3FF5A

Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Peroxisomal biogenesis factor 14
publication title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix protein import receptor, Pex14p
pubmed doi rcsb
source organism Rattus norvegicus
total genus 21
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ff5A00
1R00A 1GHCA 2EFNA 2BBYA 4KIGA 4HDUA 5HS9A 4ZYGA 1SD4A 3COAC 5H6RA 4KDPA 1FX7A 2DT5A 4KNYA 5D6EA 1LVAA 2YU3A 4L9JA 2M1BA 2O61A 1B9NA 3KLNA 1KA8A 1LEBA 4IHSA 4WK8F 3QU6A 3GZ6A 2B0LA 3Q5FA 1AOYA 3WGHA 2HQRA 4BQAA 2GAUA 3K69A 5HVQC 4FX4A 1IXRC 4JQFA 4B8XA 3R60A 1SD7A 5ILSA 4A12A 1YYVA 2H09A 4Q48A 3ECHA 2PFBA 2VE9A 1U5TB 1GXQA 1EH7A 4LJZF 3FXUA 4HX4A 1P92A 1Z6TA 2GQQA 4HA8A 5LGTA 4A6DA 3HRMA 3CUQA 4B09A 3B73A 4ZYDA 2VONA 4LMYA 5L3DA 2PBIA 1USSA 3TO9A 3V7CA 4E70A 1RNLA 3DF8A 4IXAA 1O3SA 4Y13A 2O03A 1R1VA 1B6AA 2ZNYA 1KYWA 2FRHA 2VE8A 1H9TA 5E18F 1MKMA 3ZPLA 4HQEA 3F8CA 1D5VA 1HSTA 1CF7B 1XCBA 2A6HF 2M30A 3F8NA 1FBQA 1YS6A 3BP8A 2ZMEB 2EFPA 4BHPA 5L3GA 5FLXK 3U2RA 2XAQA 1LEAA 2DBBA 1J75A 4MHGA 2IW5A 3F6OA 3HOSA 1ZRDA 3IL2A 2YX4A 4RGSA 4EQQA 4I98B 3HYIA 2RDPA 3GW2A 2M8EA 4IRGA 2E7WA 2P8TA 5D5WB 2QBYB 1YTYA 3DFGA 4RS8A 1ZAOA 1U5TC 4G6QA 4M73A 5DUIA 2W24A 3V8LA 1J2XA 2PQ8A 3D0SA 2D1HA 2VT3A 3J80Z 3P9KA 1MJAA 1BN5A 1OMIA 2QQBA 4HX7A 5FD6A 3MWMA 3GLXA 3LFKA 1QQIA 3RI4A 3QP6A 2KJCA 2VN2A 5E1WA 4EGZA 4I09A 1U8RA 4RB0A 4A5MA 3KP4A 5DDGA 5L3BA 2G9WA 3U1DA 4AIHA 2FMYA 3BJAA 4OMZA 5HLHA 4MQ9F 3GO5A 3TOAA 1C0WA 4OIOF 5FD5A 3DQVC 2L02A 3AAFA 1Z6RA 5JFRA 3HSEA 5ICFA 3IWZA 2STTA 2GWRA 2CO5A 2A68F 3KP2A 4M74A 1LQ1A 1STZA 2PG4A 1W7PA 5K5QA 3GZ5A 3DPLC 2JT1A 2A61A 2EV5A 2Q8KA 1E2XA 2DI3A 2BYVE 2F5CA 2V1DA 3ABTA 1ZARA 1MD0A 1Y0UA 2K7LA 5HDGA 4BH9A 4EGYA 2EB7A 4AIKA 3EYIA 3E5XA 1HXDA 5LRSA 2MC3A 2R7FA 4CHUA 3VEPA 3IC7A 3C7JA 4CGZA 2PMUA 1R58A 2Y48A 1XMKA 3MQ0A 5JR3A 1JE8A 2EA4A 3TO7A 5AIQA 2Y75A 2ETHA 2L01A 4P9FA 5DUKA 2VT2A 2RC4A 1SMTA 3V7SA 4ON0A 1PDNC 2E1NA 1YS7A 1ZRFA 2UXNA 1YG2A 3B02A 3BZ6A 1JHFA 3WE2A 1AWCA 4MGRA 5DCFA 2G7UA 4HAMA 3RYPA 1FC3A 4EM0B 4YIIA 3QAHA 3KFWX 3VODA 1O7LA 3FX3A 4N0BA 3WG9A 1IW7F 3BROA 2MLKA 3DXJF 4EVIA 4BYYA 3GYHX 2HKXA 3ZMZA 2EJRA 1R36A 1J9IA 3BWGA 2BEOA 1EH8A 1UHMA 4HX8A 4MTEA 3ZQ7A 3TOBA 1F4KA 3EDPA 5DD4A 3OOPA 2VBYA 5E20A 2V79A 4KN4X 3I59A 1H9GA 4DQ2A 1I6XA 4HOBA 4CZZA 3L9FA 2V1XA 3TGNA 5LHHA 4G7HF 5E8IA 1DP7P 2ZJ2A 4BHBA 1S7OA 1RIOH 3TKYA 4M9ZA 3SHFA 3E97A 4GYGA 2VXZA 2RN7A 1T2KA 3LAJA 3F8FA 2K86A 2HYFA 1MDMA 2XVCA 4LB6B 5LLQA 2J5PA 4HZFA 1LB2A 1QZYA 1W5TA 3LA2A 4PGGA 4Y17A 3I4PA 2BE5F 2HOEA 1MZBA 2H6BA 4ENJA 3M8EA 3E5UA 4UHTA 3ZMUA 1YW8A 3FF5A 4WXHA 5J6XA 2XAJA 4L9VA 3F72A 1WSUA 4LG0A 1TW2A 4OIQF 2HTSA 2ESNA 2LF8A 1XMAA 4CYDA 4I0AA 5J8FA 2XUBA 3IRRA 4LLNA 3BOQA 5HLGA 4XRFA 3MAJA 5CVIA 1ZHFA 2HWVA 5DEQA 5DCMB 2OZUA 4Q4ZF 4GXOA 4HW0A 3CUQB 3F3XA 4MQVA 2IA2A 3I54A 2BGCA 4KIFA 2A07F 2P5LC 3K2ZA 4OINF 3FXRA 3WTUC 3IKVA 2WTEA 5EEGA 5LHIA 2CW0F 4I7HA 2CFXA 2HDCA 5ED4A 4P55A 4HLXA 3D5LA 1Q1HA 2DPUA 1O3QA 2STWA 1T0FA 3JSOA 1YW9A 2MH9A 2IT0A 2PI0A 3WTVC 3HIFA 3QPTA 1FT9A 1W5SA 2V6CA 3RIRA 1VTNC 4CO8A 3FXQA 4EJOA 1TTYA 1JXSA 1ZH5A 4GCVA 4HF0A 4WF2A 4ETSA 3KP6A 2P4WA 2CYYA 1G3YA 3EYYA 1LNWA 5D4RA 4EJUA 4U88A 4M6XA 5JI6A 3K1PA 2VBXA 3GFLA 5KK1A 4CDGA 2E1CA 3TDUC 4EJVA 3GWZA 1K6OA 4WCGA 3LSTA 2O3FA 4KA4A 4KT5C 1F5TA 2HTJA 4DNCA 1FOKA 3LWFA 1WI9A 3CUQC 1SD6A 5FFZA 3PQKA 2DPDA 1P6RA 2DO7A 5BQTA 3CTAA 3IRQA 2XAGA 2G7HA 1HSJA 2XKOA 4U0YA 1ZRCA 2QYOA 1IXSB 2FOKA 1BC8C 5H6QA 4EJWA 2VOOA 2UXXA 4U7BA 3HOTA 2CSOA 3QU3A 5CJ9A 1P4XA 2ZO4A 1DDNA 2E7XA 3ML6A 1OYYA 1S8NA 1G3SA 3WU1B 4OMYA 3J81K 4HBLA 1ON2A 1W7PB 3C3WA 3CJNA 1T98A 4LB5A 5ILVA 4NQWA 2OD5A 4I2OA 4U7DA 3VFZA 3RTRA 1FP2A 1XDSA 2X4HA 5BOXA 1S29A 4AVPA 2FSWA 4HF2A 3WGGA 3E5QA 2XHKA 4ZYEA 4O3MA 3LA3A 2F5DA 1K79A 4N9IA 1O57A 4L0YB 3ECOA 4M6YA 1D3YA 2NYXA 1ZG5A 1BJAA 2XAFA 4XSXF 1ZLJA 4K2EA 4KMFA 1O3RA 3LQQA 3FM3A 1R7JA 3GFMA 3T8RA 2X0LA 2O0YA 2W84A 2RV8A 4I0BA 3H3UA 1O7FA 4L9TA 3M1EA 1B9MA 3DPTA 4IF4A 1SAXA 3ZMDA 1ZG1A 1FPQA 1DPUA 1KU2A 3F23A 3GXOA 2HYGD 4Y15A 5HLIA 5J8CA 4AD9A 2MLGA 4UVCA 3N4MA 3HSRA 3RDIA 3JTGA 1FP1D 2FQ3A 1IN6A 1JHHA 5HS8A 3MCZA 1I1GA 4MEXF 2EK5A 5CVUA 2ZCWA 1XSDA 1UB9A 2KRFA 2Q0OA 3SXYA 3NRVA 5LRRA 1T39A 1FYLA 5D6FA 3TO6A 3W6JB 5F64A 1ODDA 4AWXB 4GGGA 3ABUA 2ISZA 4ENKA 1TW3A 2ADUA 2YR2A 3REOA 2ZFWA 2KIFA 2R7DA 2RNJA 4G94A 3N97A 1REPC 1I27A 5FB2A 3R6SA 2EFWA 4ESBA 3MZHA 1KU7A 3KZYA 4PCQA 3I59B 3T1BA 1KU9A 3WTYC 1YFHA 3FHZA 1QPMA 1A04A 4IVNA 5DYMA 2O6GE 4AIJA 1R5HA 1I5ZA 2JPCA 3J7AO 1LDKB 1Z9CA 3MZYA 5F1RA 3CO6C 1F9NA 2QM3A 1MDMB 4JK1X 2HEOA 4ENMA 3JTHA 1Z1DA 2HQNA 3DKWA 2QVOA 3WODF 3HHGA 3LAPA 1NHAA 3SQNA 4L18B 4P5OA 4A5NA 4LG0B 2XGXA 4IHTA 1K78B 4P96A 5CVRA 5HDKA 1XGNA 5L3FA 1Z91A 5TJJA 1IN8A 2DQRA 1IZ1A 3FM5A 5AONA 2M5WA 1HKQA 4UNOA 3RKWA 2UWMA 5DD8A 3KP7A 5CVJA 2CQKA 1T38A 2JTVA 2FBHA 4IRIA 1FLIA 4RB3C 3QRFF 3GFIA 2A6EF 4S04A 1FSHA 2DK5A 2P5KA 4NHJA 2DU9A 5LEKA 5EEHA 5ICEA 4R8HA 3ERED 2WWYA 4UXNA 1CF7A 3ISPA 4S05A 1XSVA 3EQLF 4G6DA 1DPRA 1BIAA 2ZMEA 3FZVA 3L7WA 5HDNA 4OU0A 1XGMA 4EMSA 4A6EA 3BJ6A 3I71A 3ZMTA 4GO1A 1SD5A 3BJOA 1G4DA 2XRNA 2OQGA 2HZTA 5CLSA 1LDDA 1MGTA 4UV9A 2IA1A 2FXAA 4XSZF 1EV7A 2H6CA 5JVTA 4L9NA 5IT3A 4M71A 2KJBA 1GVJA 1HW2A 2Z33A 5FGMA 4YFNF 4M9XA 1TNSA 3FWEA 2XKPA 2MBFA 1ULYA 3SZPA 1OKRA 2JZYA 3HSFA 2A3SA 3HHHA 2DK8A 1BI2A 5BMZA 4PZJA 4L5JA 1HKTA 1B59A 4LK0F 2WV0A 2FBIA 2FEZA 2K02A 2TDXA 2XIGA 2DQLA 1KU3A 4LK1F 5CVVA 4G7OF 2RQPA 1BIBA 3F8MA 1K7AA 1TBXA 4HLYA 1YW7A 3CDHA 5FO5A 3BDDA 1XB4A 1KQ8A 4YG2F 3KZZA 4IRHA 1BBYA 5D5UB 2K4BA 1IN7A 4EM1A 3TDZC 2HKOA 2WC2A 3R0JA 2QENA 2DFIA 3RYRA 4RB2C 3P7NA 3E6MA 4WX9A 5L3CA 3H3ZA 1HKSA 1L3LA 2DTRA 2JRTA 1B4AA 3I0TA 2HFHA 3S2WA 3ULQB 4I02A 3W6KB 1B1BA 3I53A 1USTA 5DV5A 2ISYA 3J81Z 2DAOA 1FZPB 4XLNF 1MJ9A 1IAWA 2P7CB 1ONVA 2BV6A 3ROUA 3R4KA 4R1HA 4F7ZA 2W85A 4ESJA 3BPXA 1XD7A 4YIFA 4Q5SF 2LKPA 2RKHA 1WWXA 5HOOA 5H20A 2RGVA 1WKMA 4OIPF 2P6SA 2A5YB 1CGPA 5AIPA 3G3ZA 4LLGF 3NQOA 3V8KA 5F6FA 2A69F 3K0LA 5K1YA 4O6JA 4G9YA 3LQRA 1R5GA 1FY7A 3V4GA 1Z05A 2J5OA 3E6DA 3L2CA 5TRDA 2O8XA 1R1UA 2V9VA 1U3EM 4ENNA 2C6YA 3FMRA 4L0ZB 4RAYA 4M9SA 1IXCA 5A2QK 4KFCA 3T5XA 4UUVA 1SFEA 3U9GA 2EFOA 3GUDA 1XGOA 4D0PA 3K9TA 5ILUA 2QUFA 4ASNA 3JAMK 4BAYA 3EUHA 1P2FA 1S7AA 1PUEE 2FMLA 4KMUX 1QGPA 2FNAA 3HUGA 4BHCA 2VODA 3FMQA 4CXFA 1IRGA 2EV0A 2Y0MA 2CWEA 4RB1A 2KKOA 3HRTA 3QPHA 1ZYRF 2PJPA 1YIOA 4IPAA 3RJPA 1QO0D 3FMSA 1OR7A 1X3UA 4A2UA 2M87A 1HW1A 5D8LB 1UFMA 4P9UA 3M9AA 2MA3A 2KIMA 3HTSB 1S6LA 5LBQA 2FA5A 2Z3YA 1T6SA 4G7ZF 2MD5A 3GVAA 2KIUA 2AS5F 5DCMA 2VBWA 1WQ2A 2P7VB 5LEJA 2ACJA 2L4MA 1QNTA 3O2PE 2COMA 3KEQA 1ZGJA 3ZN0A 2OU2A 4N9HA 2IJLA 3KETA 1TQMA 4MTDA 4ZZDA 3ELKA 2EA2A 2FE3A 2YPRA 1D8JA 1KGSA 1UCRA 3RKYA 4HV6A 3P9CA 3ZP5A 5D5VB 2PN6A 2OBPA 2W25A 4H0EA 1P4WA 2ELHA 2XASA 2K4JA 1HBXG 4UVAA 3JSPA 1OYWA 3MEXA 3GEZA 2Z99A 2XV4S 3K1MA 1ZGAA 1PP8F 4L5IA 1GXPA 4XLPF 2OZ6A 4FHTA 1SFUA 4LGWA 3TQNA 4FX0A 1D8KA 2VC0A 4QLCU 3F21A 2IP2A 3Q9VA 3VB2A 5ICGA 5BS6A 3CUOA 3PQJA 3VOEA 3ZMVA 3DEUA 3JW4A 1G3WA 5ICCA 3H92A 2PEXA 4MNUA 1IRFA 1BI0A 1U78A 2CGPA 2XAHA 3PFIA 5JHUA 2YSRA 2IVMA 3GX4X 4HYEA 2OQRA 2W57A 5ERIA 4OIRF 1TLHB 1DUXC 2OA4A 3ZMSA 3WGIA 3HRSA 4RGXA 5K5OA 3M7GA 3M8FA 3V8JA 4O5VA 3BY6A 1FBUA 4LFUA 4BNCA 3WTXC 2L4AA 4HQMA 1TQIA 6PAXA 2ZKZA 1YO5C 1OPCA 4WXDA 2FNPA 2QQAA 3OV8A 2VBZA 1FSEA 3CO7C 3HTUA 3R61A 4ZZLA 5KVRA 1RUNA 2EWNA 2R3SA 5D8KB 2ESHA 3GF2A 3E6CC 2EV6A 3T8TA 4GYIA 1U5TA 1R23A 3HRUA 3L09A 3E6BA 5E8GA 2DW4A 3ZN1A 2AXLA 2GXBA 3NEUA 1O3TA 2HS5A 2ZBKA 5LGUA 4EV0A 1WRJA 3WE3A 4TV7A 2Q2EA 5D4SA 1IUYA 3O3KA 2V1UA 2ZNZA 3C18A 2MH2A 1XDUA 3P9IA 3KLOA 1FYKA 1ON1A 1XN7A 1BI3A 3I64A 2GXGA 3DV8A 1J59A 1IN4A 4JBAA 2L54A 3WU0A 4EM2A 3SFZA 4MEYF 1UHWA 4WXCA 3I5UA 3L00A 1FNNA 4WWCA 1FBSA 2RVCA 4Q47A 2FU4A 3QP5A 3BPVA 4KYWA 2P6TA 1P4AA 4ESFA 3WTTC 4XBFA 2M45A 1IF1A 3J80K 1XCVA 2LF7A 1F1ZA 3T0YA 2GA2A 1U2WA 3RPQA 1KQ9A 2VOPA 2UZKA 1H0MA 5BPIA 4I01A 4QWQA 1PP7U 1ZLKA 4G8XA 4PGHA 3IHUA 1J7KA 5E17F 4KN7X 3RKXA 3G73A 2FF4A 2VC1A 4A0XA 1QBJA 4KICA 4IJAA 2QBYA 5E1ZB 1U6GA 2DLLA 5BPDA 5IT9Z 2GA1A 3SZTA 1BC7C 4EJTA 2NNYA 4KUMA 2D2WA 4CICA 4UVBA 1TQPA 4R79A 3I58A 1YLFA 2P5VA 2GIVA 1HQCA 3KCCA 3KP3A 2FBKA 4M72A 1BOAA 3F22A 5L3EA 3WTSC 5HS7A 5K5RA 2D45A 3V7RA 1W7PD 1V4RA 2Z5UA 2H94A 1I1SA 1J5YA 1IN5A 1YQAA 4Z2YA 1FYMA 2NS0A 2NAZA 5A2QZ 1JGSA 1LDJA 2L3DA 2JSCA 4YFXF 2JPBA 1QZZA 5LHGA 3CLOA 2OAZA 4YFKF 4A0YA 3GFJA 4OOIA 4HDVA 3LA7A 1KYZA 1S3JA 4RAZA 2XROA 1KQ0A 4HF1A 3JAMZ 2F5FA 3R0AA 2HGCA 4NB5A 1OYIA 1TNTA 4A0ZA 1HW5A 1K78A 1MJBA 1J0RA 1BI1A 2D1VA 1G6NA 1SFXA 4UV8A 4U0VA 1RI7A 1Z7UA 4LLLA 2Z9OA 1FWZA 5FFXA 2NNNA 1R22A 1RUOA 2HR3A 2ZXJA 5CYVA 3WTWC 3WTZA 2QQ9A 1BM9A 2QWWA 2PLYA 1G3TA 2NRAC 1SMYF 2QZ8A 4PDKA 1XSXA 2CG4A 4ZYHA 3C1DA 2F5EA 2F2EA 1E17A 3KE2A 1ZG3A 2YX7A 3Q9SA 2LSOA 3F6VA 3O6BB 4RGRA 2LDUA 4U0WA 5IT9K 3KEOA 2K27A 1LJ9A 4BXUA 2QLZA 3IWFA 3F8BA 5E1XA 2IPQX 2IA0A 4LD5A 3KP5A 1W4MA 4KIBA 1L0OC 3QOPA 4FT8A 2PMHA 1RZ4A 4HV5A 1V3FA 1ZN2A 3RPUA 5D5XB 5LGNA 4RGUA 1XGSA 4ZH4F 3E3VA 2H27A 1ZREA 2LNBA 3MFKA 5FLXZ 1R1TA 3DP7A 2EFQA 1EH6A 3K1NA 3IKTA 2IRFG 3EETA 2GZWA
chains in the Genus database with same CATH superfamily
1R00A 2E35A 2EFNA 1UHSA 1GHCA 2BBYA 4Y33A 4KIGA 4HDUA 4J19A 5HS9A 4ZYGA 4P1WA 4PJJA 3O8GA 1SD4A 3G2BA 3S15J 3COAC 3ZQLA 5H6RA 4QPOA 2R7OA 4KDPA 3SEQA 3HOVJ 2R5YA 1FX7A 2DT5A 4KNYA 4CCNA 5D6EA 2F4IA 2DT6A 5E79C 2GOMA 5E3OA 3G4SI 1A6QA 5J4YA 1LVAA 2X9DA 2YU3A 4L9JA 2M1BA 1OCCH 1F36A 2O61A 1B9NA 3KLNA 1KA8A 5J1UA 4CA0A 1LEBA 4IQ4A 2QKMB 4QIWN 4CZCA 4IHSA 4WK8F 1K4TA 3QU6A 3GZ6A 3DPUA 1LE8B 1O4XA 2B0LA 3Q5FA 2DA5A 3L2WA 1AOYA 2EZHA 4PSXA 3WGHA 2HQRA 3LFUA 1UZCA 4XKBA 1FOYA 2Z16A 3A2KA 1QVTA 4BQAA 1TP4A 2GAUA 3K69A 5HVQC 4FX4A 1MMNA 2VXDA 4PSWA 1IXRC 4JQFA 3HBLA 1JUPA 4B8XA 2GXAA 3R60A 1SD7A 4HNTA 3K2AA 2M3AA 3SFIA 2DMPA 5ILSA 4A12A 3N05A 3ONQA 4OAYA 1YYVA 1G59A 2H09A 4XLCA 1S7EA 4Q48A 4D1QA 3ECHA 3MN2A 2PFBA 3A4CA 2V6EA 2P0WA 2VE9A 1H88C 1A5JA 1U5TB 1GXQA 4OWRB 1EH7A 2IS4A 1MIJA 2VQGA 1R4MB 1IV6A 4LJZF 4GDFA 3FXUA 4HX4A 1P92A 1Z77A 3D5RC 3CESA 2CV0A 1Z6TA 2GQQA 4HA8A 5IPAA 5LGTA 2LR8A 4A6DA 3HRMA 3CUQA 4B09A 3I4NJ 4DYQA 2E2IJ 3B73A 4ZYDA 2VONA 1A6IA 4LMYA 5L3DA 4FQGA 2PBIA 1USSA 3TO9A 3V7CA 4E70A 5F0FA 2Q2EB 1RNLA 2KL4A 3DF8A 1I3QJ 4IXAA 1O3SA 1TC3C 1WH5A 3PJRA 2K3PA 4Y13A 2L7FP 2O03A 1R1VA 1B6AA 3IAS2 2ZNYA 1KYWA 2VE8A 2FRHA 1H9TA 1WJ5A 1SFKA 5E18F 1FMWA 5M5YJ 1MKMA 4XMYA 3ZPLA 1OLTA 4HQEA 3F8CA 3MMYB 3L2UA 1D5VA 1HSTA 1CF7B 1XCBA 2A6HF 2KPMA 3HEFA 2CUFA 5M5XJ 3TW6A 2M30A 4B3XA 3F8NA 1FBQA 5F0HA 1YS6A 3BP8A 5E3NA 2ZMEB 2EFPA 4BHPA 2HXOA 5L3GA 5FLXK 1MNEA 2LH9A 1R6RA 3U2RA 3CCSI 2XAQA 3ZRGA 3HGYA 1LEAA 3PM1A 2DA2A 2DBBA 3G1LA 1J75A 4MHGA 2DYSH 4HPQA 1TWGJ 2IW5A 1X58A 1GLNA 3F6OA 2F48A 3OYGA 3HOSA 1ZRDA 5JHFA 2K9NA 3IL2A 2CUEA 2YX4A 4RGSA 1JTYA 4EQQA 3S3NA 2COBA 4I98B 3HYIA 1JKOC 3CP2A 2L7MP 2RDPA 3GW2A 2M8EA 2OCCH 3HGGA 3HXLA 2E7WA 2LMDA 2ZSIB 2P8TA 4IRGA 3CCQI 5D5WB 4RA2A 2QBYB 2KLOA 1YTYA 3DFGA 1B72B 4RS8A 1ZAOA 1U5TC 3SDGA 4G6QA 4M73A 3X2QH 5DUIA 1R4NB 5J40A 2W24A 3V8LA 1J2XA 2HYJA 2PQ8A 2O7OA 3D0SA 4XRMA 2ZXHA 4XONA 2D1HA 2VT3A 3J80Z 3P9KA 1BJZA 1MJAA 1BN5A 5EDNA 1OMIA 2QQBA 4HX7A 2W48A 2IGOA 5FD6A 3MWMA 3TP0A 2XGEA 2XPUA 3GLXA 3LFKA 1QQIA 3CCEI 3RI4A 3C2BA 1BL0A 3QP6A 3RZOJ 3A01B 4AYBN 2KJCA 1WJBA 2VN2A 1P7JA 5E1WA 4EGZA 4I09A 1U8RA 4RB0A 4A5MA 1BR4A 3PIPF 1K6YA 3KP4A 4A3BJ 2LREA 5DDGA 5GTIC 5L3BA 2G9WA 4ZTFA 3U1DA 3OS2A 4AIHA 2VASA 2FMYA 4EEFG 3BJAA 2B9SA 