1PYVA

Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
b'ASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase beta chain, mitochondrial precursor
publication title NMR solution structure of the mitochondrial F1beta presequence from Nicotiana plumbaginifolia
pubmed doi rcsb
source organism Nicotiana plumbaginifolia
molecule tags Hydrolase
total genus 8
structure length 53
sequence length 53
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11421 Synthase_beta ATP synthase F1 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1pyvA00
1PYVA
chains in the Genus database with same CATH superfamily
2WV1A 4MO7A 3FHZA 3NARA 1V4RA 1LNWA 3VDXA 2H1KA 4RGRA 1RZ4A 3OYEA 2ZMEB 3V8LA 1RUOA 1TW2A 1IO2A 1O3TA 2XVCA 2CMPA 2DCEA 1K6YA 1SD4A 4OIQF 1RKTA 4XLFA 2Z33A 2O8XA 1I1SA 4JOMA 2XASA 2QWWA 1DGWY 3FK6A 1KYZA 3S14J 1USTA 1R7JA 4GYGA 3AG3H 4G94A 2ZXJA 2JSPA 2L9SA 4I99C 2EFPA 4ZTFA 2JPBA 2CV1A 2CV2A 3C2HA 2DK5A 2PJPA 4IRIA 5FD6A 3FHNA 5BS6A 2ZFUA 3SFZA 3PIPF 3L2QA 1IZ1A 3ABKH 5BNGA 3OYGA 4DYQA 3HG9A 4GXOA 4EJVA 3ULQB 2VKEA 2M4KA 5CYVA 5HDGA 2ACJA 4LK1F 4AYBA 1R36A 1T95A 2M4GA 3TMOA 1HQCA 1YX5A 4HF0A 3BG9A 1Y1WJ 1V55H 1RETA 4Y3OA 1FBUA 1G59A 1UHSA 2QSHX 2QGUA 5CLSA 3DU6A 1NH3A 3REOA 1YIOA 4L9NA 2HTSA 1U5TA 3CMAI 3E1SA 4M73A 1ON1A 5IOYA 5HS8A 1OJLA 4I98B 1I3QJ 2QENA 2COBA 4U0WA 4LB6B 2R4GA 2EIKH 1ZG3A 3QPTA 1JGSA 2RC4A 1OR7C 2EIJH 3CZ6A 1VZ0A 2OA4A 2LF7A 4QWQA 1FZPB 2VJ4A 4RAGA 3E6CC 2R7VA 2ME6A 2HKOA 1TC3C 3BR2A 2XRNA 4M71A 5LEJA 5K1YA 3SHFA 3KIOA 4ZDPA 2DPUA 1BI0A 3AFHA 3PO2J 2DLLA 3ZMUA 3BC8A 3IWZA 2EILH 4BYYA 5J1RA 1VQLI 1WCMJ 4KIBA 1IV6A 5KVRA 4NQWA 1ON2A 3DCFA 4BEHA 3EUHA 1LB2A 5HLIA 1UHWA 1TWAJ 1W7PA 2B0LA 3WG7H 1J2XA 2K40A 1WSUA 2JRTA 4H4KC 5LGUA 4KMUX 3SZPA 4OWRB 4XLAA 3SEZA 3T5XA 4IRHA 1QGPA 2R3SA 1X1PA 3OYNA 1TL8A 3KLOA 1LVKA 2HQRA 3FKJA 4XNFA 1YO5C 2NOGA 4V19K 2PMUA 4Y7NJ 2ADUA 4RLQA 1WJBA 2G7HA 4LD5A 1GHCA 2EB7A 1ZARA 2EINH 1BC7C 2ZJRF 3H9GA 2LMDA 3M8FA 2ZMEC 5F6FA 5EEAA 1JT6A 2IPQX 3GO5A 3ZQIA 1GXPA 4R8HA 2ZJ2A 2D1VA 2LLKA 1KONA 3ECHA 2VL8A 5LRSA 1IRGA 1MBHA 3KLNA 4MFEA 3HSEA 3ZMDA 3KZZA 4HSRA 5LEKA 2DJNA 3MAJA 1FT9A 3HRMA 3JAMZ 1W36D 4PJLA 2QBYB 4FQGA 2Y30A 2P7CB 2W84A 2XGEA 4JK1X 2BW3B 4EEFG 3KEQA 3E5XA 1XCVA 2W00A 3Q0WA 3VWBA 2MLGA 3RYPA 3ZN1A 1BN5A 3FXKA 1TBXA 2Z3YA 2CQ7A 3JTHA 1FIPA 3BROA 5K5RA 1IXSB 1ZKGA 1Y0NA 1K7AA 3RKQA 1GVJA 1UELB 2EQRA 2KQRA 1X2MA 4DW6A 4JQFA 5DV5A 4E7SA 4ENKA 4E70A 3F8MA 4L18B 3S8PA 4HQEA 4LG0A 1ETWA 5C4JJ 1U8RA 4HF2A 2DA4A 3VSLA 1HA8A 3LWFA 1MIJA 2VPRA 3HKZN 3BT9A 5M5WJ 1K6OA 4XL9A 2YU3A 3QWLA 1K83J 1XB4A 5JI6A 1AHDP 2OJED 4W1UA 4LB5A 1BR2A 2IGNA 2M87A 5M5XJ 2XF7A 4ZYHA 1S9HA 5TISC 1SEUA 5AIPA 3HPGA 4C2MJ 2VE9A 1HKQA 1QO0D 1S3JA 5FD5A 4OMYA 1GDTA 1FEXA 1UG2A 4IX7A 4RM2A 3IHUA 1VQKI 3A01B 2QEXI 4M9ZA 3I55I 1YJWI 2V6CA 1MNEA 3S1RJ 3FBIB 2YX4A 4PUSA 1MJBA 2LDUA 1ZG1A 2MGQA 4U87A 2E36A 4HNVA 2DOEA 1MSEC 2Y9YA 3M8JA 2HFHA 3OSGA 1ULYA 2DTRA 1MDMA 3K4CA 5HDNA 2FNAA 4LITA 3M7GA 2FBKA 3G4SI 1TLHB 3FM3A 3QYFA 4HRIA 2HDCA 3SFIA 1W36C 2EIMH 2G9WA 4X0GA 3OS2A 2F4OB 3F0CA 2JMWA 2E1CA 3BJOA 4JP0A 4KISA 2O8KA 1SFUA 1MBFA 4XLCA 3H0GJ 2GOXB 2J5PA 4XOPA 3ZQHA 1IRXA 2R5YA 3GFIA 2H1LA 4O5VA 3CCJI 1YQAA 4D0PA 3VPRA 1UJ8A 3WTZA 3J80K 5D6FA 1ZRCA 1R5HA 4CUGA 1KZHA 3T1BA 2IGKA 4HLYA 1LFBA 4GO1A 4BBSJ 5AONA 3KZYA 2E35A 2F4MB 3TL4X 1WKMA 2ZJQF 1B4AA 3C2GA 5FO5A 1JHHA 2HOTA 4HV6A 4WXDA 1RC9A 2FNPA 2L2OA 3NWSA 1K4TA 2BYVE 3DWLE 1V5GA 5D4SA 4IPAA 3W2WA 4AIJA 4L9TA 4DGWB 1FNNA 2VJIA 5FLXK 2JT1A 3OV8A 3EETA 2W57A 1LE8A 1S6LA 4FX0A 3K7AJ 1Y6IA 1ZTRA 3BR6A 1Z3YA 2AO9A 1U6GA 1EH6A 4OAYA 1R58A 5GP9A 5EYRA 2E1NA 3VB2A 3FXMA 1A5JA 1TNTA 3HSRA 1T2KA 2K86A 4ZZLA 1HW2A 1KQ9A 1R5GA 2AQFA 2O6GE 4YEJA 4RDUA 5DUKA 4KT6A 1T39A 2KIMA 3QP5A 1FSEA 4ZH4F 2VODA 1X3ZB 2DQRA 2BY3A 4HDUA 4ZTJA 2P8TA 4LOCA 3F8BA 5KNLA 4Q5SF 1VI0A 3TKYA 2WADA 2DA7A 3SXYA 2R92J 1DQUA 1A6IA 1RKWA 1SFXA 1V5EA 4BJTA 1Z05A 4EVIA 5E3OA 1JUPA 3A4CA 4WXCA 3WTWC 4EGZA 2OCEA 4UHTA 3KP2A 3PNYA 1HBXG 1J75A 4S0HB 1BR4A 4DIQA 1FLIA 4MTDA 4P1WA 4DQ2A 2X6OA 2BVMA 2IGMA 4XIDA 3U9GA 3H1CA 2OAZA 2XGCA 1OKRA 2NS8A 3FXJA 5GPAA 1XSDA 1S29A 3F8NA 2GIVA 5E20A 4E6KG 1JXSA 2MFZA 4LLGF 2BV6A 3FIWA 2FUG2 3BQZA 2EZHA 5BMZA 4LG3A 3MKLA 2D1HA 5IYDJ 4M72A 4ENMA 4RB2C 3RPUA 4ESJA 4E7KA 4CXFA 3BLYA 2OQGA 3QRFF 1T56A 1OISA 5JLWA 2OZ6A 3BR5A 2O0YA 1P4XA 2X1CA 1AKHA 2HYFA 3GLLA 4AD9A 3N4MA 4A93J 2JTVA 4I0BA 4CH7A 5DUIA 1QA6A 1TT0A 1R6RA 1X58A 2RGVA 2HXIA 3J81K 2RDPA 2AXLA 2E7WA 5H2FC 2MG4A 1VQ8I 2AHQA 4BS9A 1E2XA 4B1RA 3ZPLA 2O5RA 2CQXA 4AVZA 2W82A 3DTIA 5K7FA 2H94A 2HVRA 3VEPA 1I39A 1T08B 2CUZA 1A04A 2O9LA 1TZLA 1K79A 4XLNF 3UKGA 3QU6A 3V4GA 3K4BA 3RSNA 2V1DA 5B3SH 4CCLA 2CRGA 1NK3P 3MEXA 2BY1A 3CUOA 3GZ6A 4IKFA 2B7EA 2HS5A 3S1QJ 1IN4A 2KZVA 1FYMA 2MC3A 1ETQA 4UB6C 2HQNA 1MZBA 2LRDA 2Z1DA 2JN6A 2Q2EA 4NC7A 3F22A 5L3DA 3JSOA 1MH3A 4B8XA 2CO5A 4HOBA 4B4CA 3HHGA 4W97A 2R7SA 3A0BC 2M7AA 2RQPA 5IP7J 2K85A 4BH9A 2NVXJ 1WQ2A 9ANTA 4XN0A 2STWA 3M3YJ 3A2KA 3RDIA 2QLZA 2L01A 2KKOA 4XORA 1A6QA 2CW0F 5LHHA 4AM3A 4Q47A 3I3LA 2CQNA 3RI4A 5L3EA 5LGTA 4HX7A 5M3MJ 2R5ZA 1ZR2A 1LVAA 3HEFA 1VQ4I 5TGTA 4NBQA 1JHFA 1XMKA 2PLYA 1BBYA 4II2A 2IW5A 3B02A 3UR3C 4N4NB 5C3EJ 2A3SA 1G4DA 1S7AA 5J1UA 3DXJF 2KIUA 1ZG5A 2AS5F 2ZSHB 1TP4A 3IP4B 1N77A 4KN4X 1IDZA 2O03A 5DCMA 2LC2A 4XR6A 4IQ4A 4XICA 2DA3A 3G1MA 1BL0A 2WY7Q 3GTOJ 2OC6A 3OYDA 3AAFA 3LA3A 4WX9A 3TBIA 2H8RA 3NAUA 1JUMA 1FX7A 5HLGA 2VT3A 3S2DJ 1XDSA 5FB2A 4KT5C 1WH5A 2JUCA 4A3LJ 2EFNA 4KICA 1TWGJ 4JX6A 1HKTA 4A12A 1W5CC 4RB0A 3CJTB 2DAOA 1YRNA 2R93J 4AVPA 1QHGA 3CCMI 2ELKA 3DLAA 1U8BA 5FRMA 2QQAA 1XMAA 5CVJA 3ZP5A 1VQOI 4EM1A 3C18A 4MNUA 3RQ4A 1GLNA 3W6VA 1N78A 2HDWA 2VOOA 5H6RA 3PSIA 4XOTA 2K9SA 2P0WA 3R6SA 2K3FA 3J7AO 2K7LA 1RESA 5F1JA 3FXRA 3OY9A 1P6RA 5JFRA 1P4WA 2WAQN 2NVYJ 3J80Z 1K61A 1DDNA 2XPUA 2VJ5A 4XBFA 5FKKA 2R7XA 2Q0OA 5HS9A 5B1BH 3IUOA 4QIWN 1X2NA 1TW3A 1BI2A 4KYWA 2VJJA 5L3CA 3MD2A 2UWMA 4XSXF 2QM3A 2D2WA 1R22A 3BTCA 1H0MA 3JRGA 1FYKA 1JE8A 3GFMA 3I64A 3V42A 5E1XA 5GAHJ 1OLTA 3O2PE 3OS0A 5ED4A 3ERED 2DU9A 3QOPA 4HA8A 2JA8J 2MABA 5FLXZ 3H0DA 2VXDA 3CUQA 5E79C 1LEBA 1X1BA 2XGDA 2VBXA 3C7JA 3WTYC 2EPFA 2CFXA 2EZIA 5EDNA 3BR3A 2YX7A 3I53A 3MVPA 1SVMA 1YYVA 2DTZA 1QZZA 2ZSIB 1FOKA 2V1XA 5ICEA 1R71A 3FXUA 3U1DA 1NG6A 5EZGA 1S5LC 2K9LA 1UG0A 5GTHC 1IF1A 3AL0C 4IQJA 1P2FA 4M9SA 2DFIA 1ZQ3P 3KX2A 1E17A 2R7DA 3JRFA 4CCMA 2O61A 3L2WA 2L9VA 4HX8A 1D3YA 2MD5A 2HI3A 4BACA 4ZDLA 4MIMA 2IXSA 1IGNA 4O6JA 3CCRI 2TRTA 1I27A 4D1QA 4HEA2 1UHMA 3KP5A 2P4WA 5GAGJ 3I4PA 1ZYRF 4DZPA 3GTMJ 1Q1HA 4ABZA 2UZKA 3JCUC 2TDXA 2E2HJ 3LFUA 3F6OA 1MMDA 2B63J 3GFJA 1E0EA 2BY0A 2KHMA 3S2WA 2IJLA 3K4JA 2XAJA 2CG4A 2A6TA 3HB9A 2P5VA 2F48A 5IP9J 5HNFA 5JR3A 4CA0A 3FXOA 4R79A 4BJ5C 1O4XA 4II3A 1ZN2A 3DV8A 1KA8A 2A69F 2FMYA 3LSIA 2HU9A 3E3VA 3H92A 3ZXSA 1AA7A 1YS7A 3N05A 3R0JA 4B44A 3SYTA 3DBHB 2PJRB 2I5UA 5LGNA 1TWFJ 3H5AA 4Y17A 3D0SA 4XKBA 5FFZA 3LSMA 2CW7A 2HXOA 1WI3A 2JUGA 1F5TA 1D1BA 1WJCA 5E8IA 3EUAA 1FOYA 2XAQA 4N9IA 2VB6A 3CDLA 1U5TC 2RV8A 2NNNA 3LSGA 3P9CA 3WHBA 2GA1A 2X1EA 5J4YA 1ZAOA 1OCTC 1QHHD 2XROA 2P5LC 2EZKA 2CH0A 4MGRA 1F9NA 4M9XA 5BPDA 1FYLA 3T8TA 3HUGB 1R49A 1L0OC 1Y1VJ 5E1ZB 2ELJA 4UVAA 4Y13A 2JRMA 1J59A 4AIDA 1GV2A 2MH2A 4RGUA 3CLQA 1VQMI 3HOUJ 2P6SA 5CQEA 3HOTA 2KRCA 2RN7A 4I02A 1Z6TA 4BDYA 3V8JA 3S32A 5J8CA 5J8FA 5EF6A 3Q5FA 3EDPA 2OCCH 