3BJOA

Crystal structure of the c-terminal domain of a possible atp-binding protein from methanocaldococcus jannaschii dsm 2661
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
SNALKDVLNILLMDEISKLKDFLSNLDYIKPKVNIEEEIIEIRKEDIINALKLFKGKYEIEVDKIPKAVYVYLVKKNILFLYPQRGTLKPQSFLVWNAIKRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uncharacterized ATP-binding protein MJ1010
publication title The structure of the C-terminal domain of a possible ATP-binding protein from Methanocaldococcus jannaschii DSM 2661.
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
molecule tags Nucleotide binding protein
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjoA00
3E6BA 2FMLA 4G7ZF 1AOYA 4HQMA 4LLLA 3F21A 2P4WA 1OKRA 3I64A 3KP3A 1EH7A 4AIJA 4O3MA 4WXHA 4KDPA 3F8CA 4R79A 3DF8A 3ULQB 4CHUA 3V8KA 5D8LB 3K0LA 2CG4A 4OIPF 1W5TA 3P7NA 1P4WA 2IPQX 2K4JA 2JPBA 2YSRA 5LBQA 2VE9A 4P9UA 4MGRA 2O6GE 1KU7A 3ABUA 1IN7A 2VC0A 3WTXC 1G4DA 4L0YB 3FX3A 4G7OF 4BHCA 2C6YA 3ZMUA 2M5WA 2BV6A 2V1XA 4PDKA 2HTSA 2M8EA 3BJ6A 2OA4A 3REOA 2FBKA 5K1YA 1QNTA 4YG2F 5KVRA 5HS7A 2P7CB 1ZREA 3Q9SA 3GF2A 2UZKA 4G8XA 1NHAA 2NYXA 2DQRA 3L00A 1J5YA 3H3UA 4OMYA 2Z33A 1XMKA 1T6SA 2HFHA 3RI4A 3TO9A 3LSTA 3J80Z 4MEYF 2VODA 2CO5A 2BEOA 1K7AA 4WK8F 4OOIA 2O61A 4IRGA 1YIOA 3R0JA 4LMYA 4ZYGA 5J8CA 4O6JA 3B02A 1WSUA 1LEBA 1RUNA 1XGOA 4A0XA 2VOPA 4P96A 3G73A 2XV4S 4XBFA 2H6CA 5L3CA 3FHZA 1RUOA 4PZJA 3I54A 2HQNA 3Q9VA 1TNTA 3GVAA 2L54A 2MLGA 1ZLJA 1HXDA 3ZN0A 3NEUA 1Z91A 1OMIA 2STTA 2XIGA 3NRVA 3WTVC 3U2RA 3HYIA 1O3RA 3E6CC 4Y15A 1HQCA 2IVMA 5H6QA 2QZ8A 3P9CA 1WWXA 1FBSA 2A61A 3W6KB 1VTNC 4LB5A 1S8NA 2VBWA 4UVAA 2NNYA 4KUMA 3VOEA 1YS7A 2G9WA 5D5XB 2EV5A 1HW5A 1ZRCA 1IN5A 3JAMZ 1XD7A 2Q0OA 1ZLKA 1UFMA 2LF8A 4WCGA 3FWEA 1T98A 1YLFA 5JI6A 5F1RA 3BPVA 5FLXK 3C18A 2LKPA 4EJWA 3TGNA 3FM5A 4BHBA 1LEAA 4LFUA 2XKOA 3H92A 2UWMA 3DXJF 3R6SA 1BI1A 5ILSA 1ZAOA 5FO5A 5HDNA 1W7PD 2XVCA 5DV5A 3O2PE 1SMYF 3P9KA 1ULYA 5DCFA 5DUKA 1JE8A 1R1VA 5TRDA 1ZRFA 2FBIA 2CGPA 4ON0A 3IKTA 3I59B 3LWFA 2G7UA 3IRQA 2GIVA 2W25A 4BQAA 4LG0A 5AIPA 5ED4A 2VXZA 1U3EM 4R1HA 4A5MA 3HRUA 2QBYB 2FU4A 1T0FA 1XSDA 4KMFA 1TNSA 5LRSA 4HYEA 1L0OC 4OU0A 1D3YA 3V8JA 4CO8A 1O7LA 1KQ9A 1FYKA 3HRMA 3LQQA 1QPMA 1ZRDA 3U1DA 3F8BA 1USTA 2MH9A 2GWRA 1OR7A 4A2UA 2V6CA 2RV8A 2DK8A 2FNPA 4Q48A 2DLLA 3ZP5A 2BYVE 1FX7A 2IRFG 4L9NA 2GXBA 4AVPA 3MZYA 2XAHA 1R1UA 1IXRC 2AS5F 1ZGJA 4LJZF 4M9ZA 4A12A 4I02A 4HLYA 2EFPA 4HF2A 2ZBKA 5HLHA 2ZJ2A 3QPHA 4EGZA 4KN4X 4I0AA 2OZUA 3LA2A 3VEPA 3MQ0A 4WWCA 1YW9A 1ONVA 4M6XA 3HTUA 2MLKA 2M45A 2F5EA 3GX4X 2A6HF 2K86A 3KZYA 3I53A 4XLPF 4HF0A 4BAYA 1YG2A 3PFIA 4ENNA 5A2QZ 4Z2YA 4HX8A 3WTZA 5BPIA 4HF1A 2ZCWA 3FMQA 1YS6A 2CFXA 4TV7A 4P9FA 4HLXA 1U5TA 5FD6A 1XCBA 4FX4A 3HHGA 5ILUA 3EETA 1P92A 1K6OA 3J80K 1YQAA 3ABTA 3LFKA 2QUFA 2VE8A 3CDHA 4GXOA 3EUHA 1GXQA 3SZTA 2K27A 5E8GA 2W85A 5HOOA 4M72A 2OQGA 3IHUA 1FLIA 4RGSA 2JTVA 4U7DA 1IF1A 1W7PB 4F7ZA 4LG0B 3WGHA 3ZMZA 2MH2A 2FSWA 3ECOA 2KIUA 4GO1A 3DKWA 2DQLA 1RIOH 2ESNA 3R4KA 2BBYA 2GA1A 3J81Z 3JTHA 2J5OA 5E8IA 1R00A 2KJBA 3ML6A 2DBBA 1IUYA 3DQVC 3R60A 2DFIA 2HYFA 1GHCA 3KCCA 2E1NA 2KJCA 5LGUA 3E3VA 3DEUA 4RB3C 3DV8A 5ICCA 4YIFA 5LEJA 4N9HA 2HEOA 2VOOA 3CUQC 4Q5SF 2GA2A 1LJ9A 3ECHA 1HW2A 5D4SA 4L9JA 3JAMK 1V3FA 2L4MA 1TLHB 3CUOA 1XGSA 1GXPA 3SHFA 2K4BA 1IXCA 2FBHA 4ESBA 1SD4A 1EH6A 2QQ9A 1HKTA 5JR3A 3M1EA 3KP5A 5CVUA 5ERIA 1XSVA 1Z6RA 3E5UA 1X3UA 1T38A 4KIFA 3MCZA 4LB6B 4HOBA 3G3ZA 3GFMA 4JQFA 1QGPA 3BY6A 4ZYHA 2PLYA 2CYYA 5LGTA 3GO5A 2O0YA 2VT3A 1KU9A 3BOQA 3IKVA 2OD5A 3JTGA 2RKHA 3QU6A 2PG4A 1OYWA 1P4AA 1ODDA 5D5UB 2NS0A 2A68F 3KP2A 1PUEE 3I4PA 1Q1HA 4E70A 1B1BA 4U88A 4RB1A 2ISYA 4HDVA 4H0EA 2FNAA 2FRHA 2STWA 3GFLA 1KU3A 3TO7A 3GZ6A 2ZMEB 1QBJA 4N9IA 3D0SA 2IW5A 1H9GA 3E6DA 4IRHA 4UXNA 3W6JB 4K2EA 2M1BA 1ZN2A 2HYGD 2YR2A 2ZKZA 5E1XA 3HOSA 5CVJA 2HKXA 1ZARA 2GZWA 4MTDA 1MKMA 4EJUA 3C7JA 3ZMVA 1SFUA 2QYOA 4UV9A 3HTSB 2COMA 1R36A 3COAC 2MA3A 3TDZC 2F5DA 5DYMA 5DEQA 2M87A 2PI0A 1IRFA 4WXCA 3O6BB 2QQBA 2M30A 1G3YA 2ZFWA 4GGGA 1O3SA 4ZYEA 1TW2A 2EB7A 1DUXC 5FGMA 1FYLA 3M9AA 1W4MA 3K1NA 3V8LA 3T8TA 5CLSA 5JVTA 4IVNA 1SFEA 3ZPLA 2OBPA 2Z5UA 1MD0A 4AIKA 3QPTA 4M73A 4YFXF 2DPUA 2PMUA 5A2QK 4G6QA 3I59A 3WTUC 3KLNA 2CWEA 2ELHA 3K9TA 4ENMA 2QBYA 4HA8A 3E5QA 4YFNF 1QQIA 1T2KA 4S05A 2EWNA 3QP5A 4I09A 3TKYA 1OYYA 1XDSA 2A69F 4JBAA 4OIQF 2DPDA 1DPUA 5AIQA 2XAJA 3N4MA 1UCRA 4L5IA 5FFZA 2KIFA 1L3LA 4CICA 3I58A 4HBLA 2YX7A 2Z99A 5EEGA 2NRAC 1HW1A 4YFKF 3WTWC 3FF5A 5HDKA 4LD5A 2KIMA 4D0PA 4S04A 4HX7A 3J81K 5IT9Z 3F23A 1H0MA 4O5VA 5L3EA 2L3DA 4WX9A 3KP4A 1J59A 2EFWA 1J9IA 1BIAA 5D5WB 1LQ1A 3FM3A 4RAYA 3E97A 3L09A 4G6DA 3J7AO 3I5UA 3TQNA 1OYIA 4U0VA 1O57A 3RKYA 1FP2A 4EMSA 1FT9A 5D4RA 5TJJA 2ESHA 4EJVA 2DAOA 1FY7A 2MD5A 1ZHFA 2FE3A 3ZMDA 4IHSA 1HKSA 1TQMA 1U2WA 3KETA 5J8FA 1T39A 1C0WA 3MEXA 4IRIA 1OPCA 5E1ZB 3WTTC 2XASA 4KMUX 2D2WA 1HSJA 1XGMA 3V7CA 4I2OA 2XHKA 5BMZA 1Z1DA 1F4KA 1BC8C 5LHGA 2DW4A 4KA4A 2A3SA 1FPQA 1S6LA 2JZYA 1W7PA 1I27A 3IL2A 2PBIA 3N97A 3MFKA 3QAHA 4Q4ZF 3GZ5A 4RS8A 3FXUA 4G7HF 1B6AA 4EM1A 1Z7UA 4QLCU 5F64A 2E7XA 4JK1X 2OU2A 3V7RA 3LAPA 5HLGA 2KKOA 3WU1B 4RGRA 3WG9A 3RIRA 1D8JA 5DCMB 3QP6A 4LGWA 3CUQB 3RKWA 4ETSA 3F72A 4M71A 1IZ1A 1CF7B 2RGVA 3L9FA 4BXUA 2J5PA 5HDGA 5HS9A 1K78B 1I6XA 2FA5A 4N0BA 4HQEA 1BBYA 1MZBA 3ISPA 1R1TA 1BN5A 3ZN1A 2IP2A 2FXAA 3GW2A 2ZNZA 3L2CA 1R5GA 1B9NA 4KN7X 2DTRA 5J6XA 2VC1A 2FF4A 3BJAA 1XCVA 1I1SA 4EGYA 4M6YA 2GAUA 2V9VA 2PJPA 2QWWA 4L5JA 2HKOA 3BP8A 3RJPA 3JW4A 2VONA 4CZZA 3ELKA 2A6EF 4XRFA 5D6EA 2P6SA 1R58A 4UNOA 1UHWA 4HZFA 4ESJA 1SD6A 5D6FA 5L3BA 3BPXA 1HKQA 3HHHA 1J75A 4HV5A 5EEHA 1EH8A 1FC3A 2Z3YA 4EV0A 5D5VB 2E1CA 4B09A 4MQVA 2HR3A 1B9MA 2ZMEA 3E6MA 3GEZA 5H6RA 5K5RA 2PQ8A 3WGGA 2JRTA 1F5TA 4CGZA 3H3ZA 5LHHA 4IHTA 2XRNA 1IN4A 3QOPA 1MJ9A 3EYYA 5E20A 1Y0UA 1RI7A 1IRGA 3O3KA 2LDUA 2OQRA 4UVCA 4DNCA 1P6RA 1IN6A 2HQRA 4UVBA 2MC3A 1FBQA 2VBXA 4L9TA 2GQQA 1FSEA 5FB2A 4BH9A 2D1HA 1SD5A 2DI3A 1WKMA 1IN8A 1G3TA 3BZ6A 2ZNYA 4OIOF 2X0LA 2QM3A 3BWGA 2VBYA 2O8XA 1PP8F 4ENJA 1MDMB 4ZYDA 4NQWA 2H09A 5IT9K 3TOAA 3F6VA 2P7VB 5BOXA 4WXDA 3I0TA 1P4XA 3FZVA 3PQJA 2XGXA 3TDUC 5F6FA 5AONA 4ESFA 1Z6TA 1F1ZA 4BYYA 4AD9A 1SMTA 1LDJA 1U6GA 2P5LC 1FBUA 2CQKA 3HOTA 1CGPA 3VODA 2F5CA 3WE3A 3GFJA 2XAQA 4CDGA 2R3SA 4I98B 4G94A 4KFCA 3DFGA 2TDXA 1G6NA 2EV0A 2ACJA 4HV6A 3U9GA 2Q8KA 1ZG5A 4GYIA 3WU0A 3KP6A 3HIFA 5L3GA 3IWFA 2L02A 2K7LA 1WQ2A 2XUBA 3FXQA 2IJLA 3F8NA 1MJAA 3ERED 4LLNA 2DU9A 4I01A 3ROUA 5CYVA 3HUGA 5CJ9A 2VBZA 2IA0A 3QU3A 1KYZA 1DP7P 1BIBA 4Y13A 2Y75A 3S2WA 2WV0A 3K1PA 4BNCA 1USSA 4KICA 2FOKA 4RGXA 3D5LA 3DPTA 1TW3A 4R8HA 2LF7A 2Q2EA 1DDNA 5DUIA 1IW7F 2YPRA 3EQLF 3RPQA 2JPCA 1GVJA 2IA1A 4DQ2A 3WTSC 2Y48A 4GCVA 4YIIA 6PAXA 3NQOA 1FNNA 3BDDA 1BI2A 3ZMSA 5LHIA 3LA7A 1U78A 1ZG1A 4UV8A 2P6TA 5L3FA 2DT5A 4KYWA 1HBXG 4NHJA 1P2FA 4M9SA 1JGSA 1Z9CA 1MGTA 5JFRA 2DK5A 2EJRA 1LVAA 2Y0MA 2OZ6A 3GUDA 2P5KA 3GLXA 2DO7A 5DD8A 1REPC 3C3WA 2X4HA 1V4RA 3P9IA 1H9TA 2LNBA 4A6DA 4FX0A 2EFQA 1O7FA 2P5VA 1B4AA 1XN7A 1BI0A 3KLOA 4B8XA 3Q5FA 2V79A 4ENKA 3CJNA 3C1DA 2WTEA 1YFHA 5ICGA 1W5SA 1WI9A 1YTYA 2PMHA 2PFBA 1SFXA 3ZMTA 2H94A 1A04A 3M8EA 3WODF 5E17F 3KE2A 1KGSA 1KQ8A 1J2XA 3LA3A 1LNWA 3RDIA 1YW8A 4EJTA 2D1VA 4EJOA 5HVQC 5DCMA 4ASNA 1TTYA 1RZ4A 3T0YA 1MJBA 3CUQA 3SZPA 2ETHA 2VT2A 1CF7A 3RYPA 3F6OA 5LGNA 1U5TC 3TOBA 2RC4A 1STZA 1K78A 4CXFA 2RVCA 1XDUA 2UXXA 4M9XA 1TQPA 3FMSA 3T5XA 1ON2A 4EVIA 1B59A 2PN6A 3GWZA 4KNYA 4XSZF 3GFIA 1D8KA 2HGCA 1SD7A 1DPRA 2WC2A 3VB2A 4AIHA 2QENA 2FEZA 4P5OA 4QWQA 1E17A 3CLOA 2EA2A 3K69A 4IPAA 5DDGA 1R22A 5LLQA 1S29A 1KA8A 3K1MA 5CVVA 2XKPA 4ZH4F 3I71A 2L01A 2RDPA 4XLNF 3LAJA 5CVIA 1ZGAA 1UB9A 4U0WA 1ZH5A 3LQRA 3E5XA 1YO5C 3CO6C 1BI3A 2EA4A 4RB0A 3RTRA 1LB2A 3F3XA 3GXOA 4A5NA 2XAFA 4IF4A 4XSXF 3T1BA 4MQ9F 2GXGA 3F22A 1I1GA 1G3WA 1AWCA 1R7JA 4ZZDA 2HS5A 2O3FA 1YW7A 4A6EA 5HS8A 1QZZA 4Y17A 2D45A 1R23A 1YYVA 2OAZA 2O03A 2F2EA 3RPUA 1SAXA 2BGCA 2HOEA 2E7WA 2H6BA 3KZZA 2P8TA 2NAZA 3RYRA 4ZZLA 3V7SA 5HLIA 1JHFA 3T8RA 2W57A 3CTAA 2XROA 2KRFA 2ZO4A 2VN2A 4MEXF 3F8MA 3R61A 1PP7U 1MDMA 1U8RA 2JT1A 1LDDA 4GYGA 5KK1A 4CYDA 4L9VA 2W84A 5CVRA 2V1DA 1S7AA 2B0LA 2HZTA 5DD4A 4U0YA 3FXRA 3GYHX 2HTJA 2YU3A 5LEKA 2EV6A 4MTEA 1TQIA 2RNJA 5ICEA 1D5VA 2QQAA 1JXSA 2HDCA 4PCQA 3HRTA 1FP1D 2FMYA 1FSHA 4KIBA 4PGHA 3BROA 1TBXA 3WE2A 3EYIA 4EM2A 2ADUA 2ZXJA 2PEXA 3SFZA 3V4GA 1QO0D 5K5OA 2LSOA 1KQ0A 2BE5F 5IT3A 4I7HA 1FOKA 5LRRA 3BJOA 1IAWA 1KU2A 4AWXB 5FFXA 4LLGF 1K79A 2CW0F 3IWZA 2CSOA 1XSXA 3F8FA 5E1WA 2FQ3A 5BQTA 2H27A 2NNNA 3OOPA 4OIRF 4RGUA 3VFZA 4LK0F 1IXSB 2QLZA 2IA2A 5H20A 4HAMA 3QRFF 3OV8A 3SQNA 2EK5A 1ZYRF 5JHUA 2HWVA 4FHTA 3KEOA 3K2ZA 2IT0A 3JSOA 3KP7A 2YX4A 4I0BA 4M74A 1UHMA 1J7KA 2W24A 4G9YA 2A07F 4EM0B 4UUVA 2V1UA 3RKXA 1BJAA 5BPDA 3WTYC 3MWMA 2ISZA 3HRSA 4NB5A 1FWZA 3KEQA 4FT8A 2RQPA 2RN7A 4EQQA 4Q47A 3TO6A 4A0ZA 3IRRA 2QVOA 1Z05A 1R5HA 3M7GA 3AAFA 1LDKB 4UHTA 4U7BA 1JHHA 2F5FA 3CO7C 5L3DA 1KYWA 4MNUA 1O3QA 3WGIA 4L18B 1HSTA 3PQKA 2R7FA 4BHPA 5D8KB 1PDNC 1EV7A 4KIGA 4LK1F 4HX4A 1XB4A 2JSCA 3M8FA 1I5ZA 1XGNA 4HDUA 4P55A 4IXAA 2K02A 2Z9OA 4WF2A 5FLXZ 1BM9A 5K5QA 1BOAA 3HSRA 2EFNA 5ILVA 4RAZA 3R0AA 2MBFA 2EFOA 1ZG3A 3HSEA 2A5YB 3IC7A 3B73A 1FYMA 1WRJA 2G7HA 2XAGA 5E18F 4IJAA 2UXNA 1QZYA 3JSPA 1BC7C 5BS6A 4PGGA 1O3TA 1S3JA 3DPLC 3KFWX 4OMZA 3ZQ7A 3MAJA 3L7WA 4OINF 1G3SA 4KT5C 2R7DA 1J0RA 2WWYA 4RB2C 4HW0A 1S7OA 3DP7A 4A0YA 1F9NA 3MZHA 1FZPB 1U5TB 1XMAA 1E2XA 5ICFA 1ON1A 4L0ZB 2AXLA 3EDPA 3SXYA 2L4AA 5FD5A 3HSFA 3FMRA 1RNLA 4MHGA
chains in the Genus database with same CATH superfamily
2VKHA 2WB1A 3E6BA 2FMLA 2DA6A 4G7ZF 1AOYA 4HQMA 4LLLA 5HODA 3F21A 2P4WA 4QSHA 1OKRA 2VIXA 3I64A 3KP3A 2JK3A 1EH7A 4AIJA 3QPLA 4O3MA 3ZCOA 1NG7A 4LG3A 4WXHA 4KDPA 3F8CA 4R79A 3DF8A 3ULQB 4CHUA 1WJEA 4QTRA 3CF5F 3V8KA 4B3AA 5D8LB 3HGYA 3K0LA 4BU2A 2CG4A 4OIPF 1W5TA 3P7NA 3OYLA 4U87A 1P4WA 2IPQX 2K4JA 4M3GA 2CQXA 3PSFA 4F91B 2JA7J 2JPBA 2YSRA 5LBQA 2X51A 5HNHA 2VE9A 4P9UA 3L2UA 4JX5A 3FBIB 3ZQLA 3NAUA 2CW8A 4MGRA 3HOXJ 3PSIA 2OPTA 1VQ8I 1AU7A 4DJAA 2O6GE 2BXYA 1KU7A 3G71I 1D1BA 3G6EI 3ABUA 4DYCA 1UAAA 1LFBA 3LSIA 1IN7A 2VC0A 3WTXC 1G4DA 4L0YB 3FX3A 3OYFA 2LY1A 4G7OF 3WG7H 1HDDC 1D1AA 4BHCA 2C6YA 3ZMUA 4GDFA 2M5WA 4XQFA 2BV6A 2V1XA 4PDKA 2JA6J 4HRIA 2HTSA 3S2HJ 2M8EA 3BJ6A 3KEYA 2CQNA 2OA4A 3HZJA 3REOA 2FBKA 1K4TA 5K1YA 4DOZA 1QNTA 4YG2F 5KVRA 4KJZA 5HS7A 1FEXA 2P7CB 2AQFA 1ZREA 2DA2A 1VQ9I 3Q9SA 2DA5A 4FE4A 3GF2A 2UZKA 1X2MA 3H9QA 1NHAA 4G8XA 1KONA 4BJTA 3OYBA 3CJTB 2NYXA 1G59A 3S14J 3KX2A 3JRFA 2DQRA 3L00A 2HOAA 1J5YA 1YJ9I 3H3UA 3B6AA 3MKZA 4OMYA 2Z33A 1XMKA 4YRVA 4RBOA 1T6SA 2HFHA 4DW6A 3RI4A 3TO9A 3LSTA 3J80Z 4MEYF 3H5AA 4FASD 2VODA 2R7XA 3PNTA 2CO5A 2DMPA 2DFFA 2BEOA 2B63J 3CC4I 4BACA 1K7AA 2IS1A 2LG4A 1FOXA 2KPMA 2DOAA 3K4NA 1T33A 4WK8F 3H0DA 2FOWA 4OOIA 2O61A 4IRGA 1YIOA 2JVGA 3R0JA 2IXSA 4LMYA 4ZYGA 5J8CA 4O6JA 3HOYJ 3B02A 1WSUA 2MABA 1LEBA 2M0CA 4MFDA 1RUNA 1XGOA 1R9TJ 2Y0SA 3VYUB 3ZQFA 4A0XA 4GRIA 2VOPA 3PUFA 1TWGJ 3FKJA 4P96A 3OL3A 2V9PA 3G73A 1E3PA 2XV4S 1RESA 4XBFA 3OYKA 2H6CA 1K83J 5L3CA 3FHZA 2L9VA 1RUOA 4L5EA 1Z0XA 3JRDA 4EATA 4PZJA 3I54A 1VQLI 2HQNA 3BG5A 3Q9VA 3I56I 1TNTA 3ZXSA 1V5EA 3GVAA 2M3AA 3CF2A 4CYCA 1IC8A 2L54A 4LITA 2MLGA 1VZ0A 1ZLJA 1HXDA 3ZN0A 4HSRA 3NEUA 5IP6A 1Z91A 2E2HJ 1OMIA 2E1MB 1VQOI 1WJDA 2STTA 2KT0A 2XIGA 2HQ5A 3NRVA 4FETA 5KAFC 4LOCA 4CCKA 3WTVC 5EG0A 3U2RA 1MMSA 1EKEA 3FK6A 1R4NB 3HYIA 1B72A 1O3RA 3E6CC 3BTIA 2BW3B 4Y15A 1HQCA 2IVMA 5H6QA 2QZ8A 3A0BC 3P9CA 3W2VA 2LBFA 1WWXA 2DYSH 2LRDA 2R5ZB 3MMYB 3G4SI 1FBSA 2A61A 2WBMA 