3L9FA

The crystal structure of smu.1604c from streptococcus mutans ua159
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
b'MQGKDIILGILSKKERSGYEINDILQNQLSYFYDGTYGMIYPTLRKLEKDGKITKEVVIQDGRPNKNIYAITESGKKELASYLQSDVNDEIFKSDFLMRLFFGNSLNDDDLEQLIREEIERKEEKIKRLSENLEIWKKKGELTPTQEITIKYGLAQYKSTKKVLEEELAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein smu.1604c
publication title The Crystal Structure of smu.1604c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
total genus 59
structure length 170
sequence length 170
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
A PF10400 Vir_act_alpha_C Virulence activator alpha C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l9fA01
3GFIA 2CSOA 4KIGA 1HW1A 2JT1A 1ZRFA 5HLHA 2FU4A 2Z5UA 2EFNA 2L3DA 4BHPA 4GGGA 4A5NA 4LG0B 3R0AA 2F5FA 2IP2A 2H6BA 2NS0A 4HAMA 1O7LA 4RB0A 3J80Z 1X3UA 2ZKZA 4I02A 1MD0A 3W6JB 2EB7A 4Z2YA 3HTUA 4DNCA 3QP5A 4XRFA 2G7UA 3GWZA 6PAXA 3CLOA 5DUIA 1TQPA 4AD9A 3P7NA 1MJBA 3F23A 4BQAA 2VT3A 4U0WA 1KA8A 2DLLA 4L9JA 5DDGA 3HOSA 5ICCA 2ZNZA 1YS7A 1F4KA 3I53A 5BPIA 4MQ9F 2HTSA 1FBSA 1KYZA 5AIPA 3M8FA 3T1BA 3E3VA 4I0BA 2XAQA 2QBYA 3T8RA 1R5HA 3EUHA 4HDUA 1OYYA 4XSXF 3LQRA 2YX4A 1XGSA 2QZ8A 5D5VB 2LSOA 3Q5FA 1TW3A 1ZH5A 1HW5A 1P4AA 5HVQC 5DD8A 2GA2A 1DPRA 1L3LA 2HKOA 1LNWA 2DT5A 1TNSA 4R79A 3KLNA 2X4HA 2O3FA 2FEZA 4LJZF 4B8XA 2JTVA 1IN6A 4XLPF 2DW4A 3M1EA 3LWFA 5ERIA 3I5UA 4BXUA 3KP7A 3NEUA 1BI2A 1YTYA 2OD5A 3B02A 5LRSA 3IWZA 3QPTA 1G6NA 3RIRA 2P5LC 3IRQA 2HQRA 3CUQB 1ZN2A 2RKHA 4NHJA 3MCZA 3BJAA 3FXRA 3E5QA 3HOTA 2LF8A 1IRGA 1FBQA 2V6CA 3I59A 4QWQA 1HXDA 3IKTA 1J9IA 4E70A 3WGHA 5DUKA 3QU3A 1DP7P 3ZP5A 4RGUA 4HV6A 3JAMZ 1RIOH 5BS6A 5JVTA 2ZMEB 4L9NA 1XSVA 1LJ9A 1SD4A 4CXFA 2BE5F 3ZPLA 1GHCA 3HRUA 4JQFA 2DU9A 1QBJA 1PUEE 4OIRF 3GUDA 5BPDA 4XLNF 3O3KA 4ZYHA 1E17A 4M73A 5BQTA 4JK1X 2Y75A 1HKTA 3VOEA 1U78A 1FSEA 1YIOA 4A5MA 3C7JA 3WTUC 3QAHA 2JPBA 5ED4A 1FX7A 2FOKA 1XB4A 1ZG3A 4BHCA 1H0MA 2DQRA 3SFZA 4MEYF 4WK8F 2GXGA 1FSHA 3E6CC 1B59A 1KU3A 4HQMA 2HYGD 1UB9A 5ICFA 4LB5A 2QQAA 3U2RA 1EH6A 2KRFA 1B6AA 3BPXA 2H94A 3JTGA 2V9VA 4AWXB 1I6XA 1BI1A 1ZG1A 2MH9A 3REOA 4KUMA 5CVJA 1D5VA 1O57A 3MZHA 2HKXA 5D4RA 1DPUA 1J59A 5JI6A 2YPRA 1IXCA 4YFNF 1GVJA 2P5KA 2WTEA 4UNOA 1CGPA 1FYKA 4IRHA 3V7SA 1S3JA 4XSZF 1SFEA 2DO7A 1R58A 1UHMA 4LK1F 3E5UA 4HW0A 4MGRA 2M8EA 2STTA 2A69F 2OAZA 2MH2A 5L3FA 1C0WA 5BMZA 4HQEA 1BBYA 1ZREA 2K4JA 2P7VB 1LDJA 2IRFG 2Z99A 2ZO4A 3SHFA 1IXRC 4GCVA 2FNPA 1QGPA 5A2QK 4PCQA 2IJLA 1SMTA 1YG2A 1ZLKA 2COMA 5ILUA 3QRFF 1FBUA 2Z9OA 2E1CA 1J2XA 2LKPA 1SFUA 4ZYGA 3K1PA 5FGMA 2ZMEA 4EM2A 2P7CB 2MD5A 1R5GA 4KMUX 1FC3A 5LEKA 3E97A 3HRSA 4CZZA 3TQNA 3BY6A 1KGSA 4HLYA 2GQQA 4I0AA 1TW2A 2OZ6A 4YFKF 4L5IA 3JSPA 2HTJA 1ZRDA 1KU9A 3V4GA 4CICA 3O2PE 2VC1A 2PBIA 4Q5SF 3F22A 3HRMA 3FM5A 4GYIA 4HZFA 1KQ9A 4RGXA 1G3TA 3HSFA 3COAC 3J81K 1XMKA 3KP5A 3N4MA 4U88A 1WKMA 1IN4A 1OYWA 2A6HF 2V1XA 3WTTC 4HOBA 2CW0F 4D0PA 1U8RA 2VONA 2QENA 4A0YA 1QQIA 3ABUA 2XKPA 3IRRA 5F6FA 1BC7C 2QBYB 2KIFA 1T6SA 1BI0A 1T38A 3CUOA 3HSRA 4OIOF 4IHTA 2BEOA 1QPMA 2K86A 2IA1A 5L3CA 3N97A 4ESJA 4M74A 1BC8C 1W4MA 3EYIA 3LA3A 2DK5A 2L01A 1DDNA 1Z6RA 4LB6B 1RUOA 4OOIA 2GXBA 1VTNC 1S29A 3CTAA 2VODA 1F5TA 2O03A 3D5LA 1FPQA 4CDGA 3GYHX 3C18A 3LSTA 1YW8A 2F5DA 1A04A 2KKOA 5L3EA 3IC7A 3SQNA 2A3SA 4RAYA 3TKYA 1Z1DA 3BOQA 5CYVA 3WU0A 2PJPA 1ON2A 2PG4A 1XGNA 2QWWA 4IHSA 3MZYA 2ZBKA 1XGOA 2Q0OA 3V7RA 4ZZLA 3I59B 3KE2A 2X0LA 4HV5A 4M72A 5LGNA 3CO7C 3H3UA 2PI0A 5DCFA 2Y48A 2W25A 2H6CA 4LLGF 5FLXK 1W5TA 5E1WA 3ZMZA 3KP3A 2GZWA 5FFZA 4RB1A 2P8TA 3S2WA 4MNUA 2J5OA 3MQ0A 5DEQA 2E7XA 3R60A 3WGIA 3KFWX 1O3QA 1JHFA 1T0FA 3FX3A 4XBFA 2UXXA 2VE8A 1XSDA 4A2UA 2DFIA 1JXSA 1REPC 3F8CA 2DK8A 1MJ9A 2VBXA 4HF1A 2H09A 3WG9A 4AVPA 4HF2A 2Y0MA 5E18F 2R3SA 1ON1A 1T39A 1J0RA 2NYXA 3M8EA 3WE3A 5J8CA 4UUVA 2FQ3A 1U5TC 1TQIA 4FX4A 3GO5A 4KA4A 2W24A 1P4WA 4EGZA 2KJCA 3KP4A 4P5OA 2PMHA 5ICGA 5HS7A 3V8LA 5TRDA 5LHGA 3F21A 3K1NA 5F64A 3R4KA 3DF8A 4GXOA 1U5TA 1K7AA 1E2XA 4RB3C 4M6XA 2D2WA 3EETA 1QNTA 5IT9Z 2OU2A 3ZN0A 2M30A 3I0TA 1ZRCA 3U1DA 2F2EA 3BJOA 1OYIA 3F8MA 2M5WA 5HLGA 3FMQA 3GFMA 4CHUA 4N0BA 2K4BA 2V1UA 1WQ2A 2BYVE 1LEBA 1S6LA 4P96A 2PMUA 2EV6A 3K9TA 3IL2A 2E1NA 3KEOA 1F9NA 4Y13A 4Y17A 5ILSA 4Q48A 1FYMA 3J80K 2VBYA 4L9VA 2QYOA 2PQ8A 1OKRA 3ISPA 1WRJA 4KDPA 3GW2A 3FMRA 4EQQA 3KETA 1WWXA 1I1GA 5FO5A 3K1MA 4RB2C 1SD6A 5CVVA 3WU1B 5BOXA 5LHIA 3GX4X 2FMLA 4O6JA 3I71A 2A5YB 4LMYA 3WODF 2W84A 2PEXA 2XAHA 2ZXJA 2B0LA 3JTHA 2WV0A 1IRFA 1L0OC 3PQJA 4MTDA 2STWA 2QLZA 4PDKA 3TO6A 1RI7A 1U2WA 1BJAA 1B4AA 2O0YA 2K02A 3ECHA 3HRTA 4ENNA 1NHAA 3ECOA 4AIJA 1TQMA 1B9NA 4HX7A 1HQCA 3KZZA 4GYGA 1G4DA 4A12A 1LEAA 4HLXA 2DBBA 5H6RA 4GO1A 2HS5A 2ACJA 2K7LA 3FMSA 4TV7A 5HDKA 1BN5A 3F72A 4Q4ZF 3T8TA 2XAJA 3TGNA 1MDMA 4OIQF 3DKWA 2XASA 3R61A 2FF4A 2ELHA 4MTEA 3MWMA 2R7FA 5AONA 1FP2A 5LEJA 1GXQA 1Y0UA 1S8NA 1I1SA 4UV8A 3MAJA 1ODDA 1O3RA 1QZZA 4Y15A 3HSEA 1F1ZA 4YG2F 4P9FA 2V79A 3JAMK 4AIKA 2ESHA 4ZH4F 2HR3A 3WTVC 1IF1A 3T0YA 3BJ6A 1JGSA 2O6GE 5JHUA 4KMFA 3OV8A 3ZMUA 2P6TA 2IT0A 4OIPF 4HBLA 1XSXA 3ERED 5E20A 2FBKA 5FB2A 3O6BB 2FSWA 4G7OF 3ZN1A 1D3YA 2FRHA 2BV6A 2OQGA 1ZARA 3ZQ7A 1D8KA 4G7HF 3IHUA 2WWYA 1UHWA 1ZHFA 5DV5A 1BIBA 4ESBA 5E1XA 2HDCA 4R8HA 2EA2A 3E6DA 3ZMSA 1IN7A 3V8JA 3DEUA 1LDDA 4KFCA 2ETHA 3C3WA 2KIMA 1XN7A 5J6XA 3DPLC 3HUGA 1YFHA 4M9SA 2KIUA 3BDDA 3WTXC 2FBHA 5KVRA 3RKYA 3KEQA 4HYEA 1W7PD 1OR7A 3HYIA 2NNNA 4NQWA 4UVAA 3WTSC 1R36A 3E6BA 4S05A 2VOOA 3AAFA 3W6KB 1V4RA 1P92A 2EJRA 4EM0B 3IWFA 1I5ZA 4EMSA 4CYDA 4YFXF 1HBXG 4OMZA 4LK0F 2EFWA 4WXHA 1G3YA 3ELKA 4DQ2A 3FM3A 5HS9A 5CVIA 3D0SA 4AIHA 2ZNYA 1HKQA 4BH9A 1YLFA 3CO6C 2FE3A 2PN6A 1FY7A 2RQPA 2HFHA 4WXCA 4WWCA 1ZLJA 1JE8A 4LD5A 2OBPA 3L09A 1LDKB 1HKSA 1O3TA 5HDGA 4LLLA 2GIVA 2WC2A 5HOOA 5D6FA 2C6YA 2VC0A 2HQNA 1W5SA 1KU2A 5ILVA 5FFXA 2K27A 2YR2A 2UXNA 2A07F 1S7OA 2RC4A 2YU3A 2DI3A 2FA5A 1J75A 3I4PA 4B09A 3LFKA 1ZGJA 5EEHA 1BM9A 1IN8A 3P9IA 2DPDA 3BPVA 2VN2A 3LA2A 2BBYA 4O3MA 1ONVA 4I2OA 3BZ6A 1ZG5A 4I7HA 4U7DA 2IW5A 4R1HA 1IN5A 4IXAA 4G8XA 4WCGA 1U5TB 5E17F 1G3SA 3J7AO 2HOEA 1PDNC 4RAZA 1AOYA 1K6OA 1FP1D 1T2KA 1Z6TA 2DPUA 3I54A 3CDHA 4BAYA 3BWGA 3PFIA 5FLXZ 3EYYA 3U9GA 3IKVA 3P9KA 2GAUA 1HSJA 1K78B 2ADUA 2ISZA 4ENKA 2TDXA 4U0VA 3WTWC 1USTA 4ETSA 3SXYA 2QUFA 2XVCA 3VEPA 2V1DA 2Q2EA 5LBQA 4P55A 3FZVA 1YO5C 4ENJA 4UHTA 5K5OA 4PGGA 1Z9CA 5EEGA 4H0EA 4QLCU 2EWNA 3ROUA 2XRNA 4OU0A 3BP8A 5JFRA 1KYWA 5K1YA 1ZGAA 2L54A 4IJAA 1DUXC 1K79A 1XCVA 4S04A 4EJTA 5D4SA 3H3ZA 1TBXA 2ESNA 4ON0A 3I64A 4O5VA 3DQVC 2QVOA 2HEOA 1OPCA 4UXNA 2Q8KA 3K2ZA 3ABTA 4A0XA 4UVCA 2Z33A 3H92A 3VB2A 3P9CA 1P2FA 1SAXA 3TO9A 4KIFA 4EJWA 2YSRA 5CJ9A 3TDUC 5H20A 2P5VA 5E8GA 1BI3A 1FOKA 5D5XB 1GXPA 2CYYA 3TOBA 1R22A 3L9FA 2M1BA 2RV8A 4L18B 1H9TA 4FX0A 4UV9A 2XAFA 2AXLA 3QP6A 4OMYA 2E7WA 5HS8A 1MDMB 3QPHA 1WSUA 2O8XA 1B1BA 1XGMA 5H6QA 2CQKA 1LQ1A 1EH7A 2VBWA 2AS5F 5KK1A 5DCMA 1HW2A 1YS6A 2ISYA 5CVUA 5D6EA 2YX7A 2LNBA 3TDZC 3KP2A 4NB5A 1QO0D 3QU6A 2PLYA 3LAJA 1XDUA 3KZYA 3WTZA 4KYWA 2W85A 4BYYA 3QOPA 4EV0A 3ULQB 3DV8A 4YIFA 1TTYA 2UWMA 2FNAA 3GEZA 4F7ZA 1V3FA 2DQLA 1SFXA 3GXOA 5D5WB 5D8LB 3TOAA 1USSA 1S7AA 2F5CA 4ZZDA 1K78A 4P9UA 1YW7A 1R23A 2GWRA 2CO5A 5LGUA 1XCBA 4M9ZA 5FD6A 4U0YA 3HHGA 2OZUA 1MKMA 5F1RA 3LAPA 2QM3A 2IVMA 4EM1A 4Q47A 1WI9A 3BROA 2W57A 3RPUA 4ENMA 2DAOA 5L3BA 2EV0A 1ULYA 5AIQA 1Z91A 1BIAA 2D1VA 4G94A 3OOPA 2EV5A 3FXQA 2HWVA 5HLIA 4KIBA 1W7PA 4HF0A 4KNYA 1G3WA 1T98A 3DPTA 2EK5A 3V7CA 3WE2A 2PFBA 2XGXA 1ZYRF 1RZ4A 1XDSA 3ML6A 1J5YA 1R1UA 1JHHA 5DD4A 5IT9K 1PP8F 1FT9A 4L9TA 5LRRA 4G6DA 4U7BA 4HX8A 1QZYA 1BOAA 4KT5C 2RGVA 4IVNA 4I09A 4I98B 2XV4S 3RPQA 3DFGA 5D5UB 2EA4A 3F6OA 3GF2A 1R00A 5E1ZB 2FMYA 5L3DA 4M71A 2A61A 2XKOA 1KQ8A 1CF7B 2CG4A 4EJUA 2M45A 5TJJA 4PZJA 2R7DA 2BGCA 5ICEA 2CGPA 3GZ6A 4LG0A 1IAWA 2Z3YA 3M9AA 3WTYC 2J5PA 3PQKA 2OA4A 1YW9A 4ASNA 2LDUA 2VOPA 4G9YA 1P4XA 1IZ1A 3SZTA 5K5QA 1IW7F 4EJVA 2QQBA 2RVCA 3KLOA 4LFUA 4MHGA 2L02A 3K0LA 5A2QZ 4EVIA 2P4WA 3GFJA 3ZMDA 2NRAC 1R1VA 1O7FA 3VFZA 3GVAA 3GLXA 1Q1HA 4A6DA 2EFQA 2QQ9A 4M6YA 5FD5A 4MEXF 4UVBA 1MJAA 3K69A 5CVRA 2UZKA 4KICA 2RNJA 4RGRA 3E5XA 3RDIA 3JSOA 4M9XA 4L0YB 4IRGA 3MFKA 3C1DA 1AWCA 2CWEA 3CUQC 1I27A 4A6EA 1IUYA 4CGZA 4FT8A 4MQVA 5LLQA 4ESFA 3F3XA 4WF2A 3GZ5A 2G7HA 4N9IA 4ZYEA 3KP6A 2FBIA 1FZPB 3CUQA 1PP7U 4IF4A 3J81Z 3LA7A 3MEXA 3HTSB 3L00A 2XIGA 1XMAA 3EQLF 2D1HA 4WXDA 1RUNA 2MA3A 4KN7X 3V8KA 1LB2A 2P6SA 5E8IA 4BHBA 3HHHA 2NNYA 2EFOA 4BNCA 1Z05A 3KCCA 2MLGA 2L4AA 5LHHA 3M7GA 2RDPA 5K5RA 3RTRA 2VBZA 2RN7A 2D45A 4CO8A 4IPAA 1EV7A 1MGTA 2CFXA 2IA0A 4RGSA 1TLHB 2XUBA 3RYPA 1P6RA 4FHTA 3L2CA 2MLKA 2VXZA 1CF7A 1R7JA 3I58A 2L4MA 2OQRA 4G7ZF 4EGYA 2HGCA 4HDVA 1FLIA 2XHKA 1FYLA 2IPQX 2NAZA 2ZCWA 1STZA 2JPCA 1IXSB 3NRVA 3RI4A 4ZYDA 1Z7UA 1ZAOA 1HSTA 5L3GA 5JR3A 2F5EA 4RS8A 1XD7A 5DCMB 3RKWA 2LF7A 3DXJF 5HDNA 4K2EA 2H27A 1RNLA 4JBAA 1UFMA 1FWZA 2JRTA 2O61A 1KQ0A 2A68F 3RYRA 1B9MA 2IA2A 4IRIA 3B73A 2VE9A 1YYVA 2A6EF 3JW4A 5IT3A 1SD5A 1OMIA 2EFPA 2G9WA 5D8KB 3FHZA 4LLNA 3CJNA 3G73A 3FXUA 2HZTA 3T5XA 1EH8A 1SMYF 3Q9VA 4HA8A 1O3SA 4WX9A 3VODA 4YIIA 3SZPA 2KJBA 1J7KA 1U6GA 4PGHA 2GA1A 5DYMA 2XROA 1R1TA 1SD7A 3Q9SA 3F8FA 4OINF 4KN4X 3WGGA 1YQAA 2VT2A 1U3EM 1UCRA 4G6QA 3ZMVA 2DTRA 3G3ZA 3E6MA 3ZMTA 3FWEA 2MBFA 3R0JA 4EJOA 3F8NA 1W7PB 1KU7A 2XAGA 3EDPA 3LQQA 4L5JA 2FXAA 3RJPA 4HX4A 3RKXA 2HYFA 2M87A 4LGWA 2JZYA 1MZBA 3GFLA 3NQOA 3F6VA 3TO7A 1H9GA 3F8BA 1LVAA 3FF5A 5LGTA 3R6SA 2ZFWA 5CLSA 4A0ZA 2MC3A 1TNTA 2ZJ2A 4I01A 1FNNA 3L7WA 1D8JA 2JSCA 3DP7A 4N9HA 4L0ZB 3HIFA 5J8FA
chains in the Genus database with same CATH superfamily
3MZ8A 2ME0A 2OPTA 3GFIA 2CSOA 2ECCA 2A6TA 4KIGA 1HW1A 3CCQI 3K10A 2JT1A 1FMVA 1ZRFA 4N4OB 5FRNA 5HLHA 2WY8Q 2FU4A 2Z5UA 2EFNA 2R7ZJ 2L3DA 1RPWA 4BHPA 4GGGA 2R93J 4A5NA 4LG0B 3R0AA 3IUOA 4FQGA 1YJWI 2F5FA 1WH7A 3A01B 2HPMA 2IP2A 2H6BA 2NS0A 3BTCA 1S72I 4HAMA 4BQOA 1O7LA 4G12A 3NARA 3LL7A 1VQ6I 4RB0A 4XKWA 2IS4A 1NTCA 1BJZA 1OQYA 3W2WA 3J80Z 1X3UA 4Y52J 2ZKZA 4I02A 1MD0A 3W6JB 2EB7A 2JUGA 4Z2YA 3HTUA 4DNCA 5J1YA 5E3LA 5IP6A 3QP5A 4XRFA 3EUHC 2XSDC 2G7UA 3GWZA 6PAXA 3CLOA 5K7HA 5DUIA 1TQPA 5F0FA 4AD9A 3P7NA 2VXDA 3MVPA 3J7YJ 1MJBA 4KT6A 3F23A 4BQAA 2JJ7A 2VT3A 4MO7A 2IS2A 4U0WA 1KA8A 1MSFC 2DLLA 2WY7Q 4L9JA 5DDGA 3HOSA 5ICCA 2ZNZA 2IEKA 3FK7A 4M3DA 1YS7A 3JCUC 1F4KA 2BZTA 3H9GA 3I53A 5BPIA 2CV2A 4FE4A 1U0JA 4MQ9F 5E3MA 2CQNA 2M7AA 1K4TA 2HTSA 1FBSA 1ZQ3P 1KYZA 5AIPA 3M8FA 3T1BA 4DIQA 1A31A 3E3VA 4I0BA 2LMDA 2XAQA 2QBYA 1J09A 4M6VA 3T8RA 3BR3A 1R5HA 3EUHA 3OYNA 1IDYA 5B5EC 3CJQB 4HDUA 3LSHA 1OYYA 4XSXF 3LQRA 3OL4A 2CUZA 1O4XA 2YX4A 1XGSA 5M3FJ 2QZ8A 5D5VB 2LSOA 3Q5FA 1TW3A 2GBYA 1ZH5A 3UNGC 4A3LJ 2X9DA 1YITI 3GTOJ 2V9KA 2K3FA 4MFEA 1HW5A 2HXOA 1H8AC 2GM4A 4FISA 1P4AA 2JVHA 5HVQC 2ZFUA 2E71A 5DD8A 2GA2A 2Y2ZA 1DPRA 1L3LA 2R7XA 2HKOA 1LNWA 2DT5A 1TNSA 2EZHA 3X2QH 3KLNA 2X4HA 2O3FA 4R79A 3FIWA 2FEZA 2Y9ZA 4LJZF 3MD2A 2CQXA 4B8XA 2JTVA 3OYJA 1IN6A 2DMQA 4XLPF 2FUG2 2DW4A 3M1EA 3LWFA 2VJ4A 3I5UA 5ERIA 4BXUA 3KP7A 3D5SC 3NEUA 1BI2A 1YTYA 1N75A 2OD5A 3B02A 2NOGA 5LRSA 3IWZA 1ITYA 3QPTA 1G6NA 3RIRA 3CMEI 2P5LC 3QWLA 3IRQA 1ETWA 5TGTA 1ZR4A 2HQRA 2NVUB 4W1UA 4E7KA 3CUQB 4RM2A 1ZN2A 2RKHA 4NHJA 3MCZA 2KL4A 3BJAA 3E5QA 2BHYA 3FXRA 3BG6A 2WV1A 3HOTA 2B7EA 2LF8A 1IRGA 4XN3A 3EUAA 1FBQA 3D5RC 2V6CA 3I59A 4QWQA 1HXDA 3ZQQA 3IKTA 3CCSI 5M5YJ 1I39A 2W1OA 3VPRA 1RR7A 1VQMI 1J9IA 5EZHA 5DM6F 4J01A 2YUSA 2L5QA 4E70A 5DS9A 3WGHA 5DUKA 1R5ID 5IY5H 3QU3A 4S0HB 3ZP5A 1DP7P 1XTAA 4RGUA 4HV6A 3PNVA 3F0CA 3JAMZ 1RIOH 5BS6A 1VQOI 4IZZA 4EATA 5JVTA 4J19A 4PFPA 2ZMEB 4L9NA 