3FF5A

Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal biogenesis factor 14
publication title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix protein import receptor, Pex14p
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 21
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ff5A00
3GFIA 3DEUA 1O57A 1KGSA 1W7PA 2G7HA 3FXUA 2BGCA 1WSUA 1Z1DA 4LB5A 3DXJF 1OMIA 1T39A 3WGGA 5JFRA 5F1RA 2G7UA 3HTUA 1HW1A 2DPUA 4BHPA 2A69F 4EJUA 4U0YA 2RVCA 1PUEE 2GWRA 4O3MA 1TNSA 2HR3A 2P7VB 3KP4A 1HW2A 2OD5A 2H6CA 1J75A 4Q4ZF 5HS7A 3L9FA 1O3QA 3P7NA 4ESFA 1BBYA 3B02A 4G8XA 1XSXA 1SD4A 5ILSA 3I53A 3K69A 4UNOA 5IT9Z 3CJNA 1YFHA 3IL2A 2X0LA 2KIFA 5E1WA 1DUXC 5LHIA 2FF4A 2D1VA 3P9KA 4BH9A 4WK8F 3MQ0A 5L3GA 4YFKF 2LF8A 5FLXZ 2IA2A 1U5TC 1MJBA 5DCMB 1Z05A 2QQBA 4LMYA 4M9SA 2R3SA 3REOA 4OIOF 3RPUA 1UFMA 4UV8A 4CGZA 2MA3A 3IWZA 2PQ8A 2CFXA 5DUIA 4OIQF 1WI9A 1KU3A 5TRDA 5JVTA 2LF7A 2GA2A 2EV5A 2R7FA 4L9NA 3I4PA 4L0YB 5LHGA 3GO5A 4L9JA 2O8XA 5E8IA 4NQWA 4RAYA 2IA1A 2VC1A 4HZFA 3KP7A 2ZMEB 4MTDA 4AVPA 2XROA 3FMQA 3BJ6A 3HHGA 4I7HA 1ZAOA 4I0AA 1GXQA 2DPDA 1P6RA 4HX7A 3MEXA 1YO5C 3FX3A 3R0AA 2CO5A 3DFGA 3NRVA 1XMKA 5KK1A 3QP6A 4G7OF 1E17A 1RZ4A 4ESBA 1B1BA 3P9IA 3QU3A 4WXCA 5DCFA 1W5TA 3WG9A 4YIFA 4OINF 3WTVC 4HF2A 4OOIA 2HZTA 4A0YA 2P5LC 1U5TB 4EJWA 2MLGA 5FFXA 1LEAA 3JW4A 4EMSA 4HV5A 3MZHA 3L7WA 2XKPA 4CZZA 3QOPA 3D5LA 2GAUA 4HDVA 4P9UA 2A3SA 1MZBA 3HRMA 3TO9A 2GIVA 3RTRA 4BNCA 5LBQA 2ADUA 3C7JA 3MWMA 4A0XA 2EV6A 5J8FA 4MEXF 5CVUA 2K7LA 3TGNA 5CJ9A 1ZREA 4HLXA 1KYZA 1I27A 1NHAA 4DNCA 1ZRCA 3ZMTA 2HGCA 4AIKA 1UHMA 1O3SA 1FNNA 2GXGA 4XBFA 1YW9A 4RGRA 3OV8A 4YFNF 4O6JA 1P2FA 4MEYF 1Z91A 3I64A 3ZMVA 3J80Z 1BI3A 2ZO4A 3NEUA 3C3WA 3W6JB 3E6BA 5D4SA 4P55A 1ZG5A 2LSOA 2PJPA 2ZXJA 1Z6TA 5CVJA 5E17F 4KN7X 1IW7F 2A68F 1ON1A 3I59A 3JAMZ 2VT3A 3ZP5A 3E5UA 1UCRA 2OU2A 5D8LB 1R58A 4LG0B 2IPQX 3T1BA 3BY6A 5A2QK 3GFMA 2HS5A 3TKYA 1ZARA 2P6TA 4YIIA 5TJJA 1X3UA 2ZFWA 2D2WA 5LLQA 2QQ9A 1KQ0A 1RI7A 1BIAA 2H09A 2BBYA 2HFHA 1FWZA 2UXXA 2H6BA 5ERIA 1OYWA 1TBXA 4LJZF 2AS5F 3KP6A 1OYIA 4AD9A 2RGVA 3FF5A 2RDPA 4GYIA 4IRIA 4R1HA 4BXUA 4EV0A 5DD8A 2QLZA 1H0MA 1V3FA 1MGTA 3E3VA 2VOOA 3HYIA 3IHUA 4A6DA 3M7GA 1T38A 4A0ZA 4ZYHA 1TTYA 1STZA 3F72A 2Z33A 3EETA 2QYOA 3H3UA 3HRTA 2BV6A 5BQTA 1IN4A 3KP2A 2IT0A 1IN6A 2DTRA 5D8KB 1FOKA 2O6GE 3R0JA 5IT9K 1FPQA 2PI0A 4BHBA 2EK5A 2CYYA 5D6EA 2ACJA 2L3DA 2A6HF 3I54A 4HX8A 2M87A 4UV9A 5BS6A 2FQ3A 1SD7A 1FZPB 1H9GA 3V8JA 4ENKA 3SHFA 4Y17A 4OIRF 2M30A 4N9IA 5FLXK 2ETHA 1K78B 2F5EA 3ECOA 1IRGA 4FHTA 2JTVA 3GWZA 4P96A 1LDJA 4JBAA 1W5SA 3SZTA 4U7DA 5JHUA 5FFZA 2O03A 1G3YA 2WC2A 1OR7A 2ZNYA 1U8RA 3VB2A 5EEGA 3JTGA 4ETSA 1RUNA 1IF1A 4LLGF 1O7LA 1REPC 2L01A 3E97A 1B6AA 4XSZF 2C6YA 1USTA 2STTA 2OZ6A 1ON2A 3F3XA 2NNNA 5BMZA 5E20A 1BIBA 2BE5F 4TV7A 1FY7A 4MNUA 4XLPF 2W25A 3VEPA 2HQNA 4KNYA 4HQEA 5AIPA 2FMLA 3FZVA 4WX9A 3V8LA 4ENMA 1R5HA 3DPTA 3KZZA 3M9AA 4FX4A 4ZYGA 3MAJA 1G3SA 2DQLA 2KRFA 2ZJ2A 1MJ9A 1S7AA 2RNJA 3HHHA 3TOBA 2A61A 2QUFA 4L5IA 3TDZC 3FMSA 3GF2A 2EB7A 4HQMA 1J0RA 1CF7B 3R61A 3GZ6A 1YS6A 2WTEA 5HLGA 2RN7A 1IAWA 2K4JA 3WTYC 2XAQA 4CHUA 1ZHFA 2DW4A 4K2EA 2MC3A 2P4WA 5D5VB 1RUOA 3I5UA 4LLLA 3DKWA 4KMFA 2XAGA 1ONVA 4RB2C 4R79A 2EV0A 1HSTA 4I98B 1HKTA 2V9VA 4AIJA 3HRSA 2A5YB 1D3YA 1ZLKA 3QPTA 2HQRA 5KVRA 4ASNA 1Z6RA 4KUMA 1FP1D 2FBHA 2HKXA 2WV0A 1IXRC 4JK1X 4EM2A 1KU9A 1EV7A 1YLFA 2HDCA 1F9NA 4HBLA 3J80K 3TO6A 1XSVA 3VODA 3ZMUA 2GXBA 2YPRA 1KQ9A 3K1PA 4QLCU 1IXCA 3GX4X 4A2UA 4RS8A 3RKXA 2GQQA 5LEKA 3LAJA 2M5WA 1R7JA 4OU0A 2IA0A 4UVAA 1TQMA 1KYWA 3U2RA 3JAMK 1XGMA 3BJOA 2FA5A 1GXPA 3ZMDA 2HEOA 1F4KA 1LB2A 3TO7A 3ISPA 4LFUA 1D5VA 4MQ9F 4EM1A 3CO6C 3QU6A 3KETA 4QWQA 4M9ZA 1WRJA 5K5QA 3R60A 4KYWA 1O7FA 4I09A 2L02A 1HSJA 3MCZA 3J81Z 4BYYA 2V79A 4I02A 5D6FA 3R6SA 2QZ8A 5BPDA 1XSDA 3P9CA 1LVAA 1HW5A 1BN5A 2FOKA 5K1YA 3IWFA 2HKOA 3F8NA 1XCVA 4PGHA 2V6CA 4UUVA 2VOPA 2FMYA 3RJPA 4YG2F 3HRUA 2O0YA 4ENJA 3PFIA 3PQKA 3D0SA 1DP7P 2Z99A 4IRGA 2XUBA 5E18F 1K7AA 3V7RA 6PAXA 3DV8A 3KZYA 2CQKA 4RB1A 3ERED 3RKWA 3GVAA 1BI1A 1QO0D 1K6OA 3C1DA 2FU4A 1ZG3A 2KIMA 1EH7A 1E2XA 5HDNA 3FXQA 1OKRA 3S2WA 1S8NA 5FB2A 1T98A 2EFQA 1J2XA 4Q48A 2KIUA 1Z7UA 3HSEA 1R1VA 2F5FA 2YR2A 4GO1A 4L9TA 4HF1A 1ZRFA 1HKQA 5K5OA 2VBXA 3K1NA 4MGRA 5LRRA 4RGXA 2Q2EA 3KEQA 1SFUA 1YW7A 1W7PD 4HLYA 4IF4A 5ICFA 2AXLA 2JSCA 4KDPA 1W7PB 3K1MA 2P5KA 4DQ2A 1SFXA 1XCBA 2XASA 1EH6A 2L54A 3ELKA 2K02A 3E6CC 5FD6A 5AIQA 3CUQA 2D45A 2PG4A 2CSOA 3MFKA 2Q8KA 3DPLC 5L3BA 1ULYA 5LGTA 3F6VA 3WTXC 1FP2A 5ILUA 4I01A 4HX4A 4JQFA 3LQQA 1LDKB 2DAOA 4A12A 1XDUA 3ZMZA 4WXHA 1TNTA 4CDGA 1IRFA 1B4AA 3RI4A 2MH2A 2OA4A 3IRQA 3IRRA 3AAFA 4UVBA 2O61A 4KT5C 2EFOA 2FBIA 1OPCA 3KCCA 4ZYDA 1QQIA 5BOXA 1PP7U 1Z9CA 2PMHA 2EWNA 3LSTA 1SMYF 1WQ2A 3V4GA 2NNYA 1LDDA 2NS0A 4A6EA 3ECHA 2HYFA 4G6QA 1W4MA 2OBPA 1TLHB 1BC8C 2E7XA 1MDMA 3SXYA 1R23A 1U3EM 2F5DA 5HLHA 5CVVA 5F64A 4LGWA 2CGPA 1I1GA 1S7OA 1FT9A 3HOSA 1ZN2A 3KP3A 3GEZA 3V7CA 2MBFA 1T0FA 4KIFA 4Y13A 3KLOA 3GFLA 4O5VA 4RGSA 1HQCA 3LA2A 2XAJA 1ZRDA 4HYEA 1MKMA 2B0LA 2QBYA 1R36A 4CICA 3K2ZA 2Z5UA 2O3FA 1IN5A 2DK8A 2YU3A 2DQRA 4B09A 5H6RA 3BPXA 5ICGA 3WGIA 4Y15A 3HOTA 1MD0A 4EM0B 4RGUA 1I1SA 3CTAA 2VE9A 3JTHA 5HS8A 5CVIA 1IZ1A 3KP5A 2H27A 2K4BA 2KKOA 1C0WA 4KMUX 1ZG1A 2PEXA 2V1UA 3GZ5A 2E1CA 3L2CA 2ESNA 2R7DA 4P9FA 3BWGA 2X4HA 2XIGA 2VBWA 2EJRA 2L4AA 5J8CA 1SFEA 4HAMA 3WU0A 2DI3A 2UZKA 1ZGAA 2GZWA 2VONA 2W84A 2Z3YA 3M1EA 3EYIA 2DU9A 2CWEA 3KE2A 3V8KA 1XB4A 3GYHX 1XDSA 4RB3C 2VE8A 2E1NA 2EFPA 2HTJA 4RAZA 4N9HA 2CG4A 4IRHA 1XD7A 4LLNA 2XHKA 2COMA 1ZYRF 2YX4A 4ZZDA 4KIGA 3WTTC 2JZYA 4XSXF 1GHCA 3K0LA 1KU2A 1MJAA 4HV6A 2RKHA 5J6XA 1PP8F 2HWVA 1JHFA 2VN2A 2PMUA 3WTWC 5LGUA 4ZH4F 1J7KA 4ZZLA 3TQNA 2IJLA 3N4MA 2K86A 2PFBA 2QVOA 1SAXA 2VXZA 5L3CA 1L3LA 2LDUA 1SD5A 3JSOA 1VTNC 4U88A 2BEOA 2GA1A 2QENA 1IUYA 1QPMA 1Y0UA 1TQIA 1ODDA 4IVNA 4IXAA 5ICEA 4HA8A 5DCMA 3GFJA 5ICCA 4D0PA 3F23A 2Q0OA 4FX0A 4LB6B 4GYGA 5FO5A 4CYDA 3T8TA 4NB5A 3I59B 3DQVC 3QAHA 2BYVE 2OQRA 3GXOA 4WCGA 3CDHA 3M8FA 2Z9OA 1I6XA 3LQRA 3ZPLA 2MD5A 1USSA 3G73A 2ZMEA 3KLNA 2RC4A 3DF8A 4HW0A 2VT2A 2XAFA 4BAYA 2EFNA 1YW8A 3T0YA 5CLSA 1HKSA 3Q5FA 3TDUC 1HXDA 2IRFG 2DO7A 2JPCA 3FHZA 3BROA 1L0OC 1XGNA 3HTSB 4UHTA 3RPQA 3BOQA 2IP2A 3V7SA 2KJCA 4I0BA 4FT8A 3QP5A 2ZKZA 1F1ZA 1JE8A 4OMZA 1U5TA 1TW2A 2NRAC 3WTZA 1ZGJA 3WGHA 1FSHA 2P8TA 2HYGD 1BI0A 4Q5SF 3TOAA 4EJOA 4M73A 1QBJA 1D8KA 3F22A 1A04A 2FNPA 3ULQB 1O3RA 2PN6A 4EJVA 2NYXA 3ZQ7A 4I2OA 4PGGA 1CGPA 4HF0A 2FEZA 1LQ1A 3M8EA 4R8HA 2W24A 5K5RA 3HSFA 3C18A 4MQVA 1KQ8A 5DUKA 3PQJA 2YX7A 4XRFA 4KA4A 2P7CB 4IPAA 5JI6A 5H6QA 3RDIA 1XGSA 3F8FA 4EGYA 3ML6A 2A07F 2TDXA 1EH8A 3RYRA 2OAZA 2D1HA 1WKMA 3E6MA 3COAC 4EJTA 5D5UB 1BJAA 1HBXG 3EUHA 4ON0A 5DD4A 3F8MA 3FM3A 1S3JA 2RV8A 4LK1F 2E7WA 1YIOA 3SFZA 2XRNA 4LG0A 1B9NA 1J59A 3G3ZA 4Q47A 4U0VA 4RB0A 1QZZA 4MTEA 5D5WB 3WE2A 4GGGA 4AIHA 1BOAA 3CO7C 3E5QA 5LGNA 1AWCA 1DPUA 2V1XA 1YG2A 2XV4S 3I0TA 1S6LA 1P92A 4KN4X 4M74A 1WWXA 3LA7A 1YTYA 3QRFF 3E5XA 3NQOA 4WF2A 4A5NA 4M6YA 2ISYA 5FD5A 1DPRA 4KICA 1FSEA 3WODF 3IKTA 2A6EF 4S04A 4N0BA 5JR3A 1R22A 1FX7A 1I5ZA 3WU1B 3F8BA 2RQPA 3Q9VA 1R5GA 2OQGA 1S29A 4PZJA 1R1TA 1FYLA 5L3FA 3J7AO 1B9MA 2VODA 1IN8A 1O3TA 2M45A 3O2PE 2VBYA 3GLXA 3ABTA 2F5CA 3K9TA 3SQNA 3WTUC 4L9VA 2FBKA 1JHHA 2DBBA 3LFKA 1K78A 4F7ZA 1ZH5A 2QWWA 4G6DA 3E6DA 4XLNF 1YS7A 2HOEA 5DDGA 1P4AA 3IC7A 1FBUA 1V4RA 2ZNZA 4KFCA 4IHTA 3F21A 2ZBKA 3HSRA 5EEHA 1DDNA 1FC3A 1PDNC 1FYMA 1KU7A 5ILVA 3ZN1A 3L00A 2V1DA 2J5OA 3OOPA 4IHSA 3BJAA 5F6FA 4BHCA 3H92A 1G6NA 4GXOA 2ELHA 1U2WA 4ZYEA 3VOEA 3ZMSA 3FWEA 3N97A 1T6SA 4EQQA 3Q9SA 3F6OA 1ZLJA 2FSWA 4EVIA 4L18B 4KIBA 1LJ9A 1AOYA 3FM5A 1XGOA 2JRTA 4M71A 4UXNA 5CVRA 3CUQC 3LAPA 1UHWA 3EYYA 3U9GA 3CLOA 1Q1HA 4B8XA 4A5MA 3EDPA 3O6BB 5DEQA 1XN7A 4MHGA 3GUDA 4NHJA 1FLIA 5HOOA 2VC0A 2FE3A 2MLKA 1T2KA 4CXFA 4G9YA 3CUOA 3LA3A 4HOBA 2W57A 4ESJA 3MZYA 4M6XA 4G7ZF 1CF7A 2QQAA 1RNLA 2Y75A 1G3WA 1B59A 3ROUA 5D5XB 3W6KB 5DV5A 4E70A 4H0EA 4ENNA 2STWA 1XMAA 2JT1A 1UB9A 1QZYA 3BPVA 3R4KA 2MH9A 1F5TA 5LEJA 2WWYA 5HLIA 4WWCA 5E1XA 1TQPA 2JPBA 2NAZA 4EGZA 3FMRA 1R1UA 1YYVA 1IXSB 3O3KA 2XGXA 3WTSC 2UWMA 2Y48A 1JGSA 3ZN0A 4G7HF 3B73A 3BP8A 2XAHA 4UVCA 3RKYA 4OMYA 3LWFA 3WE3A 4OIPF 1BC7C 3CUQB 2FXAA 3IKVA 2M8EA 3HUGA 5L3EA 5E8GA 3F8CA 3KFWX 3J81K 4L0ZB 1FYKA 2ZCWA 4G94A 3RYPA 2EA4A 1SD6A 3HIFA 2M1BA 2FRHA 4U7BA 5HDKA 2KJBA 4LK0F 2QM3A 1YQAA 2P6SA 4PDKA 1QGPA 3L09A 1IN7A 3ABUA 5AONA 2IVMA 2Y0MA 1FBQA 2FNAA 2EFWA 3QPHA 3I58A 2XVCA 1RIOH 1LNWA 1J5YA 5LRSA 1FBSA 1U78A 2ISZA 3RIRA 5LHHA 2LKPA 4M9XA 4GCVA 1D8JA 1G3TA 2IW5A 1BI2A 2J5PA 5IT3A 4CO8A 1SMTA 3SZPA 1MDMB 2H94A 2K27A 2LNBA 2PLYA 1R00A 5H20A 1P4XA 1U6GA 4BQAA 3T5XA 3GW2A 2EA2A 5FGMA 2W85A 5ED4A 4WXDA 2G9WA 4HDUA 1OYYA 3U1DA 2UXNA 2DK5A 1LEBA 5HS9A 4S05A 4P5OA 1P4WA 4IJAA 1KA8A 2L4MA 2QBYB 1H9TA 2YSRA 5D4RA 2ESHA 3VFZA 5HDGA 1BM9A 3H3ZA 2CW0F 3FXRA 4AWXB 4M72A 2VBZA 3KEOA 1K79A 1QNTA 5E1ZB 2XKOA 2OZUA 3DP7A 4U0WA 4YFXF 2DT5A 3JSPA 2DFIA 5BPIA 5L3DA 4L5JA 4PCQA 1G4DA 3BDDA 3I71A 2F2EA 1TW3A 1J9IA 1JXSA 2PBIA 2DLLA 1GVJA 5DYMA 5CYVA 4Z2YA 5A2QZ 3T8RA 3EQLF 3BZ6A 4LD5A 2HTSA 5HVQC 2P5VA
chains in the Genus database with same CATH superfamily
3GFIA 3DEUA 1O57A 4RLQA 3TEDA 3H35A 2O8KA 1SAUA 1KGSA 3RQIA 3HOXJ 1W7PA 3CCSI 2WY8Q 2R92J 4MO7A 2G7HA 3FXUA 2BGCA 1BA5A 1WSUA 2V7FA 1Z1DA 2VPRA 4M3BA 4E6KG 1D1BA 4LB5A 1ETOA 2F6CA 3DXJF 1OMIA 4BBRJ 3VYSB 3K4KA 3PIPF 1T39A 4CSWA 4M3EA 1MBKA 3HDDA 3WGGA 2ZFUA 5JFRA 5F1RA 3H5RA 2G7UA 5BNGA 1LKXA 2R7OA 4C2TA 3HTUA 1LPQA 1YRNA 3S8PA 1XG1A 4XNFA 3RZOJ 3A01B 2HPIA 1HW1A 1VQKI 2XPVA 2DPUA 4BHPA 2A69F 4E7HA 4EJUA 4U0YA 2RVCA 3GTJJ 2Y69H 1PUEE 3ONQA 4ZYAA 2GWRA 4O3MA 2M0CA 1TNSA 4AU7A 1JKQC 3LMMA 2VKHA 3LSRA 3S15J 3VWBA 2HR3A 2P7VB 1NH3A 2CRGA 3KP4A 3OYEA 2NS7A 2OD5A 1HW2A 2H6CA 3FXOA 1J75A 2H1LA 4Q4ZF 5HS7A 3L9FA 1O3QA 2CUEA 3P7NA 1GT0C 4ESFA 1HA8A 3ZRGA 2ZMEC 3LSGA 1BBYA 4BJTA 3B02A 3G2BA 4U87A 4G8XA 4HNUA 2LY2A 1XSXA 2JVHA 3ESWB 5B5EC 1SD4A 5ILSA 1EKEA 1MBJA 1AKHB 3I53A 3S3MA 3K69A 4Y52J 2ZJRF 4UNOA 5IT9Z 3CJNA 2VJJA 1X19A 3BCBA 2B7EA 1YFHA 4XL9A 2M4KA 3IL2A 3ABKH 1JUSA 2OF7A 2X0LA 1T8IA 5FKKA 2KIFA 2W4SA 2VXDA 3FXJA 3LSJA 5E1WA 1DUXC 4BDYA 1V5GA 3IUOA 4XKCA 5LHIA 2FF4A 1NK3P 2PX9A 3PM1A 2D1VA 3P9KA 3Q3SA 2K40A 4BH9A 4WK8F 3OYBA 1QPIA 1UJ8A 3MQ0A 5L3GA 3HGGA 4YFKF 2LF8A 5FLXZ 5B66C 2Y0SN 4AUXA 4E7JA 4X0GA 2XGCA 2HQ5A 3OWTA 2IA2A 3J7YJ 3S93A 1U5TC 2FQ4A 2I8DA 3OYNA 1MJBA 5DCMB 4B1RA 3CLQA 2XB0X 1S9HA 3PSFA 1ACIA 1NTCA 3L2UA 2HZDA 4NC8A 3DWLE 4XOTA 1Z05A 2KPMA 2QQBA 2CUFA 2WAQA 1GLNA 4LMYA 4M9SA 2R3SA 3REOA 2ZSHB 4OIOF 3RPUA 1UFMA 2JUCA 2UUZA 4UV8A 1XS9A 3TBIA 4CGZA 2MA3A 4P1WA 1P7JA 5JHFA 1YX5A 3IWZA 2PQ8A 2CFXA 3MZ8A 1ZGWA 5DUIA 4OIQF 1JI8A 1WI9A 1KU3A 1W5CC 3SEQA 4B47A 5JVTA 2LF7A 5TRDA 2GA2A 3FK7A 2EV5A 2GBYA 2R7FA 4L9NA 4UY8I 3I4PA 1S72I 5LHGA 3GO5A 4L0YB 4L9JA 3OYGA 1VFCA 4XKWA 2BVLA 5EF6A 2KDZA 2QEXI 2HQAA 2O8XA 5E8IA 4A3CJ 4XIDA 1GV2A 2L5QA 1X1CA 4BE1A 2KZVA 4NQWA 4RAYA 2IA1A 1Y8RB 2VC1A 4HZFA 3KP7A 2ZMEB 4MTDA 5IP9J 4C3IJ 4AVPA 2XROA 3FMQA 3K10A 1YITI 3BJ6A 3HJEA 3HHGA 4I7HA 1ZAOA 2BHYA 4XN0A 4I0AA 1GXQA 2DPDA 1RRJA 1P6RA 4HX7A 2OC6A 4D7NA 1XTAA 1W36C 3MEXA 1YO5C 5J47A 1Y1VJ 4BE2A 4IHVA 4IOCF 3BR2A 2KP6A 4LITA 3FX3A 1D0ZA 3R0AA 2CO5A 3DFGA 3NRVA 1XMKA 3PL8A 5KK1A 4LOCA 2NOJB 3QP6A 4G7OF 1E17A 4UB8C 1RZ4A 3NARA 2LD5A 3NWSA 4ESBA 5EGOB 1B1BA 1MNDA 3EUHC 4M3GA 1U0JA 3P9IA 3QU3A 4WXCA 5DCFA 1W5TA 1D5YA 2VJ5A 3WG9A 4YIFA 2AQEA 1K6YA 4I76A 3W2VA 4OINF 3WTVC 1VQPI 4HF2A 2PMZN 