3W6KB 1VTNC 4LB5A 4IHYA 1S8NA 1XG1A 3BCAA 1AA7A 2VBWA 4UVAA 2NNYA 1UMQA 4KUMA 2XGEA 4ZDLA 2HNHA 3FXLA 2E71A 3VOEA 1YS7A 2G9WA 5D5XB 2EV5A 2ELJA 4N4NB 2L2OA 5E3LA 1HW5A 1VQNI 1OCCH 1ZRCA 1IN5A 3CP2A 4CCNA 3JAMZ 3LSJA 2HQAA 1XD7A 2Q0OA 3SDGA 1ZLKA 5FLVA 1UFMA 2LF8A 4WCGA 3FWEA 1T98A 2HVQA 4PK4A 1UG0A 1YLFA 2IGNA 5M3FJ 5JI6A 2NS8A 2X6WA 3H0GJ 5F1RA 3CCVI 2OTJI 3F0CA 3BPVA 5FLXK 1R5ID 4A3CJ 5DS9A 1KZHA 2HDDA 3C18A 2LKPA 4EJWA 5E3NA 5HLTA 3TGNA 1IGNA 5E79C 4QPQA 3DLLF 4G12A 2KRHA 1IRXA 2M2EA 3FM5A 4BHBA 4RDUA 5EEAA 4OAZA 3ERMA 1LEAA 3FDYA 2XKOA 4LFUA 3H92A 4E4HA 2LC2A 2UWMA 1X2NA 3DXJF 3R6SA 2Z1DA 1BI1A 2VPRA 2BY0A 5ILSA 1ZAOA 3C2HA 3OYNA 4OWRB 5FO5A 5CQEA 5HDNA 1W7PD 4JX6A 1ZR2A 1TC3C 3FHNA 1MMGA 4D1QA 4BE0A 2R7UA 2XVCA 3BZCA 5DV5A 3O2PE 1SMYF 3P9KA 1ULYA 5DCFA 5KCMA 3ZGKA 3HBLA 5DUKA 3ABLH 1JE8A 4YELA 1R1VA 5TRDA 1ZRFA 3IUOA 2FBIA 2CGPA 1JKOC 2MG4A 2PX9A 3A4CA 2KLOA 4ON0A 3PO2J 2DCEA 2ZJRF 3IKTA 3HOVJ 3I59B 3LWFA 3CC2I 2G7UA 3VPRA 3IRQA 2GIVA 2W25A 4XORA 4BXFA 3RKQA 4J01A 4BQAA 3CCRI 4LG0A 1ETKA 5AIPA 1ZKGA 1A6IA 5ED4A 2EINH 2VXZA 1U3EM 4R1HA 4A5MA 2CQQA 2X1CA 3HRUA 4A3IJ 2WAEA 2ECCA 4I99C 2LREA 2FU4A 2QBYB 1T0FA 3BR6A 3BR0A 1XSDA 1TNSA 4KMFA 5LRSA 3O8GA 2DOFA 4HYEA 1SVMA 1OCZH 1N77A 1POGA 1WJ5A 3H35A 1YJNI 3BQYA 1JTYA 1L0OC 2CRGA 1D3YA 4OU0A 1S5LC 2IS2A 5IP9J 3V8JA 4CO8A 4IL6C 1O7LA 2QKMB 3VYRB 1P7IA 3MN2A 3VSKA 4YIRX 2DFEA 4C2UA 1KQ9A 1FYKA 3HRMA 2CW7A 3LQQA 1QPMA 1YRNB 1ZRDA 1W0TA 3MKWB 3U1DA 3F8BA 1USTA 2MH9A 3U21A 1R71A 3VWBA 1XS9A 2GWRA 1OR7A 3BR2A 3RQ4A 4A2UA 2EZLA 2XAUA 4E6KG 4XKCA 2V6CA 2RV8A 2DK8A 2FNPA 4Q48A 1RR8C 2DLLA 4A3GJ 3ZP5A 1FX7A 2BYVE 2IRFG 3K4KA 4L9NA 1VNDA 4ZJZA 2GXBA 2KL4A 4AVPA 3MZYA 2K5CA 2XAHA 1R1UA 1IXRC 4PJLA 3U1KA 2AS5F 2M0MA 5EZHA 1ZGJA 4LJZF 4M9ZA 3OOUA 4A12A 4I02A 4A3DJ 3HOWJ 4HLYA 2IEKA 2F4OB 2DYRH 3IH2A 2EFPA 4HF2A 2ZBKA 2XC7A 5HLHA 2ZJ2A 3QPHA 1AKHB 4EGZA 4KN4X 1ETQA 4P1WA 3KYCB 2E2JJ 2JA2A 4FCYA 5J4YA 2L7ZA 4I0AA 3LSRA 2OZUA 3LA2A 1WJFA 3C2GA 4BUPA 3VEPA 3MQ0A 3WHBA 4Y33A 4WWCA 4C30A 1YW9A 3OYDA 1ONVA 1RPWA 4M6XA 3HTUA 4BQOA 2MLKA 2M45A 2F5EA 2M4GA 4E7ZA 3GX4X 2A6HF 5M3MJ 2K86A 3KZYA 3I53A 4XLPF 5C4JJ 2G0EA 4HF0A 4BAYA 1YG2A 4Y4RA 5GPAA 3PFIA 4ENNA 5A2QZ 4Z2YA 4HX8A 2BY2A 3WTZA 5BPIA 4HF1A 4M3DA 2E60A 2ZCWA 3FMQA 3W3CA 1PJRA 1JTXA 1YS6A 2CFXA 3QPSA 3A02A 4TV7A 4P9FA 4BY7J 5K7FA 3BTJA 4HLXA 1U5TA 5FD6A 5C4XJ 3TP0A 1XCBA 1XPXA 1HCRA 4FX4A 3HHGA 5ILUA 1Y8QB 4D5CA 3EETA 3GTMJ 3DTKA 1WI3A 2LYCA 1P92A 2K9NA 1I3QJ 1K6OA 2H8WA 2BVMA 2R7WA 1X1DA 4NC7A 3J80K 1YQAA 3ABTA 3D1NI 2HOTA 3LFKA 2PMZN 2QUFA 3S17J 3S3MA 1WJAA 3KIOA 3BT9A 1Z7LA 2VE8A 3CDHA 4GXOA 5C44J 4II3A 3EUHA 2DT7B 2Z16A 3NWTA 1GXQA 2DDBA 2K27A 3SZTA 1DU0A 2GOMA 2V1NA 5E8GA 3DTIA 3HC7A 4FTHA 1X3WB 2W85A 4RAGA 5HOOA 4M72A 1JKRC 2OQGA 1PYVA 4RMNA 3IHUA 1BA5A 1FLIA 4RGSA 2R7QA 2VKVA 2ZJPF 4IOCF 2JTVA 4U7DA 3TMOA 1X1PA 1WJBA 1IF1A 1X58A 1W7PB 4AYBA 2R7OA 3CMMA 1OCPA 4F7ZA 3GTOJ 4XOTA 4Z6YA 4LG0B 1K4SA 3WGHA 3ZMZA 1BOBA 3RSNA 2UUZA 2MH2A 2FSWA 3ECOA 2KIUA 4GO1A 3DKWA 2DQLA 1RIOH 2ESNA 1XTAA 2BBYA 2GA1A 2LH9A 3R4KA 5IYDJ 3J81Z 3JTHA 2J5OA 5E8IA 1R00A 2KJBA 3CDIA 3ML6A 2DBBA 3VYSB 1ACIA 2JA8J 1IUYA 2VB6A 3DQVC 1Z67A 2EZIA 3R60A 1W0UA 2DFIA 2HYFA 5IYBJ 1GHCA 3KCCA 1V5FA 3LL7A 4LIVA 4DBRA 2E1NA 2KJCA 2LOOA 5LGUA 3E3VA 3DEUA 3LFUA 2VPLA 3JRAA 1WFXA 1PVEA 1YX5A 2LKSA 4RB3C 3BR5A 3DV8A 4A3BJ 5ICCA 4YIFA 2VQGA 5LEJA 4N9HA 2HEOA 1Q1VA 2L9RA 2WADA 2A5WA 2L0KA 2VOOA 3CUQC 4Q5SF 2GA2A 3H1CA 1LJ9A 3ECHA 1RKTA 4X0GA 2E35A 3I3LA 4XRSA 3ASNH 1HW2A 2VI6A 2XRLA 3E0JB 5D4SA 4L9JA 1EA3A 3JAMK 1V3FA 2MSYA 2L4MA 2LKXA 1TLHB 3CUOA 1XGSA 2FD5A 4XOPA 3K70C 1GXPA 3FXOA 2K4BA 3SHFA 1IXCA 2FBHA 4ESBA 2LK2A 1SD4A 3CJQB 3HEFA 1EH6A 2QQ9A 1HKTA 1A35A 5JR3A 2YS9A 5IOYA 3M1EA 3KP5A 3KYLA 5CVUA 3KYDB 5ERIA 5E3MA 1XSVA 1Z6RA 3E5UA 1X3UA 1TL8A 4AC0A 1T38A 4KIFA 1MMDA 1WZ2A 3MCZA 2F48A 4LB6B 4IEJA 4HOBA 3G3ZA 3GFMA 3RQIA 1T56A 2JWTA 2ECBA 2RQQA 4JQFA 1QGPA 3BY6A 4ZYHA 2PLYA 2CYYA 3M1CA 5LGTA 3GO5A 2X9DA 3W2WA 2O0YA 2Q1ZB 2VT3A 4B4CA 1IJWC 4Y3OA 2HPMA 1KU9A 3BOQA 3IKVA 3PL8A 4II2A 2OD5A 3JTGA 2RKHA 3QU6A 4ZYAA 3TW6A 4B43A 2PG4A 1OYWA 1P4AA 2VKDA 1ODDA 3OIPA 5D5UB 5BNGA 3JREA 1JJ8C 1DGRM 2NVUB 4XKVA 2NS0A 2A68F 3H9GA 5LD2C 3KP2A 1PUEE 4F92B 3I4PA 4XMYA 1ZR4A 1Q1HA 4E70A 2E34A 3SDBA 1B1BA 2CV1A 4BDZA 2R7RA 4U88A 3PM1A 5GAGJ 4ZC3A 2ID6A 2H8RA 5M5XJ 5F0FA 4RB1A 2ISYA 3ZQQA 1WH5A 3DBLB 3BG9A 4HDVA 2KRCA 3H3VK 4I76A 1WHUA 4H0EA 2FNAA 2JA5J 4DZPA 3CC7I 1DGWY 2FRHA 2K9QA 1GUUA 2STWA 3GFLA 1KU3A 3TO7A 3GZ6A 2R0QC 1IG7A 2R7SA 2ZMEB 2EQRA 2DXIA 4IHVA 3PO3J 1QBJA 4N9IA 3D0SA 2IW5A 1H9GA 1WPKA 3OYIA 1Y0NA 3E6DA 4IRHA 3F9KA 4UXNA 3W6JB 1PUFB 2BW3A 1VQ6I 1TWFJ 1OCRH 4K2EA 3M07A 2M1BA 3BG6A 1ZN2A 2HYGD 4KT6A 2R5ZA 2YR2A 2ZKZA 3A1YA 2X48A 5E1XA 3CCLI 1LE8B 4X1EA 3HOSA 5CVJA 2HKXA 1ZARA 2GZWA 2JUGA 4MTDA 2MD0A 2H1LA 2FX0A 3HOZJ 1ITYA 2VASA 1MKMA 2E5ZA 4EJUA 3C7JA 3ZMVA 1SFUA 4ABZA 2F4MB 1X1AA 2QYOA 4UV9A 1D1CA 3HTSB 3K4BA 2COMA 3W6VA 1R36A 2A05A 1BJZA 5KHDA 3COAC 2MA3A 3TDZC 2F5DA 5DYMA 5FKMA 1FJLA 5DEQA 4PJJA 1CQTA 3ZOBA 2M87A 4XRMA 2PI0A 1IRFA 3QYEA 4PFPA 1W36C 2LD5A 4WXCA 2JQ7A 3UNGC 2RAEA 3O6BB 2CH0A 2QQBA 2M30A 3K6GA 1G3YA 1IO2A 1X19A 2ZFWA 1ETVA 4GGGA 1O3SA 3S1MJ 1GLNA 2DDAA 4ZYEA 1MH4A 4A3LJ 1TW2A 2EB7A 4DZJA 2CUEA 4B1RA 3I9V2 3FBNB 2HYJA 1DP3A 1GV5A 1DUXC 4NQWB 3DPUA 3EPZA 5FGMA 4A3KJ 1FYLA 3M9AA 3B6CA 1W4MA 3CLQA 2KHMA 5J3LA 5EDNA 4RLQA 5J4VA 3K1NA 3V8LA 3T8TA 2KISA 2ME6A 1GVDA 3MKLA 4BE1A 3A2KA 5CLSA 2OV7A 2QSHX 3LSKA 1WGXA 5JVTA 4MIMA 4IVNA 1OR7C 1SFEA 3S1NJ 2ZB9A 3TP3A 3BCBA 1MH3A 3ZPLA 2OBPA 2Z5UA 1MD0A 4AIKA 3QPTA 3K4MA 4M73A 4YFXF 3BC8A 2DPUA 4FQGA 2PMUA 1K6YA 5A2QK 3OMYA 1JUPA 4G6QA 1U9OA 1VI0A 5FRMA 3HJEA 1YI2I 9ANTA 4JP0A 3I59A 2O9LA 3WTUC 2K9MA 3BR1A 3CCJI 4RM2A 3KLNA 3HDDA 3SFIA 2NVQJ 2CWEA 2KDZA 3UKGA 2VJIA 2ELHA 3K9TA 2I5UA 4ENMA 3N05A 4CZCA 2QBYA 2CV2A 4HA8A 2XSJC 3E5QA 4YFNF 1QQIA 2X1EA 1T2KA 2X6XA 5F0HA 4S05A 2M7BA 2EWNA 3QP5A 3WHCA 2R7VA 4I09A 3TKYA 4HEA2 1OYYA 1XDSA 5C3EJ 1JUSA 2A69F 2R5YB 3SYTA 1VQ4I 4JBAA 1YITI 4OIQF 2DPDA 1DPUA 1RR7A 4A93J 2ZSIB 1H88C 5JLXA 5AIQA 2XGCA 2XAJA 3K70D 1YRNA 3L1PA 1GV2A 3N4MA 1UCRA 1MBEA 3CCEI 4L5IA 4XKWA 5EYRA 3HUGB 5FFZA 2KIFA 4OAYA 1L3LA 4CICA 1QZEA 3K10A 3SEQA 3ASOH 2E19A 3I58A 2COBA 1YHQI 1JKPC 4HBLA 2YX7A 4PUSA 1I50J 2Z99A 5EEGA 2NRAC 2MGQA 1HW1A 2L5QA 4YFKF 3WTWC 2DA7A 3FF5A 4AIDA 5HDKA 4E7LA 4LD5A 2KIMA 4D0PA 1TWHJ 4S04A 3OYHA 3HG9A 4HX7A 1E3OC 2RREA 3J81K 5IT9Z 2V4JC 3CD6I 3F23A 1H0MA 4O5VA 2Q2EB 1NTCA 3ESWB 2L3DA 5L3EA 2LY2A 3LSMA 2QEXI 1AKHA 4WX9A 3KP4A 3Q0WA 1J59A 3ZR8X 2EFWA 1J9IA 1BIAA 4GFBA 3ABKH 5B5EC 3PIPF 3LNQA 5D5WB 2O5RA 1FOWA 3AG3H 1LQ1A 3FM3A 3DWLE 4RAYA 3E97A 3L09A 4G6DA 2K9SA 2VLAA 4HNUA 3J7AO 1Y1WJ 3I5UA 3TQNA 1OYIA 2XDVA 4U0VA 4C3IJ 2NVXJ 1O57A 2CUJA 1LVKA 3RKYA 3DU5A 1FP2A 1IDYA 4EMSA 1WCMJ 2OF7A 1FT9A 5D4RA 3IV5A 5TJJA 2ESHA 4EJVA 2DAOA 1FY7A 1OCTC 2O8KA 3ZQGA 2MD5A 1HOMA 3OS2A 1ZHFA 1O4XA 2FE3A 3ZMDA 4IHSA 1HKSA 1H8AC 1TQMA 2XGDA 1U2WA 3KETA 3AG2H 5J8FA 1T39A 4BKXA 3MEXA 3QODA 1C0WA 4IRIA 1OPCA 5E1ZB 3GMEA 2KQRA 2XASA 3WTTC 2E5NA 5FKOA 4KMUX 2D2WA 5JHFA 2QSFX 1HSJA 4HNVA 5FKKA 2EH3A 3VYTB 1XGMA 4MLOA 3V7CA 2CV0A 3RPUD 4I2OA 2XHKA 3JRCA 5BMZA 1VQKI 5GPCA 1Z1DA 3CDLA 4BQQA 1F4KA 2W1OA 1BC8C 3MZ8A 2IBDA 4BBSJ 2XPWA 3HKZA 3DEWA 3FXMA 4D7NA 5LHGA 1W36D 2DW4A 4KA4A 2A3SA 1FPQA 4UY8I 4BEHB 2OC6A 5E3OA 1S6LA 2NXNB 1QA6A 1GDTA 1D0ZA 2JZYA 2PMZA 1W7PA 5K7ZA 4H4KC 3M3YJ 3HL2A 4ZDPA 1I27A 2JJ7A 3IL2A 2PBIA 3N97A 4F3QA 4G6TB 3MFKA 1QHHD 2Y0SN 1Y6IA 3QAHA 4UUSB 4Q4ZF 3JRBA 4E7KA 4IOAF 3GZ5A 1V55H 2FUG2 3FXUA 2ME0A 4RS8A 4G7HF 4CSWA 5B66C 1F36A 1B6AA 4EM1A 1OFCX 1JI8A 3J7AY 4XM3A 1Z7UA 2VUMJ 4PSWA 5EZGA 4QLCU 5JLWA 3A03A 5F64A 2E7XA 1GT0C 1Y1VJ 4JK1X 2IAIA 2OU2A 2QF7A 4M3BA 1H89C 3V7RA 2HVSA 2KIQA 2BHZA 3LAPA 1B8IB 5HLGA 2KKOA 3WU1B 2L7MP 4RGRA 3WG9A 4C2TA 3RIRA 2VKEA 3W2AA 1D8JA 5DCMB 4AUXA 4V2FA 4CCJA 2M8GX 4F93B 3QP6A 4DYQA 4LGWA 4UUTA 3CUQB 3CQZJ 3RKWA 3F72A 4ETSA 4AM3A 2L7FP 4UB8C 4M71A 5IP7J 3SJMA 3DU6A 1IZ1A 1CF7B 3OS0A 2RGVA 3L9FA 4BXUA 2J5PA 5HDGA 5HS9A 1K78B 1I6XA 2FA5A 4N0BA 4HQEA 1BBYA 1MZBA 2W48A 3ISPA 1R1TA 4PJ0C 3S2DJ 2EILH 3DKYA 1BN5A 2X85A 4ZTFA 1AHDP 5LFAA 1QVTA 3ZN1A 2FQ4A 2FXAA 2IP2A 2DJIA 2ZNZA 1R5GA 3BR3A 1B9NA 3GW2A 3L2CA 4C2MJ 1MMNA 2BHYA 2Y31A 2DTRA 4KN7X 1EF4A 2GBYA 5J6XA 3P5JA 1JT6A 1SC7A 5J40A 4W97A 2VC1A 2FF4A 3BJAA 1XCVA 4NDLA 4BBRJ 1I1SA 2IGOA 4EGYA 4F52A 2F4IA 1MBJA 1LUJB 3E7LA 1N78A 4M6YA 2GAUA 2V9VA 2XB5A 2PJPA 2QWWA 4L5JA 2L9NA 3OY9A 4NC6A 2HKOA 3BP8A 3RJPA 2DMQA 3JW4A 3H9JA 4IQJA 2VONA 5FRNA 4CZZA 3ELKA 2A6EF 4XRFA 5IOZA 5D6EA 2P6SA 1A6QA 1VQ5I 1ETOA 1MIJA 1R58A 2TCTA 4UNOA 4XR6A 3JRIA 1UHWA 4HZFA 2Z2SB 1SD6A 5D6FA 4ESJA 1EJ9A 4HG2A 5L3BA 3BPXA 2GIZA 5F04A 1HKQA 2HPIA 3H36A 3HHHA 1J75A 3HGGA 4HV5A 2HI3A 2DT6A 5EEHA 1EH8A 1FC3A 2Z3YA 4EV0A 5D5VB 4JYKA 1IV8A 1Z3YA 3TL4X 3CCMI 3LSPA 2E1CA 4B09A 3QWLA 4MQVA 3DBRB 2HR3A 3OYGA 1B9MA 2ZMEA 5IPAA 3E6MA 3GEZA 2K9LA 3AG4H 5HNFA 2LP0A 5H6RA 5K5RA 2QCOA 2MYSA 2PQ8A 3WGGA 4I6ZA 2EIJH 2JRTA 1PUFA 1F5TA 4CGZA 5EGOB 3H3ZA 5LHHA 4IHTA 2XRNA 1OCOH 1IN4A 3QOPA 1MJ9A 2VXDA 2XSDC 2MC4A 3EYYA 1MNDA 5E20A 1Y0UA 1RI7A 1LE8A 1IRGA 3O3KA 2LDUA 1LFUP 2OQRA 1BW5A 4W1UA 1X1CA 2WAQA 4UVCA 4DNCA 2GXAA 3MD2A 5JVGF 3IH3A 3RZOJ 1P6RA 1IN6A 3FISA 4CA0A 2HQRA 1T95A 4UVBA 2MC3A 1FBQA 2VBXA 2EIMH 3KZIC 4L9TA 1MBGA 2QSGX 1IDZA 2GQQA 1FSEA 5FB2A 3NWSA 4BH9A 4XKBA 3M4OJ 3A0HC 3RZDJ 2D1HA 1SD5A 2DI3A 1WKMA 1IN8A 3MVPA 1G3TA 1HLVA 3BZ6A 2ZNYA 4OIOF 2X0LA 4DBQA 4NC8A 2QM3A 2NOGA 2VJJA 3DCFA 3BWGA 2VBYA 2IGMA 2O8XA 2CS3A 1PP8F 4ENJA 1MDMB 3Q0VA 1X4OA 2V26A 4XK4A 4ZYDA 4NQWA 3A01B 2JUCA 2H09A 5IT9K 2AQEA 4BDYA 3TOAA 3F6VA 1UELB 2LLKA 2P7VB 5BOXA 4WXDA 3I0TA 3AKZA 2HXOA 1ZGWA 2BY3A 1P4XA 3FZVA 3PQJA 1MBHA 1UZCA 2K3FA 2XGXA 5F6FA 1G8XA 3S8PA 5AONA 3TDUC 4ESFA 1Z6TA 2R7TA 4KITB 2W00A 1F1ZA 2I10A 4AD9A 4BYYA 1SFOJ 1SMTA 2QKLB 3OL4A 2QA4I 1S72I 3L2QA 1LDJA 1U6GA 2P5LC 1SEUA 4ANJA 3OYCA 4YEJA 1FBUA 2CQKA 4CH7A 3HOTA 2W7NA 1CGPA 3VODA 4XIDA 2CJJA 2F5CA 1NH3A 3WE3A 1U9NA 3BZKA 4NUBA 5F1JA 2LR8A 3GFJA 2XAQA 3K4CA 4IX7A 5GAEJ 2VQLA 4CDGA 1QHGA 2R3SA 1MMAA 2M7AA 4I98B 4G94A 4KFCA 3DFGA 2JSPA 1D0XA 1ZTRA 2TDXA 3E1SA 1G6NA 4AU7A 4HNTA 2EV0A 2ACJA 2IS4A 1ETYA 4HV6A 2ZC2A 3U9GA 2CU7A 3K4JA 4XLEA 2Q8KA 1ZG5A 3GBGA 3HM5A 2HZDA 4GYIA 5J1UA 5TISC 3WU0A 3KP6A 3HIFA 5L3GA 4ITVA 5F27A 3IWFA 2L02A 2K7LA 3AL0C 3CZ6A 1WQ2A 2OTLI 3CMEI 2R5YA 2XUBA 2CMPA 3S32A 3FXQA 3MKYB 2IJLA 3F8NA 1MJAA 3ERED 4LLNA 4JX4A 2DU9A 3WU2C 5DM6F 1MNMC 4IHXA 5KAIC 1NK3P 4I01A 3KPHA 2B9SA 3ROUA 5EF6A 2AO9A 5CYVA 1ZQ3P 3HUGA 4MFEA 3D5RC 1ENHA 5CJ9A 1FOYA 2F5VA 2VBZA 2IA0A 3QU3A 2K3PA 1KYZA 2HVRA 1DP7P 3GCMA 1BIBA 3QYBA 4Y13A 3SEZA 2Y75A 1V54H 4BE2A 3S2WA 2WV0A 3S15J 1TT5B 2HU9A 1M1EB 3BG3A 3AG1H 1RKWA 2UV1A 1VQPI 1APLC 4AYBN 3K1PA 4BNCA 1USSA 4KICA 2FOKA 2DFHA 1LKXA 2NOJB 4RGXA 3D5LA 3DPTA 2P0WA 1TW3A 4R8HA 5B3SH 3GTLJ 2LMDA 2LF7A 2Q2EA 2WV1A 1DDNA 1UHSA 5DUIA 1IW7F 2YPRA 2DMNA 1VF9A 3EQLF 3RPQA 3JRHA 2JPCA 1GVJA 1P9QC 4XNFA 4PJMA 1A5JA 3NARA 2IA1A 4XLHA 2OJED 3GTGJ 4DQ2A 3OR2C 2JN6A 3WTSC 4RA2A 1DU6A 5EJCA 5CQGA 2NVYJ 2BXZA 2Y48A 4GCVA 4YIIA 6PAXA 3NQOA 5M5YJ 1FNNA 3BDDA 1BI2A 3IAS2 3ZMSA 2V7FA 5LHIA 1TT0A 2RNGA 3LA7A 3BLYA 2NVTJ 2PJRB 1U78A 1ZG1A 2R92J 2ZSHB 4UV8A 2VJ4A 2P6TA 5L3FA 1T0FC 2DT5A 4KYWA 1U0JA 1HBXG 4BJ6C 4NHJA 2D5VA 1P2FA 4UB6C 4XRSG 4M9SA 2IGKA 3PIOF 2VQCA 1JGSA 1BL0A 1Z9CA 1MGTA 5JFRA 1JT0A 1X4PA 1BR4A 2DK5A 2EJRA 3QQAA 2ZXWH 1LVAA 1XC5A 2Y0MA 2OZ6A 3IH4A 3GUDA 2P5KA 3GLXA 2DO7A 4DGWB 3AFHA 5DD8A 2WY8Q 