2K27A

Solution structure of human pax8 paired box domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
159
Chain Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax-8
publication title The Solution Structure of DNA-free Pax-8 Paired Box Domain Accounts for Redox Regulation of Transcriptional Activity in the Pax Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 27
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A02
5LGTA 3E6DA 2NAZA 2O8XA 1R1UA 4JQFA 3HHGA 2HKOA 4G8XA 4YG2F 1KQ0A 2RDPA 2FNPA 1D8KA 5LHIA 3C18A 2NNYA 3HHHA 2GXGA 4DNCA 4CO8A 2XRNA 1DPRA 4P5OA 2L01A 5BMZA 4BNCA 3E6MA 2OD5A 4L9JA 2QBYB 4M6XA 3CUOA 3FM5A 3TOBA 1WRJA 4U7DA 2JTVA 1QPMA 3U2RA 2CG4A 2PFBA 4M9SA 3T8TA 1B59A 4LGWA 4WK8F 4Y13A 1IXSB 2QWWA 2UXXA 3ZMZA 2IW5A 6PAXA 1NHAA 4LJZF 1MD0A 5E18F 4KT5C 5TRDA 2HYGD 2FXAA 1O3TA 4B09A 2ADUA 1R1TA 2VOOA 3T1BA 3V7RA 1RZ4A 1RUOA 3JAMZ 3WTZA 1L3LA 3ECOA 5D8LB 3I64A 1Z1DA 1W7PD 4GXOA 3C3WA 2QENA 4CGZA 2HQRA 2RQPA 3T0YA 3T8RA 2IA0A 4EGYA 5DCMA 5E8GA 5ILVA 1X3UA 3TO6A 2HKXA 2QLZA 2HQNA 4R1HA 1FYKA 3FHZA 2FA5A 3J7AO 2OQGA 3J80K 3WTVC 4ZZLA 3M8EA 1Z7UA 5EEGA 3O2PE 2ACJA 2V1UA 2Y0MA 3C1DA 3K0LA 3JSOA 4U0WA 3HOSA 4KIFA 4ZYDA 2PLYA 1IXRC 3VODA 2E1NA 5D5UB 2ZCWA 1ZRCA 2HEOA 2J5OA 2YX7A 1P4WA 3EYIA 1O3SA 4UVCA 3WTSC 1IN4A 1J75A 5J6XA 4RAYA 3E6BA 5TJJA 1MDMA 2XGXA 3T5XA 2K4JA 1SFEA 4UUVA 2LKPA 4AWXB 4ETSA 2GWRA 2KIUA 5K5RA 4KMUX 1HBXG 1H9TA 2ELHA 2A07F 4G7ZF 4RGXA 2YR2A 4N9IA 1EH6A 5FGMA 1U2WA 1R7JA 5L3BA 2M5WA 4BHCA 1LDJA 2QYOA 1HW1A 1QZZA 1MGTA 2DU9A 2M30A 3TDZC 4HQMA 1XGOA 4RB0A 3I4PA 3F6OA 2FQ3A 1T0FA 4IRGA 2DQRA 2VE8A 1BBYA 4EJTA 1RNLA 3LFKA 3K69A 4U7BA 4HF2A 1XSVA 4UVAA 2O6GE 2HFHA 3P7NA 1JE8A 2OZ6A 4KN7X 1DDNA 1WQ2A 5FD5A 2FU4A 2QUFA 2RVCA 3NEUA 3BY6A 2KJCA 1O7FA 2JZYA 2YU3A 4GO1A 5JI6A 4IVNA 2VC1A 2IVMA 2MH9A 5KK1A 3P9KA 2YPRA 1Z6RA 1OYWA 4HDVA 1YG2A 4LD5A 5E20A 3R4KA 2VT3A 4ZH4F 1D3YA 1GVJA 2OA4A 4EJWA 3SFZA 3BOQA 3TO9A 4DQ2A 4Y17A 2HTSA 1TBXA 4HBLA 3E5UA 2Y48A 1ZREA 1OPCA 2GA1A 2O03A 3KEQA 4ZYHA 1ZN2A 2NRAC 3MQ0A 1SD6A 4FX0A 1ON2A 1TNSA 1G4DA 1BI3A 5BOXA 2STTA 4MGRA 4OIQF 1XMAA 3F8BA 5D5VB 2NS0A 1IN7A 3TKYA 2XAHA 4IXAA 5DD4A 2HWVA 3GW2A 4I0BA 3LAPA 5CVJA 3ZN0A 2IRFG 3J80Z 5HDKA 1C0WA 3F21A 1Y0UA 1ONVA 2MD5A 5D4RA 5DEQA 3I54A 1EH8A 1FT9A 1P92A 4HX7A 5DCMB 4BHBA 1HKTA 4FHTA 1R5HA 1ZYRF 3M8FA 2Q8KA 1XD7A 1LVAA 1XCVA 1U5TA 4RGRA 4FX4A 2WWYA 4YFXF 2FMLA 1JHHA 1FC3A 1LDDA 3KEOA 5LEKA 4WF2A 4UVBA 1IRGA 5A2QK 4G6DA 2XHKA 1P4XA 1U78A 5HS9A 1HSTA 1B1BA 2PBIA 2HS5A 4XRFA 2RN7A 3TDUC 2Z9OA 2A3SA 4RB2C 3PFIA 1ODDA 1XGSA 2XKPA 4MNUA 4BHPA 1HSJA 4N0BA 5D6EA 1LDKB 2ZFWA 1Z9CA 3HYIA 1MDMB 2GIVA 2A69F 4P96A 3KZZA 3V4GA 2Z5UA 5K5QA 1FP2A 3RYRA 1IRFA 3BZ6A 4ENKA 1XSDA 5K5OA 2VODA 3K1NA 4ENMA 3ZN1A 5LLQA 2J5PA 2KIFA 5D5WB 2DK5A 4LG0A 3L09A 4ZYEA 1H9GA 2ISZA 1TTYA 4BQAA 2EFWA 3O3KA 4L9NA 1XGNA 5AIPA 3IHUA 3K9TA 3V8KA 2ZMEA 5HLIA 4R8HA 3WTTC 2RNJA 1A04A 3F3XA 4E70A 4EVIA 2GAUA 4WXCA 2A61A 2QM3A 2B0LA 5DV5A 2DI3A 1RIOH 3S2WA 3IKVA 1T38A 3MFKA 4N9HA 3E5QA 1FWZA 4CDGA 5HDGA 2L3DA 3WTYC 1I1GA 2CFXA 3IKTA 3CLOA 3BPXA 2VOPA 1G3TA 1KU2A 3KZYA 3CUQA 3D5LA 4M71A 2ZKZA 2R3SA 5L3EA 5LEJA 1BN5A 3WTXC 4NHJA 2KJBA 4XSXF 3E3VA 3JW4A 5CYVA 4S05A 5F1RA 5ICCA 2BYVE 3ML6A 4ESBA 3HRSA 1U3EM 2EFQA 1O57A 1KGSA 2IJLA 3GUDA 2E7XA 2V1XA 2P7VB 5HDNA 4MEXF 4RAZA 3Q5FA 3J81K 5FFXA 3FM3A 3DP7A 2OU2A 4L5IA 1K78A 2W85A 5BPDA 4KMFA 3WU1B 4L18B 1KA8A 4CHUA 4QLCU 5BQTA 2JPCA 4D0PA 2LSOA 5ICEA 1E2XA 5A2QZ 4B8XA 2FBKA 3B02A 1BJAA 3U1DA 2XAJA 4ASNA 3IRQA 4A6DA 1DPUA 2JRTA 1D8JA 3ULQB 1FLIA 2PMHA 3SHFA 1EH7A 1U5TB 2VT2A 1K79A 2DBBA 2M1BA 5LRRA 4A0XA 1ZG3A 2EV0A 3F72A 5KVRA 3QOPA 5HLGA 5HLHA 1FX7A 4GYGA 2DPDA 2Z33A 3RJPA 4Y15A 3QAHA 3DQVC 5H6QA 2E1CA 1VTNC 4KDPA 1E17A 1QBJA 2NNNA 2ZNYA 1QO0D 4WX9A 2O0YA 2P4WA 3FWEA 3LA2A 5LRSA 1T39A 4L0ZB 3LQQA 3FMQA 2AXLA 2G7HA 4I01A 4RGSA 2EV6A 2IPQX 3WU0A 2CWEA 4A0YA 3HSFA 2HYFA 4MQVA 5JFRA 2P7CB 4IHSA 4CICA 1F1ZA 1G3SA 3R60A 4LG0B 5JVTA 3WTWC 1G3WA 2V1DA 3QPTA 4G6QA 2GQQA 3I5UA 2FOKA 4MEYF 1FOKA 3FF5A 2OAZA 2ZMEB 1F9NA 3WGHA 1MZBA 2DPUA 2JSCA 1S7AA 1WI9A 3R0JA 2PMUA 2XAGA 3FXUA 2MLKA 1SD7A 2H6CA 2W24A 5J8CA 1BIBA 2QVOA 1FZPB 4M9ZA 2FBHA 2HZTA 2DAOA 2LF8A 2F5CA 2EFOA 2DT5A 1MJ9A 5L3FA 3RPQA 1HW2A 2CSOA 1ON1A 5LHGA 1TQMA 2BV6A 3ABUA 3BROA 2EB7A 1LQ1A 3CUQB 4HA8A 3MAJA 1USTA 2ETHA 1ZLJA 4CYDA 4EM0B 1BOAA 2F5EA 1MKMA 2YX4A 2QZ8A 2V6CA 3B73A 4CZZA 2KIMA 5L3GA 4WXDA 3KP6A 1K7AA 4O3MA 2CQKA 2L4MA 1RUNA 3J81Z 4OOIA 2FNAA 3GFIA 4HLYA 1P4AA 1BC7C 3K1MA 1REPC 3SQNA 4RB3C 4UV9A 3CTAA 5AONA 4M9XA 2CW0F 3QP5A 3EUHA 1TLHB 3F8NA 1B9MA 3KFWX 5CJ9A 4P9FA 4M74A 3HIFA 1F4KA 1K78B 1R23A 3FMRA 2DTRA 5E1XA 1U6GA 3I71A 4EM2A 4OIPF 1YLFA 2F2EA 2HTJA 3L9FA 4F7ZA 1HKSA 1O3QA 2E7WA 3TOAA 1QNTA 1FBUA 1R00A 5CVIA 5FFZA 1IN5A 2P6SA 3BJAA 4UXNA 3RIRA 4AD9A 2BBYA 4G94A 1HXDA 1W7PA 1STZA 2VBZA 3F8CA 1ZH5A 4LK1F 2FBIA 3TO7A 2OQRA 3EETA 2GZWA 4U88A 3WTUC 3LAJA 4EV0A 2DO7A 3FXQA 4I98B 4HZFA 4NB5A 3RI4A 1CGPA 1O7LA 1LEAA 1Z91A 4KIGA 3CDHA 5J8FA 2BGCA 4LB5A 2EFNA 2XROA 1MJBA 3DXJF 1ZAOA 1GXPA 4WWCA 3Q9VA 3HUGA 2P6TA 1F5TA 2LF7A 4IHTA 2PG4A 1ZRDA 4G7HF 1FBQA 1Q1HA 1TQPA 2M45A 5H20A 4PCQA 4QWQA 4A6EA 4HQEA 2P5LC 5DD8A 4G7OF 4A5MA 3ERED 1KYZA 4LFUA 3HRTA 3HOTA 3CJNA 1OMIA 3K2ZA 1LJ9A 2R7FA 3PQKA 2DQLA 2EK5A 3G3ZA 4PGGA 1K6OA 3F22A 3M1EA 2O3FA 2XASA 4L9VA 1HQCA 3IC7A 1FPQA 2HGCA 2WTEA 1J59A 1JXSA 3GVAA 3BPVA 4HV6A 2XUBA 1R36A 2P5KA 3BP8A 2HR3A 3GX4X 1JHFA 4RGUA 2L54A 1CF7A 1KQ8A 4JK1X 4S04A 4Q4ZF 5LGNA 3VB2A 3FXRA 3V8JA 1IXCA 4JBAA 2Y75A 4CXFA 5IT3A 2RGVA 3ISPA 4EJUA 1IF1A 3GZ6A 4OINF 2UWMA 4ZZDA 2MH2A 2EA4A 4O5VA 3R0AA 4PGHA 2YSRA 3I0TA 1WKMA 2DW4A 4MQ9F 2A68F 4ZYGA 1XDSA 4A5NA 1O3RA 3EYYA 3V7CA 1LNWA 1I1SA 2ZXJA 4KN4X 1V3FA 4M6YA 5D8KB 3H92A 2VBYA 1QGPA 3ZMDA 1PUEE 4AVPA 2X0LA 4HYEA 3KP3A 4I2OA 3GF2A 3N97A 3P9CA 3F6VA 3WGGA 3HRMA 4XSZF 3GZ5A 3CO6C 2IT0A 4OMYA 4YFNF 1FBSA 3ZMSA 5E8IA 2H27A 1TQIA 3BJ6A 4LLLA 2EV5A 1HW5A 3HTUA 1FNNA 4U0YA 3ZP5A 2DK8A 1AOYA 3E5XA 1YW9A 2OBPA 3FZVA 5HOOA 4KUMA 1V4RA 2VBWA 2H09A 3M7GA 1YS6A 1XB4A 2AS5F 1U8RA 5FO5A 2FMYA 2FEZA 1S7OA 1OKRA 3WODF 4Q48A 4I0AA 1QZYA 1W7PB 5ILUA 4A12A 4GGGA 2XIGA 2D2WA 5IT9K 4YIIA 2XAQA 5E17F 3QU6A 2G9WA 2Z99A 3RKYA 3MZHA 1HKQA 2VXZA 2STWA 1G3YA 1YIOA 4LB6B 3AAFA 2Q2EA 1W4MA 1YW7A 3HSEA 3ZMTA 3EQLF 2M8EA 3ABTA 4A0ZA 5ILSA 4IRHA 4PDKA 3VOEA 1I5ZA 3LQRA 3I59A 2EFPA 3F8FA 4HLXA 1ZGAA 3ELKA 1FY7A 1W5SA 4Q5SF 4HX4A 1U5TC 3L2CA 1IN6A 3ZMVA 3L00A 1Z6TA 3KP2A 2F5FA 1YQAA 1R1VA 3M9AA 2JPBA 3COAC 1PP8F 2ZBKA 2V9VA 4EQQA 4EGZA 4I7HA 2KRFA 4L0YB 5FLXK 4ON0A 1T98A 3WE2A 1QQIA 3GYHX 1R58A 2K02A 4AIKA 1R22A 2IA2A 1CF7B 4HDUA 4RB1A 4LLNA 3R61A 1PP7U 1OYIA 3Q9SA 2V79A 5EEHA 1XSXA 2CYYA 4U0VA 4AIHA 2W57A 1PDNC 2A6EF 2MLGA 2F5DA 3HSRA 1TW2A 1J2XA 1J5YA 4IJAA 2G7UA 4WCGA 1GHCA 1UHMA 4OMZA 2QQ9A 1KQ9A 3KP7A 3GO5A 5E1WA 1KYWA 4KFCA 3DKWA 3PQJA 4OU0A 3F8MA 4HF1A 2RV8A 2RKHA 1OR7A 3BWGA 2COMA 2H94A 5AIQA 2ESHA 1XCBA 2XVCA 1USSA 5JHUA 3RTRA 3LA3A 1TW3A 4EMSA 2TDXA 1FSHA 4HF0A 3DEUA 2FE3A 2ISYA 1ZRFA 3WG9A 1L0OC 2O61A 1J7KA 1ZGJA 2DFIA 2ZO4A 3WGIA 4ESJA 2ZJ2A 1T2KA 3KCCA 3CUQC 5BS6A 3LA7A 5CVUA 2CO5A 2GA2A 5K1YA 2W25A 4G9YA 3GWZA 5F64A 1H0MA 4O6JA 2FSWA 4L5JA 4LMYA 1S6LA 3MWMA 3DPTA 1IZ1A 5IT9Z 1ULYA 3W6KB 3SZTA 1EV7A 4L9TA 2UXNA 3HRUA 1ZLKA 4OIOF 3GFJA 4P9UA 3ZMUA 2DLLA 1S8NA 5LBQA 3KLOA 1SMTA 3LSTA 3OOPA 4TV7A 4KNYA 2LDUA 3QPHA 1P2FA 5LGUA 4UV8A 3GXOA 2PI0A 1SMYF 1YFHA 1KU3A 4BAYA 3ROUA 3JTHA 1MJAA 2KKOA 3REOA 3BDDA 1BI0A 3E6CC 3KE2A 1I27A 1UFMA 5FB2A 3QRFF 3DF8A 1R5GA 5HS7A 2R7DA 1XGMA 4MHGA 2UZKA 4UHTA 1FSEA 1SD4A 2A6HF 3I59B 2RC4A 2XAFA 2K86A 1KU7A 2PJPA 1GXQA 4RS8A 4A2UA 5FD6A 1UB9A 3TGNA 2L4AA 3ZPLA 2QQBA 1BI2A 3H3UA 1G6NA 1S3JA 2WC2A 5ICGA 5FLXZ 2H6BA 2L02A 3D0SA 2ESNA 5D5XB 3G73A 1FYLA 1YO5C 4YIFA 3W6JB 2EJRA 3RKXA 4BXUA 2X4HA 3RDIA 1ZG1A 1W5TA 3L7WA 2VC0A 3V8LA 4EJOA 3ECHA 5LHHA 4Z2YA 3FX3A 2PEXA 3JSPA 1BI1A 3VFZA 3R6SA 3VEPA 3IL2A 2VE9A 2QQAA 4LLGF 5DDGA 2D1HA 1KU9A 2VBXA 1SAXA 2OZUA 1YS7A 5DCFA 1D5VA 1IN8A 1J9IA 5DYMA 3HTSB 2FRHA 1FP1D 3IRRA 1RI7A 3JTGA 3O6BB 1IW7F 3RKWA 4I09A 1AWCA 3GEZA 5ED4A 2W84A 3RYPA 3WE3A 5CLSA 1B4AA 3MCZA 3K1PA 4WXHA 4R79A 2QBYA 4P55A 3P9IA 1WWXA 1WSUA 3F23A 4K2EA 5DUKA 3SZPA 1B6AA 3C7JA 2A5YB 3DPLC 3DFGA 4GCVA 4IRIA 1B9NA 4ENJA 3I58A 5ICFA 3KETA 1BC8C 4YFKF 1IUYA 1ZHFA 4XBFA 1LB2A 5E1ZB 3GLXA 3KLNA 3OV8A 1SFXA 5HS8A 4H0EA 2Q0OA 4HV5A 1P6RA 5ERIA 4HOBA 4FT8A 2IA1A 4MTEA 5L3CA 3NQOA 1SFUA 2EA2A 3BJOA 4PZJA 3DV8A 3MEXA 3E97A 4EJVA 4MTDA 3JAMK 2PQ8A 3NRVA 1I6XA 1XMKA 3QP6A 4M72A 2C6YA 2FF4A 3FMSA 1Z05A 1YW8A 4EM1A 2D45A 2K7LA 5D4SA 1T6SA 5L3DA 3EDPA 4IPAA 4M73A 2HDCA 2P8TA 4IF4A 1TNTA 1BM9A 4I02A 5D6FA 2LNBA 4KYWA 2HOEA 3IWZA 3H3ZA 2XV4S 4KICA 5BPIA 1JGSA 5F6FA 1FYMA 2MBFA 5JR3A 4KA4A 1S29A 2D1VA 1ZG5A 4HX8A 3MZYA 1YYVA 3ZQ7A 5DUIA 2EWNA 3SXYA 2IP2A 3TQNA 5H6RA 2PN6A 2MA3A 1DUXC 1LEBA 1IAWA 2Z3YA 3IWFA 3I53A 2BEOA 2ZNZA 1J0RA 1UHWA 5CVVA 1XN7A 4BH9A 2NYXA 2XKOA 2VN2A 3QU3A 4XLPF 2BE5F 2M87A 2JT1A 1DP7P 1XDUA 3RPUA 4XLNF 2VONA 4NQWA 4KIBA 3LWFA 4BYYA 3KP5A 5CVRA 4AIJA 3V7SA 4HW0A 1ZARA 3CO7C 2WV0A 3GFMA 3N4MA 4HAMA 2GXBA 2P5VA 4ENNA 1YTYA 4Q47A 3GFLA 4UNOA 2MC3A 3U9GA 2CGPA 3KP4A 1SD5A 1OYYA 4GYIA 2K27A 1BIAA 4OIRF 5HVQC 2K4BA 4ESFA 4LK0F 1UCRA
chains in the Genus database with same CATH superfamily
5LGTA 3E6DA 2NAZA 2O8XA 4LOCA 1R1UA 1YRNB 4JQFA 3HHGA 2HKOA 4G8XA 3CF2A 3H5RA 4YG2F 1KQ0A 1R4NB 2FNPA 1D8KA 2LFBA 2RDPA 2NVQJ 5LHIA 3C18A 2ZFUA 1JTXA 3V42A 1IUFA 2NNYA 2K40A 4U87A 2DFEA 3OYHA 4XKVA 3HHHA 2GXGA 4DNCA 1WH5A 2R7RA 4CO8A 2XRNA 1GT0C 1N77A 3BT9A 1DPRA 4P5OA 3C2GA 2L01A 5BMZA 2FUG2 3IAS2 1WJCA 2FX0A 3FXMA 2EINH 2VJ5A 4BNCA 3IAM2 4RMNA 1N75A 3DKYA 3E6MA 2OD5A 4L9JA 2QBYB 2VQCA 4M6XA 3CUOA 3KEYA 4NC7A 3FM5A 3TOBA 3J7AY 1WRJA 2L7ZA 4U7DA 1PJRA 4ZTJA 2JTVA 1QPMA 3U2RA 1WJFA 2CG4A 2PFBA 2XRLA 2V26A 4M9SA 3T8TA 1B59A 4LGWA 3L2UA 4WK8F 4Y13A 3M4OJ 1VFCA 1IXSB 2ZXIA 4DIQA 2JVGA 2QWWA 1OCPA 4XKWA 2HXIA 2UXXA 3ZMZA 2IW5A 2IGOA 1K6YA 2GOMA 6PAXA 2Y0SA 1NHAA 4LJZF 2FOWA 5C44J 1MD0A 2ZSHB 5E18F 4KT5C 5TRDA 2HYGD 2FXAA 1MH3A 2WAEA 3FBIB 3ZR8X 5GAEJ 1O3TA 4DYQA 4B09A 4FETA 2ADUA 1R1TA 4ZJZA 3PNYA 1TT5B 2QCOA 2VOOA 1UAAA 1LVKA 1D0ZA 4JOMA 3T1BA 3DBLB 3V7RA 3S1MJ 1Y8RB 1RZ4A 2QQ8A 3HKZN 1RUOA 3JAMZ 3WTZA 3ZQGA 4FISA 1L3LA 3BLYA 3ECOA 1LFBA 5D8LB 3I64A 1Z1DA 2OJED 1W7PD 2ID3A 3MZ8A 3C3WA 2QENA 4GXOA 4CA0A 5F04A 3BQYA 4CGZA 4I76A 4OAYA 3FKIJ 2HQRA 2RQPA 2ID6A 3T0YA 2IA0A 4M3EA 3BTIA 3T8RA 1RKWA 2KISA 2QGUA 4EGYA 5FRNA 5DCMA 5E8GA 2JUGA 5ILVA 1X3UA 2VUMJ 3TO6A 4PJJA 2EPFA 2HKXA 2I10A 1H88C 2QLZA 2HQNA 4I99C 4R1HA 1F36A 3FHZA 2FA5A 4A69C 2BHYA 1FYKA 3J7AO 2R7WA 2OQGA 2QKMB 4CZCA 4G6TB 4KT6A 3J80K 1TC3C 3WTVC 4ZZLA 2TCTA 1VQKI 3M8EA 1Z7UA 5EEGA 5B5EC 2FJ1A 2HVQA 3O2PE 3OYAA 5E3MA 2ACJA 1K4TA 2V1UA 1YX3A 1ZTRA 4W97A 4KISA 2Y0MA 1YX5A 1V54H 3C1DA 3K0LA 1JKRC 3JSOA 2H8RA 1QU3A 4U0WA 3OYGA 2CJJA 5GAGJ 3HOSA 4KIFA 4ZYDA 2PLYA 5FROA 2BW3A 2NS7A 1IXRC 3VODA 1SEUA 5FKLA 2E1NA 5D5UB 1VQ7I 2ZCWA 1ZRCA 2HEOA 2J5OA 2YX7A 1P4WA 3SYTA 3PFYA 1YJWI 1O3SA 3RQIA 1AKHA 4UVCA 3EYIA 3WTSC 1IN4A 2RREA 1MMDA 3H0DA 1J75A 4CCNA 3OYNA 3OYDA 3ESWB 2AXTC 2DCEA 3VWBA 5J6XA 2WAQN 2CQXA 3CESA 4RAYA 3CF5F 1YE9A 2GBYA 3E6BA 1SFOJ 2VKEA 1ETKA 2M4GA 5TJJA 1MDMA 1MSFC 5J4VA 3OS1A 2XGXA 1QPIA 3PJRA 4UB6C 3T5XA 1I39A 2K4JA 1X1PA 3ASOH 1SFEA 4UUVA 3BR1A 2LKPA 3JRIA 2XGEA 2XSJC 5GPAA 1WJDA 4XLFA 4AWXB 3CDIA 4ETSA 2WAFA 2GWRA 2KIUA 5K5RA 4KMUX 1HBXG 1X1BA 1Y6IA 3LSGA 4C30A 3S1RJ 2MW8A 3P5JA 4X0GA 3JR9A 1H9TA 2ELHA 