2K27A

Solution structure of human pax8 paired box domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
159
Chain Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Paired box protein Pax-8
publication title The Solution Structure of DNA-free Pax-8 Paired Box Domain Accounts for Redox Regulation of Transcriptional Activity in the Pax Protein Family.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A02
4RAYA 1I1GA 2R7FA 2E1CA 3DP7A 4EJWA 3I59B 4PGGA 4MHGA 4IHTA 4R79A 3SFZA 3K9TA 5HDKA 1YW8A 2XAFA 1RZ4A 3FXRA 4YFXF 1VTNC 1FBSA 1A04A 1KGSA 3F6VA 1LEAA 5DEQA 3QPTA 1PP7U 5DUIA 3TQNA 3E6CC 3I59A 5E8GA 3KETA 2G9WA 1EH8A 2HFHA 3GEZA 3VODA 4MGRA 4G7OF 1I5ZA 4RGXA 3JAMK 5JVTA 4ON0A 4U0WA 2WV0A 3HRTA 2Z99A 3RKXA 3WTYC 2HKXA 2V9VA 4M9XA 1J5YA 1PDNC 1J0RA 1FY7A 3WGHA 3TDZC 1W4MA 1G3TA 1XSDA 3I5UA 3T8RA 2CSOA 3ML6A 4S04A 3ZN0A 3WTVC 1QPMA 3K69A 1MJ9A 1P92A 1FBUA 2QYOA 1FSHA 3F8MA 3RIRA 3EDPA 1ZLJA 5HVQC 2O8XA 1BIBA 1SFUA 3QRFF 1QGPA 1ULYA 3LSTA 4KIBA 1OYWA 2JRTA 1V3FA 3K1MA 3C18A 2DLLA 3HRSA 4KNYA 4OU0A 3L2CA 2XVCA 2CWEA 4M9ZA 3GVAA 2LSOA 2IA2A 1USTA 3I0TA 2BE5F 1R23A 3W6KB 2CYYA 4A5MA 1X3UA 5EEHA 2L3DA 2KRFA 1T0FA 3FMQA 4ENNA 1J2XA 1LDKB 1ZHFA 5KK1A 1LEBA 4JBAA 4ENJA 3KP6A 1R1VA 1ZRFA 3V7CA 1YQAA 4O3MA 3M9AA 4O6JA 2EB7A 5HS8A 3E5QA 1YYVA 3ZMUA 2DK5A 5L3FA 1MDMB 2OD5A 4XLPF 2NYXA 4OIQF 3CO7C 2DBBA 4CYDA 2W84A 5FLXK 3EETA 2A69F 4U7BA 3BZ6A 3J7AO 2YSRA 1U8RA 4XSZF 4F7ZA 2HWVA 3F8FA 1IRFA 1K7AA 2PBIA 4ETSA 4WX9A 1H0MA 2DI3A 2DQLA 5ILUA 3MZYA 3IWFA 3BJ6A 3V7SA 4IPAA 3V4GA 4Z2YA 5E18F 2PN6A 3P9CA 1B9NA 1P4XA 4L0ZB 2P5VA 1DP7P 4BNCA 1UB9A 2D2WA 3GFMA 3FWEA 5EEGA 2RGVA 3C1DA 3Q9SA 2Y75A 2M1BA 2ISZA 1O7LA 4WXHA 4Q4ZF 1YS6A 2QQAA 2H6CA 1IN5A 4DNCA 3E97A 5H6RA 2VE9A 2JTVA 1ZGAA 2E7XA 2A07F 5K5OA 3F8BA 2KKOA 5IT9Z 3BPVA 4G8XA 1W7PB 3BDDA 4WXDA 4L18B 1JHFA 4HA8A 3ZMDA 2ADUA 5J8CA 3WTXC 1J7KA 4TV7A 1ON2A 4HF1A 3KFWX 1DPRA 5DD8A 3D0SA 4MTDA 3RKWA 1ZRDA 1BBYA 2RNJA 2QVOA 3KP3A 2O0YA 1H9GA 4K2EA 2DQRA 2PJPA 2P4WA 3JSOA 4GGGA 4HF2A 5JHUA 4L9VA 1FP2A 1W7PA 4Y15A 1ZREA 2F5DA 4A12A 3EYYA 4CICA 5CVVA 2EA4A 4KIGA 4HZFA 3RPUA 1FNNA 1U5TB 5LHGA 4ESBA 2XHKA 3F8CA 1IN4A 3F3XA 1SD6A 2XASA 2EA2A 4L9NA 5E20A 1SFEA 3DEUA 1UHWA 2XV4S 1EH7A 1PUEE 2Y48A 3KZYA 4MNUA 1I6XA 4LGWA 2HS5A 1R5GA 2MA3A 4O5VA 4IJAA 2CW0F 4EJVA 5A2QZ 1U5TA 3IHUA 2P7VB 2HDCA 3DF8A 3FMSA 3QU6A 5LRSA 2STWA 1RUNA 4ZZDA 3E5UA 4JQFA 1LQ1A 2QZ8A 3GF2A 2NNNA 4RS8A 4I02A 4KFCA 5F64A 3WTSC 1WI9A 5F1RA 2J5PA 5HDGA 5K5QA 5HDNA 1LNWA 5CYVA 3L09A 2L54A 3FMRA 6PAXA 3WODF 3E6DA 1HSJA 2ZCWA 3BROA 3KCCA 3EUHA 1B1BA 3ECHA 4H0EA 3F8NA 4B8XA 4N0BA 2ISYA 1SD5A 4D0PA 3I64A 2YX4A 3KEOA 3ABUA 2XKPA 2YX7A 2X0LA 5FD5A 1BC7C 1YIOA 5D5UB 2FNAA 1U2WA 2VONA 3RYRA 4CDGA 4BHBA 5LEJA 5E17F 2W25A 1OYYA 3GWZA 3MFKA 1XSVA 3LA2A 4HX4A 5ERIA 2M30A 4RGSA 2O03A 1FBQA 5HOOA 2DO7A 3PFIA 3E6BA 3IWZA 4CGZA 2KJBA 5BQTA 2XRNA 1IXCA 1ONVA 4LLLA 1UCRA 2OQGA 3T1BA 2GWRA 4EJUA 3ISPA 2L02A 3HTUA 2JZYA 4B09A 1B4AA 4BH9A 2MD5A 2XAGA 4MQVA 3WTZA 2QQBA 1BIAA 2H94A 3GFLA 3TDUC 2MBFA 3LQQA 3LAPA 1G3YA 2YU3A 3M8EA 1HW1A 3ZMZA 1KQ0A 1XD7A 2M8EA 4E70A 2VBWA 5LGTA 2FU4A 3BPXA 5ICEA 4LLNA 4XBFA 3K1PA 1O3QA 1D5VA 2PLYA 1P4AA 3DPLC 5ICCA 5HLGA 1FZPB 2P5LC 2OAZA 2VBXA 2EWNA 4M71A 4EQQA 4UVCA 2HEOA 2WC2A 3GX4X 1DUXC 4M6YA 2VN2A 3VB2A 1NHAA 2QBYB 3ZMVA 5DCMA 5FD6A 1W5SA 1XSXA 1YO5C 3SQNA 2FQ3A 4HV5A 2FA5A 2V6CA 4UXNA 5KVRA 4Y13A 1WKMA 3C3WA 4RB3C 4G94A 4P9UA 4EMSA 4UUVA 2PFBA 4HQMA 2GZWA 4A0YA 2VC0A 2GA2A 4YIIA 1S3JA 4UVAA 5K5RA 4BXUA 3WU0A 4IXAA 3J80K 1K6OA 5FFXA 1IXRC 4OOIA 1E2XA 2ESNA 3WG9A 2VT3A 3E5XA 2XUBA 1TNSA 2XGXA 3GFIA 5HLHA 4IVNA 1HW2A 1HKSA 2KIMA 1T98A 3EQLF 1IXSB 5DDGA 1OYIA 2EFWA 1KQ8A 5JFRA 2A5YB 1J59A 3CUOA 1LDDA 2WWYA 1RIOH 4KYWA 2ACJA 1YW7A 5ICFA 3RPQA 5BPIA 2XAHA 3ROUA 4IF4A 3I58A 1ZG1A 3K2ZA 2XAQA 3BP8A 3TGNA 3LA3A 3ZPLA 3F21A 2NAZA 1YTYA 2FNPA 1FPQA 3CDHA 2RKHA 3DPTA 4I2OA 2A68F 2PMUA 1LDJA 3GLXA 3F23A 3JTGA 4BAYA 3MQ0A 2DU9A 2AS5F 4LD5A 1FLIA 1S29A 3CO6C 4LB5A 4R8HA 1XGSA 2MH2A 2ZJ2A 3COAC 5IT9K 4PDKA 1TBXA 3M8FA 4NHJA 3FXQA 1S7AA 4U88A 1RNLA 3M1EA 3GO5A 2HQRA 5E1XA 5FGMA 2DPDA 4Q5SF 3U2RA 4UVBA 2FSWA 4A6DA 1U78A 2EV5A 3ABTA 4ASNA 4ESJA 4MEXF 4GXOA 1BI2A 3IRRA 2BEOA 2UXXA 4ENMA 2TDXA 1R22A 5JI6A 1HKQA 1QQIA 3T0YA 2Y0MA 4UHTA 2B0LA 2BGCA 2A6HF 3J81K 2LKPA 5DV5A 3MZHA 3JSPA 2K7LA 1IW7F 3G3ZA 4DQ2A 5H20A 5LGUA 4M74A 4GYIA 1XGOA 3TKYA 5K1YA 2MLKA 4HYEA 3V8JA 1MKMA 4HX8A 1JGSA 2Z33A 1LJ9A 4P9FA 2P8TA 2L4MA 3MAJA 4JK1X 2JSCA 5CVRA 5BOXA 2KIFA 4BQAA 5CVUA 2IRFG 1E17A 3HHGA 4ESFA 2QM3A 1ODDA 4WXCA 2ZNYA 1T6SA 1MDMA 2QUFA 1R1UA 1DPUA 3FX3A 3LWFA 5CVJA 2ZMEB 2A3SA 4IRGA 4M6XA 2VBYA 2QWWA 1FSEA 1OKRA 3Q5FA 4G7HF 5D5WB 1F4KA 1G4DA 2CFXA 3AAFA 3U1DA 2OZ6A 1TW3A 2K4JA 3KE2A 3HSEA 2L4AA 4FX0A 3WTTC 3R4KA 3HRMA 4WWCA 2P5KA 3GW2A 4PGHA 1Q1HA 2ZMEA 3LA7A 1XCBA 1V4RA 5DD4A 4EM0B 4GO1A 4Y17A 2QLZA 4L9JA 4CHUA 2O6GE 5L3DA 3HRUA 1GXPA 1XGMA 4I0AA 1BOAA 2GXGA 5D8KB 2Z9OA 2HKOA 4OIOF 3SHFA 1IUYA 2CGPA 3SXYA 4WCGA 3CLOA 1WWXA 1IAWA 1Y0UA 2Z3YA 3E6MA 3GYHX 3H3UA 3IC7A 2R7DA 2P7CB 3DQVC 3FXUA 1YLFA 2UWMA 1LB2A 4HOBA 2X4HA 1SMTA 3P9KA 5HLIA 1IF1A 2FRHA 2IT0A 1GHCA 1U6GA 1XGNA 4M73A 1R7JA 2HQNA 1I27A 4KN4X 1ZARA 5J8FA 2MC3A 1KYWA 2DT5A 3QOPA 3SZTA 4I98B 1XMKA 5FB2A 3RKYA 2OU2A 3LFKA 1O57A 2D1HA 2DW4A 3FZVA 5E1ZB 3KP7A 4EM1A 1HKTA 2EV6A 1MGTA 4IRIA 1KU3A 1I1SA 4I09A 5LBQA 4A5NA 2MH9A 4XRFA 1F9NA 2GXBA 3GXOA 3T5XA 2W57A 1QNTA 1GXQA 3Q9VA 2H6BA 2J5OA 2DFIA 1D3YA 2HZTA 3HOTA 4OINF 5DUKA 1TQPA 2DTRA 2PI0A 4BHCA 3KP2A 2FOKA 3V8LA 1R00A 1ZAOA 2VT2A 2D45A 4YIFA 3ERED 2V1DA 3O6BB 2VE8A 1O3RA 1HQCA 3CUQB 4OIRF 3OV8A 2E7WA 1D8JA 4AIJA 3TO6A 4RGUA 5LRRA 1CF7B 3TO7A 3I53A 1O3SA 3I71A 4L5JA 1REPC 2HTSA 2A61A 1D8KA 1S8NA 1XDSA 4KUMA 1U5TC 4HQEA 1OR7A 2G7HA 1ZRCA 1FOKA 4AIHA 2VODA 2GAUA 1FWZA 2K86A 1JXSA 4HAMA 4Q48A 2KIUA 3KLNA 2V79A 3O2PE 1CF7A 4FHTA 4BYYA 3O3KA 1ZLKA 4WF2A 3HUGA 4CXFA 4LFUA 5LEKA 1WRJA 4GCVA 1O3TA 1P2FA 4P5OA 2Z5UA 4LG0B 3JW4A 2HOEA 4KMUX 1WQ2A 4PZJA 2UXNA 3W6JB 1TNTA 3WU1B 1G6NA 1ZYRF 2IVMA 3D5LA 4ZZLA 2DK8A 2O3FA 3RI4A 4YFNF 1Z05A 4FT8A 3ECOA 1BM9A 5J6XA 1ZG5A 3BOQA 3OOPA 3KP5A 4LK1F 4EV0A 2ZXJA 2F5EA 3IKTA 4UV9A 2DPUA 3EYIA 4ZYEA 3L00A 4WK8F 3BWGA 5BS6A 3IRQA 2FXAA 4LB6B 4I7HA 1BN5A 2VC1A 2Q0OA 4PCQA 1KU9A 1H9TA 2P6SA 3G73A 1OPCA 1FYLA 3GUDA 1QZZA 3R0JA 1AOYA 4P55A 4IRHA 2QBYA 2GA1A 3F72A 5FFZA 3CJNA 1PP8F 2IA1A 3WGGA 2Q8KA 3K1NA 1TW2A 1OMIA 2YR2A 4HBLA 2Q2EA 4EJOA 1YFHA 3HSFA 2RQPA 1IN8A 1BI0A 1ZH5A 4A0ZA 2ZBKA 2LNBA 1HXDA 3PQKA 1KYZA 3IKVA 3DXJF 3HOSA 5LGNA 4RB0A 4G7ZF 3LAJA 1T2KA 2HTJA 3HTSB 4UV8A 4CO8A 4EGZA 4UNOA 4LJZF 3HHHA 5CVIA 5IT3A 2FE3A 1C0WA 4RB1A 2BYVE 4AIKA 4L5IA 5TRDA 3E3VA 4OIPF 5DCFA 4RGRA 1HW5A 5D4SA 3QPHA 3WTWC 2F5CA 2KJCA 3ZMSA 1EV7A 3KP4A 5CLSA 1RUOA 2RV8A 2OQRA 3NRVA 3FM3A 2W24A 2H27A 4R1HA 2K02A 3DV8A 2IJLA 1Z6RA 3MCZA 3F22A 2VOPA 1R1TA 2LF8A 2NS0A 4ZYGA 1QZYA 3ZQ7A 1YW9A 1W5TA 3BJOA 5HS7A 3RDIA 1LVAA 5D6FA 4AWXB 4AD9A 4CZZA 3T8TA 3K0LA 1MD0A 1FYKA 1G3SA 4KICA 2ESHA 1K78B 2XROA 1TLHB 2PQ8A 1J75A 1BI1A 2MLGA 5D5VB 3TOBA 1JHHA 3REOA 3GZ6A 2FF4A 1IN7A 2OA4A 3L9FA 5A2QK 2BBYA 1XN7A 5DYMA 5L3EA 2IPQX 4KIFA 1SMYF 4XLNF 4HV6A 3J80Z 1J9IA 1K78A 2GQQA 2IW5A 3SZPA 2P6TA 2M5WA 2H09A 4IHSA 3VFZA 5FO5A 5CJ9A 3QP5A 2CQKA 3BJAA 1Z1DA 2HYFA 5LHHA 2ZKZA 1B6AA 2HR3A 1L3LA 2PG4A 2WTEA 1FC3A 2CO5A 3KEQA 3KLOA 5D4RA 3L7WA 4U7DA 1HBXG 5AONA 3VEPA 1KQ9A 1QBJA 3U9GA 4G6QA 3H92A 3R60A 2V1XA 4N9IA 1IN6A 4LK0F 4RAZA 3CTAA 3JAMZ 1Z9CA 2EFOA 1L0OC 2ZNZA 1GVJA 1FT9A 3I54A 4NQWA 5L3CA 3N97A 4A0XA 3V8KA 1KU7A 4GYGA 3FHZA 3HYIA 5E8IA 1AWCA 3R61A 3RTRA 2QQ9A 3IL2A 5LHIA 5BPDA 3WGIA 4U0YA 2AXLA 1W7PD 4KA4A 4LLGF 1ON1A 2OZUA 3JTHA 1SAXA 3ZP5A 1P4WA 2PEXA 2HYGD 3ULQB 2RDPA 1K79A 5D8LB 4YFKF 3GZ5A 2XAJA 1YG2A 4OMYA 1BC8C 4I0BA 5F6FA 4ZYDA 3RJPA 2LDUA 1Z7UA 1SFXA 4G9YA 2RVCA 4M72A 2YPRA 4M9SA 3FM5A 1USSA 5AIQA 5TJJA 3J81Z 2K4BA 3P7NA 4HDVA 2RC4A 4MEYF 1STZA 5AIPA 1QO0D 4OMZA 1U3EM 2BV6A 3C7JA 1XMAA 1KU2A 2EV0A 4BHPA 2F5FA 3GFJA 4KN7X 2NRAC 3ELKA 3WE3A 3R6SA 5HS9A 1FX7A 3ZN1A 1KA8A 3B02A 1TTYA 2VXZA 3M7GA 2EK5A 2FBIA 2D1VA 3N4MA 3WTUC 5FLXZ 1XDUA 2ZFWA 4HX7A 1WSUA 1TQIA 4ZYHA 4Q47A 3NEUA 2EFQA 1O7FA 1G3WA 1ZGJA 1T38A 5D5XB 2M45A 4G6DA 4MTEA 2EJRA 1HSTA 2FBKA 2VOOA 2QENA 4MQ9F 4U0VA 3MEXA 2XIGA 2M87A 1MZBA 1Z91A 2GIVA 4P96A 3V7RA 1MJAA 3MWMA 2HGCA 2STTA 2ZO4A 2G7UA 5D6EA 1TQMA 1XB4A 3R0AA 3BY6A 1P6RA 1ZN2A 4RB2C 2EFNA 5E1WA 3PQJA 1B9MA 5ED4A 2ELHA 3S2WA 3DKWA 5ICGA 1FYMA 2UZKA 4A2UA 1EH6A 3CUQA 2E1NA 2JPCA 2RN7A 4HLYA 4FX4A 4HDUA 3QAHA 4QWQA 3I4PA 4KMFA 2FMYA 4EM2A 1R58A 5LLQA 2PMHA 1RI7A 2C6YA 2XKOA 1UFMA 2DAOA 1F1ZA 1S7OA 1JE8A 3NQOA 1CGPA 5JR3A 2EFPA 4HLXA 3QP6A 2FMLA 3VOEA 2IA0A 2ETHA 4NB5A 4L9TA 5BMZA 1FP1D 2COMA 4KDPA 2R3SA 1YS7A 3KZZA 1ZG3A 3TOAA 4S05A 2K27A 4LG0A 2LF7A 5L3BA 2FEZA 5DCMB 3F6OA 3QU3A 4AVPA 3DFGA 4LMYA 3RYPA 1R36A 2F2EA 1SD7A 4QLCU 1SD4A 2JT1A 4XSXF 4N9HA 3TO9A 2V1UA 4EVIA 4L0YB 3B73A 2A6EF 2L01A 3HIFA 3HSRA 4HF0A 1Z6TA 3CUQC 1XCVA 2JPBA 4ENKA 4HW0A 4I01A 1MJBA 4EJTA 1IZ1A 1BJAA 1S6LA 5ILVA 2FBHA 5ILSA 3FF5A 2O61A 3LQRA 1R5HA 4KT5C 5L3GA 1IRGA 5H6QA 1BI3A 1UHMA 1F5TA 4EGYA 2IP2A 3P9IA 2CG4A 2VBZA 2W85A 4YG2F 1B59A 3ZMTA 3WE2A 1DDNA 2OBPA 4A6EA 3H3ZA 4ZH4F 1T39A 2NNYA
chains in the Genus database with same CATH superfamily
4RAYA 1I1GA 1JT0A 1B8IA 2R7FA 4J19A 2DA6A 1XC5A 2E1CA 3DP7A 4EJWA 3I59B 4PGGA 4MHGA 4IHTA 4ANJA 1K6YA 1U9OA 4R79A 3SFZA 3K9TA 5HDKA 3OYIA 1YW8A 2XAFA 1RZ4A 3FXRA 4CSWA 4BE0A 1WH5A 4XMYA 1X58A 3HEFA 4N4OB 5JLXA 4NC6A 2KIQA 3I3LA 3KYDB 4YFXF 1D1BA 1VTNC 3A01B 3CF2A 5HNHA 1FBSA 1A04A 1KGSA 3F6VA 1LEAA 3S3OA 2ELKA 5DEQA 3QPTA 1PP7U 2H1LA 5DUIA 2JQ7A 3CCLI 3TQNA 3KIOA 3I59A 5E8GA 3KETA 2G9WA 3E6CC 1EH8A 4FISA 2HFHA 3GEZA 3VODA 4MGRA 4G7OF 3K7AJ 1E3HA 2DFEA 1DU0A 1I5ZA 4RGXA 3HOYJ 3JAMK 3TP0A 4I76A 5JVTA 1UMQA 1W0TA 1MIJA 3RQIA 4ON0A 4XNFA 2R92J 4U0WA 5KCMA 2WV0A 3HRTA 2X6WA 2Z99A 3RKXA 3WTYC 4A3BJ 3FK7A 2HKXA 2V9VA 4M9XA 4IKFA 1J5YA 2DA2A 1PDNC 1QZEA 1J0RA 1FY7A 3TDZC 3WGHA 1W4MA 1G3TA 1XSDA 3I5UA 3T8RA 2XC7A 3K4MA 1R5ID 2CSOA 3MKWB 3ML6A 4M3DA 2Y0SA 1LE8A 4S04A 1APLC 2QKMB 3VYSB 2BW3B 3LFUA 3RZOJ 3P5JA 3D1NI 3ZN0A 3WTVC 1HCRA 1EF4A 5KHDA 1QPMA 3K69A 1MJ9A 1P92A 3B6CA 4IQ4A 5E3OA 3FISA 5CQGA 4V19K 1FBUA 2QYOA 1FSHA 1WJ5A 3F8MA 3RIRA 1WJFA 3EDPA 1ZLJA 5HVQC 1X4PA 2O8XA 3OL4A 1BIBA 1SFUA 2HNHA 2JK3A 2M4GA 3B6AA 3QOEA 4HPQA 1QGPA 4NC7A 1ULYA 3IH4A 4AC0A 3QRFF 3LSTA 3H9GA 1OYWA 4KIBA 4Y3OA 3J7YJ 4BEHA 2JRTA 3HOXJ 1V3FA 3K1MA 3C18A 2BW3A 2VXDA 4LG3A 2DLLA 2L7FP 2DCEA 4HEA2 3HRSA 3LSHA 2NVUB 3WHBA 4MIMA 4KNYA 4OU0A 3L2CA 2XVCA 2ZXWH 2CWEA 4M9ZA 3GVAA 2LSOA 2IA2A 4EEFG 1USTA 1LUJB 3I0TA 2XSDC 4UUSB 4BE1A 2XPUA 1D0ZA 2MGQA 2BE5F 4DW6A 1R23A 2X1DA 3W6KB 4PFPA 2CYYA 4A5MA 5K7HA 1X3UA 5EEHA 4HSRA 2L3DA 3SDGA 3UNGC 3L2UA 3S17J 4XLHA 2KRFA 1T0FA 3FMQA 3ZQLA 2RNGA 2OTLI 4ENNA 1J2XA 3DEWA 3A1YA 1LDKB 1P7JA 2FQ4A 1ZHFA 5KK1A 2LTPA 1LEBA 4JBAA 2JA7J 4ENJA 3KP6A 1R1VA 3OYEA 3CCVI 1VQ8I 2VKEA 3H0GJ 1ZRFA 3V7CA 1YQAA 4O3MA 3M9AA 1ETWA 3W2WA 1KONA 4MFDA 4O6JA 2EB7A 5HS8A 1MBEA 3E5QA 5EG0B 3HOWJ 1YYVA 3ZMUA 2DOFA 2DK5A 5L3FA 1MDMB 2OD5A 5IYDJ 1RETA 4XLPF 2NYXA 4OIQF 3IAS2 2M2EA 2CJJA 2DDBA 3CO7C 2DBBA 2KQRA 2W84A 5EJCA 4CYDA 4CCKA 3CJTB 2E1MB 3EETA 3CCRI 5FLXK 4DGWB 4XKVA 2A69F 4U7BA 2ID3A 3BZ6A 3J7AO 1LVKA 2YSRA 1VF9A 1U8RA 4XSZF 4F7ZA 3HZJA 1FIAA 3OS0A 2HWVA 3TL4X 3F8FA 5EG0A 1IV6A 1GDTA 1IRFA 1K7AA 2PBIA 4ETSA 1ZELA 2UV1A 4WX9A 4M3BA 1MH3A 1H0MA 2D5VA 2DI3A 2CV2A 2DQLA 3MZYA 3IWFA 3V7SA 3BJ6A 5ILUA 4IPAA 