3L9FA

The crystal structure of smu.1604c from streptococcus mutans ua159
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
170
structure length
170
Chain Sequence
MQGKDIILGILSKKERSGYEINDILQNQLSYFYDGTYGMIYPTLRKLEKDGKITKEVVIQDGRPNKNIYAITESGKKELASYLQSDVNDEIFKSDFLMRLFFGNSLNDDDLEQLIREEIERKEEKIKRLSENLEIWKKKGELTPTQEITIKYGLAQYKSTKKVLEEELAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of smu.1604c from Streptococcus mutans UA159
rcsb
source organism Streptococcus mutans
molecule tags Transcription regulator
molecule keywords Putative uncharacterized protein smu.1604c
total genus 59
structure length 170
sequence length 170
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03551 PadR Transcriptional regulator PadR-like family
A PF10400 Vir_act_alpha_C Virulence activator alpha C-term
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l9fA01
2LF8A 4CZZA 1O3RA 4PDKA 2QUFA 3WTVC 1TW3A 3GVAA 4UV9A 3KP6A 4RB1A 1Z91A 4LK0F 2A07F 1FP1D 2ISYA 4ZH4F 1HXDA 2A5YB 4N0BA 5FGMA 2ZFWA 2QM3A 2FBIA 1XCVA 3HHGA 2DO7A 4OMYA 4ESBA 5K1YA 1ZREA 3WU0A 2EV0A 4XBFA 1QZZA 2CO5A 4LJZF 5A2QZ 4DNCA 4M9SA 3KP3A 2EFPA 5FD6A 2MLGA 5H6RA 4GXOA 4A0ZA 2E7XA 3COAC 3BROA 4M72A 2L4MA 2A61A 5ILVA 1I6XA 2R7DA 4P55A 3VB2A 2F5CA 4MHGA 5HLGA 2QQAA 3C3WA 3FXUA 4YIFA 1JHFA 3M8EA 3G73A 5D5XB 5E20A 2CGPA 3LQQA 2P7VB 4D0PA 5CVVA 1IF1A 3N4MA 1OPCA 3KE2A 4LB6B 3TDUC 4L0YB 2JTVA 3DKWA 1LB2A 1A04A 1LJ9A 3RTRA 2P6SA 4MEYF 2M5WA 2GA1A 1YTYA 1YS7A 2IW5A 1ZLJA 4O5VA 2PMHA 4ENNA 2P4WA 4L5IA 5E17F 1BBYA 2BGCA 5CVJA 3GFMA 1ON2A 2PMUA 4IRHA 1MJAA 4KYWA 4HX4A 1ZARA 4HQEA 2BE5F 2W24A 1GVJA 3BDDA 3KEOA 4M6XA 3EETA 2XAGA 1U3EM 2FNPA 3KFWX 2ZKZA 4OINF 3REOA 1BI1A 2EK5A 3KZZA 3PQKA 4LG0A 2HWVA 4MEXF 2K27A 2HKXA 1MDMA 2P8TA 2LF7A 3JAMZ 2XKOA 1W5SA 1STZA 3WGIA 4JK1X 5H20A 1FX7A 2O03A 4I0AA 2UZKA 4ESFA 4RB2C 2KKOA 5D6EA 4ZZLA 3V8JA 1TW2A 5D5UB 5LBQA 3DV8A 4U0VA 1F5TA 1BC8C 3MAJA 2X4HA 2GZWA 1H9GA 3FM3A 5F6FA 5LRRA 2DW4A 3HHHA 4LLLA 1HW5A 1Z1DA 1YQAA 4BYYA 3CJNA 1S29A 5F1RA 2OZUA 5ICGA 5ILSA 4HYEA 1QZYA 2O6GE 1ZRCA 3WTSC 3RKYA 3ZQ7A 4ZYEA 4IHTA 4JBAA 1LDDA 1XGSA 4XLPF 4BH9A 3O6BB 3H92A 3KP5A 5K5RA 3F6OA 5KVRA 2G7HA 1TQIA 2YSRA 5E18F 1BI0A 2XAJA 3R0AA 4L5JA 3I54A 2VOOA 2ZXJA 1KU3A 4UXNA 1FBSA 2B0LA 5EEHA 3P7NA 1QPMA 5HVQC 1W7PD 3TQNA 3CUQB 2WWYA 3V7CA 1KQ8A 1XMAA 5J8CA 2ACJA 3GFIA 2MA3A 5HS9A 3BZ6A 3BPVA 2Q8KA 4KA4A 3E6BA 4KNYA 2HOEA 4LGWA 1FYLA 3DFGA 5FB2A 4EM0B 1D8KA 2XVCA 4IXAA 4I98B 2X0LA 1DP7P 2MC3A 4S04A 2STTA 2HEOA 3HOSA 1JHHA 4PZJA 4BHCA 3GO5A 3LAJA 3HYIA 3QPHA 2ZBKA 2HFHA 2UXNA 1FOKA 4A0XA 3L2CA 5FLXZ 5E1WA 5LLQA 3GWZA 4L0ZB 4IPAA 5HLHA 2V79A 2Z99A 3HSEA 3WE3A 3FMQA 4RAYA 4UV8A 4KT5C 3E5XA 1J75A 3KLNA 2AXLA 1B6AA 1FC3A 1IN4A 2XROA 2BEOA 4Q4ZF 1SMYF 4BAYA 3CUQC 2FNAA 2WC2A 2OQRA 4CDGA 2OD5A 3MFKA 2GWRA 2NRAC 3QP5A 5FD5A 4EJOA 3KLOA 1J5YA 1R36A 2GXBA 4EJTA 1XN7A 4GYIA 2FU4A 4A12A 1DPRA 3M1EA 3GW2A 3ZMDA 1DDNA 2ETHA 2HGCA 3BJ6A 3K0LA 1JGSA 2FBKA 4N9IA 3HRTA 2HQRA 5L3GA 2LNBA 1XD7A 5D4RA 1FPQA 2GQQA 1BIAA 4IJAA 3WTYC 4XRFA 2V1DA 5LGUA 2L54A 5HDGA 1YYVA 3LA7A 5FFXA 4P5OA 4M9XA 2J5PA 3FF5A 4M6YA 1YO5C 4OMZA 1QQIA 3EQLF 4QLCU 3NEUA 2UXXA 4RGRA 3L9FA 4HF1A 1J0RA 4HW0A 3SQNA 5FLXK 3T0YA 1E17A 3HTSB 4B8XA 3ZN1A 3JTHA 3WODF 4Z2YA 1K78A 2VBWA 5JHUA 2V6CA 3M8FA 1MJBA 1SFEA 4KUMA 1WKMA 3TDZC 4H0EA 2AS5F 4XSXF 1JE8A 1VTNC 3DPLC 2XAQA 1H0MA 4M9ZA 2DFIA 3Q5FA 2L02A 1Y0UA 4UVAA 4EMSA 3E97A 2ISZA 3JTGA 3KP4A 2H6CA 4ENJA 1QO0D 3WE2A 4R8HA 2VT2A 1RIOH 4Q47A 4CXFA 4MGRA 4RAZA 2KIUA 2IP2A 1K6OA 1YS6A 1EH6A 3K1NA 5ED4A 3GFLA 4QWQA 3KZYA 3HRUA 1T2KA 2XIGA 5DUIA 1R23A 2F5DA 3J81Z 4U7DA 3ECHA 3B02A 3GF2A 2R3SA 3RKXA 1XSXA 2FMYA 2IA2A 3M7GA 3QU3A 3EUHA 3QU6A 3P9KA 1O3TA 1W5TA 2JPCA 3CTAA 1NHAA 2DPUA 2M1BA 1P92A 1ULYA 5IT9Z 3RI4A 2DI3A 2FF4A 3ZP5A 3WGHA 2H09A 1W4MA 1TQPA 1EH7A 2VC0A 4G6QA 3KETA 3H3UA 3H3ZA 3PFIA 3IWZA 5AONA 1FT9A 3K1PA 5H6QA 1B4AA 5HDNA 1O3QA 1S8NA 4G6DA 1QGPA 3R61A 4O3MA 2HZTA 3F3XA 3DXJF 1KU7A 1GHCA 1TNTA 1XGNA 3QOPA 2VXZA 1XSVA 5CJ9A 3WTUC 2A69F 2HTJA 2EFQA 1ODDA 5HOOA 3KP2A 1IRFA 1XGOA 1ZG3A 1XDUA 2DQRA 1H9TA 1O57A 3WTZA 3LAPA 3IWFA 4FHTA 1RI7A 3EYIA 3K2ZA 3L00A 4AWXB 1U8RA 3R60A 4LB5A 1ZHFA 5HS7A 5DD8A 3F6VA 2JZYA 3TO9A 2OBPA 2W84A 2QLZA 3K69A 1SFUA 4YFNF 2ZNZA 2DAOA 3E5UA 5TRDA 2CWEA 4A6DA 1G3TA 2JRTA 1R1UA 2XUBA 2YR2A 4YG2F 4A5NA 5L3FA 4I2OA 4IF4A 3JSOA 4YFKF 4F7ZA 2KJCA 1CF7B 5ICCA 1MDMB 2O3FA 1LNWA 2G9WA 3TGNA 2P5KA 2BYVE 2Z9OA 3QP6A 5D5WB 1O3SA 2PQ8A 1LDKB 1XMKA 1MZBA 1FSHA 3E6CC 1KGSA 3N97A 5EEGA 2RC4A 3SFZA 4UVCA 1FP2A 4EV0A 3FM5A 2PG4A 1BI2A 2ZJ2A 1Z6TA 4RS8A 1MKMA 2YX4A 3V7SA 4WCGA 1CGPA 4BHPA 3P9CA 4EQQA 2QVOA 3I58A 1YG2A 3GZ6A 4G94A 5BS6A 5FO5A 4OIPF 1K7AA 1LQ1A 5L3EA 4ENKA 2HR3A 3FX3A 1HKTA 2EFOA 3BPXA 3FHZA 1T6SA 1TTYA 2HS5A 5BMZA 3I0TA 5LEKA 2M30A 3ZPLA 2M8EA 3HIFA 3IHUA 1IXSB 4HF0A 2EJRA 3JSPA 2XAHA 2VN2A 3QRFF 1AOYA 4LFUA 4Q48A 2VC1A 2ZNYA 1S7AA 4HV5A 2DLLA 1G3YA 3K1MA 4YFXF 2XHKA 4EGZA 1LDJA 1KU2A 2V9VA 3MZHA 2FE3A 1BM9A 5E1ZB 1RNLA 3GYHX 4U88A 3VODA 1ZH5A 2DBBA 3CO7C 3I59B 1G3SA 2H6BA 1W7PA 4OIOF 2RKHA 5BPIA 3FMSA 1QNTA 2W57A 5LGNA 3HRMA 4PGHA 1XB4A 1YW7A 3RJPA 1FYMA 1UFMA 4HOBA 1ZG5A 4ON0A 3LFKA 5LHHA 2RN7A 5TJJA 4N9HA 4XLNF 1D3YA 4PCQA 4HBLA 4FX0A 4KIBA 1Z6RA 1USTA 1HBXG 4MNUA 2FMLA 3BY6A 5F64A 4O6JA 3F8CA 2RVCA 1USSA 1T0FA 5L3DA 2DPDA 4GYGA 4KFCA 1OMIA 3W6JB 1YIOA 3DF8A 5JVTA 4M74A 3D0SA 2HYGD 1D8JA 3L7WA 2VODA 4IRGA 1R1VA 2NNNA 1TQMA 4I7HA 3FXRA 5LRSA 2K86A 4LG0B 4B09A 1SD7A 1J7KA 2NAZA 4EJUA 3TKYA 2QYOA 1AWCA 1E2XA 2O0YA 4HAMA 2QBYB 1WQ2A 2A68F 2H94A 5ICFA 2K4BA 1J9IA 3Q9SA 1R5HA 1YFHA 4LLGF 3FWEA 1FWZA 5CVUA 1B9NA 3PQJA 2QQBA 1SD4A 3T8RA 1R22A 1FY7A 3J80K 1V4RA 4HF2A 1UB9A 3LA3A 1ZRFA 1J2XA 2ELHA 1BN5A 2ADUA 3HTUA 4EVIA 2VBZA 3ELKA 1CF7A 1IUYA 1IXCA 3B73A 4AVPA 4DQ2A 3CLOA 1IN5A 3WTTC 4Y17A 5LEJA 4YIIA 1YW8A 3AAFA 3CDHA 3CUOA 2HQNA 1EV7A 1TNSA 3GLXA 4I09A 2RNJA 2F5EA 4HDUA 1RUOA 4HDVA 3E3VA 3ECOA 3QAHA 1G4DA 2O8XA 4LK1F 1PDNC 2J5OA 4HLYA 1R7JA 2FBHA 4AIKA 4BXUA 2DQLA 5LHGA 1QBJA 5E8IA 3SZTA 1F1ZA 2PEXA 4MTDA 1U6GA 4KDPA 3TOAA 2Y75A 4FT8A 2FEZA 3TO6A 1KQ9A 1K79A 2OA4A 1WI9A 4Y13A 1S3JA 5CYVA 3HRSA 1IAWA 3DP7A 4IHSA 2GXGA 3MQ0A 3TO7A 4CO8A 5CLSA 4A6EA 3SHFA 4TV7A 2VBXA 2DTRA 2FOKA 4L9VA 3HSRA 3M9AA 1HKQA 2XKPA 1R1TA 1FNNA 4EGYA 3F8FA 2KIFA 5E1XA 3MWMA 2IT0A 2MBFA 4AD9A 3J80Z 1HQCA 2L4AA 3EDPA 3DEUA 1B59A 2MH2A 4EJWA 3NRVA 5IT3A 4BHBA 2FXAA 2Y0MA 4AIHA 3KP7A 4L18B 3R0JA 3J81K 4WXDA 1T39A 2GIVA 1BJAA 3O2PE 3NQOA 3SZPA 3F21A 5JI6A 1P2FA 4G8XA 3FXQA 2MH9A 3C18A 2QZ8A 1R5GA 2EFNA 3W6KB 2ZCWA 4RGUA 1O7LA 1DPUA 1ZYRF 2Z3YA 1C0WA 1ZLKA 3IKTA 1IW7F 4EJVA 1G3WA 4L9TA 4M71A 1P4XA 3HSFA 3VOEA 3ZMZA 5L3CA 2EA4A 5D6FA 1SMTA 3I4PA 2K02A 2CFXA 2A6EF 4HZFA 3WGGA 3EYYA 1FZPB 2M87A 2EV5A 4NB5A 3IL2A 1O7FA 3P9IA 4CHUA 3LQRA 1I1GA 2ZO4A 2YU3A 5ICEA 1YLFA 3HOTA 4G7OF 2XASA 1B9MA 1RZ4A 4OIRF 1HSTA 2JSCA 1BC7C 2L01A 2JPBA 1ZGJA 3ZN0A 3WTXC 1LEBA 4U0YA 5DV5A 2PJPA 2CQKA 3IKVA 3BJOA 2GAUA 4I02A 2Q2EA 4CGZA 1Q1HA 1L0OC 2FSWA 4HA8A 2A3SA 1LVAA 1U78A 3ERED 2EWNA 4A5MA 3L09A 2E1NA 2E7WA 2RGVA 1ZRDA 3C7JA 1HW1A 1U2WA 2H27A 2RQPA 1OKRA 4K2EA 1XCBA 2F2EA 1P6RA 2D1HA 5AIQA 3IRQA 4P9UA 1P4AA 1TLHB 5K5OA 3SXYA 4GCVA 2K4JA 2LKPA 3K9TA 2IA0A 4WX9A 3ISPA 2IJLA 1L3LA 2OZ6A 2R7FA 3V8LA 1XDSA 4NHJA 4CYDA 2FRHA 4WF2A 4LLNA 1TBXA 4OU0A 5FFZA 3C1DA 5ERIA 1F4KA 1B1BA 2OU2A 2ESHA 5D8KB 2KJBA 3V4GA 2OAZA 3IC7A 3S2WA 3GFJA 2PN6A 4JQFA 1OYWA 4FX4A 3D5LA 4KIFA 2MD5A 3GXOA 5DD4A 3FMRA 1ZGAA 3ZMSA 4EM1A 5DCFA 1GXPA 4ZYDA 1FBUA 4ENMA 5IT9K 2EFWA 4KMFA 1I1SA 4S05A 5J8FA 4OOIA 2DU9A 1IN7A 5DEQA 5K5QA 3J7AO 3I59A 5ILUA 1YW9A 2E1CA 3FZVA 4BNCA 1IRGA 1WWXA 2Z5UA 3O3KA 2XGXA 1IZ1A 4GGGA 2GA2A 1MD0A 3ZMUA 5LGTA 3BWGA 5D4SA 3ROUA 3DQVC 4WK8F 1FBQA 3I71A 4L9NA 1Z9CA 1SD5A 2W85A 4ZYHA 3I5UA 5DCMB 1FLIA 5D8LB 2FA5A 1HSJA 2CSOA 1SD6A 2HTSA 2Y48A 4ESJA 3BP8A 4KICA 2K7LA 1ZG1A 4ASNA 1HKSA 3ULQB 1X3UA 4IRIA 4UUVA 3ABTA 1U5TC 3E5QA 4KN4X 4WWCA 1DUXC 2TDXA 2O61A 3RPQA 1JXSA 4A0YA 2IRFG 1OYIA 4EM2A 3RKWA 4HQMA 4RB0A 2PLYA 2XV4S 3E6MA 2YX7A 2DK8A 2VT3A 4UVBA 2EA2A 3TOBA 2PBIA 2NYXA 3F22A 3I64A 3RIRA 2PI0A 4U7BA 1KQ0A 4GO1A 2VBYA 2CW0F 4ZZDA 3RYPA 2MLKA 2PFBA 1IN8A 4M73A 2UWMA 2G7UA 2ZMEA 5BQTA 2ESNA 2STWA 2HKOA 4RGSA 2RDPA 5AIPA 1UCRA 1G6NA 3GUDA 3ZMTA 1SAXA 1HW2A 2HYFA 3MCZA 2D1VA 4LMYA 4G7ZF 3GEZA 5HDKA 1WSUA 4MQVA 1T38A 3JW4A 3ML6A 5BPDA 1IXRC 4MTEA 3WG9A 5KK1A 1Z7UA 1I5ZA 1R00A 2COMA 1P4WA 1S6LA 2IPQX 3F8MA 1PP8F 3T5XA 3RDIA 1FYKA 3U2RA 2IA1A 4G9YA 1REPC 1UHWA 3R4KA 2DK5A 4AIJA 4U0WA 2C6YA 2IVMA 1IN6A 2BBYA 1KYWA 3VEPA 1ZAOA 1EH8A 2KRFA 2NNYA 2VE8A 6PAXA 1SFXA 1D5VA 4P96A 4HV6A 3I53A 3OV8A 1FSEA 2WTEA 1LEAA 1R58A 3GX4X 3MEXA 2QWWA 3MZYA 2D2WA 3CUQA 2OQGA 2RV8A 2BV6A 3KCCA 4L9JA 1PP7U 2FQ3A 4XSZF 1OYYA 5D5VB 3DPTA 5HLIA 5E8GA 3VFZA 1U5TA 2DT5A 5LHIA 4BQAA 1UHMA 3LSTA 4UNOA 3WU1B 2Z33A 2NS0A 4Y15A 1V3FA 3U9GA 1MJ9A 1MGTA 1ON1A 1ZN2A 1S7OA 4I0BA 5J6XA 1PUEE 2D45A 1F9NA 4ZYGA 3V8KA 3T8TA 4P9FA 3T1BA 3Q9VA 4HX8A 5BOXA 3IRRA 2A6HF 4IVNA 3F8NA 2WV0A 5CVIA 3RPUA 1Z05A 3KEQA 4KN7X 4UHTA 2L3DA 2F5FA 3BOQA 3WTWC 1K78B 2XRNA 2W25A 3JAMK 2V1UA 3LA2A 3ABUA 5A2QK 4G7HF 4Q5SF 4KIGA 2QBYA 2VOPA 1RUNA 5L3BA 2LDUA 1WRJA 5DUKA 2QENA 2P5VA 2EB7A 2LSOA 3E6DA 2EV6A 1BI3A 2XAFA 3F72A 1W7PB 1KU9A 1T98A 1XGMA 4I01A 4R1HA 2CYYA 3CO6C 3U1DA 3QPTA 1U5TB 4A2UA 2M45A 3HUGA 2P7CB 2JT1A 4OIQF 2P5LC 3G3ZA 3GZ5A 4HLXA 1BIBA 4WXCA 4RB3C 2HDCA 2ZMEB 5DCMA 5HS8A 3OOPA 4NQWA 4ETSA 1I27A 1ONVA 3BJAA 4PGGA 2KIMA 3V7RA 3LWFA 3F8BA 5DYMA 5JR3A 2V1XA 2YPRA 4CICA 5CVRA 4R79A 2CG4A 4E70A 5JFRA 1BOAA 4RGXA 3R6SA 1XSDA 4KMUX 1KA8A 5DDGA 1KYZA 4WXHA 2VE9A 4MQ9F 4HX7A 2P6TA 1J59A 2QQ9A 4LD5A 2VONA 1OR7A 3F23A 3ZMVA 3RYRA 2Q0OA 1GXQA
chains in the Genus database with same CATH superfamily
2LF8A 2DFHA 4CZZA 1O3RA 1OCZH 2LMDA 4PDKA 2HVRA 2KP6A 2QUFA 3WTVC 4HSRA 1TW3A 3JRHA 3GVAA 4ITVA 1GV2A 4UV9A 3KP6A 4D1QA 1MIJA 3PNTA 4RB1A 2JUCA 1Z91A 4LK0F 2A07F 2KRCA 1FP1D 2ISYA 4ZH4F 2VLAA 1JJ6C 2PJRA 1HXDA 4CH7A 5B5EC 2A5YB 4N0BA 5FGMA 3VSKA 4CCJA 4XK4A 2ZFWA 3W2AA 4BJ6C 1FEXA 4JX6A 2QM3A 3L2UA 4NC7A 2FBIA 2IAIA 4RAFA 1XCVA 4DIQA 3A2KA 3HHGA 2IS4A 2DO7A 4OMYA 2DMQA 2EZLA 2QQ8A 1JJ8C 4RAGA 1MNDA 4ESBA 5K1YA 1ZREA 4BY1J 2IXSA 3H3VK 3S3OA 3WU0A 1ACIA 2EV0A 4XBFA 1QZZA 2CO5A 4LJZF 1HDPA 3DBRB 5A2QZ 4A3MJ 2CQQA 4DNCA 3FKJA 4Y3OA 4M9SA 3KP3A 1TWHJ 2EFPA 5J40A 5FD6A 1T8IA 2MLGA 5H6RA 4GXOA 3RZOJ 1HF0A 4A0ZA 3A1YA 2IGOA 2E7XA 3COAC 5HNFA 2X1CA 3BROA 4M72A 3DKXA 4II2A 2WB1N 1X1BA 1XG1A 2L4MA 1YX5A 1BL0A 2WAEA 2A61A 5ILVA 2F4IA 2MW8A 1I6XA 2R7DA 3FK7A 1TWFJ 4P55A 1MSFC 1RKTA 3VB2A 2R5ZA 3MVPA 2F5CA 2RREA 4MHGA 5HLGA 2QQAA 3C3WA 3FXUA 4F3QA 4MFEA 3TP0A 3OYBA 4YIFA 2PMZN 2VASA 1JTXA 4BQOA 1JHFA 3GTLJ 3M8EA 3G73A 5D5XB 5E20A 3GTGJ 2CGPA 3LQQA 2P7VB 2WV1A 4D0PA 2CMPA 5CVVA 1IF1A 3N4MA 1NH3A 1OPCA 1Y1WJ 1YITI 4XKWA 2OTLI 2W7NA 4XR6A 3F0CA 2NVUB 4GRIA 4ZDLA 3KE2A 4LB6B 3TDUC 4L0YB 1X1CA 4IHWA 2JTVA 3DKWA 1LB2A 1A04A 1SVMA 5FROA 3Q0UA 1LJ9A 3RTRA 2P6SA 2LBFA 2HI3A 4MEYF 2HOTA 4I76A 3ASOH 2M5WA 3LSIA 5DM7F 2GA1A 1YTYA 1YS7A 1OCTC 2IW5A 1ZLJA 3ESWB 4O5VA 5JVGF 1ZR2A 2M3AA 2X6XA 2PMHA 4MO7A 2M9HA 2K3FA 4ENNA 2M8GX 2P4WA 1OJLA 4L5IA 3RCOA 5E17F 1KZHA 1BBYA 2BGCA 1LE8A 1ETXA 1Y56A 3GFMA 5CVJA 4IOAF 1ON2A 2XPWA 3CCEI 4UB8C 2HYJA 2KQRA 2IBDA 3VSLA 2PMUA 3C2HA 3D5SC 2VKVA 1P9QC 4IRHA 1MJAA 3VYUB 4KYWA 3S2DJ 2KFDA 4HX4A 1D0ZA 1ZARA 2V1NA 4XKCA 4HQEA 2BE5F 2W24A 1GVJA 3BDDA 2E36A 3KEOA 1ETQA 2BY3A 4M6XA 3JR9A 2R5ZB 4HRIA 3EETA 2XAGA 5F1JA 3FXLA 2XGDA 4BKXA 1U3EM 2FNPA 3KFWX 3A02A 2ZKZA 4OINF 2WA0A 3REOA 1BI1A 3U21A 4ZTJA 