1REPC 3HOUJ 3C3WA 2X4HA 1V4RA 3P9IA 1H9TA 2LNBA 4A6DA 3DEEA 4FX0A 2EFQA 4IHWA 1J09A 1O7FA 2P5VA 4BJ5C 1B4AA 1XN7A 1Y39A 1BI0A 3KLOA 2XF7A 1ZELA 4LIUA 4BEHA 3IAM2 5M5WJ 4B8XA 3RCOA 2WA0A 3Q5FA 4A69C 2V79A 5J1RA 4ENKA 3CJNA 3C1DA 2WTEA 3ZQIA 2HXIA 5TGTA 2NS7A 1YFHA 1S7EA 5ICGA 1R6RA 1W5SA 4UUSA 1WI9A 2DA3A 5DTDA 4EEFG 1YTYA 2PMHA 2PFBA 5F0CA 1SFXA 3ZMTA 1QU3A 1I39A 2H94A 2R93J 1TWCJ 1A04A 3HPGA 3M8EA 3WODF 5E17F 3KE2A 1KGSA 1KQ8A 4CCOA 1J2XA 3LA3A 1LNWA 3RDIA 1YW8A 3HXLA 2LY9A 1B8IA 4EJTA 2X6OA 4XLAA 2CFOA 2QQ8A 2D1VA 4EJOA 5HVQC 3J7YJ 5DCMA 4ASNA 2WB1N 1TTYA 1RZ4A 1Y8RB 3T0YA 1MJBA 3CUQA 2QGUA 4PSXA 3SZPA 3M8JA 2ETHA 2VT2A 1JGGA 1S9HA 1ETWA 1SAUA 3ONQA 1CF7A 3RYPA 3F6OA 2LVSA 3CCYA 3G1OA 4B44A 4E7JA 3X2QH 4Y52J 5LGNA 1U5TC 3TOBA 2RC4A 1STZA 1K78A 4CXFA 3OR1C 4B48A 3GTKJ 3L2WA 2RVCA 1XDUA 2UXXA 3DLAA 4M9XA 4XN0A 2DTZA 1TQPA 3FMSA 3T5XA 4Y7NJ 4CCMA 3LOCA 4RM3A 1ON2A 4EVIA 1B59A 2M4KA 2PN6A 3GWZA 4XL9A 4KNYA 3ZRGA 4XSZF 2EBIA 3GFIA 1FTZA 4XLCA 3OYEA 3OSGA 1D8KA 2HGCA 1SD7A 2ZXHA 2ZMEC 1DPRA 2VJ5A 2WC2A 3EUHC 3VB2A 2ZJQF 4AIHA 2QENA 3TBIA 4A3EJ 3GTPJ 4FISA 2FEZA 4FE7A 1BR2A 4P5OA 1FIPA 4QWQA 1HDPA 1E17A 5CPRB 3CLOA 2EA2A 3K69A 4IPAA 4CUGA 3DTEA 5DDGA 1R22A 5LLQA 1BR1A 1E3HA 1WH7A 1UG2A 3QYFA 2MW8A 1S29A 3LMMA 2L9SA 4CCLA 3S1QJ 1KA8A 4F55A 1QRYA 1TWAJ 1TP4A 3K1MA 5CVVA 2XKPA 4ZH4F 3I71A 2L01A 4S0HB 3K7AJ 4V19K 3S16J 2RDPA 2KFDA 4XLNF 3LAJA 5CVIA 4C9YA 4IO9F 3BG7A 1ZGAA 1ORKA 3CCSI 3FK7A 5H2FC 2WY7Q 1UB9A 4XLFA 4U0WA 1ZH5A 1DQUA 3K4LA 3LQRA 3E5XA 1YO5C 3CO6C 1BI3A 2EA4A 4RB0A 3RTRA 1LB2A 3F3XA 3OYAA 3HPHA 3CMAI 4V2GA 3GXOA 4A5NA 2HDWA 3JRGA 5FROA 4RLFA 2GM4A 2AXTC 2XAFA 5FLMJ 4IF4A 2ZFUA 3ABMH 4D5FA 4XSXF 1VQMI 3T1BA 1MNEA 4MQ9F 2GXGA 3F22A 2CUZA 1I1GA 2W4SA 5EGOA 5GADJ 1G3WA 5GTHC 1R7JA 4ZZDA 1AWCA 2HS5A 2O3FA 4PJNA 1YW7A 2DA1A 2Y30A 3OSFA 4IQ4A 2XF5A 4A6EA 5HS8A 1IUFA 1QZZA 4Y17A 2D45A 1R23A 3J7ZI 3VSLA 1YYVA 1JUMA 2OAZA 3FIWA 2Y9ZA 2XF6A 2O03A 4E7SA 1ETXA 1SVOA 2F2EA 3IP4B 1T8IA 3RPUA 1SAXA 2BGCA 2DN0A 4NBQA 2HOEA 3S3OA 2E7WA 2H6BA 1HF0A 3OS1A 3KZZA 3PFYA 3DKXA 1RRJA 2P8TA 3ZQHA 2NAZA 3RYRA 4ZZLA 3V7SA 2N8GA 5HLIA 5IY5H 1JHFA 1YJWI 5FKLA 3T8RA 2W57A 3CTAA 5FJ8J 1HC8A 2BVLA 1D5YA 1F43A 2XROA 1NK2P 2KRFA 2ZO4A 2MFZA 2VN2A 4MEXF 3F8MA 3R61A 1PP7U 1MDMA 2IS6A 1E0EA 1RETA 1U8RA 4NNJA 1ZK8A 2JT1A 3GTJJ 1LDDA 3A01A 4GYGA 1I6HJ 5KK1A 4BL0B 4CYDA 1R4MB 2KP6A 4L9VA 2W84A 1QVUA 5DM7F 2B7EA 2BOLA 1BW6A 2E1OA 5CVRA 1K61A 1IRZA 2R4GA 2V1DA 1S7AA 1TZLA 2B0LA 2HZTA 5B1BH 5DD4A 4CYCB 3PUBA 3GZNB 1YOVB 3PJRA 3QOEA 5GP9A 1W1WE 4U0YA 3FXRA 2F6CA 3GYHX 4ZDOA 1JJ6C 2HTJA 2YU3A 5IYCJ 1ERDA 5LEKA 3S93A 2EV6A 2X6YA 2E1MC 4MTEA 1TQIA 5EG0B 3BTLA 2H1KA 2K85A 2RNJA 2OCCH 5ICEA 1B72B 1D5VA 2QQAA 2TRTA 3TW7A 1JXSA 2HDCA 4IZZA 4PCQA 3HRTA 1FP1D 4A3JJ 1Z21A 2FMYA 1P7JA 1V5GA 1FSHA 3S1RJ 4KIBA 4PGHA 2LBFB 3BROA 1TBXA 1N75A 3WE2A 2DMTA 4MO7A 1MBFA 3H5RA 4X6AJ 5GAHJ 4B3XA 3EYIA 2A6TA 4EM2A 2ADUA 2ZXJA 4DIQA 3OWTA 4HPQA 2Y9YA 3I4MJ 2DJNA 1MSEC 2K40A 2PEXA 3SFZA 3AL0B 3V4GA 1QO0D 5K5OA 2LSOA 1G2HA 1I3AA 2L7KA 1KQ0A 2BE5F 2VQHA 5IT3A 4I7HA 2VL8A 1LPQA 1FOKA 4C3HJ 3JR9A 2CUFA 5LRRA 3BJOA 1IAWA 1KU2A 4AWXB 5FFXA 1IV6A 1Y56A 4LLGF 4E7HA 1K79A 2CW0F 3IWZA 2CSOA 4BS9A 1XSXA 3V42A 3F8FA 5E1WA 2FQ3A 5BQTA 2H27A 2NNNA 3OOPA 3OIOA 4OIRF 4RGUA 3VFZA 1OISA 4LK0F 2DMUA 2FJ1A 3PNYA 2O7OA 1IXSB 1X1BA 2QLZA 3GLLA 2E36A 2IA2A 5H20A 2KDOA 4HAMA 1FMWA 2LTPA 3QRFF 3OV8A 3SQNA 2EK5A 3SZGA 5J47A 4M3FA 1ZYRF 2KZVA 5F08A 2R7ZJ 1X3ZB 5JHUA 2HWVA 1U8BA 2BY1A 4FHTA 3KEOA 4ZTJA 2YU9J 3HKZN 1WJCA 3K2ZA 2BZTA 2IT0A 3HB9A 3JSOA 3KP7A 1FTTA 2ICWG 3GTQJ 4XICA 2YX4A 4I0BA 2GOXB 5J1YA 3VDXA 2WAFA 1N25A 4M74A 1LFPA 1UHMA 3UR3C 1J7KA 2W24A 4G9YA 2A07F 4RAFA 4EM0B 2X1DA 3TEDA 4UUVA 1Z3XA 1YX3A 5KNLA 1QPIA 2V1UA 3K2AA 2M9HA 3I4NJ 1XMXA 3RKXA 1T08B 1BJAA 1MBKA 1SFKA 5BPDA 3BTCA 3WTYC 4M6VA 2E2IJ 3MWMA 2ISZA 3HRSA 4NB5A 1FWZA 3KEQA 4FT8A 3CJRB 4D9JA 2RQPA 3G1MA 2XB0X 1MSFC 2ELKA 2ZXIA 2RN7A 4EQQA 3FKIJ 2Y69H 2GLOA 1FIAA 2DA4A 4Q47A 3BQZA 3TO6A 4A0ZA 2XPVA 3H5NA 3DBHB 3IRRA 2QVOA 2DOEA 4QIWN 1Z05A 1R5HA 3M7GA 4BGDA 3CP8A 1LDKB 4HSTA 4XONA 4UHTA 3AAFA 4U7BA 1JHHA 2F5FA 2V9KA 3G1LA 2PJRA 2HOSA 4C3JJ 3CO7C 2OUMA 1HA8A 5L3DA 4A3MJ 2CQ7A 1OLTA 1KYWA 4MNUA 3FXJA 1O3QA 3WGIA 4L18B 1HSTA 3LSHA 3PQKA 2YUSA 3ZQCA 1A31A 1NG6A 3G2BA 3CMYA 1SVLA 2R7FA 4BHPA 5D8KB 1PDNC 1Z77A 1D0YA 3L2RA 2AHQA 1EV7A 4KIGA 1VFCA 4LK1F 4HX4A 3I55I 1XB4A 4AVZA 2JSCA 1YIJI 3M8FA 4B47A 1I5ZA 3Q3SA 1XGNA 2Y2ZA 4HDUA 2W82A 4P55A 3LSGA 1SANA 2EIKH 4IXAA 4E7IA 2XPUA 5GTIC 2K02A 2Z9OA 4WF2A 5FLXZ 1BM9A 2LFBA 5K5QA 1BOAA 1JKQC 2JMWA 3HSRA 2EFNA 2KMUA 5CKTA 5K7HA 5ILVA 4RAZA 3R0AA 2EZKA 2MBFA 2EFOA 2ID3A 1ZG3A 3HSEA 4PFOA 3CESA 2A5YB 4N4OB 3IC7A 2EPFA 2I8DA 3D5SC 4J00A 1R49A 3B73A 2JRMA 3EUAA 1FYMA 2KZGA 3FXKA 4J19A 4KISA 2V6EA 1FMVA 1WRJA 4XN3A 2G7HA 2XAGA 2DODA 3PNVA 4A3FJ 5E18F 4IJAA 4M3EA 2UXNA 1QZYA 2EZHA 2OCEA 5BS6A 3OYMA 3JSPA 1BC7C 3OIQA 3CCUI 1WVRA 1RC9A 2JVHA 4PGGA 1O3TA 4BY1J 1W5CC 4IKFA 3C2BA 1S3JA 3DPLC 3KFWX 4OMZA 3ZQ7A 3MAJA 3OYJA 1XX5A 3L7WA 4OINF 1G3SA 1UJ8A 4KT5C 2R7DA 1J0RA 2WWYA 3CCQI 4QPOA 4RB2C 1VQ7I 4BXXJ 4HW0A 1S7OA 2P81A 3DP7A 4A0YA 1F9NA 3MZHA 1FZPB 1U5TB 1MW7A 4D7MA 1XMAA 1E2XA 3EUKL 3O8HA 5ICFA 5B1AH 1A36A 1ON1A 4L0ZB 2AXLA 3EDPA 1OQYA 3SXYA 2L4AA 4DYRA 3Q0UA 4BQNA 1YE9A 3JCUC 5FD5A 3HSFA 2M34A 3L2VA 3FMRA 3S3NA 1OJLA 1RNLA 5FKNA 4MHGA 2WAQN 4JOMA
chains in the Genus database with same CATH topology
3E6BA 2FMLA 4G7ZF 1AOYA 4HQMA 4LLLA 3F21A 2P4WA 1OKRA 3I64A 3KP3A 1EH7A 4AIJA 4O3MA 4WXHA 4KDPA 3F8CA 4R79A 3DF8A 3ULQB 4CHUA 3V8KA 5D8LB 3K0LA 2CG4A 4OIPF 1W5TA 3P7NA 1P4WA 2IPQX 2K4JA 2JPBA 2YSRA 5LBQA 2VE9A 4P9UA 4MGRA 2O6GE 1KU7A 3ABUA 1IN7A 2VC0A 3WTXC 1G4DA 4L0YB 3FX3A 4G7OF 4BHCA 2C6YA 3ZMUA 2M5WA 2BV6A 2V1XA 4PDKA 2HTSA 2M8EA 3BJ6A 2OA4A 3REOA 2FBKA 5K1YA 1QNTA 4YG2F 5KVRA 5HS7A 2P7CB 1ZREA 3Q9SA 3GF2A 2UZKA 4G8XA 1NHAA 2NYXA 2DQRA 3L00A 1J5YA 3H3UA 4OMYA 2Z33A 1XMKA 1T6SA 2HFHA 3RI4A 3TO9A 3LSTA 3J80Z 4MEYF 2VODA 2CO5A 2BEOA 1K7AA 4WK8F 4OOIA 2O61A 4IRGA 1YIOA 3R0JA 4LMYA 4ZYGA 5J8CA 4O6JA 3B02A 1WSUA 1LEBA 1RUNA 1XGOA 4A0XA 2VOPA 4P96A 3G73A 2XV4S 4XBFA 2H6CA 5L3CA 3FHZA 1RUOA 4PZJA 3I54A 2HQNA 3Q9VA 1TNTA 3GVAA 2L54A 2MLGA 1ZLJA 1HXDA 3ZN0A 3NEUA 1Z91A 1OMIA 2STTA 2XIGA 3NRVA 3WTVC 3U2RA 3HYIA 1O3RA 3E6CC 4Y15A 1HQCA 2IVMA 5H6QA 2QZ8A 3P9CA 1WWXA 1FBSA 2A61A 3W6KB 1VTNC 4LB5A 1S8NA 2VBWA 4UVAA 2NNYA 4KUMA 3VOEA 1YS7A 2G9WA 5D5XB 2EV5A 1HW5A 1ZRCA 1IN5A 3JAMZ 1XD7A 2Q0OA 1ZLKA 1UFMA 2LF8A 4WCGA 3FWEA 1T98A 1YLFA 5JI6A 5F1RA 3BPVA 5FLXK 3C18A 2LKPA 4EJWA 3TGNA 3FM5A 4BHBA 1LEAA 4LFUA 2XKOA 3H92A 2UWMA 3DXJF 3R6SA 1BI1A 5ILSA 1ZAOA 5FO5A 5HDNA 1W7PD 2XVCA 5DV5A 3O2PE 1SMYF 3P9KA 1ULYA 5DCFA 5DUKA 1JE8A 1R1VA 5TRDA 1ZRFA 2FBIA 2CGPA 4ON0A 3IKTA 3I59B 3LWFA 2G7UA 3IRQA 2GIVA 2W25A 4BQAA 4LG0A 5AIPA 5ED4A 2VXZA 1U3EM 4R1HA 4A5MA 3HRUA 2QBYB 2FU4A 1T0FA 1XSDA 4KMFA 1TNSA 5LRSA 4HYEA 1L0OC 4OU0A 1D3YA 3V8JA 4CO8A 1O7LA 1KQ9A 1FYKA 3HRMA 3LQQA 1QPMA 1ZRDA 3U1DA 3F8BA 1USTA 2MH9A 2GWRA 1OR7A 4A2UA 2V6CA 2RV8A 2DK8A 2FNPA 4Q48A 2DLLA 3ZP5A 2BYVE 1FX7A 2IRFG 4L9NA 2GXBA 4AVPA 3MZYA 2XAHA 1R1UA 1IXRC 2AS5F 1ZGJA 4LJZF 4M9ZA 4A12A 4I02A 4HLYA 2EFPA 4HF2A 2ZBKA 5HLHA 2ZJ2A 3QPHA 4EGZA 4KN4X 4I0AA 2OZUA 3LA2A 3VEPA 3MQ0A 4WWCA 1YW9A 1ONVA 4M6XA 3HTUA 2MLKA 2M45A 2F5EA 3GX4X 2A6HF 2K86A 3KZYA 3I53A 4XLPF 4HF0A 4BAYA 1YG2A 3PFIA 4ENNA 5A2QZ 4Z2YA 4HX8A 3WTZA 5BPIA 4HF1A 2ZCWA 3FMQA 1YS6A 2CFXA 4TV7A 4P9FA 4HLXA 1U5TA 5FD6A 1XCBA 4FX4A 3HHGA 5ILUA 3EETA 1P92A 1K6OA 3J80K 1YQAA 3ABTA 3LFKA 2QUFA 2VE8A 3CDHA 4GXOA 3EUHA 1GXQA 3SZTA 2K27A 5E8GA 2W85A 5HOOA 4M72A 2OQGA 3IHUA 1FLIA 4RGSA 2JTVA 4U7DA 1IF1A 1W7PB 4F7ZA 4LG0B 3WGHA 3ZMZA 2MH2A 2FSWA 3ECOA 2KIUA 4GO1A 3DKWA 2DQLA 1RIOH 2ESNA 3R4KA 2BBYA 2GA1A 3J81Z 3JTHA 2J5OA 5E8IA 1R00A 2KJBA 3ML6A 2DBBA 1IUYA 3DQVC 3R60A 2DFIA 2HYFA 1GHCA 3KCCA 2E1NA 2KJCA 5LGUA 3E3VA 3DEUA 4RB3C 3DV8A 5ICCA 4YIFA 5LEJA 4N9HA 2HEOA 2VOOA 3CUQC 4Q5SF 2GA2A 1LJ9A 3ECHA 1HW2A 5D4SA 4L9JA 3JAMK 1V3FA 2L4MA 1TLHB 3CUOA 1XGSA 1GXPA 3SHFA 2K4BA 1IXCA 2FBHA 4ESBA 1SD4A 1EH6A 2QQ9A 1HKTA 5JR3A 3M1EA 3KP5A 5CVUA 5ERIA 1XSVA 1Z6RA 3E5UA 1X3UA 1T38A 4KIFA 3MCZA 4LB6B 4HOBA 3G3ZA 3GFMA 4JQFA 1QGPA 3BY6A 4ZYHA 2PLYA 2CYYA 5LGTA 3GO5A 2O0YA 2VT3A 1KU9A 3BOQA 3IKVA 2OD5A 3JTGA 2RKHA 3QU6A 2PG4A 1OYWA 1P4AA 1ODDA 5D5UB 2NS0A 2A68F 3KP2A 1PUEE 3I4PA 1Q1HA 4E70A 1B1BA 4U88A 4RB1A 2ISYA 4HDVA 4H0EA 2FNAA 2FRHA 2STWA 3GFLA 1KU3A 3TO7A 3GZ6A 2ZMEB 1QBJA 4N9IA 3D0SA 2IW5A 1H9GA 3E6DA 4IRHA 4UXNA 3W6JB 4K2EA 2M1BA 1ZN2A 2HYGD 2YR2A 2ZKZA 5E1XA 3HOSA 5CVJA 2HKXA 1ZARA 2GZWA 4MTDA 1MKMA 4EJUA 3C7JA 3ZMVA 1SFUA 2QYOA 4UV9A 3HTSB 2COMA 1R36A 3COAC 2MA3A 3TDZC 2F5DA 5DYMA 5DEQA 2M87A 2PI0A 1IRFA 4WXCA 3O6BB 2QQBA 2M30A 1G3YA 2ZFWA 4GGGA 1O3SA 4ZYEA 1TW2A 2EB7A 1DUXC 5FGMA 1FYLA 3M9AA 1W4MA 3K1NA 3V8LA 3T8TA 5CLSA 5JVTA 4IVNA 1SFEA 3ZPLA 2OBPA 2Z5UA 1MD0A 4AIKA 3QPTA 4M73A 4YFXF 2DPUA 2PMUA 5A2QK 4G6QA 3I59A 3WTUC 3KLNA 2CWEA 2ELHA 3K9TA 4ENMA 2QBYA 4HA8A 3E5QA 4YFNF 1QQIA 1T2KA 4S05A 2EWNA 3QP5A 4I09A 3TKYA 1OYYA 1XDSA 2A69F 4JBAA 4OIQF 2DPDA 1DPUA 5AIQA 2XAJA 3N4MA 1UCRA 4L5IA 5FFZA 2KIFA 1L3LA 4CICA 3I58A 4HBLA 2YX7A 2Z99A 5EEGA 2NRAC 1HW1A 4YFKF 3WTWC 3FF5A 5HDKA 4LD5A 2KIMA 4D0PA 4S04A 4HX7A 3J81K 5IT9Z 3F23A 1H0MA 4O5VA 5L3EA 2L3DA 4WX9A 3KP4A 1J59A 2EFWA 1J9IA 1BIAA 5D5WB 1LQ1A 3FM3A 4RAYA 3E97A 3L09A 4G6DA 3J7AO 3I5UA 3TQNA 1OYIA 4U0VA 1O57A 3RKYA 1FP2A 4EMSA 1FT9A 5D4RA 5TJJA 2ESHA 4EJVA 2DAOA 1FY7A 2MD5A 1ZHFA 2FE3A 3ZMDA 4IHSA 1HKSA 1TQMA 1U2WA 3KETA 5J8FA 1T39A 1C0WA 3MEXA 4IRIA 1OPCA 5E1ZB 3WTTC 2XASA 4KMUX 2D2WA 1HSJA 1XGMA 3V7CA 4I2OA 2XHKA 5BMZA 1Z1DA 1F4KA 1BC8C 5LHGA 2DW4A 4KA4A 2A3SA 1FPQA 1S6LA 2JZYA 1W7PA 1I27A 3IL2A 2PBIA 3N97A 3MFKA 3QAHA 4Q4ZF 3GZ5A 4RS8A 3FXUA 4G7HF 1B6AA 4EM1A 1Z7UA 4QLCU 5F64A 2E7XA 4JK1X 2OU2A 3V7RA 3LAPA 5HLGA 2KKOA 3WU1B 4RGRA 3WG9A 3RIRA 1D8JA 5DCMB 3QP6A 4LGWA 3CUQB 3RKWA 4ETSA 3F72A 4M71A 1IZ1A 1CF7B 2RGVA 3L9FA 4BXUA 2J5PA 5HDGA 5HS9A 1K78B 1I6XA 2FA5A 4N0BA 4HQEA 1BBYA 1MZBA 3ISPA 1R1TA 1BN5A 3ZN1A 2IP2A 2FXAA 3GW2A 2ZNZA 3L2CA 1R5GA 1B9NA 4KN7X 2DTRA 5J6XA 2VC1A 2FF4A 3BJAA 1XCVA 1I1SA 4EGYA 4M6YA 2GAUA 2V9VA 2PJPA 2QWWA 4L5JA 2HKOA 3BP8A 3RJPA 3JW4A 2VONA 4CZZA 3ELKA 2A6EF 4XRFA 5D6EA 2P6SA 1R58A 4UNOA 1UHWA 4HZFA 4ESJA 1SD6A 5D6FA 5L3BA 3BPXA 1HKQA 3HHHA 1J75A 4HV5A 5EEHA 1EH8A 1FC3A 2Z3YA 4EV0A 5D5VB 2E1CA 4B09A 4MQVA 2HR3A 1B9MA 2ZMEA 3E6MA 3GEZA 5H6RA 5K5RA 2PQ8A 3WGGA 2JRTA 1F5TA 4CGZA 3H3ZA 5LHHA 4IHTA 2XRNA 1IN4A 3QOPA 1MJ9A 3EYYA 5E20A 1Y0UA 1RI7A 1IRGA 3O3KA 2LDUA 2OQRA 4UVCA 4DNCA 1P6RA 1IN6A 2HQRA 4UVBA 2MC3A 1FBQA 2VBXA 4L9TA 2GQQA 1FSEA 5FB2A 4BH9A 2D1HA 1SD5A 2DI3A 1WKMA 1IN8A 1G3TA 3BZ6A 2ZNYA 4OIOF 2X0LA 2QM3A 3BWGA 2VBYA 2O8XA 1PP8F 4ENJA 1MDMB 4ZYDA 4NQWA 2H09A 5IT9K 3TOAA 3F6VA 2P7VB 5BOXA 4WXDA 3I0TA 1P4XA 3FZVA 3PQJA 2XGXA 3TDUC 5F6FA 5AONA 4ESFA 1Z6TA 1F1ZA 4BYYA 4AD9A 1SMTA 1LDJA 1U6GA 2P5LC 1FBUA 2CQKA 3HOTA 1CGPA 3VODA 2F5CA 3WE3A 3GFJA 2XAQA 4CDGA 2R3SA 4I98B 4G94A 4KFCA 3DFGA 2TDXA 1G6NA 2EV0A 2ACJA 4HV6A 3U9GA 2Q8KA 1ZG5A 4GYIA 3WU0A 3KP6A 3HIFA 5L3GA 3IWFA 2L02A 2K7LA 1WQ2A 2XUBA 3FXQA 2IJLA 3F8NA 1MJAA 3ERED 4LLNA 2DU9A 4I01A 3ROUA 5CYVA 3HUGA 5CJ9A 2VBZA 2IA0A 3QU3A 1KYZA 1DP7P 1BIBA 4Y13A 2Y75A 3S2WA 2WV0A 3K1PA 4BNCA 1USSA 4KICA 2FOKA 4RGXA 3D5LA 3DPTA 1TW3A 4R8HA 2LF7A 2Q2EA 1DDNA 5DUIA 1IW7F 2YPRA 3EQLF 3RPQA 2JPCA 1GVJA 2IA1A 4DQ2A 3WTSC 2Y48A 4GCVA 4YIIA 6PAXA 3NQOA 1FNNA 3BDDA 1BI2A 3ZMSA 5LHIA 3LA7A 1U78A 1ZG1A 4UV8A 