1WI3A 3OYIA 3DKYA 1LFPA 4OOIA 2HZTA 1TWHJ 4A0YA 2P5LC 1U5TB 2L7ZA 2ZXWH 4EJWA 3JR9A 2FUG2 2MLGA 1IGNA 5FFXA 1LEAA 2E60A 3JW4A 3M4OJ 4D1QA 4EMSA 4HV5A 1T95A 4EEFG 5K7ZA 2BXYA 3I4NJ 3SZGA 3MZHA 2KT0A 2DCEA 3L7WA 2XPWA 2XKPA 4CZZA 2CQQA 3QOPA 2GOXB 5CPRB 1WJDA 4YIRX 3D5LA 1J09A 1QHGA 2GAUA 4HDVA 1IC8A 4P9UA 2A3SA 4FQGA 1MZBA 2E5NA 1ZQ3P 3HRMA 4A3JJ 3JRAA 1IRXA 4J01A 3TO9A 2GIVA 3RTRA 4BNCA 4IHYA 1VQLI 1VI0A 5LBQA 2ADUA 5J1RA 5FLMJ 3C7JA 3CMEI 3MWMA 4A0XA 2EV6A 5J8FA 1EA3A 4MEXF 5CVUA 2K7LA 3TGNA 1ZR2A 5CJ9A 1ZREA 4HLXA 1KYZA 1I27A 1NHAA 4CCMA 4DNCA 1ZRCA 3ZMTA 2KQRA 2HGCA 4AIKA 4MLOA 2K9MA 1UHMA 1O3SA 1FNNA 3BTLA 4IHXA 2GXGA 3DTKA 3I55I 4XBFA 1YW9A 2D5VA 4HNVA 2RREA 2LK2A 4RGRA 1U9OA 3OV8A 4YFNF 1OCTC 4YRVA 4O6JA 3K4LA 5IYCJ 1P2FA 4MEYF 1Z91A 3QYFA 3AFHA 3I64A 4KISA 3CESA 3HPHA 3ZMVA 3J80Z 1N77A 1BI3A 2ZO4A 3GTQJ 3NEUA 2F48A 3C3WA 3A02A 3CF2A 3W6JB 3E6BA 5FJ8J 3CMMA 2K3FA 5D4SA 5H2FC 4E7ZA 4P55A 1KZHA 1WZ2A 1ZG5A 2TCTA 4JX5A 2LSOA 3IAS2 2JRMA 1SVOA 1YI2I 2PJPA 3HB9A 2ZXJA 1Z6TA 5CVJA 4YEJA 1Y6IA 5E17F 4KN7X 4HEA2 1X1DA 1IW7F 3BR1A 2A68F 2V26A 4XKVA 2DA3A 5J4VA 1ON1A 3CZ6A 2W7NA 3KYDB 3I59A 2DTZA 3JAMZ 3RKQA 2VT3A 1KONA 3ZP5A 3E5UA 1UCRA 5IP6A 4PK4A 1K4SA 2OU2A 3HKZN 5D8LB 1R58A 4LG0B 2IPQX 3Q0UA 5KAFC 3T1BA 3U21A 2XC7A 3FBIB 1YIJI 3BY6A 5A2QK 3GFMA 2HS5A 3TKYA 4BXXJ 1ZARA 3DTIA 3GBGA 2P6TA 2JSPA 4YIIA 5TJJA 1OLTA 2ZFWA 1X3UA 1X58A 4OAZA 3JRFA 2D2WA 2KHMA 5LLQA 3HOZJ 4X6AJ 2QQ9A 2DDBA 2KRCA 1KQ0A 1WJ5A 1RI7A 1BIAA 2H09A 2BBYA 2VQGA 2TRTA 1MH3A 2HFHA 1FWZA 2UXXA 1O4XA 2H6BA 3BZKA 5ERIA 1OYWA 4HSRA 4CCJA 1TBXA 2DMQA 3QWLA 4BDZA 4A3EJ 1LE8A 4MIMA 3KZIC 1QZEA 4LJZF 2AS5F 2EQRA 3KP6A 1OYIA 4AD9A 4J00A 4RBOA 2RGVA 3FF5A 2RDPA 4GYIA 4IRIA 4R1HA 4BXUA 4EV0A 1YJ9I 1FJLA 5DD8A 2HYJA 2QLZA 1H0MA 1V3FA 1MGTA 3E3VA 3K4CA 2VOOA 3QPSA 3HYIA 3IHUA 4A6DA 3M7GA 1WH7A 1T38A 2M3AA 1H8AC 1XMXA 5F0CA 4A0ZA 4FE4A 1BW6A 2DXIA 4ZYHA 1WJEA 1TTYA 1STZA 2CJJA 3F72A 4XRSA 1GVDA 2Z33A 3EETA 2E5ZA 4XKBA 3AL0C 2JJ7A 4G12A 3BTCA 2QYOA 1A31A 4ZTJA 2AHQA 1R9TJ 3H3UA 3K4NA 2X1CA 3FXLA 4E7SA 2NVTJ 3HRTA 2BV6A 2VL8A 2BW3B 5BQTA 3BG6A 4DGWB 1IN4A 1VZ0A 3KP2A 3OS0A 2IT0A 1E3PA 4NDLA 1IN6A 2DTRA 3QYEA 5D8KB 1FOKA 2E2IJ 2O6GE 2E1MC 3R0JA 1SVLA 3ZQIA 3HZJA 5IT9K 1FPQA 2PI0A 2YUSA 4BHBA 2EK5A 2CYYA 2IAIA 2PMZA 5D6EA 2ACJA 2L3DA 2A6HF 2XDVA 3DKXA 3I54A 3JREA 3LSHA 5FROA 4HX8A 2M87A 1UZCA 3LSKA 4UV9A 5B1BH 5BS6A 2FQ3A 5EG0B 1SD7A 1FZPB 3ABMH 2OCEA 1H9GA 4B44A 4PSWA 1Y56A 3V8JA 1X3ZB 4ENKA 4DBQA 3SHFA 3FKIJ 1Z77A 4Y17A 4OIRF 2DYRH 2M30A 2NVYJ 4N9IA 1R4MB 4CCLA 5FLXK 2ETHA 1K78B 3S3OA 2F5EA 3ECOA 1WGXA 2WV1A 1IRGA 4FHTA 2JTVA 1SFOJ 1LFBA 1A6IA 1DGRM 3GWZA 4P96A 1LDJA 4JBAA 1W5SA 2M7BA 3SZTA 4U7DA 5JHUA 5FFZA 2DT6A 3JRDA 4II3A 2O03A 1G3YA 2WC2A 1OR7A 2ZNYA 1U8RA 3KYCB 3E1SA 3VB2A 2CFOA 5EEGA 5F0HA 3CCMI 3GTLJ 1LVKA 3JTGA 2MABA 2K3PA 3MMYB 1YJWI 3EUAA 2PJRB 1RETA 2ZC2A 4ETSA 5EJCA 1W0TA 1X1PA 1RUNA 1IF1A 4LLGF 1DGWY 1O7LA 1REPC 2L01A 4KJZA 3E97A 3OYLA 1B6AA 4XSZF 5IYBJ 2C6YA 4PJNA 2VASA 2WADA 2XSJC 2B63J 2HXOA 1USTA 4XQFA 3HGYA 3LSPA 2STTA 2OZ6A 1ON2A 3F3XA 1JJ8C 1UELB 2NNNA 2HOTA 5BMZA 5E20A 2CV0A 1BIBA 3CCJI 3PO3J 2BE5F 2ICWG 4TV7A 2LRDA 1FY7A 4MNUA 4E7IA 3AL0B 3H9GA 1I50J 3D5SC 2W25A 4XLPF 4ZDOA 3VEPA 2HQNA 3H36A 4KNYA 3BG3A 4HQEA 5AIPA 1WPKA 2FMLA 3FZVA 1Z7LA 2V4JC 3V8LA 4WX9A 1Z3XA 4ENMA 2YS9A 1R5HA 3DPTA 3KZZA 3M9AA 4JYKA 3M8JA 4ZYGA 4FX4A 1PYVA 4UUSB 2R7TA 3MAJA 4ZTFA 2E1MB 2Q1ZB 1G3SA 2IGNA 2DQLA 2KRFA 5GTIC 2L0KA 2ZJ2A 1TT5B 3BG5A 1SVMA 1MJ9A 4DBRA 1S7AA 1Y0NA 3AG4H 4ABZA 2RNJA 1RC9A 3HHHA 3TOBA 4HG2A 2KLOA 3A0HC 3PNTA 2K85A 3ZXSA 2VUMJ 2A61A 2QUFA 4L5IA 3TDZC 4PJMA 1ETVA 3BTIA 4D5CA 3FMSA 3GF2A 3CC2I 2JA7J 4GDFA 1VQ6I 3GZNB 5JLXA 3S14J 2EB7A 4ZJZA 3BR6A 4HQMA 1J0RA 2KFDA 4L5EA 3UKGA 3CJRB 2R5ZB 4FE7A 1CF7B 3R61A 4XMYA 3GZ6A 1YS6A 3A0BC 2BXZA 2WTEA 4V2FA 5HLGA 2RN7A 3IAM2 1OR7C 1IAWA 4JOMA 3IH2A 2K4JA 3WTYC 2XAQA 4CHUA 1ZHFA 2DW4A 3MKWB 4K2EA 2MC3A 2P4WA 5D5VB 5EYRA 3L2VA 4XRMA 3CQZJ 3QODA 1RUOA 3S17J 1G2HA 1OISA 2Y9ZA 4GFBA 5B1AH 4BJ5C 3HOVJ 3I5UA 4LLLA 3DKWA 4CUGA 2R5YA 4KMFA 2XAGA 1ONVA 2QKMB 4RB2C 1V54H 4R79A 1S5LC 3AG1H 2KRHA 1LFUP 2EV0A 1HSTA 4I98B 1HKTA 2V9VA 4AIJA 3HRSA 3OR1C 4D5FA 2A5YB 1MH4A 4NBQA 1D3YA 3PUBA 1ZLKA 2X6WA 3AKZA 3QPTA 3K4JA 2HQRA 5KVRA 4ASNA 1Z6RA 4KUMA 2VLAA 1FP1D 1GUUA 1PUFB 1VQ9I 1WHUA 2FBHA 2HKXA 1W1WE 2WV0A 4BE0A 3JRIA 4W97A 1IXRC 1MSEC 4JK1X 4MFEA 2VI6A 4EM2A 2ELKA 3PUFA 3GTPJ 1KU9A 2IEKA 1EV7A 1YLFA 3CCLI 1FIAA 2HDCA 4CYCB 2HDWA 1F9NA 3MKYB 4HBLA 5FKLA 4KITB 2HVRA 3J80K 3JCUC 1IDYA 3TO6A 2CW7A 2ZXIA 1XSVA 2VQLA 3VODA 4B3XA 3ZMUA 2GXBA 2E34A 3HUGB 2YPRA 1KQ9A 3K1PA 3IH4A 2MW8A 4QLCU 2L9SA 5KAIC 1IXCA 2CQXA 5F04A 3GX4X 4A2UA 4RS8A 1HCRA 3RKXA 5KCMA 1JT0A 3BTJA 2GQQA 1ITYA 5LEKA 2JA2A 4RAGA 3H1CA 5DM6F 3LAJA 1ETYA 2IS6A 3OMYA 3NWTA 2M5WA 4BEHA 3CDLA 1R7JA 1OCZH 4OU0A 2IA0A 4UVAA 1TQMA 1KYWA 3U2RA 3OR2C 4NNJA 3JAMK 1Y8QB 4D9JA 1XGMA 3BJOA 2FA5A 3JRGA 4XLHA 1GXPA 1D1AA 3ZMDA 2HEOA 1F4KA 1LB2A 3TO7A 4HNTA 1VQ4I 2VQHA 3ISPA 4LFUA 1E3OC 1D5VA 4MQ9F 4JX4A 2GXAA 1QU3A 4II2A 4EM1A 3EPZA 3CO6C 3QU6A 4HPQA 1EF4A 3KETA 4QWQA 1X2MA 4FETA 2JA6J 1X2NA 2EZLA 1WRJA 4M9ZA 1FMVA 1WJCA 5FRNA 1Y1WJ 3ERMA 4ZDLA 5K5QA 5LFAA 3R60A 4KYWA 1O7FA 4I09A 4M3DA 2L02A 4M6VA 4IO9F 1BL0A 1B8IA 3Q0WA 1HSJA 3MCZA 3ZGKA 3J81Z 4BYYA 2DODA 2V79A 1R6RA 4I02A 5D6FA 4W1UA 3SFIA 2VB6A 3R6SA 2V9KA 2QZ8A 5BPDA 1XSDA 1K83J 3A1YA 3P9CA 1LVAA 1K4TA 1MIJA 1HW5A 2CUJA 1BN5A 4PFOA 2K9SA 2FOKA 2V9PA 2JMWA 5K1YA 3IWFA 1WCMJ 3WHBA 2HKOA 3F8NA 4OAYA 3MKLA 2AXTC 2ZSIB 1XCVA 1V5EA 4PGHA 4B48A 1FIPA 2V6CA 1B72B 4UUVA 2FMYA 2VOPA 3RJPA 4AVZA 5M3FJ 4YG2F 2QSGX 4A3GJ 3HRUA 2O0YA 4ENJA 2NOGA 3O8GA 3PFIA 3PQKA 4Y4RA 3D0SA 1DP7P 2Z99A 3J7AY 4IRGA 2XUBA 1WFXA 2LFBA 5E18F 3HOYJ 1H88C 1VF9A 1K7AA 3V7RA 6PAXA 3DV8A 1MNMC 3KZYA 2CQKA 4RB1A 2LY9A 2IBDA 1DQUA 3ERED 4C2UA 3RKWA 3GVAA 1BI1A 1QO0D 3PO2J 2KL4A 1K6OA 2EPFA 3DBRB 3C1DA 2FU4A 2RAEA 1ZG3A 2KIMA 1EH7A 1E2XA 5HDNA 1VQOI 2M34A 3FXQA 1OKRA 4G6TB 3S2WA 2HVSA 1S8NA 5FB2A 4PSXA 1T98A 2EFQA 1J2XA 4Q48A 4CCOA 2KIUA 2DT7B 2E2HJ 2IS4A 1BR4A 1Z7UA 3HSEA 1R1VA 3DLLF 1M1EB 2RNGA 5M5XJ 3RQ4A 3U1KA 4A3DJ 2EBIA 5FRMA 1BR2A 2OTJI 2F5FA 2YR2A 4GO1A 4L9TA 3RCOA 4HF1A 1ZRFA 1HKQA 1IO2A 4F91B 5K5OA 2VBXA 3HPGA 3K1NA 4MGRA 2OJED 2M2EA 1I3QJ 5LRRA 4RGXA 1MSFC 3H9QA 1TWAJ 1Z0XA 3CMYA 1YHQI 2Q2EA 3KEQA 2H1KA 1SFUA 2VJ4A 1YW7A 1W7PD 2VKDA 3KYLA 4HLYA 4IF4A 2DJIA 5ICFA 2GIZA 2AXLA 2JSCA 3W3CA 2QCOA 1W7PB 2RQQA 3K1MA 4BACA 4KDPA 2P5KA 2DA5A 3DU6A 3KIOA 4NC7A 4DQ2A 1SFXA 5F0FA 1XCBA 2XASA 3K70C 1N78A 1EH6A 2L54A 3ELKA 2HDDA 2K02A 3E6CC 4IHWA 4A3LJ 5FD6A 3K6GA 2LG4A 4IQJA 3K4BA 5AIQA 3CUQA 2LKXA 3H9JA 1WH5A 1ETWA 2D45A 2PG4A 1PJRA 2CSOA 2Q8KA 1TWFJ 3DPLC 3MFKA 5L3BA 1ULYA 2XF6A 1YRNB 5LGTA 4N4OB 1TL8A 1VQ8I 3SDBA 3F6VA 2BY0A 3WTXC 1FP2A 5ILUA 4I01A 3ZCOA 5K7FA 4HX4A 1XC5A 4BBSJ 4JQFA 3LQQA 3H0GJ 1LDKB 2DAOA 3CCQI 2K5CA 1AA7A 2EIJH 2EIKH 4A12A 2B9SA 1XDUA 3ZMZA 1VQNI 4WXHA 1TNTA 4F52A 2DMTA 2X1EA 5C4JJ 4CDGA 3TW6A 2M9HA 1IRFA 1BOBA 2E2JJ 3PSIA 4QIWN 1B4AA 3RI4A 4BQOA 5IOYA 2MH2A 2OA4A 3IRQA 4RDUA 3OSFA 3IRRA 1QA6A 3AAFA 4UVBA 2O61A 4KT5C 1A35A 1N25A 4ANJA 1JTXA 3FHNA 2EFOA 2FBIA 2HU9A 1OPCA 1W36D 3KCCA 4ZYDA 1QQIA 5BOXA 3MD2A 1Z9CA 1PP7U 2PMHA 2EWNA 3LSTA 1MMDA 2L9NA 1SMYF 1WQ2A 3V4GA 4J19A 4OWRB 2ZJPF 1ZKGA 2NNYA 1LDDA 2NS0A 1JTYA 4A6EA 4QPQA 2NXNB 3H5NA 1POGA 3AG2H 3ECHA 4D7MA 2HYFA 5E79C 4G6QA 2LREA 1W4MA 2OBPA 3I4MJ 1R4NB 1JUPA 1TLHB 2IGKA 1BC8C 2E7XA 2I10A 1MDMA 3SXYA 1R23A 1U3EM 1XPXA 2F5DA 4LG3A 4BXFA 3S1MJ 2X51A 5F1JA 5HLHA 1MMAA 5CVVA 5F64A 1R71A 4NUBA 3MVPA 4LGWA 2CGPA 3CCUI 1I1GA 1S7OA 1R49A 1FT9A 3HOSA 1U9NA 1ZN2A 2DDAA 2HI3A 3KP3A 3GEZA 2HVQA 4BJ6C 3V7CA 2MBFA 3RPUD 4F92B 1T0FA 4AIDA 2IGOA 1IUFA 2KMUA 4KIFA 4Y13A 4AM3A 3KLOA 1Z3YA 3GFLA 4O5VA 4RGSA 1HQCA 3LA2A 2XAJA 1ZRDA 4HYEA 5E3OA 1MKMA 2B0LA 2IGMA 1R36A 2WY7Q 3HL2A 3ZR8X 3CF5F 1AHDP 2QBYA 1OCPA 4CICA 3K2ZA 5IY5H 1QHHD 2Z5UA 2O3FA 1IN5A 2DK8A 2YU3A 2DQRA 3DPUA 4B09A 5HNHA 5H6RA 1TWCJ 3BPXA 1G8XA 1MBFA 2K9QA 5ICGA 3WGIA 4Y15A 3HOTA 1MD0A 3LL7A 4RGUA 1I3AA 4EM0B 2EILH 3CTAA 1I1SA 2VE9A 3JTHA 4NQWB 1Q1VA 5HS8A 1VQMI 5CVIA 3G1OA 1IZ1A 2R7UA 3KP5A 2H27A 2K4BA 2GM4A 4FISA 2KKOA 4DYRA 1HF0A 1C0WA 2LBFA 4C3JJ 4XR6A 4RLFA 4KMUX 3ABLH 1ZG1A 2PEXA 2V1UA 2R7QA 2X6XA 3GZ5A 4B3AA 2Y2ZA 2JA5J 4PJ0C 2E1CA 3VPRA 4RM3A 5HLTA 3OY9A 5TISC 3L2CA 2DFHA 2MYSA 2X48A 4ZDPA 2O5RA 2ESNA 4A3MJ 3CCYA 4UB6C 2E1OA 2R7DA 1UG0A 4P9FA 4XRSG 3BWGA 1F43A 1R5ID 3FIWA 2XPUA 2X4HA 3BQZA 2MSYA 2XIGA 2VBWA 2VQCA 1X1AA 2EJRA 2DA7A 2Y31A 2L4AA 5J8CA 3G4SI 1SFEA 4HAMA 2W00A 4LIUA 3QOEA 3WU0A 2DI3A 3OIQA 1PVEA 5GP9A 1ZGAA 2GZWA 2LOOA 2UZKA 5EZGA 2VONA 4PJJA 2W84A 2Z3YA 3M1EA 2WAEA 2EH3A 3ZQGA 4Y3OA 3EYIA 2DU9A 3FXKA 2CWEA 3KE2A 1ERDA 3TP0A 3V8KA 3A01A 4DYCA 1XB4A 3GYHX 3DU5A 1XDSA 2L9VA 3DCFA 2VPLA 4RB3C 2VE8A 3CCRI 1YE9A 2E1NA 2EFPA 2HTJA 4RAZA 4N9HA 3WG7H 2CG4A 2DA2A 4IRHA 3C2BA 1XD7A 4DJAA 4LLNA 3GTMJ 3OYFA 2XHKA 2JA8J 2COMA 1ZYRF 3K7AJ 2COBA 1T08B 2BHZA 2N8GA 2YX4A 1MW7A 1ZK8A 4ZZDA 4KIGA 5EEAA 4IQ4A 3WTTC 2JZYA 4XSXF 4B4CA 5JLWA 1GHCA 4IOAF 3K0LA 1KU2A 1MJAA 4HV6A 5GAHJ 2RKHA 3W6VA 2QF7A 5J6XA 2DA4A 1PP8F 3GCMA 2HWVA 1AKHA 2Z16A 1JHFA 2VN2A 2PMUA 3WTWC 5LGUA 1TP4A 4BKXA 4ZH4F 3CCVI 4C9YA 4GRIA 5J3LA 1J7KA 3M1CA 1MNEA 3TQNA 4ZZLA 2ECCA 2IJLA 3N4MA 2K86A 2PFBA 2X6OA 2QVOA 1SAXA 1RKTA 2VXZA 5L3CA 1E3HA 1L3LA 1I39A 2LDUA 2KISA 3RSNA 3SDGA 2K9LA 5B3SH 1SD5A 1JT6A 4IL6C 1IV6A 3JSOA 4DW6A 3BLYA 1VTNC 4U88A 2BEOA 1HOMA 4IEJA 2GA1A 2QENA 2LP0A 1IUYA 1QPMA 5F08A 1Y0UA 4BS9A 1SANA 1TQIA 1ODDA 2CMPA 2OCCH 4IVNA 3GMEA 2CU7A 2L2OA 4IXAA 5TGTA 5ICEA 3L2WA 4HA8A 5DCMA 1JKPC 3GFJA 5ICCA 4D0PA 3F23A 2Q0OA 2R7ZJ 1Z67A 2EZIA 4BGDA 1HC8A 1FOYA 1JUMA 4FX0A 4LB6B 2EIMH 4RM2A 4GYGA 4JP0A 5FO5A 5GAEJ 2CQNA 4CYDA 3T8TA 3OYJA 4NB5A 2QQ8A 3I59B 4C3HJ 1APLC 3DQVC 2CS3A 3QAHA 3SYTA 2BYVE 2BY3A 4BQQA 3IP4B 2X85A 3E7LA 3GTOJ 2H8RA 2UV1A 3G71I 1DP3A 2OQRA 3GXOA 3SJMA 4WCGA 4NC6A 3CDHA 3M8FA 2Z9OA 1I6XA 3D5RC 3LQRA 3ZPLA 1X3WB 3CP2A 2GOMA 2MD5A 3CC7I 1USSA 3HEFA 4DYQA 3G73A 1N75A 2ZMEA 5FKNA 3G1MA 3DEEA 1LE8B 3KLNA 4A69C 1TT0A 2RC4A 3DF8A 4HW0A 5M5WJ 1ZTRA 1HDPA 2VT2A 2XAFA 1I6HJ 4BAYA 2EFNA 2VKEA 1YW8A 2K9NA 3T0YA 5CLSA 1HKSA 3Q5FA 2L7KA 1BR1A 3W2AA 3TDUC 2FJ1A 3VDXA 1HXDA 2IRFG 3QYBA 2DO7A 2JPCA 4B43A 1D0YA 2HOSA 3FHZA 1IV8A 5EGOA 4H4KC 3EUKL 3BROA 1L0OC 1XGNA 2W1OA 4S0HB 1YX3A 3HTSB 2WB1A 5GTHC 4UHTA 3RPQA 3BOQA 1BJZA 2IP2A 3V7SA 2KJCA 4I0BA 4FT8A 4XM3A 3VYUB 3GTKJ 3QP5A 2ZKZA 1F1ZA 2BY1A 5J4YA 1JE8A 4OMZA 1U5TA 4PUSA 1TW2A 2Z2SB 2NRAC 3WTZA 1YJNI 1RESA 1ZGJA 2ID3A 1NG6A 3WGHA 4XLCA 1FSHA 2CQ7A 3OIPA 3S1NJ 2P8TA 3NAUA 3OYAA 2HYGD 1BI0A 1Z21A 3TOAA 4EJOA 4Q5SF 4M73A 1QBJA 3OOUA 1D8KA 5DS9A 3F22A 1A04A 2FNPA 3ULQB 1O3RA 2PN6A 3I3LA 2DA1A 4EJVA 3BG9A 5IYDJ 3OYMA 2AO9A 1UHSA 2NYXA 4XONA 3ZQ7A 1FOWA 4I2OA 2O7OA 4PGGA 1CGPA 3F0CA 2M4GA 2KIQA 4HF0A 2FEZA 3B6CA 3RZDJ 2JVGA 3LSMA 1LQ1A 3M8EA 4R8HA 2BOLA 4PFPA 2W24A 2G0EA 5K5RA 4C2MJ 2KZGA 3HSFA 3C18A 4MQVA 2NVQJ 1KQ8A 5DUKA 2JK3A 4AC0A 4CCKA 3PQJA 2YX7A 2DOAA 3DTEA 2QA4I 2CV1A 2OV7A 5FKMA 4XRFA 2XSDC 2WBMA 1JKOC 4KA4A 2P7CB 2HNHA 1UMQA 2DYSH 4IPAA 5JI6A 1U8BA 5H6QA 2DFFA 5F27A 1A5JA 1MMSA 1X1BA 2A6TA 1RR7A 1WVRA 3RDIA 1XGSA 2IS1A 1ORKA 3KPHA 3F8FA 3IV5A 4EGYA 3C2GA 3ML6A 2LY1A 2A07F 2Y9YA 1S7EA 4IX7A 1F36A 2ECBA 1TZLA 1EH8A 2TDXA 3RYRA 2OAZA 3E0JB 2D1HA 1WKMA 1XX5A 3E6MA 5CKTA 4AYBN 1JGGA 3QPLA 2LC2A 1ZR4A 3COAC 4EJTA 5J40A 5D5UB 3CCEI 1BJAA 1HBXG 2LH9A 1E0EA 3ZOBA 2CUZA 2VKVA 