2K27A

Solution structure of human pax8 paired box domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
159
Chain Sequence
b'MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Paired box protein Pax-8
publication title The Solution Structure of DNA-free Pax-8 Paired Box Domain Accounts for Redox Regulation of Transcriptional Activity in the Pax Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 27
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A02
4CZZA 3COAC 3E5QA 2YSRA 1FSEA 3LQRA 3VODA 4F7ZA 5BPIA 3P9CA 1XN7A 1QGPA 3QRFF 4L9TA 4HQMA 3M9AA 2DPUA 2HDCA 5CVRA 2ADUA 1ZG1A 2A69F 1OPCA 3F8BA 3ELKA 3C18A 5ICGA 1S8NA 1SMTA 3E6DA 1J7KA 4LJZF 2QQBA 2G9WA 2VOPA 1ON1A 4JK1X 1YQAA 1DPUA 2A5YB 1U78A 5DUKA 4IRHA 1EH7A 2Z3YA 3LA7A 4LG0B 5A2QZ 4OIPF 2CQKA 1H9TA 2XAJA 4HZFA 1ZRDA 3DQVC 1TW2A 1MDMB 2ISZA 2FMYA 2PBIA 4ZYEA 4AIHA 1KQ8A 4LGWA 5FO5A 1R1TA 1E2XA 5FFZA 3I0TA 2H6CA 1O3SA 3FMQA 4AIJA 1QPMA 1S7OA 1G3SA 1BIBA 5L3DA 2W85A 5HOOA 4A2UA 4LLLA 1ONVA 2TDXA 3KEQA 1IZ1A 1LEAA 3FXRA 1BI3A 2OQRA 3LFKA 2ETHA 1R36A 2W84A 3HHGA 3CUQC 3I5UA 4U7DA 1V4RA 5H6RA 2LDUA 2LSOA 3RKYA 1BN5A 4CDGA 1DUXC 2CGPA 3GVAA 1R58A 3I54A 2A61A 2ACJA 1FYLA 3GFJA 2K27A 5K5OA 5E1WA 3V8LA 3LA3A 2V6CA 1ZAOA 4HX7A 1P6RA 1TLHB 4UVBA 1U5TB 3F8CA 5DDGA 3WTTC 2CO5A 4HQEA 4H0EA 2FE3A 2E7XA 4QLCU 5ERIA 2ZMEA 2A6EF 3GFLA 2LF7A 3IRRA 2HZTA 2Y48A 2Z99A 3DP7A 4HF1A 3IL2A 2H27A 2L54A 3ECHA 3I4PA 3W6JB 5ILVA 1IRGA 1IN6A 3GW2A 5A2QK 1J59A 3U9GA 1WRJA 2CW0F 5D5UB 1FYKA 1I5ZA 3MCZA 3ZN1A 4NHJA 1T6SA 2P6SA 1B9NA 1A04A 1UHMA 3K1NA 2E1CA 2MH9A 5LGTA 1I1SA 4NQWA 1I1GA 2CSOA 3CUQA 4P55A 4UXNA 4N9HA 2JPBA 1WWXA 3K1MA 3RYRA 3G3ZA 3KP6A 4ZYGA 3QP6A 4NB5A 3ZN0A 2Q2EA 2XRNA 2HOEA 4G7HF 2PMUA 4PDKA 1D3YA 3LAJA 5L3BA 4LMYA 4PGHA 3NEUA 5DCFA 2DT5A 2WC2A 2HKOA 5LHGA 5J8FA 3MFKA 3GYHX 5LBQA 1SFUA 1ODDA 2R7DA 2NAZA 1ZREA 1LB2A 2VBWA 4AIKA 4I0BA 1KGSA 1R5HA 3R0JA 1GXPA 1BJAA 3TOAA 5ILUA 2YU3A 3F21A 1XGOA 1JXSA 3GFIA 1HKQA 1MJBA 4WXCA 2IA1A 2QQAA 2R7FA 1FX7A 1K78B 2F5DA 2FMLA 4KMUX 5ICCA 4CGZA 2YX4A 4G6DA 3IRQA 2VXZA 1UCRA 1EH8A 1W4MA 3KP7A 2NRAC 2W57A 1UB9A 1BI0A 1J5YA 2FEZA 1O3QA 2EA2A 2FBIA 3HYIA 1ZRCA 2DTRA 4OINF 3T1BA 2O6GE 3GUDA 1GXQA 1QO0D 1T0FA 1RUNA 4KN4X 4KIGA 3RKXA 3WGIA 2X4HA 3IWZA 4HLXA 1MGTA 2FXAA 3SQNA 4M9ZA 4U0YA 3O3KA 1LNWA 4AWXB 1W5TA 4G7OF 2EK5A 4BQAA 2HTJA 5DD4A 2L4MA 4ZH4F 3BJ6A 4O6JA 4Q4ZF 3FWEA 2O3FA 3R61A 1P4WA 1TTYA 2ZNYA 2EFWA 3KCCA 3V7SA 3T5XA 3BWGA 2VC1A 3K9TA 3W6KB 2ESNA 4LB6B 2YX7A 2IRFG 2HEOA 4G8XA 1TQIA 4KUMA 2EFPA 3K69A 1HSJA 5J6XA 2QBYA 1FBUA 2XKPA 4HW0A 2IW5A 3ROUA 5CVIA 4KA4A 5HS8A 1SD7A 2K7LA 4B8XA 1KYWA 1Q1HA 3WODF 2MBFA 4G94A 4M74A 5DYMA 3QU6A 1YFHA 3WGHA 2VOOA 2KKOA 1FYMA 4IJAA 3RPUA 4EJOA 5KK1A 2DU9A 4BH9A 2WV0A 2UXXA 4UUVA 1Z9CA 5FD5A 1P4XA 1S29A 2FRHA 1HKSA 4G7ZF 2EFNA 5AONA 4Z2YA 4L0ZB 1USTA 1I27A 3I59A 3PFIA 4GO1A 2D1VA 3HOTA 2KJBA 1OYIA 3P7NA 3BJOA 3TO6A 2DAOA 5FB2A 4R79A 5LGNA 1ZGJA 4KN7X 3CO7C 2ZMEB 5LHHA 4HX4A 1RUOA 4BNCA 3M7GA 4BHCA 4WK8F 2J5OA 3FHZA 4ETSA 2IPQX 5JVTA 5D8LB 4OMZA 5DEQA 3WTZA 4XRFA 2XUBA 1XSVA 2NNYA 5ICEA 4LFUA 5FGMA 3WTXC 3F23A 1XB4A 4Y17A 2UZKA 1QZZA 1FY7A 4L0YB 3L09A 3RJPA 5K5RA 1ULYA 2F5CA 4EJVA 1Z1DA 3QPHA 3FXUA 3RKWA 1IN4A 1G3YA 3VOEA 5LHIA 1P4AA 2A3SA 2D45A 4M6YA 1TBXA 5IT9Z 3R0AA 1XDUA 2K4BA 4LK1F 1IF1A 1U6GA 1FP2A 4UHTA 5E8GA 2DK8A 3J81Z 1RI7A 4RB1A 4KYWA 2FU4A 4IPAA 2LNBA 2NNNA 3IKVA 3HOSA 4IRIA 2HGCA 1FNNA 2GA1A 3QOPA 2Q0OA 2W25A 5HS7A 3HSEA 2MLGA 3JTHA 3KLNA 4KT5C 1R23A 4P9FA 1I6XA 5E20A 3ULQB 2GWRA 2RDPA 2O0YA 4AVPA 5F6FA 5H20A 3JAMZ 3F8FA 2HQRA 2DBBA 1YLFA 2F2EA 2EWNA 5TRDA 4IHTA 3E5UA 3FX3A 3V8KA 1J9IA 1WQ2A 4ENNA 2H6BA 3IKTA 5HDNA 4WXDA 2K02A 4U0VA 1TNTA 4IF4A 1G3TA 1KQ9A 5D6FA 4GGGA 5BMZA 4A12A 2F5EA 1QNTA 2GAUA 5F64A 4MEYF 1MZBA 4G9YA 4RB3C 4KIFA 1WKMA 1G4DA 3ECOA 4WWCA 2VT3A 1XSDA 3FM3A 3MZYA 1HBXG 3MEXA 2E1NA 3WE3A 1B6AA 1S3JA 4TV7A 1SAXA 2V1UA 3JSPA 1T38A 2ZJ2A 3WTYC 2PEXA 3TKYA 3KP3A 4OIOF 2HKXA 3ABTA 2HYGD 2XV4S 4RAYA 5IT9K 1SMYF 3KP4A 2PG4A 4IHSA 4BYYA 1AWCA 2A07F 1OMIA 1JE8A 5HDGA 3J81K 3H92A 1QBJA 2W24A 2RV8A 2X0LA 2WWYA 2L01A 4LB5A 3BOQA 3D5LA 1R22A 2R3SA 1O7LA 4HX8A 2QBYB 4KNYA 2DFIA 4XLPF 4G6QA 2MA3A 2V1XA 4EGYA 3J80Z 4ON0A 2EV0A 4EM0B 1R1VA 4ESFA 3JAMK 4RGXA 4EM1A 4GYIA 4KMFA 4HDVA 3T0YA 4R8HA 4OIRF 1G3WA 1SD5A 2QYOA 4OU0A 3I58A 4MEXF 3F8MA 1IXCA 4MQVA 5CVUA 4IVNA 4WCGA 2BGCA 4YFNF 1MKMA 1D8JA 5E8IA 3V8JA 3WTWC 1F5TA 2CFXA 3FXQA 4RGRA 5HLIA 4GYGA 5EEHA 2P4WA 1EV7A 4A5NA 1REPC 2D1HA 3RPQA 1ZLJA 3GO5A 1IN8A 5FFXA 1FZPB 4MHGA 4K2EA 1FWZA 5AIPA 1HXDA 2IJLA 5FLXZ 2VN2A 5CVJA 5IT3A 2XAFA 1E17A 3JSOA 1HQCA 4EGZA 1ZH5A 2EA4A 3G73A 4YIIA 3L2CA 1RZ4A 1XGSA 4JBAA 1LQ1A 5E1ZB 1CF7B 2XAGA 3RIRA 3V4GA 1L0OC 5HDKA 3R4KA 1XMAA 1ZARA 3DKWA 1OYWA 5J8CA 1ZG3A 2OAZA 2EJRA 4HYEA 1S6LA 4M9XA 2CG4A 5K1YA 3E6BA 2HWVA 3F6VA 4DQ2A 1LDJA 2ZCWA 4GCVA 5D5VB 1Z6RA 3C3WA 3DF8A 3TO9A 1IAWA 2QENA 1KU2A 1ZHFA 4I98B 2STTA 3SZTA 4KDPA 2KIMA 3J80K 2JZYA 4LK0F 1YIOA 3SFZA 2NS0A 1F1ZA 5JI6A 3EYIA 3HRTA 2D2WA 2M87A 4S05A 3ML6A 1YTYA 3HRSA 3EUHA 4HV5A 3QAHA 3DPLC 4RAZA 3RI4A 2EV6A 3WG9A 2MH2A 1UHWA 2JRTA 1NHAA 1KYZA 2QLZA 2JTVA 5L3FA 4Q47A 2K4JA 2XHKA 1X3UA 1FT9A 1U5TC 1S7AA 3C1DA 1U8RA 4LD5A 2VBXA 4ZZDA 2OZUA 1BBYA 2HYFA 3GX4X 2ZFWA 5E1XA 2O03A 3FMSA 2DPDA 4XLNF 2RN7A 3B73A 2LKPA 4DNCA 1BC8C 2G7HA 3T8RA 3WU1B 3HRUA 1RNLA 1XSXA 1MDMA 2VT2A 1LJ9A 2O61A 2ZO4A 4EMSA 5FLXK 3BJAA 4A0ZA 2Z9OA 3TGNA 2VONA 3AAFA 5TJJA 1G6NA 4BAYA 1LVAA 4LLNA 4IRGA 4LLGF 1U2WA 4I01A 2Y75A 2VBYA 4UVAA 4OOIA 3WGGA 3KE2A 1XD7A 5E18F 5BQTA 4M72A 1EH6A 3M1EA 3J7AO 3R6SA 5AIQA 2MD5A 1C0WA 3WTUC 2GXGA 3IWFA 4QWQA 2Z33A 1J75A 2YPRA 1D5VA 1YW8A 3HIFA 2WTEA 1YG2A 2FNAA 1YYVA 2QZ8A 3EQLF 3SXYA 5L3CA 2F5FA 2PQ8A 5D6EA 4I0AA 3ABUA 3GZ6A 2Y0MA 4OIQF 1LDDA 5D4SA 4ENJA 2CWEA 2ESHA 2EFQA 2DQLA 1GHCA 3KETA 2XAHA 2L02A 1ZYRF 4HF2A 1IN7A 3WU0A 1JHHA 2K86A 3M8FA 4D0PA 4IXAA 1BI1A 2GZWA 2IA2A 1H9GA 1BC7C 1WSUA 2OQGA 2OZ6A 3HSFA 1KU7A 3BP8A 4KFCA 1UFMA 4XSZF 4A6EA 2RQPA 2L3DA 5BS6A 4FT8A 3GWZA 2FBKA 2FA5A 2EFOA 2ZXJA 1Y0UA 1USSA 3U1DA 3QP5A 4CXFA 5KVRA 4N0BA 5ED4A 3ZP5A 3HSRA 1FC3A 3L7WA 4L5IA 3ZMUA 4HF0A 4L9VA 1U3EM 4HA8A 1T39A 5ILSA 3CJNA 3V7RA 1O7FA 1SD6A 3DV8A 3L9FA 1XCVA 3CUQB 1YO5C 3LSTA 3DPTA 4ZYHA 1O3RA 4E70A 1TW3A 4MTDA 1GVJA 2O8XA 1T2KA 1F4KA 3BPVA 3IC7A 1FLIA 2PI0A 2AXLA 3CUOA 4MGRA 4PCQA 2DLLA 2VC0A 4I09A 3TO7A 2Z5UA 3JTGA 2DK5A 4M73A 2BBYA 3GLXA 4WXHA 1YW7A 4I02A 1DP7P 3KP2A 4ZZLA 5D5WB 5D8KB 4CYDA 1K79A 2OBPA 4HV6A 1Z05A 1AOYA 4FHTA 2G7UA 1P2FA 1DDNA 1O57A 1B1BA 2DI3A 2M1BA 4A0YA 5DD8A 1W5SA 2IP2A 4KICA 3TDZC 1JGSA 1FOKA 3REOA 2RNJA 2JSCA 3SHFA 2PFBA 2HQNA 5HS9A 2V1DA 2XIGA 3U2RA 2J5PA 3FM5A 2B0LA 4HOBA 1TNSA 3E6MA 3MWMA 4B09A 3K0LA 5CYVA 5CJ9A 2FF4A 1R7JA 1B9MA 1FPQA 3JW4A 4S04A 2OA4A 5D5XB 3E97A 2QM3A 3MZHA 2DW4A 4EQQA 2LF8A 2P5VA 3P9IA 5D4RA 3C7JA 3L00A 2EB7A 3ZMTA 5HLHA 3OOPA 3F8NA 2VE9A 2KIUA 3KLOA 1HW1A 3Q9SA 4WF2A 2XASA 1ZG5A 2EV5A 5EEGA 1OKRA 3TOBA 2BV6A 1IN5A 3FMRA 3WTVC 3EYYA 2UXNA 2FSWA 2MC3A 3CDHA 3P9KA 2V9VA 1PP8F 1FBQA 4M9SA 2RC4A 2VODA 3R60A 1MD0A 2MLKA 5K5QA 5HLGA 5E17F 4ENMA 4P5OA 5DUIA 3I64A 4ZYDA 2HS5A 3KFWX 2M5WA 1KA8A 4MNUA 2FBHA 1W7PA 2ELHA 4CHUA 1LEBA 2P6TA 3KEOA 1BI2A 1JHFA 3BPXA 4ASNA 4U0WA 1IXRC 4EVIA 2HR3A 3LAPA 2PJPA 5JHUA 4L9JA 3F22A 2CYYA 2PN6A 3I59B 4L9NA 3GF2A 3GEZA 2KIFA 1XGNA 2GQQA 1Z6TA 2QVOA 5BPDA 1MJ9A 1HW2A 3PQKA 2A6HF 5L3GA 3DFGA 4RB0A 2IVMA 4FX4A 4YFXF 3DEUA 5L3EA 1YW9A 1SFXA 3E3VA 4ESJA 4MQ9F 4WX9A 3H3UA 4BHBA 1O3TA 1XMKA 5CVVA 2OU2A 1YS7A 3K1PA 5LEKA 5DCMA 2ZBKA 2H09A 2XVCA 4UVCA 3N97A 4CO8A 4L18B 2M8EA 4EJTA 3Q5FA 2IA0A 3B02A 2GIVA 1KU9A 2V79A 2COMA 3KZYA 2DQRA 2E7WA 3Q9VA 5HVQC 3BZ6A 3GXOA 3TQNA 3CO6C 3WTSC 1J2XA 4P9UA 1TQPA 2A68F 1SFEA 2QQ9A 5ICFA 4UV8A 4EJWA 2BE5F 3EDPA 1WI9A 2P7VB 4RB2C 3PQJA 2AS5F 1L3LA 3HTUA 3RDIA 4MTEA 3VB2A 3IHUA 4BXUA 1FBSA 2PMHA 1H0MA 1VTNC 3S2WA 4AD9A 2XROA 4XSXF 3H3ZA 4R1HA 4BHPA 3VEPA 1IW7F 3V7CA 2RGVA 1TQMA 3VFZA 1QZYA 2ISYA 3ZQ7A 1RIOH 6PAXA 1IXSB 1HSTA 2KJCA 4LG0A 3CTAA 3ZMVA 3F72A 1T98A 2JPCA 2XKOA 3T8TA 2QWWA 5JR3A 4HBLA 3LWFA 2M30A 1F9NA 1QQIA 2RVCA 3KP5A 1LDKB 3CLOA 5FD6A 4RGUA 3TDUC 5H6QA 3KZZA 2VE8A 4P96A 1XDSA 1B59A 2GA2A 4YFKF 3I53A 1MJAA 3DXJF 2GXBA 4FX0A 1Z7UA 2XGXA 4YG2F 3LQQA 1D8KA 5LGUA 5JFRA 2P5KA 4L5JA 3RTRA 2P5LC 3ZMDA 1R00A 1YS6A 1BOAA 2P8TA 2XAQA 2HFHA 5CLSA 4GXOA 4O5VA 3N4MA 4M6XA 4HAMA 4KIBA 3ZMSA 3ISPA 4JQFA 4EJUA 3E5XA 5F1RA 2KRFA 3HHHA 2OD5A 3QPTA 4A6DA 2STWA 3D0SA 1U5TA 1V3FA 2Q8KA 2FNPA 4PGGA 4A0XA 1KU3A 4PZJA 1ZRFA 1XCBA 3K2ZA 4HLYA 2M45A 1Z91A 4Q5SF 3GFMA 3I71A 1FSHA 3E6CC 1FP1D 2C6YA 3FF5A 4ENKA 1CGPA 4EM2A 1W7PB 3RYPA 5LLQA 2FQ3A 3MAJA 1ZGAA 1KQ0A 4M71A 1P92A 4A5MA 4UNOA 1B4AA 5LEJA 1R5GA 3NQOA 1STZA 2VBZA 3NRVA 1J0RA 3SZPA 1HW5A 5LRSA 4N9IA 4RS8A 3BROA 4XBFA 1K6OA 1OYYA 3OV8A 3BDDA 4CICA 3WE2A 2DO7A 4I7HA 1HKTA 1PUEE 5DV5A 3M8EA 3FZVA 1IRFA 1BM9A 3ZMZA 4Q48A 4OMYA 2NYXA 3BY6A 3MQ0A 2RKHA 2YR2A 5DCMB 4UV9A 4U88A 4RGSA 3GZ5A 1OR7A 1ON2A 2BYVE 4U7BA 1CF7A 3O2PE 2QUFA 1R1UA 3LA2A 3QU3A 4HDUA 1DPRA 2L4AA 4EV0A 5BOXA 1ZN2A 3O6BB 3ZPLA 3EETA 2BEOA 1W7PD 4Y15A 2JT1A 2ZKZA 1PDNC 2P7CB 4I2OA 3ERED 4O3MA 2HTSA 1PP7U 1BIAA 5LRRA 3F3XA 4Y13A 1ZLKA 2PLYA 3HRMA 1SD4A 1XGMA 2FOKA 2H94A 2ZNZA 4YIFA 2UWMA 2IT0A 3HUGA 3F6OA 1K7AA 3HTSB 1IUYA 1K78A 4ESBA
chains in the Genus database with same CATH superfamily
5IOYA 4CZZA 3COAC 3I4NJ 2O9LA 2LRDA 1LVKA 3E5QA 2YSRA 1FSEA 2Z1DA 3LQRA 3VODA 4F7ZA 1SVMA 4E7KA 5BPIA 2XB5A 3P9CA 1XN7A 1QGPA 2L9VA 4XLHA 3QRFF 4L9TA 4HQMA 2R7UA 1QVUA 3M9AA 2DPUA 2ELKA 2HDCA 3W2VA 5CVRA 2ADUA 4M3DA 1ZG1A 1APLC 2A69F 2E2JJ 1OPCA 3CF2A 3F8BA 3FXMA 2LFBA 3C18A 3ELKA 5ICGA 2XB0X 1S8NA 1SMTA 4A3FJ 3E6DA 2L7ZA 1J7KA 4LJZF 2QQBA 1GLNA 5IY5H 2G9WA 2NOJB 2R7VA 2VOPA 1VQPI 3DU5A 1ON1A 4JK1X 1YQAA 1A35A 5H2FC 3CC2I 1DPUA 2M9HA 2A5YB 1U78A 5DUKA 4IRHA 2EPFA 2ECCA 1EH7A 3FBNB 1Y8RB 2Z3YA 4E7LA 3LA7A 3KYLA 3GTMJ 2IBDA 1B72B 4LG0B 5A2QZ 3HDDA 5HNHA 4OIPF 2CQKA 2DOFA 1H9TA 3TMOA 3ABMH 5GPAA 1D1BA 4E7HA 2XAJA 3GZNB 3C2HA 4HZFA 1ZRDA 3DQVC 2A6TA 3G71I 1TW2A 1MDMB 3K4NA 4J19A 2ISZA 2FMYA 2WY7Q 2PBIA 2E1OA 4ZYEA 1IO2A 4AIHA 2E60A 1KQ8A 2E1MC 4LGWA 5FO5A 5KNLA 2E19A 1H89C 1ITYA 1R1TA 1E2XA 4FE7A 5FFZA 1YJ9I 2GOXB 3I0TA 2H6CA 2VI6A 1O3SA 1FJLA 3FKJA 3FMQA 4C3HJ 4AIJA 3ZQGA 1QPMA 4BE2A 1S7OA 1G3SA 3RKQA 3OYAA 1S7EA 1BIBA 4DIQA 5L3DA 2W85A 2MABA 4A2UA 5GAEJ 4LLLA 1ONVA 4JP0A 5HOOA 2TDXA 3DLAA 3KEQA 1IZ1A 4OAYA 1LEAA 2B7EA 3FXRA 4RA2A 1BI3A 2QKMB 5IP6A 2M2EA 2OQRA 3LFKA 2ETHA 2N8GA 3BG7A 1R36A 1BW5A 2W84A 3HHGA 1SVLA 3CUQC 2X6OA 1K6YA 3I5UA 2HNHA 2TRTA 4E7SA 2NS8A 4XLCA 4U7DA 1V4RA 2LREA 5H6RA 3OSFA 2LDUA 2LSOA 2Y0SA 3RKYA 1BN5A 4CDGA 1DUXC 2CGPA 3GVAA 1R58A 3I54A 2A61A 2ACJA 2QF7A 4N4NB 1FYLA 5GADJ 3GFJA 2ZSIB 2K27A 5K5OA 1MNEA 5E1WA 2CQXA 4I99C 3V8LA 3LA3A 2V6CA 4PSWA 5J1YA 1ZAOA 4HX7A 2NVUB 2DODA 1P6RA 2FJ1A 1TLHB 3H5AA 1XPXA 4XKWA 3K70D 3HC7A 4UVBA 1U5TB 1BR1A 3F8CA 4CSWA 5DDGA 2KDOA 1DQUA 1WH7A 3PFYA 4UUTA 4C30A 3WTTC 2CO5A 3I3LA 3LSGA 2HYJA 3LOCA 4H0EA 4HQEA 1Y0NA 1I50J 1R5ID 3OWTA 1HCRA 2FE3A 1W36C 2DA1A 2E7XA 4QLCU 5ERIA 5EYRA 2ZMEA 4BEHB 2A6EF 4IHXA 1TC3C 3GFLA 2LF7A 1HDPA 2CW8A 4PFOA 1ENHA 2HZTA 3IRRA 2Y48A 2Z99A 3DP7A 2ZXHA 5J47A 1K4TA 3VPRA 3H9GA 2LR8A 2VQHA 2V4JC 1ETWA 1MBKA 2M4KA 3ZR8X 2IS2A 4HF1A 2WB1N 1M1EB 3FXJA 5EZHA 2DOEA 3IL2A 2NVXJ 2H27A 2L54A 3ECHA 4BY7J 3BCBA 3EUHC 2HI3A 3I4PA 5C44J 3W6JB 5ILVA 4E7IA 1G59A 1IRGA 1IN6A 3GW2A 1LPQA 3OY9A 5A2QK 1J59A 3U9GA 4IKFA 1WRJA 2GIZA 2MYSA 1YOVB 2WA0A 1ZK8A 2CW0F 3AG2H 5D5UB 4FQGA 