3FF5A

Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix protein import receptor, Pex14p
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
molecule keywords Peroxisomal biogenesis factor 14
total genus 21
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ff5A00
3QPTA 1FT9A 4WXCA 4P9UA 1HKQA 3MCZA 1X3UA 3LSTA 2P7CB 5BPDA 3MAJA 2CGPA 1U78A 4M74A 1U5TC 5H6QA 2EB7A 3N4MA 1AOYA 5H20A 1RUOA 4UVCA 4LJZF 5BMZA 4ZYHA 4U88A 4Q4ZF 2PMHA 2VODA 3F8FA 3DFGA 4HOBA 2J5PA 1TQIA 4BHBA 3ULQB 1XB4A 2A68F 3KLOA 5HLHA 1FZPB 3KCCA 1CF7B 4I02A 1OMIA 3KP7A 1H9TA 3U2RA 3V7SA 5DV5A 4CDGA 2XIGA 1KQ8A 4HYEA 2MC3A 2VC1A 5ED4A 1S8NA 3BROA 1ZGJA 2D2WA 1YO5C 1BM9A 4IPAA 2F5FA 4I0AA 4L0ZB 3KP5A 2R7DA 2UXNA 3HOSA 4KT5C 3CO7C 2NNYA 1IZ1A 1OYYA 3TOAA 3KEQA 4YG2F 1YIOA 2KJCA 4AIHA 4D0PA 1FSHA 3CDHA 1W5TA 3BJAA 2R7FA 2HQRA 2L54A 4A5MA 3KZZA 2QZ8A 4UV8A 2JPCA 2YR2A 4RAYA 5J8FA 4HX4A 3GYHX 1K79A 3LA3A 3DV8A 4HDUA 3M8EA 3CJNA 3V7CA 2M45A 1SFUA 1ZREA 3BOQA 2OD5A 1LDKB 2HOEA 3FXQA 1MZBA 1BI1A 3HSFA 4NQWA 2YU3A 3QP5A 2VE8A 1GVJA 2O0YA 3EYYA 3RJPA 1BC8C 3ZMZA 5LGTA 1KU2A 2VXZA 4GYIA 3AAFA 4FT8A 1K7AA 2CW0F 3RIRA 3W6JB 4KMUX 3E6BA 3ECOA 5LHHA 2IW5A 4LD5A 4P9FA 3B73A 3FZVA 4ZYEA 4EMSA 1LDJA 1MJ9A 1FY7A 5L3BA 1I5ZA 4WWCA 4U0YA 3R4KA 3CUQB 3RI4A 1P4WA 3GUDA 3JTGA 3JAMZ 1EV7A 2YPRA 5LEJA 2NNNA 3CLOA 1U8RA 4MQVA 3GFIA 3Q9SA 4GXOA 5KVRA 2BBYA 2FEZA 1Z91A 4A0XA 1R5HA 5D4SA 3I54A 3M8FA 1RUNA 2XUBA 4WK8F 3FWEA 3IHUA 3IWZA 4G9YA 2HFHA 4L0YB 3FMQA 1AWCA 3GFLA 3SFZA 1LEAA 2IJLA 3WGHA 4U7DA 3HRMA 1WKMA 2KIUA 3FM3A 2ACJA 2D45A 4I7HA 2J5OA 3DQVC 1UFMA 3IKVA 4I2OA 3GZ6A 4LLNA 4L9TA 4G8XA 2Y48A 3KP2A 1PP8F 1E2XA 4HQMA 3DP7A 1KU9A 5TJJA 3KP3A 4PZJA 2NS0A 1IN5A 2HDCA 1RI7A 1ZGAA 1D5VA 3T0YA 3FMSA 3O2PE 2XASA 1ZG3A 2V1XA 4WX9A 2H6BA 5DDGA 2BV6A 5JR3A 4A2UA 4A6EA 4BNCA 3TO6A 1LEBA 3I71A 3R60A 4G6DA 1SMTA 4MNUA 1MDMA 1O3RA 4I09A 1DPUA 4MTDA 2P6TA 1Z6RA 2VOOA 4N0BA 5E1WA 3RKXA 2GWRA 4G7HF 4CYDA 4KIBA 1G3SA 1Y0UA 3EDPA 2LF7A 4JK1X 1OR7A 3MEXA 3ZP5A 3BDDA 2JTVA 3FXUA 3TGNA 2CO5A 1TBXA 4DQ2A 3F8MA 4YFNF 1MGTA 2RVCA 2MH9A 1ZG5A 5HOOA 5CLSA 3P9KA 3O6BB 1MDMB 1XGSA 5FO5A 4P96A 1FC3A 4M6XA 1T39A 3FHZA 1TNSA 3SHFA 2HGCA 1QGPA 1J7KA 4CHUA 3ZN0A 4IHTA 2PN6A 5F6FA 3W6KB 3ZMSA 1FBUA 5K1YA 3KP6A 2JPBA 2Z5UA 2CFXA 1WWXA 4QWQA 4HV6A 3KLNA 2FMYA 3ZN1A 5D8KB 2G9WA 2GQQA 4EJTA 4LLLA 2IA1A 3K9TA 1O57A 2A5YB 2XGXA 4XBFA 1GXQA 3I53A 1FX7A 3E6MA 3GLXA 4B8XA 1BI2A 3LWFA 1V4RA 2V6CA 3CTAA 3VODA 1F4KA 2WV0A 4L9JA 3H92A 5BOXA 4MEXF 2RNJA 1TQMA 2A07F 4Y13A 5A2QK 3BWGA 4KA4A 1TQPA 4GCVA 3T1BA 2A61A 2GA1A 4ZZLA 4EM1A 4EGYA 1BI3A 4CXFA 1G3WA 3WTTC 4HW0A 2B0LA 2EA2A 3CUQA 4R79A 4BHCA 3HRSA 3KFWX 1J2XA 1ONVA 1STZA 1LJ9A 3OOPA 3CO6C 3DPTA 2VBZA 3LQRA 5IT3A 3V8JA 2FF4A 1XMKA 3ECHA 2IRFG 3L09A 2W84A 2KJBA 2EWNA 2Y0MA 3CUOA 2P6SA 4OOIA 2Q0OA 2Q8KA 3GVAA 2MD5A 4OMYA 4BHPA 4IHSA 2FA5A 2KKOA 2DPUA 1YTYA 2E1NA 1KQ0A 4M9SA 2IP2A 1F1ZA 4UVAA 5IT9Z 3MQ0A 4HBLA 3E97A 2O03A 2NAZA 1E17A 2QWWA 3NQOA 1UCRA 1REPC 3E3VA 4XSXF 3TDUC 3U1DA 2DLLA 3Q5FA 2VONA 1XGNA 2XAFA 5HS8A 2LF8A 3QOPA 2EJRA 4G7ZF 1R22A 4AIKA 4UV9A 1GHCA 5D5XB 3PQKA 1W4MA 4M6YA 3F8NA 1IRGA 2ZKZA 1DUXC 4UNOA 1WI9A 5HDNA 2RN7A 2C6YA 5L3GA 3BP8A 5BQTA 4RGUA 3V7RA 3F8BA 1WQ2A 4OIRF 5FLXZ 1XD7A 4ESFA 1G3YA 5D4RA 2P5KA 3ZMUA 2M5WA 3RPQA 4EV0A 1LQ1A 1Z05A 1KQ9A 4NHJA 2EV5A 2O6GE 4WF2A 3I5UA 4HLYA 1IN7A 1FBSA 2DAOA 5DCMB 4RB2C 1XMAA 4O3MA 3WTUC 3ELKA 1J5YA 4XLPF 1IXSB 1UB9A 2Q2EA 2L3DA 3QPHA 3MZYA 2ZFWA 3ROUA 2PI0A 1R23A 1R1VA 4KN4X 1XDSA 4KFCA 1OYIA 2FBHA 2FMLA 1FYMA 2DQLA 1WRJA 3KP4A 2Z33A 4RGRA 2OU2A 3NRVA 3IWFA 5CVJA 2HTJA 4F7ZA 4Q5SF 2K27A 1B4AA 3HTUA 3R6SA 4L18B 1QBJA 2HKXA 3EYIA 3TO9A 3B02A 5EEHA 4H0EA 5HLIA 4HQEA 4I01A 2Y75A 5KK1A 2V79A 3M9AA 2KIMA 4Z2YA 5D5WB 2GZWA 1R58A 3BPXA 1FWZA 1KGSA 1U5TB 2OAZA 2K4BA 3QP6A 1SFEA 1ZLJA 5JHUA 2VBXA 4L9VA 1HSJA 2IT0A 4ZYDA 2EV0A 2P5LC 2HS5A 1O7LA 5D5VB 3J81K 1YS6A 3RYPA 1S7AA 2ELHA 4IJAA 2K7LA 3GEZA 3LAPA 4L5JA 3JSPA 2GIVA 1BJAA 1BC7C 2E7XA 1R7JA 2XKPA 3EQLF 1J75A 2QQ9A 3WGIA 2DBBA 4OIOF 1P2FA 3REOA 1FYKA 1K78A 2WTEA 3WTVC 3SXYA 2MH2A 5E8GA 4OINF 4LMYA 1DPRA 4GGGA 2XHKA 4I98B 4EQQA 1XSXA 3EETA 1TTYA 4OU0A 5L3FA 4U7BA 3C18A 3R61A 1SD7A 2EFNA 2X4HA 4RB0A 5D6FA 3BJ6A 3MZHA 4UUVA 2FRHA 5FB2A 5BS6A 1S3JA 1RZ4A 4XSZF 2HEOA 2XAQA 2IA0A 3J80K 3TO7A 3HOTA 2L4AA 4ESBA 3COAC 1Z1DA 4AD9A 1YS7A 1QNTA 3QRFF 4HA8A 2HWVA 4KNYA 2QM3A 1MJAA 1FP2A 3IC7A 4O6JA 2FU4A 4RGXA 2KRFA 4LB5A 2G7UA 2RQPA 1FSEA 2H27A 3RKWA 1J0RA 5JI6A 2HYFA 1B1BA 3I0TA 2JZYA 5A2QZ 1D8JA 2K02A 3WTSC 2QLZA 3WTZA 4BH9A 1A04A 2PEXA 2DK8A 3M1EA 1R5GA 2DO7A 3QU6A 3EUHA 2PMUA 1HW2A 4LG0B 4UXNA 2HZTA 5K5RA 2H94A 2VBWA 2RV8A 5ERIA 3GFJA 3F72A 3K1PA 4OMZA 4E70A 4EJVA 4NB5A 5LHIA 4HAMA 1YW8A 2FSWA 4LK1F 4ON0A 5ILUA 2F2EA 2QBYA 4O5VA 1B9NA 3R0JA 1R36A 4L5IA 5DYMA 5HLGA 1W5SA 2HTSA 3ISPA 3F6OA 4KUMA 5ICGA 4KMFA 1O3QA 5CVRA 5LGNA 2TDXA 2FOKA 1XN7A 1FP1D 3KZYA 4GYGA 5DEQA 4HZFA 1Z9CA 4A6DA 3HRTA 1F5TA 1K6OA 1MKMA 2M87A 1TW2A 3V4GA 1YFHA 1HKSA 4XRFA 1T2KA 1Z6TA 2STTA 3K0LA 1C0WA 2AS5F 2NRAC 5E1ZB 1YW7A 3RDIA 4LFUA 3LFKA 1L3LA 3JAMK 1QQIA 3BY6A 3ZMTA 4G7OF 3SZPA 4HF0A 2MBFA 1PP7U 3HHGA 3VEPA 4A0ZA 5ICCA 2EFQA 1LDDA 2XRNA 2UWMA 3HIFA 1IAWA 5FFZA 1HBXG 1R1UA 4RS8A 1R00A 2VC0A 1FPQA 1H0MA 3L00A 2CSOA 1YYVA 1KA8A 1USSA 5AIPA 4CICA 2EK5A 4IRIA 3MWMA 3GFMA 3IRRA 3HSEA 2VE9A 1W7PB 2L01A 3WTWC 1SD6A 2ESNA 4LB6B 4TV7A 4HX8A 2A6HF 2FNPA 1ZYRF 3OV8A 1XGOA 4UVBA 3IKTA 3E5QA 1P92A 2GXBA 3J81Z 2QYOA 1ZN2A 5FLXK 3M7GA 1FOKA 2ZO4A 2O61A 3F21A 2OBPA 2BE5F 2F5CA 1QO0D 2GXGA 2XV4S 2JT1A 5LHGA 2AXLA 1KU3A 3ABTA 4JBAA 3K2ZA 5F64A 2XVCA 3E5XA 4KDPA 3IRQA 2PQ8A 4QLCU 2DW4A 4KIGA 3WG9A 2P7VB 2MLGA 3T8TA 3HRUA 3FMRA 1O3TA 1TNTA 2HQNA 4ENMA 2DQRA 2E1CA 2ZNZA 4BXUA 4WXDA 4G6QA 5LBQA 5F1RA 3H3ZA 3G73A 1LNWA 5TRDA 1D3YA 5ICFA 1SFXA 3V8LA 3RYRA 4AVPA 4CO8A 4ZH4F 1G3TA 4EM0B 5K5QA 3D0SA 3RTRA 2H6CA 3GF2A 5ILSA 2EFPA 4RAZA 4EJUA 1B59A 5FFXA 5HDKA 3WTYC 2VBYA 4S05A 2P8TA 1D8KA 5FD6A 3FX3A 1MJBA 1XGMA 1T0FA 5D6EA 1BOAA 4YIIA 3Q9VA 3DEUA 1IN6A 1P4AA 3F6VA 5CJ9A 1OYWA 4EJOA 3PQJA 1L0OC 1XSVA 4RB1A 3F22A 1I1SA 4AIJA 1ZRDA 1FYLA 2XKOA 1LB2A 1G6NA 1IRFA 1XDUA 4P5OA 4FHTA 5CYVA 4L9NA 3VOEA 3LAJA 1ZAOA 4MTEA 1B6AA 2IA2A 3N97A 4MEYF 2VT2A 1ULYA 1ODDA 1HW5A 3C1DA 3JTHA 2DI3A 2O3FA 1R1TA 1I6XA 2QUFA 3KE2A 4XLNF 1BIAA 2EFOA 2ETHA 2R3SA 2V1UA 2HKOA 3GZ5A 5HS7A 4MQ9F 1YLFA 2CYYA 1ON1A 4PGHA 3GW2A 1ZRCA 4AWXB 1BIBA 4Y17A 4EGZA 4KN7X 2LDUA 4M73A 4HF2A 2Z99A 5DUKA 5DCFA 4M9XA 3K1MA 1SAXA 2COMA 5D5UB 2BGCA 4WXHA 3T5XA 3DPLC 3HUGA 4RGSA 2Z3YA 1U6GA 3E6CC 1J9IA 3GXOA 1SD4A 3F3XA 2DT5A 4EJWA 2VN2A 2FXAA 3C3WA 1IXCA 4U0WA 4EM2A 2ZCWA 3L2CA 3DF8A 4K2EA 1NHAA 4R8HA 3NEUA 1EH7A 1RIOH 3VFZA 3HHHA 3LQQA 1U3EM 1ZRFA 2ISYA 1VTNC 4P55A 1V3FA 1ZLKA 2HYGD 4IRHA 4EVIA 2ESHA 2YX4A 2W24A 3I4PA 3HSRA 5IT9K 3ABUA 2FQ3A 2VT3A 2PFBA 2F5EA 2XAGA 1YQAA 1USTA 1UHWA 3CUQC 4A0YA 4WCGA 5J6XA 3RPUA 2EFWA 3WODF 2EV6A 3GO5A 3ZQ7A 5E18F 2LNBA 4M72A 2YSRA 1KYZA 3WE3A 4Q47A 1SMYF 5DCMA 1OKRA 1KU7A 1ZH5A 2M8EA 1SD5A 1KYWA 5LGUA 2FBIA 1ZHFA 3E6DA 1PUEE 2FNAA 2RC4A 1ON2A 5E17F 1HXDA 1IUYA 1ZARA 5L3DA 1BBYA 1ZG1A 1XSDA 5E8IA 2ADUA 2DU9A 2P5VA 1EH6A 2UZKA 1TLHB 5CVUA 3D5LA 5JFRA 3TKYA 1QPMA 4YIFA 1F9NA 3KEOA 1U5TA 2A3SA 4ZYGA 1U2WA 4HX7A 2HR3A 1HKTA 2NYXA 2ZNYA 1OPCA 4BQAA 1S6LA 4M71A 5K5OA 4G94A 3F23A 1T6SA 3HTSB 2H09A 5ICEA 2OZ6A 2OA4A 1RNLA 4ZZDA 2K4JA 5E1XA 4N9HA 4UHTA 3WU0A 3MFKA 1IXRC 3R0AA 2JRTA 4S04A 5LEKA 2M1BA 3E5UA 3TDZC 3GX4X 3K69A 3TQNA 1QZZA 2QENA 4CZZA 1IW7F 3IL2A 3O3KA 5ILVA 3DXJF 3H3UA 3C7JA 2PBIA 2STWA 2WWYA 3P9CA 5AONA 2CWEA 2QQAA 1CGPA 3ZMVA 1EH8A 2DTRA 1JGSA 2RGVA 4Y15A 1JE8A 1FNNA 4U0VA 4PDKA 2ZBKA 2L02A 3T8RA 2IVMA 3TOBA 2ZMEA 3FF5A 2X0LA 4I0BA 5CVVA 4ESJA 3JW4A 2O8XA 1I27A 4GO1A 2M30A 2V9VA 3BJOA 1XCVA 2W57A 5DD8A 2Z9OA 4HV5A 2E7WA 2D1VA 1JHHA 2DFIA 1DDNA 1O7FA 5LLQA 3L9FA 3SQNA 3WTXC 1K78B 2FBKA 4A12A 2A6EF 6PAXA 3L7WA 2PLYA 3HYIA 4M9ZA 5H6RA 2MA3A 1PDNC 4BYYA 1FBQA 2G7HA 1BN5A 1DP7P 2D1HA 1IN8A 4KICA 2ISZA 2RKHA 1Z7UA 3RKYA 4OIPF 1GXPA 4RB3C 4MGRA 3WE2A 3FXRA 1HW1A 5CVIA 4FX0A 2XAHA 4LGWA 4B09A 3P7NA 5JVTA 3BPVA 4LG0A 2PG4A 2V1DA 2JSCA 5AIQA 1W7PD 3J80Z 2OQGA 4YFKF 2P4WA 3QAHA 2XAJA 2IPQX 1FLIA 4LLGF 1XCBA 4ETSA 3I58A 2W85A 2VOPA 2F5DA 2BEOA 2LKPA 5BPIA 5L3EA 2QBYB 4HDVA 4KYWA 2BYVE 5DD4A 2DK5A 3KETA 3U9GA 1S29A 2GA2A 5EEGA 1JXSA 5E20A 4A5NA 5HS9A 1G4DA 3VB2A 1YW9A 1LVAA 2RDPA 2CG4A 3V8KA 5FGMA 2CQKA 3WU1B 1HQCA 5LRRA 5D8LB 1Q1HA 3S2WA 3K1NA 2OQRA 4LK0F 4YFXF 2FE3A 5HVQC 2WC2A 1P4XA 4IXAA 1P6RA 3J7AO 2LSOA 2QVOA 1MD0A 4BAYA 2PJPA 2OZUA 4DNCA 3GWZA 1J59A 3LA2A 5FD5A 1CF7A 3ZPLA 4OIQF 4MHGA 1IF1A 2ZMEB 4HLXA 3ZMDA 2A69F 2KIFA 3I59B 4KIFA 4IF4A 1O3SA 4IRGA 2EA4A 2MLKA 4ENNA 5HDGA 4PCQA 1BI0A 2L4MA 4N9IA 1WSUA 1S7OA 2UXXA 1TW3A 3F8CA 5LRSA 2K86A 3LA7A 1IN4A 3SZTA 1T98A 2GAUA 1QZYA 1I1GA 4IVNA 4HF1A 3QU3A 1HSTA 3JSOA 5DUIA 1JHFA 4FX4A 2YX7A 2ZJ2A 5J8CA 3DKWA 1YG2A 5L3CA 3I59A 2W25A 4CGZA 3ML6A 1T38A 2DPDA 3ERED 4R1HA 3I64A 4ENKA 4Q48A 2ZXJA 3PFIA 1H9GA 3P9IA 3G3ZA 1B9MA 1W7PA 3BZ6A 4ASNA 2XROA 4ENJA 2QQBA 4PGGA 1UHMA 3FM5A 3WGGA 4JQFA
chains in the Genus database with same CATH superfamily
1OCTC 3QPTA 3M1CA 1FT9A 5C4XJ 4WXCA 2LREA 2VB6A 4HRIA 4NQWB 1FMWA 1R4MB 4P9UA 1HKQA 2Z16A 3MCZA 2O8KA 1X3UA 4XICA 3LSTA 4XONA 2P7CB 2W1OA 1LKXA 5BPDA 3MAJA 2CGPA 1WPKA 3K4KA 1U78A 4M74A 1U5TC 4IQ4A 5H6QA 5DS9A 2R5YB 2EB7A 3N4MA 1AOYA 1P7IA 3CMEI 3S32A 4NNJA 3DTEA 5H20A 4UVCA 1RUOA 4BGDA 4LJZF 4BEHB 2KRCA 5BMZA 2WA0A 4ZYHA 2CH0A 4U88A 1X1BA 4Q4ZF 2PMHA 2VODA 2O5RA 3F8FA 3DFGA 3PFYA 4HOBA 2J5PA 3BG7A 2BHYA 1TQIA 3G1OA 4BHBA 4B4CA 3ULQB 1XB4A 2A68F 2X51A 3KLOA 2CJJA 5HLHA 1P9QC 1FZPB 3KCCA 1CF7B 4I02A 5IP7J 3VYUB 1OMIA 3ABMH 1JKQC 3KP7A 1H9TA 2DJNA 4A3KJ 3U2RA 3V7SA 1R4NB 5DV5A 3PO3J 4CDGA 2YU9J 2XIGA 1KQ8A 1PYVA 2H1KA 4HYEA 3LOCA 2MC3A 1YX5A 2VC1A 3K4CA 5ED4A 4FE4A 1S8NA 4D7MA 3OYGA 3BROA 1ZGJA 1WJFA 5HLTA 1A36A 1MBKA 3FDYA 1OCOH 3BT9A 3U21A 2D2WA 1YO5C 2E71A 2WAQA 3FXMA 1D0XA 1BM9A 2KL4A 4IPAA 3SFIA 2M4KA 4U87A 1WHUA 2F5FA 4I0AA 2GOXB 2L7ZA 3TP0A 4L0ZB 2VQCA 3KP5A 5FJ8J 2R7DA 4LOCA 2MFZA 5CKTA 4LIVA 2UXNA 3BC8A 4AYBA 2DFHA 1R5ID 1XTAA 3HOSA 4KT5C 1GLNA 3CO7C 2Y31A 2NNYA 1IZ1A 1OYYA 1Z0XA 3H5RA 3TOAA 3KEQA 5JHFA 4DBQA 4G6TB 4YG2F 3HUGB 2Y9ZA 1YIOA 2E5ZA 3DEEA 2KJCA 3KEYA 4AIHA 4D0PA 2OV7A 1FSHA 2DMUA 4C3IJ 3CDHA 4V19K 1W5TA 3BJAA 2R7FA 2M7BA 4FQGA 3PJRA 2EZIA 2CMPA 3A2KA 2E36A 2L7MP 2HQRA 2L54A 3S17J 3UR3C 9ANTA 4A5MA 3EPZA 3KZZA 4D5FA 2QZ8A 4UV8A 2JPCA 2YR2A 1R71A 4RAYA 4E4HA 5J8FA 1GVDA 3ZQLA 4HX4A 3GYHX 1K79A 3C2GA 3FKIJ 2CFOA 3LA3A 4H4KC 5C44J 2DYSH 3DV8A 3TW7A 4HDUA 4JX6A 3M8EA 3CJNA 3V7CA 2DOAA 2M45A 2MABA 1X19A 1SFUA 4A3JJ 1ZREA 5IP9J 2DFEA 3BOQA 1VZ0A 2OD5A 4JX5A 3TMOA 5JLWA 3TP3A 1LDKB 2HOEA 4HNVA 3FXQA 5FRNA 1MZBA 2BHZA 1BI1A 3HSFA 4RDUA 4NQWA 1JGGA 2YU3A 3QP5A 2VE8A 2R7RA 5B5EC 1GVJA 3HL2A 2O0YA 1BR4A 2XAUA 1JI8A 2X6YA 4XOPA 2QQ8A 3EYYA 3VWBA 3RJPA 1TL8A 3ZMZA 1BC8C 4KITB 3PIOF 5LGTA 2R5YA 2RREA 1KU2A 2BVLA 1Z7LA 2DA4A 2VI6A 1JKRC 1CQTA 2VXZA 2OPTA 4GYIA 2VJ5A 3AAFA 4FT8A 2IGKA 1K7AA 1HF0A 1ETWA 2CW0F 3RIRA 3W6JB 2L9RA 5F08A 3BTCA 4KMUX 3E6BA 3ECOA 4NBQA 2OTLI 5LHHA 2IW5A 4LD5A 4P9FA 3B73A 3FZVA 4ZYEA 4EMSA 1K4SA 1XX5A 1LDJA 4BE2A 1MJ9A 2KMUA 1FY7A 2W4SA 5K7HA 5L3BA 4CCLA 1YITI 1I5ZA 2R7TA 3CCYA 4WWCA 4U0YA 3R4KA 4E7SA 2MG4A 2DJIA 3CUQB 2ZXWH 4RA2A 3RI4A 3G1LA 1P4WA 1OCZH 4HPQA 3GUDA 3JTGA 3JAMZ 3BZCA 1EV7A 2YPRA 2DMNA 5LEJA 2NNNA 3CLOA 2BY0A 3VSKA 1M1EB 1U8RA 2VQGA 2VJJA 2F4MB 3BCAA 3JRHA 