2DT7B

Solution structure of the second surp domain of human splicing factor sf3a120 in complex with a fragment of human splicing factor sf3a60
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
b'GAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor 3A subunit 3
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt7B01
4DGWB 2DT6A 1UG0A 1X4OA 2E5ZA 2DT7B 2E60A 1X4PA
chains in the Genus database with same CATH superfamily
3S8PA 2LTPA 1OYWA 1RNLA 2A6EF 2DTRA 2ZXHA 4RMNA 4CCOA 3BR1A 3KP5A 4HNUA 1ULYA 1MGTA 2B0LA 2EV6A 3DXJF 3ZQCA 4XOPA 3W3CA 1IN8A 1XD7A 3J81Z 1YLFA 1Q1VA 2PEXA 3CTAA 3QYEA 2X51A 2GXBA 1P6RA 3L00A 5IT3A 2L0KA 1U8BA 3MZ8A 2E7XA 3HSRA 3S1QJ 3RYRA 4P9FA 4L9JA 3A0HC 2RV8A 3EUAA 3GUDA 4X6AJ 4JP0A 4HQMA 1N75A 1JKRC 3K1PA 3BTCA 2VQCA 1LDDA 3V8KA 1H0MA 4EM1A 5FD6A 2JUGA 4IQJA 3TP0A 2XHKA 1BW6A 2KMUA 2LF7A 5D8LB 1PP7U 3RPQA 2AQEA 3DEWA 4KMUX 5JI6A 2RREA 1FIPA 1Z21A 2M0MA 3K4KA 1IN6A 4G8XA 5DD8A 3PIPF 3S3NA 1L3LA 1I1SA 1F1ZA 2X1CA 4Y33A 1TT5B 2KKOA 2PG4A 2RQPA 3ZQHA 3R60A 3HC7A 1XC5A 3F8MA 5CLSA 4D7MA 4BE0A 1MMSA 1HW2A 3RCOA 3BY6A 2DTZA 1VQMI 3IL2A 5D5XB 1YOVB 3Q0WA 3EYYA 2D5VA 1R5ID 3OS0A 1KONA 1YS6A 1P9QC 1P4WA 3K6GA 1JJ8C 4XLNF 3GTGJ 4MHGA 3RPUA 3JRCA 1OCPA 4KA4A 2R7OA 1FP1D 2COBA 4PUSA 1JTYA 1DPRA 4XLPF 2DXIA 2E2JJ 1FIAA 1SD7A 1XG1A 2YS9A 3PNYA 3J7ZI 1E0EA 4ENJA 3A0BC 2V1UA 3OYDA 1VQ8I 3K4JA 3K4CA 3HOSA 3JCUC 1LE8B 5EDNA 5DS9A 2XF6A 2I10A 5EG0B 2YU9J 4G94A 3BCAA 2R5ZB 2QYOA 2M34A 2F4MB 4BQAA 3I5UA 4HV6A 1O57A 3V7CA 3U2RA 2QLZA 3VOEA 3WHCA 3K2AA 4M6VA 3OYNA 2X6XA 4Q4ZF 1DU0A 5IP7J 2IGNA 3CP2A 2M30A 4D1QA 2QKMB 2CFXA 1D0XA 2DAOA 1IV6A 2WA0A 4XL9A 2OBPA 3VSKA 1NH3A 1LDJA 2H6CA 2MW8A 4CYCB 1SEUA 2EFPA 4UVBA 2CWEA 2XRLA 4XN3A 5CVRA 1K61A 1J7KA 2X6WA 4EMSA 3P5JA 1D1AA 5CPRB 4DNCA 1BR4A 1S9HA 5KAFC 3MFKA 3E97A 1ETXA 5HLTA 2F5FA 2FOKA 3ISPA 1TNTA 5FLXK 3ML6A 4MGRA 1Z1DA 3ULQB 3IP4B 2Y9YA 2HQNA 2YR2A 5GTHC 5IPAA 3I53A 2DFEA 2VKHA 3BG6A 4NBQA 2LBFB 1MH4A 2EA2A 1JHFA 3HHGA 4KFCA 2Q1ZB 2VI6A 1UMQA 4RAZA 2VN2A 4F92B 3HEFA 1IDYA 3BZKA 2Y75A 3FDYA 4OU0A 3E6CC 2JA7J 2JRMA 3DEUA 4HAMA 1E2XA 4E6KG 4M3BA 2W24A 1AKHB 1QVTA 2HTSA 4DYCA 4UV8A 1W7PD 1JGSA 1UJ8A 2VONA 3DWLE 1YRNB 2HKXA 2OQRA 3KETA 3V8LA 4BJ6C 2RQQA 4KN7X 5TRDA 2DQRA 3F6VA 2RAEA 4CHUA 2YX7A 2KZVA 2ZFWA 4LITA 3L2QA 2XAUA 2HOEA 4ZYGA 3HOVJ 1ODDA 1Z7UA 2BZTA 2IGOA 2JJ7A 3OIOA 5K7FA 4A3BJ 2LVSA 1NK3P 3CCEI 3DP7A 1ENHA 1LE8A 1ZARA 1ZHFA 3KX2A 4LLNA 4E7SA 3WGGA 1MSFC 1W36D 1WHUA 2R5ZA 4LLGF 3A02A 4F93B 2QQ9A 3H3ZA 2V6EA 2JK3A 4DZPA 3FXQA 1UG2A 3KP2A 2DK5A 4MFEA 2MA3A 3VYRB 3LSPA 3HPHA 4HLXA 1VQPI 4L18B 3ZR8X 2UZKA 2DW4A 5BOXA 4KT5C 2Y0SN 1Y8QB 5KVRA 1J59A 4B8XA 1WJ5A 1W0UA 4XLCA 5L3CA 1MJAA 2HQAA 5E8GA 4G7ZF 2ISYA 5FO5A 4IOAF 2LP0A 1ZTRA 1MH3A 2KHMA 3BCBA 5F0FA 4CYCA 2CO5A 2RKHA 2VOPA 1B9MA 3BG9A 4ZZDA 3BWGA 2VT3A 1PDNC 2FBHA 3I0TA 3QAHA 3QP5A 5LHHA 4B3XA 5D8KB 3IRQA 5F6FA 1T0FC 2DMPA 5H6QA 2E36A 2K3FA 1GT0C 1TWAJ 1XMXA 1GVDA 3P7NA 2IPQX 2OCCH 4B09A 1W7PB 3PFYA 4CCJA 2A07F 1D8KA 4AUXA 2EA4A 4P5OA 1P2FA 4A0XA 2K9NA 3LAPA 1W5CC 2OPTA 4H4KC 4LGWA 5D5VB 1OKRA 2ZCWA 3K1NA 4F3QA 3G3ZA 3ONQA 4N4OB 1E3HA 1J9IA 3HOTA 1Z3YA 1SD4A 2STWA 1Z0XA 2GIVA 2Y0SA 2HXIA 3E1SA 2P8TA 3L2VA 1K78B 3ZCOA 2MD5A 1IG7A 1FNNA 1RC9A 1XMAA 1P4AA 2HWVA 2HU9A 4FHTA 1E3OC 1B8IB 1YRNA 4HQEA 1TQIA 4QWQA 3IWZA 3Q9SA 1QHGA 1O7LA 1QGPA 1E3PA 2F48A 4YIFA 2LD5A 5FLVA 3MWMA 3S17J 1XTAA 3Q9VA 2UV1A 2ZJRF 4B44A 4A3LJ 2YPRA 2CW0F 3HDDA 2P81A 3HRSA 4DIQA 4JX5A 4DYRA 5A2QZ 4QTRA 2Z16A 2E1MB 3BTLA 3HOWJ 3K70D 3GZ6A 5F04A 5B5EC 2MBFA 3CC2I 1XGMA 2M5WA 2DOEA 2KPMA 2O7OA 2E1OA 2Z99A 2K4JA 2P6TA 4IXAA 1XCVA 5FKOA 3ZOBA 5L3EA 2XDVA 5C44J 4N9IA 2N8GA 1FMVA 1Z77A 2A5YB 4HV5A 5D5WB 1LFUP 5M5YJ 1R5HA 4PJ0C 5DYMA 2JA6J 3RTRA 4F7ZA 5K1YA 2RC4A 3HXLA 5E3OA 2MH2A 2XGXA 2L7KA 1USTA 4RGXA 3Q5FA 3OR1C 2W84A 4ITVA 3M3YJ 3F9KA 2LH9A 3WTWC 2ADUA 5FGMA 5HNHA 2A6HF 5DEQA 4WK8F 4CCLA 2FE3A 3KP6A 3QYBA 2BV6A 5CQGA 5J6XA 1MDMB 2XPUA 3JRDA 1W7PA 1VZ0A 3OOUA 1F9NA 5EEGA 4CGZA 2EILH 1KQ0A 2JWTA 3I58A 2KT0A 3EUKL 4N0BA 3BQYA 3CCQI 2O5RA 3PM1A 1YITI 3LSRA 2DA7A 5E1XA 1H88C 1J09A 2W48A 2R7TA 3E3VA 2ZXIA 5CQEA 1NK2P 1BC7C 2RNJA 5F64A 3OS1A 4WX9A 4FISA 3F22A 1OFCX 4UV9A 1QZEA 2K40A 1HKQA 4U87A 5TISC 4YFXF 1A6QA 1KGSA 2ZO4A 2ESNA 4HRIA 2IRFG 5J47A 2AQFA 1YW8A 2ZNZA 1P92A 3NRVA 2M9HA 1K6YA 2HDWA 4I99C 4M9XA 4BH9A 3RZOJ 4U7DA 4XICA 2BE5F 1D5YA 3CDLA 4UB6C 1PUFB 3IAM2 4CSWA 4YG2F 3KE2A 5JR3A 2FMYA 5E3NA 5L3BA 2DDBA 4E7LA 3TW6A 2IGMA 4XLHA 5FLMJ 1ZR4A 3BG5A 1LB2A 2FOWA 2NAZA 4EGZA 3F0CA 4FTHA 2BHZA 1WJEA 5HOOA 3E6BA 4GO1A 3F8CA 4D0PA 2O6GE 1MBKA 2R3SA 2JT1A 3WTSC 3F23A 1RR8C 3LWFA 2OTJI 3ZGKA 3IV5A 2MYSA 2ZSHB 3CF2A 4M72A 5LHGA 2IS1A 4M6YA 3H0DA 3C1DA 2W57A 3GFIA 4M9ZA 5AIQA 1ZGAA 1XX5A 4IVNA 4DOZA 1BC8C 2ELHA 3HM5A 3B73A 2DA4A 2DI3A 2EWNA 1MDMA 4RS8A 1JT0A 5M3MJ 2JPBA 4Y7NJ 3OYBA 2V26A 3FIWA 5LRSA 2CUJA 2JPCA 1FSEA 4RLFA 2LKSA 1WFXA 4U0VA 2FSWA 3R0JA 3SDBA 2K7LA 1NG6A 3ZXSA 3QQAA 2XGCA 1K79A 5BQTA 2Z3YA 4HA8A 3ECHA 2HPMA 1VQ9I 3NARA 4QPOA 5DM6F 3T8TA 4MTDA 1YFHA 1WSUA 4CCKA 2FQ3A 4HOBA 2VBXA 4EJTA 1JHHA 1UZCA 2R7VA 3PQKA 5IYCJ 1OISA 4M3GA 3ASOH 3R6SA 2BW3B 1F36A 4MQVA 1H8AC 3PL8A 4DZJA 1I39A 1MMDA 1HKSA 2QQ8A 3I4MJ 4J00A 1SFKA 1I3AA 2LREA 2XUBA 4HF1A 2RN7A 3RKYA 2DODA 1PUFA 1IF1A 2PLYA 1IUFA 1FZPB 1MBEA 1Z6RA 2PMHA 2EZKA 4LIVA 1W5TA 4ZYEA 1SC7A 3KLNA 4BY1J 4BHBA 4IKFA 2E2HJ 4KIFA 4BDZA 1X2NA 4J19A 3J7AY 1ETWA 1KU7A 1RRJA 4O5VA 3ZRGA 3HRMA 1FBUA 4KJZA 2DA6A 4OOIA 5JLXA 1Z91A 2NS7A 4IL6C 3GLLA 1WGXA 4RB2C 2ME0A 1BIBA 3A4CA 3CF5F 4FETA 3JRIA 3K4LA 1IW7F 2HKOA 1LKXA 1A35A 4Q47A 4UNOA 2CV2A 4EQQA 3GYHX 3IKTA 4UHTA 3KPHA 3S1MJ 5EJCA 2VC0A 4CA0A 5CVJA 2CU7A 3KIOA 5FFXA 4LMYA 2KDOA 3FWEA 2BHYA 1YHQI 3NWTA 4C3HJ 2DO7A 5LEJA 5LEKA 4XKCA 4A6DA 2WAFA 2DDAA 4G9YA 4HNVA 1ZR2A 2R7UA 2K9SA 1OQYA 3CJQB 3WU0A 3S15J 4BBRJ 3H9QA 2VE9A 5L3GA 2BYVE 2VQLA 1EA3A 2DU9A 1BI0A 2EFQA 3HKZA 3FXJA 3HHHA 2L4AA 5H6RA 3RKWA 3EUHA 1OR7C 2DA2A 3ELKA 4ENNA 3CD6I 3CJRB 5K7ZA 3HTSB 1X1AA 1JUPA 3DCFA 1FP2A 3C2GA 2JSPA 3W2VA 4GFBA 1O7FA 1HSTA 2BW3A 4U0YA 1HA8A 3GZ5A 1X2MA 1NTCA 5FKKA 1YJ9I 3H35A 5E20A 1HLVA 3MAJA 4WCGA 4MEYF 3H36A 2WAEA 1SFOJ 4UUVA 2VUMJ 3L2UA 2L9VA 4EATA 1VI0A 4LK0F 3FHZA 2M4KA 3IH3A 3ABTA 2PFBA 1XDSA 2P4WA 3T5XA 2L7FP 3G4SI 3BJ6A 4XK4A 4WXDA 4UUSB 2K4BA 5HS8A 2MLKA 5LGTA 3D1NI 1X3ZB 4AVZA 1ERDA 3O8HA 4B3AA 1MBJA 5J1UA 4YEJA 4FCYA 1LEBA 4F52A 2F6CA 4U7BA 4Y4RA 3G2BA 3BLYA 4BHPA 1JTXA 2IP2A 3BZCA 1DP7P 4HSTA 4MFDA 2HYFA 3ABMH 4Z6YA 2XKOA 3BC8A 2VJ4A 3JRFA 1J0RA 2HI3A 3LAJA 2W85A 4GXOA 3G1LA 1JUSA 1WKMA 3DBLB 5BS6A 1WWXA 5DUKA 1HDPA 1V5EA 4A0ZA 4BQNA 5ED4A 3N4MA 4KNYA 4RM3A 5ICGA 3N97A 1JJ6C 2KDZA 3DPLC 4MIMA 1V5FA 1XSDA 1RIOH 3DFGA 2L4MA 1A04A 2QVOA 3GVAA 2JUCA 1U5TA 2XASA 2XAJA 2CUZA 4UVCA 1Z67A 2GA1A 4XRFA 2DA3A 2O3FA 4I76A 1R9TJ 4R1HA 1R1VA 5CVUA 4AVPA 1RPWA 3RQIA 3JR9A 2B9SA 3TDUC 3CESA 2QENA 1XN7A 5DCMB 2I5UA 5A2QK 1A31A 3TOAA 2UXXA 3QODA 5K7HA 2DJNA 1FBQA 2VXZA 4A5NA 2CH0A 1UCRA 2HQRA 2ZMEC 4ABZA 4RB1A 2VBWA 2KZGA 3NAUA 1RESA 3FMRA 3E6DA 2CJJA 1VF9A 2X1EA 3KZYA 1JUMA 2V1XA 3V42A 2CQNA 4HYEA 4II2A 5F27A 1DU6A 3ABKH 5D6EA 4A69C 2R7ZJ 2WADA 4ZDPA 3TMOA 4CYDA 1S72I 4UUSA 2CYYA 4V19K 5ICFA 3A2KA 1OYYA 4XIDA 1EF4A 1IDZA 1T38A 4ZTFA 2OZ6A 4ZYHA 3F21A 1TWCJ 1GXPA 4BU2A 3OYEA 2VC1A 4OMYA 3NWSA 2QA4I 1T98A 1TTYA 2ETHA 4LFUA 4RB0A 4ASNA 