3BJOA

Crystal structure of the c-terminal domain of a possible atp-binding protein from methanocaldococcus jannaschii dsm 2661
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
b'SNALKDVLNILLMDEISKLKDFLSNLDYIKPKVNIEEEIIEIRKEDIINALKLFKGKYEIEVDKIPKAVYVYLVKKNILFLYPQRGTLKPQSFLVWNAIKRVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized ATP-binding protein MJ1010
publication title The structure of the C-terminal domain of a possible ATP-binding protein from Methanocaldococcus jannaschii DSM 2661.
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Nucleotide binding protein
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjoA00
3V4GA 2Z99A 3O6BB 3D0SA 2FBIA 2IPQX 3L2CA 3HTUA 3WTZA 1MD0A 2IA0A 1P4XA 2UWMA 4ON0A 5J8FA 4CO8A 1PP8F 3M8EA 1UB9A 2ELHA 4A2UA 1BI3A 2YX4A 1IRGA 2QUFA 1DDNA 1RNLA 4L9TA 1I5ZA 2HDCA 3DFGA 4LK1F 2K4JA 4G8XA 1Y0UA 4FT8A 4L9JA 2O61A 3GZ5A 4U7DA 1JHHA 2HKOA 2RKHA 1MGTA 4MEYF 4U7BA 4Z2YA 2UZKA 1ZREA 5BS6A 5AIQA 1Z1DA 1IF1A 1D8JA 5CJ9A 3BPXA 2ZMEB 2O8XA 2Q8KA 3CTAA 2D1VA 3GX4X 1KQ9A 5HS9A 2JPBA 4FHTA 1HKQA 2JPCA 1ZYRF 2W24A 5LEJA 1KU2A 3I59B 2K4BA 2CYYA 5JFRA 1R23A 5L3EA 3E5XA 5F64A 1B1BA 1TW2A 3O3KA 1ZGJA 2IJLA 2VE9A 5CVVA 2P8TA 1K78B 2HYFA 5K5OA 2BV6A 3HOTA 4P9FA 4MTDA 3DKWA 4AVPA 3N4MA 1GHCA 4AD9A 5K5QA 4R8HA 2PEXA 3TKYA 3JSOA 2PI0A 2DBBA 1SD6A 4NQWA 3HYIA 4HAMA 5LLQA 1W5SA 4XLPF 3U1DA 3C3WA 1YW9A 2PMUA 2EV5A 1U2WA 2ISZA 1U5TA 2QWWA 1DP7P 2HTSA 3Q9SA 2CW0F 2K02A 2H09A 4L5JA 1WI9A 1OYWA 1CGPA 3FXQA 4EGYA 2H94A 3R61A 1ZG1A 2HYGD 5DD8A 1U3EM 4K2EA 1WKMA 1UCRA 1J5YA 1U8RA 2HQRA 2A68F 3IC7A 3JAMK 4RGUA 3F22A 4LD5A 2O03A 5IT9Z 3KEQA 2VOOA 3NQOA 1STZA 1USTA 4O5VA 4UUVA 1X3UA 3MEXA 1BI1A 3GO5A 2M5WA 4RGSA 1ZLJA 2G7UA 2ESNA 2DK5A 1BOAA 2FSWA 2BGCA 4IXAA 5AONA 2KJCA 2P4WA 4KDPA 3HRUA 1JXSA 5BMZA 2HTJA 4Y13A 4YIFA 4EV0A 2XVCA 4ESBA 4OIRF 3CDHA 2RN7A 4U0VA 2IVMA 3DPLC 1SD5A 1LQ1A 2YU3A 1XGOA 1OMIA 5D8KB 2VC0A 4G94A 1T98A 2FRHA 3F3XA 5E18F 3HHGA 1Z05A 1RIOH 4R79A 3VODA 1QZZA 1Z6RA 2DPUA 1BI2A 1B6AA 1OKRA 2J5OA 4P55A 1Z9CA 1LDDA 3TQNA 1BC7C 1J9IA 1R1UA 3ML6A 2OD5A 3F6VA 2XAQA 4NB5A 3E6MA 2J5PA 4A6DA 2ZO4A 5HDKA 4UVAA 5DCMB 2IA1A 1J0RA 3GZ6A 1TLHB 2LSOA 4H0EA 1YS6A 1U5TB 2CG4A 1P4WA 4DNCA 3GFLA 4U0WA 3C7JA 2EA4A 3MAJA 3KP4A 3F72A 4HDVA 1S7AA 2L4MA 2NNYA 3HUGA 3GF2A 1TNTA 1KYZA 2GIVA 4UV8A 3ZMVA 1C0WA 3WTXC 4I01A 3I4PA 4Q48A 3ZN0A 3FZVA 3ROUA 1PUEE 5ILUA 1F4KA 3GFIA 3QP6A 5EEGA 1XGMA 1ZG5A 4BHPA 3ERED 2LNBA 2ACJA 5CYVA 4LG0A 4JQFA 3SZPA 2EB7A 3R0AA 2EK5A 2EFWA 2ETHA 2R7DA 3V8LA 2X4HA 3K2ZA 2FA5A 1S7OA 3EETA 5LRRA 3DXJF 3CUQA 4RGRA 2HQNA 3LA2A 4BHBA 1D8KA 4Q4ZF 3HOSA 3TO7A 2DFIA 4HV5A 2OBPA 4I7HA 1KQ8A 1SFXA 3VOEA 3GXOA 5ILSA 1ZN2A 5E1XA 2Z5UA 4RB2C 1XB4A 2YSRA 4OIQF 4RAYA 4M9SA 3GFMA 4G9YA 1L0OC 1MJAA 1PP7U 1ULYA 3F6OA 2CWEA 1G6NA 3G3ZA 1YLFA 2RGVA 4DQ2A 1DPUA 3LSTA 4EVIA 1KQ0A 4XLNF 4OIOF 3P9CA 4L18B 4D0PA 1XDUA 1R5HA 3BZ6A 4KIGA 2PMHA 4ZZDA 2D45A 2FNAA 5DDGA 5DV5A 2OZUA 2RNJA 2QM3A 4ENKA 2V1DA 5L3FA 1SAXA 4LB6B 5K1YA 5HDGA 2VONA 3TOBA 5D5VB 2L3DA 1XD7A 1FP2A 2F5FA 3T5XA 3AAFA 1Q1HA 4IF4A 3OOPA 2DU9A 3WTSC 2HWVA 1T6SA 1SD7A 3GUDA 4A0YA 4RB3C 3PFIA 4I0AA 2A3SA 4HQEA 1YQAA 4GXOA 4UNOA 2VOPA 5JVTA 2KRFA 1QQIA 2EV0A 1T0FA 4KFCA 3FF5A 3HSRA 1IUYA 4AIHA 1FSHA 4HV6A 3WE3A 1E2XA 1KU7A 1K6OA 3BJOA 3VFZA 2NS0A 1TTYA 5D4SA 2RVCA 3BWGA 1I1GA 3ZMZA 5JI6A 4LFUA 2DLLA 3WTUC 1ON2A 1HBXG 4WXCA 3R0JA 5E1WA 4P5OA 1FBQA 3ABTA 2XIGA 2QBYB 3EUHA 2QZ8A 4N9IA 2VBYA 2FOKA 4Q5SF 4M6XA 4BH9A 2QENA 2RQPA 3WU0A 3WGIA 1HXDA 2PN6A 1W7PD 1DPRA 3P9IA 2FQ3A 2VBXA 1D3YA 1FP1D 4L9VA 3O2PE 3IHUA 4MGRA 2LDUA 3RDIA 2L54A 2XGXA 3ZQ7A 1RZ4A 1G4DA 2G7HA 3WTVC 3R6SA 2L02A 4LLGF 2HFHA 3ZMUA 4NHJA 2STTA 2CGPA 2DAOA 3E5QA 3MCZA 4BAYA 1YS7A 1BBYA 5FO5A 1TQMA 2XUBA 4CZZA 2VT2A 2E7XA 3BP8A 3L7WA 2HOEA 2L01A 4MQVA 2A69F 5A2QK 2EA2A 1G3WA 4L0YB 5LHHA 4KT5C 1R00A 4EM0B 1KA8A 4ZYGA 2QVOA 3I5UA 2BEOA 2ZFWA 4HLYA 3ZMSA 2VBWA 2ZXJA 3F8BA 3FXRA 1SMYF 5HVQC 1U6GA 1L3LA 3H3ZA 4I0BA 3WGHA 1XMAA 2A5YB 3KE2A 2EFNA 5DEQA 1IN7A 3VEPA 3D5LA 3GWZA 1MDMB 3T8TA 1PDNC 2XKPA 4YFXF 4S04A 4R1HA 5L3BA 3E6CC 4HYEA 4OIPF 2OZ6A 1GVJA 4EJWA 3J80K 1ZHFA 3T8RA 2JZYA 3ECOA 3WG9A 3DQVC 4A0XA 2IRFG 3HHHA 4TV7A 4G7OF 3IKTA 1FWZA 3FMRA 3RYPA 4M71A 4UV9A 4YG2F 1R22A 3QU6A 4G6QA 3I58A 4LB5A 4MNUA 5H20A 5D5WB 1VTNC 3E97A 2XAHA 2M30A 2Q2EA 4HX7A 3HSEA 1IAWA 1IN6A 1FC3A 4LMYA 4P96A 4KIFA 5CVIA 1ZRFA 1P92A 4G7HF 2XRNA 2WTEA 4RS8A 2QLZA 5D8LB 2Z33A 2GA1A 5KVRA 2VBZA 2F2EA 4GYIA 2OQGA 4JBAA 5FLXK 2KIFA 4GCVA 3E6BA 5LGUA 4O3MA 1V4RA 4CHUA 2YR2A 4GYGA 2HEOA 2K86A 3L9FA 3QP5A 2NNNA 1TBXA 4LLLA 1HW2A 1CF7A 4HF2A 1H0MA 2PLYA 3ABUA 3M7GA 2DQRA 3DV8A 1ZLKA 5DYMA 4OU0A 4EJOA 3WE2A 1FPQA 3TOAA 1RI7A 4CDGA 1YIOA 4CXFA 3KCCA 3V7SA 4M6YA 2PBIA 1BC8C 6PAXA 1Z91A 2FXAA 4WF2A 2G9WA 1Z7UA 1HKTA 1ZRCA 1B4AA 4HA8A 4KNYA 1KGSA 3R4KA 1XCBA 1EH6A 3KETA 1HSJA 2COMA 3LFKA 3K1MA 2IA2A 4N9HA 2KJBA 4O6JA 1LB2A 4HOBA 2YPRA 2XKOA 1OPCA 4MHGA 1QZYA 4UXNA 3RIRA 1H9TA 4CICA 3ELKA 3SQNA 5AIPA 2YX7A 1YW7A 4CYDA 2DK8A 2MBFA 2VE8A 3Q5FA 1G3SA 4YFKF 2P6SA 2XAJA 1S3JA 3KZYA 3I53A 3BROA 1MJ9A 3KP5A 4M73A 1GXQA 2H6BA 1USSA 2M45A 2VT3A 3NEUA 1EV7A 3JAMZ 3KLNA 1IXSB 3GW2A 3KEOA 4KMUX 3J81K 4BYYA 5FGMA 1HKSA 1HW5A 3GLXA 1I6XA 4IJAA 3BDDA 3FWEA 1P6RA 1W7PA 1WSUA 1O3TA 2GAUA 1LDJA 5HDNA 2NRAC 2FE3A 1RUOA 3WGGA 2ZNYA 4L9NA 2AXLA 5ERIA 1EH8A 2ZBKA 1B9NA 3IRQA 1LDKB 4HF1A 1IZ1A 1A04A 2HR3A 2F5EA 3RTRA 1J75A 3IRRA 2MH2A 3L00A 2RC4A 3EQLF 5D5UB 4PCQA 4U0YA 1XGNA 4EJVA 3QU3A 3I0TA 3MZYA 1CF7B 2QQAA 3WU1B 5D6FA 4EGZA 5LHGA 3HIFA 5CVRA 4UVCA 4HX8A 2Y48A 5LGNA 1REPC 5J8CA 3P9KA 4M72A 2DPDA 3K69A 2PG4A 3V8KA 1XGSA 1R36A 3V7CA 4KN7X 3TO6A 4HDUA 3K9TA 3I71A 2EWNA 1P4AA 1ZARA 1R1VA 4I02A 5J6XA 1K7AA 1BJAA 4ZYEA 4B09A 3HSFA 4YIIA 5FD5A 1ZG3A 3IWZA 5E8GA 1BIBA 5DUKA 3EDPA 4Q47A 5FFXA 1S8NA 4IHSA 2E1NA 4ESFA 2FNPA 5L3CA 3WTWC 1O7FA 2EV6A 2EFQA 3MZHA 4MQ9F 4GGGA 4L5IA 1T2KA 3ZN1A 2BBYA 3F8NA 3TDUC 1R1TA 2GQQA 3N97A 4RB1A 2DI3A 3MFKA 2IT0A 1WWXA 3KP6A 4AIKA 3ECHA 1ZGAA 3KZZA 1WRJA 1XN7A 2VXZA 5ICFA 3RKWA 1I1SA 1R5GA 1QPMA 3H3UA 2K27A 1FBUA 3GFJA 5K5RA 1FT9A 1OR7A 4LG0B 2A6HF 5TJJA 5H6QA 2HS5A 2EJRA 1U78A 3I54A 2VODA 2FU4A 2CO5A 1YTYA 2UXNA 1DUXC 3LAPA 1FYKA 1UFMA 5LEKA 1IXCA 3CUQB 1IXRC 4HZFA 4ASNA 3DEUA 2LF8A 2MC3A 1LVAA 4BXUA 5DCFA 4YFNF 2ZMEA 4KMFA 4PGHA 3F21A 1E17A 2M1BA 4EM1A 2AS5F 3TO9A 1QBJA 2W84A 4MEXF 3HRSA 2BYVE 3K1PA 1ZAOA 2V9VA 3BOQA 2B0LA 2HZTA 4WXDA 4L0ZB 2TDXA 1JGSA 3RYRA 3FX3A 3FM5A 1W5TA 1Z6TA 2P7VB 3F8FA 4WCGA 1BM9A 4G6DA 2Z9OA 1G3YA 2XV4S 1XDSA 4XSXF 2F5DA 5TRDA 2H27A 4BQAA 3JTHA 3GYHX 3QRFF 2O0YA 4WX9A 3RI4A 2O3FA 3JTGA 2CSOA 1YO5C 3HRMA 1ON1A 4QWQA 3WTTC 4G7ZF 2JTVA 3QPTA 5E17F 5IT3A 3FXUA 3T0YA 2JSCA 2EFPA 4Y15A 4XSZF 2NAZA 3DP7A 3LAJA 2GXBA 2GA2A 2ZJ2A 4EQQA 5FD6A 1MJBA 2XAFA 3S2WA 1YW8A 4ENNA 5CVJA 4S05A 1TNSA 3BJ6A 2DO7A 2MD5A 4EM2A 2V1UA 2FMLA 5DUIA 1U5TC 2OAZA 3OV8A 1R58A 4B8XA 2VN2A 4A5NA 1F1ZA 5HLHA 4FX0A 3PQJA 2M8EA 2A61A 5BOXA 2L4AA 2QQBA 1O3RA 3R60A 2QYOA 3CLOA 4A6EA 3FM3A 3KP3A 2V1XA 3EYYA 4ZYHA 1B59A 4ETSA 2P6TA 1QGPA 3F8CA 3ULQB 5D4RA 4I09A 5FFZA 1IW7F 2XROA 5ICCA 2JT1A 1T38A 3KP2A 1AWCA 1LJ9A 2NYXA 3CJNA 5A2QZ 5IT9K 4AIJA 3CUOA 1BI0A 2K7LA 2FF4A 5L3DA 3EYIA 4IPAA 2HKXA 3C18A 5E20A 3CO6C 3TGNA 4BHCA 1KYWA 2XASA 4AWXB 3BJAA 5D5XB 1J59A 2PQ8A 1FBSA 1GXPA 1IN5A 3P7NA 1O3QA 1SMTA 2MLKA 2D1HA 3LWFA 4UHTA 1BN5A 4XBFA 2P5KA 1S29A 1H9GA 5DCMA 3J80Z 1XMKA 4LLNA 3SZTA 5EEHA 3RPQA 2H6CA 1FSEA 4OOIA 5E8IA 3BY6A 3K1NA 3V8JA 3IL2A 2V79A 2C6YA 2GXGA 1JE8A 1SFEA 1NHAA 2DQLA 1TQIA 1T39A 3RKXA 3F23A 2ESHA 3U2RA 3QOPA 1ONVA 4CGZA 1FY7A 3SHFA 3LQQA 3L09A 4IHTA 5KK1A 5HLIA 4WWCA 1FLIA 2RV8A 1FOKA 4QLCU 2Y75A 3QAHA 1J7KA 4A12A 5ED4A 4KUMA 4EJUA 4ESJA 2STWA 1R7JA 2FBHA 5LGTA 2ISYA 4A0ZA 5FLXZ 1BIAA 1I27A 2KKOA 4GO1A 4E70A 4HBLA 5HS8A 4LK0F 4OINF 3CUQC 1XSDA 2MLGA 1LEAA 2PJPA 2DW4A 4UVBA 2WWYA 5BQTA 5CLSA 5LHIA 1SFUA 5HOOA 4KYWA 1EH7A 2FMYA 1J2XA 1JHFA 4ZZLA 2GWRA 2Q0OA 4PDKA 1O3SA 4BNCA 5BPDA 2MA3A 4RAZA 5F6FA 2F5CA 4ZYDA 1MZBA 1HW1A 4ENMA 3BPVA 3LA7A 4LJZF 5H6RA 3E3VA 1K79A 3F8MA 1FYLA 3ZP5A 3LA3A 2RDPA 3RPUA 4IVNA 1FZPB 5LRSA 4ENJA 4HW0A 5D6EA 1V3FA 1LNWA 3ZMDA 3KP7A 2Z3YA 3TDZC 3ZMTA 3JW4A 1O57A 5CVUA 3IKVA 5ICEA 3JSPA 2XHKA 1UHWA 2XAGA 3ISPA 2QQ9A 3SXYA 4JK1X 4HLXA 4XRFA 3COAC 2W57A 5JR3A 2EFOA 1HSTA 4M74A 4N0BA 3WTYC 3PQKA 4WK8F 3B73A 2VC1A 3J7AO 3HTSB 2LKPA 3FMSA 3J81Z 1G3TA 3QPHA 3RKYA 1TW3A 2CQKA 1KU3A 3MQ0A 4HQMA 2A07F 1WQ2A 2UXXA 3WODF 1HQCA 2DTRA 1IN8A 3DF8A 2MH9A 5E1ZB 3DPTA 1YG2A 1YYVA 3T1BA 2M87A 3G73A 3ZPLA 1ODDA 2D2WA 2PFBA 2FBKA 4Y17A 4KIBA 3M8FA 4IRIA 3SFZA 3W6JB 2CFXA 3KFWX 2QBYA 3GEZA 4EJTA 2HGCA 3U9GA 4A5MA 1F5TA 2Y0MA 4HX4A 5F1RA 1O7LA 1KU9A 1D5VA 4EMSA 4RB0A 4U88A 2IP2A 2ZKZA 4PZJA 2X0LA 5HS7A 4F7ZA 1IN4A 3CO7C 1W7PB 2BE5F 2OU2A 5LBQA 1YFHA 5DD4A 4OMYA 4P9UA 2E7WA 1XCVA 2OQRA 1OYYA 5L3GA 1LEBA 1ZH5A 3W6KB 4I98B 1TQPA 3KLOA 4M9XA 3C1DA 4OMZA 3E5UA 1IRFA 2ZCWA 4KA4A 4LGWA 3K0LA 3Q9VA 1ZRDA 2P5VA 1FX7A 5FB2A 2R3SA 5HLGA 2E1CA 1W4MA 1FNNA 1XSVA 1RUNA 3I64A 1S6LA 4PGGA 2W85A 2A6EF 5ICGA 3RJPA 4I2OA 3M9AA 1F9NA 1OYIA 3MWMA 2R7FA 4ZH4F 3FHZA 3HRTA 4M9ZA 1AOYA 1SD4A 2OA4A 2IW5A 1MKMA 1QO0D 1B9MA 2WC2A 4KICA 2KIUA 4IRHA 3H92A 2DT5A 2JRTA 2LF7A 3IWFA 3NRVA 3E6DA 5JHUA 2P7CB 1MDMA 4IRGA 4MTEA 3I59A 2ADUA 5ILVA 1QNTA 3FMQA 3B02A 4KN4X 2ZNZA 3VB2A 2V6CA 2FEZA 2W25A 1K78A 3GVAA 2P5LC 4FX4A 3REOA 2GZWA 2KIMA 4WXHA 2O6GE 3V7RA 5BPIA 1P2FA 4HF0A 1XSXA 3LQRA 4RGXA 1UHMA 1FYMA 2WV0A 3M1EA
chains in the Genus database with same CATH superfamily
3V4GA 2Z99A 1T33A 5LFAA 1H89C 3O6BB 3D0SA 2FBIA 2IPQX 3L2CA 3HTUA 2R93J 3WTZA 1MD0A 1RR7A 1P7IA 2IA0A 5H2FC 3CQZJ 1P4XA 2UWMA 3AL0C 4A3FJ 3OR2C 4EATA 4XK4A 3V42A 4ON0A 2CUJA 4CCMA 1VQNI 5J8FA 4MFEA 4CO8A 1PP8F 3M8EA 1UB9A 4FETA 3CCLI 1JUPA 2EZKA 2ELHA 4A2UA 1BI3A 1YHQI 2YX4A 1IRGA 2QUFA 1DDNA 3GTMJ 2QA4I 1K6YA 1E3PA 1RNLA 2CQNA 4L9TA 1I5ZA 4MFDA 3S3OA 2HDCA 3DFGA 2HQ5A 2GLOA 1E3HA 1FTTA 4LK1F 2K4JA 4G8XA 4ZTFA 2BY0A 5FRNA 1Y0UA 4FT8A 3O8HA 4L9JA 2DT7B 2FOWA 4XICA 5DM7F 1JKRC 2V9KA 2O61A 4M3EA 3GZ5A 3K2AA 2ME0A 3SJMA 4U7DA 1MNDA 1JHHA 2HKOA 1SVLA 1A6QA 2RKHA 1MGTA 5GP9A 4MEYF 4BDYA 1ITYA 4U7BA 4Z2YA 2UZKA 2NS7A 1ZREA 5BS6A 5AIQA 2ZB9A 1EF4A 1QVUA 1Z1DA 5HODA 1QPIA 1IF1A 1YX3A 3FK6A 5CJ9A 1D8JA 3BPXA 2ZMEB 2E2JJ 2O8XA 2Q8KA 3CTAA 2D1VA 3GX4X 2K85A 2LG4A 1KQ9A 5HS9A 2JPBA 2WBMA 1HKQA 3IH2A 4FHTA 2I10A 1ZYRF 2JPCA 2W24A 5LEJA 1KU2A 3HZJA 3I59B 2E1OA 2K4BA 2CYYA 3LOCA 5JFRA 2PJRB 1R23A 1DGWY 4RM2A 5L3EA 2K9LA 3E5XA 5F64A 3CCEI 2BXYA 4I99C 3CJRB 1B1BA 1TW2A 3MMYB 3O3KA 1JKQC 1HF0A 1P7JA 1ZGJA 2IJLA 2VE9A 5CVVA 3SZGA 2P8TA 1K78B 1P9QC 2HYFA 5K5OA 2BV6A 3KIOA 3VDXA 1JT6A 4F52A 2KQRA 4QPOA 4NBQA 4F55A 1VQLI 4BQQA 3HOTA 3CCVI 1LKXA 1ETQA 4P9FA 1IUFA 5J1RA 2DMNA 3CDIA 4MTDA 2AO9A 3DKWA 4AVPA 3N4MA 2Z1DA 4PJJA 4HPQA 4AD9A 1GHCA 4X0GA 1U9OA 5KHDA 2AHQA 4BQOA 5K5QA 3KYCB 2Y31A 4R8HA 2E2IJ 4Y52J 2PEXA 3TKYA 3JSOA 2CV1A 2DBBA 1MBHA 2PI0A 4PJNA 4A93J 2VKEA 1SD6A 4NQWA 5E79C 3HYIA 4HAMA 5LLQA 4DYRA 1W5SA 3S15J 4XLPF 1Z3YA 4ZDPA 2IS1A 1GDTA 4XONA 3CMEI 3U1DA 3C3WA 1YW9A 3G1OA 2PMUA 3PNYA 5GAEJ 2EV5A 1U2WA 2NVQJ 2ISZA 4AYBA 1LE8B 2F6CA 1U5TA 2QWWA 4HNUA 3PNVA 1MIJA 2HTSA 3Q9SA 1DP7P 1UELB 2CW0F 2K02A 2H09A 4L5JA 2BVLA 2L7ZA 2XF7A 3F0CA 1WI9A 1OYWA 2MYSA 1CGPA 3FXQA 2BW3B 5JVGF 5K7HA 3I9V2 4EGYA 2H94A 3R61A 1ZG1A 1GLNA 2HYGD 5IOZA 3TBIA 2X6OA 5DD8A 1U3EM 4K2EA 1WKMA 1UCRA 1J5YA 4W97A 1OLTA 1U8RA 3OYCA 5B5EC 1VQMI 3S2DJ 3K4CA 2HQRA 2A68F 4PJ0C 2HXOA 3IC7A 4CZCA 3JAMK 4RGUA 3F22A 4LD5A 2ZJRF 3ZQHA 2O03A 