1PYVA

Nmr solution structure of the mitochondrial f1b presequence peptide from nicotiana plumbaginifolia
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
53
structure length
53
Chain Sequence
ASRRLLASLLRQSAQRGGGLISRSLGNSIPKSASRASSRASPKGFLLNRAVQY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase beta chain, mitochondrial precursor
publication title NMR solution structure of the mitochondrial F1beta presequence from Nicotiana plumbaginifolia
pubmed doi rcsb
source organism Nicotiana plumbaginifolia
molecule tags Hydrolase
total genus 8
structure length 53
sequence length 53
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2003-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11421 Synthase_beta ATP synthase F1 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.910 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 1pyvA00
1PYVA
chains in the Genus database with same CATH superfamily
4GO1A 2BHYA 4QTRA 3F72A 3E6MA 3E3VA 4MIMA 3J7YJ 3KP6A 3S2HJ 3WTVC 1KYZA 2F4IA 1S8NA 4Q5SF 2H09A 2VJJA 5CVVA 2EFPA 3F6VA 1EJ9A 1HCRA 4A3FJ 1Z3YA 5K1YA 4IHVA 3KYLA 5FKMA 4BBRJ 1X3WB 1GV2A 1AU7A 2NYXA 5E20A 1IW7F 2DA4A 1F36A 5J1UA 2JUCA 1ZQ3P 2L7MP 2Y0MA 4PDKA 4RGSA 3ZPLA 2PMZN 2KP6A 3OIOA 1ZHFA 4BY1J 2OV7A 2CG4A 2HOTA 3IP4B 3GVAA 1UHSA 2JJ7A 4BDZA 2IGOA 4YELA 4A93J 1OCRH 4HNTA 2DA3A 4LG0B 4CYCA 1D8KA 4XKCA 1FTZA 2B0LA 3Q0WA 4NUBA 1BM9A 1IUYA 2ELKA 2E5ZA 1QZYA 3K2AA 2V9KA 3TGNA 2LTPA 3ZXSA 1RR7A 4M9ZA 2NRAC 2BYVE 1CF7A 4A0XA 4HQMA 3MFKA 3F8CA 1TL8A 1OCOH 1SMYF 3BTIA 4B09A 2BW3A 1P4WA 1RIOH 1FYLA 1OYIA 2LKSA 4YIIA 3GO5A 5J1RA 1VF9A 1CGPA 4LK0F 2VBWA 2PMZA 4E7JA 3DTIA 2M87A 5BMZA 2EA2A 3H0DA 2MG4A 5GADJ 4IL6C 5CJ9A 2L02A 1HW1A 3CTAA 3QU3A 2A6HF 3VB2A 3OOPA 2KHMA 2DXIA 4OIQF 1QQIA 2KIMA 2VQLA 5IPAA 3GXOA 2DA1A 2A3SA 3MAJA 2L5QA 1XCVA 2OC6A 1W4MA 2Q1ZB 3HTSB 3OYBA 1K7AA 1MNEA 4Y13A 3H1CA 2ETHA 3CUOA 2VI6A 3S1NJ 1ZELA 4MNUA 2QQ9A 1XD7A 1XDSA 1OPCA 3JRFA 4CCLA 1F9NA 5JFRA 3IAM2 5HDNA 1B72A 2DW4A 3BZCA 4AU7A 3M3YJ 2DMQA 1K6OA 5K7FA 3J7AY 3MEXA 2WA0A 5F1JA 2L3DA 3KP7A 5ILUA 3QWLA 3NAUA 2CSOA 3CJNA 4H4KC 3IV5A 3SFZA 2V6CA 2V1UA 3K4NA 1SD5A 4FX0A 4A3BJ 3HRMA 4KITB 2R7XA 3TO7A 1CF7B 2LSOA 2P6SA 5E1ZB 1ZK8A 1QGPA 2NS7A 4BQOA 1SVLA 2BW3B 1LDKB 2Q8KA 1DQUA 1ORKA 2FSWA 3BPXA 5D5XB 2CFOA 2CV0A 5DD8A 2HPIA 4N4OB 3ROUA 1JGSA 1V54H 2DFHA 3HDDA 1R1UA 4XQFA 3BZ6A 1T6SA 2ZC2A 1FMVA 1ZGAA 3I3LA 3CCMI 3FXLA 1LE8B 4LGWA 3FZVA 3G1LA 4HZFA 4AC0A 4KN4X 4N4NB 4X0GA 4KFCA 3Q3SA 3HG9A 1XC5A 5AIQA 4P9UA 5EGOB 3U1DA 2HWVA 4EEFG 1LVAA 3W2AA 2CS3A 3HOVJ 3JR9A 3OYJA 1DUXC 4IEJA 2ZO4A 3ABMH 3CUQC 1K4TA 4L0ZB 3ABKH 3HSRA 2A05A 1LUJB 2XV4S 2MLGA 1AOYA 1LQ1A 4C30A 2LC2A 4KISA 5DCFA 3VODA 5GTIC 2E1OA 3DBHB 4NC6A 5HS8A 3WHBA 2BGCA 1FC3A 4HPQA 3HTUA 1OCCH 1RRJA 2H8WA 2VE8A 4S05A 1FX7A 1IRXA 3OR2C 4C9YA 1YO5C 1NK3P 2E2JJ 3WE3A 2E1MB 1Q1VA 1EF4A 2JVHA 3SJMA 2E7XA 4F93B 3LFUA 1Y56A 1OCPA 2G7UA 3OS1A 3CC4I 3TBIA 2LD5A 4AVPA 1ETOA 3OL4A 3CCQI 2M5WA 1J75A 2W24A 4Q47A 3OS0A 1XCBA 2YS9A 4RB1A 4ESJA 4MQ9F 1XSDA 3R6SA 2QBYA 3HXLA 2F5FA 3WG7H 4A5NA 4IHWA 3FWEA 1G2HA 2MD0A 1HDPA 2R92J 1UELB 3C18A 1F1ZA 3HSEA 4ZDPA 1XPXA 1ZR2A 2EV5A 4EGYA 3A0HC 4LJZF 2DLLA 3BDDA 4I99C 1U0JA 1JKRC 4EGZA 2NVTJ 3JRGA 2IT0A 3WTYC 1RI7A 4ZYDA 4OAYA 3U1KA 4E7HA 2M0CA 4KMFA 4M3DA 4HBLA 1WH5A 3VWBA 5B66C 2EV6A 3D0SA 1B8IB 1Z91A 3PQJA 3W6KB 4AWXB 2E35A 2ZKZA 2LREA 2W57A 4EATA 4RAFA 4KNYA 5D5VB 2YSRA 4PSWA 1WQ2A 3HM5A 2GXGA 2XKOA 1JKPC 4KDPA 5BOXA 1PP7U 2QKLB 4C3HJ 2OF7A 3G6EI 2MLKA 2VB6A 2QQ8A 3RYPA 3FIWA 1O3RA 2P5LC 1B6AA 1YX5A 4WCGA 3HB9A 2R7FA 5FD5A 3K0LA 1ETXA 3F8FA 3FXMA 2A07F 1TP4A 4EM1A 3IKTA 2XGDA 3QYEA 2KRHA 2VPLA 3ABLH 2JSCA 3A01B 1U2WA 3BCAA 2XPVA 3LMMA 1IO2A 2L4MA 3NARA 5TJJA 3S8PA 5J3LA 5JLWA 1SVMA 2ZSIB 4C3IJ 4O3MA 3RZOJ 1C0WA 2BBYA 2A5YB 3QPTA 1UG0A 3IAS2 5LLQA 4M3FA 1W5CC 1MDMB 3Q9SA 3HJEA 1MJBA 2QA4I 4G6TB 2Q0OA 2QBYB 2DI3A 3OYCA 4M3EA 2HVRA 1W0UA 1TW3A 1EH6A 1WJBA 4UUTA 1JHHA 3TEDA 2M8EA 1ZH5A 3QOEA 1U9NA 1AA7A 2P5VA 5GAEJ 3FBNB 2QEXI 1MSEC 3L2WA 2F4MB 5E8IA 3I64A 1ODDA 2KRFA 1ZGJA 3E6BA 5J6XA 4M72A 4G7HF 1XDUA 4U7DA 3CP2A 2EPFA 4BQAA 2KQRA 4PJNA 4MLOA 2IW5A 2Y0SN 2HU9A 1VQ4I 4ZDOA 3BOQA 2LY1A 3CUQA 5IYDJ 2V1NA 3HGGA 2IA2A 4XN0A 3OYIA 4IXAA 2PX9A 1GVDA 1L3LA 1NG7A 1I27A 5H6RA 2QWWA 2JRTA 3ZQFA 4LMYA 2NOGA 4I0BA 3CCSI 2IJLA 3GUDA 3SEZA 3H3ZA 4R1HA 5A2QZ 2GZWA 1ZARA 1OCZH 2Z2SB 1R5ID 4CCNA 3LAJA 4BE1A 2BE5F 3OSGA 3REOA 4WWCA 4UVBA 1NHAA 3ZCOA 2X6YA 3CDHA 4NNJA 4WX9A 2K5CA 1W7PA 1QNTA 1F43A 5DEQA 1V55H 2VOOA 5LEKA 2L7FP 2VT2A 3AAFA 5M3MJ 3ERMA 2LH9A 1XGNA 1WJFA 2O5RA 1TWHJ 4U0WA 2QSHX 4M74A 1XSXA 2DT7B 2Y0SA 1T95A 3K69A 3FM5A 1IDZA 1TLHB 2KDZA 2YUSA 2BZTA 2FMYA 3CLQA 1IXCA 1UMQA 2R7QA 3FHZA 4A3CJ 2ZJQF 5C4XJ 1R4NB 1X1BA 3PO3J 2BHZA 3RQIA 2QYOA 3DPUA 2EFOA 3GW2A 5LRRA 2XGXA 5D5UB 3L9FA 1HLVA 1A6QA 2X0LA 4KIFA 4WXDA 2CUZA 3JREA 2PJRA 3PJRA 2D2WA 2KZVA 3JAMK 4A3GJ 3KEQA 2WAQA 5FGMA 4GDFA 3S14J 1MD0A 4CZZA 1Z6RA 3V8JA 4OAZA 1J5YA 1G8XA 2MABA 3DKXA 4RBOA 1REPC 1VNDA 3H35A 2M3AA 1Z21A 2K9QA 2EBIA 2VKHA 4KT6A 5BPDA 2COBA 4A69C 3RIRA 2X4HA 1J2XA 5LHIA 1YHQI 3G4SI 4IO9F 3HRSA 3GLXA 4OOIA 1G4DA 2Y75A 2R5YB 3ZQHA 3ZQIA 1ZKGA 4OMZA 2D5VA 3I5UA 2WB1N 1ZTRA 1D3YA 1UZCA 1MMAA 2BV6A 4WXHA 4ASNA 2DDBA 4F52A 2Y2ZA 4XLNF 4MEXF 3JRIA 2UXXA 2X1DA 3K1NA 4MEYF 3A2KA 2BY0A 1WCMJ 1PUEE 2X85A 2EWNA 3KZZA 4AVZA 3K70D 3FK7A 2JQ7A 1N78A 2V79A 3B6AA 3EYIA 4MTDA 1UB9A 1IN4A 1NK2P 4HX7A 4G7ZF 3K4JA 5GP9A 2EK5A 2DFEA 2C6YA 4Y17A 4A2UA 1Z3XA 1UAAA 3H5AA 4EM2A 2VBXA 4EVIA 2KRCA 1VQMI 3NWSA 4GRIA 2HFHA 1MIJA 1J0RA 2CU7A 2GOXB 3FXQA 3HOSA 4EV0A 4E7IA 1YRNB 4M3GA 3BY6A 3FMQA 3M1EA 3VFZA 2MYSA 4ABZA 3MZ8A 2WB1A 4D9JA 2ECBA 3MKWB 4OINF 1S29A 3F8MA 3ESWB 4P1WA 4MFEA 2AS5F 2XRNA 1X58A 1PYVA 2M1BA 4X6AJ 5E3LA 3KE2A 4A3EJ 3HOWJ 1IXRC 4RM3A 4BE0A 3GWZA 2XGEA 5L3GA 2QLZA 1IN5A 3WTSC 3MCZA 1XMKA 5EZGA 5HLGA 2DMUA 5BS6A 2DYRH 2L2OA 3EUKL 4RB3C 2QKMB 2F48A 2L7ZA 2NS8A 5F64A 2IA1A 3PL8A 1GXPA 1X2NA 2P7VB 3G1MA 1R49A 1EH8A 1R7JA 4XORA 3CCVI 4I98B 2R0QC 3QODA 3QP6A 2Z16A 5FRMA 4B8XA 3QYFA 1T33A 5CQGA 4AIKA 1HF0A 3M07A 3LFKA 4RB2C 3CMYA 2D1VA 2IS1A 3IWFA 1X4OA 2ZFWA 4L18B 2G9WA 4PJLA 4RGUA 4JOMA 4II2A 2A68F 3L7WA 2DJIA 2I8DA 4P5OA 2PI0A 2R3SA 3M8EA 4BJ5C 2H6CA 3DEEA 4ENKA 3ASNH 2OZUA 3GEZA 5E8GA 2JA5J 1MJ9A 1RETA 1HKSA 1ON2A 4RLQA 2CV1A 1USTA 4PFPA 1SFOJ 5HS7A 1RNLA 5D4SA 4Q48A 2MFZA 2KJCA 1V5FA 4HNVA 3K6GA 2E7WA 1KQ0A 4BHPA 3OOUA 3TP0A 4UVAA 1KYWA 2O8KA 2EFNA 3DXJF 4A3JJ 2FQ3A 2A69F 5CKTA 1X1PA 2WV1A 4DIQA 1QO0D 5EYRA 4XLCA 1IV8A 2ADUA 2OZ6A 1UCRA 3CJRB 5HOOA 3L00A 5F08A 4D5CA 2WC2A 1FJLA 4UNOA 5H6QA 5HODA 1SD4A 4UV8A 3WGGA 3JTHA 1W1WE 2XSDC 5JVGF 2DFFA 3G3ZA 1Z0XA 4XN3A 2K9NA 1J09A 3TOBA 1R9TJ 2RQPA 5B1AH 1OMIA 4HW0A 3E7LA 2M4KA 2LVSA 1X3UA 2CFXA 1OYYA 4KICA 2FOKA 3FK6A 3GF2A 5J8FA 3P5JA 5D4RA 1V4RA 2WV0A 2ZSHB 5EDNA 4RDUA 2J5PA 2O7OA 5E3OA 2DMNA 2HYJA 3P9IA 4A6EA 1P92A 4U0YA 5E79C 1PUFB 5LGTA 1ZYRF 2BVMA 3KP2A 3BJOA 3OSFA 3GZNB 2L01A 2KZGA 4I01A 1D0ZA 2XPUA 3OMYA 5H20A 3P9KA 1DP3A 4YFKF 1CQTA 3B02A 2EIJH 1Y39A 4CUGA 3ZQCA 1FIAA 2XF7A 2FX0A 4XLPF 1JJ6C 3TW7A 4A3DJ 5HNHA 3FXOA 4NQWB 2E1MC 5IYCJ 3G73A 3HPGA 1E0EA 1D1BA 3TDUC 3S2DJ 2VL8A 1FY7A 3H5RA 4KYWA 1HSJA 3SZPA 2H27A 5C3EJ 3KP4A 1YIOA 5LGNA 2HTJA 1DDNA 4UUVA 4BQQA 4ETSA 1E2XA 5EJCA 2R7TA 1GVJA 5F0CA 1MMGA 1B1BA 3SYTA 5GAHJ 4DYRA 4C2TA 2R7SA 4A5MA 2NS0A 1IN7A 3DV8A 2TCTA 4UVCA 3CCUI 3J7ZI 1VQ8I 