4OMZA 5HLHA 2CQQA 4LIUA 4XK4A 2GLOA 4MQ9F 3GO5A 3TOAA 1C0WA 5M3FJ 4B1RA 1RPWA 5FD5A 2VQCA 3J7YJ 3BG3A 2JVHA 3CC7I 3DQVC 1Y56A 1X2MA 2G0EA 2L02A 3CJQB 3AAFA 2L9NA 1Z6RA 5JFRA 1VQPI 1DP3A 3HSEA 5EGOA 3JRFA 5M5WJ 5ICFA 3IWZA 2STTA 2GWRA 2CO5A 2XDVA 2A68F 3KP2A 3CMYA 1BW6A 1ETVA 2ICWG 1Y6IA 2TCTA 4MFEA 4M74A 1LQ1A 1STZA 2PG4A 3WU2C 4A3LJ 1W7PA 5K5QA 4ZC3A 1APLC 3GZ5A 4FISA 3DKXA 1B8IA 3DPLC 1T08B 2JT1A 2A61A 4AYBA 2EV5A 2Q8KA 2DOAA 1E2XA 3D5SC 2DI3A 2X1DA 1NG6A 2BYVE 2F5CA 2V1DA 2YS9A 3ABTA 3OS0A 2ID3A 3HPHA 2W7NA 3FHNA 1ZARA 2QKLB 3KZIC 2CQXA 1MD0A 1QVUA 1Y0UA 2K7LA 4I99C 5HDGA 4BH9A 4EGYA 2EB7A 4AIKA 3EYIA 3E5XA 1HXDA 2MSYA 5LRSA 2MC3A 2R7FA 3DLAA 4CHUA 3VEPA 5FRNA 1VQMI 2R4GA 3PL8A 4UUTA 1GT0C 3IC7A 4HSRA 3C7JA 2GM4A 4CGZA 1IRZA 4F55A 4BDZA 3OYCA 5FROA 2Y48A 1R58A 2PMUA 1XMKA 3MQ0A 5JR3A 2Y9ZA 1VQNI 5FKLA 1JE8A 2AXTC 2L9RA 2EA4A 3TO7A 2LKXA 3LL7A 5AIQA 2Y75A 4E7LA 2ETHA 2HPMA 2L01A 4P9FA 2M0MA 5DUKA 2VT2A 2RC4A 1SMTA 2IAIA 3V7SA 4Y52J 4ON0A 1PDNC 5GADJ 1QHHD 2E1NA 1YS7A 2AQEA 1ZRFA 2DJIA 3MVPA 2UXNA 1YG2A 3B02A 4M3BA 3JREA 3BZ6A 3GLLA 5C4XJ 1JHFA 2Y9YA 3WE2A 1XTAA 3OYJA 1X19A 1AWCA 4MGRA 5DCFA 4F93B 2G7UA 4HAMA 3RYPA 5GAHJ 3AG1H 1FC3A 3PSFA 4EM0B 1ITYA 5KAFC 3FBNB 1Y1VJ 2HI3A 1POGA 2OPTA 4BUPA 5IYDJ 1YJ9I 4YIIA 2QSHX 3QAHA 2M4KA 3KFWX 3VODA 1O7LA 3FX3A 4IQJA 2BHZA 4N0BA 3WG9A 1IW7F 3BROA 2KFDA 5HODA 2MLKA 3DXJF 4EVIA 2NS8A 1N75A 4BYYA 2BW3A 4LITA 3GYHX 2HKXA 3ZMZA 3BC8A 2EJRA 3GTMJ 3M1CA 1R36A 1J9IA 3BWGA 2BEOA 2F6CA 4CCLA 2E5NA 4BE2A 2EPFA 4RAFA 3O8HA 3AKZA 3VPRA 1EH8A 3TEDA 1UHMA 3C2HA 3KIOA 2L9VA 4HX8A 4BEHB 4MTEA 1MMSA 4BBRJ 2XF7A 4ZYAA 1SC7A 2BVMA 4FETA 3FXOA 3FXKA 3ZQ7A 3TOBA 1F4KA 1TWCJ 2XF5A 2KMUA 1T8IA 3EDPA 2VJJA 3VYTB 5DD4A 2FD5A 1Z21A 3OOPA 1I39A 2VBYA 2JJ7A 1YITI 5E20A 2V79A 4KN4X 3I59A 3PUBA 1H9GA 4ZDOA 4DQ2A 1I6XA 4N4OB 4RBOA 2NVQJ 4HOBA 4CZZA 2KIQA 3L9FA 1W36D 2V1XA 3TGNA 5LHHA 3ZCOA 4G7HF 1OCOH 5E8IA 1CQTA 3MKWB 2ZJ2A 4BHBA 1S7OA 1DP7P 2R5YB 1RIOH 3TKYA 4M9ZA 3SHFA 1MH3A 3E97A 4GYGA 4J00A 2VXZA 3HUGB 1YX5A 1SEUA 4BXFA 1IUFA 2RN7A 3CMMA 2LOOA 3LAJA 1T2KA 3F8FA 5LD2C 2K86A 2HXIA 1A36A 2HYFA 4Z6YA 1MDMA 2XVCA 4LB6B 3HC7A 5LLQA 2J5PA 4HZFA 1LB2A 3DTKA 1QZYA 2QGUA 1W5TA 3LA2A 4AU7A 4PGGA 3K4JA 2RREA 3CC4I 1QU3A 4Y17A 2XC7A 1MBFA 3I4PA 5EZGA 3BQZA 2BE5F 4CYCA 2HOEA 1MZBA 2H6BA 4ENJA 1JKPC 1OCTC 3M8EA 3E5UA 4UHTA 1R49A 3J7AY 2R7ZJ 3U1KA 3ZMUA 4DBRA 1YW8A 3FF5A 4WXHA 4UUSB 3G6EI 4LG3A 5J6XA 2XAJA 2V9KA 4L9VA 3F72A 1IRXA 1WSUA 3HL2A 4LG0A 1TW2A 4OIQF 2HTSA 2ESNA 2LF8A 4IX7A 1XMAA 4CYDA 2JQ7A 4I0AA 5J8FA 2XUBA 1OQYA 4XQFA 1PVEA 3IRRA 3QODA 3W2VA 4LLNA 1YRNA 2CFOA 1WPKA 1OJLA 3BOQA 2WBMA 5HLGA 5LFAA 4A3MJ 2V9PA 4XRFA 3MAJA 5CVIA 1ZHFA 2HWVA 2DJNA 4F52A 5DEQA 2M9HA 5DCMB 1U9OA 2OZUA 4Q4ZF 4FTHA 3S2HJ 4GXOA 4HW0A 3Q0VA 3CUQB 3CCMI 3F3XA 1JI8A 5EYRA 4E4HA 4MQVA 2IA2A 2NOJB 2BGCA 3I54A 1D5YA 4KIFA 2A07F 2P5LC 2DA6A 3K2ZA 3ZXSA 3VSLA 4OINF 3FXRA 3WTUC 2K40A 3IKVA 2WTEA 3FXJA 3K4CA 3M07A 5EEGA 5LHIA 5M3MJ 2CW0F 4I7HA 1UMQA 2V4JC 2CFXA 2HDCA 1RKTA 5FLMJ 3I3LA 5ED4A 5KAIC 4P55A 4HLXA 1FOWA 3D5LA 1Q1HA 2DPUA 1O3QA 2STWA 3GTQJ 1T0FA 3JSOA 3S14J 1YW9A 1JUMA 2MH9A 2E19A 3GCMA 1NG7A 1YJNI 1ORKA 4QSHA 2IT0A 5GP9A 3WTVC 2PI0A 1JKRC 3HIFA 1K61A 3QPTA 1FT9A 1W5SA 2V6CA 2IS1A 3RIRA 3BR1A 3H5NA 1D1BA 3OR2C 4XLEA 1VTNC 3DKYA 4CUGA 4NBQA 4CO8A 3FXQA 1EA3A 1ENHA 1X2NA 2B7EA 4EJOA 3OYNA 1GUUA 4RLFA 1TTYA 2KZGA 1JXSA 3U21A 3ZGKA 1ZH5A 2E2JJ 3FKIJ 4XORA 3ZR8X 1G8XA 1K4SA 3QYBA 4GCVA 4HF0A 4BY7J 2GBYA 4WF2A 3V42A 3BCBA 1E0EA 4ETSA 2MW8A 3KP6A 3P5JA 5DM7F 2P4WA 3G1MA 3L1PA 2CYYA 1G3YA 3EYYA 1LNWA 1VI0A 1U9NA 2VQHA 2OV7A 4D5CA 5D4RA 4EJUA 1YOVB 3OYBA 3HKZA 4Y7NJ 4U88A 3OYHA 4M6XA 5JI6A 3K1PA 2AO9A 2VBXA 3DBRB 3GFLA 5KK1A 4CDGA 2EBIA 1A35A 2E1CA 2LY1A 2IGMA 3TDUC 5DS9A 4EJVA 4M3DA 3GWZA 2EZKA 2XGCA 5J47A 4WCGA 1K6OA 2HOSA 3BG6A 1VNDA 3LSTA 2O3FA 4KA4A 4KT5C 4JYKA 2VQLA 4DYRA 1F5TA 2VUMJ 2HTJA 3H1CA 3S16J 4DNCA 1FOKA 3LWFA 2M4GA 4KJZA 3S1RJ 1WI9A 3CUQC 3G71I 1SD6A 2VKHA 5FFZA 3QPLA 3PQKA 4XLFA 1ZQ3P 2DPDA 3B6AA 1P6RA 3WHBA 2R7UA 1ZELA 3ABKH 2DO7A 5BQTA 3CTAA 5IYCJ 3IRQA 2XAGA 2G7HA 1X1AA 2GOXB 1UG2A 2CV2A 1HSJA 2XKOA 3PSIA 2KHMA 4U0YA 1ETXA 1ZRCA 2QYOA 1IXSB 5EG0B 2L7ZA 2FOKA 2E5ZA 4BQQA 4CH7A 1BC8C 5H6QA 4EJWA 2VOOA 4BACA 2UXXA 4U7BA 3H35A 3HOTA 2CSOA 3QU3A 3I55I 1BA5A 5CJ9A 1P4XA 2ZO4A 2QF7A 3OIPA 2X1EA 1DDNA 3BG5A 2E7XA 3ML6A 1OYYA 3IH2A 2CU7A 1I50J 2XF6A 5IOYA 1HA8A 1VQ5I 2VPLA 1S8NA 3CCJI 1D0ZA 3BR5A 4BL0B 1G3SA 3WU1B 2L5QA 4OMYA 3ZQIA 2CQNA 3J81K 3K10A 4HBLA 2WA0A 1ON2A 1HOMA 1W7PB 4FCYA 3C3WA 3CJNA 1T98A 3K70D 3PNTA 3OWTA 2GIZA 1AKHA 4LB5A 4EATA 2LY9A 2MD0A 5ILVA 4NQWA 1WFXA 2OD5A 4I2OA 4U7DA 2JN6A 3VFZA 3ZQCA 3RTRA 1FP2A 3OSGA 4C2MJ 4BS9A 1XDSA 2X4HA 1D1CA 3A02A 1OISA 5BOXA 1S29A 4AVPA 2OTJI 2FSWA 2CH0A 4HF2A 3I9V2 2XRLA 2BOLA 3WGGA 2MYSA 3E5QA 2XHKA 4ZYEA 1J09A 4O3MA 3LA3A 2F5DA 1K79A 4N9IA 2BY0A 2D5VA 1O57A 1VQ6I 4E7KA 4L0YB 3QPSA 3ECOA 4M6YA 1D3YA 2NYXA 1ZG5A 1NH3A 1BJAA 2XAFA 2WV1A 4IEJA 4XSXF 4JOMA 1ZLJA 4K2EA 4KMFA 1O3RA 1ETWA 2OJED 3LQQA 3DWLE 3FM3A 2FOWA 3RSNA 1R7JA 3GFMA 3UNGC 4BJ6C 5TISC 3T8RA 4A3EJ 4DYCA 3FXMA 3CP8A 2E36A 2X0LA 4B48A 5FKOA 2O0YA 2W84A 2RV8A 1ERDA 4I0BA 3H3UA 2XPVA 1O7FA 2I10A 3M1EA 1B9MA 4L9TA 1IG7A 4A3GJ 2E1MC 2NVYJ 3DPTA 4IF4A 4XLAA 1SAXA 1UAAA 1BR1A 4FE4A 3ZMDA 2JK3A 4W97A 3BQYA 4BDYA 4RLQA 5JLXA 1ZG1A 1FPQA 1DPUA 1KU2A 3F23A 3GXOA 2HYGD 4F91B 4Y15A 4XIDA 5FKMA 3G1OA 3DTIA 5HLIA 1JT6A 4KITB 5J8CA 4AD9A 2VB6A 2LD5A 1FEXA 2MLGA 4UVCA 3LSPA 3N4MA 3HSRA 4XN0A 1X4PA 3RDIA 4C2TA 2ELKA 2EIKH 3JTGA 1FP1D 2FQ3A 3M4OJ 2PJRB 1IN6A 1JHHA 4CCOA 2DOFA 4B3AA 5HS8A 3MCZA 1I1GA 4CSWA 4MEXF 2EK5A 5CVUA 2OC6A 2ZCWA 1XSDA 4YIRX 1UB9A 2KRFA 2Q0OA 3SXYA 2BW3B 3NRVA 3HOXJ 1SANA 5LRRA 4IO9F 1T39A 4PJMA 1FYLA 5D6FA 1DQUA 3TO6A 3W6JB 2R7TA 1DU0A 5F64A 1ODDA 4AWXB 4GGGA 1QPIA 1I6HJ 3ABUA 2ISZA 4J01A 4ENKA 1TW3A 2ADUA 1X1DA 1X1BA 2YR2A 4XNFA 3REOA 4XR6A 4C30A 2ZFWA 4NC6A 2KIFA 1YIJI 1MNDA 2R7DA 2RNJA 4G94A 1NTCA 3N97A 2K9LA 1REPC 5E3LA 1I27A 5FB2A 3R6SA 2EFWA 4ESBA 3MZHA 2DCEA 1ETOA 1P9QC 1RESA 4AIDA 2M34A 4XLHA 1KU7A 2ZJRF 4C2UA 3KZYA 4PCQA 3I59B 3AG3H 3T1BA 3CCLI 1KU9A 1MH4A 2ZXWH 3F0CA 3WTYC 3AG4H 3UKGA 3LSKA 1YFHA 3FHZA 1LUJB 2EIMH 1QPMA 1A04A 4IVNA 5DYMA 2O6GE 4AIJA 2LC2A 1R5HA 3NWSA 1I5ZA 4HSTA 2JPCA 3L2RA 3J7AO 2XSDC 1MNMC 3IAM2 3EPZA 1Z0XA 2MABA 1QHGA 1LDKB 1Z9CA 5FLVA 3QQAA 1PJRA 3MZYA 4PJ0C 2HDWA 2E1OA 3WHCA 5F1RA 1ZR4A 2LTPA 3CO6C 3BTLA 1F9NA 2LKSA 2XAUA 3KX2A 2QM3A 1MDMB 2H8RA 3BR2A 4JK1X 2HEOA 2BXYA 4ENMA 5FKNA 1AU7A 3JTHA 4M3FA 3QWLA 1Z1DA 1MBEA 5J1YA 1SFOJ 2HQNA 4NNJA 2R5ZA 1VFCA 2V26A 3OSFA 3DKWA 2QVOA 2ZFUA 3BR6A 3WODF 1LPQA 4F92B 4GFBA 3HHGA 1UELB 3LAPA 4D7MA 9ANTA 4ANJA 1NHAA 3SYTA 3SQNA 4Y4RA 1YHQI 3VWBA 2WB1N 3HZJA 2N8GA 3E7LA 2ZJPF 2AQFA 4L18B 4P5OA 1WJFA 4A5NA 4LG0B 2LFBA 5E3MA 2XGXA 4IHTA 1K78B 5H2FC 5KHDA 4P96A 2ZC2A 5CQEA 5CVRA 5HDKA 5EZHA 1XGNA 1FMVA 5L3FA 2QSGX 3TW7A 1A31A 2DODA 3LSHA 5GPAA 1Z91A 2FUG2 5TJJA 1BR2A 2DFFA 4DGWB 1IN8A 2DQRA 1IZ1A 3FM5A 5AONA 2M5WA 4HNUA 1HKQA 4XKCA 4UNOA 3RKWA 3FKJA 1FJLA 2UWMA 2JA5J 5DD8A 3KP7A 3KEYA 2IGKA 5CVJA 2CQKA 2NOGA 1T38A 2JTVA 2FBHA 4IRIA 1FLIA 1N77A 3S3OA 4M3GA 1ZK8A 4XKWA 4RM2A 4RB3C 1Y0NA 2NXNB 3RCOA 3QRFF 4FE7A 2LBFA 1U8BA 3GFIA 2I8DA 2A6EF 2X6WA 2R0QC 4II2A 4S04A 1FSHA 2DA4A 1D1AA 2DK5A 1WVRA 3MKLA 3SDBA 2X1CA 1EJ9A 2P5KA 2WB1A 2HVRA 4E7SA 4NHJA 3E0JB 2A6TA 2DU9A 1WJAA 5LEKA 5EEHA 3MKYB 5ICEA 4ZDLA 2VL8A 4R8HA 3ERED 2YUSA 3IUOA 4UXNA 2WWYA 1CF7A 5FKKA 5GAGJ 3OIQA 3ISPA 3M8JA 4S05A 2M2EA 1XSVA 3S32A 1RETA 3EQLF 1IJWC 4G6DA 2DDAA 2H1LA 4E7IA 4OIOF 1DPRA 1BIAA 2ZMEA 3FZVA 3L7WA 5HDNA 4OU0A 1XGMA 2Y0SN 1QA6A 5K7ZA 4EMSA 4A6EA 3BJ6A 3I71A 4LIVA 2XB5A 3MZ8A 4MIMA 4GO1A 3ZMTA 1ZR2A 3BR0A 3DCFA 1SD5A 1RR7A 3BJOA 3AL0C 1G4DA 2XRNA 4V2GA 2OQGA 3HM5A 3B6CA 2RAEA 5FRMA 2X48A 2HZTA 1R5ID 5CLSA 1W0UA 1LDDA 1MGTA 2K85A 4UV9A 2IA1A 2FXAA 1HDDC 2VJ4A 4PJLA 4XSZF 1EV7A 3FDYA 2H6CA 2DMNA 2HQAA 4QPQA 5JVTA 2EZLA 2VLAA 2CMPA 1JKQC 4L9NA 5IT3A 1LVKA 2KJBA 4M71A 4YRVA 1VQ9I 1GVJA 1HW2A 1MMAA 1RC9A 2Z33A 5FGMA 4YFNF 2AHQA 2W4SA 4M9XA 3OS1A 1TNSA 3FWEA 2ZXIA 2XKPA 2MBFA 1HLVA 1SVLA 1H89C 1ULYA 3SZPA 1OKRA 2JZYA 4D9JA 3NARA 3HSFA 2CS3A 3TP3A 1FIAA 2A3SA 3HHHA 1ZKGA 2DK8A 1BI2A 2HZDA 5B3SH 5BMZA 3GTLJ 4PZJA 4L5JA 1HKTA 1B59A 4E7ZA 2Y0SA 1MBKA 4X1EA 4LK0F 2O5RA 2BHYA 2FBIA 2WV0A 2FEZA 2K02A 2TDXA 5F1JA 3A01A 4XN3A 4A69C 2XIGA 2DQLA 3JR9A 1KU3A 4LK1F 4HNVA 5CVVA 3LOCA 4G7OF 4W1UA 2DA3A 1BIBA 2RQPA 3F8MA 3Q0WA 4OAZA 2ID6A 1TBXA 5C4JJ 3SJMA 4A3FJ 1K7AA 1NK3P 4N4NB 1ETKA 4BJ5C 4PK4A 4UY8I 2W00A 3ESWB 4HLYA 3OYFA 2L7KA 1X1PA 1YW7A 2EZIA 3CDHA 5FO5A 4X6AJ 2KRCA 3BDDA 3ERMA 3H9QA 1T0FC 4DZJA 3BTIA 3ZQHA 3HOZJ 4BGDA 2F4MB 1XB4A 2VJIA 3BZKA 3L2QA 3A03A 1KQ8A 2BXZA 2LY2A 3SZGA 4YG2F 3KZZA 4IRHA 4C3HJ 3CQZJ 1BBYA 5D5UB 2K4BA 2LG4A 4A3IJ 3JCUC 3ZQQA 1DGWY 5IP7J 1HDPA 3RZDJ 1EF4A 4XOPA 2XPWA 4YEJA 3HB9A 1IN7A 1PYVA 2NS7A 4EM1A 3VYUB 3TDZC 2HKOA 3DEWA 2WC2A 3R0JA 2Z2SB 1WJCA 2DFIA 2QENA 1KONA 3RYRA 1AKHB 4RB2C 4MO7A 5DTDA 3P7NA 3LSMA 3E6MA 4WX9A 5L3CA 1DU6A 3H3ZA 1HKSA 1L3LA 2DTRA 2JRTA 3S1NJ 2FX0A 1B4AA 1VQ4I 3I0TA 2EILH 3OIOA 2HFHA 3S2WA 2ECCA 2VKEA 1FIPA 4JP0A 3ULQB 4I02A 3OMYA 3W6KB 1X4OA 3JRHA 1B1BA 3NWTA 3I53A 3S93A 1USTA 1ZTRA 5DV5A 5B5EC 2ISYA 3J81Z 3QOEA 2NVTJ 2DAOA 1FZPB 1YX3A 2BVLA 3S17J 4DW6A 4F3QA 2OF7A 2JA7J 1IC8A 3HKZN 4DOZA 3KYDB 1MJ9A 4XLNF 1IAWA 2P7CB 1ONVA 2X6OA 3K4BA 5CQGA 2BV6A 3FIWA 1Z67A 2Y2ZA 3BR3A 3R4KA 3ROUA 4CCJA 4R1HA 4F7ZA 2DDBA 2W85A 3W3CA 2ELJA 4ITVA 4ESJA 3BPXA 1XD7A 3OL4A 1V5FA 4YIFA 4HG2A 2JWTA 4Q5SF 2LKPA 3IH4A 2RKHA 1WWXA 5HOOA 2O9LA 4PFPA 2KQRA 5H20A 2Y69H 2RGVA 1XMXA 3H0GJ 1MSEC 1WKMA 2LK2A 4OIPF 5DM6F 2P6SA 3PIOF 1QRYA 2A5YB 3TMOA 5BNGA 1CGPA 3HG9A 5AIPA 2HDDA 3G3ZA 4LLGF 2CRGA 3ABMH 1E3PA 3NQOA 4V19K 1GV2A 3V8KA 1MSFC 5F6FA 2A69F 1M1EB 4KISA 3K0LA 3LSGA 2DMUA 3GTJJ 2HQ5A 3CCRI 2NVXJ 5K1YA 4O6JA 2CV1A 4G9YA 4XKVA 2R7WA 3LQRA 2R92J 2HOTA 5FJ8J 1GVDA 2CUJA 3K4MA 1R5GA 1FY7A 2M8GX 1XG1A 5TGTA 2JRMA 3V4GA 1Z05A 2J5OA 4IL6C 3E6DA 3WG7H 3W6VA 2QCOA 2P81A 3L2CA 4B4CA 4M6VA 3CLQA 5TRDA 3GTPJ 4UB6C 2O8XA 1R1UA 2V9VA 1U3EM 1OR7C 2VIXA 4ENNA 2C6YA 3FMRA 4L0ZB 5HNHA 4RAYA 4M9SA 1IXCA 1ETYA 2EH3A 5A2QK 1Q1VA 4ZJZA 4KFCA 3JRCA 3JRAA 1FTZA 3T5XA 4UUVA 2K3FA 4JX5A 3I4MJ 2R93J 1LFUP 3EUKL 1ZGWA 1SFEA 3OYIA 1T95A 1WZ2A 3U9GA 3M3YJ 2EFOA 5J4VA 3GUDA 3D1NI 1XGOA 4I76A 3BLYA 2E1MB 4C9YA 2I5UA 3S3MA 3DTEA 4D0PA 3K9TA 2DT7B 5ILUA 2QUFA 4ASNA 3BG9A 3JAMK 4BAYA 1V54H 2MFZA 3BT9A 2HU9A 2WADA 3EUHA 1P2FA 1S7AA 1PUEE 2FMLA 4KMUX 1QGPA 2FNAA 2K9SA 3HUGA 4BHCA 2VODA 3LSJA 4B47A 3FMQA 4CXFA 3UR3C 1IRGA 3PFYA 5KNLA 1H8AC 1E3HA 1Y1WJ 2LP0A 5EGOB 2EV0A 2DTZA 2Y0MA 2E71A 2CWEA 4RB1A 4DZPA 2FJ1A 2W1OA 2KKOA 1VF9A 3HRTA 2R5ZB 2H1KA 3QPHA 1ZYRF 2IXSA 4NDLA 2PJPA 1YIOA 1D0YA 1JT0A 2WAQN 3HJEA 3BG7A 4UB8C 1LFBA 4IPAA 4G12A 3RJPA 1B8IB 1QO0D 3JRBA 1RKWA 4HRIA 3FMSA 2WAFA 2KDOA 4D5FA 1OR7A 4CCKA 1X3UA 4A2UA 4UUSA 1QZEA 2DOEA 3OYEA 4IOAF 2M87A 1HW1A 3CMEI 5D8LB 1V5EA 1UFMA 1JUSA 3RQ4A 4P9UA 2DYRH 3CJTB 1IGNA 3H3VK 3M9AA 2MA3A 2KIMA 1LKXA 5B66C 3HTSB 1S6LA 5LBQA 2FA5A 2Z3YA 1T6SA 4G7ZF 2LYCA 2MD5A 3I56I 2IS2A 1JJ6C 3GVAA 4BKXA 3CF5F 2KIUA 1NK2P 2AS5F 5DCMA 2VBWA 1PUFA 1WQ2A 2P7VB 5LEJA 2ACJA 3H5AA 2L4MA 1QNTA 2JMWA 3O2PE 3CMAI 1N25A 1I3AA 2CW8A 1XPXA 2COMA 4IOCF 3KEQA 2E60A 2LBFB 1ZGJA 3OR1C 3IV5A 3ZN0A 3CJRB 4RAGA 2OU2A 2KRHA 2WAQA 4N9HA 2EQRA 2ME0A 2IJLA 5K7FA 3FISA 3KETA 1TQMA 3KYCB 1P7IA 4MTDA 4ZZDA 1AHDP 3ELKA 1UG0A 2EA2A 2FE3A 2YPRA 1D8JA 