5IT9Z 3KEQA 4LITA 2VOOA 3NQOA 1STZA 1JUSA 1USTA 4O5VA 4UUVA 1X3UA 3MEXA 2K40A 2K5CA 2PX9A 3PO2J 1BI1A 2R4GA 3WG7H 3GO5A 2GBYA 2M5WA 1ZLJA 4RGSA 2XPVA 3H5AA 2G7UA 1LFPA 2ESNA 4E7IA 3A1YA 2DK5A 2ICWG 1BOAA 2FSWA 2BGCA 4IXAA 5AONA 2M3AA 2KJCA 2X6WA 4JX6A 2DFHA 2P4WA 4KDPA 2HDDA 3LNQA 2DYRH 3HRUA 3EUAA 4J01A 1JXSA 5BMZA 2HTJA 4Y13A 3DLLF 4UUSA 3OYMA 2O9LA 2JA7J 4YIFA 1IV6A 4EV0A 3GZNB 1IRZA 2XVCA 3VYSB 4ESBA 4OIRF 3CDHA 1I3QJ 2RN7A 2HDWA 4U0VA 2IVMA 3DPLC 1SD5A 1LQ1A 2OTLI 2YU3A 3G6EI 5EZHA 2PMZN 1MMSA 1XGOA 3J7ZI 1NTCA 1OMIA 5D8KB 1TT0A 2VC0A 4G94A 1Z67A 3OYIA 2M2EA 4XRSG 1T98A 2FRHA 3F3XA 5E18F 2DOFA 1X58A 2DFEA 3HHGA 1Z05A 1RIOH 4R79A 2JQ7A 3VODA 1QZZA 1Z6RA 2DPUA 2NXNB 1BI2A 3I3LA 4D5CA 1B6AA 1OKRA 2V9PA 2J5OA 2WB1N 4P55A 1Z9CA 5J1YA 1LDDA 1ZR2A 3TQNA 2X6XA 3LL7A 4M3GA 1BC7C 1UHSA 1IDZA 1J9IA 1R1UA 3ML6A 2OD5A 3O8GA 3F6VA 3L2RA 1X1AA 2E1MC 2E5NA 2XAQA 4NB5A 4A3CJ 1F43A 3E6MA 2J5PA 2HI3A 4A6DA 2ZO4A 5HDKA 4JYKA 4UVAA 5DCMB 3QYEA 2IA1A 5EZGA 5IPAA 1J0RA 2EILH 3GZ6A 3H3VK 1TLHB 1Y6IA 2LSOA 1PVEA 4H0EA 1YS6A 1U5TB 2CG4A 2EZLA 1P4WA 4DNCA 3GFLA 4RM3A 4U0WA 3C7JA 2EA4A 4XN0A 4XRMA 3H0DA 3MAJA 3KP4A 3OYGA 3S1MJ 3F72A 4HDVA 1S7AA 2L4MA 2ID6A 2NNYA 3AG1H 3HUGA 3GF2A 2LR8A 4HSRA 2RNGA 1TNTA 1KYZA 2GIVA 4UV8A 3W2WA 3ZMVA 1C0WA 3WTXC 4I01A 3I4PA 4Q48A 4BJTA 3ZN0A 3FZVA 3ROUA 1PUEE 5ILUA 3QQAA 1F4KA 3GFIA 3QP6A 5EEGA 1XGMA 4FQGA 4DBQA 1ZG5A 4BHPA 1X1DA 3W6VA 1MBFA 3ERED 2LY1A 2LNBA 2F5VA 2ACJA 3DBHB 5CYVA 5JLWA 4LG0A 4JQFA 3SZPA 3D1NI 2EB7A 2LFBA 3A01B 1D5YA 2R7VA 3R0AA 2EK5A 2EFWA 1VQOI 1BA5A 4IQJA 1QHHD 5DM6F 4C3HJ 1D1BA 2VB6A 2ETHA 4F91B 1T8IA 2R7DA 1K4TA 3S1RJ 1QA6A 3V8LA 1G59A 2X4HA 1I6HJ 3K2ZA 2FA5A 1B72B 1S7OA 3RCOA 4GFBA 3OIPA 3EETA 4Y3OA 4V2FA 3DXJF 5LRRA 3CUQA 1R4NB 2Y30A 4RGRA 2HQNA 1GV5A 1LUJB 1LFBA 2K9QA 3IP4B 1D8KA 3LA2A 3M8JA 4BHBA 4YRVA 4Q4ZF 4IZZA 2NOJB 3TO7A 3HOSA 4BACA 3PNTA 2DFIA 1H8AC 1I39A 1OR7C 4HV5A 2OBPA 4I7HA 1PYVA 2KZGA 3K70C 3LFUA 3SEZA 3I4MJ 1KQ8A 1SFXA 3VOEA 3M3YJ 2BXZA 2H1LA 3GXOA 3A02A 2DMQA 5ILSA 1UZCA 1ZN2A 3L2QA 5E1XA 3HL2A 2QKLB 2Z5UA 4RB2C 2JUCA 1XB4A 3LSKA 2YSRA 4OIQF 4RAYA 4M9SA 4KISA 1GVDA 3GFMA 4G9YA 1L0OC 2NVXJ 1MJAA 1PP7U 1ULYA 1A5JA 3F6OA 3CMYA 2ZMEC 4BE2A 2CWEA 1G6NA 2M0CA 3G3ZA 2JN6A 1WCMJ 1YLFA 3ASOH 4F93B 3Q3SA 2RGVA 3BR2A 3B6AA 4DQ2A 2JK3A 2XF6A 1DPUA 2CS3A 4XMYA 4GRIA 3LSTA 1YX5A 4EVIA 2DN0A 4BBRJ 2F4MB 5M5WJ 3K70D 2KMUA 3OSGA 1KQ0A 4XLNF 4OIOF 3OYNA 3GTKJ 1MW7A 3P9CA 4L18B 2WY7Q 4D0PA 1XDUA 1R5HA 1BW6A 2FX0A 3BZ6A 2KFDA 4LOCA 4E4HA 2DJNA 2V1NA 4KIGA 2PMHA 4ZZDA 3BZKA 4NC8A 2NVUB 1MMNA 2D45A 5CQGA 1JT0A 2FJ1A 4XN3A 2LREA 3QOEA 2FNAA 5DDGA 2CV2A 1SFKA 4KITB 5DV5A 2OZUA 3RQIA 2RNJA 2QM3A 2GXAA 4ENKA 2V1DA 5L3FA 2HU9A 2XSDC 1SAXA 3PUFA 1OCOH 5J4VA 1KONA 1FOYA 2JVGA 4LB6B 5IYBJ 4A3BJ 3ABLH 2WAEA 5K1YA 1SANA 3JRGA 5HDGA 4MLOA 3ONQA 1OCRH 3ZCOA 2VONA 3TOBA 5D5VB 1NG7A 2L3DA 2EIMH 2LK2A 3DWLE 1XD7A 1FP2A 4XLHA 2F5FA 3T5XA 5J1UA 3AAFA 1Q1HA 4IF4A 4UB6C 1ZTRA 2CQXA 1RKTA 3OOPA 2DU9A 3WTSC 1O4XA 2HWVA 4AYBN 1T6SA 1SD7A 3GUDA 4A0YA 4E7ZA 4RB3C 3I55I 3PFIA 4I0AA 2A3SA 4HQEA 3CDLA 1YQAA 4GXOA 4UNOA 2VOPA 2M0MA 5JVTA 2KRFA 1TWGJ 2F4OB 1QQIA 2R7UA 4M6VA 2EV0A 2BVMA 1HCRA 1T0FA 1V5FA 3MN2A 2BY1A 4Y4RA 4KFCA 2GOXB 4BU2A 3FF5A 3HSRA 2X48A 1IUYA 3SDGA 2EINH 2TRTA 4HG2A 2Y9YA 3FHNA 3KX2A 4AIHA 1FSHA 5TISC 4HV6A 3WE3A 1E2XA 1KU7A 1K6OA 3BJOA 1X4OA 3VFZA 2NS0A 1TTYA 5D4SA 4A3MJ 3HOVJ 3GTOJ 3HDDA 2RVCA 2CJJA 3BWGA 3KYDB 1YI2I 3JRCA 1I1GA 3ZMZA 5JI6A 1IG7A 2XDVA 4LFUA 2DLLA 1Z77A 3WTUC 9ANTA 1ON2A 1HBXG 4WXCA 3R0JA 2R7RA 5E1WA 4P5OA 1IDYA 1FBQA 1ENHA 2N8GA 2XIGA 3ABTA 2QBYB 3EUHA 2QQ8A 2E34A 2QZ8A 1N78A 2EQRA 4N9IA 3E0JB 2VBYA 2FOKA 5B1BH 4Q5SF 4M6XA 2KDZA 2V7FA 3CCYA 4II2A 4BH9A 1VQ8I 2QENA 2RQPA 3WU0A 1JGGA 3WGIA 1ACIA 1HXDA 3BG3A 4HRIA 2JA6J 1WVRA 5B66C 2R5ZB 2PN6A 2WAQA 1TT5B 2ZXIA 1W7PD 2X1DA 1DPRA 2G0EA 2KP6A 3P9IA 1OCCH 4QSHA 2FQ3A 5HLTA 2VBXA 2OPTA 3CF5F 1D3YA 4I6ZA 2IS4A 3DTIA 5M3MJ 1FP1D 4L9VA 3O2PE 3IHUA 3G4SI 4MGRA 2LDUA 3HOYJ 3RDIA 2L54A 4LIVA 2XGXA 1W36D 3ZQ7A 1RZ4A 1G4DA 2G7HA 3WTVC 5FLMJ 3R6SA 1JJ6C 4AC0A 2L02A 3QYBA 2WADA 5K7FA 2Y69H 2WV1A 4LLGF 4BUPA 1Y56A 3M07A 2HFHA 3ZMUA 3BTCA 4NHJA 3S1NJ 3LSIA 2STTA 2RQQA 1Y0NA 2CGPA 2DAOA 3E5QA 3JR9A 1JKPC 4XRSA 3MCZA 4BAYA 4M3BA 1YS7A 4S0HB 3M1CA 5KNLA 1BBYA 5FO5A 1QRYA 1TQMA 2XUBA 4CZZA 2VT2A 1WJBA 2E7XA 3BP8A 3L7WA 2DJIA 2LTPA 4C3JJ 2HOEA 2L01A 4XLEA 4MQVA 4RBOA 2Y0SA 2A69F 4QIWN 3JRDA 5A2QK 2EA2A 1G3WA 4L0YB 1A6IA 3PSFA 5LHHA 2DA6A 4KT5C 5FKOA 1R00A 4EM0B 1KA8A 1WGXA 1Q1VA 2QVOA 4ZYGA 3CCUI 2Z16A 3I5UA 3K4MA 1FIPA 3GCMA 2BOLA 2BEOA 2FQ4A 3H0GJ 2ZFWA 2R7QA 5GAGJ 2DMPA 3ZMSA 2VBWA 4HLYA 2ZXJA 2X1EA 2M4KA 3F8BA 3LMMA 1NH3A 3FXRA 4IKFA 3BTIA 2H8RA 1SMYF 5HVQC 5IYDJ 1U6GA 1L3LA 3H3ZA 1YRNA 2L7KA 4I0BA 3WGHA 2F48A 3U1KA 4IO9F 4ZDLA 1XMAA 2A5YB 1MMDA 3KE2A 2L2OA 2EFNA 3FIWA 1VF9A 4DZPA 5DEQA 4G12A 1U0JA 1IN7A 3VEPA 2UV1A 2LC2A 3D5LA 3GWZA 4XIDA 1MDMB 3T8TA 1PDNC 2XKPA 4YFXF 4S04A 4R1HA 5L3BA 3E6CC 4HYEA 2VQCA 4OIPF 2OZ6A 1GVJA 2LOOA 4EJWA 2QSHX 3J80K 3KEYA 1ZHFA 3T8RA 2JZYA 4E7LA 3CC4I 2ZFUA 5KAFC 4BDZA 1TZLA 1V5EA 3ECOA 3BT9A 2ID3A 3VYTB 3WG9A 2CH0A 2KLOA 3DQVC 1VQKI 4A0XA 3BCAA 3HXLA 2IRFG 2L7FP 3HHHA 1D0ZA 4TV7A 4DZJA 5IP6A 4XKWA 2M9HA 1JTXA 4G7OF 3IKTA 1S72I 1FWZA 3H5NA 3FMRA 2LKXA 4YELA 3RYPA 4M71A 4UV9A 1PUFB 3ZOBA 2LYCA 4YG2F 2IS6A 4BXFA 4J19A 3S14J 5IOYA 2NVYJ 3I4NJ 3Q0WA 4AU7A 1B8IA 2A6TA 5J3LA 1R22A 3QU6A 5BNGA 4XKCA 3MKWB 4XNFA 4L5EA 3G2BA 1R4MB 4HNVA 4G6QA 3I58A 4LB5A 4MNUA 5H20A 5D5WB 1VTNC 3E97A 2MD0A 1WJCA 2XAHA 2M30A 2Q2EA 4HX7A 2LKSA 3HSEA 5FKNA 3SFIA 1IAWA 2LBFA 1IN6A 1FC3A 3W2VA 4LMYA 1CQTA 3C2BA 4P96A 3A2KA 3TMOA 4HSTA 4KIFA 5CVIA 1H88C 1ZRFA 1P92A 4G7HF 2XRNA 1G2HA 2WTEA 1ETWA 4RS8A 1MSEC 1W5CC 2QLZA 5D8LB 2Z33A 2GA1A 5KVRA 5F0FA 1J09A 5F08A 2OTJI 2VBZA 4B48A 2F2EA 1OCZH 5J40A 1WJ5A 1FTZA 4GYIA 2ELKA 3WHBA 4ZJZA 2OQGA 4JBAA 5FLXK 2KIFA 4GCVA 1K61A 3E6BA 5LGUA 3FXLA 4O3MA 1MH3A 3S2HJ 1V4RA 2DYSH 2YR2A 1YJNI 4CHUA 4IX7A 1X2NA 4GYGA 2HEOA 2Y2ZA 3DEEA 2K86A 4LIUA 3L9FA 3QP5A 2NNNA 2VQHA 2M4GA 2MG4A 1TBXA 1A35A 1NK2P 4LLLA 5B3SH 1HW2A 3H5RA 1CF7A 4HF2A 3CF2A 5CKTA 1H0MA 2PLYA 1ETOA 3ABUA 3DPUA 2HOTA 3DLAA 3M7GA 2DQRA 1W36C 3S17J 3DV8A 2VIXA 2R7ZJ 1ZLKA 4RAFA 3S1QJ 5DYMA 2R7XA 4OU0A 4EJOA 1RC9A 4JOMA 3WE2A 1FPQA 1FIAA 3ZRGA 4B44A 3TOAA 5C44J 2EIJH 2MC4A 4U87A 1MBJA 1RI7A 4BL0B 1YIOA 4CDGA 4CXFA 3QPLA 3KCCA 4XR6A 1YRNB 3V7SA 1YE9A 1S9HA 1YJWI 3FXKA 3A0BC 4M6YA 2PBIA 4F92B 1BC8C 6PAXA 1Z91A 2FXAA 4WF2A 2VUMJ 2G9WA 1Z7UA 1HKTA 2XGCA 3UKGA 1ZRCA 2DA4A 2E5ZA 1X1PA 4A69C 1B4AA 4HA8A 4KNYA 4RMNA 3UR3C 5IY5H 3OMYA 4FE4A 3UNGC 1KGSA 4RA2A 3OYBA 2WAFA 3R4KA 3FXJA 4X6AJ 1XCBA 3DKYA 1EH6A 3EUKL 1HSJA 3KETA 2COMA 3LFKA 3K1MA 2IA2A 4N9HA 2KJBA 1I3AA 4O6JA 1IO2A 1LB2A 4HOBA 1R49A 2MABA 1IRXA 2XPWA 2YPRA 5GTIC 1VI0A 2XKOA 1OPCA 4ITVA 4MHGA 1QZYA 1JUMA 2L5QA 4UXNA 4XORA 2LMDA 3JRBA 5TGTA 1Z7LA 1ZGWA 4NDLA 3RIRA 2E35A 3K4LA 1H9TA 4CICA 3ELKA 5F0HA 3SQNA 5GAHJ 3S8PA 3CCMI 5AIPA 2YX7A 1YW7A 2I8DA 4BJ6C 3FDYA 4CYDA 5EDNA 4MIMA 3MKZA 2LD5A 1VQPI 2DK8A 2H1KA 3RZOJ 2MBFA 2VE8A 3Q5FA 1G3SA 1BR4A 3HKZN 4YFKF 2P6SA 2XAJA 4B47A 3BR0A 5HNFA 2LLKA 1S3JA 2HPMA 1TWHJ 1V54H 3OL3A 3KZYA 1OISA 3I53A 2X9DA 3BROA 3D5RC 1MJ9A 3KP5A 4M73A 2X6YA 1GXQA 5DS9A 1HDDC 1VQ6I 3OS0A 2H6BA 1USSA 2M45A 4CYCA 2GIZA 4BEHA 2VT3A 3NEUA 1EV7A 2K9MA 3JAMZ 4C2TA 1X2MA 3KLNA 1IXSB 1ZELA 2YS9A 3BC8A 3GW2A 3KEOA 4KMUX 3J81K 1OJLA 4RAGA 3ZQQA 4BYYA 2Z2SB 5FGMA 1HKSA 1F36A 1HW5A 3MD2A 2LBFB 3GLXA 3BCBA 5E3LA 3ZQIA 1ZR4A 1I6XA 3NWSA 4NQWB 4IJAA 3BDDA 3FWEA 1P6RA 1W7PA 1I50J 4XLFA 2KDOA 2B63J 1WSUA 1O3TA 2GAUA 1LDJA 5HDNA 2NRAC 2OJED 2FE3A 2A5WA 3S32A 1RUOA 3WGGA 2ZNYA 2VASA 4L9NA 4DW6A 3TP0A 2ZSHB 2AXLA 5ERIA 2COBA 1EH8A 2ZBKA 2WAQN 1B9NA 3IRQA 1LDKB 2K9SA 4HF1A 1IZ1A 2M34A 5C4JJ 4W1UA 1A04A 2HR3A 4M3FA 2F5EA 3RTRA 1J75A 3ZXSA 3IRRA 1D0XA 2MH2A 2HNHA 3L00A 2RC4A 3EQLF 3MKLA 5CPRB 5D5UB 2K9NA 4A3GJ 4PCQA 4U0YA 3K6GA 1XGNA 2WA0A 1A36A 4EJVA 2E19A 3QU3A 1LFUP 3I0TA 3MZYA 1CF7B 4E7KA 2QQAA 3WU1B 3HEFA 1DQUA 5D6FA 4EGZA 3CC2I 1QU3A 5LHGA 3HIFA 1ETXA 1W1WE 5CVRA 4UVCA 4HX8A 2Y48A 5LGNA 1REPC 5J8CA 5F0CA 3GTQJ 3P9KA 4JP0A 4M72A 4II3A 4B4CA 2VJ5A 2YU9J 2DPDA 3K69A 2PG4A 3DEWA 3V8KA 3GLLA 1SC7A 5C3EJ 1XGSA 1R36A 3V7CA 4KN7X 1LPQA 3FK7A 2DODA 3TO6A 4HDUA 1IV8A 3DCFA 3K9TA 3I71A 2EWNA 1P4AA 2M8GX 3HOWJ 1XX5A 2JRMA 1ZARA 4D5FA 1U8BA 2OC6A 1R1VA 2TCTA 5EG0A 3LSGA 4I02A 5J6XA 2KPMA 1K7AA 1POGA 2KT0A 1RESA 1W0UA 1BJAA 5EF6A 4E7SA 4ZYEA 4B09A 4A3IJ 3HC7A 4UUSB 3HSFA 4YIIA 2HVSA 1GUUA 3D5SC 4XL9A 5E3OA 5FD5A 3HPGA 4J00A 3RQ4A 2M7BA 1ZG3A 3IWZA 1FEXA 3U21A 5E8GA 1BIBA 4XOTA 2L0KA 1IC8A 2ZXHA 1UG0A 5DUKA 5FKMA 2LP0A 5F27A 3EDPA 2IGKA 5K7ZA 3DBLB 4Q47A 5FFXA 1R9TJ 2KRHA 3BG5A 4OAYA 1S8NA 3DTKA 4HEA2 4IHSA 2E1NA 2R0QC 3NWTA 4GDFA 2CQQA 3GBGA 4ESFA 2FNPA 5L3CA 3WTWC 1O7FA 3E1SA 3H35A 1QHGA 2RREA 5DTDA 2EV6A 2EFQA 4BEHB 4MQ9F 2DA5A 5EGOA 3MZHA 4GGGA 4L5IA 1T2KA 3PFYA 4IL6C 1ETYA 3ZN1A 3H1CA 2BBYA 3F8NA 3BZCA 3NAUA 3C2HA 3TDUC 1R1TA 3ABKH 2GQQA 2GM4A 2L7MP 3FXOA 3FBNB 1OQYA 4Y7NJ 2L9RA 3N97A 4RB1A 2DI3A 3MFKA 3IAS2 2CMPA 4BE1A 1MBKA 2IT0A 1WWXA 3G1MA 3HM5A 3KP6A 3KZIC 4AIKA 3ECHA 1ZGAA 3KZZA 3CP2A 3PSIA 3OYDA 2FD5A 1WRJA 1XN7A 5E3MA 3HUGB 2VXZA 2IBDA 2IGMA 5ICFA 3HOZJ 2ZJPF 3RKWA 1AKHA 3OR1C 4FE7A 1I1SA 4KT6A 1R5GA 4OAZA 4N4NB 2EH3A 2ZJQF 1QPMA 3H3UA 2K27A 1FBUA 3GFJA 5K5RA 3OIQA 3CLQA 1ZQ3P 1FT9A 2IXSA 2QF7A 3K7AJ 4DYCA 1OR7A 2DTZA 1N75A 1RR8C 1PJRA 2A6HF 2DT6A 3AG2H 4LG0B 2XB5A 4ZDOA 5TJJA 5H6QA 2HS5A 2EJRA 1U78A 3JCUC 3ASNH 3I54A 1WZ2A 2VODA 2FU4A 2CO5A 3CMMA 1YTYA 4H4KC 2KIQA 3OYEA 2UXNA 1DUXC 3HBLA 3LAPA 1YJ9I 2W82A 2XPUA 1VFCA 1FYKA 1UFMA 5B1AH 1DU6A 4C9YA 1HOMA 5LEKA 4CCOA 1IXCA 3MVPA 3CUQB 5C4XJ 2JVHA 1IXRC 4HZFA 1ETVA 4ASNA 3DEUA 2LF8A 2MC3A 1LVAA 2P81A 4BXUA 4IHYA 5DCFA 4YFNF 2ZMEA 4KMFA 5EG0B 4PGHA 3F21A 5JLXA 1E17A 2M1BA 4EM1A 3QPSA 5IP7J 2AS5F 3TO9A 1QBJA 2NS8A 2W84A 4MEXF 3HRSA 2BYVE 4XKVA 3WU2C 1X3ZB 1Z21A 3IH3A 4B1RA 3ESWB 3K1PA 1ZAOA 2V9VA 2JA2A 3A0HC 3CCRI 3BOQA 2B0LA 1FOWA 2HZTA 2UUZA 4WXDA 3MKYB 2Y9ZA 3WHCA 2CQ7A 1IGNA 4L0ZB 2MGQA 2TDXA 1JGSA 2E1MB 2WB1A 3DKXA 3GTLJ 1SFOJ 3RYRA 3FX3A 3FM5A 2OCCH 1MBGA 1ZKGA 1W5TA 1Z6TA 2P7VB 4PFOA 1RKWA 3F8FA 4WCGA 1RETA 4XQFA 1BM9A 2DA1A 4G6DA 2Z9OA 1G3YA 2CUFA 2XV4S 1XDSA 4XSXF 5EYRA 2F5DA 5TRDA 2CUZA 2H27A 4BQAA 2D5VA 3OS1A 2CFOA 3JTHA 3GYHX 3QRFF 2LH9A 2O0YA 1WJDA 2R7WA 4WX9A 1WH7A 5E3NA 4IHVA 3ZQLA 4CCJA 2F4IA 3RI4A 3HPHA 2EIKH 2O3FA 3JTGA 1A31A 2CSOA 2VPLA 1YO5C 3HRMA 2ZXWH 1ON1A 4QWQA 3WTTC 4G7ZF 2JTVA 3QPTA 4IQ4A 5E17F 5IT3A 4YIRX 3RPUD 1MMGA 1T95A 3OY9A 3FXUA 3L2UA 2DCEA 3T0YA 2CW7A 1WJFA 1T56A 2JSCA 2EFPA 1Y8RB 4Y15A 2QEXI 2ECBA 4XSZF 2NAZA 2DA2A 3DP7A 3LAJA 1VNDA 2GXBA 2AXTC 2GA2A 1SAUA 4NUBA 2ZJ2A 1LE8A 4P1WA 5EJCA 3DBRB 4M3DA 4EQQA 3PIOF 2QKMB 1HA8A 4A3JJ 1AKHB 1JJ8C 4DIQA 2K3PA 5FD6A 1MJBA 4BQNA 3BR1A 4DBRA 3IUOA 4LG3A 2BW3A 1Y1VJ 2XAFA 3OYLA 2OUMA 3S2WA 2MSYA 1YW8A 4ENNA 1YIJI 4KJZA 4XOPA 5CVJA 4S05A 4YEJA 2R7SA 1TNSA 2CUEA 3BJ6A 2KRCA 2DO7A 2MD5A 4EM2A 2V1UA 2FMLA 5DUIA 1YITI 1U5TC 2OAZA 3OV8A 2QSGX 1R58A 4B8XA 2ME6A 4CCLA 3K10A 2VN2A 3OSFA 3Q0UA 4A5NA 1UMQA 3HG9A 5M5YJ 1F1ZA 5HLHA 4FX0A 3PQJA 4IOAF 2DA7A 2JMWA 2XRLA 2M8EA 2A61A 5BOXA 2L4AA 2QQBA 1O3RA 3R60A 2QYOA 3CLOA 4A6EA 2XC7A 3FM3A 5CQEA 3KP3A 4C30A 2V1XA 4D7MA 3EYYA 1BW5A 4PFPA 2JWTA 1B59A 4ZYHA 4ABZA 4ETSA 5GPCA 2P6TA 4IEJA 4PJLA 1QGPA 2VQGA 1FOXA 4F3QA 3F8CA 3BR3A 4BKXA 3HJEA 3ULQB 3VPRA 3CC7I 5D4RA 1OCPA 4I09A 1WH5A 1Y8QB 4D1QA 1S7EA 2OF7A 3CJQB 5FFZA 2B9SA 1IW7F 3HGYA 