2K27A

Solution structure of human pax8 paired box domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
159
structure length
159
Chain Sequence
MPHNSIRSGHGGLNQLGGAFVNGRPLPEVVRQRIVDLAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIRPGVIGGSKPKVATPKVVEKIGDYKRQNPTMFAWEIRDRLLAEGVCDNDTVPSVSSINRIIRTKVQQPFNLPMDSGAPGGGSHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Solution Structure of DNA-free Pax-8 Paired Box Domain Accounts for Redox Regulation of Transcriptional Activity in the Pax Protein Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Paired box protein Pax-8
total genus 27
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2008-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00292 PAX 'Paired box' domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2k27A02
2X4HA 3D0SA 4L0ZB 2O3FA 2JSCA 5IT9K 1U8RA 4LG0B 5FO5A 2P5KA 3P9CA 4PCQA 4ZYHA 3ISPA 4PGHA 4I0BA 1R00A 4GYIA 5D5UB 2IT0A 3RDIA 5L3GA 3IKVA 3KP4A 3H92A 2HTJA 3HSRA 3JSOA 1B9MA 3Q9VA 3RKWA 3RI4A 1JHHA 3ZMVA 1GVJA 3HYIA 1XSXA 1ON1A 1ZGJA 2DPUA 4HF2A 4OMZA 2L3DA 2K02A 1UCRA 1BIBA 3CJNA 2DQRA 2G7HA 4OIRF 3ABUA 5ICGA 4UUVA 1IF1A 2XAJA 2M45A 3ZP5A 2ZMEA 5D4SA 3HRSA 2ZJ2A 2XAHA 2YR2A 5F6FA 1TQIA 1ZLJA 2DI3A 2Y48A 1R5GA 4KUMA 5HDNA 4P9UA 1FPQA 4G7OF 2HYFA 5BPIA 4Q4ZF 1YW7A 3BPVA 4M9SA 1R22A 1IW7F 3KLOA 3I54A 3KLNA 3GWZA 2UWMA 2K86A 3F8BA 1SD6A 4O6JA 2A07F 6PAXA 2Z3YA 5HOOA 4HOBA 4ASNA 1KQ0A 1S8NA 2HWVA 2GZWA 1FP2A 3WTYC 2H27A 1WI9A 4EQQA 1FSHA 5BMZA 1ZYRF 3E5QA 1I6XA 5AIQA 4A12A 4CDGA 2BEOA 2YSRA 4KIFA 5K5RA 2IRFG 2EV6A 5DUIA 1IXRC 5DUKA 4AWXB 4ENJA 3QOPA 4UNOA 5DD4A 1RNLA 4MQ9F 1H9TA 3PQKA 4CICA 4UXNA 3BWGA 5K5OA 3MEXA 2DU9A 1P2FA 2CWEA 2NAZA 1EH6A 3H3ZA 4L9NA 3LQQA 2HFHA 5E17F 4YFXF 2PQ8A 4EVIA 1QGPA 1D8KA 3QPHA 2R7DA 2WC2A 2JT1A 1EV7A 3GZ5A 1KU2A 1SMTA 3P9KA 1I1SA 3HUGA 2RGVA 2VONA 5L3EA 1Z7UA 2R3SA 4HA8A 2XGXA 5BOXA 3MAJA 3FHZA 3QPTA 3SFZA 4AIJA 2ZKZA 1USSA 4L9TA 2QZ8A 4YFNF 3E97A 4IXAA 3FX3A 1BN5A 3HTUA 1K7AA 4OIQF 3V8JA 2MBFA 1UHWA 3VODA 5H20A 2RC4A 3ZMTA 1I5ZA 2EJRA 2Q0OA 5LHIA 3M8FA 2V1DA 2XKPA 1W7PA 2ZXJA 2VODA 2PBIA 3E5XA 4DNCA 2OU2A 4I98B 3K0LA 1STZA 1XGNA 5CVJA 1QZYA 2O03A 2M87A 3J7AO 4TV7A 4EMSA 3GW2A 1XB4A 2E1NA 3T0YA 3M8EA 4HX8A 5JR3A 4R79A 4M9XA 2FXAA 2VN2A 4OOIA 2EK5A 3LA2A 3MFKA 3LAPA 5FGMA 3SZPA 4S05A 4A6EA 1OYWA 4KNYA 4Y15A 4WWCA 1B1BA 2OA4A 5LRRA 2VBXA 2FBKA 1AOYA 1E2XA 1E17A 3MZYA 5HDKA 1IZ1A 2M30A 4ESJA 1KYZA 2YX7A 3ZN1A 4H0EA 1BIAA 5CJ9A 3FM3A 5AONA 2B0LA 5D5WB 4U7DA 1SMYF 5BPDA 2P8TA 4RAZA 4EM1A 2FEZA 2FE3A 3LSTA 1IN4A 1P4AA 1ZH5A 2WV0A 4WCGA 4RB2C 4GGGA 3BDDA 4LB6B 4NQWA 2NNYA 1J7KA 3ML6A 2EA2A 5CLSA 2RQPA 4U88A 5DCFA 4ENNA 2OAZA 2IPQX 3TOBA 2P7CB 1FOKA 2ZO4A 2Q8KA 1XDUA 1ULYA 3P9IA 4L5IA 2STTA 2PN6A 1FZPB 4UVCA 1MJBA 2AS5F 4KICA 2Z99A 1ZAOA 1SD7A 1K6OA 2EFQA 4HQEA 4LJZF 3LFKA 2HGCA 1KU7A 5ICCA 2D45A 4FX4A 1MGTA 3E6MA 4YIFA 1RI7A 3ZPLA 1HKTA 4IHSA 4LLLA 2MH2A 1HXDA 3L7WA 1G3WA 3I5UA 1B6AA 1GXQA 5HS9A 2CQKA 2J5PA 1G3YA 2EWNA 4MEYF 2QWWA 5D5XB 2H09A 3DXJF 4EM0B 4BQAA 3V7CA 2M8EA 3DPTA 1T39A 4HV6A 2JPBA 1HKQA 3F21A 4HX4A 3WGIA 4FHTA 3RJPA 3RKXA 1IN6A 3FXRA 3IRQA 4LD5A 3KEQA 4LLNA 1BI2A 1F4KA 1QBJA 2RN7A 1HSTA 2XKOA 4EJVA 1K78B 1Z05A 2DFIA 4QWQA 2NRAC 3I58A 2FMLA 2YPRA 3GXOA 2FU4A 3GX4X 2QUFA 3RYRA 3ROUA 1PP7U 4XSZF 2UXNA 4JQFA 1R1VA 2F5DA 4BXUA 4RGUA 1BBYA 2HR3A 1WQ2A 3H3UA 4MQVA 4CZZA 3WTZA 1H9GA 4RGXA 1X3UA 3HIFA 1BC7C 1P92A 3WTSC 3DFGA 2RNJA 4P96A 4GCVA 1SFEA 4GYGA 1KYWA 3CLOA 3R4KA 4M74A 4A0YA 5EEGA 1XGSA 4BHBA 3CUQA 1FP1D 2NNNA 1QPMA 2JRTA 3V8LA 2IA2A 4EJOA 3R6SA 3KP6A 3VB2A 4IRIA 2O61A 1WRJA 1MZBA 4U7BA 3NEUA 1YG2A 2DLLA 3MCZA 3CO6C 1JE8A 3ABTA 4EGYA 3I53A 3TO6A 4EM2A 4O3MA 3I4PA 5ILSA 4U0VA 3IWFA 1O3QA 1KU3A 1C0WA 1LNWA 2QBYB 4I7HA 3HOSA 2UZKA 2K27A 4AVPA 1A04A 1H0MA 4HF1A 5ED4A 3CUQC 2L54A 1TBXA 3HRMA 1ZRCA 3KZZA 5E20A 3F3XA 1HW5A 1W5SA 1IN7A 2GXGA 3WGHA 2BYVE 2VBYA 4KN7X 4A5NA 2EB7A 2EV0A 1LEBA 1QNTA 2VOPA 4FX0A 1KA8A 3HRTA 2KIFA 2WTEA 1IRGA 2VT2A 3IKTA 2L4MA 1HQCA 1XSDA 3MQ0A 4LK0F 3WTWC 2ACJA 2DK8A 2QQ9A 5H6RA 4IRGA 4PDKA 5BQTA 1Z9CA 3LA7A 5ILUA 1GHCA 1RUOA 1ONVA 2OBPA 3OV8A 1YW8A 4G94A 5A2QK 1J0RA 1L3LA 2V9VA 3C7JA 3GO5A 2P4WA 2VXZA 2PJPA 1MDMB 1YS7A 1FNNA 1XGOA 3DKWA 1ZRFA 4U0WA 1V4RA 2TDXA 2E1CA 3DQVC 1D3YA 2VE8A 5HLGA 3V7RA 5FLXZ 4HDVA 2MC3A 2Z9OA 4G7ZF 4CHUA 3GVAA 2OZ6A 1O57A 2EV5A 2ZNZA 2GXBA 1BI0A 3GYHX 1F5TA 1OYIA 2MLKA 3M9AA 2ZCWA 5D8LB 2V1UA 2GA2A 4G7HF 2G9WA 3CDHA 1OPCA 2A6EF 2GQQA 4KIBA 5FFXA 2P5LC 2LNBA 5DEQA 3CTAA 5D6FA 3JAMK 5HLIA 2R7FA 2P6SA 3N97A 2Z5UA 4RS8A 1S3JA 5FLXK 3F6OA 3FM5A 4Q47A 1SFUA 2V79A 1WSUA 3JSPA 2H6CA 2LF8A 3IHUA 4MHGA 1HSJA 2FF4A 1O7FA 2UXXA 1BI1A 3ULQB 3QU6A 3DV8A 3T8RA 1XSVA 3QRFF 1IAWA 4P9FA 2CSOA 2DW4A 1WWXA 2F5FA 4HAMA 4ZZDA 1BC8C 3C1DA 5JHUA 1OYYA 5D8KB 4LLGF 2F5CA 5CVVA 4ON0A 1SFXA 2QM3A 1KU9A 2KRFA 3REOA 2YU3A 2O6GE 1Z91A 1QZZA 1TQPA 4BH9A 1KQ8A 3F6VA 4M73A 5IT3A 4WK8F 3IL2A 2COMA 4RB1A 3FMQA 4N9HA 1UFMA 2IA0A 1W7PB 3DEUA 3F8CA 3HOTA 3AAFA 4IF4A 4OINF 5JVTA 3C3WA 2O8XA 4R1HA 5ICFA 4KA4A 3TKYA 4I02A 1MD0A 3BP8A 3CUOA 4P5OA 2FBIA 4I01A 3WTUC 5ERIA 2ZMEB 2GIVA 2WWYA 3E6DA 4OIPF 5TRDA 3PFIA 3F72A 3TO9A 2OD5A 5LRSA 4BNCA 1ZG3A 1MJ9A 3ELKA 3WG9A 4HX7A 3P7NA 5A2QZ 1J5YA 1F1ZA 3S2WA 3ZMUA 3FXUA 2Y75A 3LWFA 1YO5C 2XHKA 2HEOA 2LF7A 2BE5F 4O5VA 2XASA 1TW2A 3IC7A 4RB3C 2QQAA 2ESHA 4KYWA 3QAHA 5E8GA 3J81Z 2ZFWA 1PDNC 2PG4A 4HYEA 4Y13A 3EYYA 5CVIA 3O2PE 3WU1B 1R36A 2ZBKA 1K78A 5HLHA 1LVAA 3MWMA 2EFNA 1O3SA 4M71A 4IPAA 1U5TB 1R58A 1U78A 1YIOA 3J81K 3QP6A 2ZNYA 1REPC 3TDZC 3ZN0A 4OIOF 3OOPA 2ISZA 4BYYA 2EFPA 2RKHA 4KT5C 4XSXF 2M5WA 2A3SA 1U5TC 4WXDA 3E3VA 1OKRA 3BOQA 4EJUA 2HOEA 4EJWA 5ILVA 3KP2A 2STWA 3D5LA 5LHGA 1YYVA 3KP5A 3GFLA 3FWEA 3EETA 1NHAA 5HS8A 2RV8A 1LJ9A 2CFXA 1XCBA 1ZREA 4L9VA 3TO7A 2HYGD 5E1WA 1WKMA 5ICEA 2A6HF 1YLFA 1TTYA 1PUEE 5FFZA 2EFOA 1ZGAA 5LBQA 2XRNA 2PI0A 4ENKA 3CO7C 1B9NA 1V3FA 1U5TA 3GZ6A 4I2OA 3WTTC 5E8IA 1HKSA 2DK5A 4EV0A 2E7XA 3FMRA 4IHTA 3KFWX 2Z33A 2G7UA 1J59A 3F22A 4HDUA 3QU3A 1VTNC 2JZYA 2MH9A 5HDGA 3FZVA 2W24A 3K1PA 4HW0A 2DAOA 4N9IA 2A69F 1W5TA 5K5QA 3DPLC 2ETHA 3R61A 4JBAA 3W6KB 3F8NA 2A61A 3VOEA 2HQNA 3TDUC 5F1RA 4A0XA 1LB2A 3KETA 2RVCA 1SD4A 2EFWA 4B09A 1W4MA 1MKMA 3I71A 2VC1A 2CYYA 4ZYEA 3JTHA 5J8FA 1XN7A 4XLPF 2P6TA 4JK1X 2FRHA 4M9ZA 4RGSA 3FF5A 3GFMA 2K4BA 3BJAA 3RIRA 4ZH4F 3ECOA 2W85A 1YW9A 4IRHA 3IRRA 4KN4X 3TQNA 1FY7A 2L02A 5TJJA 4WX9A 2XUBA 4CO8A 2VC0A 3U2RA 3U1DA 2PMHA 3I64A 4BHCA 1DUXC 3JTGA 1W7PD 1TW3A 2HZTA 3COAC 2PFBA 5F64A 5LEJA 4UV9A 1ODDA 3K9TA 2IP2A 1S7OA 4RAYA 3B73A 2DPDA 1JXSA 1CF7A 1BJAA 3GF2A 3LQRA 4A0ZA 2JTVA 3R0AA 5E1ZB 1LQ1A 1O3TA 4MEXF 4LFUA 3L00A 1FX7A 5JI6A 1FYLA 1R7JA 2LSOA 4HF0A 4LB5A 1XMKA 3SXYA 3Q9SA 4K2EA 4U0YA 4MTDA 4UVAA 3G3ZA 4MNUA 3R0JA 3ZMDA 1LDJA 2XAFA 2FNAA 4AD9A 2KJCA 2M1BA 1J75A 2VBWA 2H6BA 1QQIA 3GLXA 3HTSB 1FT9A 3VFZA 3JAMZ 4YFKF 3L09A 5BS6A 4XBFA 5J6XA 1USTA 2DTRA 4HBLA 3RTRA 3V8KA 4CXFA 5AIPA 2FNPA 3K69A 4I0AA 4YIIA 2PEXA 2F2EA 3NQOA 1L0OC 3KCCA 2VOOA 2MA3A 4ZYDA 4WF2A 4DQ2A 4L18B 2W25A 2A5YB 3I59B 1MJAA 2ESNA 1B59A 1AWCA 5LGUA 3IWZA 4L5JA 3BJOA 2QYOA 4RGRA 1ZLKA 3F8FA 4XRFA 3VEPA 3EYIA 2KIUA 1XDSA 1FBSA 3MZHA 4PGGA 3J80K 4NB5A 2GAUA 1J2XA 4GO1A 3RPUA 3HHHA 3WTVC 5IT9Z 1IXSB 1YTYA 5LGTA 2GA1A 1JHFA 3DP7A 3SZTA 2KJBA 3G73A 1O7LA 4KFCA 2V1XA 3M1EA 3V4GA 3EQLF 5K1YA 2NYXA 3BPXA 3J80Z 3ZQ7A 3WU0A 4CYDA 2O0YA 5E18F 3Q5FA 4M6YA 2JPCA 1P4XA 3L9FA 1FBQA 1D8JA 1S6LA 3BROA 2FMYA 2GWRA 3KEOA 1QO0D 2XROA 4LK1F 5FB2A 1G6NA 5EEHA 1DDNA 1R1UA 1ZRDA 2C6YA 1XGMA 2X0LA 4ETSA 1IUYA 5L3DA 1SAXA 4M72A 4UHTA 2FA5A 1HW2A 1I1GA 1LEAA 2V6CA 3WODF 2F5EA 5D4RA 2FSWA 2XIGA 4F7ZA 4EJTA 3U9GA 2XVCA 3E6BA 3BJ6A 2IA1A 3RYPA 3DF8A 2QVOA 3I59A 2LDUA 4E70A 3T5XA 1YFHA 2PLYA 2HS5A 1T0FA 4CGZA 3W6JB 2CG4A 1TNTA 3EDPA 3BY6A 5DD8A 3BZ6A 1T6SA 3ZMSA 3R60A 1ZG1A 1LDDA 1OR7A 2HTSA 4I09A 4G6QA 1F9NA 1RZ4A 2HDCA 2A68F 2MLGA 2IJLA 4ENMA 4KMFA 5L3CA 2FQ3A 3T8TA 2HQRA 1Z6TA 4IJAA 5H6QA 3HHGA 1UHMA 4ESFA 1ZN2A 2VE9A 2HKXA 1B4AA 4Q5SF 1D5VA 2DQLA 2KKOA 2CW0F 2QLZA 4GXOA 1RIOH 2NS0A 4IVNA 2P7VB 4HLYA 4MTEA 4ZZLA 3E6CC 1T98A 5DCMA 1BM9A 3WE3A 2OQRA 4A5MA 4FT8A 4BAYA 4KMUX 4XLNF 1G4DA 3FXQA 3F8MA 2XV4S 4HZFA 1OMIA 2K4JA 5LEKA 2L4AA 3LA3A 4G9YA 1R1TA 1U6GA 1XD7A 2BBYA 1J9IA 1BOAA 3ECHA 5LHHA 2E7WA 1FYKA 1RUNA 5KK1A 2Q2EA 5DYMA 3RKYA 4HLXA 3I0TA 1KQ9A 2W84A 1CF7B 4OMYA 5FD5A 1TQMA 1FWZA 4LG0A 2D1HA 1DP7P 3KZYA 1LDKB 4D0PA 4KIGA 1T2KA 3K1NA 3GFJA 3PQJA 2VT3A 2MD5A 3QP5A 3JW4A 4M6XA 3HRUA 2IW5A 3ERED 2QBYA 3KP3A 3KP7A 5HVQC 4S04A 2QENA 5JFRA 3RPQA 4G6DA 5D5VB 2PMUA 2HKOA 2XAQA 1S7AA 4EGZA 3EUHA 5CVUA 3TOAA 1SD5A 1IRFA 2FOKA 1UB9A 5HS7A 4A2UA 1BI3A 1I27A 5FD6A 2P5VA 1IN8A 4R8HA 1Q1HA 1FC3A 4UVBA 2DBBA 1IXCA 1P6RA 4HV5A 2CGPA 4KDPA 4B8XA 1JGSA 1ZHFA 1GXPA 1XMAA 1CGPA 1YS6A 1Z1DA 2DO7A 4YG2F 2OZUA 5LGNA 3SQNA 1G3TA 4L9JA 1G3SA 2FBHA 2K7LA 5CYVA 1TLHB 4WXCA 3LAJA 3GEZA 4Y17A 4AIKA 2ADUA 3ZMZA 4ESBA 2CO5A 1PP8F 1T38A 5E1XA 2Y0MA 2YX4A 5KVRA 3K1MA 1FLIA 1XCVA 4NHJA 3T1BA 1FBUA 1Y0UA 2OQGA 4QLCU 3M7GA 4HQMA 3HSFA 2J5OA 3F23A 1FSEA 2W57A 1P4WA 1MDMA 4MGRA 3SHFA 2D1VA 3FMSA 3HSEA 1O3RA 2ISYA 2AXLA 2QQBA 4N0BA 4A6DA 4WXHA 1EH7A 4AIHA 5D6EA 3O6BB 1HBXG 3B02A 1YQAA 3GFIA 1TNSA 3GUDA 4P55A 1EH8A 4ZYGA 1KGSA 3NRVA 4Z2YA 3TGNA 4L0YB 4OU0A 5DV5A 3N4MA 4LMYA 5LLQA 1R5HA 2H94A 4G8XA 3L2CA 3E5UA 1U2WA 2EA4A 2RDPA 2VBZA 5DCMB 2D2WA 2IVMA 3WTXC 5DDGA 1ON2A 1ZARA 3WE2A 5CVRA 1ZG5A 2BGCA 3KE2A 1Z6RA 2KIMA 3V7SA 2L01A 4Q48A 1DPRA 4BHPA 4UV8A 3WGGA 1R23A 1FYMA 1DPUA 2ELHA 1U3EM 1S29A 2DT5A 2BV6A 2XAGA 1IN5A 5J8CA 5L3BA 2LKPA 4LGWA 3C18A 5L3FA 3K2ZA 4RB0A 1HW1A 3CUQB 4PZJA 3O3KA 1K79A
chains in the Genus database with same CATH superfamily
2X4HA 3D0SA 3OR1C 4L0ZB 3PUFA 1DGWY 2O3FA 2JSCA 4Z6YA 3S1RJ 2L9VA 5IT9K 1U8RA 2ECBA 4LG0B 5FO5A 2P5KA 2V9PA 2EPFA 3P9CA 4RLFA 3FDYA 4PCQA 4ZYHA 3ISPA 4JX6A 4I0BA 4PGHA 2KHMA 1R00A 4GYIA 4HNUA 5D5UB 2IT0A 3RDIA 4UB8C 5L3GA 3IKVA 5F0FA 2JK3A 4RMNA 1GV5A 4A69C 3KP4A 3H92A 3EUKL 2HTJA 1WJDA 3HSRA 3O8GA 1B9MA 3Q9VA 4JYKA 3RKWA 3S8PA 3JSOA 3RI4A 1JHHA 1WJBA 4OAYA 3WU2C 3ZMVA 2L9RA 3PNYA 1GVJA 3HYIA 1XSXA 2BW3B 1ON1A 1RETA 1ZGJA 1OCCH 3DTKA 4XLHA 3RSNA 2DPUA 1IGNA 3DU6A 5F08A 4E6KG 3CP8A 4HF2A 4OMZA 2L3DA 4MO7A 1VQOI 2R0QC 2K02A 1FOYA 1UCRA 1BIBA 3CJNA 2DQRA 3H3VK 1Z3YA 1VZ0A 2G7HA 4OIRF 3ABUA 4CA0A 5ICGA 1AKHA 4BS9A 2GLOA 4UUVA 1IF1A 2NOGA 2XAJA 2M45A 3HXLA 1FTTA 3ZP5A 2ZMEA 1LKXA 5D4SA 4B44A 2X48A 3HRSA 2EQRA 5FKOA 2ZJ2A 2XAHA 5FROA 1G59A 2HDWA 2YR2A 1TQIA 5F6FA 2BVLA 1ZLJA 4IEJA 4JOMA 3CC2I 2QA4I 4XORA 2DI3A 2KPMA 2ME6A 3BTLA 2Y48A 1R5GA 4KUMA 5HDNA 3ESWB 2W82A 4P9UA 1FPQA 4G7OF 2HYFA 2X51A 5BPIA 4Q4ZF 1YW7A 4BBSJ 3BPVA 2JN6A 4M9SA 3OYEA 1R22A 1IW7F 3KLOA 3W6VA 2EIJH 2R7VA 3QQAA 3ZQFA 4HNVA 3CD6I 3I54A 3KLNA 3GWZA 2UWMA 2K86A 3F8BA 1U9NA 3SEQA 4HRIA 3G6EI 1SAUA 1SD6A 4O6JA 2A07F 4KJZA 6PAXA 1WCMJ 3FKJA 5KAFC 1ZQ3P 3ZQQA 3CF5F 2Z3YA 2KDOA 5HOOA 4HOBA 4ASNA 1JKQC 4F3QA 1KQ0A 4PSXA 2ZB9A 1S8NA 2HWVA 3E1SA 2GZWA 2QEXI 1FP2A 4E7JA 3WTYC 4F92B 2H27A 1WI9A 3DPUA 3Q0UA 4BXFA 4EQQA 5BMZA 1FSHA 3MKWB 1ZYRF 3QPLA 3E5QA 3CJTB 2WBMA 1I6XA 5AIQA 5FKMA 4A12A 1R6RA 2XGCA 4CDGA 2LP0A 2ZJQF 1FIAA 2XPVA 1BW5A 2B9SA 2ZSHB 2BEOA 1T95A 1GLNA 1Y6IA 2YSRA 4KIFA 2CJJA 5K5RA 2IRFG 2LLKA 2EV6A 2JUGA 5DUIA 1IXRC 5DUKA 4AWXB 2IGOA 4ENJA 2VL8A 1XS9A 2JUCA 3LNQA 5EJCA 3QOPA 4UNOA 5DD4A 4U87A 3H5NA 2XPUA 2R7SA 2F5VA 1RNLA 1Z67A 4MQ9F 3QODA 3CJRB 1H9TA 3DU5A 3PQKA 4B4CA 4CICA 4UXNA 3BWGA 5K5OA 2XC7A 3MEXA 2DU9A 1P2FA 3A01A 3LSKA 1TT0A 2CWEA 4CUGA 4BACA 2NAZA 2R92J 1EH6A 2CUEA 1MBFA 2DT6A 