3HGYA 1QRYA 3ECOA 2HEOA 2DTZA 3LSJA 1MSFC 1NH3A 1BI0A 1IXSB 1LFPA 3JTGA 5FB2A 2RREA 2E60A 2V26A 1Z05A 3MVPA 4S0HB 5KNLA 2CUFA 2HYFA 1U5TC 1WHUA 5J4YA 3BG9A 3FKIJ 5HLHA 5J8CA 1VQLI 3AG1H 3RYRA 2HQ5A 2EA4A 3RPUA 2VKVA 4XLEA 4CCJA 1MBEA 4J19A 2XAHA 1Z6TA 4XRMA 1DGRM 4G6DA 1K4SA 2Y30A 4JX5A 4QLCU 3CZ6A 3DTEA 4MHGA 1BIBA 1TWAJ 4EMSA 1RUOA 3BR3A 3KIOA 3GX4X 4U88A 1R71A 4E7LA 4L5EA 5CLSA 1TW2A 2IXSA 5GPCA 3PUFA 3J7AO 1IRFA 1DGWY 1R00A 3L1PA 3JRBA 2P8TA 1IJWC 2ZCWA 1TWFJ 3S3MA 1R36A 3K4MA 3FKJA 2HKXA 5ILVA 5ICCA 2YPRA 3IWZA 4GCVA 4N9IA 5B5EC 1QPIA 4ZZDA 1X1AA 3TO6A 3J80K 3BQYA 2L0KA 4BEHB 3ZN1A 3C2GA 4LK1F 3H3VK 3HHGA 3CCJI 3O2PE 4BQNA 2N8GA 1I1SA 1LE8A 2LF8A 4S04A 1R58A 3DPLC 1O57A 4K2EA 4N0BA 4L9JA 5B3SH 4YFXF 2P6TA 1XX5A 1TQMA 3FBIB 5EGOA 4IQJA 2VJ4A 2BXZA 1HA8A 2O0YA 2BY1A 1RZ4A 2LFBA 4E70A 4QPOA 5FLMJ 2E1NA 2Y69H 2UV1A 2L9RA 5BQTA 4LIVA 3OIPA 3CD6I 3A02A 4HF1A 4OIOF 3KYCB 3M9AA 5ICGA 2KLOA 4ENJA 3KLOA 2DJNA 4A6DA 1U9OA 5CVUA 2LDUA 2K9SA 3F8NA 5M5YJ 1QVUA 3IKVA 4XMYA 2ZXJA 1FZPB 4JYKA 1ACIA 3TP3A 3C2HA 3LA3A 2Z5UA 2R7DA 3DKWA 2TRTA 4GGGA 4BBSJ 3HKZN 4NC7A 4RAZA 2ZBKA 2GQQA 4XBFA 5ICEA 1W36C 4UUSB 2M7BA 1OISA 4U0VA 3JRHA 3T1BA 1AHDP 4G8XA 2AQFA 1Z77A 2UXNA 1ITYA 1HQCA 3HHHA 2DT5A 2K3FA 3GTJJ 4KMUX 4IOAF 5IP6A 2CJJA 4J01A 2EZHA 3ZMZA 3MZHA 5ED4A 1RPWA 1DU6A 3DBLB 5LHHA 1O3SA 2EZIA 3DLAA 3WU2C 1ERDA 3F21A 3D5LA 3HPHA 3F23A 4BS9A 5K5RA 3DEWA 4Y3OA 1ULYA 2IRFG 2HOAA 3PIOF 3KETA 1JKQC 2FOWA 3EUAA 2GXBA 3EYYA 2OCEA 2IS2A 3I59B 2FQ4A 4BXFA 3IL2A 3RKYA 4F3QA 3CF2A 3EQLF 1U5TA 3FXRA 2O61A 5D6FA 5DCMB 5JVTA 3Q9VA 3BTJA 3HKZA 4PUSA 2NVQJ 4LB6B 3N97A 1A6IA 1OCTC 2K3PA 3E97A 1JUSA 4U87A 1B8IA 2PEXA 5L3CA 3QRFF 1B59A 1QVTA 4FQGA 4I7HA 2VUMJ 4DGWB 2IA0A 5FKOA 1PVEA 1IRZA 2CW0F 5IYBJ 1HKTA 5HVQC 3WTTC 1BJZA 1ZG5A 4ZDLA 3W2WA 1IN6A 2RKHA 2XAJA 5FFXA 2X6OA 3U21A 5FKNA 3PNYA 1IF1A 1KU3A 3H9QA 3S15J 2JTVA 2QQBA 4W1UA 1S72I 3A01A 4V19K 1YW7A 3BR6A 3T8TA 2VBYA 2X9DA 1V3FA 1H9GA 2ZXIA 5CPRB 3ZQLA 5LFAA 1MGTA 4DQ2A 1FTTA 1P4XA 4M73A 3SDGA 3HZJA 1MDMA 1TT5B 1B4AA 2KMUA 3O8GA 1H88C 1BOAA 1EV7A 2CW7A 2NVYJ 1SD6A 4YFNF 2ME6A 1RKTA 2XDVA 2F5DA 2DK8A 5E1WA 1VQ9I 3BWGA 4ITVA 2X48A 1D1CA 3WU0A 2W4SA 4C2MJ 2PMUA 1TWGJ 2NAZA 3VOEA 1SAXA 3V7CA 2HZTA 1U5TB 5D8LB 3M4OJ 1X4PA 4HF2A 1Z1DA 2FEZA 1MH3A 1P6RA 1UFMA 1N25A 3M1CA 2XPWA 2X6WA 2CO5A 2FF4A 3RJPA 3GZ6A 1ENHA 4ENNA 3BQZA 3TOAA 3JSOA 1IV6A 4BH9A 4HF0A 1KU9A 4AYBA 1DPUA 1I6HJ 2YR2A 1IDYA 5FROA 2FMLA 2M4GA 1ON1A 3QPLA 3E6CC 2R7UA 1B9MA 3GZ5A 4P9FA 3OR1C 3UNGC 4I76A 3WTWC 1OQYA 1KU7A 4L9TA 2KKOA 2IS4A 3DU5A 3FX3A 5F04A 2VQCA 3OWTA 2YU9J 1ZLJA 4XM3A 1MBFA 3VYUB 2NVUB 5FLXK 3EPZA 5JR3A 4YIRX 5KCMA 3IH4A 5LD2C 4G9YA 4LFUA 1O4XA 2I10A 3CC7I 3JRAA 4PZJA 1SANA 1P7JA 1JT6A 1G3WA 4FX4A 2FUG2 3MKYB 4BY7J 1LNWA 2PN6A 1S7EA 3H0GJ 4B1RA 4UY8I 2QSFX 3BR1A 3E5QA 4DYCA 5DDGA 1M1EB 1BOBA 2XIGA 3C1DA 2LR8A 2EJRA 1UHMA 3JAMZ 2GA2A 2V6EA 1FBUA 2DQLA 2FRHA 3OY9A 1S5LC 2PG4A 3K4LA 1LFUP 3W6JB 1K78B 1LEBA 3VYSB 4GYGA 4D0PA 3PM1A 4FE7A 4CSWA 1YE9A 3Q0UA 4IVNA 2DTRA 3BR2A 3RKXA 4CYDA 4ENMA 3MQ0A 2XB0X 2K4JA 2RNJA 3RZDJ 2JRMA 1T39A 2XAGA 1FMWA 2ZFUA 4HOBA 1IUFA 3BJ6A 3M7GA 4Y52J 3BTLA 2GOMA 2VPRA 2IEKA 1VFCA 2R5YA 2DA6A 2HNHA 2DQRA 5GPAA 4ZYEA 2XUBA 1OFCX 3CQZJ 4PJ0C 4XR6A 3J81Z 3A0BC 5GAGJ 4DOZA 3VSLA 4BJ6C 4BDYA 2OJED 2V7FA 4IPAA 1A5JA 2WAQN 2DDAA 2MC3A 4BHCA 2XHKA 2A6TA 3S2WA 4ZH4F 5IP9J 1VQOI 2R5ZB 2B9SA 3PSIA 1H8AC 4CH7A 4QWQA 1JT0A 4DBRA 4F55A 2STWA 5FKKA 3UR3C 3E6DA 3OIQA 3LA2A 1YW8A 3MD2A 2QENA 4LOCA 3BCBA 4DBQA 4IQ4A 2PQ8A 4EJWA 1ZR4A 3PSFA 2ID6A 2X51A 4RGXA 2ME0A 5KAFC 3ELKA 1YRNA 2IS6A 4IKFA 4Y33A 5K5OA 3CJQB 2M34A 2RV8A 5FKLA 5IT3A 3I9V2 1QU3A 3HRUA 4BHBA 5F1RA 5K5QA 1PJRA 2VASA 1SVOA 1FWZA 4KIBA 1PDNC 1V5GA 3N4MA 3AG4H 3BZKA 2HS5A 3CO7C 4BAYA 5LEJA 3OYGA 4AIJA 3S3OA 5ERIA 1FBQA 5DD4A 3SFIA 2FNPA 2EB7A 1LPQA 3IH2A 2XF5A 1FT9A 2HQRA 2VODA 3ABTA 4CDGA 3NWTA 4XONA 4B4CA 4CCKA 2GA1A 5L3BA 2L9VA 3ZQGA 3K2ZA 3COAC 3LSRA 2JN6A 2BXYA 2K85A 3S1QJ 5JI6A 1GXQA 9ANTA 1R1VA 4NBQA 5FD6A 1G6NA 3K7AJ 4IHSA 2W84A 3FISA 3CDIA 3GTGJ 1YYVA 2RC4A 2MH9A 2XVCA 3ZQ7A 3RTRA 1KA8A 4HDVA 4ON0A 3J81K 3LSHA 1F4KA 5KAIC 1JI8A 4CCOA 2O8XA 3WGHA 3VEPA 2MD5A 3NQOA 2CV2A 4AD9A 1QBJA 4XIDA 2ACJA 1BR4A 2XAUA 3BR5A 4LIUA 2WY7Q 1N75A 2WADA 1STZA 1YITI 5DV5A 3BG6A 4KUMA 3AG2H 3WG9A 4IJAA 4EQQA 3IUOA 1UJ8A 3DBRB 4RB0A 3WODF 1DPRA 2XC7A 4MFDA 3F3XA 1Z7LA 5TGTA 4A0YA 3L09A 3MKLA 2V9PA 4A12A 1FYKA 2GLOA 2DMPA 3C7JA 4W97A 2LG4A 4ZYAA 3CJTB 3QOPA 1QPMA 2KJBA 2E1CA 4XNFA 1T0FC 1LB2A 2P5KA 4Y15A 5FRNA 1WRJA 1WZ2A 1VQKI 1JUMA 2R7VA 1PP8F 2M7AA 2F4OB 2VLAA 3MN2A 2ELHA 1YJWI 2CRGA 4IZZA 3RPQA 2LY2A 2MA3A 2LMDA 1TQIA 2RNGA 5LGUA 4L0YB 1G3YA 1XTAA 1T56A 4B47A 1GV5A 1SFXA 2K9LA 3ZMDA 2ESHA 3G1OA 1Y0NA 4O5VA 5M5XJ 1OR7C 1FOXA 4L5JA 2I5UA 2AO9A 4E6KG 2YX4A 4QIWN 3M8FA 3HBLA 3I4MJ 5IOYA 2XF6A 2ELJA 5KVRA 1DP7P 3I4NJ 3M8JA 5JHFA 3ULQB 1XN7A 1AKHA 1XMAA 2WTEA 2W48A 4XSXF 2AXTC 4YRVA 4JK1X 1FLIA 1B9NA 2VN2A 5F27A 4AUXA 1RKWA 3IC7A 1QZZA 3H9JA 5TISC 1RC9A 2GBYA 3S32A 1HKQA 3H36A 3T0YA 4NHJA 2F2EA 4ZYHA 5JHUA 1W5SA 3A1YA 1XGMA 3CO6C 1FOWA 2OQRA 3I4PA 4HLXA 4BE2A 1Z9CA 2RQQA 2M8GX 2V1XA 2PLYA 1D5VA 3DFGA 1YIJI 1USSA 2EFQA 1J9IA 3LOCA 5KK1A 3HYIA 1NTCA 2QUFA 4KT5C 3WU1B 1FP2A 5HNFA 1PUFA 3QPHA 3OYKA 2DAOA 3ABUA 5HS9A 2XRLA 2O9LA 3P9CA 3JRCA 1V5EA 4M9XA 2VQGA 5F0FA 5EG0B 4BACA 4QSHA 3H5NA 4NQWA 4BYYA 4Y4RA 1W0TA 3S16J 1LEAA 1N77A 5FFZA 3CP8A 2DA2A 3NEUA 1TWCJ 2QF7A 3I54A 2QSGX 2HKOA 4WXCA 4AIHA 2EFWA 2ZMEB 2VONA 5D5WB 4U7BA 1YG2A 3GLLA 4LD5A 2XB5A 2WY8Q 3TW6A 2K86A 2O3FA 3O8HA 3AG3H 4BJTA 2VKEA 1E3PA 2UZKA 1BI3A 2IPQX 5J47A 2VE9A 2JA8J 4KIGA 4BXXJ 4J00A 1BW5A 1MNMC 2XAFA 4EJTA 1AKHB 3ASOH 2K4BA 1FPQA 1MMNA 2OBPA 3K9TA 4M6XA 1G59A 3DCFA 5HLTA 5C4JJ 2DCEA 2CWEA 3QQAA 1K79A 2FXAA 2VXDA 2LBFB 3SEQA 1U78A 4DNCA 1IGNA 1WFXA 3MMYB 3K70C 3RQ4A 3K10A 2PMHA 3FXJA 1HC8A 3FMSA 4I09A 5K7ZA 4IHTA 4OMYA 5L3DA 3S93A 1FIPA 2IVMA 2H8RA 1K6YA 2LLKA 4XLFA 1T08B 3P7NA 2YU3A 3K4CA 5DYMA 4GXOA 1BI2A 1WJAA 4P96A 2IGNA 2CMPA 4MGRA 1L0OC 2Q2EA 1XMXA 2LRDA 3T8RA 4IOCF 3K4BA 4FCYA 1ETVA 4R79A 3CMMA 2DN0A 5E3NA 4FISA 1TQPA 1Y8QB 1AWCA 4EJOA 3E5UA 2HPMA 2XSJC 4HLYA 2R7OA 2DPDA 3R0JA 3OYNA 4XRSA 5H2FC 5HDGA 1MMSA 2CW8A 3AKZA 2X1CA 2UWMA 4F92B 3JCUC 3J80Z 4B43A 1OR7A 4BGDA 1R6RA 4BEHA 3X2QH 2KIFA 3WE2A 2HTSA 1LJ9A 3GTKJ 2OA4A 4ZTFA 1WKMA 2BY2A 1T38A 2VKDA 3ZMUA 3HOXJ 2EILH 5LRSA 3F0CA 4HYEA 1FYMA 2DOAA 2E2IJ 2FE3A 4FTHA 4L9NA 1Z67A 2EIKH 5EEGA 2ESNA 2LKPA 2KDOA 1UHWA 2R7WA 2X6XA 2CQQA 4OU0A 1YJ9I 4FETA 2EH3A 2H94A 5KHDA 2ZNZA 5DS9A 4BKXA 5M5WJ 1FEXA 1Y1VJ 5IT9K 3JSPA 1MBKA 1SFKA 2F6CA 3CESA 4XKBA 2XAQA 3GTLJ 4V2FA 1IAWA 1MBGA 1OYWA 2DOEA 2GIZA 1JJ8C 2Q2EB 3I55I 2DFIA 4D7MA 2LF7A 4ESBA 4MQVA 1GUUA 3PFYA 4ZZLA 2M45A 3H3UA 1FOYA 1A31A 2VIXA 4UUSA 1WGXA 3R4KA 1ZLKA 2ID3A 4CGZA 4F91B 3OYDA 1GHCA 2Y9ZA 2QCOA 3HIFA 3CCLI 4CCMA 2HQNA 3A4CA 2JPBA 4XOTA 1R5HA 3GYHX 2JK3A 5D8KB 1KONA 2ICWG 4LLNA 1S7AA 2A61A 3AFHA 2E71A 4D7NA 1HW2A 4AM3A 3OL3A 3HOZJ 5DUIA 2FBKA 2P81A 2GXAA 1W7PD 2VXZA 3GTMJ 1LVKA 4KN7X 4XKWA 1VI0A 3CMAI 1FSHA 1MJAA 3C2BA 2JZYA 3HOUJ 4LB5A 3OYEA 3I59A 4GFBA 2RDPA 1T2KA 2RGVA 3DEUA 4FE4A 2V4JC 4HA8A 5DCMA 1YOVB 2DOFA 1WI9A 5CVIA 4G12A 3LNQA 3VPRA 3AL0B 1LDDA 2HZDA 3ML6A 2HDWA 2OUMA 3FXKA 2GM4A 2H1LA 3Q0VA 2LY9A 3ZQQA 3B73A 5HDKA 5BPIA 1VQ5I 1SD7A 1S3JA 3PO2J 1RUNA 1BN5A 2JA2A 1MW7A 2CUEA 4ZJZA 1IZ1A 1R5GA 1Z7UA 4YEJA 1XGSA 4H0EA 