4KT6A

High-resolution crystal structure streptococcus pyogenes beta-nad+ glycohydrolase in complex with its endogenous inhibitor ifs reveals a water-rich interface
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
GNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structure of Streptococcus pyogenes beta-NAD(+) glycohydrolase in complex with its endogenous inhibitor IFS reveals a highly water-rich interface
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Nicotine adenine dinucleotide glycohydrolase
total genus 87
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1660 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4kt6A01
3PNTA 4KT6A
chains in the Genus database with same CATH superfamily
2KISA 2EFQA 4UVBA 3CO7C 5E1WA 3KCCA 3VDXA 3L9FA 2PMUA 3H35A 2DQRA 1SFKA 1U5TB 3F6VA 2ZFUA 3OYEA 2H27A 5IY5H 3TP3A 1ZH5A 4G94A 4JX4A 1RC9A 1XDSA 4QSHA 2L5QA 2PBIA 2ACJA 1MBGA 1WCMJ 5JHFA 3CCYA 4XN3A 2GXBA 2LFBA 1KQ8A 1GXPA 2CUFA 3E5QA 1S7AA 3V8KA 1A04A 1FX7A 1K6YA 2WA0A 2LF8A 4E7IA 1KONA 3A2KA 4QPOA 1SVLA 4BS9A 2PJRA 1D0YA 2XRLA 1ETOA 3DPTA 2QBYB 4BQAA 5JLWA 3OSFA 1B4AA 2JUCA 4ZH4F 3WTWC 1MDMA 1S7EA 1BI1A 2HYGD 4DYQA 2DW4A 4BQOA 2DO7A 2YUSA 3F6OA 4Y17A 2D1HA 3KP4A 5GPAA 1ZELA 4J19A 4MO7A 4CCJA 4XIDA 5E79C 3I4MJ 5KAIC 4RB1A 2O9LA 1K83J 2HXOA 1RETA 2E1NA 4KMUX 1S29A 2OA4A 1YITI 5TRDA 1K7AA 1SAXA 2KKOA 4RLQA 2BXZA 1R58A 1TW2A 3VFZA 2OQGA 2L7FP 2K5CA 2L01A 3RYPA 2XGDA 4KT6A 3WU1B 2R7SA 2LLKA 2JJ7A 4BL0B 4XONA 2R7OA 4PJMA 2HEOA 4ZYDA 1S8NA 3BG5A 4MEXF 5BPIA 2LY9A 2OBPA 3CUQB 1FSEA 2EB7A 4ON0A 4CICA 2QLZA 1Q1VA 2EQRA 2L3DA 3J7AO 3MZHA 1XGOA 1SEUA 1ZREA 3CDIA 2K9MA 4GYGA 1OYIA 4E7JA 1HF0A 2JA7J 1QZZA 3K4CA 3K7AJ 1YOVB 1WJDA 3GLLA 1YJWI 4EATA 4MFDA 3SEZA 2YU9J 5F6FA 4AIKA 2OCCH 2W7NA 5F0FA 4Y52J 2X6YA 1A6QA 5KHDA 2B63J 1W5CC 1KYWA 3RPQA 3CMAI 1ZG1A 4HAMA 1TQMA 3TL4X 3RKYA 2H1LA 4BAYA 2O7OA 3QPTA 3B6CA 5FKKA 2VODA 3AL0B 3TO9A 1LEBA 5J47A 3ROUA 3BT9A 1QBJA 5GAEJ 2IGOA 4HNTA 4PCQA 3WHBA 3BPVA 2CW0F 5FFXA 4V19K 1WQ2A 2W25A 5CVIA 4XKCA 4ENNA 1WI3A 5FLXK 3QP5A 5BOXA 2EINH 4JOMA 2H8RA 3S3NA 4HBLA 3ABMH 5EGOB 3TQNA 2EK5A 2F48A 3IAM2 3MMYB 4D0PA 2ECBA 3KE2A 2WB1N 2YSRA 1ZR4A 4HA8A 3GTQJ 2P5KA 2L9VA 1L0OC 2W48A 4XOPA 4ZYHA 2O6GE 3M3YJ 4XQFA 3MN2A 2LVSA 2HR3A 1OMIA 5D6FA 2VQHA 3JW4A 2HGCA 4EQQA 1TQIA 4A69C 3GF2A 5EG0A 3CMYA 4IQ4A 3H3ZA 2DA2A 3H3UA 1YE9A 1MNMC 2EPFA 4C2UA 2HVQA 1SFEA 3FIWA 1B59A 2Q2EA 1JGGA 4PK4A 2F5DA 5IYDJ 3K4KA 4A5NA 4HNVA 5EEHA 4NC8A 1I3QJ 3M8FA 4HDUA 2RVCA 1VF9A 4YIFA 2DA1A 3GZ6A 1MGTA 2Y0MA 1IRZA 2QBYA 1ON2A 1QQIA 2BW3A 2E60A 4IPAA 4RA2A 4FTHA 1ETXA 4DZPA 2FNPA 2G9WA 2HI3A 3OSGA 4C9YA 1RESA 1W36C 2HTJA 4PFPA 1UG0A 1Z1DA 4E4HA 2DMTA 2VKVA 3BR5A 2A69F 4XNFA 3GX4X 4GYIA 3DKYA 3VYTB 3RSNA 1QVTA 2YS9A 1O7LA 1D5YA 5J40A 1IW7F 1ZK8A 2GBYA 3CCVI 4DNCA 2DI3A 4ZC3A 2DFEA 1Z0XA 3QOPA 3OYDA 1DU6A 5LRRA 2WY7Q 4M71A 1T95A 4XKBA 4M9XA 1FBSA 4MLOA 1UAAA 2FQ4A 2PMHA 5HLIA 3H9QA 4A3CJ 3NWTA 1JKQC 1LDJA 1X1DA 1R5HA 4UUVA 2XAHA 3OMYA 1YJNI 3FBNB 1HCRA 2RAEA 4L0ZB 1EKEA 3CQZJ 1BR4A 3BCAA 1IN7A 1JTXA 3SDBA 4N4OB 3CF2A 1JTYA 3AG1H 4OU0A 2V6EA 2WAEA 3LSTA 2DDAA 5DM7F 3HEFA 4YEJA 1LEAA 3TDZC 2ICWG 4ZZLA 3E6DA 1QGPA 2Q0OA 3O2PE 4RBOA 3ZMUA 4IHWA 5E3MA 3F22A 2ELHA 2XGXA 4XR6A 3WU2C 4LITA 3F3XA 1IUFA 2W1OA 2STWA 2E2HJ 4FHTA 4WK8F 2XC7A 3PUFA 4BJ5C 5D8LB 4L5IA 2CUJA 4LIVA 1U9NA 3F8MA 1FP1D 3C18A 3HRSA 3WGHA 3D5LA 2LY1A 4ENJA 1QPMA 2X48A 3VSKA 2STTA 3PIOF 3FM3A 2CQXA 4A3DJ 3ML6A 4U0YA 2BVLA 2UXXA 4WWCA 4IOCF 2ZSHB 5FKOA 4CZCA 4I09A 1TNSA 4ZDLA 5ILSA 2R0QC 2HFHA 4LOCA 4YIRX 4CGZA 2Q8KA 4CUGA 2BZTA 5CQGA 2Z9OA 2XAFA 4BHPA 5DM6F 2V7FA 3CCUI 1OCZH 4QLCU 2KFDA 2PQ8A 4R1HA 3ABUA 3BY6A 4F52A 3ZN1A 2L9SA 4NBQA 1ZKGA 2K9LA 4RM2A 1LNWA 2W57A 3IKTA 3K70C 4M6VA 4XRFA 3SFIA 1EV7A 4XLEA 1OQYA 2X51A 5KNLA 1LVKA 2CV0A 3A02A 4DIQA 4NHJA 4PJNA 1VQ6I 2Y31A 1X2NA 3ABTA 3IH2A 1G3SA 1BR2A 1PP7U 2JVHA 2PX9A 4C3JJ 2A3SA 5CQEA 1SMYF 5K7FA 1SD5A 4G6DA 3ABLH 2WY8Q 3B02A 3KZIC 1W0UA 2DQLA 2EFPA 1ZLJA 3WHCA 2R7XA 3F21A 4M6YA 5LEJA 3EQLF 4IX7A 5CVRA 5IYBJ 3IRQA 2L9RA 4E7HA 3O8HA 2P81A 1SFXA 1SANA 2YPRA 3W3CA 1QU3A 2HKXA 4IOAF 1M1EB 4Y3OA 3WG9A 1WZ2A 1XMKA 5DCMB 3SQNA 1GV5A 2KDZA 5LD2C 3CCEI 1P6RA 1R36A 5GTIC 5M3MJ 3W2AA 3VYSB 2KJBA 4AIDA 3CJTB 1VTNC 4W1UA 5ILUA 3BOQA 3EDPA 1XGMA 1HXDA 5B3SH 5IT9Z 5BQTA 3ZQ7A 1YTYA 2ID6A 4A3MJ 3RPUD 3K1PA 2OU2A 3BCBA 4XLPF 4XLFA 3E7LA 1WRJA 1T0FC 2FOWA 4YFXF 2K40A 1POGA 1BC8C 1LFPA 1SD4A 2Q2EB 1G3YA 3LA2A 5ICEA 3IH3A 1X1CA 5JHUA 1UHMA 4V2FA 1S5LC 2WTEA 1FT9A 2KMUA 2VUMJ 5EG0B 1IN6A 5J1YA 3HOVJ 3SZTA 2EILH 3K70D 3TP0A 4XKWA 3EPZA 1TW3A 3S1QJ 1MNEA 4G12A 2ZJPF 3KZYA 3I5UA 3QPLA 5E17F 4FX4A 4CCNA 1XSVA 5LFAA 1FWZA 2VXDA 3SEQA 3WG7H 2DA3A 5F1RA 2P6SA 1ZTRA 1G59A 1U2WA 3JRFA 2HVSA 5J8FA 3E97A 2DMUA 2XSDC 1SVOA 1P7IA 1RZ4A 1FYKA 2Y48A 1T98A 2V4JC 2QA4I 2HPIA 2XROA 3MFKA 3KYDB 1XD7A 4AYBA 2XRNA 5D6EA 1FBUA 3JRBA 1L3LA 1OCCH 3BR2A 4KN7X 3HGGA 5HDKA 3M9AA 3E0JB 3ZQFA 2G7UA 5L3DA 3WGGA 2TCTA 2IS6A 3ABKH 1ETYA 1CQTA 3TMOA 3J80K 3ZGKA 3CO6C 3DP7A 1Y0NA 4MIMA 2YX4A 4LMYA 4O3MA 4IHVA 4A3BJ 2CJJA 3KEYA 2R7ZJ 2M45A 2D2WA 4D9JA 1R7JA 4HF0A 1XSDA 3NRVA 1T39A 4Y15A 2VL8A 2HOEA 1FIAA 2WAFA 4PJJA 1PYVA 3WGIA 1BJAA 1YQAA 2L7ZA 1XCBA 1DPUA 1Z3XA 1LPQA 2GLOA 3ZMSA 4N9IA 4BDYA 4U88A 1WGXA 3JRDA 1DP7P 1E3HA 2CUZA 3L00A 5FO5A 3P9CA 3HDDA 3HJEA 2TRTA 2K9QA 4BXUA 4W97A 1BOBA 2F4OB 4OINF 2QENA 2QYOA 1OYWA 2KT0A 4HF2A 3T8TA 9ANTA 4ABZA 1K4TA 5F27A 1WH7A 2EZLA 2QVOA 1GVDA 3HGYA 1U78A 3ZQCA 4CCMA 2BVMA 1BI3A 4I0AA 4JQFA 3VOEA 2MLGA 2FJ1A 2QUFA 4CYCB 3G3ZA 2XGEA 3BR0A 2DPDA 2HVRA 1QO0D 5DS9A 1P4AA 2HQRA 1Z77A 3OYFA 2R5ZA 3BC8A 4LLNA 3GTJJ 2HOTA 5ICFA 3EUAA 1U5TC 4S05A 2P8TA 2AO9A 2COBA 2B7EA 3T0YA 2OZUA 1YW9A 3A0BC 2CU7A 1XTAA 2R5YB 2BHZA 5LEKA 2ELJA 2V1XA 1MDMB 2DJNA 1YS7A 3PNYA 4S04A 1S3JA 4X1EA 4Z6YA 3I0TA 1ZR2A 2QCOA 3OYHA 2NNYA 1GDTA 4BJTA 1HSTA 1A35A 4A5MA 1F4KA 4BY1J 3VPRA 4ZYAA 2DLLA 3HOYJ 2ELKA 5DUKA 2KIFA 4UV8A 4PJLA 4AIHA 1U8BA 1XN7A 4IEJA 1B9NA 3TBIA 3DQVC 1JKOC 2VQGA 4JX5A 3WTSC 5F1JA 2Z1DA 3S2DJ 3LAPA 4AUXA 2F5VA 1MBEA 3CUQA 3AAFA 5E20A 2NS7A 3LOCA 4XMYA 4N0BA 1HSJA 1JI8A 1WWXA 2FE3A 1MJBA 3AG2H 3KYLA 2XAQA 1TL8A 3H9GA 3WODF 2EFWA 1N77A 1J9IA 4ESFA 4XSZF 1GVJA 4LB5A 5HNFA 1DUXC 5HLHA 1VQLI 3WTTC 5L3BA 1BN5A 3MCZA 3FBIB 2Z5UA 2GAUA 3JSPA 1PUEE 2IA2A 4PSXA 3U21A 4B8XA 1J0RA 2HXIA 3K4JA 3MAJA 1TWFJ 3L2WA 2E7XA 2FF4A 4AC0A 3I53A 5FD5A 3V8JA 2ZFWA 2ETHA 5F0CA 3L7WA 3JRGA 2DMPA 5EEAA 1KQ9A 2W82A 3S14J 4E70A 4AVZA 1I6HJ 4OIRF 4DBQA 2JUGA 2EV0A 4LK1F 1FJLA 1WJCA 1DPRA 5KK1A 2QZ8A 5FLVA 2ZMEA 4EMSA 1IGNA 4XRSA 5DYMA 2DODA 2ZNZA 5EDNA 2PJRB 1R1UA 3V4GA 3FXRA 1LFUP 1FIPA 3CUQC 1DP3A 2UWMA 2DA7A 4CA0A 1PVEA 3H92A 4C2TA 3LFKA 2HDDA 1OFCX 3BTLA 1FNNA 2DA4A 4CO8A 1K61A 5ERIA 5C44J 1ZQ3P 4BNCA 3H3VK 1FOXA 1MH4A 1T6SA 3K1NA 2BOLA 4KN4X 1G6NA 4IXAA 1TP4A 3RJPA 2R7VA 4UHTA 4QTRA 4ZTJA 2XV4S 2DAOA 1CGPA 1QPIA 1SD6A 1YO5C 2OJED 4A93J 4LLLA 2JTVA 4UVCA 2VJ5A 1Z7LA 5IOZA 2E1OA 2OV7A 3BROA 2O61A 1MJ9A 2BXYA 1MIJA 1LKXA 4UV9A 5H2FC 4FT8A 2LMDA 2CFOA 3FK6A 4H4KC 2XASA 4CCOA 2G7HA 1KQ0A 3BG7A 2EV6A 3W6VA 2BY1A 4GRIA 1S6LA 1YW8A 3OS1A 2MD0A 1XDUA 3PFYA 2M7BA 5J8CA 4B09A 2BE5F 3QQAA 3RKQA 5CPRB 2RREA 1R00A 5M3FJ 2P5VA 4BBRJ 4IRHA 4GCVA 1KGSA 4UXNA 1IG7A 4K2EA 1ZLKA 1LJ9A 3KYCB 2GOMA 5J1UA 3BG6A 4FETA 2HTSA 3CMEI 5LHIA 1VQ7I 2CRGA 2XPWA 2B9SA 2DFFA 2HQ5A 2WB1A 3GMEA 4IVNA 1IUYA 