1A36A 3DBHB 4BUPA 3EUHA 4BU2A 2M7AA 2FX0A 2A5WA 4ON0A 5DD4A 2R7VA 2P81A 4RA2A 3F8MA 3FM3A 1S3JA 5C44J 1TC3C 2RV8A 1OCOH 4LK1F 5EDNA 2E7WA 2DFEA 4XLEA 4DZJA 2R7XA 1YIOA 1GV5A 1WJAA 4BY7J 3SFZA 1D0XA 2CW8A 1MBHA 3BZCA 2XRNA 4LG0A 3GTGJ 1B9NA 1J59A 2JWTA 3G3ZA 1W0UA 2QGUA 2XGEA 2KDOA 1QRYA 5J1UA 3UNGC 4Q47A 4U0VA 5DTDA 4RB0A 5FLVA 1IG7A 2BVMA 2DMPA 2HOAA 4F93B 3K2AA 2R0QC 4N4NB 5IP7J 1QZZA 1ENHA 4MTEA 1Y39A 1SEUA 3B6AA 3HBLA 5D5WB 3AG3H 3WE2A 4GGGA 1BOAA 4AIHA 3CO7C 4F55A 3E5QA 2MD0A 3BC8A 2HPMA 2FOWA 4MFDA 3CD6I 4DZPA 5LGNA 1AWCA 1DU6A 4XOPA 4A3KJ 1DPUA 3ZQQA 2V1XA 1YG2A 2XV4S 4IZZA 2R7WA 3I0TA 4QPOA 2CV2A 4I6ZA 5GAGJ 3JRCA 1S6LA 4XICA 2A05A 3LFUA 3TMOA 1OFCX 3I9V2 2LTPA 3F9KA 3ZQCA 1P92A 4KN4X 4M74A 1WWXA 3LA7A 3OL4A 1YTYA 3O8HA 2WAFA 1MBEA 2MGQA 3QRFF 3E5XA 3NQOA 4WF2A 3S16J 4A5NA 4M6YA 2ISYA 5FD5A 1DPRA 3FK6A 2R5YB 4KICA 2EZHA 3A2KA 1WJFA 1FSEA 3WODF 3IKTA 2A6EF 1T33A 4S04A 4N0BA 5JR3A 1R22A 1FX7A 1ZELA 1I5ZA 1UAAA 3WU1B 3F8BA 2RQPA 3Q9VA 2BW3A 4M3FA 3OYKA 1ETKA 1R5GA 3V42A 1JKRC 4CA0A 2ZB9A 2ZJQF 4A3FJ 5EZHA 2OQGA 2LVSA 2DJNA 4YELA 1S29A 3VSLA 5DM7F 1WJBA 3HM5A 4PZJA 4QSHA 1R1TA 3FISA 3ZQLA 4HRIA 1FYLA 1G59A 5L3FA 3J7AO 1B9MA 2VODA 1ETQA 1IN8A 1O3TA 2M45A 3O2PE 2VBYA 3GLXA 4RMNA 3HOUJ 1X4PA 3L2RA 3ABTA 2ME0A 3WU2C 4X1EA 3H5AA 4XLAA 2R7RA 2F5CA 3K9TA 5EG0A 3SQNA 3WTUC 4L9VA 2LR8A 1ETXA 1UG2A 1T56A 2FBKA 2JQ7A 1JHHA 3A4CA 3TW7A 1YOVB 2L7MP 2MFZA 2DBBA 1TWGJ 4HSTA 3LFKA 1K78A 4F7ZA 3TP3A 1VQ7I 3H3VK 1ZH5A 3FBNB 2QWWA 2OUMA 3ASOH 3E6DA 3Q0VA 4G6DA 4XLNF 3OYDA 3LOCA 5M5YJ 1YS7A 2HOEA 2P0WA 3H0DA 5DDGA 1P4AA 2V6EA 3IC7A 4UUTA 3A03A 1FBUA 1V4RA 2ZNZA 4KFCA 4IHTA 3F21A 1V55H 2ZBKA 4E7KA 3HSRA 5EEHA 2IS2A 1DDNA 1NK2P 2NS8A 3G6EI 4XORA 1FC3A 2PJRA 4BEHB 1PDNC 1FYMA 3M07A 1KU7A 5ILVA 3ZN1A 3L00A 2YU9J 2MG4A 1MMNA 2V1DA 2J5OA 3OOPA 3CC4I 4IHSA 3BJAA 5F6FA 4BHCA 3HC7A 2VJIA 3H92A 3I56I 3ZQHA 1G6NA 1QVTA 2ELHA 1U2WA 4GXOA 3S1RJ 3PFYA 3OSGA 4ZYEA 1D1CA 3PNVA 4DOZA 4F3QA 4JX6A 3VOEA 1OJLA 3ZMSA 3FWEA 2NVXJ 3N97A 1T6SA 4EQQA 3UR3C 3J7ZI 3Q9SA 3OIOA 3F6OA 4CCNA 1ZLJA 2FSWA 5CQEA 1B8IB 5M3MJ 2R4GA 4Y33A 2ZXHA 4EVIA 4L18B 4KIBA 4AYBA 4CZCA 1LJ9A 3K70D 2LYCA 1AOYA 5LD2C 2O9LA 3FM5A 1XGOA 2JRTA 2H8WA 4M71A 4UXNA 3PIOF 2ME6A 1HLVA 3HXLA 1AU7A 5CVRA 4UUSA 3M3YJ 3G1LA 2XB5A 4BQNA 1MBGA 5K7HA 4XLFA 3CUQC 3MN2A 3VYTB 2Y0SA 2F4IA 3BR0A 4EATA 3LAPA 1UHWA 3EYYA 5IPAA 5IOZA 3U9GA 5C3EJ 4E7LA 3W2WA 3CLOA 1Q1HA 5CQGA 4B8XA 4A5MA 2XF5A 3FKJA 3C2HA 3EDPA 3HG9A 3O6BB 2OPTA 2F4MB 5DEQA 4IKFA 1XN7A 4MHGA 3GUDA 4NHJA 1FLIA 9ANTA 2JUGA 2I5UA 5HOOA 2VC0A 4BY1J 2FE3A 2MLKA 3CJQB 1T2KA 2XF7A 3BCAA 4CXFA 4G9YA 3CUOA 3LA3A 4HOBA 2FD5A 2W57A 1OQYA 4ESJA 3MZYA 2F5VA 4M6XA 4Z6YA 2IXSA 4G7ZF 4A93J 2R5ZA 1CF7A 2QQAA 4A3IJ 1RNLA 5KHDA 2Y75A 3OL3A 4E4HA 1G3WA 1B59A 3ROUA 3K4MA 1OCCH 2WA0A 5D5XB 3W6KB 5DV5A 2QSHX 4E70A 4H0EA 2E35A 4XN3A 4ENNA 2STWA 1A6QA 1XMAA 2JT1A 2MC4A 2WB1N 1UB9A 2DMUA 2VIXA 1FOXA 1QZYA 3BPVA 3R4KA 4A3BJ 2MH9A 3S2HJ 1EJ9A 1F5TA 5LEJA 2WWYA 1NG7A 5HLIA 3S3NA 4WWCA 5E1XA 1TQPA 2X1DA 2JPBA 2EINH 2NAZA 3DLAA 3ZQFA 4EGZA 3S2DJ 3FMRA 1R1UA 1YYVA 1X4OA 2BY2A 1IXSB 1RPWA 2X6YA 1FTTA 2L9RA 2L7FP 4QTRA 1QVUA 2Q2EB 3O3KA 1RR8C 1H89C 3BR5A 2XGXA 3WTSC 2UWMA 1PUFA 3JRBA 2Y48A 3CDIA 1JGSA 3ZN0A 4G7HF 1OCRH 3B73A 3BP8A 3PNYA 2XAHA 4UVCA 2R93J 3RKYA 1T0FC 4OMYA 2XRLA 3LWFA 4I99C 4CYCA 3WE3A 5J1YA 4OIPF 5C4XJ 3BG7A 1BC7C 5JVGF 3CMAI 3CUQB 3GLLA 2F4OB 3OS1A 1P7IA 2LMDA 2FXAA 3IKVA 2JN6A 2DN0A 1FTZA 1FEXA 1VQ5I 2M8EA 5GPAA 3D1NI 2E36A 1DU0A 3HUGA 5L3EA 5E8GA 3F8CA 3JRHA 3X2QH 4CH7A 1RKWA 3KFWX 3J81K 4L0ZB 1IRZA 3S1QJ 1FYKA 2ZCWA 4RAFA 4G94A 3RYPA 2EA4A 3MKZA 1SD6A 1SC7A 3HIFA 2ID6A 2M1BA 1SFKA 2FRHA 5HODA 4U7BA 2X9DA 4Y7NJ 5HDKA 3BQYA 2KJBA 2Y30A 4LK0F 1LUJB 2QM3A 1YQAA 3LNQA 2P6SA 4PDKA 1QGPA 1K61A 3L09A 1IN7A 3ABUA 5AONA 1IJWC 2IVMA 2Y0MA 1FBQA 2FNAA 1HDDC 2EFWA 2XGDA 3QPHA 1JJ6C 2QSFX 2W48A 3I58A 2XVCA 1RIOH 3LSIA 2HXIA 1LNWA 3S32A 1J5YA 5LRSA 3FDYA 4C30A 1FBSA 1U78A 2ISZA 3SEZA 3PJRA 3DEWA 3RIRA 3BR3A 5FKOA 3OYHA 3OYCA 2DOFA 5LHHA 2BZTA 2LKPA 4M9XA 3N05A 4GCVA 1D8JA 1G3TA 2IW5A 2Z1DA 3QQAA 3BT9A 1BI2A 4DIQA 4ZC3A 4V19K 2J5PA 2W82A 2CH0A 5IT3A 4CO8A 1SMTA 3CJTB 3SZPA 3OS2A 1MDMB 2V1NA 2WAQN 5GPCA 2H94A 2K27A 2LNBA 3WHCA 2PLYA 1R00A 5H20A 3VYRB 1GDTA 1P4XA 1U6GA 5HNFA 4BQAA 1BW5A 3T5XA 2GLOA 3GW2A 2EA2A 5FGMA 2M0MA 2W85A 2E71A 5ED4A 4WXDA 4BL0B 3KX2A 2G9WA 4HDUA 1OYYA 1B72A 2E19A 4FASD 3U1DA 2UXNA 2DK5A 1LEBA 1V5FA 2LKSA 5HS9A 3IH3A 5E3NA 1P9QC 4S05A 3ASNH 4P5OA 1P4WA 4IJAA 1KA8A 2L4MA 5E3LA 5GADJ 2QBYB 2AQFA 1H9TA 2R7SA 2YSRA 5D4RA 2ESHA 4FCYA 3VFZA 3L1PA 5HDGA 1BM9A 1FMWA 5KNLA 3HKZA 3CP8A 3H3ZA 2CW0F 4XK4A 3FXRA 4AWXB 4M72A 2VBZA 2QKLB 3KEOA 1K79A 1QNTA 2EZKA 5E1ZB 2XKOA 2OZUA 3FXMA 5E3MA 3DP7A 4U0WA 4YFXF 2DT5A 3JSPA 2DFIA 3HOWJ 4LIVA 2OTLI 3TL4X 5BPIA 4V2GA 4FTHA 5L3DA 2DOEA 2XAUA 2LBFB 4L5JA 1CQTA 4PCQA 1G4DA 1IDZA 2NVUB 1MMGA 2DA6A 4ITVA 3BDDA 3KEYA 3I71A 2F2EA 2LLKA 1VNDA 2DMNA 4KT6A 3P5JA 1TW3A 2M8GX 1J9IA 2PBIA 3L2QA 1JXSA 2DLLA 2ELJA 1GVJA 3DBLB 5CYVA 5DYMA 4Z2YA 3T8RA 3EQLF 5A2QZ 3BZ6A 4PJLA 4LD5A 3VSKA 2HTSA 5HVQC 2P5VA
chains in the Genus database with same CATH topology
3GFIA 3DEUA 1O57A 1KGSA 1W7PA 2G7HA 3FXUA 2BGCA 1WSUA 1Z1DA 4LB5A 3DXJF 1OMIA 1T39A 3WGGA 5JFRA 5F1RA 2G7UA 3HTUA 1HW1A 2DPUA 4BHPA 2A69F 4EJUA 4U0YA 2RVCA 1PUEE 2GWRA 4O3MA 1TNSA 2HR3A 2P7VB 3KP4A 1HW2A 2OD5A 2H6CA 1J75A 4Q4ZF 5HS7A 3L9FA 1O3QA 3P7NA 4ESFA 1BBYA 3B02A 4G8XA 1XSXA 1SD4A 5ILSA 3I53A 3K69A 4UNOA 5IT9Z 3CJNA 1YFHA 3IL2A 2X0LA 2KIFA 5E1WA 1DUXC 5LHIA 2FF4A 2D1VA 3P9KA 4BH9A 4WK8F 3MQ0A 5L3GA 4YFKF 2LF8A 5FLXZ 2IA2A 1U5TC 1MJBA 5DCMB 1Z05A 2QQBA 4LMYA 4M9SA 2R3SA 3REOA 4OIOF 3RPUA 1UFMA 4UV8A 4CGZA 2MA3A 3IWZA 2PQ8A 2CFXA 5DUIA 4OIQF 1WI9A 1KU3A 5TRDA 5JVTA 2LF7A 2GA2A 2EV5A 2R7FA 4L9NA 3I4PA 4L0YB 5LHGA 3GO5A 4L9JA 2O8XA 5E8IA 4NQWA 4RAYA 2IA1A 2VC1A 4HZFA 3KP7A 2ZMEB 4MTDA 4AVPA 2XROA 3FMQA 3BJ6A 3HHGA 4I7HA 1ZAOA 4I0AA 1GXQA 2DPDA 1P6RA 4HX7A 3MEXA 1YO5C 3FX3A 3R0AA 2CO5A 3DFGA 3NRVA 1XMKA 5KK1A 3QP6A 4G7OF 1E17A 1RZ4A 4ESBA 1B1BA 3P9IA 3QU3A 4WXCA 5DCFA 1W5TA 3WG9A 4YIFA 4OINF 3WTVC 4HF2A 4OOIA 2HZTA 4A0YA 2P5LC 1U5TB 4EJWA 2MLGA 5FFXA 1LEAA 3JW4A 4EMSA 4HV5A 3MZHA 3L7WA 2XKPA 4CZZA 3QOPA 3D5LA 2GAUA 4HDVA 4P9UA 2A3SA 1MZBA 3HRMA 3TO9A 2GIVA 3RTRA 4BNCA 5LBQA 2ADUA 3C7JA 3MWMA 4A0XA 2EV6A 5J8FA 4MEXF 5CVUA 2K7LA 3TGNA 5CJ9A 1ZREA 4HLXA 1KYZA 1I27A 1NHAA 4DNCA 1ZRCA 3ZMTA 2HGCA 4AIKA 1UHMA 1O3SA 1FNNA 2GXGA 4XBFA 1YW9A 4RGRA 3OV8A 4YFNF 4O6JA 1P2FA 4MEYF 1Z91A 3I64A 3ZMVA 3J80Z 1BI3A 2ZO4A 3NEUA 3C3WA 3W6JB 3E6BA 5D4SA 4P55A 1ZG5A 2LSOA 2PJPA 2ZXJA 1Z6TA 5CVJA 5E17F 4KN7X 1IW7F 2A68F 1ON1A 3I59A 3JAMZ 2VT3A 3ZP5A 3E5UA 1UCRA 2OU2A 5D8LB 1R58A 4LG0B 2IPQX 3T1BA 3BY6A 5A2QK 3GFMA 2HS5A 3TKYA 1ZARA 2P6TA 4YIIA 5TJJA 1X3UA 2ZFWA 2D2WA 5LLQA 2QQ9A 1KQ0A 1RI7A 1BIAA 2H09A 2BBYA 2HFHA 1FWZA 2UXXA 2H6BA 5ERIA 1OYWA 1TBXA 4LJZF 2AS5F 3KP6A 1OYIA 4AD9A 2RGVA 3FF5A 2RDPA 4GYIA 4IRIA 4R1HA 4BXUA 4EV0A 5DD8A 2QLZA 1H0MA 1V3FA 1MGTA 3E3VA 2VOOA 3HYIA 3IHUA 4A6DA 3M7GA 1T38A 4A0ZA 4ZYHA 1TTYA 1STZA 3F72A 2Z33A 3EETA 2QYOA 3H3UA 3HRTA 2BV6A 5BQTA 1IN4A 3KP2A 2IT0A 1IN6A 2DTRA 5D8KB 1FOKA 2O6GE 3R0JA 5IT9K 1FPQA 2PI0A 4BHBA 2EK5A 2CYYA 5D6EA 2ACJA 2L3DA 2A6HF 3I54A 4HX8A 2M87A 4UV9A 5BS6A 2FQ3A 1SD7A 1FZPB 1H9GA 3V8JA 4ENKA 3SHFA 4Y17A 4OIRF 2M30A 4N9IA 5FLXK 2ETHA 1K78B 2F5EA 3ECOA 1IRGA 4FHTA 2JTVA 3GWZA 4P96A 1LDJA 4JBAA 1W5SA 3SZTA 4U7DA 5JHUA 5FFZA 2O03A 1G3YA 2WC2A 1OR7A 2ZNYA 1U8RA 3VB2A 5EEGA 3JTGA 4ETSA 1RUNA 1IF1A 4LLGF 1O7LA 1REPC 2L01A 3E97A 1B6AA 4XSZF 2C6YA 1USTA 2STTA 2OZ6A 1ON2A 3F3XA 2NNNA 5BMZA 5E20A 1BIBA 2BE5F 4TV7A 1FY7A 4MNUA 4XLPF 2W25A 3VEPA 2HQNA 4KNYA 4HQEA 5AIPA 2FMLA 3FZVA 4WX9A 3V8LA 4ENMA 1R5HA 3DPTA 3KZZA 3M9AA 4FX4A 4ZYGA 3MAJA 1G3SA 2DQLA 2KRFA 2ZJ2A 1MJ9A 1S7AA 2RNJA 3HHHA 3TOBA 2A61A 2QUFA 4L5IA 3TDZC 3FMSA 3GF2A 2EB7A 4HQMA 1J0RA 1CF7B 3R61A 3GZ6A 1YS6A 2WTEA 5HLGA 2RN7A 1IAWA 2K4JA 3WTYC 2XAQA 4CHUA 1ZHFA 2DW4A 4K2EA 2MC3A 2P4WA 5D5VB 1RUOA 3I5UA 4LLLA 3DKWA 4KMFA 2XAGA 1ONVA 4RB2C 4R79A 2EV0A 1HSTA 4I98B 1HKTA 2V9VA 4AIJA 3HRSA 2A5YB 1D3YA 1ZLKA 3QPTA 2HQRA 5KVRA 4ASNA 1Z6RA 4KUMA 1FP1D 2FBHA 2HKXA 2WV0A 1IXRC 4JK1X 4EM2A 1KU9A 1EV7A 1YLFA 2HDCA 1F9NA 4HBLA 3J80K 3TO6A 1XSVA 3VODA 3ZMUA 2GXBA 2YPRA 1KQ9A 3K1PA 4QLCU 1IXCA 3GX4X 4A2UA 4RS8A 3RKXA 2GQQA 5LEKA 3LAJA 2M5WA 1R7JA 4OU0A 2IA0A 4UVAA 1TQMA 1KYWA 3U2RA 3JAMK 1XGMA 3BJOA 2FA5A 1GXPA 3ZMDA 2HEOA 1F4KA 1LB2A 3TO7A 3ISPA 4LFUA 1D5VA 4MQ9F 4EM1A 3CO6C 3QU6A 3KETA 4QWQA 4M9ZA 1WRJA 5K5QA 3R60A 4KYWA 1O7FA 4I09A 2L02A 1HSJA 3MCZA 3J81Z 4BYYA 2V79A 4I02A 5D6FA 3R6SA 2QZ8A 5BPDA 1XSDA 3P9CA 1LVAA 1HW5A 1BN5A 2FOKA 5K1YA 3IWFA 2HKOA 3F8NA 1XCVA 4PGHA 2V6CA 4UUVA 2VOPA 2FMYA 3RJPA 4YG2F 3HRUA 2O0YA 4ENJA 3PFIA 3PQKA 3D0SA 1DP7P 2Z99A 4IRGA 2XUBA 5E18F 1K7AA 3V7RA 6PAXA 3DV8A 3KZYA 2CQKA 4RB1A 3ERED 3RKWA 3GVAA 1BI1A 1QO0D 1K6OA 3C1DA 2FU4A 1ZG3A 2KIMA 1EH7A 1E2XA 5HDNA 3FXQA 1OKRA 3S2WA 1S8NA 5FB2A 1T98A 2EFQA 1J2XA 4Q48A 2KIUA 1Z7UA 3HSEA 1R1VA 2F5FA 2YR2A 4GO1A 4L9TA 4HF1A 1ZRFA 1HKQA 5K5OA 2VBXA 3K1NA 4MGRA 5LRRA 4RGXA 2Q2EA 3KEQA 1SFUA 1YW7A 1W7PD 4HLYA 4IF4A 5ICFA 2AXLA 2JSCA 4KDPA 1W7PB 3K1MA 2P5KA 4DQ2A 1SFXA 1XCBA 2XASA 1EH6A 2L54A 3ELKA 2K02A 3E6CC 5FD6A 5AIQA 3CUQA 2D45A 2PG4A 2CSOA 3MFKA 2Q8KA 3DPLC 5L3BA 1ULYA 5LGTA 3F6VA 3WTXC 1FP2A 5ILUA 4I01A 4HX4A 4JQFA 3LQQA 1LDKB 2DAOA 4A12A 1XDUA 3ZMZA 4WXHA 1TNTA 4CDGA 1IRFA 1B4AA 3RI4A 2MH2A 2OA4A 3IRQA 3IRRA 3AAFA 4UVBA 2O61A 4KT5C 2EFOA 2FBIA 1OPCA 3KCCA 4ZYDA 1QQIA 5BOXA 1PP7U 1Z9CA 2PMHA 2EWNA 3LSTA 1SMYF 1WQ2A 3V4GA 2NNYA 1LDDA 2NS0A 4A6EA 3ECHA 2HYFA 4G6QA 1W4MA 2OBPA 1TLHB 1BC8C 2E7XA 1MDMA 3SXYA 1R23A 1U3EM 2F5DA 5HLHA 5CVVA 5F64A 4LGWA 2CGPA 1I1GA 1S7OA 1FT9A 3HOSA 1ZN2A 3KP3A 3GEZA 3V7CA 2MBFA 1T0FA 4KIFA 4Y13A 3KLOA 3GFLA 4O5VA 4RGSA 1HQCA 3LA2A 2XAJA 1ZRDA 4HYEA 1MKMA 2B0LA 2QBYA 1R36A 4CICA 3K2ZA 2Z5UA 2O3FA 1IN5A 2DK8A 2YU3A 2DQRA 4B09A 5H6RA 3BPXA 5ICGA 3WGIA 4Y15A 3HOTA 1MD0A 4EM0B 4RGUA 1I1SA 3CTAA 2VE9A 3JTHA 5HS8A 5CVIA 1IZ1A 3KP5A 2H27A 2K4BA 2KKOA 1C0WA 4KMUX 1ZG1A 2PEXA 2V1UA 3GZ5A 2E1CA 3L2CA 2ESNA 2R7DA 4P9FA 3BWGA 2X4HA 2XIGA 2VBWA 2EJRA 2L4AA 5J8CA 1SFEA 4HAMA 3WU0A 2DI3A 2UZKA 1ZGAA 2GZWA 2VONA 2W84A 2Z3YA 3M1EA 3EYIA 2DU9A 2CWEA 3KE2A 3V8KA 1XB4A 3GYHX 1XDSA 4RB3C 2VE8A 2E1NA 2EFPA 2HTJA 4RAZA 4N9HA 2CG4A 4IRHA 1XD7A 4LLNA 2XHKA 2COMA 1ZYRF 2YX4A 4ZZDA 4KIGA 3WTTC 2JZYA 4XSXF 1GHCA 3K0LA 1KU2A 1MJAA 4HV6A 2RKHA 5J6XA 1PP8F 2HWVA 1JHFA 2VN2A 2PMUA 3WTWC 5LGUA 4ZH4F 1J7KA 4ZZLA 3TQNA 2IJLA 3N4MA 2K86A 2PFBA 2QVOA 1SAXA 2VXZA 5L3CA 1L3LA 2LDUA 1SD5A 3JSOA 1VTNC 4U88A 2BEOA 2GA1A 2QENA 1IUYA 1QPMA 1Y0UA 1TQIA 1ODDA 4IVNA 4IXAA 5ICEA 4HA8A 5DCMA 3GFJA 5ICCA 4D0PA 3F23A 2Q0OA 4FX0A 4LB6B 4GYGA 5FO5A 4CYDA 3T8TA 4NB5A 3I59B 3DQVC 3QAHA 2BYVE 2OQRA 3GXOA 4WCGA 3CDHA 3M8FA 2Z9OA 1I6XA 3LQRA 3ZPLA 2MD5A 1USSA 3G73A 2ZMEA 3KLNA 2RC4A 3DF8A 4HW0A 2VT2A 2XAFA 4BAYA 2EFNA 1YW8A 3T0YA 5CLSA 1HKSA 3Q5FA 3TDUC 1HXDA 2IRFG 2DO7A 2JPCA 3FHZA 3BROA 1L0OC 1XGNA 3HTSB 4UHTA 3RPQA 3BOQA 2IP2A 3V7SA 2KJCA 4I0BA 4FT8A 3QP5A 2ZKZA 1F1ZA 1JE8A 4OMZA 1U5TA 1TW2A 2NRAC 3WTZA 1ZGJA 3WGHA 1FSHA 2P8TA 2HYGD 1BI0A 4Q5SF 3TOAA 4EJOA 4M73A 1QBJA 1D8KA 3F22A 1A04A 2FNPA 3ULQB 1O3RA 2PN6A 4EJVA 2NYXA 3ZQ7A 4I2OA 4PGGA 1CGPA 4HF0A 2FEZA 1LQ1A 3M8EA 4R8HA 2W24A 5K5RA 3HSFA 3C18A 4MQVA 1KQ8A 5DUKA 3PQJA 2YX7A 4XRFA 4KA4A 2P7CB 4IPAA 5JI6A 5H6QA 3RDIA 1XGSA 3F8FA 4EGYA 3ML6A 2A07F 2TDXA 1EH8A 3RYRA 