2DT7B

Solution structure of the second surp domain of human splicing factor sf3a120 in complex with a fragment of human splicing factor sf3a60
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
GAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor 3A subunit 3
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt7B01
2DT6A 1X4OA 2E5ZA 1X4PA 1UG0A 4DGWB 2DT7B 2E60A
chains in the Genus database with same CATH superfamily
1HBXG 5IP7J 2NOGA 3ABKH 5DYMA 3MKZA 3JRGA 5D4SA 4BQOA 3LA3A 2ZNZA 2HQ5A 2QM3A 1XTAA 3Q9SA 4JX4A 3LSHA 4JX5A 4ESFA 3I64A 4HG2A 3K1NA 2KZVA 3BROA 4F92B 2HGCA 3KE2A 3CUQC 4AYBA 1DPRA 1POGA 2CFOA 3CTAA 3LFUA 1F1ZA 1LUJB 4QWQA 3F8NA 2RNJA 4X1EA 2FQ4A 1W7PB 4KITB 2G7UA 1D0XA 3VYUB 1FOWA 2EINH 1T0FA 2WTEA 1Z67A 2XKPA 3WTZA 4CCKA 2JVGA 1S9HA 4KIBA 4PK4A 3M3YJ 3VWBA 2GOXB 3K70D 2ZXHA 3A4CA 5J4YA 3I4PA 2P81A 1LEAA 4EJWA 1LEBA 3E6BA 1G8XA 3RI4A 2ESNA 1N25A 3LA2A 5HDNA 2DW4A 2R7UA 4N4OB 4HBLA 1S29A 1IXSB 2O8XA 4MIMA 1R49A 4J19A 2VKHA 3CMAI 1GLNA 3FZVA 1YOVB 2CYYA 1AWCA 3N05A 5CQEA 2FNPA 1MBKA 2M9HA 2M4GA 1B59A 2XGXA 1FMWA 1FBQA 5C3EJ 3PFYA 5IT9Z 1QHGA 2CUFA 4G7ZF 1FYKA 2D1VA 2M34A 3WTVC 3KEQA 2F5VA 4XMYA 2X6OA 3OYFA 4JK1X 3GFLA 2KISA 4DNCA 1QVTA 2XB5A 5LEKA 4LLLA 1LE8B 3WGHA 3SHFA 2IT0A 2J5OA 1EV7A 1TQIA 2G7HA 1R5GA 3FWEA 4UVBA 1D1CA 1AU7A 4P9UA 3ULQB 2DODA 1GDTA 1EF4A 3S8PA 1XX5A 5DCMB 4BBSJ 1R1UA 1U3EM 3P9CA 4Y52J 2F2EA 4B09A 2D45A 3KEYA 4CSWA 3FHZA 3TGNA 3PQKA 1JKPC 2DMPA 3ML6A 4XLEA 2QF7A 1SANA 2CW8A 3HHGA 3DBLB 1YHQI 3H0GJ 3DEEA 1T33A 2WAFA 2QWWA 1G4DA 1EA3A 1RR7A 5ILUA 4BQAA 1FSEA 1IRGA 3JRFA 4RAFA 3V8JA 2RDPA 2VE8A 2Y31A 1JHHA 3HDDA 1Z9CA 2L7FP 2Y48A 4HOBA 3GLXA 1HDPA 2XIGA 4CYCA 3FBNB 2EA4A 3G73A 4ENMA 4A3KJ 2VT2A 1FEXA 2HVQA 1A36A 5M3FJ 3HRSA 5B3SH 1JE8A 3VYSB 1R5ID 3BPXA 1ZRCA 2VQGA 1ULYA 2PFBA 5JR3A 4I98B 1X4OA 1XMKA 3SFZA 2CWEA 2JJ7A 1W7PD 1FPQA 3AL0C 2EIKH 4E6KG 3OMYA 2K9SA 1JJ8C 2KP6A 5DUKA 4XM3A 2XGEA 3FXLA 3KP7A 1QZZA 3D0SA 2GA2A 3IP4B 1V3FA 1XMAA 2NVQJ 2VJJA 3HJEA 2VBZA 1LVAA 3A01B 3DBRB 3RPUA 3B73A 5LRSA 5FGMA 