5K7HA 2COMA 1RR8C 2ZNYA 3R0AA 1R1TA 3K4KA 2QZ8A 1JXSA 2AHQA 2VC0A 3FMRA 1ZG1A 3LQRA 3KP5A 4Z2YA 3DKYA 3TL4X 1R22A 2KIUA 2ZJRF 5DUKA 5E3MA 2DT6A 4FHTA 3ZMVA 3H92A 3D5RC 2JSPA 5DTDA 4UHTA 4D5FA 5J4VA 1IN8A 4DZJA 1YFHA 2WAEA 2STTA 3BJAA 1W5TA 1RESA 3V8LA 1TNTA 1Y6IA 2V9VA 4PSXA 1IG7A 1K83J 2B63J 4CYCB 4NC8A 4M6YA 3W2VA 3BPVA 2IGKA 4PJMA 2B7EA 2OU2A 3EUHC 1WJEA 3GTPJ 2CQNA 3OS2A 1OKRA 2IGMA 3IRQA 3PNTA 2RN7A 3LL7A 2HR3A 3WTXC 1X3ZB 4EJUA 3LQQA 2JWTA 3UKGA 4RGRA 3CF5F 2PBIA 3BTCA 3E1SA 2MBFA 4M6VA 3ZRGA 1F5TA 1I50J 3I53A 1FSEA 3CLOA 3U9GA 2J5OA 1LKXA 1FNNA 5CVJA 2AXLA 3KLNA 3E0JB 4CO8A 4V2GA 4ZC3A 3QYBA 1QZEA 1J59A 4KJZA 2WBMA 3V42A 4HX8A 2E2HJ 3KP3A 3LWFA 2WWYA 1D0XA 2HDDA 1NG6A 3IRRA 3ZOBA 2EQRA 2FBHA 2E36A 5FLXZ 2ZXHA 1JTXA 3WHCA 2JA7J 2WAFA 1YW9A 2O03A 2L4AA 3KEYA 2AQEA 4Y7NJ 6PAXA 3RDIA 2R93J 2M2EA 3V8KA 2EIMH 1B72B 3OYFA 4A3LJ 3FM3A 3A03A 4AYBN 1SAUA 4E7SA 4BU2A 4EJVA 4CXFA 4I2OA 1S7OA 3T5XA 3SZTA 3KYDB 4BUPA 1ONVA 2L7KA 3GTOJ 3WTUC 3FF5A 4II3A 1JGGA 1HDDC 1A36A 2BVLA 2DA7A 5LBQA 4UXNA 4EM0B 3RKWA 2HOSA 4ANJA 1TT0A 5ILSA 2W82A 2IAIA 4RAYA 1E3OC 1YQAA 3JRDA 1QHHD 1H89C 4PK4A 1Y0UA 3V4GA 1K78A 2RVCA 2X1EA 3PQKA 5E17F 1BC8C 1MMDA 2VT3A 2OTJI 2Z1DA 4BNCA 4A0ZA 3HL2A 2EZKA 4CA0A 2CYYA 4RM2A 2ZJPF 1G3TA 3HEFA 4M3BA 4XLAA 1GT0C 2HVSA 2EV0A 2JUGA 3EDPA 2VBZA 4Z6YA 3LAPA 5CYVA 1U3EM 4WK8F 1ETKA 4HV5A 1T98A 4WF2A 5JLXA 4PGGA 2VOPA 1SEUA 2KT0A 4IHXA 4B3XA 2KL4A 1Y1WJ 4L5IA 2XROA 4GYIA 3Q5FA 1KQ8A 1TZLA 2ZXWH 2JT1A 3FXUA 2K7LA 3DPTA 1I3AA 3F8BA 2R5ZA 3WTZA 4RAGA 3NRVA 1ETYA 3LSPA 5B1BH 1ZRDA 3KZIC 4HG2A 3PIPF 2Z9OA 3BP8A 3BG7A 5AIPA 1WJCA 4BL0B 3BR0A 3D1NI 1ZG3A 4B44A 1HSTA 2HI3A 2JPCA 2Y31A 1FOKA 1I1GA 1O7LA 4XL9A 3MKZA 3ECHA 4FASD 1ZN2A 1R23A 2KISA 3WGIA 4LITA 2MC4A 1ZAOA 2VJ5A 3EUHA 2BY3A 4IF4A 3BLYA 2DYSH 2M9HA 4ZTJA 3DLLF 3ZMTA 3TDZC 3TKYA 1WI3A 2RAEA 3LSGA 3SQNA 1BA5A 4RLFA 1OLTA 4F7ZA 3W3CA 4G94A 3IH3A 4E7KA 4NB5A 4N9HA 5IY5H 2Z3YA 1H0MA 1A04A 4JP0A 1P2FA 4UV9A 4IRIA 2ZMEC 3H9GA 3N05A 4I0AA 3W6VA 3B6CA 2W00A 3L2RA 2W7NA 2H6BA 2DBBA 2QVOA 2OPTA 1R4MB 1KGSA 2BOLA 5F0HA 1SFEA 2UUZA 4LLLA 1APLC 1E17A 1S6LA 3JW4A 3QP5A 3RKQA 2DK5A 1J7KA 2E5NA 4PCQA 3SDBA 4DZPA 1BW6A 2EZLA 2H1KA 1I3QJ 5IOZA 2Y48A 3C3WA 5E18F 1WPKA 4XOPA 3F22A 3CCRI 1SFUA 1JKOC 1EA3A 2HGCA 5FLVA 2LYCA 3ZGKA 1G3SA 1HOMA 3KEOA 5EF6A 1MBJA 4UB8C 3D5SC 3E5XA 4B3AA 4E7ZA 2M0MA 1FBSA 2HXIA 2LP0A 4HX4A 3KFWX 4E4HA 2ZB9A 4PJJA 2XGCA 1O3TA 4UB6C 1X2MA 1XGOA 1XG1A 2HYGD 3G71I 1YS7A 2LK2A 1ETQA 5E1XA 5DM7F 2NNNA 1IRGA 4HQEA 1LDJA 1X1CA 3O6BB 5TRDA 1U8BA 2DPUA 1K61A 5J40A 1KZHA 2QM3A 4X1EA 3GFMA 3I71A 3ISPA 5J1YA 5CVRA 3ZP5A 2MSYA 4HSTA 5M3FJ 1BR1A 4XK4A 2YX7A 3RPUD 3DTKA 2OAZA 1BR2A 3HUGA 4KA4A 1JUPA 1U8RA 1U6GA 1D1AA 2KIQA 3L2CA 4DW6A 4IX7A 4C3JJ 5GTHC 4RMNA 4JX4A 3CCYA 3VYRB 3S1MJ 1ETWA 2R4GA 5ICFA 1JHFA 1BBYA 2K40A 3LSKA 1EH7A 1BIAA 4IRHA 1LFBA 2D45A 2VQHA 3FDYA 3OV8A 2F5CA 3CC2I 2ISZA 5L3EA 4OIPF 2A5WA 4CICA 4YIFA 1P7IA 2DMTA 3OYHA 2E19A 3QU6A 1VQ7I 3RSNA 3CUQB 3LSMA 1SC7A 3TO9A 1VTNC 1X19A 2QGUA 2K9MA 2QQAA 2W25A 4HDUA 3ZN0A 1WSUA 2Y9YA 3GFLA 2P7CB 1YTYA 1TNSA 1XB4A 4RA2A 1POGA 2CQKA 5IP7J 4I02A 4HRIA 3HC7A 1VQNI 3BT9A 3LSIA 2GAUA 2LOOA 1KU2A 5A2QK 5LHGA 1IC8A 1YLFA 2DO7A 1X1DA 2HVQA 4OIRF 1W7PB 2DODA 3F6OA 5EZHA 1D8JA 1T8IA 3OYLA 4XICA 1ZRCA 3LA7A 4XKVA 3V7RA 5EG0A 1O3QA 2FD5A 1QHGA 3TMOA 2PFBA 3V7SA 4HNUA 4L9VA 3HUGB 2D1HA 3IHUA 2XASA 2ZMEA 3RCOA 2ECCA 5L3FA 2O6GE 4G6QA 2OCCH 4MO7A 2MGQA 1MNDA 3CCEI 1VQPI 3PFIA 2NVXJ 2L9SA 3HOYJ 3OYAA 1I5ZA 4JX6A 2K27A 2F5EA 2FBIA 4M9SA 3K1PA 4TV7A 5EEHA 2PJRB 4DJAA 4G7OF 3MWMA 2FU4A 1HXDA 3S3NA 2PJPA 1BI1A 1WWXA 3VDXA 2VJIA 1MBHA 4I6ZA 3I58A 2K02A 3KX2A 3HSFA 2LNBA 4D1QA 2IP2A 2NNYA 1H9TA 2HOEA 4LG3A 2LBFA 1JE8A 2BEOA 1HW5A 3I0TA 2A6EF 2V1DA 3BG3A 1TTYA 3AL0C 5BNGA 3GFJA 1YX3A 4DYQA 2CGPA 2L9NA 2Z33A 2DA5A 1XS9A 2GIVA 2CQXA 1TBXA 3SXYA 2M30A 4MTEA 5FJ8J 3HRTA 4XLHA 2FNAA 1A35A 2KFDA 3GCMA 4HSRA 1WJ5A 1D5YA 3KCCA 4P55A 4HV6A 1MKMA 3VYTB 1P9QC 1TC3C 4IRGA 4HEA2 3GTQJ 2JA6J 4XRFA 2FA5A 3S17J 5AONA 2XKPA 1WJDA 3SZGA 1OJLA 1BJAA 1MH4A 2KPMA 4C2UA 2R7ZJ 2EINH 1KQ9A 3GFIA 1D0YA 2HDCA 2OQGA 3DQVC 5FO5A 4AIDA 3LSTA 4A3IJ 3PUBA 5C44J 1GDTA 3R61A 1YJNI 3L2VA 2LKXA 1O7FA 1FP1D 1WVRA 2L54A 5F6FA 1Q1HA 3RI4A 3KZYA 5EEAA 3I56I 4A3MJ 1I6XA 4PGHA 4OWRB 1JTYA 1E3HA 2ISYA 2ZJ2A 4PFOA 4XSZF 3BC8A 3DU6A 5HLIA 1BC7C 2HXOA 3GMEA 4ZYGA 2W1OA 3TQNA 4LLGF 2OD5A 2CUJA 5IT9Z 3CMEI 3MZYA 3HOTA 4O6JA 4YG2F 3PNVA 3R60A 3CDLA 1ZGWA 1HBXG 3DF8A 3VSKA 4XRSG 2R7RA 3OYMA 4CZCA 2W85A 5DM6F 2TDXA 4R8HA 2CH0A 1MZBA 2E34A 5CQEA 4JBAA 3BG5A 2F5VA 1T0FA 3ZR8X 4CHUA 2CQ7A 4B48A 4FT8A 1I39A 2P0WA 3BROA 4RS8A 3ZMSA 1ZRFA 1P4AA 1EKEA 3SHFA 1GLNA 4JQFA 3QPSA 1QA6A 3S1RJ 2HQAA 4HAMA 1YS6A 2P4WA 3QAHA 2JMWA 2IBDA 1DU0A 3G2BA 3F9KA 5D6EA 4A3KJ 3ONQA 3O3KA 1S9HA 2G0EA 4LG0A 1YI2I 2JVGA 3EETA 4NDLA 3U2RA 2VC1A 1SMTA 1VZ0A 2DU9A 4QPQA 2NOJB 2GWRA 3L2QA 4Q4ZF 1W36D 2FJ1A 3DP7A 2G7HA 1XSVA 1BL0A 4ESFA 1ZREA 3KPHA 3ERED 4M71A 3DWLE 2NXNB 3GBGA 4IHYA 2OTLI 1WH7A 1VQ6I 3L2UA 2Z99A 2MH2A 3K1MA 3FHNA 1UG2A 4BXUA 2MW8A 1Y8RB
chains in the Genus database with same CATH topology
1LKXA 2L2OA 2GOMA 3EUKL 2HNHA 2QKMB 2F4IA 3E0JB 3PL8A 4XR6A 4DOZA 4ZC3A 3QYBA 3VSLA 2VJJA 4KJZA 2WBMA 2V7FA 4BJ6C 4BDYA 3V42A 4XORA 1D0XA 2A6TA 1NG6A 1Z3YA 3KYLA 3QODA 2ZXHA 3PSIA 4CH7A 2WAFA 2Z16A 4DBRA 4F55A 5FRMA 3KEYA 2AQEA 3QYFA 5CQGA 3UR3C 3OIQA 2KP6A 2IS1A 3OYFA 2OV7A 1X4OA 3IP4B 3MD2A 1SAUA 3BCBA 4E7SA 4BU2A 4DBQA 4IQ4A 4PJLA 4JOMA 4II2A 4BDZA 4BUPA 2DJIA 2IGOA 4YELA 2L7KA 3PSFA 2I8DA 4P5OA 2X51A 4II3A 4HNTA 4BJ5C 3DEEA 2BVLA 2IS6A 4XKCA 4IKFA 4Y33A 3CJQB 4ANJA 4NUBA 1TT0A 4RLQA 2CV1A 2E5ZA 2W82A 2V9KA 3I9V2 4PFPA 3ZXSA 1QU3A 1PJRA 2VASA 1V5GA 1QHHD 2MFZA 1V5FA 4PK4A 3OYGA 3K6GA 2BW3A 3S3OA 2X1EA 1MMDA 2Z1DA 3OOUA 3HL2A 2XF5A 4CA0A 4RM2A 5CKTA 2PMZA 4E7JA 3NWTA 3DTIA 4XONA 4CCKA 4DIQA 4XLCA 4XLAA 3H0DA 2HVSA 2JUGA 3CJRB 5HOOA 3RTRA 4B3XA 2KL4A 3LSHA 2KHMA 4XN3A 2DXIA 1JI8A 2VQLA 1TZLA 1J09A 4CCOA 2L5QA 3DPTA 2Q1ZB 2OC6A 3OYBA 2CV2A 2M4KA 1MNEA 1BR4A 2XAUA 4LIUA 1ZELA 2WY7Q 1N75A 4HG2A 4CCLA 2WADA 2ZSHB 1WJCA 3BG7A 3IAM2 4BL0B 3BG6A 4AU7A 4B44A 3J7AY 3IUOA 2WA0A 3MKZA 4XL9A 4H4KC 4FASD 2BVMA 2XC7A 1Z7LA 5TGTA 3K4NA 2MC4A 4LITA 1D0ZA 2VJ5A 3OMYA 1DP3A 3BLYA 4ZTJA 4CUGA 2LG4A 4ZYAA 2XF7A 4XNFA 4KITB 1T0FC 2R7XA 5HNHA 4NQWB 3LSGA 5FRNA 2E1MC 3HPGA 1E0EA 1D1BA 2VL8A 3H5RA 4RLFA 1OLTA 2M7AA 4BQOA 3W3CA 2R7VA 2VLAA 2BW3B 1LDKB 4E7KA 4IZZA 2LY2A 1DQUA 2RNGA 2CV0A 4BQQA 2CFOA 2HPIA 4N4OB 2R7TA 4B47A 1MMGA 3H9GA 3N05A 2K9LA 3SYTA 4C2TA 2R7SA 4XQFA 3L2RA 2W00A 1OR7C 2W7NA 3I3LA 1FMVA 4E6KG 2XF6A 2ELJA 2BOLA 2UUZA 3M8JA 5JHFA 1LFPA 4N4NB 4X0GA 3HG9A 4YRVA 2E5NA 2RREA 2E60A 2V26A 3H9JA 3SDBA 5KNLA 3W2AA 2CS3A 3S32A 4XOPA 3OYJA 1EA3A 2LYCA 3ZGKA 3A1YA 3D5SC 4E7ZA 4BE2A 2RQQA 4XLEA 2M0MA 4CCJA 4C30A 2LC2A 4KISA 4E4HA 1DGRM 4PJJA 4HPQA 3CZ6A 3DTEA 5HNFA 3OYKA 1IRXA 3OR2C 4C9YA 4E7LA 2E1MB 1V5EA 2VQGA 1X1CA 2IXSA 2JVHA 1DGWY 4BACA 3H5NA 4Y4RA 1N77A 4F93B 3CP8A 3LFUA 1Y56A 4HSTA 3OS1A 3S3MA 1BR1A 3TBIA 3K4MA 3RPUD 3DTKA 1BR2A 3FKJA 3OL4A 4U7BA 3OS0A 1X1AA 2WY8Q 1D1AA 4BJTA 3HXLA 4BEHB 3C2GA 4IX7A 4RMNA 2MD0A 4J00A 3VYRB 1UELB 4BQNA 2R4GA 4ZDPA 3LSKA 1G59A 1MMNA 3DPLC 1U0JA 5HLTA 2VQHA 3FDYA 2DCEA 2A5WA 3FBIB 4OAYA 3OYHA 4IQJA 2VJ4A 4E7HA 1HA8A 2VXDA 2LBFB 3RSNA 3SEQA 2HVRA 1WFXA 4QPOA 3MMYB 3K70C 3LSMA 2UV1A 3VWBA 3RQ4A 3K10A 1X19A 2K9MA 4LIVA 