4KT6A

High-resolution crystal structure streptococcus pyogenes beta-nad+ glycohydrolase in complex with its endogenous inhibitor ifs reveals a water-rich interface
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
254
structure length
254
Chain Sequence
GNMERDIFEKKFKEIKDKWVTDKQADEFIETADKYADKAVQMSAVASRAEYYRMYVSRKYHYKKEFVEKLKQVYKESGASHVTSKKDVMLAFDDAKRKSTIGRQENGLFVTSFAEDMALLFTDQGKLKSADQIENIKGVDSGKYSDGVYQYEYDSELTKNIDKLGYIRTASGDTPGANSLNIPGCQTWSGKHIENSESELIFPSISVKDLKSKAVLAEIDAKGYFEIIDPTIIAPNGDHKKVTGRFKIKKMQDR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Nicotine adenine dinucleotide glycohydrolase
publication title High-resolution crystal structure of Streptococcus pyogenes beta-NAD(+) glycohydrolase in complex with its endogenous inhibitor IFS reveals a highly water-rich interface
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 87
structure length 254
sequence length 254
chains with identical sequence C
ec nomenclature
pdb deposition date 2013-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1660 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4kt6A01
4KT6A 3PNTA
chains in the Genus database with same CATH superfamily
1XDSA 4MFEA 3OYDA 3RZDJ 4G6TB 1Z6RA 3HOWJ 3Q0UA 1FOKA 1N25A 4F7ZA 3FXUA 2R7TA 3BJ6A 2KL4A 3GBGA 4YFKF 4FETA 4BEHB 3R0JA 1IJWC 3NQOA 4ZDPA 1A5JA 2M9HA 4M6YA 1SEUA 2HS5A 5GADJ 4B8XA 1WJBA 2HOEA 1JJ8C 2B9SA 5BOXA 3BTLA 4A5MA 3JAMK 4J00A 2JA6J 2JVHA 3ABMH 3J81K 4IHXA 2MBFA 1D0XA 1GLNA 5AIPA 3HPGA 3K9TA 4I0AA 3BROA 3ZMVA 4C2MJ 3CZ6A 2H94A 3FK6A 3LA2A 1WVRA 1WFXA 1T2KA 2XB0X 4Y4RA 3TBIA 3TO6A 4XRSG 3CCJI 1DU0A 3QP5A 5D5VB 5M3FJ 2QLZA 5HOOA 2L9VA 1XSVA 4MEXF 2HYGD 1XTAA 2FNPA 2HVQA 2XPVA 4HW0A 3RPUA 2W24A 2GZWA 4P1WA 3CC7I 3C3WA 5J40A 5IP9J 1ZARA 2EIMH 2JA5J 3G1MA 4N9HA 3TEDA 2LKPA 3OR1C 4OWRB 3TGNA 5M5WJ 1ON1A 3J80Z 2VOOA 3JRDA 3EPZA 5FLXK 2K40A 4BS9A 2GWRA 5GP9A 4UB8C 2MYSA 3LSKA 1A6QA 4LG0B 4CDGA 4KNYA 1I3AA 2M1BA 3K7AJ 1Z67A 3OOUA 2CFXA 3DKWA 4I76A 2HPMA 4IPAA 2OAZA 4WCGA 2H1KA 3NEUA 1WHUA 2KKOA 2QQAA 2Z33A 1ETOA 3LAPA 3LSHA 2NS8A 4L0YB 2HNHA 3QPTA 4D5CA 4XKCA 2QGUA 3H3VK 2IXSA 3K1NA 1KQ9A 2VB6A 2QSHX 2M30A 2ZXHA 3AG4H 2ELKA 3WG9A 3DTEA 1HQCA 4MO7A 2M45A 2V9VA 3SDGA 1WJFA 4XLHA 4A2UA 4F55A 2GM4A 3W2VA 3BG9A 4CA0A 3VOEA 4EATA 2UXNA 1I1SA 1BN5A 3TQNA 3ZQCA 3BQYA 3LSGA 2VPLA 1LUJB 3M07A 2OCEA 5BS6A 1MNDA 3L1PA 1E3HA 1WCMJ 1HSJA 3A1YA 4CYCA 3F3XA 3QYBA 1LEAA 4BHBA 4D7NA 1K83J 1OKRA 1QA6A 2LF8A 2M4GA 5L3FA 1SMTA 2GOMA 2DXIA 2DFFA 2VPRA 3CDHA 3WU1B 2YS9A 3CUQC 1VQ7I 3KP4A 4DZJA 1AKHB 1UG2A 1XN7A 4UV9A 3HDDA 1JT0A 3DLAA 3J7AO 2E2HJ 2EJRA 4FHTA 3WTZA 5B3SH 4L0ZB 3FHZA 5FD5A 1QGPA 1JUMA 2OCCH 3QP6A 1E3PA 3E0JB 4HAMA 2XPUA 3K70C 1CF7B 3E1SA 2VBYA 4HX4A 3LNQA 4B44A 4CCNA 2B63J 1I39A 3I56I 1YJNI 2FD5A 5F27A 2DCEA 2G7HA 1ETWA 2ECBA 2R7QA 5IPAA 2JUGA 3WTSC 1T0FA 4XONA 3S1RJ 4M3EA 4XOTA 1X58A 3WE3A 2L7MP 3RPQA 3PSFA 3MWMA 3BG3A 1KU3A 2RREA 3R4KA 3IHUA 1FWZA 1FBSA 1S3JA 2CMPA 2GA1A 3LSRA 2PJRB 1BW5A 4BACA 2JRMA 3K4JA 2D2WA 1FBUA 4XKVA 2EIKH 1YX3A 1VQ5I 2M5WA 3WTVC 1MDMA 3SHFA 4NC6A 2HFHA 5EF6A 1TW2A 3KCCA 5HVQC 3I4NJ 2YU9J 2V6EA 2IP2A 1ZR4A 1ZAOA 1VQMI 2RNGA 3BJOA 4HLXA 1X1CA 4ZYEA 1IO2A 3PFYA 5D5UB 2WADA 4RGSA 4DQ2A 4A0XA 4M73A 3ERED 1SMYF 2CW8A 2XASA 5E1XA 2QVOA 3BY6A 1ON2A 3F0CA 3IKTA 2WTEA 5HS8A 5B1BH 5HS9A 2PG4A 2DFEA 4O5VA 3S14J 2E1MB 3WTWC 1YIJI 3HTSB 2F4MB 4UVBA 1VI0A 1EV7A 2DTRA 2GAUA 2OTLI 4HZFA 2IPQX 2EZKA 2ZNZA 1UHMA 2H27A 5LHIA 2K9SA 1XCVA 2DBBA 3S2WA 1QZYA 3CCMI 2VKVA 3ABKH 3LFKA 2ZJ2A 2GLOA 4NQWB 1Y39A 3M1CA 4IOCF 2X85A 4KT5C 5TRDA 5JHFA 2RAEA 2R0QC 1I50J 3MZHA 2AS5F 4A3GJ 4YFNF 2D45A 4LLGF 2V26A 5M5XJ 4CCLA 2FEZA 3T8RA 3OS1A 1HKTA 2ZSIB 3NWSA 3Q3SA 3HOTA 5DEQA 4EM2A 4ESJA 5J1UA 3WGGA 5GPCA 2FOWA 2M0MA 1HF0A 2WAEA 2ZJQF 3EYYA 2NS0A 3GCMA 3L2CA 4J01A 3DCFA 3H5AA 1LE8B 1R49A 2BV6A 1W7PD 3ZQQA 3Q9VA 3K1PA 4E7KA 1MIJA 4Y33A 4EJWA 4HDVA 1EH8A 2K9QA 4G9YA 4FTHA 2NVXJ 5IT9K 2NVTJ 2D1HA 1IDYA 5EJCA 1TNSA 3Q0VA 3OYEA 3S1MJ 2LVSA 2BXYA 2MFZA 2RQPA 3PO2J 1GVJA 2EK5A 3IRRA 2KZVA 2K5CA 4ZZDA 4CGZA 2LTPA 1PVEA 1WJEA 3VPRA 1WSUA 3TMOA 3L2VA 2E2IJ 3GZNB 4IHSA 3RQIA 1HDDC 2LREA 4I01A 2G9WA 5K5OA 2XAJA 2EFPA 2IVMA 3KYCB 4KA4A 4E7HA 4A69C 3CCQI 1QPIA 3K4KA 2LRDA 3I58A 1P7IA 2DT5A 1NG7A 2IBDA 2DODA 5ILUA 4XL9A 1TNTA 1FYMA 4O3MA 4XLEA 4BE0A 3S3MA 3PJRA 2VODA 4M3DA 3H9JA 1G8XA 1MW7A 1XGMA 3IKVA 1POGA 3R6SA 3DEUA 2BZTA 3RJPA 4XORA 4A6DA 2GIVA 2Z2SB 4V2FA 3MMYB 2YU3A 1D1BA 1A36A 4Y17A 4A3CJ 2FE3A 2ZJRF 5IYCJ 1MBJA 2Y31A 2L01A 1LDKB 1UB9A 2OBPA 1K78B 2CH0A 3ZQFA 1QRYA 4RB3C 5HS7A 2JA8J 3VEPA 5DCFA 5J8FA 1HDPA 3VB2A 1GHCA 2P6SA 5FD6A 4ZDLA 1R1UA 1TQIA 1ACIA 3GEZA 1KYWA 2QF7A 5FKNA 4R1HA 3S3NA 3GTGJ 2MD5A 4ASNA 2N8GA 4IRIA 3RDIA 1LFBA 1WJ5A 2HVSA 2MG4A 1S7EA 1D0YA 3GTKJ 2EA4A 4P9UA 2EV5A 4UV8A 4ZTJA 1J0RA 2VXZA 2PLYA 1TW3A 1RRJA 2MLKA 4HF0A 4XRSA 3HJEA 4PJJA 4BYYA 2R5ZB 1G2HA 2JN6A 4J19A 1OR7C 3S1QJ 3FM3A 1OCTC 3K2ZA 3KFWX 4ANJA 3SZPA 1BR2A 3SQNA 4Q47A 2VBWA 3DXJF 5D4SA 2H1LA 2ZCWA 4R79A 5TISC 4A3KJ 2LYCA 1D1AA 2DU9A 1B8IB 3BR3A 4NBQA 2VQCA 1W36D 4XOPA 4RGXA 5LRSA 5CVRA 4P96A 2FU4A 4BHPA 4GO1A 2FX0A 1PJRA 4LFUA 5A2QK 4D7MA 3LSPA 1H9TA 5H6QA 1USTA 2O3FA 2WBMA 3ZPLA 1W7PA 3W2AA 2X1CA 5D5XB 3KZZA 1YW8A 2P5KA 2VL8A 1F36A 1ZTRA 1ZG1A 3C2BA 2JSPA 5CVJA 4F3QA 4FISA 5FRNA 3CF5F 1J9IA 5FB2A 2OQRA 3KP2A 4N0BA 2CW0F 2XGCA 3H9QA 1HBXG 3CCEI 5EGOB 1RPWA 1DP7P 1P6RA 1YJ9I 3BLYA 3I4MJ 2VBXA 5ERIA 1S9HA 3GMEA 4IF4A 4GXOA 3IRQA 2QBYB 1ENHA 3ECHA 2K7LA 4A3MJ 5EG0B 2NVQJ 4EEFG 3V7RA 1T8IA 3KIOA 4YEJA 1BBYA 2JSCA 3K6GA 3F22A 2H6CA 2V1UA 3VWBA 2E1NA 2L7FP 5M3MJ 2K86A 4OINF 1WKMA 3DU6A 2AQEA 3WU2C 1W0UA 4AD9A 1FY7A 2QQ8A 2E34A 4RM2A 3U2RA 3GF2A 3HKZA 4A0YA 1ZGWA 1U9OA 4HRIA 3BG5A 3F6VA 2UUZA 5F0FA 3A2KA 3FMSA 3BR6A 2XKOA 3G3ZA 3RQ4A 2CV2A 3HG9A 4KFCA 5JFRA 4LLNA 2E19A 1J7KA 4IEJA 2UWMA 3FHNA 2M34A 3PNTA 2DOFA 2RC4A 1XG1A 3TO7A 4M3BA 4MLOA 3TOAA 5JVGF 2R3SA 3L7WA 4JYKA 3VYSB 1REPC 1N77A 2COMA 3ZMUA 2CGPA 1QU3A 1JXSA 3GW2A 2HVRA 4MIMA 1R5GA 2VJIA 2O0YA 2VC1A 2P7CB 1BI3A 2DFHA 3E5UA 4I6ZA 5DD4A 2MA3A 4ENKA 2R7XA 2X6WA 4D1QA 1G6NA 1T56A 1D8JA 4Q4ZF 1WJAA 1FYLA 1K61A 2MABA 2DDAA 2DLLA 1NHAA 2IT0A 4X0GA 1IC8A 4A93J 3P9CA 3BR5A 3FDYA 4B3XA 1EF4A 2V9KA 3RKQA 1DU6A 1IDZA 2M87A 3FXOA 4B48A 3WODF 1Y6IA 3T0YA 3GTMJ 4BUPA 1JJ6C 3GWZA 2LC2A 1BL0A 2IA0A 1MJBA 1GVDA 3ULQB 4OAZA 1XMKA 1O7LA 1X1PA 2F4IA 1B9NA 2L9NA 1HLVA 5GTHC 3PQJA 3EYIA 1R1TA 1ZQ3P 3CD6I 2V4JC 2JK3A 2RN7A 4LG3A 1FX7A 5CPRB 2GOXB 1UZCA 3HSRA 5IOYA 2WWYA 1YFHA 3S15J 1P4WA 3GFLA 2NYXA 1HOMA 4G7HF 4BBRJ 3J80K 1R23A 3M9AA 3HEFA 1TTYA 4GYIA 3WHBA 1YRNB 4IKFA 5CVVA 3TP3A 3H36A 3BTCA 1YX5A 2G0EA 4RAZA 4BQOA 3LA7A 3QQAA 4DBQA 3GTQJ 2ZFWA 3PQKA 3BP8A 2ZKZA 3TW7A 4BDYA 1UAAA 4MTEA 2DK5A 3O8HA 2R7UA 4LOCA 3JRAA 1MMDA 4PFPA 1GXPA 4C9YA 1AOYA 2DQRA 2NS7A 2V7FA 2XUBA 1SFEA 3HRMA 2IS2A 3ZR8X 4IX7A 2X9DA 3FM5A 4L5JA 2BHYA 2FQ4A 3K4CA 3VYRB 1BA5A 4PDKA 3L9FA 4S04A 2DMNA 2FJ1A 4LGWA 4N4OB 4XLAA 2IA2A 1R00A 4CH7A 2OPTA 4LK0F 1P9QC 3ML6A 3GTLJ 4GRIA 1UCRA 1OCOH 4XSZF 4C2UA 1MGTA 2YX4A 1T95A 5B5EC 4V19K 1OPCA 4A3LJ 1FT9A 2HXOA 1JKPC 1IF1A 1VQNI 3QODA 2H09A 4XQFA 1Z7UA 2Q1ZB 1MSFC 2A05A 2F5EA 3GUDA 3BR1A 4C3JJ 4ESBA 4A3BJ 2CRGA 3CDIA 2BBYA 4G7ZF 5BMZA 1YTYA 2DQLA 2FA5A 3G1LA 1ZYRF 4BXXJ 1JGGA 1BW6A 5HLHA 2CQXA 4PJMA 1LFUP 4I7HA 1U5TA 1WI9A 3OYHA 2IW5A 4HF1A 2R7RA 4HBLA 3HM5A 2DFIA 2PMZN 3HBLA 3JRIA 3G6EI 1YHQI 1BJZA 3MAJA 4FX0A 4G6QA 3HZJA 2BYVE 4ZC3A 