2OAZA 2D1HA 1WKMA 3E6MA 3COAC 4EJTA 5D5UB 1BJAA 1HBXG 3EUHA 4ON0A 5DD4A 3F8MA 3FM3A 1S3JA 2RV8A 4LK1F 2E7WA 1YIOA 3SFZA 2XRNA 4LG0A 1B9NA 1J59A 3G3ZA 4Q47A 4U0VA 4RB0A 1QZZA 4MTEA 5D5WB 3WE2A 4GGGA 4AIHA 1BOAA 3CO7C 3E5QA 5LGNA 1AWCA 1DPUA 2V1XA 1YG2A 2XV4S 3I0TA 1S6LA 1P92A 4KN4X 4M74A 1WWXA 3LA7A 1YTYA 3QRFF 3E5XA 3NQOA 4WF2A 4A5NA 4M6YA 2ISYA 5FD5A 1DPRA 4KICA 1FSEA 3WODF 3IKTA 2A6EF 4S04A 4N0BA 5JR3A 1R22A 1FX7A 1I5ZA 3WU1B 3F8BA 2RQPA 3Q9VA 1R5GA 2OQGA 1S29A 4PZJA 1R1TA 1FYLA 5L3FA 3J7AO 1B9MA 2VODA 1IN8A 1O3TA 2M45A 3O2PE 2VBYA 3GLXA 3ABTA 2F5CA 3K9TA 3SQNA 3WTUC 4L9VA 2FBKA 1JHHA 2DBBA 3LFKA 1K78A 4F7ZA 1ZH5A 2QWWA 4G6DA 3E6DA 4XLNF 1YS7A 2HOEA 5DDGA 1P4AA 3IC7A 1FBUA 1V4RA 2ZNZA 4KFCA 4IHTA 3F21A 2ZBKA 3HSRA 5EEHA 1DDNA 1FC3A 1PDNC 1FYMA 1KU7A 5ILVA 3ZN1A 3L00A 2V1DA 2J5OA 3OOPA 4IHSA 3BJAA 5F6FA 4BHCA 3H92A 1G6NA 4GXOA 2ELHA 1U2WA 4ZYEA 3VOEA 3ZMSA 3FWEA 3N97A 1T6SA 4EQQA 3Q9SA 3F6OA 1ZLJA 2FSWA 4EVIA 4L18B 4KIBA 1LJ9A 1AOYA 3FM5A 1XGOA 2JRTA 4M71A 4UXNA 5CVRA 3CUQC 3LAPA 1UHWA 3EYYA 3U9GA 3CLOA 1Q1HA 4B8XA 4A5MA 3EDPA 3O6BB 5DEQA 1XN7A 4MHGA 3GUDA 4NHJA 1FLIA 5HOOA 2VC0A 2FE3A 2MLKA 1T2KA 4CXFA 4G9YA 3CUOA 3LA3A 4HOBA 2W57A 4ESJA 3MZYA 4M6XA 4G7ZF 1CF7A 2QQAA 1RNLA 2Y75A 1G3WA 1B59A 3ROUA 5D5XB 3W6KB 5DV5A 4E70A 4H0EA 4ENNA 2STWA 1XMAA 2JT1A 1UB9A 1QZYA 3BPVA 3R4KA 2MH9A 1F5TA 5LEJA 2WWYA 5HLIA 4WWCA 5E1XA 1TQPA 2JPBA 2NAZA 4EGZA 3FMRA 1R1UA 1YYVA 1IXSB 3O3KA 2XGXA 3WTSC 2UWMA 2Y48A 1JGSA 3ZN0A 4G7HF 3B73A 3BP8A 2XAHA 4UVCA 3RKYA 4OMYA 3LWFA 3WE3A 4OIPF 1BC7C 3CUQB 2FXAA 3IKVA 2M8EA 3HUGA 5L3EA 5E8GA 3F8CA 3KFWX 3J81K 4L0ZB 1FYKA 2ZCWA 4G94A 3RYPA 2EA4A 1SD6A 3HIFA 2M1BA 2FRHA 4U7BA 5HDKA 2KJBA 4LK0F 2QM3A 1YQAA 2P6SA 4PDKA 1QGPA 3L09A 1IN7A 3ABUA 5AONA 2IVMA 2Y0MA 1FBQA 2FNAA 2EFWA 3QPHA 3I58A 2XVCA 1RIOH 1LNWA 1J5YA 5LRSA 1FBSA 1U78A 2ISZA 3RIRA 5LHHA 2LKPA 4M9XA 4GCVA 1D8JA 1G3TA 2IW5A 1BI2A 2J5PA 5IT3A 4CO8A 1SMTA 3SZPA 1MDMB 2H94A 2K27A 2LNBA 2PLYA 1R00A 5H20A 1P4XA 1U6GA 4BQAA 3T5XA 3GW2A 2EA2A 5FGMA 2W85A 5ED4A 4WXDA 2G9WA 4HDUA 1OYYA 3U1DA 2UXNA 2DK5A 1LEBA 5HS9A 4S05A 4P5OA 1P4WA 4IJAA 1KA8A 2L4MA 2QBYB 1H9TA 2YSRA 5D4RA 2ESHA 3VFZA 5HDGA 1BM9A 3H3ZA 2CW0F 3FXRA 4AWXB 4M72A 2VBZA 3KEOA 1K79A 1QNTA 5E1ZB 2XKOA 2OZUA 3DP7A 4U0WA 4YFXF 2DT5A 3JSPA 2DFIA 5BPIA 5L3DA 4L5JA 4PCQA 1G4DA 3BDDA 3I71A 2F2EA 1TW3A 1J9IA 1JXSA 2PBIA 2DLLA 1GVJA 5DYMA 5CYVA 4Z2YA 5A2QZ 3T8RA 3EQLF 3BZ6A 4LD5A 2HTSA 5HVQC 2P5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFI A;  3DEU A;  1O57 A;  1KGS A;  1W7P A;  2G7H A;  3FXU A;  2BGC A;  1WSU A;  1Z1D A;  4LB5 A;  3DXJ F;  1OMI A;  1T39 A;  3WGG A;  5JFR A;  5F1R A;  2G7U A;  3HTU A;  1HW1 A;  2DPU A;  4BHP A;  2A69 F;  4EJU A;  4U0Y A;  2RVC A;  1PUE E;  2GWR A;  4O3M A;  1TNS A;  2HR3 A;  2P7V B;  3KP4 A;  1HW2 A;  2OD5 A;  2H6C A;  1J75 A;  4Q4Z F;  5HS7 A;  3L9F A;  1O3Q A;  3P7N A;  4ESF A;  1BBY A;  3B02 A;  4G8X A;  1XSX A;  1SD4 A;  5ILS A;  3I53 A;  3K69 A;  4UNO A;  5IT9 Z;  3CJN A;  1YFH A;  3IL2 A;  2X0L A;  2KIF A;  5E1W A;  1DUX C;  5LHI A;  2FF4 A;  2D1V A;  3P9K A;  4BH9 A;  4WK8 F;  3MQ0 A;  5L3G A;  4YFK F;  2LF8 A;  5FLX Z;  2IA2 A;  1U5T C;  1MJB A;  5DCM B;  1Z05 A;  2QQB A;  4LMY A;  4M9S A;  2R3S A;  3REO A;  4OIO F;  3RPU A;  1UFM A;  4UV8 A;  4CGZ A;  2MA3 A;  3IWZ A;  2PQ8 A;  2CFX A;  5DUI A;  4OIQ F;  1WI9 A;  1KU3 A;  5TRD A;  5JVT A;  2LF7 A;  2GA2 A;  2EV5 A;  2R7F A;  4L9N A;  3I4P A;  4L0Y B;  5LHG A;  3GO5 A;  4L9J A;  2O8X A;  5E8I A;  4NQW A;  4RAY A;  2IA1 A;  2VC1 A;  4HZF A;  3KP7 A;  2ZME B;  4MTD A;  4AVP A;  2XRO A;  3FMQ A;  3BJ6 A;  3HHG A;  4I7H A;  1ZAO A;  4I0A A;  1GXQ A;  2DPD A;  1P6R A;  4HX7 A;  3MEX A;  1YO5 C;  3FX3 A;  3R0A A;  2CO5 A;  3DFG A;  3NRV A;  1XMK A;  5KK1 A;  3QP6 A;  4G7O F;  1E17 A;  1RZ4 A;  4ESB A;  1B1B A;  3P9I A;  3QU3 A;  4WXC A;  5DCF A;  1W5T A;  3WG9 A;  4YIF A;  4OIN F;  3WTV C;  4HF2 A;  4OOI A;  2HZT A;  4A0Y A;  2P5L C;  1U5T B;  4EJW A;  2MLG A;  5FFX A;  1LEA A;  3JW4 A;  4EMS A;  4HV5 A;  3MZH A;  3L7W A;  2XKP A;  4CZZ A;  3QOP A;  3D5L A;  2GAU A;  4HDV A;  4P9U A;  2A3S A;  1MZB A;  3HRM A;  3TO9 A;  2GIV A;  3RTR A;  4BNC A;  5LBQ A;  2ADU A;  3C7J A;  3MWM A;  4A0X A;  2EV6 A;  5J8F A;  4MEX F;  5CVU A;  2K7L A;  3TGN A;  5CJ9 A;  1ZRE A;  4HLX A;  1KYZ A;  1I27 A;  1NHA A;  4DNC A;  1ZRC A;  3ZMT A;  2HGC A;  4AIK A;  1UHM A;  1O3S A;  1FNN A;  2GXG A;  4XBF A;  1YW9 A;  4RGR A;  3OV8 A;  4YFN F;  4O6J A;  1P2F A;  4MEY F;  1Z91 A;  3I64 A;  3ZMV A;  3J80 Z;  1BI3 A;  2ZO4 A;  3NEU A;  3C3W A;  3W6J B;  3E6B A;  5D4S A;  4P55 A;  1ZG5 A;  2LSO A;  2PJP A;  2ZXJ A;  1Z6T A;  5CVJ A;  5E17 F;  4KN7 X;  1IW7 F;  2A68 F;  1ON1 A;  3I59 A;  3JAM Z;  2VT3 A;  3ZP5 A;  3E5U A;  1UCR A;  2OU2 A;  5D8L B;  1R58 A;  4LG0 B;  2IPQ X;  3T1B A;  3BY6 A;  5A2Q K;  3GFM A;  2HS5 A;  3TKY A;  1ZAR A;  2P6T A;  4YII A;  5TJJ A;  1X3U A;  2ZFW A;  2D2W A;  5LLQ A;  2QQ9 A;  1KQ0 A;  1RI7 A;  1BIA A;  2H09 A;  2BBY A;  2HFH A;  1FWZ A;  2UXX A;  2H6B A;  5ERI A;  1OYW A;  1TBX A;  4LJZ F;  2AS5 F;  3KP6 A;  1OYI A;  4AD9 A;  2RGV A;  3FF5 A;  2RDP A;  4GYI A;  4IRI A;  4R1H A;  4BXU A;  4EV0 A;  5DD8 A;  2QLZ A;  1H0M A;  1V3F A;  1MGT A;  3E3V A;  2VOO A;  3HYI A;  3IHU A;  4A6D A;  3M7G A;  1T38 A;  4A0Z A;  4ZYH A;  1TTY A;  1STZ A;  3F72 A;  2Z33 A;  3EET A;  2QYO A;  3H3U A;  3HRT A;  2BV6 A;  5BQT A;  1IN4 A;  3KP2 A;  2IT0 A;  1IN6 A;  2DTR A;  5D8K B;  1FOK A;  2O6G E;  3R0J A;  5IT9 K;  1FPQ A;  2PI0 A;  4BHB A;  2EK5 A;  2CYY A;  5D6E A;  2ACJ A;  2L3D A;  2A6H F;  3I54 A;  4HX8 A;  2M87 A;  4UV9 A;  5BS6 A;  2FQ3 A;  1SD7 A;  1FZP B;  1H9G A;  3V8J A;  4ENK A;  3SHF A;  4Y17 A;  4OIR F;  2M30 A;  4N9I A;  5FLX K;  2ETH A;  1K78 B;  2F5E A;  3ECO A;  1IRG A;  4FHT A;  2JTV A;  3GWZ A;  4P96 A;  1LDJ A;  4JBA A;  1W5S A;  3SZT A;  4U7D A;  5JHU A;  5FFZ A;  2O03 A;  1G3Y A;  2WC2 A;  1OR7 A;  2ZNY A;  1U8R A;  3VB2 A;  5EEG A;  3JTG A;  4ETS A;  1RUN A;  1IF1 A;  4LLG F;  1O7L A;  1REP C;  2L01 A;  3E97 A;  1B6A A;  4XSZ F;  2C6Y A;  1UST A;  2STT A;  2OZ6 A;  1ON2 A;  3F3X A;  2NNN A;  5BMZ A;  5E20 A;  1BIB A;  2BE5 F;  4TV7 A;  1FY7 A;  4MNU A;  4XLP F;  2W25 A;  3VEP A;  2HQN A;  4KNY A;  4HQE A;  5AIP A;  2FML A;  3FZV A;  4WX9 A;  3V8L A;  4ENM A;  1R5H A;  3DPT A;  3KZZ A;  3M9A A;  4FX4 A;  4ZYG A;  3MAJ A;  1G3S A;  2DQL A;  2KRF A;  2ZJ2 A;  1MJ9 A;  1S7A A;  2RNJ A;  3HHH A;  3TOB A;  2A61 A;  2QUF A;  4L5I A;  3TDZ C;  3FMS A;  3GF2 A;  2EB7 A;  4HQM A;  1J0R A;  1CF7 B;  3R61 A;  3GZ6 A;  1YS6 A;  2WTE A;  5HLG A;  2RN7 A;  1IAW A;  2K4J A;  3WTY C;  2XAQ A;  4CHU A;  1ZHF A;  2DW4 A;  4K2E A;  2MC3 A;  2P4W A;  5D5V B;  1RUO A;  3I5U A;  4LLL A;  3DKW A;  4KMF A;  2XAG A;  1ONV A;  4RB2 C;  4R79 A;  2EV0 A;  1HST A;  4I98 B;  1HKT A;  2V9V A;  4AIJ A;  3HRS A;  2A5Y B;  1D3Y A;  1ZLK A;  3QPT A;  2HQR A;  5KVR A;  4ASN A;  1Z6R A;  4KUM A;  1FP1 D;  2FBH A;  2HKX A;  2WV0 A;  1IXR C;  4JK1 X;  4EM2 A;  1KU9 A;  1EV7 A;  1YLF A;  2HDC A;  1F9N A;  4HBL A;  3J80 K;  3TO6 A;  1XSV A;  3VOD A;  3ZMU A;  2GXB A;  2YPR A;  1KQ9 A;  3K1P A;  4QLC U;  1IXC A;  3GX4 X;  4A2U A;  4RS8 A;  3RKX A;  2GQQ A;  5LEK A;  3LAJ A;  2M5W A;  1R7J A;  4OU0 A;  2IA0 A;  4UVA A;  1TQM A;  1KYW A;  3U2R A;  3JAM K;  1XGM A;  3BJO A;  2FA5 A;  1GXP A;  3ZMD A;  2HEO A;  1F4K A;  1LB2 A;  3TO7 A;  3ISP A;  4LFU A;  1D5V A;  4MQ9 F;  4EM1 A;  3CO6 C;  3QU6 A;  3KET A;  4QWQ A;  4M9Z A;  1WRJ A;  5K5Q A;  3R60 A;  4KYW A;  1O7F A;  4I09 A;  2L02 A;  1HSJ A;  3MCZ A;  3J81 Z;  4BYY A;  2V79 A;  4I02 A;  5D6F A;  3R6S A;  2QZ8 A;  5BPD A;  1XSD A;  3P9C A;  1LVA A;  1HW5 A;  1BN5 A;  2FOK A;  5K1Y A;  3IWF A;  2HKO A;  3F8N A;  1XCV A;  4PGH A;  2V6C A;  4UUV A;  2VOP A;  2FMY A;  3RJP A;  4YG2 F;  3HRU A;  2O0Y A;  4ENJ A;  3PFI A;  3PQK A;  3D0S A;  1DP7 P;  2Z99 A;  4IRG A;  2XUB A;  5E18 F;  1K7A A;  3V7R A;  6PAX A;  3DV8 A;  3KZY A;  2CQK A;  4RB1 A;  3ERE D;  3RKW A;  3GVA A;  1BI1 A;  1QO0 D;  1K6O A;  3C1D A;  2FU4 A;  1ZG3 A;  2KIM A;  1EH7 A;  1E2X A;  5HDN A;  3FXQ A;  1OKR A;  3S2W A;  1S8N A;  5FB2 A;  1T98 A;  2EFQ A;  1J2X A;  4Q48 A;  2KIU A;  1Z7U A;  3HSE A;  1R1V A;  2F5F A;  2YR2 A;  4GO1 A;  4L9T A;  4HF1 A;  1ZRF A;  1HKQ A;  5K5O A;  2VBX A;  3K1N A;  4MGR A;  5LRR A;  4RGX A;  2Q2E A;  3KEQ A;  1SFU A;  1YW7 A;  1W7P D;  4HLY A;  4IF4 A;  5ICF A;  2AXL A;  2JSC A;  4KDP A;  1W7P B;  3K1M A;  2P5K A;  4DQ2 A;  1SFX A;  1XCB A;  2XAS A;  1EH6 A;  2L54 A;  3ELK A;  2K02 A;  3E6C C;  5FD6 A;  5AIQ A;  3CUQ A;  2D45 A;  2PG4 A;  2CSO A;  3MFK A;  2Q8K A;  3DPL C;  5L3B A;  1ULY A;  5LGT A;  3F6V A;  3WTX C;  1FP2 A;  5ILU A;  4I01 A;  4HX4 A;  4JQF A;  3LQQ A;  1LDK B;  2DAO A;  4A12 A;  1XDU A;  3ZMZ A;  4WXH A;  1TNT A;  4CDG A;  1IRF A;  1B4A A;  3RI4 A;  2MH2 A;  2OA4 A;  3IRQ A;  3IRR A;  3AAF A;  4UVB A;  2O61 A;  4KT5 C;  2EFO A;  2FBI A;  1OPC A;  3KCC A;  4ZYD A;  1QQI A;  5BOX A;  1PP7 U;  1Z9C A;  2PMH A;  2EWN A;  3LST A;  1SMY F;  1WQ2 A;  3V4G A;  2NNY A;  1LDD A;  2NS0 A;  4A6E A;  3ECH A;  2HYF A;  4G6Q A;  1W4M A;  2OBP A;  1TLH B;  1BC8 C;  2E7X A;  1MDM A;  3SXY A;  1R23 A;  1U3E M;  2F5D A;  5HLH A;  5CVV A;  5F64 A;  4LGW A;  2CGP A;  1I1G A;  1S7O A;  1FT9 A;  3HOS A;  1ZN2 A;  3KP3 A;  3GEZ A;  3V7C A;  2MBF A;  1T0F A;  4KIF A;  4Y13 A;  3KLO A;  3GFL A;  4O5V A;  4RGS A;  1HQC A;  3LA2 A;  2XAJ A;  1ZRD A;  4HYE A;  1MKM A;  2B0L A;  2QBY A;  1R36 A;  4CIC A;  3K2Z A;  2Z5U A;  2O3F A;  1IN5 A;  2DK8 A;  2YU3 A;  2DQR A;  4B09 A;  5H6R A;  3BPX A;  5ICG A;  3WGI A;  4Y15 A;  3HOT A;  1MD0 A;  4EM0 B;  4RGU A;  1I1S A;  3CTA A;  2VE9 A;  3JTH A;  5HS8 A;  5CVI A;  1IZ1 A;  3KP5 A;  2H27 A;  2K4B A;  2KKO A;  1C0W A;  4KMU X;  1ZG1 A;  2PEX A;  2V1U A;  3GZ5 A;  2E1C A;  3L2C A;  2ESN A;  2R7D A;  4P9F A;  3BWG A;  2X4H A;  2XIG A;  2VBW A;  2EJR A;  2L4A A;  5J8C A;  1SFE A;  4HAM A;  3WU0 A;  2DI3 A;  2UZK A;  1ZGA A;  2GZW A;  2VON A;  2W84 A;  2Z3Y A;  3M1E A;  3EYI A;  2DU9 A;  2CWE A;  3KE2 A;  3V8K A;  1XB4 A;  3GYH X;  1XDS A;  4RB3 C;  2VE8 A;  2E1N A;  2EFP A;  2HTJ A;  4RAZ A;  4N9H A;  2CG4 A;  4IRH A;  1XD7 A;  4LLN A;  2XHK A;  2COM A;  1ZYR F;  2YX4 A;  4ZZD A;  4KIG A;  3WTT C;  2JZY A;  4XSX F;  1GHC A;  3K0L A;  1KU2 A;  1MJA A;  4HV6 A;  2RKH A;  5J6X A;  1PP8 F;  2HWV A;  1JHF A;  2VN2 A;  2PMU A;  3WTW C;  5LGU A;  4ZH4 F;  1J7K A;  4ZZL A;  3TQN A;  2IJL A;  3N4M A;  2K86 A;  2PFB A;  2QVO A;  1SAX A;  2VXZ A;  5L3C A;  1L3L A;  2LDU A;  1SD5 A;  3JSO A;  1VTN C;  4U88 A;  2BEO A;  2GA1 A;  2QEN A;  1IUY A;  1QPM A;  1Y0U A;  1TQI A;  1ODD A;  4IVN A;  4IXA A;  5ICE A;  4HA8 A;  5DCM A;  3GFJ A;  5ICC A;  4D0P A;  3F23 A;  2Q0O A;  4FX0 A;  4LB6 B;  4GYG A;  5FO5 A;  4CYD A;  3T8T A;  4NB5 A;  3I59 B;  3DQV C;  3QAH A;  2BYV E;  2OQR A;  3GXO A;  4WCG A;  3CDH A;  3M8F A;  2Z9O A;  1I6X A;  3LQR A;  3ZPL A;  2MD5 A;  1USS A;  3G73 A;  2ZME A;  3KLN A;  2RC4 A;  3DF8 A;  4HW0 A;  2VT2 A;  2XAF A;  4BAY A;  2EFN A;  1YW8 A;  3T0Y A;  5CLS A;  1HKS A;  3Q5F A;  3TDU C;  1HXD A;  2IRF G;  2DO7 A;  2JPC A;  3FHZ A;  3BRO A;  1L0O C;  1XGN A;  3HTS B;  4UHT A;  3RPQ A;  3BOQ A;  2IP2 A;  3V7S A;  2KJC A;  4I0B A;  4FT8 A;  3QP5 A;  2ZKZ A;  1F1Z A;  1JE8 A;  4OMZ A;  1U5T A;  1TW2 A;  