1FYKA 3BR5A 1I5ZA 3MCZA 3ZN1A 2AXTC 1T6SA 2P6SA 4NHJA 3DEWA 2XRLA 1B9NA 3VSKA 2ECBA 1A04A 3SYTA 5LD2C 4MO7A 2DN0A 2XC7A 1UHMA 3K1NA 2E1CA 3S93A 2MH9A 1MMGA 1XX5A 2EIJH 5LGTA 1I1SA 1UELB 1FOWA 4NQWA 3Q3SA 1I1GA 1I39A 1U0JA 2CSOA 4PFPA 2HXIA 3CUQA 4P55A 3QYFA 4UXNA 4N9HA 2JPBA 1WWXA 1S72I 2BXYA 2X1EA 3K1MA 3RYRA 3G3ZA 4DYQA 3KP6A 3RCOA 3QP6A 4NB5A 3ZN0A 4D7NA 4ZYGA 2Q2EA 3K70C 2XRNA 4HNTA 2ZXIA 3H0DA 2HOEA 4G7HF 2PMUA 4NUBA 2BY3A 4PDKA 1D3YA 3LAJA 4GDFA 5L3BA 3S16J 4LMYA 4PGHA 4A3IJ 2XSDC 2X48A 3MZ8A 3X2QH 1MNDA 3NEUA 2PJRB 3S17J 4G6TB 1D0XA 4XNFA 5DCFA 3HL2A 2AHQA 2DT5A 2WC2A 2HKOA 3SDBA 2KZVA 5J4YA 5LHGA 5J8FA 3MFKA 2JA5J 3WU2C 1FIAA 4B3AA 3HGYA 1VNDA 4AC0A 1X1AA 5JLWA 3GTJJ 2X6WA 3BC8A 3GYHX 5LBQA 1SFUA 3LMMA 1ODDA 2ZSHB 2R7DA 2NAZA 1ZREA 3S3NA 2XAUA 5FKNA 2K3PA 4GFBA 4OAZA 1LB2A 1BOBA 1BW6A 3AG3H 2VBWA 4AIKA 4I0BA 3I4MJ 1KGSA 1R5HA 3R0JA 1GXPA 1BJAA 3PNTA 3TOAA 1RKWA 2CRGA 1SAUA 3IH3A 5ILUA 4FISA 2YU3A 3F21A 4IZZA 2LMDA 1TZLA 3OYDA 1XGOA 2EIKH 3J7ZI 5FLMJ 1JXSA 2AQEA 3HUGB 2HU9A 3GFIA 1WJAA 1HKQA 1JKPC 2LY1A 4BXXJ 3BTIA 3ABKH 1VQ4I 1MJBA 4WXCA 2IA1A 2QQAA 4XR6A 2R7FA 1FX7A 1K78B 2F5DA 2FMLA 2LTPA 4KMUX 5ICCA 4CGZA 2YX4A 4G6DA 3IRQA 2VXZA 3AG4H 1UCRA 1EH8A 3CCLI 1ZGWA 3S1NJ 1W4MA 3KP7A 2Y9YA 4BQOA 3CDIA 3DCFA 5F0CA 5KHDA 2FQ4A 2NRAC 3PIPF 2W57A 3D1NI 2LP0A 2QSFX 4M3EA 3K4MA 1UB9A 2AO9A 4C9YA 1BI0A 2E71A 3OS2A 2DT7B 5CQEA 1J5YA 2FEZA 3HKZN 5M5WJ 1SC7A 1IUFA 1O3QA 2EA2A 1AU7A 2FBIA 3HYIA 1ZRCA 2DTRA 4OINF 3T1BA 2O5RA 4D1QA 5GAGJ 3LSPA 2O6GE 3CCUI 2QSGX 3GUDA 1GXQA 1QO0D 1T0FA 2O7OA 2VJJA 4YIRX 1RUNA 4KN4X 2HOSA 2HZDA 4KIGA 3RKXA 1MMSA 3WGIA 2X4HA 3IWZA 5E79C 4HLXA 3ERMA 3E1SA 4ITVA 1WZ2A 1QZEA 3OIPA 1MGTA 2FXAA 4HPQA 3BQZA 2P81A 3SQNA 4M9ZA 4U0YA 4B1RA 2OCEA 1RKTA 1U9OA 3ZQCA 2FOWA 3O3KA 1LNWA 3HJEA 3P5JA 3MD2A 4AWXB 1W5TA 4G7OF 1HOMA 2EK5A 4BQAA 5M3MJ 1W5CC 2HTJA 3MKLA 3I56I 1IGNA 5DD4A 2L4MA 4ZH4F 3BJ6A 4O6JA 4Q4ZF 3FWEA 1XMXA 2QA4I 2O3FA 1LFPA 3R61A 1P4WA 2OF7A 2JA8J 1TTYA 2ZNYA 1MBGA 3KCCA 2EFWA 3V7SA 1X1PA 2F5VA 1MMNA 4AUXA 4ZTJA 3T5XA 2DMPA 3BWGA 2VC1A 3K9TA 4W1UA 2LKXA 1R49A 3G6EI 3W6KB 2ESNA 2UUZA 2DMTA 2WBMA 2DA6A 4LB6B 2YX7A 3MKYB 1PUFA 1WPKA 2IRFG 2HEOA 4G8XA 3S14J 1YE9A 1TQIA 4KUMA 1V55H 2EFPA 5EEAA 2VQGA 3K69A 1HSJA 2EINH 1BR2A 3OR1C 5J6XA 2QBYA 1FBUA 2XKPA 4HW0A 4XKBA 2IW5A 3ROUA 5CVIA 2DJIA 4KA4A 5HS8A 1SD7A 2K7LA 1T33A 4B8XA 1KYWA 2EZKA 1Q1HA 5KCMA 3WODF 2VASA 2MBFA 2IGNA 3A0HC 4G94A 3DEEA 3MVPA 3D5RC 3BZCA 3CC7I 4M74A 5K7ZA 2W48A 5DYMA 3QU6A 5TISC 3G4SI 2VQCA 4X1EA 1YFHA 1NG6A 3WGHA 3LSJA 2VOOA 2KKOA 3KEYA 1FYMA 3BR2A 4IJAA 3RPUA 4EJOA 1YJNI 5KK1A 2DU9A 1P7IA 3L2WA 1YX3A 1JGGA 2O8KA 4BH9A 2NOGA 3QYBA 2WV0A 2UXXA 4UUVA 1Z9CA 4PSXA 2WAFA 5FD5A 1P4XA 1S29A 3IP4B 3S2HJ 2FRHA 1HKSA 3JRAA 3JCUC 1SANA 4G7ZF 3ZQHA 2EFNA 1FOXA 4N4OB 5FRMA 5AONA 4Z2YA 4L0ZB 2ZJQF 1USTA 1I27A 1DU6A 1Z77A 2TCTA 5FROA 2LH9A 3I59A 3PFIA 1F36A 2F48A 3TBIA 4GO1A 3L1PA 1RR7A 3HPGA 2D1VA 3HOTA 2BHZA 2KJBA 3IH4A 1OYIA 1E3HA 3LSMA 3BJOA 3P7NA 3TO6A 4HSRA 2DAOA 5FB2A 4R79A 5LGNA 1ZGJA 4KN7X 4DBQA 3CO7C 2ZMEB 4F92B 5LHHA 3D5SC 4HX4A 2DYSH 4XKVA 1RUOA 2ZC2A 4BNCA 3M7GA 1WVRA 4BHCA 4WK8F 1LFBA 2J5OA 3FHZA 4DYRA 5EF6A 4ETSA 2IPQX 3MN2A 1I3AA 5JVTA 4QSHA 5D8LB 4OMZA 1K4SA 5DEQA 3WTZA 2BZTA 4XRFA 3AL0B 2XUBA 2R93J 2VIXA 4PJLA 5J40A 4W97A 1XSVA 2NNYA 3H9QA 5ICEA 1Z7LA 5FKOA 3CCRI 4LFUA 5FGMA 3WTXC 3F23A 1XB4A 4Y17A 1YI2I 2HXOA 2UZKA 1QZZA 1FY7A 4L0YB 3L09A 1JTXA 1WH5A 3RJPA 5K5RA 5EZGA 1ULYA 2F5CA 4EJVA 1Z1DA 3QPHA 1HLVA 5B5EC 1MMAA 2EZLA 3FXUA 1ZR2A 4JYKA 3RKWA 1N25A 1IN4A 1JKOC 4L5EA 2CQNA 3B6CA 3CMMA 3QOEA 2CV2A 1G3YA 3VOEA 5LHIA 1P4AA 2Y30A 2A3SA 2D45A 4M6YA 4X0GA 1TBXA 5IT9Z 1OCOH 2KL4A 1FTTA 2VKVA 3R0AA 4NQWB 1XDUA 2K4BA 2HVQA 4LK1F 1POGA 2K3FA 5BNGA 4KT6A 3JRHA 3MKWB 1IF1A 2E36A 1U6GA 1FP2A 4UHTA 5E8GA 2DK8A 3J81Z 1RI7A 1FOYA 4RB1A 1ETVA 4CCNA 4KYWA 2V1NA 2FU4A 1RESA 2Q2EB 3GLLA 1NK3P 2DA5A 4IPAA 3NAUA 2LNBA 2NNNA 3IKVA 3CP8A 3HOSA 1JT0A 2KRCA 1LE8A 3K7AJ 1OJLA 2R7SA 3BQYA 4IRIA 2HGCA 1FNNA 2GA1A 4PK4A 3QOPA 3S1MJ 3QPSA 2WAQA 3PM1A 2R4GA 4A69C 2Q0OA 2W25A 1UG2A 5HS7A 3HSEA 1UZCA 2L9RA 2MLGA 3OMYA 3JTHA 2F4IA 1D1CA 3KLNA 4KT5C 2LG4A 3FISA 2M3AA 1R23A 4P9FA 3BG9A 1X1CA 1I6XA 5E20A 4RAFA 1GV2A 4AM3A 3ULQB 3H3VK 3DBLB 3L2VA 1X2NA 2GWRA 2RDPA 4J01A 2O0YA 3DWLE 4AVPA 2P0WA 2X6YA 5F6FA 5H20A 3CD6I 3JAMZ 1ZR4A 3F8FA 2HQRA 2DBBA 1YLFA 2F2EA 2EWNA 5TRDA 4IHTA 2HOTA 5GPCA 3E5UA 3FX3A 3V8KA 5F0HA 1J9IA 2NVTJ 4ZTFA 1WQ2A 3OYMA 4ENNA 3OYCA 2H6BA 3IKTA 4AYBN 4RBOA 5HDNA 4BDZA 3PO2J 4WXDA 3OYBA 2K02A 4U0VA 1TNTA 2OJED 4IF4A 1G3TA 1KQ9A 5D6FA 3O8HA 4P1WA 4I6ZA 1TWHJ 2KLOA 4A3EJ 2IGKA 3A01B 4GGGA 2OV7A 5BMZA 3LNQA 2LD5A 4A12A 3QQAA 3K2AA 2F5EA 2Q1ZB 1QNTA 2GAUA 5DM6F 2HOAA 4A3CJ 5F64A 4MEYF 1MZBA 4G9YA 4RB3C 4KIFA 1WKMA 1ZQ3P 1G4DA 3ECOA 3PL8A 3IV5A 1OCRH 4WWCA 4YELA 2VT3A 1XSDA 1NK2P 4D5CA 1Y1VJ 3KX2A 3FM3A 5J1UA 3M4OJ 3MZYA 1WFXA 1HBXG 3MEXA 2E1NA 4CYCA 3WE3A 3TL4X 4C2UA 4HG2A 2CQQA 4V2FA 1OCCH 2K9NA 2CUFA 1B6AA 2K85A 1A6QA 1S3JA 1VF9A 4TV7A 1SAXA 2V1UA 3PSIA 2XGDA 2JA7J 2VL8A 2GOMA 3F9KA 4EATA 1MSEC 1N78A 2DDAA 2JMWA 3JSPA 1ETYA 4XLAA 1T38A 2ZJ2A 1VQLI 3WTYC 1Y6IA 2PEXA 3S3OA 1WJ5A 3TKYA 3KP3A 5B66C 4C3IJ 1X4PA 2DA3A 3ASOH 4OIOF 3H35A 2HKXA 3ABTA 5DM7F 4OWRB 2HYGD 2XV4S 4RAYA 2R5YA 3LL7A 1TWGJ 5IT9K 4BJ5C 1SMYF 2EILH 4XMYA 3KP4A 2PG4A 4IHSA 4BYYA 1AWCA 5C3EJ 2A07F 1OMIA 1OCPA 4NC7A 1SFOJ 5CKTA 1JE8A 5HDGA 3J81K 3H92A 1QBJA 2W24A 1V5GA 4Y33A 1XTAA 4RLQA 2M7AA 2RV8A 5DS9A 2M0CA 4XOPA 1PUFB 2X0LA 2WWYA 2L01A 5FKMA 4LB5A 3BOQA 3D5LA 2KDZA 2KIQA 3IAS2 3Q0VA 4ZYAA 1VI0A 1EF4A 1R22A 2R3SA 1O7LA 2V26A 4HX8A 2QBYB 4KNYA 1ZTRA 2DFIA 4XLPF 4CA0A 4Z6YA 4G6QA 2IGOA 2MA3A 2V1XA 2H8WA 3MKZA 4EGYA 2BW3A 3DTIA 3J80Z 4B44A 3HOUJ 3OS0A 4ON0A 4BS9A 2EV0A 2EH3A 4JX5A 3HPHA 4EM0B 1R1VA 4FE4A 4ESFA 3ESWB 3JAMK 3OYNA 4RGXA 4EM1A 3CMYA 3VYTB 1MH4A 4GYIA 4KMFA 4HDVA 3T0YA 4R8HA 2XPVA 1G3WA 4OIRF 1XS9A 5F08A 3HGGA 1FTZA 1SD5A 2QYOA 4OU0A 3I58A 4MEXF 3F8MA 4HNUA 3OSGA 1IXCA 4MQVA 5IP9J 1D0YA 4EEFG 5CVUA 4IVNA 4WCGA 2BGCA 4YFNF 3IAM2 1MKMA 1VQ6I 1D8JA 4MFEA 5E8IA 2VJ4A 3V8JA 5EGOA 3WTWC 2BHYA 4RDUA 1R4NB 2H8RA 2JN6A 1MBFA 4ANJA 1F5TA 1P7JA 2CFXA 3FXQA 5FKKA 1UMQA 5K7HA 1WCMJ 4RGRA 5HLIA 1MNMC 4GYGA 4D7MA 3UKGA 2OCCH 2VJ5A 3FXOA 3CLQA 5EEHA 2P4WA 1EV7A 4A5NA 1REPC 2D1HA 3RPQA 2R7TA 2MC4A 1ZLJA 3GO5A 1VQNI 5E3MA 1IN8A 5FFXA 1FZPB 1QHHD 4MHGA 4K2EA 1FWZA 1VQ8I 5AIPA 4UB6C 1HXDA 2IJLA 1JJ6C 5FLXZ 3L2QA 2GXAA 2VN2A 3OL4A 3DTEA 5CVJA 5IT3A 2XAFA 3CP2A 1E17A 1TWAJ 1YX5A 3JSOA 3G1OA 3J7AY 1HQCA 1R71A 2QCOA 4EGZA 2K9LA 4BKXA 1ZH5A 2EA4A 2HPMA 3G73A 4YIIA 1UHSA 3L2CA 1N75A 1RZ4A 1XGSA 2X51A 3H1CA 4JBAA 4AIDA 5E1ZB 4BQQA 1YJWI 1LQ1A 4XQFA 4HEA2 4QPQA 2CH0A 1CF7B 2VLAA 2VKHA 2XAGA 3JRDA 3GTOJ 4NC8A 2H1LA 3RIRA 3V4GA 4XLEA 1L0OC 1OQYA 3R4KA 5HDKA 1XMAA 1ZARA 4XIDA 3DKWA 1KZHA 3PUFA 1OYWA 5J8CA 1ZG3A 2CFOA 2OAZA 2ZFUA 2EJRA 5K7FA 4HYEA 1S6LA 4UB8C 4M9XA 2CG4A 3CDLA 5K1YA 2WY8Q 3E6BA 2HWVA 3F6VA 5J3LA 4DQ2A 1EA3A 1LDJA 2ZCWA 3HOYJ 4GCVA 3WG7H 4CUGA 2W1OA 1QA6A 5D5VB 1X3ZB 1ZELA 1Z6RA 4BXFA 3C3WA 3DF8A 3TO9A 1JJ8C 1IAWA 1B8IA 3JRIA 2QENA 1KU2A 1ZHFA 4I98B 2JUGA 3SZTA 2STTA 4KDPA 2KIMA 4DZJA 3J80K 2JZYA 4LK0F 3ZQQA 1YIOA 3SFZA 2NS0A 1VQ7I 1F1ZA 4F3QA 3PIOF 3DKXA 5B1AH 2RREA 5JI6A 3C2GA 3EYIA 3HRTA 2D2WA 3BR3A 2M87A 4S05A 3ML6A 1YTYA 2X9DA 3HRSA 3EUHA 3S2DJ 3CQZJ 4CCJA 4HV5A 3QAHA 3U1KA 4DZPA 2E2IJ 2KHMA 3BCAA 1T95A 3DPLC 4RAZA 3RI4A 4C2MJ 1S9HA 2EV6A 3WG9A 2X85A 2MH2A 1UHWA 4ABZA 3SEZA 4LIUA 2JRTA 2X6XA 1NHAA 2R5ZA 1KYZA 1AA7A 2QLZA 3NWTA 4D5FA 2JTVA 5L3FA 4Q47A 2K4JA 1IG7A 2XHKA 1X3UA 1FT9A 1U5TC 1S7AA 2XDVA 3C1DA 1U8RA 1CQTA 4LD5A 2VBXA 4ZZDA 2DMNA 2OZUA 3GBGA 1BBYA 2XGEA 1RR8C 4Y52J 2Y0SN 5F0FA 3A03A 1HC8A 2HYFA 3DBHB 4B43A 3GX4X 2CJJA 3KIOA 1U9NA 1N77A 1MMDA 2ZFWA 1WJBA 2DDBA 2DMUA 4PUSA 1V54H 5JVGF 5E1XA 3GTPJ 2O03A 3FMSA 2LC2A 2DPDA 2DFHA 1NH3A 4FTHA 3DU6A 2L9NA 4H4KC 4A3JJ 2IGMA 4XLNF 2RN7A 3B73A 4GRIA 2LKPA 4DNCA 1BC8C 2G7HA 3T8RA 3WU1B 1A6IA 3AKZA 2W7NA 1JTYA 2IS6A 3HRUA 1RNLA 1XSXA 1MDMA 2VT2A 1HF0A 1LJ9A 1Z67A 2O61A 2ZO4A 4EMSA 4CYCB 5FLXK 3QPLA 3BJAA 5E3NA 4A0ZA 2M4GA 2Z9OA 3TGNA 3BZKA 2JVGA 1VQMI 2VONA 3AAFA 4BBSJ 2I8DA 5TJJA 1G6NA 3OYJA 4BAYA 3OL3A 1ETOA 1LVAA 4LLNA 4RAGA 4I76A 4IRGA 4LLGF 1U2WA 4I01A 2Y75A 1T08B 2VBYA 4II2A 4UVAA 4OOIA 3WGGA 1WJEA 3KE2A 4JX4A 1XD7A 2OUMA 3ZXSA 5BQTA 5E18F 2W00A 4M72A 3VYSB 3FDYA 2E34A 4M3GA 2ZXWH 4XICA 2F4OB 1EH6A 3UR3C 3M1EA 3J7AO 4A3BJ 3R6SA 5AIQA 3HOVJ 2MD5A 1C0WA 3WTUC 2GXGA 2UV1A 9ANTA 3IWFA 4QWQA 3S32A 1OCTC 4BDYA 3JRGA 2Z33A 4AYBA 4XN0A 2MSYA 1J75A 2YPRA 1D5VA 1EKEA 1X58A 1YW8A 3HIFA 2WTEA 3K6GA 1YG2A 2VUMJ 3BR0A 2FD5A 4IHYA 2FNAA 1YYVA 1ACIA 3OYEA 4DJAA 3PNVA 2QZ8A 1IV6A 4BGDA 3EQLF 3SXYA 1GT0C 5L3CA 2F5FA 4BE0A 4F91B 2PQ8A 1WJCA 3FK6A 5D6EA 4I0AA 3DTKA 3ABUA 2BXZA 3TW7A 1KONA 1WJDA 3GZ6A 3C2BA 3ABLH 2LY2A 1IDZA 2Y0MA 4OIQF 3BLYA 1LDDA 1QU3A 5D4SA 2R0QC 4ENJA 1XC5A 1VQ9I 2GLOA 4XM3A 1YIJI 2EBIA 2CWEA 2ESHA 2EFQA 2DQLA 1GHCA 3KETA 1X1DA 2BW3B 2XAHA 1UJ8A 3CJRB 4LG3A 4Y3OA 2L02A 2HVRA 1ZYRF 2LOOA 1IN7A 1DGRM 4HF2A 4BEHA 2ZB9A 3WU0A 1JHHA 2DA2A 2Z2SB 2K86A 3H5RA 3KYCB 1NG7A 3M8FA 4D0PA 4XRSA 4IXAA 4LOCA 1BI1A 3W2AA 2GZWA 2IA2A 4IHWA 5FKLA 1H9GA 1BC7C 2CW7A 1WSUA 2JWTA 4PJMA 2OQGA 1FMVA 4B47A 3B6AA 5HODA 3FBIB 2OZ6A 3HM5A 3HSFA 1KU7A 3BP8A 4KFCA 2V7FA 1UFMA 4XSZF 3K4JA 2VPLA 4A6EA 1YHQI 5EGOB 2RQPA 2L3DA 2QQ8A 3HOZJ 5BS6A 4FT8A 3GWZA 1A5JA 1MBJA 2HQAA 2JSPA 4U87A 2E1MB 2EZIA 3RSNA 2FBKA 2FA5A 2V9PA 2QEXI 4A93J 2EFOA 2ZXJA 1Y0UA 3K4KA 2WV1A 1USSA 3U1DA 3E0JB 3CCMI 3QP5A 3CESA 4CXFA 4CCOA 5KVRA 4N0BA 4M6VA 2R7ZJ 2EZHA 5ED4A 5C4JJ 2KRHA 2KMUA 3RZOJ 3ZP5A 4A3LJ 3HSRA 1FC3A 3OOUA 3L7WA 4L5IA 3ZMUA 3H5NA 1WJFA 3I9V2 4HF0A 4L9VA 4XK4A 1U3EM 1Y8QB 4HA8A 1T39A 1WI3A 5ILSA 3JREA 3GCMA 3ZRGA 3CJNA 3ZQIA 3V7RA 1O7FA 1SD6A 3DV8A 3L9FA 1XCVA 3HZJA 2R7OA 4ZJZA 5F27A 3CUQB 1TT5B 3IH2A 1YO5C 5GAHJ 4RM3A 2I5UA 4C3JJ 1GDTA 3LSTA 3DPTA 1RPWA 4ZYHA 2WADA 4NBQA 3GTLJ 2PJRA 4XRMA 1O3RA 4KJZA 4E70A 1TW3A 2K40A 4MTDA 1G2HA 2RNGA 3FXKA 3HBLA 1GVJA 4PJNA 4IQ4A 2O8XA 2XF5A 1T2KA 1F4KA 1XG1A 1X1BA 3BPVA 3IC7A 1FLIA 2BVLA 4A3DJ 2PI0A 4A3GJ 4M3FA 2AXLA 2X1DA 3CUOA 1VFCA 2EQRA 4MIMA 5C4XJ 4MGRA 4PCQA 4IEJA 2KPMA 2XSJC 2Y9ZA 2DLLA 5DTDA 2WB1A 1F43A 2VC0A 4I09A 3TO7A 3A0BC 3TW6A 2V9KA 2Z5UA 3JTGA 2DK5A 4M73A 2BBYA 3FIWA 2LBFA 3GLXA 3E7LA 4WXHA 2KFDA 1YW7A 1DGWY 4I02A 3QWLA 2PMZN 1DP7P 1R4MB 2EIMH 2NXNB 3KP2A 4ZZLA 3GMEA 1BL0A 4IQJA 2K9SA 4DGWB 5D5WB 2JUCA 1B8IB 5D8KB 2CUJA 4CYDA 1K79A 1VQ5I 2ICWG 1R6RA 5IYDJ 2OBPA 2Z16A 1I3QJ 4HV6A 1Z05A 4XL9A 1JI8A 1HA8A 3TP3A 1AOYA 4FHTA 1X2MA 2BVMA 2G7UA 1P2FA 3RQ4A 5LFAA 4MFDA 2L7MP 1DDNA 3K4BA 1O57A 4ZDOA 3ZQLA 1ORKA 1B1BA 2IEKA 3K4LA 5JHFA 2FUG2 2DI3A 2M1BA 4A0YA 5DD8A 3OYKA 1NTCA 1W5SA 3EPZA 2IP2A 5M5XJ 3PUBA 1MBEA 3S1QJ 4KICA 3TDZC 1JGSA 2JA6J 5IPAA 3M8JA 1OISA 1FOKA 2LLKA 3REOA 2R5ZB 1OCZH 2W82A 2RNJA 3F0CA 1TT0A 2JSCA 2L9SA 2M8GX 4YRVA 2Y69H 2DMQA 4F52A 3SHFA 2PFBA 3N05A 2A05A 2HQNA 1PVEA 5HS9A 2OPTA 2V1DA 2MGQA 2XIGA 4RLFA 3U2RA 3S15J 2J5PA 2KQRA 3FM5A 2B0LA 2ZMEC 4HOBA 2H1KA 1TNSA 3E6MA 3MWMA 4B09A 2COBA 3UNGC 3K0LA 5CYVA 1G8XA 4NDLA 5CJ9A 4UUSA 2FF4A 1R7JA 2CUEA 1B9MA 4D9JA 2RAEA 3VSLA 1FPQA 3JW4A 3OIQA 4B48A 1IV8A 4S04A 1VQOI 2OA4A 3M07A 3CCSI 5D5XB 3E97A 3GTQJ 2R92J 3AL0C 2QM3A 3A1YA 4B4CA 3MZHA 2DW4A 4EQQA 1W36D 2LF8A 3M1CA 2P5VA 3P9IA 1DP3A 3OIOA 5D4RA 3C7JA 3L00A 3EUAA 4A3KJ 2JK3A 2EB7A 3ZMTA 4CCKA 2OTJI 1A31A 5HLHA 3OOPA 3F8NA 4RMNA 3RZDJ 2VE9A 2KIUA 3CCEI 3HOWJ 3KLOA 1HW1A 3KYDB 3DLLF 