2P6TA 5L3FA 2DT5A 4KYWA 1HBXG 4NHJA 1P2FA 4M9SA 1JGSA 1Z9CA 1MGTA 5JFRA 2DK5A 2EJRA 1LVAA 2Y0MA 2OZ6A 3GUDA 2P5KA 3GLXA 2DO7A 5DD8A 1REPC 3C3WA 2X4HA 1V4RA 3P9IA 1H9TA 2LNBA 4A6DA 4FX0A 2EFQA 1O7FA 2P5VA 1B4AA 1XN7A 1BI0A 3KLOA 4B8XA 3Q5FA 2V79A 4ENKA 3CJNA 3C1DA 2WTEA 1YFHA 5ICGA 1W5SA 1WI9A 1YTYA 2PMHA 2PFBA 1SFXA 3ZMTA 2H94A 1A04A 3M8EA 3WODF 5E17F 3KE2A 1KGSA 1KQ8A 1J2XA 3LA3A 1LNWA 3RDIA 1YW8A 4EJTA 2D1VA 4EJOA 5HVQC 5DCMA 4ASNA 1TTYA 1RZ4A 3T0YA 1MJBA 3CUQA 3SZPA 2ETHA 2VT2A 1CF7A 3RYPA 3F6OA 5LGNA 1U5TC 3TOBA 2RC4A 1STZA 1K78A 4CXFA 2RVCA 1XDUA 2UXXA 4M9XA 1TQPA 3FMSA 3T5XA 1ON2A 4EVIA 1B59A 2PN6A 3GWZA 4KNYA 4XSZF 3GFIA 1D8KA 2HGCA 1SD7A 1DPRA 2WC2A 3VB2A 4AIHA 2QENA 2FEZA 4P5OA 4QWQA 1E17A 3CLOA 2EA2A 3K69A 4IPAA 5DDGA 1R22A 5LLQA 1S29A 1KA8A 3K1MA 5CVVA 2XKPA 4ZH4F 3I71A 2L01A 2RDPA 4XLNF 3LAJA 5CVIA 1ZGAA 1UB9A 4U0WA 1ZH5A 3LQRA 3E5XA 1YO5C 3CO6C 1BI3A 2EA4A 4RB0A 3RTRA 1LB2A 3F3XA 3GXOA 4A5NA 2XAFA 4IF4A 4XSXF 3T1BA 4MQ9F 2GXGA 3F22A 1I1GA 1G3WA 1AWCA 1R7JA 4ZZDA 2HS5A 2O3FA 1YW7A 4A6EA 5HS8A 1QZZA 4Y17A 2D45A 1R23A 1YYVA 2OAZA 2O03A 2F2EA 3RPUA 1SAXA 2BGCA 2HOEA 2E7WA 2H6BA 3KZZA 2P8TA 2NAZA 3RYRA 4ZZLA 3V7SA 5HLIA 1JHFA 3T8RA 2W57A 3CTAA 2XROA 2KRFA 2ZO4A 2VN2A 4MEXF 3F8MA 3R61A 1PP7U 1MDMA 1U8RA 2JT1A 1LDDA 4GYGA 5KK1A 4CYDA 4L9VA 2W84A 5CVRA 2V1DA 1S7AA 2B0LA 2HZTA 5DD4A 4U0YA 3FXRA 3GYHX 2HTJA 2YU3A 5LEKA 2EV6A 4MTEA 1TQIA 2RNJA 5ICEA 1D5VA 2QQAA 1JXSA 2HDCA 4PCQA 3HRTA 1FP1D 2FMYA 1FSHA 4KIBA 4PGHA 3BROA 1TBXA 3WE2A 3EYIA 4EM2A 2ADUA 2ZXJA 2PEXA 3SFZA 3V4GA 1QO0D 5K5OA 2LSOA 1KQ0A 2BE5F 5IT3A 4I7HA 1FOKA 5LRRA 3BJOA 1IAWA 1KU2A 4AWXB 5FFXA 4LLGF 1K79A 2CW0F 3IWZA 2CSOA 1XSXA 3F8FA 5E1WA 2FQ3A 5BQTA 2H27A 2NNNA 3OOPA 4OIRF 4RGUA 3VFZA 4LK0F 1IXSB 2QLZA 2IA2A 5H20A 4HAMA 3QRFF 3OV8A 3SQNA 2EK5A 1ZYRF 5JHUA 2HWVA 4FHTA 3KEOA 3K2ZA 2IT0A 3JSOA 3KP7A 2YX4A 4I0BA 4M74A 1UHMA 1J7KA 2W24A 4G9YA 2A07F 4EM0B 4UUVA 2V1UA 3RKXA 1BJAA 5BPDA 3WTYC 3MWMA 2ISZA 3HRSA 4NB5A 1FWZA 3KEQA 4FT8A 2RQPA 2RN7A 4EQQA 4Q47A 3TO6A 4A0ZA 3IRRA 2QVOA 1Z05A 1R5HA 3M7GA 3AAFA 1LDKB 4UHTA 4U7BA 1JHHA 2F5FA 3CO7C 5L3DA 1KYWA 4MNUA 1O3QA 3WGIA 4L18B 1HSTA 3PQKA 2R7FA 4BHPA 5D8KB 1PDNC 1EV7A 4KIGA 4LK1F 4HX4A 1XB4A 2JSCA 3M8FA 1I5ZA 1XGNA 4HDUA 4P55A 4IXAA 2K02A 2Z9OA 4WF2A 5FLXZ 1BM9A 5K5QA 1BOAA 3HSRA 2EFNA 5ILVA 4RAZA 3R0AA 2MBFA 2EFOA 1ZG3A 3HSEA 2A5YB 3IC7A 3B73A 1FYMA 1WRJA 2G7HA 2XAGA 5E18F 4IJAA 2UXNA 1QZYA 3JSPA 1BC7C 5BS6A 4PGGA 1O3TA 1S3JA 3DPLC 3KFWX 4OMZA 3ZQ7A 3MAJA 3L7WA 4OINF 1G3SA 4KT5C 2R7DA 1J0RA 2WWYA 4RB2C 4HW0A 1S7OA 3DP7A 4A0YA 1F9NA 3MZHA 1FZPB 1U5TB 1XMAA 1E2XA 5ICFA 1ON1A 4L0ZB 2AXLA 3EDPA 3SXYA 2L4AA 5FD5A 3HSFA 3FMRA 1RNLA 4MHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6B A;  2FML A;  4G7Z F;  1AOY A;  4HQM A;  4LLL A;  3F21 A;  2P4W A;  1OKR A;  3I64 A;  3KP3 A;  1EH7 A;  4AIJ A;  4O3M A;  4WXH A;  4KDP A;  3F8C A;  4R79 A;  3DF8 A;  3ULQ B;  4CHU A;  3V8K A;  5D8L B;  3K0L A;  2CG4 A;  4OIP F;  1W5T A;  3P7N A;  1P4W A;  2IPQ X;  2K4J A;  2JPB A;  2YSR A;  5LBQ A;  2VE9 A;  4P9U A;  4MGR A;  2O6G E;  1KU7 A;  3ABU A;  1IN7 A;  2VC0 A;  3WTX C;  1G4D A;  4L0Y B;  3FX3 A;  4G7O F;  4BHC A;  2C6Y A;  3ZMU A;  2M5W A;  2BV6 A;  2V1X A;  4PDK A;  2HTS A;  2M8E A;  3BJ6 A;  2OA4 A;  3REO A;  2FBK A;  5K1Y A;  1QNT A;  4YG2 F;  5KVR A;  5HS7 A;  2P7C B;  1ZRE A;  3Q9S A;  3GF2 A;  2UZK A;  4G8X A;  1NHA A;  2NYX A;  2DQR A;  3L00 A;  1J5Y A;  3H3U A;  4OMY A;  2Z33 A;  1XMK A;  1T6S A;  2HFH A;  3RI4 A;  3TO9 A;  3LST A;  3J80 Z;  4MEY F;  2VOD A;  2CO5 A;  2BEO A;  1K7A A;  4WK8 F;  4OOI A;  2O61 A;  4IRG A;  1YIO A;  3R0J A;  4LMY A;  4ZYG A;  5J8C A;  4O6J A;  3B02 A;  1WSU A;  1LEB A;  1RUN A;  1XGO A;  4A0X A;  2VOP A;  4P96 A;  3G73 A;  2XV4 S;  4XBF A;  2H6C A;  5L3C A;  3FHZ A;  1RUO A;  4PZJ A;  3I54 A;  2HQN A;  3Q9V A;  1TNT A;  3GVA A;  2L54 A;  2MLG A;  1ZLJ A;  1HXD A;  3ZN0 A;  3NEU A;  1Z91 A;  1OMI A;  2STT A;  2XIG A;  3NRV A;  3WTV C;  3U2R A;  3HYI A;  1O3R A;  3E6C C;  4Y15 A;  1HQC A;  2IVM A;  5H6Q A;  2QZ8 A;  3P9C A;  1WWX A;  1FBS A;  2A61 A;  3W6K B;  1VTN C;  4LB5 A;  1S8N A;  2VBW A;  4UVA A;  2NNY A;  4KUM A;  3VOE A;  1YS7 A;  2G9W A;  5D5X B;  2EV5 A;  1HW5 A;  1ZRC A;  1IN5 A;  3JAM Z;  1XD7 A;  2Q0O A;  1ZLK A;  1UFM A;  2LF8 A;  4WCG A;  3FWE A;  1T98 A;  1YLF A;  5JI6 A;  5F1R A;  3BPV A;  5FLX K;  3C18 A;  2LKP A;  4EJW A;  3TGN A;  3FM5 A;  4BHB A;  1LEA A;  4LFU A;  2XKO A;  3H92 A;  2UWM A;  3DXJ F;  3R6S A;  1BI1 A;  5ILS A;  1ZAO A;  5FO5 A;  5HDN A;  1W7P D;  2XVC A;  5DV5 A;  3O2P E;  1SMY F;  3P9K A;  1ULY A;  5DCF A;  5DUK A;  1JE8 A;  1R1V A;  5TRD A;  1ZRF A;  2FBI A;  2CGP A;  4ON0 A;  3IKT A;  3I59 B;  3LWF A;  2G7U A;  3IRQ A;  2GIV A;  2W25 A;  4BQA A;  4LG0 A;  5AIP A;  5ED4 A;  2VXZ A;  1U3E M;  4R1H A;  4A5M A;  3HRU A;  2QBY B;  2FU4 A;  1T0F A;  1XSD A;  4KMF A;  1TNS A;  5LRS A;  4HYE A;  1L0O C;  4OU0 A;  1D3Y A;  3V8J A;  4CO8 A;  1O7L A;  1KQ9 A;  1FYK A;  3HRM A;  3LQQ A;  1QPM A;  1ZRD A;  3U1D A;  3F8B A;  1UST A;  2MH9 A;  2GWR A;  1OR7 A;  4A2U A;  2V6C A;  2RV8 A;  2DK8 A;  2FNP A;  4Q48 A;  2DLL A;  3ZP5 A;  2BYV E;  1FX7 A;  2IRF G;  4L9N A;  2GXB A;  4AVP A;  3MZY A;  2XAH A;  1R1U A;  1IXR C;  2AS5 F;  1ZGJ A;  4LJZ F;  4M9Z A;  4A12 A;  4I02 A;  4HLY A;  2EFP A;  4HF2 A;  2ZBK A;  5HLH A;  2ZJ2 A;  3QPH A;  4EGZ A;  4KN4 X;  4I0A A;  2OZU A;  3LA2 A;  3VEP A;  3MQ0 A;  4WWC A;  1YW9 A;  1ONV A;  4M6X A;  3HTU A;  2MLK A;  2M45 A;  2F5E A;  3GX4 X;  2A6H F;  2K86 A;  3KZY A;  3I53 A;  4XLP F;  4HF0 A;  4BAY A;  1YG2 A;  3PFI A;  4ENN A;  5A2Q Z;  4Z2Y A;  4HX8 A;  3WTZ A;  5BPI A;  4HF1 A;  2ZCW A;  3FMQ A;  1YS6 A;  2CFX A;  4TV7 A;  4P9F A;  4HLX A;  1U5T A;  5FD6 A;  1XCB A;  4FX4 A;  3HHG A;  5ILU A;  3EET A;  1P92 A;  1K6O A;  3J80 K;  1YQA A;  3ABT A;  3LFK A;  2QUF A;  2VE8 A;  3CDH A;  4GXO A;  3EUH A;  1GXQ A;  3SZT A;  2K27 A;  5E8G A;  2W85 A;  5HOO A;  4M72 A;  2OQG A;  3IHU A;  1FLI A;  4RGS A;  2JTV A;  4U7D A;  1IF1 A;  1W7P B;  4F7Z A;  4LG0 B;  3WGH A;  3ZMZ A;  2MH2 A;  2FSW A;  3ECO A;  2KIU A;  4GO1 A;  3DKW A;  2DQL A;  1RIO H;  2ESN A;  3R4K A;  2BBY A;  2GA1 A;  3J81 Z;  3JTH A;  2J5O A;  5E8I A;  1R00 A;  2KJB A;  3ML6 A;  2DBB A;  1IUY A;  3DQV C;  3R60 A;  2DFI A;  2HYF A;  1GHC A;  3KCC A;  2E1N A;  2KJC A;  5LGU A;  3E3V A;  3DEU A;  4RB3 C;  3DV8 A;  5ICC A;  4YIF A;  5LEJ A;  4N9H A;  2HEO A;  2VOO A;  3CUQ C;  4Q5S F;  2GA2 A;  1LJ9 A;  3ECH A;  1HW2 A;  5D4S A;  4L9J A;  3JAM K;  1V3F A;  2L4M A;  1TLH B;  3CUO A;  1XGS A;  1GXP A;  3SHF A;  2K4B A;  1IXC A;  2FBH A;  4ESB A;  1SD4 A;  1EH6 A;  2QQ9 A;  1HKT A;  5JR3 A;  3M1E A;  3KP5 A;  5CVU A;  5ERI A;  1XSV A;  1Z6R A;  3E5U A;  1X3U A;  1T38 A;  4KIF A;  3MCZ A;  4LB6 B;  4HOB A;  3G3Z A;  3GFM A;  4JQF A;  1QGP A;  3BY6 A;  4ZYH A;  2PLY A;  2CYY A;  5LGT A;  3GO5 A;  2O0Y A;  2VT3 A;  1KU9 A;  3BOQ A;  3IKV A;  2OD5 A;  3JTG A;  2RKH A;  3QU6 A;  2PG4 A;  1OYW A;  1P4A A;  1ODD A;  5D5U B;  2NS0 A;  2A68 F;  3KP2 A;  1PUE E;  3I4P A;  1Q1H A;  4E70 A;  1B1B A;  4U88 A;  4RB1 A;  2ISY A;  4HDV A;  4H0E A;  2FNA A;  2FRH A;  2STW A;  3GFL A;  1KU3 A;  3TO7 A;  3GZ6 A;  2ZME B;  1QBJ A;  4N9I A;  3D0S A;  2IW5 A;  1H9G A;  3E6D A;  4IRH A;  4UXN A;  3W6J B;  4K2E A;  2M1B A;  1ZN2 A;  2HYG D;  2YR2 A;  2ZKZ A;  5E1X A;  3HOS A;  5CVJ A;  2HKX A;  1ZAR A;  2GZW A;  4MTD A;  1MKM A;  4EJU A;  3C7J A;  3ZMV A;  1SFU A;  2QYO A;  4UV9 A;  3HTS B;  2COM A;  1R36 A;  3COA C;  2MA3 A;  3TDZ C;  2F5D A;  5DYM A;  5DEQ A;  2M87 A;  2PI0 A;  1IRF A;  4WXC A;  3O6B B;  2QQB A;  2M30 A;  1G3Y A;  2ZFW A;  4GGG A;  1O3S A;  4ZYE A;  1TW2 A;  2EB7 A;  1DUX C;  5FGM A;  1FYL A;  3M9A A;  1W4M A;  3K1N A;  3V8L A;  3T8T A;  5CLS A;  5JVT A;  4IVN A;  1SFE A;  3ZPL A;  2OBP A;  2Z5U A;  1MD0 A;  4AIK A;  3QPT A;  4M73 A;  4YFX F;  2DPU A;  2PMU A;  5A2Q K;  4G6Q A;  3I59 A;  3WTU C;  3KLN A;  2CWE A;  2ELH A;  3K9T A;  4ENM A;  2QBY A;  4HA8 A;  3E5Q A;  4YFN F;  1QQI A;  1T2K A;  4S05 A;  2EWN A;  3QP5 A;  4I09 A;  3TKY A;  1OYY A;  1XDS A;  2A69 F;  4JBA A;  4OIQ F;  2DPD A;  1DPU A;  5AIQ A;  2XAJ A;  3N4M A;  1UCR A;  4L5I A;  5FFZ A;  2KIF A;  1L3L A;  4CIC A;  3I58 A;  4HBL A;  2YX7 A;  2Z99 A;  5EEG A;  2NRA C;  1HW1 A;  4YFK F;  3WTW C;  3FF5 A;  5HDK A;  4LD5 A;  2KIM A;  4D0P A;  4S04 A;  4HX7 A;  3J81 K;  5IT9 Z;  3F23 A;  1H0M A;  4O5V A;  5L3E A;  2L3D A;  4WX9 A;  3KP4 A;  1J59 A;  2EFW A;  1J9I A;  1BIA A;  5D5W B;  1LQ1 A;  3FM3 A;  4RAY A;  3E97 A;  3L09 A;  4G6D A;  3J7A O;  3I5U A;  3TQN A;  1OYI A;  4U0V A;  1O57 A;  3RKY A;  1FP2 A;  4EMS A;  1FT9 A;  5D4R A;  5TJJ A;  2ESH A;  4EJV A;  2DAO A;  1FY7 A;  2MD5 A;  1ZHF A;  2FE3 A;  3ZMD A;  4IHS A;  1HKS A;  1TQM A;  1U2W A;  3KET A;  5J8F A;  1T39 A;  1C0W A;  3MEX A;  4IRI A;  1OPC A;  5E1Z B;  3WTT C;  2XAS A;  4KMU X;  2D2W A;  1HSJ A;  1XGM A;  3V7C A;  4I2O A;  2XHK A;  5BMZ A;  1Z1D A;  1F4K A;  1BC8 C;  5LHG A;  2DW4 A;  4KA4 A;  2A3S A;  1FPQ A;  1S6L A;  2JZY A;  1W7P A;  1I27 A;  3IL2 A;  2PBI A;  3N97 A;  3MFK A;  3QAH A;  4Q4Z F;  3GZ5 A;  4RS8 A;  3FXU A;  4G7H F;  1B6A A;  4EM1 A;  1Z7U A;  4QLC U;  5F64 A;  2E7X A;  4JK1 X;  2OU2 A;  3V7R A;  3LAP A;  5HLG A;  2KKO A;  3WU1 B;  4RGR A;  3WG9 A;  3RIR A;  1D8J A;  5DCM B;  3QP6 A;  4LGW A;  3CUQ B;  3RKW A;  4ETS A;  3F72 A;  4M71 A;  1IZ1 A;  1CF7 B;  2RGV A;  3L9F A;  4BXU A;  2J5P A;  5HDG A;  5HS9 A;  1K78 B;  1I6X A;  2FA5 A;  4N0B A;  4HQE A;  1BBY A;  1MZB A;  3ISP A;  1R1T A;  1BN5 A;  3ZN1 A;  2IP2 A;  2FXA A;  3GW2 A;  2ZNZ A;  3L2C A;  1R5G A;  1B9N A;  4KN7 X;  2DTR A;  5J6X A;  2VC1 A;  2FF4 A;  3BJA A;  1XCV A;  1I1S A;  4EGY A;  4M6Y A;  2GAU A;  2V9V A;  2PJP A;  2QWW A;  4L5J A;  2HKO A;  3BP8 A;  3RJP A;  3JW4 A;  2VON A;  4CZZ A;  3ELK A;  2A6E F;  4XRF A;  5D6E A;  2P6S A;  1R58 A;  4UNO A;  1UHW A;  4HZF A;  4ESJ A;  1SD6 A;  5D6F A;  5L3B A;  3BPX A;  1HKQ A;  3HHH A;  1J75 A;  4HV5 A;  5EEH A;  1EH8 A;  1FC3 A;  2Z3Y A;  4EV0 A;  5D5V B;  2E1C A;  4B09 A;  4MQV A;  2HR3 A;  1B9M A;  2ZME A;  3E6M A;  3GEZ A;  5H6R A;  5K5R A;  2PQ8 A;  3WGG A;  2JRT A;  1F5T A;  4CGZ A;  3H3Z A;  5LHH A;  4IHT A;  2XRN A;  1IN4 A;  3QOP A;  1MJ9 A;  3EYY A;  5E20 A;  1Y0U A;  1RI7 A;  1IRG A;  3O3K A;  2LDU A;  2OQR A;  4UVC A;  4DNC A;  1P6R A;  1IN6 A;  2HQR A;  4UVB A;  2MC3 A;  1FBQ A;  2VBX A;  4L9T A;  2GQQ A;  1FSE A;  5FB2 A;  4BH9 A;  2D1H A;  1SD5 A;  2DI3 A;  1WKM A;  1IN8 A;  1G3T A;  3BZ6 A;  2ZNY A;  4OIO F;  2X0L A;  2QM3 A;  3BWG A;  2VBY A;  2O8X A;  1PP8 F;  4ENJ A;  1MDM B;  4ZYD A;  4NQW A;  2H09 A;  5IT9 K;  3TOA A;  3F6V A;  2P7V B;  5BOX A;  4WXD A;  3I0T A;  1P4X A;  3FZV A;  3PQJ A;  2XGX A;  3TDU C;  5F6F A;  5AON A;  4ESF A;  1Z6T A;  1F1Z A;  4BYY A;  4AD9 A;  1SMT A;  1LDJ A;  1U6G A;  2P5L C;  1FBU A;  2CQK A;  3HOT A;  1CGP A;  3VOD A;  2F5C A;  3WE3 A;  3GFJ A;  2XAQ A;  4CDG A;  2R3S A;  4I98 B;  4G94 A;  4KFC A;  3DFG A;  2TDX A;  1G6N A;  2EV0 A;  2ACJ A;  4HV6 A;  3U9G A;  2Q8K A;  1ZG5 A;  4GYI A;  3WU0 A;  3KP6 A;  3HIF A;  5L3G A;  3IWF A;  2L02 A;  2K7L A;  1WQ2 A;  2XUB A;  3FXQ A;  2IJL A;  3F8N A;  1MJA A;  3ERE D;  4LLN A;  2DU9 A;  4I01 A;  3ROU A;  5CYV A;  3HUG A;  5CJ9 A;  2VBZ A;  2IA0 A;  3QU3 A;  1KYZ A;  1DP7 P;  1BIB A;  4Y13 A;  2Y75 A;  3S2W A;  2WV0 A;  