3FF5A

Crystal structure of the conserved n-terminal domain of the peroxisomal matrix-protein-import receptor, pex14p
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
54
structure length
54
Chain Sequence
GPLGSPEFREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDLAFQQS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxisomal biogenesis factor 14
publication title Crystal structure of the conserved N-terminal domain of the peroxisomal matrix protein import receptor, Pex14p
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein transport
total genus 21
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ff5A00
3BP8A 2F5EA 5CVIA 1RNLA 1GXQA 3GUDA 4PZJA 3ROUA 2OBPA 2HTJA 4HX8A 2VBWA 3F6OA 2VOOA 2ZMEA 1LB2A 4IVNA 2VBYA 3I0TA 2EFWA 1XD7A 3VODA 3BJAA 3KLOA 1MJ9A 2IA2A 2C6YA 2DI3A 2EFPA 2Q8KA 1P2FA 2CFXA 1Z91A 2IA0A 1OR7A 1FNNA 1SFEA 3WTVC 3V8LA 1I1GA 5JFRA 4MQ9F 1YTYA 1CGPA 3MZYA 1U78A 1IN5A 2VT2A 2V1UA 2A6EF 3JSOA 3FXQA 1IN6A 4CXFA 2NRAC 4ESFA 1YIOA 3KEQA 1I27A 5IT3A 3HIFA 4HV6A 4KIFA 4EM0B 3FMRA 4L9NA 2FXAA 5HLHA 1HXDA 4U0YA 1OKRA 3GZ6A 3TO9A 4A0XA 3FXUA 1U8RA 5DEQA 3NRVA 1TNSA 1KQ0A 2PN6A 3G3ZA 4KMFA 1L3LA 2A3SA 3KP7A 5BPIA 1ZREA 2CW0F 5KVRA 3W6KB 2O6GE 3S2WA 1MD0A 1XDUA 1GXPA 5H20A 5FFXA 4OINF 3TDZC 2EK5A 4RGSA 4CGZA 2AXLA 3WTZA 4Y13A 2EFOA 2O8XA 3L09A 1J2XA 3WE2A 2A69F 2ZNZA 4MTEA 5CJ9A 4M71A 5HS8A 2COMA 2ZXJA 5ILUA 2XKOA 4R1HA 4M6YA 4U0WA 5D4RA 4N9IA 4KIGA 1R5GA 1V3FA 1S8NA 4KFCA 2EFNA 4Y17A 3ERED 3PQJA 5J8FA 1S6LA 2OQGA 5LRSA 1W7PA 1TQIA 2X4HA 1FPQA 1D5VA 5DCMA 4HF1A 5BOXA 2FNPA 5E1ZB 5D6EA 4EJTA 3G73A 2PG4A 1YLFA 4RB1A 3F8FA 4LG0A 5ICGA 2PJPA 4GCVA 4MEXF 5HVQC 1IZ1A 2NYXA 1ZG1A 4LK0F 3ZMUA 3CO7C 4S05A 4NHJA 3K2ZA 5EEHA 3ZP5A 3ISPA 3I58A 5HDGA 1K6OA 3U9GA 2K4JA 2BYVE 3HHGA 2WTEA 4OMZA 1V4RA 1LDDA 4EM2A 3QPHA 1HW5A 3KZZA 3WODF 5AIQA 4CO8A 3K1PA 3EYYA 1HW2A 1U5TA 3T8TA 4XBFA 3WGIA 1ZGAA 3B73A 1HQCA 4A5MA 4I0BA 3CUQC 3R0JA 5KK1A 2AS5F 1ONVA 2P4WA 1DPUA 4QLCU 1E17A 2VBZA 3ZPLA 2KJCA 1BJAA 2HWVA 2OAZA 2GXGA 5K1YA 5HDNA 3DQVC 2VE9A 4IRIA 3MQ0A 1IRGA 2O03A 1DP7P 1F5TA 1FYMA 2WV0A 1Q1HA 5JI6A 3DPTA 4P9FA 2Z3YA 4U7BA 3CTAA 1F1ZA 3WU0A 1FOKA 3ML6A 1P6RA 4WCGA 4Q5SF 2DFIA 1QGPA 3RDIA 1SFUA 1XMKA 4ESBA 4IJAA 3I59B 2H27A 4L9TA 4U0VA 2G7HA 5AIPA 3EYIA 2IP2A 4LB6B 2ACJA 2DO7A 1B6AA 5FLXZ 5LHHA 4I0AA 4LD5A 2BGCA 4PDKA 3WU1B 2RKHA 4BXUA 2QLZA 3HRTA 3JTGA 1O7FA 4ASNA 2HS5A 1RIOH 1G3TA 3TQNA 1O3QA 1YFHA 4KICA 2EJRA 3E6BA 2EV0A 2M1BA 5LEKA 1KU2A 1JXSA 1LEAA 2HDCA 1HKSA 2QQ9A 2A07F 2HKOA 4G6DA 5FO5A 5K5RA 2OA4A 4IRGA 3RKWA 5DDGA 1BN5A 1P92A 2CG4A 2R7FA 4G7HF 3CUQB 1H0MA 2OZ6A 3D5LA 2E7XA 3TDUC 5FFZA 3KP5A 3HOSA 1KA8A 3GW2A 2K02A 5F1RA 4M74A 4PGHA 2FNAA 2ETHA 1KYZA 1QZYA 3Q9SA 2JPBA 5HLIA 4GXOA 2YR2A 3SXYA 5TRDA 1O3TA 4FHTA 4OIOF 2ZCWA 1IXCA 1K78B 2FQ3A 3QU6A 2XVCA 1FP2A 2V9VA 2VBXA 1FP1D 2E7WA 2FBIA 2GA1A 1IW7F 1UFMA 3RJPA 2A61A 1TQPA 4KN7X 1YW7A 3WTSC 2W85A 1FC3A 1PDNC 3JTHA 1HKTA 2XAHA 2LKPA 4I09A 1LEBA 1XDSA 3R6SA 4L0ZB 4JQFA 2LF7A 3RYRA 2GA2A 1LQ1A 2OD5A 1K7AA 3E6DA 4EMSA 1SD6A 1BIAA 1E2XA 2XROA 4GGGA 3MCZA 2J5OA 4CYDA 5L3GA 2FBKA 1WI9A 4HDVA 3T5XA 4PGGA 1IRFA 4AIKA 1DDNA 5ICFA 1BI1A 3FWEA 2HYGD 3FMSA 1ZRDA 4QWQA 3KZYA 4KYWA 2FOKA 3GF2A 2YU3A 1U2WA 1ODDA 2H94A 3K1MA 1R23A 1ZAOA 4MHGA 2M5WA 4Q48A 2IA1A 3V7RA 4CZZA 4KIBA 1B9MA 1BI0A 3ZMDA 1MJBA 2Y0MA 2HOEA 5D5WB 4WK8F 3GVAA 2V6CA 1L0OC 3IHUA 4WWCA 1FX7A 3F8CA 3F23A 3C18A 4EJOA 4ENNA 4R79A 3HHHA 5L3EA 1MJAA 1XSXA 1D8JA 3F22A 2D2WA 3VOEA 2M8EA 4XLNF 2QBYB 3C7JA 3T0YA 5DUKA 4KT5C 1I1SA 3TGNA 1TW3A 5D5VB 5DCFA 2HYFA 3BZ6A 5LGUA 4FX0A 3IL2A 2UZKA 2W57A 3RTRA 4P96A 1IAWA 5DYMA 5H6QA 3GFIA 2HQRA 1BOAA 3V7SA 4ETSA 3LFKA 2Z9OA 4P5OA 1QQIA 2GXBA 3ZQ7A 2DQRA 1WWXA 2ESHA 3EDPA 4HX7A 3CO6C 2VONA 4IPAA 1T2KA 3LQRA 3P9CA 2RC4A 2Q0OA 4IF4A 2G9WA 1ZRFA 2ZKZA 3IC7A 2QQAA 2V1XA 5BS6A 1YW9A 3L7WA 2D45A 1XMAA 3Q5FA 4EJUA 3BJ6A 4HA8A 3ZMZA 2EFQA 5L3CA 4RB2C 2P7VB 1Y0UA 2FRHA 1FBQA 4A6DA 4S04A 1ZG5A 3ECOA 1W4MA 3F8BA 3I64A 3U2RA 2KJBA 3O3KA 4H0EA 4LLNA 1SMTA 2PBIA 2EB7A 4G7ZF 3WTUC 4RGXA 1AWCA 2FSWA 3HYIA 3TKYA 1W5SA 3RYPA 2QWWA 2STWA 2FA5A 3U1DA 3MAJA 2P8TA 4MNUA 2L02A 5ICEA 1FYLA 4A5NA 4UV8A 1G3WA 1IN7A 3GO5A 1K79A 3VFZA 2DAOA 1FSHA 3T1BA 4Q4ZF 3V4GA 1Z05A 3GFLA 3KP2A 4ZZLA 1USTA 3DP7A 2BBYA 2YSRA 2TDXA 4UHTA 3BY6A 3DV8A 1QO0D 2EA4A 2XKPA 2NNYA 2DU9A 1AOYA 5L3DA 5CVUA 5DD4A 1ULYA 1PP8F 4AWXB 1USSA 5LHIA 4RAZA 1KQ8A 2QZ8A 5ERIA 3WTYC 1O3SA 4OMYA 3V8KA 1EH7A 3CUQA 3JAMZ 3RKXA 4YFNF 2YPRA 1YG2A 4YFKF 4BHCA 3GX4X 4WXDA 4M9ZA 2DQLA 1HSTA 1H9TA 1BIBA 4G6QA 4ON0A 1T6SA 4CHUA 4BNCA 5E20A 2OU2A 4M73A 2KRFA 1EH6A 2V79A 3GLXA 1MZBA 2W24A 5IT9Z 3P9KA 4BQAA 5ILVA 3TO7A 2EV6A 3H3UA 2H6BA 5L3FA 4L5IA 1BC8C 2STTA 3E6CC 1QZZA 4BAYA 4RGUA 4HQEA 1K78A 2VC0A 2MH9A 1X3UA 4EQQA 3O2PE 3ZN0A 4EV0A 1OMIA 1IN8A 5E17F 2ZO4A 2F2EA 2NNNA 1D3YA 1RUNA 2EA2A 3KCCA 1XSDA 5CVVA 1UHMA 2QENA 4JBAA 1O57A 2D1VA 5DD8A 3ULQB 4P55A 1XB4A 4MEYF 3EETA 1SMYF 2ZMEB 5ILSA 2P6TA 3C1DA 2J5PA 2O61A 3ZMVA 3B02A 3W6JB 2DBBA 3KP3A 4L18B 2RGVA 4WXHA 3RKYA 2EV5A 3PQKA 1O7LA 5E1XA 1SAXA 1GHCA 4UXNA 4DNCA 3M8EA 1XN7A 1KU9A 3J81Z 3J80Z 1F4KA 3HSRA 1O3RA 2JRTA 2BV6A 4BHPA 1ZYRF 1IN4A 1WSUA 4RB3C 3RI4A 1ZN2A 3F21A 1R5HA 1OYWA 4B8XA 2IPQX 1LNWA 5ICCA 2LDUA 3GYHX 3I71A 1ON1A 5HS7A 5FLXK 1ZRCA 1KGSA 3FXRA 1YO5C 1WRJA 3FMQA 4UNOA 2V1DA 3ZN1A 1HBXG 4ESJA 4LGWA 3HRSA 4B09A 4HF0A 2OZUA 2CYYA 3F8MA 4U88A 3MFKA 1NHAA 2MBFA 2HQNA 2M45A 3F72A 4RB0A 4HDUA 3DFGA 2QBYA 4P9UA 1B9NA 3F3XA 2P5KA 2FBHA 4KDPA 1U5TC 5A2QZ 4KUMA 2R7DA 2JT1A 4O5VA 3EUHA 2G7UA 1KYWA 3IKTA 3LAJA 1P4WA 4HW0A 3VEPA 4HF2A 2PMUA 2CQKA 3NEUA 4ZYEA 5CVJA 5J8CA 3QU3A 1PUEE 1HKQA 4PCQA 4FT8A 3C3WA 4RAYA 3H92A 3IWFA 3R61A 4M9XA 4KMUX 5DCMB 3TOAA 2GQQA 3FX3A 1YS6A 1J75A 2W84A 2HEOA 3LA3A 1WQ2A 4YFXF 2VT3A 1XCVA 3DEUA 4IXAA 4LG0B 3HSEA 3HRUA 2VXZA 2XAQA 2P7CB 3QAHA 5LBQA 3AAFA 2DT5A 2W25A 1EH8A 2O3FA 5HS9A 3QP6A 1W7PD 3R0AA 3WGHA 1R1UA 1ZGJA 4WF2A 1BI3A 4HQMA 3TO6A 1R22A 2IVMA 3COAC 2MH2A 2Y75A 4TV7A 5D8LB 4Y15A 2HTSA 1IXRC 2JTVA 4IHSA 4ENMA 3M8FA 3BJOA 3WGGA 2RDPA 4ZYGA 2F5FA 4OIQF 3JSPA 1XGOA 3D0SA 1JHFA 2UXXA 1U5TB 3WE3A 3DKWA 1FLIA 4YIFA 2F5CA 3LAPA 1CF7B 4ZH4F 4WX9A 3IWZA 3KLNA 1OYYA 2CWEA 1IXSB 3CLOA 4HOBA 2RNJA 5CVRA 1FSEA 1MKMA 4A6EA 3BDDA 5J6XA 3BROA 1Z6TA 3FF5A 4O6JA 2D1HA 3I5UA 1JGSA 4CDGA 1R36A 5D6FA 5LRRA 4EVIA 3ELKA 4LK1F 4CICA 4WXCA 4A0ZA 2ISZA 3RPUA 3KEOA 2Z99A 2DPUA 4L5JA 4YG2F 4XSZF 3N4MA 2VN2A 3LQQA 4KNYA 1J59A 4DQ2A 2XAGA 5BQTA 2MLGA 4AD9A 1BM9A 4BHBA 1XGSA 3GFJA 4ZYHA 2PEXA 4Q47A 5TJJA 3T8RA 2RV8A 1OPCA 4ENKA 1H9GA 3WTXC 3QPTA 1T0FA 3DF8A 2LSOA 2XGXA 1IF1A 4G9YA 4LJZF 2PLYA 1FBSA 3KFWX 1Z6RA 1HSJA 4N0BA 5AONA 2ESNA 5HOOA 5D5UB 2KKOA 1BI2A 4EGZA 1RUOA 1S3JA 3GFMA 2FMLA 4E70A 5DV5A 3I54A 3EQLF 4UVBA 4LB5A 5F6FA 2MLKA 3F8NA 2L54A 1ZHFA 4IHTA 1UB9A 2QQBA 4LFUA 1ZARA 4HBLA 4AVPA 3E5XA 5JHUA 5LGNA 1REPC 2VE8A 1B59A 2VC1A 3ABTA 5D8KB 3F6VA 3KP6A 2ZNYA 2RN7A 2XASA 5FD6A 1Z9CA 3BOQA 2A5YB 1EV7A 3HTUA 1UCRA 4UV9A 1JHHA 4OIRF 1J0RA 4M72A 1QNTA 1SFXA 2MC3A 2E1CA 4M9SA 4I02A 4O3MA 4AIHA 2UWMA 1TBXA 2IW5A 4HLYA 2VOPA 1G3YA 4MQVA 3GWZA 2CO5A 1BBYA 1P4XA 2MD5A 4R8HA 3SHFA 2BEOA 4G94A 3OOPA 3I59A 1FYKA 5HDKA 2L4MA 2FMYA 1BC7C 4KA4A 5D4SA 4UVCA 4XSXF 5JR3A 2HZTA 3SQNA 3I4PA 1DPRA 2XHKA 2ELHA 2PFBA 1ZG3A 4EJWA 2O0YA 1S29A 4OU0A 5EEGA 2X0LA 1FT9A 4N9HA 1TW2A 3CDHA 4L9VA 2L01A 2KIMA 1RZ4A 2YX7A 4JK1X 4LLLA 5E18F 3JW4A 3ECHA 1FBUA 3HSFA 4HV5A 5FD5A 1KQ9A 1VTNC 3JAMK 2EWNA 4HAMA 1R58A 5ED4A 1Z7UA 1P4AA 3IRQA 2B0LA 2FE3A 3ABUA 4LLGF 2QVOA 3E6MA 3ZMTA 1STZA 3QP5A 1T38A 3SZPA 2P6SA 1LJ9A 1XSVA 2RVCA 5IT9K 3E5UA 1YS7A 3FM3A 5JVTA 4MGRA 2IT0A 3BPVA 4ZZDA 3LA2A 3HUGA 3SZTA 3P9IA 4EM1A 2MA3A 2PI0A 3FZVA 2ZFWA 1T39A 3E97A 2ZBKA 1UHWA 1R00A 3HRMA 1MDMB 4KN4X 3CUOA 1T98A 1A04A 2R3SA 2M87A 2JPCA 2JZYA 1S7AA 2PMHA 1ZH5A 2L3DA 1TTYA 3LWFA 3P7NA 5LHGA 2OQRA 2F5DA 3RIRA 1XGMA 2BE5F 3LSTA 1KU3A 2XV4S 1FWZA 4A0YA 1ZLKA 2YX4A 2FF4A 5K5OA 3J81K 4U7DA 3J80K 3MWMA 2M30A 3FM5A 4M6XA 3MZHA 3J7AO 2PQ8A 1CF7A 3Q9VA 1C0WA 2A68F 2FEZA 2DLLA 5HLGA 2XRNA 2E1NA 2H09A 4ZYDA 3M1EA 1I6XA 3NQOA 5FB2A 3E3VA 4OIPF 4GYIA 2DTRA 1R1TA 1RI7A 4BH9A 2CSOA 1WKMA 5E1WA 2K27A 1QBJA 5D5XB 4RS8A 3FHZA 2ISYA 4HZFA 2GAUA 4I98B 4F7ZA 2K7LA 1SD4A 3HOTA 3I53A 3IKVA 3KE2A 4L0YB 5L3BA 4YIIA 4HYEA 2QYOA 4HLXA 4NB5A 2DK8A 2JSCA 1DUXC 2P5VA 4OOIA 2HGCA 2Y48A 3GXOA 5DUIA 2K86A 4GYGA 5A2QK 5CLSA 3KETA 2KIFA 3KP4A 4UUVA 2HKXA 2HFHA 2WWYA 4BYYA 2IRFG 4K2EA 4IRHA 4XRFA 1TLHB 1G4DA 1PP7U 1ZLJA 1R7JA 4HX4A 2LNBA 5CYVA 4Z2YA 2NAZA 1YYVA 1U6GA 5LGTA 4GO1A 1LDKB 4G7OF 4ENJA 1TNTA 2ZJ2A 2DW4A 4EJVA 2CGPA 1W7PB 3H3ZA 4L9JA 2GZWA 2QUFA 1G3SA 2XAJA 3R4KA 2L4AA 1MGTA 1LVAA 1Z1DA 4A12A 2RQPA 1FZPB 3CJNA 4NQWA 3L9FA 1SD5A 2XIGA 3M9AA 4A2UA 2GIVA 2Z33A 1U3EM 5BPDA 3WTTC 1R1VA 3QRFF 3SFZA 3N97A 2UXNA 3BPXA 3K69A 4LMYA 3ZMSA 3K0LA 5LLQA 3K1NA 3V7CA 1OYIA 4EGYA 3WTWC 2Q2EA 3L2CA 1S7OA 1I5ZA 1XCBA 4RGRA 2IJLA 5E8IA 2XUBA 2QM3A 5FGMA 4I01A 2HR3A 3GEZA 1SD7A 1B1BA 1D8KA 1LDJA 3V8JA 1IUYA 4G8XA 4MTDA 3PFIA 2A6HF 5BMZA 6PAXA 4I2OA 2H6CA 4I7HA 3R60A 5F64A 2Z5UA 2K4BA 2LF8A 3DXJF 3TOBA 4UVAA 1KU7A 3IRRA 1J5YA 1B4AA 5H6RA 3RPQA 3OV8A 1JE8A 2DPDA 3WG9A 3GZ5A 3O6BB 3QOPA 5LEJA 1GVJA 2FU4A 2XAFA 1FY7A 1G6NA 1YQAA 1W5TA 2KIUA 1J9IA 2GWRA 3E5QA 1F9NA 3M7GA 1HW1A 3REOA 3VB2A 5E8GA 3L00A 3DPLC 4XLPF 1TQMA 5K5QA 2VODA 3LA7A 3HTSB 3BWGA 4FX4A 2ADUA 2P5LC 2WC2A 3K9TA 1QPMA 4D0PA 1MDMA 2DK5A 2NS0A 1YW8A 1ON2A 4AIJA 3MEXA 1XGNA 1J7KA
chains in the Genus database with same CATH superfamily
5F0CA 4J01A 2E5NA 1YJ9I 3BP8A 1TWCJ 2F5EA 3DPUA 5CVIA 3ZCOA 4XKVA 4YIRX 4A69C 1VQ6I 1WJBA 1RNLA 1GXQA 3GUDA 4PZJA 3ROUA 4ZDOA 1R5ID 2BXZA 2HTJA 2OBPA 4HX8A 2VBWA 3F6OA 3VYRB 2VASA 1U9OA 2VOOA 2ZMEA 2PMZN 1LB2A 5IOYA 3SDBA 1T95A 4IVNA 2VBYA 3I0TA 2M3AA 2EFWA 1XD7A 3VODA 3BJAA 3KLOA 1Z7LA 1MJ9A 1S5LC 3ABLH 4E7SA 3LSKA 2IA2A 2C6YA 2DI3A 4XLAA 2DFEA 2EFPA 2XGCA 4LOCA 5B3SH 1OJLA 3S1MJ 3WG7H 2KZVA 2Q8KA 4Z6YA 1P2FA 2JSPA 2CFXA 1Z91A 2IA0A 1OR7A 3K4BA 1FNNA 1SFEA 2Y9YA 2XAUA 2BZTA 2LKSA 2X6OA 3WTVC 3V8LA 4IOAF 4M6VA 2L9SA 2ME0A 1I1GA 1WI3A 5JFRA 4MQ9F 1BOBA 4W97A 4L5EA 1YTYA 1CGPA 3MZYA 1U78A 1IN5A 2VT2A 5IP9J 2V1UA 1IGNA 2A6EF 3OOUA 1ETWA 2LY1A 3JSOA 3PO2J 3FXQA 4IHVA 1IN6A 3QQAA 2K9SA 4CXFA 3BT9A 2NRAC 1D0YA 4D5FA 3ABKH 3BZKA 3S32A 4XOTA 4ESFA 1D1CA 3BG3A 2DCEA 5GPCA 1YIOA 3KEQA 3HOXJ 2VLAA 1VQNI 4IL6C 1I27A 3CCUI 4HPQA 5IT3A 5K7ZA 4ZTJA 3HIFA 4HV6A 4KIFA 4EM0B 3FMRA 2ZJPF 4A3FJ 4L9NA 5J1UA 3BG9A 2FXAA 3G4SI 5HLHA 1HXDA 2VXDA 4U0YA 1OKRA 3GZ6A 3IP4B 3TO9A 2FD5A 4A0XA 3FXUA 2JWTA 1U8RA 2RREA 5E3LA 2PJRA 3CMYA 1X4OA 3Q0VA 5DEQA 3NRVA 1TNSA 1KQ0A 2PN6A 3G3ZA 4KMFA 1JUPA 2CJJA 1L3LA 5F08A 2A3SA 1FOWA 3KP7A 5BPIA 2W1OA 1ZREA 1JUSA 2CW0F 5KVRA 3FKIJ 2LP0A 2LMDA 5J4VA 2CUEA 3CMEI 3ZQFA 3OS2A 3W6KB 2O6GE 3E0JB 3S2WA 1MD0A 1T33A 4NC8A 4ZJZA 3VWBA 1X3WB 4RMNA 1XDUA 1GXPA 1G59A 3ONQA 5H20A 5FFXA 2X1EA 2DJIA 2EH3A 2HQ5A 4OINF 3TDZC 2EK5A 4RGSA 4CGZA 2AXLA 5JVGF 1MMGA 4FE7A 3WTZA 4Y13A 5CPRB 1VQ4I 2JA6J 3Q3SA 1QVUA 2EFOA 3M1CA 2O8XA 3L09A 1W5CC 1W0TA 2CQNA 1J2XA 3WE2A 2A69F 2ZNZA 1NG6A 3IH4A 4KISA 4MTEA 5FRNA 4HSTA 5CJ9A 4M71A 3MKZA 4A93J 5HS8A 2COMA 2ZXJA 5ILUA 1GDTA 1SVLA 2GIZA 2XKOA 4R1HA 3U1KA 4M6YA 4U0WA 1WZ2A 1X2MA 5D4RA 4N4NB 4N9IA 4KIGA 3HKZA 5LD2C 4XORA 1V5EA 2BHZA 2L9VA 1R5GA 4I76A 4AYBA 1V3FA 1W36D 1VQMI 1S8NA 4KFCA 2EFNA 2LVSA 2JUGA 4Y17A 4XKWA 3P5JA 3ERED 1BL0A 2XPUA 3ZGKA 3PQJA 5J8FA 1S6LA 2OQGA 5LRSA 1W7PA 1TQIA 2LR8A 2X4HA 2K5CA 3OYHA 1FPQA 1D5VA 5DCMA 3B6AA 4HF1A 2OC6A 5BOXA 2X6WA 1S7EA 2FNPA 