3JRHA 2N8GA 1TWHJ 2V1UA 3RCOA 4AIJA 1OCOH 1FTTA 1IV8A 5D4SA 3MQ0A 2NRAC 2KZVA 4HDVA 2CW7A 4HSRA 2H94A 2M1BA 4A3JJ 1MSFC 1YG2A 2R7TA 2A6EF 2CH0A 3FXOA 4B48A 3RYRA 1I1GA 4MTEA 2KPMA 3VYRB 2DMNA 2A68F 2Y75A 1R5ID 2ZO4A 2KDOA 2ZC2A 3HSRA 1UCRA 4I7HA 4EGYA 2DMQA 4HSTA 2ZMEB 3BQZA 3V7RA 2XB5A 1MJAA 3KZZA 3MVPA 2X6OA 3M1EA 3BJOA 2L0KA 3NARA 3NWSA 1J7KA 4UUSB 1BIBA 2EIMH 3IH4A 5HS8A 3DEUA 1N75A 4CDGA 1HKQA 3S3OA 5EEGA 2R5ZB 2LTPA 3G71I 2VQLA 2IP2A 1N78A 2QSGX 5H20A 3JCUC 3HB9A 5FROA 5L3EA 2EWNA 2A61A 5DUIA 3Q9SA 1V55H 4EGZA 2M9HA 2DOEA 5IP9J 5K7ZA 2BW3B 1R71A 2IA0A 1JGSA 3IC7A 2M30A 4E7KA 5IT9K 3IAS2 1RUNA 2OZ6A 2DFHA 3CESA 3S16J 3I4PA 1V5GA 1X3UA 1MSEC 1BW6A 6PAXA 3OYLA 2FQ3A 3E3VA 2E5ZA 3HTUA 3DXJF 1PUFB 4DOZA 3QP6A 2XAGA 1JUPA 1GUUA 2LR8A 1IDYA 2Y9YA 2F5CA 3HRMA 5HNHA 3GTKJ 4QWQA 2EA4A 4ASNA 1SVMA 3BDDA 3LSRA 4CZZA 2H6BA 2CMPA 2V1DA 1D1CA 5CKTA 1B72A 1XS9A 5TGTA 1Y1VJ 1D0XA 2QGUA 2QKMB 4Y4RA 2HQAA 3C1DA 1ZHFA 5IOYA 2K02A 1V5FA 4XK4A 2IRFG 3HYIA 1ZG5A 1AKHA 2XAJA 2JVGA 3L09A 1LE8B 4LG0A 1OR7C 2K27A 2XF6A 4MHGA 4AYBN 4HEA2 2LKSA 3DEWA 2IGNA 3HG9A 1VQ5I 4KYWA 1JJ6C 1IAWA 1B6AA 1FYLA 1ZRDA 5DD4A 2JSCA 1JJ8C 3CDHA 3EYIA 1FOYA 3S8PA 3F8NA 2BY3A 2J5OA 3R6SA 1WI9A 2DU9A 3QPSA 1EJ9A 1ACIA 4RS8A 3GFLA 1J5YA 4KITB 2E1CA 1YYVA 4IHYA 3H0DA 2DA5A 3HPHA 4JX6A 3HSEA 4I01A 5HLGA 5JR3A 3FMRA 2QEXI 2FSWA 3MKYB 3H5RA 1F9NA 3CCSI 3S93A 3WTXC 1I50J 4P5OA 3LQQA 4IRIA 5F04A 2Y0SA 1HQCA 1GHCA 3FF5A 2VJIA 4UVAA 2QF7A 2IVMA 2DK5A 2YX7A 1X4PA 1ZGJA 2JA5J 3PNTA 3KLOA 3WU0A 1VZ0A 1R5GA 2D45A 3ELKA 4XM3A 5KAFC 4I76A 5CYVA 2EJRA 1RIOH 3D5SC 1HDDC 1JKPC 5KVRA 3F8BA 2BYVE 3IRRA 1W36D 3PSFA 2KIMA 4HX7A 1FSHA 4OIPF 3VWBA 2TDXA 3JTHA 3WTYC 2F4MB 3HOXJ 5BPDA 1H89C 1S7OA 5IT3A 1AU7A 1YLFA 4BY7J 1K78B 4OMYA 2PI0A 4FE7A 3ZXSA 1YJ9I 5J1RA 2FBHA 2L02A 1FBQA 1VQPI 4UNOA 3SJMA 1JE8A 1FTZA 1OCRH 3OV8A 3BZKA 2KIUA 1NTCA 3AKZA 4KMFA 1IRFA 1O57A 2OUMA 5C4JJ 2LF7A 1IXSB 2Q1ZB 1OCPA 5JVTA 2R92J 3GBGA 3ZPLA 2IAIA 2HDWA 3G1LA 2FRHA 1E0EA 3BG3A 3BJ6A 4L0YB 1ZN2A 4B43A 3C2HA 3OYIA 3NAUA 4ZYEA 5GPCA 3GFIA 1OCTC 2K3FA 1H9TA 3GO5A 4JBAA 1VNDA 1A5JA 4BU2A 4Z2YA 2DDBA 4XICA 2E5NA 1ETQA 1LDKB 2F4IA 3DTKA 5FKLA 2D5VA 3OS0A 4HV5A 4P1WA 5ICGA 1IZ1A 3O8GA 3KIOA 4EV0A 2OC6A 1SAUA 3DTEA 2E1MC 4B4CA 1YX5A 3I4NJ 5CVVA 4HG2A 1MMNA 3A1YA 1MH3A 3GTLJ 2MABA 1NG6A 2QWWA 3WTVC 4EM2A 2XF5A 2OQRA 5J4VA 3U1DA 1J2XA 3FISA 2A05A 1ZRCA 5J3LA 2CO5A 1WKMA 1T0FA 3E5UA 5BNGA 4YFNF 2MG4A 2WC2A 3ZP5A 1D1BA 2CWEA 3VB2A 1GLNA 5HDNA 1IDZA 3M8JA 3PSIA 4EVIA 3OOPA 5D5UB 1MW7A 3B6AA 3BZCA 3CC7I 4BEHB 3D5RC 2DFIA 2MSYA 3OIOA 1VQNI 4MEYF 2VC1A 3LMMA 5DEQA 2CUEA 2FMYA 1R4NB 4U7BA 1R49A 3OS2A 3S32A 4XRSG 3OR2C 4QPQA 3KP5A 1ODDA 3R0JA 2C6YA 1BA5A 2MH9A 5K7HA 2OTJI 4NNJA 4II3A 1P2FA 1F5TA 4ZDPA 2VBZA 5HLTA 1TTYA 2FMLA 4AVPA 1DU0A 2PEXA 2NNNA 4OAYA 3SYTA 4A3LJ 4CHUA 2RNGA 2NAZA 4M74A 4P96A 3OYCA 4F3QA 2CW8A 3CJQB 3A03A 3CP8A 3FXMA 1T08B 2IGKA 2LBFB 3PFIA 1KU9A 4B3XA 1N25A 1YI2I 4ZDOA 2K3PA 1EA3A 1KU2A 1R1TA 2A5WA 4L9VA 2VOPA 2O5RA 1B72B 2GIVA 2EZHA 4EM0B 3JTGA 2HYJA 3FKIJ 5C4XJ 3K9TA 3CF5F 3CZ6A 3KP7A 3WE3A 2HOAA 2K86A 2Z16A 1Y39A 4B44A 2MH2A 3TKYA 1LFBA 3G1OA 4DBRA 4I6ZA 2RNJA 2XUBA 4V2GA 1TWCJ 4Y7NJ 1D1AA 2W24A 3DKXA 2O3FA 4NUBA 1CF7A 2MGQA 3BWGA 3CDLA 1XMXA 3JRCA 3GTGJ 2BV6A 2R7FA 1Y1WJ 2IJLA 2K9NA 1FOKA 3SDGA 2OD5A 3NQOA 4BE1A 2P6TA 3FMSA 1FPQA 2ESNA 4HLXA 3OYJA 2YR2A 3GWZA 3CMMA 2R3SA 2JPBA 3KP6A 3BTCA 4OMZA 1JT0A 2BHYA 2DOFA 3U1KA 4BXXJ 4BXFA 2XPUA 4X6AJ 1X3WB 2Z3YA 5AONA 1RNLA 2GQQA 3R4KA 3K1MA 2F2EA 1K6OA 1NK2P 1QHGA 1I6XA 4C3HJ 3DWLE 2Y69H 2WAQN 4JP0A 5E1ZB 3Q0WA 2E19A 3R0AA 3P5JA 3R61A 4WXCA 3PO3J 1I1SA 2DYRH 4MTDA 1BW5A 1MBJA 2LP0A 3EUHC 1ZRFA 2VT2A 4LD5A 2A5YB 3WTUC 5L3GA 1TQPA 3GTOJ 2AHQA 1JUMA 2DTZA 3LQRA 3MKZA 3CLOA 1KU7A 4G7OF 2LYCA 2XHKA 2NS8A 5EZGA 4RB0A 4M72A 2CS3A 2JWTA 2XAUA 2DBBA 4WCGA 1STZA 5D4RA 5LHGA 3WTZA 1H9GA 5GAHJ 5IP7J 3JSOA 3HOUJ 3A4CA 2QQ9A 2QQ8A 2ZJQF 2ZSIB 3BR3A 2VKHA 3HC7A 3RPUA 3T1BA 3ZQIA 2E35A 2MA3A 5DDGA 4I02A 1H88C 3GXOA 4PGGA 3WE2A 3L2QA 3PM1A 1EH8A 4G8XA 2V6CA 1P7JA 3HKZA 3IWFA 4NC6A 2VBYA 2QSHX 2JPCA 2FBKA 3S2HJ 2R93J 4XBFA 1ZGWA 4GGGA 4PDKA 5F0HA 3CD6I 3CCLI 5LGTA 3KEOA 1XB4A 3HHGA 2Z33A 2R5YA 4M3FA 1H8AC 3ZR8X 4A0YA 4IRGA 3GZNB 3HZJA 3LSIA 1A6IA 3QYFA 3CCRI 4HF1A 3BTJA 3OWTA 3RDIA 1U9OA 4ETSA 3VODA 3R60A 4CCKA 3QRFF 1VQKI 5FB2A 3S17J 2HOSA 2XPVA 4OAZA 5EZHA 1UZCA 3LSPA 4HV6A 1X2MA 3L1PA 3BG9A 3Q5FA 2H09A 3I58A 2IBDA 4J01A 2E2IJ 3BLYA 1FC3A 5FFZA 5FD6A 1X1BA 5HVQC 5K5QA 4KISA 4O5VA 3IHUA 3IP4B 2MYSA 3CCQI 4IL6C 2DTRA 3QYBA 1MMDA 3ERMA 4YG2F 2M7AA 2HYFA 4G7ZF 4UY8I 3RZOJ 2X1EA 5E1XA 2FXAA 2IXSA 1Z05A 2WAQA 3ECOA 4A0ZA 4P9FA 4L9NA 1HW1A 1Z7UA 4MNUA 3CC2I 1X1PA 1Z67A 3ZCOA 2E34A 2H8WA 4U0VA 2ZKZA 2IGMA 1SFUA 1X1AA 2JZYA 3QODA 4FISA 3UR3C 3KETA 2GXAA 5DCFA 3I71A 5H6QA 4D1QA 4KJZA 3HTSB 2JRTA 1X58A 4G6TB 1JKRC 4I0BA 3SZPA 4HPQA 3S2WA 3N05A 1T56A 2X9DA 3K4LA 4XLNF 3J81K 3BTIA 4B1RA 3F9KA 4HZFA 4A3IJ 4KUMA 2CQKA 2DA6A 1JT6A 1VI0A 3G2BA 2KP6A 2PG4A 4BQNA 2NVQJ 2HWVA 2MC3A 2VB6A 4YFKF 2VJJA 1MBFA 3A0HC 1TT0A 4NQWB 1X3ZB 1I39A 1ZARA 4N4NB 3B73A 2VKDA 1YS6A 4RB3C 1K78A 4F93B 3ZQHA 2FNAA 4MGRA 3I3LA 3ZN0A 3GYHX 2IW5A 3FXJA 4RGRA 1ZYRF 3MZ8A 2Y9ZA 3PNVA 1BJZA 2JSPA 3HRTA 3OYBA 3FZVA 3ZMZA 3KPHA 1RRJA 1I3AA 2LBFA 1ZGAA 1TT5B 2W85A 3QYEA 1P4XA 4XSXF 3L2VA 2CQ7A 2R7DA 2PN6A 2FUG2 3O6BB 4D7MA 3IV5A 1QVUA 2GZWA 3FWEA 3K10A 1RR8C 1DGWY 4IHXA 1YHQI 1W4MA 2LK2A 2DOAA 4B47A 4DYRA 2JN6A 2L7KA 4Q4ZF 5LGUA 4WXDA 5EYRA 5CVUA 1OKRA 4MQ9F 3LNQA 4UB8C 1HBXG 1K79A 3NEUA 3RQ4A 5F08A 3MD2A 1IXCA 3LA7A 4H0EA 2R7QA 1FMVA 1S72I 2BY0A 4NDLA 4KIBA 4Q47A 2DXIA 1D3YA 1XC5A 2VASA 1QZEA 3GUDA 1PP8F 2VE8A 2EA2A 4M3DA 4MFEA 4D5CA 5M5WJ 2QM3A 3LL7A 1O7FA 2WBMA 4DJAA 2VJ4A 5L3FA 1Q1HA 2F5EA 5FKMA 1WJBA 2IA1A 2ME0A 2F6CA 1ETWA 1KA8A 2M3AA 3J7YJ 1S9HA 2EH3A 4M73A 5DCMA 2JA6J 1JHHA 4M3GA 3GTMJ 2V9PA 3E1SA 2R7WA 4OOIA 1AHDP 4WF2A 4EEFG 3S15J 3H36A 3ECHA 4G9YA 2AQFA 2XVCA 1VQ9I 4HOBA 2GOXB 3O3KA 1GT0C 1EH6A 4A3KJ 2LNBA 3JRIA 1DDNA 2VXZA 4DW6A 4RM3A 2RC4A 3VSLA 4EJWA 5ILVA 4LLGF 4JK1X 1ERDA 3T8RA 3KLNA 2E1MB 3OYMA 3GZ5A 1HKSA 4S0HB 3H5AA 2O8KA 2EIJH 4HW0A 2ESHA 4D5FA 2WADA 4L18B 1UHWA 2FU4A 1UMQA 2K9SA 2EIKH 1TNTA 3OYNA 2FEZA 4M3EA 2O0YA 3HSFA 1WHUA 4I99C 4RLFA 2W4SA 1QHHD 1FY7A 3C2GA 5FLXZ 3DTIA 1Z21A 1U8RA 2WV1A 4XKVA 1O3TA 5F64A 1BOAA 4LG3A 3ASOH 2HNHA 2I8DA 1ETKA 1Z9CA 3QAHA 3QOEA 3HBLA 2M0MA 4OWRB 2X4HA 3KFWX 2NOGA 2ZJRF 1IO2A 4BE0A 2OAZA 4P55A 1WFXA 3UKGA 4HNUA 3RQIA 2E71A 1TWAJ 3C2BA 5TJJA 3KEQA 3G6EI 2Z2SB 1BL0A 1WJAA 2VOOA 3D0SA 2V9KA 2CYYA 1KYZA 2CQQA 2L54A 5L3CA 3IKVA 1SC7A 2KRCA 1RUOA 2Y30A 2VONA 1U0JA 1UJ8A 3FMQA 4X0GA 2RGVA 4A6EA 2K4JA 3J80Z 2UUZA 2P7CB 2M87A 3DCFA 4A3EJ 2E2JJ 3TEDA 3N4MA 2IS1A 4YELA 1FP2A 2Y0SN 4LJZF 2M8GX 3GFJA 3H0GJ 2H1KA 4KFCA 1HC8A 2UZKA 1D5VA 1MMAA 2E36A 2NYXA 4OIOF 1NG7A 3HOTA 1XGSA 2W00A 1D8KA 3ASNH 3DPLC 3LSMA 5J6XA 3F8CA 1LUJB 4F7ZA 1HA8A 3TO6A 2VE9A 3GLXA 4XRMA 3MKLA 2KRFA 2OCEA 1BC7C 2RN7A 3A01A 2VN2A 4GFBA 2EFNA 4U0WA 5J4YA 2MLKA 1F1ZA 2EFOA 1ONVA 1ULYA 3OR1C 3RKXA 2PFBA 2P4WA 1SMTA 1OLTA 1G8XA 2F5FA 2G0EA 2VBXA 3U2RA 1YIJI 2A6TA 2HDCA 4ZTFA 3M4OJ 1HLVA 2L9NA 1LE8A 2EBIA 1Z3YA 3L2RA 1R6RA 1J09A 1XSXA 3K2AA 2GWRA 2Z99A 4RAFA 3TDUC 1P92A 2LH9A 2L4MA 4BUPA 4L5JA 1OR7A 3C7JA 3BR6A 2A6HF 5GP9A 3M1CA 3FHNA 1VFCA 5FRMA 3DFGA 1IJWC 1D0ZA 4GO1A 3CLQA 5KCMA 5K1YA 1BM9A 1QNTA 3PQKA 