4BU2A 1ERDA 2O7OA 2CQ7A 1FJLA 1ETVA 2A07F 4G7ZF 4N4OB 4RGXA 2YR2A 4N9IA 1EH6A 5FGMA 3BZKA 2K85A 3Q0UA 5B66C 1U2WA 4CCLA 1R7JA 5L3BA 4IEJA 4AVZA 2M5WA 5EZGA 4BHCA 1MBGA 2EQRA 2DJIA 1LDJA 4IOCF 2VKVA 2QYOA 1HW1A 1QZZA 4RDUA 1MGTA 2DU9A 2M30A 3TDZC 4MFEA 4FASD 3OYMA 4HQMA 1XGOA 1IGNA 2D5VA 1BL0A 2K9SA 4RB0A 3I4PA 3N05A 3F6OA 1IO2A 2EH3A 2FQ3A 3A02A 4RBOA 1RR7A 1JKQC 3WG7H 1T0FA 1ZK8A 4DGWB 1ZR2A 3CJQB 4NQWB 4IRGA 2DQRA 4ZDPA 2VE8A 1BBYA 4BQQA 4EJTA 2DYRH 3QQAA 1RNLA 2CV0A 3LL7A 2QSHX 2X48A 3LFKA 3K69A 4U7BA 2CW8A 3CC2I 1XSVA 4UVAA 4HF2A 2O6GE 3OL3A 2LD5A 1TWGJ 1JUSA 2HFHA 3P7NA 2OZ6A 1JE8A 4KN7X 1DDNA 2LKXA 1WQ2A 3DEWA 5FD5A 5M5WJ 2FU4A 2QUFA 5GADJ 3M8JA 3A01A 2RVCA 3NEUA 1X1DA 2CV1A 4HSRA 4XLAA 3BY6A 4RLQA 2PJRB 2KJCA 2PX9A 1O7FA 1SC7A 2JZYA 2YU3A 4GO1A 2QSGX 2B9SA 5JI6A 4RM3A 5IYCJ 4IVNA 2VC1A 1T8IA 2IVMA 2MH9A 5KK1A 4AYBA 1A35A 1A31A 5J1YA 3P9KA 1Z0XA 4E7KA 1QA6A 2YPRA 1Z6RA 4ZC3A 1NK2P 1OYWA 2KQRA 2BY2A 4HDVA 1WHUA 1S9HA 2VL8A 4YEJA 1YG2A 4LD5A 5E20A 1R5ID 3R4KA 2VT3A 4ZH4F 4II2A 2IS2A 2XAUA 2ME0A 1D3YA 1GVJA 2OA4A 3I4MJ 3BQZA 5J1UA 4EJWA 3IH4A 3F0CA 3SFZA 3BCBA 3BOQA 3TO9A 1MMAA 1MMNA 4DQ2A 4Y17A 2XPUA 2HTSA 1TBXA 2DA3A 4HBLA 2X6XA 3E5UA 1FOWA 2Y48A 1ZREA 1OPCA 2GA1A 2O03A 5FRMA 3GTQJ 3KEQA 4ZYHA 1ZN2A 2NRAC 3MQ0A 1SD6A 4FX0A 3AG2H 2NS8A 1ON2A 1TNSA 2M7AA 1G4DA 1BI3A 5BOXA 2STTA 4MGRA 4PUSA 2KRHA 4OIQF 1XMAA 3F8BA 5D5VB 2VXDA 1FIPA 2NS0A 2XB5A 1GV5A 1IN7A 3TKYA 2XAHA 3DBHB 4IXAA 3NWTA 2ZB9A 5DD4A 2HWVA 3GW2A 4I0BA 3KZIC 2E1MB 3LAPA 1GLNA 2IEKA 5CVJA 3ZN0A 2IRFG 3J80Z 5HDKA 1C0WA 2Y69H 3F21A 1Y0UA 1ONVA 1TWCJ 1A5JA 2MD5A 2ZXWH 3RPUD 3JCUC 4J01A 5D4RA 4HEA2 5DEQA 3I54A 3VPRA 4QTRA 1EH8A 1FT9A 1P92A 4HX7A 5DCMB 5EZHA 3HL2A 4BHBA 3PNVA 4B1RA 1HKTA 4FHTA 3SEQA 1R5HA 1ZYRF 3M8FA 2Q8KA 2HU9A 5EG0A 1XD7A 2O8KA 1LVAA 4YRVA 1XCVA 2DTZA 3TL4X 4FTHA 1U5TA 1OR7C 2HDDA 3AL0C 2OCEA 4RGRA 2WWYA 4FX4A 4BEHA 4YFXF 2FMLA 1JHHA 1FC3A 3LSIA 3OMYA 1LDDA 2M4KA 3KEOA 5LEKA 4WF2A 3WU2C 4UVBA 1IRGA 1T56A 2R93J 3VSLA 4HSTA 5A2QK 4G6DA 2K9LA 2VQHA 2XHKA 1YI2I 3JRBA 1P4XA 5IOYA 1U78A 3BG6A 2DN0A 2BW3B 1WVRA 3K7AJ 5HS9A 1VQ8I 1V5EA 3KYLA 2HQ5A 1HSTA 1B1BA 2PBIA 2HS5A 4XRFA 3RZDJ 1AKHB 2RN7A 4BBSJ 3TDUC 2Z9OA 2A3SA 4HNTA 4RB2C 3PFIA 1ODDA 1XGSA 2XKPA 1O4XA 4Y33A 4MNUA 4BGDA 1UZCA 1HSJA 4N0BA 5D6EA 1LDKB 4BHPA 5K7ZA 2ZFWA 1VZ0A 1D1BA 1Z9CA 3HYIA 3DU5A 3OYEA 1ACIA 1MDMB 2HI3A 2GIVA 4Y52J 2A69F 4P96A 3KZZA 1ETXA 3V4GA 2Z5UA 2EILH 1TL8A 5K5QA 1FP2A 1GV2A 3H3VK 3RYRA 1IRFA 2LP0A 3BZ6A 4B3XA 4OAZA 4ENKA 1XSDA 3CCEI 5K5OA 1I3QJ 2R5YA 2VODA 2DT6A 3K1NA 4ENMA 3W2AA 1DU0A 3ZN1A 5LLQA 2E71A 5LFAA 2J5PA 2KIFA 1ZR4A 5D5WB 2DK5A 4LG0A 2CV2A 2BXYA 2RNGA 3L09A 5K7FA 4ZYEA 1H9GA 2ISZA 4ZYAA 1TTYA 4BQAA 3VYTB 4XONA 2EFWA 3LNQA 1BR2A 3O3KA 4L9NA 1XGNA 5AIPA 4CYCA 3IHUA 3G1MA 3K9TA 3V8KA 2W82A 2DXIA 2ZMEA 3FK7A 3ZQFA 3QYBA 3JRGA 3GBGA 2NOJB 4R8HA 5HLIA 3PM1A 3WTTC 2RNJA 5J3LA 1A04A 3F3XA 2Z2SB 4X1EA 1MNEA 2VB6A 2UV1A 3OYLA 1APLC 3TP0A 3K4JA 4E70A 4EVIA 2GAUA 4WXCA 4BXFA 2A61A 2OPTA 2Y2ZA 1BA5A 2QM3A 3OL4A 2B0LA 3MKYB 2QSFX 5DV5A 2DI3A 1RIOH 3S2WA 3VDXA 3IKVA 1RESA 1T38A 3CC7I 3MFKA 4LIVA 2KZGA 4N9HA 1QZEA 3E5QA 4BDYA 1FWZA 1GVDA 2A6TA 3A01B 2X85A 2EZKA 4CDGA 5HDGA 1V5FA 2L3DA 3WTYC 1XS9A 1I1GA 2CRGA 2CFXA 3IKTA 3CLOA 4AIDA 3S2HJ 3BPXA 2R92J 2VOPA 3H9GA 1G3TA 3G4SI 4F55A 1KU2A 4XLHA 3QWLA 3KZYA 3CUQA 3AG4H 3D5LA 4M71A 4A3MJ 2DA2A 2ZKZA 1YJ9I 4BQOA 2R7TA 2R3SA 5L3EA 5LEJA 3ZOBA 1BN5A 3WTXC 4NHJA 3E1SA 2KJBA 2K9QA 3BZCA 4XSXF 2LRDA 1Y1VJ 2EIJH 2QKLB 3E3VA 4H4KC 3JW4A 5CYVA 3GMEA 4S05A 5F1RA 3CJTB 5ICCA 2BYVE 2W1OA 3FXJA 3TP3A 1E3HA 1POGA 3CLQA 2Z1DA 3ML6A 4ESBA 1B8IA 3HRSA 3K70C 1U3EM 3OIOA 4Y4RA 2EFQA 1MBJA 1O57A 1KGSA 2BVMA 2ICWG 3H9JA 2E2IJ 1R6RA 4BDZA 2IJLA 1ZELA 3U21A 3GUDA 2E7XA 2V1XA 2CUEA 2P7VB 5HDNA 2H1KA 4NC8A 4MEXF 4RAZA 3DBRB 3Q5FA 4W1UA 3J81K 5FFXA 2NXNB 2HOSA 3FM3A 4NNJA 3DP7A 4JYKA 2OU2A 1VQOI 2NOGA 1XMXA 2DA4A 4L5IA 1K78A 4M3DA 3OIQA 4DZPA 5EGOA 2W00A 2X9DA 2W85A 5BPDA 4KMFA 3WU1B 4XQFA 4L18B 3BR3A 1KA8A 1TWHJ 2Y9YA 4CHUA 4QLCU 5BQTA 2F6CA 1MH4A 2JPCA 4UUTA 2M9HA 3ZRGA 4D0PA 1RKTA 2GM4A 1OCCH 2LSOA 4DBRA 5ICEA 3J7ZI 1E2XA 3X2QH 3OYCA 5A2QZ 4B8XA 2FBKA 1RETA 2KMUA 3B02A 1Y56A 1BJAA 3U1DA 3CCVI 2XAJA 2M8GX 4ASNA 3ZQCA 3IRQA 4A6DA 1DPUA 5M5YJ 1JI8A 3D5RC 2JRTA 3VYUB 1D8JA 5EG0B 1D0YA 3ULQB 1FLIA 2PMHA 3SHFA 2X1EA 3BG9A 2I8DA 1EH7A 3OWTA 1U5TB 2MC4A 2VT2A 4BEHB 1K79A 4CCJA 2DBBA 2M1BA 5LRRA 4A3JJ 2XPWA 3S15J 1DU6A 1WI3A 4A0XA 1ZG3A 3K4BA 1K4SA 2EV0A 3F72A 5KVRA 3S8PA 3QOPA 5CQEA 3LSHA 3LSPA 5HLGA 5HLHA 3OSFA 2L7KA 2L7MP 4IZZA 1FX7A 4GYGA 1AA7A 2DPDA 2KLOA 2DDAA 1DQUA 3S16J 2Z33A 2HQAA 3RJPA 3LSJA 2HOAA 4Y15A 3QAHA 1ETYA 2HDWA 3DQVC 5H6QA 4ZTFA 2E1CA 1VQNI 1W5CC 1VTNC 4KDPA 1E17A 3CMYA 1QBJA 2NNNA 5KNLA 2ZNYA 2DA1A 3S1NJ 4QSHA 1QO0D 2IXSA 1UHSA 3CP8A 3TW6A 4WX9A 4GRIA 2O0YA 2P4WA 2KIQA 3FWEA 3LA2A 5LRSA 5EJCA 1T39A 1W1WE 2FQ4A 1LPQA 3HZJA 4L0ZB 3LQQA 3OY9A 2ZJPF 4CSWA 3FMQA 2AXLA 2G7HA 3K70D 4I01A 1IG7A 2LY1A 1NH3A 4RGSA 2EV6A 2R5ZA 2IPQX 3FKJA 3WU0A 4HG2A 2CWEA 3KPHA 3ONQA 3TBIA 4A0YA 2L0KA 3HSFA 1ZGWA 3NWSA 2HYFA 3HG9A 4MQVA 4XICA 4D5FA 1RR8C 1WJ5A 5JFRA 5J4YA 2P7CB 4IHSA 4CICA 1F1ZA 1G3SA 3R60A 1MSEC 4LG0B 3DU6A 5JVTA 3WTWC 5M3FJ 1G3WA 2V1DA 2BHZA 3QPTA 4C2MJ 3L2VA 4G6QA 2GQQA 1K61A 2DOEA 2PMZA 1X3WB 3I5UA 4CYCB 1X19A 2FOKA 4MEYF 4XK4A 1FOKA 3ABMH 2OAZA 3FF5A 2EZIA 4PSWA 2ZMEB 3GTGJ 1BW5A 1K83J 3H36A 5GAHJ 4C3IJ 4QIWN 1F9NA 3WGHA 2VPRA 1MZBA 2DPUA 1X58A 1S7AA 2JSCA 1WI9A 3R0JA 2PMUA 4BJ6C 3AKZA 2XAGA 3O8GA 3FXUA 2MLKA 3Q3SA 1SVMA 1SD7A 1MNDA 2BVLA 2H6CA 3BTCA 2W24A 5DTDA 1B72A 4A3DJ 3K10A 4P1WA 4F91B 4JX5A 5J8CA 1BIBA 2QVOA 1FZPB 4M9ZA 2FBHA 2HZTA 2DAOA 1Z3XA 2LF8A 2NVYJ 1E3OC 2F5CA 2EFOA 2DT5A 4MLOA 1MJ9A 3DPUA 2LOOA 5J1RA 5M5XJ 2CQQA 4CCMA 1NK3P 2R7SA 5B1BH 5L3FA 3RPQA 2R7XA 1HW2A 4J00A 2CSOA 1ON1A 5LHGA 1TQMA 1U0JA 2BV6A 3ABUA 4HNVA 3BROA 3A1YA 3HPHA 3DWLE 3MVPA 2EB7A 3CCSI 1DP3A 1LQ1A 3CUQB 4HA8A 1EJ9A 3MAJA 3CMAI 1USTA 2ETHA 1ZLJA 4CYDA 4EM0B 1BOAA 2F5EA 1MKMA 2YX4A 2QZ8A 2V6CA 1GDTA 1S72I 3B73A 4HPQA 4B44A 4CZZA 2E19A 2KIMA 5L3GA 1MIJA 2XDVA 2P0WA 2X6OA 4WXDA 3KP6A 1K7AA 2VIXA 5C3EJ 2EBIA 1YOVB 4O3MA 1FOYA 4DOZA 2CQKA 2L4MA 4AM3A 1YITI 1RUNA 3H9QA 2CW7A 3J81Z 1Z77A 2NVXJ 1IDYA 1BOBA 4JX6A 2M0CA 3TMOA 2VKHA 3H5NA 4OOIA 2DOAA 2FNAA 2LREA 3GFIA 4HLYA 1P4AA 5F0FA 3UR3C 1BC7C 2JQ7A 3K1MA 2DYSH 4RA2A 1REPC 3SQNA 4RB3C 2DMUA 3HOVJ 4UV9A 3K4NA 1R4MB 3CTAA 5AONA 3FXLA 4M9XA 2VJIA 5IY5H 2CW0F 5HNHA 1UMQA 3QP5A 3G2BA 5GPCA 3EUHA 1TLHB 2E2HJ 2BY1A 3F8NA 1B9MA 3KIOA 3KFWX 5J40A 5CJ9A 3WHCA 4AC0A 4P9FA 3MKZA 2OC6A 2E35A 4IX7A 4M74A 2R7VA 3HIFA 2BZTA 1D1CA 1F4KA 1RPWA 1TT0A 1D1AA 2CH0A 1T95A 1K78B 1R23A 3FMRA 1HC8A 3G1LA 4UY8I 3JRHA 2DTRA 2E5NA 4UB8C 1U6GA 5E1XA 3I71A 5EGOB 2K3PA 4IOAF 3GTPJ 4EM2A 1W0UA 4OIPF 2JVHA 4M3GA 4E7JA 4D9JA 1P7IA 1YLFA 2F2EA 2CMPA 2HTJA 3L9FA 5J47A 4F7ZA 1FOXA 1OFCX 1HKSA 1EA3A 1O3QA 3M07A 2E7WA 3TOAA 1QNTA 4XM3A 3UNGC 4A3GJ 4XL9A 2X6WA 1M1EB 4BY7J 4HNUA 1FBUA 2QEXI 2VI6A 1R00A 5CVIA 1E0EA 2L9RA 5FFZA 1IN5A 2Q1ZB 4BXXJ 2P6SA 3MD2A 2HPIA 3BJAA 4UXNA 3RIRA 3K4KA 4AD9A 2BBYA 4G94A 4BS9A 5IYDJ 1X2MA 1HXDA 1FMVA 1VNDA 1D5YA 1W7PA 2DMQA 1STZA 3PL8A 2VBZA 3F8CA 1UG0A 4XOPA 2F48A 4LK1F 3L2WA 3DTKA 1ZH5A 5IP6A 2YUSA 2FBIA 3SDBA 3TO7A 2OQRA 2Z16A 3EETA 4BE1A 1DGWY 2GZWA 4U88A 3TEDA 3WTUC 2LY9A 3LAJA 1E3PA 4EV0A 1WJAA 2DO7A 1AU7A 3BG7A 3FXQA 4I98B 4HZFA 2JN6A 4NB5A 3RI4A 1CGPA 1N78A 1O7LA 2E1MC 1LEAA 1Z91A 3GCMA 1DGRM 2F5VA 3CDHA 4KIGA 5JLXA 2BGCA 3HBLA 5J8FA 4A3KJ 4F52A 2EFNA 1JUPA 2MGQA 3E0JB 1MJBA 3DXJF 3EUAA 5EDNA 2XROA 3HPGA 1ZAOA 3W6VA 1GXPA 4WWCA 3IUOA 4Z6YA 1VQLI 1EKEA 2KHMA 3Q9VA 1OCZH 3ERMA 3HUGA 4BL0B 2LTPA 2E5ZA 2P6TA 1F5TA 2LF7A 4IHTA 2PG4A 1ZRDA 4G7HF 2E36A 4B4CA 9ANTA 5KCMA 3K4LA 5EF6A 4E7HA 1FBQA 1Q1HA 1TQPA 2M45A 1Z67A 5H20A 4PCQA 4QWQA 4C3JJ 4A6EA 4HQEA 5DM7F 2P5LC 5DD8A 4G7OF 4A5MA 3ERED 3QYFA 4FCYA 1Y0NA 2M0MA 2WB1A 1PYVA 1KYZA 4XORA 3SDGA 5EEAA 3I55I 4LFUA 3HRTA 5B3SH 3HDDA 3HOTA 5F1JA 2R5ZB 3K4MA 3BR2A 3CJNA 1OMIA 3BR5A 3K2ZA 1LJ9A 5TISC 4A3IJ 2R7FA 3PQKA 4DYRA 2DQLA 2WBMA 2EK5A 3G3ZA 2X51A 1SAUA 1SVOA 4NUBA 4PGGA 1K6OA 4YELA 1JJ6C 4A93J 2CUJA 1FMWA 5H2FC 3F22A 3M1EA 2O3FA 2XASA 3IP4B 2OTLI 2COBA 2IGMA 4L9VA 1HQCA 3HM5A 5BNGA 3L2RA 3IC7A 1FPQA 2HGCA 3KX2A 4DJAA 2WTEA 1RRJA 1J59A 1JXSA 3GVAA 3BPVA 4HV6A 2XUBA 3GTKJ 1RC9A 1R36A 1U8BA 2P5KA 3BP8A 1VF9A 2HR3A 3GX4X 1LKXA 2L9SA 3ZGKA 1JHFA 4RGUA 2L54A 2E34A 3W2WA 4CCOA 2ZJRF 2MABA 1VQ9I 1CF7A 1KQ8A 4JK1X 4S04A 1CQTA 1UG2A 4Q4ZF 5LGNA 3VB2A 3HOZJ 3FXRA 3V8JA 1IXCA 4JBAA 5FJ8J 2ZJQF 4C9YA 2Y75A 1HA8A 2RQQA 2HNHA 4CXFA 3QYEA 1B72B 5IT3A 2RGVA 3J7YJ 3QPSA 4CH7A 2W7NA 3ISPA 2MG4A 4EJUA 1IF1A 3GZ6A 1WJEA 3MMYB 4OINF 2UWMA 1QRYA 4XOTA 4ZZDA 1JT0A 4IHVA 4A3LJ 3FIWA 2IS4A 2MH2A 2EA4A 1IRXA 4O5VA 3BR0A 2HXOA 3PO2J 2LC2A 2TRTA 2JA6J 3R0AA 4IHYA 3GTOJ 4XRSG 4PGHA 2YSRA 5IYBJ 2LR8A 3I0TA 3S32A 3HKZA 5JLWA 3UKGA 1F43A 4F3QA 1R71A 1WKMA 3BG3A 2AHQA 2DW4A 2KDZA 4MQ9F 2A68F 4ZYGA 1XDSA 4A5NA 3D5SC 1O3RA 3EYYA 3V7CA 1LNWA 1I1SA 3S2DJ 1T0FC 2ZXJA 2XF5A 3DTIA 4KN4X 2XSDC 1V3FA 4RM2A 4BACA 4M6YA 5D8KB 3K4CA 3H92A 2VBYA 1QGPA 3ZMDA 4C2UA 1PUEE 4HRIA 4AVPA 4QPQA 4IHWA 2X0LA 5C4JJ 4HYEA 4AYBN 2B63J 1U9NA 3KP3A 3OYIA 4I2OA 1HOMA 3GF2A 3N97A 3P9CA 1QVTA 3F6VA 3WGGA 3HRMA 4XSZF 3GZ5A 2MD0A 2DA6A 4XMYA 3CO6C 2IT0A 2JRMA 4OMYA 4XNFA 4YFNF 4XLCA 4FQGA 3M3YJ 2ZSIB 4BY1J 1FBSA 3ZMSA 5E8IA 4LIUA 4IO9F 2H27A 5KHDA 2LYCA 1TQIA 4J19A 3BJ6A 4JX4A 4LLLA 2R7ZJ 2EV5A 1HW5A 2HVSA 3VYRB 2P81A 3HTUA 1FNNA 4U0YA 3Q0VA 3ZP5A 2DK8A 2DDBA 2IAIA 1AOYA 1Z21A 3H0GJ 3E5XA 1YW9A 2OBPA 3FZVA 1HF0A 2M34A 2KZVA 2WAQA 4MFDA 5HOOA 4KUMA 1V4RA 2VBWA 2H09A 4BQNA 3OYKA 3M7GA 3L1PA 3HOWJ 1YS6A 2WADA 3HC7A 4JP0A 1XB4A 2AS5F 1U8RA 5FO5A 3KYCB 3FXKA 1Y8QB 1QVUA 2FMYA 2FEZA 3CCJI 3ZQLA 3ASNH 1S7OA 4V2GA 1OKRA 3IV5A 2VKDA 3LSRA 2AO9A 3WODF 4Q48A 2L9VA 4I0AA 1OCTC 1LFPA 1QZYA 1TWAJ 1W7PB 1TWFJ 3SZGA 5F0HA 5ILUA 4A12A 4GGGA 2XIGA 1OQYA 3GTLJ 2D2WA 5IT9K 4S0HB 4YIIA 2XAQA 5E17F 3B6AA 3QU6A 2KPMA 2G9WA 2XB0X 4II3A 4C3HJ 1Z3YA 2Z99A 3RKYA 3MZHA 1HKQA 2VXZA 2STWA 4E7IA 2K9NA 1ZQ3P 2W4SA 3ZCOA 1G3YA 1FEXA 1YIOA 4LB6B 3OYJA 1J09A 3AAFA 1ETQA 2Q2EA 1W4MA 1YW7A 3HSEA 3ZMTA 2DMTA 3EQLF 5GTIC 3EUKL 2M8EA 2KFDA 3ABTA 4IRHA 5ILSA 4A0ZA 3RSNA 4PDKA 2JWTA 3VOEA 3AG3H 3DEEA 3HUGB 1I5ZA 3LQRA 2IGKA 1ETOA 1T33A 3WHBA 2M3AA 2EZHA 5FLVA 3I59A 2LY2A 2EFPA 3F8FA 4XN3A 4HLXA 2Y30A 3S3OA 1ZGAA 2V1NA 3C2HA 3ELKA 1FY7A 2HVRA 1W5SA 4Q5SF 4HX4A 1UJ8A 5E3LA 3QPLA 1U5TC 1PUFA 3I3LA 1X1CA 3L2CA 2F4OB 1NG6A 2IBDA 1IN6A 1IJWC 3ZMVA 4FE7A 2LH9A 2UUZA 3H1CA 1Z6TA 3L00A 4Y7NJ 2ECBA 3HOXJ 1WFXA 2DA7A 2KDOA 3KP2A 2F5FA 3PSIA 1YQAA 1R1VA 3M9AA 3CMEI 2JPBA 3COAC 2K3FA 1PP8F 1OJLA 2ZBKA 4CCKA 2OUMA 3JREA 2V9VA 3W3CA 3DLLF 3OIPA 4PJ0C 4EQQA 4EGZA 3ZQHA 4I7HA 1P7JA 2ZXHA 2QF7A 3VSKA 2O5RA 3HOUJ 2KRFA 4L0YB 5CPRB 4D5CA 4XLEA 3G6EI 5FLXK 4ON0A 1T98A 3WE2A 1QQIA 3GYHX 1HDPA 3ZQIA 1R58A 1Y1WJ 3S14J 1HDDC 2Y31A 2K02A 4AIKA 1R22A 2IA2A 1CF7B 2VJJA 4HDUA 4RB1A 1KONA 1A36A 2CUZA 2H1LA 2V6EA 4RAFA 1TZLA 4LLNA 3H5AA 3R61A 1PP7U 1OYIA 1WH7A 3Q9SA 2V79A 5EEHA 1XSXA 3SJMA 2CYYA 4U0VA 2GIZA 4AIHA 2OTJI 2W57A 1PDNC 5FKMA 2B7EA 2A6EF 2MLGA 2F5DA 1SANA 1N25A 3HSRA 1TW2A 1OLTA 3BTLA 1R49A 3LSKA 1J2XA 3I56I 3C2BA 2R5YB 1J5YA 2MYSA 3DLAA 2G7UA 4IJAA 4WCGA 1GHCA 1FIAA 1UHMA 4OMZA 1FTTA 2DT7B 2QQ9A 5KAIC 5IOZA 1KQ9A 3KP7A 2JA8J 3GO5A 5E1WA 2IGNA 2DMNA 1KYWA 1VQ5I 4KFCA 1BR4A 3DKWA 3PQJA 4OU0A 3NAUA 4PFOA 1AHDP 3F8MA 2DA5A 2R4GA 3HGGA 2HPMA 4HF1A 2RV8A 2RKHA 1XX5A 