCB A;  2EH3 A;  2LFB A;  3IWZ A;  5C3E J;  3N97 A;  5IT9 Z;  2K02 A;  3CP8 A;  3M1C A;  3L2R A;  5IYD J;  3KP3 A;  2QGU A;  3W2W A;  1R1U A;  1RKW A;  1TWA J;  4BNC A;  4EGY A;  2IS4 A;  1J9I A;  1OCC H;  3TQN A;  2FOW A;  4DYR A;  1SD6 A;  3ISP A;  3ABM H;  3HGY A;  4XN3 A;  4A3D J;  3FXK A;  2RNG A;  3DEE A;  1T0F A;  2LD5 A;  2Y2Z A;  3HXL A;  4XL9 A;  2IS2 A;  1ETW A;  2VBZ A;  3KLN A;  4N9I A;  1BW5 A;  3CD6 I;  3RTR A;  2CQ7 A;  1R58 A;  3GZN B;  1Y1W J;  3K4N A;  2ZO4 A;  3D5S C;  3H0G J;  3H5N A;  3F0C A;  3GWZ A;  5CVJ A;  3FIW A;  1SAN A;  1VTN C;  2VC1 A;  1IXR C;  2ZJ2 A;  3IH3 A;  1XMA A;  2E5N A;  3OYL A;  3S1N J;  4GCV A;  3AG2 H;  1BIB A;  2IGN A;  3BCA A;  1S9H A;  2ZNZ A;  5FO5 A;  3TMO A;  4ZTJ A;  5BOX A;  3NRV A;  5JLX A;  2ELK A;  2O6G E;  4F52 A;  4HW0 A;  4MQV A;  2R7Z J;  2DFH A;  1R7J A;  1L3L A;  2KP6 A;  3EUH A;  1R5H A;  4LB6 B;  5K7Z A;  2H6C A;  5M3F J;  3CCM I;  1DUX C;  4HOB A;  1FIA A;  1QO0 D;  3WG7 H;  1S72 I;  2AS5 F;  2P8T A;  1X1C A;  3KEQ A;  2Z99 A;  1D3Y A;  2QLZ A;  3OWT A;  3LSR A;  5ICG A;  4M6V A;  3O3K A;  2COM A;  1QRY A;  2M8G X;  5K5R A;  1OIS A;  1TNS A;  2LH9 A;  3LSH A;  4ZZD A;  5ICC A;  2LKX A;  1ZR4 A;  3H92 A;  4V2F A;  3IKT A;  4HRI A;  2BYV E;  2VI6 A;  2JPB A;  3K6G A;  1IUY A;  3IRQ A;  4FT8 A;  2L02 A;  3CCV I;  1IN5 A;  2LYC A;  4DOZ A;  1IRF A;  3F21 A;  1TWG J;  3HOY J;  5LHG A;  4WX9 A;  3ZMU A;  1IAW A;  2HOE A;  5J4V A;  3ZMV A;  4GRI A;  1FY7 A;  3DP7 A;  3JRA A;  1MH4 A;  2DT6 A;  4L5J A;  3K0L A;  4HG2 A;  3A02 A;  5FKL A;  4EVI A;  1OLT A;  3HC7 A;  1JTY A;  2FMY A;  1T2K A;  5DCF A;  4X6A J;  5J6X A;  4CCK A;  1W5T A;  3I4M J;  3TO7 A;  3MQ0 A;  4NUB A;  4RMN A;  4CYC B;  2NVQ J;  3P7N A;  2MG4 A;  3GZ5 A;  5LGU A;  3GX4 X;  2OU2 A;  4I09 A;  4ZYD A;  1QZY A;  1U9N A;  1LNW A;  3PQJ A;  1AKH A;  1YW9 A;  3MFK A;  1I1G A;  2YR2 A;  1XDU A;  3FXU A;  3FXM A;  1ZG5 A;  1TQM A;  2VQC A;  2NNN A;  3BR1 A;  3GFI A;  1Y0N A;  2XV4 S;  1H0M A;  5FKM A;  3CMY A;  2HDW A;  3RKX A;  1IV6 A;  4KT6 A;  1I3A A;  2IT0 A;  4A3E J;  4IHS A;  4GGG A;  3WOD F;  4WWC A;  1U0J A;  2ZXI A;  1E2X A;  1FBU A;  3R61 A;  3V7R A;  1TW2 A;  1PUF A;  3VYU B;  3K70 D;  5KHD A;  4DBQ A;  1RUN A;  4PGH A;  2CQK A;  2XB0 X;  2STT A;  1VI0 A;  1XSV A;  2V9V A;  4KMU X;  2FJ1 A;  4PJN A;  1MDM A;  3HL2 A;  2IJL A;  5CVU A;  4KYW A;  2BBY A;  1ZK8 A;  4UNO A;  1X3Z B;  3FBI B;  3GXO A;  3E5U A;  2JA7 J;  2R0Q C;  5AIP A;  4D7M A;  2VJJ A;  3EYI A;  4A69 C;  3UR3 C;  4G94 A;  1FYM A;  5E17 F;  3GBG A;  4PGG A;  2V9P A;  1BN5 A;  3CJQ B;  3E6B A;  2KZG A;  3GTJ J;  1R23 A;  4LK0 F;  1FZP B;  1K4S A;  4KIG A;  4XOT A;  4EGZ A;  4FIS A;  4AM3 A;  3RZO J;  1UMQ A;  3L9F A;  2K4J A;  2EA4 A;  1NTC A;  2R7S A;  1NHA A;  4A2U A;  3LWF A;  3QYE A;  4V2G A;  3WTY C;  3MCZ A;  3HPH A;  5F6F A;  1T98 A;  1TZL A;  2P81 A;  3BQY A;  1XS9 A;  1VQK I;  1R22 A;  1G3S A;  2DT5 A;  1TWC J;  2ZJQ F;  4UB8 C;  3JRH A;  1EV7 A;  1XG1 A;  2HR3 A;  3AG1 H;  2MC4 A;  5GAD J;  1VFC A;  1W36 C;  5HNH A;  1IRX A;  2JTV A;  2O8X A;  3K2A A;  3U2R A;  3U21 A;  2H8R A;  2HOT A;  5H6R A;  4AD9 A;  1O57 A;  3ECO A;  1Z77 A;  5CJ9 A;  5TGT A;  3KET A;  2WAQ N;  2AXT C;  1D1B A;  2PEX A;  5E18 F;  1E3O C;  3QPH A;  3WTU C;  4BEH A;  2LC2 A;  2VKE A;  3PNT A;  5DCM B;  4ETS A;  1LEB A;  1OCO H;  5FJ8 J;  1V55 H;  1BI2 A;  1CF7 B;  1BI1 A;  2R7U A;  1SVL A;  3K4M A;  3WGG A;  2UWM A;  3DKX A;  2KRC A;  3LST A;  5FGM A;  1RKT A;  2VJI A;  1K78 B;  2QCO A;  5LGT A;  1HA8 A;  2PBI A;  2KIM A;  2P0W A;  2FOK A;  3HTS B;  4I01 A;  5BQT A;  3HOX J;  3WTV C;  4OOI A;  4UHT A;  3F8M A;  5CVV A;  2BHZ A;  4C3H J;  1LFP A;  2ADU A;  4I0B A;  3CC4 I;  1VQ4 I;  3VB2 A;  2UUZ A;  2KL4 A;  4AYB A;  4MNU A;  1J2X A;  4JP0 A;  3TW6 A;  2BVM A;  2I10 A;  2M8E A;  2TRT A;  2IAI A;  4U0Y A;  1ZG1 A;  4S0H B;  3K10 A;  2XGE A;  3DU6 