2DT7B

Solution structure of the second surp domain of human splicing factor sf3a120 in complex with a fragment of human splicing factor sf3a60
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
GAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein
molecule keywords Splicing factor 3A subunit 3
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt7B01
1X4OA 2DT7B 2E5ZA 1X4PA 4DGWB 2DT6A 2E60A 1UG0A
chains in the Genus database with same CATH superfamily
2B0LA 2RNGA 5CVRA 5ILVA 5EZHA 4A5NA 2XKOA 4YG2F 2JK3A 4C2MJ 2BY1A 5K5OA 2VE9A 2X48A 2PMZA 1K6OA 3WE3A 3ZQCA 4GDFA 3BZKA 1UG0A 3OL3A 1S9HA 4JYKA 2VBWA 3KZIC 2ZXIA 3ZMUA 4RGUA 4JQFA 4E7HA 2H1LA 4Z2YA 3U1DA 4XLAA 5BPIA 3RZOJ 5IP6A 2RQQA 1KGSA 2OQGA 1Y56A 2MH9A 1EA3A 1XD7A 2KLOA 3E5QA 2YR2A 3VYUB 1H9TA 3ZMTA 2K85A 1JHFA 2M0MA 2M87A 5IP9J 4A3JJ 4XQFA 1T0FC 3BJ6A 1IXCA 1MMSA 2HOEA 4IOAF 4CYCA 4L0ZB 2KPMA 3M8JA 2ZXJA 1IUFA 2CO5A 3HOXJ 1G8XA 2W4SA 2L9RA 5J1YA 1I6HJ 1X1PA 2K3PA 1K78A 4BHCA 2DMPA 4ANJA 1SFKA 5E3LA 3WGGA 3KIOA 1FMWA 3DEWA 4GGGA 1AOYA 1R23A 3NQOA 2NS7A 5B1BH 2BOLA 2Z99A 4E7IA 1W5CC 3C2GA 2EA4A 3DKWA 3IH2A 4M9ZA 5FKNA 2XF5A 4AU7A 1XGNA 4HOBA 4D0PA 1A31A 2RC4A 2CYYA 5DYMA 2Q2EA 3S16J 3L2WA 2CGPA 3WTWC 2RKHA 5DUKA 4AM3A 1G59A 4CHUA 1LDKB 2WV0A 4L9TA 3ERMA 3IWFA 2A61A 2ZC2A 1VQ6I 3HGGA 2DMTA 2ZKZA 2BW3B 2K9MA 2QLZA 2PJPA 1XN7A 4A3EJ 4I76A 1V5GA 1STZA 1F5TA 3LAJA 1IV8A 3LFKA 2EK5A 4P5OA 4II2A 3TQNA 5E20A 2EFWA 1BJAA 2CUFA 4UHTA 1W1WE 1Z3YA 1OYWA 1RR8C 4E7SA 3F3XA 4XN0A 5IT9K 3OS0A 2LFBA 1LVAA 3P7NA 3O8GA 3SEQA 3JTHA 3K0LA 2X4HA 4V2GA 4UUSB 1ZRCA 1DQUA 3CUQA 3KYCB 5D4RA 1BR1A 2L54A 4E7LA 4L9VA 4C3HJ 2QSFX 3T8RA 3JRHA 5HNFA 2ME6A 2LC2A 1F4KA 2XAJA 1ZRFA 1A5JA 2KRCA 5BOXA 1OPCA 4HSTA 5EEGA 2GQQA 4S04A 1AKHB 4LGWA 2ADUA 1P4AA 2IA0A 3F8CA 3IH4A 5C3EJ 5EDNA 5C4JJ 1R4NB 1V5EA 3JSOA 3G1OA 2CQ7A 3OIQA 1BA5A 4LIUA 4F3QA 5IT3A 5JLXA 1MSFC 5TGTA 3CMEI 3RKWA 3DCFA 3E3VA 3OOUA 5EYRA 5K5QA 3Q0WA 1IN5A 4EATA 2V7FA 2JA2A 4DQ2A 4BXXJ 5F0HA 2KZVA 4CO8A 3IHUA 4C30A 1AA7A 2TCTA 4HEA2 3LQQA 3RYRA 3ASOH 5JFRA 1VF9A 3S3MA 2JA5J 1IRZA 2BZTA 2EZHA 5EF6A 2BYVE 4KDPA 3VOEA 2DA5A 4A3GJ 2VXZA 2QBYA 2DAOA 1G6NA 2FRHA 3F9KA 4XLFA 1S7OA 4A6DA 5CYVA 3OS1A 1VQ5I 2XHKA 1Z6TA 4IHWA 3TW7A 4BJTA 3RDIA 1X1CA 1FSHA 4EV0A 4R79A 4WCGA 3KLNA 3WTTC 4UUSA 4HQMA 2ZSHB 1D8JA 5FFZA 5JHUA 1KU9A 4MGRA 1ACIA 2HXOA 1KA8A 2EZLA 4Z6YA 1IGNA 3CF2A 3V8LA 2ZJPF 2V6EA 3S1NJ 3GVAA 4EM1A 1IJWC 2X1EA 2G0EA 5KVRA 2IPQX 3FHNA 4XSZF 4XONA 1ZN2A 4JX5A 4A12A 4DYCA 5FO5A 4QIWN 3CC4I 4HX8A 2E1MC 2HU9A 3S1RJ 4M3EA 2E7XA 1Z6RA 1AU7A 5CVVA 2F6CA 1I6XA 4HZFA 2VIXA 4LK0F 1RNLA 2Y0SA 5DEQA 3W2AA 5M5WJ 3L00A 3QU3A 4U7BA 3CCSI 5M5XJ 1PUEE 4D7MA 3GLLA 1SMYF 3LL7A 2W7NA 2XVCA 1O3SA 4N4NB 1WH7A 4BBSJ 4X6AJ 3IL2A 4LLGF 2B7EA 3MKZA 2LMDA 2X51A 1WPKA 4I2OA 3VYSB 1GV2A 2AXTC 3OOPA 3N97A 3J7YJ 4BY7J 4FTHA 3L1PA 3WODF 2CV2A 1USSA 3S8PA 4BU2A 4A3IJ 2EILH 3ZPLA 5DS9A 3HB9A 4O6JA 4EMSA 3MQ0A 3OSGA 2ELKA 2XC7A 4A3CJ 2XAFA 4EJVA 2DK8A 2GZWA 2QVOA 2XV4S 3RI4A 3H3VK 3HUGB 2GAUA 3R0AA 1PVEA 2Z16A 1IRFA 3JRAA 2PFBA 2QUFA 2X6WA 3LSPA 3DBLB 2L4AA 2LR8A 2W00A 1QU3A 1WGXA 1KZHA 3DQVC 5IOYA 3OYGA 3S2HJ 4D1QA 3K4NA 4CCNA 2PMUA 4XOPA 5GAGJ 1VQ9I 3GWZA 2ETHA 5FD6A 1DGRM 2ELHA 4WXCA 3RYPA 1SEUA 3GTKJ 5KHDA 2OCEA 2VI6A 1WJAA 3WU2C 3ZXSA 1MJAA 1T98A 3IH3A 3S3OA 4MO7A 2KL4A 3F6OA 3GZ5A 3GTPJ 3J7ZI 4IQJA 2NS8A 3H3UA 1Z05A 5J6XA 1JGSA 4LLLA 4HV6A 3DU5A 2LBFB 4IVNA 3IAM2 4Q48A 1EH8A 1SFUA 4XNFA 2F4MB 1Y39A 2AO9A 2DQLA 5CVUA 3JRGA 2OTJI 4XSXF 3ZCOA 1WJ5A 2LKPA 1G3WA 4HX7A 4LIVA 2GIZA 3F8MA 3E6DA 2BV6A 3EQLF 4PJ0C 2L9SA 4V2FA 1N77A 2WBMA 4D5CA 3K10A 1K4SA 2V1UA 2VKEA 4I98B 5BQTA 2F48A 1LDDA 3BZ6A 5F1JA 1UMQA 4M3DA 3BR3A 3FX3A 4HNVA 1ETOA 1T0FA 4RAYA 5JVGF 3HOZJ 3PFIA 3ZRGA 4B1RA 4U87A 4DZPA 5IYCJ 1UJ8A 3H5NA 3LSGA 2WY8Q 2EV0A 4GXOA 3WHBA 1QHHD 2JMWA 3K69A 2RDPA 4A6EA 4G94A 1D0YA 3E1SA 3BCAA 3L9FA 1DP7P 2GOMA 4LB6B 3K4KA 3K9TA 4A3MJ 4XKCA 1EF4A 3OV8A 3Q0VA 2R7XA 2DMQA 1BOAA 4CDGA 2DLLA 1HC8A 2VKVA 3VSLA 5M5YJ 2E1OA 4HLXA 4BXUA 3PSIA 2DTZA 2HQAA 4PFPA 1YHQI 4PJLA 2O3FA 4Y33A 2LBFA 2LK2A 1HKTA 5D4SA 3BR6A 3P5JA 4IQ4A 1YLFA 1DDNA 1XMXA 3LSJA 1X2NA 1R4MB 3L09A 4RB0A 3QU6A 2XB0X 1T33A 2XIGA 2YX4A 2HVSA 5HLTA 5L3EA 3B6AA 3KP2A 2WAEA 3CDLA 1JUSA 2EINH 2MH2A 5GAEJ 5CJ9A 2LLKA 3WTZA 1WI3A 1ZGAA 1ULYA 4ENMA 1Y0UA 1R22A 2E1NA 2CV1A 3OYNA 1TZLA 2PN6A 2K02A 3WTYC 3CCLI 3E6MA 3TW6A 2P5LC 4HF0A 1S8NA 3RKQA 1RC9A 2HTJA 4LLNA 1YQAA 3JRDA 3FXOA 1DP3A 3P9KA 4XLHA 4AC0A 2D2WA 3P9CA 3WU0A 1KQ0A 2COBA 4B4CA 1NTCA 5J8FA 1OMIA 5LEKA 3CDIA 1IRXA 5HS7A 5B1AH 1BI3A 5FKKA 6PAXA 2DT7B 1QZYA 3U9GA 3HSFA 4E7JA 4CSWA 4LD5A 2I5UA 4BQOA 4BDZA 1D0XA 3AG3H 1B8IB 1FOKA 4UUVA 2E1MB 3CUQC 2EIJH 1SAUA 4CZZA 1TQPA 2PJRB 4R1HA 4P55A 1W7PB 2L01A 1FOXA 5A2QK 2MGQA 3BWGA 4OWRB 2OA4A 4O3MA 3OIOA 2VJ4A 2H1KA 2R7TA 1QGPA 2JTVA 1OKRA 2V79A 4FQGA 3I64A 3MCZA 3BJOA 3OYIA 2ZFUA 1U8BA 1Y8RB 3BTIA 2IJLA 4J00A 4C9YA 2J5OA 1JKOC 2BY2A 2DMUA 3V7CA 3KP6A 1ZTRA 2R7VA 2WADA 4GCVA 1T39A 3IRQA 3I9V2 2FMYA 4ESBA 4CZCA 3OYLA 1E2XA 2EA2A 4ZZDA 1FJLA 2EB7A 5EGOB 3HL2A 3HYIA 3M8EA 3L7WA 4XRSG 5IYBJ 4IPAA 5LHHA 4IOCF 2Z2SB 5LGTA 2WV1A 3BY6A 3H9GA 3ABLH 2Z5UA 2OU2A 4IKFA 4BH9A 2L9NA 3S32A 5K1YA 2KJBA 3F72A 1WFXA 2MD0A 1BI2A 3R0JA 2DYSH 4KN4X 5F64A 1ZG1A 3FXQA 4ZDPA 4UVCA 3PIPF 3AG4H 4EM0B 3I71A 4WWCA 2CQQA 3O3KA 2F5CA 1DPRA 9ANTA 3G73A 4MFDA 1Z91A 3M9AA 2M45A 2LY1A 1IUYA 2DBBA 3ABMH 4XLPF 4II3A 3BG9A 3QPHA 1DU6A 4GRIA 1W7PA 3EUHA 1VQ7I 2KIFA 3S1MJ 2MD5A 4UV9A 3I56I 3S17J 4OMYA 1J0RA 3PQKA 3W3CA 4MTDA 3MKWB 2JVGA 1I39A 3HHGA 4P9UA 3R61A 4ZC3A 4ABZA 1D8KA 1OQYA 5L3DA 3U2RA 4UVBA 1K61A 4EEFG 1QNTA 2FBIA 2I8DA 3LA7A 3HHHA 3MVPA 3E6BA 5A2QZ 1REPC 3ELKA 4XM3A 2R5ZB 1ETYA 2D1VA 3GMEA 2A6HF 1GXQA 3Q9SA 5J4VA 2OQRA 2L0KA 3QOPA 4MQ9F 4UY8I 1J9IA 1ETQA 4L9NA 3DPUA 4DNCA 4I02A 3HDDA 2ZJRF 1F36A 1LJ9A 1TQIA 2FXAA 2LREA 3RKXA 1V3FA 5FKLA 2QM3A 2RN7A 2OAZA 3DLAA 2HDDA 2OJED 3HPGA 1ITYA 4W1UA 4QPOA 2ECBA 1TNTA 1ZYRF 1A6IA 3H36A 5F04A 4BBRJ 4KISA 3JR9A 4YRVA 3ECHA 1ON1A 5KAFC 2DPDA 4WXDA 4D7NA 4U0YA 3W2WA 1HSJA 2MC3A 3KFWX 2GXGA 1FYKA 3I4NJ 3I53A 4L5JA 4LG3A 1BJZA 2HI3A 3EUKL 2VUMJ 3VB2A 4BJ6C 3ROUA 2DFHA 1RRJA 2V1XA 2L7FP 2RGVA 5DM6F 1X3ZB 2DN0A 4EJOA 4U0VA 3KX2A 3JRFA 3EETA 3FXUA 1K83J 1GLNA 3MMYB 1ZK8A 2E71A 2EJRA 4CYCB 3GTLJ 1ODDA 1MBGA 1QPIA 4EM2A 2IGNA 1RKWA 3HEFA 1H0MA 2FOKA 1VQKI 1I50J 2ISYA 1FEXA 2D1HA 2EWNA 1W0TA 2ZNYA 4NB5A 3ZMSA 2JA7J 4IEJA 2X0LA 2WC2A 2VODA 2LP0A 2ZBKA 4BEHB 4UNOA 1FTZA 4DBRA 2W84A 3ULQB 2VKHA 5KCMA 2MC4A 2X9DA 3FXLA 2K40A 2IVMA 2A05A 2HGCA 2YPRA 3GLXA 4XKVA 1A04A 4RMNA 2P0WA 3HZJA 3TBIA 3R6SA 1P9QC 3J81K 4U7DA 3F8NA 2WAQN 2XF6A 1KU7A 1U2WA 1E0EA 2HKOA 3L2CA 1SC7A 1R36A 1P92A 3GTQJ 2X6XA 2ZSIB 1J59A 1VI0A 4TV7A 3FKJA 3TMOA 1XS9A 5F0CA 2VPRA 1IF1A 2IS1A 3SJMA 2IRFG 4XKBA 3CUQB 1YRNB 3QPSA 2R0QC 2DA4A 3CO6C 4A5MA 4Y52J 2V9VA 3LA3A 2R7WA 1Y8QB 1U78A 3A1YA 2JPBA 3A0HC 1ZELA 2E5NA 3UR3C 4RB1A 4CCOA 4BQNA 1W5SA 2IW5A 5K5RA 2FMLA 1W4MA 3BG5A 4XRFA 2LY9A 4MNUA 3SZTA 5BMZA 5GTHC 2CFXA 1PYVA 4IZZA 2VONA 2M4GA 3LAPA 2CG4A 1B6AA 1RI7A 2Y0MA 3JRBA 1UHWA 1TWCJ 4N9IA 1S3JA 1J75A 5ILUA 5E8GA 1CF7A 1Y1WJ 2R92J 4I01A 3F6VA 1U8RA 2OF7A 5CPRB 3ECOA 5F6FA 5ICGA 3HKZN 2DA2A 5LRSA 4ESFA 4BEHA 1L0OC 5ED4A 1IXSB 4O5VA 1MBFA 2WAFA 2OV7A 2DMNA 2HQNA 2Y75A 3GTOJ 1ZR4A 2OUMA 1GT0C 4IRGA 3VYRB 1SD7A 4IXAA 2QGUA 4EJUA 4LJZF 