3OIPA 2LREA 4EATA 3S93A 2KLOA 4PSWA 4HRIA 3HC7A 1K6YA 2QKLB 3LSIA 2LOOA 4XLFA 3K4CA 2VB6A 4XMYA 1WJAA 2IGNA 2CMPA 1YX5A 1X1DA 2LRDA 2HVQA 3C2HA 3K4BA 4R79A 3CMMA 4NC7A 3OYLA 3QYEA 2KRHA 2VPLA 1W36C 4XKVA 2M7BA 3BCAA 2HPMA 3LMMA 3S8PA 2AQFA 1QHGA 2XSJC 2ZSIB 3TMOA 2R7OA 4HNUA 3OYNA 3HUGB 4J01A 1UG0A 3IAS2 2CW8A 3AKZA 2X1CA 3RCOA 4F92B 2UWMA 3DLAA 1MNDA 4B43A 1ERDA 4G6TB 3D5LA 3HPHA 4BS9A 4BGDA 2L9SA 3OYCA 1R6RA 3OYAA 4Y3OA 4BEHA 1WJBA 2PJRB 4DJAA 3QOEA 1AA7A 4ZTFA 3S3NA 3FBNB 2VKDA 3L2WA 3EUAA 3VDXA 2VJIA 2IS2A 4BXFA 4F3QA 3CF2A 3KX2A 2DOAA 3CP2A 2KQRA 4PJNA 4MLOA 4D1QA 2HU9A 3HKZA 4PUSA 4ZDOA 4LG3A 2KDOA 2LBFA 2LY1A 2R7WA 2X6XA 2V1NA 4FETA 2K3PA 4XN0A 3OYIA 4U87A 5KHDA 1NG7A 3AL0C 1YX3A 3SEZA 1SFKA 2F6CA 3CESA 4XKBA 2L9NA 2Z2SB 4DGWB 4CCNA 4BE1A 5HVQC 2Q2EB 4XLHA 3ZCOA 4ZDLA 2X6YA 4HSRA 3W2WA 4NNJA 1WJ5A 2K5CA 3U21A 3PNYA 3PFYA 3H9QA 3VYTB 1P9QC 2LH9A 2VIXA 1WJFA 4HEA2 2O5RA 4F91B 3OYDA 2ZXIA 2DT7B 2Y0SA 5CPRB 1T95A 4CCMA 1WJDA 3SZGA 5LFAA 3A4CA 4XOTA 2KPMA 4C2UA 2R7QA 1KONA 2KMUA 1D0YA 1X1BA 3AFHA 3DQVC 3DPUA 2CW7A 3PUBA 3OL3A 2XDVA 3L2VA 2CUZA 2PJRA 3PJRA 2KZVA 2WAQA 4ITVA 2VXZA 1D1CA 1LVKA 2W4SA 4XKWA 4OAZA 1G8XA 2MABA 3DKXA 1X4PA 3H35A 4OWRB 3OYEA 2M3AA 1Z21A 3M1CA 2V4JC 2VKHA 2X6WA 4KT6A 4PFOA 3BC8A 3DU6A 2W1OA 3AL0B 2HZDA 2HDWA 2OUMA 2CUJA 4AYBA 3ZQQA 5FROA 2R7UA 2M4GA 3HOTA 2JA2A 1MW7A 4ZJZA 4YEJA 3PNVA 1MMAA 3OR1C 3UNGC 3VSKA 2R7RA 4F52A 3OYMA 3K4KA 4CZCA 2X1DA 2IS4A 3DU5A 2CH0A 5CQEA 2VQCA 3OWTA 3ZR8X 2F5VA 3A2KA 4XM3A 2X85A 4AVZA 3DKYA 3VYUB 3TL4X 3K70D 1N78A 4B48A 3EPZA 2DT6A 2P0WA 5KCMA 3D5RC 2JSPA 5LD2C 3K4JA 1GLNA 4JQFA 2WAEA 2FUG2 3MKYB 1Z3XA 1UAAA 1Y6IA 3H5AA 2HQAA 2KRCA 3NWSA 4GRIA 4PSXA 3G2BA 2GOXB 3F9KA 3HOSA 3ONQA 4E7IA 1S9HA 4NC8A 3W2VA 2IGKA 2JVGA 4PJMA 1BOBA 3EUHC 2MYSA 1WJEA 1VZ0A 4QPQA 2WB1A 3OS2A 2IGMA 4D9JA 3MKWB 2V6EA 2NOJB 4P1WA 3OY9A 3L2QA 3K4LA 1W36D 3PNTA 1PYVA 3LL7A 3VYSB 4RM3A 4BE0A 3DWLE 3GBGA 4CSWA 1YE9A 3E1SA 3L2UA 3ZRGA 1FMWA 2ZFUA 3FHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PYV A; 
#chains in the Genus database with same CATH topology
 4GO1 A;  2BHY A;  4QTR A;  3F72 A;  3E6M A;  3E3V A;  4MIM A;  3J7Y J;  3KP6 A;  3S2H J;  3WTV C;  1KYZ A;  2F4I A;  1S8N A;  4Q5S F;  2H09 A;  2VJJ A;  5CVV A;  2EFP A;  3F6V A;  1EJ9 A;  1HCR A;  4A3F J;  1Z3Y A;  5K1Y A;  4IHV A;  3KYL A;  5FKM A;  4BBR J;  1X3W B;  1GV2 A;  1AU7 A;  2NYX A;  5E20 A;  1IW7 F;  2DA4 A;  1F36 A;  5J1U A;  2JUC A;  1ZQ3 P;  2L7M P;  2Y0M A;  4PDK A;  4RGS A;  3ZPL A;  2PMZ N;  2KP6 A;  3OIO A;  1ZHF A;  4BY1 J;  2OV7 A;  2CG4 A;  2HOT A;  3IP4 B;  3GVA A;  1UHS A;  2JJ7 A;  4BDZ A;  2IGO A;  4YEL A;  4A93 J;  1OCR H;  4HNT A;  2DA3 A;  4LG0 B;  4CYC A;  1D8K A;  4XKC A;  1FTZ A;  2B0L A;  3Q0W A;  4NUB A;  1BM9 A;  1IUY A;  2ELK A;  2E5Z A;  1QZY A;  3K2A A;  2V9K A;  3TGN A;  2LTP A;  3ZXS A;  1RR7 A;  4M9Z A;  2NRA C;  2BYV E;  1CF7 A;  4A0X A;  4HQM A;  3MFK A;  3F8C A;  1TL8 A;  1OCO H;  1SMY F;  3BTI A;  4B09 A;  2BW3 A;  1P4W A;  1RIO H;  1FYL A;  1OYI A;  2LKS A;  4YII A;  3GO5 A;  5J1R A;  1VF9 A;  1CGP A;  4LK0 F;  2VBW A;  2PMZ A;  4E7J A;  3DTI A;  2M87 A;  5BMZ A;  2EA2 A;  3H0D A;  2MG4 A;  5GAD J;  4IL6 C;  5CJ9 A;  2L02 A;  1HW1 A;  3CTA A;  3QU3 A;  2A6H F;  3VB2 A;  3OOP A;  2KHM A;  2DXI A;  4OIQ F;  1QQI A;  2KIM A;  2VQL A;  5IPA A;  3GXO A;  2DA1 A;  2A3S A;  3MAJ A;  2L5Q A;  1XCV A;  2OC6 A;  1W4M A;  2Q1Z B;  3HTS B;  3OYB A;  1K7A A;  1MNE A;  4Y13 A;  3H1C A;  2ETH A;  3CUO A;  2VI6 A;  3S1N J;  1ZEL A;  4MNU A;  2QQ9 A;  1XD7 A;  1XDS A;  1OPC A;  3JRF A;  4CCL A;  1F9N A;  5JFR A;  3IAM 2;  5HDN A;  1B72 A;  2DW4 A;  3BZC A;  4AU7 A;  3M3Y J;  2DMQ A;  1K6O A;  5K7F A;  3J7A Y;  3MEX A;  2WA0 A;  5F1J A;  2L3D A;  3KP7 A;  5ILU A;  3QWL A;  3NAU A;  2CSO A;  3CJN A;  4H4K C;  3IV5 A;  3SFZ A;  2V6C A;  2V1U A;  3K4N A;  1SD5 A;  4FX0 A;  4A3B J;  3HRM A;  4KIT B;  2R7X A;  3TO7 A;  1CF7 B;  2LSO A;  2P6S A;  5E1Z B;  1ZK8 A;  1QGP A;  2NS7 A;  4BQO A;  1SVL A;  2BW3 B;  1LDK B;  2Q8K A;  1DQU A;  1ORK A;  2FSW A;  3BPX A;  5D5X B;  2CFO A;  2CV0 A;  5DD8 A;  2HPI A;  4N4O B;  3ROU A;  1JGS A;  1V54 H;  2DFH A;  3HDD A;  1R1U A;  4XQF A;  3BZ6 A;  1T6S A;  2ZC2 A;  1FMV A;  1ZGA A;  3I3L A;  3CCM I;  3FXL A;  1LE8 B;  4LGW A;  3FZV A;  3G1L A;  4HZF A;  4AC0 A;  4KN4 X;  4N4N B;  4X0G A;  4KFC A;  3Q3S A;  3HG9 A;  1XC5 A;  5AIQ A;  4P9U A;  5EGO B;  3U1D A;  2HWV A;  4EEF G;  1LVA A;  3W2A A;  2CS3 A;  3HOV J;  3JR9 A;  3OYJ A;  1DUX C;  4IEJ A;  2ZO4 A;  3ABM H;  3CUQ C;  1K4T A;  4L0Z B;  3ABK H;  3HSR A;  2A05 A;  1LUJ B;  2XV4 S;  2MLG A;  1AOY A;  1LQ1 A;  4C30 A;  2LC2 A;  4KIS A;  5DCF A;  3VOD A;  5GTI C;  2E1O A;  3DBH B;  4NC6 A;  5HS8 A;  3WHB A;  2BGC A;  1FC3 A;  4HPQ A;  3HTU A;  1OCC H;  1RRJ A;  2H8W A;  2VE8 A;  4S05 A;  1FX7 A;  1IRX A;  3OR2 C;  4C9Y A;  1YO5 C;  1NK3 P;  2E2J J;  3WE3 A;  2E1M B;  1Q1V A;  1EF4 A;  2JVH A;  3SJM A;  2E7X A;  4F93 B;  3LFU A;  1Y56 A;  1OCP A;  2G7U A;  3OS1 A;  3CC4 I;  3TBI A;  2LD5 A;  4AVP A;  1ETO A;  3OL4 A;  3CCQ I;  2M5W A;  1J75 A;  2W24 A;  4Q47 A;  3OS0 A;  1XCB A;  2YS9 A;  4RB1 A;  4ESJ A;  4MQ9 F;  1XSD A;  3R6S A;  2QBY A;  3HXL A;  2F5F A;  3WG7 H;  4A5N A;  4IHW A;  3FWE A;  1G2H A;  2MD0 A;  1HDP A;  2R92 J;  1UEL B;  3C18 A;  1F1Z A;  3HSE A;  4ZDP A;  1XPX A;  1ZR2 A;  2EV5 A;  4EGY A;  3A0H C;  4LJZ F;  2DLL A;  3BDD A;  4I99 C;  1U0J A;  1JKR C;  4EGZ A;  2NVT J;  3JRG A;  2IT0 A;  3WTY C;  1RI7 A;  4ZYD A;  4OAY A;  3U1K A;  4E7H A;  2M0C A;  4KMF A;  4M3D A;  4HBL A;  1WH5 A;  3VWB A;  5B66 C;  2EV6 A;  3D0S A;  1B8I B;  1Z91 A;  3PQJ A;  3W6K B;  4AWX B;  2E35 A;  2ZKZ A;  2LRE A;  2W57 A;  4EAT A;  4RAF A;  4KNY A;  5D5V B;  2YSR A;  4PSW A;  1WQ2 A;  3HM5 A;  2GXG A;  2XKO A;  1JKP C;  4KDP A;  5BOX A;  1PP7 U;  2QKL B;  4C3H J;  2OF7 A;  3G6E I;  2MLK A;  2VB6 A;  2QQ8 A;  3RYP A;  3FIW A;  1O3R A;  2P5L C;  1B6A A;  1YX5 A;  4WCG A;  3HB9 A;  2R7F A;  5FD5 A;  3K0L A;  1ETX A;  3F8F A;  3FXM A;  2A07 F;  1TP4 A;  4EM1 A;  3IKT A;  2XGD A;  3QYE A;  2KRH A;  2VPL A;  3ABL H;  2JSC A;  3A01 B;  1U2W A;  3BCA A;  2XPV A;  3LMM A;  1IO2 A;  2L4M A;  3NAR A;  5TJJ A;  3S8P A;  5J3L A;  5JLW A;  1SVM A;  2ZSI B;  4C3I J;  4O3M A;  3RZO J;  1C0W A;  2BBY A;  2A5Y B;  3QPT A;  1UG0 A;  3IAS 2;  5LLQ A;  4M3F A;  1W5C C;  1MDM B;  3Q9S A;  3HJE A;  1MJB A;  2QA4 I;  4G6T B;  2Q0O A;  2QBY B;  2DI3 A;  3OYC A;  4M3E A;  2HVR A;  1W0U A;  1TW3 A;  1EH6 A;  1WJB A;  4UUT A;  1JHH A;  3TED A;  2M8E A;  1ZH5 A;  3QOE A;  1U9N A;  1AA7 A;  2P5V A;  5GAE J;  3FBN B;  2QEX I;  1MSE C;  3L2W A;  2F4M B;  5E8I A;  3I64 A;  1ODD A;  2KRF A;  1ZGJ A;  3E6B A;  5J6X A;  4M72 A;  4G7H F;  1XDU A;  4U7D A;  3CP2 A;  2EPF A;  4BQA A;  2KQR A;  4PJN A;  4MLO A;  2IW5 A;  2Y0S N;  2HU9 A;  1VQ4 I;  4ZDO A;  3BOQ A;  2LY1 A;  3CUQ A;  5IYD J;  2V1N A;  3HGG A;  2IA2 A;  4XN0 A;  3OYI A;  4IXA A;  2PX9 A;  1GVD A;  1L3L A;  1NG7 A;  1I27 A;  5H6R A;  2QWW A;  2JRT A;  3ZQF A;  4LMY A;  2NOG A;  4I0B A;  3CCS I;  2IJL A;  3GUD A;  3SEZ A;  3H3Z A;  4R1H A;  5A2Q Z;  2GZW A;  1ZAR A;  1OCZ H;  2Z2S B;  1R5I D;  4CCN A;  3LAJ A;  4BE1 A;  2BE5 F;  3OSG A;  3REO A;  4WWC A;  4UVB A;  1NHA A;  3ZCO A;  2X6Y A;  3CDH A;  4NNJ A;  4WX9 A;  2K5C