4MQVA 4IQJA 3GFIA 3Q9SA 3IP4B 3PM1A 4GXOA 1VQ5I 2HDDA 3PNTA 5KVRA 4BQOA 5E3MA 2BBYA 2FEZA 1Z91A 2MW8A 1ZGWA 1ETKA 4A0XA 5F1JA 1LE8A 1R5HA 5D4SA 4C2TA 3I54A 3M8FA 1DU6A 2E2IJ 1RUNA 4E7ZA 1QHGA 2XUBA 3PNYA 3H1CA 3PSFA 4WK8F 3FWEA 1Y56A 3IHUA 3IWZA 2XSDC 4G9YA 2HFHA 4L0YB 3FMQA 1Z67A 3G4SI 2NOGA 1AWCA 3GFLA 3SFZA 3A03A 1LEAA 1JUPA 1YHQI 2IJLA 3HOWJ 3WGHA 4U7DA 4IL6C 3DLAA 3IAS2 3HRMA 4BBRJ 5DM6F 4RLFA 2Y30A 4PJ0C 1SFOJ 1WKMA 2KIUA 3FM3A 4B3XA 4A69C 5GTHC 2ACJA 1EA3A 3OY9A 2D45A 4RM2A 4I7HA 2F4OB 2J5OA 3DQVC 1UFMA 5J47A 3MD2A 4YRVA 3IKVA 3CESA 4I2OA 4Y4RA 3GZ6A 4E7HA 4LLNA 4L9TA 4G8XA 2Y48A 5IPAA 1GV2A 2XSJC 3KP2A 1WJDA 1PP8F 1E2XA 2XF5A 4CH7A 4HQMA 3DP7A 3OYDA 1KU9A 3JRFA 5TJJA 3KP3A 2F48A 4UB8C 1I3QJ 4XN3A 4PZJA 5B1BH 1WH7A 2NS0A 1IN5A 2HDCA 1RI7A 1BOBA 1FEXA 3OYNA 1ZGAA 2DMTA 3ABLH 4F91B 4EEFG 5LD2C 1D5VA 3T0YA 3FMSA 1HC8A 4DYQA 3O2PE 2NVTJ 2XASA 1RC9A 2WY7Q 1ZG3A 4V2GA 1LFUP 2V1XA 4WX9A 2H6BA 5DDGA 3NWTA 2BV6A 5JR3A 4A2UA 3BR2A 4A6EA 3TO6A 4BNCA 3L1PA 1LEBA 1MNEA 2LKSA 2HQ5A 3AKZA 3OYBA 3I71A 1OCPA 4S0HB 1X2NA 3BG9A 4B48A 3R60A 4G6DA 1SMTA 3A01B 4MNUA 3ONQA 1MDMA 1O3RA 4I09A 1DPUA 4MTDA 4J00A 2A6TA 2ELKA 3HOXJ 2GOMA 3ZOBA 2P6TA 1UMQA 3SEZA 4BDYA 2GIZA 1Z6RA 1Z77A 2VOOA 3G6EI 2WBMA 4N0BA 5E1WA 4B44A 1IUFA 2HXIA 1IG7A 4NC8A 3KZIC 3RKXA 1WJAA 2GWRA 4G7HF 4BU2A 4CYDA 4KIBA 2HVSA 3RZDJ 2WAEA 1G3SA 1TT0A 3JREA 1Y0UA 3EDPA 2X6OA 2LF7A 4HNTA 4JK1X 5J1RA 1OR7A 3MEXA 3ZP5A 3S3MA 3BDDA 2JTVA 3FXUA 3TGNA 1U9OA 2CO5A 1S9HA 1TBXA 1X4OA 4DQ2A 2K9NA 1VI0A 2BXYA 3CDLA 3F8MA 4YFNF 1MGTA 1QRYA 2IXSA 2ZSHB 2R5ZB 2RVCA 1HOMA 2JVGA 2MH9A 1ZG5A 3K2AA 3GTOJ 2HVQA 3BR5A 5HOOA 5CLSA 4FCYA 3P9KA 2IGMA 2L9NA 3O6BB 5E3NA 3HOUJ 2LYCA 1JKPC 5EGOA 1Y1WJ 3AL0C 3BR3A 1MDMB 1I50J 3GMEA 1XGSA 5FO5A 4P96A 3CCLI 1FC3A 3BLYA 4M6XA 1YRNA 3RQ4A 1T39A 2LG4A 1IO2A 1TNSA 3FHZA 3SHFA 2HGCA 1BJZA 1QGPA 1J7KA 4CHUA 3ZQCA 3ZN0A 1NK3P 1WJBA 4FE7A 2HOTA 4IHTA 2PN6A 3M8JA 1VQNI 5F6FA 3W6KB 3JRAA 3ZMSA 3OSFA 1FBUA 1X4PA 4M3EA 5K1YA 1SAUA 1TP4A 3KP6A 2JPBA 2Z5UA 3LSKA 3TBIA 2CFXA 1WWXA 4QWQA 4HV6A 3KLNA 2BY1A 3AG3H 3CF5F 3M4OJ 4M6VA 4BQNA 2FMYA 2CV0A 2LH9A 1K6YA 1AA7A 1GUUA 3ZN1A 1WI3A 5D8KB 2G9WA 1JT6A 2GQQA 4EJTA 1K83J 2IA1A 4LLLA 3K9TA 1O57A 2A5YB 2XGXA 3BTIA 4XBFA 1GXQA 3I53A 3S3NA 1HLVA 1FX7A 3E6MA 4ZC3A 2FOWA 4CZCA 3GLXA 3CCEI 3ZQIA 4B8XA 2CQXA 1BI2A 4PFPA 3E7LA 3LWFA 1V4RA 2V6CA 2JK3A 3CTAA 3VODA 4BY7J 1F4KA 1WJCA 2HPMA 2WV0A 4L9JA 5CPRB 3H92A 2CV1A 5BOXA 4MEXF 2RNJA 1TQMA 5H2FC 5M5YJ 2A07F 4Y13A 3DBLB 2R93J 1EF4A 2CQQA 5A2QK 3BWGA 4KA4A 2DODA 1TQPA 4GCVA 3T1BA 2A61A 2GA1A 5IOYA 3OL3A 5J4YA 4BXFA 4ZZLA 2V6EA 1Y0NA 2LTPA 1VQ9I 4EM1A 3J7ZI 3H5NA 1BI3A 3LSMA 4N4NB 4HSTA 4EGYA 4CXFA 1DGWY 1ITYA 1G3WA 3WTTC 4HW0A 2B0LA 1ETXA 2EA2A 2LLKA 2EINH 2AHQA 5IP6A 3L2RA 3CUQA 4R79A 4BHCA 4IEJA 3HRSA 3KFWX 2NXNB 1J2XA 4PJJA 1ONVA 1STZA 1LJ9A 3OOPA 3OSGA 1R9TJ 2K85A 3RQIA 3DTKA 1LVKA 3CO6C 3K4JA 1BW5A 3PIPF 1SC7A 2OC6A 3DPTA 2VBZA 4DW6A 3LQRA 5IT3A 3V8JA 1SVOA 3TEDA 2FF4A 1XMKA 3FKJA 3ECHA 1TWHJ 3QPSA 5IY5H 2IRFG 3L09A 2W84A 2KJBA 4XLHA 2EWNA 2Y0MA 3CUOA 2P6SA 4OOIA 2Q0OA 2Q8KA 3GVAA 2MD5A 3QWLA 4OMYA 4BHPA 4IHSA 2JSPA 1SVLA 2TRTA 2FA5A 2KKOA 2DPUA 1YTYA 2PMZA 2E1NA 4D7NA 2BY3A 1FMVA 1OR7C 1KQ0A 4M9SA 2IP2A 3CCRI 1F1ZA 4GRIA 1F36A 4RMNA 4UVAA 5IT9Z 4AIDA 3MQ0A 4HBLA 2ZC2A 3ASNH 3E97A 2O03A 2NAZA 1E17A 2QWWA 4I99C 5FLMJ 3NQOA 1UCRA 1REPC 3GTQJ 3K10A 4J19A 3E3VA 4XSXF 3TDUC 3U1DA 2DLLA 1OJLA 4E7IA 3Q5FA 2VPRA 2VONA 2KISA 1XGNA 2XAFA 5HS8A 2LF8A 1G8XA 2DMPA 2VASA 3OWTA 1WJEA 3QOPA 5FKOA 4NC7A 2EJRA 2IEKA 4KJZA 4G7ZF 1R22A 4AIKA 4UV9A 1GHCA 5D5XB 2Q2EB 3PQKA 3SEQA 2LR8A 1W4MA 4M6YA 3F8NA 3QYBA 1IRGA 2ZKZA 1DUXC 2WAFA 3BTLA 1WI9A 3OIQA 5HDNA 3FBNB 4UNOA 2P81A 2RN7A 2C6YA 5L3GA 3BP8A 5BQTA 4RGUA 3V7RA 3F8BA 1WQ2A 4OIRF 5FLXZ 4A3EJ 3Q3SA 2KDZA 1XD7A 4ESFA 5J40A 1WCMJ 4RBOA 1G3YA 3SDGA 5D4RA 1HCRA 2HVRA 2P5KA 3ZMUA 2M5WA 3RPQA 1NG6A 4EV0A 1LQ1A 1Z05A 1KQ9A 5IOZA 4NHJA 2EV5A 3AG2H 2CU7A 2O6GE 4WF2A 2E34A 3HJEA 3I5UA 1MSFC 4HLYA 2VUMJ 1IN7A 3H9JA 1FBSA 2DAOA 4UUSB 3IH4A 2X85A 5M5WJ 2HXOA 5DCMB 2LY9A 2YS9A 4RB2C 4XL9A 1XMAA 1TZLA 5KCMA 5GP9A 1XG1A 1ETVA 4O3MA 2X6WA 2JA6J 3FBIB 3WTUC 1QHHD 1HA8A 3ELKA 2VIXA 5GAEJ 1J5YA 4XLPF 1IXSB 3S15J 1UB9A 3LSGA 3S93A 1W0UA 2Q2EA 4MLOA 2L3DA 3TL4X 3QPHA 4RLQA 2XB5A 5CQGA 3MZYA 3H3VK 2MD0A 2ZFWA 3ROUA 5F04A 3DU6A 3W3CA 3RPUD 2PI0A 1R23A 4DYRA 1R1VA 2VJ4A 2QA4I 1UG0A 4KN4X 1XDSA 2HOAA 4KFCA 2JA7J 3DBHB 3V42A 5E79C 4A93J 1OYIA 2FBHA 3DPUA 2FMLA 1FYMA 1MBFA 2DQLA 1WRJA 4QPOA 3KP4A 4XR6A 2Z33A 2VL8A 4RGRA 3O8HA 3IV5A 2OU2A 3S14J 3NRVA 1ACIA 1D0ZA 1G59A 3K4LA 1LPQA 2R7SA 1YOVB 3IWFA 1A6IA 5CVJA 2HTJA 4F7ZA 4Q5SF 4RM3A 2QEXI 2K27A 1B4AA 3HTUA 2K3FA 4D9JA 3R6SA 4L18B 1PUFB 1QBJA 3L2VA 2HKXA 1ETOA 1OLTA 3MKWB 2XGDA 3EYIA 3TO9A 2M7AA 3B02A 1DGRM 5EEHA 2GBYA 1IRXA 3BR1A 5HLIA 4H0EA 2OUMA 4HQEA 1OFCX 4BACA 3UNGC 2JA5J 2QF7A 5KNLA 4I01A 1Z21A 2Y75A 1S5LC 1POGA 1BW6A 4DYCA 1XMXA 4F52A 5KK1A 3PL8A 3OS2A 5IYBJ 2V79A 3M9AA 3HDDA 4DJAA 2KIMA 3OR1C 3PSIA 3LNQA 2BW3A 4Z2YA 2VLAA 5D5WB 2GZWA 4NDLA 1R58A 3BPXA 1FWZA 1KGSA 1U5TB 2OAZA 1JTXA 3HGGA 2K4BA 1SFEA 1ZLJA 3QP6A 4PJLA 5JHUA 4BEHA 2LFBA 3CMYA 3X2QH 2E5NA 2VBXA 3CJTB 4L9VA 1HSJA 2IT0A 4BKXA 3ESWB 4ZYDA 2EV0A 3S3OA 3OYHA 3W6VA 2V7FA 4B43A 2P5LC 1ENHA 2HS5A 2BVMA 3F0CA 2E1OA 1O7LA 1Q1VA 5D5VB 4CCJA 3J81K 4FTHA 2Y2ZA 2IAIA 5EG0A 1YS6A 3RYPA 1S7AA 2ELHA 4C3JJ 3ZQHA 4LITA 4IJAA 2K7LA 3GEZA 3LAPA 3H36A 3KYLA 4L5JA 3JSPA 2NVXJ 2GIVA 1BJAA 2BXZA 2F5VA 4UUSA 1BC7C 2L7FP 5K7FA 4AM3A 2M3AA 2VJIA 3LSRA 2E7XA 5FKMA 1R7JA 2UV1A 2JRMA 1TWFJ 4AUXA 4W97A 2XKPA 5F0CA 3CC2I 3MKZA 3EQLF 3QYFA 1J75A 2QQ9A 3HKZN 1BA5A 3ZQGA 3L2UA 2ECBA 4HG2A 3WGIA 2ME0A 3ZCOA 3HGYA 2DBBA 4OIOF 1P2FA 3REOA 1FYKA 3W2VA 2G0EA 2ICWG 3H35A 3FXJA 3CJQB 2WTEA 1K78A 3WTVC 3SXYA 2W7NA 2MH2A 5E8GA 4OINF 1YX3A 3H0GJ 4PUSA 4LMYA 1DPRA 4GGGA 2XHKA 4I98B 2QSGX 1XPXA 4EQQA 1XSXA 3RZOJ 3CQZJ 2EILH 3EETA 1YJ9I 1WJ5A 1MMSA 2R7QA 1TTYA 3CP2A 4OU0A 5L3FA 4U7BA 3C18A 3R61A 3CCSI 5GPAA 1SD7A 2EFNA 3JRBA 4PJNA 2X4HA 4RB0A 5D6FA 3BJ6A 3MZHA 1Y39A 4UUVA 2FRHA 5FB2A 3J7AY 5BS6A 1S3JA 1RZ4A 4DZPA 1IDZA 2HZDA 4XSZF 4DOZA 2VKEA 2XAQA 2HEOA 2IA0A 3W2WA 3J80K 3TO7A 3HOTA 2L4AA 2FD5A 4ESBA 3COAC 1Z1DA 3IAM2 4AD9A 1YS7A 4OAZA 4ITVA 2EBIA 1QNTA 2DN0A 2XB0X 1NH3A 1JUSA 3QRFF 5E3LA 4HA8A 1D1CA 3S1NJ 2DA7A 2HWVA 4KNYA 2QM3A 1OISA 1MJAA 3PNVA 4BE1A 1FJLA 2VKDA 1D5YA 2DA3A 1QVUA 2VPLA 4F3QA 3WHCA 1GT0C 1FP2A 4EATA 2L2OA 2OF7A 1AU7A 3IC7A 3JRIA 5LFAA 3KYCB 4O6JA 4NUBA 1X1CA 4XLFA 2FU4A 2IS6A 3QYEA 4RGXA 4F55A 2KRFA 2ME6A 3VYSB 3S16J 5EYRA 1DQUA 4LB5A 3A0HC 2G7UA 2RQPA 2ZB9A 1J09A 1FSEA 2X1CA 2R4GA 5FROA 4DZJA 2FJ1A 2H27A 4Z6YA 2QGUA 2K9LA 2QCOA 3RKWA 2IS4A 5J1YA 1J0RA 2DA5A 1X1PA 4ZDOA 4XNFA 5JI6A 2HYFA 5J4VA 1B1BA 2CS3A 3I0TA 3MKLA 3CCJI 2JZYA 3GTJJ 2HU9A 2M2EA 5A2QZ 1RESA 2K02A 1RR7A 1D8JA 3WTSC 2QLZA 3WTZA 3JRDA 1GDTA 4BH9A 1ZELA 1U8BA 4XN0A 1A04A 4IX7A 2GLOA 2COBA 2HNHA 4F93B 2V9KA 2PEXA 2DK8A 3DBRB 4BJ6C 5EF6A 5EG0B 1AHDP 3M1EA 1R5GA 2DO7A 3LFUA 3QU6A 3EUHA 4C30A 1RETA 4B47A 2PMUA 3LL7A 1HW2A 4M3DA 1R6RA 2DTZA 4LG0B 2KPMA 4UXNA 2HZTA 1IRZA 5K5RA 3LSHA 2H94A 3CCQI 2VBWA 1E3HA 2EIMH 1MNDA 2RV8A 1X58A 4YELA 4D5CA 5ERIA 3GFJA 2CUFA 3F72A 3K1PA 4OMZA 4B1RA 1SEUA 4E70A 4EJVA 4NB5A 5LHIA 4AU7A 4J01A 4IHWA 4HAMA 5DM7F 1LE8B 2HPIA 1YW8A 3K4BA 1MSEC 2FSWA 3HB9A 3CC4I 4LK1F 4ON0A 5ILUA 3Q0VA 2F2EA 1FOXA 2QBYA 2JVHA 4O5VA 3DKXA 1B9NA 2AXTC 3R0JA 1R36A 4IO9F 2DXIA 4L5IA 5DYMA 3OYJA 5HLGA 1W5SA 2B7EA 2HTSA 3ISPA 1HDDC 3E0JB 3HZJA 3F6OA 4KUMA 3SZGA 5ICGA 1LUJB 5M3FJ 2K3PA 3CF2A 4KMFA 1O3QA 1X3WB 5CVRA 5LGNA 2TDXA 2FOKA 1APLC 1XN7A 4NC6A 1ETQA 1T0FC 4FISA 1B8IA 3BTJA 1FP1D 3GTLJ 3KZYA 4GYGA 4I6ZA 1QZEA 5DEQA 3H9GA 4HZFA 2X6XA 1Z9CA 4RAFA 4A6DA 3HRTA 1I6HJ 1F5TA 1RPWA 1K6OA 4A3BJ 1MKMA 2JWTA 2M87A 1TW2A 3V4GA 3HOYJ 1YFHA 2LOOA 1D1BA 1HKSA 2DCEA 4XRFA 1T2KA 1N77A 1Z6TA 5M3MJ 4XLCA 2MC4A 2STTA 3K0LA 4BJTA 1RKWA 2EZKA 1C0WA 2AS5F 3OL4A 4BE0A 3WU2C 2NRAC 5E1ZB 1YW7A 4IZZA 3RDIA 2XGCA 2DA1A 4LFUA 3OMYA 3LFKA 2M0CA 1L3LA 3JAMK 2K5CA 2R7VA 1YIJI 1QQIA 3BY6A 3ZMTA 4G7OF 1BL0A 4MIMA 3SZPA 2H8RA 3GCMA 2K9QA 4HF0A 2MBFA 2DT6A 5GADJ 1PP7U 4PSWA 2FUG2 2DT7B 3HHGA 3VEPA 4A0ZA 5ICCA 2EFQA 1LDDA 2XRNA 4QPQA 2UWMA 3HIFA 3FHNA 1IAWA 3BZKA 1QVTA 5FFZA 3D5SC 3HXLA 1HBXG 1R1UA 2K9SA 3H9QA 4UB6C 4RS8A 2ZMEC 1R00A 2VC0A 2W00A 1FPQA 4A3GJ 2E1MC 1H0MA 3L00A 2ID3A 2CSOA 2ZJQF 2PJRA 4A3MJ 1YYVA 1KA8A 5EDNA 1USSA 3GBGA 2XF7A 5AIPA 4CICA 2EK5A 4F92B 4IRIA 3HEFA 4Y33A 3Q0UA 1KZHA 3MWMA 1N75A 2AQEA 3AG1H 3GFMA 4YEJA 3IRRA 3HSEA 2V9PA 1ERDA 2VE9A 1W7PB 2L01A 3WTWC 1E3OC 1SD6A 3CC7I 4A3FJ 2ESNA 4N4OB 4LB6B 3OOUA 4XQFA 4TV7A 4HX8A 3ZRGA 2A6HF 2FNPA 1ZQ3P 1ZYRF 3OIOA 3OV8A 4UY8I 2NS8A 2L9VA 2E1MB 3OYLA 1UG2A 3LMMA 3C2HA 3DWLE 1XGOA 2Q1ZB 2IS1A 4UVBA 1I39A 3CJRB 2NS7A 3IKTA 3E5QA 1P92A 3I9V2 2GXBA 3J81Z 2QYOA 1FTTA 1ZN2A 1PJRA 4BUPA 1A5JA 5FLXK 3M7GA 1H8AC 1FOKA 2ZO4A 3HOZJ 2O61A 5TISC 3F21A 3QOEA 4P1WA 2OBPA 1ZR2A 2NOJB 2BE5F 4A3IJ 2F5CA 1QO0D 2GXGA 2UUZA 2IGNA 3DLLF 3FXLA 2XV4S 3S2HJ 2JA2A 2JT1A 5LHGA 2AXLA 2OJED 1KU3A 2V26A 3ABTA 2I10A 3FK7A 4JBAA 4E7JA 4Y52J 1JKOC 3K2ZA 1VQOI 2LP0A 5F64A 1MW7A 1FIAA 2XVCA 2LKXA 1B8IB 3VSLA 1A6QA 2BOLA 1UHSA 3E5XA 3EUAA 2H1LA 2DDBA 2CQNA 4KDPA 3IRQA 4IHVA 2PQ8A 3JCUC 2AO9A 4QLCU 3HBLA 2L0KA 2DW4A 3BG6A 4KIGA 1H89C 2WY8Q 3WG9A 2P7VB 2MLGA 3S1MJ 4A3DJ 3T8TA 1T33A 1HDPA 1JTYA 3HRUA 1IGNA 2HQAA 1TWGJ 3FMRA 3KYDB 1O3TA 1O4XA 2KHMA 3K6GA 1TNTA 2HQNA 4ENMA 2DQRA 2E1CA 2ZNZA 4BXUA 4WXDA 2JUGA 4ANJA 1VQKI 2M9HA 4G6QA 5LBQA 1X3ZB 5F1RA 1SANA 2XPVA 3H3ZA 3JRGA 4X1EA 3LSJA 2KRHA 1LNWA 1SFKA 3JR9A 2ZXIA 3ASOH 3G73A 5TRDA 1D3YA 2EH3A 5ICFA 3CD6I 1SFXA 4BBSJ 3V8LA 3RYRA 4AVPA 4CO8A 1A35A 4ZH4F 1G3TA 4C3HJ 4EM0B 5K5QA 3GTMJ 3D0SA 3ZXSA 4XOTA 3QPLA 3RTRA 5IYDJ 4IKFA 1ZR4A 2H6CA 3GF2A 5ILSA 3AFHA 2EFPA 4RAZA 1VQLI 2CV2A 3HC7A 4QSHA 4EJUA 1B59A 1WGXA 5FFXA 4M3GA 5HDKA 2GXAA 1WZ2A 3WTYC 2VBYA 4S05A 2P8TA 1D8KA 5FD6A 3FX3A 4C2UA 1MJBA 1XGMA 2LC2A 1T0FA 5D6EA 1BOAA 3FXKA 4YIIA 1T95A 3Q9VA 3DEUA 3E1SA 1IN6A 5C3EJ 3GTPJ 1P4AA 3F6VA 5CJ9A 1OYWA 4EJOA 2DA6A 5BNGA 1JT0A 3PQJA 1L0OC 1AKHA 1XSVA 3PO2J 2XRLA 1H88C 2EIJH 3QODA 2W48A 4XKVA 4RB1A 3F22A 1I1SA 3D5RC 4AIJA 4BJ5C 1ZRDA 2E2JJ 4G12A 1FYLA 3CCUI 2XKOA 1LB2A 3MVPA 2XGEA 1LFBA 1YJWI 1G6NA 1IRFA 2R5ZA 1IV8A 2R7XA 1XDUA 1IJWC 4P5OA 4BXXJ 2HYJA 4FHTA 5CYVA 4L9NA 5F0HA 3VOEA 3CCVI 3LAJA 3P5JA 1ZAOA 4MTEA 1B6AA 2IA2A 3N97A 4MEYF 3EUHC 2Z2SB 1IDYA 2VT2A 1VQPI 1ULYA 2A5WA 3G1MA 3SYTA 1ODDA 2HDWA 1GV5A 1HW5A 3C1DA 3JTHA 3PUBA 2EQRA 3IH3A 1RR8C 2DI3A 1V5GA 2CQ7A 2O3FA 1YRNB 1YJNI 1R1TA 2M8GX 4Y3OA 1N78A 2WB1A 3DKYA 1I6XA 5C4JJ 2QUFA 5E3OA 2IS2A 3KE2A 3OR2C 3KPHA 1MBJA 4XLAA 4XORA 4XLNF 1G2HA 4IOAF 1VFCA 1BIAA 2EFOA 2ETHA 3BG5A 2B9SA 4II2A 4W1UA 4DGWB 2Y69H 2R3SA 2V1UA 2HKOA 3GZ5A 5HS7A 4MQ9F 3HKZA 2EIKH 2CW8A 3JRCA 2XC7A 1I3AA 1YLFA 4BY1J 4CA0A 4RAGA 2K40A 1V54H 2CYYA 1ON1A 4PGHA 3GW2A 4QTRA 2X1DA 4AWXB 3OYAA 1ZRCA 1BIBA 3G2BA 3K7AJ 4Y17A 1E0EA 4EGZA 4KN7X 2LDUA 4M73A 5K7ZA 1QU3A 4HF2A 2Z99A 5DUKA 4JP0A 1V5EA 5DCFA 4M9XA 4JYKA 4M3FA 5EJCA 2F6CA 1X1AA 2Z1DA 3MKYB 1K4TA 3K1MA 5GTIC 1SAXA 2COMA 5D5UB 2BGCA 4WXHA 2R7OA 3T5XA 3OYFA 3I3LA 3DPLC 3HUGA 2R7ZJ 2TCTA 4RGSA 3M07A 2Z3YA 1U6GA 3E6CC 1J9IA 3GXOA 5B66C 1SD4A 1JUMA 1VQMI 2JN6A 4ZTJA 2M4GA 3F3XA 1R49A 1IC8A 1Y6IA 3OS1A 2DT5A 2V4JC 4EJWA 3OIPA 2VN2A 2CW7A 2WV1A 4II3A 2FXAA 4CYCB 1TWCJ 1MMNA 2LVSA 1Z3XA 2OTJI 5JVGF 3C3WA 1JJ6C 1IXCA 4U0WA 4EM2A 2ZCWA 3L2CA 4C9YA 1MIJA 2JJ7A 3DF8A 