1PYVA

Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
ASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase beta chain, mitochondrial precursor
publication title NMR solution structure of the mitochondrial F1beta presequence from Nicotiana plumbaginifolia
pubmed doi rcsb
source organism Nicotiana plumbaginifolia
molecule tags Hydrolase
total genus 8
structure length 53
sequence length 53
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11421 Synthase_beta ATP synthase F1 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1pyvA00
1PYVA
chains in the Genus database with same CATH superfamily
3V7RA 4NBQA 1NH3A 4HX4A 2L3DA 2Z33A 4BDYA 3DPLC 4ENJA 4AYBA 3IWZA 4Q5SF 1T2KA 1Z3XA 2BHYA 4V2FA 2EJRA 4IJAA 3L2QA 5EEHA 2MLGA 4Z6YA 3HOSA 3BCAA 1FY7A 2YX7A 3F23A 4BXFA 5HLHA 1ZGWA 1QBJA 4S04A 2Z3YA 1W0UA 3RZOJ 1G8XA 5D5XB 2FMYA 3KYLA 1MBJA 2R7VA 4XORA 3ABKH 2W48A 2VBXA 4B3XA 5JHUA 4RA2A 1QPMA 3JSOA 2LP0A 2IXSA 1LDDA 3EPZA 1GXQA 3E6DA 1B59A 1XX5A 5KVRA 2DA6A 4ETSA 1IG7A 1VQLI 2CUZA 3F8MA 2F5FA 2DBBA 3T0YA 2MW8A 2FUG2 4HNTA 4J00A 1I6XA 3B02A 2W84A 3RKYA 1LFBA 5ED4A 2L01A 2KKOA 2LOOA 3BZCA 4FTHA 3G73A 1TWGJ 3WHCA 5FD6A 3I53A 2LMDA 3KYCB 1XMKA 2HS5A 2AXLA 1SFEA 2XPUA 3IKVA 4HQEA 4HF2A 4C3IJ 3S3NA 2M4KA 4XRSA 2DAOA 1K6OA 1JXSA 1CGPA 2KJCA 3VSKA 2KLOA 1T0FA 5IP6A 1FTTA 1O57A 2A5YB 5DCMA 3VODA 5JVTA 3OL3A 5C44J 5JHFA 1B4AA 1OQYA 4PUSA 4OWRB 4DBRA 1JGSA 5F1RA 4QTRA 4JX6A 4U0VA 2ESHA 4XN3A 1U5TA 1OCTC 1QO0D 1U8BA 1IO2A 4BDZA 4I99C 2R5ZB 1TWCJ 1Z6TA 1YIJI 5DM6F 2DCEA 2PJPA 4CGZA 3I59B 5EF6A 3F8BA 1A6IA 3GFLA 3DPUA 3HB9A 2DLLA 2E2JJ 3S2WA 4H4KC 4L9JA 2X1DA 1YW8A 2A3SA 5E3LA 2UXNA 4A3MJ 5IYBJ 2Z5UA 2AHQA 2K85A 5E79C 4IQJA 4LB6B 3K70D 2WADA 4HDUA 3BCBA 5GAHJ 5FKLA 1WWXA 1KYZA 1KGSA 4XSXF 4HOBA 1OFCX 3WGGA 4ZYAA 4I0AA 2V9VA 1IN7A 1FX7A 3M1EA 3BG3A 3JAMZ 2XAHA 4N9IA 1YJNI 1I6HJ 1V3FA 2K27A 4QIWN 3DF8A 3ZMVA 3HIFA 3EUAA 2Y2ZA 4A12A 2IS1A 3BP8A 1TNTA 4JX5A 1BC8C 2M0CA 3M8EA 3MKLA 4I7HA 3G1LA 2QA4I 3CC4I 2Q2EA 2JK3A 1AU7A 3FZVA 2L4AA 2KISA 2F5DA 4A93J 1S8NA 2MC4A 1K4SA 1ZYRF 2LLKA 2Y0MA 3FXMA 3Q9VA 4UUSB 2QGUA 3M07A 3NWSA 3TEDA 4ZDPA 1J7KA 1KQ0A 3LA3A 3IAM2 1RETA 1XN7A 1FSHA 1RNLA 1IF1A 1USTA 3D1NI 2XKOA 3TGNA 2IGOA 4C3HJ 4N0BA 4XR6A 1QGPA 1WGXA 2QUFA 2HVRA 4BNCA 1Z05A 2IBDA 3M8JA 3C1DA 3SDBA 5LGUA 4YFNF 1YOVB 4F93B 4FE4A 3JRGA 5FLXK 1T6SA 2DTZA 5E20A 3CTAA 2DT6A 3D5RC 3DP7A 1BN5A 2ZJQF 4BXXJ 2R7SA 2UWMA 1XGSA 4IXAA 3GTJJ 2VT2A 2E71A 1UHMA 1LQ1A 2NS8A 1SFXA 2DA4A 4PFPA 3WTTC 1GDTA 5B66C 1GVJA 1R36A 2FSWA 2QKLB 3HUGB 4AIJA 4IHXA 1WJCA 5LGTA 1OJLA 2VT3A 4XK4A 4MEXF 1MD0A 2EFQA 1VQ6I 2VODA 1MNEA 1QZZA 4YEJA 2P6TA 2DFFA 2LDUA 4YELA 1OLTA 3CLQA 5C4JJ 2AXTC 2EWNA 4A6EA 4D5FA 1FWZA 3TKYA 1FZPB 4Y4RA 1ZR2A 3F8FA 5L3DA 1DPRA 4E4HA 1WJAA 3PUFA 1TZLA 3H1CA 1UB9A 2V9PA 2YX4A 2H8RA 1I5ZA 3K4BA 2DA1A 1DP7P 3PIPF 2LC2A 2RV8A 2XAFA 2K9QA 3QPTA 1SVLA 3N97A 3GW2A 4OIPF 3HXLA 3TW7A 4BU2A 2DYRH 1R1TA 3REOA 3ZP5A 2E7XA 2Y69H 3BOQA 4IL6C 2DJNA 3LWFA 2JWTA 3DEWA 1WPKA 2G9WA 1BI0A 4A6DA 3ABMH 3RJPA 1YIOA 5TGTA 3A02A 3PO2J 4PJMA 4ZJZA 4FASD 2ZJRF 3FHZA 4XMYA 4CSWA 1KU7A 3MZYA 3KPHA 6PAXA 2CW0F 4RB3C 3BTJA 2ZMEC 2LY9A 3ASOH 3JCUC 4HLXA 3ZRGA 4BH9A 4C2TA 3HHHA 4M9SA 5AONA 1FEXA 3K4JA 2K4BA 2D1VA 2M4GA 3FDYA 1PUFB 2HQ5A 3CO7C 2UUZA 2HDDA 2ZKZA 1U8RA 3JREA 1N75A 1T98A 4M3FA 2DOEA 2K02A 1DQUA 3DU5A 4I6ZA 1MBFA 4IRHA 5K5RA 5KHDA 2M3AA 1C0WA 1SVOA 3CUOA 1G3YA 2X6OA 3U2RA 2KP6A 4BY1J 2VQGA 2CQNA 4N9HA 2DDBA 3OYHA 4LG3A 1YTYA 4JBAA 1YS7A 1ZLKA 2QSFX 2W25A 2MG4A 4U7DA 3EUHA 2MH9A 3A4CA 4AU7A 3TBIA 3L2RA 3DXJF 2FNAA 5LEKA 2GM4A 1Y0UA 3P7NA 3FBNB 1J0RA 3R61A 3CCQI 1X4OA 3JRIA 2LRDA 1BI1A 3DQVC 4CUGA 2LY2A 4EM2A 2OV7A 2BBYA 4L5IA 2FQ3A 1XSDA 1VQ8I 4UXNA 3RPQA 5FB2A 2CG4A 4UUTA 3ZMUA 2TCTA 3RKXA 3FXQA 5HDKA 1EA3A 3BR2A 5DM7F 1MDMA 2Z99A 5E1ZB 1GLNA 1Y56A 4D0PA 2QBYB 3GLXA 3ROUA 1R9TJ 4MO7A 2CWEA 5K1YA 4RBOA 4KYWA 2GA1A 1YFHA 1IAWA 1BC7C 1YX5A 3UNGC 1VQ9I 3GTOJ 2LSOA 4UUSA 2PMZA 3G6EI 5IT3A 4Q4ZF 1OISA 2OZ6A 1OR7A 2OUMA 3ZMDA 2NVQJ 2VUMJ 4I02A 4JK1X 1TWHJ 3JRHA 2Y9YA 3VWBA 4LB5A 2Y48A 2E2IJ 1FOWA 1GUUA 3K6GA 3H9QA 2GZWA 3F9KA 2EIKH 3S1NJ 3Q0UA 5AIQA 4C3JJ 2L54A 3JRAA 4Y15A 3GO5A 3DEEA 3TO7A 3T1BA 3MN2A 4W97A 3WGIA 5K7FA 4E7SA 4II2A 2ZC2A 3P9IA 5ILUA 3BJAA 3NARA 3DV8A 2M9HA 4FETA 3MKYB 1LPQA 2R0QC 1ENHA 1BL0A 2VE8A 1FBSA 1BOAA 1TWAJ 5JFRA 3A2KA 1OYIA 1HOMA 3GFMA 4UB8C 4AWXB 2P6SA 2O9LA 4A3DJ 2VN2A 3QOPA 2Q0OA 3FXJA 1TP4A 4U87A 2ECBA 4I09A 4DQ2A 4EM0B 1LEBA 1F1ZA 3MD2A 1BJAA 2EFPA 2WBMA 2XGEA 1ETKA 3IWFA 4RGSA 4IOAF 2GAUA 3NEUA 4DGWB 2QSGX 1ERDA 1HF0A 2MD5A 3CZ6A 4E7KA 2CUEA 2X6WA 4MQVA 4KITB 4IO9F 1XTAA 1NK3P 1R22A 3HBLA 2IA2A 4L9NA 4BJ5C 2ZXWH 1RUNA 3X2QH 2IJLA 1FNNA 1B9MA 1G6NA 1SD4A 1O3QA 2OC6A 2QQ8A 3V8JA 4F92B 1R49A 4A0ZA 2EV5A 2GOXB 2FA5A 4EJWA 1ZREA 1FOKA 3AFHA 1BIBA 3PL8A 3IP4B 4QSHA 3QPHA 3DPTA 3OYNA 2FQ4A 2V6CA 2EV6A 4KMFA 2NVYJ 3EUKL 2VBYA 4ENMA 1Z9CA 2OTJI 1Z77A 4BAYA 1VQ4I 1Z21A 5E1XA 1IN8A 2HVQA 3KZZA 5KAIC 2VI6A 3K70C 3CCLI 5M5YJ 2YU9J 2W00A 3QWLA 2E34A 3OOUA 3RQIA 1JUPA 2K3PA 3R0AA 4PDKA 3C2GA 4M73A 1MBGA 2M45A 1A5JA 5LRSA 2LR8A 1JJ6C 2JQ7A 2K4JA 5HS7A 1GVDA 1MBHA 2V26A 2ZXIA 5D5VB 2HQAA 1CF7B 4KIGA 1A31A 1RRJA 3BTLA 1MSEC 1V54H 1S9HA 2CJJA 5J4YA 3EYIA 3ZQLA 2L4MA 3KETA 1IRXA 2QENA 3S15J 1WJDA 1D1AA 5HODA 1LUJB 3CCVI 1X1CA 2PN6A 1MBKA 3BTIA 3TDZC 3CESA 1PUFA 1MKMA 3S93A 2KZGA 2G7UA 1YW9A 1VQMI 1FBQA 2RGVA 3TDUC 2PQ8A 1ACIA 2R5YA 2RDPA 2Y9ZA 4KNYA 2ZFWA 2V6EA 4NDLA 1HQCA 2L7ZA 3HRMA 2A68F 4Y52J 3CUQA 3T8TA 4HF1A 4NUBA 4C2UA 1XG1A 4CCNA 2JA6J 3OY9A 4HEA2 4L9VA 4UY8I 2CSOA 2FOKA 4YFKF 1EH8A 5CQEA 1GT0C 3KP4A 2JUCA 1WKMA 2K5CA 3RI4A 4ESBA 3KP3A 5DUKA 1W0TA 4IHWA 2JA8J 4S05A 3S17J 3TMOA 3SHFA 1K83J 1V5FA 1X3WB 2E5ZA 2Y0SN 1FPQA 2ZB9A 2DN0A 3J81K 2KDZA 2BOLA 3BJ6A 4UB6C 3JRBA 4ZYDA 3H9GA 2IEKA 4H0EA 2D5VA 3FF5A 1FIAA 3J80Z 2VKDA 3K4KA 2V1DA 1YRNA 3I54A 2DPDA 2OAZA 2ME0A 2UZKA 2KQRA 5CLSA 4B43A 5ICGA 3HDDA 2B63J 5DCMB 1KYWA 3CCRI 2AS5F 5GAEJ 4PZJA 2B0LA 5HLGA 5FO5A 4B3AA 2P5KA 2Y0SA 3PQKA 4G9YA 2EFWA 4PCQA 5ERIA 4A3KJ 3BLYA 1WVRA 1V5GA 2LD5A 3FMQA 2LNBA 1XS9A 1LVAA 1U5TB 3IH3A 3S3MA 2O61A 2VOOA 3LA2A 4MTDA 2BVMA 2HOTA 1T39A 1V5EA 3AG2H 3LSKA 2L5QA 3AG4H 1XGOA 3ZMZA 5GTHC 3PM1A 1IV6A 1J09A 2M34A 2CV1A 2VPLA 1SMTA 1JKQC 3BZKA 3MVPA 4MEYF 5D8KB 1SAUA 4PFOA 1S7EA 1IC8A 3LA7A 5AIPA 2J5PA 3HM5A 4A3LJ 3BROA 2VL8A 2X1EA 4B8XA 5DTDA 4EJTA 2FBIA 3B6CA 4G8XA 4JQFA 4YG2F 3KIOA 4JX4A 2JMWA 2IP2A 2CUJA 2DI3A 5F0FA 3F21A 3HKZN 2XIGA 3O8HA 2YS9A 5DD4A 3KZIC 3ABTA 4HNUA 3DEUA 2DFIA 1I3AA 1BBYA 2HWVA 3AL0C 3H5AA 4PSWA 2RKHA 5B3SH 4UUVA 3W6JB 3FKIJ 1D1CA 3DLLF 3OYLA 4MFDA 3IL2A 2HOEA 3CF5F 3LFKA 1KZHA 3AAFA 1A6QA 3CC7I 4A5NA 5BMZA 4DOZA 3HKZA 3HTUA 1Z7UA 4HSTA 1F5TA 2UXXA 5FKOA 1JGGA 5L3BA 5E8IA 4QPQA 4BE0A 3G4SI 2E36A 4OU0A 2XPVA 4M72A 4D7NA 5KAFC 1UCRA 3E97A 3L2VA 3H92A 2HPIA 3F0CA 4O5VA 4G12A 5FKKA 3F22A 5IY5H 5F27A 5IPAA 2IVMA 2OBPA 1E3HA 4ABZA 3SEZA 1IZ1A 3ZQCA 2AO9A 2MYSA 3LAPA 4IRIA 3S1MJ 4HZFA 3E6MA 4RM2A 5HLIA 4AC0A 2STTA 3GWZA 1FP1D 5HNFA 1ZELA 2RQQA 1FT9A 4A3GJ 3AG3H 3BQYA 3N4MA 3VYUB 4WWCA 1CF7A 4IF4A 3RPUA 1BJZA 2CW7A 4BHPA 1JTYA 1JKOC 2JVHA 2DA7A 1EF4A 3OYFA 2R7FA 3OR1C 3MEXA 2O0YA 5CVVA 5J3LA 3P5JA 2VQLA 1R6RA 2VPRA 2VC0A 2E1NA 4BQOA 5A2QK 2ELJA 2XB5A 2BE5F 1W36D 2K7LA 2E7WA 4A3JJ 4CCLA 1YO5C 1T08B 2R7QA 2LF8A 4RGUA 3DU6A 2FRHA 4G6DA 2CQKA 1D5VA 