3Q9SA 2R7XA 3RQIA 3U21A 4II3A 2XASA 4WF2A 4ZDLA 1ZG5A 2VQLA 2EV5A 3NWSA 5EG0A 2E35A 4YEJA 5B3SH 5EEGA 1OKRA 3TOBA 2BV6A 2D5VA 1Y39A 1IN5A 3FMRA 2HVSA 3LSKA 3WTVC 2L7KA 4AVZA 3EYYA 2UXNA 2FSWA 3W6VA 2MC3A 3CDHA 3P9KA 3HKZA 2V9VA 3HOXJ 1PP8F 4XONA 1FBQA 2XF6A 4M9SA 1S5LC 3CZ6A 2RC4A 5F04A 2VODA 3R60A 3CCQI 1MD0A 1Y56A 3HEFA 2B9SA 2MLKA 5K5QA 5HLGA 2B63J 5E17F 4ENMA 4P5OA 5DUIA 1WHUA 3S3MA 3A02A 2NVYJ 3I64A 4ZYDA 2RQQA 3OR2C 2KZGA 2HS5A 2DYRH 3SFIA 1VZ0A 3KFWX 1TL8A 3BR1A 4BU2A 2M5WA 1KA8A 5B1BH 3CMAI 4MNUA 2FBHA 1W7PA 1IRZA 2ELHA 1JKRC 4PJJA 4CHUA 1LEBA 2P6TA 2ID3A 3KEOA 3VDXA 2QKLB 1BI2A 1JHFA 3BPXA 2VPRA 4ASNA 2QSHX 1BR4A 4E4HA 2JJ7A 2DXIA 4U0WA 1IXRC 4ZC3A 4EVIA 2HR3A 3LAPA 3ONQA 2PJPA 5JHUA 3I55I 2F6CA 4L9JA 2CV0A 3F22A 2CYYA 3K4CA 2PN6A 3QODA 3I59B 4L9NA 3GF2A 3WHCA 2KIFA 3GEZA 1XGNA 2GQQA 3FXLA 4E7ZA 2R7WA 3QYEA 1Z6TA 2KP6A 2QVOA 1BA5A 5BPDA 1MJ9A 1HW2A 3PQKA 5JLXA 2A6HF 2WAQN 4RM2A 5IP7J 5L3GA 1E0EA 2MFZA 3DFGA 4RB0A 2IVMA 1QRYA 3OS1A 4FX4A 1AHDP 4YFXF 2R7RA 3DEUA 4XORA 3PO3J 5L3EA 1YW9A 1E3PA 1SFXA 2DFFA 3E3VA 2ME6A 4ESJA 4DBRA 1LKXA 4MQ9F 2MG4A 4WX9A 3H3UA 4BHBA 5GTHC 5IOZA 1O3TA 1XMKA 1YRNA 5CVVA 2OU2A 1YS7A 3K1PA 1GV5A 5LEKA 3L2RA 2FX0A 3NARA 5DCMA 2XGCA 2ZBKA 3GTKJ 2H09A 4FCYA 2XVCA 4UVCA 5KAFC 2CMPA 3N97A 1T0FC 2F4MB 2V6EA 1GVDA 2LK2A 1GUUA 2LKSA 3W3CA 4XLFA 3HG9A 4CO8A 1Y1WJ 4L18B 2M8EA 2CQ7A 5KAIC 4KITB 4EJTA 4LITA 3RPUD 3Q5FA 1HDDC 2DA7A 2BOLA 3LSHA 2OTLI 1K83J 3CCVI 3ZGKA 2IA0A 1YITI 3B02A 2GIVA 1KU9A 2V79A 2COMA 4BJTA 2X1CA 3OYIA 3KZYA 4ZDPA 2DQRA 3LSIA 4V2GA 1K61A 2ME0A 2E7WA 2K5CA 3JR9A 3Q9VA 5HVQC 3G1LA 3SZGA 1IC8A 3BZ6A 1Z21A 3GXOA 2G0EA 4DW6A 2L5QA 5E3OA 1EJ9A 3CC4I 1MH3A 3TQNA 3CO6C 2M7BA 2JVHA 3WTSC 2OC6A 2YS9A 1MW7A 1J2XA 2ZJRF 2ELJA 4E7JA 4P9UA 1TQPA 2JRMA 1LE8B 4BBRJ 3OYFA 2E5NA 2A5WA 5IYBJ 2A68F 1A36A 1SFEA 2VB6A 2HPIA 2QQ9A 5CQGA 3J7YJ 2BY2A 5ICFA 4UV8A 2JQ7A 1AKHA 1W0TA 4QIWN 1QHGA 4EJWA 2BE5F 3EDPA 1WI9A 2P7VB 2M0MA 4RB2C 3PQJA 3VWBA 2AS5F 3HXLA 4QPOA 3LSRA 2BY1A 2LBFB 1L3LA 3BT9A 3H36A 3HTUA 4XKCA 1PYVA 2L2OA 3RDIA 2HDDA 1JUSA 4HRIA 1O4XA 3BTCA 3TP0A 2IAIA 4MTEA 3VB2A 3IHUA 5EJCA 3VYUB 4BXUA 2VJIA 1UAAA 2LY9A 5IYCJ 4UY8I 1FBSA 2PMHA 3PJRA 1D0ZA 1H0MA 1RETA 3FKIJ 3A01A 1VTNC 2WAEA 3S2WA 4FETA 4AD9A 2XROA 4XSXF 2DA4A 3H3ZA 4R1HA 1TWCJ 4BHPA 3VEPA 3CCYA 3KZIC 1IW7F 1VQKI 3V7CA 2RGVA 1TQMA 2CV1A 4IOAF 3VFZA 4BUPA 1V5EA 1QZYA 2ISYA 2L0KA 3ZQ7A 5EDNA 2LVSA 1RIOH 3VYRB 4DYCA 6PAXA 5GP9A 5F1JA 1IXSB 1HSTA 2KJCA 1B72A 4LG0A 1SFKA 3CTAA 4A3MJ 1IRXA 4CH7A 4JX6A 3ZMVA 3F72A 1FIPA 1T98A 2JPCA 2XKOA 2AQFA 2NVQJ 3T8TA 3AFHA 2QWWA 5JR3A 1QVTA 3SEQA 4HBLA 3SJMA 3GTGJ 2VKEA 3LWFA 2M30A 5J4VA 1F9NA 1TP4A 4BY1J 1W0UA 1T8IA 1QQIA 1W1WE 2RVCA 3KP5A 1LDKB 4HNVA 3CLOA 1X4OA 2PX9A 2QGUA 3MMYB 4M3BA 4RGUA 4XOTA 3TDUC 5FD6A 5H6QA 3CMEI 1OFCX 3KZZA 3CJQB 2Y2ZA 2VE8A 4AU7A 4P96A 1X19A 1XDSA 1B59A 3BR6A 3HB9A 2GA2A 4UUSB 4YFKF 4MLOA 3I53A 1MJAA 3AG1H 1SEUA 3DXJF 2GXBA 2ZJPF 4FX0A 1Z7UA 2XGXA 2XPUA 4YG2F 3BTLA 3LQQA 2PMZA 1D8KA 5LGUA 1I6HJ 1ETXA 5JFRA 3CJTB 2P5KA 4L5JA 3RTRA 2P5LC 1Z3XA 1P9QC 2R5YB 3ZMDA 1TWFJ 1R00A 3PSFA 1YS6A 1BOAA 2P8TA 4HSTA 2XAQA 2HFHA 1BJZA 2HQ5A 2XPWA 3JRBA 5CLSA 2YU9J 1V5FA 4GXOA 1JUMA 3OYGA 4IHVA 4O5VA 1OR7C 3N4MA 4M6XA 2W4SA 4HAMA 4KIBA 3ZMSA 3ISPA 4JQFA 4EJUA 5EG0B 3E5XA 3BG5A 1PJRA 5M5YJ 2HDWA 5F1RA 2KRFA 5HNFA 3CCJI 4IL6C 4BACA 3FHNA 1QPIA 3HHHA 3ZQFA 1MBHA 5TGTA 1ETKA 3BG6A 2CUZA 4E6KG 2OD5A 3TEDA 1WGXA 3QPTA 2R7QA 2NS7A 2K9QA 4A6DA 4S0HB 2STWA 3D0SA 1U5TA 1V3FA 2Q8KA 2FNPA 4PGGA 3OYLA 4A0XA 5GTIC 3DBRB 1KU3A 2I10A 4PZJA 1Q1VA 1ZRFA 4IX7A 2VKDA 1XCBA 1SVOA 3H0GJ 3K2ZA 4HLYA 2M45A 3Q0UA 1Z91A 1MIJA 3BG3A 4JOMA 4Q5SF 3BTJA 3GFMA 1T56A 2KISA 5J1RA 1RC9A 2DOAA 3I71A 2CU7A 1D5YA 3Q0WA 1FSHA 3E6CC 2XF7A 1J09A 1OLTA 2YUSA 1FP1D 4XRSG 1E3OC 2C6YA 1JUPA 2M34A 3FF5A 4ENKA 1CGPA 4EM2A 1W7PB 4XN3A 5CPRB 3RYPA 5LLQA 2FQ3A 3JRCA 3MAJA 3S1RJ 1ZGAA 1IDYA 1JKQC 1ZKGA 1IJWC 1KQ0A 4M71A 4BQNA 1P92A 4A5MA 2MW8A 4UNOA 2GBYA 1B4AA 5LEJA 1R5GA 3G2BA 3NQOA 4F55A 3DKYA 1STZA 2VBZA 4LIVA 4G12A 3NRVA 1J0RA 2E2HJ 3SZPA 2LYCA 1HW5A 1U8BA 2L7FP 5LRSA 3IUOA 2E5ZA 4N9IA 5E3LA 4RS8A 3BROA 4C2TA 4DOZA 1Z0XA 4XBFA 1K6OA 2IXSA 1OYYA 3OV8A 3M3YJ 3S8PA 3BDDA 4CICA 3OYHA 3WE2A 3K10A 1UG0A 2DT6A 2DO7A 4I7HA 3L2UA 2JA2A 1R9TJ 2GM4A 1HKTA 1PUEE 4X6AJ 3H9JA 5DV5A 4J00A 3M8EA 4NC6A 1ETQA 2ID6A 3EUKL 3FZVA 3V42A 1IRFA 1BM9A 1Z3YA 4BL0B 3ZMZA 5M3FJ 4Q48A 3KPHA 4OMYA 3ASNH 2K9MA 1YRNB 2NYXA 4PJ0C 3WHBA 3BY6A 3W2WA 4CZCA 3MQ0A 4Y4RA 1DU0A 2RKHA 1H8AC 5HLTA 2YR2A 5DCMB 4UV9A 3A2KA 4U88A 2Y31A 4RGSA 2BY0A 1OR7A 1ON2A 3GZ5A 4Y7NJ 2BYVE 1RRJA 1D1AA 3ZOBA 4NNJA 4U7BA 2DJNA 1CF7A 3O2PE 2QUFA 1FEXA 3FK7A 1R1UA 1MSFC 3LA2A 3QU3A 4HDUA 2CS3A 1DPRA 4BJ6C 1X3WB 2L4AA 2IS1A 1LFUP 4EV0A 4IO9F 5BOXA 1ZN2A 3O6BB 3JRFA 4CCMA 1JT6A 4F93B 3DPUA 3EETA 3ZPLA 1ERDA 2BEOA 3LFUA 3G1MA 1W7PD 4FASD 4Y15A 4QTRA 2JT1A 4KISA 2ZKZA 3CF5F 2DTZA 4CCLA 5FRNA 5FJ8J 1PDNC 2P7CB 4I2OA 3ERED 4O3MA 4IOCF 2HTSA 1H88C 1PP7U 1BIAA 5LRRA 3F3XA 4B3XA 4Y13A 2IS4A 1ZLKA 3O8GA 2MD0A 2PLYA 3HRMA 1SD4A 1XGMA 2FOKA 1FMWA 2H94A 2ZNZA 3ZCOA 4BE1A 3PNYA 4YIFA 2UWMA 3A4CA 2IT0A 3HUGA 3F6OA 1K7AA 2KT0A 2DCEA 3SDGA 2DFEA 3HTSB 1IUYA 5FLVA 2VXDA 1K78A 4ESBA 4V19K 1LUJB 1AKHB
chains in the Genus database with same CATH topology
4CZZA 3COAC 3E5QA 2YSRA 1FSEA 3LQRA 3VODA 4F7ZA 5BPIA 3P9CA 1XN7A 1QGPA 3QRFF 4L9TA 4HQMA 3M9AA 2DPUA 2HDCA 5CVRA 2ADUA 1ZG1A 2A69F 1OPCA 3F8BA 3ELKA 3C18A 5ICGA 1S8NA 1SMTA 3E6DA 1J7KA 4LJZF 2QQBA 2G9WA 2VOPA 1ON1A 4JK1X 1YQAA 1DPUA 2A5YB 1U78A 5DUKA 4IRHA 1EH7A 2Z3YA 3LA7A 4LG0B 5A2QZ 4OIPF 2CQKA 1H9TA 2XAJA 4HZFA 1ZRDA 3DQVC 1TW2A 1MDMB 2ISZA 2FMYA 2PBIA 4ZYEA 4AIHA 1KQ8A 4LGWA 5FO5A 1R1TA 1E2XA 5FFZA 3I0TA 2H6CA 1O3SA 3FMQA 4AIJA 1QPMA 1S7OA 1G3SA 1BIBA 5L3DA 2W85A 5HOOA 4A2UA 4LLLA 1ONVA 2TDXA 3KEQA 1IZ1A 1LEAA 3FXRA 1BI3A 2OQRA 3LFKA 2ETHA 1R36A 2W84A 3HHGA 3CUQC 3I5UA 4U7DA 1V4RA 5H6RA 2LDUA 2LSOA 3RKYA 1BN5A 4CDGA 1DUXC 2CGPA 3GVAA 1R58A 3I54A 2A61A 2ACJA 1FYLA 3GFJA 2K27A 5K5OA 5E1WA 3V8LA 3LA3A 2V6CA 1ZAOA 4HX7A 1P6RA 1TLHB 4UVBA 1U5TB 3F8CA 5DDGA 3WTTC 2CO5A 4HQEA 4H0EA 2FE3A 2E7XA 4QLCU 5ERIA 2ZMEA 2A6EF 3GFLA 2LF7A 3IRRA 2HZTA 2Y48A 2Z99A 3DP7A 4HF1A 3IL2A 2H27A 2L54A 3ECHA 3I4PA 3W6JB 5ILVA 1IRGA 1IN6A 3GW2A 5A2QK 1J59A 3U9GA 1WRJA 2CW0F 5D5UB 1FYKA 1I5ZA 3MCZA 3ZN1A 4NHJA 1T6SA 2P6SA 1B9NA 1A04A 1UHMA 3K1NA 2E1CA 2MH9A 5LGTA 1I1SA 4NQWA 1I1GA 2CSOA 3CUQA 4P55A 4UXNA 4N9HA 2JPBA 1WWXA 3K1MA 3RYRA 3G3ZA 3KP6A 4ZYGA 3QP6A 4NB5A 3ZN0A 2Q2EA 2XRNA 2HOEA 4G7HF 2PMUA 4PDKA 1D3YA 3LAJA 5L3BA 4LMYA 4PGHA 3NEUA 5DCFA 2DT5A 2WC2A 2HKOA 5LHGA 5J8FA 3MFKA 3GYHX 5LBQA 1SFUA 1ODDA 2R7DA 2NAZA 1ZREA 1LB2A 2VBWA 4AIKA 4I0BA 1KGSA 1R5HA 3R0JA 1GXPA 1BJAA 3TOAA 5ILUA 2YU3A 3F21A 1XGOA 1JXSA 3GFIA 1HKQA 1MJBA 4WXCA 2IA1A 2QQAA 2R7FA 1FX7A 1K78B 2F5DA 2FMLA 4KMUX 5ICCA 4CGZA 2YX4A 4G6DA 3IRQA 2VXZA 1UCRA 1EH8A 1W4MA 3KP7A 2NRAC 2W57A 1UB9A 1BI0A 1J5YA 2FEZA 1O3QA 2EA2A 2FBIA 3HYIA 1ZRCA 2DTRA 4OINF 3T1BA 2O6GE 3GUDA 1GXQA 1QO0D 1T0FA 1RUNA 4KN4X 4KIGA 3RKXA 3WGIA 2X4HA 3IWZA 4HLXA 1MGTA 2FXAA 3SQNA 4M9ZA 4U0YA 3O3KA 1LNWA 4AWXB 1W5TA 4G7OF 2EK5A 4BQAA 2HTJA 5DD4A 2L4MA 4ZH4F 3BJ6A 4O6JA 4Q4ZF 3FWEA 2O3FA 3R61A 1P4WA 1TTYA 2ZNYA 2EFWA 3KCCA 3V7SA 3T5XA 3BWGA 2VC1A 3K9TA 3W6KB 2ESNA 4LB6B 2YX7A 2IRFG 2HEOA 4G8XA 1TQIA 4KUMA 2EFPA 3K69A 1HSJA 5J6XA 2QBYA 1FBUA 2XKPA 4HW0A 2IW5A 3ROUA 5CVIA 4KA4A 5HS8A 1SD7A 2K7LA 4B8XA 1KYWA 1Q1HA 3WODF 2MBFA 4G94A 4M74A 5DYMA 3QU6A 1YFHA 3WGHA 2VOOA 2KKOA 1FYMA 4IJAA 3RPUA 4EJOA 5KK1A 2DU9A 4BH9A 2WV0A 2UXXA 4UUVA 1Z9CA 5FD5A 1P4XA 1S29A 2FRHA 1HKSA 4G7ZF 2EFNA 5AONA 4Z2YA 4L0ZB 1USTA 1I27A 3I59A 3PFIA 4GO1A 2D1VA 3HOTA 2KJBA 1OYIA 3P7NA 3BJOA 3TO6A 2DAOA 5FB2A 4R79A 5LGNA 1ZGJA 4KN7X 3CO7C 2ZMEB 5LHHA 4HX4A 1RUOA 4BNCA 3M7GA 4BHCA 4WK8F 2J5OA 3FHZA 4ETSA 2IPQX 5JVTA 5D8LB 4OMZA 5DEQA 3WTZA 4XRFA 2XUBA 1XSVA 2NNYA 5ICEA 4LFUA 5FGMA 3WTXC 3F23A 1XB4A 4Y17A 2UZKA 1QZZA 1FY7A 4L0YB 3L09A 3RJPA 5K5RA 1ULYA 2F5CA 4EJVA 1Z1DA 3QPHA 3FXUA 3RKWA 1IN4A 1G3YA 3VOEA 5LHIA 1P4AA 2A3SA 2D45A 4M6YA 1TBXA 5IT9Z 3R0AA 1XDUA 2K4BA 4LK1F 1IF1A 1U6GA 1FP2A 4UHTA 5E8GA 2DK8A 3J81Z 1RI7A 4RB1A 4KYWA 2FU4A 4IPAA 2LNBA 2NNNA 3IKVA 3HOSA 4IRIA 2HGCA 1FNNA 2GA1A 3QOPA 2Q0OA 2W25A 5HS7A 3HSEA 2MLGA 3JTHA 3KLNA 4KT5C 1R23A 4P9FA 1I6XA 5E20A 3ULQB 2GWRA 2RDPA 2O0YA 4AVPA 5F6FA 5H20A 3JAMZ 3F8FA 2HQRA 2DBBA 1YLFA 2F2EA 2EWNA 5TRDA 4IHTA 3E5UA 3FX3A 3V8KA 1J9IA 1WQ2A 4ENNA 2H6BA 3IKTA 5HDNA 4WXDA 2K02A 4U0VA 1TNTA 4IF4A 1G3TA 1KQ9A 5D6FA 4GGGA 5BMZA 4A12A 2F5EA 1QNTA 2GAUA 5F64A 4MEYF 1MZBA 4G9YA 4RB3C 4KIFA 1WKMA 1G4DA 3ECOA 4WWCA 2VT3A 1XSDA 3FM3A 3MZYA 1HBXG 3MEXA 2E1NA 3WE3A 1B6AA 1S3JA 4TV7A 1SAXA 2V1UA 3JSPA 1T38A 2ZJ2A 3WTYC 2PEXA 3TKYA 3KP3A 4OIOF 2HKXA 3ABTA 2HYGD 2XV4S 4RAYA 5IT9K 1SMYF 3KP4A 2PG4A 4IHSA 4BYYA 1AWCA 2A07F 1OMIA 1JE8A 5HDGA 3J81K 3H92A 1QBJA 2W24A 2RV8A 2X0LA 2WWYA 2L01A 4LB5A 3BOQA 3D5LA 1R22A 2R3SA 1O7LA 4HX8A 2QBYB 4KNYA 2DFIA 4XLPF 4G6QA 2MA3A 2V1XA 4EGYA 3J80Z 4ON0A 2EV0A 4EM0B 1R1VA 4ESFA 3JAMK 4RGXA 4EM1A 4GYIA 4KMFA 4HDVA 3T0YA 4R8HA 4OIRF 1G3WA 1SD5A 2QYOA 4OU0A 3I58A 4MEXF 3F8MA 1IXCA 4MQVA 5CVUA 4IVNA 4WCGA 2BGCA 4YFNF 1MKMA 1D8JA 5E8IA 3V8JA 3WTWC 1F5TA 2CFXA 3FXQA 4RGRA 5HLIA 4GYGA 5EEHA 2P4WA 1EV7A 4A5NA 1REPC 2D1HA 3RPQA 1ZLJA 3GO5A 1IN8A 5FFXA 1FZPB 4MHGA 4K2EA 1FWZA 5AIPA 1HXDA 2IJLA 5FLXZ 2VN2A 5CVJA 5IT3A 2XAFA 1E17A 3JSOA 1HQCA 4EGZA 1ZH5A 2EA4A 3G73A 4YIIA 3L2CA 1RZ4A 1XGSA 4JBAA 1LQ1A 5E1ZB 1CF7B 2XAGA 3RIRA 3V4GA 1L0OC 5HDKA 3R4KA 1XMAA 1ZARA 3DKWA 1OYWA 5J8CA 1ZG3A 2OAZA 2EJRA 4HYEA 1S6LA 4M9XA 2CG4A 5K1YA 3E6BA 2HWVA 3F6VA 4DQ2A 1LDJA 2ZCWA 4GCVA 5D5VB 1Z6RA 3C3WA 3DF8A 3TO9A 1IAWA 2QENA 1KU2A 1ZHFA 4I98B 2STTA 3SZTA 4KDPA 2KIMA 3J80K 2JZYA 4LK0F 1YIOA 3SFZA 2NS0A 1F1ZA 5JI6A 3EYIA 3HRTA 2D2WA 2M87A 4S05A 3ML6A 1YTYA 3HRSA 3EUHA 4HV5A 3QAHA 3DPLC 4RAZA 3RI4A 2EV6A 3WG9A 2MH2A 1UHWA 2JRTA 1NHAA 1KYZA 2QLZA 2JTVA 5L3FA 4Q47A 2K4JA 2XHKA 1X3UA 1FT9A 1U5TC 1S7AA 3C1DA 1U8RA 4LD5A 2VBXA 4ZZDA 2OZUA 1BBYA 2HYFA 3GX4X 2ZFWA 5E1XA 2O03A 3FMSA 2DPDA 4XLNF 2RN7A 3B73A 2LKPA 4DNCA 1BC8C 2G7HA 3T8RA 3WU1B 3HRUA 1RNLA 1XSXA 1MDMA 2VT2A 1LJ9A 2O61A 2ZO4A 4EMSA 5FLXK 3BJAA 4A0ZA 2Z9OA 3TGNA 2VONA 3AAFA 5TJJA 1G6NA 4BAYA 1LVAA 4LLNA 4IRGA 4LLGF 1U2WA 4I01A 2Y75A 2VBYA 4UVAA 4OOIA 3WGGA 3KE2A 1XD7A 5E18F 5BQTA 4M72A 1EH6A 3M1EA 3J7AO 3R6SA 5AIQA 2MD5A 1C0WA 3WTUC 2GXGA 3IWFA 4QWQA 2Z33A 1J75A 2YPRA 1D5VA 1YW8A 3HIFA 2WTEA 1YG2A 2FNAA 1YYVA 2QZ8A 3EQLF 3SXYA 5L3CA 2F5FA 2PQ8A 5D6EA 4I0AA 3ABUA 3GZ6A 2Y0MA 4OIQF 1LDDA 5D4SA 4ENJA 2CWEA 2ESHA 2EFQA 2DQLA 1GHCA 3KETA 2XAHA 2L02A 1ZYRF 4HF2A 1IN7A 3WU0A 1JHHA 2K86A 3M8FA 4D0PA 4IXAA 1BI1A 2GZWA 2IA2A 1H9GA 1BC7C 1WSUA 2OQGA 2OZ6A 3HSFA 1KU7A 3BP8A 4KFCA 1UFMA 4XSZF 4A6EA 2RQPA 2L3DA 5BS6A 4FT8A 3GWZA 2FBKA 2FA5A 2EFOA 2ZXJA 1Y0UA 1USSA 3U1DA 3QP5A 4CXFA 5KVRA 4N0BA 5ED4A 3ZP5A 3HSRA 1FC3A 3L7WA 4L5IA 3ZMUA 4HF0A 4L9VA 1U3EM 4HA8A 1T39A 5ILSA 3CJNA 3V7RA 1O7FA 1SD6A 3DV8A 3L9FA 1XCVA 3CUQB 1YO5C 3LSTA 3DPTA 4ZYHA 1O3RA 4E70A 1TW3A 4MTDA 1GVJA 2O8XA 1T2KA 1F4KA 3BPVA 3IC7A 1FLIA 2PI0A 2AXLA 3CUOA 4MGRA 4PCQA 2DLLA 2VC0A 4I09A 3TO7A 2Z5UA 3JTGA 2DK5A 4M73A 2BBYA 3GLXA 4WXHA 1YW7A 4I02A 1DP7P 3KP2A 4ZZLA 5D5WB 5D8KB 4CYDA 1K79A 2OBPA 4HV6A 1Z05A 1AOYA 4FHTA 2G7UA 1P2FA 1DDNA 1O57A 1B1BA 2DI3A 2M1BA 4A0YA 5DD8A 1W5SA 2IP2A 4KICA 3TDZC 1JGSA 1FOKA 3REOA 2RNJA 2JSCA 3SHFA 2PFBA 2HQNA 5HS9A 2V1DA 2XIGA 3U2RA 2J5PA 3FM5A 2B0LA 4HOBA 1TNSA 3E6MA 3MWMA 4B09A 