3V4GA 4Z2YA 5E18F 2PN6A 3P9CA 2I8DA 1B9NA 1P4XA 3OYHA 1FOWA 4L0ZB 2P5VA 1DP7P 4A3EJ 4BNCA 3G6EI 1UB9A 2D2WA 1FOXA 5J3LA 1A36A 3GFMA 5FLMJ 3FWEA 5EEGA 3ZXSA 2AQFA 2RGVA 3C1DA 2H8WA 3Q9SA 2Y75A 2M1BA 2LR8A 1O7LA 4WXHA 2ISZA 2DMNA 2JJ7A 3HM5A 4Q4ZF 1YS6A 2CQQA 2QQAA 3JRIA 2H6CA 1IN5A 4DNCA 3E97A 5H6RA 2VE9A 2QEXI 2JTVA 2QSGX 3H5AA 3S93A 1ZGAA 2E7XA 4NDLA 1S72I 3A0HC 5IPAA 3DKYA 2A07F 1J09A 1PUFB 5K5OA 3F8BA 2F6CA 2KKOA 5IT9Z 1A5JA 3BPVA 4G8XA 2OJED 2PX9A 1W7PB 3BDDA 4LOCA 3HKZN 4WXDA 4L18B 3W6VA 1JHFA 3C2HA 4HA8A 2K9NA 3ZMDA 2ADUA 5J8CA 3WTXC 1T0FC 1J7KA 4TV7A 1ON2A 3LSJA 2L7ZA 2TRTA 4HF1A 3KFWX 1DPRA 5DD8A 3D0SA 4MTDA 2NS7A 1T08B 2OCEA 3RKWA 3ABLH 1ZRDA 3FBNB 4PJMA 4GRIA 3PJRA 1BBYA 2RNJA 2QVOA 3KP3A 2O0YA 4II2A 1H9GA 4A3IJ 1VFCA 4Y7NJ 3CESA 4K2EA 1PUFA 1N77A 2DQRA 2ID6A 2P4WA 1YIJI 2PJPA 3JSOA 4GGGA 2HVSA 4HF2A 3OS1A 5JHUA 4L9VA 1FP2A 1W7PA 4Y15A 1ZREA 3BCBA 5C3EJ 3S16J 2F5DA 1K4TA 4A12A 2E5NA 3EYYA 4CICA 1W0UA 5M5XJ 5CVVA 2EA4A 4XORA 4KIGA 4HZFA 3OL3A 3RPUA 1Y8QB 1FNNA 1U5TB 5LHGA 4ESBA 2XHKA 3F8CA 2DODA 3HPGA 3QYFA 1IN4A 2LYCA 3DLAA 3F3XA 1V55H 4DYRA 1SD6A 4YIRX 3PIPF 3JRHA 1Y39A 3GTQJ 2XASA 2EA2A 4L9NA 5E20A 2VPLA 1SFEA 4QSHA 3DEUA 1UHWA 2XV4S 1EH7A 1PUEE 2Y48A 3KZYA 3C2BA 2FX0A 2K40A 3CC4I 2L0KA 1Z0XA 2XB0X 4RBOA 4MNUA 1I6XA 4LGWA 2HS5A 1R5GA 1TWHJ 1NG6A 2MA3A 4O5VA 4XOPA 4IJAA 2CW0F 4FCYA 3BQZA 3BZCA 4EJVA 1U5TA 5A2QZ 1XMXA 1UG2A 2X6YA 3IHUA 2P7VB 2HDCA 4BQNA 3DF8A 3FMSA 3QU6A 5LRSA 3IH3A 2VKVA 4XK4A 4BJ6C 5IYBJ 2STWA 1RUNA 4ZZDA 1BW5A 3WG7H 3E5UA 4JQFA 1FMVA 1LQ1A 3OSFA 2XF5A 1BJZA 3JRFA 2QZ8A 3GF2A 2NNNA 3H5NA 4BDZA 5GAHJ 4RS8A 4I02A 4KITB 4KFCA 2XPWA 5F64A 3WTSC 1WI9A 1JUPA 5F1RA 4V2FA 3LL7A 4RAFA 2J5PA 2CW8A 5HDGA 5K5QA 3VDXA 5GTHC 1WCMJ 4E7KA 5HDNA 3JRAA 1LNWA 2KFDA 4CA0A 1Z77A 2WAQN 5CYVA 4C3JJ 3L09A 2L54A 3FMRA 6PAXA 2L2OA 3WODF 3E6DA 1HSJA 3LSGA 4OAYA 4CYCB 4U87A 2ZCWA 3HKZA 2EZLA 1E3OC 3BROA 3KCCA 3EUHA 1B1BA 3ECHA 5F0FA 4H0EA 1A35A 4L5EA 3M3YJ 4IOAF 3F8NA 2QF7A 4B8XA 4N0BA 4C3IJ 1QVUA 2ISYA 1SD5A 2DMUA 4D0PA 4PSXA 2JMWA 3I64A 2LREA 1XX5A 3VWBA 2YX4A 3KEOA 5M5WJ 2VLAA 3ABUA 2XKPA 2DN0A 2YX7A 5EGOB 2X0LA 5FD5A 1FMWA 1W5CC 2L9NA 1BC7C 1YIOA 1TWFJ 2ZXIA 5D5UB 2K85A 2FNAA 5LFAA 1U2WA 2VONA 4C2TA 3RYRA 4CDGA 4BHBA 5LEJA 2JA5J 2W25A 5E17F 4QPOA 1OYYA 1OCPA 4FASD 2E35A 3GWZA 3MFKA 1XSVA 2BZTA 1OCRH 3LA2A 2Y2ZA 4HX4A 3PSIA 3CC7I 5ERIA 2M30A 4RGSA 2O03A 3H0DA 1FBQA 5HOOA 2W82A 2DO7A 3PFIA 2KL4A 2V26A 3E6BA 3QYEA 2RREA 1OCOH 3S1NJ 2K9QA 3IWZA 5B1AH 4CGZA 3CF5F 5FKOA 1X2MA 3O8HA 1BR2A 2KJBA 3K70D 3VPRA 5BQTA 2XRNA 1IXCA 1ONVA 5IYCJ 4OWRB 4LLLA 2K3FA 1UCRA 1Z21A 2OQGA 3T1BA 2GWRA 4EJUA 1YRNA 2OV7A 4MFEA 1QA6A 1ETXA 1WJBA 3ISPA 3I9V2 2V9PA 1WI3A 3RQ4A 2L02A 5GPCA 3HTUA 2JZYA 4IL6C 4B09A 1B4AA 2KPMA 3JRDA 3BCAA 4BH9A 4ZDLA 2MD5A 2XAGA 9ANTA 1B72A 4UB8C 2NS8A 4MQVA 3WTZA 1QPIA 1CQTA 2QQBA 1O4XA 1BIAA 4BGDA 2H94A 3E7LA 3GFLA 4ZTFA 3TDUC 2KRCA 3OYBA 3W3CA 2MBFA 3LQQA 5C4JJ 2HOAA 3SFIA 2JA6J 3LAPA 3FKIJ 1G3YA 2YU3A 4DYCA 3M4OJ 3M8EA 4ZDOA 3TBIA 1HW1A 1MSFC 2WAQA 2XPVA 4NUBA 2X1EA 4UB6C 4XRSG 5F0HA 2WY8Q 3ZMZA 1KQ0A 1XD7A 2A5WA 3EUHC 2M8EA 2DOEA 2BVLA 2VBWA 4E70A 5LGTA 2FU4A 5C4XJ 3HBLA 1F36A 2DYSH 3BPXA 4PJJA 5ICEA 4LLNA 2HOSA 3U21A 5KNLA 1UHSA 4XBFA 3K1PA 1O3QA 1D5VA 3JREA 2PLYA 1P4AA 3DPLC 5ICCA 5HLGA 5M3FJ 2H1KA 1IO2A 1FZPB 1SEUA 2P5LC 2OAZA 3HC7A 2VBXA 3CMAI 5IP7J 2EWNA 1D0XA 4M71A 2EIKH 4EQQA 3JRBA 1HC8A 5IP6A 4UVCA 2HEOA 1SANA 2WC2A 4RA2A 2HU9A 2DFHA 2ZC2A 5DS9A 3GX4X 2Z2SB 5J4VA 4M6YA 4XM3A 4E7JA 1DUXC 1Y56A 2VN2A 2IS6A 3VB2A 4DOZA 3M8JA 1NHAA 2VJJA 2LC2A 5KAFC 2QBYB 3ZMVA 5DCMA 5FD6A 1W5SA 1XSXA 2HXOA 2ICWG 4CCOA 5DM7F 3SQNA 2FQ3A 3OYJA 1YO5C 4HV5A 2FA5A 2V6CA 1GT0C 3PO3J 4UXNA 5KVRA 2HVQA 4Y13A 4JX5A 1NK2P 2F5VA 4DYQA 4V2GA 1QHHD 3OYAA 1WKMA 2AXTC 2Q2EB 3FDYA 3C3WA 4RB3C 4G94A 4P9UA 1R71A 4EMSA 4FETA 4D5FA 4UUVA 2PFBA 4HQMA 1GUUA 2GZWA 4A0YA 2AO9A 4PJ0C 2VC0A 2GA2A 4YIIA 1S3JA 2RAEA 4UVAA 5K5RA 4A3KJ 4BXUA 3OYGA 1YJWI 3WU0A 4IXAA 3Q0UA 3J80K 5EZHA 1K6OA 5FFXA 2E34A 4D9JA 1IXRC 4OOIA 1E2XA 1ENHA 2ESNA 3WG9A 2VT3A 1IGNA 2MSYA 3E5XA 2XUBA 2ZSHB 1TNSA 2LY2A 2XGXA 3BR2A 3I4MJ 3GFIA 2JSPA 5GADJ 5HLHA 4IVNA 4W97A 5F08A 4E7LA 1HW2A 1HKSA 4CCLA 2OTJI 2KIMA 3K4LA 1T98A 2GM4A 3EQLF 1IXSB 4Y33A 5DDGA 5B1BH 1W36C 2VQGA 2GBYA 3BG6A 1OYIA 2EFWA 3IP4B 3BG9A 3M07A 1KQ8A 5JFRA 3RCOA 2A5YB 1T33A 3FBIB 1J59A 3CUOA 1LDDA 2WWYA 1BL0A 2CS3A 3OS2A 1D0YA 2KDOA 1RIOH 4KYWA 2ACJA 2K9SA 1YW7A 3JCUC 2QGUA 5ICFA 3RPQA 4F55A 4XQFA 5J47A 5BPIA 2GLOA 1BW6A 2XAHA 2LFBA 4BJ5C 3QPSA 3ROUA 4IF4A 4F52A 3I58A 1ZG1A 1X2NA 3K2ZA 2MYSA 2XAQA 3FXLA 1BR4A 3BP8A 3TGNA 4IX7A 3LA3A 3ZPLA 3F21A 2NAZA 2XRLA 1YOVB 4XN0A 1WHUA 1YTYA 4LITA 2FNPA 1D5YA 3BR5A 2DA3A 1K4SA 1FPQA 4Y52J 3CDHA 2JRMA 1A6QA 2RKHA 3DPTA 3A01A 4I2OA 3PSFA 1EKEA 2A68F 2PMUA 5B3SH 4RAGA 1LDJA 1HA8A 3GLXA 3F23A 3JTGA 3DLLF 4BAYA 3MQ0A 3CJQB 2DU9A 4NNJA 2AS5F 4LD5A 1FLIA 1S29A 2LLKA 3TW6A 5FKLA 5FLVA 3CO6C 4BY1J 3HB9A 4LB5A 2K3PA 4R8HA 3SZGA 1XGSA 2VI6A 2MH2A 2ZJ2A 3COAC 5IT9K 4PDKA 1TBXA 3M8FA 2BHZA 3DU6A 4NHJA 3FXQA 1S7AA 4U88A 2X9DA 2IBDA 1RNLA 3M1EA 3VSLA 3GO5A 2HQRA 5DM6F 5E1XA 1X1AA 1FEXA 4PJLA 5FGMA 2DPDA 3FIWA 3SJMA 4C2MJ 4Q5SF 1RPWA 3U2RA 2CQ7A 4UVBA 2FSWA 4A6DA 2GOMA 1U78A 2EV5A 1KZHA 1AA7A 3ABTA 4ASNA 4ESJA 4MEXF 1SVLA 5J4YA 2IAIA 4GXOA 1BI2A 3IRRA 3A02A 3PL8A 2BEOA 2NXNB 2UXXA 4ENMA 2TDXA 5LD2C 1R22A 5JI6A 4B48A 4A3FJ 5FKNA 3PNVA 1HKQA 2DOAA 2EH3A 5FROA 1QQIA 4Z6YA 3GTOJ 3T0YA 3PO2J 2DYRH 2Y0MA 4UHTA 2B0LA 3CDLA 1SVOA 3FKJA 3CMMA 2BGCA 2Y9YA 1IUFA 2A6HF 4UUTA 3J81K 2LKPA 5DV5A 3S1RJ 1WGXA 3MZHA 3BG7A 1Y0NA 3JSPA 4YRVA 2K7LA 4E6KG 1IW7F 2XSJC 3G3ZA 4DQ2A 5H20A 1MMGA 3K10A 3AFHA 5LGUA 1X4OA 3HOUJ 4M74A 1HOMA 2EZKA 3BTIA 1XGOA 4GYIA 4HSTA 3FXMA 3TKYA 4XICA 5F0CA 2L5QA 3I4NJ 1HDPA 3J7ZI 3OYNA 1FIPA 5J1RA 5K1YA 2MLKA 1ORKA 4UUSA 5C44J 1UZCA 1OISA 3CMYA 2DA4A 4QIWN 2TCTA 2OPTA 1R49A 4HYEA 3V8JA 1GV2A 2M7BA 1MKMA 4HX8A 3A2KA 1JGSA 3MVPA 2JVGA 4XRSA 2Z33A 2IS2A 1LJ9A 4P9FA 5JLWA 1VNDA 2P8TA 4CH7A 2HPMA 2L4MA 3MAJA 1FOYA 4JK1X 3AG2H 2JSCA 2R7RA 2BY2A 5CVRA 2M3AA 1M1EB 3G1OA 5BOXA 2CQNA 2KIFA 2VQCA 4BQAA 3PUFA 3MKLA 3WU2C 5CVUA 5GAEJ 2EIJH 3W2AA 2IRFG 1E17A 4DJAA 3VYUB 5GAGJ 1Z3YA 2PMZN 4JX6A 3BR6A 3HHGA 4ESFA 2QM3A 2V7FA 1ODDA 3QQAA 4WXCA 4IHVA 1LFUP 2ZNYA 1T6SA 1MDMA 2QUFA 1R1UA 1DPUA 3FX3A 2P81A 3LWFA 5CVJA 5GPAA 2ZMEB 1G2HA 2A3SA 1OLTA 4IRGA 4M6XA 1TWGJ 4MLOA 1S9HA 2VBYA 3CCMI 5DTDA 5H2FC 2EILH 3X2QH 2QWWA 1FSEA 3K4NA 1RESA 1OKRA 4HNVA 3Q5FA 2OUMA 3S3MA 1I3QJ 2JUGA 4XLAA 1VQLI 2DA5A 4G7HF 2CV0A 5E3LA 5D5WB 1F4KA 1G4DA 2CFXA 2DMTA 3KX2A 3AAFA 1MMSA 2BY3A 3U1DA 3OMYA 2OZ6A 1TW3A 2K4JA 3KE2A 3HSEA 3HL2A 2L4AA 4FX0A 3WTTC 5HODA 3R4KA 3HRMA 4WWCA 2P5KA 3GW2A 1HF0A 2FD5A 2DMPA 2VJ5A 4PGHA 3TMOA 1Q1HA 2ZMEA 3LA7A 1XCBA 4G6TB 1V4RA 2E2IJ 5DD4A 3MD2A 2NOJB 4EM0B 3TEDA 4GO1A 4Y17A 2QLZA 5JHFA 4FQGA 3Q0WA 4AU7A 5IOYA 2WBMA 3F9KA 4L9JA 2VQHA 3A4CA 4M3GA 5M3MJ 2KISA 2MABA 4CHUA 2XAUA 3L1PA 2O6GE 5L3DA 3HRUA 3NARA 1GXPA 3ZQFA 2V6EA 1XGMA 2EIMH 4I0AA 3S1MJ 1BOAA 2GXGA 2MG4A 5D8KB 4DBRA 1IV8A 2Z9OA 2FOWA 2EZIA 2HKOA 2HQAA 4OIOF 1VQ9I 3SHFA 5E3MA 1IUYA 2CGPA 4D5CA 2HXIA 2HVRA 3V42A 2MW8A 3SXYA 2Z16A 3BZKA 1H8AC 4WCGA 3CLOA 4IO9F 3BG5A 1WWXA 3D5RC 1IAWA 1Y0UA 2Z3YA 2E19A 3E6MA 4FE7A 3GYHX 1VI0A 1TWCJ 3H3UA 3IC7A 2WADA 2BXYA 5E79C 2KHMA 3PFYA 2R7DA 4I99C 2P7CB 3AG3H 1VQ7I 3DQVC 3FXUA 3RPUD 3L2RA 1YLFA 2VIXA 2UWMA 1LB2A 4HOBA 3CCYA 2X4HA 1SMTA 2LKXA 5EEAA 3MKYB 3IAM2 3P9KA 3GTKJ 3RSNA 5HLIA 1IF1A 2FRHA 1ZTRA 5B66C 3S3NA 2XDVA 2VPRA 3AL0B 1TP4A 3H1CA 2BXZA 2IT0A 1GHCA 1U6GA 3GBGA 1JGGA 4D7MA 1XGNA 4M73A 1R7JA 2K5CA 3RKQA 2HQNA 2B7EA 1I27A 2ELJA 1ETYA 4KN4X 2L7KA 1ZARA 2PMZA 3MMYB 1T95A 5J8FA 1TT5B 2MC3A 2NOGA 5EZGA 2CW7A 1KYWA 1WPKA 3H35A 1Y1WJ 2DT5A 2YS9A 3QOPA 2E1MC 2IGNA 2KMUA 3SZTA 4I98B 1XMKA 5FB2A 2M9HA 4A3LJ 3RKYA 2OU2A 3LFKA 2R5YB 3BTLA 4ITVA 1O57A 2D1HA 2W48A 2DW4A 3PNTA 3VSKA 3FZVA 1G8XA 4QTRA 5E1ZB 3KP7A 4EM1A 1WJAA 2CUFA 4FE4A 4XLCA 1VQPI 1XG1A 1HKTA 1WJEA 2EV6A 2V9KA 3RZDJ 4AVZA 1MGTA 2ZMEC 3ZCOA 4IRIA 1KU3A 1I1SA 4I09A 3LSMA 4B4CA 3OYLA 4ZTJA 3LSRA 2RQQA 5LBQA 4A5NA 2Y9ZA 2MH9A 4XRFA 1F9NA 3HGGA 1D1AA 2GXBA 1ERDA 3GXOA 3T5XA 4A3CJ 2W57A 1QNTA 5FKKA 3OY9A 1GXQA 3SEQA 5CKTA 3Q9VA 2H6BA 2J5OA 1LFPA 1POGA 2DFIA 1PVEA 3KEYA 5K7ZA 1D3YA 2HZTA 5F1JA 3HOTA 4OINF 3F0CA 2F4OB 4BE2A 2QA4I 5DUKA 3E0JB 2LBFB 1TQPA 2DTRA 2M7AA 4RMNA 5F04A 1S5LC 2OCCH 3MN2A 2PI0A 3S15J 2R7VA 4BHCA 2R7SA 1I6HJ 3KP2A 1RR8C 2K9LA 4E7ZA 2FOKA 3V8LA 2KZVA 1R00A 2CUJA 5FRMA 1ZAOA 2VT2A 2EQRA 3E1SA 2D45A 2X6OA 4YIFA 3ERED 1W1WE 2V1DA 4IHXA 4CYCA 3O6BB 1TT0A 2VE8A 3ESWB 1O3RA 2NVYJ 3GZNB 1HQCA 3CUQB 4OIRF 3OV8A 2E7WA 1D8JA 3CCUI 3G2BA 2DTZA 2LBFA 3CCQI 4HNTA 1IG7A 4AIJA 1VQOI 3TO6A 5E3NA 2EPFA 4RGUA 5LRRA 5EYRA 4BS9A 1CF7B 2LH9A 2CUZA 3TO7A 1D1CA 3QYBA 2WAFA 3I53A 1O3SA 3ZRGA 3I71A 3FXOA 3EUKL 5EGOA 4BXFA 1OCZH 2O7OA 3K4CA 1V5EA 4PJNA 4RM3A 5M5YJ 4M3EA 4L5JA 3HUGB 3C2GA 1REPC 2HTSA 1JT6A 2KRHA 2A61A 2LOOA 1D8KA 1S8NA 2ECCA 1XDSA 3QWLA 4KUMA 2BHYA 1U5TC 4HQEA 1OR7A 2G7HA 5EF6A 1ZRCA 1FOKA 4AIHA 2KLOA 2VODA 2GAUA 1FWZA 2K86A 1TL8A 1JXSA 4HAMA 4Q48A 2R7OA 3ZGKA 2KIUA 1QU3A 3KLNA 2V79A 3O2PE 4JX4A 1CF7A 1OFCX 2BOLA 1RKTA 3BTJA 4FHTA 1MBJA 3QODA 2UUZA 4BYYA 3O3KA 2O9LA 1ZLKA 4WF2A 1DU6A 1WH7A 5J1YA 3U1KA 4BKXA 2W1OA 1NTCA 3HUGA 3CCEI 4CXFA 4LFUA 5LEKA 3KZIC 1WRJA 1Y8RB 4HNUA 4GCVA 2DT6A 1UAAA 3SYTA 4CUGA 1O3TA 2R7XA 1FTZA 1QRYA 1P2FA 2FUG2 4H4KC 4P5OA 2Z5UA 1NH3A 2VB6A 4LG0B 4E7IA 1DP3A 1SC7A 4BDYA 3JW4A 4E4HA 1IC8A 3LSIA 3D5SC 2HOEA 4JP0A 4KMUX 1WQ2A 1X1BA 4PZJA 3M1CA 3S1QJ 2UXNA 4S0HB 2DMQA 1MBFA 2JVHA 1YHQI 3W6JB 2E5ZA 1TNTA 3WU1B 1G6NA 2XB5A 1ZYRF 3SDBA 2IVMA 3D5LA 1T56A 2LY1A 2GXAA 3GMEA 3KYCB 2DK8A 4ZZLA 4M3FA 2O3FA 4II3A 4A3MJ 1IRZA 1DGWY 1Z67A 3S2DJ 3RI4A 4BUPA 2E60A 2CMPA 4YFNF 1LPQA 1SAUA 1Z05A 3HXLA 4FT8A 3AG4H 3OYCA 1IJWC 1MNEA 3FXJA 3ECOA 1BM9A 5J6XA 1VQNI 1ZG5A 3BOQA 2MFZA 3KP5A 3OOPA 4LK1F 1GV5A 4EV0A 1RKWA 2ZXJA 4BU2A 2F5EA 3AKZA 3IKTA 3ZQGA 2DJIA 3OYMA 1GLNA 3LSPA 1QVTA 2IS4A 4UV9A 2DPUA 3EYIA 4ZYEA 1HDDC 3L00A 4WK8F 3BWGA 5BS6A 2ZXHA 3HJEA 2FJ1A 3IRQA 2IXSA 2FXAA 1SFKA 4LB6B 4I7HA 1BN5A 2VC1A 2Q0OA 4EATA 1OJLA 4AYBN 4PCQA 1KU9A 1SVMA 3BLYA 1H9TA 2P6SA 2WB1N 2Y30A 4XLFA 3G73A 3JR9A 1OPCA 1FYLA 3GUDA 1QZZA 3CC2I 5HLTA 3R0JA 4ZC3A 1AOYA 4P55A 2W00A 3G1LA 5B5EC 4A69C 4IRHA 3FXKA 4FTHA 1MMDA 5GP9A 2QBYA 2GA1A 3F72A 4XOTA 5FFZA 3CJNA 1PP8F 2O5RA 2IA1A 2L7MP 2VKDA 3WGGA 2ZB9A 2Q8KA 3K1NA 1TW2A 1OMIA 2YR2A 1ZK8A 1U0JA 4HBLA 2EBIA 1B8IB 2Q2EA 3VYTB 4EJOA 2QKLB 5GTIC 3VYRB 4CZCA 1EA3A 1YFHA 3DEEA 4KT6A 1BOBA 2W4SA 3QPLA 3HSFA 2QSFX 1P9QC 2RQPA 1IN8A 5CQEA 2I10A 1XS9A 1LKXA 1BI0A 4XIDA 1MW7A 1ZH5A 3H9QA 4UY8I 4X6AJ 4A0ZA 1FTTA 2ZBKA 2LNBA 1VZ0A 1OCTC 1HXDA 3PQKA 1KYZA 3IKVA 3DXJF 1A6IA 3AG1H 3HOSA 5LGNA 4RB0A 3K2AA 2NVQJ 4G7ZF 2M8GX 3LAJA 1T2KA 4G12A 3MZ8A 2HTJA 3GTJJ 3HTSB 3K6GA 4UV8A 4CO8A 4A93J 2IGMA 4EGZA 2X51A 5CPRB 4UNOA 3JRCA 4LJZF 1TC3C 3HHHA 2OC6A 3OR1C 5CVIA 5IT3A 2FE3A 4C3HJ 4P1WA 2WAEA 1I50J 4D7NA 1C0WA 4RB1A 2BY1A 3CJRB 2BYVE 4AIKA 3GTMJ 2DJNA 3IUOA 4L5IA 5TRDA 3E3VA 4OIPF 1MMNA 5DCFA 4BACA 3L2QA 1MNMC 1ETKA 4RGRA 2HZDA 1HW5A 5D4SA 3QPHA 3WTWC 4YELA 2F5CA 1LE8B 4AM3A 3HDDA 2KJCA 3ZMSA 1X1PA 3BG3A 4RLQA 3DBRB 3G1MA 1EV7A 3EUAA 4JYKA 3KP4A 5CLSA 4BL0B 5F27A 3TW7A 3DBLB 3BT9A 4XKCA 1RUOA 2RV8A 2X1CA 2OQRA 2F48A 3NRVA 1IRXA 1P7IA 5FRNA 3LOCA 2LK2A 2YUSA 3FM3A 3H5RA 3BQYA 3DCFA 2X48A 2W24A 2H27A 4R1HA 4AYBA 2K02A 3OSGA 1NG7A 1OQYA 2WB1A 2KT0A 3DV8A 3DKXA 2DA7A 2IJLA 3CP2A 1X1DA 