2LLKA 5E1ZB 2EZHA 4OAYA 5D6EA 3MMYB 4EJTA 3G73A 2PG4A 1QU3A 4PK4A 1SC7A 1YLFA 4RB1A 1B72A 3PIPF 4BL0B 2WY7Q 3F8FA 4ZDLA 1R4NB 4LG0A 5ICGA 2PJPA 4GCVA 4MEXF 5HVQC 3OIQA 1IZ1A 3O8HA 4BJTA 1VQLI 2NYXA 1ZG1A 2OCEA 2XPWA 5E3OA 1RR8C 4LK0F 3ZMUA 3CO7C 4S05A 4NHJA 3K2ZA 1SEUA 4PJ0C 3BTCA 2V7FA 5EEHA 3ZP5A 1E3PA 3ISPA 3I58A 5HDGA 3AFHA 1K6OA 2NVUB 3U9GA 2CV2A 2K4JA 3LSMA 2EINH 1OFCX 2BYVE 3HHGA 1ETXA 2WTEA 3CF5F 3DBHB 4CUGA 3UNGC 1ZR2A 4OMZA 1BJZA 2L9RA 3HKZN 1I3AA 1RKTA 1V4RA 3FXJA 3MKLA 1LDDA 4EM2A 3QPHA 2HVRA 1V5GA 1NH3A 4AYBN 4LITA 3EUAA 3LNQA 9ANTA 1HW5A 4X0GA 4XOPA 5LFAA 3KZZA 2L0KA 3WODF 2DXIA 5AIQA 4CO8A 3K1PA 3EYYA 1HW2A 1U5TA 1N78A 3FBIB 3T8TA 1Y8QB 3MKYB 2I8DA 4XBFA 3WGIA 3A03A 3QPLA 2H8RA 1ZGAA 3ZQIA 1IDYA 4AC0A 4I6ZA 3S1QJ 3B73A 1HQCA 2K40A 2Y31A 4I0BA 4A5MA 3CUQC 3HPGA 3R0JA 2ECBA 5KK1A 3E7LA 2AS5F 1ONVA 2P4WA 4E6KG 4QLCU 1YX5A 1NK2P 1DPUA 1E17A 3PUFA 2VBZA 2QF7A 3ZPLA 2KJCA 1BJAA 1TL8A 2HWVA 2OAZA 2GXGA 5K1YA 5HDNA 3DQVC 3JRBA 2VE9A 4IRIA 1JTYA 3TP3A 3G2BA 3MQ0A 1XTAA 4Y52J 2BW3B 1IRGA 1F36A 2O03A 2DMPA 1I50J 3NWSA 1DP7P 3VSKA 3K4JA 1F5TA 1FYMA 2WV0A 2GOMA 5IOZA 4DW6A 1Q1HA 2VKEA 2F4MB 5JI6A 4PJMA 4XKBA 1H8AC 4B43A 5DS9A 3TBIA 3DPTA 3HBLA 4P9FA 3TW7A 3A02A 2Z3YA 4U7BA 3CCYA 3CTAA 1F1ZA 3WU0A 1NK3P 1FOKA 3ML6A 1VI0A 1P6RA 2FOWA 4WCGA 4Q5SF 2DFIA 1QGPA 2ELKA 3RDIA 1XMKA 4ESBA 4IJAA 1SFUA 2KDZA 3RZOJ 3ABMH 2OJED 2HQAA 3I59B 2XB0X 2H27A 3BTIA 4L9TA 2LD5A 2VJ5A 4U0VA 4HNUA 2E5ZA 2G7HA 3MVPA 5AIPA 4DIQA 1VQKI 3EYIA 3MZ8A 2AHQA 2KRCA 2R92J 4XLHA 2IP2A 3FXLA 4LB6B 2ACJA 1TWGJ 2VKVA 3K4CA 2DO7A 3G6EI 3RSNA 1B6AA 1OLTA 2MD0A 5FLXZ 5LHHA 4I0AA 1WPKA 4LD5A 2BGCA 4PDKA 3PFYA 2DA5A 2XF7A 1LFPA 2CW7A 2NS8A 3WU1B 2HDDA 1DGWY 3VYSB 3A01B 2RKHA 2HXIA 4BXUA 2LRDA 2QLZA 2X51A 3OYBA 3PM1A 3HRTA 3JTGA 1O7FA 4ASNA 2HS5A 1RIOH 1G3TA 3TQNA 1TC3C 1K4TA 1TWAJ 1O3QA 1YFHA 4KICA 2EJRA 2M9HA 3PL8A 3FK6A 3E6BA 4HEA2 2EV0A 3JRAA 1UHSA 3L2VA 4X6AJ 2R93J 1OCRH 2M1BA 5LEKA 1KU2A 1JXSA 1LEAA 2HOAA 3HGYA 2HDCA 1HKSA 2QQ9A 2A07F 2HKOA 4G6DA 5FO5A 1D1BA 3BTJA 5K5RA 4Y7NJ 5J40A 4BBSJ 4HSRA 2OA4A 4IRGA 3BQYA 3GMEA 3RKWA 5DDGA 1BW5A 1BN5A 4ITVA 2W4SA 3KIOA 1XG1A 4BBRJ 1P92A 2CG4A 2R7FA 4G7HF 3CDIA 3CUQB 1H0MA 4D5CA 4OWRB 4BE0A 2Z16A 2OZ6A 3D5LA 2K9NA 1S9HA 3HL2A 4C3JJ 3A0HC 2E7XA 3TDUC 2K3FA 4ZC3A 3PJRA 5FFZA 3KP5A 3HOSA 4B47A 1KA8A 2CUJA 3JRGA 3K6GA 3S1NJ 3GW2A 4MFDA 3FISA 2K02A 5F1RA 4M74A 1FOXA 3DU5A 4PGHA 2FNAA 2VKHA 3CP2A 3CDLA 2ETHA 4BXFA 1ZR4A 1KYZA 1QZYA 3Q9SA 1YOVB 1GV5A 1PYVA 1ZELA 2JPBA 3OWTA 1R6RA 5HLIA 4GXOA 2YR2A 3SXYA 5TRDA 1XC5A 4V2FA 4BY7J 2JA7J 4IO9F 3HJEA 1CQTA 1O3TA 3ZXSA 4FHTA 4OIOF 4CCMA 2ZCWA 1YRNB 1IXCA 1K78B 2KQRA 2LG4A 4B48A 2CQQA 2FQ3A 3QU6A 4BXXJ 1ZK8A 1WJEA 2XVCA 1FP2A 3OYGA 1DU6A 1MSFC 2V9VA 2VBXA 1FP1D 3I9V2 2WAQA 1UMQA 2E7WA 2G0EA 2D5VA 1Y56A 4BE2A 1Y8RB 2FBIA 2GA1A 2DODA 2WY8Q 3L2RA 2ZFUA 1UG0A 1ZTRA 3PSIA 1IW7F 1UFMA 1JT0A 3RJPA 3PO3J 2XGEA 2A61A 1TQPA 1X1AA 2ZB9A 1YW7A 4KN7X 3J7ZI 2LY9A 3WTSC 4GDFA 2IAIA 2W85A 1FC3A 2ZC2A 1PDNC 2HOTA 3JTHA 1HKTA 4E7HA 2IS4A 1K6YA 2K85A 1LFUP 2K9QA 2XAHA 3EUHC 2LKPA 4I09A 5IP6A 3G1LA 1MMSA 3N05A 1AKHA 1LEBA 1XDSA 4RAGA 3R6SA 4L0ZB 4JQFA 2LF7A 3RYRA 2GA2A 1LQ1A 2OD5A 2IBDA 1K7AA 3E6DA 1AU7A 4EMSA 1SD6A 1I3QJ 4CZCA 1BIAA 2QCOA 2E36A 1HDPA 1E2XA 1FJLA 2XROA 1R49A 4G12A 4GGGA 4E7LA 2KMUA 3MCZA 1MBGA 2J5OA 4CYDA 1OCZH 2HU9A 2UUZA 5L3GA 2FBKA 1QZEA 1WI9A 4HDVA 1MBHA 2EZLA 3OYAA 3T5XA 4PGGA 4XLCA 5F27A 1A31A 1IRFA 4AIKA 1DQUA 1GLNA 1LE8B 3CZ6A 3UKGA 5C3EJ 4BY1J 1DDNA 2M8GX 5ICFA 1BI1A 3D1NI 4QSHA 3FWEA 3FXKA 2HYGD 3QOEA 3J7YJ 4HNVA 2LC2A 3LSIA 3FMSA 1ZRDA 5J3LA 1VNDA 3QYBA 4NNJA 4QWQA 3CLQA 2EIJH 3KZYA 4KYWA 2FOKA 3LOCA 1X2NA 1X58A 2XDVA 5GTHC 3GF2A 2YU3A 1U2WA 3FBNB 1ODDA 2E1OA 1Y1VJ 2R7SA 2H94A 3K1MA 2X1DA 1R23A 1ZAOA 4MHGA 2M5WA 4Q48A 2IA1A 2HPMA 1MSEC 2WAQN 3OSFA 3V7RA 1UAAA 2W82A 5KNLA 4LIVA 1EKEA 4KIBA 4CZZA 1B9MA 2KZGA 1BI0A 1JT6A 2RNGA 3ZMDA 1MJBA 4DYCA 1YHQI 2Y0MA 4D7NA 5F1JA 2HOEA 5D5WB 1ETQA 4WK8F 3GVAA 2V6CA 2VJJA 1YITI 1FIAA 1IO2A 2DT7B 3QYEA 1L0OC 1BA5A 3IHUA 4WWCA 1MMAA 5DM6F 1FX7A 3F8CA 3F23A 3C18A 2CS3A 1TWHJ 3BG7A 4EJOA 4ENNA 4R79A 2XF5A 3HHHA 5L3EA 4CYCA 1MJAA 1PUFB 1XSXA 1D8JA 2D2WA 3VOEA 3F22A 1WJCA 2M8EA 4XLNF 2QBYB 3OYCA 3JRCA 3C7JA 4IEJA 1JKPC 1IRXA 4F52A 3T0YA 2JA8J 5DUKA 4KT5C 5J1YA 1I1SA 2F4OB 1TW3A 3TGNA 2QGUA 5D5VB 4MIMA 5DCFA 2HYFA 3TEDA 3FXOA 3HDDA 3KPHA 3S2DJ 3BZ6A 2O8KA 5LGUA 4FX0A 3IL2A 2WAEA 5FKOA 2UZKA 2W57A 3RTRA 3G1MA 2DTZA 4P96A 1IAWA 5DYMA 4RLQA 5H6QA 3GFIA 3ASOH 2HQRA 4PSWA 1BOAA 2OPTA 3L2WA 2FJ1A 3V7SA 4ETSA 4UB8C 3LFKA 2Z9OA 4P5OA 3PNYA 1QQIA 2B7EA 2X1CA 5FKKA 2MC4A 2GXBA 3ZQ7A 2DQRA 1WWXA 2DT6A 2ESHA 3EDPA 1DU0A 4HX7A 3CO6C 2R4GA 2VONA 4IPAA 1T2KA 3LQRA 4A3JJ 1VFCA 1TWFJ 3P9CA 2Y2ZA 4I99C 2RC4A 2Q0OA 2WAFA 3K2AA 5CQGA 2XSDC 4IF4A 3LL7A 2G9WA 2LBFB 1ZRFA 2ZKZA 1LPQA 4BU2A 5GTIC 3IC7A 3SEQA 4XRSA 2QQAA 2V1XA 5BS6A 1UJ8A 4UUSA 1YW9A 1MW7A 3JRDA 4FASD 3I56I 3BR6A 2TRTA 4AUXA 3L7WA 2D45A 3DKYA 1AHDP 5DTDA 1XMAA 3Q5FA 4EJUA 4NQWB 2L9NA 5F0HA 1RPWA 2L7ZA 3BJ6A 2X6XA 4HA8A 2EFQA 3ZMZA 5L3CA 3LSPA 1W1WE 4RB2C 2P7VB 1Y0UA 3VYUB 1U8BA 2FRHA 2N8GA 1FBQA 2JN6A 4A6DA 4S04A 2E19A 1ZG5A 1HOMA 3ECOA 1W4MA 3F8BA 3I64A 3U2RA 2KJBA 4BE1A 1T0FC 3O3KA 1R4MB 4BACA 4H0EA 2A5WA 1SMTA 4LLNA 2CQ7A 3BC8A 2VL8A 2PBIA 2EB7A 4G7ZF 3WTUC 1Z21A 4RGXA 1GV2A 1AWCA 3M4OJ 2FSWA 3HYIA 3TKYA 3DWLE 1W5SA 3K4LA 3QWLA 3RYPA 2QWWA 1P7JA 2X6YA 3CQZJ 1ACIA 4NDLA 2STWA 2FA5A 3U1DA 4AVZA 2Q2EB 3DBLB 3MAJA 1LVKA 1IUFA 2P8TA 3C2HA 3OL3A 2E35A 4MNUA 3GTLJ 1O4XA 2L02A 3I3LA 5ICEA 1FYLA 2X48A 4RM2A 4A5NA 3ZQHA 3OSGA 2NOJB 1JKRC 4UV8A 1G3WA 5EF6A 1JI8A 1IN7A 3LMMA 1JKQC 3GO5A 4NC6A 2BXYA 2DOEA 1K79A 3KYDB 1UZCA 3VFZA 3A01A 5B5EC 3WHBA 1N25A 2DAOA 1FSHA 2VPLA 1SFKA 2I5UA 3T1BA 1Z0XA 3V4GA 4Q4ZF 1Z05A 4XNFA 3GFLA 3KP2A 2JVHA 4ZZLA 1G2HA 2ZMEC 2R5ZB 1USTA 3K7AJ 3DP7A 5GP9A 2E1MC 2F48A 5KAIC 2BBYA 2LREA 2TDXA 2YSRA 4UHTA 2QSHX 1VQ9I 3BY6A 3DV8A 1QO0D 2EA4A 2R0QC 1H89C 5EZHA 2XKPA 1ENHA 2NNYA 3BG5A 2DU9A 2L2OA 3CJTB 5GPAA 1AOYA 5L3DA 1WHUA 5CVUA 2LYCA 3H0DA 3PUBA 5DD4A 1ULYA 2WBMA 1PP8F 1UELB 5EGOA 5C4XJ 3DLLF 5EG0B 3MD2A 4AWXB 1USSA 5LHIA 4RAZA 2R7UA 2XSJC 1KQ8A 2QZ8A 5ERIA 3WTYC 1O3SA 4OMYA 5EDNA 4A3DJ 3V8KA 1EH7A 3CUQA 2VUMJ 3JAMZ 3RKXA 4YFNF 3HOZJ 2YPRA 3A2KA 1IDZA 1YG2A 4YFKF 1TT5B 2ZSIB 1V54H 4BHCA 4MLOA 5C44J 4PSXA 3GX4X 2JA2A 3HOWJ 4WXDA 3W2WA 4M9ZA 2BHYA 2DQLA 2KP6A 2HZDA 1HSTA 1H9TA 1BIBA 4G6QA 4ON0A 2MGQA 1T6SA 5FJ8J 3S3MA 2CV0A 4BNCA 5E20A 2OU2A 4CHUA 1GT0C 4M73A 3RQIA 2KRFA 4UY8I 1EH6A 2V79A 3GLXA 1MZBA 2W24A 4PJJA 1M1EB 2OF7A 5IT9Z 3G1OA 3P9KA 3S17J 2M0CA 3FKJA 4BQAA 3SYTA 5ILVA 3ZQGA 3OYKA 3TO7A 2EV6A 3H3UA 2H6BA 5L3FA 4L5IA 1BC8C 1YIJI 2STTA 3RPUD 3E6CC 3Q0UA 2R7ZJ 1QZZA 4BAYA 3OYNA 2QKLB 3BCBA 4RGUA 4XMYA 4HQEA 1K78A 2YU9J 3W2AA 2VC0A 3H3VK 2MH9A 2KIQA 1X3UA 4B3XA 4B44A 3JRFA 3HG9A 1RETA 3O2PE 3ZN0A 4EQQA 4EV0A 1OMIA 1ZGWA 1FTTA 1IN8A 1BR2A 1TT0A 2JMWA 2E2HJ 2QSGX 4N4OB 5E17F 1YE9A 2ZO4A 2F2EA 2NNNA 2EZKA 3LFUA 1VQ7I 1VQOI 2CFOA 1XMXA 4MFEA 1D3YA 1RUNA 2EA2A 4ANJA 3KCCA 1XSDA 2AO9A 4BEHB 5CVVA 1JJ6C 1UHMA 1SAUA 3B6CA 3SZGA 2QENA 4JBAA 3TW6A 3IUOA 2NOGA 1O57A 2D1VA 4PFOA 5DD8A 2V9PA 4QIWN 3ULQB 2PX9A 4P55A 1XB4A 5GADJ 1I6HJ 2DYRH 4MEYF 3EETA 4C3IJ 1SMYF 3ZR8X 2ZMEB 5ILSA 2P6TA 3C1DA 3CC7I 2NVYJ 2E1MB 2J5PA 2O61A 3ZMVA 3B02A 3W6JB 2DBBA 3KP3A 4L18B 2RGVA 3H36A 4WXHA 3RKYA 4D1QA 2EV5A 3HM5A 2CW8A 3PQKA 1O7LA 2UV1A 5J4YA 1FTZA 4XK4A 5E1XA 2RQQA 1SAXA 1Y0NA 1GHCA 4UXNA 4DNCA 3M8EA 1XN7A 1KU9A 3J81Z 3S1RJ 1EA3A 2LTPA 4PFPA 3AG4H 4F55A 3J80Z 3KEYA 1IC8A 3IAS2 4ZDPA 1GUUA 1F4KA 3HSRA 5EJCA 5J47A 3LSHA 1O3RA 4Y3OA 2JRTA 2BV6A 4BHPA 1ZYRF 1IN4A 2BY3A 4XR6A 1WSUA 1G8XA 2CRGA 4RB3C 4CCOA 2VJ4A 3W3CA 3D5SC 3RI4A 3BR0A 4PUSA 3H35A 1ZN2A 3F21A 1LFBA 2Y0SA 1R5HA 1OYWA 4B8XA 2O9LA 2F6CA 2MG4A 2IPQX 1N75A 1VZ0A 1LNWA 3CCLI 5ICCA 2LDUA 1VQ5I 2KRHA 3GYHX 1X3ZB 1J09A 2W00A 3I71A 4QPOA 1ON1A 5HS7A 2IGOA 3BTLA 1OQYA 5FLXK 2VQGA 1EF4A 1ZRCA 3OYJA 1KGSA 3ASNH 4HG2A 3FXRA 1WVRA 1YO5C 3I4NJ 1WRJA 2PJRB 3FMQA 4UNOA 2V1DA 4JP0A 3ZN1A 4HNTA 3L2UA 3F0CA 1MNMC 2KLOA 1HBXG 4ESJA 2F4IA 4LGWA 1JTXA 2NVQJ 3HRSA 4B09A 4HF0A 2OZUA 4RAFA 2CYYA 2P0WA 3F8MA 4U88A 3MFKA 1NHAA 2V1NA 3ZQCA 2MBFA 2HQNA 2M45A 3F72A 4RB0A 4HDUA 1PUFA 3DFGA 4XIDA 4A3LJ 2QBYA 3JRIA 2RAEA 4P9UA 4IHWA 3S15J 1B9NA 4GFBA 3F3XA 1OCCH 3S93A 2P5KA 2FBHA 3WU2C 4KDPA 5EZGA 2DOFA 3K70C 4U87A 1A6IA 1U5TC 1WH5A 5A2QZ 2KISA 4KUMA 2R7DA 2JT1A 4O5VA 3DCFA 3CCMI 2IS1A 3EUHA 1MIJA 2G7UA 3LSJA 1KYWA 3IKTA 3LAJA 2IGKA 1P4WA 1SANA 4HW0A 2FQ4A 2CUFA 3VEPA 1YJWI 4HF2A 4KT6A 1TZLA 2PMUA 4E7IA 2GBYA 2CQKA 2Z2SB 3NEUA 3JREA 2Y0SN 4ZYEA 3PNTA 5CVJA 3CMMA 3V42A 5J8CA 4H4KC 3QU3A 4C30A 1PUEE 3EPZA 2E2JJ 1HKQA 1U0JA 3FXMA 3OYMA 4PCQA 4FT8A 3AL0C 1ETVA 2ZSHB 5E3MA 2DYSH 1QRYA 3C3WA 4RAYA 3H92A 3IWFA 3R61A 5E79C 4M9XA 4IHYA 2XB5A 1Z77A 3RCOA 4KMUX 2EBIA 5DCMB 2CU7A 2EILH 4FETA 3TOAA 2GQQA 3FX3A 1YS6A 4RA2A 2LBFA 5KHDA 4KITB 2CMPA 1J75A 2W84A 3HUGB 1MBFA 3H9QA 2HEOA 3LA3A 1WQ2A 2MFZA 4YFXF 2VIXA 2VT3A 1XCVA 3DEUA 4IXAA 4QPQA 1X19A 3HSEA 4DBQA 4LG0B 3HRUA 1WJAA 3O8GA 3CF2A 3CESA 4MO7A 2VXZA 2XAQA 5HNHA 2P7CB 1WGXA 3QAHA 5LBQA 3AAFA 1QHHD 2DT5A 2O5RA 2W25A 1EH8A 2O3FA 5HS9A 3QP6A 1W7PD 5K7FA 3R0AA 5F0FA 1K4SA 1NTCA 3ZRGA 4C2TA 3WGHA 2JVGA 1R1UA 2X9DA 1ORKA 3OYFA 5IY5H 1ZGJA 3H1CA 3H5RA 1X1BA 1BI3A 4WF2A 3QPSA 4HQMA 3TO6A 1R22A 5BNGA 2IVMA 3COAC 4JOMA 3I55I 2MH2A 2Y75A 2JK3A 4M3GA 4TV7A 5D8LB 4Y15A 4B4CA 2HTSA 4XL9A 1IXRC 3S8PA 2JTVA 2HVSA 4IHSA 4ENMA 3M8FA 3BJOA 2LOOA 2R7OA 1AA7A 3OS0A 3GTPJ 3VDXA 3WGGA 4BUPA 4BGDA 2JJ7A 5CQEA 1A5JA 1SVOA 4DYRA 2W48A 3ESWB 3MKWB 4ABZA 3W6VA 1YX3A 2RDPA 4ZYGA 2F5FA 5TISC 4OIQF 1LUJB 3JSPA 1XGOA 2ID3A 3DKXA 3D0SA 3GTJJ 1JHFA 4EEFG 4V19K 2CQXA 1OCPA 2UXXA 1U5TB 3WE3A 3DKWA 3OIOA 1FLIA 4YIFA 2M34A 2AQEA 2F5CA 3LAPA 5JLXA 1CF7B 2E2IJ 4ZH4F 2OTJI 1Y1WJ 4WX9A 1X4PA 3H9GA 1IG7A 2DDBA 3IWZA 1OYYA 3KLNA 1POGA 2CWEA 4HRIA 1IXSB 4NBQA 4IQJA 4FISA 3CLOA 5B1BH 4HOBA 2RNJA 5CVRA 1FSEA 2EQRA 2ICWG 4DJAA 1MKMA 2CUZA 4X1EA 4A6EA 3BDDA 1R71A 5J6XA 5EG0A 3AL0B 1MMNA 3BROA 2GM4A 1Z6TA 3FF5A 4O6JA 2D1HA 4IQ4A 2BY1A 3K70D 3I5UA 1JGSA 5TGTA 4CDGA 1R36A 5D6FA 5LRRA 4BJ6C 4RBOA 2K9MA 2QEXI 4A3CJ 4EVIA 1TP4A 3ELKA 4LK1F 4CICA 1KZHA 4WXCA 1HCRA 4A0ZA 2XGDA 2ISZA 3BR3A 3RPUA 3KEOA 1B8IB 2MYSA 2Z99A 1BW6A 2DPUA 4L5JA 3A1YA 4YG2F 4XSZF 3N4MA 2CV1A 2QQ8A 2VN2A 3A0BC 2ECCA 2IXSA 3LQQA 4KNYA 1J59A 4DQ2A 2XAGA 3C2BA 5BQTA 2MLGA 3OYIA 3GLLA 4AD9A 1BM9A 4E4HA 4BHBA 1E3HA 1XGSA 3LSGA 3GFJA 4ZYHA 3H0GJ 2PEXA 4Q47A 2DFFA 5TJJA 3T8RA 2RV8A 1OPCA 4ENKA 4ZTFA 1H9GA 3VSLA 2HI3A 3WTXC 3QPTA 2DDAA 2WB1A 1W0UA 2R7WA 3WHCA 4PJLA 4CSWA 1T0FA 3DF8A 2LSOA 2M4GA 2XGXA 1IF1A 2ELJA 4G9YA 4LJZF 2PLYA 4IOCF 1FBSA 4II3A 2DA2A 3DLAA 3KFWX 3S3NA 1Z6RA 1HSJA 4G6TB 4N0BA 1DP3A 5AONA 1YI2I 2ESNA 5FLMJ 1D0XA 2W7NA 2LY2A 5HOOA 5D5UB 4DZJA 1GVDA 1E3OC 2KKOA 4CH7A 3FK7A 1H88C 2XPVA 4D9JA 4D7MA 1BI2A 4EGZA 1RUOA 1S3JA 3GFMA 1HA8A 4BEHA 1ZQ3P 4CCJA 2FMLA 4W1UA 3LSRA 1EJ9A 5HNFA 4E70A 2L7KA 2R7RA 5DV5A 1QPIA 1HF0A 3I54A 4M3DA 2F5VA 1OCOH 3K4KA 3EQLF 4UVBA 2M4KA 4LB5A 5F6FA 1ETKA 3S3OA 2MLKA 4XLFA 1MNDA 2K3PA 1ITYA 2NVXJ 3F8NA 5EEAA 2L54A 4BDYA 3H5NA 1ZHFA 1SVMA 4IHTA 5F04A 1UB9A 2QQBA 4LFUA 2KPMA 1ZARA 4HBLA 4AVPA 2EPFA 3E5XA 5JHUA 2R7QA 5LGNA 1REPC 2VE8A 2R7VA 1B59A 3GTOJ 2VC1A 3ABTA 5D8KB 3CCRI 4AIDA 3F6VA 4JX6A 3KP6A 2ZNYA 2RN7A 3RKQA 2XASA 4F91B 4XM3A 5FD6A 4YELA 1Z9CA 3BOQA 2A5YB 5J1RA 3OYEA 2LKXA 1IRZA 1EV7A 3HTUA 4DZPA 2BW3A 4IKFA 1IV8A 3KYLA 1UCRA 4UV9A 1JHHA 4OIRF 1BR1A 1T8IA 3GTMJ 1J0RA 