4ESFA 1HF0A 1V3FA 2LYCA 1FSHA 3LSMA 2XRNA 2VT2A 3VYUB 2STTA 2NNNA 4HX4A 5C3EJ 3MZHA 3S2WA 3KZIC 2NXNB 1YYVA 2BGCA 2OTLI 2JSCA 5LD2C 1MJ9A 2XAFA 1S7OA 1YX5A 3C2BA 4A5MA 2A05A 4Q5SF 4PDKA 5B3SH 3DTEA 3ZPLA 2W4SA 3K10A 5GAHJ 4E7JA 4I7HA 2FRHA 4IPAA 4ZH4F 1ZN2A 3G71I 2O61A 5JVTA 4HLYA 1I1GA 3LFUA 3P9KA 3KYLA 3W6VA 1SVMA 2IA0A 5E8IA 1TWHJ 5B1BH 5HNFA 4ETSA 5DCMA 1YQAA 4BY7J 1XCBA 1A5JA 1MSEC 3OYJA 1VNDA 3MKWB 4NQWB 3I9V2 3OL4A 1OYIA 1MKMA 1X1BA 2BY1A 1TWGJ 2AXLA 2GOXB 3OYLA 4RDUA 1QPIA 4C2TA 4XSXF 4HSRA 2VL8A 1AU7A 3QOEA 5M5WJ 3VYSB 5J40A 3M8FA 2E34A 2XF7A 4HBLA 4PGHA 2CQXA 5AONA 1U3EM 3I56I 2MH9A 4IEJA 3GTOJ 2PQ8A 3AG4H 1ZG5A 1WZ2A 1X1CA 1LUJB 1GV5A 3DPTA 1MMGA 2FA5A 2DA5A 1Q1HA 2GBYA 2VJIA 4WXCA 4EV0A 3A01B 1Y6IA 2QCOA 1G4DA 4R8HA 1V5GA 1GDTA 1YW7A 1XGOA 2VQGA 4G12A 2LR8A 1YX3A 2JTVA 4W1UA 1VQLI 2MC4A 3IKVA 2X9DA 3K7AJ 4S05A 3HYIA 4ON0A 1FTTA 2WV1A 3VODA 5LLQA 2IA2A 1J5YA 3RYPA 2KLOA 4LB6B 4YRVA 3S2HJ 4L5JA 1MNEA 4OIQF 5HLHA 1R5GA 1QVUA 3WU2C 1BI2A 4IHWA 1G3YA 3K9TA 4W97A 4XR6A 1MIJA 3IC7A 1UAAA 1OCZH 3K4BA 3LSGA 1T39A 4M6XA 2MD0A 1IRGA 1TL8A 3D5RC 3SHFA 2Z5UA 2L7MP 3E6MA 1UELB 2FEZA 3MZYA 3WE2A 4NC8A 3CCUI 2IT0A 5GAEJ 3ZMTA 1OLTA 1W4MA 3L7WA 4RAYA 1STZA 1YIOA 4PFPA 5TJJA 5EG0A 3WTYC 2PN6A 1ETYA 2J5OA 5JHUA 2V9KA 2PJPA 3UR3C 2EZHA 1XGSA 4N4NB 4MTEA 4G7OF 3OR2C 1ONVA 5EGOB 2WBMA 1RETA 1MNMC 1KQ9A 4UB8C 2X1DA 1X58A 2HPIA 3I59B 2K9QA 2TRTA 3FHNA 3O2PE 2CV1A 3NQOA 2R0QC 3GLXA 2EQRA 4U88A 5FROA 2KL4A 3TEDA 4FE7A 2EBIA 5LBQA 1UHSA 1ETOA 2K3PA 1IGNA 3ZQFA 4C2UA 1R22A 4HW0A 3L2RA 2GQQA 1HSJA 3CMYA 3LA2A 3U1KA 1SVOA 2R7QA 2GZWA 1S8NA 4AIKA 2X48A 3KYCB 3GFMA 1SD5A 2BXZA 2HYJA 3A01A 4BXUA 5JHFA 2CGPA 1JT6A 1ZQ3P 4C2MJ 4AIDA 2ISZA 1BI1A 2LBFA 2MFZA 2LLKA 5J8FA 1IN5A 3VWBA 3WTVC 1PJRA 3KEQA 2KIUA 2AS5F 4L9TA 1X19A 3K1MA 2P6SA 5K5QA 4RAFA 3LQRA 2V79A 1T0FA 4BYYA 1JI8A 2IGKA 2NS0A 3SXYA 1AKHA 2EFNA 2G0EA 1WRJA 4GDFA 1VQ4I 3HOUJ 3DBRB 5M3FJ 1IC8A 1ETKA 3O8GA 4CUGA 4FQGA 4KMFA 1TT0A 1WH7A 3WODF 1UB9A 2WV0A 2G7UA 1H89C 2OUMA 2HZDA 4E4HA 1UFMA 1G3SA 4RBOA 4NHJA 1EH8A 2F5DA 1DP3A 5FRMA 3WG7H 3KCCA 3WHBA 2XPWA 2MC3A 3KP7A 4YIIA 3PJRA 1DDNA 4XLFA 2ZC2A 3QYFA 4LOCA 3GTMJ 4C30A 3CC4I 3CUQC 3S2DJ 1ON1A 2IW5A 4MO7A 1X4PA 2VLAA 5EGOA 3EPZA 4A12A 4A3JJ 3OYKA 2GA2A 2EIMH 1HXDA 4EEFG 1FLIA 3I59A 2CUFA 2CW7A 2MGQA 3KZZA 3V7RA 1B4AA 2V4JC 2QZ8A 4LK1F 1YTYA 4M3FA 2M2EA 2E7WA 4F55A 2QGUA 1U2WA 1J2XA 4KIBA 1IRZA 2E5NA 5E17F 3TDZC 1Z6TA 1YW9A 3DLAA 2DOAA 2PMZN 2DFIA 4HX8A 3KFWX 1R4MB 4Z2YA 2DMNA 3CLOA 4FX0A 2R7DA 2A61A 2LF8A 4D7NA 3BG7A 3KYDB 2L54A 3H9JA 3TKYA 1TLHB 1TW3A 3OWTA 1JE8A 2PBIA 2W1OA 2HNHA 4Y3OA 3LQQA 1RKWA 5LFAA 4B4CA 2Y2ZA 3SZPA 1KYZA 1ZAOA 3HOXJ 1APLC 2DMQA 1YG2A 2OV7A 1OPCA 5DUIA 4E7KA 1IN7A 1R23A 3GF2A 4XLEA 5IY5H 3GFLA 3M7GA 4WXHA 3VDXA 2EFOA 2PJRB 2BVMA 2ZSIB 3WG9A 4YFNF 1D8JA 2JRTA 1ITYA 1K78A 4AYBN 3HRUA 1HQCA 3K4NA 2DBBA 4XRSG 2IXSA 1B8IA 2ESHA 1IRXA 2VB6A 2HGCA 3CDIA 1REPC 4KITB 3F72A 3BPXA 3PQJA 3DV8A 5DTDA 3JRGA 3WTZA 3FXMA 1HCRA 1G3TA 3Q0UA 2O9LA 4IX7A 1I6XA 1MZBA 2DFFA 4BBSJ 2O0YA 4I0BA 4ESJA 1SFUA 2PI0A 3CUOA 4CCMA 1GVJA 1K7AA 1U0JA 3GW2A 4II3A 3BT9A 2ZKZA 1R49A 4RM2A 4XNFA 2P0WA 5H2FC 1MBGA 2NOGA 4AIHA 4LLLA 5J3LA 9ANTA 5E3LA 3AL0C 1KQ8A 2EZIA 2ZJQF 1OCTC 1BN5A 1S5LC 5EF6A 3PSIA 4D5FA 5J1YA 4JQFA 3S14J 1SFXA 4HDUA 2FQ4A 3CO6C 3QPTA 3BR5A 1RUNA 3H1CA 1ZH5A 5IP6A 2H09A 4IRHA 3LA7A 3FKJA 2NVXJ 2LKXA 1IRFA 3HUGB 3S93A 3M07A 1KYWA 2GWRA 3OIQA 4X0GA 1EV7A 2HVSA 4BKXA 4PSWA 1FYLA 5D4RA 4BS9A 1BJAA 2DJIA 1MBHA 2O8KA 2E19A 2DK8A 1X3WB 4BGDA 2HOAA 5L3FA 4IO9F 5GPCA 3CCSI 2G9WA 2XF5A 1ON2A 1XGNA 1O4XA 4A2UA 2F5VA 3RIRA 3ZMSA 2D1VA 2PJRA 1TC3C 2ZXJA 2AXTC 2F5EA 5K5RA 1SAUA 3JAMZ 5DDGA 3DPUA 3F8NA 3GEZA 1SMYF 3MCZA 1IJWC 2IS4A 3AG3H 2J5PA 2HVRA 1YJNI 4JBAA 4ZC3A 1H9TA 1KU3A 4EJUA 2X6YA 3ERED 4IHVA 1VQKI 3DU5A 2HXOA 1VQ7I 3JTHA 3BP8A 1B72B 4IF4A 3HIFA 3K0LA 1CQTA 4OMZA 2ID6A 2FXAA 2K86A 3BR2A 1O3SA 6PAXA 4Y52J 3VPRA 4XONA 5HS9A 4IHTA 1BI3A 3MVPA 1IZ1A 3U1DA 4BHCA 3U21A 4D5CA 2V9PA 4DYQA 4XRMA 2Y9ZA 2BY2A 3C18A 1D5VA 1LNWA 4Y15A 4CO8A 3AKZA 2VKEA 1AOYA 4E7IA 2LSOA 2ZNYA 2LK2A 3IWFA 3TP3A 3OYCA 1TQPA 5IT9Z 5M5XJ 2HDDA 5F1JA 2VJJA 4CH7A 3OSFA 2DPUA 1D0ZA 3E5QA 4IQ4A 5CJ9A 1DUXC 4ZDOA 5E3MA 1XS9A 3HOYJ 3S3MA 2EK5A 1FBSA 4KICA 5IOZA 1Y0UA 3D0SA 3HPGA 2K9LA 3W6KB 3EYIA 3EDPA 3G6EI 4MEXF 3GBGA 2K9MA 1X3UA 2ZJ2A 2DMUA 2LFBA 3HUGA 4NUBA 3KP4A 3S32A 1VQOI 1KZHA 2EZLA 5JVGF 1GLNA 3VEPA 5BMZA 3X2QH 4ZYDA 4D9JA 2B63J 1MW7A 3M1EA 4IRIA 3OL3A 1NG7A 1F43A 1FOYA 1IAWA 1G6NA 4XQFA 2NS8A 4GGGA 4PJJA 4KT6A 3SDGA 1FYMA 1DGWY 2XIGA 3DBHB 1MJBA 4JOMA 2OJED 3HJEA 4BE1A 1UG0A 4L0ZB 3V8JA 3GTKJ 1Z05A 3GZNB 2H1LA 4PK4A 5CYVA 4NC7A 4Y17A 2Z9OA 3BG3A 2D1HA 2WWYA 4RAGA 3EUHC 3N05A 3HBLA 1QZZA 1FEXA 2QSFX 2QQAA 1WVRA 4XORA 1MMNA 5LGUA 2E5ZA 4KISA 1DPUA 1KU9A 1WI3A 3OIPA 1N77A 1D3YA 3HSEA 3JRHA 2MLGA 4JX4A 4M71A 1QPMA 4S04A 1LPQA 2P5VA 2GXAA 1ACIA 3AAFA 3MQ0A 4I01A 1FYKA 2FMLA 2RDPA 3CO7C 2CQQA 4M9SA 1Y8RB 4H0EA 2V9VA 1WJCA 3FISA 2R7WA 1PVEA 3OYIA 1T56A 3TO6A 4BEHB 3CQZJ 1R1UA 1FOWA 3T1BA 3S1NJ 2UWMA 1FX7A 4GYIA 4CXFA 3W2WA 3GX4X 2NVQJ 1B1BA 4HNTA 3Q0VA 3ABLH 2VASA 3RI4A 2ZMEB 4M73A 2OCEA 1SAXA 3WTUC 3QRFF 4EJVA 4NDLA 1FTZA 2R7FA 2JN6A 4WWCA 3BR6A 2AO9A 4OIRF 1S7EA 2LY2A 1R4NB 4PJMA 1W5SA 1I3QJ 3H92A 2LOOA 2WTEA 2JZYA 5D5UB 1TNSA 1ZRCA 4PZJA 4F91B 2G7HA 4G6DA 1H9GA 2ZJPF 1Z7LA 2Y31A 2YSRA 3P9CA 3T0YA 3JW4A 1X1DA 4DW6A 2YX4A 4EJWA 3E7LA 4HG2A 3SQNA 1ZK8A 2ELJA 4BDYA 2HEOA 2FU4A 3ABUA 1KU2A 3RJPA 3FXOA 4PCQA 5D6FA 1U5TC 3IAS2 5HDGA 3W6JB 2GLOA 1E17A 3QPLA 2DOFA 4MNUA 3BPVA 1I6HJ 1X1PA 2DCEA 3WE3A 2F4OB 1ZG3A 3ZQGA 4FT8A 3SYTA 4WF2A 5IYBJ 1G2HA 3CCJI 1QU3A 5GPAA 4S0HB 4KN4X 4IHYA 2Y30A 3GTQJ 1B59A 2L2OA 5B66C 3HGGA 5LHIA 4ESBA 3DU6A 2V1DA 2IA1A 2LKPA 1RR7A 3E0JB 3UNGC 3WU1B 2WY7Q 4CZZA 1X4OA 2NYXA 3FK7A 4A3FJ 3H3UA 3SFIA 4M3EA 4XMYA 4BEHA 2R7SA 4HEA2 3FXRA 1QBJA 3DEEA 2XAQA 1BL0A 2GIZA 1DQUA 3HOZJ 3L9FA 3KEYA 4KYWA 4GRIA 3CZ6A 3ZQQA 2HOSA 4MLOA 4I2OA 2ZMEA 2KFDA 3A03A 4XBFA 3OS2A 2OQGA 1MBFA 1U9NA 2VOOA 4AU7A 2H6BA 2XC7A 5KHDA 3IH2A 1YJWI 3LL7A 4PJLA 1CF7B 4XKWA 3LA3A 3ZP5A 3OMYA 4IZZA 3M9AA 5DD4A 2RGVA 1MD0A 4A3EJ 2ME6A 2O8XA 4KDPA 5C4XJ 4M3DA 1EH6A 3PNVA 2L01A 4M74A 3L1PA 3OYGA 1RZ4A 2NVTJ 3LSTA 3M8JA 3TGNA 5IYDJ 4OIPF 2K27A 3QOPA 1ETVA 2KP6A 5E79C 1O3RA 2VKDA 2H1KA 1CGPA 3H5AA 2DLLA 1YS7A 2KQRA 2WB1N 2EIJH 2RVCA 4BUPA 3TQNA 1TZLA 4GYGA 3OOPA 2CS3A 2COMA 2M7AA 1QNTA 4FE4A 2ICWG 4C3IJ 1OCCH 3PUFA 4OAYA 4E70A 4HDVA 4J01A 3LMMA 3BJAA 3CCVI 3DKYA 2OU2A 4Y13A 2M1BA 4EJOA 2JQ7A 2KRFA 3ZN0A 2QKLB 4DJAA 3J7AO 3DTIA 1EKEA 2DMTA 1SD6A 3I54A 3DTKA 2A5WA 4RB3C 1O3TA 4DGWB 3M8EA 3I3LA 2R7XA 2P5KA 4FASD 3K4MA 2W82A 3CJTB 3V7SA 5FB2A 3JTGA 4O3MA 1AA7A 3G1MA 5BPIA 1AHDP 3I4PA 3S16J 3M1CA 2W7NA 1ZLJA 3FM5A 1WJFA 2P7CB 2D45A 3BDDA 4BACA 5HDKA 4A0YA 4I98B 5ILUA 1L0OC 4AWXB 4NB5A 2HYGD 1RI7A 2BVLA 2L9RA 2WB1A 3QPSA 1LEAA 2VXDA 2I8DA 1A36A 3GTJJ 5FRNA 2V1NA 1BW5A 1GV2A 3SEZA 3BR3A 1W0TA 2CUEA 1ETQA 1POGA 5ILVA 1K6OA 4XSZF 1SANA 4HX7A 1CF7A 2HS5A 5L3DA 1TBXA 3W2AA 4G7HF 3MN2A 3PO2J 5HVQC 4LG0B 2A69F 4BXFA 1LQ1A 1JKOC 4KUMA 1VQ5I 4AIJA 3TL4X 1ZKGA 3IHUA 2DYSH 5HODA 4O6JA 2VPLA 1MNDA 1XSVA 1JKPC 2M4GA 3B6CA 4V2GA 3D5LA 2M7BA 4QIWN 4RGUA 2MG4A 3REOA 2IJLA 3ZMDA 2H8WA 1TQMA 3JAMK 2BOLA 5LRRA 2KRHA 3AG2H 3J80Z 2IS6A 1U9OA 4A3DJ 2JVGA 1R00A 4Q48A 4PJNA 2LRDA 2VBZA 