3FKIJ

12-subunit rna polymerase ii refined with zn-sad data
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 12
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3fkiJ00
5C4JJ 4A3KJ 2H8RA 1GUUA 2DA5A 2DA7A 1Y1WJ 2FD5A 5FKLA 1NK2P 1QRYA 1B8IA 2WV1A 3NARA 3FIWA 2O9LA 1B8IB 1GDTA 2K9QA 3I4MJ 2HOTA 4XIDA 5JLXA 4BY1J 1JKQC 1FJLA 4RDUA 1P7IA 1ZK8A 1WPKA 5K7ZA 5J1UA 3HOWJ 5IP6A 3GTKJ 1FEXA 2IEKA 3S1NJ 3RQIA 3H0GJ 5IYCJ 4BXXJ 2K9SA 3WHBA 3QPLA 3D1NI 1LE8A 2NVQJ 3S17J 5IYDJ 1A6IA 5IYBJ 1HCRA 1Q1VA 4FE7A 4M3DA 3RZDJ 1FIPA 1ETOA 3S1MJ 2H1KA 2FQ4A 4RBOA 3BR5A 3BG3A 2AHQA 1H8AC 2O8KA 1U9OA 2X48A 3HM5A 3I4NJ 2HOAA 1OCTC 3SFIA 1ZGWA 3Q3SA 1MSFC 3BQZA 1MBGA 4S0HB 3JRFA 3ZQCA 2CUEA 2M0CA 3OSGA 2G0EA 4M6VA 3GTMJ 2MG4A 5EG0B 2MSYA 2VKVA 3BT9A 3RKQA 2JA6J 3MN2A 2JMWA 1MBFA 1WI3A 1JTYA 3ZQLA 1U8BA 2D5VA 3W6VA 3TW7A 1ZKGA 5IOYA 5M5XJ 1DU0A 5BNGA 4I76A 4M3BA 3S2HJ 5EGOA 2YS9A 1VI0A 3ZQGA 4GFBA 3DCFA 2JA8J 2KT0A 1K61A 1H88C 4IHVA 2DMQA 3BTJA 5M5YJ 3CCYA 1JKOC 1APLC 3SDGA 3JRIA 1SFOJ 3HKZN 1IC8A 2LY9A 2DA1A 2ECBA 1K83J 2KDZA 1UHSA 2XPWA 3F0CA 5EF6A 2XRLA 1BJZA 3K7AJ 1A5JA 3Q0WA 1P7JA 3S16J 1ZR4A 4A3LJ 1JJ6C 2X6OA 2NS8A 2XPVA 1X58A 2NVXJ 3OOUA 5HODA 1NK3P 2YUSA 1CQTA 1JTXA 5EDNA 1R9TJ 1ETQA 2LR8A 2MW8A 4IEJA 3TP3A 2HDDA 3B6CA 3G1OA 3CQZJ 2CU7A 3GTQJ 1LFUP 1ETXA 2XGDA 4A3FJ 3S14J 1POGA 4AC0A 1DU6A 2L0KA 5FKOA 1YRNA 2VI6A 1HLVA 1B72B 1I50J 1RR7A 4C3JJ 1H89C 2M9HA 5F1JA 3SJMA 2DN0A 4FTHA 2R5YB 2LP0A 4HNVA 3ZOBA 1RESA 1TWHJ 2VUMJ 1Y1VJ 5C44J 3TW6A 1WGXA 2HYJA 4W97A 1FTTA 2CQXA 2K40A 1JGGA 2XB0X 2FJ1A 2R5ZB 4XRMA 2M8GX 1IGNA 1AU7A 4FE4A 4MFDA 4BKXA 1QPIA 5FKMA 4M3EA 1WCMJ 5EZGA 3O8HA 4I6ZA 2Y9YA 1Z0XA 2XGEA 4AYBN 1IRZA 3BTCA 3O8GA 4JX4A 1HDPA 4M3GA 4A3CJ 4BBSJ 2QF7A 2M2EA 4XK4A 2CRGA 2E1OA 3BG5A 1ETWA 4XICA 2LFBA 2NS7A 3LSRA 2O7OA 1GV5A 2Y30A 3LOCA 5M3FJ 4EEFG 3JREA 1U9NA 1TC3C 5F27A 4DYRA 4LOCA 3HOZJ 1B72A 3QQAA 2Y0SN 4IHYA 2HI3A 2ID3A 1FTZA 3A03A 2DMNA 1T33A 1BW6A 1IUFA 3S1RJ 2WB1N 4V2FA 1ITYA 3DEWA 1UMQA 2FX0A 3GBGA 4UUTA 4DYQA 4ABZA 2GLOA 2WAQN 2ECCA 2EH3A 2ME6A 1QVUA 2DJNA 1W0UA 4A3GJ 1X2MA 3FK6A 2HOSA 1MH3A 2K9NA 1NTCA 3CMYA 5E3LA 5FJ8J 3K2AA 4AUXA 4A69C 1O4XA 1LE8B 3JRAA 3HB9A 1MBKA 5DS9A 5M5WJ 3A01A 2TCTA 2Y9ZA 2DA3A 1JUPA 3HOXJ 1JT0A 1TWGJ 2NVYJ 4QSHA 4QIWN 1F36A 5IOZA 1OFCX 1IG7A 2L7MP 2M34A 1OJLA 1RETA 5F0CA 1GV2A 2R0QC 3CDLA 3LSJA 3HOVJ 1ETVA 3JRCA 4D7NA 2ME0A 3BR1A 3JR9A 2JWTA 1JKRC 1TWCJ 2QCOA 3M3YJ 5F0FA 2JA7J 1JUMA 3TP0A 4A3IJ 3PM1A 3BG9A 2VKEA 4D7MA 3JRGA 3IV5A 2HQ5A 1FIAA 1Z77A 4JP0A 4QTRA 2DA2A 4G12A 1MSEC 3L1PA 1ENHA 4A3DJ 3IH2A 5GPAA 2JA5J 4C2MJ 3S2DJ 2EZKA 1XC5A 3WHCA 2EQRA 2MGQA 1MNMC 3Q0VA 2EZLA 2EZHA 5EG0A 4JYKA 2JK3A 2R5ZA 2IBDA 1D5YA 1YRNB 5F04A 3H3VK 4DW6A 3LSPA 2LVSA 3G1MA 3MVPA 2R5YA 4BBRJ 3S15J 2CJJA 4A93J 4DZJA 3LNQA 1BW5A 1F43A 1RKWA 3A02A 4MO7A 3OIOA 1LFBA 2HXIA 2I10A 5J3LA 2GBYA 3JRBA 1TWFJ 4DZPA 1BA5A 4XRSG 2COBA 2N8GA 2ZB9A 4NDLA 3HEFA 1ZTRA 1VFCA 2DA6A 3BTLA 4MLOA 3HGGA 2CQQA 2W48A 2E19A 2R93J 3Q0UA 2CUFA 1ETKA 5IP9J 1IDZA 4B1RA 4B4CA 2XB5A 3C2BA 2LTPA 5C3EJ 3IH3A 4A3BJ 1GVDA 4D5FA 1I3QJ 1EF4A 3GTOJ 2VPRA 5EYRA 1VNDA 2OF7A 2L7ZA 1XS9A 5J1YA 2LLKA 1ETYA 3QPSA 2B63J 4W1UA 4D5CA 2XSDC 4A3JJ 3LSGA 1X2NA 4JX6A 2LK2A 4CYCA 2DA4A 3ZQHA 3OSFA 5J1RA 2P81A 3BR0A 3HBLA 4BY7J 3FISA 1PUFA 3GTJJ 3G1LA 4V2GA 4J19A 5F08A 5GP9A 5EGOB 2EZIA 2ELKA 1WH5A 5EEAA 4Y52J 1GT0C 2DMUA 2NOGA 4UUSA 5GPCA 1TWAJ 4DYCA 4Y7NJ 4X6AJ 4M3FA 5EZHA 2E2IJ 1HF0A 4C3IJ 2R92J 1UG2A 2XGCA 5K7HA 1HDDC 1JJ8C 1MBJA 5E3MA 4IHXA 1S7EA 4FCYA 2OPTA 2ID6A 5F0HA 3JRHA 2DMTA 4MFEA 4C3HJ 3RZOJ 5DTDA 2XPUA 9ANTA 5K7FA 5FKNA 3BR3A 3HDDA 5JLWA 3E7LA 1AHDP 1OCPA 1ZR2A 1IDYA 3VPRA 2E2HJ 2IAIA 4UUSB 1I6HJ 1HOMA 2E2JJ 2DTZA 5FKKA 3JRDA 2AO9A 2X9DA 3HGYA 4FISA 1G2HA 3ZQIA 2EBIA 5E3NA 1JKPC 1VF9A 2L9RA 2YU9J 2R7ZJ 3S1QJ 3BTIA 1E3OC 3GTGJ 2HXOA 5IPAA 4XRSA 1IJWC 1MH4A 1RPWA 3HOUJ 1RKTA 3GTPJ 2RAEA 2Y2ZA 4MIMA 4JX5A 4X1EA 4A3EJ 2Y31A 2DMPA 5M3MJ 2JN6A 1IV6A 1U78A 1QVTA 5FLMJ 1AKHB 5FLVA 4B3AA 4IHWA 1PUFB 2L7FP 4A3MJ 4L5EA 1BL0A 3MKLA 1WH7A 3ZQFA 1W0TA 3BQYA 1XG1A 3PO2J 3M4OJ 2LKXA 2GM4A 1JUSA 3HOYJ 1ZQ3P 3B6AA 3PO3J 1JT6A 1ORKA 3BR2A 2PMZN 3BR6A 5C4XJ 1MBHA 3FKIJ 3FK7A 3IH4A 3TEDA 2LD5A 4CYCB 1SANA 1MBEA 3A01B 5IP7J 2NVTJ 2JJ7A 1AKHA 1T56A 3UKGA 2TRTA 3GTLJ 3NAUA 5E3OA
chains in the Genus database with same CATH superfamily
1BBYA 2DO7A 2STWA 6PAXA 1B1BA 2WAFA 4GDFA 3CCLI 3TKYA 5LRSA 4HF1A 2WAEA 3HZJA 2DA7A 1Y1WJ 1D0XA 4OIPF 4XLHA 2EJRA 3SXYA 4Q4ZF 1NK2P 5TISC 4IXAA 4XLNF 1FBQA 3QU6A 3H3ZA 3NARA 2HDCA 3HIFA 4NB5A 1WSUA 4KJZA 1RZ4A 5CVIA 3ZMVA 2HOTA 4XIDA 2V79A 3AL0C 1Y8RB 2VC0A 4HF0A 4UVAA 1H0MA 4Y33A 3K70C 1ZK8A 1WPKA 5K7ZA 4ZYGA 5IP6A 3GTKJ 1XCVA 2KIMA 3S1NJ 3RQIA 1TBXA 3D5LA 2JA2A 3C1DA 3WHBA 1U5TC 4BQOA 3ZMZA 2LREA 5IYBJ 1Q1VA 3CLOA 5HLTA 1TQMA 3H1CA 2XKOA 4M73A 3PNVA 3O6BB 4UB8C 3J81K 2DXIA 2EWNA 3CUQA 3BR5A 4RBOA 2FBKA 2QENA 4E7LA 5D6FA 2O8KA 4M6YA 4FX0A 1HW5A 2ZSHB 4OWRB 3EYIA 3GZ5A 3DBHB 1DPRA 2W85A 1XGNA 2DFFA 4XMYA 3BQZA 3JAMZ 2CUEA 2M0CA 1XTAA 2EFOA 2J5PA 2M7AA 3TMOA 1KYWA 4CCKA 5EG0B 1JHFA 2FBIA 5HS7A 1J2XA 4J01A 1O3QA 2OA4A 2ZXWH 1QHHD 3DTEA 4E6KG 2D5VA 3FM3A 4EATA 3W6VA 1OPCA 1SFEA 1ZKGA 3MKZA 3L9FA 1FOXA 5BNGA 5BOXA 1XDUA 1IN6A 2YS9A 2EPFA 1T08B 1G4DA 2VXDA 2QVOA 1BC7C 3W2AA 1OYYA 1HW2A 3VYSB 1Z91A 2C6YA 3BCAA 1Z3YA 4ZTJA 4AU7A 2ZFWA 1K61A 2LY2A 2QSFX 2XGXA 4MEXF 4Q47A 5M5YJ 3BLYA 4OMYA 1E2XA 3NQOA 1JKOC 1XGOA 3OYLA 1I39A 3W6JB 1SFOJ 3ABTA 3E97A 4E7KA 2X1EA 2M4GA 3F0CA 1XCBA 2DW4A 4BQAA 4XKVA 2UWMA 1T6SA 1YIJI 2QKLB 3CUOA 5DCMA 1ZR4A 3KP7A 1LEBA 3DWLE 2ZJQF 2ZBKA 1B9MA 3I53A 3P5JA 3L09A 4I0AA 1CGPA 4II3A 5KAIC 1AWCA 2BYVE 2DK8A 1IRGA 2P6SA 3SYTA 2E5NA 3ISPA 3WTUC 1X19A 3EETA 3S2WA 2CMPA 2XAQA 2QA4I 3G1OA 1D8KA 2LY1A 3HRUA 3I59A 4DQ2A 5ICFA 4M9ZA 1F5TA 3PUFA 5FROA 1OYIA 5CVUA 1FYLA 1B72B 4CCOA 1I50J 2M9HA 3WU0A 3BWGA 2V26A 1D5VA 3J7ZI 4FTHA 2IGKA 4WXHA 3F21A 1BIAA 3IWZA 1HC8A 4ZZDA 1V5GA 3TW6A 3E6MA 1ZG1A 2K40A 1S7AA 3EYYA 1S72I 2EA4A 3D5SC 2M8GX 3EPZA 3U21A 1AU7A 5A2QK 1J7KA 4BKXA 5HNFA 1YW7A 2EK5A 2R4GA 2FXAA 2VB6A 2EA2A 1I5ZA 1WCMJ 4BHPA 4WF2A 5E18F 2A05A 2OU2A 3O8HA 3KEYA 2FOWA 1X1BA 1Z0XA 4B43A 1WJEA 3IP4B 4AYBN 4RAFA 4UV8A 2LBFA 3O8GA 5E1XA 4JX4A 3JTGA 5DCFA 4A3CJ 4U88A 2KKOA 2ETHA 2M2EA 2HKOA 2O5RA 2CRGA 5ILUA 2XV4S 3BG5A 1ETWA 1VZ0A 2DT5A 4M71A 5D5XB 2GZWA 3LAPA 2O03A 4I7HA 2Z9OA 2Y30A 3ZQ7A 4EEFG 1PDNC 3KX2A 1U9NA 4AVZA 2JVHA 3OWTA 5F27A 2ZMEB 1P9QC 4LIUA 3L00A 1B72A 3QQAA 2HGCA 3HSEA 2Y0SN 2M1BA 2RN7A 2DFHA 3A03A 1MNEA 1R23A 2WB1N 2CUJA 1OKRA 3OL4A 2LRDA 4Y17A 3DEWA 4YRVA 4XL9A 3GBGA 4UUTA 4E4HA 3J7YJ 1R71A 4EMSA 2BOLA 4KIFA 4UNOA 3KP3A 2ECCA 2A68F 4IOCF 3CLQA 3CCUI 1OISA 1X2MA 3TBIA 3I3LA 3FK6A 3AL0B 4GGGA 2EV0A 4RA2A 2ZJ2A 4HQEA 3VODA 4HX4A 3W2WA 2Q1ZB 5E3LA 2ZJRF 4I98B 4A69C 1O4XA 1I1GA 1W5CC 3DLLF 3PFIA 3BROA 1MBKA 3MAJA 5DS9A 1UELB 1ZAOA 1USTA 3KYLA 1QNTA 3IUOA 4IRHA 1TWGJ 2K4BA 4BJ5C 2HZDA 3ONQA 4QIWN 1F36A 2VJIA 4IO9F 1RI7A 4FX4A 2DOEA 1W36C 1B9NA 1XGMA 2FRHA 4R1HA 3V7CA 4RGUA 5IY5H 1RETA 5CVRA 3GZNB 4KN7X 5F0CA 1VQOI 3KPHA 3OY9A 3HOVJ 2DCEA 4OIQF 4D7NA 2H1LA 3K1MA 3K4JA 2XRNA 2B7EA 2BBYA 2JWTA 1ZRCA 4IOAF 2KZVA 2K9LA 2NNNA 4HV5A 3KYCB 4Y4RA 3PM1A 1XMAA 3FKJA 5KHDA 1LNWA 3DPTA 4D7MA 1ZREA 1YIOA 2L3DA 1FIAA 1TQIA 2D2WA 1P2FA 4DOZA 4A5NA 3IL2A 3I55I 3VYUB 5BPDA 2EFPA 2V1NA 3IH2A 3OR1C 3ZGKA 2MBFA 4E7IA 3KIOA 4C2MJ 1W36D 1J0RA 5DM6F 4EJOA 5J8FA 2BHZA 2Z5UA 5GAGJ 1MDMA 1IUYA 2MLGA 5EG0A 2AS5F 4IKFA 1BIBA 4DW6A 4RAZA 2P6TA 1OR7C 5KK1A 2CG4A 3LSPA 1IXCA 3CDIA 5LBQA 4KYWA 2EIKH 3CC4I 4EV0A 2KLOA 3S15J 4BBRJ 4BU2A 1V5FA 1Z21A 1MMSA 5K5OA 2BY1A 1IXSB 3FXKA 3A02A 1K78A 5TGTA 1IRFA 1UCRA 3G73A 1O57A 4EQQA 2DQLA 4CUGA 1TWFJ 1BA5A 2ICWG 2PX9A 2R7SA 2ZMEC 2MA3A 4NDLA 3CCJI 5LHIA 1S5LC 4KFCA 1YS6A 1X4PA 4PGHA 2CUFA 1ETKA 5IP9J 3H5RA 3PUBA 3M8JA 4B1RA 3JTHA 4GO1A 3A0BC 2XB5A 4G94A 2QSHX 1WZ2A 1Y39A 4F7ZA 5LD2C 3WODF 4U0VA 3S3OA 3FZVA 1R4NB 3DFGA 4HG2A 3OMYA 4XORA 1VNDA 2OF7A 3U9GA 2R7FA 2OUMA 2PLYA 2B63J 2WY7Q 3MQ0A 3CF5F 2MYSA 2L54A 3E3VA 3PIOF 3MZYA 3KEOA 4RAGA 4IHTA 1DP3A 1TP4A 2VC1A 1C0WA 2JVGA 2D45A 4LK1F 2KRHA 4BY7J 3GO5A 3GTJJ 4V2GA 3QP5A 4OMZA 3EDPA 1SD5A 2KPMA 1USSA 2EZIA 2KFDA 1WH5A 3QAHA 3T1BA 3ZN0A 4CZZA 3V8LA 2VBYA 3QU3A 1GT0C 4LG0A 1TWAJ 4DYCA 3PQKA 2DFIA 4M3FA 5HLHA 5L3FA 1HF0A 4C3IJ 2R92J 4BE0A 4Y15A 1HDDC 1D1CA 1KYZA 4PFOA 3HC7A 5E3MA 4IHXA 3JSPA 4FCYA 2K3FA 4XQFA 2Q2EB 4EM0B 4LGWA 4HAMA 4MFEA 3RZOJ 5K7FA 2CYYA 4JBAA 5FKNA 2A6TA 2IW5A 3DKWA 5JLWA 3E7LA 1K6YA 2CW0F 3OV8A 1ZLJA 1KZHA 3L2RA 1AHDP 1ZLKA 1IDYA 3VPRA 2VT2A 