5GTIC 3M9AA 5L3FA 3HSFA 2XAHA 4KIFA 4HBLA 3U1KA 1BJZA 2JA2A 4A0XA 1ZLJA 3S93A 2MC4A 2EV5A 4EQQA 2GWRA 3HOZJ 3DPTA 2LBFA 5FFXA 3B73A 3CQZJ 3MQ0A 5BQTA 2R5YB 1CF7B 5JHUA 3WGIA 1QBJA 2CUFA 2WB1N 4EGYA 3K6GA 5ICCA 2F5VA 4G7HF 1XG1A 2MD0A 2XAUA 4DBRA 1GVDA 1SVOA 1EJ9A 1WJ5A 3CCYA 3WODF 3IH3A 2E1MC 5EG0A 5D8KB 1ETYA 4A3IJ 2N8GA 1FWZA 3HOYJ 2LVSA 4N4OB 3PNTA 1B8IB 6PAXA 3BJAA 1LQ1A 4GCVA 4P96A 1S7OA 1XSVA 1NG7A 2M5WA 3A0HC 1MMAA 3BWGA 1RI7A 4HW0A 3JRAA 2H6BA 1PUFA 1B9MA 1QVUA 2EK5A 2Q1ZB 2BVLA 4IRGA 2X85A 4PFOA 1YJNI 3S1NJ 2L7MP 2A5WA 2VC1A 3HYIA 1LE8B 1R23A 3BDDA 4P5OA 3H3VK 2ISZA 3JRDA 5BOXA 4G12A 5K7ZA 4PDKA 4J01A 2K9MA 4IZZA 5DCFA 5DM7F 5LLQA 2GLOA 4XMYA 1ETKA 2DODA 4CO8A 2X1DA 3CJNA 2EA4A 4YIIA 3I59B 1YITI 3ZGKA 3H35A 5LHGA 1JT0A 4HV5A 1DU0A 4A6DA 2IS2A 1MKMA 3ECOA 1G3YA 2ISYA 1T0FA 5IYCJ 3SEQA 3U21A 4MEXF 2XV4S 3IWFA 2FF4A 1BW6A 4E7HA 3RIRA 1RPWA 3JREA 2NS0A 3HTUA 3QPHA 5LHIA 4L0ZB 2ME0A 3KP7A 4BQOA 1XGNA 3LL7A 3DTEA 2YUSA 3L09A 5ERIA 2KJBA 2K27A 2R7QA 3P9IA 3QOEA 2PEXA 1LJ9A 2AQEA 3CF5F 3GVAA 2A61A 2W4SA 2EV6A 2WAFA 3GEZA 2QZ8A 4NNJA 3HOVJ 3VODA 2XGXA 2MA3A 1FMVA 5M3FJ 4Y52J 1Z91A 2PI0A 3PQKA 1T8IA 2NAZA 4UNOA 3PNVA 3G2BA 3AG2H 3SJMA 5D8LB 2ID3A 2CS3A 2RNJA 2Y0SA 1YI2I 2X48A 3M1CA 4S04A 2G7UA 4BL0B 2P5KA 2W85A 3CF2A 4CCNA 3DBRB 2WA0A 2EH3A 2PX9A 3HXLA 4A3GJ 1XTAA 1VQ5I 3NQOA 4XQFA 3LA7A 2HYGD 2IA1A 2X4HA 3JW4A 3CJRB 4EJWA 2R7RA 2LKXA 4RS8A 1G3WA 2P6TA 4XLPF 2CW8A 1J9IA 3PM1A 4FE4A 4IOAF 3HGGA 4LLLA 1ITYA 2DW4A 3RJPA 5IPAA 1NHAA 2IS1A 3OIPA 2LR8A 4RAZA 3WTXC 1V5FA 2PFBA 1ETOA 3W2VA 4IHYA 2PMZA 2VQHA 5F0HA 4YFXF 2NOJB 3O6BB 1BM9A 2Z99A 2YU9J 3RZOJ 3ZQ7A 5FKOA 2X6XA 3FK7A 3K70C 1HF0A 4UVBA 1ZGWA 5KAIC 4RGSA 3PQJA 2W1OA 2RKHA 3L7WA 2XB0X 4U7DA 2IGOA 3KYDB 2FOKA 3OYBA 4A3MJ 4R1HA 1XGMA 3A02A 3MZ8A 2JA5J 2FOWA 3DKXA 3ABLH 1FY7A 3SDBA 1RUNA 4Q48A 1IXRC 2ZC2A 3O8GA 5L3GA 4BHCA 3LNQA 3LSRA 5TRDA 2R0QC 5IT3A 1X19A 2KZGA 3KETA 3M8EA 1S72I 3CCLI 3WGGA 4LIVA 4UVCA 2BZTA 5D5VB 4HNTA 2HZTA 3HBLA 2YSRA 4G6TB 4PSXA 3OOPA 1MGTA 1ERDA 1YX3A 1SAXA 1W5SA 2F4IA 3OWTA 4QPOA 3PFYA 2P7VB 1PDNC 2K9QA 1A31A 1NK2P 3DP7A 3R60A 4IF4A 3CLOA 4MHGA 3GF2A 3CP8A 3F21A 4JX5A 3L2UA 2R7UA 1IDYA 4AU7A 2JWTA 2KLOA 2Y2ZA 3OIQA 4F91B 3HOSA 3I4NJ 5GPCA 5E18F 1U9NA 2Y31A 5DCMB 2G0EA 3WE3A 1BC8C 3BZCA 3ZQCA 1D0XA 1IW7F 3H36A 1HC8A 3H9QA 2BBYA 3SQNA 3K4LA 2OV7A 4RMNA 2GXBA 3FZVA 3PFIA 2O7OA 3SDGA 1JJ8C 2FU4A 1SAUA 3VSKA 1R1TA 1RNLA 1LEAA 1G6NA 3TO7A 5IP6A 5J6XA 1X4PA 1JJ6C 2FQ4A 4BXUA 1PVEA 4XK4A 2KJCA 2V9VA 3OYFA 1IC8A 3O3KA 2M8EA 4LMYA 2MH9A 4DJAA 1MBKA 2FEZA 2VQGA 3GZ5A 4GGGA 2MSYA 1SMTA 2CSOA 4L5JA 4CZZA 2HOSA 2FBIA 3FMSA 4MEYF 3E7LA 4L0YB 2PMHA 3PUBA 3EYYA 1XPXA 3Q0VA 2DFEA 3V7RA 1XMXA 1SD5A 5EGOB 3TQNA 4IHWA 1FP1D 2FD5A 2HVQA 4ITVA 3ZN0A 4D7MA 3OYMA 4MLOA 4A69C 1EF4A 3WG9A 5HS7A 1WWXA 4ZZDA 2ZFWA 4KA4A 5HDKA 1A36A 2VT2A 3CUQB 2XB5A 4BQNA 3S3OA 4PK4A 4AIHA 5B5EC 1ZLKA 4LLNA 4WF2A 1W1WE 1Q1VA 2K4JA 5J3LA 1Y8RB 3AG4H 2V1UA 4V2FA 4IHSA 1DP3A 2K02A 3O8HA 2DK8A 1VQ9I 2M45A 2IS6A 1WH7A 4A0YA 4GRIA 2IAIA 3F6VA 2DT6A 2IA0A 2NS7A 1WJEA 4KN7X 3Q3SA 2R7OA 4M6VA 1I5ZA 2J5OA 4CYCB 5K5QA 2R7FA 1P7IA 2F2EA 3DQVC 1UCRA 1V54H 3KP4A 2B9SA 2WV0A 4OIRF 5FKLA 1PYVA 2L7ZA 2YS9A 3MWMA 4B43A 3HIFA 4J00A 5HLTA 3ELKA 4XSZF 4AYBN 3PIOF 2L4AA 1X3WB 2L5QA 2X9DA 3KCCA 3OR2C 1MBEA 4U7BA 2M9HA 1UAAA 1ODDA 1BI1A 2PQ8A 3RKWA 1XX5A 3GW2A 4M6YA 2OF7A 4EJUA 3OYAA 5K7HA 3BY6A 2RVCA 2Z9OA 1OYYA 1DP7P 2D45A 3CMYA 2A6HF 3H5NA 4F93B 1XD7A 5IT9K 4B3XA 3WE2A 4NC8A 2LNBA 3P9KA 2RAEA 3DKYA 3PL8A 3T0YA 1IUFA 2CV0A 1E3OC 3LQQA 1O7LA 1JTXA 3FBNB 1G8XA 3HGYA 4BQAA 4I09A 3L2CA 4A3DJ 4CSWA 1HSTA 1Z1DA 4GYIA 2QQBA 5LBQA 3K2ZA 2DA5A 4OOIA 4ON0A 1XSXA 2QBYA 1Z21A 3LMMA 4IHXA 2GQQA 4GFBA 2DFHA 3HRSA 3GFLA 2XKOA 5HOOA 1ZK8A 1TNSA 3K2AA 4BU2A 1TQPA 2E7XA 4UXNA 1BOAA 1RRJA 4YFNF 1T98A 1QU3A 3AL0B 1Z67A 3HC7A 4I0AA 1JGGA 4XN3A 3F3XA 2LD5A 2UXNA 3BR0A 2MW8A 3A03A 2F6CA 4RA2A 3MFKA 4PFPA 2DYRH 2P81A 2K3PA 4KNYA 4OU0A 1H88C 4BUPA 4FHTA 2CU7A 3DFGA 3A1YA 2EJRA 2JA7J 4HQMA 4DZJA 4E7IA 1Z77A 5GAEJ 3ZMSA 3GWZA 4E7JA 4U0VA 4QPQA 3VOEA 1IN8A 2QF7A 4OINF 1F43A 3R0AA 3JRBA 5DD8A 3RPQA 1SFOJ 2DA6A 3A01A 3CUQC 4EATA 1TWCJ 3J7AY 4C2UA 3U2RA 1R00A 3HHHA 1ETVA 3KYCB 4BKXA 4X6AJ 1X1AA 2LY9A 3BPVA 1W0TA 3CDIA 4Y33A 4A0ZA 3Q9SA 4A5NA 1YW7A 2COMA 4EMSA 2KIFA 3W6JB 2GM4A 3W6KB 1EV7A 3S16J 1TWHJ 2HKXA 1QRYA 1E3HA 5FLMJ 1Y39A 2DN0A 4M3DA 5FKNA 3BG7A 2VC0A 5EG0B 2DXIA 1S7EA 2ELHA 2W25A 4EM0B 3QAHA 3TP0A 1OCRH 1LPQA 2HWVA 4HG2A 3I4MJ 3K4MA 4HNUA 1U5TB 5HLHA 1PUFB 2DQLA 4DOZA 1JUSA 2MLKA 1IXCA 4KMFA 2NVTJ 3ABMH 4FCYA 2ETHA 3LSHA 1FBQA 3JSPA 4BE0A 1HXDA 2DDBA 2LH9A 4BJ6C 4BGDA 4B3AA 3HZJA 3P7NA 1FC3A 3TEDA 2DOAA 2JSCA 5F08A 4I7HA 3PSFA 3QP6A 3ONQA 4C30A 4RAYA 3B6AA 3LSTA 2ICWG 2V4JC 3TW7A 1SFEA 4HDVA 3BZ6A 1T38A 3VYTB 4NUBA 3GUDA 5HODA 3IKTA 4A2UA 1IN6A 3WU1B 3CC4I 1H9TA 1JKOC 3QYBA 4CCKA 4NQWB 3KFWX 4DYRA 4BY1J 4BEHB 1CGPA 3L2VA 2OUMA 1XC5A 2E5NA 4RLFA 2ECBA 3OYLA 2QA4I 4ETSA 1W7PB 2ZXWH 3E0JB 1Y0UA 1X3UA 4D7NA 1Z7LA 2GOMA 3OL3A 2M30A 4CICA 3OYHA 1UZCA 1ZHFA 2H09A 4M3BA 4S05A 3GTKJ 4EJOA 2KRHA 3JRCA 3NWTA 4D9JA 2V26A 1QVTA 2DMQA 5LFAA 5D5WB 3RZDJ 4RB3C 3BR1A 3CD6I 2XF5A 1H8AC 2E1MB 4BXXJ 2ZXIA 4UUVA 4PGGA 3E6MA 2L7FP 1O57A 4BY7J 3TP3A 1HCRA 2OTJI 1WJFA 4MFDA 3CMEI 3CTAA 5J4VA 2V7FA 3TO6A 5F27A 1LKXA 4ZYAA 4ENJA 2UV1A 1OCOH 4KITB 2AXTC 3CDHA 2HZDA 3IL2A 3DLLF 2OQRA 5A2QK 2W7NA 1J5YA 1R1UA 1K78A 4XRFA 4O3MA 3ZQFA 3WTUC 1P4AA 4ASNA 3D1NI 2IA2A 2JPCA 5F0CA 2XUBA 2Z16A 4XONA 3LQRA 3MCZA 3HRTA 2M3AA 1MJAA 2V9PA 1WHUA 3FDYA 4E7LA 1IAWA 1W7PD 4L5EA 1JI8A 2YPRA 3AKZA 2HQAA 5ILVA 2ID6A 4RGXA 4IL6C 3OL4A 3ZMZA 1N25A 4M6XA 3RYRA 2MYSA 1ZR4A 3DF8A 2HOEA 1OCCH 1CQTA 2HTJA 2EFQA 2M0MA 3K0LA 3M07A 3PUFA 5FJ8J 3OYIA 1HOMA 4LG0B 2DBBA 3BG6A 2ESHA 4D5CA 1F4KA 5EEGA 4I76A 3BTLA 2STTA 1BIAA 2X0LA 3HOXJ 2QSGX 1U3EM 4RBOA 2KRFA 2DDAA 2QQ9A 3ZMVA 5IT9Z 3CJQB 1FTZA 1IN5A 4ENNA 3DTKA 3F8CA 3J81Z 4J19A 1TTYA 3C2BA 1XGSA 1MMGA 1KU3A 2QQ8A 1I3AA 3TGNA 2BOLA 1KGSA 1OPCA 4AUXA 2ZB9A 2FBHA 2KDZA 1J0RA 3FMRA 4WCGA 4QSHA 3BQYA 1W4MA 3QODA 3KP3A 2WY8Q 3R4KA 2GA2A 1KU7A 1RIOH 2EFWA 1MDMB 2KP6A 4KDPA 4D5FA 2EFOA 3DEWA 1WJAA 3TDZC 2JVGA 1YE9A 3EUHC 2GXGA 3TDUC 3CCVI 3IRRA 3MKWB 3R61A 3IRQA 4NB5A 5EEHA 4KUMA 1MW7A 2XPWA 1DGRM 1D0ZA 2ESNA 4ZYEA 2FMLA 4CCOA 3EYIA 1O3SA 3BTIA 4JYKA 1LFUP 3ZQGA 1HDDC 4N9HA 4K2EA 4OMZA 1XCBA 2A5YB 3F72A 2VI6A 1WFXA 5J1YA 2IS4A 2XSDC 3AG1H 1VQ6I 1D8KA 4L9VA 1POGA 2VASA 5FGMA 3LSPA 3DPUA 3G1OA 1RR7A 1U0JA 1ONVA 3BG5A 5ILUA 5DM6F 1LDJA 2XKPA 2L7KA 2HPIA 2HEOA 4U0YA 4PSWA 3GYHX 3FXQA 4BBRJ 2LTPA 1UMQA 4KFCA 3VYSB 2Y69H 2LREA 2M2EA 2E2IJ 1ORKA 2FA5A 3DU5A 4XKWA 1D5YA 2E2JJ 1Y56A 2VLAA 2M8GX 1I1GA 3F9KA 3JTGA 3BOQA 4L5IA 4PGHA 2LY2A 1JKPC 2LK2A 3WGHA 3ABTA 2ZBKA 2NRAC 1HW5A 4EM2A 1XGOA 3LAJA 3OIOA 2DT7B 4BNCA 4BE1A 2DPDA 1KQ8A 3ZCOA 5ICGA 2XF6A 2OPTA 2X6WA 1G3TA 2IP2A 2YR2A 5K5OA 4A3EJ 1FBSA 1R5ID 1G3SA 1MMNA 4XM3A 4N0BA 4YIRX 1Z9CA 3G73A 1FJLA 2XHKA 2FSWA 1ZREA 3DEEA 3CCEI 1J09A 3I9V2 4A5MA 4UUSA 3ESWB 4G7OF 3RCOA 2GIZA 2IBDA 4X1EA 5JHFA 3OYCA 5F1RA 3K70D 3BCAA 1ZRDA 4G8XA 1APLC 4Y15A 1XS9A 3QPSA 4NDLA 3GTGJ 1IUYA 4KIGA 3IH4A 3NRVA 3QU3A 1B6AA 2HYJA 4LJZF 1OFCX 2E5ZA 3GTJJ 1MNDA 2LOOA 2CGPA 2FX0A 1SMYF 3TW6A 1BOBA 2HQ5A 3GTPJ 1OCZH 2OZUA 3FKIJ 4ESBA 3LSJA 3I58A 3COAC 4ZDOA 3GTLJ 1O3RA 2K4BA 4C2TA 3S3MA 1FOWA 2R7WA 5CVUA 1VTNC 3ZOBA 5KAFC 