1BM9A 2I10A 2HXOA 4ZYEA 1WI9A 4ZC3A 3HEFA 2NVXJ 2QLZA 4GRIA 4LIVA 5K5OA 1QA6A 4XKWA 1D0ZA 1K7AA 1SVMA 1XGMA 4ZTFA 3TOBA 4CXFA 5LGNA 1ON2A 4P96A 3KP2A 2MD0A 4Q48A 2VJ5A 1K78A 1BI2A 3FXOA 4BUPA 3H5NA 5LHHA 3QYBA 3BC8A 4P55A 4I76A 1MNMC 2VJIA 4L5EA 4OMYA 1S72I 5GPAA 1ZRDA 1IW7F 2DMPA 4LD5A 2IA1A 4E7IA 4UVCA 3QPLA 2ZNYA 4DYRA 3I3LA 5GPCA 1HW1A 2I8DA 3IRRA 2R7WA 2L9SA 3ZN0A 3OL4A 3RSNA 4XNFA 1KU9A 1ZTRA 3D5LA 2CYYA 4FX0A 2RREA 3SZGA 1FOXA 3HGGA 3E7LA 4M6VA 2ELKA 3HC7A 4D9JA 1YX3A 2X6XA 2EZKA 1JTXA 2ZXHA 3WTZA 3SFZA 1TBXA 5CVIA 5BQTA 3WTSC 2W57A 2XRNA 4L5JA 1F9NA 3BR3A 2VXZA 1U9NA 1VF9A 2KMUA 2HKOA 1OYWA 3FKJA 4UV8A 4YFXF 2VKEA 4G7ZF 5KNLA 1X4PA 2P7VB 1B9NA 1XMAA 3GTLJ 3KX2A 3F6OA 4YIFA 3HOTA 3OS2A 3IH4A 3SFIA 4GO1A 4EEFG 3HGYA 2MA3A 2VJ4A 1VQKI 2MH2A 3PSFA 1V55H 3KFWX 1J5YA 2BXZA 2IGKA 3J80K 1HSTA 5DCFA 2KRCA 4Y33A 1XD7A 4FX4A 3ZR8X 1ZN2A 2AQEA 2GLOA 5HDGA 3TP0A 2E1MB 1PJRA 1SD7A 4M3BA 4KMUX 1IGNA 3PSIA 2DMUA 2E60A 2HKXA 3LSRA 2R4GA 3L9FA 1H9GA 2O3FA 3B73A 2QWWA 3GZ5A 5KCMA 4HNVA 2V7FA 2DFEA 1TQIA 1AWCA 1WH5A 4GYIA 3QYEA 1LDKB 4BL0B 3KZYA 2KJBA 1MDMB 5IP9J 3CP2A 4P9UA 1DU0A 1P9QC 1ZGAA 2XGDA 4N4NB 1XSXA 4QPOA 1SC7A 5EJCA 2CH0A 2BZTA 4KIBA 2QVOA 4U7BA 2K9MA 2QQAA 1YYVA 2XROA 5F0HA 1CQTA 3KLNA 1NG6A 1RKWA 1T0FC 3E5UA 1Y1VJ 1RIOH 1YS6A 4U0WA 1RESA 4ESFA 1R00A 4CYCA 4A3EJ 3SZTA 3K9TA 3WHBA 2E5NA 1HKTA 2L7KA 1OMIA 1PDNC 1EH7A 1RPWA 2DA2A 4B1RA 3FM3A 5FD5A 1U5TC 3ISPA 3S2DJ 2KPMA 1LB2A 1B8IA 2NYXA 2VASA 2HTJA 5IYDJ 3HRTA 4A3IJ 3JRDA 2MC3A 4OINF 4XLPF 1HCRA 5H6QA 4BQAA 1RKTA 2VBWA 4B09A 4N4OB 3RZDJ 4RMNA 3W2VA 1JT6A 1R7JA 4JOMA 1F36A 1AOYA 3LAJA 3FIWA 4LLGF 3SQNA 4WX9A 2MABA 5GAGJ 4KICA 2MBFA 2JJ7A 2DOAA 1FBUA 2LREA 2D45A 3WU0A 3OYAA 1X19A 5E18F 3FXRA 1ETXA 3HRSA 1MH4A 2R7TA 3K1MA 1DGRM 1W1WE 2P5VA 3L00A 2VQCA 4HV6A 3HTSB 1VI0A 2ZNZA 1YITI 1ZKGA 3AG1H 3BY6A 1TC3C 2ZJPF 3PQJA 1JUSA 4RGXA 2JRTA 4M3EA 4DNCA 3U1DA 2R3SA 4D5CA 2FJ1A 2K3FA 2KFDA 2XAJA 1XDSA 1D8JA 3GZNB 3ZMTA 4FE7A 1TL8A 2ACJA 2IPQX 3NWTA 4QWQA 2CQQA 3FK7A 2JT1A 1MIJA 3TO9A 3GMEA 2RNJA 1YQAA 4FQGA 1BR1A 1WJBA 2HOSA 1V4RA 1XCBA 1B72A 2EZIA 1BW6A 5FKMA 1Y39A 2O6GE 2FBHA 2YSRA 3BZ6A 1YJWI 2PLYA 5IOYA 5L3EA 4E7JA 1JI8A 5K7HA 2B9SA 3LSTA 3QU3A 1E2XA 3Q3SA 2XVCA 3S16J 3A1YA 3J81Z 4IRGA 2Y30A 3GVAA 3HYIA 5F0CA 4EV0A 1QU3A 2LH9A 5LD2C 3PJRA 2XF7A 3M9AA 2NRAC 4WK8F 2JA7J 3H9JA 2D2WA 2NS7A 2GXBA 1J59A 3CF2A 1MMNA 4G6TB 2R5YB 1R1UA 1T8IA 3P9KA 4I01A 4X1EA 1ZGJA 3A01B 1PUEE 5DD8A 3WG7H 1L3LA 4GCVA 4U88A 5F64A 3I56I 2JA2A 3I4MJ 1QVUA 1EKEA 3O8GA 1OCCH 2WY7Q 2WAFA 3CMYA 3DTIA 1FMVA 4ENNA 2L0KA 1Z6RA 5FGMA 3CUQB 1YW7A 2LVSA 4HA8A 3Q0WA 3OYEA 1P2FA 2DTRA 3PNTA 3CD6I 5F1JA 1TLHB 1O3RA 4BACA 2HI3A 1W4MA 3IHUA 4GGGA 3C3WA 1TNSA 3SYTA 2M8GX 3DTEA 4CYDA 4C9YA 2PMZN 3H36A 4R8HA 2HXIA 2IW5A 1BR4A 3KP7A 1YJ9I 3JRFA 1HC8A 5D4RA 1XCVA 4F3QA 4MTEA 1VQOI 2GA2A 1QZEA 1Y8RB 4AUXA 4I98B 3K4MA 2XF6A 1E0EA 2F48A 5E1WA 4WF2A 1XDUA 1YRNB 1D3YA 1HKSA 4M6YA 1MMGA 1OKRA 3HOZJ 2GIVA 2XPWA 3DKXA 4MLOA 2STWA 2DFHA 4Y3OA 5M3MJ 4DZJA 4XRFA 2HFHA 4LOCA 2D1HA 4E70A 4L9TA 2PX9A 3DFGA 5ILVA 2BY1A 1MBEA 2R93J 1FIPA 3OMYA 1LE8B 2Y75A 1IN5A 2JZYA 1G59A 4Z2YA 3CDIA 3FXLA 1OCOH 2CMPA 2KIFA 2PJRB 1NG7A 3J7YJ 2VKVA 2VLAA 2R7DA 1T95A 3V8KA 1QVTA 2HNHA 2LYCA 3K7AJ 4NHJA 1B6AA 1JKPC 3G1MA 3HSEA 3VOEA 4A0YA 2HTSA 1J9IA 1R71A 1H8AC 1I50J 1R5GA 1KU2A 4JYKA 2HZDA 3K4NA 1K6YA 2QEXI 1HLVA 2A5WA 5DUIA 4BHCA 3SXYA 2FBKA 1G3SA 4BJTA 4LMYA 2EBIA 4RAFA 3TQNA 1UFMA 1UHWA 4AVPA 5JLWA 2EPFA 2ZJ2A 1Z1DA 4RAZA 2E19A 1HDDC 5L3GA 3DLAA 5L3FA 3SZPA 2HGCA 2NAZA 2X9DA 2H1LA 3EUHC 1D5YA 1DP3A 3OWTA 5J8FA 5J1YA 4YIIA 2Z2SB 2BHZA 3OS0A 1J75A 3PIOF 3ZXSA 2FXAA 4LK1F 4XKBA 2ME6A 2W24A 3HSFA 4EATA 2XC7A 1IUYA 2EFNA 2F4OB 5A2QZ 3RPUD 3HG9A 2HPMA 3HOWJ 2EA2A 4FHTA 2RQPA 3BR6A 2P5LC 3MFKA 3KEOA 2CO5A 2DDAA 1Z67A 1P4AA 4KA4A 3KCCA 1WJEA 3CCEI 2Z16A 4QLCU 2FD5A 5F08A 1IDYA 5J6XA 2R7RA 2HQNA 2X0LA 2R7XA 2DT5A 3FISA 4FT8A 1ZRFA 1HA8A 1Y0NA 4BE1A 5C4XJ 1T56A 2HYFA 2PI0A 1WRJA 4LIUA 2KDOA 1ZARA 1WFXA 1U2WA 2IT0A 2LKSA 4EJOA 1IRGA 3GTPJ 2TRTA 2F5CA 3JTHA 2CQXA 5CYVA 3QRFF 3QAHA 4BY7J 1O7LA 2VC1A 2DQRA 4I0BA 1SAXA 3LOCA 4IQ4A 4KN4X 3L09A 1OCRH 3OIPA 4S0HB 1O4XA 2Z9OA 4KISA 1FLIA 4YIRX 4HF0A 2M1BA 5HNHA 1P7JA 1YI2I 4ZZLA 2E2HJ 4MIMA 2OCEA 4M6XA 2KRHA 1SFKA 5F04A 2ZSIB 4OIOF 4LLLA 4HX7A 4OIQF 3E1SA 4BS9A 3KP6A 4BGDA 3ML6A 1D0YA 1ULYA 3DKWA 4ENKA 2HYJA 2K40A 2ZCWA 2PFBA 3A01A 4B48A 2CFOA 4JP0A 4OIRF 2M87A 4IVNA 5JR3A 3ULQB 2Q1ZB 9ANTA 4UV9A 3MAJA 4E7ZA 1PVEA 4M71A 1AHDP 1W7PA 3QOEA 1UG2A 1W5CC 4BYYA 3Q9SA 4ZH4F 1MW7A 3ZOBA 4RB2C 4WXCA 3HOVJ 3UKGA 2ID6A 3H5RA 2A69F 4P5OA 5FLVA 2KRFA 1JKRC 4XONA 1K78B 1BOBA 2WB1N 2LF7A 3OS1A 1ZR4A 4M74A 5H20A 1QRYA 1IN4A 2M2EA 2V1NA 1HDPA 3CJRB 2LBFA 1UG0A 3DKYA 3LSGA 1UELB 5E3OA 1EV7A 1KQ8A 3EDPA 2O5RA 4CH7A 1VQNI 3WODF 5M3FJ 4PJLA 2DT7B 2HQRA 4GDFA 1ONVA 3CCSI 2P7CB 3OSGA 1WZ2A 3ONQA 3WTWC 4BEHA 3T5XA 2OZUA 3DWLE 3GCMA 4XN0A 2DK8A 2H6BA 4CZZA 2K9LA 2WB1A 1OCZH 3L1PA 2NNNA 5B1BH 1UAAA 3BR5A 3OYDA 5B5EC 1LEAA 1R5ID 2ELHA 2JSPA 3GX4X 1U78A 1APLC 3I0TA 1LE8A 3L7WA 3LSJA 2EIJH 2V4JC 3J7AY 3CDLA 1W5SA 2WY8Q 4WXHA 1LVKA 3HL2A 5CVJA 5LLQA 2COMA 2PJRA 2E1CA 3L2CA 3CCJI 3F8CA 4RB0A 4DYCA 5D6FA 5ICCA 3CMAI 1I1SA 1BA5A 1OPCA 3QYFA 5J40A 5H2FC 1SD5A 1LDJA 1IUFA 2FMLA 3ECOA 3E6BA 4TV7A 1WJ5A 4EQQA 3E5XA 1MJBA 1ZAOA 1MMDA 2CU7A 2EA4A 4BQNA 3RQ4A 2DXIA 1S3JA 4ZTJA 3PFYA 4XOPA 3K69A 2EIMH 3BQZA 3WTXC 4RLQA 1G2HA 1N25A 4RGRA 4A5MA 3LQRA 3VEPA 3IUOA 1K61A 1MSFC 1FMWA 3CUQC 5F6FA 1HBXG 5CVUA 4BBSJ 3GBGA 2HEOA 1ZG5A 1A04A 2WC2A 3L2WA 1IXSB 2K9NA 2GXGA 4P9FA 4EMSA 2K86A 4LLNA 1WH7A 3I55I 1F4KA 4X6AJ 5EGOA 1S29A 2OQGA 1JHFA 4NB5A 4DZPA 1D8KA 3EYYA 3O6BB 2R7UA 4HBLA 3ZCOA 2Q8KA 1HW5A 2EZHA 3HHGA 2L02A 3HJEA 3LSIA 3OOPA 3QQAA 2HYGD 3H3UA 4RAGA 5E3NA 5K7ZA 3IV5A 1XC5A 3VYTB 4CCJA 4AVZA 2CW8A 3LL7A 2E35A 4A69C 4CYCB 3F6VA 5FRNA 4UVAA 3IC7A 5B1AH 3PO3J 1R23A 5E3MA 2GIZA 1OYYA 3CCMI 4EGZA 1S5LC 2VQHA 4RS8A 1D0XA 1TT5B 5L3CA 3WE3A 2CRGA 5J1RA 1B8IB 4PJNA 4RLFA 2RNGA 2RAEA 4HRIA 4OAZA 1IRZA 3LSMA 1S6LA 3H0GJ 1O3TA 4ANJA 2FX0A 4CCMA 2AQFA 3TP3A 2ISYA 2OCCH 2KZVA 2XDVA 2IGNA 5D5UB 4UNOA 1ZHFA 1Q1HA 4J19A 1VTNC 2ZMEB 3O2PE 5LHIA 3D5SC 4RB1A 2HOAA 1USSA 4FISA 5CPRB 3BT9A 2IGMA 5FFZA 2O8XA 2FOWA 2HZTA 3OIQA 4J01A 3GFIA 3FMSA 4EM1A 3ZMSA 3GYHX 2A6TA 4XKCA 3PFIA 3WU2C 3U21A 3MKWB 3T8RA 2YU3A 3MWMA 3A0HC 4CDGA 3BG7A 4ESJA 2X4HA 1YE9A 3KEYA 2WV0A 5EZHA 5D6EA 1VZ0A 1ETWA 2O8KA 2ICWG 3WTUC 4G94A 4OAYA 5TISC 1SANA 1E3PA 1E3OC 2KIQA 2OQRA 4R79A 4CHUA 2W85A 4NC6A 5EDNA 2VB6A 3CP8A 1B72B 2WTEA 2FE3A 2O7OA 1Z91A 2ZBKA 4XICA 1T38A 1IXCA 3OV8A 3F8NA 3GTKJ 4HV5A 1FYMA 1N77A 1MMAA 2KIUA 3OYBA 4L0YB 3BR1A 3RCOA 2YPRA 4D7MA 3G71I 3S1RJ 1WHUA 1YLFA 2BEOA 4KN7X 2A05A 4II3A 4IEJA 3QP6A 1R58A 4LGWA 3NQOA 1UJ8A 1S7AA 3LMMA 3CJTB 1U9OA 4HPQA 4AIHA 3V4GA 2BVLA 2A07F 1S7OA 2CUFA 1Z3YA 4KIFA 1Y8QB 3HPGA 4LG0A 2VONA 4MGRA 1NHAA 3V7SA 3OYJA 5LFAA 1G3WA 4BKXA 2R7ZJ 4XSZF 1BR2A 2M0MA 3K4CA 1X58A 3FXKA 3RYPA 5LBQA 3I71A 1FYLA 2IS6A 5IYCJ 4IKFA 3KLOA 5J4VA 4F52A 2QQ9A 4Y17A 2EINH 2CV2A 1XSVA 1AKHB 2OTLI 2UV1A 4PJJA 4M3DA 3R60A 2XUBA 2Y31A 3C18A 4XIDA 1QNTA 1LFUP 4A3BJ 5EG0A 2XHKA 3I58A 1U3EM 2DU9A 2L7FP 2XSJC 5DV5A 1WSUA 3ZQHA 2WAEA 1TQMA 3GXOA 1ZRCA 3RKWA 1JE8A 4HG2A 3GUDA 3CDHA 3RDIA 3ZQQA 1ORKA 1WI3A 2IA0A 2R92J 3G3ZA 4K2EA 2OA4A 5JI6A 1X1AA 2LG4A 3LSHA 5LHGA 1O3SA 2ETHA 