2EK5A 3KZZA 3PQKA 3FIWA 3OL4A 5HLTA 4JP0A 4LG0A 1BR1A 2HWVA 1VQ9I 4MEXF 1IRZA 2K27A 2HKXA 1D0XA 1MDMA 2P8TA 2LF7A 3JAMZ 2XGEA 2XKOA 3JRFA 2EIMH 1MBKA 1W5SA 2CJJA 4HNTA 1STZA 3K7AJ 4CSWA 3WGIA 2L7KA 3D5RC 2CV2A 2KPMA 4JK1X 1HA8A 5H20A 1FX7A 2O03A 4I0AA 3OSGA 4PJNA 3HOZJ 4DYRA 2UZKA 4ESFA 4RB2C 2KKOA 5D6EA 4ZZLA 2NVQJ 3V8JA 3MKYB 1YJNI 2AQEA 5HNHA 1EA3A 1TW2A 2BY0A 2VXDA 3LSJA 3SJMA 5D5UB 5LBQA 3DV8A 1IDYA 2MG4A 4KITB 4BJTA 3GTJJ 4BQQA 4IHVA 4U0VA 1F5TA 1BC8C 1JT6A 2VJ4A 1E0EA 1WH5A 3MAJA 2X4HA 2GZWA 2MD0A 4C30A 2I10A 2M4GA 3EPZA 2DYSH 1H9GA 3FM3A 5F6FA 4V2FA 5LRRA 2DW4A 2LVSA 3HHHA 2L9NA 3GZNB 1HW5A 2XPUA 4LLLA 5B1AH 4D7NA 1SFKA 1VQ6I 1Z1DA 1YQAA 4BYYA 3CJNA 1A35A 1S29A 2XRLA 5F1RA 5IYCJ 2OZUA 5ICGA 5KNLA 1Y8QB 5ILSA 3WHBA 5IP6A 4HYEA 1X4OA 5JLWA 1QZYA 2B63J 3CC7I 2JA2A 2O6GE 3KEYA 1ZRCA 3WTSC 3RKYA 2LFBA 1MBEA 3ZQ7A 4ZYEA 2VUMJ 4IHTA 2BW3A 1FMWA 4JBAA 1LDDA 2VQCA 3JRBA 1XGSA 2M0CA 4XLPF 1W36D 1F43A 4BH9A 2LRDA 2BW3B 2XPVA 3VYSB 3O6BB 1UZCA 3E1SA 3H92A 3KP5A 5K5RA 3F6OA 2KZVA 5KVRA 3S1QJ 3QYEA 2IS6A 3OS0A 2G7HA 1TQIA 2DCEA 2YSRA 5E18F 1YRNB 2R7ZJ 2PMZA 3ERMA 1BI0A 2R92J 2XAJA 4BE1A 1MMSA 3R0AA 4L5JA 3K4NA 3I54A 1Z3XA 2VOOA 3JRGA 3AL0C 2ZXJA 1KU3A 1UG2A 4UXNA 4XIDA 1FBSA 2B0LA 1SAUA 5EEHA 3P7NA 2K9LA 1MMNA 1QPMA 5HVQC 3K4JA 4B47A 4DBRA 1W7PD 3TQNA 1JGGA 4AIDA 3CUQB 3PNYA 2WWYA 3V7CA 1RRJA 2LK2A 3FK6A 4LITA 3OS1A 2IGKA 3IP4B 1XMAA 1KQ8A 2PX9A 5J8CA 2E2IJ 3SZGA 1MH3A 2ACJA 1WI3A 5IYBJ 3GFIA 1D1BA 2MA3A 3GCMA 5HS9A 2VQGA 3BZ6A 1ETWA 3BPVA 2Q8KA 4KA4A 2NVXJ 3E6BA 4KNYA 2HOEA 1NK3P 4LGWA 1FYLA 3DFGA 4DYQA 5FB2A 4EM0B 1T95A 1D8KA 1QRYA 3IAM2 2XVCA 5M5WJ 4IXAA 4I98B 2X0LA 1DP7P 2MC3A 4S04A 3FHNA 2STTA 2JSPA 1RR7A 5EZHA 1D1AA 1JKRC 1A5JA 4PUSA 4BEHB 2JJ7A 2QA4I 3HOSA 2HEOA 1JHHA 4PZJA 4BHCA 3GO5A 3LAJA 3HYIA 1MMGA 2HOSA 3QPHA 2VB6A 2ZBKA 1Z21A 2HFHA 3V42A 1WZ2A 3DLAA 1ETVA 2UXNA 1FOKA 4A0XA 4NC6A 1R71A 3L2CA 5FLXZ 5E1WA 4B48A 5LLQA 3GWZA 4DBQA 3BG5A 4L0ZB 4IPAA 2DODA 5HLHA 2LH9A 4RDUA 2V79A 2Z99A 3HSEA 1XMXA 1HC8A 3K10A 3FMQA 4UV8A 4RAYA 3WE3A 4V19K 4KT5C 3E5XA 1J75A 3KLNA 3S16J 2AXLA 2Y2ZA 4P1WA 1B6AA 1X2NA 1RETA 2GOXB 2JK3A 4E7LA 2JRMA 3IH3A 1FC3A 5F0HA 3UR3C 3G1OA 1I3AA 1IN4A 3KPHA 2XROA 2BEOA 3OYLA 4Q4ZF 1SMYF 2LD5A 4BAYA 3CUQC 2FNAA 2MSYA 3UKGA 2WC2A 2OQRA 2KT0A 2WBMA 4CDGA 1WJDA 2N8GA 2OD5A 3MFKA 1WVRA 1Z77A 1JUMA 4UUTA 3GTQJ 2ICWG 4FCYA 4L5EA 2GWRA 4LOCA 2ZFUA 2NRAC 3QOEA 4XLAA 3QP5A 3QYFA 1XX5A 5FD5A 4BL0B 4EJOA 1YHQI 3KLOA 1J5YA 4X0GA 2R93J 5F0CA 1R36A 2GXBA 3L2QA 4EJTA 1XN7A 1R4NB 3KIOA 4PJLA 4XKBA 3PO3J 1V54H 4GYIA 2FU4A 4A12A 1XTAA 1DPRA 3M1EA 3GW2A 1Z7LA 3H9GA 2L7ZA 4FISA 2ETHA 2HGCA 3ZMDA 1DDNA 3BJ6A 3CC2I 2KLOA 4A3LJ 3IH4A 4CZCA 3K0LA 2DA6A 4PSWA 4RMNA 1JGSA 2FBKA 4N9IA 3DLLF 2FUG2 3HRTA 2HQRA 2R5YB 5L3GA 2LNBA 1XD7A 1Y6IA 5D4RA 3JRIA 4UY8I 1WFXA 3I56I 1FPQA 2GQQA 3BTJA 3ASNH 1BR4A 1LFUP 1BIAA 4IJAA 3WTYC 4XRFA 2V1DA 3E0JB 3AG4H 5LGUA 2L54A 4BEHA 5C4JJ 5HDGA 1YYVA 3LA7A 1K83J 3L1PA 5FFXA 4P5OA 4I6ZA 4M9XA 3CF2A 2ZJPF 2J5PA 1HOMA 2F5VA 3AG1H 1UG0A 1VQ5I 5F08A 3SDGA 3TMOA 3J7YJ 2IS2A 3FF5A 4M6YA 1YO5C 3RKQA 2E1MB 4PJ0C 2A5WA 2EZHA 4OMZA 1QQIA 3EQLF 4QLCU 4FASD 5GAHJ 1W0TA 2BXZA 1ETOA 1WJCA 3NEUA 3BLYA 2UXXA 3CQZJ 4RGRA 1GVDA 2EINH 3L9FA 3K6GA 4HF1A 1SVLA 2OV7A 1Q1VA 2IEKA 1J0RA 3K4KA 4HW0A 3SDBA 4Y4RA 3DWLE 3OYMA 4DZJA 3DTKA 3SQNA 2AQFA 5FLXK 3T0YA 1E17A 5J47A 3HTSB 4B8XA 3ZN1A 1IUFA 3JTHA 3WODF 2CH0A 4Z2YA 2W00A 2DT6A 2K9NA 1B72B 1E3PA 1K78A 2VBWA 1MBGA 2WY8Q 5JHUA 2V6CA 4ZTFA 2UUZA 3M8FA 1MJBA 2DA7A 1SFEA 4KUMA 5J1UA 3NWTA 1WKMA 3SYTA 1FIPA 4F52A 3TDZC 4H0EA 2AS5F 5FKLA 4XSXF 2YS9A 1JE8A 4M3FA 1VTNC 3DPLC 4B1RA 2XAQA 1ZTRA 4C3IJ 5M5XJ 1H0MA 2OPTA 4M9ZA 2NXNB 2DFIA 1B8IA 4OAYA 1H8AC 3Q5FA 2ECCA 3H9QA 2L02A 1Y0UA 1BJZA 5FLVA 1R6RA 2VPRA 2WAQN 4NNJA 4UVAA 4EMSA 3E97A 4XLEA 4A69C 4BGDA 3JTGA 2ISZA 3KP4A 2XB0X 2H6CA 4ENJA 1QO0D 3WE2A 4R8HA 2VT2A 1GV5A 2E5ZA 5B1BH 3OIQA 1AKHB 3HOUJ 3HJEA 1RIOH 3BG7A 4Q47A 1IJWC 4CXFA 2X6WA 2L7FP 2QCOA 4MGRA 3I3LA 2V7FA 1LKXA 4RAZA 5EG0B 2KIUA 2IP2A 1K6OA 1YS6A 1EH6A 3QQAA 3K1NA 5ED4A 3J7AY 3GFLA 2EIJH 3O8GA 4QWQA 3KZYA 4ZJZA 3K70C 1X3WB 3LSPA 3GTOJ 3HRUA 1T2KA 2XIGA 5DUIA 1R23A 2F5DA 3J81Z 2QGUA 4U7DA 2LG4A 3ECHA 3HM5A 3B02A 2DYRH 3GF2A 4RM2A 4RA2A 2R3SA 3RKXA 1X2MA 4OWRB 1XSXA 3CJQB 1POGA 2FMYA 2IA2A 3M7GA 3QU3A 4BXXJ 5FKMA 1RESA 5DS9A 4XKVA 3EUHA 1LFBA 3QU6A 4XN0A 1OCPA 3P9KA 3AFHA 3CMMA 1O3TA 1W5TA 2JPCA 3CTAA 2LP0A 1NHAA 2DPUA 2A05A 2M1BA 3GTKJ 1P92A 1ULYA 5IT9Z 3RI4A 3S93A 2DI3A 1IV8A 4XRSA 2FF4A 3ZP5A 3WGHA 4UUSB 1Z0XA 2H09A 1W4MA 1TQPA 1EH7A 2VC0A 4CUGA 4G6QA 3LMMA 5KCMA 3KETA 3GBGA 3H3UA 3ZQQA 2Z16A 3H3ZA 3PFIA 3IWZA 4NC8A 5AONA 1G59A 5IYDJ 1FT9A 3K1PA 3PSIA 5H6QA 1B4AA 2ECBA 5HDNA 2OC6A 1X1DA 1O3QA 1S8NA 4YELA 4G6DA 2NOGA 1QGPA 3R61A 4O3MA 2HZTA 3F3XA 2KL4A 1F36A 5C4XJ 3DXJF 3DU6A 1KU7A 4E4HA 1TNTA 1GHCA 5FJ8J 1WHUA 1XGNA 2A6TA 2Y30A 3QOPA 1AU7A 2OTJI 4XOTA 5CKTA 4PJJA 2VXZA 1K4SA 1XSVA 4V2GA 1DU0A 5CJ9A 3WTUC 1RR8C 2KZGA 2A69F 2HTJA 3MD2A 2EFQA 1ODDA 5HOOA 3KP2A 3HOVJ 1IRFA 2WADA 1XGOA 1P7JA 1ZG3A 1XDUA 2DQRA 2LKXA 3G1MA 1H9TA 1O57A 1O4XA 2E60A 3SEQA 3WTZA 3L2VA 3LAPA 3QPLA 3CMEI 2Y0SN 3BTIA 4DW6A 4BACA 2CW8A 3IWFA 4FHTA 3JCUC 2ELJA 3OOUA 1RI7A 3K2ZA 1Y39A 3EYIA 4Y52J 3IUOA 3L00A 5HODA 4YIRX 2DDAA 4AWXB 3MMYB 1U8RA 3OR1C 2NVYJ 4QPQA 2WB1A 5EZGA 3R60A 4LB5A 2R7OA 1ZHFA 2KHMA 3S3NA 2HVSA 5JHFA 5HS7A 3QPSA 5DD8A 1R9TJ 3F6VA 3SEZA 1WPKA 2JZYA 5IY5H 1X3ZB 3TO9A 2OBPA 2W84A 2QLZA 2XB5A 1TT0A 1H88C 4KISA 3K69A 1SFUA 1QVTA 4YFNF 2ZNZA 1PJRA 1WJFA 2DAOA 2CS3A 3E5UA 3NARA 5TRDA 2CWEA 3AG3H 1ITYA 4A6DA 2BHYA 3BR2A 2IGNA 1QA6A 2LY1A 1U9OA 1G3TA 2JRTA 1R1UA 2XUBA 2YR2A 4YG2F 4A5NA 2K40A 3EUHC 5L3FA 1QHHD 4I2OA 1Y0NA 4XQFA 4IF4A 4UUSA 4BDYA 1KONA 3JSOA 2K9QA 1X19A 4YFKF 2E2JJ 4F7ZA 2KJCA 1CF7B 3K70D 5ICCA 4HPQA 1D1CA 3G71I 1UJ8A 1MDMB 2X48A 2O3FA 5FKNA 2JVGA 3S14J 1V5FA 3OWTA 3HG9A 2IGMA 2M2EA 4CCKA 1IV6A 1MMDA 1LNWA 2G9WA 3TGNA 9ANTA 4XMYA 3ZQGA 2WY7Q 2P5KA 3CDLA 2BYVE 2X1DA 2Z9OA 1MNEA 4A3DJ 4LIUA 3QP6A 1GUUA 3OMYA 5D5WB 1PUFA 2LBFB 1O3SA 2PQ8A 5F0FA 1U9NA 1LDKB 1XMKA 4D7MA 1MZBA 1VF9A 2R7RA 2GBYA 4B3XA 1FSHA 3E6CC 1KGSA 3N97A 2FD5A 3VPRA 5EEGA 4M3GA 2VPLA 2RC4A 1HLVA 3SFZA 4UVCA 4C2UA 1FP2A 4EV0A 3MN2A 4AU7A 5IP9J 4HEA2 4IX7A 3FM5A 4FQGA 2PG4A 1MBFA 3TBIA 1BI2A 2ZJ2A 1W1WE 1Z6TA 3QODA 4RS8A 4E7HA 1MKMA 2YX4A 2M34A 2E1MC 3V7SA 4WCGA 2VKEA 1CGPA 4KT6A 2ZXWH 4PJMA 4BHPA 1ERDA 3P9CA 4EQQA 2QVOA 3I58A 1YG2A 3GZ6A 2LY2A 4G94A 2O5RA 2HPMA 5BS6A 1TWGJ 1VZ0A 1N78A 5FO5A 4OIPF 1K7AA 1LQ1A 5L3EA 4ENKA 2HR3A 4A3GJ 3FX3A 2LR8A 1HKTA 2EFOA 3J7ZI 3BPXA 3OYDA 3S8PA 5C3EJ 1T6SA 3FHZA 1TTYA 1I3QJ 3N05A 2HS5A 4A3BJ 5BMZA 4A3JJ 2V9PA 3I0TA 5LEKA 2JQ7A 2M30A 1VI0A 3ZPLA 2M8EA 4E7SA 3HIFA 3IHUA 1IXSB 3DTEA 3CJRB 4HF0A 5GPAA 3ZGKA 2F4MB 3S1MJ 3CDIA 3PIOF 2EJRA 3ZXSA 3JSPA 2XAHA 2VN2A 3QRFF 1AOYA 4LFUA 4Q48A 1TC3C 2VC1A 3HXLA 2HDWA 5IP7J 5GPCA 2ZNYA 1S7AA 2L5QA 4FE4A 3G6EI 2CUFA 1UMQA 4NQWB 1V5EA 2NS7A 4HV5A 1MH4A 2DLLA 1G3YA 1WJEA 2BXYA 3K1MA 4YFXF 5CQEA 2Y0SA 2CQXA 2GOMA 2FJ1A 1IRXA 2XHKA 1D0YA 3L2WA 1LDJA 4EGZA 1KU2A 2V9VA 3MZHA 1A31A 2CU7A 2FE3A 1BM9A 3A0HC 1RNLA 2EQRA 5E1ZB 3ZQFA 3GYHX 4U88A 3VODA 1XS9A 1ZH5A 2DBBA 3CO7C 1S5LC 3DCFA 3I59B 1SC7A 1G3SA 3PL8A 5FRMA 2H6BA 1W7PA 4OIOF 2RKHA 5BPIA 3FMSA 1QNTA 2W57A 1HDDC 5LGNA 1J09A 4IEJA 3HRMA 4PGHA 1XB4A 5IOYA 5J1RA 3ZR8X 1YW7A 3RJPA 2HXOA 5J4YA 1FYMA 1UFMA 4HOBA 1ENHA 1ZG5A 4ON0A 2L9RA 2ZSHB 2PJRB 2E5NA 3LFKA 4RLFA 5LHHA 2RN7A 3LSGA 5TJJA 1ZELA 2CQ7A 4N9HA 4XLNF 3JREA 1D3YA 4PCQA 4HBLA 4FX0A 4KIBA 4NUBA 2AHQA 4W1UA 3NWSA 5FLMJ 1Z6RA 1USTA 1HBXG 4MNUA 2FMLA 3BY6A 5F64A 4O6JA 1WH7A 4BXFA 3F8CA 4B43A 2XF6A 2RVCA 3DPUA 2DJIA 3TW6A 1USSA 1T0FA 2HVQA 5L3DA 4BE0A 2DPDA 4IHXA 4GYGA 5GAGJ 4KFCA 4ZDPA 3W2VA 1OMIA 1OQYA 3W6JB 1U0JA 1YIOA 2DA2A 3RZDJ 3DF8A 5JVTA 2B9SA 2MC4A 3D0SA 2HYGD 3HPHA 3L7WA 4M74A 1D8JA 2VODA 3ZQHA 4IRGA 1EKEA 1R1VA 2NNNA 2MYSA 1GT0C 2OF7A 2O9LA 1TQMA 4AVZA 4I7HA 3FXRA 4CCOA 2F48A 4D5CA 2CFOA 3LSHA 5LRSA 1TP4A 2K86A 4LG0B 1EJ9A 4B09A 5TGTA 5H2FC 1SD7A 4F93B 1J7KA 2NAZA 4XN3A 4E7JA 4XLFA 2DOAA 4EJUA 3TKYA 2QYOA 3B6AA 1AWCA 2ELKA 1E2XA 3TL4X 1B8IB 2O0YA 4AM3A 2UV1A 4HAMA 3VDXA 3H5AA 1WQ2A 2A68F 2QBYB 2H94A 1WCMJ 5ICFA 2K4BA 3H36A 1J9IA 3Q9SA 1R5HA 3BG3A 2RNGA 2L2OA 3A4CA 4HSTA 1YFHA 4M3BA 1N25A 5BNGA 1SEUA 3CZ6A 4LLGF 1MW7A 3FWEA 1FWZA 3BTCA 5CVUA 3CCRI 5C44J 1B9NA 3PQJA 2QQBA 3MZ8A 1SD4A 3T8RA 1R22A 1FY7A 4M3EA 3J80K 3LSMA 4MIMA 5LFAA 1V4RA 4HF2A 1DU6A 1UB9A 3LA3A 1ZRFA 1J2XA 2ELHA 1BN5A 2ADUA 2CRGA 2E2HJ 3HTUA 4EVIA 1PYVA 2VBZA 3CCJI 1TWCJ 3C2GA 1QU3A 3ELKA 4B44A 1IGNA 1CF7A 1APLC 2JN6A 1IUYA 1ZK8A 1JT0A 3FXMA 2X1EA 4HNUA 3CP2A 1IXCA 3LFUA 3S15J 3NAUA 3B73A 4F91B 4AVPA 4DQ2A 3D1NI 2JUGA 3CLOA 1IN5A 4IOCF 3CP8A 3WTTC 2KISA 2XF5A 4Y17A 5EJCA 5LEJA 1ETKA 4YIIA 1YW8A 3AAFA 3CDHA 2DMPA 3CUOA 2QSHX 5CQGA 3MKZA 1T08B 2HQNA 1VQKI 1EV7A 2HOAA 1TNSA 2DA1A 3G1LA 3GLXA 3PM1A 2DXIA 4I09A 2RNJA 2F5EA 4HDUA 2DFEA 1RUOA 4HDVA 3DBHB 5EF6A 3E3VA 3HPGA 2HDDA 1V55H 3ECOA 2CV1A 3P5JA 3QAHA 2ZB9A 1G4DA 2XDVA 2O8XA 4LK1F 3A03A 2J5OA 2DN0A 4HLYA 1PDNC 2V4JC 1R7JA 3HC7A 3ZCOA 2FBHA 2VJJA 3Q0WA 4AIKA 1QPIA 3CC4I 4BXUA 2DQLA 1RPWA 2X6OA 2G0EA 1DQUA 5LHGA 3AG2H 1QBJA 5E8IA 3SZTA 4N4NB 1F1ZA 4QSHA 3M8JA 1NG7A 1RC9A 3TW7A 2MABA 3E7LA 2PEXA 1ZR4A 4MTDA 1U6GA 3CCUI 1QVUA 4KDPA 5GTHC 1YX3A 3TOAA 1D5YA 1BW5A 2JMWA 2Y75A 1MSEC 3JRAA 3K2AA 1AA7A 4FT8A 2FEZA 3TO6A 4RLQA 1KQ9A 2E1OA 1K79A 2M4KA 3CCVI 2OA4A 1AKHA 1WI9A 1LUJB 4Y13A 5KHDA 3BCBA 3FDYA 3BR6A 4KJZA 1S3JA 5CYVA 3HRSA 2CUEA 1IAWA 3DP7A 2AXTC 2GXGA 4IHSA 5DTDA 4Y33A 3RSNA 3HKZA 2V6EA 3MQ0A 1WJBA 3TO7A 4CO8A 2R7WA 2CW7A 5CLSA 1VQ4I 3LSRA 4A6EA 3SHFA 2M7BA 1PVEA 3CCYA 2VBXA 4TV7A 4BUPA 2DOFA 2DTRA 3A01A 4IZZA 2KDOA 3OYFA 2FOKA 4L9VA 1FTZA 3MKWB 3HSRA 4RBOA 4XNFA 4XOPA 1ORKA 1XC5A 3M9AA 4C2MJ 1HKQA 4BU2A 3H0DA 2XKPA 5EGOA 5FRNA 4JYKA 1R1TA 1FNNA 2LLKA 4BQNA 2CQNA 4EGYA 1AHDP 2DA4A 3F8FA 2EH3A 2KIFA 3ZQIA 5E1XA 1OFCX 2F6CA 3MWMA 3BR0A 2IT0A 2MBFA 2O7OA 1R4MB 4AD9A 3J80Z 1B72A 4ZC3A 3CMYA 1YJ9I 1HQCA 2L4AA 1X4PA 2HPIA 3DEUA 3EDPA 4BDZA 3U1KA 1B59A 1FOXA 2E34A 2MH2A 2Y9YA 3NRVA 4EJWA 3M07A 1E3OC 5IT3A 3CD6I 4BHBA 2FXAA 2D5VA 2Y0MA 3DBLB 5IPAA 4AIHA 3KP7A 4L18B 5E3MA 5KAFC 2MFZA 3R0JA 3J81K 2BZTA 4ZDOA 4WXDA 1Z3YA 3PO2J 1T39A 2GIVA 1BJAA 2QSGX 2BY1A 2Q1ZB 3OYCA 3O2PE 4PFPA 3NQOA 3SZPA 3F21A 3AL0B 5JI6A 1P2FA 3HEFA 4G8XA 3FXQA 1SFOJ 2H8WA 2MH9A 3HL2A 3C18A 4JX4A 2W48A 3FBNB 2QZ8A 1R5GA 4LG3A 2EFNA 1MMAA 2ME0A 4W97A 3W6KB 1H89C 1BR2A 3G2BA 2VIXA 2ZCWA 4N4OB 1X1PA 4RGUA 5K7FA 1O7LA 4X1EA 1DPUA 1ZYRF 2Z3YA 4LIVA 5F04A 1V5GA 1C0WA 1CQTA 4S0HB 2ZXHA 2DA5A 2LY9A 1ZLKA 3IKTA 1IW7F 4EJVA 2BY2A 1G3WA 3LSKA 4L9TA 2M0MA 4M71A 1P4XA 3BTLA 2EILH 3WHCA 3HSFA 3ABKH 3VOEA 2K5CA 3ZMZA 5L3CA 2E35A 2EA4A 3Q3SA 5D6FA 4F55A 3H35A 4AUXA 3ZOBA 1SMTA 3I4PA 2K02A 2CFXA 3OSFA 4CCNA 2A6EF 4HZFA 3WGGA 2BVLA 3EYYA 2FX0A 2WAQA 3VWBA 1FZPB 4C3HJ 3TEDA 2M87A 1TL8A 2EV5A 4NB5A 3IL2A 4XONA 1O7FA 3P9IA 4CHUA 3LQRA 2ZJQF 1I1GA 1LE8B 2ZO4A 5EG0A 2YU3A 5ICEA 3HGGA 1S9HA 1YLFA 4HNVA 3HOTA 3HKZN 4G7OF 2XASA 1JUPA 1B9MA 1OR7C 3EUKL 1RZ4A 4OIRF 3OYEA 2E19A 3JRDA 2R0QC 3OYGA 1NG6A 4M6VA 4CYCB 1HSTA 2JSCA 1U8BA 2L01A 1BC7C 2JPBA 1DGRM 1ZGJA 3ZN0A 3WTXC 5GP9A 4XRMA 5B66C 3GMEA 4QPOA 1LEBA 4DYCA 4U0YA 5DV5A 2PJPA 3K4CA 1QHGA 1QZEA 2DDBA 2CQKA 1IG7A 2GXAA 3IKVA 3BJOA 3BQZA 3AKZA 2GAUA 4I02A 2Q2EA 4CGZA 1Q1HA 2OJED 1L0OC 4M3DA 1EF4A 2FSWA 4HA8A 3OR2C 2A3SA 1LVAA 2QKLB 1U78A 3ERED 1MNMC 1X1AA 3FXOA 1JUSA 2LC2A 2EWNA 4MFDA 4A5MA 3L09A 4CCLA 2E1NA 3CCSI 2E7WA 1T33A 2K85A 1BW6A 4A93J 2RGVA 