3K0LA 5CYVA 5CJ9A 2FF4A 1R7JA 1B9MA 1FPQA 3JW4A 4S04A 2OA4A 5D5XB 3E97A 2QM3A 3MZHA 2DW4A 4EQQA 2LF8A 2P5VA 3P9IA 5D4RA 3C7JA 3L00A 2EB7A 3ZMTA 5HLHA 3OOPA 3F8NA 2VE9A 2KIUA 3KLOA 1HW1A 3Q9SA 4WF2A 2XASA 1ZG5A 2EV5A 5EEGA 1OKRA 3TOBA 2BV6A 1IN5A 3FMRA 3WTVC 3EYYA 2UXNA 2FSWA 2MC3A 3CDHA 3P9KA 2V9VA 1PP8F 1FBQA 4M9SA 2RC4A 2VODA 3R60A 1MD0A 2MLKA 5K5QA 5HLGA 5E17F 4ENMA 4P5OA 5DUIA 3I64A 4ZYDA 2HS5A 3KFWX 2M5WA 1KA8A 4MNUA 2FBHA 1W7PA 2ELHA 4CHUA 1LEBA 2P6TA 3KEOA 1BI2A 1JHFA 3BPXA 4ASNA 4U0WA 1IXRC 4EVIA 2HR3A 3LAPA 2PJPA 5JHUA 4L9JA 3F22A 2CYYA 2PN6A 3I59B 4L9NA 3GF2A 3GEZA 2KIFA 1XGNA 2GQQA 1Z6TA 2QVOA 5BPDA 1MJ9A 1HW2A 3PQKA 2A6HF 5L3GA 3DFGA 4RB0A 2IVMA 4FX4A 4YFXF 3DEUA 5L3EA 1YW9A 1SFXA 3E3VA 4ESJA 4MQ9F 4WX9A 3H3UA 4BHBA 1O3TA 1XMKA 5CVVA 2OU2A 1YS7A 3K1PA 5LEKA 5DCMA 2ZBKA 2H09A 2XVCA 4UVCA 3N97A 4CO8A 4L18B 2M8EA 4EJTA 3Q5FA 2IA0A 3B02A 2GIVA 1KU9A 2V79A 2COMA 3KZYA 2DQRA 2E7WA 3Q9VA 5HVQC 3BZ6A 3GXOA 3TQNA 3CO6C 3WTSC 1J2XA 4P9UA 1TQPA 2A68F 1SFEA 2QQ9A 5ICFA 4UV8A 4EJWA 2BE5F 3EDPA 1WI9A 2P7VB 4RB2C 3PQJA 2AS5F 1L3LA 3HTUA 3RDIA 4MTEA 3VB2A 3IHUA 4BXUA 1FBSA 2PMHA 1H0MA 1VTNC 3S2WA 4AD9A 2XROA 4XSXF 3H3ZA 4R1HA 4BHPA 3VEPA 1IW7F 3V7CA 2RGVA 1TQMA 3VFZA 1QZYA 2ISYA 3ZQ7A 1RIOH 6PAXA 1IXSB 1HSTA 2KJCA 4LG0A 3CTAA 3ZMVA 3F72A 1T98A 2JPCA 2XKOA 3T8TA 2QWWA 5JR3A 4HBLA 3LWFA 2M30A 1F9NA 1QQIA 2RVCA 3KP5A 1LDKB 3CLOA 5FD6A 4RGUA 3TDUC 5H6QA 3KZZA 2VE8A 4P96A 1XDSA 1B59A 2GA2A 4YFKF 3I53A 1MJAA 3DXJF 2GXBA 4FX0A 1Z7UA 2XGXA 4YG2F 3LQQA 1D8KA 5LGUA 5JFRA 2P5KA 4L5JA 3RTRA 2P5LC 3ZMDA 1R00A 1YS6A 1BOAA 2P8TA 2XAQA 2HFHA 5CLSA 4GXOA 4O5VA 3N4MA 4M6XA 4HAMA 4KIBA 3ZMSA 3ISPA 4JQFA 4EJUA 3E5XA 5F1RA 2KRFA 3HHHA 2OD5A 3QPTA 4A6DA 2STWA 3D0SA 1U5TA 1V3FA 2Q8KA 2FNPA 4PGGA 4A0XA 1KU3A 4PZJA 1ZRFA 1XCBA 3K2ZA 4HLYA 2M45A 1Z91A 4Q5SF 3GFMA 3I71A 1FSHA 3E6CC 1FP1D 2C6YA 3FF5A 4ENKA 1CGPA 4EM2A 1W7PB 3RYPA 5LLQA 2FQ3A 3MAJA 1ZGAA 1KQ0A 4M71A 1P92A 4A5MA 4UNOA 1B4AA 5LEJA 1R5GA 3NQOA 1STZA 2VBZA 3NRVA 1J0RA 3SZPA 1HW5A 5LRSA 4N9IA 4RS8A 3BROA 4XBFA 1K6OA 1OYYA 3OV8A 3BDDA 4CICA 3WE2A 2DO7A 4I7HA 1HKTA 1PUEE 5DV5A 3M8EA 3FZVA 1IRFA 1BM9A 3ZMZA 4Q48A 4OMYA 2NYXA 3BY6A 3MQ0A 2RKHA 2YR2A 5DCMB 4UV9A 4U88A 4RGSA 3GZ5A 1OR7A 1ON2A 2BYVE 4U7BA 1CF7A 3O2PE 2QUFA 1R1UA 3LA2A 3QU3A 4HDUA 1DPRA 2L4AA 4EV0A 5BOXA 1ZN2A 3O6BB 3ZPLA 3EETA 2BEOA 1W7PD 4Y15A 2JT1A 2ZKZA 1PDNC 2P7CB 4I2OA 3ERED 4O3MA 2HTSA 1PP7U 1BIAA 5LRRA 3F3XA 4Y13A 1ZLKA 2PLYA 3HRMA 1SD4A 1XGMA 2FOKA 2H94A 2ZNZA 4YIFA 2UWMA 2IT0A 3HUGA 3F6OA 1K7AA 3HTSB 1IUYA 1K78A 4ESBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZZ A;  3COA C;  3E5Q A;  2YSR A;  1FSE A;  3LQR A;  3VOD A;  4F7Z A;  5BPI A;  3P9C A;  1XN7 A;  1QGP A;  3QRF F;  4L9T A;  4HQM A;  3M9A A;  2DPU A;  2HDC A;  5CVR A;  2ADU A;  1ZG1 A;  2A69 F;  1OPC A;  3F8B A;  3ELK A;  3C18 A;  5ICG A;  1S8N A;  1SMT A;  3E6D A;  1J7K A;  4LJZ F;  2QQB A;  2G9W A;  2VOP A;  1ON1 A;  4JK1 X;  1YQA A;  1DPU A;  2A5Y B;  1U78 A;  5DUK A;  4IRH A;  1EH7 A;  2Z3Y A;  3LA7 A;  4LG0 B;  5A2Q Z;  4OIP F;  2CQK A;  1H9T A;  2XAJ A;  4HZF A;  1ZRD A;  3DQV C;  1TW2 A;  1MDM B;  2ISZ A;  2FMY A;  2PBI A;  4ZYE A;  4AIH A;  1KQ8 A;  4LGW A;  5FO5 A;  1R1T A;  1E2X A;  5FFZ A;  3I0T A;  2H6C A;  1O3S A;  3FMQ A;  4AIJ A;  1QPM A;  1S7O A;  1G3S A;  1BIB A;  5L3D A;  2W85 A;  5HOO A;  4A2U A;  4LLL A;  1ONV A;  2TDX A;  3KEQ A;  1IZ1 A;  1LEA A;  3FXR A;  1BI3 A;  2OQR A;  3LFK A;  2ETH A;  1R36 A;  2W84 A;  3HHG A;  3CUQ C;  3I5U A;  4U7D A;  1V4R A;  5H6R A;  2LDU A;  2LSO A;  3RKY A;  1BN5 A;  4CDG A;  1DUX C;  2CGP A;  3GVA A;  1R58 A;  3I54 A;  2A61 A;  2ACJ A;  1FYL A;  3GFJ A;  2K27 A;  5K5O A;  5E1W A;  3V8L A;  3LA3 A;  2V6C A;  1ZAO A;  4HX7 A;  1P6R A;  1TLH B;  4UVB A;  1U5T B;  3F8C A;  5DDG A;  3WTT C;  2CO5 A;  4HQE A;  4H0E A;  2FE3 A;  2E7X A;  4QLC U;  5ERI A;  2ZME A;  2A6E F;  3GFL A;  2LF7 A;  3IRR A;  2HZT A;  2Y48 A;  2Z99 A;  3DP7 A;  4HF1 A;  3IL2 A;  2H27 A;  2L54 A;  3ECH A;  3I4P A;  3W6J B;  5ILV A;  1IRG A;  1IN6 A;  3GW2 A;  5A2Q K;  1J59 A;  3U9G A;  1WRJ A;  2CW0 F;  5D5U B;  1FYK A;  1I5Z A;  3MCZ A;  3ZN1 A;  4NHJ A;  1T6S A;  2P6S A;  1B9N A;  1A04 A;  1UHM A;  3K1N A;  2E1C A;  2MH9 A;  5LGT A;  1I1S A;  4NQW A;  1I1G A;  2CSO A;  3CUQ A;  4P55 A;  4UXN A;  4N9H A;  2JPB A;  1WWX A;  3K1M A;  3RYR A;  3G3Z A;  3KP6 A;  4ZYG A;  3QP6 A;  4NB5 A;  3ZN0 A;  2Q2E A;  2XRN A;  2HOE A;  4G7H F;  2PMU A;  4PDK A;  1D3Y A;  3LAJ A;  5L3B A;  4LMY A;  4PGH A;  3NEU A;  5DCF A;  2DT5 A;  2WC2 A;  2HKO A;  5LHG A;  5J8F A;  3MFK A;  3GYH X;  5LBQ A;  1SFU A;  1ODD A;  2R7D A;  2NAZ A;  1ZRE A;  1LB2 A;  2VBW A;  4AIK A;  4I0B A;  1KGS A;  1R5H A;  3R0J A;  1GXP A;  1BJA A;  3TOA A;  5ILU A;  2YU3 A;  3F21 A;  1XGO A;  1JXS A;  3GFI A;  1HKQ A;  1MJB A;  4WXC A;  2IA1 A;  2QQA A;  2R7F A;  1FX7 A;  1K78 B;  2F5D A;  2FML A;  4KMU X;  5ICC A;  4CGZ A;  2YX4 A;  4G6D A;  3IRQ A;  2VXZ A;  1UCR A;  1EH8 A;  1W4M A;  3KP7 A;  2NRA C;  2W57 A;  1UB9 A;  1BI0 A;  1J5Y A;  2FEZ A;  1O3Q A;  2EA2 A;  2FBI A;  3HYI A;  1ZRC A;  2DTR A;  4OIN F;  3T1B A;  2O6G E;  3GUD A;  1GXQ A;  1QO0 D;  1T0F A;  1RUN A;  4KN4 X;  4KIG A;  3RKX A;  3WGI A;  2X4H A;  3IWZ A;  4HLX A;  1MGT A;  2FXA A;  3SQN A;  4M9Z A;  4U0Y A;  3O3K A;  1LNW A;  4AWX B;  1W5T A;  4G7O F;  2EK5 A;  4BQA A;  2HTJ A;  5DD4 A;  2L4M A;  4ZH4 F;  3BJ6 A;  4O6J A;  4Q4Z F;  3FWE A;  2O3F A;  3R61 A;  1P4W A;  1TTY A;  2ZNY A;  2EFW A;  3KCC A;  3V7S A;  3T5X A;  3BWG A;  2VC1 A;  3K9T A;  3W6K B;  2ESN A;  4LB6 B;  2YX7 A;  2IRF G;  2HEO A;  4G8X A;  1TQI A;  4KUM A;  2EFP A;  3K69 A;  1HSJ A;  5J6X A;  2QBY A;  1FBU A;  2XKP A;  4HW0 A;  2IW5 A;  3ROU A;  5CVI A;  4KA4 A;  5HS8 A;  1SD7 A;  2K7L A;  4B8X A;  1KYW A;  1Q1H A;  3WOD F;  2MBF A;  4G94 A;  4M74 A;  5DYM A;  3QU6 A;  1YFH A;  3WGH A;  2VOO A;  2KKO A;  1FYM A;  4IJA A;  3RPU A;  4EJO A;  5KK1 A;  2DU9 A;  4BH9 A;  2WV0 A;  2UXX A;  4UUV A;  1Z9C A;  5FD5 A;  1P4X A;  1S29 A;  2FRH A;  1HKS A;  4G7Z F;  2EFN A;  5AON A;  4Z2Y A;  4L0Z B;  1UST A;  1I27 A;  3I59 A;  3PFI A;  4GO1 A;  2D1V A;  3HOT A;  2KJB A;  1OYI A;  3P7N A;  3BJO A;  3TO6 A;  2DAO A;  5FB2 A;  4R79 A;  5LGN A;  1ZGJ A;  4KN7 X;  3CO7 C;  2ZME B;  5LHH A;  4HX4 A;  1RUO A;  4BNC A;  3M7G A;  4BHC A;  4WK8 F;  2J5O A;  3FHZ A;  4ETS A;  2IPQ X;  5JVT A;  5D8L B;  4OMZ A;  5DEQ A;  3WTZ A;  4XRF A;  2XUB A;  1XSV A;  2NNY A;  5ICE A;  4LFU A;  5FGM A;  3WTX C;  3F23 A;  1XB4 A;  4Y17 A;  2UZK A;  1QZZ A;  1FY7 A;  4L0Y B;  3L09 A;  3RJP A;  5K5R A;  1ULY A;  2F5C A;  4EJV A;  1Z1D A;  3QPH A;  3FXU A;  3RKW A;  1IN4 A;  1G3Y A;  3VOE A;  5LHI A;  1P4A A;  2A3S A;  2D45 A;  4M6Y A;  1TBX A;  5IT9 Z;  3R0A A;  1XDU A;  2K4B A;  4LK1 F;  1IF1 A;  1U6G A;  1FP2 A;  4UHT A;  5E8G A;  2DK8 A;  3J81 Z;  1RI7 A;  4RB1 A;  4KYW A;  2FU4 A;  4IPA A;  2LNB A;  2NNN A;  3IKV A;  3HOS A;  4IRI A;  2HGC A;  1FNN A;  2GA1 A;  3QOP A;  2Q0O A;  2W25 A;  5HS7 A;  3HSE A;  2MLG A;  3JTH A;  3KLN A;  4KT5 C;  1R23 A;  4P9F A;  1I6X A;  5E20 A;  3ULQ B;  2GWR A;  2RDP A;  2O0Y A;  4AVP A;  5F6F A;  5H20 A;  3JAM Z;  3F8F A;  2HQR A;  2DBB A;  1YLF A;  2F2E A;  2EWN A;  5TRD A;  4IHT A;  3E5U A;  3FX3 A;  3V8K A;  1J9I A;  1WQ2 A;  4ENN A;  2H6B A;  3IKT A;  5HDN A;  4WXD A;  2K02 A;  4U0V A;  1TNT A;  4IF4 A;  1G3T A;  1KQ9 A;  5D6F A;  4GGG A;  5BMZ A;  4A12 A;  2F5E A;  1QNT A;  2GAU A;  5F64 A;  4MEY F;  1MZB A;  4G9Y A;  4RB3 C;  4KIF A;  1WKM A;  1G4D A;  3ECO A;  4WWC A;  2VT3 A;  1XSD A;  3FM3 A;  3MZY A;  1HBX G;  3MEX A;  2E1N A;  3WE3 A;  1B6A A;  1S3J A;  4TV7 A;  1SAX A;  2V1U A;  3JSP A;  1T38 A;  2ZJ2 A;  3WTY C;  2PEX A;  3TKY A;  3KP3 A;  4OIO F;  2HKX A;  3ABT A;  2HYG D;  2XV4 S;  4RAY A;  5IT9 K;  1SMY F;  3KP4 A;  2PG4 A;  4IHS A;  4BYY A;  1AWC A;  2A07 F;  1OMI A;  1JE8 A;  5HDG A;  3J81 K;  3H92 A;  1QBJ A;  2W24 A;  2RV8 A;  2X0L A;  2WWY A;  2L01 A;  4LB5 A;  3BOQ A;  3D5L A;  1R22 A;  2R3S A;  1O7L A;  4HX8 A;  2QBY B;  4KNY A;  2DFI A;  4XLP F;  4G6Q A;  2MA3 A;  2V1X A;  4EGY A;  3J80 Z;  4ON0 A;  2EV0 A;  4EM0 B;  1R1V A;  4ESF A;  3JAM K;  4RGX A;  4EM1 A;  4GYI A;  4KMF A;  4HDV A;  3T0Y A;  4R8H A;  4OIR F;  1G3W A;  1SD5 A;  2QYO A;  4OU0 A;  3I58 A;  4MEX F;  3F8M A;  1IXC A;  4MQV A;  5CVU A;  4IVN A;  4WCG A;  2BGC A;  4YFN F;  1MKM A;  1D8J A;  5E8I A;  3V8J A;  3WTW C;  1F5T A;  2CFX A;  3FXQ A;  4RGR A;  5HLI A;  4GYG A;  5EEH A;  2P4W A;  1EV7 A;  4A5N A;  1REP C;  2D1H A;  3RPQ A;  1ZLJ A;  3GO5 A;  1IN8 A;  5FFX A;  1FZP B;  4MHG A;  4K2E A;  1FWZ A;  5AIP A;  1HXD A;  2IJL A;  5FLX Z;  2VN2 A;  5CVJ A;  5IT3 A;  2XAF A;  1E17 A;  3JSO A;  1HQC A;  4EGZ A;  1ZH5 A;  2EA4 A;  3G73 A;  4YII A;  3L2C A;  1RZ4 A;  1XGS A;  4JBA A;  1LQ1 A;  5E1Z B;  1CF7 B;  2XAG A;  3RIR A;  3V4G A;  1L0O C;  5HDK A;  3R4K A;  1XMA A;  1ZAR A;  3DKW A;  1OYW A;  5J8C A;  1ZG3 A;  2OAZ A;  2EJR A;  4HYE A;  1S6L A;  4M9X A;  2CG4 A;  5K1Y A;  3E6B A;  2HWV A;  3F6V A;  4DQ2 A;  1LDJ A;  2ZCW A;  4GCV A;  5D5V B;  1Z6R A;  3C3W A;  3DF8 A;  3TO9 A;  1IAW A;  2QEN A;  1KU2 A;  1ZHF A;  4I98 B;  2STT A;  3SZT A;  4KDP A;  2KIM A;  3J80 K;  2JZY A;  4LK0 F;  1YIO A;  3SFZ A;  2NS0 A;  1F1Z A;  5JI6 A;  3EYI A;  3HRT A;  2D2W A;  2M87 A;  4S05 A;  3ML6 A;  1YTY A;  3HRS A;  3EUH A;  4HV5 A;  3QAH A;  3DPL C;  4RAZ A;  3RI4 A;  2EV6 A;  3WG9 A;  2MH2 A;  1UHW A;  2JRT A;  1NHA A;  1KYZ A;  2QLZ A;  2JTV A;  5L3F A;  4Q47 A;  2K4J A;  2XHK A;  1X3U A;  1FT9 A;  1U5T C;  1S7A A;  3C1D A;  1U8R A;  4LD5 A;  2VBX A;  4ZZD A;  2OZU A;  1BBY A;  2HYF A;  3GX4 X;  2ZFW A;  5E1X A;  2O03 A;  3FMS A;  2DPD A;  4XLN F;  2RN7 A;  3B73 A;  2LKP A;  4DNC A;  1BC8 C;  2G7H A;  3T8R A;  3WU1 B;  3HRU A;  1RNL A;  1XSX A;  1MDM A;  2VT2 A;  1LJ9 A;  2O61 A;  2ZO4 A;  4EMS A;  5FLX K;  3BJA A;  4A0Z A;  2Z9O A;  3TGN A;  2VON A;  3AAF A;  5TJJ A;  1G6N A;  4BAY A;  1LVA A;  4LLN A;  4IRG A;  4LLG F;  1U2W A;  4I01 A;  2Y75 A;  2VBY A;  4UVA A;  4OOI A;  3WGG A;  3KE2 A;  1XD7 A;  5E18 F;  5BQT A;  4M72 A;  1EH6 A;  3M1E A;  3J7A O;  3R6S A;  5AIQ A;  2MD5 A;  1C0W A;  3WTU C;  2GXG A;  3IWF A;  4QWQ A;  2Z33 A;  1J75 A;  2YPR A;  1D5V A;  1YW8 A;  3HIF A;  2WTE A;  1YG2 A;  2FNA A;  1YYV A;  2QZ8 A;  3EQL F;  3SXY A;  5L3C A;  2F5F A;  2PQ8 A;  5D6E A;  4I0A A;  3ABU A;  3GZ6 A;  2Y0M A;  4OIQ F;  1LDD A;  5D4S A;  4ENJ A;  2CWE A;  2ESH A;  2EFQ A;  2DQL A;  1GHC A;  3KET A;  2XAH A;  2L02 A;  1ZYR F;  4HF2 A;  1IN7 A;  3WU0 A;  1JHH A;  2K86 A;  3M8F A;  4D0P A;  4IXA A;  1BI1 A;  2GZW A;  2IA2 A;  1H9G A;  1BC7 C;  1WSU A;  2OQG A;  2OZ6 A;  3HSF A;  1KU7 A;  3BP8 A;  4KFC A;  1UFM A;  4XSZ F;  4A6E A;  2RQP A;  2L3D A;  5BS6 A;  4FT8 A;  3GWZ A;  2FBK A;  2FA5 A;  2EFO A;  2ZXJ A;  1Y0U A;  1USS A;  3U1D A;  3QP5 A;  4CXF A;  5KVR A;  4N0B A;  5ED4 A;  3ZP5 A;  3HSR A;  1FC3 A;  3L7W A;  4L5I A;  3ZMU A;  4HF0 A;  4L9V A;  1U3E M;  4HA8 A;  1T39 A;  5ILS A;  3CJN A;  3V7R A;  1O7F A;  1SD6 A;  3DV8 A;  3L9F A;  1XCV A;  3CUQ B;  1YO5 C;  3LST A;  3DPT A;  4ZYH A;  1O3R A;  4E70 A;  1TW3 A;  4MTD A;  1GVJ A;  2O8X A;  1T2K A;  1F4K A;  3BPV A;  3IC7 A;  1FLI A;  2PI0 A;  2AXL A;  3CUO A;  4MGR A;  4PCQ A;  2DLL A;  2VC0 A;  4I09 A;  3TO7 A;  2Z5U A;  3JTG A;  2DK5 A;  4M73 A;  2BBY A;  3GLX A;  4WXH A;  