4E6KG 3HOXJ 4IHYA 4XL9A 4DW6A 3RIRA 1Z0XA 2L2OA 1B1BA 3F72A 1LKXA 3L2UA 1LNWA 4AIDA 3BPXA 1SEUA 4A3CJ 2QZ8A 2G7HA 2BV6A 4W1UA 1TT0A 3K2ZA 3A0BC 4C2MJ 5BPIA 4ZYHA 4IHSA 3WE2A 5IT9K 1ZK8A 4NQWA 3S1QJ 3COAC 3KE2A 3WTVC 3A03A 2X6YA 3K10A 3ZQFA 1QPIA 4L18B 5M5WJ 2OJED 4A3FJ 4HQMA 4UVBA 3CC2I 2KHMA 4DJAA 2JVGA 2L9VA 3E6CC 3F3XA 3G1OA 3DBLB 2H27A 4ZDLA 2WA0A 1P92A 3IAS2 3VPRA 2NVUB 1H89C 3K4LA 5HS9A 4PSXA 5HOOA 2Z1DA 1HXDA 3FX3A 4KT6A 2XAGA 5ICFA 3U1KA 3ZGKA 3JSPA 2JRMA 3GZ6A 1X2NA 5J47A 3FMRA 2CV0A 2OPTA 3D0SA 4BJ6C 2W4SA 2ADUA 2ZMEA 1R4NB 2VJJA 3W3CA 2KT0A 1RI7A 1VFCA 1R1VA 4HDVA 1MJ9A 2G0EA 2DO7A 3OYCA 3OYGA 2QKMB 1Z7LA 3B6AA 1LJ9A 1RR7A 2HDWA 1ZG3A 2WV1A 2XF5A 1M1EB 2DMTA 3FK6A 1I39A 2QM3A 1BIAA 2PMUA 2DYSH 2V9KA 3GTMJ 2JUGA 1R4MB 2DJIA 4LITA 4UHTA 4Q47A 2W1OA 4F91B 4D1QA 3C2BA 1P4WA 1JUMA 2GWRA 2ZFUA 1HKQA 2FF4A 2BY3A 3GLLA 3HZJA 3VDXA 4XLFA 5M5XJ 1EJ9A 3V7CA 5HS8A 3CQZJ 2F4IA 3DTKA 4M3GA 5BNGA 5HLTA 1GXPA 1MH3A 4OMZA 3PUBA 1QZYA 3DBHB 4M9XA 3QPSA 3BTCA 3HSRA 1RZ4A 3H3ZA 5EZGA 3ZN1A 5FJ8J 3HPHA 2P4WA 4RM3A 4FCYA 1HSJA 3O3KA 1W7PD 4G6QA 4NNJA 4F7ZA 1MMSA 1JHHA 2MFZA 2F6CA 4KT5C 4BBRJ 4G7OF 2IS4A 1SFOJ 2KIMA 4KFCA 1PYVA 4E7LA 1XPXA 1MJAA 3S2HJ 1O7FA 1P6RA 1XGNA 2O03A 2V1UA 2VKHA 4XLHA 2ID3A 1D1BA 5LRRA 4DYQA 2JSCA 2ZO4A 4WCGA 1TW2A 5CJ9A 5D4SA 2YUSA 4IPAA 3TOAA 1KU3A 2FEZA 1W5TA 2RN7A 3OYIA 3S8PA 5BOXA 2EFOA 1P7IA 1XMXA 1K4TA 2TDXA 2VE9A 3U9GA 1JJ8C 1NTCA 4MHGA 3GTGJ 2GXAA 5BS6A 2X1CA 4LFUA 3P9CA 5CKTA 2QSHX 3N05A 2VOPA 1U0JA 3FHNA 4BQQA 3M1CA 2H1KA 1W7PB 3LQQA 3KP5A 3QODA 3JRCA 3OYMA 4YRVA 1G4DA 2R5ZA 2LTPA 4AM3A 5E17F 3RKQA 1DPUA 4XKVA 3FBIB 4CA0A 2NXNB 3JR9A 3SDGA 1AKHA 3I59A 2BXYA 3I64A 2HU9A 3EETA 2BY2A 5FRMA 3FM5A 2EZLA 2OF7A 4XLAA 4ITVA 3I9V2 4U0YA 2NOGA 1A36A 3WU1B 3TO6A 3LSPA 1PP8F 1E17A 2JPBA 3SEQA 2JA5J 4CZCA 2LBFB 3M3YJ 1ODDA 2R7OA 3ZQIA 3AL0B 2DW4A 1F43A 1X2MA 1VQPI 4PGGA 1VQ5I 2JPCA 1W36C 4ZDOA 1ETOA 4BEHB 3RYRA 2V79A 3NRVA 4RDUA 3IKTA 3MKZA 3CLOA 2LY1A 1TTYA 4L0ZB 5EYRA 4MNUA 3W6KB 2EK5A 1POGA 1EH6A 4PK4A 4HLYA 2ISZA 5FLMJ 2P0WA 1ZQ3P 2N8GA 5GTIC 1TWFJ 2EQRA 2F4MB 2E1OA 5D8LB 3GFJA 3EQLF 4CICA 3Q0VA 1HW2A 2XGCA 2BW3B 4M9ZA 3H0DA 3TL4X 3W2AA 2COBA 3R6SA 2KL4A 5ILSA 2DOFA 3CCYA 3M4OJ 4DBQA 4V2GA 2PBIA 4ASNA 5J8CA 3W6VA 2EB7A 2ESNA 1FOYA 2EILH 5FROA 4EVIA 2PEXA 1FYKA 3CMMA 1H88C 4B47A 2LK2A 2QCOA 3ABLH 5H6RA 3HRUA 4O6JA 1GV5A 2BY0A 4XOTA 1IN6A 3VYRB 3CJNA 3ERMA 4XLEA 2FNPA 1UHSA 5BPDA 5FKNA 4KJZA 2NNYA 1DDNA 4EJVA 4LJZF 1FJLA 3CCUI 3JAMK 3H3VK 3M8FA 1X1DA 4MFEA 1SMYF 3Q5FA 2L9RA 5CVRA 1A35A 1ON1A 3VB2A 2XV4S 1PP7U 4BHBA 1OCPA 3SJMA 2DA3A 2LFBA 3FXUA 3S32A 1U6GA 2E1MC 2F5VA 3MMYB 4HW0A 1H0MA 5IP7J 2M30A 2M7AA 5DYMA 4IHVA 5D5WB 2YR2A 1KA8A 3S3OA 4G7HF 5EGOB 5ICEA 1JT0A 1K79A 3E5QA 5E8GA 2LKPA 3V42A 3CJQB 1TW3A 1IRFA 2CFXA 4CO8A 1QHHD 3HUGA 2DQLA 3OIOA 3GTQJ 1J2XA 3M7GA 5DEQA 3CO6C 2DMQA 5DS9A 2M7BA 3C2HA 4PJ0C 4IX7A 1KONA 1SD6A 2ZSHB 3QP5A 4V19K 2EV0A 1OR7C 3H35A 3KEQA 5FFXA 5HDNA 2ECCA 1YHQI 2NVTJ 1T33A 2MLKA 4HYEA 4XLNF 1XB4A 4XQFA 3VYSB 3PNVA 2DK5A 4HX8A 2PG4A 2OD5A 4CCKA 2GQQA 1LFPA 1P4XA 4O3MA 3DBRB 2IRFG 2LKXA 3LFUA 1UMQA 1DU6A 3ASNH 4Y13A 2M5WA 4NC7A 4I2OA 3IRQA 3BG5A 4OOIA 3ERED 4E7HA 1GHCA 5KK1A 4BE2A 1STZA 3I4NJ 3J7AO 1MNDA 1X1BA 2WWYA 2P8TA 4B4CA 5JLXA 2C6YA 2EH3A 5LEJA 3TW6A 2WAQN 4XRSG 4XBFA 2QYOA 4XRMA 3C7JA 1X3ZB 3BJOA 1KQ9A 2JTVA 2MGQA 5EEGA 2A61A 1UZCA 3RTRA 3S14J 1NK2P 2H8WA 4KUMA 4F55A 4DIQA 4NC8A 3BR0A 3PNYA 5K5QA 3DCFA 2RC4A 2QQBA 1WCMJ 4GYGA 1I3QJ 1N78A 2WAQA 4KDPA 2CQ7A 1ETYA 3QU6A 4HSRA 3KYDB 2W82A 1IJWC 1ITYA 3GF2A 1ZG1A 3I5UA 3E3VA 4LK0F 2HDCA 1DGWY 3OYKA 5GADJ 2NOJB 3ESWB 4Y7NJ 3WG9A 1DUXC 5CQGA 3ELKA 2A6EF 5J1UA 1IXRC 2BGCA 1REPC 4AIKA 1IV8A 5IOZA 2PMHA 2DPUA 4CCOA 3JTGA 1ZLJA 1I27A 3BWGA 2BW3A 4IHTA 2XRLA 3K0LA 3ZQ7A 3R0JA 2H6CA 1SFUA 2QBYA 3K2AA 3MQ0A 4A0XA 4B44A 4A2UA 4ZYGA 4ON0A 4ZZDA 2XGXA 3ZPLA 4GFBA 1WJFA 1Q1VA 3K1PA 2NS0A 1FC3A 3VFZA 4LG0B 1QQIA 4EGYA 1VQ7I 3IH2A 3BPVA 2RVCA 1GV2A 1BI3A 4X0GA 4XM3A 3J7ZI 1TQPA 1RC9A 1AA7A 2IAIA 3OR2C 2GBYA 2DMNA 2H94A 4EJUA 1ETVA 4RAYA 4AD9A 3HOYJ 5IT9Z 2XB0X 2L7MP 2JN6A 3K1NA 2HVSA 2OU2A 3OSFA 1Y6IA 3ZQGA 2XKPA 1ETQA 1MZBA 2GOMA 2VBZA 4IZZA 2B7EA 3BG9A 1H9TA 5EG0B 3MZ8A 3I4PA 1RUOA 3V8LA 3BDDA 1R5HA 2V1XA 3GEZA 3W2WA 4HAMA 5GP9A 2XSDC 1QHGA 2XAQA 3NAUA 2F5EA 2K9SA 2L9NA 2X51A 1Y1WJ 1IDZA 3LNQA 2F2EA 1WQ2A 3WTYC 1VNDA 2ZXJA 4MQ9F 1FSEA 2X85A 5HVQC 5C3EJ 1MGTA 4BXUA 1I1GA 2W7NA 2J5OA 1RR8C 5TJJA 1X3UA 4XLCA 5DDGA 5FLXZ 3MCZA 2XAUA 2P81A 1G3TA 4NQWB 3E0JB 1ZH5A 1BW5A 2Q2EB 3MZHA 2M8EA 2MSYA 3ECHA 3G2BA 4R1HA 2DODA 5JVGF 3R4KA 2IS2A 3JW4A 2DA5A 1L0OC 2FU4A 3AKZA 4WXDA 3WGHA 4AYBN 4IOCF 1FTZA 3ABUA 1X1PA 2X48A 2VXDA 2I5UA 1YG2A 3CMEI 1FP2A 4PGHA 2H09A 2VIXA 3VSLA 2XASA 5TRDA 2CS3A 2BYVE 4GXOA 4P1WA 5EEAA 2CGPA 3HOUJ 2A6HF 3UR3C 2QF7A 4C30A 2HR3A 3FWEA 3BG6A
chains in the Genus database with same CATH topology
2X6YA 3K10A 3K4MA 2XF6A 1E0EA 2KHMA 4BDYA 3DPLC 2JVGA 4DJAA 4AYBA 4NUBA 4C2UA 4CCNA 3OY9A 1MMGA 4HEA2 3DKXA 4MLOA 1Z3XA 5CQEA 4Y3OA 3L2QA 4ZDLA 2K5CA 2WA0A 3IAS2 3BCAA 3HOSA 3K4LA 4BXFA 4PSXA 5HOOA 2Z1DA 3TMOA 1G8XA 4KT6A 1V5FA 3OMYA 2E5ZA 3ZGKA 2CV0A 2BOLA 3KYLA 2R7VA 4XORA 4BJ6C 2W4SA 3H9GA 1G59A 2CMPA 4B3XA 2VJJA 2PJRB 3W3CA 1NG7A 2VKDA 2IXSA 2VLAA 3K4KA 1T95A 3EPZA 2HNHA 2LYCA 2KQRA 4B43A 3OYCA 2CUZA 3OYGA 2QKMB 1Z7LA 2HDWA 2FUG2 2HZDA 2XF5A 3K4NA 1K6YA 2Y0SA 4HNTA 2A5WA 4J00A 3BLYA 1V5GA 4BJTA 2V9KA 2JUGA 2LOOA 2DJIA 3S3MA 4LITA 2W1OA 2BVMA 1V5EA 3LSKA 2L5QA 4F91B 4D1QA 3DLAA 2ZFUA 1J09A 2CV1A 3S3NA 2VPLA 2M4KA 3VDXA 3EUHC 4XLFA 1DP3A 1SAUA 3OWTA 4PFOA 2Z2SB 2F4IA 3VSKA 3OS0A 3DTKA 5HLTA 2KLOA 3ZXSA 3PUBA 4XKBA 3OL3A 2VL8A 2X1EA 5JHFA 3HPHA 4RM3A 4EATA 2XC7A 4PUSA 4OWRB 4DBRA 3RPUD 3HG9A 2HPMA 4JQFA 4NNJA 2IS4A 2MFZA 2F6CA 2CUJA 4XN3A 4BDZA 1PYVA 4E7LA 1WJEA 2VKHA 2Z16A 4XLHA 1D1BA 4HNUA 2DCEA 2R7RA 2R7XA 3AL0C 1HA8A 3H5AA 4PSWA 3DPUA 3OYIA 4BE1A 3S8PA 1D1CA 4LIUA 3OYLA 2KDOA 1WFXA 4H4KC 2X1DA 4DOZA 3HKZA 2X1CA 5CKTA 3N05A 4HSTA 1U0JA 4IQJA 3K70D 2WADA 3BCBA 4IQ4A 3FHNA 4BQQA 3M1CA 4QPQA 4BE0A 3QODA 3OIPA 3OYMA 4YRVA 4KISA 4ZYAA 5HNHA 4XKVA 3FBIB 4CA0A 3L2VA 2HPIA 2KRHA 1SFKA 2HU9A 2ZSIB 5FRMA 3E1SA 4XLAA 3EUAA 3SEZA 4BS9A 4ITVA 2MYSA 3I9V2 4BGDA 1D0YA 2IS1A 4RM2A 4F3QA 4B48A 2CFOA 3SEQA 4CZCA 2Q1ZB 2LBFB 5HNFA 1ZELA 2RQQA 4E7ZA 2R7OA 3VYUB 3AL0B 2CW7A 3QOEA 2JVHA 2MC4A 1W36C 3OYFA 4ZDOA 3OR1C 4BEHB 3MKZA 2LY1A 3NWSA 1MW7A 2VQLA 1R6RA 4PK4A 4ZDPA 3H5RA 4P5OA 2P0WA 4BQOA 2ELJA 4XONA 3IAM2 1W36D 1BOBA 3OS1A 2IGOA 4XR6A 2BW3B 4CCLA 3H0DA 2V1NA 2R7QA 3TL4X 3W2AA 3DU6A 2KL4A 2LBFA 3CJRB 1UG0A 3DKYA 3LSGA 2HVRA 1UELB 4DBQA 3M8JA 3SDBA 2O5RA 4CH7A 4F93B 4PJLA 4ZC3A 2DT7B 5FROA 4GRIA 4LIVA 3ONQA 4XKWA 1D0ZA 4BEHA 3DWLE 3CMMA 4XN0A 4B47A 2DT6A 4ZTFA 3D5RC 2R7SA 2UWMA 2K9LA 2WB1A 2MD0A 1UAAA 4XOTA 2VJ5A 4PFPA 3OYDA 4BUPA 2JSPA 3VYRB 4XLEA 3H5NA 3QYBA 3BC8A 4KJZA 2V4JC 3HUGB 2QKLB 1WJCA 3J7AY 2VJIA 2WY8Q 1LVKA 3HL2A 4E7IA 1X1DA 2PJRA 1MNEA 4YEJA 4YELA 1OLTA 3I3LA 3QYFA 3S32A 2I8DA 2E1MC 2F5VA 3MMYB 2R7WA 2L9SA 3OL4A 4Y4RA 4E4HA 2M7AA 1WJ5A 3RSNA 4XNFA 1WJAA 1TZLA 3S3OA 3D5LA 2RREA 3SZGA 1MMDA 3K4BA 4BQNA 3RQ4A 3HC7A 2DXIA 4ZTJA 2LC2A 3PFYA 4D9JA 3V42A 1YX3A 2X6XA 4XOPA 3CJQB 2ZXHA 1QHHD 4RLQA 3HXLA 4BU2A 3IUOA 1FMWA 2VXZA 2KMUA 3FKJA 3GBGA 2M7BA 3C2HA 5KNLA 1X4PA 4IX7A 3L2WA 1KONA 2ZSHB 3KX2A 5TGTA 3HOTA 3OS2A 4PJMA 1OR7C 4ZJZA 