3UR3C 1YITI 1Z6RA 2XF7A 3MCZA 3F22A 1H89C 2VOPA 1R1TA 2LF8A 2NS0A 2P0WA 1UELB 4ZYGA 2R7WA 1QZYA 5K7FA 3ZQ7A 2YU9J 1YW9A 1W5TA 3BJOA 3CLQA 1XPXA 5HS7A 3RDIA 2X85A 1RRJA 2E36A 1LVAA 3CQZJ 5D6FA 1AKHB 4AWXB 1HLVA 4I6ZA 4XLEA 4AD9A 5HNFA 3ZQCA 1JTYA 1YJ9I 4CZZA 2VASA 3T8TA 3K0LA 1MD0A 3OIQA 1V54H 1FYKA 1G3SA 1U8BA 4KICA 3CMEI 2IEKA 2ESHA 1JUMA 3PNYA 4QPQA 2JWTA 1K78B 2GOXB 2XROA 3L2WA 1TLHB 2PQ8A 3ABMH 1YI2I 2K9MA 4PFOA 1JUSA 3PM1A 1J75A 1BI1A 2MLGA 5D5VB 2A6TA 2V1NA 3TOBA 1JHHA 3FHNA 2XGCA 3REOA 3GZ6A 2FF4A 1AKHA 1ZR4A 3LNQA 1IN7A 1ZR2A 4XKWA 1I39A 4E7SA 2R93J 3J7AY 2LY9A 2CH0A 2OA4A 3L9FA 3FK6A 5A2QK 1X3WB 4J00A 2BBYA 1XN7A 1R9TJ 5DYMA 2IPQX 5L3EA 4KIFA 1SMYF 2BY0A 1VQMI 2CU7A 4XLNF 4W1UA 4HV6A 3J80Z 1VQ5I 4RDUA 3I56I 1K78A 1J9IA 2Z1DA 2GQQA 1E3PA 2IW5A 2VUMJ 3SZPA 2DDAA 2DA1A 2LMDA 2M4KA 2P6TA 2M5WA 3SEZA 4BQQA 2WA0A 3GLLA 2H09A 4IHSA 2CRGA 3VFZA 1WVRA 5FO5A 5CJ9A 2NVTJ 3GTPJ 3QP5A 1DGRM 1JKQC 4NBQA 2CQKA 3PIOF 3BJAA 1WZ2A 1I3AA 1N25A 2ME6A 1Z1DA 2M34A 2HYFA 5LHHA 2ZKZA 2G0EA 3H9JA 1B6AA 2HR3A 1L3LA 2PG4A 4ZYAA 2CUEA 4F93B 4GDFA 2ZFUA 2WTEA 4ABZA 1FC3A 3A0BC 3Q0VA 3K4KA 2CO5A 4X0GA 2H8RA 4IHWA 3KEQA 3KLOA 3HGYA 3H3VK 1MH4A 4NQWB 5D4RA 2ZJQF 4J01A 4B47A 3L7WA 4U7DA 1HBXG 5AONA 3VEPA 3MKZA 3CCJI 3OYFA 4XKBA 1KQ9A 1QBJA 4AIDA 3U9GA 4HRIA 4C30A 4G6QA 2JN6A 3H92A 1T8IA 3R60A 2V1XA 4N9IA 1IN6A 4LK0F 4XN3A 4BBSJ 1BA5A 3CCSI 4RAZA 3CTAA 4LIUA 3S8PA 2Q1ZB 4GFBA 2LP0A 3JAMZ 1Z9CA 4BBRJ 2EFOA 2L9VA 1L0OC 4B3AA 5IP9J 1N78A 3OYKA 4XL9A 3GCMA 2ZNZA 1GVJA 1FT9A 3I54A 2HI3A 2LRDA 4NQWA 4F3QA 3ONQA 5L3CA 5EDNA 2IS1A 2QCOA 1YX3A 4A0XA 3N97A 3BR1A 3V8KA 1V5GA 2E1OA 4IEJA 3ZOBA 2F4IA 2OF7A 1KU7A 4GYGA 4RLFA 3FHZA 4BXXJ 3HYIA 3S32A 2L9SA 5E8IA 4LIVA 4ZJZA 4XR6A 1AWCA 2JUCA 3R61A 3RTRA 2QQ9A 3OOUA 2ZSIB 4IZZA 2HDDA 1UG0A 3IL2A 3JRGA 5LHIA 5BPDA 1MSEC 3NWTA 1JKOC 3DTKA 1ITYA 3WGIA 1ETQA 2VKHA 4U0YA 4A3JJ 2AXLA 1W7PD 4AUXA 2R0QC 4KA4A 1N75A 3OIOA 2E71A 4LLGF 2L9RA 1ON1A 2AQEA 2OZUA 3JTHA 5IY5H 2NVXJ 1SAXA 1VQKI 4B43A 1JKRC 3DTEA 3K4BA 2WY7Q 3ZP5A 1WFXA 1SFOJ 1P4WA 1E0EA 3UKGA 2PEXA 2HYGD 3HPHA 3ULQB 1YJNI 2RDPA 1K79A 2MD0A 5D8LB 4HG2A 4YFKF 4XRMA 3GZ5A 2XAJA 1YG2A 4OMYA 3ERMA 1BC8C 2N8GA 4I0BA 1AHDP 5F6FA 4ZYDA 1AU7A 5KAIC 2LDUA 1Z7UA 3RJPA 1SFXA 1ZQ3P 4G9YA 3GTLJ 1ETVA 2RVCA 1JJ6C 4M72A 1LFBA 2PJRB 3S2HJ 2KP6A 1U9NA 3IH2A 2YPRA 1K83J 4M9SA 3FM5A 1USSA 3OR2C 5AIQA 5TJJA 1XTAA 3J81Z 2M0CA 3O8GA 2LD5A 2K4BA 3P7NA 4HDVA 4M6VA 4YEJA 1R4MB 2RC4A 2JA8J 3A03A 4MEYF 1STZA 5AIPA 1QO0D 4OMZA 1U3EM 5TGTA 4B3XA 2BV6A 3C7JA 1XMAA 1KU2A 2EV0A 3KYLA 4IQJA 3PUBA 5J40A 4BHPA 1MMAA 2F5FA 4E7HA 1Y6IA 1DQUA 2PJRA 3GFJA 1IDZA 4KN7X 4B44A 1X3ZB 2NRAC 3ELKA 1S7EA 2KZGA 3WE3A 2EINH 3R6SA 5HS9A 1FX7A 3ZN1A 2KDZA 1KA8A 5JVGF 3B02A 1TTYA 2VXZA 3M7GA 4C9YA 2EK5A 2FBIA 2HYJA 2D1VA 3N4MA 3W2VA 3EPZA 2LG4A 3WTUC 5FLXZ 1XDUA 3DBHB 2JA2A 2B9SA 2ZFWA 4HX7A 2R5YA 2DT7B 2A05A 1WSUA 1TQIA 4ZYHA 4F91B 4Q47A 3NEUA 4D1QA 2EFQA 1Z7LA 4PSWA 1EJ9A 2R7QA 2R4GA 1O7FA 1G3WA 1ZGJA 2VQLA 1T38A 2VJIA 2Y31A 1RC9A 4XONA 5D5XB 2M45A 2LKSA 1PYVA 4G6DA 4JOMA 4MTEA 2EJRA 1HSTA 2FBKA 1PJRA 3TP3A 2VOOA 4BJTA 3I55I 1R6RA 1WJDA 3DPUA 2QENA 3BR0A 4MQ9F 4U0VA 3L2VA 4N4NB 3MEXA 2XIGA 2M87A 1MZBA 2HDWA 1Z91A 1RR7A 2GIVA 1GVDA 4P96A 3DTIA 2R5ZB 2HQ5A 3V7RA 1MJAA 3MWMA 2HGCA 1WJCA 2STTA 2ZO4A 5IOZA 4PUSA 2G7UA 4ZDPA 3K4JA 3ABKH 1Q1VA 4F92B 5D6EA 3OIPA 4DIQA 1TQMA 1XB4A 2W7NA 2BVMA 3R0AA 3BY6A 1P6RA 1ZN2A 1Y1VJ 5TISC 2ZJRF 4A3GJ 4RB2C 2AHQA 2EFNA 5E1WA 3PQJA 3G4SI 1B9MA 1VQ6I 2ZJPF 2WV1A 1YRNB 5ED4A 1BR1A 4CCMA 2ELHA 3S2WA 4PK4A 3DKWA 5ICGA 4A3DJ 2GIZA 1FYMA 2UZKA 4A2UA 2R5ZA 2F4MB 1EH6A 3CUQA 2E1NA 2JPCA 2RN7A 1JJ8C 1QHGA 4RM2A 2E2JJ 4CCNA 1TWAJ 4HLYA 1R4NB 4FX4A 2M0MA 1MBHA 3ASNH 4HDUA 2QSHX 1F43A 1NK3P 1YX5A 3QAHA 2IGKA 2O8KA 1X1CA 4QWQA 3N05A 2DFFA 3I4PA 1B72B 4KMFA 2FMYA 2R7TA 1TZLA 2CFOA 2E2HJ 2COBA 4EM2A 3AL0C 3GTGJ 2R7UA 1R58A 2B63J 4IHYA 5LLQA 2PMHA 1RI7A 2C6YA 2XKOA 1UFMA 2DAOA 1F1ZA 1S7OA 2QQ8A 4BY7J 3NQOA 1JE8A 3DWLE 3BR3A 2VJ4A 2HPIA 1CGPA 5JR3A 2EFPA 4DBQA 4HLXA 3BC8A 1FJLA 3QP6A 1W36D 2FMLA 3VOEA 2ME0A 2IA0A 2ETHA 4NB5A 4L9TA 4NC8A 5FKMA 2HOTA 4DZJA 5BMZA 1ETOA 3CZ6A 1FP1D 2XGEA 4KJZA 2COMA 1G59A 2VL8A 1ZGWA 4KDPA 2R3SA 3NWSA 4X1EA 1YS7A 1MNDA 3KZZA 3ZQIA 1ZG3A 3TOAA 4S05A 2K27A 4LG0A 4BEHB 2LF7A 5J1UA 3CD6I 4KISA 4Y4RA 5L3BA 2XF6A 2FEZA 3H36A 5DCMB 3G71I 3BTCA 1ACIA 3F6OA 3QU3A 2I5UA 3IV5A 4AVPA 4DZPA 3DFGA 3LSKA 3S14J 1MBGA 4LMYA 3RYPA 1ZKGA 1R36A 2F2EA 1IDYA 4BQOA 3WHCA 1UJ8A 3CDIA 1SD7A 4MO7A 4QLCU 3KPHA 1SD4A 2JT1A 4XSXF 2ECBA 4N9HA 3TO9A 1JKPC 3DU5A 2DXIA 2V1UA 1VQ4I 4EVIA 4L0YB 3B73A 2A6EF 2L01A 1JI8A 3HIFA 3HSRA 4HF0A 2Y0SN 1Z6TA 3CUQC 1OR7C 2MC4A 1XCVA 2JPBA 4ENKA 4HW0A 4I01A 2IGOA 1MJBA 4C2UA 4EJTA 1IZ1A 3ASOH 1K61A 1BJAA 1S6LA 4CCJA 1X19A 3LMMA 5ILVA 3K70C 3HOVJ 3OYDA 2EZHA 3HOZJ 2CQXA 2FBHA 3NAUA 5ILSA 1MBKA 3FF5A 2CV1A 3ZQQA 3LQRA 2O61A 4OAZA 2V4JC 1V5FA 1R5HA 4KT5C 5L3GA 1IRGA 5FJ8J 2XGDA 5H6QA 1OCCH 1BI3A 1UHMA 1F5TA 4EGYA 2IP2A 3Q3SA 3P9IA 5BNGA 3ZR8X 2R7ZJ 2CG4A 3OWTA 2VBZA 3ZQHA 3HG9A 2Y69H 1H88C 4IOCF 2W85A 4YG2F 1YE9A 1B59A 3ZMTA 1A31A 1Z3XA 2LVSA 3WE2A 1JTXA 1DDNA 2X6XA 2OBPA 4A6EA 4B1RA 3H3ZA 4ZH4F 1T39A 3CP8A 2NNYA
chains in the Genus database with same CATH topology
4RAYA 1I1GA 2R7FA 2E1CA 3DP7A 4EJWA 3I59B 4PGGA 4MHGA 4IHTA 4R79A 3SFZA 3K9TA 5HDKA 1YW8A 2XAFA 1RZ4A 3FXRA 4YFXF 1VTNC 1FBSA 1A04A 1KGSA 3F6VA 1LEAA 5DEQA 3QPTA 1PP7U 5DUIA 3TQNA 3E6CC 3I59A 5E8GA 3KETA 2G9WA 1EH8A 2HFHA 3GEZA 3VODA 4MGRA 4G7OF 1I5ZA 4RGXA 3JAMK 5JVTA 4ON0A 4U0WA 2WV0A 3HRTA 2Z99A 3RKXA 3WTYC 2HKXA 2V9VA 4M9XA 1J5YA 1PDNC 1J0RA 1FY7A 3WGHA 3TDZC 1W4MA 1G3TA 1XSDA 3I5UA 3T8RA 2CSOA 3ML6A 4S04A 3ZN0A 3WTVC 1QPMA 3K69A 1MJ9A 1P92A 1FBUA 2QYOA 1FSHA 3F8MA 3RIRA 3EDPA 1ZLJA 5HVQC 2O8XA 1BIBA 1SFUA 3QRFF 1QGPA 1ULYA 3LSTA 4KIBA 1OYWA 2JRTA 1V3FA 3K1MA 3C18A 2DLLA 3HRSA 4KNYA 4OU0A 3L2CA 2XVCA 2CWEA 4M9ZA 3GVAA 2LSOA 2IA2A 1USTA 3I0TA 2BE5F 1R23A 3W6KB 2CYYA 4A5MA 1X3UA 5EEHA 2L3DA 2KRFA 1T0FA 3FMQA 4ENNA 1J2XA 1LDKB 1ZHFA 5KK1A 1LEBA 4JBAA 4ENJA 3KP6A 1R1VA 1ZRFA 3V7CA 1YQAA 4O3MA 3M9AA 4O6JA 2EB7A 5HS8A 3E5QA 1YYVA 3ZMUA 2DK5A 5L3FA 1MDMB 2OD5A 4XLPF 2NYXA 4OIQF 3CO7C 2DBBA 4CYDA 2W84A 5FLXK 3EETA 2A69F 4U7BA 3BZ6A 3J7AO 2YSRA 1U8RA 4XSZF 4F7ZA 2HWVA 3F8FA 1IRFA 1K7AA 2PBIA 4ETSA 4WX9A 1H0MA 2DI3A 2DQLA 5ILUA 3MZYA 3IWFA 3BJ6A 3V7SA 4IPAA 3V4GA 4Z2YA 5E18F 2PN6A 3P9CA 1B9NA 1P4XA 4L0ZB 2P5VA 1DP7P 4BNCA 1UB9A 2D2WA 3GFMA 3FWEA 5EEGA 2RGVA 3C1DA 3Q9SA 2Y75A 2M1BA 2ISZA 1O7LA 4WXHA 4Q4ZF 1YS6A 2QQAA 2H6CA 1IN5A 4DNCA 3E97A 5H6RA 2VE9A 2JTVA 1ZGAA 2E7XA 2A07F 5K5OA 3F8BA 2KKOA 5IT9Z 3BPVA 4G8XA 1W7PB 3BDDA 4WXDA 4L18B 1JHFA 4HA8A 3ZMDA 2ADUA 5J8CA 3WTXC 1J7KA 4TV7A 1ON2A 4HF1A 3KFWX 1DPRA 5DD8A 3D0SA 4MTDA 3RKWA 1ZRDA 1BBYA 2RNJA 2QVOA 3KP3A 2O0YA 1H9GA 4K2EA 2DQRA 2PJPA 2P4WA 3JSOA 4GGGA 4HF2A 5JHUA 4L9VA 1FP2A 1W7PA 4Y15A 1ZREA 2F5DA 4A12A 3EYYA 4CICA 5CVVA 2EA4A 4KIGA 4HZFA 3RPUA 1FNNA 1U5TB 5LHGA 4ESBA 2XHKA 3F8CA 1IN4A 3F3XA 1SD6A 2XASA 2EA2A 4L9NA 5E20A 1SFEA 3DEUA 1UHWA 2XV4S 1EH7A 1PUEE 2Y48A 3KZYA 4MNUA 1I6XA 4LGWA 2HS5A 1R5GA 2MA3A 4O5VA 4IJAA 2CW0F 4EJVA 5A2QZ 1U5TA 3IHUA 2P7VB 2HDCA 3DF8A 3FMSA 3QU6A 5LRSA 2STWA 1RUNA 4ZZDA 3E5UA 4JQFA 1LQ1A 2QZ8A 3GF2A 2NNNA 4RS8A 4I02A 4KFCA 5F64A 3WTSC 1WI9A 5F1RA 2J5PA 5HDGA 5K5QA 5HDNA 1LNWA 5CYVA 3L09A 2L54A 3FMRA 6PAXA 3WODF 3E6DA 1HSJA 2ZCWA 3BROA 3KCCA 3EUHA 1B1BA 3ECHA 4H0EA 3F8NA 4B8XA 4N0BA 2ISYA 1SD5A 4D0PA 3I64A 2YX4A 3KEOA 3ABUA 2XKPA 2YX7A 2X0LA 5FD5A 1BC7C 1YIOA 5D5UB 2FNAA 1U2WA 2VONA 3RYRA 4CDGA 4BHBA 5LEJA 5E17F 2W25A 1OYYA 3GWZA 3MFKA 1XSVA 3LA2A 4HX4A 5ERIA 2M30A 4RGSA 2O03A 1FBQA 5HOOA 2DO7A 3PFIA 3E6BA 3IWZA 4CGZA 2KJBA 5BQTA 2XRNA 1IXCA 1ONVA 4LLLA 1UCRA 2OQGA 3T1BA 2GWRA 4EJUA 3ISPA 2L02A 3HTUA 2JZYA 4B09A 1B4AA 4BH9A 2MD5A 2XAGA 4MQVA 3WTZA 2QQBA 1BIAA 2H94A 3GFLA 3TDUC 2MBFA 3LQQA 3LAPA 1G3YA 2YU3A 3M8EA 1HW1A 3ZMZA 1KQ0A 1XD7A 2M8EA 4E70A 2VBWA 5LGTA 2FU4A 3BPXA 5ICEA 4LLNA 4XBFA 3K1PA 1O3QA 1D5VA 2PLYA 1P4AA 3DPLC 5ICCA 5HLGA 1FZPB 2P5LC 2OAZA 2VBXA 2EWNA 4M71A 4EQQA 4UVCA 2HEOA 2WC2A 3GX4X 1DUXC 4M6YA 2VN2A 3VB2A 1NHAA 2QBYB 3ZMVA 5DCMA 5FD6A 1W5SA 1XSXA 1YO5C 3SQNA 2FQ3A 4HV5A 2FA5A 2V6CA 4UXNA 5KVRA 4Y13A 1WKMA 3C3WA 4RB3C 4G94A 4P9UA 4EMSA 4UUVA 2PFBA 4HQMA 2GZWA 4A0YA 2VC0A 2GA2A 4YIIA 1S3JA 4UVAA 5K5RA 4BXUA 3WU0A 4IXAA 3J80K 1K6OA 5FFXA 1IXRC 4OOIA 1E2XA 2ESNA 3WG9A 2VT3A 3E5XA 2XUBA 1TNSA 2XGXA 3GFIA 5HLHA 4IVNA 1HW2A 1HKSA 2KIMA 1T98A 3EQLF 1IXSB 5DDGA 1OYIA 2EFWA 1KQ8A 5JFRA 2A5YB 1J59A 3CUOA 1LDDA 2WWYA 1RIOH 4KYWA 2ACJA 1YW7A 5ICFA 3RPQA 5BPIA 2XAHA 3ROUA 4IF4A 3I58A 1ZG1A 3K2ZA 2XAQA 3BP8A 3TGNA 3LA3A 3ZPLA 3F21A 2NAZA 1YTYA 2FNPA 1FPQA 3CDHA 2RKHA 3DPTA 4I2OA 2A68F 2PMUA 1LDJA 3GLXA 3F23A 3JTGA 4BAYA 3MQ0A 2DU9A 2AS5F 4LD5A 1FLIA 1S29A 3CO6C 4LB5A 4R8HA 1XGSA 2MH2A 2ZJ2A 3COAC 5IT9K 4PDKA 1TBXA 3M8FA 4NHJA 3FXQA 1S7AA 4U88A 1RNLA 3M1EA 3GO5A 2HQRA 5E1XA 5FGMA 2DPDA 4Q5SF 3U2RA 4UVBA 2FSWA 4A6DA 1U78A 2EV5A 3ABTA 4ASNA 4ESJA 4MEXF 4GXOA 1BI2A 3IRRA 2BEOA 2UXXA 4ENMA 2TDXA 1R22A 5JI6A 1HKQA 1QQIA 3T0YA 2Y0MA 4UHTA 2B0LA 2BGCA 2A6HF 3J81K 2LKPA 5DV5A 3MZHA 3JSPA 2K7LA 1IW7F 3G3ZA 4DQ2A 5H20A 5LGUA 4M74A 4GYIA 1XGOA 3TKYA 5K1YA 2MLKA 4HYEA 3V8JA 1MKMA 4HX8A 1JGSA 2Z33A 1LJ9A 4P9FA 2P8TA 2L4MA 3MAJA 4JK1X 2JSCA 5CVRA 5BOXA 2KIFA 4BQAA 5CVUA 2IRFG 1E17A 3HHGA 4ESFA 2QM3A 1ODDA 4WXCA 2ZNYA 1T6SA 1MDMA 2QUFA 1R1UA 1DPUA 3FX3A 3LWFA 5CVJA 2ZMEB 2A3SA 4IRGA 4M6XA 2VBYA 2QWWA 1FSEA 1OKRA 3Q5FA 4G7HF 5D5WB 1F4KA 1G4DA 2CFXA 3AAFA 3U1DA 2OZ6A 1TW3A 2K4JA 3KE2A 3HSEA 2L4AA 4FX0A 3WTTC 3R4KA 3HRMA 4WWCA 2P5KA 3GW2A 4PGHA 1Q1HA 2ZMEA 3LA7A 1XCBA 1V4RA 5DD4A 4EM0B 4GO1A 4Y17A 2QLZA 4L9JA 4CHUA 2O6GE 5L3DA 3HRUA 1GXPA 1XGMA 4I0AA 1BOAA 2GXGA 5D8KB 2Z9OA 2HKOA 4OIOF 3SHFA 1IUYA 2CGPA 3SXYA 4WCGA 3CLOA 1WWXA 1IAWA 1Y0UA 2Z3YA 3E6MA 3GYHX 3H3UA 3IC7A 2R7DA 2P7CB 3DQVC 3FXUA 1YLFA 2UWMA 1LB2A 4HOBA 2X4HA 1SMTA 3P9KA 5HLIA 1IF1A 2FRHA 2IT0A 1GHCA 1U6GA 1XGNA 4M73A 1R7JA 2HQNA 1I27A 4KN4X 1ZARA 5J8FA 2MC3A 1KYWA 2DT5A 3QOPA 3SZTA 4I98B 1XMKA 5FB2A 3RKYA 2OU2A 3LFKA 1O57A 2D1HA 2DW4A 3FZVA 5E1ZB 3KP7A 4EM1A 1HKTA 2EV6A 1MGTA 4IRIA 1KU3A 1I1SA 4I09A 5LBQA 4A5NA 2MH9A 4XRFA 1F9NA 2GXBA 3GXOA 3T5XA 2W57A 1QNTA 1GXQA 3Q9VA 2H6BA 2J5OA 2DFIA 1D3YA 2HZTA 3HOTA 4OINF 5DUKA 1TQPA 2DTRA 2PI0A 4BHCA 3KP2A 2FOKA 3V8LA 1R00A 1ZAOA 2VT2A 2D45A 4YIFA 3ERED 2V1DA 3O6BB 2VE8A 1O3RA 1HQCA 3CUQB 4OIRF 3OV8A 2E7WA 1D8JA 4AIJA 3TO6A 4RGUA 5LRRA 1CF7B 3TO7A 3I53A 1O3SA 3I71A 4L5JA 1REPC 2HTSA 2A61A 1D8KA 1S8NA 1XDSA 4KUMA 1U5TC 4HQEA 1OR7A 2G7HA 1ZRCA 1FOKA 4AIHA 2VODA 2GAUA 1FWZA 2K86A 1JXSA 4HAMA 4Q48A 2KIUA 3KLNA 2V79A 3O2PE 1CF7A 4FHTA 4BYYA 3O3KA 1ZLKA 4WF2A 3HUGA 4CXFA 4LFUA 5LEKA 1WRJA 4GCVA 1O3TA 1P2FA 4P5OA 2Z5UA 4LG0B 3JW4A 2HOEA 4KMUX 1WQ2A 4PZJA 2UXNA 3W6JB 1TNTA 3WU1B 1G6NA 1ZYRF 2IVMA 3D5LA 4ZZLA 2DK8A 2O3FA 3RI4A 4YFNF 1Z05A 4FT8A 3ECOA 1BM9A 5J6XA 1ZG5A 3BOQA 3OOPA 3KP5A 4LK1F 4EV0A 2ZXJA 2F5EA 3IKTA 4UV9A 2DPUA 3EYIA 4ZYEA 3L00A 4WK8F 3BWGA 5BS6A 3IRQA 2FXAA 4LB6B 4I7HA 1BN5A 2VC1A 2Q0OA 4PCQA 1KU9A 1H9TA 2P6SA 3G73A 1OPCA 1FYLA 3GUDA 1QZZA 3R0JA 1AOYA 4P55A 4IRHA 2QBYA 2GA1A 3F72A 5FFZA 3CJNA 1PP8F 2IA1A 3WGGA 2Q8KA 3K1NA 1TW2A 1OMIA 2YR2A 4HBLA 2Q2EA 4EJOA 1YFHA 3HSFA 2RQPA 1IN8A 1BI0A 1ZH5A 4A0ZA 2ZBKA 2LNBA 1HXDA 3PQKA 1KYZA 3IKVA 3DXJF 3HOSA 5LGNA 4RB0A 4G7ZF 3LAJA 1T2KA 2HTJA 3HTSB 4UV8A 4CO8A 4EGZA 4UNOA 4LJZF 3HHHA 5CVIA 5IT3A 2FE3A 1C0WA 4RB1A 2BYVE 4AIKA 4L5IA 5TRDA 3E3VA 4OIPF 