1YW7 A;  4I02 A;  1DP7 P;  3KP2 A;  4ZZL A;  5D5W B;  5D8K B;  4CYD A;  1K79 A;  2OBP A;  4HV6 A;  1Z05 A;  1AOY A;  4FHT A;  2G7U A;  1P2F A;  1DDN A;  1O57 A;  1B1B A;  2DI3 A;  2M1B A;  4A0Y A;  5DD8 A;  1W5S A;  2IP2 A;  4KIC A;  3TDZ C;  1JGS A;  1FOK A;  3REO A;  2RNJ A;  2JSC A;  3SHF A;  2PFB A;  2HQN A;  5HS9 A;  2V1D A;  2XIG A;  3U2R A;  2J5P A;  3FM5 A;  2B0L A;  4HOB A;  1TNS A;  3E6M A;  3MWM A;  4B09 A;  3K0L A;  5CYV A;  5CJ9 A;  2FF4 A;  1R7J A;  1B9M A;  1FPQ A;  3JW4 A;  4S04 A;  2OA4 A;  5D5X B;  3E97 A;  2QM3 A;  3MZH A;  2DW4 A;  4EQQ A;  2LF8 A;  2P5V A;  3P9I A;  5D4R A;  3C7J A;  3L00 A;  2EB7 A;  3ZMT A;  5HLH A;  3OOP A;  3F8N A;  2VE9 A;  2KIU A;  3KLO A;  1HW1 A;  3Q9S A;  4WF2 A;  2XAS A;  1ZG5 A;  2EV5 A;  5EEG A;  1OKR A;  3TOB A;  2BV6 A;  1IN5 A;  3FMR A;  3WTV C;  3EYY A;  2UXN A;  2FSW A;  2MC3 A;  3CDH A;  3P9K A;  2V9V A;  1PP8 F;  1FBQ A;  4M9S A;  2RC4 A;  2VOD A;  3R60 A;  1MD0 A;  2MLK A;  5K5Q A;  5HLG A;  5E17 F;  4ENM A;  4P5O A;  5DUI A;  3I64 A;  4ZYD A;  2HS5 A;  3KFW X;  2M5W A;  1KA8 A;  4MNU A;  2FBH A;  1W7P A;  2ELH A;  4CHU A;  1LEB A;  2P6T A;  3KEO A;  1BI2 A;  1JHF A;  3BPX A;  4ASN A;  4U0W A;  1IXR C;  4EVI A;  2HR3 A;  3LAP A;  2PJP A;  5JHU A;  4L9J A;  3F22 A;  2CYY A;  2PN6 A;  3I59 B;  4L9N A;  3GF2 A;  3GEZ A;  2KIF A;  1XGN A;  2GQQ A;  1Z6T A;  2QVO A;  5BPD A;  1MJ9 A;  1HW2 A;  3PQK A;  2A6H F;  5L3G A;  3DFG A;  4RB0 A;  2IVM A;  4FX4 A;  4YFX F;  3DEU A;  5L3E A;  1YW9 A;  1SFX A;  3E3V A;  4ESJ A;  4MQ9 F;  4WX9 A;  3H3U A;  4BHB A;  1O3T A;  1XMK A;  5CVV A;  2OU2 A;  1YS7 A;  3K1P A;  5LEK A;  5DCM A;  2ZBK A;  2H09 A;  2XVC A;  4UVC A;  3N97 A;  4CO8 A;  4L18 B;  2M8E A;  4EJT A;  3Q5F A;  2IA0 A;  3B02 A;  2GIV A;  1KU9 A;  2V79 A;  2COM A;  3KZY A;  2DQR A;  2E7W A;  3Q9V A;  5HVQ C;  3BZ6 A;  3GXO A;  3TQN A;  3CO6 C;  3WTS C;  1J2X A;  4P9U A;  1TQP A;  2A68 F;  1SFE A;  2QQ9 A;  5ICF A;  4UV8 A;  4EJW A;  2BE5 F;  3EDP A;  1WI9 A;  2P7V B;  4RB2 C;  3PQJ A;  2AS5 F;  1L3L A;  3HTU A;  3RDI A;  4MTE A;  3VB2 A;  3IHU A;  4BXU A;  1FBS A;  2PMH A;  1H0M A;  1VTN C;  3S2W A;  4AD9 A;  2XRO A;  4XSX F;  3H3Z A;  4R1H A;  4BHP A;  3VEP A;  1IW7 F;  3V7C A;  2RGV A;  1TQM A;  3VFZ A;  1QZY A;  2ISY A;  3ZQ7 A;  1RIO H;  6PAX A;  1IXS B;  1HST A;  2KJC A;  4LG0 A;  3CTA A;  3ZMV A;  3F72 A;  1T98 A;  2JPC A;  2XKO A;  3T8T A;  2QWW A;  5JR3 A;  4HBL A;  3LWF A;  2M30 A;  1F9N A;  1QQI A;  2RVC A;  3KP5 A;  1LDK B;  3CLO A;  5FD6 A;  4RGU A;  3TDU C;  5H6Q A;  3KZZ A;  2VE8 A;  4P96 A;  1XDS A;  1B59 A;  2GA2 A;  4YFK F;  3I53 A;  1MJA A;  3DXJ F;  2GXB A;  4FX0 A;  1Z7U A;  2XGX A;  4YG2 F;  3LQQ A;  1D8K A;  5LGU A;  5JFR A;  2P5K A;  4L5J A;  3RTR A;  2P5L C;  3ZMD A;  1R00 A;  1YS6 A;  1BOA A;  2P8T A;  2XAQ A;  2HFH A;  5CLS A;  4GXO A;  4O5V A;  3N4M A;  4M6X A;  4HAM A;  4KIB A;  3ZMS A;  3ISP A;  4JQF A;  4EJU A;  3E5X A;  5F1R A;  2KRF A;  3HHH A;  2OD5 A;  3QPT A;  4A6D A;  2STW A;  3D0S A;  1U5T A;  1V3F A;  2Q8K A;  2FNP A;  4PGG A;  4A0X A;  1KU3 A;  4PZJ A;  1ZRF A;  1XCB A;  3K2Z A;  4HLY A;  2M45 A;  1Z91 A;  4Q5S F;  3GFM A;  3I71 A;  1FSH A;  3E6C C;  1FP1 D;  2C6Y A;  3FF5 A;  4ENK A;  1CGP A;  4EM2 A;  1W7P B;  3RYP A;  5LLQ A;  2FQ3 A;  3MAJ A;  1ZGA A;  1KQ0 A;  4M71 A;  1P92 A;  4A5M A;  4UNO A;  1B4A A;  5LEJ A;  1R5G A;  3NQO A;  1STZ A;  2VBZ A;  3NRV A;  1J0R A;  3SZP A;  1HW5 A;  5LRS A;  4N9I A;  4RS8 A;  3BRO A;  4XBF A;  1K6O A;  1OYY A;  3OV8 A;  3BDD A;  4CIC A;  3WE2 A;  2DO7 A;  4I7H A;  1HKT A;  1PUE E;  5DV5 A;  3M8E A;  3FZV A;  1IRF A;  1BM9 A;  3ZMZ A;  4Q48 A;  4OMY A;  2NYX A;  3BY6 A;  3MQ0 A;  2RKH A;  2YR2 A;  5DCM B;  4UV9 A;  4U88 A;  4RGS A;  3GZ5 A;  1OR7 A;  1ON2 A;  2BYV E;  4U7B A;  1CF7 A;  3O2P E;  2QUF A;  1R1U A;  3LA2 A;  3QU3 A;  4HDU A;  1DPR A;  2L4A A;  4EV0 A;  5BOX A;  1ZN2 A;  3O6B B;  3ZPL A;  3EET A;  2BEO A;  1W7P D;  4Y15 A;  2JT1 A;  2ZKZ A;  1PDN C;  2P7C B;  4I2O A;  3ERE D;  4O3M A;  2HTS A;  1PP7 U;  1BIA A;  5LRR A;  3F3X A;  4Y13 A;  1ZLK A;  2PLY A;  3HRM A;  1SD4 A;  1XGM A;  2FOK A;  2H94 A;  2ZNZ A;  4YIF A;  2UWM A;  2IT0 A;  3HUG A;  3F6O A;  1K7A A;  3HTS B;  1IUY A;  1K78 A;  4ESB A; 
#chains in the Genus database with same CATH topology
 5IOY A;  4CZZ A;  3COA C;  3I4N J;  2O9L A;  2LRD A;  1LVK A;  3E5Q A;  2YSR A;  1FSE A;  2Z1D A;  3LQR A;  3VOD A;  4F7Z A;  1SVM A;  4E7K A;  5BPI A;  2XB5 A;  3P9C A;  1XN7 A;  1QGP A;  2L9V A;  4XLH A;  3QRF F;  4L9T A;  4HQM A;  2R7U A;  1QVU A;  3M9A A;  2DPU A;  2ELK A;  2HDC A;  3W2V A;  5CVR A;  2ADU A;  4M3D A;  1ZG1 A;  1APL C;  2A69 F;  2E2J J;  1OPC A;  3CF2 A;  3F8B A;  3FXM A;  2LFB A;  3C18 A;  3ELK A;  5ICG A;  2XB0 X;  1S8N A;  1SMT A;  4A3F J;  3E6D A;  2L7Z A;  1J7K A;  4LJZ F;  2QQB A;  1GLN A;  5IY5 H;  2G9W A;  2NOJ B;  2R7V A;  2VOP A;  1VQP I;  3DU5 A;  1ON1 A;  4JK1 X;  1YQA A;  1A35 A;  5H2F C;  3CC2 I;  1DPU A;  2M9H A;  2A5Y B;  1U78 A;  5DUK A;  4IRH A;  2EPF A;  2ECC A;  1EH7 A;  3FBN B;  1Y8R B;  2Z3Y A;  4E7L A;  3LA7 A;  3KYL A;  3GTM J;  2IBD A;  1B72 B;  4LG0 B;  5A2Q Z;  3HDD A;  5HNH A;  4OIP F;  2CQK A;  2DOF A;  1H9T A;  3TMO A;  3ABM H;  5GPA A;  1D1B A;  4E7H A;  2XAJ A;  3GZN B;  3C2H A;  4HZF A;  1ZRD A;  3DQV C;  2A6T A;  3G71 I;  1TW2 A;  1MDM B;  3K4N A;  4J19 A;  2ISZ A;  2FMY A;  2WY7 Q;  2PBI A;  2E1O A;  4ZYE A;  1IO2 A;  4AIH A;  2E60 A;  1KQ8 A;  2E1M C;  4LGW A;  5FO5 A;  5KNL A;  2E19 A;  1H89 C;  1ITY A;  1R1T A;  1E2X A;  4FE7 A;  5FFZ A;  1YJ9 I;  2GOX B;  3I0T A;  2H6C A;  2VI6 A;  1O3S A;  1FJL A;  3FKJ A;  3FMQ A;  4C3H J;  4AIJ A;  3ZQG A;  1QPM A;  4BE2 A;  1S7O A;  1G3S A;  3RKQ A;  3OYA A;  1S7E A;  1BIB A;  4DIQ A;  5L3D A;  2W85 A;  2MAB A;  4A2U A;  5GAE J;  4LLL A;  1ONV A;  4JP0 A;  5HOO A;  2TDX A;  3DLA A;  3KEQ A;  1IZ1 A;  4OAY A;  1LEA A;  2B7E A;  3FXR A;  4RA2 A;  1BI3 A;  2QKM B;  5IP6 A;  2M2E A;  2OQR A;  3LFK A;  2ETH A;  2N8G A;  3BG7 A;  1R36 A;  1BW5 A;  2W84 A;  3HHG A;  1SVL A;  3CUQ C;  2X6O A;  1K6Y A;  3I5U A;  2HNH A;  2TRT A;  4E7S A;  2NS8 A;  4XLC A;  4U7D A;  1V4R A;  2LRE A;  5H6R A;  3OSF A;  2LDU A;  2LSO A;  2Y0S A;  3RKY A;  1BN5 A;  4CDG A;  1DUX C;  2CGP A;  3GVA A;  1R58 A;  3I54 A;  2A61 A;  2ACJ A;  2QF7 A;  4N4N B;  1FYL A;  5GAD J;  3GFJ A;  2ZSI B;  2K27 A;  5K5O A;  1MNE A;  5E1W A;  2CQX A;  4I99 C;  3V8L A;  3LA3 A;  2V6C A;  4PSW A;  5J1Y A;  1ZAO A;  4HX7 A;  2NVU B;  2DOD A;  1P6R A;  2FJ1 A;  1TLH B;  3H5A A;  1XPX A;  4XKW A;  3K70 D;  3HC7 A;  4UVB A;  1U5T B;  1BR1 A;  3F8C A;  4CSW A;  5DDG A;  2KDO A;  1DQU A;  1WH7 A;  3PFY A;  4UUT A;  4C30 A;  3WTT C;  2CO5 A;  3I3L A;  3LSG A;  2HYJ A;  3LOC A;  4H0E A;  4HQE A;  1Y0N A;  1I50 J;  1R5I D;  3OWT A;  1HCR A;  2FE3 A;  1W36 C;  2DA1 A;  2E7X A;  4QLC U;  5ERI A;  5EYR A;  2ZME A;  4BEH B;  2A6E F;  4IHX A;  1TC3 C;  3GFL A;  2LF7 A;  1HDP A;  2CW8 A;  4PFO A;  1ENH A;  2HZT A;  3IRR A;  2Y48 A;  2Z99 A;  3DP7 A;  2ZXH A;  5J47 A;  1K4T A;  3VPR A;  3H9G A;  2LR8 A;  2VQH A;  2V4J C;  1ETW A;  1MBK A;  2M4K A;  3ZR8 X;  2IS2 A;  4HF1 A;  2WB1 N;  1M1E B;  3FXJ A;  5EZH A;  2DOE A;  3IL2 A;  2NVX J;  2H27 A;  2L54 A;  3ECH A;  4BY7 J;  3BCB A;  3EUH C;  2HI3 A;  3I4P A;  5C44 J;  3W6J B;  5ILV A;  4E7I A;  1G59 A;  1IRG A;  1IN6 A;  3GW2 A;  1LPQ A;  3OY9 A;  5A2Q K;  1J59 A;  3U9G A;  4IKF A;  1WRJ A;  2GIZ A;  2MYS A;  1YOV B;  2WA0 A;  1ZK8 A;  2CW0 F;  3AG2 H;  5D5U B;  4FQG A;  1FYK A;  3BR5 A;  1I5Z A;  3MCZ A;  3ZN1 A;  2AXT C;  1T6S A;  2P6S A;  4NHJ A;  3DEW A;  2XRL A;  1B9N A;  3VSK A;  2ECB A;  1A04 A;  3SYT A;  5LD2 C;  4MO7 A;  2DN0 A;  2XC7 A;  1UHM A;  3K1N A;  2E1C A;  3S93 A;  2MH9 A;  1MMG A;  1XX5 A;  2EIJ H;  5LGT A;  1I1S A;  1UEL B;  1FOW A;  4NQW A;  3Q3S A;  1I1G A;  1I39 A;  1U0J A;  2CSO A;  4PFP A;  2HXI A;  3CUQ A;  4P55 A;  3QYF A;  4UXN A;  4N9H A;  2JPB A;  1WWX A;  1S72 I;  2BXY A;  2X1E A;  3K1M A;  3RYR A;  3G3Z A;  4DYQ A;  3KP6 A;  3RCO A;  3QP6 A;  4NB5 A;  3ZN0 A;  4D7N A;  4ZYG A;  2Q2E A;  3K70 C;  2XRN A;  4HNT A;  2ZXI A;  3H0D A;  2HOE A;  4G7H F;  2PMU A;  4NUB A;  2BY3 A;  4PDK A;  1D3Y A;  3LAJ A;  4GDF A;  5L3B A;  3S16 J;  4LMY A;  4PGH A;  4A3I J;  2XSD C;  2X48 A;  3MZ8 A;  3X2Q H;  1MND A;  3NEU A;  2PJR B;  3S17 J;  4G6T B;  1D0X A;  4XNF A;  5DCF A;  3HL2 A;  2AHQ A;  2DT5 A;  2WC2 A;  2HKO A;  3SDB A;  2KZV A;  5J4Y A;  5LHG A;  5J8F A;  3MFK A;  2JA5 J;  3WU2 C;  1FIA A;  4B3A A;  3HGY A;  1VND A;  4AC0 A;  1X1A A;  5JLW A;  3GTJ J;  2X6W A;  3BC8 A;  3GYH X;  5LBQ A;  1SFU A;  3LMM A;  1ODD A;  2ZSH B;  2R7D A;  2NAZ A;  1ZRE A;  3S3N A;  2XAU A;  5FKN A;  2K3P A;  4GFB A;  4OAZ A;  1LB2 A;  1BOB A;  1BW6 A;  3AG3 H;  2VBW A;  4AIK A;  4I0B A;  3I4M J;  1KGS A;  1R5H A;  3R0J A;  1GXP A;  1BJA A;  3PNT A;  3TOA A;  1RKW A;  2CRG A;  1SAU A;  3IH3 A;  5ILU A;  4FIS A;  2YU3 A;  3F21 A;  4IZZ A;  2LMD A;  1TZL A;  3OYD A;  1XGO A;  2EIK H;  3J7Z I;  5FLM J;  1JXS A;  2AQE A;  3HUG B;  2HU9 A;  3GFI A;  1WJA A;  1HKQ A;  1JKP C;  2LY1 A;  4BXX J;  3BTI A;  3ABK H;  1VQ4 I;  1MJB A;  4WXC A;  2IA1 A;  2QQA A;  4XR6 A;  2R7F A;  1FX7 A;  1K78 B;  2F5D A;  2FML A;  2LTP A;  4KMU X;  5ICC A;  4CGZ A;  2YX4 A;  4G6D A;  3IRQ A;  2VXZ A;  3AG4 H;  1UCR A;  1EH8 A;  3CCL I;  1ZGW A;  3S1N J;  1W4M A;  3KP7 A;  2Y9Y A;  4BQO A;  3CDI A;  3DCF A;  5F0C A;  5KHD A;  2FQ4 A;  2NRA C;  3PIP F;  2W57 A;  3D1N I;  2LP0 A;  2QSF X;  4M3E A;  3K4M A;  1UB9 A;  2AO9 A;  4C9Y A;  1BI0 A;  2E71 A;  3OS2 A;  2DT7 B;  5CQE A;  1J5Y A;  2FEZ A;  3HKZ N;  5M5W J;  1SC7 A;  1IUF A;  1O3Q A;  2EA2 A;  1AU7 A;  2FBI A;  3HYI A;  1ZRC A;  2DTR A;  4OIN F;  3T1B A;  2O5R A;  4D1Q A;  5GAG J;  3LSP A;  2O6G E;  3CCU I;  2QSG X;  3GUD A;  1GXQ A;  1QO0 D;  1T0F A;  2O7O A;  2VJJ A;  4YIR X;  1RUN A;  4KN4 X;  2HOS A;  2HZD A;  4KIG A;  3RKX A;  1MMS A;  3WGI A;  2X4H A;  3IWZ A;  5E79 C;  4HLX A;  3ERM A;  3E1S A;  4ITV A;  1WZ2 A;  1QZE A;  3OIP A;  1MGT A;  2FXA A;  4HPQ A;  3BQZ A;  2P81 A;  3SQN A;  4M9Z A;  4U0Y A;  4B1R A;  2OCE A;  1RKT A;  1U9O A;  3ZQC A;  2FOW A;  3O3K A;  1LNW A;  3HJE A;  3P5J A;  3MD2 A;  4AWX B;  1W5T A;  4G7O F;  1HOM A;  2EK5 A;  4BQA A;  5M3M J;  1W5C C;  2HTJ A;  3MKL A;  3I56 I;  1IGN A;  5DD4 A;  2L4M A;  4ZH4 F;  3BJ6 A;  4O6J A;  4Q4Z F;  3FWE A;  1XMX A;  2QA4 I;  2O3F A;  1LFP A;  3R61 A;  1P4W A;  2OF7 A;  2JA8 J;  1TTY A;  2ZNY A;  1MBG A;  3KCC A;  2EFW A;  3V7S A;  1X1P A;  2F5V A;  1MMN A;  4AUX A;  4ZTJ A;  3T5X A;  2DMP A;  3BWG A;  2VC1 A;  3K9T A;  4W1U A;  2LKX A;  1R49 A;  3G6E I;  3W6K B;  2ESN A;  2UUZ A;  2DMT A;  2WBM A;  2DA6 A;  4LB6 B;  2YX7 A;  3MKY B;  1PUF A;  1WPK A;  2IRF G;  2HEO A;  4G8X A;  3S14 J;  1YE9 A;  1TQI A;  4KUM A;  1V55 H;  2EFP A;  5EEA A;  2VQG A;  3K69 A;  1HSJ A;  2EIN H;  1BR2 A;  3OR1 C;  5J6X A;  2QBY A;  1FBU A;  2XKP A;  4HW0 A;  4XKB A;  2IW5 A;  3ROU A;  5CVI A;  2DJI A;  4KA4 A;  5HS8 A;  1SD7 A;  2K7L A;  1T33 A;  4B8X A;  1KYW A;  2EZK A;  1Q1H A;  5KCM A;  3WOD F;  2VAS A;  2MBF A;  2IGN A;  3A0H C;  4G94 A;  3DEE A;  3MVP A;  3D5R C;  3BZC A;  3CC7 I;  4M74 A;  5K7Z A;  2W48 A;  5DYM A;  3QU6 A;  5TIS C;  3G4S I;  2VQC A;  4X1E A;  1YFH A;  1NG6 A;  3WGH A;  3LSJ A;  2VOO A;  2KKO A;  3KEY A;  1FYM A;  3BR2 