3H35A 4FASD 2VJ4A 4XMYA 3PSFA 4XQFA 3VYSB 3PNVA 4CSWA 2IGKA 4CCKA 2KRCA 4Y33A 2R7UA 1LFPA 3ZCOA 3ZRGA 3ZR8X 2AQEA 4C2TA 3LFUA 3LSIA 2E1MB 3K4JA 2M4GA 1PJRA 3FDYA 2UUZA 3PSIA 1N75A 2E60A 4NC7A 1DQUA 2R4GA 3VYTB 3DU5A 4CCJA 4AVZA 4E7HA 2CW8A 2M3AA 3LL7A 5KHDA 5KCMA 4BE2A 5FRNA 2V7FA 2KP6A 1MNDA 1LDKB 1X1BA 2VQGA 3QYEA 4BL0B 2VQHA 1D0XA 3CP2A 3OYHA 1P9QC 4LG3A 4PJNA 4RLFA 4N4NB 2RNGA 4QPOA 4HRIA 3A4CA 4AU7A 4OAZA 3TBIA 2CH0A 3L2RA 3LSMA 3FBNB 4ANJA 4U7BA 2K9MA 4CCMA 2AQFA 2KZVA 1X4OA 2XDVA 3RTRA 2LRDA 1NG6A 2IGNA 1T0FC 3DQVC 4CUGA 4F55A 2LY2A 2OV7A 4DIQA 4NC8A 2E5NA 3PNYA 2L7KA 1N78A 1EA3A 2WAQA 3D5SC 4HSRA 5CPRB 2IGMA 1GLNA 2W82A 1Y56A 2KPMA 3OIQA 2VASA 4J01A 2A6TA 4XKCA 1DGWY 3U21A 3OYKA 3MKWB 1YX5A 3UNGC 4N4OB 2NOJB 4RMNA 2PMZA 3BG7A 3W2VA 5CQGA 1YE9A 3KEYA 2OUMA 4JOMA 1VZ0A 2MABA 3VWBA 4CCOA 4OAYA 3K6GA 2DOAA 3H9QA 2LREA 3F9KA 3OYAA 1X19A 2BW3A 2R7TA 4R79A 3DEEA 1DGRM 4B44A 4E7SA 2VB6A 3CP8A 4II2A 2VQCA 3MKYB 4FETA 1WJFA 3A2KA 1N77A 1MMAA 4U87A 4XM3A 4X0GA 3OYBA 3MD2A 3RCOA 1AA7A 3OR2C 2WBMA 4DGWB 2HVSA 1ERDA 4II3A 3NWTA 3CZ6A 4E7KA 3LMMA 2X6WA 1Y6IA 4KITB 4HPQA 1BR1A 1WJBA 2GOMA 2BVLA 4IZZA 4BJ5C 1Z3YA 2OC6A 3HPGA 3W2WA 4F92B 2GOXB 4E7JA 3OYJA 1QHGA 5LFAA 1JI8A 3AFHA 1BR2A 2M0MA 3PL8A 3K4CA 2L9NA 2X51A 3IP4B 3DPTA 3OYNA 3A1YA 1QU3A 2LH9A 2IS6A 3EUKL 5LD2C 3PJRA 4IKFA 2XF7A 2X85A 4F52A 5HVQC 1Z21A 2CV2A 2UV1A 2HVQA 4PJJA 2W7NA 3H9JA 3K70C 2W00A 4XLCA 3OOUA 2XAUA 3CF2A 1MMNA 4G6TB 2XSJC 2K3PA 3C2GA 2WAEA 4NQWB 3E0JB 2JA2A 2ZXIA 2Q2EB 2V26A 2HQAA 4HG2A 2WY7Q 2WAFA 3ZQQA 3DTIA 1FMVA 3G2BA 1S9HA 1IRXA 1X1AA 2LG4A 1WJDA 1D1AA 3LSHA 1X1CA 3OYEA 2IS2A 4E6KG 4XL9A 3PNTA 3AKZA 2L2OA 3CESA 4BACA 1LKXA 3S93A 2VXDA 3L2UA 2VIXA 3SYTA 3VSLA 3DTEA 2CS3A 1TT0A 4C9YA 4P1WA 1BR4A 3UR3C 4C30A 2V6EA 3BG6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYV A; 
#chains in the Genus database with same CATH topology
 3V7R A;  4NBQ A;  1NH3 A;  4HX4 A;  2L3D A;  2Z33 A;  4BDY A;  3DPL C;  4ENJ A;  4AYB A;  3IWZ A;  4Q5S F;  1T2K A;  1Z3X A;  2BHY A;  4V2F A;  2EJR A;  4IJA A;  3L2Q A;  5EEH A;  2MLG A;  4Z6Y A;  3HOS A;  3BCA A;  1FY7 A;  2YX7 A;  3F23 A;  4BXF A;  5HLH A;  1ZGW A;  1QBJ A;  4S04 A;  2Z3Y A;  1W0U A;  3RZO J;  1G8X A;  5D5X B;  2FMY A;  3KYL A;  1MBJ A;  2R7V A;  4XOR A;  3ABK H;  2W48 A;  2VBX A;  4B3X A;  5JHU A;  4RA2 A;  1QPM A;  3JSO A;  2LP0 A;  2IXS A;  1LDD A;  3EPZ A;  1GXQ A;  3E6D A;  1B59 A;  1XX5 A;  5KVR A;  2DA6 A;  4ETS A;  1IG7 A;  1VQL I;  2CUZ A;  3F8M A;  2F5F A;  2DBB A;  3T0Y A;  2MW8 A;  2FUG 2;  4HNT A;  4J00 A;  1I6X A;  3B02 A;  2W84 A;  3RKY A;  1LFB A;  5ED4 A;  2L01 A;  2KKO A;  2LOO A;  3BZC A;  4FTH A;  3G73 A;  1TWG J;  3WHC A;  5FD6 A;  3I53 A;  2LMD A;  3KYC B;  1XMK A;  2HS5 A;  2AXL A;  1SFE A;  2XPU A;  3IKV A;  4HQE A;  4HF2 A;  4C3I J;  3S3N A;  2M4K A;  4XRS A;  2DAO A;  1K6O A;  1JXS A;  1CGP A;  2KJC A;  3VSK A;  2KLO A;  1T0F A;  5IP6 A;  1FTT A;  1O57 A;  2A5Y B;  5DCM A;  3VOD A;  5JVT A;  3OL3 A;  5C44 J;  5JHF A;  1B4A A;  1OQY A;  4PUS A;  4OWR B;  4DBR A;  1JGS A;  5F1R A;  4QTR A;  4JX6 A;  4U0V A;  2ESH A;  4XN3 A;  1U5T A;  1OCT C;  1QO0 D;  1U8B A;  1IO2 A;  4BDZ A;  4I99 C;  2R5Z B;  1TWC J;  1Z6T A;  1YIJ I;  5DM6 F;  2DCE A;  2PJP A;  4CGZ A;  3I59 B;  5EF6 A;  3F8B A;  1A6I A;  3GFL A;  3DPU A;  3HB9 A;  2DLL A;  2E2J J;  3S2W A;  4H4K C;  4L9J A;  2X1D A;  1YW8 A;  2A3S A;  5E3L A;  2UXN A;  4A3M J;  5IYB J;  2Z5U A;  2AHQ A;  2K85 A;  5E79 C;  4IQJ A;  4LB6 B;  3K70 D;  2WAD A;  4HDU A;  3BCB A;  5GAH J;  5FKL A;  1WWX A;  1KYZ A;  1KGS A;  4XSX F;  4HOB A;  1OFC X;  3WGG A;  4ZYA A;  4I0A A;  2V9V A;  1IN7 A;  1FX7 A;  3M1E A;  3BG3 A;  3JAM Z;  2XAH A;  4N9I A;  1YJN I;  1I6H J;  1V3F A;  2K27 A;  4QIW N;  3DF8 A;  3ZMV A;  3HIF A;  3EUA A;  2Y2Z A;  4A12 A;  2IS1 A;  3BP8 A;  1TNT A;  4JX5 A;  1BC8 C;  2M0C A;  3M8E A;  3MKL A;  4I7H A;  3G1L A;  2QA4 I;  3CC4 I;  2Q2E A;  2JK3 A;  1AU7 A;  3FZV A;  2L4A A;  2KIS A;  2F5D A;  4A93 J;  1S8N A;  2MC4 A;  1K4S A;  1ZYR F;  2LLK A;  2Y0M A;  3FXM A;  3Q9V A;  4UUS B;  2QGU A;  3M07 A;  3NWS A;  3TED A;  4ZDP A;  1J7K A;  1KQ0 A;  3LA3 A;  3IAM 2;  1RET A;  1XN7 A;  1FSH A;  1RNL A;  1IF1 A;  1UST A;  3D1N I;  2XKO A;  3TGN A;  2IGO A;  4C3H J;  4N0B A;  4XR6 A;  1QGP A;  1WGX A;  2QUF A;  2HVR A;  4BNC A;  1Z05 A;  2IBD A;  3M8J A;  3C1D A;  3SDB A;  5LGU A;  4YFN F;  1YOV B;  4F93 B;  4FE4 A;  3JRG A;  5FLX K;  1T6S A;  2DTZ A;  5E20 A;  3CTA A;  2DT6 A;  3D5R C;  3DP7 A;  1BN5 A;  2ZJQ F;  4BXX J;  2R7S A;  2UWM A;  1XGS A;  4IXA A;  3GTJ J;  2VT2 A;  2E71 A;  1UHM A;  1LQ1 A;  2NS8 A;  1SFX A;  2DA4 A;  4PFP A;  3WTT C;  1GDT A;  5B66 C;  1GVJ A;  1R36 A;  2FSW A;  2QKL B;  3HUG B;  4AIJ A;  4IHX A;  1WJC A;  5LGT A;  1OJL A;  2VT3 A;  4XK4 A;  4MEX F;  1MD0 A;  2EFQ A;  1VQ6 I;  2VOD A;  1MNE A;  1QZZ A;  4YEJ A;  2P6T A;  2DFF A;  2LDU A;  4YEL A;  1OLT A;  3CLQ A;  5C4J J;  2AXT C;  2EWN A;  4A6E A;  4D5F A;  1FWZ A;  3TKY A;  1FZP B;  4Y4R A;  1ZR2 A;  3F8F A;  5L3D A;  1DPR A;  4E4H A;  1WJA A;  3PUF A;  1TZL A;  3H1C A;  1UB9 A;  2V9P A;  2YX4 A;  2H8R A;  1I5Z A;  3K4B A;  2DA1 A;  1DP7 P;  3PIP F;  2LC2 A;  2RV8 A;  2XAF A;  2K9Q A;  3QPT A;  1SVL A;  3N97 A;  3GW2 A;  4OIP F;  3HXL A;  3TW7 A;  4BU2 A;  2DYR H;  1R1T A;  3REO A;  3ZP5 A;  2E7X A;  2Y69 H;  3BOQ A;  4IL6 C;  2DJN A;  3LWF A;  2JWT A;  3DEW A;  1WPK A;  2G9W A;  1BI0 A;  4A6D A;  3ABM H;  3RJP A;  1YIO A;  5TGT A;  3A02 A;  3PO2 J;  4PJM A;  4ZJZ A;  4FAS D;  2ZJR F;  3FHZ A;  4XMY A;  4CSW A;  1KU7 A;  3MZY A;  3KPH A;  6PAX A;  2CW0 F;  4RB3 C;  3BTJ A;  2ZME C;  2LY9 A;  3ASO H;  3JCU C;  4HLX A;  3ZRG A;  4BH9 A;  4C2T A;  3HHH A;  4M9S A;  5AON A;  1FEX A;  3K4J A;  2K4B A;  2D1V A;  2M4G A;  3FDY A;  1PUF B;  2HQ5 A;  3CO7 C;  2UUZ A;  2HDD A;  2ZKZ A;  1U8R A;  3JRE A;  1N75 A;  1T98 A;  4M3F A;  2DOE A;  2K02 A;  1DQU A;  3DU5 A;  4I6Z A;  1MBF A;  4IRH A;  5K5R A;  5KHD A;  2M3A A;  1C0W A;  1SVO A;  3CUO A;  1G3Y A;  2X6O A;  3U2R A;  2KP6 A;  4BY1 J;  2VQG A;  2CQN A;  4N9H A;  2DDB A;  3OYH A;  4LG3 A;  1YTY A;  4JBA A;  1YS7 A;  1ZLK A;  2QSF X;  2W25 A;  2MG4 A;  4U7D A;  3EUH A;  2MH9 A;  3A4C A;  4AU7 A;  3TBI A;  3L2R A;  3DXJ F;  2FNA A;  5LEK A;  2GM4 A;  1Y0U A;  3P7N A;  3FBN B;  1J0R A;  3R61 A;  3CCQ I;  1X4O A;  3JRI A;  2LRD A;  1BI1 A;  3DQV C;  4CUG A;  2LY2 A;  4EM2 A;  2OV7 A;  2BBY A;  4L5I A;  2FQ3 A;  1XSD A;  1VQ8 I;  4UXN A;  3RPQ A;  5FB2 A;  2CG4 A;  4UUT A;  3ZMU A;  2TCT A;  3RKX A;  3FXQ A;  5HDK A;  1EA3 A;  3BR2 A;  5DM7 F;  1MDM A;  2Z99 A;  5E1Z B;  1GLN A;  1Y56 A;  4D0P A;  2QBY B;  3GLX A;  3ROU A;  1R9T J;  4MO7 A;  2CWE A;  5K1Y A;  4RBO A;  4KYW A;  2GA1 A;  1YFH A;  1IAW A;  1BC7 C;  1YX5 A;  3UNG C;  1VQ9 I;  3GTO J;  2LSO A;  4UUS A;  2PMZ A;  3G6E I;  5IT3 A;  4Q4Z F;  1OIS A;  2OZ6 A;  1OR7 A;  2OUM A;  3ZMD A;  2NVQ J;  2VUM J;  4I02 A;  4JK1 X;  1TWH J;  3JRH A;  2Y9Y A;  3VWB A;  4LB5 A;  2Y48 A;  2E2I J;  1FOW A;  1GUU A;  3K6G A;  3H9Q A;  2GZW A;  3F9K A;  2EIK H;  3S1N J;  3Q0U A;  5AIQ A;  4C3J J;  2L54 A;  3JRA A;  4Y15 A;  3GO5 A;  3DEE A;  3TO7 A;  3T1B A;  3MN2 A;  4W97 A;  3WGI A;  5K7F A;  4E7S A;  4II2 A;  2ZC2 A;  3P9I A;  5ILU A;  3BJA A;  3NAR