1X3WB 2HS5A 3DBRB 4GYIA 4PJNA 1FLIA 2DOAA 3QWLA 4JBAA 2QBYB 2A69F 3WGHA 2V1NA 3F22A 2P6TA 2DW4A 3GFIA 3FK7A 2R7ZJ 3I59A 5LFAA 5J40A 1JKRC 1MIJA 3MZHA 3PO2J 1MSEC 3DV8A 1A35A 4G6TB 2F2EA 3F23A 1I1SA 1ZAOA 1ZLJA 5BNGA 1U0JA 2ZXWH 4YEJA 1Z3XA 1JI8A 1B59A 4D9JA 4OMZA 5GTIC 1XGMA 2Y9ZA 2EFOA 3QAHA 3J81Z 1YRNA 1IN7A 3LQRA 4HQEA 3BC8A 1IV6A 1V4RA 1X19A 4LITA 2BXYA 3I54A 3NWTA 2VE8A 3ZP5A 5CVJA 3D5LA 4FHTA 4FX4A 4BDYA 2PMZN 1XC5A 3EDPA 1CGPA 1OCOH 1WQ2A 2DT6A 2ZNZA 3IC7A 2W85A 3BQYA 1LPQA 4YFKF 3OMYA 1H9GA 3F8BA 3GYHX 3ZN0A 2M1BA 1LFUP 2LH9A 2HDWA 4ZJZA 1X4OA 1LB2A 5LD2C 3GZ6A 2HZTA 2ZO4A 5DDGA 4P96A 4M6YA 4NUBA 4A0ZA 2HQRA 2W1OA 3Q3SA 4CCLA 4KNYA 4BJ5C 4FE7A 2D45A 3WG9A 3CDHA 1R9TJ 1O3RA 2DYRH 3U1KA 1N78A 4BXFA 4XLEA 5KAIC 4ETSA 3PL8A 1TWHJ 2JT1A 3DBHB 2BVLA 5HLHA 2EZIA 2IT0A 2VJIA 5LEJA 4HYEA 4GO1A 5JR3A 1BI1A 1TBXA 2CUJA 4XRMA 1SD4A 3OWTA 1LEAA 5HNHA 2H6BA 3KEOA 3HSEA 1X2MA 2DA7A 3SFIA 3TKYA 4PDKA 1ETXA 2DI3A 2Y69H 1AWCA 1KQ9A 2M2EA 2M30A 2OPTA 2X85A 3KP4A 2IGKA 3J80K 5DD4A 1LEBA 2K27A 1RZ4A 3BZCA 3VDXA 1IDZA 5E3MA 3PUFA 1V55H 1FP1D 2WB1A 2KRFA 2CMPA 4KICA 3K1NA 1F9NA 4BY1J 2DA1A 4PFOA 3K6GA 4Y15A 3CO7C 4UXNA 4IO9F 1Q1HA 2L7ZA 2JUCA 4BQQA 2Y30A 2QKMB 5J3LA 3G3ZA 1FYMA 2QEXI 1JTXA 1A36A 4J19A 4V19K 4HV5A 3AG2H 5CQGA 1IC8A 5IYDJ 4B44A 2A6TA 2LYCA 2ZJQF 2EQRA 4Y7NJ 2AQFA 2Y9YA 2H09A 3OYFA 3M4OJ 1G3SA 5LLQA 3V4GA 4PJMA 2H6CA 3G4SI 5HLIA 1BIBA 1SFXA 1P7JA 2CSOA 2R7RA 3EUHC 4F91B 1HDDC 4J01A 3SZPA 5HS9A 2ID6A 4IJAA 3EUAA 3PUBA 1TWFJ 2P7VB 2JSCA 4CCKA 1NG6A 3QOEA 2A3SA 2BBYA 4BKXA 2G7HA 3ASNH 4G9YA 3KETA 3COAC 1D0ZA 5IP7J 1GV5A 3KCCA 3H5AA 4M3FA 1M1EB 3FDYA 3JTGA 4FX0A 2RREA 4AYBA 3BG3A 2NVTJ 2CU7A 3VODA 2FF4A 4ZTFA 3GTGJ 3ZN1A 2B9SA 1O7LA 1B1BA 2JRMA 2OTLI 2MFZA 2XPVA 4E4HA 3O2PE 5D5UB 1PP7U 1XTAA 2K86A 3D5SC 5DD8A 4G7HF 3FZVA 2KIQA 2YU3A 1NK2P 4DOZA 3FBNB 4OIPF 3TO7A 4M9SA 4L9JA 2FD5A 1GVJA 1Y1VJ 4BUPA 2HEOA 3J80Z 3L2UA 1XX5A 3A0BC 5E3NA 1H89C 3KLOA 3BDDA 4E70A 2JRTA 5E18F 4OIOF 2WA0A 1R5HA 3AG1H 1KONA 1IRGA 4RA2A 3GFMA 5E1WA 4HNUA 3OY9A 3ZOBA 1JUPA 2YU9J 1SD6A 2FOWA 1FY7A 4F92B 2GA1A 5L3FA 3S3NA 1NG7A 4AIJA 3ABKH 3TDZC 2GOXB 3G6EI 1JUMA 2Q0OA 1UELB 2Z1DA 1B4AA 1ZQ3P 3BR5A 4LMYA 2P6SA 4ZYHA 2HTSA 2R5YA 3KEYA 2CRGA 3BR1A 4ZZLA 3LOCA 4WXHA 4LFUA 2XRLA 3LFUA 4CCMA 1FSEA 2M7AA 4PGGA 1K6YA 5BS6A 1XG1A 3GEZA 3CCUI 2KDOA 4A0XA 3TGNA 3DXJF 5IY5H 1P4WA 3CJRB 4MQVA 4XR6A 1K79A 1SAXA 2IS2A 1BC8C 2Y0SN 3BR0A 2CUZA 3ISPA 1BI0A 3KYDB 3S1QJ 2R7OA 4B09A 2EH3A 3C3WA 3FKIJ 4ITVA 2EFQA 3TO9A 3GX4X 1OFCX 1LKXA 5EZGA 1QA6A 2O61A 4N9HA 3OYAA 4G7OF 2X1CA 2VBZA 2M34A 1WJCA 1D1CA 4XLCA 1ZLKA 5E3OA 3P9IA 2PQ8A 3ZQQA 2R7SA 1H8AC 3ABUA 3DFGA 4RB3C 3CLQA 1W0UA 2CH0A 3G2BA 5DCMA 4BQAA 1UHSA 2DT5A 3TP3A 1Z7UA 1ETWA 1MGTA 5FRMA 3AFHA 1EJ9A 1O57A 2MBFA 3FXRA 1SVMA 4UB6C 2O6GE 2LF8A 4NNJA 1XCBA 3BT9A 1HQCA 1IDYA 2K9QA 2R4GA 2FX0A 1G4DA 4QPQA 2PX9A 1R1UA 5TISC 2LF7A 4ZYGA 3OL4A 1QPMA 4KN7X 3OYKA 4G8XA 2X6OA 2DFIA 1OR7A 1WVRA 5F0FA 2VBYA 4RLQA 5D6EA 4XRSA 2QF7A 2VQHA 4I6ZA 1F1ZA 3DP7A 1PDNC 1VQMI 1MMDA 1T95A 4H4KC 3GW2A 2VLAA 2K9LA 3CC2I 3PNYA 2M8GX 2R7DA 2A5WA 5AIQA 3SDGA 3W6KB 4AVZA 3WE2A 5FB2A 1S72I 1NH3A 2O9LA 5DV5A 3GFLA 3GXOA 3HM5A 1O3TA 2CV0A 1LE8A 1GDTA 2STTA 2HDCA 2NVXJ 4CICA 1MMAA 5J8CA 1YS6A 2NVYJ 4RAZA 1T56A 3FHZA 2FBKA 2MW8A 3MZ8A 5FLVA 1L3LA 3H0DA 1OISA 3BR2A 3CJTB 4NC8A 1W36D 4BE2A 1WKMA 5L3GA 1VQNI 4RGSA 3VFZA 2M4KA 4MIMA 5K7ZA 1OCTC 3W6VA 2ESHA 3KP5A 2ECCA 4L5IA 2X1DA 3ESWB 3C2HA 4D5FA 1DGWY 4M74A 4I0BA 4ENKA 1XGOA 2VT2A 1EH6A 2KRHA 1LDJA 2LDUA 4PSWA 3S2WA 1SFOJ 1QVUA 3KP7A 5E1ZB 2A5YB 3ZQFA 2O5RA 1WJEA 4XIDA 1ZH5A 2PEXA 2GWRA 2XUBA 2JA6J 3K4JA 1P7IA 3FK6A 1WCMJ 3AL0C 4XOTA 3TL4X 3K70D 4AWXB 3M07A 2PG4A 3T1BA 2DJNA 1ONVA 4YFXF 2QQAA 5FKMA 3MFKA 5B66C 4KMUX 4MLOA 2UXNA 3SEZA 2V9KA 3B02A 2XKPA 5H2FC 2L3DA 1HDPA 4KT5C 3PQJA 3GO5A 4RGXA 1E3HA 4PK4A 3L2RA 2COMA 1XB4A 4IL6C 3SZGA 3PJRA 3B73A 2XPUA 3Q9VA 4AUXA 1LNWA 3UNGC 5GADJ 2KT0A 5FFXA 4XORA 1BBYA 2WWYA 3RJPA 1B9NA 1IG7A 4BGDA 4RGRA 3K7AJ 1JKQC 1BW5A 4HA8A 1BR2A 4BE0A 3VPRA 4IF4A 4YIFA 4IX7A 2Q8KA 5B3SH 3CUOA 5BPDA 2BGCA 1HKQA 1POGA 1HKSA 3GZNB 1DPUA 1XSVA 1MBKA 2HZDA 2OBPA 3SQNA 3I5UA 4B3XA 3DTEA 2CS3A 3VSKA 1O3QA 4G6DA 3QYFA 3DKYA 3LNQA 3KYLA 2HR3A 1ORKA 5D5WB 1Z7LA 1FMVA 1WSUA 4A69C 1LFPA 2W57A 1JXSA 3W6JB 3QPLA 1OCZH 3CCEI 3ZMZA 4EVIA 4X0GA 1YYVA 2W25A 3JRIA 5B5EC 1UAAA 2O0YA 3QP5A 2UZKA 3RPUA 2JWTA 4JX4A 2QQ9A 4KFCA 2UUZA 3AKZA 1BW6A 2ID3A 3IAS2 1E17A 1YX5A 3HBLA 2E60A 3H0GJ 5AONA 5FROA 2XGCA 1Y6IA 2H94A 2LRDA 2NVUB 4EGYA 3CC7I 5CVIA 4A0YA 2FEZA 2ESNA 3SFZA 4CH7A 2QYOA 2XGDA 1MD0A 3JSPA 3OYHA 1U3EM 1BOBA 5F27A 2KHMA 3HXLA 1SFEA 1TTYA 1ZHFA 2K4JA 3S2DJ 1CQTA 2P5KA 4A3BJ 4H0EA 2VASA 1X1BA 2A68F 2DK5A 3GUDA 1V54H 1X4PA 4IHXA 1XPXA 1FOWA 1FC3A 1MBEA 1RR7A 1YJ9I 3FMSA 1GUUA 1IZ1A 2ELJA 3HOSA 4OU0A 2IS6A 5E8IA 4MTEA 3I4PA 4LB5A 2QSGX 3OR1C 3OYBA 2NNNA 2G9WA 3RPUD 2WAQA 1RESA 4QTRA 3A2KA 2BHZA 3WTSC 4HG2A 3F8FA 4QLCU 3K4BA 3MD2A 1WJBA 2E19A 4YFNF 3FWEA 4DW6A 3RTRA 4M72A 2NS0A 1B72A 1RIOH 3FXKA 2LKSA 3C7JA 4ZDOA 2CFOA 3PM1A 5HODA 3CCRI 3I0TA 1HSTA 1XSXA 4N0BA 4HBLA 3WHCA 3IWZA 2FNPA 2QSHX 1APLC 2JQ7A 3FXJA 2PBIA 1OCRH 4M73A 4AVPA 2QQBA 2ZFWA 3NRVA 2VQGA 2OCCH 1S29A 2GXAA 4M3GA 3CLOA 2CW0F 4BL0B 5ICEA 4IRIA 2NRAC 4A3FJ 4YIIA 1CF7B 4BE1A 2ZB9A 1YTYA 4HRIA 1WZ2A 1QO0D 2GBYA 3DU6A 1PUFA 4M6VA 2FQ3A 3FM5A 3A02A 4OINF 4G12A 2YS9A 4Y4RA 3HPHA 4B3AA 1HW1A 1XSDA 1ERDA 4ZYEA 1TWGJ 3BG7A 1R6RA 4C3IJ 1MDMB 3H1CA 3M1EA 4QWQA 4NQWA 2Y2ZA 1R1TA 2K7LA 1U5TB 1UB9A 4CCJA 2XSDC 4WK8F 3CESA 1HCRA 3FF5A 2RQPA 4Y13A 3T5XA 3I59B 4EJTA 1D1AA 1ETVA 2VC0A 3K1MA 1FBSA 4KJZA 2FU4A 2W48A 5FRNA 3FMRA 3M8FA 3PO3J 4UB8C 1FOYA 3TEDA 1MH3A 2CQKA 1UFMA 2UWMA 5LGUA 2M7BA 5FJ8J 2B63J 3BTLA 4KIGA 4XLNF 5DUIA 3QRFF 5F08A 3LA2A 1TL8A 1P2FA 2V1DA 4AIHA 2ZMEB 4A3DJ 2XSJC 3HC7A 3AL0B 1BR4A 4JX6A 2CWEA 1I3AA 3WTXC 1UHMA 3PIOF 3J7AO 3KP3A 2Y48A 3KZYA 4MHGA 2IP2A 1ZGJA 2CW8A 2W24A 3N05A 1RPWA 2O8XA 2DDAA 2KISA 4KA4A 3ZQLA 2GLOA 5JVTA 2VOPA 5EEHA 1OYYA 3REOA 3SHFA 3ONQA 3FISA 1YITI 2K4BA 4EGZA 2OZUA 1W36C 3L2VA 1MW7A 4N4OB 2O8KA 1FZPB 1Z77A 1IXRC 2DFFA 4AD9A 4OAYA 2VC1A 4L18B 2IA2A 1OR7C 1ZKGA 1GHCA 3OYEA 4ASNA 1T6SA 1MDMA 2Y31A 3GBGA 1S6LA 1LUJB 1I1GA 2DA6A 4RAFA 3OSFA 3M1CA 2Z33A 1U5TA 3PSFA 4OAZA 3WU1B 3IV5A 5GPAA 4S0HB 4HDVA 1VTNC 5HVQC 1Z9CA 4KMFA 3RQIA 4KYWA 2XB5A 1D3YA 2JJ7A 3QYEA 1TT5B 2BXZA 4DZJA 3G1LA 3K70C 3CMMA 3F0CA 3OYDA 3CTAA 3PNVA 5L3CA 2E2IJ 3E6CC 4EJWA 2HVRA 3HOUJ 3V7SA 5HS8A 3OYCA 2EPFA 2ZMEA 3WTVC 3IRRA 2DOEA 3DTKA 1R5GA 2KJCA 3BQZA 2VKDA 4AIDA 3NEUA 1JJ8C 3SXYA 3V7RA 2IEKA 1OJLA 1YW7A 4EQQA 4IHTA 1ZRDA 1QZEA 3BOQA 3LSMA 2HYJA 2OC6A 2E34A 4MFEA 5K7HA 3I4MJ 4KITB 5J4YA 2EFNA 2KMUA 3J7AY 4HAMA 3MKYB 1H88C 5JHFA 2AXLA 2NXNB 1MZBA 2NVQJ 2XPWA 1U6GA 1YOVB 4M3BA 1Z1DA 4A2UA 4A93J 3CP8A 1LFBA 1OCPA 1J09A 1ZARA 1JE8A 3JREA 1JGGA 1MMGA 3A03A 3HOVJ 2VL8A 2CUEA 4OIRF 2V26A 2YX7A 1FWZA 3T0YA 1YE9A 2MSYA 3O6BB 2UV1A 1TC3C 4HNTA 2RV8A 2H8WA 3O8HA 2KQRA 4GFBA 2KP6A 1X1DA 2BW3A 2DTRA 2HYGD 2CW7A 4I0AA 3HRMA 1DUXC 2KFDA 2GA2A 4HF2A 3H9JA 4I7HA 1KYWA 3D5RC 1HW2A 2W82A 3MWMA 4HSRA 5DM7F 3BTCA 4OIQF 4XK4A 3DLLF 2M0CA 2VBXA 3Q5FA 5ICFA 1OLTA 1ZGWA 3DWLE 2KZGA 3V42A 3CQZJ 2EZKA 5D8KB 1XCVA 1Z67A 2DDBA 3ABTA 2XASA 1YJWI 3BPXA 2UXXA 3VEPA 2VOOA 5LHGA 3HOTA 4NC7A 2FQ4A 5IT9Z 2JVHA 1AKHA 2KIMA 3KEQA 4RBOA 3CZ6A 2XGXA 