1SVMA 1XSVA 4KJZA 4DOZA 1RKWA 1LJ9A 1SD4A 2BY1A 4CXFA 1ETXA 4DZJA 5JVGF 4RA2A 4II2A 5HNHA 2BE5F 2VIXA 1VQ8I 3ZPLA 1GHCA 3HRUA 4JQFA 1HCRA 2DU9A 1QBJA 1PUEE 4OIRF 4AIDA 3HZJA 3GUDA 5BPDA 4XLNF 3O3KA 3H36A 1T8IA 2W82A 4ZYHA 1E17A 1FOWA 4M73A 4LIUA 5BQTA 1N77A 2XRLA 4JK1X 2Y75A 3CJTB 1HKTA 3BG5A 1X3ZB 3VOEA 2VUMJ 4BKXA 1U78A 1FSEA 1YIOA 4A5MA 3C7JA 3WTUC 4B48A 3G2BA 3QAHA 2JPBA 5ED4A 1FX7A 2FOKA 2K9QA 3SEQA 1SFKA 1XB4A 3DKYA 1ZG3A 3B6CA 2Y0SA 4BHCA 1H0MA 2DQRA 1GT0C 3WHCA 1W0UA 3GTJJ 2JN6A 3SFZA 3GTMJ 4MEYF 2WAQA 5J4YA 4WK8F 1W5CC 4U87A 2DA5A 2GXGA 4DW6A 1FSHA 2CRGA 3E6CC 1B59A 1KU3A 2OCEA 4HQMA 2CMPA 2HYGD 1UB9A 3JRGA 5ICFA 4LB5A 2K85A 2QQAA 2E1MC 3U2RA 1EH6A 3DKXA 3BT9A 1FIPA 2V9PA 4PFOA 3A1YA 1HDDC 2KRFA 2L7ZA 3MKLA 1B6AA 2DOFA 3BPXA 2COBA 3KEYA 3QPSA 3TL4X 1V5GA 2H94A 3OR1C 1QRYA 3JTGA 2V9VA 3G4SI 1Y1WJ 1ENHA 1R4MB 3BC8A 4AWXB 1I6XA 1BI1A 4A3MJ 1ZG1A 2MH9A 3REOA 2M4KA 3H1CA 2HYJA 4KUMA 2EIMH 5CPRB 5CVJA 1D5VA 2MABA 2F48A 1O57A 3MZHA 1S7EA 2HKXA 5D4RA 3IAS2 1DPUA 2EINH 2DA3A 1J59A 5JI6A 2YPRA 4L5EA 1IXCA 4PSXA 3L2RA 4HNVA 4YFNF 3NAUA 1GVJA 3PM1A 5HLTA 2P5KA 2WTEA 4UNOA 2R7OA 2WAQN 1CGPA 1RESA 3F9KA 1FYKA 4IRHA 1FMWA 3Q3SA 2QEXI 3V7SA 2R7RA 2X6XA 1S3JA 1YJ9I 1Z0XA 4XSZF 1SFEA 1R6RA 1MBHA 1R58A 2DO7A 1K6YA 3JR9A 1UHMA 4AYBA 3BG3A 4LK1F 3E5UA 2R0QC 1IGNA 4HW0A 2PMZA 2ELJA 3OMYA 3OYIA 3BZKA 2JQ7A 4MGRA 4A3DJ 4BE1A 2F4MB 2X6YA 2M8EA 2STTA 4GRIA 2A69F 2OAZA 2KT0A 2MH2A 2X85A 5L3FA 1C0WA 5F04A 5BMZA 4XM3A 2IGNA 4HQEA 1FOYA 1VQLI 3DEWA 4V2FA 2VKHA 1BBYA 1ZREA 1ETKA 3K4MA 2DODA 4P1WA 2K4JA 1TWFJ 2P7VB 1X3WB 3GBGA 3PIPF 2K9MA 1LDJA 4D5CA 1WGXA 2ZB9A 1JJ6C 1JUMA 3KYCB 2OF7A 4QIWN 2IRFG 1YHQI 2VKDA 2JMWA 2Z99A 2ZO4A 3DBRB 1EKEA 3SHFA 1IXRC 2ZMEC 5GP9A 2KISA 1ETQA 4GCVA 1TZLA 4X0GA 2FNPA 3FDYA 1QGPA 1ETOA 5A2QK 4PCQA 2IJLA 1SMTA 3K6GA 1YG2A 1ZLKA 2COMA 2HVRA 3VYSB 3ZXSA 3RSNA 2HQAA 3SDGA 5ILUA 3QRFF 1LE8B 1FBUA 1IDZA 2Z9OA 2E1CA 2VL8A 1J2XA 2LKPA 5J40A 3DU5A 4ZYGA 3K1PA 5FGMA 3BQYA 4BJ6C 2R5ZB 1SFUA 4NUBA 2ZMEA 1WJAA 4EM2A 3LOCA 2XGCA 1IO2A 2AXTC 3FK6A 3G6EI 3IH2A 2P7CB 3O8HA 1T08B 2HOAA 2MD5A 2LKSA 2WA0A 4B44A 1R5GA 3JRAA 3GTQJ 4KMUX 3CCYA 3A0HC 1FC3A 1WHUA 5LEKA 3G71I 4D9JA 3E97A 3HRSA 4CZZA 3S93A 3FXLA 1OCPA 4C30A 3TQNA 3GTGJ 3BY6A 3WHBA 1KGSA 4F91B 4BL0B 4YRVA 4HLYA 2GQQA 4A3CJ 4A3JJ 5JLXA 4I0AA 1TW2A 2OZ6A 4YFKF 3CMYA 4L5IA 1A5JA 3JSPA 2HTJA 3A03A 2HI3A 1ZRDA 1KU9A 3V4GA 4CICA 3O2PE 2XB5A 3MMYB 3GCMA 2VC1A 3CCMI 2PBIA 4D5FA 4Q5SF 3F22A 3HRMA 2ZSHB 3FM5A 1M1EB 4GYIA 4HZFA 1KQ9A 4RGXA 1XS9A 4XORA 1G3TA 2JSPA 3HSFA 3OIQA 1WFXA 2BY2A 1A36A 4C3IJ 3COAC 3ZRGA 3J81K 1XMKA 3KP5A 3N4MA 4U88A 1WKMA 2DT7B 1IN4A 2RREA 1OYWA 2A6HF 1IG7A 4HRIA 3BR1A 1BW5A 3ONQA 2V1XA 2LTPA 3W2VA 3WTTC 4HOBA 3HJEA 2CW0F 2LRDA 3ZQIA 3OS1A 1KONA 3W3CA 4D0PA 3OY9A 2VPRA 2O7OA 3TMOA 1U8RA 2VONA 1MH3A 5M5WJ 1YRNA 2QENA 4DJAA 4PSWA 3Q0UA 3ERMA 5J47A 3G1LA 3VYUB 4A0YA 3W6VA 1QQIA 3CQZJ 3ABUA 2E2HJ 2XKPA 3J7ZI 2XF5A 3LSJA 3IRRA 4E7SA 5F6FA 3KYDB 1BR2A 3HGGA 1P7IA 2WB1N 3PNTA 1BC7C 2DN0A 2QBYB 5FKOA 2KIFA 1T6SA 1BI0A 1T38A 3CUOA 1Q1VA 3HSRA 1F36A 3BTIA 4OIOF 4IHTA 2BEOA 1LKXA 2MGQA 1QPMA 2K86A 2CH0A 4XONA 2OCCH 3H0GJ 4C3HJ 2YU9J 5HODA 2Y31A 3DBHB 3H5AA 2CUEA 3DCFA 3KYLA 2IA1A 5L3CA 1A6QA 3N97A 1NK2P 4ESJA 4M74A 1BC8C 1S9HA 5GAGJ 1W4MA 4BE2A 2FX0A 3E1SA 5IOYA 2ZJPF 3LA3A 3EYIA 2RQQA 2DK5A 3TW6A 2L01A 1DDNA 1Z6RA 4LB6B 4W97A 1RUOA 4OOIA 2L0KA 2GXBA 4E7HA 1VTNC 1S29A 2ZJRF 1ZKGA 3CTAA 2VODA 4OWRB 3CESA 1APLC 2O03A 1F5TA 3D5LA 1FPQA 3HXLA 4CDGA 3UKGA 4E7JA 3GYHX 3QYFA 2L9NA 3C18A 2VLAA 3LSTA 2DYRH 1YW8A 5F0CA 2F5DA 1A04A 2KKOA 5L3EA 1RETA 4Y33A 2X51A 2R7TA 1POGA 3IC7A 3SQNA 2A3SA 2DMPA 4RAYA 3VSLA 1LFBA 3TKYA 4BS9A 1Z1DA 3ESWB 3BOQA 5CYVA 3WU0A 2PJPA 1ON2A 1A6IA 3VSKA 2UUZA 2PG4A 1XGNA 3RZOJ 2JRMA 2QWWA 4IHSA 3MZYA 2ZBKA 1XGOA 3K4NA 1BW6A 4QTRA 2Q0OA 3V7RA 3I59B 4ZZLA 2VJIA 2A5WA 3KE2A 1ZR2A 2X0LA 4HV5A 5KNLA 4M72A 5LGNA 3CO7C 3H3UA 3JRIA 2PI0A 1DP3A 3DU6A 3CCUI 1MMDA 5FKLA 1T0FC 5DCFA 1V5FA 2Y48A 1GLNA 2W25A 2H6CA 2VQCA 4RMNA 5B1BH 4DBRA 4LLGF 4BEHA 3HOZJ 2E34A 5FLXK 2DA6A 3JRBA 1W5TA 4KITB 5E1WA 4CCNA 1MMAA 3ZMZA 3KP3A 2GZWA 3DEEA 5FFZA 1SANA 3OL3A 4RB1A 4PJLA 2P8TA 3S2WA 5GPCA 1V5EA 1G8XA 4MFDA 3PUBA 4MNUA 2O9LA 2J5OA 2BY3A 3MQ0A 5DEQA 2IGMA 2E7XA 1K83J 3WU2C 2H8RA 3BQZA 3R60A 3WGIA 3KFWX 4IQ4A 3P5JA 4HSTA 1O3QA 1JHFA 1T0FA 2ECBA 1DU6A 2ZSIB 1TP4A 3FX3A 3VDXA 4XBFA 2UXXA 5K7ZA 4A69C 5C4JJ 3S14J 2VE8A 1XSDA 3CLQA 4A2UA 2DFIA 3K4BA 1JXSA 1REPC 3F8CA 2DK8A 1YI2I 1VQ4I 2CJJA 1VZ0A 5EYRA 2Y9YA 3S1QJ 1MJ9A 2VBXA 1D1AA 1U9OA 4HF1A 2H09A 3WG9A 4M3EA 2NVTJ 3GMEA 1I3AA 2R4GA 4AVPA 4HF2A 2Q1ZB 1E3PA 2M0CA 2QGUA 2Y0MA 5E18F 1FOXA 2R3SA 1ON1A 2DXIA 1LUJB 1MMSA 1T39A 2XPUA 4D1QA 1J0RA 4JX6A 2NYXA 3M8EA 3WE3A 2Z2SB 3ZQFA 5J8CA 4UUVA 2FQ3A 2R7SA 1U5TC 3LFUA 1TQIA 1IC8A 2O8KA 3S2DJ 4FX4A 3SZGA 1VNDA 3GO5A 4KA4A 2W24A 1P4WA 4EGZA 3EUKL 1Z3XA 1BR1A 2KJCA 3KP4A 4P5OA 2PMHA 5ICGA 2QKMB 5J4VA 5HS7A 3V8LA 4A3EJ 2AQEA 2QCOA 1Z77A 5TRDA 5LHGA 3F21A 3DBLB 1OCZH 3K1NA 5J1RA 1A35A 3CJRB 2E1MB 5J3LA 5F64A 3S1MJ 3R4KA 3DF8A 2FOWA 2LFBA 4GXOA 2XDVA 4E7IA 1EF4A 1U5TA 3MN2A 1K7AA 1E2XA 4HG2A 4RB3C 1QVTA 5FLMJ 4M6XA 1OCCH 2D2WA 3EETA 1QNTA 5IT9Z 1QPIA 2OU2A 2XF6A 3ZN0A 2M30A 3I0TA 1T95A 2Y30A 3M1CA 3U1DA 4E6KG 1ZRCA 1HOMA 2F2EA 3GZNB 1UZCA 3BJOA 2XGDA 3HDDA 1OYIA 2X1DA 3F8MA 2M5WA 5HLGA 2B9SA 3FMQA 1Z67A 1LVKA 1KZHA 3HOVJ 2LKXA 3DLAA 3GFMA 4CHUA 1T33A 4N0BA 2ZXWH 2K4BA 1IJWC 2V1UA 1WQ2A 3HM5A 2BYVE 1LEBA 4CCOA 4RLFA 1S6LA 3TEDA 1TWGJ 4P96A 2FQ4A 2M34A 3RZDJ 3PSFA 1W0TA 3I4NJ 3HGYA 1OCTC 3FXMA 2PMUA 2EV6A 3K9TA 3IL2A 2E1NA 4CCKA 3CCRI 3KEOA 4UB8C 3HKZA 1F9NA 4Y13A 5FRMA 4Y17A 5ILSA 1R49A 3PIOF 1UJ8A 1D0XA 4Q48A 1TWCJ 5FLVA 1FYMA 3J80K 2VBYA 3AG3H 3S15J 1Y8QB 4L9VA 4DYQA 2MD0A 5CQEA 2ZC2A 3B6AA 3LNQA 2QYOA 2PQ8A 1OKRA 2F4OB 4PJMA 1W1WE 3ISPA 5LD2C 1WRJA 3KPHA 4KDPA 3GW2A 3FMRA 4EQQA 3GTLJ 3KETA 4NC8A 3S1RJ 1HDPA 1WWXA 1I1GA 1Z7LA 1QHHD 3E0JB 5FO5A 3K1MA 4RB2C 1ETVA 1SD6A 5CVVA 3WU1B 2Z1DA 3QPLA 5BOXA 3ABMH 5LHIA 3GX4X 2QSHX 2FMLA 4CUGA 1BR4A 4O6JA 3FXJA 3I71A 2KP6A 2A5YB 3DPUA 4LMYA 4A3IJ 1DQUA 1XMXA 2BXZA 3WODF 1XC5A 2W84A 4F55A 2PEXA 4BDZA 2XAHA 2RNGA 2ZXJA 2B0LA 3JTHA 2WV0A 3S3MA 2QSGX 1P7JA 1IRFA 4HSRA 1L0OC 3PQJA 4MTDA 3DTEA 3JRDA 2STWA 2QLZA 4PDKA 3TO6A 3HPGA 2ZJQF 4XLAA 1RI7A 1U2WA 1BJAA 2KZGA 1B4AA 3HKZN 2O0YA 3U1KA 2N8GA 2K02A 3ECHA 3HRTA 4X1EA 4ENNA 1NHAA 3ECOA 4DZPA 3AG1H 3QQAA 4AIJA 5F0HA 1TQMA 4CCMA 4I6ZA 1B9NA 9ANTA 2M4GA 1EA3A 3KX2A 4HX7A 4F93B 1HQCA 1ETYA 3KZZA 1OCRH 4BU2A 5EF6A 4GYGA 3OYBA 3ZQLA 2VI6A 3CD6I 1G4DA 1SFOJ 4E7ZA 3PNYA 4A12A 1LEAA 4HLXA 3A2KA 1RR8C 2DBBA 5H6RA 3CCLI 3A02A 4GO1A 1JKRC 2HS5A 1MSEC 4X6AJ 4ITVA 1BOBA 2KMUA 2W4SA 4ABZA 4B47A 2ACJA 2K7LA 2LOOA 3FMSA 1G59A 2KFDA 4TV7A 5HDKA 4E4HA 1BN5A 3F72A 4Q4ZF 3T8TA 2XAJA 4MIMA 4B4CA 1WH5A 2K40A 5EG0A 1UELB 3SEZA 1ACIA 3TGNA 1MDMA 4OIQF 1NG6A 3DKWA 2WAFA 2XASA 3R61A 1GUUA 2FF4A 3K4JA 2ELHA 1JJ8C 4A3KJ 3QODA 3ABLH 4MTEA 4V19K 3MWMA 2HPIA 2R7FA 1RC9A 4LG3A 3M3YJ 4XKCA 5AONA 1IV6A 1FP2A 5LEJA 1R9TJ 3OYKA 3LMMA 1GXQA 4RAGA 1Y0UA 1S8NA 1EJ9A 1I1SA 4UV8A 4UUTA 4E7LA 3CF2A 1XPXA 1YRNB 3LSMA 3MAJA 3JREA 1ODDA 1O3RA 4BGDA 1QZZA 4Y15A 1YIJI 3PSIA 3HSEA 1F1ZA 4YG2F 1E3HA 4M3FA 4P9FA 1SEUA 2V79A 3JAMK 3MKZA 2QQ8A 5GPAA 2CQQA 1AA7A 2X1EA 1X1DA 3BLYA 4AIKA 3I55I 2ESHA 4ZH4F 2HR3A 3WTVC 1FTTA 3OS0A 1IF1A 2DA1A 4A93J 3A0BC 2IBDA 3T0YA 3BJ6A 1JGSA 3DLLF 3BCBA 2O6GE 5JHUA 1D1BA 2GLOA 4KMFA 3OV8A 3ZMUA 2P6TA 4JYKA 3HB9A 2IT0A 4OIPF 4HBLA 3E7LA 1XSXA 2IXSA 4GFBA 4QPQA 3ERED 5E20A 2FBKA 5FB2A 2MG4A 1I50J 3DTKA 3O6BB 1SVLA 1JUPA 2FSWA 1Y0NA 1OISA 5E3NA 4G7OF 4HNTA 4PK4A 3ZN1A 5KAIC 1D3YA 2FRHA 4XLCA 2BV6A 2OQGA 4XKBA 1MNEA 1ZARA 1PJRA 2LY2A 1U9NA 3ZQ7A 1D8KA 2KRCA 3IHUA 3SDBA 4G7HF 4FASD 2WWYA 1UHWA 1ZHFA 3RPUD 4C9YA 5DV5A 1BIBA 2ME6A 2HZDA 4ESBA 3QYBA 5E1XA 1OR7C 4UY8I 2EZKA 2HDCA 2X48A 4R8HA 2KRHA 5LFAA 2EA2A 3E6DA 3ASOH 4DYCA 3ZMSA 1IN7A 3V8JA 3DEUA 1LDDA 4KFCA 2ETHA 3C3WA 2KIMA 2VJ5A 4PUSA 3LSGA 3ZCOA 1R71A 1XN7A 5J6XA 3DPLC 3HUGA 4HEA2 5IPAA 1YFHA 4M9SA 1QA6A 2KIUA 3BDDA 3WTXC 2FBHA 2L2OA 5KVRA 3J7AY 3RKYA 1IV8A 1HA8A 3KEQA 4HYEA 4BJ5C 2VB6A 1W7PD 1OR7A 4ANJA 3IV5A 3HYIA 2K5CA 2NNNA 4NQWA 4UVAA 1X4PA 3WTSC 1X19A 3PUFA 1R36A 3E6BA 4XMYA 5B3SH 5KCMA 4S05A 1HLVA 2VOOA 3AAFA 3W6KB 1SC7A 4IEJA 4JX4A 3KIOA 1V4RA 1P92A 2EJRA 4EM0B 3IWFA 3K4CA 4CYCB 1I5ZA 2NVXJ 4XN0A 3FBNB 4BEHB 4EMSA 4CYDA 4YFXF 1MNMC 1HBXG 1AU7A 4OMZA 4LK0F 1MBJA 2LLKA 3I3LA 2EFWA 4WXHA 1G3YA 1SAUA 3H5RA 3ELKA 3H0DA 3IP4B 2BVLA 1UG0A 1VF9A 4DQ2A 1Y1VJ 1VFCA 4B3XA 3FM3A 5FJ8J 5DM7F 5H2FC 2E35A 4BDYA 5HS9A 5CVIA 3D0SA 4AIHA 2ZNYA 4HNUA 1HKQA 3L2WA 1DU0A 1NG7A 1WJCA 2CW7A 4BH9A 2L9VA 5B66C 4IOAF 1YLFA 2OUMA 2GIZA 3S3NA 3CO6C 2DOEA 2FE3A 2I8DA 2PN6A 1JKOC 1FY7A 2RQPA 2HFHA 2WB1A 4WXCA 4WWCA 1ZLJA 1JE8A 4LD5A 4AM3A 2M2EA 2OBPA 2TRTA 3CDIA 3L09A 4LITA 4QSHA 1LDKB 1HKSA 1O3TA 5HDGA 3U21A 4IX7A 4LLLA 2GIVA 2WC2A 5HOOA 5D6FA 4CA0A 2C6YA 2VC0A 2HQNA 2HOTA 4BUPA 1W5SA 4JOMA 1KU2A 5ILVA 5FFXA 2K27A 2WAEA 2YR2A 2UXNA 3ABKH 2A07F 2HQ5A 3ASNH 2JK3A 1S7OA 1YX5A 2RC4A 2YU3A 4AU7A 2DI3A 4FETA 2FA5A 1OJLA 1J75A 2G0EA 1QHGA 2V1NA 3I4PA 4B09A 3LFKA 1ZGJA 5EEHA 1BM9A 1IN8A 3P9IA 2DPDA 1GVDA 1JT6A 3LSRA 4XLFA 1U8BA 3BPVA 1MBEA 1D5YA 4ZC3A 4ZDOA 2VN2A 3LA2A 2BBYA 4O3MA 2HDDA 2ICWG 1IRXA 1ONVA 2BOLA 4I2OA 3BZ6A 3OYEA 1ZG5A 3W2AA 4I7HA 4U7DA 2IW5A 4R1HA 2F6CA 5EJCA 1IN5A 1ERDA 3NWTA 5FROA 4IXAA 4G8XA 4WCGA 4KISA 4CCLA 1U5TB 1YJNI 5E17F 3C2GA 4ZDLA 3PO3J 3WG7H 1G3SA 3J7AO 3CMMA 3IH4A 1DGWY 2HOEA 4I76A 4B3AA 1PDNC 4RAZA 4IKFA 1AOYA 1W36D 1K6OA 2LH9A 1FP1D 2NVYJ 1T2KA 4MLOA 3HPHA 4CH7A 1Z6TA 2DPUA 3I54A 1UAAA 3CDHA 4BAYA 3L1PA 3BWGA 3PFIA 5IYCJ 1WCMJ 5FLXZ 3EYYA 1Z21A 4FE7A 3U9GA 2QSFX 4AC0A 3IKVA 3P9KA 1X1PA 2GAUA 1HSJA 1K78B 2ADUA 4F52A 2ISZA 4ENKA 1Y56A 1X4OA 2TDXA 4U0VA 3MKWB 3WTWC 1PUFB 1USTA 4ETSA 3DWLE 3SXYA 2QUFA 2XVCA 3VEPA 2V1DA 2Q2EA 5IOZA 1E0EA 2L7FP 2W48A 5LBQA 3M4OJ 4P55A 2KIQA 3FZVA 1YO5C 4ENJA 2DFFA 1MW7A 4UHTA 5K5OA 2HOSA 2GXAA 4LIVA 2MW8A 4PGGA 4BY7J 4XRSA 2DJIA 5EEGA 3CF5F 4H0EA 1Z9CA 4QLCU 4BBSJ 1F43A 2L9RA 4IHWA 2EWNA 3ROUA 1H88C 4ZTFA 2XRNA 2KPMA 4G6TB 4OU0A 3ZQGA 5B1AH 3BP8A 2NXNB 3QOEA 3VYTB 5JFRA 1KYWA 5K1YA 3IH3A 1GV2A 3OSFA 1ZGAA 2GOMA 2L54A 2EBIA 4IJAA 1FIAA 1DUXC 3EPZA 1QZEA 2LC2A 3BG7A 3FXOA 1R4NB 2JA8J 1K79A 1XCVA 4S04A 3CCVI 4EJTA 5D4SA 3H3ZA 1N25A 1MMGA 1TBXA 5TISC 2ESNA 1MH4A 4CYCA 5IP7J 4ON0A 3VYRB 2XAUA 2PJRA 3I64A 4O5VA 4NC6A 3DQVC 4Y4RA 2QVOA 3PL8A 2HEOA 1OPCA 3BZCA 4UXNA 1D0ZA 2Q8KA 3K2ZA 3ABTA 4A0XA 4UVCA 1S5LC 2XC7A 2Z33A 3H92A 3VB2A 3CCJI 3P9CA 1YX3A 1P2FA 1SAXA 3TO9A 2LREA 4KIFA 3OYCA 3OYDA 4EJWA 2DDAA 1VQ5I 1OFCX 2XF7A 4I99C 2YSRA 5CJ9A 3S1NJ 4PJNA 3H3VK 5E79C 3TDUC 5H20A 2P5VA 5E8GA 1BI3A 1FOKA 5D5XB 3C2HA 1FEXA 1GXPA 2OTJI 3OIOA 2CYYA 4AUXA 3UR3C 3TOBA 5GTIC 2L9SA 2JA7J 1VQNI 2DA2A 3RKQA 1R22A 1WZ2A 3L9FA 2M1BA 2RV8A 4L18B 1H9TA 4FX0A 4UV9A 2B63J 3OYLA 3OYMA 3H9QA 1I6HJ 1ZTRA 2XAFA 2E5NA 3S32A 2Z16A 2AXLA 3QP6A 4NC7A 1X2MA 1MBGA 3GLLA 3CC7I 3HOYJ 5EG0B 1UMQA 4XLHA 4OMYA 2E7WA 5HS8A 1MDMB 1AHDP 3QPHA 3AL0C 3LSIA 4ZJZA 1WSUA 2O8XA 1B1BA 1XGMA 2LBFA 5H6QA 2CQKA 1PYVA 1LQ1A 1EH7A 4JP0A 4XL9A 2VBWA 3HEFA 2AS5F 4OAZA 4B1RA 3HOWJ 5KK1A 3V42A 1LPQA 2DT6A 2W00A 5DCMA 4A3FJ 1HW2A 1YS6A 1RRJA 5EGOA 1OLTA 2ISYA 5CVUA 2I5UA 5D6EA 4H4KC 5FKKA 3CC4I 2YX7A 2IGKA 2BW3B 2LNBA 4PJ0C 3TDZC 3TP3A 4BQNA 5C3EJ 3KP2A 4NB5A 1QO0D 3QU6A 2PLYA 5FKMA 3LAJA 1XDUA 4NBQA 1HF0A 3K2AA 2M0MA 3KZYA 4XRSG 4BACA 3WTZA 4ZDPA 3TW7A 4BBRJ 4BE0A 4KYWA 1VQKI 2M3AA 2W85A 4IO9F 4BYYA 2L7KA 