3FZVA 3EQLF 3HRTA 4TV7A 3SEQA 4DQ2A 4XRSA 3FXKA 3JRAA 3CCLI 3M4OJ 4ZDLA 1JXSA 2RNGA 4HPQA 3F8BA 2W25A 1O3QA 2NOJB 3DLLF 1BBYA 4XKVA 3RKXA 2QSGX 2Q2EB 2V7FA 3OYAA 4HF2A 2KJBA 2VKVA 4FX4A 3H9GA 3Q3SA 2Z1DA 1OJLA 4ZZLA 1NHAA 3UKGA 4G6TB 2KRCA 3ESWB 4NQWA 1HDDC 1PYVA 2HFHA 2YUSA 2R93J 1UHWA 2X0LA 1QZYA 4AM3A 3CMMA 5DV5A 3R0AA 3GXOA 1DGRM 3HGYA 4OIOF 3BZ6A 5IT9K 3SFZA 2M3AA 3F8FA 1LFPA 1N25A 1WJDA 1BR1A 1TW2A 3EETA 2FX0A 2IBDA 2HTJA 3CUQB 2Q8KA 1T2KA 4V2FA 2KISA 1Y1VJ 2A3SA 2DFHA 1FMWA 4AC0A 1VTNC 3LOCA 3R61A 1FY7A 3OYHA 2DQLA 2E35A 5ICCA 1V4RA 5HS7A 1IXCA 3HZJA 2EB7A 5KAIC 4BQOA 2LY9A 2WC2A 3L2WA 2DN0A 3HTUA 5EZHA 2L3DA 5H20A 1BIAA 4BAYA 1MMAA 5J4VA 4L5EA 1IO2A 1LJ9A 2F2EA 2UUZA 1U78A 5ILSA 4IOCF 1Y0NA 3NEUA 4LG0A 3DKWA 4LIUA 5F1RA 3JRBA 4I02A 2UXNA 3H3VK 3D5SC 1T08B 4R79A 3WTXC 2CRGA 1OMIA 1EJ9A 1C0WA 2A68F 2CG4A 2LDUA 3P9IA 2ZB9A 3LSKA 3IH4A 1P4XA 1YIJI 2DT6A 1FWZA 1ZRFA 3K2ZA 2LMDA 2H27A 2OC6A 1BA5A 4L5IA 3MEXA 3LFKA 3LSHA 3FMQA 4C3JJ 2QEXI 1S7AA 1I27A 1S3JA 4KIGA 3KLOA 4BNCA 3GTPJ 4B43A 2Z2SB 3JSOA 2KIFA 2E71A 2OZUA 4UY8I 1WH5A 2M45A 2Q2EA 4JX6A 2DPDA 5D4SA 1G8XA 2X85A 1SVLA 4IRGA 5CVIA 1P7IA 5JLWA 5J4YA 5DM7F 2O03A 2EJRA 1I5ZA 2H94A 2Y0MA 3H5NA 5IP9J 2NRAC 3OY9A 4RGRA 3TBIA 4ZTJA 4ZJZA 5C4JJ 3C3WA 4LJZF 2BBYA 1WJAA 1GXQA 2VBYA 1QQIA 2DYRH 2XV4S 4NNJA 3CCRI 1USSA 5EYRA 4N9HA 3LSJA 3PSFA 3CUQA 2XAHA 3BTJA 2EINH 2PMUA 2QF7A 2OAZA 1T8IA 4OAZA 4IHSA 2HQ5A 5FKNA 2XSJC 4YIRX 3HB9A 5FKLA 3JREA 3AFHA 3QPHA 4IJAA 2M0CA 2ZFUA 3ZMVA 1VFCA 3AL0B 1D0YA 3GMEA 2DT7B 1QHHD 3RZDJ 4QLCU 1S6LA 3VFZA 4CDGA 3E5UA 2X4HA 4XKBA 5KK1A 2M8GX 4YELA 3FXUA 3O3KA 4CCNA 1A6IA 1WCMJ 4RGSA 4L0YB 5B1AH 3CDHA 2A6TA 4A3CJ 3ZQIA 2K02A 2QSHX 2HZTA 2M87A 3V4GA 4ANJA 3S1RJ 4GCVA 4JYKA 3MD2A 4CZCA 5EZGA 1AWCA 2FNPA 1R7JA 2YU3A 4P96A 3RSNA 1YO5C 3GWZA 5BPDA 5F08A 5ERIA 2K5CA 3E5XA 2GM4A 1W36C 1XMKA 2CFOA 3SJMA 5CKTA 4L9VA 3B6AA 2HDCA 2R92J 1U6GA 3C7JA 3FX3A 1EH7A 2GOMA 2C6YA 2L5QA 2XPVA 1S29A 1IXRC 2PMZA 4HZFA 2F5CA 3VB2A 1Y56A 1V54H 1XPXA 3LSIA 4ENKA 1ZG1A 1IXSB 1LVKA 1OCOH 1SFEA 1LVAA 4C9YA 1BJZA 3FM3A 4P1WA 3J81K 2E1MC 3RDIA 3QU3A 4ENMA 3S3OA 1K4TA 4XOTA 3H5RA 1U8RA 2EH3A 1FOXA 4HF0A 3WTTC 5LGNA 3O6BB 2WY8Q 3BJOA 1IUYA 2LNBA 1YE9A 3FMSA 3FBNB 1I50J 3MKZA 1J75A 1KA8A 1FJLA 2GAUA 5GAGJ 4RLQA 4AYBA 3IRRA 5GTIC 4LB5A 3T8RA 3LNQA 2VJ5A 2JVHA 4QPQA 1WQ2A 3I4NJ 1W1WE 3FK6A 4LD5A 1BOBA 3ZN1A 1QA6A 1ZGJA 2FBIA 2WAQN 2EFWA 4DBRA 4P55A 4EGYA 1HOMA 4YFKF 2V6CA 2Y69H 3BOQA 2JA5J 2QBYB 3F6OA 2R5YB 4PFOA 2FF4A 1K4SA 1R1TA 1HC8A 1XSXA 2ZXWH 3F3XA 1ZGWA 4BL0B 1BOAA 1ZELA 3QP6A 1YI2I 1FPQA 4IHXA 4I6ZA 3FF5A 5IOYA 2QWWA 1F5TA 2Q0OA 3KEOA 5FLXZ 1BR2A 2LG4A 3OYMA 1R58A 1OCRH 3IUOA 2VIXA 3CMAI 5FD5A 5F0HA 5BNGA 4B48A 3DF8A 1ORKA 3GO5A 2L9NA 4CICA 3CCMI 2IAIA 3RKQA 2MSYA 3OV8A 3K70C 3CP8A 4EVIA 3KP3A 1ZYRF 4X1EA 5AIPA 5E1ZB 3RQ4A 2XAGA 2TDXA 1ZRDA 1WPKA 3G73A 4I09A 4RA2A 5KCMA 2KIQA 2ELKA 3L09A 2QUFA 2WAQA 2ECBA 4OINF 1GUUA 1K83J 2VE8A 3SZTA 2CQKA 4UVAA 1Y1WJ 3MMYB 3ECOA 3VSLA 3I55I 1VQ6I 4A93J 2X6OA 5F0CA 2BXYA 2F4IA 2M8EA 2XKPA 3GCMA 2K85A 3ROUA 2XSDC 2R7RA 3J7YJ 1SMTA 5KNLA 4BXXJ 1PUEE 5GP9A 4BE2A 2IS2A 3DQVC 4DBQA 2PX9A 2JA2A 2XVCA 2VODA 1WI9A 2CW8A 2OF7A 2VPRA 5DCFA 2BY3A 1RKTA 2LC2A 2E60A 4L9NA 4QSHA 2MABA 4EM2A 1D1CA 4K2EA 2ECCA 2L7ZA 2LY1A 2TCTA 4BJTA 2NNYA 4UXNA 5JFRA 3OSGA 4E7ZA 2CQ7A 4A3MJ 1VQNI 3PIOF 2QBYA 3HKZN 2R5YA 3OYFA 1QO0D 2DA1A 3HL2A 3B02A 3L2CA 1B9NA 3MKLA 2KIMA 4XM3A 2XB0X 3ERMA 2ZBKA 3AG1H 3R4KA 2Z33A 2CSOA 3GFJA 3CC7I 3G1OA 2DT5A 3J80K 4UUTA 1FOKA 2HOTA 1FC3A 1PP8F 3A1YA 1R36A 2FUG2 2XB5A 3C2HA 1HW1A 4B47A 2QQBA 3PO3J 4XLAA 1BM9A 3MKYB 2HVQA 1XB4A 3CLQA 3COAC 1IV8A 2IVMA 4U0WA 2FBKA 3SZGA 4PGGA 1U5TB 2ID3A 4G6QA 1B72A 1T33A 2EV5A 3BR0A 3H0GJ 3QU6A 1Z3XA 2QM3A 2R4GA 3U9GA 2P5LC 1T95A 2HR3A 1TP4A 4LG3A 1V55H 1IN4A 2JMWA 3RPUD 1D1BA 2EIKH 1OR7A 3BROA 4BQQA 3ZQ7A 5HDNA 1XDUA 1JGGA 3FXLA 4PSXA 4A3GJ 2Y48A 2NVUB 2EPFA 2KJCA 2P7VB 5EEAA 3WGIA 2E1NA 2FNAA 2FD5A 3PNTA 5TGTA 1Y39A 2H8RA 4NC6A 2E1CA 1R71A 4A3KJ 4B1RA 1HW5A 2NVYJ 5K5OA 5J1RA 2OA4A 3BTIA 4MQ9F 2L02A 1LDKB 3BQZA 1JKQC 3GTLJ 3HG9A 4P9UA 2W00A 5HLGA 2B7EA 2BEOA 2VQHA 4A6EA 5ICEA 4BJ5C 4XN0A 2ACJA 3PUBA 2D2WA 1HBXG 4I0AA 1N78A 1GHCA 3CJNA 2XGDA 2AHQA 4OWRB 5FFZA 3TOBA 2JA8J 1FT9A 1ZREA 5E1WA 4E7HA 3TO7A 4AD9A 1ZLKA 1R6RA 1B6AA 3VYTB 1QRYA 1G3WA 2XGEA 5FKMA 3FKIJ 5FJ8J 3PFIA 3ZMZA 2BY0A 3I64A 1T6SA 4A3IJ 4EM0B 1G59A 5EEHA 2GXGA 1RUOA 1HKTA 1M1EB 3ZQLA 5CVVA 4ZYAA 2XROA 4JK1X 3DKXA 3CMEI 3I71A 3TW7A 2FJ1A 5HLIA 2OD5A 3K69A 2EV0A 3TO9A 2IEKA 3QWLA 1WJBA 3ASNH 3CCYA 3HSFA 3WGHA 3FBIB 2L9SA 2E2IJ 1LFBA 1TWFJ 5E18F 3JSPA 1UHMA 1F4KA 3ZMUA 5J8CA 1P7JA 1Z9CA 5GADJ 2CV0A 2CMPA
chains in the Genus database with same CATH topology
1MNDA 3DLAA 3S8PA 2DOAA 1MMDA 2M4GA 3D5LA 2M7BA 2ZXHA 4RMNA 4CCOA 4J00A 1SFKA 2LREA 4HNUA 3BG7A 2BOLA 2KRHA 3H9JA 2IS6A 4XOPA 3W3CA 2JVGA 3OWTA 4LIVA 4PJNA 3SEQA 2LRDA 2W1OA 4IKFA 2HNHA 3QYEA 2X51A 4BDZA 3J7AY 4ZDLA 2RNGA 4HPQA 4Y3OA 5LFAA 2NOJB 3ZRGA 4XKVA 4KJZA 2Q2EB 2V7FA 2OV7A 3OYAA 3EUAA 4E7KA 1N75A 4XLEA 3A4CA 3VDXA 2VQCA 4FETA 2PJRB 2BVMA 2ZSIB 3H9GA 2Z1DA 3K4LA 1LKXA 2JUGA 4G6TB 4IQJA 2KRCA 2CV2A 1PYVA 2KMUA 3K4NA 3CMMA 2IXSA 1DGRM 2AQEA 4CA0A 1IRXA 2VB6A 2M3AA 2RREA 2KDOA 1LFPA 1WJDA 4KITB 1BR1A 1Z21A 2M0MA 3K4KA 3NWTA 3S3NA 4XKCA 2X1CA 4Y33A 2WAFA 4IX7A 1FMWA 3HC7A 2R7UA 3CJQB 3OYHA 4BE0A 3H9QA 3RCOA 4BQOA 4CCMA 2VQLA 1EA3A 1U0JA 3L2WA 4II3A 3HKZA 4RM2A 4XNFA 2P0WA 1MMAA 1OR7C 3OS0A 1KONA 1P9QC 2UUZA 3AL0C 3CJRB 3K6GA 1X1AA 4LIUA 3C2GA 2JSPA 3W2VA 3D5SC 2BW3A 3PSIA 4R79A 2R7OA 1HA8A 4PUSA 4JQFA 3H35A 2DXIA 3PNYA 3LSKA 2WAEA 1E0EA 3L2UA 2DT6A 4EATA 3OYDA 3FKJA 3K4JA 3K4CA 3HOSA 2OC6A 3HUGB 3S93A 2M4KA 3OIQA 4X0GA 2HVSA 3LSHA 4PSWA 2XF6A 4BS9A 3BCAA 2DJIA 4AVZA 4B43A 2Z2SB 1ERDA 4BGDA 2XF5A 3OYNA 4YEJA 2X6XA 4F52A 1G8XA 2F5VA 2F6CA 2X85A 4U7BA 4Y4RA 2IGNA 3CP2A 2PJRA 3G2BA 3BLYA 4D1QA 2QKMB 4HSTA 1D0XA 1SAUA 2WA0A 4XL9A 3BC8A 3DPUA 2VJ4A 3VSKA 3H5NA 3OY9A 2IS4A 3TBIA 2HVRA 4ZTJA 4ZJZA 4ZC3A 4XN3A 2X6YA 1WJAA 2X6WA 3DU5A 1V5EA 1D1AA 5CPRB 4NNJA 4BQNA 1BR4A 1S9HA 4RM3A 3PSFA 5HLTA 3DPLC 4XONA 1V5FA 4OAZA 3U21A 3IP4B 2XSJC 2VKHA 3AFHA 3AL0B 2CUZA 2ZFUA 3BG6A 1D0YA 2LBFB 3AKZA 2DT7B 4E7IA 2Q1ZB 1QHHD 4F92B 4XKBA 3FDYA 3OYCA 3CESA 4YELA 2VJJA 4CCNA 4CH7A 4E6KG 1D0ZA 4IQ4A 4ZDOA 3QODA 2A6TA 2VXZA 4ANJA 3S3MA 2CH0A 3MD2A 4CZCA 3DWLE 3HPGA 2K9LA 3RSNA 4BJ6C 2RQQA 2K5CA 3GBGA 3L2QA 2KZVA 2X1EA 4LITA 2CFOA 2XAUA 2K9MA 1W36C 5CKTA 3V42A 2IGOA 4II2A 4NUBA 3S32A 2WADA 4ZDPA 1GLNA 2GOMA 3KX2A 3TMOA 4E7SA 2L5QA 1W36D 2PMZA 4D9JA 1MW7A 1Y56A 3OL3A 1NG7A 4F93B 3LSIA 2V6EA 3VYRB 3A2KA 1LVKA 4XQFA 3HPHA 4ZTFA 4PJJA 4C9YA 4KT6A 1DGWY 3ZR8X 4BU2A 4JOMA 4P1WA 3OYEA 2E1MC 4BE1A 1UG0A 3NWSA 3S3OA 4XOTA 3H5RA 1WJ5A 4PK4A 4XLCA 2HQAA 4NC7A 2LYCA 2WY8Q 3LSMA 3VYUB 2KHMA 3EUHC 1YE9A 3BCBA 3N05A 3FBNB 3MKZA 4XORA 1MMNA 5LD2C 2E5ZA 4KISA 3OIPA 1N77A 1YX5A 4RLQA 4AYBA 4B3XA 1T0FC 2VJ5A 2JVHA 3DTEA 4QPQA 1WJCA 1BOBA 2W4SA 3K10A 2R7WA 4E7JA 3OYIA 3PFYA 4BEHB 4CCJA 4DBRA 4P5OA 3LFUA 2UWMA 4H4KC 3KYLA 3W2WA 4PFOA 4F3QA 4HNTA 3ONQA 2VASA 4N4OB 5HNFA 3HOTA 1Z3YA 4BL0B 3OYJA 1ZELA 2Y0SA 3E1SA 3MKWB 3L2VA 4NQWB 3I9V2 3ZCOA 3OL4A 1BR2A 2LG4A 3OYMA 2HU9A 3IUOA 2LY2A 2VIXA 4PJMA 4B48A 1X1BA 2GOXB 2LOOA 2L9NA 1QHGA 3OYLA 4C2TA 4HSRA 2VL8A 4F91B 2UV1A 3K70C 3QOEA 4B44A 3CP8A 3VYSB 3RQ4A 