3M7GA 3LAJA 2HZTA 2ZJPF 3DBLB 1KA8A 2K27A 3CP8A 2WY7Q 5FKOA 2EINH 2W57A 3ASNH 2L5QA 3QU3A 1JTXA 3HRSA 3NWTA 1B6AA 1I5ZA 3D0SA 4CSWA 2R5YB 1F5TA 1YE9A 3ZRGA 4Y52J 2HKXA 3DBRB 4NNJA 5E1WA 1SD7A 1ZRCA 3BPVA 4A0ZA 1J59A 1SAXA 3KP3A 2JQ7A 2I8DA 3V42A 5J8CA 3JRHA 2E36A 3H3ZA 1IXCA 5FGMA 3S3OA 3DPUA 2PN6A 1FOXA 3CMMA 2CV1A 1W5SA 5E79C 3K69A 3O6BB 4II3A 3B73A 4UVCA 1U8BA 4LIUA 3OY9A 1B72A 4Y7NJ 2W1OA 2GXBA 1SFXA 3EUAA 2RVCA 2A6EF 1YI2I 2PBIA 2V1DA 3F21A 2WAQN 2DAOA 4L18B 3SDBA 2HZDA 4MNUA 2A5YB 2DA3A 2M7AA 4LIVA 5CKTA 4BEHA 2NXNB 3O3KA 4XSXF 5KAIC 3JSPA 1JT6A 3FXQA 4PJLA 4ZYGA 1XGOA 2BW3A 5HDGA 4F91B 5KAFC 4LB5A 3GFJA 1JE8A 3LQRA 1OJLA 2HI3A 3FZVA 3TO9A 4EVIA 5CVUA 3EQLF 3I64A 4LITA 4KDPA 3ASOH 4RLFA 4IO9F 5E17F 3WE2A 3E3VA 3Q9SA 3REOA 2BE5F 1X2MA 3T8TA 4CZCA 5HLIA 2E60A 1OCRH 2F2EA 2HGCA 5AONA 2IGNA 2AO9A 2XROA 4U0VA 4K2EA 4RM3A 4ZH4F 1SFUA 4CHUA 1X2NA 2QQ9A 2R92J 3HGYA 1R58A 4CYCB 4M74A 2Z1DA 1LPQA 2BY3A 4H0EA 2P81A 4KICA 1QVTA 3ZN1A 5C3EJ 1JHHA 2BEOA 4XIDA 3HSFA 5LGNA 1IN7A 3NRVA 1K7AA 4IQ4A 1IUYA 1EH6A 3M8FA 2Y48A 4RAFA 2O6GE 1NH3A 4PFOA 2FBKA 2LOOA 2Q0OA 4UUTA 1E2XA 1O3QA 2TCTA 2QQBA 4I2OA 1X19A 1OQYA 2H6BA 1WGXA 2LNBA 4WWCA 5BPIA 4XR6A 4XLCA 1JKRC 1Y56A 3SJMA 2R7WA 4ENJA 5B1AH 2JMWA 5J3LA 2J5PA 2IS4A 1IW7F 1XMAA 2DOEA 2ZMEA 5FKKA 4LG0A 1PDNC 3CC4I 2VUMJ 2V6CA 3H3UA 1YJWI 2KPMA 3A0BC 2R7OA 1TWCJ 4XN3A 4QWQA 1WJDA 3E5XA 1HXDA 3FISA 1H89C 4WX9A 3D5RC 2QM3A 3ABUA 3OIOA 5CQEA 2A6HF 5E8IA 4DNCA 2WAFA 3ELKA 3C18A 3KP7A 3R0AA 1TC3C 2WA0A 2Z9OA 3K1MA 2EQRA 2Y75A 3BG6A 1XDUA 2I5UA 1Q1VA 2V9PA 2MH2A 3F72A 1TWAJ 3BR2A 3I0TA 2KJCA 4HQMA 5IYDJ 4Z2YA 2Q2EB 4KJZA 3RKYA 4EM1A 4NC8A 2NOGA 4PCQA 5EYRA 2IJLA 3FMQA 3HL2A 4CO8A 1SVMA 4IRHA 3L2QA 2W4SA 1KU2A 2WB1A 2NVYJ 1Y8QB 2LG4A 1VQKI 2W25A 2YUSA 2UXXA 3G71I 1R1VA 1N75A 1K4SA 3HSEA 1QZEA 1RKTA 4BNCA 1A31A 3U1KA 3M8EA 5GAGJ 3HGGA 2ADUA 1V54H 2E35A 1R4MB 2Q8KA 3CJNA 5IYBJ 1Q1HA 1AKHA 2PMUA 1UELB 4DZPA 4OOIA 4G6DA 3CCSI 3HXLA 2LR8A 3V7SA 1BJAA 1J09A 1Z21A 2KRCA 3PSIA 2FXAA 2R93J 3FBIB 3CF2A 3D5SC 4EM0B 3ZQ7A 3CMAI 2M0CA 2WV0A 2O8KA 2Y2ZA 5IP7J 2JWTA 2HTSA 2MH9A 4GYGA 5H2FC 2Y0SA 1O3TA 3JW4A 5BQTA 4N4NB 3O8GA 1IV8A 1IRFA 4S0HB 4ENMA 4HX7A 2DA4A 5DM6F 1FZPB 3FXKA 1FP2A 1IN4A 2M8EA 3FXMA 5L3EA 1QBJA 3CJTB 4UY8I 1VQ4I 2PJRA 1VF9A 1S7AA 3SEQA 2BGCA 2X48A 4KITB 1CQTA 2ISYA 3MKWB 2KDZA 3VDXA 1G59A 5F04A 2EBIA 1IN5A 2VC0A 2XAHA 3CMYA 2JJ7A 1S5LC 1T6SA 3AKZA 4HLYA 2CUFA 5K7ZA 4HPQA 3I9V2 4RDUA 4ETSA 2K02A 2W00A 3GFIA 4UB6C 1VQ9I 2FMLA 3IWFA 1Y0NA 3W6JB 3A01A 1P7JA 2LF7A 5H20A 3JTGA 5D5WB 9ANTA 5HNFA 2EWNA 3BCBA 4Y15A 4PJ0C 5FFZA 2FBHA 4Y3OA 5D8KB 3OOPA 3QYEA 3M8JA 2LDUA 1KGSA 2VI6A 1VQOI 3AG1H 2FF4A 2JTVA 2EZIA 2FBIA 2KIUA 4NB5A 1HC8A 4HA8A 3KEQA 3S2DJ 3B02A 3ISPA 5DDGA 3HOVJ 2CUZA 4OMYA 2AXTC 3HUGA 4KIFA 4IZZA 1TQPA 3GYHX 4L9NA 4CCMA 1JI8A 1O57A 3ABTA 3ZQHA 4D5FA 2A6TA 2M3AA 2KIMA 4B3AA 1N78A 4IHYA 4CCOA 2DJIA 2L7ZA 3B6AA 1VQPI 2OF7A 3F8MA 3OYCA 3DWLE 4WXCA 3Q0WA 2HR3A 1LVKA 5E3NA 3V8JA 1GXQA 2K4BA 5E20A 4DIQA 4MTDA 4E4HA 2QZ8A 3WGIA 1TLHB 1RUOA 2P8TA 3CCRI 4AIDA 1R9TJ 3P7NA 2ID3A 1F43A 2DK8A 3IL2A 3TDZC 4RBOA 3OS2A 3BT9A 3FBNB 4RGUA 1LDJA 1D3YA 1XGSA 2PFBA 3QOPA 4BJ6C 1ZGAA 4W97A 4XMYA 4UUSA 5LD2C 3QU6A 2L9RA 2CQKA 2Y30A 4BHCA 5LGTA 1U0JA 2KFDA 2HYJA 1IXSB 5J6XA 2ZXWH 2X1EA 3BJAA 3KETA 3FMRA 3RKWA 1HW1A 2K3FA 4EQQA 2XF6A 3TKYA 4RB0A 1X4PA 3DKYA 1Y1WJ 1NK3P 2MC4A 3LL7A 1IRZA 4D0PA 4QSHA 1I3QJ 5KCMA 2E7XA 1DDNA 1S7OA 4M6VA 1XX5A 1R5HA 2GBYA 1AHDP 5FJ8J 2IAIA 4CYDA 4QPOA 4S05A 2CQNA 5FLMJ 3PFIA 3DEWA 3CJQB 3I71A 2CG4A 2J5OA 1UJ8A 1BR1A 2VT3A 2STWA 3EUHA 2F5VA 4A12A 5DUKA 2Z5UA 2QUFA 1YYVA 2DA6A 2EFWA 3F23A 1F1ZA 2DW4A 3E5QA 2PMZA 1X1DA 2W85A 3W2WA 3BDDA 1HKSA 5ILSA 3VSKA 2JVGA 4JOMA 3V7CA 2CWEA 1XMXA 1MH4A 2R7FA 4I0BA 3SYTA 1C0WA 4BE2A 5FKLA 3ZQIA 3RKXA 3K70D 2DMQA 1ULYA 2EH3A 3GVAA 2KQRA 1WPKA 3CO6C 5AIQA 1ZKGA 1K78A 2DYSH 2YPRA 4P55A 5EZHA 4UUVA 4ABZA 2Z99A 1I1GA 1MMAA 4RLQA 4DYRA 1TBXA 5KHDA 1YLFA 3QAHA 5EDNA 4A3DJ 1ZRFA 3WHCA 2BY1A 2BHZA 2UV1A 3HHHA 1MJ9A 4XICA 3OYIA 2W84A 3K2AA 2K9MA 2VONA 3VSLA 3HTUA 1P92A 2L7KA 4L9VA 4LMYA 2V1XA 1GUUA 2AXLA 3A03A 1FC3A 2BOLA 3RI4A 5LHHA 4G7OF 1ETXA 2K9LA 1Z77A 5DUIA 3S8PA 1OCZH 3WTUC 2ICWG 4UVAA 4QIWN 4BY1J 3ZMSA 4BH9A 2R5ZA 3L2RA 1TWHJ 1FLIA 4F92B 4M3FA 4ZTFA 3QPSA 3FF5A 4NC7A 4RMNA 2IS6A 4A3IJ 2OV7A 2EV0A 2O7OA 1T0FC 4RAYA 4UXNA 1YIOA 1Y8RB 2PI0A 2XF5A 1K4TA 3I59A 1ZK8A 2RV8A 3MQ0A 4WF2A 1I6HJ 5DYMA 2HOAA 1S29A 3O2PE 5HNHA 2L4AA 5HLGA 2P6TA 2RNJA 1LVAA 3A02A 4GGGA 4H4KC 2LBFA 2BVMA 4I98B 4W1UA 3ZXSA 1FTTA 3T5XA 3FKJA 3BWGA 4A3JJ 2HDCA 4M9ZA 1YOVB 2JUCA 2M2EA 2CQQA 3S17J 4M9XA 3MKYB 1OYWA 3DBHB 2V79A 3C2HA 1BIAA 2CJJA 3F6OA 4ZYDA 2VE9A 1Z3YA 1RI7A 4EGZA 2Y9ZA 3DLLF 2HQNA 5D4RA 3P9IA 2XGDA 4C30A 5LGUA 1MKMA 2DT6A 3PNYA 5F0CA 4WXDA 4AIJA 1KU7A 4KN4X 1P4XA 3DFGA 5EGOA 2OTJI 3I3LA 2FQ3A 2V1NA 3HOSA 1I27A 3L2WA 2VXDA 4R8HA 2XAGA 2DTZA 5ILVA 4WK8F 2VBZA 1PUFA 2A68F 3OMYA 2F6CA 4M6XA 3QPHA 1WJCA 3PUBA 4ZJZA 4U88A 4BDZA 5EG0A 2IA1A 5D8LB 1Y1VJ 3COAC 4FE7A 3CUQA 3BPXA 4HYEA 1S6LA 1RESA 1DP3A 5B66C 2TRTA 1YW9A 2DMPA 2GXGA 5CQGA 1FEXA 2ZXJA 1S72I 1VQ6I 1LNWA 2X6XA 3FIWA 2F5CA 2K85A 3LOCA 3F8FA 3OYGA 3J7ZI 1IGNA 2TDXA 3K10A 2DMUA 4M9SA 1I6XA 3VODA 3ZMDA 1OLTA 4CCJA 1HW2A 2XKPA 3TP0A 5LFAA 3AL0C 4I02A 4RS8A 5JLWA 5EEAA 3KLOA 2OUMA 3E6DA 1G3SA 2KDOA 3GX4X 4HF2A 2HXIA 3MEXA 3RIRA 4XLFA 2LY9A 5TGTA 4EJVA 5ICEA 2BVLA 3M3YJ 2EZLA 4AIKA 1T38A 4A3EJ 2R7VA 4MFDA 4E7LA 1MH3A 2XAUA 1D5VA 1HCRA 2QYOA 5F64A 1NTCA 5K1YA 5D6EA 1SFOJ 3KE2A 1OYIA 3C1DA 1APLC 5CJ9A 2DO7A 4HV5A 2RGVA 2XSDC 1NK2P 1HW5A 1RNLA 3F8CA 1ZG5A 3MFKA 3CLQA 1TL8A 2FOKA 1ZLJA 2E5NA 3F8NA 3NARA 2IGOA 2K9NA 3CQZJ 3VYTB 3IWZA 5DCMA 5C4JJ 4AVZA 3OSFA 4KT6A 4YFXF 1FMVA 1ZRDA 2NVUB 1WH7A 3ZMZA 2BXZA 1U5TB 3SFZA 2VQHA 3GTOJ 3GLLA 1W1WE 5LLQA 3N05A 5C4XJ 1DGWY 3ZMTA 3LSMA 1SD4A 3HOUJ 1FSHA 3OL3A 1ZELA 4JQFA 5GAHJ 3RSNA 2R4GA 3OYKA 3EETA 3Q5FA 2KP6A 2KJBA 2WV1A 4FASD 2VQLA 5LRRA 5IP6A 4Y13A 5CVIA 1VNDA 2LP0A 1MNMC 4PZJA 2DA1A 2ZO4A 3CESA 5F0HA 3CCLI 1EH7A 4CICA 2ELJA 2CU7A 5KNLA 3V8KA 2D5VA 1ODDA 4L5EA 4MQVA 6PAXA 3G2BA 1JUPA 2LH9A 5TJJA 2ISZA 3JCUC 1K6YA 3R61A 4BAYA 1W5CC 5L3DA 2XRNA 3CCYA 2GXAA 5F08A 4E70A 1VTNC 1F4KA 3ZCOA 1BOAA 3OV8A 4JBAA 3EUHC 3JRBA 1TWFJ 1BR4A 3ERMA 2DT7B 3CUOA 2XV4S 1FOWA 3AG2H 5GPAA 1B72B 3T1BA 3LA3A 4ESFA 4X6AJ 1MBEA 1RKWA 3E7LA 2OC6A 2MD0A 4DBRA 3N97A 1OISA 2XIGA 1RR8C 2LKSA 1SC7A 3OSGA 2VE8A 4L9JA 1EA3A 3OYFA 2IRFG 3G1OA 2P4WA 4B4CA 3G4SI 5DD8A 2DMTA 1G3TA 3TW6A 1D1CA 2BW3B 3H5NA 3H1CA 1NG6A 3CLOA 4U0WA 1OCPA 2OZUA 4RAGA 4MHGA 2X51A 3HYIA 3OYJA 3H35A 4U87A 3HC7A 4BL0B 1MBKA 1BOBA 2HKOA 2Z16A 1PUEE 4XBFA 2H8RA 2HDWA 3BOQA 3W6VA 4HSTA 3QPLA 1QO0D 4BU2A 3S32A 1ETKA 1XGNA 4TV7A 5K5QA 1FYKA 3M1EA 4HDUA 1IUFA 2VIXA 2IGMA 5BPDA 2E1OA 4KN7X 3AG3H 1ZH5A 1QNTA 3C7JA 4LLLA 4XKBA 2DN0A 4HEA2 3VFZA 3G73A 2O61A 4C2TA 1SANA 1WI3A 2JT1A 3BZ6A 1Z91A 2CO5A 4HG2A 2ZB9A 2R5YA 3JTHA 5L3CA 3N4MA 3OS0A 1AU7A 1K6OA 3ABLH 3HIFA 2CFOA 3IUOA 4E7ZA 2HOTA 2QCOA 3UKGA 2EV6A 3DV8A 2HTJA 2XAFA 3FWEA 4YIFA 4A5NA 1TT0A 1D0ZA 3EDPA 4EGYA 3BC8A 3PIPF 3ECOA 4RB2C 2DA2A 2ZMEB 2CSOA 2A07F 3LWFA 1BC8C 2VN2A 2HEOA 2ZC2A 5E3LA 4CCKA 1MZBA 3L09A 3OYBA 1VZ0A 2X1DA 4OIPF 3PO3J 2X6YA 1UG0A 1H9GA 1WH5A 2DA7A 4LD5A 4I99C 3KYLA 2HYFA 4ON0A 4IHTA 1ETVA 1XCBA 3MKLA 1SFKA 2JZYA 2DA5A 5D6FA 3HKZN 5GTIC 5L3GA 3U21A 4AYBN 4HNUA 3BTJA 3DKXA 1OR7A 4MQ9F 2G7UA 3TL4X 5E8GA 3CCUI 2L2OA 2IS1A 5EEHA 5JVTA 