1YX3A 5GADJ 2PMZN 2XF7A 1OJLA 5M5XJ 4ENKA 4BKXA 1YRNB 3EUHA 4HYEA 4BYYA 4MQVA 5E3LA 1FEXA 1FZPB 3FXKA 4R79A 1VQMI 4AD9A 3F23A 3ZMVA 1P9QC 3AL0C 3ZQQA 2GA1A 1IN8A 3FXUA 2V79A 2NVYJ 3ZMDA 2DYSH 2AXLA 5TISC 2HKOA 1W5TA 2NXNB 3PJRA 3J7AY 5B66C 2ZXIA 2VPLA 4NQWA 2ZXHA 2DN0A 3QU6A 3TOAA 4HQMA 5DV5A 3LSHA 2VKEA 4DGWB 4IZZA 3HOSA 2KRHA 5JLXA 3U9GA 1T8IA 2HZTA 2P0WA 1C0WA 5IPAA 5JI6A 1E3PA 5BS6A 1B8IB 1IC8A 3MWMA 1W5SA 2AS5F 4D7NA 3TO7A 2E7WA 4U7DA 4LFUA 1WH5A 3FK7A 1OISA 3ISPA 3GVAA 1I5ZA 3K4NA 5E18F 4RAZA 4BGDA 1IN5A 1Y8QB 1TWGJ 2UV1A 1TC3C 3Q3SA 4KDPA 2BY2A 5DD8A 2BGCA 1PJRA 1T33A 3ONQA 5FJ8J 1BIAA 2JK3A 2YU3A 3A01B 2QSFX 3BQYA 3I55I 5HS9A 2DJIA 4YIIA 4EJOA 1U5TA 3E6MA 5LHHA 4ZYGA 3FX3A 3LA3A 3F8FA 4FX0A 4DQ2A 3JR9A 1W0TA 4M6XA 2ZMEC 2X6XA 4CXFA 5M5YJ 1I27A 1UB9A 2K7LA 2LG4A 1ENHA 4WX9A 2ME6A 1XGNA 1J59A 3P9KA 2ECCA 1Y56A 3HIFA 3LSJA 3IL2A 1FMWA 3M7GA 5E3OA 3K6GA 3RI4A 1GXQA 1IF1A 3PL8A 2X1DA 3LSKA 3X2QH 4CCLA 3V8LA 1T38A 1XX5A 3G73A 4FCYA 1G4DA 1KU3A 3DV8A 3DF8A 4FE4A 3S1MJ 5LGNA 1BI0A 4XORA 3JAMZ 4AM3A 2ZNYA 2XKPA 1IRGA 3IWZA 5E8GA 1O3RA 3JRAA 1Y0UA 1ETVA 2GIZA 1FLIA 1UFMA 2K85A 2VBWA 1USTA 3E6BA 2FX0A 4ZJZA 3S1RJ 2CV1A 3K69A 4Y33A 2V1NA 2EV5A 3D1NI 1WJEA 3T5XA 3FDYA 4DYCA 4C3IJ 4PSWA 1E2XA 3DBRB 1ORKA 3EYYA 2X0LA 4EJTA 2OTLI 1RR7A 3QPHA 4E7SA 2L2OA 5GTHC 5JFRA 3W6KB 3K0LA 1VQOI 2ZXWH 4BDZA 2X6WA 1NH3A 2KL4A 3FXQA 3K4BA 1Z91A 2LKPA 1TLHB 3CUOA 2CFXA 4IQJA 2KQRA 4C30A 3DBLB 3OIQA 3SHFA 4LB6B 3SZGA 3J7ZI 3H9JA 4KIGA 3CCMI 1XG1A 3C3WA 3K4MA 3LFUA 2JT1A 3HXLA 1YRNA 1E3OC 1F43A 3QWLA 3M07A 4ESJA 1BBYA 2GA2A 5ED4A 1R23A 2EZKA 3GW2A 4EM1A 3G4SI 2QQAA 5AIPA 1EF4A 4DZJA 1AOYA 4HX4A 1QZYA 4GDFA 1BI2A 1ON1A 1HDPA 1K4SA 2CV2A 4RDUA 3ULQB 4YRVA 4E6KG 2KLOA 3CTAA 3Q9VA 2L4AA 3ZQLA 3F0CA 3E5XA 4XLAA 1O4XA 1RI7A 2Y2ZA 3PUBA 2IT0A 5FRNA 5EF6A 2JA2A 5K5OA 1Y8RB 5D5WB 5HODA 3OYGA 3TW7A 4F55A 1Y6IA 4PZJA 1KZHA 1V5EA 3FHZA 2DT5A 1W7PB 4FQGA 5IP6A 5BMZA 3V42A 2DK8A 1FYMA 2FBIA 2J5PA 1W7PD 4UUTA 4B3AA 2IPQX 4AU7A 2M0CA 3W2VA 1CF7B 4KT5C 4JYKA 3I59B 1HKTA 4GXOA 3N97A 4RGXA 3CJRB 1X19A 3PIPF 2VLAA 4Q48A 4E7ZA 4BHCA 1O3QA 4HX8A 2M4KA 3W6JB 3LSGA 5IYCJ 1JHFA 2I10A 1FOWA 3TOBA 1XCVA 5AIQA 5A2QK 3DEEA 3EETA 1V3FA 2LSOA 4I98B 2LD5A 4EJUA 1LQ1A 1SFOJ 3DU6A 5FLMJ 2FD5A 2HZDA 4PUSA 2JMWA 5B1BH 3GEZA 4KNYA 3AFHA 3UNGC 3RTRA 4NC7A 4E7LA 2QKLB 3V7SA 4XN0A 2RQQA 3GTPJ 4KA4A 2WWYA 3PO2J 1B9MA 4BEHA 2KHMA 3ZRGA 1G3TA 3RIRA 3F72A 4LG0B 1DGRM 3LAJA 3RKWA 2LY2A 1MNDA 3GCMA 3KP3A 3EUKL 1WJ5A 2R4GA 1VQ4I 3LWFA 1HOMA 2MFZA 3CJNA 2KJCA 4FASD 5EJCA 2LKXA 1UHSA 2P7VB 1G3WA 4AWXB 1A36A 4BBSJ 3HM5A 2ZXJA 2LRDA 1MMSA 2ISYA 1WJFA 2CG4A 4A3GJ 4L9JA 1WSUA 5DTDA 2HPMA 2R7RA 4IHSA 2M5WA 1QRYA 5A2QZ 1REPC 2JA8J 3ZOBA 1YW7A 3PQJA 2ID3A 5HS7A 2DCEA 4LIUA 2PJPA 1R22A 2XSJC 3K2ZA 4ITVA 3HL2A 3P7NA 1TZLA 2DPUA 2IEKA 2X1CA 3FXLA 3P9IA 5B5EC 2A07F 4OIQF 2AQEA 4RMNA 1UELB 3TW6A 2XGCA 2OPTA 2HQNA 2HU9A 1MMGA 4L5EA 2ISZA 4KIFA 4TV7A 3HOWJ 3COAC 1BR1A 4LGWA 1V54H 3AG3H 2XIGA 1IXRC 4BJ6C 2M34A 1R1VA 2NVUB 2RV8A 5EGOA 2EZIA 5FKNA 3OL4A 3HUGB 3KP2A 2PMZA 3JREA 4M9SA 5CVJA 4RGSA 2CQNA 2OF7A 3VEPA 3ZMTA 4BH9A 2VIXA 3DKWA 1XPXA 4KICA 4Q5SF 5LLQA 1MBHA 3BJAA 2ZJ2A 3V7CA 5ICCA 2XB0X 1DQUA 1IV6A 5FGMA 3OY9A 2KIQA 4A6DA 2LOOA 4F92B 2JQ7A 2NOJB 3QU3A 3SXYA 2CGPA 3DU5A 5GAGJ 3W2WA 5B1AH 5E8IA 2NVTJ 4PGHA 3I56I 3HPGA 2LREA 2ZCWA 1A31A 3Q0UA 4LK0F 4XLHA 3E6CC 4L9TA 1W1WE 4NB5A 3OYAA 4ESBA 2ZBKA 3J81Z 4BE2A 3L2UA 2P5LC 4Y13A 3Q0VA 1IRXA 1WVRA 4G7HF 2L7MP 4J00A 4WXHA 1EH7A 3TGNA 3H5NA 3I9V2 5CLSA 2RDPA 3BP8A 4PJ0C 1TBXA 1LDDA 1JXSA 1MD0A 3FM5A 3L2CA 1MZBA 1XMAA 4PFOA 1D8JA 3IUOA 2BEOA 1MBKA 1U6GA 2XKOA 3CCJI 4IO9F 1APLC 2KZGA 4O6JA 5K5RA 2COMA 3REOA 2DT7B 5LBQA 3MKWB 1UG2A 1NHAA 1ITYA 2DT6A 4G6QA 4HLYA 3CC4I 1ZG3A 3MZYA 4BACA 1OPCA 4A3FJ 3ERED 4EJVA 4HRIA 2MW8A 2ADUA 4RAGA 1JUSA 2M4GA 3OYKA 4CH7A 3DPUA 4BHBA 3BPXA 1SD7A 1AKHB 4RAYA 1T2KA 2GXGA 3GFMA 2H6CA 2VI6A 1H0MA 1B1BA 1USSA 1OYYA 3RZDJ 1HW5A 4IKFA 4A0XA 2M2EA 3G1MA 3HOZJ 5E3NA 3DLAA 2RQPA 4UUSA 4A12A 3HUGA 1Z6RA 2M8EA 5CJ9A 1B8IA 1NK3P 3JAMK 2GM4A 1G2HA 4BQQA 2VC0A 2MD5A 5HOOA 1RKTA 3I64A 3FKJA 4N9HA 1PUFA 3BZ6A 3CP2A 3HKZN 1RKWA 3OL3A 1R9TJ 1MKMA 5C3EJ 2X85A 4UB6C 4RGUA 1VQ8I 1F36A 5D5XB 4CYCA 1WPKA 2I5UA 1HW2A 4IF4A 1IN4A 1PDNC 3KX2A 2UXNA 2B0LA 1YIOA 3AG4H 1W7PA 4QIWN 4I2OA 4HQEA 2V9VA 2IS4A 5H6RA 3ESWB 1X4OA 3S3MA 3S1NJ 1P4WA 5D5VB 5LRSA 1R4MB 2FA5A 1RPWA 3BR1A 4II2A 2LDUA 2RKHA 2VT3A 1YFHA 2QQBA 2O8XA 2IS2A 2AXTC 1GV2A 1O3SA 4R8HA 2CSOA 4M3BA 3HRUA 2BBYA 2K4BA 4U87A 3HHHA 4XOTA 1U3EM 5HDGA 4RB2C 4ENMA 2MC4A 4A2UA 4IJAA 2NS0A 4CYDA 3VYUB 2XDVA 1AWCA 2ZB9A 4XL9A 2JRMA 2MBFA 3OOUA 1LVAA 3SFZA 5JVGF 2HS5A 4M9ZA 3DBHB 1J75A 1LB2A 2R7UA 3I54A 4ZZDA 3M8EA 1QA6A 2VPRA 2NVXJ 3DLLF 4IHTA 4CSWA 2PLYA 4C2MJ 1ZAOA 4F91B 5D8KB 2VQCA 2O03A 3OIPA 2V26A 3ZQGA 1Z6TA 2WV0A 4ANJA 3H1CA 1E17A 3MEXA 4P9UA 2D1VA 2W84A 2LC2A 1AA7A 1V4RA 4XLCA 3I59A 2FOKA
chains in the Genus database with same CATH topology
3HOSA 2KRHA 2LBFB 4B3XA 2P0WA 4ZDOA 2ELJA 2K3PA 1EA3A 2A5WA 2O5RA 3VDXA 3H35A 1SFKA 3PNYA 2ZFUA 3OYEA 3OYHA 3CZ6A 2Z16A 4B44A 4BJTA 2L5QA 4DBRA 3K4NA 4BGDA 5JHFA 1D1AA 3DKXA 4NUBA 4XN3A 4ZYAA 2UV1A 4PJLA 1K6YA 2WA0A 1PJRA 3ONQA 3TBIA 4E7IA 1KONA 4BE1A 3A2KA 4QPOA 3DQVC 4BS9A 2PJRA 2VQGA 1D0YA 3OYJA 2Z1DA 2DJIA 3DPTA 3CMMA 2F5VA 4XMYA 4BQOA 1JI8A 4BXFA 3KYLA 2X6XA 1ZELA 2LG4A 3H9GA 4CCJA 1N77A 1QHGA 1Y56A 5HNFA 3DWLE 1FMWA 3K6GA 4RLQA 3PL8A 2X1DA 3LSKA 4CCLA 3FBIB 2K5CA 3EUHC 4KT6A 4PSXA 3U21A 3K4JA 2R7SA 3L2WA 4XORA 4BL0B 4XONA 2R7OA 4PJMA 3MKZA 2LYCA 2CS3A 2W82A 4ZJZA 2CV1A 2XAUA 4AVZA 2K9MA 4Y33A 2V1NA 4E7JA 4DBQA 2JUGA 1WJCA 1WJEA 3K4CA 3FDYA 3A4CA 1WJDA 4PSWA 2ZSIB 4EATA 3SEZA 2VKHA 3HC7A 2W7NA 2PJRB 2X6YA 4E7SA 5KHDA 2L2OA 1DP3A 2UWMA 3L2QA 3TL4X 4CA0A 4C2TA 3HKZA 4BDZA 2X6WA 2KL4A 3AL0B 3K4BA 2BOLA 4IQJA 2KQRA 2IGOA 4C30A 2R7VA 3OIQA 4HNTA 4ZTJA 3SZGA 3ZR8X 3H9JA 4XKCA 3K4MA 3LFUA 3LSIA 3HXLA 3QYFA 3OWTA 4JOMA 3S3NA 2VJ5A 1Z7LA 2OV7A 4CCKA 3IAM2 3MMYB 1LKXA 4OAZA 2CFOA 4H4KC 4XOPA 4J01A 3BLYA 4CCOA 4KISA 1X1BA 5HVQC 3BG7A 2CV2A 3IP4B 2MYSA 4XQFA 4YRVA 4GRIA 3QYBA 1MMDA 4E6KG 2M7AA 2KLOA 2MD0A 2VQHA 2IXSA 2WAQA 2X1EA 2M7BA 3PFYA 3OS1A 4IQ4A 5CPRB 2RREA 1YE9A 4XLAA 3ZCOA 4C2UA 2HVQA 4PK4A 3K4KA 3PUBA 2IGMA 5FRNA 1X1AA 2JA2A 3QODA 3UR3C 2GOMA 3OYGA 4NC8A 3BG6A 4FETA 4F55A 1Y6IA 1V5EA 4D1QA 4KJZA 4G6TB 4HPQA 3N05A 3K4LA 2WB1A 3V42A 2BW3A 2E60A 3RCOA 3F9KA 4C9YA 1W36C 4AU7A 3W2VA 4PFPA 1UG0A 4E4HA 2KZVA 3G2BA 2CW7A 2KP6A 4HSRA 4BQNA 2R7TA 3CJRB 1X19A 2CH0A 2VB6A 2VJJA 2VLAA 4XNFA 4B48A 3DKYA 2KPMA 1TT0A 3RSNA 3VYTB 4NQWB 3VYRB 4E7ZA 2M4KA 4N4NB 2VKDA 3LSGA 2KDOA 3OYDA 4ZC3A 4F93B 4HSTA 2WY7Q 1T95A 4XKBA 4MLOA 1UAAA 3DEEA 3I3LA 4DGWB 3H9QA 3DU6A 3NWTA 1X1DA 2HZDA 4PUSA 3NWSA 3OMYA 3PNVA 2JSPA 3AFHA 3UNGC 3OYBA 3FBNB 3RTRA 2LBFA 1N75A 1BR4A 3BCAA 4NC7A 3SDBA 4E7LA 4N4OB 2QKLB 3CF2A 3QYEA 3L2VA 4XN0A 3S3OA 2RQQA 2WAEA 2V6EA 4YEJA 2FUG2 4BEHA 2KHMA 3ZRGA 3K10A 2VQLA 1N78A 1DGWY 1DGRM 5FROA 2DOAA 4B47A 2LY2A 1MNDA 2L7KA 3EUKL 1WJ5A 2R4GA 4XR6A 2BW3B 2MFZA 4FASD 4LITA 2W1OA 2LRDA 4E7KA 3RQ4A 2XC7A 1WJFA 3MD2A 3IAS2 3CESA 2R7QA 4BJ5C 1FMVA 2R7RA 2CUJA 4LIVA 2HPMA 1V5GA 2DXIA 2VASA 3OYLA 2E5ZA 3D5LA 3LL7A 2WBMA 2DCEA 2LY1A 2VJ4A 4LIUA 3VSKA 4DJAA 4DOZA 2XSJC 4ITVA 1WJBA 3HL2A 5HNHA 1TZLA 2X1CA 2BVLA 2F6CA 2M3AA 2AQEA 2ZSHB 2CMPA 4CZCA 1S9HA 4RMNA 4ZDLA 1D1CA 5CKTA 