1PYVA

Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
ASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ATP synthase beta chain, mitochondrial precursor
publication title NMR solution structure of the mitochondrial F1beta presequence from Nicotiana plumbaginifolia
pubmed doi rcsb
source organism Nicotiana plumbaginifolia
total genus 8
structure length 53
sequence length 53
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11421 Synthase_beta ATP synthase F1 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1pyvA00
1PYVA
chains in the Genus database with same CATH superfamily
3WTSC 1XCVA 4M9XA 2IS2A 1XSDA 1SEUA 5E1WA 4UHTA 3PQKA 4IRIA 3M3YJ 3K4LA 2R7RA 4B3XA 1S5LC 4QLCU 2D2WA 4JYKA 4KIGA 1I1GA 3RKQA 1MBEA 1Y1VJ 3E6MA 1XN7A 2Y30A 5KVRA 3E6DA 3SXYA 3E6CC 1IGNA 3K6GA 1SFOJ 4M3BA 3CCRI 2VL8A 5E18F 3GZ5A 2CS3A 2Z3YA 4RMNA 4C3IJ 1MKMA 1SAXA 2KIQA 1JHFA 2WWYA 1YIJI 1MBHA 5KNLA 3PUBA 4L5IA 3IWFA 4PJLA 2E71A 3E5QA 4BJ5C 5J3LA 1ZELA 3FX3A 4BJ6C 1DU0A 4ZZDA 1TWCJ 3SFZA 4A0XA 1Z3YA 1LEBA 2I5UA 2NVQJ 1Z9CA 4LG0A 3ECHA 4LB5A 3CZ6A 3BG7A 2BY1A 4EGYA 4HX7A 1T2KA 4ENKA 2NRAC 4A0ZA 2ZO4A 2EFOA 2A3SA 2OQRA 1PUEE 3G4SI 4IEJA 1NTCA 2DT7B 2QSFX 4HW0A 2J5PA 2XGCA 1RC9A 2IBDA 1K6YA 4LOCA 2L4MA 4UNOA 1OLTA 4CHUA 2H94A 1RR7A 3HOVJ 5HS8A 1HDDC 3ROUA 1Y0NA 3CDLA 2KFDA 5GAHJ 5HNFA 1MDMA 5HVQC 4DOZA 4F7ZA 2XVCA 3KYLA 2JK3A 2NOJB 1HSTA 3R61A 1P6RA 1Y39A 1UHWA 2LDUA 3WTXC 2F48A 1BW6A 4YG2F 1APLC 3WE2A 2R7OA 2KIMA 2TDXA 3P9CA 4G6QA 4IHVA 4NHJA 1DP3A 3JRDA 1CF7A 1QHGA 2PLYA 4M74A 1U8RA 1Q1VA 3AAFA 1ZG5A 4IVNA 3OYMA 1IXCA 1D1CA 2VKHA 1UZCA 2E7WA 3HRMA 3KP4A 2L7FP 3W6JB 3SEZA 3CD6I 2F5DA 1Y8RB 2W1OA 1PVEA 1K4TA 3RQ4A 3IRRA 3ZP5A 1KA8A 3RJPA 4UVBA 5K1YA 4B09A 1R36A 4CCMA 3ML6A 2DA7A 1ZGAA 3O2PE 3PSFA 3DTEA 2TCTA 4ZYHA 4MHGA 2LK2A 5J8FA 5C4XJ 1FSEA 1ORKA 4I76A 1JGSA 3QOPA 1YLFA 5F04A 1U8BA 3V8KA 2G7UA 4UUSB 3CJNA 2MW8A 4QSHA 2RDPA 4II2A 2L7MP 2YU9J 5C44J 1WWXA 1NG7A 1QRYA 3SYTA 4YFXF 4UUSA 2HDDA 4MEYF 2OAZA 1DPUA 1R4MB 5HDGA 2FF4A 1S29A 3FXJA 1B8IB 3N05A 3V4GA 4ESBA 2UXXA 2LTPA 2GWRA 2DFHA 1E17A 3A01A 1EA3A 5BPIA 1JUSA 3U9GA 2WY7Q 3O6BB 3RIRA 4C9YA 4I0AA 2XC7A 1J9IA 2F5VA 4DW6A 4D1QA 4M6VA 1HKQA 4RLQA 1N75A 1B4AA 3HTUA 3KFWX 5IYBJ 2ESNA 3ISPA 3RI4A 4BEHA 3OYNA 2ZXHA 4RAFA 1RIOH 5FLVA 3CO6C 2QCOA 4CGZA 2L3DA 2B7EA 3E6BA 2RQPA 3F6OA 3SJMA 4A3IJ 2EPFA 2FX0A 1EH8A 4BUPA 4F55A 3HOWJ 3IV5A 2LP0A 3N97A 5BQTA 4BHPA 3SZTA 4OIOF 2JUGA 4LK0F 1JT0A 4W97A 3HOSA 3DF8A 3K4KA 3NARA 1Y6IA 3BROA 3BZKA 4HLYA 2IA2A 3TQNA 4B3AA 1WJDA 4L9JA 1AKHB 3OIOA 2ZFUA 2HOAA 4CXFA 5DM6F 6PAXA 1R5GA 4EM0B 4P1WA 3MVPA 1H89C 3S2WA 2EA2A 3GZNB 3GXOA 2UZKA 1O3QA 3B02A 3DKYA 2XGEA 4MFEA 2WBMA 4NC7A 5ICFA 1KQ8A 1LVKA 2JA2A 4BS9A 1ZR4A 2M34A 1SC7A 4UVAA 1S6LA 2JTVA 2JVGA 4BGDA 3LQRA 3IAM2 3FXUA 4XQFA 2OBPA 1MIJA 3MMYB 2P6TA 4V2FA 4FASD 1Z77A 1FYMA 1O7FA 2ECCA 2RNGA 2NXNB 2QSHX 4AIJA 3K4MA 1HC8A 4ZC3A 2XRNA 4LFUA 4U88A 4B48A 5K5QA 3K0LA 3S3MA 2MYSA 2BZTA 1FIAA 4MQVA 2W84A 1WJBA 4WCGA 2VPLA 2YUSA 2A68F 2ID6A 3ABMH 2IT0A 1TWGJ 2GBYA 3IWZA 2XV4S 4Y4RA 3TMOA 3U1KA 2QA4I 4X6AJ 4OINF 2XPVA 1VQ9I 2Z33A 1FP2A 1L3LA 1R71A 3BJOA 4DJAA 3ABKH 2K27A 1ZKGA 5EF6A 3L1PA 3TO9A 1ETOA 2JWTA 1AWCA 1I5ZA 1MMDA 1MSFC 3HKZA 2E35A 4AU7A 1BC7C 4BKXA 3R60A 3CLOA 2YSRA 5H6RA 5GTHC 1X1BA 3VEPA 3HOXJ 2ZSHB 2BHZA 1W7PD 2F5FA 2IW5A 2CV2A 2F6CA 1I3QJ 2BBYA 3AL0C 2VQGA 3TO7A 3V42A 4L0YB 1U9OA 1YRNA 2R7ZJ 1ZH5A 2YR2A 4M72A 2L7ZA 3IH2A 2VUMJ 4Q47A 2JJ7A 1R1UA 3HHHA 1OR7C 1O3SA 1V5EA 4R8HA 4RA2A 1GV5A 3HPGA 4G94A 3I54A 3KZIC 1SD5A 3MD2A 1TW3A 1RR8C 3HYIA 1LFUP 5D4SA 1VFCA 4HZFA 4XRSA 1YI2I 4ZDLA 1LE8B 3JR9A 4UXNA 2XKOA 5JHFA 2DQLA 3HIFA 2E1MB 4KDPA 3LSGA 4FE4A 5E20A 2HKOA 3KP5A 3GTOJ 4R1HA 3K1PA 2OF7A 2L7KA 1LKXA 3E97A 4M9ZA 4ZDOA 1J75A 4AUXA 3JCUC 1BC8C 4ESFA 1ETXA 5DV5A 3OSFA 2KMUA 4KT5C 1VQ4I 1Z6TA 2EV5A 3GUDA 4HPQA 2IRFG 4Z2YA 1LUJB 2VQLA 3SQNA 1WJ5A 3OYDA 3OYFA 1T6SA 2V1DA 3OL3A 5IT9Z 2V9VA 1G8XA 1D8JA 4HSTA 1WHUA 2CMPA 1QNTA 4L5EA 5J40A 3BR3A 4LLLA 3ZQFA 3MKYB 3CF5F 2DLLA 5CLSA 1MMNA 2L9NA 5FFZA 2V6EA 2ZMEA 4IHXA 1XS9A 3OMYA 3L2CA 2XUBA 5EEHA 3FXOA 2W25A 2F4IA 2JPCA 4XR6A 3RPQA 3H36A 3NWTA 2IP2A 4RAYA 2A6TA 2VQCA 3FHZA 1X4PA 3RPUA 1O7LA 1LFPA 2VBZA 1UG0A 3BC8A 2X4HA 3AL0B 5CQEA 1FBQA 1I3AA 3ZQHA 1JKQC 3BR0A 1QZEA 5EYRA 4CCJA 3OYAA 3L2RA 3MKWB 2FQ4A 3CJRB 1REPC 2D5VA 4EM2A 3KYCB 5FKKA 4BHBA 4HLXA 3CUQC 1T98A 3DEUA 4ZZLA 3O8HA 1U5TC 4ETSA 1DP7P 3K70C 1TWFJ 3WHCA 3EPZA 4KJZA 4BQNA 1XPXA 2X85A 2IJLA 3PQJA 4ITVA 4BDYA 1W5TA 4I01A 2DT6A 3GCMA 2ETHA 2JPBA 3WGHA 2Y69H 1MJBA 5DDGA 4N9IA 5M3MJ 4RGXA 1D8KA 3QYFA 3A1YA 3HB9A 3K2AA 4IJAA 3F23A 2EIMH 2VOPA 5M5YJ 3OIPA 2IA0A 4IRGA 4PFOA 3K70D 1IRXA 5B66C 1IAWA 2A69F 2VXZA 1X2MA 3FWEA 3ZMVA 1T39A 3HJEA 3IKTA 1OCZH 2L9SA 5AIPA 4JX5A 5LHHA 3CMAI 4G7OF 1DPRA 2K3FA 4A3JJ 2R5ZB 5F6FA 4U0WA 1ZYRF 4L9TA 2EZLA 5J6XA 1D0XA 1GHCA 1TZLA 1HW2A 3A03A 3BTCA 1EV7A 2KZVA 2M1BA 2CUZA 4XM3A 4MLOA 4DYCA 3PNVA 2XPWA 2CQ7A 3CMYA 1ZLJA 3HKZN 2VPRA 4B43A 1IXSB 3K2ZA 2Q8KA 2EFPA 4LK1F 1X1DA 5LGTA 4A3FJ 5DYMA 1VZ0A 5JLXA 2W4SA 5KAFC 4NB5A 1I1SA 5M3FJ 3SZPA 1XGOA 4LIUA 4P5OA 1RRJA 1B1BA 4HBLA 3CUQB 2KL4A 4FISA 1OYWA 2NNYA 2DA6A 5CVJA 2HI3A 4I7HA 5HS9A 2HYFA 1AA7A 2YS9A 3W6VA 3OYGA 2WA0A 2Q2EB 2BV6A 4CDGA 2CQQA 2XROA 4UV8A 1RKWA 3K4BA 3KEQA 5D8LB 2ZNYA 1HCRA 3GTKJ 1QPMA 2H09A 1K6OA 2MABA 1ZGWA 5EGOB 4BL0B 4KN7X 5K5OA 2EWNA 2P7CB 5F27A 4R79A 3CJQB 4D7NA 5LRSA 4GO1A 3HOZJ 4DYRA 2W24A 3CJTB 1IV6A 2F5EA 3BPXA 5F0HA 2DXIA 1IN5A 1A35A 1IC8A 2F2EA 4NBQA 3EUAA 2PBIA 3M8JA 1DUXC 3O8GA 4Y17A 4F52A 4BQQA 3WTVC 3RSNA 4M3GA 3PIPF 3GZ6A 3DLLF 4HG2A 4FT8A 3LAJA 5AIQA 2R7FA 2HZTA 4Q4ZF 3F22A 2ACJA 1I39A 2FNAA 3FXKA 1XMXA 1J5YA 4EGZA 3LOCA 4JP0A 2PG4A 3LAPA 1MW7A 3KP2A 2D1HA 3LWFA 4OU0A 2E2HJ 2UUZA 1BI0A 1XDSA 3JW4A 4PSXA 2MFZA 5J47A 3WG7H 2WB1A 2QM3A 4B47A 5EDNA 2Y31A 1FZPB 1YX5A 3MWMA 2LKXA 5D5XB 1W4MA 2Y0SA 4BXXJ 2CO5A 1WH5A 4XRMA 1IDZA 4FETA 2DFFA 5J1UA 1MH4A 1YG2A 2H8RA 1B72A 3PUFA 3WE3A 1T33A 3FMQA 2EB7A 1ETVA 5FKOA 1QU3A 4M6XA 3O3KA 1LJ9A 5C3EJ 5HLIA 2IGMA 2LBFB 2GM4A 2QQBA 2VBXA 2O8KA 3S2HJ 2HEOA 3WG9A 2DOEA 4BE1A 2LSOA 5D6EA 4YRVA 5GPCA 1BR1A 2VBWA 1YO5C 1RKTA 1FMVA 3DP7A 2IS1A 4UB8C 4XSZF 1JGGA 2L0KA 4IPAA 1Y0UA 2CRGA 3CTAA 3VYRB 1QZZA 2V4JC 5HLHA 3LSKA 1KGSA 4Y3OA 2K9SA 3E0JB 4RGSA 2ELKA 1G3WA 2M7AA 5JLWA 3H9GA 4NQWB 4IHYA 2EFNA 4BHCA 4BBSJ 1UHSA 5DCMB 5LEKA 1TQIA 4XSXF 3WGIA 2E34A 4L9VA 3N4MA 1U2WA 1ZN2A 3LFUA 3S15J 4B8XA 3A4CA 2OPTA 4CYCB 3WU1B 2QBYB 2CU7A 3M1EA 2UWMA 1MBKA 2XRLA 1FMWA 3G1MA 2X6YA 3JAMK 3D5SC 4ASNA 4FX4A 2HOEA 3BDDA 1MNEA 2DFIA 1U3EM 2IS4A 4FQGA 1HBXG 3OWTA 4AVZA 4A93J 5LFAA 3NWSA 3PO2J 3J80K 2M4GA 3F9KA 1S3JA 3QU3A 3I59B 4ZDPA 2M8EA 4ZTJA 1MBJA 3CLQA 3TOAA 2RKHA 2ESHA 1IUFA 5E1ZB 1IRGA 3OYCA 4BNCA 2MGQA 2ELHA 2K9LA 4BE2A 1GXPA 2HTSA 1JXSA 3LSRA 3DBLB 2STWA 3K4NA 2R7QA 2JUCA 1J59A 1B6AA 2BW3B 2GIZA 3EUHA 3RQIA 4FE7A 5IT3A 1YJWI 3QP6A 5JFRA 3TO6A 1SFKA 3VDXA 3DQVC 2BW3A 4N4OB 3JRHA 2AXLA 3T5XA 2GXGA 1TQPA 3DPTA 4D0PA 4L0ZB 4KIFA 3W2AA 1SD7A 2KKOA 4L5JA 4NC8A 4BXFA 2FJ1A 3D1NI 1FEXA 4Y33A 4IHSA 3C2GA 4PJMA 4MFDA 4F92B 1T38A 4LG0B 5HOOA 1UB9A 1FT9A 2H6CA 3P7NA 5J1RA 4LMYA 2ZJPF 1OCOH 2H8WA 1XSVA 2IPQX 3GO5A 2KISA 4LJZF 1H0MA 4HRIA 1RZ4A 4E7IA 3ZRGA 1VNDA 1YFHA 1MD0A 2LOOA 4RS8A 2A5WA 1S72I 2A05A 4M3FA 1J09A 1E3OC 3KYDB 2R3SA 1UCRA 3DFGA 1CGPA 5CVIA 1G2HA 4DBQA 3GYHX 