3BJOA

Crystal structure of the c-terminal domain of a possible atp-binding protein from methanocaldococcus jannaschii dsm 2661
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
103
structure length
103
Chain Sequence
SNALKDVLNILLMDEISKLKDFLSNLDYIKPKVNIEEEIIEIRKEDIINALKLFKGKYEIEVDKIPKAVYVYLVKKNILFLYPQRGTLKPQSFLVWNAIKRVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Nucleotide binding protein
molecule keywords Uncharacterized ATP-binding protein MJ1010
publication title The structure of the C-terminal domain of a possible ATP-binding protein from Methanocaldococcus jannaschii DSM 2661.
rcsb
source organism Methanocaldococcus jannaschii dsm 2661
total genus 31
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2007-12-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3bjoA00
1WSUA 2WTEA 2RKHA 4OIOF 3WE2A 1P2FA 3I5UA 1OPCA 1HXDA 5K1YA 2KIMA 1XMAA 4EMSA 2P7VB 3NQOA 1UHWA 2V6CA 3GEZA 5BPDA 3F3XA 2DU9A 5BMZA 1YLFA 4PDKA 2YX4A 3CDHA 4KN7X 5DD8A 4EJTA 3IWZA 5JR3A 4U7BA 5DD4A 3WTVC 3RJPA 1F4KA 4LG0B 2BYVE 5ILVA 1XSDA 3OOPA 3TOBA 2OQGA 2ZMEA 4LGWA 3C7JA 2GWRA 3FXUA 1F9NA 3V7CA 6PAXA 4ESJA 3QU3A 2ISZA 1U5TB 4XLPF 4GCVA 3D5LA 3KEQA 4L18B 4OIPF 2GXBA 1ZLJA 2IW5A 4HDUA 3VEPA 3ZN1A 1G3WA 1MGTA 3TO9A 4N0BA 3LQRA 1S7OA 3BOQA 5F6FA 3N97A 1XGOA 2Z3YA 1S29A 1KU9A 1FPQA 3BJ6A 3C3WA 4IXAA 1STZA 5JVTA 1HQCA 4EJUA 5LBQA 3U1DA 3GZ5A 4M9ZA 4Z2YA 5DCMA 1G4DA 2EA4A 2V1XA 5FO5A 2PBIA 2XASA 2XUBA 5E17F 3IRQA 3K69A 3V4GA 5D8LB 1YO5C 1ZRDA 3ZPLA 2HYFA 3H3ZA 3EYYA 1B6AA 2BE5F 1ZN2A 2O6GE 4BYYA 5EEHA 3HRUA 5K5QA 3K0LA 3T5XA 5K5OA 5HS7A 5L3FA 1O7FA 1P6RA 4HF0A 5H6RA 2ZKZA 1H0MA 4HBLA 2KIFA 3I59A 1IAWA 4KA4A 3GZ6A 3D0SA 1WKMA 3H92A 2ZO4A 1OKRA 3DPTA 2FOKA 3J81Z 2WV0A 1OMIA 1YTYA 1ZLKA 4EGZA 2OBPA 3E6MA 2PI0A 4CICA 4RGRA 4ESFA 3F8FA 5LRRA 2HQRA 2PQ8A 1UCRA 1G3SA 1S3JA 4LLLA 2QBYA 5ILUA 1FBUA 5FB2A 1HKSA 3T8RA 1RIOH 4OMZA 1J0RA 5L3DA 2ZFWA 5JI6A 2COMA 2ZXJA 5HDKA 5E1XA 2K4BA 2YX7A 4M6XA 1TTYA 1QGPA 1ZG5A 3EQLF 1G3TA 4HV6A 1DPUA 4R79A 2XAFA 3TOAA 5D5VB 2KKOA 3T0YA 2OQRA 2ZCWA 3LA3A 3KP7A 5H6QA 1W4MA 1ZARA 3WTSC 2VE9A 3JSPA 3FM5A 5J6XA 3V8KA 1LDKB 1IRGA 3L09A 1TNSA 3SQNA 2DW4A 3REOA 2DO7A 4M71A 1Z9CA 5DUKA 2HS5A 2LNBA 2F5EA 3ML6A 1SMTA 2EFWA 2NAZA 4XSZF 4BHCA 1QZYA 4KDPA 3IKTA 1XB4A 1KU3A 2NRAC 3W6JB 1MZBA 3EDPA 2FSWA 2VOPA 1ULYA 4G9YA 5A2QK 4PZJA 2DAOA 3S2WA 4Q4ZF 2HKXA 1IN7A 2EFQA 2EFPA 1KQ0A 4CYDA 1IN8A 5CVJA 3ABUA 4B09A 2HR3A 3NEUA 2L4AA 3ZMZA 2JPCA 2VBWA 4HYEA 4XBFA 2LF8A 1P92A 3H3UA 1HKQA 1XDUA 2FA5A 2H09A 2GQQA 1OYWA 3DFGA 2M30A 1R1UA 4BHBA 1ZREA 3BJOA 2GXGA 3HRMA 3WGHA 3RYPA 1EH7A 1HKTA 2FNPA 1DDNA 2RVCA 5HS9A 2RGVA 2HWVA 1V4RA 3BPVA 3I4PA 5DV5A 4D0PA 3WTUC 2YPRA 3V7RA 3JTGA 2RV8A 3EUHA 3ZMTA 4F7ZA 4HX8A 4ASNA 5ICFA 1FWZA 1EV7A 5HS8A 4NB5A 3J81K 2XGXA 4IHTA 4HQEA 2MH2A 1G3YA 1C0WA 1ZH5A 5L3GA 1GHCA 2W25A 1JXSA 4LK1F 3HIFA 1BC8C 2CSOA 2K4JA 2IA1A 5LLQA 4AWXB 4WX9A 2HQNA 1I27A 1SD4A 4WK8F 1ZYRF 3RPUA 4G7OF 2CO5A 3KZYA 1R58A 4IF4A 3VOEA 4Y15A 1T6SA 2RNJA 1SFEA 2DQLA 3G73A 5LGUA 2DK5A 4R1HA 1KYZA 3QP5A 5ICGA 2VN2A 5FLXZ 2VOOA 3HOTA 1GXPA 1LB2A 4AVPA 1R7JA 1Z05A 1CGPA 2A3SA 3I53A 2H6CA 3ECOA 3PFIA 2NNNA 1FLIA 1GVJA 1ZRCA 4WCGA 1KU7A 4EJOA 4BXUA 4OMYA 1LDDA 2ISYA 4MNUA 5DCFA 1Q1HA 2EK5A 4M73A 1FOKA 5LGTA 2P5KA 3HHHA 2FBHA 4CXFA 1PP8F 2PLYA 2A6EF 3BZ6A 1QNTA 3BJAA 1IN5A 3RI4A 4UNOA 4G94A 5HVQC 4LK0F 4MGRA 3JAMZ 5DUIA 4QWQA 3TDUC 4Q47A 4UV8A 4HA8A 2JTVA 4BQAA 1ON2A 4UXNA 5FFXA 2PJPA 1SD5A 4M6YA 2STTA 1U3EM 2R7FA 1T0FA 2L3DA 1I1GA 3WGIA 3WU0A 5HLIA 1CF7A 2FBIA 2HYGD 1UFMA 4A6EA 3HTUA 3QAHA 2FNAA 5KK1A 1USSA 3CJNA 1Z91A 1BIBA 3GFJA 2XVCA 2W84A 4NHJA 4BAYA 4I02A 4UVAA 3E6CC 3LAPA 4L9TA 4AD9A 1YW7A 1T2KA 4JBAA 2R7DA 1RI7A 4A0ZA 3GYHX 1MDMB 2DFIA 4YG2F 3KZZA 3KLOA 3R0JA 3VODA 2EFNA 2EV6A 4PGGA 5D4SA 4A12A 1R00A 3VFZA 4MHGA 3MAJA 3LFKA 2O8XA 4ENKA 2CW0F 3T8TA 1S7AA 4WF2A 2G7UA 1HBXG 3RKWA 2LSOA 3FXQA 3NRVA 4EV0A 1YFHA 1U5TC 2E1NA 1P4XA 3CLOA 3GO5A 1K78B 5HOOA 2IT0A 4LJZF 4AIJA 1R1TA 4I0BA 4ENNA 4HLYA 3C1DA 3GFLA 4CO8A 2MBFA 2IJLA 5CJ9A 4ZH4F 2O3FA 4FX0A 3FX3A 1BIAA 3EETA 5D4RA 2VONA 2K27A 3DV8A 5CLSA 4JK1X 1R23A 3ELKA 5A2QZ 2STWA 1PP7U 3E6BA 4OIQF 1X3UA 1P4AA 4IVNA 4RS8A 5D6EA 1O57A 4ON0A 1F5TA 4EM1A 3LWFA 5FLXK 2E7WA 4RAYA 3MQ0A 2D45A 3SXYA 1D8JA 5BS6A 4Y13A 1W5TA 3ZMDA 4LFUA 1S6LA 2W24A 2Q8KA 2ADUA 2M1BA 4WXCA 4A5MA 1ZGAA 2XAJA 1SMYF 2KIUA 3TQNA 1J5YA 1MJBA 2ZMEB 1IXRC 2BV6A 5E1WA 5FFZA 3F8MA 2JRTA 1I6XA 3ZMSA 3IKVA 3GF2A 1UHMA 3V8LA 5LHHA 3GWZA 2XAGA 4HOBA 3V7SA 3COAC 4XRFA 3JAMK 4RGXA 2L54A 2IVMA 1FSHA 3HSFA 2F2EA 3QPTA 4ETSA 2FBKA 4WXDA 2L01A 2VC1A 1LJ9A 2V1UA 2P4WA 1RZ4A 2ELHA 2VT3A 2K7LA 3TO7A 1B9NA 1J75A 5DCMB 3RIRA 2QQAA 4U88A 4RB2C 4L0YB 5AIPA 2Z99A 2Z33A 3WTZA 3N4MA 4DQ2A 1IZ1A 3TGNA 2DPDA 4EGYA 3BP8A 3M1EA 2G7HA 3CTAA 4L0ZB 3SFZA 4IRHA 4P96A 5F1RA 3FF5A 4ZYDA 4FHTA 1SD6A 2AS5F 4LB5A 1ZG3A 3GFMA 2ACJA 4N9IA 5DDGA 1FYMA 3I59B 5TRDA 2CGPA 5D5WB 1TQMA 4ZYHA 1SFUA 1J2XA 3TO6A 4K2EA 4RAZA 5IT9Z 1E17A 2LF7A 5LEKA 5K5RA 1UB9A 2CQKA 2ZNYA 4CHUA 1TBXA 1O3SA 4IPAA 4BHPA 1JHHA 1U8RA 1A04A 1MKMA 4HF1A 2H94A 1USTA 4P9UA 3DPLC 4YFNF 2FXAA 3IHUA 1V3FA 1H9TA 2XKOA 1IF1A 2J5OA 2QBYB 3DEUA 3CO6C 1R5HA 2PMHA 2GAUA 4UHTA 5FD6A 1ONVA 2PEXA 3R61A 4ESBA 3KFWX 2Q0OA 4G7ZF 4KFCA 2RC4A 1FSEA 3WG9A 3LSTA 5D8KB 5LHIA 1FT9A 2UWMA 3QOPA 5H20A 4AIKA 3DQVC 2UZKA 2QZ8A 3MFKA 3IRRA 2NNYA 2QVOA 3E97A 3F22A 4WWCA 4CZZA 3WODF 2Y75A 3K1PA 3CUQC 1KQ8A 2VC0A 3WU1B 4U7DA 1Z7UA 2ETHA 2KJCA 4GYIA 1FX7A 3L2CA 2GZWA 3ISPA 3RKXA 5E8GA 1GXQA 1R22A 5F64A 1D8KA 3ERED 2PMUA 2QWWA 2EJRA 5LEJA 2HTSA 4ENJA 3K2ZA 2VBZA 1TLHB 3F8NA 5AONA 1KQ9A 3JW4A 4PGHA 5HDNA 4FT8A 4EQQA 3FMSA 1W7PD 2F5FA 1FYKA 2ZJ2A 3CO7C 3I54A 4A0YA 3LAJA 3E5QA 3E3VA 2VBYA 4A2UA 3JSOA 3GFIA 1IXSB 2M87A 4KIFA 1RUOA 4HQMA 2IRFG 1IXCA 2MA3A 1O3QA 3MZYA 3WE3A 2OZUA 1VTNC 2JZYA 3I0TA 4R8HA 2HEOA 3ULQB 2W85A 4YIIA 2FMLA 4MEYF 2F5CA 2QLZA 3OV8A 3HTSB 2CWEA 5E1ZB 4ENMA 3QRFF 1K6OA 5J8FA 2QENA 3GVAA 4GYGA 2HTJA 4G6QA 3J80Z 2DLLA 3KE2A 4UVBA 1ZHFA 3C18A 5L3CA 1PUEE 3P9CA 1MJAA 1LNWA 4EM0B 3LQQA 1BI2A 4Q5SF 4YFXF 1TW2A 3MWMA 4HX4A 4M9XA 4L9NA 4M9SA 4EJWA 3BWGA 2DTRA 1YG2A 4QLCU 1ZAOA 1K7AA 1FYLA 3WTYC 3K9TA 2DQRA 4LLNA 3RKYA 2DK8A 3BDDA 1O3RA 3F23A 4IRGA 2RDPA 1AWCA 5JHUA 2XHKA 5IT9K 1XD7A 2MH9A 1I5ZA 3V8JA 3K1MA 2X0LA 4KN4X 3BPXA 1W7PA 3KLNA 3ZN0A 2PN6A 3SHFA 4IHSA 1EH8A 1O7LA 1XN7A 2EB7A 2P5VA 5ERIA 1XGSA 2FU4A 3IL2A 3E5UA 1BI0A 2A5YB 1P4WA 1JHFA 1T39A 4HF2A 1OYYA 3QU6A 2KRFA 1EH6A 2L02A 2ZNZA 3L00A 4FX4A 2QM3A 3HUGA 2JPBA 3FMQA 5TJJA 3B02A 4ZZLA 4HAMA 2HKOA 3VB2A 1LEBA 3WTXC 1QO0D 4UUVA 4LG0A 1U78A 2Z9OA 3W6KB 3IC7A 2YR2A 2E1CA 2V9VA 4P55A 2QYOA 2L4MA 4KNYA 5E8IA 4JQFA 1U5TA 1Y0UA 4RB0A 4I2OA 2DBBA 3WTTC 1BI3A 1W5SA 1O3TA 2D1HA 2F5DA 3U2RA 2MLGA 4DNCA 1SAXA 4CGZA 3F8CA 1BC7C 2Q2EA 5FD5A 3K1NA 5ICCA 4HX7A 2AXLA 3RTRA 3HRTA 2W57A 1L0OC 2O03A 2RQPA 3FWEA 2HZTA 5CVRA 2H6BA 4IJAA 4OIRF 3RYRA 4M74A 2XKPA 1TNTA 4ZZDA 3R0AA 2ZBKA 4S05A 2EA2A 3PQJA 1XGMA 1ON1A 4OINF 1CF7B 1B4AA 2V79A 1QPMA 2M8EA 3M7GA 1BOAA 3M8EA 2CG4A 2OA4A 2J5PA 4H0EA 1PDNC 2G9WA 5AIQA 1B9MA 1IW7F 4HZFA 3J80K 1FNNA 1SFXA 4MTDA 1J7KA 1QQIA 3HSEA 5CVVA 2ESHA 4A5NA 2XAQA 2D1VA 2MD5A 3WTWC 2H27A 2FQ3A 3KP4A 1MJ9A 3R4KA 1HSTA 4XLNF 3ZP5A 1T38A 4E70A 2FEZA 2IA0A 1D5VA 3ZQ7A 2VXZA 4HV5A 2ESNA 2FMYA 1L3LA 3KP6A 4KMFA 3ABTA 2XROA 2GIVA 4GXOA 4MQVA 2M45A 2OU2A 3FMRA 3TDZC 3BY6A 3ZMVA 2HOEA 3HYIA 2A69F 1JGSA 4KYWA 3FZVA 2QUFA 1FP2A 1XSVA 2B0LA 2A68F 4L9VA 4L9JA 4N9HA 1QZZA 1ZG1A 1F1ZA 1IRFA 3LA7A 4U0WA 3T1BA 1Z6RA 1IN6A 4KIBA 3RDIA 1FBQA 1FY7A 3IWFA 3CUOA 2MLKA 5L3BA 2YSRA 4UVCA 3AAFA 2K86A 1MD0A 3HSRA 3O6BB 3DXJF 3KCCA 2VODA 1XGNA 3HRSA 2GA1A 5DEQA 2DI3A 1BN5A 1S8NA 2EV0A 1FZPB 3Q9VA 2Y0MA 4U0VA 1AOYA 4KMUX 3M8FA 5FGMA 2QQ9A 4I01A 3ECHA 1KYWA 1LDJA 1HW5A 4L5JA 1TQIA 1XSXA 3BROA 1YS7A 1YQAA 1YW9A 3GLXA 1BBYA 4HDVA 5HLHA 1BJAA 3I58A 1BM9A 2DT5A 1XDSA 2OD5A 3MZHA 3F72A 2BEOA 1BI1A 3RPQA 3GX4X 1WRJA 1ZRFA 4YIFA 4YFKF 2OZ6A 3LA2A 2WC2A 5L3EA 2XIGA 3P7NA 3GW2A 1RNLA 2BGCA 4O6JA 4A6DA 3M9AA 1DUXC 4KT5C 2KJBA 4WXHA 4RB3C 4EJVA 1DPRA 4L5IA 3DKWA 1DP7P 3DF8A 4RGUA 3KEOA 3E6DA 1WI9A 3KETA 1NHAA 1K79A 1YW8A 1KA8A 3F21A 4LB6B 2XAHA 3O2PE 3EYIA 3MCZA 2VT2A 3HHGA 3CUQA 1REPC 3E5XA 5LGNA 1ZGJA 2QQBA 4P9FA 1G6NA 4LLGF 2GA2A 1LVAA 1XMKA 2P6TA 3P9KA 2R3SA 2P6SA 3GXOA 3DP7A 1J9IA 1B59A 5HLGA 3ZMUA 3GUDA 4EM2A 3O3KA 4P5OA 3Q5FA 5J8CA 2V1DA 4LD5A 1U2WA 4TV7A 1HSJA 4B8XA 1YYVA 4ZYGA 1FP1D 4O3MA 2XRNA 1B1BA 5ILSA 2PG4A 5CYVA 4MEXF 2A07F 3KP5A 4M72A 4S04A 4BH9A 2JSCA 5LRSA 4GO1A 4G8XA 2VE8A 3FHZA 1LQ1A 4OU0A 2PFBA 2IPQX 2UXXA 3KP3A 2EWNA 2MC3A 5CVIA 2LDUA 1XCVA 1E2XA 1Z1DA 1I1SA 1TQPA 5E20A 1HW2A 3WGGA 3CUQB 2K02A 2Z5UA 3J7AO 4O5VA 3P9IA 2YU3A 3I64A 1J59A 2P7CB 4MTEA 4I0AA 1TW3A 2CFXA 3QP6A 1OR7A 4G7HF 2OAZA 3TKYA 5BOXA 4BNCA 2HGCA 3U9GA 2LKPA 2Y48A 2P5LC 3JTHA 4KIGA 3B73A 1R1VA 1JE8A 2NYXA 5HDGA 4G6DA 3Q9SA 4IRIA 3MEXA 3SZPA 4RB1A 4RGSA 1SD7A 2XV4S 1QBJA 2E7XA 4KICA 2JT1A 5CVUA 3F8BA 4UV9A 1HW1A 3I71A 5BQTA 2FE3A 4PCQA 4A0XA 5E18F 5D6FA 5BPIA 1RUNA 4CDGA 5LHGA 3FXRA 2FRHA 4ZYEA 2A6HF 4U0YA 1R36A 2UXNA 1FBSA 1OYIA 2HFHA 1R5GA 5IT3A 2EV5A 1D3YA 2DPUA 5JFRA 1ODDA 4OOIA 2D2WA 2CYYA 1IUYA 3QPHA 1WWXA 1XCBA 3FM3A 4I7HA 4HLXA 3PQKA 1H9GA 3KP2A 2FF4A 2A61A 2WWYA 5ICEA 2BBYA 3R6SA 2IP2A 1WQ2A 2O61A 3L7WA 5D5XB 5D5UB 1MDMA 2P8TA 4HW0A 5KVRA 3F6VA 4XSXF 4NQWA 4Q48A 2M5WA 1YS6A 3ROUA 3L9FA 5ED4A 4KUMA 2O0YA 1FC3A 4MQ9F 4LMYA 4I98B 3F6OA 2TDXA 1KU2A 3G3ZA 1K78A 3R60A 4Y17A 5DYMA 1Z6TA 2NS0A 3SZTA 1KGSA 2C6YA 2VBXA 2IA2A 1IN4A 2EFOA 4I09A 4EVIA 2HDCA 1U6GA 1W7PB 3HOSA 5EEGA 1LEAA 2X4HA 1YIOA 4AIHA 4GGGA 2RN7A 1T98A
chains in the Genus database with same CATH superfamily
1WSUA 2WTEA 4ITVA 3F9KA 4L5EA 2RKHA 3ASOH 1EJ9A 4OIOF 3WE2A 1P2FA 1QHHD 3I5UA 1OPCA 1DGWY 2L0KA 1HXDA 5K1YA 2KIMA 1XMAA 3KX2A 4EMSA 2P7VB 2XGEA 3NQOA 3F0CA 3JCUC 5BNGA 1SVOA 1SVMA 1UHWA 2V6CA 1T0FC 1MNEA 2VI6A 3BR1A 1ZTRA 3GEZA 4XRSG 1OCPA 5BPDA 2KQRA 3JRAA 1FOXA 3DEWA 1MBEA 3HUGB 4UUSB 3GBGA 3F3XA 2DU9A 3A01A 2LR8A 5BMZA 1YLFA 4PDKA 2YX4A 3CC2I 3CDHA 2VQLA 4KN7X 2JUGA 1POGA 2A05A 4ZDPA 5DD8A 4EJTA 3HOZJ 2WAQA 1ACIA 3IWZA 5JR3A 4U7BA 1F36A 5DD4A 3WTVC 3RJPA 1MNDA 1F4KA 3W2WA 4LG0B 2BYVE 5B5EC 2DMNA 5ILVA 1XSDA 3OOPA 3TOBA 2OQGA 2ZMEA 3JRBA 1N78A 1X1BA 4LGWA 5IPAA 2E60A 1WPKA 3C7JA 2GWRA 5IOZA 2VJ5A 3FXUA 3ERMA 3UNGC 1F9NA 1ZR4A 2HOSA 1EF4A 3V7CA 4S0HB 3J7ZI 6PAXA 4Y7NJ 2N8GA 3QU3A 4ESJA 2X6WA 2ISZA 4C3IJ 1U5TB 2QKLB 3I9V2 3ZGKA 2P0WA 4XLPF 2B63J 1MBKA 3H1CA 3LNQA 4XOPA 4GCVA 3AG2H 3DU6A 3D5LA 3KEQA 4L18B 4FTHA 5CQGA 2IGNA 2LG4A 4OIPF 3CCVI 2Q2EB 2GXBA 1ZLJA 2IW5A 5E79C 2M3AA 4HDUA 2E5ZA 3VEPA 3ZN1A 3NWTA 3SDBA 5KCMA 1G3WA 1MGTA 3TO9A 4N0BA 3LQRA 1S7OA 2GIZA 3BOQA 5F6FA 2L9VA 3N97A 1ORKA 2VASA 1XGOA 2Z3YA 2WB1A 1S29A 3HKZA 1VQNI 3GTQJ 1KU9A 1FPQA 3BJ6A 2L5QA 4MFDA 3C3WA 2W48A 4IXAA 2PX9A 1STZA 5JVTA 1HQCA 3OR1C 4EJUA 3U1DA 5LBQA 3GZ5A 1HC8A 4M9ZA 4Z2YA 2E2IJ 5DCMA 1G4DA 2EA4A 5EJCA 2V1XA 5FO5A 2PBIA 2XASA 2XUBA 5H2FC 3PO3J 4YELA 5E17F 3IRQA 3K69A 3V4GA 5D8LB 1YO5C 1T95A 2CUZA 3BR5A 2PJRB 1ZRDA 3ZPLA 1ZQ3P 2HYFA 2LD5A 4KITB 1TWCJ 4B3AA 2Z16A 4E7ZA 3H3ZA 3LSPA 3EYYA 2R92J 5TGTA 1B6AA 3CZ6A 4CH7A 1MBHA 2DODA 3CCYA 1T33A 5JHFA 1D0XA 3OYKA 2BE5F 4HSRA 1ZN2A 2O6GE 4BYYA 5C4JJ 5EEHA 2F48A 3HRUA 5K5QA 3K0LA 3CD6I 2QEXI 4RBOA 3T5XA 5K5OA 2DN0A 2LKSA 5FKMA 1ETQA 5HS7A 4B4CA 5L3FA 1O7FA 2XPUA 4ZC3A 3JRGA 1D5YA 1P6RA 1JTXA 2LKXA 4HF0A 5H6RA 2CUEA 2ZKZA 3BG3A 1H0MA 4HBLA 2KIFA 3I59A 2AO9A 1IAWA 4KA4A 3GZ6A 3D0SA 1WKMA 3H92A 1IDYA 2ZO4A 2DFEA 1IGNA 1WJEA 1OKRA 1TZLA 