A;  4IJA A;  3RPU A;  4EJO A;  1YJN I;  5KK1 A;  2DU9 A;  1P7I A;  3L2W A;  1YX3 A;  1JGG A;  2O8K A;  4BH9 A;  2NOG A;  3QYB A;  2WV0 A;  2UXX A;  4UUV A;  1Z9C A;  4PSX A;  2WAF A;  5FD5 A;  1P4X A;  1S29 A;  3IP4 B;  3S2H J;  2FRH A;  1HKS A;  3JRA A;  3JCU C;  1SAN A;  4G7Z F;  3ZQH A;  2EFN A;  1FOX A;  4N4O B;  5FRM A;  5AON A;  4Z2Y A;  4L0Z B;  2ZJQ F;  1UST A;  1I27 A;  1DU6 A;  1Z77 A;  2TCT A;  5FRO A;  2LH9 A;  3I59 A;  3PFI A;  1F36 A;  2F48 A;  3TBI A;  4GO1 A;  3L1P A;  1RR7 A;  3HPG A;  2D1V A;  3HOT A;  2BHZ A;  2KJB A;  3IH4 A;  1OYI A;  1E3H A;  3LSM A;  3BJO A;  3P7N A;  3TO6 A;  4HSR A;  2DAO A;  5FB2 A;  4R79 A;  5LGN A;  1ZGJ A;  4KN7 X;  4DBQ A;  3CO7 C;  2ZME B;  4F92 B;  5LHH A;  3D5S C;  4HX4 A;  2DYS H;  4XKV A;  1RUO A;  2ZC2 A;  4BNC A;  3M7G A;  1WVR A;  4BHC A;  4WK8 F;  1LFB A;  2J5O A;  3FHZ A;  4DYR A;  5EF6 A;  4ETS A;  2IPQ X;  3MN2 A;  1I3A A;  5JVT A;  4QSH A;  5D8L B;  4OMZ A;  1K4S A;  5DEQ A;  3WTZ A;  2BZT A;  4XRF A;  3AL0 B;  2XUB A;  2R93 J;  2VIX A;  4PJL A;  5J40 A;  4W97 A;  1XSV A;  2NNY A;  3H9Q A;  5ICE A;  1Z7L A;  5FKO A;  3CCR I;  4LFU A;  5FGM A;  3WTX C;  3F23 A;  1XB4 A;  4Y17 A;  1YI2 I;  2HXO A;  2UZK A;  1QZZ A;  1FY7 A;  4L0Y B;  3L09 A;  1JTX A;  1WH5 A;  3RJP A;  5K5R A;  5EZG A;  1ULY A;  2F5C A;  4EJV A;  1Z1D A;  3QPH A;  1HLV A;  5B5E C;  1MMA A;  2EZL A;  3FXU A;  1ZR2 A;  4JYK A;  3RKW A;  1N25 A;  1IN4 A;  1JKO C;  4L5E A;  2CQN A;  3B6C A;  3CMM A;  3QOE A;  2CV2 A;  1G3Y A;  3VOE A;  5LHI A;  1P4A A;  2Y30 A;  2A3S A;  2D45 A;  4M6Y A;  4X0G A;  1TBX A;  5IT9 Z;  1OCO H;  2KL4 A;  1FTT A;  2VKV A;  3R0A A;  4NQW B;  1XDU A;  2K4B A;  2HVQ A;  4LK1 F;  1POG A;  2K3F A;  5BNG A;  4KT6 A;  3JRH A;  3MKW B;  1IF1 A;  2E36 A;  1U6G A;  1FP2 A;  4UHT A;  5E8G A;  2DK8 A;  3J81 Z;  1RI7 A;  1FOY A;  4RB1 A;  1ETV A;  4CCN A;  4KYW A;  2V1N A;  2FU4 A;  1RES A;  2Q2E B;  3GLL A;  1NK3 P;  2DA5 A;  4IPA A;  3NAU A;  2LNB A;  2NNN A;  3IKV A;  3CP8 A;  3HOS A;  1JT0 A;  2KRC A;  1LE8 A;  3K7A J;  1OJL A;  2R7S A;  3BQY A;  4IRI A;  2HGC A;  1FNN A;  2GA1 A;  4PK4 A;  3QOP A;  3S1M J;  3QPS A;  2WAQ A;  3PM1 A;  2R4G A;  4A69 C;  2Q0O A;  2W25 A;  1UG2 A;  5HS7 A;  3HSE A;  1UZC A;  2L9R A;  2MLG A;  3OMY A;  3JTH A;  2F4I A;  1D1C A;  3KLN A;  4KT5 C;  2LG4 A;  3FIS A;  2M3A A;  1R23 A;  4P9F A;  3BG9 A;  1X1C A;  1I6X A;  5E20 A;  4RAF A;  1GV2 A;  4AM3 A;  3ULQ B;  3H3V K;  3DBL B;  3L2V A;  1X2N A;  2GWR A;  2RDP A;  4J01 A;  2O0Y A;  3DWL E;  4AVP A;  2P0W A;  2X6Y A;  5F6F A;  5H20 A;  3CD6 I;  3JAM Z;  1ZR4 A;  3F8F A;  2HQR A;  2DBB A;  1YLF A;  2F2E A;  2EWN A;  5TRD A;  4IHT A;  2HOT A;  5GPC A;  3E5U A;  3FX3 A;  3V8K A;  5F0H A;  1J9I A;  2NVT J;  4ZTF A;  1WQ2 A;  3OYM A;  4ENN A;  3OYC A;  2H6B A;  3IKT A;  4AYB N;  4RBO A;  5HDN A;  4BDZ A;  3PO2 J;  4WXD A;  3OYB A;  2K02 A;  4U0V A;  1TNT A;  2OJE D;  4IF4 A;  1G3T A;  1KQ9 A;  5D6F A;  3O8H A;  4P1W A;  4I6Z A;  1TWH J;  2KLO A;  4A3E J;  2IGK A;  3A01 B;  4GGG A;  2OV7 A;  5BMZ A;  3LNQ A;  2LD5 A;  4A12 A;  3QQA A;  3K2A A;  2F5E A;  2Q1Z B;  1QNT A;  2GAU A;  5DM6 F;  2HOA A;  4A3C J;  5F64 A;  4MEY F;  1MZB A;  4G9Y A;  4RB3 C;  4KIF A;  1WKM A;  1ZQ3 P;  1G4D A;  3ECO A;  3PL8 A;  3IV5 A;  1OCR H;  4WWC A;  4YEL A;  2VT3 A;  1XSD A;  1NK2 P;  4D5C A;  1Y1V J;  3KX2 A;  3FM3 A;  5J1U A;  3M4O J;  3MZY A;  1WFX A;  1HBX G;  3MEX A;  2E1N A;  4CYC A;  3WE3 A;  3TL4 X;  4C2U A;  4HG2 A;  2CQQ A;  4V2F A;  1OCC H;  2K9N A;  2CUF A;  1B6A A;  2K85 A;  1A6Q A;  1S3J A;  1VF9 A;  4TV7 A;  1SAX A;  2V1U A;  3PSI A;  2XGD A;  2JA7 J;  2VL8 A;  2GOM A;  3F9K A;  4EAT A;  1MSE C;  1N78 A;  2DDA A;  2JMW A;  3JSP A;  1ETY A;  4XLA A;  1T38 A;  2ZJ2 A;  1VQL I;  3WTY C;  1Y6I A;  2PEX A;  3S3O A;  1WJ5 A;  3TKY A;  3KP3 A;  5B66 C;  4C3I J;  1X4P A;  2DA3 A;  3ASO H;  4OIO F;  3H35 A;  2HKX A;  3ABT A;  5DM7 F;  4OWR B;  2HYG D;  2XV4 S;  4RAY A;  2R5Y A;  3LL7 A;  1TWG J;  5IT9 K;  4BJ5 C;  1SMY F;  2EIL H;  4XMY A;  3KP4 A;  2PG4 A;  4IHS A;  4BYY A;  1AWC A;  5C3E J;  2A07 F;  1OMI A;  1OCP A;  4NC7 A;  1SFO J;  5CKT A;  1JE8 A;  5HDG A;  3J81 K;  3H92 A;  1QBJ A;  2W24 A;  1V5G A;  4Y33 A;  1XTA A;  4RLQ A;  2M7A A;  2RV8 A;  5DS9 A;  2M0C A;  4XOP A;  1PUF B;  2X0L A;  2WWY A;  2L01 A;  5FKM A;  4LB5 A;  3BOQ A;  3D5L A;  2KDZ A;  2KIQ A;  3IAS 2;  3Q0V A;  4ZYA A;  1VI0 A;  1EF4 A;  1R22 A;  2R3S A;  1O7L A;  2V26 A;  4HX8 A;  2QBY B;  4KNY A;  1ZTR A;  2DFI A;  4XLP F;  4CA0 A;  4Z6Y A;  4G6Q A;  2IGO A;  2MA3 A;  2V1X A;  2H8W A;  3MKZ A;  4EGY A;  2BW3 A;  3DTI A;  3J80 Z;  4B44 A;  3HOU J;  3OS0 A;  4ON0 A;  4BS9 A;  2EV0 A;  2EH3 A;  4JX5 A;  3HPH A;  4EM0 B;  1R1V A;  4FE4 A;  4ESF A;  3ESW B;  3JAM K;  3OYN A;  4RGX A;  4EM1 A;  3CMY A;  3VYT B;  1MH4 A;  4GYI A;  4KMF A;  4HDV A;  3T0Y A;  4R8H A;  2XPV A;  1G3W A;  4OIR F;  1XS9 A;  5F08 A;  3HGG A;  1FTZ A;  1SD5 A;  2QYO A;  4OU0 A;  3I58 A;  4MEX F;  3F8M A;  4HNU A;  3OSG A;  1IXC A;  4MQV A;  5IP9 J;  1D0Y A;  4EEF G;  5CVU A;  4IVN A;  4WCG A;  2BGC A;  4YFN F;  3IAM 2;  1MKM A;  1VQ6 I;  1D8J A;  4MFE A;  5E8I A;  2VJ4 A;  3V8J A;  5EGO A;  3WTW C;  2BHY A;  4RDU A;  1R4N B;  2H8R A;  2JN6 A;  1MBF A;  4ANJ A;  1F5T A;  1P7J A;  2CFX A;  3FXQ A;  5FKK A;  1UMQ A;  5K7H A;  1WCM J;  4RGR A;  5HLI A;  1MNM C;  4GYG A;  4D7M A;  3UKG A;  2OCC H;  2VJ5 A;  3FXO A;  3CLQ A;  5EEH A;  2P4W A;  1EV7 A;  4A5N A;  1REP C;  2D1H A;  3RPQ A;  2R7T A;  2MC4 A;  1ZLJ A;  3GO5 A;  1VQN I;  5E3M A;  1IN8 A;  5FFX A;  1FZP B;  1QHH D;  4MHG A;  4K2E A;  1FWZ A;  1VQ8 I;  5AIP A;  4UB6 C;  1HXD A;  2IJL A;  1JJ6 C;  5FLX Z;  3L2Q A;  2GXA A;  2VN2 A;  3OL4 A;  3DTE A;  5CVJ A;  5IT3 A;  2XAF A;  3CP2 A;  1E17 A;  1TWA J;  1YX5 A;  3JSO A;  3G1O A;  3J7A Y;  1HQC A;  1R71 A;  2QCO A;  4EGZ A;  2K9L A;  4BKX A;  1ZH5 A;  2EA4 A;  2HPM A;  3G73 A;  4YII A;  1UHS A;  3L2C A;  1N75 A;  1RZ4 A;  1XGS A;  2X51 A;  3H1C A;  4JBA A;  4AID A;  5E1Z B;  4BQQ A;  1YJW I;  1LQ1 A;  4XQF A;  4HEA 2;  4QPQ A;  2CH0 A;  1CF7 B;  2VLA A;  2VKH A;  2XAG A;  3JRD A;  3GTO J;  4NC8 A;  2H1L A;  3RIR A;  3V4G A;  4XLE A;  1L0O C;  1OQY A;  3R4K A;  5HDK A;  1XMA A;  1ZAR A;  4XID A;  3DKW A;  1KZH A;  3PUF A;  1OYW A;  5J8C A;  1ZG3 A;  2CFO A;  2OAZ A;  2ZFU A;  2EJR A;  5K7F A;  4HYE A;  1S6L A;  4UB8 C;  4M9X A;  2CG4 A;  3CDL A;  5K1Y A;  2WY8 Q;  3E6B A;  2HWV A;  3F6V A;  5J3L A;  4DQ2 A;  1EA3 A;  1LDJ A;  2ZCW A;  3HOY J;  4GCV A;  3WG7 H;  4CUG A;  2W1O A;  1QA6 A;  5D5V B;  1X3Z B;  1ZEL A;  1Z6R A;  4BXF A;  3C3W A;  3DF8 A;  3TO9 A;  1JJ8 C;  1IAW A;  1B8I A;  3JRI A;  2QEN A;  1KU2 A;  1ZHF A;  4I98 B;  2JUG A;  3SZT A;  2STT A;  4KDP A;  2KIM A;  4DZJ A;  3J80 K;  2JZY A;  4LK0 F;  3ZQQ A;  1YIO A;  3SFZ A;  2NS0 A;  1VQ7 I;  1F1Z A;  4F3Q A;  3PIO F;  3DKX A;  5B1A H;  2RRE A;  5JI6 A;  3C2G A;  3EYI A;  3HRT A;  2D2W A;  3BR3 A;  2M87 A;  4S05 A;  3ML6 A;  1YTY A;  2X9D A;  3HRS A;  3EUH A;  3S2D J;  3CQZ J;  4CCJ A;  4HV5 A;  3QAH A;  3U1K A;  4DZP A;  2E2I J;  2KHM A;  3BCA A;  1T95 A;  3DPL C;  4RAZ A;  3RI4 A;  4C2M J;  1S9H A;  2EV6 A;  3WG9 A;  2X85 A;  2MH2 A;  1UHW A;  4ABZ A;  3SEZ A;  4LIU A;  2JRT A;  2X6X A;  1NHA A;  2R5Z A;  1KYZ A;  1AA7 A;  2QLZ A;  3NWT A;  4D5F A;  2JTV A;  5L3F A;  4Q47 A;  2K4J A;  1IG7 A;  2XHK A;  1X3U A;  1FT9 A;  1U5T C;  1S7A A;  2XDV A;  3C1D A;  1U8R A;  1CQT A;  4LD5 A;  2VBX A;  4ZZD A;  2DMN A;  2OZU A;  3GBG A;  1BBY A;  2XGE A;  1RR8 C;  4Y52 J;  2Y0S N;  5F0F A;  3A03 A;  1HC8 A;  2HYF A;  3DBH B;  4B43 A;  3GX4 X;  2CJJ A;  3KIO A;  1U9N A;  1N77 A;  1MMD A;  2ZFW A;  1WJB A;  2DDB A;  2DMU A;  4PUS A;  1V54 H;  5JVG F;  5E1X A;  3GTP J;  2O03 A;  3FMS A;  2LC2 A;  2DPD A;  2DFH A;  1NH3 A;  4FTH A;  3DU6 A;  2L9N A;  4H4K C;  4A3J J;  2IGM A;  4XLN F;  2RN7 A;  3B73 A;  4GRI A;  2LKP A;  4DNC A;  1BC8 C;  2G7H A;  3T8R A;  3WU1 B;  1A6I A;  3AKZ A;  2W7N A;  1JTY A;  2IS6 A;  3HRU A;  1RNL A;  1XSX A;  1MDM A;  2VT2 A;  1HF0 A;  1LJ9 A;  1Z67 A;  2O61 A;  2ZO4 A;  4EMS A;  4CYC B;  5FLX K;  3QPL A;  3BJA A;  5E3N A;  4A0Z A;  2M4G A;  2Z9O A;  3TGN A;  3BZK A;  2JVG A;  1VQM I;  2VON A;  3AAF A;  4BBS J;  2I8D A;  5TJJ A;  1G6N A;  3OYJ A;  4BAY A;  3OL3 A;  1ETO A;  1LVA A;  4LLN A;  4RAG A;  4I76 A;  4IRG A;  4LLG F;  1U2W A;  4I01 A;  2Y75 A;  1T08 B;  2VBY A;  4II2 A;  4UVA A;  4OOI A;  3WGG A;  1WJE A;  3KE2 A;  4JX4 A;  1XD7 A;  2OUM A;  3ZXS A;  5BQT A;  5E18 F;  2W00 A;  4M72 A;  3VYS B;  3FDY A;  2E34 A;  4M3G A;  2ZXW H;  4XIC A;  2F4O B;  1EH6 A;  3UR3 C;  3M1E A;  3J7A O;  4A3B J;  3R6S A;  5AIQ A;  3HOV J;  2MD5 A;  1C0W A;  3WTU C;  2GXG A;  2UV1 A;  9ANT A;  3IWF A;  4QWQ A;  3S32 A;  1OCT C;  4BDY A;  3JRG A;  2Z33 A;  4AYB A;  4XN0 A;  2MSY A;  1J75 A;  2YPR A;  1D5V A;  1EKE A;  1X58 A;  1YW8 A;  3HIF A;  2WTE A;  3K6G A;  1YG2 A;  2VUM J;  3BR0 A;  2FD5 A;  4IHY A;  2FNA A;  1YYV A;  1ACI A;  3OYE A;  4DJA A;  3PNV A;  2QZ8 A;  1IV6 A;  4BGD A;  3EQL F;  3SXY A;  1GT0 C;  5L3C A;  2F5F A;  4BE0 A;  4F91 B;  2PQ8 A;  1WJC A;  3FK6 A;  5D6E A;  4I0A A;  3DTK A;  3ABU A;  2BXZ A;  3TW7 A;  1KON A;  1WJD A;  3GZ6 A;  3C2B A;  3ABL H;  2LY2 A;  1IDZ A;  2Y0M A;  4OIQ F;  3BLY A;  1LDD A;  1QU3 A;  5D4S A;  2R0Q C;  4ENJ A;  1XC5 A;  1VQ9 I;  2GLO A;  4XM3 A;  1YIJ I;  2EBI A;  2CWE A;  2ESH A;  2EFQ A;  2DQL A;  1GHC A;  3KET A;  1X1D A;  2BW3 B;  2XAH A;  1UJ8 A;  3CJR B;  4LG3 A;  4Y3O A;  2L02 A;  2HVR A;  1ZYR F;  2LOO A;  1IN7 A;  1DGR M;  4HF2 A;  4BEH A;  2ZB9 A;  3WU0 A;  1JHH A;  2DA2 A;  2Z2S B;  2K86 A;  3H5R A;  3KYC B;  1NG7 A;  3M8F A;  4D0P A;  4XRS A;  4IXA A;  4LOC A;  1BI1 A;  3W2A A;  2GZW A;  2IA2 A;  4IHW A;  5FKL A;  1H9G A;  1BC7 C;  2CW7 A;  1WSU A;  2JWT A;  4PJM A;  2OQG A;  1FMV A;  4B47 A;  3B6A A;  5HOD A;  3FBI B;  2OZ6 A;  3HM5 A;  3HSF A;  1KU7 A;  3BP8 A;  4KFC A;  2V7F A;  1UFM A;  4XSZ F;  3K4J A;  2VPL A;  4A6E A;  1YHQ I;  5EGO B;  2RQP A;  2L3D A;  2QQ8 A;  3HOZ J;  5BS6 A;  4FT8 A;  3GWZ A;  1A5J A;  1MBJ A;  2HQA A;  2JSP A;  4U87 A;  2E1M B;  2EZI A;  3RSN A;  2FBK A;  2FA5 A;  2V9P A;  2QEX I;  4A93 J;  2EFO A;  2ZXJ A;  1Y0U A;  3K4K A;  2WV1 A;  1USS A;  3U1D A;  3E0J B;  3CCM I;  3QP5 A;  3CES A;  4CXF A;  4CCO A;  5KVR A;  4N0B A;  4M6V A;  2R7Z J;  2EZH A;  5ED4 A;  5C4J J;  2KRH A;  2KMU A;  3RZO J;  3ZP5 A;  4A3L J;  3HSR A;  1FC3 A;  3OOU A;  3L7W A;  4L5I A;  3ZMU A;  3H5N A;  1WJF A;  3I9V 2;  4HF0 A;  4L9V A;  4XK4 A;  1U3E M;  1Y8Q B;  4HA8 A;  1T39 A;  1WI3 A;  5ILS A;  3JRE A;  3GCM A;  3ZRG A;  3CJN A;  3ZQI A;  3V7R A;  1O7F A;  1SD6 A;  3DV8 A;  3L9F A;  1XCV A;  3HZJ A;  2R7O A;  4ZJZ A;  5F27 A;  3CUQ B;  1TT5 B;  3IH2 A;  1YO5 C;  5GAH J;  4RM3 A;  2I5U A;  4C3J J;  1GDT A;  3LST A;  3DPT A;  1RPW A;  4ZYH A;  2WAD A;  4NBQ A;  3GTL J;  2PJR A;  4XRM A;  1O3R A;  4KJZ A;  4E70 A;  1TW3 A;  2K40 A;  4MTD A;  1G2H A;  2RNG A;  3FXK A;  3HBL A;  1GVJ A;  4PJN A;  4IQ4 A;  2O8X A;  2XF5 A;  1T2K A;  1F4K A;  1XG1 A;  1X1B A;  3BPV A;  3IC7 A;  1FLI A;  2BVL A;  4A3D J;  2PI0 A;  4A3G J;  4M3F A;  2AXL A;  2X1D A;  3CUO A;  1VFC A;  2EQR A;  4MIM A;  5C4X J;  4MGR A;  4PCQ A;  4IEJ A;  2KPM A;  2XSJ C;  2Y9Z A;  2DLL A;  5DTD A;  2WB1 A;  1F43 A;  2VC0 A;  4I09 A;  3TO7 A;  3A0B C;  3TW6 