3K1P A;  4BNC A;  1USS A;  4KIC A;  2FOK A;  4RGX A;  3D5L A;  3DPT A;  1TW3 A;  4R8H A;  2LF7 A;  2Q2E A;  1DDN A;  5DUI A;  1IW7 F;  2YPR A;  3EQL F;  3RPQ A;  2JPC A;  1GVJ A;  2IA1 A;  4DQ2 A;  3WTS C;  2Y48 A;  4GCV A;  4YII A;  6PAX A;  3NQO A;  1FNN A;  3BDD A;  1BI2 A;  3ZMS A;  5LHI A;  3LA7 A;  1U78 A;  1ZG1 A;  4UV8 A;  2P6T A;  5L3F A;  2DT5 A;  4KYW A;  1HBX G;  4NHJ A;  1P2F A;  4M9S A;  1JGS A;  1Z9C A;  1MGT A;  5JFR A;  2DK5 A;  2EJR A;  1LVA A;  2Y0M A;  2OZ6 A;  3GUD A;  2P5K A;  3GLX A;  2DO7 A;  5DD8 A;  1REP C;  3C3W A;  2X4H A;  1V4R A;  3P9I A;  1H9T A;  2LNB A;  4A6D A;  4FX0 A;  2EFQ A;  1O7F A;  2P5V A;  1B4A A;  1XN7 A;  1BI0 A;  3KLO A;  4B8X A;  3Q5F A;  2V79 A;  4ENK A;  3CJN A;  3C1D A;  2WTE A;  1YFH A;  5ICG A;  1W5S A;  1WI9 A;  1YTY A;  2PMH A;  2PFB A;  1SFX A;  3ZMT A;  2H94 A;  1A04 A;  3M8E A;  3WOD F;  5E17 F;  3KE2 A;  1KGS A;  1KQ8 A;  1J2X A;  3LA3 A;  1LNW A;  3RDI A;  1YW8 A;  4EJT A;  2D1V A;  4EJO A;  5HVQ C;  5DCM A;  4ASN A;  1TTY A;  1RZ4 A;  3T0Y A;  1MJB A;  3CUQ A;  3SZP A;  2ETH A;  2VT2 A;  1CF7 A;  3RYP A;  3F6O A;  5LGN A;  1U5T C;  3TOB A;  2RC4 A;  1STZ A;  1K78 A;  4CXF A;  2RVC A;  1XDU A;  2UXX A;  4M9X A;  1TQP A;  3FMS A;  3T5X A;  1ON2 A;  4EVI A;  1B59 A;  2PN6 A;  3GWZ A;  4KNY A;  4XSZ F;  3GFI A;  1D8K A;  2HGC A;  1SD7 A;  1DPR A;  2WC2 A;  3VB2 A;  4AIH A;  2QEN A;  2FEZ A;  4P5O A;  4QWQ A;  1E17 A;  3CLO A;  2EA2 A;  3K69 A;  4IPA A;  5DDG A;  1R22 A;  5LLQ A;  1S29 A;  1KA8 A;  3K1M A;  5CVV A;  2XKP A;  4ZH4 F;  3I71 A;  2L01 A;  2RDP A;  4XLN F;  3LAJ A;  5CVI A;  1ZGA A;  1UB9 A;  4U0W A;  1ZH5 A;  3LQR A;  3E5X A;  1YO5 C;  3CO6 C;  1BI3 A;  2EA4 A;  4RB0 A;  3RTR A;  1LB2 A;  3F3X A;  3GXO A;  4A5N A;  2XAF A;  4IF4 A;  4XSX F;  3T1B A;  4MQ9 F;  2GXG A;  3F22 A;  1I1G A;  1G3W A;  1AWC A;  1R7J A;  4ZZD A;  2HS5 A;  2O3F A;  1YW7 A;  4A6E A;  5HS8 A;  1QZZ A;  4Y17 A;  2D45 A;  1R23 A;  1YYV A;  2OAZ A;  2O03 A;  2F2E A;  3RPU A;  1SAX A;  2BGC A;  2HOE A;  2E7W A;  2H6B A;  3KZZ A;  2P8T A;  2NAZ A;  3RYR A;  4ZZL A;  3V7S A;  5HLI A;  1JHF A;  3T8R A;  2W57 A;  3CTA A;  2XRO A;  2KRF A;  2ZO4 A;  2VN2 A;  4MEX F;  3F8M A;  3R61 A;  1PP7 U;  1MDM A;  1U8R A;  2JT1 A;  1LDD A;  4GYG A;  5KK1 A;  4CYD A;  4L9V A;  2W84 A;  5CVR A;  2V1D A;  1S7A A;  2B0L A;  2HZT A;  5DD4 A;  4U0Y A;  3FXR A;  3GYH X;  2HTJ A;  2YU3 A;  5LEK A;  2EV6 A;  4MTE A;  1TQI A;  2RNJ A;  5ICE A;  1D5V A;  2QQA A;  1JXS A;  2HDC A;  4PCQ A;  3HRT A;  1FP1 D;  2FMY A;  1FSH A;  4KIB A;  4PGH A;  3BRO A;  1TBX A;  3WE2 A;  3EYI A;  4EM2 A;  2ADU A;  2ZXJ A;  2PEX A;  3SFZ A;  3V4G A;  1QO0 D;  5K5O A;  2LSO A;  1KQ0 A;  2BE5 F;  5IT3 A;  4I7H A;  1FOK A;  5LRR A;  3BJO A;  1IAW A;  1KU2 A;  4AWX B;  5FFX A;  4LLG F;  1K79 A;  2CW0 F;  3IWZ A;  2CSO A;  1XSX A;  3F8F A;  5E1W A;  2FQ3 A;  5BQT A;  2H27 A;  2NNN A;  3OOP A;  4OIR F;  4RGU A;  3VFZ A;  4LK0 F;  1IXS B;  2QLZ A;  2IA2 A;  5H20 A;  4HAM A;  3QRF F;  3OV8 A;  3SQN A;  2EK5 A;  1ZYR F;  5JHU A;  2HWV A;  4FHT A;  3KEO A;  3K2Z A;  2IT0 A;  3JSO A;  3KP7 A;  2YX4 A;  4I0B A;  4M74 A;  1UHM A;  1J7K A;  2W24 A;  4G9Y A;  2A07 F;  4EM0 B;  4UUV A;  2V1U A;  3RKX A;  1BJA A;  5BPD A;  3WTY C;  3MWM A;  2ISZ A;  3HRS A;  4NB5 A;  1FWZ A;  3KEQ A;  4FT8 A;  2RQP A;  2RN7 A;  4EQQ A;  4Q47 A;  3TO6 A;  4A0Z A;  3IRR A;  2QVO A;  1Z05 A;  1R5H A;  3M7G A;  3AAF A;  1LDK B;  4UHT A;  4U7B A;  1JHH A;  2F5F A;  3CO7 C;  5L3D A;  1KYW A;  4MNU A;  1O3Q A;  3WGI A;  4L18 B;  1HST A;  3PQK A;  2R7F A;  4BHP A;  5D8K B;  1PDN C;  1EV7 A;  4KIG A;  4LK1 F;  4HX4 A;  1XB4 A;  2JSC A;  3M8F A;  1I5Z A;  1XGN A;  4HDU A;  4P55 A;  4IXA A;  2K02 A;  2Z9O A;  4WF2 A;  5FLX Z;  1BM9 A;  5K5Q A;  1BOA A;  3HSR A;  2EFN A;  5ILV A;  4RAZ A;  3R0A A;  2MBF A;  2EFO A;  1ZG3 A;  3HSE A;  2A5Y B;  3IC7 A;  3B73 A;  1FYM A;  1WRJ A;  2G7H A;  2XAG A;  5E18 F;  4IJA A;  2UXN A;  1QZY A;  3JSP A;  1BC7 C;  5BS6 A;  4PGG A;  1O3T A;  1S3J A;  3DPL C;  3KFW X;  4OMZ A;  3ZQ7 A;  3MAJ A;  3L7W A;  4OIN F;  1G3S A;  4KT5 C;  2R7D A;  1J0R A;  2WWY A;  4RB2 C;  4HW0 A;  1S7O A;  3DP7 A;  4A0Y A;  1F9N A;  3MZH A;  1FZP B;  1U5T B;  1XMA A;  1E2X A;  5ICF A;  1ON1 A;  4L0Z B;  2AXL A;  3EDP A;  3SXY A;  2L4A A;  5FD5 A;  3HSF A;  3FMR A;  1RNL A;  4MHG A; 
#chains in the Genus database with same CATH topology
 2VKH A;  2WB1 A;  3E6B A;  2FML A;  2DA6 A;  4G7Z F;  1AOY A;  4HQM A;  4LLL A;  5HOD A;  3F21 A;  2P4W A;  4QSH A;  1OKR A;  2VIX A;  3I64 A;  3KP3 A;  2JK3 A;  1EH7 A;  4AIJ A;  3QPL A;  4O3M A;  3ZCO A;  1NG7 A;  4LG3 A;  4WXH A;  4KDP A;  3F8C A;  4R79 A;  3DF8 A;  3ULQ B;  4CHU A;  1WJE A;  4QTR A;  3CF5 F;  3V8K A;  4B3A A;  5D8L B;  3HGY A;  3K0L A;  4BU2 A;  2CG4 A;  4OIP F;  1W5T A;  3P7N A;  3OYL A;  4U87 A;  1P4W A;  2IPQ X;  2K4J A;  4M3G A;  2CQX A;  3PSF A;  4F91 B;  2JA7 J;  2JPB A;  2YSR A;  5LBQ A;  2X51 A;  5HNH A;  2VE9 A;  4P9U A;  3L2U A;  4JX5 A;  3FBI B;  3ZQL A;  3NAU A;  2CW8 A;  4MGR A;  3HOX J;  3PSI A;  2OPT A;  1VQ8 I;  1AU7 A;  4DJA A;  2O6G E;  2BXY A;  1KU7 A;  3G71 I;  1D1B A;  3G6E I;  3ABU A;  4DYC A;  1UAA A;  1LFB A;  3LSI A;  1IN7 A;  2VC0 A;  3WTX C;  1G4D A;  4L0Y B;  3FX3 A;  3OYF A;  2LY1 A;  4G7O F;  3WG7 H;  1HDD C;  1D1A A;  4BHC A;  2C6Y A;  3ZMU A;  4GDF A;  2M5W A;  4XQF A;  2BV6 A;  2V1X A;  4PDK A;  2JA6 J;  4HRI A;  2HTS A;  3S2H J;  2M8E A;  3BJ6 A;  3KEY A;  2CQN A;  2OA4 A;  3HZJ A;  3REO A;  2FBK A;  1K4T A;  5K1Y A;  4DOZ A;  1QNT A;  4YG2 F;  5KVR A;  4KJZ A;  5HS7 A;  1FEX A;  2P7C B;  2AQF A;  1ZRE A;  2DA2 A;  1VQ9 I;  3Q9S A;  2DA5 A;  4FE4 A;  3GF2 A;  2UZK A;  1X2M A;  3H9Q A;  1NHA A;  4G8X A;  1KON A;  4BJT A;  3OYB A;  3CJT B;  2NYX A;  1G59 A;  3S14 J;  3KX2 A;  3JRF A;  2DQR A;  3L00 A;  2HOA A;  1J5Y A;  1YJ9 I;  3H3U A;  3B6A A;  3MKZ A;  4OMY A;  2Z33 A;  1XMK A;  4YRV A;  4RBO A;  1T6S A;  2HFH A;  4DW6 A;  3RI4 A;  3TO9 A;  3LST A;  3J80 Z;  4MEY F;  3H5A A;  4FAS D;  2VOD A;  2R7X A;  3PNT A;  2CO5 A;  2DMP A;  2DFF A;  2BEO A;  2B63 J;  3CC4 I;  4BAC A;  1K7A A;  2IS1 A;  2LG4 A;  1FOX A;  2KPM A;  2DOA A;  3K4N A;  1T33 A;  4WK8 F;  3H0D A;  2FOW A;  4OOI A;  2O61 A;  4IRG A;  1YIO A;  2JVG A;  3R0J A;  2IXS A;  4LMY A;  4ZYG A;  5J8C A;  4O6J A;  3HOY J;  3B02 A;  1WSU A;  2MAB A;  1LEB A;  2M0C A;  4MFD A;  1RUN A;  1XGO A;  1R9T J;  2Y0S A;  3VYU B;  3ZQF A;  4A0X A;  4GRI A;  2VOP A;  3PUF A;  1TWG J;  3FKJ A;  4P96 A;  3OL3 A;  2V9P A;  3G73 A;  1E3P A;  2XV4 S;  1RES A;  4XBF A;  3OYK A;  2H6C A;  1K83 J;  5L3C A;  3FHZ A;  2L9V A;  1RUO A;  4L5E A;  1Z0X A;  3JRD A;  4EAT A;  4PZJ A;  3I54 A;  1VQL I;  2HQN A;  3BG5 A;  3Q9V A;  3I56 I;  1TNT A;  3ZXS A;  1V5E A;  3GVA A;  2M3A A;  3CF2 A;  4CYC A;  1IC8 A;  2L54 A;  4LIT A;  2MLG A;  1VZ0 A;  1ZLJ A;  1HXD A;  3ZN0 A;  4HSR A;  3NEU A;  5IP6 A;  1Z91 A;  2E2H J;  1OMI A;  2E1M B;  1VQO I;  1WJD A;  2STT A;  2KT0 A;  2XIG A;  2HQ5 A;  3NRV A;  4FET A;  5KAF C;  4LOC A;  4CCK A;  3WTV C;  5EG0 A;  3U2R A;  1MMS A;  1EKE A;  3FK6 A;  1R4N B;  3HYI A;  1B72 A;  1O3R A;  3E6C C;  3BTI A;  2BW3 B;  4Y15 A;  1HQC A;  2IVM A;  5H6Q A;  2QZ8 A;  3A0B C;  3P9C A;  3W2V A;  2LBF A;  1WWX A;  2DYS H;  2LRD A;  2R5Z B;  3MMY B;  3G4S I;  1FBS A;  2A61 A;  2WBM A;  3W6K B;  1VTN C;  4LB5 A;  4IHY A;  1S8N A;  1XG1 A;  3BCA A;  1AA7 A;  2VBW A;  4UVA A;  2NNY A;  1UMQ A;  4KUM A;  2XGE A;  4ZDL A;  2HNH A;  3FXL A;  2E71 A;  3VOE A;  1YS7 A;  2G9W A;  5D5X B;  2EV5 A;  2ELJ A;  4N4N B;  2L2O A;  5E3L A;  1HW5 A;  1VQN I;  1OCC H;  1ZRC A;  1IN5 A;  3CP2 A;  4CCN A;  3JAM Z;  3LSJ A;  2HQA A;  1XD7 A;  2Q0O A;  3SDG A;  1ZLK A;  5FLV A;  1UFM A;  2LF8 A;  4WCG A;  3FWE A;  1T98 A;  2HVQ A;  4PK4 A;  1UG0 A;  1YLF A;  2IGN A;  5M3F J;  5JI6 A;  2NS8 A;  2X6W A;  3H0G J;  5F1R A;  3CCV I;  2OTJ I;  3F0C A;  3BPV A;  5FLX K;  1R5I D;  4A3C J;  5DS9 A;  1KZH A;  2HDD A;  3C18 A;  2LKP A;  4EJW A;  5E3N A;  5HLT A;  3TGN A;  1IGN A;  5E79 C;  4QPQ A;  3DLL F;  4G12 A;  2KRH A;  1IRX A;  2M2E A;  3FM5 A;  4BHB A;  4RDU A;  5EEA A;  4OAZ A;  3ERM A;  1LEA A;  3FDY A;  2XKO A;  4LFU A;  3H92 A;  4E4H A;  2LC2 A;  2UWM A;  1X2N A;  3DXJ F;  3R6S A;  2Z1D A;  1BI1 A;  2VPR A;  2BY0 A;  5ILS A;  1ZAO A;  3C2H A;  3OYN A;  4OWR B;  5FO5 A;  5CQE A;  5HDN A;  1W7P D;  4JX6 A;  1ZR2 A;  1TC3 C;  3FHN A;  1MMG A;  4D1Q A;  4BE0 A;  2R7U A;  2XVC A;  3BZC A;  5DV5 A;  3O2P E;  1SMY F;  3P9K A;  1ULY A;  5DCF A;  5KCM A;  3ZGK A;  3HBL A;  5DUK A;  3ABL H;  1JE8 A;  4YEL A;  1R1V A;  5TRD A;  1ZRF A;  3IUO A;  2FBI A;  2CGP A;  1JKO C;  2MG4 A;  2PX9 A;  3A4C A;  2KLO A;  4ON0 A;  3PO2 J;  2DCE A;  2ZJR F;  3IKT A;  3HOV J;  3I59 B;  3LWF A;  3CC2 I;  2G7U A;  3VPR A;  3IRQ A;  2GIV A;  2W25 A;  4XOR A;  4BXF A;  3RKQ A;  4J01 A;  4BQA A;  3CCR I;  4LG0 A;  1ETK A;  5AIP A;  1ZKG A;  1A6I A;  5ED4 A;  2EIN H;  2VXZ A;  1U3E M;  4R1H A;  4A5M A;  2CQQ A;  2X1C A;  3HRU A;  4A3I J;  2WAE A;  2ECC A;  4I99 C;  2LRE A;  2FU4 A;  2QBY B;  1T0F A;  3BR6 A;  3BR0 A;  1XSD A;  1TNS A;  4KMF A;  5LRS A;  3O8G A;  2DOF A;  4HYE A;  1SVM A;  1OCZ H;  1N77 A;  1POG A;  1WJ5 A;  3H35 A;  1YJN I;  3BQY A;  1JTY A;  1L0O C;  2CRG A;  1D3Y A;  4OU0 A;  1S5L C;  2IS2 A;  5IP9 J;  3V8J A;  4CO8 A;  4IL6 C;  1O7L A;  2QKM B;  3VYR B;  1P7I A;  3MN2 A;  3VSK A;  4YIR X;  2DFE A;  4C2U A;  1KQ9 A;  1FYK A;  3HRM A;  2CW7 A;  3LQQ A;  1QPM A;  1YRN B;  1ZRD A;  1W0T A;  3MKW B;  3U1D A;  3F8B A;  1UST A;  2MH9 A;  3U21 A;  1R71 A;  3VWB A;  1XS9 A;  2GWR A;  1OR7 A;  3BR2 A;  3RQ4 A;  4A2U A;  2EZL A;  2XAU A;  4E6K G;  4XKC A;  2V6C A;  2RV8 A;  2DK8 A;  2FNP A;  4Q48 A;  1RR8 C;  2DLL A;  4A3G J;  3ZP5 A;  1FX7 A;  2BYV E;  2IRF G;  3K4K A;  4L9N A;  1VND A;  4ZJZ A;  2GXB A;  2KL4 A;  4AVP A;  3MZY A;  2K5C A;  2XAH A;  1R1U A;  1IXR C;  4PJL A;  3U1K A;  2AS5 F;  2M0M A;  5EZH A;  1ZGJ A;  4LJZ F;  4M9Z A;  3OOU A;  4A12 A;  4I02 A;  4A3D J;  3HOW J;  4HLY A;  2IEK A;  2F4O B;  2DYR H;  3IH2 A;  2EFP A;  4HF2 A;  2ZBK A;  2XC7 A;  5HLH A;  2ZJ2 A;  3QPH A;  1AKH B;  4EGZ A;  4KN4 X;  1ETQ A;  4P1W A;  3KYC B;  2E2J J;  2JA2 A;  4FCY A;  5J4Y A;  2L7Z A;  4I0A A;  3LSR A;  2OZU A;  3LA2 A;  1WJF A;  3C2G A;  4BUP A;  3VEP A;  3MQ0 A;  3WHB A;  4Y33 A;  4WWC A;  4C30 A;  1YW9 A;  3OYD A;  1ONV A;  1RPW A;  4M6X A;  3HTU A;  4BQO A;  2MLK A;  2M45 A;  2F5E A;  2M4G A;  4E7Z A;  3GX4 X;  2A6H F;  5M3M J;  2K86 A;  3KZY A;  3I53 A;  4XLP F;  5C4J J;  2G0E A;  4HF0 A;  4BAY A;  1YG2 A;  4Y4R A;  5GPA A;  3PFI A;  4ENN A;  5A2Q Z;  4Z2Y A;  4HX8 A;  2BY2 A;  3WTZ A;  5BPI A;  4HF1 A;  4M3D A;  2E60 A;  2ZCW A;  3FMQ A;  3W3C A;  1PJR A;  1JTX A;  1YS6 A;  2CFX A;  3QPS A;  3A02 A;  4TV7 A;  4P9F A;  4BY7 J;  5K7F A;  3BTJ A;  4HLX A;  1U5T A;  5FD6 A;  5C4X J;  3TP0 A;  1XCB A;  1XPX A;  1HCR A;  4FX4 A;  3HHG A;  5ILU A;  1Y8Q B;  4D5C A;  3EET A;  3GTM J;  3DTK A;  1WI3 A;  2LYC A;  1P92 A;  2K9N A;  1I3Q J;  1K6O A;  2H8W A;  2BVM A;  2R7W A;  1X1D A;  4NC7 A;  3J80 K;  1YQA A;  3ABT A;  3D1N I;  2HOT A;  3LFK A;  2PMZ N;  2QUF A;  3S17 J;  3S3M A;  1WJA A;  3KIO A;  3BT9 A;  1Z7L A;  2VE8 A;  3CDH A;  4GXO A;  5C44 J;  4II3 A;  3EUH A;  2DT7 B;  2Z16 A;  3NWT A;  1GXQ A;  2DDB A;  2K27 A;  3SZT A;  1DU0 A;  2GOM A;  2V1N A;  5E8G A;  