1V5FA 5E3LA 2WAQN 5K5RA 2DU9A 4UV9A 1VQ5I 1ERDA 3KP3A 3RDIA 1RETA 3RKYA 1MDMB 2JA7J 2YX4A 3KZZA 3QYBA 1S8NA 1H9TA 4CO8A 5HODA 2KLOA 3BY6A 1BJZA 3L09A 1NK2P 3CC2I 3CCYA 3MEXA 1QPIA 1HKTA 3MN2A 1XMKA 1JTXA 2DOFA 3CESA 4W1UA 1XSXA 4IHWA 3ZQ7A 2UXNA 3I4MJ 1ETYA 1CF7B 3ZQIA 2ME6A 3OYHA 1ZAOA 2DYSH 5F0CA 2LR8A 2WV0A 3BT9A 4UVCA 2DT5A 3IAS2 3G6EI 4EEFG 3CC4I 3DEEA 2ZJ2A 1KYZA 2O7OA 1BL0A 2PMHA 2NNNA 2VKEA 2LMDA 3CCVI 1LB2A 1HXDA 4A2UA 1OCCH 4G6DA 2LREA 2COBA 2MC3A 2E36A 4I02A 1F9NA 3WHBA 3K10A 4XOTA 1QO0D 1R4NB 2CFXA 2NS0A 3KLNA 3NAUA 3R4KA 4MGRA 2QYOA 1USTA 3EDPA 3OIQA 3CP8A 4IRHA 3J7YJ 3T0YA 4RBOA 2BXZA 5B1BH 3BLYA 1A6QA 2EIKH 3MKLA 3OYBA 3BG9A 3KX2A 3KP7A 4MNUA 3S17J 4WXHA 2CJJA 2BE5F 2V6CA 2E2IJ 4XORA 1R7JA 2DA3A 3QOEA 3F21A 2P81A 4HYEA 4IX7A 3BWGA 1ZR2A 5ICGA 2I8DA 2XAQA 3GFJA 2ECBA 2EZIA 4WXDA 3HRTA 2Q1ZB 2F5CA 2KRHA 5FKLA 3A01B 3ZQCA 2RREA 4XNFA 2CGPA 4ZJZA 3FZVA 4KFCA 4CCKA 2VASA 3V8LA 2ELJA 2M45A 1CQTA 2ZFWA 5B5EC 1MSEC 2LVSA 3F8NA 1BIBA 2LG4A 2HDCA 3ZR8X 2Z9OA 4Q48A 4XLHA 2ZSIB 3EUKL 3K4CA 5FB2A 4XKWA 3IH4A 4BEHB 1BIAA 1XB4A 2K86A 3PM1A 4RDUA 1SFUA 1VI0A 1WJCA 3BJ6A 3GW2A 1L0OC 5BOXA 2J5OA 4GFBA 3QODA 4RB1A 2FXAA 3JRCA 4J01A 4E7HA 3Q9VA 3BG5A 3TKYA 1SANA 4HQMA 5EG0A 2A6EF 3C18A 3J7AO 3RYPA 2IEKA 2PX9A 2IS6A 1EF4A 3DWLE 2L9VA 5IOYA 2MLKA 3FXLA 4PCQA 5F0FA 4OAYA 5GAGJ 4YELA 4WWCA 1SAUA 4IF4A 2VI6A 2DPDA 2FBIA 2IGKA 3F0CA 1YITI 1LPQA 1SMYF 4FHTA 3WTYC 2DMQA 2Y9ZA 4XKBA 3T8RA 2DYRH 2M87A 3F8MA 2PN6A 1Z1DA 3NRVA 1E3HA 1MMSA 2VB6A 3KIOA 2H1KA 2V1UA 2MC4A 2EIJH 4OAZA 5TISC 5FGMA 3OS0A 4QIWN 4I98B 2OTJI 2VJJA 1SVLA 2B9SA 3IP4B 4CCOA 2JZYA 5JHUA 2QGUA 2IGNA 1QQIA 5EZHA 1ACIA 3M7GA 5TJJA 1ETWA 1S7EA 1R58A 3CMEI 3R0JA 2Z1DA 5E17F 3VWBA 3M8EA 5J8CA 1ZG1A 4UY8I 4A69C 1R5HA 2KPMA 1KU9A 4D5CA 1K79A 2E1MC 1FYKA 2ZXIA 2W57A 1D1BA 4MTEA 2P5VA 5ILVA 4BJTA 3K4JA 2VONA 4BQOA 1TL8A 1B9NA 4XBFA 5D5WB 1MNMC 4UUVA 2ZBKA 2DK8A 5K7ZA 1X3UA 3HRUA 2QVOA 1WRJA 4IL6C 1TLHB 3PFYA 3OYLA 2QKMB 2ZMEC 2K9MA 2WAFA 2IA1A 4RM3A 3CCJI 3K69A 5DCFA 4E7JA 4E4HA 2LY2A 3DEWA 2VLAA 4LLGF 5FRMA 2X9DA 1U78A 3L2WA 1IF1A 2E60A 2HDWA 4HF0A 2A5YB 4C2TA 4HNTA 1POGA 2EK5A 3CCQI 1XD7A 1P2FA 2Y48A 3MKZA 2CQNA 5ILSA 3FXRA 4BACA 5AONA 5K7FA 3BCBA 2MH2A 1LQ1A 1T08B 3G1OA 1Y8QB 2CFOA 2ZNZA 2EINH 3BP8A 5E3MA 4XN0A 3COAC 1D5VA 5JR3A 1S7OA 4RM2A 4IHTA 1YRNB 1WH7A 2Y0MA 4C3HJ 3EYIA 4KIBA 1VQMI 2WC2A 4IKFA 2R7UA 3DPLC 3Q0VA 4YFNF 2R7XA 2EZKA 4PUSA 3G3ZA 1G3YA 4M71A 4GGGA 5ERIA 5KK1A 1HLVA 4MQ9F 2VE9A 1KQ9A 2ZXWH 5CVVA 1ETKA 1TNSA 2K7LA 1JKRC 2R92J 5CQGA 1D5YA 4B4CA 2PJRB 3GTGJ 1D3YA 5HLGA 2X51A 1FPQA 3R6SA 3C2BA 1WJAA 2P4WA 2W82A 4EMSA 2F4MB 4HNVA 3OYKA 3ZQGA 1Z05A 3KEYA 2PJRA 2XGDA 3QPTA 3IHUA 5JVTA 3FK6A 5J4VA 1W1WE 1PP7U 2MBFA 1OKRA 2ICWG 1IZ1A 4JX4A 3GTQJ 1YYVA 3LQQA 2QEXI 3BOQA 2B63J 3DBRB 2L5QA 4HV6A 2FBKA 1O3TA 3NEUA 3LMMA 4ESJA 3GFIA 3LSTA 3HBLA 2K5CA 2DJNA 2ZMEB 4LLNA 2LKSA 3E7LA 1ON2A 3H9QA 5FFXA 4RB3C 1T0FA 4WXCA 4XLEA 4NNJA 2HTJA 3GTLJ 3V7RA 4J19A 1ZQ3P 2PQ8A 2DBBA 2UV1A 2FU4A 1SD6A 2LF7A 4OIQF 3VOEA 1N77A 3AG3H 3FF5A 2EILH 2FOKA 2DMNA 2QF7A 1GLNA 1OJLA 2LY9A 4Y15A 2DW4A 3LSMA 3BG6A 1C0WA 2W48A 4XOPA 1W7PA 2HQAA 1BA5A 3BTIA 4A6EA 4HSRA 4CH7A 1BW5A 2A6HF 2VJ5A 3ZN1A 4E6KG 5EEAA 3BR2A 3C7JA 4FX0A 4KICA 4NC6A 3SHFA 2G7HA 3TW6A 4EJWA 3RCOA 3QU6A 5HDKA 1IUYA 5H20A 2R7DA 2AO9A 5ILUA 3TBIA 2DMTA 3LL7A 3S1RJ 2NYXA 5IP7J 2YX7A 5F1JA 3AFHA 3BR5A 3JSPA 3G2BA 4M3EA 2PMZA 3BPVA 5FD5A 5ICCA 2RGVA 3HEFA 1IN6A 1S9HA 5CKTA 3WU2C 2RC4A 1WFXA 3HHGA 2EH3A 2DO7A 4UB6C 1XMAA 2HU9A 3CP2A 3DKXA 4XMYA 3H92A 3P9IA 3H35A 3KP6A 4ZYDA 2HOTA 2CUFA 4I6ZA 1YJ9I 5A2QK 1FOWA 1P9QC 1BOBA 1E2XA 3QRFF 1YX3A 3BTLA 3QYEA 4L18B 3IH3A 4IZZA 1P4WA 2OCCH 1MBGA 4N0BA 4CCLA 4X0GA 3VPRA 4ENMA 1I27A 2K9QA 1R5ID 2CW0F 3GMEA 2XSJC 4PZJA 3BR6A 1V55H 1EKEA 1USSA 3L7WA 1QHHD 1F43A 4NUBA 2BHYA 5CJ9A 5IOZA 5FRNA 3F8FA 5L3EA 4XRSG 4KUMA 3FXQA 3I55I 2ADUA 2IVMA 2OCEA 1ITYA 1SD4A 2NS7A 1ZRDA 5E8GA 5CPRB 3WODF 2QQ8A 1HSJA 2JN6A 3FISA 2FE3A 2EV0A 2VODA 5TGTA 3KE2A 3GBGA 4V19K 2GIVA 1YW9A 4EATA 2DTRA 3ABTA 3V8JA 2BVMA 1X1PA 5E3NA 2HPIA 2P0WA 2ZKZA 2XKPA 4FCYA 2QLZA 4HV5A 1FTZA 3VFZA 3OV8A 3OYIA 2Z5UA 3Q9SA 4X1EA 3ASNH 2ZC2A 3OSGA 2EJRA 1J7KA 2H6BA 3HTSB 1VQPI 1KQ0A 2HVRA 3PJRA 5LEJA 3Q0WA 3F6VA 1Z3XA 3F3XA 2GXBA 3F72A 1OCTC 2TRTA 3JTHA 4BAYA 3KPHA 4OWRB 4HF2A 4E7SA 4AD9A 2F4OB 4M9SA 1FSHA 3HXLA 3FMRA 4XKVA 1W5CC 3KLOA 3ZPLA 3S1MJ 1DGRM 2Z99A 2GA2A 1K78A 1JJ6C 1U5TA 2OC6A 2XAHA 1IN8A 3BQZA 5DS9A 2FUG2 4BE0A 2GOXB 2DMUA 1WI9A 2VN2A 2G0EA 2ISZA 3HUGA 4CA0A 5ICEA 2VKDA 3BJAA 3I71A 3SDBA 3FHNA 3GTMJ 2YU3A 3D5RC 1Z7LA 2O61A 2JMWA 3HPHA 4MTDA 3FXMA 3ZCOA 5E3OA 3QPHA 1WI3A 2KHMA 3Q0UA 9ANTA 2K40A 4XL9A 1IO2A 3I58A 1ETQA 3VSKA 3CO7C 4BH9A 3VYTB 3S8PA 1FBUA 2LNBA 2W7NA 1X3ZB 2BXYA 4GCVA 2IAIA 2VC1A 1G3TA 1QA6A 2A61A 1EH6A 2M4KA 2O5RA 1IRFA 2WV1A 1B72B 1GDTA 5L3BA 3BZ6A 1ULYA 3X2QH 1LEAA 3CUOA 1FX7A 1DU6A 1IRZA 1G6NA 1XGNA 3RZDJ 3QP5A 2HVSA 2KJBA 5LHGA 4LIVA 4BY7J 4QTRA 3JRIA 3OL4A 1K7AA 2MG4A 3D0SA 4II3A 3JAMZ 4C2MJ 1YQAA 2RQQA 2FQ3A 3DLAA 1F1ZA 4V2GA 1X1AA 3FIWA 3HSEA 3ZMSA 3M1CA 4LITA 2LY1A 3DXJF 4JOMA 2NAZA 5DM7F 5FROA 1Y1WJ 4WK8F 2NVXJ 1GV2A 1Z67A 3J80Z 1FC3A 4YIIA 1FOKA 4N9HA 3L9FA 4XKCA 3UKGA 1TNTA 2AHQA 1T8IA 1LVAA 4E7ZA 3HOYJ 4HEA2 4A3EJ 3JSOA 1MJ9A 2L02A 4E7LA 3ZMDA 2PJPA 3K9TA 4CCNA 3FKJA 2GLOA 1TWAJ 2PMZN 5HS7A 1BBYA 1V54H 4K2EA 3RTRA 3I5UA 1JKPC 4H0EA 4CSWA 3PL8A 1W36C 4HQEA 2CWEA 4RB2C 4P9FA 1OCPA 3J7ZI 1LDKB 3MZHA 2M7BA 1KU3A 3HG9A 2OZ6A 5FLXZ 1X58A 4JQFA 2XF7A 4Z6YA 2O03A 2QENA 1A5JA 3S2DJ 2FOWA 4AC0A 1YW8A 3BCAA 1P4XA 1Z0XA 3U21A 5KAIC 1JUPA 3ZMUA 5F1RA 1UHMA 2DA1A 5FD6A 2R5YA 1VQKI 3LSHA 2P8TA 3ASOH 3EQLF 2CW8A 3KEOA 1Z21A 1NK3P 3M4OJ 1W36D 2LYCA 3JRBA 4XRFA 2HWVA 5LD2C 3I64A 2GXAA 2RAEA 1X1CA 3PFIA 2XF5A 1DGWY 2E5NA 4BXUA 2M9HA 2GZWA 4B1RA 2DDAA 4YFKF 2AQEA 1AU7A 1YW7A 2P5KA 3L00A 4YEJA 3JREA 1FLIA 2VE8A 2DFEA 1X19A 2IGOA 3C2HA 4ZYAA 4IOAF 4A3CJ 4HOBA 3TOBA 1ON1A 3W2VA 5DUIA 2KP6A 1YS6A 4HX4A 3FK7A 1SFEA 5LGNA 2VC0A 4ZTFA 1VQNI 2WAEA 2XIGA 4RGRA 3HOUJ 3MZ8A 1O57A 1STZA 2FMYA 5FLXK 3KETA 2JA5J 3TGNA 3IRQA 3F8CA 2OU2A 2XB0X 3T8TA 2WTEA 3CMMA 4PFPA 3L2UA 3QAHA 1A31A 1G3SA 4KISA 2OV7A 4I99C 3H5RA 3U2RA 5D5VB 1AHDP 3S32A 3SEQA 3IKVA 1R6RA 2CH0A 3Q5FA 2R7SA 3K1NA 3NQOA 3DPUA 1JE8A 5GADJ 2O9LA 1TT0A 1JTYA 1HW5A 1RNLA 4DQ2A 4PGGA 2VBYA 3D5LA 4PJNA 1QGPA 2HXOA 2QZ8A 4IXAA 2AS5F 4PSWA 5JVGF 4KA4A 4U0YA 4EJTA 4CICA 4JBAA 2XGXA 5KHDA 2P6SA 4XLFA 2V26A 4DZPA 1XGSA 1F5TA 1TWHJ 4KNYA 2LKPA 3ERMA 3KCCA 2HNHA 2FRHA 2KIFA 1S7AA 3Q3SA 1YS7A 2FSWA 2L4AA 5E8IA 1AOYA 3DU6A 5EZGA 1BJAA 3ZOBA 2ZJQF 1XDUA 2V9KA 3BG3A 2A07F 4BYYA 4DIQA 2KDOA 2HVQA 3S1QJ 2WB1N 1R9TJ 1JJ8C 4O5VA 2BVLA 2EA4A 4EM1A 3FKIJ 3VB2A 2Y0SN 3ESWB 2ZB9A 1DDNA 3I4NJ 4IQJA 4A6DA 3GLXA 4OIPF 2X6XA 2XSDC 1UJ8A 3JTGA 3S16J 2X6OA 2MSYA 1HA8A 1RPWA 2COMA 4KMUX 5F64A 3HM5A 5FO5A 2R93J 2CV0A 4PDKA 1BI1A 2DK5A 2E2JJ 1PYVA 3K7AJ 2O6GE 2ISYA 2M8GX 3GEZA 4XONA 2LRDA 4XIDA 1I50J 2X1EA 3H3VK 2DA5A 3BR1A 5DD8A 3V7SA 4A0YA 2CQXA 1UELB 5D8KB 4A5MA 2AXTC 3OS2A 1KZHA 4F91B 1OQYA 4N4NB 2JQ7A 4EJOA 1F36A 4IQ4A 1V3FA 1K83J 2HPMA 1HDPA 4I0BA 5LBQA 1Z7UA 3CF2A 2CW7A 1I6HJ 3H0DA 2LD5A 4O3MA 2H27A 4Q5SF 2X1CA 1VQ8I 2CUEA 3GTJJ 2XAJA 2JSPA 4DZJA 3DKWA 4ZH4F 1H88C 4QPQA 3C3WA 1M1EB 1OPCA 4ABZA 1YTYA 5HDNA 1G4DA 3OR1C 3TL4X 4C2UA 4WX9A 1JI8A 4OMYA 1X4OA 1ZRFA 2DA4A 4RGUA 2LLKA 