A;  4GDF A;  2VON A;  3MMY B;  1ZLJ A;  3AAF A;  1JE8 A;  1EF4 A;  1XCV A;  4Q48 A;  1LEA A;  4L0Z B;  4IRI A;  3W6J B;  9ANT A;  2XAQ A;  1OPC A;  1ZEL A;  3JSP A;  2CWE A;  1FMW A;  3FXL A;  1MJB A;  1IZ1 A;  1SFE A;  4UY8 I;  4XIC A;  2Y30 A;  4B3X A;  2Y9Z A;  4B8X A;  3HKZ N;  4BH9 A;  3OOP A;  5HS8 A;  2JRM A;  3L1P A;  3JRD A;  1GVJ A;  2P7C B;  3OIP A;  3IAM 2;  2OD5 A;  1W7P B;  3HHH A;  1OYW A;  2V7F A;  3V7C A;  2IBD A;  1TQP A;  3OS0 A;  4AIJ A;  1B8I B;  4IHV A;  3RKW A;  2KIS A;  2BZT A;  5E3L A;  1D5V A;  2HQR A;  1J09 A;  1WI9 A;  2GZW A;  2I8D A;  3J7A Y;  2CUZ A;  1RRJ A;  1G3Y A;  3WTS C;  2M2E A;  2W4S A;  1ZAO A;  1TW3 A;  2P5L C;  1KQ0 A;  3W6K B;  1QPI A;  2HVR A;  4DYQ A;  1B8I A;  4EMS A;  2MD0 A;  3HEF A;  3WG9 A;  2E36 A;  3WE2 A;  2QVO A;  2XHK A;  4JX4 A;  5HS9 A;  3JW4 A;  5DDG A;  2Z9O A;  5CQG A;  1K7A A;  1Y0U A;  4BHP A;  2HI3 A;  1JTX A;  2F4M B;  3FXJ A;  5E1W A;  2PMZ N;  5IP9 J;  4P5O A;  4ZDL A;  4RBO A;  4QSH A;  4MGR A;  4CIC A;  2HTJ A;  2M5W A;  2P7V B;  3JRC A;  2ID6 A;  2JA2 A;  1A36 A;  1QBJ A;  2HQ5 A;  2NS8 A;  1S7A A;  3LFK A;  4E7L A;  2WY8 Q;  4ESJ A;  3K7A J;  2EZH A;  2OUM A;  4U7D A;  5IOZ A;  4A3F J;  2DQL A;  2E2H J;  4IJA A;  4FTH A;  3CC7 I;  3M1E A;  2DAO A;  3BP8 A;  3IP4 B;  1P4W A;  2H8W A;  1XSD A;  3LQR A;  3Q0V A;  4M71 A;  4PJL A;  2H27 A;  1WJB A;  2LKS A;  5LEK A;  5F0C A;  3FK6 A;  3JRE A;  1VF9 A;  1ZTR A;  2BY3 A;  1ETY A;  2EFN A;  2M87 A;  2QQ9 A;  2O7O A;  3J81 Z;  2A5Y B;  4YFN F;  2Q1Z B;  2E1M B;  1LDJ A;  2GA1 A;  4RGR A;  2LRD A;  3OL4 A;  1X58 A;  3D5R C;  3AFH A;  2EFO A;  3N05 A;  4PJJ A;  2FF4 A;  3F72 A;  3HM5 A;  3V8J A;  1VQ9 I;  2EK5 A;  1FTZ A;  1GVD A;  2AO9 A;  1TWH J;  1SD7 A;  3SYT A;  5HOD A;  1IDY A;  3EUK L;  3WTZ A;  4HNT A;  1G3T A;  5E1Z B;  2DFI A;  3RDI A;  3HUG B;  2KMU A;  5JVT A;  4A3M J;  2XSJ C;  1ZLK A;  2X1C A;  5FKN A;  3TBI A;  1XMK A;  3TP3 A;  3TP0 A;  1T39 A;  2M9H A;  3T1B A;  1GLN A;  2B7E A;  2K3F A;  2ZC2 A;  2K3P A;  3S32 A;  2QM3 A;  1I39 A;  5E8G A;  2X4H A;  5LHH A;  5D6F A;  4XR6 A;  3ZMT A;  1TC3 C;  3H3U A;  4AUX A;  4HDU A;  3I0T A;  2G0E A;  2WC2 A;  2NNY A;  1HBX G;  1EKE A;  1T0F C;  2KHM A;  3M3Y J;  2V6C A;  4GXO A;  4UV9 A;  3CCJ I;  3F23 A;  5EZH A;  1NK2 P;  2L9N A;  2CS3 A;  3I4P A;  3TDU C;  2LVS A;  1YX3 A;  2W85 A;  2RC4 A;  3SXY A;  3HOS A;  3NQO A;  3C2B A;  3KFW X;  5HDG A;  2Y31 A;  2VJ5 A;  3PUF A;  1FT9 A;  4OIP F;  1FOW A;  3IRR A;  3ESW B;  2XAF A;  5FRO A;  2JSC A;  4HV6 A;  3E3V A;  4YII A;  4KIT B;  2BW3 B;  5D4S A;  1UG2 A;  2VC0 A;  3AG3 H;  2BOL A;  4Q4Z F;  4DW6 A;  2F4O B;  4U0V A;  1V5E A;  3HPG A;  3LFU A;  2QZ8 A;  4KIB A;  1PP7 U;  1BW6 A;  1UST A;  2V1D A;  3PNV A;  3F9K A;  3FMR A;  2CGP A;  2K9L A;  1OR7 C;  3GTO J;  5ERI A;  5C44 J;  2HWV A;  1SD4 A;  2MLG A;  1X1A A;  2NAZ A;  4G6D A;  2TDX A;  1GDT A;  4BBS J;  3DBL B;  5LBQ A;  2IP2 A;  1LFU P;  1CQT A;  2CV1 A;  5LRS A;  1QNT A;  3VFZ A;  2L4A A;  1GHC A;  4A3I J;  4ENK A;  4RS8 A;  3KX2 A;  1YW7 A;  4RLF A;  2OCC H;  2HYJ A;  3BPV A;  2DA5 A;  2H09 A;  3ML6 A;  4I2O A;  4MEX F;  5F08 A;  1Z0X A;  2ESH A;  3PIO F;  2A6E F;  4KIS A;  1A6I A;  4Y33 A;  2VB6 A;  3GLX A;  5FD6 A;  5LGN A;  2KQR A;  1G3W A;  1B9N A;  1IRZ A;  4II2 A;  2ZME A;  1IO2 A;  2NVT J;  2FE3 A;  3EYY A;  2A6H F;  5TIS C;  3CF5 F;  1JJ6 C;  5DS9 A;  1ZR2 A;  2VQL A;  3OR2 C;  5M5W J;  3H35 A;  5JHF A;  5LFA A;  2VOD A;  1XPX A;  2DMN A;  1BBY A;  1ON2 A;  5EG0 B;  4NBQ A;  3RKQ A;  4LLG F;  2XDV A;  4BQA A;  4L9T A;  2O8K A;  1Z6T A;  3FHZ A;  1VQP I;  3F6O A;  5HS7 A;  2JUC A;  2KJC A;  3PUB A;  1K83 J;  3J7Y J;  1GV2 A;  3TOA A;  1FP2 A;  4LB5 A;  3A0H C;  1W0T A;  5FRM A;  3VSL A;  3CF2 A;  4OWR B;  3GO5 A;  4IPA A;  4LLL A;  4P9F A;  2V79 A;  2CQN A;  2YX4 A;  4CA0 A;  3GZ6 A;  3N4M A;  3BRO A;  1MJ9 A;  4OIR F;  5DUI A;  4E6K G;  