3A0HC 2ZNYA 5F6FA 4B09A 3RYRA 2MC3A 2QKLB 1ZN2A 4FQGA 4HNTA 2Y0MA 3FX3A 1ETQA 2C6YA 4GFBA 4XM3A 2MSYA 4DOZA 1PP7U 1MBGA 4LJZF 1UFMA 2NAZA 3KYDB 2E7WA 1M1EB 1JGSA 2CYYA 1O7FA 2EZHA 2XHKA 3HRUA 1B4AA 3DQVC 4FE4A 1TQMA 4MGRA 1YITI 4CZZA 3DPTA 2ZXIA 1GV2A 2ETHA 2VKDA 4IVNA 5BNGA 2Y9YA 1W4MA 4HQEA 2DPUA 3MCZA 2M7BA 3OR2C 3TOBA 1MDMB 3IH3A 4MEYF 1XD7A 4NUBA 3HRTA 5JR3A 3JREA 1QQIA 1O4XA 5LHGA 4IXAA 1FSEA 1WRJA 4U7DA 2CV0A 5HLTA 4OMZA 4BJTA 3V4GA 4AVPA 3CCVI 3JAMZ 2HWVA 1IZ1A 2E2JJ 2JPBA 4O6JA 4OAYA 3J81Z 3K0LA 2EFNA 2X6OA 3CTAA 3H5RA 4Z6YA 4DYQA 4KYWA 1IN8A 3B6CA 3CO7C 4B1RA 2EILH 4QLCU 3LQQA 1X3ZB 4GCVA 1W36C 2OA4A 2HOSA 3HPHA 3GTJJ 5KK1A 2DOAA 2DI3A 2P5VA 4OIQF 1ETYA 1MBHA 1FMWA 1XSXA 1R36A 3IC7A 2KT0A 4YELA 1LFPA 4M71A 3SZGA 1ITYA 4N9IA 4QPQA 1BI2A 2FSWA 2Q2EA 4PSWA 1MMSA 1CF7A 4AWXB 1CGPA 5HDNA 4C3IJ 1LEBA 4PK4A 2PX9A 1QHGA 3K4MA 5J1YA 1QVUA 3JRGA 3JRFA 3AFHA 2AQFA 3I4PA 2HQRA 5FLXZ 4RGRA 1EKEA 3L00A 1SVLA 3QOEA 4IOAF 1RC9A 2NOJB 4EV0A 2UZKA 4HSRA 3BR0A 4JX6A 5FO5A 4BQAA 2QEXI 3RCOA 5DM7F 2IGKA 3A01B 5IT3A 3AAFA 2L4MA 3J7YJ 3WTXC 3S1NJ 1DPUA 2PMHA 1QPMA 3MZ8A 3JSOA 5K7FA 3AL0B 3LSTA 4I09A 3L2UA 2EFOA 1A04A 4ITVA 2VKEA 3DPLC 1ZR2A 2LLKA 4JK1X 5IY5H 2Z3YA 4JX4A 2QKMB 4JP0A 1FBQA 2JPCA 4BE1A 2VQGA 1Z0XA 2PEXA 1XPXA 1IV6A 1MJAA 5LEKA 4EJTA 3HUGB 4BJ5C 1R7JA 1XC5A 1JKOC 5ICCA 1W5TA 3MZYA 2W82A 1UHSA 2ESHA 5CLSA 5HODA 3QYFA 4PUSA 1V3FA 2A5WA 2CS3A 4A3FJ 4NHJA 3QWLA 1BC7C 4NDLA 1H88C 2XGXA 2LK2A 3ZGKA 1WWXA 1MMGA 1ONVA 3CJRB 1U9NA 3MD2A 2XDVA 1U5TC 4IRGA 3EUKL 4XKWA 5EEGA 2ME6A 2KMUA 2IEKA 1ZHFA 1KYZA 2WC2A 2OJED 3P9KA 2XVCA 4HV6A 5JHUA 2F4OB 4EJUA 4IQJA 1E17A 3VYUB 2K3PA 3I55I 4NQWA 1MMNA 1T39A 2FMYA 2LMDA 2XB5A 2B0LA 1ZGJA 4XRMA 3ONQA 3KEOA 1R4NB 4P9FA 5J47A 1G3WA 3D1NI 4OIRF 1SVOA 2A3SA 2AHQA 4UUSB 1GDTA 4M72A 2W7NA 4YG2F 2LFBA 1HKQA 3LSIA 4LK1F 4A6EA 3A4CA 1KONA 4L5IA 2KRFA 1U3EM 3WGHA 1DQUA 3IAS2 5M5YJ 2DYRH 2O03A 4BKXA 1YG2A 2NNYA 1TZLA 2HPIA 3PM1A 5E3OA 1LJ9A 2QA4I 2CUEA 1FIPA 5LEJA 3QRFF 1T33A 2EFQA 3C2GA 1R5ID 1JUSA 4KMUX 1LE8A 1X1AA 2E5ZA 4CXFA 3X2QH 1DUXC 3NAUA 3RTRA 1LDDA 2O9LA 3DEEA 1ZG3A 4IHVA 2KIFA 3GTPJ 2ZBKA 4IHWA 3KPHA 3WTTC 2L9SA 4HX8A 4Q5SF 2RDPA 1UMQA 4DW6A 3SXYA 1Z1DA 2HDDA 3ZQLA 1RZ4A 1ERDA 2R7DA 3J7AY 1BI0A 2KIQA 2GQQA 3I53A 3OWTA 3IH4A 3OYNA 1B59A 2HU9A 3PIOF 2HQ5A 3BTIA 1U2WA 2A61A 1KZHA 1HA8A 1GT0C 2K4JA 3LSJA 3ZOBA 1FOYA 2M4KA 2Y69H 1L3LA 1YS6A 4UNOA 2QENA 1P2FA 1Z3XA 2ESNA 4AU7A 2FUG2 4PGGA 3OIPA 3W3CA 1A35A 2QSFX 1PP8F 1J75A 4AC0A 2PJPA 4AIHA 4BQNA 5DTDA 3H0GJ 4OIOF 1U78A 2STTA 2F5DA 5FROA 5JLXA 2WY8Q 5FFXA 3H0DA 1LKXA 4G94A 3ZQGA 1X3WB 5KVRA 1SAUA 2B7EA 3FKIJ 1BM9A 1W7PB 1JKQC 1VQLI 3PNVA 3OYAA 2MGQA 2JRTA 3BG7A 4DJAA 3DTIA 3HOZJ 2OZ6A 2ZMEC 3KLNA 1XSDA 4ZYHA 2GIZA 4LB6B 1VQ8I 5JI6A 1YS7A 4B43A 3HHGA 2VJJA 2KZGA 3DTKA 4V2GA 3ESWB 4DGWB 1V5FA 2ZSHB 5E1ZB 1XS9A 3FXJA 1D5YA 4IJAA 3F8BA 2JA2A 5HDKA 1RR7A 2GA2A 1AA7A 1R22A 1RIOH 3I59B 3BZKA 4X1EA 1IRXA 3KP5A 2JA7J 1E0EA 5ICFA 3I54A 1LQ1A 2WAQA 2ACJA 2I10A 1FTZA 3GLXA 4BXUA 5IT9Z 2LBFB 5J1RA 2OQGA 3W6KB 2ELHA 2OD5A 5L3BA 5E3MA 1Z7LA 3UR3C 2R7ZJ 4GDFA 1F9NA 4D9JA 5K5RA 4PJNA 3SEZA 1JHFA 3FK7A 2WB1N 3E97A 1RETA 2VOPA 1IAWA 1BI1A 1OYYA 1IG7A 1R6RA 5ICGA 3IV5A 4C3HJ 1B8IA 2RQQA 4RA2A 2L02A 1V5GA 1MBFA 2P5LC 1B9MA 1AWCA 3E6MA 1G3YA 2P7VB 1STZA 1H0MA 2VASA 3K4BA 3WTYC 2FNAA 1K79A 2F48A 2P0WA 1FJLA 3P5JA 3E6BA 1SD5A 5DS9A 1U8RA 4WXHA 1PUFB 1DPRA 2BY2A 4PSXA 4BY7J 2VLAA 4L9TA 1V4RA 3KX2A 4M3GA 5ED4A 4U7BA 5F1RA 2ID6A 3HOXJ 5K7HA 3CUQB 3ZN0A 3LFUA 3UNGC 3GFMA 3CDLA 5LBQA 5FRMA 1UHWA 5H6RA 2Y0SN 3IH2A 3RZOJ 3E6CC 3JR9A 4CUGA 1QZZA 3SFIA 3OYMA 4F93B 1X3UA 4JX5A 2QBYA 5EZGA 4AYBA 4BXFA 2YX7A 3SZTA 1WQ2A 4ZZLA 3MVPA 2XC7A 2KHMA 4EMSA 3KP6A 4XK4A 4P5OA 1J5YA 3GZ6A 5CYVA 3H9GA 3S2HJ 4KISA 1KQ8A 2L3DA 2YSRA 5IOZA 1FNNA 3R60A 2DJNA 3GZ5A 2LY2A 4U0YA 2CQ7A 1YW7A 3U1DA 2KLOA 3CP2A 3ZP5A 1O3RA 1OMIA 3DU5A 3D5LA 1B1BA 1IRGA 1Y0UA 1TT5B 5E18F 5C44J 1LB2A 3IAM2 3JRCA 2QSGX 3BCAA 3DF8A 3GO5A 3WG7H 1Z9CA 3OYLA 2A69F 2LY1A 2COBA 3MN2A 1J2XA 1T98A 2RKHA 4IL6C 1ZLKA 1FPQA 3CC2I 4AUXA 4E7SA 2E1MC 2O8XA 2VJ5A 3S16J 1FP1D 1L0OC 3PL8A 3IP4B 4KMFA 4G8XA 2XRLA 3HB9A 4B47A 3KZYA 2LKXA 2VKHA 1O3SA 4FT8A 1VFCA 2R7SA 5FKMA 5F1JA 2ECCA 2L0KA 1KU9A 1TP4A 4F52A 2YR2A 1TWGJ 2M8GX 5A2QZ 2VT2A 1V55H 2E1CA 3FXRA 4G12A 4II2A 5DV5A 2EB7A 3RPUD 4FCYA 2MW8A 4FX4A 2ZFUA 3I5UA 1JTYA 3KEYA 2KRHA 5J4YA 3PUFA 4EJOA 1FIAA 2XPWA 4KIBA 5DCMB 4BQQA 2QWWA 1IXRC 5GAEJ 3BQZA 4BBSJ 4HOBA 2EIJH 1V5EA 3S93A 2MLGA 4XLPF 2XSJC 3BZCA 4KIGA 1USSA 1RUNA 4KUMA 3M4OJ 1KQ0A 3F9KA 3KZIC 1OFCX 2FRHA 4XLNF 2KISA 4RB1A 2DPDA 3LMMA 1D8KA 3OIQA 1BIBA 2DDBA 3V8LA 1XB4A 2NNNA 4XRFA 1DGRM 2F5FA 4OU0A 1Z05A 3U9GA 4ENNA 1A6IA 3K4LA 1MSEC 4YIRX 2ME0A 4BGDA 3GXOA 4XNFA 2XF7A 3H92A 1P4AA 3OL4A 3WU0A 2XAQA 2VJ4A 3HOYJ 1QHHD 4YRVA 2LD5A 1H8AC 4Q48A 2D1VA 1IN6A 2PQ8A 4QTRA 1OCCH 1MD0A 2H8WA 3RYPA 1Z6TA 4ZDOA 4ZYAA 1WZ2A 3ROUA 1EJ9A 1T08B 5FLVA 2E71A 1YRNA 2NRAC 1W0TA 4AM3A 3K4NA 2CW7A 3MKZA 2EA2A 2OU2A 2O5RA 3FXLA 2W48A 4DYCA 1X1BA 1SD6A 1G4DA 1E3OC 1PYVA 1R71A 3DP7A 2HQAA 4E7JA 2EPFA 2XGEA 4E6KG 3CMEI 2X0LA 1X4OA 4XN0A 3TDUC 1ZREA 1YQAA 4PGHA 1MNEA 1ORKA 4YIIA 1GV5A 2L54A 2CUJA 4HNVA 1HSTA 1U6GA 2BY0A 4UHTA 4E7IA 1YO5C 2LSOA 2X4HA 1S8NA 5J4VA
chains in the Genus database with same CATH topology
3RQ4A 3OYDA 2CV2A 4G6TB 3HG9A 4OAYA 3H5RA 1U0JA 2UWMA 3FHNA 2R7TA 3GBGA 2KL4A 3PNTA 2X1EA 4FETA 4BEHB 1W36C 4ZDPA 4MLOA 3HPHA 2DOAA 3VYSB 1N77A 1WJBA 1QU3A 1FMWA 2XF6A 1X4PA 3DKYA 4YELA 2HVRA 2MC4A 1LFPA 3LL7A 3SZGA 2VJIA 5KCMA 4J00A 2JVHA 4QPQA 4PSWA 1D0XA 1GLNA 3HPGA 4QPOA 2R7XA 2X6WA 4PK4A 3CJQB 4D1QA 3CZ6A 1QHGA 3K4MA 1WFXA 1WJAA 1BR1A 4Y4RA 3TBIA 3AFHA 2AQFA 2F5VA 2MABA 3QOEA 5HOOA 2NOJB 4X0GA 2PMZA 1X1DA 4HSRA 2HVQA 3FDYA 4B3XA 2V9KA 4P1WA 3W2WA 3RCOA 2IGKA 3VSKA 2JVGA 4JOMA 4B48A 3SYTA 1Y6IA 3AL0B 4BUPA 4BE2A 2LC2A 3OR1C 4OWRB 3L2UA 3K70D 4OAZA 4ITVA 3DPLC 2KQRA 3EPZA 3A2KA 2F4IA 4BS9A 2L9NA 2QKMB 1MMAA 4RLQA 2MYSA 3LSKA 4BE1A 2V4JC 5KHDA 4LG3A 2VQGA 5CPRB 2GOXB 3OOUA 2HPMA 2UV1A 3HUGB 4BJ5C 3OYIA 2K9MA 2W82A 3VSLA 3LSHA 2L7KA 2HNHA 3QYFA 2BOLA 2A5WA 2CS3A 4PUSA 4IKFA 4XKCA 4BQOA 1YX5A 2IXSA 4DBQA 2VB6A 2K9LA 3S8PA 2ZXHA 3ZGKA 4BDYA 1UAAA 1MMGA 3CJRB 3MD2A 2R7UA 2XDVA 3DTEA 4XKWA 3EUKL 1MMDA 2KMUA 1WJFA 4PFPA 4XLHA 4C9YA 4F55A 3L2RA 3W2VA 4F92B 2IS2A 2V7FA 4ZTFA 4CA0A 3ZR8X 4IQJA 4IX7A 4EATA 3VYUB 4NC7A 2K3PA 4RMNA 1MMNA 3K4CA 3LSGA 3VYRB 2VPLA 2IS6A 2OV7A 1T0FC 3ONQA 1MNDA 3A1YA 2XF5A 4N4OB 4XLAA 3QYBA 4CH7A 5HNHA 1P9QC 2M4GA 2W7NA 4GRIA 2GOMA 2DXIA 3LSIA 4H4KC 4C2UA 1T95A 3A4CA 1KONA 2LBFA 2BVMA 3ZXSA 3QODA 4XQFA 3FKJA 1DQUA 3IAS2 2Q1ZB 1TZLA 2HPIA 3DLAA 3C2GA 3MKYB 3C2HA 4PJMA 1X1AA 1Z3YA 2E5ZA 3E0JB 3OYHA 2R7RA 3RTRA 3K70C 4C30A 3E1SA 2DT6A 3DEEA 3PNYA 4B44A 4CCNA 4ZC3A 2DCEA 3I3LA 3HOSA 2V1NA 2R7QA 3CP8A 3L2WA 2L9SA 2JUGA 2VXDA 4XONA 2WY7Q 4XOTA 3OMYA 1ERDA 3J7AY 2F6CA 2L5QA 3NWTA 3PSFA 1WJCA 2RREA 3PUBA 3OWTA 4ZJZA 4CSWA 4BDZA 3OYNA 1YE9A 3ZRGA 2HU9A 2CMPA 2PJRB 4NNJA 4BACA 3K4JA 1HA8A 4XKVA 1DP3A 1YX3A 2I8DA 3V42A 3S3OA 2M4KA 3DPUA 5CQGA 3CMMA 2CV1A 5HVQC 2V6EA 1Z3XA 4II3A 2FUG2 4AU7A 3OIPA 4LIUA 3W3CA 2RNGA 3OY9A 1X1CA 2X6XA 3PFYA 2W1OA 2WADA 4BQNA 3OYGA 3EUAA 3K10A 5FROA 2CW8A 2WY8Q 3SDBA 3H0DA 1OLTA 1LKXA 2HZDA 4CCJA 5LFAA 1SAUA 2M7AA 4LIVA 5CKTA 3AL0C 4BEHA 2E1MB 4PJLA 2BW3A 3PNVA 4F91B 2OUMA 3OYAA 3BG7A 4DJAA 2KDOA 3DTIA 4XLFA 5TGTA 4LITA 4RLFA 2BVLA 4B43A 2VJJA 4CZCA 2R7VA 