4E7ZA 1OR7A 3BWGA 2ZMEC 1UELB 2OCCH 2COMA 2R7QA 3M1CA 2LKSA 4D7NA 3FXOA 2H94A 4CUGA 5DS9A 5AIQA 2ESHA 3K2AA 1BJZA 1XCBA 2CFOA 2XVCA 1USSA 4BKXA 3PNTA 5IP9J 5JHUA 3RTRA 3LA3A 3CP2A 1JKOC 2ECCA 1ITYA 1A6QA 1TW3A 4EMSA 4EEFG 2TDXA 3PIPF 1W0TA 5GP9A 1FSHA 4HF0A 3DEUA 2FE3A 4Y3OA 2ISYA 1ZRFA 1I6HJ 4ABZA 4AU7A 3G71I 3WG9A 2YU9J 3FDYA 1L0OC 2H8WA 2L9NA 2O61A 5KAFC 1J7KA 1OCRH 1ZGJA 4M3BA 3U1KA 2DFIA 1JT6A 1WJBA 2ZO4A 3PSFA 3CCQI 2WY8Q 3WGIA 1IV6A 3FISA 4ESJA 3AG1H 2CS3A 1MBKA 2ZJ2A 4XKCA 1T2KA 2LVSA 3KCCA 3CUQC 3DTEA 3LFUA 5BS6A 1OISA 1T08B 3LA7A 2VPLA 2LBFA 3K6GA 3CMMA 2JK3A 2CO5A 2DFHA 5CVUA 3BCAA 1S7EA 2GA2A 3ZQQA 5K1YA 3A03A 3Q0WA 2W25A 1X1AA 3GWZA 4G9YA 5F64A 1H0MA 3DCFA 4O6JA 2FSWA 3O8HA 4L5JA 5C4XJ 4LMYA 1S6LA 3MWMA 3DPTA 1IZ1A 5FKNA 5IT9Z 1ULYA 3W6KB 3SZTA 3JRDA 2KL4A 1U9OA 1EV7A 5E79C 2GLOA 3S1QJ 4V19K 4L9TA 1X4PA 3W2VA 1HLVA 2MFZA 4E4HA 3ZXSA 2UXNA 2ZC2A 2FD5A 3HRUA 1ZLKA 4OIOF 2AQEA 1B8IB 1A6IA 3GFJA 4P9UA 3ZMUA 2DLLA 4ZDLA 4A3EJ 1S8NA 3CQZJ 2DOFA 2XPVA 3KYDB 1I3AA 5LBQA 3HXLA 2JMWA 1QHHD 2X1DA 3KLOA 4UUSA 5IPAA 1LE8A 3FHNA 1SMTA 4BE0A 1WGXA 3LSTA 3OOPA 4PSXA 4TV7A 4KNYA 2LDUA 3QPHA 1P2FA 3OS0A 5LGUA 2EIMH 4UV8A 3GXOA 3HGYA 2PI0A 2I5UA 2ME6A 1SMYF 5HLTA 3BTJA 1YFHA 1KU3A 4BAYA 3ROUA 3JTHA 1MJAA 2KKOA 4BJ5C 1VQPI 3REOA 3BDDA 1BI0A 1PVEA 3E6CC 3KE2A 2Y9ZA 1I27A 3I4NJ 1UFMA 5FB2A 4IL6C 3QRFF 3DF8A 1R5GA 3RZOJ 4KJZA 4XKBA 5CQGA 5HS7A 1G59A 3CZ6A 4A3CJ 1VQ6I 2R7DA 4DBQA 2AQFA 2Q2EB 5EYRA 2O9LA 4MIMA 2DODA 1XGMA 4MHGA 4D7MA 2UZKA 1KZHA 4ZDOA 1JTYA 3GTMJ 4UHTA 2XF6A 1FSEA 3HB9A 1MMSA 1WPKA 1SD4A 1YIJI 2A6HF 2JA7J 1P9QC 3I59B 2RC4A 1XC5A 2CU7A 2L7FP 2K86A 2XAFA 5M3MJ 1KU7A 2PJPA 1GXQA 2Y0SN 5JVGF 4RS8A 4F93B 2KRCA 4A2UA 5FD6A 1UB9A 1ZKGA 2JSPA 3CCYA 3TGNA 2K9MA 4KITB 3EPZA 2L4AA 4RLFA 3ZPLA 1VQMI 2QQBA 1BI2A 4QPOA 3H3UA 1H89C 1G6NA 1PUFB 1JUMA 1S3JA 2WC2A 5ICGA 1OCOH 5FLXZ 2H6BA 4ANJA 2L02A 1MBHA 3JRFA 3GTJJ 3D0SA 2V9KA 2ESNA 5D5XB 3ABLH 2ELJA 2L2OA 4M3FA 3IH3A 3G73A 1FYLA 1YO5C 3A0BC 4YIFA 3W6JB 3B6CA 2EJRA 2X1CA 3RKXA 4BXUA 1FTZA 2X4HA 3RDIA 1YJNI 4V2FA 1ZG1A 3QODA 3ABKH 2XC7A 1W5TA 2RAEA 2BXZA 3L7WA 2VC0A 3V8LA 4EJOA 2V9PA 3ECHA 4Z2YA 3FX3A 5LHHA 2PEXA 3JSPA 2MSYA 2R7UA 2EIKH 1BI1A 5B1AH 1I50J 2OV7A 4FE4A 3VFZA 2V7FA 3R6SA 3VEPA 3IL2A 3H35A 2QQAA 2VE9A 1IRZA 4LLGF 2DFFA 5DDGA 5DM6F 2D1HA 2HZDA 1KU9A 3MKWB 4B47A 4PJMA 3D1NI 4IQJA 2VBXA 1Z7LA 3AFHA 1SAXA 1R9TJ 3OYFA 2GXAA 1V5GA 2OZUA 3DKXA 1YS7A 5DCFA 3A0HC 1VI0A 1X2NA 2R7OA 1D5VA 1IN8A 2KT0A 3HJEA 1J9IA 1YRNA 4I6ZA 1GUUA 2VQLA 2BY0A 2L5QA 5DYMA 4D1QA 1TP4A 3NARA 3CDLA 4XIDA 4A3FJ 4M6VA 2E60A 3HTSB 2PMZN 2FRHA 1FP1D 2JUCA 3IRRA 1RI7A 3JTGA 2DJNA 3O6BB 1IW7F 3RKWA 1QHGA 2CQNA 4I09A 1G2HA 1AWCA 2F4MB 3GEZA 5ED4A 2XF7A 2W84A 3RYPA 1XG1A 4XR6A 3BG5A 5CLSA 2LLKA 1B4AA 3MCZA 3OR2C 3WE3A 5E3OA 3K1PA 4WXHA 4R79A 4E7SA 2QBYA 4P55A 3P9IA 1XTAA 1WWXA 4C2TA 4GFBA 1WSUA 3F23A 1X3ZB 1IC8A 2CUFA 4A3BJ 4NBQA 4K2EA 5DUKA 2A5WA 3SZPA 3CCUI 3G1OA 4MO7A 1BR1A 1B6AA 4IQ4A 3AL0B 2WV1A 3C7JA 2NVUB 1ETWA 2A5YB 1LFUP 3DPLC 3BC8A 3PUBA 4DW6A 3DFGA 4GCVA 4IHXA 4IRIA 1B9NA 1WZ2A 4ENJA 3I58A 5ICFA 3KETA 1BC8C 4YFKF 3QOEA 1MW7A 2IS6A 1IUYA 1YHQI 1ZHFA 2HOTA 3S17J 4LG3A 3OOUA 1W36C 4GDFA 3FBNB 4XBFA 3JRAA 1LB2A 3MKLA 2M2EA 5E1ZB 3GLXA 2BOLA 3KLNA 3OV8A 4EATA 3TW7A 4PK4A 2IS1A 3FK6A 1SFXA 2VJ4A 4B48A 5HS8A 4LB5A 2W48A 4H0EA 2Q0OA 4IKFA 1VQ4I 4HV5A 2WA0A 1P6RA 2VASA 5ERIA 4HOBA 2A05A 4FT8A 2IA1A 4MTEA 5L3CA 3CCRI 3L2QA 3NQOA 2XGDA 1SFKA 1SFUA 2EA2A 2K5CA 3BJOA 4OWRB 5GTHC 5JHFA 4RAGA 1NG7A 4PZJA 5FLMJ 2YS9A 3RQ4A 5LD2C 3DV8A 4DYCA 2LBFB 4DZJA 3MEXA 3E97A 4EJVA 4MTDA 3JAMK 3JRCA 2QA4I 2PQ8A 2XGCA 3NRVA 1I6XA 2HYJA 4F92B 1G8XA 1XMKA 3QP6A 4M72A 2C6YA 4B3AA 2FF4A 5CKTA 1NTCA 3FMSA 4BBRJ 1Z05A 1YW8A 4EM1A 2D45A 2K7LA 5F08A 5D4SA 2N8GA 1V55H 1T6SA 5L3DA 3EDPA 3CJRB 1HCRA 1JJ8C 1JGGA 4IPAA 2X6YA 4M73A 2HDCA 2P8TA 4IF4A 2VQGA 5K7HA 2DMPA 1TNTA 4G12A 5IP7J 1BM9A 1MBEA 4I02A 5D6FA 3VYSB 3RKQA 1ORKA 1X4OA 2LNBA 3BR6A 4KYWA 2HOEA 2JA2A 1D0XA 3IWZA 4ITVA 4PJNA 4UUSB 1LE8B 3H3ZA 3EUHC 2EZLA 3S3NA 5F27A 2E2JJ 3MN2A 4E6KG 3RCOA 3PO3J 2G0EA 3CCLI 2XV4S 1Y39A 3SFIA 3CCMI 4KICA 5BPIA 1JGSA 4YIRX 1H8AC 5F6FA 1FYMA 2JA5J 2MBFA 5JR3A 3IH2A 4KA4A 4PJLA 2M7BA 1ENHA 1S29A 3OS2A 3S3MA 2D1VA 1ZG5A 1JKPC 3PIOF 4HX8A 4E7LA 4NC6A 3MZYA 4XRMA 1BW6A 1YYVA 1MMGA 3ZQ7A 5DUIA 5F0CA 5TGTA 2EWNA 2LK2A 3SXYA 4XN0A 5HODA 2IP2A 2F4IA 3TQNA 5H6RA 2LMDA 2PN6A 1WCMJ 2MA3A 3OR1C 1DUXC 4L5EA 3HEFA 4X6AJ 1LEBA 5E3NA 1IAWA 2Z3YA 3IWFA 3I53A 2BEOA 3OYBA 2ZNZA 1J0RA 1UHWA 3F9KA 3LSMA 3PUFA 5CVVA 2WY7Q 2NVTJ 2KP6A 1XN7A 2OF7A 4BH9A 1MNMC 2NYXA 1W36D 2XKOA 2VN2A 1IV8A 1Q1VA 2GOXB 3QU3A 4XLPF 2BE5F 1SVLA 2V4JC 3SEZA 2ELKA 1MBFA 2M87A 2JT1A 1DP7P 1XDUA 5FKKA 3RPUA 4XLNF 2VLAA 2VONA 4NQWA 4KIBA 3E7LA 3LWFA 5FKOA 3HOYJ 4BYYA 3KP5A 5CVRA 4AIJA 1EF4A 3V7SA 3OSGA 2R0QC 3A4CA 1LUJB 4HW0A 3CC4I 3S93A 4BUPA 1ZARA 3CO7C 1S5LC 2WV0A 3GFMA 4XRSA 3N4MA 4AUXA 4HAMA 3LOCA 2GXBA 2P5VA 4BJTA 4B43A 2E1OA 4NDLA 4ENNA 2WB1N 4LITA 4Q47A 3GFLA 1YTYA 4UNOA 5HNFA 2MC3A 3U9GA 2BY3A 4N4NB 3KP4A 2CGPA 2JJ7A 2LG4A 1SD5A 1OYYA 4GYIA 1XPXA 3LMMA 4BE2A 2PJRA 4PFPA 3GZNB 3GLLA 2K27A 3I9V2 1BIAA 4OIRF 3A2KA 5HVQC 2K4BA 4ESFA 3CD6I 1IDZA 4LK0F 1UCRA
chains in the Genus database with same CATH topology
5LGTA 3E6DA 2NAZA 2O8XA 1R1UA 4JQFA 3HHGA 2HKOA 4G8XA 4YG2F 1KQ0A 2RDPA 2FNPA 1D8KA 5LHIA 3C18A 2NNYA 3HHHA 2GXGA 4DNCA 4CO8A 2XRNA 1DPRA 4P5OA 2L01A 5BMZA 4BNCA 3E6MA 2OD5A 4L9JA 2QBYB 4M6XA 3CUOA 3FM5A 3TOBA 1WRJA 4U7DA 2JTVA 1QPMA 3U2RA 2CG4A 2PFBA 4M9SA 3T8TA 1B59A 4LGWA 4WK8F 4Y13A 1IXSB 2QWWA 2UXXA 3ZMZA 2IW5A 6PAXA 1NHAA 4LJZF 1MD0A 5E18F 4KT5C 5TRDA 2HYGD 2FXAA 1O3TA 4B09A 2ADUA 1R1TA 2VOOA 3T1BA 3V7RA 1RZ4A 1RUOA 3JAMZ 3WTZA 1L3LA 3ECOA 5D8LB 3I64A 1Z1DA 1W7PD 4GXOA 3C3WA 2QENA 4CGZA 2HQRA 2RQPA 3T0YA 3T8RA 2IA0A 4EGYA 5DCMA 5E8GA 5ILVA 1X3UA 3TO6A 2HKXA 2QLZA 2HQNA 4R1HA 1FYKA 3FHZA 2FA5A 3J7AO 2OQGA 3J80K 3WTVC 4ZZLA 3M8EA 1Z7UA 5EEGA 3O2PE 2ACJA 2V1UA 2Y0MA 3C1DA 3K0LA 3JSOA 4U0WA 3HOSA 4KIFA 4ZYDA 2PLYA 1IXRC 3VODA 2E1NA 5D5UB 2ZCWA 1ZRCA 2HEOA 2J5OA 2YX7A 1P4WA 3EYIA 1O3SA 4UVCA 3WTSC 1IN4A 1J75A 5J6XA 4RAYA 3E6BA 5TJJA 1MDMA 2XGXA 3T5XA 2K4JA 1SFEA 4UUVA 2LKPA 4AWXB 4ETSA 2GWRA 2KIUA 5K5RA 4KMUX 1HBXG 1H9TA 2ELHA 2A07F 4G7ZF 4RGXA 2YR2A 4N9IA 1EH6A 5FGMA 1U2WA 1R7JA 5L3BA 2M5WA 4BHCA 1LDJA 2QYOA 1HW1A 1QZZA 1MGTA 2DU9A 2M30A 3TDZC 4HQMA 1XGOA 4RB0A 3I4PA 3F6OA 2FQ3A 1T0FA 4IRGA 2DQRA 2VE8A 1BBYA 4EJTA 1RNLA 3LFKA 3K69A 4U7BA 4HF2A 1XSVA 4UVAA 2O6GE 2HFHA 3P7NA 1JE8A 2OZ6A 4KN7X 1DDNA 1WQ2A 5FD5A 2FU4A 2QUFA 2RVCA 3NEUA 3BY6A 2KJCA 1O7FA 2JZYA 2YU3A 4GO1A 5JI6A 4IVNA 2VC1A 2IVMA 2MH9A 5KK1A 3P9KA 2YPRA 1Z6RA 1OYWA 4HDVA 1YG2A 4LD5A 5E20A 3R4KA 2VT3A 4ZH4F 1D3YA 1GVJA 2OA4A 4EJWA 3SFZA 3BOQA 3TO9A 4DQ2A 4Y17A 2HTSA 1TBXA 4HBLA 3E5UA 2Y48A 1ZREA 1OPCA 2GA1A 2O03A 3KEQA 4ZYHA 1ZN2A 2NRAC 3MQ0A 1SD6A 4FX0A 1ON2A 1TNSA 1G4DA 1BI3A 5BOXA 2STTA 4MGRA 4OIQF 1XMAA 3F8BA 5D5VB 2NS0A 1IN7A 3TKYA 2XAHA 4IXAA 5DD4A 2HWVA 3GW2A 4I0BA 3LAPA 5CVJA 3ZN0A 2IRFG 3J80Z 5HDKA 1C0WA 3F21A 1Y0UA 1ONVA 2MD5A 5D4RA 5DEQA 3I54A 1EH8A 1FT9A 1P92A 4HX7A 5DCMB 4BHBA 1HKTA 4FHTA 1R5HA 1ZYRF 3M8FA 2Q8KA 1XD7A 1LVAA 1XCVA 1U5TA 4RGRA 4FX4A 2WWYA 4YFXF 2FMLA 1JHHA 1FC3A 1LDDA 3KEOA 5LEKA 4WF2A 4UVBA 1IRGA 5A2QK 4G6DA 2XHKA 1P4XA 1U78A 5HS9A 1HSTA 1B1BA 2PBIA 2HS5A 4XRFA 2RN7A 3TDUC 2Z9OA 2A3SA 4RB2C 3PFIA 1ODDA 1XGSA 2XKPA 4MNUA 4BHPA 1HSJA 4N0BA 5D6EA 1LDKB 2ZFWA 1Z9CA 3HYIA 1MDMB 2GIVA 2A69F 4P96A 3KZZA 3V4GA 2Z5UA 5K5QA 1FP2A 3RYRA 1IRFA 3BZ6A 4ENKA 1XSDA 5K5OA 2VODA 3K1NA 4ENMA 3ZN1A 5LLQA 2J5PA 2KIFA 5D5WB 2DK5A 4LG0A 3L09A 4ZYEA 1H9GA 2ISZA 1TTYA 4BQAA 2EFWA 3O3KA 4L9NA 1XGNA 5AIPA 3IHUA 3K9TA 3V8KA 2ZMEA 5HLIA 4R8HA 3WTTC 2RNJA 1A04A 3F3XA 4E70A 4EVIA 2GAUA 4WXCA 2A61A 2QM3A 2B0LA 5DV5A 2DI3A 1RIOH 3S2WA 3IKVA 1T38A 3MFKA 4N9HA 3E5QA 1FWZA 4CDGA 5HDGA 2L3DA 3WTYC 1I1GA 2CFXA 3IKTA 3CLOA 3BPXA 2VOPA 1G3TA 1KU2A 3KZYA 3CUQA 3D5LA 4M71A 2ZKZA 2R3SA 5L3EA 5LEJA 1BN5A 3WTXC 4NHJA 2KJBA 4XSXF 3E3VA 3JW4A 5CYVA 4S05A 5F1RA 5ICCA 2BYVE 3ML6A 4ESBA 3HRSA 1U3EM 2EFQA 1O57A 1KGSA 2IJLA 3GUDA 2E7XA 2V1XA 2P7VB 5HDNA 4MEXF 4RAZA 3Q5FA 3J81K 5FFXA 3FM3A 3DP7A 2OU2A 4L5IA 1K78A 2W85A 5BPDA 4KMFA 3WU1B 4L18B 1KA8A 4CHUA 4QLCU 5BQTA 2JPCA 4D0PA 2LSOA 5ICEA 1E2XA 5A2QZ 4B8XA 2FBKA 3B02A 1BJAA 3U1DA 2XAJA 4ASNA 3IRQA 4A6DA 1DPUA 2JRTA 1D8JA 3ULQB 1FLIA 2PMHA 3SHFA 1EH7A 1U5TB 2VT2A 1K79A 2DBBA 2M1BA 5LRRA 4A0XA 1ZG3A 2EV0A 3F72A 5KVRA 3QOPA 5HLGA 5HLHA 1FX7A 4GYGA 2DPDA 2Z33A 3RJPA 4Y15A 3QAHA 3DQVC 5H6QA 2E1CA 1VTNC 4KDPA 1E17A 1QBJA 2NNNA 2ZNYA 1QO0D 4WX9A 2O0YA 2P4WA 3FWEA 3LA2A 5LRSA 1T39A 4L0ZB 3LQQA 3FMQA 2AXLA 2G7HA 4I01A 4RGSA 2EV6A 2IPQX 3WU0A 2CWEA 4A0YA 3HSFA 2HYFA 4MQVA 5JFRA 2P7CB 4IHSA 4CICA 1F1ZA 1G3SA 3R60A 4LG0B 5JVTA 3WTWC 1G3WA 2V1DA 3QPTA 4G6QA 2GQQA 3I5UA 2FOKA 4MEYF 1FOKA 3FF5A 2OAZA 2ZMEB 1F9NA 3WGHA 1MZBA 2DPUA 2JSCA 1S7AA 1WI9A 3R0JA 2PMUA 2XAGA 3FXUA 2MLKA 1SD7A 2H6CA 2W24A 5J8CA 1BIBA 2QVOA 1FZPB 4M9ZA 2FBHA 2HZTA 2DAOA 2LF8A 2F5CA 2EFOA 2DT5A 1MJ9A 5L3FA 3RPQA 1HW2A 2CSOA 1ON1A 5LHGA 1TQMA 2BV6A 3ABUA 3BROA 2EB7A 1LQ1A 3CUQB 4HA8A 3MAJA 1USTA 2ETHA 1ZLJA 4CYDA 4EM0B 1BOAA 2F5EA 1MKMA 2YX4A 2QZ8A 2V6CA 3B73A 4CZZA 2KIMA 5L3GA 4WXDA 3KP6A 1K7AA 4O3MA 2CQKA 2L4MA 1RUNA 3J81Z 4OOIA 2FNAA 3GFIA 4HLYA 1P4AA 1BC7C 3K1MA 1REPC 3SQNA 4RB3C 4UV9A 3CTAA 5AONA 4M9XA 2CW0F 3QP5A 3EUHA 1TLHB 3F8NA 1B9MA 3KFWX 5CJ9A 4P9FA 4M74A 3HIFA 1F4KA 1K78B 1R23A 3FMRA 2DTRA 5E1XA 1U6GA 3I71A 4EM2A 4OIPF 1YLFA 2F2EA 2HTJA 3L9FA 4F7ZA 1HKSA 1O3QA 2E7WA 3TOAA 1QNTA 1FBUA 1R00A 5CVIA 5FFZA 1IN5A 2P6SA 3BJAA 4UXNA 3RIRA 4AD9A 2BBYA 4G94A 1HXDA 1W7PA 1STZA 2VBZA 3F8CA 1ZH5A 4LK1F 2FBIA 3TO7A 2OQRA 3EETA 2GZWA 4U88A 3WTUC 3LAJA 4EV0A 2DO7A 3FXQA 4I98B 4HZFA 4NB5A 3RI4A 1CGPA 1O7LA 1LEAA 1Z91A 4KIGA 3CDHA 5J8FA 2BGCA 4LB5A 2EFNA 2XROA 1MJBA 3DXJF 1ZAOA 1GXPA 4WWCA 3Q9VA 3HUGA 2P6TA 1F5TA 2LF7A 4IHTA 2PG4A 1ZRDA 4G7HF 1FBQA 1Q1HA 1TQPA 2M45A 5H20A 4PCQA 4QWQA 4A6EA 4HQEA 2P5LC 5DD8A 4G7OF 4A5MA 3ERED 1KYZA 4LFUA 3HRTA 3HOTA 3CJNA 1OMIA 3K2ZA 1LJ9A 2R7FA 3PQKA 2DQLA 2EK5A 3G3ZA 4PGGA 1K6OA 3F22A 3M1EA 2O3FA 2XASA 4L9VA 1HQCA 3IC7A 1FPQA 2HGCA 2WTEA 1J59A 1JXSA 3GVAA 3BPVA 4HV6A 2XUBA 1R36A 2P5KA 3BP8A 2HR3A 3GX4X 1JHFA 4RGUA 2L54A 1CF7A 1KQ8A 4JK1X 4S04A 4Q4ZF 5LGNA 3VB2A 3FXRA 3V8JA 1IXCA 4JBAA 2Y75A 4CXFA 5IT3A 2RGVA 3ISPA 4EJUA 1IF1A 3GZ6A 4OINF 2UWMA 4ZZDA 2MH2A 2EA4A 4O5VA 3R0AA 4PGHA 2YSRA 3I0TA 1WKMA 2DW4A 4MQ9F 2A68F 4ZYGA 1XDSA 4A5NA 1O3RA 3EYYA 3V7CA 1LNWA 1I1SA 2ZXJA 4KN4X 1V3FA 4M6YA 5D8KB 3H92A 2VBYA 1QGPA 3ZMDA 1PUEE 4AVPA 2X0LA 4HYEA 3KP3A 4I2OA 3GF2A 3N97A 3P9CA 3F6VA 3WGGA 3HRMA 4XSZF 3GZ5A 3CO6C 2IT0A 4OMYA 4YFNF 1FBSA 3ZMSA 5E8IA 2H27A 1TQIA 3BJ6A 4LLLA 2EV5A 1HW5A 3HTUA 1FNNA 4U0YA 3ZP5A 2DK8A 1AOYA 3E5XA 1YW9A 2OBPA 3FZVA 5HOOA 4KUMA 1V4RA 2VBWA 2H09A 3M7GA 1YS6A 1XB4A 2AS5F 1U8RA 5FO5A 2FMYA 2FEZA 1S7OA 1OKRA 3WODF 4Q48A 4I0AA 1QZYA 1W7PB 5ILUA 4A12A 4GGGA 2XIGA 2D2WA 5IT9K 4YIIA 2XAQA 5E17F 3QU6A 2G9WA 2Z99A 3RKYA 3MZHA 1HKQA 2VXZA 2STWA 1G3YA 1YIOA 4LB6B 3AAFA 2Q2EA 1W4MA 1YW7A 3HSEA 3ZMTA 3EQLF 2M8EA 3ABTA 4A0ZA 5ILSA 4IRHA 4PDKA 3VOEA 1I5ZA 3LQRA 3I59A 2EFPA 3F8FA 4HLXA 1ZGAA 3ELKA 1FY7A 1W5SA 4Q5SF 4HX4A 1U5TC 3L2CA 1IN6A 3ZMVA 3L00A 1Z6TA 3KP2A 2F5FA 1YQAA 1R1VA 3M9AA 2JPBA 3COAC 1PP8F 2ZBKA 2V9VA 4EQQA 4EGZA 4I7HA 2KRFA 4L0YB 5FLXK 4ON0A 1T98A 3WE2A 1QQIA 3GYHX 1R58A 2K02A 4AIKA 1R22A 2IA2A 1CF7B 4HDUA 4RB1A 4LLNA 3R61A 1PP7U 1OYIA 3Q9SA 2V79A 5EEHA 1XSXA 