1KGSA 1UCRA 3RKYA 3K7AJ 4C3JJ 1T33A 2Z1DA 4HV6A 4YELA 4D7NA 1Y39A 1HCRA 3P9CA 3ZP5A 1LFPA 1WGXA 5D5VB 3DLLF 3RPUD 2DA7A 2PN6A 2DFEA 2OBPA 2W25A 4H0EA 3QYEA 1P4WA 1JJ8C 3OL3A 2ELHA 2XASA 2X85A 1YI2I 2K4JA 2QEXI 4JX6A 1YE9A 1HBXG 4UVAA 3LSIA 3ABLH 1OYWA 3JSPA 3MEXA 3GEZA 1TZLA 4PUSA 2Z99A 2Y30A 3FBIB 3FK7A 2ZSHB 4A3CJ 2R7RA 3K6GA 1W36C 2XV4S 3K1MA 1ZGAA 1PP8F 4L5IA 1GXPA 1ACIA 4XLPF 3JRIA 4ZTJA 1TT5B 3CC2I 4U87A 2M7BA 2OZ6A 4FHTA 1SFUA 3CCVI 2FQ4A 3H5RA 4LGWA 3TQNA 1W1WE 1IV8A 1BW5A 2VKVA 4FX0A 1D8KA 3H0DA 2VC0A 4QLCU 1V5GA 3BCAA 3F21A 2IP2A 3Q9VA 3VB2A 2B63J 2BY3A 5ICGA 5BS6A 3CUOA 3PQJA 3VOEA 3ZMVA 3DEUA 4MLOA 2IEKA 2ZJQF 3JW4A 3PUFA 3VDXA 1FOXA 1G3WA 4DJAA 2XSJC 4ZDPA 3HDDA 3PNVA 2XB0X 1HF0A 2EINH 5ICCA 5IP9J 1OCPA 1T56A 3H92A 1VQ7I 2PEXA 3DU5A 1VQOI 4MNUA 1IRFA 1BI0A 4DIQA 4I6ZA 1U78A 2CGPA 2XAHA 2JA2A 2MGQA 3PFIA 1D0XA 2UUZA 2R7XA 5JHUA 2YSRA 4M3EA 1TWHJ 2IVMA 3GX4X 3TBIA 4HYEA 2K5CA 2OQRA 2W57A 5ERIA 4OIRF 3CD6I 2HOAA 1TLHB 2V7FA 4ABZA 4NUBA 2L9SA 5B1AH 3LSRA 1DUXC 3DBHB 4BU2A 2X51A 3CZ6A 2OA4A 3ZMSA 3CCUI 3WGIA 2NVUB 3GZNB 2OUMA 3HRSA 5EG0A 1K83J 1BOBA 4RGXA 5K5OA 3M7GA 3M8FA 3QYFA 3H9GA 3V8JA 4O5VA 4A93J 1LE8A 1MBJA 3BY6A 4XRSA 1FBUA 4LFUA 3AL0B 5F0CA 4BNCA 4IHYA 2UV1A 3KPHA 3WTXC 2CJJA 2L4AA 4HQMA 1TQIA 4CYCB 2BY2A 2IGNA 4PJNA 6PAXA 2ZKZA 1VZ0A 1YO5C 4XL9A 1OPCA 3IP4B 4WXDA 2FNPA 5CKTA 4IHWA 2QQAA 1Z7LA 2HPIA 3OV8A 2VBZA 1FSEA 3CO7C 2ZMEC 2CQ7A 2KT0A 3HTUA 3KYLA 1WJEA 3R61A 4ZZLA 5KVRA 1RUNA 4H4KC 2EWNA 2R3SA 5D8KB 2ESHA 3GF2A 3OYKA 3E6CC 2EV6A 2KDZA 1EKEA 3T8TA 4GYIA 1YRNB 3S2DJ 1U5TA 3OOUA 1R23A 2HVSA 3HRUA 3C2GA 3L09A 3E6BA 5E8GA 2DW4A 2OCEA 1DGRM 3ZN1A 1MBGA 2LVSA 5JLWA 4NC7A 2AXLA 2IBDA 2GXBA 3NEUA 2JUGA 3GBGA 1O3TA 1VQKI 4BQOA 2HS5A 1VQLI 2ZBKA 4A3KJ 1TT0A 5LGUA 4EV0A 1KZHA 1WRJA 1OCZH 5B1BH 4QTRA 4HEA2 1RRJA 4IHVA 3WE3A 4TV7A 4FASD 3DU6A 2CUZA 2WY8Q 3MD2A 2A5WA 2Q2EA 5D4SA 5IY5H 1IUYA 1Z3YA 3O3KA 2ZNZA 1MBHA 2V1UA 1N78A 1G2HA 3C18A 4DBQA 2MH2A 1XDUA 3P9IA 2DXIA 3KLOA 3FXLA 1FYKA 2WY7Q 1ON1A 5GPCA 1XN7A 5GTHC 2KZVA 1BI3A 2M0CA 4XICA 3I64A 2DMTA 2GXGA 1WHUA 5C44J 1TWAJ 4KT6A 1WJDA 3DV8A 1J59A 2F5VA 1IN4A 4JBAA 2L54A 3WU0A 4RMNA 4EM2A 3SFZA 4MEYF 2JA6J 4XRSG 2QSFX 1UHWA 2X6YA 4WXCA 3I5UA 5F08A 1S72I 3L00A 1FNNA 1UJ8A 4WWCA 5HLTA 1FBSA 2RVCA 4IHXA 3RQIA 4Q47A 3VSKA 4A3DJ 2FU4A 1U0JA 1R9TJ 1X3ZB 3QP5A 3L2VA 3BPVA 4KYWA 2P6TA 1P4AA 4S0HB 1WCMJ 4ESFA 3WTTC 1IO2A 2M45A 1SVOA 4XBFA 1IF1A 1RR8C 3J80K 1XCVA 2LF7A 1F1ZA 3T0YA 4BQNA 2GA2A 3E1SA 2VJ5A 3AG2H 2A05A 1U2WA 3RPQA 1KQ9A 5IYBJ 4C3IJ 2VOPA 2UZKA 2DA1A 4RM3A 1H0MA 2OTLI 2PJRA 5BPIA 4I01A 4QWQA 1PP7U 4JX4A 3PNYA 2Q1ZB 1VQ8I 3S1QJ 1ZLKA 4G8XA 2V1NA 4PGHA 3IHUA 5EF6A 1J7KA 2RQQA 4KN7X 3GTKJ 5E17F 3RKXA 3G73A 2FF4A 2VC1A 5F04A 1S5LC 4A0XA 5HNFA 1AA7A 1QBJA 4KICA 2JVGA 2PMZN 2ME6A 4IJAA 2QBYA 1JGGA 1B72A 2L2OA 5E1ZB 1U6GA 2DLLA 3W2AA 1OCRH 5BPDA 2E2HJ 3HOUJ 5IT9Z 3ASNH 2E34A 2GA1A 3JRGA 1Y8RB 2X6XA 2WAEA 3SZTA 1BC7C 2NNYA 2KISA 3ZQFA 5C3EJ 4EJTA 4KUMA 3OYAA 3PO3J 1X3WB 2D2WA 4CICA 4UVBA 2HVQA 1TQPA 4B43A 4R79A 3I58A 3SEZA 1YLFA 2JA8J 2P5VA 2GIVA 4L5EA 1HQCA 3KCCA 3KP3A 3K70C 2FBKA 1W5CC 4M72A 1R71A 1X1CA 4AVZA 1WH7A 3OYMA 1BOAA 1SVMA 3CDIA 3F22A 5L3EA 3GMEA 3WTSC 5HS7A 1GV5A 4B44A 4LOCA 5K5RA 2D45A 2RNGA 3V7RA 1W7PD 1V4RA 1Z3XA 2R7QA 2Z5UA 2H94A 1I1SA 1J5YA 2QQ8A 3K4KA 1IN5A 1YQAA 4II3A 4Z2YA 3Q0UA 3CDLA 2VPRA 2PMZA 1FYMA 2NS0A 4BXXJ 2NAZA 5A2QZ 2W82A 1IDZA 1JGSA 2JSPA 1TL8A 2MC4A 3VYRB 1LDJA 2LRDA 5IP6A 2L3DA 2JSCA 2H8WA 4YFXF 3OY9A 2JPBA 2YU9J 1QZZA 5LHGA 2LLKA 3CLOA 2OAZA 5F27A 4YFKF 2MG4A 3GFJA 2BZTA 4A0YA 2DFHA 4OOIA 3LA7A 4HDVA 1KYZA 1S3JA 3H36A 4RAZA 3S1MJ 3DEEA 1F43A 2BY1A 4BY1J 4E6KG 2XROA 1KQ0A 4NC8A 3J7ZI 4HF1A 3AFHA 3JAMZ 2F5FA 1SAUA 3NAUA 3R0AA 5K7HA 3K4NA 2HGCA 4NQWB 4NB5A 4E7JA 1OYIA 3IH3A 3PO2J 1HC8A 2L0KA 4GRIA 1TNTA 4A0ZA 1XC5A 1HW5A 1K78A 1MJBA 4XM3A 1J0RA 1BI1A 3LNQA 2D1VA 1G6NA 1SFXA 4UV8A 4BJTA 4U0VA 1RI7A 1Z7UA 3Q3SA 3JRDA 2M7AA 4AM3A 4LLLA 4BE0A 2Z9OA 3ZOBA 1FWZA 4IKFA 1PUFB 5FFXA 3A1YA 2IS6A 2NNNA 2F4OB 1R22A 1RUOA 2HR3A 3ZQGA 3FK6A 2K9MA 2ZXJA 5CYVA 4CCMA 3WTWC 3OYLA 2XGDA 3CF2A 2JUCA 1WI3A 1XX5A 2PX9A 4V2FA 2VKDA 3WTZA 2QQ9A 1XS9A 2TRTA 5JVGF 1BM9A 2KP6A 3HOYJ 3W2WA 2QWWA 4AC0A 2R7VA 1W0TA 2PLYA 1G3TA 2NRAC 2Y31A 1SMYF 3K4LA 3TL4X 1MW7A 2QZ8A 1E3OC 1TWFJ 4PDKA 3BZCA 3HPGA 3BTJA 1XSXA 5J1RA 3S8PA 2CG4A 4ZYHA 3GTGJ 3C1DA 2F5EA 2F2EA 1E17A 4XOTA 3KE2A 1IDYA 1ZG3A 2YX7A 3Q9SA 1V55H 5EEAA 2LSOA 1Y8QB 3F6VA 3O6BB 4RGRA 1GDTA 3EUHC 4AUXA 4A3JJ 3ASOH 2LDUA 4U0WA 5IT9K 4IZZA 2DN0A 2R7SA 1ETQA 3KEOA 2K27A 1YJWI 1LJ9A 2QA4I 3BTCA 5IOZA 4E7HA 4BXUA 2ECBA 2QLZA 2O8KA 5KCMA 3HOWJ 2CW7A 3IWFA 3F8BA 5E1XA 2IPQX 2IA0A 4LD5A 1MMDA 3A0HC 3KP5A 1W4MA 3GTOJ 3VYSB 2DMQA 4KIBA 1L0OC 1OFCX 3LMMA 3QOPA 3H9JA 4FT8A 4PFOA 2PMHA 3MKZA 4Y3OA 1RZ4A 4HV5A 3DBLB 1JTXA 1V3FA 5EJCA 1ZN2A 3A0BC 3RPUA 5D5XB 5LGNA 4X0GA 2K9QA 5CPRB 3F9KA 4RGUA 4BEHA 1XGSA 4RDUA 1MMGA 4ZH4F 3E3VA 5GAEJ 2VI6A 2H27A 5J3LA 4G6TB 1ZREA 2LNBA 3MFKA 3CCYA 1FTTA 5FLXZ 3EUAA 1R1TA 3DP7A 2EFQA 2ZB9A 1EH6A 3K1NA 4MFDA 4BBSJ 3IKTA 2IRFG 2EIJH 3EETA 2GZWA 4BE1A 1S9HA 3RKQA 2HNHA 3OYDA
chains in the Genus database with same CATH topology
1R00A 1GHCA 2EFNA 2BBYA 4KIGA 4HDUA 5HS9A 4ZYGA 1SD4A 3COAC 5H6RA 4KDPA 1FX7A 2DT5A 4KNYA 5D6EA 1LVAA 2YU3A 4L9JA 2M1BA 2O61A 1B9NA 3KLNA 1KA8A 1LEBA 4IHSA 4WK8F 3QU6A 3GZ6A 2B0LA 3Q5FA 1AOYA 3WGHA 2HQRA 4BQAA 2GAUA 3K69A 5HVQC 4FX4A 1IXRC 4JQFA 4B8XA 3R60A 1SD7A 5ILSA 4A12A 1YYVA 2H09A 4Q48A 3ECHA 2PFBA 2VE9A 1U5TB 1GXQA 1EH7A 4LJZF 3FXUA 4HX4A 1P92A 1Z6TA 2GQQA 4HA8A 5LGTA 4A6DA 3HRMA 3CUQA 4B09A 3B73A 4ZYDA 2VONA 4LMYA 5L3DA 2PBIA 1USSA 3TO9A 3V7CA 4E70A 1RNLA 3DF8A 4IXAA 1O3SA 4Y13A 2O03A 1R1VA 1B6AA 2ZNYA 1KYWA 2FRHA 2VE8A 1H9TA 5E18F 1MKMA 3ZPLA 4HQEA 3F8CA 1D5VA 1HSTA 1CF7B 1XCBA 2A6HF 2M30A 3F8NA 1FBQA 1YS6A 3BP8A 2ZMEB 2EFPA 4BHPA 5L3GA 5FLXK 3U2RA 2XAQA 1LEAA 2DBBA 1J75A 4MHGA 2IW5A 3F6OA 3HOSA 1ZRDA 3IL2A 2YX4A 4RGSA 4EQQA 4I98B 3HYIA 2RDPA 3GW2A 2M8EA 4IRGA 2E7WA 2P8TA 5D5WB 2QBYB 1YTYA 3DFGA 4RS8A 1ZAOA 1U5TC 4G6QA 4M73A 5DUIA 2W24A 3V8LA 1J2XA 2PQ8A 3D0SA 2D1HA 2VT3A 3J80Z 3P9KA 1MJAA 1BN5A 1OMIA 2QQBA 4HX7A 5FD6A 3MWMA 3GLXA 3LFKA 1QQIA 3RI4A 3QP6A 2KJCA 2VN2A 5E1WA 4EGZA 4I09A 1U8RA 4RB0A 4A5MA 3KP4A 5DDGA 5L3BA 2G9WA 3U1DA 4AIHA 2FMYA 3BJAA 4OMZA 5HLHA 4MQ9F 3GO5A 3TOAA 1C0WA 4OIOF 5FD5A 3DQVC 2L02A 3AAFA 1Z6RA 5JFRA 3HSEA 5ICFA 3IWZA 2STTA 2GWRA 2CO5A 2A68F 3KP2A 4M74A 1LQ1A 1STZA 2PG4A 1W7PA 5K5QA 3GZ5A 3DPLC 2JT1A 2A61A 2EV5A 2Q8KA 1E2XA 2DI3A 2BYVE 2F5CA 2V1DA 3ABTA 1ZARA 1MD0A 1Y0UA 2K7LA 5HDGA 4BH9A 4EGYA 2EB7A 4AIKA 3EYIA 3E5XA 1HXDA 5LRSA 2MC3A 2R7FA 4CHUA 3VEPA 3IC7A 3C7JA 4CGZA 2PMUA 1R58A 2Y48A 1XMKA 3MQ0A 5JR3A 1JE8A 2EA4A 3TO7A 5AIQA 2Y75A 2ETHA 2L01A 4P9FA 5DUKA 2VT2A 2RC4A 1SMTA 3V7SA 4ON0A 1PDNC 2E1NA 1YS7A 1ZRFA 2UXNA 1YG2A 3B02A 3BZ6A 1JHFA 3WE2A 1AWCA 4MGRA 5DCFA 2G7UA 4HAMA 3RYPA 1FC3A 4EM0B 4YIIA 3QAHA 3KFWX 3VODA 1O7LA 3FX3A 4N0BA 3WG9A 1IW7F 3BROA 2MLKA 3DXJF 4EVIA 4BYYA 3GYHX 2HKXA 3ZMZA 2EJRA 1R36A 1J9IA 3BWGA 2BEOA 1EH8A 1UHMA 4HX8A 4MTEA 3ZQ7A 3TOBA 1F4KA 3EDPA 5DD4A 3OOPA 2VBYA 5E20A 2V79A 4KN4X 3I59A 1H9GA 4DQ2A 1I6XA 4HOBA 4CZZA 3L9FA 2V1XA 3TGNA 5LHHA 4G7HF 5E8IA 1DP7P 2ZJ2A 4BHBA 1S7OA 1RIOH 3TKYA 4M9ZA 3SHFA 3E97A 4GYGA 2VXZA 2RN7A 1T2KA 3LAJA 3F8FA 2K86A 2HYFA 1MDMA 2XVCA 4LB6B 5LLQA 2J5PA 4HZFA 1LB2A 1QZYA 1W5TA 3LA2A 4PGGA 4Y17A 3I4PA 2BE5F 2HOEA 1MZBA 2H6BA 4ENJA 3M8EA 3E5UA 4UHTA 3ZMUA 1YW8A 3FF5A 4WXHA 5J6XA 2XAJA 4L9VA 3F72A 1WSUA 4LG0A 1TW2A 4OIQF 2HTSA 2ESNA 2LF8A 1XMAA 4CYDA 4I0AA 5J8FA 2XUBA 3IRRA 4LLNA 3BOQA 5HLGA 4XRFA 3MAJA 5CVIA 1ZHFA 2HWVA 5DEQA 5DCMB 2OZUA 4Q4ZF 4GXOA 4HW0A 3CUQB 3F3XA 4MQVA 2IA2A 3I54A 2BGCA 4KIFA 2A07F 2P5LC 3K2ZA 4OINF 3FXRA 3WTUC 3IKVA 2WTEA 5EEGA 5LHIA 2CW0F 4I7HA 2CFXA 2HDCA 5ED4A 4P55A 4HLXA 3D5LA 1Q1HA 2DPUA 1O3QA 2STWA 1T0FA 3JSOA 1YW9A 2MH9A 2IT0A 2PI0A 3WTVC 3HIFA 3QPTA 1FT9A 1W5SA 2V6CA 3RIRA 1VTNC 4CO8A 3FXQA 4EJOA 1TTYA 1JXSA 1ZH5A 4GCVA 4HF0A 4WF2A 4ETSA 3KP6A 2P4WA 2CYYA 1G3YA 3EYYA 1LNWA 5D4RA 4EJUA 4U88A 4M6XA 5JI6A 3K1PA 2VBXA 3GFLA 5KK1A 4CDGA 2E1CA 3TDUC 4EJVA 3GWZA 1K6OA 4WCGA 3LSTA 2O3FA 4KA4A 4KT5C 1F5TA 2HTJA 4DNCA 1FOKA 3LWFA 1WI9A 3CUQC 1SD6A 5FFZA 3PQKA 2DPDA 1P6RA 2DO7A 5BQTA 3CTAA 3IRQA 2XAGA 2G7HA 1HSJA 2XKOA 4U0YA 1ZRCA 2QYOA 1IXSB 2FOKA 1BC8C 5H6QA 4EJWA 2VOOA 2UXXA 4U7BA 3HOTA 2CSOA 3QU3A 5CJ9A 1P4XA 2ZO4A 1DDNA 2E7XA 3ML6A 1OYYA 1S8NA 1G3SA 3WU1B 4OMYA 3J81K 4HBLA 1ON2A 1W7PB 3C3WA 3CJNA 1T98A 4LB5A 5ILVA 4NQWA 2OD5A 4I2OA 4U7DA 3VFZA 3RTRA 1FP2A 1XDSA 2X4HA 5BOXA 1S29A 4AVPA 2FSWA 4HF2A 3WGGA 3E5QA 2XHKA 4ZYEA 4O3MA 3LA3A 2F5DA 1K79A 4N9IA 1O57A 4L0YB 3ECOA 4M6YA 1D3YA 2NYXA 1ZG5A 1BJAA 2XAFA 4XSXF 1ZLJA 4K2EA 4KMFA 1O3RA 3LQQA 3FM3A 1R7JA 3GFMA 3T8RA 2X0LA 2O0YA 2W84A 2RV8A 4I0BA 3H3UA 1O7FA 4L9TA 3M1EA 1B9MA 3DPTA 4IF4A 1SAXA 3ZMDA 1ZG1A 1FPQA 1DPUA 1KU2A 3F23A 3GXOA 2HYGD 4Y15A 5HLIA 5J8CA 4AD9A 2MLGA 4UVCA 3N4MA 3HSRA 3RDIA 3JTGA 1FP1D 2FQ3A 1IN6A 1JHHA 5HS8A 3MCZA 1I1GA 4MEXF 2EK5A 5CVUA 2ZCWA 1XSDA 1UB9A 2KRFA 2Q0OA 3SXYA 3NRVA 5LRRA 1T39A 1FYLA 5D6FA 3TO6A 3W6JB 5F64A 1ODDA 4AWXB 4GGGA 3ABUA 2ISZA 4ENKA 1TW3A 2ADUA 2YR2A 3REOA 2ZFWA 2KIFA 2R7DA 2RNJA 4G94A 3N97A 1REPC 1I27A 5FB2A 3R6SA 2EFWA 4ESBA 3MZHA 1KU7A 3KZYA 4PCQA 3I59B 3T1BA 1KU9A 3WTYC 1YFHA 3FHZA 1QPMA 1A04A 4IVNA 5DYMA 2O6GE 4AIJA 1R5HA 1I5ZA 2JPCA 3J7AO 1LDKB 1Z9CA 3MZYA 5F1RA 3CO6C 1F9NA 2QM3A 1MDMB 4JK1X 2HEOA 4ENMA 3JTHA 1Z1DA 2HQNA 3DKWA 2QVOA 3WODF 3HHGA 3LAPA 1NHAA 3SQNA 4L18B 4P5OA 4A5NA 4LG0B 2XGXA 4IHTA 1K78B 4P96A 5CVRA 5HDKA 1XGNA 5L3FA 1Z91A 5TJJA 1IN8A 2DQRA 1IZ1A 3FM5A 5AONA 2M5WA 1HKQA 4UNOA 3RKWA 2UWMA 5DD8A 3KP7A 5CVJA 2CQKA 1T38A 2JTVA 2FBHA 4IRIA 1FLIA 4RB3C 3QRFF 3GFIA 2A6EF 4S04A 1FSHA 2DK5A 2P5KA 4NHJA 2DU9A 5LEKA 5EEHA 5ICEA 4R8HA 3ERED 2WWYA 4UXNA 1CF7A 3ISPA 4S05A 1XSVA 3EQLF 4G6DA 1DPRA 1BIAA 2ZMEA 3FZVA 3L7WA 5HDNA 4OU0A 1XGMA 4EMSA 4A6EA 3BJ6A 3I71A 3ZMTA 4GO1A 1SD5A 3BJOA 1G4DA 2XRNA 2OQGA 2HZTA 5CLSA 1LDDA 1MGTA 4UV9A 2IA1A 2FXAA 4XSZF 1EV7A 2H6CA 5JVTA 4L9NA 5IT3A 4M71A 2KJBA 1GVJA 1HW2A 2Z33A 5FGMA 4YFNF 4M9XA 1TNSA 3FWEA 2XKPA 2MBFA 1ULYA 3SZPA 1OKRA 2JZYA 3HSFA 2A3SA 3HHHA 2DK8A 1BI2A 5BMZA 4PZJA 4L5JA 1HKTA 1B59A 4LK0F 2WV0A 2FBIA 2FEZA 2K02A 2TDXA 2XIGA 2DQLA 1KU3A 4LK1F 5CVVA 4G7OF 2RQPA 1BIBA 3F8MA 1K7AA 1TBXA 4HLYA 1YW7A 3CDHA 5FO5A 3BDDA 1XB4A 1KQ8A 4YG2F 3KZZA 4IRHA 1BBYA 5D5UB 2K4BA 1IN7A 4EM1A 3TDZC 2HKOA 2WC2A 3R0JA 2QENA 2DFIA 3RYRA 4RB2C 3P7NA 3E6MA 4WX9A 5L3CA 3H3ZA 1HKSA 1L3LA 2DTRA 2JRTA 1B4AA 3I0TA 2HFHA 3S2WA 3ULQB 4I02A 3W6KB 1B1BA 3I53A 1USTA 5DV5A 2ISYA 3J81Z 2DAOA 1FZPB 4XLNF 1MJ9A 1IAWA 2P7CB 1ONVA 2BV6A 3ROUA 3R4KA 4R1HA 4F7ZA 2W85A 4ESJA 3BPXA 1XD7A 4YIFA 4Q5SF 2LKPA 2RKHA 1WWXA 5HOOA 5H20A 2RGVA 1WKMA 4OIPF 2P6SA 2A5YB 1CGPA 5AIPA 3G3ZA 4LLGF 3NQOA 3V8KA 5F6FA 2A69F 3K0LA 5K1YA 4O6JA 4G9YA 3LQRA 1R5GA 1FY7A 3V4GA 1Z05A 2J5OA 3E6DA 3L2CA 5TRDA 2O8XA 1R1UA 2V9VA 1U3EM 4ENNA 2C6YA 3FMRA 4L0ZB 4RAYA 4M9SA 1IXCA 5A2QK 4KFCA 3T5XA 4UUVA 1SFEA 3U9GA 2EFOA 3GUDA 1XGOA 4D0PA 3K9TA 5ILUA 2QUFA 4ASNA 3JAMK 4BAYA 3EUHA 1P2FA 1S7AA 1PUEE 2FMLA 4KMUX 1QGPA 2FNAA 3HUGA 4BHCA 2VODA 3FMQA 4CXFA 1IRGA 2EV0A 2Y0MA 2CWEA 4RB1A 2KKOA 3HRTA 3QPHA 1ZYRF 2PJPA 1YIOA 4IPAA 3RJPA 1QO0D 3FMSA 1OR7A 1X3UA 4A2UA 2M87A 1HW1A 5D8LB 1UFMA 4P9UA 3M9AA 2MA3A 2KIMA 3HTSB 1S6LA 5LBQA 2FA5A 2Z3YA 1T6SA 4G7ZF 2MD5A 3GVAA 2KIUA 2AS5F 5DCMA 2VBWA 1WQ2A 2P7VB 5LEJA 2ACJA 2L4MA 1QNTA 3O2PE 2COMA 3KEQA 1ZGJA 