5DCFA 4RGRA 1HW5A 5D4SA 3QPHA 3WTWC 2F5CA 2KJCA 3ZMSA 1EV7A 3KP4A 5CLSA 1RUOA 2RV8A 2OQRA 3NRVA 3FM3A 2W24A 2H27A 4R1HA 2K02A 3DV8A 2IJLA 1Z6RA 3MCZA 3F22A 2VOPA 1R1TA 2LF8A 2NS0A 4ZYGA 1QZYA 3ZQ7A 1YW9A 1W5TA 3BJOA 5HS7A 3RDIA 1LVAA 5D6FA 4AWXB 4AD9A 4CZZA 3T8TA 3K0LA 1MD0A 1FYKA 1G3SA 4KICA 2ESHA 1K78B 2XROA 1TLHB 2PQ8A 1J75A 1BI1A 2MLGA 5D5VB 3TOBA 1JHHA 3REOA 3GZ6A 2FF4A 1IN7A 2OA4A 3L9FA 5A2QK 2BBYA 1XN7A 5DYMA 5L3EA 2IPQX 4KIFA 1SMYF 4XLNF 4HV6A 3J80Z 1J9IA 1K78A 2GQQA 2IW5A 3SZPA 2P6TA 2M5WA 2H09A 4IHSA 3VFZA 5FO5A 5CJ9A 3QP5A 2CQKA 3BJAA 1Z1DA 2HYFA 5LHHA 2ZKZA 1B6AA 2HR3A 1L3LA 2PG4A 2WTEA 1FC3A 2CO5A 3KEQA 3KLOA 5D4RA 3L7WA 4U7DA 1HBXG 5AONA 3VEPA 1KQ9A 1QBJA 3U9GA 4G6QA 3H92A 3R60A 2V1XA 4N9IA 1IN6A 4LK0F 4RAZA 3CTAA 3JAMZ 1Z9CA 2EFOA 1L0OC 2ZNZA 1GVJA 1FT9A 3I54A 4NQWA 5L3CA 3N97A 4A0XA 3V8KA 1KU7A 4GYGA 3FHZA 3HYIA 5E8IA 1AWCA 3R61A 3RTRA 2QQ9A 3IL2A 5LHIA 5BPDA 3WGIA 4U0YA 2AXLA 1W7PD 4KA4A 4LLGF 1ON1A 2OZUA 3JTHA 1SAXA 3ZP5A 1P4WA 2PEXA 2HYGD 3ULQB 2RDPA 1K79A 5D8LB 4YFKF 3GZ5A 2XAJA 1YG2A 4OMYA 1BC8C 4I0BA 5F6FA 4ZYDA 3RJPA 2LDUA 1Z7UA 1SFXA 4G9YA 2RVCA 4M72A 2YPRA 4M9SA 3FM5A 1USSA 5AIQA 5TJJA 3J81Z 2K4BA 3P7NA 4HDVA 2RC4A 4MEYF 1STZA 5AIPA 1QO0D 4OMZA 1U3EM 2BV6A 3C7JA 1XMAA 1KU2A 2EV0A 4BHPA 2F5FA 3GFJA 4KN7X 2NRAC 3ELKA 3WE3A 3R6SA 5HS9A 1FX7A 3ZN1A 1KA8A 3B02A 1TTYA 2VXZA 3M7GA 2EK5A 2FBIA 2D1VA 3N4MA 3WTUC 5FLXZ 1XDUA 2ZFWA 4HX7A 1WSUA 1TQIA 4ZYHA 4Q47A 3NEUA 2EFQA 1O7FA 1G3WA 1ZGJA 1T38A 5D5XB 2M45A 4G6DA 4MTEA 2EJRA 1HSTA 2FBKA 2VOOA 2QENA 4MQ9F 4U0VA 3MEXA 2XIGA 2M87A 1MZBA 1Z91A 2GIVA 4P96A 3V7RA 1MJAA 3MWMA 2HGCA 2STTA 2ZO4A 2G7UA 5D6EA 1TQMA 1XB4A 3R0AA 3BY6A 1P6RA 1ZN2A 4RB2C 2EFNA 5E1WA 3PQJA 1B9MA 5ED4A 2ELHA 3S2WA 3DKWA 5ICGA 1FYMA 2UZKA 4A2UA 1EH6A 3CUQA 2E1NA 2JPCA 2RN7A 4HLYA 4FX4A 4HDUA 3QAHA 4QWQA 3I4PA 4KMFA 2FMYA 4EM2A 1R58A 5LLQA 2PMHA 1RI7A 2C6YA 2XKOA 1UFMA 2DAOA 1F1ZA 1S7OA 1JE8A 3NQOA 1CGPA 5JR3A 2EFPA 4HLXA 3QP6A 2FMLA 3VOEA 2IA0A 2ETHA 4NB5A 4L9TA 5BMZA 1FP1D 2COMA 4KDPA 2R3SA 1YS7A 3KZZA 1ZG3A 3TOAA 4S05A 2K27A 4LG0A 2LF7A 5L3BA 2FEZA 5DCMB 3F6OA 3QU3A 4AVPA 3DFGA 4LMYA 3RYPA 1R36A 2F2EA 1SD7A 4QLCU 1SD4A 2JT1A 4XSXF 4N9HA 3TO9A 2V1UA 4EVIA 4L0YB 3B73A 2A6EF 2L01A 3HIFA 3HSRA 4HF0A 1Z6TA 3CUQC 1XCVA 2JPBA 4ENKA 4HW0A 4I01A 1MJBA 4EJTA 1IZ1A 1BJAA 1S6LA 5ILVA 2FBHA 5ILSA 3FF5A 2O61A 3LQRA 1R5HA 4KT5C 5L3GA 1IRGA 5H6QA 1BI3A 1UHMA 1F5TA 4EGYA 2IP2A 3P9IA 2CG4A 2VBZA 2W85A 4YG2F 1B59A 3ZMTA 3WE2A 1DDNA 2OBPA 4A6EA 3H3ZA 4ZH4F 1T39A 2NNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RAY A;  1I1G A;  2R7F A;  2E1C A;  3DP7 A;  4EJW A;  3I59 B;  4PGG A;  4MHG A;  4IHT A;  4R79 A;  3SFZ A;  3K9T A;  5HDK A;  1YW8 A;  2XAF A;  1RZ4 A;  3FXR A;  4YFX F;  1VTN C;  1FBS A;  1A04 A;  1KGS A;  3F6V A;  1LEA A;  5DEQ A;  3QPT A;  1PP7 U;  5DUI A;  3TQN A;  3E6C C;  3I59 A;  5E8G A;  3KET A;  2G9W A;  1EH8 A;  2HFH A;  3GEZ A;  3VOD A;  4MGR A;  4G7O F;  1I5Z A;  4RGX A;  3JAM K;  5JVT A;  4ON0 A;  4U0W A;  2WV0 A;  3HRT A;  2Z99 A;  3RKX A;  3WTY C;  2HKX A;  2V9V A;  4M9X A;  1J5Y A;  1PDN C;  1J0R A;  1FY7 A;  3WGH A;  3TDZ C;  1W4M A;  1G3T A;  1XSD A;  3I5U A;  3T8R A;  2CSO A;  3ML6 A;  4S04 A;  3ZN0 A;  3WTV C;  1QPM A;  3K69 A;  1MJ9 A;  1P92 A;  1FBU A;  2QYO A;  1FSH A;  3F8M A;  3RIR A;  3EDP A;  1ZLJ A;  5HVQ C;  2O8X A;  1BIB A;  1SFU A;  3QRF F;  1QGP A;  1ULY A;  3LST A;  4KIB A;  1OYW A;  2JRT A;  1V3F A;  3K1M A;  3C18 A;  2DLL A;  3HRS A;  4KNY A;  4OU0 A;  3L2C A;  2XVC A;  2CWE A;  4M9Z A;  3GVA A;  2LSO A;  2IA2 A;  1UST A;  3I0T A;  2BE5 F;  1R23 A;  3W6K B;  2CYY A;  4A5M A;  1X3U A;  5EEH A;  2L3D A;  2KRF A;  1T0F A;  3FMQ A;  4ENN A;  1J2X A;  1LDK B;  1ZHF A;  5KK1 A;  1LEB A;  4JBA A;  4ENJ A;  3KP6 A;  1R1V A;  1ZRF A;  3V7C A;  1YQA A;  4O3M A;  3M9A A;  4O6J A;  2EB7 A;  5HS8 A;  3E5Q A;  1YYV A;  3ZMU A;  2DK5 A;  5L3F A;  1MDM B;  2OD5 A;  4XLP F;  2NYX A;  4OIQ F;  3CO7 C;  2DBB A;  4CYD A;  2W84 A;  5FLX K;  3EET A;  2A69 F;  4U7B A;  3BZ6 A;  3J7A O;  2YSR A;  1U8R A;  4XSZ F;  4F7Z A;  2HWV A;  3F8F A;  1IRF A;  1K7A A;  2PBI A;  4ETS A;  4WX9 A;  1H0M A;  2DI3 A;  2DQL A;  5ILU A;  3MZY A;  3IWF A;  3BJ6 A;  3V7S A;  4IPA A;  3V4G A;  4Z2Y A;  5E18 F;  2PN6 A;  3P9C A;  1B9N A;  1P4X A;  4L0Z B;  2P5V A;  1DP7 P;  4BNC A;  1UB9 A;  2D2W A;  3GFM A;  3FWE A;  5EEG A;  2RGV A;  3C1D A;  3Q9S A;  2Y75 A;  2M1B A;  2ISZ A;  1O7L A;  4WXH A;  4Q4Z F;  1YS6 A;  2QQA A;  2H6C A;  1IN5 A;  4DNC A;  3E97 A;  5H6R A;  2VE9 A;  2JTV A;  1ZGA A;  2E7X A;  2A07 F;  5K5O A;  3F8B A;  2KKO A;  5IT9 Z;  3BPV A;  4G8X A;  1W7P B;  3BDD A;  4WXD A;  4L18 B;  1JHF A;  4HA8 A;  3ZMD A;  2ADU A;  5J8C A;  3WTX C;  1J7K A;  4TV7 A;  1ON2 A;  4HF1 A;  3KFW X;  1DPR A;  5DD8 A;  3D0S A;  4MTD A;  3RKW A;  1ZRD A;  1BBY A;  2RNJ A;  2QVO A;  3KP3 A;  2O0Y A;  1H9G A;  4K2E A;  2DQR A;  2PJP A;  2P4W A;  3JSO A;  4GGG A;  4HF2 A;  5JHU A;  4L9V A;  1FP2 A;  1W7P A;  4Y15 A;  1ZRE A;  2F5D A;  4A12 A;  3EYY A;  4CIC A;  5CVV A;  2EA4 A;  4KIG A;  4HZF A;  3RPU A;  1FNN A;  1U5T B;  5LHG A;  4ESB A;  2XHK A;  3F8C A;  1IN4 A;  3F3X A;  1SD6 A;  2XAS A;  2EA2 A;  4L9N A;  5E20 A;  1SFE A;  3DEU A;  1UHW A;  2XV4 S;  1EH7 A;  1PUE E;  2Y48 A;  3KZY A;  4MNU A;  1I6X A;  4LGW A;  2HS5 A;  1R5G A;  2MA3 A;  4O5V A;  4IJA A;  2CW0 F;  4EJV A;  5A2Q Z;  1U5T A;  3IHU A;  2P7V B;  2HDC A;  3DF8 A;  3FMS A;  3QU6 A;  5LRS A;  2STW A;  1RUN A;  4ZZD A;  3E5U A;  4JQF A;  1LQ1 A;  2QZ8 A;  3GF2 A;  2NNN A;  4RS8 A;  4I02 A;  4KFC A;  5F64 A;  3WTS C;  1WI9 A;  5F1R A;  2J5P A;  5HDG A;  5K5Q A;  5HDN A;  1LNW A;  5CYV A;  3L09 A;  2L54 A;  3FMR A;  6PAX A;  3WOD F;  3E6D A;  1HSJ A;  2ZCW A;  3BRO A;  3KCC A;  3EUH A;  1B1B A;  3ECH A;  4H0E A;  3F8N A;  4B8X A;  4N0B A;  2ISY A;  1SD5 A;  4D0P A;  3I64 A;  2YX4 A;  3KEO A;  3ABU A;  2XKP A;  2YX7 A;  2X0L A;  5FD5 A;  1BC7 C;  1YIO A;  5D5U B;  2FNA A;  1U2W A;  2VON A;  3RYR A;  4CDG A;  4BHB A;  5LEJ A;  5E17 F;  2W25 A;  1OYY A;  3GWZ A;  3MFK A;  1XSV A;  3LA2 A;  4HX4 A;  5ERI A;  2M30 A;  4RGS A;  2O03 A;  1FBQ A;  5HOO A;  2DO7 A;  3PFI A;  3E6B A;  3IWZ A;  4CGZ A;  2KJB A;  5BQT A;  2XRN A;  1IXC A;  1ONV A;  4LLL A;  1UCR A;  2OQG A;  3T1B A;  2GWR A;  4EJU A;  3ISP A;  2L02 A;  3HTU A;  2JZY A;  4B09 A;  1B4A A;  4BH9 A;  2MD5 A;  2XAG A;  4MQV A;  3WTZ A;  2QQB A;  1BIA A;  2H94 A;  3GFL A;  3TDU C;  2MBF A;  3LQQ A;  3LAP A;  1G3Y A;  2YU3 A;  3M8E A;  1HW1 A;  3ZMZ A;  1KQ0 A;  1XD7 A;  2M8E A;  4E70 A;  2VBW A;  5LGT A;  2FU4 A;  3BPX A;  5ICE A;  4LLN A;  4XBF A;  3K1P A;  1O3Q A;  1D5V A;  2PLY A;  1P4A A;  3DPL C;  5ICC A;  5HLG A;  1FZP B;  2P5L C;  2OAZ A;  2VBX A;  2EWN A;  4M71 A;  4EQQ A;  4UVC A;  2HEO A;  2WC2 A;  3GX4 X;  1DUX C;  4M6Y A;  2VN2 A;  3VB2 A;  1NHA A;  2QBY B;  3ZMV A;  5DCM A;  5FD6 A;  1W5S A;  1XSX A;  1YO5 C;  3SQN A;  2FQ3 A;  4HV5 A;  2FA5 A;  2V6C A;  4UXN A;  5KVR A;  4Y13 A;  1WKM A;  3C3W A;  4RB3 C;  4G94 A;  4P9U A;  4EMS A;  4UUV A;  2PFB A;  4HQM A;  2GZW A;  4A0Y A;  2VC0 A;  2GA2 A;  4YII A;  1S3J A;  4UVA A;  5K5R A;  4BXU A;  3WU0 A;  4IXA A;  3J80 K;  1K6O A;  5FFX A;  1IXR C;  4OOI A;  1E2X A;  2ESN A;  3WG9 A;  2VT3 A;  3E5X A;  2XUB A;  1TNS A;  2XGX A;  3GFI A;  5HLH A;  4IVN A;  1HW2 A;  1HKS A;  2KIM A;  1T98 A;  3EQL F;  1IXS B;  5DDG A;  1OYI A;  2EFW A;  1KQ8 A;  5JFR A;  2A5Y B;  1J59 A;  3CUO A;  1LDD A;  2WWY A;  1RIO H;  4KYW A;  2ACJ A;  1YW7 A;  5ICF A;  3RPQ A;  5BPI A;  2XAH A;  3ROU A;  4IF4 A;  3I58 A;  1ZG1 A;  3K2Z A;  2XAQ A;  3BP8 A;  3TGN A;  3LA3 A;  3ZPL A;  3F21 A;  2NAZ A;  1YTY A;  2FNP A;  1FPQ A;  3CDH A;  2RKH A;  3DPT A;  4I2O A;  2A68 F;  2PMU A;  1LDJ A;  3GLX A;  3F23 A;  3JTG A;  4BAY A;  3MQ0 A;  2DU9 A;  2AS5 F;  4LD5 A;  1FLI A;  1S29 A;  3CO6 C;  4LB5 A;  4R8H A;  1XGS A;  2MH2 A;  2ZJ2 A;  3COA C;  5IT9 K;  4PDK A;  1TBX A;  3M8F A;  4NHJ A;  3FXQ A;  1S7A A;  4U88 A;  1RNL A;  3M1E A;  3GO5 A;  2HQR A;  5E1X A;  5FGM A;  2DPD A;  4Q5S F;  3U2R A;  4UVB A;  2FSW A;  4A6D A;  1U78 A;  2EV5 A;  3ABT A;  4ASN A;  4ESJ A;  4MEX F;  4GXO A;  1BI2 A;  3IRR A;  2BEO A;  2UXX A;  4ENM A;  2TDX A;  1R22 A;  5JI6 A;  1HKQ A;  1QQI A;  3T0Y A;  2Y0M A;  4UHT A;  2B0L A;  2BGC A;  2A6H F;  3J81 K;  2LKP A;  5DV5 A;  3MZH A;  3JSP A;  2K7L A;  1IW7 F;  3G3Z A;  4DQ2 A;  5H20 A;  5LGU A;  4M74 A;  4GYI A;  1XGO A;  3TKY A;  5K1Y A;  2MLK A;  4HYE A;  3V8J A;  1MKM A;  4HX8 A;  1JGS A;  2Z33 A;  1LJ9 A;  4P9F A;  2P8T A;  2L4M A;  3MAJ A;  4JK1 X;  2JSC A;  5CVR A;  5BOX A;  2KIF A;  4BQA A;  5CVU A;  2IRF G;  1E17 A;  3HHG A;  4ESF A;  2QM3 A;  1ODD A;  4WXC A;  2ZNY A;  1T6S A;  1MDM A;  2QUF A;  1R1U A;  1DPU A;  3FX3 A;  3LWF A;  5CVJ A;  2ZME B;  2A3S A;  4IRG A;  4M6X A;  2VBY A;  2QWW A;  1FSE A;  1OKR A;  3Q5F A;  4G7H F;  5D5W B;  1F4K A;  1G4D A;  2CFX A;  3AAF A;  3U1D A;  2OZ6 A;  1TW3 A;  2K4J A;  3KE2 A;  3HSE A;  2L4A A;  4FX0 A;  3WTT C;  3R4K A;  3HRM A;  4WWC A;  2P5K A;  3GW2 A;  4PGH A;  1Q1H A;  2ZME A;  3LA7 A;  1XCB A;  1V4R A;  5DD4 A;  4EM0 B;  4GO1 A;  4Y17 A;  2QLZ A;  4L9J A;  4CHU A;  2O6G E;  5L3D A;  3HRU A;  1GXP A;  1XGM A;  4I0A A;  1BOA A;  2GXG A;  5D8K B;  2Z9O A;  2HKO A;  4OIO F;  3SHF A;  1IUY A;  2CGP A;  3SXY A;  4WCG A;  3CLO A;  1WWX A;  1IAW A;  1Y0U A;  2Z3Y A;  3E6M A;  3GYH X;  3H3U A;  3IC7 A;  2R7D A;  2P7C B;  3DQV C;  3FXU A;  1YLF A;  2UWM A;  1LB2 A;  4HOB A;  2X4H A;  1SMT A;  3P9K A;  5HLI A;  1IF1 A;  2FRH A;  2IT0 A;  1GHC A;  1U6G A;  1XGN A;  4M73 A;  1R7J A;  2HQN A;  1I27 A;  4KN4 X;  1ZAR A;  5J8F A;  2MC3 A;  1KYW A;  2DT5 A;  3QOP A;  3SZT A;  4I98 B;  1XMK A;  5FB2 A;  3RKY A;  2OU2 A;  3LFK A;  1O57 A;  2D1H A;  2DW4 A;  3FZV A;  5E1Z B;  3KP7 A;  4EM1 A;  1HKT A;  2EV6 A;  1MGT A;  4IRI A;  1KU3 A;  1I1S A;  4I09 A;  5LBQ A;  4A5N A;  2MH9 A;  4XRF A;  1F9N A;  2GXB A;  3GXO A;  3T5X A;  2W57 A;  1QNT A;  1GXQ A;  3Q9V A;  2H6B A;  2J5O A;  2DFI A;  1D3Y A;  2HZT A;  3HOT A;  4OIN F;  5DUK A;  1TQP A;  2DTR A;  2PI0 A;  4BHC A;  3KP2 A;  2FOK A;  3V8L A;  1R00 A;  1ZAO A;  2VT2 A;  2D45 A;  4YIF A;  3ERE D;  2V1D A;  3O6B B;  2VE8 A;  1O3R A;  1HQC A;  3CUQ B;  4OIR F;  3OV8 A;  2E7W A;  1D8J A;  4AIJ A;  3TO6 A;  4RGU A;  5LRR A;  1CF7 B;  3TO7 A;  3I53 A;  1O3S A;  3I71 A;  4L5J A;  1REP C;  2HTS A;  2A61 A;  1D8K A;  1S8N A;  1XDS A;  4KUM A;  1U5T C;  4HQE A;  1OR7 A;  2G7H A;  1ZRC A;  1FOK A;  4AIH A;  2VOD A;  2GAU A;  1FWZ A;  2K86 A;  1JXS A;  4HAM A;  4Q48 A;  2KIU A;  3KLN A;  2V79 A;  3O2P E;  1CF7 A;  4FHT A;  4BYY A;  3O3K A;  1ZLK A;  4WF2 A;  3HUG A;  4CXF A;  4LFU A;  5LEK A;  1WRJ A;  4GCV A;  1O3T A;  1P2F A;  4P5O A;  2Z5U A;  4LG0 B;  3JW4 A;  2HOE A;  4KMU X;  1WQ2 A;  4PZJ A;  2UXN A;  3W6J B;  1TNT A;  3WU1 B;  1G6N A;  1ZYR F;  2IVM A;  3D5L A;  4ZZL A;  2DK8 A;  2O3F A;  3RI4 A;  4YFN F;  1Z05 A;  4FT8 A;  3ECO A;  1BM9 A;  5J6X A;  1ZG5 A;  3BOQ A;  3OOP A;  3KP5 A;  4LK1 F;  4EV0 A;  2ZXJ A;  2F5E A;  3IKT A;  4UV9 A;  2DPU A;  3EYI A;  4ZYE A;  3L00 A;  4WK8 F;  3BWG A;  5BS6 A;  3IRQ A;  2FXA A;  4LB6 B;  4I7H A;  1BN5 A;  2VC1 A;  2Q0O A;  4PCQ A;  1KU9 A;  1H9T A;  2P6S A;  3G73 A;  1OPC A;  1FYL A;  3GUD A;  1QZZ A;  3R0J A;  1AOY A;  4P55 A;  4IRH A;  2QBY A;  2GA1 A;  3F72 A;  5FFZ A;  3CJN A;  