1ZRDA 5GADJ 3C7JA 1HW1A 4E6KG 3HBLA 4XLCA 1U2WA 3BR5A 3M1CA 2H27A 2RQPA 1OKRA 4D9JA 4K2EA 1XCBA 4BBRJ 2F2EA 1P6RA 2D1HA 5AIQA 2HU9A 3IRQA 4P9UA 1P4AA 3VYTB 1TLHB 4XLHA 2LOOA 5K5OA 3DEWA 3SXYA 4GCVA 4EEFG 2K4JA 2HQAA 2LKPA 3K9TA 5TISC 2IA0A 3OIOA 4WX9A 2ID6A 2NVTJ 3ISPA 2IJLA 1L3LA 2OZ6A 2R7FA 3W3CA 3V8LA 2Z2SB 1XDSA 4DZPA 3OY9A 4XRSG 4NHJA 4CYDA 1MBJA 2FRHA 4WF2A 4LLNA 3VYRB 2GM4A 1TBXA 4OU0A 5FFZA 2X85A 1R49A 1LFPA 1IO2A 3C1DA 1VQMI 5ERIA 1F4KA 3BZCA 3CCLI 2Y69H 1FOYA 5J4VA 1B1BA 2OU2A 1X58A 2ESHA 5D8KB 2DA3A 2KJBA 3KYCB 4FTHA 3V4GA 2OAZA 1Z67A 3IC7A 3S2WA 5JLXA 3GFJA 2PN6A 4JQFA 1OYWA 4BY7J 4FX4A 4GDFA 3FBIB 3D5LA 4KIFA 1G8XA 3O8HA 3CF5F 2MD5A 3GXOA 4J01A 2XGCA 5DD4A 3FMRA 1ZGAA 3ZMSA 4EM1A 3DU5A 4BS9A 5DCFA 1GXPA 1R5ID 4ZYDA 1FBUA 2NS8A 4ENMA 2R7TA 2MGQA 3ZQCA 5IT9K 2EFWA 4KMFA 1I1SA 2ZMEC 4S05A 3A0BC 5J8FA 3ONQA 3F9KA 3HB9A 2DU9A 4OOIA 1IN7A 5DEQA 5K5QA 2JVHA 5FKOA 1T56A 3J7AO 2CUJA 3I59A 4YEJA 4XICA 5ILUA 4CCMA 4AYBN 1YW9A 2E1CA 3FZVA 4BNCA 1IRGA 1TZLA 1WWXA 2Z5UA 3O3KA 2E71A 2P0WA 2XGXA 3IV5A 3H0GJ 1IZ1A 2K3PA 2OCEA 3I9V2 4GGGA 1JTYA 2DTZA 1MD0A 2GA2A 4Z6YA 4PFOA 3ZMUA 5LGTA 1JI8A 3ZQLA 3BT9A 3BWGA 4ZYAA 1OCCH 5D4SA 3ROUA 3DQVC 4WK8F 1FBQA 3JRCA 3I71A 4L9NA 1Z9CA 3BG9A 3Q0VA 1SD5A 2W85A 4ZYHA 3I5UA 5DCMB 1FLIA 5D8LB 2FA5A 1HSJA 2VKHA 2CSOA 2HXIA 1SD6A 3BR3A 3IAS2 2EZKA 2HTSA 2JA8J 2Y48A 4ESJA 3BP8A 4KICA 4J00A 2K7LA 1OISA 4DJAA 5DM6F 2XSDC 3H5NA 1ZG1A 4ASNA 1GDTA 3ZRGA 3CMAI 3DKYA 4A3IJ 1HKSA 3ULQB 4HG2A 1X3UA 2BVMA 2ME6A 4IRIA 4UUVA 3ABTA 4A3KJ 2BHZA 4RM3A 1K4TA 1U5TC 3OYIA 4F92B 3E5QA 1GLNA 5M3FJ 4KN4X 2LTPA 4WWCA 1DUXC 3LNQA 4G12A 2TDXA 2R7QA 4ANJA 3OIPA 1PUFB 4IQ4A 2O61A 3RPQA 4EATA 1JXSA 4A0YA 5M3MJ 1I39A 2B7EA 4XORA 2IRFG 4X6AJ 3MKLA 1OYIA 4DOZA 2ZJRF 2ZXIA 3A01B 3K4LA 4PSXA 4B4CA 4EM2A 1W36C 1VQ8I 3HOYJ 3BC8A 3RKWA 2I8DA 4HQMA 3FXJA 4E7IA 4RB0A 1RKWA 2PLYA 3OL3A 2XV4S 3E6MA 3KX2A 2YX7A 2DK8A 2HQ5A 2VT3A 3BG6A 4UVBA 3QYBA 2EA2A 4XM3A 1ETYA 2EZIA 3TOBA 2PBIA 2NYXA 2K9SA 1N77A 3F22A 3I64A 3RIRA 3GLLA 2PI0A 4U7BA 4E7KA 1KQ0A 2COBA 4GO1A 2YUSA 2VBYA 1WJAA 4OAZA 1A36A 2CW0F 4ZZDA 5FKKA 3RYPA 2MLKA 2PFBA 1IN8A 2CUZA 2FOWA 1VQLI 4M73A 2UWMA 3PJRA 3OYJA 2LREA 4IL6C 2G7UA 2ZMEA 2XAUA 5BQTA 2ESNA 2STWA 4J19A 2HKOA 2QEXI 4RGSA 2RDPA 5AIPA 2YU9J 1UCRA 3PUFA 1FIAA 1G6NA 2M7AA 3GUDA 4G6TB 2L0KA 3ZMTA 4AYBA 1SAXA 2WAFA 3PUBA 3SFIA 4A3EJ 1HW2A 2AO9A 3CCQI 2HYFA 1I50J 3MCZA 2R7XA 3S1NJ 2D1VA 3S3MA 3UNGC 3OYKA 4LMYA 4G7ZF 1G2HA 3KYDB 3GEZA 5HDKA 1WSUA 3K4MA 4MQVA 1T38A 3QWLA 2HZDA 2EIKH 2V9KA 2VKDA 3JW4A 3ML6A 2JWTA 5BPDA 2VL8A 1IXRC 4MTEA 3WG9A 5KK1A 3CCMI 4PK4A 4A3FJ 3IH2A 1YOVB 1Z7UA 1I5ZA 1R00A 2COMA 1P4WA 1S6LA 2IPQX 3F8MA 3PFYA 1SANA 2DMNA 3H5RA 2VI6A 1PP8F 3T5XA 2ID3A 3RDIA 1UELB 1FYKA 3U2RA 3LL7A 2H1LA 3PNVA 4B3AA 2IA1A 4BJ5C 2XSJC 3RQIA 4UB6C 4G9YA 3S32A 1REPC 3W6VA 3RPUD 5KAIC 2OCCH 4YRVA 3X2QH 2KRHA 1UHWA 4C2TA 4C9YA 3R4KA 5E3NA 2DK5A 4AIJA 2JA7J 4U0WA 4QTRA 2C6YA 2IVMA 2W1OA 5K7ZA 1IN6A 5GTIC 2BBYA 1DP3A 1ZKGA 2GLOA 1KYWA 1MBHA 3H9JA 3VEPA 3W2WA 1ZAOA 2XC7A 3CLQA 1EH8A 2KRFA 4AC0A 2W4SA 2NNYA 2VE8A 5CPRB 5EEAA 3BQYA 6PAXA 2JA5J 3GTPJ 3I4MJ 1SFXA 2X51A 1D5VA 1W0UA 2FQ4A 4P96A 2IS1A 4HV6A 4D5FA 4E7ZA 3BZKA 3I53A 3OV8A 3B6CA 1TWAJ 1UAAA 1FSEA 3ABMH 3M3YJ 2WTEA 1LEAA 2L7MP 1R58A 3CJTB 1S7EA 3GX4X 1ZQ3P 3DEEA 2R5YA 3MEXA 2QWWA 3MZYA 1E3HA 2D2WA 3CUQA 1M1EB 2OQGA 2RV8A 2BV6A 1BOBA 2X6YA 3LOCA 3KCCA 4II3A 4L9JA 1PP7U 3HDDA 2R7SA 3PIPF 2FQ3A 4IQJA 3S17J 2EPFA 2VJ5A 4XSZF 1OCOH 1A6IA 1OYYA 3L2RA 1VFCA 2ZSIB 1ZGWA 1VQPI 3K4BA 1P7IA 5D5VB 3S1RJ 3DPTA 2DMUA 2DMTA 3G4SI 2Q2EB 5HLIA 2Y9ZA 1K6YA 2EBIA 5E8GA 3VFZA 1U5TA 2HNHA 1LPQA 3M4OJ 3WU2C 2RAEA 2DT5A 5LHIA 1UHMA 2K9MA 3FISA 3LSTA 4BQAA 4UNOA 4FETA 3WU1B 3HGYA 2KIQA 2Z33A 2NS0A 1S72I 4Y15A 3HZJA 2GIZA 1V3FA 3U9GA 1MJ9A 1MGTA 1ON1A 1ZN2A 1S7OA 3I4NJ 1YJWI 4I0BA 2L9SA 5J6XA 1PUEE 2D45A 1F9NA 4ZYGA 3V8KA 1XPXA 3T8TA 4P9FA 1WGXA 3ABLH 3C2BA 2QF7A 3T1BA 3Q9VA 4HX8A 4IO9F 4CYCA 5BOXA 2Z1DA 3IRRA 4QIWN 2I5UA 2VQLA 3GTMJ 1SVOA 1A6QA 2P81A 2A6HF 3I55I 4U87A 4IVNA 3F8NA 2WV0A 5CVIA 3OYAA 2DJNA 1Z05A 3KEQA 4KN7X 4UHTA 2VJIA 5J3LA 3RPUA 5B3SH 4IKFA 2L3DA 3CESA 4C3JJ 1HCRA 4JOMA 2F5FA 3BOQA 3WTWC 1K78B 2XRNA 5K7HA 1Y8RB 1N75A 2W25A 4XL9A 1VNDA 3JAMK 4NBQA 2V1UA 3LA2A 3ABUA 5A2QK 3OS2A 2TRTA 4DGWB 2CV0A 4G7HF 2NOJB 3HUGB 4Q5SF 4BE2A 1T0FC 2TCTA 3H1CA 4KIGA 1BA5A 4GFBA 3FXKA 1JKQC 2QBYA 2LKSA 2VOPA 1RUNA 5IOZA 5L3BA 2LDUA 1WRJA 5DUKA 2QENA 2DFFA 2P5VA 4Y7NJ 2EB7A 1K61A 2OUMA 5LD2C 2LSOA 3E6DA 2EV6A 1BI3A 2XAFA 2KMUA 5GAEJ 1JKOC 5M5YJ 3F72A 1W7PB 1KU9A 3FKIJ 2KDZA 1T98A 1XGMA 4I01A 3BR1A 3HOWJ 3TP3A 1VQOI 4R1HA 1FOWA 2CYYA 2JA6J 3CO6C 4H4KC 3U1DA 1DGWY 3QPTA 1U5TB 1TT5B 4A2UA 3DTIA 1LVKA 2M45A 5EYRA 2L9VA 3HUGA 3KZIC 1NK2P 4A3CJ 2DOEA 2P7CB 2JT1A 2H1KA 5J1YA 1FMVA 2P5LC 4OIQF 4MLOA 3EUAA 3G3ZA 4NDLA 1FJLA 5F27A 3GZ5A 2LYCA 4HLXA 1BIBA 2Y31A 4WXCA 3PSFA 2QKMB 1OCRH 5EDNA 1I6HJ 4RB3C 2HDCA 2ZMEB 5DCMA 1YIJI 5HS8A 3BCAA 3OOPA 4NQWA 4ETSA 1I27A 1Y1VJ 2W82A 1ONVA 3BJAA 4PGGA 1YI2I 2KIMA 3V7RA 1NTCA 3LWFA 3RQ4A 3F8BA 1UHSA 2DT7B 2R4GA 5DYMA 5JR3A 2XF7A 2O8KA 2V1XA 4CA0A 2H8RA 2YPRA 5E79C 1YRNA 4CICA 2X9DA 1WJ5A 1VQNI 2R7UA 4IHYA 5CVRA 4R79A 2CG4A 3HOXJ 4E70A 3OYHA 5JFRA 1BOAA 4RGXA 3R6SA 3KYLA 2QSFX 4FE7A 4KMUX 1XSDA 1KA8A 4JX5A 5DDGA 2R7VA 1YE9A 5E3LA 1KYZA 3OYNA 4WXHA 1FTTA 4BBSJ 2RQQA 2VQHA 2VE9A 4MQ9F 3WG7H 5EGOB 1W5CC 4HX7A 2P6TA 1J59A 3S2HJ 2QQ9A 4LD5A 1JKPC 1IDZA 1IC8A 2VONA 2V26A 1OLTA 1OR7A 2BOLA 3F23A 2F4OB 1VQ7I 3ZMVA 5E3OA 3RYRA 4ABZA 2ZC2A 2Q0OA 1GXQA 4I99C
chains in the Genus database with same CATH topology
2LF8A 4CZZA 1O3RA 4PDKA 2QUFA 3WTVC 1TW3A 3GVAA 4UV9A 3KP6A 4RB1A 1Z91A 4LK0F 2A07F 1FP1D 2ISYA 4ZH4F 1HXDA 2A5YB 4N0BA 5FGMA 2ZFWA 2QM3A 2FBIA 1XCVA 3HHGA 2DO7A 4OMYA 4ESBA 5K1YA 1ZREA 3WU0A 2EV0A 4XBFA 1QZZA 2CO5A 4LJZF 5A2QZ 4DNCA 4M9SA 3KP3A 2EFPA 5FD6A 2MLGA 5H6RA 4GXOA 4A0ZA 2E7XA 3COAC 3BROA 4M72A 2L4MA 2A61A 5ILVA 1I6XA 2R7DA 4P55A 3VB2A 2F5CA 4MHGA 5HLGA 2QQAA 3C3WA 3FXUA 4YIFA 1JHFA 3M8EA 3G73A 5D5XB 5E20A 2CGPA 3LQQA 2P7VB 4D0PA 5CVVA 1IF1A 3N4MA 1OPCA 3KE2A 4LB6B 3TDUC 4L0YB 2JTVA 3DKWA 1LB2A 1A04A 1LJ9A 3RTRA 2P6SA 4MEYF 2M5WA 2GA1A 1YTYA 1YS7A 2IW5A 1ZLJA 4O5VA 2PMHA 4ENNA 2P4WA 4L5IA 5E17F 1BBYA 2BGCA 5CVJA 3GFMA 1ON2A 2PMUA 4IRHA 1MJAA 4KYWA 4HX4A 1ZARA 4HQEA 2BE5F 2W24A 1GVJA 3BDDA 3KEOA 4M6XA 3EETA 2XAGA 1U3EM 2FNPA 3KFWX 2ZKZA 4OINF 3REOA 1BI1A 2EK5A 3KZZA 3PQKA 4LG0A 2HWVA 4MEXF 2K27A 2HKXA 1MDMA 2P8TA 2LF7A 3JAMZ 2XKOA 1W5SA 1STZA 3WGIA 4JK1X 5H20A 1FX7A 2O03A 4I0AA 2UZKA 4ESFA 4RB2C 2KKOA 5D6EA 4ZZLA 3V8JA 1TW2A 5D5UB 5LBQA 3DV8A 4U0VA 1F5TA 1BC8C 3MAJA 2X4HA 2GZWA 1H9GA 3FM3A 5F6FA 5LRRA 2DW4A 3HHHA 4LLLA 1HW5A 1Z1DA 1YQAA 4BYYA 3CJNA 1S29A 5F1RA 2OZUA 5ICGA 5ILSA 4HYEA 1QZYA 2O6GE 1ZRCA 3WTSC 3RKYA 3ZQ7A 4ZYEA 4IHTA 4JBAA 1LDDA 1XGSA 4XLPF 4BH9A 3O6BB 3H92A 3KP5A 5K5RA 3F6OA 5KVRA 2G7HA 1TQIA 2YSRA 5E18F 1BI0A 2XAJA 3R0AA 4L5JA 3I54A 2VOOA 2ZXJA 1KU3A 4UXNA 1FBSA 2B0LA 5EEHA 3P7NA 1QPMA 5HVQC 1W7PD 3TQNA 3CUQB 2WWYA 3V7CA 1KQ8A 1XMAA 5J8CA 2ACJA 3GFIA 2MA3A 5HS9A 3BZ6A 3BPVA 2Q8KA 4KA4A 3E6BA 4KNYA 2HOEA 4LGWA 1FYLA 3DFGA 5FB2A 4EM0B 1D8KA 2XVCA 4IXAA 4I98B 2X0LA 1DP7P 2MC3A 4S04A 2STTA 2HEOA 3HOSA 1JHHA 4PZJA 4BHCA 3GO5A 3LAJA 3HYIA 3QPHA 2ZBKA 2HFHA 2UXNA 1FOKA 4A0XA 3L2CA 5FLXZ 5E1WA 5LLQA 3GWZA 4L0ZB 4IPAA 5HLHA 2V79A 2Z99A 3HSEA 3WE3A 3FMQA 4RAYA 4UV8A 4KT5C 3E5XA 1J75A 3KLNA 2AXLA 1B6AA 1FC3A 1IN4A 2XROA 2BEOA 4Q4ZF 1SMYF 4BAYA 3CUQC 2FNAA 2WC2A 2OQRA 4CDGA 2OD5A 3MFKA 2GWRA 2NRAC 3QP5A 5FD5A 4EJOA 3KLOA 1J5YA 1R36A 2GXBA 4EJTA 1XN7A 4GYIA 2FU4A 4A12A 1DPRA 3M1EA 3GW2A 3ZMDA 1DDNA 2ETHA 2HGCA 3BJ6A 3K0LA 1JGSA 2FBKA 4N9IA 3HRTA 2HQRA 5L3GA 2LNBA 1XD7A 5D4RA 1FPQA 2GQQA 1BIAA 4IJAA 3WTYC 4XRFA 2V1DA 5LGUA 2L54A 5HDGA 1YYVA 3LA7A 5FFXA 4P5OA 4M9XA 2J5PA 3FF5A 4M6YA 1YO5C 4OMZA 1QQIA 3EQLF 4QLCU 3NEUA 2UXXA 4RGRA 3L9FA 4HF1A 1J0RA 4HW0A 3SQNA 5FLXK 3T0YA 1E17A 3HTSB 4B8XA 3ZN1A 3JTHA 3WODF 4Z2YA 1K78A 2VBWA 5JHUA 2V6CA 3M8FA 1MJBA 1SFEA 4KUMA 1WKMA 3TDZC 4H0EA 2AS5F 4XSXF 1JE8A 1VTNC 3DPLC 2XAQA 1H0MA 4M9ZA 2DFIA 3Q5FA 2L02A 1Y0UA 4UVAA 4EMSA 3E97A 2ISZA 3JTGA 3KP4A 2H6CA 4ENJA 1QO0D 3WE2A 4R8HA 2VT2A 1RIOH 4Q47A 4CXFA 4MGRA 4RAZA 2KIUA 2IP2A 1K6OA 1YS6A 1EH6A 3K1NA 5ED4A 3GFLA 4QWQA 3KZYA 3HRUA 1T2KA 2XIGA 5DUIA 1R23A 2F5DA 3J81Z 4U7DA 3ECHA 3B02A 3GF2A 2R3SA 3RKXA 1XSXA 2FMYA 2IA2A 3M7GA 3QU3A 3EUHA 3QU6A 3P9KA 1O3TA 1W5TA 2JPCA 3CTAA 1NHAA 2DPUA 2M1BA 1P92A 1ULYA 5IT9Z 3RI4A 2DI3A 2FF4A 3ZP5A 3WGHA 2H09A 1W4MA 1TQPA 1EH7A 2VC0A 4G6QA 3KETA 3H3UA 3H3ZA 3PFIA 3IWZA 5AONA 1FT9A 3K1PA 5H6QA 1B4AA 5HDNA 1O3QA 1S8NA 4G6DA 1QGPA 3R61A 4O3MA 2HZTA 3F3XA 3DXJF 1KU7A 1GHCA 1TNTA 1XGNA 3QOPA 2VXZA 1XSVA 5CJ9A 3WTUC 2A69F 2HTJA 2EFQA 1ODDA 5HOOA 3KP2A 1IRFA 1XGOA 1ZG3A 1XDUA 2DQRA 1H9TA 1O57A 3WTZA 3LAPA 3IWFA 4FHTA 1RI7A 3EYIA 3K2ZA 3L00A 4AWXB 1U8RA 3R60A 4LB5A 1ZHFA 5HS7A 5DD8A 3F6VA 2JZYA 3TO9A 2OBPA 2W84A 2QLZA 3K69A 1SFUA 4YFNF 2ZNZA 2DAOA 3E5UA 5TRDA 2CWEA 4A6DA 1G3TA 2JRTA 1R1UA 2XUBA 2YR2A 4YG2F 4A5NA 5L3FA 4I2OA 4IF4A 3JSOA 4YFKF 4F7ZA 2KJCA 1CF7B 5ICCA 1MDMB 2O3FA 1LNWA 2G9WA 3TGNA 2P5KA 2BYVE 2Z9OA 3QP6A 5D5WB 1O3SA 2PQ8A 1LDKB 1XMKA 1MZBA 1FSHA 3E6CC 1KGSA 3N97A 5EEGA 2RC4A 3SFZA 4UVCA 1FP2A 4EV0A 3FM5A 2PG4A 1BI2A 2ZJ2A 1Z6TA 4RS8A 1MKMA 2YX4A 3V7SA 4WCGA 1CGPA 4BHPA 3P9CA 4EQQA 2QVOA 3I58A 1YG2A 3GZ6A 4G94A 5BS6A 5FO5A 4OIPF 1K7AA 1LQ1A 5L3EA 4ENKA 2HR3A 3FX3A 1HKTA 2EFOA 3BPXA 3FHZA 1T6SA 1TTYA 2HS5A 5BMZA 3I0TA 5LEKA 2M30A 3ZPLA 2M8EA 3HIFA 3IHUA 1IXSB 4HF0A 2EJRA 3JSPA 2XAHA 2VN2A 3QRFF 1AOYA 4LFUA 4Q48A 2VC1A 2ZNYA 1S7AA 4HV5A 2DLLA 1G3YA 3K1MA 4YFXF 2XHKA 4EGZA 1LDJA 1KU2A 2V9VA 3MZHA 2FE3A 1BM9A 5E1ZB 1RNLA 3GYHX 4U88A 3VODA 1ZH5A 2DBBA 3CO7C 3I59B 1G3SA 2H6BA 1W7PA 4OIOF 2RKHA 5BPIA 3FMSA 1QNTA 2W57A 5LGNA 3HRMA 4PGHA 1XB4A 1YW7A 3RJPA 1FYMA 1UFMA 4HOBA 1ZG5A 4ON0A 3LFKA 5LHHA 2RN7A 5TJJA 4N9HA 4XLNF 1D3YA 4PCQA 4HBLA 4FX0A 4KIBA 1Z6RA 1USTA 1HBXG 4MNUA 2FMLA 3BY6A 5F64A 4O6JA 3F8CA 2RVCA 1USSA 1T0FA 5L3DA 2DPDA 4GYGA 4KFCA 1OMIA 3W6JB 1YIOA 3DF8A 5JVTA 4M74A 3D0SA 2HYGD 1D8JA 3L7WA 2VODA 4IRGA 1R1VA 2NNNA 1TQMA 4I7HA 3FXRA 5LRSA 2K86A 4LG0B 4B09A 1SD7A 1J7KA 2NAZA 4EJUA 3TKYA 2QYOA 1AWCA 1E2XA 2O0YA 4HAMA 2QBYB 1WQ2A 2A68F 2H94A 5ICFA 2K4BA 1J9IA 3Q9SA 1R5HA 1YFHA 4LLGF 3FWEA 1FWZA 5CVUA 1B9NA 3PQJA 2QQBA 1SD4A 3T8RA 1R22A 1FY7A 3J80K 1V4RA 4HF2A 1UB9A 3LA3A 1ZRFA 1J2XA 2ELHA 1BN5A 2ADUA 3HTUA 4EVIA 2VBZA 3ELKA 1CF7A 1IUYA 1IXCA 3B73A 4AVPA 4DQ2A 3CLOA 1IN5A 3WTTC 4Y17A 5LEJA 4YIIA 1YW8A 3AAFA 3CDHA 3CUOA 2HQNA 1EV7A 1TNSA 3GLXA 4I09A 2RNJA 2F5EA 4HDUA 1RUOA 4HDVA 3E3VA 3ECOA 3QAHA 1G4DA 2O8XA 4LK1F 1PDNC 2J5OA 4HLYA 1R7JA 2FBHA 4AIKA 4BXUA 2DQLA 5LHGA 1QBJA 5E8IA 3SZTA 1F1ZA 2PEXA 4MTDA 1U6GA 4KDPA 3TOAA 2Y75A 4FT8A 2FEZA 3TO6A 1KQ9A 1K79A 2OA4A 1WI9A 4Y13A 1S3JA 5CYVA 3HRSA 1IAWA 3DP7A 4IHSA 2GXGA 3MQ0A 3TO7A 4CO8A 5CLSA 4A6EA 3SHFA 4TV7A 2VBXA 2DTRA 2FOKA 4L9VA 3HSRA 3M9AA 1HKQA 2XKPA 1R1TA 1FNNA 4EGYA 3F8FA 2KIFA 5E1XA 3MWMA 2IT0A 2MBFA 4AD9A 3J80Z 1HQCA 2L4AA 3EDPA 3DEUA 1B59A 2MH2A 4EJWA 3NRVA 5IT3A 4BHBA 2FXAA 2Y0MA 4AIHA 3KP7A 4L18B 3R0JA 3J81K 4WXDA 1T39A 2GIVA 1BJAA 3O2PE 3NQOA 3SZPA 3F21A 5JI6A 1P2FA 4G8XA 3FXQA 2MH9A 3C18A 2QZ8A 1R5GA 2EFNA 3W6KB 2ZCWA 4RGUA 1O7LA 1DPUA 1ZYRF 2Z3YA 1C0WA 1ZLKA 3IKTA 1IW7F 4EJVA 1G3WA 4L9TA 4M71A 1P4XA 3HSFA 3VOEA 3ZMZA 5L3CA 2EA4A 5D6FA 1SMTA 3I4PA 2K02A 2CFXA 2A6EF 4HZFA 3WGGA 3EYYA 1FZPB 2M87A 2EV5A 4NB5A 3IL2A 1O7FA 3P9IA 4CHUA 3LQRA 1I1GA 2ZO4A 2YU3A 5ICEA 1YLFA 3HOTA 4G7OF 2XASA 1B9MA 1RZ4A 