1AKHB 5JVTA 1OYWA 5F0FA 5LRRA 4ESFA 2HOAA 2FQ3A 1W0UA 1FOXA 2E71A 4BQQA 2I10A 2Y48A 1D1AA 2LKPA 3H3UA 1B72A 3V8KA 4F92B 1KQ0A 1PJRA 3GCMA 2A05A 3W2AA 2GAUA 4PJ0C 4RAFA 1HW1A 4MQ9F 1OR7A 4LFUA 4IHVA 1SVLA 2CQQA 2VKVA 1GXQA 4F55A 4H0EA 4HPQA 3VFZA 5A2QZ 5E8GA 3IAS2 4FT8A 2M7BA 1SANA 3EUKL 3OMYA 4E4HA 3MZHA 1EH8A 1SD6A 3WTTC 1RR8C 5CJ9A 2ZNZA 4F7ZA 1I6HJ 5DDGA 5CVIA 5DEQA 3L1PA 3ASOH 4YRVA 4EJTA 2BE5F 3IV5A 1YIJI 1F1ZA 2PJRA 1P7JA 3JRHA 2VE8A 2F5DA 1J7KA 1YW9A 3MMYB 2Q2EB 1BW5A 1WJDA 4CZCA 1Z6RA 2CWEA 1XDUA 1O7FA 2ECCA 2V9KA 3RPUD 2M34A 1AWCA 1R4NB 2WAQA 4P9FA 5CKTA 2DT5A 3EQLF 5TJJA 1D8JA 1U78A 4XRSG 3ABUA 1JTYA 1P92A 2HDDA 2Z5UA 3ZMTA 3KE2A 1M1EB 1BIBA 2E60A 2K5CA 4XLEA 2ZJPF 2XIGA 3RTRA 1Z7UA 3IKVA 2X6YA 1IRFA 4XLHA 5CQGA 3VYUB 1Z3XA 2VBZA 1YG2A 2R5ZB 5C4XJ 3PO3J 3WTVC 3CCQI 1ENHA 2L54A 5D6EA 2IVMA 2VBWA 2NXNB 2KT0A 3P5JA 1PP7U 1ACIA 3K69A 3KP6A 3HUGA 4B47A 2RQQA 5FRNA 2ZMEA 2KPMA 2DOFA 2I8DA 3CCUI 2LG4A 1QQIA 2GXAA 1DPRA 1BA5A 1OQYA 4DNCA 3GZNB 4PCQA 2Y75A 2H27A 1YOVB 2ZCWA 1KU2A 3BJ6A 2IRFG 1VNDA 4WWCA 4IVNA 1MJ9A 3HDDA 3I56I 4C3IJ 3HTSB 5J40A 2ZXHA 1QNTA 2HR3A 2MBFA 2VOPA 2QCOA 4M3GA 3GTQJ 3C1DA 1YRNB 1H9GA 1LDDA 3FX3A 5GADJ 1CF7A 3LA2A 4A3JJ 4CDGA 2FJ1A 4G6QA 5M5YJ 2E19A 1SFKA 1STZA 2DA1A 4JX4A 2LFBA 4HSTA 1MBGA 2QVOA 2NVQJ 1SD7A 2OBPA 3FISA 1HKSA 1QPMA 4AWXB 1DPUA 4DBQA 1B8IA 2M0CA 4UUTA 1USSA 3CC2I 1Y8QB 4DYCA 1VQPI 2FXAA 2LYCA 2RNGA 2UUZA 2V79A 2BEOA 2VBYA 3KPHA 3LFKA 5HVQC 4LK0F 1VFCA 1D1CA 3CO7C 4WXHA 4L9JA 3BTJA 1YW8A 2L9RA 1B9NA 4PJJA 1I50J 2LF8A 3BPXA 2IT0A 2VPLA 2FRHA 1LFPA 3RKYA 3B6CA 1X1CA 3J7ZI 4HX4A 4IEJA 3KEOA 3HJEA 3CC7I 1YLFA 5D4RA 2KMUA 4G7ZF 3HM5A 2OD5A 1U9OA 3I59A 5KCMA 1NTCA 4NHJA 4OIOF 1ZELA 1WRJA 3ZR8X 4Z6YA 2EZLA 3DEUA 3JRIA 3GMEA 3I71A 5ILSA 2CQKA 2KL4A 3K1MA 2EA2A 1TQMA 2CUJA 4E7ZA 5F64A 2H8WA 1B1BA 2VN2A 5D5XB 2M1BA 4YG2F 3FWEA 2HVSA 1WGXA 4FTHA 1MSFC 4XKCA 5L3BA 3E5QA 3CMMA 4BHPA 2HPMA 1X1DA 2DJIA 2VQLA 4F52A 5DTDA 1K78B 1TT5B 3JR9A 1B59A 4G6DA 4CCJA 4P9UA 3MKZA 4B09A 1ZGJA 3HOWJ 2BHYA 2ZNYA 1DUXC 4XRMA 1OMIA 2A68F 1MMSA 5H6QA 4IO9F 3ZQLA 1DU6A 3I5UA 2CFOA 3KYLA 5FKMA 4CGZA 3LAPA 3G6EI 3DKWA 3H9JA 2WB1A 2QKMB 1EA3A 3WU0A 5ICFA 2D5VA 2C6YA 4MQVA 4G9YA 1FPQA 1ZGAA 3HRUA 4LGWA 3FF5A 1VQ7I 3FMQA 4LIUA 2PN6A 1BI3A 3H3ZA 3FM5A 1O3QA 5KK1A 2ZO4A 3CO6C 2VQCA 2JJ7A 4A3FJ 2BW3A 3F8FA 2DA2A 3J7YJ 1V3FA 1OYIA 2BXYA 4GDFA 5AIQA 2PBIA 3G1LA 1WI9A 2EV0A 2QYOA 2X51A 1IJWC 1E3PA 1PP8F 5KHDA 4QTRA 2XC7A 1ZRFA 4IHTA 2BHZA 2GBYA 4A3CJ 2KISA 5IYBJ 1GUUA 2JVHA 3IH2A 5CVVA 1BJAA 1X4OA 5CVRA 1QZYA 1YJ9I 5FROA 3Q9VA 3V7SA 1IV8A 2EWNA 2DI3A 3NEUA 1L3LA 1AOYA 5JLXA 3L00A 1UFMA 4QLCU 4FASD 3OR1C 1ETXA 4ZYDA 4HF1A 2XAFA 3F23A 3OOUA 2ZKZA 3KZIC 1R9TJ 5FLVA 1QPIA 2LSOA 4BXFA 4RB1A 4BAYA 1R4MB 2NYXA 2LBFB 5C44J 2Y0SN 1GV5A 2V1NA 4BHBA 1WZ2A 3G3ZA 3WTSC 2XAGA 2R7ZJ 5HNHA 4ZC3A 1FIAA 3M4OJ 2QKLB 5E1WA 2WAEA 2W24A 4UV8A 3BG3A 2O3FA 3SZTA 4I6ZA 5H20A 3OS1A 5DD4A 2XRLA 3LOCA 2LY1A 3ROUA 2DFFA 2GZWA 2E34A 4JBAA 2IEKA 2W48A 1JKRC 4B48A 4AIKA 3ERMA 3K10A 2L3DA 4IXAA 5LD2C 3Q0UA 1P9QC 4TV7A 3C3WA 3RKXA 1VF9A 1FSHA 2BGCA 3CESA 2PG4A 2PMZN 3UNGC 3TOAA 2JQ7A 1F36A 3ISPA 3D5LA 4CHUA 1TQIA 4C9YA 4ZYGA 1MBJA 2KIQA 2Q8KA 2R7TA 4I2OA 3WU2C 4HAMA 2XPVA 4F3QA 3L2RA 4FE7A 4XRSA 2A07F 1LDKB 2DYSH 4Y4RA 1WPKA 3BP8A 5CPRB 4A3BJ 1AU7A 1VQNI 3D5SC 4YELA 5BPIA 1YFHA 1SC7A 1FMWA 2TCTA 3IAM2 1EKEA 3E97A 1XN7A 2UXXA 4NC6A 3H5RA 2WTEA 2QUFA 5B1AH 4BDZA 1D0YA 2BXZA 5IY5H 3GLXA 4ANJA 3X2QH 3QYEA 5DYMA 1R1VA 2JZYA 5EGOA 4UUSB 3TOBA 1QZEA 4HYEA 2EBIA 2DO7A 3HKZA 1HSJA 3GX4X 2XDVA 2F5FA 5DS9A 3BCBA 3I54A 4U88A 3K4KA 2XSJC 1MD0A 4M74A 4XKVA 2CJJA 2WBMA 5E3MA 3T8RA 3OYKA 1FTTA 2OU2A 2Z2SB 4ZJZA 1PUEE 4CYDA 1HDPA 3KEYA 2A6EF 2Y0MA 2FE3A 3ASNH 2Y9ZA 3PJRA 1KU9A 3MZYA 4WK8F 3RQIA 3S15J 3MKYB 3MN2A 1U2WA 3E6BA 5D5UB 1OCPA 5F04A 3WHCA 4Q4ZF 3M1EA 4PJMA 4A3KJ 2L0KA 1MH4A 4Z2YA 1ZH5A 4MTEA 3TO9A 4PJNA 2L9NA 1K4SA 2CUEA 2DMTA 3G71I 1LUJB 4IOCF 2BY2A 3K9TA 3OSFA 3JAMK 2VKHA 4OAZA 4BE2A 3I0TA 4CYCA 2H6CA 1FP2A 2L02A 1IN7A 3OYJA 2LKSA 4P55A 4RM3A 1H89C 2NNYA 3DPLC 2JK3A 2HGCA 3GXOA 3QPLA 2VKDA 4C3HJ 1JKQC 1B72B 2KFDA 1KYWA 2F5CA 1G2HA 3FXLA 5B66C 2VXZA 3CCSI 1WVRA 4A6EA 2JA6J 1EH7A 4FX4A 1GT0C 4YFKF 1I6XA 1S8NA 1T33A 5IOZA 1REPC 4C3JJ 3GBGA 4UB8C 1YHQI 4AC0A 3IC7A 3QQAA 4YIFA 3N97A 2VUMJ 2LP0A 3L9FA 2CYYA 3HL2A 1A35A 3ML6A 1YTYA 3CP2A 4PZJA 5JVGF 4FETA 3W3CA 5J47A 3K1NA 4M3EA 1UB9A 4UY8I 2NVUB 5E3LA 4FISA 4V2GA 2WWYA 3HPHA 2HNHA 4I01A 5EZHA 2VONA 4KJZA 2E1OA 4M3FA 2K9NA 1D5VA 3S3NA 1BR1A 3S17J 4UV9A 5E3NA 1T6SA 3VYRB 1Z0XA 1HLVA 2QSFX 1YS6A 4OIPF 3BZKA 3D5RC 5E17F 3K1PA 2V6EA 2DMNA 1IG7A 3V7CA 2DMPA 5EJCA 2RREA 2DMUA 1W5TA 2VIXA 3LSKA 4HLXA 1N75A 1IRZA 3E6DA 3S2HJ 4EV0A 1MNMC 4HZFA 3DBLB 4IJAA 1T0FC 2F5EA 3ZRGA 1C0WA 3K4NA 3SZGA 3S1MJ 2OTLI 3EPZA 2L4MA 2WC2A 2KDOA 3E5UA 3ZQQA
chains in the Genus database with same CATH topology
1QHGA 2IS6A 3DLAA 4GRIA 5FRMA 4F55A 2DT6A 4HPQA 3VDXA 1WJEA 3IAS2 3RQ4A 3OYEA 1GLNA 2R7OA 2M7BA 1N78A 2HDWA 3EUKL 3OMYA 4E4HA 3PSIA 4XOTA 2CMPA 2DCEA 1K6YA 2P0WA 4XLFA 3DQVC 4JOMA 3OY9A 1DGWY 4YRVA 1PYVA 2VJ5A 4B43A 4J00A 2R7XA 2JSPA 2L9SA 5HLTA 2PJRA 3IUOA 4ZTFA 2CV1A 2CV2A 2L5QA 3C2HA 3OR2C 4U7BA 3FHNA 1UAAA 2ZFUA 2VJJA 3MD2A 2Q2EB 3MMYB 3OYGA 3L2QA 2UWMA 1WJDA 3HG9A 3RPUD 4CZCA 2V9KA 2WAQA 2M4KA 5CKTA 3OYAA 3V42A 1OLTA 4AYBA 3OS0A 1T95A 2E60A 2K5CA 4XLEA 3H5NA 4F93B 2M4GA 2MABA 3H0DA 2VXDA 3RTRA 3TMOA 1X1BA 4B3XA 2X6YA 1YX5A 4NC8A 5CQGA 4XLHA 3VYUB 1Z3XA 3DKYA 3PL8A 4Y3OA 2CV0A 1G59A 3DU6A 3FBNB 1G8XA 2ZSIB 1NG6A 2K9LA 3E1SA 1UG0A 4CSWA 4B47A 2RQQA 5FRNA 3AL0C 4IQJA 2KPMA 2I8DA 1Z21A 2R4GA 3LMMA 2LG4A 3KX2A 1OR7C 4CCMA 3L2WA 3CZ6A 1VZ0A 5HOOA 4ZDLA 4BACA 2IXSA 2VJ4A 4BU2A 4D1QA 2R7VA 4HEA2 2ZXHA 1QU3A 3AL0B 3HC7A 3LFUA 4ZDPA 1MMDA 4XN3A 3AFHA 1E0EA 2KHMA 3BC8A 3K4JA 2F6CA 2A6TA 4PFPA 5HNFA 4CA0A 4R79A 2K3PA 4BJ5C 1SFKA 4II3A 4BEHA 4HSTA 4BUPA 3LSIA 2HU9A 3A1YA 3ZXSA 1AA7A 3N05A 4E7IA 4E7JA 4B44A 3SYTA 4QPQA 4H4KC 4OWRB 4XLAA 3SEZA 4DBQA 2PJRB 4EATA 3OYNA 1LVKA 3J7AY 3H5AA 3FKJA 4XNFA 2LYCA 4XKBA 4C2UA 2RNGA 3LSMA 2CW7A 4RLQA 2UUZA 1WJBA 2JUGA 1D1BA 1X1AA 1WJCA 3EUAA 5HVQC 4Y33A 1D1CA 2VB6A 4PJJA 3H9GA 3LSGA 2VPLA 2X1EA 1LFPA 3BG7A 1X1CA 2DXIA 1QHHD 2KMUA 1KONA 2VL8A 4HG2A 5KCMA 2CH0A 3K4MA 1ZELA 4HNUA 3ZR8X 4DOZA 3HUGB 4HSRA 3LSHA 4BE0A 2ELJA 1W36D 2KL4A 4PJLA 2LH9A 4BJ6C 4BGDA 2CUJA 4E7ZA 5CQEA 3HOTA 2BW3B 2DOAA 2KRCA 4BDYA 2W00A 3VWBA 3S32A 3PSFA 3ONQA 4C30A 2HVSA 4XKCA 2V4JC 3CMMA 3VYTB 4NUBA 1UELB 1X1DA 2DJIA 2JA2A 2KQRA 2VQLA 3S93A 2MC4A 4JQFA 4F52A 4E7SA 3DPTA 2LBFA 3S8PA 4CCJA 3MKZA 3QYBA 4CCKA 3K6GA 3VSLA 1HA8A 2F5VA 4NQWB 2MD0A 4BEHB 2XAUA 4DBRA 3L2VA 2OUMA 4XL9A 2E5NA 4RLFA 1WJ5A 2CFOA 3OYLA 3KYLA 2E1MC 1BR2A 2IGNA 3E0JB 2XF7A 1S9HA 1Z7LA 2GOMA 3H9JA 3HPGA 4N4OB 3PNTA 2WB1A 3OL3A 3OYHA 4IX7A 4RM2A 2QKMB 1EA3A 1MNEA 3FBIB 2KRHA 4PUSA 3NWTA 1NG7A 4D9JA 1MMAA 2V26A 5LFAA 2Q1ZB 4LIUA 2BVLA 2X85A 4PFOA 2XF5A 4U87A 2E1MB 2ZXIA 2A5WA 3M8JA 2VQCA 3K4CA 4P5OA 2BW3A 4LITA 1WJFA 3QYFA 4HRIA 1W36C 2V7FA 4J01A 1LKXA 2K9MA 4ZYAA 4X0GA 4IZZA 2UV1A 4KITB 3OS2A 2X51A 5KHDA 2HZDA 4XMYA 2XC7A 2W7NA 2X1DA 3ZGKA 3H35A 4KISA 2JVHA 4XLCA 2GOXB 4XOPA 1X4OA 2IS2A 1IRXA 5FROA 2Z16A 4XONA 3SEQA 3U21A 4CUGA 2IGKA 2M3AA 4E7HA 3FDYA 4E7LA 4FASD 3OR1C 1JI8A 3TL4X 4BQOA 3AKZA 2HQAA 3LL7A 3DTEA 3C2GA 3OL4A 3OOUA 2R7QA 2L2OA 3NWSA 4BXFA 