2FJ1A 2OJED 3QOPA 4EV0A 2JUCA 1JUSA 3BR5A 3ULQB 3DV8A 4YIFA 1TTYA 2X1CA 2FNAA 3S2HJ 2UWMA 1XX5A 3GEZA 4F7ZA 2H8WA 2GOXB 2XPWA 3AG2H 3I4MJ 2VASA 1TT5B 3JRHA 1V3FA 2DQLA 1SFXA 3GXOA 5D5WB 5D8LB 2XSJC 3O8GA 2LG4A 3TOAA 1PVEA 5IYDJ 1USSA 1LFPA 2AO9A 4FTHA 1S7AA 3BR6A 4AVZA 2F5CA 1X58A 4ZZDA 1K78A 2JA5J 4P9UA 2E5ZA 3SFIA 5M5XJ 1YW7A 2V26A 2VKEA 1DGRM 2IAIA 4B43A 1PUFA 1R23A 2RAEA 3LSKA 2GWRA 5CKTA 1B72A 2CO5A 5LGUA 2K3PA 2K9NA 1XCBA 3HOXJ 1FTZA 2X6WA 4M9ZA 2ID6A 5FD6A 4U0YA 1BA5A 3HHGA 2OZUA 4IHYA 3GTPJ 1MKMA 5F1RA 3LAPA 3K70D 2QM3A 1IUFA 2IVMA 4EM1A 4RM3A 4Q47A 1WI9A 3BROA 2W57A 3RPUA 4ENMA 2DTZA 2DAOA 5JLWA 3OIPA 1K61A 1FJLA 5L3BA 2EV0A 5FKNA 1ULYA 2CQ7A 5AIQA 2HVQA 3ZQCA 1LFUP 1Z91A 3PO2J 1BIAA 4V2GA 2D1VA 4G94A 4C2UA 3OOPA 4RAFA 1T56A 2DA4A 2EV5A 3HUGB 2W7NA 3H5NA 4F3QA 2LVSA 3FXQA 2HWVA 5F08A 2HVSA 5HLIA 3D1NI 2BVMA 2EQRA 4KIBA 1W7PA 2LD5A 2EZLA 3HBLA 4HF0A 1V54H 2VPLA 1RKTA 4KNYA 2KQRA 5JHFA 1G3WA 1MNDA 2X6OA 4NQWB 5C44J 3M8JA 1T98A 3DPTA 2EK5A 3V7CA 2HU9A 5EEAA 3WE2A 2PFBA 2XGXA 1ZYRF 1RZ4A 1XDSA 1VQ9I 2E2JJ 3ML6A 1J5YA 2A05A 2JA2A 1AKHB 1R1UA 1G2HA 1JHHA 5DD4A 5IT9K 1PP8F 1FT9A 1MIJA 4XR6A 4NNJA 1Y6IA 4L9TA 5LRRA 5DTDA 1QVUA 3L2QA 4G6DA 4U7BA 2L7MP 4HX8A 1JI8A 2AQFA 1GDTA 1WVRA 1QZYA 4A3GJ 1CQTA 1BOAA 4KT5C 2RGVA 4BXXJ 1WJDA 2QF7A 4IVNA 4I09A 2YS9A 3FKJA 5GAEJ 4I98B 2DOAA 2DMNA 2XV4S 3RPQA 1WPKA 3DFGA 5D5UB 4UUSA 2EA4A 1B8IA 3F6OA 3GF2A 1R00A 3OR2C 5E1ZB 4C2TA 2FMYA 5L3DA 4M71A 2A61A 2XKOA 4XLEA 1KQ8A 2KZVA 3HC7A 3OYAA 1CF7B 3CP2A 2I10A 2CG4A 4J00A 5IYBJ 3TP0A 3I56I 4EJUA 3FXKA 2M45A 5TJJA 3GTKJ 4PZJA 2R7DA 2BGCA 3A4CA 3S3OA 4BQQA 5ICEA 2CGPA 3GZ6A 4LG0A 1X1BA 4YEJA 1IAWA 4IL6C 2Z3YA 3M9AA 3WTYC 2CFOA 1JKQC 3A01A 1I3QJ 2J5PA 3PQKA 4M3GA 2OA4A 2CV1A 3OWTA 1YW9A 2KHMA 1V55H 2XB0X 4ASNA 2NOJB 2LDUA 2LYCA 2VOPA 4G9YA 2DA7A 2BW3A 2WADA 1W36C 1P4XA 5GTHC 1MMNA 1IZ1A 3SZTA 3OYHA 5K5QA 1IW7F 4Y7NJ 3L2VA 4EJVA 3K4LA 2QQBA 3OYGA 3HL2A 3LSPA 2RVCA 3KLOA 4LFUA 1ZGWA 4DBQA 4MHGA 3JRCA 2L02A 3K0LA 5EZGA 4RDUA 5A2QZ 1QU3A 2P4WA 3GFJA 4EVIA 3ZMDA 2NRAC 1R1VA 2E36A 2OTLI 2P0WA 1O7FA 2XGEA 1TL8A 5HNFA 1WJ5A 2LY9A 3VFZA 3HOUJ 3GVAA 2VQGA 2M8GX 3GLXA 4ZYAA 3KZIC 1Q1HA 4A6DA 2EFQA 2QQ9A 4XKVA 1VQPI 2Y0SN 4M6YA 2KDOA 3OYFA 5FD5A 4YELA 4MEXF 4UVBA 1MJAA 4BY1J 2JVGA 3K69A 5CVRA 2E2IJ 2UZKA 4KICA 2RNJA 4XK4A 3SJMA 2EZIA 5F1JA 3DTIA 2DCEA 4PJJA 4RGRA 3E5XA 3RDIA 3JSOA 4M9XA 2E60A 4L0YB 2MFZA 3IAM2 4IRGA 3MFKA 1TT0A 3C1DA 1AWCA 1P9QC 2CWEA 2EIJH 2Q2EB 3FKIJ 3CUQC 4XNFA 1I27A 4A6EA 2DYSH 4CSWA 1IUYA 4CGZA 4FT8A 5IP9J 3QYEA 3TBIA 2ZXHA 4MQVA 5LLQA 4ESFA 3F3XA 4WF2A 3GZ5A 2G7HA 3H35A 1TC3C 4N9IA 4ZYEA 2HNHA 3KP6A 2ELKA 3RCOA 2FBIA 4D7NA 2XPVA 4IQJA 2DMUA 3H9JA 2BY0A 4BXFA 1FZPB 3CUQA 1PP7U 4IF4A 2OV7A 3J81Z 1OCOH 4YIRX 1VQ7I 2LK2A 3LA7A 3MEXA 3HTSB 1TWHJ 3L00A 4LOCA 2XIGA 2V7FA 3ZOBA 3AKZA 3BR0A 1XMAA 2R5YB 3EQLF 3SYTA 2D1HA 4WXDA 1RUNA 3BCAA 2PJRB 2MA3A 3S16J 1AKHA 1IRZA 4UB6C 2VQLA 3AG4H 2JA6J 4KN7X 4DYRA 3V8KA 1LB2A 2P6SA 1WJEA 4AYBN 5E8IA 4BHBA 2CUFA 3HHHA 2R7VA 2NNYA 2IS6A 2EFOA 5J1UA 2PMZN 4BNCA 2E1OA 1Z05A 3KCCA 2MLGA 2L4AA 5LHHA 2K9LA 3I9V2 3M7GA 2DJNA 3BG9A 2EIKH 3PJRA 2RDPA 2DMTA 5K5RA 3RTRA 2VBZA 2RN7A 2D45A 4HPQA 4CO8A 4IPAA 1EV7A 4N4NB 5BNGA 3CDLA 4EEFG 2QA4I 1MGTA 2DDBA 2CFXA 4JX5A 2KLOA 2BHZA 2IA0A 4RGSA 1TLHB 1WJBA 2XUBA 3RYPA 4CCJA 1P6RA 4FHTA 3NWSA 3JRFA 4XQFA 3L2CA 2MLKA 2VXZA 2LR8A 1CF7A 1R7JA 1Z3YA 2M9HA 3I58A 2MC4A 2L4MA 4M3BA 1MBFA 2OQRA 4G7ZF 5GADJ 2HGCA 4EGYA 4HDVA 1FLIA 1JTXA 2XHKA 3S17J 1FYLA 2IPQX 2NAZA 2R92J 2ZCWA 2NS7A 3BTLA 2K9SA 1STZA 2JPCA 2VKVA 3FBIB 2PX9A 3ZQHA 1IXSB 2LBFB 3NRVA 3RI4A 4ZYDA 3RQ4A 2V6EA 1Z7UA 2FD5A 1ZAOA 1HSTA 5L3GA 3OOUA 5JR3A 3OS2A 4XOTA 2F5EA 4RS8A 1XD7A 5DCMB 1E3OC 3RKWA 2LF7A 3DXJF 5HDNA 4RLQA 2CW8A 5EDNA 4K2EA 5EGOB 2H27A 3VWBA 4II3A 1RNLA 4JBAA 5K7FA 1JGGA 2IS1A 1TWAJ 2TCTA 1UFMA 1JTYA 1FWZA 3L2UA 2R7WA 3ZR8X 2JRTA 3G1OA 3AL0B 5CQGA 2O61A 3FHNA 1KQ0A 2JWTA 2VQHA 5C4XJ 3CC2I 2A68F 3RYRA 2LY1A 1B9MA 1D0YA 3CMAI 2WBMA 1K4SA 2IA2A 4IRIA 3B73A 1JKPC 2VE9A 2CV0A 1YYVA 2A6EF 2DFHA 1XG1A 2P81A 3JW4A 5KAFC 4C3JJ 4A3BJ 3K70C 2R7UA 1YE9A 3CP8A 3CZ6A 5IT3A 3BR2A 1SD5A 1OMIA 2CU7A 4C2MJ 1BL0A 2EFPA 4IHVA 2G9WA 2OC6A 4D7MA 1SVOA 3CCEI 2F4IA 5D8KB 3FHZA 4LLNA 3CJNA 1D1CA 3K4KA 3G73A 2MYSA 3BTJA 3FXUA 1B72B 2HZTA 3FISA 5E3OA 2EPFA 3T5XA 1EH8A 1SMYF 3Q0VA 2NVQJ 3Q9VA 4HA8A 2R7QA 1O3SA 4WX9A 1ZK8A 2H1LA 3VODA 4YIIA 1NK3P 3N05A 3SZPA 1X1CA 2QKLB 1GV5A 4DGWB 5GAHJ 1X2NA 2IGOA 3OSGA 2KJBA 2MSYA 1J7KA 1U6GA 4PGHA 3C2BA 4Z6YA 1NH3A 2UV1A 2GA1A 4BJTA 5DYMA 2XROA 5KHDA 1R1TA 2LP0A 1SD7A 3Q9SA 3F8FA 2HXIA 4OINF 4KN4X 3Q0WA 2NS8A 1Y39A 3WGGA 1YQAA 2VT2A 1U3EM 1UCRA 2CUJA 4G6QA 2HDWA 5M3MJ 3ZMVA 2DTRA 2H1KA 3G3ZA 1WJFA 3E6MA 3ZMTA 3G1MA 1WI3A 3FWEA 2MBFA 1UG2A 3R0JA 2Y69H 3PFYA 1N78A 4EJOA 1Y8RB 3F8NA 2EILH 2VJJA 2DFEA 1W7PB 1KU7A 4ZTJA 3HG9A 3S8PA 2R5YA 2XAGA 3EDPA 4QPOA 2CS3A 4IOCF 2BXYA 2D5VA 3LQQA 4L5JA 2FXAA 3RJPA 1LE8A 2EH3A 4OAYA 2AHQA 1HC8A 4Y3OA 4HX4A 3RKXA 2R5ZA 3MKYB 2HYFA 4XICA 2M87A 1ORKA 4XRMA 4LGWA 1JT0A 2JZYA 1MZBA 4F92B 3AFHA 4GDFA 3GFLA 4IHXA 1UHSA 3NQOA 3F6VA 4CZCA 1X1AA 2ID3A 2M7BA 1H9GA 3F8BA 2V4JC 1MBKA 3TO7A 1LVAA 3FF5A 1YOVB 5LGTA 1H89C 3M07A 3R6SA 2ZFWA 1ZELA 5CLSA 5F27A 4A0ZA 4XIDA 2MC3A 3RQIA 2KDZA 1TNTA 4FCYA 2ZJ2A 4I01A 1FNNA 3L7WA 1D8JA 3ZGKA 2JSCA 4RBOA 4XOPA 1VI0A 2F5VA 3DP7A 4N9HA 2E19A 4UUSB 1B8IB 4L0ZB 2ZXIA 3HIFA 2O5RA 3K7AJ 5J8FA 4NDLA
chains in the Genus database with same CATH topology
3GFIA 2CSOA 4KIGA 1HW1A 2JT1A 1ZRFA 5HLHA 2FU4A 2Z5UA 2EFNA 2L3DA 4BHPA 4GGGA 4A5NA 4LG0B 3R0AA 2F5FA 2IP2A 2H6BA 2NS0A 4HAMA 1O7LA 4RB0A 3J80Z 1X3UA 2ZKZA 4I02A 1MD0A 3W6JB 2EB7A 4Z2YA 3HTUA 4DNCA 3QP5A 4XRFA 2G7UA 3GWZA 6PAXA 3CLOA 5DUIA 1TQPA 4AD9A 3P7NA 1MJBA 3F23A 4BQAA 2VT3A 4U0WA 1KA8A 2DLLA 4L9JA 5DDGA 3HOSA 5ICCA 2ZNZA 1YS7A 1F4KA 3I53A 5BPIA 4MQ9F 2HTSA 1FBSA 1KYZA 5AIPA 3M8FA 3T1BA 3E3VA 4I0BA 2XAQA 2QBYA 3T8RA 1R5HA 3EUHA 4HDUA 1OYYA 4XSXF 3LQRA 2YX4A 1XGSA 2QZ8A 5D5VB 2LSOA 3Q5FA 1TW3A 1ZH5A 1HW5A 1P4AA 5HVQC 5DD8A 2GA2A 1DPRA 1L3LA 2HKOA 1LNWA 2DT5A 1TNSA 4R79A 3KLNA 2X4HA 2O3FA 2FEZA 4LJZF 4B8XA 2JTVA 1IN6A 4XLPF 2DW4A 3M1EA 3LWFA 5ERIA 3I5UA 4BXUA 3KP7A 3NEUA 1BI2A 1YTYA 2OD5A 3B02A 5LRSA 3IWZA 3QPTA 1G6NA 3RIRA 2P5LC 3IRQA 2HQRA 3CUQB 1ZN2A 2RKHA 4NHJA 3MCZA 3BJAA 3FXRA 3E5QA 3HOTA 2LF8A 1IRGA 1FBQA 2V6CA 3I59A 4QWQA 1HXDA 3IKTA 1J9IA 4E70A 3WGHA 5DUKA 3QU3A 1DP7P 3ZP5A 4RGUA 4HV6A 3JAMZ 1RIOH 5BS6A 5JVTA 2ZMEB 4L9NA 1XSVA 1LJ9A 1SD4A 4CXFA 2BE5F 3ZPLA 1GHCA 3HRUA 4JQFA 2DU9A 1QBJA 1PUEE 4OIRF 3GUDA 5BPDA 4XLNF 3O3KA 4ZYHA 1E17A 4M73A 5BQTA 4JK1X 2Y75A 1HKTA 3VOEA 1U78A 1FSEA 1YIOA 4A5MA 3C7JA 3WTUC 3QAHA 2JPBA 5ED4A 1FX7A 2FOKA 1XB4A 1ZG3A 4BHCA 1H0MA 2DQRA 3SFZA 4MEYF 4WK8F 2GXGA 1FSHA 3E6CC 1B59A 1KU3A 4HQMA 2HYGD 1UB9A 5ICFA 4LB5A 2QQAA 3U2RA 1EH6A 2KRFA 1B6AA 3BPXA 2H94A 3JTGA 2V9VA 4AWXB 1I6XA 1BI1A 1ZG1A 2MH9A 3REOA 4KUMA 5CVJA 1D5VA 1O57A 3MZHA 2HKXA 5D4RA 1DPUA 1J59A 5JI6A 2YPRA 1IXCA 4YFNF 1GVJA 2P5KA 2WTEA 4UNOA 1CGPA 1FYKA 4IRHA 3V7SA 1S3JA 4XSZF 1SFEA 2DO7A 1R58A 1UHMA 4LK1F 3E5UA 4HW0A 4MGRA 2M8EA 2STTA 2A69F 2OAZA 2MH2A 5L3FA 1C0WA 5BMZA 4HQEA 1BBYA 1ZREA 2K4JA 2P7VB 1LDJA 2IRFG 2Z99A 2ZO4A 3SHFA 1IXRC 4GCVA 2FNPA 1QGPA 5A2QK 4PCQA 2IJLA 1SMTA 1YG2A 1ZLKA 2COMA 5ILUA 3QRFF 1FBUA 2Z9OA 2E1CA 1J2XA 2LKPA 1SFUA 4ZYGA 3K1PA 5FGMA 2ZMEA 4EM2A 2P7CB 2MD5A 1R5GA 4KMUX 1FC3A 5LEKA 3E97A 3HRSA 4CZZA 3TQNA 3BY6A 1KGSA 4HLYA 2GQQA 4I0AA 1TW2A 2OZ6A 4YFKF 4L5IA 3JSPA 2HTJA 1ZRDA 1KU9A 3V4GA 4CICA 3O2PE 2VC1A 2PBIA 4Q5SF 3F22A 3HRMA 3FM5A 4GYIA 4HZFA 1KQ9A 4RGXA 1G3TA 3HSFA 3COAC 3J81K 1XMKA 3KP5A 3N4MA 4U88A 1WKMA 1IN4A 1OYWA 2A6HF 2V1XA 3WTTC 4HOBA 2CW0F 4D0PA 1U8RA 2VONA 2QENA 4A0YA 1QQIA 3ABUA 2XKPA 3IRRA 5F6FA 1BC7C 2QBYB 2KIFA 1T6SA 1BI0A 1T38A 3CUOA 3HSRA 4OIOF 4IHTA 2BEOA 1QPMA 2K86A 2IA1A 5L3CA 3N97A 4ESJA 4M74A 1BC8C 1W4MA 3EYIA 3LA3A 2DK5A 2L01A 1DDNA 1Z6RA 4LB6B 1RUOA 4OOIA 2GXBA 1VTNC 1S29A 3CTAA 2VODA 1F5TA 2O03A 3D5LA 1FPQA 4CDGA 3GYHX 3C18A 3LSTA 1YW8A 2F5DA 1A04A 2KKOA 5L3EA 3IC7A 3SQNA 2A3SA 4RAYA 3TKYA 1Z1DA 3BOQA 5CYVA 3WU0A 2PJPA 1ON2A 2PG4A 1XGNA 2QWWA 4IHSA 3MZYA 2ZBKA 1XGOA 2Q0OA 3V7RA 4ZZLA 3I59B 3KE2A 2X0LA 4HV5A 4M72A 5LGNA 3CO7C 3H3UA 2PI0A 5DCFA 2Y48A 2W25A 2H6CA 4LLGF 5FLXK 1W5TA 5E1WA 3ZMZA 3KP3A 2GZWA 5FFZA 4RB1A 2P8TA 3S2WA 4MNUA 2J5OA 3MQ0A 5DEQA 2E7XA 3R60A 3WGIA 3KFWX 1O3QA 1JHFA 1T0FA 3FX3A 4XBFA 2UXXA 2VE8A 1XSDA 4A2UA 2DFIA 1JXSA 1REPC 3F8CA 2DK8A 1MJ9A 2VBXA 4HF1A 2H09A 3WG9A 4AVPA 4HF2A 2Y0MA 5E18F 2R3SA 1ON1A 1T39A 1J0RA 2NYXA 3M8EA 3WE3A 5J8CA 4UUVA 2FQ3A 1U5TC 1TQIA 4FX4A 3GO5A 4KA4A 2W24A 1P4WA 4EGZA 2KJCA 3KP4A 4P5OA 2PMHA 5ICGA 5HS7A 3V8LA 5TRDA 5LHGA 3F21A 3K1NA 5F64A 3R4KA 3DF8A 4GXOA 1U5TA 1K7AA 1E2XA 4RB3C 4M6XA 2D2WA 3EETA 1QNTA 5IT9Z 2OU2A 3ZN0A 2M30A 3I0TA 1ZRCA 3U1DA 2F2EA 3BJOA 1OYIA 3F8MA 2M5WA 5HLGA 3FMQA 3GFMA 4CHUA 4N0BA 2K4BA 2V1UA 1WQ2A 2BYVE 1LEBA 1S6LA 4P96A 2PMUA 2EV6A 3K9TA 3IL2A 2E1NA 3KEOA 1F9NA 4Y13A 4Y17A 5ILSA 4Q48A 1FYMA 3J80K 2VBYA 4L9VA 2QYOA 2PQ8A 1OKRA 3ISPA 1WRJA 4KDPA 3GW2A 3FMRA 4EQQA 3KETA 1WWXA 1I1GA 5FO5A 3K1MA 4RB2C 1SD6A 5CVVA 3WU1B 5BOXA 5LHIA 3GX4X 2FMLA 4O6JA 3I71A 2A5YB 4LMYA 3WODF 2W84A 2PEXA 2XAHA 2ZXJA 2B0LA 3JTHA 2WV0A 1IRFA 1L0OC 3PQJA 4MTDA 2STWA 2QLZA 4PDKA 3TO6A 1RI7A 1U2WA 1BJAA 1B4AA 2O0YA 2K02A 3ECHA 3HRTA 4ENNA 1NHAA 3ECOA 4AIJA 1TQMA 1B9NA 4HX7A 1HQCA 3KZZA 4GYGA 1G4DA 4A12A 1LEAA 4HLXA 2DBBA 5H6RA 4GO1A 2HS5A 2ACJA 2K7LA 3FMSA 4TV7A 5HDKA 1BN5A 3F72A 4Q4ZF 3T8TA 2XAJA 3TGNA 1MDMA 4OIQF 3DKWA 2XASA 3R61A 2FF4A 2ELHA 4MTEA 3MWMA 2R7FA 5AONA 1FP2A 5LEJA 1GXQA 1Y0UA 1S8NA 1I1SA 4UV8A 3MAJA 1ODDA 1O3RA 1QZZA 4Y15A 3HSEA 1F1ZA 4YG2F 4P9FA 2V79A 3JAMK 4AIKA 2ESHA 4ZH4F 2HR3A 3WTVC 1IF1A 3T0YA 3BJ6A 1JGSA 2O6GE 5JHUA 4KMFA 3OV8A 3ZMUA 2P6TA 2IT0A 4OIPF 4HBLA 1XSXA 3ERED 5E20A 2FBKA 5FB2A 3O6BB 2FSWA 4G7OF 3ZN1A 1D3YA 2FRHA 2BV6A 2OQGA 1ZARA 3ZQ7A 1D8KA 4G7HF 3IHUA 2WWYA 1UHWA 1ZHFA 5DV5A 1BIBA 4ESBA 5E1XA 2HDCA 4R8HA 2EA2A 3E6DA 3ZMSA 1IN7A 3V8JA 3DEUA 1LDDA 4KFCA 2ETHA 3C3WA 2KIMA 1XN7A 5J6XA 3DPLC 3HUGA 1YFHA 4M9SA 2KIUA 3BDDA 3WTXC 2FBHA 5KVRA 3RKYA 3KEQA 4HYEA 1W7PD 1OR7A 3HYIA 2NNNA 4NQWA 4UVAA 3WTSC 1R36A 3E6BA 4S05A 2VOOA 3AAFA 3W6KB 1V4RA 1P92A 2EJRA 4EM0B 3IWFA 1I5ZA 4EMSA 4CYDA 4YFXF 1HBXG 4OMZA 4LK0F 2EFWA 4WXHA 1G3YA 3ELKA 4DQ2A 3FM3A 5HS9A 5CVIA 3D0SA 4AIHA 2ZNYA 1HKQA 4BH9A 1YLFA 3CO6C 2FE3A 2PN6A 1FY7A 2RQPA 2HFHA 4WXCA 4WWCA 1ZLJA 1JE8A 4LD5A 2OBPA 3L09A 1LDKB 1HKSA 1O3TA 5HDGA 4LLLA 2GIVA 2WC2A 5HOOA 5D6FA 2C6YA 2VC0A 2HQNA 1W5SA 1KU2A 5ILVA 5FFXA 2K27A 2YR2A 2UXNA 2A07F 1S7OA 2RC4A 2YU3A 2DI3A 2FA5A 1J75A 3I4PA 4B09A 3LFKA 1ZGJA 5EEHA 1BM9A 1IN8A 3P9IA 2DPDA 3BPVA 2VN2A 3LA2A 2BBYA 4O3MA 1ONVA 4I2OA 3BZ6A 1ZG5A 4I7HA 4U7DA 2IW5A 4R1HA 1IN5A 4IXAA 4G8XA 4WCGA 1U5TB 5E17F 1G3SA 3J7AO 2HOEA 1PDNC 4RAZA 1AOYA 1K6OA 1FP1D 1T2KA 1Z6TA 2DPUA 3I54A 3CDHA 4BAYA 3BWGA 3PFIA 5FLXZ 3EYYA 3U9GA 3IKVA 3P9KA 2GAUA 1HSJA 1K78B 2ADUA 2ISZA 4ENKA 2TDXA 4U0VA 3WTWC 1USTA 4ETSA 3SXYA 2QUFA 2XVCA 3VEPA 2V1DA 2Q2EA 5LBQA 4P55A 3FZVA 1YO5C 4ENJA 4UHTA 5K5OA 4PGGA 1Z9CA 5EEGA 4H0EA 4QLCU 2EWNA 3ROUA 2XRNA 4OU0A 3BP8A 5JFRA 1KYWA 5K1YA 1ZGAA 2L54A 4IJAA 1DUXC 1K79A 1XCVA 4S04A 4EJTA 5D4SA 3H3ZA 1TBXA 2ESNA 4ON0A 3I64A 4O5VA 3DQVC 2QVOA 2HEOA 1OPCA 4UXNA 2Q8KA 3K2ZA 3ABTA 4A0XA 4UVCA 2Z33A 3H92A 3VB2A 3P9CA 1P2FA 1SAXA 3TO9A 4KIFA 4EJWA 2YSRA 5CJ9A 3TDUC 5H20A 2P5VA 5E8GA 1BI3A 1FOKA 5D5XB 1GXPA 2CYYA 3TOBA 1R22A 3L9FA 2M1BA 2RV8A 4L18B 1H9TA 4FX0A 4UV9A 2XAFA 2AXLA 3QP6A 4OMYA 