1W36C 3DPTA 2HDWA 5EYRA 4NDLA 1YE9A 2FOKA 3QPLA 3J81Z 3AL0C 3K4CA 2WV0A 3HEFA 1VQ7I 2I5UA 4BJ6C 1OMIA 1YTYA 1ZLKA 2M34A 4EGZA 2OBPA 2ZXIA 3E6MA 2PI0A 1IJWC 1OISA 4FE4A 2NVQJ 2I10A 4BQQA 4CICA 5KNLA 3PJRA 4RGRA 2ZSIB 4ESFA 3F8FA 5LRRA 2HQRA 2WAEA 3VYSB 2PQ8A 3ZQFA 1UCRA 3KPHA 2DA4A 1SFOJ 3LSMA 1JJ6C 1G3SA 1S3JA 3ZQGA 4LLLA 2QBYA 4PJMA 2LY2A 4X1EA 5ILUA 2JA7J 1FBUA 3GTLJ 5FB2A 4BQNA 2B9SA 1HKSA 1QU3A 3T8RA 1RIOH 4OMZA 1J0RA 1U0JA 4QPOA 4IO9F 5L3DA 2RAEA 2LP0A 4II3A 5M3FJ 1XS9A 2ZFWA 3GCMA 5JI6A 1BR4A 2COMA 3UR3C 2ZXJA 3RCOA 5HDKA 5E1XA 4RLFA 2K4BA 2YX7A 2JJ7A 4M6XA 4D7MA 2HQAA 1TTYA 1QGPA 1ZG5A 3EQLF 3HGGA 1G3TA 3K4BA 1D1CA 4HV6A 1Y6IA 1DPUA 4R79A 2XAFA 3TOAA 5D5VB 2KKOA 3T0YA 1HDDC 3K4LA 2OQRA 2ZCWA 2JA8J 1IV8A 3LA3A 3KP7A 3LSKA 2IBDA 1BR2A 5H6QA 1MMAA 1W4MA 1VNDA 1ZARA 1Y1WJ 3WTSC 2VE9A 2CUJA 3JSPA 4JOMA 1Y39A 3FM5A 4M3EA 1JKRC 1MMGA 1F43A 1RKTA 5J6XA 3V8KA 3AKZA 1LDKB 1IRGA 1ETYA 1TNSA 3L09A 2DW4A 3REOA 3SQNA 2VQHA 2DO7A 1G59A 3DEEA 1I39A 4M71A 4BKXA 1Z9CA 1X4PA 5DUKA 5DTDA 3BQZA 2HS5A 3Q0UA 2LNBA 1FMVA 4JYKA 2F5EA 3ML6A 1SMTA 2VL8A 2NAZA 3FXKA 2EFWA 2NVUB 4QPQA 3W6VA 2NOJB 1YJWI 1G8XA 2DA3A 4XSZF 4BHCA 4HRIA 1QZYA 4KDPA 3IKTA 1XB4A 2KISA 1PUFA 1KU3A 2NRAC 3W6JB 3PIPF 3Q0VA 3H5RA 1MZBA 3EDPA 3BG7A 1RESA 2HDDA 2FSWA 2VOPA 1ULYA 1U8BA 3RPUD 1BL0A 2K9LA 1Z3XA 4G9YA 4A69C 5A2QK 2R7QA 2CMPA 4PZJA 4A3FJ 2DAOA 3S2WA 3TP0A 4Q4ZF 2HKXA 1IN7A 2EFQA 2EFPA 1KQ0A 4CYDA 2AHQA 1IN8A 5CVJA 1CQTA 4XKVA 1JUSA 1I50J 4GRIA 3ABUA 4B09A 1TWFJ 1EKEA 3GTGJ 2HR3A 3NEUA 3M07A 2KIQA 4F55A 1W1WE 2DYSH 1LFPA 2L4AA 4BDZA 2CQXA 3ZMZA 3QOEA 2JPCA 2VBWA 4HYEA 2JVHA 4XBFA 4RDUA 2LF8A 1P92A 2VLAA 3H3UA 2YS9A 1HKQA 1XDUA 2F6CA 2VB6A 5KAIC 2FA5A 2H09A 2O7OA 2GQQA 1T8IA 5GPCA 1SVLA 4E7KA 2EINH 1OYWA 2XGDA 2M30A 3DFGA 2BXYA 1R1UA 4BHBA 4BQOA 5EZGA 1ZREA 1UHSA 5GTHC 3BJOA 2GXGA 3HRMA 5F0HA 3PSFA 3WGHA 3RYPA 2EIKH 1EH7A 1HKTA 2FNPA 1DDNA 3H9GA 4DZPA 2RVCA 4NNJA 5HS9A 2RGVA 5C4XJ 2HWVA 3MMYB 3H3VK 4XLAA 5F0CA 1WJBA 1V4RA 3BPVA 2K3PA 3I4PA 3VSLA 2JA2A 4PJLA 5DV5A 4D0PA 4BE1A 3WTUC 2YPRA 3V7RA 4ZYAA 3JTGA 2RV8A 3EUHA 3CC4I 2CQQA 2VKEA 3IH4A 3ZMTA 2EZHA 4E7JA 3QYEA 4F7ZA 3CJQB 4HX8A 2F5VA 4ASNA 5ICFA 2V1NA 1FWZA 3S3MA 1EV7A 5HS8A 5FRMA 5J47A 2IGMA 3LSGA 3FXMA 1SEUA 4NB5A 3J81K 2HU9A 4E7HA 2XGXA 4UB6C 4IHTA 2GOMA 3S8PA 4HQEA 1OCTC 1MIJA 3S32A 2MH2A 1G3YA 1C0WA 3E1SA 2HOTA 2BXZA 1ZH5A 5L3GA 1GHCA 2W25A 3OYIA 2GLOA 1JXSA 3S14J 4LK1F 3LSJA 3HIFA 1HDPA 3PNVA 1BC8C 2CSOA 2K4JA 4XQFA 2IA1A 3OYMA 3BTJA 5CKTA 5LLQA 4AWXB 3IV5A 4F91B 3C2GA 4WX9A 5EEAA 4AM3A 2HQNA 3M8JA 1I27A 3OYNA 1Y0NA 1SD4A 4WK8F 1ZYRF 3RPUA 3G71I 4G7OF 2CO5A 3KZYA 1R58A 4U87A 2IS2A 2HZDA 4IF4A 5C44J 4ANJA 1LE8A 3VOEA 3I4MJ 4Y15A 1T6SA 2RNJA 1SFEA 3DCFA 2DQLA 1AU7A 3G73A 3SDGA 5CPRB 3FXJA 1X19A 5LGUA 2DK5A 1IC8A 2OPTA 3O8GA 5KHDA 1YHQI 1VQ9I 1VF9A 1OJLA 3NARA 4R1HA 2Y9YA 1KYZA 1AKHA 5GAGJ 3QP5A 5ICGA 2LYCA 1RPWA 5K7HA 2VN2A 1B72B 3U1KA 1Z77A 5FLXZ 2KMUA 1R4MB 2KFDA 2VOOA 3HOTA 1Z0XA 3I56I 1IRXA 3S93A 1GXPA 1LB2A 4AVPA 1R7JA 1Z05A 1X2MA 1CGPA 3CJRB 3VYRB 1X58A 2A3SA 2DFFA 2OCEA 3I53A 1SAUA 2H6CA 3ECOA 3PFIA 4FISA 4DYRA 2NNNA 2BY1A 2ZXHA 1GVJA 1VZ0A 1YIJI 1WZ2A 1FLIA 1ZRCA 4WCGA 1MBFA 4E7SA 1KU7A 4EJOA 4BXUA 2K9QA 4OMYA 5M3MJ 4CCOA 2GM4A 2HPMA 1LDDA 3ZQQA 5IP9J 1LKXA 2ISYA 2E2HJ 2JQ7A 4DBRA 4MNUA 5DCFA 1Q1HA 5J1UA 1E0EA 2EK5A 4YEJA 5J1YA 4M6VA 4M73A 1FOKA 5LGTA 2P5KA 2HVSA 3HHHA 3HGYA 2FBHA 4CXFA 1PP8F 2DOEA 4A3DJ 4HSTA 3JR9A 2PLYA 3CCJI 1VQ8I 1WH5A 4AU7A 3H0DA 2A6EF 3DPUA 3BZ6A 1YJNI 1QNTA 3BJAA 3VYUB 1IN5A 3RI4A 4UNOA 4G94A 5HVQC 4F92B 3I4NJ 4LK0F 2W00A 3A02A 4MGRA 1OCCH 3ABKH 3JAMZ 4P1WA 2EZLA 5DUIA 1WVRA 4QWQA 2NVTJ 3TDUC 4Q47A 4BEHB 4UV8A 4HA8A 1J09A 3OYHA 2JTVA 4BQAA 1ON2A 4BS9A 4UXNA 2IEKA 3KIOA 5FFXA 3CCRI 1OCOH 2PJPA 1SD5A 4M6YA 3CP8A 2STTA 1U3EM 3LSIA 5E3NA 3OWTA 1VFCA 3FXLA 1ZELA 2Y0SN 3ZOBA 1WJCA 4BL0B 5IYBJ 2R7FA 3OS1A 4XKWA 3GTJJ 1T0FA 2L3DA 3TEDA 3AFHA 1I1GA 5FKKA 3WGIA 1WJ5A 4HEA2 3WU0A 2EIMH 5HLIA 3RZOJ 2JUCA 2FBIA 1CF7A 1QPIA 2HYGD 1UFMA 2W4SA 4A6EA 2Y2ZA 2PMZA 3HTUA 3QAHA 3DKYA 4PFPA 1X1DA 2FNAA 5KK1A 1USSA 3ESWB 3CJNA 1JKOC 1Z91A 3H9QA 4KISA 4BBSJ 1BIBA 2X1CA 1APLC 3GFJA 2XVCA 4IHYA 4IEJA 2W84A 1DQUA 4BAYA 1XTAA 4NHJA 4C2TA 1JKQC 4UY8I 5J4YA 4NC8A 3DBRB 4I02A 1X2NA 4UVAA 3E6CC 3OSFA 3LAPA 1W36D 3PNYA 1GDTA 4L9TA 1TWAJ 4AD9A 1YW7A 1MMSA 2R5ZB 2X51A 1T2KA 1V5FA 1XPXA 1NK3P 4JBAA 2R7DA 1RI7A 2KPMA 4A0ZA 3GYHX 4XLFA 1MDMB 2DFIA 2X6YA 4YG2F 1FTTA 3KZZA 3KLOA 3R0JA 3VODA 1WH7A 4GFBA 2EFNA 3OYJA 1VQ4I 2EV6A 4PGGA 5D4SA 3BR0A 3OYEA 1WCMJ 4B44A 4A12A 1R00A 3VFZA 4MHGA 4NQWB 2CV0A 3MAJA 2K5CA 2O8XA 3DBHB 2FQ4A 3LFKA 1A31A 3SYTA 1HF0A 5J3LA 4ZJZA 4ENKA 4NBQA 1RETA 3OIOA 3OR2C 2IGKA 1DGRM 5GAEJ 2CW0F 2BY0A 3T8TA 4IOAF 1S7AA 4WF2A 2G7UA 1HBXG 2O9LA 3RKWA 3B6AA 2LSOA 3FXQA 1B8IB 3NRVA 4RMNA 4EV0A 3WHCA 3J7YJ 4XRMA 4W1UA 1YFHA 1LFUP 1U5TC 3DTKA 2E1NA 1P4XA 3CLOA 3GO5A 3QYBA 1K78B 1MH3A 2DDBA 5HOOA 2CS3A 1PVEA 2IT0A 2LBFB 1UELB 4LJZF 2ELKA 2V9PA 4AIJA 4HG2A 5B66C 3G2BA 3A03A 1R1TA 4I0BA 4ENNA 4HLYA 3C1DA 3GFLA 4CO8A 2XC7A 2MBFA 2IJLA 5CJ9A 1VQLI 4ZH4F 2R7WA 2O3FA 1WI3A 4FX0A 4IHVA 1VQKI 3FX3A 4Y52J 1BIAA 3EETA 2L7KA 5D4RA 2VONA 2K27A 5E3LA 3DV8A 5CLSA 4B48A 2LTPA 4JK1X 1R23A 1I6HJ 4DBQA 1TP4A 3ELKA 1X3WB 1BJZA 5A2QZ 3UKGA 3JRHA 2STWA 4HPQA 1PP7U 3E6BA 4OIQF 1X3UA 4LG3A 3IAM2 1P4AA 4IVNA 2LLKA 4RS8A 4ZTJA 2HVRA 5E3OA 4QSHA 3JREA 4F52A 5D6EA 3D1NI 1O57A 4UB8C 1JUMA 2VJIA 1ETXA 4ON0A 4LIVA 1F5TA 2ZB9A 4EM1A 3LWFA 5FKNA 5FLXK 2LVSA 1I3AA 2E7WA 2CJJA 3I55I 3KYLA 1Z21A 4RAYA 4B3XA 3OYAA 3MQ0A 3A01B 3PUBA 2D45A 3SXYA 3SEZA 1ETOA 1DP3A 1D8JA 1X1AA 5BS6A 3H9JA 2I8DA 4Y13A 1W5TA 3ZMDA 4C2UA 4LFUA 1S6LA 2W24A 3ZQCA 2Q8KA 2ADUA 2M1BA 4WXCA 2X6XA 2XPWA 4A5MA 1ZGAA 2XAJA 1SMYF 2KP6A 2KIUA 3TQNA 1J5YA 2R4GA 1MJBA 2ZMEB 1IXRC 1YJ9I 2BV6A 2LC2A 1ZK8A 5E1WA 4E7LA 5FFZA 3F8MA 1OCRH 4N4OB 2JRTA 4J00A 1I6XA 4JP0A 3ZMSA 3IKVA 4A3LJ 2DA6A 3GF2A 1UHMA 3V8LA 2TCTA 2YUSA 5LHHA 4M3FA 3OS0A 4XIDA 1QVTA 4E7IA 3GWZA 2FX0A 2XAGA 1T56A 4HOBA 2K3FA 3V7SA 1ETVA 1QHGA 3I3LA 3COAC 3OYGA 5FLVA 4XRFA 2HI3A 2L7ZA 3L1PA 3JAMK 5F08A 1ZGWA 3QQAA 4RGXA 4B47A 2JK3A 2L54A 2IVMA 3HOWJ 4BXXJ 1FSHA 3HSFA 2F2EA 3QPTA 4ETSA 3SJMA 3RZDJ 1MSFC 3HPHA 4FQGA 1IO2A 2KDOA 2FBKA 2LY9A 4WXDA 2WV1A 3G1LA 4DYCA 5EGOA 2L01A 1A6QA 2VC1A 5J1RA 1LJ9A 2V1UA 2P4WA 1RZ4A 2ELHA 3ASNH 2VT3A 1JKPC 2K7LA 3TO7A 1B9NA 2L9SA 3CCEI 5JVGF 4Z6YA 1J75A 5DCMB 3RIRA 2QQAA 4U88A 2X9DA 2XF5A 3A1YA 4RB2C 4L0YB 4YRVA 5AIPA 2Z99A 2Z33A 3WTZA 2R93J 3N4MA 2DMUA 4DQ2A 1IZ1A 3AL0B 3TGNA 2DPDA 3G1MA 4EGYA 3O8HA 3BP8A 3M1EA 2G7HA 3CCLI 2CH0A 3CTAA 4PK4A 4L0ZB 3H35A 3BTLA 1MH4A 3HBLA 3QPSA 1NG6A 4I6ZA 2DCEA 2BW3A 4OAYA 1K83J 5DM7F 3WU2C 2KT0A 3SFZA 2V6EA 3IH3A 3G4SI 1IG7A 4IRHA 3LMMA 1RR8C 1XC5A 2MYSA 4P96A 5F1RA 2ZXWH 3FF5A 4ZYDA 4FHTA 1SD6A 3WG7H 2AS5F 4LB5A 2A5WA 1ZG3A 3GFMA 1VQPI 2X6OA 2ACJA 4N9IA 5DDGA 2R0QC 4BY1J 2CUFA 1BOBA 1DU6A 1FYMA 3ZQIA 2L9RA 3L2WA 3I59B 2OTLI 5TRDA 4XLCA 3HPGA 2CGPA 5D5WB 1TQMA 4ZYHA 1SFUA 3H0GJ 1J2XA 3TO6A 1K4SA 1ENHA 4K2EA 4RAZA 5LD2C 5IT9Z 1E17A 2HPIA 2LF7A 5M5WJ 4JX6A 3OYDA 2W82A 5LEKA 5K5RA 1UB9A 2CQKA 2ZNYA 3DLAA 5FLMJ 4X0GA 2LOOA 2CFOA 2CW8A 1TWGJ 4CHUA 1TBXA 5EGOB 1O3SA 4IPAA 4BHPA 5DM6F 4Y4RA 1JHHA 1E3HA 3ABMH 1U8RA 2QF7A 1A04A 1MKMA 1XX5A 1QRYA 4HF1A 2H94A 2HVQA 1MMNA 3PFYA 1USTA 4P9UA 4F3QA 3DPLC 4YFNF 3FKIJ 2FXAA 2L2OA 3IHUA 3K4KA 4AYBN 1V3FA 1WHUA 3SEQA 2M4GA 1H9TA 5GPAA 3BCBA 2FUG2 2HQ5A 4XM3A 2XKOA 1IF1A 4V19K 2J5OA 2QBYB 3DEUA 4AC0A 3CO6C 3OSGA 1R5HA 2PMHA 2GAUA 4UHTA 5FD6A 1ONVA 2PEXA 3X2QH 3R61A 4ESBA 5JLWA 3KFWX 1SC7A 2Q0OA 1S7EA 4G7ZF 4KFCA 3M1CA 2RC4A 1FSEA 3WG9A 4AUXA 2VUMJ 4EATA 3LSTA 2E1MB 3S2HJ 3KEYA 5D8KB 3DWLE 4BJ5C 5LHIA 1FT9A 2HOAA 4PFOA 2UWMA 3QOPA 5H20A 4AIKA 3BZCA 3DQVC 5KAFC 2UZKA 4XL9A 2TRTA 4BBRJ 2QZ8A 2RNGA 3MFKA 3IRRA 2NNYA 2QVOA 2DDAA 2VKHA 3CQZJ 2VIXA 3E97A 2E19A 2JMWA 3F22A 1Y1VJ 4WWCA 4CZZA 3OYCA 4D9JA 1E3PA 2AQFA 3HB9A 3WODF 2Y75A 3K1PA 2CV1A 1R6RA 3RSNA 2V26A 3CUQC 3S15J 3NWSA 1KQ8A 2VC0A 3WU1B 2UV1A 4A3BJ 4U7DA 1MW7A 1Z7UA 2ETHA 2KJCA 4GYIA 1FX7A 3L2CA 2GZWA 3ISPA 3RKXA 5E8GA 3MKZA 3PL8A 2KDZA 1GXQA 1R22A 5F64A 1R71A 1D8KA 3ERED 2MFZA 1ZKGA 2PMUA 2NS7A 5HNFA 2XDVA 2QWWA 1W0UA 3IAS2 2EJRA 5LEJA 2HTSA 4ENJA 3K2ZA 2R5YA 3K70C 2VBZA 1NK2P 2MGQA 2OUMA 1TLHB 3PM1A 1H8AC 3F8NA 1X4OA 4CZCA 4BY7J 5AONA 2ECCA 1KQ9A 3CESA 2L7FP 3JW4A 4PGHA 5HDNA 1LPQA 4FT8A 3OMYA 4EQQA 3FMSA 1W7PD 1R5ID 3CCSI 1JT6A 2F5FA 2AXTC 2RQQA 2ZJ2A 1PUFB 2ZJRF 3CO7C 1FYKA 3CJTB 4JX4A 2WBMA 2M8GX 3I54A 4A0YA 2DTZA 3LAJA 5IOYA 3E5QA 3E3VA 2VBYA 4A2UA 3L2UA 3CC7I 3EUAA 1NTCA 3JSOA 1AHDP 4IOCF 2BHZA 3GFIA 1IXSB 2M87A 4KIFA 1SFKA 4MLOA 2MW8A 3D5SC 1RUOA 4HQMA 2DA1A 4I76A 4DJAA 2IRFG 1IXCA 2MA3A 1IDZA 1P7JA 3HZJA 4NC6A 1O3QA 3MZYA 3WE3A 5EG0A 2O5RA 1WJAA 2OZUA 3BLYA 4IHWA 4LOCA 1VTNC 2JZYA 3I0TA 4PJNA 4R8HA 2HEOA 3S16J 1RRJA 3ULQB 1KZHA 3CMYA 2W85A 4YIIA 1ITYA 3QWLA 2FMLA 3B6CA 5IP7J 4MEYF 2F5CA 4QIWN 2QLZA 4IHXA 1Y8QB 2EZIA 3OV8A 2CWEA 5E1ZB 2JSPA 4ENMA 3QRFF 1K6OA 3HTSB 5J8FA 2QENA 3GVAA 4GYGA 1ETKA 2K9MA 4F93B 1ETWA 2HTJA 2K40A 2K9NA 1S9HA 2M0MA 3HJEA 2DLLA 3KE2A 4G6QA 1V55H 4PSWA 4UVBA 1ZHFA 3CMEI 1PYVA 3C18A 5L3CA 1S72I 1PUEE 5M5XJ 3KYCB 1MJAA 3P9CA 1LNWA 4EM0B 3MKWB 3LQQA 1BI2A 2LRDA 5C3EJ 4BJTA 4Q5SF 4YFXF 1YRNA 1TW2A 3MWMA 1UG0A 3FIWA 2CQNA 4HX4A 4CYCA 4M9XA 3BR6A 2LK2A 4L9NA 4M9SA 4EJWA 3VDXA 3BWGA 4BACA 2DTRA 2K9SA 1YG2A 1FIPA 1RR7A 4QLCU 1ZAOA 3CDLA 1UG2A 1K7AA 1FYLA 3WTYC 3K9TA 1OQYA 2DQRA 3CDIA 4LLNA 3RKYA 2DK8A 1WGXA 3BDDA 3MD2A 3M3YJ 1A5JA 1O3RA 2BY2A 5DS9A 3F23A 2WADA 2X48A 4IRGA 2RDPA 2VPRA 1YX5A 4HNVA 1AWCA 5JHUA 4PUSA 5F1JA 2FOWA 3HXLA 2XHKA 2XSJC 2ME6A 5IT9K 1XD7A 1X3ZB 1MBGA 2MH9A 3IH2A 2W7NA 1I5ZA 2HYJA 3V8JA 2EZKA 3K1MA 2X0LA 4KN4X 3AG3H 3BPXA 3TBIA 3WHBA 2LH9A 1HCRA 1W7PA 3KLNA 3ZN0A 1R9TJ 4D1QA 2PN6A 3SHFA 3ZQLA 5HNHA 1EH8A 3IP4B 4IHSA 1O7LA 1XN7A 2EB7A 2P5VA 5ERIA 1JI8A 1XGSA 2FU4A 4A3KJ 3IL2A 4J19A 3E5UA 2IS1A 1BI0A 4A3GJ 2A5YB 1P4WA 2HXIA 2R7ZJ 1K4TA 2XSDC 1LE8B 2NVXJ 4IKFA 1JHFA 3IUOA 1T39A 4HF2A 1OYYA 2ME0A 3H5NA 3H5AA 2EIJH 3QU6A 2KRFA 1EH6A 2L02A 1U9OA 2ZNZA 3FXOA 3L2QA 2OF7A 1D0ZA 3L00A 4FX4A 3S1QJ 3PSIA 2QM3A 3HUGA 2JPBA 5JLXA 3FMQA 4UUSA 5TJJA 1AKHB 3B02A 3K10A 2ZJPF 4ZZLA 2PMZN 2QGUA 3JRCA 3ZRGA 4HAMA 2HKOA 4IX7A 1YITI 1UAAA 3VB2A 3JRFA 1LEBA 3WTXC 2EBIA 1QO0D 3BZKA 2DT7B 1LVKA 4RAFA 4UUVA 1I3QJ 3GMEA 2HXOA 4LG0A 1U78A 3OYBA 2Z9OA 2E34A 3W6KB 3IC7A 1D1BA 2W1OA 2YR2A 5LFAA 1Y8RB 2E1CA 2V9VA 1OLTA 2DJIA 3BG5A 4P55A 3A0BC 4BE2A 2QYOA 4C3HJ 5K7FA 1QZEA 2L4MA 4KNYA 5E8IA 2IAIA 4A3JJ 2COBA 4JQFA 1U5TA 2F4OB 4MIMA 2Y0SA 5E3MA 1Y0UA 4RB0A 1O4XA 4I2OA 2DBBA 3WTTC 1BI3A 1QVUA 1W5SA 2O8KA 3CMAI 1O3TA 2D1HA 2F5DA 3U2RA 2MLGA 4DNCA 1SAXA 4DZJA 4CGZA 3F8CA 1TT5B 4LIUA 3OS2A 3GZNB 1BC7C 2Q2EA 5FD5A 3OY9A 3K1NA 5EDNA 2ID6A 3OOUA 5ICCA 1IRZA 5GTIC 4HX7A 2R7XA 2AXLA 2WAQN 3RTRA 3HRTA 2QKMB 3OL4A 2W57A 3G6EI 1L0OC 2O03A 2K85A 3S2DJ 2RQPA 3FWEA 2HZTA 5CVRA 2H6BA 3RQIA 4G12A 3HOXJ 3FHNA 4IJAA 4OIRF 3RYRA 3VPRA 4M74A 2XKPA 1TNTA 4ZZDA 3R0AA 2ZBKA 3PUFA 4EEFG 4S05A 2EA2A 3EUKL 2PJRA 3PQJA 2DOFA 1XGMA 1ON1A 2XAUA 4OINF 3LSRA 4N4NB 4XKCA 1CF7B 3BC8A 1B4AA 4IZZA 2V79A 4D5FA 1QPMA 3RKQA 3S1MJ 4M3GA 2M8EA 3M7GA 1XMXA 1BOAA 2XB5A 3M8EA 4ZDOA 3OYFA 2CG4A 1GUUA 2V4JC 2OA4A 2J5PA 4H0EA 1PDNC 1UZCA 2G9WA 2XF7A 2XRLA 5AIQA 1HOMA 2ZC2A 1B9MA 2E35A 3KYDB 1IW7F 4HZFA 4E4HA 3J80K 1FNNA 1SFXA 2WB1N 1ERDA 4MTDA 3HKZN 1J7KA 2VJ4A 1QQIA 3HSEA 5CVVA 2ESHA 4A5NA 4XKBA 2XAQA 4QTRA 3K7AJ 2D1VA 2MD5A 2R7OA 4IL6C 2X85A 3JRDA 3WTWC 2H27A 2FQ3A 4KJZA 4NUBA 2GOXB 3KP4A 1MJ9A 