3H3ZA 2DFFA 1HOMA 4L9NA 3LQQA 3OL4A 4IQJA 2HFHA 5E17F 4YFXF 2PQ8A 4J00A 2OV7A 4QSHA 1VQMI 2BOLA 4EATA 4EVIA 1QGPA 1D8KA 2Y2ZA 3QPHA 2V9KA 4V2GA 2R7DA 2WC2A 2JT1A 4PJJA 2RQQA 4G12A 1EV7A 1A5JA 1U8BA 1SANA 3GZ5A 1KU2A 1SMTA 3P9KA 1X1AA 4C2UA 1I1SA 3HUGA 3ASOH 2E1MB 2RGVA 2VONA 2XPWA 5L3EA 2DMNA 4NBQA 1ZKGA 1QPIA 2COBA 2HQAA 1PYVA 4E7LA 5IYBJ 2WB1N 1V5EA 3VWBA 1Z7UA 2R3SA 3K4MA 2O8KA 4HA8A 2XGXA 1WZ2A 2PX9A 1HC8A 5LFAA 5BOXA 2KRCA 3MAJA 3FHZA 5EF6A 2PJRA 3QPTA 2CQNA 2E19A 3K7AJ 3DEWA 3SFZA 4AIJA 2HNHA 2ZKZA 1USSA 4L9TA 4GRIA 2K9NA 2QZ8A 4B48A 5TISC 4YFNF 5IOYA 3E97A 1UG2A 4IXAA 3CMYA 3FX3A 3AG2H 1BN5A 1DU0A 3HTUA 1P7JA 2OUMA 1K7AA 3PNTA 3OYLA 4OIQF 3V8JA 2MBFA 2DYSH 3L2RA 1UHWA 3OIQA 3VODA 5H20A 2HQ5A 2RC4A 2LBFB 3ZMTA 1I5ZA 2EJRA 2Q0OA 5LHIA 3M8FA 1IRZA 2V1DA 5FLVA 2XKPA 1W7PA 2ZXJA 2VODA 1V55H 2IGNA 2PBIA 1PUFB 3E5XA 4DNCA 2OU2A 4I98B 3K0LA 1NTCA 1LUJB 1STZA 2CH0A 4BL0B 1XGNA 3MMYB 5CVJA 3BCBA 5CQGA 1QZYA 2O03A 2M87A 2NVQJ 2VQCA 3E7LA 3BR3A 3J7AO 5E79C 4TV7A 3DTIA 2R7QA 4EMSA 4DIQA 3GW2A 1XB4A 2A6TA 4DYQA 2E1NA 1CQTA 3T0YA 2LREA 3M8EA 4HX8A 4B3AA 1N75A 2XAUA 5JR3A 4R79A 2K9LA 2CQXA 4M9XA 2FXAA 3HB9A 2VN2A 3ZGKA 4CZCA 2BXYA 4OOIA 2Y9YA 3LFUA 2CW7A 2EK5A 2O7OA 2DA2A 3LA2A 2X1EA 4HSTA 1G8XA 5EDNA 1X1DA 3SEZA 3MFKA 2DODA 5GPAA 3LAPA 5FGMA 3RZDJ 2BHZA 3SZPA 2H8WA 4S05A 5GAHJ 3IAS2 5CKTA 1NG6A 4A6EA 3GMEA 1OYWA 3H0GJ 2CQQA 4Y15A 4KNYA 1N77A 1OISA 4WWCA 2W48A 1IRXA 1MMNA 2L9NA 1B1BA 2OA4A 5LRRA 2VBXA 1E3OC 2MG4A 3BTCA 4FISA 2FBKA 3K6GA 3KZIC 4DJAA 1AOYA 2GBYA 3LSMA 3S1MJ 3I55I 1E2XA 1TWCJ 4XMYA 2VKDA 3VSKA 4RM2A 1E17A 3MZYA 4FE4A 5HDKA 1IZ1A 2M30A 4ESJA 1KYZA 2YX7A 3ZN1A 3IUOA 1ETQA 2GOMA 4H0EA 1BIAA 3LSIA 2R7WA 5CJ9A 3FM3A 5AONA 4DZJA 4UUSA 3TP0A 1D1CA 2B0LA 1JJ6C 5D5WB 3ERMA 4U7DA 2H1KA 1SMYF 3OYCA 5BPDA 2P8TA 4RAZA 4EM1A 2FEZA 2FE3A 3LSTA 1IN4A 3QYFA 1P4AA 1ZH5A 1LFBA 2WY8Q 2DOAA 2WV0A 5FLMJ 4WCGA 4RB2C 3CCJI 4GGGA 1ACIA 3BDDA 3D5RC 3BZKA 4MIMA 1X3ZB 1GVDA 1E0EA 4LB6B 2VKEA 3DBLB 4NQWA 4FASD 1J7KA 3ML6A 2NNYA 1P9QC 3HPHA 2EA2A 5CLSA 2O9LA 3A01B 4A3CJ 2RQPA 4PUSA 4U88A 5DCFA 2DT7B 4ENNA 2VLAA 4A3MJ 2NVTJ 4NNJA 4OWRB 4PSWA 3ZR8X 3HOXJ 2OAZA 2IPQX 3TOBA 2P7CB 1FOKA 2X6YA 2ZO4A 4D7MA 2Q8KA 1XDUA 1ULYA 3FXJA 4B47A 1IO2A 1BW6A 2CUJA 2JA6J 2IS4A 3DKXA 3P9IA 4L5IA 2STTA 2PN6A 1FZPB 2M3AA 4XKCA 2VIXA 4UVCA 5IPAA 5GADJ 1MJBA 2AS5F 2RAEA 2Z99A 4KICA 2JA7J 1ZAOA 1U9OA 2MGQA 5GAGJ 1Y1VJ 4XN0A 1WFXA 3W2WA 1SD7A 1Z0XA 3GBGA 1MBGA 2EFQA 4HQEA 1K6OA 4LJZF 3LFKA 2HGCA 4BJ6C 1KU7A 5ICCA 2D45A 4FX4A 1ETWA 3M3YJ 1G2HA 1MGTA 3E6MA 4YIFA 1VQ4I 4BDYA 1F36A 2Q2EB 4DBRA 1RPWA 1RI7A 3S32A 4XKWA 1JGGA 3ZPLA 2XRLA 2DDBA 5B66C 1HKTA 3NARA 1MBEA 2QSFX 4IHSA 2R7TA 1QRYA 1W1WE 4LLLA 2MH2A 3JRBA 1HXDA 3BR0A 3L7WA 5EGOB 1G3WA 3I5UA 1B6AA 2IEKA 1GXQA 5HS9A 2CQKA 2J5PA 2WB1A 1G3YA 3FK6A 5J40A 2EWNA 2DTZA 3ZCOA 4MEYF 2QWWA 5D5XB 2H09A 3DXJF 1TWHJ 2XGEA 4EM0B 4DOZA 2JA5J 1ETOA 1R4NB 3KYDB 4BQAA 3KPHA 3V7CA 1LE8B 4A3FJ 2M8EA 5FKNA 2R5ZB 1ZK8A 3DBHB 3DPTA 1T39A 4HV6A 1Y56A 2VJ4A 4ZTJA 3D5SC 2JPBA 2HXIA 4XOPA 1HKQA 5B3SH 3F21A 4HX4A 1D1AA 4FHTA 3RJPA 1WH7A 3RKXA 5DTDA 3WGIA 1HDDC 1IN6A 4GDFA 3FXRA 5KAIC 3IRQA 2ZC2A 4LD5A 1EA3A 1MMAA 3IP4B 1XTAA 4ZTFA 3KEQA 4V2FA 3I56I 4LLNA 1BI2A 1A6IA 1VQ9I 1F4KA 1QBJA 2P0WA 2RN7A 1HSTA 2DFEA 2XKOA 4EJVA 2L7KA 2Q1ZB 2WV1A 1Z05A 5GTIC 4C2MJ 2NXNB 1K78B 1I3AA 2DFIA 1V5GA 4BE0A 3G2BA 4QWQA 2NRAC 3PJRA 3I58A 1E3HA 4BKXA 1RRJA 5CPRB 2FMLA 2YPRA 3JRAA 3GXOA 2FU4A 3GX4X 2EZKA 3K4LA 5HODA 2QUFA 1MW7A 3ROUA 3RYRA 4BJ5C 4X0GA 1PP7U 4DYCA 4XSZF 2UXNA 4JQFA 1R1VA 2F5DA 1OQYA 4BXUA 4RGUA 2HZDA 1BBYA 2HR3A 4DZPA 1WQ2A 4RDUA 3H3UA 2M34A 3UR3C 2IAIA 4MQVA 4CZZA 3WTZA 3CCQI 1FTZA 2EH3A 3CMAI 1H9GA 4RGXA 5J4YA 3ZQLA 1X3UA 2KP6A 3HIFA 2R7ZJ 1BC7C 3DLAA 1P92A 3WTSC 3DFGA 2RNJA 3OWTA 4P96A 3WHCA 4Y4RA 3AKZA 1OCRH 4GCVA 1SFEA 4GYGA 1JI8A 3TMOA 1KYWA 1LE8A 3CLOA 3H9QA 2XGDA 2VB6A 1GUUA 2HVRA 2DXIA 4M3GA 4Y3OA 3IH3A 3R4KA 4M74A 4A0YA 3A02A 5EEGA 3OS2A 2HXOA 1XGSA 3P5JA 4BHBA 3CUQA 1AA7A 1FP1D 2NNNA 3HG9A 3PUBA 2KDZA 4XOTA 1QPMA 1OR7C 2JRTA 2GXAA 2M9HA 5K7HA 1V54H 3V8LA 3VYTB 2IA2A 1K6YA 2Z2SB 1VFCA 4EJOA 3GTPJ 3R6SA 3KP6A 3FXKA 1NH3A 4XM3A 3VB2A 4QPQA 4IRIA 2O61A 1UZCA 1WRJA 5FRNA 1MZBA 4FETA 4U7BA 3NEUA 1YG2A 2DLLA 3TL4X 3MCZA 2WAQN 3CCVI 1K61A 3RQIA 5M5WJ 2IS2A 3CO6C 1U0JA 1JE8A 1POGA 3ABTA 3OYHA 3RZOJ 4L5EA 4EGYA 2QKLB 3I53A 3TO6A 4EM2A 4J19A 4O3MA 3CZ6A 2DA3A 1ETKA 2DA4A 2LK2A 3I4PA 5ILSA 4U0VA 3IWFA 1ETVA 2VQLA 1O3QA 1H89C 1QU3A 1KU3A 3U1KA 4C3JJ 1LNWA 2FX0A 5K7FA 1C0WA 3ZQHA 3MKZA 2QBYB 1X1BA 3HGGA 2HOAA 4I7HA 3ZXSA 3HOSA 3GTLJ 1Z77A 2UZKA 1IV6A 2K27A 1H88C 4AVPA 1A04A 1H0MA 4HF1A 5ED4A 2HU9A 3CUQC 2L54A 3HJEA 4RBOA 5EG0B 4MFEA 2E60A 1MNMC 1TBXA 3HRMA 2L0KA 3OYIA 3LOCA 4BXXJ 1ZRCA 3KZZA 4RLQA 5E20A 3MVPA 9ANTA 3F3XA 1F43A 1HW5A 1W5SA 1IN7A 2GXGA 2BYVE 2VBYA 4KN7X 3WGHA 2G0EA 4A5NA 2EB7A 3K70C 2EV0A 4YEJA 1LEBA 1QNTA 3O8HA 2VOPA 3HPGA 4FX0A 4D5CA 1KA8A 3OS0A 3AG4H 1N78A 3K10A 4XRMA 4UUSB 1TT5B 3CMEI 4BJTA 4V19K 1W5CC 2NS8A 1N25A 3HM5A 4UUTA 2EINH 3HEFA 5GAEJ 3HRTA 2KIFA 2WTEA 1IRGA 2VT2A 5KCMA 3IKTA 2L4MA 2BZTA 1HQCA 3GZNB 1SEUA 5GTHC 3FBIB 1XSDA 2V26A 3MQ0A 4QPOA 2WAQA 4LK0F 4XNFA 3WTWC 5EGOA 2ACJA 2ME0A 2DK8A 4E7KA 3PL8A 2QQ9A 1JUSA 2E36A 4W1UA 1VQ8I 5H6RA 5F1JA 3ABMH 2R5YB 3X2QH 2FOWA 2EBIA 4IHXA 1WGXA 4IRGA 4PDKA 5BQTA 1Z9CA 1X3WB 3AFHA 3IAM2 3LA7A 1MH4A 4RAFA 5B1BH 5FJ8J 5ILUA 2LR8A 1GHCA 1EF4A 4UY8I 4FE7A 5IP7J 5JVGF 2P81A 1RUOA 2O5RA 1ONVA 3JRFA 2VXDA 2OBPA 3OV8A 1YW8A 3MD2A 3N05A 4G94A 5A2QK 1QA6A 5EG0A 4XL9A 1GV2A 1J0RA 3HUGB 1AHDP 1L3LA 2V9VA 3C7JA 1J09A 5J3LA 1GT0C 4JX4A 3GO5A 4A3IJ 2P4WA 2VXZA 4XKVA 2PJPA 2M7BA 2EILH 3G1LA 1MDMB 3AL0B 2WAFA 3IV5A 1YS7A 1FNNA 3BTIA 1R4MB 1XGOA 3ZOBA 2DMUA 3CCMI 2KL4A 3DKWA 1ZRFA 2KIQA 4LIVA 1D0XA 1PJRA 2CFOA 2BY0A 1OJLA 1V4RA 4U0WA 1JKPC 1IDZA 2TDXA 3J7AY 2E1CA 3DQVC 2FQ4A 4XK4A 3OSGA 1BR2A 1D3YA 3LSGA 1X19A 2VE8A 3CESA 5HLGA 3V7RA 1ITYA 5FLXZ 3G1MA 4HDVA 2MC3A 2Z9OA 2ZJRF 4G7ZF 4CHUA 3GVAA 2OZ6A 2JRMA 1Q1VA 1O57A 2EV5A 2ZNZA 3NWTA 2GXBA 1BI0A 4ZYAA 3GYHX 1OYIA 2MLKA 3M9AA 1F5TA 2ZCWA 5D8LB 4BQOA 2V1UA 3K4JA 2GA2A 1Y8RB 4G7HF 3KIOA 2G9WA 3CDHA 5J47A 1OPCA 2A6EF 2GQQA 4KIBA 5FFXA 2P5LC 4IQ4A 3A03A 2IS1A 2LNBA 5DEQA 3CTAA 5D6FA 4KT6A 4UB6C 3JAMK 4AVZA 2R4GA 4BEHA 5HLIA 3S3MA 3ZQGA 1PVEA 2R7FA 4C2TA 5IP9J 2UV1A 2K3PA 2P6SA 1FMWA 4MLOA 1YHQI 3N97A 2X6WA 1R71A 2Z5UA 4N4NB 1X1PA 4RS8A 1S3JA 3K4NA 5FLXK 3F6OA 3A1YA 3ZQIA 3FM5A 4Q47A 5E3NA 1SFUA 2V79A 4CCOA 3JSPA 1WSUA 1EKEA 2H6CA 2LF8A 3I9V2 3IHUA 4MHGA 1HSJA 2FF4A 2HYJA 1D0ZA 1O7FA 4XR6A 3RQ4A 2UXXA 5HLTA 1BI1A 3ULQB 3QU6A 3DV8A 1YJWI 2X85A 3T8RA 1FEXA 3WG7H 2LYCA 2XF7A 1XSVA 3QRFF 3OIOA 4Y33A 3AG3H 4F91B 3FISA 5K7ZA 4A3GJ 1QVTA 1IAWA 4P9FA 3HOWJ 4BE2A 3F0CA 2CSOA 3CCSI 2DW4A 1Y39A 1VQLI 1T08B 1WWXA 4RM3A 2F5FA 4HAMA 1PUFA 2I5UA 4ZZDA 3DBRB 1BC8C 5IYCJ 1AKHB 3C1DA 5JHUA 2VPLA 1X2MA 3OOUA 1OYYA 4H4KC 2Y30A 5B5EC 2IGMA 5D8KB 4LLGF 2F5CA 4Y7NJ 4PJLA 1OCOH 3M1CA 5CVVA 5IOZA 4ON0A 1O4XA 1SFXA 2QM3A 4C3IJ 1KU9A 2KRFA 3Q3SA 3REOA 2YU3A 2O6GE 3G4SI 1JJ8C 1B72A 1Z91A 2UUZA 3ABKH 4BQQA 1QZZA 2M2EA 1BR1A 1TQPA 4BH9A 2HPMA 2F4MB 1KQ8A 2NVUB 3F6VA 2L7ZA 4M73A 5IT3A 2XSDC 4WK8F 1V5FA 3IL2A 2COMA 4RB1A 4A3EJ 2ELKA 2CU7A 3FMQA 3VYRB 4N9HA 1UFMA 2IA0A 3DEUA 1W7PB 3F8CA 4XLCA 3AAFA 2JVHA 3HOTA 3PO3J 4IF4A 4OINF 3HGYA 5JVTA 3QOEA 3C3WA 2O8XA 2X6OA 4R1HA 4I6ZA 3OYFA 5ICFA 2Y0SA 3K2AA 1IG7A 3JCUC 1JT6A 1VF9A 1TWGJ 3TKYA 4KA4A 1YJNI 4BUPA 1W36C 4I02A 1MD0A 3BP8A 3CUOA 3BG7A 4P5OA 2FBIA 4I01A 3WTUC 1W36D 5J1RA 5ERIA 2ZMEB 1ZR4A 5J1UA 2GIVA 4NUBA 2WWYA 3E6DA 2NOJB 1LVKA 2OTLI 4OIPF 1T33A 2R5ZA 5TRDA 3PFIA 3F72A 3TO9A 3LSRA 1UAAA 2LC2A 2E71A 2OD5A 2KZGA 5LRSA 4BNCA 1ZG3A 1JUPA 1MJ9A 3ELKA 3WG9A 2ZFUA 4X6AJ 5TGTA 3MKYB 2WADA 1DP3A 3KX2A 2ID6A 4HX7A 1D1BA 3P7NA 4RAGA 1YX5A 5A2QZ 2DMPA 2HOSA 1J5YA 1F1ZA 2KQRA 3S2WA 3ZMUA 4M3EA 3FXUA 2Y75A 2VKHA 3LWFA 3W2VA 1X4PA 4F52A 1YO5C 2XHKA 2HEOA 3JRIA 2LF7A 2BE5F 4O5VA 2XASA 4LIUA 3CLQA 1TW2A 3IC7A 1SVOA 1WJCA 3CCEI 4RB3C 2IBDA 1MSFC 2QQAA 1Y8QB 2ESHA 4A3DJ 4QTRA 3OYJA 4KYWA 3QAHA 5E8GA 3J81Z 1QHGA 4MFDA 2R93J 2V7FA 3GTOJ 1S5LC 2ZFWA 3KYCB 1PDNC 2CW8A 2PG4A 4HYEA 3WHBA 4II2A 5DS9A 5C4XJ 3BG5A 2V6EA 2K5CA 4Y13A 3DKYA 3Q0WA 3EYYA 1MBHA 4C30A 5CVIA 1R9TJ 3O2PE 1T0FC 3WU1B 1R36A 2KISA 2ZBKA 1K78A 5HLHA 3JRCA 1SFKA 1LVAA 3MWMA 3CP2A 2EFNA 1ZELA 2QKMB 1O3SA 2ID3A 4M71A 4IPAA 1ZTRA 1U5TB 2K40A 1R58A 2L7MP 2L5QA 1U78A 1YIOA 3J81K 2X6XA 2LG4A 2A05A 2XB5A 2CUZA 2DJIA 3H5AA 3I3LA 3QP6A 2ZNYA 1REPC 3TDZC 3ZN0A 4OIOF 5IP6A 3OOPA 2ISZA 3GTJJ 1MMDA 1S7EA 4BYYA 2EFPA 2RKHA 4ITVA 1YJ9I 1YX3A 3K70D 4KT5C 2W4SA 4XSXF 1B8IA 5M5YJ 3H1CA 3CDLA 1OFCX 2M5WA 2A3SA 2MSYA 1U5TC 4WXDA 4XN3A 3TP3A 1KONA 3E3VA 1DQUA 2I10A 1OKRA 3BOQA 2LMDA 4EJUA 4BE1A 2HOEA 4EJWA 5ILVA 1M1EB 2ZMEC 3KP2A 3FK7A 2STWA 3D5LA 5LHGA 1FIPA 3UNGC 1YYVA 3KP5A 3LSPA 3GFLA 3FWEA 3EETA 1NHAA 5HS8A 2RV8A 1LJ9A 2CFXA 1XCBA 1ZREA 4L9VA 3CMMA 3TO7A 1Y1WJ 4ZDOA 2HYGD 5E1WA 1WKMA 3D1NI 5ICEA 2EZLA 2A6HF 1YLFA 1TTYA 1PUEE 3JRDA 4ZDPA 5FFZA 1RR8C 2EFOA 1ZGAA 4E4HA 5LBQA 2XRNA 2PI0A 4DW6A 1W0UA 3OS1A 4ENKA 1A31A 3CO7C 1LFUP 1A36A 1B9NA 1V3FA 1U5TA 2OTJI 2BXZA 4ZDLA 2KT0A 2ZXWH 1K4TA 2M7AA 3BG6A 4S0HB 3GZ6A 4I2OA 2M0CA 4DYRA 3WTTC 3OSFA 5E8IA 1HKSA 4XLEA 2DK5A 1NK2P 1I6HJ 4AM3A 4EV0A 4QIWN 2E7XA 3FMRA 1NG7A 3K4CA 4DBQA 4IHTA 5FRMA 1OCTC 3KFWX 2Z33A 1HLVA 2G7UA 1VQ5I 1OCZH 2CS3A 1H8AC 4B43A 1J59A 3F22A 4NC8A 1DGRM 2K9MA 3SDBA 5HNHA 3I4NJ 2X9DA 4BGDA 4HDUA 2OJED 3QU3A 1VTNC 2JZYA 2MH9A 2AHQA 5HDGA 3FZVA 2OCEA 1ENHA 2LKSA 3L2VA 2W24A 2QF7A 3K1PA 1WJAA 1Y0NA 2XF6A 1RKTA 4HW0A 2DAOA 2DA5A 3M8JA 2AXTC 4A93J 4N9IA 5DM6F 2YUSA 2A69F 2D5VA 4XIDA 1W5TA 5K5QA 4EEFG 3DPLC 4BY1J 4F93B 2ETHA 3R61A 4JBAA 1TZLA 3HOUJ 4PFOA 3W6KB 3F8NA 2B7EA 2A61A 3VOEA 4X1EA 3OY9A 2HQNA 3TDUC 2KRHA 1ZR2A 1TWFJ 1ORKA 2KZVA 3BLYA 3K4BA 5F1RA 3BQYA 4A0XA 1I50J 1LB2A 1TC3C 3KETA 2RVCA 3C2HA 1KZHA 1SD4A 3BR2A 3L2WA 2EFWA 4B09A 1W4MA 1MKMA 1JT0A 4XLFA 3I71A 1WJEA 2VC1A 4YELA 2CYYA 1MBJA 4ZYEA 3JTHA 5J8FA 1XN7A 2OC6A 4XLPF 2CV1A 2P6TA 4JK1X 3LL7A 2FRHA 4M9ZA 3H5RA 4RGSA 3FF5A 3GFMA 2LD5A 2K4BA 2QQ8A 3BJAA 3RIRA 1JKRC 2CRGA 4BU2A 3KEYA 4LITA 3A4CA 4ZH4F 3ECOA 3S93A 4E7HA 2W85A 1YW9A 2LBFA 4PJNA 4IRHA 5F27A 3IRRA 3HZJA 2MYSA 4KN4X 3OL3A 4M3BA 3TQNA 5M3MJ 1FY7A 1WJFA 4CCNA 2L02A 5F0CA 4J01A 2HDDA 5TJJA 4WX9A 2XUBA 4CO8A 2VC0A 1IC8A 3U2RA 2HOTA 3DWLE 4XKBA 1Z7LA 3U1DA 2PMHA 3FHNA 3I64A 4BHCA 1DUXC 2R5YA 5GPCA 5B1AH 3HOYJ 4I76A 2JA8J 3JTGA 1W7PD 4IHYA 1TW3A 1JTYA 4E7IA 2PJRB 2HZTA 2X1DA 4BEHB 3COAC 1HA8A 3A0HC 3J7YJ 2PFBA 2DOEA 5F64A 5LEJA 4UV9A 2E2HJ 1ODDA 2CUFA 5EEAA 3K9TA 1BA5A 1MNDA 1XX5A 2IP2A 1S7OA 2LOOA 4RAYA 3B73A 2DPDA 3CCLI 2FUG2 1ETXA 1JXSA 3LMMA 1CF7A 2F4OB 1BJAA 3GF2A 3LQRA 5E3OA 4A0ZA 3A2KA 2JTVA 2DYRH 4M3FA 3R0AA 5E1ZB 4ANJA 1LQ1A 2E1MC 2N8GA 1O3TA 4MEXF 4LFUA 1FMVA 5IY5H 3L00A 1FX7A 5CQEA 5JI6A 1FYLA 1OLTA 1R7JA 1MMGA 2LSOA 4HF0A 4CYCB 4AYBN 4LB5A 4G6TB 1XMKA 3NWSA 3SXYA 4IHWA 3Q9SA 4K2EA 4U0YA 4MTDA 3S1QJ 2DFHA 3FKIJ 4PJMA 4UVAA 3G3ZA 4MNUA 3R0JA 5KNLA 3ZMDA 1LDJA 5GP9A 2XAFA 3S16J 2FNAA 4IZZA 4AD9A 4A3LJ 2EZHA 5LD2C 3M4OJ 4C9YA 2KJCA 2M1BA 4OAZA 1J75A 2F48A 2BW3A 2VBWA 2H6BA 3KYLA 3CDIA 1QQIA 3PIOF 3GLXA 3HTSB 2FJ1A 1FT9A 3HL2A 3CCRI 3VFZA 3JAMZ 1HCRA 4YFKF 1UJ8A 2A5WA 3EUHC 3L09A 5BS6A 4XBFA 3GTGJ 5J6XA 1USTA 2DTRA 1BOBA 4HBLA 1B8IB 3RTRA 3V8KA 3SDGA 4CXFA 5AIPA 3FXOA 1SC7A 3J7ZI 3DLLF 2FNPA 3K69A 4I0AA 4YIIA 2PEXA 2V4JC 4BQNA 2F2EA 3NQOA 1L0OC 3KCCA 1XC5A 1I39A 2VOOA 3OYAA 2MA3A 4ZYDA 4WF2A 1P7IA 4DQ2A 4L18B 2DA1A 4PFPA 2W25A 4CSWA 2A5YB 