2E7WA 5HS8A 1MDMB 3QPHA 1WSUA 2O8XA 1B1BA 1XGMA 5H6QA 2CQKA 1LQ1A 1EH7A 2VBWA 2AS5F 5KK1A 5DCMA 1HW2A 1YS6A 2ISYA 5CVUA 5D6EA 2YX7A 2LNBA 3TDZC 3KP2A 4NB5A 1QO0D 3QU6A 2PLYA 3LAJA 1XDUA 3KZYA 3WTZA 4KYWA 2W85A 4BYYA 3QOPA 4EV0A 3ULQB 3DV8A 4YIFA 1TTYA 2UWMA 2FNAA 3GEZA 4F7ZA 1V3FA 2DQLA 1SFXA 3GXOA 5D5WB 5D8LB 3TOAA 1USSA 1S7AA 2F5CA 4ZZDA 1K78A 4P9UA 1YW7A 1R23A 2GWRA 2CO5A 5LGUA 1XCBA 4M9ZA 5FD6A 4U0YA 3HHGA 2OZUA 1MKMA 5F1RA 3LAPA 2QM3A 2IVMA 4EM1A 4Q47A 1WI9A 3BROA 2W57A 3RPUA 4ENMA 2DAOA 5L3BA 2EV0A 1ULYA 5AIQA 1Z91A 1BIAA 2D1VA 4G94A 3OOPA 2EV5A 3FXQA 2HWVA 5HLIA 4KIBA 1W7PA 4HF0A 4KNYA 1G3WA 1T98A 3DPTA 2EK5A 3V7CA 3WE2A 2PFBA 2XGXA 1ZYRF 1RZ4A 1XDSA 3ML6A 1J5YA 1R1UA 1JHHA 5DD4A 5IT9K 1PP8F 1FT9A 4L9TA 5LRRA 4G6DA 4U7BA 4HX8A 1QZYA 1BOAA 4KT5C 2RGVA 4IVNA 4I09A 4I98B 2XV4S 3RPQA 3DFGA 5D5UB 2EA4A 3F6OA 3GF2A 1R00A 5E1ZB 2FMYA 5L3DA 4M71A 2A61A 2XKOA 1KQ8A 1CF7B 2CG4A 4EJUA 2M45A 5TJJA 4PZJA 2R7DA 2BGCA 5ICEA 2CGPA 3GZ6A 4LG0A 1IAWA 2Z3YA 3M9AA 3WTYC 2J5PA 3PQKA 2OA4A 1YW9A 4ASNA 2LDUA 2VOPA 4G9YA 1P4XA 1IZ1A 3SZTA 5K5QA 1IW7F 4EJVA 2QQBA 2RVCA 3KLOA 4LFUA 4MHGA 2L02A 3K0LA 5A2QZ 4EVIA 2P4WA 3GFJA 3ZMDA 2NRAC 1R1VA 1O7FA 3VFZA 3GVAA 3GLXA 1Q1HA 4A6DA 2EFQA 2QQ9A 4M6YA 5FD5A 4MEXF 4UVBA 1MJAA 3K69A 5CVRA 2UZKA 4KICA 2RNJA 4RGRA 3E5XA 3RDIA 3JSOA 4M9XA 4L0YB 4IRGA 3MFKA 3C1DA 1AWCA 2CWEA 3CUQC 1I27A 4A6EA 1IUYA 4CGZA 4FT8A 4MQVA 5LLQA 4ESFA 3F3XA 4WF2A 3GZ5A 2G7HA 4N9IA 4ZYEA 3KP6A 2FBIA 1FZPB 3CUQA 1PP7U 4IF4A 3J81Z 3LA7A 3MEXA 3HTSB 3L00A 2XIGA 1XMAA 3EQLF 2D1HA 4WXDA 1RUNA 2MA3A 4KN7X 3V8KA 1LB2A 2P6SA 5E8IA 4BHBA 3HHHA 2NNYA 2EFOA 4BNCA 1Z05A 3KCCA 2MLGA 2L4AA 5LHHA 3M7GA 2RDPA 5K5RA 3RTRA 2VBZA 2RN7A 2D45A 4CO8A 4IPAA 1EV7A 1MGTA 2CFXA 2IA0A 4RGSA 1TLHB 2XUBA 3RYPA 1P6RA 4FHTA 3L2CA 2MLKA 2VXZA 1CF7A 1R7JA 3I58A 2L4MA 2OQRA 4G7ZF 4EGYA 2HGCA 4HDVA 1FLIA 2XHKA 1FYLA 2IPQX 2NAZA 2ZCWA 1STZA 2JPCA 1IXSB 3NRVA 3RI4A 4ZYDA 1Z7UA 1ZAOA 1HSTA 5L3GA 5JR3A 2F5EA 4RS8A 1XD7A 5DCMB 3RKWA 2LF7A 3DXJF 5HDNA 4K2EA 2H27A 1RNLA 4JBAA 1UFMA 1FWZA 2JRTA 2O61A 1KQ0A 2A68F 3RYRA 1B9MA 2IA2A 4IRIA 3B73A 2VE9A 1YYVA 2A6EF 3JW4A 5IT3A 1SD5A 1OMIA 2EFPA 2G9WA 5D8KB 3FHZA 4LLNA 3CJNA 3G73A 3FXUA 2HZTA 3T5XA 1EH8A 1SMYF 3Q9VA 4HA8A 1O3SA 4WX9A 3VODA 4YIIA 3SZPA 2KJBA 1J7KA 1U6GA 4PGHA 2GA1A 5DYMA 2XROA 1R1TA 1SD7A 3Q9SA 3F8FA 4OINF 4KN4X 3WGGA 1YQAA 2VT2A 1U3EM 1UCRA 4G6QA 3ZMVA 2DTRA 3G3ZA 3E6MA 3ZMTA 3FWEA 2MBFA 3R0JA 4EJOA 3F8NA 1W7PB 1KU7A 2XAGA 3EDPA 3LQQA 4L5JA 2FXAA 3RJPA 4HX4A 3RKXA 2HYFA 2M87A 4LGWA 2JZYA 1MZBA 3GFLA 3NQOA 3F6VA 3TO7A 1H9GA 3F8BA 1LVAA 3FF5A 5LGTA 3R6SA 2ZFWA 5CLSA 4A0ZA 2MC3A 1TNTA 2ZJ2A 4I01A 1FNNA 3L7WA 1D8JA 2JSCA 3DP7A 4N9HA 4L0ZB 3HIFA 5J8FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFI A;  2CSO A;  4KIG A;  1HW1 A;  2JT1 A;  1ZRF A;  5HLH A;  2FU4 A;  2Z5U A;  2EFN A;  2L3D A;  4BHP A;  4GGG A;  4A5N A;  4LG0 B;  3R0A A;  2F5F A;  2IP2 A;  2H6B A;  2NS0 A;  4HAM A;  1O7L A;  4RB0 A;  3J80 Z;  1X3U A;  2ZKZ A;  4I02 A;  1MD0 A;  3W6J B;  2EB7 A;  4Z2Y A;  3HTU A;  4DNC A;  3QP5 A;  4XRF A;  2G7U A;  3GWZ A;  6PAX A;  3CLO A;  5DUI A;  1TQP A;  4AD9 A;  3P7N A;  1MJB A;  3F23 A;  4BQA A;  2VT3 A;  4U0W A;  1KA8 A;  2DLL A;  4L9J A;  5DDG A;  3HOS A;  5ICC A;  2ZNZ A;  1YS7 A;  1F4K A;  3I53 A;  5BPI A;  4MQ9 F;  2HTS A;  1FBS A;  1KYZ A;  5AIP A;  3M8F A;  3T1B A;  3E3V A;  4I0B A;  2XAQ A;  2QBY A;  3T8R A;  1R5H A;  3EUH A;  4HDU A;  1OYY A;  4XSX F;  3LQR A;  2YX4 A;  1XGS A;  2QZ8 A;  5D5V B;  2LSO A;  3Q5F A;  1TW3 A;  1ZH5 A;  1HW5 A;  1P4A A;  5HVQ C;  5DD8 A;  2GA2 A;  1DPR A;  1L3L A;  2HKO A;  1LNW A;  2DT5 A;  1TNS A;  4R79 A;  3KLN A;  2X4H A;  2O3F A;  2FEZ A;  4LJZ F;  4B8X A;  2JTV A;  1IN6 A;  4XLP F;  2DW4 A;  3M1E A;  3LWF A;  5ERI A;  3I5U A;  4BXU A;  3KP7 A;  3NEU A;  1BI2 A;  1YTY A;  2OD5 A;  3B02 A;  5LRS A;  3IWZ A;  3QPT A;  1G6N A;  3RIR A;  2P5L C;  3IRQ A;  2HQR A;  3CUQ B;  1ZN2 A;  2RKH A;  4NHJ A;  3MCZ A;  3BJA A;  3FXR A;  3E5Q A;  3HOT A;  2LF8 A;  1IRG A;  1FBQ A;  2V6C A;  3I59 A;  4QWQ A;  1HXD A;  3IKT A;  1J9I A;  4E70 A;  3WGH A;  5DUK A;  3QU3 A;  1DP7 P;  3ZP5 A;  4RGU A;  4HV6 A;  3JAM Z;  1RIO H;  5BS6 A;  5JVT A;  2ZME B;  4L9N A;  1XSV A;  1LJ9 A;  1SD4 A;  4CXF A;  2BE5 F;  3ZPL A;  1GHC A;  3HRU A;  4JQF A;  2DU9 A;  1QBJ A;  1PUE E;  4OIR F;  3GUD A;  5BPD A;  4XLN F;  3O3K A;  4ZYH A;  1E17 A;  4M73 A;  5BQT A;  4JK1 X;  2Y75 A;  1HKT A;  3VOE A;  1U78 A;  1FSE A;  1YIO A;  4A5M A;  3C7J A;  3WTU C;  3QAH A;  2JPB A;  5ED4 A;  1FX7 A;  2FOK A;  1XB4 A;  1ZG3 A;  4BHC A;  1H0M A;  2DQR A;  3SFZ A;  4MEY F;  4WK8 F;  2GXG A;  1FSH A;  3E6C C;  1B59 A;  1KU3 A;  4HQM A;  2HYG D;  1UB9 A;  5ICF A;  4LB5 A;  2QQA A;  3U2R A;  1EH6 A;  2KRF A;  1B6A A;  3BPX A;  2H94 A;  3JTG A;  2V9V A;  4AWX B;  1I6X A;  1BI1 A;  1ZG1 A;  2MH9 A;  3REO A;  4KUM A;  5CVJ A;  1D5V A;  1O57 A;  3MZH A;  2HKX A;  5D4R A;  1DPU A;  1J59 A;  5JI6 A;  2YPR A;  1IXC A;  4YFN F;  1GVJ A;  2P5K A;  2WTE A;  4UNO A;  1CGP A;  1FYK A;  4IRH A;  3V7S A;  1S3J A;  4XSZ F;  1SFE A;  2DO7 A;  1R58 A;  1UHM A;  4LK1 F;  3E5U A;  4HW0 A;  4MGR A;  2M8E A;  2STT A;  2A69 F;  2OAZ A;  2MH2 A;  5L3F A;  1C0W A;  5BMZ A;  4HQE A;  1BBY A;  1ZRE A;  2K4J A;  2P7V B;  1LDJ A;  2IRF G;  2Z99 A;  2ZO4 A;  3SHF A;  1IXR C;  4GCV A;  2FNP A;  1QGP A;  5A2Q K;  4PCQ A;  2IJL A;  1SMT A;  1YG2 A;  1ZLK A;  2COM A;  5ILU A;  3QRF F;  1FBU A;  2Z9O A;  2E1C A;  1J2X A;  2LKP A;  1SFU A;  4ZYG A;  3K1P A;  5FGM A;  2ZME A;  4EM2 A;  2P7C B;  2MD5 A;  1R5G A;  4KMU X;  1FC3 A;  5LEK A;  3E97 A;  3HRS A;  4CZZ A;  3TQN A;  3BY6 A;  1KGS A;  4HLY A;  2GQQ A;  4I0A A;  1TW2 A;  2OZ6 A;  4YFK F;  4L5I A;  3JSP A;  2HTJ A;  1ZRD A;  1KU9 A;  3V4G A;  4CIC A;  3O2P E;  2VC1 A;  2PBI A;  4Q5S F;  3F22 A;  3HRM A;  3FM5 A;  4GYI A;  4HZF A;  1KQ9 A;  4RGX A;  1G3T A;  3HSF A;  3COA C;  3J81 K;  1XMK A;  3KP5 A;  3N4M A;  4U88 A;  1WKM A;  1IN4 A;  1OYW A;  2A6H F;  2V1X A;  3WTT C;  4HOB A;  2CW0 F;  4D0P A;  1U8R A;  2VON A;  2QEN A;  4A0Y A;  1QQI A;  3ABU A;  2XKP A;  3IRR A;  5F6F A;  1BC7 C;  2QBY B;  2KIF A;  1T6S A;  1BI0 A;  1T38 A;  3CUO A;  3HSR A;  4OIO F;  4IHT A;  2BEO A;  1QPM A;  2K86 A;  2IA1 A;  5L3C A;  3N97 A;  4ESJ A;  4M74 A;  1BC8 C;  1W4M A;  3EYI A;  3LA3 A;  2DK5 A;  2L01 A;  1DDN A;  1Z6R A;  4LB6 B;  1RUO A;  4OOI A;  2GXB A;  1VTN C;  1S29 A;  3CTA A;  2VOD A;  1F5T A;  2O03 A;  3D5L A;  1FPQ A;  4CDG A;  3GYH X;  3C18 A;  3LST A;  1YW8 A;  2F5D A;  1A04 A;  2KKO A;  5L3E A;  3IC7 A;  3SQN A;  2A3S A;  4RAY A;  3TKY A;  1Z1D A;  3BOQ A;  5CYV A;  3WU0 A;  2PJP A;  1ON2 A;  2PG4 A;  1XGN A;  2QWW A;  4IHS A;  3MZY A;  2ZBK A;  1XGO A;  2Q0O A;  3V7R A;  4ZZL A;  3I59 B;  3KE2 A;  2X0L A;  4HV5 A;  4M72 A;  5LGN A;  3CO7 C;  3H3U A;  2PI0 A;  5DCF A;  2Y48 A;  2W25 A;  2H6C A;  4LLG F;  5FLX K;  1W5T A;  5E1W A;  3ZMZ A;  3KP3 A;  2GZW A;  5FFZ A;  4RB1 A;  2P8T A;  3S2W A;  4MNU A;  2J5O A;  3MQ0 A;  5DEQ A;  2E7X A;  3R60 A;  3WGI A;  3KFW X;  1O3Q A;  1JHF A;  1T0F A;  3FX3 A;  4XBF A;  2UXX A;  2VE8 A;  1XSD A;  4A2U A;  2DFI A;  1JXS A;  1REP C;  3F8C A;  2DK8 A;  1MJ9 A;  2VBX A;  4HF1 A;  2H09 A;  3WG9 A;  4AVP A;  4HF2 A;  2Y0M A;  5E18 F;  2R3S A;  1ON1 A;  1T39 A;  1J0R A;  2NYX A;  3M8E A;  3WE3 A;  5J8C A;  4UUV A;  2FQ3 A;  1U5T C;  1TQI A;  4FX4 A;  3GO5 A;  4KA4 A;  2W24 A;  1P4W A;  4EGZ A;  2KJC A;  3KP4 A;  4P5O A;  2PMH A;  5ICG A;  5HS7 A;  3V8L A;  5TRD A;  5LHG A;  3F21 A;  3K1N A;  5F64 A;  3R4K A;  3DF8 A;  4GXO A;  1U5T A;  1K7A A;  1E2X A;  4RB3 C;  4M6X A;  2D2W A;  3EET A;  1QNT A;  5IT9 Z;  2OU2 A;  3ZN0 A;  2M30 A;  3I0T A;  1ZRC A;  3U1D A;  2F2E A;  3BJO A;  1OYI A;  3F8M A;  2M5W A;  5HLG A;  3FMQ A;  3GFM A;  4CHU A;  4N0B A;  2K4B A;  2V1U A;  1WQ2 A;  2BYV E;  1LEB A;  1S6L A;  4P96 A;  2PMU A;  2EV6 A;  3K9T A;  3IL2 A;  2E1N A;  3KEO A;  1F9N A;  4Y13 A;  4Y17 A;  5ILS A;  4Q48 A;  1FYM A;  3J80 K;  2VBY A;  4L9V A;  2QYO A;  2PQ8 A;  1OKR A;  3ISP A;  1WRJ A;  4KDP A;  3GW2 A;  3FMR A;  4EQQ A;  3KET A;  1WWX A;  1I1G A;  5FO5 A;  3K1M A;  4RB2 C;  1SD6 A;  5CVV A;  3WU1 B;  5BOX A;  5LHI A;  3GX4 X;  2FML A;  4O6J A;  3I71 A;  2A5Y B;  4LMY A;  3WOD F;  2W84 A;  2PEX A;  2XAH A;  2ZXJ A;  2B0L A;  3JTH A;  2WV0 A;  1IRF A;  1L0O C;  3PQJ A;  4MTD A;  2STW A;  2QLZ A;  4PDK A;  3TO6 A;  1RI7 A;  1U2W A;  1BJA A;  1B4A A;  2O0Y A;  2K02 A;  3ECH A;  3HRT A;  4ENN A;  1NHA A;  3ECO A;  4AIJ A;  1TQM A;  1B9N A;  4HX7 A;  1HQC A;  3KZZ A;  4GYG A;  1G4D A;  4A12 A;  1LEA A;  4HLX A;  2DBB A;  5H6R A;  4GO1 A;  2HS5 A;  2ACJ A;  2K7L A;  3FMS A;  4TV7 A;  5HDK A;  1BN5 A;  3F72 A;  4Q4Z F;  3T8T A;  2XAJ A;  3TGN A;  1MDM A;  4OIQ F;  3DKW A;  2XAS A;  3R61 A;  2FF4 A;  2ELH A;  4MTE A;  3MWM A;  2R7F A;  5AON A;  1FP2 A;  5LEJ A;  1GXQ A;  1Y0U A;  1S8N A;  1I1S A;  4UV8 A;  3MAJ A;  1ODD A;  1O3R A;  1QZZ A;  4Y15 A;  3HSE A;  1F1Z A;  4YG2 F;  4P9F A;  2V79 A;  3JAM K;  4AIK A;  2ESH A;  4ZH4 F;  2HR3 A;  3WTV C;  1IF1 A;  3T0Y A;  3BJ6 A;  1JGS A;  2O6G E;  5JHU A;  4KMF A;  3OV8 A;  3ZMU A;  2P6T A;  2IT0 A;  4OIP F;  4HBL A;  1XSX A;  3ERE D;  5E20 A;  2FBK A;  5FB2 A;  3O6B B;  2FSW A;  4G7O F;  3ZN1 A;  1D3Y A;  2FRH A;  2BV6 A;  2OQG A;  1ZAR A;  3ZQ7 A;  1D8K A;  4G7H F;  3IHU A;  2WWY A;  1UHW A;  1ZHF A;  5DV5 A;  1BIB A;  4ESB A;  5E1X A;  2HDC A;  4R8H A;  2EA2 A;  3E6D A;  3ZMS A;  1IN7 A;  3V8J A;  3DEU A;  1LDD A;  4KFC A;  2ETH A;  3C3W A;  2KIM A;  1XN7 A;  5J6X A;  3DPL C;  3HUG A;  1YFH A;  4M9S A;  2KIU A;  3BDD A;  3WTX C;  2FBH A;  5KVR A;  3RKY A;  3KEQ A;  4HYE A;  1W7P D;  1OR7 A;  3HYI A;  2NNN A;  4NQW A;  4UVA A;  3WTS C;  1R36 A;  3E6B A;  4S05 A;  2VOO A;  3AAF A;  3W6K B;  1V4R A;  1P92 A;  2EJR A;  4EM0 B;  3IWF A;  1I5Z A;  4EMS A;  4CYD A;  4YFX F;  1HBX G;  4OMZ A;  4LK0 F;  2EFW A;  4WXH A;  1G3Y A;  3ELK A;  4DQ2 A;  3FM3 A;  5HS9 A;  5CVI A;  3D0S A;  4AIH A;  2ZNY A;  1HKQ A;  4BH9 A;  1YLF A;  3CO6 C;  2FE3 A;  2PN6 A;  1FY7 A;  2RQP A;  2HFH A;  4WXC A;  4WWC A;  1ZLJ A;  1JE8 A;  4LD5 A;  2OBP A;  3L09 A;  1LDK B;  1HKS A;  1O3T A;  5HDG A;  4LLL A;  2GIV A;  2WC2 A;  5HOO A;  5D6F A;  2C6Y A;  2VC0 A;  2HQN A;  1W5S A;  1KU2 A;  5ILV A;  5FFX A;  2K27 A;  2YR2 A;  2UXN A;  2A07 F;  1S7O A;  2RC4 A;  2YU3 A;  2DI3 A;  2FA5 A;  1J75 A;  3I4P A;  4B09 A;  3LFK A;  1ZGJ A;  5EEH A;  1BM9 A;  1IN8 A;  3P9I A;  2DPD A;  3BPV A;  2VN2 A;  3LA2 A;  2BBY A;  4O3M A;  1ONV A;  4I2O A;  3BZ6 A;  1ZG5 A;  4I7H A;  4U7D A;  2IW5 A;  4R1H A;  1IN5 A;  4IXA A;  4G8X A;  4WCG A;  1U5T B;  5E17 F;  1G3S A;  3J7A O;  2HOE A;  1PDN C;  4RAZ A;  1AOY A;  1K6O A;  1FP1 D;  1T2K A;  1Z6T A;  2DPU A;  3I54 A;  3CDH A;  4BAY A;  3BWG A;  3PFI A;  5FLX Z;  3EYY A;  3U9G A;  3IKV A;  3P9K A;  2GAU A;  1HSJ A;  1K78 B;  2ADU A;  2ISZ A;  4ENK A;  2TDX A;  4U0V A;  3WTW C;  1UST A;  4ETS A;  3SXY A;  2QUF A;  2XVC A;  3VEP A;  2V1D A;  2Q2E A;  5LBQ A;  4P55 A;  3FZV A;  1YO5 C;  4ENJ A;  4UHT A;  5K5O A;  4PGG A;  1Z9C A;  5EEG A;  4H0E A;  4QLC U;  2EWN A;  3ROU A;  2XRN A;  4OU0 A;  3BP8 A;  5JFR A;  1KYW A;  5K1Y A;  1ZGA A;  2L54 A;  4IJA A;  1DUX C;  1K79 A;  1XCV A;  4S04 A;  4EJT A;  5D4S A;  3H3Z A;  1TBX A;  2ESN A;  4ON0 A;  3I64 A;  4O5V A;  3DQV C;  2QVO A;  2HEO A;  1OPC A;  4UXN A;  2Q8K A;  3K2Z A;  3ABT