3R4KA 1HSTA 3SFIA 2VPLA 2A6TA 4XLNF 3ZP5A 1T38A 4E70A 2FEZA 2IA0A 1D5VA 3ZQ7A 2CV2A 2VXZA 2M4KA 3HOVJ 3J80Z 4M3BA 4PJJA 3LOCA 4W97A 5F27A 4HV5A 2DMTA 2ESNA 2FMYA 1L3LA 3KP6A 4KMFA 2M7AA 2JVGA 3ABTA 4CA0A 2XROA 2ZMEC 1OCZH 2DA2A 2GIVA 3AG4H 4GXOA 4MQVA 2M45A 2OU2A 3FMRA 3TDZC 3K4MA 3BY6A 3K4NA 3ZMVA 2DXIA 3P5JA 2IS6A 2HOEA 3HYIA 1Y56A 2P81A 2HNHA 2A69F 3W2VA 1JGSA 4KYWA 3FZVA 2QUFA 1FP2A 1MSEC 1XSVA 2B0LA 3CCUI 3PIOF 2A68F 3K4JA 3W3CA 4L9VA 1EA3A 4L9JA 4N9HA 2EILH 2JA5J 1QZZA 1ZG1A 1F1ZA 1IRFA 3LA7A 4U0WA 2H8WA 3T1BA 2ICWG 2L9NA 1Z6RA 1IN6A 4XORA 4KIBA 3RDIA 3Q3SA 4XLEA 1IV6A 1JTYA 1FBQA 3DU5A 1FY7A 3IWFA 1P7IA 3CUOA 3TMOA 2MLKA 5L3BA 2QCOA 2YSRA 4UVCA 3AAFA 1N77A 4XN3A 4MFEA 2K86A 2R7RA 3CCQI 2BY3A 2WY8Q 2M0CA 1A35A 4CCNA 1MD0A 5F0FA 3HSRA 4BGDA 3O6BB 3DXJF 3KCCA 3A4CA 4CSWA 1NH3A 3FBIB 2VODA 1TL8A 3W2AA 3A2KA 3C2BA 1XGNA 2ELJA 3FK7A 3PO2J 3HRSA 2GA1A 5DEQA 3GTMJ 2DI3A 3CLQA 2BVMA 3HG9A 2JWTA 4BU2A 2F4IA 1BN5A 4CCLA 1S8NA 2EV0A 2OJED 3SZGA 1FZPB 3Q9VA 3K70D 2Y0MA 1P9QC 2BHYA 4U0VA 1HLVA 5GADJ 1AOYA 4KMUX 4PSXA 3M8FA 5FGMA 2QQ9A 4I01A 1BW5A 4CCMA 3ECHA 1YI2I 1KYWA 1LDJA 1HW5A 4L5JA 3VSKA 2VJJA 4CCKA 4XRSA 5IY5H 1TQIA 2OV7A 1XG1A 1XSXA 3HC7A 4D5CA 2QA4I 1QA6A 4V2GA 3BROA 5FRNA 3ZCOA 1YS7A 1YQAA 1YW9A 2E71A 2H1KA 2KRCA 3S1NJ 5TISC 3GLXA 1BBYA 1HA8A 3HDDA 3QYFA 4DOZA 1FOWA 4LITA 4HDVA 5HLHA 1BJAA 2KLOA 2ZJQF 2IGOA 2EPFA 3I58A 1BM9A 2DT5A 3BTCA 2V7FA 2KZVA 2ZSHB 1XDSA 2OD5A 1Q1VA 4YIRX 3MZHA 3F72A 2MD0A 2BEOA 2H8RA 1BI1A 3RPQA 2E5NA 3HM5A 1WRJA 4XN0A 4DYQA 3GX4X 3C2HA 1ZRFA 3GTKJ 4YIFA 4YFKF 1RKWA 2OZ6A 2AQEA 3LA2A 2WC2A 5L3EA 1VQ5I 2DMQA 2XIGA 4A3CJ 2YU9J 1A36A 3GLLA 2DOAA 3GW2A 1RNLA 2BGCA 3P7NA 4O6JA 3ZXSA 4A6DA 1BW6A 2RREA 3M9AA 1DUXC 1X1CA 4KT5C 1FEXA 1GLNA 4ZDLA 2KJBA 3MKYB 4WXHA 4RB3C 3BCAA 4EJVA 1FIAA 1DPRA 4L5IA 3N05A 4JX5A 3DKWA 1DP7P 3DF8A 4RGUA 2V9KA 3KEOA 3E6DA 1WI9A 2F4MB 3CP2A 3KETA 1NHAA 1VQ6I 1K79A 1YW8A 2CRGA 2KRHA 2R7TA 1KA8A 1KONA 3F21A 1JGGA 3DTEA 4ZTFA 2M2EA 4LB6B 4II2A 2XAHA 1FOYA 1UMQA 3MKLA 3O2PE 3EYIA 3MCZA 3FK6A 2JA6J 2VT2A 3HHGA 1MBJA 3L2VA 3CUQA 3VWBA 2D5VA 4B1RA 2EQRA 2E1MC 1REPC 4D7NA 3E5XA 2OTJI 5LGNA 1ZGJA 2QQBA 2VKDA 4P9FA 1G6NA 2MABA 2DYRH 4LLGF 2GA2A 5J4VA 3LFUA 2ECBA 1LVAA 3QODA 1GV5A 1XMKA 2P6TA 4KT6A 2DMPA 3P9KA 3BR3A 2UUZA 2R3SA 2P6SA 3GXOA 3DP7A 2BW3B 1GT0C 1J9IA 1B59A 2E36A 2Z2SB 3ZMUA 5HLGA 4G6TB 3GUDA 1NG7A 3S3OA 1RC9A 4AYBA 4EM2A 2Y69H 3TL4X 3O3KA 4P5OA 3ZR8X 3Q5FA 4A3IJ 2WA0A 5CQEA 2OCCH 4IQ4A 2VKVA 2NS8A 5J8CA 2V1DA 3E7LA 3OIQA 2Y31A 4DIQA 4FCYA 4LD5A 5IYDJ 1U2WA 3BG6A 4TV7A 2BVLA 4BUPA 1HSJA 4B8XA 1YYVA 5B1BH 4CUGA 4ZYGA 1FP1D 1GV2A 3OL3A 4M3DA 5HLTA 4O3MA 1FTZA 2XRNA 1TWHJ 4XLHA 3OYLA 1B1BA 5ILSA 2XPVA 2DA5A 4FE7A 2NXNB 2PG4A 3RQ4A 4OAZA 5CYVA 2OC6A 4MEXF 2A07F 3KP5A 4M72A 4S04A 2G0EA 3GTPJ 4BH9A 2JSCA 3A0HC 5LRSA 4GO1A 3DTIA 5FKLA 5M5YJ 4G8XA 2VE8A 3HOUJ 3HL2A 3FHZA 2JN6A 2QSFX 3MVPA 1TT0A 4OU0A 4DGWB 1LQ1A 1R49A 2PFBA 3K2AA 3ONQA 1JUPA 4PJ0C 5FROA 1BR1A 1MMDA 2XGCA 2IPQX 2UXXA 2E1OA 1FMWA 3KP3A 5J40A 2EWNA 4C9YA 2MC3A 1K61A 3G1OA 1T08B 5CVIA 3DBLB 4BXFA 2LDUA 1A6IA 1XCVA 1E2XA 1Z1DA 2DFHA 1I1SA 1TQPA 5E20A 1HW2A 3WGGA 2X1DA 3V42A 4B43A 3CUQB 2K02A 2Z5UA 1WJDA 3LL7A 3J7AO 3CMMA 4O5VA 3BT9A 5B3SH 3P9IA 2YU3A 4XR6A 1GVDA 3I64A 1J59A 3FKJA 5EF6A 2DT6A 3S3NA 1B72A 2P7CB 3ZQHA 1Z67A 2R7VA 1ZR2A 4X6AJ 3MN2A 2GBYA 5FJ8J 2QSGX 5EZHA 1Z7LA 4FETA 4MTEA 1WFXA 2XF6A 4XONA 3FISA 4I0AA 1TW3A 1IUFA 2CFXA 3BQYA 2L7MP 2LMDA 1D1AA 3E0JB 4XOTA 3QP6A 1OR7A 2ZFUA 4G7HF 2NVYJ 5GAHJ 2OAZA 1G2HA 3TKYA 1S5LC 5BOXA 4BNCA 2HGCA 5K7ZA 3CF5F 3U9GA 2LKPA 2Y48A 2P5LC 3JTHA 1JJ8C 4KIGA 3B73A 1R1VA 1JE8A 3FBNB 4V2FA 2NYXA 5HDGA 4G6DA 3Q9SA 4C2MJ 3PNTA 2QQ8A 2CU7A 4IRIA 3MEXA 3SZPA 4GDFA 3DLLF 3BR2A 3K6GA 4RB1A 4RGSA 1SD7A 2XV4S 1QBJA 4H4KC 3NAUA 1BA5A 2E7XA 4KICA 3DKXA 3JRIA 3L2RA 2JT1A 5CVUA 3F8BA 1PJRA 3FDYA 4DW6A 2R5YB 4E6KG 4UV9A 1HW1A 3EUHC 3I71A 4OWRB 4XICA 5BQTA 2WAFA 1V54H 2FE3A 2DA7A 1FJLA 4BEHA 4PCQA 4A0XA 1OR7C 5E18F 4J01A 4IQJA 5D6FA 5BPIA 1RUNA 4CDGA 1VI0A 5LHGA 2IS4A 2ID3A 2KZGA 3FXRA 1VQMI 2FRHA 4ZYEA 3OIPA 1AA7A 2A6HF 4U0YA 1R36A 2UXNA 1FBSA 1OYIA 2MC4A 3S1RJ 2M9HA 2HFHA 3KZIC 2LFBA 1Z3YA 3LSHA 1R5GA 2EV5A 5IT3A 1D3YA 2DPUA 1V5EA 5JFRA 1ODDA 1YX3A 4OOIA 1D0YA 2D2WA 2CYYA 1YOVB 5FKOA 1IUYA 2Y30A 1WWXA 3QPHA 1XCBA 2H1LA 3FM3A 2MSYA 2KHMA 2M7BA 1K6YA 1TC3C 4XNFA 1SANA 4Y33A 4I7HA 4RM3A 4HLXA 2E2JJ 5EG0B 2KL4A 3PQKA 4BDYA 3AG1H 2VXDA 1H9GA 3Q0WA 3KP2A 2CW7A 2FF4A 2LY1A 4I99C 3CCMI 2BOLA 2A61A 4FASD 5IP6A 2WWYA 3H36A 5ICEA 1LUJB 2VQGA 3MZ8A 4BE0A 2XB0X 2BBYA 4RAGA 2FD5A 3R6SA 3U21A 2FJ1A 4A3EJ 1VQOI 1E3OC 2IP2A 2R5ZA 1WQ2A 2O61A 4HNUA 3EPZA 3L7WA 4ABZA 3M4OJ 5D5XB 5D5UB 1MDMA 2NOGA 2Q1ZB 5IYCJ 5GP9A 2P8TA 4MO7A 4HNTA 4A93J 4HW0A 5KVRA 3F6VA 4XSXF 4Y3OA 4C30A 3CF2A 1YRNB 4NQWA 4NC7A 4Q48A 2WY7Q 2M5WA 4CYCB 1YS6A 2GXAA 2CQ7A 2Y9ZA 3ROUA 1LFBA 1V5GA 3VYTB 2QSHX 1N25A 2BZTA 3L9FA 4C3JJ 1W0TA 3TW7A 3GTOJ 5ED4A 2Z1DA 1H88C 3BG9A 4XK4A 3BTIA 4KUMA 4UUTA 2MG4A 2O0YA 1FC3A 4MQ9F 4LMYA 1M1EB 3TP3A 4I98B 1U9NA 1JT0A 3F6OA 5F04A 4RLQA 1B8IA 1MNMC 2TDXA 1DU0A 3HOYJ 9ANTA 1KU2A 4RA2A 4AIDA 1UJ8A 3G3ZA 1K78A 2VQCA 3R60A 3J7AY 2R7SA 2LBFA 1WJFA 4Y17A 5DYMA 1Z6TA 2NS0A 3D5RC 3SZTA 2B7EA 1KGSA 5B1AH 1W5CC 2C6YA 2VBXA 4RM2A 2IXSA 2LREA 2X1EA 2IA2A 1IN4A 1OFCX 2EFOA 4I09A 4EVIA 2HDCA 2R7UA 5HODA 3S17J 2EH3A 1H89C 4AVZA 3TW6A 4A3MJ 1U6GA 1W7PB 1R4NB 3HOSA 5EEGA 1LEAA 2X4HA 1N75A 1YIOA 4AIHA 2DJNA 4XMYA 4GGGA 3ABLH 2RN7A 1T98A 4CCJA 2JRMA 1X1PA
chains in the Genus database with same CATH topology
1WSUA 2WTEA 2RKHA 4OIOF 3WE2A 1P2FA 3I5UA 1OPCA 1HXDA 5K1YA 2KIMA 1XMAA 4EMSA 2P7VB 3NQOA 1UHWA 2V6CA 3GEZA 5BPDA 3F3XA 2DU9A 5BMZA 1YLFA 4PDKA 2YX4A 3CDHA 4KN7X 5DD8A 4EJTA 3IWZA 5JR3A 4U7BA 5DD4A 3WTVC 3RJPA 1F4KA 4LG0B 2BYVE 5ILVA 1XSDA 3OOPA 3TOBA 2OQGA 2ZMEA 4LGWA 3C7JA 2GWRA 3FXUA 1F9NA 3V7CA 6PAXA 4ESJA 3QU3A 2ISZA 1U5TB 4XLPF 4GCVA 3D5LA 3KEQA 4L18B 4OIPF 2GXBA 1ZLJA 2IW5A 4HDUA 3VEPA 3ZN1A 1G3WA 1MGTA 3TO9A 4N0BA 3LQRA 1S7OA 3BOQA 5F6FA 3N97A 1XGOA 2Z3YA 1S29A 1KU9A 1FPQA 3BJ6A 3C3WA 4IXAA 1STZA 5JVTA 1HQCA 4EJUA 5LBQA 3U1DA 3GZ5A 4M9ZA 4Z2YA 5DCMA 1G4DA 2EA4A 2V1XA 5FO5A 2PBIA 2XASA 2XUBA 5E17F 3IRQA 3K69A 3V4GA 5D8LB 1YO5C 1ZRDA 3ZPLA 2HYFA 3H3ZA 3EYYA 1B6AA 2BE5F 1ZN2A 2O6GE 4BYYA 5EEHA 3HRUA 5K5QA 3K0LA 3T5XA 5K5OA 5HS7A 5L3FA 1O7FA 1P6RA 4HF0A 5H6RA 2ZKZA 1H0MA 4HBLA 2KIFA 3I59A 1IAWA 4KA4A 3GZ6A 3D0SA 1WKMA 3H92A 2ZO4A 1OKRA 3DPTA 2FOKA 3J81Z 2WV0A 1OMIA 1YTYA 1ZLKA 4EGZA 2OBPA 3E6MA 2PI0A 4CICA 4RGRA 4ESFA 3F8FA 5LRRA 2HQRA 2PQ8A 1UCRA 1G3SA 1S3JA 4LLLA 2QBYA 5ILUA 1FBUA 5FB2A 1HKSA 3T8RA 1RIOH 4OMZA 1J0RA 5L3DA 2ZFWA 5JI6A 2COMA 2ZXJA 5HDKA 5E1XA 2K4BA 2YX7A 4M6XA 1TTYA 1QGPA 1ZG5A 3EQLF 1G3TA 4HV6A 1DPUA 4R79A 2XAFA 3TOAA 5D5VB 2KKOA 3T0YA 2OQRA 2ZCWA 3LA3A 3KP7A 5H6QA 1W4MA 1ZARA 3WTSC 2VE9A 3JSPA 3FM5A 5J6XA 3V8KA 1LDKB 1IRGA 3L09A 1TNSA 3SQNA 2DW4A 3REOA 2DO7A 4M71A 1Z9CA 5DUKA 2HS5A 2LNBA 2F5EA 3ML6A 1SMTA 2EFWA 2NAZA 4XSZF 4BHCA 1QZYA 4KDPA 3IKTA 1XB4A 1KU3A 2NRAC 3W6JB 1MZBA 3EDPA 2FSWA 2VOPA 1ULYA 4G9YA 5A2QK 4PZJA 2DAOA 3S2WA 4Q4ZF 2HKXA 1IN7A 2EFQA 2EFPA 1KQ0A 4CYDA 1IN8A 5CVJA 3ABUA 4B09A 2HR3A 3NEUA 2L4AA 3ZMZA 2JPCA 2VBWA 4HYEA 4XBFA 2LF8A 1P92A 3H3UA 1HKQA 1XDUA 2FA5A 2H09A 2GQQA 1OYWA 3DFGA 2M30A 1R1UA 4BHBA 1ZREA 3BJOA 2GXGA 3HRMA 3WGHA 3RYPA 1EH7A 1HKTA 2FNPA 1DDNA 2RVCA 5HS9A 2RGVA 2HWVA 1V4RA 3BPVA 3I4PA 5DV5A 4D0PA 3WTUC 2YPRA 3V7RA 3JTGA 2RV8A 3EUHA 3ZMTA 4F7ZA 4HX8A 4ASNA 5ICFA 1FWZA 1EV7A 5HS8A 4NB5A 3J81K 2XGXA 4IHTA 4HQEA 2MH2A 1G3YA 1C0WA 1ZH5A 5L3GA 1GHCA 2W25A 1JXSA 4LK1F 3HIFA 1BC8C 2CSOA 2K4JA 2IA1A 5LLQA 4AWXB 4WX9A 2HQNA 1I27A 1SD4A 4WK8F 1ZYRF 3RPUA 4G7OF 2CO5A 3KZYA 1R58A 4IF4A 3VOEA 4Y15A 1T6SA 2RNJA 1SFEA 2DQLA 3G73A 5LGUA 2DK5A 4R1HA 1KYZA 3QP5A 5ICGA 2VN2A 5FLXZ 2VOOA 3HOTA 1GXPA 1LB2A 4AVPA 1R7JA 1Z05A 1CGPA 2A3SA 3I53A 2H6CA 3ECOA 3PFIA 2NNNA 1FLIA 1GVJA 1ZRCA 4WCGA 1KU7A 4EJOA 4BXUA 4OMYA 1LDDA 2ISYA 4MNUA 5DCFA 1Q1HA 2EK5A 4M73A 1FOKA 5LGTA 2P5KA 3HHHA 2FBHA 4CXFA 1PP8F 2PLYA 2A6EF 3BZ6A 1QNTA 3BJAA 1IN5A 3RI4A 4UNOA 4G94A 5HVQC 4LK0F 4MGRA 3JAMZ 5DUIA 4QWQA 3TDUC 4Q47A 4UV8A 4HA8A 2JTVA 4BQAA 1ON2A 4UXNA 5FFXA 2PJPA 1SD5A 4M6YA 2STTA 1U3EM 2R7FA 1T0FA 2L3DA 1I1GA 3WGIA 3WU0A 5HLIA 1CF7A 2FBIA 2HYGD 1UFMA 4A6EA 3HTUA 3QAHA 2FNAA 5KK1A 1USSA 3CJNA 1Z91A 1BIBA 3GFJA 2XVCA 2W84A 4NHJA 4BAYA 4I02A 4UVAA 3E6CC 3LAPA 4L9TA 4AD9A 1YW7A 1T2KA 4JBAA 2R7DA 1RI7A 4A0ZA 3GYHX 1MDMB 2DFIA 4YG2F 3KZZA 3KLOA 3R0JA 3VODA 2EFNA 2EV6A 4PGGA 5D4SA 4A12A 1R00A 3VFZA 4MHGA 3MAJA 3LFKA 2O8XA 4ENKA 2CW0F 3T8TA 1S7AA 4WF2A 2G7UA 1HBXG 3RKWA 2LSOA 3FXQA 3NRVA 4EV0A 1YFHA 1U5TC 2E1NA 1P4XA 3CLOA 3GO5A 1K78B 5HOOA 2IT0A 4LJZF 4AIJA 1R1TA 4I0BA 4ENNA 4HLYA 3C1DA 3GFLA 4CO8A 2MBFA 2IJLA 5CJ9A 4ZH4F 2O3FA 4FX0A 3FX3A 1BIAA 3EETA 5D4RA 2VONA 2K27A 3DV8A 5CLSA 4JK1X 1R23A 3ELKA 5A2QZ 2STWA 1PP7U 3E6BA 4OIQF 1X3UA 1P4AA 4IVNA 4RS8A 5D6EA 1O57A 4ON0A 1F5TA 4EM1A 3LWFA 5FLXK 2E7WA 4RAYA 3MQ0A 2D45A 3SXYA 1D8JA 5BS6A 4Y13A 1W5TA 3ZMDA 4LFUA 1S6LA 2W24A 2Q8KA 2ADUA 2M1BA 4WXCA 4A5MA 1ZGAA 2XAJA 1SMYF 2KIUA 3TQNA 1J5YA 1MJBA 2ZMEB 1IXRC 2BV6A 5E1WA 5FFZA 3F8MA 2JRTA 1I6XA 3ZMSA 3IKVA 3GF2A 1UHMA 3V8LA 5LHHA 3GWZA 2XAGA 4HOBA 3V7SA 3COAC 4XRFA 3JAMK 4RGXA 2L54A 2IVMA 1FSHA 3HSFA 2F2EA 3QPTA 4ETSA 2FBKA 4WXDA 2L01A 2VC1A 1LJ9A 2V1UA 2P4WA 1RZ4A 2ELHA 2VT3A 2K7LA 3TO7A 1B9NA 1J75A 5DCMB 3RIRA 2QQAA 4U88A 4RB2C 4L0YB 5AIPA 2Z99A 2Z33A 3WTZA 3N4MA 4DQ2A 1IZ1A 3TGNA 2DPDA 4EGYA 3BP8A 3M1EA 2G7HA 3CTAA 4L0ZB 3SFZA 4IRHA 4P96A 5F1RA 3FF5A 4ZYDA 4FHTA 1SD6A 2AS5F 4LB5A 1ZG3A 3GFMA 2ACJA 4N9IA 5DDGA 1FYMA 3I59B 5TRDA 2CGPA 5D5WB 1TQMA 4ZYHA 1SFUA 1J2XA 3TO6A 4K2EA 4RAZA 5IT9Z 1E17A 2LF7A 5LEKA 5K5RA 1UB9A 2CQKA 2ZNYA 4CHUA 1TBXA 1O3SA 4IPAA 4BHPA 1JHHA 1U8RA 1A04A 1MKMA 4HF1A 2H94A 1USTA 4P9UA 3DPLC 4YFNF 2FXAA 3IHUA 1V3FA 1H9TA 2XKOA 1IF1A 2J5OA 2QBYB 3DEUA 3CO6C 1R5HA 2PMHA 2GAUA 4UHTA 5FD6A 1ONVA 2PEXA 3R61A 4ESBA 3KFWX 2Q0OA 4G7ZF 4KFCA 2RC4A 1FSEA 3WG9A 3LSTA 5D8KB 5LHIA 1FT9A 2UWMA 3QOPA 5H20A 4AIKA 3DQVC 2UZKA 2QZ8A 3MFKA 3IRRA 2NNYA 2QVOA 3E97A 3F22A 4WWCA 4CZZA 3WODF 2Y75A 3K1PA 3CUQC 1KQ8A 2VC0A 3WU1B 4U7DA 1Z7UA 2ETHA 2KJCA 4GYIA 1FX7A 3L2CA 2GZWA 3ISPA 3RKXA 5E8GA 1GXQA 1R22A 5F64A 1D8KA 3ERED 2PMUA 2QWWA 2EJRA 5LEJA 2HTSA 4ENJA 3K2ZA 2VBZA 1TLHB 3F8NA 5AONA 1KQ9A 3JW4A 4PGHA 5HDNA 4FT8A 4EQQA 3FMSA 1W7PD 2F5FA 1FYKA 2ZJ2A 3CO7C 3I54A 4A0YA 3LAJA 3E5QA 3E3VA 2VBYA 4A2UA 3JSOA 3GFIA 1IXSB 2M87A 4KIFA 1RUOA 4HQMA 2IRFG 1IXCA 2MA3A 1O3QA 3MZYA 3WE3A 2OZUA 1VTNC 2JZYA 3I0TA 4R8HA 2HEOA 3ULQB 2W85A 4YIIA 2FMLA 4MEYF 2F5CA 2QLZA 3OV8A 3HTSB 2CWEA 5E1ZB 4ENMA 3QRFF 1K6OA 5J8FA 2QENA 3GVAA 4GYGA 2HTJA 4G6QA 3J80Z 2DLLA 3KE2A 4UVBA 1ZHFA 3C18A 5L3CA 1PUEE 3P9CA 1MJAA 1LNWA 4EM0B 3LQQA 1BI2A 4Q5SF 4YFXF 1TW2A 3MWMA 4HX4A 4M9XA 4L9NA 4M9SA 4EJWA 3BWGA 2DTRA 1YG2A 4QLCU 1ZAOA 1K7AA 1FYLA 3WTYC 3K9TA 2DQRA 4LLNA 3RKYA 2DK8A 3BDDA 1O3RA 3F23A 4IRGA 2RDPA 1AWCA 5JHUA 2XHKA 5IT9K 1XD7A 2MH9A 1I5ZA 3V8JA 3K1MA 2X0LA 4KN4X 3BPXA 1W7PA 3KLNA 3ZN0A 2PN6A 3SHFA 4IHSA 1EH8A 1O7LA 1XN7A 2EB7A 2P5VA 5ERIA 1XGSA 2FU4A 3IL2A 3E5UA 1BI0A 2A5YB 1P4WA 1JHFA 1T39A 4HF2A 1OYYA 3QU6A 2KRFA 1EH6A 2L02A 2ZNZA 3L00A 4FX4A 2QM3A 3HUGA 2JPBA 3FMQA 5TJJA 3B02A 4ZZLA 4HAMA 2HKOA 3VB2A 1LEBA 3WTXC 1QO0D 4UUVA 4LG0A 1U78A 2Z9OA 3W6KB 3IC7A 2YR2A 2E1CA 2V9VA 4P55A 2QYOA 2L4MA 4KNYA 5E8IA 4JQFA 1U5TA 1Y0UA 4RB0A 4I2OA 2DBBA 3WTTC 1BI3A 1W5SA 1O3TA 2D1HA 2F5DA 3U2RA 2MLGA 4DNCA 1SAXA 4CGZA 3F8CA 1BC7C 2Q2EA 5FD5A 3K1NA 5ICCA 4HX7A 2AXLA 3RTRA 