4NQWA 2WWYA 2IAIA 4LG0B 4ENMA 1I6HJ 2E2JJ 3U1KA 5LGTA 2JSCA 4RB0A 1ZGAA 2KZGA 3HGYA 2DOAA 3ZQIA 2EBIA 3GFLA 2DBBA 2EIJH 3C3WA 1VF9A 5E3NA 1CF7A 5CVJA 3RDIA 4EJVA 4HDVA 1IJWC 5J6XA 4IX7A 4HYEA 2DOFA 1REPC 3PQJA 4JX5A 4X1EA 4BHCA 1DUXC 2DT7B 1IV6A 3F8BA 4HV6A 2RDPA 4XM3A 1DGWY 3R60A 1QVTA 5CVVA 3CC7I 1OYWA 4ESFA 1AKHB 2W24A 5IT9Z 5FLVA 3FMSA 2HQRA 3CJQB 1UJ8A 2K27A 1UHWA 1PP8F 2A3SA 1P4AA 2VKHA 3BQYA 1XG1A 2CQ7A 4A0ZA 3MKWB 2V9PA 1W0TA 2GM4A 3OYEA 1JUSA 5GAHJ 1ZQ3P 3B6AA 2EILH 3P9KA 2VT3A 1JT6A 1ORKA 3ZMUA 2L7KA 2PMZN 4B48A 1W7PB 1MGTA 1SANA 3C18A 1W7PA 3LSKA 5IP7J 4IVNA 1NH3A 3CCMI 2DU9A 3HL2A 1O7FA 4A12A 4XLPF 3F8NA 3KP6A 4EJTA 5CKTA 1XMXA 5E3OA 2IJLA 5FRMA 2H8RA 2XAGA 4AIDA 1UB9A 2GWRA 2D1HA 3K1PA 4PDKA 1KONA 2FD5A 3RPUA 3SQNA 5H20A 4HSRA 2WV1A 4PGGA 2CV1A 4AM3A 3GYHX 2O0YA 4XKCA 2QEXI 2A5WA 3QYBA 1Z1DA 4S05A 2EFWA 2F6CA 3OS0A 3I4MJ 2K9QA 1FWZA 4R79A 3CCQI 5D5WB 2E34A 3S93A 3CP8A 4II2A 1JKQC 1B59A 1W4MA 2ESNA 4A2UA 4DBQA 3J80K 5J1UA 2K7LA 3RPUD 3LSIA 3H9GA 5FFXA 1QGPA 1FEXA 2QLZA 1MMGA 4XR6A 4GYGA 2E1CA 4NC7A 4JK1X 3QPLA 2X6XA 1T0FC 5HNHA 3ULQB 1A6IA 4AIHA 4LB5A 2IA2A 1U2WA 2XAJA 3GFMA 3RKXA 1UFMA 2E7XA 2RV8A 2W82A 3RZDJ 3SFZA 2H1KA 2FQ4A 2EIMH 1IAWA 4G8XA 2R7XA 3VYRB 3RQ4A 2HTSA 1YFHA 1Z05A 2X4HA 4HEA2 4XLCA 1X3ZB 3SFIA 1LPQA 3Q3SA 1ZELA 1MSFC 2CO5A 3E5QA 2G0EA 1O3SA 1XB4A 3J7AY 2VQCA 4G7HF 2MG4A 2MSYA 2VKVA 5FGMA 1R1UA 2MC4A 2A69F 1HKTA 1ZG5A 3AFHA 3ZN1A 2XF7A 4UXNA 3ZQLA 4LITA 1XGSA 3TW7A 3F8FA 2IGOA 1FY7A 5EGOA 2DDAA 3FXOA 3A0HC 3ZQGA 4OAYA 2I8DA 2L01A 3HRSA 3ERED 2XF5A 1SVOA 5EEGA 4IHVA 2RQPA 1EH7A 3BTJA 3U1DA 2X6WA 3CCYA 1T95A 3EUHA 3SDGA 1YX3A 3JRIA 5HVQC 3BOQA 3GFIA 2XRLA 3K7AJ 1A5JA 3BPVA 3G2BA 3E6CC 4MTEA 3S16J 3BG6A 3FHZA 1JJ6C 2PQ8A 2OC6A 2NVXJ 1KA8A 1EH8A 2P4WA 3T8RA 2YU3A 2JT1A 5HODA 1NK3P 2YUSA 3L2WA 1CF7B 1JTXA 5HLGA 2DODA 1R9TJ 1ETQA 3TP3A 3I58A 3WGIA 2VODA 4HNTA 2CU7A 1A35A 3FXMA 2QM3A 4UVCA 5DUKA 3GTQJ 1YYVA 1ETXA 5J47A 2XGDA 2KIUA 3CP2A 3DF8A 4IHSA 4UB6C 4MGRA 2ZXHA 3CTAA 1G6NA 1KQ0A 4ZZLA 1AA7A 2KIFA 2M3AA 1MJBA 2XAUA 1F4KA 2DI3A 2PI0A 1BR4A 2P0WA 3GLLA 1H89C 2XC7A 5F1JA 4U0WA 2OV7A 4LD5A 3SJMA 5LEKA 3IC7A 4Q5SF 1IRXA 3LA3A 2R5YB 3WG7H 4FQGA 3ZOBA 1RESA 1ZYRF 4HPQA 3HXLA 1WGXA 3MMYB 3OS1A 5AIQA 4I0BA 4KT5C 4AVPA 4V19K 5FO5A 4UUVA 3WTVC 2QQBA 2P8TA 3QYFA 3R6SA 4MFDA 4ENNA 5FKMA 2WB1A 3CMMA 5DYMA 5LGNA 2H09A 4IQ4A 1ERDA 5KAFC 4HRIA 3R0AA 1K4SA 1R22A 4NQWB 2HEOA 2Y9YA 2A6EF 4AWXB 1IRZA 5FRNA 1HDPA 4Q48A 3PNYA 4M3GA 3QWLA 5E8GA 3ELKA 2PMZA 1YO5C 2OJED 1HKSA 2E1OA 3HPHA 4RGXA 2LFBA 2NS7A 2ELJA 2VJ5A 2OQGA 2O7OA 3QODA 1W7PD 1S9HA 1FNNA 1BOAA 3HSFA 4ZYHA 3LOCA 1N78A 1V4RA 2L02A 1A36A 2W7NA 2FSWA 4L9JA 4LOCA 3HOZJ 3RIRA 1E0EA 3RCOA 4M72A 2LKPA 3RYPA 3BZKA 4F55A 4XRFA 4BNCA 4MQ9F 4KISA 1GHCA 1E3PA 2CH0A 2L2OA 4XLAA 5GTIC 2XUBA 3MKYB 3AG1H 3S1RJ 4V2FA 4HA8A 2OQRA 2HVQA 1ITYA 1TT0A 3TOBA 1XX5A 2COMA 5CQEA 4FETA 4DYQA 2IPQX 2YR2A 4ABZA 4EGZA 4BDYA 5HS8A 1KU7A 2DJIA 1W0UA 1X4OA 3SZPA 1HA8A 5JHFA 2CFOA 2UUZA 3DBLB 2M8EA 3OS2A 2K9NA 1NTCA 5FD6A 2RREA 3ECHA 4E7ZA 3VSKA 3ABKH 1P6RA 1FT9A 3K2AA 3CZ6A 2L4AA 3HB9A 1D1AA 1D3YA 1OCZH 1V5EA 4A6DA 1AOYA 3A01A 2TCTA 5GADJ 3AG2H 5B1AH 2Y9ZA 4CXFA 5FLXZ 3OYGA 4QSHA 5J8CA 3E6BA 5IOZA 1IG7A 4U7BA 2JUGA 4JQFA 4XN0A 3P9CA 1OJLA 2IGMA 1GV2A 1QZZA 4F91B 1XSVA 2R0QC 2YPRA 3LSJA 3QOPA 1MKMA 1T2KA 4N0BA 3JRCA 3AAFA 1T8IA 2FUG2 2ME0A 4WXCA 2QYOA 4BH9A 3ABLH 4C2TA 3H92A 1JKRC 1ONVA 5KNLA 2QCOA 3M3YJ 2JA7J 3RI4A 2EB7A 3WTYC 5AONA 1R6RA 3BG9A 3JRGA 4YIFA 2IS6A 4GYIA 2ISYA 3L2CA 2HQ5A 1Z77A 2UXXA 4GCVA 2P5LC 4JP0A 1MSEC 1GXPA 1R36A 3L1PA 2ADUA 2JQ7A 4A3DJ 5E17F 4IPAA 3EUAA 2RNGA 2DDBA 3DLAA 5JVTA 4N4NB 4BAYA 2VL8A 2V9KA 2WA0A 1WJAA 2M87A 2MGQA 1R4MB 3I71A 1YTYA 2KRFA 1TW3A 2V9VA 1A31A 2EZHA 1G3YA 4JYKA 1D5YA 1R7JA 3LWFA 2M7BA 1YW9A 2X1CA 3BCBA 3CCRI 2XIGA 4L5IA 4D9JA 2CGPA 4BE2A 1K7AA 1Y8QB 2BY0A 3H3UA 2PEXA 2LVSA 2CJJA 4WWCA 4A93J 4DZJA 3LNQA 3REOA 1F43A 5TJJA 3S3NA 4G6TB 3K69A 4LJZF 4IRIA 4OAZA 1LFBA 1G3WA 5J3LA 3JRBA 3DU6A 4DZPA 2IXSA 3SDBA 1V54H 2MFZA 4BQQA 1MJAA 1R5HA 1UZCA 2F5DA 3PNTA 2CQKA 2CQQA 2R93J 1YJ9I 1E17A 1FMVA 3FBIB 1M1EB 4MHGA 4ZJZA 2ZFUA 1PYVA 4MQVA 2BVMA 1SFKA 4U7DA 2LTPA 4G6QA 2GIVA 4NNJA 3K0LA 5L3DA 1EF4A 4OINF 2E1MB 3HUGB 4IF4A 3FM5A 3NEUA 5EYRA 1VQLI 3BJAA 1RRJA 1G3TA 2LLKA 1ETYA 4W1UA 2JUCA 1FZPB 3LSGA 1FYKA 1WJ5A 3K70D 1XDSA 2KJBA 2LK2A 3DEUA 1T39A 5E8IA 3ZQHA 1QBJA 5J1RA 4BE1A 2P81A 3HBLA 3VOEA 1PUFA 3G1LA 4J19A 2ZCWA 3D0SA 1YQAA 4H4KC 4O5VA 5FD5A 5GP9A 2OCEA 4BEHB 3CMAI 3PIPF 5EEAA 3ECOA 3IWFA 2GA1A 4RLFA 2NOGA 3LQRA 2I5UA 1RUOA 4Y7NJ 1YJNI 5EZHA 4YFXF 2HU9A 2XGCA 2PG4A 1A04A 2R7VA 4E7SA 3L2UA 3B73A 4LIVA 2VJJA 2OPTA 2ID6A 4F3QA 1TQPA 4N9IA 2BEOA 2Y69H 2JTVA 2HKXA 4LLGF 2XPUA 4D1QA 2LBFB 3H0DA 3HDDA 1K78B 4B3XA 5LRRA 3KE2A 4UUSB 5AIPA 1FLIA 2DTZA 3T8TA 4FISA 1G2HA 1FP2A 3WU2C 2O61A 3S1QJ 2OTLI 3P7NA 3IKTA 2YU9J 1SFUA 4BXUA 3LA2A 4P5OA 1K79A 2O3FA 4RMNA 5IPAA 4XRSA 2VASA 1MH4A 1RPWA 3M9AA 3WGGA 2UZKA 4A6EA 4MIMA 4EJWA 3JW4A 3F3XA 4HLXA 4NBQA 4B3AA 1MJ9A 1MNDA 1QHGA 4IHWA 3WTXC 3NWSA 3S32A 2GOMA 1MW7A 4A3MJ 4L5EA 1BL0A 1Z67A 4FHTA 4YIRX 1VQ5I 3PO2J 3OYDA 3M4OJ 4CDGA 3H9QA 3IAS2 3PO3J 3QPHA 5LHGA 3BR2A 3BR6A 1MBHA 1SMTA 2NAZA 5F6FA 3L2VA 4CCJA 2LD5A 3VDXA 3A01B 2KJCA 3QPTA 2JJ7A 2TRTA 4M6XA 3GTLJ 3HSRA 4X0GA 5C4JJ 5D8LB 4EVIA 1SD4A 4A3KJ 2HPIA 1ACIA 3MZ8A 2XSJC 1LKXA 4ASNA 2GXBA 1J9IA 1WRJA 2CUZA 2DA5A 3LAJA 3G6EI 3FXRA 2ZNZA 1SD6A 4CCLA 5FKLA 1B8IA 3HTUA 4KIBA 4I02A 4IRGA 3I5UA 1VTNC 1B8IB 3T5XA 2CSOA 1ZARA 3RKYA 4CZCA 5ICCA 1Q1HA 1GDTA 1S29A 3CJNA 2LYCA 4KT6A 5ED4A 3WTSC 2P5KA 5JI6A 2DT6A 3F23A 3GW2A 1FJLA 4RDUA 1U0JA 1P7IA 5A2QZ 2FA5A 2LH9A 5CJ9A 3HOTA 3H0GJ 5IYCJ 3X2QH 1DDNA 4BXXJ 3HUGA 2CWEA 3D1NI 3G4SI 3GXOA 5IYDJ 5FLXK 3S17J 1RNLA 1BJAA 4OIRF 2V1UA 4OIOF 1FIPA 4UVBA 1DP7P 2FF4A 2AHQA 3WTWC 3GLXA 2EV5A 2X48A 2FNAA 3DPLC 3M8FA 2HOAA 1OMIA 1WHUA 2G7HA 4ZYAA 3FXJA 1TNTA 1MBGA 4S0HB 1X3UA 3JRFA 2K9MA 2GIZA 2R7WA 4M9SA 3GTMJ 3EUKL 4CYDA 2NVUB 4PJNA 2DFEA 3RKQA 3CDHA 1G8XA 1O3RA 4I09A 2JZYA 2OD5A 3MN2A 2JMWA 3KCCA 4CSWA 1WI3A 3LMMA 1JTYA 1XMKA 3M7GA 5DUIA 4HLYA 2ELHA 2HPMA 1FOYA 5HDNA 3KLNA 1FPQA 2DQRA 1BR1A 4DBRA 1U3EM 3LSMA 2Y75A 1VI0A 2ESHA 1XPXA 2JA8J 4XONA 3ZPLA 5ERIA 2PMHA 3I64A 2IVMA 3GMEA 4L5JA 1F1ZA 2OBPA 2VQGA 2XVCA 2K5CA 1APLC 1VQ6I 4LFUA 2V4JC 4HW0A 2M0MA 4ZC3A 1FOWA 2LY9A 2MD0A 3ESWB 2ECBA 2W00A 2FQ3A 2E7WA 2XPWA 5EF6A 5H2FC 1LVKA 5GAEJ 1XD7A 2A5YB 1QU3A 1LFPA 4A3LJ 2X6OA 3OIQA 1J75A 2XPVA 3T0YA 1X58A 3HOSA 4E7HA 2F5FA 3HJEA 2FE3A 3B02A 2M30A 4U87A 5LHHA 1FSHA 3IKVA 3OOUA 3GUDA 1CQTA 2VLAA 2HYGD 4IEJA 1TZLA 3KLOA 2H27A 1FBUA 3CQZJ 2Y0SA 3FMRA 3Q9SA 1LFUP 3P9IA 4F92B 1KQ8A 2OAZA 3S14J 3M1CA 3WE3A 4AC0A 1DU6A 2L0KA 5FKOA 2QQ9A 1YRNA 2K4JA 1MIJA 5K5QA 1HLVA 3QYEA 2OZUA 3F8MA 4C3JJ 4HBLA 4A0YA 1WJDA 2DN0A 3WTTC 1Y0UA 1EJ9A 2PN6A 4I99C 2LF7A 4B47A 4HNVA 2VE8A 3ZMSA 3C2HA 1I1SA 1TWHJ 4XNFA 2ZC2A 5C44J 3DQVC 3W6KB 4W97A 2LG4A 2QBYB 2MC3A 2CQXA 3RTRA 1IV8A 1IZ1A 1IGNA 3E5XA 3PSIA 2VJ4A 2G9WA 4AYBA 2VBZA 2HZTA 3PFYA 4BXFA 5EZGA 3JCUC 4WX9A 2RGVA 2B9SA 3HRMA 4I6ZA 3KFWX 5DD4A 5DCMB 2PMUA 1F9NA 2XGEA 1MMAA 1R1VA 4HX7A 4E70A 3BTCA 2Z33A 1VQ8I 2PBIA 3TO6A 4BBSJ 2QF7A 4XK4A 4ANJA 1Y0NA 4XICA 2R7UA 2EINH 3DPUA 4KICA 4N4OB 1YS7A 5M3FJ 3N05A 3RPQA 2LC2A 3W2VA 5JR3A 4PJJA 3OYAA 3CJRB 4GXOA 1ZH5A 5HLIA 4CHUA 2E35A 2HTJA 4Z2YA 3A4CA 2FU4A 5KVRA 5BPIA 1QZEA 2ZXIA 5EEHA 4ZDLA 1SEUA 1WQ2A 3GEZA 2Y0MA 4PSXA 2KISA 2BXYA 3QRFF 1P4WA 3E0JB 5JHUA 4O6JA 2ID3A 4OOIA 3FXLA 1FTZA 2DMNA 4PK4A 1T33A 1BN5A 1IUFA 3DEEA 1QA6A 4QPQA 4BQNA 2JPCA 2M4KA 1UMQA 2AXTC 1S3JA 2X1DA 4B8XA 5E1WA 4F52A 4RB3C 4PCQA 2F2EA 1ZRDA 2WAQN 2HYFA 1ON2A 2WTEA 2ME6A 1QVUA 2DJNA 1NHAA 5E79C 2YX7A 4A3GJ 4A5MA 3IRQA 5TRDA 3ABUA 3BPXA 2AXLA 3VFZA 4DGWB 2DPDA 3F6OA 2VXZA 3MEXA 4PJ0C 2F5EA 3BG7A 4YELA 1IN8A 3CMYA 1DGRM 1N75A 1KGSA 4ZYEA 4AUXA 1K4TA 3JRAA 1EH6A 3FXQA 4UV9A 4WK8F 1WI9A 5D4SA 2Q0OA 1R5GA 2DA3A 5LGUA 3HOXJ 2WADA 2PJRB 3WU1B 4BDZA 4EM2A 3RSNA 1EA3A 2M34A 2A6HF 1D0YA 2FBHA 1O3TA 3V7SA 1ETVA 1SMYF 2HNHA 3BR1A 1V55H 1TWCJ 3TP0A 1RR8C 1L0OC 1ODDA 3KP5A 1OCOH 4M74A 2BY2A 2MLKA 4NUBA 2KP6A 2E1MC 2V1XA 1VQ4I 4QTRA 3TO7A 2DA2A 4G12A 5H6QA 1MMNA 3V8JA 3BDDA 1ENHA 3J81Z 4M9XA 4BGDA 2UV1A 4N9HA 4XSZF 2O6GE 3S2DJ 2EZKA 2UXNA 2F4MB 1XC5A 3GX4X 3WHCA 1V3FA 2EQRA 2E1NA 2R3SA 1KU2A 3Q0VA 4J00A 3R4KA 2LMDA 5E1ZB 1ZHFA 1OQYA 2R5ZA 1J5YA 2LOOA 2K85A 1MDMB 3H3VK 3CUQB 2DK5A 4HDUA 4P9FA 1Z6TA 1FX7A 4LK0F 3MVPA 2R5YA 4AIJA 3C7JA 3E1SA 4HX8A 2JRTA 5L3BA 2JRMA 2W57A 4G7ZF 5BQTA 4EJUA 1SAXA 2FMLA 4P1WA 