2OQR A;  2DO7 A;  4J01 A;  2V1U A;  1WI3 A;  2J5O A;  5EEH A;  4BY1 J;  1JT6 A;  1Q1H A;  2LG4 A;  2OAZ A;  3OL3 A;  2MAB A;  3MKY B;  1SAX A;  2GIZ A;  1ACI A;  2G9W A;  4B4C A;  1BR1 A;  3JTH A;  4Z6Y A;  2NOJ B;  4YFK F;  1LDD A;  3U9G A;  1YX5 A;  4ZJZ A;  4RGX A;  5J4Y A;  1KU9 A;  2HTS A;  2A68 F;  3L00 A;  4YG2 F;  5KVR A;  3BZC A;  3KE2 A;  3QP6 A;  3WTX C;  4CGZ A;  3FXO A;  2VOO A;  2EIM H;  3RPU A;  3PFY A;  3L2W A;  1LE8 A;  4NQW A;  1Y39 A;  3QPS A;  2MFZ A;  1FTT A;  2DFE A;  2YU3 A;  2ZSI B;  2L9S A;  2GOM A;  3CCU I;  1FBQ A;  5D5U B;  4RAZ A;  5EG0 A;  3LL7 A;  4M9Z A;  3SFI A;  4V19 K;  2JUG A;  3WE3 A;  3MZH A;  2E71 A;  2F5F A;  2KLO A;  3NWT A;  2ZB9 A;  5D5V B;  4RM3 A;  1H9T A;  4BS9 A;  3BG9 A;  3CUO A;  1WJF A;  1GV5 A;  5LEJ A;  3CME I;  3IWF A;  1ZRE A;  4B44 A;  2M1B A;  2E60 A;  4QPQ A;  2LNB A;  2QSG X;  3H9Q A;  2R7D A;  3ZQF A;  4G9Y A;  2Z33 A;  4UUV A;  1DU6 A;  1MIJ A;  2IW5 A;  2XKP A;  4RDU A;  3CLO A;  5FLM J;  2OA4 A;  1OQY A;  2WA0 A;  4KN4 X;  1BR4 A;  3G6E I;  2CV0 A;  1Y6I A;  3EQL F;  2LY9 A;  5J8C A;  2OBP A;  3CTA A;  1TL8 A;  5DV5 A;  4NHJ A;  4HX8 A;  4HF2 A;  2LBF A;  3DF8 A;  3ECH A;  4XLC A;  2LKP A;  2EIJ H;  1TP4 A;  3RCO A;  4EJU A;  3J81 K;  3BOQ A;  4UUS A;  1R49 A;  3GTL J;  2IA0 A;  5K7F A;  3LA3 A;  3I56 I;  3S1R J;  3KP4 A;  4RA2 A;  1XGM A;  3FZV A;  3MEX A;  2F48 A;  2R7Q A;  4BL0 B;  5JI6 A;  2K86 A;  2XRN A;  4C2T A;  3QPL A;  3CP2 A;  1U5T B;  4Z2Y A;  2VIX A;  4IQJ A;  1IRG A;  5K7H A;  3RYP A;  3FKJ A;  3AL0 B;  1VND A;  4NDL A;  1HOM A;  2OV7 A;  4ZDO A;  5LHI A;  1YFH A;  4BHC A;  1PUE E;  2KIQ A;  2PI0 A;  2CFX A;  2A3S A;  1O7F A;  4EM1 A;  4L18 B;  2VN2 A;  2ZME C;  2OZU A;  4BQO A;  1BC7 C;  2QEN A;  3FWE A;  1WSU A;  2Y69 H;  3IUO A;  3K1N A;  2UZK A;  1I6X A;  2HNH A;  3DU5 A;  4XRM A;  1J7K A;  3NAU A;  1R5G A;  4CUG A;  3M8E A;  3QOD A;  3G1L A;  3S93 A;  2VPL A;  4KUM A;  5KAF C;  2R7F A;  1NG7 A;  3K2Z A;  3F6V A;  3JRF A;  2EIN H;  2QWW A;  3SHF A;  2NVU B;  4HST A;  1LKX A;  2BVL A;  2M7A A;  1VQ7 I;  2IRF G;  3PJR A;  2WTE A;  1IF1 A;  3CO7 C;  1UG0 A;  5BNG A;  1G2H A;  2F5C A;  4C2U A;  2LMD A;  4M72 A;  3BT9 A;  2XSD C;  4BXX J;  3ZRG A;  1W36 D;  4O6J A;  4L9N A;  4MTE A;  4KMF A;  2CQX A;  4LFU A;  1J59 A;  3WU0 A;  2JN6 A;  1HSJ A;  2EFQ A;  1YG2 A;  2QQA A;  2CH0 A;  2JWT A;  4QTR A;  2CU7 A;  2GXG A;  3A01 B;  2CW8 A;  2ZXW H;  2X6X A;  4AIK A;  2CRG A;  4FET A;  2VJ4 A;  3TL4 X;  1RIO H;  2QBY B;  2W57 A;  3CMM A;  1BJA A;  1O3R A;  1FMV A;  4OMZ A;  2ZXH A;  5M5X J;  2CUE A;  2ZME B;  5CVI A;  2IXS A;  2GIV A;  4GYG A;  3RKY A;  5GTH C;  6PAX A;  1Z21 A;  2X1E A;  1E0E A;  3T0Y A;  2MH2 A;  4EM2 A;  1U3E M;  4FCY A;  3BR5 A;  3ZMZ A;  2LY2 A;  2Q2E A;  1YLF A;  2OZ6 A;  3V4G A;  3WU1 B;  2EV6 A;  2HKO A;  3VYR B;  2VXZ A;  1P2F A;  3SDG A;  1EJ9 A;  4IOA F;  5EDN A;  2DMT A;  3I4N J;  1Z3Y A;  3BQZ A;  3SQN A;  1NK3 P;  5DD8 A;  2K85 A;  1JXS A;  4FX0 A;  1AA7 A;  5JFR A;  3FM3 A;  4PFO A;  3KZY A;  1W4M A;  2K9N A;  4CZZ A;  3KP2 A;  3COA C;  2E7X A;  4QIW N;  3F8B A;  4OAY A;  1FPQ A;  2XKO A;  4F93 B;  3I55 I;  4QLC U;  4BQQ A;  2HVS A;  1UHW A;  4GYI A;  1WJC A;  2WB1 N;  3GFL A;  3CUQ C;  1FYK A;  1DP7 P;  2BY0 A;  2QSH X;  2YUS A;  1WHU A;  2GOX B;  2MGQ A;  3BJO A;  2K27 A;  3CUQ A;  2MC3 A;  4JX6 A;  1TQI A;  2DOA A;  2P5V A;  2B63 J;  4XLA A;  2H6B A;  2Y0S N;  1FNN A;  1YI2 I;  2VOP A;  5EJC A;  4EJO A;  3Q5F A;  4MEY F;  2DQR A;  4UXN A;  3DXJ F;  4XKW A;  1L0O C;  3CCY A;  3BR2 A;  5H6Q A;  2DMQ A;  4G8X A;  1E3P A;  1IN6 A;  3HHG A;  2XF6 A;  3OR1 C;  5M3M J;  2OF7 A;  3L09 A;  4BGD A;  1Y8R B;  3DFG A;  1ZRF A;  3ABL H;  1SVM A;  1WZ2 A;  2LOO A;  4L5E A;  2EIL H;  1U9O A;  2DA4 A;  1P9Q C;  3S8P A;  1A6Q A;  2WAF A;  3CLQ A;  2F5E A;  3OYI A;  2BGC A;  3OV8 A;  4ANJ A;  2GLO A;  2IPQ X;  2KIU A;  3GTQ J;  