2XF7A 4DIQA 1Z7LA 5KCMA 2Z16A 2E1MB 1X1CA 1X1DA 2WAQA 3DPTA 3K70D 1MMGA 4HG2A 2ELJA 2VJIA 1Y6IA 4BDYA 2KPMA 1V5GA 3IAS2 2XDVA 2VQGA 3MMYB 1YX3A 3VSLA 1FMVA 2MC4A 2F4IA 2DCEA 3RTRA 3SYTA 2R7RA 3HXLA 5KNLA 2KLOA 2L7KA 2IS2A 4BE2A 1QU3A 4YRVA 3OR1C 4ITVA 1MNEA 3DQVC 4DBQA 2JA2A 2CW8A 3F9KA 2LH9A 2L2OA 2LC2A 3DU6A 4XR6A 5HNHA 1UAAA 2E60A 4CCLA 2MABA 3E0JB 1D1CA 3K4BA 3UNGC 3QYBA 3LSGA 2WY7Q 5CQGA 1X4OA 2LY1A 2MD0A 3D5RC 4BJTA 1VZ0A 3OOUA 1UELB 4XMYA 4BEHA 4E7ZA 2R7SA 4HEA2 4NC8A 3DEEA 3EUKL 1OLTA 1DQUA 3OYFA 3KEYA 4PFPA 4GRIA 2O5RA 3HL2A 3CZ6A 3ZQQA 4MLOA 2V9KA 4XM3A 3OS2A 1J09A 3UR3C 4AU7A 2XC7A 4N4NB 2R7TA 3OR2C 5KHDA 2ZXIA 2WBMA 5CQEA 3OS1A 3LL7A 4PJLA 2X1DA 2HPIA 3FHNA 3A1YA 4XKWA 2CV1A 3OMYA 2FUG2 5FROA 4IZZA 3C2HA 4U87A 2KL4A 4HRIA 4B47A 2AQFA 2K3PA 4XLAA 3MKYB 2HVQA 4C2UA 1K6YA 2HDWA 3PNVA 3L2RA 3SZGA 3OYGA 3M8JA 2R7QA 3IAM2 4CSWA 1Z3XA 2KP6A 2R4GA 4E7LA 1T95A 2VKDA 4LG3A 5JHFA 3H5AA 2IGMA 4XLHA 3RPUD 1D1BA 4BQQA 2KQRA 4BUPA 4PSXA 2LBFA 2MFZA 1TZLA 2CS3A 3VWBA 2M7AA 1WJEA 1PJRA 5HOOA 3PNTA 1X19A 5TGTA 4OAYA 1JI8A 4J01A 2IGKA 3LMMA 3DKYA 2QKLB 4DJAA 3ZGKA 3DTIA 2MYSA 2ZSHB 3CF2A 1LDKB 2IS1A 3H0DA 3HG9A 3DTKA 2W00A 2VQHA 2A5WA 4BJ5C 4CUGA 4DOZA 4XN0A 3PUBA 4DGWB 1N78A 3I3LA 1TT0A 2R7XA 4FASD 3K4MA 2W82A 2OUMA 2HZDA 4OWRB 4E4HA 3OYBA 1AA7A 2V26A 2CUJA 4E7HA 4RLFA 3M1CA 2W7NA 1DP3A 1R6RA 3VYTB 1WFXA 1WJFA 5FRMA 3SDBA 4BACA 3PJRA 1NG6A 4XLFA 3ZXSA 1G59A 3QYFA 4C30A 2BVLA 2WB1A 4ZYAA 2VXDA 1X4PA 2I8DA 2VLAA 2HPMA 2V1NA 5FRNA 3DKXA 3SEZA 3EPZA 4QPOA 3OYKA 4CCKA 1WJBA 3W2AA 5HVQC 2R7VA 2CW7A 3FBIB 2L9SA 4BXFA 2V4JC 3TL4X 2BW3B 4F55A 2CV0A 2E5NA 2CMPA 3PL8A 2VPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGW B;  2DT6 A;  1UG0 A;  1X4O A;  2E5Z A;  2DT7 B;  2E60 A;  1X4P A; 
#chains in the Genus database with same CATH topology
 3S8P A;  2LTP A;  1OYW A;  1RNL A;  2A6E F;  2DTR A;  2ZXH A;  4RMN A;  4CCO A;  3BR1 A;  3KP5 A;  4HNU A;  1ULY A;  1MGT A;  2B0L A;  2EV6 A;  3DXJ F;  3ZQC A;  4XOP A;  3W3C A;  1IN8 A;  1XD7 A;  3J81 Z;  1YLF A;  1Q1V A;  2PEX A;  3CTA A;  3QYE A;  2X51 A;  2GXB A;  1P6R A;  3L00 A;  5IT3 A;  2L0K A;  1U8B A;  3MZ8 A;  2E7X A;  3HSR A;  3S1Q J;  3RYR A;  4P9F A;  4L9J A;  3A0H C;  2RV8 A;  3EUA A;  3GUD A;  4X6A J;  4JP0 A;  4HQM A;  1N75 A;  1JKR C;  3K1P A;  3BTC A;  2VQC A;  1LDD A;  3V8K A;  1H0M A;  4EM1 A;  5FD6 A;  2JUG A;  4IQJ A;  3TP0 A;  2XHK A;  1BW6 A;  2KMU A;  2LF7 A;  5D8L B;  1PP7 U;  3RPQ A;  2AQE A;  3DEW A;  4KMU X;  5JI6 A;  2RRE A;  1FIP A;  1Z21 A;  2M0M A;  3K4K A;  1IN6 A;  4G8X A;  5DD8 A;  3PIP F;  3S3N A;  1L3L A;  1I1S A;  1F1Z A;  2X1C A;  4Y33 A;  1TT5 B;  2KKO A;  2PG4 A;  2RQP A;  3ZQH A;  3R60 A;  3HC7 A;  1XC5 A;  3F8M A;  5CLS A;  4D7M A;  4BE0 A;  1MMS A;  1HW2 A;  3RCO A;  3BY6 A;  2DTZ A;  1VQM I;  3IL2 A;  5D5X B;  1YOV B;  3Q0W A;  3EYY A;  2D5V A;  1R5I D;  3OS0 A;  1KON A;  1YS6 A;  1P9Q C;  1P4W A;  3K6G A;  1JJ8 C;  4XLN F;  3GTG J;  4MHG A;  3RPU A;  3JRC A;  1OCP A;  4KA4 A;  2R7O A;  1FP1 D;  2COB A;  4PUS A;  1JTY A;  1DPR A;  4XLP F;  2DXI A;  2E2J J;  1FIA A;  1SD7 A;  1XG1 A;  2YS9 A;  3PNY A;  3J7Z I;  1E0E A;  4ENJ A;  3A0B C;  2V1U A;  3OYD A;  1VQ8 I;  3K4J A;  3K4C A;  3HOS A;  3JCU C;  1LE8 B;  5EDN A;  5DS9 A;  2XF6 A;  2I10 A;  5EG0 B;  2YU9 J;  4G94 A;  3BCA A;  2R5Z B;  2QYO A;  2M34 A;  2F4M B;  4BQA A;  3I5U A;  4HV6 A;  1O57 A;  3V7C A;  3U2R A;  2QLZ A;  3VOE A;  3WHC A;  3K2A A;  4M6V A;  3OYN A;  2X6X A;  4Q4Z F;  1DU0 A;  5IP7 J;  2IGN A;  3CP2 A;  2M30 A;  4D1Q A;  2QKM B;  2CFX A;  1D0X A;  2DAO A;  1IV6 A;  2WA0 A;  4XL9 A;  2OBP A;  3VSK A;  1NH3 A;  1LDJ A;  2H6C A;  2MW8 A;  4CYC B;  1SEU A;  2EFP A;  4UVB A;  2CWE A;  2XRL A;  4XN3 A;  5CVR A;  1K61 A;  1J7K A;  2X6W A;  4EMS A;  3P5J A;  1D1A A;  5CPR B;  4DNC A;  1BR4 A;  1S9H A;  5KAF C;  3MFK A;  3E97 A;  1ETX A;  5HLT A;  2F5F A;  2FOK A;  3ISP A;  1TNT A;  5FLX K;  3ML6 A;  4MGR A;  1Z1D A;  3ULQ B;  3IP4 B;  2Y9Y A;  2HQN A;  2YR2 A;  5GTH C;  5IPA A;  3I53 A;  2DFE A;  2VKH A;  3BG6 A;  4NBQ A;  2LBF B;  1MH4 A;  2EA2 A;  1JHF A;  3HHG A;  4KFC A;  2Q1Z B;  2VI6 A;  1UMQ A;  4RAZ A;  2VN2 A;  4F92 B;  3HEF A;  1IDY A;  3BZK A;  2Y75 A;  3FDY A;  4OU0 A;  3E6C C;  2JA7 J;  2JRM A;  3DEU A;  4HAM A;  1E2X A;  4E6K G;  4M3B A;  2W24 A;  1AKH B;  1QVT A;  2HTS A;  4DYC A;  4UV8 A;  1W7P D;  1JGS A;  1UJ8 A;  2VON A;  3DWL E;  1YRN B;  2HKX A;  2OQR A;  3KET A;  3V8L A;  4BJ6 C;  2RQQ A;  4KN7 X;  5TRD A;  2DQR A;  3F6V A;  2RAE A;  4CHU A;  2YX7 A;  2KZV A;  2ZFW A;  4LIT A;  3L2Q A;  2XAU A;  2HOE A;  4ZYG A;  3HOV J;  1ODD A;  1Z7U A;  2BZT A;  2IGO A;  2JJ7 A;  3OIO A;  5K7F A;  4A3B J;  2LVS A;  1NK3 P;  3CCE I;  3DP7 A;  1ENH A;  1LE8 A;  1ZAR A;  1ZHF A;  3KX2 A;  4LLN A;  4E7S A;  3WGG A;  1MSF C;  1W36 D;  1WHU A;  2R5Z A;  4LLG F;  3A02 A;  4F93 B;  2QQ9 A;  3H3Z A;  2V6E A;  2JK3 A;  4DZP A;  3FXQ A;  1UG2 A;  3KP2 A;  2DK5 A;  4MFE A;  2MA3 A;  3VYR B;  3LSP A;  3HPH A;  4HLX A;  1VQP I;  4L18 B;  3ZR8 X;  2UZK A;  2DW4 A;  5BOX A;  4KT5 C;  2Y0S N;  1Y8Q B;  5KVR A;  1J59 A;  4B8X A;  1WJ5 A;  1W0U A;  4XLC A;  5L3C A;  1MJA A;  2HQA A;  5E8G A;  4G7Z F;  2ISY A;  5FO5 A;  4IOA F;  2LP0 A;  1ZTR A;  1MH3 A;  2KHM A;  3BCB A;  5F0F A;  4CYC A;  2CO5 A;  2RKH A;  2VOP A;  1B9M A;  3BG9 A;  4ZZD A;  3BWG A;  2VT3 A;  1PDN C;  2FBH A;  3I0T A;  3QAH A;  3QP5 A;  5LHH A;  4B3X A;  5D8K B;  3IRQ A;  5F6F A;  1T0F C;  2DMP A;  5H6Q A;  2E36 A;  2K3F A;  1GT0 C;  1TWA J;  1XMX A;  1GVD A;  3P7N A;  2IPQ X;  2OCC H;  4B09 A;  1W7P B;  3PFY A;  4CCJ A;  2A07 F;  1D8K A;  4AUX A;  2EA4 A;  4P5O A;  1P2F A;  4A0X A;  2K9N A;  3LAP A;  1W5C C;  2OPT A;  4H4K C;  4LGW A;  5D5V B;  1OKR A;  2ZCW A;  3K1N A;  4F3Q A;  3G3Z A;  3ONQ A;  4N4O B;  1E3H A;  1J9I A;  3HOT A;  1Z3Y A;  1SD4 A;  2STW A;  1Z0X A;  2GIV A;  2Y0S A;  2HXI A;  3E1S A;  2P8T A;  3L2V A;  1K78 B;  3ZCO A;  2MD5 A;  1IG7 A;  1FNN A;  1RC9 A;  1XMA A;  1P4A A;  2HWV A;  2HU9 A;  4FHT A;  1E3O C;  1B8I B;  1YRN A;  4HQE A;  1TQI A;  4QWQ A;  3IWZ A;  3Q9S A;  1QHG A;  1O7L A;  1QGP A;  1E3P A;  2F48 A;  4YIF A;  2LD5 A;  5FLV A;  3MWM A;  3S17 J;  1XTA A;  3Q9V A;  2UV1 A;  2ZJR F;  4B44 A;  4A3L J;  2YPR A;  2CW0 F;  3HDD A;  2P81 A;  3HRS A;  4DIQ A;  4JX5 A;  4DYR A;  5A2Q Z;  4QTR A;  2Z16 A;  2E1M B;  3BTL A;  3HOW J;  3K70 D;  3GZ6 A;  5F04 A;  5B5E C;  2MBF A;  3CC2 I;  1XGM A;  2M5W A;  2DOE A;  2KPM A;  2O7O A;  2E1O A;  2Z99 A;  2K4J A;  2P6T A;  4IXA A;  1XCV A;  5FKO A;  3ZOB A;  5L3E A;  2XDV A;  5C44 J;  4N9I A;  2N8G A;  1FMV A;  1Z77 A;  2A5Y B;  4HV5 A;  5D5W B;  1LFU P;  5M5Y J;  1R5H A;  4PJ0 C;  5DYM A;  2JA6 J;  3RTR A;  4F7Z A;  5K1Y A;  2RC4 A;  3HXL A;  5E3O A;  2MH2 A;  2XGX A;  2L7K A;  1UST A;  4RGX A;  3Q5F A;  3OR1 C;  2W84 A;  4ITV A;  3M3Y J;  3F9K A;  2LH9 A;  3WTW C;  2ADU A;  5FGM A;  5HNH A;  2A6H F;  5DEQ A;  4WK8 F;  4CCL A;  2FE3 A;  3KP6 A;  3QYB A;  2BV6 A;  5CQG A;  5J6X A;  1MDM B;  2XPU A;  3JRD A;  1W7P A;  1VZ0 A;  3OOU A;  1F9N A;  5EEG A;  4CGZ A;  2EIL H;  1KQ0 A;  2JWT A;  3I58 A;  2KT0 A;  3EUK L;  4N0B A;  3BQY A;  3CCQ I;  2O5R A;  3PM1 A;  1YIT I;  3LSR A;  2DA7 A;  5E1X A;  1H88 C;  1J09 A;  2W48 A;  2R7T A;  