2CYYA 4U0VA 4AIHA 2W57A 1PDNC 2A6EF 2MLGA 2F5DA 3HSRA 1TW2A 1J2XA 1J5YA 4IJAA 2G7UA 4WCGA 1GHCA 1UHMA 4OMZA 2QQ9A 1KQ9A 3KP7A 3GO5A 5E1WA 1KYWA 4KFCA 3DKWA 3PQJA 4OU0A 3F8MA 4HF1A 2RV8A 2RKHA 1OR7A 3BWGA 2COMA 2H94A 5AIQA 2ESHA 1XCBA 2XVCA 1USSA 5JHUA 3RTRA 3LA3A 1TW3A 4EMSA 2TDXA 1FSHA 4HF0A 3DEUA 2FE3A 2ISYA 1ZRFA 3WG9A 1L0OC 2O61A 1J7KA 1ZGJA 2DFIA 2ZO4A 3WGIA 4ESJA 2ZJ2A 1T2KA 3KCCA 3CUQC 5BS6A 3LA7A 5CVUA 2CO5A 2GA2A 5K1YA 2W25A 4G9YA 3GWZA 5F64A 1H0MA 4O6JA 2FSWA 4L5JA 4LMYA 1S6LA 3MWMA 3DPTA 1IZ1A 5IT9Z 1ULYA 3W6KB 3SZTA 1EV7A 4L9TA 2UXNA 3HRUA 1ZLKA 4OIOF 3GFJA 4P9UA 3ZMUA 2DLLA 1S8NA 5LBQA 3KLOA 1SMTA 3LSTA 3OOPA 4TV7A 4KNYA 2LDUA 3QPHA 1P2FA 5LGUA 4UV8A 3GXOA 2PI0A 1SMYF 1YFHA 1KU3A 4BAYA 3ROUA 3JTHA 1MJAA 2KKOA 3REOA 3BDDA 1BI0A 3E6CC 3KE2A 1I27A 1UFMA 5FB2A 3QRFF 3DF8A 1R5GA 5HS7A 2R7DA 1XGMA 4MHGA 2UZKA 4UHTA 1FSEA 1SD4A 2A6HF 3I59B 2RC4A 2XAFA 2K86A 1KU7A 2PJPA 1GXQA 4RS8A 4A2UA 5FD6A 1UB9A 3TGNA 2L4AA 3ZPLA 2QQBA 1BI2A 3H3UA 1G6NA 1S3JA 2WC2A 5ICGA 5FLXZ 2H6BA 2L02A 3D0SA 2ESNA 5D5XB 3G73A 1FYLA 1YO5C 4YIFA 3W6JB 2EJRA 3RKXA 4BXUA 2X4HA 3RDIA 1ZG1A 1W5TA 3L7WA 2VC0A 3V8LA 4EJOA 3ECHA 5LHHA 4Z2YA 3FX3A 2PEXA 3JSPA 1BI1A 3VFZA 3R6SA 3VEPA 3IL2A 2VE9A 2QQAA 4LLGF 5DDGA 2D1HA 1KU9A 2VBXA 1SAXA 2OZUA 1YS7A 5DCFA 1D5VA 1IN8A 1J9IA 5DYMA 3HTSB 2FRHA 1FP1D 3IRRA 1RI7A 3JTGA 3O6BB 1IW7F 3RKWA 4I09A 1AWCA 3GEZA 5ED4A 2W84A 3RYPA 3WE3A 5CLSA 1B4AA 3MCZA 3K1PA 4WXHA 4R79A 2QBYA 4P55A 3P9IA 1WWXA 1WSUA 3F23A 4K2EA 5DUKA 3SZPA 1B6AA 3C7JA 2A5YB 3DPLC 3DFGA 4GCVA 4IRIA 1B9NA 4ENJA 3I58A 5ICFA 3KETA 1BC8C 4YFKF 1IUYA 1ZHFA 4XBFA 1LB2A 5E1ZB 3GLXA 3KLNA 3OV8A 1SFXA 5HS8A 4H0EA 2Q0OA 4HV5A 1P6RA 5ERIA 4HOBA 4FT8A 2IA1A 4MTEA 5L3CA 3NQOA 1SFUA 2EA2A 3BJOA 4PZJA 3DV8A 3MEXA 3E97A 4EJVA 4MTDA 3JAMK 2PQ8A 3NRVA 1I6XA 1XMKA 3QP6A 4M72A 2C6YA 2FF4A 3FMSA 1Z05A 1YW8A 4EM1A 2D45A 2K7LA 5D4SA 1T6SA 5L3DA 3EDPA 4IPAA 4M73A 2HDCA 2P8TA 4IF4A 1TNTA 1BM9A 4I02A 5D6FA 2LNBA 4KYWA 2HOEA 3IWZA 3H3ZA 2XV4S 4KICA 5BPIA 1JGSA 5F6FA 1FYMA 2MBFA 5JR3A 4KA4A 1S29A 2D1VA 1ZG5A 4HX8A 3MZYA 1YYVA 3ZQ7A 5DUIA 2EWNA 3SXYA 2IP2A 3TQNA 5H6RA 2PN6A 2MA3A 1DUXC 1LEBA 1IAWA 2Z3YA 3IWFA 3I53A 2BEOA 2ZNZA 1J0RA 1UHWA 5CVVA 1XN7A 4BH9A 2NYXA 2XKOA 2VN2A 3QU3A 4XLPF 2BE5F 2M87A 2JT1A 1DP7P 1XDUA 3RPUA 4XLNF 2VONA 4NQWA 4KIBA 3LWFA 4BYYA 3KP5A 5CVRA 4AIJA 3V7SA 4HW0A 1ZARA 3CO7C 2WV0A 3GFMA 3N4MA 4HAMA 2GXBA 2P5VA 4ENNA 1YTYA 4Q47A 3GFLA 4UNOA 2MC3A 3U9GA 2CGPA 3KP4A 1SD5A 1OYYA 4GYIA 2K27A 1BIAA 4OIRF 5HVQC 2K4BA 4ESFA 4LK0F 1UCRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LGT A;  3E6D A;  2NAZ A;  2O8X A;  1R1U A;  4JQF A;  3HHG A;  2HKO A;  4G8X A;  4YG2 F;  1KQ0 A;  2RDP A;  2FNP A;  1D8K A;  5LHI A;  3C18 A;  2NNY A;  3HHH A;  2GXG A;  4DNC A;  4CO8 A;  2XRN A;  1DPR A;  4P5O A;  2L01 A;  5BMZ A;  4BNC A;  3E6M A;  2OD5 A;  4L9J A;  2QBY B;  4M6X A;  3CUO A;  3FM5 A;  3TOB A;  1WRJ A;  4U7D A;  2JTV A;  1QPM A;  3U2R A;  2CG4 A;  2PFB A;  4M9S A;  3T8T A;  1B59 A;  4LGW A;  4WK8 F;  4Y13 A;  1IXS B;  2QWW A;  2UXX A;  3ZMZ A;  2IW5 A;  6PAX A;  1NHA A;  4LJZ F;  1MD0 A;  5E18 F;  4KT5 C;  5TRD A;  2HYG D;  2FXA A;  1O3T A;  4B09 A;  2ADU A;  1R1T A;  2VOO A;  3T1B A;  3V7R A;  1RZ4 A;  1RUO A;  3JAM Z;  3WTZ A;  1L3L A;  3ECO A;  5D8L B;  3I64 A;  1Z1D A;  1W7P D;  4GXO A;  3C3W A;  2QEN A;  4CGZ A;  2HQR A;  2RQP A;  3T0Y A;  3T8R A;  2IA0 A;  4EGY A;  5DCM A;  5E8G A;  5ILV A;  1X3U A;  3TO6 A;  2HKX A;  2QLZ A;  2HQN A;  4R1H A;  1FYK A;  3FHZ A;  2FA5 A;  3J7A O;  2OQG A;  3J80 K;  3WTV C;  4ZZL A;  3M8E A;  1Z7U A;  5EEG A;  3O2P E;  2ACJ A;  2V1U A;  2Y0M A;  3C1D A;  3K0L A;  3JSO A;  4U0W A;  3HOS A;  4KIF A;  4ZYD A;  2PLY A;  1IXR C;  3VOD A;  2E1N A;  5D5U B;  2ZCW A;  1ZRC A;  2HEO A;  2J5O A;  2YX7 A;  1P4W A;  3EYI A;  1O3S A;  4UVC A;  3WTS C;  1IN4 A;  1J75 A;  5J6X A;  4RAY A;  3E6B A;  5TJJ A;  1MDM A;  2XGX A;  3T5X A;  2K4J A;  1SFE A;  4UUV A;  2LKP A;  4AWX B;  4ETS A;  2GWR A;  2KIU A;  5K5R A;  4KMU X;  1HBX G;  1H9T A;  2ELH A;  2A07 F;  4G7Z F;  4RGX A;  2YR2 A;  4N9I A;  1EH6 A;  5FGM A;  1U2W A;  1R7J A;  5L3B A;  2M5W A;  4BHC A;  1LDJ A;  2QYO A;  1HW1 A;  1QZZ A;  1MGT A;  2DU9 A;  2M30 A;  3TDZ C;  4HQM A;  1XGO A;  4RB0 A;  3I4P A;  3F6O A;  2FQ3 A;  1T0F A;  4IRG A;  2DQR A;  2VE8 A;  1BBY A;  4EJT A;  1RNL A;  3LFK A;  3K69 A;  4U7B A;  4HF2 A;  1XSV A;  4UVA A;  2O6G E;  2HFH A;  3P7N A;  1JE8 A;  2OZ6 A;  4KN7 X;  1DDN A;  1WQ2 A;  5FD5 A;  2FU4 A;  2QUF A;  2RVC A;  3NEU A;  3BY6 A;  2KJC A;  1O7F A;  2JZY A;  2YU3 A;  4GO1 A;  5JI6 A;  4IVN A;  2VC1 A;  2IVM A;  2MH9 A;  5KK1 A;  3P9K A;  2YPR A;  1Z6R A;  1OYW A;  4HDV A;  1YG2 A;  4LD5 A;  5E20 A;  3R4K A;  2VT3 A;  4ZH4 F;  1D3Y A;  1GVJ A;  2OA4 A;  4EJW A;  3SFZ A;  3BOQ A;  3TO9 A;  4DQ2 A;  4Y17 A;  2HTS A;  1TBX A;  4HBL A;  3E5U A;  2Y48 A;  1ZRE A;  1OPC A;  2GA1 A;  2O03 A;  3KEQ A;  4ZYH A;  1ZN2 A;  2NRA C;  3MQ0 A;  1SD6 A;  4FX0 A;  1ON2 A;  1TNS A;  1G4D A;  1BI3 A;  5BOX A;  2STT A;  4MGR A;  4OIQ F;  1XMA A;  3F8B A;  5D5V B;  2NS0 A;  1IN7 A;  3TKY A;  2XAH A;  4IXA A;  5DD4 A;  2HWV A;  3GW2 A;  4I0B A;  3LAP A;  5CVJ A;  3ZN0 A;  2IRF G;  3J80 Z;  5HDK A;  1C0W A;  3F21 A;  1Y0U A;  1ONV A;  2MD5 A;  5D4R A;  5DEQ A;  3I54 A;  1EH8 A;  1FT9 A;  1P92 A;  4HX7 A;  5DCM B;  4BHB A;  1HKT A;  4FHT A;  1R5H A;  1ZYR F;  3M8F A;  2Q8K A;  1XD7 A;  1LVA A;  1XCV A;  1U5T A;  4RGR A;  4FX4 A;  2WWY A;  4YFX F;  2FML A;  1JHH A;  1FC3 A;  1LDD A;  3KEO A;  5LEK A;  4WF2 A;  4UVB A;  1IRG A;  5A2Q K;  4G6D A;  2XHK A;  1P4X A;  1U78 A;  5HS9 A;  1HST A;  1B1B A;  2PBI A;  2HS5 A;  4XRF A;  2RN7 A;  3TDU C;  2Z9O A;  2A3S A;  4RB2 C;  3PFI A;  1ODD A;  1XGS A;  2XKP A;  4MNU A;  4BHP A;  1HSJ A;  4N0B A;  5D6E A;  1LDK B;  2ZFW A;  1Z9C A;  3HYI A;  1MDM B;  2GIV A;  2A69 F;  4P96 A;  3KZZ A;  3V4G A;  2Z5U A;  5K5Q A;  1FP2 A;  3RYR A;  1IRF A;  3BZ6 A;  4ENK A;  1XSD A;  5K5O A;  2VOD A;  3K1N A;  4ENM A;  3ZN1 A;  5LLQ A;  2J5P A;  2KIF A;  5D5W B;  2DK5 A;  4LG0 A;  3L09 A;  4ZYE A;  1H9G A;  2ISZ A;  1TTY A;  4BQA A;  2EFW A;  3O3K A;  4L9N A;  1XGN A;  5AIP A;  3IHU A;  3K9T A;  3V8K A;  2ZME A;  5HLI A;  4R8H A;  3WTT C;  2RNJ A;  1A04 A;  3F3X A;  4E70 A;  4EVI A;  2GAU A;  4WXC A;  2A61 A;  2QM3 A;  2B0L A;  5DV5 A;  2DI3 A;  1RIO H;  3S2W A;  3IKV A;  1T38 A;  3MFK A;  4N9H A;  3E5Q A;  1FWZ A;  4CDG A;  5HDG A;  2L3D A;  3WTY C;  1I1G A;  2CFX A;  3IKT A;  3CLO A;  3BPX A;  2VOP A;  1G3T A;  1KU2 A;  3KZY A;  3CUQ A;  3D5L A;  4M71 A;  2ZKZ A;  2R3S A;  5L3E A;  5LEJ A;  1BN5 A;  3WTX C;  4NHJ A;  2KJB A;  4XSX F;  3E3V A;  3JW4 A;  5CYV A;  4S05 A;  5F1R A;  5ICC A;  2BYV E;  3ML6 A;  4ESB A;  3HRS A;  1U3E M;  2EFQ A;  1O57 A;  1KGS A;  2IJL A;  3GUD A;  2E7X A;  2V1X A;  2P7V B;  5HDN A;  4MEX F;  4RAZ A;  3Q5F A;  3J81 K;  5FFX A;  3FM3 A;  3DP7 A;  2OU2 A;  4L5I A;  1K78 A;  2W85 A;  5BPD A;  4KMF A;  3WU1 B;  4L18 B;  1KA8 A;  4CHU A;  4QLC U;  5BQT A;  2JPC A;  4D0P A;  2LSO A;  5ICE A;  1E2X A;  5A2Q Z;  4B8X A;  2FBK A;  3B02 A;  1BJA A;  3U1D A;  2XAJ A;  4ASN A;  3IRQ A;  4A6D A;  1DPU A;  2JRT A;  1D8J A;  3ULQ B;  1FLI A;  2PMH A;  3SHF A;  1EH7 A;  1U5T B;  2VT2 A;  1K79 A;  2DBB A;  2M1B A;  5LRR A;  4A0X A;  1ZG3 A;  2EV0 A;  3F72 A;  5KVR A;  3QOP A;  5HLG A;  5HLH A;  1FX7 A;  4GYG A;  2DPD A;  2Z33 A;  3RJP A;  4Y15 A;  3QAH A;  3DQV C;  5H6Q A;  2E1C A;  1VTN C;  4KDP A;  1E17 A;  1QBJ A;  2NNN A;  2ZNY A;  1QO0 D;  4WX9 A;  2O0Y A;  2P4W A;  3FWE A;  3LA2 A;  5LRS A;  1T39 A;  4L0Z B;  3LQQ A;  3FMQ A;  2AXL A;  2G7H A;  4I01 A;  4RGS A;  2EV6 A;  2IPQ X;  3WU0 A;  2CWE A;  4A0Y A;  3HSF A;  2HYF A;  4MQV A;  5JFR A;  2P7C B;  4IHS A;  4CIC A;  1F1Z A;  1G3S A;  3R60 A;  4LG0 B;  5JVT A;  3WTW C;  1G3W A;  2V1D A;  3QPT A;  4G6Q A;  2GQQ A;  3I5U A;  2FOK A;  4MEY F;  1FOK A;  3FF5 A;  2OAZ A;  2ZME B;  1F9N A;  3WGH A;  1MZB A;  2DPU A;  2JSC A;  1S7A A;  1WI9 A;  3R0J A;  2PMU A;  2XAG A;  3FXU A;  2MLK A;  1SD7 A;  2H6C A;  2W24 A;  5J8C A;  1BIB A;  2QVO A;  1FZP B;  4M9Z A;  2FBH A;  2HZT A;  2DAO A;  2LF8 A;  2F5C A;  2EFO A;  2DT5 A;  1MJ9 A;  5L3F A;  3RPQ A;  1HW2 A;  2CSO A;  1ON1 A;  5LHG A;  1TQM A;  2BV6 A;  3ABU A;  3BRO A;  2EB7 A;  1LQ1 A;  3CUQ B;  4HA8 A;  3MAJ A;  1UST A;  2ETH A;  1ZLJ A;  4CYD A;  4EM0 B;  1BOA A;  2F5E A;  1MKM A;  2YX4 A;  2QZ8 A;  2V6C A;  3B73 A;  4CZZ A;  2KIM A;  5L3G A;  4WXD A;  3KP6 A;  1K7A A;  4O3M A;  2CQK A;  2L4M A;  1RUN A;  3J81 Z;  4OOI A;  2FNA A;  3GFI A;  4HLY A;  1P4A A;  1BC7 C;  3K1M A;  1REP C;  3SQN A;  4RB3 C;  4UV9 A;  3CTA A;  5AON A;  4M9X A;  2CW0 F;  3QP5 A;  3EUH A;  1TLH B;  3F8N A;  1B9M A;  3KFW X;  5CJ9 A;  4P9F A;  4M74 A;  3HIF A;  1F4K A;  1K78 B;  1R23 A;  3FMR A;  2DTR A;  5E1X A;  1U6G A;  3I71 A;  4EM2 A;  4OIP F;  1YLF A;  2F2E A;  2HTJ A;  3L9F A;  4F7Z A;  1HKS A;  1O3Q A;  2E7W A;  3TOA A;  1QNT A;  1FBU A;  1R00 A;  5CVI A;  5FFZ A;  1IN5 A;  2P6S A;  3BJA A;  4UXN A;  3RIR A;  4AD9 A;  2BBY A;  4G94 A;  1HXD A;  1W7P A;  1STZ A;  2VBZ A;  3F8C A;  1ZH5 A;  4LK1 F;  2FBI A;  3TO7 A;  2OQR A;  3EET A;  2GZW A;  4U88 A;  3WTU C;  3LAJ A;  4EV0 A;  2DO7 A;  3FXQ A;  4I98 B;  4HZF A;  4NB5 A;  3RI4 A;  1CGP A;  1O7L A;  1LEA A;  1Z91 A;  4KIG A;  3CDH A;  5J8F A;  2BGC A;  4LB5 A;  2EFN A;  2XRO A;  1MJB A;  3DXJ F;  1ZAO A;  1GXP A;  4WWC A;  3Q9V A;  3HUG A;  2P6T A;  1F5T A;  2LF7 A;  4IHT A;  2PG4 A;  1ZRD A;  4G7H F;  1FBQ A;  1Q1H A;  1TQP A;  2M45 A;  5H20 A;  4PCQ A;  4QWQ A;  4A6E A;  4HQE A;  2P5L C;  5DD8 A;  4G7O F;  4A5M A;  3ERE D;  1KYZ A;  4LFU A;  3HRT A;  3HOT A;  3CJN A;  1OMI A;  3K2Z A;  1LJ9 A;  2R7F A;  3PQK A;  2DQL A;  2EK5 A;  3G3Z A;  4PGG A;  1K6O A;  3F22 A;  3M1E A;  2O3F A;  2XAS A;  4L9V A;  1HQC A;  3IC7 A;  1FPQ A;  2HGC A;  2WTE A;  1J59 A;  1JXS A;  3GVA A;  3BPV A;  4HV6 A;  2XUB A;  1R36 A;  2P5K A;  3BP8 A;  2HR3 A;  3GX4 X;  1JHF A;  4RGU A;  2L54 A;  1CF7 A;  1KQ8 A;  4JK1 X;  4S04 A;  4Q4Z F;  5LGN A;  3VB2 A;  3FXR A;  3V8J A;  1IXC A;  4JBA A;  2Y75 A;  4CXF A;  5IT3 A;  2RGV A;  3ISP A;  4EJU A;  1IF1 A;  3GZ6 A;  4OIN F;  2UWM A;  4ZZD A;  2MH2 A;  2EA4 A;  4O5V A;  3R0A A;  4PGH A;  2YSR A;  3I0T A;  1WKM A;  2DW4 A;  4MQ9 F;  2A68 F;  4ZYG A;  1XDS A;  4A5N A;  1O3R A;  3EYY A;  3V7C A;  1LNW A;  1I1S A;  2ZXJ A;  4KN4 X;  1V3F A;  4M6Y A;  5D8K B;  3H92 A;  2VBY A;  1QGP A;  3ZMD A;  1PUE E;  4AVP A;  2X0L A;  4HYE A;  3KP3 A;  4I2O A;  3GF2 A;  3N97 A;  3P9C A;  3F6V A;  3WGG A;  3HRM A;  4XSZ F;  3GZ5 A;  3CO6 C;  2IT0 A;  4OMY A;  4YFN F;  1FBS A;  3ZMS A;  5E8I A;  2H27 A;  1TQI A;  3BJ6 A;  4LLL A;  2EV5 A;  1HW5 A;  3HTU A;  1FNN A;  4U0Y A;  3ZP5 A;  2DK8 A;  1AOY A;  3E5X A;  1YW9 A;  2OBP A;  3FZV A;  5HOO A;  4KUM A;  1V4R A;  2VBW A;  2H09 A;  3M7G A;  1YS6 A;  1XB4 A;  2AS5 F;  1U8R A;  5FO5 A;  2FMY A;  2FEZ A;  1S7O A;  1OKR A;  3WOD F;  4Q48 A;  4I0A A;  1QZY A;  1W7P B;  5ILU A;  4A12 A;  4GGG A;  2XIG A;  2D2W A;  5IT9 K;  4YII A;  2XAQ A;  5E17 F;  3QU6 A;  2G9W A;  2Z99 A;  3RKY A;  3MZH A;  1HKQ A;  2VXZ A;  2STW A;  1G3Y A;  1YIO A;  4LB6 B;  3AAF A;  2Q2E A;  1W4M A;  1YW7 A;  3HSE A;  3ZMT A;  3EQL F;  2M8E A;  3ABT A;  4A0Z A;  5ILS A;  4IRH A;  4PDK A;  3VOE A;  1I5Z A;  3LQR A;  3I59 A;  2EFP A;  3F8F A;  4HLX A;  