3ZP5A 4MTDA 5DDGA 4KMFA 3BC8A 2V6CA 3AG4H 4CGZA 3TGNA 4RS8A 1S6LA 4QLCU 3VYTB 4XRSG 2COBA 2ZB9A 1VQKI 1O7LA 3M07A 1U5TB 1ZTRA 3HEFA 3K2ZA 1VFCA 3FXUA 2DA6A 2BV6A 4NHJA 3HGGA 2E19A 1STZA 2NS0A 2RKHA 1IDZA 4E7JA 1IN5A 2E36A 1X1PA 3E6DA 4A3BJ 3F22A 4FT8A 3GTOJ 3I56I 3ASOH 3H36A 5J4VA 3ZMTA 1VQPI 2K86A 1WJBA 3WGHA 5J1YA 3J80Z 3UNGC 4BS9A 4S04A 3QPSA 2DYSH 2WBMA 2XSDC 1FP1D 4AIKA 4A3JJ 4AD9A 1IW7F 1FBSA 1GXQA 4KN4X 4L0ZB 2VN2A 4ENJA 4CYCA 3MFKA 4DJAA 1I27A 3JAMK 5DEQA 4A0XA 2X51A 3N4MA 1JXSA 2QGUA 3FISA 3OYKA 3BY6A 4XBFA 3H9JA 2CV2A 4C9YA 3W3CA 2LF8A 4L9VA 4Y52J 3LSHA 5JVGF 3C2GA 2DMUA 2LDUA 2IRFG 1G3SA 3L7WA 2P5VA 4X6AJ 3A2KA 2WY8Q 5B5EC 4YG2F 4P9UA 1UG0A 2K02A 5K7HA 2E5ZA 1MBJA 1Z3XA 1X1CA 2BGCA 2VBXA 2Q8KA 5F0HA 5D6EA 2DMTA 2VQHA 1B6AA 5FB2A 4C3HJ 2GQQA 3F8CA 5DTDA 3ZQQA 4KMUX 1R1TA 2BZTA 3BR3A 3EQLF 3M8EA 3AKZA 3Q9VA 1ZR2A 2O8XA 2E2HJ 4YFNF 3G3ZA 1FC3A 1HOMA 3DKYA 5FKKA 2AO9A 3JRDA 4HSTA 3V42A 2X9DA 2GA2A 1JHHA 1JI8A 4WXDA 3KEQA 4P55A 2VKDA 2R7QA 1ZRFA 3HOUJ 2Z99A 2Q2EA 1UHMA 4BACA 4RM2A 3CF2A 1P92A 2W4SA 2Y31A 5M3MJ 2ZJPF 1B4AA 1PVEA 1YE9A 5FLMJ 2OTJI 1BC8C 3BZCA 1JGSA 1SAUA 4P96A 3CJTB 3H5AA 2D1VA 1PUFB 2L7FP 3PL8A 1IXRC 2PJPA 1OCRH 1RIOH 3MKLA 1WH7A 4C30A 2A61A 2LKXA 2WAQA 4G7OF 2J5OA 2MD5A 3K4KA 3KZZA 2RNJA 5C4XJ 3OYFA 3FKIJ 3FK7A 3IH4A 3H5NA 1MBEA 1LDJA 2F4OB 1Z7UA 4RAYA 2NVTJ 3K6GA 2NRAC 1AKHA 3OR2C 1UAAA 3UKGA 1GLNA 3NAUA 1D0ZA 3K4BA 1YITI 2A07F 1TLHB 2GXAA 1GUUA 1YG2A 2GXGA 4KDPA 2FMYA 2TDXA 1EKEA 3VEPA 2KRCA 1ZGJA 1QRYA 2QUFA 1FYMA 1DPUA 2VONA 3FIWA 4XOTA 2BY3A 2O9LA 4ETSA 3OOPA 2QZ8A 5ICGA 5JLXA 4BY1J 2F5CA 2IT0A 3CC2I 5BS6A 4PUSA 1HBXG 2X0LA 2FOKA 5ILVA 4XLEA 3FMQA 3E5UA 3HOWJ 4CCNA 1HKQA 2IEKA 3AG3H 4LMYA 4RB1A 2K9SA 5D5VB 4L9TA 2LSOA 2EV6A 1LE8A 2NVQJ 1HCRA 3OYIA 4FE7A 4M3DA 1I3AA 2EFQA 3CCEI 1ETOA 2KDOA 3S1MJ 3FDYA 3BG3A 1H8AC 3K4MA 1WVRA 1XSDA 1U9OA 3HM5A 1BI1A 2IGNA 2X6YA 3I4NJ 5J40A 1OCTC 1ZGWA 2H6CA 4HQMA 3ZQCA 4HOBA 3OSGA 1SVMA 4M6VA 2BXZA 4PJLA 1NG7A 3CUQC 3OYMA 2F48A 3BT9A 4PJMA 1TW2A 5ICEA 2JA6J 5LLQA 3F6VA 5BMZA 1MBFA 3RYRA 4QPOA 1IF1A 1ON1A 2L9NA 5L3GA 4Y13A 1U8BA 2MABA 1LDDA 4TV7A 5IOYA 4HNUA 1MMDA 2GAUA 4LG3A 4ZTFA 1LUJB 5M5XJ 1IN4A 5CPRB 1DU0A 2HDWA 4I76A 4M3BA 2CW8A 2QQAA 3S2HJ 1HSTA 4PZJA 4ZH4F 3QOEA 4GFBA 3DCFA 5F1RA 2XDVA 2LKSA 1OLTA 1HW1A 1YOVB 3K10A 2STTA 2H94A 2KT0A 1H88C 5K1YA 2DMQA 2H6BA 3DV8A 4KNYA 1K6OA 1IO2A 4ENKA 2PFBA 2XAFA 3PJRA 3HKZN 1IC8A 1D1BA 1FOKA 3QP6A 2DA1A 4IJAA 2XHKA 3TDUC 1K83J 2KDZA 1NG6A 1UHSA 3NWTA 5B1BH 1U5TA 1BJZA 2NOJB 2W84A 3Q0WA 1W5TA 1P7JA 1LB2A 1G59A 1H9TA 2NS8A 3HRTA 2JPBA 5B3SH 1LEAA 2CW7A 2VE9A 2V6EA 3VWBA 3RJPA 4RM3A 2F5VA 2XASA 4HF2A 3ZMDA 3DBRB 1LDKB 3FWEA 1EV7A 5EDNA 2LR8A 2MW8A 2HDDA 3B6CA 5CYVA 5LFAA 2MH9A 3O3KA 3FX3A 4CH7A 3SEQA 4A3FJ 3HG9A 4PFPA 1POGA 1XN7A 3TQNA 3ZRGA 1ULYA 2BE5F 2M5WA 3PSFA 2VI6A 3VB2A 4GRIA 2VOOA 3LA7A 4NC6A 3VSLA 1RR7A 2ZKZA 5JFRA 3CCSI 2ZXJA 4L0YB 1KU9A 3SEZA 2LP0A 2ISZA 2VUMJ 1Y1VJ 5FFZA 4EM1A 4XSXF 2HYJA 3FHNA 1T38A 2HQNA 1FTTA 1JGGA 5B66C 2XB0X 1PP7U 2FJ1A 4OU0A 4F93B 4XRMA 2R5ZB 2VPLA 2L9VA 4FE4A 2DYRH 1QPIA 4IQJA 2R7RA 5CLSA 3OYNA 1VQ9I 4MEYF 1TL8A 3BP8A 4M3EA 1X1AA 2JSPA 1PJRA 3I9V2 4ESJA 3HHGA 4CA0A 2R7DA 3DXJF 1H9GA 1Y6IA 1S8NA 3D5RC 3IAM2 2XAHA 2IS4A 4RLQA 2DLLA 3BJ6A 4NC8A 2CS3A 4WCGA 3HKZA 3I0TA 5HOOA 4G6DA 3GFJA 4YEJA 1ZN2A 4ON0A 2XF6A 1YW8A 2KIQA 3LSRA 5DM7F 3CMEI 3F9KA 3HYIA 1GV5A 2VIXA 2CQNA 2W1OA 2IP2A 4PSWA 5K5RA 3JREA 1Z6RA 1TC3C 1WFXA 2RVCA 1BI0A 4XKBA 4DYRA 4EGYA 1BI3A 3OL3A 5IT3A 3V7RA 2FNPA 2HOEA 1WKMA 3BJOA 1BR2A 1E3HA 4QWQA 2F4IA 4IHYA 2HI3A 1TNSA 2AQFA 3N97A 1BW6A 2E60A 4RGRA 2DPUA 2BHYA 2QQ8A 2L5QA 3DU5A 5ILSA 4KITB 2FX0A 4YIIA 2QKMB 2HQAA 4CICA 2GLOA 3WTZA 2EH3A 3I4PA 3S3MA 2MH2A 4BL0B 5HS9A 3ABMH 2HOSA 1MD0A 4O3MA 2YSRA 2X85A 1MH3A 3GF2A 1JE8A 4RGSA 3S8PA 5FJ8J 1LE8B 1HSJA 5D8KB 4Y3OA 2NYXA 1LVAA 5M5WJ 2H8WA 3DP7A 2V1DA 5HDGA 5GTHC 2QWWA 1JUPA 1JT0A 2P7CB 4K2EA 3V4GA 2NVYJ 5EJCA 2DAOA 3G71I 3SZTA 1Z7LA 1OFCX 2L7MP 2QSGX 3GWZA 2PJRA 4G9YA 1A6QA 4CCMA 2CFXA 2OZ6A 3TL4X 1R49A 1WWXA 1WJFA 3CDLA 2B0LA 3IRRA 1IN7A 3LL7A 3COAC 3JR9A 3TOAA 1TTYA 4BUPA 5F0FA 1JUMA 2EFNA 3ASNH 4A3IJ 3KETA 2VKEA 4KUMA 3DTKA 3IV5A 1R00A 1P4XA 5D4RA 5KCMA 1U6GA 1RUNA 1BM9A 4ITVA 4Z6YA 2Z3YA 3ZR8X 5GPAA 1QQIA 2JA5J 3JSOA 4FASD 2VOPA 3SHFA 5L3EA 3DKXA 1MNMC 1FMWA 3LFKA 3HTSB 5E20A 1SVLA 3F72A 2EZLA 4ZDPA 2JK3A 2IBDA 1YRNB 3FBNB 5F04A 3J7AO 2BVLA 2M45A 2R7TA 3K9TA 3L2QA 1QO0D 5DD8A 1SD7A 3G1MA 3M1EA 1X1DA 2V7FA 4HZFA 1YJWI 2HFHA 3HPGA 4BYYA 3MZHA 2HS5A 1HXDA 1BW5A 2L4MA 4CO8A 1RKWA 1Z9CA 4MO7A 2QBYA 2KL4A 1GVJA 3OIOA 4XN3A 2HXIA 3CD6I 3WG9A 2I10A 3K1NA 3KP2A 3CCVI 1W5SA 2GBYA 4XOPA 3GZ6A 2HVRA 3MD2A 2OCCH 3HHHA 2N8GA 3BTLA 4I01A 4MLOA 4DNCA 2K3PA 1FSEA 1OCCH 4I2OA 4KA4A 3U2RA 2W48A 3CO7C 5H6RA 1Y56A 3Q0UA 1ZG3A 1YX5A 4LLLA 1RC9A 3K4LA 2ZNYA 3GCMA 4B4CA 5CQGA 3C2BA 2KMUA 1VQNI 3V8KA 3EUHC 4L9NA 5C3EJ 1SC7A 3IH3A 2ZMEA 1GVDA 2BW3A 2Z2SB 2Z1DA 4BEHA 4D5FA 1I3QJ 1YLFA 3ZXSA 3KP4A 2VPRA 1VQMI 2BW3B 2KHMA 3LFUA 2L7ZA 1XS9A 3OYBA 4U0YA 5DV5A 5L3CA 4D5CA 2ZO4A 3I54A 1LQ1A 5IT9K 4DIQA 2ZSIB 1QZYA 4XKWA 1X2NA 1D8JA 1WJCA 3MWMA 4JX6A 3OYJA 2IS1A 2DA4A 4XLFA 3OSFA 2E71A 1KU3A 3BR0A 3H35A 2IS2A 3GVAA 3OYHA 2W25A 4H0EA 4UY8I 2LNBA 2XKPA 5F08A 3K4CA 5EGOB 2ELKA 1OR7A 1TT5B 3Q5FA 2FEZA 5F64A 5LEJA 1SFXA 4UUSA 1R5ID 5GPCA 3OYCA 3ML6A 1DQUA 1T98A 2R7OA 4R8HA 2E2IJ 3TDZC 2XROA 2Y48A 1UG2A 1YHQI 2WV0A 2NNYA 4MNUA 2HVSA 2RQQA 4ESBA 1JJ8C 5HDKA 1YI2I 3A1YA 1S7EA 2KQRA 2CV0A 3BZ6A 1R58A 3JRHA 2P7VB 2ACJA 4ZDOA 3KZYA 9ANTA 1L3LA 4JOMA 3OIPA 1OCPA 3SZGA 1I6XA 3FF5A 4B09A 2Z16A 1HQCA 1N77A 1MZBA 3R0JA 1BI2A 3NRVA 4YFKF 3ROUA 1JKPC 1S7OA 2L9SA 2L9RA 4B44A 2R7ZJ 4D0PA 4C2UA 3CO6C 3BTIA 1E3OC 3IHUA 4IL6C 3GTGJ 2HXOA 3KYDB 3ZCOA 2G7UA 1RKTA 3GTPJ 2RAEA 4BJ6C 2Y2ZA 1BOBA 3ERMA 1X3WB 1W1WE 3K4NA 4A3EJ 2DMPA 2JN6A 1J09A 5D5UB 1U78A 2WC2A 1T0FA 2AQEA 2GOXB 2RC4A 3KZIC 3R61A 1J59A 1U8RA 4KIGA 3WE2A 1PUEE 1N25A 4ZYDA 3ZQFA 5J4YA 3HOYJ 2IA1A 3MCZA 3I59B 3LSTA 2YX4A 1XSXA 4IZZA 4RB2C 2VQLA 2HWVA 2DTRA 3TEDA 4LLNA 1QPMA 3DTIA 1KQ9A 3LQQA 4CYCB 4UHTA 2HR3A 3UR3C 2NXNB 3RKWA 1LJ9A 4LB6B 3TO9A 4BHBA 4BJTA 2VBWA 1VQ7I 4L18B 1T56A 3O2PE 3CESA 2IA0A
chains in the Genus database with same CATH topology
5C4JJ 4A3KJ 2H8RA 1GUUA 2DA5A 2DA7A 1Y1WJ 2FD5A 5FKLA 1NK2P 1QRYA 1B8IA 2WV1A 3NARA 3FIWA 2O9LA 1B8IB 1GDTA 2K9QA 3I4MJ 2HOTA 4XIDA 5JLXA 4BY1J 1JKQC 1FJLA 4RDUA 1P7IA 1ZK8A 1WPKA 5K7ZA 5J1UA 3HOWJ 5IP6A 3GTKJ 1FEXA 2IEKA 3S1NJ 3RQIA 3H0GJ 5IYCJ 4BXXJ 2K9SA 3WHBA 3QPLA 3D1NI 1LE8A 2NVQJ 3S17J 5IYDJ 1A6IA 5IYBJ 1HCRA 1Q1VA 4FE7A 4M3DA 3RZDJ 1FIPA 1ETOA 3S1MJ 2H1KA 2FQ4A 4RBOA 3BR5A 3BG3A 2AHQA 1H8AC 2O8KA 1U9OA 2X48A 3HM5A 3I4NJ 2HOAA 1OCTC 3SFIA 1ZGWA 3Q3SA 1MSFC 3BQZA 1MBGA 4S0HB 3JRFA 3ZQCA 2CUEA 2M0CA 3OSGA 2G0EA 4M6VA 3GTMJ 2MG4A 5EG0B 2MSYA 2VKVA 3BT9A 3RKQA 2JA6J 3MN2A 2JMWA 1MBFA 1WI3A 1JTYA 3ZQLA 1U8BA 2D5VA 3W6VA 3TW7A 1ZKGA 5IOYA 5M5XJ 1DU0A 5BNGA 4I76A 4M3BA 3S2HJ 5EGOA 2YS9A 1VI0A 3ZQGA 4GFBA 3DCFA 2JA8J 2KT0A 1K61A 1H88C 4IHVA 2DMQA 3BTJA 5M5YJ 3CCYA 1JKOC 1APLC 3SDGA 3JRIA 1SFOJ 3HKZN 1IC8A 2LY9A 2DA1A 2ECBA 1K83J 2KDZA 1UHSA 2XPWA 3F0CA 5EF6A 2XRLA 1BJZA 3K7AJ 1A5JA 3Q0WA 1P7JA 3S16J 1ZR4A 4A3LJ 1JJ6C 2X6OA 2NS8A 2XPVA 1X58A 2NVXJ 3OOUA 5HODA 1NK3P 2YUSA 1CQTA 1JTXA 5EDNA 1R9TJ 1ETQA 2LR8A 2MW8A 4IEJA 3TP3A 2HDDA 3B6CA 3G1OA 3CQZJ 2CU7A 3GTQJ 1LFUP 1ETXA 2XGDA 4A3FJ 3S14J 1POGA 4AC0A 1DU6A 2L0KA 5FKOA 1YRNA 2VI6A 1HLVA 1B72B 1I50J 1RR7A 4C3JJ 1H89C 2M9HA 5F1JA 3SJMA 2DN0A 4FTHA 2R5YB 2LP0A 4HNVA 3ZOBA 1RESA 1TWHJ 2VUMJ 1Y1VJ 5C44J 3TW6A 1WGXA 2HYJA 4W97A 1FTTA 2CQXA 2K40A 1JGGA 2XB0X 2FJ1A 2R5ZB 4XRMA 2M8GX 1IGNA 1AU7A 4FE4A 4MFDA 4BKXA 1QPIA 5FKMA 4M3EA 1WCMJ 5EZGA 3O8HA 4I6ZA 2Y9YA 1Z0XA 2XGEA 4AYBN 1IRZA 3BTCA 3O8GA 4JX4A 1HDPA 4M3GA 4A3CJ 4BBSJ 2QF7A 2M2EA 4XK4A 2CRGA 2E1OA 3BG5A 1ETWA 4XICA 2LFBA 2NS7A 3LSRA 2O7OA 1GV5A 2Y30A 3LOCA 5M3FJ 4EEFG 3JREA 1U9NA 1TC3C 5F27A 4DYRA 4LOCA 3HOZJ 1B72A 3QQAA 2Y0SN 4IHYA 2HI3A 2ID3A 1FTZA 3A03A 2DMNA 1T33A 1BW6A 1IUFA 3S1RJ 2WB1N 4V2FA 1ITYA 3DEWA 1UMQA 2FX0A 3GBGA 4UUTA 4DYQA 4ABZA 2GLOA 2WAQN 2ECCA 2EH3A 2ME6A 1QVUA 2DJNA 1W0UA 4A3GJ 1X2MA 3FK6A 2HOSA 1MH3A 2K9NA 1NTCA 3CMYA 5E3LA 5FJ8J 3K2AA 4AUXA 4A69C 1O4XA 1LE8B 3JRAA 3HB9A 1MBKA 5DS9A 5M5WJ 3A01A 2TCTA 2Y9ZA 2DA3A 1JUPA 3HOXJ 1JT0A 1TWGJ 2NVYJ 4QSHA 4QIWN 1F36A 5IOZA 1OFCX 1IG7A 2L7MP 2M34A 1OJLA 1RETA 5F0CA 1GV2A 2R0QC 3CDLA 3LSJA 3HOVJ 1ETVA 3JRCA 4D7NA 2ME0A 3BR1A 3JR9A 2JWTA 1JKRC 1TWCJ 2QCOA 3M3YJ 5F0FA 2JA7J 1JUMA 3TP0A 4A3IJ 3PM1A 3BG9A 