3DTI A;  3HC7 A;  4FTH A;  1X3W B;  2W85 A;  4RAG A;  5HOO A;  4M72 A;  1JKR C;  2OQG A;  1PYV A;  4RMN A;  3IHU A;  1BA5 A;  1FLI A;  4RGS A;  2R7Q A;  2VKV A;  2ZJP F;  4IOC F;  2JTV A;  4U7D A;  3TMO A;  1X1P A;  1WJB A;  1IF1 A;  1X58 A;  1W7P B;  4AYB A;  2R7O A;  3CMM A;  1OCP A;  4F7Z A;  3GTO J;  4XOT A;  4Z6Y A;  4LG0 B;  1K4S A;  3WGH A;  3ZMZ A;  1BOB A;  3RSN A;  2UUZ A;  2MH2 A;  2FSW A;  3ECO A;  2KIU A;  4GO1 A;  3DKW A;  2DQL A;  1RIO H;  2ESN A;  1XTA A;  2BBY A;  2GA1 A;  2LH9 A;  3R4K A;  5IYD J;  3J81 Z;  3JTH A;  2J5O A;  5E8I A;  1R00 A;  2KJB A;  3CDI A;  3ML6 A;  2DBB A;  3VYS B;  1ACI A;  2JA8 J;  1IUY A;  2VB6 A;  3DQV C;  1Z67 A;  2EZI A;  3R60 A;  1W0U A;  2DFI A;  2HYF A;  5IYB J;  1GHC A;  3KCC A;  1V5F A;  3LL7 A;  4LIV A;  4DBR A;  2E1N A;  2KJC A;  2LOO A;  5LGU A;  3E3V A;  3DEU A;  3LFU A;  2VPL A;  3JRA A;  1WFX A;  1PVE A;  1YX5 A;  2LKS A;  4RB3 C;  3BR5 A;  3DV8 A;  4A3B J;  5ICC A;  4YIF A;  2VQG A;  5LEJ A;  4N9H A;  2HEO A;  1Q1V A;  2L9R A;  2WAD A;  2A5W A;  2L0K A;  2VOO A;  3CUQ C;  4Q5S F;  2GA2 A;  3H1C A;  1LJ9 A;  3ECH A;  1RKT A;  4X0G A;  2E35 A;  3I3L A;  4XRS A;  3ASN H;  1HW2 A;  2VI6 A;  2XRL A;  3E0J B;  5D4S A;  4L9J A;  1EA3 A;  3JAM K;  1V3F A;  2MSY A;  2L4M A;  2LKX A;  1TLH B;  3CUO A;  1XGS A;  2FD5 A;  4XOP A;  3K70 C;  1GXP A;  3FXO A;  2K4B A;  3SHF A;  1IXC A;  2FBH A;  4ESB A;  2LK2 A;  1SD4 A;  3CJQ B;  3HEF A;  1EH6 A;  2QQ9 A;  1HKT A;  1A35 A;  5JR3 A;  2YS9 A;  5IOY A;  3M1E A;  3KP5 A;  3KYL A;  5CVU A;  3KYD B;  5ERI A;  5E3M A;  1XSV A;  1Z6R A;  3E5U A;  1X3U A;  1TL8 A;  4AC0 A;  1T38 A;  4KIF A;  1MMD A;  1WZ2 A;  3MCZ A;  2F48 A;  4LB6 B;  4IEJ A;  4HOB A;  3G3Z A;  3GFM A;  3RQI A;  1T56 A;  2JWT A;  2ECB A;  2RQQ A;  4JQF A;  1QGP A;  3BY6 A;  4ZYH A;  2PLY A;  2CYY A;  3M1C A;  5LGT A;  3GO5 A;  2X9D A;  3W2W A;  2O0Y A;  2Q1Z B;  2VT3 A;  4B4C A;  1IJW C;  4Y3O A;  2HPM A;  1KU9 A;  3BOQ A;  3IKV A;  3PL8 A;  4II2 A;  2OD5 A;  3JTG A;  2RKH A;  3QU6 A;  4ZYA A;  3TW6 A;  4B43 A;  2PG4 A;  1OYW A;  1P4A A;  2VKD A;  1ODD A;  3OIP A;  5D5U B;  5BNG A;  3JRE A;  1JJ8 C;  1DGR M;  2NVU B;  4XKV A;  2NS0 A;  2A68 F;  3H9G A;  5LD2 C;  3KP2 A;  1PUE E;  4F92 B;  3I4P A;  4XMY A;  1ZR4 A;  1Q1H A;  4E70 A;  2E34 A;  3SDB A;  1B1B A;  2CV1 A;  4BDZ A;  2R7R A;  4U88 A;  3PM1 A;  5GAG J;  4ZC3 A;  2ID6 A;  2H8R A;  5M5X J;  5F0F A;  4RB1 A;  2ISY A;  3ZQQ A;  1WH5 A;  3DBL B;  3BG9 A;  4HDV A;  2KRC A;  3H3V K;  4I76 A;  1WHU A;  4H0E A;  2FNA A;  2JA5 J;  4DZP A;  3CC7 I;  1DGW Y;  2FRH A;  2K9Q A;  1GUU A;  2STW A;  3GFL A;  1KU3 A;  3TO7 A;  3GZ6 A;  2R0Q C;  1IG7 A;  2R7S A;  2ZME B;  2EQR A;  2DXI A;  4IHV A;  3PO3 J;  1QBJ A;  4N9I A;  3D0S A;  2IW5 A;  1H9G A;  1WPK A;  3OYI A;  1Y0N A;  3E6D A;  4IRH A;  3F9K A;  4UXN A;  3W6J B;  1PUF B;  2BW3 A;  1VQ6 I;  1TWF J;  1OCR H;  4K2E A;  3M07 A;  2M1B A;  3BG6 A;  1ZN2 A;  2HYG D;  4KT6 A;  2R5Z A;  2YR2 A;  2ZKZ A;  3A1Y A;  2X48 A;  5E1X A;  3CCL I;  1LE8 B;  4X1E A;  3HOS A;  5CVJ A;  2HKX A;  1ZAR A;  2GZW A;  2JUG A;  4MTD A;  2MD0 A;  2H1L A;  2FX0 A;  3HOZ J;  1ITY A;  2VAS A;  1MKM A;  2E5Z A;  4EJU A;  3C7J A;  3ZMV A;  1SFU A;  4ABZ A;  2F4M B;  1X1A A;  2QYO A;  4UV9 A;  1D1C A;  3HTS B;  3K4B A;  2COM A;  3W6V A;  1R36 A;  2A05 A;  1BJZ A;  5KHD A;  3COA C;  2MA3 A;  3TDZ C;  2F5D A;  5DYM A;  5FKM A;  1FJL A;  5DEQ A;  4PJJ A;  1CQT A;  3ZOB A;  2M87 A;  4XRM A;  2PI0 A;  1IRF A;  3QYE A;  4PFP A;  1W36 C;  2LD5 A;  4WXC A;  2JQ7 A;  3UNG C;  2RAE A;  3O6B B;  2CH0 A;  2QQB A;  2M30 A;  3K6G A;  1G3Y A;  1IO2 A;  1X19 A;  2ZFW A;  1ETV A;  4GGG A;  1O3S A;  3S1M J;  1GLN A;  2DDA A;  4ZYE A;  1MH4 A;  4A3L J;  1TW2 A;  2EB7 A;  4DZJ A;  2CUE A;  4B1R A;  3I9V 2;  3FBN B;  2HYJ A;  1DP3 A;  1GV5 A;  1DUX C;  4NQW B;  3DPU A;  3EPZ A;  5FGM A;  4A3K J;  1FYL A;  3M9A A;  3B6C A;  1W4M A;  3CLQ A;  2KHM A;  5J3L A;  5EDN A;  4RLQ A;  5J4V A;  3K1N A;  3V8L A;  3T8T A;  2KIS A;  2ME6 A;  1GVD A;  3MKL A;  4BE1 A;  3A2K A;  5CLS A;  2OV7 A;  2QSH X;  3LSK A;  1WGX A;  5JVT A;  4MIM A;  4IVN A;  1OR7 C;  1SFE A;  3S1N J;  2ZB9 A;  3TP3 A;  3BCB A;  1MH3 A;  3ZPL A;  2OBP A;  2Z5U A;  1MD0 A;  4AIK A;  3QPT A;  3K4M A;  4M73 A;  4YFX F;  3BC8 A;  2DPU A;  4FQG A;  2PMU A;  1K6Y A;  5A2Q K;  3OMY A;  1JUP A;  4G6Q A;  1U9O A;  1VI0 A;  5FRM A;  3HJE A;  1YI2 I;  9ANT A;  4JP0 A;  3I59 A;  2O9L A;  3WTU C;  2K9M A;  3BR1 A;  3CCJ I;  4RM2 A;  3KLN A;  3HDD A;  3SFI A;  2NVQ J;  2CWE A;  2KDZ A;  3UKG A;  2VJI A;  2ELH A;  3K9T A;  2I5U A;  4ENM A;  3N05 A;  4CZC A;  2QBY A;  2CV2 A;  4HA8 A;  2XSJ C;  3E5Q A;  4YFN F;  1QQI A;  2X1E A;  1T2K A;  2X6X A;  5F0H A;  4S05 A;  2M7B A;  2EWN A;  3QP5 A;  3WHC A;  2R7V A;  4I09 A;  3TKY A;  4HEA 2;  1OYY A;  1XDS A;  5C3E J;  1JUS A;  2A69 F;  2R5Y B;  3SYT A;  1VQ4 I;  4JBA A;  1YIT I;  4OIQ F;  2DPD A;  1DPU A;  1RR7 A;  4A93 J;  2ZSI B;  1H88 C;  5JLX A;  5AIQ A;  2XGC A;  2XAJ A;  3K70 D;  1YRN A;  3L1P A;  1GV2 A;  3N4M A;  1UCR A;  1MBE A;  3CCE I;  4L5I A;  4XKW A;  5EYR A;  3HUG B;  5FFZ A;  2KIF A;  4OAY A;  1L3L A;  4CIC A;  1QZE A;  3K10 A;  3SEQ A;  3ASO H;  2E19 A;  3I58 A;  2COB A;  1YHQ I;  1JKP C;  4HBL A;  2YX7 A;  4PUS A;  1I50 J;  2Z99 A;  5EEG A;  2NRA C;  2MGQ A;  1HW1 A;  2L5Q A;  4YFK F;  3WTW C;  2DA7 A;  3FF5 A;  4AID A;  5HDK A;  4E7L A;  4LD5 A;  2KIM A;  4D0P A;  1TWH J;  4S04 A;  3OYH A;  3HG9 A;  4HX7 A;  1E3O C;  2RRE A;  3J81 K;  5IT9 Z;  2V4J C;  3CD6 I;  3F23 A;  1H0M A;  4O5V A;  2Q2E B;  1NTC A;  3ESW B;  2L3D A;  5L3E A;  2LY2 A;  3LSM A;  2QEX I;  1AKH A;  4WX9 A;  3KP4 A;  3Q0W A;  1J59 A;  3ZR8 X;  2EFW A;  1J9I A;  1BIA A;  4GFB A;  3ABK H;  5B5E C;  3PIP F;  3LNQ A;  5D5W B;  2O5R A;  1FOW A;  3AG3 H;  1LQ1 A;  3FM3 A;  3DWL E;  4RAY A;  3E97 A;  3L09 A;  4G6D A;  2K9S A;  2VLA A;  4HNU A;  3J7A O;  1Y1W J;  3I5U A;  3TQN A;  1OYI A;  2XDV A;  4U0V A;  4C3I J;  2NVX J;  1O57 A;  2CUJ A;  1LVK A;  3RKY A;  3DU5 A;  1FP2 A;  1IDY A;  4EMS A;  1WCM J;  2OF7 A;  1FT9 A;  5D4R A;  3IV5 A;  5TJJ A;  2ESH A;  4EJV A;  2DAO A;  1FY7 A;  1OCT C;  2O8K A;  3ZQG A;  2MD5 A;  1HOM A;  3OS2 A;  1ZHF A;  1O4X A;  2FE3 A;  3ZMD A;  4IHS A;  1HKS A;  1H8A C;  1TQM A;  2XGD A;  1U2W A;  3KET A;  3AG2 H;  5J8F A;  1T39 A;  4BKX A;  3MEX A;  3QOD A;  1C0W A;  4IRI A;  1OPC A;  5E1Z B;  3GME A;  2KQR A;  2XAS A;  3WTT C;  2E5N A;  5FKO A;  4KMU X;  2D2W A;  5JHF A;  2QSF X;  1HSJ A;  4HNV A;  5FKK A;  2EH3 A;  3VYT B;  1XGM A;  4MLO A;  3V7C A;  2CV0 A;  3RPU D;  4I2O A;  2XHK A;  3JRC A;  5BMZ A;  1VQK I;  5GPC A;  1Z1D A;  3CDL A;  4BQQ A;  1F4K A;  2W1O A;  1BC8 C;  3MZ8 A;  2IBD A;  4BBS J;  2XPW A;  3HKZ A;  3DEW A;  3FXM A;  4D7N A;  5LHG A;  1W36 D;  2DW4 A;  4KA4 A;  2A3S A;  1FPQ A;  4UY8 I;  4BEH B;  2OC6 A;  5E3O A;  1S6L A;  2NXN B;  1QA6 A;  1GDT A;  1D0Z A;  2JZY A;  2PMZ A;  1W7P A;  5K7Z A;  4H4K C;  3M3Y J;  3HL2 A;  4ZDP A;  1I27 A;  2JJ7 A;  3IL2 A;  2PBI A;  3N97 A;  4F3Q A;  4G6T B;  3MFK A;  1QHH D;  2Y0S N;  1Y6I A;  3QAH A;  4UUS B;  4Q4Z F;  3JRB A;  4E7K A;  4IOA F;  3GZ5 A;  1V55 H;  2FUG 2;  3FXU A;  2ME0 A;  4RS8 A;  4G7H F;  4CSW A;  5B66 C;  1F36 A;  1B6A A;  4EM1 A;  1OFC X;  1JI8 A;  3J7A Y;  4XM3 A;  1Z7U A;  2VUM J;  4PSW A;  5EZG A;  4QLC U;  5JLW A;  3A03 A;  5F64 A;  2E7X A;  1GT0 C;  1Y1V J;  4JK1 X;  2IAI A;  2OU2 A;  2QF7 A;  4M3B A;  1H89 C;  3V7R A;  2HVS A;  2KIQ A;  2BHZ A;  3LAP A;  1B8I B;  5HLG A;  2KKO A;  3WU1 B;  2L7M P;  4RGR A;  3WG9 A;  4C2T A;  3RIR A;  2VKE A;  3W2A A;  1D8J A;  5DCM B;  4AUX A;  4V2F A;  4CCJ A;  2M8G X;  4F93 B;  3QP6 A;  4DYQ A;  4LGW A;  4UUT A;  3CUQ B;  3CQZ J;  3RKW A;  3F72 A;  4ETS A;  4AM3 A;  2L7F P;  4UB8 C;  4M71 A;  5IP7 J;  3SJM A;  3DU6 A;  1IZ1 A;  1CF7 B;  3OS0 A;  2RGV A;  3L9F A;  4BXU A;  2J5P A;  5HDG A;  5HS9 A;  1K78 B;  1I6X A;  2FA5 A;  4N0B A;  4HQE A;  1BBY A;  1MZB A;  2W48 A;  3ISP A;  1R1T A;  4PJ0 C;  3S2D J;  2EIL H;  3DKY A;  1BN5 A;  2X85 A;  4ZTF A;  1AHD P;  5LFA A;  1QVT A;  3ZN1 A;  2FQ4 A;  2FXA A;  2IP2 A;  2DJI A;  2ZNZ A;  1R5G A;  3BR3 A;  1B9N A;  3GW2 A;  3L2C A;  4C2M J;  1MMN A;  2BHY A;  2Y31 A;  2DTR A;  4KN7 X;  1EF4 A;  2GBY A;  5J6X A;  3P5J A;  1JT6 A;  1SC7 A;  5J40 A;  4W97 A;  2VC1 A;  2FF4 A;  3BJA A;  1XCV A;  4NDL A;  4BBR J;  1I1S A;  2IGO A;  4EGY A;  4F52 A;  2F4I A;  1MBJ A;  1LUJ B;  3E7L A;  1N78 A;  4M6Y A;  2GAU A;  2V9V A;  2XB5 A;  2PJP A;  2QWW A;  4L5J A;  2L9N A;  3OY9 A;  4NC6 A;  2HKO A;  3BP8 A;  3RJP A;  2DMQ A;  3JW4 A;  3H9J A;  4IQJ A;  2VON A;  5FRN A;  4CZZ A;  3ELK A;  2A6E F;  4XRF A;  5IOZ A;  5D6E A;  2P6S A;  1A6Q A;  1VQ5 I;  1ETO A;  1MIJ A;  1R58 A;  2TCT A;  4UNO A;  4XR6 A;  3JRI A;  1UHW A;  4HZF A;  2Z2S B;  1SD6 A;  5D6F A;  4ESJ A;  1EJ9 A;  4HG2 A;  5L3B A;  3BPX A;  2GIZ A;  5F04 A;  1HKQ A;  2HPI A;  3H36 A;  3HHH A;  1J75 A;  3HGG A;  4HV5 A;  2HI3 A;  2DT6 A;  5EEH A;  1EH8 A;  1FC3 A;  2Z3Y A;  4EV0 A;  5D5V B;  4JYK A;  1IV8 A;  1Z3Y A;  3TL4 X;  3CCM I;  3LSP A;  2E1C A;  4B09 A;  3QWL A;  4MQV A;  3DBR B;  2HR3 A;  3OYG A;  1B9M A;  2ZME A;  5IPA A;  3E6M A;  3GEZ A;  2K9L A;  3AG4 H;  5HNF A;  2LP0 A;  5H6R A;  5K5R A;  2QCO A;  2MYS A;  2PQ8 A;  3WGG A;  4I6Z A;  2EIJ H;  2JRT A;  1PUF A;  1F5T A;  4CGZ A;  5EGO B;  3H3Z A;  5LHH A;  4IHT A;  2XRN A;  1OCO H;  1IN4 A;  3QOP A;  1MJ9 A;  2VXD A;  2XSD C;  2MC4 A;  3EYY A;  1MND A;  5E20 A;  1Y0U A;  1RI7 A;  1LE8 A;  1IRG A;  3O3K A;  2LDU A;  1LFU P;  2OQR A;  1BW5 A;  4W1U A;  1X1C A;  2WAQ A;  4UVC A;  4DNC A;  2GXA A;  3MD2 A;  5JVG F;  3IH3 A;  3RZO J;  1P6R A;  1IN6 A;  3FIS A;  4CA0 A;  2HQR A;  1T95 A;  4UVB A;  2MC3 A;  1FBQ A;  2VBX A;  2EIM H;  3KZI C;  4L9T A;  1MBG A;  2QSG X;  1IDZ A;  2GQQ A;  1FSE A;  5FB2 A;  3NWS A;  4BH9 A;  4XKB A;  3M4O J;  3A0H C;  3RZD J;  2D1H A;  1SD5 A;  2DI3 A;  1WKM A;  1IN8 A;  3MVP A;  1G3T A;  1HLV A;  3BZ6 A;  2ZNY A;  4OIO F;  2X0L A;  4DBQ A;  4NC8 A;  2QM3 A;  2NOG A;  2VJJ A;  3DCF A;  3BWG A;  2VBY A;  2IGM A;  2O8X A;  2CS3 A;  1PP8 F;  4ENJ A;  1MDM B;  3Q0V A;  1X4O A;  2V26 A;  4XK4 A;  4ZYD A;  4NQW A;  3A01 B;  2JUC A;  2H09 A;  5IT9 K;  2AQE A;  4BDY A;  3TOA A;  3F6V A;  1UEL B;  2LLK A;  2P7V B;  5BOX A;  4WXD A;  3I0T A;  3AKZ A;  2HXO A;  1ZGW A;  2BY3 A;  1P4X A;  3FZV A;  3PQJ A;  1MBH A;  1UZC A;  2K3F A;  2XGX A;  5F6F A;  1G8X A;  3S8P A;  5AON A;  3TDU C;  4ESF A;  1Z6T A;  2R7T A;  4KIT B;  2W00 A;  1F1Z A;  2I10 A;  4AD9 A;  4BYY A;  1SFO J;  1SMT A;  2QKL B;  3OL4 A;  2QA4 I;  1S72 I;  3L2Q A;  1LDJ A;  1U6G A;  2P5L C;  1SEU A;  4ANJ A;  3OYC A;  4YEJ A;  1FBU A;  2CQK A;  4CH7 A;  3HOT A;  2W7N A;  1CGP A;  3VOD A;  4XID A;  2CJJ A;  2F5C A;  1NH3 A;  3WE3 A;  1U9N A;  3BZK A;  4NUB A;  5F1J A;  2LR8 A;  3GFJ A;  2XAQ A;  3K4C A;  4IX7 A;  5GAE J;  2VQL A;  4CDG A;  1QHG A;  2R3S A;  1MMA A;  2M7A A;  4I98 B;  4G94 A;  4KFC A;  3DFG A;  2JSP A;  1D0X A;  1ZTR A;  2TDX A;  3E1S A;  1G6N A;  4AU7 A;  4HNT A;  2EV0 A;  2ACJ A;  2IS4 A;  1ETY A;  4HV6 A;  2ZC2 A;  3U9G A;  2CU7 A;  3K4J A;  4XLE A;  2Q8K A;  1ZG5 A;  3GBG A;  3HM5 A;  2HZD A;  4GYI A;  5J1U A;  5TIS C;  3WU0 A;  3KP6 A;  3HIF A;  5L3G A;  4ITV A;  5F27 A;  3IWF A;  2L02 A;  2K7L A;  3AL0 C;  3CZ6 A;  1WQ2 A;  2OTL I;  3CME I;  2R5Y A;  2XUB