5DM6 F;  1J0R A;  3OYN A;  2ESN A;  3G1M A;  4XKB A;  4XQF A;  3K4L A;  5IPA A;  5E3M A;  2JK3 A;  3NAR A;  4LG0 A;  2OQG A;  3R6S A;  3R60 A;  3HB9 A;  4AVZ A;  1ZYR F;  2OPT A;  3Q9S A;  4HLX A;  3VDX A;  5BS6 A;  5J8F A;  4LIU A;  2M3A A;  4MLO A;  5KCM A;  2ECB A;  4RAF A;  5D8K B;  1FOX A;  1O7L A;  2DA6 A;  2VKH A;  5ILU A;  1D5Y A;  4W97 A;  3M8J A;  2M0C A;  3HRT A;  4P55 A;  3H36 A;  4KA4 A;  3VOD A;  1P7J A;  2QSF X;  1JKO C;  1ZKG A;  3MAJ A;  1FLI A;  3F3X A;  3K4C A;  1K78 A;  4JBA A;  4Y4R A;  5EGO B;  4X0G A;  5IYC J;  3A2K A;  3PO2 J;  3KZI C;  4LLN A;  2YS9 A;  2E35 A;  4KIC A;  5IY5 H;  4MQ9 F;  1Z1D A;  2HQN A;  4AU7 A;  3HJE A;  5IP6 A;  3QQA A;  1D0Z A;  1WKM A;  4DQ2 A;  3WU2 C;  4PSW A;  2HXI A;  1HKS A;  4WXH A;  3F8F A;  2P6T A;  3PM1 A;  5FLX K;  2JJ7 A;  1OYI A;  3CCE I;  1TBX A;  4U88 A;  4NNJ A;  2FBH A;  3HRM A;  4PK4 A;  4E4H A;  2E5Z A;  2RV8 A;  2AHQ A;  2VL8 A;  5ICE A;  3GFJ A;  2ETH A;  5FLV A;  4CYC A;  1GT0 C;  2ZFW A;  4BBR J;  2HGC A;  4C9Y A;  2Z16 A;  1DGW Y;  1MMN A;  2OTL I;  2MA3 A;  3OYC A;  3QRF F;  1LJ9 A;  4B47 A;  1GXQ A;  4P96 A;  1WJE A;  3JAM Z;  4ESB A;  1OFC X;  2NVX J;  3DQV C;  2KIF A;  3BTC A;  3NEU A;  1ITY A;  1WCM J;  4PFP A;  1HDP A;  4YRV A;  5B1B H;  1R9T J;  3HBL A;  3OYH A;  4FHT A;  5DM7 F;  5GP9 A;  2DTR A;  3UNG C;  1SEU A;  2K9Q A;  1KU3 A;  1IG7 A;  3ZQC A;  2STW A;  4IXA A;  1W1W E;  4M3B A;  3KCC A;  1R00 A;  4L9J A;  3QOP A;  1T95 A;  2Y75 A;  3GVA A;  2GQQ A;  5J1R A;  2XB5 A;  3DBR B;  3JSO A;  5JLW A;  3ZMD A;  5DD4 A;  2FRH A;  2B0L A;  1PUF B;  2M30 A;  3BG5 A;  2LDU A;  3MWM A;  1B59 A;  1MMG A;  5HLH A;  2M34 A;  3OSG A;  5B1A H;  2ZBK A;  3BDD A;  2EJR A;  2O3F A;  1WPK A;  2E19 A;  2HVQ A;  4I0A A;  4D0P A;  1FIP A;  2GWR A;  2BE5 F;  4IHW A;  2LTP A;  3OMY A;  1A35 A;  2MBF A;  3G71 I;  4HX7 A;  1HST A;  1OCR H;  4BJ6 C;  1Z9C A;  1WH7 A;  5CKT A;  5IP7 J;  2EFW A;  3FHN A;  1PYV A;  3F8C A;  2GM4 A;  2X85 A;  2L7F P;  2W1O A;  1FC3 A;  2DMP A;  4L5I A;  2O5R A;  2HYG D;  2P4W A;  4X1E A;  1MJA A;  4L9V A;  1WFX A;  2HKX A;  3G2B A;  2ZXJ A;  3C3W A;  3R0J A;  1VZ0 A;  3OOU A;  2WAQ A;  1IC8 A;  3KLO A;  4FQG A;  2HPM A;  2EQR A;  3DPT A;  3KP6 A;  3HOW J;  2KT0 A;  1F4K A;  2CSO A;  2W00 A;  4O3M A;  1R4N B;  5J47 A;  2CO5 A;  3JRI A;  3A1Y A;  1MH3 A;  3P9C A;  4H0E A;  4F7Z A;  2QEX I;  1QZE A;  5HDK A;  4KN7 X;  5E3O A;  4G7O F;  3E97 A;  3DPU A;  1JJ8 C;  2E2I J;  2R7T A;  2DA7 A;  4LGW A;  1ETK A;  1W5C C;  3K9T A;  1TTY A;  2E34 A;  3DLL F;  1DP3 A;  1JKP C;  1WWX A;  3LSM A;  2G7U A;  4AYB N;  2QYO A;  4CH7 A;  2NS7 A;  3IKV A;  1S29 A;  3PO3 J;  1ULY A;  1KGS A;  1Z67 A;  1B6A A;  3CCL I;  2HXO A;  1H89 C;  4UV8 A;  2ACJ A;  4F55 A;  2DA2 A;  4HBL A;  1P7I A;  2DK8 A;  4JOM A;  1FP1 D;  4EJV A;  2PQ8 A;  2H94 A;  2L7M P;  3IL2 A;  1S3J A;  3FIS A;  4HPQ A;  4D9J A;  4DIQ A;  3H3Z A;  1MMD A;  2X51 A;  2Z3Y A;  1I27 A;  4N0B A;  1VQL I;  1SFK A;  1LDK B;  1IV8 A;  3L2Q A;  2DOE A;  4B43 A;  5D5W B;  3LAJ A;  4BAC A;  1AKH B;  4HDV A;  2X0L A;  4HX4 A;  2WAD A;  3GCM A;  3G73 A;  3TW7 A;  2D1V A;  4BJ5 C;  3HRU A;  5A2Q K;  4CCO A;  3LAP A;  3JTG A;  3MN2 A;  4C3I J;  3FK7 A;  1VQN I;  2H1K A;  1VQM I;  2M0M A;  4N4N B;  5F1R A;  3WHC A;  3S2H J;  4MHG A;  2EFP A;  3SJM A;  2AQE A;  4ZYE A;  4UUS B;  2R5Z B;  1T38 A;  4U7B A;  2JVH A;  2QQ8 A;  4WXC A;  3VOE A;  1BA5 A;  1IN7 A;  1S8N A;  2PMZ A;  2O61 A;  2UV1 A;  3HSF A;  2ZJR F;  3HOU J;  1YYV A;  2LK2 A;  1YE9 A;  2M7B A;  3BC8 A;  1DGR M;  3RJP A;  3RPQ A;  1SD5 A;  3E5X A;  3MVP A;  4ZC3 A;  2L2O A;  4MIM A;  4XON A;  5B66 C;  4XRS A;  3GLL A;  2EWN A;  5JVG F;  1VQ8 I;  3OYA A;  2YU9 J;  2ID3 A;  3DWL E;  3FDY A;  4HEA 2;  1LPQ A;  1DPR A;  2DA1 A;  3LSI A;  3T5X A;  3K4B A;  2F2E A;  3KZZ A;  4PZJ A;  4ASN A;  3DBH B;  4A0Y A;  4E7K A;  4KNY A;  3QP5 A;  3V7S A;  2UXX