2LKXA 3I59B 1MJAA 2VASA 2ESNA 3NAUA 3PSIA 4BY7J 3EUAA 1B59A 2HVSA 1AWCA 2LY2A 3ZRGA 5LGUA 3IWZA 4L5JA 3BJOA 2QYOA 4CCKA 5DM7F 4RGRA 1ZLKA 3F8FA 4XRFA 5HNFA 3VEPA 1K83J 3EYIA 2KIUA 4DGWB 1XDSA 1MSEC 2IXSA 1FBSA 2NVYJ 3MZHA 2PMZA 3MZ8A 1T56A 4PGGA 1WVRA 3OYMA 3J80K 1ETYA 4NB5A 1J2XA 2GAUA 4XONA 2JQ7A 4GO1A 4IO9F 5EYRA 3HKZA 1TWAJ 1XG1A 2Y69H 3VYUB 3RPUA 3DEEA 3HHHA 3WTVC 5IT9Z 4B3XA 1IXSB 1UHSA 1YTYA 5LGTA 3HBLA 2XB0X 2GA1A 1JHFA 2HVQA 3DP7A 4AUXA 4CCMA 3BCAA 3SZTA 2KJBA 3RPUD 3OYNA 2KFDA 3G73A 4BDZA 1WPKA 4I99C 1O7LA 3RCOA 4KFCA 3SZGA 2PMZN 2V1XA 4HEA2 3S2DJ 3M1EA 2RNGA 2EIMH 3V4GA 2CMPA 3EQLF 2JA2A 5K1YA 2NYXA 2LY1A 3BPXA 3TW6A 3J80Z 1QZEA 3WU0A 1VI0A 1SVMA 2O0YA 3ZQ7A 4CYDA 5E18F 4FCYA 3PO2J 2E1OA 3Q5FA 4XRSG 2E2IJ 4M6YA 2JPCA 5C4JJ 3JREA 5EZGA 2ELJA 3SJMA 1P4XA 4AYBA 3VSLA 4AC0A 4A3KJ 2JWTA 3L9FA 2E5NA 3JRGA 1FBQA 1IDYA 1YOVB 1D8JA 1S6LA 3BROA 2FMYA 3QYEA 2GWRA 3KEOA 1R5ID 1QO0D 3L1PA 4W97A 2JVGA 2GIZA 2XROA 3BC8A 4LK1F 2VKVA 5FB2A 1G6NA 4IOAF 5EEHA 1TP4A 4PK4A 2DDAA 5J1YA 4KISA 3S2HJ 1YIJI 1DDNA 3QWLA 1R1UA 3CCUI 1S72I 1ZRDA 2C6YA 1E3PA 2KMUA 1AU7A 1BR4A 4JP0A 1D5YA 4NC6A 1XGMA 3VYSB 3AG1H 1HF0A 1GDTA 2X0LA 2TCTA 4ETSA 3GTMJ 1IUYA 1YI2I 5L3DA 1SAXA 3OYGA 4LOCA 3AL0C 5C44J 4M72A 4UHTA 2R7OA 2FA5A 2HPIA 1HW2A 3OYBA 1I1GA 3BR6A 1LEAA 4FQGA 2V6CA 3G71I 5FKKA 4ZC3A 1XMXA 3WODF 2F5EA 5D4RA 1DU6A 2FSWA 1I3QJ 3HC7A 1YRNB 2XIGA 1MBKA 4F7ZA 4CYCA 4EJTA 3U9GA 3E6BA 1A6QA 2XVCA 3BJ6A 5M5XJ 1ZGWA 3SYTA 2IA1A 3RYPA 3DF8A 1FOXA 2QVOA 3L2UA 2M4KA 3VDXA 5C3EJ 2R7RA 3I59A 2LDUA 1JTXA 2AQEA 4E70A 2F4IA 3T5XA 1YFHA 2R7XA 2DA6A 1S9HA 2PLYA 3TBIA 2E34A 3W2AA 2HS5A 2CV0A 1T0FA 1X2NA 2JSPA 4CGZA 3W6JB 2CG4A 2X1CA 1TNTA 2WY7Q 3EDPA 2H8RA 2QSHX 2VJJA 3BY6A 2BVMA 5DD8A 2OPTA 2W7NA 3BZ6A 1T6SA 3ZMSA 3R60A 1ZG1A 1LDDA 5F04A 1OR7A 2HTSA 3MN2A 2NVXJ 1OCPA 4LG3A 4I09A 4G6QA 1F9NA 1RZ4A 2IS6A 2HDCA 4ZJZA 2A68F 1X1CA 2MLGA 2IJLA 4ENMA 1WH5A 3CC4I 2L7FP 3I4MJ 4D5FA 1MNEA 3BZCA 1HDPA 4E7SA 4KMFA 1RESA 5L3CA 2FQ3A 3T8TA 5J4VA 4XICA 4YRVA 2HQRA 1APLC 3HOZJ 3H9GA 3S17J 1Z6TA 2VJIA 4IJAA 3Q0VA 4PJ0C 2W1OA 5H6QA 2MW8A 3HHGA 1UHMA 4ESFA 1ZN2A 2Y31A 2Y9ZA 2VE9A 2HKXA 1B4AA 2EIKH 2M4GA 4Q5SF 1D5VA 2DQLA 2OCCH 2KKOA 2CW0F 2DCEA 2QLZA 4GXOA 1RIOH 1X4OA 3CCYA 2CQ7A 2NS0A 4IVNA 2LTPA 2P7VB 4IX7A 3H9JA 4HLYA 4MTEA 1WI3A 4ZZLA 2GOXB 3E6CC 1T98A 5DCMA 3S1NJ 3IH2A 1BM9A 2ICWG 4HG2A 2DMQA 2CV2A 3HOVJ 4IL6C 2GM4A 1TL8A 4IHVA 1MMSA 3WE3A 2BHYA 2OQRA 3S14J 3PIPF 1MIJA 4A5MA 4FT8A 4CH7A 4XLAA 3LSJA 3QYBA 4KMUX 1WJ5A 4BAYA 4XLNF 3GTQJ 1G4DA 2ZXHA 3FXQA 2I8DA 3H36A 3F8MA 2L9SA 2XV4S 5JHFA 3PNVA 1OMIA 2K4JA 4HZFA 4B1RA 3FBNB 2K9SA 3CQZJ 5LEKA 2VUMJ 2L4AA 3G1OA 3H35A 2VQHA 2XF5A 3BTJA 1T8IA 3LA3A 2QCOA 4ABZA 4G9YA 2LRDA 4IOCF 1R1TA 1U6GA 1XD7A 2BBYA 3ABLH 1J9IA 3W3CA 1BOAA 2JJ7A 1IV8A 1LFPA 4HSRA 3ECHA 1IUFA 5LHHA 2Z16A 2E7WA 3OYDA 3ASNH 1FYKA 1RUNA 4M6VA 4D1QA 5KK1A 4P1WA 2Q2EA 5DYMA 1MH3A 3RKYA 4HLXA 1A35A 3I0TA 1RKWA 1KQ9A 3BR1A 2W84A 1CF7B 2TRTA 2QGUA 4OMYA 3ONQA 5FD5A 1TQMA 1JUMA 1FWZA 4A3BJ 4LG0A 2D1HA 3M07A 3HKZN 1NK3P 2DMTA 1DP7P 4M3DA 2ZJPF 1BJZA 1VQNI 3KZYA 1LDKB 2LVSA 4D0PA 4KIGA 1T2KA 3K1NA 3QPSA 3GFJA 3F9KA 2E35A 3PQJA 2VT3A 2MD5A 3QP5A 3JW4A 2L2OA 4M6XA 3HRUA 2IW5A 3ERED 2QBYA 1YITI 3KP3A 2ZSIB 3KP7A 5HVQC 4S04A 2QENA 4F55A 3LSHA 5JFRA 2VPRA 3RPQA 4XQFA 4G6DA 1FJLA 1B72B 2XDVA 5D5VB 3BR5A 3JR9A 2PMUA 2HKOA 2XAQA 1S7AA 1W0TA 2DOFA 4EGZA 3EUHA 5CVUA 3TOAA 3UKGA 3K4KA 2H1LA 2LFBA 1SD5A 1IRFA 1Z3XA 2FOKA 4D7NA 5JLXA 3DTEA 5E3LA 3CJQB 1UB9A 5HS7A 4A2UA 2YU9J 1BI3A 3BT9A 1I27A 4D9JA 2MD0A 5FD6A 2P5VA 3B6AA 1IN8A 2BY2A 1Q1HA 4R8HA 2F6CA 3BG9A 2VQGA 1FC3A 3GLLA 3MKLA 4UVBA 2DBBA 3SFIA 4IKFA 1IXCA 1P6RA 4HV5A 3BQZA 2CGPA 2BY1A 4KDPA 3S15J 4B8XA 1X58A 1R49A 1JGSA 5IYDJ 2QSGX 3OR2C 3RKQA 2NS7A 1ZHFA 1GXPA 2JMWA 1XMAA 1CGPA 1YS6A 3A0BC 1Z1DA 4NQWB 2DO7A 4YG2F 3TEDA 2OZUA 5LGNA 3SQNA 3C2BA 2M8GX 3S3NA 1G3TA 3OYKA 4L9JA 2B63J 3CC7I 3VPRA 1G3SA 1UELB 2MFZA 2K7LA 2FBHA 1UG0A 5CYVA 1TLHB 4WXCA 4RA2A 3LAJA 4FTHA 3GEZA 4Y17A 4AIKA 4AIDA 2ADUA 2E5ZA 3PSFA 2WA0A 3B6CA 3ZMZA 4ESBA 4XRSA 2OF7A 2CO5A 1PP8F 1T38A 5E1XA 2Y0MA 2YX4A 5KVRA 3K1MA 1QHHD 2EZIA 3U21A 2DA7A 1FLIA 3HDDA 1XCVA 4NHJA 2HI3A 3T1BA 3S3OA 1FBUA 2W00A 1YE9A 1Y0UA 2OQGA 2V1NA 3EPZA 4JX5A 3TW7A 4CCJA 1XPXA 2DJNA 4QLCU 3V42A 1YRNA 3M7GA 4HQMA 2R7UA 3HSFA 2J5OA 3F23A 1FSEA 2AQFA 2IGKA 2W57A 1P4WA 1UMQA 1MDMA 4MGRA 1SFOJ 3SHFA 2M0MA 2D1VA 3FMSA 3HSEA 2AO9A 1D0YA 1O3RA 2ISYA 2AXLA 2Y0SN 2QQBA 4E7ZA 1RC9A 4N0BA 4A6DA 4WXHA 1ERDA 4II3A 1EH7A 4AIHA 5D6EA 3OMYA 1QVUA 3C2GA 3OIPA 4YIRX 3O6BB 2LH9A 3FXLA 5JLWA 2FD5A 3H0DA 5E3MA 1FOWA 3DCFA 1K4SA 3E0JB 1IJWC 4CCLA 1HBXG 3FXMA 1BL0A 1LPQA 4GFBA 3B02A 1YQAA 1TNSA 3GUDA 4P55A 4AU7A 3GFIA 1EH8A 4NC7A 4ZYGA 1KGSA 3NRVA 1SVLA 3ZQCA 3PM1A 4Z2YA 3IH4A 3TGNA 4L0YB 3GTKJ 4OU0A 2ZXIA 1Z21A 5BNGA 5DV5A 4N4OB 2RREA 3N4MA 1WHUA 3BG3A 4LMYA 1R5HA 5LLQA 3L2QA 1EJ9A 2LY9A 2H94A 4G8XA 3CF2A 2MABA 5FKLA 4C3HJ 3L2CA 1VQ6I 4HNTA 3E5UA 1RR7A 1U2WA 1VQ7I 1VNDA 2EA4A 5F0HA 2WAEA 2RDPA 2VBZA 2K9QA 5DCMB 2D2WA 2IVMA 4Y52J 3WTXC 5DDGA 1ON2A 4KITB 1ZARA 3WE2A 5CVRA 2VI6A 4BBRJ 2DN0A 1ZG5A 2BGCA 3KE2A 1Z6RA 2ECCA 2YS9A 2KIMA 3GCMA 2L01A 4Q48A 1DPRA 2VJ5A 5EZHA 3V7SA 4BHPA 4UV8A 3WGGA 5M3FJ 2E2JJ 1R23A 2XSJC 1FYMA 2KLOA 1JKOC 1DPUA 2BY3A 5KHDA 2ELHA 1U3EM 4NDLA 1S29A 2DT5A 2MC4A 2BV6A 4HPQA 5H2FC 2XAGA 1IN5A 5J8CA 3FIWA 5L3BA 2LKPA 1VQPI 4LGWA 3C18A 3PFYA 5L3FA 3K2ZA 4RB0A 4A3JJ 2K3FA 2K85A 3JRHA 1HW1A 2Z1DA 3CUQB 4PZJA 3O3KA 1K79A 1VQKI
chains in the Genus database with same CATH topology
2X4HA 3D0SA 4L0ZB 2O3FA 2JSCA 5IT9K 1U8RA 4LG0B 5FO5A 2P5KA 3P9CA 4PCQA 4ZYHA 3ISPA 4PGHA 4I0BA 1R00A 4GYIA 5D5UB 2IT0A 3RDIA 5L3GA 3IKVA 3KP4A 3H92A 2HTJA 3HSRA 3JSOA 1B9MA 3Q9VA 3RKWA 3RI4A 1JHHA 3ZMVA 1GVJA 3HYIA 1XSXA 1ON1A 1ZGJA 2DPUA 4HF2A 4OMZA 2L3DA 2K02A 1UCRA 1BIBA 3CJNA 2DQRA 2G7HA 4OIRF 3ABUA 5ICGA 4UUVA 1IF1A 2XAJA 2M45A 3ZP5A 2ZMEA 5D4SA 3HRSA 2ZJ2A 2XAHA 2YR2A 5F6FA 1TQIA 1ZLJA 2DI3A 2Y48A 1R5GA 4KUMA 5HDNA 4P9UA 1FPQA 4G7OF 2HYFA 5BPIA 4Q4ZF 1YW7A 3BPVA 4M9SA 1R22A 1IW7F 3KLOA 3I54A 3KLNA 3GWZA 2UWMA 2K86A 3F8BA 1SD6A 4O6JA 2A07F 6PAXA 2Z3YA 5HOOA 4HOBA 4ASNA 1KQ0A 1S8NA 2HWVA 2GZWA 1FP2A 3WTYC 2H27A 1WI9A 4EQQA 1FSHA 5BMZA 1ZYRF 3E5QA 1I6XA 5AIQA 4A12A 4CDGA 2BEOA 2YSRA 4KIFA 5K5RA 2IRFG 2EV6A 5DUIA 1IXRC 5DUKA 4AWXB 4ENJA 3QOPA 4UNOA 5DD4A 1RNLA 4MQ9F 1H9TA 3PQKA 4CICA 4UXNA 3BWGA 5K5OA 3MEXA 2DU9A 1P2FA 2CWEA 2NAZA 1EH6A 3H3ZA 4L9NA 3LQQA 2HFHA 5E17F 4YFXF 2PQ8A 4EVIA 1QGPA 1D8KA 3QPHA 2R7DA 2WC2A 2JT1A 1EV7A 3GZ5A 1KU2A 1SMTA 3P9KA 1I1SA 3HUGA 2RGVA 2VONA 5L3EA 1Z7UA 2R3SA 4HA8A 2XGXA 5BOXA 3MAJA 3FHZA 3QPTA 3SFZA 4AIJA 2ZKZA 1USSA 4L9TA 2QZ8A 4YFNF 3E97A 4IXAA 3FX3A 1BN5A 3HTUA 1K7AA 4OIQF 3V8JA 2MBFA 1UHWA 3VODA 5H20A 2RC4A 3ZMTA 1I5ZA 2EJRA 2Q0OA 5LHIA 3M8FA 2V1DA 2XKPA 1W7PA 2ZXJA 2VODA 2PBIA 3E5XA 4DNCA 2OU2A 4I98B 3K0LA 1STZA 1XGNA 5CVJA 1QZYA 2O03A 2M87A 3J7AO 4TV7A 4EMSA 3GW2A 1XB4A 2E1NA 3T0YA 3M8EA 4HX8A 5JR3A 4R79A 4M9XA 2FXAA 2VN2A 4OOIA 2EK5A 3LA2A 3MFKA 3LAPA 5FGMA 3SZPA 4S05A 4A6EA 1OYWA 4KNYA 4Y15A 4WWCA 1B1BA 2OA4A 5LRRA 2VBXA 2FBKA 1AOYA 1E2XA 1E17A 3MZYA 5HDKA 1IZ1A 2M30A 4ESJA 1KYZA 2YX7A 3ZN1A 4H0EA 1BIAA 5CJ9A 3FM3A 5AONA 2B0LA 5D5WB 4U7DA 1SMYF 5BPDA 2P8TA 4RAZA 4EM1A 2FEZA 2FE3A 3LSTA 1IN4A 1P4AA 1ZH5A 2WV0A 4WCGA 4RB2C 4GGGA 3BDDA 4LB6B 4NQWA 2NNYA 1J7KA 3ML6A 2EA2A 5CLSA 2RQPA 4U88A 5DCFA 4ENNA 2OAZA 2IPQX 3TOBA 2P7CB 1FOKA 2ZO4A 2Q8KA 1XDUA 1ULYA 3P9IA 4L5IA 2STTA 2PN6A 1FZPB 4UVCA 1MJBA 2AS5F 4KICA 2Z99A 1ZAOA 1SD7A 1K6OA 2EFQA 4HQEA 4LJZF 3LFKA 2HGCA 1KU7A 5ICCA 2D45A 4FX4A 1MGTA 3E6MA 4YIFA 1RI7A 3ZPLA 1HKTA 4IHSA 4LLLA 2MH2A 1HXDA 3L7WA 1G3WA 3I5UA 1B6AA 1GXQA 5HS9A 2CQKA 2J5PA 1G3YA 2EWNA 4MEYF 2QWWA 5D5XB 2H09A 3DXJF 4EM0B 4BQAA 3V7CA 2M8EA 3DPTA 1T39A 4HV6A 2JPBA 1HKQA 3F21A 4HX4A 3WGIA 4FHTA 3RJPA 3RKXA 1IN6A 3FXRA 3IRQA 4LD5A 3KEQA 4LLNA 1BI2A 1F4KA 1QBJA 2RN7A 1HSTA 2XKOA 4EJVA 1K78B 1Z05A 2DFIA 4QWQA 2NRAC 3I58A 2FMLA 2YPRA 3GXOA 2FU4A 3GX4X 2QUFA 3RYRA 3ROUA 1PP7U 4XSZF 2UXNA 4JQFA 1R1VA 2F5DA 4BXUA 4RGUA 1BBYA 2HR3A 1WQ2A 3H3UA 4MQVA 4CZZA 3WTZA 1H9GA 4RGXA 1X3UA 3HIFA 1BC7C 1P92A 3WTSC 3DFGA 2RNJA 4P96A 4GCVA 1SFEA 4GYGA 1KYWA 3CLOA 3R4KA 4M74A 4A0YA 5EEGA 1XGSA 4BHBA 3CUQA 1FP1D 2NNNA 1QPMA 2JRTA 3V8LA 2IA2A 4EJOA 3R6SA 3KP6A 3VB2A 4IRIA 2O61A 1WRJA 1MZBA 4U7BA 3NEUA 1YG2A 2DLLA 3MCZA 3CO6C 1JE8A 3ABTA 4EGYA 3I53A 3TO6A 4EM2A 4O3MA 3I4PA 5ILSA 4U0VA 3IWFA 1O3QA 1KU3A 1C0WA 1LNWA 2QBYB 4I7HA 3HOSA 2UZKA 2K27A 4AVPA 1A04A 1H0MA 4HF1A 5ED4A 3CUQC 2L54A 1TBXA 3HRMA 1ZRCA 3KZZA 5E20A 3F3XA 1HW5A 1W5SA 1IN7A 2GXGA 3WGHA 2BYVE 2VBYA 4KN7X 4A5NA 2EB7A 2EV0A 1LEBA 1QNTA 2VOPA 4FX0A 1KA8A 3HRTA 2KIFA 2WTEA 1IRGA 2VT2A 3IKTA 2L4MA 1HQCA 1XSDA 3MQ0A 4LK0F 3WTWC 2ACJA 2DK8A 2QQ9A 5H6RA 4IRGA 4PDKA 5BQTA 1Z9CA 3LA7A 5ILUA 1GHCA 1RUOA 1ONVA 2OBPA 3OV8A 1YW8A 4G94A 5A2QK 1J0RA 1L3LA 2V9VA 3C7JA 3GO5A 2P4WA 2VXZA 2PJPA 1MDMB 1YS7A 1FNNA 1XGOA 3DKWA 1ZRFA 4U0WA 1V4RA 2TDXA 2E1CA 3DQVC 1D3YA 2VE8A 5HLGA 3V7RA 5FLXZ 4HDVA 2MC3A 2Z9OA 4G7ZF 4CHUA 3GVAA 2OZ6A 1O57A 2EV5A 2ZNZA 2GXBA 1BI0A 3GYHX 1F5TA 1OYIA 2MLKA 3M9AA 2ZCWA 5D8LB 2V1UA 2GA2A 4G7HF 2G9WA 3CDHA 1OPCA 2A6EF 2GQQA 4KIBA 5FFXA 2P5LC 2LNBA 5DEQA 3CTAA 5D6FA 3JAMK 5HLIA 2R7FA 2P6SA 3N97A 2Z5UA 4RS8A 1S3JA 5FLXK 3F6OA 3FM5A 4Q47A 1SFUA 2V79A 1WSUA 3JSPA 2H6CA 2LF8A 3IHUA 4MHGA 1HSJA 2FF4A 1O7FA 2UXXA 1BI1A 3ULQB 3QU6A 3DV8A 3T8RA 1XSVA 3QRFF 1IAWA 4P9FA 2CSOA 2DW4A 1WWXA 2F5FA 4HAMA 4ZZDA 1BC8C 3C1DA 5JHUA 1OYYA 5D8KB 4LLGF 2F5CA 5CVVA 4ON0A 1SFXA 2QM3A 1KU9A 2KRFA 3REOA 2YU3A 2O6GE 1Z91A 1QZZA 1TQPA 4BH9A 1KQ8A 3F6VA 4M73A 5IT3A 4WK8F 3IL2A 2COMA 4RB1A 3FMQA 4N9HA 1UFMA 2IA0A 1W7PB 3DEUA 3F8CA 3HOTA 3AAFA 4IF4A 4OINF 5JVTA 3C3WA 2O8XA 4R1HA 5ICFA 4KA4A 3TKYA 4I02A 1MD0A 3BP8A 3CUOA 4P5OA 2FBIA 4I01A 3WTUC 5ERIA 2ZMEB 2GIVA 2WWYA 3E6DA 4OIPF 5TRDA 3PFIA 3F72A 3TO9A 2OD5A 5LRSA 4BNCA 1ZG3A 1MJ9A 3ELKA 3WG9A 4HX7A 3P7NA 5A2QZ 1J5YA 1F1ZA 3S2WA 3ZMUA 3FXUA 2Y75A 3LWFA 1YO5C 2XHKA 2HEOA 2LF7A 2BE5F 4O5VA 2XASA 1TW2A 3IC7A 4RB3C 2QQAA 2ESHA 4KYWA 3QAHA 5E8GA 3J81Z 2ZFWA 1PDNC 2PG4A 4HYEA 4Y13A 3EYYA 5CVIA 3O2PE 3WU1B 1R36A 2ZBKA 1K78A 5HLHA 1LVAA 3MWMA 2EFNA 1O3SA 4M71A 4IPAA 1U5TB 1R58A 1U78A 1YIOA 3J81K 3QP6A 2ZNYA 1REPC 3TDZC 3ZN0A 4OIOF 3OOPA 2ISZA 4BYYA 2EFPA 2RKHA 4KT5C 4XSXF 2M5WA 2A3SA 1U5TC 4WXDA 3E3VA 1OKRA 3BOQA 4EJUA 2HOEA 4EJWA 5ILVA 3KP2A 2STWA 3D5LA 5LHGA 1YYVA 3KP5A 3GFLA 3FWEA 3EETA 1NHAA 5HS8A 2RV8A 1LJ9A 2CFXA 1XCBA 1ZREA 4L9VA 3TO7A 2HYGD 5E1WA 1WKMA 5ICEA 2A6HF 1YLFA 1TTYA 1PUEE 5FFZA 2EFOA 1ZGAA 5LBQA 2XRNA 2PI0A 4ENKA 3CO7C 1B9NA 1V3FA 1U5TA 3GZ6A 4I2OA 3WTTC 5E8IA 1HKSA 2DK5A 4EV0A 2E7XA 3FMRA 4IHTA 3KFWX 2Z33A 2G7UA 1J59A 3F22A 4HDUA 3QU3A 1VTNC 2JZYA 2MH9A 5HDGA 3FZVA 2W24A 3K1PA 4HW0A 2DAOA 4N9IA 2A69F 1W5TA 5K5QA 3DPLC 2ETHA 3R61A 4JBAA 3W6KB 3F8NA 2A61A 3VOEA 2HQNA 3TDUC 5F1RA 4A0XA 1LB2A 3KETA 2RVCA 1SD4A 2EFWA 4B09A 1W4MA 1MKMA 3I71A 2VC1A 2CYYA 4ZYEA 3JTHA 5J8FA 1XN7A 4XLPF 2P6TA 4JK1X 2FRHA 4M9ZA 4RGSA 3FF5A 3GFMA 2K4BA 3BJAA 3RIRA 4ZH4F 3ECOA 2W85A 1YW9A 4IRHA 3IRRA 4KN4X 3TQNA 1FY7A 2L02A 5TJJA 4WX9A 2XUBA 4CO8A 2VC0A 3U2RA 3U1DA 2PMHA 3I64A 4BHCA 1DUXC 3JTGA 1W7PD 1TW3A 2HZTA 3COAC 2PFBA 5F64A 5LEJA 4UV9A 1ODDA 3K9TA 2IP2A 1S7OA 4RAYA 3B73A 2DPDA 1JXSA 1CF7A 1BJAA 3GF2A 3LQRA 4A0ZA 2JTVA 3R0AA 5E1ZB 1LQ1A 1O3TA 4MEXF 4LFUA 3L00A 1FX7A 5JI6A 1FYLA 1R7JA 2LSOA 4HF0A 4LB5A 1XMKA 3SXYA 3Q9SA 4K2EA 4U0YA 4MTDA 4UVAA 3G3ZA 4MNUA 3R0JA 3ZMDA 1LDJA 2XAFA 2FNAA 4AD9A 2KJCA 2M1BA 1J75A 2VBWA 2H6BA 1QQIA 