A;  2CMP A;  3S32 A;  3FXQ A;  3MKY B;  2IJL A;  3F8N A;  1MJA A;  3ERE D;  4LLN A;  4JX4 A;  2DU9 A;  3WU2 C;  5DM6 F;  1MNM C;  4IHX A;  5KAI C;  1NK3 P;  4I01 A;  3KPH A;  2B9S A;  3ROU A;  5EF6 A;  2AO9 A;  5CYV A;  1ZQ3 P;  3HUG A;  4MFE A;  3D5R C;  1ENH A;  5CJ9 A;  1FOY A;  2F5V A;  2VBZ A;  2IA0 A;  3QU3 A;  2K3P A;  1KYZ A;  2HVR A;  1DP7 P;  3GCM A;  1BIB A;  3QYB A;  4Y13 A;  3SEZ A;  2Y75 A;  1V54 H;  4BE2 A;  3S2W A;  2WV0 A;  3S15 J;  1TT5 B;  2HU9 A;  1M1E B;  3BG3 A;  3AG1 H;  1RKW A;  2UV1 A;  1VQP I;  1APL C;  4AYB N;  3K1P A;  4BNC A;  1USS A;  4KIC A;  2FOK A;  2DFH A;  1LKX A;  2NOJ B;  4RGX A;  3D5L A;  3DPT A;  2P0W A;  1TW3 A;  4R8H A;  5B3S H;  3GTL J;  2LMD A;  2LF7 A;  2Q2E A;  2WV1 A;  1DDN A;  1UHS A;  5DUI A;  1IW7 F;  2YPR A;  2DMN A;  1VF9 A;  3EQL F;  3RPQ A;  3JRH A;  2JPC A;  1GVJ A;  1P9Q C;  4XNF A;  4PJM A;  1A5J A;  3NAR A;  2IA1 A;  4XLH A;  2OJE D;  3GTG J;  4DQ2 A;  3OR2 C;  2JN6 A;  3WTS C;  4RA2 A;  1DU6 A;  5EJC A;  5CQG A;  2NVY J;  2BXZ A;  2Y48 A;  4GCV A;  4YII A;  6PAX A;  3NQO A;  5M5Y J;  1FNN A;  3BDD A;  1BI2 A;  3IAS 2;  3ZMS A;  2V7F A;  5LHI A;  1TT0 A;  2RNG A;  3LA7 A;  3BLY A;  2NVT J;  2PJR B;  1U78 A;  1ZG1 A;  2R92 J;  2ZSH B;  4UV8 A;  2VJ4 A;  2P6T A;  5L3F A;  1T0F C;  2DT5 A;  4KYW A;  1U0J A;  1HBX G;  4BJ6 C;  4NHJ A;  2D5V A;  1P2F A;  4UB6 C;  4XRS G;  4M9S A;  2IGK A;  3PIO F;  2VQC A;  1JGS A;  1BL0 A;  1Z9C A;  1MGT A;  5JFR A;  1JT0 A;  1X4P A;  1BR4 A;  2DK5 A;  2EJR A;  3QQA A;  2ZXW H;  1LVA A;  1XC5 A;  2Y0M A;  2OZ6 A;  3IH4 A;  3GUD A;  2P5K A;  3GLX A;  2DO7 A;  4DGW B;  3AFH A;  5DD8 A;  2WY8 Q;  1REP C;  3HOU J;  3C3W A;  2X4H A;  1V4R A;  3P9I A;  1H9T A;  2LNB A;  4A6D A;  3DEE A;  4FX0 A;  2EFQ A;  4IHW A;  1J09 A;  1O7F A;  2P5V A;  4BJ5 C;  1B4A A;  1XN7 A;  1Y39 A;  1BI0 A;  3KLO A;  2XF7 A;  1ZEL A;  4LIU A;  4BEH A;  3IAM 2;  5M5W J;  4B8X A;  3RCO A;  2WA0 A;  3Q5F A;  4A69 C;  2V79 A;  5J1R A;  4ENK A;  3CJN A;  3C1D A;  2WTE A;  3ZQI A;  2HXI A;  5TGT A;  2NS7 A;  1YFH A;  1S7E A;  5ICG A;  1R6R A;  1W5S A;  4UUS A;  1WI9 A;  2DA3 A;  5DTD A;  4EEF G;  1YTY A;  2PMH A;  2PFB A;  5F0C A;  1SFX A;  3ZMT A;  1QU3 A;  1I39 A;  2H94 A;  2R93 J;  1TWC J;  1A04 A;  3HPG A;  3M8E A;  3WOD F;  5E17 F;  3KE2 A;  1KGS A;  1KQ8 A;  4CCO A;  1J2X A;  3LA3 A;  1LNW A;  3RDI A;  1YW8 A;  3HXL A;  2LY9 A;  1B8I A;  4EJT A;  2X6O A;  4XLA A;  2CFO A;  2QQ8 A;  2D1V A;  4EJO A;  5HVQ C;  3J7Y J;  5DCM A;  4ASN A;  2WB1 N;  1TTY A;  1RZ4 A;  1Y8R B;  3T0Y A;  1MJB A;  3CUQ A;  2QGU A;  4PSX A;  3SZP A;  3M8J A;  2ETH A;  2VT2 A;  1JGG A;  1S9H A;  1ETW A;  1SAU A;  3ONQ A;  1CF7 A;  3RYP A;  3F6O A;  2LVS A;  3CCY A;  3G1O A;  4B44 A;  4E7J A;  3X2Q H;  4Y52 J;  5LGN A;  1U5T C;  3TOB A;  2RC4 A;  1STZ A;  1K78 A;  4CXF A;  3OR1 C;  4B48 A;  3GTK J;  3L2W A;  2RVC A;  1XDU A;  2UXX A;  3DLA A;  4M9X A;  4XN0 A;  2DTZ A;  1TQP A;  3FMS A;  3T5X A;  4Y7N J;  4CCM A;  3LOC A;  4RM3 A;  1ON2 A;  4EVI A;  1B59 A;  2M4K A;  2PN6 A;  3GWZ A;  4XL9 A;  4KNY A;  3ZRG A;  4XSZ F;  2EBI A;  3GFI A;  1FTZ A;  4XLC A;  3OYE A;  3OSG A;  1D8K A;  2HGC A;  1SD7 A;  2ZXH A;  2ZME C;  1DPR A;  2VJ5 A;  2WC2 A;  3EUH C;  3VB2 A;  2ZJQ F;  4AIH A;  2QEN A;  3TBI A;  4A3E J;  3GTP J;  4FIS A;  2FEZ A;  4FE7 A;  1BR2 A;  4P5O A;  1FIP A;  4QWQ A;  1HDP A;  1E17 A;  5CPR B;  3CLO A;  2EA2 A;  3K69 A;  4IPA A;  4CUG A;  3DTE A;  5DDG A;  1R22 A;  5LLQ A;  1BR1 A;  1E3H A;  1WH7 A;  1UG2 A;  3QYF A;  2MW8 A;  1S29 A;  3LMM A;  2L9S A;  4CCL A;  3S1Q J;  1KA8 A;  4F55 A;  1QRY A;  1TWA J;  1TP4 A;  3K1M A;  5CVV A;  2XKP A;  4ZH4 F;  3I71 A;  2L01 A;  4S0H B;  3K7A J;  4V19 K;  3S16 J;  2RDP A;  2KFD A;  4XLN F;  3LAJ A;  5CVI A;  4C9Y A;  4IO9 F;  3BG7 A;  1ZGA A;  1ORK A;  3CCS I;  3FK7 A;  5H2F C;  2WY7 Q;  1UB9 A;  4XLF A;  4U0W A;  1ZH5 A;  1DQU A;  3K4L A;  3LQR A;  3E5X A;  1YO5 C;  3CO6 C;  1BI3 A;  2EA4 A;  4RB0 A;  3RTR A;  1LB2 A;  3F3X A;  3OYA A;  3HPH A;  3CMA I;  4V2G A;  3GXO A;  4A5N A;  2HDW A;  3JRG A;  5FRO A;  4RLF A;  2GM4 A;  2AXT C;  2XAF A;  5FLM J;  4IF4 A;  2ZFU A;  3ABM H;  4D5F A;  4XSX F;  1VQM I;  3T1B A;  1MNE A;  4MQ9 F;  2GXG A;  3F22 A;  2CUZ A;  1I1G A;  2W4S A;  5EGO A;  5GAD J;  1G3W A;  5GTH C;  1R7J A;  4ZZD A;  1AWC A;  2HS5 A;  2O3F A;  4PJN A;  1YW7 A;  2DA1 A;  2Y30 A;  3OSF A;  4IQ4 A;  2XF5 A;  4A6E A;  5HS8 A;  1IUF A;  1QZZ A;  4Y17 A;  2D45 A;  1R23 A;  3J7Z I;  3VSL A;  1YYV A;  1JUM A;  2OAZ A;  3FIW A;  2Y9Z A;  2XF6 A;  2O03 A;  4E7S A;  1ETX A;  1SVO A;  2F2E A;  3IP4 B;  1T8I A;  3RPU A;  1SAX A;  2BGC A;  2DN0 A;  4NBQ A;  2HOE A;  3S3O A;  2E7W A;  2H6B A;  1HF0 A;  3OS1 A;  3KZZ A;  3PFY A;  3DKX A;  1RRJ A;  2P8T A;  3ZQH A;  2NAZ A;  3RYR A;  4ZZL A;  3V7S A;  2N8G A;  5HLI A;  5IY5 H;  1JHF A;  1YJW I;  5FKL A;  3T8R A;  2W57 A;  3CTA A;  5FJ8 J;  1HC8 A;  2BVL A;  1D5Y A;  1F43 A;  2XRO A;  1NK2 P;  2KRF A;  2ZO4 A;  2MFZ A;  2VN2 A;  4MEX F;  3F8M A;  3R61 A;  1PP7 U;  1MDM A;  2IS6 A;  1E0E A;  1RET A;  1U8R A;  4NNJ A;  1ZK8 A;  2JT1 A;  3GTJ J;  1LDD A;  3A01 A;  4GYG A;  1I6H J;  5KK1 A;  4BL0 B;  4CYD A;  1R4M B;  2KP6 A;  4L9V A;  2W84 A;  1QVU A;  5DM7 F;  2B7E A;  2BOL A;  1BW6 A;  2E1O A;  5CVR A;  1K61 A;  1IRZ A;  2R4G A;  2V1D A;  1S7A A;  1TZL A;  2B0L A;  2HZT A;  5B1B H;  5DD4 A;  4CYC B;  3PUB A;  3GZN B;  1YOV B;  3PJR A;  3QOE A;  5GP9 A;  1W1W E;  4U0Y A;  3FXR A;  2F6C A;  3GYH X;  4ZDO A;  1JJ6 C;  2HTJ A;  2YU3 A;  5IYC J;  1ERD A;  5LEK A;  3S93 A;  2EV6 A;  2X6Y A;  2E1M C;  4MTE A;  1TQI A;  5EG0 B;  3BTL A;  2H1K A;  2K85 A;  2RNJ A;  2OCC H;  5ICE A;  1B72 B;  1D5V A;  2QQA A;  2TRT A;  3TW7 A;  1JXS A;  2HDC A;  4IZZ A;  4PCQ A;  3HRT A;  1FP1 D;  4A3J J;  1Z21 A;  2FMY A;  1P7J A;  1V5G A;  1FSH A;  3S1R J;  4KIB A;  4PGH A;  2LBF B;  3BRO A;  1TBX A;  1N75 A;  3WE2 A;  2DMT A;  4MO7 A;  1MBF A;  3H5R A;  4X6A J;  5GAH J;  4B3X A;  3EYI A;  2A6T A;  4EM2 A;  2ADU A;  2ZXJ A;  4DIQ A;  3OWT A;  4HPQ A;  2Y9Y A;  3I4M J;  2DJN A;  1MSE C;  2K40 A;  2PEX A;  3SFZ A;  3AL0 B;  3V4G A;  1QO0 D;  5K5O A;  2LSO A;  1G2H A;  1I3A A;  2L7K A;  1KQ0 A;  2BE5 F;  2VQH A;  5IT3 A;  4I7H A;  2VL8 A;  1LPQ A;  1FOK A;  4C3H J;  3JR9 A;  2CUF A;  5LRR A;  3BJO A;  1IAW A;  1KU2 A;  4AWX B;  5FFX A;  1IV6 A;  1Y56 A;  4LLG F;  4E7H A;  1K79 A;  2CW0 F;  3IWZ A;  2CSO A;  4BS9 A;  1XSX A;  3V42 A;  3F8F A;  5E1W A;  2FQ3 A;  5BQT A;  2H27 A;  2NNN A;  3OOP A;  3OIO A;  4OIR F;  4RGU A;  3VFZ A;  1OIS A;  4LK0 F;  2DMU A;  2FJ1 A;  3PNY A;  2O7O A;  1IXS B;  1X1B A;  2QLZ A;  3GLL A;  2E36 A;  2IA2 A;  5H20 A;  2KDO A;  4HAM A;  1FMW A;  2LTP A;  3QRF F;  3OV8 A;  3SQN A;  2EK5 A;  3SZG A;  5J47 A;  4M3F A;  1ZYR F;  2KZV A;  5F08 A;  2R7Z J;  1X3Z B;  5JHU A;  2HWV A;  1U8B A;  2BY1 A;  4FHT A;  3KEO A;  4ZTJ A;  2YU9 J;  3HKZ N;  1WJC A;  3K2Z A;  2BZT A;  2IT0 A;  3HB9 A;  3JSO A;  3KP7 A;  1FTT A;  2ICW G;  3GTQ J;  4XIC A;  2YX4 A;  4I0B A;  2GOX B;  5J1Y A;  3VDX A;  2WAF A;  1N25 A;  4M74 A;  1LFP A;  1UHM A;  3UR3 C;  1J7K A;  2W24 A;  4G9Y A;  2A07 F;  4RAF A;  4EM0 B;  2X1D A;  3TED A;  4UUV A;  1Z3X A;  1YX3 A;  5KNL A;  1QPI A;  2V1U A;  3K2A A;  2M9H A;  3I4N J;  1XMX A;  3RKX A;  1T08 B;  1BJA A;  1MBK A;  1SFK A;  5BPD A;  3BTC A;  3WTY C;  4M6V A;  2E2I J;  3MWM A;  2ISZ A;  3HRS A;  4NB5 A;  1FWZ A;  3KEQ A;  4FT8 A;  3CJR B;  4D9J A;  2RQP A;  3G1M A;  2XB0 X;  1MSF C;  2ELK A;  2ZXI A;  2RN7 A;  4EQQ A;  3FKI J;  2Y69 H;  2GLO A;  1FIA A;  2DA4 A;  4Q47 A;  3BQZ A;  3TO6 A;  4A0Z A;  2XPV A;  3H5N A;  3DBH B;  3IRR A;  2QVO A;  2DOE A;  4QIW N;  1Z05 A;  1R5H A;  3M7G A;  4BGD A;  3CP8 A;  1LDK B;  4HST A;  4XON A;  4UHT A;  3AAF A;  4U7B A;  1JHH A;  2F5F A;  2V9K A;  3G1L A;  2PJR A;  2HOS A;  4C3J J;  3CO7 C;  2OUM A;  1HA8 A;  5L3D A;  4A3M J;  2CQ7 A;  1OLT A;  1KYW A;  4MNU A;  3FXJ A;  1O3Q A;  3WGI A;  4L18 B;  1HST A;  3LSH A;  3PQK A;  2YUS A;  3ZQC A;  1A31 A;  1NG6 A;  3G2B A;  3CMY A;  1SVL A;  2R7F A;  4BHP A;  5D8K B;  1PDN C;  1Z77 A;  1D0Y A;  3L2R A;  2AHQ A;  1EV7 A;  4KIG A;  1VFC A;  4LK1 F;  4HX4 A;  3I55 I;  1XB4 A;  4AVZ A;  2JSC A;  1YIJ I;  3M8F A;  4B47 A;  1I5Z A;  3Q3S A;  1XGN A;  2Y2Z A;  4HDU A;  2W82 A;  4P55 A;  3LSG A;  1SAN A;  2EIK H;  4IXA A;  4E7I A;  2XPU A;  5GTI C;  2K02 A;  2Z9O A;  4WF2 A;  5FLX Z;  1BM9 A;  2LFB A;  5K5Q A;  1BOA A;  1JKQ C;  2JMW A;  3HSR A;  2EFN A;  2KMU A;  5CKT A;  5K7H A;  5ILV A;  4RAZ A;  3R0A A;  2EZK A;  2MBF A;  2EFO A;  2ID3 A;  1ZG3 A;  3HSE A;  4PFO A;  3CES A;  2A5Y B;  4N4O B;  3IC7 A;  2EPF A;  2I8D A;  3D5S C;  4J00 A;  1R49 A;  3B73 A;  2JRM A;  3EUA A;  1FYM A;  2KZG A;  3FXK A;  4J19 A;  4KIS A;  2V6E A;  1FMV A;  1WRJ A;  4XN3 A;  2G7H A;  2XAG A;  2DOD A;  3PNV A;  4A3F J;  5E18 F;  4IJA A;  4M3E A;  2UXN A;  1QZY A;  2EZH A;  2OCE A;  5BS6 A;  3OYM A;  3JSP A;  1BC7 C;  3OIQ A;  3CCU I;  1WVR A;  1RC9 A;  2JVH A;  4PGG A;  1O3T A;  4BY1 J;  1W5C C;  4IKF A;  3C2B A;  1S3J A;  3DPL C;  3KFW X;  4OMZ A;  3ZQ7 A;  3MAJ A;  3OYJ A;  1XX5 A;  3L7W A;  4OIN F;  1G3S A;  1UJ8 A;  4KT5 C;  2R7D A;  1J0R A;  2WWY A;  3CCQ I;  4QPO A;  4RB2 C;  1VQ7 I;  4BXX J;  4HW0 A;  1S7O A;  2P81 A;  3DP7 A;  4A0Y A;  1F9N A;  3MZH A;  1FZP B;  1U5T B;  1MW7 A;  4D7M A;  1XMA A;  1E2X A;  3EUK L;  3O8H A;  5ICF A;  5B1A H;  1A36 A;  1ON1 A;  4L0Z B;  2AXL A;  3EDP A;  1OQY A;  3SXY A;  2L4A A;  4DYR A;  3Q0U A;  4BQN A;  1YE9 A;  3JCU C;  5FD5 A;  3HSF A;  2M34 A;  3L2V A;  3FMR A;  3S3N A;  1OJL A;  1RNL A;  5FKN A;  4MHG A;  2WAQ N;  4JOM A; 
#chains in the Genus database with same CATH homology