3DTKA 4E7LA 2E60A 4DGWB 1V5FA 2ZSHB 2XAUA 4NQWB 2IGNA 3M1CA 4RM3A 2X85A 2JA2A 5JHFA 1AA7A 2Z1DA 1IRXA 2V26A 1E0EA 4CCLA 2WAQA 4IQ4A 3OS1A 2ZSIB 3NWSA 3HOTA 2LBFB 4PFOA 2LOOA 2E5NA 1Z7LA 2M0MA 3UR3C 2IGOA 4D9JA 2WAEA 4PJNA 1X19A 3SEZA 4XR6A 4XLCA 4J01A 3VYTB 1Y56A 1R6RA 3H5AA 4AVZA 2R7WA 4KT6A 1FMVA 2IS4A 2RQQA 3ZQQA 4E7KA 1V5GA 4Y33A 2KPMA 2VQHA 2R7OA 3N05A 4XN3A 1WJDA 1DGWY 3LSMA 3OYEA 3OL3A 1ZELA 3D5RC 2MFZA 4JQFA 5CQEA 2VASA 3K4BA 3RSNA 2WAFA 2P0WA 2R4GA 2KZVA 2K5CA 3OYKA 2KP6A 1WJEA 4FASD 2VQLA 2WA0A 3TMOA 3L2VA 3BG6A 2LREA 4PSXA 2VLAA 3CESA 3KX2A 4U7BA 2ELJA 2Q2EB 5KNLA 4E7HA 4KJZA 4NC8A 3LFUA 3K4KA 3G2BA 2LRDA 3UNGC 3HL2A 2LH9A 1NG7A 5FRMA 3L2QA 1K6YA 2W4SA 2WB1A 4XL9A 2LG4A 4XLEA 4CUGA 4BE0A 3ZCOA 3S3MA 3EUHC 1BR4A 3OYMA 3PJRA 4F93B 1N75A 2DT7B 3H9JA 1G8XA 1MW7A 4AYBA 4BXFA 2OC6A 2MD0A 4DBRA 4XORA 2XC7A 2KHMA 2Z2SB 4P5OA 3MMYB 1D1BA 3H9GA 4KISA 1EA3A 3OYFA 1LDKB 1UELB 2LY2A 1D1CA 2BW3B 3H5NA 1NG6A 3OYJA 2CH0A 3HXLA 2X51A 1J09A 2KRCA 1Z21A 3H35A 4U87A 3HC7A 3PSIA 2KLOA 3CP2A 4BL0B 1BOBA 3DU5A 4ZDLA 3FBIB 2Z16A 3D5LA 3CF2A 3D5SC 2HDWA 3S3NA 4HSTA 3IAM2 4BU2A 3S32A 3BCAA 3OYLA 2LY1A 1WJ5A 2Y0SA 2HVSA 2VIXA 1D0YA 2IGMA 4N4NB 4ZTJA 2VXZA 4E7SA 2E1MC 2VJ5A 4XKBA 3PL8A 3IP4B 4HEA2 4C2TA 4B47A 4PJJA 2VKHA 4HG2A 2PJRA 3SEQA 2R7SA 3OS0A 1OR7C 4KITB 3MKWB 4F52A 3VDXA 1G59A 4ANJA 4II2A 1BR2A 3RPUD 2CFOA 3IUOA 2ZFUA 4E7ZA 3AKZA 4HPQA 3KEYA 2KRHA 4R79A 3I9V2 1TT0A 1D0ZA 2LYCA 4BQQA 1D1AA 3BC8A 2W00A 2VQCA 3S93A 1W36D 1V5EA 4XOPA 2XSJC 4CCKA 3F9KA 3OYBA 1VZ0A 2X1DA 1PJRA 5HNFA 3BCBA 2X6YA 3LMMA 3OIQA 1UG0A 2WBMA 3W2AA 1DGRM 2X1CA 3KYLA 2VL8A 4Y3OA 3K4LA 3QYEA 2JSPA 3M8JA 4F3QA 4BGDA 5FRNA 4XNFA 2XF7A 3OL4A 1SFKA 2VJ4A 1QHHD 4YRVA 3H9QA 3U21A 4HNUA 3DKXA 3TL4X 2CUZA 2L2OA 2IS1A 4ZDOA 4ZYAA 4IZZA 2QKLB 3BLYA 4CCMA 1JI8A 4HNTA 2A6TA 2M3AA 1N78A 1S9HA 3K4NA 2CW7A 4CCOA 3MKZA 4XM3A 2DJIA 4DOZA 2O5RA 3OYCA 1X1BA 3DWLE 1PYVA 3DQVC 4YEJA 1LVKA 2HQAA 3K6GA 4E7JA 4E6KG 3DPTA 2ZXIA 1X4OA 4XN0A 2VKDA 4DIQA 4E4HA 1MNEA 3VWBA 3OR2C 2M7BA 4NUBA 3DU6A 2CUJA 2AQEA 3OS2A 4RM2A 4E7IA 2CV0A 3FBNB 5HLTA 3HKZA 4BJTA 4BJ6C 4HRIA 4XMYA 2UUZA 5LD2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KT6 A;  3PNT A; 
#chains in the Genus database with same CATH topology
 1XDS A;  4MFE A;  3OYD A;  3RZD J;  4G6T B;  1Z6R A;  3HOW J;  3Q0U A;  1FOK A;  1N25 A;  4F7Z A;  3FXU A;  2R7T A;  3BJ6 A;  2KL4 A;  3GBG A;  4YFK F;  4FET A;  4BEH B;  3R0J A;  1IJW C;  3NQO A;  4ZDP A;  1A5J A;  2M9H A;  4M6Y A;  1SEU A;  2HS5 A;  5GAD J;  4B8X A;  1WJB A;  2HOE A;  1JJ8 C;  2B9S A;  5BOX A;  3BTL A;  4A5M A;  3JAM K;  4J00 A;  2JA6 J;  2JVH A;  3ABM H;  3J81 K;  4IHX A;  2MBF A;  1D0X A;  1GLN A;  5AIP A;  3HPG A;  3K9T A;  4I0A A;  3BRO A;  3ZMV A;  4C2M J;  3CZ6 A;  2H94 A;  3FK6 A;  3LA2 A;  1WVR A;  1WFX A;  1T2K A;  2XB0 X;  4Y4R A;  3TBI A;  3TO6 A;  4XRS G;  3CCJ I;  1DU0 A;  3QP5 A;  5D5V B;  5M3F J;  2QLZ A;  5HOO A;  2L9V A;  1XSV A;  4MEX F;  2HYG D;  1XTA A;  2FNP A;  2HVQ A;  2XPV A;  4HW0 A;  3RPU A;  2W24 A;  2GZW A;  4P1W A;  3CC7 I;  3C3W A;  5J40 A;  5IP9 J;  1ZAR A;  2EIM H;  2JA5 J;  3G1M A;  4N9H A;  3TED A;  2LKP A;  3OR1 C;  4OWR B;  3TGN A;  5M5W J;  1ON1 A;  3J80 Z;  2VOO A;  3JRD A;  3EPZ A;  5FLX K;  2K40 A;  4BS9 A;  2GWR A;  5GP9 A;  4UB8 C;  2MYS A;  3LSK A;  1A6Q A;  4LG0 B;  4CDG A;  4KNY A;  1I3A A;  2M1B A;  3K7A J;  1Z67 A;  3OOU A;  2CFX A;  3DKW A;  4I76 A;  2HPM A;  4IPA A;  2OAZ A;  4WCG A;  2H1K A;  3NEU A;  1WHU A;  2KKO A;  2QQA A;  2Z33 A;  1ETO A;  3LAP A;  3LSH A;  2NS8 A;  4L0Y B;  2HNH A;  3QPT A;  4D5C A;  4XKC A;  2QGU A;  3H3V K;  2IXS A;  3K1N A;  1KQ9 A;  2VB6 A;  2QSH X;  2M30 A;  2ZXH A;  3AG4 H;  2ELK A;  3WG9 A;  3DTE A;  1HQC A;  4MO7 A;  2M45 A;  2V9V A;  3SDG A;  1WJF A;  4XLH A;  4A2U A;  4F55 A;  2GM4 A;  3W2V A;  3BG9 A;  4CA0 A;  3VOE A;  4EAT A;  2UXN A;  1I1S A;  1BN5 A;  3TQN A;  3ZQC A;  3BQY A;  3LSG A;  2VPL A;  1LUJ B;  3M07 A;  2OCE A;  5BS6 A;  1MND A;  3L1P A;  1E3H A;  1WCM J;  1HSJ A;  3A1Y A;  4CYC A;  3F3X A;  3QYB A;  1LEA A;  4BHB A;  4D7N A;  1K83 J;  1OKR A;  1QA6 A;  2LF8 A;  2M4G A;  5L3F A;  1SMT A;  2GOM A;  2DXI A;  2DFF A;  2VPR A;  3CDH A;  3WU1 B;  2YS9 A;  3CUQ C;  1VQ7 I;  3KP4 A;  4DZJ A;  1AKH B;  1UG2 A;  1XN7 A;  4UV9 A;  3HDD A;  1JT0 A;  3DLA A;  3J7A O;  2E2H J;  2EJR A;  4FHT A;  3WTZ A;  5B3S H;  4L0Z B;  3FHZ A;  5FD5 A;  1QGP A;  1JUM A;  2OCC H;  3QP6 A;  1E3P A;  3E0J B;  4HAM A;  2XPU A;  3K70 C;  1CF7 B;  3E1S A;  2VBY A;  4HX4 A;  3LNQ A;  4B44 A;  4CCN A;  2B63 J;  1I39 A;  3I56 I;  1YJN I;  2FD5 A;  5F27 A;  2DCE A;  2G7H A;  1ETW A;  2ECB A;  2R7Q A;  5IPA A;  2JUG A;  3WTS C;  1T0F A;  4XON A;  3S1R J;  4M3E A;  4XOT A;  1X58 A;  3WE3 A;  2L7M P;  3RPQ A;  3PSF A;  3MWM A;  3BG3 A;  1KU3 A;  2RRE A;  3R4K A;  3IHU A;  1FWZ A;  1FBS A;  1S3J A;  2CMP A;  2GA1 A;  3LSR A;  2PJR B;  1BW5 A;  4BAC A;  2JRM A;  3K4J A;  2D2W A;  1FBU A;  4XKV A;  2EIK H;  1YX3 A;  1VQ5 I;  2M5W A;  3WTV C;  1MDM A;  3SHF A;  4NC6 A;  2HFH A;  5EF6 A;  1TW2 A;  3KCC A;  5HVQ C;  3I4N J;  2YU9 J;  2V6E A;  2IP2 A;  1ZR4 A;  1ZAO A;  1VQM I;  2RNG A;  3BJO A;  4HLX A;  1X1C A;  4ZYE A;  1IO2 A;  3PFY A;  5D5U B;  2WAD A;  4RGS A;  4DQ2 A;  4A0X A;  4M73 A;  3ERE D;  1SMY F;  2CW8 A;  2XAS A;  5E1X A;  2QVO A;  3BY6 A;  1ON2 A;  3F0C A;  3IKT A;  2WTE A;  5HS8 A;  5B1B H;  5HS9 A;  2PG4 A;  2DFE A;  4O5V A;  3S14 J;  2E1M B;  3WTW C;  1YIJ I;  3HTS B;  2F4M B;  4UVB A;  1VI0 A;  1EV7 A;  2DTR A;  2GAU A;  2OTL I;  4HZF A;  2IPQ X;  2EZK A;  2ZNZ A;  1UHM A;  2H27 A;  5LHI A;  2K9S A;  1XCV A;  2DBB A;  3S2W A;  1QZY A;  3CCM I;  2VKV A;  3ABK H;  3LFK A;  2ZJ2 A;  2GLO A;  4NQW B;  1Y39 A;  3M1C A;  4IOC F;  2X85 A;  4KT5 C;  5TRD A;  5JHF A;  2RAE A;  2R0Q C;  1I50 J;  3MZH A;  2AS5 F;  4A3G J;  4YFN F;  2D45 A;  4LLG F;  2V26 A;  5M5X J;  4CCL A;  2FEZ A;  3T8R A;  3OS1 A;  1HKT A;  2ZSI B;  3NWS A;  3Q3S A;  3HOT A;  5DEQ A;  4EM2 A;  4ESJ A;  5J1U A;  3WGG A;  5GPC A;  2FOW A;  2M0M A;  1HF0 A;  2WAE A;  2ZJQ F;  3EYY A;  2NS0 A;  3GCM A;  3L2C A;  4J01 A;  3DCF A;  3H5A A;  1LE8 B;  1R49 A;  2BV6 A;  1W7P D;  3ZQQ A;  3Q9V A;  3K1P A;  4E7K A;  1MIJ A;  4Y33 A;  4EJW A;  4HDV A;  1EH8 A;  2K9Q A;  4G9Y A;  4FTH A;  2NVX J;  5IT9 K;  2NVT J;  2D1H A;  1IDY A;  5EJC A;  1TNS A;  3Q0V A;  3OYE A;  3S1M J;  2LVS A;  2BXY A;  2MFZ A;  2RQP A;  3PO2 J;  1GVJ A;  2EK5 A;  3IRR A;  2KZV A;  2K5C A;  4ZZD A;  4CGZ A;  2LTP A;  1PVE A;  1WJE A;  3VPR A;  1WSU A;  3TMO A;  3L2V A;  2E2I J;  3GZN B;  4IHS A;  3RQI A;  1HDD C;  2LRE A;  4I01 A;  2G9W A;  5K5O A;  2XAJ A;  2EFP A;  2IVM A;  3KYC B;  4KA4 A;  4E7H A;  4A69 C;  3CCQ I;  1QPI A;  3K4K A;  2LRD A;  3I58 A;  1P7I A;  2DT5 A;  1NG7 A;  2IBD A;  2DOD A;  5ILU A;  4XL9 A;  1TNT A;  1FYM A;  4O3M A;  4XLE A;  4BE0 A;  3S3M A;  3PJR A;  2VOD A;  4M3D A;  3H9J A;  1G8X A;  1MW7 A;  1XGM A;  3IKV A;  1POG A;  3R6S A;  3DEU A;  2BZT A;  3RJP A;  4XOR A;  4A6D A;  2GIV A;  2Z2S B;  4V2F A;  3MMY B;  2YU3 A;  1D1B A;  1A36 A;  4Y17 A;  4A3C J;  2FE3 A;  2ZJR F;  5IYC J;  1MBJ A;  2Y31 A;  2L01 A;  1LDK B;  1UB9 A;  2OBP A;  1K78 B;  2CH0 A;  3ZQF A;  1QRY A;  4RB3 C;  5HS7 A;  2JA8 J;  3VEP A;  5DCF A;  5J8F A;  1HDP A;  3VB2 A;  1GHC A;  2P6S A;  5FD6 A;  4ZDL A;  1R1U A;  1TQI