A;  1W7P A;  1QNT A;  1F43 A;  5DEQ A;  1V55 H;  2VOO A;  5LEK A;  2L7F P;  2VT2 A;  3AAF A;  5M3M J;  3ERM A;  2LH9 A;  1XGN A;  1WJF A;  2O5R A;  1TWH J;  4U0W A;  2QSH X;  4M74 A;  1XSX A;  2DT7 B;  2Y0S A;  1T95 A;  3K69 A;  3FM5 A;  1IDZ A;  1TLH B;  2KDZ A;  2YUS A;  2BZT A;  2FMY A;  3CLQ A;  1IXC A;  1UMQ A;  2R7Q A;  3FHZ A;  4A3C J;  2ZJQ F;  5C4X J;  1R4N B;  1X1B A;  3PO3 J;  2BHZ A;  3RQI A;  2QYO A;  3DPU A;  2EFO A;  3GW2 A;  5LRR A;  2XGX A;  5D5U B;  3L9F A;  1HLV A;  1A6Q A;  2X0L A;  4KIF A;  4WXD A;  2CUZ A;  3JRE A;  2PJR A;  3PJR A;  2D2W A;  2KZV A;  3JAM K;  4A3G J;  3KEQ A;  2WAQ A;  5FGM A;  4GDF A;  3S14 J;  1MD0 A;  4CZZ A;  1Z6R A;  3V8J A;  4OAZ A;  1J5Y A;  1G8X A;  2MAB A;  3DKX A;  4RBO A;  1REP C;  1VND A;  3H35 A;  2M3A A;  1Z21 A;  2K9Q A;  2EBI A;  2VKH A;  4KT6 A;  5BPD A;  2COB A;  4A69 C;  3RIR A;  2X4H A;  1J2X A;  5LHI A;  1YHQ I;  3G4S I;  4IO9 F;  3HRS A;  3GLX A;  4OOI A;  1G4D A;  2Y75 A;  2R5Y B;  3ZQH A;  3ZQI A;  1ZKG A;  4OMZ A;  2D5V A;  3I5U A;  2WB1 N;  1ZTR A;  1D3Y A;  1UZC A;  1MMA A;  2BV6 A;  4WXH A;  4ASN A;  2DDB A;  4F52 A;  2Y2Z A;  4XLN F;  4MEX F;  3JRI A;  2UXX A;  2X1D A;  3K1N A;  4MEY F;  3A2K A;  2BY0 A;  1WCM J;  1PUE E;  2X85 A;  2EWN A;  3KZZ A;  4AVZ A;  3K70 D;  3FK7 A;  2JQ7 A;  1N78 A;  2V79 A;  3B6A A;  3EYI A;  4MTD A;  1UB9 A;  1IN4 A;  1NK2 P;  4HX7 A;  4G7Z F;  3K4J A;  5GP9 A;  2EK5 A;  2DFE A;  2C6Y A;  4Y17 A;  4A2U A;  1Z3X A;  1UAA A;  3H5A A;  4EM2 A;  2VBX A;  4EVI A;  2KRC A;  1VQM I;  3NWS A;  4GRI A;  2HFH A;  1MIJ A;  1J0R A;  2CU7 A;  2GOX B;  3FXQ A;  3HOS A;  4EV0 A;  4E7I A;  1YRN B;  4M3G A;  3BY6 A;  3FMQ A;  3M1E A;  3VFZ A;  2MYS A;  4ABZ A;  3MZ8 A;  2WB1 A;  4D9J A;  2ECB A;  3MKW B;  4OIN F;  1S29 A;  3F8M A;  3ESW B;  4P1W A;  4MFE A;  2AS5 F;  2XRN A;  1X58 A;  1PYV A;  2M1B A;  4X6A J;  5E3L A;  3KE2 A;  4A3E J;  3HOW J;  1IXR C;  4RM3 A;  4BE0 A;  3GWZ A;  2XGE A;  5L3G A;  2QLZ A;  1IN5 A;  3WTS C;  3MCZ A;  1XMK A;  5EZG A;  5HLG A;  2DMU A;  5BS6 A;  2DYR H;  2L2O A;  3EUK L;  4RB3 C;  2QKM B;  2F48 A;  2L7Z A;  2NS8 A;  5F64 A;  2IA1 A;  3PL8 A;  1GXP A;  1X2N A;  2P7V B;  3G1M A;  1R49 A;  1EH8 A;  1R7J A;  4XOR A;  3CCV I;  4I98 B;  2R0Q C;  3QOD A;  3QP6 A;  2Z16 A;  5FRM A;  4B8X A;  3QYF A;  1T33 A;  5CQG A;  4AIK A;  1HF0 A;  3M07 A;  3LFK A;  4RB2 C;  3CMY A;  2D1V A;  2IS1 A;  3IWF A;  1X4O A;  2ZFW A;  4L18 B;  2G9W A;  4PJL A;  4RGU A;  4JOM A;  4II2 A;  2A68 F;  3L7W A;  2DJI A;  2I8D A;  4P5O A;  2PI0 A;  2R3S A;  3M8E A;  4BJ5 C;  2H6C A;  3DEE A;  4ENK A;  3ASN H;  2OZU A;  3GEZ A;  5E8G A;  2JA5 J;  1MJ9 A;  1RET A;  1HKS A;  1ON2 A;  4RLQ A;  2CV1 A;  1UST A;  4PFP A;  1SFO J;  5HS7 A;  1RNL A;  5D4S A;  4Q48 A;  2MFZ A;  2KJC A;  1V5F A;  4HNV A;  3K6G A;  2E7W A;  1KQ0 A;  4BHP A;  3OOU A;  3TP0 A;  4UVA A;  1KYW A;  2O8K A;  2EFN A;  3DXJ F;  4A3J J;  2FQ3 A;  2A69 F;  5CKT A;  1X1P A;  2WV1 A;  4DIQ A;  1QO0 D;  5EYR A;  4XLC A;  1IV8 A;  2ADU A;  2OZ6 A;  1UCR A;  3CJR B;  5HOO A;  3L00 A;  5F08 A;  4D5C A;  2WC2 A;  1FJL A;  4UNO A;  5H6Q A;  5HOD A;  1SD4 A;  4UV8 A;  3WGG A;  3JTH A;  1W1W E;  2XSD C;  5JVG F;  2DFF A;  3G3Z A;  1Z0X A;  4XN3 A;  2K9N A;  1J09 A;  3TOB A;  1R9T J;  2RQP A;  5B1A H;  1OMI A;  4HW0 A;  3E7L A;  2M4K A;  2LVS A;  1X3U A;  2CFX A;  1OYY A;  4KIC A;  2FOK A;  3FK6 A;  3GF2 A;  5J8F A;  3P5J A;  5D4R A;  1V4R A;  2WV0 A;  2ZSH B;  5EDN A;  4RDU A;  2J5P A;  2O7O A;  5E3O A;  2DMN A;  2HYJ A;  3P9I A;  4A6E A;  1P92 A;  4U0Y A;  5E79 C;  1PUF B;  5LGT A;  1ZYR F;  2BVM A;  3KP2 A;  3BJO A;  3OSF A;  3GZN B;  2L01 A;  2KZG A;  4I01 A;  1D0Z A;  2XPU A;  3OMY A;  5H20 A;  3P9K A;  1DP3 A;  4YFK F;  1CQT A;  3B02 A;  2EIJ H;  1Y39 A;  4CUG A;  3ZQC A;  1FIA A;  2XF7 A;  2FX0 A;  4XLP F;  1JJ6 C;  3TW7 A;  4A3D J;  5HNH A;  3FXO A;  4NQW B;  2E1M C;  5IYC J;  3G73 A;  3HPG A;  1E0E A;  1D1B A;  3TDU C;  3S2D J;  2VL8 A;  1FY7 A;  3H5R A;  4KYW A;  1HSJ A;  3SZP A;  2H27 A;  5C3E J;  3KP4 A;  1YIO A;  5LGN A;  2HTJ A;  1DDN A;  4UUV A;  4BQQ A;  4ETS A;  1E2X A;  5EJC A;  2R7T A;  1GVJ A;  5F0C A;  1MMG A;  1B1B A;  3SYT A;  5GAH J;  4DYR A;  4C2T A;  2R7S A;  4A5M A;  2NS0 A;  1IN7 A;  3DV8 A;  2TCT A;  4UVC A;  3CCU I;  3J7Z I;  1VQ8 I;  3HGY A;  1QRY A;  3ECO A;  2HEO A;  2DTZ A;  3LSJ A;  1MSF C;  1NH3 A;  1BI0 A;  1IXS B;  1LFP A;  3JTG A;  5FB2 A;  2RRE A;  2E60 A;  2V26 A;  1Z05 A;  3MVP A;  4S0H B;  5KNL A;  2CUF A;  2HYF A;  1U5T C;  1WHU A;  5J4Y A;  3BG9 A;  3FKI J;  5HLH A;  5J8C A;  1VQL I;  3AG1 H;  3RYR A;  2HQ5 A;  2EA4 A;  3RPU A;  2VKV A;  4XLE A;  4CCJ A;  1MBE A;  4J19 A;  2XAH A;  1Z6T A;  4XRM A;  1DGR M;  4G6D A;  1K4S A;  2Y30 A;  4JX5 A;  4QLC U;  3CZ6 A;  3DTE A;  4MHG A;  1BIB A;  1TWA J;  4EMS A;  1RUO A;  3BR3 A;  3KIO A;  3GX4 X;  4U88 A;  1R71 A;  4E7L A;  4L5E A;  5CLS A;  1TW2 A;  2IXS A;  5GPC A;  3PUF A;  3J7A O;  1IRF A;  1DGW Y;  1R00 A;  3L1P A;  3JRB A;  2P8T A;  1IJW C;  2ZCW A;  1TWF J;  3S3M A;  1R36 A;  3K4M A;  3FKJ A;  2HKX A;  5ILV A;  5ICC A;  2YPR A;  3IWZ A;  4GCV A;  4N9I A;  5B5E C;  1QPI A;  4ZZD A;  1X1A A;  3TO6 A;  3J80 K;  3BQY A;  2L0K A;  4BEH B;  3ZN1 A;  3C2G A;  4LK1 F;  3H3V K;  3HHG A;  3CCJ I;  3O2P E;  4BQN A;  2N8G A;  1I1S A;  1LE8 A;  2LF8 A;  4S04 A;  1R58 A;  3DPL C;  1O57 A;  4K2E A;  4N0B A;  4L9J A;  5B3S H;  4YFX F;  2P6T A;  1XX5 A;  1TQM A;  3FBI B;  5EGO A;  4IQJ A;  2VJ4 A;  2BXZ A;  1HA8 A;  2O0Y A;  2BY1 A;  1RZ4 A;  2LFB A;  4E70 A;  4QPO A;  5FLM J;  2E1N A;  2Y69 H;  2UV1 A;  2L9R A;  5BQT A;  4LIV A;  3OIP A;  3CD6 I;  3A02 A;  4HF1 A;  4OIO F;  3KYC B;  3M9A A;  5ICG A;  2KLO A;  4ENJ A;  3KLO A;  2DJN A;  4A6D A;  1U9O A;  5CVU A;  2LDU A;  2K9S A;  3F8N A;  5M5Y J;  1QVU A;  3IKV A;  4XMY A;  2ZXJ A;  1FZP B;  4JYK A;  1ACI A;  3TP3 A;  3C2H A;  3LA3 A;  2Z5U A;  2R7D A;  3DKW A;  2TRT A;  4GGG A;  4BBS J;  3HKZ N;  4NC7 A;  4RAZ A;  2ZBK A;  2GQQ A;  4XBF A;  5ICE A;  1W36 C;  4UUS B;  2M7B A;  1OIS A;  4U0V A;  3JRH A;  3T1B A;  1AHD P;  4G8X A;  2AQF A;  1Z77 A;  2UXN A;  1ITY A;  1HQC A;  3HHH A;  2DT5 A;  2K3F A;  3GTJ J;  4KMU X;  4IOA F;  5IP6 A;  2CJJ A;  4J01 A;  2EZH A;  3ZMZ A;  3MZH A;  5ED4 A;  1RPW A;  1DU6 A;  3DBL B;  5LHH A;  1O3S A;  2EZI A;  3DLA A;  3WU2 C;  1ERD A;  3F21 A;  3D5L A;  3HPH A;  3F23 A;  4BS9 A;  5K5R A;  3DEW A;  4Y3O A;  1ULY A;  2IRF G;  2HOA A;  3PIO F;  3KET A;  1JKQ C;  2FOW A;  3EUA A;  2GXB A;  3EYY A;  2OCE A;  2IS2 A;  3I59 B;  2FQ4 A;  4BXF A;  3IL2 A;  3RKY A;  4F3Q A;  3CF2 A;  3EQL F;  1U5T A;  3FXR A;  2O61 A;  5D6F A;  5DCM B;  5JVT A;  3Q9V A;  3BTJ A;  3HKZ A;  4PUS A;  2NVQ J;  4LB6 B;  3N97 A;  1A6I A;  1OCT C;  2K3P A;  3E97 A;  1JUS A;  4U87 A;  1B8I A;  2PEX A;  5L3C A;  3QRF F;  1B59 A;  1QVT A;  4FQG A;  4I7H A;  2VUM J;  4DGW B;  2IA0 A;  5FKO A;  1PVE A;  1IRZ A;  2CW0 F;  5IYB J;  1HKT A;  5HVQ C;  3WTT C;  1BJZ A;  1ZG5 A;  4ZDL A;  3W2W A;  1IN6 A;  2RKH A;  2XAJ A;  5FFX A;  2X6O A;  3U21 A;  5FKN A;  3PNY A;  1IF1 A;  1KU3 A;  3H9Q A;  3S15 J;  2JTV A;  2QQB A;  4W1U A;  1S72 I;  3A01 A;  4V19 K;  1YW7 A;  3BR6 A;  3T8T A;  2VBY A;  2X9D A;  1V3F A;  1H9G A;  2ZXI A;  5CPR B;  3ZQL A;  5LFA A;  1MGT A;  4DQ2 A;  1FTT A;  1P4X