1PP8 F;  2IA1 A;  3WGG A;  2Q8K A;  3K1N A;  1TW2 A;  1OMI A;  2YR2 A;  4HBL A;  2Q2E A;  4EJO A;  1YFH A;  3HSF A;  2RQP A;  1IN8 A;  1BI0 A;  1ZH5 A;  4A0Z A;  2ZBK A;  2LNB A;  1HXD A;  3PQK A;  1KYZ A;  3IKV A;  3DXJ F;  3HOS A;  5LGN A;  4RB0 A;  4G7Z F;  3LAJ A;  1T2K A;  2HTJ A;  3HTS B;  4UV8 A;  4CO8 A;  4EGZ A;  4UNO A;  4LJZ F;  3HHH A;  5CVI A;  5IT3 A;  2FE3 A;  1C0W A;  4RB1 A;  2BYV E;  4AIK A;  4L5I A;  5TRD A;  3E3V A;  4OIP F;  5DCF A;  4RGR A;  1HW5 A;  5D4S A;  3QPH A;  3WTW C;  2F5C A;  2KJC A;  3ZMS A;  1EV7 A;  3KP4 A;  5CLS A;  1RUO A;  2RV8 A;  2OQR A;  3NRV A;  3FM3 A;  2W24 A;  2H27 A;  4R1H A;  2K02 A;  3DV8 A;  2IJL A;  1Z6R A;  3MCZ A;  3F22 A;  2VOP A;  1R1T A;  2LF8 A;  2NS0 A;  4ZYG A;  1QZY A;  3ZQ7 A;  1YW9 A;  1W5T A;  3BJO A;  5HS7 A;  3RDI A;  1LVA A;  5D6F A;  4AWX B;  4AD9 A;  4CZZ A;  3T8T A;  3K0L A;  1MD0 A;  1FYK A;  1G3S A;  4KIC A;  2ESH A;  1K78 B;  2XRO A;  1TLH B;  2PQ8 A;  1J75 A;  1BI1 A;  2MLG A;  5D5V B;  3TOB A;  1JHH A;  3REO A;  3GZ6 A;  2FF4 A;  1IN7 A;  2OA4 A;  3L9F A;  5A2Q K;  2BBY A;  1XN7 A;  5DYM A;  5L3E A;  2IPQ X;  4KIF A;  1SMY F;  4XLN F;  4HV6 A;  3J80 Z;  1J9I A;  1K78 A;  2GQQ A;  2IW5 A;  3SZP A;  2P6T A;  2M5W A;  2H09 A;  4IHS A;  3VFZ A;  5FO5 A;  5CJ9 A;  3QP5 A;  2CQK A;  3BJA A;  1Z1D A;  2HYF A;  5LHH A;  2ZKZ A;  1B6A A;  2HR3 A;  1L3L A;  2PG4 A;  2WTE A;  1FC3 A;  2CO5 A;  3KEQ A;  3KLO A;  5D4R A;  3L7W A;  4U7D A;  1HBX G;  5AON A;  3VEP A;  1KQ9 A;  1QBJ A;  3U9G A;  4G6Q A;  3H92 A;  3R60 A;  2V1X A;  4N9I A;  1IN6 A;  4LK0 F;  4RAZ A;  3CTA A;  3JAM Z;  1Z9C A;  2EFO A;  1L0O C;  2ZNZ A;  1GVJ A;  1FT9 A;  3I54 A;  4NQW A;  5L3C A;  3N97 A;  4A0X A;  3V8K A;  1KU7 A;  4GYG A;  3FHZ A;  3HYI A;  5E8I A;  1AWC A;  3R61 A;  3RTR A;  2QQ9 A;  3IL2 A;  5LHI A;  5BPD A;  3WGI A;  4U0Y A;  2AXL A;  1W7P D;  4KA4 A;  4LLG F;  1ON1 A;  2OZU A;  3JTH A;  1SAX A;  3ZP5 A;  1P4W A;  2PEX A;  2HYG D;  3ULQ B;  2RDP A;  1K79 A;  5D8L B;  4YFK F;  3GZ5 A;  2XAJ A;  1YG2 A;  4OMY A;  1BC8 C;  4I0B A;  5F6F A;  4ZYD A;  3RJP A;  2LDU A;  1Z7U A;  1SFX A;  4G9Y A;  2RVC A;  4M72 A;  2YPR A;  4M9S A;  3FM5 A;  1USS A;  5AIQ A;  5TJJ A;  3J81 Z;  2K4B A;  3P7N A;  4HDV A;  2RC4 A;  4MEY F;  1STZ A;  5AIP A;  1QO0 D;  4OMZ A;  1U3E M;  2BV6 A;  3C7J A;  1XMA A;  1KU2 A;  2EV0 A;  4BHP A;  2F5F A;  3GFJ A;  4KN7 X;  2NRA C;  3ELK A;  3WE3 A;  3R6S A;  5HS9 A;  1FX7 A;  3ZN1 A;  1KA8 A;  3B02 A;  1TTY A;  2VXZ A;  3M7G A;  2EK5 A;  2FBI A;  2D1V A;  3N4M A;  3WTU C;  5FLX Z;  1XDU A;  2ZFW A;  4HX7 A;  1WSU A;  1TQI A;  4ZYH A;  4Q47 A;  3NEU A;  2EFQ A;  1O7F A;  1G3W A;  1ZGJ A;  1T38 A;  5D5X B;  2M45 A;  4G6D A;  4MTE A;  2EJR A;  1HST A;  2FBK A;  2VOO A;  2QEN A;  4MQ9 F;  4U0V A;  3MEX A;  2XIG A;  2M87 A;  1MZB A;  1Z91 A;  2GIV A;  4P96 A;  3V7R A;  1MJA A;  3MWM A;  2HGC A;  2STT A;  2ZO4 A;  2G7U A;  5D6E A;  1TQM A;  1XB4 A;  3R0A A;  3BY6 A;  1P6R A;  1ZN2 A;  4RB2 C;  2EFN A;  5E1W A;  3PQJ A;  1B9M A;  5ED4 A;  2ELH A;  3S2W A;  3DKW A;  5ICG A;  1FYM A;  2UZK A;  4A2U A;  1EH6 A;  3CUQ A;  2E1N A;  2JPC A;  2RN7 A;  4HLY A;  4FX4 A;  4HDU A;  3QAH A;  4QWQ A;  3I4P A;  4KMF A;  2FMY A;  4EM2 A;  1R58 A;  5LLQ A;  2PMH A;  1RI7 A;  2C6Y A;  2XKO A;  1UFM A;  2DAO A;  1F1Z A;  1S7O A;  1JE8 A;  3NQO A;  1CGP A;  5JR3 A;  2EFP A;  4HLX A;  3QP6 A;  2FML A;  3VOE A;  2IA0 A;  2ETH A;  4NB5 A;  4L9T A;  5BMZ A;  1FP1 D;  2COM A;  4KDP A;  2R3S A;  1YS7 A;  3KZZ A;  1ZG3 A;  3TOA A;  4S05 A;  2K27 A;  4LG0 A;  2LF7 A;  5L3B A;  2FEZ A;  5DCM B;  3F6O A;  3QU3 A;  4AVP A;  3DFG A;  4LMY A;  3RYP A;  1R36 A;  2F2E A;  1SD7 A;  4QLC U;  1SD4 A;  2JT1 A;  4XSX F;  4N9H A;  3TO9 A;  2V1U A;  4EVI A;  4L0Y B;  3B73 A;  2A6E F;  2L01 A;  3HIF A;  3HSR A;  4HF0 A;  1Z6T A;  3CUQ C;  1XCV A;  2JPB A;  4ENK A;  4HW0 A;  4I01 A;  1MJB A;  4EJT A;  1IZ1 A;  1BJA A;  1S6L A;  5ILV A;  2FBH A;  5ILS A;  3FF5 A;  2O61 A;  3LQR A;  1R5H A;  4KT5 C;  5L3G A;  1IRG A;  5H6Q A;  1BI3 A;  1UHM A;  1F5T A;  4EGY A;  2IP2 A;  3P9I A;  2CG4 A;  2VBZ A;  2W85 A;  4YG2 F;  1B59 A;  3ZMT A;  3WE2 A;  1DDN A;  2OBP A;  4A6E A;  3H3Z A;  4ZH4 F;  1T39 A;  2NNY A; 
#chains in the Genus database with same CATH topology
 4RAY A;  1I1G A;  1JT0 A;  1B8I A;  2R7F A;  4J19 A;  2DA6 A;  1XC5 A;  2E1C A;  3DP7 A;  4EJW A;  3I59 B;  4PGG A;  4MHG A;  4IHT A;  4ANJ A;  1K6Y A;  1U9O A;  4R79 A;  3SFZ A;  3K9T A;  5HDK A;  3OYI A;  1YW8 A;  2XAF A;  1RZ4 A;  3FXR A;  4CSW A;  4BE0 A;  1WH5 A;  4XMY A;  1X58 A;  3HEF A;  4N4O B;  5JLX A;  4NC6 A;  2KIQ A;  3I3L A;  3KYD B;  4YFX F;  1D1B A;  1VTN C;  3A01 B;  3CF2 A;  5HNH A;  1FBS A;  1A04 A;  1KGS A;  3F6V A;  1LEA A;  3S3O A;  2ELK A;  5DEQ A;  3QPT A;  1PP7 U;  2H1L A;  5DUI A;  2JQ7 A;  3CCL I;  3TQN A;  3KIO A;  3I59 A;  5E8G A;  3KET A;  2G9W A;  3E6C C;  1EH8 A;  4FIS A;  2HFH A;  3GEZ A;  3VOD A;  4MGR A;  4G7O F;  3K7A J;  1E3H A;  2DFE A;  1DU0 A;  1I5Z A;  4RGX A;  3HOY J;  3JAM K;  3TP0 A;  4I76 A;  5JVT A;  1UMQ A;  1W0T A;  1MIJ A;  3RQI A;  4ON0 A;  4XNF A;  2R92 J;  4U0W A;  5KCM A;  2WV0 A;  3HRT A;  2X6W A;  2Z99 A;  3RKX A;  3WTY C;  4A3B J;  3FK7 A;  2HKX A;  2V9V A;  4M9X A;  4IKF A;  1J5Y A;  2DA2 A;  1PDN C;  1QZE A;  1J0R A;  1FY7 A;  3TDZ C;  3WGH A;  1W4M A;  1G3T A;  1XSD A;  3I5U A;  3T8R A;  2XC7 A;  3K4M A;  1R5I D;  2CSO A;  3MKW B;  3ML6 A;  4M3D A;  2Y0S A;  1LE8 A;  4S04 A;  1APL C;  2QKM B;  3VYS B;  2BW3 B;  3LFU A;  3RZO J;  3P5J A;  3D1N I;  3ZN0 A;  3WTV C;  1HCR A;  1EF4 A;  5KHD A;  1QPM A;  3K69 A;  1MJ9 A;  1P92 A;  3B6C A;  4IQ4 A;  5E3O A;  3FIS A;  5CQG A;  4V19 K;  1FBU A;  2QYO A;  1FSH A;  1WJ5 A;  3F8M A;  3RIR A;  1WJF A;  3EDP A;  1ZLJ A;  5HVQ C;  1X4P A;  2O8X A;  3OL4 A;  1BIB A;  1SFU A;  2HNH A;  2JK3 A;  2M4G A;  3B6A A;  3QOE A;  4HPQ A;  1QGP A;  4NC7 A;  1ULY A;  3IH4 A;  4AC0 A;  3QRF F;  3LST A;  3H9G A;  1OYW A;  4KIB A;  4Y3O A;  3J7Y J;  4BEH A;  2JRT A;  3HOX J;  1V3F A;  3K1M A;  3C18 A;  2BW3 A;  2VXD A;  4LG3 A;  2DLL A;  2L7F P;  2DCE A;  4HEA 2;  3HRS A;  3LSH A;  2NVU B;  3WHB A;  4MIM A;  4KNY A;  4OU0 A;  3L2C A;  2XVC A;  2ZXW H;  2CWE A;  4M9Z A;  3GVA A;  2LSO A;  2IA2 A;  4EEF G;  1UST A;  1LUJ B;  3I0T A;  2XSD C;  4UUS B;  4BE1 A;  2XPU A;  1D0Z A;  2MGQ A;  2BE5 F;  4DW6 A;  1R23 A;  2X1D A;  3W6K B;  4PFP A;  2CYY A;  4A5M A;  5K7H A;  1X3U A;  5EEH A;  4HSR A;  2L3D A;  3SDG A;  3UNG C;  3L2U A;  3S17 J;  4XLH A;  2KRF A;  1T0F A;  3FMQ A;  3ZQL A;  2RNG A;  2OTL I;  4ENN A;  1J2X A;  3DEW A;  3A1Y A;  1LDK B;  1P7J A;  2FQ4 A;  1ZHF A;  5KK1 A;  2LTP A;  1LEB A;  4JBA A;  2JA7 J;  4ENJ A;  3KP6 A;  1R1V A;  3OYE A;  3CCV I;  1VQ8 I;  2VKE A;  3H0G J;  1ZRF A;  3V7C A;  1YQA A;  4O3M A;  3M9A A;  1ETW A;  3W2W A;  1KON A;  4MFD A;  4O6J A;  2EB7 A;  5HS8 A;  1MBE A;  3E5Q A;  5EG0 B;  3HOW J;  1YYV A;  3ZMU A;  2DOF A;  2DK5 A;  5L3F A;  1MDM B;  2OD5 A;  5IYD J;  1RET A;  4XLP F;  2NYX A;  4OIQ F;  3IAS 2;  2M2E A;  2CJJ A;  2DDB A;  3CO7 C;  2DBB A;  2KQR A;  2W84 A;  5EJC A;  4CYD A;  4CCK A;  3CJT B;  2E1M B;  3EET A;  3CCR I;  5FLX K;  4DGW B;  4XKV A;  2A69 F;  4U7B A;  2ID3 A;  3BZ6 A;  3J7A O;  1LVK A;  2YSR A;  1VF9 A;  1U8R A;  4XSZ F;  4F7Z A;  3HZJ A;  1FIA A;  3OS0 A;  2HWV A;  3TL4 X;  3F8F A;  5EG0 A;  1IV6 A;  1GDT A;  1IRF A;  1K7A A;  2PBI A;  4ETS A;  1ZEL A;  2UV1 A;  4WX9 A;  4M3B A;  1MH3 A;  1H0M A;  2D5V A;  2DI3 A;  2CV2 A;  2DQL A;  3MZY A;  3IWF A;  3V7S A;  3BJ6 A;  5ILU A;  4IPA A;  3V4G A;  4Z2Y A;  5E18 F;  2PN6 A;  3P9C A;  2I8D A;  1B9N A;  1P4X A;  3OYH A;  1FOW A;  4L0Z B;  2P5V A;  1DP7 P;  4A3E J;  4BNC A;  3G6E I;  1UB9 A;  2D2W A;  1FOX A;  5J3L A;  1A36 A;  3GFM A;  5FLM J;  3FWE A;  5EEG A;  3ZXS A;  2AQF A;  2RGV A;  3C1D A;  2H8W A;  3Q9S A;  2Y75 A;  2M1B A;  2LR8 A;  1O7L A;  4WXH A;  2ISZ A;  2DMN A;  2JJ7 A;  3HM5 A;  4Q4Z F;  1YS6 A;  2CQQ A;  2QQA A;  3JRI A;  2H6C A;  1IN5 A;  4DNC A;  3E97 A;  5H6R A;  2VE9 A;  2QEX I;  2JTV A;  2QSG X;  3H5A A;  3S93 A;  1ZGA A;  2E7X A;  4NDL A;  1S72 I;  3A0H C;  5IPA A;  3DKY A;  2A07 F;  1J09 A;  1PUF B;  5K5O A;  3F8B A;  2F6C A;  2KKO A;  5IT9 Z;  1A5J A;  3BPV A;  4G8X A;  2OJE D;  2PX9 A;  1W7P B;  3BDD A;  4LOC A;  3HKZ N;  4WXD A;  4L18 B;  3W6V A;  1JHF A;  3C2H A;  4HA8 A;  2K9N A;  3ZMD A;  2ADU A;  5J8C A;  3WTX C;  1T0F C;  1J7K A;  4TV7 A;  1ON2 A;  3LSJ A;  2L7Z A;  2TRT A;  4HF1 A;  3KFW X;  1DPR A;  5DD8 A;  3D0S A;  4MTD A;  2NS7 A;  1T08 B;  2OCE A;  3RKW A;  3ABL H;  1ZRD A;  3FBN B;  4PJM A;  4GRI A;  3PJR A;  1BBY A;  2RNJ A;  2QVO A;  3KP3 A;  2O0Y A;  4II2 A;  1H9G A;  4A3I J;  1VFC A;  4Y7N J;  3CES A;  4K2E A;  1PUF A;  1N77 A;  2DQR A;  2ID6 A;  2P4W A;  1YIJ I;  2PJP A;  3JSO A;  4GGG A;  2HVS A;  4HF2 A;  3OS1 A;  5JHU A;  4L9V A;  1FP2 A;  1W7P A;  4Y15 A;  1ZRE A;  3BCB A;  5C3E J;  3S16 J;  2F5D A;  1K4T A;  4A12 A;  2E5N A;  3EYY A;  4CIC A;  1W0U A;  5M5X J;  5CVV A;  2EA4 A;  4XOR A;  4KIG A;  4HZF A;  3OL3 A;  3RPU A;  1Y8Q B;  1FNN A;  1U5T B;  5LHG A;  4ESB A;  2XHK A;  3F8C A;  2DOD A;  3HPG A;  3QYF A;  1IN4 A;  2LYC A;  3DLA A;  3F3X A;  1V55 H;  4DYR A;  1SD6 A;  4YIR X;  3PIP F;  3JRH A;  1Y39 A;  3GTQ J;  2XAS A;  2EA2 A;  4L9N A;  5E20 A;  2VPL A;  1SFE A;  4QSH A;  3DEU A;  1UHW A;  2XV4 S;  1EH7 A;  1PUE E;  2Y48 A;  3KZY A;  3C2B A;  2FX0 A;  2K40 A;  3CC4 I;  2L0K A;  1Z0X A;  2XB0 X;  4RBO A;  4MNU A;  1I6X A;  4LGW A;  2HS5 A;  1R5G A;  1TWH J;  1NG6 A;  2MA3 A;  4O5V A;  4XOP A;  4IJA A;  2CW0 F;  4FCY A;  3BQZ A;  3BZC A;  4EJV A;  1U5T A;  5A2Q Z;  1XMX A;  1UG2 A;  2X6Y A;  3IHU A;  2P7V B;  2HDC A;  4BQN A;  3DF8 A;  3FMS A;  3QU6 A;  5LRS A;  3IH3 A;  2VKV A;  4XK4 A;  4BJ6 C;  5IYB J;  2STW A;  1RUN A;  4ZZD A;  1BW5 A;  3WG7 H;  3E5U A;  4JQF A;  1FMV A;  1LQ1 A;  3OSF A;  2XF5 A;  1BJZ A;  3JRF A;  2QZ8 A;  3GF2 A;  2NNN A;  3H5N A;  4BDZ A;  5GAH J;  4RS8 A;  4I02 A;  4KIT B;  4KFC A;  2XPW A;  5F64 A;  3WTS C;  1WI9 A;  1JUP A;  5F1R A;  4V2F A;  3LL7 A;  4RAF A;  2J5P A;  2CW8 A;  5HDG A;  5K5Q A;  3VDX A;  5GTH C;  1WCM J;  4E7K A;  5HDN A;  3JRA A;  1LNW A;  2KFD A;  4CA0 A;  1Z77 A;  2WAQ N;  5CYV A;  4C3J J;  3L09 A;  2L54 A;  3FMR A;  6PAX A;  2L2O A;  3WOD F;  3E6D A;  1HSJ A;  3LSG A;  4OAY A;  4CYC B;  4U87 A;  2ZCW A;  3HKZ A;  2EZL A;  1E3O C;  3BRO A;  3KCC A;  3EUH A;  1B1B A;  3ECH A;  5F0F A;  4H0E A;  1A35 A;  4L5E A;  3M3Y J;  4IOA F;  3F8N A;  2QF7 A;  4B8X A;  4N0B A;  4C3I J;  1QVU A;  2ISY A;  1SD5 A;  2DMU A;  4D0P A;  4PSX A;  2JMW A;  3I64 A;  2LRE A;  1XX5 A;  3VWB A;  2YX4 A;  3KEO A;  5M5W J;  2VLA A;  3ABU A;  2XKP A;  2DN0 A;  2YX7 A;  5EGO B;  2X0L A;  5FD5 A;  1FMW A;  1W5C C;  2L9N A;  1BC7 C;  1YIO A;  1TWF J;  2ZXI A;  5D5U B;  2K85 A;  2FNA A;  5LFA A;  1U2W A;  2VON A;  4C2T A;  3RYR A;  4CDG A;  4BHB A;  5LEJ A;  2JA5 J;  2W25 A;  5E17 F;  4QPO A;  1OYY A;  1OCP A;  4FAS D;  2E35 A;  3GWZ A;  3MFK A;  1XSV A;  2BZT A;  1OCR H;  3LA2 A;  2Y2Z A;  4HX4 A;  3PSI A;  3CC7 I;  5ERI A;  2M30 A;  4RGS A;  2O03 A;  3H0D A;  1FBQ A;  5HOO A;  2W82 A;  2DO7 A;  3PFI A;  2KL4 A;  2V26 A;  3E6B A;  3QYE A;  2RRE A;  1OCO H;  3S1N J;  2K9Q A;  3IWZ A;  5B1A H;  4CGZ A;  3CF5 F;  5FKO A;  1X2M A;  3O8H A;  1BR2 A;  2KJB A;  3K70 D;  