5FLXK 1IN4A 1JTYA 2ISZA 4BAYA 3X2QH 3I55I 1WWXA 4ON0A 2QENA 2IGOA 2EBIA 2XAGA 2XDVA 3E7LA 2R5YB 1YFHA 1S5LC 1YW8A 3KE2A 1FBQA 4XN3A 3UKGA 2VPLA 3RCOA 1FYLA 1U9OA 3CCQI 5DTDA 2ZJ2A 2ICWG 5EJCA 2VJJA 2HOSA 1SVLA 2NNYA 1X3UA 3QPTA 5HLGA 3MEXA 2F5VA 2R7UA 2HFHA 3RIRA 2N8GA 2JN6A 3LSTA 2FE3A 4GYGA 3C2BA 1JHHA 5AIPA 1SMTA 1R5ID 1MH4A 1FTTA 4FCYA 1HBXG 3DF8A 3V8JA 2P7CB 2OD5A 2DXIA 1S7EA 1JT6A 1TNSA 2M9HA 4KIFA 3TOBA 1WJDA 1RETA 2WTEA 1MKMA 3TDUC 1HOMA 1UG2A 3E97A 2XRNA 4C2UA 2DJIA 2PI0A 4NHJA 2KKOA 2FJ1A 1VNDA 1QVTA 2HPIA 1USTA 1D1BA 1QRYA 2E35A 5IOZA 4RLFA 4FE4A 1BL0A 4PGHA 4DBQA 1KYZA 3JW4A 2ZXHA 3LSRA 4A3KJ 3NARA 4F52A 1K7AA 1IO2A 2P8TA 5DCFA 1I27A 5DCMB 3JAMK 2R7FA 3SDBA 5TRDA 3CJNA 2E7WA 2QWWA 2WB1N 3HIFA 4KT6A 1R71A 3HTUA 2F5EA 1JKPC 2QZ8A 3D1NI 4CYDA 4XICA 3R60A 4XKWA 2M3AA 2E36A 4XL9A 2RNJA 1MBHA 2F4IA 3K2AA 3TP0A 4DJAA 3OYJA 1ZR2A 1TW2A 3H5RA 4I09A 2L4MA 2DCEA 2X6YA 2L2OA 2CJJA 3IKTA 3ZR8X 4G6QA 2MLKA 1KU2A 3CCYA 1J7KA 4WX9A 2MA3A 3DPTA 4NC6A 2K9NA 2GXBA 4Q47A 1WRJA 3OIPA 5FLXZ 2BY3A 5M3FJ 1J5YA 3BTJA 1FIPA 3PFYA 5E79C 1YX3A 2V4JC 2VT3A 3TO6A 5LGNA 5FLMJ 2QA4I 1P6RA 1K4TA 5EEAA 2R93J 1LE8B 1RUNA 1FT9A 5CKTA 2M5WA 3BROA 2VB6A 4RM3A 2HQ5A 3BJAA 2QKLB 2LD5A 5ERIA 5TJJA 3B6CA 3DTIA 1FNNA 4IHSA 4Q5SF 2H8RA 3RPQA 2LKXA 4LK1F 1DU0A 1YW9A 1AHDP 3M3YJ 2E1CA 5ICCA 2OZ6A 4AYBN 3LSHA 3R4KA 3VWBA 2IXSA 3ZQIA 1LQ1A 3G1MA 3CJQB 4RM2A 3HRUA 3MN2A 1IN6A 4K2EA 3RQ4A 1TT0A 2HKXA 5K7FA 1WJFA 1VFCA 1E3OC 2R3SA 1JJ6C 2BEOA 1YO5C 1EKEA 2MYSA 2YUSA 5D6FA 2LVSA 2P5VA 2EFPA 2R7QA 3RSNA 3HUGA 2CQXA 1KU3A 1MJ9A 1S7AA 1XMKA 4LG0B 3MZYA 2V6CA 3FMQA 2H27A 4RAGA 3IP4B 1Z0XA 3CCVI 4UUTA 4FETA 3HRTA 4U0WA 3T8TA 4F93B 2BVMA 3JAMZ 3KZZA 5JLWA 3A4CA 3LSKA 4IRHA 1ZG5A 5H6QA 1HXDA 1ETKA 5ILSA 1NK3P 3D0SA 1MNDA 3OR2C 4FISA 5FD5A 3IKVA 3OS2A 1VQ8I 4YIRX 2L02A 4B43A 1XGSA 4P9FA 5EG0B 1MJBA 1IW7F 1Y0NA 2F4OB 2DO7A 3K4LA 5KK1A 3HOWJ 2NOJB 2O03A 3NAUA 2TRTA 2JZYA 4JOMA 2ACJA 1MNEA 2RVCA 5HDKA 1I5ZA 1YS7A 2F5DA 2K3FA 1T2KA 2HOAA 2TDXA 4ZTJA 1UZCA 2NYXA 3EYYA 1YJNI 3ZQHA 1G3YA 2AHQA 1SD5A 4E7KA 1QBJA 2L9VA 3H9QA 1MNMC 2DPUA 5C4XJ 2KDZA 4M6XA 1TLHB 3MAJA 3ML6A 3K4MA 2EV6A 5E17F 3DPLC 4KUMA 4G7ZF 4CXFA 2HNHA 2K9SA 2L7MP 3E0JB 4B47A 4C3JJ 1WI9A 2MG4A 4F7ZA 3LWFA 3HJEA 1U5TC 1ENHA 3K2ZA 1WHUA 2HYFA 4PZJA 3CP2A 1NHAA 2VXDA 5E1XA 1HW5A 3QP6A 3HRSA 1TWAJ 5D8LB 4NDLA 4B48A 4PCQA 1GVDA 3FM3A 4I99C 1FX7A 2MLGA 2NAZA 5FGMA 4JP0A 3G71I 4U88A 4UV8A 3I58A 3IUOA 3U21A 5C44J 1OYIA 2VQCA 2IS4A 2DA3A 4LG0A 2CQNA 2ZMEC 3S93A 4FT8A 1F43A 2DODA 1U9NA 1FPQA 1R1VA 2O7OA 1YI2I 2E5ZA 1LVKA 3F21A 4FASD 1TP4A 3LSIA 3QYBA 3SYTA 2E2HJ 3EYIA 2FNAA 2HPMA 1T38A 2XF7A 5EG0A 4QSHA 3V8KA 3BCBA 1BN5A 1X1AA 5CLSA 3PNTA 3TOAA 4PUSA 4HX4A 1XDUA 3L2QA 1OCCH 1MMNA 2K5CA 4HDUA 4JK1X 4YELA 1B9MA 4Y17A 3A01B 1GXPA 1BC7C 3H35A 4Y3OA 2LG4A 5J1UA 3RKYA 4XBFA 1EH7A 4ZYDA 5JI6A 5H6RA 4IHYA 1VZ0A 2QCOA 4CA0A 4E6KG 5HOOA 2BY0A 2IGMA 3CMAI 1X58A 2L5QA 4MEYF 3I3LA 4WF2A 4ENNA 1FBUA 2KIUA 5H20A 4DIQA 4BACA 1RUOA 4HPQA 1ZREA 2JA8J 2M8EA 3FXMA 1Q1VA 2IBDA 2BHYA 3HG9A 4ESJA 2NOGA 1IAWA 5M3MJ 4BNCA 3E5UA 2JUGA 3E5XA 3BPVA 1IN8A 5F1RA 1VQ4I 1V5FA 1FP2A 2JPCA 3JRCA 5HDNA 3N4MA 3BLYA 4R8HA 4X1EA 1N75A 1B72B 4L0YB 4AIKA 3HGYA 4S05A 2EIMH 2YSRA 3M7GA 3WGIA 2FA5A 5HDGA 1KQ8A 4ZYAA 4LOCA 2IA1A 2P81A 4IHVA 2JSPA 3EPZA 2XROA 3HTSB 3ZGKA 3OYMA 3WG7H 4DYRA 1Z21A 1YIJI 1B8IA 3GTJJ 4DYQA 3BP8A 1SANA 4OOIA 4PJJA 1FIAA 2XAUA 2L7KA 3GTMJ 2IAIA 2E2JJ 1WH5A 2FUG2 2PJRA 1HA8A 2FSWA 3LMMA 2GM4A 2LOOA 3C18A 2AQEA 1SVOA 2HOTA 4XMYA 4RS8A 1TQMA 5GPCA 3RZDJ 3A01A 1HF0A 2HXIA 1O4XA 1QQIA 4M9XA 2DU9A 1PUFB 5D5VB 4B8XA 1D5VA 2BE5F 5FKOA 4DGWB 4CGZA 5D5XB 2DFEA 1YG2A 1R58A 4CUGA 4UVAA 5LRRA 4BHPA 1VQPI 4NQWB 4HLYA 2VQLA 1ON2A 3HOYJ 3ZMVA 4C2TA 2RAEA 1JT0A 3AAFA 2MABA 3S14J 3DKXA 2PLYA 3FIWA 4RB2C 5GAHJ 4ENJA 1I3QJ 2I10A 3CF5F 5EGOA 1ZG3A 2EIKH 3GCMA 3BG6A 2LTPA 2DQRA 2GIVA 1QHGA 1E3PA 1XMAA 1W7PD 2EV5A 4W97A 3ZMDA 2XAHA 4Q4ZF 3WTUC 2D5VA 2VJ5A 3C1DA 1TW3A 4F55A 4ZH4F 3CCMI 3CCJI 4E7ZA 1YIOA 3W2VA 1MBJA 2A6EF 3DEUA 2A07F 5GP9A 2PMHA 2J5PA 1J2XA 4ZDLA 4MEXF 4HF1A 3QODA 1BIAA 1R00A 5KNLA 2STWA 1G2HA 3ZQGA 3Q0UA 4PSXA 3S15J 4BS9A 1RKTA 1PP8F 1P4XA 1QZZA 2P4WA 4NBQA 2C6YA 4P1WA 1R49A 1O7FA 1UCRA 4BHBA 4BYYA 2XGEA 2FBHA 3HKZA 3MKLA 4L5EA 5J47A 4RDUA 1VQOI 1R7JA 2WY7Q 2G7UA 4HW0A 5IPAA 2LY2A 1T8IA 2LSOA 1C0WA 2XAQA 3KPHA 3DEEA 3K4CA 3K1PA 4KIBA 2QQ8A 2VN2A 3GFJA 4M71A 2Q1ZB 5CQEA 1K78B 3HSRA 3CD6I 3QQAA 1W5TA 3H92A 2AS5F 1XDSA 3ERED 1HLVA 1A6QA 2ME0A 1T08B 2R5ZA 2HVQA 2HWVA 2Q2EB 2Z3YA 5LBQA 2F5FA 3ZQ7A 3GF2A 1PJRA 1EV7A 2ZCWA 3JCUC 1D5YA 5L3BA 2DOFA 2LNBA 3VYTB 1N25A 5LHIA 2Z9OA 3FBIB 3NWSA 2V9PA 3CMYA 4A3LJ 1VQLI 1G3TA 5J1RA 1BM9A 3H3ZA
chains in the Genus database with same CATH topology
2RNGA 3H9JA 2Z2SB 3D5RC 3H9GA 3OYAA 2W82A 2X1CA 4HSRA 4IKFA 2L9NA 3S32A 2PMZA 1WJCA 1D1CA 1WFXA 4XLCA 2MD0A 2R7SA 3ZQQA 1UG0A 3OL3A 1S9HA 1OLTA 2ZXIA 4ZDPA 2CH0A 3G2BA 4JQFA 3DWLE 4E7HA 3V42A 4XLAA 2RQQA 1Y56A 2LY1A 5FRMA 3AFHA 1EA3A 2KLOA 4II3A 3VYUB 4GRIA 4NNJA 2M0MA 3HOTA 4NC7A 2R4GA 4XQFA 1T0FC 2JVHA 4QPQA 3CZ6A 3OL4A 3W3CA 3MKWB 2KPMA 2JVGA 3M8JA 3OYKA 4ZC3A 1G8XA 2W4SA 2IGOA 4RLQA 2XDVA 2K3PA 2VQHA 4ANJA 1SFKA 1FMWA 4XN3A 1MMDA 1T95A 4H4KC 3RCOA 2VPLA 4E7IA 2BOLA 2I8DA 2VLAA 3C2GA 2K9LA 2VJJA 2XF5A 4AU7A 3PNYA 4AVZA 2A5WA 4XM3A 2F5VA 3L2WA 2R7UA 1G59A 1LDKB 2CV0A 3DPUA 2BW3B 2K9MA 1MMAA 2DXIA 2LREA 1V5GA 1WJDA 3DLAA 3HPGA 3H0DA 4C2UA 4P5OA 4QPOA 2DJIA 4II2A 4NC8A 1W36D 4BE2A 2HPIA 4KISA 1D1BA 4YRVA 2M4KA 4RLFA 1Z3YA 4E7SA 4XN0A 3OS0A 2X1DA 3W2WA 4DBQA 3C2HA 2ZXHA 1DGWY 4F52A 3SEQA 1DQUA 3SDBA 4LG3A 1BR1A 3EUKL 4E7LA 2KRHA 4PSWA 4KT6A 4BJ6C 5HNFA 2LC2A 2O5RA 1WJEA 2KRCA 3K4JA 3KX2A 4XKWA 2M3AA 4HSTA 4XL9A 2F4IA 3AL0C 4XOTA 4DJAA 3TL4X 3K70D 1GLNA 3MMYB 3OYJA 1V5EA 3H5RA 2DCEA 2X6YA 2L2OA 3OIQA 3ZR8X 4LIUA 2IGNA 4MLOA 3SEZA 2V9KA 4F3QA 5TGTA 3DPTA 3OOUA 4PK4A 3L2RA 4EATA 3SZGA 2V7FA 2JA2A 3OIPA 3PJRA 3PFYA 1YX3A 2V4JC 2KZVA 4C30A 3UNGC 1AA7A 4HEA2 4XORA 4BEHB 4BGDA 5CKTA 4DBRA 3S3MA 2VB6A 2VKHA 1BR2A 4BE0A 5KCMA 4RM3A 2MC4A 4IX7A 2QKLB 4XKVA 2VXZA 3DTIA 4RMNA 2P0WA 3F9KA 3TBIA 4XLFA 1P9QC 2HZDA 2XF6A 3OS1A 4B3XA 3LSHA 3DTEA 1E0EA 2CS3A 3VSKA 4BJTA 3VWBA 1X1CA 2IXSA 3QYFA 3DKYA 3KYLA 2X6XA 2ZSIB 4R79A 3CJQB 4RM2A 1Z7LA 1FMVA 2ZSHB 3FKJA 1TT0A 3RQ4A 3TMOA 1WJFA 1LFPA 2IS1A 2MYSA 4XKBA 3RSNA 2R7QA 4X0GA 3CF2A 2R7WA 1UAAA 3A1YA 2V6EA 3IP4B 1ZELA 2E5NA 3UR3C 2UUZA 2X1EA 4FETA 4CCOA 4BQNA 4F93B 2BVMA 3FHNA 3AKZA 3A4CA 3IAS2 3LSKA 1YX5A 4XONA 2E60A 5FROA 1Y6IA 2LRDA 1PYVA 4IZZA 1MNDA 2M4GA 3OR2C 4CH7A 3OS2A 3OYHA 1BOBA 2E1MC 2HU9A 4B43A 2KHMA 3HXLA 2F6CA 3K4LA 2NOJB 2VIXA 5CPRB 4JOMA 2Y0SA 3W2AA 1MNEA 2VASA 1X1BA 4BEHA 4U7BA 4ZTJA 1X4PA 4E7KA 3LL7A 3H9QA 2W7NA 2WAFA 2OV7A 4N4NB 2OUMA 3VYRB 3K4MA 2ELJA 3HOSA 3MKZA 2X51A 3DPLC 4PJNA 2DOAA 2IS6A 3VYSB 2HNHA 2V1NA 3E0JB 3OR1C 3OYBA 3RPUD 4B47A 2WAQA 2CV2A 3S8PA 4BU2A 3A2KA 5LFAA 4HG2A 3CP2A 3K4BA 3MD2A 1WJBA 4G6TB 2VXDA 2XC7A 1U0JA 4B48A 4YEJA 1Z3XA 3RTRA 1JI8A 4D9JA 3IUOA 3BC8A 3U21A 1X19A 2VQCA 4LITA 2IS4A 3HUGB 4ZDOA 2Z16A 2CFOA 3NWTA 2X6WA 3S93A 3D5LA 2W00A 1QU3A 4BDYA 3DQVC 3OYGA 2E5ZA 1LVKA 4FASD 2DT6A 3LSIA 4D1QA 3QYBA 3SYTA 3K4NA 3OMYA 4CCNA 4XOPA 2VQGA 2HPMA 1DGRM 2LH9A 2HDWA 4ZJZA 1X4OA 2XF7A 5LD2C 5KHDA 4BL0B 3BCBA 1X1AA 3PNTA 1WJAA 4PUSA 3ZXSA 3S3OA 4BE1A 3L2QA 2KL4A 1MMNA 4NUBA 