4M72A 3SFIA 3HOVJ 3OYDA 1QNTA 1RC9A 1SFXA 1Z3YA 2MC3A 4FTHA 2E1CA 4M9SA 2WB1N 4I02A 3VPRA 4O3MA 4AIHA 2UWMA 1TBXA 2ZXWH 2IW5A 2VQCA 1WFXA 4HLYA 3S16J 2VOPA 3BQZA 1G3YA 4MQVA 3GWZA 2CO5A 1BBYA 1P4XA 2MD5A 4R8HA 2DA4A 3SHFA 2BEOA 4G94A 3OOPA 3CCVI 3PIOF 1V5FA 3I59A 1FYKA 2IS2A 2LK2A 5HDKA 2L4MA 5KCMA 2FMYA 1BC7C 1X1DA 4KA4A 3FIWA 5IYCJ 5D4SA 1A35A 4UVCA 3M3YJ 4XSXF 3Q0WA 5JR3A 1RKWA 2I10A 2HZTA 3SQNA 1NG7A 2ZJQF 3I4PA 1DPRA 3GCMA 2H1LA 2XHKA 3BCAA 2ELHA 2DMTA 2PFBA 1ZG3A 2DMNA 4FCYA 3FHNA 3OMYA 4FQGA 1IJWC 1WJFA 4EJWA 2O0YA 3OR2C 2V26A 2M2EA 2FX0A 1S29A 3F9KA 4OU0A 5EEGA 2VQLA 2X0LA 1AKHB 2A05A 1FMVA 1FT9A 3CC4I 2XC7A 3ERMA 4N9HA 1S72I 5B1AH 5FLVA 1TW2A 4ZYAA 3CDHA 4M3BA 4IZZA 4L9VA 5IPAA 2L01A 3BLYA 2KIMA 1RZ4A 2A6TA 2YX7A 4JK1X 2DJNA 4LLLA 1RRJA 3DTIA 5E18F 1OR7C 3QODA 1ETYA 2DFHA 5GAHJ 4V2GA 3JCUC 2ID6A 3JW4A 1MH3A 3RQ4A 3ECHA 1FBUA 1WJDA 3HSFA 2COBA 3SJMA 2KT0A 4HV5A 5FD5A 3I4MJ 1KQ9A 4XONA 1VTNC 2JA5J 3BG6A 2EWNA 3JAMK 3AG3H 1KONA 4HAMA 1R58A 2DA3A 4RLFA 3PNVA 2R5YB 5ED4A 2NVTJ 1Z7UA 2VKDA 1P4AA 3HB9A 3IRQA 4NC7A 2B0LA 2FE3A 4JX4A 3ABUA 1RESA 2VPRA 1PVEA 4LLGF 2QVOA 4NUBA 3E6MA 3ZMTA 1STZA 2QKMB 3BR1A 3QP5A 1T38A 3L2QA 3SZPA 2P6SA 2IS6A 1LJ9A 1XSVA 1Z67A 2LH9A 2RVCA 1D1AA 5IT9K 3E5UA 1YS7A 2HPIA 5C4JJ 3FM3A 5JVTA 2DA1A 4MGRA 2IT0A 1UG2A 3CD6I 2DMUA 3BPVA 3CJRB 3U21A 4ZZDA 3LA2A 3HUGA 3SZTA 3P9IA 4EM1A 2MA3A 2PI0A 1FOYA 1ZKGA 3FZVA 2WV1A 3SEZA 4CA0A 3HEFA 5EYRA 1HLVA 3K4NA 1WCMJ 3CCEI 1HDDC 2ZFWA 2L7FP 1T39A 1SFOJ 3KYCB 3E97A 2ZBKA 1UHWA 1R00A 3HRMA 3OR1C 1YRNA 2FUG2 2Y69H 1MMDA 3A4CA 3S14J 4XICA 4BDZA 1MDMB 2NXNB 4KN4X 3CUOA 1T98A 1A04A 3X2QH 2JUCA 4QTRA 2R3SA 1ETOA 2M87A 2JPCA 4JYKA 2B63J 1WJ5A 5M3MJ 5HLTA 4CYCB 2JZYA 4PJNA 1P9QC 1S7AA 2HNHA 1XPXA 3TL4X 2PMHA 1ZH5A 3CC2I 2AXTC 3BR2A 5JLWA 1BR4A 4OAZA 2L3DA 1TTYA 3LWFA 3P7NA 2GXAA 5LHGA 2OQRA 3OIPA 3NARA 2F5DA 2DA6A 5K7HA 4RDUA 3KX2A 3QYFA 3RIRA 1XGMA 1Y6IA 1A36A 2BE5F 3LSTA 1KU3A 2XV4S 4BS9A 5H2FC 2XRLA 2Q1ZB 5IYBJ 5FKNA 2BY0A 2CH0A 1FWZA 4A0YA 1ZLKA 2YX4A 2FF4A 5K5OA 4XN3A 2R7TA 3J81K 4U7DA 3J80K 3MWMA 2EIKH 1Y39A 2M30A 4Y4RA 3K4MA 3S2HJ 1K61A 4E7KA 3FM5A 4M6XA 3MZHA 5GAEJ 3J7AO 2YS9A 1FIPA 2PQ8A 1CF7A 4EATA 4C2MJ 4C3HJ 3Q9VA 1C0WA 2K9LA 2A68F 3DBRB 1LE8A 2L5QA 1JKOC 1MBJA 2FEZA 2H8WA 4E7ZA 2KFDA 1PJRA 4F92B 2BVLA 3JRHA 5FRMA 2IGMA 2DLLA 5HLGA 4DBRA 2XRNA 2E1NA 2H09A 3EUKL 4ZYDA 3M1EA 1I6XA 2V4JC 3NQOA 5FB2A 3E3VA 4OIPF 4GYIA 1ERDA 2DTRA 1E0EA 1R1TA 1RI7A 4BH9A 4IHXA 2CSOA 4UUSB 4Y33A 5KAFC 2JQ7A 1WKMA 4IX7A 4C9YA 5E1WA 2EIMH 3DEWA 3PSFA 2E34A 2AQFA 2K27A 2B9SA 1QBJA 5D5XB 3ZOBA 4RS8A 4CCLA 2OTLI 3FHZA 4M3EA 2HYJA 2ISYA 3BZCA 4A3GJ 4HZFA 2GAUA 4I98B 4F7ZA 3HOUJ 4KJZA 2K7LA 1QVTA 1SD4A 3HOTA 3I53A 3IKVA 1B8IA 3KE2A 3G71I 4L0YB 5L3BA 5HODA 4YIIA 4HYEA 1F43A 2QYOA 2BOLA 1QHGA 4HLXA 2Y30A 4NB5A 3E1SA 2DK8A 4BQQA 1MNEA 3CMAI 2JSCA 2IEKA 1DUXC 1T56A 3OL4A 4XLEA 2DA7A 2P5VA 3HXLA 1X1PA 4OOIA 4A3MJ 2HGCA 2Y48A 3GTQJ 4UUTA 1APLC 3GXOA 4B3AA 3VYTB 5DUIA 2K86A 4BKXA 4GYGA 3ZQQA 5A2QK 5CLSA 3KETA 1JUMA 2KIFA 3MN2A 3W2VA 3KP4A 4UUVA 2HKXA 2HFHA 5M3FJ 2WWYA 1Z3XA 5E3NA 4BYYA 3AG2H 4J00A 2IRFG 3UR3C 1MBEA 1RR7A 4LIUA 1FEXA 4F93B 3IH2A 4K2EA 4XRSG 5M5WJ 4IRHA 4LG3A 3ZQLA 1D5YA 4XRFA 4YEJA 1TLHB 1G4DA 1PP7U 1ZLJA 2MSYA 1R7JA 4HX4A 2LNBA 5CYVA 4Z2YA 2NAZA 1YYVA 1U6GA 5LGTA 4GO1A 1T08B 1JJ8C 5IYDJ 3J7AY 1LDKB 4G7OF 5IP7J 4A3BJ 3NAUA 4UB6C 4ENJA 5EGOB 1K83J 2OUMA 1TNTA 2V6EA 2ZJ2A 2DW4A 2BVMA 2E60A 4EJVA 2CGPA 3D5RC 4JX5A 4J19A 1W7PB 3H3ZA 4L9JA 2GZWA 3HOYJ 2QSFX 2QUFA 1G3SA 2XAJA 3AKZA 3R4KA 5M5XJ 4F3QA 2OCCH 2KL4A 2L4AA 2Z1DA 1MGTA 1LVAA 1Z1DA 2M0MA 2BY2A 4CCKA 3C2GA 4XQFA 4A12A 2RQPA 1B72B 1FZPB 4CCNA 2ZJRF 3GTGJ 3DTEA 3CJNA 2DN0A 5DM7F 4RM3A 4NQWA 3CCJI 5FKLA 1N77A 3L9FA 4DYQA 2KDOA 1SD5A 2XIGA 1MH4A 3M9AA 2EZIA 2Y9ZA 4A2UA 3KZIC 2GIVA 1X1CA 4YRVA 4A3KJ 1A6QA 2Z33A 1D0ZA 1U3EM 1JGGA 5BPDA 2HVQA 3WTTC 3OS1A 1R1VA 3QRFF 5FROA 3SDGA 3SFZA 3N97A 4P1WA 3CJQB 3IAM2 3M8JA 2O7OA 2UXNA 3BPXA 1U9NA 2WA0A 3FDYA 3K69A 3IH3A 4LMYA 3TMOA 3TP0A 3ZMSA 1HC8A 3K0LA 2QA4I 5LLQA 3K1NA 3V7CA 1OYIA 3M07A 1WH7A 4EGYA 1XX5A 4XKCA 1VQPI 5CKTA 3WTWC 2Q2EA 3L2CA 1S7OA 4BQNA 2GLOA 1R9TJ 1FMWA 4S0HB 1I5ZA 2X85A 1XCBA 2MABA 2IJLA 4RGRA 5E8IA 2XUBA 2QM3A 5FGMA 5M5YJ 2OV7A 1VQ8I 2R7XA 4I01A 2HR3A 3GEZA 1XS9A 3H9JA 1SD7A 1B1BA 1D8KA 3H5AA 1LDJA 3OYLA 2E71A 3V8JA 2R5ZA 4BJ5C 4A3EJ 1IUYA 4G8XA 4MTDA 1QA6A 3DEEA 2WADA 3PFIA 2A6HF 5BMZA 6PAXA 4I2OA 2VQHA 4DGWB 2H6CA 4I7HA 3R60A 4M3FA 5JHFA 5F64A 2Z5UA 2YUSA 2ZXIA 2K4BA 2JRMA 3GTKJ 1VF9A 2LF8A 1P7IA 1DGRM 3DXJF 3TOBA 4UVAA 1KU7A 1LKXA 3IRRA 1J5YA 2KHMA 3AG1H 1B4AA 5H6RA 3RPQA 4AM3A 3OV8A 1JE8A 3HC7A 2DPDA 2R5YA 2NS7A 2ME6A 3WG9A 3GZ5A 3O6BB 3QOPA 1OISA 2PMZA 2H1KA 5LEJA 3CCQI 1I39A 1GVJA 2FU4A 3HPHA 5GAGJ 3JR9A 3CCSI 2V9KA 2XAFA 4B1RA 1FY7A 1G6NA 2DOAA 1YQAA 2TCTA 2P81A 1W5TA 3IV5A 2KIUA 1J9IA 3HZJA 2GWRA 1YJNI 3K10A 3E5QA 3CP8A 1F9NA 3M7GA 2DMQA 1HW1A 3REOA 3VB2A 2IGNA 2LFBA 5E8GA 3L00A 3HGGA 2HDWA 2ZXHA 3NWTA 3DPLC 3BR5A 2HXOA 4XN0A 4DOZA 5B66C 4XLPF 1MBKA 1TQMA 1OCTC 5K5QA 5FKMA 3GZNB 2VODA 3LA7A 2VI6A 3HTSB 3BWGA 4FX4A 2ADUA 2P5LC 1IV6A 2GOXB 4BQOA 2WC2A 3K9TA 1QPMA 3DU6A 3RZDJ 1Q1VA 2HOSA 2M7AA 2VB6A 4D0PA 1MDMA 2MW8A 2DK5A 2NS0A 4E7JA 3L1PA 2M7BA 2VJIA 1YW8A 2XF6A 4AU7A 4GRIA 1ON2A 2L7MP 4FE4A 4XRMA 1V55H 3OY9A 4II2A 4AIJA 3MEXA 1XGNA 3DTKA 1W36C 1J7KA 4C2UA 3GBGA 4A3IJ
chains in the Genus database with same CATH topology
3BP8A 2F5EA 5CVIA 1RNLA 1GXQA 3GUDA 4PZJA 3ROUA 2OBPA 2HTJA 4HX8A 2VBWA 3F6OA 2VOOA 2ZMEA 1LB2A 4IVNA 2VBYA 3I0TA 2EFWA 1XD7A 3VODA 3BJAA 3KLOA 1MJ9A 2IA2A 2C6YA 2DI3A 2EFPA 2Q8KA 1P2FA 2CFXA 1Z91A 2IA0A 1OR7A 1FNNA 1SFEA 3WTVC 3V8LA 1I1GA 5JFRA 4MQ9F 1YTYA 1CGPA 3MZYA 1U78A 1IN5A 2VT2A 2V1UA 2A6EF 3JSOA 3FXQA 1IN6A 4CXFA 2NRAC 4ESFA 1YIOA 3KEQA 1I27A 5IT3A 3HIFA 4HV6A 4KIFA 4EM0B 3FMRA 4L9NA 2FXAA 5HLHA 1HXDA 4U0YA 1OKRA 3GZ6A 3TO9A 4A0XA 3FXUA 1U8RA 5DEQA 3NRVA 1TNSA 1KQ0A 2PN6A 3G3ZA 4KMFA 1L3LA 2A3SA 3KP7A 5BPIA 1ZREA 2CW0F 5KVRA 3W6KB 2O6GE 3S2WA 1MD0A 1XDUA 1GXPA 5H20A 5FFXA 4OINF 3TDZC 2EK5A 4RGSA 4CGZA 2AXLA 3WTZA 4Y13A 2EFOA 2O8XA 3L09A 1J2XA 3WE2A 2A69F 2ZNZA 4MTEA 5CJ9A 4M71A 5HS8A 2COMA 2ZXJA 5ILUA 2XKOA 4R1HA 4M6YA 4U0WA 5D4RA 4N9IA 4KIGA 1R5GA 1V3FA 1S8NA 4KFCA 2EFNA 4Y17A 3ERED 3PQJA 5J8FA 1S6LA 2OQGA 5LRSA 1W7PA 1TQIA 2X4HA 1FPQA 1D5VA 5DCMA 4HF1A 5BOXA 2FNPA 5E1ZB 5D6EA 4EJTA 3G73A 2PG4A 1YLFA 4RB1A 3F8FA 4LG0A 5ICGA 2PJPA 4GCVA 4MEXF 5HVQC 1IZ1A 2NYXA 1ZG1A 4LK0F 3ZMUA 3CO7C 4S05A 4NHJA 3K2ZA 5EEHA 3ZP5A 3ISPA 3I58A 5HDGA 1K6OA 3U9GA 2K4JA 2BYVE 3HHGA 2WTEA 4OMZA 1V4RA 1LDDA 4EM2A 3QPHA 1HW5A 3KZZA 3WODF 5AIQA 4CO8A 3K1PA 3EYYA 1HW2A 1U5TA 3T8TA 4XBFA 3WGIA 1ZGAA 3B73A 1HQCA 4A5MA 4I0BA 3CUQC 3R0JA 5KK1A 2AS5F 1ONVA 2P4WA 1DPUA 4QLCU 1E17A 2VBZA 3ZPLA 2KJCA 1BJAA 2HWVA 2OAZA 2GXGA 5K1YA 5HDNA 3DQVC 2VE9A 4IRIA 3MQ0A 1IRGA 2O03A 1DP7P 1F5TA 1FYMA 2WV0A 1Q1HA 5JI6A 3DPTA 4P9FA 2Z3YA 4U7BA 3CTAA 1F1ZA 3WU0A 1FOKA 3ML6A 1P6RA 4WCGA 4Q5SF 2DFIA 1QGPA 3RDIA 1SFUA 1XMKA 4ESBA 4IJAA 3I59B 2H27A 4L9TA 4U0VA 2G7HA 5AIPA 3EYIA 2IP2A 4LB6B 2ACJA 2DO7A 1B6AA 5FLXZ 5LHHA 4I0AA 4LD5A 2BGCA 4PDKA 3WU1B 2RKHA 4BXUA 2QLZA 3HRTA 3JTGA 1O7FA 4ASNA 2HS5A 1RIOH 1G3TA 3TQNA 1O3QA 1YFHA 4KICA 2EJRA 3E6BA 2EV0A 2M1BA 5LEKA 1KU2A 1JXSA 1LEAA 2HDCA 1HKSA 2QQ9A 2A07F 2HKOA 4G6DA 5FO5A 5K5RA 2OA4A 4IRGA 3RKWA 5DDGA 1BN5A 1P92A 2CG4A 2R7FA 4G7HF 3CUQB 1H0MA 2OZ6A 3D5LA 2E7XA 3TDUC 5FFZA 3KP5A 3HOSA 1KA8A 3GW2A 2K02A 5F1RA 4M74A 4PGHA 2FNAA 2ETHA 1KYZA 1QZYA 3Q9SA 2JPBA 5HLIA 4GXOA 2YR2A 3SXYA 5TRDA 1O3TA 4FHTA 4OIOF 2ZCWA 1IXCA 1K78B 2FQ3A 3QU6A 2XVCA 1FP2A 2V9VA 2VBXA 1FP1D 2E7WA 2FBIA 2GA1A 1IW7F 1UFMA 3RJPA 2A61A 1TQPA 4KN7X 1YW7A 3WTSC 2W85A 1FC3A 1PDNC 3JTHA 1HKTA 2XAHA 2LKPA 4I09A 1LEBA 1XDSA 3R6SA 4L0ZB 4JQFA 2LF7A 3RYRA 2GA2A 1LQ1A 2OD5A 1K7AA 3E6DA 4EMSA 1SD6A 1BIAA 1E2XA 2XROA 4GGGA 3MCZA 2J5OA 4CYDA 5L3GA 2FBKA 1WI9A 4HDVA 3T5XA 4PGGA 1IRFA 4AIKA 1DDNA 5ICFA 1BI1A 3FWEA 2HYGD 3FMSA 1ZRDA 4QWQA 3KZYA 4KYWA 2FOKA 3GF2A 2YU3A 1U2WA 1ODDA 2H94A 3K1MA 1R23A 1ZAOA 4MHGA 2M5WA 4Q48A 2IA1A 3V7RA 4CZZA 4KIBA 1B9MA 1BI0A 3ZMDA 1MJBA 2Y0MA 2HOEA 5D5WB 4WK8F 3GVAA 2V6CA 1L0OC 3IHUA 4WWCA 1FX7A 3F8CA 3F23A 3C18A 4EJOA 4ENNA 4R79A 3HHHA 5L3EA 1MJAA 1XSXA 1D8JA 3F22A 2D2WA 3VOEA 2M8EA 4XLNF 2QBYB 3C7JA 3T0YA 5DUKA 4KT5C 1I1SA 3TGNA 1TW3A 5D5VB 5DCFA 2HYFA 3BZ6A 5LGUA 4FX0A 3IL2A 2UZKA 2W57A 3RTRA 4P96A 1IAWA 5DYMA 5H6QA 3GFIA 2HQRA 1BOAA 3V7SA 4ETSA 3LFKA 2Z9OA 4P5OA 1QQIA 2GXBA 3ZQ7A 2DQRA 1WWXA 2ESHA 3EDPA 4HX7A 3CO6C 2VONA 4IPAA 1T2KA 3LQRA 3P9CA 2RC4A 2Q0OA 4IF4A 2G9WA 1ZRFA 2ZKZA 3IC7A 2QQAA 2V1XA 5BS6A 1YW9A 3L7WA 2D45A 1XMAA 3Q5FA 4EJUA 3BJ6A 4HA8A 3ZMZA 2EFQA 5L3CA 4RB2C 2P7VB 1Y0UA 2FRHA 1FBQA 4A6DA 4S04A 1ZG5A 3ECOA 1W4MA 3F8BA 3I64A 3U2RA 2KJBA 3O3KA 4H0EA 4LLNA 1SMTA 2PBIA 2EB7A 4G7ZF 3WTUC 4RGXA 1AWCA 2FSWA 3HYIA 3TKYA 1W5SA 3RYPA 2QWWA 2STWA 2FA5A 3U1DA 3MAJA 2P8TA 4MNUA 2L02A 5ICEA 1FYLA 4A5NA 4UV8A 1G3WA 1IN7A 3GO5A 1K79A 3VFZA 2DAOA 1FSHA 3T1BA 4Q4ZF 3V4GA 1Z05A 3GFLA 3KP2A 4ZZLA 1USTA 3DP7A 2BBYA 2YSRA 2TDXA 4UHTA 3BY6A 3DV8A 1QO0D 2EA4A 2XKPA 2NNYA 2DU9A 1AOYA 5L3DA 5CVUA 5DD4A 1ULYA 1PP8F 4AWXB 1USSA 5LHIA 4RAZA 1KQ8A 2QZ8A 5ERIA 3WTYC 1O3SA 4OMYA 3V8KA 1EH7A 3CUQA 3JAMZ 3RKXA 4YFNF 2YPRA 1YG2A 4YFKF 4BHCA 3GX4X 4WXDA 4M9ZA 2DQLA 1HSTA 1H9TA 1BIBA 4G6QA 4ON0A 1T6SA 4CHUA 4BNCA 5E20A 2OU2A 4M73A 2KRFA 1EH6A 2V79A 3GLXA 1MZBA 2W24A 5IT9Z 3P9KA 4BQAA 5ILVA 3TO7A 2EV6A 3H3UA 2H6BA 5L3FA 4L5IA 1BC8C 2STTA 3E6CC 1QZZA 4BAYA 4RGUA 4HQEA 1K78A 2VC0A 2MH9A 1X3UA 4EQQA 3O2PE 3ZN0A 4EV0A 1OMIA 1IN8A 5E17F 2ZO4A 2F2EA 2NNNA 1D3YA 1RUNA 2EA2A 3KCCA 1XSDA 5CVVA 1UHMA 2QENA 4JBAA 1O57A 2D1VA 5DD8A 3ULQB 4P55A 1XB4A 4MEYF 3EETA 1SMYF 2ZMEB 5ILSA 2P6TA 3C1DA 2J5PA 2O61A 3ZMVA 3B02A 3W6JB 2DBBA 3KP3A 4L18B 2RGVA 4WXHA 3RKYA 2EV5A 3PQKA 1O7LA 5E1XA 1SAXA 1GHCA 4UXNA 4DNCA 3M8EA 1XN7A 1KU9A 3J81Z 3J80Z 1F4KA 3HSRA 1O3RA 2JRTA 2BV6A 4BHPA 1ZYRF 1IN4A 1WSUA 4RB3C 3RI4A 1ZN2A 3F21A 1R5HA 1OYWA 4B8XA 2IPQX 1LNWA 5ICCA 2LDUA 3GYHX 3I71A 1ON1A 5HS7A 5FLXK 1ZRCA 1KGSA 3FXRA 1YO5C 1WRJA 3FMQA 4UNOA 2V1DA 3ZN1A 1HBXG 4ESJA 4LGWA 3HRSA 4B09A 4HF0A 2OZUA 2CYYA 3F8MA 4U88A 3MFKA 1NHAA 2MBFA 2HQNA 2M45A 3F72A 4RB0A 4HDUA 3DFGA 2QBYA 4P9UA 1B9NA 3F3XA 2P5KA 2FBHA 4KDPA 1U5TC 5A2QZ 4KUMA 2R7DA 2JT1A 4O5VA 3EUHA 2G7UA 1KYWA 3IKTA 3LAJA 1P4WA 4HW0A 3VEPA 4HF2A 2PMUA 2CQKA 3NEUA 4ZYEA 5CVJA 5J8CA 3QU3A 1PUEE 1HKQA 4PCQA 4FT8A 3C3WA 4RAYA 3H92A 3IWFA 3R61A 4M9XA 4KMUX 5DCMB 3TOAA 2GQQA 3FX3A 1YS6A 1J75A 2W84A 2HEOA 3LA3A 1WQ2A 4YFXF 2VT3A 1XCVA 3DEUA 4IXAA 4LG0B 3HSEA 3HRUA 2VXZA 2XAQA 2P7CB 3QAHA 5LBQA 3AAFA 2DT5A 2W25A 1EH8A 2O3FA 5HS9A 3QP6A 1W7PD 3R0AA 3WGHA 1R1UA 1ZGJA 4WF2A 1BI3A 4HQMA 3TO6A 1R22A 2IVMA 3COAC 2MH2A 2Y75A 4TV7A 5D8LB 4Y15A 2HTSA 1IXRC 2JTVA 4IHSA 4ENMA 3M8FA 3BJOA 3WGGA 2RDPA 4ZYGA 2F5FA 4OIQF 3JSPA 1XGOA 3D0SA 1JHFA 2UXXA 1U5TB 3WE3A 3DKWA 1FLIA 4YIFA 2F5CA 3LAPA 1CF7B 4ZH4F 4WX9A 3IWZA 3KLNA 1OYYA 2CWEA 1IXSB 3CLOA 4HOBA 2RNJA 5CVRA 1FSEA 1MKMA 4A6EA 3BDDA 5J6XA 3BROA 1Z6TA 3FF5A 4O6JA 2D1HA 3I5UA 1JGSA 4CDGA 1R36A 5D6FA 5LRRA 4EVIA 3ELKA 4LK1F 4CICA 4WXCA 4A0ZA 2ISZA 3RPUA 3KEOA 2Z99A 2DPUA 4L5JA 4YG2F 4XSZF 3N4MA 2VN2A 3LQQA 4KNYA 1J59A 4DQ2A 2XAGA 5BQTA 2MLGA 4AD9A 1BM9A 4BHBA 1XGSA 3GFJA 4ZYHA 2PEXA 4Q47A 5TJJA 3T8RA 2RV8A 1OPCA 4ENKA 1H9GA 3WTXC 3QPTA 1T0FA 3DF8A 2LSOA 2XGXA 1IF1A 4G9YA 4LJZF 2PLYA 1FBSA 3KFWX 1Z6RA 1HSJA 4N0BA 5AONA 2ESNA 5HOOA 5D5UB 2KKOA 1BI2A 4EGZA 1RUOA 1S3JA 3GFMA 2FMLA 4E70A 5DV5A 3I54A 3EQLF 4UVBA 4LB5A 