3HZJA 2VOOA 5FJ8J 3RYRA 5GTIC 4AYBA 2BEOA 3I56I 5IPAA 2PI0A 4U7BA 2L9RA 5EG0B 5IYDJ 3QQAA 1R1VA 1TBXA 4NDLA 5D6FA 2HKXA 4JK1X 4D5FA 1K4SA 2XAUA 4E7KA 2DJIA 1YJNI 1IN7A 3H3ZA 4A12A 1O3RA 1LDDA 2P5LC 2P7VB 3I53A 1IV8A 4XN3A 1TTYA 2CUJA 4G8XA 3I0TA 1R1TA 4H4KC 4ZYEA 4A3KJ 1B8IA 3FDYA 5B3SH 2VXDA 3QPLA 4XK4A 2FNPA 1A6IA 1HOMA 3VODA 4EV0A 3VSLA 3DBHB 1K61A 3TP0A 4A3BJ 2XASA 4WF2A 3WGGA 2XDVA 3S1NJ 4EQQA 3EETA 4U0VA 3WTWC 3ULQB 4EJUA 1JUMA 1W0TA 3DTKA 1NG6A 5IY5H 1VQLI 1NHAA 1QVTA 1IXRC 3AG4H 2AQFA 2HR3A 5DEQA 3JRFA 3FM5A 3DU5A 3OOPA 2KRCA 5L3DA 4LD5A 3RKXA 1VQ6I 2BY3A 2V79A 2JA6J 1IDYA 3LSPA 1VQ7I 1HW1A 2ID3A 3B73A 1FP1D 2MD0A 3W3CA 2JSCA 3FBIB 4PJ0C 2KIUA 2IXSA 1MH3A 3BZCA 1WPKA 1D1AA 4DGWB 1VTNC 1OYYA 2HYGD 2EBIA 5FKNA 1AKHA 3GVAA 1I6XA 2DA2A 2X6WA 3OR2C 3SFIA 2LF8A 3PNYA 2CV1A 2VT2A 3ECOA 4AVPA 4G12A 4CUGA 2XHKA 5M5XJ 3AG2H 2QQ9A 4XLAA 2DDBA 1T0FC 1FBSA 5BPDA 2Y75A 4E70A 3HDDA 1A04A 1U9NA 2M0CA 4G7ZF 4KMFA 3I4PA 4S05A 2QKLB 5GP9A 3P9KA 4IO9F 4M73A 3GF2A 3HSFA 4C30A 1GT0C 2NVUB 4AWXB 1QBJA 3JRGA 4PK4A 2JT1A 2ZXJA 4RAGA 2MD5A 2NVYJ 1SFXA 1F4KA 3J7AY 2O0YA 3L2VA 4HDUA 1DQUA 1YHQI 1FIPA 4FTHA 3TP3A 1PUFB 4ENNA 4F3QA 4RB0A 2BY2A 3CDHA 2Y2ZA 3KZYA 1EH7A 2OJED 1E3PA 2CSOA 1PUFA 2G9WA 2JVHA 3MZYA 1WQ2A 5E79C 3W2WA 5LLQA 3CQZJ 2GQQA 2FEZA 3ABLH 3A02A 3TDZC 1HQCA 3LA7A 3RPUD 4AIDA 2RNJA 1PJRA 2FMLA 4RAZA 3GX4X 2EV6A 2XF6A 4QPOA 3K1MA 2H1LA 4BY1J 1TC3C 2M2EA 2O8XA 1X2NA 5JI6A 3BQYA 3S3OA 1FYLA 4J00A 3ELKA 2E1CA 1BOAA 4RLFA 1JKOC 1LNWA 5LRRA 3H5NA 2GAUA 3DCFA 4GYIA 2HQNA 2R7VA 3WU0A 1SVOA 1MJAA 2Z16A 5EJCA 2PFBA 3LFKA 3FM3A 4Y13A 2CG4A 2KRFA 3HC7A 5FLMJ 3S93A 1WJEA 5H6QA 2DQRA 2BYVE 2OZUA 2WY8Q 2Y9YA 1XTAA 4AYBN 2XPUA 4BDZA 5IP6A 1KU2A 2WADA 5D4RA 2MA3A 1OCRH 1JHHA 3HGYA 1ZGJA 4PGHA 5IYCJ 1BR2A 3UR3C 4PJJA 4Y7NJ 2NVTJ 1Y56A 4A5NA 1ENHA 2QWWA 2X48A 5HNHA 3CCUI 1LE8A 2M30A 2ZCWA 5A2QZ 4S04A 1MNDA 3AKZA 1W7PB 1ODDA 2HS5A 1P7JA 2MLGA 1P7IA 4C3JJ 3H5AA 3LA2A 1ZLKA 4I09A 2LH9A 1EJ9A 1WCMJ 1E0EA 1GVDA 2N8GA 4LB6B 3VYUB 1WKMA 3ZXSA 4A3LJ 5M5WJ 3OY9A 1YIOA 4TV7A 3QWLA 1UAAA 2GOMA 3PO3J 1R49A 2E7XA 2DAOA 4XLCA 3V7CA 2GA1A 4KT6A 2JRTA 3H9JA 3LSIA 3A2KA 2HFHA 1D0ZA 2HGCA 4A3MJ 3CCEI 2KJCA 2VT3A 2XAFA 5DUKA 2KQRA 3GLLA 3FMSA 5L3CA 3TEDA 4D7MA 3H1CA 1BM9A 5B1AH 5LHIA 3JRAA 2VIXA 4BQAA 3I3LA 2QQAA 1P92A 1FOYA 2W85A 3OOUA 4I2OA 4BU2A 4A3GJ 1H8AC 1LDJA 4MIMA 2ZJRF 4Y52J 2K02A 2OUMA 3H0GJ 3GFMA 2HYJA 3M9AA 4CYDA 2BGCA 2X1DA 1T56A 1KYWA 5EEGA 1OR7A 2MH9A 2RVCA 4JX6A 3PSIA 1IW7F 2LC2A 3CCLI 3J81Z 5IT9K 4CZCA 3MQ0A 4HA8A 3GFLA 4BBRJ 1TQMA 1TP4A 1W5SA 4EVIA 5J1YA 3W6KB 4XLPF 2EFWA 4KN4X 5H2FC 4AM3A 3GWZA 2HQ5A 1Z6RA 2VKVA 3IUOA 4MEXF 2FA5A 2O3FA 1J0RA 5DTDA 2L2OA 3CCSI 1R23A 1GUUA 1HKSA 2BOLA 2NOGA 3E5XA 1ZARA 4U7DA 1UMQA 5FKMA 5CVUA 1SVMA 1BN5A 2D1VA 2DMPA 2ME0A 4G7HF 3G1LA 1PDNC 1IJWC 3G73A 1QZYA 5F08A 4GYGA 3CDIA 2QSGX 3S3NA 5CVRA 3E3VA 1P4AA 2KT0A 1GXQA 5KCMA 3T1BA 1FY7A 5HLTA 1BI2A 2XB5A 3C1DA 2R5ZA 2R0QC 1IN4A 1GVJA 2I10A 1R00A 3QPSA 3OS1A 1BI3A 2QUFA 4GDFA 3J81K 2PEXA 3ZQQA 4M3DA 3A0BC 1OMIA 1ONVA 4G9YA 3IC7A 2VJ4A 2X0LA 2PMUA 2V1NA 3HGGA 3U1DA 1WGXA 1W0UA 4ZYGA 2D45A 1MMAA 2L01A 1UG2A 4DNCA 1HF0A 2VJIA 1K78B 4DBRA 3G71I 1U5TB 2E5ZA 3ZN0A 2EQRA 3CUQA 1XCBA 3HUGB 2M3AA 2OA4A 1FJLA 4AIKA 2K4BA 4DYQA 4M6YA 2M0MA 4OIRF 3FBNB 2Q2EA 4HNUA 1FWZA 2RV8A 4ENJA 2NS8A 3LA3A 4QWQA 2K85A 2B0LA 2Z2SB 4OOIA 5IP9J 3ZGKA 4U87A 3CCMI 2JRMA 4GRIA 5TRDA 1VF9A 3TDUC 1O4XA 2C6YA 5GPAA 2EFQA 3WTZA 2LFBA 5EGOA 3SZGA 2R7TA 1VQOI 1TT5B 2E19A 2KZGA 3LNQA 2VQHA 2JA8J 1IG7A 3ZMZA 1FNNA 3I9V2 1ZHFA 1PP8F 4P55A 3A0HC 1KU7A 2DCEA 1RI7A 5ED4A 2E1NA 1RUOA 2WAQA 4MO7A 1U6GA 2EZHA 3ABUA 1RESA 4S0HB 3B6CA 3HSRA 1Q1HA 1ZG3A 1OYIA 1WVRA 3EUHC 1WSUA 1TW2A 4HAMA 3MFKA 2DI3A 5BNGA 4AIHA 4HDVA 1MGTA 4XLNF 4B44A 2DOAA 2FD5A 3M8FA 4HX8A 4IOCF 2HQRA 1X3WB 2M5WA 1ZREA 3S14J 3REOA 1V5GA 1XG1A 3F8BA 5CYVA 2DPUA 3LSJA 4KYWA 5BS6A 4XICA 3SDGA 3H3UA 1RUNA 1FOXA 4KITB 3RZOJ 5C4JJ 4ANJA 3HL2A 3CC7I 2RN7A 1G59A 1MZBA 1LFBA 4D9JA 2LBFA 3PIOF 2W00A 1T95A 4LG3A 5K7HA 4L9NA 2XAGA 1MMGA 3DTIA 1FTTA 4ON0A 1ZK8A 4YIRX 3WTTC 4O6JA 3ZQLA 1JT6A 3ERED 3BTJA 1NH3A 1A36A 2R5YB 3WTUC 1OISA 4EJVA 4G6TB 2FBHA 2OTLI 1QVUA 2K9NA 1ZRCA 4P96A 2DN0A 4F93B 3OYEA 4HF1A 1SMTA 2Q0OA 3MCZA 5E1XA 1WZ2A 3AG1H 3L2QA 3OYJA 2V7FA 1WJFA 2V1XA 4CZZA 3VYSB 4NQWA 1XC5A 3M07A 1YOVB 3TW7A 2OD5A 3P5JA 3HRSA 1XGMA 1BR4A 3E5UA 5DD4A 5DCMA 1KONA 4P9UA 1N25A 3E1SA 3MAJA 3PNTA 3HOTA 2HZDA 2R7WA 4A3DJ 2KDZA 1OFCX 3RKWA 2K3PA 1N78A 1B9MA 2K4JA 1UFMA 2E1OA 4CYCA 2V9PA 3GTPJ 1D0YA 2QBYA 1H9GA 4GXOA 1B59A 1XX5A 1MBFA 4UUTA 2CYYA 3DV8A 2DODA 3UNGC 1R22A 3ONQA 2DTZA 1U0JA 1Z91A 2OQGA 2HXIA 5L3FA 2STTA 3B6AA 1J2XA 2CQKA 2R4GA 2BY0A 3IL2A 3ZMTA 1YE9A 4YIFA 4OMZA 5LGUA 3EYYA 5L3GA 4LGWA 5J4YA 5D5UB 3I59A 2YPRA 5BMZA 2HOSA 5GAEJ 1ZTRA 2L54A 3R0AA 1V4RA
chains in the Genus database with same CATH topology
2CUJA 2MABA 2K5CA 2IS2A 4H4KC 4BL0B 4R79A 3CJQB 3FDYA 3K4LA 2R7RA 3H9QA 2VXDA 4B3XA 4XLEA 4NNJA 3VSLA 2DXIA 2UV1A 3K6GA 2XDVA 1N77A 3EUAA 3M8JA 2VL8A 4F52A 4BQQA 3RSNA 3DTKA 4HG2A 1GLNA 1NG6A 2CS3A 4RMNA 3LSMA 2AQFA 5KNLA 3PUBA 3BG6A 3DU5A 4PJLA 4XOPA 2KRCA 2HQAA 4BJ5C 4HSRA 4CH7A 1ZELA 4BJ6C 2VJ5A 4E6KG 1MW7A 2UUZA 4PSXA 2MD0A 1Z3YA 2MFZA 3W3CA 2WB1A 3FBIB 4B47A 3RCOA 2IXSA 3CZ6A 1YX5A 1D1AA 3BG7A 4DGWB 2Y0SA 3TBIA 3LL7A 4FETA 3OR2C 2X6WA 2DT7B 3AFHA 3PNYA 3G2BA 2CV1A 1K6YA 2PMZA 4CUGA 1QU3A 5CKTA 1OLTA 1S9HA 4XLAA 1T0FC 1WFXA 2IGMA 2LBFB 3CP2A 2HU9A 3DKXA 4XMYA 5HNFA 3H35A 4BE1A 5HVQC 4YRVA 4DOZA 1P9QC 1BOBA 1YX3A 1BR1A 2QKLB 3KYLA 1FMVA 3QYEA 2NOJB 2IS1A 4IZZA 4C30A 4CCLA 4X0GA 4PK4A 2R7OA 3VYRB 2V4JC 1DP3A 3LSKA 2XSJC 4Y3OA 1QHGA 3E0JB 3J7AY 3L2VA 1QHHD 1DQUA 2M7AA 4NUBA 5FRNA 3H9GA 4NQWB 3OYMA 1D1CA 2VKHA 4F3QA 3SEZA 2W1OA 3RQ4A 5CPRB 2JVHA 3LFUA 4CCMA 3PSFA 3A4CA 3W2WA 3DTEA 5TGTA 3RPUD 3GBGA 1PJRA 2UWMA 2XF6A 1FMWA 4QPOA 2X6YA 3D5SC 4EATA 2BVMA 1MNEA 2HPIA 2P0WA 2IS4A 3OWTA 4AVZA 5LFAA 3OYIA 3NWSA 4II2A 3S3OA 4J00A 2M4GA 3F9KA 4RLFA 1NG7A 3H5NA 3SYTA 4ZDPA 2HVRA 3PJRA 4ZTJA 2R7VA 2Z16A 1Z3XA 3OYCA 3N05A 3HC7A 2K9LA 1EA3A 4BE2A 4OWRB 2WY7Q 4C9YA 3S93A 2XC7A 2F5VA 4E7SA 4D1QA 1WJEA 3K4NA 2R7QA 2WY8Q 4RLQA 3HXLA 1N75A 4BDZA 2WADA 4XKVA 2BW3B 1BR2A 3UR3C 4PJJA 1Y56A 4BEHA 1DGRM 2ZXHA 3OYNA 5HNHA 1SFKA 3VDXA 3DQVC 2OC6A 3AKZA 1MNDA 2BW3A 4N4OB 2FUG2 4BE0A 2GOXB 4BUPA 3DPTA 4CA0A 2VKDA 4F55A 3W2AA 3SDBA 3FHNA 3H5AA 4NC8A 4BXFA 3D5RC 2LH9A 1Z7LA 2JUGA 3HPHA 3ZCOA 1E0EA 4Y33A 3VYUB 3C2GA 2KHMA 4PJMA 3ZXSA 4F92B 3K4KA 3HOSA 4XL9A 5HOOA 3OY9A 1Y6IA 3VSKA 1UAAA 2GOMA 1WJDA 3VYTB 4HRIA 2ZFUA 4XLCA 3S8PA 4E7IA 3ZRGA 4KT6A 2W7NA 4P1WA 2LOOA 2A5WA 3H9JA 2M4KA 2O5RA 3LSIA 3A2KA 1D0ZA 1J09A 3DKYA 2WBMA 4NC7A 2KQRA 4DBQA 2HVSA 1LVKA 1V5FA 2JA2A 4LIVA 4BS9A 1ERDA 3OL4A 2VIXA 4II3A 3I3LA 2RQQA 2JVGA 3DLAA 3QYBA 4BGDA 1X1AA 3IAM2 3OOUA 2KLOA 4XQFA 3M1CA 4BU2A 4LITA 2LY1A 4JOMA 3MMYB 5FROA 4FASD 2OUMA 2RNGA 4XKCA 2X1DA 3CESA 3K4MA 4E7ZA 4ZC3A 4HEA2 4B48A 4E7LA 3PSIA 2LC2A 3OYHA 3S3MA 2MYSA 4CZCA 4CCNA 3FKJA 2VPLA 1WJBA 3IAS2 3DEEA 4Y4RA 3RTRA 3TMOA 4CSWA 3PL8A 1W36C 1LDKB 2LREA 4DJAA 2M7BA 3IUOA 3HG9A 3K10A 4JQFA 4XOTA 2L2OA 2XF7A 1MMDA 2BOLA 3HKZA 4AU7A 3OIQA 3CP8A 3BCAA 3BLYA 1X1BA 3U21A 3OYBA 3KX2A 2ZSHB 3LSHA 4XORA 2CV2A 2F6CA 3AL0C 2VQGA 2CW8A 3S3NA 3QOEA 1Z21A 5KCMA 4IX7A 3V42A 2I8DA 2LYCA 1W36D 5HLTA 5LD2C 1X1CA 2XF5A 1DGWY 2E5NA 1OR7C 