2K5CA 4CCLA 2W1OA 4YELA 4HRIA 3DU6A 4IQJA 3H35A 4Y3OA 2LG4A 4BJ5C 4Y4RA 1VZ0A 3HPHA 4CA0A 4E6KG 4BXFA 5HOOA 3DU5A 2IGMA 2LBFB 1N78A 1ERDA 4XLEA 2L5QA 3BG7A 3IAM2 3I3LA 3PL8A 1R6RA 4DIQA 4BACA 2BVLA 4HPQA 4XNFA 2VJIA 3HG9A 4CCJA 2CUJA 3CESA 3ZCOA 3OWTA 1WJ5A 5HNHA 1D1AA 4LIVA 2JUGA 4KJZA 2L9SA 1N77A 2WBMA 5FRNA 2X85A 3K10A 1V5FA 2IGKA 3VDXA 2UWMA 2M7BA 2WB1A 3BLYA 1N75A 2CMPA 2XSJC 3K6GA 4PFOA 3HC7A 3ZRGA 3AL0B 4U87A 4ZYAA 1BR4A 4BQQA 2QKMB 3H5NA 3LSGA 2WY8Q 3EPZA 2JSPA 5CQGA 1QHHD 3ZGKA 1D0YA 3E1SA 4B44A 2A6TA 3BCAA 3OYMA 1Z21A 2LYCA 2GOMA 3K4KA 2AQFA 4XKCA 2CW8A 4PJJA 2XAUA 3OYFA 2L7KA 3N05A 2R7XA 2FUG2 4PJMA 2PJRA 1HA8A 3LMMA 2LOOA 2AQEA 4XMYA 3VSLA 2R7RA 3EUHC 3PSIA 3ONQA 2HQAA 4PFPA 4F91B 4J01A 1W36C 3L2VA 1MW7A 4N4OB 4PJLA 4DGWB 4Y33A 2LBFA 3EUAA 3PUBA 4OAYA 4IQ4A 1NG6A 1OR7C 4CCKA 3QOEA 3OYEA 3GBGA 4CUGA 4NQWB 1D0ZA 3M1CA 2HVSA 2VQLA 3H5AA 3PSFA 4OAZA 5HLTA 3FDYA 2WAEA 2RREA 4AYBA 4C2TA 5HVQC 2MABA 3DKXA 4ZTFA 3QYEA 2CV1A 3OYNA 1TZLA 3K70C 3CMMA 3OYDA 3PNVA 2MFZA 3BG6A 4E4HA 1QHGA 3D5SC 2HVRA 1DP3A 3OYCA 4DOZA 2VJ5A 3FBNB 4XLHA 4F55A 3DTKA 4E7ZA 3W2VA 2VKDA 4BUPA 1IRXA 3L2UA 4ZDLA 3QODA 5KNLA 2DT7B 3LSMA 4E7JA 2WA0A 4BQOA 4CSWA 4BDZA 1KONA 2OC6A 4PSXA 1D0XA 4BS9A 2E1MB 3OY9A 4HNUA 1SAUA 4F92B 4KITB 3S3NA 1NG7A 2PJRB 4P1WA 2KMUA 3J7AY 2GOXB 3MKYB 3HKZA 1UELB 5JHFA 2Z1DA 4OWRB 2WY7Q 2VJ4A 2R7TA 2LY2A 3OYIA 3DEEA 3K4CA 3CP8A 3KEYA 2ZFUA 1J09A 3LFUA 4CCMA 2Q1ZB 5CQEA 4J00A 2M7AA 4C9YA 1K6YA 1MMGA 2VL8A 2KDOA 3CJRB 2V26A 2R7VA 2WADA 2HVQA 1YE9A 4XR6A 2Q2EB 2UV1A 2IS2A 4HNTA 3I9V2 1PJRA 2CUZA 4CZCA 2KQRA 3OYLA 2KP6A 1X1DA 2BW3A 2R7OA 3VYTB 2CW7A 3FBIB 3NWSA 4ITVA 3HL2A 1LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4O A;  2DT7 B;  2E5Z A;  1X4P A;  4DGW B;  2DT6 A;  2E60 A;  1UG0 A; 
#chains in the Genus database with same CATH topology
 2B0L A;  2RNG A;  5CVR A;  5ILV A;  5EZH A;  4A5N A;  2XKO A;  4YG2 F;  2JK3 A;  4C2M J;  2BY1 A;  5K5O A;  2VE9 A;  2X48 A;  2PMZ A;  1K6O A;  3WE3 A;  3ZQC A;  4GDF A;  3BZK A;  1UG0 A;  3OL3 A;  1S9H A;  4JYK A;  2VBW A;  3KZI C;  2ZXI A;  3ZMU A;  4RGU A;  4JQF A;  4E7H A;  2H1L A;  4Z2Y A;  3U1D A;  4XLA A;  5BPI A;  3RZO J;  5IP6 A;  2RQQ A;  1KGS A;  2OQG A;  1Y56 A;  2MH9 A;  1EA3 A;  1XD7 A;  2KLO A;  3E5Q A;  2YR2 A;  3VYU B;  1H9T A;  3ZMT A;  2K85 A;  1JHF A;  2M0M A;  2M87 A;  5IP9 J;  4A3J J;  4XQF A;  1T0F C;  3BJ6 A;  1IXC A;  1MMS A;  2HOE A;  4IOA F;  4CYC A;  4L0Z B;  2KPM A;  3M8J A;  2ZXJ A;  1IUF A;  2CO5 A;  3HOX J;  1G8X A;  2W4S A;  2L9R A;  5J1Y A;  1I6H J;  1X1P A;  2K3P A;  1K78 A;  4BHC A;  2DMP A;  4ANJ A;  1SFK A;  5E3L A;  3WGG A;  3KIO A;  1FMW A;  3DEW A;  4GGG A;  1AOY A;  1R23 A;  3NQO A;  2NS7 A;  5B1B H;  2BOL A;  2Z99 A;  4E7I A;  1W5C C;  3C2G A;  2EA4 A;  3DKW A;  3IH2 A;  4M9Z A;  5FKN A;  2XF5 A;  4AU7 A;  1XGN A;  4HOB A;  4D0P A;  1A31 A;  2RC4 A;  2CYY A;  5DYM A;  2Q2E A;  3S16 J;  3L2W A;  2CGP A;  3WTW C;  2RKH A;  5DUK A;  4AM3 A;  1G59 A;  4CHU A;  1LDK B;  2WV0 A;  4L9T A;  3ERM A;  3IWF A;  2A61 A;  2ZC2 A;  1VQ6 I;  3HGG A;  2DMT A;  2ZKZ A;  2BW3 B;  2K9M A;  2QLZ A;  2PJP A;  1XN7 A;  4A3E J;  4I76 A;  1V5G A;  1STZ A;  1F5T A;  3LAJ A;  1IV8 A;  3LFK A;  2EK5 A;  4P5O A;  4II2 A;  3TQN A;  5E20 A;  2EFW A;  1BJA A;  2CUF A;  4UHT A;  1W1W E;  1Z3Y A;  1OYW A;  1RR8 C;  4E7S A;  3F3X A;  4XN0 A;  5IT9 K;  3OS0 A;  2LFB A;  1LVA A;  3P7N A;  3O8G A;  3SEQ A;  3JTH A;  3K0L A;  2X4H A;  4V2G A;  4UUS B;  1ZRC A;  1DQU A;  3CUQ A;  3KYC B;  5D4R A;  1BR1 A;  2L54 A;  4E7L A;  4L9V A;  4C3H J;  2QSF X;  3T8R A;  3JRH A;  5HNF A;  2ME6 A;  2LC2 A;  1F4K A;  2XAJ A;  1ZRF A;  1A5J A;  2KRC A;  5BOX A;  1OPC A;  4HST A;  5EEG A;  2GQQ A;  4S04 A;  1AKH B;  4LGW A;  2ADU A;  1P4A A;  2IA0 A;  3F8C A;  3IH4 A;  5C3E J;  5EDN A;  5C4J J;  1R4N B;  1V5E A;  3JSO A;  3G1O A;  2CQ7 A;  3OIQ A;  1BA5 A;  4LIU A;  4F3Q A;  5IT3 A;  5JLX A;  1MSF C;  5TGT A;  3CME I;  3RKW A;  3DCF A;  3E3V A;  3OOU A;  5EYR A;  5K5Q A;  3Q0W A;  1IN5 A;  4EAT A;  2V7F A;  2JA2 A;  4DQ2 A;  4BXX J;  5F0H A;  2KZV A;  4CO8 A;  3IHU A;  4C30 A;  1AA7 A;  2TCT A;  4HEA 2;  3LQQ A;  3RYR A;  3ASO H;  5JFR A;  1VF9 A;  3S3M A;  2JA5 J;  1IRZ A;  2BZT A;  2EZH A;  5EF6 A;  2BYV E;  4KDP A;  3VOE A;  2DA5 A;  4A3G J;  2VXZ A;  2QBY A;  2DAO A;  1G6N A;  2FRH A;  3F9K A;  4XLF A;  1S7O A;  4A6D A;  5CYV A;  3OS1 A;  1VQ5 I;  2XHK A;  1Z6T A;  4IHW A;  3TW7 A;  4BJT A;  3RDI A;  1X1C A;  1FSH A;  4EV0 A;  4R79 A;  4WCG A;  3KLN A;  3WTT C;  4UUS A;  4HQM A;  2ZSH B;  1D8J A;  5FFZ A;  5JHU A;  1KU9 A;  4MGR A;  1ACI A;  2HXO A;  1KA8 A;  2EZL A;  4Z6Y A;  1IGN A;  3CF2 A;  3V8L A;  2ZJP F;  2V6E A;  3S1N J;  3GVA A;  4EM1 A;  1IJW C;  2X1E A;  2G0E A;  5KVR A;  2IPQ X;  3FHN A;  4XSZ F;  4XON A;  1ZN2 A;  4JX5 A;  4A12 A;  4DYC A;  5FO5 A;  4QIW N;  3CC4 I;  4HX8 A;  2E1M C;  2HU9 A;  3S1R J;  4M3E A;  2E7X A;  1Z6R A;  1AU7 A;  5CVV A;  2F6C A;  1I6X A;  4HZF A;  2VIX A;  4LK0 F;  1RNL A;  2Y0S A;  5DEQ A;  3W2A A;  5M5W J;  3L00 A;  3QU3 A;  4U7B A;  3CCS I;  5M5X J;  1PUE E;  4D7M A;  3GLL A;  1SMY F;  3LL7 A;  2W7N A;  2XVC A;  1O3S A;  4N4N B;  1WH7 A;  4BBS J;  4X6A J;  3IL2 A;  4LLG F;  2B7E A;  3MKZ A;  2LMD A;  2X51 A;  1WPK A;  4I2O A;  3VYS B;  1GV2 A;  2AXT C;  3OOP A;  3N97 A;  3J7Y J;  4BY7 J;  4FTH A;  3L1P A;  3WOD F;  2CV2 A;  1USS A;  3S8P A;  4BU2 A;  4A3I J;  2EIL H;  3ZPL A;  5DS9 A;  3HB9 A;  4O6J A;  4EMS A;  3MQ0 A;  3OSG A;  2ELK A;  2XC7 A;  4A3C J;  2XAF A;  4EJV A;  2DK8 A;  2GZW A;  2QVO A;  2XV4 S;  3RI4 A;  3H3V K;  3HUG B;  2GAU A;  3R0A A;  1PVE A;  2Z16 A;  1IRF A;  3JRA A;  2PFB A;  2QUF A;  2X6W A;  3LSP A;  3DBL B;  2L4A A;  2LR8 A;  2W00 A;  1QU3 A;  1WGX A;  1KZH A;  3DQV C;  5IOY A;  3OYG A;  3S2H J;  4D1Q A;  3K4N A;  4CCN A;  2PMU A;  4XOP A;  5GAG J;  1VQ9 I;  3GWZ A;  2ETH A;  5FD6 A;  1DGR M;  2ELH A;  4WXC A;  3RYP A;  1SEU A;  3GTK J;  5KHD A;  2OCE A;  2VI6 A;  1WJA A;  3WU2 C;  3ZXS A;  1MJA A;  1T98 A;  3IH3 A;  3S3O A;  4MO7 A;  2KL4 A;  3F6O A;  3GZ5 A;  3GTP J;  3J7Z I;  4IQJ A;  2NS8 A;  3H3U A;  1Z05 A;  5J6X A;  1JGS A;  4LLL A;  4HV6 A;  3DU5 A;  2LBF B;  4IVN A;  3IAM 2;  4Q48 A;  1EH8 A;  1SFU A;  4XNF A;  2F4M B;  1Y39 A;  2AO9 A;  2DQL A;  5CVU A;  3JRG A;  2OTJ I;  4XSX F;  3ZCO A;  1WJ5 A;  2LKP A;  1G3W A;  4HX7 A;  4LIV A;  2GIZ A;  3F8M A;  3E6D A;  2BV6 A;  3EQL F;  4PJ0 C;  2L9S A;  4V2F A;  1N77 A;  2WBM A;  4D5C A;  3K10 A;  1K4S A;  2V1U A;  2VKE A;  4I98 B;  5BQT A;  2F48 A;  1LDD A;  3BZ6 A;  5F1J A;  1UMQ A;  4M3D A;  3BR3 A;  3FX3 A;  4HNV A;  1ETO A;  1T0F A;  4RAY A;  5JVG F;  3HOZ J;  3PFI A;  3ZRG A;  4B1R A;  4U87 A;  4DZP A;  5IYC J;  1UJ8 A;  3H5N A;  3LSG A;  2WY8 Q;  2EV0 A;  4GXO A;  3WHB A;  1QHH D;  2JMW A;  3K69 A;  2RDP A;  4A6E A;  4G94 A;  1D0Y A;  3E1S A;  3BCA A;  3L9F A;  1DP7 P;  2GOM A;  4LB6 B;  3K4K A;  3K9T A;  4A3M J;  4XKC A;  1EF4 A;  3OV8 A;  3Q0V A;  2R7X A;  2DMQ A;  1BOA A;  4CDG A;  2DLL A;  1HC8 A;  2VKV A;  3VSL A;  5M5Y J;  2E1O A;  4HLX A;  4BXU A;  3PSI A;  2DTZ A;  2HQA A;  4PFP A;  1YHQ I;  4PJL A;  2O3F A;  4Y33 A;  2LBF A;  2LK2 A;  1HKT A;  5D4S A;  3BR6 A;  3P5J A;  4IQ4 A;  1YLF A;  1DDN A;  1XMX A;  3LSJ A;  