A;  3DV8 A;  2M9H A;  4FET A;  3MKY B;  1LPQ A;  2R0Q C;  1ENH A;  1BL0 A;  2VE8 A;  1FBS A;  1BOA A;  1TWA J;  5JFR A;  3A2K A;  1OYI A;  1HOM A;  3GFM A;  4UB8 C;  4AWX B;  2P6S A;  2O9L A;  4A3D J;  2VN2 A;  3QOP A;  2Q0O A;  3FXJ A;  1TP4 A;  4U87 A;  2ECB A;  4I09 A;  4DQ2 A;  4EM0 B;  1LEB A;  1F1Z A;  3MD2 A;  1BJA A;  2EFP A;  2WBM A;  2XGE A;  1ETK A;  3IWF A;  4RGS A;  4IOA F;  2GAU A;  3NEU A;  4DGW B;  2QSG X;  1ERD A;  1HF0 A;  2MD5 A;  3CZ6 A;  4E7K A;  2CUE A;  2X6W A;  4MQV A;  4KIT B;  4IO9 F;  1XTA A;  1NK3 P;  1R22 A;  3HBL A;  2IA2 A;  4L9N A;  4BJ5 C;  2ZXW H;  1RUN A;  3X2Q H;  2IJL A;  1FNN A;  1B9M A;  1G6N A;  1SD4 A;  1O3Q A;  2OC6 A;  2QQ8 A;  3V8J A;  4F92 B;  1R49 A;  4A0Z A;  2EV5 A;  2GOX B;  2FA5 A;  4EJW A;  1ZRE A;  1FOK A;  3AFH A;  1BIB A;  3PL8 A;  3IP4 B;  4QSH A;  3QPH A;  3DPT A;  3OYN A;  2FQ4 A;  2V6C A;  2EV6 A;  4KMF A;  2NVY J;  3EUK L;  2VBY A;  4ENM A;  1Z9C A;  2OTJ I;  1Z77 A;  4BAY A;  1VQ4 I;  1Z21 A;  5E1X A;  1IN8 A;  2HVQ A;  3KZZ A;  5KAI C;  2VI6 A;  3K70 C;  3CCL I;  5M5Y J;  2YU9 J;  2W00 A;  3QWL A;  2E34 A;  3OOU A;  3RQI A;  1JUP A;  2K3P A;  3R0A A;  4PDK A;  3C2G A;  4M73 A;  1MBG A;  2M45 A;  1A5J A;  5LRS A;  2LR8 A;  1JJ6 C;  2JQ7 A;  2K4J A;  5HS7 A;  1GVD A;  1MBH A;  2V26 A;  2ZXI A;  5D5V B;  2HQA A;  1CF7 B;  4KIG A;  1A31 A;  1RRJ A;  3BTL A;  1MSE C;  1V54 H;  1S9H A;  2CJJ A;  5J4Y A;  3EYI A;  3ZQL A;  2L4M A;  3KET A;  1IRX A;  2QEN A;  3S15 J;  1WJD A;  1D1A A;  5HOD A;  1LUJ B;  3CCV I;  1X1C A;  2PN6 A;  1MBK A;  3BTI A;  3TDZ C;  3CES A;  1PUF A;  1MKM A;  3S93 A;  2KZG A;  2G7U A;  1YW9 A;  1VQM I;  1FBQ A;  2RGV A;  3TDU C;  2PQ8 A;  1ACI A;  2R5Y A;  2RDP A;  2Y9Z A;  4KNY A;  2ZFW A;  2V6E A;  4NDL A;  1HQC A;  2L7Z A;  3HRM A;  2A68 F;  4Y52 J;  3CUQ A;  3T8T A;  4HF1 A;  4NUB A;  4C2U A;  1XG1 A;  4CCN A;  2JA6 J;  3OY9 A;  4HEA 2;  4L9V A;  4UY8 I;  2CSO A;  2FOK A;  4YFK F;  1EH8 A;  5CQE A;  1GT0 C;  3KP4 A;  2JUC A;  1WKM A;  2K5C A;  3RI4 A;  4ESB A;  3KP3 A;  5DUK A;  1W0T A;  4IHW A;  2JA8 J;  4S05 A;  3S17 J;  3TMO A;  3SHF A;  1K83 J;  1V5F A;  1X3W B;  2E5Z A;  2Y0S N;  1FPQ A;  2ZB9 A;  2DN0 A;  3J81 K;  2KDZ A;  2BOL A;  3BJ6 A;  4UB6 C;  3JRB A;  4ZYD A;  3H9G A;  2IEK A;  4H0E A;  2D5V A;  3FF5 A;  1FIA A;  3J80 Z;  2VKD A;  3K4K A;  2V1D A;  1YRN A;  3I54 A;  2DPD A;  2OAZ A;  2ME0 A;  2UZK A;  2KQR A;  5CLS A;  4B43 A;  5ICG A;  3HDD A;  2B63 J;  5DCM B;  1KYW A;  3CCR I;  2AS5 F;  5GAE J;  4PZJ A;  2B0L A;  5HLG A;  5FO5 A;  4B3A A;  2P5K A;  2Y0S A;  3PQK A;  4G9Y A;  2EFW A;  4PCQ A;  5ERI A;  4A3K J;  3BLY A;  1WVR A;  1V5G A;  2LD5 A;  3FMQ A;  2LNB A;  1XS9 A;  1LVA A;  1U5T B;  3IH3 A;  3S3M A;  2O61 A;  2VOO A;  3LA2 A;  4MTD A;  2BVM A;  2HOT A;  1T39 A;  1V5E A;  3AG2 H;  3LSK A;  2L5Q A;  3AG4 H;  1XGO A;  3ZMZ A;  5GTH C;  3PM1 A;  1IV6 A;  1J09 A;  2M34 A;  2CV1 A;  2VPL A;  1SMT A;  1JKQ C;  3BZK A;  3MVP A;  4MEY F;  5D8K B;  1SAU A;  4PFO A;  1S7E A;  1IC8 A;  3LA7 A;  5AIP A;  2J5P A;  3HM5 A;  4A3L J;  3BRO A;  2VL8 A;  2X1E A;  4B8X A;  5DTD A;  4EJT A;  2FBI A;  3B6C A;  4G8X A;  4JQF A;  4YG2 F;  3KIO A;  4JX4 A;  2JMW A;  2IP2 A;  2CUJ A;  2DI3 A;  5F0F A;  3F21 A;  3HKZ N;  2XIG A;  3O8H A;  2YS9 A;  5DD4 A;  3KZI C;  3ABT A;  4HNU A;  3DEU A;  2DFI A;  1I3A A;  1BBY A;  2HWV A;  3AL0 C;  3H5A A;  4PSW A;  2RKH A;  5B3S H;  4UUV A;  3W6J B;  3FKI J;  1D1C A;  3DLL F;  3OYL A;  4MFD A;  3IL2 A;  2HOE A;  3CF5 F;  3LFK A;  1KZH A;  3AAF A;  1A6Q A;  3CC7 I;  4A5N A;  5BMZ A;  4DOZ A;  3HKZ A;  3HTU A;  1Z7U A;  4HST A;  1F5T A;  2UXX A;  5FKO A;  1JGG A;  5L3B A;  5E8I A;  4QPQ A;  4BE0 A;  3G4S I;  2E36 A;  4OU0 A;  2XPV A;  4M72 A;  4D7N A;  5KAF C;  1UCR A;  3E97 A;  3L2V A;  3H92 A;  2HPI A;  3F0C A;  4O5V A;  4G12 A;  5FKK A;  3F22 A;  5IY5 H;  5F27 A;  5IPA A;  2IVM A;  2OBP A;  1E3H A;  4ABZ A;  3SEZ A;  1IZ1 A;  3ZQC A;  2AO9 A;  2MYS A;  3LAP A;  4IRI A;  3S1M J;  4HZF A;  3E6M A;  4RM2 A;  5HLI A;  4AC0 A;  2STT A;  3GWZ A;  1FP1 D;  5HNF A;  1ZEL A;  2RQQ A;  1FT9 A;  4A3G J;  3AG3 H;  3BQY A;  3N4M A;  3VYU B;  4WWC A;  1CF7 A;  4IF4 A;  3RPU A;  1BJZ A;  2CW7 A;  4BHP A;  1JTY A;  1JKO C;  2JVH A;  2DA7 A;  1EF4 A;  3OYF A;  2R7F A;  3OR1 C;  3MEX A;  2O0Y A;  5CVV A;  5J3L A;  3P5J A;  2VQL A;  1R6R A;  2VPR A;  2VC0 A;  2E1N A;  4BQO A;  5A2Q K;  2ELJ A;  2XB5 A;  2BE5 F;  1W36 D;  2K7L A;  2E7W A;  4A3J J;  4CCL A;  1YO5 C;  1T08 B;  2R7Q A;  2LF8 A;  4RGU A;  3DU6 A;  2FRH A;  4G6D A;  2CQK A;  1D5V A;  1BM9 A;  2I10 A;  2HXO A;  4ZYE A;  1WI9 A;  4ZC3 A;  3HEF A;  2NVX J;  2QLZ A;  4GRI A;  4LIV A;  5K5O A;  1QA6 A;  4XKW A;  1D0Z A;  1K7A A;  1SVM A;  1XGM A;  4ZTF A;  3TOB A;  4CXF A;  5LGN A;  1ON2 A;  4P96 A;  3KP2 A;  2MD0 A;  4Q48 A;  2VJ5 A;  1K78 A;  1BI2 A;  3FXO A;  4BUP A;  3H5N A;  5LHH A;  3QYB A;  3BC8 A;  4P55 A;  4I76 A;  1MNM C;  2VJI A;  4L5E A;  4OMY A;  1S72 I;  5GPA A;  1ZRD A;  1IW7 F;  2DMP A;  4LD5 A;  2IA1 A;  4E7I A;  4UVC A;  3QPL A;  2ZNY A;  4DYR A;  3I3L A;  5GPC A;  1HW1 A;  2I8D A;  3IRR A;  2R7W A;  2L9S A;  3ZN0 A;  3OL4 A;  3RSN A;  4XNF A;  1KU9 A;  1ZTR A;  3D5L A;  2CYY A;  4FX0 A;  2RRE A;  3SZG A;  1FOX A;  3HGG A;  3E7L A;  4M6V A;  2ELK A;  3HC7 A;  4D9J A;  1YX3 A;  2X6X A;  2EZK A;  1JTX A;  2ZXH A;  3WTZ A;  3SFZ A;  1TBX A;  5CVI A;  5BQT A;  3WTS C;  2W57 A;  2XRN A;  4L5J A;  1F9N A;  3BR3 A;  2VXZ A;  1U9N A;  1VF9 A;  2KMU A;  2HKO A;  1OYW A;  3FKJ A;  4UV8 A;  4YFX F;  2VKE A;  4G7Z F;  5KNL A;  1X4P A;  2P7V B;  1B9N A;  1XMA A;  3GTL J;  3KX2 A;  3F6O A;  4YIF A;  3HOT A;  3OS2 A;  3IH4 A;  3SFI A;  4GO1 A;  4EEF G;  3HGY A;  2MA3 A;  2VJ4 A;  1VQK I;  2MH2 A;  3PSF A;  1V55 H;  3KFW X;  1J5Y A;  2BXZ A;  2IGK A;  3J80 K;  1HST A;  5DCF A;  2KRC A;  4Y33 A;  1XD7 A;  4FX4 A;  3ZR8 X;  1ZN2 A;  2AQE A;  2GLO A;  5HDG A;  3TP0 A;  2E1M B;  1PJR A;  1SD7 A;  4M3B A;  4KMU X;  1IGN A;  3PSI A;  2DMU A;  2E60 A;  2HKX A;  3LSR A;  2R4G A;  3L9F A;  1H9G A;  2O3F A;  3B73 A;  2QWW A;  3GZ5 A;  5KCM A;  4HNV A;  2V7F A;  2DFE A;  1TQI A;  1AWC A;  1WH5 A;  4GYI A;  3QYE A;  1LDK B;  4BL0 B;  3KZY A;  2KJB A;  1MDM B;  5IP9 J;  3CP2 A;  4P9U A;  1DU0 A;  1P9Q C;  1ZGA A;  2XGD A;  4N4N B;  1XSX A;  4QPO A;  1SC7 A;  5EJC A;  2CH0 A;  2BZT A;  4KIB A;  2QVO A;  4U7B A;  2K9M A;  2QQA A;  1YYV A;  2XRO A;  5F0H A;  1CQT A;  3KLN A;  1NG6 A;  1RKW A;  1T0F C;  3E5U A;  1Y1V J;  1RIO H;  1YS6 A;  4U0W A;  1RES A;  4ESF A;  1R00 A;  4CYC A;  4A3E J;  3SZT A;  3K9T A;  3WHB A;  2E5N A;  1HKT A;  2L7K A;  1OMI A;  1PDN C;  1EH7 A;  1RPW A;  2DA2 A;  4B1R A;  3FM3 A;  5FD5 A;  1U5T C;  3ISP A;  3S2D J;  2KPM A;  1LB2 A;  1B8I A;  2NYX A;  2VAS A;  2HTJ A;  5IYD J;  3HRT A;  4A3I J;  3JRD A;  2MC3 A;  4OIN F;  4XLP F;  1HCR A;  5H6Q A;  4BQA A;  1RKT A;  2VBW A;  4B09 A;  4N4O B;  3RZD J;  4RMN A;  3W2V A;  1JT6 A;  1R7J A;  4JOM A;  1F36 A;  1AOY A;  3LAJ A;  3FIW A;  4LLG F;  3SQN A;  4WX9 A;  2MAB A;  5GAG J;  4KIC A;  2MBF A;  2JJ7 A;  2DOA A;  1FBU A;  2LRE A;  2D45 A;  3WU0 A;  3OYA A;  1X19 A;  5E18 F;  3FXR A;  1ETX A;  3HRS A;  1MH4 A;  2R7T A;  3K1M A;  1DGR M;  1W1W E;  2P5V A;  3L00 A;  2VQC A;  4HV6 A;  