A;  1ACI A;  3GEZ A;  1KYW A;  2QF7 A;  5FKN A;  4R1H A;  3S3N A;  3GTG J;  2MD5 A;  4ASN A;  2N8G A;  4IRI A;  3RDI A;  1LFB A;  1WJ5 A;  2HVS A;  2MG4 A;  1S7E A;  1D0Y A;  3GTK J;  2EA4 A;  4P9U A;  2EV5 A;  4UV8 A;  4ZTJ A;  1J0R A;  2VXZ A;  2PLY A;  1TW3 A;  1RRJ A;  2MLK A;  4HF0 A;  4XRS A;  3HJE A;  4PJJ A;  4BYY A;  2R5Z B;  1G2H A;  2JN6 A;  4J19 A;  1OR7 C;  3S1Q J;  3FM3 A;  1OCT C;  3K2Z A;  3KFW X;  4ANJ A;  3SZP A;  1BR2 A;  3SQN A;  4Q47 A;  2VBW A;  3DXJ F;  5D4S A;  2H1L A;  2ZCW A;  4R79 A;  5TIS C;  4A3K J;  2LYC A;  1D1A A;  2DU9 A;  1B8I B;  3BR3 A;  4NBQ A;  2VQC A;  1W36 D;  4XOP A;  4RGX A;  5LRS A;  5CVR A;  4P96 A;  2FU4 A;  4BHP A;  4GO1 A;  2FX0 A;  1PJR A;  4LFU A;  5A2Q K;  4D7M A;  3LSP A;  1H9T A;  5H6Q A;  1UST A;  2O3F A;  2WBM A;  3ZPL A;  1W7P A;  3W2A A;  2X1C A;  5D5X B;  3KZZ A;  1YW8 A;  2P5K A;  2VL8 A;  1F36 A;  1ZTR A;  1ZG1 A;  3C2B A;  2JSP A;  5CVJ A;  4F3Q A;  4FIS A;  5FRN A;  3CF5 F;  1J9I A;  5FB2 A;  2OQR A;  3KP2 A;  4N0B A;  2CW0 F;  2XGC A;  3H9Q A;  1HBX G;  3CCE I;  5EGO B;  1RPW A;  1DP7 P;  1P6R A;  1YJ9 I;  3BLY A;  3I4M J;  2VBX A;  5ERI A;  1S9H A;  3GME A;  4IF4 A;  4GXO A;  3IRQ A;  2QBY B;  1ENH A;  3ECH A;  2K7L A;  4A3M J;  5EG0 B;  2NVQ J;  4EEF G;  3V7R A;  1T8I A;  3KIO A;  4YEJ A;  1BBY A;  2JSC A;  3K6G A;  3F22 A;  2H6C A;  2V1U A;  3VWB A;  2E1N A;  2L7F P;  5M3M J;  2K86 A;  4OIN F;  1WKM A;  3DU6 A;  2AQE A;  3WU2 C;  1W0U A;  4AD9 A;  1FY7 A;  2QQ8 A;  2E34 A;  4RM2 A;  3U2R A;  3GF2 A;  3HKZ A;  4A0Y A;  1ZGW A;  1U9O A;  4HRI A;  3BG5 A;  3F6V A;  2UUZ A;  5F0F A;  3A2K A;  3FMS A;  3BR6 A;  2XKO A;  3G3Z A;  3RQ4 A;  2CV2 A;  3HG9 A;  4KFC A;  5JFR A;  4LLN A;  2E19 A;  1J7K A;  4IEJ A;  2UWM A;  3FHN A;  2M34 A;  3PNT A;  2DOF A;  2RC4 A;  1XG1 A;  3TO7 A;  4M3B A;  4MLO A;  3TOA A;  5JVG F;  2R3S A;  3L7W A;  4JYK A;  3VYS B;  1REP C;  1N77 A;  2COM A;  3ZMU A;  2CGP A;  1QU3 A;  1JXS A;  3GW2 A;  2HVR A;  4MIM A;  1R5G A;  2VJI A;  2O0Y A;  2VC1 A;  2P7C B;  1BI3 A;  2DFH A;  3E5U A;  4I6Z A;  5DD4 A;  2MA3 A;  4ENK A;  2R7X A;  2X6W A;  4D1Q A;  1G6N A;  1T56 A;  1D8J A;  4Q4Z F;  1WJA A;  1FYL A;  1K61 A;  2MAB A;  2DDA A;  2DLL A;  1NHA A;  2IT0 A;  4X0G A;  1IC8 A;  4A93 J;  3P9C A;  3BR5 A;  3FDY A;  4B3X A;  1EF4 A;  2V9K A;  3RKQ A;  1DU6 A;  1IDZ A;  2M87 A;  3FXO A;  4B48 A;  3WOD F;  1Y6I A;  3T0Y A;  3GTM J;  4BUP A;  1JJ6 C;  3GWZ A;  2LC2 A;  1BL0 A;  2IA0 A;  1MJB A;  1GVD A;  3ULQ B;  4OAZ A;  1XMK A;  1O7L A;  1X1P A;  2F4I A;  1B9N A;  2L9N A;  1HLV A;  5GTH C;  3PQJ A;  3EYI A;  1R1T A;  1ZQ3 P;  3CD6 I;  2V4J C;  2JK3 A;  2RN7 A;  4LG3 A;  1FX7 A;  5CPR B;  2GOX B;  1UZC A;  3HSR A;  5IOY A;  2WWY A;  1YFH A;  3S15 J;  1P4W A;  3GFL A;  2NYX A;  1HOM A;  4G7H F;  4BBR J;  3J80 K;  1R23 A;  3M9A A;  3HEF A;  1TTY A;  4GYI A;  3WHB A;  1YRN B;  4IKF A;  5CVV A;  3TP3 A;  3H36 A;  3BTC A;  1YX5 A;  2G0E A;  4RAZ A;  4BQO A;  3LA7 A;  3QQA A;  4DBQ A;  3GTQ J;  2ZFW A;  3PQK A;  3BP8 A;  2ZKZ A;  3TW7 A;  4BDY A;  1UAA A;  4MTE A;  2DK5 A;  3O8H A;  2R7U A;  4LOC A;  3JRA A;  1MMD A;  4PFP A;  1GXP A;  4C9Y A;  1AOY A;  2DQR A;  2NS7 A;  2V7F A;  2XUB A;  1SFE A;  3HRM A;  2IS2 A;  3ZR8 X;  4IX7 A;  2X9D A;  3FM5 A;  4L5J A;  2BHY A;  2FQ4 A;  3K4C A;  3VYR B;  1BA5 A;  4PDK A;  3L9F A;  4S04 A;  2DMN A;  2FJ1 A;  4LGW A;  4N4O B;  4XLA A;  2IA2 A;  1R00 A;  4CH7 A;  2OPT A;  4LK0 F;  1P9Q C;  3ML6 A;  3GTL J;  4GRI A;  1UCR A;  1OCO H;  4XSZ F;  4C2U A;  1MGT A;  2YX4 A;  1T95 A;  5B5E C;  4V19 K;  1OPC A;  4A3L J;  1FT9 A;  2HXO A;  1JKP C;  1IF1 A;  1VQN I;  3QOD A;  2H09 A;  4XQF A;  1Z7U A;  2Q1Z B;  1MSF C;  2A05 A;  2F5E A;  3GUD A;  3BR1 A;  4C3J J;  4ESB A;  4A3B J;  2CRG A;  3CDI A;  2BBY A;  4G7Z F;  5BMZ A;  1YTY A;  2DQL A;  2FA5 A;  3G1L A;  1ZYR F;  4BXX J;  1JGG A;  1BW6 A;  5HLH A;  2CQX A;  4PJM A;  1LFU P;  4I7H A;  1U5T A;  1WI9 A;  3OYH A;  2IW5 A;  4HF1 A;  2R7R A;  4HBL A;  3HM5 A;  2DFI A;  2PMZ N;  3HBL A;  3JRI A;  3G6E I;  1YHQ I;  1BJZ A;  3MAJ A;  4FX0 A;  4G6Q A;  3HZJ A;  2BYV E;  4ZC3 A;  3M7G A;  3LAJ A;  2HZT A;  2ZJP F;  3DBL B;  1KA8 A;  2K27 A;  3CP8 A;  2WY7 Q;  5FKO A;  2EIN H;  2W57 A;  3ASN H;  2L5Q A;  3QU3 A;  1JTX A;  3HRS A;  3NWT A;  1B6A A;  1I5Z A;  3D0S A;  4CSW A;  2R5Y B;  1F5T A;  1YE9 A;  3ZRG A;  4Y52 J;  2HKX A;  3DBR B;  4NNJ A;  5E1W A;  1SD7 A;  1ZRC A;  3BPV A;  4A0Z A;  1J59 A;  1SAX A;  3KP3 A;  2JQ7 A;  2I8D A;  3V42 A;  5J8C A;  3JRH A;  2E36 A;  3H3Z A;  1IXC A;  5FGM A;  3S3O A;  3DPU A;  2PN6 A;  1FOX A;  3CMM A;  2CV1 A;  1W5S A;  5E79 C;  3K69 A;  3O6B B;  4II3 A;  3B73 A;  4UVC A;  1U8B A;  4LIU A;  3OY9 A;  1B72 A;  4Y7N J;  2W1O A;  2GXB A;  1SFX A;  3EUA A;  2RVC A;  2A6E F;  1YI2 I;  2PBI A;  2V1D A;  3F21 A;  2WAQ N;  2DAO A;  4L18 B;  3SDB A;  2HZD A;  4MNU A;  2A5Y B;  2DA3 A;  2M7A A;  4LIV A;  5CKT A;  4BEH A;  2NXN B;  3O3K A;  4XSX F;  5KAI C;  3JSP A;  1JT6 A;  3FXQ A;  4PJL A;  4ZYG A;  1XGO A;  2BW3 A;  5HDG A;  4F91 B;  5KAF C;  4LB5 A;  3GFJ A;  1JE8 A;  3LQR A;  1OJL A;  2HI3 A;  3FZV A;  3TO9 A;  4EVI A;  5CVU A;  3EQL F;  3I64 A;  4LIT A;  4KDP A;  3ASO H;  4RLF A;  4IO9 F;  5E17 F;  3WE2 A;  3E3V A;  3Q9S A;  3REO A;  2BE5 F;  1X2M A;  3T8T A;  4CZC A;  5HLI A;  2E60 A;  1OCR H;  2F2E A;  2HGC A;  5AON A;  2IGN A;  2AO9 A;  2XRO A;  4U0V A;  4K2E A;  4RM3 A;  4ZH4 F;  1SFU A;  4CHU A;  1X2N A;  2QQ9 A;  2R92 J;  3HGY A;  1R58 A;  4CYC B;  4M74 A;  2Z1D A;  1LPQ A;  2BY3 A;  4H0E A;  2P81 A;  4KIC A;  1QVT A;  3ZN1 A;  5C3E J;  1JHH A;  2BEO A;  4XID A;  3HSF A;  5LGN A;  1IN7 A;  3NRV A;  1K7A A;  4IQ4 A;  1IUY A;  1EH6 A;  3M8F A;  2Y48 A;  4RAF A;  2O6G E;  1NH3 A;  4PFO A;  2FBK A;  2LOO A;  2Q0O A;  4UUT A;  1E2X A;  1O3Q A;  2TCT A;  2QQB A;  4I2O A;  1X19 A;  1OQY A;  2H6B A;  1WGX A;  2LNB A;  4WWC A;  5BPI A;  4XR6 A;  4XLC A;  1JKR C;  1Y56 A;  3SJM A;  2R7W A;  4ENJ A;  5B1A H;  2JMW A;  5J3L A;  2J5P A;  2IS4 A;  1IW7 F;  1XMA A;  2DOE A;  2ZME A;  5FKK A;  4LG0 A;  1PDN C;  3CC4 I;  2VUM J;  2V6C A;  3H3U A;  1YJW I;  2KPM A;  3A0B C;  2R7O A;  1TWC J;  4XN3 A;  4QWQ A;  1WJD A;  3E5X A;  1HXD A;  3FIS A;  1H89 C;  4WX9 A;  3D5R C;  2QM3 A;  3ABU A;  3OIO A;  5CQE A;  2A6H F;  5E8I A;  4DNC A;  2WAF A;  3ELK A;  3C18 A;  3KP7 A;  3R0A A;  1TC3 C;  2WA0 A;  2Z9O A;  3K1M A;  2EQR A;  2Y75 A;  3BG6 A;  1XDU A;  2I5U A;  1Q1V A;  2V9P A;  2MH2 A;  3F72 A;  1TWA J;  3BR2 A;  3I0T A;  2KJC A;  4HQM A;  5IYD J;  4Z2Y A;  2Q2E B;  4KJZ A;  3RKY A;  4EM1 A;  4NC8 A;  2NOG A;  4PCQ A;  5EYR A;  2IJL A;  3FMQ A;  3HL2 A;  4CO8 A;  1SVM A;  4IRH A;  3L2Q A;  2W4S A;  1KU2 A;  2WB1 A;  2NVY J;  1Y8Q B;  2LG4 A;  1VQK I;  2W25 A;  2YUS A;  2UXX A;  3G71 I;  1R1V A;  1N75 A;  1K4S A;  3HSE A;  1QZE A;  1RKT A;  4BNC A;  1A31 A;  3U1K A;  3M8E A;  5GAG J;  3HGG A;  2ADU A;  1V54 H;  2E35 A;  1R4M B;  2Q8K A;  3CJN A;  5IYB J;  1Q1H A;  1AKH A;  2PMU A;  1UEL B;  4DZP A;  4OOI A;  4G6D A;  3CCS I;  3HXL A;  2LR8 A;  3V7S A;  1BJA A;  1J09 A;  1Z21 A;  2KRC A;  3PSI A;  2FXA A;  2R93 J;  3FBI B;  3CF2 A;  3D5S C;  4EM0 B;  3ZQ7 A;  3CMA I;  2M0C A;  2WV0 A;  2O8K A;  2Y2Z A;  5IP7 J;  2JWT A;  2HTS A;  2MH9 A;  4GYG A;  5H2F C;  2Y0S A;  1O3T A;  3JW4 A;  5BQT A;  4N4N B;  3O8G A;  