2XROA 1S5LC 1X3WB 3S3MA 5ICCA 4PK4A 2JT1A 2ZSIB 1T38A 3KP2A 2JA5J 1AWCA 4AM3A 2W7NA 1LJ9A 3KPHA 2NYXA 3CCJI 3TP3A 2HVQA 3CJNA 5A2QZ 5IT9K 4AIJA 3CUOA 3DU5A 1BI0A 1YOVB 2K7LA 3K4NA 5GADJ 2FF4A 5L3DA 4E6KG 4FCYA 3F9KA 3ZGKA 2L9VA 3L1PA 3EYIA 4A3EJ 1Z0XA 2DA3A 2IEKA 3E7LA 4IPAA 4DJAA 2HKXA 1NK3P 2XB0X 3C18A 5E20A 3CO6C 2OV7A 1SVMA 3TGNA 3A4CA 4BHCA 1KYWA 3AFHA 2VPRA 2XASA 1MBEA 3ERMA 3K4JA 4AWXB 5GTHC 2LVSA 3BJAA 5D5XB 1J59A 2PQ8A 2DDBA 1FBSA 1GXPA 1HDPA 3X2QH 1IN5A 3HGGA 3B6CA 2R7TA 1U9NA 2CU7A 3P7NA 5LD2C 1O3QA 2JSPA 1SMTA 2MLKA 2D1HA 3LWFA 4UHTA 1BN5A 4CCKA 1APLC 4FTHA 4XBFA 2P5KA 2MFZA 1AHDP 1S29A 1LVKA 2BY2A 1BR1A 1H9GA 5DCMA 3GMEA 3J80Z 2VKDA 1XMKA 2HOSA 3HOUJ 4LLNA 4UY8I 2VI6A 3LSJA 2W48A 3H9QA 1TWAJ 2E36A 3SZTA 5EEHA 4AVZA 3OYAA 3BTLA 3RPQA 2VLAA 2H6CA 1FSEA 2WY8Q 1T08B 4OOIA 3M4OJ 3N05A 5E8IA 3BY6A 2L9NA 2R92J 3K1NA 3OL4A 3V8JA 3IL2A 2XGEA 2V79A 1XS9A 2C6YA 1VQ5I 2GXGA 3BR6A 1JE8A 1R6RA 3RSNA 1SFEA 4BE0A 2VKVA 1NHAA 3PIPF 2DQLA 1TQIA 1HLVA 1T39A 1MMAA 2I5UA 3TW7A 3RKXA 3F23A 2ESHA 3U2RA 3QOPA 1BR2A 1ONVA 4CGZA 1TC3C 1FY7A 2Q1ZB 2DMTA 3A01A 2X85A 3SDBA 4CSWA 1X1CA 4NNJA 3SHFA 3LQQA 3L09A 4IHTA 3Q0VA 5KK1A 5HLIA 3JRFA 3BG6A 4WWCA 1FLIA 2CW8A 2RV8A 1FOKA 2KZVA 4OWRB 4QLCU 3I56I 2Y75A 3QAHA 2FUG2 1B72A 5FLVA 1XPXA 1J7KA 1R5ID 4JX5A 4C2UA 4A12A 4RLFA 1VQ9I 5KCMA 1FJLA 3OYJA 5ED4A 2YUSA 3AG3H 4KUMA 4EJUA 4ESJA 2STWA 1K83J 1R7JA 2VQLA 2FBHA 2QSFX 1Y1WJ 4E7HA 1KZHA 1AU7A 2E2HJ 5LGTA 2BHZA 3RZDJ 2ISYA 2LY9A 5F1JA 4A0ZA 5FLXZ 1BIAA 5FJ8J 4JX4A 2VXDA 1Y39A 1WHUA 1I27A 2KKOA 4GO1A 4PSWA 3ZQCA 1X19A 1B8IB 4E70A 2XAUA 1SEUA 3AL0B 4HBLA 5HS8A 4LK0F 4OINF 3PUBA 3CUQC 3AKZA 2DMUA 1XSDA 2MLGA 1LEAA 3VYRB 2DW4A 3FXMA 2PJPA 4UVBA 2WWYA 5BQTA 5CLSA 5LHIA 1SFUA 5HOOA 2QCOA 3P5JA 4KYWA 1EH7A 2FMYA 1J2XA 2Q2EB 3BG9A 1JHFA 2BHYA 4B3XA 4IHXA 4DYQA 4ZZLA 3OYKA 2O5RA 4AUXA 2AQEA 2JJ7A 2GWRA 2Q0OA 4PDKA 1O3SA 3ZQFA 1BL0A 1W0TA 1WPKA 1XMXA 3K4KA 5BPDA 4BNCA 2MA3A 4RAZA 5F6FA 3FKJA 2R7OA 4FISA 5IYCJ 2F5CA 3PM1A 4ZYDA 3CCSI 3TL4X 1WI3A 1MZBA 1HW1A 4ENMA 2AQFA 4IHWA 3BPVA 4Z6YA 3LA7A 4LJZF 5H6RA 3E3VA 4ZYAA 1V5GA 4PSXA 1K79A 3F8MA 4C3IJ 2VJ4A 1FYLA 3ZP5A 1GV2A 3OOUA 1UJ8A 3LA3A 1R71A 2RDPA 3RPUA 4IVNA 1FZPB 5LRSA 4ENJA 4HW0A 4X1EA 1ETKA 5D6EA 3OS2A 1UAAA 1UG2A 4HNTA 1V3FA 1TWCJ 1XC5A 3G71I 3DU6A 1LNWA 2VJIA 3ZMDA 3KP7A 2Z3YA 3TDZC 3ZMTA 3JW4A 1O57A 1QVTA 5CVUA 2E60A 3IKVA 3LSRA 2M7AA 5ICEA 3JSPA 3TEDA 2XHKA 1TP4A 1UHWA 2XAGA 3ISPA 3J7YJ 2QQ9A 1Z3XA 2B7EA 2X51A 4PUSA 3SXYA 4JK1X 1ZK8A 2OCEA 4HLXA 4XRFA 3J7AY 2XGDA 3COAC 1MNEA 2W57A 2P0WA 5JR3A 1BJZA 3K4BA 2EFOA 1HSTA 4M74A 4N0BA 1D1AA 2XF5A 3ZQGA 5M3FJ 2ZC2A 4B3AA 3WTYC 4AIDA 5FKLA 2A05A 2Y0SN 4FASD 3PQKA 1IJWC 3CJTB 2HZDA 4WK8F 4DOZA 5F04A 4CH7A 1E3OC 3B73A 1V55H 2VC1A 2NOGA 1MNMC 2DDAA 3HTSB 4BY1J 3J7AO 3CP8A 5FKKA 2LKPA 3FMSA 4XLCA 3J81Z 1G3TA 1WFXA 3QPHA 3VSKA 3RKYA 1TW3A 1SVOA 2CQKA 4NC7A 2ELJA 4RLQA 1KU3A 2H8WA 3MQ0A 4HQMA 2A07F 1DP3A 2KHMA 1WQ2A 2UXXA 3W3CA 2HXIA 3WODF 3FBIB 1HQCA 1RPWA 2DTRA 1IN8A 3DF8A 3RKQA 3CCQI 2MH9A 5M5XJ 2DFFA 2V6EA 5E1ZB 3HOXJ 3DPTA 1YG2A 2GOMA 3OWTA 4QTRA 3VYUB 4BY7J 2QGUA 1YYVA 2X1CA 3BR5A 3T1BA 2M87A 2DOEA 4D7NA 5FROA 4ZTJA 1JI8A 3G73A 3ZPLA 4V19K 1ODDA 1AA7A 1NG6A 3ABMH 2D2WA 2PFBA 1T0FC 1TWFJ 1K4SA 2JUGA 3HB9A 4Y33A 3JRHA 2FBKA 4Y17A 4KIBA 3M8FA 4IRIA 3IV5A 3SFZA 3OIOA 3IH4A 3W6JB 2CFXA 3KFWX 2QBYA 4CA0A 4BBSJ 3GEZA 3OYFA 1EJ9A 4EJTA 4ANJA 3JRAA 2LY2A 1N77A 2HGCA 1BOBA 3U9GA 4A5MA 1F5TA 4CYCB 2DXIA 5KAIC 2Y0MA 2EBIA 3DTEA 4HX4A 5F1RA 1O7LA 1KU9A 4N4OB 1D5VA 4EMSA 3JRIA 4RB0A 4U88A 2IAIA 2IP2A 2ZKZA 4PZJA 2R5YA 2R5ZA 2X0LA 3S93A 5HS7A 4F7ZA 1IN4A 1VQ7I 3CO7C 1W7PB 3W2AA 1WJAA 4EEFG 2BE5F 2OU2A 2CRGA 2EZIA 4UB8C 2HYJA 5LBQA 1G8XA 2V4JC 1YFHA 3EUHC 5DD4A 3LSPA 1OCTC 4OMYA 1HC8A 1WJEA 4P9UA 2IS2A 2E7WA 4QPQA 1XCVA 4I76A 4CCNA 2RAEA 2OQRA 1OYYA 5L3GA 3VWBA 2BY3A 1LEBA 1ZH5A 1XTAA 4NC6A 3A03A 4BGDA 2O8KA 3W6KB 2K3FA 3CESA 3JREA 2V26A 4I98B 1TQPA 4A3KJ 3KLOA 4M9XA 3SEQA 4D9JA 3C1DA 2KISA 4OMZA 3S16J 3E5UA 1IRFA 2EPFA 4PJMA 2ZCWA 4KA4A 4LGWA 3K0LA 2HOAA 3Q9VA 1ZRDA 3S3NA 2P5VA 1FX7A 2L9SA 3BQYA 5FB2A 2R3SA 4XKBA 5J47A 3L2WA 1MH4A 5HLGA 4E7JA 2VKHA 1XG1A 1EA3A 4B43A 5JHFA 1D1CA 2E1CA 1W4MA 3LSMA 1FNNA 1XSVA 1RUNA 1FMWA 3I64A 1S6LA 4PGGA 3QYFA 3H36A 1GT0C 1ERDA 2W85A 3EPZA 2A6EF 3VSLA 4V2GA 3KYLA 5ICGA 3RJPA 2NVTJ 1EKEA 3C2GA 4I2OA 2W00A 3H9JA 5FRMA 3CD6I 3M9AA 3BG7A 1F9NA 2ECCA 1OYIA 3MWMA 3AG4H 2R7FA 4ZC3A 4ZH4F 3FHZA 2DOAA 3HRTA 4M9ZA 1D0YA 5HNHA 1AOYA 3G1LA 1ORKA 5J4YA 1TL8A 1SD4A 2JA8J 1RRJA 2LRDA 2OA4A 2IW5A 3SYTA 3ZR8X 1MKMA 1QO0D 1B9MA 2WC2A 5GPAA 4KICA 4RDUA 1MSFC 2KIUA 3TW6A 4IRHA 4XM3A 3GTGJ 3H92A 4G6TB 2DT5A 3FKIJ 1JKOC 5EEAA 4MO7A 3H9GA 2JRTA 2LF7A 3IWFA 3NRVA 2HVRA 2EZHA 1JTYA 2PMZA 1VZ0A 3E6DA 5JHUA 2XSJC 3QODA 1MDMA 2P7CB 4A3LJ 4IRGA 4MTEA 3I59A 4IOCF 3IAM2 3HKZA 1X1BA 2PJRA 2ADUA 3BLYA 2CV0A 5ILVA 3BTJA 3QWLA 3FISA 4BJ5C 1QNTA 3LSHA 3FMQA 4C2MJ 3B02A 2HPIA 4KN4X 3PJRA 3OYHA 1DGRM 2ZNZA 2HQAA 2MW8A 1OFCX 2FEZA 2V6CA 3VB2A 4CUGA 2BZTA 1E0EA 2KL4A 2W25A 2IGNA 1K78A 2W4SA 3GVAA 3GTJJ 2W1OA 1QZEA 2P5LC 4FX4A 4XLAA 1FMVA 2E71A 4BS9A 3MZ8A 3REOA 2GZWA 2KIMA 3CZ6A 4WXHA 1M1EB 3PL8A 1PUFA 2O6GE 4UUTA 2IGOA 2VL8A 3V7RA 5BPIA 5EGOB 1N25A 1P2FA 3GTPJ 2VJJA 4HF0A 1XSXA 3LQRA 4BXXJ 2O7OA 4A3DJ 2R5YB 5IP9J 4RGXA 1UHMA 3NARA 1X4PA 3L2VA 4DGWB 3CMAI 1FYMA 1VQ4I 3PO3J 2WV0A 1DU0A 3BQZA 3M1EA
chains in the Genus database with same CATH topology
3V4GA 2Z99A 3O6BB 3D0SA 2FBIA 2IPQX 3L2CA 3HTUA 3WTZA 1MD0A 2IA0A 1P4XA 2UWMA 4ON0A 5J8FA 4CO8A 1PP8F 3M8EA 1UB9A 2ELHA 4A2UA 1BI3A 2YX4A 1IRGA 2QUFA 1DDNA 1RNLA 4L9TA 1I5ZA 2HDCA 3DFGA 4LK1F 2K4JA 4G8XA 1Y0UA 4FT8A 4L9JA 2O61A 3GZ5A 4U7DA 1JHHA 2HKOA 2RKHA 1MGTA 4MEYF 4U7BA 4Z2YA 2UZKA 1ZREA 5BS6A 5AIQA 1Z1DA 1IF1A 1D8JA 5CJ9A 3BPXA 2ZMEB 2O8XA 2Q8KA 3CTAA 2D1VA 3GX4X 1KQ9A 5HS9A 2JPBA 4FHTA 1HKQA 2JPCA 1ZYRF 2W24A 5LEJA 1KU2A 3I59B 2K4BA 2CYYA 5JFRA 1R23A 5L3EA 3E5XA 5F64A 1B1BA 1TW2A 3O3KA 1ZGJA 2IJLA 2VE9A 5CVVA 2P8TA 1K78B 2HYFA 5K5OA 2BV6A 3HOTA 4P9FA 4MTDA 3DKWA 4AVPA 3N4MA 1GHCA 4AD9A 5K5QA 4R8HA 2PEXA 3TKYA 3JSOA 2PI0A 2DBBA 1SD6A 4NQWA 3HYIA 4HAMA 5LLQA 1W5SA 4XLPF 3U1DA 3C3WA 1YW9A 2PMUA 2EV5A 1U2WA 2ISZA 1U5TA 2QWWA 1DP7P 2HTSA 3Q9SA 2CW0F 2K02A 2H09A 4L5JA 1WI9A 1OYWA 1CGPA 3FXQA 4EGYA 2H94A 3R61A 1ZG1A 2HYGD 5DD8A 1U3EM 4K2EA 1WKMA 1UCRA 1J5YA 1U8RA 2HQRA 2A68F 3IC7A 3JAMK 4RGUA 3F22A 4LD5A 2O03A 5IT9Z 3KEQA 2VOOA 3NQOA 1STZA 1USTA 4O5VA 4UUVA 1X3UA 3MEXA 1BI1A 3GO5A 2M5WA 4RGSA 1ZLJA 2G7UA 2ESNA 2DK5A 1BOAA 2FSWA 2BGCA 4IXAA 5AONA 2KJCA 2P4WA 4KDPA 3HRUA 1JXSA 5BMZA 2HTJA 4Y13A 4YIFA 4EV0A 2XVCA 4ESBA 4OIRF 3CDHA 2RN7A 4U0VA 2IVMA 3DPLC 1SD5A 1LQ1A 2YU3A 1XGOA 1OMIA 5D8KB 2VC0A 4G94A 1T98A 2FRHA 3F3XA 5E18F 3HHGA 1Z05A 1RIOH 4R79A 3VODA 1QZZA 1Z6RA 2DPUA 1BI2A 1B6AA 1OKRA 2J5OA 4P55A 1Z9CA 1LDDA 3TQNA 1BC7C 1J9IA 1R1UA 3ML6A 2OD5A 3F6VA 2XAQA 4NB5A 3E6MA 2J5PA 4A6DA 2ZO4A 5HDKA 4UVAA 5DCMB 2IA1A 1J0RA 3GZ6A 1TLHB 2LSOA 4H0EA 1YS6A 1U5TB 2CG4A 1P4WA 4DNCA 3GFLA 4U0WA 3C7JA 2EA4A 3MAJA 3KP4A 3F72A 4HDVA 1S7AA 2L4MA 2NNYA 3HUGA 3GF2A 1TNTA 1KYZA 2GIVA 4UV8A 3ZMVA 1C0WA 3WTXC 4I01A 3I4PA 4Q48A 3ZN0A 3FZVA 3ROUA 1PUEE 5ILUA 1F4KA 3GFIA 3QP6A 5EEGA 1XGMA 1ZG5A 4BHPA 3ERED 2LNBA 2ACJA 5CYVA 4LG0A 4JQFA 3SZPA 2EB7A 3R0AA 2EK5A 2EFWA 2ETHA 2R7DA 3V8LA 2X4HA 3K2ZA 2FA5A 1S7OA 3EETA 5LRRA 3DXJF 3CUQA 4RGRA 2HQNA 3LA2A 4BHBA 1D8KA 4Q4ZF 3HOSA 3TO7A 2DFIA 4HV5A 2OBPA 4I7HA 1KQ8A 1SFXA 3VOEA 3GXOA 5ILSA 1ZN2A 5E1XA 2Z5UA 4RB2C 1XB4A 2YSRA 4OIQF 4RAYA 4M9SA 3GFMA 4G9YA 1L0OC 1MJAA 1PP7U 1ULYA 3F6OA 2CWEA 1G6NA 3G3ZA 1YLFA 2RGVA 4DQ2A 1DPUA 3LSTA 4EVIA 1KQ0A 4XLNF 4OIOF 3P9CA 4L18B 4D0PA 1XDUA 1R5HA 3BZ6A 4KIGA 2PMHA 4ZZDA 2D45A 2FNAA 5DDGA 5DV5A 2OZUA 2RNJA 2QM3A 4ENKA 2V1DA 5L3FA 1SAXA 4LB6B 5K1YA 5HDGA 2VONA 3TOBA 5D5VB 2L3DA 1XD7A 1FP2A 2F5FA 3T5XA 3AAFA 1Q1HA 4IF4A 3OOPA 2DU9A 3WTSC 2HWVA 1T6SA 1SD7A 3GUDA 4A0YA 4RB3C 3PFIA 4I0AA 2A3SA 4HQEA 1YQAA 4GXOA 4UNOA 2VOPA 5JVTA 2KRFA 1QQIA 2EV0A 1T0FA 4KFCA 3FF5A 3HSRA 1IUYA 4AIHA 1FSHA 4HV6A 3WE3A 1E2XA 1KU7A 1K6OA 3BJOA 3VFZA 2NS0A 1TTYA 5D4SA 2RVCA 3BWGA 1I1GA 3ZMZA 5JI6A 4LFUA 2DLLA 3WTUC 1ON2A 1HBXG 4WXCA 3R0JA 5E1WA 4P5OA 1FBQA 3ABTA 2XIGA 2QBYB 3EUHA 2QZ8A 4N9IA 2VBYA 2FOKA 4Q5SF 4M6XA 4BH9A 2QENA 2RQPA 3WU0A 3WGIA 1HXDA 2PN6A 1W7PD 1DPRA 3P9IA 2FQ3A 2VBXA 1D3YA 1FP1D 4L9VA 3O2PE 3IHUA 4MGRA 2LDUA 3RDIA 2L54A 2XGXA 3ZQ7A 1RZ4A 1G4DA 2G7HA 3WTVC 3R6SA 2L02A 4LLGF 2HFHA 3ZMUA 4NHJA 2STTA 2CGPA 2DAOA 3E5QA 3MCZA 4BAYA 1YS7A 1BBYA 5FO5A 1TQMA 2XUBA 4CZZA 2VT2A 2E7XA 3BP8A 3L7WA 2HOEA 2L01A 4MQVA 2A69F 5A2QK 2EA2A 1G3WA 4L0YB 5LHHA 4KT5C 1R00A 4EM0B 1KA8A 4ZYGA 2QVOA 3I5UA 2BEOA 2ZFWA 4HLYA 3ZMSA 2VBWA 2ZXJA 3F8BA 3FXRA 1SMYF 5HVQC 1U6GA 1L3LA 3H3ZA 4I0BA 3WGHA 1XMAA 2A5YB 3KE2A 2EFNA 5DEQA 1IN7A 3VEPA 3D5LA 3GWZA 1MDMB 3T8TA 1PDNC 2XKPA 4YFXF 4S04A 4R1HA 5L3BA 3E6CC 4HYEA 4OIPF 2OZ6A 1GVJA 4EJWA 3J80K 1ZHFA 3T8RA 2JZYA 3ECOA 3WG9A 3DQVC 4A0XA 2IRFG 3HHHA 4TV7A 4G7OF 3IKTA 1FWZA 3FMRA 3RYPA 4M71A 4UV9A 4YG2F 1R22A 3QU6A 4G6QA 3I58A 4LB5A 4MNUA 5H20A 5D5WB 1VTNC 3E97A 2XAHA 2M30A 2Q2EA 4HX7A 3HSEA 1IAWA 1IN6A 1FC3A 4LMYA 4P96A 4KIFA 5CVIA 1ZRFA 1P92A 4G7HF 2XRNA 2WTEA 4RS8A 2QLZA 5D8LB 2Z33A 2GA1A 5KVRA 2VBZA 2F2EA 4GYIA 2OQGA 4JBAA 5FLXK 2KIFA 4GCVA 3E6BA 5LGUA 4O3MA 1V4RA 4CHUA 2YR2A 4GYGA 2HEOA 2K86A 3L9FA 3QP5A 2NNNA 1TBXA 4LLLA 1HW2A 1CF7A 4HF2A 1H0MA 2PLYA 3ABUA 3M7GA 2DQRA 3DV8A 1ZLKA 5DYMA 4OU0A 4EJOA 3WE2A 1FPQA 3TOAA 1RI7A 4CDGA 1YIOA 4CXFA 3KCCA 3V7SA 4M6YA 2PBIA 1BC8C 6PAXA 1Z91A 2FXAA 4WF2A 2G9WA 1Z7UA 1HKTA 1ZRCA 1B4AA 4HA8A 4KNYA 1KGSA 3R4KA 1XCBA 1EH6A 3KETA 1HSJA 2COMA 3LFKA 3K1MA 2IA2A 4N9HA 2KJBA 4O6JA 1LB2A 4HOBA 2YPRA 2XKOA 1OPCA 4MHGA 1QZYA 4UXNA 3RIRA 1H9TA 4CICA 3ELKA 3SQNA 5AIPA 2YX7A 1YW7A 4CYDA 2DK8A 2MBFA 2VE8A 3Q5FA 1G3SA 4YFKF 2P6SA 2XAJA 1S3JA 3KZYA 3I53A 3BROA 1MJ9A 3KP5A 4M73A 1GXQA 2H6BA 1USSA 2M45A 2VT3A 3NEUA 1EV7A 3JAMZ 3KLNA 1IXSB 3GW2A 3KEOA 4KMUX 3J81K 4BYYA 5FGMA 1HKSA 1HW5A 3GLXA 1I6XA 4IJAA 3BDDA 3FWEA 1P6RA 1W7PA 1WSUA 1O3TA 2GAUA 1LDJA 5HDNA 2NRAC 2FE3A 1RUOA 3WGGA 2ZNYA 4L9NA 2AXLA 5ERIA 1EH8A 2ZBKA 1B9NA 3IRQA 1LDKB 4HF1A 1IZ1A 1A04A 2HR3A 2F5EA 3RTRA 1J75A 3IRRA 2MH2A 3L00A 2RC4A 3EQLF 5D5UB 4PCQA 4U0YA 1XGNA 4EJVA 3QU3A 3I0TA 3MZYA 1CF7B 2QQAA 3WU1B 5D6FA 4EGZA 5LHGA 3HIFA 5CVRA 4UVCA 4HX8A 2Y48A 5LGNA 1REPC 5J8CA 3P9KA 4M72A 2DPDA 3K69A 2PG4A 3V8KA 1XGSA 1R36A 3V7CA 4KN7X 3TO6A 4HDUA 3K9TA 3I71A 2EWNA 1P4AA 1ZARA 1R1VA 4I02A 5J6XA 1K7AA 1BJAA 4ZYEA 4B09A 3HSFA 4YIIA 5FD5A 1ZG3A 3IWZA 5E8GA 1BIBA 5DUKA 3EDPA 4Q47A 5FFXA 1S8NA 4IHSA 2E1NA 4ESFA 2FNPA 5L3CA 3WTWC 1O7FA 2EV6A 2EFQA 3MZHA 4MQ9F 4GGGA 4L5IA 1T2KA 3ZN1A 2BBYA 3F8NA 3TDUC 1R1TA 2GQQA 3N97A 4RB1A 2DI3A 3MFKA 2IT0A 1WWXA 3KP6A 4AIKA 3ECHA 1ZGAA 3KZZA 1WRJA 1XN7A 2VXZA 5ICFA 3RKWA 1I1SA 1R5GA 1QPMA 3H3UA 2K27A 1FBUA 3GFJA 5K5RA 1FT9A 1OR7A 4LG0B 2A6HF 5TJJA 5H6QA 2HS5A 2EJRA 1U78A 3I54A 2VODA 2FU4A 2CO5A 1YTYA 2UXNA 1DUXC 3LAPA 1FYKA 1UFMA 5LEKA 1IXCA 3CUQB 1IXRC 4HZFA 4ASNA 3DEUA 2LF8A 2MC3A 1LVAA 4BXUA 5DCFA 4YFNF 2ZMEA 4KMFA 4PGHA 3F21A 1E17A 2M1BA 4EM1A 2AS5F 3TO9A 1QBJA 2W84A 4MEXF 3HRSA 2BYVE 3K1PA 1ZAOA 2V9VA 3BOQA 2B0LA 2HZTA 4WXDA 4L0ZB 2TDXA 1JGSA 3RYRA 3FX3A 3FM5A 1W5TA 1Z6TA 2P7VB 3F8FA 4WCGA 1BM9A 4G6DA 2Z9OA 1G3YA 2XV4S 1XDSA 4XSXF 2F5DA 5TRDA 2H27A 4BQAA 3JTHA 3GYHX 3QRFF 2O0YA 4WX9A 3RI4A 2O3FA 3JTGA 2CSOA 1YO5C 3HRMA 1ON1A 4QWQA 3WTTC 4G7ZF 2JTVA 3QPTA 5E17F 5IT3A 3FXUA 3T0YA 2JSCA 2EFPA 4Y15A 4XSZF 2NAZA 3DP7A 3LAJA 2GXBA 2GA2A 2ZJ2A 4EQQA 