5F6FA 2MLKA 3F8NA 2L54A 1ZHFA 4IHTA 1UB9A 2QQBA 4LFUA 1ZARA 4HBLA 4AVPA 3E5XA 5JHUA 5LGNA 1REPC 2VE8A 1B59A 2VC1A 3ABTA 5D8KB 3F6VA 3KP6A 2ZNYA 2RN7A 2XASA 5FD6A 1Z9CA 3BOQA 2A5YB 1EV7A 3HTUA 1UCRA 4UV9A 1JHHA 4OIRF 1J0RA 4M72A 1QNTA 1SFXA 2MC3A 2E1CA 4M9SA 4I02A 4O3MA 4AIHA 2UWMA 1TBXA 2IW5A 4HLYA 2VOPA 1G3YA 4MQVA 3GWZA 2CO5A 1BBYA 1P4XA 2MD5A 4R8HA 3SHFA 2BEOA 4G94A 3OOPA 3I59A 1FYKA 5HDKA 2L4MA 2FMYA 1BC7C 4KA4A 5D4SA 4UVCA 4XSXF 5JR3A 2HZTA 3SQNA 3I4PA 1DPRA 2XHKA 2ELHA 2PFBA 1ZG3A 4EJWA 2O0YA 1S29A 4OU0A 5EEGA 2X0LA 1FT9A 4N9HA 1TW2A 3CDHA 4L9VA 2L01A 2KIMA 1RZ4A 2YX7A 4JK1X 4LLLA 5E18F 3JW4A 3ECHA 1FBUA 3HSFA 4HV5A 5FD5A 1KQ9A 1VTNC 3JAMK 2EWNA 4HAMA 1R58A 5ED4A 1Z7UA 1P4AA 3IRQA 2B0LA 2FE3A 3ABUA 4LLGF 2QVOA 3E6MA 3ZMTA 1STZA 3QP5A 1T38A 3SZPA 2P6SA 1LJ9A 1XSVA 2RVCA 5IT9K 3E5UA 1YS7A 3FM3A 5JVTA 4MGRA 2IT0A 3BPVA 4ZZDA 3LA2A 3HUGA 3SZTA 3P9IA 4EM1A 2MA3A 2PI0A 3FZVA 2ZFWA 1T39A 3E97A 2ZBKA 1UHWA 1R00A 3HRMA 1MDMB 4KN4X 3CUOA 1T98A 1A04A 2R3SA 2M87A 2JPCA 2JZYA 1S7AA 2PMHA 1ZH5A 2L3DA 1TTYA 3LWFA 3P7NA 5LHGA 2OQRA 2F5DA 3RIRA 1XGMA 2BE5F 3LSTA 1KU3A 2XV4S 1FWZA 4A0YA 1ZLKA 2YX4A 2FF4A 5K5OA 3J81K 4U7DA 3J80K 3MWMA 2M30A 3FM5A 4M6XA 3MZHA 3J7AO 2PQ8A 1CF7A 3Q9VA 1C0WA 2A68F 2FEZA 2DLLA 5HLGA 2XRNA 2E1NA 2H09A 4ZYDA 3M1EA 1I6XA 3NQOA 5FB2A 3E3VA 4OIPF 4GYIA 2DTRA 1R1TA 1RI7A 4BH9A 2CSOA 1WKMA 5E1WA 2K27A 1QBJA 5D5XB 4RS8A 3FHZA 2ISYA 4HZFA 2GAUA 4I98B 4F7ZA 2K7LA 1SD4A 3HOTA 3I53A 3IKVA 3KE2A 4L0YB 5L3BA 4YIIA 4HYEA 2QYOA 4HLXA 4NB5A 2DK8A 2JSCA 1DUXC 2P5VA 4OOIA 2HGCA 2Y48A 3GXOA 5DUIA 2K86A 4GYGA 5A2QK 5CLSA 3KETA 2KIFA 3KP4A 4UUVA 2HKXA 2HFHA 2WWYA 4BYYA 2IRFG 4K2EA 4IRHA 4XRFA 1TLHB 1G4DA 1PP7U 1ZLJA 1R7JA 4HX4A 2LNBA 5CYVA 4Z2YA 2NAZA 1YYVA 1U6GA 5LGTA 4GO1A 1LDKB 4G7OF 4ENJA 1TNTA 2ZJ2A 2DW4A 4EJVA 2CGPA 1W7PB 3H3ZA 4L9JA 2GZWA 2QUFA 1G3SA 2XAJA 3R4KA 2L4AA 1MGTA 1LVAA 1Z1DA 4A12A 2RQPA 1FZPB 3CJNA 4NQWA 3L9FA 1SD5A 2XIGA 3M9AA 4A2UA 2GIVA 2Z33A 1U3EM 5BPDA 3WTTC 1R1VA 3QRFF 3SFZA 3N97A 2UXNA 3BPXA 3K69A 4LMYA 3ZMSA 3K0LA 5LLQA 3K1NA 3V7CA 1OYIA 4EGYA 3WTWC 2Q2EA 3L2CA 1S7OA 1I5ZA 1XCBA 4RGRA 2IJLA 5E8IA 2XUBA 2QM3A 5FGMA 4I01A 2HR3A 3GEZA 1SD7A 1B1BA 1D8KA 1LDJA 3V8JA 1IUYA 4G8XA 4MTDA 3PFIA 2A6HF 5BMZA 6PAXA 4I2OA 2H6CA 4I7HA 3R60A 5F64A 2Z5UA 2K4BA 2LF8A 3DXJF 3TOBA 4UVAA 1KU7A 3IRRA 1J5YA 1B4AA 5H6RA 3RPQA 3OV8A 1JE8A 2DPDA 3WG9A 3GZ5A 3O6BB 3QOPA 5LEJA 1GVJA 2FU4A 2XAFA 1FY7A 1G6NA 1YQAA 1W5TA 2KIUA 1J9IA 2GWRA 3E5QA 1F9NA 3M7GA 1HW1A 3REOA 3VB2A 5E8GA 3L00A 3DPLC 4XLPF 1TQMA 5K5QA 2VODA 3LA7A 3HTSB 3BWGA 4FX4A 2ADUA 2P5LC 2WC2A 3K9TA 1QPMA 4D0PA 1MDMA 2DK5A 2NS0A 1YW8A 1ON2A 4AIJA 3MEXA 1XGNA 1J7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP8 A;  2F5E A;  5CVI A;  1RNL A;  1GXQ A;  3GUD A;  4PZJ A;  3ROU A;  2OBP A;  2HTJ A;  4HX8 A;  2VBW A;  3F6O A;  2VOO A;  2ZME A;  1LB2 A;  4IVN A;  2VBY A;  3I0T A;  2EFW A;  1XD7 A;  3VOD A;  3BJA A;  3KLO A;  1MJ9 A;  2IA2 A;  2C6Y A;  2DI3 A;  2EFP A;  2Q8K A;  1P2F A;  2CFX A;  1Z91 A;  2IA0 A;  1OR7 A;  1FNN A;  1SFE A;  3WTV C;  3V8L A;  1I1G A;  5JFR A;  4MQ9 F;  1YTY A;  1CGP A;  3MZY A;  1U78 A;  1IN5 A;  2VT2 A;  2V1U A;  2A6E F;  3JSO A;  3FXQ A;  1IN6 A;  4CXF A;  2NRA C;  4ESF A;  1YIO A;  3KEQ A;  1I27 A;  5IT3 A;  3HIF A;  4HV6 A;  4KIF A;  4EM0 B;  3FMR A;  4L9N A;  2FXA A;  5HLH A;  1HXD A;  4U0Y A;  1OKR A;  3GZ6 A;  3TO9 A;  4A0X A;  3FXU A;  1U8R A;  5DEQ A;  3NRV A;  1TNS A;  1KQ0 A;  2PN6 A;  3G3Z A;  4KMF A;  1L3L A;  2A3S A;  3KP7 A;  5BPI A;  1ZRE A;  2CW0 F;  5KVR A;  3W6K B;  2O6G E;  3S2W A;  1MD0 A;  1XDU A;  1GXP A;  5H20 A;  5FFX A;  4OIN F;  3TDZ C;  2EK5 A;  4RGS A;  4CGZ A;  2AXL A;  3WTZ A;  4Y13 A;  2EFO A;  2O8X A;  3L09 A;  1J2X A;  3WE2 A;  2A69 F;  2ZNZ A;  4MTE A;  5CJ9 A;  4M71 A;  5HS8 A;  2COM A;  2ZXJ A;  5ILU A;  2XKO A;  4R1H A;  4M6Y A;  4U0W A;  5D4R A;  4N9I A;  4KIG A;  1R5G A;  1V3F A;  1S8N A;  4KFC A;  2EFN A;  4Y17 A;  3ERE D;  3PQJ A;  5J8F A;  1S6L A;  2OQG A;  5LRS A;  1W7P A;  1TQI A;  2X4H A;  1FPQ A;  1D5V A;  5DCM A;  4HF1 A;  5BOX A;  2FNP A;  5E1Z B;  5D6E A;  4EJT A;  3G73 A;  2PG4 A;  1YLF A;  4RB1 A;  3F8F A;  4LG0 A;  5ICG A;  2PJP A;  4GCV A;  4MEX F;  5HVQ C;  1IZ1 A;  2NYX A;  1ZG1 A;  4LK0 F;  3ZMU A;  3CO7 C;  4S05 A;  4NHJ A;  3K2Z A;  5EEH A;  3ZP5 A;  3ISP A;  3I58 A;  5HDG A;  1K6O A;  3U9G A;  2K4J A;  2BYV E;  3HHG A;  2WTE A;  4OMZ A;  1V4R A;  1LDD A;  4EM2 A;  3QPH A;  1HW5 A;  3KZZ A;  3WOD F;  5AIQ A;  4CO8 A;  3K1P A;  3EYY A;  1HW2 A;  1U5T A;  3T8T A;  4XBF A;  3WGI A;  1ZGA A;  3B73 A;  1HQC A;  4A5M A;  4I0B A;  3CUQ C;  3R0J A;  5KK1 A;  2AS5 F;  1ONV A;  2P4W A;  1DPU A;  4QLC U;  1E17 A;  2VBZ A;  3ZPL A;  2KJC A;  1BJA A;  2HWV A;  2OAZ A;  2GXG A;  5K1Y A;  5HDN A;  3DQV C;  2VE9 A;  4IRI A;  3MQ0 A;  1IRG A;  2O03 A;  1DP7 P;  1F5T A;  1FYM A;  2WV0 A;  1Q1H A;  5JI6 A;  3DPT A;  4P9F A;  2Z3Y A;  4U7B A;  3CTA A;  1F1Z A;  3WU0 A;  1FOK A;  3ML6 A;  1P6R A;  4WCG A;  4Q5S F;  2DFI A;  1QGP A;  3RDI A;  1SFU A;  1XMK A;  4ESB A;  4IJA A;  3I59 B;  2H27 A;  4L9T A;  4U0V A;  2G7H A;  5AIP A;  3EYI A;  2IP2 A;  4LB6 B;  2ACJ A;  2DO7 A;  1B6A A;  5FLX Z;  5LHH A;  4I0A A;  4LD5 A;  2BGC A;  4PDK A;  3WU1 B;  2RKH A;  4BXU A;  2QLZ A;  3HRT A;  3JTG A;  1O7F A;  4ASN A;  2HS5 A;  1RIO H;  1G3T A;  3TQN A;  1O3Q A;  1YFH A;  4KIC A;  2EJR A;  3E6B A;  2EV0 A;  2M1B A;  5LEK A;  1KU2 A;  1JXS A;  1LEA A;  2HDC A;  1HKS A;  2QQ9 A;  2A07 F;  2HKO A;  4G6D A;  5FO5 A;  5K5R A;  2OA4 A;  4IRG A;  3RKW A;  5DDG A;  1BN5 A;  1P92 A;  2CG4 A;  2R7F A;  4G7H F;  3CUQ B;  1H0M A;  2OZ6 A;  3D5L A;  2E7X A;  3TDU C;  5FFZ A;  3KP5 A;  3HOS A;  1KA8 A;  3GW2 A;  2K02 A;  5F1R A;  4M74 A;  4PGH A;  2FNA A;  2ETH A;  1KYZ A;  1QZY A;  3Q9S A;  2JPB A;  5HLI A;  4GXO A;  2YR2 A;  3SXY A;  5TRD A;  1O3T A;  4FHT A;  4OIO F;  2ZCW A;  1IXC A;  1K78 B;  2FQ3 A;  3QU6 A;  2XVC A;  1FP2 A;  2V9V A;  2VBX A;  1FP1 D;  2E7W A;  2FBI A;  2GA1 A;  1IW7 F;  1UFM A;  3RJP A;  2A61 A;  1TQP A;  4KN7 X;  1YW7 A;  3WTS C;  2W85 A;  1FC3 A;  1PDN C;  3JTH A;  1HKT A;  2XAH A;  2LKP A;  4I09 A;  1LEB A;  1XDS A;  3R6S A;  4L0Z B;  4JQF A;  2LF7 A;  3RYR A;  2GA2 A;  1LQ1 A;  2OD5 A;  1K7A A;  3E6D A;  4EMS A;  1SD6 A;  1BIA A;  1E2X A;  2XRO A;  4GGG A;  3MCZ A;  2J5O A;  4CYD A;  5L3G A;  2FBK A;  1WI9 A;  4HDV A;  3T5X A;  4PGG A;  1IRF A;  4AIK A;  1DDN A;  5ICF A;  1BI1 A;  3FWE A;  2HYG D;  3FMS A;  1ZRD A;  4QWQ A;  3KZY A;  4KYW A;  2FOK A;  3GF2 A;  2YU3 A;  1U2W A;  1ODD A;  2H94 A;  3K1M A;  1R23 A;  1ZAO A;  4MHG A;  2M5W A;  4Q48 A;  2IA1 A;  3V7R A;  4CZZ A;  4KIB A;  1B9M A;  1BI0 A;  3ZMD A;  1MJB A;  2Y0M A;  2HOE A;  5D5W B;  4WK8 F;  3GVA A;  2V6C A;  1L0O C;  3IHU A;  4WWC A;  1FX7 A;  3F8C A;  3F23 A;  3C18 A;  4EJO A;  4ENN A;  4R79 A;  3HHH A;  5L3E A;  1MJA A;  1XSX A;  1D8J A;  3F22 A;  2D2W A;  3VOE A;  2M8E A;  4XLN F;  2QBY B;  3C7J A;  3T0Y A;  5DUK A;  4KT5 C;  1I1S A;  3TGN A;  1TW3 A;  5D5V B;  5DCF A;  2HYF A;  3BZ6 A;  5LGU A;  4FX0 A;  3IL2 A;  2UZK A;  2W57 A;  3RTR A;  4P96 A;  1IAW A;  5DYM A;  5H6Q A;  3GFI A;  2HQR A;  1BOA A;  3V7S A;  4ETS A;  3LFK A;  2Z9O A;  4P5O A;  1QQI A;  2GXB A;  3ZQ7 A;  2DQR A;  1WWX A;  2ESH A;  3EDP A;  4HX7 A;  3CO6 C;  2VON A;  4IPA A;  1T2K A;  3LQR A;  3P9C A;  2RC4 A;  2Q0O A;  4IF4 A;  2G9W A;  1ZRF A;  2ZKZ A;  3IC7 A;  2QQA A;  2V1X A;  5BS6 A;  1YW9 A;  3L7W A;  2D45 A;  1XMA A;  3Q5F A;  4EJU A;  3BJ6 A;  4HA8 A;  3ZMZ A;  2EFQ A;  5L3C A;  4RB2 C;  2P7V B;  1Y0U A;  2FRH A;  1FBQ A;  4A6D A;  4S04 A;  1ZG5 A;  3ECO A;  1W4M A;  3F8B A;  3I64 A;  3U2R A;  2KJB A;  3O3K A;  4H0E A;  4LLN A;  1SMT A;  2PBI A;  2EB7 A;  4G7Z F;  3WTU C;  4RGX A;  1AWC A;  2FSW A;  3HYI A;  3TKY A;  1W5S A;  3RYP A;  2QWW A;  2STW A;  2FA5 A;  3U1D A;  3MAJ A;  2P8T A;  4MNU A;  2L02 A;  5ICE A;  1FYL A;  4A5N A;  4UV8 A;  1G3W A;  1IN7 A;  3GO5 A;  1K79 A;  3VFZ A;  2DAO A;  1FSH A;  3T1B A;  4Q4Z F;  3V4G A;  1Z05 A;  3GFL A;  3KP2 A;  4ZZL A;  1UST A;  3DP7 A;  2BBY A;  2YSR A;  2TDX A;  4UHT A;  3BY6 A;  3DV8 A;  1QO0 D;  2EA4 A;  2XKP A;  2NNY A;  2DU9 A;  1AOY A;  5L3D A;  5CVU A;  5DD4 A;  1ULY A;  1PP8 F;  4AWX B;  1USS A;  5LHI A;  4RAZ A;  1KQ8 A;  2QZ8 A;  5ERI A;  3WTY C;  1O3S A;  4OMY A;  3V8K A;  1EH7 A;  3CUQ A;  3JAM Z;  3RKX A;  4YFN F;  2YPR A;  1YG2 A;  4YFK F;  4BHC A;  3GX4 X;  4WXD A;  4M9Z A;  2DQL A;  1HST A;  1H9T A;  1BIB A;  4G6Q A;  4ON0 A;  1T6S A;  4CHU A;  4BNC A;  5E20 A;  2OU2 A;  4M73 A;  2KRF A;  1EH6 A;  2V79 A;  3GLX A;  1MZB A;  2W24 A;  5IT9 Z;  3P9K A;  4BQA A;  5ILV A;  3TO7 A;  2EV6 A;  3H3U A;  2H6B A;  5L3F A;  4L5I A;  1BC8 C;  2STT A;  3E6C C;  1QZZ A;  4BAY A;  4RGU A;  4HQE A;  1K78 A;  2VC0 A;  2MH9 A;  1X3U A;  4EQQ A;  3O2P E;  3ZN0 A;  4EV0 A;  1OMI A;  1IN8 A;  5E17 F;  2ZO4 A;  2F2E A;  2NNN A;  1D3Y A;  1RUN A;  2EA2 A;  3KCC A;  1XSD A;  5CVV A;  1UHM A;  2QEN A;  4JBA A;  1O57 A;  2D1V A;  5DD8 A;  3ULQ B;  4P55 A;  1XB4 A;  4MEY F;  3EET A;  1SMY F;  2ZME B;  5ILS A;  2P6T A;  3C1D A;  2J5P A;  2O61 A;  3ZMV A;  3B02 A;  3W6J B;  2DBB A;  3KP3 A;  4L18 B;  2RGV A;  4WXH A;  3RKY A;  2EV5 A;  3PQK A;  1O7L A;  5E1X A;  1SAX A;  1GHC A;  4UXN A;  4DNC A;  3M8E A;  1XN7 A;  1KU9 A;  3J81 Z;  3J80 Z;  1F4K A;  3HSR A;  1O3R A;  2JRT A;  2BV6 A;  4BHP A;  1ZYR F;  1IN4 A;  1WSU A;  4RB3 C;  3RI4 A;  1ZN2 A;  3F21 A;  1R5H A;  1OYW A;  4B8X A;  2IPQ X;  1LNW A;  5ICC A;  2LDU A;  3GYH X;  3I71 A;  1ON1 A;  5HS7 A;  5FLX K;  1ZRC A;  1KGS A;  3FXR A;  1YO5 C;  1WRJ A;  3FMQ A;  4UNO A;  2V1D A;  3ZN1 A;  1HBX G;  4ESJ A;  4LGW A;  3HRS A;  4B09 A;  4HF0 A;  2OZU A;  2CYY A;  3F8M A;  4U88 A;  3MFK A;  1NHA A;  2MBF A;  2HQN A;  2M45 A;  3F72 A;  4RB0 A;  4HDU A;  3DFG A;  2QBY A;  4P9U A;  1B9N A;  3F3X A;  2P5K A;  2FBH A;  4KDP A;  1U5T C;  5A2Q Z;  4KUM A;  2R7D A;  2JT1 A;  4O5V A;  3EUH A;  2G7U A;  1KYW A;  3IKT A;  3LAJ A;  1P4W A;  4HW0 A;  3VEP A;  4HF2 A;  2PMU A;  2CQK A;  3NEU A;  4ZYE A;  5CVJ A;  5J8C A;  3QU3 A;  1PUE E;  1HKQ A;  4PCQ A;  4FT8 A;  3C3W A;  4RAY A;  3H92 A;  3IWF A;  3R61 A;  4M9X A;  4KMU X;  5DCM B;  3TOA A;  2GQQ A;  3FX3 A;  1YS6 A;  1J75 A;  2W84 A;  2HEO A;  3LA3 A;  1WQ2 A;  4YFX F;  2VT3 A;  1XCV A;  3DEU A;  4IXA A;  4LG0 B;  3HSE A;  3HRU A;  2VXZ A;  2XAQ A;  2P7C B;  3QAH A;  5LBQ A;  3AAF A;  2DT5 A;  2W25 A;  1EH8 A;  2O3F A;  5HS9 A;  3QP6 A;  1W7P D;  3R0A A;  3WGH A;  1R1U A;  1ZGJ A;  4WF2 A;  1BI3 A;  4HQM A;  3TO6 A;  1R22 A;  2IVM A;  3COA C;  2MH2 A;  2Y75 A;  4TV7 A;  5D8L B;  4Y15 A;  2HTS A;  1IXR C;  2JTV A;  4IHS A;  4ENM A;  3M8F A;  3BJO A;  3WGG A;  2RDP A;  4ZYG A;  2F5F A;  4OIQ F;  3JSP A;  1XGO A;  3D0S A;  1JHF A;  2UXX A;  1U5T B;  3WE3 A;  3DKW A;  1FLI A;  4YIF A;  2F5C A;  3LAP A;  1CF7 B;  4ZH4 F;  4WX9 A;  3IWZ A;  3KLN A;  1OYY A;  2CWE A;  1IXS B;  3CLO A;  4HOB A;  2RNJ A;  5CVR A;  1FSE A;  1MKM A;  4A6E A;  3BDD A;  5J6X A;  3BRO A;  1Z6T A;  3FF5 A;  4O6J A;  2D1H A;  3I5U A;  1JGS A;  4CDG A;  1R36 A;  5D6F A;  5LRR A;  4EVI A;  3ELK A;  4LK1 F;  4CIC A;  4WXC A;  4A0Z A;  2ISZ A;  3RPU A;  3KEO A;  2Z99 A;  2DPU A;  4L5J A;  4YG2 F;  4XSZ F;  3N4M A;  2VN2 A;  3LQQ A;  4KNY A;  1J59 A;  4DQ2 A;  2XAG A;  5BQT A;  2MLG A;  4AD9 A;  1BM9 A;  4BHB A;  1XGS A;  3GFJ A;  4ZYH A;  2PEX A;  