3E3V A;  2ZXI A;  5CQE A;  1NK2 P;  1BC7 C;  2RNJ A;  5F64 A;  3OS1 A;  4WX9 A;  4FIS A;  3F22 A;  1OFC X;  4UV9 A;  1QZE A;  2K40 A;  1HKQ A;  4U87 A;  5TIS C;  4YFX F;  1A6Q A;  1KGS A;  2ZO4 A;  2ESN A;  4HRI A;  2IRF G;  5J47 A;  2AQF A;  1YW8 A;  2ZNZ A;  1P92 A;  3NRV A;  2M9H A;  1K6Y A;  2HDW A;  4I99 C;  4M9X A;  4BH9 A;  3RZO J;  4U7D A;  4XIC A;  2BE5 F;  1D5Y A;  3CDL A;  4UB6 C;  1PUF B;  3IAM 2;  4CSW A;  4YG2 F;  3KE2 A;  5JR3 A;  2FMY A;  5E3N A;  5L3B A;  2DDB A;  4E7L A;  3TW6 A;  2IGM A;  4XLH A;  5FLM J;  1ZR4 A;  3BG5 A;  1LB2 A;  2FOW A;  2NAZ A;  4EGZ A;  3F0C A;  4FTH A;  2BHZ A;  1WJE A;  5HOO A;  3E6B A;  4GO1 A;  3F8C A;  4D0P A;  2O6G E;  1MBK A;  2R3S A;  2JT1 A;  3WTS C;  3F23 A;  1RR8 C;  3LWF A;  2OTJ I;  3ZGK A;  3IV5 A;  2MYS A;  2ZSH B;  3CF2 A;  4M72 A;  5LHG A;  2IS1 A;  4M6Y A;  3H0D A;  3C1D A;  2W57 A;  3GFI A;  4M9Z A;  5AIQ A;  1ZGA A;  1XX5 A;  4IVN A;  4DOZ A;  1BC8 C;  2ELH A;  3HM5 A;  3B73 A;  2DA4 A;  2DI3 A;  2EWN A;  1MDM A;  4RS8 A;  1JT0 A;  5M3M J;  2JPB A;  4Y7N J;  3OYB A;  2V26 A;  3FIW A;  5LRS A;  2CUJ A;  2JPC A;  1FSE A;  4RLF A;  2LKS A;  1WFX A;  4U0V A;  2FSW A;  3R0J A;  3SDB A;  2K7L A;  1NG6 A;  3ZXS A;  3QQA A;  2XGC A;  1K79 A;  5BQT A;  2Z3Y A;  4HA8 A;  3ECH A;  2HPM A;  1VQ9 I;  3NAR A;  4QPO A;  5DM6 F;  3T8T A;  4MTD A;  1YFH A;  1WSU A;  4CCK A;  2FQ3 A;  4HOB A;  2VBX A;  4EJT A;  1JHH A;  1UZC A;  2R7V A;  3PQK A;  5IYC J;  1OIS A;  4M3G A;  3ASO H;  3R6S A;  2BW3 B;  1F36 A;  4MQV A;  1H8A C;  3PL8 A;  4DZJ A;  1I39 A;  1MMD A;  1HKS A;  2QQ8 A;  3I4M J;  4J00 A;  1SFK A;  1I3A A;  2LRE A;  2XUB A;  4HF1 A;  2RN7 A;  3RKY A;  2DOD A;  1PUF A;  1IF1 A;  2PLY A;  1IUF A;  1FZP B;  1MBE A;  1Z6R A;  2PMH A;  2EZK A;  4LIV A;  1W5T A;  4ZYE A;  1SC7 A;  3KLN A;  4BY1 J;  4BHB A;  4IKF A;  2E2H J;  4KIF A;  4BDZ A;  1X2N A;  4J19 A;  3J7A Y;  1ETW A;  1KU7 A;  1RRJ A;  4O5V A;  3ZRG A;  3HRM A;  1FBU A;  4KJZ A;  2DA6 A;  4OOI A;  5JLX A;  1Z91 A;  2NS7 A;  4IL6 C;  3GLL A;  1WGX A;  4RB2 C;  2ME0 A;  1BIB A;  3A4C A;  3CF5 F;  4FET A;  3JRI A;  3K4L A;  1IW7 F;  2HKO A;  1LKX A;  1A35 A;  4Q47 A;  4UNO A;  2CV2 A;  4EQQ A;  3GYH X;  3IKT A;  4UHT A;  3KPH A;  3S1M J;  5EJC A;  2VC0 A;  4CA0 A;  5CVJ A;  2CU7 A;  3KIO A;  5FFX A;  4LMY A;  2KDO A;  3FWE A;  2BHY A;  1YHQ I;  3NWT A;  4C3H J;  2DO7 A;  5LEJ A;  5LEK A;  4XKC A;  4A6D A;  2WAF A;  2DDA A;  4G9Y A;  4HNV A;  1ZR2 A;  2R7U A;  2K9S A;  1OQY A;  3CJQ B;  3WU0 A;  3S15 J;  4BBR J;  3H9Q A;  2VE9 A;  5L3G A;  2BYV E;  2VQL A;  1EA3 A;  2DU9 A;  1BI0 A;  2EFQ A;  3HKZ A;  3FXJ A;  3HHH A;  2L4A A;  5H6R A;  3RKW A;  3EUH A;  1OR7 C;  2DA2 A;  3ELK A;  4ENN A;  3CD6 I;  3CJR B;  5K7Z A;  3HTS B;  1X1A A;  1JUP A;  3DCF A;  1FP2 A;  3C2G A;  2JSP A;  3W2V A;  4GFB A;  1O7F A;  1HST A;  2BW3 A;  4U0Y A;  1HA8 A;  3GZ5 A;  1X2M A;  1NTC A;  5FKK A;  1YJ9 I;  3H35 A;  5E20 A;  1HLV A;  3MAJ A;  4WCG A;  4MEY F;  3H36 A;  2WAE A;  1SFO J;  4UUV A;  2VUM J;  3L2U A;  2L9V A;  4EAT A;  1VI0 A;  4LK0 F;  3FHZ A;  2M4K A;  3IH3 A;  3ABT A;  2PFB A;  1XDS A;  2P4W A;  3T5X A;  2L7F P;  3G4S I;  3BJ6 A;  4XK4 A;  4WXD A;  4UUS B;  2K4B A;  5HS8 A;  2MLK A;  5LGT A;  3D1N I;  1X3Z B;  4AVZ A;  1ERD A;  3O8H A;  4B3A A;  1MBJ A;  5J1U A;  4YEJ A;  4FCY A;  1LEB A;  4F52 A;  2F6C A;  4U7B A;  4Y4R A;  3G2B A;  3BLY A;  4BHP A;  1JTX A;  2IP2 A;  3BZC A;  1DP7 P;  4HST A;  4MFD A;  2HYF A;  3ABM H;  4Z6Y A;  2XKO A;  3BC8 A;  2VJ4 A;  3JRF A;  1J0R A;  2HI3 A;  3LAJ A;  2W85 A;  4GXO A;  3G1L A;  1JUS A;  1WKM A;  3DBL B;  5BS6 A;  1WWX A;  5DUK A;  1HDP A;  1V5E A;  4A0Z A;  4BQN A;  5ED4 A;  3N4M A;  4KNY A;  4RM3 A;  5ICG A;  3N97 A;  1JJ6 C;  2KDZ A;  3DPL C;  4MIM A;  1V5F A;  1XSD A;  1RIO H;  3DFG A;  2L4M A;  1A04 A;  2QVO A;  3GVA A;  2JUC A;  1U5T A;  2XAS A;  2XAJ A;  2CUZ A;  4UVC A;  1Z67 A;  2GA1 A;  4XRF A;  2DA3 A;  2O3F A;  4I76 A;  1R9T J;  4R1H A;  1R1V A;  5CVU A;  4AVP A;  1RPW A;  3RQI A;  3JR9 A;  2B9S A;  3TDU C;  3CES A;  2QEN A;  1XN7 A;  5DCM B;  2I5U A;  5A2Q K;  1A31 A;  3TOA A;  2UXX A;  3QOD A;  5K7H A;  2DJN A;  1FBQ A;  2VXZ A;  4A5N A;  2CH0 A;  1UCR A;  2HQR A;  2ZME C;  4ABZ A;  4RB1 A;  2VBW A;  2KZG A;  3NAU A;  1RES A;  3FMR A;  3E6D A;  2CJJ A;  1VF9 A;  2X1E A;  3KZY A;  1JUM A;  2V1X A;  3V42 A;  2CQN A;  4HYE A;  4II2 A;  5F27 A;  1DU6 A;  3ABK H;  5D6E A;  4A69 C;  2R7Z J;  2WAD A;  4ZDP A;  3TMO A;  4CYD A;  1S72 I;  4UUS A;  2CYY A;  4V19 K;  5ICF A;  3A2K A;  1OYY A;  4XID A;  1EF4 A;  1IDZ A;  1T38 A;  4ZTF A;  2OZ6 A;  4ZYH A;  3F21 A;  1TWC J;  1GXP A;  4BU2 A;  3OYE A;  2VC1 A;  4OMY A;  3NWS A;  2QA4 I;  1T98 A;  1TTY A;  2ETH A;  4LFU A;  4RB0 A;  4ASN A;  4ESF A;  1HF0 A;  1V3F A;  2LYC A;  1FSH A;  3LSM A;  2XRN A;  2VT2 A;  3VYU B;  2STT A;  2NNN A;  4HX4 A;  5C3E J;  3MZH A;  3S2W A;  3KZI C;  2NXN B;  1YYV A;  2BGC A;  2OTL I;  2JSC A;  5LD2 C;  1MJ9 A;  2XAF A;  1S7O A;  1YX5 A;  3C2B A;  4A5M A;  2A05 A;  4Q5S F;  4PDK A;  5B3S H;  3DTE A;  3ZPL A;  2W4S A;  3K10 A;  5GAH J;  4E7J A;  4I7H A;  2FRH A;  4IPA A;  4ZH4 F;  1ZN2 A;  3G71 I;  2O61 A;  5JVT A;  4HLY A;  1I1G A;  3LFU A;  3P9K A;  3KYL A;  3W6V A;  1SVM A;  2IA0 A;  5E8I A;  1TWH J;  5B1B H;  5HNF A;  4ETS A;  5DCM A;  1YQA A;  4BY7 J;  1XCB A;  1A5J A;  1MSE C;  3OYJ A;  1VND A;  3MKW B;  4NQW B;  3I9V 2;  3OL4 A;  1OYI A;  1MKM A;  1X1B A;  2BY1 A;  1TWG J;  2AXL A;  2GOX B;  3OYL A;  4RDU A;  1QPI A;  4C2T A;  4XSX F;  4HSR A;  2VL8 A;  1AU7 A;  3QOE A;  5M5W J;  3VYS B;  5J40 A;  3M8F A;  2E34 A;  2XF7 A;  4HBL A;  4PGH A;  2CQX A;  5AON A;  1U3E M;  3I56 I;  2MH9 A;  4IEJ A;  3GTO J;  2PQ8 A;  3AG4 H;  1ZG5 A;  1WZ2 A;  1X1C A;  1LUJ B;  1GV5 A;  3DPT A;  1MMG A;  2FA5 A;  2DA5 A;  1Q1H A;  2GBY A;  2VJI A;  4WXC A;  4EV0 A;  3A01 B;  1Y6I A;  2QCO A;  1G4D A;  4R8H A;  1V5G A;  1GDT A;  1YW7 A;  1XGO A;  2VQG A;  4G12 A;  2LR8 A;  1YX3 A;  2JTV A;  4W1U A;  1VQL I;  2MC4 A;  3IKV A;  2X9D A;  3K7A J;  4S05 A;  3HYI A;  4ON0 A;  1FTT A;  2WV1 A;  3VOD A;  5LLQ A;  2IA2 A;  1J5Y A;  3RYP A;  2KLO A;  4LB6 B;  4YRV A;  3S2H J;  4L5J A;  1MNE A;  4OIQ F;  5HLH A;  1R5G A;  1QVU A;  3WU2 C;  1BI2 A;  4IHW A;  1G3Y A;  3K9T A;  4W97 A;  4XR6 A;  1MIJ A;  3IC7 A;  1UAA A;  1OCZ H;  3K4B A;  3LSG A;  1T39 A;  4M6X A;  2MD0 A;  1IRG A;  1TL8 A;  3D5R C;  3SHF A;  2Z5U A;  2L7M P;  3E6M A;  1UEL B;  2FEZ A;  3MZY A;  3WE2 A;  4NC8 A;  3CCU I;  2IT0 A;  5GAE J;  3ZMT A;  1OLT A;  1W4M A;  3L7W A;  4RAY A;  1STZ A;  1YIO A;  4PFP A;  5TJJ A;  5EG0 A;  3WTY C;  2PN6 A;  1ETY A;  2J5O A;  5JHU A;  2V9K A;  2PJP A;  3UR3 C;  2EZH A;  1XGS A;  4N4N B;  4MTE A;  4G7O F;  3OR2 C;  1ONV A;  5EGO B;  2WBM A;  1RET A;  1MNM C;  1KQ9 A;  4UB8 C;  2X1D A;  1X58 A;  2HPI A;  3I59 B;  2K9Q A;  2TRT A;  3FHN A;  3O2P E;  2CV1 A;  3NQO A;  2R0Q C;  3GLX A;  2EQR A;  4U88 A;  5FRO A;  2KL4 A;  3TED A;  4FE7 A;  2EBI A;  5LBQ A;  1UHS A;  1ETO A;  2K3P A;  1IGN A;  3ZQF A;  4C2U A;  1R22 A;  4HW0 A;  3L2R A;  2GQQ A;  1HSJ A;  3CMY A;  3LA2 A;  3U1K A;  1SVO A;  2R7Q A;  2GZW A;  1S8N A;  4AIK A;  2X48 A;  3KYC B;  3GFM A;  1SD5 A;  2BXZ A;  2HYJ A;  3A01 A;  4BXU A;  