4K2EA 1W0TA 1NHAA 4R8HA 3ZR8X 3ERMA 4YIRX 2YUSA 3NEUA 1EH7A 3A02A 3NARA 1RIOH 1EJ9A 3WG7H 3VFZA 1Y1VJ 3HHHA 3LQQA 1U3EM 1MBEA 2X9DA 1ZRFA 1JJ8C 2ISYA 2LK2A 2KZGA 1BR1A 1VTNC 4P55A 2ZJRF 3SJMA 2VQHA 3ZQFA 1V3FA 1ZLKA 2HYGD 4IRHA 4EVIA 2ESHA 2YX4A 4XKCA 4XRMA 2W24A 4DIQA 3CLQA 3I4PA 3HSRA 4X0GA 5IT9K 3L2QA 1VNDA 3ABUA 3FK6A 4LG3A 2X48A 2FQ3A 2VT3A 1B72B 3N05A 1S7EA 2PFBA 3UKGA 2F5EA 2Y0SN 2XAGA 1YQAA 1USTA 2QKMB 1UHWA 3CUQC 1EKEA 2PX9A 4A0YA 4WCGA 2LRDA 3RPUA 5J6XA 5FKKA 2EFWA 3WODF 2EV6A 3GO5A 3ZQ7A 5E18F 1ORKA 2LNBA 2RAEA 4JOMA 4M72A 2YSRA 3SDBA 1KYZA 3WE3A 4A3CJ 4CYCA 5TGTA 4A3LJ 3K70C 4Q47A 3A0BC 5FRMA 1SMYF 5CQEA 5DCMA 2KP6A 1OKRA 2D5VA 4X6AJ 1KU7A 1ZH5A 2M8EA 1SD5A 1KYWA 2E60A 2I5UA 5LGUA 1UAAA 2NVUB 1PUFA 2FBIA 1ZHFA 3E6DA 2QSFX 2RQQA 1PUEE 3CDIA 4ZJZA 2FNAA 2RC4A 1ON2A 2XPWA 1TT5B 5E17F 1HXDA 1IUYA 1ZARA 4B3AA 4OAYA 1MBGA 5L3DA 1BBYA 1ZG1A 1XSDA 5E8IA 2KLOA 1UZCA 4GDFA 3K4NA 2ADUA 2DU9A 2P5VA 1EH6A 2WAQN 4JX4A 1TLHB 2UZKA 5CVUA 1W36D 3D5LA 5HNFA 2AQFA 5KAIC 5JFRA 3NWSA 3TKYA 5B3SH 1VQ7I 4I76A 1QPMA 4YIFA 5B1AH 1F9NA 3KEOA 3MN2A 2VKHA 1U5TA 3HPHA 4KISA 3AL0B 3A01A 1RKTA 2A3SA 4ZYGA 3HPGA 4E6KG 1U2WA 3J7YJ 2CUZA 2ZJPF 4ZTFA 4HX7A 4IHYA 1W1WE 2CUEA 1YE9A 2HR3A 5EGOB 1HKTA 3BQZA 4IOCF 2NYXA 2ZNYA 1OPCA 4BQAA 1F43A 1S6LA 4M71A 5K5OA 3IH2A 4G94A 3F23A 1T6SA 1NK2P 2L9SA 3HTSB 4XMYA 2H09A 5ICEA 4PK4A 1FIPA 2OA4A 1RNLA 2OZ6A 2MSYA 5J3LA 3HOVJ 1E3PA 1D1AA 3FXOA 4ZZDA 3OYMA 1VF9A 2K4JA 3TW6A 3B6CA 5E1XA 1FOWA 2KZVA 3KX2A 3PUFA 3CMMA 4N9HA 4UHTA 4KT6A 3WHBA 3WU0A 1VQ4I 2XDVA 3MFKA 1IXRC 3R0AA 2JRTA 1BR2A 4AC0A 3RSNA 5LEKA 2M1BA 3E5UA 4S04A 3RKQA 1DP3A 3TDZC 5GAHJ 3GX4X 3K69A 3TQNA 1QZZA 2QENA 4CZZA 1IW7F 3IL2A 1AKHB 3VPRA 2Y9YA 3O3KA 5ILVA 3VYTB 1K61A 5EZHA 3DXJF 1XS9A 3H3UA 3C7JA 5FKLA 2PBIA 2BZTA 2STWA 3I4NJ 2LBFA 2WWYA 3P9CA 5AONA 2CWEA 4HSRA 2QQAA 1CGPA 3ZMVA 1EH8A 2DTRA 1JGSA 4M3BA 2RGVA 4Y15A 1JE8A 2JA8J 4PSXA 1FNNA 2P0WA 3OYIA 5HNHA 4U0VA 2EZHA 4PDKA 2ZBKA 4FETA 2L02A 4XKWA 3T8RA 3LSPA 2KDOA 4BS9A 5JLXA 4XLEA 4ZYAA 3FIWA 2IVMA 1D0YA 2EPFA 3TOBA 2V1NA 3S8PA 4XM3A 2ZMEA 3FF5A 2X0LA 3CP8A 4I0BA 5CVVA 2ECCA 4ESJA 3JW4A 5J1UA 3U1KA 2EZLA 2O8XA 1I27A 1U9NA 2BY2A 4GO1A 2M30A 2V9VA 3BJOA 1WH5A 1XCVA 2W57A 5DD8A 2JMWA 5FKNA 2Z9OA 4HV5A 4DBRA 2E7WA 2D1VA 1JHHA 2DFIA 2O7OA 1DDNA 4XIDA 1OQYA 3GTKJ 5F0FA 1O7FA 1TWAJ 3AG4H 2DMQA 2DOEA 5LLQA 3QQAA 3L9FA 3SQNA 3WTXC 4D1QA 1W36C 1K78B 1SVMA 2FBKA 2FX0A 3DU5A 4AYBN 4A12A 2A6EF 3BG3A 3MMYB 3L7WA 2PLYA 6PAXA 1MBHA 1RRJA 3HYIA 4M9ZA 5H6RA 2MA3A 1PDNC 1FOYA 3S1RJ 2LD5A 4BYYA 1FBQA 1QA6A 2RNGA 2G7HA 1Y8QB 3GTGJ 1BN5A 3G71I 2WB1N 1DP7P 4E7LA 1NTCA 2D1HA 4PJMA 3H0DA 1MMDA 2M0MA 1IN8A 4KICA 2ISZA 4XRSG 3FISA 4LIUA 1VQ8I 2W82A 2RKHA 2E19A 2VQLA 1N25A 3A1YA 3I55I 1Z7UA 3OYCA 3D1NI 2DOFA 3RKYA 3HG9A 1A31A 4HEA2 2OCEA 2DFFA 4ZDLA 1GXPA 4OIPF 5FLVA 1MNMC 2LY1A 3K70D 4RB3C 1Z3YA 4MGRA 3NAUA 3WE2A 3FXRA 3L2WA 3CZ6A 2JQ7A 1HW1A 2ZXHA 5CVIA 2ELJA 4FX0A 2K9MA 2XAHA 4L5EA 4LGWA 1YI2I 5IYCJ 4MFDA 3CMAI 1ZK8A 4B09A 3P7NA 4FASD 5JVTA 3BPVA 2WADA 4BL0B 4LG0A 2PG4A 2V1DA 2JSCA 5AIQA 1W7PD 3J80Z 2ID6A 3BCBA 2OQGA 4YFKF 2L5QA 2P4WA 5KAFC 3QAHA 2XAJA 1DU0A 2IPQX 1FLIA 4LLGF 1XCBA 2DDAA 1V5FA 2E2HJ 1OCRH 3Q0WA 4CSWA 2MGQA 1WFXA 4ETSA 3I58A 5EEAA 3B6AA 2W85A 2VOPA 3DEWA 1S72I 2F5DA 2BEOA 2LKPA 4V2FA 5BPIA 4IHXA 5EZGA 1B72A 5L3EA 2QBYB 4HDVA 4KYWA 3BR6A 2BYVE 5DD4A 2DK5A 3O8GA 4XRSA 3KETA 3M3YJ 3U9GA 1S29A 1PVEA 2GA2A 3BR0A 3S2DJ 5EEGA 1JXSA 5E20A 4A5NA 2LMDA 5HS9A 1G4DA 4BQQA 3VB2A 1YW9A 1ZKGA 1LVAA 2O9LA 2QKLB 3I4MJ 2RDPA 2NVYJ 5M5XJ 1MMGA 4ABZA 3W2AA 2CG4A 3V8KA 5FGMA 2CQKA 4UUTA 3WU1B 2HOSA 4ZDPA 3DTIA 2NVQJ 1FTZA 2LY2A 1HQCA 5KHDA 5LRRA 2R7WA 5D8LB 1Q1HA 3S2WA 2H8WA 3MZ8A 3K1NA 3OYEA 2OQRA 4LK0F 2A05A 1ETYA 2F4IA 2FE3A 2PMZN 3KIOA 4AVZA 4YFXF 2WC2A 5HVQC 4GFBA 1P4XA 4IXAA 2CUJA 4BDZA 3OYKA 1P6RA 1W5CC 3J7AO 2LSOA 2IBDA 2QVOA 1MD0A 4BAYA 3IUOA 2E35A 2R7UA 4OWRB 4E7KA 2PJPA 1XC5A 3A4CA 1X1DA 2OZUA 5DTDA 2Y0SA 4DNCA 3DCFA 2M34A 4QIWN 1X2MA 3GWZA 1J59A 3EUKL 4CCKA 3LA2A 5FD5A 2ZFUA 1CF7A 3S1QJ 4C2MJ 2ZSIB 1NG7A 3ZPLA 4OIQF 2XF6A 4MHGA 1IF1A 2ZMEB 1QPIA 1TC3C 2N8GA 4HLXA 3VYRB 3ZMDA 2A69F 4CCMA 2QSHX 2KIFA 3LSIA 3I59B 2PJRB 4KIFA 4IF4A 1O3SA 4IRGA 1V55H 2FQ4A 2EA4A 2MLKA 2KFDA 4ENNA 5HDGA 2JUCA 4PCQA 2L7KA 1WVRA 4XK4A 2R92J 1BI0A 2L4MA 2OCCH 3VDXA 3I56I 2CRGA 2HI3A 1T56A 4MO7A 4N9IA 1WSUA 1S7OA 2UXXA 1LFPA 4CUGA 1TW3A 2KT0A 1MH4A 4MFEA 3F8CA 5LRSA 2K86A 3LA7A 4PFOA 1IN4A 2KIQA 2VKVA 1Y8RB 4CCOA 4HNUA 3SZTA 3CCMI 1T98A 3OS0A 3F9KA 2XPUA 2GAUA 2MYSA 3ZQQA 1MH3A 1QZYA 2DA2A 5GAGJ 1I1GA 2VXDA 3ABKH 4IVNA 4HF1A 3QU3A 2BW3B 2X1EA 1ZTRA 1UELB 3K4MA 1OCCH 1VQ6I 2LBFB 3H5AA 2B63J 1IV6A 5F27A 1HSTA 3RCOA 1P7JA 2GM4A 3JSOA 5DUIA 1JHFA 2R0QC 1KONA 3GZNB 4FX4A 3C2BA 2DYRH 2IGOA 2KQRA 2YX7A 2ZJ2A 5J8CA 5HODA 4Y7NJ 1T08B 3DKWA 3HM5A 1YG2A 5L3CA 3I59A 2W25A 3GLLA 3ML6A 3ZGKA 4CGZA 4XKBA 1T38A 2DPDA 3ERED 4R1HA 3I64A 4ENKA 4Q48A 1UJ8A 2ZXJA 3PFIA 1U0JA 1T8IA 1H9GA 3P9IA 3G3ZA 1B9MA 1W7PA 1MMAA 3BZ6A 4CCNA 4ASNA 2XROA 4ENJA 3BQYA 2QQBA 4PGGA 1UHMA 3FM5A 3WGGA 5GPCA 4JQFA 2I8DA
chains in the Genus database with same CATH topology
3QPTA 1FT9A 4WXCA 4P9UA 1HKQA 3MCZA 1X3UA 3LSTA 2P7CB 5BPDA 3MAJA 2CGPA 1U78A 4M74A 1U5TC 5H6QA 2EB7A 3N4MA 1AOYA 5H20A 1RUOA 4UVCA 4LJZF 5BMZA 4ZYHA 4U88A 4Q4ZF 2PMHA 2VODA 3F8FA 3DFGA 4HOBA 2J5PA 1TQIA 4BHBA 3ULQB 1XB4A 2A68F 3KLOA 5HLHA 1FZPB 3KCCA 1CF7B 4I02A 1OMIA 3KP7A 1H9TA 3U2RA 3V7SA 5DV5A 4CDGA 2XIGA 1KQ8A 4HYEA 2MC3A 2VC1A 5ED4A 1S8NA 3BROA 1ZGJA 2D2WA 1YO5C 1BM9A 4IPAA 2F5FA 4I0AA 4L0ZB 3KP5A 2R7DA 2UXNA 3HOSA 4KT5C 3CO7C 2NNYA 1IZ1A 1OYYA 3TOAA 3KEQA 4YG2F 1YIOA 2KJCA 4AIHA 4D0PA 1FSHA 3CDHA 1W5TA 3BJAA 2R7FA 2HQRA 2L54A 4A5MA 3KZZA 2QZ8A 4UV8A 2JPCA 2YR2A 4RAYA 5J8FA 4HX4A 3GYHX 1K79A 3LA3A 3DV8A 4HDUA 3M8EA 3CJNA 3V7CA 2M45A 1SFUA 1ZREA 3BOQA 2OD5A 1LDKB 2HOEA 3FXQA 1MZBA 1BI1A 3HSFA 4NQWA 2YU3A 3QP5A 2VE8A 1GVJA 2O0YA 3EYYA 3RJPA 1BC8C 3ZMZA 5LGTA 1KU2A 2VXZA 4GYIA 3AAFA 4FT8A 1K7AA 2CW0F 3RIRA 3W6JB 4KMUX 3E6BA 3ECOA 5LHHA 2IW5A 4LD5A 4P9FA 3B73A 3FZVA 4ZYEA 4EMSA 1LDJA 1MJ9A 1FY7A 5L3BA 1I5ZA 4WWCA 4U0YA 3R4KA 3CUQB 3RI4A 1P4WA 3GUDA 3JTGA 3JAMZ 1EV7A 2YPRA 5LEJA 2NNNA 3CLOA 1U8RA 4MQVA 3GFIA 3Q9SA 4GXOA 5KVRA 2BBYA 2FEZA 1Z91A 4A0XA 1R5HA 5D4SA 3I54A 3M8FA 1RUNA 2XUBA 4WK8F 3FWEA 3IHUA 3IWZA 4G9YA 2HFHA 4L0YB 3FMQA 1AWCA 3GFLA 3SFZA 1LEAA 2IJLA 3WGHA 4U7DA 3HRMA 1WKMA 2KIUA 3FM3A 2ACJA 2D45A 4I7HA 2J5OA 3DQVC 1UFMA 3IKVA 4I2OA 3GZ6A 4LLNA 4L9TA 4G8XA 2Y48A 3KP2A 1PP8F 1E2XA 4HQMA 3DP7A 1KU9A 5TJJA 3KP3A 4PZJA 2NS0A 1IN5A 2HDCA 1RI7A 1ZGAA 1D5VA 3T0YA 3FMSA 3O2PE 2XASA 1ZG3A 2V1XA 4WX9A 2H6BA 5DDGA 2BV6A 5JR3A 4A2UA 4A6EA 4BNCA 3TO6A 1LEBA 3I71A 3R60A 4G6DA 1SMTA 4MNUA 1MDMA 1O3RA 4I09A 1DPUA 4MTDA 2P6TA 1Z6RA 2VOOA 4N0BA 5E1WA 3RKXA 2GWRA 4G7HF 4CYDA 4KIBA 1G3SA 1Y0UA 3EDPA 2LF7A 4JK1X 1OR7A 3MEXA 3ZP5A 3BDDA 2JTVA 3FXUA 3TGNA 2CO5A 1TBXA 4DQ2A 3F8MA 4YFNF 1MGTA 2RVCA 2MH9A 1ZG5A 5HOOA 5CLSA 3P9KA 3O6BB 1MDMB 1XGSA 5FO5A 4P96A 1FC3A 4M6XA 1T39A 3FHZA 1TNSA 3SHFA 2HGCA 1QGPA 1J7KA 4CHUA 3ZN0A 4IHTA 2PN6A 5F6FA 3W6KB 3ZMSA 1FBUA 5K1YA 3KP6A 2JPBA 2Z5UA 2CFXA 1WWXA 4QWQA 4HV6A 3KLNA 2FMYA 3ZN1A 5D8KB 2G9WA 2GQQA 4EJTA 4LLLA 2IA1A 3K9TA 1O57A 2A5YB 2XGXA 4XBFA 1GXQA 3I53A 1FX7A 3E6MA 3GLXA 4B8XA 1BI2A 3LWFA 1V4RA 2V6CA 3CTAA 3VODA 1F4KA 2WV0A 4L9JA 3H92A 5BOXA 4MEXF 2RNJA 1TQMA 2A07F 4Y13A 5A2QK 3BWGA 4KA4A 1TQPA 4GCVA 3T1BA 2A61A 2GA1A 4ZZLA 4EM1A 4EGYA 1BI3A 4CXFA 1G3WA 3WTTC 4HW0A 2B0LA 2EA2A 3CUQA 4R79A 4BHCA 3HRSA 3KFWX 1J2XA 1ONVA 1STZA 1LJ9A 3OOPA 3CO6C 3DPTA 2VBZA 3LQRA 5IT3A 3V8JA 2FF4A 1XMKA 3ECHA 2IRFG 3L09A 2W84A 2KJBA 2EWNA 2Y0MA 3CUOA 2P6SA 4OOIA 2Q0OA 2Q8KA 3GVAA 2MD5A 4OMYA 4BHPA 4IHSA 2FA5A 2KKOA 2DPUA 1YTYA 2E1NA 1KQ0A 4M9SA 2IP2A 1F1ZA 4UVAA 5IT9Z 3MQ0A 4HBLA 3E97A 2O03A 2NAZA 1E17A 2QWWA 3NQOA 1UCRA 1REPC 3E3VA 4XSXF 3TDUC 3U1DA 2DLLA 3Q5FA 2VONA 1XGNA 2XAFA 5HS8A 2LF8A 3QOPA 2EJRA 4G7ZF 1R22A 4AIKA 4UV9A 1GHCA 5D5XB 3PQKA 1W4MA 4M6YA 3F8NA 1IRGA 2ZKZA 1DUXC 4UNOA 1WI9A 5HDNA 2RN7A 2C6YA 5L3GA 3BP8A 5BQTA 4RGUA 3V7RA 3F8BA 1WQ2A 4OIRF 5FLXZ 1XD7A 4ESFA 1G3YA 5D4RA 2P5KA 3ZMUA 2M5WA 3RPQA 4EV0A 1LQ1A 1Z05A 1KQ9A 4NHJA 2EV5A 2O6GE 4WF2A 3I5UA 4HLYA 1IN7A 1FBSA 2DAOA 5DCMB 4RB2C 1XMAA 4O3MA 3WTUC 3ELKA 1J5YA 4XLPF 1IXSB 1UB9A 2Q2EA 2L3DA 3QPHA 3MZYA 2ZFWA 3ROUA 2PI0A 1R23A 1R1VA 4KN4X 1XDSA 4KFCA 1OYIA 2FBHA 2FMLA 1FYMA 2DQLA 1WRJA 3KP4A 2Z33A 4RGRA 2OU2A 3NRVA 3IWFA 5CVJA 2HTJA 4F7ZA 4Q5SF 2K27A 1B4AA 3HTUA 3R6SA 4L18B 1QBJA 2HKXA 3EYIA 3TO9A 3B02A 5EEHA 4H0EA 5HLIA 4HQEA 4I01A 2Y75A 5KK1A 2V79A 3M9AA 2KIMA 4Z2YA 5D5WB 2GZWA 1R58A 3BPXA 1FWZA 1KGSA 1U5TB 2OAZA 2K4BA 3QP6A 1SFEA 1ZLJA 5JHUA 2VBXA 4L9VA 1HSJA 2IT0A 4ZYDA 2EV0A 2P5LC 2HS5A 1O7LA 5D5VB 3J81K 1YS6A 3RYPA 1S7AA 2ELHA 4IJAA 2K7LA 3GEZA 3LAPA 4L5JA 3JSPA 2GIVA 1BJAA 1BC7C 2E7XA 1R7JA 2XKPA 3EQLF 1J75A 2QQ9A 3WGIA 2DBBA 4OIOF 1P2FA 3REOA 1FYKA 1K78A 2WTEA 3WTVC 3SXYA 2MH2A 5E8GA 4OINF 4LMYA 1DPRA 4GGGA 2XHKA 4I98B 4EQQA 1XSXA 3EETA 1TTYA 4OU0A 5L3FA 4U7BA 3C18A 3R61A 1SD7A 2EFNA 2X4HA 4RB0A 5D6FA 3BJ6A 3MZHA 4UUVA 2FRHA 5FB2A 5BS6A 1S3JA 1RZ4A 4XSZF 2HEOA 2XAQA 2IA0A 3J80K 3TO7A 3HOTA 2L4AA 4ESBA 3COAC 1Z1DA 4AD9A 1YS7A 1QNTA 3QRFF 4HA8A 2HWVA 4KNYA 2QM3A 1MJAA 1FP2A 3IC7A 4O6JA 2FU4A 4RGXA 2KRFA 4LB5A 2G7UA 2RQPA 1FSEA 2H27A 3RKWA 1J0RA 5JI6A 2HYFA 1B1BA 3I0TA 2JZYA 5A2QZ 1D8JA 2K02A 3WTSC 2QLZA 3WTZA 4BH9A 1A04A 2PEXA 2DK8A 3M1EA 1R5GA 2DO7A 3QU6A 3EUHA 2PMUA 1HW2A 4LG0B 4UXNA 2HZTA 5K5RA 2H94A 2VBWA 2RV8A 5ERIA 3GFJA 3F72A 3K1PA 4OMZA 4E70A 4EJVA 4NB5A 5LHIA 4HAMA 1YW8A 2FSWA 4LK1F 4ON0A 5ILUA 2F2EA 2QBYA 4O5VA 1B9NA 3R0JA 1R36A 4L5IA 5DYMA 5HLGA 1W5SA 2HTSA 3ISPA 3F6OA 4KUMA 5ICGA 4KMFA 1O3QA 5CVRA 5LGNA 2TDXA 2FOKA 1XN7A 1FP1D 3KZYA 4GYGA 5DEQA 4HZFA 1Z9CA 4A6DA 3HRTA 1F5TA 1K6OA 1MKMA 2M87A 1TW2A 3V4GA 1YFHA 1HKSA 4XRFA 1T2KA 1Z6TA 2STTA 3K0LA 1C0WA 2AS5F 2NRAC 5E1ZB 1YW7A 3RDIA 4LFUA 3LFKA 1L3LA 3JAMK 1QQIA 3BY6A 3ZMTA 4G7OF 3SZPA 4HF0A 2MBFA 1PP7U 3HHGA 3VEPA 4A0ZA 5ICCA 2EFQA 1LDDA 2XRNA 2UWMA 3HIFA 1IAWA 5FFZA 1HBXG 1R1UA 4RS8A 1R00A 2VC0A 1FPQA 1H0MA 3L00A 2CSOA 1YYVA 1KA8A 1USSA 5AIPA 4CICA 2EK5A 4IRIA 3MWMA 3GFMA 3IRRA 3HSEA 2VE9A 1W7PB 2L01A 3WTWC 1SD6A 2ESNA 4LB6B 4TV7A 4HX8A 2A6HF 2FNPA 1ZYRF 3OV8A 1XGOA 4UVBA 3IKTA 3E5QA 1P92A 2GXBA 3J81Z 2QYOA 1ZN2A 5FLXK 3M7GA 1FOKA 2ZO4A 2O61A 3F21A 2OBPA 2BE5F 2F5CA 1QO0D 2GXGA 2XV4S 2JT1A 5LHGA 2AXLA 1KU3A 3ABTA 4JBAA 3K2ZA 5F64A 2XVCA 3E5XA 4KDPA 3IRQA 2PQ8A 4QLCU 2DW4A 4KIGA 3WG9A 2P7VB 2MLGA 3T8TA 3HRUA 3FMRA 1O3TA 1TNTA 2HQNA 4ENMA 2DQRA 2E1CA 2ZNZA 4BXUA 4WXDA 4G6QA 5LBQA 5F1RA 3H3ZA 3G73A 1LNWA 5TRDA 1D3YA 5ICFA 1SFXA 3V8LA 3RYRA 4AVPA 4CO8A 4ZH4F 1G3TA 4EM0B 5K5QA 3D0SA 3RTRA 2H6CA 3GF2A 5ILSA 2EFPA 4RAZA 4EJUA 1B59A 5FFXA 5HDKA 3WTYC 2VBYA 4S05A 2P8TA 1D8KA 5FD6A 3FX3A 1MJBA 1XGMA 1T0FA 5D6EA 1BOAA 4YIIA 3Q9VA 3DEUA 1IN6A 1P4AA 3F6VA 5CJ9A 1OYWA 4EJOA 3PQJA 1L0OC 1XSVA 4RB1A 3F22A 1I1SA 4AIJA 1ZRDA 1FYLA 2XKOA 1LB2A 1G6NA 1IRFA 1XDUA 4P5OA 4FHTA 5CYVA 4L9NA 3VOEA 3LAJA 1ZAOA 4MTEA 1B6AA 2IA2A 3N97A 4MEYF 2VT2A 1ULYA 1ODDA 1HW5A 3C1DA 3JTHA 2DI3A 2O3FA 1R1TA 1I6XA 2QUFA 3KE2A 4XLNF 1BIAA 2EFOA 2ETHA 2R3SA 2V1UA 2HKOA 3GZ5A 5HS7A 4MQ9F 1YLFA 2CYYA 1ON1A 4PGHA 3GW2A 1ZRCA 4AWXB 1BIBA 4Y17A 4EGZA 4KN7X 2LDUA 4M73A 4HF2A 2Z99A 5DUKA 5DCFA 4M9XA 3K1MA 1SAXA 2COMA 5D5UB 2BGCA 4WXHA 3T5XA 3DPLC 3HUGA 4RGSA 2Z3YA 1U6GA 3E6CC 1J9IA 3GXOA 1SD4A 3F3XA 2DT5A 4EJWA 2VN2A 2FXAA 3C3WA 1IXCA 4U0WA 4EM2A 