1UELB 5TGTA 4CUGA 1D0XA 2QKMB 3E1SA 5CQGA 2R7WA 4Y4RA 2HU9A 2HQAA 1MMGA 1V5FA 2V7FA 2AQFA 1BR1A 2GOXB 2JVGA 4F52A 1OR7C 4XLCA 2L9SA 2XF6A 4BJ6C 4HEA2 2VXZA 2K9LA 4RM2A 3K70C 4RM3A 3HG9A 2IGNA 4XLEA 2X51A 3VSLA 5KNLA 1LVKA 3OL4A 2CV0A 3HUGB 4DIQA 2PMZA 4PJNA 1ERDA 1BR2A 2E1MB 3S8PA 2JVHA 3OYMA 5CQEA 2VIXA 3H5AA 2WY8Q 4KITB 2R7XA 2WADA 3H0DA 4IX7A 3HPHA 1DQUA 3OY9A 4E7HA 1QU3A 2LOOA 3W3CA 3OYNA 3MKYB 3H5RA 4F92B 2NOJB 3S93A 3DU5A 4RLFA 3W2WA 4Y3OA 2W4SA 4P5OA 1QHHD 3C2GA 3DTIA 3HPGA 1Z21A 2Y0SA 5LD2C 2LREA 4XKVA 2VJIA 4LG3A 2HNHA 2I8DA 1X4PA 3W2AA 4XLHA 3VYSB 3PNTA 3QOEA 4OWRB 2M0MA 1VZ0A 3OYAA 4BE0A 4BE2A 3L2UA 4XM3A 1WFXA 1IRXA 4HNUA 4J00A 3D5SC 3H5NA 3RPUD 3I9V2 3BCBA 4XLFA 1W36D 2Z2SB 3PSFA 1WJAA 1T0FC 2V9KA 4PFOA 3IUOA 3VWBA 2KRCA 1LFPA 1U0JA 2Q2EB 1X1CA 4X0GA 2DT7B 2KMUA 3MKWB 3ZXSA 3K70D 4XKWA 2DT6A 2UUZA 3EPZA 1MNEA 4BACA 2IS1A 4YELA 3AKZA 4CCNA 4HRIA 2OUMA 5LFAA 1MMAA 2VXDA 3SEQA 2M4GA 3OYKA 2Q1ZB 4CH7A 3DPUA 1NG7A 3HOTA 1G59A 2W00A 3GBGA 2HVSA 3DPLC 2HDWA 3LSMA 1E0EA 4IKFA 1HA8A 4B43A 3C2HA 3OYIA 3DLAA 2V4JC 2HPIA 4BU2A 4AYBA 2E5NA 1LDKB 2F4IA 3DTKA 4BQQA 5HOOA 3OS0A 3FKJA 4P1WA 3E0JB 3OR1C 3CP2A 2OC6A 1SAUA 3DTEA 2E1MC 2IS6A 1OLTA 1G8XA 3OL3A 1YX5A 2A6TA 2X85A 4ZTFA 4HG2A 1MMNA 3A1YA 3TMOA 2MABA 1NG6A 2L9NA 3ZGKA 1Z3YA 3L2RA 1R6RA 2XF5A 3KX2A 1J09A 2LH9A 3KEYA 4D9JA 4BUPA 2VL8A 2IS4A 2WAFA 4PJJA 1PYVA 1X4OA 3S3MA 1D1BA 1GLNA 3M8JA 3PSIA 3M1CA 3FHNA 4II2A 5FRMA 1MW7A 1D0ZA 1Z3XA 5KCMA 4BEHB 4BDYA 1YX3A 2IS2A 3D5RC 2XF7A 4U87A 4XOTA 3LMMA 2CUZA 4U7BA 2MC4A 3OS2A 3VYUB 2XDVA 4R79A 1BOBA 3S32A 3OR2C 4XL9A 4QPQA 1P9QC 3AL0C 3ZQQA 3OOUA 4NNJA 4II3A 2R7UA 4ZDPA 5HLTA 3PJRA 4CCMA 4CSWA 2BVMA 4JQFA 3J7AY 4F91B 2ZXIA 2VQCA 3OIPA 4OAYA 2V26A 2VPLA 3SYTA 4ANJA 2HVRA 2ZXHA 2RNGA 2LC2A 3OYFA 3BC8A 3OYCA 4F3QA 2CW8A 3CJQB 1AA7A 3CP8A 3EUAA 3LSHA 2IGKA 4IZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNT A;  4KT6 A; 
#chains in the Genus database with same CATH topology
 2KIS A;  2EFQ A;  4UVB A;  3CO7 C;  5E1W A;  3KCC A;  3VDX A;  3L9F A;  2PMU A;  3H35 A;  2DQR A;  1SFK A;  1U5T B;  3F6V A;  2ZFU A;  3OYE A;  2H27 A;  5IY5 H;  3TP3 A;  1ZH5 A;  4G94 A;  4JX4 A;  1RC9 A;  1XDS A;  4QSH A;  2L5Q A;  2PBI A;  2ACJ A;  1MBG A;  1WCM J;  5JHF A;  3CCY A;  4XN3 A;  2GXB A;  2LFB A;  1KQ8 A;  1GXP A;  2CUF A;  3E5Q A;  1S7A A;  3V8K A;  1A04 A;  1FX7 A;  1K6Y A;  2WA0 A;  2LF8 A;  4E7I A;  1KON A;  3A2K A;  4QPO A;  1SVL A;  4BS9 A;  2PJR A;  1D0Y A;  2XRL A;  1ETO A;  3DPT A;  2QBY B;  4BQA A;  5JLW A;  3OSF A;  1B4A A;  2JUC A;  4ZH4 F;  3WTW C;  1MDM A;  1S7E A;  1BI1 A;  2HYG D;  4DYQ A;  2DW4 A;  4BQO A;  2DO7 A;  2YUS A;  3F6O A;  4Y17 A;  2D1H A;  3KP4 A;  5GPA A;  1ZEL A;  4J19 A;  4MO7 A;  4CCJ A;  4XID A;  5E79 C;  3I4M J;  5KAI C;  4RB1 A;  2O9L A;  1K83 J;  2HXO A;  1RET A;  2E1N A;  4KMU X;  1S29 A;  2OA4 A;  1YIT I;  5TRD A;  1K7A A;  1SAX A;  2KKO A;  4RLQ A;  2BXZ A;  1R58 A;  1TW2 A;  3VFZ A;  2OQG A;  2L7F P;  2K5C A;  2L01 A;  3RYP A;  2XGD A;  4KT6 A;  3WU1 B;  2R7S A;  2LLK A;  2JJ7 A;  4BL0 B;  4XON A;  2R7O A;  4PJM A;  2HEO A;  4ZYD A;  1S8N A;  3BG5 A;  4MEX F;  5BPI A;  2LY9 A;  2OBP A;  3CUQ B;  1FSE A;  2EB7 A;  4ON0 A;  4CIC A;  2QLZ A;  1Q1V A;  2EQR A;  2L3D A;  3J7A O;  3MZH A;  1XGO A;  1SEU A;  1ZRE A;  3CDI A;  2K9M A;  4GYG A;  1OYI A;  4E7J A;  1HF0 A;  2JA7 J;  1QZZ A;  3K4C A;  3K7A J;  1YOV B;  1WJD A;  3GLL A;  1YJW I;  4EAT A;  4MFD A;  3SEZ A;  2YU9 J;  5F6F A;  4AIK A;  2OCC H;  2W7N A;  5F0F A;  4Y52 J;  2X6Y A;  1A6Q A;  5KHD A;  2B63 J;  1W5C C;  1KYW A;  3RPQ A;  3CMA I;  1ZG1 A;  4HAM A;  1TQM A;  3TL4 X;  3RKY A;  2H1L A;  4BAY A;  2O7O A;  3QPT A;  3B6C A;  5FKK A;  2VOD A;  3AL0 B;  3TO9 A;  1LEB A;  5J47 A;  3ROU A;  3BT9 A;  1QBJ A;  5GAE J;  2IGO A;  4HNT A;  4PCQ A;  3WHB A;  3BPV A;  2CW0 F;  5FFX A;  4V19 K;  1WQ2 A;  2W25 A;  5CVI A;  4XKC A;  4ENN A;  1WI3 A;  5FLX K;  3QP5 A;  5BOX A;  2EIN H;  4JOM A;  2H8R A;  3S3N A;  4HBL A;  3ABM H;  5EGO B;  3TQN A;  2EK5 A;  2F48 A;  3IAM 2;  3MMY B;  4D0P A;  2ECB A;  3KE2 A;  2WB1 N;  2YSR A;  1ZR4 A;  4HA8 A;  3GTQ J;  2P5K A;  2L9V A;  1L0O C;  2W48 A;  4XOP A;  4ZYH A;  2O6G E;  3M3Y J;  4XQF A;  3MN2 A;  2LVS A;  2HR3 A;  1OMI A;  5D6F A;  2VQH A;  3JW4 A;  2HGC A;  4EQQ A;  1TQI A;  4A69 C;  3GF2 A;  5EG0 A;  3CMY A;  4IQ4 A;  3H3Z A;  2DA2 A;  3H3U A;  1YE9 A;  1MNM C;  2EPF A;  4C2U A;  2HVQ A;  1SFE A;  3FIW A;  1B59 A;  2Q2E A;  1JGG A;  4PK4 A;  2F5D A;  5IYD J;  3K4K A;  4A5N A;  4HNV A;  5EEH A;  4NC8 A;  1I3Q J;  3M8F A;  4HDU A;  2RVC A;  1VF9 A;  4YIF A;  2DA1 A;  3GZ6 A;  1MGT A;  2Y0M A;  1IRZ A;  2QBY A;  1ON2 A;  1QQI A;  2BW3 A;  2E60 A;  4IPA A;  4RA2 A;  4FTH A;  1ETX A;  4DZP A;  2FNP A;  2G9W A;  2HI3 A;  3OSG A;  4C9Y A;  1RES A;  1W36 C;  2HTJ A;  4PFP A;  1UG0 A;  1Z1D A;  4E4H A;  2DMT A;  2VKV A;  3BR5 A;  2A69 F;  4XNF A;  3GX4 X;  4GYI A;  3DKY A;  3VYT B;  3RSN A;  1QVT A;  2YS9 A;  1O7L A;  1D5Y A;  5J40 A;  1IW7 F;  1ZK8 A;  2GBY A;  3CCV I;  4DNC A;  2DI3 A;  4ZC3 A;  2DFE A;  1Z0X A;  3QOP A;  3OYD A;  1DU6 A;  5LRR A;  2WY7 Q;  4M71 A;  1T95 A;  4XKB A;  4M9X A;  1FBS A;  4MLO A;  1UAA A;  2FQ4 A;  2PMH A;  5HLI A;  3H9Q A;  4A3C J;  3NWT A;  1JKQ C;  1LDJ A;  1X1D A;  1R5H A;  4UUV A;  2XAH A;  3OMY A;  1YJN I;  3FBN B;  1HCR A;  2RAE A;  4L0Z B;  1EKE A;  3CQZ J;  1BR4 A;  3BCA A;  1IN7 A;  1JTX A;  3SDB A;  4N4O B;  3CF2 A;  1JTY A;  3AG1 H;  4OU0 A;  2V6E A;  2WAE A;  3LST A;  2DDA A;  5DM7 F;  3HEF A;  4YEJ A;  1LEA A;  3TDZ C;  2ICW G;  4ZZL A;  3E6D A;  1QGP A;  2Q0O A;  3O2P E;  4RBO A;  3ZMU A;  4IHW A;  5E3M A;  3F22 A;  2ELH A;  2XGX A;  4XR6 A;  3WU2 C;  4LIT A;  3F3X A;  1IUF A;  2W1O A;  2STW A;  2E2H J;  4FHT A;  4WK8 F;  2XC7 A;  3PUF A;  4BJ5 C;  5D8L B;  4L5I A;  2CUJ A;  4LIV A;  1U9N A;  3F8M A;  1FP1 D;  3C18 A;  3HRS A;  3WGH A;  3D5L A;  2LY1 A;  4ENJ A;  1QPM A;  2X48 A;  3VSK A;  2STT A;  3PIO F;  3FM3 A;  2CQX A;  4A3D J;  3ML6 A;  4U0Y A;  2BVL A;  2UXX A;  4WWC A;  4IOC F;  2ZSH B;  5FKO A;  4CZC A;  4I09 A;  1TNS A;  4ZDL A;  5ILS A;  2R0Q C;  2HFH A;  4LOC A;  4YIR X;  4CGZ A;  2Q8K A;  4CUG A;  2BZT A;  5CQG A;  2Z9O A;  2XAF A;  4BHP A;  5DM6 F;  2V7F A;  3CCU I;  1OCZ H;  4QLC U;  2KFD A;  2PQ8 A;  4R1H A;  3ABU A;  3BY6 A;  4F52 A;  3ZN1 A;  2L9S A;  4NBQ A;  1ZKG A;  2K9L A;  4RM2 A;  1LNW A;  2W57 A;  3IKT A;  3K70 C;  4M6V A;  4XRF A;  3SFI A;  1EV7 A;  4XLE A;  1OQY A;  2X51 A;  5KNL A;  1LVK A;  2CV0 A;  3A02 A;  4DIQ A;  4NHJ A;  4PJN A;  1VQ6 I;  2Y31 A;  1X2N A;  3ABT A;  3IH2 A;  1G3S A;  1BR2 A;  1PP7 U;  2JVH A;  2PX9 A;  4C3J J;  2A3S A;  5CQE A;  1SMY F;  5K7F A;  1SD5 A;  4G6D A;  3ABL H;  2WY8 Q;  3B02 A;  3KZI C;  1W0U A;  2DQL A;  2EFP A;  1ZLJ A;  3WHC A;  2R7X A;  3F21 A;  4M6Y A;  5LEJ A;  3EQL F;  4IX7 A;  5CVR A;  5IYB J;  3IRQ A;  2L9R A;  4E7H A;  3O8H A;  2P81 A;  1SFX A;  1SAN A;  2YPR A;  3W3C A;  1QU3 A;  2HKX A;  4IOA F;  1M1E B;  4Y3O A;  3WG9 A;  1WZ2 A;  1XMK A;  5DCM B;  3SQN A;  1GV5 A;  2KDZ A;  5LD2 C;  3CCE I;  1P6R A;  1R36 A;  5GTI C;  5M3M J;  3W2A A;  3VYS B;  2KJB A;  4AID A;  3CJT B;  1VTN C;  4W1U A;  5ILU A;  3BOQ A;  3EDP A;  1XGM A;  1HXD A;  5B3S H;  5IT9 Z;  5BQT A;  3ZQ7 A;  1YTY A;  2ID6 A;  