3ZN0A 2OU2A 4N9HA 2IJLA 3KETA 1TQMA 4MTDA 4ZZDA 3ELKA 2EA2A 2FE3A 2YPRA 1D8JA 1KGSA 1UCRA 3RKYA 4HV6A 3P9CA 3ZP5A 5D5VB 2PN6A 2OBPA 2W25A 4H0EA 1P4WA 2ELHA 2XASA 2K4JA 1HBXG 4UVAA 3JSPA 1OYWA 3MEXA 3GEZA 2Z99A 2XV4S 3K1MA 1ZGAA 1PP8F 4L5IA 1GXPA 4XLPF 2OZ6A 4FHTA 1SFUA 4LGWA 3TQNA 4FX0A 1D8KA 2VC0A 4QLCU 3F21A 2IP2A 3Q9VA 3VB2A 5ICGA 5BS6A 3CUOA 3PQJA 3VOEA 3ZMVA 3DEUA 3JW4A 1G3WA 5ICCA 3H92A 2PEXA 4MNUA 1IRFA 1BI0A 1U78A 2CGPA 2XAHA 3PFIA 5JHUA 2YSRA 2IVMA 3GX4X 4HYEA 2OQRA 2W57A 5ERIA 4OIRF 1TLHB 1DUXC 2OA4A 3ZMSA 3WGIA 3HRSA 4RGXA 5K5OA 3M7GA 3M8FA 3V8JA 4O5VA 3BY6A 1FBUA 4LFUA 4BNCA 3WTXC 2L4AA 4HQMA 1TQIA 6PAXA 2ZKZA 1YO5C 1OPCA 4WXDA 2FNPA 2QQAA 3OV8A 2VBZA 1FSEA 3CO7C 3HTUA 3R61A 4ZZLA 5KVRA 1RUNA 2EWNA 2R3SA 5D8KB 2ESHA 3GF2A 3E6CC 2EV6A 3T8TA 4GYIA 1U5TA 1R23A 3HRUA 3L09A 3E6BA 5E8GA 2DW4A 3ZN1A 2AXLA 2GXBA 3NEUA 1O3TA 2HS5A 2ZBKA 5LGUA 4EV0A 1WRJA 3WE3A 4TV7A 2Q2EA 5D4SA 1IUYA 3O3KA 2V1UA 2ZNZA 3C18A 2MH2A 1XDUA 3P9IA 3KLOA 1FYKA 1ON1A 1XN7A 1BI3A 3I64A 2GXGA 3DV8A 1J59A 1IN4A 4JBAA 2L54A 3WU0A 4EM2A 3SFZA 4MEYF 1UHWA 4WXCA 3I5UA 3L00A 1FNNA 4WWCA 1FBSA 2RVCA 4Q47A 2FU4A 3QP5A 3BPVA 4KYWA 2P6TA 1P4AA 4ESFA 3WTTC 4XBFA 2M45A 1IF1A 3J80K 1XCVA 2LF7A 1F1ZA 3T0YA 2GA2A 1U2WA 3RPQA 1KQ9A 2VOPA 2UZKA 1H0MA 5BPIA 4I01A 4QWQA 1PP7U 1ZLKA 4G8XA 4PGHA 3IHUA 1J7KA 5E17F 4KN7X 3RKXA 3G73A 2FF4A 2VC1A 4A0XA 1QBJA 4KICA 4IJAA 2QBYA 5E1ZB 1U6GA 2DLLA 5BPDA 5IT9Z 2GA1A 3SZTA 1BC7C 4EJTA 2NNYA 4KUMA 2D2WA 4CICA 4UVBA 1TQPA 4R79A 3I58A 1YLFA 2P5VA 2GIVA 1HQCA 3KCCA 3KP3A 2FBKA 4M72A 1BOAA 3F22A 5L3EA 3WTSC 5HS7A 5K5RA 2D45A 3V7RA 1W7PD 1V4RA 2Z5UA 2H94A 1I1SA 1J5YA 1IN5A 1YQAA 4Z2YA 1FYMA 2NS0A 2NAZA 5A2QZ 1JGSA 1LDJA 2L3DA 2JSCA 4YFXF 2JPBA 1QZZA 5LHGA 3CLOA 2OAZA 4YFKF 4A0YA 3GFJA 4OOIA 4HDVA 3LA7A 1KYZA 1S3JA 4RAZA 2XROA 1KQ0A 4HF1A 3JAMZ 2F5FA 3R0AA 2HGCA 4NB5A 1OYIA 1TNTA 4A0ZA 1HW5A 1K78A 1MJBA 1J0RA 1BI1A 2D1VA 1G6NA 1SFXA 4UV8A 4U0VA 1RI7A 1Z7UA 4LLLA 2Z9OA 1FWZA 5FFXA 2NNNA 1R22A 1RUOA 2HR3A 2ZXJA 5CYVA 3WTWC 3WTZA 2QQ9A 1BM9A 2QWWA 2PLYA 1G3TA 2NRAC 1SMYF 2QZ8A 4PDKA 1XSXA 2CG4A 4ZYHA 3C1DA 2F5EA 2F2EA 1E17A 3KE2A 1ZG3A 2YX7A 3Q9SA 2LSOA 3F6VA 3O6BB 4RGRA 2LDUA 4U0WA 5IT9K 3KEOA 2K27A 1LJ9A 4BXUA 2QLZA 3IWFA 3F8BA 5E1XA 2IPQX 2IA0A 4LD5A 3KP5A 1W4MA 4KIBA 1L0OC 3QOPA 4FT8A 2PMHA 1RZ4A 4HV5A 1V3FA 1ZN2A 3RPUA 5D5XB 5LGNA 4RGUA 1XGSA 4ZH4F 3E3VA 2H27A 1ZREA 2LNBA 3MFKA 5FLXZ 1R1TA 3DP7A 2EFQA 1EH6A 3K1NA 3IKTA 2IRFG 3EETA 2GZWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R00 A;  1GHC A;  2EFN A;  2BBY A;  4KIG A;  4HDU A;  5HS9 A;  4ZYG A;  1SD4 A;  3COA C;  5H6R A;  4KDP A;  1FX7 A;  2DT5 A;  4KNY A;  5D6E A;  1LVA A;  2YU3 A;  4L9J A;  2M1B A;  2O61 A;  1B9N A;  3KLN A;  1KA8 A;  1LEB A;  4IHS A;  4WK8 F;  3QU6 A;  3GZ6 A;  2B0L A;  3Q5F A;  1AOY A;  3WGH A;  2HQR A;  4BQA A;  2GAU A;  3K69 A;  5HVQ C;  4FX4 A;  1IXR C;  4JQF A;  4B8X A;  3R60 A;  1SD7 A;  5ILS A;  4A12 A;  1YYV A;  2H09 A;  4Q48 A;  3ECH A;  2PFB A;  2VE9 A;  1U5T B;  1GXQ A;  1EH7 A;  4LJZ F;  3FXU A;  4HX4 A;  1P92 A;  1Z6T A;  2GQQ A;  4HA8 A;  5LGT A;  4A6D A;  3HRM A;  3CUQ A;  4B09 A;  3B73 A;  4ZYD A;  2VON A;  4LMY A;  5L3D A;  2PBI A;  1USS A;  3TO9 A;  3V7C A;  4E70 A;  1RNL A;  3DF8 A;  4IXA A;  1O3S A;  4Y13 A;  2O03 A;  1R1V A;  1B6A A;  2ZNY A;  1KYW A;  2FRH A;  2VE8 A;  1H9T A;  5E18 F;  1MKM A;  3ZPL A;  4HQE A;  3F8C A;  1D5V A;  1HST A;  1CF7 B;  1XCB A;  2A6H F;  2M30 A;  3F8N A;  1FBQ A;  1YS6 A;  3BP8 A;  2ZME B;  2EFP A;  4BHP A;  5L3G A;  5FLX K;  3U2R A;  2XAQ A;  1LEA A;  2DBB A;  1J75 A;  4MHG A;  2IW5 A;  3F6O A;  3HOS A;  1ZRD A;  3IL2 A;  2YX4 A;  4RGS A;  4EQQ A;  4I98 B;  3HYI A;  2RDP A;  3GW2 A;  2M8E A;  4IRG A;  2E7W A;  2P8T A;  5D5W B;  2QBY B;  1YTY A;  3DFG A;  4RS8 A;  1ZAO A;  1U5T C;  4G6Q A;  4M73 A;  5DUI A;  2W24 A;  3V8L A;  1J2X A;  2PQ8 A;  3D0S A;  2D1H A;  2VT3 A;  3J80 Z;  3P9K A;  1MJA A;  1BN5 A;  1OMI A;  2QQB A;  4HX7 A;  5FD6 A;  3MWM A;  3GLX A;  3LFK A;  1QQI A;  3RI4 A;  3QP6 A;  2KJC A;  2VN2 A;  5E1W A;  4EGZ A;  4I09 A;  1U8R A;  4RB0 A;  4A5M A;  3KP4 A;  5DDG A;  5L3B A;  2G9W A;  3U1D A;  4AIH A;  2FMY A;  3BJA A;  4OMZ A;  5HLH A;  4MQ9 F;  3GO5 A;  3TOA A;  1C0W A;  4OIO F;  5FD5 A;  3DQV C;  2L02 A;  3AAF A;  1Z6R A;  5JFR A;  3HSE A;  5ICF A;  3IWZ A;  2STT A;  2GWR A;  2CO5 A;  2A68 F;  3KP2 A;  4M74 A;  1LQ1 A;  1STZ A;  2PG4 A;  1W7P A;  5K5Q A;  3GZ5 A;  3DPL C;  2JT1 A;  2A61 A;  2EV5 A;  2Q8K A;  1E2X A;  2DI3 A;  2BYV E;  2F5C A;  2V1D A;  3ABT A;  1ZAR A;  1MD0 A;  1Y0U A;  2K7L A;  5HDG A;  4BH9 A;  4EGY A;  2EB7 A;  4AIK A;  3EYI A;  3E5X A;  1HXD A;  5LRS A;  2MC3 A;  2R7F A;  4CHU A;  3VEP A;  3IC7 A;  3C7J A;  4CGZ A;  2PMU A;  1R58 A;  2Y48 A;  1XMK A;  3MQ0 A;  5JR3 A;  1JE8 A;  2EA4 A;  3TO7 A;  5AIQ A;  2Y75 A;  2ETH A;  2L01 A;  4P9F A;  5DUK A;  2VT2 A;  2RC4 A;  1SMT A;  3V7S A;  4ON0 A;  1PDN C;  2E1N A;  1YS7 A;  1ZRF A;  2UXN A;  1YG2 A;  3B02 A;  3BZ6 A;  1JHF A;  3WE2 A;  1AWC A;  4MGR A;  5DCF A;  2G7U A;  4HAM A;  3RYP A;  1FC3 A;  4EM0 B;  4YII A;  3QAH A;  3KFW X;  3VOD A;  1O7L A;  3FX3 A;  4N0B A;  3WG9 A;  1IW7 F;  3BRO A;  2MLK A;  3DXJ F;  4EVI A;  4BYY A;  3GYH X;  2HKX A;  3ZMZ A;  2EJR A;  1R36 A;  1J9I A;  3BWG A;  2BEO A;  1EH8 A;  1UHM A;  4HX8 A;  4MTE A;  3ZQ7 A;  3TOB A;  1F4K A;  3EDP A;  5DD4 A;  3OOP A;  2VBY A;  5E20 A;  2V79 A;  4KN4 X;  3I59 A;  1H9G A;  4DQ2 A;  1I6X A;  4HOB A;  4CZZ A;  3L9F A;  2V1X A;  3TGN A;  5LHH A;  4G7H F;  5E8I A;  1DP7 P;  2ZJ2 A;  4BHB A;  1S7O A;  1RIO H;  3TKY A;  4M9Z A;  3SHF A;  3E97 A;  4GYG A;  2VXZ A;  2RN7 A;  1T2K A;  3LAJ A;  3F8F A;  2K86 A;  2HYF A;  1MDM A;  2XVC A;  4LB6 B;  5LLQ A;  2J5P A;  4HZF A;  1LB2 A;  1QZY A;  1W5T A;  3LA2 A;  4PGG A;  4Y17 A;  3I4P A;  2BE5 F;  2HOE A;  1MZB A;  2H6B A;  4ENJ A;  3M8E A;  3E5U A;  4UHT A;  3ZMU A;  1YW8 A;  3FF5 A;  4WXH A;  5J6X A;  2XAJ A;  4L9V A;  3F72 A;  1WSU A;  4LG0 A;  1TW2 A;  4OIQ F;  2HTS A;  2ESN A;  2LF8 A;  1XMA A;  4CYD A;  4I0A A;  5J8F A;  2XUB A;  3IRR A;  4LLN A;  3BOQ A;  5HLG A;  4XRF A;  3MAJ A;  5CVI A;  1ZHF A;  2HWV A;  5DEQ A;  5DCM B;  2OZU A;  4Q4Z F;  4GXO A;  4HW0 A;  3CUQ B;  3F3X A;  4MQV A;  2IA2 A;  3I54 A;  2BGC A;  4KIF A;  2A07 F;  2P5L C;  3K2Z A;  4OIN F;  3FXR A;  3WTU C;  3IKV A;  2WTE A;  5EEG A;  5LHI A;  2CW0 F;  4I7H A;  2CFX A;  2HDC A;  5ED4 A;  4P55 A;  4HLX A;  3D5L A;  1Q1H A;  2DPU A;  1O3Q A;  2STW A;  1T0F A;  3JSO A;  1YW9 A;  2MH9 A;  2IT0 A;  2PI0 A;  3WTV C;  3HIF A;  3QPT A;  1FT9 A;  1W5S A;  2V6C A;  3RIR A;  1VTN C;  4CO8 A;  3FXQ A;  4EJO A;  1TTY A;  1JXS A;  1ZH5 A;  4GCV A;  4HF0 A;  4WF2 A;  4ETS A;  3KP6 A;  2P4W A;  2CYY A;  1G3Y A;  3EYY A;  1LNW A;  5D4R A;  4EJU A;  4U88 A;  4M6X A;  5JI6 A;  3K1P A;  2VBX A;  3GFL A;  5KK1 A;  4CDG A;  2E1C A;  3TDU C;  4EJV A;  3GWZ A;  1K6O A;  4WCG A;  3LST A;  2O3F A;  4KA4 A;  4KT5 C;  1F5T A;  2HTJ A;  4DNC A;  1FOK A;  3LWF A;  1WI9 A;  3CUQ C;  1SD6 A;  5FFZ A;  3PQK A;  2DPD A;  1P6R A;  2DO7 A;  5BQT A;  3CTA A;  3IRQ A;  2XAG A;  2G7H A;  1HSJ A;  2XKO A;  4U0Y A;  1ZRC A;  2QYO A;  1IXS B;  2FOK A;  1BC8 C;  5H6Q A;  4EJW A;  2VOO A;  2UXX A;  4U7B A;  3HOT A;  2CSO A;  3QU3 A;  5CJ9 A;  1P4X A;  2ZO4 A;  1DDN A;  2E7X A;  3ML6 A;  1OYY A;  1S8N A;  1G3S A;  3WU1 B;  4OMY A;  3J81 K;  4HBL A;  1ON2 A;  1W7P B;  3C3W A;  3CJN A;  1T98 A;  4LB5 A;  5ILV A;  4NQW A;  2OD5 A;  4I2O A;  4U7D A;  3VFZ A;  3RTR A;  1FP2 A;  1XDS A;  2X4H A;  5BOX A;  1S29 A;  4AVP A;  2FSW A;  4HF2 A;  3WGG A;  3E5Q A;  2XHK A;  4ZYE A;  4O3M A;  3LA3 A;  2F5D A;  1K79 A;  4N9I A;  1O57 A;  4L0Y B;  3ECO A;  4M6Y A;  1D3Y A;  2NYX A;  1ZG5 A;  1BJA A;  2XAF A;  4XSX F;  1ZLJ A;  4K2E A;  4KMF A;  1O3R A;  3LQQ A;  3FM3 A;  1R7J A;  3GFM A;  3T8R A;  2X0L A;  2O0Y A;  2W84 A;  2RV8 A;  4I0B A;  3H3U A;  1O7F A;  4L9T A;  3M1E A;  1B9M A;  3DPT A;  4IF4 A;  1SAX A;  3ZMD A;  1ZG1 A;  1FPQ A;  1DPU A;  1KU2 A;  3F23 A;  3GXO A;  2HYG D;  4Y15 A;  5HLI A;  5J8C A;  4AD9 A;  2MLG A;  4UVC A;  3N4M A;  3HSR A;  3RDI A;  3JTG A;  1FP1 D;  2FQ3 A;  1IN6 A;  1JHH A;  5HS8 A;  3MCZ A;  1I1G A;  4MEX F;  2EK5 A;  5CVU A;  2ZCW A;  1XSD A;  1UB9 A;  2KRF A;  2Q0O A;  3SXY A;  3NRV A;  5LRR A;  1T39 A;  1FYL A;  5D6F A;  3TO6 A;  3W6J B;  5F64 A;  1ODD A;  4AWX B;  4GGG A;  3ABU A;  2ISZ A;  4ENK A;  1TW3 A;  2ADU A;  2YR2 A;  3REO A;  2ZFW A;  2KIF A;  2R7D A;  2RNJ A;  4G94 A;  3N97 A;  1REP C;  1I27 A;  5FB2 A;  3R6S A;  2EFW A;  4ESB A;  3MZH A;  1KU7 A;  3KZY A;  4PCQ A;  3I59 B;  3T1B A;  1KU9 A;  3WTY C;  1YFH A;  3FHZ A;  1QPM A;  1A04 A;  4IVN A;  5DYM A;  2O6G E;  4AIJ A;  1R5H A;  1I5Z A;  2JPC A;  3J7A O;  1LDK B;  1Z9C A;  3MZY A;  5F1R A;  3CO6 C;  1F9N A;  2QM3 A;  1MDM B;  4JK1 X;  2HEO A;  4ENM A;  3JTH A;  1Z1D A;  2HQN A;  3DKW A;  2QVO A;  3WOD F;  3HHG A;  3LAP A;  1NHA A;  3SQN A;  4L18 B;  4P5O A;  4A5N A;  4LG0 B;  2XGX A;  4IHT A;  1K78 B;  4P96 A;  5CVR A;  5HDK A;  1XGN A;  5L3F A;  1Z91 A;  5TJJ A;  1IN8 A;  2DQR A;  1IZ1 A;  3FM5 A;  5AON A;  2M5W A;  1HKQ A;  4UNO A;  3RKW A;  2UWM A;  5DD8 A;  3KP7 A;  5CVJ A;  2CQK A;  1T38 A;  2JTV A;  2FBH A;  4IRI A;  1FLI A;  4RB3 C;  3QRF F;  3GFI A;  2A6E F;  4S04 A;  1FSH A;  2DK5 A;  2P5K A;  4NHJ A;  2DU9 A;  5LEK A;  5EEH A;  5ICE A;  4R8H A;  3ERE D;  2WWY A;  4UXN A;  1CF7 A;  3ISP A;  4S05 A;  1XSV A;  3EQL F;  4G6D A;  1DPR A;  1BIA A;  2ZME A;  3FZV A;  3L7W A;  5HDN A;  4OU0 A;  1XGM A;  4EMS A;  4A6E A;  3BJ6 A;  3I71 A;  3ZMT A;  4GO1 A;  1SD5 A;  3BJO A;  1G4D A;  2XRN A;  2OQG A;  2HZT A;  5CLS A;  1LDD A;  1MGT A;  4UV9 A;  2IA1 A;  2FXA A;  4XSZ F;  1EV7 A;  2H6C A;  5JVT A;  4L9N A;  5IT3 A;  4M71 A;  2KJB A;  1GVJ A;  1HW2 A;  2Z33 A;  5FGM A;  4YFN F;  4M9X A;  1TNS A;  3FWE A;  2XKP A;  2MBF A;  1ULY A;  3SZP A;  1OKR A;  2JZY A;  3HSF A;  2A3S A;  3HHH A;  2DK8 A;  1BI2 A;  5BMZ A;  4PZJ A;  4L5J A;  1HKT A;  1B59 A;  4LK0 F;  2WV0 A;  2FBI A;  2FEZ A;  2K02 A;  2TDX A;  2XIG A;  2DQL A;  1KU3 A;  4LK1 F;  5CVV A;  4G7O F;  2RQP A;  1BIB A;  3F8M A;  1K7A A;  1TBX A;  4HLY A;  1YW7 A;  3CDH A;  5FO5 A;  3BDD A;  1XB4 A;  1KQ8 A;  4YG2 F;  3KZZ A;  4IRH A;  1BBY A;  5D5U B;  2K4B A;  1IN7 A;  4EM1 A;  3TDZ C;  2HKO A;  2WC2 A;  3R0J A;  2QEN A;  2DFI A;  3RYR A;  4RB2 C;  3P7N A;  3E6M A;  4WX9 A;  5L3C A;  3H3Z A;  1HKS A;  1L3L A;  2DTR A;  2JRT A;  1B4A A;  3I0T A;  2HFH A;  3S2W A;  3ULQ B;  4I02 A;  3W6K B;  1B1B A;  3I53 A;  1UST A;  5DV5 A;  2ISY A;  3J81 Z;  2DAO A;  1FZP B;  4XLN F;  1MJ9 A;  1IAW A;  2P7C B;  1ONV A;  2BV6 A;  3ROU A;  3R4K A;  4R1H A;  4F7Z A;  2W85 A;  4ESJ A;  3BPX A;  1XD7 A;  4YIF A;  4Q5S F;  2LKP A;  2RKH A;  1WWX A;  5HOO A;  5H20 A;  2RGV A;  1WKM A;  4OIP F;  2P6S A;  2A5Y B;  1CGP A;  5AIP A;  3G3Z A;  4LLG F;  3NQO A;  3V8K A;  5F6F A;  2A69 F;  3K0L A;  5K1Y A;  4O6J A;  4G9Y A;  3LQR A;  1R5G A;  1FY7 A;  3V4G A;  1Z05 A;  2J5O A;  3E6D A;  3L2C A;  5TRD A;  2O8X A;  1R1U A;  2V9V A;  1U3E M;  4ENN A;  2C6Y A;  3FMR A;  4L0Z B;  4RAY A;  4M9S A;  1IXC A;  5A2Q K;  4KFC A;  3T5X A;  4UUV A;  1SFE A;  3U9G A;  2EFO A;  3GUD A;  1XGO A;  4D0P A;  3K9T A;  5ILU A;  2QUF A;  4ASN A;  3JAM K;  4BAY A;  3EUH A;  1P2F A;  1S7A A;  1PUE E;  2FML A;  4KMU X;  1QGP A;  2FNA A;  