A;  3AG4 H;  2X6O A;  4QWQ A;  1R36 A;  5K5Q A;  3A4C A;  5D8L B;  2EA2 A;  4M3D A;  3FXQ A;  1HXD A;  1POG A;  3CC2 I;  5DTD A;  1N77 A;  2LP0 A;  1XN7 A;  1J5Y A;  1BM9 A;  4M73 A;  2XF5 A;  1D8J A;  2W82 A;  2WV0 A;  4Y3O A;  3JRG A;  1JUS A;  4HNV A;  5L3G A;  1UB9 A;  3G3Z A;  2ICW G;  2VPR A;  4EQQ A;  3JAM K;  1D0Y A;  4LMY A;  2E1C A;  2O9L A;  1P4A A;  3ZN1 A;  2KRF A;  1SFO J;  2YX7 A;  1HLV A;  1LFB A;  2XAH A;  1X1B A;  1F5T A;  2K4B A;  1XC5 A;  3R0A A;  4HLY A;  2E2J J;  3SEZ A;  2K7L A;  4XID A;  3BG7 A;  4XK4 A;  3H5A A;  3TGN A;  4LG0 B;  5H20 A;  3WHB A;  2IS1 A;  4EJW A;  4A3C J;  4B1R A;  3S3M A;  2VE8 A;  4EM0 B;  2O03 A;  3FMS A;  3HSE A;  4LOC A;  1MW7 A;  1FJL A;  4IHX A;  2V9K A;  1V54 H;  3AL0 C;  3H0D A;  5HLG A;  3ABK H;  1JI8 A;  3DTI A;  3M9A A;  3TO9 A;  4XBF A;  1X4O A;  5FKK A;  3L7W A;  4YEJ A;  4I02 A;  2RKH A;  2FX0 A;  2CMP A;  3O6B B;  4F3Q A;  3DEW A;  2L7Z A;  2M45 A;  3KYL A;  2QUF A;  5FFX A;  1HCR A;  1IN8 A;  2L9V A;  2PJR A;  2RNJ A;  2FSW A;  1MKM A;  4RGS A;  3RI4 A;  1R1V A;  5E8I A;  2XAU A;  4XLE A;  3EUH C;  1LUJ B;  3O2P E;  2Q8K A;  4CHU A;  4EJT A;  2WBM A;  4BDY A;  1U6G A;  2CQQ A;  2R5Y A;  4IX7 A;  4BYY A;  4RB2 C;  2XGD A;  4XLH A;  4B48 A;  5B3S H;  4DBR A;  5CQE A;  3K70 C;  4NB5 A;  1ZHF A;  2XGC A;  1W7P D;  1WQ2 A;  1SFX A;  1R1T A;  4NC6 A;  2XF7 A;  2W84 A;  4F91 B;  4UVA A;  5ED4 A;  4DZJ A;  2VQH A;  2NYX A;  1X19 A;  1RNL A;  2W25 A;  2XPW A;  1U5T C;  2A61 A;  2DI3 A;  3K69 A;  3LSK A;  4JK1 X;  3RQ4 A;  3MZ8 A;  1Q1V A;  2JMW A;  3BJA A;  4I98 B;  3CCS I;  1HC8 A;  3ZQH A;  3AKZ A;  2V26 A;  3CDL A;  1ETO A;  3BPX A;  3S2D J;  3BTI A;  4L0Y B;  1RR7 A;  2FUG 2;  3ZP5 A;  3S1Q J;  3OYE A;  2L4M A;  2M4K A;  3B02 A;  3I71 A;  1H9G A;  3IAS 2;  3VYS B;  5GPC A;  3J7Z I;  3UKG A;  5FFZ A;  2ZSH B;  3HRS A;  3K4J A;  1DPU A;  1J75 A;  3ERE D;  3RIR A;  1P6R A;  4RAG A;  3TDZ C;  3J80 Z;  3EPZ A;  3IV5 A;  1VQ6 I;  1BJZ A;  2E1N A;  2DMU A;  3HOV J;  4I7H A;  2KDO A;  2DBB A;  3ZPL A;  5D5X B;  4HYE A;  2DOD A;  4W1U A;  2WAE A;  3KYD B;  3QU3 A;  3QAH A;  2KZV A;  2R7V A;  3GF2 A;  2IEK A;  5DYM A;  3OYF A;  2ISY A;  3OS2 A;  1I6H J;  2HZT A;  4BE0 A;  4S05 A;  1ZGJ A;  3WGH A;  4D5F A;  2UXN A;  2XVC A;  3ONQ A;  1H88 C;  1KU7 A;  3HUG A;  1ON1 A;  3E0J B;  4OIO F;  1TNT A;  1XMX A;  2FA5 A;  2V6E A;  3M8F A;  3A03 A;  1BI0 A;  1S7O A;  4CXF A;  2FD5 A;  4M74 A;  3U1K A;  3H1C A;  1H8A C;  1R71 A;  2RQQ A;  4Y52 J;  1JUP A;  2VBX A;  3BTL A;  4XSZ F;  1WJ5 A;  3WTW C;  4XLN F;  4RM2 A;  5EGO A;  4YIF A;  4JQF A;  4A3J J;  3QYF A;  1FWZ A;  4UUT A;  5CVR A;  2G7H A;  2XAS A;  3C18 A;  1JHF A;  4CCL A;  4XLF A;  1QA6 A;  1REP C;  3FXR A;  4Y15 A;  4F92 B;  2BHY A;  3B6A A;  3OY9 A;  4IHT A;  3EDP A;  3SDB A;  5AIQ A;  1KQ9 A;  1QZZ A;  3KEO A;  4BJT A;  1Z7U A;  5CLS A;  1RR8 C;  1LVA A;  4HNU A;  3E6D A;  1B4A A;  4C2M J;  2DDB A;  2F6C A;  5BPI A;  2LF7 A;  3ZQ7 A;  1X4P A;  3DTE A;  4HSR A;  4FX4 A;  1IN4 A;  1KA8 A;  2JRT A;  4R79 A;  1S6L A;  4II3 A;  2IGK A;  2W7N A;  4ENN A;  2DLL A;  3GFM A;  1NH3 A;  4YEL A;  2HPI A;  4DJA A;  3E6M A;  3S2W A;  1ZQ3 P;  2Q0O A;  3CZ6 A;  4IRG A;  1WGX A;  2HOA A;  4A93 J;  4IF4 A;  4Y7N J;  4XOP A;  2EIK H;  5F64 A;  3SZP A;  1RES A;  3VWB A;  3C1D A;  1PDN C;  1V5F A;  2DYS H;  3E5Q A;  1KU2 A;  3FKI J;  3OYD A;  4PDK A;  4BU2 A;  1QPM A;  3IH4 A;  3TKY A;  5LD2 C;  1YS6 A;  1IW7 F;  5E1X A;  3HZJ A;  5DCM A;  1C0W A;  4HF1 A;  3M4O J;  4BEH B;  1X1P A;  1F9N A;  2DTZ A;  2V1N A;  3ABU A;  3FF5 A;  2GA2 A;  3HTU A;  4IVN A;  3KPH A;  4M9X A;  4WXD A;  2VT3 A;  1YOV B;  1YW8 A;  2K9S A;  4IO9 F;  3PNY A;  2ELH A;  3B6C A;  4P9U A;  1FSE A;  2DPU A;  2JT1 A;  2ME0 A;  3ZR8 X;  2ZKZ A;  1LB2 A;  2MH9 A;  1ORK A;  3HOZ J;  1HF0 A;  2A07 F;  2WB1 A;  3JR9 A;  1M1E B;  1E17 A;  4M6X A;  3E6C C;  3S1M J;  4J19 A;  