4A3M J;  3RPU D;  3K1P A;  2OU2 A;  3BCB A;  4XLP F;  4XLF A;  3E7L A;  1WRJ A;  1T0F C;  2FOW A;  4YFX F;  2K40 A;  1POG A;  1BC8 C;  1LFP A;  1SD4 A;  2Q2E B;  1G3Y A;  3LA2 A;  5ICE A;  3IH3 A;  1X1C A;  5JHU A;  1UHM A;  4V2F A;  1S5L C;  2WTE A;  1FT9 A;  2KMU A;  2VUM J;  5EG0 B;  1IN6 A;  5J1Y A;  3HOV J;  3SZT A;  2EIL H;  3K70 D;  3TP0 A;  4XKW A;  3EPZ A;  1TW3 A;  3S1Q J;  1MNE A;  4G12 A;  2ZJP F;  3KZY A;  3I5U A;  3QPL A;  5E17 F;  4FX4 A;  4CCN A;  1XSV A;  5LFA A;  1FWZ A;  2VXD A;  3SEQ A;  3WG7 H;  2DA3 A;  5F1R A;  2P6S A;  1ZTR A;  1G59 A;  1U2W A;  3JRF A;  2HVS A;  5J8F A;  3E97 A;  2DMU A;  2XSD C;  1SVO A;  1P7I A;  1RZ4 A;  1FYK A;  2Y48 A;  1T98 A;  2V4J C;  2QA4 I;  2HPI A;  2XRO A;  3MFK A;  3KYD B;  1XD7 A;  4AYB A;  2XRN A;  5D6E A;  1FBU A;  3JRB A;  1L3L A;  1OCC H;  3BR2 A;  4KN7 X;  3HGG A;  5HDK A;  3M9A A;  3E0J B;  3ZQF A;  2G7U A;  5L3D A;  3WGG A;  2TCT A;  2IS6 A;  3ABK H;  1ETY A;  1CQT A;  3TMO A;  3J80 K;  3ZGK A;  3CO6 C;  3DP7 A;  1Y0N A;  4MIM A;  2YX4 A;  4LMY A;  4O3M A;  4IHV A;  4A3B J;  2CJJ A;  3KEY A;  2R7Z J;  2M45 A;  2D2W A;  4D9J A;  1R7J A;  4HF0 A;  1XSD A;  3NRV A;  1T39 A;  4Y15 A;  2VL8 A;  2HOE A;  1FIA A;  2WAF A;  4PJJ A;  1PYV A;  3WGI A;  1BJA A;  1YQA A;  2L7Z A;  1XCB A;  1DPU A;  1Z3X A;  1LPQ A;  2GLO A;  3ZMS A;  4N9I A;  4BDY A;  4U88 A;  1WGX A;  3JRD A;  1DP7 P;  1E3H A;  2CUZ A;  3L00 A;  5FO5 A;  3P9C A;  3HDD A;  3HJE A;  2TRT A;  2K9Q A;  4BXU A;  4W97 A;  1BOB A;  2F4O B;  4OIN F;  2QEN A;  2QYO A;  1OYW A;  2KT0 A;  4HF2 A;  3T8T A;  9ANT A;  4ABZ A;  1K4T A;  5F27 A;  1WH7 A;  2EZL A;  2QVO A;  1GVD A;  3HGY A;  1U78 A;  3ZQC A;  4CCM A;  2BVM A;  1BI3 A;  4I0A A;  4JQF A;  3VOE A;  2MLG A;  2FJ1 A;  2QUF A;  4CYC B;  3G3Z A;  2XGE A;  3BR0 A;  2DPD A;  2HVR A;  1QO0 D;  5DS9 A;  1P4A A;  2HQR A;  1Z77 A;  3OYF A;  2R5Z A;  3BC8 A;  4LLN A;  3GTJ J;  2HOT A;  5ICF A;  3EUA A;  1U5T C;  4S05 A;  2P8T A;  2AO9 A;  2COB A;  2B7E A;  3T0Y A;  2OZU A;  1YW9 A;  3A0B C;  2CU7 A;  1XTA A;  2R5Y B;  2BHZ A;  5LEK A;  2ELJ A;  2V1X A;  1MDM B;  2DJN A;  1YS7 A;  3PNY A;  4S04 A;  1S3J A;  4X1E A;  4Z6Y A;  3I0T A;  1ZR2 A;  2QCO A;  3OYH A;  2NNY A;  1GDT A;  4BJT A;  1HST A;  1A35 A;  4A5M A;  1F4K A;  4BY1 J;  3VPR A;  4ZYA A;  2DLL A;  3HOY J;  2ELK A;  5DUK A;  2KIF A;  4UV8 A;  4PJL A;  4AIH A;  1U8B A;  1XN7 A;  4IEJ A;  1B9N A;  3TBI A;  3DQV C;  1JKO C;  2VQG A;  4JX5 A;  3WTS C;  5F1J A;  2Z1D A;  3S2D J;  3LAP A;  4AUX A;  2F5V A;  1MBE A;  3CUQ A;  3AAF A;  5E20 A;  2NS7 A;  3LOC A;  4XMY A;  4N0B A;  1HSJ A;  1JI8 A;  1WWX A;  2FE3 A;  1MJB A;  3AG2 H;  3KYL A;  2XAQ A;  1TL8 A;  3H9G A;  3WOD F;  2EFW A;  1N77 A;  1J9I A;  4ESF A;  4XSZ F;  1GVJ A;  4LB5 A;  5HNF A;  1DUX C;  5HLH A;  1VQL I;  3WTT C;  5L3B A;  1BN5 A;  3MCZ A;  3FBI B;  2Z5U A;  2GAU A;  3JSP A;  1PUE E;  2IA2 A;  4PSX A;  3U21 A;  4B8X A;  1J0R A;  2HXI A;  3K4J A;  3MAJ A;  1TWF J;  3L2W A;  2E7X A;  2FF4 A;  4AC0 A;  3I53 A;  5FD5 A;  3V8J A;  2ZFW A;  2ETH A;  5F0C A;  3L7W A;  3JRG A;  2DMP A;  5EEA A;  1KQ9 A;  2W82 A;  3S14 J;  4E70 A;  4AVZ A;  1I6H J;  4OIR F;  4DBQ A;  2JUG A;  2EV0 A;  4LK1 F;  1FJL A;  1WJC A;  1DPR A;  5KK1 A;  2QZ8 A;  5FLV A;  2ZME A;  4EMS A;  1IGN A;  4XRS A;  5DYM A;  2DOD A;  2ZNZ A;  5EDN A;  2PJR B;  1R1U A;  3V4G A;  3FXR A;  1LFU P;  1FIP A;  3CUQ C;  1DP3 A;  2UWM A;  2DA7 A;  4CA0 A;  1PVE A;  3H92 A;  4C2T A;  3LFK A;  2HDD A;  1OFC X;  3BTL A;  1FNN A;  2DA4 A;  4CO8 A;  1K61 A;  5ERI A;  5C44 J;  1ZQ3 P;  4BNC A;  3H3V K;  1FOX A;  1MH4 A;  1T6S A;  3K1N A;  2BOL A;  4KN4 X;  1G6N A;  4IXA A;  1TP4 A;  3RJP A;  2R7V A;  4UHT A;  4QTR A;  4ZTJ A;  2XV4 S;  2DAO A;  1CGP A;  1QPI A;  1SD6 A;  1YO5 C;  2OJE D;  4A93 J;  4LLL A;  2JTV A;  4UVC A;  2VJ5 A;  1Z7L A;  5IOZ A;  2E1O A;  2OV7 A;  3BRO A;  2O61 A;  1MJ9 A;  2BXY A;  1MIJ A;  1LKX A;  4UV9 A;  5H2F C;  4FT8 A;  2LMD A;  2CFO A;  3FK6 A;  4H4K C;  2XAS A;  4CCO A;  2G7H A;  1KQ0 A;  3BG7 A;  2EV6 A;  3W6V A;  2BY1 A;  4GRI A;  1S6L A;  1YW8 A;  3OS1 A;  2MD0 A;  1XDU A;  3PFY A;  2M7B A;  5J8C A;  4B09 A;  2BE5 F;  3QQA A;  3RKQ A;  5CPR B;  2RRE A;  1R00 A;  5M3F J;  2P5V A;  4BBR J;  4IRH A;  4GCV A;  1KGS A;  4UXN A;  1IG7 A;  4K2E A;  1ZLK A;  1LJ9 A;  3KYC B;  2GOM A;  5J1U A;  3BG6 A;  4FET A;  2HTS A;  3CME I;  5LHI A;  1VQ7 I;  2CRG A;  2XPW A;  2B9S A;  2DFF A;  2HQ5 A;  2WB1 A;  3GME A;  4IVN A;  1IUY A;  3JRH A;  2N8G A;  1TWH J;  2V1U A;  3RCO A;  4AIJ A;  1OCO H;  1FTT A;  1IV8 A;  5D4S A;  3MQ0 A;  2NRA C;  2KZV A;  4HDV A;  2CW7 A;  4HSR A;  2H94 A;  2M1B A;  4A3J J;  1MSF C;  1YG2 A;  2R7T A;  2A6E F;  2CH0 A;  3FXO A;  4B48 A;  3RYR A;  1I1G A;  4MTE A;  2KPM A;  3VYR B;  2DMN A;  2A68 F;  2Y75 A;  1R5I D;  2ZO4 A;  2KDO A;  2ZC2 A;  3HSR A;  1UCR A;  4I7H A;  4EGY A;  2DMQ A;  4HST A;  2ZME B;  3BQZ A;  3V7R A;  2XB5 A;  1MJA A;  3KZZ A;  3MVP A;  2X6O A;  3M1E A;  3BJO A;  2L0K A;  3NAR A;  3NWS A;  1J7K A;  4UUS B;  1BIB A;  2EIM H;  3IH4 A;  5HS8 A;  3DEU A;  1N75 A;  4CDG A;  1HKQ A;  3S3O A;  5EEG A;  2R5Z B;  2LTP A;  3G71 I;  2VQL A;  2IP2 A;  1N78 A;  2QSG X;  5H20 A;  3JCU C;  3HB9 A;  5FRO A;  5L3E A;  2EWN A;  2A61 A;  5DUI A;  3Q9S A;  1V55 H;  4EGZ A;  2M9H A;  2DOE A;  5IP9 J;  5K7Z A;  2BW3 B;  1R71 A;  2IA0 A;  1JGS A;  3IC7 A;  2M30 A;  4E7K A;  5IT9 K;  3IAS 2;  1RUN A;  2OZ6 A;  2DFH A;  3CES A;  3S16 J;  3I4P A;  1V5G A;  1X3U A;  1MSE C;  1BW6 A;  6PAX A;  3OYL A;  2FQ3 A;  3E3V A;  2E5Z A;  3HTU A;  3DXJ F;  1PUF B;  4DOZ A;  3QP6 A;  2XAG A;  1JUP A;  1GUU A;  2LR8 A;  1IDY A;  2Y9Y A;  2F5C A;  3HRM A;  5HNH A;  3GTK J;  4QWQ A;  2EA4 A;  4ASN A;  1SVM A;  3BDD A;  3LSR A;  4CZZ A;  2H6B A;  2CMP A;  2V1D A;  1D1C A;  5CKT A;  1B72 A;  1XS9 A;  5TGT A;  1Y1V J;  1D0X A;  2QGU A;  2QKM B;  4Y4R A;  2HQA A;  3C1D A;  1ZHF A;  5IOY A;  2K02 A;  1V5F A;  4XK4 A;  2IRF G;  3HYI A;  1ZG5 A;  1AKH A;  2XAJ A;  2JVG A;  3L09 A;  1LE8 B;  4LG0 A;  1OR7 C;  2K27 A;  2XF6 A;  4MHG A;  4AYB N;  4HEA 2;  2LKS A;  3DEW A;  2IGN A;  3HG9 A;  1VQ5 I;  4KYW A;  1JJ6 C;  1IAW A;  1B6A A;  1FYL A;  1ZRD A;  5DD4 A;  2JSC A;  1JJ8 C;  3CDH A;  3EYI A;  1FOY A;  3S8P A;  3F8N A;  2BY3 A;  2J5O A;  3R6S A;  1WI9 A;  2DU9 A;  3QPS A;  1EJ9 A;  1ACI A;  4RS8 A;  3GFL A;  1J5Y A;  4KIT B;  2E1C A;  1YYV A;  4IHY A;  3H0D A;  2DA5 A;  3HPH A;  4JX6 A;  3HSE A;  4I01 A;  5HLG A;  5JR3 A;  3FMR A;  2QEX I;  2FSW A;  3MKY B;  3H5R A;  1F9N A;  3CCS I;  3S93 A;  3WTX C;  1I50 J;  4P5O A;  3LQQ A;  4IRI A;  5F04 A;  2Y0S A;  1HQC A;  1GHC A;  3FF5 A;  2VJI A;  4UVA A;  2QF7 A;  2IVM A;  2DK5 A;  2YX7 A;  1X4P A;  1ZGJ A;  2JA5 J;  3PNT A;  3KLO A;  3WU0 A;  1VZ0 A;  1R5G A;  2D45 A;  3ELK A;  4XM3 A;  5KAF C;  4I76 A;  5CYV A;  2EJR A;  1RIO H;  3D5S C;  1HDD C;  1JKP C;  5KVR A;  3F8B A;  2BYV E;  3IRR A;  1W36 D;  3PSF A;  2KIM A;  4HX7 A;  1FSH A;  4OIP F;  3VWB A;  2TDX A;  3JTH A;  3WTY C;  2F4M B;  3HOX J;  5BPD A;  1H89 C;  1S7O A;  5IT3 A;  1AU7 A;  1YLF A;  4BY7 J;  1K78 B;  4OMY A;  2PI0 A;  4FE7 A;  3ZXS A;  1YJ9 I;  5J1R A;  2FBH A;  2L02 A;  1FBQ A;  1VQP I;  4UNO A;  3SJM A;  1JE8 A;  1FTZ A;  1OCR H;  3OV8 A;  3BZK A;  2KIU A;  1NTC