1IV8 A;  1IRF A;  4S0H B;  4ENM A;  4HX7 A;  2DA4 A;  5DM6 F;  1FZP B;  3FXK A;  1FP2 A;  1IN4 A;  2M8E A;  3FXM A;  5L3E A;  1QBJ A;  3CJT B;  4UY8 I;  1VQ4 I;  2PJR A;  1VF9 A;  1S7A A;  3SEQ A;  2BGC A;  2X48 A;  4KIT B;  1CQT A;  2ISY A;  3MKW B;  2KDZ A;  3VDX A;  1G59 A;  5F04 A;  2EBI A;  1IN5 A;  2VC0 A;  2XAH A;  3CMY A;  2JJ7 A;  1S5L C;  1T6S A;  3AKZ A;  4HLY A;  2CUF A;  5K7Z A;  4HPQ A;  3I9V 2;  4RDU A;  4ETS A;  2K02 A;  2W00 A;  3GFI A;  4UB6 C;  1VQ9 I;  2FML A;  3IWF A;  1Y0N A;  3W6J B;  3A01 A;  1P7J A;  2LF7 A;  5H20 A;  3JTG A;  5D5W B;  9ANT A;  5HNF A;  2EWN A;  3BCB A;  4Y15 A;  4PJ0 C;  5FFZ A;  2FBH A;  4Y3O A;  5D8K B;  3OOP A;  3QYE A;  3M8J A;  2LDU A;  1KGS A;  2VI6 A;  1VQO I;  3AG1 H;  2FF4 A;  2JTV A;  2EZI A;  2FBI A;  2KIU A;  4NB5 A;  1HC8 A;  4HA8 A;  3KEQ A;  3S2D J;  3B02 A;  3ISP A;  5DDG A;  3HOV J;  2CUZ A;  4OMY A;  2AXT C;  3HUG A;  4KIF A;  4IZZ A;  1TQP A;  3GYH X;  4L9N A;  4CCM A;  1JI8 A;  1O57 A;  3ABT A;  3ZQH A;  4D5F A;  2A6T A;  2M3A A;  2KIM A;  4B3A A;  1N78 A;  4IHY A;  4CCO A;  2DJI A;  2L7Z A;  3B6A A;  1VQP I;  2OF7 A;  3F8M A;  3OYC A;  3DWL E;  4WXC A;  3Q0W A;  2HR3 A;  1LVK A;  5E3N A;  3V8J A;  1GXQ A;  2K4B A;  5E20 A;  4DIQ A;  4MTD A;  4E4H A;  2QZ8 A;  3WGI A;  1TLH B;  1RUO A;  2P8T A;  3CCR I;  4AID A;  1R9T J;  3P7N A;  2ID3 A;  1F43 A;  2DK8 A;  3IL2 A;  3TDZ C;  4RBO A;  3OS2 A;  3BT9 A;  3FBN B;  4RGU A;  1LDJ A;  1D3Y A;  1XGS A;  2PFB A;  3QOP A;  4BJ6 C;  1ZGA A;  4W97 A;  4XMY A;  4UUS A;  5LD2 C;  3QU6 A;  2L9R A;  2CQK A;  2Y30 A;  4BHC A;  5LGT A;  1U0J A;  2KFD A;  2HYJ A;  1IXS B;  5J6X A;  2ZXW H;  2X1E A;  3BJA A;  3KET A;  3FMR A;  3RKW A;  1HW1 A;  2K3F A;  4EQQ A;  2XF6 A;  3TKY A;  4RB0 A;  1X4P A;  3DKY A;  1Y1W J;  1NK3 P;  2MC4 A;  3LL7 A;  1IRZ A;  4D0P A;  4QSH A;  1I3Q J;  5KCM A;  2E7X A;  1DDN A;  1S7O A;  4M6V A;  1XX5 A;  1R5H A;  2GBY A;  1AHD P;  5FJ8 J;  2IAI A;  4CYD A;  4QPO A;  4S05 A;  2CQN A;  5FLM J;  3PFI A;  3DEW A;  3CJQ B;  3I71 A;  2CG4 A;  2J5O A;  1UJ8 A;  1BR1 A;  2VT3 A;  2STW A;  3EUH A;  2F5V A;  4A12 A;  5DUK A;  2Z5U A;  2QUF A;  1YYV A;  2DA6 A;  2EFW A;  3F23 A;  1F1Z A;  2DW4 A;  3E5Q A;  2PMZ A;  1X1D A;  2W85 A;  3W2W A;  3BDD A;  1HKS A;  5ILS A;  3VSK A;  2JVG A;  4JOM A;  3V7C A;  2CWE A;  1XMX A;  1MH4 A;  2R7F A;  4I0B A;  3SYT A;  1C0W A;  4BE2 A;  5FKL A;  3ZQI A;  3RKX A;  3K70 D;  2DMQ A;  1ULY A;  2EH3 A;  3GVA A;  2KQR A;  1WPK A;  3CO6 C;  5AIQ A;  1ZKG A;  1K78 A;  2DYS H;  2YPR A;  4P55 A;  5EZH A;  4UUV A;  4ABZ A;  2Z99 A;  1I1G A;  1MMA A;  4RLQ A;  4DYR A;  1TBX A;  5KHD A;  1YLF A;  3QAH A;  5EDN A;  4A3D J;  1ZRF A;  3WHC A;  2BY1 A;  2BHZ A;  2UV1 A;  3HHH A;  1MJ9 A;  4XIC A;  3OYI A;  2W84 A;  3K2A A;  2K9M A;  2VON A;  3VSL A;  3HTU A;  1P92 A;  2L7K A;  4L9V A;  4LMY A;  2V1X A;  1GUU A;  2AXL A;  3A03 A;  1FC3 A;  2BOL A;  3RI4 A;  5LHH A;  4G7O F;  1ETX A;  2K9L A;  1Z77 A;  5DUI A;  3S8P A;  1OCZ H;  3WTU C;  2ICW G;  4UVA A;  4QIW N;  4BY1 J;  3ZMS A;  4BH9 A;  2R5Z A;  3L2R A;  1TWH J;  1FLI A;  4F92 B;  4M3F A;  4ZTF A;  3QPS A;  3FF5 A;  4NC7 A;  4RMN A;  2IS6 A;  4A3I J;  2OV7 A;  2EV0 A;  2O7O A;  1T0F C;  4RAY A;  4UXN A;  1YIO A;  1Y8R B;  2PI0 A;  2XF5 A;  1K4T A;  3I59 A;  1ZK8 A;  2RV8 A;  3MQ0 A;  4WF2 A;  1I6H J;  5DYM A;  2HOA A;  1S29 A;  3O2P E;  5HNH A;  2L4A A;  5HLG A;  2P6T A;  2RNJ A;  1LVA A;  3A02 A;  4GGG A;  4H4K C;  2LBF A;  2BVM A;  4I98 B;  4W1U A;  3ZXS A;  1FTT A;  3T5X A;  3FKJ A;  3BWG A;  4A3J J;  2HDC A;  4M9Z A;  1YOV B;  2JUC A;  2M2E A;  2CQQ A;  3S17 J;  4M9X A;  3MKY B;  1OYW A;  3DBH B;  2V79 A;  3C2H A;  1BIA A;  2CJJ A;  3F6O A;  4ZYD A;  2VE9 A;  1Z3Y A;  1RI7 A;  4EGZ A;  2Y9Z A;  3DLL F;  2HQN A;  5D4R A;  3P9I A;  2XGD A;  4C30 A;  5LGU A;  1MKM A;  2DT6 A;  3PNY A;  5F0C A;  4WXD A;  4AIJ A;  1KU7 A;  4KN4 X;  1P4X A;  3DFG A;  5EGO A;  2OTJ I;  3I3L A;  2FQ3 A;  2V1N A;  3HOS A;  1I27 A;  3L2W A;  2VXD A;  4R8H A;  2XAG A;  2DTZ A;  5ILV A;  4WK8 F;  2VBZ A;  1PUF A;  2A68 F;  3OMY A;  2F6C A;  4M6X A;  3QPH A;  1WJC A;  3PUB A;  4ZJZ A;  4U88 A;  4BDZ A;  5EG0 A;  2IA1 A;  5D8L B;  1Y1V J;  3COA C;  4FE7 A;  3CUQ A;  3BPX A;  4HYE A;  1S6L A;  1RES A;  1DP3 A;  5B66 C;  2TRT A;  1YW9 A;  2DMP A;  2GXG A;  5CQG A;  1FEX A;  2ZXJ A;  1S72 I;  1VQ6 I;  1LNW A;  2X6X A;  3FIW A;  2F5C A;  2K85 A;  3LOC A;  3F8F A;  3OYG A;  3J7Z I;  1IGN A;  2TDX A;  3K10 A;  2DMU A;  4M9S A;  1I6X A;  3VOD A;  3ZMD A;  1OLT A;  4CCJ A;  1HW2 A;  2XKP A;  3TP0 A;  5LFA A;  3AL0 C;  4I02 A;  4RS8 A;  5JLW A;  5EEA A;  3KLO A;  2OUM A;  3E6D A;  1G3S A;  2KDO A;  3GX4 X;  4HF2 A;  2HXI A;  3MEX A;  3RIR A;  4XLF A;  2LY9 A;  5TGT A;  4EJV A;  5ICE A;  2BVL A;  3M3Y J;  2EZL A;  4AIK A;  1T38 A;  4A3E J;  2R7V A;  4MFD A;  4E7L A;  1MH3 A;  2XAU A;  1D5V A;  1HCR A;  2QYO A;  5F64 A;  1NTC A;  5K1Y A;  5D6E A;  1SFO J;  3KE2 A;  1OYI A;  3C1D A;  1APL C;  5CJ9 A;  2DO7 A;  4HV5 A;  2RGV A;  2XSD C;  1NK2 P;  1HW5 A;  1RNL A;  3F8C A;  1ZG5 A;  3MFK A;  3CLQ A;  1TL8 A;  2FOK A;  1ZLJ A;  2E5N A;  3F8N A;  3NAR A;  2IGO A;  2K9N A;  3CQZ J;  3VYT B;  3IWZ A;  5DCM A;  5C4J J;  4AVZ A;  3OSF A;  4KT6 A;  4YFX F;  1FMV A;  1ZRD A;  2NVU B;  1WH7 A;  3ZMZ A;  2BXZ A;  1U5T B;  3SFZ A;  2VQH A;  3GTO J;  3GLL A;  1W1W E;  5LLQ A;  3N05 A;  5C4X J;  1DGW Y;  3ZMT A;  3LSM A;  1SD4 A;  3HOU J;  1FSH A;  3OL3 A;  1ZEL A;  4JQF A;  5GAH J;  3RSN A;  2R4G A;  3OYK A;  3EET A;  3Q5F A;  2KP6 A;  2KJB A;  2WV1 A;  4FAS D;  2VQL A;  5LRR A;  5IP6 A;  4Y13 A;  5CVI A;  1VND A;  2LP0 A;  1MNM C;  4PZJ A;  2DA1 A;  2ZO4 A;  3CES A;  5F0H A;  3CCL I;  1EH7 A;  4CIC A;  2ELJ A;  2CU7 A;  5KNL A;  3V8K A;  2D5V A;  1ODD A;  4L5E A;  4MQV A;  6PAX A;  3G2B A;  1JUP A;  2LH9 A;  5TJJ A;  2ISZ A;  3JCU C;  1K6Y A;  3R61 A;  4BAY A;  1W5C C;  5L3D A;  2XRN A;  3CCY A;  2GXA A;  5F08 A;  4E70 A;  1VTN C;  1F4K A;  3ZCO A;  1BOA A;  3OV8 A;  4JBA A;  3EUH C;  3JRB A;  1TWF J;  1BR4 A;  3ERM A;  2DT7 B;  3CUO A;  2XV4 S;  1FOW A;  3AG2 H;  5GPA A;  1B72 B;  3T1B A;  3LA3 A;  4ESF A;  4X6A J;  1MBE A;  1RKW A;  3E7L A;  2OC6 A;  2MD0 A;  4DBR A;  3N97 A;  1OIS A;  2XIG A;  1RR8 C;  2LKS A;  1SC7 A;  3OSG A;  2VE8 A;  4L9J A;  1EA3 A;  3OYF A;  2IRF G;  3G1O A;  2P4W A;  4B4C A;  3G4S I;  5DD8 A;  2DMT A;  1G3T A;  3TW6 A;  1D1C A;  2BW3 B;  3H5N A;  3H1C A;  1NG6 A;  3CLO A;  4U0W A;  1OCP A;  2OZU A;  4RAG A;  4MHG A;  2X51 A;  3HYI A;  3OYJ A;  3H35 A;  4U87 A;  3HC7 A;  4BL0 B;  1MBK A;  1BOB A;  2HKO A;  2Z16 A;  1PUE E;  4XBF A;  2H8R A;  2HDW A;  3BOQ A;  3W6V A;  4HST A;  3QPL A;  1QO0 D;  4BU2 A;  3S32 A;  1ETK A;  1XGN A;  4TV7 A;  5K5Q A;  1FYK A;  3M1E A;  4HDU A;  1IUF A;  2VIX A;  2IGM A;  5BPD A;  2E1O A;  4KN7 X;  3AG3 H;  1ZH5 A;  1QNT A;  3C7J A;  4LLL A;  4XKB A;  2DN0 A;  4HEA 2;  3VFZ A;  3G73 A;  2O61 A;  4C2T A;  1SAN A;  1WI3 A;  2JT1 A;  3BZ6 A;  1Z91 A;  2CO5 A;  4HG2 A;  2ZB9 A;  2R5Y A;  3JTH A;  5L3C A;  3N4M A;  3OS0 A;  1AU7 A;  1K6O A;  3ABL H;  3HIF A;  2CFO A;  3IUO A;  4E7Z A;  2HOT A;  2QCO A;  3UKG A;  2EV6 A;  3DV8 A;  2HTJ A;  2XAF A;  3FWE A;  4YIF A;  4A5N A;  1TT0 A;  1D0Z A;  3EDP A;  4EGY A;  3BC8 A;  3PIP F;  3ECO A;  4RB2 C;  2DA2 A;  2ZME B;  2CSO A;  2A07 F;  3LWF