5FD6A 1MJBA 2XAFA 3S2WA 1YW8A 4ENNA 5CVJA 4S05A 1TNSA 3BJ6A 2DO7A 2MD5A 4EM2A 2V1UA 2FMLA 5DUIA 1U5TC 2OAZA 3OV8A 1R58A 4B8XA 2VN2A 4A5NA 1F1ZA 5HLHA 4FX0A 3PQJA 2M8EA 2A61A 5BOXA 2L4AA 2QQBA 1O3RA 3R60A 2QYOA 3CLOA 4A6EA 3FM3A 3KP3A 2V1XA 3EYYA 4ZYHA 1B59A 4ETSA 2P6TA 1QGPA 3F8CA 3ULQB 5D4RA 4I09A 5FFZA 1IW7F 2XROA 5ICCA 2JT1A 1T38A 3KP2A 1AWCA 1LJ9A 2NYXA 3CJNA 5A2QZ 5IT9K 4AIJA 3CUOA 1BI0A 2K7LA 2FF4A 5L3DA 3EYIA 4IPAA 2HKXA 3C18A 5E20A 3CO6C 3TGNA 4BHCA 1KYWA 2XASA 4AWXB 3BJAA 5D5XB 1J59A 2PQ8A 1FBSA 1GXPA 1IN5A 3P7NA 1O3QA 1SMTA 2MLKA 2D1HA 3LWFA 4UHTA 1BN5A 4XBFA 2P5KA 1S29A 1H9GA 5DCMA 3J80Z 1XMKA 4LLNA 3SZTA 5EEHA 3RPQA 2H6CA 1FSEA 4OOIA 5E8IA 3BY6A 3K1NA 3V8JA 3IL2A 2V79A 2C6YA 2GXGA 1JE8A 1SFEA 1NHAA 2DQLA 1TQIA 1T39A 3RKXA 3F23A 2ESHA 3U2RA 3QOPA 1ONVA 4CGZA 1FY7A 3SHFA 3LQQA 3L09A 4IHTA 5KK1A 5HLIA 4WWCA 1FLIA 2RV8A 1FOKA 4QLCU 2Y75A 3QAHA 1J7KA 4A12A 5ED4A 4KUMA 4EJUA 4ESJA 2STWA 1R7JA 2FBHA 5LGTA 2ISYA 4A0ZA 5FLXZ 1BIAA 1I27A 2KKOA 4GO1A 4E70A 4HBLA 5HS8A 4LK0F 4OINF 3CUQC 1XSDA 2MLGA 1LEAA 2PJPA 2DW4A 4UVBA 2WWYA 5BQTA 5CLSA 5LHIA 1SFUA 5HOOA 4KYWA 1EH7A 2FMYA 1J2XA 1JHFA 4ZZLA 2GWRA 2Q0OA 4PDKA 1O3SA 4BNCA 5BPDA 2MA3A 4RAZA 5F6FA 2F5CA 4ZYDA 1MZBA 1HW1A 4ENMA 3BPVA 3LA7A 4LJZF 5H6RA 3E3VA 1K79A 3F8MA 1FYLA 3ZP5A 3LA3A 2RDPA 3RPUA 4IVNA 1FZPB 5LRSA 4ENJA 4HW0A 5D6EA 1V3FA 1LNWA 3ZMDA 3KP7A 2Z3YA 3TDZC 3ZMTA 3JW4A 1O57A 5CVUA 3IKVA 5ICEA 3JSPA 2XHKA 1UHWA 2XAGA 3ISPA 2QQ9A 3SXYA 4JK1X 4HLXA 4XRFA 3COAC 2W57A 5JR3A 2EFOA 1HSTA 4M74A 4N0BA 3WTYC 3PQKA 4WK8F 3B73A 2VC1A 3J7AO 3HTSB 2LKPA 3FMSA 3J81Z 1G3TA 3QPHA 3RKYA 1TW3A 2CQKA 1KU3A 3MQ0A 4HQMA 2A07F 1WQ2A 2UXXA 3WODF 1HQCA 2DTRA 1IN8A 3DF8A 2MH9A 5E1ZB 3DPTA 1YG2A 1YYVA 3T1BA 2M87A 3G73A 3ZPLA 1ODDA 2D2WA 2PFBA 2FBKA 4Y17A 4KIBA 3M8FA 4IRIA 3SFZA 3W6JB 2CFXA 3KFWX 2QBYA 3GEZA 4EJTA 2HGCA 3U9GA 4A5MA 1F5TA 2Y0MA 4HX4A 5F1RA 1O7LA 1KU9A 1D5VA 4EMSA 4RB0A 4U88A 2IP2A 2ZKZA 4PZJA 2X0LA 5HS7A 4F7ZA 1IN4A 3CO7C 1W7PB 2BE5F 2OU2A 5LBQA 1YFHA 5DD4A 4OMYA 4P9UA 2E7WA 1XCVA 2OQRA 1OYYA 5L3GA 1LEBA 1ZH5A 3W6KB 4I98B 1TQPA 3KLOA 4M9XA 3C1DA 4OMZA 3E5UA 1IRFA 2ZCWA 4KA4A 4LGWA 3K0LA 3Q9VA 1ZRDA 2P5VA 1FX7A 5FB2A 2R3SA 5HLGA 2E1CA 1W4MA 1FNNA 1XSVA 1RUNA 3I64A 1S6LA 4PGGA 2W85A 2A6EF 5ICGA 3RJPA 4I2OA 3M9AA 1F9NA 1OYIA 3MWMA 2R7FA 4ZH4F 3FHZA 3HRTA 4M9ZA 1AOYA 1SD4A 2OA4A 2IW5A 1MKMA 1QO0D 1B9MA 2WC2A 4KICA 2KIUA 4IRHA 3H92A 2DT5A 2JRTA 2LF7A 3IWFA 3NRVA 3E6DA 5JHUA 2P7CB 1MDMA 4IRGA 4MTEA 3I59A 2ADUA 5ILVA 1QNTA 3FMQA 3B02A 4KN4X 2ZNZA 3VB2A 2V6CA 2FEZA 2W25A 1K78A 3GVAA 2P5LC 4FX4A 3REOA 2GZWA 2KIMA 4WXHA 2O6GE 3V7RA 5BPIA 1P2FA 4HF0A 1XSXA 3LQRA 4RGXA 1UHMA 1FYMA 2WV0A 3M1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4G A;  2Z99 A;  3O6B B;  3D0S A;  2FBI A;  2IPQ X;  3L2C A;  3HTU A;  3WTZ A;  1MD0 A;  2IA0 A;  1P4X A;  2UWM A;  4ON0 A;  5J8F A;  4CO8 A;  1PP8 F;  3M8E A;  1UB9 A;  2ELH A;  4A2U A;  1BI3 A;  2YX4 A;  1IRG A;  2QUF A;  1DDN A;  1RNL A;  4L9T A;  1I5Z A;  2HDC A;  3DFG A;  4LK1 F;  2K4J A;  4G8X A;  1Y0U A;  4FT8 A;  4L9J A;  2O61 A;  3GZ5 A;  4U7D A;  1JHH A;  2HKO A;  2RKH A;  1MGT A;  4MEY F;  4U7B A;  4Z2Y A;  2UZK A;  1ZRE A;  5BS6 A;  5AIQ A;  1Z1D A;  1IF1 A;  1D8J A;  5CJ9 A;  3BPX A;  2ZME B;  2O8X A;  2Q8K A;  3CTA A;  2D1V A;  3GX4 X;  1KQ9 A;  5HS9 A;  2JPB A;  4FHT A;  1HKQ A;  2JPC A;  1ZYR F;  2W24 A;  5LEJ A;  1KU2 A;  3I59 B;  2K4B A;  2CYY A;  5JFR A;  1R23 A;  5L3E A;  3E5X A;  5F64 A;  1B1B A;  1TW2 A;  3O3K A;  1ZGJ A;  2IJL A;  2VE9 A;  5CVV A;  2P8T A;  1K78 B;  2HYF A;  5K5O A;  2BV6 A;  3HOT A;  4P9F A;  4MTD A;  3DKW A;  4AVP A;  3N4M A;  1GHC A;  4AD9 A;  5K5Q A;  4R8H A;  2PEX A;  3TKY A;  3JSO A;  2PI0 A;  2DBB A;  1SD6 A;  4NQW A;  3HYI A;  4HAM A;  5LLQ A;  1W5S A;  4XLP F;  3U1D A;  3C3W A;  1YW9 A;  2PMU A;  2EV5 A;  1U2W A;  2ISZ A;  1U5T A;  2QWW A;  1DP7 P;  2HTS A;  3Q9S A;  2CW0 F;  2K02 A;  2H09 A;  4L5J A;  1WI9 A;  1OYW A;  1CGP A;  3FXQ A;  4EGY A;  2H94 A;  3R61 A;  1ZG1 A;  2HYG D;  5DD8 A;  1U3E M;  4K2E A;  1WKM A;  1UCR A;  1J5Y A;  1U8R A;  2HQR A;  2A68 F;  3IC7 A;  3JAM K;  4RGU A;  3F22 A;  4LD5 A;  2O03 A;  5IT9 Z;  3KEQ A;  2VOO A;  3NQO A;  1STZ A;  1UST A;  4O5V A;  4UUV A;  1X3U A;  3MEX A;  1BI1 A;  3GO5 A;  2M5W A;  4RGS A;  1ZLJ A;  2G7U A;  2ESN A;  2DK5 A;  1BOA A;  2FSW A;  2BGC A;  4IXA A;  5AON A;  2KJC A;  2P4W A;  4KDP A;  3HRU A;  1JXS A;  5BMZ A;  2HTJ A;  4Y13 A;  4YIF A;  4EV0 A;  2XVC A;  4ESB A;  4OIR F;  3CDH A;  2RN7 A;  4U0V A;  2IVM A;  3DPL C;  1SD5 A;  1LQ1 A;  2YU3 A;  1XGO A;  1OMI A;  5D8K B;  2VC0 A;  4G94 A;  1T98 A;  2FRH A;  3F3X A;  5E18 F;  3HHG A;  1Z05 A;  1RIO H;  4R79 A;  3VOD A;  1QZZ A;  1Z6R A;  2DPU A;  1BI2 A;  1B6A A;  1OKR A;  2J5O A;  4P55 A;  1Z9C A;  1LDD A;  3TQN A;  1BC7 C;  1J9I A;  1R1U A;  3ML6 A;  2OD5 A;  3F6V A;  2XAQ A;  4NB5 A;  3E6M A;  2J5P A;  4A6D A;  2ZO4 A;  5HDK A;  4UVA A;  5DCM B;  2IA1 A;  1J0R A;  3GZ6 A;  1TLH B;  2LSO A;  4H0E A;  1YS6 A;  1U5T B;  2CG4 A;  1P4W A;  4DNC A;  3GFL A;  4U0W A;  3C7J A;  2EA4 A;  3MAJ A;  3KP4 A;  3F72 A;  4HDV A;  1S7A A;  2L4M A;  2NNY A;  3HUG A;  3GF2 A;  1TNT A;  1KYZ A;  2GIV A;  4UV8 A;  3ZMV A;  1C0W A;  3WTX C;  4I01 A;  3I4P A;  4Q48 A;  3ZN0 A;  3FZV A;  3ROU A;  1PUE E;  5ILU A;  1F4K A;  3GFI A;  3QP6 A;  5EEG A;  1XGM A;  1ZG5 A;  4BHP A;  3ERE D;  2LNB A;  2ACJ A;  5CYV A;  4LG0 A;  4JQF A;  3SZP A;  2EB7 A;  3R0A A;  2EK5 A;  2EFW A;  2ETH A;  2R7D A;  3V8L A;  2X4H A;  3K2Z A;  2FA5 A;  1S7O A;  3EET A;  5LRR A;  3DXJ F;  3CUQ A;  4RGR A;  2HQN A;  3LA2 A;  4BHB A;  1D8K A;  4Q4Z F;  3HOS A;  3TO7 A;  2DFI A;  4HV5 A;  2OBP A;  4I7H A;  1KQ8 A;  1SFX A;  3VOE A;  3GXO A;  5ILS A;  1ZN2 A;  5E1X A;  2Z5U A;  4RB2 C;  1XB4 A;  2YSR A;  4OIQ F;  4RAY A;  4M9S A;  3GFM A;  4G9Y A;  1L0O C;  1MJA A;  1PP7 U;  1ULY A;  3F6O A;  2CWE A;  1G6N A;  3G3Z A;  1YLF A;  2RGV A;  4DQ2 A;  1DPU A;  3LST A;  4EVI A;  1KQ0 A;  4XLN F;  4OIO F;  3P9C A;  4L18 B;  4D0P A;  1XDU A;  1R5H A;  3BZ6 A;  4KIG A;  2PMH A;  4ZZD A;  2D45 A;  2FNA A;  5DDG A;  5DV5 A;  2OZU A;  2RNJ A;  2QM3 A;  4ENK A;  2V1D A;  5L3F A;  1SAX A;  4LB6 B;  5K1Y A;  5HDG A;  2VON A;  3TOB A;  5D5V B;  2L3D A;  1XD7 A;  1FP2 A;  2F5F A;  3T5X A;  3AAF A;  1Q1H A;  4IF4 A;  3OOP A;  2DU9 A;  3WTS C;  2HWV A;  1T6S A;  1SD7 A;  3GUD A;  4A0Y A;  4RB3 C;  3PFI A;  4I0A A;  2A3S A;  4HQE A;  1YQA A;  4GXO A;  4UNO A;  2VOP A;  5JVT A;  2KRF A;  1QQI A;  2EV0 A;  1T0F A;  4KFC A;  3FF5 A;  3HSR A;  1IUY A;  4AIH A;  1FSH A;  4HV6 A;  3WE3 A;  1E2X A;  1KU7 A;  1K6O A;  3BJO A;  3VFZ A;  2NS0 A;  1TTY A;  5D4S A;  2RVC A;  3BWG A;  1I1G A;  3ZMZ A;  5JI6 A;  4LFU A;  2DLL A;  3WTU C;  1ON2 A;  1HBX G;  4WXC A;  3R0J A;  5E1W A;  4P5O A;  1FBQ A;  3ABT A;  2XIG A;  2QBY B;  3EUH A;  2QZ8 A;  4N9I A;  2VBY A;  2FOK A;  4Q5S F;  4M6X A;  4BH9 A;  2QEN A;  2RQP A;  3WU0 A;  3WGI A;  1HXD A;  2PN6 A;  1W7P D;  1DPR A;  3P9I A;  2FQ3 A;  2VBX A;  1D3Y A;  1FP1 D;  4L9V A;  3O2P E;  3IHU A;  4MGR A;  2LDU A;  3RDI A;  2L54 A;  2XGX A;  3ZQ7 A;  1RZ4 A;  1G4D A;  2G7H A;  3WTV C;  3R6S A;  2L02 A;  4LLG F;  2HFH A;  3ZMU A;  4NHJ A;  2STT A;  2CGP A;  2DAO A;  3E5Q A;  3MCZ A;  4BAY A;  1YS7 A;  1BBY A;  5FO5 A;  1TQM A;  2XUB A;  4CZZ A;  2VT2 A;  2E7X A;  3BP8 A;  3L7W A;  2HOE A;  2L01 A;  4MQV A;  2A69 F;  5A2Q K;  2EA2 A;  1G3W A;  4L0Y B;  5LHH A;  4KT5 C;  1R00 A;  4EM0 B;  1KA8 A;  4ZYG A;  2QVO A;  3I5U A;  2BEO A;  2ZFW A;  4HLY A;  3ZMS A;  2VBW A;  2ZXJ A;  3F8B A;  3FXR A;  1SMY F;  5HVQ C;  1U6G A;  1L3L A;  3H3Z A;  4I0B A;  3WGH A;  1XMA A;  2A5Y B;  3KE2 A;  2EFN A;  5DEQ A;  1IN7 A;  3VEP A;  3D5L A;  3GWZ A;  1MDM B;  3T8T A;  1PDN C;  2XKP A;  4YFX F;  4S04 A;  4R1H A;  5L3B A;  3E6C C;  4HYE A;  4OIP F;  2OZ6 A;  1GVJ A;  4EJW A;  3J80 K;  1ZHF A;  3T8R A;  2JZY A;  3ECO A;  3WG9 A;  3DQV C;  4A0X A;  2IRF G;  3HHH A;  4TV7 A;  4G7O F;  3IKT A;  1FWZ A;  3FMR A;  3RYP A;  4M71 A;  4UV9 A;  4YG2 F;  1R22 A;  3QU6 A;  4G6Q A;  3I58 A;  4LB5 A;  4MNU A;  5H20 A;  5D5W B;  1VTN C;  3E97 A;  2XAH A;  2M30 A;  2Q2E A;  4HX7 A;  3HSE A;  1IAW A;  1IN6 A;  1FC3 A;  4LMY A;  4P96 A;  4KIF A;  5CVI A;  1ZRF A;  1P92 A;  4G7H F;  2XRN A;  2WTE A;  4RS8 A;  2QLZ A;  5D8L B;  2Z33 A;  2GA1 A;  5KVR A;  2VBZ A;  2F2E A;  4GYI A;  2OQG A;  4JBA A;  5FLX K;  2KIF A;  4GCV A;  3E6B A;  5LGU A;  4O3M A;  1V4R A;  4CHU A;  2YR2 A;  4GYG A;  2HEO A;  2K86 A;  3L9F A;  3QP5 A;  2NNN A;  1TBX A;  4LLL A;  1HW2 A;  1CF7 A;  4HF2 A;  1H0M A;  2PLY A;  3ABU A;  3M7G A;  2DQR A;  3DV8 A;  1ZLK A;  5DYM A;  4OU0 A;  4EJO A;  3WE2 A;  1FPQ A;  3TOA A;  1RI7 A;  4CDG A;  1YIO A;  4CXF A;  3KCC A;  3V7S A;  4M6Y A;  2PBI A;  1BC8 C;  6PAX A;  1Z91 A;  2FXA A;  4WF2 A;  2G9W A;  1Z7U A;  1HKT A;  1ZRC A;  1B4A A;  4HA8 A;  4KNY A;  1KGS A;  3R4K A;  1XCB A;  1EH6 A;  3KET A;  1HSJ A;  2COM A;  3LFK A;  3K1M A;  2IA2 A;  4N9H A;  2KJB A;  4O6J A;  1LB2 A;  4HOB A;  2YPR A;  2XKO A;  1OPC A;  4MHG A;  1QZY A;  4UXN A;  3RIR A;  1H9T A;  4CIC A;  3ELK A;  3SQN A;  5AIP A;  2YX7 A;  1YW7 A;  4CYD A;  2DK8 A;  2MBF A;  2VE8 A;  3Q5F A;  1G3S A;  4YFK F;  2P6S A;  2XAJ A;  1S3J A;  3KZY A;  3I53 A;  3BRO A;  1MJ9 A;  3KP5 A;  4M73 A;  1GXQ A;  2H6B A;  1USS A;  2M45 A;  2VT3 A;  3NEU A;  1EV7 A;  3JAM Z;  3KLN A;  1IXS B;  3GW2 A;  3KEO A;  4KMU X;  3J81 K;  4BYY A;  5FGM A;  1HKS A;  1HW5 A;  3GLX A;  1I6X A;  4IJA A;  3BDD A;  3FWE A;  1P6R A;  1W7P A;  1WSU A;  1O3T A;  2GAU A;  1LDJ A;  5HDN A;  2NRA C;  2FE3 A;  1RUO A;  3WGG A;  2ZNY A;  4L9N A;  2AXL A;  5ERI A;  1EH8 A;  2ZBK A;  1B9N A;  3IRQ A;  1LDK B;  4HF1 A;  1IZ1 A;  1A04 A;  2HR3 A;  2F5E A;  3RTR A;  1J75 A;  3IRR A;  2MH2 A;  3L00 A;  2RC4 A;  3EQL F;  5D5U B;  4PCQ A;  4U0Y A;  1XGN A;  4EJV A;  3QU3 A;  3I0T A;  3MZY A;  1CF7 B;  2QQA A;  3WU1 B;  5D6F A;  4EGZ A;  5LHG A;  3HIF A;  5CVR A;  4UVC A;  4HX8 A;  2Y48 A;  5LGN A;  1REP C;  5J8C A;  3P9K A;  4M72 A;  2DPD A;  3K69 A;  2PG4 A;  3V8K A;  1XGS A;  1R36 A;  3V7C A;  4KN7 X;  3TO6 A;  4HDU A;  3K9T A;  3I71 A;  2EWN A;  1P4A A;  1ZAR A;  1R1V A;  4I02 A;  5J6X A;  1K7A A;  1BJA A;  4ZYE A;  4B09 A;  3HSF A;  4YII A;  5FD5 A;  1ZG3 A;  3IWZ A;  5E8G A;  1BIB A;  5DUK A;  3EDP A;  4Q47 A;  5FFX A;  1S8N A;  4IHS A;  2E1N A;  4ESF A;  2FNP A;  5L3C A;  3WTW C;  1O7F A;  2EV6 A;  2EFQ A;  3MZH A;  4MQ9 F;  4GGG A;  4L5I A;  1T2K A;  3ZN1 A;  2BBY A;  3F8N A;  3TDU C;  1R1T A;  2GQQ A;  3N97 A;  4RB1 A;  2DI3 A;  3MFK A;  2IT0 A;  1WWX A;  3KP6 A;  4AIK A;  3ECH A;  1ZGA A;  3KZZ A;  1WRJ A;  1XN7 A;  2VXZ A;  5ICF A;  3RKW A;  1I1S A;  1R5G A;  1QPM A;  3H3U A;  2K27 A;  1FBU A;  3GFJ A;  5K5R A;  1FT9 A;  1OR7 A;  4LG0 B;  2A6H F;  5TJJ A;  5H6Q A;  2HS5 A;  2EJR A;  1U78 A;  3I54 A;  2VOD A;  2FU4 A;  2CO5 A;  1YTY A;  2UXN A;  1DUX C;  3LAP A;  1FYK A;  1UFM A;  5LEK A;  1IXC A;  3CUQ B;  1IXR C;  4HZF A;  4ASN A;  3DEU A;  2LF8 A;  2MC3 A;  1LVA A;  4BXU A;  5DCF A;  4YFN F;  2ZME A;  4KMF A;  4PGH A;  3F21 A;  1E17 A;  2M1B A;  4EM1 A;  2AS5 F;  3TO9 A;  1QBJ A;  2W84 A;  4MEX F;  3HRS A;  2BYV E;  3K1P A;  1ZAO A;  2V9V A;  3BOQ A;  2B0L A;  2HZT A;  4WXD A;  4L0Z B;  2TDX A;  1JGS A;  3RYR A;  3FX3 A;  3FM5 A;  1W5T A;  1Z6T A;  2P7V B;  3F8F A;  4WCG A;  1BM9 A;  4G6D A;  2Z9O A;  1G3Y A;  2XV4 S;  