3QOEA 3DWLE 2MYSA 1V5GA 2AQEA 2W4SA 2LBFB 3W2WA 2V1NA 2M0MA 2WAFA 4DGWB 3OYIA 2VJIA 4NNJA 3BG6A 1FMVA 1Y6IA 5HNHA 4ZC3A 1Z3YA 2QKLB 2WAEA 4OAYA 3PNVA 3G2BA 2CS3A 2Y0SA 3CJQB 3OS1A 3M1CA 3DTKA 4BL0B 2LY1A 2HPMA 3CF2A 4CCNA 2WA0A 3HXLA 2AQFA 4B48A 1MMGA 4YEJA 3K10A 4XQFA 4KT6A 2BOLA 5LD2C 1P9QC 3CJRB 2R7RA 3QODA 4ZTJA 2WY8Q 2CW8A 3CESA 5KNLA 2WADA 3UNGC 2KP6A 1DQUA 1V5EA 2IS1A 3D5LA 3OIPA 4BJTA 1WJAA 2JVGA 4C9YA 3A4CA 1YE9A 3EUHC 1V5FA 3W2VA 3PNYA 2R7TA 4F3QA 3L2RA 2PMZA 3MKWB 1LDKB 2VQHA 1MW7A 2NOJB 1DGRM 1D0ZA 1BR4A 4CCOA 4Y4RA 4DIQA 4P1WA 5CPRB 2BVMA 2X6XA 2IGMA 3D5SC 4YELA 3K70C 1FMWA 2W1OA 3IAM2 2IGOA 3H5RA 4E6KG 1WFXA 2MFZA 2IS4A 3OYBA 2FUG2 4BDZA 1D0YA 4ANJA 4LG3A 2VASA 3QYEA 3DKXA 3SDBA 3DPUA 3HKZA 1U0JA 4E7KA 2XDVA 3BLYA 3BCBA 2L7KA 2HPIA 1X19A 2XSJC 3K4KA 4PSWA 4XKVA 2X1CA 2WBMA 4LIVA 3OYKA 2Z2SB 4ZJZA 3VYSB 4HNTA 3KEYA 4PSXA 4G6TB 4CH7A 1TT0A 1R6RA 2LREA 3PJRA 1ERDA 1YX3A 2F4IA 3DU5A 4XKWA 3OWTA 4QPOA 3PFYA 1Y56A 3MKYB 2VLAA 4BS9A 4PJMA 3F9KA 2O5RA 3CP8A 2LY2A 4AVZA 2W82A 3DTIA 4PJNA 2L9NA 2HVRA 3L2UA 2R7UA 2CUZA 4AU7A 2KLOA 1TZLA 2VKHA 2DT7B 3OIQA 4OAZA 4BE2A 4F91B 3HOSA 3K4BA 3RSNA 4BE1A 3ZCOA 2XF6A 3OYJA 4CCLA 2X6WA 4RM3A 1D0XA 3H9QA 3DPLC 3K4LA 4IKFA 1MMNA 2OV7A 2VKDA 4RMNA 4XM3A 2KZVA 1SAUA 3VSKA 2VXZA 2LRDA 1X4PA 2Z1DA 3DEEA 4NC7A 1J09A 3I9V2 3RCOA 5JHFA 3OYCA 3OYFA 3K70D 3GBGA 2R7SA 3BCAA 2M7AA 3HL2A 3CP2A 4XN0A 4FETA 4DJAA 3A2KA 2VQGA 3W3CA 4XORA 3I3LA 3HPHA 2HNHA 2E5ZA 4KJZA 1MNDA 2LOOA 3PUBA 5TGTA 3S3NA 1BR1A 3VYRB 4II2A 3UR3C 1BOBA 4N4NB 2HVQA 4ITVA 3D5RC 4ZDOA 2V6EA 4C2TA 2ZSHB 3OYMA 3S3MA 2R7WA 4MLOA 3IP4B 2RREA 1N77A 2LC2A 4XR6A 4IQ4A 2VIXA 2WY7Q 2OC6A 3LSKA 3OYDA 1N75A 4BQQA 3TBIA 4BQNA 3S3OA 1D1AA 4PK4A 4F92B 1PJRA 1DP3A 1T0FC 3ZRGA 3K4NA 3SZGA 3W2AA 3EPZA 2KDOA 3ZQQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYV A; 
#chains in the Genus database with same CATH topology
 2WV1 A;  4MO7 A;  3FHZ A;  3NAR A;  1V4R A;  1LNW A;  3VDX A;  2H1K A;  4RGR A;  1RZ4 A;  3OYE A;  2ZME B;  3V8L A;  1RUO A;  1TW2 A;  1IO2 A;  1O3T A;  2XVC A;  2CMP A;  2DCE A;  1K6Y A;  1SD4 A;  4OIQ F;  1RKT A;  4XLF A;  2Z33 A;  2O8X A;  1I1S A;  4JOM A;  2XAS A;  2QWW A;  1DGW Y;  3FK6 A;  1KYZ A;  3S14 J;  1UST A;  1R7J A;  4GYG A;  3AG3 H;  4G94 A;  2ZXJ A;  2JSP A;  2L9S A;  4I99 C;  2EFP A;  4ZTF A;  2JPB A;  2CV1 A;  2CV2 A;  3C2H A;  2DK5 A;  2PJP A;  4IRI A;  5FD6 A;  3FHN A;  5BS6 A;  2ZFU A;  3SFZ A;  3PIP F;  3L2Q A;  1IZ1 A;  3ABK H;  5BNG A;  3OYG A;  4DYQ A;  3HG9 A;  4GXO A;  4EJV A;  3ULQ B;  2VKE A;  2M4K A;  5CYV A;  5HDG A;  2ACJ A;  4LK1 F;  4AYB A;  1R36 A;  1T95 A;  2M4G A;  3TMO A;  1HQC A;  1YX5 A;  4HF0 A;  3BG9 A;  1Y1W J;  1V55 H;  1RET A;  4Y3O A;  1FBU A;  1G59 A;  1UHS A;  2QSH X;  2QGU A;  5CLS A;  3DU6 A;  1NH3 A;  3REO A;  1YIO A;  4L9N A;  2HTS A;  1U5T A;  3CMA I;  3E1S A;  4M73 A;  1ON1 A;  5IOY A;  5HS8 A;  1OJL A;  4I98 B;  1I3Q J;  2QEN A;  2COB A;  4U0W A;  4LB6 B;  2R4G A;  2EIK H;  1ZG3 A;  3QPT A;  1JGS A;  2RC4 A;  1OR7 C;  2EIJ H;  3CZ6 A;  1VZ0 A;  2OA4 A;  2LF7 A;  4QWQ A;  1FZP B;  2VJ4 A;  4RAG A;  3E6C C;  2R7V A;  2ME6 A;  2HKO A;  1TC3 C;  3BR2 A;  2XRN A;  4M71 A;  5LEJ A;  5K1Y A;  3SHF A;  3KIO A;  4ZDP A;  2DPU A;  1BI0 A;  3AFH A;  3PO2 J;  2DLL A;  3ZMU A;  3BC8 A;  3IWZ A;  2EIL H;  4BYY A;  5J1R A;  1VQL I;  1WCM J;  4KIB A;  1IV6 A;  5KVR A;  4NQW A;  1ON2 A;  3DCF A;  4BEH A;  3EUH A;  1LB2 A;  5HLI A;  1UHW A;  1TWA J;  1W7P A;  2B0L A;  3WG7 H;  1J2X A;  2K40 A;  1WSU A;  2JRT A;  4H4K C;  5LGU A;  4KMU X;  3SZP A;  4OWR B;  4XLA A;  3SEZ A;  3T5X A;  4IRH A;  1QGP A;  2R3S A;  1X1P A;  3OYN A;  1TL8 A;  3KLO A;  1LVK A;  2HQR A;  3FKJ A;  4XNF A;  1YO5 C;  2NOG A;  4V19 K;  2PMU A;  4Y7N J;  2ADU A;  4RLQ A;  1WJB A;  2G7H A;  4LD5 A;  1GHC A;  2EB7 A;  1ZAR A;  2EIN H;  1BC7 C;  2ZJR F;  3H9G A;  2LMD A;  3M8F A;  2ZME C;  5F6F A;  5EEA A;  1JT6 A;  2IPQ X;  3GO5 A;  3ZQI A;  1GXP A;  4R8H A;  2ZJ2 A;  2D1V A;  2LLK A;  1KON A;  3ECH A;  2VL8 A;  5LRS A;  1IRG A;  1MBH A;  3KLN A;  4MFE A;  3HSE A;  3ZMD A;  3KZZ A;  4HSR A;  5LEK A;  2DJN A;  3MAJ A;  1FT9 A;  3HRM A;  3JAM Z;  1W36 D;  4PJL A;  2QBY B;  4FQG A;  2Y30 A;  2P7C B;  2W84 A;  2XGE A;  4JK1 X;  2BW3 B;  4EEF G;  3KEQ A;  3E5X A;  1XCV A;  2W00 A;  3Q0W A;  3VWB A;  2MLG A;  3RYP A;  3ZN1 A;  1BN5 A;  3FXK A;  1TBX A;  2Z3Y A;  2CQ7 A;  3JTH A;  1FIP A;  3BRO A;  5K5R A;  1IXS B;  1ZKG A;  1Y0N A;  1K7A A;  3RKQ A;  1GVJ A;  1UEL B;  2EQR A;  2KQR A;  1X2M A;  4DW6 A;  4JQF A;  5DV5 A;  4E7S A;  4ENK A;  4E70 A;  3F8M A;  4L18 B;  3S8P A;  4HQE A;  4LG0 A;  1ETW A;  5C4J J;  1U8R A;  4HF2 A;  2DA4 A;  3VSL A;  1HA8 A;  3LWF A;  1MIJ A;  2VPR A;  3HKZ N;  3BT9 A;  5M5W J;  1K6O A;  4XL9 A;  2YU3 A;  3QWL A;  1K83 J;  1XB4 A;  5JI6 A;  1AHD P;  2OJE D;  4W1U A;  4LB5 A;  1BR2 A;  2IGN A;  2M87 A;  5M5X J;  2XF7 A;  4ZYH A;  1S9H A;  5TIS C;  1SEU A;  5AIP A;  3HPG A;  4C2M J;  2VE9 A;  1HKQ A;  1QO0 D;  1S3J A;  5FD5 A;  4OMY A;  1GDT A;  1FEX A;  1UG2 A;  4IX7 A;  4RM2 A;  3IHU A;  1VQK I;  3A01 B;  2QEX I;  4M9Z A;  3I55 I;  1YJW I;  2V6C A;  1MNE A;  3S1R J;  3FBI B;  2YX4 A;  4PUS A;  1MJB A;  2LDU A;  1ZG1 A;  2MGQ A;  4U87 A;  2E36 A;  4HNV A;  2DOE A;  1MSE C;  2Y9Y A;  3M8J A;  2HFH A;  3OSG A;  1ULY A;  2DTR A;  1MDM A;  3K4C A;  5HDN A;  2FNA A;  4LIT A;  3M7G A;  2FBK A;  3G4S I;  1TLH B;  3FM3 A;  3QYF A;  4HRI A;  2HDC A;  3SFI A;  1W36 C;  2EIM H;  2G9W A;  4X0G A;  3OS2 A;  2F4O B;  3F0C A;  2JMW A;  2E1C A;  3BJO A;  4JP0 A;  4KIS A;  2O8K A;  1SFU A;  1MBF A;  4XLC A;  3H0G J;  2GOX B;  2J5P A;  4XOP A;  3ZQH A;  1IRX A;  2R5Y A;  3GFI A;  2H1L A;  4O5V A;  3CCJ I;  1YQA A;  4D0P A;  3VPR A;  1UJ8 A;  3WTZ A;  3J80 K;  5D6F A;  1ZRC A;  1R5H A;  4CUG A;  1KZH A;  3T1B A;  2IGK A;  4HLY A;  1LFB A;  4GO1 A;  4BBS J;  5AON A;  3KZY A;  2E35 A;  2F4M B;  3TL4 X;  1WKM A;  2ZJQ F;  1B4A A;  3C2G A;  5FO5 A;  1JHH A;  2HOT A;  4HV6 A;  4WXD A;  1RC9 A;  2FNP A;  2L2O A;  3NWS A;  1K4T A;  2BYV E;  3DWL E;  1V5G A;  5D4S A;  4IPA A;  3W2W A;  4AIJ A;  4L9T A;  4DGW B;  1FNN A;  2VJI A;  5FLX K;  2JT1 A;  3OV8 A;  3EET A;  2W57 A;  1LE8 A;  1S6L A;  4FX0 A;  3K7A J;  1Y6I A;  1ZTR A;  3BR6 A;  1Z3Y A;  2AO9 A;  1U6G A;  1EH6 A;  4OAY A;  1R58 A;  5GP9 A;  5EYR A;  2E1N A;  3VB2 A;  3FXM A;  1A5J A;  1TNT A;  3HSR A;  1T2K A;  2K86 A;  4ZZL A;  1HW2 A;  1KQ9 A;  1R5G A;  2AQF A;  2O6G E;  4YEJ A;  4RDU A;  5DUK A;  4KT6 A;  1T39 A;  2KIM A;  3QP5 A;  1FSE A;  4ZH4 F;  2VOD A;  1X3Z B;  2DQR A;  2BY3 A;  4HDU A;  4ZTJ A;  2P8T A;  4LOC A;  3F8B A;  5KNL A;  4Q5S F;  1VI0 A;  3TKY A;  2WAD A;  2DA7 A;  3SXY A;  2R92 J;  1DQU A;  1A6I A;  1RKW A;  1SFX A;  1V5E A;  4BJT A;  1Z05 A;  4EVI A;  5E3O A;  1JUP A;  3A4C A;  4WXC A;  3WTW C;  4EGZ A;  2OCE A;  4UHT A;  3KP2 A;  3PNY A;  1HBX G;  1J75 A;  4S0H B;  1BR4 A;  4DIQ A;  1FLI A;  4MTD A;  4P1W A;  4DQ2 A;  2X6O A;  2BVM A;  2IGM A;  4XID A;  3U9G A;  3H1C A;  2OAZ A;  2XGC A;  1OKR A;  2NS8 A;  3FXJ A;  5GPA A;  1XSD A;  1S29 A;  3F8N A;  2GIV A;  5E20 A;  4E6K G;  1JXS A;  2MFZ A;  4LLG F;  2BV6 A;  3FIW A;  2FUG 2;  3BQZ A;  2EZH A;  5BMZ A;  4LG3 A;  3MKL A;  2D1H A;  5IYD J;  4M72 A;  4ENM A;  4RB2 C;  