 3E6B A;  2FML A;  4G7Z F;  1AOY A;  4HQM A;  4LLL A;  3F21 A;  2P4W A;  1OKR A;  3I64 A;  3KP3 A;  1EH7 A;  4AIJ A;  4O3M A;  4WXH A;  4KDP A;  3F8C A;  4R79 A;  3DF8 A;  3ULQ B;  4CHU A;  3V8K A;  5D8L B;  3K0L A;  2CG4 A;  4OIP F;  1W5T A;  3P7N A;  1P4W A;  2IPQ X;  2K4J A;  2JPB A;  2YSR A;  5LBQ A;  2VE9 A;  4P9U A;  4MGR A;  2O6G E;  1KU7 A;  3ABU A;  1IN7 A;  2VC0 A;  3WTX C;  1G4D A;  4L0Y B;  3FX3 A;  4G7O F;  4BHC A;  2C6Y A;  3ZMU A;  2M5W A;  2BV6 A;  2V1X A;  4PDK A;  2HTS A;  2M8E A;  3BJ6 A;  2OA4 A;  3REO A;  2FBK A;  5K1Y A;  1QNT A;  4YG2 F;  5KVR A;  5HS7 A;  2P7C B;  1ZRE A;  3Q9S A;  3GF2 A;  2UZK A;  4G8X A;  1NHA A;  2NYX A;  2DQR A;  3L00 A;  1J5Y A;  3H3U A;  4OMY A;  2Z33 A;  1XMK A;  1T6S A;  2HFH A;  3RI4 A;  3TO9 A;  3LST A;  3J80 Z;  4MEY F;  2VOD A;  2CO5 A;  2BEO A;  1K7A A;  4WK8 F;  4OOI A;  2O61 A;  4IRG A;  1YIO A;  3R0J A;  4LMY A;  4ZYG A;  5J8C A;  4O6J A;  3B02 A;  1WSU A;  1LEB A;  1RUN A;  1XGO A;  4A0X A;  2VOP A;  4P96 A;  3G73 A;  2XV4 S;  4XBF A;  2H6C A;  5L3C A;  3FHZ A;  1RUO A;  4PZJ A;  3I54 A;  2HQN A;  3Q9V A;  1TNT A;  3GVA A;  2L54 A;  2MLG A;  1ZLJ A;  1HXD A;  3ZN0 A;  3NEU A;  1Z91 A;  1OMI A;  2STT A;  2XIG A;  3NRV A;  3WTV C;  3U2R A;  3HYI A;  1O3R A;  3E6C C;  4Y15 A;  1HQC A;  2IVM A;  5H6Q A;  2QZ8 A;  3P9C A;  1WWX A;  1FBS A;  2A61 A;  3W6K B;  1VTN C;  4LB5 A;  1S8N A;  2VBW A;  4UVA A;  2NNY A;  4KUM A;  3VOE A;  1YS7 A;  2G9W A;  5D5X B;  2EV5 A;  1HW5 A;  1ZRC A;  1IN5 A;  3JAM Z;  1XD7 A;  2Q0O A;  1ZLK A;  1UFM A;  2LF8 A;  4WCG A;  3FWE A;  1T98 A;  1YLF A;  5JI6 A;  5F1R A;  3BPV A;  5FLX K;  3C18 A;  2LKP A;  4EJW A;  3TGN A;  3FM5 A;  4BHB A;  1LEA A;  4LFU A;  2XKO A;  3H92 A;  2UWM A;  3DXJ F;  3R6S A;  1BI1 A;  5ILS A;  1ZAO A;  5FO5 A;  5HDN A;  1W7P D;  2XVC A;  5DV5 A;  3O2P E;  1SMY F;  3P9K A;  1ULY A;  5DCF A;  5DUK A;  1JE8 A;  1R1V A;  5TRD A;  1ZRF A;  2FBI A;  2CGP A;  4ON0 A;  3IKT A;  3I59 B;  3LWF A;  2G7U A;  3IRQ A;  2GIV A;  2W25 A;  4BQA A;  4LG0 A;  5AIP A;  5ED4 A;  2VXZ A;  1U3E M;  4R1H A;  4A5M A;  3HRU A;  2QBY B;  2FU4 A;  1T0F A;  1XSD A;  4KMF A;  1TNS A;  5LRS A;  4HYE A;  1L0O C;  4OU0 A;  1D3Y A;  3V8J A;  4CO8 A;  1O7L A;  1KQ9 A;  1FYK A;  3HRM A;  3LQQ A;  1QPM A;  1ZRD A;  3U1D A;  3F8B A;  1UST A;  2MH9 A;  2GWR A;  1OR7 A;  4A2U A;  2V6C A;  2RV8 A;  2DK8 A;  2FNP A;  4Q48 A;  2DLL A;  3ZP5 A;  2BYV E;  1FX7 A;  2IRF G;  4L9N A;  2GXB A;  4AVP A;  3MZY A;  2XAH A;  1R1U A;  1IXR C;  2AS5 F;  1ZGJ A;  4LJZ F;  4M9Z A;  4A12 A;  4I02 A;  4HLY A;  2EFP A;  4HF2 A;  2ZBK A;  5HLH A;  2ZJ2 A;  3QPH A;  4EGZ A;  4KN4 X;  4I0A A;  2OZU A;  3LA2 A;  3VEP A;  3MQ0 A;  4WWC A;  1YW9 A;  1ONV A;  4M6X A;  3HTU A;  2MLK A;  2M45 A;  2F5E A;  3GX4 X;  2A6H F;  2K86 A;  3KZY A;  3I53 A;  4XLP F;  4HF0 A;  4BAY A;  1YG2 A;  3PFI A;  4ENN A;  5A2Q Z;  4Z2Y A;  4HX8 A;  3WTZ A;  5BPI A;  4HF1 A;  2ZCW A;  3FMQ A;  1YS6 A;  2CFX A;  4TV7 A;  4P9F A;  4HLX A;  1U5T A;  5FD6 A;  1XCB A;  4FX4 A;  3HHG A;  5ILU A;  3EET A;  1P92 A;  1K6O A;  3J80 K;  1YQA A;  3ABT A;  3LFK A;  2QUF A;  2VE8 A;  3CDH A;  4GXO A;  3EUH A;  1GXQ A;  3SZT A;  2K27 A;  5E8G A;  2W85 A;  5HOO A;  4M72 A;  2OQG A;  3IHU A;  1FLI A;  4RGS A;  2JTV A;  4U7D A;  1IF1 A;  1W7P B;  4F7Z A;  4LG0 B;  3WGH A;  3ZMZ A;  2MH2 A;  2FSW A;  3ECO A;  2KIU A;  4GO1 A;  3DKW A;  2DQL A;  1RIO H;  2ESN A;  3R4K A;  2BBY A;  2GA1 A;  3J81 Z;  3JTH A;  2J5O A;  5E8I A;  1R00 A;  2KJB A;  3ML6 A;  2DBB A;  1IUY A;  3DQV C;  3R60 A;  2DFI A;  2HYF A;  1GHC A;  3KCC A;  2E1N A;  2KJC A;  5LGU A;  3E3V A;  3DEU A;  4RB3 C;  3DV8 A;  5ICC A;  4YIF A;  5LEJ A;  4N9H A;  2HEO A;  2VOO A;  3CUQ C;  4Q5S F;  2GA2 A;  1LJ9 A;  3ECH A;  1HW2 A;  5D4S A;  4L9J A;  3JAM K;  1V3F A;  2L4M A;  1TLH B;  3CUO A;  1XGS A;  1GXP A;  3SHF A;  2K4B A;  1IXC A;  2FBH A;  4ESB A;  1SD4 A;  1EH6 A;  2QQ9 A;  1HKT A;  5JR3 A;  3M1E A;  3KP5 A;  5CVU A;  5ERI A;  1XSV A;  1Z6R A;  3E5U A;  1X3U A;  1T38 A;  4KIF A;  3MCZ A;  4LB6 B;  4HOB A;  3G3Z A;  3GFM A;  4JQF A;  1QGP A;  3BY6 A;  4ZYH A;  2PLY A;  2CYY A;  5LGT A;  3GO5 A;  2O0Y A;  2VT3 A;  1KU9 A;  3BOQ A;  3IKV A;  2OD5 A;  3JTG A;  2RKH A;  3QU6 A;  2PG4 A;  1OYW A;  1P4A A;  1ODD A;  5D5U B;  2NS0 A;  2A68 F;  3KP2 A;  1PUE E;  3I4P A;  1Q1H A;  4E70 A;  1B1B A;  4U88 A;  4RB1 A;  2ISY A;  4HDV A;  4H0E A;  2FNA A;  2FRH A;  2STW A;  3GFL A;  1KU3 A;  3TO7 A;  3GZ6 A;  2ZME B;  1QBJ A;  4N9I A;  3D0S A;  2IW5 A;  1H9G A;  3E6D A;  4IRH A;  4UXN A;  3W6J B;  4K2E A;  2M1B A;  1ZN2 A;  2HYG D;  2YR2 A;  2ZKZ A;  5E1X A;  3HOS A;  5CVJ A;  2HKX A;  1ZAR A;  2GZW A;  4MTD A;  1MKM A;  4EJU A;  3C7J A;  3ZMV A;  1SFU A;  2QYO A;  4UV9 A;  3HTS B;  2COM A;  1R36 A;  3COA C;  2MA3 A;  3TDZ C;  2F5D A;  5DYM A;  5DEQ A;  2M87 A;  2PI0 A;  1IRF A;  4WXC A;  3O6B B;  2QQB A;  2M30 A;  1G3Y A;  2ZFW A;  4GGG A;  1O3S A;  4ZYE A;  1TW2 A;  2EB7 A;  1DUX C;  5FGM A;  1FYL A;  3M9A A;  1W4M A;  3K1N A;  3V8L A;  3T8T A;  5CLS A;  5JVT A;  4IVN A;  1SFE A;  3ZPL A;  2OBP A;  2Z5U A;  1MD0 A;  4AIK A;  3QPT A;  4M73 A;  4YFX F;  2DPU A;  2PMU A;  5A2Q K;  4G6Q A;  3I59 A;  3WTU C;  3KLN A;  2CWE A;  2ELH A;  3K9T A;  4ENM A;  2QBY A;  4HA8 A;  3E5Q A;  4YFN F;  1QQI A;  1T2K A;  4S05 A;  2EWN A;  3QP5 A;  4I09 A;  3TKY A;  1OYY A;  1XDS A;  2A69 F;  4JBA A;  4OIQ F;  2DPD A;  1DPU A;  5AIQ A;  2XAJ A;  3N4M A;  1UCR A;  4L5I A;  5FFZ A;  2KIF A;  1L3L A;  4CIC A;  3I58 A;  4HBL A;  2YX7 A;  2Z99 A;  5EEG A;  2NRA C;  1HW1 A;  4YFK F;  3WTW C;  3FF5 A;  5HDK A;  4LD5 A;  2KIM A;  4D0P A;  4S04 A;  4HX7 A;  3J81 K;  5IT9 Z;  3F23 A;  1H0M A;  4O5V A;  5L3E A;  2L3D A;  4WX9 A;  3KP4 A;  1J59 A;  2EFW A;  1J9I A;  1BIA A;  5D5W B;  1LQ1 A;  3FM3 A;  4RAY A;  3E97 A;  3L09 A;  4G6D A;  3J7A O;  3I5U A;  3TQN A;  1OYI A;  4U0V A;  1O57 A;  3RKY A;  1FP2 A;  4EMS A;  1FT9 A;  5D4R A;  5TJJ A;  2ESH A;  4EJV A;  2DAO A;  1FY7 A;  2MD5 A;  1ZHF A;  2FE3 A;  3ZMD A;  4IHS A;  1HKS A;  1TQM A;  1U2W A;  3KET A;  5J8F A;  1T39 A;  1C0W A;  3MEX A;  4IRI A;  1OPC A;  5E1Z B;  3WTT C;  2XAS A;  4KMU X;  2D2W A;  1HSJ A;  1XGM A;  3V7C A;  4I2O A;  2XHK A;  5BMZ A;  1Z1D A;  1F4K A;  1BC8 C;  5LHG A;  2DW4 A;  4KA4 A;  2A3S A;  1FPQ A;  1S6L A;  2JZY A;  1W7P A;  1I27 A;  3IL2 A;  2PBI A;  3N97 A;  3MFK A;  3QAH A;  4Q4Z F;  3GZ5 A;  4RS8 A;  3FXU A;  4G7H F;  1B6A A;  4EM1 A;  1Z7U A;  4QLC U;  5F64 A;  2E7X A;  4JK1 X;  2OU2 A;  3V7R A;  3LAP A;  5HLG A;  2KKO A;  3WU1 B;  4RGR A;  3WG9 A;  3RIR A;  1D8J A;  5DCM B;  3QP6 A;  4LGW A;  3CUQ B;  3RKW A;  4ETS A;  3F72 A;  4M71 A;  1IZ1 A;  1CF7 B;  2RGV A;  3L9F A;  4BXU A;  2J5P A;  5HDG A;  5HS9 A;  1K78 B;  1I6X A;  2FA5 A;  4N0B A;  4HQE A;  1BBY A;  1MZB A;  3ISP A;  1R1T A;  1BN5 A;  3ZN1 A;  2IP2 A;  2FXA A;  3GW2 A;  2ZNZ A;  3L2C A;  1R5G A;  1B9N A;  4KN7 X;  2DTR A;  5J6X A;  2VC1 A;  2FF4 A;  3BJA A;  1XCV A;  1I1S A;  4EGY A;  4M6Y A;  2GAU A;  2V9V A;  2PJP A;  2QWW A;  4L5J A;  2HKO A;  3BP8 A;  3RJP A;  3JW4 A;  2VON A;  4CZZ A;  3ELK A;  2A6E F;  4XRF A;  5D6E A;  2P6S A;  1R58 A;  4UNO A;  1UHW A;  4HZF A;  4ESJ A;  1SD6 A;  5D6F A;  5L3B A;  3BPX A;  1HKQ A;  3HHH A;  1J75 A;  4HV5 A;  5EEH A;  1EH8 A;  1FC3 A;  2Z3Y A;  4EV0 A;  5D5V B;  2E1C A;  4B09 A;  4MQV A;  2HR3 A;  1B9M A;  2ZME A;  3E6M A;  3GEZ A;  5H6R A;  5K5R A;  2PQ8 A;  3WGG A;  2JRT A;  1F5T A;  4CGZ A;  3H3Z A;  5LHH A;  4IHT A;  2XRN A;  1IN4 A;  3QOP A;  1MJ9 A;  3EYY A;  5E20 A;  1Y0U A;  1RI7 A;  1IRG A;  3O3K A;  2LDU A;  2OQR A;  4UVC A;  4DNC A;  1P6R A;  1IN6 A;  2HQR A;  4UVB A;  2MC3 A;  1FBQ A;  2VBX A;  4L9T A;  2GQQ A;  1FSE A;  5FB2 A;  4BH9 A;  2D1H A;  1SD5 A;  2DI3 A;  1WKM A;  1IN8 A;  1G3T A;  3BZ6 A;  2ZNY A;  4OIO F;  2X0L A;  2QM3 A;  3BWG A;  2VBY A;  2O8X A;  1PP8 F;  4ENJ A;  1MDM B;  4ZYD A;  4NQW A;  2H09 A;  5IT9 K;  3TOA A;  3F6V A;  2P7V B;  5BOX A;  4WXD A;  3I0T A;  1P4X A;  3FZV A;  3PQJ A;  2XGX A;  3TDU C;  5F6F A;  5AON A;  4ESF A;  1Z6T A;  1F1Z A;  4BYY A;  4AD9 A;  1SMT A;  1LDJ A;  1U6G A;  2P5L C;  1FBU A;  2CQK A;  3HOT A;  1CGP A;  3VOD A;  2F5C A;  3WE3 A;  3GFJ A;  2XAQ A;  4CDG A;  2R3S A;  4I98 B;  4G94 A;  4KFC A;  3DFG A;  2TDX A;  1G6N A;  2EV0 A;  2ACJ A;  4HV6 A;  3U9G A;  2Q8K A;  1ZG5 A;  4GYI A;  3WU0 A;  3KP6 A;  3HIF A;  5L3G A;  3IWF A;  2L02 A;  2K7L A;  1WQ2 A;  2XUB A;  3FXQ A;  2IJL A;  3F8N A;  1MJA A;  3ERE D;  4LLN A;  2DU9 A;  4I01 A;  3ROU A;  5CYV A;  3HUG A;  5CJ9 A;  2VBZ A;  2IA0 A;  3QU3 A;  1KYZ A;  1DP7 P;  1BIB A;  4Y13 A;  2Y75 A;  3S2W A;  2WV0 A;  3K1P A;  4BNC A;  1USS A;  4KIC A;  2FOK A;  4RGX A;  3D5L A;  3DPT A;  1TW3 A;  4R8H A;  2LF7 A;  2Q2E A;  1DDN A;  5DUI A;  1IW7 F;  2YPR A;  3EQL F;  3RPQ A;  2JPC A;  1GVJ A;  2IA1 A;  4DQ2 A;  3WTS C;  2Y48 A;  4GCV A;  4YII A;  6PAX A;  3NQO A;  1FNN A;  3BDD A;  1BI2 A;  3ZMS A;  5LHI A;  3LA7 A;  1U78 A;  1ZG1 A;  4UV8 A;  2P6T A;  5L3F A;  2DT5 A;  4KYW A;  1HBX G;  4NHJ A;  1P2F A;  4M9S A;  1JGS A;  1Z9C A;  1MGT A;  5JFR A;  2DK5 A;  2EJR A;  1LVA A;  2Y0M A;  2OZ6 A;  3GUD A;  2P5K A;  3GLX A;  2DO7 A;  5DD8 A;  1REP C;  3C3W A;  2X4H A;  1V4R A;  3P9I A;  1H9T A;  2LNB A;  4A6D A;  4FX0 A;  2EFQ A;  1O7F A;  2P5V A;  1B4A A;  1XN7 A;  1BI0 A;  3KLO A;  4B8X A;  3Q5F A;  2V79 A;  4ENK A;  3CJN A;  3C1D A;  2WTE A;  1YFH A;  5ICG A;  1W5S A;  1WI9 A;  1YTY A;  2PMH A;  2PFB A;  1SFX A;  3ZMT A;  2H94 A;  1A04 A;  3M8E A;  3WOD F;  5E17 F;  3KE2 A;  1KGS A;  1KQ8 A;  1J2X A;  3LA3 A;  1LNW A;  3RDI A;  1YW8 A;  4EJT A;  2D1V A;  4EJO A;  5HVQ C;  5DCM A;  4ASN A;  1TTY A;  1RZ4 A;  3T0Y A;  1MJB A;  3CUQ A;  3SZP A;  2ETH A;  2VT2 A;  1CF7 A;  3RYP A;  3F6O A;  5LGN A;  1U5T C;  3TOB A;  2RC4 A;  1STZ A;  1K78 A;  4CXF A;  2RVC A;  1XDU A;  2UXX A;  4M9X A;  1TQP A;  3FMS A;  3T5X A;  1ON2 A;  4EVI A;  1B59 A;  2PN6 A;  3GWZ A;  4KNY A;  4XSZ F;  3GFI A;  1D8K A;  2HGC A;  1SD7 A;  1DPR A;  2WC2 A;  3VB2 A;  4AIH A;  2QEN A;  2FEZ A;  4P5O A;  4QWQ A;  1E17 A;  3CLO A;  2EA2 A;  3K69 A;  4IPA A;  5DDG A;  1R22 A;  5LLQ A;  1S29 A;  1KA8 A;  3K1M A;  5CVV A;  2XKP A;  4ZH4 F;  3I71 A;  2L01 A;  2RDP A;  4XLN F;  3LAJ A;  5CVI A;  1ZGA A;  1UB9 A;  4U0W A;  1ZH5 A;  3LQR A;  3E5X A;  1YO5 C;  3CO6 C;  1BI3 A;  2EA4 A;  4RB0 A;  3RTR A;  1LB2 A;  3F3X A;  3GXO A;  4A5N A;  2XAF A;  4IF4 A;  4XSX F;  3T1B A;  4MQ9 F;  2GXG A;  3F22 A;  1I1G A;  1G3W A;  1AWC A;  1R7J A;  4ZZD A;  2HS5 A;  2O3F A;  1YW7 A;  4A6E A;  5HS8 A;  1QZZ A;  4Y17 A;  2D45 A;  1R23 A;  1YYV A;  2OAZ A;  2O03 A;  2F2E A;  3RPU A;  1SAX A;  2BGC A;  2HOE A;  2E7W A;  2H6B A;  3KZZ A;  2P8T A;  2NAZ A;  3RYR A;  4ZZL A;  3V7S A;  5HLI A;  1JHF A;  3T8R A;  2W57 A;  3CTA A;  2XRO A;  2KRF A;  2ZO4 A;  2VN2 A;  4MEX F;  3F8M A;  3R61 A;  1PP7 U;  1MDM A;  1U8R A;  2JT1 A;  1LDD A;  4GYG A;  5KK1 A;  4CYD A;  4L9V A;  2W84 A;  5CVR A;  2V1D A;  1S7A A;  2B0L A;  2HZT A;  5DD4 A;  4U0Y A;  3FXR A;  3GYH X;  2HTJ A;  2YU3 A;  5LEK A;  2EV6 A;  4MTE A;  1TQI A;  2RNJ A;  5ICE A;  1D5V A;  2QQA A;  1JXS A;  2HDC A;  4PCQ A;  3HRT A;  1FP1 D;  2FMY A;  1FSH A;  4KIB A;  4PGH A;  3BRO A;  1TBX A;  3WE2 A;  3EYI A;  4EM2 A;  2ADU A;  2ZXJ A;  2PEX A;  3SFZ A;  3V4G A;  1QO0 D;  5K5O A;  2LSO A;  1KQ0 A;  2BE5 F;  5IT3 A;  4I7H A;  1FOK A;  5LRR A;  3BJO A;  1IAW A;  1KU2 A;  4AWX B;  5FFX A;  4LLG F;  1K79 A;  2CW0 F;  3IWZ A;  2CSO A;  1XSX A;  3F8F A;  5E1W A;  2FQ3 A;  5BQT A;  2H27 A;  2NNN A;  3OOP A;  4OIR F;  4RGU A;  3VFZ A;  4LK0 F;  1IXS B;  2QLZ A;  2IA2 A;  5H20 A;  4HAM A;  3QRF F;  3OV8 A;  3SQN A;  2EK5 A;  1ZYR F;  5JHU A;  2HWV A;  4FHT A;  3KEO A;  3K2Z A;  2IT0 A;  3JSO A;  3KP7 A;  2YX4 A;  4I0B A;  4M74 A;  1UHM A;  1J7K A;  2W24 A;  4G9Y A;  2A07 F;  4EM0 B;  4UUV A;  2V1U A;  3RKX A;  1BJA A;  5BPD A;  3WTY C;  3MWM A;  2ISZ A;  3HRS A;  4NB5 A;  1FWZ A;  3KEQ A;  4FT8 A;  2RQP A;  2RN7 A;  4EQQ A;  4Q47 A;  3TO6 A;  4A0Z A;  3IRR A;  2QVO A;  1Z05 A;  1R5H A;  3M7G A;  3AAF A;  1LDK B;  4UHT A;  4U7B A;  1JHH A;  2F5F A;  3CO7 C;  5L3D A;  1KYW A;  4MNU A;  1O3Q A;  3WGI A;  4L18 B;  1HST A;  3PQK A;  2R7F A;  4BHP A;  5D8K B;  1PDN C;  1EV7 A;  4KIG A;  4LK1 F;  4HX4 A;  1XB4 A;  2JSC A;  3M8F A;  1I5Z A;  1XGN A;  4HDU A;  4P55 A;  4IXA A;  2K02 A;  2Z9O A;  4WF2 A;  5FLX Z;  1BM9 A;  5K5Q A;  1BOA A;  3HSR A;  2EFN A;  5ILV A;  4RAZ A;  3R0A A;  2MBF A;  2EFO A;  1ZG3 A;  3HSE A;  2A5Y B;  3IC7 A;  3B73 A;  1FYM A;  1WRJ A;  2G7H A;  2XAG A;  5E18 F;  4IJA A;  2UXN A;  1QZY A;  3JSP A;  1BC7 C;  5BS6 A;  4PGG A;  1O3T A;  1S3J A;  3DPL C;  3KFW X;  4OMZ A;  3ZQ7 A;  3MAJ A;  3L7W A;  4OIN F;  1G3S A;  4KT5 C;  2R7D A;  1J0R A;  2WWY A;  4RB2 C;  4HW0 A;  1S7O A;  3DP7 A;  4A0Y A;  1F9N A;  3MZH A;  1FZP B;  1U5T B;  1XMA A;  1E2X A;  5ICF A;  1ON1 A;  4L0Z B;  2AXL A;  3EDP A;  3SXY A;  2L4A A;  5FD5 A;  3HSF A;  3FMR A;  1RNL A;  4MHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...