3HRTA 2W57A 1L0OC 2O03A 2RQPA 3FWEA 2HZTA 5CVRA 2H6BA 4IJAA 4OIRF 3RYRA 4M74A 2XKPA 1TNTA 4ZZDA 3R0AA 2ZBKA 4S05A 2EA2A 3PQJA 1XGMA 1ON1A 4OINF 1CF7B 1B4AA 2V79A 1QPMA 2M8EA 3M7GA 1BOAA 3M8EA 2CG4A 2OA4A 2J5PA 4H0EA 1PDNC 2G9WA 5AIQA 1B9MA 1IW7F 4HZFA 3J80K 1FNNA 1SFXA 4MTDA 1J7KA 1QQIA 3HSEA 5CVVA 2ESHA 4A5NA 2XAQA 2D1VA 2MD5A 3WTWC 2H27A 2FQ3A 3KP4A 1MJ9A 3R4KA 1HSTA 4XLNF 3ZP5A 1T38A 4E70A 2FEZA 2IA0A 1D5VA 3ZQ7A 2VXZA 4HV5A 2ESNA 2FMYA 1L3LA 3KP6A 4KMFA 3ABTA 2XROA 2GIVA 4GXOA 4MQVA 2M45A 2OU2A 3FMRA 3TDZC 3BY6A 3ZMVA 2HOEA 3HYIA 2A69F 1JGSA 4KYWA 3FZVA 2QUFA 1FP2A 1XSVA 2B0LA 2A68F 4L9VA 4L9JA 4N9HA 1QZZA 1ZG1A 1F1ZA 1IRFA 3LA7A 4U0WA 3T1BA 1Z6RA 1IN6A 4KIBA 3RDIA 1FBQA 1FY7A 3IWFA 3CUOA 2MLKA 5L3BA 2YSRA 4UVCA 3AAFA 2K86A 1MD0A 3HSRA 3O6BB 3DXJF 3KCCA 2VODA 1XGNA 3HRSA 2GA1A 5DEQA 2DI3A 1BN5A 1S8NA 2EV0A 1FZPB 3Q9VA 2Y0MA 4U0VA 1AOYA 4KMUX 3M8FA 5FGMA 2QQ9A 4I01A 3ECHA 1KYWA 1LDJA 1HW5A 4L5JA 1TQIA 1XSXA 3BROA 1YS7A 1YQAA 1YW9A 3GLXA 1BBYA 4HDVA 5HLHA 1BJAA 3I58A 1BM9A 2DT5A 1XDSA 2OD5A 3MZHA 3F72A 2BEOA 1BI1A 3RPQA 3GX4X 1WRJA 1ZRFA 4YIFA 4YFKF 2OZ6A 3LA2A 2WC2A 5L3EA 2XIGA 3P7NA 3GW2A 1RNLA 2BGCA 4O6JA 4A6DA 3M9AA 1DUXC 4KT5C 2KJBA 4WXHA 4RB3C 4EJVA 1DPRA 4L5IA 3DKWA 1DP7P 3DF8A 4RGUA 3KEOA 3E6DA 1WI9A 3KETA 1NHAA 1K79A 1YW8A 1KA8A 3F21A 4LB6B 2XAHA 3O2PE 3EYIA 3MCZA 2VT2A 3HHGA 3CUQA 1REPC 3E5XA 5LGNA 1ZGJA 2QQBA 4P9FA 1G6NA 4LLGF 2GA2A 1LVAA 1XMKA 2P6TA 3P9KA 2R3SA 2P6SA 3GXOA 3DP7A 1J9IA 1B59A 5HLGA 3ZMUA 3GUDA 4EM2A 3O3KA 4P5OA 3Q5FA 5J8CA 2V1DA 4LD5A 1U2WA 4TV7A 1HSJA 4B8XA 1YYVA 4ZYGA 1FP1D 4O3MA 2XRNA 1B1BA 5ILSA 2PG4A 5CYVA 4MEXF 2A07F 3KP5A 4M72A 4S04A 4BH9A 2JSCA 5LRSA 4GO1A 4G8XA 2VE8A 3FHZA 1LQ1A 4OU0A 2PFBA 2IPQX 2UXXA 3KP3A 2EWNA 2MC3A 5CVIA 2LDUA 1XCVA 1E2XA 1Z1DA 1I1SA 1TQPA 5E20A 1HW2A 3WGGA 3CUQB 2K02A 2Z5UA 3J7AO 4O5VA 3P9IA 2YU3A 3I64A 1J59A 2P7CB 4MTEA 4I0AA 1TW3A 2CFXA 3QP6A 1OR7A 4G7HF 2OAZA 3TKYA 5BOXA 4BNCA 2HGCA 3U9GA 2LKPA 2Y48A 2P5LC 3JTHA 4KIGA 3B73A 1R1VA 1JE8A 2NYXA 5HDGA 4G6DA 3Q9SA 4IRIA 3MEXA 3SZPA 4RB1A 4RGSA 1SD7A 2XV4S 1QBJA 2E7XA 4KICA 2JT1A 5CVUA 3F8BA 4UV9A 1HW1A 3I71A 5BQTA 2FE3A 4PCQA 4A0XA 5E18F 5D6FA 5BPIA 1RUNA 4CDGA 5LHGA 3FXRA 2FRHA 4ZYEA 2A6HF 4U0YA 1R36A 2UXNA 1FBSA 1OYIA 2HFHA 1R5GA 5IT3A 2EV5A 1D3YA 2DPUA 5JFRA 1ODDA 4OOIA 2D2WA 2CYYA 1IUYA 3QPHA 1WWXA 1XCBA 3FM3A 4I7HA 4HLXA 3PQKA 1H9GA 3KP2A 2FF4A 2A61A 2WWYA 5ICEA 2BBYA 3R6SA 2IP2A 1WQ2A 2O61A 3L7WA 5D5XB 5D5UB 1MDMA 2P8TA 4HW0A 5KVRA 3F6VA 4XSXF 4NQWA 4Q48A 2M5WA 1YS6A 3ROUA 3L9FA 5ED4A 4KUMA 2O0YA 1FC3A 4MQ9F 4LMYA 4I98B 3F6OA 2TDXA 1KU2A 3G3ZA 1K78A 3R60A 4Y17A 5DYMA 1Z6TA 2NS0A 3SZTA 1KGSA 2C6YA 2VBXA 2IA2A 1IN4A 2EFOA 4I09A 4EVIA 2HDCA 1U6GA 1W7PB 3HOSA 5EEGA 1LEAA 2X4HA 1YIOA 4AIHA 4GGGA 2RN7A 1T98A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WSU A;  2WTE A;  2RKH A;  4OIO F;  3WE2 A;  1P2F A;  3I5U A;  1OPC A;  1HXD A;  5K1Y A;  2KIM A;  1XMA A;  4EMS A;  2P7V B;  3NQO A;  1UHW A;  2V6C A;  3GEZ A;  5BPD A;  3F3X A;  2DU9 A;  5BMZ A;  1YLF A;  4PDK A;  2YX4 A;  3CDH A;  4KN7 X;  5DD8 A;  4EJT A;  3IWZ A;  5JR3 A;  4U7B A;  5DD4 A;  3WTV C;  3RJP A;  1F4K A;  4LG0 B;  2BYV E;  5ILV A;  1XSD A;  3OOP A;  3TOB A;  2OQG A;  2ZME A;  4LGW A;  3C7J A;  2GWR A;  3FXU A;  1F9N A;  3V7C A;  6PAX A;  4ESJ A;  3QU3 A;  2ISZ A;  1U5T B;  4XLP F;  4GCV A;  3D5L A;  3KEQ A;  4L18 B;  4OIP F;  2GXB A;  1ZLJ A;  2IW5 A;  4HDU A;  3VEP A;  3ZN1 A;  1G3W A;  1MGT A;  3TO9 A;  4N0B A;  3LQR A;  1S7O A;  3BOQ A;  5F6F A;  3N97 A;  1XGO A;  2Z3Y A;  1S29 A;  1KU9 A;  1FPQ A;  3BJ6 A;  3C3W A;  4IXA A;  1STZ A;  5JVT A;  1HQC A;  4EJU A;  5LBQ A;  3U1D A;  3GZ5 A;  4M9Z A;  4Z2Y A;  5DCM A;  1G4D A;  2EA4 A;  2V1X A;  5FO5 A;  2PBI A;  2XAS A;  2XUB A;  5E17 F;  3IRQ A;  3K69 A;  3V4G A;  5D8L B;  1YO5 C;  1ZRD A;  3ZPL A;  2HYF A;  3H3Z A;  3EYY A;  1B6A A;  2BE5 F;  1ZN2 A;  2O6G E;  4BYY A;  5EEH A;  3HRU A;  5K5Q A;  3K0L A;  3T5X A;  5K5O A;  5HS7 A;  5L3F A;  1O7F A;  1P6R A;  4HF0 A;  5H6R A;  2ZKZ A;  1H0M A;  4HBL A;  2KIF A;  3I59 A;  1IAW A;  4KA4 A;  3GZ6 A;  3D0S A;  1WKM A;  3H92 A;  2ZO4 A;  1OKR A;  3DPT A;  2FOK A;  3J81 Z;  2WV0 A;  1OMI A;  1YTY A;  1ZLK A;  4EGZ A;  2OBP A;  3E6M A;  2PI0 A;  4CIC A;  4RGR A;  4ESF A;  3F8F A;  5LRR A;  2HQR A;  2PQ8 A;  1UCR A;  1G3S A;  1S3J A;  4LLL A;  2QBY A;  5ILU A;  1FBU A;  5FB2 A;  1HKS A;  3T8R A;  1RIO H;  4OMZ A;  1J0R A;  5L3D A;  2ZFW A;  5JI6 A;  2COM A;  2ZXJ A;  5HDK A;  5E1X A;  2K4B A;  2YX7 A;  4M6X A;  1TTY A;  1QGP A;  1ZG5 A;  3EQL F;  1G3T A;  4HV6 A;  1DPU A;  4R79 A;  2XAF A;  3TOA A;  5D5V B;  2KKO A;  3T0Y A;  2OQR A;  2ZCW A;  3LA3 A;  3KP7 A;  5H6Q A;  1W4M A;  1ZAR A;  3WTS C;  2VE9 A;  3JSP A;  3FM5 A;  5J6X A;  3V8K A;  1LDK B;  1IRG A;  3L09 A;  1TNS A;  3SQN A;  2DW4 A;  3REO A;  2DO7 A;  4M71 A;  1Z9C A;  5DUK A;  2HS5 A;  2LNB A;  2F5E A;  3ML6 A;  1SMT A;  2EFW A;  2NAZ A;  4XSZ F;  4BHC A;  1QZY A;  4KDP A;  3IKT A;  1XB4 A;  1KU3 A;  2NRA C;  3W6J B;  1MZB A;  3EDP A;  2FSW A;  2VOP A;  1ULY A;  4G9Y A;  5A2Q K;  4PZJ A;  2DAO A;  3S2W A;  4Q4Z F;  2HKX A;  1IN7 A;  2EFQ A;  2EFP A;  1KQ0 A;  4CYD A;  1IN8 A;  5CVJ A;  3ABU A;  4B09 A;  2HR3 A;  3NEU A;  2L4A A;  3ZMZ A;  2JPC A;  2VBW A;  4HYE A;  4XBF A;  2LF8 A;  1P92 A;  3H3U A;  1HKQ A;  1XDU A;  2FA5 A;  2H09 A;  2GQQ A;  1OYW A;  3DFG A;  2M30 A;  1R1U A;  4BHB A;  1ZRE A;  3BJO A;  2GXG A;  3HRM A;  3WGH A;  3RYP A;  1EH7 A;  1HKT A;  2FNP A;  1DDN A;  2RVC A;  5HS9 A;  2RGV A;  2HWV A;  1V4R A;  3BPV A;  3I4P A;  5DV5 A;  4D0P A;  3WTU C;  2YPR A;  3V7R A;  3JTG A;  2RV8 A;  3EUH A;  3ZMT A;  4F7Z A;  4HX8 A;  4ASN A;  5ICF A;  1FWZ A;  1EV7 A;  5HS8 A;  4NB5 A;  3J81 K;  2XGX A;  4IHT A;  4HQE A;  2MH2 A;  1G3Y A;  1C0W A;  1ZH5 A;  5L3G A;  1GHC A;  2W25 A;  1JXS A;  4LK1 F;  3HIF A;  1BC8 C;  2CSO A;  2K4J A;  2IA1 A;  5LLQ A;  4AWX B;  4WX9 A;  2HQN A;  1I27 A;  1SD4 A;  4WK8 F;  1ZYR F;  3RPU A;  4G7O F;  2CO5 A;  3KZY A;  1R58 A;  4IF4 A;  3VOE A;  4Y15 A;  1T6S A;  2RNJ A;  1SFE A;  2DQL A;  3G73 A;  5LGU A;  2DK5 A;  4R1H A;  1KYZ A;  3QP5 A;  5ICG A;  2VN2 A;  5FLX Z;  2VOO A;  3HOT A;  1GXP A;  1LB2 A;  4AVP A;  1R7J A;  1Z05 A;  1CGP A;  2A3S A;  3I53 A;  2H6C A;  3ECO A;  3PFI A;  2NNN A;  1FLI A;  1GVJ A;  1ZRC A;  4WCG A;  1KU7 A;  4EJO A;  4BXU A;  4OMY A;  1LDD A;  2ISY A;  4MNU A;  5DCF A;  1Q1H A;  2EK5 A;  4M73 A;  1FOK A;  5LGT A;  2P5K A;  3HHH A;  2FBH A;  4CXF A;  1PP8 F;  2PLY A;  2A6E F;  3BZ6 A;  1QNT A;  3BJA A;  1IN5 A;  3RI4 A;  4UNO A;  4G94 A;  5HVQ C;  4LK0 F;  4MGR A;  3JAM Z;  5DUI A;  4QWQ A;  3TDU C;  4Q47 A;  4UV8 A;  4HA8 A;  2JTV A;  4BQA A;  1ON2 A;  4UXN A;  5FFX A;  2PJP A;  1SD5 A;  4M6Y A;  2STT A;  1U3E M;  2R7F A;  1T0F A;  2L3D A;  1I1G A;  3WGI A;  3WU0 A;  5HLI A;  1CF7 A;  2FBI A;  2HYG D;  1UFM A;  4A6E A;  3HTU A;  3QAH A;  2FNA A;  5KK1 A;  1USS A;  3CJN A;  1Z91 A;  1BIB A;  3GFJ A;  2XVC A;  2W84 A;  4NHJ A;  4BAY A;  4I02 A;  4UVA A;  3E6C C;  3LAP A;  4L9T A;  4AD9 A;  1YW7 A;  1T2K A;  4JBA A;  2R7D A;  1RI7 A;  4A0Z A;  3GYH X;  1MDM B;  2DFI A;  4YG2 F;  3KZZ A;  3KLO A;  3R0J A;  3VOD A;  2EFN A;  2EV6 A;  4PGG A;  5D4S A;  4A12 A;  1R00 A;  3VFZ A;  4MHG A;  3MAJ A;  3LFK A;  2O8X A;  4ENK A;  2CW0 F;  3T8T A;  1S7A A;  4WF2 A;  2G7U A;  1HBX G;  3RKW A;  2LSO A;  3FXQ A;  3NRV A;  4EV0 A;  1YFH A;  1U5T C;  2E1N A;  1P4X A;  3CLO A;  3GO5 A;  1K78 B;  5HOO A;  2IT0 A;  4LJZ F;  4AIJ A;  1R1T A;  4I0B A;  4ENN A;  4HLY A;  3C1D A;  3GFL A;  4CO8 A;  2MBF A;  2IJL A;  5CJ9 A;  4ZH4 F;  2O3F A;  4FX0 A;  3FX3 A;  1BIA A;  3EET A;  5D4R A;  2VON A;  2K27 A;  3DV8 A;  5CLS A;  4JK1 X;  1R23 A;  3ELK A;  5A2Q Z;  2STW A;  1PP7 U;  3E6B A;  4OIQ F;  1X3U A;  1P4A A;  4IVN A;  4RS8 A;  5D6E A;  1O57 A;  4ON0 A;  1F5T A;  4EM1 A;  3LWF A;  5FLX K;  2E7W A;  4RAY A;  3MQ0 A;  2D45 A;  3SXY A;  1D8J A;  5BS6 A;  4Y13 A;  1W5T A;  3ZMD A;  4LFU A;  1S6L A;  2W24 A;  2Q8K A;  2ADU A;  2M1B A;  4WXC A;  4A5M A;  1ZGA A;  2XAJ A;  1SMY F;  2KIU A;  3TQN A;  1J5Y A;  1MJB A;  2ZME B;  1IXR C;  2BV6 A;  5E1W A;  5FFZ A;  3F8M A;  2JRT A;  1I6X A;  3ZMS A;  3IKV A;  3GF2 A;  1UHM A;  3V8L A;  5LHH A;  3GWZ A;  2XAG A;  4HOB A;  3V7S A;  3COA C;  4XRF A;  3JAM K;  4RGX A;  2L54 A;  2IVM A;  1FSH A;  3HSF A;  2F2E A;  3QPT A;  4ETS A;  2FBK A;  4WXD A;  2L01 A;  2VC1 A;  1LJ9 A;  2V1U A;  2P4W A;  1RZ4 A;  2ELH A;  2VT3 A;  2K7L A;  3TO7 A;  1B9N A;  1J75 A;  5DCM B;  3RIR A;  2QQA A;  4U88 A;  4RB2 C;  4L0Y B;  5AIP A;  2Z99 A;  2Z33 A;  3WTZ A;  3N4M A;  4DQ2 A;  1IZ1 A;  3TGN A;  2DPD A;  4EGY A;  3BP8 A;  3M1E A;  2G7H A;  3CTA A;  4L0Z B;  3SFZ A;  4IRH A;  4P96 A;  5F1R A;  3FF5 A;  4ZYD A;  4FHT A;  1SD6 A;  2AS5 F;  4LB5 A;  1ZG3 A;  3GFM A;  2ACJ A;  4N9I A;  5DDG A;  1FYM A;  3I59 B;  5TRD A;  2CGP A;  5D5W B;  1TQM A;  4ZYH A;  1SFU A;  1J2X A;  3TO6 A;  4K2E A;  4RAZ A;  5IT9 Z;  1E17 A;  2LF7 A;  5LEK A;  5K5R A;  1UB9 A;  2CQK A;  2ZNY A;  4CHU A;  1TBX A;  1O3S A;  4IPA A;  4BHP A;  1JHH A;  1U8R A;  1A04 A;  1MKM A;  4HF1 A;  2H94 A;  1UST A;  4P9U A;  3DPL C;  4YFN F;  2FXA A;  3IHU A;  1V3F A;  1H9T A;  2XKO A;  1IF1 A;  2J5O A;  2QBY B;  3DEU A;  3CO6 C;  1R5H A;  2PMH A;  2GAU A;  4UHT A;  5FD6 A;  1ONV A;  2PEX A;  3R61 A;  4ESB A;  3KFW X;  2Q0O A;  4G7Z F;  4KFC A;  2RC4 A;  1FSE A;  3WG9 A;  3LST A;  5D8K B;  5LHI A;  1FT9 A;  2UWM A;  3QOP A;  5H20 A;  4AIK A;  3DQV C;  2UZK A;  2QZ8 A;  3MFK A;  3IRR A;  2NNY A;  2QVO A;  3E97 A;  3F22 A;  4WWC A;  4CZZ A;  3WOD F;  2Y75 A;  3K1P A;  3CUQ C;  1KQ8 A;  2VC0 A;  3WU1 B;  4U7D A;  1Z7U A;  2ETH A;  2KJC A;  4GYI A;  1FX7 A;  3L2C A;  2GZW A;  3ISP A;  3RKX A;  5E8G A;  1GXQ A;  1R22 A;  5F64 A;  1D8K A;  3ERE D;  2PMU A;  2QWW A;  2EJR A;  5LEJ A;  2HTS A;  4ENJ A;  3K2Z A;  2VBZ A;  1TLH B;  3F8N A;  5AON A;  1KQ9 A;  3JW4 A;  4PGH A;  5HDN A;  4FT8 A;  4EQQ A;  3FMS A;  1W7P D;  2F5F A;  1FYK A;  2ZJ2 A;  3CO7 C;  3I54 A;  4A0Y A;  3LAJ A;  3E5Q A;  3E3V A;  2VBY A;  4A2U A;  3JSO A;  3GFI A;  1IXS B;  2M87 A;  4KIF A;  1RUO A;  4HQM A;  2IRF G;  1IXC A;  2MA3 A;  1O3Q A;  3MZY A;  3WE3 A;  2OZU A;  1VTN C;  2JZY A;  3I0T A;  4R8H A;  2HEO A;  3ULQ B;  2W85 A;  4YII A;  2FML A;  4MEY F;  2F5C A;  2QLZ A;  3OV8 A;  3HTS B;  2CWE A;  5E1Z B;  4ENM A;  3QRF F;  1K6O A;  5J8F A;  2QEN A;  3GVA A;  4GYG A;  2HTJ A;  4G6Q A;  3J80 Z;  2DLL A;  3KE2 A;  4UVB A;  1ZHF A;  3C18 A;  5L3C A;  1PUE E;  3P9C A;  1MJA A;  1LNW A;  4EM0 B;  3LQQ A;  1BI2 A;  4Q5S F;  4YFX F;  1TW2 A;  3MWM A;  4HX4 A;  4M9X A;  4L9N A;  4M9S A;  4EJW A;  3BWG A;  2DTR A;  1YG2 A;  4QLC U;  1ZAO A;  1K7A A;  1FYL A;  3WTY C;  3K9T A;  2DQR A;  4LLN A;  3RKY A;  2DK8 A;  3BDD A;  1O3R A;  3F23 A;  4IRG A;  2RDP A;  1AWC A;  5JHU A;  2XHK A;  5IT9 K;  1XD7 A;  2MH9 A;  1I5Z A;  3V8J A;  3K1M A;  2X0L A;  4KN4 X;  3BPX A;  1W7P A;  3KLN A;  3ZN0 A;  2PN6 A;  3SHF A;  4IHS A;  1EH8 A;  1O7L A;  1XN7 A;  2EB7 A;  2P5V A;  5ERI A;  1XGS A;  2FU4 A;  3IL2 A;  3E5U A;  1BI0 A;  2A5Y B;  1P4W A;  1JHF A;  1T39 A;  4HF2 A;  1OYY A;  3QU6 A;  2KRF A;  1EH6 A;  2L02 A;  2ZNZ A;  3L00 A;  4FX4 A;  2QM3 A;  3HUG A;  2JPB A;  3FMQ A;  5TJJ A;  3B02 A;  4ZZL A;  4HAM A;  2HKO A;  3VB2 A;  1LEB A;  3WTX C;  1QO0 D;  4UUV A;  4LG0 A;  1U78 A;  2Z9O A;  3W6K B;  3IC7 A;  2YR2 A;  2E1C A;  2V9V