2VKEA 4D7MA 3JRGA 3IV5A 2HQ5A 1FIAA 1Z77A 4JP0A 4QTRA 2DA2A 4G12A 1MSEC 3L1PA 1ENHA 4A3DJ 3IH2A 5GPAA 2JA5J 4C2MJ 3S2DJ 2EZKA 1XC5A 3WHCA 2EQRA 2MGQA 1MNMC 3Q0VA 2EZLA 2EZHA 5EG0A 4JYKA 2JK3A 2R5ZA 2IBDA 1D5YA 1YRNB 5F04A 3H3VK 4DW6A 3LSPA 2LVSA 3G1MA 3MVPA 2R5YA 4BBRJ 3S15J 2CJJA 4A93J 4DZJA 3LNQA 1BW5A 1F43A 1RKWA 3A02A 4MO7A 3OIOA 1LFBA 2HXIA 2I10A 5J3LA 2GBYA 3JRBA 1TWFJ 4DZPA 1BA5A 4XRSG 2COBA 2N8GA 2ZB9A 4NDLA 3HEFA 1ZTRA 1VFCA 2DA6A 3BTLA 4MLOA 3HGGA 2CQQA 2W48A 2E19A 2R93J 3Q0UA 2CUFA 1ETKA 5IP9J 1IDZA 4B1RA 4B4CA 2XB5A 3C2BA 2LTPA 5C3EJ 3IH3A 4A3BJ 1GVDA 4D5FA 1I3QJ 1EF4A 3GTOJ 2VPRA 5EYRA 1VNDA 2OF7A 2L7ZA 1XS9A 5J1YA 2LLKA 1ETYA 3QPSA 2B63J 4W1UA 4D5CA 2XSDC 4A3JJ 3LSGA 1X2NA 4JX6A 2LK2A 4CYCA 2DA4A 3ZQHA 3OSFA 5J1RA 2P81A 3BR0A 3HBLA 4BY7J 3FISA 1PUFA 3GTJJ 3G1LA 4V2GA 4J19A 5F08A 5GP9A 5EGOB 2EZIA 2ELKA 1WH5A 5EEAA 4Y52J 1GT0C 2DMUA 2NOGA 4UUSA 5GPCA 1TWAJ 4DYCA 4Y7NJ 4X6AJ 4M3FA 5EZHA 2E2IJ 1HF0A 4C3IJ 2R92J 1UG2A 2XGCA 5K7HA 1HDDC 1JJ8C 1MBJA 5E3MA 4IHXA 1S7EA 4FCYA 2OPTA 2ID6A 5F0HA 3JRHA 2DMTA 4MFEA 4C3HJ 3RZOJ 5DTDA 2XPUA 9ANTA 5K7FA 5FKNA 3BR3A 3HDDA 5JLWA 3E7LA 1AHDP 1OCPA 1ZR2A 1IDYA 3VPRA 2E2HJ 2IAIA 4UUSB 1I6HJ 1HOMA 2E2JJ 2DTZA 5FKKA 3JRDA 2AO9A 2X9DA 3HGYA 4FISA 1G2HA 3ZQIA 2EBIA 5E3NA 1JKPC 1VF9A 2L9RA 2YU9J 2R7ZJ 3S1QJ 3BTIA 1E3OC 3GTGJ 2HXOA 5IPAA 4XRSA 1IJWC 1MH4A 1RPWA 3HOUJ 1RKTA 3GTPJ 2RAEA 2Y2ZA 4MIMA 4JX5A 4X1EA 4A3EJ 2Y31A 2DMPA 5M3MJ 2JN6A 1IV6A 1U78A 1QVTA 5FLMJ 1AKHB 5FLVA 4B3AA 4IHWA 1PUFB 2L7FP 4A3MJ 4L5EA 1BL0A 3MKLA 1WH7A 3ZQFA 1W0TA 3BQYA 1XG1A 3PO2J 3M4OJ 2LKXA 2GM4A 1JUSA 3HOYJ 1ZQ3P 3B6AA 3PO3J 1JT6A 1ORKA 3BR2A 2PMZN 3BR6A 5C4XJ 1MBHA 3FKIJ 3FK7A 3IH4A 3TEDA 2LD5A 4CYCB 1SANA 1MBEA 3A01B 5IP7J 2NVTJ 2JJ7A 1AKHA 1T56A 3UKGA 2TRTA 3GTLJ 3NAUA 5E3OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4J J;  4A3K J;  2H8R A;  1GUU A;  2DA5 A;  2DA7 A;  1Y1W J;  2FD5 A;  5FKL A;  1NK2 P;  1QRY A;  1B8I A;  2WV1 A;  3NAR A;  3FIW A;  2O9L A;  1B8I B;  1GDT A;  2K9Q A;  3I4M J;  2HOT A;  4XID A;  5JLX A;  4BY1 J;  1JKQ C;  1FJL A;  4RDU A;  1P7I A;  1ZK8 A;  1WPK A;  5K7Z A;  5J1U A;  3HOW J;  5IP6 A;  3GTK J;  1FEX A;  2IEK A;  3S1N J;  3RQI A;  3H0G J;  5IYC J;  4BXX J;  2K9S A;  3WHB A;  3QPL A;  3D1N I;  1LE8 A;  2NVQ J;  3S17 J;  5IYD J;  1A6I A;  5IYB J;  1HCR A;  1Q1V A;  4FE7 A;  4M3D A;  3RZD J;  1FIP A;  1ETO A;  3S1M J;  2H1K A;  2FQ4 A;  4RBO A;  3BR5 A;  3BG3 A;  2AHQ A;  1H8A C;  2O8K A;  1U9O A;  2X48 A;  3HM5 A;  3I4N J;  2HOA A;  1OCT C;  3SFI A;  1ZGW A;  3Q3S A;  1MSF C;  3BQZ A;  1MBG A;  4S0H B;  3JRF A;  3ZQC A;  2CUE A;  2M0C A;  3OSG A;  2G0E A;  4M6V A;  3GTM J;  2MG4 A;  5EG0 B;  2MSY A;  2VKV A;  3BT9 A;  3RKQ A;  2JA6 J;  3MN2 A;  2JMW A;  1MBF A;  1WI3 A;  1JTY A;  3ZQL A;  1U8B A;  2D5V A;  3W6V A;  3TW7 A;  1ZKG A;  5IOY A;  5M5X J;  1DU0 A;  5BNG A;  4I76 A;  4M3B A;  3S2H J;  5EGO A;  2YS9 A;  1VI0 A;  3ZQG A;  4GFB A;  3DCF A;  2JA8 J;  2KT0 A;  1K61 A;  1H88 C;  4IHV A;  2DMQ A;  3BTJ A;  5M5Y J;  3CCY A;  1JKO C;  1APL C;  3SDG A;  3JRI A;  1SFO J;  3HKZ N;  1IC8 A;  2LY9 A;  2DA1 A;  2ECB A;  1K83 J;  2KDZ A;  1UHS A;  2XPW A;  3F0C A;  5EF6 A;  2XRL A;  1BJZ A;  3K7A J;  1A5J A;  3Q0W A;  1P7J A;  3S16 J;  1ZR4 A;  4A3L J;  1JJ6 C;  2X6O A;  2NS8 A;  2XPV A;  1X58 A;  2NVX J;  3OOU A;  5HOD A;  1NK3 P;  2YUS A;  1CQT A;  1JTX A;  5EDN A;  1R9T J;  1ETQ A;  2LR8 A;  2MW8 A;  4IEJ A;  3TP3 A;  2HDD A;  3B6C A;  3G1O A;  3CQZ J;  2CU7 A;  3GTQ J;  1LFU P;  1ETX A;  2XGD A;  4A3F J;  3S14 J;  1POG A;  4AC0 A;  1DU6 A;  2L0K A;  5FKO A;  1YRN A;  2VI6 A;  1HLV A;  1B72 B;  1I50 J;  1RR7 A;  4C3J J;  1H89 C;  2M9H A;  5F1J A;  3SJM A;  2DN0 A;  4FTH A;  2R5Y B;  2LP0 A;  4HNV A;  3ZOB A;  1RES A;  1TWH J;  2VUM J;  1Y1V J;  5C44 J;  3TW6 A;  1WGX A;  2HYJ A;  4W97 A;  1FTT A;  2CQX A;  2K40 A;  1JGG A;  2XB0 X;  2FJ1 A;  2R5Z B;  4XRM A;  2M8G X;  1IGN A;  1AU7 A;  4FE4 A;  4MFD A;  4BKX A;  1QPI A;  5FKM A;  4M3E A;  1WCM J;  5EZG A;  3O8H A;  4I6Z A;  2Y9Y A;  1Z0X A;  2XGE A;  4AYB N;  1IRZ A;  3BTC A;  3O8G A;  4JX4 A;  1HDP A;  4M3G A;  4A3C J;  4BBS J;  2QF7 A;  2M2E A;  4XK4 A;  2CRG A;  2E1O A;  3BG5 A;  1ETW A;  4XIC A;  2LFB A;  2NS7 A;  3LSR A;  2O7O A;  1GV5 A;  2Y30 A;  3LOC A;  5M3F J;  4EEF G;  3JRE A;  1U9N A;  1TC3 C;  5F27 A;  4DYR A;  4LOC A;  3HOZ J;  1B72 A;  3QQA A;  2Y0S N;  4IHY A;  2HI3 A;  2ID3 A;  1FTZ A;  3A03 A;  2DMN A;  1T33 A;  1BW6 A;  1IUF A;  3S1R J;  2WB1 N;  4V2F A;  1ITY A;  3DEW A;  1UMQ A;  2FX0 A;  3GBG A;  4UUT A;  4DYQ A;  4ABZ A;  2GLO A;  2WAQ N;  2ECC A;  2EH3 A;  2ME6 A;  1QVU A;  2DJN A;  1W0U A;  4A3G J;  1X2M A;  3FK6 A;  2HOS A;  1MH3 A;  2K9N A;  1NTC A;  3CMY A;  5E3L A;  5FJ8 J;  3K2A A;  4AUX A;  4A69 C;  1O4X A;  1LE8 B;  3JRA A;  3HB9 A;  1MBK A;  5DS9 A;  5M5W J;  3A01 A;  2TCT A;  2Y9Z A;  2DA3 A;  1JUP A;  3HOX J;  1JT0 A;  1TWG J;  2NVY J;  4QSH A;  4QIW N;  1F36 A;  5IOZ A;  1OFC X;  1IG7 A;  2L7M P;  2M34 A;  1OJL A;  1RET A;  5F0C A;  1GV2 A;  2R0Q C;  3CDL A;  3LSJ A;  3HOV J;  1ETV A;  3JRC A;  4D7N A;  2ME0 A;  3BR1 A;  3JR9 A;  2JWT A;  1JKR C;  1TWC J;  2QCO A;  3M3Y J;  5F0F A;  2JA7 J;  1JUM A;  3TP0 A;  4A3I J;  3PM1 A;  3BG9 A;  2VKE A;  4D7M A;  3JRG A;  3IV5 A;  2HQ5 A;  1FIA A;  1Z77 A;  4JP0 A;  4QTR A;  2DA2 A;  4G12 A;  1MSE C;  3L1P A;  1ENH A;  4A3D J;  3IH2 A;  5GPA A;  2JA5 J;  4C2M J;  3S2D J;  2EZK A;  1XC5 A;  3WHC A;  2EQR A;  2MGQ A;  1MNM C;  3Q0V A;  2EZL A;  2EZH A;  5EG0 A;  4JYK A;  2JK3 A;  2R5Z A;  2IBD A;  1D5Y A;  1YRN B;  5F04 A;  3H3V K;  4DW6 A;  3LSP A;  2LVS A;  3G1M A;  3MVP A;  2R5Y A;  4BBR J;  3S15 J;  2CJJ A;  4A93 J;  4DZJ A;  3LNQ A;  1BW5 A;  1F43 A;  1RKW A;  3A02 A;  4MO7 A;  3OIO A;  1LFB A;  2HXI A;  2I10 A;  5J3L A;  2GBY A;  3JRB A;  1TWF J;  4DZP A;  1BA5 A;  4XRS G;  2COB A;  2N8G A;  2ZB9 A;  4NDL A;  3HEF A;  1ZTR A;  1VFC A;  2DA6 A;  3BTL A;  4MLO A;  3HGG A;  2CQQ A;  2W48 A;  2E19 A;  2R93 J;  3Q0U A;  2CUF A;  1ETK A;  5IP9 J;  1IDZ A;  4B1R A;  4B4C A;  2XB5 A;  3C2B A;  2LTP A;  5C3E J;  3IH3 A;  4A3B J;  1GVD A;  4D5F A;  1I3Q J;  1EF4 A;  3GTO J;  2VPR A;  5EYR A;  1VND A;  2OF7 A;  2L7Z A;  1XS9 A;  5J1Y A;  2LLK A;  1ETY A;  3QPS A;  2B63 J;  4W1U A;  4D5C A;  2XSD C;  4A3J J;  3LSG A;  1X2N A;  4JX6 A;  2LK2 A;  4CYC A;  2DA4 A;  3ZQH A;  3OSF A;  5J1R A;  2P81 A;  3BR0 A;  3HBL A;  4BY7 J;  3FIS A;  1PUF A;  3GTJ J;  3G1L A;  4V2G A;  4J19 A;  5F08 A;  5GP9 A;  5EGO B;  2EZI A;  2ELK A;  1WH5 A;  5EEA A;  4Y52 J;  1GT0 C;  2DMU A;  2NOG A;  4UUS A;  5GPC A;  1TWA J;  4DYC A;  4Y7N J;  4X6A J;  4M3F A;  5EZH A;  2E2I J;  1HF0 A;  4C3I J;  2R92 J;  1UG2 A;  2XGC A;  5K7H A;  1HDD C;  1JJ8 C;  1MBJ A;  5E3M A;  4IHX A;  1S7E A;  4FCY A;  2OPT A;  2ID6 A;  5F0H A;  3JRH A;  2DMT A;  4MFE A;  4C3H J;  3RZO J;  5DTD A;  2XPU A;  9ANT A;  5K7F A;  5FKN A;  3BR3 A;  3HDD A;  5JLW A;  3E7L A;  1AHD P;  1OCP A;  1ZR2 A;  1IDY A;  3VPR A;  2E2H J;  2IAI A;  4UUS B;  1I6H J;  1HOM A;  2E2J J;  2DTZ A;  5FKK A;  3JRD A;  2AO9 A;  2X9D A;  3HGY A;  4FIS A;  1G2H A;  3ZQI A;  2EBI A;  5E3N A;  1JKP C;  1VF9 A;  2L9R A;  2YU9 J;  2R7Z J;  3S1Q J;  3BTI A;  1E3O C;  3GTG J;  2HXO A;  5IPA A;  4XRS A;  1IJW C;  1MH4 A;  1RPW A;  3HOU J;  1RKT A;  3GTP J;  2RAE A;  2Y2Z A;  4MIM A;  4JX5 A;  4X1E A;  4A3E J;  2Y31 A;  2DMP A;  5M3M J;  2JN6 A;  1IV6 A;  1U78 A;  1QVT A;  5FLM J;  1AKH B;  5FLV A;  4B3A A;  4IHW A;  1PUF B;  2L7F P;  4A3M J;  4L5E A;  1BL0 A;  3MKL A;  1WH7 A;  3ZQF A;  1W0T A;  3BQY A;  1XG1 A;  3PO2 J;  3M4O J;  2LKX A;  2GM4 A;  1JUS A;  3HOY J;  1ZQ3 P;  3B6A A;  3PO3 J;  1JT6 A;  1ORK A;  3BR2 A;  2PMZ N;  3BR6 A;  5C4X J;  1MBH A;  3FKI J;  3FK7 A;  3IH4 A;  3TED A;  2LD5 A;  4CYC B;  1SAN A;  1MBE A;  3A01 B;  5IP7 J;  2NVT J;  2JJ7 A;  1AKH A;  1T56 A;  3UKG A;  2TRT A;  3GTL J;  3NAU A;  5E3O A; 
#chains in the Genus database with same CATH topology