3HTS B;  1VI0 A;  2ZNZ A;  1YIT I;  1ZKG A;  3AG1 H;  3BY6 A;  1TC3 C;  2ZJP F;  3PQJ A;  1JUS A;  4RGX A;  2JRT A;  4M3E A;  4DNC A;  3U1D A;  2R3S A;  4D5C A;  2FJ1 A;  2K3F A;  2KFD A;  2XAJ A;  1XDS A;  1D8J A;  3GZN B;  3ZMT A;  4FE7 A;  1TL8 A;  2ACJ A;  2IPQ X;  3NWT A;  4QWQ A;  2CQQ A;  3FK7 A;  2JT1 A;  1MIJ A;  3TO9 A;  3GME A;  2RNJ A;  1YQA A;  4FQG A;  1BR1 A;  1WJB A;  2HOS A;  1V4R A;  1XCB A;  1B72 A;  2EZI A;  1BW6 A;  5FKM A;  1Y39 A;  2O6G E;  2FBH A;  2YSR A;  3BZ6 A;  1YJW I;  2PLY A;  5IOY A;  5L3E A;  4E7J A;  1JI8 A;  5K7H A;  2B9S A;  3LST A;  3QU3 A;  1E2X A;  3Q3S A;  2XVC A;  3S16 J;  3A1Y A;  3J81 Z;  4IRG A;  2Y30 A;  3GVA A;  3HYI A;  5F0C A;  4EV0 A;  1QU3 A;  2LH9 A;  5LD2 C;  3PJR A;  2XF7 A;  3M9A A;  2NRA C;  4WK8 F;  2JA7 J;  3H9J A;  2D2W A;  2NS7 A;  2GXB A;  1J59 A;  3CF2 A;  1MMN A;  4G6T B;  2R5Y B;  1R1U A;  1T8I A;  3P9K A;  4I01 A;  4X1E A;  1ZGJ A;  3A01 B;  1PUE E;  5DD8 A;  3WG7 H;  1L3L A;  4GCV A;  4U88 A;  5F64 A;  3I56 I;  2JA2 A;  3I4M J;  1QVU A;  1EKE A;  3O8G A;  1OCC H;  2WY7 Q;  2WAF A;  3CMY A;  3DTI A;  1FMV A;  4ENN A;  2L0K A;  1Z6R A;  5FGM A;  3CUQ B;  1YW7 A;  2LVS A;  4HA8 A;  3Q0W A;  3OYE A;  1P2F A;  2DTR A;  3PNT A;  3CD6 I;  5F1J A;  1TLH B;  1O3R A;  4BAC A;  2HI3 A;  1W4M A;  3IHU A;  4GGG A;  3C3W A;  1TNS A;  3SYT A;  2M8G X;  3DTE A;  4CYD A;  4C9Y A;  2PMZ N;  3H36 A;  4R8H A;  2HXI A;  2IW5 A;  1BR4 A;  3KP7 A;  1YJ9 I;  3JRF A;  1HC8 A;  5D4R A;  1XCV A;  4F3Q A;  4MTE A;  1VQO I;  2GA2 A;  1QZE A;  1Y8R B;  4AUX A;  4I98 B;  3K4M A;  2XF6 A;  1E0E A;  2F48 A;  5E1W A;  4WF2 A;  1XDU A;  1YRN B;  1D3Y A;  1HKS A;  4M6Y A;  1MMG A;  1OKR A;  3HOZ J;  2GIV A;  2XPW A;  3DKX A;  4MLO A;  2STW A;  2DFH A;  4Y3O A;  5M3M J;  4DZJ A;  4XRF A;  2HFH A;  4LOC A;  2D1H A;  4E70 A;  4L9T A;  2PX9 A;  3DFG A;  5ILV A;  2BY1 A;  1MBE A;  2R93 J;  1FIP A;  3OMY A;  1LE8 B;  2Y75 A;  1IN5 A;  2JZY A;  1G59 A;  4Z2Y A;  3CDI A;  3FXL A;  1OCO H;  2CMP A;  2KIF A;  2PJR B;  1NG7 A;  3J7Y J;  2VKV A;  2VLA A;  2R7D A;  1T95 A;  3V8K A;  1QVT A;  2HNH A;  2LYC A;  3K7A J;  4NHJ A;  1B6A A;  1JKP C;  3G1M A;  3HSE A;  3VOE A;  4A0Y A;  2HTS A;  1J9I A;  1R71 A;  1H8A C;  1I50 J;  1R5G A;  1KU2 A;  4JYK A;  2HZD A;  3K4N A;  1K6Y A;  2QEX I;  1HLV A;  2A5W A;  5DUI A;  4BHC A;  3SXY A;  2FBK A;  1G3S A;  4BJT A;  4LMY A;  2EBI A;  4RAF A;  3TQN A;  1UFM A;  1UHW A;  4AVP A;  5JLW A;  2EPF A;  2ZJ2 A;  1Z1D A;  4RAZ A;  2E19 A;  1HDD C;  5L3G A;  3DLA A;  5L3F A;  3SZP A;  2HGC A;  2NAZ A;  2X9D A;  2H1L A;  3EUH C;  1D5Y A;  1DP3 A;  3OWT A;  5J8F A;  5J1Y A;  4YII A;  2Z2S B;  2BHZ A;  3OS0 A;  1J75 A;  3PIO F;  3ZXS A;  2FXA A;  4LK1 F;  4XKB A;  2ME6 A;  2W24 A;  3HSF A;  4EAT A;  2XC7 A;  1IUY A;  2EFN A;  2F4O B;  5A2Q Z;  3RPU D;  3HG9 A;  2HPM A;  3HOW J;  2EA2 A;  4FHT A;  2RQP A;  3BR6 A;  2P5L C;  3MFK A;  3KEO A;  2CO5 A;  2DDA A;  1Z67 A;  1P4A A;  4KA4 A;  3KCC A;  1WJE A;  3CCE I;  2Z16 A;  4QLC U;  2FD5 A;  5F08 A;  1IDY A;  5J6X A;  2R7R A;  2HQN A;  2X0L A;  2R7X A;  2DT5 A;  3FIS A;  4FT8 A;  1ZRF A;  1HA8 A;  1Y0N A;  4BE1 A;  5C4X J;  1T56 A;  2HYF A;  2PI0 A;  1WRJ A;  4LIU A;  2KDO A;  1ZAR A;  1WFX A;  1U2W A;  2IT0 A;  2LKS A;  4EJO A;  1IRG A;  3GTP J;  2TRT A;  2F5C A;  3JTH A;  2CQX A;  5CYV A;  3QRF F;  3QAH A;  4BY7 J;  1O7L A;  2VC1 A;  2DQR A;  4I0B A;  1SAX A;  3LOC A;  4IQ4 A;  4KN4 X;  3L09 A;  1OCR H;  3OIP A;  4S0H B;  1O4X A;  2Z9O A;  4KIS A;  1FLI A;  4YIR X;  4HF0 A;  2M1B A;  5HNH A;  1P7J A;  1YI2 I;  4ZZL A;  2E2H J;  4MIM A;  2OCE A;  4M6X A;  2KRH A;  1SFK A;  5F04 A;  2ZSI B;  4OIO F;  4LLL A;  4HX7 A;  4OIQ F;  3E1S A;  4BS9 A;  3KP6 A;  4BGD A;  3ML6 A;  1D0Y A;  1ULY A;  3DKW A;  4ENK A;  2HYJ A;  2K40 A;  2ZCW A;  2PFB A;  3A01 A;  4B48 A;  2CFO A;  4JP0 A;  4OIR F;  2M87 A;  4IVN A;  5JR3 A;  3ULQ B;  2Q1Z B;  9ANT A;  4UV9 A;  3MAJ A;  4E7Z A;  1PVE A;  4M71 A;  1AHD P;  1W7P A;  3QOE A;  1UG2 A;  1W5C C;  4BYY A;  3Q9S A;  4ZH4 F;  1MW7 A;  3ZOB A;  4RB2 C;  4WXC A;  3HOV J;  3UKG A;  2ID6 A;  3H5R A;  2A69 F;  4P5O A;  5FLV A;  2KRF A;  1JKR C;  4XON A;  1K78 B;  1BOB A;  2WB1 N;  2LF7 A;  3OS1 A;  1ZR4 A;  4M74 A;  5H20 A;  1QRY A;  1IN4 A;  2M2E A;  2V1N A;  1HDP A;  3CJR B;  2LBF A;  1UG0 A;  3DKY A;  3LSG A;  1UEL B;  5E3O A;  1EV7 A;  1KQ8 A;  3EDP A;  2O5R A;  4CH7 A;  1VQN I;  3WOD F;  5M3F J;  4PJL A;  2DT7 B;  2HQR A;  4GDF A;  1ONV A;  3CCS I;  2P7C B;  3OSG A;  1WZ2 A;  3ONQ A;  3WTW C;  4BEH A;  3T5X A;  2OZU A;  3DWL E;  3GCM A;  4XN0 A;  2DK8 A;  2H6B A;  4CZZ A;  2K9L A;  2WB1 A;  1OCZ H;  3L1P A;  2NNN A;  5B1B H;  1UAA A;  3BR5 A;  3OYD A;  5B5E C;  1LEA A;  1R5I D;  2ELH A;  2JSP A;  3GX4 X;  1U78 A;  1APL C;  3I0T A;  1LE8 A;  3L7W A;  3LSJ A;  2EIJ H;  2V4J C;  3J7A Y;  3CDL A;  1W5S A;  2WY8 Q;  4WXH A;  1LVK A;  3HL2 A;  5CVJ A;  5LLQ A;  2COM A;  2PJR A;  2E1C A;  3L2C A;  3CCJ I;  3F8C A;  4RB0 A;  4DYC A;  5D6F A;  5ICC A;  3CMA I;  1I1S A;  1BA5 A;  1OPC A;  3QYF A;  5J40 A;  5H2F C;  1SD5 A;  1LDJ A;  1IUF A;  2FML A;  3ECO A;  3E6B A;  4TV7 A;  1WJ5 A;  4EQQ A;  3E5X A;  1MJB A;  1ZAO A;  1MMD A;  2CU7 A;  2EA4 A;  4BQN A;  3RQ4 A;  2DXI A;  1S3J A;  4ZTJ A;  3PFY A;  4XOP A;  3K69 A;  2EIM H;  3BQZ A;  3WTX C;  4RLQ A;  1G2H A;  1N25 A;  4RGR A;  4A5M A;  3LQR A;  3VEP A;  3IUO A;  1K61 A;  1MSF C;  1FMW A;  3CUQ C;  5F6F A;  1HBX G;  5CVU A;  4BBS J;  3GBG A;  2HEO A;  1ZG5 A;  1A04 A;  2WC2 A;  3L2W A;  1IXS B;  2K9N A;  2GXG A;  4P9F A;  4EMS A;  2K86 A;  4LLN A;  1WH7 A;  3I55 I;  1F4K A;  4X6A J;  5EGO A;  1S29 A;  2OQG A;  1JHF A;  4NB5 A;  4DZP A;  1D8K A;  3EYY A;  3O6B B;  2R7U A;  4HBL A;  3ZCO A;  2Q8K A;  1HW5 A;  2EZH A;  3HHG A;  2L02 A;  3HJE A;  3LSI A;  3OOP A;  3QQA A;  2HYG D;  3H3U A;  4RAG A;  5E3N A;  5K7Z A;  3IV5 A;  1XC5 A;  3VYT B;  4CCJ A;  4AVZ A;  2CW8 A;  3LL7 A;  2E35 A;  4A69 C;  4CYC B;  3F6V A;  5FRN A;  4UVA A;  3IC7 A;  5B1A H;  3PO3 J;  1R23 A;  5E3M A;  2GIZ A;  1OYY A;  3CCM I;  4EGZ A;  1S5L C;  2VQH A;  4RS8 A;  1D0X A;  1TT5 B;  5L3C A;  3WE3 A;  2CRG A;  5J1R A;  1B8I B;  4PJN A;  4RLF A;  2RNG A;  2RAE A;  4HRI A;  4OAZ A;  1IRZ A;  3LSM A;  1S6L A;  3H0G J;  1O3T A;  4ANJ A;  2FX0 A;  4CCM A;  2AQF A;  3TP3 A;  2ISY A;  2OCC H;  2KZV A;  2XDV A;  2IGN A;  5D5U B;  4UNO A;  1ZHF A;  1Q1H A;  4J19 A;  1VTN C;  2ZME B;  3O2P E;  5LHI A;  3D5S C;  4RB1 A;  2HOA A;  1USS A;  4FIS A;  5CPR B;  3BT9 A;  2IGM A;  5FFZ A;  2O8X A;  2FOW A;  2HZT A;  3OIQ A;  4J01 A;  3GFI A;  3FMS A;  4EM1 A;  3ZMS A;  3GYH X;  2A6T A;  4XKC A;  3PFI A;  3WU2 C;  3U21 A;  3MKW B;  3T8R A;  2YU3 A;  3MWM A;  3A0H C;  4CDG A;  3BG7 A;  4ESJ A;  2X4H A;  1YE9 A;  3KEY A;  2WV0 A;  5EZH A;  5D6E A;  1VZ0 A;  1ETW A;  2O8K A;  2ICW G;  3WTU C;  4G94 A;  4OAY A;  5TIS C;  1SAN A;  1E3P A;  1E3O C;  2KIQ A;  2OQR A;  4R79 A;  4CHU A;  2W85 A;  4NC6 A;  5EDN A;  2VB6 A;  3CP8 A;  1B72 B;  2WTE A;  2FE3 A;  2O7O A;  1Z91 A;  2ZBK A;  4XIC A;  1T38 A;  1IXC A;  3OV8 A;  3F8N A;  3GTK J;  4HV5 A;  1FYM A;  1N77 A;  1MMA A;  2KIU A;  3OYB A;  4L0Y B;  3BR1 A;  3RCO A;  2YPR A;  4D7M A;  3G71 I;  3S1R J;  1WHU A;  1YLF A;  2BEO A;  4KN7 X;  2A05 A;  4II3 A;  4IEJ A;  3QP6 A;  1R58 A;  4LGW A;  3NQO A;  1UJ8 A;  1S7A A;  3LMM A;  3CJT B;  1U9O A;  4HPQ A;  4AIH A;  3V4G A;  2BVL A;  2A07 F;  1S7O A;  2CUF A;  1Z3Y A;  4KIF A;  1Y8Q B;  3HPG A;  4LG0 A;  2VON A;  4MGR A;  1NHA A;  3V7S A;  3OYJ A;  5LFA A;  1G3W A;  4BKX A;  2R7Z J;  4XSZ F;  1BR2 A;  2M0M A;  3K4C A;  1X58 A;  3FXK A;  3RYP A;  5LBQ A;  3I71 A;  1FYL A;  2IS6 A;  5IYC J;  4IKF A;  3KLO A;  5J4V A;  4F52 A;  2QQ9 A;  4Y17 A;  2EIN H;  2CV2 A;  1XSV A;  1AKH B;  2OTL I;  2UV1 A;  4PJJ A;  4M3D A;  3R60 A;  2XUB A;  2Y31 A;  3C18 A;  4XID A;  1QNT A;  1LFU P;  4A3B J;  5EG0 A;  2XHK A;  3I58 A;  1U3E M;  2DU9 A;  2L7F P;  2XSJ C;  5DV5 A;  1WSU A;  3ZQH A;  2WAE A;  1TQM A;  3GXO A;  1ZRC A;  3RKW A;  1JE8 A;  4HG2 A;  3GUD A;  3CDH A;  3RDI A;  3ZQQ A;  1ORK A;  1WI3 A;  2IA0 A;  2R92 J;  3G3Z A;  4K2E A;  2OA4 A;  5JI6 A;  1X1A A;  2LG4 A;  3LSH A;  5LHG A;  1O3S A;  2ETH A;  4E6K G;  3HOX J;  4IHY A;  4XL9 A;  4DW6 A;  3RIR A;  1Z0X A;  2L2O A;  1B1B A;  3F72 A;  1LKX A;  3L2U A;  1LNW A;  4AID A;  3BPX A;  1SEU A;  4A3C J;  2QZ8 A;  2G7H A;  2BV6 A;  4W1U A;  1TT0 A;  3K2Z A;  3A0B C;  4C2M J;  5BPI A;  4ZYH A;  4IHS A;  3WE2 A;  5IT9 K;  1ZK8 A;  4NQW A;  3S1Q J;  3COA C;  3KE2 A;  3WTV C;  3A03 A;  2X6Y A;  3K10 A;  3ZQF A;  1QPI A;  4L18 B;  5M5W J;  2OJE D;  4A3F J;  4HQM A;  4UVB A;  3CC2 I;  2KHM A;  4DJA A;  2JVG A;  2L9V A;  3E6C C;  3F3X A;  3G1O A;  3DBL B;  2H27 A;  4ZDL A;  2WA0 A;  1P92 A;  3IAS 2;  3VPR A;  2NVU B;  1H89 C;  3K4L A;  5HS9 A;  4PSX A;  5HOO A;  2Z1D A;  1HXD A;  3FX3 A;  4KT6 A;  2XAG A;  5ICF A;  3U1K A;  3ZGK A;  3JSP A;  2JRM A;  3GZ6 A;  1X2N A;  5J47 A;  3FMR A;  2CV0 A;  2OPT A;  3D0S A;  4BJ6 C;  2W4S A;  2ADU A;  2ZME A;  1R4N B;  2VJJ A;  3W3C A;  2KT0 A;  1RI7 A;  1VFC A;  1R1V A;  4HDV A;  1MJ9 A;  2G0E A;  2DO7 A;  3OYC A;  3OYG A;  2QKM B;  1Z7L A;  3B6A A;  1LJ9 A;  1RR7 A;  2HDW A;  1ZG3 A;  2WV1 A;  2XF5 A;  1M1E B;  2DMT A;  3FK6 A;  1I39 A;  2QM3 A;  1BIA A;  2PMU A;  2DYS H;  2V9K A;  3GTM J;  2JUG A;  1R4M B;  2DJI A;  4LIT A;  4UHT A;  4Q47 A;  2W1O A;  4F91 B;  4D1Q A;  3C2B A;  1P4W A;  1JUM A;  2GWR A;  2ZFU A;  1HKQ A;  2FF4 A;  2BY3 A;  3GLL A;  3HZJ A;  3VDX A;  4XLF A;  5M5X J;  1EJ9 A;  3V7C A;  5HS8 A;  3CQZ J;  2F4I A;  3DTK A;  4M3G A;  5BNG A;  5HLT A;  1GXP A;  1MH3 A;  4OMZ A;  3PUB A;  1QZY A;  3DBH B;  4M9X A;  3QPS A;  3BTC A;  3HSR A;  1RZ4 A;  3H3Z A;  5EZG A;  3ZN1 A;  5FJ8 J;  3HPH A;  2P4W A;  4RM3 A;  4FCY A;  1HSJ A;  3O3K A;  1W7P D;  4G6Q A;  4NNJ A;  4F7Z A;  1MMS A;  1JHH A;  2MFZ A;  2F6C A;  4KT5 C;  4BBR J;  4G7O F;  2IS4 A;  1SFO J;  2KIM A;  4KFC A;  1PYV A;  4E7L A;  1XPX A;  1MJA A;  3S2H J;  1O7F A;  1P6R A;  1XGN A;  2O03 A;  2V1U A;  2VKH A;  4XLH A;  2ID3 A;  1D1B A;  5LRR A;  4DYQ A;  2JSC A;  2ZO4 A;  4WCG A;  1TW2 A;  5CJ9 A;  5D4S A;  2YUS A;  4IPA A;  3TOA A;  1KU3 A;  2FEZ A;  1W5T A;  2RN7 A;  3OYI A;  3S8P A;  5BOX A;  2EFO A;  1P7I A;  1XMX A;  1K4T A;  2TDX A;  2VE9 A;  3U9G A;  1JJ8 C;  1NTC A;  4MHG A;  3GTG J;  2GXA A;  5BS6 A;  2X1C A;  4LFU A;  3P9C A;  5CKT A;  2QSH X;  3N05 A;  2VOP A;  1U0J A;  3FHN A;  4BQQ A;  3M1C A;  2H1K A;  1W7P B;  3LQQ A;  3KP5 A;  3QOD A;  3JRC A;  3OYM A;  4YRV A;  1G4D A;  2R5Z A;  2LTP A;  4AM3 A;  5E17 F;  3RKQ A;  1DPU A;  4XKV A;  3FBI B;  4CA0 A;  2NXN B;  3JR9 A;  3SDG A;  1AKH A;  3I59 A;  2BXY A;  3I64 A;  2HU9 A;  3EET A;  2BY2 A;  5FRM A;  3FM5 A;  2EZL A;  2OF7 A;  4XLA A;  4ITV A;  3I9V 2;  4U0Y A;  2NOG A;  1A36 A;  3WU1 B;  3TO6 A;  3LSP A;  1PP8 F;  1E17 A;  2JPB A;  3SEQ A;  2JA5 J;  4CZC A;  2LBF B;  3M3Y J;  1ODD A;  2R7O A;  3ZQI A;  3AL0 B;  2DW4 A;  1F43 A;  1X2M A;  1VQP I;  4PGG A;  1VQ5 I;  2JPC A;  1W36 C;  4ZDO A;  1ETO A;  4BEH B;  3RYR A;  2V79 A;  3NRV A;  4RDU A;  3IKT A;  3MKZ A;  3CLO A;  2LY1 A;  1TTY A;  4L0Z B;  5EYR A;  4MNU A;  3W6K B;  2EK5 A;  1POG A;  1EH6 A;  4PK4 A;  4HLY A;  2ISZ A;  5FLM J;  2P0W A;  1ZQ3 P;  2N8G A;  5GTI C;  1TWF J;  2EQR A;  2F4M B;  2E1O A;  5D8L B;  3GFJ A;  3EQL F;  4CIC A;  3Q0V A;  1HW2 A;  2XGC A;  2BW3 B;  4M9Z A;  3H0D A;  3TL4 X;  3W2A A;  2COB A;  3R6S A;  2KL4 A;  5ILS A;  2DOF A;  3CCY A;  3M4O J;  4DBQ A;  4V2G A;  2PBI A;  4ASN A;  5J8C A;  3W6V A;  2EB7 A;  2ESN A;  1FOY A;  2EIL H;  5FRO A;  4EVI A;  2PEX A;  1FYK A;  3CMM A;  1H88 C;  4B47 A;  2LK2 A;  2QCO A;  3ABL H;  5H6R A;  3HRU A;  4O6J A;  1GV5 A;  2BY0 A;  4XOT A;  1IN6 A;  3VYR B;  3CJN A;  3ERM A;  4XLE A;  2FNP A;  1UHS A;  5BPD A;  5FKN A;  4KJZ A;  2NNY A;  1DDN A;  4EJV A;  4LJZ F;  1FJL A;  3CCU I;  3JAM K;  3H3V K;  3M8F A;  1X1D A;  4MFE A;  1SMY F;  3Q5F A;  2L9R A;  5CVR A;  1A35 A;  1ON1 A;  3VB2 A;  2XV4 S;  1PP7 U;  4BHB A;  1OCP A;  3SJM A;  2DA3 A;  2LFB A;  3FXU A;  3S32 A;  1U6G A;  2E1M C;  2F5V A;  3MMY B;  4HW0 A;  1H0M A;  5IP7 J;  2M30 A;  2M7A A;  5DYM A;  4IHV A;  5D5W B;  2YR2 A;  1KA8 A;  3S3O A;  4G7H F;  5EGO B;  5ICE A;  1JT0 A;  1K79 A;  3E5Q A;  5E8G A;  2LKP A;  3V42 A;  3CJQ B;  1TW3 A;  1IRF A;  2CFX A;  4CO8 A;  1QHH D;  3HUG A;  2DQL A;  3OIO A;  3GTQ J;  1J2X A;  3M7G A;  5DEQ A;  3CO6 C;  2DMQ A;  5DS9 A;  2M7B A;  3C2H A;  4PJ0 C;  4IX7 A;  1KON A;  1SD6 A;  2ZSH B;  3QP5 A;  4V19 K;  2EV0 A;  1OR7 C;  3H35 A;  3KEQ A;  5FFX A;  5HDN A;  2ECC A;  1YHQ I;  2NVT J;  1T33 A;  2MLK A;  4HYE A;  4XLN F;  1XB4 A;  4XQF A;  3VYS B;  3PNV A;  2DK5 A;  4HX8 A;  2PG4 A;  2OD5 A;  4CCK A;  2GQQ A;  1LFP A;  1P4X A;  4O3M A;  3DBR B;  2IRF G;  2LKX A;  3LFU A;  1UMQ A;  1DU6 A;  3ASN H;  4Y13 A;  2M5W A;  4NC7 A;  4I2O A;  3IRQ A;  3BG5 A;  4OOI A;  3ERE D;  4E7H A;  1GHC A;  5KK1 A;  4BE2 A;  1STZ A;  3I4N J;  3J7A O;  1MND A;  1X1B A;  2WWY A;  2P8T A;  4B4C A;  5JLX A;  2C6Y A;  2EH3 A;  5LEJ A;  3TW6 A;  2WAQ N;  4XRS G;  4XBF A;  2QYO A;  4XRM A;  3C7J A;  1X3Z B;  3BJO A;  1KQ9 A;  2JTV A;  2MGQ A;  5EEG A;  2A61 A;  1UZC A;  3RTR A;  3S14 J;  1NK2 P;  2H8W A;  4KUM A;  4F55 A;  4DIQ A;  4NC8 A;  3BR0 A;  3PNY A;  5K5Q A;  3DCF A;  2RC4 A;  2QQB A;  1WCM J;  4GYG A;  1I3Q J;  1N78 A;  2WAQ A;  4KDP A;  2CQ7 A;  1ETY A;  3QU6 A;  4HSR A;  3KYD B;  2W82 A;  1IJW C;  1ITY A;  3GF2 A;  1ZG1 A;  3I5U A;  3E3V A;  4LK0 F;  2HDC A;  1DGW Y;  3OYK A;  5GAD J;  2NOJ B;  3ESW B;  4Y7N J;  3WG9 A;  1DUX C;  5CQG A;  3ELK A;  2A6E F;  5J1U A;  1IXR C;  2BGC A;  1REP C;  4AIK A;  1IV8 A;  5IOZ A;  2PMH A;  2DPU A;  4CCO A;  3JTG A;  1ZLJ A;  1I27 A;  3BWG A;  2BW3 A;  4IHT A;  2XRL A;  3K0L A;  3ZQ7 A;  3R0J A;  2H6C A;  1SFU A;  2QBY A;  3K2A A;  3MQ0 A;  4A0X A;  4B44 A;  4A2U A;  4ZYG A;  4ON0 A;  4ZZD A;  2XGX A;  3ZPL A;  4GFB A;  1WJF A;  1Q1V A;  3K1P A;  2NS0 A;  1FC3 A;  3VFZ A;  4LG0 B;  1QQI A;  4EGY A;  1VQ7 I;  3IH2 A;  3BPV A;  2RVC A;  1GV2 A;  1BI3 A;  4X0G A;  4XM3 A;  3J7Z I;  1TQP A;  1RC9 A;  1AA7 A;  2IAI A;  3OR2 C;  2GBY A;  2DMN A;  2H94 A;  4EJU A;  1ETV A;  4RAY A;  4AD9 A;  3HOY J;  5IT9 Z;  2XB0 X;  2L7M P;  2JN6 A;  3K1N A;  2HVS A;  2OU2 A;  3OSF A;  1Y6I A;  3ZQG A;  2XKP A;  1ETQ A;  1MZB A;  2GOM A;  2VBZ A;  4IZZ A;  2B7E A;  3BG9 A;  1H9T A;  5EG0 B;  3MZ8 A;  3I4P A;  1RUO A;  3V8L A;  3BDD A;  1R5H A;  2V1X A;  3GEZ A;  3W2W A;  4HAM A;  5GP9 A;  2XSD C;  1QHG A;  2XAQ A;  3NAU A;  2F5E A;  2K9S A;  2L9N A;  2X51 A;  1Y1W J;  1IDZ A;  3LNQ A;  2F2E A;  1WQ2 A;  3WTY C;  1VND A;  2ZXJ A;  4MQ9 F;  1FSE A;  2X85 A;  5HVQ C;  5C3E J;  1MGT A;  4BXU A;  1I1G A;  2W7N A;  2J5O A;  1RR8 C;  5TJJ A;  1X3U A;  4XLC A;  5DDG A;  5FLX Z;  3MCZ A;  2XAU A;  2P81 A;  1G3T A;  4NQW B;  3E0J B;  1ZH5 A;  1BW5 A;  2Q2E B;  3MZH A;  2M8E A;  2MSY A;  3ECH A;  3G2B A;  4R1H A;  2DOD A;  5JVG F;  3R4K A;  2IS2 A;  3JW4 A;  2DA5 A;  1L0O C;  2FU4 A;  3AKZ A;  4WXD A;  3WGH A;  4AYB N;  4IOC F;  1FTZ A;  3ABU A;  1X1P A;  2X48 A;  2VXD A;  2I5U A;  1YG2 A;  3CME I;  1FP2 A;  4PGH A;  2H09 A;  2VIX A;  3VSL A;  2XAS A;  5TRD A;  2CS3 A;  2BYV E;  4GXO A;  4P1W A;  5EEA A;  2CGP A;  3HOU J;  2A6H F;  3UR3 C;  2QF7 A;  4C30 A;  2HR3 A;  3FWE A;  3BG6 A; 