A;  4P55 A;  2QYO A;  2L4M A;  4KNY A;  5E8I A;  4JQF A;  1U5T A;  1Y0U A;  4RB0 A;  4I2O A;  2DBB A;  3WTT C;  1BI3 A;  1W5S A;  1O3T A;  2D1H A;  2F5D A;  3U2R A;  2MLG A;  4DNC A;  1SAX A;  4CGZ A;  3F8C A;  1BC7 C;  2Q2E A;  5FD5 A;  3K1N A;  5ICC A;  4HX7 A;  2AXL A;  3RTR A;  3HRT A;  2W57 A;  1L0O C;  2O03 A;  2RQP A;  3FWE A;  2HZT A;  5CVR A;  2H6B A;  4IJA A;  4OIR F;  3RYR A;  4M74 A;  2XKP A;  1TNT A;  4ZZD A;  3R0A A;  2ZBK A;  4S05 A;  2EA2 A;  3PQJ A;  1XGM A;  1ON1 A;  4OIN F;  1CF7 B;  1B4A A;  2V79 A;  1QPM A;  2M8E A;  3M7G A;  1BOA A;  3M8E A;  2CG4 A;  2OA4 A;  2J5P A;  4H0E A;  1PDN C;  2G9W A;  5AIQ A;  1B9M A;  1IW7 F;  4HZF A;  3J80 K;  1FNN A;  1SFX A;  4MTD A;  1J7K A;  1QQI A;  3HSE A;  5CVV A;  2ESH A;  4A5N A;  2XAQ A;  2D1V A;  2MD5 A;  3WTW C;  2H27 A;  2FQ3 A;  3KP4 A;  1MJ9 A;  3R4K A;  1HST A;  4XLN F;  3ZP5 A;  1T38 A;  4E70 A;  2FEZ A;  2IA0 A;  1D5V A;  3ZQ7 A;  2VXZ A;  4HV5 A;  2ESN A;  2FMY A;  1L3L A;  3KP6 A;  4KMF A;  3ABT A;  2XRO A;  2GIV A;  4GXO A;  4MQV A;  2M45 A;  2OU2 A;  3FMR A;  3TDZ C;  3BY6 A;  3ZMV A;  2HOE A;  3HYI A;  2A69 F;  1JGS A;  4KYW A;  3FZV A;  2QUF A;  1FP2 A;  1XSV A;  2B0L A;  2A68 F;  4L9V A;  4L9J A;  4N9H A;  1QZZ A;  1ZG1 A;  1F1Z A;  1IRF A;  3LA7 A;  4U0W A;  3T1B A;  1Z6R A;  1IN6 A;  4KIB A;  3RDI A;  1FBQ A;  1FY7 A;  3IWF A;  3CUO A;  2MLK A;  5L3B A;  2YSR A;  4UVC A;  3AAF A;  2K86 A;  1MD0 A;  3HSR A;  3O6B B;  3DXJ F;  3KCC A;  2VOD A;  1XGN A;  3HRS A;  2GA1 A;  5DEQ A;  2DI3 A;  1BN5 A;  1S8N A;  2EV0 A;  1FZP B;  3Q9V A;  2Y0M A;  4U0V A;  1AOY A;  4KMU X;  3M8F A;  5FGM A;  2QQ9 A;  4I01 A;  3ECH A;  1KYW A;  1LDJ A;  1HW5 A;  4L5J A;  1TQI A;  1XSX A;  3BRO A;  1YS7 A;  1YQA A;  1YW9 A;  3GLX A;  1BBY A;  4HDV A;  5HLH A;  1BJA A;  3I58 A;  1BM9 A;  2DT5 A;  1XDS A;  2OD5 A;  3MZH A;  3F72 A;  2BEO A;  1BI1 A;  3RPQ A;  3GX4 X;  1WRJ A;  1ZRF A;  4YIF A;  4YFK F;  2OZ6 A;  3LA2 A;  2WC2 A;  5L3E A;  2XIG A;  3P7N A;  3GW2 A;  1RNL A;  2BGC A;  4O6J A;  4A6D A;  3M9A A;  1DUX C;  4KT5 C;  2KJB A;  4WXH A;  4RB3 C;  4EJV A;  1DPR A;  4L5I A;  3DKW A;  1DP7 P;  3DF8 A;  4RGU A;  3KEO A;  3E6D A;  1WI9 A;  3KET A;  1NHA A;  1K79 A;  1YW8 A;  1KA8 A;  3F21 A;  4LB6 B;  2XAH A;  3O2P E;  3EYI A;  3MCZ A;  2VT2 A;  3HHG A;  3CUQ A;  1REP C;  3E5X A;  5LGN A;  1ZGJ A;  2QQB A;  4P9F A;  1G6N A;  4LLG F;  2GA2 A;  1LVA A;  1XMK A;  2P6T A;  3P9K A;  2R3S A;  2P6S A;  3GXO A;  3DP7 A;  1J9I A;  1B59 A;  5HLG A;  3ZMU A;  3GUD A;  4EM2 A;  3O3K A;  4P5O A;  3Q5F A;  5J8C A;  2V1D A;  4LD5 A;  1U2W A;  4TV7 A;  1HSJ A;  4B8X A;  1YYV A;  4ZYG A;  1FP1 D;  4O3M A;  2XRN A;  1B1B A;  5ILS A;  2PG4 A;  5CYV A;  4MEX F;  2A07 F;  3KP5 A;  4M72 A;  4S04 A;  4BH9 A;  2JSC A;  5LRS A;  4GO1 A;  4G8X A;  2VE8 A;  3FHZ A;  1LQ1 A;  4OU0 A;  2PFB A;  2IPQ X;  2UXX A;  3KP3 A;  2EWN A;  2MC3 A;  5CVI A;  2LDU A;  1XCV A;  1E2X A;  1Z1D A;  1I1S A;  1TQP A;  5E20 A;  1HW2 A;  3WGG A;  3CUQ B;  2K02 A;  2Z5U A;  3J7A O;  4O5V A;  3P9I A;  2YU3 A;  3I64 A;  1J59 A;  2P7C B;  4MTE A;  4I0A A;  1TW3 A;  2CFX A;  3QP6 A;  1OR7 A;  4G7H F;  2OAZ A;  3TKY A;  5BOX A;  4BNC A;  2HGC A;  3U9G A;  2LKP A;  2Y48 A;  2P5L C;  3JTH A;  4KIG A;  3B73 A;  1R1V A;  1JE8 A;  2NYX A;  5HDG A;  4G6D A;  3Q9S A;  4IRI A;  3MEX A;  3SZP A;  4RB1 A;  4RGS A;  1SD7 A;  2XV4 S;  1QBJ A;  2E7X A;  4KIC A;  2JT1 A;  5CVU A;  3F8B A;  4UV9 A;  1HW1 A;  3I71 A;  5BQT A;  2FE3 A;  4PCQ A;  4A0X A;  5E18 F;  5D6F A;  5BPI A;  1RUN A;  4CDG A;  5LHG A;  3FXR A;  2FRH A;  4ZYE A;  2A6H F;  4U0Y A;  1R36 A;  2UXN A;  1FBS A;  1OYI A;  2HFH A;  1R5G A;  5IT3 A;  2EV5 A;  1D3Y A;  2DPU A;  5JFR A;  1ODD A;  4OOI A;  2D2W A;  2CYY A;  1IUY A;  3QPH A;  1WWX A;  1XCB A;  3FM3 A;  4I7H A;  4HLX A;  3PQK A;  1H9G A;  3KP2 A;  2FF4 A;  2A61 A;  2WWY A;  5ICE A;  2BBY A;  3R6S A;  2IP2 A;  1WQ2 A;  2O61 A;  3L7W A;  5D5X B;  5D5U B;  1MDM A;  2P8T A;  4HW0 A;  5KVR A;  3F6V A;  4XSX F;  4NQW A;  4Q48 A;  2M5W A;  1YS6 A;  3ROU A;  3L9F A;  5ED4 A;  4KUM A;  2O0Y A;  1FC3 A;  4MQ9 F;  4LMY A;  4I98 B;  3F6O A;  2TDX A;  1KU2 A;  3G3Z A;  1K78 A;  3R60 A;  4Y17 A;  5DYM A;  1Z6T A;  2NS0 A;  3SZT A;  1KGS A;  2C6Y A;  2VBX A;  2IA2 A;  1IN4 A;  2EFO A;  4I09 A;  4EVI A;  2HDC A;  1U6G A;  1W7P B;  3HOS A;  5EEG A;  1LEA A;  2X4H A;  1YIO A;  4AIH A;  4GGG A;  2RN7 A;  1T98 A; 
#chains in the Genus database with same CATH topology
 1WSU A;  2WTE A;  4ITV A;  3F9K A;  4L5E A;  2RKH A;  3ASO H;  1EJ9 A;  4OIO F;  3WE2 A;  1P2F A;  1QHH D;  3I5U A;  1OPC A;  1DGW Y;  2L0K A;  1HXD A;  5K1Y A;  2KIM A;  1XMA A;  3KX2 A;  4EMS A;  2P7V B;  2XGE A;  3NQO A;  3F0C A;  3JCU C;  5BNG A;  1SVO A;  1SVM A;  1UHW A;  2V6C A;  1T0F C;  1MNE A;  2VI6 A;  3BR1 A;  1ZTR A;  3GEZ A;  4XRS G;  1OCP A;  5BPD A;  2KQR A;  3JRA A;  1FOX A;  3DEW A;  1MBE A;  3HUG B;  4UUS B;  3GBG A;  3F3X A;  2DU9 A;  3A01 A;  2LR8 A;  5BMZ A;  1YLF A;  4PDK A;  2YX4 A;  3CC2 I;  3CDH A;  2VQL A;  4KN7 X;  2JUG A;  1POG A;  2A05 A;  4ZDP A;  5DD8 A;  4EJT A;  3HOZ J;  2WAQ A;  1ACI A;  3IWZ A;  5JR3 A;  4U7B A;  1F36 A;  5DD4 A;  3WTV C;  3RJP A;  1MND A;  1F4K A;  3W2W A;  4LG0 B;  2BYV E;  5B5E C;  2DMN A;  5ILV A;  1XSD A;  3OOP A;  3TOB A;  2OQG A;  2ZME A;  3JRB A;  1N78 A;  1X1B A;  4LGW A;  5IPA A;  2E60 A;  1WPK A;  3C7J A;  2GWR A;  5IOZ A;  2VJ5 A;  3FXU A;  3ERM A;  3UNG C;  1F9N A;  1ZR4 A;  2HOS A;  1EF4 A;  3V7C A;  4S0H B;  3J7Z I;  6PAX A;  4Y7N J;  2N8G A;  3QU3 A;  4ESJ A;  2X6W A;  2ISZ A;  4C3I J;  1U5T B;  2QKL B;  3I9V 2;  3ZGK A;  2P0W A;  4XLP F;  2B63 J;  1MBK A;  3H1C A;  3LNQ A;  4XOP A;  4GCV A;  3AG2 H;  3DU6 A;  3D5L A;  3KEQ A;  4L18 B;  4FTH A;  5CQG A;  2IGN A;  2LG4 A;  4OIP F;  3CCV I;  2Q2E B;  2GXB A;  1ZLJ A;  2IW5 A;  5E79 C;  2M3A A;  4HDU A;  2E5Z A;  3VEP A;  3ZN1 A;  3NWT A;  3SDB A;  5KCM A;  1G3W A;  1MGT A;  3TO9 A;  4N0B A;  3LQR A;  1S7O A;  2GIZ A;  3BOQ A;  5F6F A;  2L9V A;  3N97 A;  1ORK A;  2VAS A;  1XGO A;  2Z3Y A;  2WB1 A;  1S29 A;  3HKZ A;  1VQN I;  3GTQ J;  1KU9 A;  1FPQ A;  3BJ6 A;  2L5Q A;  4MFD A;  3C3W A;  2W48 A;  4IXA A;  2PX9 A;  1STZ A;  5JVT A;  1HQC A;  3OR1 C;  4EJU A;  3U1D A;  5LBQ A;  3GZ5 A;  1HC8 A;  4M9Z A;  4Z2Y A;  2E2I J;  5DCM A;  1G4D A;  2EA4 A;  5EJC A;  2V1X A;  5FO5 A;  2PBI A;  2XAS A;  2XUB A;  5H2F C;  3PO3 J;  4YEL A;  5E17 F;  3IRQ A;  3K69 A;  3V4G A;  5D8L B;  1YO5 C;  1T95 A;  2CUZ A;  3BR5 A;  2PJR B;  1ZRD A;  3ZPL A;  1ZQ3 P;  2HYF A;  2LD5 A;  4KIT B;  1TWC J;  4B3A A;  2Z16 A;  4E7Z A;  3H3Z A;  3LSP A;  3EYY A;  2R92 J;  5TGT A;  1B6A A;  3CZ6 A;  4CH7 A;  1MBH A;  2DOD A;  3CCY A;  1T33 A;  5JHF A;  1D0X A;  3OYK A;  2BE5 F;  4HSR A;  1ZN2 A;  2O6G E;  4BYY A;  5C4J J;  5EEH A;  2F48 A;  3HRU A;  5K5Q A;  3K0L A;  3CD6 I;  2QEX I;  4RBO A;  3T5X A;  5K5O A;  2DN0 A;  2LKS A;  5FKM A;  1ETQ A;  5HS7 A;  4B4C A;  5L3F A;  1O7F A;  2XPU A;  4ZC3 A;  3JRG A;  1D5Y A;  1P6R A;  1JTX A;  2LKX A;  4HF0 A;  5H6R A;  2CUE A;  2ZKZ A;  3BG3 A;  1H0M A;  4HBL A;  2KIF A;  3I59 A;  2AO9 A;  1IAW A;  4KA4 A;  3GZ6 A;  3D0S A;  1WKM A;  3H92 A;  1IDY A;  2ZO4 A;  2DFE A;  1IGN A;  1WJE A;  1OKR A;  1TZL A;  1W36 C;  3DPT A;  2HDW A;  5EYR A;  4NDL A;  1YE9 A;  2FOK A;  3QPL A;  3J81 Z;  3AL0 C;  3K4C A;  2WV0 A;  3HEF A;  1VQ7 I;  2I5U A;  4BJ6 C;  1OMI A;  1YTY A;  1ZLK A;  2M34 A;  4EGZ A;  2OBP A;  2ZXI A;  3E6M A;  2PI0 A;  1IJW C;  1OIS A;  4FE4 A;  2NVQ J;  2I10 A;  4BQQ A;  4CIC A;  5KNL A;  3PJR A;  4RGR A;  2ZSI B;  4ESF A;  3F8F A;  5LRR A;  2HQR A;  2WAE A;  3VYS B;  2PQ8 A;  3ZQF A;  1UCR A;  3KPH A;  2DA4 A;  1SFO J;  3LSM A;  1JJ6 C;  1G3S A;  1S3J A;  3ZQG A;  4LLL A;  2QBY A;  4PJM A;  2LY2 A;  4X1E A;  5ILU A;  2JA7 J;  1FBU A;  3GTL J;  5FB2 A;  4BQN A;  2B9S A;  1HKS A;  1QU3 A;  3T8R A;  1RIO H;  4OMZ A;  1J0R A;  1U0J A;  4QPO A;  4IO9 F;  5L3D A;  2RAE A;  2LP0 A;  4II3 A;  5M3F J;  1XS9 A;  2ZFW A;  3GCM A;  5JI6 A;  1BR4 A;  2COM A;  3UR3 C;  2ZXJ A;  3RCO A;  5HDK A;  5E1X A;  4RLF A;  2K4B A;  2YX7 A;  2JJ7 A;  4M6X A;  4D7M A;  2HQA A;  1TTY A;  1QGP A;  1ZG5 A;  3EQL F;  3HGG A;  1G3T A;  3K4B A;  1D1C A;  4HV6 A;  1Y6I A;  1DPU A;  4R79 A;  2XAF A;  3TOA A;  5D5V B;  2KKO A;  3T0Y A;  1HDD C;  3K4L A;  2OQR A;  2ZCW A;  2JA8 J;  1IV8 A;  3LA3 A;  3KP7 A;  3LSK A;  2IBD A;  1BR2 A;  5H6Q A;  1MMA A;  1W4M A;  1VND A;  1ZAR A;  1Y1W J;  3WTS C;  2VE9 A;  2CUJ A;  3JSP A;  4JOM A;  1Y39 A;  3FM5 A;  4M3E A;  1JKR C;  1MMG A;  1F43 A;  1RKT A;  5J6X A;  3V8K A;  3AKZ A;  1LDK B;  1IRG A;  1ETY A;  1TNS A;  3L09 A;  2DW4 A;  3REO A;  3SQN A;  2VQH A;  2DO7 A;  1G59 A;  3DEE A;  1I39 A;  4M71 A;  4BKX A;  1Z9C A;  1X4P A;  5DUK A;  5DTD A;  3BQZ A;  2HS5 A;  3Q0U A;  2LNB A;  1FMV A;  4JYK A;  2F5E A;  3ML6 A;  1SMT A;  2VL8 A;  2NAZ A;  3FXK A;  2EFW A;  2NVU B;  4QPQ A;  3W6V A;  2NOJ B;  1YJW I;  1G8X A;  2DA3 A;  4XSZ F;  4BHC A;  4HRI A;  1QZY A;  4KDP A;  3IKT A;  1XB4 A;  2KIS A;  1PUF A;  1KU3 A;  2NRA C;  3W6J B;  3PIP F;  3Q0V A;  3H5R A;  1MZB A;  3EDP A;  3BG7 A;  1RES A;  2HDD A;  2FSW A;  2VOP A;  1ULY A;  1U8B A;  3RPU D;  1BL0 A;  2K9L A;  1Z3X A;  4G9Y A;  4A69 C;  5A2Q K;  2R7Q A;  2CMP A;  4PZJ A;  4A3F J;  2DAO A;  3S2W A;  3TP0 A;  4Q4Z F;  2HKX A;  1IN7 A;  2EFQ A;  2EFP A;  1KQ0 A;  4CYD A;  2AHQ A;  1IN8 A;  5CVJ A;  1CQT A;  4XKV A;  1JUS A;  1I50 J;  4GRI A;  3ABU A;  4B09 A;  1TWF J;  1EKE A;  3GTG J;  2HR3 A;  3NEU A;  3M07 A;  2KIQ A;  4F55 A;  1W1W E;  2DYS H;  1LFP A;  2L4A A;  4BDZ A;  2CQX A;  3ZMZ A;  3QOE A;  2JPC A;  2VBW A;  4HYE A;  2JVH A;  4XBF A;  4RDU A;  2LF8 A;  1P92 A;  2VLA A;  3H3U A;  2YS9 A;  1HKQ A;  1XDU A;  2F6C A;  2VB6 A;  5KAI C;  2FA5 A;  2H09 A;  2O7O A;  2GQQ A;  1T8I A;  5GPC A;  1SVL A;  4E7K A;  2EIN H;  1OYW A;  2XGD A;  2M30 A;  3DFG A;  2BXY A;  1R1U A;  4BHB A;  4BQO A;  5EZG A;  1ZRE A;  1UHS A;  5GTH C;  3BJO A;  2GXG A;  3HRM A;  5F0H A;  3PSF A;  3WGH A;  3RYP A;  2EIK H;  1EH7 A;  1HKT A;  2FNP A;  1DDN A;  3H9G A;  4DZP A;  2RVC A;  4NNJ A;  5HS9 A;  2RGV A;  5C4X J;  2HWV A;  3MMY B;  3H3V K;  4XLA A;  5F0C A;  1WJB A;  1V4R A;  3BPV A;  2K3P A;  3I4P A;  3VSL A;  2JA2 A;  4PJL A;  5DV5 A;  4D0P A;  4BE1 A;  3WTU C;  2YPR A;  3V7R A;  4ZYA A;  3JTG A;  2RV8 A;  3EUH A;  3CC4 I;  2CQQ A;  2VKE A;  3IH4 A;  3ZMT A;  2EZH A;  4E7J A;  3QYE A;  4F7Z A;  3CJQ B;  4HX8 A;  2F5V A;  4ASN A;  5ICF A;  2V1N A;  1FWZ A;  3S3M A;  1EV7 A;  5HS8 A;  5FRM A;  5J47 A;  2IGM A;  3LSG A;  3FXM A;  1SEU A;  4NB5 A;  3J81 K;  2HU9 A;  4E7H A;  2XGX A;  4UB6 C;  4IHT A;  2GOM A;  3S8P A;  4HQE A;  1OCT C;  1MIJ A;  3S32 A;  2MH2 A;  1G3Y A;  1C0W A;  3E1S A;  2HOT A;  2BXZ A;  1ZH5 A;  5L3G A;  1GHC A;  2W25 A;  3OYI A;  2GLO A;  1JXS A;  3S14 J;  4LK1 F;  3LSJ A;  3HIF A;  1HDP A;  3PNV A;  1BC8 C;  2CSO A;  2K4J A;  4XQF A;  2IA1 A;  3OYM A;  3BTJ A;  5CKT A;  5LLQ A;  4AWX B;  3IV5 A;  4F91 B;  3C2G A;  4WX9 A;  5EEA A;  4AM3 A;  2HQN A;  3M8J A;  1I27 A;  3OYN A;  1Y0N A;  1SD4 A;  4WK8 F;  1ZYR F;  3RPU A;  3G71 I;  4G7O F;  2CO5 A;  3KZY A;  1R58 A;  4U87 A;  2IS2 A;  2HZD A;  4IF4 A;  5C44 J;  4ANJ A;  1LE8 A;  3VOE A;  3I4M J;  4Y15 A;  1T6S A;  2RNJ A;  1SFE A;  3DCF A;  2DQL A;  1AU7 A;  3G73 A;  3SDG A;  5CPR B;  3FXJ A;  1X19 A;  5LGU A;  2DK5 A;  1IC8 A;  2OPT A;  