1X2N A;  1R4M B;  3L09 A;  4RB0 A;  3QU6 A;  2XB0 X;  1T33 A;  2XIG A;  2YX4 A;  2HVS A;  5HLT A;  5L3E A;  3B6A A;  3KP2 A;  2WAE A;  3CDL A;  1JUS A;  2EIN H;  2MH2 A;  5GAE J;  5CJ9 A;  2LLK A;  3WTZ A;  1WI3 A;  1ZGA A;  1ULY A;  4ENM A;  1Y0U A;  1R22 A;  2E1N A;  2CV1 A;  3OYN A;  1TZL A;  2PN6 A;  2K02 A;  3WTY C;  3CCL I;  3E6M A;  3TW6 A;  2P5L C;  4HF0 A;  1S8N A;  3RKQ A;  1RC9 A;  2HTJ A;  4LLN A;  1YQA A;  3JRD A;  3FXO A;  1DP3 A;  3P9K A;  4XLH A;  4AC0 A;  2D2W A;  3P9C A;  3WU0 A;  1KQ0 A;  2COB A;  4B4C A;  1NTC A;  5J8F A;  1OMI A;  5LEK A;  3CDI A;  1IRX A;  5HS7 A;  5B1A H;  1BI3 A;  5FKK A;  6PAX A;  2DT7 B;  1QZY A;  3U9G A;  3HSF A;  4E7J A;  4CSW A;  4LD5 A;  2I5U A;  4BQO A;  4BDZ A;  1D0X A;  3AG3 H;  1B8I B;  1FOK A;  4UUV A;  2E1M B;  3CUQ C;  2EIJ H;  1SAU A;  4CZZ A;  1TQP A;  2PJR B;  4R1H A;  4P55 A;  1W7P B;  2L01 A;  1FOX A;  5A2Q K;  2MGQ A;  3BWG A;  4OWR B;  2OA4 A;  4O3M A;  3OIO A;  2VJ4 A;  2H1K A;  2R7T A;  1QGP A;  2JTV A;  1OKR A;  2V79 A;  4FQG A;  3I64 A;  3MCZ A;  3BJO A;  3OYI A;  2ZFU A;  1U8B A;  1Y8R B;  3BTI A;  2IJL A;  4J00 A;  4C9Y A;  2J5O A;  1JKO C;  2BY2 A;  2DMU A;  3V7C A;  3KP6 A;  1ZTR A;  2R7V A;  2WAD A;  4GCV A;  1T39 A;  3IRQ A;  3I9V 2;  2FMY A;  4ESB A;  4CZC A;  3OYL A;  1E2X A;  2EA2 A;  4ZZD A;  1FJL A;  2EB7 A;  5EGO B;  3HL2 A;  3HYI A;  3M8E A;  3L7W A;  4XRS G;  5IYB J;  4IPA A;  5LHH A;  4IOC F;  2Z2S B;  5LGT A;  2WV1 A;  3BY6 A;  3H9G A;  3ABL H;  2Z5U A;  2OU2 A;  4IKF A;  4BH9 A;  2L9N A;  3S32 A;  5K1Y A;  2KJB A;  3F72 A;  1WFX A;  2MD0 A;  1BI2 A;  3R0J A;  2DYS H;  4KN4 X;  5F64 A;  1ZG1 A;  3FXQ A;  4ZDP A;  4UVC A;  3PIP F;  3AG4 H;  4EM0 B;  3I71 A;  4WWC A;  2CQQ A;  3O3K A;  2F5C A;  1DPR A;  9ANT A;  3G73 A;  4MFD A;  1Z91 A;  3M9A A;  2M45 A;  2LY1 A;  1IUY A;  2DBB A;  3ABM H;  4XLP F;  4II3 A;  3BG9 A;  3QPH A;  1DU6 A;  4GRI A;  1W7P A;  3EUH A;  1VQ7 I;  2KIF A;  3S1M J;  2MD5 A;  4UV9 A;  3I56 I;  3S17 J;  4OMY A;  1J0R A;  3PQK A;  3W3C A;  4MTD A;  3MKW B;  2JVG A;  1I39 A;  3HHG A;  4P9U A;  3R61 A;  4ZC3 A;  4ABZ A;  1D8K A;  1OQY A;  5L3D A;  3U2R A;  4UVB A;  1K61 A;  4EEF G;  1QNT A;  2FBI A;  2I8D A;  3LA7 A;  3HHH A;  3MVP A;  3E6B A;  5A2Q Z;  1REP C;  3ELK A;  4XM3 A;  2R5Z B;  1ETY A;  2D1V A;  3GME A;  2A6H F;  1GXQ A;  3Q9S A;  5J4V A;  2OQR A;  2L0K A;  3QOP A;  4MQ9 F;  4UY8 I;  1J9I A;  1ETQ A;  4L9N A;  3DPU A;  4DNC A;  4I02 A;  3HDD A;  2ZJR F;  1F36 A;  1LJ9 A;  1TQI A;  2FXA A;  2LRE A;  3RKX A;  1V3F A;  5FKL A;  2QM3 A;  2RN7 A;  2OAZ A;  3DLA A;  2HDD A;  2OJE D;  3HPG A;  1ITY A;  4W1U A;  4QPO A;  2ECB A;  1TNT A;  1ZYR F;  1A6I A;  3H36 A;  5F04 A;  4BBR J;  4KIS A;  3JR9 A;  4YRV A;  3ECH A;  1ON1 A;  5KAF C;  2DPD A;  4WXD A;  4D7N A;  4U0Y A;  3W2W A;  1HSJ A;  2MC3 A;  3KFW X;  2GXG A;  1FYK A;  3I4N J;  3I53 A;  4L5J A;  4LG3 A;  1BJZ A;  2HI3 A;  3EUK L;  2VUM J;  3VB2 A;  4BJ6 C;  3ROU A;  2DFH A;  1RRJ A;  2V1X A;  2L7F P;  2RGV A;  5DM6 F;  1X3Z B;  2DN0 A;  4EJO A;  4U0V A;  3KX2 A;  3JRF A;  3EET A;  3FXU A;  1K83 J;  1GLN A;  3MMY B;  1ZK8 A;  2E71 A;  2EJR A;  4CYC B;  3GTL J;  1ODD A;  1MBG A;  1QPI A;  4EM2 A;  2IGN A;  1RKW A;  3HEF A;  1H0M A;  2FOK A;  1VQK I;  1I50 J;  2ISY A;  1FEX A;  2D1H A;  2EWN A;  1W0T A;  2ZNY A;  4NB5 A;  3ZMS A;  2JA7 J;  4IEJ A;  2X0L A;  2WC2 A;  2VOD A;  2LP0 A;  2ZBK A;  4BEH B;  4UNO A;  1FTZ A;  4DBR A;  2W84 A;  3ULQ B;  2VKH A;  5KCM A;  2MC4 A;  2X9D A;  3FXL A;  2K40 A;  2IVM A;  2A05 A;  2HGC A;  2YPR A;  3GLX A;  4XKV A;  1A04 A;  4RMN A;  2P0W A;  3HZJ A;  3TBI A;  3R6S A;  1P9Q C;  3J81 K;  4U7D A;  3F8N A;  2WAQ N;  2XF6 A;  1KU7 A;  1U2W A;  1E0E A;  2HKO A;  3L2C A;  1SC7 A;  1R36 A;  1P92 A;  3GTQ J;  2X6X A;  2ZSI B;  1J59 A;  1VI0 A;  4TV7 A;  3FKJ A;  3TMO A;  1XS9 A;  5F0C A;  2VPR A;  1IF1 A;  2IS1 A;  3SJM A;  2IRF G;  4XKB A;  3CUQ B;  1YRN B;  3QPS A;  2R0Q C;  2DA4 A;  3CO6 C;  4A5M A;  4Y52 J;  2V9V A;  3LA3 A;  2R7W A;  1Y8Q B;  1U78 A;  3A1Y A;  2JPB A;  3A0H C;  1ZEL A;  2E5N A;  3UR3 C;  4RB1 A;  4CCO A;  4BQN A;  1W5S A;  2IW5 A;  5K5R A;  2FML A;  1W4M A;  3BG5 A;  4XRF A;  2LY9 A;  4MNU A;  3SZT A;  5BMZ A;  5GTH C;  2CFX A;  1PYV A;  4IZZ A;  2VON A;  2M4G A;  3LAP A;  2CG4 A;  1B6A A;  1RI7 A;  2Y0M A;  3JRB A;  1UHW A;  1TWC J;  4N9I A;  1S3J A;  1J75 A;  5ILU A;  5E8G A;  1CF7 A;  1Y1W J;  2R92 J;  4I01 A;  3F6V A;  1U8R A;  2OF7 A;  5CPR B;  3ECO A;  5F6F A;  5ICG A;  3HKZ N;  2DA2 A;  5LRS A;  4ESF A;  4BEH A;  1L0O C;  5ED4 A;  1IXS B;  4O5V A;  1MBF A;  2WAF A;  2OV7 A;  2DMN A;  2HQN A;  2Y75 A;  3GTO J;  1ZR4 A;  2OUM A;  1GT0 C;  4IRG A;  3VYR B;  1SD7 A;  4IXA A;  2QGU A;  4EJU A;  4LJZ F;  1X3W B;  2HS5 A;  3DBR B;  4GYI A;  4PJN A;  1FLI A;  2DOA A;  3QWL A;  4JBA A;  2QBY B;  2A69 F;  3WGH A;  2V1N A;  3F22 A;  2P6T A;  2DW4 A;  3GFI A;  3FK7 A;  2R7Z J;  3I59 A;  5LFA A;  5J40 A;  1JKR C;  1MIJ A;  3MZH A;  3PO2 J;  1MSE C;  3DV8 A;  1A35 A;  4G6T B;  2F2E A;  3F23 A;  1I1S A;  1ZAO A;  1ZLJ A;  5BNG A;  1U0J A;  2ZXW H;  4YEJ A;  1Z3X A;  1JI8 A;  1B59 A;  4D9J A;  4OMZ A;  5GTI C;  1XGM A;  2Y9Z A;  2EFO A;  3QAH A;  3J81 Z;  1YRN A;  1IN7 A;  3LQR A;  4HQE A;  3BC8 A;  1IV6 A;  1V4R A;  1X19 A;  4LIT A;  2BXY A;  3I54 A;  3NWT A;  2VE8 A;  3ZP5 A;  5CVJ A;  3D5L A;  4FHT A;  4FX4 A;  4BDY A;  2PMZ N;  1XC5 A;  3EDP A;  1CGP A;  1OCO H;  1WQ2 A;  2DT6 A;  2ZNZ A;  3IC7 A;  2W85 A;  3BQY A;  1LPQ A;  4YFK F;  3OMY A;  1H9G A;  3F8B A;  3GYH X;  3ZN0 A;  2M1B A;  1LFU P;  2LH9 A;  2HDW A;  4ZJZ A;  1X4O A;  1LB2 A;  5LD2 C;  3GZ6 A;  2HZT A;  2ZO4 A;  5DDG A;  4P96 A;  4M6Y A;  4NUB A;  4A0Z A;  2HQR A;  2W1O A;  3Q3S A;  4CCL A;  4KNY A;  4BJ5 C;  4FE7 A;  2D45 A;  3WG9 A;  3CDH A;  1R9T J;  1O3R A;  2DYR H;  3U1K A;  1N78 A;  4BXF A;  4XLE A;  5KAI C;  4ETS A;  3PL8 A;  1TWH J;  2JT1 A;  3DBH B;  2BVL A;  5HLH A;  2EZI A;  2IT0 A;  2VJI A;  5LEJ A;  4HYE A;  4GO1 A;  5JR3 A;  1BI1 A;  1TBX A;  2CUJ A;  4XRM A;  1SD4 A;  3OWT A;  1LEA A;  5HNH A;  2H6B A;  3KEO A;  3HSE A;  1X2M A;  2DA7 A;  3SFI A;  3TKY A;  4PDK A;  1ETX A;  2DI3 A;  2Y69 H;  1AWC A;  1KQ9 A;  2M2E A;  2M30 A;  2OPT A;  2X85 A;  3KP4 A;  2IGK A;  3J80 K;  5DD4 A;  1LEB A;  2K27 A;  1RZ4 A;  3BZC A;  3VDX A;  1IDZ A;  5E3M A;  3PUF A;  1V55 H;  1FP1 D;  2WB1 A;  2KRF A;  2CMP A;  4KIC A;  3K1N A;  1F9N A;  4BY1 J;  2DA1 A;  4PFO A;  3K6G A;  4Y15 A;  3CO7 C;  4UXN A;  4IO9 F;  1Q1H A;  2L7Z A;  2JUC A;  4BQQ A;  2Y30 A;  2QKM B;  5J3L A;  3G3Z A;  1FYM A;  2QEX I;  1JTX A;  1A36 A;  4J19 A;  4V19 K;  4HV5 A;  3AG2 H;  5CQG A;  1IC8 A;  5IYD J;  4B44 A;  2A6T A;  2LYC A;  2ZJQ F;  2EQR A;  4Y7N J;  2AQF A;  2Y9Y A;  2H09 A;  3OYF A;  3M4O J;  1G3S A;  5LLQ A;  3V4G A;  4PJM A;  2H6C A;  3G4S I;  5HLI A;  1BIB A;  1SFX A;  1P7J A;  2CSO A;  2R7R A;  3EUH C;  4F91 B;  1HDD C;  4J01 A;  3SZP A;  5HS9 A;  2ID6 A;  4IJA A;  3EUA A;  3PUB A;  1TWF J;  2P7V B;  2JSC A;  4CCK A;  1NG6 A;  3QOE A;  2A3S A;  2BBY A;  4BKX A;  2G7H A;  3ASN H;  4G9Y A;  3KET A;  3COA C;  1D0Z A;  5IP7 J;  1GV5 A;  3KCC A;  3H5A A;  4M3F A;  1M1E B;  3FDY A;  3JTG A;  4FX0 A;  2RRE A;  4AYB A;  3BG3 A;  2NVT J;  2CU7 A;  3VOD