5JHF A;  2CGP A;  1JT6 A;  1ZQ3 P;  4C2M J;  4AID A;  2ISZ A;  1BI1 A;  2LBF A;  2MFZ A;  2LLK A;  5J8F A;  1IN5 A;  3VWB A;  3WTV C;  1PJR A;  3KEQ A;  2KIU A;  2AS5 F;  4L9T A;  1X19 A;  3K1M A;  2P6S A;  5K5Q A;  4RAF A;  3LQR A;  2V79 A;  1T0F A;  4BYY A;  1JI8 A;  2IGK A;  2NS0 A;  3SXY A;  1AKH A;  2EFN A;  2G0E A;  1WRJ A;  4GDF A;  1VQ4 I;  3HOU J;  3DBR B;  5M3F J;  1IC8 A;  1ETK A;  3O8G A;  4CUG A;  4FQG A;  4KMF A;  1TT0 A;  1WH7 A;  3WOD F;  1UB9 A;  2WV0 A;  2G7U A;  1H89 C;  2OUM A;  2HZD A;  4E4H A;  1UFM A;  1G3S A;  4RBO A;  4NHJ A;  1EH8 A;  2F5D A;  1DP3 A;  5FRM A;  3WG7 H;  3KCC A;  3WHB A;  2XPW A;  2MC3 A;  3KP7 A;  4YII A;  3PJR A;  1DDN A;  4XLF A;  2ZC2 A;  3QYF A;  4LOC A;  3GTM J;  4C30 A;  3CC4 I;  3CUQ C;  3S2D J;  1ON1 A;  2IW5 A;  4MO7 A;  1X4P A;  2VLA A;  5EGO A;  3EPZ A;  4A12 A;  4A3J J;  3OYK A;  2GA2 A;  2EIM H;  1HXD A;  4EEF G;  1FLI A;  3I59 A;  2CUF A;  2CW7 A;  2MGQ A;  3KZZ A;  3V7R A;  1B4A A;  2V4J C;  2QZ8 A;  4LK1 F;  1YTY A;  4M3F A;  2M2E A;  2E7W A;  4F55 A;  2QGU A;  1U2W A;  1J2X A;  4KIB A;  1IRZ A;  2E5N A;  5E17 F;  3TDZ C;  1Z6T A;  1YW9 A;  3DLA A;  2DOA A;  2PMZ N;  2DFI A;  4HX8 A;  3KFW X;  1R4M B;  4Z2Y A;  2DMN A;  3CLO A;  4FX0 A;  2R7D A;  2A61 A;  2LF8 A;  4D7N A;  3BG7 A;  3KYD B;  2L54 A;  3H9J A;  3TKY A;  1TLH B;  1TW3 A;  3OWT A;  1JE8 A;  2PBI A;  2W1O A;  2HNH A;  4Y3O A;  3LQQ A;  1RKW A;  5LFA A;  4B4C A;  2Y2Z A;  3SZP A;  1KYZ A;  1ZAO A;  3HOX J;  1APL C;  2DMQ A;  1YG2 A;  2OV7 A;  1OPC A;  5DUI A;  4E7K A;  1IN7 A;  1R23 A;  3GF2 A;  4XLE A;  5IY5 H;  3GFL A;  3M7G A;  4WXH A;  3VDX A;  2EFO A;  2PJR B;  2BVM A;  2ZSI B;  3WG9 A;  4YFN F;  1D8J A;  2JRT A;  1ITY A;  1K78 A;  4AYB N;  3HRU A;  1HQC A;  3K4N A;  2DBB A;  4XRS G;  2IXS A;  1B8I A;  2ESH A;  1IRX A;  2VB6 A;  2HGC A;  3CDI A;  1REP C;  4KIT B;  3F72 A;  3BPX A;  3PQJ A;  3DV8 A;  5DTD A;  3JRG A;  3WTZ A;  3FXM A;  1HCR A;  1G3T A;  3Q0U A;  2O9L A;  4IX7 A;  1I6X A;  1MZB A;  2DFF A;  4BBS J;  2O0Y A;  4I0B A;  4ESJ A;  1SFU A;  2PI0 A;  3CUO A;  4CCM A;  1GVJ A;  1K7A A;  1U0J A;  3GW2 A;  4II3 A;  3BT9 A;  2ZKZ A;  1R49 A;  4RM2 A;  4XNF A;  2P0W A;  5H2F C;  1MBG A;  2NOG A;  4AIH A;  4LLL A;  5J3L A;  9ANT A;  5E3L A;  3AL0 C;  1KQ8 A;  2EZI A;  2ZJQ F;  1OCT C;  1BN5 A;  1S5L C;  5EF6 A;  3PSI A;  4D5F A;  5J1Y A;  4JQF A;  3S14 J;  1SFX A;  4HDU A;  2FQ4 A;  3CO6 C;  3QPT A;  3BR5 A;  1RUN A;  3H1C A;  1ZH5 A;  5IP6 A;  2H09 A;  4IRH A;  3LA7 A;  3FKJ A;  2NVX J;  2LKX A;  1IRF A;  3HUG B;  3S93 A;  3M07 A;  1KYW A;  2GWR A;  3OIQ A;  4X0G A;  1EV7 A;  2HVS A;  4BKX A;  4PSW A;  1FYL A;  5D4R A;  4BS9 A;  1BJA A;  2DJI A;  1MBH A;  2O8K A;  2E19 A;  2DK8 A;  1X3W B;  4BGD A;  2HOA A;  5L3F A;  4IO9 F;  5GPC A;  3CCS I;  2G9W A;  2XF5 A;  1ON2 A;  1XGN A;  1O4X A;  4A2U A;  2F5V A;  3RIR A;  3ZMS A;  2D1V A;  2PJR A;  1TC3 C;  2ZXJ A;  2AXT C;  2F5E A;  5K5R A;  1SAU A;  3JAM Z;  5DDG A;  3DPU A;  3F8N A;  3GEZ A;  1SMY F;  3MCZ A;  1IJW C;  2IS4 A;  3AG3 H;  2J5P A;  2HVR A;  1YJN I;  4JBA A;  4ZC3 A;  1H9T A;  1KU3 A;  4EJU A;  2X6Y A;  3ERE D;  4IHV A;  1VQK I;  3DU5 A;  2HXO A;  1VQ7 I;  3JTH A;  3BP8 A;  1B72 B;  4IF4 A;  3HIF A;  3K0L A;  1CQT A;  4OMZ A;  2ID6 A;  2FXA A;  2K86 A;  3BR2 A;  1O3S A;  6PAX A;  4Y52 J;  3VPR A;  4XON A;  5HS9 A;  4IHT A;  1BI3 A;  3MVP A;  1IZ1 A;  3U1D A;  4BHC A;  3U21 A;  4D5C A;  2V9P A;  4DYQ A;  4XRM A;  2Y9Z A;  2BY2 A;  3C18 A;  1D5V A;  1LNW A;  4Y15 A;  4CO8 A;  3AKZ A;  2VKE A;  1AOY A;  4E7I A;  2LSO A;  2ZNY A;  2LK2 A;  3IWF A;  3TP3 A;  3OYC A;  1TQP A;  5IT9 Z;  5M5X J;  2HDD A;  5F1J A;  2VJJ A;  4CH7 A;  3OSF A;  2DPU A;  1D0Z A;  3E5Q A;  4IQ4 A;  5CJ9 A;  1DUX C;  4ZDO A;  5E3M A;  1XS9 A;  3HOY J;  3S3M A;  2EK5 A;  1FBS A;  4KIC A;  5IOZ A;  1Y0U A;  3D0S A;  3HPG A;  2K9L A;  3W6K B;  3EYI A;  3EDP A;  3G6E I;  4MEX F;  3GBG A;  2K9M A;  1X3U A;  2ZJ2 A;  2DMU A;  2LFB A;  3HUG A;  4NUB A;  3KP4 A;  3S32 A;  1VQO I;  1KZH A;  2EZL A;  5JVG F;  1GLN A;  3VEP A;  5BMZ A;  3X2Q H;  4ZYD A;  4D9J A;  2B63 J;  1MW7 A;  3M1E A;  4IRI A;  3OL3 A;  1NG7 A;  1F43 A;  1FOY A;  1IAW A;  1G6N A;  4XQF A;  2NS8 A;  4GGG A;  4PJJ A;  4KT6 A;  3SDG A;  1FYM A;  1DGW Y;  2XIG A;  3DBH B;  1MJB A;  4JOM A;  2OJE D;  3HJE A;  4BE1 A;  1UG0 A;  4L0Z B;  3V8J A;  3GTK J;  1Z05 A;  3GZN B;  2H1L A;  4PK4 A;  5CYV A;  4NC7 A;  4Y17 A;  2Z9O A;  3BG3 A;  2D1H A;  2WWY A;  4RAG A;  3EUH C;  3N05 A;  3HBL A;  1QZZ A;  1FEX A;  2QSF X;  2QQA A;  1WVR A;  4XOR A;  1MMN A;  5LGU A;  2E5Z A;  4KIS A;  1DPU A;  1KU9 A;  1WI3 A;  3OIP A;  1N77 A;  1D3Y A;  3HSE A;  3JRH A;  2MLG A;  4JX4 A;  4M71 A;  1QPM A;  4S04 A;  1LPQ A;  2P5V A;  2GXA A;  1ACI A;  3AAF A;  3MQ0 A;  4I01 A;  1FYK A;  2FML A;  2RDP A;  3CO7 C;  2CQQ A;  4M9S A;  1Y8R B;  4H0E A;  2V9V A;  1WJC A;  3FIS A;  2R7W A;  1PVE A;  3OYI A;  1T56 A;  3TO6 A;  4BEH B;  3CQZ J;  1R1U A;  1FOW A;  3T1B A;  3S1N J;  2UWM A;  1FX7 A;  4GYI A;  4CXF A;  3W2W A;  3GX4 X;  2NVQ J;  1B1B A;  4HNT A;  3Q0V A;  3ABL H;  2VAS A;  3RI4 A;  2ZME B;  4M73 A;  2OCE A;  1SAX A;  3WTU C;  3QRF F;  4EJV A;  4NDL A;  1FTZ A;  2R7F A;  2JN6 A;  4WWC A;  3BR6 A;  2AO9 A;  4OIR F;  1S7E A;  2LY2 A;  1R4N B;  4PJM A;  1W5S A;  1I3Q J;  3H92 A;  2LOO A;  2WTE A;  2JZY A;  5D5U B;  1TNS A;  1ZRC A;  4PZJ A;  4F91 B;  2G7H A;  4G6D A;  1H9G A;  2ZJP F;  1Z7L A;  2Y31 A;  2YSR A;  3P9C A;  3T0Y A;  3JW4 A;  1X1D A;  4DW6 A;  2YX4 A;  4EJW A;  3E7L A;  4HG2 A;  3SQN A;  1ZK8 A;  2ELJ A;  4BDY A;  2HEO A;  2FU4 A;  3ABU A;  1KU2 A;  3RJP A;  3FXO A;  4PCQ A;  5D6F A;  1U5T C;  3IAS 2;  5HDG A;  3W6J B;  2GLO A;  1E17 A;  3QPL A;  2DOF A;  4MNU A;  3BPV A;  1I6H J;  1X1P A;  2DCE A;  3WE3 A;  2F4O B;  1ZG3 A;  3ZQG A;  4FT8 A;  3SYT A;  4WF2 A;  5IYB J;  1G2H A;  3CCJ I;  1QU3 A;  5GPA A;  4S0H B;  4KN4 X;  4IHY A;  2Y30 A;  3GTQ J;  1B59 A;  2L2O A;  5B66 C;  3HGG A;  5LHI A;  4ESB A;  3DU6 A;  2V1D A;  2IA1 A;  2LKP A;  1RR7 A;  3E0J B;  3UNG C;  3WU1 B;  2WY7 Q;  4CZZ A;  1X4O A;  2NYX A;  3FK7 A;  4A3F J;  3H3U A;  3SFI A;  4M3E A;  4XMY A;  4BEH A;  2R7S A;  4HEA 2;  3FXR A;  1QBJ A;  3DEE A;  2XAQ A;  1BL0 A;  2GIZ A;  1DQU A;  3HOZ J;  3L9F A;  3KEY A;  4KYW A;  4GRI A;  3CZ6 A;  3ZQQ A;  2HOS A;  4MLO A;  4I2O A;  2ZME A;  2KFD A;  3A03 A;  4XBF A;  3OS2 A;  2OQG A;  1MBF A;  1U9N A;  2VOO A;  4AU7 A;  2H6B A;  2XC7 A;  5KHD A;  3IH2 A;  1YJW I;  3LL7 A;  4PJL A;  1CF7 B;  4XKW A;  3LA3 A;  3ZP5 A;  3OMY A;  4IZZ A;  3M9A A;  5DD4 A;  2RGV A;  1MD0 A;  4A3E J;  2ME6 A;  2O8X A;  4KDP A;  5C4X J;  4M3D A;  1EH6 A;  3PNV A;  2L01 A;  4M74 A;  3L1P A;  3OYG A;  1RZ4 A;  2NVT J;  3LST A;  3M8J A;  3TGN A;  5IYD J;  4OIP F;  2K27 A;  3QOP A;  1ETV A;  2KP6 A;  5E79 C;  1O3R A;  2VKD A;  2H1K A;  1CGP A;  3H5A A;  2DLL A;  1YS7 A;  2KQR A;  2WB1 N;  2EIJ H;  2RVC A;  4BUP A;  3TQN A;  1TZL A;  4GYG A;  3OOP A;  2CS3 A;  2COM A;  2M7A A;  1QNT A;  4FE4 A;  2ICW G;  4C3I J;  1OCC H;  3PUF A;  4OAY A;  4E70 A;  4HDV A;  4J01 A;  3LMM A;  3BJA A;  3CCV I;  3DKY A;  2OU2 A;  4Y13 A;  2M1B A;  4EJO A;  2JQ7 A;  2KRF A;  3ZN0 A;  2QKL B;  4DJA A;  3J7A O;  3DTI A;  1EKE A;  