4Q47 A;  5TJJ A;  3T8R A;  2RV8 A;  1OPC A;  4ENK A;  1H9G A;  3WTX C;  3QPT A;  1T0F A;  3DF8 A;  2LSO A;  2XGX A;  1IF1 A;  4G9Y A;  4LJZ F;  2PLY A;  1FBS A;  3KFW X;  1Z6R A;  1HSJ A;  4N0B A;  5AON A;  2ESN A;  5HOO A;  5D5U B;  2KKO A;  1BI2 A;  4EGZ A;  1RUO A;  1S3J A;  3GFM A;  2FML A;  4E70 A;  5DV5 A;  3I54 A;  3EQL F;  4UVB A;  4LB5 A;  5F6F A;  2MLK A;  3F8N A;  2L54 A;  1ZHF A;  4IHT A;  1UB9 A;  2QQB A;  4LFU A;  1ZAR A;  4HBL A;  4AVP A;  3E5X A;  5JHU A;  5LGN A;  1REP C;  2VE8 A;  1B59 A;  2VC1 A;  3ABT A;  5D8K B;  3F6V A;  3KP6 A;  2ZNY A;  2RN7 A;  2XAS A;  5FD6 A;  1Z9C A;  3BOQ A;  2A5Y B;  1EV7 A;  3HTU A;  1UCR A;  4UV9 A;  1JHH A;  4OIR F;  1J0R A;  4M72 A;  1QNT A;  1SFX A;  2MC3 A;  2E1C A;  4M9S A;  4I02 A;  4O3M A;  4AIH A;  2UWM A;  1TBX A;  2IW5 A;  4HLY A;  2VOP A;  1G3Y A;  4MQV A;  3GWZ A;  2CO5 A;  1BBY A;  1P4X A;  2MD5 A;  4R8H A;  3SHF A;  2BEO A;  4G94 A;  3OOP A;  3I59 A;  1FYK A;  5HDK A;  2L4M A;  2FMY A;  1BC7 C;  4KA4 A;  5D4S A;  4UVC A;  4XSX F;  5JR3 A;  2HZT A;  3SQN A;  3I4P A;  1DPR A;  2XHK A;  2ELH A;  2PFB A;  1ZG3 A;  4EJW A;  2O0Y A;  1S29 A;  4OU0 A;  5EEG A;  2X0L A;  1FT9 A;  4N9H A;  1TW2 A;  3CDH A;  4L9V A;  2L01 A;  2KIM A;  1RZ4 A;  2YX7 A;  4JK1 X;  4LLL A;  5E18 F;  3JW4 A;  3ECH A;  1FBU A;  3HSF A;  4HV5 A;  5FD5 A;  1KQ9 A;  1VTN C;  3JAM K;  2EWN A;  4HAM A;  1R58 A;  5ED4 A;  1Z7U A;  1P4A A;  3IRQ A;  2B0L A;  2FE3 A;  3ABU A;  4LLG F;  2QVO A;  3E6M A;  3ZMT A;  1STZ A;  3QP5 A;  1T38 A;  3SZP A;  2P6S A;  1LJ9 A;  1XSV A;  2RVC A;  5IT9 K;  3E5U A;  1YS7 A;  3FM3 A;  5JVT A;  4MGR A;  2IT0 A;  3BPV A;  4ZZD A;  3LA2 A;  3HUG A;  3SZT A;  3P9I A;  4EM1 A;  2MA3 A;  2PI0 A;  3FZV A;  2ZFW A;  1T39 A;  3E97 A;  2ZBK A;  1UHW A;  1R00 A;  3HRM A;  1MDM B;  4KN4 X;  3CUO A;  1T98 A;  1A04 A;  2R3S A;  2M87 A;  2JPC A;  2JZY A;  1S7A A;  2PMH A;  1ZH5 A;  2L3D A;  1TTY A;  3LWF A;  3P7N A;  5LHG A;  2OQR A;  2F5D A;  3RIR A;  1XGM A;  2BE5 F;  3LST A;  1KU3 A;  2XV4 S;  1FWZ A;  4A0Y A;  1ZLK A;  2YX4 A;  2FF4 A;  5K5O A;  3J81 K;  4U7D A;  3J80 K;  3MWM A;  2M30 A;  3FM5 A;  4M6X A;  3MZH A;  3J7A O;  2PQ8 A;  1CF7 A;  3Q9V A;  1C0W A;  2A68 F;  2FEZ A;  2DLL A;  5HLG A;  2XRN A;  2E1N A;  2H09 A;  4ZYD A;  3M1E A;  1I6X A;  3NQO A;  5FB2 A;  3E3V A;  4OIP F;  4GYI A;  2DTR A;  1R1T A;  1RI7 A;  4BH9 A;  2CSO A;  1WKM A;  5E1W A;  2K27 A;  1QBJ A;  5D5X B;  4RS8 A;  3FHZ A;  2ISY A;  4HZF A;  2GAU A;  4I98 B;  4F7Z A;  2K7L A;  1SD4 A;  3HOT A;  3I53 A;  3IKV A;  3KE2 A;  4L0Y B;  5L3B A;  4YII A;  4HYE A;  2QYO A;  4HLX A;  4NB5 A;  2DK8 A;  2JSC A;  1DUX C;  2P5V A;  4OOI A;  2HGC A;  2Y48 A;  3GXO A;  5DUI A;  2K86 A;  4GYG A;  5A2Q K;  5CLS A;  3KET A;  2KIF A;  3KP4 A;  4UUV A;  2HKX A;  2HFH A;  2WWY A;  4BYY A;  2IRF G;  4K2E A;  4IRH A;  4XRF A;  1TLH B;  1G4D A;  1PP7 U;  1ZLJ A;  1R7J A;  4HX4 A;  2LNB A;  5CYV A;  4Z2Y A;  2NAZ A;  1YYV A;  1U6G A;  5LGT A;  4GO1 A;  1LDK B;  4G7O F;  4ENJ A;  1TNT A;  2ZJ2 A;  2DW4 A;  4EJV A;  2CGP A;  1W7P B;  3H3Z A;  4L9J A;  2GZW A;  2QUF A;  1G3S A;  2XAJ A;  3R4K A;  2L4A A;  1MGT A;  1LVA A;  1Z1D A;  4A12 A;  2RQP A;  1FZP B;  3CJN A;  4NQW A;  3L9F A;  1SD5 A;  2XIG A;  3M9A A;  4A2U A;  2GIV A;  2Z33 A;  1U3E M;  5BPD A;  3WTT C;  1R1V A;  3QRF F;  3SFZ A;  3N97 A;  2UXN A;  3BPX A;  3K69 A;  4LMY A;  3ZMS A;  3K0L A;  5LLQ A;  3K1N A;  3V7C A;  1OYI A;  4EGY A;  3WTW C;  2Q2E A;  3L2C A;  1S7O A;  1I5Z A;  1XCB A;  4RGR A;  2IJL A;  5E8I A;  2XUB A;  2QM3 A;  5FGM A;  4I01 A;  2HR3 A;  3GEZ A;  1SD7 A;  1B1B A;  1D8K A;  1LDJ A;  3V8J A;  1IUY A;  4G8X A;  4MTD A;  3PFI A;  2A6H F;  5BMZ A;  6PAX A;  4I2O A;  2H6C A;  4I7H A;  3R60 A;  5F64 A;  2Z5U A;  2K4B A;  2LF8 A;  3DXJ F;  3TOB A;  4UVA A;  1KU7 A;  3IRR A;  1J5Y A;  1B4A A;  5H6R A;  3RPQ A;  3OV8 A;  1JE8 A;  2DPD A;  3WG9 A;  3GZ5 A;  3O6B B;  3QOP A;  5LEJ A;  1GVJ A;  2FU4 A;  2XAF A;  1FY7 A;  1G6N A;  1YQA A;  1W5T A;  2KIU A;  1J9I A;  2GWR A;  3E5Q A;  1F9N A;  3M7G A;  1HW1 A;  3REO A;  3VB2 A;  5E8G A;  3L00 A;  3DPL C;  4XLP F;  1TQM A;  5K5Q A;  2VOD A;  3LA7 A;  3HTS B;  3BWG A;  4FX4 A;  2ADU A;  2P5L C;  2WC2 A;  3K9T A;  1QPM A;  4D0P A;  1MDM A;  2DK5 A;  2NS0 A;  1YW8 A;  1ON2 A;  4AIJ A;  3MEX A;  1XGN A;  1J7K A; 
#chains in the Genus database with same CATH topology
 5F0C A;  4J01 A;  2E5N A;  1YJ9 I;  3BP8 A;  1TWC J;  2F5E A;  3DPU A;  5CVI A;  3ZCO A;  4XKV A;  4YIR X;  4A69 C;  1VQ6 I;  1WJB A;  1RNL A;  1GXQ A;  3GUD A;  4PZJ A;  3ROU A;  4ZDO A;  1R5I D;  2BXZ A;  2HTJ A;  2OBP A;  4HX8 A;  2VBW A;  3F6O A;  3VYR B;  2VAS A;  1U9O A;  2VOO A;  2ZME A;  2PMZ N;  1LB2 A;  5IOY A;  3SDB A;  1T95 A;  4IVN A;  2VBY A;  3I0T A;  2M3A A;  2EFW A;  1XD7 A;  3VOD A;  3BJA A;  3KLO A;  1Z7L A;  1MJ9 A;  1S5L C;  3ABL H;  4E7S A;  3LSK A;  2IA2 A;  2C6Y A;  2DI3 A;  4XLA A;  2DFE A;  2EFP A;  2XGC A;  4LOC A;  5B3S H;  1OJL A;  3S1M J;  3WG7 H;  2KZV A;  2Q8K A;  4Z6Y A;  1P2F A;  2JSP A;  2CFX A;  1Z91 A;  2IA0 A;  1OR7 A;  3K4B A;  1FNN A;  1SFE A;  2Y9Y A;  2XAU A;  2BZT A;  2LKS A;  2X6O A;  3WTV C;  3V8L A;  4IOA F;  4M6V A;  2L9S A;  2ME0 A;  1I1G A;  1WI3 A;  5JFR A;  4MQ9 F;  1BOB A;  4W97 A;  4L5E A;  1YTY A;  1CGP A;  3MZY A;  1U78 A;  1IN5 A;  2VT2 A;  5IP9 J;  2V1U A;  1IGN A;  2A6E F;  3OOU A;  1ETW A;  2LY1 A;  3JSO A;  3PO2 J;  3FXQ A;  4IHV A;  1IN6 A;  3QQA A;  2K9S A;  4CXF A;  3BT9 A;  2NRA C;  1D0Y A;  4D5F A;  3ABK H;  3BZK A;  3S32 A;  4XOT A;  4ESF A;  1D1C A;  3BG3 A;  2DCE A;  5GPC A;  1YIO A;  3KEQ A;  3HOX J;  2VLA A;  1VQN I;  4IL6 C;  1I27 A;  3CCU I;  4HPQ A;  5IT3 A;  5K7Z A;  4ZTJ A;  3HIF A;  4HV6 A;  4KIF A;  4EM0 B;  3FMR A;  2ZJP F;  4A3F J;  4L9N A;  5J1U A;  3BG9 A;  2FXA A;  3G4S I;  5HLH A;  1HXD A;  2VXD A;  4U0Y A;  1OKR A;  3GZ6 A;  3IP4 B;  3TO9 A;  2FD5 A;  4A0X A;  3FXU A;  2JWT A;  1U8R A;  2RRE A;  5E3L A;  2PJR A;  3CMY A;  1X4O A;  3Q0V A;  5DEQ A;  3NRV A;  1TNS A;  1KQ0 A;  2PN6 A;  3G3Z A;  4KMF A;  1JUP A;  2CJJ A;  1L3L A;  5F08 A;  2A3S A;  1FOW A;  3KP7 A;  5BPI A;  2W1O A;  1ZRE A;  1JUS A;  2CW0 F;  5KVR A;  3FKI J;  2LP0 A;  2LMD A;  5J4V A;  2CUE A;  3CME I;  3ZQF A;  3OS2 A;  3W6K B;  2O6G E;  3E0J B;  3S2W A;  1MD0 A;  1T33 A;  4NC8 A;  4ZJZ A;  3VWB A;  1X3W B;  4RMN A;  1XDU A;  1GXP A;  1G59 A;  3ONQ A;  5H20 A;  5FFX A;  2X1E A;  2DJI A;  2EH3 A;  2HQ5 A;  4OIN F;  3TDZ C;  2EK5 A;  4RGS A;  4CGZ A;  2AXL A;  5JVG F;  1MMG A;  4FE7 A;  3WTZ A;  4Y13 A;  5CPR B;  1VQ4 I;  2JA6 J;  3Q3S A;  1QVU A;  2EFO A;  3M1C A;  2O8X A;  3L09 A;  1W5C C;  1W0T A;  2CQN A;  1J2X A;  3WE2 A;  2A69 F;  2ZNZ A;  1NG6 A;  3IH4 A;  4KIS A;  4MTE A;  5FRN A;  4HST A;  5CJ9 A;  4M71 A;  3MKZ A;  4A93 J;  5HS8 A;  2COM A;  2ZXJ A;  5ILU A;  1GDT A;  1SVL A;  2GIZ A;  2XKO A;  4R1H A;  3U1K A;  4M6Y A;  4U0W A;  1WZ2 A;  1X2M A;  5D4R A;  4N4N B;  4N9I A;  4KIG A;  3HKZ A;  5LD2 C;  4XOR A;  1V5E A;  2BHZ A;  2L9V A;  1R5G A;  4I76 A;  4AYB A;  1V3F A;  1W36 D;  1VQM I;  1S8N A;  4KFC A;  2EFN A;  2LVS A;  2JUG A;  4Y17 A;  4XKW A;  3P5J A;  3ERE D;  1BL0 A;  2XPU A;  3ZGK A;  3PQJ A;  5J8F A;  1S6L A;  2OQG A;  5LRS A;  1W7P A;  1TQI A;  2LR8 A;  2X4H A;  2K5C A;  3OYH A;  1FPQ A;  1D5V A;  5DCM A;  3B6A A;  4HF1 A;  2OC6 A;  5BOX A;  2X6W A;  1S7E A;  2FNP A;  2LLK A;  5E1Z B;  2EZH A;  4OAY A;  5D6E A;  3MMY B;  4EJT A;  3G73 A;  2PG4 A;  1QU3 A;  4PK4 A;  1SC7 A;  1YLF A;  4RB1 A;  1B72 A;  3PIP F;  4BL0 B;  2WY7 Q;  3F8F A;  4ZDL A;  1R4N B;  4LG0 A;  5ICG A;  2PJP A;  4GCV A;  4MEX F;  5HVQ C;  3OIQ A;  1IZ1 A;  3O8H A;  4BJT A;  1VQL I;  2NYX A;  1ZG1 A;  2OCE A;  2XPW A;  5E3O A;  1RR8 C;  4LK0 F;  3ZMU A;  3CO7 C;  4S05 A;  4NHJ A;  3K2Z A;  1SEU A;  4PJ0 C;  3BTC A;  2V7F A;  5EEH A;  3ZP5 A;  1E3P A;  3ISP A;  3I58 A;  5HDG A;  3AFH A;  1K6O A;  2NVU B;  3U9G A;  2CV2 A;  2K4J A;  3LSM A;  2EIN H;  1OFC X;  2BYV E;  3HHG A;  1ETX A;  2WTE A;  3CF5 F;  3DBH B;  4CUG A;  3UNG C;  1ZR2 A;  4OMZ A;  1BJZ A;  2L9R A;  3HKZ N;  1I3A A;  1RKT A;  1V4R A;  3FXJ A;  3MKL A;  1LDD A;  4EM2 A;  3QPH A;  2HVR A;  1V5G A;  1NH3 A;  4AYB N;  4LIT A;  3EUA A;  3LNQ A;  9ANT A;  1HW5 A;  4X0G A;  4XOP A;  5LFA A;  3KZZ A;  2L0K A;  3WOD F;  2DXI A;  5AIQ A;  4CO8 A;  3K1P A;  3EYY A;  1HW2 A;  1U5T A;  1N78 A;  3FBI B;  3T8T A;  1Y8Q B;  3MKY B;  2I8D A;  4XBF A;  3WGI A;  3A03 A;  3QPL A;  2H8R A;  1ZGA A;  3ZQI A;  1IDY A;  4AC0 A;  4I6Z A;  3S1Q J;  3B73 A;  1HQC A;  2K40 A;  2Y31 A;  4I0B A;  4A5M A;  3CUQ C;  3HPG A;  3R0J A;  2ECB A;  5KK1 A;  3E7L A;  2AS5 F;  1ONV A;  2P4W A;  4E6K G;  4QLC U;  1YX5 A;  1NK2 P;  1DPU A;  1E17 A;  3PUF A;  2VBZ A;  2QF7 A;  3ZPL A;  2KJC A;  1BJA A;  1TL8 A;  2HWV A;  2OAZ A;  2GXG A;  5K1Y A;  5HDN A;  3DQV C;  3JRB A;  2VE9 A;  4IRI A;  1JTY A;  3TP3 A;  3G2B A;  3MQ0 A;  1XTA A;  4Y52 J;  2BW3 B;  1IRG A;  1F36 A;  2O03 A;  2DMP A;  1I50 J;  3NWS A;  1DP7 P;  3VSK A;  3K4J A;  1F5T A;  1FYM A;  2WV0 A;  2GOM A;  5IOZ A;  4DW6 A;  1Q1H A;  2VKE A;  2F4M B;  5JI6 A;  4PJM A;  4XKB A;  1H8A C;  4B43 A;  5DS9 A;  3TBI A;  3DPT A;  3HBL A;  4P9F A;  3TW7 A;  3A02 A;  2Z3Y A;  4U7B A;  3CCY A;  3CTA A;  1F1Z A;  3WU0 A;  1NK3 P;  1FOK A;  3ML6 A;  1VI0 A;  1P6R A;  2FOW A;  4WCG A;  4Q5S F;  2DFI A;  1QGP A;  2ELK A;  3RDI A;  1XMK A;  4ESB A;  4IJA A;  1SFU A;  2KDZ A;  3RZO J;  3ABM H;  2OJE D;  2HQA A;  3I59 B;  2XB0 X;  2H27 A;  3BTI A;  4L9T A;  2LD5 A;  2VJ5 A;  4U0V A;  4HNU A;  2E5Z A;  2G7H A;  3MVP A;  5AIP A;  4DIQ A;  1VQK I;  3EYI A;  3MZ8 A;  2AHQ A;  2KRC A;  2R92 J;  4XLH A;  2IP2 A;  3FXL A;  4LB6 B;  2ACJ A;  1TWG J;  2VKV A;  3K4C A;  2DO7 A;  3G6E I;  3RSN A;  1B6A A;  1OLT A;  2MD0 A;  5FLX Z;  5LHH A;  4I0A A;  1WPK A;  4LD5 A;  2BGC A;  4PDK A;  3PFY A;  2DA5 A;  2XF7 A;  1LFP A;  2CW7 A;  2NS8 A;  3WU1 B;  2HDD A;  1DGW Y;  3VYS B;  3A01 B;  2RKH A;  2HXI A;  4BXU A;  2LRD A;  2QLZ A;  2X51 A;  3OYB A;  3PM1 A;  3HRT A;  3JTG A;  1O7F A;  4ASN A;  2HS5 A;  1RIO H;  1G3T A;  3TQN A;  1TC3 C;  1K4T A;  1TWA J;  1O3Q A;  1YFH A;  4KIC A;  2EJR A;  2M9H A;  3PL8 A;  3FK6 A;  3E6B A;  4HEA 2;  2EV0 A;  3JRA A;  1UHS A;  3L2V A;  4X6A J;  2R93 J;  1OCR H;  2M1B A;  5LEK A;  1KU2 A;  1JXS A;  1LEA A;  2HOA A;  3HGY A;  2HDC A;  1HKS A;  2QQ9 A;  2A07 F;  2HKO A;  4G6D A;  5FO5 A;  1D1B A;  3BTJ A;  5K5R A;  4Y7N J;  5J40 A;  4BBS J;  4HSR A;  2OA4 A;  4IRG A;  3BQY A;  3GME A;  3RKW A;  5DDG A;  1BW5 A;  1BN5 A;  4ITV A;  2W4S A;  3KIO A;  1XG1 A;  4BBR J;  1P92 A;  2CG4 A;  2R7F A;  4G7H F;  3CDI A;  3CUQ B;  1H0M A;  4D5C A;  4OWR B;  4BE0 A;  2Z16 A;  2OZ6 A;  3D5L A;  2K9N A;  1S9H A;  3HL2 A;  4C3J J;  3A0H C;  2E7X A;  3TDU C;  2K3F A;  4ZC3 A;  3PJR A;  5FFZ A;  3KP5 A;  3HOS A;  4B47 A;  1KA8 A;  2CUJ A;  3JRG A;  3K6G A;  3S1N J;  3GW2 A;  4MFD A;  3FIS A;  2K02 A;  5F1R A;  4M74 A;  1FOX A;  3DU5 A;  4PGH A;  2FNA A;  2VKH A;  3CP2 A;  3CDL A;  2ETH A;  4BXF A;  1ZR4 A;  1KYZ A;  1QZY A;  3Q9S A;  1YOV B;  1GV5 A;  1PYV A;  1ZEL A;  2JPB A;  3OWT A;  1R6R A;  5HLI A;  4GXO A;  2YR2 A;  3SXY A;  5TRD A;  1XC5 A;  4V2F A;  4BY7 J;  2JA7 J;  4IO9 F;  3HJE A;  1CQT A;  1O3T A;  3ZXS A;  4FHT A;  4OIO F;  4CCM A;  2ZCW A;  1YRN B;  1IXC A;  1K78 B;  2KQR A;  2LG4 A;  4B48 A;  2CQQ A;  2FQ3 A;  3QU6 