4OIRF 1HSTA 2JSCA 1BC7C 2L01A 2JPBA 1ZGJA 3ZN0A 3WTXC 1LEBA 4U0YA 5DV5A 2PJPA 2CQKA 3IKVA 3BJOA 2GAUA 4I02A 2Q2EA 4CGZA 1Q1HA 1L0OC 2FSWA 4HA8A 2A3SA 1LVAA 1U78A 3ERED 2EWNA 4A5MA 3L09A 2E1NA 2E7WA 2RGVA 1ZRDA 3C7JA 1HW1A 1U2WA 2H27A 2RQPA 1OKRA 4K2EA 1XCBA 2F2EA 1P6RA 2D1HA 5AIQA 3IRQA 4P9UA 1P4AA 1TLHB 5K5OA 3SXYA 4GCVA 2K4JA 2LKPA 3K9TA 2IA0A 4WX9A 3ISPA 2IJLA 1L3LA 2OZ6A 2R7FA 3V8LA 1XDSA 4NHJA 4CYDA 2FRHA 4WF2A 4LLNA 1TBXA 4OU0A 5FFZA 3C1DA 5ERIA 1F4KA 1B1BA 2OU2A 2ESHA 5D8KB 2KJBA 3V4GA 2OAZA 3IC7A 3S2WA 3GFJA 2PN6A 4JQFA 1OYWA 4FX4A 3D5LA 4KIFA 2MD5A 3GXOA 5DD4A 3FMRA 1ZGAA 3ZMSA 4EM1A 5DCFA 1GXPA 4ZYDA 1FBUA 4ENMA 5IT9K 2EFWA 4KMFA 1I1SA 4S05A 5J8FA 4OOIA 2DU9A 1IN7A 5DEQA 5K5QA 3J7AO 3I59A 5ILUA 1YW9A 2E1CA 3FZVA 4BNCA 1IRGA 1WWXA 2Z5UA 3O3KA 2XGXA 1IZ1A 4GGGA 2GA2A 1MD0A 3ZMUA 5LGTA 3BWGA 5D4SA 3ROUA 3DQVC 4WK8F 1FBQA 3I71A 4L9NA 1Z9CA 1SD5A 2W85A 4ZYHA 3I5UA 5DCMB 1FLIA 5D8LB 2FA5A 1HSJA 2CSOA 1SD6A 2HTSA 2Y48A 4ESJA 3BP8A 4KICA 2K7LA 1ZG1A 4ASNA 1HKSA 3ULQB 1X3UA 4IRIA 4UUVA 3ABTA 1U5TC 3E5QA 4KN4X 4WWCA 1DUXC 2TDXA 2O61A 3RPQA 1JXSA 4A0YA 2IRFG 1OYIA 4EM2A 3RKWA 4HQMA 4RB0A 2PLYA 2XV4S 3E6MA 2YX7A 2DK8A 2VT3A 4UVBA 2EA2A 3TOBA 2PBIA 2NYXA 3F22A 3I64A 3RIRA 2PI0A 4U7BA 1KQ0A 4GO1A 2VBYA 2CW0F 4ZZDA 3RYPA 2MLKA 2PFBA 1IN8A 4M73A 2UWMA 2G7UA 2ZMEA 5BQTA 2ESNA 2STWA 2HKOA 4RGSA 2RDPA 5AIPA 1UCRA 1G6NA 3GUDA 3ZMTA 1SAXA 1HW2A 2HYFA 3MCZA 2D1VA 4LMYA 4G7ZF 3GEZA 5HDKA 1WSUA 4MQVA 1T38A 3JW4A 3ML6A 5BPDA 1IXRC 4MTEA 3WG9A 5KK1A 1Z7UA 1I5ZA 1R00A 2COMA 1P4WA 1S6LA 2IPQX 3F8MA 1PP8F 3T5XA 3RDIA 1FYKA 3U2RA 2IA1A 4G9YA 1REPC 1UHWA 3R4KA 2DK5A 4AIJA 4U0WA 2C6YA 2IVMA 1IN6A 2BBYA 1KYWA 3VEPA 1ZAOA 1EH8A 2KRFA 2NNYA 2VE8A 6PAXA 1SFXA 1D5VA 4P96A 4HV6A 3I53A 3OV8A 1FSEA 2WTEA 1LEAA 1R58A 3GX4X 3MEXA 2QWWA 3MZYA 2D2WA 3CUQA 2OQGA 2RV8A 2BV6A 3KCCA 4L9JA 1PP7U 2FQ3A 4XSZF 1OYYA 5D5VB 3DPTA 5HLIA 5E8GA 3VFZA 1U5TA 2DT5A 5LHIA 4BQAA 1UHMA 3LSTA 4UNOA 3WU1B 2Z33A 2NS0A 4Y15A 1V3FA 3U9GA 1MJ9A 1MGTA 1ON1A 1ZN2A 1S7OA 4I0BA 5J6XA 1PUEE 2D45A 1F9NA 4ZYGA 3V8KA 3T8TA 4P9FA 3T1BA 3Q9VA 4HX8A 5BOXA 3IRRA 2A6HF 4IVNA 3F8NA 2WV0A 5CVIA 3RPUA 1Z05A 3KEQA 4KN7X 4UHTA 2L3DA 2F5FA 3BOQA 3WTWC 1K78B 2XRNA 2W25A 3JAMK 2V1UA 3LA2A 3ABUA 5A2QK 4G7HF 4Q5SF 4KIGA 2QBYA 2VOPA 1RUNA 5L3BA 2LDUA 1WRJA 5DUKA 2QENA 2P5VA 2EB7A 2LSOA 3E6DA 2EV6A 1BI3A 2XAFA 3F72A 1W7PB 1KU9A 1T98A 1XGMA 4I01A 4R1HA 2CYYA 3CO6C 3U1DA 3QPTA 1U5TB 4A2UA 2M45A 3HUGA 2P7CB 2JT1A 4OIQF 2P5LC 3G3ZA 3GZ5A 4HLXA 1BIBA 4WXCA 4RB3C 2HDCA 2ZMEB 5DCMA 5HS8A 3OOPA 4NQWA 4ETSA 1I27A 1ONVA 3BJAA 4PGGA 2KIMA 3V7RA 3LWFA 3F8BA 5DYMA 5JR3A 2V1XA 2YPRA 4CICA 5CVRA 4R79A 2CG4A 4E70A 5JFRA 1BOAA 4RGXA 3R6SA 1XSDA 4KMUX 1KA8A 5DDGA 1KYZA 4WXHA 2VE9A 4MQ9F 4HX7A 2P6TA 1J59A 2QQ9A 4LD5A 2VONA 1OR7A 3F23A 3ZMVA 3RYRA 2Q0OA 1GXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF8 A;  4CZZ A;  1O3R A;  4PDK A;  2QUF A;  3WTV C;  1TW3 A;  3GVA A;  4UV9 A;  3KP6 A;  4RB1 A;  1Z91 A;  4LK0 F;  2A07 F;  1FP1 D;  2ISY A;  4ZH4 F;  1HXD A;  2A5Y B;  4N0B A;  5FGM A;  2ZFW A;  2QM3 A;  2FBI A;  1XCV A;  3HHG A;  2DO7 A;  4OMY A;  4ESB A;  5K1Y A;  1ZRE A;  3WU0 A;  2EV0 A;  4XBF A;  1QZZ A;  2CO5 A;  4LJZ F;  5A2Q Z;  4DNC A;  4M9S A;  3KP3 A;  2EFP A;  5FD6 A;  2MLG A;  5H6R A;  4GXO A;  4A0Z A;  2E7X A;  3COA C;  3BRO A;  4M72 A;  2L4M A;  2A61 A;  5ILV A;  1I6X A;  2R7D A;  4P55 A;  3VB2 A;  2F5C A;  4MHG A;  5HLG A;  2QQA A;  3C3W A;  3FXU A;  4YIF A;  1JHF A;  3M8E A;  3G73 A;  5D5X B;  5E20 A;  2CGP A;  3LQQ A;  2P7V B;  4D0P A;  5CVV A;  1IF1 A;  3N4M A;  1OPC A;  3KE2 A;  4LB6 B;  3TDU C;  4L0Y B;  2JTV A;  3DKW A;  1LB2 A;  1A04 A;  1LJ9 A;  3RTR A;  2P6S A;  4MEY F;  2M5W A;  2GA1 A;  1YTY A;  1YS7 A;  2IW5 A;  1ZLJ A;  4O5V A;  2PMH A;  4ENN A;  2P4W A;  4L5I A;  5E17 F;  1BBY A;  2BGC A;  5CVJ A;  3GFM A;  1ON2 A;  2PMU A;  4IRH A;  1MJA A;  4KYW A;  4HX4 A;  1ZAR A;  4HQE A;  2BE5 F;  2W24 A;  1GVJ A;  3BDD A;  3KEO A;  4M6X A;  3EET A;  2XAG A;  1U3E M;  2FNP A;  3KFW X;  2ZKZ A;  4OIN F;  3REO A;  1BI1 A;  2EK5 A;  3KZZ A;  3PQK A;  4LG0 A;  2HWV A;  4MEX F;  2K27 A;  2HKX A;  1MDM A;  2P8T A;  2LF7 A;  3JAM Z;  2XKO A;  1W5S A;  1STZ A;  3WGI A;  4JK1 X;  5H20 A;  1FX7 A;  2O03 A;  4I0A A;  2UZK A;  4ESF A;  4RB2 C;  2KKO A;  5D6E A;  4ZZL A;  3V8J A;  1TW2 A;  5D5U B;  5LBQ A;  3DV8 A;  4U0V A;  1F5T A;  1BC8 C;  3MAJ A;  2X4H A;  2GZW A;  1H9G A;  3FM3 A;  5F6F A;  5LRR A;  2DW4 A;  3HHH A;  4LLL A;  1HW5 A;  1Z1D A;  1YQA A;  4BYY A;  3CJN A;  1S29 A;  5F1R A;  2OZU A;  5ICG A;  5ILS A;  4HYE A;  1QZY A;  2O6G E;  1ZRC A;  3WTS C;  3RKY A;  3ZQ7 A;  4ZYE A;  4IHT A;  4JBA A;  1LDD A;  1XGS A;  4XLP F;  4BH9 A;  3O6B B;  3H92 A;  3KP5 A;  5K5R A;  3F6O A;  5KVR A;  2G7H A;  1TQI A;  2YSR A;  5E18 F;  1BI0 A;  2XAJ A;  3R0A A;  4L5J A;  3I54 A;  2VOO A;  2ZXJ A;  1KU3 A;  4UXN A;  1FBS A;  2B0L A;  5EEH A;  3P7N A;  1QPM A;  5HVQ C;  1W7P D;  3TQN A;  3CUQ B;  2WWY A;  3V7C A;  1KQ8 A;  1XMA A;  5J8C A;  2ACJ A;  3GFI A;  2MA3 A;  5HS9 A;  3BZ6 A;  3BPV A;  2Q8K A;  4KA4 A;  3E6B A;  4KNY A;  2HOE A;  4LGW A;  1FYL A;  3DFG A;  5FB2 A;  4EM0 B;  1D8K A;  2XVC A;  4IXA A;  4I98 B;  2X0L A;  1DP7 P;  2MC3 A;  4S04 A;  2STT A;  2HEO A;  3HOS A;  1JHH A;  4PZJ A;  4BHC A;  3GO5 A;  3LAJ A;  3HYI A;  3QPH A;  2ZBK A;  2HFH A;  2UXN A;  1FOK A;  4A0X A;  3L2C A;  5FLX Z;  5E1W A;  5LLQ A;  3GWZ A;  4L0Z B;  4IPA A;  5HLH A;  2V79 A;  2Z99 A;  3HSE A;  3WE3 A;  3FMQ A;  4RAY A;  4UV8 A;  4KT5 C;  3E5X A;  1J75 A;  3KLN A;  2AXL A;  1B6A A;  1FC3 A;  1IN4 A;  2XRO A;  2BEO A;  4Q4Z F;  1SMY F;  4BAY A;  3CUQ C;  2FNA A;  2WC2 A;  2OQR A;  4CDG A;  2OD5 A;  3MFK A;  2GWR A;  2NRA C;  3QP5 A;  5FD5 A;  4EJO A;  3KLO A;  1J5Y A;  1R36 A;  2GXB A;  4EJT A;  1XN7 A;  4GYI A;  2FU4 A;  4A12 A;  1DPR A;  3M1E A;  3GW2 A;  3ZMD A;  1DDN A;  2ETH A;  2HGC A;  3BJ6 A;  3K0L A;  1JGS A;  2FBK A;  4N9I A;  3HRT A;  2HQR A;  5L3G A;  2LNB A;  1XD7 A;  5D4R A;  1FPQ A;  2GQQ A;  1BIA A;  4IJA A;  3WTY C;  4XRF A;  2V1D A;  5LGU A;  2L54 A;  5HDG A;  1YYV A;  3LA7 A;  5FFX A;  4P5O A;  4M9X A;  2J5P A;  3FF5 A;  4M6Y A;  1YO5 C;  4OMZ A;  1QQI A;  3EQL F;  4QLC U;  3NEU A;  2UXX A;  4RGR A;  3L9F A;  4HF1 A;  1J0R A;  4HW0 A;  3SQN A;  5FLX K;  3T0Y A;  1E17 A;  3HTS B;  4B8X A;  3ZN1 A;  3JTH A;  3WOD F;  4Z2Y A;  1K78 A;  2VBW A;  5JHU A;  2V6C A;  3M8F A;  1MJB A;  1SFE A;  4KUM A;  1WKM A;  3TDZ C;  4H0E A;  2AS5 F;  4XSX F;  1JE8 A;  1VTN C;  3DPL C;  2XAQ A;  1H0M A;  4M9Z A;  2DFI A;  3Q5F A;  2L02 A;  1Y0U A;  4UVA A;  4EMS A;  3E97 A;  2ISZ A;  3JTG A;  3KP4 A;  2H6C A;  4ENJ A;  1QO0 D;  3WE2 A;  4R8H A;  2VT2 A;  1RIO H;  4Q47 A;  4CXF A;  4MGR A;  4RAZ A;  2KIU A;  2IP2 A;  1K6O A;  1YS6 A;  1EH6 A;  3K1N A;  5ED4 A;  3GFL A;  4QWQ A;  3KZY A;  3HRU A;  1T2K A;  2XIG A;  5DUI A;  1R23 A;  2F5D A;  3J81 Z;  4U7D A;  3ECH A;  3B02 A;  3GF2 A;  2R3S A;  3RKX A;  1XSX A;  2FMY A;  2IA2 A;  3M7G A;  3QU3 A;  3EUH A;  3QU6 A;  3P9K A;  1O3T A;  1W5T A;  2JPC A;  3CTA A;  1NHA A;  2DPU A;  2M1B A;  1P92 A;  1ULY A;  5IT9 Z;  3RI4 A;  2DI3 A;  2FF4 A;  3ZP5 A;  3WGH A;  2H09 A;  1W4M A;  1TQP A;  1EH7 A;  2VC0 A;  4G6Q A;  3KET A;  3H3U A;  3H3Z A;  3PFI A;  3IWZ A;  5AON A;  1FT9 A;  3K1P A;  5H6Q A;  1B4A A;  5HDN A;  1O3Q A;  1S8N A;  4G6D A;  1QGP A;  3R61 A;  4O3M A;  2HZT A;  3F3X A;  3DXJ F;  1KU7 A;  1GHC A;  1TNT A;  1XGN A;  3QOP A;  2VXZ A;  1XSV A;  5CJ9 A;  3WTU C;  2A69 F;  2HTJ A;  2EFQ A;  1ODD A;  5HOO A;  3KP2 A;  1IRF A;  1XGO A;  1ZG3 A;  1XDU A;  2DQR A;  1H9T A;  1O57 A;  3WTZ A;  3LAP A;  3IWF A;  4FHT A;  1RI7 A;  3EYI A;  3K2Z A;  3L00 A;  4AWX B;  1U8R A;  3R60 A;  4LB5 A;  1ZHF A;  5HS7 A;  5DD8 A;  3F6V A;  2JZY A;  3TO9 A;  2OBP A;  2W84 A;  2QLZ A;  3K69 A;  1SFU A;  4YFN F;  2ZNZ A;  2DAO A;  3E5U A;  5TRD A;  2CWE A;  4A6D A;  1G3T A;  2JRT A;  1R1U A;  2XUB A;  2YR2 A;  4YG2 F;  4A5N A;  5L3F A;  4I2O A;  4IF4 A;  3JSO A;  4YFK F;  4F7Z A;  2KJC A;  1CF7 B;  5ICC A;  1MDM B;  2O3F A;  1LNW A;  2G9W A;  3TGN A;  2P5K A;  2BYV E;  2Z9O A;  3QP6 A;  5D5W B;  1O3S A;  2PQ8 A;  1LDK B;  1XMK A;  1MZB A;  1FSH A;  3E6C C;  1KGS A;  3N97 A;  5EEG A;  2RC4 A;  3SFZ A;  4UVC A;  1FP2 A;  4EV0 A;  3FM5 A;  2PG4 A;  1BI2 A;  2ZJ2 A;  1Z6T A;  4RS8 A;  1MKM A;  2YX4 A;  3V7S A;  4WCG A;  1CGP A;  4BHP A;  3P9C A;  4EQQ A;  2QVO A;  3I58 A;  1YG2 A;  3GZ6 A;  4G94 A;  5BS6 A;  5FO5 A;  4OIP F;  1K7A A;  1LQ1 A;  5L3E A;  4ENK A;  2HR3 A;  3FX3 A;  1HKT A;  2EFO A;  3BPX A;  3FHZ A;  1T6S A;  1TTY A;  2HS5 A;  5BMZ A;  3I0T A;  5LEK A;  2M30 A;  3ZPL A;  2M8E A;  3HIF A;  3IHU A;  1IXS B;  4HF0 A;  2EJR A;  3JSP A;  2XAH A;  2VN2 A;  3QRF F;  1AOY A;  4LFU A;  4Q48 A;  2VC1 A;  2ZNY A;  1S7A A;  4HV5 A;  2DLL A;  1G3Y A;  3K1M A;  4YFX F;  2XHK A;  4EGZ A;  1LDJ A;  1KU2 A;  2V9V A;  3MZH A;  2FE3 A;  1BM9 A;  5E1Z B;  1RNL A;  3GYH X;  4U88 A;  3VOD A;  1ZH5 A;  2DBB A;  3CO7 C;  3I59 B;  1G3S A;  2H6B A;  1W7P A;  4OIO F;  2RKH A;  5BPI A;  3FMS A;  1QNT A;  2W57 A;  5LGN A;  3HRM A;  4PGH A;  1XB4 A;  1YW7 A;  3RJP A;  1FYM A;  1UFM A;  4HOB A;  1ZG5 A;  4ON0 A;  3LFK A;  5LHH A;  2RN7 A;  5TJJ A;  4N9H A;  4XLN F;  1D3Y A;  4PCQ A;  4HBL A;  4FX0 A;  4KIB A;  1Z6R A;  1UST A;  1HBX G;  4MNU A;  2FML A;  3BY6 A;  5F64 A;  4O6J A;  3F8C A;  2RVC A;  1USS A;  1T0F A;  5L3D A;  2DPD A;  4GYG A;  4KFC A;  1OMI A;  3W6J B;  1YIO A;  3DF8 A;  5JVT A;  4M74 A;  3D0S A;  2HYG D;  1D8J A;  3L7W A;  2VOD A;  4IRG A;  1R1V A;  2NNN A;  1TQM A;  4I7H A;  3FXR A;  5LRS A;  2K86 A;  4LG0 B;  4B09 A;  1SD7 A;  1J7K A;  2NAZ A;  4EJU A;  3TKY A;  2QYO A;  1AWC A;  1E2X A;  2O0Y A;  4HAM A;  2QBY B;  1WQ2 A;  2A68 F;  2H94 A;  5ICF A;  2K4B A;  1J9I A;  3Q9S A;  1R5H A;  1YFH A;  4LLG F;  3FWE A;  1FWZ A;  5CVU A;  1B9N A;  3PQJ A;  2QQB A;  1SD4 A;  3T8R A;  1R22 A;  1FY7 A;  3J80 K;  1V4R A;  4HF2 A;  1UB9 A;  3LA3 A;  1ZRF A;  1J2X A;  2ELH A;  1BN5 A;  2ADU A;  3HTU A;  4EVI A;  2VBZ A;  3ELK A;  1CF7 A;  1IUY A;  1IXC A;  3B73 A;  4AVP A;  4DQ2 A;  3CLO A;  1IN5 A;  3WTT C;  4Y17 A;  5LEJ A;  4YII A;  1YW8 A;  3AAF A;  3CDH A;  3CUO A;  2HQN A;  1EV7 A;  1TNS A;  3GLX A;  4I09 A;  2RNJ A;  2F5E A;  4HDU A;  1RUO A;  4HDV A;  3E3V A;  3ECO A;  3QAH A;  1G4D A;  2O8X A;  4LK1 F;  1PDN C;  2J5O A;  4HLY A;  1R7J A;  2FBH A;  4AIK A;  4BXU A;  2DQL A;  5LHG A;  1QBJ A;  5E8I A;  3SZT A;  1F1Z A;  2PEX A;  4MTD A;  1U6G A;  4KDP A;  3TOA A;  2Y75 A;  4FT8 A;  2FEZ A;  3TO6 A;  1KQ9 A;  1K79 A;  2OA4 A;  1WI9 A;  4Y13 A;  1S3J A;  5CYV A;  3HRS A;  1IAW A;  3DP7 A;  4IHS A;  2GXG A;  3MQ0 A;  3TO7 A;  4CO8 A;  5CLS A;  4A6E A;  3SHF A;  4TV7 A;  2VBX A;  2DTR A;  2FOK A;  4L9V A;  3HSR A;  3M9A A;  1HKQ A;  2XKP A;  1R1T A;  1FNN A;  4EGY A;  3F8F A;  2KIF A;  5E1X A;  3MWM A;  2IT0 A;  2MBF A;  4AD9 A;  3J80 Z;  1HQC A;  2L4A A;  3EDP A;  3DEU A;  1B59 A;  2MH2 A;  4EJW A;  3NRV A;  5IT3 A;  4BHB A;  2FXA A;  2Y0M A;  4AIH A;  3KP7 A;  4L18 B;  3R0J A;  3J81 K;  4WXD A;  1T39 A;  2GIV A;  1BJA A;  3O2P E;  3NQO A;  3SZP A;  3F21 A;  5JI6 A;  1P2F A;  4G8X A;  3FXQ A;  2MH9 A;  3C18 A;  2QZ8 A;  1R5G A;  2EFN A;  3W6K B;  2ZCW A;  4RGU A;  1O7L A;  1DPU A;  1ZYR F;  2Z3Y A;  1C0W A;  1ZLK A;  3IKT A;  1IW7 F;  4EJV A;  1G3W A;  4L9T A;  4M71 A;  1P4X A;  3HSF A;  3VOE A;  3ZMZ A;  5L3C A;  2EA4 A;  5D6F