1XDS A;  4XSX F;  2F5D A;  5TRD A;  2H27 A;  4BQA A;  3JTH A;  3GYH X;  3QRF F;  2O0Y A;  4WX9 A;  3RI4 A;  2O3F A;  3JTG A;  2CSO A;  1YO5 C;  3HRM A;  1ON1 A;  4QWQ A;  3WTT C;  4G7Z F;  2JTV A;  3QPT A;  5E17 F;  5IT3 A;  3FXU A;  3T0Y A;  2JSC A;  2EFP A;  4Y15 A;  4XSZ F;  2NAZ A;  3DP7 A;  3LAJ A;  2GXB A;  2GA2 A;  2ZJ2 A;  4EQQ A;  5FD6 A;  1MJB A;  2XAF A;  3S2W A;  1YW8 A;  4ENN A;  5CVJ A;  4S05 A;  1TNS A;  3BJ6 A;  2DO7 A;  2MD5 A;  4EM2 A;  2V1U A;  2FML A;  5DUI A;  1U5T C;  2OAZ A;  3OV8 A;  1R58 A;  4B8X A;  2VN2 A;  4A5N A;  1F1Z A;  5HLH A;  4FX0 A;  3PQJ A;  2M8E A;  2A61 A;  5BOX A;  2L4A A;  2QQB A;  1O3R A;  3R60 A;  2QYO A;  3CLO A;  4A6E A;  3FM3 A;  3KP3 A;  2V1X A;  3EYY A;  4ZYH A;  1B59 A;  4ETS A;  2P6T A;  1QGP A;  3F8C A;  3ULQ B;  5D4R A;  4I09 A;  5FFZ A;  1IW7 F;  2XRO A;  5ICC A;  2JT1 A;  1T38 A;  3KP2 A;  1AWC A;  1LJ9 A;  2NYX A;  3CJN A;  5A2Q Z;  5IT9 K;  4AIJ A;  3CUO A;  1BI0 A;  2K7L A;  2FF4 A;  5L3D A;  3EYI A;  4IPA A;  2HKX A;  3C18 A;  5E20 A;  3CO6 C;  3TGN A;  4BHC A;  1KYW A;  2XAS A;  4AWX B;  3BJA A;  5D5X B;  1J59 A;  2PQ8 A;  1FBS A;  1GXP A;  1IN5 A;  3P7N A;  1O3Q A;  1SMT A;  2MLK A;  2D1H A;  3LWF A;  4UHT A;  1BN5 A;  4XBF A;  2P5K A;  1S29 A;  1H9G A;  5DCM A;  3J80 Z;  1XMK A;  4LLN A;  3SZT A;  5EEH A;  3RPQ A;  2H6C A;  1FSE A;  4OOI A;  5E8I A;  3BY6 A;  3K1N A;  3V8J A;  3IL2 A;  2V79 A;  2C6Y A;  2GXG A;  1JE8 A;  1SFE A;  1NHA A;  2DQL A;  1TQI A;  1T39 A;  3RKX A;  3F23 A;  2ESH A;  3U2R A;  3QOP A;  1ONV A;  4CGZ A;  1FY7 A;  3SHF A;  3LQQ A;  3L09 A;  4IHT A;  5KK1 A;  5HLI A;  4WWC A;  1FLI A;  2RV8 A;  1FOK A;  4QLC U;  2Y75 A;  3QAH A;  1J7K A;  4A12 A;  5ED4 A;  4KUM A;  4EJU A;  4ESJ A;  2STW A;  1R7J A;  2FBH A;  5LGT A;  2ISY A;  4A0Z A;  5FLX Z;  1BIA A;  1I27 A;  2KKO A;  4GO1 A;  4E70 A;  4HBL A;  5HS8 A;  4LK0 F;  4OIN F;  3CUQ C;  1XSD A;  2MLG A;  1LEA A;  2PJP A;  2DW4 A;  4UVB A;  2WWY A;  5BQT A;  5CLS A;  5LHI A;  1SFU A;  5HOO A;  4KYW A;  1EH7 A;  2FMY A;  1J2X A;  1JHF A;  4ZZL A;  2GWR A;  2Q0O A;  4PDK A;  1O3S A;  4BNC A;  5BPD A;  2MA3 A;  4RAZ A;  5F6F A;  2F5C A;  4ZYD A;  1MZB A;  1HW1 A;  4ENM A;  3BPV A;  3LA7 A;  4LJZ F;  5H6R A;  3E3V A;  1K79 A;  3F8M A;  1FYL A;  3ZP5 A;  3LA3 A;  2RDP A;  3RPU A;  4IVN A;  1FZP B;  5LRS A;  4ENJ A;  4HW0 A;  5D6E A;  1V3F A;  1LNW A;  3ZMD A;  3KP7 A;  2Z3Y A;  3TDZ C;  3ZMT A;  3JW4 A;  1O57 A;  5CVU A;  3IKV A;  5ICE A;  3JSP A;  2XHK A;  1UHW A;  2XAG A;  3ISP A;  2QQ9 A;  3SXY A;  4JK1 X;  4HLX A;  4XRF A;  3COA C;  2W57 A;  5JR3 A;  2EFO A;  1HST A;  4M74 A;  4N0B A;  3WTY C;  3PQK A;  4WK8 F;  3B73 A;  2VC1 A;  3J7A O;  3HTS B;  2LKP A;  3FMS A;  3J81 Z;  1G3T A;  3QPH A;  3RKY A;  1TW3 A;  2CQK A;  1KU3 A;  3MQ0 A;  4HQM A;  2A07 F;  1WQ2 A;  2UXX A;  3WOD F;  1HQC A;  2DTR A;  1IN8 A;  3DF8 A;  2MH9 A;  5E1Z B;  3DPT A;  1YG2 A;  1YYV A;  3T1B A;  2M87 A;  3G73 A;  3ZPL A;  1ODD A;  2D2W A;  2PFB A;  2FBK A;  4Y17 A;  4KIB A;  3M8F A;  4IRI A;  3SFZ A;  3W6J B;  2CFX A;  3KFW X;  2QBY A;  3GEZ A;  4EJT A;  2HGC A;  3U9G A;  4A5M A;  1F5T A;  2Y0M A;  4HX4 A;  5F1R A;  1O7L A;  1KU9 A;  1D5V A;  4EMS A;  4RB0 A;  4U88 A;  2IP2 A;  2ZKZ A;  4PZJ A;  2X0L A;  5HS7 A;  4F7Z A;  1IN4 A;  3CO7 C;  1W7P B;  2BE5 F;  2OU2 A;  5LBQ A;  1YFH A;  5DD4 A;  4OMY A;  4P9U A;  2E7W A;  1XCV A;  2OQR A;  1OYY A;  5L3G A;  1LEB A;  1ZH5 A;  3W6K B;  4I98 B;  1TQP A;  3KLO A;  4M9X A;  3C1D A;  4OMZ A;  3E5U A;  1IRF A;  2ZCW A;  4KA4 A;  4LGW A;  3K0L A;  3Q9V A;  1ZRD A;  2P5V A;  1FX7 A;  5FB2 A;  2R3S A;  5HLG A;  2E1C A;  1W4M A;  1FNN A;  1XSV A;  1RUN A;  3I64 A;  1S6L A;  4PGG A;  2W85 A;  2A6E F;  5ICG A;  3RJP A;  4I2O A;  3M9A A;  1F9N A;  1OYI A;  3MWM A;  2R7F A;  4ZH4 F;  3FHZ A;  3HRT A;  4M9Z A;  1AOY A;  1SD4 A;  2OA4 A;  2IW5 A;  1MKM A;  1QO0 D;  1B9M A;  2WC2 A;  4KIC A;  2KIU A;  4IRH A;  3H92 A;  2DT5 A;  2JRT A;  2LF7 A;  3IWF A;  3NRV A;  3E6D A;  5JHU A;  2P7C B;  1MDM A;  4IRG A;  4MTE A;  3I59 A;  2ADU A;  5ILV A;  1QNT A;  3FMQ A;  3B02 A;  4KN4 X;  2ZNZ A;  3VB2 A;  2V6C A;  2FEZ A;  2W25 A;  1K78 A;  3GVA A;  2P5L C;  4FX4 A;  3REO A;  2GZW A;  2KIM A;  4WXH A;  2O6G E;  3V7R A;  5BPI A;  1P2F A;  4HF0 A;  1XSX A;  3LQR A;  4RGX A;  1UHM A;  1FYM A;  2WV0 A;  3M1E A; 
#chains in the Genus database with same CATH topology
 3V4G A;  2Z99 A;  1T33 A;  5LFA A;  1H89 C;  3O6B B;  3D0S A;  2FBI A;  2IPQ X;  3L2C A;  3HTU A;  2R93 J;  3WTZ A;  1MD0 A;  1RR7 A;  1P7I A;  2IA0 A;  5H2F C;  3CQZ J;  1P4X A;  2UWM A;  3AL0 C;  4A3F J;  3OR2 C;  4EAT A;  4XK4 A;  3V42 A;  4ON0 A;  2CUJ A;  4CCM A;  1VQN I;  5J8F A;  4MFE A;  4CO8 A;  1PP8 F;  3M8E A;  1UB9 A;  4FET A;  3CCL I;  1JUP A;  2EZK A;  2ELH A;  4A2U A;  1BI3 A;  1YHQ I;  2YX4 A;  1IRG A;  2QUF A;  1DDN A;  3GTM J;  2QA4 I;  1K6Y A;  1E3P A;  1RNL A;  2CQN A;  4L9T A;  1I5Z A;  4MFD A;  3S3O A;  2HDC A;  3DFG A;  2HQ5 A;  2GLO A;  1E3H A;  1FTT A;  4LK1 F;  2K4J A;  4G8X A;  4ZTF A;  2BY0 A;  5FRN A;  1Y0U A;  4FT8 A;  3O8H A;  4L9J A;  2DT7 B;  2FOW A;  4XIC A;  5DM7 F;  1JKR C;  2V9K A;  2O61 A;  4M3E A;  3GZ5 A;  3K2A A;  2ME0 A;  3SJM A;  4U7D A;  1MND A;  1JHH A;  2HKO A;  1SVL A;  1A6Q A;  2RKH A;  1MGT A;  5GP9 A;  4MEY F;  4BDY A;  1ITY A;  4U7B A;  4Z2Y A;  2UZK A;  2NS7 A;  1ZRE A;  5BS6 A;  5AIQ A;  2ZB9 A;  1EF4 A;  1QVU A;  1Z1D A;  5HOD A;  1QPI A;  1IF1 A;  1YX3 A;  3FK6 A;  5CJ9 A;  1D8J A;  3BPX A;  2ZME B;  2E2J J;  2O8X A;  2Q8K A;  3CTA A;  2D1V A;  3GX4 X;  2K85 A;  2LG4 A;  1KQ9 A;  5HS9 A;  2JPB A;  2WBM A;  1HKQ A;  3IH2 A;  4FHT A;  2I10 A;  1ZYR F;  2JPC A;  2W24 A;  5LEJ A;  1KU2 A;  3HZJ A;  3I59 B;  2E1O A;  2K4B A;  2CYY A;  3LOC A;  5JFR A;  2PJR B;  1R23 A;  1DGW Y;  4RM2 A;  5L3E A;  2K9L A;  3E5X A;  5F64 A;  3CCE I;  2BXY A;  4I99 C;  3CJR B;  1B1B A;  1TW2 A;  3MMY B;  3O3K A;  1JKQ C;  1HF0 A;  1P7J A;  1ZGJ A;  2IJL A;  2VE9 A;  5CVV A;  3SZG A;  2P8T A;  1K78 B;  1P9Q C;  2HYF A;  5K5O A;  2BV6 A;  3KIO A;  3VDX A;  1JT6 A;  4F52 A;  2KQR A;  4QPO A;  4NBQ A;  4F55 A;  1VQL I;  4BQQ A;  3HOT A;  3CCV I;  1LKX A;  1ETQ A;  4P9F A;  1IUF A;  5J1R A;  2DMN A;  3CDI A;  4MTD A;  2AO9 A;  3DKW A;  4AVP A;  3N4M A;  2Z1D A;  4PJJ A;  4HPQ A;  4AD9 A;  1GHC A;  4X0G A;  1U9O A;  5KHD A;  2AHQ A;  4BQO A;  5K5Q A;  3KYC B;  2Y31 A;  4R8H A;  2E2I J;  4Y52 J;  2PEX A;  3TKY A;  3JSO A;  2CV1 A;  2DBB A;  1MBH A;  2PI0 A;  4PJN A;  4A93 J;  2VKE A;  1SD6 A;  4NQW A;  5E79 C;  3HYI A;  4HAM A;  5LLQ A;  4DYR A;  1W5S A;  3S15 J;  4XLP F;  1Z3Y A;  4ZDP A;  2IS1 A;  1GDT A;  4XON A;  3CME I;  3U1D A;  3C3W A;  1YW9 A;  3G1O A;  2PMU A;  3PNY A;  5GAE J;  2EV5 A;  1U2W A;  2NVQ J;  2ISZ A;  4AYB A;  1LE8 B;  2F6C A;  1U5T A;  2QWW A;  4HNU A;  3PNV A;  1MIJ A;  2HTS A;  3Q9S A;  1DP7 P;  1UEL B;  2CW0 F;  2K02 A;  2H09 A;  4L5J A;  2BVL A;  2L7Z A;  2XF7 A;  3F0C A;  1WI9 A;  1OYW A;  2MYS A;  1CGP A;  3FXQ A;  2BW3 B;  5JVG F;  5K7H A;  3I9V 2;  4EGY A;  2H94 A;  3R61 A;  1ZG1 A;  1GLN A;  2HYG D;  5IOZ A;  3TBI A;  2X6O A;  5DD8 A;  1U3E M;  4K2E A;  1WKM A;  1UCR A;  1J5Y A;  4W97 A;  1OLT A;  1U8R A;  3OYC A;  5B5E C;  1VQM I;  3S2D J;  3K4C A;  2HQR A;  2A68 F;  4PJ0 C;  2HXO A;  3IC7 A;  4CZC A;  3JAM K;  4RGU A;  3F22 A;  4LD5 A;  2ZJR F;  3ZQH A;  2O03 A;  5IT9 Z;  3KEQ A;  4LIT A;  2VOO A;  3NQO A;  1STZ A;  1JUS A;  1UST A;  4O5V A;  4UUV A;  1X3U A;  3MEX A;  2K40 A;  2K5C A;  2PX9 A;  3PO2 J;  1BI1 A;  2R4G A;  3WG7 H;  3GO5 A;  2GBY A;  2M5W A;  1ZLJ A;  4RGS A;  2XPV A;  3H5A A;  2G7U A;  1LFP A;  2ESN A;  4E7I A;  3A1Y A;  2DK5 A;  2ICW G;  1BOA A;  2FSW A;  2BGC A;  4IXA A;  5AON A;  2M3A A;  2KJC A;  2X6W A;  4JX6 A;  2DFH A;  2P4W A;  4KDP A;  2HDD A;  3LNQ A;  2DYR H;  3HRU A;  3EUA A;  4J01 A;  1JXS A;  5BMZ A;  2HTJ A;  4Y13 A;  3DLL F;  4UUS A;  3OYM A;  2O9L A;  2JA7 J;  4YIF A;  1IV6 A;  4EV0 A;  3GZN B;  1IRZ A;  2XVC A;  3VYS B;  4ESB A;  4OIR F;  3CDH A;  1I3Q J;  2RN7 A;  2HDW A;  4U0V A;  2IVM A;  3DPL C;  1SD5 A;  1LQ1 A;  2OTL I;  2YU3 A;  3G6E I;  5EZH A;  2PMZ N;  1MMS A;  1XGO A;  3J7Z I;  1NTC A;  1OMI A;  5D8K B;  1TT0 A;  2VC0 A;  4G94 A;  1Z67 A;  3OYI A;  2M2E A;  4XRS G;  1T98 A;  2FRH A;  3F3X A;  5E18 F;  2DOF A;  1X58 A;  2DFE A;  3HHG A;  1Z05 A;  1RIO H;  4R79 A;  2JQ7 A;  3VOD A;  1QZZ A;  1Z6R A;  2DPU A;  2NXN B;  1BI2 A;  3I3L A;  4D5C A;  1B6A A;  1OKR A;  2V9P A;  2J5O A;  2WB1 N;  4P55 A;  1Z9C A;  5J1Y A;  1LDD A;  1ZR2 A;  3TQN A;  2X6X A;  3LL7 A;  4M3G A;  1BC7 C;  1UHS A;  1IDZ A;  1J9I A;  1R1U A;  3ML6 A;  2OD5 A;  3O8G A;  3F6V A;  3L2R A;  1X1A A;  2E1M C;  2E5N A;  2XAQ A;  4NB5 A;  4A3C J;  1F43 A;  3E6M A;  2J5P A;  2HI3 A;  4A6D A;  2ZO4 A;  5HDK A;  4JYK A;  4UVA A;  5DCM B;  3QYE A;  2IA1 A;  5EZG A;  5IPA A;  1J0R A;  2EIL H;  3GZ6 A;  3H3V K;  1TLH B;  1Y6I A;  2LSO A;  1PVE A;  4H0E A;  1YS6 A;  1U5T B;  2CG4 A;  2EZL A;  1P4W A;  4DNC A;  3GFL A;  4RM3 A;  4U0W A;  3C7J A;  2EA4 A;  4XN0 A;  4XRM A;  3H0D A;  3MAJ A;  3KP4 A;  3OYG A;  3S1M J;  3F72 A;  4HDV A;  1S7A A;  2L4M A;  2ID6 A;  2NNY A;  3AG1 H;  3HUG A;  3GF2 A;  2LR8 A;  4HSR A;  2RNG A;  1TNT A;  1KYZ A;  2GIV A;  4UV8 A;  3W2W A;  3ZMV A;  1C0W A;  3WTX C;  4I01 A;  3I4P A;  4Q48 A;  4BJT A;  3ZN0 A;  3FZV A;  3ROU A;  1PUE E;  5ILU A;  3QQA A;  1F4K A;  3GFI A;  3QP6 A;  5EEG A;  1XGM A;  4FQG A;  4DBQ A;  1ZG5 A;  4BHP A;  1X1D A;  3W6V A;  1MBF A;  3ERE D;  2LY1 A;  2LNB A;  2F5V A;  2ACJ A;  3DBH B;  5CYV A;  5JLW A;  4LG0 A;  4JQF A;  3SZP A;  3D1N I;  2EB7 A;  2LFB A;  3A01 B;  1D5Y A;  2R7V A;  3R0A A;  2EK5 A;  2EFW A;  1VQO I;  1BA5 A;  4IQJ A;  1QHH D;  5DM6 F;  4C3H J;  1D1B A;  2VB6 A;  2ETH A;  4F91 B;  1T8I A;  2R7D A;  1K4T A;  3S1R J;  1QA6 A;  3V8L A;  1G59 A;  2X4H A;  1I6H J;  3K2Z A;  2FA5 A;  1B72 B;  1S7O A;  3RCO A;  4GFB A;  3OIP A;  3EET A;  4Y3O A;  4V2F A;  3DXJ F;  5LRR A;  3CUQ A;  1R4N B;  2Y30 A;  4RGR A;  2HQN A;  1GV5 A;  1LUJ B;  1LFB A;  2K9Q A;  3IP4 B;  1D8K A;  3LA2 A;  3M8J A;  4BHB A;  4YRV A;  4Q4Z F;  4IZZ A;  2NOJ B;  3TO7 A;  3HOS A;  4BAC A;  3PNT A;  2DFI A;  1H8A C;  1I39 A;  1OR7 C;  4HV5 A;  2OBP A;  4I7H A;  1PYV A;  2KZG A;  3K70 C;  3LFU A;  3SEZ A;  3I4M J;  1KQ8 A;  1SFX A;  3VOE A;  3M3Y J;  2BXZ A;  2H1L A;  3GXO A;  3A02 A;  2DMQ A;  5ILS A;  1UZC A;  1ZN2 A;  3L2Q A;  5E1X A;  3HL2 A;  2QKL B;  2Z5U A;  4RB2 C;  2JUC A;  1XB4 A;  3LSK A;  2YSR A;  4OIQ F;  4RAY A;  4M9S A;  4KIS A;  1GVD A;  3GFM A;  4G9Y A;  1L0O C;  2NVX J;  1MJA A;  1PP7 U;  1ULY A;  1A5J A;  3F6O A;  3CMY A;  2ZME C;  4BE2 A;  2CWE A;  1G6N A;  2M0C A;  3G3Z A;  2JN6 A;  1WCM J;  1YLF A;  3ASO H;  4F93 B;  3Q3S A;  2RGV A;  3BR2 A;  3B6A A;  4DQ2 A;  2JK3 A;  2XF6 A;  1DPU A;  2CS3 A;  4XMY A;  4GRI A;  3LST A;  1YX5 A;  4EVI A;  2DN0 A;  4BBR J;  2F4M B;  5M5W J;  3K70 D;  2KMU A;  3OSG A;  1KQ0 A;  4XLN F;  4OIO F;  3OYN A;  3GTK J;  1MW7 A;  3P9C A;  4L18 B;  2WY7 Q;  4D0P A;  1XDU A;  1R5H A;  1BW6 A;  2FX0 A;  3BZ6 A;  2KFD A;  4LOC A;  4E4H A;  2DJN A;  2V1N A;  4KIG A;  2PMH A;  4ZZD A;  3BZK A;  4NC8 A;  2NVU B;  1MMN A;  2D45 A;  5CQG A;  1JT0 A;  2FJ1 A;  4XN3 A;  2LRE A;  3QOE A;  2FNA A;  5DDG A;  2CV2 A;  1SFK A;  4KIT B;  5DV5 A;  2OZU A;  3RQI A;  2RNJ A;  2QM3 A;  2GXA A;  4ENK A;  2V1D A;  