3GLXA 3HTSB 1FT9A 3VFZA 3JAMZ 4YFKF 3L09A 5BS6A 4XBFA 5J6XA 1USTA 2DTRA 4HBLA 3RTRA 3V8KA 4CXFA 5AIPA 2FNPA 3K69A 4I0AA 4YIIA 2PEXA 2F2EA 3NQOA 1L0OC 3KCCA 2VOOA 2MA3A 4ZYDA 4WF2A 4DQ2A 4L18B 2W25A 2A5YB 3I59B 1MJAA 2ESNA 1B59A 1AWCA 5LGUA 3IWZA 4L5JA 3BJOA 2QYOA 4RGRA 1ZLKA 3F8FA 4XRFA 3VEPA 3EYIA 2KIUA 1XDSA 1FBSA 3MZHA 4PGGA 3J80K 4NB5A 2GAUA 1J2XA 4GO1A 3RPUA 3HHHA 3WTVC 5IT9Z 1IXSB 1YTYA 5LGTA 2GA1A 1JHFA 3DP7A 3SZTA 2KJBA 3G73A 1O7LA 4KFCA 2V1XA 3M1EA 3V4GA 3EQLF 5K1YA 2NYXA 3BPXA 3J80Z 3ZQ7A 3WU0A 4CYDA 2O0YA 5E18F 3Q5FA 4M6YA 2JPCA 1P4XA 3L9FA 1FBQA 1D8JA 1S6LA 3BROA 2FMYA 2GWRA 3KEOA 1QO0D 2XROA 4LK1F 5FB2A 1G6NA 5EEHA 1DDNA 1R1UA 1ZRDA 2C6YA 1XGMA 2X0LA 4ETSA 1IUYA 5L3DA 1SAXA 4M72A 4UHTA 2FA5A 1HW2A 1I1GA 1LEAA 2V6CA 3WODF 2F5EA 5D4RA 2FSWA 2XIGA 4F7ZA 4EJTA 3U9GA 2XVCA 3E6BA 3BJ6A 2IA1A 3RYPA 3DF8A 2QVOA 3I59A 2LDUA 4E70A 3T5XA 1YFHA 2PLYA 2HS5A 1T0FA 4CGZA 3W6JB 2CG4A 1TNTA 3EDPA 3BY6A 5DD8A 3BZ6A 1T6SA 3ZMSA 3R60A 1ZG1A 1LDDA 1OR7A 2HTSA 4I09A 4G6QA 1F9NA 1RZ4A 2HDCA 2A68F 2MLGA 2IJLA 4ENMA 4KMFA 5L3CA 2FQ3A 3T8TA 2HQRA 1Z6TA 4IJAA 5H6QA 3HHGA 1UHMA 4ESFA 1ZN2A 2VE9A 2HKXA 1B4AA 4Q5SF 1D5VA 2DQLA 2KKOA 2CW0F 2QLZA 4GXOA 1RIOH 2NS0A 4IVNA 2P7VB 4HLYA 4MTEA 4ZZLA 3E6CC 1T98A 5DCMA 1BM9A 3WE3A 2OQRA 4A5MA 4FT8A 4BAYA 4KMUX 4XLNF 1G4DA 3FXQA 3F8MA 2XV4S 4HZFA 1OMIA 2K4JA 5LEKA 2L4AA 3LA3A 4G9YA 1R1TA 1U6GA 1XD7A 2BBYA 1J9IA 1BOAA 3ECHA 5LHHA 2E7WA 1FYKA 1RUNA 5KK1A 2Q2EA 5DYMA 3RKYA 4HLXA 3I0TA 1KQ9A 2W84A 1CF7B 4OMYA 5FD5A 1TQMA 1FWZA 4LG0A 2D1HA 1DP7P 3KZYA 1LDKB 4D0PA 4KIGA 1T2KA 3K1NA 3GFJA 3PQJA 2VT3A 2MD5A 3QP5A 3JW4A 4M6XA 3HRUA 2IW5A 3ERED 2QBYA 3KP3A 3KP7A 5HVQC 4S04A 2QENA 5JFRA 3RPQA 4G6DA 5D5VB 2PMUA 2HKOA 2XAQA 1S7AA 4EGZA 3EUHA 5CVUA 3TOAA 1SD5A 1IRFA 2FOKA 1UB9A 5HS7A 4A2UA 1BI3A 1I27A 5FD6A 2P5VA 1IN8A 4R8HA 1Q1HA 1FC3A 4UVBA 2DBBA 1IXCA 1P6RA 4HV5A 2CGPA 4KDPA 4B8XA 1JGSA 1ZHFA 1GXPA 1XMAA 1CGPA 1YS6A 1Z1DA 2DO7A 4YG2F 2OZUA 5LGNA 3SQNA 1G3TA 4L9JA 1G3SA 2FBHA 2K7LA 5CYVA 1TLHB 4WXCA 3LAJA 3GEZA 4Y17A 4AIKA 2ADUA 3ZMZA 4ESBA 2CO5A 1PP8F 1T38A 5E1XA 2Y0MA 2YX4A 5KVRA 3K1MA 1FLIA 1XCVA 4NHJA 3T1BA 1FBUA 1Y0UA 2OQGA 4QLCU 3M7GA 4HQMA 3HSFA 2J5OA 3F23A 1FSEA 2W57A 1P4WA 1MDMA 4MGRA 3SHFA 2D1VA 3FMSA 3HSEA 1O3RA 2ISYA 2AXLA 2QQBA 4N0BA 4A6DA 4WXHA 1EH7A 4AIHA 5D6EA 3O6BB 1HBXG 3B02A 1YQAA 3GFIA 1TNSA 3GUDA 4P55A 1EH8A 4ZYGA 1KGSA 3NRVA 4Z2YA 3TGNA 4L0YB 4OU0A 5DV5A 3N4MA 4LMYA 5LLQA 1R5HA 2H94A 4G8XA 3L2CA 3E5UA 1U2WA 2EA4A 2RDPA 2VBZA 5DCMB 2D2WA 2IVMA 3WTXC 5DDGA 1ON2A 1ZARA 3WE2A 5CVRA 1ZG5A 2BGCA 3KE2A 1Z6RA 2KIMA 3V7SA 2L01A 4Q48A 1DPRA 4BHPA 4UV8A 3WGGA 1R23A 1FYMA 1DPUA 2ELHA 1U3EM 1S29A 2DT5A 2BV6A 2XAGA 1IN5A 5J8CA 5L3BA 2LKPA 4LGWA 3C18A 5L3FA 3K2ZA 4RB0A 1HW1A 3CUQB 4PZJA 3O3KA 1K79A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X4H A;  3D0S A;  4L0Z B;  2O3F A;  2JSC A;  5IT9 K;  1U8R A;  4LG0 B;  5FO5 A;  2P5K A;  3P9C A;  4PCQ A;  4ZYH A;  3ISP A;  4PGH A;  4I0B A;  1R00 A;  4GYI A;  5D5U B;  2IT0 A;  3RDI A;  5L3G A;  3IKV A;  3KP4 A;  3H92 A;  2HTJ A;  3HSR A;  3JSO A;  1B9M A;  3Q9V A;  3RKW A;  3RI4 A;  1JHH A;  3ZMV A;  1GVJ A;  3HYI A;  1XSX A;  1ON1 A;  1ZGJ A;  2DPU A;  4HF2 A;  4OMZ A;  2L3D A;  2K02 A;  1UCR A;  1BIB A;  3CJN A;  2DQR A;  2G7H A;  4OIR F;  3ABU A;  5ICG A;  4UUV A;  1IF1 A;  2XAJ A;  2M45 A;  3ZP5 A;  2ZME A;  5D4S A;  3HRS A;  2ZJ2 A;  2XAH A;  2YR2 A;  5F6F A;  1TQI A;  1ZLJ A;  2DI3 A;  2Y48 A;  1R5G A;  4KUM A;  5HDN A;  4P9U A;  1FPQ A;  4G7O F;  2HYF A;  5BPI A;  4Q4Z F;  1YW7 A;  3BPV A;  4M9S A;  1R22 A;  1IW7 F;  3KLO A;  3I54 A;  3KLN A;  3GWZ A;  2UWM A;  2K86 A;  3F8B A;  1SD6 A;  4O6J A;  2A07 F;  6PAX A;  2Z3Y A;  5HOO A;  4HOB A;  4ASN A;  1KQ0 A;  1S8N A;  2HWV A;  2GZW A;  1FP2 A;  3WTY C;  2H27 A;  1WI9 A;  4EQQ A;  1FSH A;  5BMZ A;  1ZYR F;  3E5Q A;  1I6X A;  5AIQ A;  4A12 A;  4CDG A;  2BEO A;  2YSR A;  4KIF A;  5K5R A;  2IRF G;  2EV6 A;  5DUI A;  1IXR C;  5DUK A;  4AWX B;  4ENJ A;  3QOP A;  4UNO A;  5DD4 A;  1RNL A;  4MQ9 F;  1H9T A;  3PQK A;  4CIC A;  4UXN A;  3BWG A;  5K5O A;  3MEX A;  2DU9 A;  1P2F A;  2CWE A;  2NAZ A;  1EH6 A;  3H3Z A;  4L9N A;  3LQQ A;  2HFH A;  5E17 F;  4YFX F;  2PQ8 A;  4EVI A;  1QGP A;  1D8K A;  3QPH A;  2R7D A;  2WC2 A;  2JT1 A;  1EV7 A;  3GZ5 A;  1KU2 A;  1SMT A;  3P9K A;  1I1S A;  3HUG A;  2RGV A;  2VON A;  5L3E A;  1Z7U A;  2R3S A;  4HA8 A;  2XGX A;  5BOX A;  3MAJ A;  3FHZ A;  3QPT A;  3SFZ A;  4AIJ A;  2ZKZ A;  1USS A;  4L9T A;  2QZ8 A;  4YFN F;  3E97 A;  4IXA A;  3FX3 A;  1BN5 A;  3HTU A;  1K7A A;  4OIQ F;  3V8J A;  2MBF A;  1UHW A;  3VOD A;  5H20 A;  2RC4 A;  3ZMT A;  1I5Z A;  2EJR A;  2Q0O A;  5LHI A;  3M8F A;  2V1D A;  2XKP A;  1W7P A;  2ZXJ A;  2VOD A;  2PBI A;  3E5X A;  4DNC A;  2OU2 A;  4I98 B;  3K0L A;  1STZ A;  1XGN A;  5CVJ A;  1QZY A;  2O03 A;  2M87 A;  3J7A O;  4TV7 A;  4EMS A;  3GW2 A;  1XB4 A;  2E1N A;  3T0Y A;  3M8E A;  4HX8 A;  5JR3 A;  4R79 A;  4M9X A;  2FXA A;  2VN2 A;  4OOI A;  2EK5 A;  3LA2 A;  3MFK A;  3LAP A;  5FGM A;  3SZP A;  4S05 A;  4A6E A;  1OYW A;  4KNY A;  4Y15 A;  4WWC A;  1B1B A;  2OA4 A;  5LRR A;  2VBX A;  2FBK A;  1AOY A;  1E2X A;  1E17 A;  3MZY A;  5HDK A;  1IZ1 A;  2M30 A;  4ESJ A;  1KYZ A;  2YX7 A;  3ZN1 A;  4H0E A;  1BIA A;  5CJ9 A;  3FM3 A;  5AON A;  2B0L A;  5D5W B;  4U7D A;  1SMY F;  5BPD A;  2P8T A;  4RAZ A;  4EM1 A;  2FEZ A;  2FE3 A;  3LST A;  1IN4 A;  1P4A A;  1ZH5 A;  2WV0 A;  4WCG A;  4RB2 C;  4GGG A;  3BDD A;  4LB6 B;  4NQW A;  2NNY A;  1J7K A;  3ML6 A;  2EA2 A;  5CLS A;  2RQP A;  4U88 A;  5DCF A;  4ENN A;  2OAZ A;  2IPQ X;  3TOB A;  2P7C B;  1FOK A;  2ZO4 A;  2Q8K A;  1XDU A;  1ULY A;  3P9I A;  4L5I A;  2STT A;  2PN6 A;  1FZP B;  4UVC A;  1MJB A;  2AS5 F;  4KIC A;  2Z99 A;  1ZAO A;  1SD7 A;  1K6O A;  2EFQ A;  4HQE A;  4LJZ F;  3LFK A;  2HGC A;  1KU7 A;  5ICC A;  2D45 A;  4FX4 A;  1MGT A;  3E6M A;  4YIF A;  1RI7 A;  3ZPL A;  1HKT A;  4IHS A;  4LLL A;  2MH2 A;  1HXD A;  3L7W A;  1G3W A;  3I5U A;  1B6A A;  1GXQ A;  5HS9 A;  2CQK A;  2J5P A;  1G3Y A;  2EWN A;  4MEY F;  2QWW A;  5D5X B;  2H09 A;  3DXJ F;  4EM0 B;  4BQA A;  3V7C A;  2M8E A;  3DPT A;  1T39 A;  4HV6 A;  2JPB A;  1HKQ A;  3F21 A;  4HX4 A;  3WGI A;  4FHT A;  3RJP A;  3RKX A;  1IN6 A;  3FXR A;  3IRQ A;  4LD5 A;  3KEQ A;  4LLN A;  1BI2 A;  1F4K A;  1QBJ A;  2RN7 A;  1HST A;  2XKO A;  4EJV A;  1K78 B;  1Z05 A;  2DFI A;  4QWQ A;  2NRA C;  3I58 A;  2FML A;  2YPR A;  3GXO A;  2FU4 A;  3GX4 X;  2QUF A;  3RYR A;  3ROU A;  1PP7 U;  4XSZ F;  2UXN A;  4JQF A;  1R1V A;  2F5D A;  4BXU A;  4RGU A;  1BBY A;  2HR3 A;  1WQ2 A;  3H3U A;  4MQV A;  4CZZ A;  3WTZ A;  1H9G A;  4RGX A;  1X3U A;  3HIF A;  1BC7 C;  1P92 A;  3WTS C;  3DFG A;  2RNJ A;  4P96 A;  4GCV A;  1SFE A;  4GYG A;  1KYW A;  3CLO A;  3R4K A;  4M74 A;  4A0Y A;  5EEG A;  1XGS A;  4BHB A;  3CUQ A;  1FP1 D;  2NNN A;  1QPM A;  2JRT A;  3V8L A;  2IA2 A;  4EJO A;  3R6S A;  3KP6 A;  3VB2 A;  4IRI A;  2O61 A;  1WRJ A;  1MZB A;  4U7B A;  3NEU A;  1YG2 A;  2DLL A;  3MCZ A;  3CO6 C;  1JE8 A;  3ABT A;  4EGY A;  3I53 A;  3TO6 A;  4EM2 A;  4O3M A;  3I4P A;  5ILS A;  4U0V A;  3IWF A;  1O3Q A;  1KU3 A;  1C0W A;  1LNW A;  2QBY B;  4I7H A;  3HOS A;  2UZK A;  2K27 A;  4AVP A;  1A04 A;  1H0M A;  4HF1 A;  5ED4 A;  3CUQ C;  2L54 A;  1TBX A;  3HRM A;  1ZRC A;  3KZZ A;  5E20 A;  3F3X A;  1HW5 A;  1W5S A;  1IN7 A;  2GXG A;  3WGH A;  2BYV E;  2VBY A;  4KN7 X;  4A5N A;  2EB7 A;  2EV0 A;  1LEB A;  1QNT A;  2VOP A;  4FX0 A;  1KA8 A;  3HRT A;  2KIF A;  2WTE A;  1IRG A;  2VT2 A;  3IKT A;  2L4M A;  1HQC A;  1XSD A;  3MQ0 A;  4LK0 F;  3WTW C;  2ACJ A;  2DK8 A;  2QQ9 A;  5H6R A;  4IRG A;  4PDK A;  5BQT A;  1Z9C A;  3LA7 A;  5ILU A;  1GHC A;  1RUO A;  1ONV A;  2OBP A;  3OV8 A;  1YW8 A;  4G94 A;  5A2Q K;  1J0R A;  1L3L A;  2V9V A;  3C7J A;  3GO5 A;  2P4W A;  2VXZ A;  2PJP A;  1MDM B;  1YS7 A;  1FNN A;  1XGO A;  3DKW A;  1ZRF A;  4U0W A;  1V4R A;  2TDX A;  2E1C A;  3DQV C;  1D3Y A;  2VE8 A;  5HLG A;  3V7R A;  5FLX Z;  4HDV A;  2MC3 A;  2Z9O A;  4G7Z F;  4CHU A;  3GVA A;  2OZ6 A;  1O57 A;  2EV5 A;  2ZNZ A;  2GXB A;  1BI0 A;  3GYH X;  1F5T A;  1OYI A;  2MLK A;  3M9A A;  2ZCW A;  5D8L B;  2V1U A;  2GA2 A;  4G7H F;  2G9W A;  3CDH A;  1OPC A;  2A6E F;  2GQQ A;  4KIB A;  5FFX A;  2P5L C;  2LNB A;  5DEQ A;  3CTA A;  5D6F A;  3JAM K;  5HLI A;  2R7F A;  2P6S A;  3N97 A;  2Z5U A;  4RS8 A;  1S3J A;  5FLX K;  3F6O A;  3FM5 A;  4Q47 A;  1SFU A;  2V79 A;  1WSU A;  3JSP A;  2H6C A;  2LF8 A;  3IHU A;  4MHG A;  1HSJ A;  2FF4 A;  1O7F A;  2UXX A;  1BI1 A;  3ULQ B;  3QU6 A;  3DV8 A;  3T8R A;  1XSV A;  3QRF F;  1IAW A;  4P9F A;  2CSO A;  2DW4 A;  1WWX A;  2F5F A;  4HAM A;  4ZZD A;  1BC8 C;  3C1D A;  5JHU A;  1OYY A;  5D8K B;  4LLG F;  2F5C A;  5CVV A;  4ON0 A;  1SFX A;  2QM3 A;  1KU9 A;  2KRF A;  3REO A;  2YU3 A;  2O6G E;  1Z91 A;  1QZZ A;  1TQP A;  4BH9 A;  1KQ8 A;  3F6V A;  4M73 A;  5IT3 A;  4WK8 F;  3IL2 A;  2COM A;  4RB1 A;  3FMQ A;  4N9H A;  1UFM A;  2IA0 A;  1W7P B;  3DEU A;  3F8C A;  3HOT A;  3AAF A;  4IF4 A;  4OIN F;  5JVT A;  3C3W A;  2O8X A;  4R1H A;  5ICF A;  4KA4 A;  3TKY A;  4I02 A;  1MD0 A;  3BP8 A;  3CUO A;  4P5O A;  2FBI A;  4I01 A;  3WTU C;  5ERI A;  2ZME B;  2GIV A;  2WWY A;  3E6D A;  4OIP F;  5TRD A;  3PFI A;  3F72 A;  3TO9 A;  2OD5 A;  5LRS A;  4BNC A;  1ZG3 A;  1MJ9 A;  3ELK A;  3WG9 A;  4HX7 A;  3P7N A;  5A2Q Z;  1J5Y A;  1F1Z A;  3S2W A;  3ZMU A;  3FXU A;  2Y75 A;  3LWF A;  1YO5 C;  2XHK A;  2HEO A;  2LF7 A;  2BE5 F;  4O5V A;  2XAS A;  1TW2 A;  3IC7 A;  4RB3 C;  2QQA A;  2ESH A;  4KYW A;  3QAH A;  5E8G A;  3J81 Z;  2ZFW A;  1PDN C;  2PG4 A;  4HYE A;  4Y13 A;  3EYY A;  5CVI A;  3O2P E;  3WU1 B;  1R36 A;  2ZBK A;  1K78 A;  5HLH A;  1LVA A;  3MWM A;  2EFN A;  1O3S A;  4M71 A;  4IPA A;  1U5T B;  1R58 A;  1U78 A;  1YIO A;  3J81 K;  3QP6 A;  2ZNY A;  1REP C;  3TDZ C;  3ZN0 A;  4OIO F;  3OOP A;  2ISZ A;  4BYY A;  2EFP A;  2RKH A;  4KT5 C;  4XSX F;  2M5W A;  2A3S A;  1U5T C;  4WXD A;  3E3V A;  1OKR A;  3BOQ A;  4EJU A;  2HOE A;  4EJW A;  5ILV A;  3KP2 A;  2STW A;  3D5L A;  5LHG A;  1YYV A;  3KP5 A;  3GFL A;  3FWE A;  3EET A;  1NHA A;  5HS8 A;  2RV8 A;  1LJ9 A;  2CFX A;  1XCB A;  1ZRE A;  4L9V A;  3TO7 A;  2HYG D;  5E1W A;  1WKM A;  5ICE A;  2A6H F;  1YLF A;  1TTY A;  1PUE E;  5FFZ A;  2EFO A;  1ZGA A;  5LBQ A;  2XRN A;  2PI0 A;  4ENK A;  3CO7 C;  1B9N A;  1V3F A;  1U5T A;  3GZ6 A;  4I2O A;  3WTT C;  5E8I A;  1HKS A;  2DK5 A;  4EV0 A;  2E7X A;  3FMR A;  4IHT A;  3KFW X;  2Z33 A;  2G7U A;  1J59 A;  3F22 A;  4HDU A;  3QU3 A;  1VTN C;  2JZY A;  2MH9 A;  5HDG A;  3FZV A;  2W24 A;  3K1P A;  4HW0 A;  2DAO A;  4N9I A;  2A69 F;  1W5T A;  5K5Q A;  3DPL C;  2ETH A;  3R61 A;  4JBA A;  3W6K B;  3F8N A;  2A61 A;  3VOE A;  2HQN A;  3TDU C;  5F1R A;  4A0X A;  1LB2 A;  3KET A;  2RVC A;  1SD4 A;  2EFW A;  4B09 A;  1W4M A;  1MKM A;  3I71 A;  2VC1 A;  2CYY A;  4ZYE A;  3JTH A;  5J8F A;  1XN7 A;  4XLP F;  2P6T A;  4JK1 X;  2FRH A;  4M9Z A;  4RGS A;  3FF5 A;  3GFM A;  2K4B A;  3BJA A;  3RIR A;  4ZH4 F;  3ECO A;  2W85 A;  1YW9 A;  4IRH A;  3IRR A;  4KN4 X;  3TQN A;  1FY7 A;  2L02 A;  5TJJ A;  4WX9 A;  2XUB A;  4CO8 A;  2VC0 A;  3U2R A;  3U1D A;  2PMH A;  3I64 A;  4BHC A;  1DUX C;  3JTG A;  1W7P D;  1TW3 A;  2HZT A;  3COA C;  2PFB A;  5F64 A;  5LEJ A;  4UV9 A;  1ODD A;  3K9T A;  2IP2 A;  1S7O A;  4RAY A;  3B73 A;  2DPD A;  1JXS A;  1CF7 A;  1BJA A;  3GF2 A;  3LQR A;  4A0Z A;  2JTV A;  3R0A A;  5E1Z B;  1LQ1 A;  1O3T