2Q1ZB 1V5EA 2KRHA 2RREA 2AQEA 3HPGA 4XNFA 4ZJZA 3OS1A 4CCKA 3ZQQA 3MD2A 2VASA 4YEJA 2ELJA 1X19A 2IGOA 3C2HA 2VJ4A 4ZYAA 2LG4A 3W2VA 2V1NA 3ZR8X 2KP6A 4XLHA 2ZSIB 3EUKL 3K4CA 4XKWA 4BEHB 4ZDLA 4ZTFA 1MMAA 1WJCA 2WAEA 5JHFA 2VJIA 4DBRA 2E1MB 2E5ZA 3LSGA 3QODA 4J01A 4E7HA 3HUGB 2L7KA 1LKXA 2M3AA 4ZDOA 2IS6A 3CMMA 4PFPA 3DWLE 3L2UA 2KMUA 2M0MA 4HPQA 4KISA 3FBNB 2OV7A 4HNUA 4OAYA 2VQLA 3H5RA 1WJ5A 3OYDA 4YELA 3OL3A 3OYFA 1SAUA 2Z2SB 3S32A 1G8XA 2IGKA 3SEQA 4HSTA 4U87A 1R6RA 2CH0A 2CMPA 3ZGKA 4GRIA 3MKYB 4XKBA 2R7SA 1MMNA 2L9NA 2V6EA 3SZGA 3DPUA 3OMYA 2R7TA 1TT0A 2F4IA 2VB6A 4XR6A 2VQHA 3D5LA 2MC4A 3NWTA 4OAZA 4PJNA 3I9V2 3OS0A 2A6TA 2VQCA 4PSWA 1X4PA 1LFPA 2DCEA 2VJJA 1UG0A 2WAQA 3BC8A 5KHDA 3IP4B 4XLFA 4CCOA 2V26A 3AL0B 5CQEA 2IGNA 2HNHA 4CCJA 3OYAA 3L2RA 3MKWB 3CJRB 2Z1DA 3DU6A 3EUHC 3VWBA 2V9KA 4B44A 2DOAA 4DIQA 2KDOA 2HVQA 2KPMA 2BVLA 2E1MC 2ZXIA 1D1BA 1V5GA 3K70C 4BJTA 3K4JA 3EPZA 4KJZA 4BQNA 4IQJA 4BQOA 2X85A 2X6XA 4ITVA 4KITB 4BDYA 1HA8A 2DT6A 3PFYA 3OYLA 2QKMB 4ANJA 2CV0A 2K9MA 2WAFA 3HL2A 4RM3A 4E7JA 1PYVA 1G59A 4E4HA 2LY2A 2VLAA 5FRMA 4XONA 3L2WA 2LRDA 2E60A 2X1EA 2HDWA 2LBFA 3QYFA 4D9JA 3A1YA 2W00A 4C2TA 4HNTA 1UELB 1T95A 4LG3A 1MMGA 3DTIA 3OS2A 4F91B 4N4NB 3MKZA 3OIPA 4BACA 4IQ4A 3BCBA 4PFOA 3K70D 1IRXA 4G6TB 2CFOA 2VXZA 4XN0A 2HPMA 2L9SA 4RM2A 3CF2A 2CW7A 4F93B 3OYEA 3H0DA 4IKFA 2R7UA 3L2QA 2X1CA 2V7FA 1D0XA 1WJFA 3DPLC 3OYJA 2R7XA 2JSPA 1TZLA 4PUSA 3VYSB 2KZVA 2CUZA 4XM3A 4MLOA 3PNVA 4QPQA 1BR4A 4B43A 1KONA 1X1DA 5CQGA 3E1SA 2PJRB 1VZ0A 3PNTA 3HOTA 2HZDA 2X51A 2W4SA 2R7WA 3OR1C 2K3PA 3TL4X 4C2UA 1N78A 1JI8A 1X4OA 1WJAA 2W82A 4P5OA 4LIUA 3OYKA 1D0YA 3KEYA 2PJRA 4AYBA 3UNGC 2KL4A 4U7BA 3ONQA 1U0JA 2R4GA 1AA7A 1YE9A 3OYGA 2WA0A 2Q2EB 2XAUA 4E7KA 2DJIA 2L5QA 3K4BA 4XN3A 3LMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYV A; 
#chains in the Genus database with same CATH topology
 3WTS C;  1XCV A;  4M9X A;  2IS2 A;  1XSD A;  1SEU A;  5E1W A;  4UHT A;  3PQK A;  4IRI A;  3M3Y J;  3K4L A;  2R7R A;  4B3X A;  1S5L C;  4QLC U;  2D2W A;  4JYK A;  4KIG A;  1I1G A;  3RKQ A;  1MBE A;  1Y1V J;  3E6M A;  1XN7 A;  2Y30 A;  5KVR A;  3E6D A;  3SXY A;  3E6C C;  1IGN A;  3K6G A;  1SFO J;  4M3B A;  3CCR I;  2VL8 A;  5E18 F;  3GZ5 A;  2CS3 A;  2Z3Y A;  4RMN A;  4C3I J;  1MKM A;  1SAX A;  2KIQ A;  1JHF A;  2WWY A;  1YIJ I;  1MBH A;  5KNL A;  3PUB A;  4L5I A;  3IWF A;  4PJL A;  2E71 A;  3E5Q A;  4BJ5 C;  5J3L A;  1ZEL A;  3FX3 A;  4BJ6 C;  1DU0 A;  4ZZD A;  1TWC J;  3SFZ A;  4A0X A;  1Z3Y A;  1LEB A;  2I5U A;  2NVQ J;  1Z9C A;  4LG0 A;  3ECH A;  4LB5 A;  3CZ6 A;  3BG7 A;  2BY1 A;  4EGY A;  4HX7 A;  1T2K A;  4ENK A;  2NRA C;  4A0Z A;  2ZO4 A;  2EFO A;  2A3S A;  2OQR A;  1PUE E;  3G4S I;  4IEJ A;  1NTC A;  2DT7 B;  2QSF X;  4HW0 A;  2J5P A;  2XGC A;  1RC9 A;  2IBD A;  1K6Y A;  4LOC A;  2L4M A;  4UNO A;  1OLT A;  4CHU A;  2H94 A;  1RR7 A;  3HOV J;  5HS8 A;  1HDD C;  3ROU A;  1Y0N A;  3CDL A;  2KFD A;  5GAH J;  5HNF A;  1MDM A;  5HVQ C;  4DOZ A;  4F7Z A;  2XVC A;  3KYL A;  2JK3 A;  2NOJ B;  1HST A;  3R61 A;  1P6R A;  1Y39 A;  1UHW A;  2LDU A;  3WTX C;  2F48 A;  1BW6 A;  4YG2 F;  1APL C;  3WE2 A;  2R7O A;  2KIM A;  2TDX A;  3P9C A;  4G6Q A;  4IHV A;  4NHJ A;  1DP3 A;  3JRD A;  1CF7 A;  1QHG A;  2PLY A;  4M74 A;  1U8R A;  1Q1V A;  3AAF A;  1ZG5 A;  4IVN A;  3OYM A;  1IXC A;  1D1C A;  2VKH A;  1UZC A;  2E7W A;  3HRM A;  3KP4 A;  2L7F P;  3W6J B;  3SEZ A;  3CD6 I;  2F5D A;  1Y8R B;  2W1O A;  1PVE A;  1K4T A;  3RQ4 A;  3IRR A;  3ZP5 A;  1KA8 A;  3RJP A;  4UVB A;  5K1Y A;  4B09 A;  1R36 A;  4CCM A;  3ML6 A;  2DA7 A;  1ZGA A;  3O2P E;  3PSF A;  3DTE A;  2TCT A;  4ZYH A;  4MHG A;  2LK2 A;  5J8F A;  5C4X J;  1FSE A;  1ORK A;  4I76 A;  1JGS A;  3QOP A;  1YLF A;  5F04 A;  1U8B A;  3V8K A;  2G7U A;  4UUS B;  3CJN A;  2MW8 A;  4QSH A;  2RDP A;  4II2 A;  2L7M P;  2YU9 J;  5C44 J;  1WWX A;  1NG7 A;  1QRY A;  3SYT A;  4YFX F;  4UUS A;  2HDD A;  4MEY F;  2OAZ A;  1DPU A;  1R4M B;  5HDG A;  2FF4 A;  1S29 A;  3FXJ A;  1B8I B;  3N05 A;  3V4G A;  4ESB A;  2UXX A;  2LTP A;  2GWR A;  2DFH A;  1E17 A;  3A01 A;  1EA3 A;  5BPI A;  1JUS A;  3U9G A;  2WY7 Q;  3O6B B;  3RIR A;  4C9Y A;  4I0A A;  2XC7 A;  1J9I A;  2F5V A;  4DW6 A;  4D1Q A;  4M6V A;  1HKQ A;  4RLQ A;  1N75 A;  1B4A A;  3HTU A;  3KFW X;  5IYB J;  2ESN A;  3ISP A;  3RI4 A;  4BEH A;  3OYN A;  2ZXH A;  4RAF A;  1RIO H;  5FLV A;  3CO6 C;  2QCO A;  4CGZ A;  2L3D A;  2B7E A;  3E6B A;  2RQP A;  3F6O A;  3SJM A;  4A3I J;  2EPF A;  2FX0 A;  1EH8 A;  4BUP A;  4F55 A;  3HOW J;  3IV5 A;  2LP0 A;  3N97 A;  5BQT A;  4BHP A;  3SZT A;  4OIO F;  2JUG A;  4LK0 F;  1JT0 A;  4W97 A;  3HOS A;  3DF8 A;  3K4K A;  3NAR A;  1Y6I A;  3BRO A;  3BZK A;  4HLY A;  2IA2 A;  3TQN A;  4B3A A;  1WJD A;  4L9J A;  1AKH B;  3OIO A;  2ZFU A;  2HOA A;  4CXF A;  5DM6 F;  6PAX A;  1R5G A;  4EM0 B;  4P1W A;  3MVP A;  1H89 C;  3S2W A;  2EA2 A;  3GZN B;  3GXO A;  2UZK A;  1O3Q A;  3B02 A;  3DKY A;  2XGE A;  4MFE A;  2WBM A;  4NC7 A;  5ICF A;  1KQ8 A;  1LVK A;  2JA2 A;  4BS9 A;  1ZR4 A;  2M34 A;  1SC7 A;  4UVA A;  1S6L A;  2JTV A;  2JVG A;  4BGD A;  3LQR A;  3IAM 2;  3FXU A;  4XQF A;  2OBP A;  1MIJ A;  3MMY B;  2P6T A;  4V2F A;  4FAS D;  1Z77 A;  1FYM A;  1O7F A;  2ECC A;  2RNG A;  2NXN B;  2QSH X;  4AIJ A;  3K4M A;  1HC8 A;  4ZC3 A;  2XRN A;  4LFU A;  4U88 A;  4B48 A;  5K5Q A;  3K0L A;  3S3M A;  2MYS A;  2BZT A;  1FIA A;  4MQV A;  2W84 A;  1WJB A;  4WCG A;  2VPL A;  2YUS A;  2A68 F;  2ID6 A;  3ABM H;  2IT0 A;  1TWG J;  2GBY A;  3IWZ A;  2XV4 S;  4Y4R A;  3TMO A;  3U1K A;  2QA4 I;  4X6A J;  4OIN F;  2XPV A;  1VQ9 I;  2Z33 A;  1FP2 A;  1L3L A;  1R71 A;  3BJO A;  4DJA A;  3ABK H;  2K27 A;  1ZKG A;  5EF6 A;  3L1P A;  3TO9 A;  1ETO A;  2JWT A;  1AWC A;  1I5Z A;  1MMD A;  1MSF C;  3HKZ A;  2E35 A;  4AU7 A;  1BC7 C;  4BKX A;  3R60 A;  3CLO A;  2YSR A;  5H6R A;  5GTH C;  1X1B A;  3VEP A;  3HOX J;  2ZSH B;  2BHZ A;  1W7P D;  2F5F A;  2IW5 A;  2CV2 A;  2F6C A;  1I3Q J;  2BBY A;  3AL0 C;  2VQG A;  3TO7 A;  3V42 A;  4L0Y B;  1U9O A;  1YRN A;  2R7Z J;  1ZH5 A;  2YR2 A;  4M72 A;  2L7Z A;  3IH2 A;  2VUM J;  4Q47 A;  2JJ7 A;  1R1U A;  3HHH A;  1OR7 C;  1O3S A;  1V5E A;  4R8H A;  4RA2 A;  1GV5 A;  3HPG A;  4G94 A;  3I54 A;  3KZI C;  1SD5 A;  3MD2 A;  1TW3 A;  1RR8 C;  3HYI A;  1LFU P;  5D4S A;  1VFC A;  4HZF A;  4XRS A;  1YI2 I;  4ZDL A;  1LE8 B;  3JR9 A;  4UXN A;  2XKO A;  5JHF A;  2DQL A;  3HIF A;  2E1M B;  4KDP A;  3LSG A;  4FE4 A;  5E20 A;  2HKO A;  3KP5 A;  3GTO J;  4R1H A;  3K1P A;  2OF7 A;  2L7K A;  1LKX A;  3E97 A;  4M9Z A;  4ZDO A;  1J75 A;  4AUX A;  3JCU C;  1BC8 C;  4ESF A;  1ETX A;  5DV5 A;  3OSF A;  2KMU A;  4KT5 C;  1VQ4 I;  1Z6T A;  2EV5 A;  3GUD A;  4HPQ A;  2IRF G;  4Z2Y A;  1LUJ B;  2VQL A;  3SQN A;  1WJ5 A;  3OYD A;  3OYF A;  1T6S A;  2V1D A;  3OL3 A;  5IT9 Z;  2V9V A;  1G8X A;  1D8J A;  4HST A;  1WHU A;  2CMP A;  1QNT A;  4L5E A;  5J40 A;  3BR3 A;  4LLL A;  3ZQF A;  3MKY B;  3CF5 F;  2DLL A;  5CLS A;  1MMN A;  2L9N A;  5FFZ A;  2V6E A;  2ZME A;  4IHX A;  1XS9 A;  3OMY A;  3L2C A;  2XUB A;  5EEH A;  3FXO A;  2W25 A;  2F4I A;  2JPC A;  4XR6 A;  3RPQ A;  3H36 A;  3NWT A;  2IP2 A;  4RAY A;  2A6T A;  2VQC A;  3FHZ A;  1X4P A;  3RPU A;  1O7L A;  1LFP A;  2VBZ A;  1UG0 A;  3BC8 A;  2X4H A;  3AL0 B;  5CQE A;  1FBQ A;  