4BE1 A;  1HQC A;  1F1Z A;  3Q0W A;  1BC8 C;  2L5Q A;  4I99 C;  4E70 A;  4KJZ A;  4PCQ A;  2XRO A;  2NOG A;  2VLA A;  3I54 A;  2YSR A;  4XRF A;  5BPD A;  2CJJ A;  1I50 J;  4OAZ A;  2EB7 A;  5TJJ A;  1Z91 A;  1MDM B;  1JGS A;  4DZP A;  4XLP F;  1T8I A;  2OTJ I;  3BLY A;  4A5N A;  2L3D A;  4BE2 A;  3QOE A;  2ZJP F;  2JZY A;  3CUQ B;  2IA1 A;  3ZQG A;  3W2V A;  3KP7 A;  3M7G A;  3ZN0 A;  3U1D A;  3PSF A;  4E7J A;  3K4K A;  5L3C A;  3Q9V A;  1SVO A;  3S14 J;  2DN0 A;  2FU4 A;  3JCU C;  2XAJ A;  4BXU A;  2PG4 A;  1K6Y A;  4Q47 A;  2C6Y A;  1YRN B;  2WY7 Q;  3W2A A;  4CCJ A;  4DGW B;  3H3V K;  1NG6 A;  2ZCW A;  1OKR A;  2DYR H;  1K4T A;  4RAY A;  3S3O A;  2HEO A;  3CJN A;  3BG3 A;  3ZGK A;  2CUF A;  3IH2 A;  1KON A;  1ZRD A;  1ODD A;  2PLY A;  1TT5 B;  1AU7 A;  5F27 A;  3DEU A;  2XC7 A;  4HF0 A;  2DFF A;  4ON0 A;  2JA5 J;  5ICF A;  5EF6 A;  2E1M C;  3REO A;  1FX7 A;  2GBY A;  1UFM A;  2TCT A;  1MMA A;  2R93 J;  2LR8 A;  2L7K A;  5J1U A;  1IDZ A;  1W5S A;  1G6N A;  3X2Q H;  3HKZ A;  1KYZ A;  3NWS A;  4ZTF A;  4RLQ A;  2F5V A;  4LG3 A;  2IS6 A;  2VAS A;  5CYV A;  2XIG A;  3A01 A;  1JKQ C;  1HW2 A;  4LK1 F;  4AID A;  1MSE C;  2CW0 F;  2RAE A;  3H9G A;  3DTK A;  3SEQ A;  1RUO A;  1AWC A;  1BL0 A;  5J3L A;  1YJN I;  2AQF A;  1OJL A;  2FNA A;  1ONV A;  1UHS A;  2JQ7 A;  3LSJ A;  3DCF A;  2O0Y A;  2B9S A;  1ZGW A;  2CUJ A;  3ZCO A;  1XX5 A;  3MKW B;  4I6Z A;  1FBS A;  1V4R A;  2YPR A;  2EV5 A;  4M6Y A;  4CSW A;  2PJR B;  2H1L A;  1WJD A;  2XPU A;  4JYK A;  2DXI A;  4LIT A;  1BOA A;  2VT2 A;  3RSN A;  2L0K A;  4DYC A;  3O8G A;  3RZD J;  5FLX Z;  4EEF G;  2VBW A;  4A6D A;  4XN0 A;  3W3C A;  1R5I D;  3IHU A;  1V3F A;  2A69 F;  2Z5U A;  4UVB A;  3WTT C;  2V1X A;  4PJ0 C;  4IL6 C;  4IEJ A;  3OIO A;  2D2W A;  5KNL A;  4N9H A;  2QA4 I;  2R4G A;  3ZQL A;  4BUP A;  1MNM C;  2GXA A;  1KQ8 A;  1XGS A;  1ENH A;  2QF7 A;  5GAG J;  4RB0 A;  1X3W B;  2ELJ A;  5ILV A;  4I76 A;  2R7W A;  4HA8 A;  4XMY A;  5FB2 A;  3BR6 A;  4XKV A;  1MBE A;  2RVC A;  1Z7L A;  5HOO A;  5F0F A;  2P5K A;  2RRE A;  5C4J J;  2DOF A;  1WJA A;  3SFZ A;  4BKX A;  1HDD C;  3GTM J;  2RN7 A;  4EAT A;  1FEX A;  1XB4 A;  2IGO A;  2Y9Y A;  4BY7 J;  3ZQI A;  3DV8 A;  3ZOB A;  3E1S A;  3P9K A;  4KFC A;  4OIQ F;  3GTG J;  3I59 B;  3C2H A;  4WF2 A;  2Z2S B;  2MYS A;  1XGN A;  2N8G A;  2JA8 J;  5HLI A;  5F1J A;  1JGG A;  3K1M A;  2DK5 A;  1BR2 A;  1FOY A;  4UB6 C;  1Y1V J;  1I5Z A;  4IQ4 A;  1Z6R A;  5LLQ A;  3GTP J;  1Z3X A;  3CO6 C;  1TWF J;  1HW5 A;  2A05 A;  2NRA C;  1UHM A;  1WH5 A;  2KFD A;  2E1O A;  5FKO A;  1LQ1 A;  4YIR X;  4PJM A;  3O8H A;  1WVR A;  1Y8Q B;  1U8B A;  3L2C A;  1X2N A;  1MD0 A;  3MD2 A;  4G6T B;  3FMQ A;  2CW7 A;  2HFH A;  3I58 A;  1QGP A;  3S3N A;  3RPU D;  1UJ8 A;  1G8X A;  3BY6 A;  4A3K J;  2EZL A;  2KDZ A;  2IA2 A;  3ZQQ A;  1GXP A;  3LMM A;  2ZNY A;  1ETQ A;  1SMY F;  4JX5 A;  4U0W A;  5L3E A;  4IKF A;  4Y13 A;  4IOC F;  1JUM A;  2EZI A;  3IC7 A;  4CZC A;  2WWY A;  2A6T A;  1O3Q A;  4BHB A;  3PFI A;  1SAU A;  4ZZL A;  4CCN A;  1YIT I;  3ELK A;  3P5J A;  1A31 A;  4NQW B;  1OCT C;  4FE7 A;  1ETX A;  4MFD A;  1JKR C;  4S04 A;  4ZYA A;  2X6Y A;  4G6Q A;  2ISZ A;  1MSF C;  3ZMS A;  1TT0 A;  5B5E C;  3W6V A;  3DLA A;  3C2G A;  3ZXS A;  1AHD P;  2PMH A;  3CDI A;  3HOT A;  2PJP A;  2MW8 A;  3RYR A;  1YO5 C;  3T8T A;  2DJI A;  3DPL C;  1QHG A;  4KT5 C;  1HKQ A;  1MBK A;  1N25 A;  4J00 A;  1CGP A;  2M4G A;  3BZK A;  3H5R A;  1VQO I;  4YFX F;  4Y17 A;  4ENM A;  1K6O A;  1OYY A;  3C7J A;  5GAE J;  2CFO A;  2VUM J;  2FXA A;  5HLT A;  4E7H A;  1K61 A;  3LNQ A;  2HDC A;  4ABZ A;  2CV2 A;  2K40 A;  2VQG A;  3TOB A;  1OMI A;  2DCE A;  1YJW I;  3J7A O;  1P4X A;  5AON A;  4FAS D;  4ZYH A;  1YRN A;  3RQI A;  3LSG A;  2W24 A;  1MBG A;  4A3L J;  2JVG A;  1U78 A;  1FOK A;  3HGG A;  4A3B J;  4NC7 A;  2LLK A;  3BJ6 A;  4M3F A;  1KYW A;  5GTI C;  1OCZ H;  1U8R A;  3DKW A;  