2ZCWA 3L2CA 3DF8A 4K2EA 1NHAA 4R8HA 3NEUA 1EH7A 1RIOH 3VFZA 3HHHA 3LQQA 1U3EM 1ZRFA 2ISYA 1VTNC 4P55A 1V3FA 1ZLKA 2HYGD 4IRHA 4EVIA 2ESHA 2YX4A 2W24A 3I4PA 3HSRA 5IT9K 3ABUA 2FQ3A 2VT3A 2PFBA 2F5EA 2XAGA 1YQAA 1USTA 1UHWA 3CUQC 4A0YA 4WCGA 5J6XA 3RPUA 2EFWA 3WODF 2EV6A 3GO5A 3ZQ7A 5E18F 2LNBA 4M72A 2YSRA 1KYZA 3WE3A 4Q47A 1SMYF 5DCMA 1OKRA 1KU7A 1ZH5A 2M8EA 1SD5A 1KYWA 5LGUA 2FBIA 1ZHFA 3E6DA 1PUEE 2FNAA 2RC4A 1ON2A 5E17F 1HXDA 1IUYA 1ZARA 5L3DA 1BBYA 1ZG1A 1XSDA 5E8IA 2ADUA 2DU9A 2P5VA 1EH6A 2UZKA 1TLHB 5CVUA 3D5LA 5JFRA 3TKYA 1QPMA 4YIFA 1F9NA 3KEOA 1U5TA 2A3SA 4ZYGA 1U2WA 4HX7A 2HR3A 1HKTA 2NYXA 2ZNYA 1OPCA 4BQAA 1S6LA 4M71A 5K5OA 4G94A 3F23A 1T6SA 3HTSB 2H09A 5ICEA 2OZ6A 2OA4A 1RNLA 4ZZDA 2K4JA 5E1XA 4N9HA 4UHTA 3WU0A 3MFKA 1IXRC 3R0AA 2JRTA 4S04A 5LEKA 2M1BA 3E5UA 3TDZC 3GX4X 3K69A 3TQNA 1QZZA 2QENA 4CZZA 1IW7F 3IL2A 3O3KA 5ILVA 3DXJF 3H3UA 3C7JA 2PBIA 2STWA 2WWYA 3P9CA 5AONA 2CWEA 2QQAA 1CGPA 3ZMVA 1EH8A 2DTRA 1JGSA 2RGVA 4Y15A 1JE8A 1FNNA 4U0VA 4PDKA 2ZBKA 2L02A 3T8RA 2IVMA 3TOBA 2ZMEA 3FF5A 2X0LA 4I0BA 5CVVA 4ESJA 3JW4A 2O8XA 1I27A 4GO1A 2M30A 2V9VA 3BJOA 1XCVA 2W57A 5DD8A 2Z9OA 4HV5A 2E7WA 2D1VA 1JHHA 2DFIA 1DDNA 1O7FA 5LLQA 3L9FA 3SQNA 3WTXC 1K78B 2FBKA 4A12A 2A6EF 6PAXA 3L7WA 2PLYA 3HYIA 4M9ZA 5H6RA 2MA3A 1PDNC 4BYYA 1FBQA 2G7HA 1BN5A 1DP7P 2D1HA 1IN8A 4KICA 2ISZA 2RKHA 1Z7UA 3RKYA 4OIPF 1GXPA 4RB3C 4MGRA 3WE2A 3FXRA 1HW1A 5CVIA 4FX0A 2XAHA 4LGWA 4B09A 3P7NA 5JVTA 3BPVA 4LG0A 2PG4A 2V1DA 2JSCA 5AIQA 1W7PD 3J80Z 2OQGA 4YFKF 2P4WA 3QAHA 2XAJA 2IPQX 1FLIA 4LLGF 1XCBA 4ETSA 3I58A 2W85A 2VOPA 2F5DA 2BEOA 2LKPA 5BPIA 5L3EA 2QBYB 4HDVA 4KYWA 2BYVE 5DD4A 2DK5A 3KETA 3U9GA 1S29A 2GA2A 5EEGA 1JXSA 5E20A 4A5NA 5HS9A 1G4DA 3VB2A 1YW9A 1LVAA 2RDPA 2CG4A 3V8KA 5FGMA 2CQKA 3WU1B 1HQCA 5LRRA 5D8LB 1Q1HA 3S2WA 3K1NA 2OQRA 4LK0F 4YFXF 2FE3A 5HVQC 2WC2A 1P4XA 4IXAA 1P6RA 3J7AO 2LSOA 2QVOA 1MD0A 4BAYA 2PJPA 2OZUA 4DNCA 3GWZA 1J59A 3LA2A 5FD5A 1CF7A 3ZPLA 4OIQF 4MHGA 1IF1A 2ZMEB 4HLXA 3ZMDA 2A69F 2KIFA 3I59B 4KIFA 4IF4A 1O3SA 4IRGA 2EA4A 2MLKA 4ENNA 5HDGA 4PCQA 1BI0A 2L4MA 4N9IA 1WSUA 1S7OA 2UXXA 1TW3A 3F8CA 5LRSA 2K86A 3LA7A 1IN4A 3SZTA 1T98A 2GAUA 1QZYA 1I1GA 4IVNA 4HF1A 3QU3A 1HSTA 3JSOA 5DUIA 1JHFA 4FX4A 2YX7A 2ZJ2A 5J8CA 3DKWA 1YG2A 5L3CA 3I59A 2W25A 4CGZA 3ML6A 1T38A 2DPDA 3ERED 4R1HA 3I64A 4ENKA 4Q48A 2ZXJA 3PFIA 1H9GA 3P9IA 3G3ZA 1B9MA 1W7PA 3BZ6A 4ASNA 2XROA 4ENJA 2QQBA 4PGGA 1UHMA 3FM5A 3WGGA 4JQFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QPT A;  1FT9 A;  4WXC A;  4P9U A;  1HKQ A;  3MCZ A;  1X3U A;  3LST A;  2P7C B;  5BPD A;  3MAJ A;  2CGP A;  1U78 A;  4M74 A;  1U5T C;  5H6Q A;  2EB7 A;  3N4M A;  1AOY A;  5H20 A;  1RUO A;  4UVC A;  4LJZ F;  5BMZ A;  4ZYH A;  4U88 A;  4Q4Z F;  2PMH A;  2VOD A;  3F8F A;  3DFG A;  4HOB A;  2J5P A;  1TQI A;  4BHB A;  3ULQ B;  1XB4 A;  2A68 F;  3KLO A;  5HLH A;  1FZP B;  3KCC A;  1CF7 B;  4I02 A;  1OMI A;  3KP7 A;  1H9T A;  3U2R A;  3V7S A;  5DV5 A;  4CDG A;  2XIG A;  1KQ8 A;  4HYE A;  2MC3 A;  2VC1 A;  5ED4 A;  1S8N A;  3BRO A;  1ZGJ A;  2D2W A;  1YO5 C;  1BM9 A;  4IPA A;  2F5F A;  4I0A A;  4L0Z B;  3KP5 A;  2R7D A;  2UXN A;  3HOS A;  4KT5 C;  3CO7 C;  2NNY A;  1IZ1 A;  1OYY A;  3TOA A;  3KEQ A;  4YG2 F;  1YIO A;  2KJC A;  4AIH A;  4D0P A;  1FSH A;  3CDH A;  1W5T A;  3BJA A;  2R7F A;  2HQR A;  2L54 A;  4A5M A;  3KZZ A;  2QZ8 A;  4UV8 A;  2JPC A;  2YR2 A;  4RAY A;  5J8F A;  4HX4 A;  3GYH X;  1K79 A;  3LA3 A;  3DV8 A;  4HDU A;  3M8E A;  3CJN A;  3V7C A;  2M45 A;  1SFU A;  1ZRE A;  3BOQ A;  2OD5 A;  1LDK B;  2HOE A;  3FXQ A;  1MZB A;  1BI1 A;  3HSF A;  4NQW A;  2YU3 A;  3QP5 A;  2VE8 A;  1GVJ A;  2O0Y A;  3EYY A;  3RJP A;  1BC8 C;  3ZMZ A;  5LGT A;  1KU2 A;  2VXZ A;  4GYI A;  3AAF A;  4FT8 A;  1K7A A;  2CW0 F;  3RIR A;  3W6J B;  4KMU X;  3E6B A;  3ECO A;  5LHH A;  2IW5 A;  4LD5 A;  4P9F A;  3B73 A;  3FZV A;  4ZYE A;  4EMS A;  1LDJ A;  1MJ9 A;  1FY7 A;  5L3B A;  1I5Z A;  4WWC A;  4U0Y A;  3R4K A;  3CUQ B;  3RI4 A;  1P4W A;  3GUD A;  3JTG A;  3JAM Z;  1EV7 A;  2YPR A;  5LEJ A;  2NNN A;  3CLO A;  1U8R A;  4MQV A;  3GFI A;  3Q9S A;  4GXO A;  5KVR A;  2BBY A;  2FEZ A;  1Z91 A;  4A0X A;  1R5H A;  5D4S A;  3I54 A;  3M8F A;  1RUN A;  2XUB A;  4WK8 F;  3FWE A;  3IHU A;  3IWZ A;  4G9Y A;  2HFH A;  4L0Y B;  3FMQ A;  1AWC A;  3GFL A;  3SFZ A;  1LEA A;  2IJL A;  3WGH A;  4U7D A;  3HRM A;  1WKM A;  2KIU A;  3FM3 A;  2ACJ A;  2D45 A;  4I7H A;  2J5O A;  3DQV C;  1UFM A;  3IKV A;  4I2O A;  3GZ6 A;  4LLN A;  4L9T A;  4G8X A;  2Y48 A;  3KP2 A;  1PP8 F;  1E2X A;  4HQM A;  3DP7 A;  1KU9 A;  5TJJ A;  3KP3 A;  4PZJ A;  2NS0 A;  1IN5 A;  2HDC A;  1RI7 A;  1ZGA A;  1D5V A;  3T0Y A;  3FMS A;  3O2P E;  2XAS A;  1ZG3 A;  2V1X A;  4WX9 A;  2H6B A;  5DDG A;  2BV6 A;  5JR3 A;  4A2U A;  4A6E A;  4BNC A;  3TO6 A;  1LEB A;  3I71 A;  3R60 A;  4G6D A;  1SMT A;  4MNU A;  1MDM A;  1O3R A;  4I09 A;  1DPU A;  4MTD A;  2P6T A;  1Z6R A;  2VOO A;  4N0B A;  5E1W A;  3RKX A;  2GWR A;  4G7H F;  4CYD A;  4KIB A;  1G3S A;  1Y0U A;  3EDP A;  2LF7 A;  4JK1 X;  1OR7 A;  3MEX A;  3ZP5 A;  3BDD A;  2JTV A;  3FXU A;  3TGN A;  2CO5 A;  1TBX A;  4DQ2 A;  3F8M A;  4YFN F;  1MGT A;  2RVC A;  2MH9 A;  1ZG5 A;  5HOO A;  5CLS A;  3P9K A;  3O6B B;  1MDM B;  1XGS A;  5FO5 A;  4P96 A;  1FC3 A;  4M6X A;  1T39 A;  3FHZ A;  1TNS A;  3SHF A;  2HGC A;  1QGP A;  1J7K A;  4CHU A;  3ZN0 A;  4IHT A;  2PN6 A;  5F6F A;  3W6K B;  3ZMS A;  1FBU A;  5K1Y A;  3KP6 A;  2JPB A;  2Z5U A;  2CFX A;  1WWX A;  4QWQ A;  4HV6 A;  3KLN A;  2FMY A;  3ZN1 A;  5D8K B;  2G9W A;  2GQQ A;  4EJT A;  4LLL A;  2IA1 A;  3K9T A;  1O57 A;  2A5Y B;  2XGX A;  4XBF A;  1GXQ A;  3I53 A;  1FX7 A;  3E6M A;  3GLX A;  4B8X A;  1BI2 A;  3LWF A;  1V4R A;  2V6C A;  3CTA A;  3VOD A;  1F4K A;  2WV0 A;  4L9J A;  3H92 A;  5BOX A;  4MEX F;  2RNJ A;  1TQM A;  2A07 F;  4Y13 A;  5A2Q K;  3BWG A;  4KA4 A;  1TQP A;  4GCV A;  3T1B A;  2A61 A;  2GA1 A;  4ZZL A;  4EM1 A;  4EGY A;  1BI3 A;  4CXF A;  1G3W A;  3WTT C;  4HW0 A;  2B0L A;  2EA2 A;  3CUQ A;  4R79 A;  4BHC A;  3HRS A;  3KFW X;  1J2X A;  1ONV A;  1STZ A;  1LJ9 A;  3OOP A;  3CO6 C;  3DPT A;  2VBZ A;  3LQR A;  5IT3 A;  3V8J A;  2FF4 A;  1XMK A;  3ECH A;  2IRF G;  3L09 A;  2W84 A;  2KJB A;  2EWN A;  2Y0M A;  3CUO A;  2P6S A;  4OOI A;  2Q0O A;  2Q8K A;  3GVA A;  2MD5 A;  4OMY A;  4BHP A;  4IHS A;  2FA5 A;  2KKO A;  2DPU A;  1YTY A;  2E1N A;  1KQ0 A;  4M9S A;  2IP2 A;  1F1Z A;  4UVA A;  5IT9 Z;  3MQ0 A;  4HBL A;  3E97 A;  2O03 A;  2NAZ A;  1E17 A;  2QWW A;  3NQO A;  1UCR A;  1REP C;  3E3V A;  4XSX F;  3TDU C;  3U1D A;  2DLL A;  3Q5F A;  2VON A;  1XGN A;  2XAF A;  5HS8 A;  2LF8 A;  3QOP A;  2EJR A;  4G7Z F;  1R22 A;  4AIK A;  4UV9 A;  1GHC A;  5D5X B;  3PQK A;  1W4M A;  4M6Y A;  3F8N A;  1IRG A;  2ZKZ A;  1DUX C;  4UNO A;  1WI9 A;  5HDN A;  2RN7 A;  2C6Y A;  5L3G A;  3BP8 A;  5BQT A;  4RGU A;  3V7R A;  3F8B A;  1WQ2 A;  4OIR F;  5FLX Z;  1XD7 A;  4ESF A;  1G3Y A;  5D4R A;  2P5K A;  3ZMU A;  2M5W A;  3RPQ A;  4EV0 A;  1LQ1 A;  1Z05 A;  1KQ9 A;  4NHJ A;  2EV5 A;  2O6G E;  4WF2 A;  3I5U A;  4HLY A;  1IN7 A;  1FBS A;  2DAO A;  5DCM B;  4RB2 C;  1XMA A;  4O3M A;  3WTU C;  3ELK A;  1J5Y A;  4XLP F;  1IXS B;  1UB9 A;  2Q2E A;  2L3D A;  3QPH A;  3MZY A;  2ZFW A;  3ROU A;  2PI0 A;  1R23 A;  1R1V A;  4KN4 X;  1XDS A;  4KFC A;  1OYI A;  2FBH A;  2FML A;  1FYM A;  2DQL A;  1WRJ A;  3KP4 A;  2Z33 A;  4RGR A;  2OU2 A;  3NRV A;  3IWF A;  5CVJ A;  2HTJ A;  4F7Z A;  4Q5S F;  2K27 A;  1B4A A;  3HTU A;  3R6S A;  4L18 B;  1QBJ A;  2HKX A;  3EYI A;  3TO9 A;  3B02 A;  5EEH A;  4H0E A;  5HLI A;  4HQE A;  4I01 A;  2Y75 A;  5KK1 A;  2V79 A;  3M9A A;  2KIM A;  4Z2Y A;  5D5W B;  2GZW A;  1R58 A;  3BPX A;  1FWZ A;  1KGS A;  1U5T B;  2OAZ A;  2K4B A;  3QP6 A;  1SFE A;  1ZLJ A;  5JHU A;  2VBX A;  4L9V A;  1HSJ A;  2IT0 A;  4ZYD A;  2EV0 A;  2P5L C;  2HS5 A;  1O7L A;  5D5V B;  3J81 K;  1YS6 A;  3RYP A;  1S7A A;  2ELH A;  4IJA A;  2K7L A;  3GEZ A;  3LAP A;  4L5J A;  3JSP A;  2GIV A;  1BJA A;  1BC7 C;  2E7X A;  1R7J A;  2XKP A;  3EQL F;  1J75 A;  2QQ9 A;  3WGI A;  2DBB A;  4OIO F;  1P2F A;  3REO A;  1FYK A;  1K78 A;  2WTE A;  3WTV C;  3SXY A;  2MH2 A;  5E8G A;  4OIN F;  4LMY A;  1DPR A;  4GGG A;  2XHK A;  4I98 B;  4EQQ A;  1XSX A;  3EET A;  1TTY A;  4OU0 A;  5L3F A;  4U7B A;  3C18 A;  3R61 A;  1SD7 A;  2EFN A;  2X4H A;  4RB0 A;  5D6F A;  3BJ6 A;  3MZH A;  4UUV A;  2FRH A;  5FB2 A;  5BS6 A;  1S3J A;  1RZ4 A;  4XSZ F;  2HEO A;  2XAQ A;  2IA0 A;  3J80 K;  3TO7 A;  3HOT A;  2L4A A;  4ESB A;  3COA C;  1Z1D A;  4AD9 A;  1YS7 A;  1QNT A;  3QRF F;  4HA8 A;  2HWV A;  4KNY A;  2QM3 A;  1MJA A;  1FP2 A;  3IC7 A;  4O6J A;  2FU4 A;  4RGX A;  2KRF A;  4LB5 A;  2G7U A;  2RQP A;  1FSE A;  2H27 A;  3RKW A;  1J0R A;  5JI6 A;  2HYF A;  1B1B A;  3I0T A;  2JZY A;  5A2Q Z;  1D8J A;  2K02 A;  3WTS C;  2QLZ A;  3WTZ A;  4BH9 A;  1A04 A;  2PEX A;  2DK8 A;  3M1E A;  1R5G A;  2DO7 A;  3QU6 A;  3EUH A;  2PMU A;  1HW2 A;  4LG0 B;  4UXN A;  2HZT A;  5K5R A;  2H94 A;  2VBW A;  2RV8 A;  5ERI A;  3GFJ A;  3F72 A;  3K1P A;  4OMZ A;  4E70 A;  4EJV A;  4NB5 A;  5LHI A;  4HAM A;  1YW8 A;  2FSW A;  4LK1 F;  4ON0 A;  5ILU A;  2F2E A;  2QBY A;  4O5V A;  1B9N A;  3R0J A;  1R36 A;  4L5I A;  5DYM A;  5HLG A;  1W5S A;  2HTS A;  3ISP A;  3F6O A;  4KUM A;  5ICG A;  4KMF A;  1O3Q A;  5CVR A;  5LGN A;  2TDX A;  2FOK A;  1XN7 A;  1FP1 D;  3KZY A;  4GYG A;  5DEQ A;  4HZF A;  1Z9C A;  4A6D A;  3HRT A;  1F5T A;  1K6O A;  1MKM A;  2M87 A;  1TW2 A;  3V4G A;  1YFH A;  1HKS A;  4XRF A;  1T2K A;  1Z6T A;  2STT A;  3K0L A;  1C0W A;  2AS5 F;  2NRA C;  5E1Z B;  1YW7 A;  3RDI A;  4LFU A;  3LFK A;  1L3L A;  3JAM K;  1QQI A;  3BY6 A;  3ZMT A;  4G7O F;  3SZP A;  4HF0 A;  2MBF A;  1PP7 U;  3HHG A;  3VEP A;  4A0Z A;  5ICC A;  2EFQ A;  1LDD A;  2XRN A;  2UWM A;  3HIF A;  1IAW A;  5FFZ A;  1HBX G;  1R1U A;  4RS8 A;  1R00 A;  2VC0 A;  1FPQ A;  1H0M A;  3L00 A;  2CSO A;  1YYV A;  1KA8 A;  1USS A;  5AIP A;  4CIC A;  2EK5 A;  4IRI A;  3MWM A;  3GFM A;  3IRR A;  3HSE A;  2VE9 A;  1W7P B;  2L01 A;  3WTW C;  1SD6 A;  2ESN A;  4LB6 B;  4TV7 A;  4HX8 A;  2A6H F;  2FNP A;  1ZYR F;  3OV8 A;  1XGO A;  4UVB A;  3IKT A;  3E5Q A;  1P92 A;  2GXB A;  3J81 Z;  2QYO A;  1ZN2 A;  5FLX K;  3M7G A;  1FOK A;  2ZO4 A;  2O61 A;  3F21 A;  2OBP A;  2BE5 F;  2F5C A;  1QO0 D;  2GXG A;  2XV4 S;  2JT1 A;  5LHG A;  2AXL A;  1KU3 A;  3ABT A;  4JBA A;  3K2Z A;  5F64 A;  2XVC A;  3E5X A;  4KDP A;  3IRQ A;  2PQ8 A;  4QLC U;  2DW4 A;  4KIG A;  3WG9 A;  2P7V B;  2MLG A;  3T8T A;  3HRU A;  3FMR A;  1O3T A;  1TNT A;  2HQN A;  4ENM A;  2DQR A;  2E1C A;  2ZNZ A;  4BXU A;  4WXD A;  4G6Q A;  5LBQ A;  5F1R A;  3H3Z A;  3G73 A;  1LNW A;  5TRD A;  1D3Y A;  5ICF A;  1SFX A;  3V8L A;  3RYR A;  4AVP A;  4CO8 A;  4ZH4 F;  1G3T A;  4EM0 B;  5K5Q A;  3D0S A;  3RTR A;  2H6C A;  3GF2 A;  5ILS A;  2EFP A;  4RAZ A;  4EJU A;  1B59 A;  5FFX A;  5HDK A;  3WTY C;  2VBY A;  4S05 A;  2P8T A;  1D8K A;  5FD6 A;  3FX3 A;  1MJB A;  1XGM A;  1T0F A;  5D6E A;  1BOA A;  4YII A;  3Q9V A;  3DEU A;  1IN6 A;  1P4A A;  3F6V A;  5CJ9 A;  1OYW A;  4EJO A;  3PQJ A;  1L0O C;  1XSV A;  4RB1 A;  3F22 A;  1I1S A;  4AIJ A;  1ZRD A;  1FYL A;  2XKO A;  1LB2 A;  1G6N A;  1IRF A;  1XDU A;  4P5O A;  4FHT A;  5CYV A;  4L9N A;  3VOE A;  3LAJ A;  1ZAO A;  4MTE A;  1B6A A;  2IA2 A;  3N97 A;  4MEY F;  2VT2 A;  1ULY A;  1ODD A;  1HW5 A;  3C1D A;  3JTH A;  2DI3 A;  2O3F A;  1R1T