1I3A A;  3ZQH A;  1JKQ C;  3BR0 A;  1QZE A;  5EYR A;  4CCJ A;  3OYA A;  3L2R A;  3MKW B;  2FQ4 A;  3CJR B;  1REP C;  2D5V A;  4EM2 A;  3KYC B;  5FKK A;  4BHB A;  4HLX A;  3CUQ C;  1T98 A;  3DEU A;  4ZZL A;  3O8H A;  1U5T C;  4ETS A;  1DP7 P;  3K70 C;  1TWF J;  3WHC A;  3EPZ A;  4KJZ A;  4BQN A;  1XPX A;  2X85 A;  2IJL A;  3PQJ A;  4ITV A;  4BDY A;  1W5T A;  4I01 A;  2DT6 A;  3GCM A;  2ETH A;  2JPB A;  3WGH A;  2Y69 H;  1MJB A;  5DDG A;  4N9I A;  5M3M J;  4RGX A;  1D8K A;  3QYF A;  3A1Y A;  3HB9 A;  3K2A A;  4IJA A;  3F23 A;  2EIM H;  2VOP A;  5M5Y J;  3OIP A;  2IA0 A;  4IRG A;  4PFO A;  3K70 D;  1IRX A;  5B66 C;  1IAW A;  2A69 F;  2VXZ A;  1X2M A;  3FWE A;  3ZMV A;  1T39 A;  3HJE A;  3IKT A;  1OCZ H;  2L9S A;  5AIP A;  4JX5 A;  5LHH A;  3CMA I;  4G7O F;  1DPR A;  2K3F A;  4A3J J;  2R5Z B;  5F6F A;  4U0W A;  1ZYR F;  4L9T A;  2EZL A;  5J6X A;  1D0X A;  1GHC A;  1TZL A;  1HW2 A;  3A03 A;  3BTC A;  1EV7 A;  2KZV A;  2M1B A;  2CUZ A;  4XM3 A;  4MLO A;  4DYC A;  3PNV A;  2XPW A;  2CQ7 A;  3CMY A;  1ZLJ A;  3HKZ N;  2VPR A;  4B43 A;  1IXS B;  3K2Z A;  2Q8K A;  2EFP A;  4LK1 F;  1X1D A;  5LGT A;  4A3F J;  5DYM A;  1VZ0 A;  5JLX A;  2W4S A;  5KAF C;  4NB5 A;  1I1S A;  5M3F J;  3SZP A;  1XGO A;  4LIU A;  4P5O A;  1RRJ A;  1B1B A;  4HBL A;  3CUQ B;  2KL4 A;  4FIS A;  1OYW A;  2NNY A;  2DA6 A;  5CVJ A;  2HI3 A;  4I7H A;  5HS9 A;  2HYF A;  1AA7 A;  2YS9 A;  3W6V A;  3OYG A;  2WA0 A;  2Q2E B;  2BV6 A;  4CDG A;  2CQQ A;  2XRO A;  4UV8 A;  1RKW A;  3K4B A;  3KEQ A;  5D8L B;  2ZNY A;  1HCR A;  3GTK J;  1QPM A;  2H09 A;  1K6O A;  2MAB A;  1ZGW A;  5EGO B;  4BL0 B;  4KN7 X;  5K5O A;  2EWN A;  2P7C B;  5F27 A;  4R79 A;  3CJQ B;  4D7N A;  5LRS A;  4GO1 A;  3HOZ J;  4DYR A;  2W24 A;  3CJT B;  1IV6 A;  2F5E A;  3BPX A;  5F0H A;  2DXI A;  1IN5 A;  1A35 A;  1IC8 A;  2F2E A;  4NBQ A;  3EUA A;  2PBI A;  3M8J A;  1DUX C;  3O8G A;  4Y17 A;  4F52 A;  4BQQ A;  3WTV C;  3RSN A;  4M3G A;  3PIP F;  3GZ6 A;  3DLL F;  4HG2 A;  4FT8 A;  3LAJ A;  5AIQ A;  2R7F A;  2HZT A;  4Q4Z F;  3F22 A;  2ACJ A;  1I39 A;  2FNA A;  3FXK A;  1XMX A;  1J5Y A;  4EGZ A;  3LOC A;  4JP0 A;  2PG4 A;  3LAP A;  1MW7 A;  3KP2 A;  2D1H A;  3LWF A;  4OU0 A;  2E2H J;  2UUZ A;  1BI0 A;  1XDS A;  3JW4 A;  4PSX A;  2MFZ A;  5J47 A;  3WG7 H;  2WB1 A;  2QM3 A;  4B47 A;  5EDN A;  2Y31 A;  1FZP B;  1YX5 A;  3MWM A;  2LKX A;  5D5X B;  1W4M A;  2Y0S A;  4BXX J;  2CO5 A;  1WH5 A;  4XRM A;  1IDZ A;  4FET A;  2DFF A;  5J1U A;  1MH4 A;  1YG2 A;  2H8R A;  1B72 A;  3PUF A;  3WE3 A;  1T33 A;  3FMQ A;  2EB7 A;  1ETV A;  5FKO A;  1QU3 A;  4M6X A;  3O3K A;  1LJ9 A;  5C3E J;  5HLI A;  2IGM A;  2LBF B;  2GM4 A;  2QQB A;  2VBX A;  2O8K A;  3S2H J;  2HEO A;  3WG9 A;  2DOE A;  4BE1 A;  2LSO A;  5D6E A;  4YRV A;  5GPC A;  1BR1 A;  2VBW A;  1YO5 C;  1RKT A;  1FMV A;  3DP7 A;  2IS1 A;  4UB8 C;  4XSZ F;  1JGG A;  2L0K A;  4IPA A;  1Y0U A;  2CRG A;  3CTA A;  3VYR B;  1QZZ A;  2V4J C;  5HLH A;  3LSK A;  1KGS A;  4Y3O A;  2K9S A;  3E0J B;  4RGS A;  2ELK A;  1G3W A;  2M7A A;  5JLW A;  3H9G A;  4NQW B;  4IHY A;  2EFN A;  4BHC A;  4BBS J;  1UHS A;  5DCM B;  5LEK A;  1TQI A;  4XSX F;  3WGI A;  2E34 A;  4L9V A;  3N4M A;  1U2W A;  1ZN2 A;  3LFU A;  3S15 J;  4B8X A;  3A4C A;  2OPT A;  4CYC B;  3WU1 B;  2QBY B;  2CU7 A;  3M1E A;  2UWM A;  1MBK A;  2XRL A;  1FMW A;  3G1M A;  2X6Y A;  3JAM K;  3D5S C;  4ASN A;  4FX4 A;  2HOE A;  3BDD A;  1MNE A;  2DFI A;  1U3E M;  2IS4 A;  4FQG A;  1HBX G;  3OWT A;  4AVZ A;  4A93 J;  5LFA A;  3NWS A;  3PO2 J;  3J80 K;  2M4G A;  3F9K A;  1S3J A;  3QU3 A;  3I59 B;  4ZDP A;  2M8E A;  4ZTJ A;  1MBJ A;  3CLQ A;  3TOA A;  2RKH A;  2ESH A;  1IUF A;  5E1Z B;  1IRG A;  3OYC A;  4BNC A;  2MGQ A;  2ELH A;  2K9L A;  4BE2 A;  1GXP A;  2HTS A;  1JXS A;  3LSR A;  3DBL B;  2STW A;  3K4N A;  2R7Q A;  2JUC A;  1J59 A;  1B6A A;  2BW3 B;  2GIZ A;  3EUH A;  3RQI A;  4FE7 A;  5IT3 A;  1YJW I;  3QP6 A;  5JFR A;  3TO6 A;  1SFK A;  3VDX A;  3DQV C;  2BW3 A;  4N4O B;  3JRH A;  2AXL A;  3T5X A;  2GXG A;  1TQP A;  3DPT A;  4D0P A;  4L0Z B;  4KIF A;  3W2A A;  1SD7 A;  2KKO A;  4L5J A;  4NC8 A;  4BXF A;  2FJ1 A;  3D1N I;  1FEX A;  4Y33 A;  4IHS A;  3C2G A;  4PJM A;  4MFD A;  4F92 B;  1T38 A;  4LG0 B;  5HOO A;  1UB9 A;  1FT9 A;  2H6C A;  3P7N A;  5J1R A;  4LMY A;  2ZJP F;  1OCO H;  2H8W A;  1XSV A;  2IPQ X;  3GO5 A;  2KIS A;  4LJZ F;  1H0M A;  4HRI A;  1RZ4 A;  4E7I A;  3ZRG A;  1VND A;  1YFH A;  1MD0 A;  2LOO A;  4RS8 A;  2A5W A;  1S72 I;  2A05 A;  4M3F A;  1J09 A;  1E3O C;  3KYD B;  2R3S A;  1UCR A;  3DFG A;  1CGP A;  5CVI A;  1G2H A;  4DBQ A;  3GYH X;  1V5F A;  5E3L A;  2WAQ N;  5K5R A;  2DU9 A;  4UV9 A;  1VQ5 I;  1ERD A;  3KP3 A;  3RDI A;  1RET A;  3RKY A;  1MDM B;  2JA7 J;  2YX4 A;  3KZZ A;  3QYB A;  1S8N A;  1H9T A;  4CO8 A;  5HOD A;  2KLO A;  3BY6 A;  1BJZ A;  3L09 A;  1NK2 P;  3CC2 I;  3CCY A;  3MEX A;  1QPI A;  1HKT A;  3MN2 A;  1XMK A;  1JTX A;  2DOF A;  3CES A;  4W1U A;  1XSX A;  4IHW A;  3ZQ7 A;  2UXN A;  3I4M J;  1ETY A;  1CF7 B;  3ZQI A;  2ME6 A;  3OYH A;  1ZAO A;  2DYS H;  5F0C A;  2LR8 A;  2WV0 A;  3BT9 A;  4UVC A;  2DT5 A;  3IAS 2;  3G6E I;  4EEF G;  3CC4 I;  3DEE A;  2ZJ2 A;  1KYZ A;  2O7O A;  1BL0 A;  2PMH A;  2NNN A;  2VKE A;  2LMD A;  3CCV I;  1LB2 A;  1HXD A;  4A2U A;  1OCC H;  4G6D A;  2LRE A;  2COB A;  2MC3 A;  2E36 A;  4I02 A;  1F9N A;  3WHB A;  3K10 A;  4XOT A;  1QO0 D;  1R4N B;  2CFX A;  2NS0 A;  3KLN A;  3NAU A;  3R4K A;  4MGR A;  2QYO A;  1UST A;  3EDP A;  3OIQ A;  3CP8 A;  4IRH A;  3J7Y J;  3T0Y A;  4RBO A;  2BXZ A;  5B1B H;  3BLY A;  1A6Q A;  2EIK H;  3MKL A;  3OYB A;  3BG9 A;  3KX2 A;  3KP7 A;  4MNU A;  3S17 J;  4WXH A;  2CJJ A;  2BE5 F;  2V6C A;  2E2I J;  4XOR A;  1R7J A;  2DA3 A;  3QOE A;  3F21 A;  2P81 A;  4HYE A;  4IX7 A;  3BWG A;  1ZR2 A;  5ICG A;  2I8D A;  2XAQ A;  3GFJ A;  2ECB A;  2EZI A;  4WXD A;  3HRT A;  2Q1Z B;  2F5C A;  2KRH A;  5FKL A;  3A01 B;  3ZQC A;  2RRE A;  4XNF A;  2CGP A;  4ZJZ A;  3FZV A;  4KFC A;  4CCK A;  2VAS A;  3V8L A;  2ELJ A;  2M45 A;  1CQT A;  2ZFW A;  5B5E C;  1MSE C;  2LVS A;  3F8N A;  1BIB A;  2LG4 A;  2HDC A;  3ZR8 X;  2Z9O A;  4Q48 A;  4XLH A;  2ZSI B;  3EUK L;  3K4C A;  5FB2 A;  4XKW A;  3IH4 A;  4BEH B;  1BIA A;  1XB4 A;  2K86 A;  3PM1 A;  4RDU A;  1SFU A;  1VI0 A;  1WJC A;  3BJ6 A;  3GW2 A;  1L0O C;  5BOX A;  2J5O A;  4GFB A;  3QOD A;  4RB1 A;  2FXA A;  3JRC A;  4J01 A;  4E7H A;  3Q9V A;  3BG5 A;  3TKY A;  1SAN A;  4HQM A;  5EG0 A;  2A6E F;  3C18 A;  3J7A O;  3RYP A;  2IEK A;  2PX9 A;  2IS6 A;  1EF4 A;  3DWL E;  2L9V A;  5IOY A;  2MLK A;  3FXL A;  4PCQ A;  5F0F A;  4OAY A;  5GAG J;  4YEL A;  4WWC A;  1SAU A;  4IF4 A;  2VI6 A;  2DPD A;  2FBI A;  2IGK A;  3F0C A;  1YIT I;  1LPQ A;  1SMY F;  4FHT A;  3WTY C;  2DMQ A;  2Y9Z A;  4XKB A;  3T8R A;  2DYR H;  2M87 A;  3F8M A;  2PN6 A;  1Z1D A;  3NRV A;  1E3H A;  1MMS A;  2VB6 A;  3KIO A;  2H1K A;  2V1U A;  2MC4 A;  2EIJ H;  4OAZ A;  5TIS C;  5FGM A;  3OS0 A;  4QIW N;  4I98 B;  2OTJ I;  2VJJ A;  1SVL A;  2B9S A;  3IP4 B;  4CCO A;  2JZY A;  5JHU A;  2QGU A;  2IGN A;  1QQI A;  5EZH A;  1ACI A;  3M7G A;  5TJJ A;  1ETW A;  1S7E A;  1R58 A;  3CME I;  3R0J A;  2Z1D A;  5E17 F;  3VWB A;  3M8E A;  5J8C A;  1ZG1 A;  4UY8 I;  4A69 C;  1R5H A;  2KPM A;  1KU9 A;  4D5C A;  1K79 A;  2E1M C;  1FYK A;  