A;  3AKZ A;  4KMF A;  1IRF A;  1O57 A;  2OUM A;  5C4J J;  2LF7 A;  1IXS B;  2Q1Z B;  1OCP A;  5JVT A;  2R92 J;  3GBG A;  3ZPL A;  2IAI A;  2HDW A;  3G1L A;  2FRH A;  1E0E A;  3BG3 A;  3BJ6 A;  4L0Y B;  1ZN2 A;  4B43 A;  3C2H A;  3OYI A;  3NAU A;  4ZYE A;  5GPC A;  3GFI A;  1OCT C;  2K3F A;  1H9T A;  3GO5 A;  4JBA A;  1VND A;  1A5J A;  4BU2 A;  4Z2Y A;  2DDB A;  4XIC A;  2E5N A;  1ETQ A;  1LDK B;  2F4I A;  3DTK A;  5FKL A;  2D5V A;  3OS0 A;  4HV5 A;  4P1W A;  5ICG A;  1IZ1 A;  3O8G A;  3KIO A;  4EV0 A;  2OC6 A;  1SAU A;  3DTE A;  2E1M C;  4B4C A;  1YX5 A;  3I4N J;  5CVV A;  4HG2 A;  1MMN A;  3A1Y A;  1MH3 A;  3GTL J;  2MAB A;  1NG6 A;  2QWW A;  3WTV C;  4EM2 A;  2XF5 A;  2OQR A;  5J4V A;  3U1D A;  1J2X A;  3FIS A;  2A05 A;  1ZRC A;  5J3L A;  2CO5 A;  1WKM A;  1T0F A;  3E5U A;  5BNG A;  4YFN F;  2MG4 A;  2WC2 A;  3ZP5 A;  1D1B A;  2CWE A;  3VB2 A;  1GLN A;  5HDN A;  1IDZ A;  3M8J A;  3PSI A;  4EVI A;  3OOP A;  5D5U B;  1MW7 A;  3B6A A;  3BZC A;  3CC7 I;  4BEH B;  3D5R C;  2DFI A;  2MSY A;  3OIO A;  1VQN I;  4MEY F;  2VC1 A;  3LMM A;  5DEQ A;  2CUE A;  2FMY A;  1R4N B;  4U7B A;  1R49 A;  3OS2 A;  3S32 A;  4XRS G;  3OR2 C;  4QPQ A;  3KP5 A;  1ODD A;  3R0J A;  2C6Y A;  1BA5 A;  2MH9 A;  5K7H A;  2OTJ I;  4NNJ A;  4II3 A;  1P2F A;  1F5T A;  4ZDP A;  2VBZ A;  5HLT A;  1TTY A;  2FML A;  4AVP A;  1DU0 A;  2PEX A;  2NNN A;  4OAY A;  3SYT A;  4A3L J;  4CHU A;  2RNG A;  2NAZ A;  4M74 A;  4P96 A;  3OYC A;  4F3Q A;  2CW8 A;  3CJQ B;  3A03 A;  3CP8 A;  3FXM A;  1T08 B;  2IGK A;  2LBF B;  3PFI A;  1KU9 A;  4B3X A;  1N25 A;  1YI2 I;  4ZDO A;  2K3P A;  1EA3 A;  1KU2 A;  1R1T A;  2A5W A;  4L9V A;  2VOP A;  2O5R A;  1B72 B;  2GIV A;  2EZH A;  4EM0 B;  3JTG A;  2HYJ A;  3FKI J;  5C4X J;  3K9T A;  3CF5 F;  3CZ6 A;  3KP7 A;  3WE3 A;  2HOA A;  2K86 A;  2Z16 A;  1Y39 A;  4B44 A;  2MH2 A;  3TKY A;  1LFB A;  3G1O A;  4DBR A;  4I6Z A;  2RNJ A;  2XUB A;  4V2G A;  1TWC J;  4Y7N J;  1D1A A;  2W24 A;  3DKX A;  2O3F A;  4NUB A;  1CF7 A;  2MGQ A;  3BWG A;  3CDL A;  1XMX A;  3JRC A;  3GTG J;  2BV6 A;  2R7F A;  1Y1W J;  2IJL A;  2K9N A;  1FOK A;  3SDG A;  2OD5 A;  3NQO A;  4BE1 A;  2P6T A;  3FMS A;  1FPQ A;  2ESN A;  4HLX A;  3OYJ A;  2YR2 A;  3GWZ A;  3CMM A;  2R3S A;  2JPB A;  3KP6 A;  3BTC A;  4OMZ A;  1JT0 A;  2BHY A;  2DOF A;  3U1K A;  4BXX J;  4BXF A;  2XPU A;  4X6A J;  1X3W B;  2Z3Y A;  5AON A;  1RNL A;  2GQQ A;  3R4K A;  3K1M A;  2F2E A;  1K6O A;  1NK2 P;  1QHG A;  1I6X A;  4C3H J;  3DWL E;  2Y69 H;  2WAQ N;  4JP0 A;  5E1Z B;  3Q0W A;  2E19 A;  3R0A A;  3P5J A;  3R61 A;  4WXC A;  3PO3 J;  1I1S A;  2DYR H;  4MTD A;  1BW5 A;  1MBJ A;  2LP0 A;  3EUH C;  1ZRF A;  2VT2 A;  4LD5 A;  2A5Y B;  3WTU C;  5L3G A;  1TQP A;  3GTO J;  2AHQ A;  1JUM A;  2DTZ A;  3LQR A;  3MKZ A;  3CLO A;  1KU7 A;  4G7O F;  2LYC A;  2XHK A;  2NS8 A;  5EZG A;  4RB0 A;  4M72 A;  2CS3 A;  2JWT A;  2XAU A;  2DBB A;  4WCG A;  1STZ A;  5D4R A;  5LHG A;  3WTZ A;  1H9G A;  5GAH J;  5IP7 J;  3JSO A;  3HOU J;  3A4C A;  2QQ9 A;  2QQ8 A;  2ZJQ F;  2ZSI B;  3BR3 A;  2VKH A;  3HC7 A;  3RPU A;  3T1B A;  3ZQI A;  2E35 A;  2MA3 A;  5DDG A;  4I02 A;  1H88 C;  3GXO A;  4PGG A;  3WE2 A;  3L2Q A;  3PM1 A;  1EH8 A;  4G8X A;  2V6C A;  1P7J A;  3HKZ A;  3IWF A;  4NC6 A;  2VBY A;  2QSH X;  2JPC A;  2FBK A;  3S2H J;  2R93 J;  4XBF A;  1ZGW A;  4GGG A;  4PDK A;  5F0H A;  3CD6 I;  3CCL I;  5LGT A;  3KEO A;  1XB4 A;  3HHG A;  2Z33 A;  2R5Y A;  4M3F A;  1H8A C;  3ZR8 X;  4A0Y A;  4IRG A;  3GZN B;  3HZJ A;  3LSI A;  1A6I A;  3QYF A;  3CCR I;  4HF1 A;  3BTJ A;  3OWT A;  3RDI A;  1U9O A;  4ETS A;  3VOD A;  3R60 A;  4CCK A;  3QRF F;  1VQK I;  5FB2 A;  3S17 J;  2HOS A;  2XPV A;  4OAZ A;  5EZH A;  1UZC A;  3LSP A;  4HV6 A;  1X2M A;  3L1P A;  3BG9 A;  3Q5F A;  2H09 A;  3I58 A;  2IBD A;  4J01 A;  2E2I J;  3BLY A;  1FC3 A;  5FFZ A;  5FD6 A;  1X1B A;  5HVQ C;  5K5Q A;  4KIS A;  4O5V A;  3IHU A;  3IP4 B;  2MYS A;  3CCQ I;  4IL6 C;  2DTR A;  3QYB A;  1MMD A;  3ERM A;  4YG2 F;  2M7A A;  2HYF A;  4G7Z F;  4UY8 I;  3RZO J;  2X1E A;  5E1X A;  2FXA A;  2IXS A;  1Z05 A;  2WAQ A;  3ECO A;  4A0Z A;  4P9F A;  4L9N A;  1HW1 A;  1Z7U A;  4MNU A;  3CC2 I;  1X1P A;  1Z67 A;  3ZCO A;  2E34 A;  2H8W A;  4U0V A;  2ZKZ A;  2IGM A;  1SFU A;  1X1A A;  2JZY A;  3QOD A;  4FIS A;  3UR3 C;  3KET A;  2GXA A;  5DCF A;  3I71 A;  5H6Q A;  4D1Q A;  4KJZ A;  3HTS B;  2JRT A;  1X58 A;  4G6T B;  1JKR C;  4I0B A;  3SZP A;  4HPQ A;  3S2W A;  3N05 A;  1T56 A;  2X9D A;  3K4L A;  4XLN F;  3J81 K;  3BTI A;  4B1R A;  3F9K A;  4HZF A;  4A3I J;  4KUM A;  2CQK A;  2DA6 A;  1JT6 A;  1VI0 A;  3G2B A;  2KP6 A;  2PG4 A;  4BQN A;  2NVQ J;  2HWV A;  2MC3 A;  2VB6 A;  4YFK F;  2VJJ A;  1MBF A;  3A0H C;  1TT0 A;  4NQW B;  1X3Z B;  1I39 A;  1ZAR A;  4N4N B;  3B73 A;  2VKD A;  1YS6 A;  4RB3 C;  1K78 A;  4F93 B;  3ZQH A;  2FNA A;  4MGR A;  3I3L A;  3ZN0 A;  3GYH X;  2IW5 A;  3FXJ A;  4RGR A;  1ZYR F;  3MZ8 A;  2Y9Z A;  3PNV A;  1BJZ A;  2JSP A;  3HRT A;  3OYB A;  3FZV A;  3ZMZ A;  3KPH A;  1RRJ A;  1I3A A;  2LBF A;  1ZGA A;  1TT5 B;  2W85 A;  3QYE A;  1P4X A;  4XSX F;  3L2V A;  2CQ7 A;  2R7D A;  2PN6 A;  2FUG 2;  3O6B B;  4D7M A;  3IV5 A;  1QVU A;  2GZW A;  3FWE A;  3K10 A;  1RR8 C;  1DGW Y;  4IHX A;  1YHQ I;  1W4M A;  2LK2 A;  2DOA A;  4B47 A;  4DYR A;  2JN6 A;  2L7K A;  4Q4Z F;  5LGU A;  4WXD A;  5EYR A;  5CVU A;  1OKR A;  4MQ9 F;  3LNQ A;  4UB8 C;  1HBX G;  1K79 A;  3NEU A;  3RQ4 A;  5F08 A;  3MD2 A;  1IXC A;  3LA7 A;  4H0E A;  2R7Q A;  1FMV A;  1S72 I;  2BY0 A;  4NDL A;  4KIB A;  4Q47 A;  2DXI A;  1D3Y A;  1XC5 A;  2VAS A;  1QZE A;  3GUD A;  1PP8 F;  2VE8 A;  2EA2 A;  4M3D A;  4MFE A;  4D5C A;  5M5W J;  2QM3 A;  3LL7 A;  1O7F A;  2WBM A;  4DJA A;  2VJ4 A;  5L3F A;  1Q1H A;  2F5E A;  5FKM A;  1WJB A;  2IA1 A;  2ME0 A;  2F6C A;  1ETW A;  1KA8 A;  2M3A A;  3J7Y J;  1S9H A;  2EH3 A;  4M73 A;  5DCM A;  2JA6 J;  1JHH A;  4M3G A;  3GTM J;  2V9P A;  3E1S A;  2R7W A;  4OOI A;  1AHD P;  4WF2 A;  4EEF G;  3S15 J;  3H36 A;  3ECH A;  4G9Y A;  2AQF A;  2XVC A;  1VQ9 I;  4HOB A;  2GOX B;  3O3K A;  1GT0 C;  1EH6 A;  4A3K J;  2LNB A;  3JRI A;  1DDN A;  2VXZ A;  4DW6 A;  4RM3 A;  2RC4 A;  3VSL A;  4EJW A;  5ILV A;  4LLG F;  4JK1 X;  1ERD A;  3T8R A;  3KLN A;  2E1M B;  3OYM A;  3GZ5 A;  1HKS A;  4S0H B;  3H5A A;  2O8K A;  2EIJ H;  4HW0 A;  2ESH A;  4D5F A;  2WAD A;  4L18 B;  1UHW A;  2FU4 A;  1UMQ A;  2K9S A;  2EIK H;  1TNT A;  3OYN A;  2FEZ A;  4M3E A;  2O0Y A;  3HSF A;  1WHU A;  4I99 C;  4RLF A;  2W4S A;  1QHH D;  1FY7 A;  3C2G A;  5FLX Z;  3DTI A;  1Z21 A;  1U8R A;  2WV1 A;  4XKV A;  1O3T A;  5F64 A;  1BOA A;  4LG3 A;  3ASO H;  2HNH A;  2I8D A;  1ETK A;  1Z9C A;  3QAH A;  3QOE A;  3HBL A;  2M0M A;  4OWR B;  2X4H A;  3KFW X;  2NOG A;  2ZJR F;  1IO2 A;  4BE0 A;  2OAZ A;  4P55 A;  1WFX A;  3UKG A;  4HNU A;  3RQI A;  2E71 A;  1TWA J;  3C2B A;  5TJJ A;  3KEQ A;  3G6E I;  2Z2S B;  1BL0 A;  1WJA A;  2VOO A;  3D0S A;  2V9K A;  2CYY A;  1KYZ A;  2CQQ A;  2L54 A;  5L3C A;  3IKV A;  1SC7 A;  2KRC A;  1RUO A;  2Y30 A;  2VON A;  1U0J A;  1UJ8 A;  3FMQ A;  4X0G A;  2RGV A;  4A6E A;  2K4J A;  3J80 Z;  2UUZ A;  2P7C B;  2M87 A;  3DCF A;  4A3E J;  2E2J J;  3TED A;  3N4M A;  2IS1 A;  4YEL A;  1FP2 A;  2Y0S N;  4LJZ F;  2M8G X;  3GFJ A;  3H0G J;  2H1K A;  4KFC A;  1HC8 A;  2UZK A;  1D5V A;  