A;  1I6X A;  2QUF A;  3KE2 A;  4XLN F;  1BIA A;  2EFO A;  2ETH A;  2R3S A;  2V1U A;  2HKO A;  3GZ5 A;  5HS7 A;  4MQ9 F;  1YLF A;  2CYY A;  1ON1 A;  4PGH A;  3GW2 A;  1ZRC A;  4AWX B;  1BIB A;  4Y17 A;  4EGZ A;  4KN7 X;  2LDU A;  4M73 A;  4HF2 A;  2Z99 A;  5DUK A;  5DCF A;  4M9X A;  3K1M A;  1SAX A;  2COM A;  5D5U B;  2BGC A;  4WXH A;  3T5X A;  3DPL C;  3HUG A;  4RGS A;  2Z3Y A;  1U6G A;  3E6C C;  1J9I A;  3GXO A;  1SD4 A;  3F3X A;  2DT5 A;  4EJW A;  2VN2 A;  2FXA A;  3C3W A;  1IXC A;  4U0W A;  4EM2 A;  2ZCW A;  3L2C A;  3DF8 A;  4K2E A;  1NHA A;  4R8H A;  3NEU A;  1EH7 A;  1RIO H;  3VFZ A;  3HHH A;  3LQQ A;  1U3E M;  1ZRF A;  2ISY A;  1VTN C;  4P55 A;  1V3F A;  1ZLK A;  2HYG D;  4IRH A;  4EVI A;  2ESH A;  2YX4 A;  2W24 A;  3I4P A;  3HSR A;  5IT9 K;  3ABU A;  2FQ3 A;  2VT3 A;  2PFB A;  2F5E A;  2XAG A;  1YQA A;  1UST A;  1UHW A;  3CUQ C;  4A0Y A;  4WCG A;  5J6X A;  3RPU A;  2EFW A;  3WOD F;  2EV6 A;  3GO5 A;  3ZQ7 A;  5E18 F;  2LNB A;  4M72 A;  2YSR A;  1KYZ A;  3WE3 A;  4Q47 A;  1SMY F;  5DCM A;  1OKR A;  1KU7 A;  1ZH5 A;  2M8E A;  1SD5 A;  1KYW A;  5LGU A;  2FBI A;  1ZHF A;  3E6D A;  1PUE E;  2FNA A;  2RC4 A;  1ON2 A;  5E17 F;  1HXD A;  1IUY A;  1ZAR A;  5L3D A;  1BBY A;  1ZG1 A;  1XSD A;  5E8I A;  2ADU A;  2DU9 A;  2P5V A;  1EH6 A;  2UZK A;  1TLH B;  5CVU A;  3D5L A;  5JFR A;  3TKY A;  1QPM A;  4YIF A;  1F9N A;  3KEO A;  1U5T A;  2A3S A;  4ZYG A;  1U2W A;  4HX7 A;  2HR3 A;  1HKT A;  2NYX A;  2ZNY A;  1OPC A;  4BQA A;  1S6L A;  4M71 A;  5K5O A;  4G94 A;  3F23 A;  1T6S A;  3HTS B;  2H09 A;  5ICE A;  2OZ6 A;  2OA4 A;  1RNL A;  4ZZD A;  2K4J A;  5E1X A;  4N9H A;  4UHT A;  3WU0 A;  3MFK A;  1IXR C;  3R0A A;  2JRT A;  4S04 A;  5LEK A;  2M1B A;  3E5U A;  3TDZ C;  3GX4 X;  3K69 A;  3TQN A;  1QZZ A;  2QEN A;  4CZZ A;  1IW7 F;  3IL2 A;  3O3K A;  5ILV A;  3DXJ F;  3H3U A;  3C7J A;  2PBI A;  2STW A;  2WWY A;  3P9C A;  5AON A;  2CWE A;  2QQA A;  1CGP A;  3ZMV A;  1EH8 A;  2DTR A;  1JGS A;  2RGV A;  4Y15 A;  1JE8 A;  1FNN A;  4U0V A;  4PDK A;  2ZBK A;  2L02 A;  3T8R A;  2IVM A;  3TOB A;  2ZME A;  3FF5 A;  2X0L A;  4I0B A;  5CVV A;  4ESJ A;  3JW4 A;  2O8X A;  1I27 A;  4GO1 A;  2M30 A;  2V9V A;  3BJO A;  1XCV A;  2W57 A;  5DD8 A;  2Z9O A;  4HV5 A;  2E7W A;  2D1V A;  1JHH A;  2DFI A;  1DDN A;  1O7F A;  5LLQ A;  3L9F A;  3SQN A;  3WTX C;  1K78 B;  2FBK A;  4A12 A;  2A6E F;  6PAX A;  3L7W A;  2PLY A;  3HYI A;  4M9Z A;  5H6R A;  2MA3 A;  1PDN C;  4BYY A;  1FBQ A;  2G7H A;  1BN5 A;  1DP7 P;  2D1H A;  1IN8 A;  4KIC A;  2ISZ A;  2RKH A;  1Z7U A;  3RKY A;  4OIP F;  1GXP A;  4RB3 C;  4MGR A;  3WE2 A;  3FXR A;  1HW1 A;  5CVI A;  4FX0 A;  2XAH A;  4LGW A;  4B09 A;  3P7N A;  5JVT A;  3BPV A;  4LG0 A;  2PG4 A;  2V1D A;  2JSC A;  5AIQ A;  1W7P D;  3J80 Z;  2OQG A;  4YFK F;  2P4W A;  3QAH A;  2XAJ A;  2IPQ X;  1FLI A;  4LLG F;  1XCB A;  4ETS A;  3I58 A;  2W85 A;  2VOP A;  2F5D A;  2BEO A;  2LKP A;  5BPI A;  5L3E A;  2QBY B;  4HDV A;  4KYW A;  2BYV E;  5DD4 A;  2DK5 A;  3KET A;  3U9G A;  1S29 A;  2GA2 A;  5EEG A;  1JXS A;  5E20 A;  4A5N A;  5HS9 A;  1G4D A;  3VB2 A;  1YW9 A;  1LVA A;  2RDP A;  2CG4 A;  3V8K A;  5FGM A;  2CQK A;  3WU1 B;  1HQC A;  5LRR A;  5D8L B;  1Q1H A;  3S2W A;  3K1N A;  2OQR A;  4LK0 F;  4YFX F;  2FE3 A;  5HVQ C;  2WC2 A;  1P4X A;  4IXA A;  1P6R A;  3J7A O;  2LSO A;  2QVO A;  1MD0 A;  4BAY A;  2PJP A;  2OZU A;  4DNC A;  3GWZ A;  1J59 A;  3LA2 A;  5FD5 A;  1CF7 A;  3ZPL A;  4OIQ F;  4MHG A;  1IF1 A;  2ZME B;  4HLX A;  3ZMD A;  2A69 F;  2KIF A;  3I59 B;  4KIF A;  4IF4 A;  1O3S A;  4IRG A;  2EA4 A;  2MLK A;  4ENN A;  5HDG A;  4PCQ A;  1BI0 A;  2L4M A;  4N9I A;  1WSU A;  1S7O A;  2UXX A;  1TW3 A;  3F8C A;  5LRS A;  2K86 A;  3LA7 A;  1IN4 A;  3SZT A;  1T98 A;  2GAU A;  1QZY A;  1I1G A;  4IVN A;  4HF1 A;  3QU3 A;  1HST A;  3JSO A;  5DUI A;  1JHF A;  4FX4 A;  2YX7 A;  2ZJ2 A;  5J8C A;  3DKW A;  1YG2 A;  5L3C A;  3I59 A;  2W25 A;  4CGZ A;  3ML6 A;  1T38 A;  2DPD A;  3ERE D;  4R1H A;  3I64 A;  4ENK A;  4Q48 A;  2ZXJ A;  3PFI A;  1H9G A;  3P9I A;  3G3Z A;  1B9M A;  1W7P A;  3BZ6 A;  4ASN A;  2XRO A;  4ENJ A;  2QQB A;  4PGG A;  1UHM A;  3FM5 A;  3WGG A;  4JQF A; 
#chains in the Genus database with same CATH topology
 1OCT C;  3QPT A;  3M1C A;  1FT9 A;  5C4X J;  4WXC A;  2LRE A;  2VB6 A;  4HRI A;  4NQW B;  1FMW A;  1R4M B;  4P9U A;  1HKQ A;  2Z16 A;  3MCZ A;  2O8K A;  1X3U A;  4XIC A;  3LST A;  4XON A;  2P7C B;  2W1O A;  1LKX A;  5BPD A;  3MAJ A;  2CGP A;  1WPK A;  3K4K A;  1U78 A;  4M74 A;  1U5T C;  4IQ4 A;  5H6Q A;  5DS9 A;  2R5Y B;  2EB7 A;  3N4M A;  1AOY A;  1P7I A;  3CME I;  3S32 A;  4NNJ A;  3DTE A;  5H20 A;  4UVC A;  1RUO A;  4BGD A;  4LJZ F;  4BEH B;  2KRC A;  5BMZ A;  2WA0 A;  4ZYH A;  2CH0 A;  4U88 A;  1X1B A;  4Q4Z F;  2PMH A;  2VOD A;  2O5R A;  3F8F A;  3DFG A;  3PFY A;  4HOB A;  2J5P A;  3BG7 A;  2BHY A;  1TQI A;  3G1O A;  4BHB A;  4B4C A;  3ULQ B;  1XB4 A;  2A68 F;  2X51 A;  3KLO A;  2CJJ A;  5HLH A;  1P9Q C;  1FZP B;  3KCC A;  1CF7 B;  4I02 A;  5IP7 J;  3VYU B;  1OMI A;  3ABM H;  1JKQ C;  3KP7 A;  1H9T A;  2DJN A;  4A3K J;  3U2R A;  3V7S A;  1R4N B;  5DV5 A;  3PO3 J;  4CDG A;  2YU9 J;  2XIG A;  1KQ8 A;  1PYV A;  2H1K A;  4HYE A;  3LOC A;  2MC3 A;  1YX5 A;  2VC1 A;  3K4C A;  5ED4 A;  4FE4 A;  1S8N A;  4D7M A;  3OYG A;  3BRO A;  1ZGJ A;  1WJF A;  5HLT A;  1A36 A;  1MBK A;  3FDY A;  1OCO H;  3BT9 A;  3U21 A;  2D2W A;  1YO5 C;  2E71 A;  2WAQ A;  3FXM A;  1D0X A;  1BM9 A;  2KL4 A;  4IPA A;  3SFI A;  2M4K A;  4U87 A;  1WHU A;  2F5F A;  4I0A A;  2GOX B;  2L7Z A;  3TP0 A;  4L0Z B;  2VQC A;  3KP5 A;  5FJ8 J;  2R7D A;  4LOC A;  2MFZ A;  5CKT A;  4LIV A;  2UXN A;  3BC8 A;  4AYB A;  2DFH A;  1R5I D;  1XTA A;  3HOS A;  4KT5 C;  1GLN A;  3CO7 C;  2Y31 A;  2NNY A;  1IZ1 A;  1OYY A;  1Z0X A;  3H5R A;  3TOA A;  3KEQ A;  5JHF A;  4DBQ A;  4G6T B;  4YG2 F;  3HUG B;  2Y9Z A;  1YIO A;  2E5Z A;  3DEE A;  2KJC A;  3KEY A;  4AIH A;  4D0P A;  2OV7 A;  1FSH A;  2DMU A;  4C3I J;  3CDH A;  4V19 K;  1W5T A;  3BJA A;  2R7F A;  2M7B A;  4FQG A;  3PJR A;  2EZI A;  2CMP A;  3A2K A;  2E36 A;  2L7M P;  2HQR A;  2L54 A;  3S17 J;  3UR3 C;  9ANT A;  4A5M A;  3EPZ A;  3KZZ A;  4D5F A;  2QZ8 A;  4UV8 A;  2JPC A;  2YR2 A;  1R71 A;  4RAY A;  4E4H A;  5J8F A;  1GVD A;  3ZQL A;  4HX4 A;  3GYH X;  1K79 A;  3C2G A;  3FKI J;  2CFO A;  3LA3 A;  4H4K C;  5C44 J;  2DYS H;  3DV8 A;  3TW7 A;  4HDU A;  4JX6 A;  3M8E A;  3CJN A;  3V7C A;  2DOA A;  2M45 A;  2MAB A;  1X19 A;  1SFU A;  4A3J J;  1ZRE A;  5IP9 J;  2DFE A;  3BOQ A;  1VZ0 A;  2OD5 A;  4JX5 A;  3TMO A;  5JLW A;  3TP3 A;  1LDK B;  2HOE A;  4HNV A;  3FXQ A;  5FRN A;  1MZB A;  2BHZ A;  1BI1 A;  3HSF A;  4RDU A;  4NQW A;  1JGG A;  2YU3 A;  3QP5 A;  2VE8 A;  2R7R A;  5B5E C;  1GVJ A;  3HL2 A;  2O0Y A;  1BR4 A;  2XAU A;  1JI8 A;  2X6Y A;  4XOP A;  2QQ8 A;  3EYY A;  3VWB A;  3RJP A;  1TL8 A;  3ZMZ A;  1BC8 C;  4KIT B;  3PIO F;  5LGT A;  2R5Y A;  2RRE A;  1KU2 A;  2BVL A;  1Z7L A;  2DA4 A;  2VI6 A;  1JKR C;  1CQT A;  2VXZ A;  2OPT A;  4GYI A;  2VJ5 A;  3AAF A;  4FT8 A;  2IGK A;  1K7A A;  1HF0 A;  1ETW A;  2CW0 F;  3RIR A;  3W6J B;  2L9R A;  5F08 A;  3BTC A;  4KMU X;  3E6B A;  3ECO A;  4NBQ A;  2OTL I;  5LHH A;  2IW5 A;  4LD5 A;  4P9F A;  3B73 A;  3FZV A;  4ZYE A;  4EMS A;  1K4S A;  1XX5 A;  1LDJ A;  4BE2 A;  1MJ9 A;  2KMU A;  1FY7 A;  2W4S A;  5K7H A;  5L3B A;  4CCL A;  1YIT I;  1I5Z A;  2R7T A;  3CCY A;  4WWC A;  4U0Y A;  3R4K A;  4E7S A;  2MG4 A;  2DJI A;  3CUQ B;  2ZXW H;  4RA2 A;  3RI4 A;  3G1L A;  1P4W A;  1OCZ H;  4HPQ A;  3GUD A;  3JTG A;  3JAM Z;  3BZC A;  1EV7 A;  2YPR A;  2DMN A;  5LEJ A;  2NNN A;  3CLO A;  2BY0 A;  3VSK A;  1M1E B;  1U8R A;  2VQG A;  2VJJ A;  2F4M B;  3BCA A;  3JRH A;  4MQV A;  4IQJ A;  3GFI A;  3Q9S A;  3IP4 B;  3PM1 A;  4GXO A;  1VQ5 I;  2HDD A;  3PNT A;  5KVR A;  4BQO A;  5E3M A;  2BBY A;  2FEZ A;  1Z91 A;  2MW8 A;  1ZGW A;  1ETK A;  4A0X A;  5F1J A;  1LE8 A;  1R5H A;  5D4S A;  4C2T A;  3I54 A;  3M8F A;  1DU6 A;  2E2I J;  1RUN A;  4E7Z A;  1QHG A;  2XUB A;  3PNY A;  3H1C A;  3PSF A;  4WK8 F;  3FWE A;  1Y56 A;  3IHU A;  3IWZ A;  2XSD C;  4G9Y A;  2HFH A;  4L0Y B;  3FMQ A;  1Z67 A;  3G4S I;  2NOG A;  1AWC A;  3GFL A;  3SFZ A;  3A03 A;  1LEA A;  1JUP A;  1YHQ I;  2IJL A;  3HOW J;  3WGH A;  4U7D A;  4IL6 C;  3DLA A;  3IAS 2;  3HRM A;  4BBR J;  5DM6 F;  4RLF A;  2Y30 A;  4PJ0 C;  1SFO J;  1WKM A;  2KIU A;  3FM3 A;  4B3X A;  4A69 C;  5GTH C;  2ACJ A;  1EA3 A;  3OY9 A;  2D45 A;  4RM2 A;  4I7H A;  2F4O B;  2J5O A;  3DQV C;  1UFM A;  5J47 A;  3MD2 A;  4YRV A;  3IKV A;  3CES A;  4I2O A;  4Y4R A;  3GZ6 A;  4E7H A;  4LLN A;  4L9T A;  4G8X A;  2Y48 A;  5IPA A;  1GV2 A;  2XSJ C;  3KP2 A;  1WJD A;  1PP8 F;  1E2X A;  2XF5 A;  4CH7 A;  4HQM A;  3DP7 A;  3OYD A;  1KU9 A;  3JRF A;  5TJJ A;  3KP3 A;  2F48 A;  4UB8 C;  1I3Q J;  4XN3 A;  4PZJ A;  5B1B H;  1WH7 A;  2NS0 A;  1IN5 A;  2HDC A;  1RI7 A;  1BOB A;  1FEX A;  3OYN A;  1ZGA A;  2DMT A;  3ABL H;  4F91 B;  4EEF G;  5LD2 C;  1D5V A;  3T0Y A;  3FMS A;  1HC8 A;  4DYQ A;  3O2P E;  2NVT J;  2XAS A;  1RC9 A;  2WY7 Q;  1ZG3 A;  4V2G A;  1LFU P;  2V1X A;  4WX9 A;  2H6B A;  5DDG A;  3NWT A;  2BV6 A;  5JR3 A;  4A2U A;  3BR2 A;  4A6E A;  3TO6 A;  4BNC A;  3L1P A;  1LEB A;  1MNE A;  2LKS A;  2HQ5 A;  3AKZ A;  3OYB A;  3I71 A;  1OCP A;  4S0H B;  1X2N A;  3BG9 A;  4B48 A;  3R60 A;  4G6D A;  1SMT A;  3A01 B;  4MNU A;  3ONQ A;  1MDM A;  1O3R A;  4I09 A;  1DPU A;  4MTD A;  4J00 A;  2A6T A;  2ELK A;  3HOX J;  2GOM A;  3ZOB A;  2P6T A;  1UMQ A;  3SEZ A;  4BDY A;  2GIZ A;  1Z6R A;  1Z77 A;  2VOO A;  3G6E I;  2WBM A;  4N0B A;  5E1W A;  4B44 A;  1IUF A;  2HXI A;  1IG7 A;  4NC8 A;  3KZI C;  3RKX A;  1WJA A;  2GWR A;  4G7H F;  4BU2 A;  4CYD A;  4KIB A;  2HVS A;  3RZD J;  2WAE A;  1G3S A;  1TT0 A;  3JRE A;  1Y0U A;  3EDP A;  2X6O A;  2LF7 A;  4HNT A;  4JK1 X;  5J1R A;  1OR7 A;  3MEX A;  3ZP5 A;  3S3M A;  3BDD A;  2JTV A;  3FXU A;  3TGN A;  1U9O A;  2CO5 A;  1S9H A;  1TBX A;  1X4O A;  4DQ2 A;  2K9N A;  1VI0 A;  2BXY A;  3CDL A;  3F8M A;  4YFN F;  1MGT A;  1QRY A;  2IXS A;  2ZSH B;  2R5Z B;  2RVC A;  1HOM A;  2JVG A;  2MH9 A;  1ZG5 A;  3K2A A;  3GTO J;  2HVQ A;  3BR5 A;  5HOO A;  5CLS A;  4FCY A;  3P9K A;  2IGM A;  2L9N A;  3O6B B;  5E3N A;  3HOU J;  2LYC A;  1JKP C;  5EGO A;  1Y1W J;  3AL0 C;  3BR3 A;  1MDM B;  1I50 J;  3GME A;  1XGS A;  5FO5 A;  4P96 A;  3CCL I;  1FC3 A;  3BLY A;  4M6X A;  1YRN A;  3RQ4 A;  1T39 A;  2LG4 A;  1IO2 A;  1TNS A;  3FHZ A;  3SHF A;  2HGC A;  1BJZ A;  1QGP A;  1J7K A;  4CHU A;  3ZQC A;  3ZN0 A;  1NK3 P;  1WJB A;  4FE7 A;  2HOT A;  4IHT A;  2PN6 A;  3M8J A;  1VQN I;  5F6F A;  3W6K B;  3JRA A;  3ZMS A;  3OSF A;  1FBU A;  1X4P A;  4M3E A;  5K1Y A;  1SAU A;  1TP4 A;  3KP6 A;  2JPB A;  2Z5U A;  3LSK A;  3TBI A;  2CFX A;  1WWX A;  4QWQ A;  4HV6 A;  3KLN A;  2BY1 A;  3AG3 H;  3CF5 F;  3M4O J;  4M6V A;  4BQN A;  2FMY A;  2CV0 A;  2LH9 A;  1K6Y A;  1AA7 A;  1GUU A;  3ZN1 A;  1WI3 A;  5D8K B;  2G9W A;  1JT6 A;  2GQQ A;  4EJT A;  1K83 J;  2IA1 A;  4LLL A;  3K9T A;  1O57 A;  2A5Y B;  2XGX A;  3BTI A;  4XBF A;  1GXQ A;  3I53 A;  3S3N A;  1HLV A;  1FX7 A;  3E6M A;  4ZC3 A;  2FOW A;  4CZC A;  3GLX A;  3CCE I;  3ZQI A;  4B8X A;  2CQX A;  1BI2 A;  4PFP A;  3E7L A;  3LWF A;  1V4R A;  2V6C A;  2JK3 A;  3CTA A;  3VOD A;  4BY7 J;  1F4K A;  1WJC A;  2HPM A;  2WV0 A;  4L9J A;  5CPR B;  3H92 A;  2CV1 A;  5BOX A;  4MEX F;  2RNJ A;  1TQM A;  5H2F C;  5M5Y J;  2A07 F;  4Y13 A;  3DBL B;  2R93 J;  1EF4 A;  2CQQ A;  5A2Q K;  3BWG A;  4KA4 A;  2DOD A;  1TQP A;  4GCV A;  3T1B A;  2A61 A;  2GA1 A;  5IOY A;  3OL3 A;  5J4Y A;  4BXF A;  4ZZL A;  2V6E A;  1Y0N A;  2LTP A;  1VQ9 I;  4EM1 A;  3J7Z I;  3H5N A;  1BI3 A;  3LSM A;  4N4N B;  4HST A;  4EGY A;  4CXF A;  1DGW Y;  1ITY A;  1G3W A;  3WTT C;  4HW0 A;  2B0L A;  1ETX A;  2EA2 A;  2LLK A;  2EIN H;  2AHQ A;  5IP6 A;  3L2R A;  3CUQ A;  4R79 A;  4BHC A;  4IEJ A;  3HRS A;  3KFW X;  2NXN B;  1J2X A;  4PJJ A;  1ONV A;  1STZ A;  1LJ9 A;  3OOP A;  3OSG A;  1R9T J;  2K85 A;  3RQI A;  3DTK A;  1LVK A;  3CO6 C;  3K4J A;  1BW5 A;  3PIP F;  1SC7 A;  2OC6 A;  3DPT A;  2VBZ A;  4DW6 A;  3LQR A;  5IT3 A;  3V8J A;  1SVO A;  3TED A;  2FF4 A;  1XMK A;  3FKJ A;  3ECH A;  1TWH J;  3QPS A;  5IY5 H;  2IRF G;  3L09 A;  2W84 A;  2KJB A;  4XLH A;  2EWN A;  2Y0M A;  3CUO A;  2P6S A;  4OOI A;  2Q0O A;  2Q8K A;  3GVA A;  2MD5 A;  3QWL A;  4OMY A;  4BHP A;  4IHS A;  2JSP A;  1SVL A;  2TRT A;  2FA5 A;  2KKO A;  2DPU A;  1YTY A;  2PMZ A;  2E1N A;  4D7N A;  2BY3 A;  1FMV A;  1OR7 C;  1KQ0 A;  4M9S A;  2IP2 A;  3CCR I;  1F1Z A;  4GRI A;  1F36 A;  4RMN A;  4UVA A;  5IT9 Z;  4AID A;  3MQ0 A;  4HBL A;  2ZC2 A;  3ASN H;  3E97 A;  2O03 A;  2NAZ A;  1E17 A;  2QWW A;  4I99 C;  5FLM J;  3NQO A;  1UCR A;  1REP C;  3GTQ J;  3K10 A;  4J19 A;  3E3V A;  4XSX F;  3TDU C;  3U1D A;  2DLL A;  1OJL A;  4E7I A;  3Q5F A;  2VPR A;  2VON A;  2KIS A;  1XGN A;  2XAF A;  5HS8 A;  2LF8 A;  1G8X A;  2DMP A;  2VAS A;  3OWT A;  1WJE A;  3QOP A;  5FKO A;  4NC7 A;  2EJR A;  2IEK A;  4KJZ A;  4G7Z F;  1R22 A;  4AIK A;  4UV9 A;  1GHC A;  5D5X B;  2Q2E B;  3PQK A;  3SEQ A;  2LR8 A;  1W4M A;  4M6Y A;  3F8N A;  3QYB A;  1IRG A;  2ZKZ A;  1DUX C;  2WAF A;  3BTL A;  1WI9 A;  3OIQ A;  5HDN A;  3FBN B;  4UNO A;  2P81 A;  2RN7 A;  2C6Y A;  5L3G A;  3BP8 A;  5BQT A;  4RGU A;  3V7R A;  3F8B A;  1WQ2 A;  4OIR F;  5FLX Z;  4A3E J;  3Q3S A;  2KDZ A;  1XD7 A;  4ESF A;  5J40 A;  1WCM J;  4RBO A;  1G3Y A;  3SDG A;  5D4R A;  1HCR A;  2HVR A;  2P5K A;  3ZMU A;  2M5W A;  3RPQ A;  1NG6 A;  4EV0 A;  1LQ1 A;  1Z05 A;  1KQ9 A;  5IOZ A;  4NHJ A;  2EV5 A;  3AG2 H;  2CU7 A;  2O6G E;  4WF2 A;  2E34 A;  3HJE A;  3I5U A;  1MSF C;  4HLY A;  2VUM J;  1IN7 A;  3H9J A;  1FBS A;  2DAO A;  4UUS B;  3IH4 A;  2X85 A;  5M5W J;  2HXO A;  5DCM B;  2LY9 A;  2YS9 A;  4RB2 C;  4XL9 A;  1XMA A;  1TZL A;  5KCM A;  5GP9 A;  1XG1 A;  1ETV A;  4O3M A;  2X6W A;  2JA6 J;  3FBI B;  3WTU C;  1QHH D;  1HA8 A;  3ELK A;  2VIX A;  5GAE J;  1J5Y A;  4XLP F;  1IXS B;  3S15 J;  1UB9 A;  3LSG A;  3S93 A;  1W0U A;  2Q2E A;  4MLO A;  2L3D A;  3TL4 X;  3QPH A;  4RLQ A;  2XB5 A;  5CQG A;  3MZY A;  3H3V K;  2MD0 A;  2ZFW A;  3ROU A;  5F04 A;  3DU6 A;  3W3C A;  3RPU D;  2PI0 A;  1R23 A;  4DYR A;  1R1V A;  2VJ4 A;  2QA4 I;  1UG0 A;  4KN4 X;  1XDS A;  2HOA A;  4KFC A;  2JA7 J;  3DBH B;  3V42 A;  5E79 C;  4A93 J;  1OYI A;  2FBH A;  3DPU A;  2FML A;  1FYM A;  1MBF A;  2DQL A;  1WRJ A;  4QPO A;  3KP4 A;  4XR6 A;  2Z33 A;  2VL8 A;  4RGR A;  3O8H A;  3IV5 A;  2OU2 A;  3S14 J;  3NRV A;  1ACI A;  1D0Z A;  1G59 A;  3K4L A;  1LPQ A;  2R7S A;  1YOV B;  3IWF A;  1A6I A;  5CVJ A;  2HTJ A;  4F7Z A;  4Q5S F;  4RM3 A;  2QEX I;  2K27 A;  1B4A A;  3HTU A;  2K3F A;  4D9J A;  3R6S A;  4L18 B;  1PUF B;  1QBJ A;  3L2V A;  2HKX A;  1ETO A;  1OLT A;  3MKW B;  2XGD A;  3EYI A;  3TO9 A;  2M7A A;  3B02 A;  1DGR M;  5EEH A;  2GBY A;  1IRX A;  3BR1 A;  5HLI A;  4H0E A;  2OUM A;  4HQE A;  1OFC X;  4BAC A;  3UNG C;  2JA5 J;  2QF7 A;  5KNL A;  4I01 A;  1Z21 A;  2Y75 A;  1S5L C;  1POG A;  1BW6 A;  4DYC A;  1XMX A;  4F52 A;  5KK1 A;  3PL8 A;  3OS2 A;  5IYB J;  2V79 A;  3M9A A;  3HDD A;  4DJA A;  2KIM A;  3OR1 C;  3PSI A;  3LNQ A;  2BW3 A;  4Z2Y A;  2VLA A;  5D5W B;  2GZW A;  4NDL A;  1R58 A;  3BPX A;  1FWZ A;  1KGS A;  1U5T B;  2OAZ A;  1JTX A;  3HGG A;  2K4B A;  1SFE A;  1ZLJ A;  3QP6 A;  4PJL A;  5JHU A;  4BEH A;  2LFB A;  3CMY A;  3X2Q H;  2E5N A;  2VBX A;  3CJT B;  4L9V A;  1HSJ A;  2IT0 A;  4BKX A;  3ESW B;  4ZYD A;  2EV0 A;  3S3O A;  3OYH A;  3W6V A;  2V7F A;  4B43 A;  2P5L C;  1ENH A;  2HS5 A;  2BVM A;  3F0C A;  2E1O A;  1O7L A;  1Q1V A;  5D5V B;  4CCJ A;  3J81 K;  4FTH A;  2Y2Z A;  2IAI A;  5EG0 A;  1YS6 A;  3RYP A;  1S7A A;  2ELH A;  4C3J J;  3ZQH A;  4LIT A;  4IJA A;  2K7L A;  3GEZ A;  3LAP A;  3H36 A;  3KYL A;  4L5J A;  3JSP A;  2NVX J;  2GIV A;  1BJA A;  2BXZ A;  2F5V A;  4UUS A;  1BC7 C;  2L7F P;  5K7F A;  4AM3 A;  2M3A A;  2VJI A;  3LSR A;  2E7X A;  5FKM A;  1R7J A;  2UV1 A;  2JRM A;  1TWF J;  4AUX A;  4W97 A;  2XKP A;  5F0C A;  3CC2 I;  3MKZ A;  3EQL F;  3QYF A;  1J75 A;  2QQ9 A;  3HKZ N;  1BA5 A;  3ZQG A;  3L2U A;  2ECB A;  4HG2 A;  3WGI A;  2ME0 A;  3ZCO A;  3HGY A;  2DBB A;  4OIO F;  1P2F A;  3REO A;  1FYK A;  3W2V A;  2G0E A;  2ICW G;  3H35 A;  3FXJ A;  3CJQ B;  2WTE A;  1K78 A;  3WTV C;  3SXY A;  2W7N A;  2MH2 A;  5E8G A;  4OIN F;  1YX3 A;  3H0G J;  4PUS A;  4LMY A;  1DPR A;  4GGG A;  2XHK A;  4I98 B;  2QSG X;  1XPX A;  4EQQ A;  1XSX A;  3RZO J;  3CQZ J;  2EIL H;  3EET A;  1YJ9 I;  1WJ5 A;  1MMS A;  2R7Q A;  1TTY A;  3CP2 A;  4OU0 A;  5L3F A;  4U7B A;  3C18 A;  3R61 A;  3CCS I;  5GPA A;  1SD7 A;  2EFN A;  3JRB A;  4PJN A;  2X4H A;  4RB0 A;  5D6F A;  3BJ6 A;  3MZH A;  1Y39 A;  4UUV A;  2FRH A;  5FB2 A;  3J7A Y;  5BS6 A;  1S3J A;  1RZ4 A;  4DZP A;  1IDZ A;  2HZD A;  4XSZ F;  4DOZ A;  2VKE A;  2XAQ A;  2HEO A;  2IA0 A;  3W2W A;  3J80 K;  3TO7 A;  3HOT A;  2L4A A;  2FD5 A;  4ESB A;  3COA C;  1Z1D A;  3IAM 2;  4AD9 A;  1YS7 A;  4OAZ A;  4ITV A;  2EBI A;  1QNT A;  2DN0 A;  2XB0 X;  1NH3 A;  1JUS A;  3QRF F;  5E3L A;  4HA8 A;  1D1C A;  3S1N J;  2DA7 A;  2HWV A;  4KNY A;  2QM3 A;  1OIS A;  1MJA A;  3PNV A;  4BE1 A;  1FJL A;  2VKD A;  1D5Y A;  2DA3 A;  1QVU A;  2VPL A;  4F3Q A;  3WHC A;  1GT0 C;  1FP2 A;  4EAT A;  2L2O A;  2OF7 A;  1AU7 A;  3IC7 A;  3JRI A;  5LFA A;  3KYC B;  4O6J A;  4NUB A;  1X1C A;  4XLF A;  2FU4 A;  2IS6 A;  3QYE A;  4RGX A;  4F55 A;  2KRF A;  2ME6 A;  3VYS B;  3S16 J;  5EYR A;  1DQU A;  4LB5 A;  3A0H C;  2G7U A;  2RQP A;  2ZB9 A;  1J09 A;  1FSE A;  2X1C A;  2R4G A;  5FRO A;  4DZJ A;  2FJ1 A;  2H27 A;  4Z6Y A;  2QGU A;  2K9L A;  2QCO A;  3RKW A;  2IS4 A;  5J1Y A;  1J0R A;  2DA5 A;  1X1P A;  4ZDO A;  4XNF A;  5JI6 A;  2HYF A;  5J4V A;  1B1B A;  2CS3 A;  3I0T A;  3MKL A;  3CCJ I;  2JZY A;  3GTJ J;  2HU9 A;  2M2E A;  5A2Q Z;  1RES A;  2K02 A;  1RR7 A;  1D8J A;  3WTS C;  2QLZ A;  3WTZ A;  3JRD A;  1GDT A;  4BH9 A;  1ZEL A;  1U8B A;  4XN0 A;  1A04 A;  4IX7 A;  2GLO A;  2COB A;  2HNH A;  4F93 B;  2V9K A;  2PEX A;  2DK8 A;  3DBR B;  4BJ6 C;  5EF6 A;  5EG0 B;  1AHD P;  3M1E A;  1R5G A;  2DO7 A;  3LFU A;  3QU6 A;  3EUH A;  4C30 A;  1RET A;  4B47 A;  2PMU A;  3LL7 A;  1HW2 A;  4M3D A;  1R6R A;  2DTZ A;  4LG0 B;  2KPM A;  4UXN A;  2HZT A;  1IRZ A;  5K5R A;  3LSH A;  2H94 A;  3CCQ I;  2VBW A;  1E3H A;  2EIM H;  1MND A;  2RV8 A;  1X58 A;  4YEL A;  4D5C A;  5ERI A;  3GFJ A;  2CUF A;  3F72 A;  3K1P A;  4OMZ A;  4B1R A;  1SEU A;  4E70 A;  4EJV A;  4NB5 A;  5LHI A;  4AU7 A;  4J01 A;  4IHW A;  4HAM A;  5DM7 F;  1LE8 B;  2HPI A;  1YW8 A;  3K4B A;  1MSE C;  2FSW A;  3HB9 A;  3CC4 I;  4LK1 F;  4ON0 A;  5ILU A;  3Q0V A;  2F2E A;  1FOX A;  2QBY A;  2JVH A;  4O5V A;  3DKX A;  1B9N A;  2AXT C;  3R0J A;  1R36 A;  4IO9 F;  2DXI A;  4L5I A;  5DYM A;  3OYJ A;  5HLG A;  1W5S A;  2B7E A;  2HTS A;  3ISP A;  1HDD C;  3E0J B;  3HZJ A;  3F6O A;  4KUM A;  3SZG A;  5ICG A;  1LUJ B;  5M3F J;  2K3P A;  3CF2 A;  4KMF A;  1O3Q A;  1X3W B;  5CVR A;  5LGN A;  2TDX A;  2FOK A;  1APL C;  1XN7 A;  4NC6 A;  1ETQ A;  1T0F C;  4FIS A;  1B8I A;  3BTJ A;  1FP1 D;  3GTL J;  3KZY A;  4GYG A;  4I6Z A;  1QZE A;  5DEQ A;  3H9G A;  4HZF A;  2X6X A;  1Z9C A;  4RAF A;  4A6D A;  3HRT A;  1I6H J;  1F5T A;  1RPW A;  1K6O A;  4A3B J;  1MKM A;  2JWT A;  2M87 A;  1TW2 A;  3V4G A;  3HOY J;  1YFH A;  2LOO A;  1D1B A;  1HKS A;  2DCE A;  4XRF A;  1T2K A;  1N77 A;  1Z6T A;  5M3M J;  4XLC A;  2MC4 A;  2STT A;  3K0L A;  4BJT A;  1RKW A;  2EZK A;  1C0W A;  2AS5 F;  3OL4 A;  4BE0 A;  3WU2 C;  2NRA C;  5E1Z B;  1YW7 A;  4IZZ A;  3RDI A;  2XGC A;  2DA1 A;  4LFU A;  3OMY A;  3LFK A;  2M0C A;  1L3L A;  3JAM K;  2K5C A;  2R7V A;  1YIJ I;  1QQI A;  3BY6 A;  3ZMT A;  4G7O F;  1BL0 A;  4MIM A;  3SZP A;  2H8R A;  3GCM A;  2K9Q A;  4HF0 A;  2MBF A;  2DT6 A;  5GAD J;  1PP7 U;  4PSW A;  2FUG 2;  2DT7 B;  3HHG A;  3VEP A;  4A0Z A;  5ICC A;  2EFQ A;  1LDD A;  2XRN A;  4QPQ A;  2UWM A;  3HIF A;  3FHN A;  1IAW A;  3BZK A;  1QVT A;  5FFZ A;  3D5S C;  3HXL A;  1HBX G;  1R1U A;  2K9S A;  3H9Q A;  4UB6 C;  4RS8 A;  2ZME C;  1R00 A;  2VC0 A;  2W00 A;  1FPQ A;  4A3G J;  2E1M C;  1H0M A;  3L00 A;  2ID3 A;  2CSO A;  2ZJQ F;  2PJR A;  4A3M J;  1YYV A;  1KA8 A;  5EDN A;  1USS A;  3GBG A;  2XF7 A;  5AIP A;  4CIC A;  2EK5 A;  4F92 B;  4IRI A;  3HEF A;  4Y33 A;  3Q0U A;  1KZH A;  3MWM A;  1N75 A;  2AQE A;  3AG1 H;  3GFM A;  4YEJ A;  3IRR A;  3HSE A;  2V9P A;  1ERD A;  2VE9 A;  1W7P B;  2L01 A;  3WTW C;  1E3O C;  1SD6 A;  3CC7 I;  4A3F J;  2ESN A;  4N4O B;  4LB6 B;  3OOU A;  4XQF A;  4TV7 A;  4HX8 A;  3ZRG A;  2A6H F;  2FNP A;  1ZQ3 P;  1ZYR F;  3OIO A;  3OV8 A;  4UY8 I;  2NS8 A;  2L9V A;  2E1M B;  3OYL A;  1UG2 A;  3LMM A;  3C2H A;  3DWL E;  1XGO A;  2Q1Z B;  2IS1 A;  4UVB A;  1I39 A;  3CJR B;  2NS7 A;  3IKT A;  3E5Q A;  1P92 A;  3I9V 2;  2GXB A;  3J81 Z;  2QYO A;  1FTT A;  1ZN2 A;  1PJR A;  4BUP A;  1A5J A;  5FLX K;  3M7G A;  1H8A C;  1FOK A;  2ZO4 A;  3HOZ J;  2O61 A;  5TIS C;  3F21 A;  3QOE A;  4P1W A;  2OBP A;  1ZR2 A;  2NOJ B;  2BE5 F;  4A3I J;  2F5C A;  1QO0 D;  2GXG A;  2UUZ A;  2IGN A;  3DLL F;  3FXL A;  2XV4 S;  3S2H J;  2JA2 A;  2JT1 A;  5LHG A;  2AXL A;  2OJE D;  1KU3 A;  2V26 A;  3ABT A;  2I10 A;  3FK7 A;  4JBA A;  4E7J A;  4Y52 J;  1JKO C;  3K2Z A;  1VQO I;  2LP0 A;  5F64 A;  1MW7 A;  1FIA A;  2XVC A;  2LKX A;  1B8I B;  3VSL A;  1A6Q A;  2BOL A;  1UHS A;  3E5X A;  3EUA A;  2H1L A;  2DDB A;  2CQN A;  4KDP A;  3IRQ A;  4IHV A;  2PQ8 A;  3JCU C;  2AO9 A;  4QLC U;  3HBL A;  2L0K A;  2DW4 A;  3BG6 A;  4KIG A;  1H89 C;  2WY8 Q;  3WG9 A;  2P7V B;  2MLG A;  3S1M J;  4A3D J;  3T8T A;  1T33 A;  1HDP A;  1JTY A;  3HRU A;  1IGN A;  2HQA A;  1TWG J;  3FMR A;  3KYD B;  1O3T A;  1O4X A;  2KHM A;  3K6G A;  1TNT A;  2HQN A;  4ENM A;  2DQR A;  2E1C A;  2ZNZ A;  4BXU A;  4WXD A;  2JUG A;  4ANJ A;  1VQK I;  2M9H A;  4G6Q A;  5LBQ A;  1X3Z B;  5F1R A;  1SAN A;  2XPV A;  3H3Z A;  3JRG A;  4X1E A;  3LSJ A;  2KRH A;  1LNW A;  1SFK A;  3JR9 A;  2ZXI A;  3ASO H;  3G73 A;  5TRD A;  1D3Y A;  2EH3 A;  5ICF A;  3CD6 I;  1SFX A;  4BBS J;  3V8L A;  3RYR A;  4AVP A;  4CO8 A;  1A35 A;  4ZH4 F;  1G3T A;  4C3H J;  4EM0 B;  5K5Q A;  3GTM J;  3D0S A;  3ZXS A;  4XOT A;  3QPL A;  3RTR A;  5IYD J;  4IKF A;  1ZR4 A;  2H6C A;  3GF2 A;  5ILS A;  3AFH A;  2EFP A;  4RAZ A;  1VQL I;  2CV2 A;  3HC7 A;  4QSH A;  4EJU A;  1B59 A;  1WGX A;  5FFX A;  4M3G A;  5HDK A;  2GXA A;  1WZ2 A;  3WTY C;  2VBY A;  4S05 A;  2P8T A;  1D8K A;  5FD6 A;  3FX3 A;  4C2U A;  1MJB A;  1XGM A;  2LC2 A;  1T0F A;  5D6E A;  1BOA A;  3FXK A;  4YII A;  1T95 A;  3Q9V A;  3DEU A;  3E1S A;  1IN6 A;  5C3E J;  3GTP J;  1P4A A;  3F6V A;  5CJ9 A;  1OYW A;  4EJO A;  2DA6 A;  5BNG A;  1JT0 A;  3PQJ A;  1L0O C;  1AKH A;  1XSV A;  3PO2 