3HUG A;  4BHC A;  2VOD A;  3FMQ A;  4CXF A;  1IRG A;  2EV0 A;  2Y0M A;  2CWE A;  4RB1 A;  2KKO A;  3HRT A;  3QPH A;  1ZYR F;  2PJP A;  1YIO A;  4IPA A;  3RJP A;  1QO0 D;  3FMS A;  1OR7 A;  1X3U A;  4A2U A;  2M87 A;  1HW1 A;  5D8L B;  1UFM A;  4P9U A;  3M9A A;  2MA3 A;  2KIM A;  3HTS B;  1S6L A;  5LBQ A;  2FA5 A;  2Z3Y A;  1T6S A;  4G7Z F;  2MD5 A;  3GVA A;  2KIU A;  2AS5 F;  5DCM A;  2VBW A;  1WQ2 A;  2P7V B;  5LEJ A;  2ACJ A;  2L4M A;  1QNT A;  3O2P E;  2COM A;  3KEQ A;  1ZGJ A;  3ZN0 A;  2OU2 A;  4N9H A;  2IJL A;  3KET A;  1TQM A;  4MTD A;  4ZZD A;  3ELK A;  2EA2 A;  2FE3 A;  2YPR A;  1D8J A;  1KGS A;  1UCR A;  3RKY A;  4HV6 A;  3P9C A;  3ZP5 A;  5D5V B;  2PN6 A;  2OBP A;  2W25 A;  4H0E A;  1P4W A;  2ELH A;  2XAS A;  2K4J A;  1HBX G;  4UVA A;  3JSP A;  1OYW A;  3MEX A;  3GEZ A;  2Z99 A;  2XV4 S;  3K1M A;  1ZGA A;  1PP8 F;  4L5I A;  1GXP A;  4XLP F;  2OZ6 A;  4FHT A;  1SFU A;  4LGW A;  3TQN A;  4FX0 A;  1D8K A;  2VC0 A;  4QLC U;  3F21 A;  2IP2 A;  3Q9V A;  3VB2 A;  5ICG A;  5BS6 A;  3CUO A;  3PQJ A;  3VOE A;  3ZMV A;  3DEU A;  3JW4 A;  1G3W A;  5ICC A;  3H92 A;  2PEX A;  4MNU A;  1IRF A;  1BI0 A;  1U78 A;  2CGP A;  2XAH A;  3PFI A;  5JHU A;  2YSR A;  2IVM A;  3GX4 X;  4HYE A;  2OQR A;  2W57 A;  5ERI A;  4OIR F;  1TLH B;  1DUX C;  2OA4 A;  3ZMS A;  3WGI A;  3HRS A;  4RGX A;  5K5O A;  3M7G A;  3M8F A;  3V8J A;  4O5V A;  3BY6 A;  1FBU A;  4LFU A;  4BNC A;  3WTX C;  2L4A A;  4HQM A;  1TQI A;  6PAX A;  2ZKZ A;  1YO5 C;  1OPC A;  4WXD A;  2FNP A;  2QQA A;  3OV8 A;  2VBZ A;  1FSE A;  3CO7 C;  3HTU A;  3R61 A;  4ZZL A;  5KVR A;  1RUN A;  2EWN A;  2R3S A;  5D8K B;  2ESH A;  3GF2 A;  3E6C C;  2EV6 A;  3T8T A;  4GYI A;  1U5T A;  1R23 A;  3HRU A;  3L09 A;  3E6B A;  5E8G A;  2DW4 A;  3ZN1 A;  2AXL A;  2GXB A;  3NEU A;  1O3T A;  2HS5 A;  2ZBK A;  5LGU A;  4EV0 A;  1WRJ A;  3WE3 A;  4TV7 A;  2Q2E A;  5D4S A;  1IUY A;  3O3K A;  2V1U A;  2ZNZ A;  3C18 A;  2MH2 A;  1XDU A;  3P9I A;  3KLO A;  1FYK A;  1ON1 A;  1XN7 A;  1BI3 A;  3I64 A;  2GXG A;  3DV8 A;  1J59 A;  1IN4 A;  4JBA A;  2L54 A;  3WU0 A;  4EM2 A;  3SFZ A;  4MEY F;  1UHW A;  4WXC A;  3I5U A;  3L00 A;  1FNN A;  4WWC A;  1FBS A;  2RVC A;  4Q47 A;  2FU4 A;  3QP5 A;  3BPV A;  4KYW A;  2P6T A;  1P4A A;  4ESF A;  3WTT C;  4XBF A;  2M45 A;  1IF1 A;  3J80 K;  1XCV A;  2LF7 A;  1F1Z A;  3T0Y A;  2GA2 A;  1U2W A;  3RPQ A;  1KQ9 A;  2VOP A;  2UZK A;  1H0M A;  5BPI A;  4I01 A;  4QWQ A;  1PP7 U;  1ZLK A;  4G8X A;  4PGH A;  3IHU A;  1J7K A;  5E17 F;  4KN7 X;  3RKX A;  3G73 A;  2FF4 A;  2VC1 A;  4A0X A;  1QBJ A;  4KIC A;  4IJA A;  2QBY A;  5E1Z B;  1U6G A;  2DLL A;  5BPD A;  5IT9 Z;  2GA1 A;  3SZT A;  1BC7 C;  4EJT A;  2NNY A;  4KUM A;  2D2W A;  4CIC A;  4UVB A;  1TQP A;  4R79 A;  3I58 A;  1YLF A;  2P5V A;  2GIV A;  1HQC A;  3KCC A;  3KP3 A;  2FBK A;  4M72 A;  1BOA A;  3F22 A;  5L3E A;  3WTS C;  5HS7 A;  5K5R A;  2D45 A;  3V7R A;  1W7P D;  1V4R A;  2Z5U A;  2H94 A;  1I1S A;  1J5Y A;  1IN5 A;  1YQA A;  4Z2Y A;  1FYM A;  2NS0 A;  2NAZ A;  5A2Q Z;  1JGS A;  1LDJ A;  2L3D A;  2JSC A;  4YFX F;  2JPB A;  1QZZ A;  5LHG A;  3CLO A;  2OAZ A;  4YFK F;  4A0Y A;  3GFJ A;  4OOI A;  4HDV A;  3LA7 A;  1KYZ A;  1S3J A;  4RAZ A;  2XRO A;  1KQ0 A;  4HF1 A;  3JAM Z;  2F5F A;  3R0A A;  2HGC A;  4NB5 A;  1OYI A;  1TNT A;  4A0Z A;  1HW5 A;  1K78 A;  1MJB A;  1J0R A;  1BI1 A;  2D1V A;  1G6N A;  1SFX A;  4UV8 A;  4U0V A;  1RI7 A;  1Z7U A;  4LLL A;  2Z9O A;  1FWZ A;  5FFX A;  2NNN A;  1R22 A;  1RUO A;  2HR3 A;  2ZXJ A;  5CYV A;  3WTW C;  3WTZ A;  2QQ9 A;  1BM9 A;  2QWW A;  2PLY A;  1G3T A;  2NRA C;  1SMY F;  2QZ8 A;  4PDK A;  1XSX A;  2CG4 A;  4ZYH A;  3C1D A;  2F5E A;  2F2E A;  1E17 A;  3KE2 A;  1ZG3 A;  2YX7 A;  3Q9S A;  2LSO A;  3F6V A;  3O6B B;  4RGR A;  2LDU A;  4U0W A;  5IT9 K;  3KEO A;  2K27 A;  1LJ9 A;  4BXU A;  2QLZ A;  3IWF A;  3F8B A;  5E1X A;  2IPQ X;  2IA0 A;  4LD5 A;  3KP5 A;  1W4M A;  4KIB A;  1L0O C;  3QOP A;  4FT8 A;  2PMH A;  1RZ4 A;  4HV5 A;  1V3F A;  1ZN2 A;  3RPU A;  5D5X B;  5LGN A;  4RGU A;  1XGS A;  4ZH4 F;  3E3V A;  2H27 A;  1ZRE A;  2LNB A;  3MFK A;  5FLX Z;  1R1T A;  3DP7 A;  2EFQ A;  1EH6 A;  3K1N A;  3IKT A;  2IRF G;  3EET A;  2GZW A; 
#chains in the Genus database with same CATH topology
 1R00 A;  2E35 A;  2EFN A;  1UHS A;  1GHC A;  2BBY A;  4Y33 A;  4KIG A;  4HDU A;  4J19 A;  5HS9 A;  4ZYG A;  4P1W A;  4PJJ A;  3O8G A;  1SD4 A;  3G2B A;  3S15 J;  3COA C;  3ZQL A;  5H6R A;  4QPO A;  2R7O A;  4KDP A;  3SEQ A;  3HOV J;  2R5Y A;  1FX7 A;  2DT5 A;  4KNY A;  4CCN A;  5D6E A;  2F4I A;  2DT6 A;  5E79 C;  2GOM A;  5E3O A;  3G4S I;  1A6Q A;  5J4Y A;  1LVA A;  2X9D A;  2YU3 A;  4L9J A;  2M1B A;  1OCC H;  1F36 A;  2O61 A;  1B9N A;  3KLN A;  1KA8 A;  5J1U A;  4CA0 A;  1LEB A;  4IQ4 A;  2QKM B;  4QIW N;  4CZC A;  4IHS A;  4WK8 F;  1K4T A;  3QU6 A;  3GZ6 A;  3DPU A;  1LE8 B;  1O4X A;  2B0L A;  3Q5F A;  2DA5 A;  3L2W A;  1AOY A;  2EZH A;  4PSX A;  3WGH A;  2HQR A;  3LFU A;  1UZC A;  4XKB A;  1FOY A;  2Z16 A;  3A2K A;  1QVT A;  4BQA A;  1TP4 A;  2GAU A;  3K69 A;  5HVQ C;  4FX4 A;  1MMN A;  2VXD A;  4PSW A;  1IXR C;  4JQF A;  3HBL A;  1JUP A;  4B8X A;  2GXA A;  3R60 A;  1SD7 A;  4HNT A;  3K2A A;  2M3A A;  3SFI A;  2DMP A;  5ILS A;  4A12 A;  3N05 A;  3ONQ A;  4OAY A;  1YYV A;  1G59 A;  2H09 A;  4XLC A;  1S7E A;  4Q48 A;  4D1Q A;  3ECH A;  3MN2 A;  2PFB A;  3A4C A;  2V6E A;  2P0W A;  2VE9 A;  1H88 C;  1A5J A;  1U5T B;  1GXQ A;  4OWR B;  1EH7 A;  2IS4 A;  1MIJ A;  2VQG A;  1R4M B;  1IV6 A;  4LJZ F;  4GDF A;  3FXU A;  4HX4 A;  1P92 A;  1Z77 A;  3D5R C;  3CES A;  2CV0 A;  1Z6T A;  2GQQ A;  4HA8 A;  5IPA A;  5LGT A;  2LR8 A;  4A6D A;  3HRM A;  3CUQ A;  4B09 A;  3I4N J;  4DYQ A;  2E2I J;  3B73 A;  4ZYD A;  2VON A;  1A6I A;  4LMY A;  5L3D A;  4FQG A;  2PBI A;  1USS A;  3TO9 A;  3V7C A;  4E70 A;  5F0F A;  2Q2E B;  1RNL A;  2KL4 A;  3DF8 A;  1I3Q J;  4IXA A;  1O3S A;  1TC3 C;  1WH5 A;  3PJR A;  2K3P A;  4Y13 A;  2L7F P;  2O03 A;  1R1V A;  1B6A A;  3IAS 2;  2ZNY A;  1KYW A;  2VE8 A;  2FRH A;  1H9T A;  1WJ5 A;  1SFK A;  5E18 F;  1FMW A;  5M5Y J;  1MKM A;  4XMY A;  3ZPL A;  1OLT A;  4HQE A;  3F8C A;  3MMY B;  3L2U A;  1D5V A;  1HST A;  1CF7 B;  1XCB A;  2A6H F;  2KPM A;  3HEF A;  2CUF A;  5M5X J;  3TW6 A;  2M30 A;  4B3X A;  3F8N A;  1FBQ A;  5F0H A;  1YS6 A;  3BP8 A;  5E3N A;  2ZME B;  2EFP A;  4BHP A;  2HXO A;  5L3G A;  5FLX K;  1MNE A;  2LH9 A;  1R6R A;  3U2R A;  3CCS I;  2XAQ A;  3ZRG A;  3HGY A;  1LEA A;  3PM1 A;  2DA2 A;  2DBB A;  3G1L A;  1J75 A;  4MHG A;  2DYS H;  4HPQ A;  1TWG J;  2IW5 A;  1X58 A;  1GLN A;  3F6O A;  2F48 A;  3OYG A;  3HOS A;  1ZRD A;  5JHF A;  2K9N A;  3IL2 A;  2CUE A;  2YX4 A;  4RGS A;  1JTY A;  4EQQ A;  3S3N A;  2COB A;  4I98 B;  3HYI A;  1JKO C;  3CP2 A;  2L7M P;  2RDP A;  3GW2 A;  2M8E A;  2OCC H;  3HGG A;  3HXL A;  2E7W A;  2LMD A;  2ZSI B;  2P8T A;  4IRG A;  3CCQ I;  5D5W B;  4RA2 A;  2QBY B;  2KLO A;  1YTY A;  3DFG A;  1B72 B;  4RS8 A;  1ZAO A;  1U5T C;  3SDG A;  4G6Q A;  4M73 A;  3X2Q H;  5DUI A;  1R4N B;  5J40 A;  2W24 A;  3V8L A;  1J2X A;  2HYJ A;  2PQ8 A;  2O7O A;  3D0S A;  4XRM A;  2ZXH A;  4XON A;  2D1H A;  2VT3 A;  3J80 Z;  3P9K A;  1BJZ A;  1MJA A;  1BN5 A;  5EDN A;  1OMI A;  2QQB A;  4HX7 A;  2W48 A;  2IGO A;  5FD6 A;  3MWM A;  3TP0 A;  2XGE A;  2XPU A;  3GLX A;  3LFK A;  1QQI A;  3CCE I;  3RI4 A;  3C2B A;  1BL0 A;  3QP6 A;  3RZO J;  3A01 B;  4AYB N;  2KJC A;  1WJB A;  2VN2 A;  1P7J A;  5E1W A;  4EGZ A;  4I09 A;  1U8R A;  4RB0 A;  4A5M A;  1BR4 A;  3PIP F;  1K6Y A;  3KP4 A;  4A3B J;  2LRE A;  5DDG A;  5GTI C;  5L3B A;  2G9W A;  4ZTF A;  3U1D A;  3OS2 A;  4AIH A;  2VAS A;  2FMY A;  4EEF G;  3BJA A;  2B9S A;  4OMZ A;  5HLH A;  2CQQ A;  4LIU A;  4XK4 A;  2GLO A;  4MQ9 F;  3GO5 A;  3TOA A;  1C0W A;  5M3F J;  4B1R A;  1RPW A;  5FD5 A;  2VQC A;  3J7Y J;  3BG3 A;  2JVH A;  3CC7 I;  3DQV C;  1Y56 A;  1X2M A;  2G0E A;  2L02 A;  3CJQ B;  3AAF A;  2L9N A;  1Z6R A;  5JFR A;  1VQP I;  1DP3 A;  3HSE A;  5EGO A;  3JRF A;  5M5W J;  5ICF A;  3IWZ A;  2STT A;  2GWR A;  2CO5 A;  2XDV A;  2A68 F;  3KP2 A;  3CMY A;  1BW6 A;  1ETV A;  2ICW G;  1Y6I A;  2TCT A;  4MFE A;  4M74 A;  1LQ1 A;  1STZ A;  2PG4 A;  3WU2 C;  4A3L J;  1W7P A;  5K5Q A;  4ZC3 A;  1APL C;  3GZ5 A;  4FIS A;  3DKX A;  1B8I A;  3DPL C;  1T08 B;  2JT1 A;  2A61 A;  4AYB A;  2EV5 A;  2Q8K A;  2DOA A;  1E2X A;  3D5S C;  2DI3 A;  2X1D A;  1NG6 A;  2BYV E;  2F5C A;  2V1D A;  2YS9 A;  3ABT A;  3OS0 A;  2ID3 A;  3HPH A;  2W7N A;  3FHN A;  1ZAR A;  2QKL B;  3KZI C;  2CQX A;  1MD0 A;  1QVU A;  1Y0U A;  2K7L A;  4I99 C;  5HDG A;  4BH9 A;  4EGY A;  2EB7 A;  4AIK A;  3EYI A;  3E5X A;  1HXD A;  2MSY A;  5LRS A;  2MC3 A;  2R7F A;  3DLA A;  4CHU A;  3VEP A;  5FRN A;  1VQM I;  2R4G A;  3PL8 A;  4UUT A;  1GT0 C;  3IC7 A;  4HSR A;  3C7J A;  2GM4 A;  4CGZ A;  1IRZ A;  4F55 A;  4BDZ A;  3OYC A;  5FRO A;  2Y48 A;  1R58 A;  2PMU A;  1XMK A;  3MQ0 A;  5JR3 A;  2Y9Z A;  1VQN I;  5FKL A;  1JE8 A;  2AXT C;  2L9R A;  2EA4 A;  3TO7 A;  2LKX A;  3LL7 A;  5AIQ A;  2Y75 A;  4E7L A;  2ETH A;  2HPM A;  2L01 A;  4P9F A;  2M0M A;  5DUK A;  2VT2 A;  2RC4 A;  1SMT A;  2IAI A;  3V7S A;  4Y52 J;  4ON0 A;  1PDN C;  5GAD J;  1QHH D;  2E1N A;  1YS7 A;  2AQE A;  1ZRF A;  2DJI A;  3MVP A;  2UXN A;  1YG2 A;  3B02 A;  4M3B A;  3JRE A;  3BZ6 A;  3GLL A;  5C4X J;  1JHF A;  2Y9Y A;  3WE2 A;  1XTA A;  3OYJ A;  1X19 A;  1AWC A;  4MGR A;  5DCF A;  4F93 B;  2G7U A;  4HAM A;  3RYP A;  5GAH J;  3AG1 H;  1FC3 A;  3PSF A;  4EM0 B;  1ITY A;  5KAF C;  3FBN B;  1Y1V J;  2HI3 A;  1POG A;  2OPT A;  4BUP A;  5IYD J;  1YJ9 I;  4YII A;  2QSH X;  3QAH A;  2M4K A;  3KFW X;  3VOD A;  1O7L A;  3FX3 A;  4IQJ A;  2BHZ A;  4N0B A;  3WG9 A;  1IW7 F;  3BRO A;  2KFD A;  5HOD A;  2MLK A;  3DXJ F;  4EVI A;  2NS8 A;  1N75 A;  4BYY A;  2BW3 A;  4LIT A;  3GYH X;  2HKX A;  3ZMZ A;  3BC8 A;  2EJR A;  3GTM J;  3M1C A;  1R36 A;  1J9I A;  3BWG A;  2BEO A;  2F6C A;  4CCL A;  2E5N A;  4BE2 A;  2EPF A;  4RAF A;  3O8H A;  3AKZ A;  3VPR A;  1EH8 A;  3TED A;  1UHM A;  3C2H A;  3KIO A;  2L9V A;  4HX8 A;  4BEH B;  4MTE A;  1MMS A;  4BBR J;  2XF7 A;  4ZYA A;  1SC7 A;  2BVM A;  4FET A;  3FXO A;  3FXK A;  3ZQ7 A;  3TOB A;  1F4K A;  1TWC J;  2XF5 A;  2KMU A;  1T8I A;  3EDP A;  2VJJ A;  3VYT B;  5DD4 A;  2FD5 A;  1Z21 A;  3OOP A;  1I39 A;  2VBY A;  2JJ7 A;  1YIT I;  5E20 A;  2V79 A;  4KN4 X;  3I59 A;  3PUB A;  1H9G A;  4ZDO A;  4DQ2 A;  1I6X A;  4N4O B;  4RBO A;  2NVQ J;  4HOB A;  4CZZ A;  2KIQ A;  3L9F A;  1W36 D;  2V1X A;  3TGN A;  5LHH A;  3ZCO A;  4G7H F;  1OCO H;  5E8I A;  1CQT A;  3MKW B;  2ZJ2 A;  4BHB A;  1S7O A;  1DP7 P;  2R5Y B;  1RIO H;  3TKY A;  4M9Z A;  3SHF A;  1MH3 A;  3E97 A;  4GYG A;  4J00 A;  2VXZ A;  3HUG B;  1YX5 A;  1SEU A;  4BXF A;  1IUF A;  2RN7 A;  3CMM A;  2LOO A;  3LAJ A;  1T2K A;  3F8F A;  5LD2 C;  2K86 A;  2HXI A;  1A36 A;  2HYF A;  4Z6Y A;  1MDM A;  2XVC A;  4LB6 B;  3HC7 A;  5LLQ A;  2J5P A;  4HZF A;  1LB2 A;  3DTK A;  1QZY A;  2QGU A;  1W5T A;  3LA2 A;  4AU7 A;  4PGG A;  3K4J A;  2RRE A;  3CC4 I;  1QU3 A;  4Y17 A;  2XC7 A;  1MBF A;  3I4P A;  5EZG A;  3BQZ A;  2BE5 F;  4CYC A;  2HOE A;  1MZB A;  2H6B A;  4ENJ A;  1JKP C;  1OCT C;  3M8E A;  3E5U A;  4UHT A;  1R49 A;  3J7A Y;  2R7Z J;  3U1K A;  3ZMU A;  4DBR A;  1YW8 A;  3FF5 A;  4WXH A;  4UUS B;  3G6E I;  4LG3 A;  5J6X A;  2XAJ A;  2V9K A;  4L9V A;  3F72 A;  1IRX A;  1WSU A;  3HL2 A;  4LG0 