A;  2FF4 A;  4ZTF A;  3GTG J;  3ZN1 A;  2B9S A;  1O7L A;  1B1B A;  2JRM A;  2OTL I;  2MFZ A;  2XPV A;  4E4H A;  3O2P E;  5D5U B;  1PP7 U;  1XTA A;  2K86 A;  3D5S C;  5DD8 A;  4G7H F;  3FZV A;  2KIQ A;  2YU3 A;  1NK2 P;  4DOZ A;  3FBN B;  4OIP F;  3TO7 A;  4M9S A;  4L9J A;  2FD5 A;  1GVJ A;  1Y1V J;  4BUP A;  2HEO A;  3J80 Z;  3L2U A;  1XX5 A;  3A0B C;  5E3N A;  1H89 C;  3KLO A;  3BDD A;  4E70 A;  2JRT A;  5E18 F;  4OIO F;  2WA0 A;  1R5H A;  3AG1 H;  1KON A;  1IRG A;  4RA2 A;  3GFM A;  5E1W A;  4HNU A;  3OY9 A;  3ZOB A;  1JUP A;  2YU9 J;  1SD6 A;  2FOW A;  1FY7 A;  4F92 B;  2GA1 A;  5L3F A;  3S3N A;  1NG7 A;  4AIJ A;  3ABK H;  3TDZ C;  2GOX B;  3G6E I;  1JUM A;  2Q0O A;  1UEL B;  2Z1D A;  1B4A A;  1ZQ3 P;  3BR5 A;  4LMY A;  2P6S A;  4ZYH A;  2HTS A;  2R5Y A;  3KEY A;  2CRG A;  3BR1 A;  4ZZL A;  3LOC A;  4WXH A;  4LFU A;  2XRL A;  3LFU A;  4CCM A;  1FSE A;  2M7A A;  4PGG A;  1K6Y A;  5BS6 A;  1XG1 A;  3GEZ A;  3CCU I;  2KDO A;  4A0X A;  3TGN A;  3DXJ F;  5IY5 H;  1P4W A;  3CJR B;  4MQV A;  4XR6 A;  1K79 A;  1SAX A;  2IS2 A;  1BC8 C;  2Y0S N;  3BR0 A;  2CUZ A;  3ISP A;  1BI0 A;  3KYD B;  3S1Q J;  2R7O A;  4B09 A;  2EH3 A;  3C3W A;  3FKI J;  4ITV A;  2EFQ A;  3TO9 A;  3GX4 X;  1OFC X;  1LKX A;  5EZG A;  1QA6 A;  2O61 A;  4N9H A;  3OYA A;  4G7O F;  2X1C A;  2VBZ A;  2M34 A;  1WJC A;  1D1C A;  4XLC A;  1ZLK A;  5E3O A;  3P9I A;  2PQ8 A;  3ZQQ A;  2R7S A;  1H8A C;  3ABU A;  3DFG A;  4RB3 C;  3CLQ A;  1W0U A;  2CH0 A;  3G2B A;  5DCM A;  4BQA A;  1UHS A;  2DT5 A;  3TP3 A;  1Z7U A;  1ETW A;  1MGT A;  5FRM A;  3AFH A;  1EJ9 A;  1O57 A;  2MBF A;  3FXR A;  1SVM A;  4UB6 C;  2O6G E;  2LF8 A;  4NNJ A;  1XCB A;  3BT9 A;  1HQC A;  1IDY A;  2K9Q A;  2R4G A;  2FX0 A;  1G4D A;  4QPQ A;  2PX9 A;  1R1U A;  5TIS C;  2LF7 A;  4ZYG A;  3OL4 A;  1QPM A;  4KN7 X;  3OYK A;  4G8X A;  2X6O A;  2DFI A;  1OR7 A;  1WVR A;  5F0F A;  2VBY A;  4RLQ A;  5D6E A;  4XRS A;  2QF7 A;  2VQH A;  4I6Z A;  1F1Z A;  3DP7 A;  1PDN C;  1VQM I;  1MMD A;  1T95 A;  4H4K C;  3GW2 A;  2VLA A;  2K9L A;  3CC2 I;  3PNY A;  2M8G X;  2R7D A;  2A5W A;  5AIQ A;  3SDG A;  3W6K B;  4AVZ A;  3WE2 A;  5FB2 A;  1S72 I;  1NH3 A;  2O9L A;  5DV5 A;  3GFL A;  3GXO A;  3HM5 A;  1O3T A;  2CV0 A;  1LE8 A;  1GDT A;  2STT A;  2HDC A;  2NVX J;  4CIC A;  1MMA A;  5J8C A;  1YS6 A;  2NVY J;  4RAZ A;  1T56 A;  3FHZ A;  2FBK A;  2MW8 A;  3MZ8 A;  5FLV A;  1L3L A;  3H0D A;  1OIS A;  3BR2 A;  3CJT B;  4NC8 A;  1W36 D;  4BE2 A;  1WKM A;  5L3G A;  1VQN I;  4RGS A;  3VFZ A;  2M4K A;  4MIM A;  5K7Z A;  1OCT C;  3W6V A;  2ESH A;  3KP5 A;  2ECC A;  4L5I A;  2X1D A;  3ESW B;  3C2H A;  4D5F A;  1DGW Y;  4M74 A;  4I0B A;  4ENK A;  1XGO A;  2VT2 A;  1EH6 A;  2KRH A;  1LDJ A;  2LDU A;  4PSW A;  3S2W A;  1SFO J;  1QVU A;  3KP7 A;  5E1Z B;  2A5Y B;  3ZQF A;  2O5R A;  1WJE A;  4XID A;  1ZH5 A;  2PEX A;  2GWR A;  2XUB A;  2JA6 J;  3K4J A;  1P7I A;  3FK6 A;  1WCM J;  3AL0 C;  4XOT A;  3TL4 X;  3K70 D;  4AWX B;  3M07 A;  2PG4 A;  3T1B A;  2DJN A;  1ONV A;  4YFX F;  2QQA A;  5FKM A;  3MFK A;  5B66 C;  4KMU X;  4MLO A;  2UXN A;  3SEZ A;  2V9K A;  3B02 A;  2XKP A;  5H2F C;  2L3D A;  1HDP A;  4KT5 C;  3PQJ A;  3GO5 A;  4RGX A;  1E3H A;  4PK4 A;  3L2R A;  2COM A;  1XB4 A;  4IL6 C;  3SZG A;  3PJR A;  3B73 A;  2XPU A;  3Q9V A;  4AUX A;  1LNW A;  3UNG C;  5GAD J;  2KT0 A;  5FFX A;  4XOR A;  1BBY A;  2WWY A;  3RJP A;  1B9N A;  1IG7 A;  4BGD A;  4RGR A;  3K7A J;  1JKQ C;  1BW5 A;  4HA8 A;  1BR2 A;  4BE0 A;  3VPR A;  4IF4 A;  4YIF A;  4IX7 A;  2Q8K A;  5B3S H;  3CUO A;  5BPD A;  2BGC A;  1HKQ A;  1POG A;  1HKS A;  3GZN B;  1DPU A;  1XSV A;  1MBK A;  2HZD A;  2OBP A;  3SQN A;  3I5U A;  4B3X A;  3DTE A;  2CS3 A;  3VSK A;  1O3Q A;  4G6D A;  3QYF A;  3DKY A;  3LNQ A;  3KYL A;  2HR3 A;  1ORK A;  5D5W B;  1Z7L A;  1FMV A;  1WSU A;  4A69 C;  1LFP A;  2W57 A;  1JXS A;  3W6J B;  3QPL A;  1OCZ H;  3CCE I;  3ZMZ A;  4EVI A;  4X0G A;  1YYV A;  2W25 A;  3JRI A;  5B5E C;  1UAA A;  2O0Y A;  3QP5 A;  2UZK A;  3RPU A;  2JWT A;  4JX4 A;  2QQ9 A;  4KFC A;  2UUZ A;  3AKZ A;  1BW6 A;  2ID3 A;  3IAS 2;  1E17 A;  1YX5 A;  3HBL A;  2E60 A;  3H0G J;  5AON A;  5FRO A;  2XGC A;  1Y6I A;  2H94 A;  2LRD A;  2NVU B;  4EGY A;  3CC7 I;  5CVI A;  4A0Y A;  2FEZ A;  2ESN A;  3SFZ A;  4CH7 A;  2QYO A;  2XGD A;  1MD0 A;  3JSP A;  3OYH A;  1U3E M;  1BOB A;  5F27 A;  2KHM A;  3HXL A;  1SFE A;  1TTY A;  1ZHF A;  2K4J A;  3S2D J;  1CQT A;  2P5K A;  4A3B J;  4H0E A;  2VAS A;  1X1B A;  2A68 F;  2DK5 A;  3GUD A;  1V54 H;  1X4P A;  4IHX A;  1XPX A;  1FOW A;  1FC3 A;  1MBE A;  1RR7 A;  1YJ9 I;  3FMS A;  1GUU A;  1IZ1 A;  2ELJ A;  3HOS A;  4OU0 A;  2IS6 A;  5E8I A;  4MTE A;  3I4P A;  4LB5 A;  2QSG X;  3OR1 C;  3OYB A;  2NNN A;  2G9W A;  3RPU D;  2WAQ A;  1RES A;  4QTR A;  3A2K A;  2BHZ A;  3WTS C;  4HG2 A;  3F8F A;  4QLC U;  3K4B A;  3MD2 A;  1WJB A;  2E19 A;  4YFN F;  3FWE A;  4DW6 A;  3RTR A;  4M72 A;  2NS0 A;  1B72 A;  1RIO H;  3FXK A;  2LKS A;  3C7J A;  4ZDO A;  2CFO A;  3PM1 A;  5HOD A;  3CCR I;  3I0T A;  1HST A;  1XSX A;  4N0B A;  4HBL A;  3WHC A;  3IWZ A;  2FNP A;  2QSH X;  1APL C;  2JQ7 A;  3FXJ A;  2PBI A;  1OCR H;  4M73 A;  4AVP A;  2QQB A;  2ZFW A;  3NRV A;  2VQG A;  2OCC H;  1S29 A;  2GXA A;  4M3G A;  3CLO A;  2CW0 F;  4BL0 B;  5ICE A;  4IRI A;  2NRA C;  4A3F J;  4YII A;  1CF7 B;  4BE1 A;  2ZB9 A;  1YTY A;  4HRI A;  1WZ2 A;  1QO0 D;  2GBY A;  3DU6 A;  1PUF A;  4M6V A;  2FQ3 A;  3FM5 A;  3A02 A;  4OIN F;  4G12 A;  2YS9 A;  4Y4R A;  3HPH A;  4B3A A;  1HW1 A;  1XSD A;  1ERD A;  4ZYE A;  1TWG J;  3BG7 A;  1R6R A;  4C3I J;  1MDM B;  3H1C A;  3M1E A;  4QWQ A;  4NQW A;  2Y2Z A;  1R1T A;  2K7L A;  1U5T B;  1UB9 A;  4CCJ A;  2XSD C;  4WK8 F;  3CES A;  1HCR A;  3FF5 A;  2RQP A;  4Y13 A;  3T5X A;  3I59 B;  4EJT A;  1D1A A;  1ETV A;  2VC0 A;  3K1M A;  1FBS A;  4KJZ A;  2FU4 A;  2W48 A;  5FRN A;  3FMR A;  3M8F A;  3PO3 J;  4UB8 C;  1FOY A;  3TED A;  1MH3 A;  2CQK A;  1UFM A;  2UWM A;  5LGU A;  2M7B A;  5FJ8 J;  2B63 J;  3BTL A;  4KIG A;  4XLN F;  5DUI A;  3QRF F;  5F08 A;  3LA2 A;  1TL8 A;  1P2F A;  2V1D A;  4AIH A;  2ZME B;  4A3D J;  2XSJ C;  3HC7 A;  3AL0 B;  1BR4 A;  4JX6 A;  2CWE A;  1I3A A;  3WTX C;  1UHM A;  3PIO F;  3J7A O;  3KP3 A;  2Y48 A;  3KZY A;  4MHG A;  2IP2 A;  1ZGJ A;  2CW8 A;  2W24 A;  3N05 A;  1RPW A;  2O8X A;  2DDA A;  2KIS A;  4KA4 A;  3ZQL A;  2GLO A;  5JVT A;  2VOP A;  5EEH A;  1OYY A;  3REO A;  3SHF A;  3ONQ A;  3FIS A;  1YIT I;  2K4B A;  4EGZ A;  2OZU A;  1W36 C;  3L2V A;  1MW7 A;  4N4O B;  2O8K A;  1FZP B;  1Z77 A;  1IXR C;  2DFF A;  4AD9 A;  4OAY A;  2VC1 A;  4L18 B;  2IA2 A;  1OR7 C;  1ZKG A;  1GHC A;  3OYE A;  4ASN A;  1T6S A;  1MDM A;  2Y31 A;  3GBG A;  1S6L A;  1LUJ B;  1I1G A;  2DA6 A;  4RAF A;  3OSF A;  3M1C A;  2Z33 A;  1U5T A;  3PSF A;  4OAZ A;  3WU1 B;  3IV5 A;  5GPA A;  4S0H B;  4HDV A;  1VTN C;  5HVQ C;  1Z9C A;  4KMF A;  3RQI A;  4KYW A;  2XB5 A;  1D3Y A;  2JJ7 A;  3QYE A;  1TT5 B;  2BXZ A;  4DZJ A;  3G1L A;  3K70 C;  3CMM A;  3F0C A;  3OYD A;  3CTA A;  3PNV A;  5L3C A;  2E2I J;  3E6C C;  4EJW A;  2HVR A;  3HOU J;  3V7S A;  5HS8 A;  3OYC A;  2EPF A;  2ZME A;  3WTV C;  3IRR A;  2DOE A;  3DTK A;  1R5G A;  2KJC A;  3BQZ A;  2VKD A;  4AID A;  3NEU A;  1JJ8 C;  3SXY A;  3V7R A;  2IEK A;  1OJL A;  1YW7 A;  4EQQ A;  4IHT A;  1ZRD A;  1QZE A;  3BOQ A;  3LSM A;  2HYJ A;  2OC6 A;  2E34 A;  4MFE A;  5K7H A;  3I4M J;  4KIT B;  5J4Y A;  2EFN A;  2KMU A;  3J7A Y;  4HAM A;  3MKY B;  1H88 C;  5JHF A;  2AXL A;  2NXN B;  1MZB A;  2NVQ J;  2XPW A;  1U6G A;  1YOV B;  4M3B A;  1Z1D A;  4A2U A;  4A93 J;  3CP8 A;  1LFB A;  1OCP A;  1J09 A;  1ZAR A;  1JE8 A;  3JRE A;  1JGG A;  1MMG A;  3A03 A;  3HOV J;  2VL8 A;  2CUE A;  4OIR F;  2V26 A;  2YX7 A;  1FWZ A;  3T0Y A;  1YE9 A;  2MSY A;  3O6B B;  2UV1 A;  1TC3 C;  4HNT A;  2RV8 A;  2H8W A;  3O8H A;  2KQR A;  4GFB A;  2KP6 A;  1X1D A;  2BW3 A;  2DTR A;  2HYG D;  2CW7 A;  4I0A A;  3HRM A;  1DUX C;  2KFD A;  2GA2 A;  4HF2 A;  3H9J A;  4I7H A;  1KYW A;  3D5R C;  1HW2 A;  2W82 A;  3MWM A;  4HSR A;  5DM7 F;  3BTC A;  4OIQ F;  4XK4 A;  3DLL F;  2M0C A;  2VBX A;  3Q5F A;  5ICF A;  1OLT A;  1ZGW A;  3DWL E;  2KZG A;  3V42 A;  3CQZ J;  2EZK A;  5D8K B;  1XCV A;  1Z67 A;  2DDB A;  3ABT A;  2XAS A;  1YJW I;  3BPX A;  2UXX A;  3VEP A;  2VOO A;  5LHG A;  3HOT A;  4NC7 A;  2FQ4 A;  5IT9 Z;  2JVH A;  1AKH A;  2KIM A;  3KEQ A;  4RBO A;  3CZ6 A;  2XGX A;  5FLX K;  1IN4 A;  1JTY A;  2ISZ A;  4BAY A;  3X2Q H;  3I55 I;  1WWX A;  4ON0 A;  2QEN A;  2IGO A;  2EBI A;  2XAG A;  2XDV A;  3E7L A;  2R5Y B;  1YFH A;  1S5L C;  1YW8 A;  3KE2 A;  1FBQ A;  4XN3 A;  3UKG A;  2VPL A;  3RCO A;  1FYL A;  1U9O A;  3CCQ I;  5DTD A;  2ZJ2 A;  2ICW G;  5EJC A;  2VJJ A;  2HOS A;  1SVL A;  2NNY A;  1X3U A;  3QPT A;  5HLG A;  3MEX A;  2F5V A;  2R7U A;  2HFH A;  3RIR A;  2N8G A;  2JN6 A;  3LST A;  2FE3 A;  4GYG A;  3C2B A;  1JHH A;  5AIP A;  1SMT A;  1R5I D;  1MH4 A;  1FTT A;  4FCY A;  1HBX G;  3DF8 A;  3V8J A;  2P7C B;  2OD5 A;  2DXI A;  1S7E A;  1JT6 A;  1TNS A;  2M9H A;  4KIF A;  3TOB A;  1WJD A;  1RET A;  2WTE A;  1MKM A;  3TDU C;  1HOM A;  1UG2 A;  3E97 A;  2XRN A;  4C2U A;  2DJI A;  2PI0 A;  4NHJ A;  2KKO A;  2FJ1 A;  1VND A;  1QVT A;  2HPI A;  1UST A;  1D1B A;  1QRY A;  2E35 A;  5IOZ A;  4RLF A;  4FE4 A;  1BL0 A;  4PGH A;  4DBQ A;  1KYZ A;  3JW4 A;  2ZXH A;  3LSR A;  4A3K J;  3NAR A;  4F52 A;  1K7A A;  1IO2 A;  2P8T A;  5DCF A;  1I27 A;  5DCM B;  3JAM K;  2R7F A;  3SDB A;  5TRD A;  3CJN A;  2E7W A;  2QWW A;  2WB1 N;  3HIF A;  4KT6 A;  1R71 A;  3HTU A;  2F5E A;  1JKP C;  2QZ8 A;  3D1N I;  4CYD A;  4XIC A;  3R60 A;  4XKW A;  2M3A A;  2E36 A;  4XL9 A;  2RNJ A;  1MBH A;  2F4I A;  3K2A A;  3TP0 A;  4DJA A;  3OYJ A;  1ZR2 A;  1TW2 A;  3H5R A;  4I09 A;  2L4M A;  2DCE A;  2X6Y A;  2L2O A;  2CJJ A;  3IKT A;  3ZR8 X;  4G6Q A;  2MLK A;  1KU2 A;  3CCY A;  1J7K A;  4WX9 A;  2MA3 A;  3DPT A;  4NC6 A;  2K9N A;  2GXB A;  4Q47 A;  1WRJ A;  3OIP A;  5FLX Z;  2BY3 A;  5M3F J;  1J5Y A;  3BTJ A;  1FIP A;  3PFY A;  5E79 C;  1YX3 A;  2V4J C;  2VT3 A;  3TO6 A;  5LGN A;  5FLM J;  2QA4 I;  1P6R A;  1K4T A;  5EEA A;  2R93 J;  1LE8 B;  1RUN A;  1FT9 A;  5CKT A;  2M5W A;  3BRO A;  2VB6 A;  4RM3 A;  2HQ5 A;  3BJA A;  2QKL B;  2LD5 A;  5ERI A;  5TJJ A;  3B6C A;  3DTI A;  1FNN A;  4IHS A;  4Q5S F;  2H8R A;  3RPQ A;  2LKX A;  4LK1 F;  1DU0 A;  1YW9 A;  1AHD P;  3M3Y J;  2E1C A;  5ICC A;  2OZ6 A;  4AYB N;  3LSH A;  3R4K A;  3VWB A;  2IXS A;  3ZQI A;  1LQ1 A;  3G1M A;  3CJQ B;  4RM2 A;  3HRU A;  3MN2 A;  1IN6 A;  4K2E A;  3RQ4 A;  1TT0 A;  2HKX A;  5K7F A;  1WJF A;  1VFC A;  1E3O C;  2R3S A;  1JJ6 C;  2BEO A;  1YO5 C;  1EKE A;  2MYS A;  2YUS A;  5D6F A;  2LVS A;  2P5V A;  2EFP A;  2R7Q A;  3RSN A;  3HUG A;  2CQX A;  1KU3 A;  1MJ9 A;  1S7A A;  1XMK A;  4LG0 B;  3MZY A;  2V6C A;  3FMQ A;  2H27 A;  4RAG A;  3IP4 B;  1Z0X A;  3CCV I;  4UUT A;  4FET A;  3HRT A;  4U0W A;  3T8T A;  4F93 B;  2BVM A;  3JAM Z;  3KZZ A;  5JLW A;  3A4C A;  3LSK A;  4IRH A;  1ZG5 A;  5H6Q A;  1HXD A;  1ETK A;  5ILS A;  1NK3 P;  3D0S A;  1MND A;  3OR2 C;  4FIS A;  5FD5 A;  3IKV A;  3OS2 A;  1VQ8 I;  4YIR X;  2L02 A;  4B43 A;  1XGS A;  4P9F A;  5EG0 B;  1MJB A;  1IW7 F;  1Y0N A;  2F4O B;  2DO7 A;  3K4L A;  5KK1 A;  3HOW J;  2NOJ B;  2O03 A;  3NAU A;  2TRT A;  2JZY A;  4JOM A;  2ACJ A;  1MNE A;  2RVC A;  5HDK A;  1I5Z A;  1YS7 A;  2F5D A;  2K3F A;  1T2K A;  2HOA A;  2TDX A;  4ZTJ A;  1UZC A;  2NYX A;  3EYY A;  1YJN I;  3ZQH A;  1G3Y A;  2AHQ A;  1SD5 A;  4E7K A;  1QBJ A;  2L9V A;  3H9Q A;  1MNM C;  2DPU A;  5C4X J;  2KDZ A;  4M6X A;  1TLH B;  3MAJ A;  3ML6 A;  3K4M A;  2EV6 A;  5E17 F;  3DPL C;  4KUM A;  4G7Z F;  4CXF A;  2HNH A;  2K9S A;  2L7M P;  3E0J B;  4B47 A;  4C3J J;  1WI9 A;  2MG4 A;  4F7Z A;  3LWF A;  3HJE A;  1U5T C;  1ENH A;  3K2Z A;  1WHU A;  2HYF A;  4PZJ A;  3CP2 A;  1NHA A;  2VXD A;  5E1X A;  1HW5 A;  3QP6 A;  3HRS A;  1TWA J;  5D8L B;  4NDL A;  4B48 A;  4PCQ A;  1GVD A;  3FM3 A;  4I99 C;  1FX7 A;  2MLG A;  2NAZ A;  5FGM A;  4JP0 A;  3G71 I;  4U88 A;  4UV8 A;  3I58 A;  3IUO A;  3U21 A;  5C44 J;  1OYI A;  2VQC A;  2IS4 A;  2DA3 A;  4LG0 A;  2CQN A;  2ZME C;  3S93 A;  4FT8 A;  1F43 A;  2DOD A;  1U9N A;  1FPQ A;  1R1V A;  2O7O A;  1YI2 I;  2E5Z A;  1LVK A;  3F21 A;  4FAS D;  1TP4 A;  3LSI A;  3QYB A;  3SYT A;  2E2H J;  3EYI A;  2FNA A;  2HPM A;  1T38 A;  2XF7 A;  5EG0 A;  4QSH A;  3V8K A;  3BCB A;  1BN5 A;  1X1A A;  5CLS A;  3PNT A;  3TOA A;  4PUS A;  4HX4 A;  1XDU A;  3L2Q A;  1OCC H;  1MMN A;  2K5C A;  4HDU A;  4JK1 X;  4YEL A;  1B9M A;  4Y17 A;  3A01 B;  1GXP A;  1BC7 C;  3H35 A;  4Y3O A;  2LG4 A;  5J1U A;  3RKY A;  4XBF A;  1EH7 A;  4ZYD A;  5JI6 A;  5H6R A;  4IHY A;  1VZ0 A;  2QCO A;  4CA0 A;  4E6K G;  5HOO A;  2BY0 A;  2IGM A;  3CMA I;  1X58 A;  2L5Q A;  4MEY F;  3I3L A;  4WF2 A;  4ENN A;  1FBU A;  2KIU A;  5H20 A;  4DIQ A;  4BAC A;  1RUO A;  4HPQ A;  1ZRE A;  2JA8 J;  2M8E A;  3FXM A;  1Q1V A;  2IBD A;  2BHY A;  3HG9 A;  4ESJ A;  2NOG A;  1IAW A;  5M3M J;  4BNC A;  3E5U A;  2JUG A;  3E5X A;  3BPV A;  1IN8 A;  5F1R A;  1VQ4 I;  1V5F A;  1FP2 A;  2JPC A;  3JRC A;  5HDN A;  3N4M A;  3BLY A;  4R8H A;  4X1E A;  1N75 A;  1B72 B;  4L0Y B;  4AIK A;  3HGY A;  4S05 A;  2EIM H;  2YSR A;  3M7G A;  3WGI A;  2FA5 A;  5HDG A;  1KQ8 A;  4ZYA A;  4LOC A;  2IA1 A;  2P81 A;  4IHV A;  2JSP A;  3EPZ A;  2XRO A;  3HTS B;  3ZGK A;  3OYM A;  3WG7 H;  4DYR A;  1Z21 A;  1YIJ I;  1B8I A;  3GTJ J;  4DYQ A;  3BP8 A;  1SAN A;  4OOI A;  4PJJ A;  1FIA A;  2XAU A;  2L7K A;  3GTM J;  2IAI A;  2E2J J;  1WH5 A;  2FUG 2;  2PJR A;  1HA8 A;  2FSW A;  3LMM A;  2GM4 A;  2LOO A;  3C18 A;  2AQE A;  1SVO A;  2HOT A;  4XMY A;  4RS8 A;  1TQM A;  5GPC A;  3RZD J;  3A01 A;  1HF0 A;  2HXI A;  1O4X A;  1QQI A;  4M9X A;  2DU9 A;  1PUF B;  5D5V B;  4B8X A;  1D5V A;  2BE5 F;  5FKO A;  4DGW B;  4CGZ A;  5D5X B;  2DFE A;  1YG2 A;  1R58 A;  4CUG A;  4UVA A;  5LRR A;  4BHP A;  1VQP I;  4NQW B;  4HLY A;  2VQL A;  1ON2 A;  3HOY J;  3ZMV A;  4C2T A;  2RAE A;  1JT0 A;  3AAF A;  2MAB A;  3S14 J;  3DKX A;  2PLY A;  3FIW A;  4RB2 C;  5GAH J;  4ENJ A;  1I3Q J;  2I10 A;  3CF5 F;  5EGO A;  1ZG3 A;  2EIK H;  3GCM A;  3BG6 A;  2LTP A;  2DQR A;  2GIV A;  1QHG A;  1E3P A;  1XMA A;  1W7P D;  2EV5 A;  4W97 A;  3ZMD A;  2XAH A;  4Q4Z F;  3WTU C;  2D5V A;  2VJ5 A;  3C1D A;  1TW3 A;  4F55 A;  4ZH4 F;  3CCM I;  3CCJ I;  4E7Z A;  1YIO A;  3W2V A;  1MBJ A;  2A6E F;  3DEU A;  2A07 F;  5GP9 A;  2PMH A;  2J5P A;  1J2X A;  4ZDL A;  4MEX F;  4HF1 A;  3QOD A;  1BIA A;  1R00 A;  5KNL A;  2STW A;  1G2H A;  3ZQG A;  3Q0U A;  4PSX A;  3S15 J;  4BS9 A;  1RKT A;  1PP8 F;  1P4X A;  1QZZ A;  2P4W A;  4NBQ A;  2C6Y A;  4P1W A;  1R49 A;  1O7F A;  1UCR A;  4BHB A;  4BYY A;  2XGE A;  2FBH A;  3HKZ A;  3MKL A;  4L5E A;  5J47 A;  4RDU A;  1VQO I;  1R7J A;  2WY7 Q;  2G7U A;  4HW0 A;  5IPA A;  2LY2 A;  1T8I A;  2LSO A;  1C0W A;  2XAQ A;  3KPH A;  3DEE A;  3K4C A;  3K1P A;  4KIB A;  2QQ8 A;  2VN2 A;  3GFJ A;  4M71 A;  2Q1Z B;  5CQE A;  1K78 B;  3HSR A;  3CD6 I;  3QQA A;  1W5T A;  3H92 A;  2AS5 F;  1XDS A;  3ERE D;  1HLV A;  1A6Q A;  2ME0 A;  1T08 B;  2R5Z A;  2HVQ A;  2HWV A;  2Q2E B;  2Z3Y A;  5LBQ A;  2F5F A;  3ZQ7 A;  3GF2 A;  1PJR A;  1EV7 A;  2ZCW A;  3JCU C;  1D5Y A;  5L3B A;  2DOF A;  2LNB A;  3VYT B;  1N25 A;  5LHI A;  2Z9O A;  3FBI B;  3NWS A;  2V9P A;  3CMY A;  4A3L J;  1VQL I;  1G3T A;  5J1R A;  1BM9 A;  3H3Z A; 