 1BBY A;  2DO7 A;  2STW A;  6PAX A;  1B1B A;  2WAF A;  4GDF A;  3CCL I;  3TKY A;  5LRS A;  4HF1 A;  2WAE A;  3HZJ A;  2DA7 A;  1Y1W J;  1D0X A;  4OIP F;  4XLH A;  2EJR A;  3SXY A;  4Q4Z F;  1NK2 P;  5TIS C;  4IXA A;  4XLN F;  1FBQ A;  3QU6 A;  3H3Z A;  3NAR A;  2HDC A;  3HIF A;  4NB5 A;  1WSU A;  4KJZ A;  1RZ4 A;  5CVI A;  3ZMV A;  2HOT A;  4XID A;  2V79 A;  3AL0 C;  1Y8R B;  2VC0 A;  4HF0 A;  4UVA A;  1H0M A;  4Y33 A;  3K70 C;  1ZK8 A;  1WPK A;  5K7Z A;  4ZYG A;  5IP6 A;  3GTK J;  1XCV A;  2KIM A;  3S1N J;  3RQI A;  1TBX A;  3D5L A;  2JA2 A;  3C1D A;  3WHB A;  1U5T C;  4BQO A;  3ZMZ A;  2LRE A;  5IYB J;  1Q1V A;  3CLO A;  5HLT A;  1TQM A;  3H1C A;  2XKO A;  4M73 A;  3PNV A;  3O6B B;  4UB8 C;  3J81 K;  2DXI A;  2EWN A;  3CUQ A;  3BR5 A;  4RBO A;  2FBK A;  2QEN A;  4E7L A;  5D6F A;  2O8K A;  4M6Y A;  4FX0 A;  1HW5 A;  2ZSH B;  4OWR B;  3EYI A;  3GZ5 A;  3DBH B;  1DPR A;  2W85 A;  1XGN A;  2DFF A;  4XMY A;  3BQZ A;  3JAM Z;  2CUE A;  2M0C A;  1XTA A;  2EFO A;  2J5P A;  2M7A A;  3TMO A;  1KYW A;  4CCK A;  5EG0 B;  1JHF A;  2FBI A;  5HS7 A;  1J2X A;  4J01 A;  1O3Q A;  2OA4 A;  2ZXW H;  1QHH D;  3DTE A;  4E6K G;  2D5V A;  3FM3 A;  4EAT A;  3W6V A;  1OPC A;  1SFE A;  1ZKG A;  3MKZ A;  3L9F A;  1FOX A;  5BNG A;  5BOX A;  1XDU A;  1IN6 A;  2YS9 A;  2EPF A;  1T08 B;  1G4D A;  2VXD A;  2QVO A;  1BC7 C;  3W2A A;  1OYY A;  1HW2 A;  3VYS B;  1Z91 A;  2C6Y A;  3BCA A;  1Z3Y A;  4ZTJ A;  4AU7 A;  2ZFW A;  1K61 A;  2LY2 A;  2QSF X;  2XGX A;  4MEX F;  4Q47 A;  5M5Y J;  3BLY A;  4OMY A;  1E2X A;  3NQO A;  1JKO C;  1XGO A;  3OYL A;  1I39 A;  3W6J B;  1SFO J;  3ABT A;  3E97 A;  4E7K A;  2X1E A;  2M4G A;  3F0C A;  1XCB A;  2DW4 A;  4BQA A;  4XKV A;  2UWM A;  1T6S A;  1YIJ I;  2QKL B;  3CUO A;  5DCM A;  1ZR4 A;  3KP7 A;  1LEB A;  3DWL E;  2ZJQ F;  2ZBK A;  1B9M A;  3I53 A;  3P5J A;  3L09 A;  4I0A A;  1CGP A;  4II3 A;  5KAI C;  1AWC A;  2BYV E;  2DK8 A;  1IRG A;  2P6S A;  3SYT A;  2E5N A;  3ISP A;  3WTU C;  1X19 A;  3EET A;  3S2W A;  2CMP A;  2XAQ A;  2QA4 I;  3G1O A;  1D8K A;  2LY1 A;  3HRU A;  3I59 A;  4DQ2 A;  5ICF A;  4M9Z A;  1F5T A;  3PUF A;  5FRO A;  1OYI A;  5CVU A;  1FYL A;  1B72 B;  4CCO A;  1I50 J;  2M9H A;  3WU0 A;  3BWG A;  2V26 A;  1D5V A;  3J7Z I;  4FTH A;  2IGK A;  4WXH A;  3F21 A;  1BIA A;  3IWZ A;  1HC8 A;  4ZZD A;  1V5G A;  3TW6 A;  3E6M A;  1ZG1 A;  2K40 A;  1S7A A;  3EYY A;  1S72 I;  2EA4 A;  3D5S C;  2M8G X;  3EPZ A;  3U21 A;  1AU7 A;  5A2Q K;  1J7K A;  4BKX A;  5HNF A;  1YW7 A;  2EK5 A;  2R4G A;  2FXA A;  2VB6 A;  2EA2 A;  1I5Z A;  1WCM J;  4BHP A;  4WF2 A;  5E18 F;  2A05 A;  2OU2 A;  3O8H A;  3KEY A;  2FOW A;  1X1B A;  1Z0X A;  4B43 A;  1WJE A;  3IP4 B;  4AYB N;  4RAF A;  4UV8 A;  2LBF A;  3O8G A;  5E1X A;  4JX4 A;  3JTG A;  5DCF A;  4A3C J;  4U88 A;  2KKO A;  2ETH A;  2M2E A;  2HKO A;  2O5R A;  2CRG A;  5ILU A;  2XV4 S;  3BG5 A;  1ETW A;  1VZ0 A;  2DT5 A;  4M71 A;  5D5X B;  2GZW A;  3LAP A;  2O03 A;  4I7H A;  2Z9O A;  2Y30 A;  3ZQ7 A;  4EEF G;  1PDN C;  3KX2 A;  1U9N A;  4AVZ A;  2JVH A;  3OWT A;  5F27 A;  2ZME B;  1P9Q C;  4LIU A;  3L00 A;  1B72 A;  3QQA A;  2HGC A;  3HSE A;  2Y0S N;  2M1B A;  2RN7 A;  2DFH A;  3A03 A;  1MNE A;  1R23 A;  2WB1 N;  2CUJ A;  1OKR A;  3OL4 A;  2LRD A;  4Y17 A;  3DEW A;  4YRV A;  4XL9 A;  3GBG A;  4UUT A;  4E4H A;  3J7Y J;  1R71 A;  4EMS A;  2BOL A;  4KIF A;  4UNO A;  3KP3 A;  2ECC A;  2A68 F;  4IOC F;  3CLQ A;  3CCU I;  1OIS A;  1X2M A;  3TBI A;  3I3L A;  3FK6 A;  3AL0 B;  4GGG A;  2EV0 A;  4RA2 A;  2ZJ2 A;  4HQE A;  3VOD A;  4HX4 A;  3W2W A;  2Q1Z B;  5E3L A;  2ZJR F;  4I98 B;  4A69 C;  1O4X A;  1I1G A;  1W5C C;  3DLL F;  3PFI A;  3BRO A;  1MBK A;  3MAJ A;  5DS9 A;  1UEL B;  1ZAO A;  1UST A;  3KYL A;  1QNT A;  3IUO A;  4IRH A;  1TWG J;  2K4B A;  4BJ5 C;  2HZD A;  3ONQ A;  4QIW N;  1F36 A;  2VJI A;  4IO9 F;  1RI7 A;  4FX4 A;  2DOE A;  1W36 C;  1B9N A;  1XGM A;  2FRH A;  4R1H A;  3V7C A;  4RGU A;  5IY5 H;  1RET A;  5CVR A;  3GZN B;  4KN7 X;  5F0C A;  1VQO I;  3KPH A;  3OY9 A;  3HOV J;  2DCE A;  4OIQ F;  4D7N A;  2H1L A;  3K1M A;  3K4J A;  2XRN A;  2B7E A;  2BBY A;  2JWT A;  1ZRC A;  4IOA F;  2KZV A;  2K9L A;  2NNN A;  4HV5 A;  3KYC B;  4Y4R A;  3PM1 A;  1XMA A;  3FKJ A;  5KHD A;  1LNW A;  3DPT A;  4D7M A;  1ZRE A;  1YIO A;  2L3D A;  1FIA A;  1TQI A;  2D2W A;  1P2F A;  4DOZ A;  4A5N A;  3IL2 A;  3I55 I;  3VYU B;  5BPD A;  2EFP A;  2V1N A;  3IH2 A;  3OR1 C;  3ZGK A;  2MBF A;  4E7I A;  3KIO A;  4C2M J;  1W36 D;  1J0R A;  5DM6 F;  4EJO A;  5J8F A;  2BHZ A;  2Z5U A;  5GAG J;  1MDM A;  1IUY A;  2MLG A;  5EG0 A;  2AS5 F;  4IKF A;  1BIB A;  4DW6 A;  4RAZ A;  2P6T A;  1OR7 C;  5KK1 A;  2CG4 A;  3LSP A;  1IXC A;  3CDI A;  5LBQ A;  4KYW A;  2EIK H;  3CC4 I;  4EV0 A;  2KLO A;  3S15 J;  4BBR J;  4BU2 A;  1V5F A;  1Z21 A;  1MMS A;  5K5O A;  2BY1 A;  1IXS B;  3FXK A;  3A02 A;  1K78 A;  5TGT A;  1IRF A;  1UCR A;  3G73 A;  1O57 A;  4EQQ A;  2DQL A;  4CUG A;  1TWF J;  1BA5 A;  2ICW G;  2PX9 A;  2R7S A;  2ZME C;  2MA3 A;  4NDL A;  3CCJ I;  5LHI A;  1S5L C;  4KFC A;  1YS6 A;  1X4P A;  4PGH A;  2CUF A;  1ETK A;  5IP9 J;  3H5R A;  3PUB A;  3M8J A;  4B1R A;  3JTH A;  4GO1 A;  3A0B C;  2XB5 A;  4G94 A;  2QSH X;  1WZ2 A;  1Y39 A;  4F7Z A;  5LD2 C;  3WOD F;  4U0V A;  3S3O A;  3FZV A;  1R4N B;  3DFG A;  4HG2 A;  3OMY A;  4XOR A;  1VND A;  2OF7 A;  3U9G A;  2R7F A;  2OUM A;  2PLY A;  2B63 J;  2WY7 Q;  3MQ0 A;  3CF5 F;  2MYS A;  2L54 A;  3E3V A;  3PIO F;  3MZY A;  3KEO A;  4RAG A;  4IHT A;  1DP3 A;  1TP4 A;  2VC1 A;  1C0W A;  2JVG A;  2D45 A;  4LK1 F;  2KRH A;  4BY7 J;  3GO5 A;  3GTJ J;  4V2G A;  3QP5 A;  4OMZ A;  3EDP A;  1SD5 A;  2KPM A;  1USS A;  2EZI A;  2KFD A;  1WH5 A;  3QAH A;  3T1B A;  3ZN0 A;  4CZZ A;  3V8L A;  2VBY A;  3QU3 A;  1GT0 C;  4LG0 A;  1TWA J;  4DYC A;  3PQK A;  2DFI A;  4M3F A;  5HLH A;  5L3F A;  1HF0 A;  4C3I J;  2R92 J;  4BE0 A;  4Y15 A;  1HDD C;  1D1C A;  1KYZ A;  4PFO A;  3HC7 A;  5E3M A;  4IHX A;  3JSP A;  4FCY A;  2K3F A;  4XQF A;  2Q2E B;  4EM0 B;  4LGW A;  4HAM A;  4MFE A;  3RZO J;  5K7F A;  2CYY A;  4JBA A;  5FKN A;  2A6T A;  2IW5 A;  3DKW A;  5JLW A;  3E7L A;  1K6Y A;  2CW0 F;  3OV8 A;  1ZLJ A;  1KZH A;  3L2R A;  1AHD P;  1ZLK A;  1IDY A;  3VPR A;  2VT2 A;  4NQW A;  2WWY A;  2IAI A;  4LG0 B;  4ENM A;  1I6H J;  2E2J J;  3U1K A;  5LGT A;  2JSC A;  4RB0 A;  1ZGA A;  2KZG A;  3HGY A;  2DOA A;  3ZQI A;  2EBI A;  3GFL A;  2DBB A;  2EIJ H;  3C3W A;  1VF9 A;  5E3N A;  1CF7 A;  5CVJ A;  3RDI A;  4EJV A;  4HDV A;  1IJW C;  5J6X A;  4IX7 A;  4HYE A;  2DOF A;  1REP C;  3PQJ A;  4JX5 A;  4X1E A;  4BHC A;  1DUX C;  2DT7 B;  1IV6 A;  3F8B A;  4HV6 A;  2RDP A;  4XM3 A;  1DGW Y;  3R60 A;  1QVT A;  5CVV A;  3CC7 I;  1OYW A;  4ESF A;  1AKH B;  2W24 A;  5IT9 Z;  5FLV A;  3FMS A;  2HQR A;  3CJQ B;  1UJ8 A;  2K27 A;  1UHW A;  1PP8 F;  2A3S A;  1P4A A;  2VKH A;  3BQY A;  1XG1 A;  2CQ7 A;  4A0Z A;  3MKW B;  2V9P A;  1W0T A;  2GM4 A;  3OYE A;  1JUS A;  5GAH J;  1ZQ3 P;  3B6A A;  2EIL H;  3P9K A;  2VT3 A;  1JT6 A;  1ORK A;  3ZMU A;  2L7K A;  2PMZ N;  4B48 A;  1W7P B;  1MGT A;  1SAN A;  3C18 A;  1W7P A;  3LSK A;  5IP7 J;  4IVN A;  1NH3 A;  3CCM I;  2DU9 A;  3HL2 A;  1O7F A;  4A12 A;  4XLP F;  3F8N A;  3KP6 A;  4EJT A;  5CKT A;  1XMX A;  5E3O A;  2IJL A;  5FRM A;  2H8R A;  2XAG A;  4AID A;  1UB9 A;  2GWR A;  2D1H A;  3K1P A;  4PDK A;  1KON A;  2FD5 A;  3RPU A;  3SQN A;  5H20 A;  4HSR A;  2WV1 A;  4PGG A;  2CV1 A;  4AM3 A;  3GYH X;  2O0Y A;  4XKC A;  2QEX I;  2A5W A;  3QYB A;  1Z1D A;  4S05 A;  2EFW A;  2F6C A;  3OS0 A;  3I4M J;  2K9Q A;  1FWZ A;  4R79 A;  3CCQ I;  5D5W B;  2E34 A;  3S93 A;  3CP8 A;  4II2 A;  1JKQ C;  1B59 A;  1W4M A;  2ESN A;  4A2U A;  4DBQ A;  3J80 K;  5J1U A;  2K7L A;  3RPU D;  3LSI A;  3H9G A;  5FFX A;  1QGP A;  1FEX A;  2QLZ A;  1MMG A;  4XR6 A;  4GYG A;  2E1C A;  4NC7 A;  4JK1 X;  3QPL A;  2X6X A;  1T0F C;  5HNH A;  3ULQ B;  1A6I A;  4AIH A;  4LB5 A;  2IA2 A;  1U2W A;  2XAJ A;  3GFM A;  3RKX A;  1UFM A;  2E7X A;  2RV8 A;  2W82 A;  3RZD J;  3SFZ A;  2H1K A;  2FQ4 A;  2EIM H;  1IAW A;  4G8X A;  2R7X A;  3VYR B;  3RQ4 A;  2HTS A;  1YFH A;  1Z05 A;  2X4H A;  4HEA 2;  4XLC A;  1X3Z B;  3SFI A;  1LPQ A;  3Q3S A;  1ZEL A;  1MSF C;  2CO5 A;  3E5Q A;  2G0E A;  1O3S A;  1XB4 A;  3J7A Y;  2VQC A;  4G7H F;  2MG4 A;  2MSY A;  2VKV A;  5FGM A;  1R1U A;  2MC4 A;  2A69 F;  1HKT A;  1ZG5 A;  3AFH A;  3ZN1 A;  2XF7 A;  4UXN A;  3ZQL A;  4LIT A;  1XGS A;  3TW7 A;  3F8F A;  2IGO A;  1FY7 A;  5EGO A;  2DDA A;  3FXO A;  3A0H C;  3ZQG A;  4OAY A;  2I8D A;  2L01 A;  3HRS A;  3ERE D;  2XF5 A;  1SVO A;  5EEG A;  4IHV A;  2RQP A;  1EH7 A;  3BTJ A;  3U1D A;  2X6W A;  3CCY A;  1T95 A;  3EUH A;  3SDG A;  1YX3 A;  3JRI A;  5HVQ C;  3BOQ A;  3GFI A;  2XRL A;  3K7A J;  1A5J A;  3BPV A;  3G2B A;  3E6C C;  4MTE A;  3S16 J;  3BG6 A;  3FHZ A;  1JJ6 C;  2PQ8 A;  2OC6 A;  2NVX J;  1KA8 A;  1EH8 A;  2P4W A;  3T8R A;  2YU3 A;  2JT1 A;  5HOD A;  1NK3 P;  