5L3F A;  2HU9 A;  2XSD C;  1SAX A;  3PUF A;  1OCO H;  5J4V A;  1KON A;  1FOY A;  2JVG A;  4LB6 B;  5IYB J;  4A3B J;  3ABL H;  2WAE A;  5K1Y A;  1SAN A;  3JRG A;  5HDG A;  4MLO A;  3ONQ A;  1OCR H;  3ZCO A;  2VON A;  3TOB A;  5D5V B;  1NG7 A;  2L3D A;  2EIM H;  2LK2 A;  3DWL E;  1XD7 A;  1FP2 A;  4XLH A;  2F5F A;  3T5X A;  5J1U A;  3AAF A;  1Q1H A;  4IF4 A;  4UB6 C;  1ZTR A;  2CQX A;  1RKT A;  3OOP A;  2DU9 A;  3WTS C;  1O4X A;  2HWV A;  4AYB N;  1T6S A;  1SD7 A;  3GUD A;  4A0Y A;  4E7Z A;  4RB3 C;  3I55 I;  3PFI A;  4I0A A;  2A3S A;  4HQE A;  3CDL A;  1YQA A;  4GXO A;  4UNO A;  2VOP A;  2M0M A;  5JVT A;  2KRF A;  1TWG J;  2F4O B;  1QQI A;  2R7U A;  4M6V A;  2EV0 A;  2BVM A;  1HCR A;  1T0F A;  1V5F A;  3MN2 A;  2BY1 A;  4Y4R A;  4KFC A;  2GOX B;  4BU2 A;  3FF5 A;  3HSR A;  2X48 A;  1IUY A;  3SDG A;  2EIN H;  2TRT A;  4HG2 A;  2Y9Y A;  3FHN A;  3KX2 A;  4AIH A;  1FSH A;  5TIS C;  4HV6 A;  3WE3 A;  1E2X A;  1KU7 A;  1K6O A;  3BJO A;  1X4O A;  3VFZ A;  2NS0 A;  1TTY A;  5D4S A;  4A3M J;  3HOV J;  3GTO J;  3HDD A;  2RVC A;  2CJJ A;  3BWG A;  3KYD B;  1YI2 I;  3JRC A;  1I1G A;  3ZMZ A;  5JI6 A;  1IG7 A;  2XDV A;  4LFU A;  2DLL A;  1Z77 A;  3WTU C;  9ANT A;  1ON2 A;  1HBX G;  4WXC A;  3R0J A;  2R7R A;  5E1W A;  4P5O A;  1IDY A;  1FBQ A;  1ENH A;  2N8G A;  2XIG A;  3ABT A;  2QBY B;  3EUH A;  2QQ8 A;  2E34 A;  2QZ8 A;  1N78 A;  2EQR A;  4N9I A;  3E0J B;  2VBY A;  2FOK A;  5B1B H;  4Q5S F;  4M6X A;  2KDZ A;  2V7F A;  3CCY A;  4II2 A;  4BH9 A;  1VQ8 I;  2QEN A;  2RQP A;  3WU0 A;  1JGG A;  3WGI A;  1ACI A;  1HXD A;  3BG3 A;  4HRI A;  2JA6 J;  1WVR A;  5B66 C;  2R5Z B;  2PN6 A;  2WAQ A;  1TT5 B;  2ZXI A;  1W7P D;  2X1D A;  1DPR A;  2G0E A;  2KP6 A;  3P9I A;  1OCC H;  4QSH A;  2FQ3 A;  5HLT A;  2VBX A;  2OPT A;  3CF5 F;  1D3Y A;  4I6Z A;  2IS4 A;  3DTI A;  5M3M J;  1FP1 D;  4L9V A;  3O2P E;  3IHU A;  3G4S I;  4MGR A;  2LDU A;  3HOY J;  3RDI A;  2L54 A;  4LIV A;  2XGX A;  1W36 D;  3ZQ7 A;  1RZ4 A;  1G4D A;  2G7H A;  3WTV C;  5FLM J;  3R6S A;  1JJ6 C;  4AC0 A;  2L02 A;  3QYB A;  2WAD A;  5K7F A;  2Y69 H;  2WV1 A;  4LLG F;  4BUP A;  1Y56 A;  3M07 A;  2HFH A;  3ZMU A;  3BTC A;  4NHJ A;  3S1N J;  3LSI A;  2STT A;  2RQQ A;  1Y0N A;  2CGP A;  2DAO A;  3E5Q A;  3JR9 A;  1JKP C;  4XRS A;  3MCZ A;  4BAY A;  4M3B A;  1YS7 A;  4S0H B;  3M1C A;  5KNL A;  1BBY A;  5FO5 A;  1QRY A;  1TQM A;  2XUB A;  4CZZ A;  2VT2 A;  1WJB A;  2E7X A;  3BP8 A;  3L7W A;  2DJI A;  2LTP A;  4C3J J;  2HOE A;  2L01 A;  4XLE A;  4MQV A;  4RBO A;  2Y0S A;  2A69 F;  4QIW N;  3JRD A;  5A2Q K;  2EA2 A;  1G3W A;  4L0Y B;  1A6I A;  3PSF A;  5LHH A;  2DA6 A;  4KT5 C;  5FKO A;  1R00 A;  4EM0 B;  1KA8 A;  1WGX A;  1Q1V A;  2QVO A;  4ZYG A;  3CCU I;  2Z16 A;  3I5U A;  3K4M A;  1FIP A;  3GCM A;  2BOL A;  2BEO A;  2FQ4 A;  3H0G J;  2ZFW A;  2R7Q A;  5GAG J;  2DMP A;  3ZMS A;  2VBW A;  4HLY A;  2ZXJ A;  2X1E A;  2M4K A;  3F8B A;  3LMM A;  1NH3 A;  3FXR A;  4IKF A;  3BTI A;  2H8R A;  1SMY F;  5HVQ C;  5IYD J;  1U6G A;  1L3L A;  3H3Z A;  1YRN A;  2L7K A;  4I0B A;  3WGH A;  2F48 A;  3U1K A;  4IO9 F;  4ZDL A;  1XMA A;  2A5Y B;  1MMD A;  3KE2 A;  2L2O A;  2EFN A;  3FIW A;  1VF9 A;  4DZP A;  5DEQ A;  4G12 A;  1U0J A;  1IN7 A;  3VEP A;  2UV1 A;  2LC2 A;  3D5L A;  3GWZ A;  4XID A;  1MDM B;  3T8T A;  1PDN C;  2XKP A;  4YFX F;  4S04 A;  4R1H A;  5L3B A;  3E6C C;  4HYE A;  2VQC A;  4OIP F;  2OZ6 A;  1GVJ A;  2LOO A;  4EJW A;  2QSH X;  3J80 K;  3KEY A;  1ZHF A;  3T8R A;  2JZY A;  4E7L A;  3CC4 I;  2ZFU A;  5KAF C;  4BDZ A;  1TZL A;  1V5E A;  3ECO A;  3BT9 A;  2ID3 A;  3VYT B;  3WG9 A;  2CH0 A;  2KLO A;  3DQV C;  1VQK I;  4A0X A;  3BCA A;  3HXL A;  2IRF G;  2L7F P;  3HHH A;  1D0Z A;  4TV7 A;  4DZJ A;  5IP6 A;  4XKW A;  2M9H A;  1JTX A;  4G7O F;  3IKT A;  1S72 I;  1FWZ A;  3H5N A;  3FMR A;  2LKX A;  4YEL A;  3RYP A;  4M71 A;  4UV9 A;  1PUF B;  3ZOB A;  2LYC A;  4YG2 F;  2IS6 A;  4BXF A;  4J19 A;  3S14 J;  5IOY A;  2NVY J;  3I4N J;  3Q0W A;  4AU7 A;  1B8I A;  2A6T A;  5J3L A;  1R22 A;  3QU6 A;  5BNG A;  4XKC A;  3MKW B;  4XNF A;  4L5E A;  3G2B A;  1R4M B;  4HNV A;  4G6Q A;  3I58 A;  4LB5 A;  4MNU A;  5H20 A;  5D5W B;  1VTN C;  3E97 A;  2MD0 A;  1WJC A;  2XAH A;  2M30 A;  2Q2E A;  4HX7 A;  2LKS A;  3HSE A;  5FKN A;  3SFI A;  1IAW A;  2LBF A;  1IN6 A;  1FC3 A;  3W2V A;  4LMY A;  1CQT A;  3C2B A;  4P96 A;  3A2K A;  3TMO A;  4HST A;  4KIF A;  5CVI A;  1H88 C;  1ZRF A;  1P92 A;  4G7H F;  2XRN A;  1G2H A;  2WTE A;  1ETW A;  4RS8 A;  1MSE C;  1W5C C;  2QLZ A;  5D8L B;  2Z33 A;  2GA1 A;  5KVR A;  5F0F A;  1J09 A;  5F08 A;  2OTJ I;  2VBZ A;  4B48 A;  2F2E A;  1OCZ H;  5J40 A;  1WJ5 A;  1FTZ A;  4GYI A;  2ELK A;  3WHB A;  4ZJZ A;  2OQG A;  4JBA A;  5FLX K;  2KIF A;  4GCV A;  1K61 A;  3E6B A;  5LGU A;  3FXL A;  4O3M A;  1MH3 A;  3S2H J;  1V4R A;  2DYS H;  2YR2 A;  1YJN I;  4CHU A;  4IX7 A;  1X2N A;  4GYG A;  2HEO A;  2Y2Z A;  3DEE A;  2K86 A;  4LIU A;  3L9F A;  3QP5 A;  2NNN A;  2VQH A;  2M4G A;  2MG4 A;  1TBX A;  1A35 A;  1NK2 P;  4LLL A;  5B3S H;  1HW2 A;  3H5R A;  1CF7 A;  4HF2 A;  3CF2 A;  5CKT A;  1H0M A;  2PLY A;  1ETO A;  3ABU A;  3DPU A;  2HOT A;  3DLA A;  3M7G A;  2DQR A;  1W36 C;  3S17 J;  3DV8 A;  2VIX A;  2R7Z J;  1ZLK A;  4RAF A;  3S1Q J;  5DYM A;  2R7X A;  4OU0 A;  4EJO A;  1RC9 A;  4JOM A;  3WE2 A;  1FPQ A;  1FIA A;  3ZRG A;  4B44 A;  3TOA A;  5C44 J;  2EIJ H;  2MC4 A;  4U87 A;  1MBJ A;  1RI7 A;  4BL0 B;  1YIO A;  4CDG A;  4CXF A;  3QPL A;  3KCC A;  4XR6 A;  1YRN B;  3V7S A;  1YE9 A;  1S9H A;  1YJW I;  3FXK A;  3A0B C;  4M6Y A;  2PBI A;  4F92 B;  1BC8 C;  6PAX A;  1Z91 A;  2FXA A;  4WF2 A;  2VUM J;  2G9W A;  1Z7U A;  1HKT A;  2XGC A;  3UKG A;  1ZRC A;  2DA4 A;  2E5Z A;  1X1P A;  4A69 C;  1B4A A;  4HA8 A;  4KNY A;  4RMN A;  3UR3 C;  5IY5 H;  3OMY A;  4FE4 A;  3UNG C;  1KGS A;  4RA2 A;  3OYB A;  2WAF A;  3R4K A;  3FXJ A;  4X6A J;  1XCB A;  3DKY A;  1EH6 A;  3EUK L;  1HSJ A;  3KET A;  2COM A;  3LFK A;  3K1M A;  2IA2 A;  4N9H A;  2KJB A;  1I3A A;  4O6J A;  1IO2 A;  1LB2 A;  4HOB A;  1R49 A;  2MAB A;  1IRX A;  2XPW A;  2YPR A;  5GTI C;  1VI0 A;  2XKO A;  1OPC A;  4ITV A;  4MHG A;  1QZY A;  1JUM A;  2L5Q A;  4UXN A;  4XOR A;  2LMD A;  3JRB A;  5TGT A;  1Z7L A;  1ZGW A;  4NDL A;  3RIR A;  2E35 A;  3K4L A;  1H9T A;  4CIC A;  3ELK A;  5F0H A;  3SQN A;  5GAH J;  3S8P A;  3CCM I;  5AIP A;  2YX7 A;  1YW7 A;  2I8D A;  4BJ6 C;  3FDY A;  4CYD A;  5EDN A;  4MIM A;  3MKZ A;  2LD5 A;  1VQP I;  2DK8 A;  2H1K A;  3RZO J;  2MBF A;  2VE8 A;  3Q5F A;  1G3S A;  1BR4 A;  3HKZ N;  4YFK F;  2P6S A;  2XAJ A;  4B47 A;  3BR0 A;  5HNF A;  2LLK A;  1S3J A;  2HPM A;  1TWH J;  1V54 H;  3OL3 A;  3KZY A;  1OIS A;  3I53 A;  2X9D A;  3BRO A;  3D5R C;  1MJ9 A;  3KP5 A;  4M73 A;  2X6Y A;  1GXQ A;  5DS9 A;  1HDD C;  1VQ6 I;  3OS0 A;  2H6B A;  1USS A;  2M45 A;  4CYC A;  2GIZ A;  4BEH A;  2VT3 A;  3NEU A;  1EV7 A;  2K9M A;  3JAM Z;  4C2T A;  1X2M A;  3KLN A;  1IXS B;  1ZEL A;  2YS9 A;  3BC8 A;  3GW2 A;  3KEO A;  4KMU X;  3J81 K;  1OJL A;  4RAG A;  3ZQQ A;  4BYY A;  2Z2S B;  5FGM A;  1HKS A;  1F36 A;  1HW5 A;  3MD2 A;  2LBF B;  3GLX A;  3BCB A;  5E3L A;  3ZQI A;  1ZR4 A;  1I6X A;  3NWS A;  4NQW B;  4IJA A;  3BDD A;  3FWE A;  1P6R A;  1W7P A;  1I50 J;  4XLF A;  2KDO A;  2B63 J;  1WSU A;  1O3T A;  2GAU A;  1LDJ A;  5HDN A;  2NRA C;  2OJE D;  2FE3 A;  2A5W A;  3S32 A;  1RUO A;  3WGG A;  2ZNY A;  2VAS A;  4L9N A;  4DW6 A;  3TP0 A;  2ZSH B;  2AXL A;  5ERI A;  2COB A;  1EH8 A;  2ZBK A;  2WAQ N;  1B9N A;  3IRQ A;  1LDK B;  2K9S A;  4HF1 A;  1IZ1 A;  2M34 A;  5C4J J;  4W1U A;  1A04 A;  2HR3 A;  4M3F A;  2F5E A;  3RTR A;  1J75 A;  3ZXS A;  3IRR A;  1D0X A;  2MH2 A;  2HNH A;  3L00 A;  2RC4 A;  3EQL F;  3MKL A;  5CPR B;  5D5U B;  2K9N A;  4A3G J;  4PCQ A;  4U0Y A;  3K6G A;  1XGN A;  2WA0 A;  1A36 A;  4EJV A;  2E19 A;  3QU3 A;  1LFU P;  3I0T A;  3MZY A;  1CF7 B;  4E7K A;  2QQA A;  3WU1 B;  3HEF A;  1DQU A;  5D6F A;  4EGZ A;  3CC2 I;  1QU3 A;  5LHG A;  3HIF A;  1ETX A;  1W1W E;  5CVR A;  4UVC A;  4HX8 A;  2Y48 A;  5LGN A;  1REP C;  5J8C A;  5F0C A;  3GTQ J;  3P9K A;  4JP0 A;  4M72 A;  4II3 A;  4B4C A;  2VJ5 A;  2YU9 J;  2DPD A;  3K69 A;  2PG4 A;  3DEW A;  3V8K A;  3GLL A;  1SC7 A;  5C3E J;  1XGS A;  1R36 A;  3V7C A;  4KN7 X;  1LPQ A;  3FK7 A;  2DOD A;  3TO6 A;  4HDU A;  1IV8 A;  3DCF A;  3K9T A;  3I71 A;  2EWN A;  1P4A A;  2M8G X;  3HOW J;  1XX5 A;  2JRM A;  1ZAR A;  4D5F A;  1U8B A;  2OC6 A;  1R1V A;  2TCT A;  5EG0 A;  3LSG A;  4I02 A;  5J6X A;  2KPM A;  1K7A A;  1POG A;  2KT0 A;  1RES A;  1W0U A;  1BJA A;  5EF6 A;  4E7S A;  4ZYE A;  4B09 A;  4A3I J;  3HC7 A;  4UUS B;  3HSF A;  4YII A;  2HVS A;  1GUU A;  3D5S C;  4XL9 A;  5E3O A;  5FD5 A;  3HPG A;  4J00 A;  3RQ4 A;  2M7B A;  1ZG3 A;  3IWZ A;  1FEX A;  3U21 A;  5E8G A;  1BIB A;  4XOT A;  2L0K A;  1IC8 A;  2ZXH A;  1UG0 A;  5DUK A;  5FKM A;  2LP0 A;  5F27 A;  3EDP A;  2IGK A;  5K7Z A;  3DBL B;  4Q47 A;  5FFX A;  1R9T J;  2KRH A;  3BG5 A;  4OAY A;  1S8N A;  3DTK A;  4HEA 2;  4IHS A;  2E1N A;  2R0Q C;  3NWT A;  4GDF A;  2CQQ A;  3GBG A;  4ESF A;  2FNP A;  5L3C A;  3WTW C;  1O7F A;  3E1S A;  3H35 A;  1QHG A;  2RRE A;  5DTD A;  2EV6 A;  2EFQ A;  4BEH B;  4MQ9 F;  2DA5 A;  5EGO A;  3MZH A;  4GGG A;  4L5I A;  1T2K A;  3PFY A;  4IL6 C;  1ETY A;  3ZN1 A;  3H1C A;  2BBY A;  3F8N A;  3BZC A;  3NAU A;  3C2H A;  3TDU C;  1R1T A;  3ABK H;  2GQQ A;  2GM4 A;  2L7M P;  3FXO A;  3FBN B;  1OQY A;  4Y7N J;  2L9R A;  3N97 A;  4RB1 A;  2DI3 A;  3MFK A;  3IAS 2;  2CMP A;  4BE1 A;  1MBK A;  2IT0 A;  1WWX A;  3G1M A;  3HM5 A;  3KP6 A;  3KZI C;  4AIK A;  3ECH A;  1ZGA A;  3KZZ A;  3CP2 A;  3PSI A;  3OYD A;  2FD5 A;  1WRJ A;  1XN7 A;  5E3M A;  3HUG B;  2VXZ A;  2IBD A;  2IGM A;  5ICF A;  3HOZ J;  2ZJP F;  3RKW A;  1AKH A;  3OR1 C;  4FE7 A;  1I1S A;  4KT6 A;  1R5G A;  4OAZ A;  4N4N B;  2EH3 A;  2ZJQ F;  1QPM A;  3H3U A;  2K27 A;  1FBU A;  3GFJ A;  5K5R A;  3OIQ A;  3CLQ A;  1ZQ3 P;  1FT9 A;  2IXS A;  2QF7 A;  3K7A J;  4DYC A;  1OR7 A;  2DTZ A;  1N75 A;  1RR8 C;  1PJR A;  2A6H F;  2DT6 A;  3AG2 H;  4LG0 B;  2XB5 A;  4ZDO A;  5TJJ A;  5H6Q A;  2HS5 A;  2EJR A;  1U78 A;  3JCU C;  3ASN H;  3I54 A;  1WZ2 A;  2VOD A;  2FU4 A;  2CO5 A;  3CMM A;  1YTY A;  4H4K C;  2KIQ A;  3OYE A;  2UXN A;  1DUX C;  3HBL A;  3LAP A;  1YJ9 I;  2W82 A;  2XPU A;  1VFC A;  1FYK A;  1UFM A;  5B1A H;  1DU6 A;  4C9Y A;  1HOM A;  5LEK A;  4CCO A;  1IXC A;  3MVP A;  3CUQ B;  5C4X J;  2JVH A;  1IXR C;  4HZF A;  1ETV A;  4ASN A;  3DEU A;  2LF8 A;  2MC3 A;  1LVA A;  2P81 A;  4BXU A;  4IHY A;  5DCF A;  4YFN F;  2ZME A;  4KMF A;  5EG0 B;  4PGH A;  3F21 A;  5JLX A;  1E17 A;  2M1B A;  4EM1 A;  3QPS A;  5IP7 J;  2AS5 F;  3TO9 A;  1QBJ A;  2NS8 A;  2W84 A;  4MEX F;  3HRS A;  2BYV E;  4XKV A;  3WU2 C;  1X3Z B;  1Z21 A;  3IH3 A;  4B1R A;  3ESW B;  3K1P A;  1ZAO A;  2V9V A;  2JA2 A;  3A0H C;  3CCR I;  3BOQ A;  2B0L A;  1FOW A;  2HZT A;  2UUZ A;  4WXD A;  3MKY B;  2Y9Z A;  3WHC A;  2CQ7 A;  1IGN A;  4L0Z B;  2MGQ A;  2TDX A;  1JGS A;  2E1M B;  2WB1 A;  3DKX A;  3GTL J;  1SFO J;  3RYR A;  3FX3 A;  3FM5 A;  2OCC H;  1MBG A;  1ZKG A;  1W5T A;  1Z6T A;  2P7V B;  4PFO A;  1RKW A;  3F8F A;  4WCG A;  1RET A;  4XQF A;  1BM9 A;  2DA1 A;  4G6D A;  2Z9O A;  1G3Y A;  2CUF A;  2XV4 S;  1XDS A;  4XSX F;  5EYR A;  2F5D A;  5TRD A;  2CUZ A;  2H27 A;  4BQA A;  2D5V A;  3OS1 A;  2CFO A;  3JTH A;  3GYH X;  3QRF F;  2LH9 A;  2O0Y A;  1WJD A;  2R7W A;  4WX9 A;  1WH7 A;  5E3N