3VPR A;  5BQT A;  2XRN A;  1IXC A;  1ONV A;  5IYC J;  4OWR B;  4LLL A;  2K3F A;  1UCR A;  1Z21 A;  2OQG A;  3T1B A;  2GWR A;  4EJU A;  1YRN A;  2OV7 A;  4MFE A;  1QA6 A;  1ETX A;  1WJB A;  3ISP A;  3I9V 2;  2V9P A;  1WI3 A;  3RQ4 A;  2L02 A;  5GPC A;  3HTU A;  2JZY A;  4IL6 C;  4B09 A;  1B4A A;  2KPM A;  3JRD A;  3BCA A;  4BH9 A;  4ZDL A;  2MD5 A;  2XAG A;  9ANT A;  1B72 A;  4UB8 C;  2NS8 A;  4MQV A;  3WTZ A;  1QPI A;  1CQT A;  2QQB A;  1O4X A;  1BIA A;  4BGD A;  2H94 A;  3E7L A;  3GFL A;  4ZTF A;  3TDU C;  2KRC A;  3OYB A;  3W3C A;  2MBF A;  3LQQ A;  5C4J J;  2HOA A;  3SFI A;  2JA6 J;  3LAP A;  3FKI J;  1G3Y A;  2YU3 A;  4DYC A;  3M4O J;  3M8E A;  4ZDO A;  3TBI A;  1HW1 A;  1MSF C;  2WAQ A;  2XPV A;  4NUB A;  2X1E A;  4UB6 C;  4XRS G;  5F0H A;  2WY8 Q;  3ZMZ A;  1KQ0 A;  1XD7 A;  2A5W A;  3EUH C;  2M8E A;  2DOE A;  2BVL A;  2VBW A;  4E70 A;  5LGT A;  2FU4 A;  5C4X J;  3HBL A;  1F36 A;  2DYS H;  3BPX A;  4PJJ A;  5ICE A;  4LLN A;  2HOS A;  3U21 A;  5KNL A;  1UHS A;  4XBF A;  3K1P A;  1O3Q A;  1D5V A;  3JRE A;  2PLY A;  1P4A A;  3DPL C;  5ICC A;  5HLG A;  5M3F J;  2H1K A;  1IO2 A;  1FZP B;  1SEU A;  2P5L C;  2OAZ A;  3HC7 A;  2VBX A;  3CMA I;  5IP7 J;  2EWN A;  1D0X A;  4M71 A;  2EIK H;  4EQQ A;  3JRB A;  1HC8 A;  5IP6 A;  4UVC A;  2HEO A;  1SAN A;  2WC2 A;  4RA2 A;  2HU9 A;  2DFH A;  2ZC2 A;  5DS9 A;  3GX4 X;  2Z2S B;  5J4V A;  4M6Y A;  4XM3 A;  4E7J A;  1DUX C;  1Y56 A;  2VN2 A;  2IS6 A;  3VB2 A;  4DOZ A;  3M8J A;  1NHA A;  2VJJ A;  2LC2 A;  5KAF C;  2QBY B;  3ZMV A;  5DCM A;  5FD6 A;  1W5S A;  1XSX A;  2HXO A;  2ICW G;  4CCO A;  5DM7 F;  3SQN A;  2FQ3 A;  3OYJ A;  1YO5 C;  4HV5 A;  2FA5 A;  2V6C A;  1GT0 C;  3PO3 J;  4UXN A;  5KVR A;  2HVQ A;  4Y13 A;  4JX5 A;  1NK2 P;  2F5V A;  4DYQ A;  4V2G A;  1QHH D;  3OYA A;  1WKM A;  2AXT C;  2Q2E B;  3FDY A;  3C3W A;  4RB3 C;  4G94 A;  4P9U A;  1R71 A;  4EMS A;  4FET A;  4D5F A;  4UUV A;  2PFB A;  4HQM A;  1GUU A;  2GZW A;  4A0Y A;  2AO9 A;  4PJ0 C;  2VC0 A;  2GA2 A;  4YII A;  1S3J A;  2RAE A;  4UVA A;  5K5R A;  4A3K J;  4BXU A;  3OYG A;  1YJW I;  3WU0 A;  4IXA A;  3Q0U A;  3J80 K;  5EZH A;  1K6O A;  5FFX A;  2E34 A;  4D9J A;  1IXR C;  4OOI A;  1E2X A;  1ENH A;  2ESN A;  3WG9 A;  2VT3 A;  1IGN A;  2MSY A;  3E5X A;  2XUB A;  2ZSH B;  1TNS A;  2LY2 A;  2XGX A;  3BR2 A;  3I4M J;  3GFI A;  2JSP A;  5GAD J;  5HLH A;  4IVN A;  4W97 A;  5F08 A;  4E7L A;  1HW2 A;  1HKS A;  4CCL A;  2OTJ I;  2KIM A;  3K4L A;  1T98 A;  2GM4 A;  3EQL F;  1IXS B;  4Y33 A;  5DDG A;  5B1B H;  1W36 C;  2VQG A;  2GBY A;  3BG6 A;  1OYI A;  2EFW A;  3IP4 B;  3BG9 A;  3M07 A;  1KQ8 A;  5JFR A;  3RCO A;  2A5Y B;  1T33 A;  3FBI B;  1J59 A;  3CUO A;  1LDD A;  2WWY A;  1BL0 A;  2CS3 A;  3OS2 A;  1D0Y A;  2KDO A;  1RIO H;  4KYW A;  2ACJ A;  2K9S A;  1YW7 A;  3JCU C;  2QGU A;  5ICF A;  3RPQ A;  4F55 A;  4XQF A;  5J47 A;  5BPI A;  2GLO A;  1BW6 A;  2XAH A;  2LFB A;  4BJ5 C;  3QPS A;  3ROU A;  4IF4 A;  4F52 A;  3I58 A;  1ZG1 A;  1X2N A;  3K2Z A;  2MYS A;  2XAQ A;  3FXL A;  1BR4 A;  3BP8 A;  3TGN A;  4IX7 A;  3LA3 A;  3ZPL A;  3F21 A;  2NAZ A;  2XRL A;  1YOV B;  4XN0 A;  1WHU A;  1YTY A;  4LIT A;  2FNP A;  1D5Y A;  3BR5 A;  2DA3 A;  1K4S A;  1FPQ A;  4Y52 J;  3CDH A;  2JRM A;  1A6Q A;  2RKH A;  3DPT A;  3A01 A;  4I2O A;  3PSF A;  1EKE A;  2A68 F;  2PMU A;  5B3S H;  4RAG A;  1LDJ A;  1HA8 A;  3GLX A;  3F23 A;  3JTG A;  3DLL F;  4BAY A;  3MQ0 A;  3CJQ B;  2DU9 A;  4NNJ A;  2AS5 F;  4LD5 A;  1FLI A;  1S29 A;  2LLK A;  3TW6 A;  5FKL A;  5FLV A;  3CO6 C;  4BY1 J;  3HB9 A;  4LB5 A;  2K3P A;  4R8H A;  3SZG A;  1XGS A;  2VI6 A;  2MH2 A;  2ZJ2 A;  3COA C;  5IT9 K;  4PDK A;  1TBX A;  3M8F A;  2BHZ A;  3DU6 A;  4NHJ A;  3FXQ A;  1S7A A;  4U88 A;  2X9D A;  2IBD A;  1RNL A;  3M1E A;  3VSL A;  3GO5 A;  2HQR A;  5DM6 F;  5E1X A;  1X1A A;  1FEX A;  4PJL A;  5FGM A;  2DPD A;  3FIW A;  3SJM A;  4C2M J;  4Q5S F;  1RPW A;  3U2R A;  2CQ7 A;  4UVB A;  2FSW A;  4A6D A;  2GOM A;  1U78 A;  2EV5 A;  1KZH A;  1AA7 A;  3ABT A;  4ASN A;  4ESJ A;  4MEX F;  1SVL A;  5J4Y A;  2IAI A;  4GXO A;  1BI2 A;  3IRR A;  3A02 A;  3PL8 A;  2BEO A;  2NXN B;  2UXX A;  4ENM A;  2TDX A;  5LD2 C;  1R22 A;  5JI6 A;  4B48 A;  4A3F J;  5FKN A;  3PNV A;  1HKQ A;  2DOA A;  2EH3 A;  5FRO A;  1QQI A;  4Z6Y A;  3GTO J;  3T0Y A;  3PO2 J;  2DYR H;  2Y0M A;  4UHT A;  2B0L A;  3CDL A;  1SVO A;  3FKJ A;  3CMM A;  2BGC A;  2Y9Y A;  1IUF A;  2A6H F;  4UUT A;  3J81 K;  2LKP A;  5DV5 A;  3S1R J;  1WGX A;  3MZH A;  3BG7 A;  1Y0N A;  3JSP A;  4YRV A;  2K7L A;  4E6K G;  1IW7 F;  2XSJ C;  3G3Z A;  4DQ2 A;  5H20 A;  1MMG A;  3K10 A;  3AFH A;  5LGU A;  1X4O A;  3HOU J;  4M74 A;  1HOM A;  2EZK A;  3BTI A;  1XGO A;  4GYI A;  4HST A;  3FXM A;  3TKY A;  4XIC A;  5F0C A;  2L5Q A;  3I4N J;  1HDP A;  3J7Z I;  3OYN A;  1FIP A;  5J1R A;  5K1Y A;  2MLK A;  1ORK A;  4UUS A;  5C44 J;  1UZC A;  1OIS A;  3CMY A;  2DA4 A;  4QIW N;  2TCT A;  2OPT A;  1R49 A;  4HYE A;  3V8J A;  1GV2 A;  2M7B A;  1MKM A;  4HX8 A;  3A2K A;  1JGS A;  3MVP A;  2JVG A;  4XRS A;  2Z33 A;  2IS2 A;  1LJ9 A;  4P9F A;  5JLW A;  1VND A;  2P8T A;  4CH7 A;  2HPM A;  2L4M A;  3MAJ A;  1FOY A;  4JK1 X;  3AG2 H;  2JSC A;  2R7R A;  2BY2 A;  5CVR A;  2M3A A;  1M1E B;  3G1O A;  5BOX A;  2CQN A;  2KIF A;  2VQC A;  4BQA A;  3PUF A;  3MKL A;  3WU2 C;  5CVU A;  5GAE J;  2EIJ H;  3W2A A;  2IRF G;  1E17 A;  4DJA A;  3VYU B;  5GAG J;  1Z3Y A;  2PMZ N;  4JX6 A;  3BR6 A;  3HHG A;  4ESF A;  2QM3 A;  2V7F A;  1ODD A;  3QQA A;  4WXC A;  4IHV A;  1LFU P;  2ZNY A;  1T6S A;  1MDM A;  2QUF A;  1R1U A;  1DPU A;  3FX3 A;  2P81 A;  3LWF A;  5CVJ A;  5GPA A;  2ZME B;  1G2H A;  2A3S A;  1OLT A;  4IRG A;  4M6X A;  1TWG J;  4MLO A;  1S9H A;  2VBY A;  3CCM I;  5DTD A;  5H2F C;  2EIL H;  3X2Q H;  2QWW A;  1FSE A;  3K4N A;  1RES A;  1OKR A;  4HNV A;  3Q5F A;  2OUM A;  3S3M A;  1I3Q J;  2JUG A;  4XLA A;  1VQL I;  2DA5 A;  4G7H F;  2CV0 A;  5E3L A;  5D5W B;  1F4K A;  1G4D A;  2CFX A;  2DMT A;  3KX2 A;  3AAF A;  1MMS A;  2BY3 A;  3U1D A;  3OMY A;  2OZ6 A;  1TW3 A;  2K4J A;  3KE2 A;  3HSE A;  3HL2 A;  2L4A A;  4FX0 A;  3WTT C;  5HOD A;  3R4K A;  3HRM A;  4WWC A;  2P5K A;  3GW2 A;  1HF0 A;  2FD5 A;  2DMP A;  2VJ5 A;  4PGH A;  3TMO A;  1Q1H A;  2ZME A;  3LA7 A;  1XCB A;  4G6T B;  1V4R A;  2E2I J;  5DD4 A;  3MD2 A;  2NOJ B;  4EM0 B;  3TED A;  4GO1 A;  4Y17 A;  2QLZ A;  5JHF A;  4FQG A;  3Q0W A;  4AU7 A;  5IOY A;  2WBM A;  3F9K A;  4L9J A;  2VQH A;  3A4C A;  4M3G A;  5M3M J;  2KIS A;  2MAB A;  4CHU A;  2XAU A;  3L1P A;  2O6G E;  5L3D A;  3HRU A;  3NAR A;  1GXP A;  3ZQF A;  2V6E A;  1XGM A;  2EIM H;  4I0A A;  3S1M J;  1BOA A;  2GXG A;  2MG4 A;  5D8K B;  4DBR A;  1IV8 A;  2Z9O A;  2FOW A;  2EZI A;  2HKO A;  2HQA A;  4OIO F;  1VQ9 I;  3SHF A;  5E3M A;  1IUY A;  2CGP A;  4D5C A;  2HXI A;  2HVR A;  3V42 A;  2MW8 A;  3SXY A;  2Z16 A;  3BZK A;  1H8A C;  4WCG A;  3CLO A;  4IO9 F;  3BG5 A;  1WWX A;  3D5R C;  1IAW A;  1Y0U A;  2Z3Y A;  2E19 A;  3E6M A;  4FE7 A;  3GYH X;  1VI0 A;  1TWC J;  3H3U A;  3IC7 A;  2WAD A;  2BXY A;  5E79 C;  2KHM A;  3PFY A;  2R7D A;  4I99 C;  2P7C B;  3AG3 H;  1VQ7 I;  3DQV C;  3FXU A;  3RPU D;  3L2R A;  1YLF A;  2VIX A;  2UWM A;  1LB2 A;  4HOB A;  3CCY A;  2X4H A;  1SMT A;  2LKX A;  5EEA A;  3MKY B;  3IAM 2;  3P9K A;  3GTK J;  3RSN A;  5HLI A;  1IF1 A;  2FRH A;  1ZTR A;  5B66 C;  3S3N A;  2XDV A;  2VPR A;  3AL0 B;  1TP4 A;  3H1C A;  2BXZ A;  2IT0 A;  1GHC A;  1U6G A;  3GBG A;  1JGG A;  4D7M A;  1XGN A;  4M73 A;  1R7J A;  2K5C A;  3RKQ A;  2HQN A;  2B7E A;  1I27 A;  2ELJ A;  1ETY A;  4KN4 X;  2L7K A;  1ZAR A;  2PMZ A;  3MMY B;  1T95 A;  5J8F A;  1TT5 B;  2MC3 A;  2NOG A;  5EZG A;  2CW7 A;  1KYW A;  1WPK A;  3H35 A;  1Y1W J;  2DT5 A;  2YS9 A;  3QOP A;  2E1M C;  2IGN A;  2KMU A;  3SZT A;  4I98 B;  1XMK A;  5FB2 A;  2M9H A;  4A3L J;  3RKY A;  2OU2 A;  3LFK A;  2R5Y B;  3BTL A;  4ITV A;  1O57 A;  2D1H A;  2W48 A;  2DW4 A;  3PNT A;  3VSK A;  3FZV A;  1G8X A;  4QTR A;  5E1Z B;  3KP7 A;  4EM1 A;  1WJA A;  2CUF A;  4FE4 A;  4XLC A;  1VQP I;  1XG1 A;  1HKT A;  1WJE A;  2EV6 A;  2V9K A;  3RZD J;  4AVZ A;  1MGT A;  2ZME C;  3ZCO A;  4IRI A;  1KU3 A;  1I1S A;  4I09 A;  3LSM A;  4B4C A;  3OYL A;  4ZTJ A;  3LSR A;  2RQQ A;  5LBQ A;  4A5N A;  2Y9Z A;  2MH9 A;  4XRF A;  1F9N A;  3HGG A;  1D1A A;  2GXB A;  1ERD A;  3GXO A;  3T5X A;  4A3C J;  2W57 A;  1QNT A;  5FKK A;  3OY9 A;  1GXQ A;  3SEQ A;  5CKT A;  3Q9V A;  2H6B A;  2J5O A;  1LFP A;  1POG A;  2DFI A;  1PVE A;  3KEY A;  5K7Z A;  1D3Y A;  2HZT A;  5F1J A;  3HOT A;  4OIN F;  3F0C A;  2F4O B;  4BE2 A;  2QA4 I;  5DUK A;  3E0J B;  2LBF B;  1TQP A;  2DTR A;  2M7A A;  4RMN A;  5F04 A;  1S5L C;  2OCC H;  3MN2 A;  2PI0 A;  3S15 J;  2R7V A;  4BHC A;  2R7S A;  1I6H J;  3KP2 A;  1RR8 C;  2K9L A;  4E7Z A;  2FOK A;  3V8L A;  2KZV A;  1R00 A;  2CUJ A;  5FRM A;  1ZAO A;  2VT2 A;  2EQR A;  3E1S A;  2D45 A;  2X6O A;  4YIF A;  3ERE D;  1W1W E;  2V1D A;  4IHX A;  4CYC A;  3O6B B;  1TT0 A;  2VE8 A;  3ESW B;  1O3R A;  2NVY J;  3GZN B;  1HQC A;  3CUQ B;  4OIR F;  3OV8 A;  2E7W A;  1D8J A;  3CCU I;  3G2B A;  2DTZ A;  2LBF A;  3CCQ I;  4HNT A;  1IG7 A;  4AIJ A;  1VQO I;  3TO6 A;  5E3N A;  2EPF A;  4RGU A;  5LRR A;  5EYR A;  4BS9 A;  1CF7 B;  2LH9 A;  2CUZ A;  3TO7 A;  1D1C A;  3QYB A;  2WAF A;  3I53 A;  1O3S A;  3ZRG A;  3I71 A;  3FXO A;  3EUK L;  5EGO A;  4BXF A;  1OCZ H;  2O7O A;  3K4C A;  1V5E A;  4PJN A;  4RM3 A;  5M5Y J;  4M3E A;  4L5J A;  3HUG B;  3C2G A;  1REP C;  2HTS A;  1JT6 A;  2KRH A;  2A61 A;  2LOO A;  1D8K A;  1S8N A;  2ECC A;  1XDS A;  3QWL A;  4KUM A;  2BHY A;  1U5T C;  4HQE A;  1OR7 A;  2G7H A;  5EF6 A;  1ZRC A;  1FOK A;  4AIH A;  2KLO A;  2VOD A;  2GAU A;  1FWZ A;  2K86 A;  1TL8 A;  1JXS A;  4HAM A;  4Q48 A;  2R7O A;  3ZGK A;  2KIU A;  1QU3 A;  3KLN A;  2V79 A;  3O2P E;  4JX4 A;  1CF7 A;  1OFC X;  2BOL A;  1RKT A;  3BTJ A;  4FHT A;  1MBJ A;  3QOD A;  2UUZ A;  4BYY A;  3O3K A;  2O9L A;  1ZLK A;  4WF2 A;  1DU6 A;  1WH7 A;  5J1Y A;  3U1K A;  4BKX A;  2W1O A;  1NTC A;  3HUG A;  3CCE I;  4CXF A;  4LFU A;  5LEK A;  3KZI C;  1WRJ A;  1Y8R B;  4HNU A;  4GCV A;  2DT6 A;  1UAA A;  3SYT A;  4CUG A;  1O3T A;  2R7X A;  1FTZ A;  1QRY A;  1P2F A;  2FUG 2;  4H4K C;  4P5O A;  2Z5U A;  1NH3 A;  2VB6 A;  4LG0 B;  4E7I A;  1DP3 A;  1SC7 A;  4BDY A;  3JW4 A;  4E4H A;  1IC8 A;  3LSI A;  3D5S C;  2HOE A;  4JP0 A;  4KMU X;  1WQ2 A;  1X1B A;  4PZJ A;  3M1C A;  3S1Q J;  2UXN A;  4S0H B;  2DMQ A;  1MBF A;  2JVH A;  1YHQ I;  3W6J B;  2E5Z A;  1TNT A;  3WU1 B;  1G6N A;  2XB5 A;  1ZYR F;  3SDB A;  2IVM A;  3D5L A;  1T56 A;  2LY1 A;  2GXA A;  3GME A;  3KYC B;  2DK8 A;  4ZZL A;  4M3F A;  2O3F A;  4II3 A;  4A3M J;  1IRZ A;  1DGW Y;  1Z67 A;  3S2D J;  3RI4 A;  4BUP A;  2E60 A;  2CMP A;  4YFN F;  1LPQ A;  1SAU A;  1Z05 A;  3HXL A;  4FT8 A;  3AG4 H;  3OYC A;  1IJW C;  1MNE A;  3FXJ A;  3ECO A;  1BM9 A;  5J6X A;  1VQN I;  1ZG5 A;  3BOQ A;  2MFZ A;  3KP5 A;  3OOP A;  4LK1 F;  1GV5 A;  4EV0 A;  1RKW A;  2ZXJ A;  4BU2 A;  2F5E A;  3AKZ A;  3IKT A;  3ZQG A;  2DJI A;  3OYM A;  1GLN A;  3LSP A;  1QVT A;  2IS4 A;  4UV9 A;  2DPU A;  3EYI A;  4ZYE A;  1HDD C;  3L00 A;  4WK8 F;  3BWG A;  5BS6 A;  2ZXH A;  3HJE A;  2FJ1 A;  3IRQ A;  2IXS A;  2FXA A;  1SFK A;  4LB6 B;  4I7H A;  1BN5 A;  2VC1 A;  2Q0O A;  4EAT A;  1OJL A;  4AYB N;  4PCQ A;  1KU9 A;  1SVM A;  3BLY A;  1H9T A;  2P6S A;  2WB1 N;  2Y30 A;  4XLF A;  3G73 A;  3JR9 