A;  1TW2 A;  4OIQ F;  2HTS A;  2ESN A;  2LF8 A;  4IX7 A;  1XMA A;  4CYD A;  2JQ7 A;  4I0A A;  5J8F A;  2XUB A;  1OQY A;  4XQF A;  1PVE A;  3IRR A;  3QOD A;  3W2V A;  4LLN A;  1YRN A;  2CFO A;  1WPK A;  1OJL A;  3BOQ A;  2WBM A;  5HLG A;  5LFA A;  4A3M J;  2V9P A;  4XRF A;  3MAJ A;  5CVI A;  1ZHF A;  2HWV A;  2DJN A;  4F52 A;  5DEQ A;  2M9H A;  5DCM B;  1U9O A;  2OZU A;  4Q4Z F;  4FTH A;  3S2H J;  4GXO A;  4HW0 A;  3Q0V A;  3CUQ B;  3CCM I;  3F3X A;  1JI8 A;  5EYR A;  4E4H A;  4MQV A;  2IA2 A;  2NOJ B;  2BGC A;  3I54 A;  1D5Y A;  4KIF A;  2A07 F;  2P5L C;  2DA6 A;  3K2Z A;  3ZXS A;  3VSL A;  4OIN F;  3FXR A;  3WTU C;  2K40 A;  3IKV A;  2WTE A;  3FXJ A;  3K4C A;  3M07 A;  5EEG A;  5LHI A;  5M3M J;  2CW0 F;  4I7H A;  1UMQ A;  2V4J C;  2CFX A;  2HDC A;  1RKT A;  5FLM J;  3I3L A;  5ED4 A;  5KAI C;  4P55 A;  4HLX A;  1FOW A;  3D5L A;  1Q1H A;  2DPU A;  1O3Q A;  2STW A;  3GTQ J;  1T0F A;  3JSO A;  3S14 J;  1YW9 A;  1JUM A;  2MH9 A;  2E19 A;  3GCM A;  1NG7 A;  1YJN I;  1ORK A;  4QSH A;  2IT0 A;  5GP9 A;  3WTV C;  2PI0 A;  1JKR C;  3HIF A;  1K61 A;  3QPT A;  1FT9 A;  1W5S A;  2V6C A;  2IS1 A;  3RIR A;  3BR1 A;  3H5N A;  1D1B A;  3OR2 C;  4XLE A;  1VTN C;  3DKY A;  4CUG A;  4NBQ A;  4CO8 A;  3FXQ A;  1EA3 A;  1ENH A;  1X2N A;  2B7E A;  4EJO A;  3OYN A;  1GUU A;  4RLF A;  1TTY A;  2KZG A;  1JXS A;  3U21 A;  3ZGK A;  1ZH5 A;  2E2J J;  3FKI J;  4XOR A;  3ZR8 X;  1G8X A;  1K4S A;  3QYB A;  4GCV A;  4HF0 A;  4BY7 J;  2GBY A;  4WF2 A;  3V42 A;  3BCB A;  1E0E A;  4ETS A;  2MW8 A;  3KP6 A;  3P5J A;  5DM7 F;  2P4W A;  3G1M A;  3L1P A;  2CYY A;  1G3Y A;  3EYY A;  1LNW A;  1VI0 A;  1U9N A;  2VQH A;  2OV7 A;  4D5C A;  5D4R A;  4EJU A;  1YOV B;  3OYB A;  3HKZ A;  4Y7N J;  4U88 A;  3OYH A;  4M6X A;  5JI6 A;  3K1P A;  2AO9 A;  2VBX A;  3DBR B;  3GFL A;  5KK1 A;  4CDG A;  2EBI A;  1A35 A;  2E1C A;  2LY1 A;  2IGM A;  3TDU C;  5DS9 A;  4EJV A;  4M3D A;  3GWZ A;  2EZK A;  2XGC A;  5J47 A;  4WCG A;  1K6O A;  2HOS A;  3BG6 A;  1VND A;  3LST A;  2O3F A;  4KA4 A;  4KT5 C;  4JYK A;  2VQL A;  4DYR A;  1F5T A;  2VUM J;  2HTJ A;  3H1C A;  3S16 J;  4DNC A;  1FOK A;  3LWF A;  2M4G A;  4KJZ A;  3S1R J;  1WI9 A;  3CUQ C;  3G71 I;  1SD6 A;  2VKH A;  5FFZ A;  3QPL A;  3PQK A;  4XLF A;  1ZQ3 P;  2DPD A;  3B6A A;  1P6R A;  3WHB A;  2R7U A;  1ZEL A;  3ABK H;  2DO7 A;  5BQT A;  3CTA A;  5IYC J;  3IRQ A;  2XAG A;  2G7H A;  1X1A A;  2GOX B;  1UG2 A;  2CV2 A;  1HSJ A;  2XKO A;  3PSI A;  2KHM A;  4U0Y A;  1ETX A;  1ZRC A;  2QYO A;  1IXS B;  5EG0 B;  2L7Z A;  2FOK A;  2E5Z A;  4BQQ A;  4CH7 A;  1BC8 C;  5H6Q A;  4EJW A;  2VOO A;  4BAC A;  2UXX A;  4U7B A;  3H35 A;  3HOT A;  2CSO A;  3QU3 A;  3I55 I;  1BA5 A;  5CJ9 A;  1P4X A;  2ZO4 A;  2QF7 A;  3OIP A;  2X1E A;  1DDN A;  3BG5 A;  2E7X A;  3ML6 A;  1OYY A;  3IH2 A;  2CU7 A;  1I50 J;  2XF6 A;  5IOY A;  1HA8 A;  1VQ5 I;  2VPL A;  1S8N A;  3CCJ I;  1D0Z A;  3BR5 A;  4BL0 B;  1G3S A;  3WU1 B;  2L5Q A;  4OMY A;  3ZQI A;  2CQN A;  3J81 K;  3K10 A;  4HBL A;  2WA0 A;  1ON2 A;  1HOM A;  1W7P B;  4FCY A;  3C3W A;  3CJN A;  1T98 A;  3K70 D;  3PNT A;  3OWT A;  2GIZ A;  1AKH A;  4LB5 A;  4EAT A;  2LY9 A;  2MD0 A;  5ILV A;  4NQW A;  1WFX A;  2OD5 A;  4I2O A;  4U7D A;  2JN6 A;  3VFZ A;  3ZQC A;  3RTR A;  1FP2 A;  3OSG A;  4C2M J;  4BS9 A;  1XDS A;  2X4H A;  1D1C A;  3A02 A;  1OIS A;  5BOX A;  1S29 A;  4AVP A;  2OTJ I;  2FSW A;  2CH0 A;  4HF2 A;  3I9V 2;  2XRL A;  2BOL A;  3WGG A;  2MYS A;  3E5Q A;  2XHK A;  4ZYE A;  1J09 A;  4O3M A;  3LA3 A;  2F5D A;  1K79 A;  4N9I A;  2BY0 A;  2D5V A;  1O57 A;  1VQ6 I;  4E7K A;  4L0Y B;  3QPS A;  3ECO A;  4M6Y A;  1D3Y A;  2NYX A;  1ZG5 A;  1NH3 A;  1BJA A;  2XAF A;  2WV1 A;  4IEJ A;  4XSX F;  4JOM A;  1ZLJ A;  4K2E A;  4KMF A;  1O3R A;  1ETW A;  2OJE D;  3LQQ A;  3DWL E;  3FM3 A;  2FOW A;  3RSN A;  1R7J A;  3GFM A;  3UNG C;  4BJ6 C;  5TIS C;  3T8R A;  4A3E J;  4DYC A;  3FXM A;  3CP8 A;  2E36 A;  2X0L A;  4B48 A;  5FKO A;  2O0Y A;  2W84 A;  2RV8 A;  1ERD A;  4I0B A;  3H3U A;  2XPV A;  1O7F A;  2I10 A;  3M1E A;  1B9M A;  4L9T A;  1IG7 A;  4A3G J;  2E1M C;  2NVY J;  3DPT A;  4IF4 A;  4XLA A;  1SAX A;  1UAA A;  1BR1 A;  4FE4 A;  3ZMD A;  2JK3 A;  4W97 A;  3BQY A;  4BDY A;  4RLQ A;  5JLX A;  1ZG1 A;  1FPQ A;  1DPU A;  1KU2 A;  3F23 A;  3GXO A;  2HYG D;  4F91 B;  4Y15 A;  4XID A;  5FKM A;  3G1O A;  3DTI A;  5HLI A;  1JT6 A;  4KIT B;  5J8C A;  4AD9 A;  2VB6 A;  2LD5 A;  1FEX A;  2MLG A;  4UVC A;  3LSP A;  3N4M A;  3HSR A;  4XN0 A;  1X4P A;  3RDI A;  4C2T A;  2ELK A;  2EIK H;  3JTG A;  1FP1 D;  2FQ3 A;  3M4O J;  2PJR B;  1IN6 A;  1JHH A;  4CCO A;  2DOF A;  4B3A A;  5HS8 A;  3MCZ A;  1I1G A;  4CSW A;  4MEX F;  2EK5 A;  5CVU A;  2OC6 A;  2ZCW A;  1XSD A;  4YIR X;  1UB9 A;  2KRF A;  2Q0O A;  3SXY A;  2BW3 B;  3NRV A;  3HOX J;  1SAN A;  5LRR A;  4IO9 F;  1T39 A;  4PJM A;  1FYL A;  5D6F A;  1DQU A;  3TO6 A;  3W6J B;  2R7T A;  1DU0 A;  5F64 A;  1ODD A;  4AWX B;  4GGG A;  1QPI A;  1I6H J;  3ABU A;  2ISZ A;  4J01 A;  4ENK A;  1TW3 A;  2ADU A;  1X1D A;  1X1B A;  2YR2 A;  4XNF A;  3REO A;  4XR6 A;  4C30 A;  2ZFW A;  4NC6 A;  2KIF A;  1YIJ I;  1MND A;  2R7D A;  2RNJ A;  4G94 A;  1NTC A;  3N97 A;  2K9L A;  1REP C;  5E3L A;  1I27 A;  5FB2 A;  3R6S A;  2EFW A;  4ESB A;  3MZH A;  2DCE A;  1ETO A;  1P9Q C;  1RES A;  4AID A;  2M34 A;  4XLH A;  1KU7 A;  2ZJR F;  4C2U A;  3KZY A;  4PCQ A;  3I59 B;  3AG3 H;  3T1B A;  3CCL I;  1KU9 A;  1MH4 A;  2ZXW H;  3F0C A;  3WTY C;  3AG4 H;  3UKG A;  3LSK A;  1YFH A;  3FHZ A;  1LUJ B;  2EIM H;  1QPM A;  1A04 A;  4IVN A;  5DYM A;  2O6G E;  4AIJ A;  2LC2 A;  1R5H A;  3NWS A;  1I5Z A;  4HST A;  2JPC A;  3L2R A;  3J7A O;  2XSD C;  1MNM C;  3IAM 2;  3EPZ A;  1Z0X A;  2MAB A;  1QHG A;  1LDK B;  1Z9C A;  5FLV A;  3QQA A;  1PJR A;  3MZY A;  4PJ0 C;  2HDW A;  2E1O A;  3WHC A;  5F1R A;  1ZR4 A;  2LTP A;  3CO6 C;  3BTL A;  1F9N A;  2LKS A;  2XAU A;  3KX2 A;  2QM3 A;  1MDM B;  2H8R A;  3BR2 A;  4JK1 X;  2HEO A;  2BXY A;  4ENM A;  5FKN A;  1AU7 A;  3JTH A;  4M3F A;  3QWL A;  1Z1D A;  1MBE A;  5J1Y A;  1SFO J;  2HQN A;  4NNJ A;  2R5Z A;  1VFC A;  2V26 A;  3OSF A;  3DKW A;  2QVO A;  2ZFU A;  3BR6 A;  3WOD F;  1LPQ A;  4F92 B;  4GFB A;  3HHG A;  1UEL B;  3LAP A;  4D7M A;  9ANT A;  4ANJ A;  1NHA A;  3SYT A;  3SQN A;  4Y4R A;  1YHQ I;  3VWB A;  2WB1 N;  3HZJ A;  2N8G A;  3E7L A;  2ZJP F;  2AQF A;  4L18 B;  4P5O A;  1WJF A;  4A5N A;  4LG0 B;  2LFB A;  5E3M A;  2XGX A;  4IHT A;  1K78 B;  5H2F C;  5KHD A;  4P96 A;  2ZC2 A;  5CQE A;  5CVR A;  5HDK A;  5EZH A;  1XGN A;  1FMV A;  5L3F A;  2QSG X;  3TW7 A;  1A31 A;  2DOD A;  3LSH A;  5GPA A;  1Z91 A;  2FUG 2;  5TJJ A;  1BR2 A;  2DFF A;  4DGW B;  1IN8 A;  2DQR A;  1IZ1 A;  3FM5 A;  5AON A;  2M5W A;  4HNU A;  1HKQ A;  4XKC A;  4UNO A;  3RKW A;  3FKJ A;  1FJL A;  2UWM A;  2JA5 J;  5DD8 A;  3KP7 A;  3KEY A;  2IGK A;  5CVJ A;  2CQK A;  2NOG A;  1T38 A;  2JTV A;  2FBH A;  4IRI A;  1FLI A;  1N77 A;  3S3O A;  4M3G A;  1ZK8 A;  4XKW A;  4RM2 A;  4RB3 C;  1Y0N A;  2NXN B;  3RCO A;  3QRF F;  4FE7 A;  2LBF A;  1U8B A;  3GFI A;  2I8D A;  2A6E F;  2X6W A;  2R0Q C;  4II2 A;  4S04 A;  1FSH A;  2DA4 A;  1D1A A;  2DK5 A;  1WVR A;  3MKL A;  3SDB A;  2X1C A;  1EJ9 A;  2P5K A;  2WB1 A;  2HVR A;  4E7S A;  4NHJ A;  3E0J B;  2A6T A;  2DU9 A;  1WJA A;  5LEK A;  5EEH A;  3MKY B;  5ICE A;  4ZDL A;  2VL8 A;  4R8H A;  3ERE D;  2YUS A;  3IUO A;  4UXN A;  2WWY A;  1CF7 A;  5FKK A;  5GAG J;  3OIQ A;  3ISP A;  3M8J A;  4S05 A;  2M2E A;  1XSV A;  3S32 A;  1RET A;  3EQL F;  1IJW C;  4G6D A;  2DDA A;  2H1L A;  4E7I A;  4OIO F;  1DPR A;  1BIA A;  2ZME A;  3FZV A;  3L7W A;  5HDN A;  4OU0 A;  1XGM A;  2Y0S N;  1QA6 A;  5K7Z A;  4EMS A;  4A6E A;  3BJ6 A;  3I71 A;  4LIV A;  2XB5 A;  3MZ8 A;  4MIM A;  4GO1 A;  3ZMT A;  1ZR2 A;  3BR0 A;  3DCF A;  1SD5 A;  1RR7 A;  3BJO A;  3AL0 C;  1G4D A;  2XRN A;  4V2G A;  2OQG A;  3HM5 A;  3B6C A;  2RAE A;  5FRM A;  2X48 A;  2HZT A;  1R5I D;  5CLS A;  1W0U A;  1LDD A;  1MGT A;  2K85 A;  4UV9 A;  2IA1 A;  2FXA A;  1HDD C;  2VJ4 A;  4PJL A;  4XSZ F;  1EV7 A;  3FDY A;  2H6C A;  2DMN A;  2HQA A;  4QPQ A;  5JVT A;  2EZL A;  2VLA A;  2CMP A;  1JKQ C;  4L9N A;  5IT3 A;  1LVK A;  2KJB A;  4M71 A;  4YRV A;  1VQ9 I;  1GVJ A;  1HW2 A;  1MMA A;  1RC9 A;  2Z33 A;  5FGM A;  4YFN F;  2AHQ A;  2W4S A;  4M9X A;  3OS1 A;  1TNS A;  3FWE A;  2ZXI A;  2XKP A;  2MBF A;  1HLV A;  1SVL A;  1H89 C;  1ULY A;  3SZP A;  1OKR A;  2JZY A;  4D9J A;  3NAR A;  3HSF A;  2CS3 A;  3TP3 A;  1FIA A;  2A3S A;  3HHH A;  1ZKG A;  2DK8 A;  1BI2 A;  2HZD A;  5B3S H;  5BMZ A;  3GTL J;  4PZJ A;  4L5J A;  1HKT A;  1B59 A;  4E7Z A;  2Y0S A;  1MBK A;  4X1E A;  4LK0 F;  2O5R A;  2BHY A;  2FBI A;  2WV0 A;  2FEZ A;  2K02 A;  2TDX A;  5F1J A;  3A01 A;  4XN3 A;  4A69 C;  2XIG A;  2DQL A;  3JR9 A;  1KU3 A;  4LK1 F;  4HNV A;  5CVV A;  3LOC A;  4G7O F;  4W1U A;  2DA3 A;  1BIB A;  2RQP A;  3F8M A;  3Q0W A;  4OAZ A;  2ID6 A;  1TBX A;  5C4J J;  3SJM A;  4A3F J;  1K7A A;  1NK3 P;  4N4N B;  1ETK A;  4BJ5 C;  4PK4 A;  4UY8 I;  2W00 A;  3ESW B;  4HLY A;  3OYF A;  2L7K A;  1X1P A;  1YW7 A;  2EZI A;  3CDH A;  5FO5 A;  4X6A J;  2KRC A;  3BDD A;  3ERM A;  3H9Q A;  1T0F C;  4DZJ A;  3BTI A;  3ZQH A;  3HOZ J;  4BGD A;  2F4M B;  1XB4 A;  2VJI A;  3BZK A;  3L2Q A;  3A03 A;  1KQ8 A;  2BXZ A;  2LY2 A;  3SZG A;  4YG2 F;  3KZZ A;  4IRH A;  4C3H J;  3CQZ J;  1BBY A;  5D5U B;  2K4B A;  2LG4 A;  4A3I J;  3JCU C;  3ZQQ A;  1DGW Y;  5IP7 J;  1HDP A;  3RZD J;  1EF4 A;  4XOP A;  2XPW A;  4YEJ A;  3HB9 A;  1IN7 A;  1PYV A;  2NS7 A;  4EM1 A;  3VYU B;  3TDZ C;  2HKO A;  3DEW A;  2WC2 A;  3R0J A;  2Z2S B;  1WJC A;  2DFI A;  2QEN A;  1KON A;  3RYR A;  1AKH B;  4RB2 C;  4MO7 A;  5DTD A;  3P7N A;  3LSM A;  3E6M A;  4WX9 A;  5L3C A;  1DU6 A;  3H3Z A;  1HKS A;  1L3L A;  2DTR A;  2JRT A;  3S1N J;  2FX0 A;  1B4A A;  1VQ4 I;  3I0T A;  2EIL H;  3OIO A;  2HFH A;  3S2W A;  2ECC A;  2VKE A;  1FIP A;  4JP0 A;  3ULQ B;  4I02 A;  3OMY A;  3W6K B;  1X4O A;  3JRH A;  1B1B A;  3NWT A;  3I53 A;  3S93 A;  1UST A;  1ZTR A;  5DV5 A;  5B5E C;  2ISY A;  3J81 Z;  3QOE A;  2NVT J;  2DAO A;  1FZP B;  1YX3 A;  2BVL A;  3S17 J;  4DW6 A;  4F3Q A;  2OF7 A;  2JA7 J;  1IC8 A;  3HKZ N;  4DOZ A;  3KYD B;  1MJ9 A;  4XLN F;  1IAW A;  2P7C B;  1ONV A;  2X6O A;  3K4B A;  5CQG A;  2BV6 A;  3FIW A;  1Z67 A;  2Y2Z A;  3BR3 A;  3R4K A;  3ROU A;  4CCJ A;  4R1H A;  4F7Z A;  2DDB A;  2W85 A;  3W3C A;  2ELJ A;  4ITV A;  4ESJ A;  3BPX A;  1XD7 A;  3OL4 A;  1V5F A;  4YIF A;  4HG2 A;  2JWT A;  4Q5S F;  2LKP A;  3IH4 A;  2RKH A;  1WWX A;  5HOO A;  2O9L A;  4PFP A;  2KQR A;  5H20 A;  2Y69 H;  2RGV A;  1XMX A;  3H0G J;  1MSE C;  1WKM A;  2LK2 A;  4OIP F;  5DM6 F;  2P6S A;  3PIO F;  1QRY A;  2A5Y B;  3TMO A;  5BNG A;  1CGP A;  3HG9 A;  5AIP A;  2HDD A;  3G3Z A;  4LLG F;  2CRG A;  3ABM H;  1E3P A;  3NQO A;  4V19 K;  1GV2 A;  3V8K A;  1MSF C;  5F6F A;  2A69 F;  1M1E B;  4KIS A;  3K0L A;  3LSG A;  2DMU A;  3GTJ J;  2HQ5 A;  3CCR I;  2NVX J;  5K1Y A;  4O6J A;  2CV1 A;  4G9Y A;  4XKV A;  2R7W A;  3LQR A;  2R92 J;  2HOT A;  5FJ8 J;  1GVD A;  2CUJ A;  3K4M A;  1R5G A;  1FY7 A;  2M8G X;  1XG1 A;  5TGT A;  2JRM A;  3V4G A;  1Z05 A;  2J5O A;  4IL6 C;  3E6D A;  3WG7 H;  3W6V A;  2QCO A;  2P81 A;  3L2C A;  4B4C A;  4M6V A;  3CLQ A;  5TRD A;  3GTP J;  4UB6 C;  2O8X A;  1R1U A;  2V9V A;  1U3E M;  1OR7 C;  2VIX A;  4ENN A;  2C6Y A;  3FMR A;  4L0Z B;  5HNH A;  4RAY