3RPU A;  4ESJ A;  4E7K A;  4CXF A;  3BLY A;  2OQG A;  3QRF F;  1T56 A;  1OIS A;  5JLW A;  2OZ6 A;  3BR5 A;  2O0Y A;  1P4X A;  2X1C A;  1AKH A;  2HYF A;  3GLL A;  4AD9 A;  3N4M A;  4A93 J;  2JTV A;  4I0B A;  4CH7 A;  5DUI A;  1QA6 A;  1TT0 A;  1R6R A;  1X58 A;  2RGV A;  2HXI A;  3J81 K;  2RDP A;  2AXL A;  2E7W A;  5H2F C;  2MG4 A;  1VQ8 I;  2AHQ A;  4BS9 A;  1E2X A;  4B1R A;  3ZPL A;  2O5R A;  2CQX A;  4AVZ A;  2W82 A;  3DTI A;  5K7F A;  2H94 A;  2HVR A;  3VEP A;  1I39 A;  1T08 B;  2CUZ A;  1A04 A;  2O9L A;  1TZL A;  1K79 A;  4XLN F;  3UKG A;  3QU6 A;  3V4G A;  3K4B A;  3RSN A;  2V1D A;  5B3S H;  4CCL A;  2CRG A;  1NK3 P;  3MEX A;  2BY1 A;  3CUO A;  3GZ6 A;  4IKF A;  2B7E A;  2HS5 A;  3S1Q J;  1IN4 A;  2KZV A;  1FYM A;  2MC3 A;  1ETQ A;  4UB6 C;  2HQN A;  1MZB A;  2LRD A;  2Z1D A;  2JN6 A;  2Q2E A;  4NC7 A;  3F22 A;  5L3D A;  3JSO A;  1MH3 A;  4B8X A;  2CO5 A;  4HOB A;  4B4C A;  3HHG A;  4W97 A;  2R7S A;  3A0B C;  2M7A A;  2RQP A;  5IP7 J;  2K85 A;  4BH9 A;  2NVX J;  1WQ2 A;  9ANT A;  4XN0 A;  2STW A;  3M3Y J;  3A2K A;  3RDI A;  2QLZ A;  2L01 A;  2KKO A;  4XOR A;  1A6Q A;  2CW0 F;  5LHH A;  4AM3 A;  4Q47 A;  3I3L A;  2CQN A;  3RI4 A;  5L3E A;  5LGT A;  4HX7 A;  5M3M J;  2R5Z A;  1ZR2 A;  1LVA A;  3HEF A;  1VQ4 I;  5TGT A;  4NBQ A;  1JHF A;  1XMK A;  2PLY A;  1BBY A;  4II2 A;  2IW5 A;  3B02 A;  3UR3 C;  4N4N B;  5C3E J;  2A3S A;  1G4D A;  1S7A A;  5J1U A;  3DXJ F;  2KIU A;  1ZG5 A;  2AS5 F;  2ZSH B;  1TP4 A;  3IP4 B;  1N77 A;  4KN4 X;  1IDZ A;  2O03 A;  5DCM A;  2LC2 A;  4XR6 A;  4IQ4 A;  4XIC A;  2DA3 A;  3G1M A;  1BL0 A;  2WY7 Q;  3GTO J;  2OC6 A;  3OYD A;  3AAF A;  3LA3 A;  4WX9 A;  3TBI A;  2H8R A;  3NAU A;  1JUM A;  1FX7 A;  5HLG A;  2VT3 A;  3S2D J;  1XDS A;  5FB2 A;  4KT5 C;  1WH5 A;  2JUC A;  4A3L J;  2EFN A;  4KIC A;  1TWG J;  4JX6 A;  1HKT A;  4A12 A;  1W5C C;  4RB0 A;  3CJT B;  2DAO A;  1YRN A;  2R93 J;  4AVP A;  1QHG A;  3CCM I;  2ELK A;  3DLA A;  1U8B A;  5FRM A;  2QQA A;  1XMA A;  5CVJ A;  3ZP5 A;  1VQO I;  4EM1 A;  3C18 A;  4MNU A;  3RQ4 A;  1GLN A;  3W6V A;  1N78 A;  2HDW A;  2VOO A;  5H6R A;  3PSI A;  4XOT A;  2K9S A;  2P0W A;  3R6S A;  2K3F A;  3J7A O;  2K7L A;  1RES A;  5F1J A;  3FXR A;  3OY9 A;  1P6R A;  5JFR A;  1P4W A;  2WAQ N;  2NVY J;  3J80 Z;  1K61 A;  1DDN A;  2XPU A;  2VJ5 A;  4XBF A;  5FKK A;  2R7X A;  2Q0O A;  5HS9 A;  5B1B H;  3IUO A;  4QIW N;  1X2N A;  1TW3 A;  1BI2 A;  4KYW A;  2VJJ A;  5L3C A;  3MD2 A;  2UWM A;  4XSX F;  2QM3 A;  2D2W A;  1R22 A;  3BTC A;  1H0M A;  3JRG A;  1FYK A;  1JE8 A;  3GFM A;  3I64 A;  3V42 A;  5E1X A;  5GAH J;  1OLT A;  3O2P E;  3OS0 A;  5ED4 A;  3ERE D;  2DU9 A;  3QOP A;  4HA8 A;  2JA8 J;  2MAB A;  5FLX Z;  3H0D A;  2VXD A;  3CUQ A;  5E79 C;  1LEB A;  1X1B A;  2XGD A;  2VBX A;  3C7J A;  3WTY C;  2EPF A;  2CFX A;  2EZI A;  5EDN A;  3BR3 A;  2YX7 A;  3I53 A;  3MVP A;  1SVM A;  1YYV A;  2DTZ A;  1QZZ A;  2ZSI B;  1FOK A;  2V1X A;  5ICE A;  1R71 A;  3FXU A;  3U1D A;  1NG6 A;  5EZG A;  1S5L C;  2K9L A;  1UG0 A;  5GTH C;  1IF1 A;  3AL0 C;  4IQJ A;  1P2F A;  4M9S A;  2DFI A;  1ZQ3 P;  3KX2 A;  1E17 A;  2R7D A;  3JRF A;  4CCM A;  2O61 A;  3L2W A;  2L9V A;  4HX8 A;  1D3Y A;  2MD5 A;  2HI3 A;  4BAC A;  4ZDL A;  4MIM A;  2IXS A;  1IGN A;  4O6J A;  3CCR I;  2TRT A;  1I27 A;  4D1Q A;  4HEA 2;  1UHM A;  3KP5 A;  2P4W A;  5GAG J;  3I4P A;  1ZYR F;  4DZP A;  3GTM J;  1Q1H A;  4ABZ A;  2UZK A;  3JCU C;  2TDX A;  2E2H J;  3LFU A;  3F6O A;  1MMD A;  2B63 J;  3GFJ A;  1E0E A;  2BY0 A;  2KHM A;  3S2W A;  2IJL A;  3K4J A;  2XAJ A;  2CG4 A;  2A6T A;  3HB9 A;  2P5V A;  2F48 A;  5IP9 J;  5HNF A;  5JR3 A;  4CA0 A;  3FXO A;  4R79 A;  4BJ5 C;  1O4X A;  4II3 A;  1ZN2 A;  3DV8 A;  1KA8 A;  2A69 F;  2FMY A;  3LSI A;  2HU9 A;  3E3V A;  3H92 A;  3ZXS A;  1AA7 A;  1YS7 A;  3N05 A;  3R0J A;  4B44 A;  3SYT A;  3DBH B;  2PJR B;  2I5U A;  5LGN A;  1TWF J;  3H5A A;  4Y17 A;  3D0S A;  4XKB A;  5FFZ A;  3LSM A;  2CW7 A;  2HXO A;  1WI3 A;  2JUG A;  1F5T A;  1D1B A;  1WJC A;  5E8I A;  3EUA A;  1FOY A;  2XAQ A;  4N9I A;  2VB6 A;  3CDL A;  1U5T C;  2RV8 A;  2NNN A;  3LSG A;  3P9C A;  3WHB A;  2GA1 A;  2X1E A;  5J4Y A;  1ZAO A;  1OCT C;  1QHH D;  2XRO A;  2P5L C;  2EZK A;  2CH0 A;  4MGR A;  1F9N A;  4M9X A;  5BPD A;  1FYL A;  3T8T A;  3HUG B;  1R49 A;  1L0O C;  1Y1V J;  5E1Z B;  2ELJ A;  4UVA A;  4Y13 A;  2JRM A;  1J59 A;  4AID A;  1GV2 A;  2MH2 A;  4RGU A;  3CLQ A;  1VQM I;  3HOU J;  2P6S A;  5CQE A;  3HOT A;  2KRC A;  2RN7 A;  4I02 A;  1Z6T A;  4BDY A;  3V8J A;  3S32 A;  5J8C A;  5J8F A;  5EF6 A;  3Q5F A;  3EDP A;  2OCC H;  5GTI C;  3M9A A;  5L3F A;  3HSF A;  2XAH A;  4KIF A;  4HBL A;  3U1K A;  1BJZ A;  2JA2 A;  4A0X A;  1ZLJ A;  3S93 A;  2MC4 A;  2EV5 A;  4EQQ A;  2GWR A;  3HOZ J;  3DPT A;  2LBF A;  5FFX A;  3B73 A;  3CQZ J;  3MQ0 A;  5BQT A;  2R5Y B;  1CF7 B;  5JHU A;  3WGI A;  1QBJ A;  2CUF A;  2WB1 N;  4EGY A;  3K6G A;  5ICC A;  2F5V A;  4G7H F;  1XG1 A;  2MD0 A;  2XAU A;  4DBR A;  1GVD A;  1SVO A;  1EJ9 A;  1WJ5 A;  3CCY A;  3WOD F;  3IH3 A;  2E1M C;  5EG0 A;  5D8K B;  1ETY A;  4A3I J;  2N8G A;  1FWZ A;  3HOY J;  2LVS A;  4N4O B;  3PNT A;  1B8I B;  6PAX A;  3BJA A;  1LQ1 A;  4GCV A;  4P96 A;  1S7O A;  1XSV A;  1NG7 A;  2M5W A;  3A0H C;  1MMA A;  3BWG A;  1RI7 A;  4HW0 A;  3JRA A;  2H6B A;  1PUF A;  1B9M A;  1QVU A;  2EK5 A;  2Q1Z B;  2BVL A;  4IRG A;  2X85 A;  4PFO A;  1YJN I;  3S1N J;  2L7M P;  2A5W A;  2VC1 A;  3HYI A;  1LE8 B;  1R23 A;  3BDD A;  4P5O A;  3H3V K;  2ISZ A;  3JRD A;  5BOX A;  4G12 A;  5K7Z A;  4PDK A;  4J01 A;  2K9M A;  4IZZ A;  5DCF A;  5DM7 F;  5LLQ A;  2GLO A;  4XMY A;  1ETK A;  2DOD A;  4CO8 A;  2X1D A;  3CJN A;  2EA4 A;  4YII A;  3I59 B;  1YIT I;  3ZGK A;  3H35 A;  5LHG A;  1JT0 A;  4HV5 A;  1DU0 A;  4A6D A;  2IS2 A;  1MKM A;  3ECO A;  1G3Y A;  2ISY A;  1T0F A;  5IYC J;  3SEQ A;  3U21 A;  4MEX F;  2XV4 S;  3IWF A;  2FF4 A;  1BW6 A;  4E7H A;  3RIR A;  1RPW A;  3JRE A;  2NS0 A;  3HTU A;  3QPH A;  5LHI A;  4L0Z B;  2ME0 A;  3KP7 A;  4BQO A;  1XGN A;  3LL7 A;  3DTE A;  2YUS A;  3L09 A;  5ERI A;  2KJB A;  2K27 A;  2R7Q A;  3P9I A;  3QOE A;  2PEX A;  1LJ9 A;  2AQE A;  3CF5 F;  3GVA A;  2A61 A;  2W4S A;  2EV6 A;  2WAF A;  3GEZ A;  2QZ8 A;  4NNJ A;  3HOV J;  3VOD A;  2XGX A;  2MA3 A;  1FMV A;  5M3F J;  4Y52 J;  1Z91 A;  2PI0 A;  3PQK A;  1T8I A;  2NAZ A;  4UNO A;  3PNV A;  3G2B A;  3AG2 H;  3SJM A;  5D8L B;  2ID3 A;  2CS3 A;  2RNJ A;  2Y0S A;  1YI2 I;  2X48 A;  3M1C A;  4S04 A;  2G7U A;  4BL0 B;  2P5K A;  2W85 A;  3CF2 A;  4CCN A;  3DBR B;  2WA0 A;  2EH3 A;  2PX9 A;  3HXL A;  4A3G J;  1XTA A;  1VQ5 I;  3NQO A;  4XQF A;  3LA7 A;  2HYG D;  2IA1 A;  2X4H A;  3JW4 A;  3CJR B;  4EJW A;  2R7R A;  2LKX A;  4RS8 A;  1G3W A;  2P6T A;  4XLP F;  2CW8 A;  1J9I A;  3PM1 A;  4FE4 A;  4IOA F;  3HGG A;  4LLL A;  1ITY A;  2DW4 A;  3RJP A;  5IPA A;  1NHA A;  2IS1 A;  3OIP A;  2LR8 A;  4RAZ A;  3WTX C;  1V5F A;  2PFB A;  1ETO A;  3W2V A;  4IHY A;  2PMZ A;  2VQH A;  5F0H A;  4YFX F;  2NOJ B;  3O6B B;  1BM9 A;  2Z99 A;  2YU9 J;  3RZO J;  3ZQ7 A;  5FKO A;  2X6X A;  3FK7 A;  3K70 C;  1HF0 A;  4UVB A;  1ZGW A;  5KAI C;  4RGS A;  3PQJ A;  2W1O A;  2RKH A;  3L7W A;  2XB0 X;  4U7D A;  2IGO A;  3KYD B;  2FOK A;  3OYB A;  4A3M J;  4R1H A;  1XGM A;  3A02 A;  3MZ8 A;  2JA5 J;  2FOW A;  3DKX A;  