A;  4IHV A;  3ZQL A;  4CCJ A;  2F4I A;  3RI4 A;  3HPH A;  2EIK H;  2O3F A;  3JTG A;  1A31 A;  2CSO A;  2VPL A;  1YO5 C;  3HRM A;  2ZXW H;  1ON1 A;  4QWQ A;  3WTT C;  4G7Z F;  2JTV A;  3QPT A;  4IQ4 A;  5E17 F;  5IT3 A;  4YIR X;  3RPU D;  1MMG A;  1T95 A;  3OY9 A;  3FXU A;  3L2U A;  2DCE A;  3T0Y A;  2CW7 A;  1WJF A;  1T56 A;  2JSC A;  2EFP A;  1Y8R B;  4Y15 A;  2QEX I;  2ECB A;  4XSZ F;  2NAZ A;  2DA2 A;  3DP7 A;  3LAJ A;  1VND A;  2GXB A;  2AXT C;  2GA2 A;  1SAU A;  4NUB A;  2ZJ2 A;  1LE8 A;  4P1W A;  5EJC A;  3DBR B;  4M3D A;  4EQQ A;  3PIO F;  2QKM B;  1HA8 A;  4A3J J;  1AKH B;  1JJ8 C;  4DIQ A;  2K3P A;  5FD6 A;  1MJB A;  4BQN A;  3BR1 A;  4DBR A;  3IUO A;  4LG3 A;  2BW3 A;  1Y1V J;  2XAF A;  3OYL A;  2OUM A;  3S2W A;  2MSY A;  1YW8 A;  4ENN A;  1YIJ I;  4KJZ A;  4XOP A;  5CVJ A;  4S05 A;  4YEJ A;  2R7S A;  1TNS A;  2CUE A;  3BJ6 A;  2KRC A;  2DO7 A;  2MD5 A;  4EM2 A;  2V1U A;  2FML A;  5DUI A;  1YIT I;  1U5T C;  2OAZ A;  3OV8 A;  2QSG X;  1R58 A;  4B8X A;  2ME6 A;  4CCL A;  3K10 A;  2VN2 A;  3OSF A;  3Q0U A;  4A5N A;  1UMQ A;  3HG9 A;  5M5Y J;  1F1Z A;  5HLH A;  4FX0 A;  3PQJ A;  4IOA F;  2DA7 A;  2JMW A;  2XRL A;  2M8E A;  2A61 A;  5BOX A;  2L4A A;  2QQB A;  1O3R A;  3R60 A;  2QYO A;  3CLO A;  4A6E A;  2XC7 A;  3FM3 A;  5CQE A;  3KP3 A;  4C30 A;  2V1X A;  4D7M A;  3EYY A;  1BW5 A;  4PFP A;  2JWT A;  1B59 A;  4ZYH A;  4ABZ A;  4ETS A;  5GPC A;  2P6T A;  4IEJ A;  4PJL A;  1QGP A;  2VQG A;  1FOX A;  4F3Q A;  3F8C A;  3BR3 A;  4BKX A;  3HJE A;  3ULQ B;  3VPR A;  3CC7 I;  5D4R A;  1OCP A;  4I09 A;  1WH5 A;  1Y8Q B;  4D1Q A;  1S7E A;  2OF7 A;  3CJQ B;  5FFZ A;  2B9S A;  1IW7 F;  3HGY A;  2XRO A;  1S5L C;  1X3W B;  3S3M A;  5ICC A;  4PK4 A;  2JT1 A;  2ZSI B;  1T38 A;  3KP2 A;  2JA5 J;  1AWC A;  4AM3 A;  2W7N A;  1LJ9 A;  3KPH A;  2NYX A;  3CCJ I;  3TP3 A;  2HVQ A;  3CJN A;  5A2Q Z;  5IT9 K;  4AIJ A;  3CUO A;  3DU5 A;  1BI0 A;  1YOV B;  2K7L A;  3K4N A;  5GAD J;  2FF4 A;  5L3D A;  4E6K G;  4FCY A;  3F9K A;  3ZGK A;  2L9V A;  3L1P A;  3EYI A;  4A3E J;  1Z0X A;  2DA3 A;  2IEK A;  3E7L A;  4IPA A;  4DJA A;  2HKX A;  1NK3 P;  2XB0 X;  3C18 A;  5E20 A;  3CO6 C;  2OV7 A;  1SVM A;  3TGN A;  3A4C A;  4BHC A;  1KYW A;  3AFH A;  2VPR A;  2XAS A;  1MBE A;  3ERM A;  3K4J A;  4AWX B;  5GTH C;  2LVS A;  3BJA A;  5D5X B;  1J59 A;  2PQ8 A;  2DDB A;  1FBS A;  1GXP A;  1HDP A;  3X2Q H;  1IN5 A;  3HGG A;  3B6C A;  2R7T A;  1U9N A;  2CU7 A;  3P7N A;  5LD2 C;  1O3Q A;  2JSP A;  1SMT A;  2MLK A;  2D1H A;  3LWF A;  4UHT A;  1BN5 A;  4CCK A;  1APL C;  4FTH A;  4XBF A;  2P5K A;  2MFZ A;  1AHD P;  1S29 A;  1LVK A;  2BY2 A;  1BR1 A;  1H9G A;  5DCM A;  3GME A;  3J80 Z;  2VKD A;  1XMK A;  2HOS A;  3HOU J;  4LLN A;  4UY8 I;  2VI6 A;  3LSJ A;  2W48 A;  3H9Q A;  1TWA J;  2E36 A;  3SZT A;  5EEH A;  4AVZ A;  3OYA A;  3BTL A;  3RPQ A;  2VLA A;  2H6C A;  1FSE A;  2WY8 Q;  1T08 B;  4OOI A;  3M4O J;  3N05 A;  5E8I A;  3BY6 A;  2L9N A;  2R92 J;  3K1N A;  3OL4 A;  3V8J A;  3IL2 A;  2XGE A;  2V79 A;  1XS9 A;  2C6Y A;  1VQ5 I;  2GXG A;  3BR6 A;  1JE8 A;  1R6R A;  3RSN A;  1SFE A;  4BE0 A;  2VKV A;  1NHA A;  3PIP F;  2DQL A;  1TQI A;  1HLV A;  1T39 A;  1MMA A;  2I5U A;  3TW7 A;  3RKX A;  3F23 A;  2ESH A;  3U2R A;  3QOP A;  1BR2 A;  1ONV A;  4CGZ A;  1TC3 C;  1FY7 A;  2Q1Z B;  2DMT A;  3A01 A;  2X85 A;  3SDB A;  4CSW A;  1X1C A;  4NNJ A;  3SHF A;  3LQQ A;  3L09 A;  4IHT A;  3Q0V A;  5KK1 A;  5HLI A;  3JRF A;  3BG6 A;  4WWC A;  1FLI A;  2CW8 A;  2RV8 A;  1FOK A;  2KZV A;  4OWR B;  4QLC U;  3I56 I;  2Y75 A;  3QAH A;  2FUG 2;  1B72 A;  5FLV A;  1XPX A;  1J7K A;  1R5I D;  4JX5 A;  4C2U A;  4A12 A;  4RLF A;  1VQ9 I;  5KCM A;  1FJL A;  3OYJ A;  5ED4 A;  2YUS A;  3AG3 H;  4KUM A;  4EJU A;  4ESJ A;  2STW A;  1K83 J;  1R7J A;  2VQL A;  2FBH A;  2QSF X;  1Y1W J;  4E7H A;  1KZH A;  1AU7 A;  2E2H J;  5LGT A;  2BHZ A;  3RZD J;  2ISY A;  2LY9 A;  5F1J A;  4A0Z A;  5FLX Z;  1BIA A;  5FJ8 J;  4JX4 A;  2VXD A;  1Y39 A;  1WHU A;  1I27 A;  2KKO A;  4GO1 A;  4PSW A;  3ZQC A;  1X19 A;  1B8I B;  4E70 A;  2XAU A;  1SEU A;  3AL0 B;  4HBL A;  5HS8 A;  4LK0 F;  4OIN F;  3PUB A;  3CUQ C;  3AKZ A;  2DMU A;  1XSD A;  2MLG A;  1LEA A;  3VYR B;  2DW4 A;  3FXM A;  2PJP A;  4UVB A;  2WWY A;  5BQT A;  5CLS A;  5LHI A;  1SFU A;  5HOO A;  2QCO A;  3P5J A;  4KYW A;  1EH7 A;  2FMY A;  1J2X A;  2Q2E B;  3BG9 A;  1JHF A;  2BHY A;  4B3X A;  4IHX A;  4DYQ A;  4ZZL A;  3OYK A;  2O5R A;  4AUX A;  2AQE A;  2JJ7 A;  2GWR A;  2Q0O A;  4PDK A;  1O3S A;  3ZQF A;  1BL0 A;  1W0T A;  1WPK A;  1XMX A;  3K4K A;  5BPD A;  4BNC A;  2MA3 A;  4RAZ A;  5F6F A;  3FKJ A;  2R7O A;  4FIS A;  5IYC J;  2F5C A;  3PM1 A;  4ZYD A;  3CCS I;  3TL4 X;  1WI3 A;  1MZB A;  1HW1 A;  4ENM A;  2AQF A;  4IHW A;  3BPV A;  4Z6Y A;  3LA7 A;  4LJZ F;  5H6R A;  3E3V A;  4ZYA A;  1V5G A;  4PSX A;  1K79 A;  3F8M A;  4C3I J;  2VJ4 A;  1FYL A;  3ZP5 A;  1GV2 A;  3OOU A;  1UJ8 A;  3LA3 A;  1R71 A;  2RDP A;  3RPU A;  4IVN A;  1FZP B;  5LRS A;  4ENJ A;  4HW0 A;  4X1E A;  1ETK A;  5D6E A;  3OS2 A;  1UAA A;  1UG2 A;  4HNT A;  1V3F A;  1TWC J;  1XC5 A;  3G71 I;  3DU6 A;  1LNW A;  2VJI A;  3ZMD A;  3KP7 A;  2Z3Y A;  3TDZ C;  3ZMT A;  3JW4 A;  1O57 A;  1QVT A;  5CVU A;  2E60 A;  3IKV A;  3LSR A;  2M7A A;  5ICE A;  3JSP A;  3TED A;  2XHK A;  1TP4 A;  1UHW A;  2XAG A;  3ISP A;  3J7Y J;  2QQ9 A;  1Z3X A;  2B7E A;  2X51 A;  4PUS A;  3SXY A;  4JK1 X;  1ZK8 A;  2OCE A;  4HLX A;  4XRF A;  3J7A Y;  2XGD A;  3COA C;  1MNE A;  2W57 A;  2P0W A;  5JR3 A;  1BJZ A;  3K4B A;  2EFO A;  1HST A;  4M74 A;  4N0B A;  1D1A A;  2XF5 A;  3ZQG A;  5M3F J;  2ZC2 A;  4B3A A;  3WTY C;  4AID A;  5FKL A;  2A05 A;  2Y0S N;  4FAS D;  3PQK A;  1IJW C;  3CJT B;  2HZD A;  4WK8 F;  4DOZ A;  5F04 A;  4CH7 A;  1E3O C;  3B73 A;  1V55 H;  2VC1 A;  2NOG A;  1MNM C;  2DDA A;  3HTS B;  4BY1 J;  3J7A O;  3CP8 A;  5FKK A;  2LKP A;  3FMS A;  4XLC A;  3J81 Z;  1G3T A;  1WFX A;  3QPH A;  3VSK A;  3RKY A;  1TW3 A;  1SVO A;  2CQK A;  4NC7 A;  2ELJ A;  4RLQ A;  1KU3 A;  2H8W A;  3MQ0 A;  4HQM A;  2A07 F;  1DP3 A;  2KHM A;  1WQ2 A;  2UXX A;  3W3C A;  2HXI A;  3WOD F;  3FBI B;  1HQC A;  1RPW A;  2DTR A;  1IN8 A;  3DF8 A;  3RKQ A;  3CCQ I;  2MH9 A;  5M5X J;  2DFF A;  2V6E A;  5E1Z B;  3HOX J;  3DPT A;  1YG2 A;  2GOM A;  3OWT A;  4QTR A;  3VYU B;  4BY7 J;  2QGU A;  1YYV A;  2X1C A;  3BR5 A;  3T1B A;  2M87 A;  2DOE A;  4D7N A;  5FRO A;  4ZTJ A;  1JI8 A;  3G73 A;  3ZPL A;  4V19 K;  1ODD A;  1AA7 A;  1NG6 A;  3ABM H;  2D2W A;  2PFB A;  1T0F C;  1TWF J;  1K4S A;  2JUG A;  3HB9 A;  4Y33 A;  3JRH A;  2FBK A;  4Y17 A;  4KIB A;  3M8F A;  4IRI A;  3IV5 A;  3SFZ A;  3OIO A;  3IH4 A;  3W6J B;  2CFX A;  3KFW X;  2QBY A;  4CA0 A;  4BBS J;  3GEZ A;  3OYF A;  1EJ9 A;  4EJT A;  4ANJ A;  3JRA A;  2LY2 A;  1N77 A;  2HGC A;  1BOB A;  3U9G A;  4A5M A;  1F5T A;  4CYC B;  2DXI A;  5KAI C;  2Y0M A;  2EBI A;  3DTE A;  4HX4 A;  5F1R A;  1O7L A;  1KU9 A;  4N4O B;  1D5V A;  4EMS A;  3JRI A;  4RB0 A;  4U88 A;  2IAI A;  2IP2 A;  2ZKZ A;  4PZJ A;  2R5Y A;  2R5Z A;  2X0L A;  3S93 A;  5HS7 A;  4F7Z A;  1IN4 A;  1VQ7 I;  3CO7 C;  1W7P B;  3W2A A;  1WJA A;  4EEF G;  2BE5 F;  2OU2 A;  2CRG A;  2EZI A;  4UB8 C;  2HYJ A;  5LBQ A;  1G8X A;  2V4J C;  1YFH A;  3EUH C;  5DD4 A;  3LSP A;  1OCT C;  4OMY A;  1HC8 A;  1WJE A;  4P9U A;  2IS2 A;  2E7W A;  4QPQ A;  1XCV A;  4I76 A;  4CCN A;  2RAE A;  2OQR A;  1OYY A;  5L3G A;  3VWB A;  2BY3 A;  1LEB A;  1ZH5 A;  1XTA A;  4NC6 A;  3A03 A;  4BGD A;  2O8K A;  3W6K B;  2K3F A;  3CES A;  3JRE A;  2V26 A;  4I98 B;  1TQP A;  4A3K J;  3KLO A;  4M9X A;  3SEQ A;  4D9J A;  3C1D A;  2KIS A;  4OMZ A;  3S16 J;  3E5U A;  1IRF A;  2EPF A;  4PJM A;  2ZCW A;  4KA4 A;  4LGW A;  3K0L A;  2HOA A;  3Q9V A;  1ZRD A;  3S3N A;  2P5V A;  1FX7 A;  2L9S A;  3BQY A;  5FB2 A;  2R3S A;  4XKB A;  5J47 A;  3L2W A;  1MH4 A;  5HLG A;  4E7J A;  2VKH A;  1XG1 A;  1EA3 A;  4B43 A;  5JHF A;  1D1C A;  2E1C A;  1W4M A;  3LSM A;  1FNN A;  1XSV A;  1RUN A;  1FMW A;  3I64 A;  1S6L A;  4PGG A;  3QYF A;  3H36 A;  1GT0 C;  1ERD A;  2W85 A;  3EPZ A;  2A6E F;  3VSL A;  4V2G A;  3KYL A;  5ICG A;  3RJP A;  2NVT J;  1EKE A;  3C2G A;  4I2O A;  2W00 A;  3H9J A;  5FRM A;  3CD6 I;  3M9A A;  3BG7 A;  1F9N A;  2ECC A;  1OYI A;  3MWM A;  3AG4 H;  2R7F A;  4ZC3 A;  4ZH4 F;  3FHZ A;  2DOA A;  3HRT A;  4M9Z A;  1D0Y A;  5HNH A;  1AOY A;  3G1L A;  1ORK A;  5J4Y A;  1TL8 A;  1SD4 A;  2JA8 J;  1RRJ A;  2LRD A;  2OA4 A;  2IW5 A;  3SYT A;  3ZR8 X;  1MKM A;  1QO0 D;  1B9M A;  2WC2 A;  5GPA A;  4KIC A;  4RDU A;  1MSF C;  2KIU A;  3TW6 A;  4IRH A;  4XM3 A;  3GTG J;  3H92 A;  4G6T B;  2DT5 A;  3FKI J;  1JKO C;  5EEA A;  4MO7 A;  3H9G A;  2JRT A;  2LF7 A;  3IWF A;  3NRV A;  2HVR A;  2EZH A;  1JTY A;  2PMZ A;  1VZ0 A;  3E6D A;  5JHU A;  2XSJ C;  3QOD A;  1MDM A;  2P7C B;  4A3L J;  4IRG A;  4MTE A;  3I59 A;  4IOC F;  3IAM 2;  3HKZ A;  1X1B A;  2PJR A;  2ADU A;  3BLY A;  2CV0 A;  5ILV A;  3BTJ A;  3QWL A;  3FIS A;  4BJ5 C;  1QNT A;  3LSH A;  3FMQ A;  4C2M J;  3B02 A;  2HPI A;  4KN4 X;  3PJR A;  3OYH A;  1DGR M;  2ZNZ A;  2HQA A;  2MW8 A;  1OFC X;  2FEZ A;  2V6C A;  3VB2 A;  4CUG A;  2BZT A;  1E0E A;  2KL4 A;  2W25 A;  2IGN A;  1K78 A;  2W4S A;  3GVA A;  3GTJ J;  2W1O A;  1QZE A;  2P5L C;  4FX4 A;  4XLA A;  1FMV A;  2E71 A;  4BS9 A;  3MZ8 A;  3REO A;  2GZW A;  2KIM A;  3CZ6 A;  4WXH A;  1M1E B;  3PL8 A;  1PUF A;  2O6G E;  4UUT A;  2IGO A;  2VL8 A;  3V7R A;  5BPI A;  5EGO B;  1N25 A;  1P2F A;  3GTP J;  2VJJ A;  4HF0 A;  1XSX A;  3LQR A;  4BXX J;  2O7O A;  4A3D J;  2R5Y B;  5IP9 J;  4RGX A;  1UHM A;  3NAR A;  1X4P A;  3L2V A;  4DGW B;  3CMA I;  1FYM A;  1VQ4 I;  3PO3 J;  2WV0 A;  1DU0 A;  3BQZ A;  3M1E A; 
#chains in the Genus database with same CATH homology