A;  4M73 A;  3SDG A;  3HZJ A;  1MDM A;  1TT5 B;  1B4A A;  2KMU A;  3O8G A;  1H88 C;  1BOA A;  1EV7 A;  2CW7 A;  2NVY J;  1SD6 A;  4YFN F;  2ME6 A;  1RKT A;  2XDV A;  2F5D A;  2DK8 A;  5E1W A;  1VQ9 I;  3BWG A;  4ITV A;  2X48 A;  1D1C A;  3WU0 A;  2W4S A;  4C2M J;  2PMU A;  1TWG J;  2NAZ A;  3VOE A;  1SAX A;  3V7C A;  2HZT A;  1U5T B;  5D8L B;  3M4O J;  1X4P A;  4HF2 A;  1Z1D A;  2FEZ A;  1MH3 A;  1P6R A;  1UFM A;  1N25 A;  3M1C A;  2XPW A;  2X6W A;  2CO5 A;  2FF4 A;  3RJP A;  3GZ6 A;  1ENH A;  4ENN A;  3BQZ A;  3TOA A;  3JSO A;  1IV6 A;  4BH9 A;  4HF0 A;  1KU9 A;  4AYB A;  1DPU A;  1I6H J;  2YR2 A;  1IDY A;  5FRO A;  2FML A;  2M4G A;  1ON1 A;  3QPL A;  3E6C C;  2R7U A;  1B9M A;  3GZ5 A;  4P9F A;  3OR1 C;  3UNG C;  4I76 A;  3WTW C;  1OQY A;  1KU7 A;  4L9T A;  2KKO A;  2IS4 A;  3DU5 A;  3FX3 A;  5F04 A;  2VQC A;  3OWT A;  2YU9 J;  1ZLJ A;  4XM3 A;  1MBF A;  3VYU B;  2NVU B;  5FLX K;  3EPZ A;  5JR3 A;  4YIR X;  5KCM A;  3IH4 A;  5LD2 C;  4G9Y A;  4LFU A;  1O4X A;  2I10 A;  3CC7 I;  3JRA A;  4PZJ A;  1SAN A;  1P7J A;  1JT6 A;  1G3W A;  4FX4 A;  2FUG 2;  3MKY B;  4BY7 J;  1LNW A;  2PN6 A;  1S7E A;  3H0G J;  4B1R A;  4UY8 I;  2QSF X;  3BR1 A;  3E5Q A;  4DYC A;  5DDG A;  1M1E B;  1BOB A;  2XIG A;  3C1D A;  2LR8 A;  2EJR A;  1UHM A;  3JAM Z;  2GA2 A;  2V6E A;  1FBU A;  2DQL A;  2FRH A;  3OY9 A;  1S5L C;  2PG4 A;  3K4L A;  1LFU P;  3W6J B;  1K78 B;  1LEB A;  3VYS B;  4GYG A;  4D0P A;  3PM1 A;  4FE7 A;  4CSW A;  1YE9 A;  3Q0U A;  4IVN A;  2DTR A;  3BR2 A;  3RKX A;  4CYD A;  4ENM A;  3MQ0 A;  2XB0 X;  2K4J A;  2RNJ A;  3RZD J;  2JRM A;  1T39 A;  2XAG A;  1FMW A;  2ZFU A;  4HOB A;  1IUF A;  3BJ6 A;  3M7G A;  4Y52 J;  3BTL A;  2GOM A;  2VPR A;  2IEK A;  1VFC A;  2R5Y A;  2DA6 A;  2HNH A;  2DQR A;  5GPA A;  4ZYE A;  2XUB A;  1OFC X;  3CQZ J;  4PJ0 C;  4XR6 A;  3J81 Z;  3A0B C;  5GAG J;  4DOZ A;  3VSL A;  4BJ6 C;  4BDY A;  2OJE D;  2V7F A;  4IPA A;  1A5J A;  2WAQ N;  2DDA A;  2MC3 A;  4BHC A;  2XHK A;  2A6T A;  3S2W A;  4ZH4 F;  5IP9 J;  1VQO I;  2R5Z B;  2B9S A;  3PSI A;  1H8A C;  4CH7 A;  4QWQ A;  1JT0 A;  4DBR A;  4F55 A;  2STW A;  5FKK A;  3UR3 C;  3E6D A;  3OIQ A;  3LA2 A;  1YW8 A;  3MD2 A;  2QEN A;  4LOC A;  3BCB A;  4DBQ A;  4IQ4 A;  2PQ8 A;  4EJW A;  1ZR4 A;  3PSF A;  2ID6 A;  2X51 A;  4RGX A;  2ME0 A;  5KAF C;  3ELK A;  1YRN A;  2IS6 A;  4IKF A;  4Y33 A;  5K5O A;  3CJQ B;  2M34 A;  2RV8 A;  5FKL A;  5IT3 A;  3I9V 2;  1QU3 A;  3HRU A;  4BHB A;  5F1R A;  5K5Q A;  1PJR A;  2VAS A;  1SVO A;  1FWZ A;  4KIB A;  1PDN C;  1V5G A;  3N4M A;  3AG4 H;  3BZK A;  2HS5 A;  3CO7 C;  4BAY A;  5LEJ A;  3OYG A;  4AIJ A;  3S3O A;  5ERI A;  1FBQ A;  5DD4 A;  3SFI A;  2FNP A;  2EB7 A;  1LPQ A;  3IH2 A;  2XF5 A;  1FT9 A;  2HQR A;  2VOD A;  3ABT A;  4CDG A;  3NWT A;  4XON A;  4B4C A;  4CCK A;  2GA1 A;  5L3B A;  2L9V A;  3ZQG A;  3K2Z A;  3COA C;  3LSR A;  2JN6 A;  2BXY A;  2K85 A;  3S1Q J;  5JI6 A;  1GXQ A;  9ANT A;  1R1V A;  4NBQ A;  5FD6 A;  1G6N A;  3K7A J;  4IHS A;  2W84 A;  3FIS A;  3CDI A;  3GTG J;  1YYV A;  2RC4 A;  2MH9 A;  2XVC A;  3ZQ7 A;  3RTR A;  1KA8 A;  4HDV A;  4ON0 A;  3J81 K;  3LSH A;  1F4K A;  5KAI C;  1JI8 A;  4CCO A;  2O8X A;  3WGH A;  3VEP A;  2MD5 A;  3NQO A;  2CV2 A;  4AD9 A;  1QBJ A;  4XID A;  2ACJ A;  1BR4 A;  2XAU A;  3BR5 A;  4LIU A;  2WY7 Q;  1N75 A;  2WAD A;  1STZ A;  1YIT I;  5DV5 A;  3BG6 A;  4KUM A;  3AG2 H;  3WG9 A;  4IJA A;  4EQQ A;  3IUO A;  1UJ8 A;  3DBR B;  4RB0 A;  3WOD F;  1DPR A;  2XC7 A;  4MFD A;  3F3X A;  1Z7L A;  5TGT A;  4A0Y A;  3L09 A;  3MKL A;  2V9P A;  4A12 A;  1FYK A;  2GLO A;  2DMP A;  3C7J A;  4W97 A;  2LG4 A;  4ZYA A;  3CJT B;  3QOP A;  1QPM A;  2KJB A;  2E1C A;  4XNF A;  1T0F C;  1LB2 A;  2P5K A;  4Y15 A;  5FRN A;  1WRJ A;  1WZ2 A;  1VQK I;  1JUM A;  2R7V A;  1PP8 F;  2M7A A;  2F4O B;  2VLA A;  3MN2 A;  2ELH A;  1YJW I;  2CRG A;  4IZZ A;  3RPQ A;  2LY2 A;  2MA3 A;  2LMD A;  1TQI A;  2RNG A;  5LGU A;  4L0Y B;  1G3Y A;  1XTA A;  1T56 A;  4B47 A;  1GV5 A;  1SFX A;  2K9L A;  3ZMD A;  2ESH A;  3G1O A;  1Y0N A;  4O5V A;  5M5X J;  1OR7 C;  1FOX A;  4L5J A;  2I5U A;  2AO9 A;  4E6K G;  2YX4 A;  4QIW N;  3M8F A;  3HBL A;  3I4M J;  5IOY A;  2XF6 A;  2ELJ A;  5KVR A;  1DP7 P;  3I4N J;  3M8J A;  5JHF A;  3ULQ B;  1XN7 A;  1AKH A;  1XMA A;  2WTE A;  2W48 A;  4XSX F;  2AXT C;  4YRV A;  4JK1 X;  1FLI A;  1B9N A;  2VN2 A;  5F27 A;  4AUX A;  1RKW A;  3IC7 A;  1QZZ A;  3H9J A;  5TIS C;  1RC9 A;  2GBY A;  3S32 A;  1HKQ A;  3H36 A;  3T0Y A;  4NHJ A;  2F2E A;  4ZYH A;  5JHU A;  1W5S A;  3A1Y A;  1XGM A;  3CO6 C;  1FOW A;  2OQR A;  3I4P A;  4HLX A;  4BE2 A;  1Z9C A;  2RQQ A;  2M8G X;  2V1X A;  2PLY A;  1D5V A;  3DFG A;  1YIJ I;  1USS A;  2EFQ A;  1J9I A;  3LOC A;  5KK1 A;  3HYI A;  1NTC A;  2QUF A;  4KT5 C;  3WU1 B;  1FP2 A;  5HNF A;  1PUF A;  3QPH A;  3OYK A;  2DAO A;  3ABU A;  5HS9 A;  2XRL A;  2O9L A;  3P9C A;  3JRC A;  1V5E A;  4M9X A;  2VQG A;  5F0F A;  5EG0 B;  4BAC A;  4QSH A;  3H5N A;  4NQW A;  4BYY A;  4Y4R A;  1W0T A;  3S16 J;  1LEA A;  1N77 A;  5FFZ A;  3CP8 A;  2DA2 A;  3NEU A;  1TWC J;  2QF7 A;  3I54 A;  2QSG X;  2HKO A;  4WXC A;  4AIH A;  2EFW A;  2ZME B;  2VON A;  5D5W B;  4U7B A;  1YG2 A;  3GLL A;  4LD5 A;  2XB5 A;  2WY8 Q;  3TW6 A;  2K86 A;  2O3F A;  3O8H A;  3AG3 H;  4BJT A;  2VKE A;  1E3P A;  2UZK A;  1BI3 A;  2IPQ X;  5J47 A;  2VE9 A;  2JA8 J;  4KIG A;  4BXX J;  4J00 A;  1BW5 A;  1MNM C;  2XAF A;  4EJT A;  1AKH B;  3ASO H;  2K4B A;  1FPQ A;  1MMN A;  2OBP A;  3K9T A;  4M6X A;  1G59 A;  3DCF A;  5HLT A;  5C4J J;  2DCE A;  2CWE A;  3QQA A;  1K79 A;  2FXA A;  2VXD A;  2LBF B;  3SEQ A;  1U78 A;  4DNC A;  1IGN A;  1WFX A;  3MMY B;  3K70 C;  3RQ4 A;  3K10 A;  2PMH A;  3FXJ A;  1HC8 A;  3FMS A;  4I09 A;  5K7Z A;  4IHT A;  4OMY A;  5L3D A;  3S93 A;  1FIP A;  2IVM A;  2H8R A;  1K6Y A;  2LLK A;  4XLF A;  1T08 B;  3P7N A;  2YU3 A;  3K4C A;  5DYM A;  4GXO A;  1BI2 A;  1WJA A;  4P96 A;  2IGN A;  2CMP A;  4MGR A;  1L0O C;  2Q2E A;  1XMX A;  2LRD A;  3T8R A;  4IOC F;  3K4B A;  4FCY A;  1ETV A;  4R79 A;  3CMM A;  2DN0 A;  5E3N A;  4FIS A;  1TQP A;  1Y8Q B;  1AWC A;  4EJO A;  3E5U A;  2HPM A;  2XSJ C;  4HLY A;  2R7O A;  2DPD A;  3R0J A;  3OYN A;  4XRS A;  5H2F C;  5HDG A;  1MMS A;  2CW8 A;  3AKZ A;  2X1C A;  2UWM A;  4F92 B;  3JCU C;  3J80 Z;  4B43 A;  1OR7 A;  4BGD A;  1R6R A;  4BEH A;  3X2Q H;  2KIF A;  3WE2 A;  2HTS A;  1LJ9 A;  3GTK J;  2OA4 A;  4ZTF A;  1WKM A;  2BY2 A;  1T38 A;  2VKD A;  3ZMU A;  3HOX J;  2EIL H;  5LRS A;  3F0C A;  4HYE A;  1FYM A;  2DOA A;  2E2I J;  2FE3 A;  4FTH A;  4L9N A;  1Z67 A;  2EIK H;  5EEG A;  2ESN A;  2LKP A;  2KDO A;  1UHW A;  2R7W A;  2X6X A;  2CQQ A;  4OU0 A;  1YJ9 I;  4FET A;  2EH3 A;  2H94 A;  5KHD A;  2ZNZ A;  5DS9 A;  4BKX A;  5M5W J;  1FEX A;  1Y1V J;  5IT9 K;  3JSP A;  1MBK A;  1SFK A;  2F6C A;  3CES A;  4XKB A;  2XAQ A;  3GTL J;  4V2F A;  1IAW A;  1MBG A;  1OYW A;  2DOE A;  2GIZ A;  1JJ8 C;  2Q2E B;  3I55 I;  2DFI A;  4D7M A;  2LF7 A;  4ESB A;  4MQV A;  1GUU A;  3PFY A;  4ZZL A;  2M45 A;  3H3U A;  1FOY A;  1A31 A;  2VIX A;  4UUS A;  1WGX A;  3R4K A;  1ZLK A;  2ID3 A;  4CGZ A;  4F91 B;  3OYD A;  1GHC A;  2Y9Z A;  2QCO A;  3HIF A;  3CCL I;  4CCM A;  2HQN A;  3A4C A;  2JPB A;  4XOT A;  1R5H A;  3GYH X;  2JK3 A;  5D8K B;  1KON A;  2ICW G;  4LLN A;  1S7A A;  2A61 A;  3AFH A;  2E71 A;  4D7N