A;  4MEX F;  4LFU A;  3L00 A;  1FX7 A;  5JI6 A;  1FYL A;  1R7J A;  2LSO A;  4HF0 A;  4LB5 A;  1XMK A;  3SXY A;  3Q9S A;  4K2E A;  4U0Y A;  4MTD A;  4UVA A;  3G3Z A;  4MNU A;  3R0J A;  3ZMD A;  1LDJ A;  2XAF A;  2FNA A;  4AD9 A;  2KJC A;  2M1B A;  1J75 A;  2VBW A;  2H6B A;  1QQI A;  3GLX A;  3HTS B;  1FT9 A;  3VFZ A;  3JAM Z;  4YFK F;  3L09 A;  5BS6 A;  4XBF A;  5J6X A;  1UST A;  2DTR A;  4HBL A;  3RTR A;  3V8K A;  4CXF A;  5AIP A;  2FNP A;  3K69 A;  4I0A A;  4YII A;  2PEX A;  2F2E A;  3NQO A;  1L0O C;  3KCC A;  2VOO A;  2MA3 A;  4ZYD A;  4WF2 A;  4DQ2 A;  4L18 B;  2W25 A;  2A5Y B;  3I59 B;  1MJA A;  2ESN A;  1B59 A;  1AWC A;  5LGU A;  3IWZ A;  4L5J A;  3BJO A;  2QYO A;  4RGR A;  1ZLK A;  3F8F A;  4XRF A;  3VEP A;  3EYI A;  2KIU A;  1XDS A;  1FBS A;  3MZH A;  4PGG A;  3J80 K;  4NB5 A;  2GAU A;  1J2X A;  4GO1 A;  3RPU A;  3HHH A;  3WTV C;  5IT9 Z;  1IXS B;  1YTY A;  5LGT A;  2GA1 A;  1JHF A;  3DP7 A;  3SZT A;  2KJB A;  3G73 A;  1O7L A;  4KFC A;  2V1X A;  3M1E A;  3V4G A;  3EQL F;  5K1Y A;  2NYX A;  3BPX A;  3J80 Z;  3ZQ7 A;  3WU0 A;  4CYD A;  2O0Y A;  5E18 F;  3Q5F A;  4M6Y A;  2JPC A;  1P4X A;  3L9F A;  1FBQ A;  1D8J A;  1S6L A;  3BRO A;  2FMY A;  2GWR A;  3KEO A;  1QO0 D;  2XRO A;  4LK1 F;  5FB2 A;  1G6N A;  5EEH A;  1DDN A;  1R1U A;  1ZRD A;  2C6Y A;  1XGM A;  2X0L A;  4ETS A;  1IUY A;  5L3D A;  1SAX A;  4M72 A;  4UHT A;  2FA5 A;  1HW2 A;  1I1G A;  1LEA A;  2V6C A;  3WOD F;  2F5E A;  5D4R A;  2FSW A;  2XIG A;  4F7Z A;  4EJT A;  3U9G A;  2XVC A;  3E6B A;  3BJ6 A;  2IA1 A;  3RYP A;  3DF8 A;  2QVO A;  3I59 A;  2LDU A;  4E70 A;  3T5X A;  1YFH A;  2PLY A;  2HS5 A;  1T0F A;  4CGZ A;  3W6J B;  2CG4 A;  1TNT A;  3EDP A;  3BY6 A;  5DD8 A;  3BZ6 A;  1T6S A;  3ZMS A;  3R60 A;  1ZG1 A;  1LDD A;  1OR7 A;  2HTS A;  4I09 A;  4G6Q A;  1F9N A;  1RZ4 A;  2HDC A;  2A68 F;  2MLG A;  2IJL A;  4ENM A;  4KMF A;  5L3C A;  2FQ3 A;  3T8T A;  2HQR A;  1Z6T A;  4IJA A;  5H6Q A;  3HHG A;  1UHM A;  4ESF A;  1ZN2 A;  2VE9 A;  2HKX A;  1B4A A;  4Q5S F;  1D5V A;  2DQL A;  2KKO A;  2CW0 F;  2QLZ A;  4GXO A;  1RIO H;  2NS0 A;  4IVN A;  2P7V B;  4HLY A;  4MTE A;  4ZZL A;  3E6C C;  1T98 A;  5DCM A;  1BM9 A;  3WE3 A;  2OQR A;  4A5M A;  4FT8 A;  4BAY A;  4KMU X;  4XLN F;  1G4D A;  3FXQ A;  3F8M A;  2XV4 S;  4HZF A;  1OMI A;  2K4J A;  5LEK A;  2L4A A;  3LA3 A;  4G9Y A;  1R1T A;  1U6G A;  1XD7 A;  2BBY A;  1J9I A;  1BOA A;  3ECH A;  5LHH A;  2E7W A;  1FYK A;  1RUN A;  5KK1 A;  2Q2E A;  5DYM A;  3RKY A;  4HLX A;  3I0T A;  1KQ9 A;  2W84 A;  1CF7 B;  4OMY A;  5FD5 A;  1TQM A;  1FWZ A;  4LG0 A;  2D1H A;  1DP7 P;  3KZY A;  1LDK B;  4D0P A;  4KIG A;  1T2K A;  3K1N A;  3GFJ A;  3PQJ A;  2VT3 A;  2MD5 A;  3QP5 A;  3JW4 A;  4M6X A;  3HRU A;  2IW5 A;  3ERE D;  2QBY A;  3KP3 A;  3KP7 A;  5HVQ C;  4S04 A;  2QEN A;  5JFR A;  3RPQ A;  4G6D A;  5D5V B;  2PMU A;  2HKO A;  2XAQ A;  1S7A A;  4EGZ A;  3EUH A;  5CVU A;  3TOA A;  1SD5 A;  1IRF A;  2FOK A;  1UB9 A;  5HS7 A;  4A2U A;  1BI3 A;  1I27 A;  5FD6 A;  2P5V A;  1IN8 A;  4R8H A;  1Q1H A;  1FC3 A;  4UVB A;  2DBB A;  1IXC A;  1P6R A;  4HV5 A;  2CGP A;  4KDP A;  4B8X A;  1JGS A;  1ZHF A;  1GXP A;  1XMA A;  1CGP A;  1YS6 A;  1Z1D A;  2DO7 A;  4YG2 F;  2OZU A;  5LGN A;  3SQN A;  1G3T A;  4L9J A;  1G3S A;  2FBH A;  2K7L A;  5CYV A;  1TLH B;  4WXC A;  3LAJ A;  3GEZ A;  4Y17 A;  4AIK A;  2ADU A;  3ZMZ A;  4ESB A;  2CO5 A;  1PP8 F;  1T38 A;  5E1X A;  2Y0M A;  2YX4 A;  5KVR A;  3K1M A;  1FLI A;  1XCV A;  4NHJ A;  3T1B A;  1FBU A;  1Y0U A;  2OQG A;  4QLC U;  3M7G A;  4HQM A;  3HSF A;  2J5O A;  3F23 A;  1FSE A;  2W57 A;  1P4W A;  1MDM A;  4MGR A;  3SHF A;  2D1V A;  3FMS A;  3HSE A;  1O3R A;  2ISY A;  2AXL A;  2QQB A;  4N0B A;  4A6D A;  4WXH A;  1EH7 A;  4AIH A;  5D6E A;  3O6B B;  1HBX G;  3B02 A;  1YQA A;  3GFI A;  1TNS A;  3GUD A;  4P55 A;  1EH8 A;  4ZYG A;  1KGS A;  3NRV A;  4Z2Y A;  3TGN A;  4L0Y B;  4OU0 A;  5DV5 A;  3N4M A;  4LMY A;  5LLQ A;  1R5H A;  2H94 A;  4G8X A;  3L2C A;  3E5U A;  1U2W A;  2EA4 A;  2RDP A;  2VBZ A;  5DCM B;  2D2W A;  2IVM A;  3WTX C;  5DDG A;  1ON2 A;  1ZAR A;  3WE2 A;  5CVR A;  1ZG5 A;  2BGC A;  3KE2 A;  1Z6R A;  2KIM A;  3V7S A;  2L01 A;  4Q48 A;  1DPR A;  4BHP A;  4UV8 A;  3WGG A;  1R23 A;  1FYM A;  1DPU A;  2ELH A;  1U3E M;  1S29 A;  2DT5 A;  2BV6 A;  2XAG A;  1IN5 A;  5J8C A;  5L3B A;  2LKP A;  4LGW A;  3C18 A;  5L3F A;  3K2Z A;  4RB0 A;  1HW1 A;  3CUQ B;  4PZJ A;  3O3K A;  1K79 A; 
#chains in the Genus database with same CATH topology
 2X4H A;  3D0S A;  3OR1 C;  4L0Z B;  3PUF A;  1DGW Y;  2O3F A;  2JSC A;  4Z6Y A;  3S1R J;  2L9V A;  5IT9 K;  1U8R A;  2ECB A;  4LG0 B;  5FO5 A;  2P5K A;  2V9P A;  2EPF A;  3P9C A;  4RLF A;  3FDY A;  4PCQ A;  4ZYH A;  3ISP A;  4JX6 A;  4I0B A;  4PGH A;  2KHM A;  1R00 A;  4GYI A;  4HNU A;  5D5U B;  2IT0 A;  3RDI A;  4UB8 C;  5L3G A;  3IKV A;  5F0F A;  2JK3 A;  4RMN A;  1GV5 A;  4A69 C;  3KP4 A;  3H92 A;  3EUK L;  2HTJ A;  1WJD A;  3HSR A;  3O8G A;  1B9M A;  3Q9V A;  4JYK A;  3RKW A;  3S8P A;  3JSO A;  3RI4 A;  1JHH A;  1WJB A;  4OAY A;  3WU2 C;  3ZMV A;  2L9R A;  3PNY A;  1GVJ A;  3HYI A;  1XSX A;  2BW3 B;  1ON1 A;  1RET A;  1ZGJ A;  1OCC H;  3DTK A;  4XLH A;  3RSN A;  2DPU A;  1IGN A;  3DU6 A;  5F08 A;  4E6K G;  3CP8 A;  4HF2 A;  4OMZ A;  2L3D A;  4MO7 A;  1VQO I;  2R0Q C;  2K02 A;  1FOY A;  1UCR A;  1BIB A;  3CJN A;  2DQR A;  3H3V K;  1Z3Y A;  1VZ0 A;  2G7H A;  4OIR F;  3ABU A;  4CA0 A;  5ICG A;  1AKH A;  4BS9 A;  2GLO A;  4UUV A;  1IF1 A;  2NOG A;  2XAJ A;  2M45 A;  3HXL A;  1FTT A;  3ZP5 A;  2ZME A;  1LKX A;  5D4S A;  4B44 A;  2X48 A;  3HRS A;  2EQR A;  5FKO A;  2ZJ2 A;  2XAH A;  5FRO A;  1G59 A;  2HDW A;  2YR2 A;  1TQI A;  5F6F A;  2BVL A;  1ZLJ A;  4IEJ A;  4JOM A;  3CC2 I;  2QA4 I;  4XOR A;  2DI3 A;  2KPM A;  2ME6 A;  3BTL A;  2Y48 A;  1R5G A;  4KUM A;  5HDN A;  3ESW B;  2W82 A;  4P9U A;  1FPQ A;  4G7O F;  2HYF A;  2X51 A;  5BPI A;  4Q4Z F;  1YW7 A;  4BBS J;  3BPV A;  2JN6 A;  4M9S A;  3OYE A;  1R22 A;  1IW7 F;  3KLO A;  3W6V A;  2EIJ H;  2R7V A;  3QQA A;  3ZQF A;  4HNV A;  3CD6 I;  3I54 A;  3KLN A;  3GWZ A;  2UWM A;  2K86 A;  3F8B A;  1U9N A;  3SEQ A;  4HRI A;  3G6E I;  1SAU A;  1SD6 A;  4O6J A;  2A07 F;  4KJZ A;  6PAX A;  1WCM J;  3FKJ A;  5KAF C;  1ZQ3 P;  3ZQQ A;  3CF5 F;  2Z3Y A;  2KDO A;  5HOO A;  4HOB A;  4ASN A;  1JKQ C;  4F3Q A;  1KQ0 A;  4PSX A;  2ZB9 A;  1S8N A;  2HWV A;  3E1S A;  2GZW A;  2QEX I;  1FP2 A;  4E7J A;  3WTY C;  4F92 B;  2H27 A;  1WI9 A;  3DPU A;  3Q0U A;  4BXF A;  4EQQ A;  5BMZ A;  1FSH A;  3MKW B;  1ZYR F;  3QPL A;  3E5Q A;  3CJT B;  2WBM A;  1I6X A;  5AIQ A;  5FKM A;  4A12 A;  1R6R A;  2XGC A;  4CDG A;  2LP0 A;  2ZJQ F;  1FIA A;  2XPV A;  1BW5 A;  2B9S A;  2ZSH B;  2BEO A;  1T95 A;  1GLN A;  1Y6I A;  2YSR A;  4KIF A;  2CJJ A;  5K5R A;  2IRF G;  2LLK A;  2EV6 A;  2JUG A;  5DUI A;  1IXR C;  5DUK A;  4AWX B;  2IGO A;  4ENJ A;  2VL8 A;  1XS9 A;  2JUC A;  3LNQ A;  5EJC A;  3QOP A;  4UNO A;  5DD4 A;  4U87 A;  3H5N A;  2XPU A;  2R7S A;  2F5V A;  1RNL A;  1Z67 A;  4MQ9 F;  3QOD A;  3CJR B;  1H9T A;  3DU5 A;  3PQK A;  4B4C A;  4CIC A;  4UXN A;  3BWG A;  5K5O A;  2XC7 A;  3MEX A;  2DU9 A;  1P2F A;  3A01 A;  3LSK A;  1TT0 A;  2CWE A;  4CUG A;  4BAC A;  2NAZ A;  2R92 J;  1EH6 A;  2CUE A;  1MBF A;  2DT6 A;  3H3Z A;  2DFF A;  1HOM A;  4L9N A;  3LQQ A;  3OL4 A;  4IQJ A;  2HFH A;  5E17 F;  4YFX F;  2PQ8 A;  4J00 A;  2OV7 A;  4QSH A;  1VQM I;  2BOL A;  4EAT A;  4EVI A;  1QGP A;  1D8K A;  2Y2Z A;  3QPH A;  2V9K A;  4V2G A;  2R7D A;  2WC2 A;  2JT1 A;  4PJJ A;  2RQQ A;  4G12 A;  1EV7 A;  1A5J A;  1U8B A;  1SAN A;  3GZ5 A;  1KU2 A;  1SMT A;  3P9K A;  1X1A A;  4C2U A;  1I1S A;  3HUG A;  3ASO H;  2E1M B;  2RGV A;  2VON A;  2XPW A;  5L3E A;  2DMN A;  4NBQ A;  1ZKG A;  1QPI A;  2COB A;  2HQA A;  1PYV A;  4E7L A;  5IYB J;  2WB1 N;  1V5E A;  3VWB A;  1Z7U A;  2R3S A;  3K4M A;  2O8K A;  4HA8 A;  2XGX A;  1WZ2 A;  2PX9 A;  1HC8 A;  5LFA A;  5BOX A;  2KRC A;  3MAJ A;  3FHZ A;  5EF6 A;  2PJR A;  3QPT A;  2CQN A;  2E19 A;  3K7A J;  3DEW A;  3SFZ A;  4AIJ A;  2HNH A;  2ZKZ A;  1USS A;  4L9T A;  4GRI A;  2K9N A;  2QZ8 A;  4B48 A;  5TIS C;  4YFN F;  5IOY A;  3E97 A;  1UG2 A;  4IXA A;  3CMY A;  3FX3 A;  3AG2 H;  1BN5 A;  1DU0 A;  3HTU A;  1P7J A;  2OUM A;  1K7A A;  3PNT A;  3OYL A;  4OIQ F;  3V8J A;  2MBF A;  2DYS H;  3L2R A;  1UHW A;  3OIQ A;  3VOD A;  5H20 A;  2HQ5 A;  2RC4 A;  2LBF B;  3ZMT A;  1I5Z A;  2EJR A;  2Q0O A;  5LHI A;  3M8F A;  1IRZ A;  2V1D A;  5FLV A;  2XKP A;  1W7P A;  2ZXJ A;  2VOD A;  1V55 H;  2IGN A;  2PBI A;  1PUF B;  3E5X A;  4DNC A;  2OU2 A;  4I98 B;  3K0L A;  1NTC A;  1LUJ B;  1STZ A;  2CH0 A;  4BL0 B;  1XGN A;  3MMY B;  5CVJ A;  3BCB A;  5CQG A;  1QZY A;  2O03 A;  2M87 A;  2NVQ J;  2VQC A;  3E7L A;  3BR3 A;  3J7A O;  5E79 C;  4TV7 A;  3DTI A;  2R7Q A;  4EMS A;  4DIQ A;  3GW2 A;  1XB4 A;  2A6T A;  4DYQ A;  2E1N A;  1CQT A;  3T0Y A;  2LRE A;  3M8E A;  4HX8 A;  4B3A A;  1N75 A;  2XAU A;  5JR3 A;  4R79 A;  2K9L A;  2CQX A;  4M9X A;  2FXA A;  3HB9 A;  2VN2 A;  3ZGK A;  4CZC A;  2BXY A;  4OOI A;  2Y9Y A;  3LFU A;  2CW7 A;  2EK5 A;  2O7O A;  2DA2 A;  3LA2 A;  2X1E A;  4HST A;  1G8X A;  5EDN A;  1X1D A;  3SEZ A;  3MFK A;  2DOD A;  5GPA A;  3LAP A;  5FGM A;  3RZD J;  2BHZ A;  3SZP A;  2H8W A;  4S05 A;  5GAH J;  3IAS 2;  5CKT A;  1NG6 A;  4A6E A;  3GME A;  1OYW A;  3H0G J;  2CQQ A;  4Y15 A;  4KNY A;  1N77 A;  1OIS A;  4WWC A;  2W48 A;  1IRX A;  1MMN A;  2L9N A;  1B1B A;  2OA4 A;  5LRR A;  2VBX A;  1E3O C;  2MG4 A;  3BTC A;  4FIS A;  2FBK A;  3K6G A;  3KZI C;  4DJA A;  1AOY A;  2GBY A;  3LSM A;  3S1M J;  3I55 I;  1E2X A;  1TWC J;  4XMY A;  2VKD A;  3VSK A;  4RM2 A;  1E17 A;  3MZY A;  4FE4 A;  5HDK A;  1IZ1 A;  2M30 A;  4ESJ A;  1KYZ A;  2YX7 A;  3ZN1 A;  3IUO A;  1ETQ A;  2GOM A;  4H0E A;  1BIA A;  3LSI A;  2R7W A;  5CJ9 A;  3FM3 A;  5AON A;  4DZJ A;  4UUS A;  3TP0 A;  1D1C A;  2B0L A;  1JJ6 C;  5D5W B;  3ERM A;  4U7D A;  2H1K A;  1SMY F;  3OYC A;  5BPD A;  2P8T A;  4RAZ A;  4EM1 A;  2FEZ A;  2FE3 A;  3LST A;  1IN4 A;  3QYF A;  1P4A A;  1ZH5 A;  1LFB A;  2WY8 Q;  2DOA A;  2WV0 A;  5FLM J;  4WCG A;  4RB2 C;  3CCJ I;  4GGG A;  1ACI A;  3BDD A;  3D5R C;  3BZK A;  4MIM A;  1X3Z B;  1GVD A;  1E0E A;  4LB6 B;  2VKE A;  3DBL B;  4NQW A;  4FAS D;  1J7K A;  3ML6 A;  2NNY A;  1P9Q C;  3HPH A;  2EA2 A;  5CLS A;  2O9L A;  3A01 B;  4A3C J;  2RQP A;  4PUS A;  4U88 A;  5DCF A;  2DT7 B;  4ENN A;  2VLA A;  4A3M J;  2NVT J;  4NNJ A;  4OWR B;  4PSW A;  3ZR8 X;  3HOX J;  2OAZ A;  2IPQ X;  3TOB A;  2P7C B;  1FOK A;  2X6Y A;  2ZO4 A;  4D7M A;  2Q8K A;  1XDU A;  1ULY A;  3FXJ A;  4B47 A;  1IO2 A;  1BW6 A;  2CUJ A;  2JA6 J;  2IS4 A;  3DKX A;  3P9I A;  4L5I A;  2STT A;  2PN6 A;  1FZP B;  2M3A A;  4XKC A;  2VIX A;  4UVC A;  5IPA A;  5GAD J;  1MJB A;  2AS5 F;  2RAE A;  2Z99 A;  4KIC A;  2JA7 J;  1ZAO A;  1U9O A;  2MGQ A;  5GAG J;  1Y1V J;  4XN0 A;  1WFX A;  3W2W A;  1SD7 A;  1Z0X A;  3GBG A;  1MBG A;  2EFQ A;  4HQE A;  1K6O A;  4LJZ F;  3LFK A;  2HGC A;  4BJ6 C;  1KU7 A;  5ICC A;  2D45 A;  4FX4 A;  1ETW A;  3M3Y J;  1G2H A;  1MGT A;  3E6M A;  4YIF A;  1VQ4 I;  4BDY A;  1F36 A;  2Q2E B;  4DBR A;  1RPW A;  1RI7 A;  3S32 A;  4XKW A;  1JGG A;  3ZPL A;  2XRL A;  2DDB A;  5B66 C;  1HKT A;  3NAR A;  1MBE A;  2QSF X;  4IHS A;  2R7T A;  1QRY A;  1W1W E;  4LLL A;  2MH2 A;  3JRB A;  1HXD A;  3BR0 A;  3L7W A;  5EGO B;  1G3W A;  3I5U A;  1B6A A;  2IEK A;  1GXQ A;  5HS9 A;  2CQK A;  2J5P A;  2WB1 A;  