A;  4A0X A;  4UVC A;  2Z33 A;  3H92 A;  3VB2 A;  3P9C A;  1P2F A;  1SAX A;  3TO9 A;  4KIF A;  4EJW A;  2YSR A;  5CJ9 A;  3TDU C;  5H20 A;  2P5V A;  5E8G A;  1BI3 A;  1FOK A;  5D5X B;  1GXP A;  2CYY A;  3TOB A;  1R22 A;  3L9F A;  2M1B A;  2RV8 A;  4L18 B;  1H9T A;  4FX0 A;  4UV9 A;  2XAF A;  2AXL A;  3QP6 A;  4OMY A;  2E7W A;  5HS8 A;  1MDM B;  3QPH A;  1WSU A;  2O8X A;  1B1B A;  1XGM A;  5H6Q A;  2CQK A;  1LQ1 A;  1EH7 A;  2VBW A;  2AS5 F;  5KK1 A;  5DCM A;  1HW2 A;  1YS6 A;  2ISY A;  5CVU A;  5D6E A;  2YX7 A;  2LNB A;  3TDZ C;  3KP2 A;  4NB5 A;  1QO0 D;  3QU6 A;  2PLY A;  3LAJ A;  1XDU A;  3KZY A;  3WTZ A;  4KYW A;  2W85 A;  4BYY A;  3QOP A;  4EV0 A;  3ULQ B;  3DV8 A;  4YIF A;  1TTY A;  2UWM A;  2FNA A;  3GEZ A;  4F7Z A;  1V3F A;  2DQL A;  1SFX A;  3GXO A;  5D5W B;  5D8L B;  3TOA A;  1USS A;  1S7A A;  2F5C A;  4ZZD A;  1K78 A;  4P9U A;  1YW7 A;  1R23 A;  2GWR A;  2CO5 A;  5LGU A;  1XCB A;  4M9Z A;  5FD6 A;  4U0Y A;  3HHG A;  2OZU A;  1MKM A;  5F1R A;  3LAP A;  2QM3 A;  2IVM A;  4EM1 A;  4Q47 A;  1WI9 A;  3BRO A;  2W57 A;  3RPU A;  4ENM A;  2DAO A;  5L3B A;  2EV0 A;  1ULY A;  5AIQ A;  1Z91 A;  1BIA A;  2D1V A;  4G94 A;  3OOP A;  2EV5 A;  3FXQ A;  2HWV A;  5HLI A;  4KIB A;  1W7P A;  4HF0 A;  4KNY A;  1G3W A;  1T98 A;  3DPT A;  2EK5 A;  3V7C A;  3WE2 A;  2PFB A;  2XGX A;  1ZYR F;  1RZ4 A;  1XDS A;  3ML6 A;  1J5Y A;  1R1U A;  1JHH A;  5DD4 A;  5IT9 K;  1PP8 F;  1FT9 A;  4L9T A;  5LRR A;  4G6D A;  4U7B A;  4HX8 A;  1QZY A;  1BOA A;  4KT5 C;  2RGV A;  4IVN A;  4I09 A;  4I98 B;  2XV4 S;  3RPQ A;  3DFG A;  5D5U B;  2EA4 A;  3F6O A;  3GF2 A;  1R00 A;  5E1Z B;  2FMY A;  5L3D A;  4M71 A;  2A61 A;  2XKO A;  1KQ8 A;  1CF7 B;  2CG4 A;  4EJU A;  2M45 A;  5TJJ A;  4PZJ A;  2R7D A;  2BGC A;  5ICE A;  2CGP A;  3GZ6 A;  4LG0 A;  1IAW A;  2Z3Y A;  3M9A A;  3WTY C;  2J5P A;  3PQK A;  2OA4 A;  1YW9 A;  4ASN A;  2LDU A;  2VOP A;  4G9Y A;  1P4X A;  1IZ1 A;  3SZT A;  5K5Q A;  1IW7 F;  4EJV A;  2QQB A;  2RVC A;  3KLO A;  4LFU A;  4MHG A;  2L02 A;  3K0L A;  5A2Q Z;  4EVI A;  2P4W A;  3GFJ A;  3ZMD A;  2NRA C;  1R1V A;  1O7F A;  3VFZ A;  3GVA A;  3GLX A;  1Q1H A;  4A6D A;  2EFQ A;  2QQ9 A;  4M6Y A;  5FD5 A;  4MEX F;  4UVB A;  1MJA A;  3K69 A;  5CVR A;  2UZK A;  4KIC A;  2RNJ A;  4RGR A;  3E5X A;  3RDI A;  3JSO A;  4M9X A;  4L0Y B;  4IRG A;  3MFK A;  3C1D A;  1AWC A;  2CWE A;  3CUQ C;  1I27 A;  4A6E A;  1IUY A;  4CGZ A;  4FT8 A;  4MQV A;  5LLQ A;  4ESF A;  3F3X A;  4WF2 A;  3GZ5 A;  2G7H A;  4N9I A;  4ZYE A;  3KP6 A;  2FBI A;  1FZP B;  3CUQ A;  1PP7 U;  4IF4 A;  3J81 Z;  3LA7 A;  3MEX A;  3HTS B;  3L00 A;  2XIG A;  1XMA A;  3EQL F;  2D1H A;  4WXD A;  1RUN A;  2MA3 A;  4KN7 X;  3V8K A;  1LB2 A;  2P6S A;  5E8I A;  4BHB A;  3HHH A;  2NNY A;  2EFO A;  4BNC A;  1Z05 A;  3KCC A;  2MLG A;  2L4A A;  5LHH A;  3M7G A;  2RDP A;  5K5R A;  3RTR A;  2VBZ A;  2RN7 A;  2D45 A;  4CO8 A;  4IPA A;  1EV7 A;  1MGT A;  2CFX A;  2IA0 A;  4RGS A;  1TLH B;  2XUB A;  3RYP A;  1P6R A;  4FHT A;  3L2C A;  2MLK A;  2VXZ A;  1CF7 A;  1R7J A;  3I58 A;  2L4M A;  2OQR A;  4G7Z F;  4EGY A;  2HGC A;  4HDV A;  1FLI A;  2XHK A;  1FYL A;  2IPQ X;  2NAZ A;  2ZCW A;  1STZ A;  2JPC A;  1IXS B;  3NRV A;  3RI4 A;  4ZYD A;  1Z7U A;  1ZAO A;  1HST A;  5L3G A;  5JR3 A;  2F5E A;  4RS8 A;  1XD7 A;  5DCM B;  3RKW A;  2LF7 A;  3DXJ F;  5HDN A;  4K2E A;  2H27 A;  1RNL A;  4JBA A;  1UFM A;  1FWZ A;  2JRT A;  2O61 A;  1KQ0 A;  2A68 F;  3RYR A;  1B9M A;  2IA2 A;  4IRI A;  3B73 A;  2VE9 A;  1YYV A;  2A6E F;  3JW4 A;  5IT3 A;  1SD5 A;  1OMI A;  2EFP A;  2G9W A;  5D8K B;  3FHZ A;  4LLN A;  3CJN A;  3G73 A;  3FXU A;  2HZT A;  3T5X A;  1EH8 A;  1SMY F;  3Q9V A;  4HA8 A;  1O3S A;  4WX9 A;  3VOD A;  4YII A;  3SZP A;  2KJB A;  1J7K A;  1U6G A;  4PGH A;  2GA1 A;  5DYM A;  2XRO A;  1R1T A;  1SD7 A;  3Q9S A;  3F8F A;  4OIN F;  4KN4 X;  3WGG A;  1YQA A;  2VT2 A;  1U3E M;  1UCR A;  4G6Q A;  3ZMV A;  2DTR A;  3G3Z A;  3E6M A;  3ZMT A;  3FWE A;  2MBF A;  3R0J A;  4EJO A;  3F8N A;  1W7P B;  1KU7 A;  2XAG A;  3EDP A;  3LQQ A;  4L5J A;  2FXA A;  3RJP A;  4HX4 A;  3RKX A;  2HYF A;  2M87 A;  4LGW A;  2JZY A;  1MZB A;  3GFL A;  3NQO A;  3F6V A;  3TO7 A;  1H9G A;  3F8B A;  1LVA A;  3FF5 A;  5LGT A;  3R6S A;  2ZFW A;  5CLS A;  4A0Z A;  2MC3 A;  1TNT A;  2ZJ2 A;  4I01 A;  1FNN A;  3L7W A;  1D8J A;  2JSC A;  3DP7 A;  4N9H A;  4L0Z B;  3HIF A;  5J8F A; 
#chains in the Genus database with same CATH topology
 3MZ8 A;  2ME0 A;  2OPT A;  3GFI A;  2CSO A;  2ECC A;  2A6T A;  4KIG A;  1HW1 A;  3CCQ I;  3K10 A;  2JT1 A;  1FMV A;  1ZRF A;  4N4O B;  5FRN A;  5HLH A;  2WY8 Q;  2FU4 A;  2Z5U A;  2EFN A;  2R7Z J;  2L3D A;  1RPW A;  4BHP A;  4GGG A;  2R93 J;  4A5N A;  4LG0 B;  3R0A A;  3IUO A;  4FQG A;  1YJW I;  2F5F A;  1WH7 A;  3A01 B;  2HPM A;  2IP2 A;  2H6B A;  2NS0 A;  3BTC A;  1S72 I;  4HAM A;  4BQO A;  1O7L A;  4G12 A;  3NAR A;  3LL7 A;  1VQ6 I;  4RB0 A;  4XKW A;  2IS4 A;  1NTC A;  1BJZ A;  1OQY A;  3W2W A;  3J80 Z;  1X3U A;  4Y52 J;  2ZKZ A;  4I02 A;  1MD0 A;  3W6J B;  2EB7 A;  2JUG A;  4Z2Y A;  3HTU A;  4DNC A;  5J1Y A;  5E3L A;  5IP6 A;  3QP5 A;  4XRF A;  3EUH C;  2XSD C;  2G7U A;  3GWZ A;  6PAX A;  3CLO A;  5K7H A;  5DUI A;  1TQP A;  5F0F A;  4AD9 A;  3P7N A;  2VXD A;  3MVP A;  3J7Y J;  1MJB A;  4KT6 A;  3F23 A;  4BQA A;  2JJ7 A;  2VT3 A;  4MO7 A;  2IS2 A;  4U0W A;  1KA8 A;  1MSF C;  2DLL A;  2WY7 Q;  4L9J A;  5DDG A;  3HOS A;  5ICC A;  2ZNZ A;  2IEK A;  3FK7 A;  4M3D A;  1YS7 A;  3JCU C;  1F4K A;  2BZT A;  3H9G A;  3I53 A;  5BPI A;  2CV2 A;  4FE4 A;  1U0J A;  4MQ9 F;  5E3M A;  2CQN A;  2M7A A;  1K4T A;  2HTS A;  1FBS A;  1ZQ3 P;  1KYZ A;  5AIP A;  3M8F A;  3T1B A;  4DIQ A;  1A31 A;  3E3V A;  4I0B A;  2LMD A;  2XAQ A;  2QBY A;  1J09 A;  4M6V A;  3T8R A;  3BR3 A;  1R5H A;  3EUH A;  3OYN A;  1IDY A;  5B5E C;  3CJQ B;  4HDU A;  3LSH A;  1OYY A;  4XSX F;  3LQR A;  3OL4 A;  2CUZ A;  1O4X A;  2YX4 A;  1XGS A;  5M3F J;  2QZ8 A;  5D5V B;  2LSO A;  3Q5F A;  1TW3 A;  2GBY A;  1ZH5 A;  3UNG C;  4A3L J;  2X9D A;  1YIT I;  3GTO J;  2V9K A;  2K3F A;  4MFE A;  1HW5 A;  2HXO A;  1H8A C;  2GM4 A;  4FIS A;  1P4A A;  2JVH A;  5HVQ C;  2ZFU A;  2E71 A;  5DD8 A;  2GA2 A;  2Y2Z A;  1DPR A;  1L3L A;  2R7X A;  2HKO A;  1LNW A;  2DT5 A;  1TNS A;  2EZH A;  3X2Q H;  3KLN A;  2X4H A;  2O3F A;  4R79 A;  3FIW A;  2FEZ A;  2Y9Z A;  4LJZ F;  3MD2 A;  2CQX A;  4B8X A;  2JTV A;  3OYJ A;  1IN6 A;  2DMQ A;  4XLP F;  2FUG 2;  2DW4 A;  3M1E A;  3LWF A;  2VJ4 A;  3I5U A;  5ERI A;  4BXU A;  3KP7 A;  3D5S C;  3NEU A;  1BI2 A;  1YTY A;  1N75 A;  2OD5 A;  3B02 A;  2NOG A;  5LRS A;  3IWZ A;  1ITY A;  3QPT A;  1G6N A;  3RIR A;  3CME I;  2P5L C;  3QWL A;  3IRQ A;  1ETW A;  5TGT A;  1ZR4 A;  2HQR A;  2NVU B;  4W1U A;  4E7K A;  3CUQ B;  4RM2 A;  1ZN2 A;  2RKH A;  4NHJ A;  3MCZ A;  2KL4 A;  3BJA A;  3E5Q A;  2BHY A;  3FXR A;  3BG6 A;  2WV1 A;  3HOT A;  2B7E A;  2LF8 A;  1IRG A;  4XN3 A;  3EUA A;  1FBQ A;  3D5R C;  2V6C A;  3I59 A;  4QWQ A;  1HXD A;  3ZQQ A;  3IKT A;  3CCS I;  5M5Y J;  1I39 A;  2W1O A;  3VPR A;  1RR7 A;  1VQM I;  1J9I A;  5EZH A;  5DM6 F;  4J01 A;  2YUS A;  2L5Q A;  4E70 A;  5DS9 A;  3WGH A;  5DUK A;  1R5I D;  5IY5 H;  3QU3 A;  4S0H B;  3ZP5 A;  1DP7 P;  1XTA A;  4RGU A;  4HV6 A;  3PNV A;  3F0C A;  3JAM Z;  1RIO H;  5BS6 A;  1VQO I;  4IZZ A;  4EAT A;  5JVT A;  4J19 A;  4PFP A;  2ZME B;  4L9N A;  1SVM A;  1XSV A;  4KJZ A;  4DOZ A;  1RKW A;  1LJ9 A;  1SD4 A;  2BY1 A;  4CXF A;  1ETX A;  4DZJ A;  5JVG F;  4RA2 A;  4II2 A;  5HNH A;  2BE5 F;  2VIX A;  1VQ8 I;  3ZPL A;  1GHC A;  3HRU A;  4JQF A;  1HCR A;  2DU9 A;  1QBJ A;  1PUE E;  4OIR F;  4AID A;  3HZJ A;  3GUD A;  5BPD A;  4XLN F;  3O3K A;  3H36 A;  1T8I A;  2W82 A;  4ZYH A;  1E17 A;  1FOW A;  4M73 A;  4LIU A;  5BQT A;  1N77 A;  2XRL A;  4JK1 X;  2Y75 A;  3CJT B;  1HKT A;  3BG5 A;  1X3Z B;  3VOE A;  2VUM J;  4BKX A;  1U78 A;  1FSE A;  1YIO A;  4A5M A;  3C7J A;  3WTU C;  4B48 A;  3G2B A;  3QAH A;  2JPB A;  5ED4 A;  1FX7 A;  2FOK A;  2K9Q A;  3SEQ A;  1SFK A;  1XB4 A;  3DKY A;  1ZG3 A;  3B6C A;  2Y0S A;  4BHC A;  1H0M A;  2DQR A;  1GT0 C;  3WHC A;  1W0U A;  3GTJ J;  2JN6 A;  3SFZ A;  3GTM J;  4MEY F;  2WAQ A;  5J4Y A;  4WK8 F;  1W5C C;  4U87 A;  2DA5 A;  2GXG A;  4DW6 A;  1FSH A;  2CRG A;  3E6C C;  1B59 A;  1KU3 A;  2OCE A;  4HQM A;  2CMP A;  2HYG D;  1UB9 A;  3JRG A;  5ICF A;  4LB5 A;  2K85 A;  2QQA A;  2E1M C;  3U2R A;  1EH6 A;  3DKX A;  3BT9 A;  1FIP A;  2V9P A;  4PFO A;  3A1Y A;  1HDD C;  2KRF A;  2L7Z A;  3MKL A;  1B6A A;  2DOF A;  3BPX A;  2COB A;  3KEY A;  3QPS A;  3TL4 X;  1V5G A;  2H94 A;  3OR1 C;  1QRY A;  3JTG A;  2V9V A;  3G4S I;  1Y1W J;  1ENH A;  1R4M B;  3BC8 A;  4AWX B;  1I6X A;  1BI1 A;  4A3M J;  1ZG1 A;  2MH9 A;  3REO A;  2M4K A;  3H1C A;  2HYJ A;  4KUM A;  2EIM H;  5CPR B;  5CVJ A;  1D5V A;  2MAB A;  2F48 A;  1O57 A;  3MZH A;  1S7E A;  2HKX A;  5D4R A;  3IAS 2;  1DPU A;  2EIN H;  2DA3 A;  1J59 A;  5JI6 A;  2YPR A;  4L5E A;  1IXC A;  4PSX A;  3L2R A;  4HNV A;  4YFN F;  3NAU A;  1GVJ A;  3PM1 A;  5HLT A;  2P5K A;  2WTE A;  4UNO A;  2R7O A;  2WAQ N;  1CGP A;  1RES A;  3F9K A;  1FYK A;  4IRH A;  1FMW A;  3Q3S A;  2QEX I;  3V7S A;  2R7R A;  2X6X A;  1S3J A;  1YJ9 I;  1Z0X A;  4XSZ F;  1SFE A;  1R6R A;  1MBH A;  1R58 A;  2DO7 A;  1K6Y A;  3JR9 A;  1UHM A;  4AYB A;  3BG3 A;  4LK1 F;  3E5U A;  2R0Q C;  1IGN A;  4HW0 A;  2PMZ A;  2ELJ A;  3OMY A;  3OYI A;  3BZK A;  2JQ7 A;  4MGR A;  4A3D J;  4BE1 A;  2F4M B;  2X6Y A;  2M8E A;  2STT A;  4GRI A;  2A69 F;  2OAZ A;  2KT0 A;  2MH2 A;  2X85 A;  5L3F A;  1C0W A;  5F04 A;  5BMZ A;  4XM3 A;  2IGN A;  4HQE A;  1FOY A;  1VQL I;  3DEW A;  4V2F A;  2VKH A;  1BBY A;  1ZRE A;  1ETK A;  3K4M A;  2DOD A;  4P1W A;  2K4J A;  1TWF J;  2P7V B;  1X3W B;  3GBG A;  3PIP F;  2K9M A;  1LDJ A;  4D5C A;  1WGX A;  2ZB9 A;  1JJ6 C;  1JUM A;  3KYC B;  2OF7 A;  4QIW N;  2IRF G;  1YHQ I;  2VKD A;  2JMW A;  2Z99 A;  2ZO4 A;  3DBR B;  1EKE A;  3SHF A;  1IXR C;  2ZME C;  5GP9 A;  2KIS A;  1ETQ A;  4GCV A;  1TZL A;  4X0G A;  2FNP A;  3FDY A;  1QGP A;  1ETO A;  5A2Q K;  4PCQ A;  2IJL A;  1SMT A;  3K6G A;  1YG2 A;  1ZLK A;  2COM A;  2HVR A;  3VYS B;  3ZXS A;  3RSN A;  2HQA A;  3SDG A;  5ILU A;  3QRF F;  1LE8 B;  1FBU A;  1IDZ A;  2Z9O A;  2E1C A;  2VL8 A;  1J2X A;  2LKP A;  5J40 A;  3DU5 A;  4ZYG A;  3K1P A;  5FGM A;  3BQY A;  4BJ6 C;  2R5Z B;  1SFU A;  4NUB A;  2ZME A;  1WJA A;  4EM2 A;  3LOC A;  2XGC A;  1IO2 A;  2AXT C;  3FK6 A;  3G6E I;  3IH2 A;  2P7C B;  3O8H A;  1T08 B;  2HOA A;  2MD5 A;  2LKS A;  2WA0 A;  4B44 A;  1R5G A;  3JRA A;  3GTQ J;  4KMU X;  3CCY A;  3A0H C;  1FC3 A;  1WHU A;  5LEK A;  3G71 I;  4D9J A;  3E97 A;  3HRS A;  4CZZ A;  3S93 A;  3FXL A;  1OCP A;  4C30 A;  3TQN A;  3GTG J;  3BY6 A;  3WHB A;  1KGS A;  4F91 B;  4BL0 B;  4YRV A;  4HLY A;  2GQQ A;  4A3C J;  4A3J J;  5JLX A;  4I0A A;  1TW2 A;  2OZ6 A;  4YFK F;  3CMY A;  4L5I A;  1A5J A;  3JSP A;  2HTJ A;  3A03 A;  2HI3 A;  1ZRD A;  1KU9 A;  3V4G A;  4CIC A;  3O2P E;  2XB5 A;  3MMY B;  3GCM A;  2VC1 A;  3CCM I;  2PBI A;  4D5F A;  4Q5S F;  3F22 A;  3HRM A;  2ZSH B;  3FM5 A;  1M1E B;  4GYI A;  4HZF A;  1KQ9 A;  4RGX A;  1XS9 A;  4XOR A;  1G3T A;  2JSP A;  3HSF A;  3OIQ A;  1WFX A;  2BY2 A;  1A36 A;  4C3I J;  3COA C;  3ZRG A;  3J81 K;  1XMK A;  3KP5 A;  3N4M A;  4U88 A;  1WKM A;  2DT7 B;  1IN4 A;  2RRE A;  1OYW A;  2A6H F;  1IG7 A;  4HRI A;  3BR1 A;  1BW5 A;  3ONQ A;  2V1X A;  2LTP A;  3W2V A;  3WTT C;  4HOB A;  