A;  1OPC A;  1FYL A;  3GUD A;  1QZZ A;  3CC2 I;  5HLT A;  3R0J A;  4ZC3 A;  1AOY A;  4P55 A;  2W00 A;  3G1L A;  5B5E C;  4A69 C;  4IRH A;  3FXK A;  4FTH A;  1MMD A;  5GP9 A;  2QBY A;  2GA1 A;  3F72 A;  4XOT A;  5FFZ A;  3CJN A;  1PP8 F;  2O5R A;  2IA1 A;  2L7M P;  2VKD A;  3WGG A;  2ZB9 A;  2Q8K A;  3K1N A;  1TW2 A;  1OMI A;  2YR2 A;  1ZK8 A;  1U0J A;  4HBL A;  2EBI A;  1B8I B;  2Q2E A;  3VYT B;  4EJO A;  2QKL B;  5GTI C;  3VYR B;  4CZC A;  1EA3 A;  1YFH A;  3DEE A;  4KT6 A;  1BOB A;  2W4S A;  3QPL A;  3HSF A;  2QSF X;  1P9Q C;  2RQP A;  1IN8 A;  5CQE A;  2I10 A;  1XS9 A;  1LKX A;  1BI0 A;  4XID A;  1MW7 A;  1ZH5 A;  3H9Q A;  4UY8 I;  4X6A J;  4A0Z A;  1FTT A;  2ZBK A;  2LNB A;  1VZ0 A;  1OCT C;  1HXD A;  3PQK A;  1KYZ A;  3IKV A;  3DXJ F;  1A6I A;  3AG1 H;  3HOS A;  5LGN A;  4RB0 A;  3K2A A;  2NVQ J;  4G7Z F;  2M8G X;  3LAJ A;  1T2K A;  4G12 A;  3MZ8 A;  2HTJ A;  3GTJ J;  3HTS B;  3K6G A;  4UV8 A;  4CO8 A;  4A93 J;  2IGM A;  4EGZ A;  2X51 A;  5CPR B;  4UNO A;  3JRC A;  4LJZ F;  1TC3 C;  3HHH A;  2OC6 A;  3OR1 C;  5CVI A;  5IT3 A;  2FE3 A;  4C3H J;  4P1W A;  2WAE A;  1I50 J;  4D7N A;  1C0W A;  4RB1 A;  2BY1 A;  3CJR B;  2BYV E;  4AIK A;  3GTM J;  2DJN A;  3IUO A;  4L5I A;  5TRD A;  3E3V A;  4OIP F;  1MMN A;  5DCF A;  4BAC A;  3L2Q A;  1MNM C;  1ETK A;  4RGR A;  2HZD A;  1HW5 A;  5D4S A;  3QPH A;  3WTW C;  4YEL A;  2F5C A;  1LE8 B;  4AM3 A;  3HDD A;  2KJC A;  3ZMS A;  1X1P A;  3BG3 A;  4RLQ A;  3DBR B;  3G1M A;  1EV7 A;  3EUA A;  4JYK A;  3KP4 A;  5CLS A;  4BL0 B;  5F27 A;  3TW7 A;  3DBL B;  3BT9 A;  4XKC A;  1RUO A;  2RV8 A;  2X1C A;  2OQR A;  2F48 A;  3NRV A;  1IRX A;  1P7I A;  5FRN A;  3LOC A;  2LK2 A;  2YUS A;  3FM3 A;  3H5R A;  3BQY A;  3DCF A;  2X48 A;  2W24 A;  2H27 A;  4R1H A;  4AYB A;  2K02 A;  3OSG A;  1NG7 A;  1OQY A;  2WB1 A;  2KT0 A;  3DV8 A;  3DKX A;  2DA7 A;  2IJL A;  3CP2 A;  1X1D A;  3UR3 C;  1YIT I;  1Z6R A;  2XF7 A;  3MCZ A;  3F22 A;  1H89 C;  2VOP A;  1R1T A;  2LF8 A;  2NS0 A;  2P0W A;  1UEL B;  4ZYG A;  2R7W A;  1QZY A;  5K7F A;  3ZQ7 A;  2YU9 J;  1YW9 A;  1W5T A;  3BJO A;  3CLQ A;  1XPX A;  5HS7 A;  3RDI A;  2X85 A;  1RRJ A;  2E36 A;  1LVA A;  3CQZ J;  5D6F A;  1AKH B;  4AWX B;  1HLV A;  4I6Z A;  4XLE A;  4AD9 A;  5HNF A;  3ZQC A;  1JTY A;  1YJ9 I;  4CZZ A;  2VAS A;  3T8T A;  3K0L A;  1MD0 A;  3OIQ A;  1V54 H;  1FYK A;  1G3S A;  1U8B A;  4KIC A;  3CME I;  2IEK A;  2ESH A;  1JUM A;  3PNY A;  4QPQ A;  2JWT A;  1K78 B;  2GOX B;  2XRO A;  3L2W A;  1TLH B;  2PQ8 A;  3ABM H;  1YI2 I;  2K9M A;  4PFO A;  1JUS A;  3PM1 A;  1J75 A;  1BI1 A;  2MLG A;  5D5V B;  2A6T A;  2V1N A;  3TOB A;  1JHH A;  3FHN A;  2XGC A;  3REO A;  3GZ6 A;  2FF4 A;  1AKH A;  1ZR4 A;  3LNQ A;  1IN7 A;  1ZR2 A;  4XKW A;  1I39 A;  4E7S A;  2R93 J;  3J7A Y;  2LY9 A;  2CH0 A;  2OA4 A;  3L9F A;  3FK6 A;  5A2Q K;  1X3W B;  4J00 A;  2BBY A;  1XN7 A;  1R9T J;  5DYM A;  2IPQ X;  5L3E A;  4KIF A;  1SMY F;  2BY0 A;  1VQM I;  2CU7 A;  4XLN F;  4W1U A;  4HV6 A;  3J80 Z;  1VQ5 I;  4RDU A;  3I56 I;  1K78 A;  1J9I A;  2Z1D A;  2GQQ A;  1E3P A;  2IW5 A;  2VUM J;  3SZP A;  2DDA A;  2DA1 A;  2LMD A;  2M4K A;  2P6T A;  2M5W A;  3SEZ A;  4BQQ A;  2WA0 A;  3GLL A;  2H09 A;  4IHS A;  2CRG A;  3VFZ A;  1WVR A;  5FO5 A;  5CJ9 A;  2NVT J;  3GTP J;  3QP5 A;  1DGR M;  1JKQ C;  4NBQ A;  2CQK A;  3PIO F;  3BJA A;  1WZ2 A;  1I3A A;  1N25 A;  2ME6 A;  1Z1D A;  2M34 A;  2HYF A;  5LHH A;  2ZKZ A;  2G0E A;  3H9J A;  1B6A A;  2HR3 A;  1L3L A;  2PG4 A;  4ZYA A;  2CUE A;  4F93 B;  4GDF A;  2ZFU A;  2WTE A;  4ABZ A;  1FC3 A;  3A0B C;  3Q0V A;  3K4K A;  2CO5 A;  4X0G A;  2H8R A;  4IHW A;  3KEQ A;  3KLO A;  3HGY A;  3H3V K;  1MH4 A;  4NQW B;  5D4R A;  2ZJQ F;  4J01 A;  4B47 A;  3L7W A;  4U7D A;  1HBX G;  5AON A;  3VEP A;  3MKZ A;  3CCJ I;  3OYF A;  4XKB A;  1KQ9 A;  1QBJ A;  4AID A;  3U9G A;  4HRI A;  4C30 A;  4G6Q A;  2JN6 A;  3H92 A;  1T8I A;  3R60 A;  2V1X A;  4N9I A;  1IN6 A;  4LK0 F;  4XN3 A;  4BBS J;  1BA5 A;  3CCS I;  4RAZ A;  3CTA A;  4LIU A;  3S8P A;  2Q1Z B;  4GFB A;  2LP0 A;  3JAM Z;  1Z9C A;  4BBR J;  2EFO A;  2L9V A;  1L0O C;  4B3A A;  5IP9 J;  1N78 A;  3OYK A;  4XL9 A;  3GCM A;  2ZNZ A;  1GVJ A;  1FT9 A;  3I54 A;  2HI3 A;  2LRD A;  4NQW A;  4F3Q A;  3ONQ A;  5L3C A;  5EDN A;  2IS1 A;  2QCO A;  1YX3 A;  4A0X A;  3N97 A;  3BR1 A;  3V8K A;  1V5G A;  2E1O A;  4IEJ A;  3ZOB A;  2F4I A;  2OF7 A;  1KU7 A;  4GYG A;  4RLF A;  3FHZ A;  4BXX J;  3HYI A;  3S32 A;  2L9S A;  5E8I A;  4LIV A;  4ZJZ A;  4XR6 A;  1AWC A;  2JUC A;  3R61 A;  3RTR A;  2QQ9 A;  3OOU A;  2ZSI B;  4IZZ A;  2HDD A;  1UG0 A;  3IL2 A;  3JRG A;  5LHI A;  5BPD A;  1MSE C;  3NWT A;  1JKO C;  3DTK A;  1ITY A;  3WGI A;  1ETQ A;  2VKH A;  4U0Y A;  4A3J J;  2AXL A;  1W7P D;  4AUX A;  2R0Q C;  4KA4 A;  1N75 A;  3OIO A;  2E71 A;  4LLG F;  2L9R A;  1ON1 A;  2AQE A;  2OZU A;  3JTH A;  5IY5 H;  2NVX J;  1SAX A;  1VQK I;  4B43 A;  1JKR C;  3DTE A;  3K4B A;  2WY7 Q;  3ZP5 A;  1WFX A;  1SFO J;  1P4W A;  1E0E A;  3UKG A;  2PEX A;  2HYG D;  3HPH A;  3ULQ B;  1YJN I;  2RDP A;  1K79 A;  2MD0 A;  5D8L B;  4HG2 A;  4YFK F;  4XRM A;  3GZ5 A;  2XAJ A;  1YG2 A;  4OMY A;  3ERM A;  1BC8 C;  2N8G A;  4I0B A;  1AHD P;  5F6F A;  4ZYD A;  1AU7 A;  5KAI C;  2LDU A;  1Z7U A;  3RJP A;  1SFX A;  1ZQ3 P;  4G9Y A;  3GTL J;  1ETV A;  2RVC A;  1JJ6 C;  4M72 A;  1LFB A;  2PJR B;  3S2H J;  2KP6 A;  1U9N A;  3IH2 A;  2YPR A;  1K83 J;  4M9S A;  3FM5 A;  1USS A;  3OR2 C;  5AIQ A;  5TJJ A;  1XTA A;  3J81 Z;  2M0C A;  3O8G A;  2LD5 A;  2K4B A;  3P7N A;  4HDV A;  4M6V A;  4YEJ A;  1R4M B;  2RC4 A;  2JA8 J;  3A03 A;  4MEY F;  1STZ A;  5AIP A;  1QO0 D;  4OMZ A;  1U3E M;  5TGT A;  4B3X A;  2BV6 A;  3C7J A;  1XMA A;  1KU2 A;  2EV0 A;  3KYL A;  4IQJ A;  3PUB A;  5J40 A;  4BHP A;  1MMA A;  2F5F A;  4E7H A;  1Y6I A;  1DQU A;  2PJR A;  3GFJ A;  1IDZ A;  4KN7 X;  4B44 A;  1X3Z B;  2NRA C;  3ELK A;  1S7E A;  2KZG A;  3WE3 A;  2EIN H;  3R6S A;  5HS9 A;  1FX7 A;  3ZN1 A;  2KDZ A;  1KA8 A;  5JVG F;  3B02 A;  1TTY A;  2VXZ A;  3M7G A;  4C9Y A;  2EK5 A;  2FBI A;  2HYJ A;  2D1V A;  3N4M A;  3W2V A;  3EPZ A;  2LG4 A;  3WTU C;  5FLX Z;  1XDU A;  3DBH B;  2JA2 A;  2B9S A;  2ZFW A;  4HX7 A;  2R5Y A;  2DT7 B;  2A05 A;  1WSU A;  1TQI A;  4ZYH A;  4F91 B;  4Q47 A;  3NEU A;  4D1Q A;  2EFQ A;  1Z7L A;  4PSW A;  1EJ9 A;  2R7Q A;  2R4G A;  1O7F A;  1G3W A;  1ZGJ A;  2VQL A;  1T38 A;  2VJI A;  2Y31 A;  1RC9 A;  4XON A;  5D5X B;  2M45 A;  2LKS A;  1PYV A;  4G6D A;  4JOM A;  4MTE A;  2EJR A;  1HST A;  2FBK A;  1PJR A;  3TP3 A;  2VOO A;  4BJT A;  3I55 I;  1R6R A;  1WJD A;  3DPU A;  2QEN A;  3BR0 A;  4MQ9 F;  4U0V A;  3L2V A;  4N4N B;  3MEX A;  2XIG A;  2M87 A;  1MZB A;  2HDW A;  1Z91 A;  1RR7 A;  2GIV A;  1GVD A;  4P96 A;  3DTI A;  2R5Z B;  2HQ5 A;  3V7R A;  1MJA A;  3MWM A;  2HGC A;  1WJC A;  2STT A;  2ZO4 A;  5IOZ A;  4PUS A;  2G7U A;  4ZDP A;  3K4J A;  3ABK H;  1Q1V A;  4F92 B;  5D6E A;  3OIP A;  4DIQ A;  1TQM A;  1XB4 A;  2W7N A;  2BVM A;  3R0A A;  3BY6 A;  1P6R A;  1ZN2 A;  1Y1V J;  5TIS C;  2ZJR F;  4A3G J;  4RB2 C;  2AHQ A;  2EFN A;  5E1W A;  3PQJ A;  3G4S I;  1B9M A;  1VQ6 I;  2ZJP F;  2WV1 A;  1YRN B;  5ED4 A;  1BR1 A;  4CCM A;  2ELH A;  3S2W A;  4PK4 A;  3DKW A;  5ICG A;  4A3D J;  2GIZ A;  1FYM A;  2UZK A;  4A2U A;  2R5Z A;  2F4M B;  1EH6 A;  3CUQ A;  2E1N A;  2JPC A;  2RN7 A;  1JJ8 C;  1QHG A;  4RM2 A;  2E2J J;  4CCN A;  1TWA J;  4HLY A;  1R4N B;  4FX4 A;  2M0M A;  1MBH A;  3ASN H;  4HDU A;  2QSH X;  1F43 A;  1NK3 P;  1YX5 A;  3QAH A;  2IGK A;  2O8K A;  1X1C A;  4QWQ A;  3N05 A;  2DFF A;  3I4P A;  1B72 B;  4KMF A;  2FMY A;  2R7T A;  1TZL A;  2CFO A;  2E2H J;  2COB A;  4EM2 A;  3AL0 C;  3GTG J;  2R7U A;  1R58 A;  2B63 J;  4IHY A;  5LLQ A;  2PMH A;  1RI7 A;  2C6Y A;  2XKO A;  1UFM A;  2DAO A;  1F1Z A;  1S7O A;  2QQ8 A;  4BY7 J;  3NQO A;  1JE8 A;  3DWL E;  3BR3 A;  2VJ4 A;  2HPI A;  1CGP A;  5JR3 A;  2EFP A;  4DBQ A;  4HLX A;  3BC8 A;  1FJL A;  3QP6 A;  1W36 D;  2FML A;  3VOE A;  2ME0 A;  2IA0 A;  2ETH A;  4NB5 A;  4L9T A;  4NC8 A;  5FKM A;  2HOT A;  4DZJ A;  5BMZ A;  1ETO A;  3CZ6 A;  1FP1 D;  2XGE A;  4KJZ A;  2COM A;  1G59 A;  2VL8 A;  1ZGW A;  4KDP A;  2R3S A;  3NWS A;  4X1E A;  1YS7 A;  1MND A;  3KZZ A;  3ZQI A;  1ZG3 A;  3TOA A;  4S05 A;  2K27 A;  4LG0 A;  4BEH B;  2LF7 A;  5J1U A;  3CD6 I;  4KIS A;  4Y4R A;  5L3B A;  2XF6 A;  2FEZ A;  3H36 A;  5DCM B;  3G71 I;  3BTC A;  1ACI A;  3F6O A;  3QU3 A;  2I5U A;  3IV5 A;  4AVP A;  4DZP A;  3DFG A;  3LSK A;  3S14 J;  1MBG A;  4LMY A;  3RYP A;  1ZKG A;  1R36 A;  2F2E A;  1IDY A;  4BQO A;  3WHC A;  1UJ8 A;  3CDI A;  1SD7 A;  4MO7 A;  4QLC U;  3KPH A;  1SD4 A;  2JT1 A;  4XSX F;  2ECB A;  4N9H A;  3TO9 A;  1JKP C;  3DU5 A;  2DXI A;  2V1U A;  1VQ4 I;  4EVI A;  4L0Y B;  3B73 A;  2A6E F;  2L01 A;  1JI8 A;  3HIF A;  3HSR A;  4HF0 A;  2Y0S N;  1Z6T A;  3CUQ C;  1OR7 C;  2MC4 A;  1XCV A;  2JPB A;  4ENK A;  4HW0 A;  4I01 A;  2IGO A;  1MJB A;  4C2U A;  4EJT A;  1IZ1 A;  3ASO H;  1K61 A;  1BJA A;  1S6L A;  4CCJ A;  1X19 A;  3LMM A;  5ILV A;  3K70 C;  3HOV J;  3OYD A;  2EZH A;  3HOZ J;  2CQX A;  2FBH A;  3NAU A;  5ILS A;  1MBK A;  3FF5 A;  2CV1 A;  3ZQQ A;  3LQR A;  2O61 A;  4OAZ A;  2V4J C;  1V5F A;  1R5H A;  4KT5 C;  5L3G A;  1IRG A;  5FJ8 J;  2XGD A;  5H6Q A;  1OCC H;  1BI3 A;  1UHM A;  1F5T A;  4EGY A;  2IP2 A;  3Q3S A;  3P9I A;  5BNG A;  3ZR8 X;  2R7Z J;  2CG4 A;  3OWT A;  2VBZ A;  3ZQH A;  3HG9 A;  2Y69 H;  1H88 C;  4IOC F;  2W85 A;  4YG2 F;  1YE9 A;  1B59 A;  3ZMT A;  1A31 A;  1Z3X A;  2LVS A;  3WE2 A;  1JTX A;  1DDN A;  2X6X A;  2OBP A;  4A6E A;  4B1R A;  3H3Z A;  4ZH4 F;  1T39 A;  3CP8 A;  2NNY A; 
#chains in the Genus database with same CATH homology
 4RAY A;  1I1G A;  2R7F A;  2E1C A;  3DP7 A;  4EJW A;  3I59 B;  4PGG A;  4MHG A;  4IHT A;  4R79 A;  3SFZ A;  3K9T A;  5HDK A;  1YW8 A;  2XAF A;  1RZ4 A;  3FXR A;  4YFX F;  1VTN C;  1FBS A;  1A04 A;  1KGS A;  3F6V A;  1LEA A;  5DEQ A;  3QPT A;  1PP7 U;  5DUI A;  3TQN A;  3E6C C;  3I59 A;  5E8G A;  3KET A;  2G9W A;  1EH8 A;  2HFH A;  3GEZ A;  3VOD A;  4MGR A;  4G7O F;  1I5Z A;  4RGX A;  3JAM K;  5JVT A;  4ON0 A;  4U0W A;  2WV0 A;  3HRT A;  2Z99 A;  3RKX A;  3WTY C;  2HKX A;  2V9V A;  4M9X A;  1J5Y A;  1PDN C;  1J0R A;  1FY7 A;  3WGH A;  3TDZ C;  1W4M A;  1G3T A;  1XSD A;  3I5U A;  3T8R A;  2CSO A;  3ML6 A;  4S04 A;  3ZN0 A;  3WTV C;  1QPM A;  3K69 A;  1MJ9 A;  1P92 A;  1FBU A;  2QYO A;  1FSH A;  3F8M A;  3RIR A;  3EDP A;  1ZLJ A;  5HVQ C;  2O8X A;  1BIB A;  1SFU A;  3QRF F;  1QGP A;  1ULY A;  3LST A;  4KIB A;  1OYW A;  2JRT A;  1V3F A;  3K1M A;  3C18 A;  2DLL A;  3HRS A;  4KNY A;  4OU0 A;  3L2C A;  2XVC A;  2CWE A;  4M9Z A;  3GVA A;  2LSO A;  2IA2 A;  1UST A;  3I0T A;  2BE5 F;  1R23 A;  3W6K B;  2CYY A;  4A5M A;  1X3U A;  5EEH A;  2L3D A;  2KRF A;  1T0F A;  3FMQ A;  4ENN A;  1J2X A;  1LDK B;  1ZHF A;  5KK1 A;  1LEB A;  4JBA A;  4ENJ A;  3KP6 A;  1R1V A;  1ZRF A;  3V7C A;  1YQA A;  4O3M A;  3M9A A;  4O6J A;  2EB7 A;  5HS8 A;  3E5Q A;  1YYV A;  3ZMU A;  2DK5 A;  5L3F A;  1MDM B;  2OD5 A;  4XLP F;  2NYX A;  4OIQ F;  3CO7 C;  2DBB A;  4CYD A;  2W84 A;  5FLX K;  3EET A;  2A69 F;  4U7B A;  3BZ6 A;  3J7A O;  2YSR A;  1U8R A;  4XSZ F;  4F7Z A;  2HWV A;  3F8F A;  1IRF A;  1K7A A;  2PBI A;  4ETS A;  4WX9 A;  1H0M A;  2DI3 A;  2DQL A;  5ILU A;  3MZY A;  3IWF A;  3BJ6 A;  3V7S A;  4IPA A;  3V4G A;  4Z2Y A;  5E18 F;  2PN6 A;  3P9C A;  1B9N A;  1P4X