1G3Y A;  3FK6 A;  5J40 A;  2EWN A;  2DTZ A;  3ZCO A;  4MEY F;  2QWW A;  5D5X B;  2H09 A;  3DXJ F;  1TWH J;  2XGE A;  4EM0 B;  4DOZ A;  2JA5 J;  1ETO A;  1R4N B;  3KYD B;  4BQA A;  3KPH A;  3V7C A;  1LE8 B;  4A3F J;  2M8E A;  5FKN A;  2R5Z B;  1ZK8 A;  3DBH B;  3DPT A;  1T39 A;  4HV6 A;  1Y56 A;  2VJ4 A;  4ZTJ A;  3D5S C;  2JPB A;  2HXI A;  4XOP A;  1HKQ A;  5B3S H;  3F21 A;  4HX4 A;  1D1A A;  4FHT A;  3RJP A;  1WH7 A;  3RKX A;  5DTD A;  3WGI A;  1HDD C;  1IN6 A;  4GDF A;  3FXR A;  5KAI C;  3IRQ A;  2ZC2 A;  4LD5 A;  1EA3 A;  1MMA A;  3IP4 B;  1XTA A;  4ZTF A;  3KEQ A;  4V2F A;  3I56 I;  4LLN A;  1BI2 A;  1A6I A;  1VQ9 I;  1F4K A;  1QBJ A;  2P0W A;  2RN7 A;  1HST A;  2DFE A;  2XKO A;  4EJV A;  2L7K A;  2Q1Z B;  2WV1 A;  1Z05 A;  5GTI C;  4C2M J;  2NXN B;  1K78 B;  1I3A A;  2DFI A;  1V5G A;  4BE0 A;  3G2B A;  4QWQ A;  2NRA C;  3PJR A;  3I58 A;  1E3H A;  4BKX A;  1RRJ A;  5CPR B;  2FML A;  2YPR A;  3JRA A;  3GXO A;  2FU4 A;  3GX4 X;  2EZK A;  3K4L A;  5HOD A;  2QUF A;  1MW7 A;  3ROU A;  3RYR A;  4BJ5 C;  4X0G A;  1PP7 U;  4DYC A;  4XSZ F;  2UXN A;  4JQF A;  1R1V A;  2F5D A;  1OQY A;  4BXU A;  4RGU A;  2HZD A;  1BBY A;  2HR3 A;  4DZP A;  1WQ2 A;  4RDU A;  3H3U A;  2M34 A;  3UR3 C;  2IAI A;  4MQV A;  4CZZ A;  3WTZ A;  3CCQ I;  1FTZ A;  2EH3 A;  3CMA I;  1H9G A;  4RGX A;  5J4Y A;  3ZQL A;  1X3U A;  2KP6 A;  3HIF A;  2R7Z J;  1BC7 C;  3DLA A;  1P92 A;  3WTS C;  3DFG A;  2RNJ A;  3OWT A;  4P96 A;  3WHC A;  4Y4R A;  3AKZ A;  1OCR H;  4GCV A;  1SFE A;  4GYG A;  1JI8 A;  3TMO A;  1KYW A;  1LE8 A;  3CLO A;  3H9Q A;  2XGD A;  2VB6 A;  1GUU A;  2HVR A;  2DXI A;  4M3G A;  4Y3O A;  3IH3 A;  3R4K A;  4M74 A;  4A0Y A;  3A02 A;  5EEG A;  3OS2 A;  2HXO A;  1XGS A;  3P5J A;  4BHB A;  3CUQ A;  1AA7 A;  1FP1 D;  2NNN A;  3HG9 A;  3PUB A;  2KDZ A;  4XOT A;  1QPM A;  1OR7 C;  2JRT A;  2GXA A;  2M9H A;  5K7H A;  1V54 H;  3V8L A;  3VYT B;  2IA2 A;  1K6Y A;  2Z2S B;  1VFC A;  4EJO A;  3GTP J;  3R6S A;  3KP6 A;  3FXK A;  1NH3 A;  4XM3 A;  3VB2 A;  4QPQ A;  4IRI A;  2O61 A;  1UZC A;  1WRJ A;  5FRN A;  1MZB A;  4FET A;  4U7B A;  3NEU A;  1YG2 A;  2DLL A;  3TL4 X;  3MCZ A;  2WAQ N;  3CCV I;  1K61 A;  3RQI A;  5M5W J;  2IS2 A;  3CO6 C;  1U0J A;  1JE8 A;  1POG A;  3ABT A;  3OYH A;  3RZO J;  4L5E A;  4EGY A;  2QKL B;  3I53 A;  3TO6 A;  4EM2 A;  4J19 A;  4O3M A;  3CZ6 A;  2DA3 A;  1ETK A;  2DA4 A;  2LK2 A;  3I4P A;  5ILS A;  4U0V A;  3IWF A;  1ETV A;  2VQL A;  1O3Q A;  1H89 C;  1QU3 A;  1KU3 A;  3U1K A;  4C3J J;  1LNW A;  2FX0 A;  5K7F A;  1C0W A;  3ZQH A;  3MKZ A;  2QBY B;  1X1B A;  3HGG A;  2HOA A;  4I7H A;  3ZXS A;  3HOS A;  3GTL J;  1Z77 A;  2UZK A;  1IV6 A;  2K27 A;  1H88 C;  4AVP A;  1A04 A;  1H0M A;  4HF1 A;  5ED4 A;  2HU9 A;  3CUQ C;  2L54 A;  3HJE A;  4RBO A;  5EG0 B;  4MFE A;  2E60 A;  1MNM C;  1TBX A;  3HRM A;  2L0K A;  3OYI A;  3LOC A;  4BXX J;  1ZRC A;  3KZZ A;  4RLQ A;  5E20 A;  3MVP A;  9ANT A;  3F3X A;  1F43 A;  1HW5 A;  1W5S A;  1IN7 A;  2GXG A;  2BYV E;  2VBY A;  4KN7 X;  3WGH A;  2G0E A;  4A5N A;  2EB7 A;  3K70 C;  2EV0 A;  4YEJ A;  1LEB A;  1QNT A;  3O8H A;  2VOP A;  3HPG A;  4FX0 A;  4D5C A;  1KA8 A;  3OS0 A;  3AG4 H;  1N78 A;  3K10 A;  4XRM A;  4UUS B;  1TT5 B;  3CME I;  4BJT A;  4V19 K;  1W5C C;  2NS8 A;  1N25 A;  3HM5 A;  4UUT A;  2EIN H;  3HEF A;  5GAE J;  3HRT A;  2KIF A;  2WTE A;  1IRG A;  2VT2 A;  5KCM A;  3IKT A;  2L4M A;  2BZT A;  1HQC A;  3GZN B;  1SEU A;  5GTH C;  3FBI B;  1XSD A;  2V26 A;  3MQ0 A;  4QPO A;  2WAQ A;  4LK0 F;  4XNF A;  3WTW C;  5EGO A;  2ACJ A;  2ME0 A;  2DK8 A;  4E7K A;  3PL8 A;  2QQ9 A;  1JUS A;  2E36 A;  4W1U A;  1VQ8 I;  5H6R A;  5F1J A;  3ABM H;  2R5Y B;  3X2Q H;  2FOW A;  2EBI A;  4IHX A;  1WGX A;  4IRG A;  4PDK A;  5BQT A;  1Z9C A;  1X3W B;  3AFH A;  3IAM 2;  3LA7 A;  1MH4 A;  4RAF A;  5B1B H;  5FJ8 J;  5ILU A;  2LR8 A;  1GHC A;  1EF4 A;  4UY8 I;  4FE7 A;  5IP7 J;  5JVG F;  2P81 A;  1RUO A;  2O5R A;  1ONV A;  3JRF A;  2VXD A;  2OBP A;  3OV8 A;  1YW8 A;  3MD2 A;  3N05 A;  4G94 A;  5A2Q K;  1QA6 A;  5EG0 A;  4XL9 A;  1GV2 A;  1J0R A;  3HUG B;  1AHD P;  1L3L A;  2V9V A;  3C7J A;  1J09 A;  5J3L A;  1GT0 C;  4JX4 A;  3GO5 A;  4A3I J;  2P4W A;  2VXZ A;  4XKV A;  2PJP A;  2M7B A;  2EIL H;  3G1L A;  1MDM B;  3AL0 B;  2WAF A;  3IV5 A;  1YS7 A;  1FNN A;  3BTI A;  1R4M B;  1XGO A;  3ZOB A;  2DMU A;  3CCM I;  2KL4 A;  3DKW A;  1ZRF A;  2KIQ A;  4LIV A;  1D0X A;  1PJR A;  2CFO A;  2BY0 A;  1OJL A;  1V4R A;  4U0W A;  1JKP C;  1IDZ A;  2TDX A;  3J7A Y;  2E1C A;  3DQV C;  2FQ4 A;  4XK4 A;  3OSG A;  1BR2 A;  1D3Y A;  3LSG A;  1X19 A;  2VE8 A;  3CES A;  5HLG A;  3V7R A;  1ITY A;  5FLX Z;  3G1M A;  4HDV A;  2MC3 A;  2Z9O A;  2ZJR F;  4G7Z F;  4CHU A;  3GVA A;  2OZ6 A;  2JRM A;  1Q1V A;  1O57 A;  2EV5 A;  2ZNZ A;  3NWT A;  2GXB A;  1BI0 A;  4ZYA A;  3GYH X;  1OYI A;  2MLK A;  3M9A A;  1F5T A;  2ZCW A;  5D8L B;  4BQO A;  2V1U A;  3K4J A;  2GA2 A;  1Y8R B;  4G7H F;  3KIO A;  2G9W A;  3CDH A;  5J47 A;  1OPC A;  2A6E F;  2GQQ A;  4KIB A;  5FFX A;  2P5L C;  4IQ4 A;  3A03 A;  2IS1 A;  2LNB A;  5DEQ A;  3CTA A;  5D6F A;  4KT6 A;  4UB6 C;  3JAM K;  4AVZ A;  2R4G A;  4BEH A;  5HLI A;  3S3M A;  3ZQG A;  1PVE A;  2R7F A;  4C2T A;  5IP9 J;  2UV1 A;  2K3P A;  2P6S A;  1FMW A;  4MLO A;  1YHQ I;  3N97 A;  2X6W A;  1R71 A;  2Z5U A;  4N4N B;  1X1P A;  4RS8 A;  1S3J A;  3K4N A;  5FLX K;  3F6O A;  3A1Y A;  3ZQI A;  3FM5 A;  4Q47 A;  5E3N A;  1SFU A;  2V79 A;  4CCO A;  3JSP A;  1WSU A;  1EKE A;  2H6C A;  2LF8 A;  3I9V 2;  3IHU A;  4MHG A;  1HSJ A;  2FF4 A;  2HYJ A;  1D0Z A;  1O7F A;  4XR6 A;  3RQ4 A;  2UXX A;  5HLT A;  1BI1 A;  3ULQ B;  3QU6 A;  3DV8 A;  1YJW I;  2X85 A;  3T8R A;  1FEX A;  3WG7 H;  2LYC A;  2XF7 A;  1XSV A;  3QRF F;  3OIO A;  4Y33 A;  3AG3 H;  4F91 B;  3FIS A;  5K7Z A;  4A3G J;  1QVT A;  1IAW A;  4P9F A;  3HOW J;  4BE2 A;  3F0C A;  2CSO A;  3CCS I;  2DW4 A;  1Y39 A;  1VQL I;  1T08 B;  1WWX A;  4RM3 A;  2F5F A;  4HAM A;  1PUF A;  2I5U A;  4ZZD A;  3DBR B;  1BC8 C;  5IYC J;  1AKH B;  3C1D A;  5JHU A;  2VPL A;  1X2M A;  3OOU A;  1OYY A;  4H4K C;  2Y30 A;  5B5E C;  2IGM A;  5D8K B;  4LLG F;  2F5C A;  4Y7N J;  4PJL A;  1OCO H;  3M1C A;  5CVV A;  5IOZ A;  4ON0 A;  1O4X A;  1SFX A;  2QM3 A;  4C3I J;  1KU9 A;  2KRF A;  3Q3S A;  3REO A;  2YU3 A;  2O6G E;  3G4S I;  1JJ8 C;  1B72 A;  1Z91 A;  2UUZ A;  3ABK H;  4BQQ A;  1QZZ A;  2M2E A;  1BR1 A;  1TQP A;  4BH9 A;  2HPM A;  2F4M B;  1KQ8 A;  2NVU B;  3F6V A;  2L7Z A;  4M73 A;  5IT3 A;  2XSD C;  4WK8 F;  1V5F A;  3IL2 A;  2COM A;  4RB1 A;  4A3E J;  2ELK A;  2CU7 A;  3FMQ A;  3VYR B;  4N9H A;  1UFM A;  2IA0 A;  3DEU A;  1W7P B;  3F8C A;  4XLC A;  3AAF A;  2JVH A;  3HOT A;  3PO3 J;  4IF4 A;  4OIN F;  3HGY A;  5JVT A;  3QOE A;  3C3W A;  2O8X A;  2X6O A;  4R1H A;  4I6Z A;  3OYF A;  5ICF A;  2Y0S A;  3K2A A;  1IG7 A;  3JCU C;  1JT6 A;  1VF9 A;  1TWG J;  3TKY A;  4KA4 A;  1YJN I;  4BUP A;  1W36 C;  4I02 A;  1MD0 A;  3BP8 A;  3CUO A;  3BG7 A;  4P5O A;  2FBI A;  4I01 A;  3WTU C;  1W36 D;  5J1R A;  5ERI A;  2ZME B;  1ZR4 A;  5J1U A;  2GIV A;  4NUB A;  2WWY A;  3E6D A;  2NOJ B;  1LVK A;  2OTL I;  4OIP F;  1T33 A;  2R5Z A;  5TRD A;  3PFI A;  3F72 A;  3TO9 A;  3LSR A;  1UAA A;  2LC2 A;  2E71 A;  2OD5 A;  2KZG A;  5LRS A;  4BNC A;  1ZG3 A;  1JUP A;  1MJ9 A;  3ELK A;  3WG9 A;  2ZFU A;  4X6A J;  5TGT A;  3MKY B;  2WAD A;  1DP3 A;  3KX2 A;  2ID6 A;  4HX7 A;  1D1B A;  3P7N A;  4RAG A;  1YX5 A;  5A2Q Z;  2DMP A;  2HOS A;  1J5Y A;  1F1Z A;  2KQR A;  3S2W A;  3ZMU A;  4M3E A;  3FXU A;  2Y75 A;  2VKH A;  3LWF A;  3W2V A;  1X4P A;  4F52 A;  1YO5 C;  2XHK A;  2HEO A;  3JRI A;  2LF7 A;  2BE5 F;  4O5V A;  2XAS A;  4LIU A;  3CLQ A;  1TW2 A;  3IC7 A;  1SVO A;  1WJC A;  3CCE I;  4RB3 C;  2IBD A;  1MSF C;  2QQA A;  1Y8Q B;  2ESH A;  4A3D J;  4QTR A;  3OYJ A;  4KYW A;  3QAH A;  5E8G A;  3J81 Z;  1QHG A;  4MFD A;  2R93 J;  2V7F A;  3GTO J;  1S5L C;  2ZFW A;  3KYC B;  1PDN C;  2CW8 A;  2PG4 A;  4HYE A;  3WHB A;  4II2 A;  5DS9 A;  5C4X J;  3BG5 A;  2V6E A;  2K5C A;  4Y13 A;  3DKY A;  3Q0W A;  3EYY A;  1MBH A;  4C30 A;  5CVI A;  1R9T J;  3O2P E;  1T0F C;  3WU1 B;  1R36 A;  2KIS A;  2ZBK A;  1K78 A;  5HLH A;  3JRC A;  1SFK A;  1LVA A;  3MWM A;  3CP2 A;  2EFN A;  1ZEL A;  2QKM B;  1O3S A;  2ID3 A;  4M71 A;  4IPA A;  1ZTR A;  1U5T B;  2K40 A;  1R58 A;  2L7M P;  2L5Q A;  1U78 A;  1YIO A;  3J81 K;  2X6X A;  2LG4 A;  2A05 A;  2XB5 A;  2CUZ A;  2DJI A;  3H5A A;  3I3L A;  3QP6 A;  2ZNY A;  1REP C;  3TDZ C;  3ZN0 A;  4OIO F;  5IP6 A;  3OOP A;  2ISZ A;  3GTJ J;  1MMD A;  1S7E A;  4BYY A;  2EFP A;  2RKH A;  4ITV A;  1YJ9 I;  1YX3 A;  3K70 D;  4KT5 C;  2W4S A;  4XSX F;  1B8I A;  5M5Y J;  3H1C A;  3CDL A;  1OFC X;  2M5W A;  2A3S A;  2MSY A;  1U5T C;  4WXD A;  4XN3 A;  3TP3 A;  1KON A;  3E3V A;  1DQU A;  2I10 A;  1OKR A;  3BOQ A;  2LMD A;  4EJU A;  4BE1 A;  2HOE A;  4EJW A;  5ILV A;  1M1E B;  2ZME C;  3KP2 A;  3FK7 A;  2STW A;  3D5L A;  5LHG A;  1FIP A;  3UNG C;  1YYV A;  3KP5 A;  3LSP A;  3GFL A;  3FWE A;  3EET A;  1NHA A;  5HS8 A;  2RV8 A;  1LJ9 A;  2CFX A;  1XCB A;  1ZRE A;  4L9V A;  3CMM A;  3TO7 A;  1Y1W J;  4ZDO A;  2HYG D;  5E1W A;  1WKM A;  3D1N I;  5ICE A;  2EZL A;  2A6H F;  1YLF A;  1TTY A;  1PUE E;  3JRD A;  4ZDP A;  5FFZ A;  1RR8 C;  2EFO A;  1ZGA A;  4E4H A;  5LBQ A;  2XRN A;  2PI0 A;  4DW6 A;  1W0U A;  3OS1 A;  4ENK A;  1A31 A;  3CO7 C;  1LFU P;  1A36 A;  1B9N A;  1V3F A;  1U5T A;  2OTJ I;  2BXZ A;  4ZDL A;  2KT0 A;  2ZXW H;  1K4T A;  2M7A A;  3BG6 A;  4S0H B;  3GZ6 A;  4I2O A;  2M0C A;  4DYR A;  3WTT C;  3OSF A;  5E8I A;  1HKS A;  4XLE A;  2DK5 A;  1NK2 P;  1I6H J;  4AM3 A;  4EV0 A;  4QIW N;  2E7X A;  3FMR A;  1NG7 A;  3K4C A;  4DBQ A;  4IHT A;  5FRM A;  1OCT C;  3KFW X;  2Z33 A;  1HLV A;  2G7U A;  1VQ5 I;  1OCZ H;  2CS3 A;  1H8A C;  4B43 A;  1J59 A;  3F22 A;  4NC8 A;  1DGR M;  2K9M A;  3SDB A;  5HNH A;  3I4N J;  2X9D A;  4BGD A;  4HDU A;  2OJE D;  3QU3 A;  1VTN C;  2JZY A;  2MH9 A;  2AHQ A;  5HDG A;  3FZV A;  2OCE A;  1ENH A;  2LKS A;  3L2V A;  2W24 A;  2QF7 A;  3K1P A;  1WJA A;  1Y0N A;  2XF6 A;  1RKT A;  4HW0 A;  2DAO A;  2DA5 A;  3M8J A;  2AXT C;  4A93 J;  4N9I A;  5DM6 F;  2YUS A;  2A69 F;  2D5V A;  4XID A;  1W5T A;  5K5Q A;  4EEF G;  3DPL C;  4BY1 J;  4F93 B;  2ETH A;  3R61 A;  4JBA A;  1TZL A;  3HOU J;  4PFO A;  3W6K B;  3F8N A;  2B7E A;  2A61 A;  3VOE A;  4X1E A;  3OY9 A;  2HQN A;  3TDU C;  2KRH A;  1ZR2 A;  1TWF J;  1ORK A;  2KZV A;  3BLY A;  3K4B A;  5F1R A;  3BQY A;  4A0X A;  1I50 J;  1LB2 A;  1TC3 C;  3KET A;  2RVC A;  3C2H A;  1KZH A;  1SD4 A;  3BR2 A;  3L2W A;  2EFW A;  4B09 A;  1W4M A;  1MKM A;  1JT0 A;  4XLF A;  3I71 A;  1WJE A;  2VC1 A;  4YEL A;  2CYY A;  1MBJ A;  4ZYE A;  3JTH A;  5J8F A;  1XN7 A;  2OC6 A;  4XLP F;  2CV1 A;  2P6T A;  4JK1 X;  3LL7 A;  2FRH A;  4M9Z A;  3H5R A;  4RGS A;  3FF5 A;  3GFM A;  2LD5 A;  2K4B A;  2QQ8 A;  3BJA A;  3RIR A;  1JKR C;  2CRG A;  4BU2 A;  3KEY A;  4LIT A;  3A4C A;  4ZH4 F;  3ECO A;  3S93 A;  4E7H A;  2W85 A;  1YW9 A;  2LBF A;  4PJN A;  4IRH A;  5F27 A;  3IRR A;  3HZJ A;  2MYS A;  4KN4 X;  3OL3 A;  4M3B A;  3TQN A;  5M3M J;  1FY7 A;  1WJF A;  4CCN A;  2L02 A;  5F0C A;  4J01 A;  2HDD A;  5TJJ A;  4WX9 A;  2XUB A;  4CO8 A;  2VC0 A;  1IC8 A;  3U2R A;  2HOT A;  3DWL E;  4XKB A;  1Z7L A;  3U1D A;  2PMH A;  3FHN A;  3I64 A;  4BHC A;  1DUX C;  2R5Y A;  5GPC A;  5B1A H;  3HOY J;  4I76 A;  2JA8 J;  3JTG A;  1W7P D;  4IHY A;  1TW3 A;  1JTY A;  4E7I A;  2PJR B;  2HZT A;  