A;  1BC8 C;  2VN2 A;  2HEO A;  2ZC2 A;  5E3L A;  4CCK A;  1MZB A;  3L09 A;  3OYB A;  1VZ0 A;  2X1D A;  4OIP F;  3PO3 J;  2X6Y A;  1UG0 A;  1H9G A;  1WH5 A;  2DA7 A;  4LD5 A;  4I99 C;  3KYL A;  2HYF A;  4ON0 A;  4IHT A;  1ETV A;  1XCB A;  3MKL A;  1SFK A;  2JZY A;  2DA5 A;  5D6F A;  3HKZ N;  5GTI C;  5L3G A;  3U21 A;  4AYB N;  4HNU A;  3BTJ A;  3DKX A;  1OR7 A;  4MQ9 F;  2G7U A;  3TL4 X;  5E8G A;  3CCU I;  2L2O A;  2IS1 A;  5EEH A;  5JVT A;  3A0H C;  2ZNY A;  5F6F A;  4B09 A;  3RYR A;  2MC3 A;  2QKL B;  1ZN2 A;  4FQG A;  4HNT A;  2Y0M A;  3FX3 A;  1ETQ A;  2C6Y A;  4GFB A;  4XM3 A;  2MSY A;  4DOZ A;  1PP7 U;  1MBG A;  4LJZ F;  1UFM A;  2NAZ A;  3KYD B;  2E7W A;  1M1E B;  1JGS A;  2CYY A;  1O7F A;  2EZH A;  2XHK A;  3HRU A;  1B4A A;  3DQV C;  4FE4 A;  1TQM A;  4MGR A;  1YIT I;  4CZZ A;  3DPT A;  2ZXI A;  1GV2 A;  2ETH A;  2VKD A;  4IVN A;  5BNG A;  2Y9Y A;  1W4M A;  4HQE A;  2DPU A;  3MCZ A;  2M7B A;  3OR2 C;  3TOB A;  1MDM B;  3IH3 A;  4MEY F;  1XD7 A;  4NUB A;  3HRT A;  5JR3 A;  3JRE A;  1QQI A;  1O4X A;  5LHG A;  4IXA A;  1FSE A;  1WRJ A;  4U7D A;  2CV0 A;  5HLT A;  4OMZ A;  4BJT A;  3V4G A;  4AVP A;  3CCV I;  3JAM Z;  2HWV A;  1IZ1 A;  2E2J J;  2JPB A;  4O6J A;  4OAY A;  3J81 Z;  3K0L A;  2EFN A;  2X6O A;  3CTA A;  3H5R A;  4Z6Y A;  4DYQ A;  4KYW A;  1IN8 A;  3B6C A;  3CO7 C;  4B1R A;  2EIL H;  4QLC U;  3LQQ A;  1X3Z B;  4GCV A;  1W36 C;  2OA4 A;  2HOS A;  3HPH A;  3GTJ J;  5KK1 A;  2DOA A;  2DI3 A;  2P5V A;  4OIQ F;  1ETY A;  1MBH A;  1FMW A;  1XSX A;  1R36 A;  3IC7 A;  2KT0 A;  4YEL A;  1LFP A;  4M71 A;  3SZG A;  1ITY A;  4N9I A;  4QPQ A;  1BI2 A;  2FSW A;  2Q2E A;  4PSW A;  1MMS A;  1CF7 A;  4AWX B;  1CGP A;  5HDN A;  4C3I J;  1LEB A;  4PK4 A;  2PX9 A;  1QHG A;  3K4M A;  5J1Y A;  1QVU A;  3JRG A;  3JRF A;  3AFH A;  2AQF A;  3I4P A;  2HQR A;  5FLX Z;  4RGR A;  1EKE A;  3L00 A;  1SVL A;  3QOE A;  4IOA F;  1RC9 A;  2NOJ B;  4EV0 A;  2UZK A;  4HSR A;  3BR0 A;  4JX6 A;  5FO5 A;  4BQA A;  2QEX I;  3RCO A;  5DM7 F;  2IGK A;  3A01 B;  5IT3 A;  3AAF A;  2L4M A;  3J7Y J;  3WTX C;  3S1N J;  1DPU A;  2PMH A;  1QPM A;  3MZ8 A;  3JSO A;  5K7F A;  3AL0 B;  3LST A;  4I09 A;  3L2U A;  2EFO A;  1A04 A;  4ITV A;  2VKE A;  3DPL C;  1ZR2 A;  2LLK A;  4JK1 X;  5IY5 H;  2Z3Y A;  4JX4 A;  2QKM B;  4JP0 A;  1FBQ A;  2JPC A;  4BE1 A;  2VQG A;  1Z0X A;  2PEX A;  1XPX A;  1IV6 A;  1MJA A;  5LEK A;  4EJT A;  3HUG B;  4BJ5 C;  1R7J A;  1XC5 A;  1JKO C;  5ICC A;  1W5T A;  3MZY A;  2W82 A;  1UHS A;  2ESH A;  5CLS A;  5HOD A;  3QYF A;  4PUS A;  1V3F A;  2A5W A;  2CS3 A;  4A3F J;  4NHJ A;  3QWL A;  1BC7 C;  4NDL A;  1H88 C;  2XGX A;  2LK2 A;  3ZGK A;  1WWX A;  1MMG A;  1ONV A;  3CJR B;  1U9N A;  3MD2 A;  2XDV A;  1U5T C;  4IRG A;  3EUK L;  4XKW A;  5EEG A;  2ME6 A;  2KMU A;  2IEK A;  1ZHF A;  1KYZ A;  2WC2 A;  2OJE D;  3P9K A;  2XVC A;  4HV6 A;  5JHU A;  2F4O B;  4EJU A;  4IQJ A;  1E17 A;  3VYU B;  2K3P A;  3I55 I;  4NQW A;  1MMN A;  1T39 A;  2FMY A;  2LMD A;  2XB5 A;  2B0L A;  1ZGJ A;  4XRM A;  3ONQ A;  3KEO A;  1R4N B;  4P9F A;  5J47 A;  1G3W A;  3D1N I;  4OIR F;  1SVO A;  2A3S A;  2AHQ A;  4UUS B;  1GDT A;  4M72 A;  2W7N A;  4YG2 F;  2LFB A;  1HKQ A;  3LSI A;  4LK1 F;  4A6E A;  3A4C A;  1KON A;  4L5I A;  2KRF A;  1U3E M;  3WGH A;  1DQU A;  3IAS 2;  5M5Y J;  2DYR H;  2O03 A;  4BKX A;  1YG2 A;  2NNY A;  1TZL A;  2HPI A;  3PM1 A;  5E3O A;  1LJ9 A;  2QA4 I;  2CUE A;  1FIP A;  5LEJ A;  3QRF F;  1T33 A;  2EFQ A;  3C2G A;  1R5I D;  1JUS A;  4KMU X;  1LE8 A;  1X1A A;  2E5Z A;  4CXF A;  3X2Q H;  1DUX C;  3NAU A;  3RTR A;  1LDD A;  2O9L A;  3DEE A;  1ZG3 A;  4IHV A;  2KIF A;  3GTP J;  2ZBK A;  4IHW A;  3KPH A;  3WTT C;  2L9S A;  4HX8 A;  4Q5S F;  2RDP A;  1UMQ A;  4DW6 A;  3SXY A;  1Z1D A;  2HDD A;  3ZQL A;  1RZ4 A;  1ERD A;  2R7D A;  3J7A Y;  1BI0 A;  2KIQ A;  2GQQ A;  3I53 A;  3OWT A;  3IH4 A;  3OYN A;  1B59 A;  2HU9 A;  3PIO F;  2HQ5 A;  3BTI A;  1U2W A;  2A61 A;  1KZH A;  1HA8 A;  1GT0 C;  2K4J A;  3LSJ A;  3ZOB A;  1FOY A;  2M4K A;  2Y69 H;  1L3L A;  1YS6 A;  4UNO A;  2QEN A;  1P2F A;  1Z3X A;  2ESN A;  4AU7 A;  2FUG 2;  4PGG A;  3OIP A;  3W3C A;  1A35 A;  2QSF X;  1PP8 F;  1J75 A;  4AC0 A;  2PJP A;  4AIH A;  4BQN A;  5DTD A;  3H0G J;  4OIO F;  1U78 A;  2STT A;  2F5D A;  5FRO A;  5JLX A;  2WY8 Q;  5FFX A;  3H0D A;  1LKX A;  4G94 A;  3ZQG A;  1X3W B;  5KVR A;  1SAU A;  2B7E A;  3FKI J;  1BM9 A;  1W7P B;  1JKQ C;  1VQL I;  3PNV A;  3OYA A;  2MGQ A;  2JRT A;  3BG7 A;  4DJA A;  3DTI A;  3HOZ J;  2OZ6 A;  2ZME C;  3KLN A;  1XSD A;  4ZYH A;  2GIZ A;  4LB6 B;  1VQ8 I;  5JI6 A;  1YS7 A;  4B43 A;  3HHG A;  2VJJ A;  2KZG A;  3DTK A;  4V2G A;  3ESW B;  4DGW B;  1V5F A;  2ZSH B;  5E1Z B;  1XS9 A;  3FXJ A;  1D5Y A;  4IJA A;  3F8B A;  2JA2 A;  5HDK A;  1RR7 A;  2GA2 A;  1AA7 A;  1R22 A;  1RIO H;  3I59 B;  3BZK A;  4X1E A;  1IRX A;  3KP5 A;  2JA7 J;  1E0E A;  5ICF A;  3I54 A;  1LQ1 A;  2WAQ A;  2ACJ A;  2I10 A;  1FTZ A;  3GLX A;  4BXU A;  5IT9 Z;  2LBF B;  5J1R A;  2OQG A;  3W6K B;  2ELH A;  2OD5 A;  5L3B A;  5E3M A;  1Z7L A;  3UR3 C;  2R7Z J;  4GDF A;  1F9N A;  4D9J A;  5K5R A;  4PJN A;  3SEZ A;  1JHF A;  3FK7 A;  2WB1 N;  3E97 A;  1RET A;  2VOP A;  1IAW A;  1BI1 A;  1OYY A;  1IG7 A;  1R6R A;  5ICG A;  3IV5 A;  4C3H J;  1B8I A;  2RQQ A;  4RA2 A;  2L02 A;  1V5G A;  1MBF A;  2P5L C;  1B9M A;  1AWC A;  3E6M A;  1G3Y A;  2P7V B;  1STZ A;  1H0M A;  2VAS A;  3K4B A;  3WTY C;  2FNA A;  1K79 A;  2F48 A;  2P0W A;  1FJL A;  3P5J A;  3E6B A;  1SD5 A;  5DS9 A;  1U8R A;  4WXH A;  1PUF B;  1DPR A;  2BY2 A;  4PSX A;  4BY7 J;  2VLA A;  4L9T A;  1V4R A;  3KX2 A;  4M3G A;  5ED4 A;  4U7B A;  5F1R A;  2ID6 A;  3HOX J;  5K7H A;  3CUQ B;  3ZN0 A;  3LFU A;  3UNG C;  3GFM A;  3CDL A;  5LBQ A;  5FRM A;  1UHW A;  5H6R A;  2Y0S N;  3IH2 A;  3RZO J;  3E6C C;  3JR9 A;  4CUG A;  1QZZ A;  3SFI A;  3OYM A;  4F93 B;  1X3U A;  4JX5 A;  2QBY A;  5EZG A;  4AYB A;  4BXF A;  2YX7 A;  3SZT A;  1WQ2 A;  4ZZL A;  3MVP A;  2XC7 A;  2KHM A;  4EMS A;  3KP6 A;  4XK4 A;  4P5O A;  1J5Y A;  3GZ6 A;  5CYV A;  3H9G A;  3S2H J;  4KIS A;  1KQ8 A;  2L3D A;  2YSR A;  5IOZ A;  1FNN A;  3R60 A;  2DJN A;  3GZ5 A;  2LY2 A;  4U0Y A;  2CQ7 A;  1YW7 A;  3U1D A;  2KLO A;  3CP2 A;  3ZP5 A;  1O3R A;  1OMI A;  3DU5 A;  3D5L A;  1B1B A;  1IRG A;  1Y0U A;  1TT5 B;  5E18 F;  5C44 J;  1LB2 A;  3IAM 2;  3JRC A;  2QSG X;  3BCA A;  3DF8 A;  3GO5 A;  3WG7 H;  1Z9C A;  3OYL A;  2A69 F;  2LY1 A;  2COB A;  3MN2 A;  1J2X A;  1T98 A;  2RKH A;  4IL6 C;  1ZLK A;  1FPQ A;  3CC2 I;  4AUX A;  4E7S A;  2E1M C;  2O8X A;  2VJ5 A;  3S16 J;  1FP1 D;  1L0O C;  3PL8 A;  3IP4 B;  4KMF A;  4G8X A;  2XRL A;  3HB9 A;  4B47 A;  3KZY A;  2LKX A;  2VKH A;  1O3S A;  4FT8 A;  1VFC A;  2R7S A;  5FKM A;  5F1J A;  2ECC A;  2L0K A;  1KU9 A;  1TP4 A;  4F52 A;  2YR2 A;  1TWG J;  2M8G X;  5A2Q Z;  2VT2 A;  1V55 H;  2E1C A;  3FXR A;  4G12 A;  4II2 A;  5DV5 A;  2EB7 A;  3RPU D;  4FCY A;  2MW8 A;  4FX4 A;  2ZFU A;  3I5U A;  1JTY A;  3KEY A;  2KRH A;  5J4Y A;  3PUF A;  4EJO A;  1FIA A;  2XPW A;  4KIB A;  5DCM B;  4BQQ A;  2QWW A;  1IXR C;  5GAE J;  3BQZ A;  4BBS J;  4HOB A;  2EIJ H;  1V5E A;  3S93 A;  2MLG A;  4XLP F;  2XSJ C;  3BZC A;  4KIG A;  1USS A;  1RUN A;  4KUM A;  3M4O J;  1KQ0 A;  3F9K A;  3KZI C;  1OFC X;  2FRH A;  4XLN F;  2KIS A;  4RB1 A;  2DPD A;  3LMM A;  1D8K A;  3OIQ A;  1BIB A;  2DDB A;  3V8L A;  1XB4 A;  2NNN A;  4XRF A;  1DGR M;  2F5F A;  4OU0 A;  1Z05 A;  3U9G A;  4ENN A;  1A6I A;  3K4L A;  1MSE C;  4YIR X;  2ME0 A;  4BGD A;  3GXO A;  4XNF A;  2XF7 A;  3H92 A;  1P4A A;  3OL4 A;  3WU0 A;  2XAQ A;  2VJ4 A;  3HOY J;  1QHH D;  4YRV A;  2LD5 A;  1H8A C;  4Q48 A;  2D1V A;  1IN6 A;  2PQ8 A;  4QTR A;  1OCC H;  1MD0 A;  2H8W A;  3RYP A;  1Z6T A;  4ZDO A;  4ZYA A;  1WZ2 A;  3ROU A;  1EJ9 A;  1T08 B;  5FLV A;  2E71 A;  1YRN A;  2NRA C;  1W0T A;  4AM3 A;  3K4N A;  2CW7 A;  3MKZ A;  2EA2 A;  2OU2 A;  2O5R A;  3FXL A;  2W48 A;  4DYC A;  1X1B A;  1SD6 A;  1G4D A;  1E3O C;  1PYV A;  1R71 A;  3DP7 A;  2HQA A;  4E7J A;  2EPF A;  2XGE A;  4E6K G;  3CME I;  2X0L A;  1X4O A;  4XN0 A;  3TDU C;  1ZRE A;  1YQA A;  4PGH A;  1MNE A;  1ORK A;  4YII A;  1GV5 A;  2L54 A;  2CUJ A;  4HNV A;  1HST A;  1U6G A;  2BY0 A;  4UHT A;  4E7I A;  1YO5 C;  2LSO A;  2X4H A;  1S8N A;  5J4V A; 