A;  4BXX J;  1ZK8 A;  1WJE A;  2XVC A;  1FP2 A;  3OYG A;  1DU6 A;  1MSF C;  2V9V A;  2VBX A;  1FP1 D;  3I9V 2;  2WAQ A;  1UMQ A;  2E7W A;  2G0E A;  2D5V A;  1Y56 A;  4BE2 A;  1Y8R B;  2FBI A;  2GA1 A;  2DOD A;  2WY8 Q;  3L2R A;  2ZFU A;  1UG0 A;  1ZTR A;  3PSI A;  1IW7 F;  1UFM A;  1JT0 A;  3RJP A;  3PO3 J;  2XGE A;  2A61 A;  1TQP A;  1X1A A;  2ZB9 A;  1YW7 A;  4KN7 X;  3J7Z I;  2LY9 A;  3WTS C;  4GDF A;  2IAI A;  2W85 A;  1FC3 A;  2ZC2 A;  1PDN C;  2HOT A;  3JTH A;  1HKT A;  4E7H A;  2IS4 A;  1K6Y A;  2K85 A;  1LFU P;  2K9Q A;  2XAH A;  3EUH C;  2LKP A;  4I09 A;  5IP6 A;  3G1L A;  1MMS A;  3N05 A;  1AKH A;  1LEB A;  1XDS A;  4RAG A;  3R6S A;  4L0Z B;  4JQF A;  2LF7 A;  3RYR A;  2GA2 A;  1LQ1 A;  2OD5 A;  2IBD A;  1K7A A;  3E6D A;  1AU7 A;  4EMS A;  1SD6 A;  1I3Q J;  4CZC A;  1BIA A;  2QCO A;  2E36 A;  1HDP A;  1E2X A;  1FJL A;  2XRO A;  1R49 A;  4G12 A;  4GGG A;  4E7L A;  2KMU A;  3MCZ A;  1MBG A;  2J5O A;  4CYD A;  1OCZ H;  2HU9 A;  2UUZ A;  5L3G A;  2FBK A;  1QZE A;  1WI9 A;  4HDV A;  1MBH A;  2EZL A;  3OYA A;  3T5X A;  4PGG A;  4XLC A;  5F27 A;  1A31 A;  1IRF A;  4AIK A;  1DQU A;  1GLN A;  1LE8 B;  3CZ6 A;  3UKG A;  5C3E J;  4BY1 J;  1DDN A;  2M8G X;  5ICF A;  1BI1 A;  3D1N I;  4QSH A;  3FWE A;  3FXK A;  2HYG D;  3QOE A;  3J7Y J;  4HNV A;  2LC2 A;  3LSI A;  3FMS A;  1ZRD A;  5J3L A;  1VND A;  3QYB A;  4NNJ A;  4QWQ A;  3CLQ A;  2EIJ H;  3KZY A;  4KYW A;  2FOK A;  3LOC A;  1X2N A;  1X58 A;  2XDV A;  5GTH C;  3GF2 A;  2YU3 A;  1U2W A;  3FBN B;  1ODD A;  2E1O A;  1Y1V J;  2R7S A;  2H94 A;  3K1M A;  2X1D A;  1R23 A;  1ZAO A;  4MHG A;  2M5W A;  4Q48 A;  2IA1 A;  2HPM A;  1MSE C;  2WAQ N;  3OSF A;  3V7R A;  1UAA A;  2W82 A;  5KNL A;  4LIV A;  1EKE A;  4KIB A;  4CZZ A;  1B9M A;  2KZG A;  1BI0 A;  1JT6 A;  2RNG A;  3ZMD A;  1MJB A;  4DYC A;  1YHQ I;  2Y0M A;  4D7N A;  5F1J A;  2HOE A;  5D5W B;  1ETQ A;  4WK8 F;  3GVA A;  2V6C A;  2VJJ A;  1YIT I;  1FIA A;  1IO2 A;  2DT7 B;  3QYE A;  1L0O C;  1BA5 A;  3IHU A;  4WWC A;  1MMA A;  5DM6 F;  1FX7 A;  3F8C A;  3F23 A;  3C18 A;  2CS3 A;  1TWH J;  3BG7 A;  4EJO A;  4ENN A;  4R79 A;  2XF5 A;  3HHH A;  5L3E A;  4CYC A;  1MJA A;  1PUF B;  1XSX A;  1D8J A;  2D2W A;  3VOE A;  3F22 A;  1WJC A;  2M8E A;  4XLN F;  2QBY B;  3OYC A;  3JRC A;  3C7J A;  4IEJ A;  1JKP C;  1IRX A;  4F52 A;  3T0Y A;  2JA8 J;  5DUK A;  4KT5 C;  5J1Y A;  1I1S A;  2F4O B;  1TW3 A;  3TGN A;  2QGU A;  5D5V B;  4MIM A;  5DCF A;  2HYF A;  3TED A;  3FXO A;  3HDD A;  3KPH A;  3S2D J;  3BZ6 A;  2O8K A;  5LGU A;  4FX0 A;  3IL2 A;  2WAE A;  5FKO A;  2UZK A;  2W57 A;  3RTR A;  3G1M A;  2DTZ A;  4P96 A;  1IAW A;  5DYM A;  4RLQ A;  5H6Q A;  3GFI A;  3ASO H;  2HQR A;  4PSW A;  1BOA A;  2OPT A;  3L2W A;  2FJ1 A;  3V7S A;  4ETS A;  4UB8 C;  3LFK A;  2Z9O A;  4P5O A;  3PNY A;  1QQI A;  2B7E A;  2X1C A;  5FKK A;  2MC4 A;  2GXB A;  3ZQ7 A;  2DQR A;  1WWX A;  2DT6 A;  2ESH A;  3EDP A;  1DU0 A;  4HX7 A;  3CO6 C;  2R4G A;  2VON A;  4IPA A;  1T2K A;  3LQR A;  4A3J J;  1VFC A;  1TWF J;  3P9C A;  2Y2Z A;  4I99 C;  2RC4 A;  2Q0O A;  2WAF A;  3K2A A;  5CQG A;  2XSD C;  4IF4 A;  3LL7 A;  2G9W A;  2LBF B;  1ZRF A;  2ZKZ A;  1LPQ A;  4BU2 A;  5GTI C;  3IC7 A;  3SEQ A;  4XRS A;  2QQA A;  2V1X A;  5BS6 A;  1UJ8 A;  4UUS A;  1YW9 A;  1MW7 A;  3JRD A;  4FAS D;  3I56 I;  3BR6 A;  2TRT A;  4AUX A;  3L7W A;  2D45 A;  3DKY A;  1AHD P;  5DTD A;  1XMA A;  3Q5F A;  4EJU A;  4NQW B;  2L9N A;  5F0H A;  1RPW A;  2L7Z A;  3BJ6 A;  2X6X A;  4HA8 A;  2EFQ A;  3ZMZ A;  5L3C A;  3LSP A;  1W1W E;  4RB2 C;  2P7V B;  1Y0U A;  3VYU B;  1U8B A;  2FRH A;  2N8G A;  1FBQ A;  2JN6 A;  4A6D A;  4S04 A;  2E19 A;  1ZG5 A;  1HOM A;  3ECO A;  1W4M A;  3F8B A;  3I64 A;  3U2R A;  2KJB A;  4BE1 A;  1T0F C;  3O3K A;  1R4M B;  4BAC A;  4H0E A;  2A5W A;  1SMT A;  4LLN A;  2CQ7 A;  3BC8 A;  2VL8 A;  2PBI A;  2EB7 A;  4G7Z F;  3WTU C;  1Z21 A;  4RGX A;  1GV2 A;  1AWC A;  3M4O J;  2FSW A;  3HYI A;  3TKY A;  3DWL E;  1W5S A;  3K4L A;  3QWL A;  3RYP A;  2QWW A;  1P7J A;  2X6Y A;  3CQZ J;  1ACI A;  4NDL A;  2STW A;  2FA5 A;  3U1D A;  4AVZ A;  2Q2E B;  3DBL B;  3MAJ A;  1LVK A;  1IUF A;  2P8T A;  3C2H A;  3OL3 A;  2E35 A;  4MNU A;  3GTL J;  1O4X A;  2L02 A;  3I3L A;  5ICE A;  1FYL A;  2X48 A;  4RM2 A;  4A5N A;  3ZQH A;  3OSG A;  2NOJ B;  1JKR C;  4UV8 A;  1G3W A;  5EF6 A;  1JI8 A;  1IN7 A;  3LMM A;  1JKQ C;  3GO5 A;  4NC6 A;  2BXY A;  2DOE A;  1K79 A;  3KYD B;  1UZC A;  3VFZ A;  3A01 A;  5B5E C;  3WHB A;  1N25 A;  2DAO A;  1FSH A;  2VPL A;  1SFK A;  2I5U A;  3T1B A;  1Z0X A;  3V4G A;  4Q4Z F;  1Z05 A;  4XNF A;  3GFL A;  3KP2 A;  2JVH A;  4ZZL A;  1G2H A;  2ZME C;  2R5Z B;  1UST A;  3K7A J;  3DP7 A;  5GP9 A;  2E1M C;  2F48 A;  5KAI C;  2BBY A;  2LRE A;  2TDX A;  2YSR A;  4UHT A;  2QSH X;  1VQ9 I;  3BY6 A;  3DV8 A;  1QO0 D;  2EA4 A;  2R0Q C;  1H89 C;  5EZH A;  2XKP A;  1ENH A;  2NNY A;  3BG5 A;  2DU9 A;  2L2O A;  3CJT B;  5GPA A;  1AOY A;  5L3D A;  1WHU A;  5CVU A;  2LYC A;  3H0D A;  3PUB A;  5DD4 A;  1ULY A;  2WBM A;  1PP8 F;  1UEL B;  5EGO A;  5C4X J;  3DLL F;  5EG0 B;  3MD2 A;  4AWX B;  1USS A;  5LHI A;  4RAZ A;  2R7U A;  2XSJ C;  1KQ8 A;  2QZ8 A;  5ERI A;  3WTY C;  1O3S A;  4OMY A;  5EDN A;  4A3D J;  3V8K A;  1EH7 A;  3CUQ A;  2VUM J;  3JAM Z;  3RKX A;  4YFN F;  3HOZ J;  2YPR A;  3A2K A;  1IDZ A;  1YG2 A;  4YFK F;  1TT5 B;  2ZSI B;  1V54 H;  4BHC A;  4MLO A;  5C44 J;  4PSX A;  3GX4 X;  2JA2 A;  3HOW J;  4WXD A;  3W2W A;  4M9Z A;  2BHY A;  2DQL A;  2KP6 A;  2HZD A;  1HST A;  1H9T A;  1BIB A;  4G6Q A;  4ON0 A;  2MGQ A;  1T6S A;  5FJ8 J;  3S3M A;  2CV0 A;  4BNC A;  5E20 A;  2OU2 A;  4CHU A;  1GT0 C;  4M73 A;  3RQI A;  2KRF A;  4UY8 I;  1EH6 A;  2V79 A;  3GLX A;  1MZB A;  2W24 A;  4PJJ A;  1M1E B;  2OF7 A;  5IT9 Z;  3G1O A;  3P9K A;  3S17 J;  2M0C A;  3FKJ A;  4BQA A;  3SYT A;  5ILV A;  3ZQG A;  3OYK A;  3TO7 A;  2EV6 A;  3H3U A;  2H6B A;  5L3F A;  4L5I A;  1BC8 C;  1YIJ I;  2STT A;  3RPU D;  3E6C C;  3Q0U A;  2R7Z J;  1QZZ A;  4BAY A;  3OYN A;  2QKL B;  3BCB A;  4RGU A;  4XMY A;  4HQE A;  1K78 A;  2YU9 J;  3W2A A;  2VC0 A;  3H3V K;  2MH9 A;  2KIQ A;  1X3U A;  4B3X A;  4B44 A;  3JRF A;  3HG9 A;  1RET A;  3O2P E;  3ZN0 A;  4EQQ A;  4EV0 A;  1OMI A;  1ZGW A;  1FTT A;  1IN8 A;  1BR2 A;  1TT0 A;  2JMW A;  2E2H J;  2QSG X;  4N4O B;  5E17 F;  1YE9 A;  2ZO4 A;  2F2E A;  2NNN A;  2EZK A;  3LFU A;  1VQ7 I;  1VQO I;  2CFO A;  1XMX A;  4MFE A;  1D3Y A;  1RUN A;  2EA2 A;  4ANJ A;  3KCC A;  1XSD A;  2AO9 A;  4BEH B;  5CVV A;  1JJ6 C;  1UHM A;  1SAU A;  3B6C A;  3SZG A;  2QEN A;  4JBA A;  3TW6 A;  3IUO A;  2NOG A;  1O57 A;  2D1V A;  4PFO A;  5DD8 A;  2V9P A;  4QIW N;  3ULQ B;  2PX9 A;  4P55 A;  1XB4 A;  5GAD J;  1I6H J;  2DYR H;  4MEY F;  3EET A;  4C3I J;  1SMY F;  3ZR8 X;  2ZME B;  5ILS A;  2P6T A;  3C1D A;  3CC7 I;  2NVY J;  2E1M B;  2J5P A;  2O61 A;  3ZMV A;  3B02 A;  3W6J B;  2DBB A;  3KP3 A;  4L18 B;  2RGV A;  3H36 A;  4WXH A;  3RKY A;  4D1Q A;  2EV5 A;  3HM5 A;  2CW8 A;  3PQK A;  1O7L A;  2UV1 A;  5J4Y A;  1FTZ A;  4XK4 A;  5E1X A;  2RQQ A;  1SAX A;  1Y0N A;  1GHC A;  4UXN A;  4DNC A;  3M8E A;  1XN7 A;  1KU9 A;  3J81 Z;  3S1R J;  1EA3 A;  2LTP A;  4PFP A;  3AG4 H;  4F55 A;  3J80 Z;  3KEY A;  1IC8 A;  3IAS 2;  4ZDP A;  1GUU A;  1F4K A;  3HSR A;  5EJC A;  5J47 A;  3LSH A;  1O3R A;  4Y3O A;  2JRT A;  2BV6 A;  4BHP A;  1ZYR F;  1IN4 A;  2BY3 A;  4XR6 A;  1WSU A;  1G8X A;  2CRG A;  4RB3 C;  4CCO A;  2VJ4 A;  3W3C A;  3D5S C;  3RI4 A;  3BR0 A;  4PUS A;  3H35 A;  1ZN2 A;  3F21 A;  1LFB A;  2Y0S A;  1R5H A;  1OYW A;  4B8X A;  2O9L A;  2F6C A;  2MG4 A;  2IPQ X;  1N75 A;  1VZ0 A;  1LNW A;  3CCL I;  5ICC A;  2LDU A;  1VQ5 I;  2KRH A;  3GYH X;  1X3Z B;  1J09 A;  2W00 A;  3I71 A;  4QPO A;  1ON1 A;  5HS7 A;  2IGO A;  3BTL A;  1OQY A;  5FLX K;  2VQG A;  1EF4 A;  1ZRC A;  3OYJ A;  1KGS A;  3ASN H;  4HG2 A;  3FXR A;  1WVR A;  1YO5 C;  3I4N J;  1WRJ A;  2PJR B;  3FMQ A;  4UNO A;  2V1D A;  4JP0 A;  3ZN1 A;  4HNT A;  3L2U A;  3F0C A;  1MNM C;  2KLO A;  1HBX G;  4ESJ A;  2F4I A;  4LGW A;  1JTX A;  2NVQ J;  3HRS A;  4B09 A;  4HF0 A;  2OZU A;  4RAF A;  2CYY A;  2P0W A;  3F8M A;  4U88 A;  3MFK A;  1NHA A;  2V1N A;  3ZQC A;  2MBF A;  2HQN A;  2M45 A;  3F72 A;  4RB0 A;  4HDU A;  1PUF A;  3DFG A;  4XID A;  4A3L J;  2QBY A;  3JRI A;  2RAE A;  4P9U A;  4IHW A;  3S15 J;  1B9N A;  4GFB A;  3F3X A;  1OCC H;  3S93 A;  2P5K A;  2FBH A;  3WU2 C;  4KDP A;  5EZG A;  2DOF A;  3K70 C;  4U87 A;  1A6I A;  1U5T C;  1WH5 A;  5A2Q Z;  2KIS A;  4KUM A;  2R7D A;  2JT1 A;  4O5V A;  3DCF A;  3CCM I;  2IS1 A;  3EUH A;  1MIJ A;  2G7U A;  3LSJ A;  1KYW A;  3IKT A;  3LAJ A;  2IGK A;  1P4W A;  1SAN A;  4HW0 A;  2FQ4 A;  2CUF A;  3VEP A;  1YJW I;  4HF2 A;  4KT6 A;  1TZL A;  2PMU A;  4E7I A;  2GBY A;  2CQK A;  2Z2S B;  3NEU A;  3JRE A;  2Y0S N;  4ZYE A;  3PNT A;  5CVJ A;  3CMM A;  3V42 A;  5J8C A;  4H4K C;  3QU3 A;  4C30 A;  1PUE E;  3EPZ A;  2E2J J;  1HKQ A;  1U0J A;  3FXM A;  3OYM A;  4PCQ A;  4FT8 A;  3AL0 C;  1ETV A;  2ZSH B;  5E3M A;  2DYS H;  1QRY A;  3C3W A;  4RAY A;  3H92 A;  3IWF A;  3R61 A;  5E79 C;  4M9X A;  4IHY A;  2XB5 A;  1Z77 A;  3RCO A;  4KMU X;  2EBI A;  5DCM B;  2CU7 A;  2EIL H;  4FET A;  3TOA A;  2GQQ A;  3FX3 A;  1YS6 A;  4RA2 A;  2LBF A;  5KHD A;  4KIT B;  2CMP A;  1J75 A;  2W84 A;  3HUG B;  1MBF A;  3H9Q A;  2HEO A;  3LA3 A;  1WQ2 A;  2MFZ A;  4YFX F;  2VIX A;  2VT3 A;  1XCV A;  3DEU A;  4IXA A;  4QPQ A;  1X19 A;  3HSE A;  4DBQ A;  4LG0 B;  3HRU A;  1WJA A;  3O8G A;  3CF2 A;  3CES A;  4MO7 A;  2VXZ A;  2XAQ A;  5HNH A;  2P7C B;  1WGX A;  3QAH A;  5LBQ A;  3AAF A;  1QHH D;  2DT5 A;  2O5R A;  2W25 A;  1EH8 A;  2O3F A;  5HS9 A;  3QP6 A;  1W7P D;  5K7F A;  3R0A A;  5F0F A;  1K4S A;  1NTC A;  3ZRG A;  4C2T A;  3WGH A;  2JVG A;  1R1U A;  2X9D A;  1ORK A;  3OYF A;  5IY5 H;  1ZGJ A;  3H1C A;  3H5R A;  1X1B A;  1BI3 A;  4WF2 A;  3QPS A;  4HQM A;  3TO6 A;  1R22 A;  5BNG A;  2IVM A;  3COA C;  4JOM A;  3I55 I;  2MH2 A;  2Y75 A;  2JK3 A;  4M3G A;  4TV7 A;  5D8L B;  4Y15 A;  4B4C A;  2HTS A;  4XL9 A;  1IXR C;  3S8P A;  2JTV A;  2HVS A;  4IHS A;  4ENM A;  3M8F A;  3BJO A;  2LOO A;  2R7O A;  1AA7 A;  3OS0 A;  3GTP J;  3VDX A;  3WGG A;  4BUP A;  4BGD A;  2JJ7 A;  5CQE A;  1A5J A;  1SVO A;  4DYR A;  2W48 A;  3ESW B;  3MKW B;  4ABZ A;  3W6V A;  1YX3 A;  2RDP A;  4ZYG A;  2F5F A;  5TIS C;  4OIQ F;  1LUJ B;  3JSP A;  1XGO A;  2ID3 A;  3DKX A;  3D0S A;  3GTJ J;  1JHF A;  4EEF G;  4V19 K;  2CQX A;  1OCP A;  2UXX A;  1U5T B;  3WE3 A;  3DKW A;  3OIO A;  1FLI A;  4YIF A;  2M34 A;  2AQE A;  2F5C A;  3LAP A;  5JLX A;  1CF7 B;  2E2I J;  4ZH4 F;  2OTJ I;  1Y1W J;  4WX9 A;  1X4P A;  3H9G A;  1IG7 A;  2DDB A;  3IWZ A;  1OYY A;  3KLN A;  1POG A;  2CWE A;  4HRI A;  1IXS B;  4NBQ A;  4IQJ A;  4FIS A;  3CLO A;  5B1B H;  4HOB A;  2RNJ A;  5CVR A;  1FSE A;  2EQR A;  2ICW G;  4DJA A;  1MKM A;  2CUZ A;  4X1E A;  4A6E A;  3BDD A;  1R71 A;  5J6X A;  5EG0 A;  3AL0 B;  1MMN A;  3BRO A;  2GM4 A;  1Z6T A;  3FF5 A;  4O6J A;  2D1H A;  4IQ4 A;  2BY1 A;  3K70 D;  3I5U A;  1JGS A;  5TGT A;  4CDG A;  1R36 A;  5D6F A;  5LRR A;  4BJ6 C;  4RBO A;  2K9M A;  2QEX I;  4A3C J;  4EVI A;  1TP4 A;  3ELK A;  4LK1 F;  4CIC A;  1KZH A;  4WXC A;  1HCR A;  4A0Z A;  2XGD A;  2ISZ A;  3BR3 A;  3RPU A;  3KEO A;  1B8I B;  2MYS A;  2Z99 A;  1BW6 A;  2DPU A;  4L5J A;  3A1Y A;  4YG2 F;  4XSZ F;  3N4M A;  2CV1 A;  2QQ8 A;  2VN2 A;  3A0B C;  2ECC A;  2IXS A;  3LQQ A;  4KNY A;  1J59 