1MMA A;  2E36 A;  2NYX A;  4OIO F;  1NG7 A;  3HOT A;  1XGS A;  2W00 A;  1D8K A;  3ASN H;  3DPL C;  3LSM A;  5J6X A;  3F8C A;  1LUJ B;  4F7Z A;  1HA8 A;  3TO6 A;  2VE9 A;  3GLX A;  4XRM A;  3MKL A;  2KRF A;  2OCE A;  1BC7 C;  2RN7 A;  3A01 A;  2VN2 A;  4GFB A;  2EFN A;  4U0W A;  5J4Y A;  2MLK A;  1F1Z A;  2EFO A;  1ONV A;  1ULY A;  3OR1 C;  3RKX A;  2PFB A;  2P4W A;  1SMT A;  1OLT A;  1G8X A;  2F5F A;  2G0E A;  2VBX A;  3U2R A;  1YIJ I;  2A6T A;  2HDC A;  4ZTF A;  3M4O J;  1HLV A;  2L9N A;  1LE8 A;  2EBI A;  1Z3Y A;  3L2R A;  1R6R A;  1J09 A;  1XSX A;  3K2A A;  2GWR A;  2Z99 A;  4RAF A;  3TDU C;  1P92 A;  2LH9 A;  2L4M A;  4BUP A;  4L5J A;  1OR7 A;  3C7J A;  3BR6 A;  2A6H F;  5GP9 A;  3M1C A;  3FHN A;  1VFC A;  5FRM A;  3DFG A;  1IJW C;  1D0Z A;  4GO1 A;  3CLQ A;  5KCM A;  5K1Y A;  1BM9 A;  1QNT A;  3PQK A;  1YX3 A;  5GAD J;  2PMZ N;  2XF7 A;  1OJL A;  5M5X J;  4ENK A;  4BKX A;  1YRN B;  3EUH A;  4HYE A;  4BYY A;  4MQV A;  5E3L A;  1FEX A;  1FZP B;  3FXK A;  4R79 A;  1VQM I;  4AD9 A;  3F23 A;  3ZMV A;  1P9Q C;  3AL0 C;  3ZQQ A;  2GA1 A;  1IN8 A;  3FXU A;  2V79 A;  2NVY J;  3ZMD A;  2DYS H;  2AXL A;  5TIS C;  2HKO A;  1W5T A;  2NXN B;  3PJR A;  3J7A Y;  5B66 C;  2ZXI A;  2VPL A;  4NQW A;  2ZXH A;  2DN0 A;  3QU6 A;  3TOA A;  4HQM A;  5DV5 A;  3LSH A;  2VKE A;  4DGW B;  4IZZ A;  3HOS A;  2KRH A;  5JLX A;  3U9G A;  1T8I A;  2HZT A;  2P0W A;  1C0W A;  5IPA A;  5JI6 A;  1E3P A;  5BS6 A;  1B8I B;  1IC8 A;  3MWM A;  1W5S A;  2AS5 F;  4D7N A;  3TO7 A;  2E7W A;  4U7D A;  4LFU A;  1WH5 A;  3FK7 A;  1OIS A;  3ISP A;  3GVA A;  1I5Z A;  3K4N A;  5E18 F;  4RAZ A;  4BGD A;  1IN5 A;  1Y8Q B;  1TWG J;  2UV1 A;  1TC3 C;  3Q3S A;  4KDP A;  2BY2 A;  5DD8 A;  2BGC A;  1PJR A;  1T33 A;  3ONQ A;  5FJ8 J;  1BIA A;  2JK3 A;  2YU3 A;  3A01 B;  2QSF X;  3BQY A;  3I55 I;  5HS9 A;  2DJI A;  4YII A;  4EJO A;  1U5T A;  3E6M A;  5LHH A;  4ZYG A;  3FX3 A;  3LA3 A;  3F8F A;  4FX0 A;  4DQ2 A;  3JR9 A;  1W0T A;  4M6X A;  2ZME C;  2X6X A;  4CXF A;  5M5Y J;  1I27 A;  1UB9 A;  2K7L A;  2LG4 A;  1ENH A;  4WX9 A;  2ME6 A;  1XGN A;  1J59 A;  3P9K A;  2ECC A;  1Y56 A;  3HIF A;  3LSJ A;  3IL2 A;  1FMW A;  3M7G A;  5E3O A;  3K6G A;  3RI4 A;  1GXQ A;  1IF1 A;  3PL8 A;  2X1D A;  3LSK A;  3X2Q H;  4CCL A;  3V8L A;  1T38 A;  1XX5 A;  3G73 A;  4FCY A;  1G4D A;  1KU3 A;  3DV8 A;  3DF8 A;  4FE4 A;  3S1M J;  5LGN A;  1BI0 A;  4XOR A;  3JAM Z;  4AM3 A;  2ZNY A;  2XKP A;  1IRG A;  3IWZ A;  5E8G A;  1O3R A;  3JRA A;  1Y0U A;  1ETV A;  2GIZ A;  1FLI A;  1UFM A;  2K85 A;  2VBW A;  1UST A;  3E6B A;  2FX0 A;  4ZJZ A;  3S1R J;  2CV1 A;  3K69 A;  4Y33 A;  2V1N A;  2EV5 A;  3D1N I;  1WJE A;  3T5X A;  3FDY A;  4DYC A;  4C3I J;  4PSW A;  1E2X A;  3DBR B;  1ORK A;  3EYY A;  2X0L A;  4EJT A;  2OTL I;  1RR7 A;  3QPH A;  4E7S A;  2L2O A;  5GTH C;  5JFR A;  3W6K B;  3K0L A;  1VQO I;  2ZXW H;  4BDZ A;  2X6W A;  1NH3 A;  2KL4 A;  3FXQ A;  3K4B A;  1Z91 A;  2LKP A;  1TLH B;  3CUO A;  2CFX A;  4IQJ A;  2KQR A;  4C30 A;  3DBL B;  3OIQ A;  3SHF A;  4LB6 B;  3SZG A;  3J7Z I;  3H9J A;  4KIG A;  3CCM I;  1XG1 A;  3C3W A;  3K4M A;  3LFU A;  2JT1 A;  3HXL A;  1YRN A;  1E3O C;  1F43 A;  3QWL A;  3M07 A;  4ESJ A;  1BBY A;  2GA2 A;  5ED4 A;  1R23 A;  2EZK A;  3GW2 A;  4EM1 A;  3G4S I;  2QQA A;  5AIP A;  1EF4 A;  4DZJ A;  1AOY A;  4HX4 A;  1QZY A;  4GDF A;  1BI2 A;  1ON1 A;  1HDP A;  1K4S A;  2CV2 A;  4RDU A;  3ULQ B;  4YRV A;  4E6K G;  2KLO A;  3CTA A;  3Q9V A;  2L4A A;  3ZQL A;  3F0C A;  3E5X A;  4XLA A;  1O4X A;  1RI7 A;  2Y2Z A;  3PUB A;  2IT0 A;  5FRN A;  5EF6 A;  2JA2 A;  5K5O A;  1Y8R B;  5D5W B;  5HOD A;  3OYG A;  3TW7 A;  4F55 A;  1Y6I A;  4PZJ A;  1KZH A;  1V5E A;  3FHZ A;  2DT5 A;  1W7P B;  4FQG A;  5IP6 A;  5BMZ A;  3V42 A;  2DK8 A;  1FYM A;  2FBI A;  2J5P A;  1W7P D;  4UUT A;  4B3A A;  2IPQ X;  4AU7 A;  2M0C A;  3W2V A;  1CF7 B;  4KT5 C;  4JYK A;  3I59 B;  1HKT A;  4GXO A;  3N97 A;  4RGX A;  3CJR B;  1X19 A;  3PIP F;  2VLA A;  4Q48 A;  4E7Z A;  4BHC A;  1O3Q A;  4HX8 A;  2M4K A;  3W6J B;  3LSG A;  5IYC J;  1JHF A;  2I10 A;  1FOW A;  3TOB A;  1XCV A;  5AIQ A;  5A2Q K;  3DEE A;  3EET A;  1V3F A;  2LSO A;  4I98 B;  2LD5 A;  4EJU A;  1LQ1 A;  1SFO J;  3DU6 A;  5FLM J;  2FD5 A;  2HZD A;  4PUS A;  2JMW A;  5B1B H;  3GEZ A;  4KNY A;  3AFH A;  3UNG C;  3RTR A;  4NC7 A;  4E7L A;  2QKL B;  3V7S A;  4XN0 A;  2RQQ A;  3GTP J;  4KA4 A;  2WWY A;  3PO2 J;  1B9M A;  4BEH A;  2KHM A;  3ZRG A;  1G3T A;  3RIR A;  3F72 A;  4LG0 B;  1DGR M;  3LAJ A;  3RKW A;  2LY2 A;  1MND A;  3GCM A;  3KP3 A;  3EUK L;  1WJ5 A;  2R4G A;  1VQ4 I;  3LWF A;  1HOM A;  2MFZ A;  3CJN A;  2KJC A;  4FAS D;  5EJC A;  2LKX A;  1UHS A;  2P7V B;  1G3W A;  4AWX B;  1A36 A;  4BBS J;  3HM5 A;  2ZXJ A;  2LRD A;  1MMS A;  2ISY A;  1WJF A;  2CG4 A;  4A3G J;  4L9J A;  1WSU A;  5DTD A;  2HPM A;  2R7R A;  4IHS A;  2M5W A;  1QRY A;  5A2Q Z;  1REP C;  2JA8 J;  3ZOB A;  1YW7 A;  3PQJ A;  2ID3 A;  5HS7 A;  2DCE A;  4LIU A;  2PJP A;  1R22 A;  2XSJ C;  3K2Z A;  4ITV A;  3HL2 A;  3P7N A;  1TZL A;  2DPU A;  2IEK A;  2X1C A;  3FXL A;  3P9I A;  5B5E C;  2A07 F;  4OIQ F;  2AQE A;  4RMN A;  1UEL B;  3TW6 A;  2XGC A;  2OPT A;  2HQN A;  2HU9 A;  1MMG A;  4L5E A;  2ISZ A;  4KIF A;  4TV7 A;  3HOW J;  3COA C;  1BR1 A;  4LGW A;  1V54 H;  3AG3 H;  2XIG A;  1IXR C;  4BJ6 C;  2M34 A;  1R1V A;  2NVU B;  2RV8 A;  5EGO A;  2EZI A;  5FKN A;  3OL4 A;  3HUG B;  3KP2 A;  2PMZ A;  3JRE A;  4M9S A;  5CVJ A;  4RGS A;  2CQN A;  2OF7 A;  3VEP A;  3ZMT A;  4BH9 A;  2VIX A;  3DKW A;  1XPX A;  4KIC A;  4Q5S F;  5LLQ A;  1MBH A;  3BJA A;  2ZJ2 A;  3V7C A;  5ICC A;  2XB0 X;  1DQU A;  1IV6 A;  5FGM A;  3OY9 A;  2KIQ A;  4A6D A;  2LOO A;  4F92 B;  2JQ7 A;  2NOJ B;  3QU3 A;  3SXY A;  2CGP A;  3DU5 A;  5GAG J;  3W2W A;  5B1A H;  5E8I A;  2NVT J;  4PGH A;  3I56 I;  3HPG A;  2LRE A;  2ZCW A;  1A31 A;  3Q0U A;  4LK0 F;  4XLH A;  3E6C C;  4L9T A;  1W1W E;  4NB5 A;  3OYA A;  4ESB A;  2ZBK A;  3J81 Z;  4BE2 A;  3L2U A;  2P5L C;  4Y13 A;  3Q0V A;  1IRX A;  1WVR A;  4G7H F;  2L7M P;  4J00 A;  4WXH A;  1EH7 A;  3TGN A;  3H5N A;  3I9V 2;  5CLS A;  2RDP A;  3BP8 A;  4PJ0 C;  1TBX A;  1LDD A;  1JXS A;  1MD0 A;  3FM5 A;  3L2C A;  1MZB A;  1XMA A;  4PFO A;  1D8J A;  3IUO A;  2BEO A;  1MBK A;  1U6G A;  2XKO A;  3CCJ I;  4IO9 F;  1APL C;  2KZG A;  4O6J A;  5K5R A;  2COM A;  3REO A;  2DT7 B;  5LBQ A;  3MKW B;  1UG2 A;  1NHA A;  1ITY A;  2DT6 A;  4G6Q A;  4HLY A;  3CC4 I;  1ZG3 A;  3MZY A;  4BAC A;  1OPC A;  4A3F J;  3ERE D;  4EJV A;  4HRI A;  2MW8 A;  2ADU A;  4RAG A;  1JUS A;  2M4G A;  3OYK A;  4CH7 A;  3DPU A;  4BHB A;  3BPX A;  1SD7 A;  1AKH B;  4RAY A;  1T2K A;  2GXG A;  3GFM A;  2H6C A;  2VI6 A;  1H0M A;  1B1B A;  1USS A;  1OYY A;  3RZD J;  1HW5 A;  4IKF A;  4A0X A;  2M2E A;  3G1M A;  3HOZ J;  5E3N A;  3DLA A;  2RQP A;  4UUS A;  4A12 A;  3HUG A;  1Z6R A;  2M8E A;  5CJ9 A;  1B8I A;  1NK3 P;  3JAM K;  2GM4 A;  1G2H A;  4BQQ A;  2VC0 A;  2MD5 A;  5HOO A;  1RKT A;  3I64 A;  3FKJ A;  4N9H A;  1PUF A;  3BZ6 A;  3CP2 A;  3HKZ N;  1RKW A;  3OL3 A;  1R9T J;  1MKM A;  5C3E J;  2X85 A;  4UB6 C;  4RGU A;  1VQ8 I;  1F36 A;  5D5X B;  4CYC A;  1WPK A;  2I5U A;  1HW2 A;  4IF4 A;  1IN4 A;  1PDN C;  3KX2 A;  2UXN A;  2B0L A;  1YIO A;  3AG4 H;  1W7P A;  4QIW N;  4I2O A;  4HQE A;  2V9V A;  2IS4 A;  5H6R A;  3ESW B;  1X4O A;  3S3M A;  3S1N J;  1P4W A;  5D5V B;  5LRS A;  1R4M B;  2FA5 A;  1RPW A;  3BR1 A;  4II2 A;  2LDU A;  2RKH A;  2VT3 A;  1YFH A;  2QQB A;  2O8X A;  2IS2 A;  2AXT C;  1GV2 A;  1O3S A;  4R8H A;  2CSO A;  4M3B A;  3HRU A;  2BBY A;  2K4B A;  4U87 A;  3HHH A;  4XOT A;  1U3E M;  5HDG A;  4RB2 C;  4ENM A;  2MC4 A;  4A2U A;  4IJA A;  2NS0 A;  4CYD A;  3VYU B;  2XDV A;  1AWC A;  2ZB9 A;  4XL9 A;  2JRM A;  2MBF A;  3OOU A;  1LVA A;  3SFZ A;  5JVG F;  2HS5 A;  4M9Z A;  3DBH B;  1J75 A;  1LB2 A;  2R7U A;  3I54 A;  4ZZD A;  3M8E A;  1QA6 A;  2VPR A;  2NVX J;  3DLL F;  4IHT A;  4CSW A;  2PLY A;  4C2M J;  1ZAO A;  4F91 B;  5D8K B;  2VQC A;  2O03 A;  3OIP A;  2V26 A;  3ZQG A;  1Z6T A;  2WV0 A;  4ANJ A;  3H1C A;  1E17 A;  3MEX A;  4P9U A;  2D1V A;  2W84 A;  2LC2 A;  1AA7 A;  1V4R A;  4XLC A;  3I59 A;  2FOK A; 