3ABL H;  1FY7 A;  3SDB A;  1RUN A;  4Q48 A;  1IXR C;  2ZC2 A;  3O8G A;  5L3G A;  4BHC A;  3LNQ A;  3LSR A;  5TRD A;  2R0Q C;  5IT3 A;  1X19 A;  2KZG A;  3KET A;  3M8E A;  1S72 I;  3CCL I;  3WGG A;  4LIV A;  4UVC A;  2BZT A;  5D5V B;  4HNT A;  2HZT A;  3HBL A;  2YSR A;  4G6T B;  4PSX A;  3OOP A;  1MGT A;  1ERD A;  1YX3 A;  1SAX A;  1W5S A;  2F4I A;  3OWT A;  4QPO A;  3PFY A;  2P7V B;  1PDN C;  2K9Q A;  1A31 A;  1NK2 P;  3DP7 A;  3R60 A;  4IF4 A;  3CLO A;  4MHG A;  3GF2 A;  3CP8 A;  3F21 A;  4JX5 A;  3L2U A;  2R7U A;  1IDY A;  4AU7 A;  2JWT A;  2KLO A;  2Y2Z A;  3OIQ A;  4F91 B;  3HOS A;  3I4N J;  5GPC A;  5E18 F;  1U9N A;  2Y31 A;  5DCM B;  2G0E A;  3WE3 A;  1BC8 C;  3BZC A;  3ZQC A;  1D0X A;  1IW7 F;  3H36 A;  1HC8 A;  3H9Q A;  2BBY A;  3SQN A;  3K4L A;  2OV7 A;  4RMN A;  2GXB A;  3FZV A;  3PFI A;  2O7O A;  3SDG A;  1JJ8 C;  2FU4 A;  1SAU A;  3VSK A;  1R1T A;  1RNL A;  1LEA A;  1G6N A;  3TO7 A;  5IP6 A;  5J6X A;  1X4P A;  1JJ6 C;  2FQ4 A;  4BXU A;  1PVE A;  4XK4 A;  2KJC A;  2V9V A;  3OYF A;  1IC8 A;  3O3K A;  2M8E A;  4LMY A;  2MH9 A;  4DJA A;  1MBK A;  2FEZ A;  2VQG A;  3GZ5 A;  4GGG A;  2MSY A;  1SMT A;  2CSO A;  4L5J A;  4CZZ A;  2HOS A;  2FBI A;  3FMS A;  4MEY F;  3E7L A;  4L0Y B;  2PMH A;  3PUB A;  3EYY A;  1XPX A;  3Q0V A;  2DFE A;  3V7R A;  1XMX A;  1SD5 A;  5EGO B;  3TQN A;  4IHW A;  1FP1 D;  2FD5 A;  2HVQ A;  4ITV A;  3ZN0 A;  4D7M A;  3OYM A;  4MLO A;  4A69 C;  1EF4 A;  3WG9 A;  5HS7 A;  1WWX A;  4ZZD A;  2ZFW A;  4KA4 A;  5HDK A;  1A36 A;  2VT2 A;  3CUQ B;  2XB5 A;  4BQN A;  3S3O A;  4PK4 A;  4AIH A;  5B5E C;  1ZLK A;  4LLN A;  4WF2 A;  1W1W E;  1Q1V A;  2K4J A;  5J3L A;  1Y8R B;  3AG4 H;  2V1U A;  4V2F A;  4IHS A;  1DP3 A;  2K02 A;  3O8H A;  2DK8 A;  1VQ9 I;  2M45 A;  2IS6 A;  1WH7 A;  4A0Y A;  4GRI A;  2IAI A;  3F6V A;  2DT6 A;  2IA0 A;  2NS7 A;  1WJE A;  4KN7 X;  3Q3S A;  2R7O A;  4M6V A;  1I5Z A;  2J5O A;  4CYC B;  5K5Q A;  2R7F A;  1P7I A;  2F2E A;  3DQV C;  1UCR A;  1V54 H;  3KP4 A;  2B9S A;  2WV0 A;  4OIR F;  5FKL A;  1PYV A;  2L7Z A;  2YS9 A;  3MWM A;  4B43 A;  3HIF A;  4J00 A;  5HLT A;  3ELK A;  4XSZ F;  4AYB N;  3PIO F;  2L4A A;  1X3W B;  2L5Q A;  2X9D A;  3KCC A;  3OR2 C;  1MBE A;  4U7B A;  2M9H A;  1UAA A;  1ODD A;  1BI1 A;  2PQ8 A;  3RKW A;  1XX5 A;  3GW2 A;  4M6Y A;  2OF7 A;  4EJU A;  3OYA A;  5K7H A;  3BY6 A;  2RVC A;  2Z9O A;  1OYY A;  1DP7 P;  2D45 A;  3CMY A;  2A6H F;  3H5N A;  4F93 B;  1XD7 A;  5IT9 K;  4B3X A;  3WE2 A;  4NC8 A;  2LNB A;  3P9K A;  2RAE A;  3DKY A;  3PL8 A;  3T0Y A;  1IUF A;  2CV0 A;  1E3O C;  3LQQ A;  1O7L A;  1JTX A;  3FBN B;  1G8X A;  3HGY A;  4BQA A;  4I09 A;  3L2C A;  4A3D J;  4CSW A;  1HST A;  1Z1D A;  4GYI A;  2QQB A;  5LBQ A;  3K2Z A;  2DA5 A;  4OOI A;  4ON0 A;  1XSX A;  2QBY A;  1Z21 A;  3LMM A;  4IHX A;  2GQQ A;  4GFB A;  2DFH A;  3HRS A;  3GFL A;  2XKO A;  5HOO A;  1ZK8 A;  1TNS A;  3K2A A;  4BU2 A;  1TQP A;  2E7X A;  4UXN A;  1BOA A;  1RRJ A;  4YFN F;  1T98 A;  1QU3 A;  3AL0 B;  1Z67 A;  3HC7 A;  4I0A A;  1JGG A;  4XN3 A;  3F3X A;  2LD5 A;  2UXN A;  3BR0 A;  2MW8 A;  3A03 A;  2F6C A;  4RA2 A;  3MFK A;  4PFP A;  2DYR H;  2P81 A;  2K3P A;  4KNY A;  4OU0 A;  1H88 C;  4BUP A;  4FHT A;  2CU7 A;  3DFG A;  3A1Y A;  2EJR A;  2JA7 J;  4HQM A;  4DZJ A;  4E7I A;  1Z77 A;  5GAE J;  3ZMS A;  3GWZ A;  4E7J A;  4U0V A;  4QPQ A;  3VOE A;  1IN8 A;  2QF7 A;  4OIN F;  1F43 A;  3R0A A;  3JRB A;  5DD8 A;  3RPQ A;  1SFO J;  2DA6 A;  3A01 A;  3CUQ C;  4EAT A;  1TWC J;  3J7A Y;  4C2U A;  3U2R A;  1R00 A;  3HHH A;  1ETV A;  3KYC B;  4BKX A;  4X6A J;  1X1A A;  2LY9 A;  3BPV A;  1W0T A;  3CDI A;  4Y33 A;  4A0Z A;  3Q9S A;  4A5N A;  1YW7 A;  2COM A;  4EMS A;  2KIF A;  3W6J B;  2GM4 A;  3W6K B;  1EV7 A;  3S16 J;  1TWH J;  2HKX A;  1QRY A;  1E3H A;  5FLM J;  1Y39 A;  2DN0 A;  4M3D A;  5FKN A;  3BG7 A;  2VC0 A;  5EG0 B;  2DXI A;  1S7E A;  2ELH A;  2W25 A;  4EM0 B;  3QAH A;  3TP0 A;  1OCR H;  1LPQ A;  2HWV A;  4HG2 A;  3I4M J;  3K4M A;  4HNU A;  1U5T B;  5HLH A;  1PUF B;  2DQL A;  4DOZ A;  1JUS A;  2MLK A;  1IXC A;  4KMF A;  2NVT J;  3ABM H;  4FCY A;  2ETH A;  3LSH A;  1FBQ A;  3JSP A;  4BE0 A;  1HXD A;  2DDB A;  2LH9 A;  4BJ6 C;  4BGD A;  4B3A A;  3HZJ A;  3P7N A;  1FC3 A;  3TED A;  2DOA A;  2JSC A;  5F08 A;  4I7H A;  3PSF A;  3QP6 A;  3ONQ A;  4C30 A;  4RAY A;  3B6A A;  3LST A;  2ICW G;  2V4J C;  3TW7 A;  1SFE A;  4HDV A;  3BZ6 A;  1T38 A;  3VYT B;  4NUB A;  3GUD A;  5HOD A;  3IKT A;  4A2U A;  1IN6 A;  3WU1 B;  3CC4 I;  1H9T A;  1JKO C;  3QYB A;  4CCK A;  4NQW B;  3KFW X;  4DYR A;  4BY1 J;  4BEH B;  1CGP A;  3L2V A;  2OUM A;  1XC5 A;  2E5N A;  4RLF A;  2ECB A;  3OYL A;  2QA4 I;  4ETS A;  1W7P B;  2ZXW H;  3E0J B;  1Y0U A;  1X3U A;  4D7N A;  1Z7L A;  2GOM A;  3OL3 A;  2M30 A;  4CIC A;  3OYH A;  1UZC A;  1ZHF A;  2H09 A;  4M3B A;  4S05 A;  3GTK J;  4EJO A;  2KRH A;  3JRC A;  3NWT A;  4D9J A;  2V26 A;  1QVT A;  2DMQ A;  5LFA A;  5D5W B;  3RZD J;  4RB3 C;  3BR1 A;  3CD6 I;  2XF5 A;  1H8A C;  2E1M B;  4BXX J;  2ZXI A;  4UUV A;  4PGG A;  3E6M A;  2L7F P;  1O57 A;  4BY7 J;  3TP3 A;  1HCR A;  2OTJ I;  1WJF A;  4MFD A;  3CME I;  3CTA A;  5J4V A;  2V7F A;  3TO6 A;  5F27 A;  1LKX A;  4ZYA A;  4ENJ A;  2UV1 A;  1OCO H;  4KIT B;  2AXT C;  3CDH A;  2HZD A;  3IL2 A;  3DLL F;  2OQR A;  5A2Q K;  2W7N A;  1J5Y A;  1R1U A;  1K78 A;  4XRF A;  4O3M A;  3ZQF A;  3WTU C;  1P4A A;  4ASN A;  3D1N I;  2IA2 A;  2JPC A;  5F0C A;  2XUB A;  2Z16 A;  4XON A;  3LQR A;  3MCZ A;  3HRT A;  2M3A A;  1MJA A;  2V9P A;  1WHU A;  3FDY A;  4E7L A;  1IAW A;  1W7P D;  4L5E A;  1JI8 A;  2YPR A;  3AKZ A;  2HQA A;  5ILV A;  2ID6 A;  4RGX A;  4IL6 C;  3OL4 A;  3ZMZ A;  1N25 A;  4M6X A;  3RYR A;  2MYS A;  1ZR4 A;  3DF8 A;  2HOE A;  1OCC H;  1CQT A;  2HTJ A;  2EFQ A;  2M0M A;  3K0L A;  3M07 A;  3PUF A;  5FJ8 J;  3OYI A;  1HOM A;  4LG0 B;  2DBB A;  3BG6 A;  2ESH A;  4D5C A;  1F4K A;  5EEG A;  4I76 A;  3BTL A;  2STT A;  1BIA A;  2X0L A;  3HOX J;  2QSG X;  1U3E M;  4RBO A;  2KRF A;  2DDA A;  2QQ9 A;  3ZMV A;  5IT9 Z;  3CJQ B;  1FTZ A;  1IN5 A;  4ENN A;  3DTK A;  3F8C A;  3J81 Z;  4J19 A;  1TTY A;  3C2B A;  1XGS A;  1MMG A;  1KU3 A;  2QQ8 A;  1I3A A;  3TGN A;  2BOL A;  1KGS A;  1OPC A;  4AUX A;  2ZB9 A;  2FBH A;  2KDZ A;  1J0R A;  3FMR A;  4WCG A;  4QSH A;  3BQY A;  1W4M A;  3QOD A;  3KP3 A;  2WY8 Q;  3R4K A;  2GA2 A;  1KU7 A;  1RIO H;  2EFW A;  1MDM B;  2KP6 A;  4KDP A;  4D5F A;  2EFO A;  3DEW A;  1WJA A;  3TDZ C;  2JVG A;  1YE9 A;  3EUH C;  2GXG A;  3TDU C;  3CCV I;  3IRR A;  3MKW B;  3R61 A;  3IRQ A;  4NB5 A;  5EEH A;  4KUM A;  1MW7 A;  2XPW A;  1DGR M;  1D0Z A;  2ESN A;  4ZYE A;  2FML A;  4CCO A;  3EYI A;  1O3S A;  3BTI A;  4JYK A;  1LFU P;  3ZQG A;  1HDD C;  4N9H A;  4K2E A;  4OMZ A;  1XCB A;  2A5Y B;  3F72 A;  2VI6 A;  1WFX A;  5J1Y A;  2IS4 A;  2XSD C;  3AG1 H;  1VQ6 I;  1D8K A;  4L9V A;  1POG A;  2VAS A;  5FGM A;  3LSP A;  3DPU A;  3G1O A;  1RR7 A;  1U0J A;  1ONV A;  3BG5 A;  5ILU A;  5DM6 F;  1LDJ A;  2XKP A;  2L7K A;  2HPI A;  2HEO A;  4U0Y A;  4PSW A;  3GYH X;  3FXQ A;  4BBR J;  2LTP A;  1UMQ A;  4KFC A;  3VYS B;  2Y69 H;  2LRE A;  2M2E A;  2E2I J;  1ORK A;  2FA5 A;  3DU5 A;  4XKW A;  1D5Y A;  2E2J J;  1Y56 A;  2VLA A;  2M8G X;  1I1G A;  3F9K A;  3JTG A;  3BOQ A;  4L5I A;  4PGH A;  2LY2 A;  1JKP C;  2LK2 A;  3WGH A;  3ABT A;  2ZBK A;  2NRA C;  1HW5 A;  4EM2 A;  1XGO A;  3LAJ A;  3OIO A;  2DT7 B;  4BNC A;  4BE1 A;  2DPD A;  1KQ8 A;  3ZCO A;  5ICG A;  2XF6 A;  2OPT A;  2X6W A;  1G3T A;  2IP2 A;  2YR2 A;  5K5O A;  4A3E J;  1FBS A;  1R5I D;  1G3S A;  1MMN A;  4XM3 A;  4N0B A;  4YIR X;  1Z9C A;  3G73 A;  1FJL A;  2XHK A;  2FSW A;  1ZRE A;  3DEE A;  3CCE I;  1J09 A;  3I9V 2;  4A5M A;  4UUS A;  3ESW B;  4G7O F;  3RCO A;  2GIZ A;  2IBD A;  4X1E A;  5JHF A;  3OYC A;  5F1R A;  3K70 D;  3BCA A;  1ZRD A;  4G8X A;  1APL C;  4Y15 A;  1XS9 A;  3QPS A;  4NDL A;  3GTG J;  1IUY A;  4KIG A;  3IH4 A;  3NRV A;  3QU3 A;  1B6A A;  2HYJ A;  4LJZ F;  1OFC X;  2E5Z A;  3GTJ J;  1MND A;  2LOO A;  2CGP A;  2FX0 A;  1SMY F;  3TW6 A;  1BOB A;  2HQ5 A;  3GTP J;  1OCZ H;  2OZU A;  3FKI J;  4ESB A;  3LSJ A;  3I58 A;  3COA C;  4ZDO A;  3GTL J;  1O3R A;  2K4B A;  4C2T A;  3S3M A;  1FOW A;  2R7W A;  5CVU A;  1VTN C;  3ZOB A;  5KAF C;  1AKH B;  5JVT A;  1OYW A;  5F0F A;  5LRR A;  4ESF A;  2HOA A;  2FQ3 A;  1W0U A;  1FOX A;  2E71 A;  4BQQ A;  2I10 A;  2Y48 A;  1D1A A;  2LKP A;  3H3U A;  1B72 A;  3V8K A;  4F92 B;  1KQ0 A;  1PJR A;  3GCM A;  2A05 A;  3W2A A;  2GAU A;  4PJ0 C;  4RAF A;  1HW1 A;  4MQ9 F;  1OR7 A;  4LFU A;  4IHV A;  1SVL A;  2CQQ A;  2VKV A;  1GXQ A;  4F55 A;  4H0E A;  4HPQ A;  3VFZ A;  5A2Q Z;  5E8G A;  3IAS 2;  4FT8 A;  2M7B A;  1SAN A;  3EUK L;  3OMY A;  4E4H A;  3MZH A;  1EH8 A;  1SD6 A;  3WTT C;  1RR8 C;  5CJ9 A;  2ZNZ A;  4F7Z A;  1I6H J;  5DDG A;  5CVI A;  5DEQ A;  3L1P A;  3ASO H;  4YRV A;  4EJT A;  2BE5 F;  3IV5 A;  1YIJ I;  1F1Z A;  2PJR A;  1P7J A;  3JRH A;  2VE8 A;  2F5D A;  1J7K A;  1YW9 A;  3MMY B;  2Q2E B;  1BW5 A;  1WJD A;  4CZC A;  1Z6R A;  2CWE A;  1XDU A;  1O7F A;  2ECC A;  2V9K A;  3RPU D;  2M34 A;  1AWC A;  1R4N B;  2WAQ A;  4P9F A;  5CKT A;  2DT5 A;  3EQL F;  5TJJ A;  1D8J A;  1U78 A;  4XRS G;  3ABU A;  1JTY A;  1P92 A;  2HDD A;  2Z5U A;  3ZMT A;  3KE2 A;  1M1E B;  1BIB A;  2E60 A;  2K5C A;  4XLE A;  2ZJP F;  2XIG A;  3RTR A;  1Z7U A;  3IKV A;  2X6Y A;  1IRF A;  4XLH A;  5CQG A;  3VYU B;  1Z3X A;  2VBZ A;  1YG2 A;  2R5Z B;  5C4X J;  3PO3 J;  3WTV C;  3CCQ I;  1ENH A;  2L54 A;  5D6E A;  2IVM A;  2VBW A;  2NXN B;  2KT0 A;  3P5J A;  1PP7 U;  1ACI A;  3K69 A;  3KP6 A;  3HUG A;  4B47 A;  2RQQ A;  5FRN A;  2ZME A;  2KPM A;  2DOF A;  2I8D A;  3CCU I;  2LG4 A;  1QQI A;  2GXA A;  1DPR A;  1BA5 A;  1OQY A;  4DNC A;  3GZN B;  4PCQ A;  2Y75 A;  2H27 A;  1YOV B;  2ZCW A;  1KU2 A;  3BJ6 A;  2IRF G;  1VND A;  4WWC A;  4IVN A;  1MJ9 A;  3HDD A;  3I56 I;  4C3I J;  3HTS B;  5J40 A;  2ZXH A;  1QNT A;  2HR3 A;  2MBF A;  2VOP A;  2QCO A;  4M3G A;  3GTQ J;  3C1D A;  1YRN B;  1H9G A;  1LDD A;  3FX3 A;  5GAD J;  1CF7 A;  3LA2 A;  4A3J J;  4CDG A;  2FJ1 A;  4G6Q A;  5M5Y J;  2E19 A;  1SFK A;  1STZ A;  2DA1 A;  4JX4 A;  2LFB A;  4HST A;  1MBG A;  2QVO A;  2NVQ J;  1SD7 A;  2OBP A;  3FIS A;  1HKS A;  1QPM A;  4AWX B;  1DPU A;  4DBQ A;  1B8I A;  2M0C A;  4UUT A;  1USS A;  3CC2 I;  1Y8Q B;  4DYC A;  1VQP I;  2FXA A;  2LYC A;  2RNG A;  2UUZ A;  2V79 A;  2BEO A;  2VBY A;  3KPH A;  3LFK A;  5HVQ C;  4LK0 F;  1VFC A;  1D1C A;  3CO7 C;  4WXH A;  4L9J A;  3BTJ A;  1YW8 A;  2L9R A;  1B9N A;  4PJJ A;  1I50 J;  2LF8 A;  3BPX A;  2IT0 A;  2VPL A;  2FRH A;  1LFP A;  3RKY A;  3B6C A;  1X1C A;  3J7Z I;  4HX4 A;  4IEJ A;  3KEO A;  3HJE A;  3CC7 I;  1YLF A;  5D4R A;  2KMU A;  4G7Z F;  3HM5 A;  2OD5 A;  1U9O A;  3I59 A;  5KCM A;  1NTC A;  4NHJ A;  4OIO F;  1ZEL A;  1WRJ A;  3ZR8 X;  4Z6Y A;  2EZL A;  3DEU A;  3JRI A;  3GME A;  3I71 A;  5ILS A;  2CQK A;  2KL4 A;  3K1M A;  2EA2 A;  1TQM A;  2CUJ A;  4E7Z A;  5F64 A;  2H8W A;  1B1B A;  2VN2 A;  5D5X B;  2M1B A;  4YG2 F;  3FWE A;  2HVS A;  1WGX A;  4FTH A;  1MSF C;  4XKC A;  5L3B A;  3E5Q A;  3CMM A;  4BHP A;  2HPM A;  1X1D A;  2DJI A;  2VQL A;  4F52 A;  5DTD A;  1K78 B;  1TT5 B;  3JR9 A;  1B59 A;  4G6D A;  4CCJ A;  4P9U A;  3MKZ A;  4B09 A;  1ZGJ A;  3HOW J;  2BHY A;  2ZNY A;  1DUX C;  4XRM A;  1OMI A;  2A68 F;  1MMS A;  5H6Q A;  4IO9 F;  3ZQL A;  1DU6 A;  3I5U A;  2CFO A;  3KYL A;  5FKM A;  4CGZ A;  3LAP A;  3G6E I;  3DKW A;  3H9J A;  2WB1 A;  2QKM B;  1EA3 A;  3WU0 A;  5ICF A;  2D5V A;  2C6Y A;  4MQV A;  4G9Y A;  1FPQ A;  1ZGA A;  3HRU A;  4LGW A;  3FF5 A;  1VQ7 I;  3FMQ A;  4LIU A;  2PN6 A;  1BI3 A;  3H3Z A;  3FM5 A;  1O3Q A;  5KK1 A;  2ZO4 A;  3CO6 C;  2VQC A;  2JJ7 A;  4A3F J;  2BW3 A;  3F8F A;  2DA2 A;  3J7Y J;  1V3F A;  1OYI A;  2BXY A;  4GDF A;  5AIQ A;  2PBI A;  3G1L A;  1WI9 A;  2EV0 A;  2QYO A;  2X51 A;  1IJW C;  1E3P A;  1PP8 F;  5KHD A;  4QTR A;  2XC7 A;  1ZRF A;  4IHT A;  2BHZ A;  2GBY A;  4A3C J;  2KIS A;  5IYB J;  1GUU A;  2JVH A;  3IH2 A;  5CVV A;  1BJA A;  1X4O A;  5CVR A;  1QZY A;  1YJ9 I;  5FRO A;  3Q9V A;  3V7S A;  1IV8 A;  2EWN A;  2DI3 A;  3NEU A;  1L3L A;  1AOY A;  5JLX A;  3L00 A;  1UFM A;  4QLC U;  4FAS D;  3OR1 C;  1ETX A;  4ZYD A;  4HF1 A;  2XAF A;  3F23 A;  3OOU A;  2ZKZ A;  3KZI C;  1R9T J;  5FLV A;  1QPI A;  2LSO A;  4BXF A;  4RB1 A;  4BAY A;  1R4M B;  2NYX A;  2LBF B;  5C44 J;  2Y0S N;  1GV5 A;  2V1N A;  4BHB A;  1WZ2 A;  3G3Z A;  3WTS C;  2XAG A;  2R7Z J;  5HNH A;  4ZC3 A;  1FIA A;  3M4O J;  2QKL B;  5E1W A;  2WAE A;  2W24 A;  4UV8 A;  3BG3 A;  2O3F A;  3SZT A;  4I6Z A;  5H20 A;  3OS1 A;  5DD4 A;  2XRL A;  3LOC A;  2LY1 A;  3ROU A;  2DFF A;  2GZW A;  2E34 A;  4JBA A;  2IEK A;  2W48 A;  1JKR C;  4B48 A;  4AIK A;  3ERM A;  3K10 A;  2L3D A;  4IXA A;  5LD2 C;  3Q0U A;  1P9Q C;  4TV7 A;  3C3W A;  3RKX A;  1VF9 A;  1FSH A;  2BGC A;  3CES A;  2PG4 A;  2PMZ N;  3UNG C;  3TOA A;  2JQ7 A;  1F36 A;  3ISP A;  3D5L A;  4CHU A;  1TQI A;  4C9Y A;  4ZYG A;  1MBJ A;  2KIQ A;  2Q8K A;  2R7T A;  4I2O A;  3WU2 C;  4HAM A;  2XPV A;  4F3Q A;  3L2R A;  4FE7 A;  4XRS A;  2A07 F;  1LDK B;  2DYS H;  4Y4R A;  1WPK A;  3BP8 A;  5CPR B;  4A3B J;  1AU7 A;  1VQN I;  3D5S C;  4YEL A;  5BPI A;  1YFH A;  1SC7 A;  1FMW A;  2TCT A;  3IAM 2;  1EKE A;  3E97 A;  1XN7 A;  2UXX A;  4NC6 A;  3H5R A;  2WTE A;  2QUF A;  5B1A H;  4BDZ A;  1D0Y A;  2BXZ A;  5IY5 H;  3GLX A;  4ANJ A;  3X2Q H;  3QYE A;  5DYM A;  1R1V A;  2JZY A;  5EGO A;  4UUS B;  3TOB A;  1QZE A;  4HYE A;  2EBI A;  2DO7 A;  3HKZ A;  1HSJ A;  3GX4 X;  2XDV A;  2F5F A;  5DS9 A;  3BCB A;  3I54 A;  4U88 A;  3K4K A;  2XSJ C;  1MD0 A;  4M74 A;  4XKV A;  2CJJ A;  2WBM A;  5E3M A;  3T8R A;  3OYK A;  1FTT A;  2OU2 A;  2Z2S B;  4ZJZ A;  1PUE E;  4CYD A;  1HDP A;  3KEY A;  2A6E F;  2Y0M A;  2FE3 A;  3ASN H;  2Y9Z A;  3PJR A;  1KU9 A;  3MZY A;  4WK8 F;  3RQI A;  3S15 J;  3MKY B;  3MN2 A;  1U2W A;  3E6B A;  5D5U B;  1OCP A;  5F04 A;  3WHC A;  4Q4Z F;  3M1E A;  4PJM A;  4A3K J;  2L0K A;  1MH4 A;  4Z2Y A;  1ZH5 A;  4MTE A;  3TO9 A;  4PJN A;  2L9N A;  1K4S A;  2CUE A;  2DMT A;  3G71 I;  1LUJ B;  4IOC F;  2BY2 A;  3K9T A;  3OSF A;  3JAM K;  2VKH A;  4OAZ A;  4BE2 A;  3I0T A;  4CYC A;  2H6C A;  1FP2 A;  2L02 A;  1IN7 A;  3OYJ A;  2LKS A;  4P55 A;  4RM3 A;  1H89 C;  2NNY A;  3DPL C;  2JK3 A;  2HGC A;  3GXO A;  3QPL A;  2VKD A;  4C3H J;  1JKQ C;  1B72 B;  2KFD A;  1KYW A;  2F5C A;  1G2H A;  3FXL A;  5B66 C;  2VXZ A;  3CCS I;  1WVR A;  4A6E A;  2JA6 J;  1EH7 A;  4FX4 A;  1GT0 C;  4YFK F;  1I6X A;  1S8N A;  1T33 A;  5IOZ A;  1REP C;  4C3J J;  3GBG A;  4UB8 C;  1YHQ I;  4AC0 A;  3IC7 A;  3QQA A;  4YIF A;  3N97 A;  2VUM J;  2LP0 A;  3L9F A;  2CYY A;  3HL2 A;  1A35 A;  3ML6 A;  1YTY A;  3CP2 A;  4PZJ A;  5JVG F;  4FET A;  3W3C A;  5J47 A;  3K1N A;  4M3E A;  1UB9 A;  4UY8 I;  2NVU B;  5E3L A;  4FIS A;  4V2G A;  2WWY A;  3HPH A;  2HNH A;  4I01 A;  5EZH A;  2VON A;  4KJZ A;  2E1O A;  4M3F A;  2K9N A;  1D5V A;  3S3N A;  1BR1 A;  3S17 J;  4UV9 A;  5E3N A;  1T6S A;  3VYR B;  1Z0X A;  1HLV A;  2QSF X;  1YS6 A;  4OIP F;  3BZK A;  3D5R C;  5E17 F;  3K1P A;  2V6E A;  2DMN A;  1IG7 A;  3V7C A;  2DMP A;  5EJC A;  2RRE A;  2DMU A;  1W5T A;  2VIX A;  3LSK A;  4HLX A;  1N75 A;  1IRZ A;  3E6D A;  3S2H J;  4EV0 A;  1MNM C;  4HZF A;  3DBL B;  4IJA A;  1T0F C;  2F5E A;  3ZRG A;  1C0W A;  3K4N A;  3SZG A;  3S1M J;  2OTL I;  3EPZ A;  2L4M A;  2WC2 A;  2KDO A;  3E5U A;  3ZQQ A; 