A;  4DQ2 A;  2XAG A;  3C2B A;  5BQT A;  2MLG A;  3OYI A;  3GLL A;  4AD9 A;  1BM9 A;  4E4H A;  4BHB A;  1E3H A;  1XGS A;  3LSG A;  3GFJ A;  4ZYH A;  3H0G J;  2PEX A;  4Q47 A;  2DFF A;  5TJJ A;  3T8R A;  2RV8 A;  1OPC A;  4ENK A;  4ZTF A;  1H9G A;  3VSL A;  2HI3 A;  3WTX C;  3QPT A;  2DDA A;  2WB1 A;  1W0U A;  2R7W A;  3WHC A;  4PJL A;  4CSW A;  1T0F A;  3DF8 A;  2LSO A;  2M4G A;  2XGX A;  1IF1 A;  2ELJ A;  4G9Y A;  4LJZ F;  2PLY A;  4IOC F;  1FBS A;  4II3 A;  2DA2 A;  3DLA A;  3KFW X;  3S3N A;  1Z6R A;  1HSJ A;  4G6T B;  4N0B A;  1DP3 A;  5AON A;  1YI2 I;  2ESN A;  5FLM J;  1D0X A;  2W7N A;  2LY2 A;  5HOO A;  5D5U B;  4DZJ A;  1GVD A;  1E3O C;  2KKO A;  4CH7 A;  3FK7 A;  1H88 C;  2XPV A;  4D9J A;  4D7M A;  1BI2 A;  4EGZ A;  1RUO A;  1S3J A;  3GFM A;  1HA8 A;  4BEH A;  1ZQ3 P;  4CCJ A;  2FML A;  4W1U A;  3LSR A;  1EJ9 A;  5HNF A;  4E70 A;  2L7K A;  2R7R A;  5DV5 A;  1QPI A;  1HF0 A;  3I54 A;  4M3D A;  2F5V A;  1OCO H;  3K4K A;  3EQL F;  4UVB A;  2M4K A;  4LB5 A;  5F6F A;  1ETK A;  3S3O A;  2MLK A;  4XLF A;  1MND A;  2K3P A;  1ITY A;  2NVX J;  3F8N A;  5EEA A;  2L54 A;  4BDY A;  3H5N A;  1ZHF A;  1SVM A;  4IHT A;  5F04 A;  1UB9 A;  2QQB A;  4LFU A;  2KPM A;  1ZAR A;  4HBL A;  4AVP A;  2EPF A;  3E5X A;  5JHU A;  2R7Q A;  5LGN A;  1REP C;  2VE8 A;  2R7V A;  1B59 A;  3GTO J;  2VC1 A;  3ABT A;  5D8K B;  3CCR I;  4AID A;  3F6V A;  4JX6 A;  3KP6 A;  2ZNY A;  2RN7 A;  3RKQ A;  2XAS A;  4F91 B;  4XM3 A;  5FD6 A;  4YEL A;  1Z9C A;  3BOQ A;  2A5Y B;  5J1R A;  3OYE A;  2LKX A;  1IRZ A;  1EV7 A;  3HTU A;  4DZP A;  2BW3 A;  4IKF A;  1IV8 A;  3KYL A;  1UCR A;  4UV9 A;  1JHH A;  4OIR F;  1BR1 A;  1T8I A;  3GTM J;  1J0R A;  4M72 A;  3SFI A;  3HOV J;  3OYD A;  1QNT A;  1RC9 A;  1SFX A;  1Z3Y A;  2MC3 A;  4FTH A;  2E1C A;  4M9S A;  2WB1 N;  4I02 A;  3VPR A;  4O3M A;  4AIH A;  2UWM A;  1TBX A;  2ZXW H;  2IW5 A;  2VQC A;  1WFX A;  4HLY A;  3S16 J;  2VOP A;  3BQZ A;  1G3Y A;  4MQV A;  3GWZ A;  2CO5 A;  1BBY A;  1P4X A;  2MD5 A;  4R8H A;  2DA4 A;  3SHF A;  2BEO A;  4G94 A;  3OOP A;  3CCV I;  3PIO F;  1V5F A;  3I59 A;  1FYK A;  2IS2 A;  2LK2 A;  5HDK A;  2L4M A;  5KCM A;  2FMY A;  1BC7 C;  1X1D A;  4KA4 A;  3FIW A;  5IYC J;  5D4S A;  1A35 A;  4UVC A;  3M3Y J;  4XSX F;  3Q0W A;  5JR3 A;  1RKW A;  2I10 A;  2HZT A;  3SQN A;  1NG7 A;  2ZJQ F;  3I4P A;  1DPR A;  3GCM A;  2H1L A;  2XHK A;  3BCA A;  2ELH A;  2DMT A;  2PFB A;  1ZG3 A;  2DMN A;  4FCY A;  3FHN A;  3OMY A;  4FQG A;  1IJW C;  1WJF A;  4EJW A;  2O0Y A;  3OR2 C;  2V26 A;  2M2E A;  2FX0 A;  1S29 A;  3F9K A;  4OU0 A;  5EEG A;  2VQL A;  2X0L A;  1AKH B;  2A05 A;  1FMV A;  1FT9 A;  3CC4 I;  2XC7 A;  3ERM A;  4N9H A;  1S72 I;  5B1A H;  5FLV A;  1TW2 A;  4ZYA A;  3CDH A;  4M3B A;  4IZZ A;  4L9V A;  5IPA A;  2L01 A;  3BLY A;  2KIM A;  1RZ4 A;  2A6T A;  2YX7 A;  4JK1 X;  2DJN A;  4LLL A;  1RRJ A;  3DTI A;  5E18 F;  1OR7 C;  3QOD A;  1ETY A;  2DFH A;  5GAH J;  4V2G A;  3JCU C;  2ID6 A;  3JW4 A;  1MH3 A;  3RQ4 A;  3ECH A;  1FBU A;  1WJD A;  3HSF A;  2COB A;  3SJM A;  2KT0 A;  4HV5 A;  5FD5 A;  3I4M J;  1KQ9 A;  4XON A;  1VTN C;  2JA5 J;  3BG6 A;  2EWN A;  3JAM K;  3AG3 H;  1KON A;  4HAM A;  1R58 A;  2DA3 A;  4RLF A;  3PNV A;  2R5Y B;  5ED4 A;  2NVT J;  1Z7U A;  2VKD A;  1P4A A;  3HB9 A;  3IRQ A;  4NC7 A;  2B0L A;  2FE3 A;  4JX4 A;  3ABU A;  1RES A;  2VPR A;  1PVE A;  4LLG F;  2QVO A;  4NUB A;  3E6M A;  3ZMT A;  1STZ A;  2QKM B;  3BR1 A;  3QP5 A;  1T38 A;  3L2Q A;  3SZP A;  2P6S A;  2IS6 A;  1LJ9 A;  1XSV A;  1Z67 A;  2LH9 A;  2RVC A;  1D1A A;  5IT9 K;  3E5U A;  1YS7 A;  2HPI A;  5C4J J;  3FM3 A;  5JVT A;  2DA1 A;  4MGR A;  2IT0 A;  1UG2 A;  3CD6 I;  2DMU A;  3BPV A;  3CJR B;  3U21 A;  4ZZD A;  3LA2 A;  3HUG A;  3SZT A;  3P9I A;  4EM1 A;  2MA3 A;  2PI0 A;  1FOY A;  1ZKG A;  3FZV A;  2WV1 A;  3SEZ A;  4CA0 A;  3HEF A;  5EYR A;  1HLV A;  3K4N A;  1WCM J;  3CCE I;  1HDD C;  2ZFW A;  2L7F P;  1T39 A;  1SFO J;  3KYC B;  3E97 A;  2ZBK A;  1UHW A;  1R00 A;  3HRM A;  3OR1 C;  1YRN A;  2FUG 2;  2Y69 H;  1MMD A;  3A4C A;  3S14 J;  4XIC A;  4BDZ A;  1MDM B;  2NXN B;  4KN4 X;  3CUO A;  1T98 A;  1A04 A;  3X2Q H;  2JUC A;  4QTR A;  2R3S A;  1ETO A;  2M87 A;  2JPC A;  4JYK A;  2B63 J;  1WJ5 A;  5M3M J;  5HLT A;  4CYC B;  2JZY A;  4PJN A;  1P9Q C;  1S7A A;  2HNH A;  1XPX A;  3TL4 X;  2PMH A;  1ZH5 A;  3CC2 I;  2AXT C;  3BR2 A;  5JLW A;  1BR4 A;  4OAZ A;  2L3D A;  1TTY A;  3LWF A;  3P7N A;  2GXA A;  5LHG A;  2OQR A;  3OIP A;  3NAR A;  2F5D A;  2DA6 A;  5K7H A;  4RDU A;  3KX2 A;  3QYF A;  3RIR A;  1XGM A;  1Y6I A;  1A36 A;  2BE5 F;  3LST A;  1KU3 A;  2XV4 S;  4BS9 A;  5H2F C;  2XRL A;  2Q1Z B;  5IYB J;  5FKN A;  2BY0 A;  2CH0 A;  1FWZ A;  4A0Y A;  1ZLK A;  2YX4 A;  2FF4 A;  5K5O A;  4XN3 A;  2R7T A;  3J81 K;  4U7D A;  3J80 K;  3MWM A;  2EIK H;  1Y39 A;  2M30 A;  4Y4R A;  3K4M A;  3S2H J;  1K61 A;  4E7K A;  3FM5 A;  4M6X A;  3MZH A;  5GAE J;  3J7A O;  2YS9 A;  1FIP A;  2PQ8 A;  1CF7 A;  4EAT A;  4C2M J;  4C3H J;  3Q9V A;  1C0W A;  2K9L A;  2A68 F;  3DBR B;  1LE8 A;  2L5Q A;  1JKO C;  1MBJ A;  2FEZ A;  2H8W A;  4E7Z A;  2KFD A;  1PJR A;  4F92 B;  2BVL A;  3JRH A;  5FRM A;  2IGM A;  2DLL A;  5HLG A;  4DBR A;  2XRN A;  2E1N A;  2H09 A;  3EUK L;  4ZYD A;  3M1E A;  1I6X A;  2V4J C;  3NQO A;  5FB2 A;  3E3V A;  4OIP F;  4GYI A;  1ERD A;  2DTR A;  1E0E A;  1R1T A;  1RI7 A;  4BH9 A;  4IHX A;  2CSO A;  4UUS B;  4Y33 A;  5KAF C;  2JQ7 A;  1WKM A;  4IX7 A;  4C9Y A;  5E1W A;  2EIM H;  3DEW A;  3PSF A;  2E34 A;  2AQF A;  2K27 A;  2B9S A;  1QBJ A;  5D5X B;  3ZOB A;  4RS8 A;  4CCL A;  2OTL I;  3FHZ A;  4M3E A;  2HYJ A;  2ISY A;  3BZC A;  4A3G J;  4HZF A;  2GAU A;  4I98 B;  4F7Z A;  3HOU J;  4KJZ A;  2K7L A;  1QVT A;  1SD4 A;  3HOT A;  3I53 A;  3IKV A;  1B8I A;  3KE2 A;  3G71 I;  4L0Y B;  5L3B A;  5HOD A;  4YII A;  4HYE A;  1F43 A;  2QYO A;  2BOL A;  1QHG A;  4HLX A;  2Y30 A;  4NB5 A;  3E1S A;  2DK8 A;  4BQQ A;  1MNE A;  3CMA I;  2JSC A;  2IEK A;  1DUX C;  1T56 A;  3OL4 A;  4XLE A;  2DA7 A;  2P5V A;  3HXL A;  1X1P A;  4OOI A;  4A3M J;  2HGC A;  2Y48 A;  3GTQ J;  4UUT A;  1APL C;  3GXO A;  4B3A A;  3VYT B;  5DUI A;  2K86 A;  4BKX A;  4GYG A;  3ZQQ A;  5A2Q K;  5CLS A;  3KET A;  1JUM A;  2KIF A;  3MN2 A;  3W2V A;  3KP4 A;  4UUV A;  2HKX A;  2HFH A;  5M3F J;  2WWY A;  1Z3X A;  5E3N A;  4BYY A;  3AG2 H;  4J00 A;  2IRF G;  3UR3 C;  1MBE A;  1RR7 A;  4LIU A;  1FEX A;  4F93 B;  3IH2 A;  4K2E A;  4XRS G;  5M5W J;  4IRH A;  4LG3 A;  3ZQL A;  1D5Y A;  4XRF A;  4YEJ A;  1TLH B;  1G4D A;  1PP7 U;  1ZLJ A;  2MSY A;  1R7J A;  4HX4 A;  2LNB A;  5CYV A;  4Z2Y A;  2NAZ A;  1YYV A;  1U6G A;  5LGT A;  4GO1 A;  1T08 B;  1JJ8 C;  5IYD J;  3J7A Y;  1LDK B;  4G7O F;  5IP7 J;  4A3B J;  3NAU A;  4UB6 C;  4ENJ A;  5EGO B;  1K83 J;  2OUM A;  1TNT A;  2V6E A;  2ZJ2 A;  2DW4 A;  2BVM A;  2E60 A;  4EJV A;  2CGP A;  3D5R C;  4JX5 A;  4J19 A;  1W7P B;  3H3Z A;  4L9J A;  2GZW A;  3HOY J;  2QSF X;  2QUF A;  1G3S A;  2XAJ A;  3AKZ A;  3R4K A;  5M5X J;  4F3Q A;  2OCC H;  2KL4 A;  2L4A A;  2Z1D A;  1MGT A;  1LVA A;  1Z1D A;  2M0M A;  2BY2 A;  4CCK A;  3C2G A;  4XQF A;  4A12 A;  2RQP A;  1B72 B;  1FZP B;  4CCN A;  2ZJR F;  3GTG J;  3DTE A;  3CJN A;  2DN0 A;  5DM7 F;  4RM3 A;  4NQW A;  3CCJ I;  5FKL A;  1N77 A;  3L9F A;  4DYQ A;  2KDO A;  1SD5 A;  2XIG A;  1MH4 A;  3M9A A;  2EZI A;  2Y9Z A;  4A2U A;  3KZI C;  2GIV A;  1X1C A;  4YRV A;  4A3K J;  1A6Q A;  2Z33 A;  1D0Z A;  1U3E M;  1JGG A;  5BPD A;  2HVQ A;  3WTT C;  3OS1 A;  1R1V A;  3QRF F;  5FRO A;  3SDG A;  3SFZ A;  3N97 A;  4P1W A;  3CJQ B;  3IAM 2;  3M8J A;  2O7O A;  2UXN A;  3BPX A;  1U9N A;  2WA0 A;  3FDY A;  3K69 A;  3IH3 A;  4LMY A;  3TMO A;  3TP0 A;  3ZMS A;  1HC8 A;  3K0L A;  2QA4 I;  5LLQ A;  3K1N A;  3V7C A;  1OYI A;  3M07 A;  1WH7 A;  4EGY A;  1XX5 A;  4XKC A;  1VQP I;  5CKT A;  3WTW C;  2Q2E A;  3L2C A;  1S7O A;  4BQN A;  2GLO A;  1R9T J;  1FMW A;  4S0H B;  1I5Z A;  2X85 A;  1XCB A;  2MAB A;  2IJL A;  4RGR A;  5E8I A;  2XUB A;  2QM3 A;  5FGM A;  5M5Y J;  2OV7 A;  1VQ8 I;  2R7X A;  4I01 A;  2HR3 A;  3GEZ A;  1XS9 A;  3H9J A;  1SD7 A;  1B1B A;  1D8K A;  3H5A A;  1LDJ A;  3OYL A;  2E71 A;  3V8J A;  2R5Z A;  4BJ5 C;  4A3E J;  1IUY A;  4G8X A;  4MTD A;  1QA6 A;  3DEE A;  2WAD A;  3PFI A;  2A6H F;  5BMZ A;  6PAX A;  4I2O A;  2VQH A;  4DGW B;  2H6C A;  4I7H A;  3R60 A;  4M3F A;  5JHF A;  5F64 A;  2Z5U A;  2YUS A;  2ZXI A;  2K4B A;  2JRM A;  3GTK J;  1VF9 A;  2LF8 A;  1P7I A;  1DGR M;  3DXJ F;  3TOB A;  4UVA A;  1KU7 A;  1LKX A;  3IRR A;  1J5Y A;  2KHM A;  3AG1 H;  1B4A A;  5H6R A;  3RPQ A;  4AM3 A;  3OV8 A;  1JE8 A;  3HC7 A;  2DPD A;  2R5Y A;  2NS7 A;  2ME6 A;  3WG9 A;  3GZ5 A;  3O6B B;  3QOP A;  1OIS A;  2PMZ A;  2H1K A;  5LEJ A;  3CCQ I;  1I39 A;  1GVJ A;  2FU4 A;  3HPH A;  5GAG J;  3JR9 A;  3CCS I;  2V9K A;  2XAF A;  4B1R A;  1FY7 A;  1G6N A;  2DOA A;  1YQA A;  2TCT A;  2P81 A;  1W5T A;  3IV5 A;  2KIU A;  1J9I A;  3HZJ A;  2GWR A;  1YJN I;  3K10 A;  3E5Q A;  3CP8 A;  1F9N A;  3M7G A;  2DMQ A;  1HW1 A;  3REO A;  3VB2 A;  2IGN A;  2LFB A;  5E8G A;  3L00 A;  3HGG A;  2HDW A;  2ZXH A;  3NWT A;  3DPL C;  3BR5 A;  2HXO A;  4XN0 A;  4DOZ A;  5B66 C;  4XLP F;  1MBK A;  1TQM A;  1OCT C;  5K5Q A;  5FKM A;  3GZN B;  2VOD A;  3LA7 A;  2VI6 A;  3HTS B;  3BWG A;  4FX4 A;  2ADU A;  2P5L C;  1IV6 A;  2GOX B;  4BQO A;  2WC2 A;  3K9T A;  1QPM A;  3DU6 A;  3RZD J;  1Q1V A;  2HOS A;  2M7A A;  2VB6 A;  4D0P A;  1MDM A;  2MW8 A;  2DK5 A;  2NS0 A;  4E7J A;  3L1P A;  2M7B A;  2VJI A;  1YW8 A;  2XF6 A;  4AU7 A;  4GRI A;  1ON2 A;  2L7M P;  4FE4 A;  4XRM A;  1V55 H;  3OY9 A;  4II2 A;  4AIJ A;  3MEX A;  1XGN A;  3DTK A;  1W36 C;  1J7K A;  4C2U A;  3GBG A;  4A3I J; 
#chains in the Genus database with same CATH homology