A;  1SMT A;  3I4P A;  2K02 A;  2CFX A;  2A6E F;  4HZF A;  3WGG A;  3EYY A;  1FZP B;  2M87 A;  2EV5 A;  4NB5 A;  3IL2 A;  1O7F A;  3P9I A;  4CHU A;  3LQR A;  1I1G A;  2ZO4 A;  2YU3 A;  5ICE A;  1YLF A;  3HOT A;  4G7O F;  2XAS A;  1B9M A;  1RZ4 A;  4OIR F;  1HST A;  2JSC A;  1BC7 C;  2L01 A;  2JPB A;  1ZGJ A;  3ZN0 A;  3WTX C;  1LEB A;  4U0Y A;  5DV5 A;  2PJP A;  2CQK A;  3IKV A;  3BJO A;  2GAU A;  4I02 A;  2Q2E A;  4CGZ A;  1Q1H A;  1L0O C;  2FSW A;  4HA8 A;  2A3S A;  1LVA A;  1U78 A;  3ERE D;  2EWN A;  4A5M A;  3L09 A;  2E1N A;  2E7W A;  2RGV A;  1ZRD A;  3C7J A;  1HW1 A;  1U2W A;  2H27 A;  2RQP A;  1OKR A;  4K2E A;  1XCB A;  2F2E A;  1P6R A;  2D1H A;  5AIQ A;  3IRQ A;  4P9U A;  1P4A A;  1TLH B;  5K5O A;  3SXY A;  4GCV A;  2K4J A;  2LKP A;  3K9T A;  2IA0 A;  4WX9 A;  3ISP A;  2IJL A;  1L3L A;  2OZ6 A;  2R7F A;  3V8L A;  1XDS A;  4NHJ A;  4CYD A;  2FRH A;  4WF2 A;  4LLN A;  1TBX A;  4OU0 A;  5FFZ A;  3C1D A;  5ERI A;  1F4K A;  1B1B A;  2OU2 A;  2ESH A;  5D8K B;  2KJB A;  3V4G A;  2OAZ A;  3IC7 A;  3S2W A;  3GFJ A;  2PN6 A;  4JQF A;  1OYW A;  4FX4 A;  3D5L A;  4KIF A;  2MD5 A;  3GXO A;  5DD4 A;  3FMR A;  1ZGA A;  3ZMS A;  4EM1 A;  5DCF A;  1GXP A;  4ZYD A;  1FBU A;  4ENM A;  5IT9 K;  2EFW A;  4KMF A;  1I1S A;  4S05 A;  5J8F A;  4OOI A;  2DU9 A;  1IN7 A;  5DEQ A;  5K5Q A;  3J7A O;  3I59 A;  5ILU A;  1YW9 A;  2E1C A;  3FZV A;  4BNC A;  1IRG A;  1WWX A;  2Z5U A;  3O3K A;  2XGX A;  1IZ1 A;  4GGG A;  2GA2 A;  1MD0 A;  3ZMU A;  5LGT A;  3BWG A;  5D4S A;  3ROU A;  3DQV C;  4WK8 F;  1FBQ A;  3I71 A;  4L9N A;  1Z9C A;  1SD5 A;  2W85 A;  4ZYH A;  3I5U A;  5DCM B;  1FLI A;  5D8L B;  2FA5 A;  1HSJ A;  2CSO A;  1SD6 A;  2HTS A;  2Y48 A;  4ESJ A;  3BP8 A;  4KIC A;  2K7L A;  1ZG1 A;  4ASN A;  1HKS A;  3ULQ B;  1X3U A;  4IRI A;  4UUV A;  3ABT A;  1U5T C;  3E5Q A;  4KN4 X;  4WWC A;  1DUX C;  2TDX A;  2O61 A;  3RPQ A;  1JXS A;  4A0Y A;  2IRF G;  1OYI A;  4EM2 A;  3RKW A;  4HQM A;  4RB0 A;  2PLY A;  2XV4 S;  3E6M A;  2YX7 A;  2DK8 A;  2VT3 A;  4UVB A;  2EA2 A;  3TOB A;  2PBI A;  2NYX A;  3F22 A;  3I64 A;  3RIR A;  2PI0 A;  4U7B A;  1KQ0 A;  4GO1 A;  2VBY A;  2CW0 F;  4ZZD A;  3RYP A;  2MLK A;  2PFB A;  1IN8 A;  4M73 A;  2UWM A;  2G7U A;  2ZME A;  5BQT A;  2ESN A;  2STW A;  2HKO A;  4RGS A;  2RDP A;  5AIP A;  1UCR A;  1G6N A;  3GUD A;  3ZMT A;  1SAX A;  1HW2 A;  2HYF A;  3MCZ A;  2D1V A;  4LMY A;  4G7Z F;  3GEZ A;  5HDK A;  1WSU A;  4MQV A;  1T38 A;  3JW4 A;  3ML6 A;  5BPD A;  1IXR C;  4MTE A;  3WG9 A;  5KK1 A;  1Z7U A;  1I5Z A;  1R00 A;  2COM A;  1P4W A;  1S6L A;  2IPQ X;  3F8M A;  1PP8 F;  3T5X A;  3RDI A;  1FYK A;  3U2R A;  2IA1 A;  4G9Y A;  1REP C;  1UHW A;  3R4K A;  2DK5 A;  4AIJ A;  4U0W A;  2C6Y A;  2IVM A;  1IN6 A;  2BBY A;  1KYW A;  3VEP A;  1ZAO A;  1EH8 A;  2KRF A;  2NNY A;  2VE8 A;  6PAX A;  1SFX A;  1D5V A;  4P96 A;  4HV6 A;  3I53 A;  3OV8 A;  1FSE A;  2WTE A;  1LEA A;  1R58 A;  3GX4 X;  3MEX A;  2QWW A;  3MZY A;  2D2W A;  3CUQ A;  2OQG A;  2RV8 A;  2BV6 A;  3KCC A;  4L9J A;  1PP7 U;  2FQ3 A;  4XSZ F;  1OYY A;  5D5V B;  3DPT A;  5HLI A;  5E8G A;  3VFZ A;  1U5T A;  2DT5 A;  5LHI A;  4BQA A;  1UHM A;  3LST A;  4UNO A;  3WU1 B;  2Z33 A;  2NS0 A;  4Y15 A;  1V3F A;  3U9G A;  1MJ9 A;  1MGT A;  1ON1 A;  1ZN2 A;  1S7O A;  4I0B A;  5J6X A;  1PUE E;  2D45 A;  1F9N A;  4ZYG A;  3V8K A;  3T8T A;  4P9F A;  3T1B A;  3Q9V A;  4HX8 A;  5BOX A;  3IRR A;  2A6H F;  4IVN A;  3F8N A;  2WV0 A;  5CVI A;  3RPU A;  1Z05 A;  3KEQ A;  4KN7 X;  4UHT A;  2L3D A;  2F5F A;  3BOQ A;  3WTW C;  1K78 B;  2XRN A;  2W25 A;  3JAM K;  2V1U A;  3LA2 A;  3ABU A;  5A2Q K;  4G7H F;  4Q5S F;  4KIG A;  2QBY A;  2VOP A;  1RUN A;  5L3B A;  2LDU A;  1WRJ A;  5DUK A;  2QEN A;  2P5V A;  2EB7 A;  2LSO A;  3E6D A;  2EV6 A;  1BI3 A;  2XAF A;  3F72 A;  1W7P B;  1KU9 A;  1T98 A;  1XGM A;  4I01 A;  4R1H A;  2CYY A;  3CO6 C;  3U1D A;  3QPT A;  1U5T B;  4A2U A;  2M45 A;  3HUG A;  2P7C B;  2JT1 A;  4OIQ F;  2P5L C;  3G3Z A;  3GZ5 A;  4HLX A;  1BIB A;  4WXC A;  4RB3 C;  2HDC A;  2ZME B;  5DCM A;  5HS8 A;  3OOP A;  4NQW A;  4ETS A;  1I27 A;  1ONV A;  3BJA A;  4PGG A;  2KIM A;  3V7R A;  3LWF A;  3F8B A;  5DYM A;  5JR3 A;  2V1X A;  2YPR A;  4CIC A;  5CVR A;  4R79 A;  2CG4 A;  4E70 A;  5JFR A;  1BOA A;  4RGX A;  3R6S A;  1XSD A;  4KMU X;  1KA8 A;  5DDG A;  1KYZ A;  4WXH A;  2VE9 A;  4MQ9 F;  4HX7 A;  2P6T A;  1J59 A;  2QQ9 A;  4LD5 A;  2VON A;  1OR7 A;  3F23 A;  3ZMV A;  3RYR A;  2Q0O A;  1GXQ A; 
#chains in the Genus database with same CATH topology
 2LF8 A;  2DFH A;  4CZZ A;  1O3R A;  1OCZ H;  2LMD A;  4PDK A;  2HVR A;  2KP6 A;  2QUF A;  3WTV C;  4HSR A;  1TW3 A;  3JRH A;  3GVA A;  4ITV A;  1GV2 A;  4UV9 A;  3KP6 A;  4D1Q A;  1MIJ A;  3PNT A;  4RB1 A;  2JUC A;  1Z91 A;  4LK0 F;  2A07 F;  2KRC A;  1FP1 D;  2ISY A;  4ZH4 F;  2VLA A;  1JJ6 C;  2PJR A;  1HXD A;  4CH7 A;  5B5E C;  2A5Y B;  4N0B A;  5FGM A;  3VSK A;  4CCJ A;  4XK4 A;  2ZFW A;  3W2A A;  4BJ6 C;  1FEX A;  4JX6 A;  2QM3 A;  3L2U A;  4NC7 A;  2FBI A;  2IAI A;  4RAF A;  1XCV A;  4DIQ A;  3A2K A;  3HHG A;  2IS4 A;  2DO7 A;  4OMY A;  2DMQ A;  2EZL A;  2QQ8 A;  1JJ8 C;  4RAG A;  1MND A;  4ESB A;  5K1Y A;  1ZRE A;  4BY1 J;  2IXS A;  3H3V K;  3S3O A;  3WU0 A;  1ACI A;  2EV0 A;  4XBF A;  1QZZ A;  2CO5 A;  4LJZ F;  1HDP A;  3DBR B;  5A2Q Z;  4A3M J;  2CQQ A;  4DNC A;  3FKJ A;  4Y3O A;  4M9S A;  3KP3 A;  1TWH J;  2EFP A;  5J40 A;  5FD6 A;  1T8I A;  2MLG A;  5H6R A;  4GXO A;  3RZO J;  1HF0 A;  4A0Z A;  3A1Y A;  2IGO A;  2E7X A;  3COA C;  5HNF A;  2X1C A;  3BRO A;  4M72 A;  3DKX A;  4II2 A;  2WB1 N;  1X1B A;  1XG1 A;  2L4M A;  1YX5 A;  1BL0 A;  2WAE A;  2A61 A;  5ILV A;  2F4I A;  2MW8 A;  1I6X A;  2R7D A;  3FK7 A;  1TWF J;  4P55 A;  1MSF C;  1RKT A;  3VB2 A;  2R5Z A;  3MVP A;  2F5C A;  2RRE A;  4MHG A;  5HLG A;  2QQA A;  3C3W A;  3FXU A;  4F3Q A;  4MFE A;  3TP0 A;  3OYB A;  4YIF A;  2PMZ N;  2VAS A;  1JTX A;  4BQO A;  1JHF A;  3GTL J;  3M8E A;  3G73 A;  5D5X B;  5E20 A;  3GTG J;  2CGP A;  3LQQ A;  2P7V B;  2WV1 A;  4D0P A;  2CMP A;  5CVV A;  1IF1 A;  3N4M A;  1NH3 A;  1OPC A;  1Y1W J;  1YIT I;  4XKW A;  2OTL I;  2W7N A;  4XR6 A;  3F0C A;  2NVU B;  4GRI A;  4ZDL A;  3KE2 A;  4LB6 B;  3TDU C;  4L0Y B;  1X1C A;  4IHW A;  2JTV A;  3DKW A;  1LB2 A;  1A04 A;  1SVM A;  5FRO A;  3Q0U A;  1LJ9 A;  3RTR A;  2P6S A;  2LBF A;  2HI3 A;  4MEY F;  2HOT A;  4I76 A;  3ASO H;  2M5W A;  3LSI A;  5DM7 F;  2GA1 A;  1YTY A;  1YS7 A;  1OCT C;  2IW5 A;  1ZLJ A;  3ESW B;  4O5V A;  5JVG F;  1ZR2 A;  2M3A A;  2X6X A;  2PMH A;  4MO7 A;  2M9H A;  2K3F A;  4ENN A;  2M8G X;  2P4W A;  1OJL A;  4L5I A;  3RCO A;  5E17 F;  1KZH A;  1BBY A;  2BGC A;  1LE8 A;  1ETX A;  1Y56 A;  3GFM A;  5CVJ A;  4IOA F;  1ON2 A;  2XPW A;  3CCE I;  4UB8 C;  2HYJ A;  2KQR A;  2IBD A;  3VSL A;  2PMU A;  3C2H A;  3D5S C;  2VKV A;  1P9Q C;  4IRH A;  1MJA A;  3VYU B;  4KYW A;  3S2D J;  2KFD A;  4HX4 A;  1D0Z A;  1ZAR A;  2V1N A;  4XKC A;  4HQE A;  2BE5 F;  2W24 A;  1GVJ A;  3BDD A;  2E36 A;  3KEO A;  1ETQ A;  2BY3 A;  4M6X A;  3JR9 A;  2R5Z B;  4HRI A;  3EET A;  2XAG A;  5F1J A;  3FXL A;  2XGD A;  4BKX A;  1U3E M;  2FNP A;  3KFW X;  3A02 A;  2ZKZ A;  4OIN F;  2WA0 A;  3REO A;  1BI1 A;  3U21 A;  4ZTJ A;  2EK5 A;  3KZZ A;  3PQK A;  3FIW A;  3OL4 A;  5HLT A;  4JP0 A;  4LG0 A;  1BR1 A;  2HWV A;  1VQ9 I;  4MEX F;  1IRZ A;  2K27 A;  2HKX A;  1D0X A;  1MDM A;  2P8T A;  2LF7 A;  3JAM Z;  2XGE A;  2XKO A;  3JRF A;  2EIM H;  1MBK A;  1W5S A;  2CJJ A;  4HNT A;  1STZ A;  3K7A J;  4CSW A;  3WGI A;  2L7K A;  3D5R C;  2CV2 A;  2KPM A;  4JK1 X;  1HA8 A;  5H20 A;  1FX7 A;  2O03 A;  4I0A A;  3OSG A;  4PJN A;  3HOZ J;  4DYR A;  2UZK A;  4ESF A;  4RB2 C;  2KKO A;  5D6E A;  4ZZL A;  2NVQ J;  3V8J A;  3MKY B;  1YJN I;  2AQE A;  5HNH A;  1EA3 A;  1TW2 A;  2BY0 A;  2VXD A;  3LSJ A;  3SJM A;  5D5U B;  5LBQ A;  3DV8 A;  1IDY A;  2MG4 A;  4KIT B;  4BJT A;  3GTJ J;  4BQQ A;  4IHV A;  4U0V A;  1F5T A;  1BC8 C;  1JT6 A;  2VJ4 A;  1E0E A;  1WH5 A;  3MAJ A;  2X4H A;  2GZW A;  2MD0 A;  4C30 A;  2I10 A;  2M4G A;  3EPZ A;  2DYS H;  1H9G A;  3FM3 A;  5F6F A;  4V2F A;  5LRR A;  2DW4 A;  2LVS A;  3HHH A;  2L9N A;  3GZN B;  1HW5 A;  2XPU A;  4LLL A;  5B1A H;  4D7N A;  1SFK A;  1VQ6 I;  1Z1D A;  1YQA A;  4BYY A;  3CJN A;  1A35 A;  1S29 A;  2XRL A;  5F1R A;  5IYC J;  2OZU A;  5ICG A;  5KNL A;  1Y8Q B;  5ILS A;  3WHB A;  5IP6 A;  4HYE A;  1X4O A;  5JLW A;  1QZY A;  2B63 J;  3CC7 I;  2JA2 A;  2O6G E;  3KEY A;  1ZRC A;  3WTS C;  3RKY A;  2LFB A;  1MBE A;  3ZQ7 A;  4ZYE A;  2VUM J;  4IHT A;  2BW3 A;  1FMW A;  4JBA A;  1LDD A;  2VQC A;  3JRB A;  1XGS A;  2M0C A;  4XLP F;  1W36 D;  1F43 A;  4BH9 A;  2LRD A;  2BW3 B;  2XPV A;  3VYS B;  3O6B B;  1UZC A;  3E1S A;  3H92 A;  3KP5 A;  5K5R A;  3F6O A;  2KZV A;  5KVR A;  3S1Q J;  3QYE A;  2IS6 A;  3OS0 A;  2G7H A;  1TQI A;  2DCE A;  2YSR A;  5E18 F;  1YRN B;  2R7Z J;  2PMZ A;  3ERM A;  1BI0 A;  2R92 J;  2XAJ A;  4BE1 A;  1MMS A;  3R0A A;  4L5J A;  3K4N A;  3I54 A;  1Z3X A;  2VOO A;  3JRG A;  3AL0 C;  2ZXJ A;  1KU3 A;  1UG2 A;  4UXN A;  4XID A;  1FBS A;  2B0L A;  1SAU A;  5EEH A;  3P7N A;  2K9L A;  1MMN A;  1QPM A;  5HVQ C;  3K4J A;  4B47 A;  4DBR A;  1W7P D;  3TQN A;  1JGG A;  4AID A;  3CUQ B;  3PNY A;  2WWY A;  3V7C A;  1RRJ A;  2LK2 A;  3FK6 A;  4LIT A;  3OS1 A;  2IGK A;  3IP4 B;  1XMA A;  1KQ8 A;  2PX9 A;  5J8C A;  2E2I J;  3SZG A;  1MH3 A;  2ACJ A;  1WI3 A;  5IYB J;  3GFI A;  1D1B A;  2MA3 A;  3GCM A;  5HS9 A;  2VQG A;  3BZ6 A;  1ETW A;  3BPV A;  2Q8K A;  4KA4 A;  2NVX J;  3E6B A;  4KNY A;  2HOE A;  1NK3 P;  4LGW A;  1FYL A;  3DFG A;  4DYQ A;  5FB2 A;  4EM0 B;  1T95 A;  1D8K A;  1QRY A;  3IAM 2;  2XVC A;  5M5W J;  4IXA A;  4I98 B;  2X0L A;  1DP7 P;  2MC3 A;  4S04 A;  3FHN A;  2STT A;  2JSP A;  1RR7 A;  5EZH A;  1D1A A;  1JKR C;  1A5J A;  4PUS A;  4BEH B;  2JJ7 A;  2QA4 I;  3HOS A;  2HEO A;  1JHH A;  4PZJ A;  4BHC A;  3GO5 A;  3LAJ A;  3HYI A;  1MMG A;  2HOS A;  3QPH A;  2VB6 A;  2ZBK A;  1Z21 A;  2HFH A;  3V42 A;  1WZ2 A;  3DLA A;  1ETV A;  2UXN A;  1FOK A;  4A0X A;  4NC6 A;  1R71 A;  3L2C A;  5FLX Z;  5E1W A;  4B48 A;  5LLQ A;  3GWZ A;  4DBQ A;  3BG5 A;  4L0Z B;  4IPA A;  2DOD A;  5HLH A;  2LH9 A;  4RDU A;  2V79 A;  2Z99 A;  3HSE A;  1XMX A;  1HC8 A;  3K10 A;  3FMQ A;  4UV8 A;  4RAY A;  3WE3 A;  4V19 K;  4KT5 C;  3E5X A;  1J75 A;  3KLN A;  3S16 J;  2AXL A;  2Y2Z A;  4P1W A;  1B6A A;  1X2N A;  1RET A;  2GOX B;  2JK3 A;  4E7L A;  2JRM A;  3IH3 A;  1FC3 A;  5F0H A;  3UR3 C;  3G1O A;  1I3A A;  1IN4 A;  3KPH A;  2XRO A;  2BEO A;  3OYL A;  4Q4Z F;  1SMY F;  2LD5 A;  4BAY A;  3CUQ C;  2FNA A;  2MSY A;  3UKG A;  2WC2 A;  2OQR A;  2KT0 A;  2WBM A;  4CDG A;  1WJD A;  2N8G A;  2OD5 A;  3MFK A;  1WVR A;  1Z77 A;  1JUM A;  4UUT A;  3GTQ J;  2ICW G;  4FCY A;  4L5E A;  2GWR A;  4LOC A;  2ZFU A;  2NRA C;  3QOE A;  4XLA A;  3QP5 A;  3QYF A;  1XX5 A;  5FD5 A;  4BL0 B;  4EJO A;  1YHQ I;  3KLO A;  1J5Y A;  4X0G A;  2R93 J;  5F0C A;  1R36 A;  2GXB A;  3L2Q A;  4EJT A;  1XN7 A;  1R4N B;  3KIO A;  4PJL A;  4XKB A;  3PO3 J;  1V54 H;  4GYI A;  2FU4 A;  4A12 A;  1XTA A;  1DPR A;  3M1E A;  3GW2 A;  1Z7L A;  3H9G A;  2L7Z A;  4FIS A;  2ETH A;  2HGC A;  3ZMD A;  1DDN A;  3BJ6 A;  3CC2 I;  2KLO A;  4A3L J;  3IH4 A;  4CZC A;  3K0L A;  2DA6 A;  4PSW A;  4RMN A;  1JGS A;  2FBK A;  4N9I A;  3DLL F;  2FUG 2;  3HRT A;  2HQR A;  2R5Y B;  5L3G A;  2LNB A;  1XD7 A;  1Y6I A;  5D4R A;  3JRI A;  4UY8 I;  1WFX A;  3I56 I;  1FPQ A;  2GQQ A;  3BTJ A;  3ASN H;  1BR4 A;  1LFU P;  1BIA A;  4IJA A;  3WTY C;  4XRF A;  2V1D A;  3E0J B;  3AG4 H;  5LGU A;  2L54 A;  4BEH A;  5C4J J;  5HDG A;  1YYV A;  3LA7 A;  1K83 J;  3L1P A;  5FFX A;  4P5O A;  4I6Z A;  4M9X A;  3CF2 A;  2ZJP F;  2J5P A;  1HOM A;  2F5V A;  3AG1 H;  1UG0 A;  1VQ5 I;  5F08 A;  3SDG A;  3TMO A;  3J7Y J;  2IS2 A;  3FF5 A;  4M6Y A;  1YO5 C;  3RKQ A;  2E1M B;  4PJ0 C;  2A5W A;  2EZH A;  4OMZ A;  1QQI A;  3EQL F;  4QLC U;  4FAS D;  5GAH J;  1W0T A;  2BXZ A;  1ETO A;  1WJC A;  3NEU A;  3BLY A;  2UXX A;  3CQZ J;  4RGR A;  1GVD A;  2EIN H;  3L9F A;  3K6G A;  4HF1 A;  1SVL A;  2OV7 A;  1Q1V A;  2IEK A;  1J0R A;  3K4K A;  4HW0 A;  3SDB A;  4Y4R A;  3DWL E;  3OYM A;  4DZJ A;  3DTK A;  3SQN A;  2AQF A;  5FLX K;  3T0Y A;  1E17 A;  5J47 A;  3HTS B;  4B8X A;  3ZN1 A;  1IUF A;  3JTH A;  3WOD F;  2CH0 A;  4Z2Y A;  2W00 A;  2DT6 A;  2K9N A;  1B72 B;  1E3P A;  1K78 A;  2VBW A;  1MBG A;  2WY8 Q;  5JHU A;  2V6C A;  4ZTF A;  2UUZ A;  3M8F A;  1MJB A;  2DA7 A;  1SFE A;  4KUM A;  5J1U A;  3NWT A;  1WKM A;  3SYT A;  1FIP A;  4F52 A;  3TDZ C;  4H0E A;  2AS5 F;  5FKL A;  4XSX F;  2YS9 A;  1JE8 A;  4M3F A;  1VTN C;  3DPL C;  4B1R A;  2XAQ A;  1ZTR A;  4C3I J;  5M5X J;  1H0M A;  2OPT A;  4M9Z A;  2NXN B;  2DFI A;  1B8I A;  4OAY A;  1H8A C;  3Q5F A;  2ECC A;  3H9Q A;  2L02 A;  1Y0U A;  1BJZ A;  5FLV A;  1R6R A;  2VPR A;  2WAQ N;  4NNJ A;  4UVA A;  4EMS A;  3E97 A;  4XLE A;  4A69 C;  4BGD A;  3JTG A;  2ISZ A;  3KP4 A;  2XB0 X;  2H6C A;  4ENJ A;  1QO0 D;  3WE2 A;  4R8H A;  2VT2 A;  1GV5 A;  2E5Z A;  5B1B H;  3OIQ A;  1AKH B;  3HOU J;  3HJE A;  1RIO H;  3BG7 A;  4Q47 A;  1IJW C;  4CXF A;  2X6W A;  2L7F P;  2QCO A;  4MGR A;  3I3L A;  2V7F A;  1LKX A;  4RAZ A;  5EG0 B;  2KIU A;  2IP2 A;  1K6O A;  1YS6 A;  1EH6 A;  3QQA A;  3K1N A;  5ED4 A;  3J7A Y;  3GFL A;  2EIJ H;  3O8G A;  4QWQ A;  3KZY A;  4ZJZ A;  3K70 C;  1X3W B;  3LSP A;  3GTO J;  3HRU A;  1T2K A;  2XIG A;  5DUI A;  1R23 A;  2F5D A;  3J81 Z;  2QGU A;  4U7D A;  2LG4 A;  3ECH A;  3HM5 A;  3B02 A;  2DYR H;  3GF2 A;  4RM2 A;  4RA2 A;  2R3S A;  3RKX A;  1X2M A;  4OWR B;  1XSX A;  3CJQ B;  1POG A;  2FMY A;  2IA2 A;  3M7G A;  3QU3 A;  4BXX J;  5FKM A;  1RES A;  5DS9 A;  4XKV A;  3EUH A;  1LFB A;  3QU6 A;  4XN0 A;  1OCP A;  3P9K A;  3AFH A;  3CMM A;  1O3T A;  1W5T A;  2JPC A;  3CTA A;  2LP0 A;  1NHA A;  2DPU A;  2A05 A;  2M1B A;  3GTK J;  1P92 A;  1ULY A;  5IT9 Z;  3RI4 A;  3S93 A;  2DI3 A;  1IV8 A;  4XRS A;  2FF4 A;  3ZP5 A;  3WGH A;  4UUS B;  1Z0X A;  2H09 A;  1W4M A;  1TQP A;  1EH7 A;  2VC0 A;  4CUG A;  4G6Q A;  3LMM A;  5KCM A;  3KET A;  3GBG A;  3H3U A;  3ZQQ A;  2Z16 A;  3H3Z A;  3PFI A;  3IWZ A;  4NC8 A;  5AON A;  1G59 A;  5IYD J;  1FT9 A;  3K1P A;  3PSI A;  5H6Q A;  1B4A A;  2ECB A;  5HDN A;  2OC6 A;  1X1D A;  1O3Q A;  1S8N A;  4YEL A;  4G6D A;  2NOG A;  1QGP A;  3R61 A;  4O3M A;  2HZT A;  3F3X A;  2KL4 A;  1F36 A;  5C4X J;  3DXJ F;  3DU6 A;  1KU7 A;  4E4H A;  1TNT A;  1GHC A;  5FJ8 J;  1WHU A;  1XGN A;  2A6T A;  2Y30 A;  3QOP A;  1AU7 A;  2OTJ I;  4XOT A;  5CKT A;  4PJJ A;  2VXZ A;  1K4S A;  1XSV A;  4V2G A;  1DU0 A;  5CJ9 A;  3WTU C;  1RR8 C;  2KZG A;  2A69 F;  2HTJ A;  3MD2 A;  2EFQ A;  1ODD A;  5HOO A;  3KP2 A;  3HOV J;  1IRF A;  2WAD A;  1XGO A;  1P7J A;  1ZG3 A;  1XDU A;  2DQR A;  2LKX A;  3G1M A;  1H9T A;  1O57 A;  1O4X A;  2E60 A;  3SEQ A;  3WTZ A;  3L2V A;  3LAP A;  3QPL A;  3CME I;  2Y0S N;  3BTI A;  4DW6 A;  4BAC A;  2CW8 A;  3IWF A;  4FHT A;  3JCU C;  2ELJ A;  3OOU A;  1RI7 A;  3K2Z A;  1Y39 A;  3EYI A;  4Y52 J;  3IUO A;  3L00 A;  5HOD A;  4YIR X;  2DDA A;  4AWX B;  3MMY B;  1U8R A;  3OR1 C;  2NVY J;  4QPQ A;  2WB1 A;  5EZG A;  3R60 A;  4LB5 A;  2R7O A;  1ZHF A;  2KHM A;  3S3N A;  2HVS A;  5JHF A;  5HS7 A;  3QPS A;  5DD8 A;  1R9T J;  3F6V A;  3SEZ A;  1WPK A;  2JZY A;  5IY5 H;  1X3Z B;  3TO9 A;  2OBP A;  2W84 A;  2QLZ A;  2XB5 A;  1TT0 A;  1H88 C;  4KIS A;  3K69 A;  1SFU A;  1QVT A;  4YFN F;  2ZNZ A;  1PJR A;  1WJF A;  2DAO A;  2CS3 A;  3E5U A;  3NAR A;  5TRD A;  2CWE A;  3AG3 H;  1ITY A;  4A6D A;  2BHY A;  3BR2 A;  2IGN A;  1QA6 A;  2LY1 A;  1U9O A;  1G3T A;  2JRT A;  1R1U A;  2XUB A;  2YR2 A;  4YG2 F;  4A5N A;  2K40 A;  3EUH C;  5L3F A;  1QHH D;  4I2O A;  1Y0N A;  4XQF A;  4IF4 A;  4UUS A;  4BDY A;  1KON A;  3JSO A;  2K9Q A;  1X19 A;  4YFK F;  2E2J J;  4F7Z A;  2KJC A;  1CF7 B;  3K70 D;  5ICC A;  4HPQ A;  1D1C A;  3G71 I;  1UJ8 A;  1MDM B;  2X48 A;  2O3F A;  5FKN A;  2JVG A;  3S14 J;  1V5F A;  3OWT A;  3HG9 A;  2IGM A;  2M2E A;  4CCK A;  1IV6 A;  1MMD A;  1LNW A;  2G9W A;  3TGN A;  9ANT A;  4XMY A;  3ZQG A;  2WY7 Q;  2P5K A;  3CDL A;  2BYV E;  2X1D A;  2Z9O A;  1MNE A;  4A3D J;  4LIU A;  3QP6 A;  1GUU A;  3OMY A;  5D5W B;  1PUF A;  2LBF B;  1O3S A;  2PQ8 A;  5F0F A;  1U9N A;  1LDK B;  1XMK A;  4D7M A;  1MZB A;  1VF9 A;  2R7R A;  2GBY A;  4B3X A;  1FSH A;  3E6C C;  1KGS A;  3N97 A;  2FD5 A;  3VPR A;  5EEG A;  4M3G A;  2VPL A;  2RC4 A;  1HLV A;  3SFZ A;  4UVC A;  4C2U A;  1FP2 A;  4EV0 A;  3MN2 A;  4AU7 A;  5IP9 J;  4HEA 2;  4IX7 A;  3FM5 A;  4FQG A;  2PG4 A;  1MBF A;  3TBI A;  1BI2 A;  2ZJ2 A;  1W1W E;  1Z6T A;  3QOD A;  4RS8 A;  4E7H A;  1MKM A;  2YX4 A;  2M34 A;  2E1M C;  3V7S A;  4WCG A;  2VKE A;  1CGP A;  4KT6 A;  2ZXW H;  4PJM A;  4BHP A;  1ERD A;  3P9C A;  4EQQ A;  2QVO A;  3I58 A;  1YG2 A;  3GZ6 A;  2LY2 A;  4G94 A;  2O5R A;  2HPM A;  5BS6 A;  1TWG J;  1VZ0 A;  1N78 A;  5FO5 A;  4OIP F;  1K7A A;  1LQ1 A;  5L3E A;  4ENK A;  2HR3 A;  4A3G J;  3FX3 A;  2LR8 A;  1HKT A;  2EFO A;  3J7Z I;  3BPX A;  3OYD A;  3S8P A;  5C3E J;  1T6S A;  3FHZ A;  1TTY A;  1I3Q J;  3N05 A;  2HS5 A;  4A3B J;  5BMZ A;  4A3J J;  2V9P A;  3I0T A;  5LEK A;  2JQ7 A;  2M30 A;  1VI0 A;  3ZPL A;  2M8E A;  4E7S A;  3HIF A;  3IHU A;  1IXS B;  3DTE A;  3CJR B;  4HF0 A;  5GPA A;  3ZGK A;  2F4M B;  3S1M J;  3CDI A;  3PIO F;  2EJR A;  3ZXS A;  3JSP A;  2XAH A;  2VN2 A;  3QRF F;  1AOY A;  4LFU A;  4Q48 A;  1TC3 C;  2VC1 A;  3HXL A;  2HDW A;  5IP7 J;  5GPC A;  2ZNY A;  1S7A A;  2L5Q A;  4FE4 A;  3G6E I;  2CUF A;  1UMQ A;  4NQW B;  1V5E A;  2NS7 A;  4HV5 A;  1MH4 A;  2DLL A;  1G3Y A;  1WJE A;  2BXY A;  3K1M A;  4YFX F;  5CQE A;  2Y0S A;  2CQX A;  2GOM A;  2FJ1 A;  1IRX A;  2XHK A;  1D0Y A;  3L2W A;  1LDJ A;  4EGZ A;  1KU2 A;  2V9V A;  3MZH A;  1A31 A;  2CU7 A;  2FE3 A;  1BM9 A;  3A0H C;  1RNL A;  2EQR A;  5E1Z B;  3ZQF A;  3GYH X;  4U88 A;  3VOD A;  1XS9 A;  1ZH5 A;  2DBB A;  3CO7 C;  1S5L C;  3DCF A;  3I59 B;  1SC7 A;  1G3S A;  3PL8 A;  5FRM A;  2H6B A;  1W7P A;  4OIO F;  2RKH A;  5BPI A;  3FMS A;  1QNT A;  2W57 A;  1HDD C;  5LGN A;  1J09 A;  4IEJ A;  3HRM A;  4PGH A;  1XB4 A;  5IOY A;  5J1R A;  3ZR8 X;  1YW7 A;  3RJP A;  2HXO A;  5J4Y A;  1FYM A;  1UFM A;  4HOB A;  1ENH A;  1ZG5 A;  4ON0 A;  2L9R A;  2ZSH B;  2PJR B;  2E5N A;  3LFK A;  4RLF A;  5LHH A;  2RN7 A;  3LSG A;  5TJJ A;  1ZEL A;  2CQ7 A;  4N9H A;  4XLN F;  3JRE A;  1D3Y A;  4PCQ A;  4HBL A;  4FX0 A;  4KIB A;  4NUB A;  2AHQ A;  4W1U A;  3NWS A;  5FLM J;  1Z6R A;  1UST A;  1HBX G;  4MNU A;  2FML A;  3BY6 A;  5F64 A;  4O6J A;  1WH7 A;  4BXF A;  3F8C A;  4B43 A;  2XF6 A;  2RVC A;  3DPU A;  2DJI A;  3TW6 A;  1USS A;  1T0F A;  2HVQ A;  5L3D A;  4BE0 A;  2DPD A;  4IHX A;  4GYG A;  5GAG J;  4KFC A;  4ZDP A;  3W2V A;  1OMI A;  1OQY A;  3W6J B;  1U0J A;  1YIO A;  2DA2 A;  3RZD J;  3DF8 A;  5JVT A;  2B9S A;  2MC4 A;  3D0S A;  2HYG D;  3HPH A;  3L7W A;  4M74 A;  1D8J A;  2VOD A;  3ZQH A;  4IRG A;  1EKE A;  1R1V A;  2NNN A;  2MYS A;  1GT0 C;  2OF7 A;  2O9L A;  1TQM A;  4AVZ A;  4I7H A;  3FXR A;  4CCO A;  2F48 A;  4D5C A;  2CFO A;  3LSH A;  5LRS A;  1TP4 A;  2K86 A;  4LG0 B;  1EJ9 A;  4B09 A;  5TGT A;  5H2F C;  1SD7 A;  4F93 B;  1J7K A;  2NAZ A;  4XN3 A;  4E7J A;  4XLF A;  2DOA A;  4EJU A;  3TKY A;  2QYO A;  3B6A A;  1AWC A;  2ELK A;  1E2X A;  3TL4 X;  1B8I B;  2O0Y A;  4AM3 A;  2UV1 A;  4HAM A;  3VDX A;  3H5A A;  1WQ2 A;  2A68 F;  2QBY B;  2H94 A;  1WCM J;  5ICF A;  2K4B A;  3H36 A;  1J9I A;  3Q9S A;  1R5H A;  3BG3 A;  2RNG A;  2L2O A;  3A4C A;  4HST A;  1YFH A;  4M3B A;  1N25 A;  5BNG A;  1SEU A;  3CZ6 A;  4LLG F;  1MW7 A;  3FWE A;  1FWZ A;  3BTC A;  5CVU A;  3CCR I;  5C44 J;  1B9N A;  3PQJ A;  2QQB A;  3MZ8 A;  1SD4 A;  3T8R A;  1R22 A;  1FY7 A;  4M3E A;  3J80 K;  3LSM A;  4MIM A;  5LFA A;  1V4R A;  4HF2 A;  1DU6 A;  1UB9 A;  3LA3 A;  1ZRF A;  1J2X A;  2ELH A;  1BN5 A;  2ADU A;  2CRG A;  2E2H J;  3HTU A;  4EVI A;  1PYV A;  2VBZ A;  3CCJ I;  1TWC J;  3C2G A;  1QU3 A;  3ELK A;  4B44 A;  1IGN A;  1CF7 A;  1APL C;  2JN6 A;  1IUY A;  1ZK8 A;  1JT0 A;  3FXM A;  2X1E A;  4HNU A;  3CP2 A;  1IXC A;  3LFU A;  3S15 J;  3NAU A;  3B73 A;  4F91 B;  4AVP A;  4DQ2 A;  3D1N I;  2JUG A;  3CLO A;  1IN5 A;  4IOC F;  3CP8 A;  3WTT C;  2KIS A;  2XF5 A;  4Y17 A;  5EJC A;  5LEJ A;  1ETK A;  4YII A;  1YW8 A;  3AAF A;  3CDH A;  2DMP A;  3CUO A;  2QSH X;  5CQG A;  3MKZ A;  1T08 B;  2HQN A;  1VQK I;  1EV7 A;  2HOA A;  1TNS A;  2DA1 A;  3G1L A;  3GLX A;  3PM1 A;  2DXI A;  4I09 A;  2RNJ A;  2F5E A;  4HDU A;  2DFE A;  1RUO A;  4HDV A;  3DBH B;  5EF6 A;  3E3V A;  3HPG A;  2HDD A;  1V55 H;  3ECO A;  2CV1 A;  3P5J A;  3QAH A;  2ZB9 A;  1G4D A;  2XDV A;  2O8X A;  4LK1 F;  3A03 A;  2J5O A;  2DN0 A;  4HLY A;  1PDN C;  2V4J C;  1R7J A;  3HC7 A;  3ZCO A;  2FBH A;  2VJJ A;  3Q0W A;  4AIK A;  1QPI A;  3CC4 I;  4BXU A;  2DQL A;  1RPW A;  2X6O A;  2G0E A;  1DQU A;  5LHG A;  3AG2 H;  1QBJ A;  5E8I A;  3SZT A;  4N4N B;  1F1Z A;  4QSH A;  3M8J A;  1NG7 A;  1RC9 A;  3TW7 A;  2MAB A;  3E7L A;  2PEX A;  1ZR4 A;  4MTD A;  1U6G A;  3CCU I;  1QVU A;  4KDP A;  5GTH C;  1YX3 A;  3TOA A;  1D5Y A;  1BW5 A;  2JMW A;  2Y75 A;  1MSE C;  3JRA A;  3K2A A;  1AA7 A;  4FT8 A;  2FEZ A;  3TO6 A;  4RLQ A;  1KQ9 A;  2E1O A;  1K79 A;  2M4K A;  3CCV I;  2OA4 A;  1AKH A;  1WI9 A;  1LUJ B;  4Y13 A;  5KHD A;  3BCB A;  3FDY A;  3BR6 A;  4KJZ A;  1S3J A;  5CYV A;  3HRS A;  2CUE A;  1IAW A;  3DP7 A;  2AXT C;  2GXG A;  4IHS A;  5DTD A;  4Y33 A;  3RSN A;  3HKZ A;  2V6E A;  3MQ0 A;  1WJB A;  3TO7 A;  4CO8 A;  2R7W A;  2CW7 A;  5CLS A;  1VQ4 I;  3LSR A;  4A6E A;  3SHF A;  2M7B A;  1PVE A;  3CCY A;  2VBX A;  4TV7 A;  4BUP A;  2DOF A;  2DTR A;  3A01 A;  4IZZ A;  2KDO A;  3OYF A;  2FOK A;  4L9V A;  1FTZ A;  3MKW B;  3HSR A;  4RBO A;  4XNF A;  4XOP A;  1ORK A;  1XC5 A;  3M9A A;  4C2M J;  1HKQ A;  4BU2 A;  3H0D A;  2XKP A;  5EGO A;  5FRN A;  4JYK A;  1R1T A;  1FNN A;  2LLK A;  4BQN A;  2CQN A;  4EGY A;  1AHD P;  2DA4 A;  3F8F A;  2EH3 A;  2KIF A;  3ZQI A;  5E1X A;  1OFC X;  2F6C A;  3MWM A;  3BR0 A;  2IT0 A;  2MBF A;  2O7O A;  1R4M B;  4AD9 A;  3J80 Z;  1B72 A;  4ZC3 A;  3CMY A;  1YJ9 I;  1HQC A;  2L4A A;  1X4P A;  2HPI A;  3DEU A;  3EDP A;  4BDZ A;  3U1K A;  1B59 A;  1FOX A;  2E34 A;  2MH2 A;  2Y9Y A;  3NRV A;  4EJW A;  3M07 A;  1E3O C;  5IT3 A;  3CD6 I;  4BHB A;  2FXA A;  2D5V A;  2Y0M A;  3DBL B;  5IPA A;  4AIH A;  3KP7 A;  4L18 B;  5E3M A;  5KAF C;  2MFZ A;  3R0J A;  3J81 K;  2BZT A;  4ZDO A;  4WXD A;  1Z3Y A;  3PO2 J;  1T39 A;  2GIV A;  1BJA A;  2QSG X;  2BY1 A;  2Q1Z B;  3OYC A;  3O2P E;  4PFP A;  3NQO A;  3SZP A;  3F21 A;  3AL0 B;  5JI6 A;  1P2F A;  3HEF A;  4G8X A;  3FXQ A;  1SFO J;  2H8W A;  2MH9 A;  3HL2 A;  3C18 A;  4JX4 A;  2W48 A;  3FBN B;  2QZ8 A;  1R5G A;  4LG3 A;  2EFN A;  1MMA A;  2ME0 A;  4W97 A;  3W6K B;  1H89 C;  1BR2 A;  3G2B A;  2VIX A;  2ZCW A;  4N4O B;  1X1P A;  4RGU A;  5K7F A;  1O7L A;  4X1E A;  1DPU A;  1ZYR F;  2Z3Y