2X1D A;  4BEH B;  3COA C;  1HA8 A;  3A0H C;  3J7Y J;  2PFB A;  2DOE A;  5F64 A;  5LEJ A;  4UV9 A;  2E2H J;  1ODD A;  2CUF A;  5EEA A;  3K9T A;  1BA5 A;  1MND A;  1XX5 A;  2IP2 A;  1S7O A;  2LOO A;  4RAY A;  3B73 A;  2DPD A;  3CCL I;  2FUG 2;  1ETX A;  1JXS A;  3LMM A;  1CF7 A;  2F4O B;  1BJA A;  3GF2 A;  3LQR A;  5E3O A;  4A0Z A;  3A2K A;  2JTV A;  2DYR H;  4M3F A;  3R0A A;  5E1Z B;  4ANJ A;  1LQ1 A;  2E1M C;  2N8G A;  1O3T A;  4MEX F;  4LFU A;  1FMV A;  5IY5 H;  3L00 A;  1FX7 A;  5CQE A;  5JI6 A;  1FYL A;  1OLT A;  1R7J A;  1MMG A;  2LSO A;  4HF0 A;  4CYC B;  4AYB N;  4LB5 A;  4G6T B;  1XMK A;  3NWS A;  3SXY A;  4IHW A;  3Q9S A;  4K2E A;  4U0Y A;  4MTD A;  3S1Q J;  2DFH A;  3FKI J;  4PJM A;  4UVA A;  3G3Z A;  4MNU A;  3R0J A;  5KNL A;  3ZMD A;  1LDJ A;  5GP9 A;  2XAF A;  3S16 J;  2FNA A;  4IZZ A;  4AD9 A;  4A3L J;  2EZH A;  5LD2 C;  3M4O J;  4C9Y A;  2KJC A;  2M1B A;  4OAZ A;  1J75 A;  2F48 A;  2BW3 A;  2VBW A;  2H6B A;  3KYL A;  3CDI A;  1QQI A;  3PIO F;  3GLX A;  3HTS B;  2FJ1 A;  1FT9 A;  3HL2 A;  3CCR I;  3VFZ A;  3JAM Z;  1HCR A;  4YFK F;  1UJ8 A;  2A5W A;  3EUH C;  3L09 A;  5BS6 A;  4XBF A;  3GTG J;  5J6X A;  1UST A;  2DTR A;  1BOB A;  4HBL A;  1B8I B;  3RTR A;  3V8K A;  3SDG A;  4CXF A;  5AIP A;  3FXO A;  1SC7 A;  3J7Z I;  3DLL F;  2FNP A;  3K69 A;  4I0A A;  4YII A;  2PEX A;  2V4J C;  4BQN A;  2F2E A;  3NQO A;  1L0O C;  3KCC A;  1XC5 A;  1I39 A;  2VOO A;  3OYA A;  2MA3 A;  4ZYD A;  4WF2 A;  1P7I A;  4DQ2 A;  4L18 B;  2DA1 A;  4PFP A;  2W25 A;  4CSW A;  2A5Y B;  2LKX A;  3I59 B;  1MJA A;  2VAS A;  2ESN A;  3NAU A;  3PSI A;  4BY7 J;  3EUA A;  1B59 A;  2HVS A;  1AWC A;  2LY2 A;  3ZRG A;  5LGU A;  3IWZ A;  4L5J A;  3BJO A;  2QYO A;  4CCK A;  5DM7 F;  4RGR A;  1ZLK A;  3F8F A;  4XRF A;  5HNF A;  3VEP A;  1K83 J;  3EYI A;  2KIU A;  4DGW B;  1XDS A;  1MSE C;  2IXS A;  1FBS A;  2NVY J;  3MZH A;  2PMZ A;  3MZ8 A;  1T56 A;  4PGG A;  1WVR A;  3OYM A;  3J80 K;  1ETY A;  4NB5 A;  1J2X A;  2GAU A;  4XON A;  2JQ7 A;  4GO1 A;  4IO9 F;  5EYR A;  3HKZ A;  1TWA J;  1XG1 A;  2Y69 H;  3VYU B;  3RPU A;  3DEE A;  3HHH A;  3WTV C;  5IT9 Z;  4B3X A;  1IXS B;  1UHS A;  1YTY A;  5LGT A;  3HBL A;  2XB0 X;  2GA1 A;  1JHF A;  2HVQ A;  3DP7 A;  4AUX A;  4CCM A;  3BCA A;  3SZT A;  2KJB A;  3RPU D;  3OYN A;  2KFD A;  3G73 A;  4BDZ A;  1WPK A;  4I99 C;  1O7L A;  3RCO A;  4KFC A;  3SZG A;  2PMZ N;  2V1X A;  4HEA 2;  3S2D J;  3M1E A;  2RNG A;  2EIM H;  3V4G A;  2CMP A;  3EQL F;  2JA2 A;  5K1Y A;  2NYX A;  2LY1 A;  3BPX A;  3TW6 A;  3J80 Z;  1QZE A;  3WU0 A;  1VI0 A;  1SVM A;  2O0Y A;  3ZQ7 A;  4CYD A;  5E18 F;  4FCY A;  3PO2 J;  2E1O A;  3Q5F A;  4XRS G;  2E2I J;  4M6Y A;  2JPC A;  5C4J J;  3JRE A;  5EZG A;  2ELJ A;  3SJM A;  1P4X A;  4AYB A;  3VSL A;  4AC0 A;  4A3K J;  2JWT A;  3L9F A;  2E5N A;  3JRG A;  1FBQ A;  1IDY A;  1YOV B;  1D8J A;  1S6L A;  3BRO A;  2FMY A;  3QYE A;  2GWR A;  3KEO A;  1R5I D;  1QO0 D;  3L1P A;  4W97 A;  2JVG A;  2GIZ A;  2XRO A;  3BC8 A;  4LK1 F;  2VKV A;  5FB2 A;  1G6N A;  4IOA F;  5EEH A;  1TP4 A;  4PK4 A;  2DDA A;  5J1Y A;  4KIS A;  3S2H J;  1YIJ I;  1DDN A;  3QWL A;  1R1U A;  3CCU I;  1S72 I;  1ZRD A;  2C6Y A;  1E3P A;  2KMU A;  1AU7 A;  1BR4 A;  4JP0 A;  1D5Y A;  4NC6 A;  1XGM A;  3VYS B;  3AG1 H;  1HF0 A;  1GDT A;  2X0L A;  2TCT A;  4ETS A;  3GTM J;  1IUY A;  1YI2 I;  5L3D A;  1SAX A;  3OYG A;  4LOC A;  3AL0 C;  5C44 J;  4M72 A;  4UHT A;  2R7O A;  2FA5 A;  2HPI A;  1HW2 A;  3OYB A;  1I1G A;  3BR6 A;  1LEA A;  4FQG A;  2V6C A;  3G71 I;  5FKK A;  4ZC3 A;  1XMX A;  3WOD F;  2F5E A;  5D4R A;  1DU6 A;  2FSW A;  1I3Q J;  3HC7 A;  1YRN B;  2XIG A;  1MBK A;  4F7Z A;  4CYC A;  4EJT A;  3U9G A;  3E6B A;  1A6Q A;  2XVC A;  3BJ6 A;  5M5X J;  1ZGW A;  3SYT A;  2IA1 A;  3RYP A;  3DF8 A;  1FOX A;  2QVO A;  3L2U A;  2M4K A;  3VDX A;  5C3E J;  2R7R A;  3I59 A;  2LDU A;  1JTX A;  2AQE A;  4E70 A;  2F4I A;  3T5X A;  1YFH A;  2R7X A;  2DA6 A;  1S9H A;  2PLY A;  3TBI A;  2E34 A;  3W2A A;  2HS5 A;  2CV0 A;  1T0F A;  1X2N A;  2JSP A;  4CGZ A;  3W6J B;  2CG4 A;  2X1C A;  1TNT A;  2WY7 Q;  3EDP A;  2H8R A;  2QSH X;  2VJJ A;  3BY6 A;  2BVM A;  5DD8 A;  2OPT A;  2W7N A;  3BZ6 A;  1T6S A;  3ZMS A;  3R60 A;  1ZG1 A;  1LDD A;  5F04 A;  1OR7 A;  2HTS A;  3MN2 A;  2NVX J;  1OCP A;  4LG3 A;  4I09 A;  4G6Q A;  1F9N A;  1RZ4 A;  2IS6 A;  2HDC A;  4ZJZ A;  2A68 F;  1X1C A;  2MLG A;  2IJL A;  4ENM A;  1WH5 A;  3CC4 I;  2L7F P;  3I4M J;  4D5F A;  1MNE A;  3BZC A;  1HDP A;  4E7S A;  4KMF A;  1RES A;  5L3C A;  2FQ3 A;  3T8T A;  5J4V A;  4XIC A;  4YRV A;  2HQR A;  1APL C;  3HOZ J;  3H9G A;  3S17 J;  1Z6T A;  2VJI A;  4IJA A;  3Q0V A;  4PJ0 C;  2W1O A;  5H6Q A;  2MW8 A;  3HHG A;  1UHM A;  4ESF A;  1ZN2 A;  2Y31 A;  2Y9Z A;  2VE9 A;  2HKX A;  1B4A A;  2EIK H;  2M4G A;  4Q5S F;  1D5V A;  2DQL A;  2OCC H;  2KKO A;  2CW0 F;  2DCE A;  2QLZ A;  4GXO A;  1RIO H;  1X4O A;  3CCY A;  2CQ7 A;  2NS0 A;  4IVN A;  2LTP A;  2P7V B;  4IX7 A;  3H9J A;  4HLY A;  4MTE A;  1WI3 A;  4ZZL A;  2GOX B;  3E6C C;  1T98 A;  5DCM A;  3S1N J;  3IH2 A;  1BM9 A;  2ICW G;  4HG2 A;  2DMQ A;  2CV2 A;  3HOV J;  4IL6 C;  2GM4 A;  1TL8 A;  4IHV A;  1MMS A;  3WE3 A;  2BHY A;  2OQR A;  3S14 J;  3PIP F;  1MIJ A;  4A5M A;  4FT8 A;  4CH7 A;  4XLA A;  3LSJ A;  3QYB A;  4KMU X;  1WJ5 A;  4BAY A;  4XLN F;  3GTQ J;  1G4D A;  2ZXH A;  3FXQ A;  2I8D A;  3H36 A;  3F8M A;  2L9S A;  2XV4 S;  5JHF A;  3PNV A;  1OMI A;  2K4J A;  4HZF A;  4B1R A;  3FBN B;  2K9S A;  3CQZ J;  5LEK A;  2VUM J;  2L4A A;  3G1O A;  3H35 A;  2VQH A;  2XF5 A;  3BTJ A;  1T8I A;  3LA3 A;  2QCO A;  4ABZ A;  4G9Y A;  2LRD A;  4IOC F;  1R1T A;  1U6G A;  1XD7 A;  2BBY A;  3ABL H;  1J9I A;  3W3C A;  1BOA A;  2JJ7 A;  1IV8 A;  1LFP A;  4HSR A;  3ECH A;  1IUF A;  5LHH A;  2Z16 A;  2E7W A;  3OYD A;  3ASN H;  1FYK A;  1RUN A;  4M6V A;  4D1Q A;  5KK1 A;  4P1W A;  2Q2E A;  5DYM A;  1MH3 A;  3RKY A;  4HLX A;  1A35 A;  3I0T A;  1RKW A;  1KQ9 A;  3BR1 A;  2W84 A;  1CF7 B;  2TRT A;  2QGU A;  4OMY A;  3ONQ A;  5FD5 A;  1TQM A;  1JUM A;  1FWZ A;  4A3B J;  4LG0 A;  2D1H A;  3M07 A;  3HKZ N;  1NK3 P;  2DMT A;  1DP7 P;  4M3D A;  2ZJP F;  1BJZ A;  1VQN I;  3KZY A;  1LDK B;  2LVS A;  4D0P A;  4KIG A;  1T2K A;  3K1N A;  3QPS A;  3GFJ A;  3F9K A;  2E35 A;  3PQJ A;  2VT3 A;  2MD5 A;  3QP5 A;  3JW4 A;  2L2O A;  4M6X A;  3HRU A;  2IW5 A;  3ERE D;  2QBY A;  1YIT I;  3KP3 A;  2ZSI B;  3KP7 A;  5HVQ C;  4S04 A;  2QEN A;  4F55 A;  3LSH A;  5JFR A;  2VPR A;  3RPQ A;  4XQF A;  4G6D A;  1FJL A;  1B72 B;  2XDV A;  5D5V B;  3BR5 A;  3JR9 A;  2PMU A;  2HKO A;  2XAQ A;  1S7A A;  1W0T A;  2DOF A;  4EGZ A;  3EUH A;  5CVU A;  3TOA A;  3UKG A;  3K4K A;  2H1L A;  2LFB A;  1SD5 A;  1IRF A;  1Z3X A;  2FOK A;  4D7N A;  5JLX A;  3DTE A;  5E3L A;  3CJQ B;  1UB9 A;  5HS7 A;  4A2U A;  2YU9 J;  1BI3 A;  3BT9 A;  1I27 A;  4D9J A;  2MD0 A;  5FD6 A;  2P5V A;  3B6A A;  1IN8 A;  2BY2 A;  1Q1H A;  4R8H A;  2F6C A;  3BG9 A;  2VQG A;  1FC3 A;  3GLL A;  3MKL A;  4UVB A;  2DBB A;  3SFI A;  4IKF A;  1IXC A;  1P6R A;  4HV5 A;  3BQZ A;  2CGP A;  2BY1 A;  4KDP A;  3S15 J;  4B8X A;  1X58 A;  1R49 A;  1JGS A;  5IYD J;  2QSG X;  3OR2 C;  3RKQ A;  2NS7 A;  1ZHF A;  1GXP A;  2JMW A;  1XMA A;  1CGP A;  1YS6 A;  3A0B C;  1Z1D A;  4NQW B;  2DO7 A;  4YG2 F;  3TED A;  2OZU A;  5LGN A;  3SQN A;  3C2B A;  2M8G X;  3S3N A;  1G3T A;  3OYK A;  4L9J A;  2B63 J;  3CC7 I;  3VPR A;  1G3S A;  1UEL B;  2MFZ A;  2K7L A;  2FBH A;  1UG0 A;  5CYV A;  1TLH B;  4WXC A;  4RA2 A;  3LAJ A;  4FTH A;  3GEZ A;  4Y17 A;  4AIK A;  4AID A;  2ADU A;  2E5Z A;  3PSF A;  2WA0 A;  3B6C A;  3ZMZ A;  4ESB A;  4XRS A;  2OF7 A;  2CO5 A;  1PP8 F;  1T38 A;  5E1X A;  2Y0M A;  2YX4 A;  5KVR A;  3K1M A;  1QHH D;  2EZI A;  3U21 A;  2DA7 A;  1FLI A;  3HDD A;  1XCV A;  4NHJ A;  2HI3 A;  3T1B A;  3S3O A;  1FBU A;  2W00 A;  1YE9 A;  1Y0U A;  2OQG A;  2V1N A;  3EPZ A;  4JX5 A;  3TW7 A;  4CCJ A;  1XPX A;  2DJN A;  4QLC U;  3V42 A;  1YRN A;  3M7G A;  4HQM A;  2R7U A;  3HSF A;  2J5O A;  3F23 A;  1FSE A;  2AQF A;  2IGK A;  2W57 A;  1P4W A;  1UMQ A;  1MDM A;  4MGR A;  1SFO J;  3SHF A;  2M0M A;  2D1V A;  3FMS A;  3HSE A;  2AO9 A;  1D0Y A;  1O3R A;  2ISY A;  2AXL A;  2Y0S N;  2QQB A;  4E7Z A;  1RC9 A;  4N0B A;  4A6D A;  4WXH A;  1ERD A;  4II3 A;  1EH7 A;  4AIH A;  5D6E A;  3OMY A;  1QVU A;  3C2G A;  3OIP A;  4YIR X;  3O6B B;  2LH9 A;  3FXL A;  5JLW A;  2FD5 A;  3H0D A;  5E3M A;  1FOW A;  3DCF A;  1K4S A;  3E0J B;  1IJW C;  4CCL A;  1HBX G;  3FXM A;  1BL0 A;  1LPQ A;  4GFB A;  3B02 A;  1YQA A;  1TNS A;  3GUD A;  4P55 A;  4AU7 A;  3GFI A;  1EH8 A;  4NC7 A;  4ZYG A;  1KGS A;  3NRV A;  1SVL A;  3ZQC A;  3PM1 A;  4Z2Y A;  3IH4 A;  3TGN A;  4L0Y B;  3GTK J;  4OU0 A;  2ZXI A;  1Z21 A;  5BNG A;  5DV5 A;  4N4O B;  2RRE A;  3N4M A;  1WHU A;  3BG3 A;  4LMY A;  1R5H A;  5LLQ A;  3L2Q A;  1EJ9 A;  2LY9 A;  2H94 A;  4G8X A;  3CF2 A;  2MAB A;  5FKL A;  4C3H J;  3L2C A;  1VQ6 I;  4HNT A;  3E5U A;  1RR7 A;  1U2W A;  1VQ7 I;  1VND A;  2EA4 A;  5F0H A;  2WAE A;  2RDP A;  2VBZ A;  2K9Q A;  5DCM B;  2D2W A;  2IVM A;  4Y52 J;  3WTX C;  5DDG A;  1ON2 A;  4KIT B;  1ZAR A;  3WE2 A;  5CVR A;  2VI6 A;  4BBR J;  2DN0 A;  1ZG5 A;  2BGC A;  3KE2 A;  1Z6R A;  2ECC A;  2YS9 A;  2KIM A;  3GCM A;  2L01 A;  4Q48 A;  1DPR A;  2VJ5 A;  5EZH A;  3V7S A;  4BHP A;  4UV8 A;  3WGG A;  5M3F J;  2E2J J;  1R23 A;  2XSJ C;  1FYM A;  2KLO A;  1JKO C;  1DPU A;  2BY3 A;  5KHD A;  2ELH A;  1U3E M;  4NDL A;  1S29 A;  2DT5 A;  2MC4 A;  2BV6 A;  4HPQ A;  5H2F C;  2XAG A;  1IN5 A;  5J8C A;  3FIW A;  5L3B A;  2LKP A;  1VQP I;  4LGW A;  3C18 A;  3PFY A;  5L3F A;  3K2Z A;  4RB0 A;  4A3J J;  2K3F A;  2K85 A;  3JRH A;  1HW1 A;  2Z1D A;  3CUQ B;  4PZJ A;  3O3K A;  1K79 A;  1VQK I; 
#chains in the Genus database with same CATH homology