#chains in the Genus database with same CATH homology
 3HOS A;  2KRH A;  2LBF B;  4B3X A;  2P0W A;  4ZDO A;  2ELJ A;  2K3P A;  1EA3 A;  2A5W A;  2O5R A;  3VDX A;  3H35 A;  1SFK A;  3PNY A;  2ZFU A;  3OYE A;  3OYH A;  3CZ6 A;  2Z16 A;  4B44 A;  4BJT A;  2L5Q A;  4DBR A;  3K4N A;  4BGD A;  5JHF A;  1D1A A;  3DKX A;  4NUB A;  4XN3 A;  4ZYA A;  2UV1 A;  4PJL A;  1K6Y A;  2WA0 A;  1PJR A;  3ONQ A;  3TBI A;  4E7I A;  1KON A;  4BE1 A;  3A2K A;  4QPO A;  3DQV C;  4BS9 A;  2PJR A;  2VQG A;  1D0Y A;  3OYJ A;  2Z1D A;  2DJI A;  3DPT A;  3CMM A;  2F5V A;  4XMY A;  4BQO A;  1JI8 A;  4BXF A;  3KYL A;  2X6X A;  1ZEL A;  2LG4 A;  3H9G A;  4CCJ A;  1N77 A;  1QHG A;  1Y56 A;  5HNF A;  3DWL E;  1FMW A;  3K6G A;  4RLQ A;  3PL8 A;  2X1D A;  3LSK A;  4CCL A;  3FBI B;  2K5C A;  3EUH C;  4KT6 A;  4PSX A;  3U21 A;  3K4J A;  2R7S A;  3L2W A;  4XOR A;  4BL0 B;  4XON A;  2R7O A;  4PJM A;  3MKZ A;  2LYC A;  2CS3 A;  2W82 A;  4ZJZ A;  2CV1 A;  2XAU A;  4AVZ A;  2K9M A;  4Y33 A;  2V1N A;  4E7J A;  4DBQ A;  2JUG A;  1WJC A;  1WJE A;  3K4C A;  3FDY A;  3A4C A;  1WJD A;  4PSW A;  2ZSI B;  4EAT A;  3SEZ A;  2VKH A;  3HC7 A;  2W7N A;  2PJR B;  2X6Y A;  4E7S A;  5KHD A;  2L2O A;  1DP3 A;  2UWM A;  3L2Q A;  3TL4 X;  4CA0 A;  4C2T A;  3HKZ A;  4BDZ A;  2X6W A;  2KL4 A;  3AL0 B;  3K4B A;  2BOL A;  4IQJ A;  2KQR A;  2IGO A;  4C30 A;  2R7V A;  3OIQ A;  4HNT A;  4ZTJ A;  3SZG A;  3ZR8 X;  3H9J A;  4XKC A;  3K4M A;  3LFU A;  3LSI A;  3HXL A;  3QYF A;  3OWT A;  4JOM A;  3S3N A;  2VJ5 A;  1Z7L A;  2OV7 A;  4CCK A;  3IAM 2;  3MMY B;  1LKX A;  4OAZ A;  2CFO A;  4H4K C;  4XOP A;  4J01 A;  3BLY A;  4CCO A;  4KIS A;  1X1B A;  5HVQ C;  3BG7 A;  2CV2 A;  3IP4 B;  2MYS A;  4XQF A;  4YRV A;  4GRI A;  3QYB A;  1MMD A;  4E6K G;  2M7A A;  2KLO A;  2MD0 A;  2VQH A;  2IXS A;  2WAQ A;  2X1E A;  2M7B A;  3PFY A;  3OS1 A;  4IQ4 A;  5CPR B;  2RRE A;  1YE9 A;  4XLA A;  3ZCO A;  4C2U A;  2HVQ A;  4PK4 A;  3K4K A;  3PUB A;  2IGM A;  5FRN A;  1X1A A;  2JA2 A;  3QOD A;  3UR3 C;  2GOM A;  3OYG A;  4NC8 A;  3BG6 A;  4FET A;  4F55 A;  1Y6I A;  1V5E A;  4D1Q A;  4KJZ A;  4G6T B;  4HPQ A;  3N05 A;  3K4L A;  2WB1 A;  3V42 A;  2BW3 A;  2E60 A;  3RCO A;  3F9K A;  4C9Y A;  1W36 C;  4AU7 A;  3W2V A;  4PFP A;  1UG0 A;  4E4H A;  2KZV A;  3G2B A;  2CW7 A;  2KP6 A;  4HSR A;  4BQN A;  2R7T A;  3CJR B;  1X19 A;  2CH0 A;  2VB6 A;  2VJJ A;  2VLA A;  4XNF A;  4B48 A;  3DKY A;  2KPM A;  1TT0 A;  3RSN A;  3VYT B;  4NQW B;  3VYR B;  4E7Z A;  2M4K A;  4N4N B;  2VKD A;  3LSG A;  2KDO A;  3OYD A;  4ZC3 A;  4F93 B;  4HST A;  2WY7 Q;  1T95 A;  4XKB A;  4MLO A;  1UAA A;  3DEE A;  3I3L A;  4DGW B;  3H9Q A;  3DU6 A;  3NWT A;  1X1D A;  2HZD A;  4PUS A;  3NWS A;  3OMY A;  3PNV A;  2JSP A;  3AFH A;  3UNG C;  3OYB A;  3FBN B;  3RTR A;  2LBF A;  1N75 A;  1BR4 A;  3BCA A;  4NC7 A;  3SDB A;  4E7L A;  4N4O B;  2QKL B;  3CF2 A;  3QYE A;  3L2V A;  4XN0 A;  3S3O A;  2RQQ A;  2WAE A;  2V6E A;  4YEJ A;  2FUG 2;  4BEH A;  2KHM A;  3ZRG A;  3K10 A;  2VQL A;  1N78 A;  1DGW Y;  1DGR M;  5FRO A;  2DOA A;  4B47 A;  2LY2 A;  1MND A;  2L7K A;  3EUK L;  1WJ5 A;  2R4G A;  4XR6 A;  2BW3 B;  2MFZ A;  4FAS D;  4LIT A;  2W1O A;  2LRD A;  4E7K A;  3RQ4 A;  2XC7 A;  1WJF A;  3MD2 A;  3IAS 2;  3CES A;  2R7Q A;  4BJ5 C;  1FMV A;  2R7R A;  2CUJ A;  4LIV A;  2HPM A;  1V5G A;  2DXI A;  2VAS A;  3OYL A;  2E5Z A;  3D5L A;  3LL7 A;  2WBM A;  2DCE A;  2LY1 A;  2VJ4 A;  4LIU A;  3VSK A;  4DJA A;  4DOZ A;  2XSJ C;  4ITV A;  1WJB A;  3HL2 A;  5HNH A;  1TZL A;  2X1C A;  2BVL A;  2F6C A;  2M3A A;  2AQE A;  2ZSH B;  2CMP A;  4CZC A;  1S9H A;  4RMN A;  4ZDL A;  1D1C A;  5CKT A;  1UEL B;  5TGT A;  4CUG A;  1D0X A;  2QKM B;  3E1S A;  5CQG A;  2R7W A;  4Y4R A;  2HU9 A;  2HQA A;  1MMG A;  1V5F A;  2V7F A;  2AQF A;  1BR1 A;  2GOX B;  2JVG A;  4F52 A;  1OR7 C;  4XLC A;  2L9S A;  2XF6 A;  4BJ6 C;  4HEA 2;  2VXZ A;  2K9L A;  4RM2 A;  3K70 C;  4RM3 A;  3HG9 A;  2IGN A;  4XLE A;  2X51 A;  3VSL A;  5KNL A;  1LVK A;  3OL4 A;  2CV0 A;  3HUG B;  4DIQ A;  2PMZ A;  4PJN A;  1ERD A;  1BR2 A;  2E1M B;  3S8P A;  2JVH A;  3OYM A;  5CQE A;  2VIX A;  3H5A A;  2WY8 Q;  4KIT B;  2R7X A;  2WAD A;  3H0D A;  4IX7 A;  3HPH A;  1DQU A;  3OY9 A;  4E7H A;  1QU3 A;  2LOO A;  3W3C A;  3OYN A;  3MKY B;  3H5R A;  4F92 B;  2NOJ B;  3S93 A;  3DU5 A;  4RLF A;  3W2W A;  4Y3O A;  2W4S A;  4P5O A;  1QHH D;  3C2G A;  3DTI A;  3HPG A;  1Z21 A;  2Y0S A;  5LD2 C;  2LRE A;  4XKV A;  2VJI A;  4LG3 A;  2HNH A;  2I8D A;  1X4P A;  3W2A A;  4XLH A;  3VYS B;  3PNT A;  3QOE A;  4OWR B;  2M0M A;  1VZ0 A;  3OYA A;  4BE0 A;  4BE2 A;  3L2U A;  4XM3 A;  1WFX A;  1IRX A;  4HNU A;  4J00 A;  3D5S C;  3H5N A;  3RPU D;  3I9V 2;  3BCB A;  4XLF A;  1W36 D;  2Z2S B;  3PSF A;  1WJA A;  1T0F C;  2V9K A;  4PFO A;  3IUO A;  3VWB A;  2KRC A;  1LFP A;  1U0J A;  2Q2E B;  1X1C A;  4X0G A;  2DT7 B;  2KMU A;  3MKW B;  3ZXS A;  3K70 D;  4XKW A;  2DT6 A;  2UUZ A;  3EPZ A;  1MNE A;  4BAC A;  2IS1 A;  4YEL A;  3AKZ A;  4CCN A;  4HRI A;  2OUM A;  5LFA A;  1MMA A;  2VXD A;  3SEQ A;  2M4G A;  3OYK A;  2Q1Z B;  4CH7 A;  3DPU A;  1NG7 A;  3HOT A;  1G59 A;  2W00 A;  3GBG A;  2HVS A;  3DPL C;  2HDW A;  3LSM A;  1E0E A;  4IKF A;  1HA8 A;  4B43 A;  3C2H A;  3OYI A;  3DLA A;  2V4J C;  2HPI A;  4BU2 A;  4AYB A;  2E5N A;  1LDK B;  2F4I A;  3DTK A;  4BQQ A;  5HOO A;  3OS0 A;  3FKJ A;  4P1W A;  3E0J B;  3OR1 C;  3CP2 A;  2OC6 A;  1SAU A;  3DTE A;  2E1M C;  2IS6 A;  1OLT A;  1G8X A;  3OL3 A;  1YX5 A;  2A6T A;  2X85 A;  4ZTF A;  4HG2 A;  1MMN A;  3A1Y A;  3TMO A;  2MAB A;  1NG6 A;  2L9N A;  3ZGK A;  1Z3Y A;  3L2R A;  1R6R A;  2XF5 A;  3KX2 A;  1J09 A;  2LH9 A;  3KEY A;  4D9J A;  4BUP A;  2VL8 A;  2IS4 A;  2WAF A;  4PJJ A;  1PYV A;  1X4O A;  3S3M A;  1D1B A;  1GLN A;  3M8J A;  3PSI A;  3M1C A;  3FHN A;  4II2 A;  5FRM A;  1MW7 A;  1D0Z A;  1Z3X A;  5KCM A;  4BEH B;  4BDY A;  1YX3 A;  2IS2 A;  3D5R C;  2XF7 A;  4U87 A;  4XOT A;  3LMM A;  2CUZ A;  4U7B A;  2MC4 A;  3OS2 A;  3VYU B;  2XDV A;  4R79 A;  1BOB A;  3S32 A;  3OR2 C;  4XL9 A;  4QPQ A;  1P9Q C;  3AL0 C;  3ZQQ A;  3OOU A;  4NNJ A;  4II3 A;  2R7U A;  4ZDP A;  5HLT A;  3PJR A;  4CCM A;  4CSW A;  2BVM A;  4JQF A;  3J7A Y;  4F91 B;  2ZXI A;  2VQC A;  3OIP A;  4OAY A;  2V26 A;  2VPL A;  3SYT A;  4ANJ A;  2HVR A;  2ZXH A;  2RNG A;  2LC2 A;  3OYF A;  3BC8 A;  3OYC A;  4F3Q A;  2CW8 A;  3CJQ B;  1AA7 A;  3CP8 A;  3EUA A;  3LSH A;  2IGK A;  4IZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...