#chains in the Genus database with same CATH homology
 2RNG A;  3H9J A;  2Z2S B;  3D5R C;  3H9G A;  3OYA A;  2W82 A;  2X1C A;  4HSR A;  4IKF A;  2L9N A;  3S32 A;  2PMZ A;  1WJC A;  1D1C A;  1WFX A;  4XLC A;  2MD0 A;  2R7S A;  3ZQQ A;  1UG0 A;  3OL3 A;  1S9H A;  1OLT A;  2ZXI A;  4ZDP A;  2CH0 A;  3G2B A;  4JQF A;  3DWL E;  4E7H A;  3V42 A;  4XLA A;  2RQQ A;  1Y56 A;  2LY1 A;  5FRM A;  3AFH A;  1EA3 A;  2KLO A;  4II3 A;  3VYU B;  4GRI A;  4NNJ A;  2M0M A;  3HOT A;  4NC7 A;  2R4G A;  4XQF A;  1T0F C;  2JVH A;  4QPQ A;  3CZ6 A;  3OL4 A;  3W3C A;  3MKW B;  2KPM A;  2JVG A;  3M8J A;  3OYK A;  4ZC3 A;  1G8X A;  2W4S A;  2IGO A;  4RLQ A;  2XDV A;  2K3P A;  2VQH A;  4ANJ A;  1SFK A;  1FMW A;  4XN3 A;  1MMD A;  1T95 A;  4H4K C;  3RCO A;  2VPL A;  4E7I A;  2BOL A;  2I8D A;  2VLA A;  3C2G A;  2K9L A;  2VJJ A;  2XF5 A;  4AU7 A;  3PNY A;  4AVZ A;  2A5W A;  4XM3 A;  2F5V A;  3L2W A;  2R7U A;  1G59 A;  1LDK B;  2CV0 A;  3DPU A;  2BW3 B;  2K9M A;  1MMA A;  2DXI A;  2LRE A;  1V5G A;  1WJD A;  3DLA A;  3HPG A;  3H0D A;  4C2U A;  4P5O A;  4QPO A;  2DJI A;  4II2 A;  4NC8 A;  1W36 D;  4BE2 A;  2HPI A;  4KIS A;  1D1B A;  4YRV A;  2M4K A;  4RLF A;  1Z3Y A;  4E7S A;  4XN0 A;  3OS0 A;  2X1D A;  3W2W A;  4DBQ A;  3C2H A;  2ZXH A;  1DGW Y;  4F52 A;  3SEQ A;  1DQU A;  3SDB A;  4LG3 A;  1BR1 A;  3EUK L;  4E7L A;  2KRH A;  4PSW A;  4KT6 A;  4BJ6 C;  5HNF A;  2LC2 A;  2O5R A;  1WJE A;  2KRC A;  3K4J A;  3KX2 A;  4XKW A;  2M3A A;  4HST A;  4XL9 A;  2F4I A;  3AL0 C;  4XOT A;  4DJA A;  3TL4 X;  3K70 D;  1GLN A;  3MMY B;  3OYJ A;  1V5E A;  3H5R A;  2DCE A;  2X6Y A;  2L2O A;  3OIQ A;  3ZR8 X;  4LIU A;  2IGN A;  4MLO A;  3SEZ A;  2V9K A;  4F3Q A;  5TGT A;  3DPT A;  3OOU A;  4PK4 A;  3L2R A;  4EAT A;  3SZG A;  2V7F A;  2JA2 A;  3OIP A;  3PJR A;  3PFY A;  1YX3 A;  2V4J C;  2KZV A;  4C30 A;  3UNG C;  1AA7 A;  4HEA 2;  4XOR A;  4BEH B;  4BGD A;  5CKT A;  4DBR A;  3S3M A;  2VB6 A;  2VKH A;  1BR2 A;  4BE0 A;  5KCM A;  4RM3 A;  2MC4 A;  4IX7 A;  2QKL B;  4XKV A;  2VXZ A;  3DTI A;  4RMN A;  2P0W A;  3F9K A;  3TBI A;  4XLF A;  1P9Q C;  2HZD A;  2XF6 A;  3OS1 A;  4B3X A;  3LSH A;  3DTE A;  1E0E A;  2CS3 A;  3VSK A;  4BJT A;  3VWB A;  1X1C A;  2IXS A;  3QYF A;  3DKY A;  3KYL A;  2X6X A;  2ZSI B;  4R79 A;  3CJQ B;  4RM2 A;  1Z7L A;  1FMV A;  2ZSH B;  3FKJ A;  1TT0 A;  3RQ4 A;  3TMO A;  1WJF A;  1LFP A;  2IS1 A;  2MYS A;  4XKB A;  3RSN A;  2R7Q A;  4X0G A;  3CF2 A;  2R7W A;  1UAA A;  3A1Y A;  2V6E A;  3IP4 B;  1ZEL A;  2E5N A;  3UR3 C;  2UUZ A;  2X1E A;  4FET A;  4CCO A;  4BQN A;  4F93 B;  2BVM A;  3FHN A;  3AKZ A;  3A4C A;  3IAS 2;  3LSK A;  1YX5 A;  4XON A;  2E60 A;  5FRO A;  1Y6I A;  2LRD A;  1PYV A;  4IZZ A;  1MND A;  2M4G A;  3OR2 C;  4CH7 A;  3OS2 A;  3OYH A;  1BOB A;  2E1M C;  2HU9 A;  4B43 A;  2KHM A;  3HXL A;  2F6C A;  3K4L A;  2NOJ B;  2VIX A;  5CPR B;  4JOM A;  2Y0S A;  3W2A A;  1MNE A;  2VAS A;  1X1B A;  4BEH A;  4U7B A;  4ZTJ A;  1X4P A;  4E7K A;  3LL7 A;  3H9Q A;  2W7N A;  2WAF A;  2OV7 A;  4N4N B;  2OUM A;  3VYR B;  3K4M A;  2ELJ A;  3HOS A;  3MKZ A;  2X51 A;  3DPL C;  4PJN A;  2DOA A;  2IS6 A;  3VYS B;  2HNH A;  2V1N A;  3E0J B;  3OR1 C;  3OYB A;  3RPU D;  4B47 A;  2WAQ A;  2CV2 A;  3S8P A;  4BU2 A;  3A2K A;  5LFA A;  4HG2 A;  3CP2 A;  3K4B A;  3MD2 A;  1WJB A;  4G6T B;  2VXD A;  2XC7 A;  1U0J A;  4B48 A;  4YEJ A;  1Z3X A;  3RTR A;  1JI8 A;  4D9J A;  3IUO A;  3BC8 A;  3U21 A;  1X19 A;  2VQC A;  4LIT A;  2IS4 A;  3HUG B;  4ZDO A;  2Z16 A;  2CFO A;  3NWT A;  2X6W A;  3S93 A;  3D5L A;  2W00 A;  1QU3 A;  4BDY A;  3DQV C;  3OYG A;  2E5Z A;  1LVK A;  4FAS D;  2DT6 A;  3LSI A;  4D1Q A;  3QYB A;  3SYT A;  3K4N A;  3OMY A;  4CCN A;  4XOP A;  2VQG A;  2HPM A;  1DGR M;  2LH9 A;  2HDW A;  4ZJZ A;  1X4O A;  2XF7 A;  5LD2 C;  5KHD A;  4BL0 B;  3BCB A;  1X1A A;  3PNT A;  1WJA A;  4PUS A;  3ZXS A;  3S3O A;  4BE1 A;  3L2Q A;  2KL4 A;  1MMN A;  4NUB A;  2K5C A;  4CCL A;  2W1O A;  4YEL A;  4HRI A;  3DU6 A;  4IQJ A;  3H35 A;  4Y3O A;  2LG4 A;  4BJ5 C;  4Y4R A;  1VZ0 A;  3HPH A;  4CA0 A;  4E6K G;  4BXF A;  5HOO A;  3DU5 A;  2IGM A;  2LBF B;  1N78 A;  1ERD A;  4XLE A;  2L5Q A;  3BG7 A;  3IAM 2;  3I3L A;  3PL8 A;  1R6R A;  4DIQ A;  4BAC A;  2BVL A;  4HPQ A;  4XNF A;  2VJI A;  3HG9 A;  4CCJ A;  2CUJ A;  3CES A;  3ZCO A;  3OWT A;  1WJ5 A;  5HNH A;  1D1A A;  4LIV A;  2JUG A;  4KJZ A;  2L9S A;  1N77 A;  2WBM A;  5FRN A;  2X85 A;  3K10 A;  1V5F A;  2IGK A;  3VDX A;  2UWM A;  2M7B A;  2WB1 A;  3BLY A;  1N75 A;  2CMP A;  2XSJ C;  3K6G A;  4PFO A;  3HC7 A;  3ZRG A;  3AL0 B;  4U87 A;  4ZYA A;  1BR4 A;  4BQQ A;  2QKM B;  3H5N A;  3LSG A;  2WY8 Q;  3EPZ A;  2JSP A;  5CQG A;  1QHH D;  3ZGK A;  1D0Y A;  3E1S A;  4B44 A;  2A6T A;  3BCA A;  3OYM A;  1Z21 A;  2LYC A;  2GOM A;  3K4K A;  2AQF A;  4XKC A;  2CW8 A;  4PJJ A;  2XAU A;  3OYF A;  2L7K A;  3N05 A;  2R7X A;  2FUG 2;  4PJM A;  2PJR A;  1HA8 A;  3LMM A;  2LOO A;  2AQE A;  4XMY A;  3VSL A;  2R7R A;  3EUH C;  3PSI A;  3ONQ A;  2HQA A;  4PFP A;  4F91 B;  4J01 A;  1W36 C;  3L2V A;  1MW7 A;  4N4O B;  4PJL A;  4DGW B;  4Y33 A;  2LBF A;  3EUA A;  3PUB A;  4OAY A;  4IQ4 A;  1NG6 A;  1OR7 C;  4CCK A;  3QOE A;  3OYE A;  3GBG A;  4CUG A;  4NQW B;  1D0Z A;  3M1C A;  2HVS A;  2VQL A;  3H5A A;  3PSF A;  4OAZ A;  5HLT A;  3FDY A;  2WAE A;  2RRE A;  4AYB A;  4C2T A;  5HVQ C;  2MAB A;  3DKX A;  4ZTF A;  3QYE A;  2CV1 A;  3OYN A;  1TZL A;  3K70 C;  3CMM A;  3OYD A;  3PNV A;  2MFZ A;  3BG6 A;  4E4H A;  1QHG A;  3D5S C;  2HVR A;  1DP3 A;  3OYC A;  4DOZ A;  2VJ5 A;  3FBN B;  4XLH A;  4F55 A;  3DTK A;  4E7Z A;  3W2V A;  2VKD A;  4BUP A;  1IRX A;  3L2U A;  4ZDL A;  3QOD A;  5KNL A;  2DT7 B;  3LSM A;  4E7J A;  2WA0 A;  4BQO A;  4CSW A;  4BDZ A;  1KON A;  2OC6 A;  4PSX A;  1D0X A;  4BS9 A;  2E1M B;  3OY9 A;  4HNU A;  1SAU A;  4F92 B;  4KIT B;  3S3N A;  1NG7 A;  2PJR B;  4P1W A;  2KMU A;  3J7A Y;  2GOX B;  3MKY B;  3HKZ A;  1UEL B;  5JHF A;  2Z1D A;  4OWR B;  2WY7 Q;  2VJ4 A;  2R7T A;  2LY2 A;  3OYI A;  3DEE A;  3K4C A;  3CP8 A;  3KEY A;  2ZFU A;  1J09 A;  3LFU A;  4CCM A;  2Q1Z B;  5CQE A;  4J00 A;  2M7A A;  4C9Y A;  1K6Y A;  1MMG A;  2VL8 A;  2KDO A;  3CJR B;  2V26 A;  2R7V A;  2WAD A;  2HVQ A;  1YE9 A;  4XR6 A;  2Q2E B;  2UV1 A;  2IS2 A;  4HNT A;  3I9V 2;  1PJR A;  2CUZ A;  4CZC A;  2KQR A;  3OYL A;  2KP6 A;  1X1D A;  2BW3 A;  2R7O A;  3VYT B;  2CW7 A;  3FBI B;  3NWS A;  4ITV A;  3HL2 A;  1LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...