 3BP8 A;  2F5E A;  5CVI A;  1RNL A;  1GXQ A;  3GUD A;  4PZJ A;  3ROU A;  2OBP A;  2HTJ A;  4HX8 A;  2VBW A;  3F6O A;  2VOO A;  2ZME A;  1LB2 A;  4IVN A;  2VBY A;  3I0T A;  2EFW A;  1XD7 A;  3VOD A;  3BJA A;  3KLO A;  1MJ9 A;  2IA2 A;  2C6Y A;  2DI3 A;  2EFP A;  2Q8K A;  1P2F A;  2CFX A;  1Z91 A;  2IA0 A;  1OR7 A;  1FNN A;  1SFE A;  3WTV C;  3V8L A;  1I1G A;  5JFR A;  4MQ9 F;  1YTY A;  1CGP A;  3MZY A;  1U78 A;  1IN5 A;  2VT2 A;  2V1U A;  2A6E F;  3JSO A;  3FXQ A;  1IN6 A;  4CXF A;  2NRA C;  4ESF A;  1YIO A;  3KEQ A;  1I27 A;  5IT3 A;  3HIF A;  4HV6 A;  4KIF A;  4EM0 B;  3FMR A;  4L9N A;  2FXA A;  5HLH A;  1HXD A;  4U0Y A;  1OKR A;  3GZ6 A;  3TO9 A;  4A0X A;  3FXU A;  1U8R A;  5DEQ A;  3NRV A;  1TNS A;  1KQ0 A;  2PN6 A;  3G3Z A;  4KMF A;  1L3L A;  2A3S A;  3KP7 A;  5BPI A;  1ZRE A;  2CW0 F;  5KVR A;  3W6K B;  2O6G E;  3S2W A;  1MD0 A;  1XDU A;  1GXP A;  5H20 A;  5FFX A;  4OIN F;  3TDZ C;  2EK5 A;  4RGS A;  4CGZ A;  2AXL A;  3WTZ A;  4Y13 A;  2EFO A;  2O8X A;  3L09 A;  1J2X A;  3WE2 A;  2A69 F;  2ZNZ A;  4MTE A;  5CJ9 A;  4M71 A;  5HS8 A;  2COM A;  2ZXJ A;  5ILU A;  2XKO A;  4R1H A;  4M6Y A;  4U0W A;  5D4R A;  4N9I A;  4KIG A;  1R5G A;  1V3F A;  1S8N A;  4KFC A;  2EFN A;  4Y17 A;  3ERE D;  3PQJ A;  5J8F A;  1S6L A;  2OQG A;  5LRS A;  1W7P A;  1TQI A;  2X4H A;  1FPQ A;  1D5V A;  5DCM A;  4HF1 A;  5BOX A;  2FNP A;  5E1Z B;  5D6E A;  4EJT A;  3G73 A;  2PG4 A;  1YLF A;  4RB1 A;  3F8F A;  4LG0 A;  5ICG A;  2PJP A;  4GCV A;  4MEX F;  5HVQ C;  1IZ1 A;  2NYX A;  1ZG1 A;  4LK0 F;  3ZMU A;  3CO7 C;  4S05 A;  4NHJ A;  3K2Z A;  5EEH A;  3ZP5 A;  3ISP A;  3I58 A;  5HDG A;  1K6O A;  3U9G A;  2K4J A;  2BYV E;  3HHG A;  2WTE A;  4OMZ A;  1V4R A;  1LDD A;  4EM2 A;  3QPH A;  1HW5 A;  3KZZ A;  3WOD F;  5AIQ A;  4CO8 A;  3K1P A;  3EYY A;  1HW2 A;  1U5T A;  3T8T A;  4XBF A;  3WGI A;  1ZGA A;  3B73 A;  1HQC A;  4A5M A;  4I0B A;  3CUQ C;  3R0J A;  5KK1 A;  2AS5 F;  1ONV A;  2P4W A;  1DPU A;  4QLC U;  1E17 A;  2VBZ A;  3ZPL A;  2KJC A;  1BJA A;  2HWV A;  2OAZ A;  2GXG A;  5K1Y A;  5HDN A;  3DQV C;  2VE9 A;  4IRI A;  3MQ0 A;  1IRG A;  2O03 A;  1DP7 P;  1F5T A;  1FYM A;  2WV0 A;  1Q1H A;  5JI6 A;  3DPT A;  4P9F A;  2Z3Y A;  4U7B A;  3CTA A;  1F1Z A;  3WU0 A;  1FOK A;  3ML6 A;  1P6R A;  4WCG A;  4Q5S F;  2DFI A;  1QGP A;  3RDI A;  1SFU A;  1XMK A;  4ESB A;  4IJA A;  3I59 B;  2H27 A;  4L9T A;  4U0V A;  2G7H A;  5AIP A;  3EYI A;  2IP2 A;  4LB6 B;  2ACJ A;  2DO7 A;  1B6A A;  5FLX Z;  5LHH A;  4I0A A;  4LD5 A;  2BGC A;  4PDK A;  3WU1 B;  2RKH A;  4BXU A;  2QLZ A;  3HRT A;  3JTG A;  1O7F A;  4ASN A;  2HS5 A;  1RIO H;  1G3T A;  3TQN A;  1O3Q A;  1YFH A;  4KIC A;  2EJR A;  3E6B A;  2EV0 A;  2M1B A;  5LEK A;  1KU2 A;  1JXS A;  1LEA A;  2HDC A;  1HKS A;  2QQ9 A;  2A07 F;  2HKO A;  4G6D A;  5FO5 A;  5K5R A;  2OA4 A;  4IRG A;  3RKW A;  5DDG A;  1BN5 A;  1P92 A;  2CG4 A;  2R7F A;  4G7H F;  3CUQ B;  1H0M A;  2OZ6 A;  3D5L A;  2E7X A;  3TDU C;  5FFZ A;  3KP5 A;  3HOS A;  1KA8 A;  3GW2 A;  2K02 A;  5F1R A;  4M74 A;  4PGH A;  2FNA A;  2ETH A;  1KYZ A;  1QZY A;  3Q9S A;  2JPB A;  5HLI A;  4GXO A;  2YR2 A;  3SXY A;  5TRD A;  1O3T A;  4FHT A;  4OIO F;  2ZCW A;  1IXC A;  1K78 B;  2FQ3 A;  3QU6 A;  2XVC A;  1FP2 A;  2V9V A;  2VBX A;  1FP1 D;  2E7W A;  2FBI A;  2GA1 A;  1IW7 F;  1UFM A;  3RJP A;  2A61 A;  1TQP A;  4KN7 X;  1YW7 A;  3WTS C;  2W85 A;  1FC3 A;  1PDN C;  3JTH A;  1HKT A;  2XAH A;  2LKP A;  4I09 A;  1LEB A;  1XDS A;  3R6S A;  4L0Z B;  4JQF A;  2LF7 A;  3RYR A;  2GA2 A;  1LQ1 A;  2OD5 A;  1K7A A;  3E6D A;  4EMS A;  1SD6 A;  1BIA A;  1E2X A;  2XRO A;  4GGG A;  3MCZ A;  2J5O A;  4CYD A;  5L3G A;  2FBK A;  1WI9 A;  4HDV A;  3T5X A;  4PGG A;  1IRF A;  4AIK A;  1DDN A;  5ICF A;  1BI1 A;  3FWE A;  2HYG D;  3FMS A;  1ZRD A;  4QWQ A;  3KZY A;  4KYW A;  2FOK A;  3GF2 A;  2YU3 A;  1U2W A;  1ODD A;  2H94 A;  3K1M A;  1R23 A;  1ZAO A;  4MHG A;  2M5W A;  4Q48 A;  2IA1 A;  3V7R A;  4CZZ A;  4KIB A;  1B9M A;  1BI0 A;  3ZMD A;  1MJB A;  2Y0M A;  2HOE A;  5D5W B;  4WK8 F;  3GVA A;  2V6C A;  1L0O C;  3IHU A;  4WWC A;  1FX7 A;  3F8C A;  3F23 A;  3C18 A;  4EJO A;  4ENN A;  4R79 A;  3HHH A;  5L3E A;  1MJA A;  1XSX A;  1D8J A;  3F22 A;  2D2W A;  3VOE A;  2M8E A;  4XLN F;  2QBY B;  3C7J A;  3T0Y A;  5DUK A;  4KT5 C;  1I1S A;  3TGN A;  1TW3 A;  5D5V B;  5DCF A;  2HYF A;  3BZ6 A;  5LGU A;  4FX0 A;  3IL2 A;  2UZK A;  2W57 A;  3RTR A;  4P96 A;  1IAW A;  5DYM A;  5H6Q A;  3GFI A;  2HQR A;  1BOA A;  3V7S A;  4ETS A;  3LFK A;  2Z9O A;  4P5O A;  1QQI A;  2GXB A;  3ZQ7 A;  2DQR A;  1WWX A;  2ESH A;  3EDP A;  4HX7 A;  3CO6 C;  2VON A;  4IPA A;  1T2K A;  3LQR A;  3P9C A;  2RC4 A;  2Q0O A;  4IF4 A;  2G9W A;  1ZRF A;  2ZKZ A;  3IC7 A;  2QQA A;  2V1X A;  5BS6 A;  1YW9 A;  3L7W A;  2D45 A;  1XMA A;  3Q5F A;  4EJU A;  3BJ6 A;  4HA8 A;  3ZMZ A;  2EFQ A;  5L3C A;  4RB2 C;  2P7V B;  1Y0U A;  2FRH A;  1FBQ A;  4A6D A;  4S04 A;  1ZG5 A;  3ECO A;  1W4M A;  3F8B A;  3I64 A;  3U2R A;  2KJB A;  3O3K A;  4H0E A;  4LLN A;  1SMT A;  2PBI A;  2EB7 A;  4G7Z F;  3WTU C;  4RGX A;  1AWC A;  2FSW A;  3HYI A;  3TKY A;  1W5S A;  3RYP A;  2QWW A;  2STW A;  2FA5 A;  3U1D A;  3MAJ A;  2P8T A;  4MNU A;  2L02 A;  5ICE A;  1FYL A;  4A5N A;  4UV8 A;  1G3W A;  1IN7 A;  3GO5 A;  1K79 A;  3VFZ A;  2DAO A;  1FSH A;  3T1B A;  4Q4Z F;  3V4G A;  1Z05 A;  3GFL A;  3KP2 A;  4ZZL A;  1UST A;  3DP7 A;  2BBY A;  2YSR A;  2TDX A;  4UHT A;  3BY6 A;  3DV8 A;  1QO0 D;  2EA4 A;  2XKP A;  2NNY A;  2DU9 A;  1AOY A;  5L3D A;  5CVU A;  5DD4 A;  1ULY A;  1PP8 F;  4AWX B;  1USS A;  5LHI A;  4RAZ A;  1KQ8 A;  2QZ8 A;  5ERI A;  3WTY C;  1O3S A;  4OMY A;  3V8K A;  1EH7 A;  3CUQ A;  3JAM Z;  3RKX A;  4YFN F;  2YPR A;  1YG2 A;  4YFK F;  4BHC A;  3GX4 X;  4WXD A;  4M9Z A;  2DQL A;  1HST A;  1H9T A;  1BIB A;  4G6Q A;  4ON0 A;  1T6S A;  4CHU A;  4BNC A;  5E20 A;  2OU2 A;  4M73 A;  2KRF A;  1EH6 A;  2V79 A;  3GLX A;  1MZB A;  2W24 A;  5IT9 Z;  3P9K A;  4BQA A;  5ILV A;  3TO7 A;  2EV6 A;  3H3U A;  2H6B A;  5L3F A;  4L5I A;  1BC8 C;  2STT A;  3E6C C;  1QZZ A;  4BAY A;  4RGU A;  4HQE A;  1K78 A;  2VC0 A;  2MH9 A;  1X3U A;  4EQQ A;  3O2P E;  3ZN0 A;  4EV0 A;  1OMI A;  1IN8 A;  5E17 F;  2ZO4 A;  2F2E A;  2NNN A;  1D3Y A;  1RUN A;  2EA2 A;  3KCC A;  1XSD A;  5CVV A;  1UHM A;  2QEN A;  4JBA A;  1O57 A;  2D1V A;  5DD8 A;  3ULQ B;  4P55 A;  1XB4 A;  4MEY F;  3EET A;  1SMY F;  2ZME B;  5ILS A;  2P6T A;  3C1D A;  2J5P A;  2O61 A;  3ZMV A;  3B02 A;  3W6J B;  2DBB A;  3KP3 A;  4L18 B;  2RGV A;  4WXH A;  3RKY A;  2EV5 A;  3PQK A;  1O7L A;  5E1X A;  1SAX A;  1GHC A;  4UXN A;  4DNC A;  3M8E A;  1XN7 A;  1KU9 A;  3J81 Z;  3J80 Z;  1F4K A;  3HSR A;  1O3R A;  2JRT A;  2BV6 A;  4BHP A;  1ZYR F;  1IN4 A;  1WSU A;  4RB3 C;  3RI4 A;  1ZN2 A;  3F21 A;  1R5H A;  1OYW A;  4B8X A;  2IPQ X;  1LNW A;  5ICC A;  2LDU A;  3GYH X;  3I71 A;  1ON1 A;  5HS7 A;  5FLX K;  1ZRC A;  1KGS A;  3FXR A;  1YO5 C;  1WRJ A;  3FMQ A;  4UNO A;  2V1D A;  3ZN1 A;  1HBX G;  4ESJ A;  4LGW A;  3HRS A;  4B09 A;  4HF0 A;  2OZU A;  2CYY A;  3F8M A;  4U88 A;  3MFK A;  1NHA A;  2MBF A;  2HQN A;  2M45 A;  3F72 A;  4RB0 A;  4HDU A;  3DFG A;  2QBY A;  4P9U A;  1B9N A;  3F3X A;  2P5K A;  2FBH A;  4KDP A;  1U5T C;  5A2Q Z;  4KUM A;  2R7D A;  2JT1 A;  4O5V A;  3EUH A;  2G7U A;  1KYW A;  3IKT A;  3LAJ A;  1P4W A;  4HW0 A;  3VEP A;  4HF2 A;  2PMU A;  2CQK A;  3NEU A;  4ZYE A;  5CVJ A;  5J8C A;  3QU3 A;  1PUE E;  1HKQ A;  4PCQ A;  4FT8 A;  3C3W A;  4RAY A;  3H92 A;  3IWF A;  3R61 A;  4M9X A;  4KMU X;  5DCM B;  3TOA A;  2GQQ A;  3FX3 A;  1YS6 A;  1J75 A;  2W84 A;  2HEO A;  3LA3 A;  1WQ2 A;  4YFX F;  2VT3 A;  1XCV A;  3DEU A;  4IXA A;  4LG0 B;  3HSE A;  3HRU A;  2VXZ A;  2XAQ A;  2P7C B;  3QAH A;  5LBQ A;  3AAF A;  2DT5 A;  2W25 A;  1EH8 A;  2O3F A;  5HS9 A;  3QP6 A;  1W7P D;  3R0A A;  3WGH A;  1R1U A;  1ZGJ A;  4WF2 A;  1BI3 A;  4HQM A;  3TO6 A;  1R22 A;  2IVM A;  3COA C;  2MH2 A;  2Y75 A;  4TV7 A;  5D8L B;  4Y15 A;  2HTS A;  1IXR C;  2JTV A;  4IHS A;  4ENM A;  3M8F A;  3BJO A;  3WGG A;  2RDP A;  4ZYG A;  2F5F A;  4OIQ F;  3JSP A;  1XGO A;  3D0S A;  1JHF A;  2UXX A;  1U5T B;  3WE3 A;  3DKW A;  1FLI A;  4YIF A;  2F5C A;  3LAP A;  1CF7 B;  4ZH4 F;  4WX9 A;  3IWZ A;  3KLN A;  1OYY A;  2CWE A;  1IXS B;  3CLO A;  4HOB A;  2RNJ A;  5CVR A;  1FSE A;  1MKM A;  4A6E A;  3BDD A;  5J6X A;  3BRO A;  1Z6T A;  3FF5 A;  4O6J A;  2D1H A;  3I5U A;  1JGS A;  4CDG A;  1R36 A;  5D6F A;  5LRR A;  4EVI A;  3ELK A;  4LK1 F;  4CIC A;  4WXC A;  4A0Z A;  2ISZ A;  3RPU A;  3KEO A;  2Z99 A;  2DPU A;  4L5J A;  4YG2 F;  4XSZ F;  3N4M A;  2VN2 A;  3LQQ A;  4KNY A;  1J59 A;  4DQ2 A;  2XAG A;  5BQT A;  2MLG A;  4AD9 A;  1BM9 A;  4BHB A;  1XGS A;  3GFJ A;  4ZYH A;  2PEX A;  4Q47 A;  5TJJ A;  3T8R A;  2RV8 A;  1OPC A;  4ENK A;  1H9G A;  3WTX C;  3QPT A;  1T0F A;  3DF8 A;  2LSO A;  2XGX A;  1IF1 A;  4G9Y A;  4LJZ F;  2PLY A;  1FBS A;  3KFW X;  1Z6R A;  1HSJ A;  4N0B A;  5AON A;  2ESN A;  5HOO A;  5D5U B;  2KKO A;  1BI2 A;  4EGZ A;  1RUO A;  1S3J A;  3GFM A;  2FML A;  4E70 A;  5DV5 A;  3I54 A;  3EQL F;  4UVB A;  4LB5 A;  5F6F A;  2MLK A;  3F8N A;  2L54 A;  1ZHF A;  4IHT A;  1UB9 A;  2QQB A;  4LFU A;  1ZAR A;  4HBL A;  4AVP A;  3E5X A;  5JHU A;  5LGN A;  1REP C;  2VE8 A;  1B59 A;  2VC1 A;  3ABT A;  5D8K B;  3F6V A;  3KP6 A;  2ZNY A;  2RN7 A;  2XAS A;  5FD6 A;  1Z9C A;  3BOQ A;  2A5Y B;  1EV7 A;  3HTU A;  1UCR A;  4UV9 A;  1JHH A;  4OIR F;  1J0R A;  4M72 A;  1QNT A;  1SFX A;  2MC3 A;  2E1C A;  4M9S A;  4I02 A;  4O3M A;  4AIH A;  2UWM A;  1TBX A;  2IW5 A;  4HLY A;  2VOP A;  1G3Y A;  4MQV A;  3GWZ A;  2CO5 A;  1BBY A;  1P4X A;  2MD5 A;  4R8H A;  3SHF A;  2BEO A;  4G94 A;  3OOP A;  3I59 A;  1FYK A;  5HDK A;  2L4M A;  2FMY A;  1BC7 C;  4KA4 A;  5D4S A;  4UVC A;  4XSX F;  5JR3 A;  2HZT A;  3SQN A;  3I4P A;  1DPR A;  2XHK A;  2ELH A;  2PFB A;  1ZG3 A;  4EJW A;  2O0Y A;  1S29 A;  4OU0 A;  5EEG A;  2X0L A;  1FT9 A;  4N9H A;  1TW2 A;  3CDH A;  4L9V A;  2L01 A;  2KIM A;  1RZ4 A;  2YX7 A;  4JK1 X;  4LLL A;  5E18 F;  3JW4 A;  3ECH A;  1FBU A;  3HSF A;  4HV5 A;  5FD5 A;  1KQ9 A;  1VTN C;  3JAM K;  2EWN A;  4HAM A;  1R58 A;  5ED4 A;  1Z7U A;  1P4A A;  3IRQ A;  2B0L A;  2FE3 A;  3ABU A;  4LLG F;  2QVO A;  3E6M A;  3ZMT A;  1STZ A;  3QP5 A;  1T38 A;  3SZP A;  2P6S A;  1LJ9 A;  1XSV A;  2RVC A;  5IT9 K;  3E5U A;  1YS7 A;  3FM3 A;  5JVT A;  4MGR A;  2IT0 A;  3BPV A;  4ZZD A;  3LA2 A;  3HUG A;  3SZT A;  3P9I A;  4EM1 A;  2MA3 A;  2PI0 A;  3FZV A;  2ZFW A;  1T39 A;  3E97 A;  2ZBK A;  1UHW A;  1R00 A;  3HRM A;  1MDM B;  4KN4 X;  3CUO A;  1T98 A;  1A04 A;  2R3S A;  2M87 A;  2JPC A;  2JZY A;  1S7A A;  2PMH A;  1ZH5 A;  2L3D A;  1TTY A;  3LWF A;  3P7N A;  5LHG A;  2OQR A;  2F5D A;  3RIR A;  1XGM A;  2BE5 F;  3LST A;  1KU3 A;  2XV4 S;  1FWZ A;  4A0Y A;  1ZLK A;  2YX4 A;  2FF4 A;  5K5O A;  3J81 K;  4U7D A;  3J80 K;  3MWM A;  2M30 A;  3FM5 A;  4M6X A;  3MZH A;  3J7A O;  2PQ8 A;  1CF7 A;  3Q9V A;  1C0W A;  2A68 F;  2FEZ A;  2DLL A;  5HLG A;  2XRN A;  2E1N A;  2H09 A;  4ZYD A;  3M1E A;  1I6X A;  3NQO A;  5FB2 A;  3E3V A;  4OIP F;  4GYI A;  2DTR A;  1R1T A;  1RI7 A;  4BH9 A;  2CSO A;  1WKM A;  5E1W A;  2K27 A;  1QBJ A;  5D5X B;  4RS8 A;  3FHZ A;  2ISY A;  4HZF A;  2GAU A;  4I98 B;  4F7Z A;  2K7L A;  1SD4 A;  3HOT A;  3I53 A;  3IKV A;  3KE2 A;  4L0Y B;  5L3B A;  4YII A;  4HYE A;  2QYO A;  4HLX A;  4NB5 A;  2DK8 A;  2JSC A;  1DUX C;  2P5V A;  4OOI A;  2HGC A;  2Y48 A;  3GXO A;  5DUI A;  2K86 A;  4GYG A;  5A2Q K;  5CLS A;  3KET A;  2KIF A;  3KP4 A;  4UUV A;  2HKX A;  2HFH A;  2WWY A;  4BYY A;  2IRF G;  4K2E A;  4IRH A;  4XRF A;  1TLH B;  1G4D A;  1PP7 U;  1ZLJ A;  1R7J A;  4HX4 A;  2LNB A;  5CYV A;  4Z2Y A;  2NAZ A;  1YYV A;  1U6G A;  5LGT A;  4GO1 A;  1LDK B;  4G7O F;  4ENJ A;  1TNT A;  2ZJ2 A;  2DW4 A;  4EJV A;  2CGP A;  1W7P B;  3H3Z A;  4L9J A;  2GZW A;  2QUF A;  1G3S A;  2XAJ A;  3R4K A;  2L4A A;  1MGT A;  1LVA A;  1Z1D A;  4A12 A;  2RQP A;  1FZP B;  3CJN A;  4NQW A;  3L9F A;  1SD5 A;  2XIG A;  3M9A A;  4A2U A;  2GIV A;  2Z33 A;  1U3E M;  5BPD A;  3WTT C;  1R1V A;  3QRF F;  3SFZ A;  3N97 A;  2UXN A;  3BPX A;  3K69 A;  4LMY A;  3ZMS A;  3K0L A;  5LLQ A;  3K1N A;  3V7C A;  1OYI A;  4EGY A;  3WTW C;  2Q2E A;  3L2C A;  1S7O A;  1I5Z A;  1XCB A;  4RGR A;  2IJL A;  5E8I A;  2XUB A;  2QM3 A;  5FGM A;  4I01 A;  2HR3 A;  3GEZ A;  1SD7 A;  1B1B A;  1D8K A;  1LDJ A;  3V8J A;  1IUY A;  4G8X A;  4MTD A;  3PFI A;  2A6H F;  5BMZ A;  6PAX A;  4I2O A;  2H6C A;  4I7H A;  3R60 A;  5F64 A;  2Z5U A;  2K4B A;  2LF8 A;  3DXJ F;  3TOB A;  4UVA A;  1KU7 A;  3IRR A;  1J5Y A;  1B4A A;  5H6R A;  3RPQ A;  3OV8 A;  1JE8 A;  2DPD A;  3WG9 A;  3GZ5 A;  3O6B B;  3QOP A;  5LEJ A;  1GVJ A;  2FU4 A;  2XAF A;  1FY7 A;  1G6N A;  1YQA A;  1W5T A;  2KIU A;  1J9I A;  2GWR A;  3E5Q A;  1F9N A;  3M7G A;  1HW1 A;  3REO A;  3VB2 A;  5E8G A;  3L00 A;  3DPL C;  4XLP F;  1TQM A;  5K5Q A;  2VOD A;  3LA7 A;  3HTS B;  3BWG A;  4FX4 A;  2ADU A;  2P5L C;  2WC2 A;  3K9T A;  1QPM A;  4D0P A;  1MDM A;  2DK5 A;  2NS0 A;  1YW8 A;  1ON2 A;  4AIJ A;  3MEX A;  1XGN A;  1J7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...