A;  4LIV A;  5F04 A;  1V5G A;  1C0W A;  1CQT A;  4S0H B;  2ZXH A;  2DA5 A;  2LY9 A;  1ZLK A;  3IKT A;  1IW7 F;  4EJV A;  2BY2 A;  1G3W A;  3LSK A;  4L9T A;  2M0M A;  4M71 A;  1P4X A;  3BTL A;  2EIL H;  3WHC A;  3HSF A;  3ABK H;  3VOE A;  2K5C A;  3ZMZ A;  5L3C A;  2E35 A;  2EA4 A;  3Q3S A;  5D6F A;  4F55 A;  3H35 A;  4AUX A;  3ZOB A;  1SMT A;  3I4P A;  2K02 A;  2CFX A;  3OSF A;  4CCN A;  2A6E F;  4HZF A;  3WGG A;  2BVL A;  3EYY A;  2FX0 A;  2WAQ A;  3VWB A;  1FZP B;  4C3H J;  3TED A;  2M87 A;  1TL8 A;  2EV5 A;  4NB5 A;  3IL2 A;  4XON A;  1O7F A;  3P9I A;  4CHU A;  3LQR A;  2ZJQ F;  1I1G A;  1LE8 B;  2ZO4 A;  5EG0 A;  2YU3 A;  5ICE A;  3HGG A;  1S9H A;  1YLF A;  4HNV A;  3HOT A;  3HKZ N;  4G7O F;  2XAS A;  1JUP A;  1B9M A;  1OR7 C;  3EUK L;  1RZ4 A;  4OIR F;  3OYE A;  2E19 A;  3JRD A;  2R0Q C;  3OYG A;  1NG6 A;  4M6V A;  4CYC B;  1HST A;  2JSC A;  1U8B A;  2L01 A;  1BC7 C;  2JPB A;  1DGR M;  1ZGJ A;  3ZN0 A;  3WTX C;  5GP9 A;  4XRM A;  5B66 C;  3GME A;  4QPO A;  1LEB A;  4DYC A;  4U0Y A;  5DV5 A;  2PJP A;  3K4C A;  1QHG A;  1QZE A;  2DDB A;  2CQK A;  1IG7 A;  2GXA A;  3IKV A;  3BJO A;  3BQZ A;  3AKZ A;  2GAU A;  4I02 A;  2Q2E A;  4CGZ A;  1Q1H A;  2OJE D;  1L0O C;  4M3D A;  1EF4 A;  2FSW A;  4HA8 A;  3OR2 C;  2A3S A;  1LVA A;  2QKL B;  1U78 A;  3ERE D;  1MNM C;  1X1A A;  3FXO A;  1JUS A;  2LC2 A;  2EWN A;  4MFD A;  4A5M A;  3L09 A;  4CCL A;  2E1N A;  3CCS I;  2E7W A;  1T33 A;  2K85 A;  1BW6 A;  4A93 J;  2RGV A;  1ZRD A;  5GAD J;  3C7J A;  1HW1 A;  4E6K G;  3HBL A;  4XLC A;  1U2W A;  3BR5 A;  3M1C A;  2H27 A;  2RQP A;  1OKR A;  4D9J A;  4K2E A;  1XCB A;  4BBR J;  2F2E A;  1P6R A;  2D1H A;  5AIQ A;  2HU9 A;  3IRQ A;  4P9U A;  1P4A A;  3VYT B;  1TLH B;  4XLH A;  2LOO A;  5K5O A;  3DEW A;  3SXY A;  4GCV A;  4EEF G;  2K4J A;  2HQA A;  2LKP A;  3K9T A;  5TIS C;  2IA0 A;  3OIO A;  4WX9 A;  2ID6 A;  2NVT J;  3ISP A;  2IJL A;  1L3L A;  2OZ6 A;  2R7F A;  3W3C A;  3V8L A;  2Z2S B;  1XDS A;  4DZP A;  3OY9 A;  4XRS G;  4NHJ A;  4CYD A;  1MBJ A;  2FRH A;  4WF2 A;  4LLN A;  3VYR B;  2GM4 A;  1TBX A;  4OU0 A;  5FFZ A;  2X85 A;  1R49 A;  1LFP A;  1IO2 A;  3C1D A;  1VQM I;  5ERI A;  1F4K A;  3BZC A;  3CCL I;  2Y69 H;  1FOY A;  5J4V A;  1B1B A;  2OU2 A;  1X58 A;  2ESH A;  5D8K B;  2DA3 A;  2KJB A;  3KYC B;  4FTH A;  3V4G A;  2OAZ A;  1Z67 A;  3IC7 A;  3S2W A;  5JLX A;  3GFJ A;  2PN6 A;  4JQF A;  1OYW A;  4BY7 J;  4FX4 A;  4GDF A;  3FBI B;  3D5L A;  4KIF A;  1G8X A;  3O8H A;  3CF5 F;  2MD5 A;  3GXO A;  4J01 A;  2XGC A;  5DD4 A;  3FMR A;  1ZGA A;  3ZMS A;  4EM1 A;  3DU5 A;  4BS9 A;  5DCF A;  1GXP A;  1R5I D;  4ZYD A;  1FBU A;  2NS8 A;  4ENM A;  2R7T A;  2MGQ A;  3ZQC A;  5IT9 K;  2EFW A;  4KMF A;  1I1S A;  2ZME C;  4S05 A;  3A0B C;  5J8F A;  3ONQ A;  3F9K A;  3HB9 A;  2DU9 A;  4OOI A;  1IN7 A;  5DEQ A;  5K5Q A;  2JVH A;  5FKO A;  1T56 A;  3J7A O;  2CUJ A;  3I59 A;  4YEJ A;  4XIC A;  5ILU A;  4CCM A;  4AYB N;  1YW9 A;  2E1C A;  3FZV A;  4BNC A;  1IRG A;  1TZL A;  1WWX A;  2Z5U A;  3O3K A;  2E71 A;  2P0W A;  2XGX A;  3IV5 A;  3H0G J;  1IZ1 A;  2K3P A;  2OCE A;  3I9V 2;  4GGG A;  1JTY A;  2DTZ A;  1MD0 A;  2GA2 A;  4Z6Y A;  4PFO A;  3ZMU A;  5LGT A;  1JI8 A;  3ZQL A;  3BT9 A;  3BWG A;  4ZYA A;  1OCC H;  5D4S A;  3ROU A;  3DQV C;  4WK8 F;  1FBQ A;  3JRC A;  3I71 A;  4L9N A;  1Z9C A;  3BG9 A;  3Q0V A;  1SD5 A;  2W85 A;  4ZYH A;  3I5U A;  5DCM B;  1FLI A;  5D8L B;  2FA5 A;  1HSJ A;  2VKH A;  2CSO A;  2HXI A;  1SD6 A;  3BR3 A;  3IAS 2;  2EZK A;  2HTS A;  2JA8 J;  2Y48 A;  4ESJ A;  3BP8 A;  4KIC A;  4J00 A;  2K7L A;  1OIS A;  4DJA A;  5DM6 F;  2XSD C;  3H5N A;  1ZG1 A;  4ASN A;  1GDT A;  3ZRG A;  3CMA I;  3DKY A;  4A3I J;  1HKS A;  3ULQ B;  4HG2 A;  1X3U A;  2BVM A;  2ME6 A;  4IRI A;  4UUV A;  3ABT A;  4A3K J;  2BHZ A;  4RM3 A;  1K4T A;  1U5T C;  3OYI A;  4F92 B;  3E5Q A;  1GLN A;  5M3F J;  4KN4 X;  2LTP A;  4WWC A;  1DUX C;  3LNQ A;  4G12 A;  2TDX A;  2R7Q A;  4ANJ A;  3OIP A;  1PUF B;  4IQ4 A;  2O61 A;  3RPQ A;  4EAT A;  1JXS A;  4A0Y A;  5M3M J;  1I39 A;  2B7E A;  4XOR A;  2IRF G;  4X6A J;  3MKL A;  1OYI A;  4DOZ A;  2ZJR F;  2ZXI A;  3A01 B;  3K4L A;  4PSX A;  4B4C A;  4EM2 A;  1W36 C;  1VQ8 I;  3HOY J;  3BC8 A;  3RKW A;  2I8D A;  4HQM A;  3FXJ A;  4E7I A;  4RB0 A;  1RKW A;  2PLY A;  3OL3 A;  2XV4 S;  3E6M A;  3KX2 A;  2YX7 A;  2DK8 A;  2HQ5 A;  2VT3 A;  3BG6 A;  4UVB A;  3QYB A;  2EA2 A;  4XM3 A;  1ETY A;  2EZI A;  3TOB A;  2PBI A;  2NYX A;  2K9S A;  1N77 A;  3F22 A;  3I64 A;  3RIR A;  3GLL A;  2PI0 A;  4U7B A;  4E7K A;  1KQ0 A;  2COB A;  4GO1 A;  2YUS A;  2VBY A;  1WJA A;  4OAZ A;  1A36 A;  2CW0 F;  4ZZD A;  5FKK A;  3RYP A;  2MLK A;  2PFB A;  1IN8 A;  2CUZ A;  2FOW A;  1VQL I;  4M73 A;  2UWM A;  3PJR A;  3OYJ A;  2LRE A;  4IL6 C;  2G7U A;  2ZME A;  2XAU A;  5BQT A;  2ESN A;  2STW A;  4J19 A;  2HKO A;  2QEX I;  4RGS A;  2RDP A;  5AIP A;  2YU9 J;  1UCR A;  3PUF A;  1FIA A;  1G6N A;  2M7A A;  3GUD A;  4G6T B;  2L0K A;  3ZMT A;  4AYB A;  1SAX A;  2WAF A;  3PUB A;  3SFI A;  4A3E J;  1HW2 A;  2AO9 A;  3CCQ I;  2HYF A;  1I50 J;  3MCZ A;  2R7X A;  3S1N J;  2D1V A;  3S3M A;  3UNG C;  3OYK A;  4LMY A;  4G7Z F;  1G2H A;  3KYD B;  3GEZ A;  5HDK A;  1WSU A;  3K4M A;  4MQV A;  1T38 A;  3QWL A;  2HZD A;  2EIK H;  2V9K A;  2VKD A;  3JW4 A;  3ML6 A;  2JWT A;  5BPD A;  2VL8 A;  1IXR C;  4MTE A;  3WG9 A;  5KK1 A;  3CCM I;  4PK4 A;  4A3F J;  3IH2 A;  1YOV B;  1Z7U A;  1I5Z A;  1R00 A;  2COM A;  1P4W A;  1S6L A;  2IPQ X;  3F8M A;  3PFY A;  1SAN A;  2DMN A;  3H5R A;  2VI6 A;  1PP8 F;  3T5X A;  2ID3 A;  3RDI A;  1UEL B;  1FYK A;  3U2R A;  3LL7 A;  2H1L A;  3PNV A;  4B3A A;  2IA1 A;  4BJ5 C;  2XSJ C;  3RQI A;  4UB6 C;  4G9Y A;  3S32 A;  1REP C;  3W6V A;  3RPU D;  5KAI C;  2OCC H;  4YRV A;  3X2Q H;  2KRH A;  1UHW A;  4C2T A;  4C9Y A;  3R4K A;  5E3N A;  2DK5 A;  4AIJ A;  2JA7 J;  4U0W A;  4QTR A;  2C6Y A;  2IVM A;  2W1O A;  5K7Z A;  1IN6 A;  5GTI C;  2BBY A;  1DP3 A;  1ZKG A;  2GLO A;  1KYW A;  1MBH A;  3H9J A;  3VEP A;  3W2W A;  1ZAO A;  2XC7 A;  3CLQ A;  1EH8 A;  2KRF A;  4AC0 A;  2W4S A;  2NNY A;  2VE8 A;  5CPR B;  5EEA A;  3BQY A;  6PAX A;  2JA5 J;  3GTP J;  3I4M J;  1SFX A;  2X51 A;  1D5V A;  1W0U A;  2FQ4 A;  4P96 A;  2IS1 A;  4HV6 A;  4D5F A;  4E7Z A;  3BZK A;  3I53 A;  3OV8 A;  3B6C A;  1TWA J;  1UAA A;  1FSE A;  3ABM H;  3M3Y J;  2WTE A;  1LEA A;  2L7M P;  1R58 A;  3CJT B;  1S7E A;  3GX4 X;  1ZQ3 P;  3DEE A;  2R5Y A;  3MEX A;  2QWW A;  3MZY A;  1E3H A;  2D2W A;  3CUQ A;  1M1E B;  2OQG A;  2RV8 A;  2BV6 A;  1BOB A;  2X6Y A;  3LOC A;  3KCC A;  4II3 A;  4L9J A;  1PP7 U;  3HDD A;  2R7S A;  3PIP F;  2FQ3 A;  4IQJ A;  3S17 J;  2EPF A;  2VJ5 A;  4XSZ F;  1OCO H;  1A6I A;  1OYY A;  3L2R A;  1VFC A;  2ZSI B;  1ZGW A;  1VQP I;  3K4B A;  1P7I A;  5D5V B;  3S1R J;  3DPT A;  2DMU A;  2DMT A;  3G4S I;  2Q2E B;  5HLI A;  2Y9Z A;  1K6Y A;  2EBI A;  5E8G A;  3VFZ A;  1U5T A;  2HNH A;  1LPQ A;  3M4O J;  3WU2 C;  2RAE A;  2DT5 A;  5LHI A;  1UHM A;  2K9M A;  3FIS A;  3LST A;  4BQA A;  4UNO A;  4FET A;  3WU1 B;  3HGY A;  2KIQ A;  2Z33 A;  2NS0 A;  1S72 I;  4Y15 A;  3HZJ A;  2GIZ A;  1V3F A;  3U9G A;  1MJ9 A;  1MGT A;  1ON1 A;  1ZN2 A;  1S7O A;  3I4N J;  1YJW I;  4I0B A;  2L9S A;  5J6X A;  1PUE E;  2D45 A;  1F9N A;  4ZYG A;  3V8K A;  1XPX A;  3T8T A;  4P9F A;  1WGX A;  3ABL H;  3C2B A;  2QF7 A;  3T1B A;  3Q9V A;  4HX8 A;  4IO9 F;  4CYC A;  5BOX A;  2Z1D A;  3IRR A;  4QIW N;  2I5U A;  2VQL A;  3GTM J;  1SVO A;  1A6Q A;  2P81 A;  2A6H F;  3I55 I;  4U87 A;  4IVN A;  3F8N A;  2WV0 A;  5CVI A;  3OYA A;  2DJN A;  1Z05 A;  3KEQ A;  4KN7 X;  4UHT A;  2VJI A;  5J3L A;  3RPU A;  5B3S H;  4IKF A;  2L3D A;  3CES A;  4C3J J;  1HCR A;  4JOM A;  2F5F A;  3BOQ A;  3WTW C;  1K78 B;  2XRN A;  5K7H A;  1Y8R B;  1N75 A;  2W25 A;  4XL9 A;  1VND A;  3JAM K;  4NBQ A;  2V1U A;  3LA2 A;  3ABU A;  5A2Q K;  3OS2 A;  2TRT A;  4DGW B;  2CV0 A;  4G7H F;  2NOJ B;  3HUG B;  4Q5S F;  4BE2 A;  1T0F C;  2TCT A;  3H1C A;  4KIG A;  1BA5 A;  4GFB A;  3FXK A;  1JKQ C;  2QBY A;  2LKS A;  2VOP A;  1RUN A;  5IOZ A;  5L3B A;  2LDU A;  1WRJ A;  5DUK A;  2QEN A;  2DFF A;  2P5V A;  4Y7N J;  2EB7 A;  1K61 A;  2OUM A;  5LD2 C;  2LSO A;  3E6D A;  2EV6 A;  1BI3 A;  2XAF A;  2KMU A;  5GAE J;  1JKO C;  5M5Y J;  3F72 A;  1W7P B;  1KU9 A;  3FKI J;  2KDZ A;  1T98 A;  1XGM A;  4I01 A;  3BR1 A;  3HOW J;  3TP3 A;  1VQO I;  4R1H A;  1FOW A;  2CYY A;  2JA6 J;  3CO6 C;  4H4K C;  3U1D A;  1DGW Y;  3QPT A;  1U5T B;  1TT5 B;  4A2U A;  3DTI A;  1LVK A;  2M45 A;  5EYR A;  2L9V A;  3HUG A;  3KZI C;  1NK2 P;  4A3C J;  2DOE A;  2P7C B;  2JT1 A;  2H1K A;  5J1Y A;  1FMV A;  2P5L C;  4OIQ F;  4MLO A;  3EUA A;  3G3Z A;  4NDL A;  1FJL A;  5F27 A;  3GZ5 A;  2LYC A;  4HLX A;  1BIB A;  2Y31 A;  4WXC A;  3PSF A;  2QKM B;  1OCR H;  5EDN A;  1I6H J;  4RB3 C;  2HDC A;  2ZME B;  5DCM A;  1YIJ I;  5HS8 A;  3BCA A;  3OOP A;  4NQW A;  4ETS A;  1I27 A;  1Y1V J;  2W82 A;  1ONV A;  3BJA A;  4PGG A;  1YI2 I;  2KIM A;  3V7R A;  1NTC A;  3LWF A;  3RQ4 A;  3F8B A;  1UHS A;  2DT7 B;  2R4G A;  5DYM A;  5JR3 A;  2XF7 A;  2O8K A;  2V1X A;  4CA0 A;  2H8R A;  2YPR A;  5E79 C;  1YRN A;  4CIC A;  2X9D A;  1WJ5 A;  1VQN I;  2R7U A;  4IHY A;  5CVR A;  4R79 A;  2CG4 A;  3HOX J;  4E70 A;  3OYH A;  5JFR A;  1BOA A;  4RGX A;  3R6S A;  3KYL A;  2QSF X;  4FE7 A;  4KMU X;  1XSD A;  1KA8 A;  4JX5 A;  5DDG A;  2R7V A;  1YE9 A;  5E3L A;  1KYZ A;  3OYN A;  4WXH A;  1FTT A;  4BBS J;  2RQQ A;  2VQH A;  2VE9 A;  4MQ9 F;  3WG7 H;  5EGO B;  1W5C C;  4HX7 A;  2P6T A;  1J59 A;  3S2H J;  2QQ9 A;  4LD5 A;  1JKP C;  1IDZ A;  1IC8 A;  2VON A;  2V26 A;  1OLT A;  1OR7 A;  2BOL A;  3F23 A;  2F4O B;  1VQ7 I;  3ZMV A;  5E3O A;  3RYR A;  4ABZ A;  2ZC2 A;  2Q0O A;  1GXQ A;  4I99 C; 
#chains in the Genus database with same CATH homology