#chains in the Genus database with same CATH homology
 2X6Y A;  3K10 A;  3K4M A;  2XF6 A;  1E0E A;  2KHM A;  4BDY A;  3DPL C;  2JVG A;  4DJA A;  4AYB A;  4NUB A;  4C2U A;  4CCN A;  3OY9 A;  1MMG A;  4HEA 2;  3DKX A;  4MLO A;  1Z3X A;  5CQE A;  4Y3O A;  3L2Q A;  4ZDL A;  2K5C A;  2WA0 A;  3IAS 2;  3BCA A;  3HOS A;  3K4L A;  4BXF A;  4PSX A;  5HOO A;  2Z1D A;  3TMO A;  1G8X A;  4KT6 A;  1V5F A;  3OMY A;  2E5Z A;  3ZGK A;  2CV0 A;  2BOL A;  3KYL A;  2R7V A;  4XOR A;  4BJ6 C;  2W4S A;  3H9G A;  1G59 A;  2CMP A;  4B3X A;  2VJJ A;  2PJR B;  3W3C A;  1NG7 A;  2VKD A;  2IXS A;  2VLA A;  3K4K A;  1T95 A;  3EPZ A;  2HNH A;  2LYC A;  2KQR A;  4B43 A;  3OYC A;  2CUZ A;  3OYG A;  2QKM B;  1Z7L A;  2HDW A;  2FUG 2;  2HZD A;  2XF5 A;  3K4N A;  1K6Y A;  2Y0S A;  4HNT A;  2A5W A;  4J00 A;  3BLY A;  1V5G A;  4BJT A;  2V9K A;  2JUG A;  2LOO A;  2DJI A;  3S3M A;  4LIT A;  2W1O A;  2BVM A;  1V5E A;  3LSK A;  2L5Q A;  4F91 B;  4D1Q A;  3DLA A;  2ZFU A;  1J09 A;  2CV1 A;  3S3N A;  2VPL A;  2M4K A;  3VDX A;  3EUH C;  4XLF A;  1DP3 A;  1SAU A;  3OWT A;  4PFO A;  2Z2S B;  2F4I A;  3VSK A;  3OS0 A;  3DTK A;  5HLT A;  2KLO A;  3ZXS A;  3PUB A;  4XKB A;  3OL3 A;  2VL8 A;  2X1E A;  5JHF A;  3HPH A;  4RM3 A;  4EAT A;  2XC7 A;  4PUS A;  4OWR B;  4DBR A;  3RPU D;  3HG9 A;  2HPM A;  4JQF A;  4NNJ A;  2IS4 A;  2MFZ A;  2F6C A;  2CUJ A;  4XN3 A;  4BDZ A;  1PYV A;  4E7L A;  1WJE A;  2VKH A;  2Z16 A;  4XLH A;  1D1B A;  4HNU A;  2DCE A;  2R7R A;  2R7X A;  3AL0 C;  1HA8 A;  3H5A A;  4PSW A;  3DPU A;  3OYI A;  4BE1 A;  3S8P A;  1D1C A;  4LIU A;  3OYL A;  2KDO A;  1WFX A;  4H4K C;  2X1D A;  4DOZ A;  3HKZ A;  2X1C A;  5CKT A;  3N05 A;  4HST A;  1U0J A;  4IQJ A;  3K70 D;  2WAD A;  3BCB A;  4IQ4 A;  3FHN A;  4BQQ A;  3M1C A;  4QPQ A;  4BE0 A;  3QOD A;  3OIP A;  3OYM A;  4YRV A;  4KIS A;  4ZYA A;  5HNH A;  4XKV A;  3FBI B;  4CA0 A;  3L2V A;  2HPI A;  2KRH A;  1SFK A;  2HU9 A;  2ZSI B;  5FRM A;  3E1S A;  4XLA A;  3EUA A;  3SEZ A;  4BS9 A;  4ITV A;  2MYS A;  3I9V 2;  4BGD A;  1D0Y A;  2IS1 A;  4RM2 A;  4F3Q A;  4B48 A;  2CFO A;  3SEQ A;  4CZC A;  2Q1Z B;  2LBF B;  5HNF A;  1ZEL A;  2RQQ A;  4E7Z A;  2R7O A;  3VYU B;  3AL0 B;  2CW7 A;  3QOE A;  2JVH A;  2MC4 A;  1W36 C;  3OYF A;  4ZDO A;  3OR1 C;  4BEH B;  3MKZ A;  2LY1 A;  3NWS A;  1MW7 A;  2VQL A;  1R6R A;  4PK4 A;  4ZDP A;  3H5R A;  4P5O A;  2P0W A;  4BQO A;  2ELJ A;  4XON A;  3IAM 2;  1W36 D;  1BOB A;  3OS1 A;  2IGO A;  4XR6 A;  2BW3 B;  4CCL A;  3H0D A;  2V1N A;  2R7Q A;  3TL4 X;  3W2A A;  3DU6 A;  2KL4 A;  2LBF A;  3CJR B;  1UG0 A;  3DKY A;  3LSG A;  2HVR A;  1UEL B;  4DBQ A;  3M8J A;  3SDB A;  2O5R A;  4CH7 A;  4F93 B;  4PJL A;  4ZC3 A;  2DT7 B;  5FRO A;  4GRI A;  4LIV A;  3ONQ A;  4XKW A;  1D0Z A;  4BEH A;  3DWL E;  3CMM A;  4XN0 A;  4B47 A;  2DT6 A;  4ZTF A;  3D5R C;  2R7S A;  2UWM A;  2K9L A;  2WB1 A;  2MD0 A;  1UAA A;  4XOT A;  2VJ5 A;  4PFP A;  3OYD A;  4BUP A;  2JSP A;  3VYR B;  4XLE A;  3H5N A;  3QYB A;  3BC8 A;  4KJZ A;  2V4J C;  3HUG B;  2QKL B;  1WJC A;  3J7A Y;  2VJI A;  2WY8 Q;  1LVK A;  3HL2 A;  4E7I A;  1X1D A;  2PJR A;  1MNE A;  4YEJ A;  4YEL A;  1OLT A;  3I3L A;  3QYF A;  3S32 A;  2I8D A;  2E1M C;  2F5V A;  3MMY B;  2R7W A;  2L9S A;  3OL4 A;  4Y4R A;  4E4H A;  2M7A A;  1WJ5 A;  3RSN A;  4XNF A;  1WJA A;  1TZL A;  3S3O A;  3D5L A;  2RRE A;  3SZG A;  1MMD A;  3K4B A;  4BQN A;  3RQ4 A;  3HC7 A;  2DXI A;  4ZTJ A;  2LC2 A;  3PFY A;  4D9J A;  3V42 A;  1YX3 A;  2X6X A;  4XOP A;  3CJQ B;  2ZXH A;  1QHH D;  4RLQ A;  3HXL A;  4BU2 A;  3IUO A;  1FMW A;  2VXZ A;  2KMU A;  3FKJ A;  3GBG A;  2M7B A;  3C2H A;  5KNL A;  1X4P A;  4IX7 A;  3L2W A;  1KON A;  2ZSH B;  3KX2 A;  5TGT A;  3HOT A;  3OS2 A;  4PJM A;  1OR7 C;  4ZJZ A;  3H35 A;  4FAS D;  2VJ4 A;  4XMY A;  3PSF A;  4XQF A;  3VYS B;  3PNV A;  4CSW A;  2IGK A;  4CCK A;  2KRC A;  4Y33 A;  2R7U A;  1LFP A;  3ZCO A;  3ZRG A;  3ZR8 X;  2AQE A;  4C2T A;  3LFU A;  3LSI A;  2E1M B;  3K4J A;  2M4G A;  1PJR A;  3FDY A;  2UUZ A;  3PSI A;  1N75 A;  2E60 A;  4NC7 A;  1DQU A;  2R4G A;  3VYT B;  3DU5 A;  4CCJ A;  4AVZ A;  4E7H A;  2CW8 A;  2M3A A;  3LL7 A;  5KHD A;  5KCM A;  4BE2 A;  5FRN A;  2V7F A;  2KP6 A;  1MND A;  1LDK B;  1X1B A;  2VQG A;  3QYE A;  4BL0 B;  2VQH A;  1D0X A;  3CP2 A;  3OYH A;  1P9Q C;  4LG3 A;  4PJN A;  4RLF A;  4N4N B;  2RNG A;  4QPO A;  4HRI A;  3A4C A;  4AU7 A;  4OAZ A;  3TBI A;  2CH0 A;  3L2R A;  3LSM A;  3FBN B;  4ANJ A;  4U7B A;  2K9M A;  4CCM A;  2AQF A;  2KZV A;  1X4O A;  2XDV A;  3RTR A;  2LRD A;  1NG6 A;  2IGN A;  1T0F C;  3DQV C;  4CUG A;  4F55 A;  2LY2 A;  2OV7 A;  4DIQ A;  4NC8 A;  2E5N A;  3PNY A;  2L7K A;  1N78 A;  1EA3 A;  2WAQ A;  3D5S C;  4HSR A;  5CPR B;  2IGM A;  1GLN A;  2W82 A;  1Y56 A;  2KPM A;  3OIQ A;  2VAS A;  4J01 A;  2A6T A;  4XKC A;  1DGW Y;  3U21 A;  3OYK A;  3MKW B;  1YX5 A;  3UNG C;  4N4O B;  2NOJ B;  4RMN A;  2PMZ A;  3BG7 A;  3W2V A;  5CQG A;  1YE9 A;  3KEY A;  2OUM A;  4JOM A;  1VZ0 A;  2MAB A;  3VWB A;  4CCO A;  4OAY A;  3K6G A;  2DOA A;  3H9Q A;  2LRE A;  3F9K A;  3OYA A;  1X19 A;  2BW3 A;  2R7T A;  4R79 A;  3DEE A;  1DGR M;  4B44 A;  4E7S A;  2VB6 A;  3CP8 A;  4II2 A;  2VQC A;  3MKY B;  4FET A;  1WJF A;  3A2K A;  1N77 A;  1MMA A;  4U87 A;  4XM3 A;  4X0G A;  3OYB A;  3MD2 A;  3RCO A;  1AA7 A;  3OR2 C;  2WBM A;  4DGW B;  2HVS A;  1ERD A;  4II3 A;  3NWT A;  3CZ6 A;  4E7K A;  3LMM A;  2X6W A;  1Y6I A;  4KIT B;  4HPQ A;  1BR1 A;  1WJB A;  2GOM A;  2BVL A;  4IZZ A;  4BJ5 C;  1Z3Y A;  2OC6 A;  3HPG A;  3W2W A;  4F92 B;  2GOX B;  4E7J A;  3OYJ A;  1QHG A;  5LFA A;  1JI8 A;  3AFH A;  1BR2 A;  2M0M A;  3PL8 A;  3K4C A;  2L9N A;  2X51 A;  3IP4 B;  3DPT A;  3OYN A;  3A1Y A;  1QU3 A;  2LH9 A;  2IS6 A;  3EUK L;  5LD2 C;  3PJR A;  4IKF A;  2XF7 A;  2X85 A;  4F52 A;  5HVQ C;  1Z21 A;  2CV2 A;  2UV1 A;  2HVQ A;  4PJJ A;  2W7N A;  3H9J A;  3K70 C;  2W00 A;  4XLC A;  3OOU A;  2XAU A;  3CF2 A;  1MMN A;  4G6T B;  2XSJ C;  2K3P A;  3C2G A;  2WAE A;  4NQW B;  3E0J B;  2JA2 A;  2ZXI A;  2Q2E B;  2V26 A;  2HQA A;  4HG2 A;  2WY7 Q;  2WAF A;  3ZQQ A;  3DTI A;  1FMV A;  3G2B A;  1S9H A;  1IRX A;  1X1A A;  2LG4 A;  1WJD A;  1D1A A;  3LSH A;  1X1C A;  3OYE A;  2IS2 A;  4E6K G;  4XL9 A;  3PNT A;  3AKZ A;  2L2O A;  3CES A;  4BAC A;  1LKX A;  3S93 A;  2VXD A;  3L2U A;  2VIX A;  3SYT A;  3VSL A;  3DTE A;  2CS3 A;  1TT0 A;  4C9Y A;  4P1W A;  1BR4 A;  3UR3 C;  4C30 A;  2V6E A;  3BG6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...