2NRA C;  3WTZ A;  1ZGJ A;  3WGH A;  1FSH A;  2P8T A;  2HYG D;  1BI0 A;  4Q5S F;  3TOA A;  4EJO A;  4M73 A;  1QBJ A;  1D8K A;  3F22 A;  1A04 A;  2FNP A;  3ULQ B;  1O3R A;  2PN6 A;  4EJV A;  2NYX A;  3ZQ7 A;  4I2O A;  4PGG A;  1CGP A;  4HF0 A;  2FEZ A;  1LQ1 A;  3M8E A;  4R8H A;  2W24 A;  5K5R A;  3HSF A;  3C18 A;  4MQV A;  1KQ8 A;  5DUK A;  3PQJ A;  2YX7 A;  4XRF A;  4KA4 A;  2P7C B;  4IPA A;  5JI6 A;  5H6Q A;  3RDI A;  1XGS A;  3F8F A;  4EGY A;  3ML6 A;  2A07 F;  2TDX A;  1EH8 A;  3RYR A;  2OAZ A;  2D1H A;  1WKM A;  3E6M A;  3COA C;  4EJT A;  5D5U B;  1BJA A;  1HBX G;  3EUH A;  4ON0 A;  5DD4 A;  3F8M A;  3FM3 A;  1S3J A;  2RV8 A;  4LK1 F;  2E7W A;  1YIO A;  3SFZ A;  2XRN A;  4LG0 A;  1B9N A;  1J59 A;  3G3Z A;  4Q47 A;  4U0V A;  4RB0 A;  1QZZ A;  4MTE A;  5D5W B;  3WE2 A;  4GGG A;  4AIH A;  1BOA A;  3CO7 C;  3E5Q A;  5LGN A;  1AWC A;  1DPU A;  2V1X A;  1YG2 A;  2XV4 S;  3I0T A;  1S6L A;  1P92 A;  4KN4 X;  4M74 A;  1WWX A;  3LA7 A;  1YTY A;  3QRF F;  3E5X A;  3NQO A;  4WF2 A;  4A5N A;  4M6Y A;  2ISY A;  5FD5 A;  1DPR A;  4KIC A;  1FSE A;  3WOD F;  3IKT A;  2A6E F;  4S04 A;  4N0B A;  5JR3 A;  1R22 A;  1FX7 A;  1I5Z A;  3WU1 B;  3F8B A;  2RQP A;  3Q9V A;  1R5G A;  2OQG A;  1S29 A;  4PZJ A;  1R1T A;  1FYL A;  5L3F A;  3J7A O;  1B9M A;  2VOD A;  1IN8 A;  1O3T A;  2M45 A;  3O2P E;  2VBY A;  3GLX A;  3ABT A;  2F5C A;  3K9T A;  3SQN A;  3WTU C;  4L9V A;  2FBK A;  1JHH A;  2DBB A;  3LFK A;  1K78 A;  4F7Z A;  1ZH5 A;  2QWW A;  4G6D A;  3E6D A;  4XLN F;  1YS7 A;  2HOE A;  5DDG A;  1P4A A;  3IC7 A;  1FBU A;  1V4R A;  2ZNZ A;  4KFC A;  4IHT A;  3F21 A;  2ZBK A;  3HSR A;  5EEH A;  1DDN A;  1FC3 A;  1PDN C;  1FYM A;  1KU7 A;  5ILV A;  3ZN1 A;  3L00 A;  2V1D A;  2J5O A;  3OOP A;  4IHS A;  3BJA A;  5F6F A;  4BHC A;  3H92 A;  1G6N A;  4GXO A;  2ELH A;  1U2W A;  4ZYE A;  3VOE A;  3ZMS A;  3FWE A;  3N97 A;  1T6S A;  4EQQ A;  3Q9S A;  3F6O A;  1ZLJ A;  2FSW A;  4EVI A;  4L18 B;  4KIB A;  1LJ9 A;  1AOY A;  3FM5 A;  1XGO A;  2JRT A;  4M71 A;  4UXN A;  5CVR A;  3CUQ C;  3LAP A;  1UHW A;  3EYY A;  3U9G A;  3CLO A;  1Q1H A;  4B8X A;  4A5M A;  3EDP A;  3O6B B;  5DEQ A;  1XN7 A;  4MHG A;  3GUD A;  4NHJ A;  1FLI A;  5HOO A;  2VC0 A;  2FE3 A;  2MLK A;  1T2K A;  4CXF A;  4G9Y A;  3CUO A;  3LA3 A;  4HOB A;  2W57 A;  4ESJ A;  3MZY A;  4M6X A;  4G7Z F;  1CF7 A;  2QQA A;  1RNL A;  2Y75 A;  1G3W A;  1B59 A;  3ROU A;  5D5X B;  3W6K B;  5DV5 A;  4E70 A;  4H0E A;  4ENN A;  2STW A;  1XMA A;  2JT1 A;  1UB9 A;  1QZY A;  3BPV A;  3R4K A;  2MH9 A;  1F5T A;  5LEJ A;  2WWY A;  5HLI A;  4WWC A;  5E1X A;  1TQP A;  2JPB A;  2NAZ A;  4EGZ A;  3FMR A;  1R1U A;  1YYV A;  1IXS B;  3O3K A;  2XGX A;  3WTS C;  2UWM A;  2Y48 A;  1JGS A;  3ZN0 A;  4G7H F;  3B73 A;  3BP8 A;  2XAH A;  4UVC A;  3RKY A;  4OMY A;  3LWF A;  3WE3 A;  4OIP F;  1BC7 C;  3CUQ B;  2FXA A;  3IKV A;  2M8E A;  3HUG A;  5L3E A;  5E8G A;  3F8C A;  3KFW X;  3J81 K;  4L0Z B;  1FYK A;  2ZCW A;  4G94 A;  3RYP A;  2EA4 A;  1SD6 A;  3HIF A;  2M1B A;  2FRH A;  4U7B A;  5HDK A;  2KJB A;  4LK0 F;  2QM3 A;  1YQA A;  2P6S A;  4PDK A;  1QGP A;  3L09 A;  1IN7 A;  3ABU A;  5AON A;  2IVM A;  2Y0M A;  1FBQ A;  2FNA A;  2EFW A;  3QPH A;  3I58 A;  2XVC A;  1RIO H;  1LNW A;  1J5Y A;  5LRS A;  1FBS A;  1U78 A;  2ISZ A;  3RIR A;  5LHH A;  2LKP A;  4M9X A;  4GCV A;  1D8J A;  1G3T A;  2IW5 A;  1BI2 A;  2J5P A;  5IT3 A;  4CO8 A;  1SMT A;  3SZP A;  1MDM B;  2H94 A;  2K27 A;  2LNB A;  2PLY A;  1R00 A;  5H20 A;  1P4X A;  1U6G A;  4BQA A;  3T5X A;  3GW2 A;  2EA2 A;  5FGM A;  2W85 A;  5ED4 A;  4WXD A;  2G9W A;  4HDU A;  1OYY A;  3U1D A;  2UXN A;  2DK5 A;  1LEB A;  5HS9 A;  4S05 A;  4P5O A;  1P4W A;  4IJA A;  1KA8 A;  2L4M A;  2QBY B;  1H9T A;  2YSR A;  5D4R A;  2ESH A;  3VFZ A;  5HDG A;  1BM9 A;  3H3Z A;  2CW0 F;  3FXR A;  4AWX B;  4M72 A;  2VBZ A;  3KEO A;  1K79 A;  1QNT A;  5E1Z B;  2XKO A;  2OZU A;  3DP7 A;  4U0W A;  4YFX F;  2DT5 A;  3JSP A;  2DFI A;  5BPI A;  5L3D A;  4L5J A;  4PCQ A;  1G4D A;  3BDD A;  3I71 A;  2F2E A;  1TW3 A;  1J9I A;  1JXS A;  2PBI A;  2DLL A;  1GVJ A;  5DYM A;  5CYV A;  4Z2Y A;  5A2Q Z;  3T8R A;  3EQL F;  3BZ6 A;  4LD5 A;  2HTS A;  5HVQ C;  2P5V A; 
#chains in the Genus database with same CATH topology
 3GFI A;  3DEU A;  1O57 A;  4RLQ A;  3TED A;  3H35 A;  2O8K A;  1SAU A;  1KGS A;  3RQI A;  3HOX J;  1W7P A;  3CCS I;  2WY8 Q;  2R92 J;  4MO7 A;  2G7H A;  3FXU A;  2BGC A;  1BA5 A;  1WSU A;  2V7F A;  1Z1D A;  2VPR A;  4M3B A;  4E6K G;  1D1B A;  4LB5 A;  1ETO A;  2F6C A;  3DXJ F;  1OMI A;  4BBR J;  3VYS B;  3K4K A;  3PIP F;  1T39 A;  4CSW A;  4M3E A;  1MBK A;  3HDD A;  3WGG A;  2ZFU A;  5JFR A;  5F1R A;  3H5R A;  2G7U A;  5BNG A;  1LKX A;  2R7O A;  4C2T A;  3HTU A;  1LPQ A;  1YRN A;  3S8P A;  1XG1 A;  4XNF A;  3RZO J;  3A01 B;  2HPI A;  1HW1 A;  1VQK I;  2XPV A;  2DPU A;  4BHP A;  2A69 F;  4E7H A;  4EJU A;  4U0Y A;  2RVC A;  3GTJ J;  2Y69 H;  1PUE E;  3ONQ A;  4ZYA A;  2GWR A;  4O3M A;  2M0C A;  1TNS A;  4AU7 A;  1JKQ C;  3LMM A;  2VKH A;  3LSR A;  3S15 J;  3VWB A;  2HR3 A;  2P7V B;  1NH3 A;  2CRG A;  3KP4 A;  3OYE A;  2NS7 A;  2OD5 A;  1HW2 A;  2H6C A;  3FXO A;  1J75 A;  2H1L A;  4Q4Z F;  5HS7 A;  3L9F A;  1O3Q A;  2CUE A;  3P7N A;  1GT0 C;  4ESF A;  1HA8 A;  3ZRG A;  2ZME C;  3LSG A;  1BBY A;  4BJT A;  3B02 A;  3G2B A;  4U87 A;  4G8X A;  4HNU A;  2LY2 A;  1XSX A;  2JVH A;  3ESW B;  5B5E C;  1SD4 A;  5ILS A;  1EKE A;  1MBJ A;  1AKH B;  3I53 A;  3S3M A;  3K69 A;  4Y52 J;  2ZJR F;  4UNO A;  5IT9 Z;  3CJN A;  2VJJ A;  1X19 A;  3BCB A;  2B7E A;  1YFH A;  4XL9 A;  2M4K A;  3IL2 A;  3ABK H;  1JUS A;  2OF7 A;  2X0L A;  1T8I A;  5FKK A;  2KIF A;  2W4S A;  2VXD A;  3FXJ A;  3LSJ A;  5E1W A;  1DUX C;  4BDY A;  1V5G A;  3IUO A;  4XKC A;  5LHI A;  2FF4 A;  1NK3 P;  2PX9 A;  3PM1 A;  2D1V A;  3P9K A;  3Q3S A;  2K40 A;  4BH9 A;  4WK8 F;  3OYB A;  1QPI A;  1UJ8 A;  3MQ0 A;  5L3G A;  3HGG A;  4YFK F;  2LF8 A;  5FLX Z;  5B66 C;  2Y0S N;  4AUX A;  4E7J A;  4X0G A;  2XGC A;  2HQ5 A;  3OWT A;  2IA2 A;  3J7Y J;  3S93 A;  1U5T C;  2FQ4 A;  2I8D A;  3OYN A;  1MJB A;  5DCM B;  4B1R A;  3CLQ A;  2XB0 X;  1S9H A;  3PSF A;  1ACI A;  1NTC A;  3L2U A;  2HZD A;  4NC8 A;  3DWL E;  4XOT A;  1Z05 A;  2KPM A;  2QQB A;  2CUF A;  2WAQ A;  1GLN A;  4LMY A;  4M9S A;  2R3S A;  3REO A;  2ZSH B;  4OIO F;  3RPU A;  1UFM A;  2JUC A;  2UUZ A;  4UV8 A;  1XS9 A;  3TBI A;  4CGZ A;  2MA3 A;  4P1W A;  1P7J A;  5JHF A;  1YX5 A;  3IWZ A;  2PQ8 A;  2CFX A;  3MZ8 A;  1ZGW A;  5DUI A;  4OIQ F;  1JI8 A;  1WI9 A;  1KU3 A;  1W5C C;  3SEQ A;  4B47 A;  5JVT A;  2LF7 A;  5TRD A;  2GA2 A;  3FK7 A;  2EV5 A;  2GBY A;  2R7F A;  4L9N A;  4UY8 I;  3I4P A;  1S72 I;  5LHG A;  3GO5 A;  4L0Y B;  4L9J A;  3OYG A;  1VFC A;  4XKW A;  2BVL A;  5EF6 A;  2KDZ A;  2QEX I;  2HQA A;  2O8X A;  5E8I A;  4A3C J;  4XID A;  1GV2 A;  2L5Q A;  1X1C A;  4BE1 A;  2KZV A;  4NQW A;  4RAY A;  2IA1 A;  1Y8R B;  2VC1 A;  4HZF A;  3KP7 A;  2ZME B;  4MTD A;  5IP9 J;  4C3I J;  4AVP A;  2XRO A;  3FMQ A;  3K10 A;  1YIT I;  3BJ6 A;  3HJE A;  3HHG A;  4I7H A;  1ZAO A;  2BHY A;  4XN0 A;  4I0A A;  1GXQ A;  2DPD A;  1RRJ A;  1P6R A;  4HX7 A;  2OC6 A;  4D7N A;  1XTA A;  1W36 C;  3MEX A;  1YO5 C;  5J47 A;  1Y1V J;  4BE2 A;  4IHV A;  4IOC F;  3BR2 A;  2KP6 A;  4LIT A;  3FX3 A;  1D0Z A;  3R0A A;  2CO5 A;  3DFG A;  3NRV A;  1XMK A;  3PL8 A;  5KK1 A;  4LOC A;  2NOJ B;  3QP6 A;  4G7O F;  1E17 A;  4UB8 C;  1RZ4 A;  3NAR A;  2LD5 A;  3NWS A;  4ESB A;  5EGO B;  1B1B A;  1MND A;  3EUH C;  4M3G A;  1U0J A;  3P9I A;  3QU3 A;  4WXC A;  5DCF A;  1W5T A;  1D5Y A;  2VJ5 A;  3WG9 A;  4YIF A;  2AQE A;  1K6Y A;  4I76 A;  3W2V A;  4OIN F;  3WTV C;  1VQP I;  4HF2 A;  2PMZ N;  1WI3 A;  3OYI A;  3DKY A;  1LFP A;  4OOI A;  2HZT A;  1TWH J;  4A0Y A;  2P5L C;  1U5T B;  2L7Z A;  2ZXW H;  4EJW A;  3JR9 A;  2FUG 2;  2MLG A;  1IGN A;  5FFX A;  1LEA A;  2E60 A;  3JW4 A;  3M4O J;  4D1Q A;  4EMS A;  4HV5 A;  1T95 A;  4EEF G;  5K7Z A;  2BXY A;  3I4N J;  3SZG A;  3MZH A;  2KT0 A;  2DCE A;  3L7W A;  2XPW A;  2XKP A;  4CZZ A;  2CQQ A;  3QOP A;  2GOX B;  5CPR B;  1WJD A;  4YIR X;  3D5L A;  1J09 A;  1QHG A;  2GAU A;  4HDV A;  1IC8 A;  4P9U A;  2A3S A;  4FQG A;  1MZB A;  2E5N A;  1ZQ3 P;  3HRM A;  4A3J J;  3JRA A;  1IRX A;  4J01 A;  3TO9 A;  2GIV A;  3RTR A;  4BNC A;  4IHY A;  1VQL I;  1VI0 A;  5LBQ A;  2ADU A;  5J1R A;  5FLM J;  3C7J A;  3CME I;  3MWM A;  4A0X A;  2EV6 A;  5J8F A;  1EA3 A;  4MEX F;  5CVU A;  2K7L A;  3TGN A;  1ZR2 A;  5CJ9 A;  1ZRE A;  4HLX A;  1KYZ A;  1I27 A;  1NHA A;  4CCM A;  4DNC A;  1ZRC A;  3ZMT A;  2KQR A;  2HGC A;  4AIK A;  4MLO A;  2K9M A;  1UHM A;  1O3S A;  1FNN A;  3BTL A;  4IHX A;  2GXG A;  3DTK A;  3I55 I;  4XBF A;  1YW9 A;  2D5V A;  4HNV A;  2RRE A;  2LK2 A;  4RGR A;  1U9O A;  3OV8 A;  4YFN F;  1OCT C;  4YRV A;  4O6J A;  3K4L A;  5IYC J;  1P2F A;  4MEY F;  1Z91 A;  3QYF A;  3AFH A;  3I64 A;  4KIS A;  3CES A;  3HPH A;  3ZMV A;  3J80 Z;  1N77 A;  1BI3 A;  2ZO4 A;  3GTQ J;  3NEU A;  2F48 A;  3C3W A;  3A02 A;  3CF2 A;  3W6J B;  3E6B A;  5FJ8 J;  3CMM A;  2K3F A;  5D4S A;  5H2F C;  4E7Z A;  4P55 A;  1KZH A;  1WZ2 A;  1ZG5 A;  2TCT A;  4JX5 A;  2LSO A;  3IAS 2;  2JRM A;  1SVO A;  1YI2 I;  2PJP A;  3HB9 A;  2ZXJ A;  1Z6T A;  5CVJ A;  4YEJ A;  1Y6I A;  5E17 F;  4KN7 X;  4HEA 2;  1X1D A;  1IW7 F;  3BR1 A;  2A68 F;  2V26 A;  4XKV A;  2DA3 A;  5J4V A;  1ON1 A;  3CZ6 A;  2W7N A;  3KYD B;  3I59 A;  2DTZ A;  3JAM Z;  3RKQ A;  2VT3 A;  1KON A;  3ZP5 A;  3E5U A;  1UCR A;  5IP6 A;  4PK4 A;  1K4S A;  2OU2 A;  3HKZ N;  5D8L B;  1R58 A;  4LG0 B;  2IPQ X;  3Q0U A;  5KAF C;  3T1B A;  3U21 A;  2XC7 A;  3FBI B;  1YIJ I;  3BY6 A;  5A2Q K;  3GFM A;  2HS5 A;  3TKY A;  4BXX J;  1ZAR A;  3DTI A;  3GBG A;  2P6T A;  2JSP A;  4YII A;  5TJJ A;  1OLT A;  2ZFW A;  1X3U A;  1X58 A;  4OAZ A;  3JRF A;  2D2W A;  2KHM A;  5LLQ A;  3HOZ J;  4X6A J;  2QQ9 A;  2DDB A;  2KRC A;  1KQ0 A;  1WJ5 A;  1RI7 A;  1BIA A;  2H09 A;  2BBY A;  2VQG A;  2TRT A;  1MH3 A;  2HFH A;  1FWZ A;  2UXX A;  1O4X A;  2H6B A;  3BZK A;  5ERI A;  1OYW A;  4HSR A;  4CCJ A;  1TBX A;  2DMQ A;  3QWL A;  4BDZ A;  4A3E J;  1LE8 A;  4MIM A;  3KZI C;  1QZE A;  4LJZ F;  2AS5 F;  2EQR A;  3KP6 A;  1OYI A;  4AD9 A;  4J00 A;  4RBO A;  2RGV A;  3FF5 A;  2RDP A;  4GYI A;  4IRI A;  4R1H A;  4BXU A;  4EV0 A;  1YJ9 I;  1FJL A;  5DD8 A;  2HYJ A;  2QLZ A;  1H0M A;  1V3F A;  1MGT A;  3E3V A;  3K4C A;  2VOO A;  3QPS A;  3HYI A;  3IHU A;  4A6D A;  3M7G A;  1WH7 A;  1T38 A;  2M3A A;  1H8A C;  1XMX A;  5F0C A;  4A0Z A;  4FE4 A;  1BW6 A;  2DXI A;  4ZYH A;  1WJE A;  1TTY A;  1STZ A;  2CJJ A;  3F72 A;  4XRS A;  1GVD A;  2Z33 A;  3EET A;  2E5Z A;  4XKB A;  3AL0 C;  2JJ7 A;  4G12 A;  3BTC A;  2QYO A;  1A31 A;  4ZTJ A;  2AHQ A;  1R9T J;  3H3U A;  3K4N A;  2X1C A;  3FXL A;  4E7S A;  2NVT J;  3HRT A;  2BV6 A;  2VL8 A;  2BW3 B;  5BQT A;  3BG6 A;  4DGW B;  1IN4 A;  1VZ0 A;  3KP2 A;  3OS0 A;  2IT0 A;  1E3P A;  4NDL A;  1IN6 A;  2DTR A;  3QYE A;  5D8K B;  1FOK A;  2E2I J;  2O6G E;  2E1M C;  3R0J A;  1SVL A;  3ZQI A;  3HZJ A;  5IT9 K;  1FPQ A;  2PI0 A;  2YUS A;  4BHB A;  2EK5 A;  2CYY A;  2IAI A;  2PMZ A;  5D6E A;  2ACJ A;  2L3D A;  2A6H F;  2XDV A;  3DKX A;  3I54 A;  3JRE A;  3LSH A;  5FRO A;  4HX8 A;  2M87 A;  1UZC A;  3LSK A;  4UV9 A;  5B1B H;  5BS6 A;  2FQ3 A;  5EG0 B;  1SD7 A;  1FZP B;  3ABM H;  2OCE A;  1H9G A;  4B44 A;  4PSW A;  1Y56 A;  3V8J A;  1X3Z B;  4ENK