 2LF8 A;  4CZZ A;  1O3R A;  4PDK A;  2QUF A;  3WTV C;  1TW3 A;  3GVA A;  4UV9 A;  3KP6 A;  4RB1 A;  1Z91 A;  4LK0 F;  2A07 F;  1FP1 D;  2ISY A;  4ZH4 F;  1HXD A;  2A5Y B;  4N0B A;  5FGM A;  2ZFW A;  2QM3 A;  2FBI A;  1XCV A;  3HHG A;  2DO7 A;  4OMY A;  4ESB A;  5K1Y A;  1ZRE A;  3WU0 A;  2EV0 A;  4XBF A;  1QZZ A;  2CO5 A;  4LJZ F;  5A2Q Z;  4DNC A;  4M9S A;  3KP3 A;  2EFP A;  5FD6 A;  2MLG A;  5H6R A;  4GXO A;  4A0Z A;  2E7X A;  3COA C;  3BRO A;  4M72 A;  2L4M A;  2A61 A;  5ILV A;  1I6X A;  2R7D A;  4P55 A;  3VB2 A;  2F5C A;  4MHG A;  5HLG A;  2QQA A;  3C3W A;  3FXU A;  4YIF A;  1JHF A;  3M8E A;  3G73 A;  5D5X B;  5E20 A;  2CGP A;  3LQQ A;  2P7V B;  4D0P A;  5CVV A;  1IF1 A;  3N4M A;  1OPC A;  3KE2 A;  4LB6 B;  3TDU C;  4L0Y B;  2JTV A;  3DKW A;  1LB2 A;  1A04 A;  1LJ9 A;  3RTR A;  2P6S A;  4MEY F;  2M5W A;  2GA1 A;  1YTY A;  1YS7 A;  2IW5 A;  1ZLJ A;  4O5V A;  2PMH A;  4ENN A;  2P4W A;  4L5I A;  5E17 F;  1BBY A;  2BGC A;  5CVJ A;  3GFM A;  1ON2 A;  2PMU A;  4IRH A;  1MJA A;  4KYW A;  4HX4 A;  1ZAR A;  4HQE A;  2BE5 F;  2W24 A;  1GVJ A;  3BDD A;  3KEO A;  4M6X A;  3EET A;  2XAG A;  1U3E M;  2FNP A;  3KFW X;  2ZKZ A;  4OIN F;  3REO A;  1BI1 A;  2EK5 A;  3KZZ A;  3PQK A;  4LG0 A;  2HWV A;  4MEX F;  2K27 A;  2HKX A;  1MDM A;  2P8T A;  2LF7 A;  3JAM Z;  2XKO A;  1W5S A;  1STZ A;  3WGI A;  4JK1 X;  5H20 A;  1FX7 A;  2O03 A;  4I0A A;  2UZK A;  4ESF A;  4RB2 C;  2KKO A;  5D6E A;  4ZZL A;  3V8J A;  1TW2 A;  5D5U B;  5LBQ A;  3DV8 A;  4U0V A;  1F5T A;  1BC8 C;  3MAJ A;  2X4H A;  2GZW A;  1H9G A;  3FM3 A;  5F6F A;  5LRR A;  2DW4 A;  3HHH A;  4LLL A;  1HW5 A;  1Z1D A;  1YQA A;  4BYY A;  3CJN A;  1S29 A;  5F1R A;  2OZU A;  5ICG A;  5ILS A;  4HYE A;  1QZY A;  2O6G E;  1ZRC A;  3WTS C;  3RKY A;  3ZQ7 A;  4ZYE A;  4IHT A;  4JBA A;  1LDD A;  1XGS A;  4XLP F;  4BH9 A;  3O6B B;  3H92 A;  3KP5 A;  5K5R A;  3F6O A;  5KVR A;  2G7H A;  1TQI A;  2YSR A;  5E18 F;  1BI0 A;  2XAJ A;  3R0A A;  4L5J A;  3I54 A;  2VOO A;  2ZXJ A;  1KU3 A;  4UXN A;  1FBS A;  2B0L A;  5EEH A;  3P7N A;  1QPM A;  5HVQ C;  1W7P D;  3TQN A;  3CUQ B;  2WWY A;  3V7C A;  1KQ8 A;  1XMA A;  5J8C A;  2ACJ A;  3GFI A;  2MA3 A;  5HS9 A;  3BZ6 A;  3BPV A;  2Q8K A;  4KA4 A;  3E6B A;  4KNY A;  2HOE A;  4LGW A;  1FYL A;  3DFG A;  5FB2 A;  4EM0 B;  1D8K A;  2XVC A;  4IXA A;  4I98 B;  2X0L A;  1DP7 P;  2MC3 A;  4S04 A;  2STT A;  2HEO A;  3HOS A;  1JHH A;  4PZJ A;  4BHC A;  3GO5 A;  3LAJ A;  3HYI A;  3QPH A;  2ZBK A;  2HFH A;  2UXN A;  1FOK A;  4A0X A;  3L2C A;  5FLX Z;  5E1W A;  5LLQ A;  3GWZ A;  4L0Z B;  4IPA A;  5HLH A;  2V79 A;  2Z99 A;  3HSE A;  3WE3 A;  3FMQ A;  4RAY A;  4UV8 A;  4KT5 C;  3E5X A;  1J75 A;  3KLN A;  2AXL A;  1B6A A;  1FC3 A;  1IN4 A;  2XRO A;  2BEO A;  4Q4Z F;  1SMY F;  4BAY A;  3CUQ C;  2FNA A;  2WC2 A;  2OQR A;  4CDG A;  2OD5 A;  3MFK A;  2GWR A;  2NRA C;  3QP5 A;  5FD5 A;  4EJO A;  3KLO A;  1J5Y A;  1R36 A;  2GXB A;  4EJT A;  1XN7 A;  4GYI A;  2FU4 A;  4A12 A;  1DPR A;  3M1E A;  3GW2 A;  3ZMD A;  1DDN A;  2ETH A;  2HGC A;  3BJ6 A;  3K0L A;  1JGS A;  2FBK A;  4N9I A;  3HRT A;  2HQR A;  5L3G A;  2LNB A;  1XD7 A;  5D4R A;  1FPQ A;  2GQQ A;  1BIA A;  4IJA A;  3WTY C;  4XRF A;  2V1D A;  5LGU A;  2L54 A;  5HDG A;  1YYV A;  3LA7 A;  5FFX A;  4P5O A;  4M9X A;  2J5P A;  3FF5 A;  4M6Y A;  1YO5 C;  4OMZ A;  1QQI A;  3EQL F;  4QLC U;  3NEU A;  2UXX A;  4RGR A;  3L9F A;  4HF1 A;  1J0R A;  4HW0 A;  3SQN A;  5FLX K;  3T0Y A;  1E17 A;  3HTS B;  4B8X A;  3ZN1 A;  3JTH A;  3WOD F;  4Z2Y A;  1K78 A;  2VBW A;  5JHU A;  2V6C A;  3M8F A;  1MJB A;  1SFE A;  4KUM A;  1WKM A;  3TDZ C;  4H0E A;  2AS5 F;  4XSX F;  1JE8 A;  1VTN C;  3DPL C;  2XAQ A;  1H0M A;  4M9Z A;  2DFI A;  3Q5F A;  2L02 A;  1Y0U A;  4UVA A;  4EMS A;  3E97 A;  2ISZ A;  3JTG A;  3KP4 A;  2H6C A;  4ENJ A;  1QO0 D;  3WE2 A;  4R8H A;  2VT2 A;  1RIO H;  4Q47 A;  4CXF A;  4MGR A;  4RAZ A;  2KIU A;  2IP2 A;  1K6O A;  1YS6 A;  1EH6 A;  3K1N A;  5ED4 A;  3GFL A;  4QWQ A;  3KZY A;  3HRU A;  1T2K A;  2XIG A;  5DUI A;  1R23 A;  2F5D A;  3J81 Z;  4U7D A;  3ECH A;  3B02 A;  3GF2 A;  2R3S A;  3RKX A;  1XSX A;  2FMY A;  2IA2 A;  3M7G A;  3QU3 A;  3EUH A;  3QU6 A;  3P9K A;  1O3T A;  1W5T A;  2JPC A;  3CTA A;  1NHA A;  2DPU A;  2M1B A;  1P92 A;  1ULY A;  5IT9 Z;  3RI4 A;  2DI3 A;  2FF4 A;  3ZP5 A;  3WGH A;  2H09 A;  1W4M A;  1TQP A;  1EH7 A;  2VC0 A;  4G6Q A;  3KET A;  3H3U A;  3H3Z A;  3PFI A;  3IWZ A;  5AON A;  1FT9 A;  3K1P A;  5H6Q A;  1B4A A;  5HDN A;  1O3Q A;  1S8N A;  4G6D A;  1QGP A;  3R61 A;  4O3M A;  2HZT A;  3F3X A;  3DXJ F;  1KU7 A;  1GHC A;  1TNT A;  1XGN A;  3QOP A;  2VXZ A;  1XSV A;  5CJ9 A;  3WTU C;  2A69 F;  2HTJ A;  2EFQ A;  1ODD A;  5HOO A;  3KP2 A;  1IRF A;  1XGO A;  1ZG3 A;  1XDU A;  2DQR A;  1H9T A;  1O57 A;  3WTZ A;  3LAP A;  3IWF A;  4FHT A;  1RI7 A;  3EYI A;  3K2Z A;  3L00 A;  4AWX B;  1U8R A;  3R60 A;  4LB5 A;  1ZHF A;  5HS7 A;  5DD8 A;  3F6V A;  2JZY A;  3TO9 A;  2OBP A;  2W84 A;  2QLZ A;  3K69 A;  1SFU A;  4YFN F;  2ZNZ A;  2DAO A;  3E5U A;  5TRD A;  2CWE A;  4A6D A;  1G3T A;  2JRT A;  1R1U A;  2XUB A;  2YR2 A;  4YG2 F;  4A5N A;  5L3F A;  4I2O A;  4IF4 A;  3JSO A;  4YFK F;  4F7Z A;  2KJC A;  1CF7 B;  5ICC A;  1MDM B;  2O3F A;  1LNW A;  2G9W A;  3TGN A;  2P5K A;  2BYV E;  2Z9O A;  3QP6 A;  5D5W B;  1O3S A;  2PQ8 A;  1LDK B;  1XMK A;  1MZB A;  1FSH A;  3E6C C;  1KGS A;  3N97 A;  5EEG A;  2RC4 A;  3SFZ A;  4UVC A;  1FP2 A;  4EV0 A;  3FM5 A;  2PG4 A;  1BI2 A;  2ZJ2 A;  1Z6T A;  4RS8 A;  1MKM A;  2YX4 A;  3V7S A;  4WCG A;  1CGP A;  4BHP A;  3P9C A;  4EQQ A;  2QVO A;  3I58 A;  1YG2 A;  3GZ6 A;  4G94 A;  5BS6 A;  5FO5 A;  4OIP F;  1K7A A;  1LQ1 A;  5L3E A;  4ENK A;  2HR3 A;  3FX3 A;  1HKT A;  2EFO A;  3BPX A;  3FHZ A;  1T6S A;  1TTY A;  2HS5 A;  5BMZ A;  3I0T A;  5LEK A;  2M30 A;  3ZPL A;  2M8E A;  3HIF A;  3IHU A;  1IXS B;  4HF0 A;  2EJR A;  3JSP A;  2XAH A;  2VN2 A;  3QRF F;  1AOY A;  4LFU A;  4Q48 A;  2VC1 A;  2ZNY A;  1S7A A;  4HV5 A;  2DLL A;  1G3Y A;  3K1M A;  4YFX F;  2XHK A;  4EGZ A;  1LDJ A;  1KU2 A;  2V9V A;  3MZH A;  2FE3 A;  1BM9 A;  5E1Z B;  1RNL A;  3GYH X;  4U88 A;  3VOD A;  1ZH5 A;  2DBB A;  3CO7 C;  3I59 B;  1G3S A;  2H6B A;  1W7P A;  4OIO F;  2RKH A;  5BPI A;  3FMS A;  1QNT A;  2W57 A;  5LGN A;  3HRM A;  4PGH A;  1XB4 A;  1YW7 A;  3RJP A;  1FYM A;  1UFM A;  4HOB A;  1ZG5 A;  4ON0 A;  3LFK A;  5LHH A;  2RN7 A;  5TJJ A;  4N9H A;  4XLN F;  1D3Y A;  4PCQ A;  4HBL A;  4FX0 A;  4KIB A;  1Z6R A;  1UST A;  1HBX G;  4MNU A;  2FML A;  3BY6 A;  5F64 A;  4O6J A;  3F8C A;  2RVC A;  1USS A;  1T0F A;  5L3D A;  2DPD A;  4GYG A;  4KFC A;  1OMI A;  3W6J B;  1YIO A;  3DF8 A;  5JVT A;  4M74 A;  3D0S A;  2HYG D;  1D8J A;  3L7W A;  2VOD A;  4IRG A;  1R1V A;  2NNN A;  1TQM A;  4I7H A;  3FXR A;  5LRS A;  2K86 A;  4LG0 B;  4B09 A;  1SD7 A;  1J7K A;  2NAZ A;  4EJU A;  3TKY A;  2QYO A;  1AWC A;  1E2X A;  2O0Y A;  4HAM A;  2QBY B;  1WQ2 A;  2A68 F;  2H94 A;  5ICF A;  2K4B A;  1J9I A;  3Q9S A;  1R5H A;  1YFH A;  4LLG F;  3FWE A;  1FWZ A;  5CVU A;  1B9N A;  3PQJ A;  2QQB A;  1SD4 A;  3T8R A;  1R22 A;  1FY7 A;  3J80 K;  1V4R A;  4HF2 A;  1UB9 A;  3LA3 A;  1ZRF A;  1J2X A;  2ELH A;  1BN5 A;  2ADU A;  3HTU A;  4EVI A;  2VBZ A;  3ELK A;  1CF7 A;  1IUY A;  1IXC A;  3B73 A;  4AVP A;  4DQ2 A;  3CLO A;  1IN5 A;  3WTT C;  4Y17 A;  5LEJ A;  4YII A;  1YW8 A;  3AAF A;  3CDH A;  3CUO A;  2HQN A;  1EV7 A;  1TNS A;  3GLX A;  4I09 A;  2RNJ A;  2F5E A;  4HDU A;  1RUO A;  4HDV A;  3E3V A;  3ECO A;  3QAH A;  1G4D A;  2O8X A;  4LK1 F;  1PDN C;  2J5O A;  4HLY A;  1R7J A;  2FBH A;  4AIK A;  4BXU A;  2DQL A;  5LHG A;  1QBJ A;  5E8I A;  3SZT A;  1F1Z A;  2PEX A;  4MTD A;  1U6G A;  4KDP A;  3TOA A;  2Y75 A;  4FT8 A;  2FEZ A;  3TO6 A;  1KQ9 A;  1K79 A;  2OA4 A;  1WI9 A;  4Y13 A;  1S3J A;  5CYV A;  3HRS A;  1IAW A;  3DP7 A;  4IHS A;  2GXG A;  3MQ0 A;  3TO7 A;  4CO8 A;  5CLS A;  4A6E A;  3SHF A;  4TV7 A;  2VBX A;  2DTR A;  2FOK A;  4L9V A;  3HSR A;  3M9A A;  1HKQ A;  2XKP A;  1R1T A;  1FNN A;  4EGY A;  3F8F A;  2KIF A;  5E1X A;  3MWM A;  2IT0 A;  2MBF A;  4AD9 A;  3J80 Z;  1HQC A;  2L4A A;  3EDP A;  3DEU A;  1B59 A;  2MH2 A;  4EJW A;  3NRV A;  5IT3 A;  4BHB A;  2FXA A;  2Y0M A;  4AIH A;  3KP7 A;  4L18 B;  3R0J A;  3J81 K;  4WXD A;  1T39 A;  2GIV A;  1BJA A;  3O2P E;  3NQO A;  3SZP A;  3F21 A;  5JI6 A;  1P2F A;  4G8X A;  3FXQ A;  2MH9 A;  3C18 A;  2QZ8 A;  1R5G A;  2EFN A;  3W6K B;  2ZCW A;  4RGU A;  1O7L A;  1DPU A;  1ZYR F;  2Z3Y A;  1C0W A;  1ZLK A;  3IKT A;  1IW7 F;  4EJV A;  1G3W A;  4L9T A;  4M71 A;  1P4X A;  3HSF A;  3VOE A;  3ZMZ A;  5L3C A;  2EA4 A;  5D6F A;  1SMT A;  3I4P A;  2K02 A;  2CFX A;  2A6E F;  4HZF A;  3WGG A;  3EYY A;  1FZP B;  2M87 A;  2EV5 A;  4NB5 A;  3IL2 A;  1O7F A;  3P9I A;  4CHU A;  3LQR A;  1I1G A;  2ZO4 A;  2YU3 A;  5ICE A;  1YLF A;  3HOT A;  4G7O F;  2XAS A;  1B9M A;  1RZ4 A;  4OIR F;  1HST A;  2JSC A;  1BC7 C;  2L01 A;  2JPB A;  1ZGJ A;  3ZN0 A;  3WTX C;  1LEB A;  4U0Y A;  5DV5 A;  2PJP A;  2CQK A;  3IKV A;  3BJO A;  2GAU A;  4I02 A;  2Q2E A;  4CGZ A;  1Q1H A;  1L0O C;  2FSW A;  4HA8 A;  2A3S A;  1LVA A;  1U78 A;  3ERE D;  2EWN A;  4A5M A;  3L09 A;  2E1N A;  2E7W A;  2RGV A;  1ZRD A;  3C7J A;  1HW1 A;  1U2W A;  2H27 A;  2RQP A;  1OKR A;  4K2E A;  1XCB A;  2F2E A;  1P6R A;  2D1H A;  5AIQ A;  3IRQ A;  4P9U A;  1P4A A;  1TLH B;  5K5O A;  3SXY A;  4GCV A;  2K4J A;  2LKP A;  3K9T A;  2IA0 A;  4WX9 A;  3ISP A;  2IJL A;  1L3L A;  2OZ6 A;  2R7F A;  3V8L A;  1XDS A;  4NHJ A;  4CYD A;  2FRH A;  4WF2 A;  4LLN A;  1TBX A;  4OU0 A;  5FFZ A;  3C1D A;  5ERI A;  1F4K A;  1B1B A;  2OU2 A;  2ESH A;  5D8K B;  2KJB A;  3V4G A;  2OAZ A;  3IC7 A;  3S2W A;  3GFJ A;  2PN6 A;  4JQF A;  1OYW A;  4FX4 A;  3D5L A;  4KIF A;  2MD5 A;  3GXO A;  5DD4 A;  3FMR A;  1ZGA A;  3ZMS A;  4EM1 A;  5DCF A;  1GXP A;  4ZYD A;  1FBU A;  4ENM A;  5IT9 K;  2EFW A;  4KMF A;  1I1S A;  4S05 A;  5J8F A;  4OOI A;  2DU9 A;  1IN7 A;  5DEQ A;  5K5Q A;  3J7A O;  3I59 A;  5ILU A;  1YW9 A;  2E1C A;  3FZV A;  4BNC A;  1IRG A;  1WWX A;  2Z5U A;  3O3K A;  2XGX A;  1IZ1 A;  4GGG A;  2GA2 A;  1MD0 A;  3ZMU A;  5LGT A;  3BWG A;  5D4S A;  3ROU A;  3DQV C;  4WK8 F;  1FBQ A;  3I71 A;  4L9N A;  1Z9C A;  1SD5 A;  2W85 A;  4ZYH A;  3I5U A;  5DCM B;  1FLI A;  5D8L B;  2FA5 A;  1HSJ A;  2CSO A;  1SD6 A;  2HTS A;  2Y48 A;  4ESJ A;  3BP8 A;  4KIC A;  2K7L A;  1ZG1 A;  4ASN A;  1HKS A;  3ULQ B;  1X3U A;  4IRI A;  4UUV A;  3ABT A;  1U5T C;  3E5Q A;  4KN4 X;  4WWC A;  1DUX C;  2TDX A;  2O61 A;  3RPQ A;  1JXS A;  4A0Y A;  2IRF G;  1OYI A;  4EM2 A;  3RKW A;  4HQM A;  4RB0 A;  2PLY A;  2XV4 S;  3E6M A;  2YX7 A;  2DK8 A;  2VT3 A;  4UVB A;  2EA2 A;  3TOB A;  2PBI A;  2NYX A;  3F22 A;  3I64 A;  3RIR A;  2PI0 A;  4U7B A;  1KQ0 A;  4GO1 A;  2VBY A;  2CW0 F;  4ZZD A;  3RYP A;  2MLK A;  2PFB A;  1IN8 A;  4M73 A;  2UWM A;  2G7U A;  2ZME A;  5BQT A;  2ESN A;  2STW A;  2HKO A;  4RGS A;  2RDP A;  5AIP A;  1UCR A;  1G6N A;  3GUD A;  3ZMT A;  1SAX A;  1HW2 A;  2HYF A;  3MCZ A;  2D1V A;  4LMY A;  4G7Z F;  3GEZ A;  5HDK A;  1WSU A;  4MQV A;  1T38 A;  3JW4 A;  3ML6 A;  5BPD A;  1IXR C;  4MTE A;  3WG9 A;  5KK1 A;  1Z7U A;  1I5Z A;  1R00 A;  2COM A;  1P4W A;  1S6L A;  2IPQ X;  3F8M A;  1PP8 F;  3T5X A;  3RDI A;  1FYK A;  3U2R A;  2IA1 A;  4G9Y A;  1REP C;  1UHW A;  3R4K A;  2DK5 A;  4AIJ A;  4U0W A;  2C6Y A;  2IVM A;  1IN6 A;  2BBY A;  1KYW A;  3VEP A;  1ZAO A;  1EH8 A;  2KRF A;  2NNY A;  2VE8 A;  6PAX A;  1SFX A;  1D5V A;  4P96 A;  4HV6 A;  3I53 A;  3OV8 A;  1FSE A;  2WTE A;  1LEA A;  1R58 A;  3GX4 X;  3MEX A;  2QWW A;  3MZY A;  2D2W A;  3CUQ A;  2OQG A;  2RV8 A;  2BV6 A;  3KCC A;  4L9J A;  1PP7 U;  2FQ3 A;  4XSZ F;  1OYY A;  5D5V B;  3DPT A;  5HLI A;  5E8G A;  3VFZ A;  1U5T A;  2DT5 A;  5LHI A;  4BQA A;  1UHM A;  3LST A;  4UNO A;  3WU1 B;  2Z33 A;  2NS0 A;  4Y15 A;  1V3F A;  3U9G A;  1MJ9 A;  1MGT A;  1ON1 A;  1ZN2 A;  1S7O A;  4I0B A;  5J6X A;  1PUE E;  2D45 A;  1F9N A;  4ZYG A;  3V8K A;  3T8T A;  4P9F A;  3T1B A;  3Q9V A;  4HX8 A;  5BOX A;  3IRR A;  2A6H F;  4IVN A;  3F8N A;  2WV0 A;  5CVI A;  3RPU A;  1Z05 A;  3KEQ A;  4KN7 X;  4UHT A;  2L3D A;  2F5F A;  3BOQ A;  3WTW C;  1K78 B;  2XRN A;  2W25 A;  3JAM K;  2V1U A;  3LA2 A;  3ABU A;  5A2Q K;  4G7H F;  4Q5S F;  4KIG A;  2QBY A;  2VOP A;  1RUN A;  5L3B A;  2LDU A;  1WRJ A;  5DUK A;  2QEN A;  2P5V A;  2EB7 A;  2LSO A;  3E6D A;  2EV6 A;  1BI3 A;  2XAF A;  3F72 A;  1W7P B;  1KU9 A;  1T98 A;  1XGM A;  4I01 A;  4R1H A;  2CYY A;  3CO6 C;  3U1D A;  3QPT A;  1U5T B;  4A2U A;  2M45 A;  3HUG A;  2P7C B;  2JT1 A;  4OIQ F;  2P5L C;  3G3Z A;  3GZ5 A;  4HLX A;  1BIB A;  4WXC A;  4RB3 C;  2HDC A;  2ZME B;  5DCM A;  5HS8 A;  3OOP A;  4NQW A;  4ETS A;  1I27 A;  1ONV A;  3BJA A;  4PGG A;  2KIM A;  3V7R A;  3LWF A;  3F8B A;  5DYM A;  5JR3 A;  2V1X A;  2YPR A;  4CIC A;  5CVR A;  4R79 A;  2CG4 A;  4E70 A;  5JFR A;  1BOA A;  4RGX A;  3R6S A;  1XSD A;  4KMU X;  1KA8 A;  5DDG A;  1KYZ A;  4WXH A;  2VE9 A;  4MQ9 F;  4HX7 A;  2P6T A;  1J59 A;  2QQ9 A;  4LD5 A;  2VON A;  1OR7 A;  3F23 A;  3ZMV A;  3RYR A;  2Q0O A;  1GXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...