A;  1HW2 A;  4AM3 A;  3OL3 A;  3HOZ J;  5DUI A;  2FBK A;  2P81 A;  2GXA A;  1W7P D;  2VXZ A;  3GTM J;  1LVK A;  4KN7 X;  4XKW A;  1VI0 A;  3CMA I;  1FSH A;  1MJA A;  3C2B A;  2JZY A;  3HOU J;  4LB5 A;  3OYE A;  3I59 A;  4GFB A;  2RDP A;  1T2K A;  2RGV A;  3DEU A;  4FE4 A;  2V4J C;  4HA8 A;  5DCM A;  1YOV B;  2DOF A;  1WI9 A;  5CVI A;  4G12 A;  3LNQ A;  3VPR A;  3AL0 B;  1LDD A;  2HZD A;  3ML6 A;  2HDW A;  2OUM A;  3FXK A;  2GM4 A;  2H1L A;  3Q0V A;  2LY9 A;  3ZQQ A;  3B73 A;  5HDK A;  5BPI A;  1VQ5 I;  1SD7 A;  1S3J A;  3PO2 J;  1RUN A;  1BN5 A;  2JA2 A;  1MW7 A;  2CUE A;  4ZJZ A;  1IZ1 A;  1R5G A;  1Z7U A;  4YEJ A;  1XGS A;  4H0E A;  5K7H A;  2COM A;  1RR8 C;  2ZNY A;  3R0A A;  1R1T A;  3K4K A;  2QZ8 A;  1JXS A;  2AHQ A;  2VC0 A;  3FMR A;  1ZG1 A;  3LQR A;  3KP5 A;  4Z2Y A;  3DKY A;  3TL4 X;  1R22 A;  2KIU A;  2ZJR F;  5DUK A;  5E3M A;  2DT6 A;  4FHT A;  3ZMV A;  3H92 A;  3D5R C;  2JSP A;  5DTD A;  4UHT A;  4D5F A;  5J4V A;  1IN8 A;  4DZJ A;  1YFH A;  2WAE A;  2STT A;  3BJA A;  1W5T A;  1RES A;  3V8L A;  1TNT A;  1Y6I A;  2V9V A;  4PSX A;  1IG7 A;  1K83 J;  2B63 J;  4CYC B;  4NC8 A;  4M6Y A;  3W2V A;  3BPV A;  2IGK A;  4PJM A;  2B7E A;  2OU2 A;  3EUH C;  1WJE A;  3GTP J;  2CQN A;  3OS2 A;  1OKR A;  2IGM A;  3IRQ A;  3PNT A;  2RN7 A;  3LL7 A;  2HR3 A;  3WTX C;  1X3Z B;  4EJU A;  3LQQ A;  2JWT A;  3UKG A;  4RGR A;  3CF5 F;  2PBI A;  3BTC A;  3E1S A;  2MBF A;  4M6V A;  3ZRG A;  1F5T A;  1I50 J;  3I53 A;  1FSE A;  3CLO A;  3U9G A;  2J5O A;  1LKX A;  1FNN A;  5CVJ A;  2AXL A;  3KLN A;  3E0J B;  4CO8 A;  4V2G A;  4ZC3 A;  3QYB A;  1QZE A;  1J59 A;  4KJZ A;  2WBM A;  3V42 A;  4HX8 A;  2E2H J;  3KP3 A;  3LWF A;  2WWY A;  1D0X A;  2HDD A;  1NG6 A;  3IRR A;  3ZOB A;  2EQR A;  2FBH A;  2E36 A;  5FLX Z;  2ZXH A;  1JTX A;  3WHC A;  2JA7 J;  2WAF A;  1YW9 A;  2O03 A;  2L4A A;  3KEY A;  2AQE A;  4Y7N J;  6PAX A;  3RDI A;  2R93 J;  2M2E A;  3V8K A;  2EIM H;  1B72 B;  3OYF A;  4A3L J;  3FM3 A;  3A03 A;  4AYB N;  1SAU A;  4E7S A;  4BU2 A;  4EJV A;  4CXF A;  4I2O A;  1S7O A;  3T5X A;  3SZT A;  3KYD B;  4BUP A;  1ONV A;  2L7K A;  3GTO J;  3WTU C;  3FF5 A;  4II3 A;  1JGG A;  1HDD C;  1A36 A;  2BVL A;  2DA7 A;  5LBQ A;  4UXN A;  4EM0 B;  3RKW A;  2HOS A;  4ANJ A;  1TT0 A;  5ILS A;  2W82 A;  2IAI A;  4RAY A;  1E3O C;  1YQA A;  3JRD A;  1QHH D;  1H89 C;  4PK4 A;  1Y0U A;  3V4G A;  1K78 A;  2RVC A;  2X1E A;  3PQK A;  5E17 F;  1BC8 C;  1MMD A;  2VT3 A;  2OTJ I;  2Z1D A;  4BNC A;  4A0Z A;  3HL2 A;  2EZK A;  4CA0 A;  2CYY A;  4RM2 A;  2ZJP F;  1G3T A;  3HEF A;  4M3B A;  4XLA A;  1GT0 C;  2HVS A;  2EV0 A;  2JUG A;  3EDP A;  2VBZ A;  4Z6Y A;  3LAP A;  5CYV A;  1U3E M;  4WK8 F;  1ETK A;  4HV5 A;  1T98 A;  4WF2 A;  5JLX A;  4PGG A;  2VOP A;  1SEU A;  2KT0 A;  4IHX A;  4B3X A;  2KL4 A;  1Y1W J;  4L5I A;  2XRO A;  4GYI A;  3Q5F A;  1KQ8 A;  1TZL A;  2ZXW H;  2JT1 A;  3FXU A;  2K7L A;  3DPT A;  1I3A A;  3F8B A;  2R5Z A;  3WTZ A;  4RAG A;  3NRV A;  1ETY A;  3LSP A;  5B1B H;  1ZRD A;  3KZI C;  4HG2 A;  3PIP F;  2Z9O A;  3BP8 A;  3BG7 A;  5AIP A;  1WJC A;  4BL0 B;  3BR0 A;  3D1N I;  1ZG3 A;  4B44 A;  1HST A;  2HI3 A;  2JPC A;  2Y31 A;  1FOK A;  1I1G A;  1O7L A;  4XL9 A;  3MKZ A;  3ECH A;  4FAS D;  1ZN2 A;  1R23 A;  2KIS A;  3WGI A;  4LIT A;  2MC4 A;  1ZAO A;  2VJ5 A;  3EUH A;  2BY3 A;  4IF4 A;  3BLY A;  2DYS H;  2M9H A;  4ZTJ A;  3DLL F;  3ZMT A;  3TDZ C;  3TKY A;  1WI3 A;  2RAE A;  3LSG A;  3SQN A;  1BA5 A;  4RLF A;  1OLT A;  4F7Z A;  3W3C A;  4G94 A;  3IH3 A;  4E7K A;  4NB5 A;  4N9H A;  5IY5 H;  2Z3Y A;  1H0M A;  1A04 A;  4JP0 A;  1P2F A;  4UV9 A;  4IRI A;  2ZME C;  3H9G A;  3N05 A;  4I0A A;  3W6V A;  3B6C A;  2W00 A;  3L2R A;  2W7N A;  2H6B A;  2DBB A;  2QVO A;  2OPT A;  1R4M B;  1KGS A;  2BOL A;  5F0H A;  1SFE A;  2UUZ A;  4LLL A;  1APL C;  1E17 A;  1S6L A;  3JW4 A;  3QP5 A;  3RKQ A;  2DK5 A;  1J7K A;  2E5N A;  4PCQ A;  3SDB A;  4DZP A;  1BW6 A;  2EZL A;  2H1K A;  1I3Q J;  5IOZ A;  2Y48 A;  3C3W A;  5E18 F;  1WPK A;  4XOP A;  3F22 A;  3CCR I;  1SFU A;  1JKO C;  1EA3 A;  2HGC A;  5FLV A;  2LYC A;  3ZGK A;  1G3S A;  1HOM A;  3KEO A;  5EF6 A;  1MBJ A;  4UB8 C;  3D5S C;  3E5X A;  4B3A A;  4E7Z A;  2M0M A;  1FBS A;  2HXI A;  2LP0 A;  4HX4 A;  3KFW X;  4E4H A;  2ZB9 A;  4PJJ A;  2XGC A;  1O3T A;  4UB6 C;  1X2M A;  1XGO A;  1XG1 A;  2HYG D;  3G71 I;  1YS7 A;  2LK2 A;  1ETQ A;  5E1X A;  5DM7 F;  2NNN A;  1IRG A;  4HQE A;  1LDJ A;  1X1C A;  3O6B B;  5TRD A;  1U8B A;  2DPU A;  1K61 A;  5J40 A;  1KZH A;  2QM3 A;  4X1E A;  3GFM A;  3I71 A;  3ISP A;  5J1Y A;  5CVR A;  3ZP5 A;  2MSY A;  4HST A;  5M3F J;  1BR1 A;  4XK4 A;  2YX7 A;  3RPU D;  3DTK A;  2OAZ A;  1BR2 A;  3HUG A;  4KA4 A;  1JUP A;  1U8R A;  1U6G A;  1D1A A;  2KIQ A;  3L2C A;  4DW6 A;  4IX7 A;  4C3J J;  5GTH C;  4RMN A;  4JX4 A;  3CCY A;  3VYR B;  3S1M J;  1ETW A;  2R4G A;  5ICF A;  1JHF A;  1BBY A;  2K40 A;  3LSK A;  1EH7 A;  1BIA A;  4IRH A;  1LFB A;  2D45 A;  2VQH A;  3FDY A;  3OV8 A;  2F5C A;  3CC2 I;  2ISZ A;  5L3E A;  4OIP F;  2A5W A;  4CIC A;  4YIF A;  1P7I A;  2DMT A;  3OYH A;  2E19 A;  3QU6 A;  1VQ7 I;  3RSN A;  3CUQ B;  3LSM A;  1SC7 A;  3TO9 A;  1VTN C;  1X19 A;  2QGU A;  2K9M A;  2QQA A;  2W25 A;  4HDU A;  3ZN0 A;  1WSU A;  2Y9Y A;  3GFL A;  2P7C B;  1YTY A;  1TNS A;  1XB4 A;  4RA2 A;  1POG A;  2CQK A;  5IP7 J;  4I02 A;  4HRI A;  3HC7 A;  1VQN I;  3BT9 A;  3LSI A;  2GAU A;  2LOO A;  1KU2 A;  5A2Q K;  5LHG A;  1IC8 A;  1YLF A;  2DO7 A;  1X1D A;  2HVQ A;  4OIR F;  1W7P B;  2DOD A;  3F6O A;  5EZH A;  1D8J A;  1T8I A;  3OYL A;  4XIC A;  1ZRC A;  3LA7 A;  4XKV A;  3V7R A;  5EG0 A;  1O3Q A;  2FD5 A;  1QHG A;  3TMO A;  2PFB A;  3V7S A;  4HNU A;  4L9V A;  3HUG B;  2D1H A;  3IHU A;  2XAS A;  2ZME A;  3RCO A;  2ECC A;  5L3F A;  2O6G E;  4G6Q A;  2OCC H;  4MO7 A;  2MGQ A;  1MND A;  3CCE I;  1VQP I;  3PFI A;  2NVX J;  2L9S A;  3HOY J;  3OYA A;  1I5Z A;  4JX6 A;  2K27 A;  2F5E A;  2FBI A;  4M9S A;  3K1P A;  4TV7 A;  5EEH A;  2PJR B;  4DJA A;  4G7O F;  3MWM A;  2FU4 A;  1HXD A;  3S3N A;  2PJP A;  1BI1 A;  1WWX A;  3VDX A;  2VJI A;  1MBH A;  4I6Z A;  3I58 A;  2K02 A;  3KX2 A;  3HSF A;  2LNB A;  4D1Q A;  2IP2 A;  2NNY A;  1H9T A;  2HOE A;  4LG3 A;  2LBF A;  1JE8 A;  2BEO A;  1HW5 A;  3I0T A;  2A6E F;  2V1D A;  3BG3 A;  1TTY A;  3AL0 C;  5BNG A;  3GFJ A;  1YX3 A;  4DYQ A;  2CGP A;  2L9N A;  2Z33 A;  2DA5 A;  1XS9 A;  2GIV A;  2CQX A;  1TBX A;  3SXY A;  2M30 A;  4MTE A;  5FJ8 J;  3HRT A;  4XLH A;  2FNA A;  1A35 A;  2KFD A;  3GCM A;  4HSR A;  1WJ5 A;  1D5Y A;  3KCC A;  4P55 A;  4HV6 A;  1MKM A;  3VYT B;  1P9Q C;  1TC3 C;  4IRG A;  4HEA 2;  3GTQ J;  2JA6 J;  4XRF A;  2FA5 A;  3S17 J;  5AON A;  2XKP A;  1WJD A;  3SZG A;  1OJL A;  1BJA A;  1MH4 A;  2KPM A;  4C2U A;  2R7Z J;  2EIN H;  1KQ9 A;  3GFI A;  1D0Y A;  2HDC A;  2OQG A;  3DQV C;  5FO5 A;  4AID A;  3LST A;  4A3I J;  3PUB A;  5C44 J;  1GDT A;  3R61 A;  1YJN I;  3L2V A;  2LKX A;  1O7F A;  1FP1 D;  1WVR A;  2L54 A;  5F6F A;  1Q1H A;  3RI4 A;  3KZY A;  5EEA A;  3I56 I;  4A3M J;  1I6X A;  4PGH A;  4OWR B;  1JTY A;  1E3H A;  2ISY A;  2ZJ2 A;  4PFO A;  4XSZ F;  3BC8 A;  3DU6 A;  5HLI A;  1BC7 C;  2HXO A;  3GME A;  4ZYG A;  2W1O A;  3TQN A;  4LLG F;  2OD5 A;  2CUJ A;  5IT9 Z;  3CME I;  3MZY A;  3HOT A;  4O6J A;  4YG2 F;  3PNV A;  3R60 A;  3CDL A;  1ZGW A;  1HBX G;  3DF8 A;  3VSK A;  4XRS G;  2R7R A;  3OYM A;  4CZC A;  2W85 A;  5DM6 F;  2TDX A;  4R8H A;  2CH0 A;  1MZB A;  2E34 A;  5CQE A;  4JBA A;  3BG5 A;  2F5V A;  1T0F A;  3ZR8 X;  4CHU A;  2CQ7 A;  4B48 A;  4FT8 A;  1I39 A;  2P0W A;  3BRO A;  4RS8 A;  3ZMS A;  1ZRF A;  1P4A A;  1EKE A;  3SHF A;  1GLN A;  4JQF A;  3QPS A;  1QA6 A;  3S1R J;  2HQA A;  4HAM A;  1YS6 A;  2P4W A;  3QAH A;  2JMW A;  2IBD A;  1DU0 A;  3G2B A;  3F9K A;  5D6E A;  4A3K J;  3ONQ A;  3O3K A;  1S9H A;  2G0E A;  4LG0 A;  1YI2 I;  2JVG A;  3EET A;  4NDL A;  3U2R A;  2VC1 A;  1SMT A;  1VZ0 A;  2DU9 A;  4QPQ A;  2NOJ B;  2GWR A;  3L2Q A;  4Q4Z F;  1W36 D;  2FJ1 A;  3DP7 A;  2G7H A;  1XSV A;  1BL0 A;  4ESF A;  1ZRE A;  3KPH A;  3ERE D;  4M71 A;  3DWL E;  2NXN B;  3GBG A;  4IHY A;  2OTL I;  1WH7 A;  1VQ6 I;  3L2U A;  2Z99 A;  2MH2 A;  3K1M A;  3FHN A;  1UG2 A;  4BXU A;  2MW8 A;  1Y8R B; 