3O8G A;  5KHD A;  1YHQ I;  1VQ9 I;  1VF9 A;  1OJL A;  3NAR A;  4R1H A;  2Y9Y A;  1KYZ A;  1AKH A;  5GAG J;  3QP5 A;  5ICG A;  2LYC A;  1RPW A;  5K7H A;  2VN2 A;  1B72 B;  3U1K A;  1Z77 A;  5FLX Z;  2KMU A;  1R4M B;  2KFD A;  2VOO A;  3HOT A;  1Z0X A;  3I56 I;  1IRX A;  3S93 A;  1GXP A;  1LB2 A;  4AVP A;  1R7J A;  1Z05 A;  1X2M A;  1CGP A;  3CJR B;  3VYR B;  1X58 A;  2A3S A;  2DFF A;  2OCE A;  3I53 A;  1SAU A;  2H6C A;  3ECO A;  3PFI A;  4FIS A;  4DYR A;  2NNN A;  2BY1 A;  2ZXH A;  1GVJ A;  1VZ0 A;  1YIJ I;  1WZ2 A;  1FLI A;  1ZRC A;  4WCG A;  1MBF A;  4E7S A;  1KU7 A;  4EJO A;  4BXU A;  2K9Q A;  4OMY A;  5M3M J;  4CCO A;  2GM4 A;  2HPM A;  1LDD A;  3ZQQ A;  5IP9 J;  1LKX A;  2ISY A;  2E2H J;  2JQ7 A;  4DBR A;  4MNU A;  5DCF A;  1Q1H A;  5J1U A;  1E0E A;  2EK5 A;  4YEJ A;  5J1Y A;  4M6V A;  4M73 A;  1FOK A;  5LGT A;  2P5K A;  2HVS A;  3HHH A;  3HGY A;  2FBH A;  4CXF A;  1PP8 F;  2DOE A;  4A3D J;  4HST A;  3JR9 A;  2PLY A;  3CCJ I;  1VQ8 I;  1WH5 A;  4AU7 A;  3H0D A;  2A6E F;  3DPU A;  3BZ6 A;  1YJN I;  1QNT A;  3BJA A;  3VYU B;  1IN5 A;  3RI4 A;  4UNO A;  4G94 A;  5HVQ C;  4F92 B;  3I4N J;  4LK0 F;  2W00 A;  3A02 A;  4MGR A;  1OCC H;  3ABK H;  3JAM Z;  4P1W A;  2EZL A;  5DUI A;  1WVR A;  4QWQ A;  2NVT J;  3TDU C;  4Q47 A;  4BEH B;  4UV8 A;  4HA8 A;  1J09 A;  3OYH A;  2JTV A;  4BQA A;  1ON2 A;  4BS9 A;  4UXN A;  2IEK A;  3KIO A;  5FFX A;  3CCR I;  1OCO H;  2PJP A;  1SD5 A;  4M6Y A;  3CP8 A;  2STT A;  1U3E M;  3LSI A;  5E3N A;  3OWT A;  1VFC A;  3FXL A;  1ZEL A;  2Y0S N;  3ZOB A;  1WJC A;  4BL0 B;  5IYB J;  2R7F A;  3OS1 A;  4XKW A;  3GTJ J;  1T0F A;  2L3D A;  3TED A;  3AFH A;  1I1G A;  5FKK A;  3WGI A;  1WJ5 A;  4HEA 2;  3WU0 A;  2EIM H;  5HLI A;  3RZO J;  2JUC A;  2FBI A;  1CF7 A;  1QPI A;  2HYG D;  1UFM A;  2W4S A;  4A6E A;  2Y2Z A;  2PMZ A;  3HTU A;  3QAH A;  3DKY A;  4PFP A;  1X1D A;  2FNA A;  5KK1 A;  1USS A;  3ESW B;  3CJN A;  1JKO C;  1Z91 A;  3H9Q A;  4KIS A;  4BBS J;  1BIB A;  2X1C A;  1APL C;  3GFJ A;  2XVC A;  4IHY A;  4IEJ A;  2W84 A;  1DQU A;  4BAY A;  1XTA A;  4NHJ A;  4C2T A;  1JKQ C;  4UY8 I;  5J4Y A;  4NC8 A;  3DBR B;  4I02 A;  1X2N A;  4UVA A;  3E6C C;  3OSF A;  3LAP A;  1W36 D;  3PNY A;  1GDT A;  4L9T A;  1TWA J;  4AD9 A;  1YW7 A;  1MMS A;  2R5Z B;  2X51 A;  1T2K A;  1V5F A;  1XPX A;  1NK3 P;  4JBA A;  2R7D A;  1RI7 A;  2KPM A;  4A0Z A;  3GYH X;  4XLF A;  1MDM B;  2DFI A;  2X6Y A;  4YG2 F;  1FTT A;  3KZZ A;  3KLO A;  3R0J A;  3VOD A;  1WH7 A;  4GFB A;  2EFN A;  3OYJ A;  1VQ4 I;  2EV6 A;  4PGG A;  5D4S A;  3BR0 A;  3OYE A;  1WCM J;  4B44 A;  4A12 A;  1R00 A;  3VFZ A;  4MHG A;  4NQW B;  2CV0 A;  3MAJ A;  2K5C A;  2O8X A;  3DBH B;  2FQ4 A;  3LFK A;  1A31 A;  3SYT A;  1HF0 A;  5J3L A;  4ZJZ A;  4ENK A;  4NBQ A;  1RET A;  3OIO A;  3OR2 C;  2IGK A;  1DGR M;  5GAE J;  2CW0 F;  2BY0 A;  3T8T A;  4IOA F;  1S7A A;  4WF2 A;  2G7U A;  1HBX G;  2O9L A;  3RKW A;  3B6A A;  2LSO A;  3FXQ A;  1B8I B;  3NRV A;  4RMN A;  4EV0 A;  3WHC A;  3J7Y J;  4XRM A;  4W1U A;  1YFH A;  1LFU P;  1U5T C;  3DTK A;  2E1N A;  1P4X A;  3CLO A;  3GO5 A;  3QYB A;  1K78 B;  1MH3 A;  2DDB A;  5HOO A;  2CS3 A;  1PVE A;  2IT0 A;  2LBF B;  1UEL B;  4LJZ F;  2ELK A;  2V9P A;  4AIJ A;  4HG2 A;  5B66 C;  3G2B A;  3A03 A;  1R1T A;  4I0B A;  4ENN A;  4HLY A;  3C1D A;  3GFL A;  4CO8 A;  2XC7 A;  2MBF A;  2IJL A;  5CJ9 A;  1VQL I;  4ZH4 F;  2R7W A;  2O3F A;  1WI3 A;  4FX0 A;  4IHV A;  1VQK I;  3FX3 A;  4Y52 J;  1BIA A;  3EET A;  2L7K A;  5D4R A;  2VON A;  2K27 A;  5E3L A;  3DV8 A;  5CLS A;  4B48 A;  2LTP A;  4JK1 X;  1R23 A;  1I6H J;  4DBQ A;  1TP4 A;  3ELK A;  1X3W B;  1BJZ A;  5A2Q Z;  3UKG A;  3JRH A;  2STW A;  4HPQ A;  1PP7 U;  3E6B A;  4OIQ F;  1X3U A;  4LG3 A;  3IAM 2;  1P4A A;  4IVN A;  2LLK A;  4RS8 A;  4ZTJ A;  2HVR A;  5E3O A;  4QSH A;  3JRE A;  4F52 A;  5D6E A;  3D1N I;  1O57 A;  4UB8 C;  1JUM A;  2VJI A;  1ETX A;  4ON0 A;  4LIV A;  1F5T A;  2ZB9 A;  4EM1 A;  3LWF A;  5FKN A;  5FLX K;  2LVS A;  1I3A A;  2E7W A;  2CJJ A;  3I55 I;  3KYL A;  1Z21 A;  4RAY A;  4B3X A;  3OYA A;  3MQ0 A;  3A01 B;  3PUB A;  2D45 A;  3SXY A;  3SEZ A;  1ETO A;  1DP3 A;  1D8J A;  1X1A A;  5BS6 A;  3H9J A;  2I8D A;  4Y13 A;  1W5T A;  3ZMD A;  4C2U A;  4LFU A;  1S6L A;  2W24 A;  3ZQC A;  2Q8K A;  2ADU A;  2M1B A;  4WXC A;  2X6X A;  2XPW A;  4A5M A;  1ZGA A;  2XAJ A;  1SMY F;  2KP6 A;  2KIU A;  3TQN A;  1J5Y A;  2R4G A;  1MJB A;  2ZME B;  1IXR C;  1YJ9 I;  2BV6 A;  2LC2 A;  1ZK8 A;  5E1W A;  4E7L A;  5FFZ A;  3F8M A;  1OCR H;  4N4O B;  2JRT A;  4J00 A;  1I6X A;  4JP0 A;  3ZMS A;  3IKV A;  4A3L J;  2DA6 A;  3GF2 A;  1UHM A;  3V8L A;  2TCT A;  2YUS A;  5LHH A;  4M3F A;  3OS0 A;  4XID A;  1QVT A;  4E7I A;  3GWZ A;  2FX0 A;  2XAG A;  1T56 A;  4HOB A;  2K3F A;  3V7S A;  1ETV A;  1QHG A;  3I3L A;  3COA C;  3OYG A;  5FLV A;  4XRF A;  2HI3 A;  2L7Z A;  3L1P A;  3JAM K;  5F08 A;  1ZGW A;  3QQA A;  4RGX A;  4B47 A;  2JK3 A;  2L54 A;  2IVM A;  3HOW J;  4BXX J;  1FSH A;  3HSF A;  2F2E A;  3QPT A;  4ETS A;  3SJM A;  3RZD J;  1MSF C;  3HPH A;  4FQG A;  1IO2 A;  2KDO A;  2FBK A;  2LY9 A;  4WXD A;  2WV1 A;  3G1L A;  4DYC A;  5EGO A;  2L01 A;  1A6Q A;  2VC1 A;  5J1R A;  1LJ9 A;  2V1U A;  2P4W A;  1RZ4 A;  2ELH A;  3ASN H;  2VT3 A;  1JKP C;  2K7L A;  3TO7 A;  1B9N A;  2L9S A;  3CCE I;  5JVG F;  4Z6Y A;  1J75 A;  5DCM B;  3RIR A;  2QQA A;  4U88 A;  2X9D A;  2XF5 A;  3A1Y A;  4RB2 C;  4L0Y B;  4YRV A;  5AIP A;  2Z99 A;  2Z33 A;  3WTZ A;  2R93 J;  3N4M A;  2DMU A;  4DQ2 A;  1IZ1 A;  3AL0 B;  3TGN A;  2DPD A;  3G1M A;  4EGY A;  3O8H A;  3BP8 A;  3M1E A;  2G7H A;  3CCL I;  2CH0 A;  3CTA A;  4PK4 A;  4L0Z B;  3H35 A;  3BTL A;  1MH4 A;  3HBL A;  3QPS A;  1NG6 A;  4I6Z A;  2DCE A;  2BW3 A;  4OAY A;  1K83 J;  5DM7 F;  3WU2 C;  2KT0 A;  3SFZ A;  2V6E A;  3IH3 A;  3G4S I;  1IG7 A;  4IRH A;  3LMM A;  1RR8 C;  1XC5 A;  2MYS A;  4P96 A;  5F1R A;  2ZXW H;  3FF5 A;  4ZYD A;  4FHT A;  1SD6 A;  3WG7 H;  2AS5 F;  4LB5 A;  2A5W A;  1ZG3 A;  3GFM A;  1VQP I;  2X6O A;  2ACJ A;  4N9I A;  5DDG A;  2R0Q C;  4BY1 J;  2CUF A;  1BOB A;  1DU6 A;  1FYM A;  3ZQI A;  2L9R A;  3L2W A;  3I59 B;  2OTL I;  5TRD A;  4XLC A;  3HPG A;  2CGP A;  5D5W B;  1TQM A;  4ZYH A;  1SFU A;  3H0G J;  1J2X A;  3TO6 A;  1K4S A;  1ENH A;  4K2E A;  4RAZ A;  5LD2 C;  5IT9 Z;  1E17 A;  2HPI A;  2LF7 A;  5M5W J;  4JX6 A;  3OYD A;  2W82 A;  5LEK A;  5K5R A;  1UB9 A;  2CQK A;  2ZNY A;  3DLA A;  5FLM J;  4X0G A;  2LOO A;  2CFO A;  2CW8 A;  1TWG J;  4CHU A;  1TBX A;  5EGO B;  1O3S A;  4IPA A;  4BHP A;  5DM6 F;  4Y4R A;  1JHH A;  1E3H A;  3ABM H;  1U8R A;  2QF7 A;  1A04 A;  1MKM A;  1XX5 A;  1QRY A;  4HF1 A;  2H94 A;  2HVQ A;  1MMN A;  3PFY A;  1UST A;  4P9U A;  4F3Q A;  3DPL C;  4YFN F;  3FKI J;  2FXA A;  2L2O A;  3IHU A;  3K4K A;  4AYB N;  1V3F A;  1WHU A;  3SEQ A;  2M4G A;  1H9T A;  5GPA A;  3BCB A;  2FUG 2;  2HQ5 A;  4XM3 A;  2XKO A;  1IF1 A;  4V19 K;  2J5O A;  2QBY B;  3DEU A;  4AC0 A;  3CO6 C;  3OSG A;  1R5H A;  2PMH A;  2GAU A;  4UHT A;  5FD6 A;  1ONV A;  2PEX A;  3X2Q H;  3R61 A;  4ESB A;  5JLW A;  3KFW X;  1SC7 A;  2Q0O A;  1S7E A;  4G7Z F;  4KFC A;  3M1C A;  2RC4 A;  1FSE A;  3WG9 A;  4AUX A;  2VUM J;  4EAT A;  3LST A;  2E1M B;  3S2H J;  3KEY A;  5D8K B;  3DWL E;  4BJ5 C;  5LHI A;  1FT9 A;  2HOA A;  4PFO A;  2UWM A;  3QOP A;  5H20 A;  4AIK A;  3BZC A;  3DQV C;  5KAF C;  2UZK A;  4XL9 A;  2TRT A;  4BBR J;  2QZ8 A;  2RNG A;  3MFK A;  3IRR A;  2NNY A;  2QVO A;  2DDA A;  2VKH A;  3CQZ J;  2VIX A;  3E97 A;  2E19 A;  2JMW A;  3F22 A;  1Y1V J;  4WWC A;  4CZZ A;  3OYC A;  4D9J A;  1E3P A;  2AQF A;  3HB9 A;  3WOD F;  2Y75 A;  3K1P A;  2CV1 A;  1R6R A;  3RSN A;  2V26 A;  3CUQ C;  3S15 J;  3NWS A;  1KQ8 A;  2VC0 A;  3WU1 B;  2UV1 A;  4A3B J;  4U7D A;  1MW7 A;  1Z7U A;  2ETH A;  2KJC A;  4GYI A;  1FX7 A;  3L2C A;  2GZW A;  3ISP A;  3RKX A;  5E8G A;  3MKZ A;  3PL8 A;  2KDZ A;  1GXQ A;  1R22 A;  5F64 A;  1R71 A;  1D8K A;  3ERE D;  2MFZ A;  1ZKG A;  2PMU A;  2NS7 A;  5HNF A;  2XDV A;  2QWW A;  1W0U A;  3IAS 2;  2EJR A;  5LEJ A;  2HTS A;  4ENJ A;  3K2Z A;  2R5Y A;  3K70 C;  2VBZ A;  1NK2 P;  2MGQ A;  2OUM A;  1TLH B;  3PM1 A;  1H8A C;  3F8N A;  1X4O A;  4CZC A;  4BY7 J;  5AON A;  2ECC A;  1KQ9 A;  3CES A;  2L7F P;  3JW4 A;  4PGH A;  5HDN A;  1LPQ A;  4FT8 A;  3OMY A;  4EQQ A;  3FMS A;  1W7P D;  1R5I D;  3CCS I;  1JT6 A;  2F5F A;  2AXT C;  2RQQ A;  2ZJ2 A;  1PUF B;  2ZJR F;  3CO7 C;  1FYK A;  3CJT B;  4JX4 A;  2WBM A;  2M8G X;  3I54 A;  4A0Y A;  2DTZ A;  3LAJ A;  5IOY A;  3E5Q A;  3E3V A;  2VBY A;  4A2U A;  3L2U A;  3CC7 I;  3EUA A;  1NTC A;  3JSO A;  1AHD P;  4IOC F;  2BHZ A;  3GFI A;  1IXS B;  2M87 A;  4KIF A;  1SFK A;  4MLO A;  2MW8 A;  3D5S C;  1RUO A;  4HQM A;  2DA1 A;  4I76 A;  4DJA A;  2IRF G;  1IXC A;  2MA3 A;  1IDZ A;  1P7J A;  3HZJ A;  4NC6 A;  1O3Q A;  3MZY A;  3WE3 A;  5EG0 A;  2O5R A;  1WJA A;  2OZU A;  3BLY A;  4IHW A;  4LOC A;  1VTN C;  2JZY A;  3I0T A;  4PJN A;  4R8H A;  2HEO A;  3S16 J;  1RRJ A;  3ULQ B;  1KZH A;  3CMY A;  2W85 A;  4YII A;  1ITY A;  3QWL A;  2FML A;  3B6C A;  5IP7 J;  4MEY F;  2F5C A;  4QIW N;  2QLZ A;  4IHX A;  1Y8Q B;  2EZI A;  3OV8 A;  2CWE A;  5E1Z B;  2JSP A;  4ENM A;  3QRF F;  1K6O A;  3HTS B;  5J8F A;  2QEN A;  3GVA A;  4GYG A;  1ETK A;  2K9M A;  4F93 B;  1ETW A;  2HTJ A;  2K40 A;  2K9N A;  1S9H A;  2M0M A;  3HJE A;  2DLL A;  3KE2 A;  4G6Q A;  1V55 H;  4PSW A;  4UVB A;  1ZHF A;  3CME I;  1PYV A;  3C18 A;  5L3C A;  1S72 I;  1PUE E;  5M5X J;  3KYC B;  1MJA A;  3P9C A;  1LNW A;  4EM0 B;  3MKW B;  3LQQ A;  1BI2 A;  2LRD A;  5C3E J;  4BJT A;  4Q5S F;  4YFX F;  1YRN A;  1TW2 A;  3MWM A;  1UG0 A;  3FIW A;  2CQN A;  4HX4 A;  4CYC A;  4M9X A;  3BR6 A;  2LK2 A;  4L9N A;  4M9S A;  4EJW A;  3VDX A;  3BWG A;  4BAC A;  2DTR A;  2K9S A;  1YG2 A;  1FIP A;  1RR7 A;  4QLC U;  1ZAO A;  3CDL A;  1UG2 A;  1K7A A;  1FYL A;  3WTY C;  3K9T A;  1OQY A;  2DQR A;  3CDI A;  4LLN A;  3RKY A;  2DK8 A;  1WGX A;  3BDD A;  3MD2 A;  3M3Y J;  1A5J A;  1O3R A;  2BY2 A;  5DS9 A;  3F23 A;  2WAD A;  2X48 A;  4IRG A;  2RDP A;  2VPR A;  1YX5 A;  4HNV A;  1AWC A;  5JHU A;  4PUS A;  5F1J A;  2FOW A;  3HXL A;  2XHK A;  2XSJ C;  2ME6 A;  5IT9 K;  1XD7 A;  1X3Z B;  1MBG A;  2MH9 A;  3IH2 A;  2W7N A;  1I5Z A;  2HYJ A;  3V8J A;  2EZK A;  3K1M A;  2X0L A;  4KN4 X;  3AG3 H;  3BPX A;  3TBI A;  3WHB A;  2LH9 A;  1HCR A;  1W7P A;  3KLN A;  3ZN0 A;  1R9T J;  4D1Q A;  2PN6 A;  3SHF A;  3ZQL A;  5HNH A;  1EH8 A;  3IP4 B;  4IHS A;  1O7L A;  1XN7 A;  2EB7 A;  2P5V A;  5ERI A;  1JI8 A;  1XGS A;  2FU4 A;  4A3K J;  3IL2 A;  4J19 A;  3E5U A;  2IS1 A;  1BI0 A;  4A3G J;  2A5Y B;  1P4W A;  2HXI A;  2R7Z J;  1K4T A;  2XSD C;  1LE8 B;  2NVX J;  4IKF A;  1JHF A;  3IUO A;  1T39 A;  4HF2 A;  1OYY A;  2ME0 A;  3H5N A;  3H5A A;  2EIJ H;  3QU6 A;  2KRF A;  1EH6 A;  2L02 A;  1U9O A;  2ZNZ A;  3FXO A;  3L2Q A;  2OF7 A;  1D0Z A;  3L00 A;  4FX4 A;  3S1Q J;  3PSI A;  2QM3 A;  3HUG A;  2JPB A;  5JLX A;  3FMQ A;  4UUS A;  5TJJ A;  1AKH B;  3B02 A;  3K10 A;  2ZJP F;  4ZZL A;  2PMZ N;  2QGU A;  3JRC A;  3ZRG A;  4HAM A;  2HKO A;  4IX7 A;  1YIT I;  1UAA A;  3VB2 A;  3JRF A;  1LEB A;  3WTX C;  2EBI A;  1QO0 D;  3BZK A;  2DT7 B;  1LVK A;  4RAF A;  4UUV A;  1I3Q J;  3GME A;  2HXO A;  4LG0 A;  1U78 A;  3OYB A;  2Z9O A;  2E34 A;  3W6K B;  3IC7 A;  1D1B A;  2W1O A;  2YR2 A;  5LFA A;  1Y8R B;  2E1C A;  2V9V A;  1OLT A;  2DJI A;  3BG5 A;  4P55 A;  3A0B C;  4BE2 A;  2QYO A;  4C3H J;  5K7F A;  1QZE A;  