3HJE A;  2CW0 F;  2LRD A;  3ZQI A;  3OS1 A;  1KON A;  3W3C A;  4D0P A;  3OY9 A;  2VPR A;  2O7O A;  3TMO A;  1U8R A;  2VON A;  1MH3 A;  5M5W J;  1YRN A;  2QEN A;  4DJA A;  4PSW A;  3Q0U A;  3ERM A;  5J47 A;  3G1L A;  3VYU B;  4A0Y A;  3W6V A;  1QQI A;  3CQZ J;  3ABU A;  2E2H J;  2XKP A;  3J7Z I;  2XF5 A;  3LSJ A;  3IRR A;  4E7S A;  5F6F A;  3KYD B;  1BR2 A;  3HGG A;  1P7I A;  2WB1 N;  3PNT A;  1BC7 C;  2DN0 A;  2QBY B;  5FKO A;  2KIF A;  1T6S A;  1BI0 A;  1T38 A;  3CUO A;  1Q1V A;  3HSR A;  1F36 A;  3BTI A;  4OIO F;  4IHT A;  2BEO A;  1LKX A;  2MGQ A;  1QPM A;  2K86 A;  2CH0 A;  4XON A;  2OCC H;  3H0G J;  4C3H J;  2YU9 J;  5HOD A;  2Y31 A;  3DBH B;  3H5A A;  2CUE A;  3DCF A;  3KYL A;  2IA1 A;  5L3C A;  1A6Q A;  3N97 A;  1NK2 P;  4ESJ A;  4M74 A;  1BC8 C;  1S9H A;  5GAG J;  1W4M A;  4BE2 A;  2FX0 A;  3E1S A;  5IOY A;  2ZJP F;  3LA3 A;  3EYI A;  2RQQ A;  2DK5 A;  3TW6 A;  2L01 A;  1DDN A;  1Z6R A;  4LB6 B;  4W97 A;  1RUO A;  4OOI A;  2L0K A;  2GXB A;  4E7H A;  1VTN C;  1S29 A;  2ZJR F;  1ZKG A;  3CTA A;  2VOD A;  4OWR B;  3CES A;  1APL C;  2O03 A;  1F5T A;  3D5L A;  1FPQ A;  3HXL A;  4CDG A;  3UKG A;  4E7J A;  3GYH X;  3QYF A;  2L9N A;  3C18 A;  2VLA A;  3LST A;  2DYR H;  1YW8 A;  5F0C A;  2F5D A;  1A04 A;  2KKO A;  5L3E A;  1RET A;  4Y33 A;  2X51 A;  2R7T A;  1POG A;  3IC7 A;  3SQN A;  2A3S A;  2DMP A;  4RAY A;  3VSL A;  1LFB A;  3TKY A;  4BS9 A;  1Z1D A;  3ESW B;  3BOQ A;  5CYV A;  3WU0 A;  2PJP A;  1ON2 A;  1A6I A;  3VSK A;  2UUZ A;  2PG4 A;  1XGN A;  3RZO J;  2JRM A;  2QWW A;  4IHS A;  3MZY A;  2ZBK A;  1XGO A;  3K4N A;  1BW6 A;  4QTR A;  2Q0O A;  3V7R A;  3I59 B;  4ZZL A;  2VJI A;  2A5W A;  3KE2 A;  1ZR2 A;  2X0L A;  4HV5 A;  5KNL A;  4M72 A;  5LGN A;  3CO7 C;  3H3U A;  3JRI A;  2PI0 A;  1DP3 A;  3DU6 A;  3CCU I;  1MMD A;  5FKL A;  1T0F C;  5DCF A;  1V5F A;  2Y48 A;  1GLN A;  2W25 A;  2H6C A;  2VQC A;  4RMN A;  5B1B H;  4DBR A;  4LLG F;  4BEH A;  3HOZ J;  2E34 A;  5FLX K;  2DA6 A;  3JRB A;  1W5T A;  4KIT B;  5E1W A;  4CCN A;  1MMA A;  3ZMZ A;  3KP3 A;  2GZW A;  3DEE A;  5FFZ A;  1SAN A;  3OL3 A;  4RB1 A;  4PJL A;  2P8T A;  3S2W A;  5GPC A;  1V5E A;  1G8X A;  4MFD A;  3PUB A;  4MNU A;  2O9L A;  2J5O A;  2BY3 A;  3MQ0 A;  5DEQ A;  2IGM A;  2E7X A;  1K83 J;  3WU2 C;  2H8R A;  3BQZ A;  3R60 A;  3WGI A;  3KFW X;  4IQ4 A;  3P5J A;  4HST A;  1O3Q A;  1JHF A;  1T0F A;  2ECB A;  1DU6 A;  2ZSI B;  1TP4 A;  3FX3 A;  3VDX A;  4XBF A;  2UXX A;  5K7Z A;  4A69 C;  5C4J J;  3S14 J;  2VE8 A;  1XSD A;  3CLQ A;  4A2U A;  2DFI A;  3K4B A;  1JXS A;  1REP C;  3F8C A;  2DK8 A;  1YI2 I;  1VQ4 I;  2CJJ A;  1VZ0 A;  5EYR A;  2Y9Y A;  3S1Q J;  1MJ9 A;  2VBX A;  1D1A A;  1U9O A;  4HF1 A;  2H09 A;  3WG9 A;  4M3E A;  2NVT J;  3GME A;  1I3A A;  2R4G A;  4AVP A;  4HF2 A;  2Q1Z B;  1E3P A;  2M0C A;  2QGU A;  2Y0M A;  5E18 F;  1FOX A;  2R3S A;  1ON1 A;  2DXI A;  1LUJ B;  1MMS A;  1T39 A;  2XPU A;  4D1Q A;  1J0R A;  4JX6 A;  2NYX A;  3M8E A;  3WE3 A;  2Z2S B;  3ZQF A;  5J8C A;  4UUV A;  2FQ3 A;  2R7S A;  1U5T C;  3LFU A;  1TQI A;  1IC8 A;  2O8K A;  3S2D J;  4FX4 A;  3SZG A;  1VND A;  3GO5 A;  4KA4 A;  2W24 A;  1P4W A;  4EGZ A;  3EUK L;  1Z3X A;  1BR1 A;  2KJC A;  3KP4 A;  4P5O A;  2PMH A;  5ICG A;  2QKM B;  5J4V A;  5HS7 A;  3V8L A;  4A3E J;  2AQE A;  2QCO A;  1Z77 A;  5TRD A;  5LHG A;  3F21 A;  3DBL B;  1OCZ H;  3K1N A;  5J1R A;  1A35 A;  3CJR B;  2E1M B;  5J3L A;  5F64 A;  3S1M J;  3R4K A;  3DF8 A;  2FOW A;  2LFB A;  4GXO A;  2XDV A;  4E7I A;  1EF4 A;  1U5T A;  3MN2 A;  1K7A A;  1E2X A;  4HG2 A;  4RB3 C;  1QVT A;  5FLM J;  4M6X A;  1OCC H;  2D2W A;  3EET A;  1QNT A;  5IT9 Z;  1QPI A;  2OU2 A;  2XF6 A;  3ZN0 A;  2M30 A;  3I0T A;  1T95 A;  2Y30 A;  3M1C A;  3U1D A;  4E6K G;  1ZRC A;  1HOM A;  2F2E A;  3GZN B;  1UZC A;  3BJO A;  2XGD A;  3HDD A;  1OYI A;  2X1D A;  3F8M A;  2M5W A;  5HLG A;  2B9S A;  3FMQ A;  1Z67 A;  1LVK A;  1KZH A;  3HOV J;  2LKX A;  3DLA A;  3GFM A;  4CHU A;  1T33 A;  4N0B A;  2ZXW H;  2K4B A;  1IJW C;  2V1U A;  1WQ2 A;  3HM5 A;  2BYV E;  1LEB A;  4CCO A;  4RLF A;  1S6L A;  3TED A;  1TWG J;  4P96 A;  2FQ4 A;  2M34 A;  3RZD J;  3PSF A;  1W0T A;  3I4N J;  3HGY A;  1OCT C;  3FXM A;  2PMU A;  2EV6 A;  3K9T A;  3IL2 A;  2E1N A;  4CCK A;  3CCR I;  3KEO A;  4UB8 C;  3HKZ A;  1F9N A;  4Y13 A;  5FRM A;  4Y17 A;  5ILS A;  1R49 A;  3PIO F;  1UJ8 A;  1D0X A;  4Q48 A;  1TWC J;  5FLV A;  1FYM A;  3J80 K;  2VBY A;  3AG3 H;  3S15 J;  1Y8Q B;  4L9V A;  4DYQ A;  2MD0 A;  5CQE A;  2ZC2 A;  3B6A A;  3LNQ A;  2QYO A;  2PQ8 A;  1OKR A;  2F4O B;  4PJM A;  1W1W E;  3ISP A;  5LD2 C;  1WRJ A;  3KPH A;  4KDP A;  3GW2 A;  3FMR A;  4EQQ A;  3GTL J;  3KET A;  4NC8 A;  3S1R J;  1HDP A;  1WWX A;  1I1G A;  1Z7L A;  1QHH D;  3E0J B;  5FO5 A;  3K1M A;  4RB2 C;  1ETV A;  1SD6 A;  5CVV A;  3WU1 B;  2Z1D A;  3QPL A;  5BOX A;  3ABM H;  5LHI A;  3GX4 X;  2QSH X;  2FML A;  4CUG A;  1BR4 A;  4O6J A;  3FXJ A;  3I71 A;  2KP6 A;  2A5Y B;  3DPU A;  4LMY A;  4A3I J;  1DQU A;  1XMX A;  2BXZ A;  3WOD F;  1XC5 A;  2W84 A;  4F55 A;  2PEX A;  4BDZ A;  2XAH A;  2RNG A;  2ZXJ A;  2B0L A;  3JTH A;  2WV0 A;  3S3M A;  2QSG X;  1P7J A;  1IRF A;  4HSR A;  1L0O C;  3PQJ A;  4MTD A;  3DTE A;  3JRD A;  2STW A;  2QLZ A;  4PDK A;  3TO6 A;  3HPG A;  2ZJQ F;  4XLA A;  1RI7 A;  1U2W A;  1BJA A;  2KZG A;  1B4A A;  3HKZ N;  2O0Y A;  3U1K A;  2N8G A;  2K02 A;  3ECH A;  3HRT A;  4X1E A;  4ENN A;  1NHA A;  3ECO A;  4DZP A;  3AG1 H;  3QQA A;  4AIJ A;  5F0H A;  1TQM A;  4CCM A;  4I6Z A;  1B9N A;  9ANT A;  2M4G A;  1EA3 A;  3KX2 A;  4HX7 A;  4F93 B;  1HQC A;  1ETY A;  3KZZ A;  1OCR H;  4BU2 A;  5EF6 A;  4GYG A;  3OYB A;  3ZQL A;  2VI6 A;  3CD6 I;  1G4D A;  1SFO J;  4E7Z A;  3PNY A;  4A12 A;  1LEA A;  4HLX A;  3A2K A;  1RR8 C;  2DBB A;  5H6R A;  3CCL I;  3A02 A;  4GO1 A;  1JKR C;  2HS5 A;  1MSE C;  4X6A J;  4ITV A;  1BOB A;  2KMU A;  2W4S A;  4ABZ A;  4B47 A;  2ACJ A;  2K7L A;  2LOO A;  3FMS A;  1G59 A;  2KFD A;  4TV7 A;  5HDK A;  4E4H A;  1BN5 A;  3F72 A;  4Q4Z F;  3T8T A;  2XAJ A;  4MIM A;  4B4C A;  1WH5 A;  2K40 A;  5EG0 A;  1UEL B;  3SEZ A;  1ACI A;  3TGN A;  1MDM A;  4OIQ F;  1NG6 A;  3DKW A;  2WAF A;  2XAS A;  3R61 A;  1GUU A;  2FF4 A;  3K4J A;  2ELH A;  1JJ8 C;  4A3K J;  3QOD A;  3ABL H;  4MTE A;  4V19 K;  3MWM A;  2HPI A;  2R7F A;  1RC9 A;  4LG3 A;  3M3Y J;  4XKC A;  5AON A;  1IV6 A;  1FP2 A;  5LEJ A;  1R9T J;  3OYK A;  3LMM A;  1GXQ A;  4RAG A;  1Y0U A;  1S8N A;  1EJ9 A;  1I1S A;  4UV8 A;  4UUT A;  4E7L A;  3CF2 A;  1XPX A;  1YRN B;  3LSM A;  3MAJ A;  3JRE A;  1ODD A;  1O3R A;  4BGD A;  1QZZ A;  4Y15 A;  1YIJ I;  3PSI A;  3HSE A;  1F1Z A;  4YG2 F;  1E3H A;  4M3F A;  4P9F A;  1SEU A;  2V79 A;  3JAM K;  3MKZ A;  2QQ8 A;  5GPA A;  2CQQ A;  1AA7 A;  2X1E A;  1X1D A;  3BLY A;  4AIK A;  3I55 I;  2ESH A;  4ZH4 F;  2HR3 A;  3WTV C;  1FTT A;  3OS0 A;  1IF1 A;  2DA1 A;  4A93 J;  3A0B C;  2IBD A;  3T0Y A;  3BJ6 A;  1JGS A;  3DLL F;  3BCB A;  2O6G E;  5JHU A;  1D1B A;  2GLO A;  4KMF A;  3OV8 A;  3ZMU A;  2P6T A;  4JYK A;  3HB9 A;  2IT0 A;  4OIP F;  4HBL A;  3E7L A;  1XSX A;  2IXS A;  4GFB A;  4QPQ A;  3ERE D;  5E20 A;  2FBK A;  5FB2 A;  2MG4 A;  1I50 J;  3DTK A;  3O6B B;  1SVL A;  1JUP A;  2FSW A;  1Y0N A;  1OIS A;  5E3N A;  4G7O F;  4HNT A;  4PK4 A;  3ZN1 A;  5KAI C;  1D3Y A;  2FRH A;  4XLC A;  2BV6 A;  2OQG A;  4XKB A;  1MNE A;  1ZAR A;  1PJR A;  2LY2 A;  1U9N A;  3ZQ7 A;  1D8K A;  2KRC A;  3IHU A;  3SDB A;  4G7H F;  4FAS D;  2WWY A;  1UHW A;  1ZHF A;  3RPU D;  4C9Y A;  5DV5 A;  1BIB A;  2ME6 A;  2HZD A;  4ESB A;  3QYB A;  5E1X A;  1OR7 C;  4UY8 I;  2EZK A;  2HDC A;  2X48 A;  4R8H A;  2KRH A;  5LFA A;  2EA2 A;  3E6D A;  3ASO H;  4DYC A;  3ZMS A;  1IN7 A;  3V8J A;  3DEU A;  1LDD A;  4KFC A;  2ETH A;  3C3W A;  2KIM A;  2VJ5 A;  4PUS A;  3LSG A;  3ZCO A;  1R71 A;  1XN7 A;  5J6X A;  3DPL C;  3HUG A;  4HEA 2;  5IPA A;  1YFH A;  4M9S A;  1QA6 A;  2KIU A;  3BDD A;  3WTX C;  2FBH A;  2L2O A;  5KVR A;  3J7A Y;  3RKY A;  1IV8 A;  1HA8 A;  3KEQ A;  4HYE A;  4BJ5 C;  2VB6 A;  1W7P D;  1OR7 A;  4ANJ A;  3IV5 A;  3HYI A;  2K5C A;  2NNN A;  4NQW A;  4UVA A;  1X4P A;  3WTS C;  1X19 A;  3PUF A;  1R36 A;  3E6B A;  4XMY A;  5B3S H;  5KCM A;  4S05 A;  1HLV A;  2VOO A;  3AAF A;  3W6K B;  1SC7 A;  4IEJ A;  4JX4 A;  3KIO A;  1V4R A;  1P92 A;  2EJR A;  4EM0 B;  3IWF A;  3K4C A;  4CYC B;  1I5Z A;  2NVX J;  4XN0 A;  3FBN B;  4BEH B;  4EMS A;  4CYD A;  4YFX F;  1MNM C;  1HBX G;  1AU7 A;  4OMZ A;  4LK0 F;  1MBJ A;  2LLK A;  3I3L A;  2EFW A;  4WXH A;  1G3Y A;  1SAU A;  3H5R A;  3ELK A;  3H0D A;  3IP4 B;  2BVL A;  1UG0 A;  1VF9 A;  4DQ2 A;  1Y1V J;  1VFC A;  4B3X A;  3FM3 A;  5FJ8 J;  5DM7 F;  5H2F C;  2E35 A;  4BDY A;  5HS9 A;  5CVI A;  3D0S A;  4AIH A;  2ZNY A;  4HNU A;  1HKQ A;  3L2W A;  1DU0 A;  1NG7 A;  1WJC A;  2CW7 A;  4BH9 A;  2L9V A;  5B66 C;  4IOA F;  1YLF A;  2OUM A;  2GIZ A;  3S3N A;  3CO6 C;  2DOE A;  2FE3 A;  2I8D A;  2PN6 A;  1JKO C;  1FY7 A;  2RQP A;  2HFH A;  2WB1 A;  4WXC A;  4WWC A;  1ZLJ A;  1JE8 A;  4LD5 A;  4AM3 A;  2M2E A;  2OBP A;  2TRT A;  3CDI A;  3L09 A;  4LIT A;  4QSH A;  1LDK B;  1HKS A;  1O3T A;  5HDG A;  3U21 A;  4IX7 A;  4LLL A;  2GIV A;  2WC2 A;  5HOO A;  5D6F A;  4CA0 A;  2C6Y A;  2VC0 A;  2HQN A;  2HOT A;  4BUP A;  1W5S A;  4JOM A;  1KU2 A;  5ILV A;  5FFX A;  2K27 A;  2WAE A;  2YR2 A;  2UXN A;  3ABK H;  2A07 F;  2HQ5 A;  3ASN H;  2JK3 A;  1S7O A;  1YX5 A;  2RC4 A;  2YU3 A;  4AU7 A;  2DI3 A;  4FET A;  2FA5 A;  1OJL A;  1J75 A;  2G0E A;  1QHG A;  2V1N A;  3I4P A;  4B09 A;  3LFK A;  1ZGJ A;  5EEH A;  1BM9 A;  1IN8 A;  3P9I A;  2DPD A;  1GVD A;  1JT6 A;  3LSR A;  4XLF A;  1U8B A;  3BPV A;  1MBE A;  1D5Y A;  4ZC3 A;  4ZDO A;  2VN2 A;  3LA2 A;  2BBY A;  4O3M A;  2HDD A;  2ICW G;  1IRX A;  1ONV A;  2BOL A;  4I2O A;  3BZ6 A;  3OYE A;  1ZG5 A;  3W2A A;  4I7H A;  4U7D A;  2IW5 A;  4R1H A;  2F6C A;  5EJC A;  1IN5 A;  1ERD A;  3NWT A;  5FRO A;  4IXA A;  4G8X A;  4WCG A;  4KIS A;  4CCL A;  1U5T B;  1YJN I;  5E17 F;  3C2G A;  4ZDL A;  3PO3 J;  3WG7 H;  1G3S A;  3J7A O;  3CMM A;  3IH4 A;  1DGW Y;  2HOE A;  4I76 A;  4B3A A;  1PDN C;  4RAZ A;  4IKF A;  1AOY A;  1W36 D;  1K6O A;  2LH9 A;  1FP1 D;  2NVY J;  1T2K A;  4MLO A;  3HPH A;  4CH7 A;  1Z6T A;  2DPU A;  3I54 A;  1UAA A;  3CDH A;  4BAY A;  3L1P A;  3BWG A;  3PFI A;  5IYC J;  1WCM J;  5FLX Z;  3EYY A;  1Z21 A;  4FE7 A;  3U9G A;  2QSF X;  4AC0 A;  3IKV A;  3P9K A;  1X1P A;  2GAU A;  1HSJ A;  1K78 B;  2ADU A;  4F52 A;  2ISZ A;  4ENK A;  1Y56 A;  1X4O A;  2TDX A;  4U0V A;  3MKW B;  3WTW C;  1PUF B;  1UST A;  4ETS A;  3DWL E;  3SXY A;  2QUF A;  2XVC A;  3VEP A;  2V1D A;  2Q2E A;  5IOZ A;  1E0E A;  2L7F P;  2W48 A;  5LBQ A;  3M4O J;  4P55 A;  2KIQ A;  3FZV A;  1YO5 C;  4ENJ A;  2DFF A;  1MW7 A;  4UHT A;  5K5O A;  2HOS A;  2GXA A;  4LIV A;  2MW8 A;  4PGG A;  4BY7 J;  4XRS A;  2DJI A;  5EEG A;  3CF5 F;  4H0E A;  1Z9C A;  4QLC U;  4BBS J;  1F43 A;  2L9R A;  4IHW A;  2EWN A;  3ROU A;  1H88 C;  4ZTF A;  2XRN A;  2KPM A;  4G6T B;  4OU0 A;  3ZQG A;  5B1A H;  3BP8 A;  2NXN B;  3QOE A;  3VYT B;  5JFR A;  1KYW A;  5K1Y A;  3IH3 A;  1GV2 A;  3OSF A;  1ZGA A;  2GOM A;  2L54 A;  2EBI A;  4IJA A;  1FIA A;  1DUX C;  3EPZ A;  1QZE A;  2LC2 A;  3BG7 A;  3FXO A;  1R4N B;  2JA8 J;  1K79 A;  1XCV A;  4S04 A;  3CCV I;  4EJT A;  5D4S A;  3H3Z A;  1N25 A;  1MMG A;  1TBX A;  5TIS C;  2ESN A;  1MH4 A;  4CYC A;  5IP7 J;  4ON0 A;  3VYR B;  2XAU A;  2PJR A;  3I64 A;  4O5V A;  4NC6 A;  