1ZGA A;  3ELK A;  1FY7 A;  1W5S A;  4Q5S F;  4HX4 A;  1U5T C;  3L2C A;  1IN6 A;  3ZMV A;  3L00 A;  1Z6T A;  3KP2 A;  2F5F A;  1YQA A;  1R1V A;  3M9A A;  2JPB A;  3COA C;  1PP8 F;  2ZBK A;  2V9V A;  4EQQ A;  4EGZ A;  4I7H A;  2KRF A;  4L0Y B;  5FLX K;  4ON0 A;  1T98 A;  3WE2 A;  1QQI A;  3GYH X;  1R58 A;  2K02 A;  4AIK A;  1R22 A;  2IA2 A;  1CF7 B;  4HDU A;  4RB1 A;  4LLN A;  3R61 A;  1PP7 U;  1OYI A;  3Q9S A;  2V79 A;  5EEH A;  1XSX A;  2CYY A;  4U0V A;  4AIH A;  2W57 A;  1PDN C;  2A6E F;  2MLG A;  2F5D A;  3HSR A;  1TW2 A;  1J2X A;  1J5Y A;  4IJA A;  2G7U A;  4WCG A;  1GHC A;  1UHM A;  4OMZ A;  2QQ9 A;  1KQ9 A;  3KP7 A;  3GO5 A;  5E1W A;  1KYW A;  4KFC A;  3DKW A;  3PQJ A;  4OU0 A;  3F8M A;  4HF1 A;  2RV8 A;  2RKH A;  1OR7 A;  3BWG A;  2COM A;  2H94 A;  5AIQ A;  2ESH A;  1XCB A;  2XVC A;  1USS A;  5JHU A;  3RTR A;  3LA3 A;  1TW3 A;  4EMS A;  2TDX A;  1FSH A;  4HF0 A;  3DEU A;  2FE3 A;  2ISY A;  1ZRF A;  3WG9 A;  1L0O C;  2O61 A;  1J7K A;  1ZGJ A;  2DFI A;  2ZO4 A;  3WGI A;  4ESJ A;  2ZJ2 A;  1T2K A;  3KCC A;  3CUQ C;  5BS6 A;  3LA7 A;  5CVU A;  2CO5 A;  2GA2 A;  5K1Y A;  2W25 A;  4G9Y A;  3GWZ A;  5F64 A;  1H0M A;  4O6J A;  2FSW A;  4L5J A;  4LMY A;  1S6L A;  3MWM A;  3DPT A;  1IZ1 A;  5IT9 Z;  1ULY A;  3W6K B;  3SZT A;  1EV7 A;  4L9T A;  2UXN A;  3HRU A;  1ZLK A;  4OIO F;  3GFJ A;  4P9U A;  3ZMU A;  2DLL A;  1S8N A;  5LBQ A;  3KLO A;  1SMT A;  3LST A;  3OOP A;  4TV7 A;  4KNY A;  2LDU A;  3QPH A;  1P2F A;  5LGU A;  4UV8 A;  3GXO A;  2PI0 A;  1SMY F;  1YFH A;  1KU3 A;  4BAY A;  3ROU A;  3JTH A;  1MJA A;  2KKO A;  3REO A;  3BDD A;  1BI0 A;  3E6C C;  3KE2 A;  1I27 A;  1UFM A;  5FB2 A;  3QRF F;  3DF8 A;  1R5G A;  5HS7 A;  2R7D A;  1XGM A;  4MHG A;  2UZK A;  4UHT A;  1FSE A;  1SD4 A;  2A6H F;  3I59 B;  2RC4 A;  2XAF A;  2K86 A;  1KU7 A;  2PJP A;  1GXQ A;  4RS8 A;  4A2U A;  5FD6 A;  1UB9 A;  3TGN A;  2L4A A;  3ZPL A;  2QQB A;  1BI2 A;  3H3U A;  1G6N A;  1S3J A;  2WC2 A;  5ICG A;  5FLX Z;  2H6B A;  2L02 A;  3D0S A;  2ESN A;  5D5X B;  3G73 A;  1FYL A;  1YO5 C;  4YIF A;  3W6J B;  2EJR A;  3RKX A;  4BXU A;  2X4H A;  3RDI A;  1ZG1 A;  1W5T A;  3L7W A;  2VC0 A;  3V8L A;  4EJO A;  3ECH A;  5LHH A;  4Z2Y A;  3FX3 A;  2PEX A;  3JSP A;  1BI1 A;  3VFZ A;  3R6S A;  3VEP A;  3IL2 A;  2VE9 A;  2QQA A;  4LLG F;  5DDG A;  2D1H A;  1KU9 A;  2VBX A;  1SAX A;  2OZU A;  1YS7 A;  5DCF A;  1D5V A;  1IN8 A;  1J9I A;  5DYM A;  3HTS B;  2FRH A;  1FP1 D;  3IRR A;  1RI7 A;  3JTG A;  3O6B B;  1IW7 F;  3RKW A;  4I09 A;  1AWC A;  3GEZ A;  5ED4 A;  2W84 A;  3RYP A;  3WE3 A;  5CLS A;  1B4A A;  3MCZ A;  3K1P A;  4WXH A;  4R79 A;  2QBY A;  4P55 A;  3P9I A;  1WWX A;  1WSU A;  3F23 A;  4K2E A;  5DUK A;  3SZP A;  1B6A A;  3C7J A;  2A5Y B;  3DPL C;  3DFG A;  4GCV A;  4IRI A;  1B9N A;  4ENJ A;  3I58 A;  5ICF A;  3KET A;  1BC8 C;  4YFK F;  1IUY A;  1ZHF A;  4XBF A;  1LB2 A;  5E1Z B;  3GLX A;  3KLN A;  3OV8 A;  1SFX A;  5HS8 A;  4H0E A;  2Q0O A;  4HV5 A;  1P6R A;  5ERI A;  4HOB A;  4FT8 A;  2IA1 A;  4MTE A;  5L3C A;  3NQO A;  1SFU A;  2EA2 A;  3BJO A;  4PZJ A;  3DV8 A;  3MEX A;  3E97 A;  4EJV A;  4MTD A;  3JAM K;  2PQ8 A;  3NRV A;  1I6X A;  1XMK A;  3QP6 A;  4M72 A;  2C6Y A;  2FF4 A;  3FMS A;  1Z05 A;  1YW8 A;  4EM1 A;  2D45 A;  2K7L A;  5D4S A;  1T6S A;  5L3D A;  3EDP A;  4IPA A;  4M73 A;  2HDC A;  2P8T A;  4IF4 A;  1TNT A;  1BM9 A;  4I02 A;  5D6F A;  2LNB A;  4KYW A;  2HOE A;  3IWZ A;  3H3Z A;  2XV4 S;  4KIC A;  5BPI A;  1JGS A;  5F6F A;  1FYM A;  2MBF A;  5JR3 A;  4KA4 A;  1S29 A;  2D1V A;  1ZG5 A;  4HX8 A;  3MZY A;  1YYV A;  3ZQ7 A;  5DUI A;  2EWN A;  3SXY A;  2IP2 A;  3TQN A;  5H6R A;  2PN6 A;  2MA3 A;  1DUX C;  1LEB A;  1IAW A;  2Z3Y A;  3IWF A;  3I53 A;  2BEO A;  2ZNZ A;  1J0R A;  1UHW A;  5CVV A;  1XN7 A;  4BH9 A;  2NYX A;  2XKO A;  2VN2 A;  3QU3 A;  4XLP F;  2BE5 F;  2M87 A;  2JT1 A;  1DP7 P;  1XDU A;  3RPU A;  4XLN F;  2VON A;  4NQW A;  4KIB A;  3LWF A;  4BYY A;  3KP5 A;  5CVR A;  4AIJ A;  3V7S A;  4HW0 A;  1ZAR A;  3CO7 C;  2WV0 A;  3GFM A;  3N4M A;  4HAM A;  2GXB A;  2P5V A;  4ENN A;  1YTY A;  4Q47 A;  3GFL A;  4UNO A;  2MC3 A;  3U9G A;  2CGP A;  3KP4 A;  1SD5 A;  1OYY A;  4GYI A;  2K27 A;  1BIA A;  4OIR F;  5HVQ C;  2K4B A;  4ESF A;  4LK0 F;  1UCR A; 
#chains in the Genus database with same CATH topology
 5LGT A;  3E6D A;  2NAZ A;  2O8X A;  4LOC A;  1R1U A;  1YRN B;  4JQF A;  3HHG A;  2HKO A;  4G8X A;  3CF2 A;  3H5R A;  4YG2 F;  1KQ0 A;  1R4N B;  2FNP A;  1D8K A;  2LFB A;  2RDP A;  2NVQ J;  5LHI A;  3C18 A;  2ZFU A;  1JTX A;  3V42 A;  1IUF A;  2NNY A;  2K40 A;  4U87 A;  2DFE A;  3OYH A;  4XKV A;  3HHH A;  2GXG A;  4DNC A;  1WH5 A;  2R7R A;  4CO8 A;  2XRN A;  1GT0 C;  1N77 A;  3BT9 A;  1DPR A;  4P5O A;  3C2G A;  2L01 A;  5BMZ A;  2FUG 2;  3IAS 2;  1WJC A;  2FX0 A;  3FXM A;  2EIN H;  2VJ5 A;  4BNC A;  3IAM 2;  4RMN A;  1N75 A;  3DKY A;  3E6M A;  2OD5 A;  4L9J A;  2QBY B;  2VQC A;  4M6X A;  3CUO A;  3KEY A;  4NC7 A;  3FM5 A;  3TOB A;  3J7A Y;  1WRJ A;  2L7Z A;  4U7D A;  1PJR A;  4ZTJ A;  2JTV A;  1QPM A;  3U2R A;  1WJF A;  2CG4 A;  2PFB A;  2XRL A;  2V26 A;  4M9S A;  3T8T A;  1B59 A;  4LGW A;  3L2U A;  4WK8 F;  4Y13 A;  3M4O J;  1VFC A;  1IXS B;  2ZXI A;  4DIQ A;  2JVG A;  2QWW A;  1OCP A;  4XKW A;  2HXI A;  2UXX A;  3ZMZ A;  2IW5 A;  2IGO A;  1K6Y A;  2GOM A;  6PAX A;  2Y0S A;  1NHA A;  4LJZ F;  2FOW A;  5C44 J;  1MD0 A;  2ZSH B;  5E18 F;  4KT5 C;  5TRD A;  2HYG D;  2FXA A;  1MH3 A;  2WAE A;  3FBI B;  3ZR8 X;  5GAE J;  1O3T A;  4DYQ A;  4B09 A;  4FET A;  2ADU A;  1R1T A;  4ZJZ A;  3PNY A;  1TT5 B;  2QCO A;  2VOO A;  1UAA A;  1LVK A;  1D0Z A;  4JOM A;  3T1B A;  3DBL B;  3V7R A;  3S1M J;  1Y8R B;  1RZ4 A;  2QQ8 A;  3HKZ N;  1RUO A;  3JAM Z;  3WTZ A;  3ZQG A;  4FIS A;  1L3L A;  3BLY A;  3ECO A;  1LFB A;  5D8L B;  3I64 A;  1Z1D A;  2OJE D;  1W7P D;  2ID3 A;  3MZ8 A;  3C3W A;  2QEN A;  4GXO A;  4CA0 A;  5F04 A;  3BQY A;  4CGZ A;  4I76 A;  4OAY A;  3FKI J;  2HQR A;  2RQP A;  2ID6 A;  3T0Y A;  2IA0 A;  4M3E A;  3BTI A;  3T8R A;  1RKW A;  2KIS A;  2QGU A;  4EGY A;  5FRN A;  5DCM A;  5E8G A;  2JUG A;  5ILV A;  1X3U A;  2VUM J;  3TO6 A;  4PJJ A;  2EPF A;  2HKX A;  2I10 A;  1H88 C;  2QLZ A;  2HQN A;  4I99 C;  4R1H A;  1F36 A;  3FHZ A;  2FA5 A;  4A69 C;  2BHY A;  1FYK A;  3J7A O;  2R7W A;  2OQG A;  2QKM B;  4CZC A;  4G6T B;  4KT6 A;  3J80 K;  1TC3 C;  3WTV C;  4ZZL A;  2TCT A;  1VQK I;  3M8E A;  1Z7U A;  5EEG A;  5B5E C;  2FJ1 A;  2HVQ A;  3O2P E;  3OYA A;  5E3M A;  2ACJ A;  1K4T A;  2V1U A;  1YX3 A;  1ZTR A;  4W97 A;  4KIS A;  2Y0M A;  1YX5 A;  1V54 H;  3C1D A;  3K0L A;  1JKR C;  3JSO A;  2H8R A;  1QU3 A;  4U0W A;  3OYG A;  2CJJ A;  5GAG J;  3HOS A;  4KIF A;  4ZYD A;  2PLY A;  5FRO A;  2BW3 A;  2NS7 A;  1IXR C;  3VOD A;  1SEU A;  5FKL A;  2E1N A;  5D5U B;  1VQ7 I;  2ZCW A;  1ZRC A;  2HEO A;  2J5O A;  2YX7 A;  1P4W A;  3SYT A;  3PFY A;  1YJW I;  1O3S A;  3RQI A;  1AKH A;  4UVC A;  3EYI A;  3WTS C;  1IN4 A;  2RRE A;  1MMD A;  3H0D A;  1J75 A;  4CCN A;  3OYN A;  3OYD A;  3ESW B;  2AXT C;  2DCE A;  3VWB A;  5J6X A;  2WAQ N;  2CQX A;  3CES A;  4RAY A;  3CF5 F;  1YE9 A;  2GBY A;  3E6B A;  1SFO J;  2VKE A;  1ETK A;  2M4G A;  5TJJ A;  1MDM A;  1MSF C;  5J4V A;  3OS1 A;  2XGX A;  1QPI A;  3PJR A;  4UB6 C;  3T5X A;  1I39 A;  2K4J A;  1X1P A;  3ASO H;  1SFE A;  4UUV A;  3BR1 A;  2LKP A;  3JRI A;  2XGE A;  2XSJ C;  5GPA A;  1WJD A;  4XLF A;  4AWX B;  3CDI A;  4ETS A;  2WAF A;  2GWR A;  2KIU A;  5K5R A;  4KMU X;  1HBX G;  1X1B A;  1Y6I A;  3LSG A;  4C30 A;  3S1R J;  2MW8 A;  3P5J A;  4X0G A;  3JR9 A;  1H9T A;  2ELH A;  4BU2 A;  1ERD A;  2O7O A;  2CQ7 A;  1FJL A;  1ETV A;  2A07 F;  4G7Z F;  4N4O B;  4RGX A;  2YR2 A;  4N9I A;  1EH6 A;  5FGM A;  3BZK A;  2K85 A;  3Q0U A;  5B66 C;  1U2W A;  4CCL A;  1R7J A;  5L3B A;  4IEJ A;  4AVZ A;  2M5W A;  5EZG A;  4BHC A;  1MBG A;  2EQR A;  2DJI A;  1LDJ A;  4IOC F;  2VKV A;  2QYO A;  1HW1 A;  1QZZ A;  4RDU A;  1MGT A;  2DU9 A;  2M30 A;  3TDZ C;  4MFE A;  4FAS D;  3OYM A;  4HQM A;  1XGO A;  1IGN A;  2D5V A;  1BL0 A;  2K9S A;  4RB0 A;  3I4P A;  3N05 A;  3F6O A;  1IO2 A;  2EH3 A;  2FQ3 A;  3A02 A;  4RBO A;  1RR7 A;  1JKQ C;  3WG7 H;  1T0F A;  1ZK8 A;  4DGW B;  1ZR2 A;  3CJQ B;  4NQW B;  4IRG A;  2DQR A;  4ZDP A;  2VE8 A;  1BBY A;  4BQQ A;  4EJT A;  2DYR H;  3QQA A;  1RNL A;  2CV0 A;  3LL7 A;  2QSH X;  2X48 A;  3LFK A;  3K69 A;  4U7B A;  2CW8 A;  3CC2 I;  1XSV A;  4UVA A;  4HF2 A;  2O6G E;  3OL3 A;  2LD5 A;  1TWG J;  1JUS A;  2HFH A;  3P7N A;  2OZ6 A;  1JE8 A;  4KN7 X;  1DDN A;  2LKX A;  1WQ2 A;  3DEW A;  5FD5 A;  5M5W J;  2FU4 A;  2QUF A;  5GAD J;  3M8J A;  3A01 A;  2RVC A;  3NEU A;  1X1D A;  2CV1 A;  4HSR A;  4XLA A;  3BY6 A;  4RLQ A;  2PJR B;  2KJC A;  2PX9 A;  1O7F A;  1SC7 A;  2JZY A;  2YU3 A;  4GO1 A;  2QSG X;  2B9S A;  5JI6 A;  4RM3 A;  5IYC J;  4IVN A;  2VC1 A;  1T8I A;  2IVM A;  2MH9 A;  5KK1 A;  4AYB A;  1A35 A;  1A31 A;  5J1Y A;  3P9K A;  1Z0X A;  4E7K A;  1QA6 A;  2YPR A;  1Z6R A;  4ZC3 A;  1NK2 P;  1OYW A;  2KQR A;  2BY2 A;  4HDV A;  1WHU A;  1S9H A;  2VL8 A;  4YEJ A;  1YG2 A;  4LD5 A;  5E20 A;  1R5I D;  3R4K A;  2VT3 A;  4ZH4 F;  4II2 A;  2IS2 A;  2XAU A;  2ME0 A;  1D3Y A;  1GVJ A;  2OA4 A;  3I4M J;  3BQZ A;  5J1U A;  4EJW A;  3IH4 A;  3F0C A;  3SFZ A;  3BCB A;  3BOQ A;  3TO9 A;  1MMA A;  1MMN A;  4DQ2 A;  4Y17 A;  2XPU A;  2HTS A;  1TBX A;  2DA3 A;  4HBL A;  2X6X A;  3E5U A;  1FOW A;  2Y48 A;  1ZRE A;  1OPC A;  2GA1 A;  2O03 A;  5FRM A;  3GTQ J;  3KEQ A;  4ZYH A;  1ZN2 A;  2NRA C;  3MQ0 A;  1SD6 A;  4FX0 A;  3AG2 H;  2NS8 A;  1ON2 A;  1TNS A;  2M7A A;  1G4D A;  1BI3 A;  5BOX A;  2STT A;  4MGR A;  4PUS A;  2KRH A;  4OIQ F;  1XMA A;  3F8B A;  5D5V B;  2VXD A;  1FIP A;  2NS0 A;  2XB5 A;  1GV5 A;  1IN7 A;  3TKY A;  2XAH A;  3DBH B;  4IXA A;  3NWT A;  2ZB9 A;  5DD4 A;  2HWV A;  3GW2 A;  4I0B A;  3KZI C;  2E1M B;  3LAP A;  1GLN A;  2IEK A;  5CVJ A;  3ZN0 A;  2IRF G;  3J80 Z;  5HDK A;  1C0W A;  2Y69 H;  3F21 A;  1Y0U A;  1ONV A;  1TWC J;  1A5J A;  2MD5 A;  2ZXW H;  3RPU D;  3JCU C;  4J01 A;  5D4R A;  4HEA 2;  5DEQ A;  3I54 A;  3VPR A;  4QTR A;  1EH8 A;  1FT9 A;  1P92 A;  4HX7 A;  5DCM B;  5EZH A;  3HL2 A;  4BHB A;  3PNV A;  4B1R A;  1HKT A;  4FHT A;  3SEQ A;  1R5H A;  1ZYR F;  3M8F A;  2Q8K A;  2HU9 A;  5EG0 A;  1XD7 A;  2O8K A;  1LVA A;  4YRV A;  1XCV A;  2DTZ A;  3TL4 X;  4FTH A;  1U5T A;  1OR7 C;  2HDD A;  3AL0 C;  2OCE A;  4RGR A;  2WWY A;  4FX4 A;  4BEH A;  4YFX F;  2FML A;  1JHH A;  1FC3 A;  3LSI A;  3OMY A;  1LDD A;  2M4K A;  3KEO A;  5LEK A;  4WF2 A;  3WU2 C;  4UVB A;  1IRG A;  1T56 A;  2R93 J;  3VSL A;  4HST A;  5A2Q K;  4G6D A;  2K9L A;  2VQH A;  2XHK A;  1YI2 I;  3JRB A;  1P4X A;  5IOY A;  1U78 A;  3BG6 A;  2DN0 A;  2BW3 B;  1WVR A;  3K7A J;  5HS9 A;  1VQ8 I;  1V5E A;  3KYL A;  2HQ5 A;  1HST A;  1B1B A;  2PBI A;  2HS5 A;  4XRF A;  3RZD J;  1AKH B;  2RN7 A;  4BBS J;  3TDU C;  2Z9O A;  2A3S A;  4HNT A;  4RB2 C;  3PFI A;  1ODD A;  1XGS A;  2XKP A;  1O4X A;  4Y33 A;  4MNU A;  4BGD A;  1UZC A;  1HSJ A;  4N0B A;  5D6E A;  1LDK B;  4BHP A;  5K7Z A;  2ZFW A;  1VZ0 A;  1D1B A;  1Z9C A;  3HYI A;  3DU5 A;  3OYE A;  1ACI A;  1MDM B;  2HI3 A;  2GIV A;  4Y52 J;  2A69 F;  4P96 A;  3KZZ A;  1ETX A;  3V4G A;  2Z5U A;  2EIL H;  1TL8 A;  5K5Q A;  1FP2 A;  1GV2 A;  3H3V K;  3RYR A;  1IRF A;  2LP0 A;  3BZ6 A;  4B3X A;  4OAZ A;  4ENK A;  1XSD A;  3CCE I;  5K5O A;  1I3Q J;  2R5Y A;  2VOD A;  2DT6 A;  