A;  2V9K A;  2Z5U A;  3JTG A;  2DK5 A;  4M73 A;  2BBY A;  3FIW A;  2LBF A;  3GLX A;  3E7L A;  4WXH A;  2KFD A;  1YW7 A;  1DGW Y;  4I02 A;  3QWL A;  2PMZ N;  1DP7 P;  1R4M B;  2EIM H;  2NXN B;  3KP2 A;  4ZZL A;  3GME A;  1BL0 A;  4IQJ A;  2K9S A;  4DGW B;  5D5W B;  2JUC A;  1B8I B;  5D8K B;  2CUJ A;  4CYD A;  1K79 A;  1VQ5 I;  2ICW G;  1R6R A;  5IYD J;  2OBP A;  2Z16 A;  1I3Q J;  4HV6 A;  1Z05 A;  4XL9 A;  1JI8 A;  1HA8 A;  3TP3 A;  1AOY A;  4FHT A;  1X2M A;  2BVM A;  2G7U A;  1P2F A;  3RQ4 A;  5LFA A;  4MFD A;  2L7M P;  1DDN A;  3K4B A;  1O57 A;  4ZDO A;  3ZQL A;  1ORK A;  1B1B A;  2IEK A;  3K4L A;  5JHF A;  2FUG 2;  2DI3 A;  2M1B A;  4A0Y A;  5DD8 A;  3OYK A;  1NTC A;  1W5S A;  3EPZ A;  2IP2 A;  5M5X J;  3PUB A;  1MBE A;  3S1Q J;  4KIC A;  3TDZ C;  1JGS A;  2JA6 J;  5IPA A;  3M8J A;  1OIS A;  1FOK A;  2LLK A;  3REO A;  2R5Z B;  1OCZ H;  2W82 A;  2RNJ A;  3F0C A;  1TT0 A;  2JSC A;  2L9S A;  2M8G X;  4YRV A;  2Y69 H;  2DMQ A;  4F52 A;  3SHF A;  2PFB A;  3N05 A;  2A05 A;  2HQN A;  1PVE A;  5HS9 A;  2OPT A;  2V1D A;  2MGQ A;  2XIG A;  4RLF A;  3U2R A;  3S15 J;  2J5P A;  2KQR A;  3FM5 A;  2B0L A;  2ZME C;  4HOB A;  2H1K A;  1TNS A;  3E6M A;  3MWM A;  4B09 A;  2COB A;  3UNG C;  3K0L A;  5CYV A;  1G8X A;  4NDL A;  5CJ9 A;  4UUS A;  2FF4 A;  1R7J A;  2CUE A;  1B9M A;  4D9J A;  2RAE A;  3VSL A;  1FPQ A;  3JW4 A;  3OIQ A;  4B48 A;  1IV8 A;  4S04 A;  1VQO I;  2OA4 A;  3M07 A;  3CCS I;  5D5X B;  3E97 A;  3GTQ J;  2R92 J;  3AL0 C;  2QM3 A;  3A1Y A;  4B4C A;  3MZH A;  2DW4 A;  4EQQ A;  1W36 D;  2LF8 A;  3M1C A;  2P5V A;  3P9I A;  1DP3 A;  3OIO A;  5D4R A;  3C7J A;  3L00 A;  3EUA A;  4A3K J;  2JK3 A;  2EB7 A;  3ZMT A;  4CCK A;  2OTJ I;  1A31 A;  5HLH A;  3OOP A;  3F8N A;  4RMN A;  3RZD J;  2VE9 A;  2KIU A;  3CCE I;  3HOW J;  3KLO A;  1HW1 A;  3KYD B;  3DLL F;  3Q9S A;  2R7X A;  3RQI A;  3U21 A;  4II3 A;  2XAS A;  4WF2 A;  4ZDL A;  1ZG5 A;  2VQL A;  2EV5 A;  3NWS A;  5EG0 A;  2E35 A;  4YEJ A;  5B3S H;  5EEG A;  1OKR A;  3TOB A;  2BV6 A;  2D5V A;  1Y39 A;  1IN5 A;  3FMR A;  2HVS A;  3LSK A;  3WTV C;  2L7K A;  4AVZ A;  3EYY A;  2UXN A;  2FSW A;  3W6V A;  2MC3 A;  3CDH A;  3P9K A;  3HKZ A;  2V9V A;  3HOX J;  1PP8 F;  4XON A;  1FBQ A;  2XF6 A;  4M9S A;  1S5L C;  3CZ6 A;  2RC4 A;  5F04 A;  2VOD A;  3R60 A;  3CCQ I;  1MD0 A;  1Y56 A;  3HEF A;  2B9S A;  2MLK A;  5K5Q A;  5HLG A;  2B63 J;  5E17 F;  4ENM A;  4P5O A;  5DUI A;  1WHU A;  3S3M A;  3A02 A;  2NVY J;  3I64 A;  4ZYD A;  2RQQ A;  3OR2 C;  2KZG A;  2HS5 A;  2DYR H;  3SFI A;  1VZ0 A;  3KFW X;  1TL8 A;  3BR1 A;  4BU2 A;  2M5W A;  1KA8 A;  5B1B H;  3CMA I;  4MNU A;  2FBH A;  1W7P A;  1IRZ A;  2ELH A;  1JKR C;  4PJJ A;  4CHU A;  1LEB A;  2P6T A;  2ID3 A;  3KEO A;  3VDX A;  2QKL B;  1BI2 A;  1JHF A;  3BPX A;  2VPR A;  4ASN A;  2QSH X;  1BR4 A;  4E4H A;  2JJ7 A;  2DXI A;  4U0W A;  1IXR C;  4ZC3 A;  4EVI A;  2HR3 A;  3LAP A;  3ONQ A;  2PJP A;  5JHU A;  3I55 I;  2F6C A;  4L9J A;  2CV0 A;  3F22 A;  2CYY A;  3K4C A;  2PN6 A;  3QOD A;  3I59 B;  4L9N A;  3GF2 A;  3WHC A;  2KIF A;  3GEZ A;  1XGN A;  2GQQ A;  3FXL A;  4E7Z A;  2R7W A;  3QYE A;  1Z6T A;  2KP6 A;  2QVO A;  1BA5 A;  5BPD A;  1MJ9 A;  1HW2 A;  3PQK A;  5JLX A;  2A6H F;  2WAQ N;  4RM2 A;  5IP7 J;  5L3G A;  1E0E A;  2MFZ A;  3DFG A;  4RB0 A;  2IVM A;  1QRY A;  3OS1 A;  4FX4 A;  1AHD P;  4YFX F;  2R7R A;  3DEU A;  4XOR A;  3PO3 J;  5L3E A;  1YW9 A;  1E3P A;  1SFX A;  2DFF A;  3E3V A;  2ME6 A;  4ESJ A;  4DBR A;  1LKX A;  4MQ9 F;  2MG4 A;  4WX9 A;  3H3U A;  4BHB A;  5GTH C;  5IOZ A;  1O3T A;  1XMK A;  1YRN A;  5CVV A;  2OU2 A;  1YS7 A;  3K1P A;  1GV5 A;  5LEK A;  3L2R A;  2FX0 A;  3NAR A;  5DCM A;  2XGC A;  2ZBK A;  3GTK J;  2H09 A;  4FCY A;  2XVC A;  4UVC A;  5KAF C;  2CMP A;  3N97 A;  1T0F C;  2F4M B;  2V6E A;  1GVD A;  2LK2 A;  1GUU A;  2LKS A;  3W3C A;  4XLF A;  3HG9 A;  4CO8 A;  1Y1W J;  4L18 B;  2M8E A;  2CQ7 A;  5KAI C;  4KIT B;  4EJT A;  4LIT A;  3RPU D;  3Q5F A;  1HDD C;  2DA7 A;  2BOL A;  3LSH A;  2OTL I;  1K83 J;  3CCV I;  3ZGK A;  2IA0 A;  1YIT I;  3B02 A;  2GIV A;  1KU9 A;  2V79 A;  2COM A;  4BJT A;  2X1C A;  3OYI A;  3KZY A;  4ZDP A;  2DQR A;  3LSI A;  4V2G A;  1K61 A;  2ME0 A;  2E7W A;  2K5C A;  3JR9 A;  3Q9V A;  5HVQ C;  3G1L A;  3SZG A;  1IC8 A;  3BZ6 A;  1Z21 A;  3GXO A;  2G0E A;  4DW6 A;  2L5Q A;  5E3O A;  1EJ9 A;  3CC4 I;  1MH3 A;  3TQN A;  3CO6 C;  2M7B A;  2JVH A;  3WTS C;  2OC6 A;  2YS9 A;  1MW7 A;  1J2X A;  2ZJR F;  2ELJ A;  4E7J A;  4P9U A;  1TQP A;  2JRM A;  1LE8 B;  4BBR J;  3OYF A;  2E5N A;  2A5W A;  5IYB J;  2A68 F;  1A36 A;  1SFE A;  2VB6 A;  2HPI A;  2QQ9 A;  5CQG A;  3J7Y J;  2BY2 A;  5ICF A;  4UV8 A;  2JQ7 A;  1AKH A;  1W0T A;  4QIW N;  1QHG A;  4EJW A;  2BE5 F;  3EDP A;  1WI9 A;  2P7V B;  2M0M A;  4RB2 C;  3PQJ A;  3VWB A;  2AS5 F;  3HXL A;  4QPO A;  3LSR A;  2BY1 A;  2LBF B;  1L3L A;  3BT9 A;  3H36 A;  3HTU A;  4XKC A;  1PYV A;  2L2O A;  3RDI A;  2HDD A;  1JUS A;  4HRI A;  1O4X A;  3BTC A;  3TP0 A;  2IAI A;  4MTE A;  3VB2 A;  3IHU A;  5EJC A;  3VYU B;  4BXU A;  2VJI A;  1UAA A;  2LY9 A;  5IYC J;  4UY8 I;  1FBS A;  2PMH A;  3PJR A;  1D0Z A;  1H0M A;  1RET A;  3FKI J;  3A01 A;  1VTN C;  2WAE A;  3S2W A;  4FET A;  4AD9 A;  2XRO A;  4XSX F;  2DA4 A;  3H3Z A;  4R1H A;  1TWC J;  4BHP A;  3VEP A;  3CCY A;  3KZI C;  1IW7 F;  1VQK I;  3V7C A;  2RGV A;  1TQM A;  2CV1 A;  4IOA F;  3VFZ A;  4BUP A;  1V5E A;  1QZY A;  2ISY A;  2L0K A;  3ZQ7 A;  5EDN A;  2LVS A;  1RIO H;  3VYR B;  4DYC A;  6PAX A;  5GP9 A;  5F1J A;  1IXS B;  1HST A;  2KJC A;  1B72 A;  4LG0 A;  1SFK A;  3CTA A;  4A3M J;  1IRX A;  4CH7 A;  4JX6 A;  3ZMV A;  3F72 A;  1FIP A;  1T98 A;  2JPC A;  2XKO A;  2AQF A;  2NVQ J;  3T8T A;  3AFH A;  2QWW A;  5JR3 A;  1QVT A;  3SEQ A;  4HBL A;  3SJM A;  3GTG J;  2VKE A;  3LWF A;  2M30 A;  5J4V A;  1F9N A;  1TP4 A;  4BY1 J;  1W0U A;  1T8I A;  1QQI A;  1W1W E;  2RVC A;  3KP5 A;  1LDK B;  4HNV A;  3CLO A;  1X4O A;  2PX9 A;  2QGU A;  3MMY B;  4M3B A;  4RGU A;  4XOT A;  3TDU C;  5FD6 A;  5H6Q A;  3CME I;  1OFC X;  3KZZ A;  3CJQ B;  2Y2Z A;  2VE8 A;  4AU7 A;  4P96 A;  1X19 A;  1XDS A;  1B59 A;  3BR6 A;  3HB9 A;  2GA2 A;  4UUS B;  4YFK F;  4MLO A;  3I53 A;  1MJA A;  3AG1 H;  1SEU A;  3DXJ F;  2GXB A;  2ZJP F;  4FX0 A;  1Z7U A;  2XGX A;  2XPU A;  4YG2 F;  3BTL A;  3LQQ A;  2PMZ A;  1D8K A;  5LGU A;  1I6H J;  1ETX A;  5JFR A;  3CJT B;  2P5K A;  4L5J A;  3RTR A;  2P5L C;  1Z3X A;  1P9Q C;  2R5Y B;  3ZMD A;  1TWF J;  1R00 A;  3PSF A;  1YS6 A;  1BOA A;  2P8T A;  4HST A;  2XAQ A;  2HFH A;  1BJZ A;  2HQ5 A;  2XPW A;  3JRB A;  5CLS A;  2YU9 J;  1V5F A;  4GXO A;  1JUM A;  3OYG A;  4IHV A;  4O5V A;  1OR7 C;  3N4M A;  4M6X A;  2W4S A;  4HAM A;  4KIB A;  3ZMS A;  3ISP A;  4JQF A;  4EJU A;  5EG0 B;  3E5X A;  3BG5 A;  1PJR A;  5M5Y J;  2HDW A;  5F1R A;  2KRF A;  5HNF A;  3CCJ I;  4IL6 C;  4BAC A;  3FHN A;  1QPI A;  3HHH A;  3ZQF A;  1MBH A;  5TGT A;  1ETK A;  3BG6 A;  2CUZ A;  4E6K G;  2OD5 A;  3TED A;  1WGX A;  3QPT A;  2R7Q A;  2NS7 A;  2K9Q A;  4A6D A;  4S0H B;  2STW A;  3D0S A;  1U5T A;  1V3F A;  2Q8K A;  2FNP A;  4PGG A;  3OYL A;  4A0X A;  5GTI C;  3DBR B;  1KU3 A;  2I10 A;  4PZJ A;  1Q1V A;  1ZRF A;  4IX7 A;  2VKD A;  1XCB A;  1SVO A;  3H0G J;  3K2Z A;  4HLY A;  2M45 A;  3Q0U A;  1Z91 A;  1MIJ A;  3BG3 A;  4JOM A;  4Q5S F;  3BTJ A;  3GFM A;  1T56 A;  2KIS A;  5J1R A;  1RC9 A;  2DOA A;  3I71 A;  2CU7 A;  1D5Y A;  3Q0W A;  1FSH A;  3E6C C;  2XF7 A;  1J09 A;  1OLT A;  2YUS A;  1FP1 D;  4XRS G;  1E3O C;  2C6Y A;  1JUP A;  2M34 A;  3FF5 A;  4ENK A;  1CGP A;  4EM2 A;  1W7P B;  4XN3 A;  5CPR B;  3RYP A;  5LLQ A;  2FQ3 A;  3JRC A;  3MAJ A;  3S1R J;  1ZGA A;  1IDY A;  1JKQ C;  1ZKG A;  1IJW C;  1KQ0 A;  4M71 A;  4BQN A;  1P92 A;  4A5M A;  2MW8 A;  4UNO A;  2GBY A;  1B4A A;  5LEJ A;  1R5G A;  3G2B A;  3NQO A;  4F55 A;  3DKY A;  1STZ A;  2VBZ A;  4LIV A;  4G12 A;  3NRV A;  1J0R A;  2E2H J;  3SZP A;  2LYC A;  1HW5 A;  1U8B A;  2L7F P;  5LRS A;  3IUO A;  2E5Z A;  4N9I A;  5E3L A;  4RS8 A;  3BRO A;  4C2T A;  4DOZ A;  1Z0X A;  4XBF A;  1K6O A;  2IXS A;  1OYY A;  3OV8 A;  3M3Y J;  3S8P A;  3BDD A;  4CIC A;  3OYH A;  3WE2 A;  3K10 A;  1UG0 A;  2DT6 A;  2DO7 A;  4I7H A;  3L2U A;  2JA2 A;  1R9T J;  2GM4 A;  1HKT A;  1PUE E;  4X6A J;  3H9J A;  5DV5 A;  4J00 A;  3M8E A;  4NC6 A;  1ETQ A;  2ID6 A;  3EUK L;  3FZV A;  3V42 A;  1IRF A;  1BM9 A;  1Z3Y A;  4BL0 B;  3ZMZ A;  5M3F J;  4Q48 A;  3KPH A;  4OMY A;  3ASN H;  2K9M A;  1YRN B;  2NYX A;  4PJ0 C;  3WHB A;  3BY6 A;  3W2W A;  4CZC A;  3MQ0 A;  4Y4R A;  1DU0 A;  2RKH A;  1H8A C;  5HLT A;  2YR2 A;  5DCM B;  4UV9 A;  3A2K A;  4U88 A;  2Y31 A;  4RGS A;  2BY0 A;  1OR7 A;  1ON2 A;  3GZ5 A;  4Y7N J;  2BYV E;  1RRJ A;  1D1A A;  3ZOB A;  4NNJ A;  4U7B A;  2DJN A;  1CF7 A;  3O2P E;  2QUF A;  1FEX A;  3FK7 A;  1R1U A;  1MSF C;  3LA2 A;  3QU3 A;  4HDU A;  2CS3 A;  1DPR A;  4BJ6 C;  1X3W B;  2L4A A;  2IS1 A;  1LFU P;  4EV0 A;  4IO9 F;  5BOX A;  1ZN2 A;  3O6B B;  3JRF A;  4CCM A;  1JT6 A;  4F93 B;  3DPU A;  3EET A;  3ZPL A;  1ERD A;  2BEO A;  3LFU A;  3G1M A;  1W7P D;  4FAS D;  4Y15 A;  4QTR A;  2JT1 A;  4KIS A;  2ZKZ A;  3CF5 F;  2DTZ A;  4CCL A;  5FRN A;  5FJ8 J;  1PDN C;  2P7C B;  4I2O A;  3ERE D;  4O3M A;  4IOC F;  2HTS A;  1H88 C;  1PP7 U;  1BIA A;  5LRR A;  3F3X A;  4B3X A;  4Y13 A;  2IS4 A;  1ZLK A;  3O8G A;  2MD0 A;  2PLY A;  3HRM A;  1SD4 A;  1XGM A;  2FOK A;  1FMW A;  2H94 A;  2ZNZ A;  3ZCO A;  4BE1 A;  3PNY A;  4YIF A;  2UWM A;  3A4C A;  2IT0 A;  3HUG A;  3F6O A;  1K7A A;  2KT0 A;  2DCE A;  3SDG A;  2DFE A;  3HTS B;  1IUY A;  5FLV A;  2VXD A;  1K78 A;  4ESB A;  4V19 K;  1LUJ B;  1AKH B; 
#chains in the Genus database with same CATH homology
 4CZZ A;  3COA C;  3E5Q A;  2YSR A;  1FSE A;  3LQR A;  3VOD A;  4F7Z A;  5BPI A;  3P9C A;  1XN7 A;  1QGP A;  3QRF F;  4L9T A;  4HQM A;  3M9A A;  2DPU A;  2HDC A;  5CVR A;  2ADU A;  1ZG1 A;  2A69 F;  1OPC A;  3F8B A;  3ELK A;  3C18 A;  5ICG A;  1S8N A;  1SMT A;  3E6D A;  1J7K A;  4LJZ F;  2QQB A;  2G9W A;  2VOP A;  1ON1 A;  4JK1 X;  1YQA A;  1DPU A;  2A5Y B;  1U78 A;  5DUK A;  4IRH A;  1EH7 A;  2Z3Y A;  3LA7 A;  4LG0 B;  5A2Q Z;  4OIP F;  2CQK A;  1H9T A;  2XAJ A;  4HZF A;  1ZRD A;  3DQV C;  1TW2 A;  1MDM B;  2ISZ A;  2FMY A;  2PBI A;  4ZYE A;  4AIH A;  1KQ8 A;  4LGW A;  5FO5 A;  1R1T A;  1E2X A;  5FFZ A;  3I0T A;  2H6C A;  1O3S A;  3FMQ A;  4AIJ A;  1QPM A;  1S7O A;  1G3S A;  1BIB A;  5L3D A;  2W85 A;  5HOO A;  4A2U A;  4LLL A;  1ONV A;  2TDX A;  3KEQ A;  1IZ1 A;  1LEA A;  3FXR A;  1BI3 A;  2OQR A;  3LFK A;  2ETH A;  1R36 A;  2W84 A;  3HHG A;  3CUQ C;  3I5U A;  4U7D A;  1V4R A;  5H6R A;  2LDU A;  2LSO A;  3RKY A;  1BN5 A;  4CDG A;  1DUX C;  2CGP A;  3GVA A;  1R58 A;  3I54 A;  2A61 A;  2ACJ A;  1FYL A;  3GFJ A;  2K27 A;  5K5O A;  5E1W A;  3V8L A;  3LA3 A;  2V6C A;  1ZAO A;  4HX7 A;  1P6R A;  1TLH B;  4UVB A;  1U5T B;  3F8C A;  5DDG A;  3WTT C;  2CO5 A;  4HQE A;  4H0E A;  2FE3 A;  2E7X A;  4QLC U;  5ERI A;  2ZME A;  2A6E F;  3GFL A;  2LF7 A;  3IRR A;  2HZT A;  2Y48 A;  2Z99 A;  3DP7 A;  4HF1 A;  3IL2 A;  2H27 A;  2L54 A;  3ECH A;  3I4P A;  3W6J B;  5ILV A;  1IRG A;  1IN6 A;  3GW2 A;  5A2Q K;  1J59 A;  3U9G A;  1WRJ A;  2CW0 F;  5D5U B;  1FYK A;  1I5Z A;  3MCZ A;  3ZN1 A;  4NHJ A;  1T6S A;  2P6S A;  1B9N A;  1A04 A;  1UHM A;  3K1N A;  2E1C A;  2MH9 A;  5LGT A;  1I1S A;  4NQW A;  1I1G A;  2CSO A;  3CUQ A;  4P55 A;  4UXN A;  4N9H A;  