2L4M A;  4KNY A;  5E8I A;  2IAI A;  4A3J J;  2COB A;  4JQF A;  1U5T A;  2F4O B;  4MIM A;  2Y0S A;  5E3M A;  1Y0U A;  4RB0 A;  1O4X A;  4I2O A;  2DBB A;  3WTT C;  1BI3 A;  1QVU A;  1W5S A;  2O8K A;  3CMA I;  1O3T A;  2D1H A;  2F5D A;  3U2R A;  2MLG A;  4DNC A;  1SAX A;  4DZJ A;  4CGZ A;  3F8C A;  1TT5 B;  4LIU A;  3OS2 A;  3GZN B;  1BC7 C;  2Q2E A;  5FD5 A;  3OY9 A;  3K1N A;  5EDN A;  2ID6 A;  3OOU A;  5ICC A;  1IRZ A;  5GTI C;  4HX7 A;  2R7X A;  2AXL A;  2WAQ N;  3RTR A;  3HRT A;  2QKM B;  3OL4 A;  2W57 A;  3G6E I;  1L0O C;  2O03 A;  2K85 A;  3S2D J;  2RQP A;  3FWE A;  2HZT A;  5CVR A;  2H6B A;  3RQI A;  4G12 A;  3HOX J;  3FHN A;  4IJA A;  4OIR F;  3RYR A;  3VPR A;  4M74 A;  2XKP A;  1TNT A;  4ZZD A;  3R0A A;  2ZBK A;  3PUF A;  4EEF G;  4S05 A;  2EA2 A;  3EUK L;  2PJR A;  3PQJ A;  2DOF A;  1XGM A;  1ON1 A;  2XAU A;  4OIN F;  3LSR A;  4N4N B;  4XKC A;  1CF7 B;  3BC8 A;  1B4A A;  4IZZ A;  2V79 A;  4D5F A;  1QPM A;  3RKQ A;  3S1M J;  4M3G A;  2M8E A;  3M7G A;  1XMX A;  1BOA A;  2XB5 A;  3M8E A;  4ZDO A;  3OYF A;  2CG4 A;  1GUU A;  2V4J C;  2OA4 A;  2J5P A;  4H0E A;  1PDN C;  1UZC A;  2G9W A;  2XF7 A;  2XRL A;  5AIQ A;  1HOM A;  2ZC2 A;  1B9M A;  2E35 A;  3KYD B;  1IW7 F;  4HZF A;  4E4H A;  3J80 K;  1FNN A;  1SFX A;  2WB1 N;  1ERD A;  4MTD A;  3HKZ N;  1J7K A;  2VJ4 A;  1QQI A;  3HSE A;  5CVV A;  2ESH A;  4A5N A;  4XKB A;  2XAQ A;  4QTR A;  3K7A J;  2D1V A;  2MD5 A;  2R7O A;  4IL6 C;  2X85 A;  3JRD A;  3WTW C;  2H27 A;  2FQ3 A;  4KJZ A;  4NUB A;  2GOX B;  3KP4 A;  1MJ9 A;  3R4K A;  1HST A;  3SFI A;  2VPL A;  2A6T A;  4XLN F;  3ZP5 A;  1T38 A;  4E70 A;  2FEZ A;  2IA0 A;  1D5V A;  3ZQ7 A;  2CV2 A;  2VXZ A;  2M4K A;  3HOV J;  3J80 Z;  4M3B A;  4PJJ A;  3LOC A;  4W97 A;  5F27 A;  4HV5 A;  2DMT A;  2ESN A;  2FMY A;  1L3L A;  3KP6 A;  4KMF A;  2M7A A;  2JVG A;  3ABT A;  4CA0 A;  2XRO A;  2ZME C;  1OCZ H;  2DA2 A;  2GIV A;  3AG4 H;  4GXO A;  4MQV A;  2M45 A;  2OU2 A;  3FMR A;  3TDZ C;  3K4M A;  3BY6 A;  3K4N A;  3ZMV A;  2DXI A;  3P5J A;  2IS6 A;  2HOE A;  3HYI A;  1Y56 A;  2P81 A;  2HNH A;  2A69 F;  3W2V A;  1JGS A;  4KYW A;  3FZV A;  2QUF A;  1FP2 A;  1MSE C;  1XSV A;  2B0L A;  3CCU I;  3PIO F;  2A68 F;  3K4J A;  3W3C A;  4L9V A;  1EA3 A;  4L9J A;  4N9H A;  2EIL H;  2JA5 J;  1QZZ A;  1ZG1 A;  1F1Z A;  1IRF A;  3LA7 A;  4U0W A;  2H8W A;  3T1B A;  2ICW G;  2L9N A;  1Z6R A;  1IN6 A;  4XOR A;  4KIB A;  3RDI A;  3Q3S A;  4XLE A;  1IV6 A;  1JTY A;  1FBQ A;  3DU5 A;  1FY7 A;  3IWF A;  1P7I A;  3CUO A;  3TMO A;  2MLK A;  5L3B A;  2QCO A;  2YSR A;  4UVC A;  3AAF A;  1N77 A;  4XN3 A;  4MFE A;  2K86 A;  2R7R A;  3CCQ I;  2BY3 A;  2WY8 Q;  2M0C A;  1A35 A;  4CCN A;  1MD0 A;  5F0F A;  3HSR A;  4BGD A;  3O6B B;  3DXJ F;  3KCC A;  3A4C A;  4CSW A;  1NH3 A;  3FBI B;  2VOD A;  1TL8 A;  3W2A A;  3A2K A;  3C2B A;  1XGN A;  2ELJ A;  3FK7 A;  3PO2 J;  3HRS A;  2GA1 A;  5DEQ A;  3GTM J;  2DI3 A;  3CLQ A;  2BVM A;  3HG9 A;  2JWT A;  4BU2 A;  2F4I A;  1BN5 A;  4CCL A;  1S8N A;  2EV0 A;  2OJE D;  3SZG A;  1FZP B;  3Q9V A;  3K70 D;  2Y0M A;  1P9Q C;  2BHY A;  4U0V A;  1HLV A;  5GAD J;  1AOY A;  4KMU X;  4PSX A;  3M8F A;  5FGM A;  2QQ9 A;  4I01 A;  1BW5 A;  4CCM A;  3ECH A;  1YI2 I;  1KYW A;  1LDJ A;  1HW5 A;  4L5J A;  3VSK A;  2VJJ A;  4CCK A;  4XRS A;  5IY5 H;  1TQI A;  2OV7 A;  1XG1 A;  1XSX A;  3HC7 A;  4D5C A;  2QA4 I;  1QA6 A;  4V2G A;  3BRO A;  5FRN A;  3ZCO A;  1YS7 A;  1YQA A;  1YW9 A;  2E71 A;  2H1K A;  2KRC A;  3S1N J;  5TIS C;  3GLX A;  1BBY A;  1HA8 A;  3HDD A;  3QYF A;  4DOZ A;  1FOW A;  4LIT A;  4HDV A;  5HLH A;  1BJA A;  2KLO A;  2ZJQ F;  2IGO A;  2EPF A;  3I58 A;  1BM9 A;  2DT5 A;  3BTC A;  2V7F A;  2KZV A;  2ZSH B;  1XDS A;  2OD5 A;  1Q1V A;  4YIR X;  3MZH A;  3F72 A;  2MD0 A;  2BEO A;  2H8R A;  1BI1 A;  3RPQ A;  2E5N A;  3HM5 A;  1WRJ A;  4XN0 A;  4DYQ A;  3GX4 X;  3C2H A;  1ZRF A;  3GTK J;  4YIF A;  4YFK F;  1RKW A;  2OZ6 A;  2AQE A;  3LA2 A;  2WC2 A;  5L3E A;  1VQ5 I;  2DMQ A;  2XIG A;  4A3C J;  2YU9 J;  1A36 A;  3GLL A;  2DOA A;  3GW2 A;  1RNL A;  2BGC A;  3P7N A;  4O6J A;  3ZXS A;  4A6D A;  1BW6 A;  2RRE A;  3M9A A;  1DUX C;  1X1C A;  4KT5 C;  1FEX A;  1GLN A;  4ZDL A;  2KJB A;  3MKY B;  4WXH A;  4RB3 C;  3BCA A;  4EJV A;  1FIA A;  1DPR A;  4L5I A;  3N05 A;  4JX5 A;  3DKW A;  1DP7 P;  3DF8 A;  4RGU A;  2V9K A;  3KEO A;  3E6D A;  1WI9 A;  2F4M B;  3CP2 A;  3KET A;  1NHA A;  1VQ6 I;  1K79 A;  1YW8 A;  2CRG A;  2KRH A;  2R7T A;  1KA8 A;  1KON A;  3F21 A;  1JGG A;  3DTE A;  4ZTF A;  2M2E A;  4LB6 B;  4II2 A;  2XAH A;  1FOY A;  1UMQ A;  3MKL A;  3O2P E;  3EYI A;  3MCZ A;  3FK6 A;  2JA6 J;  2VT2 A;  3HHG A;  1MBJ A;  3L2V A;  3CUQ A;  3VWB A;  2D5V A;  4B1R A;  2EQR A;  2E1M C;  1REP C;  4D7N A;  3E5X A;  2OTJ I;  5LGN A;  1ZGJ A;  2QQB A;  2VKD A;  4P9F A;  1G6N A;  2MAB A;  2DYR H;  4LLG F;  2GA2 A;  5J4V A;  3LFU A;  2ECB A;  1LVA A;  3QOD A;  1GV5 A;  1XMK A;  2P6T A;  4KT6 A;  2DMP A;  3P9K A;  3BR3 A;  2UUZ A;  2R3S A;  2P6S A;  3GXO A;  3DP7 A;  2BW3 B;  1GT0 C;  1J9I A;  1B59 A;  2E36 A;  2Z2S B;  3ZMU A;  5HLG A;  4G6T B;  3GUD A;  1NG7 A;  3S3O A;  1RC9 A;  4AYB A;  4EM2 A;  2Y69 H;  3TL4 X;  3O3K A;  4P5O A;  3ZR8 X;  3Q5F A;  4A3I J;  2WA0 A;  5CQE A;  2OCC H;  4IQ4 A;  2VKV A;  2NS8 A;  5J8C A;  2V1D A;  3E7L A;  3OIQ A;  2Y31 A;  4DIQ A;  4FCY A;  4LD5 A;  5IYD J;  1U2W A;  3BG6 A;  4TV7 A;  2BVL A;  4BUP A;  1HSJ A;  4B8X A;  1YYV A;  5B1B H;  4CUG A;  4ZYG A;  1FP1 D;  1GV2 A;  3OL3 A;  4M3D A;  5HLT A;  4O3M A;  1FTZ A;  2XRN A;  1TWH J;  4XLH A;  3OYL A;  1B1B A;  5ILS A;  2XPV A;  2DA5 A;  4FE7 A;  2NXN B;  2PG4 A;  3RQ4 A;  4OAZ A;  5CYV A;  2OC6 A;  4MEX F;  2A07 F;  3KP5 A;  4M72 A;  4S04 A;  2G0E A;  3GTP J;  4BH9 A;  2JSC A;  3A0H C;  5LRS A;  4GO1 A;  3DTI A;  5FKL A;  5M5Y J;  4G8X A;  2VE8 A;  3HOU J;  3HL2 A;  3FHZ A;  2JN6 A;  2QSF X;  3MVP A;  1TT0 A;  4OU0 A;  4DGW B;  1LQ1 A;  1R49 A;  2PFB A;  3K2A A;  3ONQ A;  1JUP A;  4PJ0 C;  5FRO A;  1BR1 A;  1MMD A;  2XGC A;  2IPQ X;  2UXX A;  2E1O A;  1FMW A;  3KP3 A;  5J40 A;  2EWN A;  4C9Y A;  2MC3 A;  1K61 A;  3G1O A;  1T08 B;  5CVI A;  3DBL B;  4BXF A;  2LDU A;  1A6I A;  1XCV A;  1E2X A;  1Z1D A;  2DFH A;  1I1S A;  1TQP A;  5E20 A;  1HW2 A;  3WGG A;  2X1D A;  3V42 A;  4B43 A;  3CUQ B;  2K02 A;  2Z5U A;  1WJD A;  3LL7 A;  3J7A O;  3CMM A;  4O5V A;  3BT9 A;  5B3S H;  3P9I A;  2YU3 A;  4XR6 A;  1GVD A;  3I64 A;  1J59 A;  3FKJ A;  5EF6 A;  2DT6 A;  3S3N A;  1B72 A;  2P7C B;  3ZQH A;  1Z67 A;  2R7V A;  1ZR2 A;  4X6A J;  3MN2 A;  2GBY A;  5FJ8 J;  2QSG X;  5EZH A;  1Z7L A;  4FET A;  4MTE A;  1WFX A;  2XF6 A;  4XON A;  3FIS A;  4I0A A;  1TW3 A;  1IUF A;  2CFX A;  3BQY A;  2L7M P;  2LMD A;  1D1A A;  3E0J B;  4XOT A;  3QP6 A;  1OR7 A;  2ZFU A;  4G7H F;  2NVY J;  5GAH J;  2OAZ A;  1G2H A;  3TKY A;  1S5L C;  5BOX A;  4BNC A;  2HGC A;  5K7Z A;  3CF5 F;  3U9G A;  2LKP A;  2Y48 A;  2P5L C;  3JTH A;  1JJ8 C;  4KIG A;  3B73 A;  1R1V A;  1JE8 A;  3FBN B;  4V2F A;  2NYX A;  5HDG A;  4G6D A;  3Q9S A;  4C2M J;  3PNT A;  2QQ8 A;  2CU7 A;  4IRI A;  3MEX A;  3SZP A;  4GDF A;  3DLL F;  3BR2 A;  3K6G A;  4RB1 A;  4RGS A;  1SD7 A;  2XV4 S;  1QBJ A;  4H4K C;  3NAU A;  1BA5 A;  2E7X A;  4KIC A;  3DKX A;  3JRI A;  3L2R A;  2JT1 A;  5CVU A;  3F8B A;  1PJR A;  3FDY A;  4DW6 A;  2R5Y B;  4E6K G;  4UV9 A;  1HW1 A;  3EUH C;  3I71 A;  4OWR B;  4XIC A;  5BQT A;  2WAF A;  1V54 H;  2FE3 A;  2DA7 A;  1FJL A;  4BEH A;  4PCQ A;  4A0X A;  1OR7 C;  5E18 F;  4J01 A;  4IQJ A;  5D6F A;  5BPI A;  1RUN A;  4CDG A;  1VI0 A;  5LHG A;  2IS4 A;  2ID3 A;  2KZG A;  3FXR A;  1VQM I;  2FRH A;  4ZYE A;  3OIP A;  1AA7 A;  2A6H F;  4U0Y A;  1R36 A;  2UXN A;  1FBS A;  1OYI A;  2MC4 A;  3S1R J;  2M9H A;  2HFH A;  3KZI C;  2LFB A;  1Z3Y A;  3LSH A;  1R5G A;  2EV5 A;  5IT3 A;  1D3Y A;  2DPU A;  1V5E A;  5JFR A;  1ODD A;  1YX3 A;  4OOI A;  1D0Y A;  2D2W A;  2CYY A;  1YOV B;  5FKO A;  1IUY A;  2Y30 A;  1WWX A;  3QPH A;  1XCB A;  2H1L A;  3FM3 A;  2MSY A;  2KHM A;  2M7B A;  1K6Y A;  1TC3 C;  4XNF A;  1SAN A;  4Y33 A;  4I7H A;  4RM3 A;  4HLX A;  2E2J J;  5EG0 B;  2KL4 A;  3PQK A;  4BDY A;  3AG1 H;  2VXD A;  1H9G A;  3Q0W A;  3KP2 A;  2CW7 A;  2FF4 A;  2LY1 A;  4I99 C;  3CCM I;  2BOL A;  2A61 A;  4FAS D;  5IP6 A;  2WWY A;  3H36 A;  5ICE A;  1LUJ B;  2VQG A;  3MZ8 A;  4BE0 A;  2XB0 X;  2BBY A;  4RAG A;  2FD5 A;  3R6S A;  3U21 A;  2FJ1 A;  4A3E J;  1VQO I;  1E3O C;  2IP2 A;  2R5Z A;  1WQ2 A;  2O61 A;  4HNU A;  3EPZ A;  3L7W A;  4ABZ A;  3M4O J;  5D5X B;  5D5U B;  1MDM A;  2NOG A;  2Q1Z B;  5IYC J;  5GP9 A;  2P8T A;  4MO7 A;  4HNT A;  4A93 J;  4HW0 A;  5KVR A;  3F6V A;  4XSX F;  4Y3O A;  4C30 A;  3CF2 A;  1YRN B;  4NQW A;  4NC7 A;  4Q48 A;  2WY7 Q;  2M5W A;  4CYC B;  1YS6 A;  2GXA A;  2CQ7 A;  2Y9Z A;  3ROU A;  1LFB A;  1V5G A;  3VYT B;  2QSH X;  1N25 A;  2BZT A;  3L9F A;  4C3J J;  1W0T A;  3TW7 A;  3GTO J;  5ED4 A;  2Z1D A;  1H88 C;  3BG9 A;  4XK4 A;  3BTI A;  4KUM A;  4UUT A;  2MG4 A;  2O0Y A;  1FC3 A;  4MQ9 F;  4LMY A;  1M1E B;  3TP3 A;  4I98 B;  1U9N A;  1JT0 A;  3F6O A;  5F04 A;  4RLQ A;  1B8I A;  1MNM C;  2TDX A;  1DU0 A;  3HOY J;  9ANT A;  1KU2 A;  4RA2 A;  4AID A;  1UJ8 A;  3G3Z A;  1K78 A;  2VQC A;  3R60 A;  3J7A Y;  2R7S A;  2LBF A;  1WJF A;  4Y17 A;  5DYM A;  1Z6T A;  2NS0 A;  3D5R C;  3SZT A;  2B7E A;  1KGS A;  5B1A H;  1W5C C;  2C6Y A;  2VBX A;  4RM2 A;  2IXS A;  2LRE A;  2X1E A;  2IA2 A;  1IN4 A;  1OFC X;  2EFO A;  4I09 A;  4EVI A;  2HDC A;  2R7U A;  5HOD A;  3S17 J;  2EH3 A;  1H89 C;  4AVZ A;  3TW6 A;  4A3M J;  1U6G A;  1W7P B;  1R4N B;  3HOS A;  5EEG A;  1LEA A;  2X4H A;  1N75 A;  1YIO A;  4AIH A;  2DJN A;  4XMY A;  4GGG A;  3ABL H;  2RN7 A;  1T98 A;  4CCJ A;  2JRM A;  1X1P A; 
#chains in the Genus database with same CATH homology