2YUS A;  3L2W A;  1CF7 B;  1JTX A;  5HLG A;  2DOD A;  1R9T J;  1ETQ A;  3TP3 A;  3I58 A;  3WGI A;  2VOD A;  4HNT A;  2CU7 A;  1A35 A;  3FXM A;  2QM3 A;  4UVC A;  5DUK A;  3GTQ J;  1YYV A;  1ETX A;  5J47 A;  2XGD A;  2KIU A;  3CP2 A;  3DF8 A;  4IHS A;  4UB6 C;  4MGR A;  2ZXH A;  3CTA A;  1G6N A;  1KQ0 A;  4ZZL A;  1AA7 A;  2KIF A;  2M3A A;  1MJB A;  2XAU A;  1F4K A;  2DI3 A;  2PI0 A;  1BR4 A;  2P0W A;  3GLL A;  1H89 C;  2XC7 A;  5F1J A;  4U0W A;  2OV7 A;  4LD5 A;  3SJM A;  5LEK A;  3IC7 A;  4Q5S F;  1IRX A;  3LA3 A;  2R5Y B;  3WG7 H;  4FQG A;  3ZOB A;  1RES A;  1ZYR F;  4HPQ A;  3HXL A;  1WGX A;  3MMY B;  3OS1 A;  5AIQ A;  4I0B A;  4KT5 C;  4AVP A;  4V19 K;  5FO5 A;  4UUV A;  3WTV C;  2QQB A;  2P8T A;  3QYF A;  3R6S A;  4MFD A;  4ENN A;  5FKM A;  2WB1 A;  3CMM A;  5DYM A;  5LGN A;  2H09 A;  4IQ4 A;  1ERD A;  5KAF C;  4HRI A;  3R0A A;  1K4S A;  1R22 A;  4NQW B;  2HEO A;  2Y9Y A;  2A6E F;  4AWX B;  1IRZ A;  5FRN A;  1HDP A;  4Q48 A;  3PNY A;  4M3G A;  3QWL A;  5E8G A;  3ELK A;  2PMZ A;  1YO5 C;  2OJE D;  1HKS A;  2E1O A;  3HPH A;  4RGX A;  2LFB A;  2NS7 A;  2ELJ A;  2VJ5 A;  2OQG A;  2O7O A;  3QOD A;  1W7P D;  1S9H A;  1FNN A;  1BOA A;  3HSF A;  4ZYH A;  3LOC A;  1N78 A;  1V4R A;  2L02 A;  1A36 A;  2W7N A;  2FSW A;  4L9J A;  4LOC A;  3HOZ J;  3RIR A;  1E0E A;  3RCO A;  4M72 A;  2LKP A;  3RYP A;  3BZK A;  4F55 A;  4XRF A;  4BNC A;  4MQ9 F;  4KIS A;  1GHC A;  1E3P A;  2CH0 A;  2L2O A;  4XLA A;  5GTI C;  2XUB A;  3MKY B;  3AG1 H;  3S1R J;  4V2F A;  4HA8 A;  2OQR A;  2HVQ A;  1ITY A;  1TT0 A;  3TOB A;  1XX5 A;  2COM A;  5CQE A;  4FET A;  4DYQ A;  2IPQ X;  2YR2 A;  4ABZ A;  4EGZ A;  4BDY A;  5HS8 A;  1KU7 A;  2DJI A;  1W0U A;  1X4O A;  3SZP A;  1HA8 A;  5JHF A;  2CFO A;  2UUZ A;  3DBL B;  2M8E A;  3OS2 A;  2K9N A;  1NTC A;  5FD6 A;  2RRE A;  3ECH A;  4E7Z A;  3VSK A;  3ABK H;  1P6R A;  1FT9 A;  3K2A A;  3CZ6 A;  2L4A A;  3HB9 A;  1D1A A;  1D3Y A;  1OCZ H;  1V5E A;  4A6D A;  1AOY A;  3A01 A;  2TCT A;  5GAD J;  3AG2 H;  5B1A H;  2Y9Z A;  4CXF A;  5FLX Z;  3OYG A;  4QSH A;  5J8C A;  3E6B A;  5IOZ A;  1IG7 A;  4U7B A;  2JUG A;  4JQF A;  4XN0 A;  3P9C A;  1OJL A;  2IGM A;  1GV2 A;  1QZZ A;  4F91 B;  1XSV A;  2R0Q C;  2YPR A;  3LSJ A;  3QOP A;  1MKM A;  1T2K A;  4N0B A;  3JRC A;  3AAF A;  1T8I A;  2FUG 2;  2ME0 A;  4WXC A;  2QYO A;  4BH9 A;  3ABL H;  4C2T A;  3H92 A;  1JKR C;  1ONV A;  5KNL A;  2QCO A;  3M3Y J;  2JA7 J;  3RI4 A;  2EB7 A;  3WTY C;  5AON A;  1R6R A;  3BG9 A;  3JRG A;  4YIF A;  2IS6 A;  4GYI A;  2ISY A;  3L2C A;  2HQ5 A;  1Z77 A;  2UXX A;  4GCV A;  2P5L C;  4JP0 A;  1MSE C;  1GXP A;  1R36 A;  3L1P A;  2ADU A;  2JQ7 A;  4A3D J;  5E17 F;  4IPA A;  3EUA A;  2RNG A;  2DDB A;  3DLA A;  5JVT A;  4N4N B;  4BAY A;  2VL8 A;  2V9K A;  2WA0 A;  1WJA A;  2M87 A;  2MGQ A;  1R4M B;  3I71 A;  1YTY A;  2KRF A;  1TW3 A;  2V9V A;  1A31 A;  2EZH A;  1G3Y A;  4JYK A;  1D5Y A;  1R7J A;  3LWF A;  2M7B A;  1YW9 A;  2X1C A;  3BCB A;  3CCR I;  2XIG A;  4L5I A;  4D9J A;  2CGP A;  4BE2 A;  1K7A A;  1Y8Q B;  2BY0 A;  3H3U A;  2PEX A;  2LVS A;  2CJJ A;  4WWC A;  4A93 J;  4DZJ A;  3LNQ A;  3REO A;  1F43 A;  5TJJ A;  3S3N A;  4G6T B;  3K69 A;  4LJZ F;  4IRI A;  4OAZ A;  1LFB A;  1G3W A;  5J3L A;  3JRB A;  3DU6 A;  4DZP A;  2IXS A;  3SDB A;  1V54 H;  2MFZ A;  4BQQ A;  1MJA A;  1R5H A;  1UZC A;  2F5D A;  3PNT A;  2CQK A;  2CQQ A;  2R93 J;  1YJ9 I;  1E17 A;  1FMV A;  3FBI B;  1M1E B;  4MHG A;  4ZJZ A;  2ZFU A;  1PYV A;  4MQV A;  2BVM A;  1SFK A;  4U7D A;  2LTP A;  4G6Q A;  2GIV A;  4NNJ A;  3K0L A;  5L3D A;  1EF4 A;  4OIN F;  2E1M B;  3HUG B;  4IF4 A;  3FM5 A;  3NEU A;  5EYR A;  1VQL I;  3BJA A;  1RRJ A;  1G3T A;  2LLK A;  1ETY A;  4W1U A;  2JUC A;  1FZP B;  3LSG A;  1FYK A;  1WJ5 A;  3K70 D;  1XDS A;  2KJB A;  2LK2 A;  3DEU A;  1T39 A;  5E8I A;  3ZQH A;  1QBJ A;  5J1R A;  4BE1 A;  2P81 A;  3HBL A;  3VOE A;  1PUF A;  3G1L A;  4J19 A;  2ZCW A;  3D0S A;  1YQA A;  4H4K C;  4O5V A;  5FD5 A;  5GP9 A;  2OCE A;  4BEH B;  3CMA I;  3PIP F;  5EEA A;  3ECO A;  3IWF A;  2GA1 A;  4RLF A;  2NOG A;  3LQR A;  2I5U A;  1RUO A;  4Y7N J;  1YJN I;  5EZH A;  4YFX F;  2HU9 A;  2XGC A;  2PG4 A;  1A04 A;  2R7V A;  4E7S A;  3L2U A;  3B73 A;  4LIV A;  2VJJ A;  2OPT A;  2ID6 A;  4F3Q A;  1TQP A;  4N9I A;  2BEO A;  2Y69 H;  2JTV A;  2HKX A;  4LLG F;  2XPU A;  4D1Q A;  2LBF B;  3H0D A;  3HDD A;  1K78 B;  4B3X A;  5LRR A;  3KE2 A;  4UUS B;  5AIP A;  1FLI A;  2DTZ A;  3T8T A;  4FIS A;  1G2H A;  1FP2 A;  3WU2 C;  2O61 A;  3S1Q J;  2OTL I;  3P7N A;  3IKT A;  2YU9 J;  1SFU A;  4BXU A;  3LA2 A;  4P5O A;  1K79 A;  2O3F A;  4RMN A;  5IPA A;  4XRS A;  2VAS A;  1MH4 A;  1RPW A;  3M9A A;  3WGG A;  2UZK A;  4A6E A;  4MIM A;  4EJW A;  3JW4 A;  3F3X A;  4HLX A;  4NBQ A;  4B3A A;  1MJ9 A;  1MND A;  1QHG A;  4IHW A;  3WTX C;  3NWS A;  3S32 A;  2GOM A;  1MW7 A;  4A3M J;  4L5E A;  1BL0 A;  1Z67 A;  4FHT A;  4YIR X;  1VQ5 I;  3PO2 J;  3OYD A;  3M4O J;  4CDG A;  3H9Q A;  3IAS 2;  3PO3 J;  3QPH A;  5LHG A;  3BR2 A;  3BR6 A;  1MBH A;  1SMT A;  2NAZ A;  5F6F A;  3L2V A;  4CCJ A;  2LD5 A;  3VDX A;  3A01 B;  2KJC A;  3QPT A;  2JJ7 A;  2TRT A;  4M6X A;  3GTL J;  3HSR A;  4X0G A;  5C4J J;  5D8L B;  4EVI A;  1SD4 A;  4A3K J;  2HPI A;  1ACI A;  3MZ8 A;  2XSJ C;  1LKX A;  4ASN A;  2GXB A;  1J9I A;  1WRJ A;  2CUZ A;  2DA5 A;  3LAJ A;  3G6E I;  3FXR A;  2ZNZ A;  1SD6 A;  4CCL A;  5FKL A;  1B8I A;  3HTU A;  4KIB A;  4I02 A;  4IRG A;  3I5U A;  1VTN C;  1B8I B;  3T5X A;  2CSO A;  1ZAR A;  3RKY A;  4CZC A;  5ICC A;  1Q1H A;  1GDT A;  1S29 A;  3CJN A;  2LYC A;  4KT6 A;  5ED4 A;  3WTS C;  2P5K A;  5JI6 A;  2DT6 A;  3F23 A;  3GW2 A;  1FJL A;  4RDU A;  1U0J A;  1P7I A;  5A2Q Z;  2FA5 A;  2LH9 A;  5CJ9 A;  3HOT A;  3H0G J;  5IYC J;  3X2Q H;  1DDN A;  4BXX J;  3HUG A;  2CWE A;  3D1N I;  3G4S I;  3GXO A;  5IYD J;  5FLX K;  3S17 J;  1RNL A;  1BJA A;  4OIR F;  2V1U A;  4OIO F;  1FIP A;  4UVB A;  1DP7 P;  2FF4 A;  2AHQ A;  3WTW C;  3GLX A;  2EV5 A;  2X48 A;  2FNA A;  3DPL C;  3M8F A;  2HOA A;  1OMI A;  1WHU A;  2G7H A;  4ZYA A;  3FXJ A;  1TNT A;  1MBG A;  4S0H B;  1X3U A;  3JRF A;  2K9M A;  2GIZ A;  2R7W A;  4M9S A;  3GTM J;  3EUK L;  4CYD A;  2NVU B;  4PJN A;  2DFE A;  3RKQ A;  3CDH A;  1G8X A;  1O3R A;  4I09 A;  2JZY A;  2OD5 A;  3MN2 A;  2JMW A;  3KCC A;  4CSW A;  1WI3 A;  3LMM A;  1JTY A;  1XMK A;  3M7G A;  5DUI A;  4HLY A;  2ELH A;  2HPM A;  1FOY A;  5HDN A;  3KLN A;  1FPQ A;  2DQR A;  1BR1 A;  4DBR A;  1U3E M;  3LSM A;  2Y75 A;  1VI0 A;  2ESH A;  1XPX A;  2JA8 J;  4XON A;  3ZPL A;  5ERI A;  2PMH A;  3I64 A;  2IVM A;  3GME A;  4L5J A;  1F1Z A;  2OBP A;  2VQG A;  2XVC A;  2K5C A;  1APL C;  1VQ6 I;  4LFU A;  2V4J C;  4HW0 A;  2M0M A;  4ZC3 A;  1FOW A;  2LY9 A;  2MD0 A;  3ESW B;  2ECB A;  2W00 A;  2FQ3 A;  2E7W A;  2XPW A;  5EF6 A;  5H2F C;  1LVK A;  5GAE J;  1XD7 A;  2A5Y B;  1QU3 A;  1LFP A;  4A3L J;  2X6O A;  3OIQ A;  1J75 A;  2XPV A;  3T0Y A;  1X58 A;  3HOS A;  4E7H A;  2F5F A;  3HJE A;  2FE3 A;  3B02 A;  2M30 A;  4U87 A;  5LHH A;  1FSH A;  3IKV A;  3OOU A;  3GUD A;  1CQT A;  2VLA A;  2HYG D;  4IEJ A;  1TZL A;  3KLO A;  2H27 A;  1FBU A;  3CQZ J;  2Y0S A;  3FMR A;  3Q9S A;  1LFU P;  3P9I A;  4F92 B;  1KQ8 A;  2OAZ A;  3S14 J;  3M1C A;  3WE3 A;  4AC0 A;  1DU6 A;  2L0K A;  5FKO A;  2QQ9 A;  1YRN A;  2K4J A;  1MIJ A;  5K5Q A;  1HLV A;  3QYE A;  2OZU A;  3F8M A;  4C3J J;  4HBL A;  4A0Y A;  1WJD A;  2DN0 A;  3WTT C;  1Y0U A;  1EJ9 A;  2PN6 A;  4I99 C;  2LF7 A;  4B47 A;  4HNV A;  2VE8 A;  3ZMS A;  3C2H A;  1I1S A;  1TWH J;  4XNF A;  2ZC2 A;  5C44 J;  3DQV C;  3W6K B;  4W97 A;  2LG4 A;  2QBY B;  2MC3 A;  2CQX A;  3RTR A;  1IV8 A;  1IZ1 A;  1IGN A;  3E5X A;  3PSI A;  2VJ4 A;  2G9W A;  4AYB A;  2VBZ A;  2HZT A;  3PFY A;  4BXF A;  5EZG A;  3JCU C;  4WX9 A;  2RGV A;  2B9S A;  3HRM A;  4I6Z A;  3KFW X;  5DD4 A;  5DCM B;  2PMU A;  1F9N A;  2XGE A;  1MMA A;  1R1V A;  4HX7 A;  4E70 A;  3BTC A;  2Z33 A;  1VQ8 I;  2PBI A;  3TO6 A;  4BBS J;  2QF7 A;  4XK4 A;  4ANJ A;  1Y0N A;  4XIC A;  2R7U A;  2EIN H;  3DPU A;  4KIC A;  4N4O B;  1YS7 A;  5M3F J;  3N05 A;  3RPQ A;  2LC2 A;  3W2V A;  5JR3 A;  4PJJ A;  3OYA A;  3CJR B;  4GXO A;  1ZH5 A;  5HLI A;  4CHU A;  2E35 A;  2HTJ A;  4Z2Y A;  3A4C A;  2FU4 A;  5KVR A;  5BPI A;  1QZE A;  2ZXI A;  5EEH A;  4ZDL A;  1SEU A;  1WQ2 A;  3GEZ A;  2Y0M A;  4PSX A;  2KIS A;  2BXY A;  3QRF F;  1P4W A;  3E0J B;  5JHU A;  4O6J A;  2ID3 A;  4OOI A;  3FXL A;  1FTZ A;  2DMN A;  4PK4 A;  1T33 A;  