3K1N A;  4ENM A;  3W2A A;  1DU0 A;  3ZN1 A;  5LLQ A;  2E71 A;  5LFA A;  2J5P A;  2KIF A;  1ZR4 A;  5D5W B;  2DK5 A;  4LG0 A;  2CV2 A;  2BXY A;  2RNG A;  3L09 A;  5K7F A;  4ZYE A;  1H9G A;  2ISZ A;  4ZYA A;  1TTY A;  4BQA A;  3VYT B;  4XON A;  2EFW A;  3LNQ A;  1BR2 A;  3O3K A;  4L9N A;  1XGN A;  5AIP A;  4CYC A;  3IHU A;  3G1M A;  3K9T A;  3V8K A;  2W82 A;  2DXI A;  2ZME A;  3FK7 A;  3ZQF A;  3QYB A;  3JRG A;  3GBG A;  2NOJ B;  4R8H A;  5HLI A;  3PM1 A;  3WTT C;  2RNJ A;  5J3L A;  1A04 A;  3F3X A;  2Z2S B;  4X1E A;  1MNE A;  2VB6 A;  2UV1 A;  3OYL A;  1APL C;  3TP0 A;  3K4J A;  4E70 A;  4EVI A;  2GAU A;  4WXC A;  4BXF A;  2A61 A;  2OPT A;  2Y2Z A;  1BA5 A;  2QM3 A;  3OL4 A;  2B0L A;  3MKY B;  2QSF X;  5DV5 A;  2DI3 A;  1RIO H;  3S2W A;  3VDX A;  3IKV A;  1RES A;  1T38 A;  3CC7 I;  3MFK A;  4LIV A;  2KZG A;  4N9H A;  1QZE A;  3E5Q A;  4BDY A;  1FWZ A;  1GVD A;  2A6T A;  3A01 B;  2X85 A;  2EZK A;  4CDG A;  5HDG A;  1V5F A;  2L3D A;  3WTY C;  1XS9 A;  1I1G A;  2CRG A;  2CFX A;  3IKT A;  3CLO A;  4AID A;  3S2H J;  3BPX A;  2R92 J;  2VOP A;  3H9G A;  1G3T A;  3G4S I;  4F55 A;  1KU2 A;  4XLH A;  3QWL A;  3KZY A;  3CUQ A;  3AG4 H;  3D5L A;  4M71 A;  4A3M J;  2DA2 A;  2ZKZ A;  1YJ9 I;  4BQO A;  2R7T A;  2R3S A;  5L3E A;  5LEJ A;  3ZOB A;  1BN5 A;  3WTX C;  4NHJ A;  3E1S A;  2KJB A;  2K9Q A;  3BZC A;  4XSX F;  2LRD A;  1Y1V J;  2EIJ H;  2QKL B;  3E3V A;  4H4K C;  3JW4 A;  5CYV A;  3GME A;  4S05 A;  5F1R A;  3CJT B;  5ICC A;  2BYV E;  2W1O A;  3FXJ A;  3TP3 A;  1E3H A;  1POG A;  3CLQ A;  2Z1D A;  3ML6 A;  4ESB A;  1B8I A;  3HRS A;  3K70 C;  1U3E M;  3OIO A;  4Y4R A;  2EFQ A;  1MBJ A;  1O57 A;  1KGS A;  2BVM A;  2ICW G;  3H9J A;  2E2I J;  1R6R A;  4BDZ A;  2IJL A;  1ZEL A;  3U21 A;  3GUD A;  2E7X A;  2V1X A;  2CUE A;  2P7V B;  5HDN A;  2H1K A;  4NC8 A;  4MEX F;  4RAZ A;  3DBR B;  3Q5F A;  4W1U A;  3J81 K;  5FFX A;  2NXN B;  2HOS A;  3FM3 A;  4NNJ A;  3DP7 A;  4JYK A;  2OU2 A;  1VQO I;  2NOG A;  1XMX A;  2DA4 A;  4L5I A;  1K78 A;  4M3D A;  3OIQ A;  4DZP A;  5EGO A;  2W00 A;  2X9D A;  2W85 A;  5BPD A;  4KMF A;  3WU1 B;  4XQF A;  4L18 B;  3BR3 A;  1KA8 A;  1TWH J;  2Y9Y A;  4CHU A;  4QLC U;  5BQT A;  2F6C A;  1MH4 A;  2JPC A;  4UUT A;  2M9H A;  3ZRG A;  4D0P A;  1RKT A;  2GM4 A;  1OCC H;  2LSO A;  4DBR A;  5ICE A;  3J7Z I;  1E2X A;  3X2Q H;  3OYC A;  5A2Q Z;  4B8X A;  2FBK A;  1RET A;  2KMU A;  3B02 A;  1Y56 A;  1BJA A;  3U1D A;  3CCV I;  2XAJ A;  2M8G X;  4ASN A;  3ZQC A;  3IRQ A;  4A6D A;  1DPU A;  5M5Y J;  1JI8 A;  3D5R C;  2JRT A;  3VYU B;  1D8J A;  5EG0 B;  1D0Y A;  3ULQ B;  1FLI A;  2PMH A;  3SHF A;  2X1E A;  3BG9 A;  2I8D A;  1EH7 A;  3OWT A;  1U5T B;  2MC4 A;  2VT2 A;  4BEH B;  1K79 A;  4CCJ A;  2DBB A;  2M1B A;  5LRR A;  4A3J J;  2XPW A;  3S15 J;  1DU6 A;  1WI3 A;  4A0X A;  1ZG3 A;  3K4B A;  1K4S A;  2EV0 A;  3F72 A;  5KVR A;  3S8P A;  3QOP A;  5CQE A;  3LSH A;  3LSP A;  5HLG A;  5HLH A;  3OSF A;  2L7K A;  2L7M P;  4IZZ A;  1FX7 A;  4GYG A;  1AA7 A;  2DPD A;  2KLO A;  2DDA A;  1DQU A;  3S16 J;  2Z33 A;  2HQA A;  3RJP A;  3LSJ A;  2HOA A;  4Y15 A;  3QAH A;  1ETY A;  2HDW A;  3DQV C;  5H6Q A;  4ZTF A;  2E1C A;  1VQN I;  1W5C C;  1VTN C;  4KDP A;  1E17 A;  3CMY A;  1QBJ A;  2NNN A;  5KNL A;  2ZNY A;  2DA1 A;  3S1N J;  4QSH A;  1QO0 D;  2IXS A;  1UHS A;  3CP8 A;  3TW6 A;  4WX9 A;  4GRI A;  2O0Y A;  2P4W A;  2KIQ A;  3FWE A;  3LA2 A;  5LRS A;  5EJC A;  1T39 A;  1W1W E;  2FQ4 A;  1LPQ A;  3HZJ A;  4L0Z B;  3LQQ A;  3OY9 A;  2ZJP F;  4CSW A;  3FMQ A;  2AXL A;  2G7H A;  3K70 D;  4I01 A;  1IG7 A;  2LY1 A;  1NH3 A;  4RGS A;  2EV6 A;  2R5Z A;  2IPQ X;  3FKJ A;  3WU0 A;  4HG2 A;  2CWE A;  3KPH A;  3ONQ A;  3TBI A;  4A0Y A;  2L0K A;  3HSF A;  1ZGW A;  3NWS A;  2HYF A;  3HG9 A;  4MQV A;  4XIC A;  4D5F A;  1RR8 C;  1WJ5 A;  5JFR A;  5J4Y A;  2P7C B;  4IHS A;  4CIC A;  1F1Z A;  1G3S A;  3R60 A;  1MSE C;  4LG0 B;  3DU6 A;  5JVT A;  3WTW C;  5M3F J;  1G3W A;  2V1D A;  2BHZ A;  3QPT A;  4C2M J;  3L2V A;  4G6Q A;  2GQQ A;  1K61 A;  2DOE A;  2PMZ A;  1X3W B;  3I5U A;  4CYC B;  1X19 A;  2FOK A;  4MEY F;  4XK4 A;  1FOK A;  3ABM H;  2OAZ A;  3FF5 A;  2EZI A;  4PSW A;  2ZME B;  3GTG J;  1BW5 A;  1K83 J;  3H36 A;  5GAH J;  4C3I J;  4QIW N;  1F9N A;  3WGH A;  2VPR A;  1MZB A;  2DPU A;  1X58 A;  1S7A A;  2JSC A;  1WI9 A;  3R0J A;  2PMU A;  4BJ6 C;  3AKZ A;  2XAG A;  3O8G A;  3FXU A;  2MLK A;  3Q3S A;  1SVM A;  1SD7 A;  1MND A;  2BVL A;  2H6C A;  3BTC A;  2W24 A;  5DTD A;  1B72 A;  4A3D J;  3K10 A;  4P1W A;  4F91 B;  4JX5 A;  5J8C A;  1BIB A;  2QVO A;  1FZP B;  4M9Z A;  2FBH A;  2HZT A;  2DAO A;  1Z3X A;  2LF8 A;  2NVY J;  1E3O C;  2F5C A;  2EFO A;  2DT5 A;  4MLO A;  1MJ9 A;  3DPU A;  2LOO A;  5J1R A;  5M5X J;  2CQQ A;  4CCM A;  1NK3 P;  2R7S A;  5B1B H;  5L3F A;  3RPQ A;  2R7X A;  1HW2 A;  4J00 A;  2CSO A;  1ON1 A;  5LHG A;  1TQM A;  1U0J A;  2BV6 A;  3ABU A;  4HNV A;  3BRO A;  3A1Y A;  3HPH A;  3DWL E;  3MVP A;  2EB7 A;  3CCS I;  1DP3 A;  1LQ1 A;  3CUQ B;  4HA8 A;  1EJ9 A;  3MAJ A;  3CMA I;  1UST A;  2ETH A;  1ZLJ A;  4CYD A;  4EM0 B;  1BOA A;  2F5E A;  1MKM A;  2YX4 A;  2QZ8 A;  2V6C A;  1GDT A;  1S72 I;  3B73 A;  4HPQ A;  4B44 A;  4CZZ A;  2E19 A;  2KIM A;  5L3G A;  1MIJ A;  2XDV A;  2P0W A;  2X6O A;  4WXD A;  3KP6 A;  1K7A A;  2VIX A;  5C3E J;  2EBI A;  1YOV B;  4O3M A;  1FOY A;  4DOZ A;  2CQK A;  2L4M A;  4AM3 A;  1YIT I;  1RUN A;  3H9Q A;  2CW7 A;  3J81 Z;  1Z77 A;  2NVX J;  1IDY A;  1BOB A;  4JX6 A;  2M0C A;  3TMO A;  2VKH A;  3H5N A;  4OOI A;  2DOA A;  2FNA A;  2LRE A;  3GFI A;  4HLY A;  1P4A A;  5F0F A;  3UR3 C;  1BC7 C;  2JQ7 A;  3K1M A;  2DYS H;  4RA2 A;  1REP C;  3SQN A;  4RB3 C;  2DMU A;  3HOV J;  4UV9 A;  3K4N A;  1R4M B;  3CTA A;  5AON A;  3FXL A;  4M9X A;  2VJI A;  5IY5 H;  2CW0 F;  5HNH A;  1UMQ A;  3QP5 A;  3G2B A;  5GPC A;  3EUH A;  1TLH B;  2E2H J;  2BY1 A;  3F8N A;  1B9M A;  3KIO A;  3KFW X;  5J40 A;  5CJ9 A;  3WHC A;  4AC0 A;  4P9F A;  3MKZ A;  2OC6 A;  2E35 A;  4IX7 A;  4M74 A;  2R7V A;  3HIF A;  2BZT A;  1D1C A;  1F4K A;  1RPW A;  1TT0 A;  1D1A A;  2CH0 A;  1T95 A;  1K78 B;  1R23 A;  3FMR A;  1HC8 A;  3G1L A;  4UY8 I;  3JRH A;  2DTR A;  2E5N A;  4UB8 C;  1U6G A;  5E1X A;  3I71 A;  5EGO B;  2K3P A;  4IOA F;  3GTP J;  4EM2 A;  1W0U A;  4OIP F;  2JVH A;  4M3G A;  4E7J A;  4D9J A;  1P7I A;  1YLF A;  2F2E A;  2CMP A;  2HTJ A;  3L9F A;  5J47 A;  4F7Z A;  1FOX A;  1OFC X;  1HKS A;  1EA3 A;  1O3Q A;  3M07 A;  2E7W A;  3TOA A;  1QNT A;  4XM3 A;  3UNG C;  4A3G J;  4XL9 A;  2X6W A;  1M1E B;  4BY7 J;  4HNU A;  1FBU A;  2QEX I;  2VI6 A;  1R00 A;  5CVI A;  1E0E A;  2L9R A;  5FFZ A;  1IN5 A;  2Q1Z B;  4BXX J;  2P6S A;  3MD2 A;  2HPI A;  3BJA A;  4UXN A;  3RIR A;  3K4K A;  4AD9 A;  2BBY A;  4G94 A;  4BS9 A;  5IYD J;  1X2M A;  1HXD A;  1FMV A;  1VND A;  1D5Y A;  1W7P A;  2DMQ A;  1STZ A;  3PL8 A;  2VBZ A;  3F8C A;  1UG0 A;  4XOP A;  2F48 A;  4LK1 F;  3L2W A;  3DTK A;  1ZH5 A;  5IP6 A;  2YUS A;  2FBI A;  3SDB A;  3TO7 A;  2OQR A;  2Z16 A;  3EET A;  4BE1 A;  1DGW Y;  2GZW A;  4U88 A;  3TED A;  3WTU C;  2LY9 A;  3LAJ A;  1E3P A;  4EV0 A;  1WJA A;  2DO7 A;  1AU7 A;  3BG7 A;  3FXQ A;  4I98 B;  4HZF A;  2JN6 A;  4NB5 A;  3RI4 A;  1CGP A;  1N78 A;  1O7L A;  2E1M C;  1LEA A;  1Z91 A;  3GCM A;  1DGR M;  2F5V A;  3CDH A;  4KIG A;  5JLX A;  2BGC A;  3HBL A;  5J8F A;  4A3K J;  4F52 A;  2EFN A;  1JUP A;  2MGQ A;  3E0J B;  1MJB A;  3DXJ F;  3EUA A;  5EDN A;  2XRO A;  3HPG A;  1ZAO A;  3W6V A;  1GXP A;  4WWC A;  3IUO A;  4Z6Y A;  1VQL I;  1EKE A;  2KHM A;  3Q9V A;  1OCZ H;  3ERM A;  3HUG A;  4BL0 B;  2LTP A;  2E5Z A;  2P6T A;  1F5T A;  2LF7 A;  4IHT A;  2PG4 A;  1ZRD A;  4G7H F;  2E36 A;  4B4C A;  9ANT A;  5KCM A;  3K4L A;  5EF6 A;  4E7H A;  1FBQ A;  1Q1H A;  1TQP A;  2M45 A;  1Z67 A;  5H20 A;  4PCQ A;  4QWQ A;  4C3J J;  4A6E A;  4HQE A;  5DM7 F;  2P5L C;  5DD8 A;  4G7O F;  4A5M A;  3ERE D;  3QYF A;  4FCY A;  1Y0N A;  2M0M A;  2WB1 A;  1PYV A;  1KYZ A;  4XOR A;  3SDG A;  5EEA A;  3I55 I;  4LFU A;  3HRT A;  5B3S H;  3HDD A;  3HOT A;  5F1J A;  2R5Z B;  3K4M A;  3BR2 A;  3CJN A;  1OMI A;  3BR5 A;  3K2Z A;  1LJ9 A;  5TIS C;  4A3I J;  2R7F A;  3PQK A;  4DYR A;  2DQL A;  2WBM A;  2EK5 A;  3G3Z A;  2X51 A;  1SAU A;  1SVO A;  4NUB A;  4PGG A;  1K6O A;  4YEL A;  1JJ6 C;  4A93 J;  2CUJ A;  1FMW A;  5H2F C;  3F22 A;  3M1E A;  2O3F A;  2XAS A;  3IP4 B;  2OTL I;  2COB A;  2IGM A;  4L9V A;  1HQC A;  3HM5 A;  5BNG A;  3L2R A;  3IC7 A;  1FPQ A;  2HGC A;  3KX2 A;  4DJA A;  2WTE A;  1RRJ A;  1J59 A;  1JXS A;  3GVA A;  3BPV A;  4HV6 A;  2XUB A;  3GTK J;  1RC9 A;  1R36 A;  1U8B A;  2P5K A;  3BP8 A;  1VF9 A;  2HR3 A;  3GX4 X;  1LKX A;  2L9S A;  3ZGK A;  1JHF A;  4RGU A;  2L54 A;  2E34 A;  3W2W A;  4CCO A;  2ZJR F;  2MAB A;  1VQ9 I;  1CF7 A;  1KQ8 A;  4JK1 X;  4S04 A;  1CQT A;  1UG2 A;  4Q4Z F;  5LGN A;  3VB2 A;  3HOZ J;  3FXR A;  3V8J A;  1IXC A;  4JBA A;  5FJ8 J;  2ZJQ F;  4C9Y A;  2Y75 A;  1HA8 A;  2RQQ A;  2HNH A;  4CXF A;  3QYE A;  1B72 B;  5IT3 A;  2RGV A;  3J7Y J;  3QPS A;  4CH7 A;  2W7N A;  3ISP A;  2MG4 A;  4EJU A;  1IF1 A;  3GZ6 A;  1WJE A;  3MMY B;  4OIN F;  2UWM A;  1QRY A;  4XOT A;  4ZZD A;  1JT0 A;  4IHV A;  4A3L J;  3FIW A;  2IS4 A;  2MH2 A;  2EA4 A;  1IRX A;  4O5V A;  3BR0 A;  2HXO A;  3PO2 J;  2LC2 A;  2TRT A;  2JA6 J;  3R0A A;  4IHY A;  3GTO J;  4XRS G;  4PGH A;  2YSR A;  5IYB J;  2LR8 A;  3I0T A;  3S32 A;  3HKZ A;  5JLW A;  3UKG A;  1F43 A;  4F3Q A;  1R71 A;  1WKM A;  3BG3 A;  2AHQ A;  2DW4 A;  2KDZ A;  4MQ9 F;  2A68 F;  4ZYG A;  1XDS A;  4A5N A;  3D5S C;  1O3R A;  3EYY A;  3V7C A;  1LNW A;  1I1S A;  3S2D J;  1T0F C;  2ZXJ A;  2XF5 A;  3DTI A;  4KN4 X;  2XSD C;  1V3F A;  4RM2 A;  4BAC A;  4M6Y A;  5D8K B;  3K4C A;  3H92 A;  2VBY A;  1QGP A;  3ZMD A;  4C2U A;  1PUE E;  4HRI A;  4AVP A;  4QPQ A;  4IHW A;  2X0L A;  5C4J J;  4HYE A;  4AYB N;  2B63 J;  1U9N A;  3KP3 A;  3OYI A;  4I2O A;  1HOM A;  3GF2 A;  3N97 A;  3P9C A;  1QVT A;  3F6V A;  3WGG A;  3HRM A;  4XSZ F;  3GZ5 A;  2MD0 A;  2DA6 A;  4XMY A;  3CO6 C;  2IT0 A;  2JRM A;  4OMY A;  4XNF A;  4YFN F;  4XLC A;  4FQG A;  3M3Y J;  2ZSI B;  4BY1 J;  1FBS A;  3ZMS A;  5E8I A;  4LIU A;  4IO9 F;  2H27 A;  5KHD A;  2LYC A;  1TQI A;  4J19 A;  3BJ6 A;  4JX4 A;  4LLL A;  2R7Z J;  2EV5 A;  1HW5 A;  2HVS A;  3VYR B;  2P81 A;  3HTU A;  1FNN A;  4U0Y A;  3Q0V A;  3ZP5 A;  2DK8 A;  2DDB A;  2IAI A;  1AOY A;  1Z21 A;  3H0G J;  3E5X A;  1YW9 A;  2OBP A;  3FZV A;  1HF0 A;  2M34 A;  2KZV A;  2WAQ A;  4MFD A;  5HOO A;  4KUM A;  1V4R A;  2VBW A;  2H09 A;  4BQN A;  3OYK A;  3M7G A;  3L1P A;  3HOW J;  1YS6 A;  2WAD A;  3HC7 A;  4JP0 A;  1XB4 A;  2AS5 F;  1U8R A;  5FO5 A;  3KYC B;  3FXK A;  1Y8Q B;  1QVU A;  2FMY A;  2FEZ A;  3CCJ I;  3ZQL A;  3ASN H;  1S7O A;  4V2G A;  1OKR A;  3IV5 A;  2VKD A;  3LSR A;  2AO9 A;  3WOD F;  4Q48 A;  2L9V A;  4I0A A;  1OCT C;  1LFP A;  1QZY A;  1TWA J;  1W7P B;  1TWF J;  3SZG A;  5F0H A;  5ILU A;  4A12 A;  4GGG A;  2XIG A;  1OQY A;  3GTL J;  2D2W A;  5IT9 K;  4S0H B;  4YII A;  2XAQ A;  5E17 F;  3B6A A;  3QU6 A;  2KPM A;  2G9W A;  2XB0 X;  4II3 A;  4C3H J;  1Z3Y A;  2Z99 A;  3RKY A;  3MZH A;  1HKQ A;  2VXZ A;  2STW A;  4E7I A;  2K9N A;  1ZQ3 P;  2W4S A;  3ZCO A;  1G3Y A;  1FEX A;  1YIO A;  4LB6 B;  3OYJ A;  1J09 A;  3AAF A;  1ETQ A;  2Q2E A;  1W4M A;  1YW7 A;  3HSE A;  3ZMT A;  2DMT A;  3EQL F;  5GTI C;  3EUK L;  2M8E A;  2KFD A;  3ABT A;  4IRH A;  5ILS A;  