J;  2XRL A;  1H88 C;  2EIJ H;  3QOD A;  2W48 A;  4XKV A;  4RB1 A;  3F22 A;  1I1S A;  3D5R C;  4AIJ A;  4BJ5 C;  1ZRD A;  2E2J J;  4G12 A;  1FYL A;  3CCU I;  2XKO A;  1LB2 A;  3MVP A;  2XGE A;  1LFB A;  1YJW I;  1G6N A;  1IRF A;  2R5Z A;  1IV8 A;  2R7X A;  1XDU A;  1IJW C;  4P5O A;  4BXX J;  2HYJ A;  4FHT A;  5CYV A;  4L9N A;  5F0H A;  3VOE A;  3CCV I;  3LAJ A;  3P5J A;  1ZAO A;  4MTE A;  1B6A A;  2IA2 A;  3N97 A;  4MEY F;  3EUH C;  2Z2S B;  1IDY A;  2VT2 A;  1VQP I;  1ULY A;  2A5W A;  3G1M A;  3SYT A;  1ODD A;  2HDW A;  1GV5 A;  1HW5 A;  3C1D A;  3JTH A;  3PUB A;  2EQR A;  3IH3 A;  1RR8 C;  2DI3 A;  1V5G A;  2CQ7 A;  2O3F A;  1YRN B;  1YJN I;  1R1T A;  2M8G X;  4Y3O A;  1N78 A;  2WB1 A;  3DKY A;  1I6X A;  5C4J J;  2QUF A;  5E3O A;  2IS2 A;  3KE2 A;  3OR2 C;  3KPH A;  1MBJ A;  4XLA A;  4XOR A;  4XLN F;  1G2H A;  4IOA F;  1VFC A;  1BIA A;  2EFO A;  2ETH A;  3BG5 A;  2B9S A;  4II2 A;  4W1U A;  4DGW B;  2Y69 H;  2R3S A;  2V1U A;  2HKO A;  3GZ5 A;  5HS7 A;  4MQ9 F;  3HKZ A;  2EIK H;  2CW8 A;  3JRC A;  2XC7 A;  1I3A A;  1YLF A;  4BY1 J;  4CA0 A;  4RAG A;  2K40 A;  1V54 H;  2CYY A;  1ON1 A;  4PGH A;  3GW2 A;  4QTR A;  2X1D A;  4AWX B;  3OYA A;  1ZRC A;  1BIB A;  3G2B A;  3K7A J;  4Y17 A;  1E0E A;  4EGZ A;  4KN7 X;  2LDU A;  4M73 A;  5K7Z A;  1QU3 A;  4HF2 A;  2Z99 A;  5DUK A;  4JP0 A;  1V5E A;  5DCF A;  4M9X A;  4JYK A;  4M3F A;  5EJC A;  2F6C A;  1X1A A;  2Z1D A;  3MKY B;  1K4T A;  3K1M A;  5GTI C;  1SAX A;  2COM A;  5D5U B;  2BGC A;  4WXH A;  2R7O A;  3T5X A;  3OYF A;  3I3L A;  3DPL C;  3HUG A;  2R7Z J;  2TCT A;  4RGS A;  3M07 A;  2Z3Y A;  1U6G A;  3E6C C;  1J9I A;  3GXO A;  5B66 C;  1SD4 A;  1JUM A;  1VQM I;  2JN6 A;  4ZTJ A;  2M4G A;  3F3X A;  1R49 A;  1IC8 A;  1Y6I A;  3OS1 A;  2DT5 A;  2V4J C;  4EJW A;  3OIP A;  2VN2 A;  2CW7 A;  2WV1 A;  4II3 A;  2FXA A;  4CYC B;  1TWC J;  1MMN A;  2LVS A;  1Z3X A;  2OTJ I;  5JVG F;  3C3W A;  1JJ6 C;  1IXC A;  4U0W A;  4EM2 A;  2ZCW A;  3L2C A;  4C9Y A;  1MIJ A;  2JJ7 A;  3DF8 A;  4K2E A;  1W0T A;  1NHA A;  4R8H A;  3ZR8 X;  3ERM A;  4YIR X;  2YUS A;  3NEU A;  1EH7 A;  3A02 A;  3NAR A;  1RIO H;  1EJ9 A;  3WG7 H;  3VFZ A;  1Y1V J;  3HHH A;  3LQQ A;  1U3E M;  1MBE A;  2X9D A;  1ZRF A;  1JJ8 C;  2ISY A;  2LK2 A;  2KZG A;  1BR1 A;  1VTN C;  4P55 A;  2ZJR F;  3SJM A;  2VQH A;  3ZQF A;  1V3F A;  1ZLK A;  2HYG D;  4IRH A;  4EVI A;  2ESH A;  2YX4 A;  4XKC A;  4XRM A;  2W24 A;  4DIQ A;  3CLQ A;  3I4P A;  3HSR A;  4X0G A;  5IT9 K;  3L2Q A;  1VND A;  3ABU A;  3FK6 A;  4LG3 A;  2X48 A;  2FQ3 A;  2VT3 A;  1B72 B;  3N05 A;  1S7E A;  2PFB A;  3UKG A;  2F5E A;  2Y0S N;  2XAG A;  1YQA A;  1UST A;  2QKM B;  1UHW A;  3CUQ C;  1EKE A;  2PX9 A;  4A0Y A;  4WCG A;  2LRD A;  3RPU A;  5J6X A;  5FKK A;  2EFW A;  3WOD F;  2EV6 A;  3GO5 A;  3ZQ7 A;  5E18 F;  1ORK A;  2LNB A;  2RAE A;  4JOM A;  4M72 A;  2YSR A;  3SDB A;  1KYZ A;  3WE3 A;  4A3C J;  4CYC A;  5TGT A;  4A3L J;  3K70 C;  4Q47 A;  3A0B C;  5FRM A;  1SMY F;  5CQE A;  5DCM A;  2KP6 A;  1OKR A;  2D5V A;  4X6A J;  1KU7 A;  1ZH5 A;  2M8E A;  1SD5 A;  1KYW A;  2E60 A;  2I5U A;  5LGU A;  1UAA A;  2NVU B;  1PUF A;  2FBI A;  1ZHF A;  3E6D A;  2QSF X;  2RQQ A;  1PUE E;  3CDI A;  4ZJZ A;  2FNA A;  2RC4 A;  1ON2 A;  2XPW A;  1TT5 B;  5E17 F;  1HXD A;  1IUY A;  1ZAR A;  4B3A A;  4OAY A;  1MBG A;  5L3D A;  1BBY A;  1ZG1 A;  1XSD A;  5E8I A;  2KLO A;  1UZC A;  4GDF A;  3K4N A;  2ADU A;  2DU9 A;  2P5V A;  1EH6 A;  2WAQ N;  4JX4 A;  1TLH B;  2UZK A;  5CVU A;  1W36 D;  3D5L A;  5HNF A;  2AQF A;  5KAI C;  5JFR A;  3NWS A;  3TKY A;  5B3S H;  1VQ7 I;  4I76 A;  1QPM A;  4YIF A;  5B1A H;  1F9N A;  3KEO A;  3MN2 A;  2VKH A;  1U5T A;  3HPH A;  4KIS A;  3AL0 B;  3A01 A;  1RKT A;  2A3S A;  4ZYG A;  3HPG A;  4E6K G;  1U2W A;  3J7Y J;  2CUZ A;  2ZJP F;  4ZTF A;  4HX7 A;  4IHY A;  1W1W E;  2CUE A;  1YE9 A;  2HR3 A;  5EGO B;  1HKT A;  3BQZ A;  4IOC F;  2NYX A;  2ZNY A;  1OPC A;  4BQA A;  1F43 A;  1S6L A;  4M71 A;  5K5O A;  3IH2 A;  4G94 A;  3F23 A;  1T6S A;  1NK2 P;  2L9S A;  3HTS B;  4XMY A;  2H09 A;  5ICE A;  4PK4 A;  1FIP A;  2OA4 A;  1RNL A;  2OZ6 A;  2MSY A;  5J3L A;  3HOV J;  1E3P A;  1D1A A;  3FXO A;  4ZZD A;  3OYM A;  1VF9 A;  2K4J A;  3TW6 A;  3B6C A;  5E1X A;  1FOW A;  2KZV A;  3KX2 A;  3PUF A;  3CMM A;  4N9H A;  4UHT A;  4KT6 A;  3WHB A;  3WU0 A;  1VQ4 I;  2XDV A;  3MFK A;  1IXR C;  3R0A A;  2JRT A;  1BR2 A;  4AC0 A;  3RSN A;  5LEK A;  2M1B A;  3E5U A;  4S04 A;  3RKQ A;  1DP3 A;  3TDZ C;  5GAH J;  3GX4 X;  3K69 A;  3TQN A;  1QZZ A;  2QEN A;  4CZZ A;  1IW7 F;  3IL2 A;  1AKH B;  3VPR A;  2Y9Y A;  3O3K A;  5ILV A;  3VYT B;  1K61 A;  5EZH A;  3DXJ F;  1XS9 A;  3H3U A;  3C7J A;  5FKL A;  2PBI A;  2BZT A;  2STW A;  3I4N J;  2LBF A;  2WWY A;  3P9C A;  5AON A;  2CWE A;  4HSR A;  2QQA A;  1CGP A;  3ZMV A;  1EH8 A;  2DTR A;  1JGS A;  4M3B A;  2RGV A;  4Y15 A;  1JE8 A;  2JA8 J;  4PSX A;  1FNN A;  2P0W A;  3OYI A;  5HNH A;  4U0V A;  2EZH A;  4PDK A;  2ZBK A;  4FET A;  2L02 A;  4XKW A;  3T8R A;  3LSP A;  2KDO A;  4BS9 A;  5JLX A;  4XLE A;  4ZYA A;  3FIW A;  2IVM A;  1D0Y A;  2EPF A;  3TOB A;  2V1N A;  3S8P A;  4XM3 A;  2ZME A;  3FF5 A;  2X0L A;  3CP8 A;  4I0B A;  5CVV A;  2ECC A;  4ESJ A;  3JW4 A;  5J1U A;  3U1K A;  2EZL A;  2O8X A;  1I27 A;  1U9N A;  2BY2 A;  4GO1 A;  2M30 A;  2V9V A;  3BJO A;  1WH5 A;  1XCV A;  2W57 A;  5DD8 A;  2JMW A;  5FKN A;  2Z9O A;  4HV5 A;  4DBR A;  2E7W A;  2D1V A;  1JHH A;  2DFI A;  2O7O A;  1DDN A;  4XID A;  1OQY A;  3GTK J;  5F0F A;  1O7F A;  1TWA J;  3AG4 H;  2DMQ A;  2DOE A;  5LLQ A;  3QQA A;  3L9F A;  3SQN A;  3WTX C;  4D1Q A;  1W36 C;  1K78 B;  1SVM A;  2FBK A;  2FX0 A;  3DU5 A;  4AYB N;  4A12 A;  2A6E F;  3BG3 A;  3MMY B;  3L7W A;  2PLY A;  6PAX A;  1MBH A;  1RRJ A;  3HYI A;  4M9Z A;  5H6R A;  2MA3 A;  1PDN C;  1FOY A;  3S1R J;  2LD5 A;  4BYY A;  1FBQ A;  1QA6 A;  2RNG A;  2G7H A;  1Y8Q B;  3GTG J;  1BN5 A;  3G71 I;  2WB1 N;  1DP7 P;  4E7L A;  1NTC A;  2D1H A;  4PJM A;  3H0D A;  1MMD A;  2M0M A;  1IN8 A;  4KIC A;  2ISZ A;  4XRS G;  3FIS A;  4LIU A;  1VQ8 I;  2W82 A;  2RKH A;  2E19 A;  2VQL A;  1N25 A;  3A1Y A;  3I55 I;  1Z7U A;  3OYC A;  3D1N I;  2DOF A;  3RKY A;  3HG9 A;  1A31 A;  4HEA 2;  2OCE A;  2DFF A;  4ZDL A;  1GXP A;  4OIP F;  5FLV A;  1MNM C;  2LY1 A;  3K70 D;  4RB3 C;  1Z3Y A;  4MGR A;  3NAU A;  3WE2 A;  3FXR A;  3L2W A;  3CZ6 A;  2JQ7 A;  1HW1 A;  2ZXH A;  5CVI A;  2ELJ A;  4FX0 A;  2K9M A;  2XAH A;  4L5E A;  4LGW A;  1YI2 I;  5IYC J;  4MFD A;  3CMA I;  1ZK8 A;  4B09 A;  3P7N A;  4FAS D;  5JVT A;  3BPV A;  2WAD A;  4BL0 B;  4LG0 A;  2PG4 A;  2V1D A;  2JSC A;  5AIQ A;  1W7P D;  3J80 Z;  2ID6 A;  3BCB A;  2OQG A;  4YFK F;  2L5Q A;  2P4W A;  5KAF C;  3QAH A;  2XAJ A;  1DU0 A;  2IPQ X;  1FLI A;  4LLG F;  1XCB A;  2DDA A;  1V5F A;  2E2H J;  1OCR H;  3Q0W A;  4CSW A;  2MGQ A;  1WFX A;  4ETS A;  3I58 A;  5EEA A;  3B6A A;  2W85 A;  2VOP A;  3DEW A;  1S72 I;  2F5D A;  2BEO A;  2LKP A;  4V2F A;  5BPI A;  4IHX A;  5EZG A;  1B72 A;  5L3E A;  2QBY B;  4HDV A;  4KYW A;  3BR6 A;  2BYV E;  5DD4 A;  2DK5 A;  3O8G A;  4XRS A;  3KET A;  3M3Y J;  3U9G A;  1S29 A;  1PVE A;  2GA2 A;  3BR0 A;  3S2D J;  5EEG A;  1JXS A;  5E20 A;  4A5N A;  2LMD A;  5HS9 A;  1G4D A;  4BQQ A;  3VB2 A;  1YW9 A;  1ZKG A;  1LVA A;  2O9L A;  2QKL B;  3I4M J;  2RDP A;  2NVY J;  5M5X J;  1MMG A;  4ABZ A;  3W2A A;  2CG4 A;  3V8K A;  5FGM A;  2CQK A;  4UUT A;  3WU1 B;  2HOS A;  4ZDP A;  3DTI A;  2NVQ J;  1FTZ A;  2LY2 A;  1HQC A;  5KHD A;  5LRR A;  2R7W A;  5D8L B;  1Q1H A;  3S2W A;  2H8W A;  3MZ8 A;  3K1N A;  3OYE A;  2OQR A;  4LK0 F;  2A05 A;  1ETY A;  2F4I A;  2FE3 A;  2PMZ N;  3KIO A;  4AVZ A;  4YFX F;  2WC2 A;  5HVQ C;  4GFB A;  1P4X A;  4IXA A;  2CUJ A;  4BDZ A;  3OYK A;  1P6R A;  1W5C C;  3J7A O;  2LSO A;  2IBD A;  2QVO A;  1MD0 A;  4BAY A;  3IUO A;  2E35 A;  2R7U A;  4OWR B;  4E7K A;  2PJP A;  1XC5 A;  3A4C A;  1X1D A;  2OZU A;  5DTD A;  2Y0S A;  4DNC A;  3DCF A;  2M34 A;  4QIW N;  1X2M A;  3GWZ A;  1J59 A;  3EUK L;  4CCK A;  3LA2 A;  5FD5 A;  2ZFU A;  1CF7 A;  3S1Q J;  4C2M J;  2ZSI B;  1NG7 A;  3ZPL A;  4OIQ F;  2XF6 A;  4MHG A;  1IF1 A;  2ZME B;  1QPI A;  1TC3 C;  2N8G A;  4HLX A;  3VYR B;  3ZMD A;  2A69 F;  4CCM A;  2QSH X;  2KIF A;  3LSI A;  3I59 B;  2PJR B;  4KIF A;  4IF4 A;  1O3S A;  4IRG A;  1V55 H;  2FQ4 A;  2EA4 A;  2MLK A;  2KFD A;  4ENN A;  5HDG A;  2JUC A;  4PCQ A;  2L7K A;  1WVR A;  4XK4 A;  2R92 J;  1BI0 A;  2L4M A;  2OCC H;  3VDX A;  3I56 I;  2CRG A;  2HI3 A;  1T56 A;  4MO7 A;  4N9I A;  1WSU A;  1S7O A;  2UXX A;  1LFP A;  4CUG A;  1TW3 A;  2KT0 A;  1MH4 A;  4MFE A;  3F8C A;  5LRS A;  2K86 A;  3LA7 A;  4PFO A;  1IN4 A;  2KIQ A;  2VKV A;  1Y8R B;  4CCO A;  4HNU A;  3SZT A;  3CCM I;  1T98 A;  3OS0 A;  3F9K A;  2XPU A;  2GAU A;  2MYS A;  3ZQQ A;  1MH3 A;  1QZY A;  2DA2 A;  5GAG J;  1I1G A;  2VXD A;  3ABK H;  4IVN A;  4HF1 A;  3QU3 A;  2BW3 B;  2X1E A;  1ZTR A;  1UEL B;  3K4M A;  1OCC H;  1VQ6 I;  2LBF B;  3H5A A;  2B63 J;  1IV6 A;  5F27 A;  1HST A;  3RCO A;  1P7J A;  2GM4 A;  3JSO A;  5DUI A;  1JHF A;  2R0Q C;  1KON A;  3GZN B;  4FX4 A;  3C2B A;  2DYR H;  2IGO A;  2KQR A;  2YX7 A;  2ZJ2 A;  5J8C A;  5HOD A;  4Y7N J;  1T08 B;  3DKW A;  3HM5 A;  1YG2 A;  5L3C A;  3I59 A;  2W25 A;  3GLL A;  3ML6 A;  3ZGK A;  4CGZ A;  4XKB A;  1T38 A;  2DPD A;  3ERE D;  4R1H A;  3I64 A;  4ENK A;  4Q48 A;  1UJ8 A;  2ZXJ A;  3PFI A;  1U0J A;  1T8I A;  1H9G A;  3P9I A;  3G3Z A;  1B9M A;  1W7P A;  1MMA A;  3BZ6 A;  4CCN A;  4ASN A;  2XRO A;  4ENJ A;  3BQY A;  2QQB A;  4PGG A;  1UHM A;  3FM5 A;  3WGG A;  5GPC A;  4JQF A;  2I8D A; 
#chains in the Genus database with same CATH homology
 3QPT A;  1FT9 A;  4WXC A;  4P9U A;  1HKQ A;  3MCZ A;  1X3U A;  3LST A;  2P7C B;  5BPD A;  3MAJ A;  2CGP A;  1U78 A;  4M74 A;  1U5T C;  5H6Q A;  2EB7 A;  3N4M A;  1AOY A;  5H20 A;  1RUO A;  4UVC A;  4LJZ F;  5BMZ A;  4ZYH A;  4U88 A;  4Q4Z F;  2PMH A;  2VOD A;  3F8F A;  3DFG A;  4HOB A;  2J5P A;  1TQI A;  4BHB A;  3ULQ B;  1XB4 A;  2A68 F;  3KLO A;  5HLH A;  1FZP B;  3KCC A;  1CF7 B;  4I02 A;  1OMI A;  3KP7 A;  1H9T A;  3U2R A;  3V7S A;  5DV5 A;  4CDG A;  2XIG A;  1KQ8 A;  4HYE A;  2MC3 A;  2VC1 A;  5ED4 A;  1S8N A;  3BRO A;  1ZGJ A;  2D2W A;  1YO5 C;  1BM9 A;  4IPA A;  2F5F A;  4I0A A;  4L0Z B;  3KP5 A;  2R7D A;  2UXN A;  3HOS A;  4KT5 C;  3CO7 C;  2NNY A;  1IZ1 A;  1OYY A;  3TOA A;  3KEQ A;  4YG2 F;  1YIO A;  2KJC A;  4AIH A;  4D0P A;  1FSH A;  3CDH A;  1W5T A;  3BJA A;  2R7F A;  2HQR A;  2L54 A;  4A5M A;  3KZZ A;  2QZ8 A;  4UV8 A;  2JPC A;  2YR2 A;  4RAY A;  5J8F A;  4HX4 A;  3GYH X;  1K79 A;  3LA3 A;  3DV8 A;  4HDU A;  3M8E A;  3CJN A;  3V7C A;  2M45 A;  1SFU A;  1ZRE A;  3BOQ A;  2OD5 A;  1LDK B;  2HOE A;  3FXQ A;  1MZB A;  1BI1 A;  3HSF A;  4NQW A;  2YU3 A;  3QP5 A;  2VE8 A;  1GVJ A;  2O0Y A;  3EYY A;  3RJP A;  1BC8 C;  3ZMZ A;  5LGT A;  1KU2 A;  2VXZ A;  4GYI A;  3AAF A;  4FT8 A;  1K7A A;  2CW0 F;  3RIR A;  3W6J B;  4KMU X;  3E6B A;  3ECO A;  5LHH A;  2IW5 A;  4LD5 A;  4P9F A;  3B73 A;  3FZV A;  4ZYE A;  4EMS A;  1LDJ A;  1MJ9 A;  1FY7 A;  5L3B A;  1I5Z A;  4WWC A;  4U0Y A;  3R4K A;  3CUQ B;  3RI4 A;  1P4W A;  3GUD A;  3JTG A;  3JAM Z;  1EV7 A;  2YPR A;  5LEJ A;  2NNN A;  3CLO A;  1U8R A;  4MQV A;  3GFI A;  3Q9S A;  4GXO A;  5KVR A;  2BBY A;  2FEZ A;  1Z91 A;  4A0X A;  1R5H A;  5D4S A;  3I54 A;  3M8F A;  1RUN A;  2XUB A;  4WK8 F;  3FWE A;  3IHU