A;  4M9S A;  1IXC A;  1ETY A;  2EH3 A;  5A2Q K;  1Q1V A;  4ZJZ A;  4KFC A;  3JRC A;  3JRA A;  1FTZ A;  3T5X A;  4UUV A;  2K3F A;  4JX5 A;  3I4M J;  2R93 J;  1LFU P;  3EUK L;  1ZGW A;  1SFE A;  3OYI A;  1T95 A;  1WZ2 A;  3U9G A;  3M3Y J;  2EFO A;  5J4V A;  3GUD A;  3D1N I;  1XGO A;  4I76 A;  3BLY A;  2E1M B;  4C9Y A;  2I5U A;  3S3M A;  3DTE A;  4D0P A;  3K9T A;  2DT7 B;  5ILU A;  2QUF A;  4ASN A;  3BG9 A;  3JAM K;  4BAY A;  1V54 H;  2MFZ A;  3BT9 A;  2HU9 A;  2WAD A;  3EUH A;  1P2F A;  1S7A A;  1PUE E;  2FML A;  4KMU X;  1QGP A;  2FNA A;  2K9S A;  3HUG A;  4BHC A;  2VOD A;  3LSJ A;  4B47 A;  3FMQ A;  4CXF A;  3UR3 C;  1IRG A;  3PFY A;  5KNL A;  1H8A C;  1E3H A;  1Y1W J;  2LP0 A;  5EGO B;  2EV0 A;  2DTZ A;  2Y0M A;  2E71 A;  2CWE A;  4RB1 A;  4DZP A;  2FJ1 A;  2W1O A;  2KKO A;  1VF9 A;  3HRT A;  2R5Z B;  2H1K A;  3QPH A;  1ZYR F;  2IXS A;  4NDL A;  2PJP A;  1YIO A;  1D0Y A;  1JT0 A;  2WAQ N;  3HJE A;  3BG7 A;  4UB8 C;  1LFB A;  4IPA A;  4G12 A;  3RJP A;  1B8I B;  1QO0 D;  3JRB A;  1RKW A;  4HRI A;  3FMS A;  2WAF A;  2KDO A;  4D5F A;  1OR7 A;  4CCK A;  1X3U A;  4A2U A;  4UUS A;  1QZE A;  2DOE A;  3OYE A;  4IOA F;  2M87 A;  1HW1 A;  3CME I;  5D8L B;  1V5E A;  1UFM A;  1JUS A;  3RQ4 A;  4P9U A;  2DYR H;  3CJT B;  1IGN A;  3H3V K;  3M9A A;  2MA3 A;  2KIM A;  1LKX A;  5B66 C;  3HTS B;  1S6L A;  5LBQ A;  2FA5 A;  2Z3Y A;  1T6S A;  4G7Z F;  2LYC A;  2MD5 A;  3I56 I;  2IS2 A;  1JJ6 C;  3GVA A;  4BKX A;  3CF5 F;  2KIU A;  1NK2 P;  2AS5 F;  5DCM A;  2VBW A;  1PUF A;  1WQ2 A;  2P7V B;  5LEJ A;  2ACJ A;  3H5A A;  2L4M A;  1QNT A;  2JMW A;  3O2P E;  3CMA I;  1N25 A;  1I3A A;  2CW8 A;  1XPX A;  2COM A;  4IOC F;  3KEQ A;  2E60 A;  2LBF B;  1ZGJ A;  3OR1 C;  3IV5 A;  3ZN0 A;  3CJR B;  4RAG A;  2OU2 A;  2KRH A;  2WAQ A;  4N9H A;  2EQR A;  2ME0 A;  2IJL A;  5K7F A;  3FIS A;  3KET A;  1TQM A;  3KYC B;  1P7I A;  4MTD A;  4ZZD A;  1AHD P;  3ELK A;  1UG0 A;  2EA2 A;  2FE3 A;  2YPR A;  1D8J A;  1KGS A;  1UCR A;  3RKY A;  3K7A J;  4C3J J;  1T33 A;  2Z1D A;  4HV6 A;  4YEL A;  4D7N A;  1Y39 A;  1HCR A;  3P9C A;  3ZP5 A;  1LFP A;  1WGX A;  5D5V B;  3DLL F;  3RPU D;  2DA7 A;  2PN6 A;  2DFE A;  2OBP A;  2W25 A;  4H0E A;  3QYE A;  1P4W A;  1JJ8 C;  3OL3 A;  2ELH A;  2XAS A;  2X85 A;  1YI2 I;  2K4J A;  2QEX I;  4JX6 A;  1YE9 A;  1HBX G;  4UVA A;  3LSI A;  3ABL H;  1OYW A;  3JSP A;  3MEX A;  3GEZ A;  1TZL A;  4PUS A;  2Z99 A;  2Y30 A;  3FBI B;  3FK7 A;  2ZSH B;  4A3C J;  2R7R A;  3K6G A;  1W36 C;  2XV4 S;  3K1M A;  1ZGA A;  1PP8 F;  4L5I A;  1GXP A;  1ACI A;  4XLP F;  3JRI A;  4ZTJ A;  1TT5 B;  3CC2 I;  4U87 A;  2M7B A;  2OZ6 A;  4FHT A;  1SFU A;  3CCV I;  2FQ4 A;  3H5R A;  4LGW A;  3TQN A;  1W1W E;  1IV8 A;  1BW5 A;  2VKV A;  4FX0 A;  1D8K A;  3H0D A;  2VC0 A;  4QLC U;  1V5G A;  3BCA A;  3F21 A;  2IP2 A;  3Q9V A;  3VB2 A;  2B63 J;  2BY3 A;  5ICG A;  5BS6 A;  3CUO A;  3PQJ A;  3VOE A;  3ZMV A;  3DEU A;  4MLO A;  2IEK A;  2ZJQ F;  3JW4 A;  3PUF A;  3VDX A;  1FOX A;  1G3W A;  4DJA A;  2XSJ C;  4ZDP A;  3HDD A;  3PNV A;  2XB0 X;  1HF0 A;  2EIN H;  5ICC A;  5IP9 J;  1OCP A;  1T56 A;  3H92 A;  1VQ7 I;  2PEX A;  3DU5 A;  1VQO I;  4MNU A;  1IRF A;  1BI0 A;  4DIQ A;  4I6Z A;  1U78 A;  2CGP A;  2XAH A;  2JA2 A;  2MGQ A;  3PFI A;  1D0X A;  2UUZ A;  2R7X A;  5JHU A;  2YSR A;  4M3E A;  1TWH J;  2IVM A;  3GX4 X;  3TBI A;  4HYE A;  2K5C A;  2OQR A;  2W57 A;  5ERI A;  4OIR F;  3CD6 I;  2HOA A;  1TLH B;  2V7F A;  4ABZ A;  4NUB A;  2L9S A;  5B1A H;  3LSR A;  1DUX C;  3DBH B;  4BU2 A;  2X51 A;  3CZ6 A;  2OA4 A;  3ZMS A;  3CCU I;  3WGI A;  2NVU B;  3GZN B;  2OUM A;  3HRS A;  5EG0 A;  1K83 J;  1BOB A;  4RGX A;  5K5O A;  3M7G A;  3M8F A;  3QYF A;  3H9G A;  3V8J A;  4O5V A;  4A93 J;  1LE8 A;  1MBJ A;  3BY6 A;  4XRS A;  1FBU A;  4LFU A;  3AL0 B;  5F0C A;  4BNC A;  4IHY A;  2UV1 A;  3KPH A;  3WTX C;  2CJJ A;  2L4A A;  4HQM A;  1TQI A;  4CYC B;  2BY2 A;  2IGN A;  4PJN A;  6PAX A;  2ZKZ A;  1VZ0 A;  1YO5 C;  4XL9 A;  1OPC A;  3IP4 B;  4WXD A;  2FNP A;  5CKT A;  4IHW A;  2QQA A;  1Z7L A;  2HPI A;  3OV8 A;  2VBZ A;  1FSE A;  3CO7 C;  2ZME C;  2CQ7 A;  2KT0 A;  3HTU A;  3KYL A;  1WJE A;  3R61 A;  4ZZL A;  5KVR A;  1RUN A;  4H4K C;  2EWN A;  2R3S A;  5D8K B;  2ESH A;  3GF2 A;  3OYK A;  3E6C C;  2EV6 A;  2KDZ A;  1EKE A;  3T8T A;  4GYI A;  1YRN B;  3S2D J;  1U5T A;  3OOU A;  1R23 A;  2HVS A;  3HRU A;  3C2G A;  3L09 A;  3E6B A;  5E8G A;  2DW4 A;  2OCE A;  1DGR M;  3ZN1 A;  1MBG A;  2LVS A;  5JLW A;  4NC7 A;  2AXL A;  2IBD A;  2GXB A;  3NEU A;  2JUG A;  3GBG A;  1O3T A;  1VQK I;  4BQO A;  2HS5 A;  1VQL I;  2ZBK A;  4A3K J;  1TT0 A;  5LGU A;  4EV0 A;  1KZH A;  1WRJ A;  1OCZ H;  5B1B H;  4QTR A;  4HEA 2;  1RRJ A;  4IHV A;  3WE3 A;  4TV7 A;  4FAS D;  3DU6 A;  2CUZ A;  2WY8 Q;  3MD2 A;  2A5W A;  2Q2E A;  5D4S A;  5IY5 H;  1IUY A;  1Z3Y A;  3O3K A;  2ZNZ A;  1MBH A;  2V1U A;  1N78 A;  1G2H A;  3C18 A;  4DBQ A;  2MH2 A;  1XDU A;  3P9I A;  2DXI A;  3KLO A;  3FXL A;  1FYK A;  2WY7 Q;  1ON1 A;  5GPC A;  1XN7 A;  5GTH C;  2KZV A;  1BI3 A;  2M0C A;  4XIC A;  3I64 A;  2DMT A;  2GXG A;  1WHU A;  5C44 J;  1TWA J;  4KT6 A;  1WJD A;  3DV8 A;  1J59 A;  2F5V A;  1IN4 A;  4JBA A;  2L54 A;  3WU0 A;  4RMN A;  4EM2 A;  3SFZ A;  4MEY F;  2JA6 J;  4XRS G;  2QSF X;  1UHW A;  2X6Y A;  4WXC A;  3I5U A;  5F08 A;  1S72 I;  3L00 A;  1FNN A;  1UJ8 A;  4WWC A;  5HLT A;  1FBS A;  2RVC A;  4IHX A;  3RQI A;  4Q47 A;  3VSK A;  4A3D J;  2FU4 A;  1U0J A;  1R9T J;  1X3Z B;  3QP5 A;  3L2V A;  3BPV A;  4KYW A;  2P6T A;  1P4A A;  4S0H B;  1WCM J;  4ESF A;  3WTT C;  1IO2 A;  2M45 A;  1SVO A;  4XBF A;  1IF1 A;  1RR8 C;  3J80 K;  1XCV A;  2LF7 A;  1F1Z A;  3T0Y A;  4BQN A;  2GA2 A;  3E1S A;  2VJ5 A;  3AG2 H;  2A05 A;  1U2W A;  3RPQ A;  1KQ9 A;  5IYB J;  4C3I J;  2VOP A;  2UZK A;  2DA1 A;  4RM3 A;  1H0M A;  2OTL I;  2PJR A;  5BPI A;  4I01 A;  4QWQ A;  1PP7 U;  4JX4 A;  3PNY A;  2Q1Z B;  1VQ8 I;  3S1Q J;  1ZLK A;  4G8X A;  2V1N A;  4PGH A;  3IHU A;  5EF6 A;  1J7K A;  2RQQ A;  4KN7 X;  3GTK J;  5E17 F;  3RKX A;  3G73 A;  2FF4 A;  2VC1 A;  5F04 A;  1S5L C;  4A0X A;  5HNF A;  1AA7 A;  1QBJ A;  4KIC A;  2JVG A;  2PMZ N;  2ME6 A;  4IJA A;  2QBY A;  1JGG A;  1B72 A;  2L2O A;  5E1Z B;  1U6G A;  2DLL A;  3W2A A;  1OCR H;  5BPD A;  2E2H J;  3HOU J;  5IT9 Z;  3ASN H;  2E34 A;  2GA1 A;  3JRG A;  1Y8R B;  2X6X A;  2WAE A;  3SZT A;  1BC7 C;  2NNY A;  2KIS A;  3ZQF A;  5C3E J;  4EJT A;  4KUM A;  3OYA A;  3PO3 J;  1X3W B;  2D2W A;  4CIC A;  4UVB A;  2HVQ A;  1TQP A;  4B43 A;  4R79 A;  3I58 A;  3SEZ A;  1YLF A;  2JA8 J;  2P5V A;  2GIV A;  4L5E A;  1HQC A;  3KCC A;  3KP3 A;  3K70 C;  2FBK A;  1W5C C;  4M72 A;  1R71 A;  1X1C A;  4AVZ A;  1WH7 A;  3OYM A;  1BOA A;  1SVM A;  3CDI A;  3F22 A;  5L3E A;  3GME A;  3WTS C;  5HS7 A;  1GV5 A;  4B44 A;  4LOC A;  5K5R A;  2D45 A;  2RNG A;  3V7R A;  1W7P D;  1V4R A;  1Z3X A;  2R7Q A;  2Z5U A;  2H94 A;  1I1S A;  1J5Y A;  2QQ8 A;  3K4K A;  1IN5 A;  1YQA A;  4II3 A;  4Z2Y A;  3Q0U A;  3CDL A;  2VPR A;  2PMZ A;  1FYM A;  2NS0 A;  4BXX J;  2NAZ A;  5A2Q Z;  2W82 A;  1IDZ A;  1JGS A;  2JSP A;  1TL8 A;  2MC4 A;  3VYR B;  1LDJ A;  2LRD A;  5IP6 A;  2L3D A;  2JSC A;  2H8W A;  4YFX F;  3OY9 A;  2JPB A;  2YU9 J;  1QZZ A;  5LHG A;  2LLK A;  3CLO A;  2OAZ A;  5F27 A;  4YFK F;  2MG4 A;  3GFJ A;  2BZT A;  4A0Y A;  2DFH A;  4OOI A;  3LA7 A;  4HDV A;  1KYZ A;  1S3J A;  3H36 A;  4RAZ A;  3S1M J;  3DEE A;  1F43 A;  2BY1 A;  4BY1 J;  4E6K G;  2XRO A;  1KQ0 A;  4NC8 A;  3J7Z I;  4HF1 A;  3AFH A;  3JAM Z;  2F5F A;  1SAU A;  3NAU A;  3R0A A;  5K7H A;  3K4N A;  2HGC A;  4NQW B;  4NB5 A;  4E7J A;  1OYI A;  3IH3 A;  3PO2 J;  1HC8 A;  2L0K A;  4GRI A;  1TNT A;  4A0Z A;  1XC5 A;  1HW5 A;  1K78 A;  1MJB A;  4XM3 A;  1J0R A;  1BI1 A;  3LNQ A;  2D1V A;  1G6N A;  1SFX A;  4UV8 A;  4BJT A;  4U0V A;  1RI7 A;  1Z7U A;  3Q3S A;  3JRD A;  2M7A A;  4AM3 A;  4LLL A;  4BE0 A;  2Z9O A;  3ZOB A;  1FWZ A;  4IKF A;  1PUF B;  5FFX A;  3A1Y A;  2IS6 A;  2NNN A;  2F4O B;  1R22 A;  1RUO A;  2HR3 A;  3ZQG A;  3FK6 A;  2K9M A;  2ZXJ A;  5CYV A;  4CCM A;  3WTW C;  3OYL A;  2XGD A;  3CF2 A;  2JUC A;  1WI3 A;  1XX5 A;  2PX9 A;  4V2F A;  2VKD A;  3WTZ A;  2QQ9 A;  1XS9 A;  2TRT A;  5JVG F;  1BM9 A;  2KP6 A;  3HOY J;  3W2W A;  2QWW A;  4AC0 A;  2R7V A;  1W0T A;  2PLY A;  1G3T A;  2NRA C;  2Y31 A;  1SMY F;  3K4L A;  3TL4 X;  1MW7 A;  2QZ8 A;  1E3O C;  1TWF J;  4PDK A;  3BZC A;  3HPG A;  3BTJ A;  1XSX A;  5J1R A;  3S8P A;  2CG4 A;  4ZYH A;  3GTG J;  3C1D A;  2F5E A;  2F2E A;  1E17 A;  4XOT A;  3KE2 A;  1IDY A;  1ZG3 A;  2YX7 A;  3Q9S A;  1V55 H;  5EEA A;  2LSO A;  1Y8Q B;  3F6V A;  3O6B B;  4RGR A;  1GDT A;  3EUH C;  4AUX A;  4A3J J;  3ASO H;  2LDU A;  4U0W A;  5IT9 K;  4IZZ A;  2DN0 A;  2R7S A;  1ETQ A;  3KEO A;  2K27 A;  1YJW I;  1LJ9 A;  2QA4 I;  3BTC A;  5IOZ A;  4E7H A;  4BXU A;  2ECB A;  2QLZ A;  2O8K A;  5KCM A;  3HOW J;  2CW7 A;  3IWF A;  3F8B A;  5E1X A;  2IPQ X;  2IA0 A;  4LD5 A;  1MMD A;  3A0H C;  3KP5 A;  1W4M A;  3GTO J;  3VYS B;  2DMQ A;  4KIB A;  1L0O C;  1OFC X;  3LMM A;  3QOP A;  3H9J A;  4FT8 A;  4PFO A;  2PMH A;  3MKZ A;  4Y3O A;  1RZ4 A;  4HV5 A;  3DBL B;  1JTX A;  1V3F A;  5EJC A;  1ZN2 A;  3A0B C;  3RPU A;  5D5X B;  5LGN A;  4X0G A;  2K9Q A;  5CPR B;  3F9K A;  4RGU A;  4BEH A;  1XGS A;  4RDU A;  1MMG A;  4ZH4 F;  3E3V A;  5GAE J;  2VI6 A;  2H27 A;  5J3L A;  4G6T B;  1ZRE A;  2LNB A;  3MFK A;  3CCY A;  1FTT A;  5FLX Z;  3EUA A;  1R1T A;  3DP7 A;  2EFQ A;  2ZB9 A;  1EH6 A;  3K1N A;  4MFD A;  4BBS J;  3IKT A;  2IRF G;  2EIJ H;  3EET A;  2GZW A;  4BE1 A;  1S9H A;  3RKQ A;  2HNH A;  3OYD A; 
#chains in the Genus database with same CATH homology
 1R00 A;  1GHC A;  2EFN A;  2BBY A;  4KIG A;  4HDU A;  5HS9 A;  4ZYG A;  1SD4 A;  3COA C;  5H6R A;  4KDP A;  1FX7 A;  2DT5 A;  4KNY A;  5D6E A;  1LVA A;  2YU3 A;  4L9J A;  2M1B A;  2O61 A;  1B9N A;  3KLN A;  1KA8 A;  1LEB A;  4IHS A;  4WK8 F;  3QU6 A;  3GZ6 A;  2B0L A;  3Q5F A;  1AOY A;  3WGH A;  2HQR A;  4BQA A;  2GAU A;  3K69 A;  5HVQ C;  4FX4 A;  1IXR C;  4JQF A;  4B8X A;  3R60 A;  1SD7 A;  5ILS A;  4A12 A;  1YYV A;  2H09 A;  4Q48 A;  3ECH A;  2PFB A;  2VE9 A;  1U5T B;  1GXQ A;  1EH7 A;  4LJZ F;  3FXU A;  4HX4 A;  1P92 A;  1Z6T A;  2GQQ A;  4HA8 A;  5LGT A;  4A6D A;  3HRM A;  3CUQ A;  4B09 A;  3B73 A;  4ZYD A;  2VON A;  4LMY A;  5L3D A;  2PBI A;  1USS A;  3TO9 A;  3V7C A;  4E70 A;  1RNL A;  3DF8 A;  4IXA A;  1O3S A;  4Y13 A;  2O03 A;  1R1V A;  1B6A A;  2ZNY A;  1KYW A;  2FRH A;  2VE8 A;  1H9T A;  5E18 F;  1MKM A;  3ZPL A;  4HQE A;  3F8C A;  1D5V A;  1HST A;  1CF7 B;  1XCB A;  2A6H F;  2M30 A;  3F8N A;  1FBQ A;  1YS6 A;  3BP8 A;  2ZME B;  2EFP A;  4BHP A;  5L3G A;  5FLX K;  3U2R A;  2XAQ A;  1LEA A;  2DBB A;  1J75 A;  4MHG A;  2IW5 A;  3F6O A;  3HOS A;  1ZRD A;  3IL2 A;  2YX4 A;  4RGS A;  4EQQ A;  4I98 B;  3HYI A;  2RDP A;  3GW2 A;  2M8E A;  4IRG A;  2E7W A;  2P8T A;  5D5W B;  2QBY B;  1YTY A;  3DFG A;  4RS8 A;  1ZAO A;  1U5T C;  4G6Q A;  4M73 A;  5DUI A;  2W24 A;  3V8L A;  1J2X A;  2PQ8 A;  3D0S A;  2D1H A;  2VT3 A;  3J80 Z;  3P9K A;  1MJA A;  1BN5 A;  1OMI A;  2QQB A;  4HX7 A;  5FD6 A;  3MWM A;  3GLX A;  3LFK A;  1QQI A;  3RI4 A;  3QP6 A;  2KJC A;  2VN2 A;  5E1W A;  4EGZ A;  4I09 A;  1U8R A;  4RB0 A;  4A5M A;  3KP4 A;  5DDG A;  5L3B A;  2G9W A;  3U1D A;  4AIH A;  2FMY A;  3BJA A;  4OMZ A;  5HLH A;  4MQ9 F;  3GO5 A;  3TOA A;  1C0W A;  4OIO F;  