2DMT A;  1SD6 A;  3I54 A;  3DTK A;  2A5W A;  4RB3 C;  1O3T A;  4DGW B;  3M8E A;  3I3L A;  2R7X A;  2P5K A;  4FAS D;  3K4M A;  2W82 A;  3CJT B;  3V7S A;  5FB2 A;  3JTG A;  4O3M A;  1AA7 A;  3G1M A;  5BPI A;  1AHD P;  3I4P A;  3S16 J;  3M1C A;  2W7N A;  1ZLJ A;  3FM5 A;  1WJF A;  2P7C B;  2D45 A;  3BDD A;  4BAC A;  5HDK A;  4A0Y A;  4I98 B;  5ILU A;  1L0O C;  4AWX B;  4NB5 A;  2HYG D;  1RI7 A;  2BVL A;  2L9R A;  2WB1 A;  3QPS A;  1LEA A;  2VXD A;  2I8D A;  1A36 A;  3GTJ J;  5FRN A;  2V1N A;  1BW5 A;  1GV2 A;  3SEZ A;  3BR3 A;  1W0T A;  2CUE A;  1ETQ A;  1POG A;  5ILV A;  1K6O A;  4XSZ F;  1SAN A;  4HX7 A;  1CF7 A;  2HS5 A;  5L3D A;  1TBX A;  3W2A A;  4G7H F;  3MN2 A;  3PO2 J;  5HVQ C;  4LG0 B;  2A69 F;  4BXF A;  1LQ1 A;  1JKO C;  4KUM A;  1VQ5 I;  4AIJ A;  3TL4 X;  1ZKG A;  3IHU A;  2DYS H;  5HOD A;  4O6J A;  2VPL A;  1MND A;  1XSV A;  1JKP C;  2M4G A;  3B6C A;  4V2G A;  3D5L A;  2M7B A;  4QIW N;  4RGU A;  2MG4 A;  3REO A;  2IJL A;  3ZMD A;  2H8W A;  1TQM A;  3JAM K;  2BOL A;  5LRR A;  2KRH A;  3AG2 H;  3J80 Z;  2IS6 A;  1U9O A;  4A3D J;  2JVG A;  1R00 A;  4Q48 A;  4PJN A;  2LRD A;  2VBZ A;  3FZV A;  3EQL F;  3HRT A;  4TV7 A;  3SEQ A;  4DQ2 A;  4XRS A;  3FXK A;  3JRA A;  3CCL I;  3M4O J;  4ZDL A;  1JXS A;  2RNG A;  4HPQ A;  3F8B A;  2W25 A;  1O3Q A;  2NOJ B;  3DLL F;  1BBY A;  4XKV A;  3RKX A;  2QSG X;  2Q2E B;  2V7F A;  3OYA A;  4HF2 A;  2KJB A;  2VKV A;  4FX4 A;  3H9G A;  3Q3S A;  2Z1D A;  1OJL A;  4ZZL A;  1NHA A;  3UKG A;  4G6T B;  2KRC A;  3ESW B;  4NQW A;  1HDD C;  1PYV A;  2HFH A;  2YUS A;  2R93 J;  1UHW A;  2X0L A;  1QZY A;  4AM3 A;  3CMM A;  5DV5 A;  3R0A A;  3GXO A;  1DGR M;  3HGY A;  4OIO F;  3BZ6 A;  5IT9 K;  3SFZ A;  2M3A A;  3F8F A;  1LFP A;  1N25 A;  1WJD A;  1BR1 A;  1TW2 A;  3EET A;  2FX0 A;  2IBD A;  2HTJ A;  3CUQ B;  2Q8K A;  1T2K A;  4V2F A;  2KIS A;  1Y1V J;  2A3S A;  2DFH A;  1FMW A;  4AC0 A;  1VTN C;  3LOC A;  3R61 A;  1FY7 A;  3OYH A;  2DQL A;  2E35 A;  5ICC A;  1V4R A;  5HS7 A;  1IXC A;  3HZJ A;  2EB7 A;  5KAI C;  4BQO A;  2LY9 A;  2WC2 A;  3L2W A;  2DN0 A;  3HTU A;  5EZH A;  2L3D A;  5H20 A;  1BIA A;  4BAY A;  1MMA A;  5J4V A;  4L5E A;  1IO2 A;  1LJ9 A;  2F2E A;  2UUZ A;  1U78 A;  5ILS A;  4IOC F;  1Y0N A;  3NEU A;  4LG0 A;  3DKW A;  4LIU A;  5F1R A;  3JRB A;  4I02 A;  2UXN A;  3H3V K;  3D5S C;  1T08 B;  4R79 A;  3WTX C;  2CRG A;  1OMI A;  1EJ9 A;  1C0W A;  2A68 F;  2CG4 A;  2LDU A;  3P9I A;  2ZB9 A;  3LSK A;  3IH4 A;  1P4X A;  1YIJ I;  2DT6 A;  1FWZ A;  1ZRF A;  3K2Z A;  2LMD A;  2H27 A;  2OC6 A;  1BA5 A;  4L5I A;  3MEX A;  3LFK A;  3LSH A;  3FMQ A;  4C3J J;  2QEX I;  1S7A A;  1I27 A;  1S3J A;  4KIG A;  3KLO A;  4BNC A;  3GTP J;  4B43 A;  2Z2S B;  3JSO A;  2KIF A;  2E71 A;  2OZU A;  4UY8 I;  1WH5 A;  2M45 A;  2Q2E A;  4JX6 A;  2DPD A;  5D4S A;  1G8X A;  2X85 A;  1SVL A;  4IRG A;  5CVI A;  1P7I A;  5JLW A;  5J4Y A;  5DM7 F;  2O03 A;  2EJR A;  1I5Z A;  2H94 A;  2Y0M A;  3H5N A;  5IP9 J;  2NRA C;  3OY9 A;  4RGR A;  3TBI A;  4ZTJ A;  4ZJZ A;  5C4J J;  3C3W A;  4LJZ F;  2BBY A;  1WJA A;  1GXQ A;  2VBY A;  1QQI A;  2DYR H;  2XV4 S;  4NNJ A;  3CCR I;  1USS A;  5EYR A;  4N9H A;  3LSJ A;  3PSF A;  3CUQ A;  2XAH A;  3BTJ A;  2EIN H;  2PMU A;  2QF7 A;  2OAZ A;  1T8I A;  4OAZ A;  4IHS A;  2HQ5 A;  5FKN A;  2XSJ C;  4YIR X;  3HB9 A;  5FKL A;  3JRE A;  3AFH A;  3QPH A;  4IJA A;  2M0C A;  2ZFU A;  3ZMV A;  1VFC A;  3AL0 B;  1D0Y A;  3GME A;  2DT7 B;  1QHH D;  3RZD J;  4QLC U;  1S6L A;  3VFZ A;  4CDG A;  3E5U A;  2X4H A;  4XKB A;  5KK1 A;  2M8G X;  4YEL A;  3FXU A;  3O3K A;  4CCN A;  1A6I A;  1WCM J;  4RGS A;  4L0Y B;  5B1A H;  3CDH A;  2A6T A;  4A3C J;  3ZQI A;  2K02 A;  2QSH X;  2HZT A;  2M87 A;  3V4G A;  4ANJ A;  3S1R J;  4GCV A;  4JYK A;  3MD2 A;  4CZC A;  5EZG A;  1AWC A;  2FNP A;  1R7J A;  2YU3 A;  4P96 A;  3RSN A;  1YO5 C;  3GWZ A;  5BPD A;  5F08 A;  5ERI A;  2K5C A;  3E5X A;  2GM4 A;  1W36 C;  1XMK A;  2CFO A;  3SJM A;  5CKT A;  4L9V A;  3B6A A;  2HDC A;  2R92 J;  1U6G A;  3C7J A;  3FX3 A;  1EH7 A;  2GOM A;  2C6Y A;  2L5Q A;  2XPV A;  1S29 A;  1IXR C;  2PMZ A;  4HZF A;  2F5C A;  3VB2 A;  1Y56 A;  1V54 H;  1XPX A;  3LSI A;  4ENK A;  1ZG1 A;  1IXS B;  1LVK A;  1OCO H;  1SFE A;  1LVA A;  4C9Y A;  1BJZ A;  3FM3 A;  4P1W A;  3J81 K;  2E1M C;  3RDI A;  3QU3 A;  4ENM A;  3S3O A;  1K4T A;  4XOT A;  3H5R A;  1U8R A;  2EH3 A;  1FOX A;  4HF0 A;  3WTT C;  5LGN A;  3O6B B;  2WY8 Q;  3BJO A;  1IUY A;  2LNB A;  1YE9 A;  3FMS A;  3FBN B;  1I50 J;  3MKZ A;  1J75 A;  1KA8 A;  1FJL A;  2GAU A;  5GAG J;  4RLQ A;  4AYB A;  3IRR A;  5GTI C;  4LB5 A;  3T8R A;  3LNQ A;  2VJ5 A;  2JVH A;  4QPQ A;  1WQ2 A;  3I4N J;  1W1W E;  3FK6 A;  4LD5 A;  1BOB A;  3ZN1 A;  1QA6 A;  1ZGJ A;  2FBI A;  2WAQ N;  2EFW A;  4DBR A;  4P55 A;  4EGY A;  1HOM A;  4YFK F;  2V6C A;  2Y69 H;  3BOQ A;  2JA5 J;  2QBY B;  3F6O A;  2R5Y B;  4PFO A;  2FF4 A;  1K4S A;  1R1T A;  1HC8 A;  1XSX A;  2ZXW H;  3F3X A;  1ZGW A;  4BL0 B;  1BOA A;  1ZEL A;  3QP6 A;  1YI2 I;  1FPQ A;  4IHX A;  4I6Z A;  3FF5 A;  5IOY A;  2QWW A;  1F5T A;  2Q0O A;  3KEO A;  5FLX Z;  1BR2 A;  2LG4 A;  3OYM A;  1R58 A;  1OCR H;  3IUO A;  2VIX A;  3CMA I;  5FD5 A;  5F0H A;  5BNG A;  4B48 A;  3DF8 A;  1ORK A;  3GO5 A;  2L9N A;  4CIC A;  3CCM I;  2IAI A;  3RKQ A;  2MSY A;  3OV8 A;  3K70 C;  3CP8 A;  4EVI A;  3KP3 A;  1ZYR F;  4X1E A;  5AIP A;  5E1Z B;  3RQ4 A;  2XAG A;  2TDX A;  1ZRD A;  1WPK A;  3G73 A;  4I09 A;  4RA2 A;  5KCM A;  2KIQ A;  2ELK A;  3L09 A;  2QUF A;  2WAQ A;  2ECB A;  4OIN F;  1GUU A;  1K83 J;  2VE8 A;  3SZT A;  2CQK A;  4UVA A;  1Y1W J;  3MMY B;  3ECO A;  3VSL A;  3I55 I;  1VQ6 I;  4A93 J;  2X6O A;  5F0C A;  2BXY A;  2F4I A;  2M8E A;  2XKP A;  3GCM A;  2K85 A;  3ROU A;  2XSD C;  2R7R A;  3J7Y J;  1SMT A;  5KNL A;  4BXX J;  1PUE E;  5GP9 A;  4BE2 A;  2IS2 A;  3DQV C;  4DBQ A;  2PX9 A;  2JA2 A;  2XVC A;  2VOD A;  1WI9 A;  2CW8 A;  2OF7 A;  2VPR A;  5DCF A;  2BY3 A;  1RKT A;  2LC2 A;  2E60 A;  4L9N A;  4QSH A;  2MAB A;  4EM2 A;  1D1C A;  4K2E A;  2ECC A;  2L7Z A;  2LY1 A;  2TCT A;  4BJT A;  2NNY A;  4UXN A;  5JFR A;  3OSG A;  4E7Z A;  2CQ7 A;  4A3M J;  1VQN I;  3PIO F;  2QBY A;  3HKZ N;  2R5Y A;  3OYF A;  1QO0 D;  2DA1 A;  3HL2 A;  3B02 A;  3L2C A;  1B9N A;  3MKL A;  2KIM A;  4XM3 A;  2XB0 X;  3ERM A;  2ZBK A;  3AG1 H;  3R4K A;  2Z33 A;  2CSO A;  3GFJ A;  3CC7 I;  3G1O A;  2DT5 A;  3J80 K;  4UUT A;  1FOK A;  2HOT A;  1FC3 A;  1PP8 F;  3A1Y A;  1R36 A;  2FUG 2;  2XB5 A;  3C2H A;  1HW1 A;  4B47 A;  2QQB A;  3PO3 J;  4XLA A;  1BM9 A;  3MKY B;  2HVQ A;  1XB4 A;  3CLQ A;  3COA C;  1IV8 A;  2IVM A;  4U0W A;  2FBK A;  3SZG A;  4PGG A;  1U5T B;  2ID3 A;  4G6Q A;  1B72 A;  1T33 A;  2EV5 A;  3BR0 A;  3H0G J;  3QU6 A;  1Z3X A;  2QM3 A;  2R4G A;  3U9G A;  2P5L C;  1T95 A;  2HR3 A;  1TP4 A;  4LG3 A;  1V55 H;  1IN4 A;  2JMW A;  3RPU D;  1D1B A;  2EIK H;  1OR7 A;  3BRO A;  4BQQ A;  3ZQ7 A;  5HDN A;  1XDU A;  1JGG A;  3FXL A;  4PSX A;  4A3G J;  2Y48 A;  2NVU B;  2EPF A;  2KJC A;  2P7V B;  5EEA A;  3WGI A;  2E1N A;  2FNA A;  2FD5 A;  3PNT A;  5TGT A;  1Y39 A;  2H8R A;  4NC6 A;  2E1C A;  1R71 A;  4A3K J;  4B1R A;  1HW5 A;  2NVY J;  5K5O A;  5J1R A;  2OA4 A;  3BTI A;  4MQ9 F;  2L02 A;  1LDK B;  3BQZ A;  1JKQ C;  3GTL J;  3HG9 A;  4P9U A;  2W00 A;  5HLG A;  2B7E A;  2BEO A;  2VQH A;  4A6E A;  5ICE A;  4BJ5 C;  4XN0 A;  2ACJ A;  3PUB A;  2D2W A;  1HBX G;  4I0A A;  1N78 A;  1GHC A;  3CJN A;  2XGD A;  2AHQ A;  4OWR B;  5FFZ A;  3TOB A;  2JA8 J;  1FT9 A;  1ZRE A;  5E1W A;  4E7H A;  3TO7 A;  4AD9 A;  1ZLK A;  1R6R A;  1B6A A;  3VYT B;  1QRY A;  1G3W A;  2XGE A;  5FKM A;  3FKI J;  5FJ8 J;  3PFI A;  3ZMZ A;  2BY0 A;  3I64 A;  1T6S A;  4A3I J;  4EM0 B;  1G59 A;  5EEH A;  2GXG A;  1RUO A;  1HKT A;  1M1E B;  3ZQL A;  5CVV A;  4ZYA A;  2XRO A;  4JK1 X;  3DKX A;  3CME I;  3I71 A;  3TW7 A;  2FJ1 A;  5HLI A;  2OD5 A;  3K69 A;  2EV0 A;  3TO9 A;  2IEK A;  3QWL A;  1WJB A;  3ASN H;  3CCY A;  3HSF A;  3WGH A;  3FBI B;  2L9S A;  2E2I J;  1LFB A;  1TWF J;  5E18 F;  3JSP A;  1UHM A;  1F4K A;  3ZMU A;  5J8C A;  1P7J A;  1Z9C A;  5GAD J;  2CV0 A;  2CMP A; 