1BN5 A;  1IUF A;  3DEE A;  1QA6 A;  4QPQ A;  4BQN A;  2JPC A;  2M4K A;  1UMQ A;  2AXT C;  1S3J A;  2X1D A;  4B8X A;  5E1W A;  4F52 A;  4RB3 C;  4PCQ A;  2F2E A;  1ZRD A;  2WAQ N;  2HYF A;  1ON2 A;  2WTE A;  2ME6 A;  1QVU A;  2DJN A;  1NHA A;  5E79 C;  2YX7 A;  4A3G J;  4A5M A;  3IRQ A;  5TRD A;  3ABU A;  3BPX A;  2AXL A;  3VFZ A;  4DGW B;  2DPD A;  3F6O A;  2VXZ A;  3MEX A;  4PJ0 C;  2F5E A;  3BG7 A;  4YEL A;  1IN8 A;  3CMY A;  1DGR M;  1N75 A;  1KGS A;  4ZYE A;  4AUX A;  1K4T A;  3JRA A;  1EH6 A;  3FXQ A;  4UV9 A;  4WK8 F;  1WI9 A;  5D4S A;  2Q0O A;  1R5G A;  2DA3 A;  5LGU A;  3HOX J;  2WAD A;  2PJR B;  3WU1 B;  4BDZ A;  4EM2 A;  3RSN A;  1EA3 A;  2M34 A;  2A6H F;  1D0Y A;  2FBH A;  1O3T A;  3V7S A;  1ETV A;  1SMY F;  2HNH A;  3BR1 A;  1V55 H;  1TWC J;  3TP0 A;  1RR8 C;  1L0O C;  1ODD A;  3KP5 A;  1OCO H;  4M74 A;  2BY2 A;  2MLK A;  4NUB A;  2KP6 A;  2E1M C;  2V1X A;  1VQ4 I;  4QTR A;  3TO7 A;  2DA2 A;  4G12 A;  5H6Q A;  1MMN A;  3V8J A;  3BDD A;  1ENH A;  3J81 Z;  4M9X A;  4BGD A;  2UV1 A;  4N9H A;  4XSZ F;  2O6G E;  3S2D J;  2EZK A;  2UXN A;  2F4M B;  1XC5 A;  3GX4 X;  3WHC A;  1V3F A;  2EQR A;  2E1N A;  2R3S A;  1KU2 A;  3Q0V A;  4J00 A;  3R4K A;  2LMD A;  5E1Z B;  1ZHF A;  1OQY A;  2R5Z A;  1J5Y A;  2LOO A;  2K85 A;  1MDM B;  3H3V K;  3CUQ B;  2DK5 A;  4HDU A;  4P9F A;  1Z6T A;  1FX7 A;  4LK0 F;  3MVP A;  2R5Y A;  4AIJ A;  3C7J A;  3E1S A;  4HX8 A;  2JRT A;  5L3B A;  2JRM A;  2W57 A;  4G7Z F;  5BQT A;  4EJU A;  1SAX A;  2FML A;  4P1W A;  3ZP5 A;  4MTD A;  5DDG A;  4KMF A;  3BC8 A;  2V6C A;  3AG4 H;  4CGZ A;  3TGN A;  4RS8 A;  1S6L A;  4QLC U;  3VYT B;  4XRS G;  2COB A;  2ZB9 A;  1VQK I;  1O7L A;  3M07 A;  1U5T B;  1ZTR A;  3HEF A;  3K2Z A;  1VFC A;  3FXU A;  2DA6 A;  2BV6 A;  4NHJ A;  3HGG A;  2E19 A;  1STZ A;  2NS0 A;  2RKH A;  1IDZ A;  4E7J A;  1IN5 A;  2E36 A;  1X1P A;  3E6D A;  4A3B J;  3F22 A;  4FT8 A;  3GTO J;  3I56 I;  3ASO H;  3H36 A;  5J4V A;  3ZMT A;  1VQP I;  2K86 A;  1WJB A;  3WGH A;  5J1Y A;  3J80 Z;  3UNG C;  4BS9 A;  4S04 A;  3QPS A;  2DYS H;  2WBM A;  2XSD C;  1FP1 D;  4AIK A;  4A3J J;  4AD9 A;  1IW7 F;  1FBS A;  1GXQ A;  4KN4 X;  4L0Z B;  2VN2 A;  4ENJ A;  4CYC A;  3MFK A;  4DJA A;  1I27 A;  3JAM K;  5DEQ A;  4A0X A;  2X51 A;  3N4M A;  1JXS A;  2QGU A;  3FIS A;  3OYK A;  3BY6 A;  4XBF A;  3H9J A;  2CV2 A;  4C9Y A;  3W3C A;  2LF8 A;  4L9V A;  4Y52 J;  3LSH A;  5JVG F;  3C2G A;  2DMU A;  2LDU A;  2IRF G;  1G3S A;  3L7W A;  2P5V A;  4X6A J;  3A2K A;  2WY8 Q;  5B5E C;  4YG2 F;  4P9U A;  1UG0 A;  2K02 A;  5K7H A;  2E5Z A;  1MBJ A;  1Z3X A;  1X1C A;  2BGC A;  2VBX A;  2Q8K A;  5F0H A;  5D6E A;  2DMT A;  2VQH A;  1B6A A;  5FB2 A;  4C3H J;  2GQQ A;  3F8C A;  5DTD A;  3ZQQ A;  4KMU X;  1R1T A;  2BZT A;  3BR3 A;  3EQL F;  3M8E A;  3AKZ A;  3Q9V A;  1ZR2 A;  2O8X A;  2E2H J;  4YFN F;  3G3Z A;  1FC3 A;  1HOM A;  3DKY A;  5FKK A;  2AO9 A;  3JRD A;  4HST A;  3V42 A;  2X9D A;  2GA2 A;  1JHH A;  1JI8 A;  4WXD A;  3KEQ A;  4P55 A;  2VKD A;  2R7Q A;  1ZRF A;  3HOU J;  2Z99 A;  2Q2E A;  1UHM A;  4BAC A;  4RM2 A;  3CF2 A;  1P92 A;  2W4S A;  2Y31 A;  5M3M J;  2ZJP F;  1B4A A;  1PVE A;  1YE9 A;  5FLM J;  2OTJ I;  1BC8 C;  3BZC A;  1JGS A;  1SAU A;  4P96 A;  3CJT B;  3H5A A;  2D1V A;  1PUF B;  2L7F P;  3PL8 A;  1IXR C;  2PJP A;  1OCR H;  1RIO H;  3MKL A;  1WH7 A;  4C30 A;  2A61 A;  2LKX A;  2WAQ A;  4G7O F;  2J5O A;  2MD5 A;  3K4K A;  3KZZ A;  2RNJ A;  5C4X J;  3OYF A;  3FKI J;  3FK7 A;  3IH4 A;  3H5N A;  1MBE A;  1LDJ A;  2F4O B;  1Z7U A;  4RAY A;  2NVT J;  3K6G A;  2NRA C;  1AKH A;  3OR2 C;  1UAA A;  3UKG A;  1GLN A;  3NAU A;  1D0Z A;  3K4B A;  1YIT I;  2A07 F;  1TLH B;  2GXA A;  1GUU A;  1YG2 A;  2GXG A;  4KDP A;  2FMY A;  2TDX A;  1EKE A;  3VEP A;  2KRC A;  1ZGJ A;  1QRY A;  2QUF A;  1FYM A;  1DPU A;  2VON A;  3FIW A;  4XOT A;  2BY3 A;  2O9L A;  4ETS A;  3OOP A;  2QZ8 A;  5ICG A;  5JLX A;  4BY1 J;  2F5C A;  2IT0 A;  3CC2 I;  5BS6 A;  4PUS A;  1HBX G;  2X0L A;  2FOK A;  5ILV A;  4XLE A;  3FMQ A;  3E5U A;  3HOW J;  4CCN A;  1HKQ A;  2IEK A;  3AG3 H;  4LMY A;  4RB1 A;  2K9S A;  5D5V B;  4L9T A;  2LSO A;  2EV6 A;  1LE8 A;  2NVQ J;  1HCR A;  3OYI A;  4FE7 A;  4M3D A;  1I3A A;  2EFQ A;  3CCE I;  1ETO A;  2KDO A;  3S1M J;  3FDY A;  3BG3 A;  1H8A C;  3K4M A;  1WVR A;  1XSD A;  1U9O A;  3HM5 A;  1BI1 A;  2IGN A;  2X6Y A;  3I4N J;  5J40 A;  1OCT C;  1ZGW A;  2H6C A;  4HQM A;  3ZQC A;  4HOB A;  3OSG A;  1SVM A;  4M6V A;  2BXZ A;  4PJL A;  1NG7 A;  3CUQ C;  3OYM A;  2F48 A;  3BT9 A;  4PJM A;  1TW2 A;  5ICE A;  2JA6 J;  5LLQ A;  3F6V A;  5BMZ A;  1MBF A;  3RYR A;  4QPO A;  1IF1 A;  1ON1 A;  2L9N A;  5L3G A;  4Y13 A;  1U8B A;  2MAB A;  1LDD A;  4TV7 A;  5IOY A;  4HNU A;  1MMD A;  2GAU A;  4LG3 A;  4ZTF A;  1LUJ B;  5M5X J;  1IN4 A;  5CPR B;  1DU0 A;  2HDW A;  4I76 A;  4M3B A;  2CW8 A;  2QQA A;  3S2H J;  1HST A;  4PZJ A;  4ZH4 F;  3QOE A;  4GFB A;  3DCF A;  5F1R A;  2XDV A;  2LKS A;  1OLT A;  1HW1 A;  1YOV B;  3K10 A;  2STT A;  2H94 A;  2KT0 A;  1H88 C;  5K1Y A;  2DMQ A;  2H6B A;  3DV8 A;  4KNY A;  1K6O A;  1IO2 A;  4ENK A;  2PFB A;  2XAF A;  3PJR A;  3HKZ N;  1IC8 A;  1D1B A;  1FOK A;  3QP6 A;  2DA1 A;  4IJA A;  2XHK A;  3TDU C;  1K83 J;  2KDZ A;  1NG6 A;  1UHS A;  3NWT A;  5B1B H;  1U5T A;  1BJZ A;  2NOJ B;  2W84 A;  3Q0W A;  1W5T A;  1P7J A;  1LB2 A;  1G59 A;  1H9T A;  2NS8 A;  3HRT A;  2JPB A;  5B3S H;  1LEA A;  2CW7 A;  2VE9 A;  2V6E A;  3VWB A;  3RJP A;  4RM3 A;  2F5V A;  2XAS A;  4HF2 A;  3ZMD A;  3DBR B;  1LDK B;  3FWE A;  1EV7 A;  5EDN A;  2LR8 A;  2MW8 A;  2HDD A;  3B6C A;  5CYV A;  5LFA A;  2MH9 A;  3O3K A;  3FX3 A;  4CH7 A;  3SEQ A;  4A3F J;  3HG9 A;  4PFP A;  1POG A;  1XN7 A;  3TQN A;  3ZRG A;  1ULY A;  2BE5 F;  2M5W A;  3PSF A;  2VI6 A;  3VB2 A;  4GRI A;  2VOO A;  3LA7 A;  4NC6 A;  3VSL A;  1RR7 A;  2ZKZ A;  5JFR A;  3CCS I;  2ZXJ A;  4L0Y B;  1KU9 A;  3SEZ A;  2LP0 A;  2ISZ A;  2VUM J;  1Y1V J;  5FFZ A;  4EM1 A;  4XSX F;  2HYJ A;  3FHN A;  1T38 A;  2HQN A;  1FTT A;  1JGG A;  5B66 C;  2XB0 X;  1PP7 U;  2FJ1 A;  4OU0 A;  4F93 B;  4XRM A;  2R5Z B;  2VPL A;  2L9V A;  4FE4 A;  2DYR H;  1QPI A;  4IQJ A;  2R7R A;  5CLS A;  3OYN A;  1VQ9 I;  4MEY F;  1TL8 A;  3BP8 A;  4M3E A;  1X1A A;  2JSP A;  1PJR A;  3I9V 2;  4ESJ A;  3HHG A;  4CA0 A;  2R7D A;  3DXJ F;  1H9G A;  1Y6I A;  1S8N A;  3D5R C;  3IAM 2;  2XAH A;  2IS4 A;  4RLQ A;  2DLL A;  3BJ6 A;  4NC8 A;  2CS3 A;  4WCG A;  3HKZ A;  3I0T A;  5HOO A;  4G6D A;  3GFJ A;  4YEJ A;  1ZN2 A;  4ON0 A;  2XF6 A;  1YW8 A;  2KIQ A;  3LSR A;  5DM7 F;  3CME I;  3F9K A;  3HYI A;  1GV5 A;  2VIX A;  2CQN A;  2W1O A;  2IP2 A;  4PSW A;  5K5R A;  3JRE A;  1Z6R A;  1TC3 C;  1WFX A;  2RVC A;  1BI0 A;  4XKB A;  4DYR A;  4EGY A;  1BI3 A;  3OL3 A;  5IT3 A;  3V7R A;  2FNP A;  2HOE A;  1WKM A;  3BJO A;  1BR2 A;  1E3H A;  4QWQ A;  2F4I A;  4IHY A;  2HI3 A;  1TNS A;  2AQF A;  3N97 A;  1BW6 A;  2E60 A;  4RGR A;  2DPU A;  2BHY A;  2QQ8 A;  2L5Q A;  3DU5 A;  5ILS A;  4KIT B;  2FX0 A;  4YII A;  2QKM B;  2HQA A;  4CIC A;  2GLO A;  3WTZ A;  2EH3 A;  3I4P A;  3S3M A;  2MH2 A;  4BL0 B;  5HS9 A;  3ABM H;  2HOS A;  1MD0 A;  4O3M A;  2YSR A;  2X85 A;  1MH3 A;  3GF2 A;  1JE8 A;  4RGS A;  3S8P A;  5FJ8 J;  1LE8 B;  1HSJ A;  5D8K B;  4Y3O A;  2NYX A;  1LVA A;  5M5W J;  2H8W A;  3DP7 A;  2V1D A;  5HDG A;  5GTH C;  2QWW A;  1JUP A;  1JT0 A;  2P7C B;  4K2E A;  3V4G A;  2NVY J;  5EJC A;  2DAO A;  3G71 I;  3SZT A;  1Z7L A;  1OFC X;  2L7M P;  2QSG X;  3GWZ A;  2PJR A;  4G9Y A;  1A6Q A;  4CCM A;  2CFX A;  2OZ6 A;  3TL4 X;  1R49 A;  1WWX A;  1WJF A;  3CDL A;  2B0L A;  3IRR A;  1IN7 A;  3LL7 A;  3COA C;  3JR9 A;  3TOA A;  1TTY A;  4BUP A;  5F0F A;  1JUM A;  2EFN A;  3ASN H;  4A3I J;  3KET A;  2VKE A;  4KUM A;  3DTK A;  3IV5 A;  1R00 A;  1P4X A;  5D4R A;  5KCM A;  1U6G A;  1RUN A;  1BM9 A;  4ITV A;  4Z6Y A;  2Z3Y A;  3ZR8 X;  5GPA A;  1QQI A;  2JA5 J;  3JSO A;  4FAS D;  2VOP A;  3SHF A;  5L3E A;  3DKX A;  1MNM C;  1FMW A;  3LFK A;  3HTS B;  5E20 A;  1SVL A;  3F72 A;  2EZL A;  4ZDP A;  2JK3 A;  2IBD A;  1YRN B;  3FBN B;  5F04 A;  3J7A O;  2BVL A;  2M45 A;  2R7T A;  3K9T A;  3L2Q A;  1QO0 D;  5DD8 A;  1SD7 A;  3G1M A;  3M1E A;  1X1D A;  2V7F A;  4HZF A;  1YJW I;  2HFH A;  3HPG A;  4BYY A;  3MZH A;  2HS5 A;  1HXD A;  1BW5 A;  2L4M A;  4CO8 A;  1RKW A;  1Z9C A;  4MO7 A;  2QBY A;  2KL4 A;  1GVJ A;  3OIO A;  4XN3 A;  2HXI A;  3CD6 I;  3WG9 A;  2I10 A;  3K1N A;  3KP2 A;  3CCV I;  1W5S A;  2GBY A;  4XOP A;  3GZ6 A;  