5FD5 A;  3DQV C;  2L02 A;  3AAF A;  1Z6R A;  5JFR A;  3HSE A;  5ICF A;  3IWZ A;  2STT A;  2GWR A;  2CO5 A;  2A68 F;  3KP2 A;  4M74 A;  1LQ1 A;  1STZ A;  2PG4 A;  1W7P A;  5K5Q A;  3GZ5 A;  3DPL C;  2JT1 A;  2A61 A;  2EV5 A;  2Q8K A;  1E2X A;  2DI3 A;  2BYV E;  2F5C A;  2V1D A;  3ABT A;  1ZAR A;  1MD0 A;  1Y0U A;  2K7L A;  5HDG A;  4BH9 A;  4EGY A;  2EB7 A;  4AIK A;  3EYI A;  3E5X A;  1HXD A;  5LRS A;  2MC3 A;  2R7F A;  4CHU A;  3VEP A;  3IC7 A;  3C7J A;  4CGZ A;  2PMU A;  1R58 A;  2Y48 A;  1XMK A;  3MQ0 A;  5JR3 A;  1JE8 A;  2EA4 A;  3TO7 A;  5AIQ A;  2Y75 A;  2ETH A;  2L01 A;  4P9F A;  5DUK A;  2VT2 A;  2RC4 A;  1SMT A;  3V7S A;  4ON0 A;  1PDN C;  2E1N A;  1YS7 A;  1ZRF A;  2UXN A;  1YG2 A;  3B02 A;  3BZ6 A;  1JHF A;  3WE2 A;  1AWC A;  4MGR A;  5DCF A;  2G7U A;  4HAM A;  3RYP A;  1FC3 A;  4EM0 B;  4YII A;  3QAH A;  3KFW X;  3VOD A;  1O7L A;  3FX3 A;  4N0B A;  3WG9 A;  1IW7 F;  3BRO A;  2MLK A;  3DXJ F;  4EVI A;  4BYY A;  3GYH X;  2HKX A;  3ZMZ A;  2EJR A;  1R36 A;  1J9I A;  3BWG A;  2BEO A;  1EH8 A;  1UHM A;  4HX8 A;  4MTE A;  3ZQ7 A;  3TOB A;  1F4K A;  3EDP A;  5DD4 A;  3OOP A;  2VBY A;  5E20 A;  2V79 A;  4KN4 X;  3I59 A;  1H9G A;  4DQ2 A;  1I6X A;  4HOB A;  4CZZ A;  3L9F A;  2V1X A;  3TGN A;  5LHH A;  4G7H F;  5E8I A;  1DP7 P;  2ZJ2 A;  4BHB A;  1S7O A;  1RIO H;  3TKY A;  4M9Z A;  3SHF A;  3E97 A;  4GYG A;  2VXZ A;  2RN7 A;  1T2K A;  3LAJ A;  3F8F A;  2K86 A;  2HYF A;  1MDM A;  2XVC A;  4LB6 B;  5LLQ A;  2J5P A;  4HZF A;  1LB2 A;  1QZY A;  1W5T A;  3LA2 A;  4PGG A;  4Y17 A;  3I4P A;  2BE5 F;  2HOE A;  1MZB A;  2H6B A;  4ENJ A;  3M8E A;  3E5U A;  4UHT A;  3ZMU A;  1YW8 A;  3FF5 A;  4WXH A;  5J6X A;  2XAJ A;  4L9V A;  3F72 A;  1WSU A;  4LG0 A;  1TW2 A;  4OIQ F;  2HTS A;  2ESN A;  2LF8 A;  1XMA A;  4CYD A;  4I0A A;  5J8F A;  2XUB A;  3IRR A;  4LLN A;  3BOQ A;  5HLG A;  4XRF A;  3MAJ A;  5CVI A;  1ZHF A;  2HWV A;  5DEQ A;  5DCM B;  2OZU A;  4Q4Z F;  4GXO A;  4HW0 A;  3CUQ B;  3F3X A;  4MQV A;  2IA2 A;  3I54 A;  2BGC A;  4KIF A;  2A07 F;  2P5L C;  3K2Z A;  4OIN F;  3FXR A;  3WTU C;  3IKV A;  2WTE A;  5EEG A;  5LHI A;  2CW0 F;  4I7H A;  2CFX A;  2HDC A;  5ED4 A;  4P55 A;  4HLX A;  3D5L A;  1Q1H A;  2DPU A;  1O3Q A;  2STW A;  1T0F A;  3JSO A;  1YW9 A;  2MH9 A;  2IT0 A;  2PI0 A;  3WTV C;  3HIF A;  3QPT A;  1FT9 A;  1W5S A;  2V6C A;  3RIR A;  1VTN C;  4CO8 A;  3FXQ A;  4EJO A;  1TTY A;  1JXS A;  1ZH5 A;  4GCV A;  4HF0 A;  4WF2 A;  4ETS A;  3KP6 A;  2P4W A;  2CYY A;  1G3Y A;  3EYY A;  1LNW A;  5D4R A;  4EJU A;  4U88 A;  4M6X A;  5JI6 A;  3K1P A;  2VBX A;  3GFL A;  5KK1 A;  4CDG A;  2E1C A;  3TDU C;  4EJV A;  3GWZ A;  1K6O A;  4WCG A;  3LST A;  2O3F A;  4KA4 A;  4KT5 C;  1F5T A;  2HTJ A;  4DNC A;  1FOK A;  3LWF A;  1WI9 A;  3CUQ C;  1SD6 A;  5FFZ A;  3PQK A;  2DPD A;  1P6R A;  2DO7 A;  5BQT A;  3CTA A;  3IRQ A;  2XAG A;  2G7H A;  1HSJ A;  2XKO A;  4U0Y A;  1ZRC A;  2QYO A;  1IXS B;  2FOK A;  1BC8 C;  5H6Q A;  4EJW A;  2VOO A;  2UXX A;  4U7B A;  3HOT A;  2CSO A;  3QU3 A;  5CJ9 A;  1P4X A;  2ZO4 A;  1DDN A;  2E7X A;  3ML6 A;  1OYY A;  1S8N A;  1G3S A;  3WU1 B;  4OMY A;  3J81 K;  4HBL A;  1ON2 A;  1W7P B;  3C3W A;  3CJN A;  1T98 A;  4LB5 A;  5ILV A;  4NQW A;  2OD5 A;  4I2O A;  4U7D A;  3VFZ A;  3RTR A;  1FP2 A;  1XDS A;  2X4H A;  5BOX A;  1S29 A;  4AVP A;  2FSW A;  4HF2 A;  3WGG A;  3E5Q A;  2XHK A;  4ZYE A;  4O3M A;  3LA3 A;  2F5D A;  1K79 A;  4N9I A;  1O57 A;  4L0Y B;  3ECO A;  4M6Y A;  1D3Y A;  2NYX A;  1ZG5 A;  1BJA A;  2XAF A;  4XSX F;  1ZLJ A;  4K2E A;  4KMF A;  1O3R A;  3LQQ A;  3FM3 A;  1R7J A;  3GFM A;  3T8R A;  2X0L A;  2O0Y A;  2W84 A;  2RV8 A;  4I0B A;  3H3U A;  1O7F A;  4L9T A;  3M1E A;  1B9M A;  3DPT A;  4IF4 A;  1SAX A;  3ZMD A;  1ZG1 A;  1FPQ A;  1DPU A;  1KU2 A;  3F23 A;  3GXO A;  2HYG D;  4Y15 A;  5HLI A;  5J8C A;  4AD9 A;  2MLG A;  4UVC A;  3N4M A;  3HSR A;  3RDI A;  3JTG A;  1FP1 D;  2FQ3 A;  1IN6 A;  1JHH A;  5HS8 A;  3MCZ A;  1I1G A;  4MEX F;  2EK5 A;  5CVU A;  2ZCW A;  1XSD A;  1UB9 A;  2KRF A;  2Q0O A;  3SXY A;  3NRV A;  5LRR A;  1T39 A;  1FYL A;  5D6F A;  3TO6 A;  3W6J B;  5F64 A;  1ODD A;  4AWX B;  4GGG A;  3ABU A;  2ISZ A;  4ENK A;  1TW3 A;  2ADU A;  2YR2 A;  3REO A;  2ZFW A;  2KIF A;  2R7D A;  2RNJ A;  4G94 A;  3N97 A;  1REP C;  1I27 A;  5FB2 A;  3R6S A;  2EFW A;  4ESB A;  3MZH A;  1KU7 A;  3KZY A;  4PCQ A;  3I59 B;  3T1B A;  1KU9 A;  3WTY C;  1YFH A;  3FHZ A;  1QPM A;  1A04 A;  4IVN A;  5DYM A;  2O6G E;  4AIJ A;  1R5H A;  1I5Z A;  2JPC A;  3J7A O;  1LDK B;  1Z9C A;  3MZY A;  5F1R A;  3CO6 C;  1F9N A;  2QM3 A;  1MDM B;  4JK1 X;  2HEO A;  4ENM A;  3JTH A;  1Z1D A;  2HQN A;  3DKW A;  2QVO A;  3WOD F;  3HHG A;  3LAP A;  1NHA A;  3SQN A;  4L18 B;  4P5O A;  4A5N A;  4LG0 B;  2XGX A;  4IHT A;  1K78 B;  4P96 A;  5CVR A;  5HDK A;  1XGN A;  5L3F A;  1Z91 A;  5TJJ A;  1IN8 A;  2DQR A;  1IZ1 A;  3FM5 A;  5AON A;  2M5W A;  1HKQ A;  4UNO A;  3RKW A;  2UWM A;  5DD8 A;  3KP7 A;  5CVJ A;  2CQK A;  1T38 A;  2JTV A;  2FBH A;  4IRI A;  1FLI A;  4RB3 C;  3QRF F;  3GFI A;  2A6E F;  4S04 A;  1FSH A;  2DK5 A;  2P5K A;  4NHJ A;  2DU9 A;  5LEK A;  5EEH A;  5ICE A;  4R8H A;  3ERE D;  2WWY A;  4UXN A;  1CF7 A;  3ISP A;  4S05 A;  1XSV A;  3EQL F;  4G6D A;  1DPR A;  1BIA A;  2ZME A;  3FZV A;  3L7W A;  5HDN A;  4OU0 A;  1XGM A;  4EMS A;  4A6E A;  3BJ6 A;  3I71 A;  3ZMT A;  4GO1 A;  1SD5 A;  3BJO A;  1G4D A;  2XRN A;  2OQG A;  2HZT A;  5CLS A;  1LDD A;  1MGT A;  4UV9 A;  2IA1 A;  2FXA A;  4XSZ F;  1EV7 A;  2H6C A;  5JVT A;  4L9N A;  5IT3 A;  4M71 A;  2KJB A;  1GVJ A;  1HW2 A;  2Z33 A;  5FGM A;  4YFN F;  4M9X A;  1TNS A;  3FWE A;  2XKP A;  2MBF A;  1ULY A;  3SZP A;  1OKR A;  2JZY A;  3HSF A;  2A3S A;  3HHH A;  2DK8 A;  1BI2 A;  5BMZ A;  4PZJ A;  4L5J A;  1HKT A;  1B59 A;  4LK0 F;  2WV0 A;  2FBI A;  2FEZ A;  2K02 A;  2TDX A;  2XIG A;  2DQL A;  1KU3 A;  4LK1 F;  5CVV A;  4G7O F;  2RQP A;  1BIB A;  3F8M A;  1K7A A;  1TBX A;  4HLY A;  1YW7 A;  3CDH A;  5FO5 A;  3BDD A;  1XB4 A;  1KQ8 A;  4YG2 F;  3KZZ A;  4IRH A;  1BBY A;  5D5U B;  2K4B A;  1IN7 A;  4EM1 A;  3TDZ C;  2HKO A;  2WC2 A;  3R0J A;  2QEN A;  2DFI A;  3RYR A;  4RB2 C;  3P7N A;  3E6M A;  4WX9 A;  5L3C A;  3H3Z A;  1HKS A;  1L3L A;  2DTR A;  2JRT A;  1B4A A;  3I0T A;  2HFH A;  3S2W A;  3ULQ B;  4I02 A;  3W6K B;  1B1B A;  3I53 A;  1UST A;  5DV5 A;  2ISY A;  3J81 Z;  2DAO A;  1FZP B;  4XLN F;  1MJ9 A;  1IAW A;  2P7C B;  1ONV A;  2BV6 A;  3ROU A;  3R4K A;  4R1H A;  4F7Z A;  2W85 A;  4ESJ A;  3BPX A;  1XD7 A;  4YIF A;  4Q5S F;  2LKP A;  2RKH A;  1WWX A;  5HOO A;  5H20 A;  2RGV A;  1WKM A;  4OIP F;  2P6S A;  2A5Y B;  1CGP A;  5AIP A;  3G3Z A;  4LLG F;  3NQO A;  3V8K A;  5F6F A;  2A69 F;  3K0L A;  5K1Y A;  4O6J A;  4G9Y A;  3LQR A;  1R5G A;  1FY7 A;  3V4G A;  1Z05 A;  2J5O A;  3E6D A;  3L2C A;  5TRD A;  2O8X A;  1R1U A;  2V9V A;  1U3E M;  4ENN A;  2C6Y A;  3FMR A;  4L0Z B;  4RAY A;  4M9S A;  1IXC A;  5A2Q K;  4KFC A;  3T5X A;  4UUV A;  1SFE A;  3U9G A;  2EFO A;  3GUD A;  1XGO A;  4D0P A;  3K9T A;  5ILU A;  2QUF A;  4ASN A;  3JAM K;  4BAY A;  3EUH A;  1P2F A;  1S7A A;  1PUE E;  2FML A;  4KMU X;  1QGP A;  2FNA A;  3HUG A;  4BHC A;  2VOD A;  3FMQ A;  4CXF A;  1IRG A;  2EV0 A;  2Y0M A;  2CWE A;  4RB1 A;  2KKO A;  3HRT A;  3QPH A;  1ZYR F;  2PJP A;  1YIO A;  4IPA A;  3RJP A;  1QO0 D;  3FMS A;  1OR7 A;  1X3U A;  4A2U A;  2M87 A;  1HW1 A;  5D8L B;  1UFM A;  4P9U A;  3M9A A;  2MA3 A;  2KIM A;  3HTS B;  1S6L A;  5LBQ A;  2FA5 A;  2Z3Y A;  1T6S A;  4G7Z F;  2MD5 A;  3GVA A;  2KIU A;  2AS5 F;  5DCM A;  2VBW A;  1WQ2 A;  2P7V B;  5LEJ A;  2ACJ A;  2L4M A;  1QNT A;  3O2P E;  2COM A;  3KEQ A;  1ZGJ A;  3ZN0 A;  2OU2 A;  4N9H A;  2IJL A;  3KET A;  1TQM A;  4MTD A;  4ZZD A;  3ELK A;  2EA2 A;  2FE3 A;  2YPR A;  1D8J A;  1KGS A;  1UCR A;  3RKY A;  4HV6 A;  3P9C A;  3ZP5 A;  5D5V B;  2PN6 A;  2OBP A;  2W25 A;  4H0E A;  1P4W A;  2ELH A;  2XAS A;  2K4J A;  1HBX G;  4UVA A;  3JSP A;  1OYW A;  3MEX A;  3GEZ A;  2Z99 A;  2XV4 S;  3K1M A;  1ZGA A;  1PP8 F;  4L5I A;  1GXP A;  4XLP F;  2OZ6 A;  4FHT A;  1SFU A;  4LGW A;  3TQN A;  4FX0 A;  1D8K A;  2VC0 A;  4QLC U;  3F21 A;  2IP2 A;  3Q9V A;  3VB2 A;  5ICG A;  5BS6 A;  3CUO A;  3PQJ A;  3VOE A;  3ZMV A;  3DEU A;  3JW4 A;  1G3W A;  5ICC A;  3H92 A;  2PEX A;  4MNU A;  1IRF A;  1BI0 A;  1U78 A;  2CGP A;  2XAH A;  3PFI A;  5JHU A;  2YSR A;  2IVM A;  3GX4 X;  4HYE A;  2OQR A;  2W57 A;  5ERI A;  4OIR F;  1TLH B;  1DUX C;  2OA4 A;  3ZMS A;  3WGI A;  3HRS A;  4RGX A;  5K5O A;  3M7G A;  3M8F A;  3V8J A;  4O5V A;  3BY6 A;  1FBU A;  4LFU A;  4BNC A;  3WTX C;  2L4A A;  4HQM A;  1TQI A;  6PAX A;  2ZKZ A;  1YO5 C;  1OPC A;  4WXD A;  2FNP A;  2QQA A;  3OV8 A;  2VBZ A;  1FSE A;  3CO7 C;  3HTU A;  3R61 A;  4ZZL A;  5KVR A;  1RUN A;  2EWN A;  2R3S A;  5D8K B;  2ESH A;  3GF2 A;  3E6C C;  2EV6 A;  3T8T A;  4GYI A;  1U5T A;  1R23 A;  3HRU A;  3L09 A;  3E6B A;  5E8G A;  2DW4 A;  3ZN1 A;  2AXL A;  2GXB A;  3NEU A;  1O3T A;  2HS5 A;  2ZBK A;  5LGU A;  4EV0 A;  1WRJ A;  3WE3 A;  4TV7 A;  2Q2E A;  5D4S A;  1IUY A;  3O3K A;  2V1U A;  2ZNZ A;  3C18 A;  2MH2 A;  1XDU A;  3P9I A;  3KLO A;  1FYK A;  1ON1 A;  1XN7 A;  1BI3 A;  3I64 A;  2GXG A;  3DV8 A;  1J59 A;  1IN4 A;  4JBA A;  2L54 A;  3WU0 A;  4EM2 A;  3SFZ A;  4MEY F;  1UHW A;  4WXC A;  3I5U A;  3L00 A;  1FNN A;  4WWC A;  1FBS A;  2RVC A;  4Q47 A;  2FU4 A;  3QP5 A;  3BPV A;  4KYW A;  2P6T A;  1P4A A;  4ESF A;  3WTT C;  4XBF A;  2M45 A;  1IF1 A;  3J80 K;  1XCV A;  2LF7 A;  1F1Z A;  3T0Y A;  2GA2 A;  1U2W A;  3RPQ A;  1KQ9 A;  2VOP A;  2UZK A;  1H0M A;  5BPI A;  4I01 A;  4QWQ A;  1PP7 U;  1ZLK A;  4G8X A;  4PGH A;  3IHU A;  1J7K A;  5E17 F;  4KN7 X;  3RKX A;  3G73 A;  2FF4 A;  2VC1 A;  4A0X A;  1QBJ A;  4KIC A;  4IJA A;  2QBY A;  5E1Z B;  1U6G A;  2DLL A;  5BPD A;  5IT9 Z;  2GA1 A;  3SZT A;  1BC7 C;  4EJT A;  2NNY A;  4KUM A;  2D2W A;  4CIC A;  4UVB A;  1TQP A;  4R79 A;  3I58 A;  1YLF A;  2P5V A;  2GIV A;  1HQC A;  3KCC A;  3KP3 A;  2FBK A;  4M72 A;  1BOA A;  3F22 A;  5L3E A;  3WTS C;  5HS7 A;  5K5R A;  2D45 A;  3V7R A;  1W7P D;  1V4R A;  2Z5U A;  2H94 A;  1I1S A;  1J5Y A;  1IN5 A;  1YQA A;  4Z2Y A;  1FYM A;  2NS0 A;  2NAZ A;  5A2Q Z;  1JGS A;  1LDJ A;  2L3D A;  2JSC A;  4YFX F;  2JPB A;  1QZZ A;  5LHG A;  3CLO A;  2OAZ A;  4YFK F;  4A0Y A;  3GFJ A;  4OOI A;  4HDV A;  3LA7 A;  1KYZ A;  1S3J A;  4RAZ A;  2XRO A;  1KQ0 A;  4HF1 A;  3JAM Z;  2F5F A;  3R0A A;  2HGC A;  4NB5 A;  1OYI A;  1TNT A;  4A0Z A;  1HW5 A;  1K78 A;  1MJB A;  1J0R A;  1BI1 A;  2D1V A;  1G6N A;  1SFX A;  4UV8 A;  4U0V A;  1RI7 A;  1Z7U A;  4LLL A;  2Z9O A;  1FWZ A;  5FFX A;  2NNN A;  1R22 A;  1RUO A;  2HR3 A;  2ZXJ A;  5CYV A;  3WTW C;  3WTZ A;  2QQ9 A;  1BM9 A;  2QWW A;  2PLY A;  1G3T A;  2NRA C;  1SMY F;  2QZ8 A;  4PDK A;  1XSX A;  2CG4 A;  4ZYH A;  3C1D A;  2F5E A;  2F2E A;  1E17 A;  3KE2 A;  1ZG3 A;  2YX7 A;  3Q9S A;  2LSO A;  3F6V A;  3O6B B;  4RGR A;  2LDU A;  4U0W A;  5IT9 K;  3KEO A;  2K27 A;  1LJ9 A;  4BXU A;  2QLZ A;  3IWF A;  3F8B A;  5E1X A;  2IPQ X;  2IA0 A;  4LD5 A;  3KP5 A;  1W4M A;  4KIB A;  1L0O C;  3QOP A;  4FT8 A;  2PMH A;  1RZ4 A;  4HV5 A;  1V3F A;  1ZN2 A;  3RPU A;  5D5X B;  5LGN A;  4RGU A;  1XGS A;  4ZH4 F;  3E3V A;  2H27 A;  1ZRE A;  2LNB A;  3MFK A;  5FLX Z;  1R1T A;  3DP7 A;  2EFQ A;  1EH6 A;  3K1N A;  3IKT A;  2IRF G;  3EET A;  2GZW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...