#chains in the Genus database with same CATH homology
 3RQ4 A;  3OYD A;  2CV2 A;  4G6T B;  3HG9 A;  4OAY A;  3H5R A;  1U0J A;  2UWM A;  3FHN A;  2R7T A;  3GBG A;  2KL4 A;  3PNT A;  2X1E A;  4FET A;  4BEH B;  1W36 C;  4ZDP A;  4MLO A;  3HPH A;  2DOA A;  3VYS B;  1N77 A;  1WJB A;  1QU3 A;  1FMW A;  2XF6 A;  1X4P A;  3DKY A;  4YEL A;  2HVR A;  2MC4 A;  1LFP A;  3LL7 A;  3SZG A;  2VJI A;  5KCM A;  4J00 A;  2JVH A;  4QPQ A;  4PSW A;  1D0X A;  1GLN A;  3HPG A;  4QPO A;  2R7X A;  2X6W A;  4PK4 A;  3CJQ B;  4D1Q A;  3CZ6 A;  1QHG A;  3K4M A;  1WFX A;  1WJA A;  1BR1 A;  4Y4R A;  3TBI A;  3AFH A;  2AQF A;  2F5V A;  2MAB A;  3QOE A;  5HOO A;  2NOJ B;  4X0G A;  2PMZ A;  1X1D A;  4HSR A;  2HVQ A;  3FDY A;  4B3X A;  2V9K A;  4P1W A;  3W2W A;  3RCO A;  2IGK A;  3VSK A;  2JVG A;  4JOM A;  4B48 A;  3SYT A;  1Y6I A;  3AL0 B;  4BUP A;  4BE2 A;  2LC2 A;  3OR1 C;  4OWR B;  3L2U A;  3K70 D;  4OAZ A;  4ITV A;  3DPL C;  2KQR A;  3EPZ A;  3A2K A;  2F4I A;  4BS9 A;  2L9N A;  2QKM B;  1MMA A;  4RLQ A;  2MYS A;  3LSK A;  4BE1 A;  2V4J C;  5KHD A;  4LG3 A;  2VQG A;  5CPR B;  2GOX B;  3OOU A;  2HPM A;  2UV1 A;  3HUG B;  4BJ5 C;  3OYI A;  2K9M A;  2W82 A;  3VSL A;  3LSH A;  2L7K A;  2HNH A;  3QYF A;  2BOL A;  2A5W A;  2CS3 A;  4PUS A;  4IKF A;  4XKC A;  4BQO A;  1YX5 A;  2IXS A;  4DBQ A;  2VB6 A;  2K9L A;  3S8P A;  2ZXH A;  3ZGK A;  4BDY A;  1UAA A;  1MMG A;  3CJR B;  3MD2 A;  2R7U A;  2XDV A;  3DTE A;  4XKW A;  3EUK L;  1MMD A;  2KMU A;  1WJF A;  4PFP A;  4XLH A;  4C9Y A;  4F55 A;  3L2R A;  3W2V A;  4F92 B;  2IS2 A;  2V7F A;  4ZTF A;  4CA0 A;  3ZR8 X;  4IQJ A;  4IX7 A;  4EAT A;  3VYU B;  4NC7 A;  2K3P A;  4RMN A;  1MMN A;  3K4C A;  3LSG A;  3VYR B;  2VPL A;  2IS6 A;  2OV7 A;  1T0F C;  3ONQ A;  1MND A;  3A1Y A;  2XF5 A;  4N4O B;  4XLA A;  3QYB A;  4CH7 A;  5HNH A;  1P9Q C;  2M4G A;  2W7N A;  4GRI A;  2GOM A;  2DXI A;  3LSI A;  4H4K C;  4C2U A;  1T95 A;  3A4C A;  1KON A;  2LBF A;  2BVM A;  3ZXS A;  3QOD A;  4XQF A;  3FKJ A;  1DQU A;  3IAS 2;  2Q1Z B;  1TZL A;  2HPI A;  3DLA A;  3C2G A;  3MKY B;  3C2H A;  4PJM A;  1X1A A;  1Z3Y A;  2E5Z A;  3E0J B;  3OYH A;  2R7R A;  3RTR A;  3K70 C;  4C30 A;  3E1S A;  2DT6 A;  3DEE A;  3PNY A;  4B44 A;  4CCN A;  4ZC3 A;  2DCE A;  3I3L A;  3HOS A;  2V1N A;  2R7Q A;  3CP8 A;  3L2W A;  2L9S A;  2JUG A;  2VXD A;  4XON A;  2WY7 Q;  4XOT A;  3OMY A;  1ERD A;  3J7A Y;  2F6C A;  2L5Q A;  3NWT A;  3PSF A;  1WJC A;  2RRE A;  3PUB A;  3OWT A;  4ZJZ A;  4CSW A;  4BDZ A;  3OYN A;  1YE9 A;  3ZRG A;  2HU9 A;  2CMP A;  2PJR B;  4NNJ A;  4BAC A;  3K4J A;  1HA8 A;  4XKV A;  1DP3 A;  1YX3 A;  2I8D A;  3V42 A;  3S3O A;  2M4K A;  3DPU A;  5CQG A;  3CMM A;  2CV1 A;  5HVQ C;  2V6E A;  1Z3X A;  4II3 A;  2FUG 2;  4AU7 A;  3OIP A;  4LIU A;  3W3C A;  2RNG A;  3OY9 A;  1X1C A;  2X6X A;  3PFY A;  2W1O A;  2WAD A;  4BQN A;  3OYG A;  3EUA A;  3K10 A;  5FRO A;  2CW8 A;  2WY8 Q;  3SDB A;  3H0D A;  1OLT A;  1LKX A;  2HZD A;  4CCJ A;  5LFA A;  1SAU A;  2M7A A;  4LIV A;  5CKT A;  3AL0 C;  4BEH A;  2E1M B;  4PJL A;  2BW3 A;  3PNV A;  4F91 B;  2OUM A;  3OYA A;  3BG7 A;  4DJA A;  2KDO A;  3DTI A;  4XLF A;  5TGT A;  4LIT A;  4RLF A;  2BVL A;  4B43 A;  2VJJ A;  4CZC A;  2R7V A;  3DTK A;  4E7L A;  2E60 A;  4DGW B;  1V5F A;  2ZSH B;  2XAU A;  4NQW B;  2IGN A;  3M1C A;  4RM3 A;  2X85 A;  2JA2 A;  5JHF A;  1AA7 A;  2Z1D A;  1IRX A;  2V26 A;  1E0E A;  4CCL A;  2WAQ A;  4IQ4 A;  3OS1 A;  2ZSI B;  3NWS A;  3HOT A;  2LBF B;  4PFO A;  2LOO A;  2E5N A;  1Z7L A;  2M0M A;  3UR3 C;  2IGO A;  4D9J A;  2WAE A;  4PJN A;  1X19 A;  3SEZ A;  4XR6 A;  4XLC A;  4J01 A;  3VYT B;  1Y56 A;  1R6R A;  3H5A A;  4AVZ A;  2R7W A;  4KT6 A;  1FMV A;  2IS4 A;  2RQQ A;  3ZQQ A;  4E7K A;  1V5G A;  4Y33 A;  2KPM A;  2VQH A;  2R7O A;  3N05 A;  4XN3 A;  1WJD A;  1DGW Y;  3LSM A;  3OYE A;  3OL3 A;  1ZEL A;  3D5R C;  2MFZ A;  4JQF A;  5CQE A;  2VAS A;  3K4B A;  3RSN A;  2WAF A;  2P0W A;  2R4G A;  2KZV A;  2K5C A;  3OYK A;  2KP6 A;  1WJE A;  4FAS D;  2VQL A;  2WA0 A;  3TMO A;  3L2V A;  3BG6 A;  2LRE A;  4PSX A;  2VLA A;  3CES A;  3KX2 A;  4U7B A;  2ELJ A;  2Q2E B;  5KNL A;  4E7H A;  4KJZ A;  4NC8 A;  3LFU A;  3K4K A;  3G2B A;  2LRD A;  3UNG C;  3HL2 A;  2LH9 A;  1NG7 A;  5FRM A;  3L2Q A;  1K6Y A;  2W4S A;  2WB1 A;  4XL9 A;  2LG4 A;  4XLE A;  4CUG A;  4BE0 A;  3ZCO A;  3S3M A;  3EUH C;  1BR4 A;  3OYM A;  3PJR A;  4F93 B;  1N75 A;  2DT7 B;  3H9J A;  1G8X A;  1MW7 A;  4AYB A;  4BXF A;  2OC6 A;  2MD0 A;  4DBR A;  4XOR A;  2XC7 A;  2KHM A;  2Z2S B;  4P5O A;  3MMY B;  1D1B A;  3H9G A;  4KIS A;  1EA3 A;  3OYF A;  1LDK B;  1UEL B;  2LY2 A;  1D1C A;  2BW3 B;  3H5N A;  1NG6 A;  3OYJ A;  2CH0 A;  3HXL A;  2X51 A;  1J09 A;  2KRC A;  1Z21 A;  3H35 A;  4U87 A;  3HC7 A;  3PSI A;  2KLO A;  3CP2 A;  4BL0 B;  1BOB A;  3DU5 A;  4ZDL A;  3FBI B;  2Z16 A;  3D5L A;  3CF2 A;  3D5S C;  2HDW A;  3S3N A;  4HST A;  3IAM 2;  4BU2 A;  3S32 A;  3BCA A;  3OYL A;  2LY1 A;  1WJ5 A;  2Y0S A;  2HVS A;  2VIX A;  1D0Y A;  2IGM A;  4N4N B;  4ZTJ A;  2VXZ A;  4E7S A;  2E1M C;  2VJ5 A;  4XKB A;  3PL8 A;  3IP4 B;  4HEA 2;  4C2T A;  4B47 A;  4PJJ A;  2VKH A;  4HG2 A;  2PJR A;  3SEQ A;  2R7S A;  3OS0 A;  1OR7 C;  4KIT B;  3MKW B;  4F52 A;  3VDX A;  1G59 A;  4ANJ A;  4II2 A;  1BR2 A;  3RPU D;  2CFO A;  3IUO A;  2ZFU A;  4E7Z A;  3AKZ A;  4HPQ A;  3KEY A;  2KRH A;  4R79 A;  3I9V 2;  1TT0 A;  1D0Z A;  2LYC A;  4BQQ A;  1D1A A;  3BC8 A;  2W00 A;  2VQC A;  3S93 A;  1W36 D;  1V5E A;  4XOP A;  2XSJ C;  4CCK A;  3F9K A;  3OYB A;  1VZ0 A;  2X1D A;  1PJR A;  5HNF A;  3BCB A;  2X6Y A;  3LMM A;  3OIQ A;  1UG0 A;  2WBM A;  3W2A A;  1DGR M;  2X1C A;  3KYL A;  2VL8 A;  4Y3O A;  3K4L A;  3QYE A;  2JSP A;  3M8J A;  4F3Q A;  4BGD A;  5FRN A;  4XNF A;  2XF7 A;  3OL4 A;  1SFK A;  2VJ4 A;  1QHH D;  4YRV A;  3H9Q A;  3U21 A;  4HNU A;  3DKX A;  3TL4 X;  2CUZ A;  2L2O A;  2IS1 A;  4ZDO A;  4ZYA A;  4IZZ A;  2QKL B;  3BLY A;  4CCM A;  1JI8 A;  4HNT A;  2A6T A;  2M3A A;  1N78 A;  1S9H A;  3K4N A;  2CW7 A;  4CCO A;  3MKZ A;  4XM3 A;  2DJI A;  4DOZ A;  2O5R A;  3OYC A;  1X1B A;  3DWL E;  1PYV A;  3DQV C;  4YEJ A;  1LVK A;  2HQA A;  3K6G A;  4E7J A;  4E6K G;  3DPT A;  2ZXI A;  1X4O A;  4XN0 A;  2VKD A;  4DIQ A;  4E4H A;  1MNE A;  3VWB A;  3OR2 C;  2M7B A;  4NUB A;  3DU6 A;  2CUJ A;  2AQE A;  3OS2 A;  4RM2 A;  4E7I A;  2CV0 A;  3FBN B;  5HLT A;  3HKZ A;  4BJT A;  4BJ6 C;  4HRI A;  4XMY A;  2UUZ A;  5LD2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...