A;  4DBQ A;  3SHF A;  3FKI J;  1Z77 A;  4Y17 A;  4OIR F;  2DYR H;  2M30 A;  2NVY J;  4N9I A;  1R4M B;  4CCL A;  5FLX K;  2ETH A;  1K78 B;  3S3O A;  2F5E A;  3ECO A;  1WGX A;  2WV1 A;  1IRG A;  4FHT A;  2JTV A;  1SFO J;  1LFB A;  1A6I A;  1DGR M;  3GWZ A;  4P96 A;  1LDJ A;  4JBA A;  1W5S A;  2M7B A;  3SZT A;  4U7D A;  5JHU A;  5FFZ A;  2DT6 A;  3JRD A;  4II3 A;  2O03 A;  1G3Y A;  2WC2 A;  1OR7 A;  2ZNY A;  1U8R A;  3KYC B;  3E1S A;  3VB2 A;  2CFO A;  5EEG A;  5F0H A;  3CCM I;  3GTL J;  1LVK A;  3JTG A;  2MAB A;  2K3P A;  3MMY B;  1YJW I;  3EUA A;  2PJR B;  1RET A;  2ZC2 A;  4ETS A;  5EJC A;  1W0T A;  1X1P A;  1RUN A;  1IF1 A;  4LLG F;  1DGW Y;  1O7L A;  1REP C;  2L01 A;  4KJZ A;  3E97 A;  3OYL A;  1B6A A;  4XSZ F;  5IYB J;  2C6Y A;  4PJN A;  2VAS A;  2WAD A;  2XSJ C;  2B63 J;  2HXO A;  1UST A;  4XQF A;  3HGY A;  3LSP A;  2STT A;  2OZ6 A;  1ON2 A;  3F3X A;  1JJ8 C;  1UEL B;  2NNN A;  2HOT A;  5BMZ A;  5E20 A;  2CV0 A;  1BIB A;  3CCJ I;  3PO3 J;  2BE5 F;  2ICW G;  4TV7 A;  2LRD A;  1FY7 A;  4MNU A;  4E7I A;  3AL0 B;  3H9G A;  1I50 J;  3D5S C;  2W25 A;  4XLP F;  4ZDO A;  3VEP A;  2HQN A;  3H36 A;  4KNY A;  3BG3 A;  4HQE A;  5AIP A;  1WPK A;  2FML A;  3FZV A;  1Z7L A;  2V4J C;  3V8L A;  4WX9 A;  1Z3X A;  4ENM A;  2YS9 A;  1R5H A;  3DPT A;  3KZZ A;  3M9A A;  4JYK A;  3M8J A;  4ZYG A;  4FX4 A;  1PYV A;  4UUS B;  2R7T A;  3MAJ A;  4ZTF A;  2E1M B;  2Q1Z B;  1G3S A;  2IGN A;  2DQL A;  2KRF A;  5GTI C;  2L0K A;  2ZJ2 A;  1TT5 B;  3BG5 A;  1SVM A;  1MJ9 A;  4DBR A;  1S7A A;  1Y0N A;  3AG4 H;  4ABZ A;  2RNJ A;  1RC9 A;  3HHH A;  3TOB A;  4HG2 A;  2KLO A;  3A0H C;  3PNT A;  2K85 A;  3ZXS A;  2VUM J;  2A61 A;  2QUF A;  4L5I A;  3TDZ C;  4PJM A;  1ETV A;  3BTI A;  4D5C A;  3FMS A;  3GF2 A;  3CC2 I;  2JA7 J;  4GDF A;  1VQ6 I;  3GZN B;  5JLX A;  3S14 J;  2EB7 A;  4ZJZ A;  3BR6 A;  4HQM A;  1J0R A;  2KFD A;  4L5E A;  3UKG A;  3CJR B;  2R5Z B;  4FE7 A;  1CF7 B;  3R61 A;  4XMY A;  3GZ6 A;  1YS6 A;  3A0B C;  2BXZ A;  2WTE A;  4V2F A;  5HLG A;  2RN7 A;  3IAM 2;  1OR7 C;  1IAW A;  4JOM A;  3IH2 A;  2K4J A;  3WTY C;  2XAQ A;  4CHU A;  1ZHF A;  2DW4 A;  3MKW B;  4K2E A;  2MC3 A;  2P4W A;  5D5V B;  5EYR A;  3L2V A;  4XRM A;  3CQZ J;  3QOD A;  1RUO A;  3S17 J;  1G2H A;  1OIS A;  2Y9Z A;  4GFB A;  5B1A H;  4BJ5 C;  3HOV J;  3I5U A;  4LLL A;  3DKW A;  4CUG A;  2R5Y A;  4KMF A;  2XAG A;  1ONV A;  2QKM B;  4RB2 C;  1V54 H;  4R79 A;  1S5L C;  3AG1 H;  2KRH A;  1LFU P;  2EV0 A;  1HST A;  4I98 B;  1HKT A;  2V9V A;  4AIJ A;  3HRS A;  3OR1 C;  4D5F A;  2A5Y B;  1MH4 A;  4NBQ A;  1D3Y A;  3PUB A;  1ZLK A;  2X6W A;  3AKZ A;  3QPT A;  3K4J A;  2HQR A;  5KVR A;  4ASN A;  1Z6R A;  4KUM A;  2VLA A;  1FP1 D;  1GUU A;  1PUF B;  1VQ9 I;  1WHU A;  2FBH A;  2HKX A;  1W1W E;  2WV0 A;  4BE0 A;  3JRI A;  4W97 A;  1IXR C;  1MSE C;  4JK1 X;  4MFE A;  2VI6 A;  4EM2 A;  2ELK A;  3PUF A;  3GTP J;  1KU9 A;  2IEK A;  1EV7 A;  1YLF A;  3CCL I;  1FIA A;  2HDC A;  4CYC B;  2HDW A;  1F9N A;  3MKY B;  4HBL A;  5FKL A;  4KIT B;  2HVR A;  3J80 K;  3JCU C;  1IDY A;  3TO6 A;  2CW7 A;  2ZXI A;  1XSV A;  2VQL A;  3VOD A;  4B3X A;  3ZMU A;  2GXB A;  2E34 A;  3HUG B;  2YPR A;  1KQ9 A;  3K1P A;  3IH4 A;  2MW8 A;  4QLC U;  2L9S A;  5KAI C;  1IXC A;  2CQX A;  5F04 A;  3GX4 X;  4A2U A;  4RS8 A;  1HCR A;  3RKX A;  5KCM A;  1JT0 A;  3BTJ A;  2GQQ A;  1ITY A;  5LEK A;  2JA2 A;  4RAG A;  3H1C A;  5DM6 F;  3LAJ A;  1ETY A;  2IS6 A;  3OMY A;  3NWT A;  2M5W A;  4BEH A;  3CDL A;  1R7J A;  1OCZ H;  4OU0 A;  2IA0 A;  4UVA A;  1TQM A;  1KYW A;  3U2R A;  3OR2 C;  4NNJ A;  3JAM K;  1Y8Q B;  4D9J A;  1XGM A;  3BJO A;  2FA5 A;  3JRG A;  4XLH A;  1GXP A;  1D1A A;  3ZMD A;  2HEO A;  1F4K A;  1LB2 A;  3TO7 A;  4HNT A;  1VQ4 I;  2VQH A;  3ISP A;  4LFU A;  1E3O C;  1D5V A;  4MQ9 F;  4JX4 A;  2GXA A;  1QU3 A;  4II2 A;  4EM1 A;  3EPZ A;  3CO6 C;  3QU6 A;  4HPQ A;  1EF4 A;  3KET A;  4QWQ A;  1X2M A;  4FET A;  2JA6 J;  1X2N A;  2EZL A;  1WRJ A;  4M9Z A;  1FMV A;  1WJC A;  5FRN A;  1Y1W J;  3ERM A;  4ZDL A;  5K5Q A;  5LFA A;  3R60 A;  4KYW A;  1O7F A;  4I09 A;  4M3D A;  2L02 A;  4M6V A;  4IO9 F;  1BL0 A;  1B8I A;  3Q0W A;  1HSJ A;  3MCZ A;  3ZGK A;  3J81 Z;  4BYY A;  2DOD A;  2V79 A;  1R6R A;  4I02 A;  5D6F A;  4W1U A;  3SFI A;  2VB6 A;  3R6S A;  2V9K A;  2QZ8 A;  5BPD A;  1XSD A;  1K83 J;  3A1Y A;  3P9C A;  1LVA A;  1K4T A;  1MIJ A;  1HW5 A;  2CUJ A;  1BN5 A;  4PFO A;  2K9S A;  2FOK A;  2V9P A;  2JMW A;  5K1Y A;  3IWF A;  1WCM J;  3WHB A;  2HKO A;  3F8N A;  4OAY A;  3MKL A;  2AXT C;  2ZSI B;  1XCV A;  1V5E A;  4PGH A;  4B48 A;  1FIP A;  2V6C A;  1B72 B;  4UUV A;  2FMY A;  2VOP A;  3RJP A;  4AVZ A;  5M3F J;  4YG2 F;  2QSG X;  4A3G J;  3HRU A;  2O0Y A;  4ENJ A;  2NOG A;  3O8G A;  3PFI A;  3PQK A;  4Y4R A;  3D0S A;  1DP7 P;  2Z99 A;  3J7A Y;  4IRG A;  2XUB A;  1WFX A;  2LFB A;  5E18 F;  3HOY J;  1H88 C;  1VF9 A;  1K7A A;  3V7R A;  6PAX A;  3DV8 A;  1MNM C;  3KZY A;  2CQK A;  4RB1 A;  2LY9 A;  2IBD A;  1DQU A;  3ERE D;  4C2U A;  3RKW A;  3GVA A;  1BI1 A;  1QO0 D;  3PO2 J;  2KL4 A;  1K6O A;  2EPF A;  3DBR B;  3C1D A;  2FU4 A;  2RAE A;  1ZG3 A;  2KIM A;  1EH7 A;  1E2X A;  5HDN A;  1VQO I;  2M34 A;  3FXQ A;  1OKR A;  4G6T B;  3S2W A;  2HVS A;  1S8N A;  5FB2 A;  4PSX A;  1T98 A;  2EFQ A;  1J2X A;  4Q48 A;  4CCO A;  2KIU A;  2DT7 B;  2E2H J;  2IS4 A;  1BR4 A;  1Z7U A;  3HSE A;  1R1V A;  3DLL F;  1M1E B;  2RNG A;  5M5X J;  3RQ4 A;  3U1K A;  4A3D J;  2EBI A;  5FRM A;  1BR2 A;  2OTJ I;  2F5F A;  2YR2 A;  4GO1 A;  4L9T A;  3RCO A;  4HF1 A;  1ZRF A;  1HKQ A;  1IO2 A;  4F91 B;  5K5O A;  2VBX A;  3HPG A;  3K1N A;  4MGR A;  2OJE D;  2M2E A;  1I3Q J;  5LRR A;  4RGX A;  1MSF C;  3H9Q A;  1TWA J;  1Z0X A;  3CMY A;  1YHQ I;  2Q2E A;  3KEQ A;  2H1K A;  1SFU A;  2VJ4 A;  1YW7 A;  1W7P D;  2VKD A;  3KYL A;  4HLY A;  4IF4 A;  2DJI A;  5ICF A;  2GIZ A;  2AXL A;  2JSC A;  3W3C A;  2QCO A;  1W7P B;  2RQQ A;  3K1M A;  4BAC A;  4KDP A;  2P5K A;  2DA5 A;  3DU6 A;  3KIO A;  4NC7 A;  4DQ2 A;  1SFX A;  5F0F A;  1XCB A;  2XAS A;  3K70 C;  1N78 A;  1EH6 A;  2L54 A;  3ELK A;  2HDD A;  2K02 A;  3E6C C;  4IHW A;  4A3L J;  5FD6 A;  3K6G A;  2LG4 A;  4IQJ A;  3K4B A;  5AIQ A;  3CUQ A;  2LKX A;  3H9J A;  1WH5 A;  1ETW A;  2D45 A;  2PG4 A;  1PJR A;  2CSO A;  2Q8K A;  1TWF J;  3DPL C;  3MFK A;  5L3B A;  1ULY A;  2XF6 A;  1YRN B;  5LGT A;  4N4O B;  1TL8 A;  1VQ8 I;  3SDB A;  3F6V A;  2BY0 A;  3WTX C;  1FP2 A;  5ILU A;  4I01 A;  3ZCO A;  5K7F A;  4HX4 A;  1XC5 A;  4BBS J;  4JQF A;  3LQQ A;  3H0G J;  1LDK B;  2DAO A;  3CCQ I;  2K5C A;  1AA7 A;  2EIJ H;  2EIK H;  4A12 A;  2B9S A;  1XDU A;  3ZMZ A;  1VQN I;  4WXH A;  1TNT A;  4F52 A;  2DMT A;  2X1E A;  5C4J J;  4CDG A;  3TW6 A;  2M9H A;  1IRF A;  1BOB A;  2E2J J;  3PSI A;  4QIW N;  1B4A A;  3RI4 A;  4BQO A;  5IOY A;  2MH2 A;  2OA4 A;  3IRQ A;  4RDU A;  3OSF A;  3IRR A;  1QA6 A;  3AAF A;  4UVB A;  2O61 A;  4KT5 C;  1A35 A;  1N25 A;  4ANJ A;  1JTX A;  3FHN A;  2EFO A;  2FBI A;  2HU9 A;  1OPC A;  1W36 D;  3KCC A;  4ZYD A;  1QQI A;  5BOX A;  3MD2 A;  1Z9C A;  1PP7 U;  2PMH A;  2EWN A;  3LST A;  1MMD A;  2L9N A;  1SMY F;  1WQ2 A;  3V4G A;  4J19 A;  4OWR B;  2ZJP F;  1ZKG A;  2NNY A;  1LDD A;  2NS0 A;  1JTY A;  4A6E A;  4QPQ A;  2NXN B;  3H5N A;  1POG A;  3AG2 H;  3ECH A;  4D7M A;  2HYF A;  5E79 C;  4G6Q A;  2LRE A;  1W4M A;  2OBP A;  3I4M J;  1R4N B;  1JUP A;  1TLH B;  2IGK A;  1BC8 C;  2E7X A;  2I10 A;  1MDM A;  3SXY A;  1R23 A;  1U3E M;  1XPX A;  2F5D A;  4LG3 A;  4BXF A;  3S1M J;  2X51 A;  5F1J A;  5HLH A;  1MMA A;  5CVV A;  5F64 A;  1R71 A;  4NUB A;  3MVP A;  4LGW A;  2CGP A;  3CCU I;  1I1G A;  1S7O A;  1R49 A;  1FT9 A;  3HOS A;  1U9N A;  1ZN2 A;  2DDA A;  2HI3 A;  3KP3 A;  3GEZ A;  2HVQ A;  4BJ6 C;  3V7C A;  2MBF A;  3RPU D;  4F92 B;  1T0F A;  4AID A;  2IGO A;  1IUF A;  2KMU A;  4KIF A;  4Y13 A;  4AM3 A;  3KLO A;  1Z3Y A;  3GFL A;  4O5V A;  4RGS A;  1HQC A;  3LA2 A;  2XAJ A;  1ZRD A;  4HYE A;  5E3O A;  1MKM A;  2B0L A;  2IGM A;  1R36 A;  2WY7 Q;  3HL2 A;  3ZR8 X;  3CF5 F;  1AHD P;  2QBY A;  1OCP A;  4CIC A;  3K2Z A;  5IY5 H;  1QHH D;  2Z5U A;  2O3F A;  1IN5 A;  2DK8 A;  2YU3 A;  2DQR A;  3DPU A;  4B09 A;  5HNH A;  5H6R A;  1TWC J;  3BPX A;  1G8X A;  1MBF A;  2K9Q A;  5ICG A;  3WGI A;  4Y15 A;  3HOT A;  1MD0 A;  3LL7 A;  4RGU A;  1I3A A;  4EM0 B;  2EIL H;  3CTA A;  1I1S A;  2VE9 A;  3JTH A;  4NQW B;  1Q1V A;  5HS8 A;  1VQM I;  5CVI A;  3G1O A;  1IZ1 A;  2R7U A;  3KP5 A;  2H27 A;  2K4B A;  2GM4 A;  4FIS A;  2KKO A;  4DYR A;  1HF0 A;  1C0W A;  2LBF A;  4C3J J;  4XR6 A;  4RLF A;  4KMU X;  3ABL H;  1ZG1 A;  2PEX A;  2V1U A;  2R7Q A;  2X6X A;  3GZ5 A;  4B3A A;  2Y2Z A;  2JA5 J;  4PJ0 C;  2E1C A;  3VPR A;  4RM3 A;  5HLT A;  3OY9 A;  5TIS C;  3L2C A;  2DFH A;  2MYS A;  2X48 A;  4ZDP A;  2O5R A;  2ESN A;  4A3M J;  3CCY A;  4UB6 C;  2E1O A;  2R7D A;  1UG0 A;  4P9F A;  4XRS G;  3BWG A;  1F43 A;  1R5I D;  3FIW A;  2XPU A;  2X4H A;  3BQZ A;  2MSY A;  2XIG A;  2VBW A;  2VQC A;  1X1A A;  2EJR A;  2DA7 A;  2Y31 A;  2L4A A;  5J8C A;  3G4S I;  1SFE A;  4HAM A;  2W00 A;  4LIU A;  3QOE A;  3WU0 A;  2DI3 A;  3OIQ A;  1PVE A;  5GP9 A;  1ZGA A;  2GZW A;  2LOO A;  2UZK A;  5EZG A;  2VON A;  4PJJ A;  2W84 A;  2Z3Y A;  3M1E A;  2WAE A;  2EH3 A;  3ZQG A;  4Y3O A;  3EYI A;  2DU9 A;  3FXK A;  2CWE A;  3KE2 A;  1ERD A;  3TP0 A;  3V8K A;  3A01 A;  4DYC A;  1XB4 A;  3GYH X;  3DU5 A;  1XDS A;  2L9V A;  3DCF A;  2VPL A;  4RB3 C;  2VE8 A;  3CCR I;  1YE9 A;  2E1N A;  2EFP A;  2HTJ A;  4RAZ A;  4N9H A;  3WG7 H;  2CG4 A;  2DA2 A;  4IRH A;  3C2B A;  1XD7 A;  4DJA A;  4LLN A;  3GTM J;  3OYF A;  2XHK A;  2JA8 J;  2COM A;  1ZYR F;  3K7A J;  2COB A;  1T08 B;  2BHZ A;  2N8G A;  2YX4 A;  1MW7 A;  1ZK8 A;  4ZZD A;  4KIG A;  5EEA A;  4IQ4 A;  3WTT C;  2JZY A;  4XSX F;  4B4C A;  5JLW A;  1GHC A;  4IOA F;  3K0L A;  1KU2 A;  1MJA A;  4HV6 A;  5GAH J;  2RKH A;  3W6V A;  2QF7 A;  5J6X A;  2DA4 A;  1PP8 F;  3GCM A;  2HWV A;  1AKH A;  2Z16 A;  1JHF A;  2VN2 A;  2PMU A;  3WTW C;  5LGU A;  1TP4 A;  4BKX A;  4ZH4 F;  3CCV I;  4C9Y A;  4GRI A;  5J3L A;  1J7K A;  3M1C A;  1MNE A;  3TQN A;  4ZZL A;  2ECC A;  2IJL A;  3N4M A;  2K86 A;  2PFB A;  2X6O A;  2QVO A;  1SAX A;  1RKT A;  2VXZ A;  5L3C A;  1E3H A;  1L3L A;  1I39 A;  2LDU A;  2KIS A;  3RSN A;  3SDG A;  2K9L A;  5B3S H;  1SD5 A;  1JT6 A;  4IL6 C;  1IV6 A;  3JSO A;  4DW6 A;  3BLY A;  1VTN C;  4U88 A;  2BEO A;  1HOM A;  4IEJ A;  2GA1 A;  2QEN A;  2LP0 A;  1IUY A;  1QPM A;  5F08 A;  1Y0U A;  4BS9 A;  1SAN A;  1TQI A;  1ODD A;  2CMP A;  2OCC H;  4IVN A;  3GME A;  2CU7 A;  2L2O A;  4IXA A;  5TGT A;  5ICE A;  3L2W A;  4HA8 A;  5DCM A;  1JKP C;  3GFJ A;  5ICC A;  4D0P A;  3F23 A;  2Q0O A;  2R7Z J;  1Z67 A;  2EZI A;  4BGD A;  1HC8 A;  1FOY A;  1JUM A;  4FX0 A;  4LB6 B;  2EIM H;  4RM2 A;  4GYG A;  4JP0 A;  5FO5 A;  5GAE J;  2CQN A;  4CYD A;  3T8T A;  3OYJ A;  4NB5 A;  2QQ8 A;  3I59 B;  4C3H J;  1APL C;  3DQV C;  2CS3 A;  3QAH A;  3SYT A;  2BYV E;  2BY3 A;  4BQQ A;  3IP4 B;  2X85 A;  3E7L A;  3GTO J;  2H8R A;  2UV1 A;  3G71 I;  1DP3 A;  2OQR A;  3GXO A;  3SJM A;  4WCG A;  4NC6 A;  3CDH A;  3M8F A;  2Z9O A;  1I6X A;  3D5R C;  3LQR A;  3ZPL A;  1X3W B;  3CP2 A;  2GOM A;  2MD5 A;  3CC7 I;  1USS A;  3HEF A;  4DYQ A;  3G73 A;  1N75 A;  2ZME A;  5FKN A;  3G1M A;  3DEE A;  1LE8 B;  3KLN A;  4A69 C;  1TT0 A;  2RC4 A;  3DF8 A;  4HW0 A;  5M5W J;  1ZTR A;  1HDP A;  2VT2 