3DQV C;  4Y4R A;  2QVO A;  3PL8 A;  2HEO A;  1OPC A;  3BZC A;  4UXN A;  1D0Z A;  2Q8K A;  3K2Z A;  3ABT A;  4A0X A;  4UVC A;  1S5L C;  2XC7 A;  2Z33 A;  3H92 A;  3VB2 A;  3CCJ I;  3P9C A;  1YX3 A;  1P2F A;  1SAX A;  3TO9 A;  2LRE A;  4KIF A;  3OYC A;  3OYD A;  4EJW A;  2DDA A;  1VQ5 I;  1OFC X;  2XF7 A;  4I99 C;  2YSR A;  5CJ9 A;  3S1N J;  4PJN A;  3H3V K;  5E79 C;  3TDU C;  5H20 A;  2P5V A;  5E8G A;  1BI3 A;  1FOK A;  5D5X B;  3C2H A;  1FEX A;  1GXP A;  2OTJ I;  3OIO A;  2CYY A;  4AUX A;  3UR3 C;  3TOB A;  5GTI C;  2L9S A;  2JA7 J;  1VQN I;  2DA2 A;  3RKQ A;  1R22 A;  1WZ2 A;  3L9F A;  2M1B A;  2RV8 A;  4L18 B;  1H9T A;  4FX0 A;  4UV9 A;  2B63 J;  3OYL A;  3OYM A;  3H9Q A;  1I6H J;  1ZTR A;  2XAF A;  2E5N A;  3S32 A;  2Z16 A;  2AXL A;  3QP6 A;  4NC7 A;  1X2M A;  1MBG A;  3GLL A;  3CC7 I;  3HOY J;  5EG0 B;  1UMQ A;  4XLH A;  4OMY A;  2E7W A;  5HS8 A;  1MDM B;  1AHD P;  3QPH A;  3AL0 C;  3LSI A;  4ZJZ A;  1WSU A;  2O8X A;  1B1B A;  1XGM A;  2LBF A;  5H6Q A;  2CQK A;  1PYV A;  1LQ1 A;  1EH7 A;  4JP0 A;  4XL9 A;  2VBW A;  3HEF A;  2AS5 F;  4OAZ A;  4B1R A;  3HOW J;  5KK1 A;  3V42 A;  1LPQ A;  2DT6 A;  2W00 A;  5DCM A;  4A3F J;  1HW2 A;  1YS6 A;  1RRJ A;  5EGO A;  1OLT A;  2ISY A;  5CVU A;  2I5U A;  5D6E A;  4H4K C;  5FKK A;  3CC4 I;  2YX7 A;  2IGK A;  2BW3 B;  2LNB A;  4PJ0 C;  3TDZ C;  3TP3 A;  4BQN A;  5C3E J;  3KP2 A;  4NB5 A;  1QO0 D;  3QU6 A;  2PLY A;  5FKM A;  3LAJ A;  1XDU A;  4NBQ A;  1HF0 A;  3K2A A;  2M0M A;  3KZY A;  4XRS G;  4BAC A;  3WTZ A;  4ZDP A;  3TW7 A;  4BBR J;  4BE0 A;  4KYW A;  1VQK I;  2M3A A;  2W85 A;  4IO9 F;  4BYY A;  2L7K A;  2FJ1 A;  2OJE D;  3QOP A;  4EV0 A;  2JUC A;  1JUS A;  3BR5 A;  3ULQ B;  3DV8 A;  4YIF A;  1TTY A;  2X1C A;  2FNA A;  3S2H J;  2UWM A;  1XX5 A;  3GEZ A;  4F7Z A;  2H8W A;  2GOX B;  2XPW A;  3AG2 H;  3I4M J;  2VAS A;  1TT5 B;  3JRH A;  1V3F A;  2DQL A;  1SFX A;  3GXO A;  5D5W B;  5D8L B;  2XSJ C;  3O8G A;  2LG4 A;  3TOA A;  1PVE A;  5IYD J;  1USS A;  1LFP A;  2AO9 A;  4FTH A;  1S7A A;  3BR6 A;  4AVZ A;  2F5C A;  1X58 A;  4ZZD A;  1K78 A;  2JA5 J;  4P9U A;  2E5Z A;  3SFI A;  5M5X J;  1YW7 A;  2V26 A;  2VKE A;  1DGR M;  2IAI A;  4B43 A;  1PUF A;  1R23 A;  2RAE A;  3LSK A;  2GWR A;  5CKT A;  1B72 A;  2CO5 A;  5LGU A;  2K3P A;  2K9N A;  1XCB A;  3HOX J;  1FTZ A;  2X6W A;  4M9Z A;  2ID6 A;  5FD6 A;  4U0Y A;  1BA5 A;  3HHG A;  2OZU A;  4IHY A;  3GTP J;  1MKM A;  5F1R A;  3LAP A;  3K70 D;  2QM3 A;  1IUF A;  2IVM A;  4EM1 A;  4RM3 A;  4Q47 A;  1WI9 A;  3BRO A;  2W57 A;  3RPU A;  4ENM A;  2DTZ A;  2DAO A;  5JLW A;  3OIP A;  1K61 A;  1FJL A;  5L3B A;  2EV0 A;  5FKN A;  1ULY A;  2CQ7 A;  5AIQ A;  2HVQ A;  3ZQC A;  1LFU P;  1Z91 A;  3PO2 J;  1BIA A;  4V2G A;  2D1V A;  4G94 A;  4C2U A;  3OOP A;  4RAF A;  1T56 A;  2DA4 A;  2EV5 A;  3HUG B;  2W7N A;  3H5N A;  4F3Q A;  2LVS A;  3FXQ A;  2HWV A;  5F08 A;  2HVS A;  5HLI A;  3D1N I;  2BVM A;  2EQR A;  4KIB A;  1W7P A;  2LD5 A;  2EZL A;  3HBL A;  4HF0 A;  1V54 H;  2VPL A;  1RKT A;  4KNY A;  2KQR A;  5JHF A;  1G3W A;  1MND A;  2X6O A;  4NQW B;  5C44 J;  3M8J A;  1T98 A;  3DPT A;  2EK5 A;  3V7C A;  2HU9 A;  5EEA A;  3WE2 A;  2PFB A;  2XGX A;  1ZYR F;  1RZ4 A;  1XDS A;  1VQ9 I;  2E2J J;  3ML6 A;  1J5Y A;  2A05 A;  2JA2 A;  1AKH B;  1R1U A;  1G2H A;  1JHH A;  5DD4 A;  5IT9 K;  1PP8 F;  1FT9 A;  1MIJ A;  4XR6 A;  4NNJ A;  1Y6I A;  4L9T A;  5LRR A;  5DTD A;  1QVU A;  3L2Q A;  4G6D A;  4U7B A;  2L7M P;  4HX8 A;  1JI8 A;  2AQF A;  1GDT A;  1WVR A;  1QZY A;  4A3G J;  1CQT A;  1BOA A;  4KT5 C;  2RGV A;  4BXX J;  1WJD A;  2QF7 A;  4IVN A;  4I09 A;  2YS9 A;  3FKJ A;  5GAE J;  4I98 B;  2DOA A;  2DMN A;  2XV4 S;  3RPQ A;  1WPK A;  3DFG A;  5D5U B;  4UUS A;  2EA4 A;  1B8I A;  3F6O A;  3GF2 A;  1R00 A;  3OR2 C;  5E1Z B;  4C2T A;  2FMY A;  5L3D A;  4M71 A;  2A61 A;  2XKO A;  4XLE A;  1KQ8 A;  2KZV A;  3HC7 A;  3OYA A;  1CF7 B;  3CP2 A;  2I10 A;  2CG4 A;  4J00 A;  5IYB J;  3TP0 A;  3I56 I;  4EJU A;  3FXK A;  2M45 A;  5TJJ A;  3GTK J;  4PZJ A;  2R7D A;  2BGC A;  3A4C A;  3S3O A;  4BQQ A;  5ICE A;  2CGP A;  3GZ6 A;  4LG0 A;  1X1B A;  4YEJ A;  1IAW A;  4IL6 C;  2Z3Y A;  3M9A A;  3WTY C;  2CFO A;  1JKQ C;  3A01 A;  1I3Q J;  2J5P A;  3PQK A;  4M3G A;  2OA4 A;  2CV1 A;  3OWT A;  1YW9 A;  2KHM A;  1V55 H;  2XB0 X;  4ASN A;  2NOJ B;  2LDU A;  2LYC A;  2VOP A;  4G9Y A;  2DA7 A;  2BW3 A;  2WAD A;  1W36 C;  1P4X A;  5GTH C;  1MMN A;  1IZ1 A;  3SZT A;  3OYH A;  5K5Q A;  1IW7 F;  4Y7N J;  3L2V A;  4EJV A;  3K4L A;  2QQB A;  3OYG A;  3HL2 A;  3LSP A;  2RVC A;  3KLO A;  4LFU A;  1ZGW A;  4DBQ A;  4MHG A;  3JRC A;  2L02 A;  3K0L A;  5EZG A;  4RDU A;  5A2Q Z;  1QU3 A;  2P4W A;  3GFJ A;  4EVI A;  3ZMD A;  2NRA C;  1R1V A;  2E36 A;  2OTL I;  2P0W A;  1O7F A;  2XGE A;  1TL8 A;  5HNF A;  1WJ5 A;  2LY9 A;  3VFZ A;  3HOU J;  3GVA A;  2VQG A;  2M8G X;  3GLX A;  4ZYA A;  3KZI C;  1Q1H A;  4A6D A;  2EFQ A;  2QQ9 A;  4XKV A;  1VQP I;  2Y0S N;  4M6Y A;  2KDO A;  3OYF A;  5FD5 A;  4YEL A;  4MEX F;  4UVB A;  1MJA A;  4BY1 J;  2JVG A;  3K69 A;  5CVR A;  2E2I J;  2UZK A;  4KIC A;  2RNJ A;  4XK4 A;  3SJM A;  2EZI A;  5F1J A;  3DTI A;  2DCE A;  4PJJ A;  4RGR A;  3E5X A;  3RDI A;  3JSO A;  4M9X A;  2E60 A;  4L0Y B;  2MFZ A;  3IAM 2;  4IRG A;  3MFK A;  1TT0 A;  3C1D A;  1AWC A;  1P9Q C;  2CWE A;  2EIJ H;  2Q2E B;  3FKI J;  3CUQ C;  4XNF A;  1I27 A;  4A6E A;  2DYS H;  4CSW A;  1IUY A;  4CGZ A;  4FT8 A;  5IP9 J;  3QYE A;  3TBI A;  2ZXH A;  4MQV A;  5LLQ A;  4ESF A;  3F3X A;  4WF2 A;  3GZ5 A;  2G7H A;  3H35 A;  1TC3 C;  4N9I A;  4ZYE A;  2HNH A;  3KP6 A;  2ELK A;  3RCO A;  2FBI A;  4D7N A;  2XPV A;  4IQJ A;  2DMU A;  3H9J A;  2BY0 A;  4BXF A;  1FZP B;  3CUQ A;  1PP7 U;  4IF4 A;  2OV7 A;  3J81 Z;  1OCO H;  4YIR X;  1VQ7 I;  2LK2 A;  3LA7 A;  3MEX A;  3HTS B;  1TWH J;  3L00 A;  4LOC A;  2XIG A;  2V7F A;  3ZOB A;  3AKZ A;  3BR0 A;  1XMA A;  2R5Y B;  3EQL F;  3SYT A;  2D1H A;  4WXD A;  1RUN A;  3BCA A;  2PJR B;  2MA3 A;  3S16 J;  1AKH A;  1IRZ A;  4UB6 C;  2VQL A;  3AG4 H;  2JA6 J;  4KN7 X;  4DYR A;  3V8K A;  1LB2 A;  2P6S A;  1WJE A;  4AYB N;  5E8I A;  4BHB A;  2CUF A;  3HHH A;  2R7V A;  2NNY A;  2IS6 A;  2EFO A;  5J1U A;  2PMZ N;  4BNC A;  2E1O A;  1Z05 A;  3KCC A;  2MLG A;  2L4A A;  5LHH A;  2K9L A;  3I9V 2;  3M7G A;  2DJN A;  3BG9 A;  2EIK H;  3PJR A;  2RDP A;  2DMT A;  5K5R A;  3RTR A;  2VBZ A;  2RN7 A;  2D45 A;  4HPQ A;  4CO8 A;  4IPA A;  1EV7 A;  4N4N B;  5BNG A;  3CDL A;  4EEF G;  2QA4 I;  1MGT A;  2DDB A;  2CFX A;  4JX5 A;  2KLO A;  2BHZ A;  2IA0 A;  4RGS A;  1TLH B;  1WJB A;  2XUB A;  3RYP A;  4CCJ A;  1P6R A;  4FHT A;  3NWS A;  3JRF A;  4XQF A;  3L2C A;  2MLK A;  2VXZ A;  2LR8 A;  1CF7 A;  1R7J A;  1Z3Y A;  2M9H A;  3I58 A;  2MC4 A;  2L4M A;  4M3B A;  1MBF A;  2OQR A;  4G7Z F;  5GAD J;  2HGC A;  4EGY A;  4HDV A;  1FLI A;  1JTX A;  2XHK A;  3S17 J;  1FYL A;  2IPQ X;  2NAZ A;  2R92 J;  2ZCW A;  2NS7 A;  3BTL A;  2K9S A;  1STZ A;  2JPC A;  2VKV A;  3FBI B;  2PX9 A;  3ZQH A;  1IXS B;  2LBF B;  3NRV A;  3RI4 A;  4ZYD A;  3RQ4 A;  2V6E A;  1Z7U A;  2FD5 A;  1ZAO A;  1HST A;  5L3G A;  3OOU A;  5JR3 A;  3OS2 A;  4XOT A;  2F5E A;  4RS8 A;  1XD7 A;  5DCM B;  1E3O C;  3RKW A;  2LF7 A;  3DXJ F;  5HDN A;  4RLQ A;  2CW8 A;  5EDN A;  4K2E A;  5EGO B;  2H27 A;  3VWB A;  4II3 A;  1RNL A;  4JBA A;  5K7F A;  1JGG A;  2IS1 A;  1TWA J;  2TCT A;  1UFM A;  1JTY A;  1FWZ A;  3L2U A;  2R7W A;  3ZR8 X;  2JRT A;  3G1O A;  3AL0 B;  5CQG A;  2O61 A;  3FHN A;  1KQ0 A;  2JWT A;  2VQH A;  5C4X J;  3CC2 I;  2A68 F;  3RYR A;  2LY1 A;  1B9M A;  1D0Y A;  3CMA I;  2WBM A;  1K4S A;  2IA2 A;  4IRI A;  3B73 A;  1JKP C;  2VE9 A;  2CV0 A;  1YYV A;  2A6E F;  2DFH A;  1XG1 A;  2P81 A;  3JW4 A;  5KAF C;  4C3J J;  4A3B J;  3K70 C;  2R7U A;  1YE9 A;  3CP8 A;  3CZ6 A;  5IT3 A;  3BR2 A;  1SD5 A;  1OMI A;  2CU7 A;  4C2M J;  1BL0 A;  2EFP A;  4IHV A;  2G9W A;  2OC6 A;  4D7M A;  1SVO A;  3CCE I;  2F4I A;  5D8K B;  3FHZ A;  4LLN A;  3CJN A;  1D1C A;  3K4K A;  3G73 A;  2MYS A;  3BTJ A;  3FXU A;  1B72 B;  2HZT A;  3FIS A;  5E3O A;  2EPF A;  3T5X A;  1EH8 A;  1SMY F;  3Q0V A;  2NVQ J;  3Q9V A;  4HA8 A;  2R7Q A;  1O3S A;  4WX9 A;  1ZK8 A;  2H1L A;  3VOD A;  4YII A;  1NK3 P;  3N05 A;  3SZP A;  1X1C A;  2QKL B;  1GV5 A;  4DGW B;  5GAH J;  1X2N A;  2IGO A;  3OSG A;  2KJB A;  2MSY A;  1J7K A;  1U6G A;  4PGH A;  3C2B A;  4Z6Y A;  1NH3 A;  2UV1 A;  2GA1 A;  4BJT A;  5DYM A;  2XRO A;  5KHD A;  1R1T A;  2LP0 A;  1SD7 A;  3Q9S A;  3F8F A;  2HXI A;  4OIN F;  4KN4 X;  3Q0W A;  2NS8 A;  1Y39 A;  3WGG A;  1YQA A;  2VT2 A;  1U3E M;  1UCR A;  2CUJ A;  4G6Q A;  2HDW A;  5M3M J;  3ZMV A;  2DTR A;  2H1K A;  3G3Z A;  1WJF A;  3E6M A;  3ZMT A;  3G1M A;  1WI3 A;  3FWE A;  2MBF A;  1UG2 A;  3R0J A;  2Y69 H;  3PFY A;  1N78 A;  4EJO A;  1Y8R B;  3F8N A;  2EIL H;  2VJJ A;  2DFE A;  1W7P B;  1KU7 A;  4ZTJ A;  3HG9 A;  3S8P A;  2R5Y A;  2XAG A;  3EDP A;  4QPO A;  2CS3 A;  4IOC F;  2BXY A;  2D5V A;  3LQQ A;  4L5J A;  2FXA A;  3RJP A;  1LE8 A;  2EH3 A;  4OAY A;  2AHQ A;  1HC8 A;  4Y3O A;  4HX4 A;  3RKX A;  2R5Z A;  3MKY B;  2HYF A;  4XIC A;  2M87 A;  1ORK A;  4XRM A;  4LGW A;  1JT0 A;  2JZY A;  1MZB A;  4F92 B;  3AFH A;  4GDF A;  3GFL A;  4IHX A;  1UHS A;  3NQO A;  3F6V A;  4CZC A;  1X1A A;  2ID3 A;  2M7B A;  1H9G A;  3F8B A;  2V4J C;  1MBK A;  3TO7 A;  1LVA A;  3FF5 A;  1YOV B;  5LGT A;  1H89 C;  3M07 A;  3R6S A;  2ZFW A;  1ZEL A;  5CLS A;  5F27 A;  4A0Z A;  4XID A;  2MC3 A;  3RQI A;  2KDZ A;  1TNT A;  4FCY A;  2ZJ2 A;  4I01 A;  1FNN A;  3L7W A;  1D8J A;  3ZGK A;  2JSC A;  4RBO A;  4XOP A;  1VI0 A;  2F5V A;  3DP7 A;  4N9H A;  2E19 A;  4UUS B;  1B8I B;  4L0Z B;  2ZXI A;  3HIF A;  2O5R A;  3K7A J;  5J8F A;  4NDL A; 
#chains in the Genus database with same CATH homology