#chains in the Genus database with same CATH homology
 1QHG A;  2IS6 A;  3DLA A;  4GRI A;  5FRM A;  4F55 A;  2DT6 A;  4HPQ A;  3VDX A;  1WJE A;  3IAS 2;  3RQ4 A;  3OYE A;  1GLN A;  2R7O A;  2M7B A;  1N78 A;  2HDW A;  3EUK L;  3OMY A;  4E4H A;  3PSI A;  4XOT A;  2CMP A;  2DCE A;  1K6Y A;  2P0W A;  4XLF A;  3DQV C;  4JOM A;  3OY9 A;  1DGW Y;  4YRV A;  1PYV A;  2VJ5 A;  4B43 A;  4J00 A;  2R7X A;  2JSP A;  2L9S A;  5HLT A;  2PJR A;  3IUO A;  4ZTF A;  2CV1 A;  2CV2 A;  2L5Q A;  3C2H A;  3OR2 C;  4U7B A;  3FHN A;  1UAA A;  2ZFU A;  2VJJ A;  3MD2 A;  2Q2E B;  3MMY B;  3OYG A;  3L2Q A;  2UWM A;  1WJD A;  3HG9 A;  3RPU D;  4CZC A;  2V9K A;  2WAQ A;  2M4K A;  5CKT A;  3OYA A;  3V42 A;  1OLT A;  4AYB A;  3OS0 A;  1T95 A;  2E60 A;  2K5C A;  4XLE A;  3H5N A;  4F93 B;  2M4G A;  2MAB A;  3H0D A;  2VXD A;  3RTR A;  3TMO A;  1X1B A;  4B3X A;  2X6Y A;  1YX5 A;  4NC8 A;  5CQG A;  4XLH A;  3VYU B;  1Z3X A;  3DKY A;  3PL8 A;  4Y3O A;  2CV0 A;  1G59 A;  3DU6 A;  3FBN B;  1G8X A;  2ZSI B;  1NG6 A;  2K9L A;  3E1S A;  1UG0 A;  4CSW A;  4B47 A;  2RQQ A;  5FRN A;  3AL0 C;  4IQJ A;  2KPM A;  2I8D A;  1Z21 A;  2R4G A;  3LMM A;  2LG4 A;  3KX2 A;  1OR7 C;  4CCM A;  3L2W A;  3CZ6 A;  1VZ0 A;  5HOO A;  4ZDL A;  4BAC A;  2IXS A;  2VJ4 A;  4BU2 A;  4D1Q A;  2R7V A;  4HEA 2;  2ZXH A;  1QU3 A;  3AL0 B;  3HC7 A;  3LFU A;  4ZDP A;  1MMD A;  4XN3 A;  3AFH A;  1E0E A;  2KHM A;  3BC8 A;  3K4J A;  2F6C A;  2A6T A;  4PFP A;  5HNF A;  4CA0 A;  4R79 A;  2K3P A;  4BJ5 C;  1SFK A;  4II3 A;  4BEH A;  4HST A;  4BUP A;  3LSI A;  2HU9 A;  3A1Y A;  3ZXS A;  1AA7 A;  3N05 A;  4E7I A;  4E7J A;  4B44 A;  3SYT A;  4QPQ A;  4H4K C;  4OWR B;  4XLA A;  3SEZ A;  4DBQ A;  2PJR B;  4EAT A;  3OYN A;  1LVK A;  3J7A Y;  3H5A A;  3FKJ A;  4XNF A;  2LYC A;  4XKB A;  4C2U A;  2RNG A;  3LSM A;  2CW7 A;  4RLQ A;  2UUZ A;  1WJB A;  2JUG A;  1D1B A;  1X1A A;  1WJC A;  3EUA A;  5HVQ C;  4Y33 A;  1D1C A;  2VB6 A;  4PJJ A;  3H9G A;  3LSG A;  2VPL A;  2X1E A;  1LFP A;  3BG7 A;  1X1C A;  2DXI A;  1QHH D;  2KMU A;  1KON A;  2VL8 A;  4HG2 A;  5KCM A;  2CH0 A;  3K4M A;  1ZEL A;  4HNU A;  3ZR8 X;  4DOZ A;  3HUG B;  4HSR A;  3LSH A;  4BE0 A;  2ELJ A;  1W36 D;  2KL4 A;  4PJL A;  2LH9 A;  4BJ6 C;  4BGD A;  2CUJ A;  4E7Z A;  5CQE A;  3HOT A;  2BW3 B;  2DOA A;  2KRC A;  4BDY A;  2W00 A;  3VWB A;  3S32 A;  3PSF A;  3ONQ A;  4C30 A;  2HVS A;  4XKC A;  2V4J C;  3CMM A;  3VYT B;  4NUB A;  1UEL B;  1X1D A;  2DJI A;  2JA2 A;  2KQR A;  2VQL A;  3S93 A;  2MC4 A;  4JQF A;  4F52 A;  4E7S A;  3DPT A;  2LBF A;  3S8P A;  4CCJ A;  3MKZ A;  3QYB A;  4CCK A;  3K6G A;  3VSL A;  1HA8 A;  2F5V A;  4NQW B;  2MD0 A;  4BEH B;  2XAU A;  4DBR A;  3L2V A;  2OUM A;  4XL9 A;  2E5N A;  4RLF A;  1WJ5 A;  2CFO A;  3OYL A;  3KYL A;  2E1M C;  1BR2 A;  2IGN A;  3E0J B;  2XF7 A;  1S9H A;  1Z7L A;  2GOM A;  3H9J A;  3HPG A;  4N4O B;  3PNT A;  2WB1 A;  3OL3 A;  3OYH A;  4IX7 A;  4RM2 A;  2QKM B;  1EA3 A;  1MNE A;  3FBI B;  2KRH A;  4PUS A;  3NWT A;  1NG7 A;  4D9J A;  1MMA A;  2V26 A;  5LFA A;  2Q1Z B;  4LIU A;  2BVL A;  2X85 A;  4PFO A;  2XF5 A;  4U87 A;  2E1M B;  2ZXI A;  2A5W A;  3M8J A;  2VQC A;  3K4C A;  4P5O A;  2BW3 A;  4LIT A;  1WJF A;  3QYF A;  4HRI A;  1W36 C;  2V7F A;  4J01 A;  1LKX A;  2K9M A;  4ZYA A;  4X0G A;  4IZZ A;  2UV1 A;  4KIT B;  3OS2 A;  2X51 A;  5KHD A;  2HZD A;  4XMY A;  2XC7 A;  2W7N A;  2X1D A;  3ZGK A;  3H35 A;  4KIS A;  2JVH A;  4XLC A;  2GOX B;  4XOP A;  1X4O A;  2IS2 A;  1IRX A;  5FRO A;  2Z16 A;  4XON A;  3SEQ A;  3U21 A;  4CUG A;  2IGK A;  2M3A A;  4E7H A;  3FDY A;  4E7L A;  4FAS D;  3OR1 C;  1JI8 A;  3TL4 X;  4BQO A;  3AKZ A;  2HQA A;  3LL7 A;  3DTE A;  3C2G A;  3OL4 A;  3OOU A;  2R7Q A;  2L2O A;  3NWS A;  4BXF A;  3QOE A;  3DWL E;  2MYS A;  1V5G A;  2AQE A;  2W4S A;  2LBF B;  3W2W A;  2V1N A;  2M0M A;  2WAF A;  4DGW B;  3OYI A;  2VJI A;  4NNJ A;  3BG6 A;  1FMV A;  1Y6I A;  5HNH A;  4ZC3 A;  1Z3Y A;  2QKL B;  2WAE A;  4OAY A;  3PNV A;  3G2B A;  2CS3 A;  2Y0S A;  3CJQ B;  3OS1 A;  3M1C A;  3DTK A;  4BL0 B;  2LY1 A;  2HPM A;  3CF2 A;  4CCN A;  2WA0 A;  3HXL A;  2AQF A;  4B48 A;  1MMG A;  4YEJ A;  3K10 A;  4XQF A;  4KT6 A;  2BOL A;  5LD2 C;  1P9Q C;  3CJR B;  2R7R A;  3QOD A;  4ZTJ A;  2WY8 Q;  2CW8 A;  3CES A;  5KNL A;  2WAD A;  3UNG C;  2KP6 A;  1DQU A;  1V5E A;  2IS1 A;  3D5L A;  3OIP A;  4BJT A;  1WJA A;  2JVG A;  4C9Y A;  3A4C A;  1YE9 A;  3EUH C;  1V5F A;  3W2V A;  3PNY A;  2R7T A;  4F3Q A;  3L2R A;  2PMZ A;  3MKW B;  1LDK B;  2VQH A;  1MW7 A;  2NOJ B;  1DGR M;  1D0Z A;  1BR4 A;  4CCO A;  4Y4R A;  4DIQ A;  4P1W A;  5CPR B;  2BVM A;  2X6X A;  2IGM A;  3D5S C;  4YEL A;  3K70 C;  1FMW A;  2W1O A;  3IAM 2;  2IGO A;  3H5R A;  4E6K G;  1WFX A;  2MFZ A;  2IS4 A;  3OYB A;  2FUG 2;  4BDZ A;  1D0Y A;  4ANJ A;  4LG3 A;  2VAS A;  3QYE A;  3DKX A;  3SDB A;  3DPU A;  3HKZ A;  1U0J A;  4E7K A;  2XDV A;  3BLY A;  3BCB A;  2L7K A;  2HPI A;  1X19 A;  2XSJ C;  3K4K A;  4PSW A;  4XKV A;  2X1C A;  2WBM A;  4LIV A;  3OYK A;  2Z2S B;  4ZJZ A;  3VYS B;  4HNT A;  3KEY A;  4PSX A;  4G6T B;  4CH7 A;  1TT0 A;  1R6R A;  2LRE A;  3PJR A;  1ERD A;  1YX3 A;  2F4I A;  3DU5 A;  4XKW A;  3OWT A;  4QPO A;  3PFY A;  1Y56 A;  3MKY B;  2VLA A;  4BS9 A;  4PJM A;  3F9K A;  2O5R A;  3CP8 A;  2LY2 A;  4AVZ A;  2W82 A;  3DTI A;  4PJN A;  2L9N A;  2HVR A;  3L2U A;  2R7U A;  2CUZ A;  4AU7 A;  2KLO A;  1TZL A;  2VKH A;  2DT7 B;  3OIQ A;  4OAZ A;  4BE2 A;  4F91 B;  3HOS A;  3K4B A;  3RSN A;  4BE1 A;  3ZCO A;  2XF6 A;  3OYJ A;  4CCL A;  2X6W A;  4RM3 A;  1D0X A;  3H9Q A;  3DPL C;  3K4L A;  4IKF A;  1MMN A;  2OV7 A;  2VKD A;  4RMN A;  4XM3 A;  2KZV A;  1SAU A;  3VSK A;  2VXZ A;  2LRD A;  1X4P A;  2Z1D A;  3DEE A;  4NC7 A;  1J09 A;  3I9V 2;  3RCO A;  5JHF A;  3OYC A;  3OYF A;  3K70 D;  3GBG A;  2R7S A;  3BCA A;  2M7A A;  3HL2 A;  3CP2 A;  4XN0 A;  4FET A;  4DJA A;  3A2K A;  2VQG A;  3W3C A;  4XOR A;  3I3L A;  3HPH A;  2HNH A;  2E5Z A;  4KJZ A;  1MND A;  2LOO A;  3PUB A;  5TGT A;  3S3N A;  1BR1 A;  3VYR B;  4II2 A;  3UR3 C;  1BOB A;  4N4N B;  2HVQ A;  4ITV A;  3D5R C;  4ZDO A;  2V6E A;  4C2T A;  2ZSH B;  3OYM A;  3S3M A;  2R7W A;  4MLO A;  3IP4 B;  2RRE A;  1N77 A;  2LC2 A;  4XR6 A;  4IQ4 A;  2VIX A;  2WY7 Q;  2OC6 A;  3LSK A;  3OYD A;  1N75 A;  4BQQ A;  3TBI A;  4BQN A;  3S3O A;  1D1A A;  4PK4 A;  4F92 B;  1PJR A;  1DP3 A;  1T0F C;  3ZRG A;  3K4N A;  3SZG A;  3W2A A;  3EPZ A;  2KDO A;  3ZQQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...