A;  2XAF A;  1I6H J;  4BAY A;  2EFN A;  2VKE A;  1YW8 A;  2K9N A;  3T0Y A;  5CLS A;  1HKS A;  3Q5F A;  2L7K A;  1BR1 A;  3W2A A;  3TDU C;  2FJ1 A;  3VDX A;  1HXD A;  2IRF G;  3QYB A;  2DO7 A;  2JPC A;  4B43 A;  1D0Y A;  2HOS A;  3FHZ A;  1IV8 A;  5EGO A;  4H4K C;  3EUK L;  3BRO A;  1L0O C;  1XGN A;  2W1O A;  4S0H B;  1YX3 A;  3HTS B;  2WB1 A;  5GTH C;  4UHT A;  3RPQ A;  3BOQ A;  1BJZ A;  2IP2 A;  3V7S A;  2KJC A;  4I0B A;  4FT8 A;  4XM3 A;  3VYU B;  3GTK J;  3QP5 A;  2ZKZ A;  1F1Z A;  2BY1 A;  5J4Y A;  1JE8 A;  4OMZ A;  1U5T A;  4PUS A;  1TW2 A;  2Z2S B;  2NRA C;  3WTZ A;  1YJN I;  1RES A;  1ZGJ A;  2ID3 A;  1NG6 A;  3WGH A;  4XLC A;  1FSH A;  2CQ7 A;  3OIP A;  3S1N J;  2P8T A;  3NAU A;  3OYA A;  2HYG D;  1BI0 A;  1Z21 A;  3TOA A;  4EJO A;  4Q5S F;  4M73 A;  1QBJ A;  3OOU A;  1D8K A;  5DS9 A;  3F22 A;  1A04 A;  2FNP A;  3ULQ B;  1O3R A;  2PN6 A;  3I3L A;  2DA1 A;  4EJV A;  3BG9 A;  5IYD J;  3OYM A;  2AO9 A;  1UHS A;  2NYX A;  4XON A;  3ZQ7 A;  1FOW A;  4I2O A;  2O7O A;  4PGG A;  1CGP A;  3F0C A;  2M4G A;  2KIQ A;  4HF0 A;  2FEZ A;  3B6C A;  3RZD J;  2JVG A;  3LSM A;  1LQ1 A;  3M8E A;  4R8H A;  2BOL A;  4PFP A;  2W24 A;  2G0E A;  5K5R A;  4C2M J;  2KZG A;  3HSF A;  3C18 A;  4MQV A;  2NVQ J;  1KQ8 A;  5DUK A;  2JK3 A;  4AC0 A;  4CCK A;  3PQJ A;  2YX7 A;  2DOA A;  3DTE A;  2QA4 I;  2CV1 A;  2OV7 A;  5FKM A;  4XRF A;  2XSD C;  2WBM A;  1JKO C;  4KA4 A;  2P7C B;  2HNH A;  1UMQ A;  2DYS H;  4IPA A;  5JI6 A;  1U8B A;  5H6Q A;  2DFF A;  5F27 A;  1A5J A;  1MMS A;  1X1B A;  2A6T A;  1RR7 A;  1WVR A;  3RDI A;  1XGS A;  2IS1 A;  1ORK A;  3KPH A;  3F8F A;  3IV5 A;  4EGY A;  3C2G A;  3ML6 A;  2LY1 A;  2A07 F;  2Y9Y A;  1S7E A;  4IX7 A;  1F36 A;  2ECB A;  1TZL A;  1EH8 A;  2TDX A;  3RYR A;  2OAZ A;  3E0J B;  2D1H A;  1WKM A;  1XX5 A;  3E6M A;  5CKT A;  4AYB N;  1JGG A;  3QPL A;  2LC2 A;  1ZR4 A;  3COA C;  4EJT A;  5J40 A;  5D5U B;  3CCE I;  1BJA A;  1HBX G;  2LH9 A;  1E0E A;  3ZOB A;  2CUZ A;  2VKV A;  1A36 A;  3DBH B;  4BUP A;  3EUH A;  4BU2 A;  2M7A A;  2FX0 A;  2A5W A;  4ON0 A;  5DD4 A;  2R7V A;  2P81 A;  4RA2 A;  3F8M A;  3FM3 A;  1S3J A;  5C44 J;  1TC3 C;  2RV8 A;  1OCO H;  4LK1 F;  5EDN A;  2E7W A;  2DFE A;  4XLE A;  4DZJ A;  2R7X A;  1YIO A;  1GV5 A;  1WJA A;  4BY7 J;  3SFZ A;  1D0X A;  2CW8 A;  1MBH A;  3BZC A;  2XRN A;  4LG0 A;  3GTG J;  1B9N A;  1J59 A;  2JWT A;  3G3Z A;  1W0U A;  2QGU A;  2XGE A;  2KDO A;  1QRY A;  5J1U A;  3UNG C;  4Q47 A;  4U0V A;  5DTD A;  4RB0 A;  5FLV A;  1IG7 A;  2BVM A;  2DMP A;  2HOA A;  4F93 B;  3K2A A;  2R0Q C;  4N4N B;  5IP7 J;  1QZZ A;  1ENH A;  4MTE A;  1Y39 A;  1SEU A;  3B6A A;  3HBL A;  5D5W B;  3AG3 H;  3WE2 A;  4GGG A;  1BOA A;  4AIH A;  3CO7 C;  4F55 A;  3E5Q A;  2MD0 A;  3BC8 A;  2HPM A;  2FOW A;  4MFD A;  3CD6 I;  4DZP A;  5LGN A;  1AWC A;  1DU6 A;  4XOP A;  4A3K J;  1DPU A;  3ZQQ A;  2V1X A;  1YG2 A;  2XV4 S;  4IZZ A;  2R7W A;  3I0T A;  4QPO A;  2CV2 A;  4I6Z A;  5GAG J;  3JRC A;  1S6L A;  4XIC A;  2A05 A;  3LFU A;  3TMO A;  1OFC X;  3I9V 2;  2LTP A;  3F9K A;  3ZQC A;  1P92 A;  4KN4 X;  4M74 A;  1WWX A;  3LA7 A;  3OL4 A;  1YTY A;  3O8H A;  2WAF A;  1MBE A;  2MGQ A;  3QRF F;  3E5X A;  3NQO A;  4WF2 A;  3S16 J;  4A5N A;  4M6Y A;  2ISY A;  5FD5 A;  1DPR A;  3FK6 A;  2R5Y B;  4KIC A;  2EZH A;  3A2K A;  1WJF A;  1FSE A;  3WOD F;  3IKT A;  2A6E F;  1T33 A;  4S04 A;  4N0B A;  5JR3 A;  1R22 A;  1FX7 A;  1ZEL A;  1I5Z A;  1UAA A;  3WU1 B;  3F8B A;  2RQP A;  3Q9V A;  2BW3 A;  4M3F A;  3OYK A;  1ETK A;  1R5G A;  3V42 A;  1JKR C;  4CA0 A;  2ZB9 A;  2ZJQ F;  4A3F J;  5EZH A;  2OQG A;  2LVS A;  2DJN A;  4YEL A;  1S29 A;  3VSL A;  5DM7 F;  1WJB A;  3HM5 A;  4PZJ A;  4QSH A;  1R1T A;  3FIS A;  3ZQL A;  4HRI A;  1FYL A;  1G59 A;  5L3F A;  3J7A O;  1B9M A;  2VOD A;  1ETQ A;  1IN8 A;  1O3T A;  2M45 A;  3O2P E;  2VBY A;  3GLX A;  4RMN A;  3HOU J;  1X4P A;  3L2R A;  3ABT A;  2ME0 A;  3WU2 C;  4X1E A;  3H5A A;  4XLA A;  2R7R A;  2F5C A;  3K9T A;  5EG0 A;  3SQN A;  3WTU C;  4L9V A;  2LR8 A;  1ETX A;  1UG2 A;  1T56 A;  2FBK A;  2JQ7 A;  1JHH A;  3A4C A;  3TW7 A;  1YOV B;  2L7M P;  2MFZ A;  2DBB A;  1TWG J;  4HST A;  3LFK A;  1K78 A;  4F7Z A;  3TP3 A;  1VQ7 I;  3H3V K;  1ZH5 A;  3FBN B;  2QWW A;  2OUM A;  3ASO H;  3E6D A;  3Q0V A;  4G6D A;  4XLN F;  3OYD A;  3LOC A;  5M5Y J;  1YS7 A;  2HOE A;  2P0W A;  3H0D A;  5DDG A;  1P4A A;  2V6E A;  3IC7 A;  4UUT A;  3A03 A;  1FBU A;  1V4R A;  2ZNZ A;  4KFC A;  4IHT A;  3F21 A;  1V55 H;  2ZBK A;  4E7K A;  3HSR A;  5EEH A;  2IS2 A;  1DDN A;  1NK2 P;  2NS8 A;  3G6E I;  4XOR A;  1FC3 A;  2PJR A;  4BEH B;  1PDN C;  1FYM A;  3M07 A;  1KU7 A;  5ILV A;  3ZN1 A;  3L00 A;  2YU9 J;  2MG4 A;  1MMN A;  2V1D A;  2J5O A;  3OOP A;  3CC4 I;  4IHS A;  3BJA A;  5F6F A;  4BHC A;  3HC7 A;  2VJI A;  3H92 A;  3I56 I;  3ZQH A;  1G6N A;  1QVT A;  2ELH A;  1U2W A;  4GXO A;  3S1R J;  3PFY A;  3OSG A;  4ZYE A;  1D1C A;  3PNV A;  4DOZ A;  4F3Q A;  4JX6 A;  3VOE A;  1OJL A;  3ZMS A;  3FWE A;  2NVX J;  3N97 A;  1T6S A;  4EQQ A;  3UR3 C;  3J7Z I;  3Q9S A;  3OIO A;  3F6O A;  4CCN A;  1ZLJ A;  2FSW A;  5CQE A;  1B8I B;  5M3M J;  2R4G A;  4Y33 A;  2ZXH A;  4EVI A;  4L18 B;  4KIB A;  4AYB A;  4CZC A;  1LJ9 A;  3K70 D;  2LYC A;  1AOY A;  5LD2 C;  2O9L A;  3FM5 A;  1XGO A;  2JRT A;  2H8W A;  4M71 A;  4UXN A;  3PIO F;  2ME6 A;  1HLV A;  3HXL A;  1AU7 A;  5CVR A;  4UUS A;  3M3Y J;  3G1L A;  2XB5 A;  4BQN A;  1MBG A;  5K7H A;  4XLF A;  3CUQ C;  3MN2 A;  3VYT B;  2Y0S A;  2F4I A;  3BR0 A;  4EAT A;  3LAP A;  1UHW A;  3EYY A;  5IPA A;  5IOZ A;  3U9G A;  5C3E J;  4E7L A;  3W2W A;  3CLO A;  1Q1H A;  5CQG A;  4B8X A;  4A5M A;  2XF5 A;  3FKJ A;  3C2H A;  3EDP A;  3HG9 A;  3O6B B;  2OPT A;  2F4M B;  5DEQ A;  4IKF A;  1XN7 A;  4MHG A;  3GUD A;  4NHJ A;  1FLI A;  9ANT A;  2JUG A;  2I5U A;  5HOO A;  2VC0 A;  4BY1 J;  2FE3 A;  2MLK A;  3CJQ B;  1T2K A;  2XF7 A;  3BCA A;  4CXF A;  4G9Y A;  3CUO A;  3LA3 A;  4HOB A;  2FD5 A;  2W57 A;  1OQY A;  4ESJ A;  3MZY A;  2F5V A;  4M6X A;  4Z6Y A;  2IXS A;  4G7Z F;  4A93 J;  2R5Z A;  1CF7 A;  2QQA A;  4A3I J;  1RNL A;  5KHD A;  2Y75 A;  3OL3 A;  4E4H A;  1G3W A;  1B59 A;  3ROU A;  3K4M A;  1OCC H;  2WA0 A;  5D5X B;  3W6K B;  5DV5 A;  2QSH X;  4E70 A;  4H0E A;  2E35 A;  4XN3 A;  4ENN A;  2STW A;  1A6Q A;  1XMA A;  2JT1 A;  2MC4 A;  2WB1 N;  1UB9 A;  2DMU A;  2VIX A;  1FOX A;  1QZY A;  3BPV A;  3R4K A;  4A3B J;  2MH9 A;  3S2H J;  1EJ9 A;  1F5T A;  5LEJ A;  2WWY A;  1NG7 A;  5HLI A;  3S3N A;  4WWC A;  5E1X A;  1TQP A;  2X1D A;  2JPB A;  2EIN H;  2NAZ A;  3DLA A;  3ZQF A;  4EGZ A;  3S2D J;  3FMR A;  1R1U A;  1YYV A;  1X4O A;  2BY2 A;  1IXS B;  1RPW A;  2X6Y A;  1FTT A;  2L9R A;  2L7F P;  4QTR A;  1QVU A;  2Q2E B;  3O3K A;  1RR8 C;  1H89 C;  3BR5 A;  2XGX A;  3WTS C;  2UWM A;  1PUF A;  3JRB A;  2Y48 A;  3CDI A;  1JGS A;  3ZN0 A;  4G7H F;  1OCR H;  3B73 A;  3BP8 A;  3PNY A;  2XAH A;  4UVC A;  2R93 J;  3RKY A;  1T0F C;  4OMY A;  2XRL A;  3LWF A;  4I99 C;  4CYC A;  3WE3 A;  5J1Y A;  4OIP F;  5C4X J;  3BG7 A;  1BC7 C;  5JVG F;  3CMA I;  3CUQ B;  3GLL A;  2F4O B;  3OS1 A;  1P7I A;  2LMD A;  2FXA A;  3IKV A;  2JN6 A;  2DN0 A;  1FTZ A;  1FEX A;  1VQ5 I;  2M8E A;  5GPA A;  3D1N I;  2E36 A;  1DU0 A;  3HUG A;  5L3E A;  5E8G A;  3F8C A;  3JRH A;  3X2Q H;  4CH7 A;  1RKW A;  3KFW X;  3J81 K;  4L0Z B;  1IRZ A;  3S1Q J;  1FYK A;  2ZCW A;  4RAF A;  4G94 A;  3RYP A;  2EA4 A;  3MKZ A;  1SD6 A;  1SC7 A;  3HIF A;  2ID6 A;  2M1B A;  1SFK A;  2FRH A;  5HOD A;  4U7B A;  2X9D A;  4Y7N J;  5HDK A;  3BQY A;  2KJB A;  2Y30 A;  4LK0 F;  1LUJ B;  2QM3 A;  1YQA A;  3LNQ A;  2P6S A;  4PDK A;  1QGP A;  1K61 A;  3L09 A;  1IN7 A;  3ABU A;  5AON A;  1IJW C;  2IVM A;  2Y0M A;  1FBQ A;  2FNA A;  1HDD C;  2EFW A;  2XGD A;  3QPH A;  1JJ6 C;  2QSF X;  2W48 A;  3I58 A;  2XVC A;  1RIO H;  3LSI A;  2HXI A;  1LNW A;  3S32 A;  1J5Y A;  5LRS A;  3FDY A;  4C30 A;  1FBS A;  1U78 A;  2ISZ A;  3SEZ A;  3PJR A;  3DEW A;  3RIR A;  3BR3 A;  5FKO A;  3OYH A;  3OYC A;  2DOF A;  5LHH A;  2BZT A;  2LKP A;  4M9X A;  3N05 A;  4GCV A;  1D8J A;  1G3T A;  2IW5 A;  2Z1D A;  3QQA A;  3BT9 A;  1BI2 A;  4DIQ A;  4ZC3 A;  4V19 K;  2J5P A;  2W82 A;  2CH0 A;  5IT3 A;  4CO8 A;  1SMT A;  3CJT B;  3SZP A;  3OS2 A;  1MDM B;  2V1N A;  2WAQ N;  5GPC A;  2H94 A;  2K27 A;  2LNB A;  3WHC A;  2PLY A;  1R00 A;  5H20 A;  3VYR B;  1GDT A;  1P4X A;  1U6G A;  5HNF A;  4BQA A;  1BW5 A;  3T5X A;  2GLO A;  3GW2 A;  2EA2 A;  5FGM A;  2M0M A;  2W85 A;  2E71 A;  5ED4 A;  4WXD A;  4BL0 B;  3KX2 A;  2G9W A;  4HDU A;  1OYY A;  1B72 A;  2E19 A;  4FAS D;  3U1D A;  2UXN A;  2DK5 A;  1LEB A;  1V5F A;  2LKS A;  5HS9 A;  3IH3 A;  5E3N A;  1P9Q C;  4S05 A;  3ASN H;  4P5O A;  1P4W A;  4IJA A;  1KA8 A;  2L4M A;  5E3L A;  5GAD J;  2QBY B;  2AQF A;  1H9T A;  2R7S A;  2YSR A;  5D4R A;  2ESH A;  4FCY A;  3VFZ A;  3L1P A;  5HDG A;  1BM9 A;  1FMW A;  5KNL A;  3HKZ A;  3CP8 A;  3H3Z A;  2CW0 F;  4XK4 A;  3FXR A;  4AWX B;  4M72 A;  2VBZ A;  2QKL B;  3KEO A;  1K79 A;  1QNT A;  2EZK A;  5E1Z B;  2XKO A;  2OZU A;  3FXM A;  5E3M A;  3DP7 A;  4U0W A;  4YFX F;  2DT5 A;  3JSP A;  2DFI A;  3HOW J;  4LIV A;  2OTL I;  3TL4 X;  5BPI A;  4V2G A;  4FTH A;  5L3D A;  2DOE A;  2XAU A;  2LBF B;  4L5J A;  1CQT A;  4PCQ A;  1G4D A;  1IDZ A;  2NVU B;  1MMG A;  2DA6 A;  4ITV A;  3BDD A;  3KEY A;  3I71 A;  2F2E A;  2LLK A;  1VND A;  2DMN A;  4KT6 A;  3P5J A;  1TW3 A;  2M8G X;  1J9I A;  2PBI A;  3L2Q A;  1JXS A;  2DLL A;  2ELJ A;  1GVJ A;  3DBL B;  5CYV A;  5DYM A;  4Z2Y A;  3T8R A;  3EQL F;  5A2Q Z;  3BZ6 A;  4PJL A;  4LD5 A;  3VSK A;  2HTS A;  5HVQ C;  2P5V A; 
#chains in the Genus database with same CATH homology
 3GFI A;  3DEU A;  1O57 A;  1KGS A;  1W7P A;  2G7H A;  3FXU A;  2BGC A;  1WSU A;  1Z1D A;  4LB5 A;  3DXJ F;  1OMI A;  1T39 A;  3WGG A;  5JFR A;  5F1R A;  2G7U A;  3HTU A;  1HW1 A;  2DPU A;  4BHP A;  2A69 F;  4EJU A;  4U0Y A;  2RVC A;  1PUE E;  2GWR A;  4O3M A;  1TNS A;  2HR3 A;  2P7V B;  3KP4 A;  1HW2 A;  2OD5 A;  2H6C A;  1J75 A;  4Q4Z F;  5HS7 A;  3L9F A;  1O3Q A;  3P7N A;  4ESF A;  1BBY A;  3B02 A;  4G8X A;  1XSX A;  1SD4 A;  5ILS A;  3I53 A;  3K69 A;  4UNO A;  5IT9 Z;  3CJN A;  1YFH A;  3IL2 A;  2X0L A;  2KIF A;  5E1W A;  1DUX C;  5LHI A;  2FF4 A;  2D1V A;  3P9K A;  4BH9 A;  4WK8 F;  3MQ0 A;  5L3G A;  4YFK F;  2LF8 A;  5FLX Z;  2IA2 A;  1U5T C;  1MJB A;  5DCM B;  1Z05 A;  2QQB A;  4LMY A;  4M9S A;  2R3S A;  3REO A;  4OIO F;  3RPU A;  1UFM A;  4UV8 A;  4CGZ A;  2MA3 A;  3IWZ A;  2PQ8 A;  2CFX A;  5DUI A;  4OIQ F;  1WI9 A;  1KU3 A;  5TRD A;  5JVT A;  2LF7 A;  2GA2 A;  2EV5 A;  2R7F A;  4L9N A;  3I4P A;  4L0Y B;  5LHG A;  3GO5 A;  4L9J A;  2O8X A;  5E8I A;  4NQW A;  4RAY A;  2IA1 A;  2VC1 A;  4HZF A;  3KP7 A;  2ZME B;  4MTD A;  4AVP A;  2XRO A;  3FMQ A;  3BJ6 A;  3HHG A;  4I7H A;  1ZAO A;  4I0A A;  1GXQ A;  2DPD A;  1P6R A;  4HX7 A;  3MEX A;  1YO5 C;  3FX3 A;  3R0A A;  2CO5 A;  3DFG A;  3NRV A;  1XMK A;  5KK1 A;  3QP6 A;  4G7O F;  1E17 A;  1RZ4 A;  4ESB A;  1B1B A;  3P9I A;  3QU3 A;  4WXC A;  5DCF A;  1W5T A;  3WG9 A;  4YIF A;  4OIN F;  3WTV C;  4HF2 A;  4OOI A;  2HZT A;  4A0Y A;  2P5L C;  1U5T B;  4EJW A;  2MLG A;  5FFX A;  1LEA A;  3JW4 A;  4EMS A;  4HV5 A;  3MZH A;  3L7W A;  2XKP A;  4CZZ A;  3QOP A;  3D5L A;  2GAU A;  4HDV A;  4P9U A;  2A3S A;  1MZB A;  3HRM A;  3TO9 A;  2GIV A;  3RTR A;  4BNC A;  5LBQ A;  2ADU A;  3C7J A;  3MWM A;  4A0X A;  