 2X4H A;  3D0S A;  4L0Z B;  2O3F A;  2JSC A;  5IT9 K;  1U8R A;  4LG0 B;  5FO5 A;  2P5K A;  3P9C A;  4PCQ A;  4ZYH A;  3ISP A;  4PGH A;  4I0B A;  1R00 A;  4GYI A;  5D5U B;  2IT0 A;  3RDI A;  5L3G A;  3IKV A;  3KP4 A;  3H92 A;  2HTJ A;  3HSR A;  3JSO A;  1B9M A;  3Q9V A;  3RKW A;  3RI4 A;  1JHH A;  3ZMV A;  1GVJ A;  3HYI A;  1XSX A;  1ON1 A;  1ZGJ A;  2DPU A;  4HF2 A;  4OMZ A;  2L3D A;  2K02 A;  1UCR A;  1BIB A;  3CJN A;  2DQR A;  2G7H A;  4OIR F;  3ABU A;  5ICG A;  4UUV A;  1IF1 A;  2XAJ A;  2M45 A;  3ZP5 A;  2ZME A;  5D4S A;  3HRS A;  2ZJ2 A;  2XAH A;  2YR2 A;  5F6F A;  1TQI A;  1ZLJ A;  2DI3 A;  2Y48 A;  1R5G A;  4KUM A;  5HDN A;  4P9U A;  1FPQ A;  4G7O F;  2HYF A;  5BPI A;  4Q4Z F;  1YW7 A;  3BPV A;  4M9S A;  1R22 A;  1IW7 F;  3KLO A;  3I54 A;  3KLN A;  3GWZ A;  2UWM A;  2K86 A;  3F8B A;  1SD6 A;  4O6J A;  2A07 F;  6PAX A;  2Z3Y A;  5HOO A;  4HOB A;  4ASN A;  1KQ0 A;  1S8N A;  2HWV A;  2GZW A;  1FP2 A;  3WTY C;  2H27 A;  1WI9 A;  4EQQ A;  1FSH A;  5BMZ A;  1ZYR F;  3E5Q A;  1I6X A;  5AIQ A;  4A12 A;  4CDG A;  2BEO A;  2YSR A;  4KIF A;  5K5R A;  2IRF G;  2EV6 A;  5DUI A;  1IXR C;  5DUK A;  4AWX B;  4ENJ A;  3QOP A;  4UNO A;  5DD4 A;  1RNL A;  4MQ9 F;  1H9T A;  3PQK A;  4CIC A;  4UXN A;  3BWG A;  5K5O A;  3MEX A;  2DU9 A;  1P2F A;  2CWE A;  2NAZ A;  1EH6 A;  3H3Z A;  4L9N A;  3LQQ A;  2HFH A;  5E17 F;  4YFX F;  2PQ8 A;  4EVI A;  1QGP A;  1D8K A;  3QPH A;  2R7D A;  2WC2 A;  2JT1 A;  1EV7 A;  3GZ5 A;  1KU2 A;  1SMT A;  3P9K A;  1I1S A;  3HUG A;  2RGV A;  2VON A;  5L3E A;  1Z7U A;  2R3S A;  4HA8 A;  2XGX A;  5BOX A;  3MAJ A;  3FHZ A;  3QPT A;  3SFZ A;  4AIJ A;  2ZKZ A;  1USS A;  4L9T A;  2QZ8 A;  4YFN F;  3E97 A;  4IXA A;  3FX3 A;  1BN5 A;  3HTU A;  1K7A A;  4OIQ F;  3V8J A;  2MBF A;  1UHW A;  3VOD A;  5H20 A;  2RC4 A;  3ZMT A;  1I5Z A;  2EJR A;  2Q0O A;  5LHI A;  3M8F A;  2V1D A;  2XKP A;  1W7P A;  2ZXJ A;  2VOD A;  2PBI A;  3E5X A;  4DNC A;  2OU2 A;  4I98 B;  3K0L A;  1STZ A;  1XGN A;  5CVJ A;  1QZY A;  2O03 A;  2M87 A;  3J7A O;  4TV7 A;  4EMS A;  3GW2 A;  1XB4 A;  2E1N A;  3T0Y A;  3M8E A;  4HX8 A;  5JR3 A;  4R79 A;  4M9X A;  2FXA A;  2VN2 A;  4OOI A;  2EK5 A;  3LA2 A;  3MFK A;  3LAP A;  5FGM A;  3SZP A;  4S05 A;  4A6E A;  1OYW A;  4KNY A;  4Y15 A;  4WWC A;  1B1B A;  2OA4 A;  5LRR A;  2VBX A;  2FBK A;  1AOY A;  1E2X A;  1E17 A;  3MZY A;  5HDK A;  1IZ1 A;  2M30 A;  4ESJ A;  1KYZ A;  2YX7 A;  3ZN1 A;  4H0E A;  1BIA A;  5CJ9 A;  3FM3 A;  5AON A;  2B0L A;  5D5W B;  4U7D A;  1SMY F;  5BPD A;  2P8T A;  4RAZ A;  4EM1 A;  2FEZ A;  2FE3 A;  3LST A;  1IN4 A;  1P4A A;  1ZH5 A;  2WV0 A;  4WCG A;  4RB2 C;  4GGG A;  3BDD A;  4LB6 B;  4NQW A;  2NNY A;  1J7K A;  3ML6 A;  2EA2 A;  5CLS A;  2RQP A;  4U88 A;  5DCF A;  4ENN A;  2OAZ A;  2IPQ X;  3TOB A;  2P7C B;  1FOK A;  2ZO4 A;  2Q8K A;  1XDU A;  1ULY A;  3P9I A;  4L5I A;  2STT A;  2PN6 A;  1FZP B;  4UVC A;  1MJB A;  2AS5 F;  4KIC A;  2Z99 A;  1ZAO A;  1SD7 A;  1K6O A;  2EFQ A;  4HQE A;  4LJZ F;  3LFK A;  2HGC A;  1KU7 A;  5ICC A;  2D45 A;  4FX4 A;  1MGT A;  3E6M A;  4YIF A;  1RI7 A;  3ZPL A;  1HKT A;  4IHS A;  4LLL A;  2MH2 A;  1HXD A;  3L7W A;  1G3W A;  3I5U A;  1B6A A;  1GXQ A;  5HS9 A;  2CQK A;  2J5P A;  1G3Y A;  2EWN A;  4MEY F;  2QWW A;  5D5X B;  2H09 A;  3DXJ F;  4EM0 B;  4BQA A;  3V7C A;  2M8E A;  3DPT A;  1T39 A;  4HV6 A;  2JPB A;  1HKQ A;  3F21 A;  4HX4 A;  3WGI A;  4FHT A;  3RJP A;  3RKX A;  1IN6 A;  3FXR A;  3IRQ A;  4LD5 A;  3KEQ A;  4LLN A;  1BI2 A;  1F4K A;  1QBJ A;  2RN7 A;  1HST A;  2XKO A;  4EJV A;  1K78 B;  1Z05 A;  2DFI A;  4QWQ A;  2NRA C;  3I58 A;  2FML A;  2YPR A;  3GXO A;  2FU4 A;  3GX4 X;  2QUF A;  3RYR A;  3ROU A;  1PP7 U;  4XSZ F;  2UXN A;  4JQF A;  1R1V A;  2F5D A;  4BXU A;  4RGU A;  1BBY A;  2HR3 A;  1WQ2 A;  3H3U A;  4MQV A;  4CZZ A;  3WTZ A;  1H9G A;  4RGX A;  1X3U A;  3HIF A;  1BC7 C;  1P92 A;  3WTS C;  3DFG A;  2RNJ A;  4P96 A;  4GCV A;  1SFE A;  4GYG A;  1KYW A;  3CLO A;  3R4K A;  4M74 A;  4A0Y A;  5EEG A;  1XGS A;  4BHB A;  3CUQ A;  1FP1 D;  2NNN A;  1QPM A;  2JRT A;  3V8L A;  2IA2 A;  4EJO A;  3R6S A;  3KP6 A;  3VB2 A;  4IRI A;  2O61 A;  1WRJ A;  1MZB A;  4U7B A;  3NEU A;  1YG2 A;  2DLL A;  3MCZ A;  3CO6 C;  1JE8 A;  3ABT A;  4EGY A;  3I53 A;  3TO6 A;  4EM2 A;  4O3M A;  3I4P A;  5ILS A;  4U0V A;  3IWF A;  1O3Q A;  1KU3 A;  1C0W A;  1LNW A;  2QBY B;  4I7H A;  3HOS A;  2UZK A;  2K27 A;  4AVP A;  1A04 A;  1H0M A;  4HF1 A;  5ED4 A;  3CUQ C;  2L54 A;  1TBX A;  3HRM A;  1ZRC A;  3KZZ A;  5E20 A;  3F3X A;  1HW5 A;  1W5S A;  1IN7 A;  2GXG A;  3WGH A;  2BYV E;  2VBY A;  4KN7 X;  4A5N A;  2EB7 A;  2EV0 A;  1LEB A;  1QNT A;  2VOP A;  4FX0 A;  1KA8 A;  3HRT A;  2KIF A;  2WTE A;  1IRG A;  2VT2 A;  3IKT A;  2L4M A;  1HQC A;  1XSD A;  3MQ0 A;  4LK0 F;  3WTW C;  2ACJ A;  2DK8 A;  2QQ9 A;  5H6R A;  4IRG A;  4PDK A;  5BQT A;  1Z9C A;  3LA7 A;  5ILU A;  1GHC A;  1RUO A;  1ONV A;  2OBP A;  3OV8 A;  1YW8 A;  4G94 A;  5A2Q K;  1J0R A;  1L3L A;  2V9V A;  3C7J A;  3GO5 A;  2P4W A;  2VXZ A;  2PJP A;  1MDM B;  1YS7 A;  1FNN A;  1XGO A;  3DKW A;  1ZRF A;  4U0W A;  1V4R A;  2TDX A;  2E1C A;  3DQV C;  1D3Y A;  2VE8 A;  5HLG A;  3V7R A;  5FLX Z;  4HDV A;  2MC3 A;  2Z9O A;  4G7Z F;  4CHU A;  3GVA A;  2OZ6 A;  1O57 A;  2EV5 A;  2ZNZ A;  2GXB A;  1BI0 A;  3GYH X;  1F5T A;  1OYI A;  2MLK A;  3M9A A;  2ZCW A;  5D8L B;  2V1U A;  2GA2 A;  4G7H F;  2G9W A;  3CDH A;  1OPC A;  2A6E F;  2GQQ A;  4KIB A;  5FFX A;  2P5L C;  2LNB A;  5DEQ A;  3CTA A;  5D6F A;  3JAM K;  5HLI A;  2R7F A;  2P6S A;  3N97 A;  2Z5U A;  4RS8 A;  1S3J A;  5FLX K;  3F6O A;  3FM5 A;  4Q47 A;  1SFU A;  2V79 A;  1WSU A;  3JSP A;  2H6C A;  2LF8 A;  3IHU A;  4MHG A;  1HSJ A;  2FF4 A;  1O7F A;  2UXX A;  1BI1 A;  3ULQ B;  3QU6 A;  3DV8 A;  3T8R A;  1XSV A;  3QRF F;  1IAW A;  4P9F A;  2CSO A;  2DW4 A;  1WWX A;  2F5F A;  4HAM A;  4ZZD A;  1BC8 C;  3C1D A;  5JHU A;  1OYY A;  5D8K B;  4LLG F;  2F5C A;  5CVV A;  4ON0 A;  1SFX A;  2QM3 A;  1KU9 A;  2KRF A;  3REO A;  2YU3 A;  2O6G E;  1Z91 A;  1QZZ A;  1TQP A;  4BH9 A;  1KQ8 A;  3F6V A;  4M73 A;  5IT3 A;  4WK8 F;  3IL2 A;  2COM A;  4RB1 A;  3FMQ A;  4N9H A;  1UFM A;  2IA0 A;  1W7P B;  3DEU A;  3F8C A;  3HOT A;  3AAF A;  4IF4 A;  4OIN F;  5JVT A;  3C3W A;  2O8X A;  4R1H A;  5ICF A;  4KA4 A;  3TKY A;  4I02 A;  1MD0 A;  3BP8 A;  3CUO A;  4P5O A;  2FBI A;  4I01 A;  3WTU C;  5ERI A;  2ZME B;  2GIV A;  2WWY A;  3E6D A;  4OIP F;  5TRD A;  3PFI A;  3F72 A;  3TO9 A;  2OD5 A;  5LRS A;  4BNC A;  1ZG3 A;  1MJ9 A;  3ELK A;  3WG9 A;  4HX7 A;  3P7N A;  5A2Q Z;  1J5Y A;  1F1Z A;  3S2W A;  3ZMU A;  3FXU A;  2Y75 A;  3LWF A;  1YO5 C;  2XHK A;  2HEO A;  2LF7 A;  2BE5 F;  4O5V A;  2XAS A;  1TW2 A;  3IC7 A;  4RB3 C;  2QQA A;  2ESH A;  4KYW A;  3QAH A;  5E8G A;  3J81 Z;  2ZFW A;  1PDN C;  2PG4 A;  4HYE A;  4Y13 A;  3EYY A;  5CVI A;  3O2P E;  3WU1 B;  1R36 A;  2ZBK A;  1K78 A;  5HLH A;  1LVA A;  3MWM A;  2EFN A;  1O3S A;  4M71 A;  4IPA A;  1U5T B;  1R58 A;  1U78 A;  1YIO A;  3J81 K;  3QP6 A;  2ZNY A;  1REP C;  3TDZ C;  3ZN0 A;  4OIO F;  3OOP A;  2ISZ A;  4BYY A;  2EFP A;  2RKH A;  4KT5 C;  4XSX F;  2M5W A;  2A3S A;  1U5T C;  4WXD A;  3E3V A;  1OKR A;  3BOQ A;  4EJU A;  2HOE A;  4EJW A;  5ILV A;  3KP2 A;  2STW A;  3D5L A;  5LHG A;  1YYV A;  3KP5 A;  3GFL A;  3FWE A;  3EET A;  1NHA A;  5HS8 A;  2RV8 A;  1LJ9 A;  2CFX A;  1XCB A;  1ZRE A;  4L9V A;  3TO7 A;  2HYG D;  5E1W A;  1WKM A;  5ICE A;  2A6H F;  1YLF A;  1TTY A;  1PUE E;  5FFZ A;  2EFO A;  1ZGA A;  5LBQ A;  2XRN A;  2PI0 A;  4ENK A;  3CO7 C;  1B9N A;  1V3F A;  1U5T A;  3GZ6 A;  4I2O A;  3WTT C;  5E8I A;  1HKS A;  2DK5 A;  4EV0 A;  2E7X A;  3FMR A;  4IHT A;  3KFW X;  2Z33 A;  2G7U A;  1J59 A;  3F22 A;  4HDU A;  3QU3 A;  1VTN C;  2JZY A;  2MH9 A;  5HDG A;  3FZV A;  2W24 A;  3K1P A;  4HW0 A;  2DAO A;  4N9I A;  2A69 F;  1W5T A;  5K5Q A;  3DPL C;  2ETH A;  3R61 A;  4JBA A;  3W6K B;  3F8N A;  2A61 A;  3VOE A;  2HQN A;  3TDU C;  5F1R A;  4A0X A;  1LB2 A;  3KET A;  2RVC A;  1SD4 A;  2EFW A;  4B09 A;  1W4M A;  1MKM A;  3I71 A;  2VC1 A;  2CYY A;  4ZYE A;  3JTH A;  5J8F A;  1XN7 A;  4XLP F;  2P6T A;  4JK1 X;  2FRH A;  4M9Z A;  4RGS A;  3FF5 A;  3GFM A;  2K4B A;  3BJA A;  3RIR A;  4ZH4 F;  3ECO A;  2W85 A;  1YW9 A;  4IRH A;  3IRR A;  4KN4 X;  3TQN A;  1FY7 A;  2L02 A;  5TJJ A;  4WX9 A;  2XUB A;  4CO8 A;  2VC0 A;  3U2R A;  3U1D A;  2PMH A;  3I64 A;  4BHC A;  1DUX C;  3JTG A;  1W7P D;  1TW3 A;  2HZT A;  3COA C;  2PFB A;  5F64 A;  5LEJ A;  4UV9 A;  1ODD A;  3K9T A;  2IP2 A;  1S7O A;  4RAY A;  3B73 A;  2DPD A;  1JXS A;  1CF7 A;  1BJA A;  3GF2 A;  3LQR A;  4A0Z A;  2JTV A;  3R0A A;  5E1Z B;  1LQ1 A;  1O3T A;  4MEX F;  4LFU A;  3L00 A;  1FX7 A;  5JI6 A;  1FYL A;  1R7J A;  2LSO A;  4HF0 A;  4LB5 A;  1XMK A;  3SXY A;  3Q9S A;  4K2E A;  4U0Y A;  4MTD A;  4UVA A;  3G3Z A;  4MNU A;  3R0J A;  3ZMD A;  1LDJ A;  2XAF A;  2FNA A;  4AD9 A;  2KJC A;  2M1B A;  1J75 A;  2VBW A;  2H6B A;  1QQI A;  3GLX A;  3HTS B;  1FT9 A;  3VFZ A;  3JAM Z;  4YFK F;  3L09 A;  5BS6 A;  4XBF A;  5J6X A;  1UST A;  2DTR A;  4HBL A;  3RTR A;  3V8K A;  4CXF A;  5AIP A;  2FNP A;  3K69 A;  4I0A A;  4YII A;  2PEX A;  2F2E A;  3NQO A;  1L0O C;  3KCC A;  2VOO A;  2MA3 A;  4ZYD A;  4WF2 A;  4DQ2 A;  4L18 B;  2W25 A;  2A5Y B;  3I59 B;  1MJA A;  2ESN A;  1B59 A;  1AWC A;  5LGU A;  3IWZ A;  4L5J A;  3BJO A;  2QYO A;  4RGR A;  1ZLK A;  3F8F A;  4XRF A;  3VEP A;  3EYI A;  2KIU A;  1XDS A;  1FBS A;  3MZH A;  4PGG A;  3J80 K;  4NB5 A;  2GAU A;  1J2X A;  4GO1 A;  3RPU A;  3HHH A;  3WTV C;  5IT9 Z;  1IXS B;  1YTY A;  5LGT A;  2GA1 A;  1JHF A;  3DP7 A;  3SZT A;  2KJB A;  3G73 A;  1O7L A;  4KFC A;  2V1X A;  3M1E A;  3V4G A;  3EQL F;  5K1Y A;  2NYX A;  3BPX A;  3J80 Z;  3ZQ7 A;  3WU0 A;  4CYD A;  2O0Y A;  5E18 F;  3Q5F A;  4M6Y A;  2JPC A;  1P4X A;  3L9F A;  1FBQ A;  1D8J A;  1S6L A;  3BRO A;  2FMY A;  2GWR A;  3KEO A;  1QO0 D;  2XRO A;  4LK1 F;  5FB2 A;  1G6N A;  5EEH A;  1DDN A;  1R1U A;  1ZRD A;  2C6Y A;  1XGM A;  2X0L A;  4ETS A;  1IUY A;  5L3D A;  1SAX A;  4M72 A;  4UHT A;  2FA5 A;  1HW2 A;  1I1G A;  1LEA A;  2V6C A;  3WOD F;  2F5E A;  5D4R A;  2FSW A;  2XIG A;  4F7Z A;  4EJT A;  3U9G A;  2XVC A;  3E6B A;  3BJ6 A;  2IA1 A;  3RYP A;  3DF8 A;  2QVO A;  3I59 A;  2LDU A;  4E70 A;  3T5X A;  1YFH A;  2PLY A;  2HS5 A;  1T0F A;  4CGZ A;  3W6J B;  2CG4 A;  1TNT A;  3EDP A;  3BY6 A;  5DD8 A;  3BZ6 A;  1T6S A;  3ZMS A;  3R60 A;  1ZG1 A;  1LDD A;  1OR7 A;  2HTS A;  4I09 A;  4G6Q A;  1F9N A;  1RZ4 A;  2HDC A;  2A68 F;  2MLG A;  2IJL A;  4ENM A;  4KMF A;  5L3C A;  2FQ3 A;  3T8T A;  2HQR A;  1Z6T A;  4IJA A;  5H6Q A;  3HHG A;  1UHM A;  4ESF A;  1ZN2 A;  2VE9 A;  2HKX A;  1B4A A;  4Q5S F;  1D5V A;  2DQL A;  2KKO A;  2CW0 F;  2QLZ A;  4GXO A;  1RIO H;  2NS0 A;  4IVN A;  2P7V B;  4HLY A;  4MTE A;  4ZZL A;  3E6C C;  1T98 A;  5DCM A;  1BM9 A;  3WE3 A;  2OQR A;  4A5M A;  4FT8 A;  4BAY A;  4KMU X;  4XLN F;  1G4D A;  3FXQ A;  3F8M A;  2XV4 S;  4HZF A;  1OMI A;  2K4J A;  5LEK A;  2L4A A;  3LA3 A;  4G9Y A;  1R1T A;  1U6G A;  1XD7 A;  2BBY A;  1J9I A;  1BOA A;  3ECH A;  5LHH A;  2E7W A;  1FYK A;  1RUN A;  5KK1 A;  2Q2E A;  5DYM A;  3RKY A;  4HLX A;  3I0T A;  1KQ9 A;  2W84 A;  1CF7 B;  4OMY A;  5FD5 A;  1TQM A;  1FWZ A;  4LG0 A;  2D1H A;  1DP7 P;  3KZY A;  1LDK B;  4D0P A;  4KIG A;  1T2K A;  3K1N A;  3GFJ A;  3PQJ A;  2VT3 A;  2MD5 A;  3QP5 A;  3JW4 A;  4M6X A;  3HRU A;  2IW5 A;  3ERE D;  2QBY A;  3KP3 A;  3KP7 A;  5HVQ C;  4S04 A;  2QEN A;  5JFR A;  3RPQ A;  4G6D A;  5D5V B;  2PMU A;  2HKO A;  2XAQ A;  1S7A A;  4EGZ A;  3EUH A;  5CVU A;  3TOA A;  1SD5 A;  1IRF A;  2FOK A;  1UB9 A;  5HS7 A;  4A2U A;  1BI3 A;  1I27 A;  5FD6 A;  2P5V A;  1IN8 A;  4R8H A;  1Q1H A;  1FC3 A;  4UVB A;  2DBB A;  1IXC A;  1P6R A;  4HV5 A;  2CGP A;  4KDP A;  4B8X A;  1JGS A;  1ZHF A;  1GXP A;  1XMA A;  1CGP A;  1YS6 A;  1Z1D A;  2DO7 A;  4YG2 F;  2OZU A;  5LGN A;  3SQN A;  1G3T A;  4L9J A;  1G3S A;  2FBH A;  2K7L A;  5CYV A;  1TLH B;  4WXC A;  3LAJ A;  3GEZ A;  4Y17 A;  4AIK A;  2ADU A;  3ZMZ A;  4ESB A;  2CO5 A;  1PP8 F;  1T38 A;  5E1X A;  2Y0M A;  2YX4 A;  5KVR A;  3K1M A;  1FLI A;  1XCV A;  4NHJ A;  3T1B A;  1FBU A;  1Y0U A;  2OQG A;  4QLC U;  3M7G A;  4HQM A;  3HSF A;  2J5O A;  3F23 A;  1FSE A;  2W57 A;  1P4W A;  1MDM A;  4MGR A;  3SHF A;  2D1V A;  3FMS A;  3HSE A;  1O3R A;  2ISY A;  2AXL A;  2QQB A;  4N0B A;  4A6D A;  4WXH A;  1EH7 A;  4AIH A;  5D6E A;  3O6B B;  1HBX G;  3B02 A;  1YQA A;  3GFI A;  1TNS A;  3GUD A;  4P55 A;  1EH8 A;  4ZYG A;  1KGS A;  3NRV A;  4Z2Y A;  3TGN A;  4L0Y B;  4OU0 A;  5DV5 A;  3N4M A;  4LMY A;  5LLQ A;  1R5H A;  2H94 A;  4G8X A;  3L2C A;  3E5U A;  1U2W A;  2EA4 A;  2RDP A;  2VBZ A;  5DCM B;  2D2W A;  2IVM A;  3WTX C;  5DDG A;  1ON2 A;  1ZAR A;  3WE2 A;  5CVR A;  1ZG5 A;  2BGC A;  3KE2 A;  1Z6R A;  2KIM A;  3V7S A;  2L01 A;  4Q48 A;  1DPR A;  4BHP A;  4UV8 A;  3WGG A;  1R23 A;  1FYM A;  1DPU A;  2ELH A;  1U3E M;  1S29 A;  2DT5 A;  2BV6 A;  2XAG A;  1IN5 A;  5J8C A;  5L3B A;  2LKP A;  4LGW A;  3C18 A;  5L3F A;  3K2Z A;  4RB0 A;  1HW1 A;  3CUQ B;  4PZJ A;  3O3K A;  1K79 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...