 1WSU A;  2WTE A;  2RKH A;  4OIO F;  3WE2 A;  1P2F A;  3I5U A;  1OPC A;  1HXD A;  5K1Y A;  2KIM A;  1XMA A;  4EMS A;  2P7V B;  3NQO A;  1UHW A;  2V6C A;  3GEZ A;  5BPD A;  3F3X A;  2DU9 A;  5BMZ A;  1YLF A;  4PDK A;  2YX4 A;  3CDH A;  4KN7 X;  5DD8 A;  4EJT A;  3IWZ A;  5JR3 A;  4U7B A;  5DD4 A;  3WTV C;  3RJP A;  1F4K A;  4LG0 B;  2BYV E;  5ILV A;  1XSD A;  3OOP A;  3TOB A;  2OQG A;  2ZME A;  4LGW A;  3C7J A;  2GWR A;  3FXU A;  1F9N A;  3V7C A;  6PAX A;  4ESJ A;  3QU3 A;  2ISZ A;  1U5T B;  4XLP F;  4GCV A;  3D5L A;  3KEQ A;  4L18 B;  4OIP F;  2GXB A;  1ZLJ A;  2IW5 A;  4HDU A;  3VEP A;  3ZN1 A;  1G3W A;  1MGT A;  3TO9 A;  4N0B A;  3LQR A;  1S7O A;  3BOQ A;  5F6F A;  3N97 A;  1XGO A;  2Z3Y A;  1S29 A;  1KU9 A;  1FPQ A;  3BJ6 A;  3C3W A;  4IXA A;  1STZ A;  5JVT A;  1HQC A;  4EJU A;  5LBQ A;  3U1D A;  3GZ5 A;  4M9Z A;  4Z2Y A;  5DCM A;  1G4D A;  2EA4 A;  2V1X A;  5FO5 A;  2PBI A;  2XAS A;  2XUB A;  5E17 F;  3IRQ A;  3K69 A;  3V4G A;  5D8L B;  1YO5 C;  1ZRD A;  3ZPL A;  2HYF A;  3H3Z A;  3EYY A;  1B6A A;  2BE5 F;  1ZN2 A;  2O6G E;  4BYY A;  5EEH A;  3HRU A;  5K5Q A;  3K0L A;  3T5X A;  5K5O A;  5HS7 A;  5L3F A;  1O7F A;  1P6R A;  4HF0 A;  5H6R A;  2ZKZ A;  1H0M A;  4HBL A;  2KIF A;  3I59 A;  1IAW A;  4KA4 A;  3GZ6 A;  3D0S A;  1WKM A;  3H92 A;  2ZO4 A;  1OKR A;  3DPT A;  2FOK A;  3J81 Z;  2WV0 A;  1OMI A;  1YTY A;  1ZLK A;  4EGZ A;  2OBP A;  3E6M A;  2PI0 A;  4CIC A;  4RGR A;  4ESF A;  3F8F A;  5LRR A;  2HQR A;  2PQ8 A;  1UCR A;  1G3S A;  1S3J A;  4LLL A;  2QBY A;  5ILU A;  1FBU A;  5FB2 A;  1HKS A;  3T8R A;  1RIO H;  4OMZ A;  1J0R A;  5L3D A;  2ZFW A;  5JI6 A;  2COM A;  2ZXJ A;  5HDK A;  5E1X A;  2K4B A;  2YX7 A;  4M6X A;  1TTY A;  1QGP A;  1ZG5 A;  3EQL F;  1G3T A;  4HV6 A;  1DPU A;  4R79 A;  2XAF A;  3TOA A;  5D5V B;  2KKO A;  3T0Y A;  2OQR A;  2ZCW A;  3LA3 A;  3KP7 A;  5H6Q A;  1W4M A;  1ZAR A;  3WTS C;  2VE9 A;  3JSP A;  3FM5 A;  5J6X A;  3V8K A;  1LDK B;  1IRG A;  3L09 A;  1TNS A;  3SQN A;  2DW4 A;  3REO A;  2DO7 A;  4M71 A;  1Z9C A;  5DUK A;  2HS5 A;  2LNB A;  2F5E A;  3ML6 A;  1SMT A;  2EFW A;  2NAZ A;  4XSZ F;  4BHC A;  1QZY A;  4KDP A;  3IKT A;  1XB4 A;  1KU3 A;  2NRA C;  3W6J B;  1MZB A;  3EDP A;  2FSW A;  2VOP A;  1ULY A;  4G9Y A;  5A2Q K;  4PZJ A;  2DAO A;  3S2W A;  4Q4Z F;  2HKX A;  1IN7 A;  2EFQ A;  2EFP A;  1KQ0 A;  4CYD A;  1IN8 A;  5CVJ A;  3ABU A;  4B09 A;  2HR3 A;  3NEU A;  2L4A A;  3ZMZ A;  2JPC A;  2VBW A;  4HYE A;  4XBF A;  2LF8 A;  1P92 A;  3H3U A;  1HKQ A;  1XDU A;  2FA5 A;  2H09 A;  2GQQ A;  1OYW A;  3DFG A;  2M30 A;  1R1U A;  4BHB A;  1ZRE A;  3BJO A;  2GXG A;  3HRM A;  3WGH A;  3RYP A;  1EH7 A;  1HKT A;  2FNP A;  1DDN A;  2RVC A;  5HS9 A;  2RGV A;  2HWV A;  1V4R A;  3BPV A;  3I4P A;  5DV5 A;  4D0P A;  3WTU C;  2YPR A;  3V7R A;  3JTG A;  2RV8 A;  3EUH A;  3ZMT A;  4F7Z A;  4HX8 A;  4ASN A;  5ICF A;  1FWZ A;  1EV7 A;  5HS8 A;  4NB5 A;  3J81 K;  2XGX A;  4IHT A;  4HQE A;  2MH2 A;  1G3Y A;  1C0W A;  1ZH5 A;  5L3G A;  1GHC A;  2W25 A;  1JXS A;  4LK1 F;  3HIF A;  1BC8 C;  2CSO A;  2K4J A;  2IA1 A;  5LLQ A;  4AWX B;  4WX9 A;  2HQN A;  1I27 A;  1SD4 A;  4WK8 F;  1ZYR F;  3RPU A;  4G7O F;  2CO5 A;  3KZY A;  1R58 A;  4IF4 A;  3VOE A;  4Y15 A;  1T6S A;  2RNJ A;  1SFE A;  2DQL A;  3G73 A;  5LGU A;  2DK5 A;  4R1H A;  1KYZ A;  3QP5 A;  5ICG A;  2VN2 A;  5FLX Z;  2VOO A;  3HOT A;  1GXP A;  1LB2 A;  4AVP A;  1R7J A;  1Z05 A;  1CGP A;  2A3S A;  3I53 A;  2H6C A;  3ECO A;  3PFI A;  2NNN A;  1FLI A;  1GVJ A;  1ZRC A;  4WCG A;  1KU7 A;  4EJO A;  4BXU A;  4OMY A;  1LDD A;  2ISY A;  4MNU A;  5DCF A;  1Q1H A;  2EK5 A;  4M73 A;  1FOK A;  5LGT A;  2P5K A;  3HHH A;  2FBH A;  4CXF A;  1PP8 F;  2PLY A;  2A6E F;  3BZ6 A;  1QNT A;  3BJA A;  1IN5 A;  3RI4 A;  4UNO A;  4G94 A;  5HVQ C;  4LK0 F;  4MGR A;  3JAM Z;  5DUI A;  4QWQ A;  3TDU C;  4Q47 A;  4UV8 A;  4HA8 A;  2JTV A;  4BQA A;  1ON2 A;  4UXN A;  5FFX A;  2PJP A;  1SD5 A;  4M6Y A;  2STT A;  1U3E M;  2R7F A;  1T0F A;  2L3D A;  1I1G A;  3WGI A;  3WU0 A;  5HLI A;  1CF7 A;  2FBI A;  2HYG D;  1UFM A;  4A6E A;  3HTU A;  3QAH A;  2FNA A;  5KK1 A;  1USS A;  3CJN A;  1Z91 A;  1BIB A;  3GFJ A;  2XVC A;  2W84 A;  4NHJ A;  4BAY A;  4I02 A;  4UVA A;  3E6C C;  3LAP A;  4L9T A;  4AD9 A;  1YW7 A;  1T2K A;  4JBA A;  2R7D A;  1RI7 A;  4A0Z A;  3GYH X;  1MDM B;  2DFI A;  4YG2 F;  3KZZ A;  3KLO A;  3R0J A;  3VOD A;  2EFN A;  2EV6 A;  4PGG A;  5D4S A;  4A12 A;  1R00 A;  3VFZ A;  4MHG A;  3MAJ A;  3LFK A;  2O8X A;  4ENK A;  2CW0 F;  3T8T A;  1S7A A;  4WF2 A;  2G7U A;  1HBX G;  3RKW A;  2LSO A;  3FXQ A;  3NRV A;  4EV0 A;  1YFH A;  1U5T C;  2E1N A;  1P4X A;  3CLO A;  3GO5 A;  1K78 B;  5HOO A;  2IT0 A;  4LJZ F;  4AIJ A;  1R1T A;  4I0B A;  4ENN A;  4HLY A;  3C1D A;  3GFL A;  4CO8 A;  2MBF A;  2IJL A;  5CJ9 A;  4ZH4 F;  2O3F A;  4FX0 A;  3FX3 A;  1BIA A;  3EET A;  5D4R A;  2VON A;  2K27 A;  3DV8 A;  5CLS A;  4JK1 X;  1R23 A;  3ELK A;  5A2Q Z;  2STW A;  1PP7 U;  3E6B A;  4OIQ F;  1X3U A;  1P4A A;  4IVN A;  4RS8 A;  5D6E A;  1O57 A;  4ON0 A;  1F5T A;  4EM1 A;  3LWF A;  5FLX K;  2E7W A;  4RAY A;  3MQ0 A;  2D45 A;  3SXY A;  1D8J A;  5BS6 A;  4Y13 A;  1W5T A;  3ZMD A;  4LFU A;  1S6L A;  2W24 A;  2Q8K A;  2ADU A;  2M1B A;  4WXC A;  4A5M A;  1ZGA A;  2XAJ A;  1SMY F;  2KIU A;  3TQN A;  1J5Y A;  1MJB A;  2ZME B;  1IXR C;  2BV6 A;  5E1W A;  5FFZ A;  3F8M A;  2JRT A;  1I6X A;  3ZMS A;  3IKV A;  3GF2 A;  1UHM A;  3V8L A;  5LHH A;  3GWZ A;  2XAG A;  4HOB A;  3V7S A;  3COA C;  4XRF A;  3JAM K;  4RGX A;  2L54 A;  2IVM A;  1FSH A;  3HSF A;  2F2E A;  3QPT A;  4ETS A;  2FBK A;  4WXD A;  2L01 A;  2VC1 A;  1LJ9 A;  2V1U A;  2P4W A;  1RZ4 A;  2ELH A;  2VT3 A;  2K7L A;  3TO7 A;  1B9N A;  1J75 A;  5DCM B;  3RIR A;  2QQA A;  4U88 A;  4RB2 C;  4L0Y B;  5AIP A;  2Z99 A;  2Z33 A;  3WTZ A;  3N4M A;  4DQ2 A;  1IZ1 A;  3TGN A;  2DPD A;  4EGY A;  3BP8 A;  3M1E A;  2G7H A;  3CTA A;  4L0Z B;  3SFZ A;  4IRH A;  4P96 A;  5F1R A;  3FF5 A;  4ZYD A;  4FHT A;  1SD6 A;  2AS5 F;  4LB5 A;  1ZG3 A;  3GFM A;  2ACJ A;  4N9I A;  5DDG A;  1FYM A;  3I59 B;  5TRD A;  2CGP A;  5D5W B;  1TQM A;  4ZYH A;  1SFU A;  1J2X A;  3TO6 A;  4K2E A;  4RAZ A;  5IT9 Z;  1E17 A;  2LF7 A;  5LEK A;  5K5R A;  1UB9 A;  2CQK A;  2ZNY A;  4CHU A;  1TBX A;  1O3S A;  4IPA A;  4BHP A;  1JHH A;  1U8R A;  1A04 A;  1MKM A;  4HF1 A;  2H94 A;  1UST A;  4P9U A;  3DPL C;  4YFN F;  2FXA A;  3IHU A;  1V3F A;  1H9T A;  2XKO A;  1IF1 A;  2J5O A;  2QBY B;  3DEU A;  3CO6 C;  1R5H A;  2PMH A;  2GAU A;  4UHT A;  5FD6 A;  1ONV A;  2PEX A;  3R61 A;  4ESB A;  3KFW X;  2Q0O A;  4G7Z F;  4KFC A;  2RC4 A;  1FSE A;  3WG9 A;  3LST A;  5D8K B;  5LHI A;  1FT9 A;  2UWM A;  3QOP A;  5H20 A;  4AIK A;  3DQV C;  2UZK A;  2QZ8 A;  3MFK A;  3IRR A;  2NNY A;  2QVO A;  3E97 A;  3F22 A;  4WWC A;  4CZZ A;  3WOD F;  2Y75 A;  3K1P A;  3CUQ C;  1KQ8 A;  2VC0 A;  3WU1 B;  4U7D A;  1Z7U A;  2ETH A;  2KJC A;  4GYI A;  1FX7 A;  3L2C A;  2GZW A;  3ISP A;  3RKX A;  5E8G A;  1GXQ A;  1R22 A;  5F64 A;  1D8K A;  3ERE D;  2PMU A;  2QWW A;  2EJR A;  5LEJ A;  2HTS A;  4ENJ A;  3K2Z A;  2VBZ A;  1TLH B;  3F8N A;  5AON A;  1KQ9 A;  3JW4 A;  4PGH A;  5HDN A;  4FT8 A;  4EQQ A;  3FMS A;  1W7P D;  2F5F A;  1FYK A;  2ZJ2 A;  3CO7 C;  3I54 A;  4A0Y A;  3LAJ A;  3E5Q A;  3E3V A;  2VBY A;  4A2U A;  3JSO A;  3GFI A;  1IXS B;  2M87 A;  4KIF A;  1RUO A;  4HQM A;  2IRF G;  1IXC A;  2MA3 A;  1O3Q A;  3MZY A;  3WE3 A;  2OZU A;  1VTN C;  2JZY A;  3I0T A;  4R8H A;  2HEO A;  3ULQ B;  2W85 A;  4YII A;  2FML A;  4MEY F;  2F5C A;  2QLZ A;  3OV8 A;  3HTS B;  2CWE A;  5E1Z B;  4ENM A;  3QRF F;  1K6O A;  5J8F A;  2QEN A;  3GVA A;  4GYG A;  2HTJ A;  4G6Q A;  3J80 Z;  2DLL A;  3KE2 A;  4UVB A;  1ZHF A;  3C18 A;  5L3C A;  1PUE E;  3P9C A;  1MJA A;  1LNW A;  4EM0 B;  3LQQ A;  1BI2 A;  4Q5S F;  4YFX F;  1TW2 A;  3MWM A;  4HX4 A;  4M9X A;  4L9N A;  4M9S A;  4EJW A;  3BWG A;  2DTR A;  1YG2 A;  4QLC U;  1ZAO A;  1K7A A;  1FYL A;  3WTY C;  3K9T A;  2DQR A;  4LLN A;  3RKY A;  2DK8 A;  3BDD A;  1O3R A;  3F23 A;  4IRG A;  2RDP A;  1AWC A;  5JHU A;  2XHK A;  5IT9 K;  1XD7 A;  2MH9 A;  1I5Z A;  3V8J A;  3K1M A;  2X0L A;  4KN4 X;  3BPX A;  1W7P A;  3KLN A;  3ZN0 A;  2PN6 A;  3SHF A;  4IHS A;  1EH8 A;  1O7L A;  1XN7 A;  2EB7 A;  2P5V A;  5ERI A;  1XGS A;  2FU4 A;  3IL2 A;  3E5U A;  1BI0 A;  2A5Y B;  1P4W A;  1JHF A;  1T39 A;  4HF2 A;  1OYY A;  3QU6 A;  2KRF A;  1EH6 A;  2L02 A;  2ZNZ A;  3L00 A;  4FX4 A;  2QM3 A;  3HUG A;  2JPB A;  3FMQ A;  5TJJ A;  3B02 A;  4ZZL A;  4HAM A;  2HKO A;  3VB2 A;  1LEB A;  3WTX C;  1QO0 D;  4UUV A;  4LG0 A;  1U78 A;  2Z9O A;  3W6K B;  3IC7 A;  2YR2 A;  2E1C A;  2V9V A;  4P55 A;  2QYO A;  2L4M A;  4KNY A;  5E8I A;  4JQF A;  1U5T A;  1Y0U A;  4RB0 A;  4I2O A;  2DBB A;  3WTT C;  1BI3 A;  1W5S A;  1O3T A;  2D1H A;  2F5D A;  3U2R A;  2MLG A;  4DNC A;  1SAX A;  4CGZ A;  3F8C A;  1BC7 C;  2Q2E A;  5FD5 A;  3K1N A;  5ICC A;  4HX7 A;  2AXL A;  3RTR A;  3HRT A;  2W57 A;  1L0O C;  2O03 A;  2RQP A;  3FWE A;  2HZT A;  5CVR A;  2H6B A;  4IJA A;  4OIR F;  3RYR A;  4M74 A;  2XKP A;  1TNT A;  4ZZD A;  3R0A A;  2ZBK A;  4S05 A;  2EA2 A;  3PQJ A;  1XGM A;  1ON1 A;  4OIN F;  1CF7 B;  1B4A A;  2V79 A;  1QPM A;  2M8E A;  3M7G A;  1BOA A;  3M8E A;  2CG4 A;  2OA4 A;  2J5P A;  4H0E A;  1PDN C;  2G9W A;  5AIQ A;  1B9M A;  1IW7 F;  4HZF A;  3J80 K;  1FNN A;  1SFX A;  4MTD A;  1J7K A;  1QQI A;  3HSE A;  5CVV A;  2ESH A;  4A5N A;  2XAQ A;  2D1V A;  2MD5 A;  3WTW C;  2H27 A;  2FQ3 A;  3KP4 A;  1MJ9 A;  3R4K A;  1HST A;  4XLN F;  3ZP5 A;  1T38 A;  4E70 A;  2FEZ A;  2IA0 A;  1D5V A;  3ZQ7 A;  2VXZ A;  4HV5 A;  2ESN A;  2FMY A;  1L3L A;  3KP6 A;  4KMF A;  3ABT A;  2XRO A;  2GIV A;  4GXO A;  4MQV A;  2M45 A;  2OU2 A;  3FMR A;  3TDZ C;  3BY6 A;  3ZMV A;  2HOE A;  3HYI A;  2A69 F;  1JGS A;  4KYW A;  3FZV A;  2QUF A;  1FP2 A;  1XSV A;  2B0L A;  2A68 F;  4L9V A;  4L9J A;  4N9H A;  1QZZ A;  1ZG1 A;  1F1Z A;  1IRF A;  3LA7 A;  4U0W A;  3T1B A;  1Z6R A;  1IN6 A;  4KIB A;  3RDI A;  1FBQ A;  1FY7 A;  3IWF A;  3CUO A;  2MLK A;  5L3B A;  2YSR A;  4UVC A;  3AAF A;  2K86 A;  1MD0 A;  3HSR A;  3O6B B;  3DXJ F;  3KCC A;  2VOD A;  1XGN A;  3HRS A;  2GA1 A;  5DEQ A;  2DI3 A;  1BN5 A;  1S8N A;  2EV0 A;  1FZP B;  3Q9V A;  2Y0M A;  4U0V A;  1AOY A;  4KMU X;  3M8F A;  5FGM A;  2QQ9 A;  4I01 A;  3ECH A;  1KYW A;  1LDJ A;  1HW5 A;  4L5J A;  1TQI A;  1XSX A;  3BRO A;  1YS7 A;  1YQA A;  1YW9 A;  3GLX A;  1BBY A;  4HDV A;  5HLH A;  1BJA A;  3I58 A;  1BM9 A;  2DT5 A;  1XDS A;  2OD5 A;  3MZH A;  3F72 A;  2BEO A;  1BI1 A;  3RPQ A;  3GX4 X;  1WRJ A;  1ZRF A;  4YIF A;  4YFK F;  2OZ6 A;  3LA2 A;  2WC2 A;  5L3E A;  2XIG A;  3P7N A;  3GW2 A;  1RNL A;  2BGC A;  4O6J A;  4A6D A;  3M9A A;  1DUX C;  4KT5 C;  2KJB A;  4WXH A;  4RB3 C;  4EJV A;  1DPR A;  4L5I A;  3DKW A;  1DP7 P;  3DF8 A;  4RGU A;  3KEO A;  3E6D A;  1WI9 A;  3KET A;  1NHA A;  1K79 A;  1YW8 A;  1KA8 A;  3F21 A;  4LB6 B;  2XAH A;  3O2P E;  3EYI A;  3MCZ A;  2VT2 A;  3HHG A;  3CUQ A;  1REP C;  3E5X A;  5LGN A;  1ZGJ A;  2QQB A;  4P9F A;  1G6N A;  4LLG F;  2GA2 A;  1LVA A;  1XMK A;  2P6T A;  3P9K A;  2R3S A;  2P6S A;  3GXO A;  3DP7 A;  1J9I A;  1B59 A;  5HLG A;  3ZMU A;  3GUD A;  4EM2 A;  3O3K A;  4P5O A;  3Q5F A;  5J8C A;  2V1D A;  4LD5 A;  1U2W A;  4TV7 A;  1HSJ A;  4B8X A;  1YYV A;  4ZYG A;  1FP1 D;  4O3M A;  2XRN A;  1B1B A;  5ILS A;  2PG4 A;  5CYV A;  4MEX F;  2A07 F;  3KP5 A;  4M72 A;  4S04 A;  4BH9 A;  2JSC A;  5LRS A;  4GO1 A;  4G8X A;  2VE8 A;  3FHZ A;  1LQ1 A;  4OU0 A;  2PFB A;  2IPQ X;  2UXX A;  3KP3 A;  2EWN A;  2MC3 A;  5CVI A;  2LDU A;  1XCV A;  1E2X A;  1Z1D A;  1I1S A;  1TQP A;  5E20 A;  1HW2 A;  3WGG A;  3CUQ B;  2K02 A;  2Z5U A;  3J7A O;  4O5V A;  3P9I A;  2YU3 A;  3I64 A;  1J59 A;  2P7C B;  4MTE A;  4I0A A;  1TW3 A;  2CFX A;  3QP6 A;  1OR7 A;  4G7H F;  2OAZ A;  3TKY A;  5BOX A;  4BNC A;  2HGC A;  3U9G A;  2LKP A;  2Y48 A;  2P5L C;  3JTH A;  4KIG A;  3B73 A;  1R1V A;  1JE8 A;  2NYX A;  5HDG A;  4G6D A;  3Q9S A;  4IRI A;  3MEX A;  3SZP A;  4RB1 A;  4RGS A;  1SD7 A;  2XV4 S;  1QBJ A;  2E7X A;  4KIC A;  2JT1 A;  5CVU A;  3F8B A;  4UV9 A;  1HW1 A;  3I71 A;  5BQT A;  2FE3 A;  4PCQ A;  4A0X A;  5E18 F;  5D6F A;  5BPI A;  1RUN A;  4CDG A;  5LHG A;  3FXR A;  2FRH A;  4ZYE A;  2A6H F;  4U0Y A;  1R36 A;  2UXN A;  1FBS A;  1OYI A;  2HFH A;  1R5G A;  5IT3 A;  2EV5 A;  1D3Y A;  2DPU A;  5JFR A;  1ODD A;  4OOI A;  2D2W A;  2CYY A;  1IUY A;  3QPH A;  1WWX A;  1XCB A;  3FM3 A;  4I7H A;  4HLX A;  3PQK A;  1H9G A;  3KP2 A;  2FF4 A;  2A61 A;  2WWY A;  5ICE A;  2BBY A;  3R6S A;  2IP2 A;  1WQ2 A;  2O61 A;  3L7W A;  5D5X B;  5D5U B;  1MDM A;  2P8T A;  4HW0 A;  5KVR A;  3F6V A;  4XSX F;  4NQW A;  4Q48 A;  2M5W A;  1YS6 A;  3ROU A;  3L9F A;  5ED4 A;  4KUM A;  2O0Y A;  1FC3 A;  4MQ9 F;  4LMY A;  4I98 B;  3F6O A;  2TDX A;  1KU2 A;  3G3Z A;  1K78 A;  3R60 A;  4Y17 A;  5DYM A;  1Z6T A;  2NS0 A;  3SZT A;  1KGS A;  2C6Y A;  2VBX A;  2IA2 A;  1IN4 A;  2EFO A;  4I09 A;  4EVI A;  2HDC A;  1U6G A;  1W7P B;  3HOS A;  5EEG A;  1LEA A;  2X4H A;  1YIO A;  4AIH A;  4GGG A;  2RN7 A;  1T98 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...