2EV6 A;  5J8F A;  4MEX F;  5CVU A;  2K7L A;  3TGN A;  5CJ9 A;  1ZRE A;  4HLX A;  1KYZ A;  1I27 A;  1NHA A;  4DNC A;  1ZRC A;  3ZMT A;  2HGC A;  4AIK A;  1UHM A;  1O3S A;  1FNN A;  2GXG A;  4XBF A;  1YW9 A;  4RGR A;  3OV8 A;  4YFN F;  4O6J A;  1P2F A;  4MEY F;  1Z91 A;  3I64 A;  3ZMV A;  3J80 Z;  1BI3 A;  2ZO4 A;  3NEU A;  3C3W A;  3W6J B;  3E6B A;  5D4S A;  4P55 A;  1ZG5 A;  2LSO A;  2PJP A;  2ZXJ A;  1Z6T A;  5CVJ A;  5E17 F;  4KN7 X;  1IW7 F;  2A68 F;  1ON1 A;  3I59 A;  3JAM Z;  2VT3 A;  3ZP5 A;  3E5U A;  1UCR A;  2OU2 A;  5D8L B;  1R58 A;  4LG0 B;  2IPQ X;  3T1B A;  3BY6 A;  5A2Q K;  3GFM A;  2HS5 A;  3TKY A;  1ZAR A;  2P6T A;  4YII A;  5TJJ A;  1X3U A;  2ZFW A;  2D2W A;  5LLQ A;  2QQ9 A;  1KQ0 A;  1RI7 A;  1BIA A;  2H09 A;  2BBY A;  2HFH A;  1FWZ A;  2UXX A;  2H6B A;  5ERI A;  1OYW A;  1TBX A;  4LJZ F;  2AS5 F;  3KP6 A;  1OYI A;  4AD9 A;  2RGV A;  3FF5 A;  2RDP A;  4GYI A;  4IRI A;  4R1H A;  4BXU A;  4EV0 A;  5DD8 A;  2QLZ A;  1H0M A;  1V3F A;  1MGT A;  3E3V A;  2VOO A;  3HYI A;  3IHU A;  4A6D A;  3M7G A;  1T38 A;  4A0Z A;  4ZYH A;  1TTY A;  1STZ A;  3F72 A;  2Z33 A;  3EET A;  2QYO A;  3H3U A;  3HRT A;  2BV6 A;  5BQT A;  1IN4 A;  3KP2 A;  2IT0 A;  1IN6 A;  2DTR A;  5D8K B;  1FOK A;  2O6G E;  3R0J A;  5IT9 K;  1FPQ A;  2PI0 A;  4BHB A;  2EK5 A;  2CYY A;  5D6E A;  2ACJ A;  2L3D A;  2A6H F;  3I54 A;  4HX8 A;  2M87 A;  4UV9 A;  5BS6 A;  2FQ3 A;  1SD7 A;  1FZP B;  1H9G A;  3V8J A;  4ENK A;  3SHF A;  4Y17 A;  4OIR F;  2M30 A;  4N9I A;  5FLX K;  2ETH A;  1K78 B;  2F5E A;  3ECO A;  1IRG A;  4FHT A;  2JTV A;  3GWZ A;  4P96 A;  1LDJ A;  4JBA A;  1W5S A;  3SZT A;  4U7D A;  5JHU A;  5FFZ A;  2O03 A;  1G3Y A;  2WC2 A;  1OR7 A;  2ZNY A;  1U8R A;  3VB2 A;  5EEG A;  3JTG A;  4ETS A;  1RUN A;  1IF1 A;  4LLG F;  1O7L A;  1REP C;  2L01 A;  3E97 A;  1B6A A;  4XSZ F;  2C6Y A;  1UST A;  2STT A;  2OZ6 A;  1ON2 A;  3F3X A;  2NNN A;  5BMZ A;  5E20 A;  1BIB A;  2BE5 F;  4TV7 A;  1FY7 A;  4MNU A;  4XLP F;  2W25 A;  3VEP A;  2HQN A;  4KNY A;  4HQE A;  5AIP A;  2FML A;  3FZV A;  4WX9 A;  3V8L A;  4ENM A;  1R5H A;  3DPT A;  3KZZ A;  3M9A A;  4FX4 A;  4ZYG A;  3MAJ A;  1G3S A;  2DQL A;  2KRF A;  2ZJ2 A;  1MJ9 A;  1S7A A;  2RNJ A;  3HHH A;  3TOB A;  2A61 A;  2QUF A;  4L5I A;  3TDZ C;  3FMS A;  3GF2 A;  2EB7 A;  4HQM A;  1J0R A;  1CF7 B;  3R61 A;  3GZ6 A;  1YS6 A;  2WTE A;  5HLG A;  2RN7 A;  1IAW A;  2K4J A;  3WTY C;  2XAQ A;  4CHU A;  1ZHF A;  2DW4 A;  4K2E A;  2MC3 A;  2P4W A;  5D5V B;  1RUO A;  3I5U A;  4LLL A;  3DKW A;  4KMF A;  2XAG A;  1ONV A;  4RB2 C;  4R79 A;  2EV0 A;  1HST A;  4I98 B;  1HKT A;  2V9V A;  4AIJ A;  3HRS A;  2A5Y B;  1D3Y A;  1ZLK A;  3QPT A;  2HQR A;  5KVR A;  4ASN A;  1Z6R A;  4KUM A;  1FP1 D;  2FBH A;  2HKX A;  2WV0 A;  1IXR C;  4JK1 X;  4EM2 A;  1KU9 A;  1EV7 A;  1YLF A;  2HDC A;  1F9N A;  4HBL A;  3J80 K;  3TO6 A;  1XSV A;  3VOD A;  3ZMU A;  2GXB A;  2YPR A;  1KQ9 A;  3K1P A;  4QLC U;  1IXC A;  3GX4 X;  4A2U A;  4RS8 A;  3RKX A;  2GQQ A;  5LEK A;  3LAJ A;  2M5W A;  1R7J A;  4OU0 A;  2IA0 A;  4UVA A;  1TQM A;  1KYW A;  3U2R A;  3JAM K;  1XGM A;  3BJO A;  2FA5 A;  1GXP A;  3ZMD A;  2HEO A;  1F4K A;  1LB2 A;  3TO7 A;  3ISP A;  4LFU A;  1D5V A;  4MQ9 F;  4EM1 A;  3CO6 C;  3QU6 A;  3KET A;  4QWQ A;  4M9Z A;  1WRJ A;  5K5Q A;  3R60 A;  4KYW A;  1O7F A;  4I09 A;  2L02 A;  1HSJ A;  3MCZ A;  3J81 Z;  4BYY A;  2V79 A;  4I02 A;  5D6F A;  3R6S A;  2QZ8 A;  5BPD A;  1XSD A;  3P9C A;  1LVA A;  1HW5 A;  1BN5 A;  2FOK A;  5K1Y A;  3IWF A;  2HKO A;  3F8N A;  1XCV A;  4PGH A;  2V6C A;  4UUV A;  2VOP A;  2FMY A;  3RJP A;  4YG2 F;  3HRU A;  2O0Y A;  4ENJ A;  3PFI A;  3PQK A;  3D0S A;  1DP7 P;  2Z99 A;  4IRG A;  2XUB A;  5E18 F;  1K7A A;  3V7R A;  6PAX A;  3DV8 A;  3KZY A;  2CQK A;  4RB1 A;  3ERE D;  3RKW A;  3GVA A;  1BI1 A;  1QO0 D;  1K6O A;  3C1D A;  2FU4 A;  1ZG3 A;  2KIM A;  1EH7 A;  1E2X A;  5HDN A;  3FXQ A;  1OKR A;  3S2W A;  1S8N A;  5FB2 A;  1T98 A;  2EFQ A;  1J2X A;  4Q48 A;  2KIU A;  1Z7U A;  3HSE A;  1R1V A;  2F5F A;  2YR2 A;  4GO1 A;  4L9T A;  4HF1 A;  1ZRF A;  1HKQ A;  5K5O A;  2VBX A;  3K1N A;  4MGR A;  5LRR A;  4RGX A;  2Q2E A;  3KEQ A;  1SFU A;  1YW7 A;  1W7P D;  4HLY A;  4IF4 A;  5ICF A;  2AXL A;  2JSC A;  4KDP A;  1W7P B;  3K1M A;  2P5K A;  4DQ2 A;  1SFX A;  1XCB A;  2XAS A;  1EH6 A;  2L54 A;  3ELK A;  2K02 A;  3E6C C;  5FD6 A;  5AIQ A;  3CUQ A;  2D45 A;  2PG4 A;  2CSO A;  3MFK A;  2Q8K A;  3DPL C;  5L3B A;  1ULY A;  5LGT A;  3F6V A;  3WTX C;  1FP2 A;  5ILU A;  4I01 A;  4HX4 A;  4JQF A;  3LQQ A;  1LDK B;  2DAO A;  4A12 A;  1XDU A;  3ZMZ A;  4WXH A;  1TNT A;  4CDG A;  1IRF A;  1B4A A;  3RI4 A;  2MH2 A;  2OA4 A;  3IRQ A;  3IRR A;  3AAF A;  4UVB A;  2O61 A;  4KT5 C;  2EFO A;  2FBI A;  1OPC A;  3KCC A;  4ZYD A;  1QQI A;  5BOX A;  1PP7 U;  1Z9C A;  2PMH A;  2EWN A;  3LST A;  1SMY F;  1WQ2 A;  3V4G A;  2NNY A;  1LDD A;  2NS0 A;  4A6E A;  3ECH A;  2HYF A;  4G6Q A;  1W4M A;  2OBP A;  1TLH B;  1BC8 C;  2E7X A;  1MDM A;  3SXY A;  1R23 A;  1U3E M;  2F5D A;  5HLH A;  5CVV A;  5F64 A;  4LGW A;  2CGP A;  1I1G A;  1S7O A;  1FT9 A;  3HOS A;  1ZN2 A;  3KP3 A;  3GEZ A;  3V7C A;  2MBF A;  1T0F A;  4KIF A;  4Y13 A;  3KLO A;  3GFL A;  4O5V A;  4RGS A;  1HQC A;  3LA2 A;  2XAJ A;  1ZRD A;  4HYE A;  1MKM A;  2B0L A;  2QBY A;  1R36 A;  4CIC A;  3K2Z A;  2Z5U A;  2O3F A;  1IN5 A;  2DK8 A;  2YU3 A;  2DQR A;  4B09 A;  5H6R A;  3BPX A;  5ICG A;  3WGI A;  4Y15 A;  3HOT A;  1MD0 A;  4EM0 B;  4RGU A;  1I1S A;  3CTA A;  2VE9 A;  3JTH A;  5HS8 A;  5CVI A;  1IZ1 A;  3KP5 A;  2H27 A;  2K4B A;  2KKO A;  1C0W A;  4KMU X;  1ZG1 A;  2PEX A;  2V1U A;  3GZ5 A;  2E1C A;  3L2C A;  2ESN A;  2R7D A;  4P9F A;  3BWG A;  2X4H A;  2XIG A;  2VBW A;  2EJR A;  2L4A A;  5J8C A;  1SFE A;  4HAM A;  3WU0 A;  2DI3 A;  2UZK A;  1ZGA A;  2GZW A;  2VON A;  2W84 A;  2Z3Y A;  3M1E A;  3EYI A;  2DU9 A;  2CWE A;  3KE2 A;  3V8K A;  1XB4 A;  3GYH X;  1XDS A;  4RB3 C;  2VE8 A;  2E1N A;  2EFP A;  2HTJ A;  4RAZ A;  4N9H A;  2CG4 A;  4IRH A;  1XD7 A;  4LLN A;  2XHK A;  2COM A;  1ZYR F;  2YX4 A;  4ZZD A;  4KIG A;  3WTT C;  2JZY A;  4XSX F;  1GHC A;  3K0L A;  1KU2 A;  1MJA A;  4HV6 A;  2RKH A;  5J6X A;  1PP8 F;  2HWV A;  1JHF A;  2VN2 A;  2PMU A;  3WTW C;  5LGU A;  4ZH4 F;  1J7K A;  4ZZL A;  3TQN A;  2IJL A;  3N4M A;  2K86 A;  2PFB A;  2QVO A;  1SAX A;  2VXZ A;  5L3C A;  1L3L A;  2LDU A;  1SD5 A;  3JSO A;  1VTN C;  4U88 A;  2BEO A;  2GA1 A;  2QEN A;  1IUY A;  1QPM A;  1Y0U A;  1TQI A;  1ODD A;  4IVN A;  4IXA A;  5ICE A;  4HA8 A;  5DCM A;  3GFJ A;  5ICC A;  4D0P A;  3F23 A;  2Q0O A;  4FX0 A;  4LB6 B;  4GYG A;  5FO5 A;  4CYD A;  3T8T A;  4NB5 A;  3I59 B;  3DQV C;  3QAH A;  2BYV E;  2OQR A;  3GXO A;  4WCG A;  3CDH A;  3M8F A;  2Z9O A;  1I6X A;  3LQR A;  3ZPL A;  2MD5 A;  1USS A;  3G73 A;  2ZME A;  3KLN A;  2RC4 A;  3DF8 A;  4HW0 A;  2VT2 A;  2XAF A;  4BAY A;  2EFN A;  1YW8 A;  3T0Y A;  5CLS A;  1HKS A;  3Q5F A;  3TDU C;  1HXD A;  2IRF G;  2DO7 A;  2JPC A;  3FHZ A;  3BRO A;  1L0O C;  1XGN A;  3HTS B;  4UHT A;  3RPQ A;  3BOQ A;  2IP2 A;  3V7S A;  2KJC A;  4I0B A;  4FT8 A;  3QP5 A;  2ZKZ A;  1F1Z A;  1JE8 A;  4OMZ A;  1U5T A;  1TW2 A;  2NRA C;  3WTZ A;  1ZGJ A;  3WGH A;  1FSH A;  2P8T A;  2HYG D;  1BI0 A;  4Q5S F;  3TOA A;  4EJO A;  4M73 A;  1QBJ A;  1D8K A;  3F22 A;  1A04 A;  2FNP A;  3ULQ B;  1O3R A;  2PN6 A;  4EJV A;  2NYX A;  3ZQ7 A;  4I2O A;  4PGG A;  1CGP A;  4HF0 A;  2FEZ A;  1LQ1 A;  3M8E A;  4R8H A;  2W24 A;  5K5R A;  3HSF A;  3C18 A;  4MQV A;  1KQ8 A;  5DUK A;  3PQJ A;  2YX7 A;  4XRF A;  4KA4 A;  2P7C B;  4IPA A;  5JI6 A;  5H6Q A;  3RDI A;  1XGS A;  3F8F A;  4EGY A;  3ML6 A;  2A07 F;  2TDX A;  1EH8 A;  3RYR A;  2OAZ A;  2D1H A;  1WKM A;  3E6M A;  3COA C;  4EJT A;  5D5U B;  1BJA A;  1HBX G;  3EUH A;  4ON0 A;  5DD4 A;  3F8M A;  3FM3 A;  1S3J A;  2RV8 A;  4LK1 F;  2E7W A;  1YIO A;  3SFZ A;  2XRN A;  4LG0 A;  1B9N A;  1J59 A;  3G3Z A;  4Q47 A;  4U0V A;  4RB0 A;  1QZZ A;  4MTE A;  5D5W B;  3WE2 A;  4GGG A;  4AIH A;  1BOA A;  3CO7 C;  3E5Q A;  5LGN A;  1AWC A;  1DPU A;  2V1X A;  1YG2 A;  2XV4 S;  3I0T A;  1S6L A;  1P92 A;  4KN4 X;  4M74 A;  1WWX A;  3LA7 A;  1YTY A;  3QRF F;  3E5X A;  3NQO A;  4WF2 A;  4A5N A;  4M6Y A;  2ISY A;  5FD5 A;  1DPR A;  4KIC A;  1FSE A;  3WOD F;  3IKT A;  2A6E F;  4S04 A;  4N0B A;  5JR3 A;  1R22 A;  1FX7 A;  1I5Z A;  3WU1 B;  3F8B A;  2RQP A;  3Q9V A;  1R5G A;  2OQG A;  1S29 A;  4PZJ A;  1R1T A;  1FYL A;  5L3F A;  3J7A O;  1B9M A;  2VOD A;  1IN8 A;  1O3T A;  2M45 A;  3O2P E;  2VBY A;  3GLX A;  3ABT A;  2F5C A;  3K9T A;  3SQN A;  3WTU C;  4L9V A;  2FBK A;  1JHH A;  2DBB A;  3LFK A;  1K78 A;  4F7Z A;  1ZH5 A;  2QWW A;  4G6D A;  3E6D A;  4XLN F;  1YS7 A;  2HOE A;  5DDG A;  1P4A A;  3IC7 A;  1FBU A;  1V4R A;  2ZNZ A;  4KFC A;  4IHT A;  3F21 A;  2ZBK A;  3HSR A;  5EEH A;  1DDN A;  1FC3 A;  1PDN C;  1FYM A;  1KU7 A;  5ILV A;  3ZN1 A;  3L00 A;  2V1D A;  2J5O A;  3OOP A;  4IHS A;  3BJA A;  5F6F A;  4BHC A;  3H92 A;  1G6N A;  4GXO A;  2ELH A;  1U2W A;  4ZYE A;  3VOE A;  3ZMS A;  3FWE A;  3N97 A;  1T6S A;  4EQQ A;  3Q9S A;  3F6O A;  1ZLJ A;  2FSW A;  4EVI A;  4L18 B;  4KIB A;  1LJ9 A;  1AOY A;  3FM5 A;  1XGO A;  2JRT A;  4M71 A;  4UXN A;  5CVR A;  3CUQ C;  3LAP A;  1UHW A;  3EYY A;  3U9G A;  3CLO A;  1Q1H A;  4B8X A;  4A5M A;  3EDP A;  3O6B B;  5DEQ A;  1XN7 A;  4MHG A;  3GUD A;  4NHJ A;  1FLI A;  5HOO A;  2VC0 A;  2FE3 A;  2MLK A;  1T2K A;  4CXF A;  4G9Y A;  3CUO A;  3LA3 A;  4HOB A;  2W57 A;  4ESJ A;  3MZY A;  4M6X A;  4G7Z F;  1CF7 A;  2QQA A;  1RNL A;  2Y75 A;  1G3W A;  1B59 A;  3ROU A;  5D5X B;  3W6K B;  5DV5 A;  4E70 A;  4H0E A;  4ENN A;  2STW A;  1XMA A;  2JT1 A;  1UB9 A;  1QZY A;  3BPV A;  3R4K A;  2MH9 A;  1F5T A;  5LEJ A;  2WWY A;  5HLI A;  4WWC A;  5E1X A;  1TQP A;  2JPB A;  2NAZ A;  4EGZ A;  3FMR A;  1R1U A;  1YYV A;  1IXS B;  3O3K A;  2XGX A;  3WTS C;  2UWM A;  2Y48 A;  1JGS A;  3ZN0 A;  4G7H F;  3B73 A;  3BP8 A;  2XAH A;  4UVC A;  3RKY A;  4OMY A;  3LWF A;  3WE3 A;  4OIP F;  1BC7 C;  3CUQ B;  2FXA A;  3IKV A;  2M8E A;  3HUG A;  5L3E A;  5E8G A;  3F8C A;  3KFW X;  3J81 K;  4L0Z B;  1FYK A;  2ZCW A;  4G94 A;  3RYP A;  2EA4 A;  1SD6 A;  3HIF A;  2M1B A;  2FRH A;  4U7B A;  5HDK A;  2KJB A;  4LK0 F;  2QM3 A;  1YQA A;  2P6S A;  4PDK A;  1QGP A;  3L09 A;  1IN7 A;  3ABU A;  5AON A;  2IVM A;  2Y0M A;  1FBQ A;  2FNA A;  2EFW A;  3QPH A;  3I58 A;  2XVC A;  1RIO H;  1LNW A;  1J5Y A;  5LRS A;  1FBS A;  1U78 A;  2ISZ A;  3RIR A;  5LHH A;  2LKP A;  4M9X A;  4GCV A;  1D8J A;  1G3T A;  2IW5 A;  1BI2 A;  2J5P A;  5IT3 A;  4CO8 A;  1SMT A;  3SZP A;  1MDM B;  2H94 A;  2K27 A;  2LNB A;  2PLY A;  1R00 A;  5H20 A;  1P4X A;  1U6G A;  4BQA A;  3T5X A;  3GW2 A;  2EA2 A;  5FGM A;  2W85 A;  5ED4 A;  4WXD A;  2G9W A;  4HDU A;  1OYY A;  3U1D A;  2UXN A;  2DK5 A;  1LEB A;  5HS9 A;  4S05 A;  4P5O A;  1P4W A;  4IJA A;  1KA8 A;  2L4M A;  2QBY B;  1H9T A;  2YSR A;  5D4R A;  2ESH A;  3VFZ A;  5HDG A;  1BM9 A;  3H3Z A;  2CW0 F;  3FXR A;  4AWX B;  4M72 A;  2VBZ A;  3KEO A;  1K79 A;  1QNT A;  5E1Z B;  2XKO A;  2OZU A;  3DP7 A;  4U0W A;  4YFX F;  2DT5 A;  3JSP A;  2DFI A;  5BPI A;  5L3D A;  4L5J A;  4PCQ A;  1G4D A;  3BDD A;  3I71 A;  2F2E A;  1TW3 A;  1J9I A;  1JXS A;  2PBI A;  2DLL A;  1GVJ A;  5DYM A;  5CYV A;  4Z2Y A;  5A2Q Z;  3T8R A;  3EQL F;  3BZ6 A;  4LD5 A;  2HTS A;  5HVQ C;  2P5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...