1I1S A;  3PSI A;  3ASO H;  3D0S A;  1MMS A;  2RGV A;  3FX3 A;  5BMZ A;  2AXL A;  3G1O A;  2LBF B;  1RZ4 A;  3F22 A;  4IZZ A;  1QHH D;  1XCB A;  4MFE A;  2ECC A;  2PX9 A;  5IT9 K;  5M5Y J;  3LA7 A;  1HW1 A;  3BR0 A;  3CJR B;  3ASN H;  2FNP A;  2R3S A;  3MKL A;  3SZG A;  1N75 A;  5K5O A;  5L3F A;  3S15 J;  3S16 J;  2LF8 A;  3OSF A;  3KYC B;  1MBH A;  1W0U A;  1MND A;  3SZT A;  3ULQ B;  1SC7 A;  2R5Z A;  2L54 A;  4B09 A;  1MBJ A;  4P1W A;  5E20 A;  1D0X A;  3VEP A;  1TLH B;  2GXB A;  2HQA A;  1ZAR A;  1IUF A;  2PN6 A;  1UEL B;  1EH6 A;  2DJN A;  2DDA A;  3ROU A;  1X1D A;  3BTJ A;  1YHQ I;  1K79 A;  2R7X A;  1F36 A;  2Y0S A;  3FBN B;  5E3N A;  1QVU A;  1LE8 B;  3CCR I;  3LOC A;  2XUB A;  3V42 A;  1D8K A;  1QQI A;  2RDP A;  3CJT B;  5EEG A;  1O3S A;  2JA6 J;  2FML A;  2D5V A;  2RQP A;  4A5M A;  2MSY A;  1EH7 A;  3OYB A;  1N78 A;  2FBK A;  4GO1 A;  2PFB A;  2X9D A;  5F0H A;  1P92 A;  4TV7 A;  4XKC A;  4E7S A;  4D7N A;  2JPC A;  1B9M A;  3P9I A;  2KRH A;  4B3A A;  4AWX B;  4N4O B;  3HSR A;  2IVM A;  1B72 A;  4AIH A;  4BQN A;  1G59 A;  1DQU A;  4CO8 A;  4ZYG A;  5IOY A;  4FE4 A;  2BW3 A;  3D1N I;  4M3G A;  4E7I A;  4C3J J;  5ILS A;  3QU6 A;  3HYI A;  5JR3 A;  4BDZ A;  1QVT A;  3HDD A;  4OU0 A;  1XSX A;  4LIV A;  4RB3 C;  2D45 A;  2Z1D A;  5HVQ C;  2XGX A;  3I9V 2;  5E79 C;  4E7Z A;  2EBI A;  1V5G A;  4G12 A;  4IRH A;  2R7O A; 
#chains in the Genus database with same CATH homology
 3EPZ A;  1ZEL A;  1FMW A;  2KDO A;  4NC8 A;  3L2U A;  4XKW A;  2WAE A;  4B3X A;  2KZV A;  5CPR B;  2R7V A;  2XF6 A;  3OYF A;  3OIP A;  3IAM 2;  3OR1 C;  3OS2 A;  2V7F A;  3OS0 A;  4BE0 A;  4BGD A;  4U87 A;  3ONQ A;  2LOO A;  1J09 A;  1P9Q C;  2I8D A;  3S8P A;  2CUZ A;  3J7A Y;  2WAF A;  3KEY A;  3E0J B;  3OYI A;  2V6E A;  2DT7 B;  3VSK A;  4ANJ A;  2HZD A;  2W4S A;  2RQQ A;  2HVR A;  2R7R A;  1WJ5 A;  3OYN A;  3OIQ A;  2MD0 A;  4RM2 A;  4JQF A;  4XKB A;  2QKM B;  2ZFU A;  3K4L A;  3QYF A;  4XQF A;  5CQG A;  4CCL A;  4XLF A;  4F92 B;  4AVZ A;  3VDX A;  3OY9 A;  1EA3 A;  4P5O A;  4ZDL A;  3SDB A;  4BJT A;  3I3L A;  4LIU A;  2M3A A;  4MLO A;  5KCM A;  2K9M A;  4D1Q A;  4HNU A;  2JSP A;  2JA2 A;  1PJR A;  2VKH A;  4C30 A;  2F6C A;  3M8J A;  1X4P A;  4E7L A;  2WY8 Q;  1UAA A;  2F4I A;  2OUM A;  3DTE A;  3EUA A;  4HSR A;  3VYT B;  4CCM A;  4PUS A;  4R79 A;  3K4C A;  4II3 A;  2IGK A;  3IP4 B;  2W7N A;  4X0G A;  4Y4R A;  3A2K A;  4PJL A;  4YEL A;  2HPI A;  4DJA A;  4QPO A;  1WJB A;  3CZ6 A;  4AU7 A;  3HG9 A;  2LY1 A;  2Q2E B;  1D0Z A;  2HU9 A;  4PSW A;  2Q1Z B;  4XOP A;  2E1M B;  3H9J A;  3VWB A;  2LRD A;  3OL4 A;  3L2V A;  1V5F A;  3D5R C;  4NNJ A;  3AFH A;  3N05 A;  4PJJ A;  3OYD A;  4PK4 A;  4E4H A;  3OYK A;  2E5Z A;  1MNE A;  4BU2 A;  2VL8 A;  3D5L A;  4XNF A;  4H4K C;  5LD2 C;  3SYT A;  2K5C A;  2VXD A;  3EUK L;  4BEH B;  3BG6 A;  4HNT A;  3HUG B;  2KMU A;  4C9Y A;  2XSJ C;  2Z16 A;  1DGW Y;  2V1N A;  2X1C A;  3TBI A;  1MMN A;  3OYC A;  1GLN A;  4B47 A;  4ZDP A;  1D1C A;  2K3P A;  3S32 A;  1WJE A;  3PNY A;  3PL8 A;  2V4J C;  3ZR8 X;  3DQV C;  1R6R A;  2LRE A;  4XR6 A;  2VKD A;  2WB1 A;  3DKY A;  4XM3 A;  4PFP A;  1T0F C;  2KHM A;  4BE1 A;  2OC6 A;  4YRV A;  2L5Q A;  4KJZ A;  4BXF A;  4ITV A;  2L9N A;  3OYH A;  2CS3 A;  5HNF A;  2VLA A;  1BOB A;  1YX3 A;  3HOS A;  3UNG C;  4OAZ A;  2VJ5 A;  1ERD A;  3OYJ A;  2IGM A;  5FRO A;  3BLY A;  4BE2 A;  1LVK A;  3QOE A;  5FRN A;  1T95 A;  4KIT B;  2BW3 B;  3W2V A;  4XOR A;  2BOL A;  3PSF A;  4E7J A;  1Y56 A;  3K4K A;  2A5W A;  2X1D A;  1V5E A;  3OYM A;  1K6Y A;  3HPG A;  3LFU A;  2WY7 Q;  3PNV A;  3F9K A;  3W2A A;  4CCJ A;  2K9L A;  1OR7 C;  2X6W A;  4DGW B;  3OYG A;  2KPM A;  1MMG A;  1NG6 A;  1X1A A;  3S3O A;  3MKZ A;  2HVQ A;  3ZGK A;  2CV1 A;  1KON A;  3QYB A;  2XC7 A;  3OMY A;  3KX2 A;  4RLF A;  4BJ6 C;  5CKT A;  2E1M C;  3FHN A;  1PYV A;  1MMA A;  2X85 A;  2L7K A;  3OS1 A;  1QU3 A;  4KIS A;  2W1O A;  3HKZ A;  3NWS A;  4ZTF A;  2O5R A;  2F5V A;  4LG3 A;  4RLQ A;  2IS6 A;  2VAS A;  2QKL B;  4Y33 A;  2VB6 A;  1WFX A;  3G2B A;  2KQR A;  3H9G A;  3DTK A;  4II2 A;  3SEQ A;  1D1A A;  1VZ0 A;  3CES A;  3OOU A;  2WAQ A;  2HPM A;  2AQF A;  4PSX A;  3DPT A;  2VQL A;  3BCB A;  3OR2 C;  3H35 A;  2W00 A;  2CUJ A;  3ZCO A;  5JHF A;  5LFA A;  3CP8 A;  3M1C A;  3L2R A;  3MKW B;  3W2W A;  3A1Y A;  4CSW A;  2IS4 A;  2PJR B;  2XDV A;  1WJD A;  2DXI A;  4LIT A;  4XN3 A;  3RSN A;  3DPU A;  2R7T A;  2RNG A;  3PUB A;  3DEE A;  4XN0 A;  5FRM A;  3W3C A;  3VSL A;  3CF2 A;  3HXL A;  4OWR B;  4XL9 A;  2IS2 A;  1DP3 A;  3LSM A;  4CA0 A;  4CH7 A;  3RTR A;  4E6K G;  5KNL A;  2R4G A;  4BUP A;  4F55 A;  4J01 A;  2ELJ A;  3K4N A;  3D5S C;  2R7W A;  4JOM A;  4XMY A;  2LG4 A;  3H5N A;  4XKV A;  3OL3 A;  1Z7L A;  2MAB A;  2E5N A;  5HOO A;  3OYL A;  3MKY B;  2RRE A;  1BR1 A;  1WJA A;  2NOJ B;  3BCA A;  2IGN A;  3TMO A;  1S9H A;  4HPQ A;  4ZTJ A;  1YX5 A;  4D9J A;  4DIQ A;  4ZJZ A;  1MMD A;  2X51 A;  4EAT A;  2IGO A;  4F52 A;  1SFK A;  3E1S A;  1LDK B;  3L2Q A;  2KP6 A;  3C2H A;  3PFY A;  4B43 A;  2Z2S B;  2MYS A;  3L2W A;  4BAC A;  1BR2 A;  2WAD A;  1X1C A;  4IQ4 A;  2MFZ A;  4BJ5 C;  3OWT A;  4CCO A;  1Z3X A;  2L9S A;  2ZSI B;  2GOM A;  3LSH A;  2LH9 A;  3LL7 A;  4PJM A;  2JUG A;  3MD2 A;  2M0M A;  4G6T B;  4N4N B;  2CW7 A;  3S3N A;  3RPU D;  1G8X A;  2KLO A;  3NWT A;  4HRI A;  2AQE A;  4RM3 A;  4BS9 A;  1WJF A;  3K6G A;  3ZQQ A;  4U7B A;  2JVH A;  3LMM A;  4B44 A;  2LYC A;  4DOZ A;  4IKF A;  2PMZ A;  2E60 A;  4QPQ A;  2UV1 A;  3H9Q A;  4CZC A;  1YE9 A;  2M7B A;  2A6T A;  3BC8 A;  4GRI A;  1SAU A;  1DGR M;  4CCN A;  2WA0 A;  1BR4 A;  4ZC3 A;  2DT6 A;  2L2O A;  4NQW B;  4XON A;  4HG2 A;  2CV0 A;  4ZYA A;  2X6Y A;  1OLT A;  1Y6I A;  3HC7 A;  3OYA A;  3FDY A;  3DWL E;  4HEA 2;  3LSI A;  1TT0 A;  3DLA A;  3C2G A;  3ZXS A;  4CCK A;  3K4B A;  2LBF A;  4XLC A;  4E7K A;  3HOT A;  3RCO A;  4NUB A;  4RMN A;  3A4C A;  2DJI A;  3DPL C;  1QHG A;  4J00 A;  2M4G A;  3H5R A;  2VQC A;  1N77 A;  2R7Q A;  4BL0 B;  2CFO A;  4C2T A;  5HLT A;  4E7H A;  3CP2 A;  2XF5 A;  2HDW A;  2VIX A;  4IQJ A;  2W82 A;  4KT6 A;  4Y3O A;  3FKJ A;  3AL0 B;  2CV2 A;  2OV7 A;  4ZDO A;  1U0J A;  2VQG A;  2ZXI A;  2DCE A;  4FAS D;  3VYU B;  3K70 D;  5KHD A;  4DBQ A;  3LSG A;  4BQO A;  2JVG A;  4PJN A;  1D0Y A;  3IUO A;  4NC7 A;  3HL2 A;  2HNH A;  3DU5 A;  1X1B A;  3PSI A;  3FBI B;  4CUG A;  3QOD A;  2LBF B;  3S93 A;  2VPL A;  2VJJ A;  1NG7 A;  3SEZ A;  3BG7 A;  4IZZ A;  1QHH D;  3UR3 C;  3H5A A;  4HST A;  1LKX A;  2BVL A;  2M7A A;  3PJR A;  2IS1 A;  1UG0 A;  3GBG A;  3S3M A;  3CJQ B;  3CJR B;  4C2U A;  1MW7 A;  2V9K A;  3AL0 C;  3ZRG A;  3H0D A;  1W36 D;  1JI8 A;  3SZG A;  3DTI A;  1N75 A;  4XOT A;  1X4O A;  1MND A;  4YEJ A;  2CMP A;  4F3Q A;  4P1W A;  2R7S A;  2CH0 A;  3KYL A;  1D0X A;  3QYE A;  2PJR A;  3HPH A;  1TZL A;  2HQA A;  2CW8 A;  1UEL B;  2X6X A;  2XAU A;  4XLE A;  4FET A;  2VJ4 A;  3TL4 X;  3EUH C;  1X1D A;  2MC4 A;  2WBM A;  3CMM A;  2R7X A;  2Y0S A;  4BDY A;  3FBN B;  1W36 C;  5HNH A;  1IRX A;  3U21 A;  1FMV A;  4IX7 A;  2ZXH A;  4XLH A;  2IXS A;  4B48 A;  4DBR A;  3V42 A;  5CQE A;  1Z21 A;  2X1E A;  5TGT A;  1E0E A;  3K70 C;  1D1B A;  4BEH A;  2LC2 A;  3PNT A;  2LY2 A;  3OYB A;  1N78 A;  2XF7 A;  2VXZ A;  3VYR B;  4F91 B;  2R7U A;  2VQH A;  3K4M A;  2UWM A;  4XKC A;  1X19 A;  2KRC A;  3DKX A;  4E7S A;  2VJI A;  1Z3Y A;  2KRH A;  1HA8 A;  4N4O B;  3LSK A;  3RQ4 A;  2P0W A;  1AA7 A;  4PFO A;  4BQN A;  3AKZ A;  2V26 A;  1G59 A;  1DQU A;  2BW3 A;  4E7I A;  2FUG 2;  1LFP A;  3OYE A;  2UUZ A;  2M4K A;  2KL4 A;  4AYB A;  4OAY A;  4F93 B;  4BDZ A;  3VYS B;  2BVM A;  3IAS 2;  4BQQ A;  2HVS A;  3K10 A;  1WJC A;  2ZSH B;  3DU6 A;  4LIV A;  3K4J A;  2Z1D A;  3MMY B;  5HVQ C;  3I9V 2;  2GOX B;  4E7Z A;  1V5G A;  2DOA A;  2R7O A;  4XLA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...