 3GFI A;  2CSO A;  4KIG A;  1HW1 A;  2JT1 A;  1ZRF A;  5HLH A;  2FU4 A;  2Z5U A;  2EFN A;  2L3D A;  4BHP A;  4GGG A;  4A5N A;  4LG0 B;  3R0A A;  2F5F A;  2IP2 A;  2H6B A;  2NS0 A;  4HAM A;  1O7L A;  4RB0 A;  3J80 Z;  1X3U A;  2ZKZ A;  4I02 A;  1MD0 A;  3W6J B;  2EB7 A;  4Z2Y A;  3HTU A;  4DNC A;  3QP5 A;  4XRF A;  2G7U A;  3GWZ A;  6PAX A;  3CLO A;  5DUI A;  1TQP A;  4AD9 A;  3P7N A;  1MJB A;  3F23 A;  4BQA A;  2VT3 A;  4U0W A;  1KA8 A;  2DLL A;  4L9J A;  5DDG A;  3HOS A;  5ICC A;  2ZNZ A;  1YS7 A;  1F4K A;  3I53 A;  5BPI A;  4MQ9 F;  2HTS A;  1FBS A;  1KYZ A;  5AIP A;  3M8F A;  3T1B A;  3E3V A;  4I0B A;  2XAQ A;  2QBY A;  3T8R A;  1R5H A;  3EUH A;  4HDU A;  1OYY A;  4XSX F;  3LQR A;  2YX4 A;  1XGS A;  2QZ8 A;  5D5V B;  2LSO A;  3Q5F A;  1TW3 A;  1ZH5 A;  1HW5 A;  1P4A A;  5HVQ C;  5DD8 A;  2GA2 A;  1DPR A;  1L3L A;  2HKO A;  1LNW A;  2DT5 A;  1TNS A;  4R79 A;  3KLN A;  2X4H A;  2O3F A;  2FEZ A;  4LJZ F;  4B8X A;  2JTV A;  1IN6 A;  4XLP F;  2DW4 A;  3M1E A;  3LWF A;  5ERI A;  3I5U A;  4BXU A;  3KP7 A;  3NEU A;  1BI2 A;  1YTY A;  2OD5 A;  3B02 A;  5LRS A;  3IWZ A;  3QPT A;  1G6N A;  3RIR A;  2P5L C;  3IRQ A;  2HQR A;  3CUQ B;  1ZN2 A;  2RKH A;  4NHJ A;  3MCZ A;  3BJA A;  3FXR A;  3E5Q A;  3HOT A;  2LF8 A;  1IRG A;  1FBQ A;  2V6C A;  3I59 A;  4QWQ A;  1HXD A;  3IKT A;  1J9I A;  4E70 A;  3WGH A;  5DUK A;  3QU3 A;  1DP7 P;  3ZP5 A;  4RGU A;  4HV6 A;  3JAM Z;  1RIO H;  5BS6 A;  5JVT A;  2ZME B;  4L9N A;  1XSV A;  1LJ9 A;  1SD4 A;  4CXF A;  2BE5 F;  3ZPL A;  1GHC A;  3HRU A;  4JQF A;  2DU9 A;  1QBJ A;  1PUE E;  4OIR F;  3GUD A;  5BPD A;  4XLN F;  3O3K A;  4ZYH A;  1E17 A;  4M73 A;  5BQT A;  4JK1 X;  2Y75 A;  1HKT A;  3VOE A;  1U78 A;  1FSE A;  1YIO A;  4A5M A;  3C7J A;  3WTU C;  3QAH A;  2JPB A;  5ED4 A;  1FX7 A;  2FOK A;  1XB4 A;  1ZG3 A;  4BHC A;  1H0M A;  2DQR A;  3SFZ A;  4MEY F;  4WK8 F;  2GXG A;  1FSH A;  3E6C C;  1B59 A;  1KU3 A;  4HQM A;  2HYG D;  1UB9 A;  5ICF A;  4LB5 A;  2QQA A;  3U2R A;  1EH6 A;  2KRF A;  1B6A A;  3BPX A;  2H94 A;  3JTG A;  2V9V A;  4AWX B;  1I6X A;  1BI1 A;  1ZG1 A;  2MH9 A;  3REO A;  4KUM A;  5CVJ A;  1D5V A;  1O57 A;  3MZH A;  2HKX A;  5D4R A;  1DPU A;  1J59 A;  5JI6 A;  2YPR A;  1IXC A;  4YFN F;  1GVJ A;  2P5K A;  2WTE A;  4UNO A;  1CGP A;  1FYK A;  4IRH A;  3V7S A;  1S3J A;  4XSZ F;  1SFE A;  2DO7 A;  1R58 A;  1UHM A;  4LK1 F;  3E5U A;  4HW0 A;  4MGR A;  2M8E A;  2STT A;  2A69 F;  2OAZ A;  2MH2 A;  5L3F A;  1C0W A;  5BMZ A;  4HQE A;  1BBY A;  1ZRE A;  2K4J A;  2P7V B;  1LDJ A;  2IRF G;  2Z99 A;  2ZO4 A;  3SHF A;  1IXR C;  4GCV A;  2FNP A;  1QGP A;  5A2Q K;  4PCQ A;  2IJL A;  1SMT A;  1YG2 A;  1ZLK A;  2COM A;  5ILU A;  3QRF F;  1FBU A;  2Z9O A;  2E1C A;  1J2X A;  2LKP A;  1SFU A;  4ZYG A;  3K1P A;  5FGM A;  2ZME A;  4EM2 A;  2P7C B;  2MD5 A;  1R5G A;  4KMU X;  1FC3 A;  5LEK A;  3E97 A;  3HRS A;  4CZZ A;  3TQN A;  3BY6 A;  1KGS A;  4HLY A;  2GQQ A;  4I0A A;  1TW2 A;  2OZ6 A;  4YFK F;  4L5I A;  3JSP A;  2HTJ A;  1ZRD A;  1KU9 A;  3V4G A;  4CIC A;  3O2P E;  2VC1 A;  2PBI A;  4Q5S F;  3F22 A;  3HRM A;  3FM5 A;  4GYI A;  4HZF A;  1KQ9 A;  4RGX A;  1G3T A;  3HSF A;  3COA C;  3J81 K;  1XMK A;  3KP5 A;  3N4M A;  4U88 A;  1WKM A;  1IN4 A;  1OYW A;  2A6H F;  2V1X A;  3WTT C;  4HOB A;  2CW0 F;  4D0P A;  1U8R A;  2VON A;  2QEN A;  4A0Y A;  1QQI A;  3ABU A;  2XKP A;  3IRR A;  5F6F A;  1BC7 C;  2QBY B;  2KIF A;  1T6S A;  1BI0 A;  1T38 A;  3CUO A;  3HSR A;  4OIO F;  4IHT A;  2BEO A;  1QPM A;  2K86 A;  2IA1 A;  5L3C A;  3N97 A;  4ESJ A;  4M74 A;  1BC8 C;  1W4M A;  3EYI A;  3LA3 A;  2DK5 A;  2L01 A;  1DDN A;  1Z6R A;  4LB6 B;  1RUO A;  4OOI A;  2GXB A;  1VTN C;  1S29 A;  3CTA A;  2VOD A;  1F5T A;  2O03 A;  3D5L A;  1FPQ A;  4CDG A;  3GYH X;  3C18 A;  3LST A;  1YW8 A;  2F5D A;  1A04 A;  2KKO A;  5L3E A;  3IC7 A;  3SQN A;  2A3S A;  4RAY A;  3TKY A;  1Z1D A;  3BOQ A;  5CYV A;  3WU0 A;  2PJP A;  1ON2 A;  2PG4 A;  1XGN A;  2QWW A;  4IHS A;  3MZY A;  2ZBK A;  1XGO A;  2Q0O A;  3V7R A;  4ZZL A;  3I59 B;  3KE2 A;  2X0L A;  4HV5 A;  4M72 A;  5LGN A;  3CO7 C;  3H3U A;  2PI0 A;  5DCF A;  2Y48 A;  2W25 A;  2H6C A;  4LLG F;  5FLX K;  1W5T A;  5E1W A;  3ZMZ A;  3KP3 A;  2GZW A;  5FFZ A;  4RB1 A;  2P8T A;  3S2W A;  4MNU A;  2J5O A;  3MQ0 A;  5DEQ A;  2E7X A;  3R60 A;  3WGI A;  3KFW X;  1O3Q A;  1JHF A;  1T0F A;  3FX3 A;  4XBF A;  2UXX A;  2VE8 A;  1XSD A;  4A2U A;  2DFI A;  1JXS A;  1REP C;  3F8C A;  2DK8 A;  1MJ9 A;  2VBX A;  4HF1 A;  2H09 A;  3WG9 A;  4AVP A;  4HF2 A;  2Y0M A;  5E18 F;  2R3S A;  1ON1 A;  1T39 A;  1J0R A;  2NYX A;  3M8E A;  3WE3 A;  5J8C A;  4UUV A;  2FQ3 A;  1U5T C;  1TQI A;  4FX4 A;  3GO5 A;  4KA4 A;  2W24 A;  1P4W A;  4EGZ A;  2KJC A;  3KP4 A;  4P5O A;  2PMH A;  5ICG A;  5HS7 A;  3V8L A;  5TRD A;  5LHG A;  3F21 A;  3K1N A;  5F64 A;  3R4K A;  3DF8 A;  4GXO A;  1U5T A;  1K7A A;  1E2X A;  4RB3 C;  4M6X A;  2D2W A;  3EET A;  1QNT A;  5IT9 Z;  2OU2 A;  3ZN0 A;  2M30 A;  3I0T A;  1ZRC A;  3U1D A;  2F2E A;  3BJO A;  1OYI A;  3F8M A;  2M5W A;  5HLG A;  3FMQ A;  3GFM A;  4CHU A;  4N0B A;  2K4B A;  2V1U A;  1WQ2 A;  2BYV E;  1LEB A;  1S6L A;  4P96 A;  2PMU A;  2EV6 A;  3K9T A;  3IL2 A;  2E1N A;  3KEO A;  1F9N A;  4Y13 A;  4Y17 A;  5ILS A;  4Q48 A;  1FYM A;  3J80 K;  2VBY A;  4L9V A;  2QYO A;  2PQ8 A;  1OKR A;  3ISP A;  1WRJ A;  4KDP A;  3GW2 A;  3FMR A;  4EQQ A;  3KET A;  1WWX A;  1I1G A;  5FO5 A;  3K1M A;  4RB2 C;  1SD6 A;  5CVV A;  3WU1 B;  5BOX A;  5LHI A;  3GX4 X;  2FML A;  4O6J A;  3I71 A;  2A5Y B;  4LMY A;  3WOD F;  2W84 A;  2PEX A;  2XAH A;  2ZXJ A;  2B0L A;  3JTH A;  2WV0 A;  1IRF A;  1L0O C;  3PQJ A;  4MTD A;  2STW A;  2QLZ A;  4PDK A;  3TO6 A;  1RI7 A;  1U2W A;  1BJA A;  1B4A A;  2O0Y A;  2K02 A;  3ECH A;  3HRT A;  4ENN A;  1NHA A;  3ECO A;  4AIJ A;  1TQM A;  1B9N A;  4HX7 A;  1HQC A;  3KZZ A;  4GYG A;  1G4D A;  4A12 A;  1LEA A;  4HLX A;  2DBB A;  5H6R A;  4GO1 A;  2HS5 A;  2ACJ A;  2K7L A;  3FMS A;  4TV7 A;  5HDK A;  1BN5 A;  3F72 A;  4Q4Z F;  3T8T A;  2XAJ A;  3TGN A;  1MDM A;  4OIQ F;  3DKW A;  2XAS A;  3R61 A;  2FF4 A;  2ELH A;  4MTE A;  3MWM A;  2R7F A;  5AON A;  1FP2 A;  5LEJ A;  1GXQ A;  1Y0U A;  1S8N A;  1I1S A;  4UV8 A;  3MAJ A;  1ODD A;  1O3R A;  1QZZ A;  4Y15 A;  3HSE A;  1F1Z A;  4YG2 F;  4P9F A;  2V79 A;  3JAM K;  4AIK A;  2ESH A;  4ZH4 F;  2HR3 A;  3WTV C;  1IF1 A;  3T0Y A;  3BJ6 A;  1JGS A;  2O6G E;  5JHU A;  4KMF A;  3OV8 A;  3ZMU A;  2P6T A;  2IT0 A;  4OIP F;  4HBL A;  1XSX A;  3ERE D;  5E20 A;  2FBK A;  5FB2 A;  3O6B B;  2FSW A;  4G7O F;  3ZN1 A;  1D3Y A;  2FRH A;  2BV6 A;  2OQG A;  1ZAR A;  3ZQ7 A;  1D8K A;  4G7H F;  3IHU A;  2WWY A;  1UHW A;  1ZHF A;  5DV5 A;  1BIB A;  4ESB A;  5E1X A;  2HDC A;  4R8H A;  2EA2 A;  3E6D A;  3ZMS A;  1IN7 A;  3V8J A;  3DEU A;  1LDD A;  4KFC A;  2ETH A;  3C3W A;  2KIM A;  1XN7 A;  5J6X A;  3DPL C;  3HUG A;  1YFH A;  4M9S A;  2KIU A;  3BDD A;  3WTX C;  2FBH A;  5KVR A;  3RKY A;  3KEQ A;  4HYE A;  1W7P D;  1OR7 A;  3HYI A;  2NNN A;  4NQW A;  4UVA A;  3WTS C;  1R36 A;  3E6B A;  4S05 A;  2VOO A;  3AAF A;  3W6K B;  1V4R A;  1P92 A;  2EJR A;  4EM0 B;  3IWF A;  1I5Z A;  4EMS A;  4CYD A;  4YFX F;  1HBX G;  4OMZ A;  4LK0 F;  2EFW A;  4WXH A;  1G3Y A;  3ELK A;  4DQ2 A;  3FM3 A;  5HS9 A;  5CVI A;  3D0S A;  4AIH A;  2ZNY A;  1HKQ A;  4BH9 A;  1YLF A;  3CO6 C;  2FE3 A;  2PN6 A;  1FY7 A;  2RQP A;  2HFH A;  4WXC A;  4WWC A;  1ZLJ A;  1JE8 A;  4LD5 A;  2OBP A;  3L09 A;  1LDK B;  1HKS A;  1O3T A;  5HDG A;  4LLL A;  2GIV A;  2WC2 A;  5HOO A;  5D6F A;  2C6Y A;  2VC0 A;  2HQN A;  1W5S A;  1KU2 A;  5ILV A;  5FFX A;  2K27 A;  2YR2 A;  2UXN A;  2A07 F;  1S7O A;  2RC4 A;  2YU3 A;  2DI3 A;  2FA5 A;  1J75 A;  3I4P A;  4B09 A;  3LFK A;  1ZGJ A;  5EEH A;  1BM9 A;  1IN8 A;  3P9I A;  2DPD A;  3BPV A;  2VN2 A;  3LA2 A;  2BBY A;  4O3M A;  1ONV A;  4I2O A;  3BZ6 A;  1ZG5 A;  4I7H A;  4U7D A;  2IW5 A;  4R1H A;  1IN5 A;  4IXA A;  4G8X A;  4WCG A;  1U5T B;  5E17 F;  1G3S A;  3J7A O;  2HOE A;  1PDN C;  4RAZ A;  1AOY A;  1K6O A;  1FP1 D;  1T2K A;  1Z6T A;  2DPU A;  3I54 A;  3CDH A;  4BAY A;  3BWG A;  3PFI A;  5FLX Z;  3EYY A;  3U9G A;  3IKV A;  3P9K A;  2GAU A;  1HSJ A;  1K78 B;  2ADU A;  2ISZ A;  4ENK A;  2TDX A;  4U0V A;  3WTW C;  1UST A;  4ETS A;  3SXY A;  2QUF A;  2XVC A;  3VEP A;  2V1D A;  2Q2E A;  5LBQ A;  4P55 A;  3FZV A;  1YO5 C;  4ENJ A;  4UHT A;  5K5O A;  4PGG A;  1Z9C A;  5EEG A;  4H0E A;  4QLC U;  2EWN A;  3ROU A;  2XRN A;  4OU0 A;  3BP8 A;  5JFR A;  1KYW A;  5K1Y A;  1ZGA A;  2L54 A;  4IJA A;  1DUX C;  1K79 A;  1XCV A;  4S04 A;  4EJT A;  5D4S A;  3H3Z A;  1TBX A;  2ESN A;  4ON0 A;  3I64 A;  4O5V A;  3DQV C;  2QVO A;  2HEO A;  1OPC A;  4UXN A;  2Q8K A;  3K2Z A;  3ABT A;  4A0X A;  4UVC A;  2Z33 A;  3H92 A;  3VB2 A;  3P9C A;  1P2F A;  1SAX A;  3TO9 A;  4KIF A;  4EJW A;  2YSR A;  5CJ9 A;  3TDU C;  5H20 A;  2P5V A;  5E8G A;  1BI3 A;  1FOK A;  5D5X B;  1GXP A;  2CYY A;  3TOB A;  1R22 A;  3L9F A;  2M1B A;  2RV8 A;  4L18 B;  1H9T A;  4FX0 A;  4UV9 A;  2XAF A;  2AXL A;  3QP6 A;  4OMY A;  2E7W A;  5HS8 A;  1MDM B;  3QPH A;  1WSU A;  2O8X A;  1B1B A;  1XGM A;  5H6Q A;  2CQK A;  1LQ1 A;  1EH7 A;  2VBW A;  2AS5 F;  5KK1 A;  5DCM A;  1HW2 A;  1YS6 A;  2ISY A;  5CVU A;  5D6E A;  2YX7 A;  2LNB A;  3TDZ C;  3KP2 A;  4NB5 A;  1QO0 D;  3QU6 A;  2PLY A;  3LAJ A;  1XDU A;  3KZY A;  3WTZ A;  4KYW A;  2W85 A;  4BYY A;  3QOP A;  4EV0 A;  3ULQ B;  3DV8 A;  4YIF A;  1TTY A;  2UWM A;  2FNA A;  3GEZ A;  4F7Z A;  1V3F A;  2DQL A;  1SFX A;  3GXO A;  5D5W B;  5D8L B;  3TOA A;  1USS A;  1S7A A;  2F5C A;  4ZZD A;  1K78 A;  4P9U A;  1YW7 A;  1R23 A;  2GWR A;  2CO5 A;  5LGU A;  1XCB A;  4M9Z A;  5FD6 A;  4U0Y A;  3HHG A;  2OZU A;  1MKM A;  5F1R A;  3LAP A;  2QM3 A;  2IVM A;  4EM1 A;  4Q47 A;  1WI9 A;  3BRO A;  2W57 A;  3RPU A;  4ENM A;  2DAO A;  5L3B A;  2EV0 A;  1ULY A;  5AIQ A;  1Z91 A;  1BIA A;  2D1V A;  4G94 A;  3OOP A;  2EV5 A;  3FXQ A;  2HWV A;  5HLI A;  4KIB A;  1W7P A;  4HF0 A;  4KNY A;  1G3W A;  1T98 A;  3DPT A;  2EK5 A;  3V7C A;  3WE2 A;  2PFB A;  2XGX A;  1ZYR F;  1RZ4 A;  1XDS A;  3ML6 A;  1J5Y A;  1R1U A;  1JHH A;  5DD4 A;  5IT9 K;  1PP8 F;  1FT9 A;  4L9T A;  5LRR A;  4G6D A;  4U7B A;  4HX8 A;  1QZY A;  1BOA A;  4KT5 C;  2RGV A;  4IVN A;  4I09 A;  4I98 B;  2XV4 S;  3RPQ A;  3DFG A;  5D5U B;  2EA4 A;  3F6O A;  3GF2 A;  1R00 A;  5E1Z B;  2FMY A;  5L3D A;  4M71 A;  2A61 A;  2XKO A;  1KQ8 A;  1CF7 B;  2CG4 A;  4EJU A;  2M45 A;  5TJJ A;  4PZJ A;  2R7D A;  2BGC A;  5ICE A;  2CGP A;  3GZ6 A;  4LG0 A;  1IAW A;  2Z3Y A;  3M9A A;  3WTY C;  2J5P A;  3PQK A;  2OA4 A;  1YW9 A;  4ASN A;  2LDU A;  2VOP A;  4G9Y A;  1P4X A;  1IZ1 A;  3SZT A;  5K5Q A;  1IW7 F;  4EJV A;  2QQB A;  2RVC A;  3KLO A;  4LFU A;  4MHG A;  2L02 A;  3K0L A;  5A2Q Z;  4EVI A;  2P4W A;  3GFJ A;  3ZMD A;  2NRA C;  1R1V A;  1O7F A;  3VFZ A;  3GVA A;  3GLX A;  1Q1H A;  4A6D A;  2EFQ A;  2QQ9 A;  4M6Y A;  5FD5 A;  4MEX F;  4UVB A;  1MJA A;  3K69 A;  5CVR A;  2UZK A;  4KIC A;  2RNJ A;  4RGR A;  3E5X A;  3RDI A;  3JSO A;  4M9X A;  4L0Y B;  4IRG A;  3MFK A;  3C1D A;  1AWC A;  2CWE A;  3CUQ C;  1I27 A;  4A6E A;  1IUY A;  4CGZ A;  4FT8 A;  4MQV A;  5LLQ A;  4ESF A;  3F3X A;  4WF2 A;  3GZ5 A;  2G7H A;  4N9I A;  4ZYE A;  3KP6 A;  2FBI A;  1FZP B;  3CUQ A;  1PP7 U;  4IF4 A;  3J81 Z;  3LA7 A;  3MEX A;  3HTS B;  3L00 A;  2XIG A;  1XMA A;  3EQL F;  2D1H A;  4WXD A;  1RUN A;  2MA3 A;  4KN7 X;  3V8K A;  1LB2 A;  2P6S A;  5E8I A;  4BHB A;  3HHH A;  2NNY A;  2EFO A;  4BNC A;  1Z05 A;  3KCC A;  2MLG A;  2L4A A;  5LHH A;  3M7G A;  2RDP A;  5K5R A;  3RTR A;  2VBZ A;  2RN7 A;  2D45 A;  4CO8 A;  4IPA A;  1EV7 A;  1MGT A;  2CFX A;  2IA0 A;  4RGS A;  1TLH B;  2XUB A;  3RYP A;  1P6R A;  4FHT A;  3L2C A;  2MLK A;  2VXZ A;  1CF7 A;  1R7J A;  3I58 A;  2L4M A;  2OQR A;  4G7Z F;  4EGY A;  2HGC A;  4HDV A;  1FLI A;  2XHK A;  1FYL A;  2IPQ X;  2NAZ A;  2ZCW A;  1STZ A;  2JPC A;  1IXS B;  3NRV A;  3RI4 A;  4ZYD A;  1Z7U A;  1ZAO A;  1HST A;  5L3G A;  5JR3 A;  2F5E A;  4RS8 A;  1XD7 A;  5DCM B;  3RKW A;  2LF7 A;  3DXJ F;  5HDN A;  4K2E A;  2H27 A;  1RNL A;  4JBA A;  1UFM A;  1FWZ A;  2JRT A;  2O61 A;  1KQ0 A;  2A68 F;  3RYR A;  1B9M A;  2IA2 A;  4IRI A;  3B73 A;  2VE9 A;  1YYV A;  2A6E F;  3JW4 A;  5IT3 A;  1SD5 A;  1OMI A;  2EFP A;  2G9W A;  5D8K B;  3FHZ A;  4LLN A;  3CJN A;  3G73 A;  3FXU A;  2HZT A;  3T5X A;  1EH8 A;  1SMY F;  3Q9V A;  4HA8 A;  1O3S A;  4WX9 A;  3VOD A;  4YII A;  3SZP A;  2KJB A;  1J7K A;  1U6G A;  4PGH A;  2GA1 A;  5DYM A;  2XRO A;  1R1T A;  1SD7 A;  3Q9S A;  3F8F A;  4OIN F;  4KN4 X;  3WGG A;  1YQA A;  2VT2 A;  1U3E M;  1UCR A;  4G6Q A;  3ZMV A;  2DTR A;  3G3Z A;  3E6M A;  3ZMT A;  3FWE A;  2MBF A;  3R0J A;  4EJO A;  3F8N A;  1W7P B;  1KU7 A;  2XAG A;  3EDP A;  3LQQ A;  4L5J A;  2FXA A;  3RJP A;  4HX4 A;  3RKX A;  2HYF A;  2M87 A;  4LGW A;  2JZY A;  1MZB A;  3GFL A;  3NQO A;  3F6V A;  3TO7 A;  1H9G A;  3F8B A;  1LVA A;  3FF5 A;  5LGT A;  3R6S A;  2ZFW A;  5CLS A;  4A0Z A;  2MC3 A;  1TNT A;  2ZJ2 A;  4I01 A;  1FNN A;  3L7W A;  1D8J A;  2JSC A;  3DP7 A;  4N9H A;  4L0Z B;  3HIF A;  5J8F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...