2HVR A;  3MD2 A;  2OCC H;  3HHH A;  2N8G A;  3BTL A;  4I01 A;  4MLO A;  4DNC A;  2K3P A;  1FSE A;  1OCC H;  4I2O A;  4KA4 A;  3U2R A;  2W48 A;  3CO7 C;  5H6R A;  1Y56 A;  3Q0U A;  1ZG3 A;  1YX5 A;  4LLL A;  1RC9 A;  3K4L A;  2ZNY A;  3GCM A;  4B4C A;  5CQG A;  3C2B A;  2KMU A;  1VQN I;  3V8K A;  3EUH C;  4L9N A;  5C3E J;  1SC7 A;  3IH3 A;  2ZME A;  1GVD A;  2BW3 A;  2Z2S B;  2Z1D A;  4BEH A;  4D5F A;  1I3Q J;  1YLF A;  3ZXS A;  3KP4 A;  2VPR A;  1VQM I;  2BW3 B;  2KHM A;  3LFU A;  2L7Z A;  1XS9 A;  3OYB A;  4U0Y A;  5DV5 A;  5L3C A;  4D5C A;  2ZO4 A;  3I54 A;  1LQ1 A;  5IT9 K;  4DIQ A;  2ZSI B;  1QZY A;  4XKW A;  1X2N A;  1D8J A;  1WJC A;  3MWM A;  4JX6 A;  3OYJ A;  2IS1 A;  2DA4 A;  4XLF A;  3OSF A;  2E71 A;  1KU3 A;  3BR0 A;  3H35 A;  2IS2 A;  3GVA A;  3OYH A;  2W25 A;  4H0E A;  4UY8 I;  2LNB A;  2XKP A;  5F08 A;  3K4C A;  5EGO B;  2ELK A;  1OR7 A;  1TT5 B;  3Q5F A;  2FEZ A;  5F64 A;  5LEJ A;  1SFX A;  4UUS A;  1R5I D;  5GPC A;  3OYC A;  3ML6 A;  1DQU A;  1T98 A;  2R7O A;  4R8H A;  2E2I J;  3TDZ C;  2XRO A;  2Y48 A;  1UG2 A;  1YHQ I;  2WV0 A;  2NNY A;  4MNU A;  2HVS A;  2RQQ A;  4ESB A;  1JJ8 C;  5HDK A;  1YI2 I;  3A1Y A;  1S7E A;  2KQR A;  2CV0 A;  3BZ6 A;  1R58 A;  3JRH A;  2P7V B;  2ACJ A;  4ZDO A;  3KZY A;  9ANT A;  1L3L A;  4JOM A;  3OIP A;  1OCP A;  3SZG A;  1I6X A;  3FF5 A;  4B09 A;  2Z16 A;  1HQC A;  1N77 A;  1MZB A;  3R0J A;  1BI2 A;  3NRV A;  4YFK F;  3ROU A;  1JKP C;  1S7O A;  2L9S A;  2L9R A;  4B44 A;  2R7Z J;  4D0P A;  4C2U A;  3CO6 C;  3BTI A;  1E3O C;  3IHU A;  4IL6 C;  3GTG J;  2HXO A;  3KYD B;  3ZCO A;  2G7U A;  1RKT A;  3GTP J;  2RAE A;  4BJ6 C;  2Y2Z A;  1BOB A;  3ERM A;  1X3W B;  1W1W E;  3K4N A;  4A3E J;  2DMP A;  2JN6 A;  1J09 A;  5D5U B;  1U78 A;  2WC2 A;  1T0F A;  2AQE A;  2GOX B;  2RC4 A;  3KZI C;  3R61 A;  1J59 A;  1U8R A;  4KIG A;  3WE2 A;  1PUE E;  1N25 A;  4ZYD A;  3ZQF A;  5J4Y A;  3HOY J;  2IA1 A;  3MCZ A;  3I59 B;  3LST A;  2YX4 A;  1XSX A;  4IZZ A;  4RB2 C;  2VQL A;  2HWV A;  2DTR A;  3TED A;  4LLN A;  1QPM A;  3DTI A;  1KQ9 A;  3LQQ A;  4CYC B;  4UHT A;  2HR3 A;  3UR3 C;  2NXN B;  3RKW A;  1LJ9 A;  4LB6 B;  3TO9 A;  4BHB A;  4BJT A;  2VBW A;  1VQ7 I;  4L18 B;  1T56 A;  3O2P E;  3CES A;  2IA0 A; 
#chains in the Genus database with same CATH homology
 5C4J J;  4A3K J;  2H8R A;  1GUU A;  2DA5 A;  2DA7 A;  1Y1W J;  2FD5 A;  5FKL A;  1NK2 P;  1QRY A;  1B8I A;  2WV1 A;  3NAR A;  3FIW A;  2O9L A;  1B8I B;  1GDT A;  2K9Q A;  3I4M J;  2HOT A;  4XID A;  5JLX A;  4BY1 J;  1JKQ C;  1FJL A;  4RDU A;  1P7I A;  1ZK8 A;  1WPK A;  5K7Z A;  5J1U A;  3HOW J;  5IP6 A;  3GTK J;  1FEX A;  2IEK A;  3S1N J;  3RQI A;  3H0G J;  5IYC J;  4BXX J;  2K9S A;  3WHB A;  3QPL A;  3D1N I;  1LE8 A;  2NVQ J;  3S17 J;  5IYD J;  1A6I A;  5IYB J;  1HCR A;  1Q1V A;  4FE7 A;  4M3D A;  3RZD J;  1FIP A;  1ETO A;  3S1M J;  2H1K A;  2FQ4 A;  4RBO A;  3BR5 A;  3BG3 A;  2AHQ A;  1H8A C;  2O8K A;  1U9O A;  2X48 A;  3HM5 A;  3I4N J;  2HOA A;  1OCT C;  3SFI A;  1ZGW A;  3Q3S A;  1MSF C;  3BQZ A;  1MBG A;  4S0H B;  3JRF A;  3ZQC A;  2CUE A;  2M0C A;  3OSG A;  2G0E A;  4M6V A;  3GTM J;  2MG4 A;  5EG0 B;  2MSY A;  2VKV A;  3BT9 A;  3RKQ A;  2JA6 J;  3MN2 A;  2JMW A;  1MBF A;  1WI3 A;  1JTY A;  3ZQL A;  1U8B A;  2D5V A;  3W6V A;  3TW7 A;  1ZKG A;  5IOY A;  5M5X J;  1DU0 A;  5BNG A;  4I76 A;  4M3B A;  3S2H J;  5EGO A;  2YS9 A;  1VI0 A;  3ZQG A;  4GFB A;  3DCF A;  2JA8 J;  2KT0 A;  1K61 A;  1H88 C;  4IHV A;  2DMQ A;  3BTJ A;  5M5Y J;  3CCY A;  1JKO C;  1APL C;  3SDG A;  3JRI A;  1SFO J;  3HKZ N;  1IC8 A;  2LY9 A;  2DA1 A;  2ECB A;  1K83 J;  2KDZ A;  1UHS A;  2XPW A;  3F0C A;  5EF6 A;  2XRL A;  1BJZ A;  3K7A J;  1A5J A;  3Q0W A;  1P7J A;  3S16 J;  1ZR4 A;  4A3L J;  1JJ6 C;  2X6O A;  2NS8 A;  2XPV A;  1X58 A;  2NVX J;  3OOU A;  5HOD A;  1NK3 P;  2YUS A;  1CQT A;  1JTX A;  5EDN A;  1R9T J;  1ETQ A;  2LR8 A;  2MW8 A;  4IEJ A;  3TP3 A;  2HDD A;  3B6C A;  3G1O A;  3CQZ J;  2CU7 A;  3GTQ J;  1LFU P;  1ETX A;  2XGD A;  4A3F J;  3S14 J;  1POG A;  4AC0 A;  1DU6 A;  2L0K A;  5FKO A;  1YRN A;  2VI6 A;  1HLV A;  1B72 B;  1I50 J;  1RR7 A;  4C3J J;  1H89 C;  2M9H A;  5F1J A;  3SJM A;  2DN0 A;  4FTH A;  2R5Y B;  2LP0 A;  4HNV A;  3ZOB A;  1RES A;  1TWH J;  2VUM J;  1Y1V J;  5C44 J;  3TW6 A;  1WGX A;  2HYJ A;  4W97 A;  1FTT A;  2CQX A;  2K40 A;  1JGG A;  2XB0 X;  2FJ1 A;  2R5Z B;  4XRM A;  2M8G X;  1IGN A;  1AU7 A;  4FE4 A;  4MFD A;  4BKX A;  1QPI A;  5FKM A;  4M3E A;  1WCM J;  5EZG A;  3O8H A;  4I6Z A;  2Y9Y A;  1Z0X A;  2XGE A;  4AYB N;  1IRZ A;  3BTC A;  3O8G A;  4JX4 A;  1HDP A;  4M3G A;  4A3C J;  4BBS J;  2QF7 A;  2M2E A;  4XK4 A;  2CRG A;  2E1O A;  3BG5 A;  1ETW A;  4XIC A;  2LFB A;  2NS7 A;  3LSR A;  2O7O A;  1GV5 A;  2Y30 A;  3LOC A;  5M3F J;  4EEF G;  3JRE A;  1U9N A;  1TC3 C;  5F27 A;  4DYR A;  4LOC A;  3HOZ J;  1B72 A;  3QQA A;  2Y0S N;  4IHY A;  2HI3 A;  2ID3 A;  1FTZ A;  3A03 A;  2DMN A;  1T33 A;  1BW6 A;  1IUF A;  3S1R J;  2WB1 N;  4V2F A;  1ITY A;  3DEW A;  1UMQ A;  2FX0 A;  3GBG A;  4UUT A;  4DYQ A;  4ABZ A;  2GLO A;  2WAQ N;  2ECC A;  2EH3 A;  2ME6 A;  1QVU A;  2DJN A;  1W0U A;  4A3G J;  1X2M A;  3FK6 A;  2HOS A;  1MH3 A;  2K9N A;  1NTC A;  3CMY A;  5E3L A;  5FJ8 J;  3K2A A;  4AUX A;  4A69 C;  1O4X A;  1LE8 B;  3JRA A;  3HB9 A;  1MBK A;  5DS9 A;  5M5W J;  3A01 A;  2TCT A;  2Y9Z A;  2DA3 A;  1JUP A;  3HOX J;  1JT0 A;  1TWG J;  2NVY J;  4QSH A;  4QIW N;  1F36 A;  5IOZ A;  1OFC X;  1IG7 A;  2L7M P;  2M34 A;  1OJL A;  1RET A;  5F0C A;  1GV2 A;  2R0Q C;  3CDL A;  3LSJ A;  3HOV J;  1ETV A;  3JRC A;  4D7N A;  2ME0 A;  3BR1 A;  3JR9 A;  2JWT A;  1JKR C;  1TWC J;  2QCO A;  3M3Y J;  5F0F A;  2JA7 J;  1JUM A;  3TP0 A;  4A3I J;  3PM1 A;  3BG9 A;  2VKE A;  4D7M A;  3JRG A;  3IV5 A;  2HQ5 A;  1FIA A;  1Z77 A;  4JP0 A;  4QTR A;  2DA2 A;  4G12 A;  1MSE C;  3L1P A;  1ENH A;  4A3D J;  3IH2 A;  5GPA A;  2JA5 J;  4C2M J;  3S2D J;  2EZK A;  1XC5 A;  3WHC A;  2EQR A;  2MGQ A;  1MNM C;  3Q0V A;  2EZL A;  2EZH A;  5EG0 A;  4JYK A;  2JK3 A;  2R5Z A;  2IBD A;  1D5Y A;  1YRN B;  5F04 A;  3H3V K;  4DW6 A;  3LSP A;  2LVS A;  3G1M A;  3MVP A;  2R5Y A;  4BBR J;  3S15 J;  2CJJ A;  4A93 J;  4DZJ A;  3LNQ A;  1BW5 A;  1F43 A;  1RKW A;  3A02 A;  4MO7 A;  3OIO A;  1LFB A;  2HXI A;  2I10 A;  5J3L A;  2GBY A;  3JRB A;  1TWF J;  4DZP A;  1BA5 A;  4XRS G;  2COB A;  2N8G A;  2ZB9 A;  4NDL A;  3HEF A;  1ZTR A;  1VFC A;  2DA6 A;  3BTL A;  4MLO A;  3HGG A;  2CQQ A;  2W48 A;  2E19 A;  2R93 J;  3Q0U A;  2CUF A;  1ETK A;  5IP9 J;  1IDZ A;  4B1R A;  4B4C A;  2XB5 A;  3C2B A;  2LTP A;  5C3E J;  3IH3 A;  4A3B J;  1GVD A;  4D5F A;  1I3Q J;  1EF4 A;  3GTO J;  2VPR A;  5EYR A;  1VND A;  2OF7 A;  2L7Z A;  1XS9 A;  5J1Y A;  2LLK A;  1ETY A;  3QPS A;  2B63 J;  4W1U A;  4D5C A;  2XSD C;  4A3J J;  3LSG A;  1X2N A;  4JX6 A;  2LK2 A;  4CYC A;  2DA4 A;  3ZQH A;  3OSF A;  5J1R A;  2P81 A;  3BR0 A;  3HBL A;  4BY7 J;  3FIS A;  1PUF A;  3GTJ J;  3G1L A;  4V2G A;  4J19 A;  5F08 A;  5GP9 A;  5EGO B;  2EZI A;  2ELK A;  1WH5 A;  5EEA A;  4Y52 J;  1GT0 C;  2DMU A;  2NOG A;  4UUS A;  5GPC A;  1TWA J;  4DYC A;  4Y7N J;  4X6A J;  4M3F A;  5EZH A;  2E2I J;  1HF0 A;  4C3I J;  2R92 J;  1UG2 A;  2XGC A;  5K7H A;  1HDD C;  1JJ8 C;  1MBJ A;  5E3M A;  4IHX A;  1S7E A;  4FCY A;  2OPT A;  2ID6 A;  5F0H A;  3JRH A;  2DMT A;  4MFE A;  4C3H J;  3RZO J;  5DTD A;  2XPU A;  9ANT A;  5K7F A;  5FKN A;  3BR3 A;  3HDD A;  5JLW A;  3E7L A;  1AHD P;  1OCP A;  1ZR2 A;  1IDY A;  3VPR A;  2E2H J;  2IAI A;  4UUS B;  1I6H J;  1HOM A;  2E2J J;  2DTZ A;  5FKK A;  3JRD A;  2AO9 A;  2X9D A;  3HGY A;  4FIS A;  1G2H A;  3ZQI A;  2EBI A;  5E3N A;  1JKP C;  1VF9 A;  2L9R A;  2YU9 J;  2R7Z J;  3S1Q J;  3BTI A;  1E3O C;  3GTG J;  2HXO A;  5IPA A;  4XRS A;  1IJW C;  1MH4 A;  1RPW A;  3HOU J;  1RKT A;  3GTP J;  2RAE A;  2Y2Z A;  4MIM A;  4JX5 A;  4X1E A;  4A3E J;  2Y31 A;  2DMP A;  5M3M J;  2JN6 A;  1IV6 A;  1U78 A;  1QVT A;  5FLM J;  1AKH B;  5FLV A;  4B3A A;  4IHW A;  1PUF B;  2L7F P;  4A3M J;  4L5E A;  1BL0 A;  3MKL A;  1WH7 A;  3ZQF A;  1W0T A;  3BQY A;  1XG1 A;  3PO2 J;  3M4O J;  2LKX A;  2GM4 A;  1JUS A;  3HOY J;  1ZQ3 P;  3B6A A;  3PO3 J;  1JT6 A;  1ORK A;  3BR2 A;  2PMZ N;  3BR6 A;  5C4X J;  1MBH A;  3FKI J;  3FK7 A;  3IH4 A;  3TED A;  2LD5 A;  4CYC B;  1SAN A;  1MBE A;  3A01 B;  5IP7 J;  2NVT J;  2JJ7 A;  1AKH A;  1T56 A;  3UKG A;  2TRT A;  3GTL J;  3NAU A;  5E3O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...