2JPB A;  1WWX A;  3K1M A;  3RYR A;  3G3Z A;  3KP6 A;  4ZYG A;  3QP6 A;  4NB5 A;  3ZN0 A;  2Q2E A;  2XRN A;  2HOE A;  4G7H F;  2PMU A;  4PDK A;  1D3Y A;  3LAJ A;  5L3B A;  4LMY A;  4PGH A;  3NEU A;  5DCF A;  2DT5 A;  2WC2 A;  2HKO A;  5LHG A;  5J8F A;  3MFK A;  3GYH X;  5LBQ A;  1SFU A;  1ODD A;  2R7D A;  2NAZ A;  1ZRE A;  1LB2 A;  2VBW A;  4AIK A;  4I0B A;  1KGS A;  1R5H A;  3R0J A;  1GXP A;  1BJA A;  3TOA A;  5ILU A;  2YU3 A;  3F21 A;  1XGO A;  1JXS A;  3GFI A;  1HKQ A;  1MJB A;  4WXC A;  2IA1 A;  2QQA A;  2R7F A;  1FX7 A;  1K78 B;  2F5D A;  2FML A;  4KMU X;  5ICC A;  4CGZ A;  2YX4 A;  4G6D A;  3IRQ A;  2VXZ A;  1UCR A;  1EH8 A;  1W4M A;  3KP7 A;  2NRA C;  2W57 A;  1UB9 A;  1BI0 A;  1J5Y A;  2FEZ A;  1O3Q A;  2EA2 A;  2FBI A;  3HYI A;  1ZRC A;  2DTR A;  4OIN F;  3T1B A;  2O6G E;  3GUD A;  1GXQ A;  1QO0 D;  1T0F A;  1RUN A;  4KN4 X;  4KIG A;  3RKX A;  3WGI A;  2X4H A;  3IWZ A;  4HLX A;  1MGT A;  2FXA A;  3SQN A;  4M9Z A;  4U0Y A;  3O3K A;  1LNW A;  4AWX B;  1W5T A;  4G7O F;  2EK5 A;  4BQA A;  2HTJ A;  5DD4 A;  2L4M A;  4ZH4 F;  3BJ6 A;  4O6J A;  4Q4Z F;  3FWE A;  2O3F A;  3R61 A;  1P4W A;  1TTY A;  2ZNY A;  2EFW A;  3KCC A;  3V7S A;  3T5X A;  3BWG A;  2VC1 A;  3K9T A;  3W6K B;  2ESN A;  4LB6 B;  2YX7 A;  2IRF G;  2HEO A;  4G8X A;  1TQI A;  4KUM A;  2EFP A;  3K69 A;  1HSJ A;  5J6X A;  2QBY A;  1FBU A;  2XKP A;  4HW0 A;  2IW5 A;  3ROU A;  5CVI A;  4KA4 A;  5HS8 A;  1SD7 A;  2K7L A;  4B8X A;  1KYW A;  1Q1H A;  3WOD F;  2MBF A;  4G94 A;  4M74 A;  5DYM A;  3QU6 A;  1YFH A;  3WGH A;  2VOO A;  2KKO A;  1FYM A;  4IJA A;  3RPU A;  4EJO A;  5KK1 A;  2DU9 A;  4BH9 A;  2WV0 A;  2UXX A;  4UUV A;  1Z9C A;  5FD5 A;  1P4X A;  1S29 A;  2FRH A;  1HKS A;  4G7Z F;  2EFN A;  5AON A;  4Z2Y A;  4L0Z B;  1UST A;  1I27 A;  3I59 A;  3PFI A;  4GO1 A;  2D1V A;  3HOT A;  2KJB A;  1OYI A;  3P7N A;  3BJO A;  3TO6 A;  2DAO A;  5FB2 A;  4R79 A;  5LGN A;  1ZGJ A;  4KN7 X;  3CO7 C;  2ZME B;  5LHH A;  4HX4 A;  1RUO A;  4BNC A;  3M7G A;  4BHC A;  4WK8 F;  2J5O A;  3FHZ A;  4ETS A;  2IPQ X;  5JVT A;  5D8L B;  4OMZ A;  5DEQ A;  3WTZ A;  4XRF A;  2XUB A;  1XSV A;  2NNY A;  5ICE A;  4LFU A;  5FGM A;  3WTX C;  3F23 A;  1XB4 A;  4Y17 A;  2UZK A;  1QZZ A;  1FY7 A;  4L0Y B;  3L09 A;  3RJP A;  5K5R A;  1ULY A;  2F5C A;  4EJV A;  1Z1D A;  3QPH A;  3FXU A;  3RKW A;  1IN4 A;  1G3Y A;  3VOE A;  5LHI A;  1P4A A;  2A3S A;  2D45 A;  4M6Y A;  1TBX A;  5IT9 Z;  3R0A A;  1XDU A;  2K4B A;  4LK1 F;  1IF1 A;  1U6G A;  1FP2 A;  4UHT A;  5E8G A;  2DK8 A;  3J81 Z;  1RI7 A;  4RB1 A;  4KYW A;  2FU4 A;  4IPA A;  2LNB A;  2NNN A;  3IKV A;  3HOS A;  4IRI A;  2HGC A;  1FNN A;  2GA1 A;  3QOP A;  2Q0O A;  2W25 A;  5HS7 A;  3HSE A;  2MLG A;  3JTH A;  3KLN A;  4KT5 C;  1R23 A;  4P9F A;  1I6X A;  5E20 A;  3ULQ B;  2GWR A;  2RDP A;  2O0Y A;  4AVP A;  5F6F A;  5H20 A;  3JAM Z;  3F8F A;  2HQR A;  2DBB A;  1YLF A;  2F2E A;  2EWN A;  5TRD A;  4IHT A;  3E5U A;  3FX3 A;  3V8K A;  1J9I A;  1WQ2 A;  4ENN A;  2H6B A;  3IKT A;  5HDN A;  4WXD A;  2K02 A;  4U0V A;  1TNT A;  4IF4 A;  1G3T A;  1KQ9 A;  5D6F A;  4GGG A;  5BMZ A;  4A12 A;  2F5E A;  1QNT A;  2GAU A;  5F64 A;  4MEY F;  1MZB A;  4G9Y A;  4RB3 C;  4KIF A;  1WKM A;  1G4D A;  3ECO A;  4WWC A;  2VT3 A;  1XSD A;  3FM3 A;  3MZY A;  1HBX G;  3MEX A;  2E1N A;  3WE3 A;  1B6A A;  1S3J A;  4TV7 A;  1SAX A;  2V1U A;  3JSP A;  1T38 A;  2ZJ2 A;  3WTY C;  2PEX A;  3TKY A;  3KP3 A;  4OIO F;  2HKX A;  3ABT A;  2HYG D;  2XV4 S;  4RAY A;  5IT9 K;  1SMY F;  3KP4 A;  2PG4 A;  4IHS A;  4BYY A;  1AWC A;  2A07 F;  1OMI A;  1JE8 A;  5HDG A;  3J81 K;  3H92 A;  1QBJ A;  2W24 A;  2RV8 A;  2X0L A;  2WWY A;  2L01 A;  4LB5 A;  3BOQ A;  3D5L A;  1R22 A;  2R3S A;  1O7L A;  4HX8 A;  2QBY B;  4KNY A;  2DFI A;  4XLP F;  4G6Q A;  2MA3 A;  2V1X A;  4EGY A;  3J80 Z;  4ON0 A;  2EV0 A;  4EM0 B;  1R1V A;  4ESF A;  3JAM K;  4RGX A;  4EM1 A;  4GYI A;  4KMF A;  4HDV A;  3T0Y A;  4R8H A;  4OIR F;  1G3W A;  1SD5 A;  2QYO A;  4OU0 A;  3I58 A;  4MEX F;  3F8M A;  1IXC A;  4MQV A;  5CVU A;  4IVN A;  4WCG A;  2BGC A;  4YFN F;  1MKM A;  1D8J A;  5E8I A;  3V8J A;  3WTW C;  1F5T A;  2CFX A;  3FXQ A;  4RGR A;  5HLI A;  4GYG A;  5EEH A;  2P4W A;  1EV7 A;  4A5N A;  1REP C;  2D1H A;  3RPQ A;  1ZLJ A;  3GO5 A;  1IN8 A;  5FFX A;  1FZP B;  4MHG A;  4K2E A;  1FWZ A;  5AIP A;  1HXD A;  2IJL A;  5FLX Z;  2VN2 A;  5CVJ A;  5IT3 A;  2XAF A;  1E17 A;  3JSO A;  1HQC A;  4EGZ A;  1ZH5 A;  2EA4 A;  3G73 A;  4YII A;  3L2C A;  1RZ4 A;  1XGS A;  4JBA A;  1LQ1 A;  5E1Z B;  1CF7 B;  2XAG A;  3RIR A;  3V4G A;  1L0O C;  5HDK A;  3R4K A;  1XMA A;  1ZAR A;  3DKW A;  1OYW A;  5J8C A;  1ZG3 A;  2OAZ A;  2EJR A;  4HYE A;  1S6L A;  4M9X A;  2CG4 A;  5K1Y A;  3E6B A;  2HWV A;  3F6V A;  4DQ2 A;  1LDJ A;  2ZCW A;  4GCV A;  5D5V B;  1Z6R A;  3C3W A;  3DF8 A;  3TO9 A;  1IAW A;  2QEN A;  1KU2 A;  1ZHF A;  4I98 B;  2STT A;  3SZT A;  4KDP A;  2KIM A;  3J80 K;  2JZY A;  4LK0 F;  1YIO A;  3SFZ A;  2NS0 A;  1F1Z A;  5JI6 A;  3EYI A;  3HRT A;  2D2W A;  2M87 A;  4S05 A;  3ML6 A;  1YTY A;  3HRS A;  3EUH A;  4HV5 A;  3QAH A;  3DPL C;  4RAZ A;  3RI4 A;  2EV6 A;  3WG9 A;  2MH2 A;  1UHW A;  2JRT A;  1NHA A;  1KYZ A;  2QLZ A;  2JTV A;  5L3F A;  4Q47 A;  2K4J A;  2XHK A;  1X3U A;  1FT9 A;  1U5T C;  1S7A A;  3C1D A;  1U8R A;  4LD5 A;  2VBX A;  4ZZD A;  2OZU A;  1BBY A;  2HYF A;  3GX4 X;  2ZFW A;  5E1X A;  2O03 A;  3FMS A;  2DPD A;  4XLN F;  2RN7 A;  3B73 A;  2LKP A;  4DNC A;  1BC8 C;  2G7H A;  3T8R A;  3WU1 B;  3HRU A;  1RNL A;  1XSX A;  1MDM A;  2VT2 A;  1LJ9 A;  2O61 A;  2ZO4 A;  4EMS A;  5FLX K;  3BJA A;  4A0Z A;  2Z9O A;  3TGN A;  2VON A;  3AAF A;  5TJJ A;  1G6N A;  4BAY A;  1LVA A;  4LLN A;  4IRG A;  4LLG F;  1U2W A;  4I01 A;  2Y75 A;  2VBY A;  4UVA A;  4OOI A;  3WGG A;  3KE2 A;  1XD7 A;  5E18 F;  5BQT A;  4M72 A;  1EH6 A;  3M1E A;  3J7A O;  3R6S A;  5AIQ A;  2MD5 A;  1C0W A;  3WTU C;  2GXG A;  3IWF A;  4QWQ A;  2Z33 A;  1J75 A;  2YPR A;  1D5V A;  1YW8 A;  3HIF A;  2WTE A;  1YG2 A;  2FNA A;  1YYV A;  2QZ8 A;  3EQL F;  3SXY A;  5L3C A;  2F5F A;  2PQ8 A;  5D6E A;  4I0A A;  3ABU A;  3GZ6 A;  2Y0M A;  4OIQ F;  1LDD A;  5D4S A;  4ENJ A;  2CWE A;  2ESH A;  2EFQ A;  2DQL A;  1GHC A;  3KET A;  2XAH A;  2L02 A;  1ZYR F;  4HF2 A;  1IN7 A;  3WU0 A;  1JHH A;  2K86 A;  3M8F A;  4D0P A;  4IXA A;  1BI1 A;  2GZW A;  2IA2 A;  1H9G A;  1BC7 C;  1WSU A;  2OQG A;  2OZ6 A;  3HSF A;  1KU7 A;  3BP8 A;  4KFC A;  1UFM A;  4XSZ F;  4A6E A;  2RQP A;  2L3D A;  5BS6 A;  4FT8 A;  3GWZ A;  2FBK A;  2FA5 A;  2EFO A;  2ZXJ A;  1Y0U A;  1USS A;  3U1D A;  3QP5 A;  4CXF A;  5KVR A;  4N0B A;  5ED4 A;  3ZP5 A;  3HSR A;  1FC3 A;  3L7W A;  4L5I A;  3ZMU A;  4HF0 A;  4L9V A;  1U3E M;  4HA8 A;  1T39 A;  5ILS A;  3CJN A;  3V7R A;  1O7F A;  1SD6 A;  3DV8 A;  3L9F A;  1XCV A;  3CUQ B;  1YO5 C;  3LST A;  3DPT A;  4ZYH A;  1O3R A;  4E70 A;  1TW3 A;  4MTD A;  1GVJ A;  2O8X A;  1T2K A;  1F4K A;  3BPV A;  3IC7 A;  1FLI A;  2PI0 A;  2AXL A;  3CUO A;  4MGR A;  4PCQ A;  2DLL A;  2VC0 A;  4I09 A;  3TO7 A;  2Z5U A;  3JTG A;  2DK5 A;  4M73 A;  2BBY A;  3GLX A;  4WXH A;  1YW7 A;  4I02 A;  1DP7 P;  3KP2 A;  4ZZL A;  5D5W B;  5D8K B;  4CYD A;  1K79 A;  2OBP A;  4HV6 A;  1Z05 A;  1AOY A;  4FHT A;  2G7U A;  1P2F A;  1DDN A;  1O57 A;  1B1B A;  2DI3 A;  2M1B A;  4A0Y A;  5DD8 A;  1W5S A;  2IP2 A;  4KIC A;  3TDZ C;  1JGS A;  1FOK A;  3REO A;  2RNJ A;  2JSC A;  3SHF A;  2PFB A;  2HQN A;  5HS9 A;  2V1D A;  2XIG A;  3U2R A;  2J5P A;  3FM5 A;  2B0L A;  4HOB A;  1TNS A;  3E6M A;  3MWM A;  4B09 A;  3K0L A;  5CYV A;  5CJ9 A;  2FF4 A;  1R7J A;  1B9M A;  1FPQ A;  3JW4 A;  4S04 A;  2OA4 A;  5D5X B;  3E97 A;  2QM3 A;  3MZH A;  2DW4 A;  4EQQ A;  2LF8 A;  2P5V A;  3P9I A;  5D4R A;  3C7J A;  3L00 A;  2EB7 A;  3ZMT A;  5HLH A;  3OOP A;  3F8N A;  2VE9 A;  2KIU A;  3KLO A;  1HW1 A;  3Q9S A;  4WF2 A;  2XAS A;  1ZG5 A;  2EV5 A;  5EEG A;  1OKR A;  3TOB A;  2BV6 A;  1IN5 A;  3FMR A;  3WTV C;  3EYY A;  2UXN A;  2FSW A;  2MC3 A;  3CDH A;  3P9K A;  2V9V A;  1PP8 F;  1FBQ A;  4M9S A;  2RC4 A;  2VOD A;  3R60 A;  1MD0 A;  2MLK A;  5K5Q A;  5HLG A;  5E17 F;  4ENM A;  4P5O A;  5DUI A;  3I64 A;  4ZYD A;  2HS5 A;  3KFW X;  2M5W A;  1KA8 A;  4MNU A;  2FBH A;  1W7P A;  2ELH A;  4CHU A;  1LEB A;  2P6T A;  3KEO A;  1BI2 A;  1JHF A;  3BPX A;  4ASN A;  4U0W A;  1IXR C;  4EVI A;  2HR3 A;  3LAP A;  2PJP A;  5JHU A;  4L9J A;  3F22 A;  2CYY A;  2PN6 A;  3I59 B;  4L9N A;  3GF2 A;  3GEZ A;  2KIF A;  1XGN A;  2GQQ A;  1Z6T A;  2QVO A;  5BPD A;  1MJ9 A;  1HW2 A;  3PQK A;  2A6H F;  5L3G A;  3DFG A;  4RB0 A;  2IVM A;  4FX4 A;  4YFX F;  3DEU A;  5L3E A;  1YW9 A;  1SFX A;  3E3V A;  4ESJ A;  4MQ9 F;  4WX9 A;  3H3U A;  4BHB A;  1O3T A;  1XMK A;  5CVV A;  2OU2 A;  1YS7 A;  3K1P A;  5LEK A;  5DCM A;  2ZBK A;  2H09 A;  2XVC A;  4UVC A;  3N97 A;  4CO8 A;  4L18 B;  2M8E A;  4EJT A;  3Q5F A;  2IA0 A;  3B02 A;  2GIV A;  1KU9 A;  2V79 A;  2COM A;  3KZY A;  2DQR A;  2E7W A;  3Q9V A;  5HVQ C;  3BZ6 A;  3GXO A;  3TQN A;  3CO6 C;  3WTS C;  1J2X A;  4P9U A;  1TQP A;  2A68 F;  1SFE A;  2QQ9 A;  5ICF A;  4UV8 A;  4EJW A;  2BE5 F;  3EDP A;  1WI9 A;  2P7V B;  4RB2 C;  3PQJ A;  2AS5 F;  1L3L A;  3HTU A;  3RDI A;  4MTE A;  3VB2 A;  3IHU A;  4BXU A;  1FBS A;  2PMH A;  1H0M A;  1VTN C;  3S2W A;  4AD9 A;  2XRO A;  4XSX F;  3H3Z A;  4R1H A;  4BHP A;  3VEP A;  1IW7 F;  3V7C A;  2RGV A;  1TQM A;  3VFZ A;  1QZY A;  2ISY A;  3ZQ7 A;  1RIO H;  6PAX A;  1IXS B;  1HST A;  2KJC A;  4LG0 A;  3CTA A;  3ZMV A;  3F72 A;  1T98 A;  2JPC A;  2XKO A;  3T8T A;  2QWW A;  5JR3 A;  4HBL A;  3LWF A;  2M30 A;  1F9N A;  1QQI A;  2RVC A;  3KP5 A;  1LDK B;  3CLO A;  5FD6 A;  4RGU A;  3TDU C;  5H6Q A;  3KZZ A;  2VE8 A;  4P96 A;  1XDS A;  1B59 A;  2GA2 A;  4YFK F;  3I53 A;  1MJA A;  3DXJ F;  2GXB A;  4FX0 A;  1Z7U A;  2XGX A;  4YG2 F;  3LQQ A;  1D8K A;  5LGU A;  5JFR A;  2P5K A;  4L5J A;  3RTR A;  2P5L C;  3ZMD A;  1R00 A;  1YS6 A;  1BOA A;  2P8T A;  2XAQ A;  2HFH A;  5CLS A;  4GXO A;  4O5V A;  3N4M A;  4M6X A;  4HAM A;  4KIB A;  3ZMS A;  3ISP A;  4JQF A;  4EJU A;  3E5X A;  5F1R A;  2KRF A;  3HHH A;  2OD5 A;  3QPT A;  4A6D A;  2STW A;  3D0S A;  1U5T A;  1V3F A;  2Q8K A;  2FNP A;  4PGG A;  4A0X A;  1KU3 A;  4PZJ A;  1ZRF A;  1XCB A;  3K2Z A;  4HLY A;  2M45 A;  1Z91 A;  4Q5S F;  3GFM A;  3I71 A;  1FSH A;  3E6C C;  1FP1 D;  2C6Y A;  3FF5 A;  4ENK A;  1CGP A;  4EM2 A;  1W7P B;  3RYP A;  5LLQ A;  2FQ3 A;  3MAJ A;  1ZGA A;  1KQ0 A;  4M71 A;  1P92 A;  4A5M A;  4UNO A;  1B4A A;  5LEJ A;  1R5G A;  3NQO A;  1STZ A;  2VBZ A;  3NRV A;  1J0R A;  3SZP A;  1HW5 A;  5LRS A;  4N9I A;  4RS8 A;  3BRO A;  4XBF A;  1K6O A;  1OYY A;  3OV8 A;  3BDD A;  4CIC A;  3WE2 A;  2DO7 A;  4I7H A;  1HKT A;  1PUE E;  5DV5 A;  3M8E A;  3FZV A;  1IRF A;  1BM9 A;  3ZMZ A;  4Q48 A;  4OMY A;  2NYX A;  3BY6 A;  3MQ0 A;  2RKH A;  2YR2 A;  5DCM B;  4UV9 A;  4U88 A;  4RGS A;  3GZ5 A;  1OR7 A;  1ON2 A;  2BYV E;  4U7B A;  1CF7 A;  3O2P E;  2QUF A;  1R1U A;  3LA2 A;  3QU3 A;  4HDU A;  1DPR A;  2L4A A;  4EV0 A;  5BOX A;  1ZN2 A;  3O6B B;  3ZPL A;  3EET A;  2BEO A;  1W7P D;  4Y15 A;  2JT1 A;  2ZKZ A;  1PDN C;  2P7C B;  4I2O A;  3ERE D;  4O3M A;  2HTS A;  1PP7 U;  1BIA A;  5LRR A;  3F3X A;  4Y13 A;  1ZLK A;  2PLY A;  3HRM A;  1SD4 A;  1XGM A;  2FOK A;  2H94 A;  2ZNZ A;  4YIF A;  2UWM A;  2IT0 A;  3HUG A;  3F6O A;  1K7A A;  3HTS B;  1IUY A;  1K78 A;  4ESB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...