#chains in the Genus database with same CATH homology
 1MND A;  3DLA A;  3S8P A;  2DOA A;  1MMD A;  2M4G A;  3D5L A;  2M7B A;  2ZXH A;  4RMN A;  4CCO A;  4J00 A;  1SFK A;  2LRE A;  4HNU A;  3BG7 A;  2BOL A;  2KRH A;  3H9J A;  2IS6 A;  4XOP A;  3W3C A;  2JVG A;  3OWT A;  4LIV A;  4PJN A;  3SEQ A;  2LRD A;  2W1O A;  4IKF A;  2HNH A;  3QYE A;  2X51 A;  4BDZ A;  3J7A Y;  4ZDL A;  2RNG A;  4HPQ A;  4Y3O A;  5LFA A;  2NOJ B;  3ZRG A;  4XKV A;  4KJZ A;  2Q2E B;  2V7F A;  2OV7 A;  3OYA A;  3EUA A;  4E7K A;  1N75 A;  4XLE A;  3A4C A;  3VDX A;  2VQC A;  4FET A;  2PJR B;  2BVM A;  2ZSI B;  3H9G A;  2Z1D A;  3K4L A;  1LKX A;  2JUG A;  4G6T B;  4IQJ A;  2KRC A;  2CV2 A;  1PYV A;  2KMU A;  3K4N A;  3CMM A;  2IXS A;  1DGR M;  2AQE A;  4CA0 A;  1IRX A;  2VB6 A;  2M3A A;  2RRE A;  2KDO A;  1LFP A;  1WJD A;  4KIT B;  1BR1 A;  1Z21 A;  2M0M A;  3K4K A;  3NWT A;  3S3N A;  4XKC A;  2X1C A;  4Y33 A;  2WAF A;  4IX7 A;  1FMW A;  3HC7 A;  2R7U A;  3CJQ B;  3OYH A;  4BE0 A;  3H9Q A;  3RCO A;  4BQO A;  4CCM A;  2VQL A;  1EA3 A;  1U0J A;  3L2W A;  4II3 A;  3HKZ A;  4RM2 A;  4XNF A;  2P0W A;  1MMA A;  1OR7 C;  3OS0 A;  1KON A;  1P9Q C;  2UUZ A;  3AL0 C;  3CJR B;  3K6G A;  1X1A A;  4LIU A;  3C2G A;  2JSP A;  3W2V A;  3D5S C;  2BW3 A;  3PSI A;  4R79 A;  2R7O A;  1HA8 A;  4PUS A;  4JQF A;  3H35 A;  2DXI A;  3PNY A;  3LSK A;  2WAE A;  1E0E A;  3L2U A;  2DT6 A;  4EAT A;  3OYD A;  3FKJ A;  3K4J A;  3K4C A;  3HOS A;  2OC6 A;  3HUG B;  3S93 A;  2M4K A;  3OIQ A;  4X0G A;  2HVS A;  3LSH A;  4PSW A;  2XF6 A;  4BS9 A;  3BCA A;  2DJI A;  4AVZ A;  4B43 A;  2Z2S B;  1ERD A;  4BGD A;  2XF5 A;  3OYN A;  4YEJ A;  2X6X A;  4F52 A;  1G8X A;  2F5V A;  2F6C A;  2X85 A;  4U7B A;  4Y4R A;  2IGN A;  3CP2 A;  2PJR A;  3G2B A;  3BLY A;  4D1Q A;  2QKM B;  4HST A;  1D0X A;  1SAU A;  2WA0 A;  4XL9 A;  3BC8 A;  3DPU A;  2VJ4 A;  3VSK A;  3H5N A;  3OY9 A;  2IS4 A;  3TBI A;  2HVR A;  4ZTJ A;  4ZJZ A;  4ZC3 A;  4XN3 A;  2X6Y A;  1WJA A;  2X6W A;  3DU5 A;  1V5E A;  1D1A A;  5CPR B;  4NNJ A;  4BQN A;  1BR4 A;  1S9H A;  4RM3 A;  3PSF A;  5HLT A;  3DPL C;  4XON A;  1V5F A;  4OAZ A;  3U21 A;  3IP4 B;  2XSJ C;  2VKH A;  3AFH A;  3AL0 B;  2CUZ A;  2ZFU A;  3BG6 A;  1D0Y A;  2LBF B;  3AKZ A;  2DT7 B;  4E7I A;  2Q1Z B;  1QHH D;  4F92 B;  4XKB A;  3FDY A;  3OYC A;  3CES A;  4YEL A;  2VJJ A;  4CCN A;  4CH7 A;  4E6K G;  1D0Z A;  4IQ4 A;  4ZDO A;  3QOD A;  2A6T A;  2VXZ A;  4ANJ A;  3S3M A;  2CH0 A;  3MD2 A;  4CZC A;  3DWL E;  3HPG A;  2K9L A;  3RSN A;  4BJ6 C;  2RQQ A;  2K5C A;  3GBG A;  3L2Q A;  2KZV A;  2X1E A;  4LIT A;  2CFO A;  2XAU A;  2K9M A;  1W36 C;  5CKT A;  3V42 A;  2IGO A;  4II2 A;  4NUB A;  3S32 A;  2WAD A;  4ZDP A;  1GLN A;  2GOM A;  3KX2 A;  3TMO A;  4E7S A;  2L5Q A;  1W36 D;  2PMZ A;  4D9J A;  1MW7 A;  1Y56 A;  3OL3 A;  1NG7 A;  4F93 B;  3LSI A;  2V6E A;  3VYR B;  3A2K A;  1LVK A;  4XQF A;  3HPH A;  4ZTF A;  4PJJ A;  4C9Y A;  4KT6 A;  1DGW Y;  3ZR8 X;  4BU2 A;  4JOM A;  4P1W A;  3OYE A;  2E1M C;  4BE1 A;  1UG0 A;  3NWS A;  3S3O A;  4XOT A;  3H5R A;  1WJ5 A;  4PK4 A;  4XLC A;  2HQA A;  4NC7 A;  2LYC A;  2WY8 Q;  3LSM A;  3VYU B;  2KHM A;  3EUH C;  1YE9 A;  3BCB A;  3N05 A;  3FBN B;  3MKZ A;  4XOR A;  1MMN A;  5LD2 C;  2E5Z A;  4KIS A;  3OIP A;  1N77 A;  1YX5 A;  4RLQ A;  4AYB A;  4B3X A;  1T0F C;  2VJ5 A;  2JVH A;  3DTE A;  4QPQ A;  1WJC A;  1BOB A;  2W4S A;  3K10 A;  2R7W A;  4E7J A;  3OYI A;  3PFY A;  4BEH B;  4CCJ A;  4DBR A;  4P5O A;  3LFU A;  2UWM A;  4H4K C;  3KYL A;  3W2W A;  4PFO A;  4F3Q A;  4HNT A;  3ONQ A;  2VAS A;  4N4O B;  5HNF A;  3HOT A;  1Z3Y A;  4BL0 B;  3OYJ A;  1ZEL A;  2Y0S A;  3E1S A;  3MKW B;  3L2V A;  4NQW B;  3I9V 2;  3ZCO A;  3OL4 A;  1BR2 A;  2LG4 A;  3OYM A;  2HU9 A;  3IUO A;  2LY2 A;  2VIX A;  4PJM A;  4B48 A;  1X1B A;  2GOX B;  2LOO A;  2L9N A;  1QHG A;  3OYL A;  4C2T A;  4HSR A;  2VL8 A;  4F91 B;  2UV1 A;  3K70 C;  3QOE A;  4B44 A;  3CP8 A;  3VYS B;  3RQ4 A;  2XF7 A;  4DIQ A;  1Z7L A;  5KCM A;  2Z16 A;  2E1M B;  1X1C A;  1X1D A;  2WAQ A;  3DPT A;  3K70 D;  1MMG A;  4HG2 A;  2ELJ A;  2VJI A;  1Y6I A;  4BDY A;  2KPM A;  1V5G A;  3IAS 2;  2XDV A;  2VQG A;  3MMY B;  1YX3 A;  3VSL A;  1FMV A;  2MC4 A;  2F4I A;  2DCE A;  3RTR A;  3SYT A;  2R7R A;  3HXL A;  5KNL A;  2KLO A;  2L7K A;  2IS2 A;  4BE2 A;  1QU3 A;  4YRV A;  3OR1 C;  4ITV A;  1MNE A;  3DQV C;  4DBQ A;  2JA2 A;  2CW8 A;  3F9K A;  2LH9 A;  2L2O A;  2LC2 A;  3DU6 A;  4XR6 A;  5HNH A;  1UAA A;  2E60 A;  4CCL A;  2MAB A;  3E0J B;  1D1C A;  3K4B A;  3UNG C;  3QYB A;  3LSG A;  2WY7 Q;  5CQG A;  1X4O A;  2LY1 A;  2MD0 A;  3D5R C;  4BJT A;  1VZ0 A;  3OOU A;  1UEL B;  4XMY A;  4BEH A;  4E7Z A;  2R7S A;  4HEA 2;  4NC8 A;  3DEE A;  3EUK L;  1OLT A;  1DQU A;  3OYF A;  3KEY A;  4PFP A;  4GRI A;  2O5R A;  3HL2 A;  3CZ6 A;  3ZQQ A;  4MLO A;  2V9K A;  4XM3 A;  3OS2 A;  1J09 A;  3UR3 C;  4AU7 A;  2XC7 A;  4N4N B;  2R7T A;  3OR2 C;  5KHD A;  2ZXI A;  2WBM A;  5CQE A;  3OS1 A;  3LL7 A;  4PJL A;  2X1D A;  2HPI A;  3FHN A;  3A1Y A;  4XKW A;  2CV1 A;  3OMY A;  2FUG 2;  5FRO A;  4IZZ A;  3C2H A;  4U87 A;  2KL4 A;  4HRI A;  4B47 A;  2AQF A;  2K3P A;  4XLA A;  3MKY B;  2HVQ A;  4C2U A;  1K6Y A;  2HDW A;  3PNV A;  3L2R A;  3SZG A;  3OYG A;  3M8J A;  2R7Q A;  3IAM 2;  4CSW A;  1Z3X A;  2KP6 A;  2R4G A;  4E7L A;  1T95 A;  2VKD A;  4LG3 A;  5JHF A;  3H5A A;  2IGM A;  4XLH A;  3RPU D;  1D1B A;  4BQQ A;  2KQR A;  4BUP A;  4PSX A;  2LBF A;  2MFZ A;  1TZL A;  2CS3 A;  3VWB A;  2M7A A;  1WJE A;  1PJR A;  5HOO A;  3PNT A;  1X19 A;  5TGT A;  4OAY A;  1JI8 A;  4J01 A;  2IGK A;  3LMM A;  3DKY A;  2QKL B;  4DJA A;  3ZGK A;  3DTI A;  2MYS A;  2ZSH B;  3CF2 A;  1LDK B;  2IS1 A;  3H0D A;  3HG9 A;  3DTK A;  2W00 A;  2VQH A;  2A5W A;  4BJ5 C;  4CUG A;  4DOZ A;  4XN0 A;  3PUB A;  4DGW B;  1N78 A;  3I3L A;  1TT0 A;  2R7X A;  4FAS D;  3K4M A;  2W82 A;  2OUM A;  2HZD A;  4OWR B;  4E4H A;  3OYB A;  1AA7 A;  2V26 A;  2CUJ A;  4E7H A;  4RLF A;  3M1C A;  2W7N A;  1DP3 A;  1R6R A;  3VYT B;  1WFX A;  1WJF A;  5FRM A;  3SDB A;  4BAC A;  3PJR A;  1NG6 A;  4XLF A;  3ZXS A;  1G59 A;  3QYF A;  4C30 A;  2BVL A;  2WB1 A;  4ZYA A;  2VXD A;  1X4P A;  2I8D A;  2VLA A;  2HPM A;  2V1N A;  5FRN A;  3DKX A;  3SEZ A;  3EPZ A;  4QPO A;  3OYK A;  4CCK A;  1WJB A;  3W2A A;  5HVQ C;  2R7V A;  2CW7 A;  3FBI B;  2L9S A;  4BXF A;  2V4J C;  3TL4 X;  2BW3 B;  4F55 A;  2CV0 A;  2E5N A;  2CMP A;  3PL8 A;  2VPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...