4A0Z A;  3RSN A;  4PDK A;  2JWT A;  3VOE A;  3AG3 H;  3DEE A;  3HUG B;  1I5Z A;  3LQR A;  2IGK A;  1ETO A;  1T33 A;  3WHB A;  2M3A A;  2EZH A;  5FLV A;  3I59 A;  2LY2 A;  2EFP A;  3F8F A;  4XN3 A;  4HLX A;  2Y30 A;  3S3O A;  1ZGA A;  2V1N A;  3C2H A;  3ELK A;  1FY7 A;  2HVR A;  1W5S A;  4Q5S F;  4HX4 A;  1UJ8 A;  5E3L A;  3QPL A;  1U5T C;  1PUF A;  3I3L A;  1X1C A;  3L2C A;  2F4O B;  1NG6 A;  2IBD A;  1IN6 A;  1IJW C;  3ZMV A;  4FE7 A;  2LH9 A;  2UUZ A;  3H1C A;  1Z6T A;  3L00 A;  4Y7N J;  2ECB A;  3HOX J;  1WFX A;  2DA7 A;  2KDO A;  3KP2 A;  2F5F A;  3PSI A;  1YQA A;  1R1V A;  3M9A A;  3CME I;  2JPB A;  3COA C;  2K3F A;  1PP8 F;  1OJL A;  2ZBK A;  4CCK A;  2OUM A;  3JRE A;  2V9V A;  3W3C A;  3DLL F;  3OIP A;  4PJ0 C;  4EQQ A;  4EGZ A;  3ZQH A;  4I7H A;  1P7J A;  2ZXH A;  2QF7 A;  3VSK A;  2O5R A;  3HOU J;  2KRF A;  4L0Y B;  5CPR B;  4D5C A;  4XLE A;  3G6E I;  5FLX K;  4ON0 A;  1T98 A;  3WE2 A;  1QQI A;  3GYH X;  1HDP A;  3ZQI A;  1R58 A;  1Y1W J;  3S14 J;  1HDD C;  2Y31 A;  2K02 A;  4AIK A;  1R22 A;  2IA2 A;  1CF7 B;  2VJJ A;  4HDU A;  4RB1 A;  1KON A;  1A36 A;  2CUZ A;  2H1L A;  2V6E A;  4RAF A;  1TZL A;  4LLN A;  3H5A A;  3R61 A;  1PP7 U;  1OYI A;  1WH7 A;  3Q9S A;  2V79 A;  5EEH A;  1XSX A;  3SJM A;  2CYY A;  4U0V A;  2GIZ A;  4AIH A;  2OTJ I;  2W57 A;  1PDN C;  5FKM A;  2B7E A;  2A6E F;  2MLG A;  2F5D A;  1SAN A;  1N25 A;  3HSR A;  1TW2 A;  1OLT A;  3BTL A;  1R49 A;  3LSK A;  1J2X A;  3I56 I;  3C2B A;  2R5Y B;  1J5Y A;  2MYS A;  3DLA A;  2G7U A;  4IJA A;  4WCG A;  1GHC A;  1FIA A;  1UHM A;  4OMZ A;  1FTT A;  2DT7 B;  2QQ9 A;  5KAI C;  5IOZ A;  1KQ9 A;  3KP7 A;  2JA8 J;  3GO5 A;  5E1W A;  2IGN A;  2DMN A;  1KYW A;  1VQ5 I;  4KFC A;  1BR4 A;  3DKW A;  3PQJ A;  4OU0 A;  3NAU A;  4PFO A;  1AHD P;  3F8M A;  2DA5 A;  2R4G A;  3HGG A;  2HPM A;  4HF1 A;  2RV8 A;  2RKH A;  1XX5 A;  4E7Z A;  1OR7 A;  3BWG A;  2ZME C;  1UEL B;  2OCC H;  2COM A;  2R7Q A;  3M1C A;  2LKS A;  4D7N A;  3FXO A;  2H94 A;  4CUG A;  5DS9 A;  5AIQ A;  2ESH A;  3K2A A;  1BJZ A;  1XCB A;  2CFO A;  2XVC A;  1USS A;  4BKX A;  3PNT A;  5IP9 J;  5JHU A;  3RTR A;  3LA3 A;  3CP2 A;  1JKO C;  2ECC A;  1ITY A;  1A6Q A;  1TW3 A;  4EMS A;  4EEF G;  2TDX A;  3PIP F;  1W0T A;  5GP9 A;  1FSH A;  4HF0 A;  3DEU A;  2FE3 A;  4Y3O A;  2ISY A;  1ZRF A;  1I6H J;  4ABZ A;  4AU7 A;  3G71 I;  3WG9 A;  2YU9 J;  3FDY A;  1L0O C;  2H8W A;  2L9N A;  2O61 A;  5KAF C;  1J7K A;  1OCR H;  1ZGJ A;  4M3B A;  3U1K A;  2DFI A;  1JT6 A;  1WJB A;  2ZO4 A;  3PSF A;  3CCQ I;  2WY8 Q;  3WGI A;  1IV6 A;  3FIS A;  4ESJ A;  3AG1 H;  2CS3 A;  1MBK A;  2ZJ2 A;  4XKC A;  1T2K A;  2LVS A;  3KCC A;  3CUQ C;  3DTE A;  3LFU A;  5BS6 A;  1OIS A;  1T08 B;  3LA7 A;  2VPL A;  2LBF A;  3K6G A;  3CMM A;  2JK3 A;  2CO5 A;  2DFH A;  5CVU A;  3BCA A;  1S7E A;  2GA2 A;  3ZQQ A;  5K1Y A;  3A03 A;  3Q0W A;  2W25 A;  1X1A A;  3GWZ A;  4G9Y A;  5F64 A;  1H0M A;  3DCF A;  4O6J A;  2FSW A;  3O8H A;  4L5J A;  5C4X J;  4LMY A;  1S6L A;  3MWM A;  3DPT A;  1IZ1 A;  5FKN A;  5IT9 Z;  1ULY A;  3W6K B;  3SZT A;  3JRD A;  2KL4 A;  1U9O A;  1EV7 A;  5E79 C;  2GLO A;  3S1Q J;  4V19 K;  4L9T A;  1X4P A;  3W2V A;  1HLV A;  2MFZ A;  4E4H A;  3ZXS A;  2UXN A;  2ZC2 A;  2FD5 A;  3HRU A;  1ZLK A;  4OIO F;  2AQE A;  1B8I B;  1A6I A;  3GFJ A;  4P9U A;  3ZMU A;  2DLL A;  4ZDL A;  4A3E J;  1S8N A;  3CQZ J;  2DOF A;  2XPV A;  3KYD B;  1I3A A;  5LBQ A;  3HXL A;  2JMW A;  1QHH D;  2X1D A;  3KLO A;  4UUS A;  5IPA A;  1LE8 A;  3FHN A;  1SMT A;  4BE0 A;  1WGX A;  3LST A;  3OOP A;  4PSX A;  4TV7 A;  4KNY A;  2LDU A;  3QPH A;  1P2F A;  3OS0 A;  5LGU A;  2EIM H;  4UV8 A;  3GXO A;  3HGY A;  2PI0 A;  2I5U A;  2ME6 A;  1SMY F;  5HLT A;  3BTJ A;  1YFH A;  1KU3 A;  4BAY A;  3ROU A;  3JTH A;  1MJA A;  2KKO A;  4BJ5 C;  1VQP I;  3REO A;  3BDD A;  1BI0 A;  1PVE A;  3E6C C;  3KE2 A;  2Y9Z A;  1I27 A;  3I4N J;  1UFM A;  5FB2 A;  4IL6 C;  3QRF F;  3DF8 A;  1R5G A;  3RZO J;  4KJZ A;  4XKB A;  5CQG A;  5HS7 A;  1G59 A;  3CZ6 A;  4A3C J;  1VQ6 I;  2R7D A;  4DBQ A;  2AQF A;  2Q2E B;  5EYR A;  2O9L A;  4MIM A;  2DOD A;  1XGM A;  4MHG A;  4D7M A;  2UZK A;  1KZH A;  4ZDO A;  1JTY A;  3GTM J;  4UHT A;  2XF6 A;  1FSE A;  3HB9 A;  1MMS A;  1WPK A;  1SD4 A;  1YIJ I;  2A6H F;  2JA7 J;  1P9Q C;  3I59 B;  2RC4 A;  1XC5 A;  2CU7 A;  2L7F P;  2K86 A;  2XAF A;  5M3M J;  1KU7 A;  2PJP A;  1GXQ A;  2Y0S N;  5JVG F;  4RS8 A;  4F93 B;  2KRC A;  4A2U A;  5FD6 A;  1UB9 A;  1ZKG A;  2JSP A;  3CCY A;  3TGN A;  2K9M A;  4KIT B;  3EPZ A;  2L4A A;  4RLF A;  3ZPL A;  1VQM I;  2QQB A;  1BI2 A;  4QPO A;  3H3U A;  1H89 C;  1G6N A;  1PUF B;  1JUM A;  1S3J A;  2WC2 A;  5ICG A;  1OCO H;  5FLX Z;  2H6B A;  4ANJ A;  2L02 A;  1MBH A;  3JRF A;  3GTJ J;  3D0S A;  2V9K A;  2ESN A;  5D5X B;  3ABL H;  2ELJ A;  2L2O A;  4M3F A;  3IH3 A;  3G73 A;  1FYL A;  1YO5 C;  3A0B C;  4YIF A;  3W6J B;  3B6C A;  2EJR A;  2X1C A;  3RKX A;  4BXU A;  1FTZ A;  2X4H A;  3RDI A;  1YJN I;  4V2F A;  1ZG1 A;  3QOD A;  3ABK H;  2XC7 A;  1W5T A;  2RAE A;  2BXZ A;  3L7W A;  2VC0 A;  3V8L A;  4EJO A;  2V9P A;  3ECH A;  4Z2Y A;  3FX3 A;  5LHH A;  2PEX A;  3JSP A;  2MSY A;  2R7U A;  2EIK H;  1BI1 A;  5B1A H;  1I50 J;  2OV7 A;  4FE4 A;  3VFZ A;  2V7F A;  3R6S A;  3VEP A;  3IL2 A;  3H35 A;  2QQA A;  2VE9 A;  1IRZ A;  4LLG F;  2DFF A;  5DDG A;  5DM6 F;  2D1H A;  2HZD A;  1KU9 A;  3MKW B;  4B47 A;  4PJM A;  3D1N I;  4IQJ A;  2VBX A;  1Z7L A;  3AFH A;  1SAX A;  1R9T J;  3OYF A;  2GXA A;  1V5G A;  2OZU A;  3DKX A;  1YS7 A;  5DCF A;  3A0H C;  1VI0 A;  1X2N A;  2R7O A;  1D5V A;  1IN8 A;  2KT0 A;  3HJE A;  1J9I A;  1YRN A;  4I6Z A;  1GUU A;  2VQL A;  2BY0 A;  2L5Q A;  5DYM A;  4D1Q A;  1TP4 A;  3NAR A;  3CDL A;  4XID A;  4A3F J;  4M6V A;  2E60 A;  3HTS B;  2PMZ N;  2FRH A;  1FP1 D;  2JUC A;  3IRR A;  1RI7 A;  3JTG A;  2DJN A;  3O6B B;  1IW7 F;  3RKW A;  1QHG A;  2CQN A;  4I09 A;  1G2H A;  1AWC A;  2F4M B;  3GEZ A;  5ED4 A;  2XF7 A;  2W84 A;  3RYP A;  1XG1 A;  4XR6 A;  3BG5 A;  5CLS A;  2LLK A;  1B4A A;  3MCZ A;  3OR2 C;  3WE3 A;  5E3O A;  3K1P A;  4WXH A;  4R79 A;  4E7S A;  2QBY A;  4P55 A;  3P9I A;  1XTA A;  1WWX A;  4C2T A;  4GFB A;  1WSU A;  3F23 A;  1X3Z B;  1IC8 A;  2CUF A;  4A3B J;  4NBQ A;  4K2E A;  5DUK A;  2A5W A;  3SZP A;  3CCU I;  3G1O A;  4MO7 A;  1BR1 A;  1B6A A;  4IQ4 A;  3AL0 B;  2WV1 A;  3C7J A;  2NVU B;  1ETW A;  2A5Y B;  1LFU P;  3DPL C;  3BC8 A;  3PUB A;  4DW6 A;  3DFG A;  4GCV A;  4IHX A;  4IRI A;  1B9N A;  1WZ2 A;  4ENJ A;  3I58 A;  5ICF A;  3KET A;  1BC8 C;  4YFK F;  3QOE A;  1MW7 A;  2IS6 A;  1IUY A;  1YHQ I;  1ZHF A;  2HOT A;  3S17 J;  4LG3 A;  3OOU A;  1W36 C;  4GDF A;  3FBN B;  4XBF A;  3JRA A;  1LB2 A;  3MKL A;  2M2E A;  5E1Z B;  3GLX A;  2BOL A;  3KLN A;  3OV8 A;  4EAT A;  3TW7 A;  4PK4 A;  2IS1 A;  3FK6 A;  1SFX A;  2VJ4 A;  4B48 A;  5HS8 A;  4LB5 A;  2W48 A;  4H0E A;  2Q0O A;  4IKF A;  1VQ4 I;  4HV5 A;  2WA0 A;  1P6R A;  2VAS A;  5ERI A;  4HOB A;  2A05 A;  4FT8 A;  2IA1 A;  4MTE A;  5L3C A;  3CCR I;  3L2Q A;  3NQO A;  2XGD A;  1SFK A;  1SFU A;  2EA2 A;  2K5C A;  3BJO A;  4OWR B;  5GTH C;  5JHF A;  4RAG A;  1NG7 A;  4PZJ A;  5FLM J;  2YS9 A;  3RQ4 A;  5LD2 C;  3DV8 A;  4DYC A;  2LBF B;  4DZJ A;  3MEX A;  3E97 A;  4EJV A;  4MTD A;  3JAM K;  3JRC A;  2QA4 I;  2PQ8 A;  2XGC A;  3NRV A;  1I6X A;  2HYJ A;  4F92 B;  1G8X A;  1XMK A;  3QP6 A;  4M72 A;  2C6Y A;  4B3A A;  2FF4 A;  5CKT A;  1NTC A;  3FMS A;  4BBR J;  1Z05 A;  1YW8 A;  4EM1 A;  2D45 A;  2K7L A;  5F08 A;  5D4S A;  2N8G A;  1V55 H;  1T6S A;  5L3D A;  3EDP A;  3CJR B;  1HCR A;  1JJ8 C;  1JGG A;  4IPA A;  2X6Y A;  4M73 A;  2HDC A;  2P8T A;  4IF4 A;  2VQG A;  5K7H A;  2DMP A;  1TNT A;  4G12 A;  5IP7 J;  1BM9 A;  1MBE A;  4I02 A;  5D6F A;  3VYS B;  3RKQ A;  1ORK A;  1X4O A;  2LNB A;  3BR6 A;  4KYW A;  2HOE A;  2JA2 A;  1D0X A;  3IWZ A;  4ITV A;  4PJN A;  4UUS B;  1LE8 B;  3H3Z A;  3EUH C;  2EZL A;  3S3N A;  5F27 A;  2E2J J;  3MN2 A;  4E6K G;  3RCO A;  3PO3 J;  2G0E A;  3CCL I;  2XV4 S;  1Y39 A;  3SFI A;  3CCM I;  4KIC A;  5BPI A;  1JGS A;  4YIR X;  1H8A C;  5F6F A;  1FYM A;  2JA5 J;  2MBF A;  5JR3 A;  3IH2 A;  4KA4 A;  4PJL A;  2M7B A;  1ENH A;  1S29 A;  3OS2 A;  3S3M A;  2D1V A;  1ZG5 A;  1JKP C;  3PIO F;  4HX8 A;  4E7L A;  4NC6 A;  3MZY A;  4XRM A;  1BW6 A;  1YYV A;  1MMG A;  3ZQ7 A;  5DUI A;  5F0C A;  5TGT A;  2EWN A;  2LK2 A;  3SXY A;  4XN0 A;  5HOD A;  2IP2 A;  2F4I A;  3TQN A;  5H6R A;  2LMD A;  2PN6 A;  1WCM J;  2MA3 A;  3OR1 C;  1DUX C;  4L5E A;  3HEF A;  4X6A J;  1LEB A;  5E3N A;  1IAW A;  2Z3Y A;  3IWF A;  3I53 A;  2BEO A;  3OYB A;  2ZNZ A;  1J0R A;  1UHW A;  3F9K A;  3LSM A;  3PUF A;  5CVV A;  2WY7 Q;  2NVT J;  2KP6 A;  1XN7 A;  2OF7 A;  4BH9 A;  1MNM C;  2NYX A;  1W36 D;  2XKO A;  2VN2 A;  1IV8 A;  1Q1V A;  2GOX B;  3QU3 A;  4XLP F;  2BE5 F;  1SVL A;  2V4J C;  3SEZ A;  2ELK A;  1MBF A;  2M87 A;  2JT1 A;  1DP7 P;  1XDU A;  5FKK A;  3RPU A;  4XLN F;  2VLA A;  2VON A;  4NQW A;  4KIB A;  3E7L A;  3LWF A;  5FKO A;  3HOY J;  4BYY A;  3KP5 A;  5CVR A;  4AIJ A;  1EF4 A;  3V7S A;  3OSG A;  2R0Q C;  3A4C A;  1LUJ B;  4HW0 A;  3CC4 I;  3S93 A;  4BUP A;  1ZAR A;  3CO7 C;  1S5L C;  2WV0 A;  3GFM A;  4XRS A;  3N4M A;  4AUX A;  4HAM A;  3LOC A;  2GXB A;  2P5V A;  4BJT A;  4B43 A;  2E1O A;  4NDL A;  4ENN A;  2WB1 N;  4LIT A;  4Q47 A;  3GFL A;  1YTY A;  4UNO A;  5HNF A;  2MC3 A;  3U9G A;  2BY3 A;  4N4N B;  3KP4 A;  2CGP A;  2JJ7 A;  2LG4 A;  1SD5 A;  1OYY A;  4GYI A;  1XPX A;  3LMM A;  4BE2 A;  2PJR A;  4PFP A;  3GZN B;  3GLL A;  2K27 A;  3I9V 2;  1BIA A;  4OIR F;  3A2K A;  5HVQ C;  2K4B A;  4ESF A;  3CD6 I;  1IDZ A;  4LK0 F;  1UCR A; 
#chains in the Genus database with same CATH homology
 5LGT A;  3E6D A;  2NAZ A;  2O8X A;  1R1U A;  4JQF A;  3HHG A;  2HKO A;  4G8X A;  4YG2 F;  1KQ0 A;  2RDP A;  2FNP A;  1D8K A;  5LHI A;  3C18 A;  2NNY A;  3HHH A;  2GXG A;  4DNC A;  4CO8 A;  2XRN A;  1DPR A;  4P5O A;  2L01 A;  5BMZ A;  4BNC A;  3E6M A;  2OD5 A;  4L9J A;  2QBY B;  4M6X A;  3CUO A;  3FM5 A;  3TOB A;  1WRJ A;  4U7D A;  2JTV A;  1QPM A;  3U2R A;  2CG4 A;  2PFB A;  4M9S A;  3T8T A;  1B59 A;  4LGW A;  4WK8 F;  4Y13 A;  1IXS B;  2QWW A;  2UXX A;  3ZMZ A;  2IW5 A;  6PAX A;  1NHA A;  4LJZ F;  1MD0 A;  5E18 F;  4KT5 C;  5TRD A;  2HYG D;  2FXA A;  1O3T A;  4B09 A;  2ADU A;  1R1T A;  2VOO A;  3T1B A;  3V7R A;  1RZ4 A;  1RUO A;  3JAM Z;  3WTZ A;  1L3L A;  3ECO A;  5D8L B;  3I64 A;  1Z1D A;  1W7P D;  4GXO A;  3C3W A;  2QEN A;  4CGZ A;  2HQR A;  2RQP A;  3T0Y A;  3T8R A;  2IA0 A;  4EGY A;  5DCM A;  5E8G A;  5ILV A;  1X3U A;  3TO6 A;  2HKX A;  2QLZ A;  2HQN A;  4R1H A;  1FYK A;  3FHZ A;  2FA5 A;  3J7A O;  2OQG A;  3J80 K;  3WTV C;  4ZZL A;  3M8E A;  1Z7U A;  5EEG A;  3O2P E;  2ACJ A;  2V1U A;  2Y0M A;  3C1D A;  3K0L A;  3JSO A;  4U0W A;  3HOS A;  4KIF A;  4ZYD A;  2PLY A;  1IXR C;  3VOD A;  2E1N A;  5D5U B;  2ZCW A;  1ZRC A;  2HEO A;  2J5O A;  2YX7 A;  1P4W A;  3EYI A;  1O3S A;  4UVC A;  3WTS C;  1IN4 A;  1J75 A;  5J6X A;  4RAY A;  3E6B A;  5TJJ A;  1MDM A;  2XGX A;  3T5X A;  2K4J A;  1SFE A;  4UUV A;  2LKP A;  4AWX B;  4ETS A;  2GWR A;  2KIU A;  5K5R A;  4KMU X;  1HBX G;  1H9T A;  2ELH A;  2A07 F;  4G7Z F;  4RGX A;  2YR2 A;  4N9I A;  1EH6 A;  5FGM A;  1U2W A;  1R7J A;  5L3B A;  2M5W A;  4BHC A;  1LDJ A;  2QYO A;  1HW1 A;  1QZZ A;  1MGT A;  2DU9 A;  2M30 A;  3TDZ C;  4HQM A;  1XGO A;  4RB0 A;  3I4P A;  3F6O A;  2FQ3 A;  1T0F A;  4IRG