2ZXI A;  2W57 A;  1D1B A;  4MTE A;  2P5V A;  5ILV A;  4BJT A;  3K4J A;  2VON A;  4BQO A;  1TL8 A;  1B9N A;  4XBF A;  5D5W B;  1MNM C;  4UUV A;  2ZBK A;  2DK8 A;  5K7Z A;  1X3U A;  3HRU A;  2QVO A;  1WRJ A;  4IL6 C;  1TLH B;  3PFY A;  3OYL A;  2QKM B;  2ZME C;  2K9M A;  2WAF A;  2IA1 A;  4RM3 A;  3CCJ I;  3K69 A;  5DCF A;  4E7J A;  4E4H A;  2LY2 A;  3DEW A;  2VLA A;  4LLG F;  5FRM A;  2X9D A;  1U78 A;  3L2W A;  1IF1 A;  2E60 A;  2HDW A;  4HF0 A;  2A5Y B;  4C2T A;  4HNT A;  1POG A;  2EK5 A;  3CCQ I;  1XD7 A;  1P2F A;  2Y48 A;  3MKZ A;  2CQN A;  5ILS A;  3FXR A;  4BAC A;  5AON A;  5K7F A;  3BCB A;  2MH2 A;  1LQ1 A;  1T08 B;  3G1O A;  1Y8Q B;  2CFO A;  2ZNZ A;  2EIN H;  3BP8 A;  5E3M A;  4XN0 A;  3COA C;  1D5V A;  5JR3 A;  1S7O A;  4RM2 A;  4IHT A;  1YRN B;  1WH7 A;  2Y0M A;  4C3H J;  3EYI A;  4KIB A;  1VQM I;  2WC2 A;  4IKF A;  2R7U A;  3DPL C;  3Q0V A;  4YFN F;  2R7X A;  2EZK A;  4PUS A;  3G3Z A;  1G3Y A;  4M71 A;  4GGG A;  5ERI A;  5KK1 A;  1HLV A;  4MQ9 F;  2VE9 A;  1KQ9 A;  2ZXW H;  5CVV A;  1ETK A;  1TNS A;  2K7L A;  1JKR C;  2R92 J;  5CQG A;  1D5Y A;  4B4C A;  2PJR B;  3GTG J;  1D3Y A;  5HLG A;  2X51 A;  1FPQ A;  3R6S A;  3C2B A;  1WJA A;  2P4W A;  2W82 A;  4EMS A;  2F4M B;  4HNV A;  3OYK A;  3ZQG A;  1Z05 A;  3KEY A;  2PJR A;  2XGD A;  3QPT A;  3IHU A;  5JVT A;  3FK6 A;  5J4V A;  1W1W E;  1PP7 U;  2MBF A;  1OKR A;  2ICW G;  1IZ1 A;  4JX4 A;  3GTQ J;  1YYV A;  3LQQ A;  2QEX I;  3BOQ A;  2B63 J;  3DBR B;  2L5Q A;  4HV6 A;  2FBK A;  1O3T A;  3NEU A;  3LMM A;  4ESJ A;  3GFI A;  3LST A;  3HBL A;  2K5C A;  2DJN A;  2ZME B;  4LLN A;  2LKS A;  3E7L A;  1ON2 A;  3H9Q A;  5FFX A;  4RB3 C;  1T0F A;  4WXC A;  4XLE A;  4NNJ A;  2HTJ A;  3GTL J;  3V7R A;  4J19 A;  1ZQ3 P;  2PQ8 A;  2DBB A;  2UV1 A;  2FU4 A;  1SD6 A;  2LF7 A;  4OIQ F;  3VOE A;  1N77 A;  3AG3 H;  3FF5 A;  2EIL H;  2FOK A;  2DMN A;  2QF7 A;  1GLN A;  1OJL A;  2LY9 A;  4Y15 A;  2DW4 A;  3LSM A;  3BG6 A;  1C0W A;  2W48 A;  4XOP A;  1W7P A;  2HQA A;  1BA5 A;  3BTI A;  4A6E A;  4HSR A;  4CH7 A;  1BW5 A;  2A6H F;  2VJ5 A;  3ZN1 A;  4E6K G;  5EEA A;  3BR2 A;  3C7J A;  4FX0 A;  4KIC A;  4NC6 A;  3SHF A;  2G7H A;  3TW6 A;  4EJW A;  3RCO A;  3QU6 A;  5HDK A;  1IUY A;  5H20 A;  2R7D A;  2AO9 A;  5ILU A;  3TBI A;  2DMT A;  3LL7 A;  3S1R J;  2NYX A;  5IP7 J;  2YX7 A;  5F1J A;  3AFH A;  3BR5 A;  3JSP A;  3G2B A;  4M3E A;  2PMZ A;  3BPV A;  5FD5 A;  5ICC A;  2RGV A;  3HEF A;  1IN6 A;  1S9H A;  5CKT A;  3WU2 C;  2RC4 A;  1WFX A;  3HHG A;  2EH3 A;  2DO7 A;  4UB6 C;  1XMA A;  2HU9 A;  3CP2 A;  3DKX A;  4XMY A;  3H92 A;  3P9I A;  3H35 A;  3KP6 A;  4ZYD A;  2HOT A;  2CUF A;  4I6Z A;  1YJ9 I;  5A2Q K;  1FOW A;  1P9Q C;  1BOB A;  1E2X A;  3QRF F;  1YX3 A;  3BTL A;  3QYE A;  4L18 B;  3IH3 A;  4IZZ A;  1P4W A;  2OCC H;  1MBG A;  4N0B A;  4CCL A;  4X0G A;  3VPR A;  4ENM A;  1I27 A;  2K9Q A;  1R5I D;  2CW0 F;  3GME A;  2XSJ C;  4PZJ A;  3BR6 A;  1V55 H;  1EKE A;  1USS A;  3L7W A;  1QHH D;  1F43 A;  4NUB A;  2BHY A;  5CJ9 A;  5IOZ A;  5FRN A;  3F8F A;  5L3E A;  4XRS G;  4KUM A;  3FXQ A;  3I55 I;  2ADU A;  2IVM A;  2OCE A;  1ITY A;  1SD4 A;  2NS7 A;  1ZRD A;  5E8G A;  5CPR B;  3WOD F;  2QQ8 A;  1HSJ A;  2JN6 A;  3FIS A;  2FE3 A;  2EV0 A;  2VOD A;  5TGT A;  3KE2 A;  3GBG A;  4V19 K;  2GIV A;  1YW9 A;  4EAT A;  2DTR A;  3ABT A;  3V8J A;  2BVM A;  1X1P A;  5E3N A;  2HPI A;  2P0W A;  2ZKZ A;  2XKP A;  4FCY A;  2QLZ A;  4HV5 A;  1FTZ A;  3VFZ A;  3OV8 A;  3OYI A;  2Z5U A;  3Q9S A;  4X1E A;  3ASN H;  2ZC2 A;  3OSG A;  2EJR A;  1J7K A;  2H6B A;  3HTS B;  1VQP I;  1KQ0 A;  2HVR A;  3PJR A;  5LEJ A;  3Q0W A;  3F6V A;  1Z3X A;  3F3X A;  2GXB A;  3F72 A;  1OCT C;  2TRT A;  3JTH A;  4BAY A;  3KPH A;  4OWR B;  4HF2 A;  4E7S A;  4AD9 A;  2F4O B;  4M9S A;  1FSH A;  3HXL A;  3FMR A;  4XKV A;  1W5C C;  3KLO A;  3ZPL A;  3S1M J;  1DGR M;  2Z99 A;  2GA2 A;  1K78 A;  1JJ6 C;  1U5T A;  2OC6 A;  2XAH A;  1IN8 A;  3BQZ A;  5DS9 A;  2FUG 2;  4BE0 A;  2GOX B;  2DMU A;  1WI9 A;  2VN2 A;  2G0E A;  2ISZ A;  3HUG A;  4CA0 A;  5ICE A;  2VKD A;  3BJA A;  3I71 A;  3SDB A;  3FHN A;  3GTM J;  2YU3 A;  3D5R C;  1Z7L A;  2O61 A;  2JMW A;  3HPH A;  4MTD A;  3FXM A;  3ZCO A;  5E3O A;  3QPH A;  1WI3 A;  2KHM A;  3Q0U A;  9ANT A;  2K40 A;  4XL9 A;  1IO2 A;  3I58 A;  1ETQ A;  3VSK A;  3CO7 C;  4BH9 A;  3VYT B;  3S8P A;  1FBU A;  2LNB A;  2W7N A;  1X3Z B;  2BXY A;  4GCV A;  2IAI A;  2VC1 A;  1G3T A;  1QA6 A;  2A61 A;  1EH6 A;  2M4K A;  2O5R A;  1IRF A;  2WV1 A;  1B72 B;  1GDT A;  5L3B A;  3BZ6 A;  1ULY A;  3X2Q H;  1LEA A;  3CUO A;  1FX7 A;  1DU6 A;  1IRZ A;  1G6N A;  1XGN A;  3RZD J;  3QP5 A;  2HVS A;  2KJB A;  5LHG A;  4LIV A;  4BY7 J;  4QTR A;  3JRI A;  3OL4 A;  1K7A A;  2MG4 A;  3D0S A;  4II3 A;  3JAM Z;  4C2M J;  1YQA A;  2RQQ A;  2FQ3 A;  3DLA A;  1F1Z A;  4V2G A;  1X1A A;  3FIW A;  3HSE A;  3ZMS A;  3M1C A;  4LIT A;  2LY1 A;  3DXJ F;  4JOM A;  2NAZ A;  5DM7 F;  5FRO A;  1Y1W J;  4WK8 F;  2NVX J;  1GV2 A;  1Z67 A;  3J80 Z;  1FC3 A;  4YII A;  1FOK A;  4N9H A;  3L9F A;  4XKC A;  3UKG A;  1TNT A;  2AHQ A;  1T8I A;  1LVA A;  4E7Z A;  3HOY J;  4HEA 2;  4A3E J;  3JSO A;  1MJ9 A;  2L02 A;  4E7L A;  3ZMD A;  2PJP A;  3K9T A;  4CCN A;  3FKJ A;  2GLO A;  1TWA J;  2PMZ N;  5HS7 A;  1BBY A;  1V54 H;  4K2E A;  3RTR A;  3I5U A;  1JKP C;  4H0E A;  4CSW A;  3PL8 A;  1W36 C;  4HQE A;  2CWE A;  4RB2 C;  4P9F A;  1OCP A;  3J7Z I;  1LDK B;  3MZH A;  2M7B A;  1KU3 A;  3HG9 A;  2OZ6 A;  5FLX Z;  1X58 A;  4JQF A;  2XF7 A;  4Z6Y A;  2O03 A;  2QEN A;  1A5J A;  3S2D J;  2FOW A;  4AC0 A;  1YW8 A;  3BCA A;  1P4X A;  1Z0X A;  3U21 A;  5KAI C;  1JUP A;  3ZMU A;  5F1R A;  1UHM A;  2DA1 A;  5FD6 A;  2R5Y A;  1VQK I;  3LSH A;  2P8T A;  3ASO H;  3EQL F;  2CW8 A;  3KEO A;  1Z21 A;  1NK3 P;  3M4O J;  1W36 D;  2LYC A;  3JRB A;  4XRF A;  2HWV A;  5LD2 C;  3I64 A;  2GXA A;  2RAE A;  1X1C A;  3PFI A;  2XF5 A;  1DGW Y;  2E5N A;  4BXU A;  2M9H A;  2GZW A;  4B1R A;  2DDA A;  4YFK F;  2AQE A;  1AU7 A;  1YW7 A;  2P5K A;  3L00 A;  4YEJ A;  3JRE A;  1FLI A;  2VE8 A;  2DFE A;  1X19 A;  2IGO A;  3C2H A;  4ZYA A;  4IOA F;  4A3C J;  4HOB A;  3TOB A;  1ON1 A;  3W2V A;  5DUI A;  2KP6 A;  1YS6 A;  4HX4 A;  3FK7 A;  1SFE A;  5LGN A;  2VC0 A;  4ZTF A;  1VQN I;  2WAE A;  2XIG A;  4RGR A;  3HOU J;  3MZ8 A;  1O57 A;  1STZ A;  2FMY A;  5FLX K;  3KET A;  2JA5 J;  3TGN A;  3IRQ A;  3F8C A;  2OU2 A;  2XB0 X;  3T8T A;  2WTE A;  3CMM A;  4PFP A;  3L2U A;  3QAH A;  1A31 A;  1G3S A;  4KIS A;  2OV7 A;  4I99 C;  3H5R A;  3U2R A;  5D5V B;  1AHD P;  3S32 A;  3SEQ A;  3IKV A;  1R6R A;  2CH0 A;  3Q5F A;  2R7S A;  3K1N A;  3NQO A;  3DPU A;  1JE8 A;  5GAD J;  2O9L A;  1TT0 A;  1JTY A;  1HW5 A;  1RNL A;  4DQ2 A;  4PGG A;  2VBY A;  3D5L A;  4PJN A;  1QGP A;  2HXO A;  2QZ8 A;  4IXA A;  2AS5 F;  4PSW A;  5JVG F;  4KA4 A;  4U0Y A;  4EJT A;  4CIC A;  4JBA A;  2XGX A;  5KHD A;  2P6S A;  4XLF A;  2V26 A;  4DZP A;  1XGS A;  1F5T A;  1TWH J;  4KNY A;  2LKP A;  3ERM A;  3KCC A;  2HNH A;  2FRH A;  2KIF A;  1S7A A;  3Q3S A;  1YS7 A;  2FSW A;  2L4A A;  5E8I A;  1AOY A;  3DU6 A;  5EZG A;  1BJA A;  3ZOB A;  2ZJQ F;  1XDU A;  2V9K A;  3BG3 A;  2A07 F;  4BYY A;  4DIQ A;  2KDO A;  2HVQ A;  3S1Q J;  2WB1 N;  1R9T J;  1JJ8 C;  4O5V A;  2BVL A;  2EA4 A;  4EM1 A;  3FKI J;  3VB2 A;  2Y0S N;  3ESW