#chains in the Genus database with same CATH homology
 1LKX A;  2L2O A;  2GOM A;  3EUK L;  2HNH A;  2QKM B;  2F4I A;  3E0J B;  3PL8 A;  4XR6 A;  4DOZ A;  4ZC3 A;  3QYB A;  3VSL A;  2VJJ A;  4KJZ A;  2WBM A;  2V7F A;  4BJ6 C;  4BDY A;  3V42 A;  4XOR A;  1D0X A;  2A6T A;  1NG6 A;  1Z3Y A;  3KYL A;  3QOD A;  2ZXH A;  3PSI A;  4CH7 A;  2WAF A;  2Z16 A;  4DBR A;  4F55 A;  5FRM A;  3KEY A;  2AQE A;  3QYF A;  5CQG A;  3UR3 C;  3OIQ A;  2KP6 A;  2IS1 A;  3OYF A;  2OV7 A;  1X4O A;  3IP4 B;  3MD2 A;  1SAU A;  3BCB A;  4E7S A;  4BU2 A;  4DBQ A;  4IQ4 A;  4PJL A;  4JOM A;  4II2 A;  4BDZ A;  4BUP A;  2DJI A;  2IGO A;  4YEL A;  2L7K A;  3PSF A;  2I8D A;  4P5O A;  2X51 A;  4II3 A;  4HNT A;  4BJ5 C;  3DEE A;  2BVL A;  2IS6 A;  4XKC A;  4IKF A;  4Y33 A;  3CJQ B;  4ANJ A;  4NUB A;  1TT0 A;  4RLQ A;  2CV1 A;  2E5Z A;  2W82 A;  2V9K A;  3I9V 2;  4PFP A;  3ZXS A;  1QU3 A;  1PJR A;  2VAS A;  1V5G A;  1QHH D;  2MFZ A;  1V5F A;  4PK4 A;  3OYG A;  3K6G A;  2BW3 A;  3S3O A;  2X1E A;  1MMD A;  2Z1D A;  3OOU A;  3HL2 A;  2XF5 A;  4CA0 A;  4RM2 A;  5CKT A;  2PMZ A;  4E7J A;  3NWT A;  3DTI A;  4XON A;  4CCK A;  4DIQ A;  4XLC A;  4XLA A;  3H0D A;  2HVS A;  2JUG A;  3CJR B;  5HOO A;  3RTR A;  4B3X A;  2KL4 A;  3LSH A;  2KHM A;  4XN3 A;  2DXI A;  1JI8 A;  2VQL A;  1TZL A;  1J09 A;  4CCO A;  2L5Q A;  3DPT A;  2Q1Z B;  2OC6 A;  3OYB A;  2CV2 A;  2M4K A;  1MNE A;  1BR4 A;  2XAU A;  4LIU A;  1ZEL A;  2WY7 Q;  1N75 A;  4HG2 A;  4CCL A;  2WAD A;  2ZSH B;  1WJC A;  3BG7 A;  3IAM 2;  4BL0 B;  3BG6 A;  4AU7 A;  4B44 A;  3J7A Y;  3IUO A;  2WA0 A;  3MKZ A;  4XL9 A;  4H4K C;  4FAS D;  2BVM A;  2XC7 A;  1Z7L A;  5TGT A;  3K4N A;  2MC4 A;  4LIT A;  1D0Z A;  2VJ5 A;  3OMY A;  1DP3 A;  3BLY A;  4ZTJ A;  4CUG A;  2LG4 A;  4ZYA A;  2XF7 A;  4XNF A;  4KIT B;  1T0F C;  2R7X A;  5HNH A;  4NQW B;  3LSG A;  5FRN A;  2E1M C;  3HPG A;  1E0E A;  1D1B A;  2VL8 A;  3H5R A;  4RLF A;  1OLT A;  2M7A A;  4BQO A;  3W3C A;  2R7V A;  2VLA A;  2BW3 B;  1LDK B;  4E7K A;  4IZZ A;  2LY2 A;  1DQU A;  2RNG A;  2CV0 A;  4BQQ A;  2CFO A;  2HPI A;  4N4O B;  2R7T A;  4B47 A;  1MMG A;  3H9G A;  3N05 A;  2K9L A;  3SYT A;  4C2T A;  2R7S A;  4XQF A;  3L2R A;  2W00 A;  1OR7 C;  2W7N A;  3I3L A;  1FMV A;  4E6K G;  2XF6 A;  2ELJ A;  2BOL A;  2UUZ A;  3M8J A;  5JHF A;  1LFP A;  4N4N B;  4X0G A;  3HG9 A;  4YRV A;  2E5N A;  2RRE A;  2E60 A;  2V26 A;  3H9J A;  3SDB A;  5KNL A;  3W2A A;  2CS3 A;  3S32 A;  4XOP A;  3OYJ A;  1EA3 A;  2LYC A;  3ZGK A;  3A1Y A;  3D5S C;  4E7Z A;  4BE2 A;  2RQQ A;  4XLE A;  2M0M A;  4CCJ A;  4C30 A;  2LC2 A;  4KIS A;  4E4H A;  1DGR M;  4PJJ A;  4HPQ A;  3CZ6 A;  3DTE A;  5HNF A;  3OYK A;  1IRX A;  3OR2 C;  4C9Y A;  4E7L A;  2E1M B;  1V5E A;  2VQG A;  1X1C A;  2IXS A;  2JVH A;  1DGW Y;  4BAC A;  3H5N A;  4Y4R A;  1N77 A;  4F93 B;  3CP8 A;  3LFU A;  1Y56 A;  4HST A;  3OS1 A;  3S3M A;  1BR1 A;  3TBI A;  3K4M A;  3RPU D;  3DTK A;  1BR2 A;  3FKJ A;  3OL4 A;  4U7B A;  3OS0 A;  1X1A A;  2WY8 Q;  1D1A A;  4BJT A;  3HXL A;  4BEH B;  3C2G A;  4IX7 A;  4RMN A;  2MD0 A;  4J00 A;  3VYR B;  1UEL B;  4BQN A;  2R4G A;  4ZDP A;  3LSK A;  1G59 A;  1MMN A;  3DPL C;  1U0J A;  5HLT A;  2VQH A;  3FDY A;  2DCE A;  2A5W A;  3FBI B;  4OAY A;  3OYH A;  4IQJ A;  2VJ4 A;  4E7H A;  1HA8 A;  2VXD A;  2LBF B;  3RSN A;  3SEQ A;  2HVR A;  1WFX A;  4QPO A;  3MMY B;  3K70 C;  3LSM A;  2UV1 A;  3VWB A;  3RQ4 A;  3K10 A;  1X19 A;  2K9M A;  4LIV A;  3OIP A;  2LRE A;  4EAT A;  3S93 A;  2KLO A;  4PSW A;  4HRI A;  3HC7 A;  1K6Y A;  2QKL B;  3LSI A;  2LOO A;  4XLF A;  3K4C A;  2VB6 A;  4XMY A;  1WJA A;  2IGN A;  2CMP A;  1YX5 A;  1X1D A;  2LRD A;  2HVQ A;  3C2H A;  3K4B A;  4R79 A;  3CMM A;  4NC7 A;  3OYL A;  3QYE A;  2KRH A;  2VPL A;  1W36 C;  4XKV A;  2M7B A;  3BCA A;  2HPM A;  3LMM A;  3S8P A;  2AQF A;  1QHG A;  2XSJ C;  2ZSI B;  3TMO A;  2R7O A;  4HNU A;  3OYN A;  3HUG B;  4J01 A;  1UG0 A;  3IAS 2;  2CW8 A;  3AKZ A;  2X1C A;  3RCO A;  4F92 B;  2UWM A;  3DLA A;  1MND A;  4B43 A;  1ERD A;  4G6T B;  3D5L A;  3HPH A;  4BS9 A;  4BGD A;  2L9S A;  3OYC A;  1R6R A;  3OYA A;  4Y3O A;  4BEH A;  1WJB A;  2PJR B;  4DJA A;  3QOE A;  1AA7 A;  4ZTF A;  3S3N A;  3FBN B;  2VKD A;  3L2W A;  3EUA A;  3VDX A;  2VJI A;  2IS2 A;  4BXF A;  4F3Q A;  3CF2 A;  3KX2 A;  2DOA A;  3CP2 A;  2KQR A;  4PJN A;  4MLO A;  4D1Q A;  2HU9 A;  3HKZ A;  4PUS A;  4ZDO A;  4LG3 A;  2KDO A;  2LBF A;  2LY1 A;  2R7W A;  2X6X A;  2V1N A;  4FET A;  2K3P A;  4XN0 A;  3OYI A;  4U87 A;  5KHD A;  1NG7 A;  3AL0 C;  1YX3 A;  3SEZ A;  1SFK A;  2F6C A;  3CES A;  4XKB A;  2L9N A;  2Z2S B;  4DGW B;  4CCN A;  4BE1 A;  5HVQ C;  2Q2E B;  4XLH A;  3ZCO A;  4ZDL A;  2X6Y A;  4HSR A;  3W2W A;  4NNJ A;  1WJ5 A;  2K5C A;  3U21 A;  3PNY A;  3PFY A;  3H9Q A;  3VYT B;  1P9Q C;  2LH9 A;  2VIX A;  1WJF A;  4HEA 2;  2O5R A;  4F91 B;  3OYD A;  2ZXI A;  2DT7 B;  2Y0S A;  5CPR B;  1T95 A;  4CCM A;  1WJD A;  3SZG A;  5LFA A;  3A4C A;  4XOT A;  2KPM A;  4C2U A;  2R7Q A;  1KON A;  2KMU A;  1D0Y A;  1X1B A;  3AFH A;  3DQV C;  3DPU A;  2CW7 A;  3PUB A;  3OL3 A;  2XDV A;  3L2V A;  2CUZ A;  2PJR A;  3PJR A;  2KZV A;  2WAQ A;  4ITV A;  2VXZ A;  1D1C A;  1LVK A;  2W4S A;  4XKW A;  4OAZ A;  1G8X A;  2MAB A;  3DKX A;  1X4P A;  3H35 A;  4OWR B;  3OYE A;  2M3A A;  1Z21 A;  3M1C A;  2V4J C;  2VKH A;  2X6W A;  4KT6 A;  4PFO A;  3BC8 A;  3DU6 A;  2W1O A;  3AL0 B;  2HZD A;  2HDW A;  2OUM A;  2CUJ A;  4AYB A;  3ZQQ A;  5FRO A;  2R7U A;  2M4G A;  3HOT A;  2JA2 A;  1MW7 A;  4ZJZ A;  4YEJ A;  3PNV A;  1MMA A;  3OR1 C;  3UNG C;  3VSK A;  2R7R A;  4F52 A;  3OYM A;  3K4K A;  4CZC A;  2X1D A;  2IS4 A;  3DU5 A;  2CH0 A;  5CQE A;  2VQC A;  3OWT A;  3ZR8 X;  2F5V A;  3A2K A;  4XM3 A;  2X85 A;  4AVZ A;  3DKY A;  3VYU B;  3TL4 X;  3K70 D;  1N78 A;  4B48 A;  3EPZ A;  2DT6 A;  2P0W A;  5KCM A;  3D5R C;  2JSP A;  5LD2 C;  3K4J A;  1GLN A;  4JQF A;  2WAE A;  2FUG 2;  3MKY B;  1Z3X A;  1UAA A;  1Y6I A;  3H5A A;  2HQA A;  2KRC A;  3NWS A;  4GRI A;  4PSX A;  3G2B A;  2GOX B;  3F9K A;  3HOS A;  3ONQ A;  4E7I A;  1S9H A;  4NC8 A;  3W2V A;  2IGK A;  2JVG A;  4PJM A;  1BOB A;  3EUH C;  2MYS A;  1WJE A;  1VZ0 A;  4QPQ A;  2WB1 A;  3OS2 A;  2IGM A;  4D9J A;  3MKW B;  2V6E A;  2NOJ B;  4P1W A;  3OY9 A;  3L2Q A;  3K4L A;  1W36 D;  3PNT A;  1PYV A;  3LL7 A;  3VYS B;  4RM3 A;  4BE0 A;  3DWL E;  3GBG A;  4CSW A;  1YE9 A;  3E1S A;  3L2U A;  3ZRG A;  1FMW A;  2ZFU A;  3FHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...