A;  2DQR A;  2VE8 A;  1BBY A;  4EJT A;  1RNL A;  3LFK A;  3K69 A;  4U7B A;  4HF2 A;  1XSV A;  4UVA A;  2O6G E;  2HFH A;  3P7N A;  1JE8 A;  2OZ6 A;  4KN7 X;  1DDN A;  1WQ2 A;  5FD5 A;  2FU4 A;  2QUF A;  2RVC A;  3NEU A;  3BY6 A;  2KJC A;  1O7F A;  2JZY A;  2YU3 A;  4GO1 A;  5JI6 A;  4IVN A;  2VC1 A;  2IVM A;  2MH9 A;  5KK1 A;  3P9K A;  2YPR A;  1Z6R A;  1OYW A;  4HDV A;  1YG2 A;  4LD5 A;  5E20 A;  3R4K A;  2VT3 A;  4ZH4 F;  1D3Y A;  1GVJ A;  2OA4 A;  4EJW A;  3SFZ A;  3BOQ A;  3TO9 A;  4DQ2 A;  4Y17 A;  2HTS A;  1TBX A;  4HBL A;  3E5U A;  2Y48 A;  1ZRE A;  1OPC A;  2GA1 A;  2O03 A;  3KEQ A;  4ZYH A;  1ZN2 A;  2NRA C;  3MQ0 A;  1SD6 A;  4FX0 A;  1ON2 A;  1TNS A;  1G4D A;  1BI3 A;  5BOX A;  2STT A;  4MGR A;  4OIQ F;  1XMA A;  3F8B A;  5D5V B;  2NS0 A;  1IN7 A;  3TKY A;  2XAH A;  4IXA A;  5DD4 A;  2HWV A;  3GW2 A;  4I0B A;  3LAP A;  5CVJ A;  3ZN0 A;  2IRF G;  3J80 Z;  5HDK A;  1C0W A;  3F21 A;  1Y0U A;  1ONV A;  2MD5 A;  5D4R A;  5DEQ A;  3I54 A;  1EH8 A;  1FT9 A;  1P92 A;  4HX7 A;  5DCM B;  4BHB A;  1HKT A;  4FHT A;  1R5H A;  1ZYR F;  3M8F A;  2Q8K A;  1XD7 A;  1LVA A;  1XCV A;  1U5T A;  4RGR A;  4FX4 A;  2WWY A;  4YFX F;  2FML A;  1JHH A;  1FC3 A;  1LDD A;  3KEO A;  5LEK A;  4WF2 A;  4UVB A;  1IRG A;  5A2Q K;  4G6D A;  2XHK A;  1P4X A;  1U78 A;  5HS9 A;  1HST A;  1B1B A;  2PBI A;  2HS5 A;  4XRF A;  2RN7 A;  3TDU C;  2Z9O A;  2A3S A;  4RB2 C;  3PFI A;  1ODD A;  1XGS A;  2XKP A;  4MNU A;  4BHP A;  1HSJ A;  4N0B A;  5D6E A;  1LDK B;  2ZFW A;  1Z9C A;  3HYI A;  1MDM B;  2GIV A;  2A69 F;  4P96 A;  3KZZ A;  3V4G A;  2Z5U A;  5K5Q A;  1FP2 A;  3RYR A;  1IRF A;  3BZ6 A;  4ENK A;  1XSD A;  5K5O A;  2VOD A;  3K1N A;  4ENM A;  3ZN1 A;  5LLQ A;  2J5P A;  2KIF A;  5D5W B;  2DK5 A;  4LG0 A;  3L09 A;  4ZYE A;  1H9G A;  2ISZ A;  1TTY A;  4BQA A;  2EFW A;  3O3K A;  4L9N A;  1XGN A;  5AIP A;  3IHU A;  3K9T A;  3V8K A;  2ZME A;  5HLI A;  4R8H A;  3WTT C;  2RNJ A;  1A04 A;  3F3X A;  4E70 A;  4EVI A;  2GAU A;  4WXC A;  2A61 A;  2QM3 A;  2B0L A;  5DV5 A;  2DI3 A;  1RIO H;  3S2W A;  3IKV A;  1T38 A;  3MFK A;  4N9H A;  3E5Q A;  1FWZ A;  4CDG A;  5HDG A;  2L3D A;  3WTY C;  1I1G A;  2CFX A;  3IKT A;  3CLO A;  3BPX A;  2VOP A;  1G3T A;  1KU2 A;  3KZY A;  3CUQ A;  3D5L A;  4M71 A;  2ZKZ A;  2R3S A;  5L3E A;  5LEJ A;  1BN5 A;  3WTX C;  4NHJ A;  2KJB A;  4XSX F;  3E3V A;  3JW4 A;  5CYV A;  4S05 A;  5F1R A;  5ICC A;  2BYV E;  3ML6 A;  4ESB A;  3HRS A;  1U3E M;  2EFQ A;  1O57 A;  1KGS A;  2IJL A;  3GUD A;  2E7X A;  2V1X A;  2P7V B;  5HDN A;  4MEX F;  4RAZ A;  3Q5F A;  3J81 K;  5FFX A;  3FM3 A;  3DP7 A;  2OU2 A;  4L5I A;  1K78 A;  2W85 A;  5BPD A;  4KMF A;  3WU1 B;  4L18 B;  1KA8 A;  4CHU A;  4QLC U;  5BQT A;  2JPC A;  4D0P A;  2LSO A;  5ICE A;  1E2X A;  5A2Q Z;  4B8X A;  2FBK A;  3B02 A;  1BJA A;  3U1D A;  2XAJ A;  4ASN A;  3IRQ A;  4A6D A;  1DPU A;  2JRT A;  1D8J A;  3ULQ B;  1FLI A;  2PMH A;  3SHF A;  1EH7 A;  1U5T B;  2VT2 A;  1K79 A;  2DBB A;  2M1B A;  5LRR A;  4A0X A;  1ZG3 A;  2EV0 A;  3F72 A;  5KVR A;  3QOP A;  5HLG A;  5HLH A;  1FX7 A;  4GYG A;  2DPD A;  2Z33 A;  3RJP A;  4Y15 A;  3QAH A;  3DQV C;  5H6Q A;  2E1C A;  1VTN C;  4KDP A;  1E17 A;  1QBJ A;  2NNN A;  2ZNY A;  1QO0 D;  4WX9 A;  2O0Y A;  2P4W A;  3FWE A;  3LA2 A;  5LRS A;  1T39 A;  4L0Z B;  3LQQ A;  3FMQ A;  2AXL A;  2G7H A;  4I01 A;  4RGS A;  2EV6 A;  2IPQ X;  3WU0 A;  2CWE A;  4A0Y A;  3HSF A;  2HYF A;  4MQV A;  5JFR A;  2P7C B;  4IHS A;  4CIC A;  1F1Z A;  1G3S A;  3R60 A;  4LG0 B;  5JVT A;  3WTW C;  1G3W A;  2V1D A;  3QPT A;  4G6Q A;  2GQQ A;  3I5U A;  2FOK A;  4MEY F;  1FOK A;  3FF5 A;  2OAZ A;  2ZME B;  1F9N A;  3WGH A;  1MZB A;  2DPU A;  2JSC A;  1S7A A;  1WI9 A;  3R0J A;  2PMU A;  2XAG A;  3FXU A;  2MLK A;  1SD7 A;  2H6C A;  2W24 A;  5J8C A;  1BIB A;  2QVO A;  1FZP B;  4M9Z A;  2FBH A;  2HZT A;  2DAO A;  2LF8 A;  2F5C A;  2EFO A;  2DT5 A;  1MJ9 A;  5L3F A;  3RPQ A;  1HW2 A;  2CSO A;  1ON1 A;  5LHG A;  1TQM A;  2BV6 A;  3ABU A;  3BRO A;  2EB7 A;  1LQ1 A;  3CUQ B;  4HA8 A;  3MAJ A;  1UST A;  2ETH A;  1ZLJ A;  4CYD A;  4EM0 B;  1BOA A;  2F5E A;  1MKM A;  2YX4 A;  2QZ8 A;  2V6C A;  3B73 A;  4CZZ A;  2KIM A;  5L3G A;  4WXD A;  3KP6 A;  1K7A A;  4O3M A;  2CQK A;  2L4M A;  1RUN A;  3J81 Z;  4OOI A;  2FNA A;  3GFI A;  4HLY A;  1P4A A;  1BC7 C;  3K1M A;  1REP C;  3SQN A;  4RB3 C;  4UV9 A;  3CTA A;  5AON A;  4M9X A;  2CW0 F;  3QP5 A;  3EUH A;  1TLH B;  3F8N A;  1B9M A;  3KFW X;  5CJ9 A;  4P9F A;  4M74 A;  3HIF A;  1F4K A;  1K78 B;  1R23 A;  3FMR A;  2DTR A;  5E1X A;  1U6G A;  3I71 A;  4EM2 A;  4OIP F;  1YLF A;  2F2E A;  2HTJ A;  3L9F A;  4F7Z A;  1HKS A;  1O3Q A;  2E7W A;  3TOA A;  1QNT A;  1FBU A;  1R00 A;  5CVI A;  5FFZ A;  1IN5 A;  2P6S A;  3BJA A;  4UXN A;  3RIR A;  4AD9 A;  2BBY A;  4G94 A;  1HXD A;  1W7P A;  1STZ A;  2VBZ A;  3F8C A;  1ZH5 A;  4LK1 F;  2FBI A;  3TO7 A;  2OQR A;  3EET A;  2GZW A;  4U88 A;  3WTU C;  3LAJ A;  4EV0 A;  2DO7 A;  3FXQ A;  4I98 B;  4HZF A;  4NB5 A;  3RI4 A;  1CGP A;  1O7L A;  1LEA A;  1Z91 A;  4KIG A;  3CDH A;  5J8F A;  2BGC A;  4LB5 A;  2EFN A;  2XRO A;  1MJB A;  3DXJ F;  1ZAO A;  1GXP A;  4WWC A;  3Q9V A;  3HUG A;  2P6T A;  1F5T A;  2LF7 A;  4IHT A;  2PG4 A;  1ZRD A;  4G7H F;  1FBQ A;  1Q1H A;  1TQP A;  2M45 A;  5H20 A;  4PCQ A;  4QWQ A;  4A6E A;  4HQE A;  2P5L C;  5DD8 A;  4G7O F;  4A5M A;  3ERE D;  1KYZ A;  4LFU A;  3HRT A;  3HOT A;  3CJN A;  1OMI A;  3K2Z A;  1LJ9 A;  2R7F A;  3PQK A;  2DQL A;  2EK5 A;  3G3Z A;  4PGG A;  1K6O A;  3F22 A;  3M1E A;  2O3F A;  2XAS A;  4L9V A;  1HQC A;  3IC7 A;  1FPQ A;  2HGC A;  2WTE A;  1J59 A;  1JXS A;  3GVA A;  3BPV A;  4HV6 A;  2XUB A;  1R36 A;  2P5K A;  3BP8 A;  2HR3 A;  3GX4 X;  1JHF A;  4RGU A;  2L54 A;  1CF7 A;  1KQ8 A;  4JK1 X;  4S04 A;  4Q4Z F;  5LGN A;  3VB2 A;  3FXR A;  3V8J A;  1IXC A;  4JBA A;  2Y75 A;  4CXF A;  5IT3 A;  2RGV A;  3ISP A;  4EJU A;  1IF1 A;  3GZ6 A;  4OIN F;  2UWM A;  4ZZD A;  2MH2 A;  2EA4 A;  4O5V A;  3R0A A;  4PGH A;  2YSR A;  3I0T A;  1WKM A;  2DW4 A;  4MQ9 F;  2A68 F;  4ZYG A;  1XDS A;  4A5N A;  1O3R A;  3EYY A;  3V7C A;  1LNW A;  1I1S A;  2ZXJ A;  4KN4 X;  1V3F A;  4M6Y A;  5D8K B;  3H92 A;  2VBY A;  1QGP A;  3ZMD A;  1PUE E;  4AVP A;  2X0L A;  4HYE A;  3KP3 A;  4I2O A;  3GF2 A;  3N97 A;  3P9C A;  3F6V A;  3WGG A;  3HRM A;  4XSZ F;  3GZ5 A;  3CO6 C;  2IT0 A;  4OMY A;  4YFN F;  1FBS A;  3ZMS A;  5E8I A;  2H27 A;  1TQI A;  3BJ6 A;  4LLL A;  2EV5 A;  1HW5 A;  3HTU A;  1FNN A;  4U0Y A;  3ZP5 A;  2DK8 A;  1AOY A;  3E5X A;  1YW9 A;  2OBP A;  3FZV A;  5HOO A;  4KUM A;  1V4R A;  2VBW A;  2H09 A;  3M7G A;  1YS6 A;  1XB4 A;  2AS5 F;  1U8R A;  5FO5 A;  2FMY A;  2FEZ A;  1S7O A;  1OKR A;  3WOD F;  4Q48 A;  4I0A A;  1QZY A;  1W7P B;  5ILU A;  4A12 A;  4GGG A;  2XIG A;  2D2W A;  5IT9 K;  4YII A;  2XAQ A;  5E17 F;  3QU6 A;  2G9W A;  2Z99 A;  3RKY A;  3MZH A;  1HKQ A;  2VXZ A;  2STW A;  1G3Y A;  1YIO A;  4LB6 B;  3AAF A;  2Q2E A;  1W4M A;  1YW7 A;  3HSE A;  3ZMT A;  3EQL F;  2M8E A;  3ABT A;  4A0Z A;  5ILS A;  4IRH A;  4PDK A;  3VOE A;  1I5Z A;  3LQR A;  3I59 A;  2EFP A;  3F8F A;  4HLX A;  1ZGA A;  3ELK A;  1FY7 A;  1W5S A;  4Q5S F;  4HX4 A;  1U5T C;  3L2C A;  1IN6 A;  3ZMV A;  3L00 A;  1Z6T A;  3KP2 A;  2F5F A;  1YQA A;  1R1V A;  3M9A A;  2JPB A;  3COA C;  1PP8 F;  2ZBK A;  2V9V A;  4EQQ A;  4EGZ A;  4I7H A;  2KRF A;  4L0Y B;  5FLX K;  4ON0 A;  1T98 A;  3WE2 A;  1QQI A;  3GYH X;  1R58 A;  2K02 A;  4AIK A;  1R22 A;  2IA2 A;  1CF7 B;  4HDU A;  4RB1 A;  4LLN A;  3R61 A;  1PP7 U;  1OYI A;  3Q9S A;  2V79 A;  5EEH A;  1XSX A;  2CYY A;  4U0V A;  4AIH A;  2W57 A;  1PDN C;  2A6E F;  2MLG A;  2F5D A;  3HSR A;  1TW2 A;  1J2X A;  1J5Y A;  4IJA A;  2G7U A;  4WCG A;  1GHC A;  1UHM A;  4OMZ A;  2QQ9 A;  1KQ9 A;  3KP7 A;  3GO5 A;  5E1W A;  1KYW A;  4KFC A;  3DKW A;  3PQJ A;  4OU0 A;  3F8M A;  4HF1 A;  2RV8 A;  2RKH A;  1OR7 A;  3BWG A;  2COM A;  2H94 A;  5AIQ A;  2ESH A;  1XCB A;  2XVC A;  1USS A;  5JHU A;  3RTR A;  3LA3 A;  1TW3 A;  4EMS A;  2TDX A;  1FSH A;  4HF0 A;  3DEU A;  2FE3 A;  2ISY A;  1ZRF A;  3WG9 A;  1L0O C;  2O61 A;  1J7K A;  1ZGJ A;  2DFI A;  2ZO4 A;  3WGI A;  4ESJ A;  2ZJ2 A;  1T2K A;  3KCC A;  3CUQ C;  5BS6 A;  3LA7 A;  5CVU A;  2CO5 A;  2GA2 A;  5K1Y A;  2W25 A;  4G9Y A;  3GWZ A;  5F64 A;  1H0M A;  4O6J A;  2FSW A;  4L5J A;  4LMY A;  1S6L A;  3MWM A;  3DPT A;  1IZ1 A;  5IT9 Z;  1ULY A;  3W6K B;  3SZT A;  1EV7 A;  4L9T A;  2UXN A;  3HRU A;  1ZLK A;  4OIO F;  3GFJ A;  4P9U A;  3ZMU A;  2DLL A;  1S8N A;  5LBQ A;  3KLO A;  1SMT A;  3LST A;  3OOP A;  4TV7 A;  4KNY A;  2LDU A;  3QPH A;  1P2F A;  5LGU A;  4UV8 A;  3GXO A;  2PI0 A;  1SMY F;  1YFH A;  1KU3 A;  4BAY A;  3ROU A;  3JTH A;  1MJA A;  2KKO A;  3REO A;  3BDD A;  1BI0 A;  3E6C C;  3KE2 A;  1I27 A;  1UFM A;  5FB2 A;  3QRF F;  3DF8 A;  1R5G A;  5HS7 A;  2R7D A;  1XGM A;  4MHG A;  2UZK A;  4UHT A;  1FSE A;  1SD4 A;  2A6H F;  3I59 B;  2RC4 A;  2XAF A;  2K86 A;  1KU7 A;  2PJP A;  1GXQ A;  4RS8 A;  4A2U A;  5FD6 A;  1UB9 A;  3TGN A;  2L4A A;  3ZPL A;  2QQB A;  1BI2 A;  3H3U A;  1G6N A;  1S3J A;  2WC2 A;  5ICG A;  5FLX Z;  2H6B A;  2L02 A;  3D0S A;  2ESN A;  5D5X B;  3G73 A;  1FYL A;  1YO5 C;  4YIF A;  3W6J B;  2EJR A;  3RKX A;  4BXU A;  2X4H A;  3RDI A;  1ZG1 A;  1W5T A;  3L7W A;  2VC0 A;  3V8L A;  4EJO A;  3ECH A;  5LHH A;  4Z2Y A;  3FX3 A;  2PEX A;  3JSP A;  1BI1 A;  3VFZ A;  3R6S A;  3VEP A;  3IL2 A;  2VE9 A;  2QQA A;  4LLG F;  5DDG A;  2D1H A;  1KU9 A;  2VBX A;  1SAX A;  2OZU A;  1YS7 A;  5DCF A;  1D5V A;  1IN8 A;  1J9I A;  5DYM A;  3HTS B;  2FRH A;  1FP1 D;  3IRR A;  1RI7 A;  3JTG A;  3O6B B;  1IW7 F;  3RKW A;  4I09 A;  1AWC A;  3GEZ A;  5ED4 A;  2W84 A;  3RYP A;  3WE3 A;  5CLS A;  1B4A A;  3MCZ A;  3K1P A;  4WXH A;  4R79 A;  2QBY A;  4P55 A;  3P9I A;  1WWX A;  1WSU A;  3F23 A;  4K2E A;  5DUK A;  3SZP A;  1B6A A;  3C7J A;  2A5Y B;  3DPL C;  3DFG A;  4GCV A;  4IRI A;  1B9N A;  4ENJ A;  3I58 A;  5ICF A;  3KET A;  1BC8 C;  4YFK F;  1IUY A;  1ZHF A;  4XBF A;  1LB2 A;  5E1Z B;  3GLX A;  3KLN A;  3OV8 A;  1SFX A;  5HS8 A;  4H0E A;  2Q0O A;  4HV5 A;  1P6R A;  5ERI A;  4HOB A;  4FT8 A;  2IA1 A;  4MTE A;  5L3C A;  3NQO A;  1SFU A;  2EA2 A;  3BJO A;  4PZJ A;  3DV8 A;  3MEX A;  3E97 A;  4EJV A;  4MTD A;  3JAM K;  2PQ8 A;  3NRV A;  1I6X A;  1XMK A;  3QP6 A;  4M72 A;  2C6Y A;  2FF4 A;  3FMS A;  1Z05 A;  1YW8 A;  4EM1 A;  2D45 A;  2K7L A;  5D4S A;  1T6S A;  5L3D A;  3EDP A;  4IPA A;  4M73 A;  2HDC A;  2P8T A;  4IF4 A;  1TNT A;  1BM9 A;  4I02 A;  5D6F A;  2LNB A;  4KYW A;  2HOE A;  3IWZ A;  3H3Z A;  2XV4 S;  4KIC A;  5BPI A;  1JGS A;  5F6F A;  1FYM A;  2MBF A;  5JR3 A;  4KA4 A;  1S29 A;  2D1V A;  1ZG5 A;  4HX8 A;  3MZY A;  1YYV A;  3ZQ7 A;  5DUI A;  2EWN A;  3SXY A;  2IP2 A;  3TQN A;  5H6R A;  2PN6 A;  2MA3 A;  1DUX C;  1LEB A;  1IAW A;  2Z3Y A;  3IWF A;  3I53 A;  2BEO A;  2ZNZ A;  1J0R A;  1UHW A;  5CVV A;  1XN7 A;  4BH9 A;  2NYX A;  2XKO A;  2VN2 A;  3QU3 A;  4XLP F;  2BE5 F;  2M87 A;  2JT1 A;  1DP7 P;  1XDU A;  3RPU A;  4XLN F;  2VON A;  4NQW A;  4KIB A;  3LWF A;  4BYY A;  3KP5 A;  5CVR A;  4AIJ A;  3V7S A;  4HW0 A;  1ZAR A;  3CO7 C;  2WV0 A;  3GFM A;  3N4M A;  4HAM A;  2GXB A;  2P5V A;  4ENN A;  1YTY A;  4Q47 A;  3GFL A;  4UNO A;  2MC3 A;  3U9G A;  2CGP A;  3KP4 A;  1SD5 A;  1OYY A;  4GYI A;  2K27 A;  1BIA A;  4OIR F;  5HVQ C;  2K4B A;  4ESF A;  4LK0 F;  1UCR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...