B;  2ZB9 A;  1DDN A;  3I4N J;  4IQJ A;  4A6D A;  3GLX A;  4OIP F;  2X6X A;  2XSD C;  1UJ8 A;  3JTG A;  3S16 J;  2X6O A;  2MSY A;  1HA8 A;  1RPW A;  2COM A;  4KMU X;  5F64 A;  3HM5 A;  5FO5 A;  2R93 J;  2CV0 A;  4PDK A;  1BI1 A;  2DK5 A;  2E2J J;  1PYV A;  3K7A J;  2O6G E;  2ISY A;  2M8G X;  3GEZ A;  4XON A;  2LRD A;  4XID A;  1I50 J;  2X1E A;  3H3V K;  2DA5 A;  3BR1 A;  5DD8 A;  3V7S A;  4A0Y A;  2CQX A;  1UEL B;  5D8K B;  4A5M A;  2AXT C;  3OS2 A;  1KZH A;  4F91 B;  1OQY A;  4N4N B;  2JQ7 A;  4EJO A;  1F36 A;  4IQ4 A;  1V3F A;  1K83 J;  2HPM A;  1HDP A;  4I0B A;  5LBQ A;  1Z7U A;  3CF2 A;  2CW7 A;  1I6H J;  3H0D A;  2LD5 A;  4O3M A;  2H27 A;  4Q5S F;  2X1C A;  1VQ8 I;  2CUE A;  3GTJ J;  2XAJ A;  2JSP A;  4DZJ A;  3DKW A;  4ZH4 F;  1H88 C;  4QPQ A;  3C3W A;  1M1E B;  1OPC A;  4ABZ A;  1YTY A;  5HDN A;  1G4D A;  3OR1 C;  3TL4 X;  4C2U A;  4WX9 A;  1JI8 A;  4OMY A;  1X4O A;  1ZRF A;  2DA4 A;  4RGU A;  2LLK A;  3HZJ A;  2VOO A;  5FJ8 J;  3RYR A;  5GTI C;  4AYB A;  2BEO A;  3I56 I;  5IPA A;  2PI0 A;  4U7B A;  2L9R A;  5EG0 B;  5IYD J;  3QQA A;  1R1V A;  1TBX A;  4NDL A;  5D6F A;  2HKX A;  4JK1 X;  4D5F A;  1K4S A;  2XAU A;  4E7K A;  2DJI A;  1YJN I;  1IN7 A;  3H3Z A;  4A12 A;  1O3R A;  1LDD A;  2P5L C;  2P7V B;  3I53 A;  1IV8 A;  4XN3 A;  1TTY A;  2CUJ A;  4G8X A;  3I0T A;  1R1T A;  4H4K C;  4ZYE A;  4A3K J;  1B8I A;  3FDY A;  5B3S H;  2VXD A;  3QPL A;  4XK4 A;  2FNP A;  1A6I A;  1HOM A;  3VOD A;  4EV0 A;  3VSL A;  3DBH B;  1K61 A;  3TP0 A;  4A3B J;  2XAS A;  4WF2 A;  3WGG A;  2XDV A;  3S1N J;  4EQQ A;  3EET A;  4U0V A;  3WTW C;  3ULQ B;  4EJU A;  1JUM A;  1W0T A;  3DTK A;  1NG6 A;  5IY5 H;  1VQL I;  1NHA A;  1QVT A;  1IXR C;  3AG4 H;  2AQF A;  2HR3 A;  5DEQ A;  3JRF A;  3FM5 A;  3DU5 A;  3OOP A;  2KRC A;  5L3D A;  4LD5 A;  3RKX A;  1VQ6 I;  2BY3 A;  2V79 A;  2JA6 J;  1IDY A;  3LSP A;  1VQ7 I;  1HW1 A;  2ID3 A;  3B73 A;  1FP1 D;  2MD0 A;  3W3C A;  2JSC A;  3FBI B;  4PJ0 C;  2KIU A;  2IXS A;  1MH3 A;  3BZC A;  1WPK A;  1D1A A;  4DGW B;  1VTN C;  1OYY A;  2HYG D;  2EBI A;  5FKN A;  1AKH A;  3GVA A;  1I6X A;  2DA2 A;  2X6W A;  3OR2 C;  3SFI A;  2LF8 A;  3PNY A;  2CV1 A;  2VT2 A;  3ECO A;  4AVP A;  4G12 A;  4CUG A;  2XHK A;  5M5X J;  3AG2 H;  2QQ9 A;  4XLA A;  2DDB A;  1T0F C;  1FBS A;  5BPD A;  2Y75 A;  4E70 A;  3HDD A;  1A04 A;  1U9N A;  2M0C A;  4G7Z F;  4KMF A;  3I4P A;  4S05 A;  2QKL B;  5GP9 A;  3P9K A;  4IO9 F;  4M73 A;  3GF2 A;  3HSF A;  4C30 A;  1GT0 C;  2NVU B;  4AWX B;  1QBJ A;  3JRG A;  4PK4 A;  2JT1 A;  2ZXJ A;  4RAG A;  2MD5 A;  2NVY J;  1SFX A;  1F4K A;  3J7A Y;  2O0Y A;  3L2V A;  4HDU A;  1DQU A;  1YHQ I;  1FIP A;  4FTH A;  3TP3 A;  1PUF B;  4ENN A;  4F3Q A;  4RB0 A;  2BY2 A;  3CDH A;  2Y2Z A;  3KZY A;  1EH7 A;  2OJE D;  1E3P A;  2CSO A;  1PUF A;  2G9W A;  2JVH A;  3MZY A;  1WQ2 A;  5E79 C;  3W2W A;  5LLQ A;  3CQZ J;  2GQQ A;  2FEZ A;  3ABL H;  3A02 A;  3TDZ C;  1HQC A;  3LA7 A;  3RPU D;  4AID A;  2RNJ A;  1PJR A;  2FML A;  4RAZ A;  3GX4 X;  2EV6 A;  2XF6 A;  4QPO A;  3K1M A;  2H1L A;  4BY1 J;  1TC3 C;  2M2E A;  2O8X A;  1X2N A;  5JI6 A;  3BQY A;  3S3O A;  1FYL A;  4J00 A;  3ELK A;  2E1C A;  1BOA A;  4RLF A;  1JKO C;  1LNW A;  5LRR A;  3H5N A;  2GAU A;  3DCF A;  4GYI A;  2HQN A;  2R7V A;  3WU0 A;  1SVO A;  1MJA A;  2Z16 A;  5EJC A;  2PFB A;  3LFK A;  3FM3 A;  4Y13 A;  2CG4 A;  2KRF A;  3HC7 A;  5FLM J;  3S93 A;  1WJE A;  5H6Q A;  2DQR A;  2BYV E;  2OZU A;  2WY8 Q;  2Y9Y A;  1XTA A;  4AYB N;  2XPU A;  4BDZ A;  5IP6 A;  1KU2 A;  2WAD A;  5D4R A;  2MA3 A;  1OCR H;  1JHH A;  3HGY A;  1ZGJ A;  4PGH A;  5IYC J;  1BR2 A;  3UR3 C;  4PJJ A;  4Y7N J;  2NVT J;  1Y56 A;  4A5N A;  1ENH A;  2QWW A;  2X48 A;  5HNH A;  3CCU I;  1LE8 A;  2M30 A;  2ZCW A;  5A2Q Z;  4S04 A;  1MND A;  3AKZ A;  1W7P B;  1ODD A;  2HS5 A;  1P7J A;  2MLG A;  1P7I A;  4C3J J;  3H5A A;  3LA2 A;  1ZLK A;  4I09 A;  2LH9 A;  1EJ9 A;  1WCM J;  1E0E A;  1GVD A;  2N8G A;  4LB6 B;  3VYU B;  1WKM A;  3ZXS A;  4A3L J;  5M5W J;  3OY9 A;  1YIO A;  4TV7 A;  3QWL A;  1UAA A;  2GOM A;  3PO3 J;  1R49 A;  2E7X A;  2DAO A;  4XLC A;  3V7C A;  2GA1 A;  4KT6 A;  2JRT A;  3H9J A;  3LSI A;  3A2K A;  2HFH A;  1D0Z A;  2HGC A;  4A3M J;  3CCE I;  2KJC A;  2VT3 A;  2XAF A;  5DUK A;  2KQR A;  3GLL A;  3FMS A;  5L3C A;  3TED A;  4D7M A;  3H1C A;  1BM9 A;  5B1A H;  5LHI A;  3JRA A;  2VIX A;  4BQA A;  3I3L A;  2QQA A;  1P92 A;  1FOY A;  2W85 A;  3OOU A;  4I2O A;  4BU2 A;  4A3G J;  1H8A C;  1LDJ A;  4MIM A;  2ZJR F;  4Y52 J;  2K02 A;  2OUM A;  3H0G J;  3GFM A;  2HYJ A;  3M9A A;  4CYD A;  2BGC A;  2X1D A;  1T56 A;  1KYW A;  5EEG A;  1OR7 A;  2MH9 A;  2RVC A;  4JX6 A;  3PSI A;  1IW7 F;  2LC2 A;  3CCL I;  3J81 Z;  5IT9 K;  4CZC A;  3MQ0 A;  4HA8 A;  3GFL A;  4BBR J;  1TQM A;  1TP4 A;  1W5S A;  4EVI A;  5J1Y A;  3W6K B;  4XLP F;  2EFW A;  4KN4 X;  5H2F C;  4AM3 A;  3GWZ A;  2HQ5 A;  1Z6R A;  2VKV A;  3IUO A;  4MEX F;  2FA5 A;  2O3F A;  1J0R A;  5DTD A;  2L2O A;  3CCS I;  1R23 A;  1GUU A;  1HKS A;  2BOL A;  2NOG A;  3E5X A;  1ZAR A;  4U7D A;  1UMQ A;  5FKM A;  5CVU A;  1SVM A;  1BN5 A;  2D1V A;  2DMP A;  2ME0 A;  4G7H F;  3G1L A;  1PDN C;  1IJW C;  3G73 A;  1QZY A;  5F08 A;  4GYG A;  3CDI A;  2QSG X;  3S3N A;  5CVR A;  3E3V A;  1P4A A;  2KT0 A;  1GXQ A;  5KCM A;  3T1B A;  1FY7 A;  5HLT A;  1BI2 A;  2XB5 A;  3C1D A;  2R5Z A;  2R0Q C;  1IN4 A;  1GVJ A;  2I10 A;  1R00 A;  3QPS A;  3OS1 A;  1BI3 A;  2QUF A;  4GDF A;  3J81 K;  2PEX A;  3ZQQ A;  4M3D A;  3A0B C;  1OMI A;  1ONV A;  4G9Y A;  3IC7 A;  2VJ4 A;  2X0L A;  2PMU A;  2V1N A;  3HGG A;  3U1D A;  1WGX A;  1W0U A;  4ZYG A;  2D45 A;  1MMA A;  2L01 A;  1UG2 A;  4DNC A;  1HF0 A;  2VJI A;  1K78 B;  4DBR A;  3G71 I;  1U5T B;  2E5Z A;  3ZN0 A;  2EQR A;  3CUQ A;  1XCB A;  3HUG B;  2M3A A;  2OA4 A;  1FJL A;  4AIK A;  2K4B A;  4DYQ A;  4M6Y A;  2M0M A;  4OIR F;  3FBN B;  2Q2E A;  4HNU A;  1FWZ A;  2RV8 A;  4ENJ A;  2NS8 A;  3LA3 A;  4QWQ A;  2K85 A;  2B0L A;  2Z2S B;  4OOI A;  5IP9 J;  3ZGK A;  4U87 A;  3CCM I;  2JRM A;  4GRI A;  5TRD A;  1VF9 A;  3TDU C;  1O4X A;  2C6Y A;  5GPA A;  2EFQ A;  3WTZ A;  2LFB A;  5EGO A;  3SZG A;  2R7T A;  1VQO I;  1TT5 B;  2E19 A;  2KZG A;  3LNQ A;  2VQH A;  2JA8 J;  1IG7 A;  3ZMZ A;  1FNN A;  3I9V 2;  1ZHF A;  1PP8 F;  4P55 A;  3A0H C;  1KU7 A;  2DCE A;  1RI7 A;  5ED4 A;  2E1N A;  1RUO A;  2WAQ A;  4MO7 A;  1U6G A;  2EZH A;  3ABU A;  1RES A;  4S0H B;  3B6C A;  3HSR A;  1Q1H A;  1ZG3 A;  1OYI A;  1WVR A;  3EUH C;  1WSU A;  1TW2 A;  4HAM A;  3MFK A;  2DI3 A;  5BNG A;  4AIH A;  4HDV A;  1MGT A;  4XLN F;  4B44 A;  2DOA A;  2FD5 A;  3M8F A;  4HX8 A;  4IOC F;  2HQR A;  1X3W B;  2M5W A;  1ZRE A;  3S14 J;  3REO A;  1V5G A;  1XG1 A;  3F8B A;  5CYV A;  2DPU A;  3LSJ A;  4KYW A;  5BS6 A;  4XIC A;  3SDG A;  3H3U A;  1RUN A;  1FOX A;  4KIT B;  3RZO J;  5C4J J;  4ANJ A;  3HL2 A;  3CC7 I;  2RN7 A;  1G59 A;  1MZB A;  1LFB A;  4D9J A;  2LBF A;  3PIO F;  2W00 A;  1T95 A;  4LG3 A;  5K7H A;  4L9N A;  2XAG A;  1MMG A;  3DTI A;  1FTT A;  4ON0 A;  1ZK8 A;  4YIR X;  3WTT C;  4O6J A;  3ZQL A;  1JT6 A;  3ERE D;  3BTJ A;  1NH3 A;  1A36 A;  2R5Y B;  3WTU C;  1OIS A;  4EJV A;  4G6T B;  2FBH A;  2OTL I;  1QVU A;  2K9N A;  1ZRC A;  4P96 A;  2DN0 A;  4F93 B;  3OYE A;  4HF1 A;  1SMT A;  2Q0O A;  3MCZ A;  5E1X A;  1WZ2 A;  3AG1 H;  3L2Q A;  3OYJ A;  2V7F A;  1WJF A;  2V1X A;  4CZZ A;  3VYS B;  4NQW A;  1XC5 A;  3M07 A;  1YOV B;  3TW7 A;  2OD5 A;  3P5J A;  3HRS A;  1XGM A;  1BR4 A;  3E5U A;  5DD4 A;  5DCM A;  1KON A;  4P9U A;  1N25 A;  3E1S A;  3MAJ A;  3PNT A;  3HOT A;  2HZD A;  2R7W A;  4A3D J;  2KDZ A;  1OFC X;  3RKW A;  2K3P A;  1N78 A;  1B9M A;  2K4J A;  1UFM A;  2E1O A;  4CYC A;  2V9P A;  3GTP J;  1D0Y A;  2QBY A;  1H9G A;  4GXO A;  1B59 A;  1XX5 A;  1MBF A;  4UUT A;  2CYY A;  3DV8 A;  2DOD A;  3UNG C;  1R22 A;  3ONQ A;  2DTZ A;  1U0J A;  1Z91 A;  2OQG A;  2HXI A;  5L3F A;  2STT A;  3B6A A;  1J2X A;  2CQK A;  2R4G A;  2BY0 A;  3IL2 A;  3ZMT A;  1YE9 A;  4YIF A;  4OMZ A;  5LGU A;  3EYY A;  5L3G A;  4LGW A;  5J4Y A;  5D5U B;  3I59 A;  2YPR A;  5BMZ A;  2HOS A;  5GAE J;  1ZTR A;  2L54 A;  3R0A A;  1V4R A; 