A;  3IWZ A;  4G9Y A;  2HFH A;  4L0Y B;  3FMQ A;  1AWC A;  3GFL A;  3SFZ A;  1LEA A;  2IJL A;  3WGH A;  4U7D A;  3HRM A;  1WKM A;  2KIU A;  3FM3 A;  2ACJ A;  2D45 A;  4I7H A;  2J5O A;  3DQV C;  1UFM A;  3IKV A;  4I2O A;  3GZ6 A;  4LLN A;  4L9T A;  4G8X A;  2Y48 A;  3KP2 A;  1PP8 F;  1E2X A;  4HQM A;  3DP7 A;  1KU9 A;  5TJJ A;  3KP3 A;  4PZJ A;  2NS0 A;  1IN5 A;  2HDC A;  1RI7 A;  1ZGA A;  1D5V A;  3T0Y A;  3FMS A;  3O2P E;  2XAS A;  1ZG3 A;  2V1X A;  4WX9 A;  2H6B A;  5DDG A;  2BV6 A;  5JR3 A;  4A2U A;  4A6E A;  4BNC A;  3TO6 A;  1LEB A;  3I71 A;  3R60 A;  4G6D A;  1SMT A;  4MNU A;  1MDM A;  1O3R A;  4I09 A;  1DPU A;  4MTD A;  2P6T A;  1Z6R A;  2VOO A;  4N0B A;  5E1W A;  3RKX A;  2GWR A;  4G7H F;  4CYD A;  4KIB A;  1G3S A;  1Y0U A;  3EDP A;  2LF7 A;  4JK1 X;  1OR7 A;  3MEX A;  3ZP5 A;  3BDD A;  2JTV A;  3FXU A;  3TGN A;  2CO5 A;  1TBX A;  4DQ2 A;  3F8M A;  4YFN F;  1MGT A;  2RVC A;  2MH9 A;  1ZG5 A;  5HOO A;  5CLS A;  3P9K A;  3O6B B;  1MDM B;  1XGS A;  5FO5 A;  4P96 A;  1FC3 A;  4M6X A;  1T39 A;  3FHZ A;  1TNS A;  3SHF A;  2HGC A;  1QGP A;  1J7K A;  4CHU A;  3ZN0 A;  4IHT A;  2PN6 A;  5F6F A;  3W6K B;  3ZMS A;  1FBU A;  5K1Y A;  3KP6 A;  2JPB A;  2Z5U A;  2CFX A;  1WWX A;  4QWQ A;  4HV6 A;  3KLN A;  2FMY A;  3ZN1 A;  5D8K B;  2G9W A;  2GQQ A;  4EJT A;  4LLL A;  2IA1 A;  3K9T A;  1O57 A;  2A5Y B;  2XGX A;  4XBF A;  1GXQ A;  3I53 A;  1FX7 A;  3E6M A;  3GLX A;  4B8X A;  1BI2 A;  3LWF A;  1V4R A;  2V6C A;  3CTA A;  3VOD A;  1F4K A;  2WV0 A;  4L9J A;  3H92 A;  5BOX A;  4MEX F;  2RNJ A;  1TQM A;  2A07 F;  4Y13 A;  5A2Q K;  3BWG A;  4KA4 A;  1TQP A;  4GCV A;  3T1B A;  2A61 A;  2GA1 A;  4ZZL A;  4EM1 A;  4EGY A;  1BI3 A;  4CXF A;  1G3W A;  3WTT C;  4HW0 A;  2B0L A;  2EA2 A;  3CUQ A;  4R79 A;  4BHC A;  3HRS A;  3KFW X;  1J2X A;  1ONV A;  1STZ A;  1LJ9 A;  3OOP A;  3CO6 C;  3DPT A;  2VBZ A;  3LQR A;  5IT3 A;  3V8J A;  2FF4 A;  1XMK A;  3ECH A;  2IRF G;  3L09 A;  2W84 A;  2KJB A;  2EWN A;  2Y0M A;  3CUO A;  2P6S A;  4OOI A;  2Q0O A;  2Q8K A;  3GVA A;  2MD5 A;  4OMY A;  4BHP A;  4IHS A;  2FA5 A;  2KKO A;  2DPU A;  1YTY A;  2E1N A;  1KQ0 A;  4M9S A;  2IP2 A;  1F1Z A;  4UVA A;  5IT9 Z;  3MQ0 A;  4HBL A;  3E97 A;  2O03 A;  2NAZ A;  1E17 A;  2QWW A;  3NQO A;  1UCR A;  1REP C;  3E3V A;  4XSX F;  3TDU C;  3U1D A;  2DLL A;  3Q5F A;  2VON A;  1XGN A;  2XAF A;  5HS8 A;  2LF8 A;  3QOP A;  2EJR A;  4G7Z F;  1R22 A;  4AIK A;  4UV9 A;  1GHC A;  5D5X B;  3PQK A;  1W4M A;  4M6Y A;  3F8N A;  1IRG A;  2ZKZ A;  1DUX C;  4UNO A;  1WI9 A;  5HDN A;  2RN7 A;  2C6Y A;  5L3G A;  3BP8 A;  5BQT A;  4RGU A;  3V7R A;  3F8B A;  1WQ2 A;  4OIR F;  5FLX Z;  1XD7 A;  4ESF A;  1G3Y A;  5D4R A;  2P5K A;  3ZMU A;  2M5W A;  3RPQ A;  4EV0 A;  1LQ1 A;  1Z05 A;  1KQ9 A;  4NHJ A;  2EV5 A;  2O6G E;  4WF2 A;  3I5U A;  4HLY A;  1IN7 A;  1FBS A;  2DAO A;  5DCM B;  4RB2 C;  1XMA A;  4O3M A;  3WTU C;  3ELK A;  1J5Y A;  4XLP F;  1IXS B;  1UB9 A;  2Q2E A;  2L3D A;  3QPH A;  3MZY A;  2ZFW A;  3ROU A;  2PI0 A;  1R23 A;  1R1V A;  4KN4 X;  1XDS A;  4KFC A;  1OYI A;  2FBH A;  2FML A;  1FYM A;  2DQL A;  1WRJ A;  3KP4 A;  2Z33 A;  4RGR A;  2OU2 A;  3NRV A;  3IWF A;  5CVJ A;  2HTJ A;  4F7Z A;  4Q5S F;  2K27 A;  1B4A A;  3HTU A;  3R6S A;  4L18 B;  1QBJ A;  2HKX A;  3EYI A;  3TO9 A;  3B02 A;  5EEH A;  4H0E A;  5HLI A;  4HQE A;  4I01 A;  2Y75 A;  5KK1 A;  2V79 A;  3M9A A;  2KIM A;  4Z2Y A;  5D5W B;  2GZW A;  1R58 A;  3BPX A;  1FWZ A;  1KGS A;  1U5T B;  2OAZ A;  2K4B A;  3QP6 A;  1SFE A;  1ZLJ A;  5JHU A;  2VBX A;  4L9V A;  1HSJ A;  2IT0 A;  4ZYD A;  2EV0 A;  2P5L C;  2HS5 A;  1O7L A;  5D5V B;  3J81 K;  1YS6 A;  3RYP A;  1S7A A;  2ELH A;  4IJA A;  2K7L A;  3GEZ A;  3LAP A;  4L5J A;  3JSP A;  2GIV A;  1BJA A;  1BC7 C;  2E7X A;  1R7J A;  2XKP A;  3EQL F;  1J75 A;  2QQ9 A;  3WGI A;  2DBB A;  4OIO F;  1P2F A;  3REO A;  1FYK A;  1K78 A;  2WTE A;  3WTV C;  3SXY A;  2MH2 A;  5E8G A;  4OIN F;  4LMY A;  1DPR A;  4GGG A;  2XHK A;  4I98 B;  4EQQ A;  1XSX A;  3EET A;  1TTY A;  4OU0 A;  5L3F A;  4U7B A;  3C18 A;  3R61 A;  1SD7 A;  2EFN A;  2X4H A;  4RB0 A;  5D6F A;  3BJ6 A;  3MZH A;  4UUV A;  2FRH A;  5FB2 A;  5BS6 A;  1S3J A;  1RZ4 A;  4XSZ F;  2HEO A;  2XAQ A;  2IA0 A;  3J80 K;  3TO7 A;  3HOT A;  2L4A A;  4ESB A;  3COA C;  1Z1D A;  4AD9 A;  1YS7 A;  1QNT A;  3QRF F;  4HA8 A;  2HWV A;  4KNY A;  2QM3 A;  1MJA A;  1FP2 A;  3IC7 A;  4O6J A;  2FU4 A;  4RGX A;  2KRF A;  4LB5 A;  2G7U A;  2RQP A;  1FSE A;  2H27 A;  3RKW A;  1J0R A;  5JI6 A;  2HYF A;  1B1B A;  3I0T A;  2JZY A;  5A2Q Z;  1D8J A;  2K02 A;  3WTS C;  2QLZ A;  3WTZ A;  4BH9 A;  1A04 A;  2PEX A;  2DK8 A;  3M1E A;  1R5G A;  2DO7 A;  3QU6 A;  3EUH A;  2PMU A;  1HW2 A;  4LG0 B;  4UXN A;  2HZT A;  5K5R A;  2H94 A;  2VBW A;  2RV8 A;  5ERI A;  3GFJ A;  3F72 A;  3K1P A;  4OMZ A;  4E70 A;  4EJV A;  4NB5 A;  5LHI A;  4HAM A;  1YW8 A;  2FSW A;  4LK1 F;  4ON0 A;  5ILU A;  2F2E A;  2QBY A;  4O5V A;  1B9N A;  3R0J A;  1R36 A;  4L5I A;  5DYM A;  5HLG A;  1W5S A;  2HTS A;  3ISP A;  3F6O A;  4KUM A;  5ICG A;  4KMF A;  1O3Q A;  5CVR A;  5LGN A;  2TDX A;  2FOK A;  1XN7 A;  1FP1 D;  3KZY A;  4GYG A;  5DEQ A;  4HZF A;  1Z9C A;  4A6D A;  3HRT A;  1F5T A;  1K6O A;  1MKM A;  2M87 A;  1TW2 A;  3V4G A;  1YFH A;  1HKS A;  4XRF A;  1T2K A;  1Z6T A;  2STT A;  3K0L A;  1C0W A;  2AS5 F;  2NRA C;  5E1Z B;  1YW7 A;  3RDI A;  4LFU A;  3LFK A;  1L3L A;  3JAM K;  1QQI A;  3BY6 A;  3ZMT A;  4G7O F;  3SZP A;  4HF0 A;  2MBF A;  1PP7 U;  3HHG A;  3VEP A;  4A0Z A;  5ICC A;  2EFQ A;  1LDD A;  2XRN A;  2UWM A;  3HIF A;  1IAW A;  5FFZ A;  1HBX G;  1R1U A;  4RS8 A;  1R00 A;  2VC0 A;  1FPQ A;  1H0M A;  3L00 A;  2CSO A;  1YYV A;  1KA8 A;  1USS A;  5AIP A;  4CIC A;  2EK5 A;  4IRI A;  3MWM A;  3GFM A;  3IRR A;  3HSE A;  2VE9 A;  1W7P B;  2L01 A;  3WTW C;  1SD6 A;  2ESN A;  4LB6 B;  4TV7 A;  4HX8 A;  2A6H F;  2FNP A;  1ZYR F;  3OV8 A;  1XGO A;  4UVB A;  3IKT A;  3E5Q A;  1P92 A;  2GXB A;  3J81 Z;  2QYO A;  1ZN2 A;  5FLX K;  3M7G A;  1FOK A;  2ZO4 A;  2O61 A;  3F21 A;  2OBP A;  2BE5 F;  2F5C A;  1QO0 D;  2GXG A;  2XV4 S;  2JT1 A;  5LHG A;  2AXL A;  1KU3 A;  3ABT A;  4JBA A;  3K2Z A;  5F64 A;  2XVC A;  3E5X A;  4KDP A;  3IRQ A;  2PQ8 A;  4QLC U;  2DW4 A;  4KIG A;  3WG9 A;  2P7V B;  2MLG A;  3T8T A;  3HRU A;  3FMR A;  1O3T A;  1TNT A;  2HQN A;  4ENM A;  2DQR A;  2E1C A;  2ZNZ A;  4BXU A;  4WXD A;  4G6Q A;  5LBQ A;  5F1R A;  3H3Z A;  3G73 A;  1LNW A;  5TRD A;  1D3Y A;  5ICF A;  1SFX A;  3V8L A;  3RYR A;  4AVP A;  4CO8 A;  4ZH4 F;  1G3T A;  4EM0 B;  5K5Q A;  3D0S A;  3RTR A;  2H6C A;  3GF2 A;  5ILS A;  2EFP A;  4RAZ A;  4EJU A;  1B59 A;  5FFX A;  5HDK A;  3WTY C;  2VBY A;  4S05 A;  2P8T A;  1D8K A;  5FD6 A;  3FX3 A;  1MJB A;  1XGM A;  1T0F A;  5D6E A;  1BOA A;  4YII A;  3Q9V A;  3DEU A;  1IN6 A;  1P4A A;  3F6V A;  5CJ9 A;  1OYW A;  4EJO A;  3PQJ A;  1L0O C;  1XSV A;  4RB1 A;  3F22 A;  1I1S A;  4AIJ A;  1ZRD A;  1FYL A;  2XKO A;  1LB2 A;  1G6N A;  1IRF A;  1XDU A;  4P5O A;  4FHT A;  5CYV A;  4L9N A;  3VOE A;  3LAJ A;  1ZAO A;  4MTE A;  1B6A A;  2IA2 A;  3N97 A;  4MEY F;  2VT2 A;  1ULY A;  1ODD A;  1HW5 A;  3C1D A;  3JTH A;  2DI3 A;  2O3F A;  1R1T A;  1I6X A;  2QUF A;  3KE2 A;  4XLN F;  1BIA A;  2EFO A;  2ETH A;  2R3S A;  2V1U A;  2HKO A;  3GZ5 A;  5HS7 A;  4MQ9 F;  1YLF A;  2CYY A;  1ON1 A;  4PGH A;  3GW2 A;  1ZRC A;  4AWX B;  1BIB A;  4Y17 A;  4EGZ A;  4KN7 X;  2LDU A;  4M73 A;  4HF2 A;  2Z99 A;  5DUK A;  5DCF A;  4M9X A;  3K1M A;  1SAX A;  2COM A;  5D5U B;  2BGC A;  4WXH A;  3T5X A;  3DPL C;  3HUG A;  4RGS A;  2Z3Y A;  1U6G A;  3E6C C;  1J9I A;  3GXO A;  1SD4 A;  3F3X A;  2DT5 A;  4EJW A;  2VN2 A;  2FXA A;  3C3W A;  1IXC A;  4U0W A;  4EM2 A;  2ZCW A;  3L2C A;  3DF8 A;  4K2E A;  1NHA A;  4R8H A;  3NEU A;  1EH7 A;  1RIO H;  3VFZ A;  3HHH A;  3LQQ A;  1U3E M;  1ZRF A;  2ISY A;  1VTN C;  4P55 A;  1V3F A;  1ZLK A;  2HYG D;  4IRH A;  4EVI A;  2ESH A;  2YX4 A;  2W24 A;  3I4P A;  3HSR A;  5IT9 K;  3ABU A;  2FQ3 A;  2VT3 A;  2PFB A;  2F5E A;  2XAG A;  1YQA A;  1UST A;  1UHW A;  3CUQ C;  4A0Y A;  4WCG A;  5J6X A;  3RPU A;  2EFW A;  3WOD F;  2EV6 A;  3GO5 A;  3ZQ7 A;  5E18 F;  2LNB A;  4M72 A;  2YSR A;  1KYZ A;  3WE3 A;  4Q47 A;  1SMY F;  5DCM A;  1OKR A;  1KU7 A;  1ZH5 A;  2M8E A;  1SD5 A;  1KYW A;  5LGU A;  2FBI A;  1ZHF A;  3E6D A;  1PUE E;  2FNA A;  2RC4 A;  1ON2 A;  5E17 F;  1HXD A;  1IUY A;  1ZAR A;  5L3D A;  1BBY A;  1ZG1 A;  1XSD A;  5E8I A;  2ADU A;  2DU9 A;  2P5V A;  1EH6 A;  2UZK A;  1TLH B;  5CVU A;  3D5L A;  5JFR A;  3TKY A;  1QPM A;  4YIF A;  1F9N A;  3KEO A;  1U5T A;  2A3S A;  4ZYG A;  1U2W A;  4HX7 A;  2HR3 A;  1HKT A;  2NYX A;  2ZNY A;  1OPC A;  4BQA A;  1S6L A;  4M71 A;  5K5O A;  4G94 A;  3F23 A;  1T6S A;  3HTS B;  2H09 A;  5ICE A;  2OZ6 A;  2OA4 A;  1RNL A;  4ZZD A;  2K4J A;  5E1X A;  4N9H A;  4UHT A;  3WU0 A;  3MFK A;  1IXR C;  3R0A A;  2JRT A;  4S04 A;  5LEK A;  2M1B A;  3E5U A;  3TDZ C;  3GX4 X;  3K69 A;  3TQN A;  1QZZ A;  2QEN A;  4CZZ A;  1IW7 F;  3IL2 A;  3O3K A;  5ILV A;  3DXJ F;  3H3U A;  3C7J A;  2PBI A;  2STW A;  2WWY A;  3P9C A;  5AON A;  2CWE A;  2QQA A;  1CGP A;  3ZMV A;  1EH8 A;  2DTR A;  1JGS A;  2RGV A;  4Y15 A;  1JE8 A;  1FNN A;  4U0V A;  4PDK A;  2ZBK A;  2L02 A;  3T8R A;  2IVM A;  3TOB A;  2ZME A;  3FF5 A;  2X0L A;  4I0B A;  5CVV A;  4ESJ A;  3JW4 A;  2O8X A;  1I27 A;  4GO1 A;  2M30 A;  2V9V A;  3BJO A;  1XCV A;  2W57 A;  5DD8 A;  2Z9O A;  4HV5 A;  2E7W A;  2D1V A;  1JHH A;  2DFI A;  1DDN A;  1O7F A;  5LLQ A;  3L9F A;  3SQN A;  3WTX C;  1K78 B;  2FBK A;  4A12 A;  2A6E F;  6PAX A;  3L7W A;  2PLY A;  3HYI A;  4M9Z A;  5H6R A;  2MA3 A;  1PDN C;  4BYY A;  1FBQ A;  2G7H A;  1BN5 A;  1DP7 P;  2D1H A;  1IN8 A;  4KIC A;  2ISZ A;  2RKH A;  1Z7U A;  3RKY A;  4OIP F;  1GXP A;  4RB3 C;  4MGR A;  3WE2 A;  3FXR A;  1HW1 A;  5CVI A;  4FX0 A;  2XAH A;  4LGW A;  4B09 A;  3P7N A;  5JVT A;  3BPV A;  4LG0 A;  2PG4 A;  2V1D A;  2JSC A;  5AIQ A;  1W7P D;  3J80 Z;  2OQG A;  4YFK F;  2P4W A;  3QAH A;  2XAJ A;  2IPQ X;  1FLI A;  4LLG F;  1XCB A;  4ETS A;  3I58 A;  2W85 A;  2VOP A;  2F5D A;  2BEO A;  2LKP A;  5BPI A;  5L3E A;  2QBY B;  4HDV A;  4KYW A;  2BYV E;  5DD4 A;  2DK5 A;  3KET A;  3U9G A;  1S29 A;  2GA2 A;  5EEG A;  1JXS A;  5E20 A;  4A5N A;  5HS9 A;  1G4D A;  3VB2 A;  1YW9 A;  1LVA A;  2RDP A;  2CG4 A;  3V8K A;  5FGM A;  2CQK A;  3WU1 B;  1HQC A;  5LRR A;  5D8L B;  1Q1H A;  3S2W A;  3K1N A;  2OQR A;  4LK0 F;  4YFX F;  2FE3 A;  5HVQ C;  2WC2 A;  1P4X A;  4IXA A;  1P6R A;  3J7A O;  2LSO A;  2QVO A;  1MD0 A;  4BAY A;  2PJP A;  2OZU A;  4DNC A;  3GWZ A;  1J59 A;  3LA2 A;  5FD5 A;  1CF7 A;  3ZPL A;  4OIQ F;  4MHG A;  1IF1 A;  2ZME B;  4HLX A;  3ZMD A;  2A69 F;  2KIF A;  3I59 B;  4KIF A;  4IF4 A;  1O3S A;  4IRG A;  2EA4 A;  2MLK A;  4ENN A;  5HDG A;  4PCQ A;  1BI0 A;  2L4M A;  4N9I A;  1WSU A;  1S7O A;  2UXX A;  1TW3 A;  3F8C A;  5LRS A;  2K86 A;  3LA7 A;  1IN4 A;  3SZT A;  1T98 A;  2GAU A;  1QZY A;  1I1G A;  4IVN A;  4HF1 A;  3QU3 A;  1HST A;  3JSO A;  5DUI A;  1JHF A;  4FX4 A;  2YX7 A;  2ZJ2 A;  5J8C A;  3DKW A;  1YG2 A;  5L3C A;  3I59 A;  2W25 A;  4CGZ A;  3ML6 A;  1T38 A;  2DPD A;  3ERE D;  4R1H A;  3I64 A;  4ENK A;  4Q48 A;  2ZXJ A;  3PFI A;  1H9G A;  3P9I A;  3G3Z A;  1B9M A;  1W7P A;  3BZ6 A;  4ASN A;  2XRO A;  4ENJ A;  2QQB A;  4PGG A;  1UHM A;  3FM5 A;  3WGG A;  4JQF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...