A;  4L0Z B;  2P5V A;  1DP7 P;  4BNC A;  1UB9 A;  2D2W A;  3GFM A;  3FWE A;  5EEG A;  2RGV A;  3C1D A;  3Q9S A;  2Y75 A;  2M1B A;  2ISZ A;  1O7L A;  4WXH A;  4Q4Z F;  1YS6 A;  2QQA A;  2H6C A;  1IN5 A;  4DNC A;  3E97 A;  5H6R A;  2VE9 A;  2JTV A;  1ZGA A;  2E7X A;  2A07 F;  5K5O A;  3F8B A;  2KKO A;  5IT9 Z;  3BPV A;  4G8X A;  1W7P B;  3BDD A;  4WXD A;  4L18 B;  1JHF A;  4HA8 A;  3ZMD A;  2ADU A;  5J8C A;  3WTX C;  1J7K A;  4TV7 A;  1ON2 A;  4HF1 A;  3KFW X;  1DPR A;  5DD8 A;  3D0S A;  4MTD A;  3RKW A;  1ZRD A;  1BBY A;  2RNJ A;  2QVO A;  3KP3 A;  2O0Y A;  1H9G A;  4K2E A;  2DQR A;  2PJP A;  2P4W A;  3JSO A;  4GGG A;  4HF2 A;  5JHU A;  4L9V A;  1FP2 A;  1W7P A;  4Y15 A;  1ZRE A;  2F5D A;  4A12 A;  3EYY A;  4CIC A;  5CVV A;  2EA4 A;  4KIG A;  4HZF A;  3RPU A;  1FNN A;  1U5T B;  5LHG A;  4ESB A;  2XHK A;  3F8C A;  1IN4 A;  3F3X A;  1SD6 A;  2XAS A;  2EA2 A;  4L9N A;  5E20 A;  1SFE A;  3DEU A;  1UHW A;  2XV4 S;  1EH7 A;  1PUE E;  2Y48 A;  3KZY A;  4MNU A;  1I6X A;  4LGW A;  2HS5 A;  1R5G A;  2MA3 A;  4O5V A;  4IJA A;  2CW0 F;  4EJV A;  5A2Q Z;  1U5T A;  3IHU A;  2P7V B;  2HDC A;  3DF8 A;  3FMS A;  3QU6 A;  5LRS A;  2STW A;  1RUN A;  4ZZD A;  3E5U A;  4JQF A;  1LQ1 A;  2QZ8 A;  3GF2 A;  2NNN A;  4RS8 A;  4I02 A;  4KFC A;  5F64 A;  3WTS C;  1WI9 A;  5F1R A;  2J5P A;  5HDG A;  5K5Q A;  5HDN A;  1LNW A;  5CYV A;  3L09 A;  2L54 A;  3FMR A;  6PAX A;  3WOD F;  3E6D A;  1HSJ A;  2ZCW A;  3BRO A;  3KCC A;  3EUH A;  1B1B A;  3ECH A;  4H0E A;  3F8N A;  4B8X A;  4N0B A;  2ISY A;  1SD5 A;  4D0P A;  3I64 A;  2YX4 A;  3KEO A;  3ABU A;  2XKP A;  2YX7 A;  2X0L A;  5FD5 A;  1BC7 C;  1YIO A;  5D5U B;  2FNA A;  1U2W A;  2VON A;  3RYR A;  4CDG A;  4BHB A;  5LEJ A;  5E17 F;  2W25 A;  1OYY A;  3GWZ A;  3MFK A;  1XSV A;  3LA2 A;  4HX4 A;  5ERI A;  2M30 A;  4RGS A;  2O03 A;  1FBQ A;  5HOO A;  2DO7 A;  3PFI A;  3E6B A;  3IWZ A;  4CGZ A;  2KJB A;  5BQT A;  2XRN A;  1IXC A;  1ONV A;  4LLL A;  1UCR A;  2OQG A;  3T1B A;  2GWR A;  4EJU A;  3ISP A;  2L02 A;  3HTU A;  2JZY A;  4B09 A;  1B4A A;  4BH9 A;  2MD5 A;  2XAG A;  4MQV A;  3WTZ A;  2QQB A;  1BIA A;  2H94 A;  3GFL A;  3TDU C;  2MBF A;  3LQQ A;  3LAP A;  1G3Y A;  2YU3 A;  3M8E A;  1HW1 A;  3ZMZ A;  1KQ0 A;  1XD7 A;  2M8E A;  4E70 A;  2VBW A;  5LGT A;  2FU4 A;  3BPX A;  5ICE A;  4LLN A;  4XBF A;  3K1P A;  1O3Q A;  1D5V A;  2PLY A;  1P4A A;  3DPL C;  5ICC A;  5HLG A;  1FZP B;  2P5L C;  2OAZ A;  2VBX A;  2EWN A;  4M71 A;  4EQQ A;  4UVC A;  2HEO A;  2WC2 A;  3GX4 X;  1DUX C;  4M6Y A;  2VN2 A;  3VB2 A;  1NHA A;  2QBY B;  3ZMV A;  5DCM A;  5FD6 A;  1W5S A;  1XSX A;  1YO5 C;  3SQN A;  2FQ3 A;  4HV5 A;  2FA5 A;  2V6C A;  4UXN A;  5KVR A;  4Y13 A;  1WKM A;  3C3W A;  4RB3 C;  4G94 A;  4P9U A;  4EMS A;  4UUV A;  2PFB A;  4HQM A;  2GZW A;  4A0Y A;  2VC0 A;  2GA2 A;  4YII A;  1S3J A;  4UVA A;  5K5R A;  4BXU A;  3WU0 A;  4IXA A;  3J80 K;  1K6O A;  5FFX A;  1IXR C;  4OOI A;  1E2X A;  2ESN A;  3WG9 A;  2VT3 A;  3E5X A;  2XUB A;  1TNS A;  2XGX A;  3GFI A;  5HLH A;  4IVN A;  1HW2 A;  1HKS A;  2KIM A;  1T98 A;  3EQL F;  1IXS B;  5DDG A;  1OYI A;  2EFW A;  1KQ8 A;  5JFR A;  2A5Y B;  1J59 A;  3CUO A;  1LDD A;  2WWY A;  1RIO H;  4KYW A;  2ACJ A;  1YW7 A;  5ICF A;  3RPQ A;  5BPI A;  2XAH A;  3ROU A;  4IF4 A;  3I58 A;  1ZG1 A;  3K2Z A;  2XAQ A;  3BP8 A;  3TGN A;  3LA3 A;  3ZPL A;  3F21 A;  2NAZ A;  1YTY A;  2FNP A;  1FPQ A;  3CDH A;  2RKH A;  3DPT A;  4I2O A;  2A68 F;  2PMU A;  1LDJ A;  3GLX A;  3F23 A;  3JTG A;  4BAY A;  3MQ0 A;  2DU9 A;  2AS5 F;  4LD5 A;  1FLI A;  1S29 A;  3CO6 C;  4LB5 A;  4R8H A;  1XGS A;  2MH2 A;  2ZJ2 A;  3COA C;  5IT9 K;  4PDK A;  1TBX A;  3M8F A;  4NHJ A;  3FXQ A;  1S7A A;  4U88 A;  1RNL A;  3M1E A;  3GO5 A;  2HQR A;  5E1X A;  5FGM A;  2DPD A;  4Q5S F;  3U2R A;  4UVB A;  2FSW A;  4A6D A;  1U78 A;  2EV5 A;  3ABT A;  4ASN A;  4ESJ A;  4MEX F;  4GXO A;  1BI2 A;  3IRR A;  2BEO A;  2UXX A;  4ENM A;  2TDX A;  1R22 A;  5JI6 A;  1HKQ A;  1QQI A;  3T0Y A;  2Y0M A;  4UHT A;  2B0L A;  2BGC A;  2A6H F;  3J81 K;  2LKP A;  5DV5 A;  3MZH A;  3JSP A;  2K7L A;  1IW7 F;  3G3Z A;  4DQ2 A;  5H20 A;  5LGU A;  4M74 A;  4GYI A;  1XGO A;  3TKY A;  5K1Y A;  2MLK A;  4HYE A;  3V8J A;  1MKM A;  4HX8 A;  1JGS A;  2Z33 A;  1LJ9 A;  4P9F A;  2P8T A;  2L4M A;  3MAJ A;  4JK1 X;  2JSC A;  5CVR A;  5BOX A;  2KIF A;  4BQA A;  5CVU A;  2IRF G;  1E17 A;  3HHG A;  4ESF A;  2QM3 A;  1ODD A;  4WXC A;  2ZNY A;  1T6S A;  1MDM A;  2QUF A;  1R1U A;  1DPU A;  3FX3 A;  3LWF A;  5CVJ A;  2ZME B;  2A3S A;  4IRG A;  4M6X A;  2VBY A;  2QWW A;  1FSE A;  1OKR A;  3Q5F A;  4G7H F;  5D5W B;  1F4K A;  1G4D A;  2CFX A;  3AAF A;  3U1D A;  2OZ6 A;  1TW3 A;  2K4J A;  3KE2 A;  3HSE A;  2L4A A;  4FX0 A;  3WTT C;  3R4K A;  3HRM A;  4WWC A;  2P5K A;  3GW2 A;  4PGH A;  1Q1H A;  2ZME A;  3LA7 A;  1XCB A;  1V4R A;  5DD4 A;  4EM0 B;  4GO1 A;  4Y17 A;  2QLZ A;  4L9J A;  4CHU A;  2O6G E;  5L3D A;  3HRU A;  1GXP A;  1XGM A;  4I0A A;  1BOA A;  2GXG A;  5D8K B;  2Z9O A;  2HKO A;  4OIO F;  3SHF A;  1IUY A;  2CGP A;  3SXY A;  4WCG A;  3CLO A;  1WWX A;  1IAW A;  1Y0U A;  2Z3Y A;  3E6M A;  3GYH X;  3H3U A;  3IC7 A;  2R7D A;  2P7C B;  3DQV C;  3FXU A;  1YLF A;  2UWM A;  1LB2 A;  4HOB A;  2X4H A;  1SMT A;  3P9K A;  5HLI A;  1IF1 A;  2FRH A;  2IT0 A;  1GHC A;  1U6G A;  1XGN A;  4M73 A;  1R7J A;  2HQN A;  1I27 A;  4KN4 X;  1ZAR A;  5J8F A;  2MC3 A;  1KYW A;  2DT5 A;  3QOP A;  3SZT A;  4I98 B;  1XMK A;  5FB2 A;  3RKY A;  2OU2 A;  3LFK A;  1O57 A;  2D1H A;  2DW4 A;  3FZV A;  5E1Z B;  3KP7 A;  4EM1 A;  1HKT A;  2EV6 A;  1MGT A;  4IRI A;  1KU3 A;  1I1S A;  4I09 A;  5LBQ A;  4A5N A;  2MH9 A;  4XRF A;  1F9N A;  2GXB A;  3GXO A;  3T5X A;  2W57 A;  1QNT A;  1GXQ A;  3Q9V A;  2H6B A;  2J5O A;  2DFI A;  1D3Y A;  2HZT A;  3HOT A;  4OIN F;  5DUK A;  1TQP A;  2DTR A;  2PI0 A;  4BHC A;  3KP2 A;  2FOK A;  3V8L A;  1R00 A;  1ZAO A;  2VT2 A;  2D45 A;  4YIF A;  3ERE D;  2V1D A;  3O6B B;  2VE8 A;  1O3R A;  1HQC A;  3CUQ B;  4OIR F;  3OV8 A;  2E7W A;  1D8J A;  4AIJ A;  3TO6 A;  4RGU A;  5LRR A;  1CF7 B;  3TO7 A;  3I53 A;  1O3S A;  3I71 A;  4L5J A;  1REP C;  2HTS A;  2A61 A;  1D8K A;  1S8N A;  1XDS A;  4KUM A;  1U5T C;  4HQE A;  1OR7 A;  2G7H A;  1ZRC A;  1FOK A;  4AIH A;  2VOD A;  2GAU A;  1FWZ A;  2K86 A;  1JXS A;  4HAM A;  4Q48 A;  2KIU A;  3KLN A;  2V79 A;  3O2P E;  1CF7 A;  4FHT A;  4BYY A;  3O3K A;  1ZLK A;  4WF2 A;  3HUG A;  4CXF A;  4LFU A;  5LEK A;  1WRJ A;  4GCV A;  1O3T A;  1P2F A;  4P5O A;  2Z5U A;  4LG0 B;  3JW4 A;  2HOE A;  4KMU X;  1WQ2 A;  4PZJ A;  2UXN A;  3W6J B;  1TNT A;  3WU1 B;  1G6N A;  1ZYR F;  2IVM A;  3D5L A;  4ZZL A;  2DK8 A;  2O3F A;  3RI4 A;  4YFN F;  1Z05 A;  4FT8 A;  3ECO A;  1BM9 A;  5J6X A;  1ZG5 A;  3BOQ A;  3OOP A;  3KP5 A;  4LK1 F;  4EV0 A;  2ZXJ A;  2F5E A;  3IKT A;  4UV9 A;  2DPU A;  3EYI A;  4ZYE A;  3L00 A;  4WK8 F;  3BWG A;  5BS6 A;  3IRQ A;  2FXA A;  4LB6 B;  4I7H A;  1BN5 A;  2VC1 A;  2Q0O A;  4PCQ A;  1KU9 A;  1H9T A;  2P6S A;  3G73 A;  1OPC A;  1FYL A;  3GUD A;  1QZZ A;  3R0J A;  1AOY A;  4P55 A;  4IRH A;  2QBY A;  2GA1 A;  3F72 A;  5FFZ A;  3CJN A;  1PP8 F;  2IA1 A;  3WGG A;  2Q8K A;  3K1N A;  1TW2 A;  1OMI A;  2YR2 A;  4HBL A;  2Q2E A;  4EJO A;  1YFH A;  3HSF A;  2RQP A;  1IN8 A;  1BI0 A;  1ZH5 A;  4A0Z A;  2ZBK A;  2LNB A;  1HXD A;  3PQK A;  1KYZ A;  3IKV A;  3DXJ F;  3HOS A;  5LGN A;  4RB0 A;  4G7Z F;  3LAJ A;  1T2K A;  2HTJ A;  3HTS B;  4UV8 A;  4CO8 A;  4EGZ A;  4UNO A;  4LJZ F;  3HHH A;  5CVI A;  5IT3 A;  2FE3 A;  1C0W A;  4RB1 A;  2BYV E;  4AIK A;  4L5I A;  5TRD A;  3E3V A;  4OIP F;  5DCF A;  4RGR A;  1HW5 A;  5D4S A;  3QPH A;  3WTW C;  2F5C A;  2KJC A;  3ZMS A;  1EV7 A;  3KP4 A;  5CLS A;  1RUO A;  2RV8 A;  2OQR A;  3NRV A;  3FM3 A;  2W24 A;  2H27 A;  4R1H A;  2K02 A;  3DV8 A;  2IJL A;  1Z6R A;  3MCZ A;  3F22 A;  2VOP A;  1R1T A;  2LF8 A;  2NS0 A;  4ZYG A;  1QZY A;  3ZQ7 A;  1YW9 A;  1W5T A;  3BJO A;  5HS7 A;  3RDI A;  1LVA A;  5D6F A;  4AWX B;  4AD9 A;  4CZZ A;  3T8T A;  3K0L A;  1MD0 A;  1FYK A;  1G3S A;  4KIC A;  2ESH A;  1K78 B;  2XRO A;  1TLH B;  2PQ8 A;  1J75 A;  1BI1 A;  2MLG A;  5D5V B;  3TOB A;  1JHH A;  3REO A;  3GZ6 A;  2FF4 A;  1IN7 A;  2OA4 A;  3L9F A;  5A2Q K;  2BBY A;  1XN7 A;  5DYM A;  5L3E A;  2IPQ X;  4KIF A;  1SMY F;  4XLN F;  4HV6 A;  3J80 Z;  1J9I A;  1K78 A;  2GQQ A;  2IW5 A;  3SZP A;  2P6T A;  2M5W A;  2H09 A;  4IHS A;  3VFZ A;  5FO5 A;  5CJ9 A;  3QP5 A;  2CQK A;  3BJA A;  1Z1D A;  2HYF A;  5LHH A;  2ZKZ A;  1B6A A;  2HR3 A;  1L3L A;  2PG4 A;  2WTE A;  1FC3 A;  2CO5 A;  3KEQ A;  3KLO A;  5D4R A;  3L7W A;  4U7D A;  1HBX G;  5AON A;  3VEP A;  1KQ9 A;  1QBJ A;  3U9G A;  4G6Q A;  3H92 A;  3R60 A;  2V1X A;  4N9I A;  1IN6 A;  4LK0 F;  4RAZ A;  3CTA A;  3JAM Z;  1Z9C A;  2EFO A;  1L0O C;  2ZNZ A;  1GVJ A;  1FT9 A;  3I54 A;  4NQW A;  5L3C A;  3N97 A;  4A0X A;  3V8K A;  1KU7 A;  4GYG A;  3FHZ A;  3HYI A;  5E8I A;  1AWC A;  3R61 A;  3RTR A;  2QQ9 A;  3IL2 A;  5LHI A;  5BPD A;  3WGI A;  4U0Y A;  2AXL A;  1W7P D;  4KA4 A;  4LLG F;  1ON1 A;  2OZU A;  3JTH A;  1SAX A;  3ZP5 A;  1P4W A;  2PEX A;  2HYG D;  3ULQ B;  2RDP A;  1K79 A;  5D8L B;  4YFK F;  3GZ5 A;  2XAJ A;  1YG2 A;  4OMY A;  1BC8 C;  4I0B A;  5F6F A;  4ZYD A;  3RJP A;  2LDU A;  1Z7U A;  1SFX A;  4G9Y A;  2RVC A;  4M72 A;  2YPR A;  4M9S A;  3FM5 A;  1USS A;  5AIQ A;  5TJJ A;  3J81 Z;  2K4B A;  3P7N A;  4HDV A;  2RC4 A;  4MEY F;  1STZ A;  5AIP A;  1QO0 D;  4OMZ A;  1U3E M;  2BV6 A;  3C7J A;  1XMA A;  1KU2 A;  2EV0 A;  4BHP A;  2F5F A;  3GFJ A;  4KN7 X;  2NRA C;  3ELK A;  3WE3 A;  3R6S A;  5HS9 A;  1FX7 A;  3ZN1 A;  1KA8 A;  3B02 A;  1TTY A;  2VXZ A;  3M7G A;  2EK5 A;  2FBI A;  2D1V A;  3N4M A;  3WTU C;  5FLX Z;  1XDU A;  2ZFW A;  4HX7 A;  1WSU A;  1TQI A;  4ZYH A;  4Q47 A;  3NEU A;  2EFQ A;  1O7F A;  1G3W A;  1ZGJ A;  1T38 A;  5D5X B;  2M45 A;  4G6D A;  4MTE A;  2EJR A;  1HST A;  2FBK A;  2VOO A;  2QEN A;  4MQ9 F;  4U0V A;  3MEX A;  2XIG A;  2M87 A;  1MZB A;  1Z91 A;  2GIV A;  4P96 A;  3V7R A;  1MJA A;  3MWM A;  2HGC A;  2STT A;  2ZO4 A;  2G7U A;  5D6E A;  1TQM A;  1XB4 A;  3R0A A;  3BY6 A;  1P6R A;  1ZN2 A;  4RB2 C;  2EFN A;  5E1W A;  3PQJ A;  1B9M A;  5ED4 A;  2ELH A;  3S2W A;  3DKW A;  5ICG A;  1FYM A;  2UZK A;  4A2U A;  1EH6 A;  3CUQ A;  2E1N A;  2JPC A;  2RN7 A;  4HLY A;  4FX4 A;  4HDU A;  3QAH A;  4QWQ A;  3I4P A;  4KMF A;  2FMY A;  4EM2 A;  1R58 A;  5LLQ A;  2PMH A;  1RI7 A;  2C6Y A;  2XKO A;  1UFM A;  2DAO A;  1F1Z A;  1S7O A;  1JE8 A;  3NQO A;  1CGP A;  5JR3 A;  2EFP A;  4HLX A;  3QP6 A;  2FML A;  3VOE A;  2IA0 A;  2ETH A;  4NB5 A;  4L9T A;  5BMZ A;  1FP1 D;  2COM A;  4KDP A;  2R3S A;  1YS7 A;  3KZZ A;  1ZG3 A;  3TOA A;  4S05 A;  2K27 A;  4LG0 A;  2LF7 A;  5L3B A;  2FEZ A;  5DCM B;  3F6O A;  3QU3 A;  4AVP A;  3DFG A;  4LMY A;  3RYP A;  1R36 A;  2F2E A;  1SD7 A;  4QLC U;  1SD4 A;  2JT1 A;  4XSX F;  4N9H A;  3TO9 A;  2V1U A;  4EVI A;  4L0Y B;  3B73 A;  2A6E F;  2L01 A;  3HIF A;  3HSR A;  4HF0 A;  1Z6T A;  3CUQ C;  1XCV A;  2JPB A;  4ENK A;  4HW0 A;  4I01 A;  1MJB A;  4EJT A;  1IZ1 A;  1BJA A;  1S6L A;  5ILV A;  2FBH A;  5ILS A;  3FF5 A;  2O61 A;  3LQR A;  1R5H A;  4KT5 C;  5L3G A;  1IRG A;  5H6Q A;  1BI3 A;  1UHM A;  1F5T A;  4EGY A;  2IP2 A;  3P9I A;  2CG4 A;  2VBZ A;  2W85 A;  4YG2 F;  1B59 A;  3ZMT A;  3WE2 A;  1DDN A;  2OBP A;  4A6E A;  3H3Z A;  4ZH4 F;  1T39 A;  2NNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...