#chains in the Genus database with same CATH homology
 2CUJ A;  2MAB A;  2K5C A;  2IS2 A;  4H4K C;  4BL0 B;  4R79 A;  3CJQ B;  3FDY A;  3K4L A;  2R7R A;  3H9Q A;  2VXD A;  4B3X A;  4XLE A;  4NNJ A;  3VSL A;  2DXI A;  2UV1 A;  3K6G A;  2XDV A;  1N77 A;  3EUA A;  3M8J A;  2VL8 A;  4F52 A;  4BQQ A;  3RSN A;  3DTK A;  4HG2 A;  1GLN A;  1NG6 A;  2CS3 A;  4RMN A;  3LSM A;  2AQF A;  5KNL A;  3PUB A;  3BG6 A;  3DU5 A;  4PJL A;  4XOP A;  2KRC A;  2HQA A;  4BJ5 C;  4HSR A;  4CH7 A;  1ZEL A;  4BJ6 C;  2VJ5 A;  4E6K G;  1MW7 A;  2UUZ A;  4PSX A;  2MD0 A;  1Z3Y A;  2MFZ A;  3W3C A;  2WB1 A;  3FBI B;  4B47 A;  3RCO A;  2IXS A;  3CZ6 A;  1YX5 A;  1D1A A;  3BG7 A;  4DGW B;  2Y0S A;  3TBI A;  3LL7 A;  4FET A;  3OR2 C;  2X6W A;  2DT7 B;  3AFH A;  3PNY A;  3G2B A;  2CV1 A;  1K6Y A;  2PMZ A;  4CUG A;  1QU3 A;  5CKT A;  1OLT A;  1S9H A;  4XLA A;  1T0F C;  1WFX A;  2IGM A;  2LBF B;  3CP2 A;  2HU9 A;  3DKX A;  4XMY A;  5HNF A;  3H35 A;  4BE1 A;  5HVQ C;  4YRV A;  4DOZ A;  1P9Q C;  1BOB A;  1YX3 A;  1BR1 A;  2QKL B;  3KYL A;  1FMV A;  3QYE A;  2NOJ B;  2IS1 A;  4IZZ A;  4C30 A;  4CCL A;  4X0G A;  4PK4 A;  2R7O A;  3VYR B;  2V4J C;  1DP3 A;  3LSK A;  2XSJ C;  4Y3O A;  1QHG A;  3E0J B;  3J7A Y;  3L2V A;  1QHH D;  1DQU A;  2M7A A;  4NUB A;  5FRN A;  3H9G A;  4NQW B;  3OYM A;  1D1C A;  2VKH A;  4F3Q A;  3SEZ A;  2W1O A;  3RQ4 A;  5CPR B;  2JVH A;  3LFU A;  4CCM A;  3PSF A;  3A4C A;  3W2W A;  3DTE A;  5TGT A;  3RPU D;  3GBG A;  1PJR A;  2UWM A;  2XF6 A;  1FMW A;  4QPO A;  2X6Y A;  3D5S C;  4EAT A;  2BVM A;  1MNE A;  2HPI A;  2P0W A;  2IS4 A;  3OWT A;  4AVZ A;  5LFA A;  3OYI A;  3NWS A;  4II2 A;  3S3O A;  4J00 A;  2M4G A;  3F9K A;  4RLF A;  1NG7 A;  3H5N A;  3SYT A;  4ZDP A;  2HVR A;  3PJR A;  4ZTJ A;  2R7V A;  2Z16 A;  1Z3X A;  3OYC A;  3N05 A;  3HC7 A;  2K9L A;  1EA3 A;  4BE2 A;  4OWR B;  2WY7 Q;  4C9Y A;  3S93 A;  2XC7 A;  2F5V A;  4E7S A;  4D1Q A;  1WJE A;  3K4N A;  2R7Q A;  2WY8 Q;  4RLQ A;  3HXL A;  1N75 A;  4BDZ A;  2WAD A;  4XKV A;  2BW3 B;  1BR2 A;  3UR3 C;  4PJJ A;  1Y56 A;  4BEH A;  1DGR M;  2ZXH A;  3OYN A;  5HNH A;  1SFK A;  3VDX A;  3DQV C;  2OC6 A;  3AKZ A;  1MND A;  2BW3 A;  4N4O B;  2FUG 2;  4BE0 A;  2GOX B;  4BUP A;  3DPT A;  4CA0 A;  2VKD A;  4F55 A;  3W2A A;  3SDB A;  3FHN A;  3H5A A;  4NC8 A;  4BXF A;  3D5R C;  2LH9 A;  1Z7L A;  2JUG A;  3HPH A;  3ZCO A;  1E0E A;  4Y33 A;  3VYU B;  3C2G A;  2KHM A;  4PJM A;  3ZXS A;  4F92 B;  3K4K A;  3HOS A;  4XL9 A;  5HOO A;  3OY9 A;  1Y6I A;  3VSK A;  1UAA A;  2GOM A;  1WJD A;  3VYT B;  4HRI A;  2ZFU A;  4XLC A;  3S8P A;  4E7I A;  3ZRG A;  4KT6 A;  2W7N A;  4P1W A;  2LOO A;  2A5W A;  3H9J A;  2M4K A;  2O5R A;  3LSI A;  3A2K A;  1D0Z A;  1J09 A;  3DKY A;  2WBM A;  4NC7 A;  2KQR A;  4DBQ A;  2HVS A;  1LVK A;  1V5F A;  2JA2 A;  4LIV A;  4BS9 A;  1ERD A;  3OL4 A;  2VIX A;  4II3 A;  3I3L A;  2RQQ A;  2JVG A;  3DLA A;  3QYB A;  4BGD A;  1X1A A;  3IAM 2;  3OOU A;  2KLO A;  4XQF A;  3M1C A;  4BU2 A;  4LIT A;  2LY1 A;  4JOM A;  3MMY B;  5FRO A;  4FAS D;  2OUM A;  2RNG A;  4XKC A;  2X1D A;  3CES A;  3K4M A;  4E7Z A;  4ZC3 A;  4HEA 2;  4B48 A;  4E7L A;  3PSI A;  2LC2 A;  3OYH A;  3S3M A;  2MYS A;  4CZC A;  4CCN A;  3FKJ A;  2VPL A;  1WJB A;  3IAS 2;  3DEE A;  4Y4R A;  3RTR A;  3TMO A;  4CSW A;  3PL8 A;  1W36 C;  1LDK B;  2LRE A;  4DJA A;  2M7B A;  3IUO A;  3HG9 A;  3K10 A;  4JQF A;  4XOT A;  2L2O A;  2XF7 A;  1MMD A;  2BOL A;  3HKZ A;  4AU7 A;  3OIQ A;  3CP8 A;  3BCA A;  3BLY A;  1X1B A;  3U21 A;  3OYB A;  3KX2 A;  2ZSH B;  3LSH A;  4XOR A;  2CV2 A;  2F6C A;  3AL0 C;  2VQG A;  2CW8 A;  3S3N A;  3QOE A;  1Z21 A;  5KCM A;  4IX7 A;  3V42 A;  2I8D A;  2LYC A;  1W36 D;  5HLT A;  5LD2 C;  1X1C A;  2XF5 A;  1DGW Y;  2E5N A;  1OR7 C;  2Q1Z B;  1V5E A;  2KRH A;  2RRE A;  2AQE A;  3HPG A;  4XNF A;  4ZJZ A;  3OS1 A;  4CCK A;  3ZQQ A;  3MD2 A;  2VAS A;  4YEJ A;  2ELJ A;  1X19 A;  2IGO A;  3C2H A;  2VJ4 A;  4ZYA A;  2LG4 A;  3W2V A;  2V1N A;  3ZR8 X;  2KP6 A;  4XLH A;  2ZSI B;  3EUK L;  3K4C A;  4XKW A;  4BEH B;  4ZDL A;  4ZTF A;  1MMA A;  1WJC A;  2WAE A;  5JHF A;  2VJI A;  4DBR A;  2E1M B;  2E5Z A;  3LSG A;  3QOD A;  4J01 A;  4E7H A;  3HUG B;  2L7K A;  1LKX A;  2M3A A;  4ZDO A;  2IS6 A;  3CMM A;  4PFP A;  3DWL E;  3L2U A;  2KMU A;  2M0M A;  4HPQ A;  4KIS A;  3FBN B;  2OV7 A;  4HNU A;  4OAY A;  2VQL A;  3H5R A;  1WJ5 A;  3OYD A;  4YEL A;  3OL3 A;  3OYF A;  1SAU A;  2Z2S B;  3S32 A;  1G8X A;  2IGK A;  3SEQ A;  4HST A;  4U87 A;  1R6R A;  2CH0 A;  2CMP A;  3ZGK A;  4GRI A;  3MKY B;  4XKB A;  2R7S A;  1MMN A;  2L9N A;  2V6E A;  3SZG A;  3DPU A;  3OMY A;  2R7T A;  1TT0 A;  2F4I A;  2VB6 A;  4XR6 A;  2VQH A;  3D5L A;  2MC4 A;  3NWT A;  4OAZ A;  4PJN A;  3I9V 2;  3OS0 A;  2A6T A;  2VQC A;  4PSW A;  1X4P A;  1LFP A;  2DCE A;  2VJJ A;  1UG0 A;  2WAQ A;  3BC8 A;  5KHD A;  3IP4 B;  4XLF A;  4CCO A;  2V26 A;  3AL0 B;  5CQE A;  2IGN A;  2HNH A;  4CCJ A;  3OYA A;  3L2R A;  3MKW B;  3CJR B;  2Z1D A;  3DU6 A;  3EUH C;  3VWB A;  2V9K A;  4B44 A;  2DOA A;  4DIQ A;  2KDO A;  2HVQ A;  2KPM A;  2BVL A;  2E1M C;  2ZXI A;  1D1B A;  1V5G A;  3K70 C;  4BJT A;  3K4J A;  3EPZ A;  4KJZ A;  4BQN A;  4IQJ A;  4BQO A;  2X85 A;  2X6X A;  4ITV A;  4KIT B;  4BDY A;  1HA8 A;  2DT6 A;  3PFY A;  3OYL A;  2QKM B;  4ANJ A;  2CV0 A;  2K9M A;  2WAF A;  3HL2 A;  4RM3 A;  4E7J A;  1PYV A;  1G59 A;  4E4H A;  2LY2 A;  2VLA A;  5FRM A;  4XON A;  3L2W A;  2LRD A;  2E60 A;  2X1E A;  2HDW A;  2LBF A;  3QYF A;  4D9J A;  3A1Y A;  2W00 A;  4C2T A;  4HNT A;  1UEL B;  1T95 A;  4LG3 A;  1MMG A;  3DTI A;  3OS2 A;  4F91 B;  4N4N B;  3MKZ A;  3OIP A;  4BAC A;  4IQ4 A;  3BCB A;  4PFO A;  3K70 D;  1IRX A;  4G6T B;  2CFO A;  2VXZ A;  4XN0 A;  2HPM A;  2L9S A;  4RM2 A;  3CF2 A;  2CW7 A;  4F93 B;  3OYE A;  3H0D A;  4IKF A;  2R7U A;  3L2Q A;  2X1C A;  2V7F A;  1D0X A;  1WJF A;  3DPL C;  3OYJ A;  2R7X A;  2JSP A;  1TZL A;  4PUS A;  3VYS B;  2KZV A;  2CUZ A;  4XM3 A;  4MLO A;  3PNV A;  4QPQ A;  1BR4 A;  4B43 A;  1KON A;  1X1D A;  5CQG A;  3E1S A;  2PJR B;  1VZ0 A;  3PNT A;  3HOT A;  2HZD A;  2X51 A;  2W4S A;  2R7W A;  3OR1 C;  2K3P A;  3TL4 X;  4C2U A;  1N78 A;  1JI8 A;  1X4O A;  1WJA A;  2W82 A;  4P5O A;  4LIU A;  3OYK A;  1D0Y A;  3KEY A;  2PJR A;  4AYB A;  3UNG C;  2KL4 A;  4U7B A;  3ONQ A;  1U0J A;  2R4G A;  1AA7 A;  1YE9 A;  3OYG A;  2WA0 A;  2Q2E B;  2XAU A;  4E7K A;  2DJI A;  2L5Q A;  3K4B A;  4XN3 A;  3LMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...