 3V4G A;  2Z99 A;  3O6B B;  3D0S A;  2FBI A;  2IPQ X;  3L2C A;  3HTU A;  3WTZ A;  1MD0 A;  2IA0 A;  1P4X A;  2UWM A;  4ON0 A;  5J8F A;  4CO8 A;  1PP8 F;  3M8E A;  1UB9 A;  2ELH A;  4A2U A;  1BI3 A;  2YX4 A;  1IRG A;  2QUF A;  1DDN A;  1RNL A;  4L9T A;  1I5Z A;  2HDC A;  3DFG A;  4LK1 F;  2K4J A;  4G8X A;  1Y0U A;  4FT8 A;  4L9J A;  2O61 A;  3GZ5 A;  4U7D A;  1JHH A;  2HKO A;  2RKH A;  1MGT A;  4MEY F;  4U7B A;  4Z2Y A;  2UZK A;  1ZRE A;  5BS6 A;  5AIQ A;  1Z1D A;  1IF1 A;  1D8J A;  5CJ9 A;  3BPX A;  2ZME B;  2O8X A;  2Q8K A;  3CTA A;  2D1V A;  3GX4 X;  1KQ9 A;  5HS9 A;  2JPB A;  4FHT A;  1HKQ A;  2JPC A;  1ZYR F;  2W24 A;  5LEJ A;  1KU2 A;  3I59 B;  2K4B A;  2CYY A;  5JFR A;  1R23 A;  5L3E A;  3E5X A;  5F64 A;  1B1B A;  1TW2 A;  3O3K A;  1ZGJ A;  2IJL A;  2VE9 A;  5CVV A;  2P8T A;  1K78 B;  2HYF A;  5K5O A;  2BV6 A;  3HOT A;  4P9F A;  4MTD A;  3DKW A;  4AVP A;  3N4M A;  1GHC A;  4AD9 A;  5K5Q A;  4R8H A;  2PEX A;  3TKY A;  3JSO A;  2PI0 A;  2DBB A;  1SD6 A;  4NQW A;  3HYI A;  4HAM A;  5LLQ A;  1W5S A;  4XLP F;  3U1D A;  3C3W A;  1YW9 A;  2PMU A;  2EV5 A;  1U2W A;  2ISZ A;  1U5T A;  2QWW A;  1DP7 P;  2HTS A;  3Q9S A;  2CW0 F;  2K02 A;  2H09 A;  4L5J A;  1WI9 A;  1OYW A;  1CGP A;  3FXQ A;  4EGY A;  2H94 A;  3R61 A;  1ZG1 A;  2HYG D;  5DD8 A;  1U3E M;  4K2E A;  1WKM A;  1UCR A;  1J5Y A;  1U8R A;  2HQR A;  2A68 F;  3IC7 A;  3JAM K;  4RGU A;  3F22 A;  4LD5 A;  2O03 A;  5IT9 Z;  3KEQ A;  2VOO A;  3NQO A;  1STZ A;  1UST A;  4O5V A;  4UUV A;  1X3U A;  3MEX A;  1BI1 A;  3GO5 A;  2M5W A;  4RGS A;  1ZLJ A;  2G7U A;  2ESN A;  2DK5 A;  1BOA A;  2FSW A;  2BGC A;  4IXA A;  5AON A;  2KJC A;  2P4W A;  4KDP A;  3HRU A;  1JXS A;  5BMZ A;  2HTJ A;  4Y13 A;  4YIF A;  4EV0 A;  2XVC A;  4ESB A;  4OIR F;  3CDH A;  2RN7 A;  4U0V A;  2IVM A;  3DPL C;  1SD5 A;  1LQ1 A;  2YU3 A;  1XGO A;  1OMI A;  5D8K B;  2VC0 A;  4G94 A;  1T98 A;  2FRH A;  3F3X A;  5E18 F;  3HHG A;  1Z05 A;  1RIO H;  4R79 A;  3VOD A;  1QZZ A;  1Z6R A;  2DPU A;  1BI2 A;  1B6A A;  1OKR A;  2J5O A;  4P55 A;  1Z9C A;  1LDD A;  3TQN A;  1BC7 C;  1J9I A;  1R1U A;  3ML6 A;  2OD5 A;  3F6V A;  2XAQ A;  4NB5 A;  3E6M A;  2J5P A;  4A6D A;  2ZO4 A;  5HDK A;  4UVA A;  5DCM B;  2IA1 A;  1J0R A;  3GZ6 A;  1TLH B;  2LSO A;  4H0E A;  1YS6 A;  1U5T B;  2CG4 A;  1P4W A;  4DNC A;  3GFL A;  4U0W A;  3C7J A;  2EA4 A;  3MAJ A;  3KP4 A;  3F72 A;  4HDV A;  1S7A A;  2L4M A;  2NNY A;  3HUG A;  3GF2 A;  1TNT A;  1KYZ A;  2GIV A;  4UV8 A;  3ZMV A;  1C0W A;  3WTX C;  4I01 A;  3I4P A;  4Q48 A;  3ZN0 A;  3FZV A;  3ROU A;  1PUE E;  5ILU A;  1F4K A;  3GFI A;  3QP6 A;  5EEG A;  1XGM A;  1ZG5 A;  4BHP A;  3ERE D;  2LNB A;  2ACJ A;  5CYV A;  4LG0 A;  4JQF A;  3SZP A;  2EB7 A;  3R0A A;  2EK5 A;  2EFW A;  2ETH A;  2R7D A;  3V8L A;  2X4H A;  3K2Z A;  2FA5 A;  1S7O A;  3EET A;  5LRR A;  3DXJ F;  3CUQ A;  4RGR A;  2HQN A;  3LA2 A;  4BHB A;  1D8K A;  4Q4Z F;  3HOS A;  3TO7 A;  2DFI A;  4HV5 A;  2OBP A;  4I7H A;  1KQ8 A;  1SFX A;  3VOE A;  3GXO A;  5ILS A;  1ZN2 A;  5E1X A;  2Z5U A;  4RB2 C;  1XB4 A;  2YSR A;  4OIQ F;  4RAY A;  4M9S A;  3GFM A;  4G9Y A;  1L0O C;  1MJA A;  1PP7 U;  1ULY A;  3F6O A;  2CWE A;  1G6N A;  3G3Z A;  1YLF A;  2RGV A;  4DQ2 A;  1DPU A;  3LST A;  4EVI A;  1KQ0 A;  4XLN F;  4OIO F;  3P9C A;  4L18 B;  4D0P A;  1XDU A;  1R5H A;  3BZ6 A;  4KIG A;  2PMH A;  4ZZD A;  2D45 A;  2FNA A;  5DDG A;  5DV5 A;  2OZU A;  2RNJ A;  2QM3 A;  4ENK A;  2V1D A;  5L3F A;  1SAX A;  4LB6 B;  5K1Y A;  5HDG A;  2VON A;  3TOB A;  5D5V B;  2L3D A;  1XD7 A;  1FP2 A;  2F5F A;  3T5X A;  3AAF A;  1Q1H A;  4IF4 A;  3OOP A;  2DU9 A;  3WTS C;  2HWV A;  1T6S A;  1SD7 A;  3GUD A;  4A0Y A;  4RB3 C;  3PFI A;  4I0A A;  2A3S A;  4HQE A;  1YQA A;  4GXO A;  4UNO A;  2VOP A;  5JVT A;  2KRF A;  1QQI A;  2EV0 A;  1T0F A;  4KFC A;  3FF5 A;  3HSR A;  1IUY A;  4AIH A;  1FSH A;  4HV6 A;  3WE3 A;  1E2X A;  1KU7 A;  1K6O A;  3BJO A;  3VFZ A;  2NS0 A;  1TTY A;  5D4S A;  2RVC A;  3BWG A;  1I1G A;  3ZMZ A;  5JI6 A;  4LFU A;  2DLL A;  3WTU C;  1ON2 A;  1HBX G;  4WXC A;  3R0J A;  5E1W A;  4P5O A;  1FBQ A;  3ABT A;  2XIG A;  2QBY B;  3EUH A;  2QZ8 A;  4N9I A;  2VBY A;  2FOK A;  4Q5S F;  4M6X A;  4BH9 A;  2QEN A;  2RQP A;  3WU0 A;  3WGI A;  1HXD A;  2PN6 A;  1W7P D;  1DPR A;  3P9I A;  2FQ3 A;  2VBX A;  1D3Y A;  1FP1 D;  4L9V A;  3O2P E;  3IHU A;  4MGR A;  2LDU A;  3RDI A;  2L54 A;  2XGX A;  3ZQ7 A;  1RZ4 A;  1G4D A;  2G7H A;  3WTV C;  3R6S A;  2L02 A;  4LLG F;  2HFH A;  3ZMU A;  4NHJ A;  2STT A;  2CGP A;  2DAO A;  3E5Q A;  3MCZ A;  4BAY A;  1YS7 A;  1BBY A;  5FO5 A;  1TQM A;  2XUB A;  4CZZ A;  2VT2 A;  2E7X A;  3BP8 A;  3L7W A;  2HOE A;  2L01 A;  4MQV A;  2A69 F;  5A2Q K;  2EA2 A;  1G3W A;  4L0Y B;  5LHH A;  4KT5 C;  1R00 A;  4EM0 B;  1KA8 A;  4ZYG A;  2QVO A;  3I5U A;  2BEO A;  2ZFW A;  4HLY A;  3ZMS A;  2VBW A;  2ZXJ A;  3F8B A;  3FXR A;  1SMY F;  5HVQ C;  1U6G A;  1L3L A;  3H3Z A;  4I0B A;  3WGH A;  1XMA A;  2A5Y B;  3KE2 A;  2EFN A;  5DEQ A;  1IN7 A;  3VEP A;  3D5L A;  3GWZ A;  1MDM B;  3T8T A;  1PDN C;  2XKP A;  4YFX F;  4S04 A;  4R1H A;  5L3B A;  3E6C C;  4HYE A;  4OIP F;  2OZ6 A;  1GVJ A;  4EJW A;  3J80 K;  1ZHF A;  3T8R A;  2JZY A;  3ECO A;  3WG9 A;  3DQV C;  4A0X A;  2IRF G;  3HHH A;  4TV7 A;  4G7O F;  3IKT A;  1FWZ A;  3FMR A;  3RYP A;  4M71 A;  4UV9 A;  4YG2 F;  1R22 A;  3QU6 A;  4G6Q A;  3I58 A;  4LB5 A;  4MNU A;  5H20 A;  5D5W B;  1VTN C;  3E97 A;  2XAH A;  2M30 A;  2Q2E A;  4HX7 A;  3HSE A;  1IAW A;  1IN6 A;  1FC3 A;  4LMY A;  4P96 A;  4KIF A;  5CVI A;  1ZRF A;  1P92 A;  4G7H F;  2XRN A;  2WTE A;  4RS8 A;  2QLZ A;  5D8L B;  2Z33 A;  2GA1 A;  5KVR A;  2VBZ A;  2F2E A;  4GYI A;  2OQG A;  4JBA A;  5FLX K;  2KIF A;  4GCV A;  3E6B A;  5LGU A;  4O3M A;  1V4R A;  4CHU A;  2YR2 A;  4GYG A;  2HEO A;  2K86 A;  3L9F A;  3QP5 A;  2NNN A;  1TBX A;  4LLL A;  1HW2 A;  1CF7 A;  4HF2 A;  1H0M A;  2PLY A;  3ABU A;  3M7G A;  2DQR A;  3DV8 A;  1ZLK A;  5DYM A;  4OU0 A;  4EJO A;  3WE2 A;  1FPQ A;  3TOA A;  1RI7 A;  4CDG A;  1YIO A;  4CXF A;  3KCC A;  3V7S A;  4M6Y A;  2PBI A;  1BC8 C;  6PAX A;  1Z91 A;  2FXA A;  4WF2 A;  2G9W A;  1Z7U A;  1HKT A;  1ZRC A;  1B4A A;  4HA8 A;  4KNY A;  1KGS A;  3R4K A;  1XCB A;  1EH6 A;  3KET A;  1HSJ A;  2COM A;  3LFK A;  3K1M A;  2IA2 A;  4N9H A;  2KJB A;  4O6J A;  1LB2 A;  4HOB A;  2YPR A;  2XKO A;  1OPC A;  4MHG A;  1QZY A;  4UXN A;  3RIR A;  1H9T A;  4CIC A;  3ELK A;  3SQN A;  5AIP A;  2YX7 A;  1YW7 A;  4CYD A;  2DK8 A;  2MBF A;  2VE8 A;  3Q5F A;  1G3S A;  4YFK F;  2P6S A;  2XAJ A;  1S3J A;  3KZY A;  3I53 A;  3BRO A;  1MJ9 A;  3KP5 A;  4M73 A;  1GXQ A;  2H6B A;  1USS A;  2M45 A;  2VT3 A;  3NEU A;  1EV7 A;  3JAM Z;  3KLN A;  1IXS B;  3GW2 A;  3KEO A;  4KMU X;  3J81 K;  4BYY A;  5FGM A;  1HKS A;  1HW5 A;  3GLX A;  1I6X A;  4IJA A;  3BDD A;  3FWE A;  1P6R A;  1W7P A;  1WSU A;  1O3T A;  2GAU A;  1LDJ A;  5HDN A;  2NRA C;  2FE3 A;  1RUO A;  3WGG A;  2ZNY A;  4L9N A;  2AXL A;  5ERI A;  1EH8 A;  2ZBK A;  1B9N A;  3IRQ A;  1LDK B;  4HF1 A;  1IZ1 A;  1A04 A;  2HR3 A;  2F5E A;  3RTR A;  1J75 A;  3IRR A;  2MH2 A;  3L00 A;  2RC4 A;  3EQL F;  5D5U B;  4PCQ A;  4U0Y A;  1XGN A;  4EJV A;  3QU3 A;  3I0T A;  3MZY A;  1CF7 B;  2QQA A;  3WU1 B;  5D6F A;  4EGZ A;  5LHG A;  3HIF A;  5CVR A;  4UVC A;  4HX8 A;  2Y48 A;  5LGN A;  1REP C;  5J8C A;  3P9K A;  4M72 A;  2DPD A;  3K69 A;  2PG4 A;  3V8K A;  1XGS A;  1R36 A;  3V7C A;  4KN7 X;  3TO6 A;  4HDU A;  3K9T A;  3I71 A;  2EWN A;  1P4A A;  1ZAR A;  1R1V A;  4I02 A;  5J6X A;  1K7A A;  1BJA A;  4ZYE A;  4B09 A;  3HSF A;  4YII A;  5FD5 A;  1ZG3 A;  3IWZ A;  5E8G A;  1BIB A;  5DUK A;  3EDP A;  4Q47 A;  5FFX A;  1S8N A;  4IHS A;  2E1N A;  4ESF A;  2FNP A;  5L3C A;  3WTW C;  1O7F A;  2EV6 A;  2EFQ A;  3MZH A;  4MQ9 F;  4GGG A;  4L5I A;  1T2K A;  3ZN1 A;  2BBY A;  3F8N A;  3TDU C;  1R1T A;  2GQQ A;  3N97 A;  4RB1 A;  2DI3 A;  3MFK A;  2IT0 A;  1WWX A;  3KP6 A;  4AIK A;  3ECH A;  1ZGA A;  3KZZ A;  1WRJ A;  1XN7 A;  2VXZ A;  5ICF A;  3RKW A;  1I1S A;  1R5G A;  1QPM A;  3H3U A;  2K27 A;  1FBU A;  3GFJ A;  5K5R A;  1FT9 A;  1OR7 A;  4LG0 B;  2A6H F;  5TJJ A;  5H6Q A;  2HS5 A;  2EJR A;  1U78 A;  3I54 A;  2VOD A;  2FU4 A;  2CO5 A;  1YTY A;  2UXN A;  1DUX C;  3LAP A;  1FYK A;  1UFM A;  5LEK A;  1IXC A;  3CUQ B;  1IXR C;  4HZF A;  4ASN A;  3DEU A;  2LF8 A;  2MC3 A;  1LVA A;  4BXU A;  5DCF A;  4YFN F;  2ZME A;  4KMF A;  4PGH A;  3F21 A;  1E17 A;  2M1B A;  4EM1 A;  2AS5 F;  3TO9 A;  1QBJ A;  2W84 A;  4MEX F;  3HRS A;  2BYV E;  3K1P A;  1ZAO A;  2V9V A;  3BOQ A;  2B0L A;  2HZT A;  4WXD A;  4L0Z B;  2TDX A;  1JGS A;  3RYR A;  3FX3 A;  3FM5 A;  1W5T A;  1Z6T A;  2P7V B;  3F8F A;  4WCG A;  1BM9 A;  4G6D A;  2Z9O A;  1G3Y A;  2XV4 S;  1XDS A;  4XSX F;  2F5D A;  5TRD A;  2H27 A;  4BQA A;  3JTH A;  3GYH X;  3QRF F;  2O0Y A;  4WX9 A;  3RI4 A;  2O3F A;  3JTG A;  2CSO A;  1YO5 C;  3HRM A;  1ON1 A;  4QWQ A;  3WTT C;  4G7Z F;  2JTV A;  3QPT A;  5E17 F;  5IT3 A;  3FXU A;  3T0Y A;  2JSC A;  2EFP A;  4Y15 A;  4XSZ F;  2NAZ A;  3DP7 A;  3LAJ A;  2GXB A;  2GA2 A;  2ZJ2 A;  4EQQ A;  5FD6 A;  1MJB A;  2XAF A;  3S2W A;  1YW8 A;  4ENN A;  5CVJ A;  4S05 A;  1TNS A;  3BJ6 A;  2DO7 A;  2MD5 A;  4EM2 A;  2V1U A;  2FML A;  5DUI A;  1U5T C;  2OAZ A;  3OV8 A;  1R58 A;  4B8X A;  2VN2 A;  4A5N A;  1F1Z A;  5HLH A;  4FX0 A;  3PQJ A;  2M8E A;  2A61 A;  5BOX A;  2L4A A;  2QQB A;  1O3R A;  3R60 A;  2QYO A;  3CLO A;  4A6E A;  3FM3 A;  3KP3 A;  2V1X A;  3EYY A;  4ZYH A;  1B59 A;  4ETS A;  2P6T A;  1QGP A;  3F8C A;  3ULQ B;  5D4R A;  4I09 A;  5FFZ A;  1IW7 F;  2XRO A;  5ICC A;  2JT1 A;  1T38 A;  3KP2 A;  1AWC A;  1LJ9 A;  2NYX A;  3CJN A;  5A2Q Z;  5IT9 K;  4AIJ A;  3CUO A;  1BI0 A;  2K7L A;  2FF4 A;  5L3D A;  3EYI A;  4IPA A;  2HKX A;  3C18 A;  5E20 A;  3CO6 C;  3TGN A;  4BHC A;  1KYW A;  2XAS A;  4AWX B;  3BJA A;  5D5X B;  1J59 A;  2PQ8 A;  1FBS A;  1GXP A;  1IN5 A;  3P7N A;  1O3Q A;  1SMT A;  2MLK A;  2D1H A;  3LWF A;  4UHT A;  1BN5 A;  4XBF A;  2P5K A;  1S29 A;  1H9G A;  5DCM A;  3J80 Z;  1XMK A;  4LLN A;  3SZT A;  5EEH A;  3RPQ A;  2H6C A;  1FSE A;  4OOI A;  5E8I A;  3BY6 A;  3K1N A;  3V8J A;  3IL2 A;  2V79 A;  2C6Y A;  2GXG A;  1JE8 A;  1SFE A;  1NHA A;  2DQL A;  1TQI A;  1T39 A;  3RKX A;  3F23 A;  2ESH A;  3U2R A;  3QOP A;  1ONV A;  4CGZ A;  1FY7 A;  3SHF A;  3LQQ A;  3L09 A;  4IHT A;  5KK1 A;  5HLI A;  4WWC A;  1FLI A;  2RV8 A;  1FOK A;  4QLC U;  2Y75 A;  3QAH A;  1J7K A;  4A12 A;  5ED4 A;  4KUM A;  4EJU A;  4ESJ A;  2STW A;  1R7J A;  2FBH A;  5LGT A;  2ISY A;  4A0Z A;  5FLX Z;  1BIA A;  1I27 A;  2KKO A;  4GO1 A;  4E70 A;  4HBL A;  5HS8 A;  4LK0 F;  4OIN F;  3CUQ C;  1XSD A;  2MLG A;  1LEA A;  2PJP A;  2DW4 A;  4UVB A;  2WWY A;  5BQT A;  5CLS A;  5LHI A;  1SFU A;  5HOO A;  4KYW A;  1EH7 A;  2FMY A;  1J2X A;  1JHF A;  4ZZL A;  2GWR A;  2Q0O A;  4PDK A;  1O3S A;  4BNC A;  5BPD A;  2MA3 A;  4RAZ A;  5F6F A;  2F5C A;  4ZYD A;  1MZB A;  1HW1 A;  4ENM A;  3BPV A;  3LA7 A;  4LJZ F;  5H6R A;  3E3V A;  1K79 A;  3F8M A;  1FYL A;  3ZP5 A;  3LA3 A;  2RDP A;  3RPU A;  4IVN A;  1FZP B;  5LRS A;  4ENJ A;  4HW0 A;  5D6E A;  1V3F A;  1LNW A;  3ZMD A;  3KP7 A;  2Z3Y A;  3TDZ C;  3ZMT A;  3JW4 A;  1O57 A;  5CVU A;  3IKV A;  5ICE A;  3JSP A;  2XHK A;  1UHW A;  2XAG A;  3ISP A;  2QQ9 A;  3SXY A;  4JK1 X;  4HLX A;  4XRF A;  3COA C;  2W57 A;  5JR3 A;  2EFO A;  1HST A;  4M74 A;  4N0B A;  3WTY C;  3PQK A;  4WK8 F;  3B73 A;  2VC1 A;  3J7A O;  3HTS B;  2LKP A;  3FMS A;  3J81 Z;  1G3T A;  3QPH A;  3RKY A;  1TW3 A;  2CQK A;  1KU3 A;  3MQ0 A;  4HQM A;  2A07 F;  1WQ2 A;  2UXX A;  3WOD F;  1HQC A;  2DTR A;  1IN8 A;  3DF8 A;  2MH9 A;  5E1Z B;  3DPT A;  1YG2 A;  1YYV A;  3T1B A;  2M87 A;  3G73 A;  3ZPL A;  1ODD A;  2D2W A;  2PFB A;  2FBK A;  4Y17 A;  4KIB A;  3M8F A;  4IRI A;  3SFZ A;  3W6J B;  2CFX A;  3KFW X;  2QBY A;  3GEZ A;  4EJT A;  2HGC A;  3U9G A;  4A5M A;  1F5T A;  2Y0M A;  4HX4 A;  5F1R A;  1O7L A;  1KU9 A;  1D5V A;  4EMS A;  4RB0 A;  4U88 A;  2IP2 A;  2ZKZ A;  4PZJ A;  2X0L A;  5HS7 A;  4F7Z A;  1IN4 A;  3CO7 C;  1W7P B;  2BE5 F;  2OU2 A;  5LBQ A;  1YFH A;  5DD4 A;  4OMY A;  4P9U A;  2E7W A;  1XCV A;  2OQR A;  1OYY A;  5L3G A;  1LEB A;  1ZH5 A;  3W6K B;  4I98 B;  1TQP A;  3KLO A;  4M9X A;  3C1D A;  4OMZ A;  3E5U A;  1IRF A;  2ZCW A;  4KA4 A;  4LGW A;  3K0L A;  3Q9V A;  1ZRD A;  2P5V A;  1FX7 A;  5FB2 A;  2R3S A;  5HLG A;  2E1C A;  1W4M A;  1FNN A;  1XSV A;  1RUN A;  3I64 A;  1S6L A;  4PGG A;  2W85 A;  2A6E F;  5ICG A;  3RJP A;  4I2O A;  3M9A A;  1F9N A;  1OYI A;  3MWM A;  2R7F A;  4ZH4 F;  3FHZ A;  3HRT A;  4M9Z A;  1AOY A;  1SD4 A;  2OA4 A;  2IW5 A;  1MKM A;  1QO0 D;  1B9M A;  2WC2 A;  4KIC A;  2KIU A;  4IRH A;  3H92 A;  2DT5 A;  2JRT A;  2LF7 A;  3IWF A;  3NRV A;  3E6D A;  5JHU A;  2P7C B;  1MDM A;  4IRG A;  4MTE A;  3I59 A;  2ADU A;  5ILV A;  1QNT A;  3FMQ A;  3B02 A;  4KN4 X;  2ZNZ A;  3VB2 A;  2V6C A;  2FEZ A;  2W25 A;  1K78 A;  3GVA A;  2P5L C;  4FX4 A;  3REO A;  2GZW A;  2KIM A;  4WXH A;  2O6G E;  3V7R A;  5BPI A;  1P2F A;  4HF0 A;  1XSX A;  3LQR A;  4RGX A;  1UHM A;  1FYM A;  2WV0 A;  3M1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...