1A5JA 4KUMA 2NS7A 3OR2C 2CG4A 4C9YA 1VQOI 2K85A 2GM4A 3DXJF 3TO7A 1RUNA 1I1GA 4WWCA 2R5YB 2GLOA 4B8XA 4KMUX 1FYMA 1MBFA 4KJZA 1VNDA 3O6BB 5HLIA 4BJ6C 1UG0A 2E7XA 1I6HJ 2QGUA 4BKXA 2FEZA 2ID6A 2M5WA 4S0HB 4HEA2 3KP5A 2W24A 5E1WA 1ETYA 4YIIA 3REOA 2DA7A 3C2BA 4C30A 2R7DA 1WJBA 1FBSA 4FHTA 2YPRA 1F4KA 3O2PE 2RAEA 2XSDC 5GTHC 4E4HA 5TISC 2VJ4A 2VIXA 4Z2YA 3VYRB 2LNBA 1RNLA 3HZJA 1G59A 3E1SA 3FISA 3DLLF 1JGGA 2MC4A 2X1EA 3IAS2 1O57A 3R60A 3SZGA 3ZQQA 5KAFC 5LGUA 4X6AJ 2V1UA 2HYJA 2KDZA 1K4SA 2XDVA 2HYGD 3C18A 4XSZF 5FO5A 4M3FA 3WTSC 1BR2A 2NVYJ 2BE5F 4A3BJ 4G6TB 2BV6A 4RB1A 3M8JA 1IN7A 2ZO4A 2R7TA 1KQ8A 1FMVA 4RMNA 4F3QA 2V1XA 2V9PA 2AQEA 2JWTA 1KQ0A 1TWFJ 2EFNA 2ZJPF 1LVKA 1QU3A 4CCJA 3S2DJ 1EJ9A 4YEJA 2JA6J 2A68F 2CMPA 4XRFA 2NRAC 1OISA 3RKYA 2Y0SN 1IDZA 4WCGA 1SMYF 3Q9VA 3ECHA 4CZZA 3EUHA 2AQFA 3EUKL 1K4TA 2H27A 5ED4A 2EBIA 2PJRB 2FMYA 3K0LA 1LQ1A 2VONA 2STWA 1QPMA 1MBHA 1Z05A 3ZQCA 2JSCA 4KN7X 2IW5A 1FYLA 1JTXA 3JRHA 1FP1D 3BZCA 1JUSA 1T98A 2VUMJ 1RR8C 1L0OC 5KHDA 1PJRA 1N78A 3A03A 4O6JA 4A69C 4KISA 2FRHA 3PIOF 3H35A 5CYVA 1YJWI 1OFCX 1UB9A 2Y30A 2OTJI 1OCRH 1IC8A 3GBGA 2XV4S 3AL0B 1WKMA 1ZR4A 2A5WA 3AG3H 5BS6A 3S15J 1DGRM 5LFAA 3BR1A 4B3XA 2UXNA 2DU9A 1H8AC 4OINF 1S7EA 5FKLA 4OIRF 2QBYB 4IKFA 4Y7NJ 3CF5F 1S7OA 5DEQA 3VODA 3FXQA 2UV1A 3DEWA 1OYYA 4A3IJ 3HRTA 5BOXA 4FQGA 4F52A 4XICA 3FDYA 3TO9A 3MKYB 2OUMA 1RRJA 4ZDOA 1YLFA 3BWGA 2HPMA 3K7AJ 4QLCU 1OLTA 4EVIA 1RC9A 1IGNA 2KL4A 2XAGA 4H4KC 1XDUA 3H9JA 5EF6A 2P5LC 3HSRA 4L9NA 2JRMA 4XK4A 3L2CA 4E7SA 3I71A 3T0YA 2ZCWA 1QGPA 4FISA 1TW3A 3CJRB 4OMYA 1Z6RA 1V5EA 3LL7A 3ZR8X 1JKQC 2F5DA 2VOOA 1D8JA 4A3LJ 1ETQA 3F6VA 1JT0A 3H1CA 3CCVI 2F6CA 2OZ6A 2DTZA 2GIZA 4M73A 3GLLA 2BHZA 4N9IA 2GXBA 1Y56A 1KGSA 4UB8C 3SXYA 3CCLI 3NQOA 4RGRA 3HOYJ 2DOFA 1GUUA 2H1LA 1Z1DA 3DU5A 2CV1A 5TRDA 5HOOA 2VQCA 4HDVA 3T8TA 3IH4A 4I02A 4NB5A 2F5EA 3ERED 4OAYA 2OQRA 2LKPA 3OYGA 1FOXA 2HPIA 1XGOA 2EFWA 1FP2A 1HDDC 1XGNA 2L2OA 2EK5A 4DYQA 4IHYA 3MVPA 1DQUA 3F23A 1WJCA 2VODA 4L5IA 1W7PA 3F72A 2QSFX 1QNTA 1BA5A 2AXLA 3K2AA 3FXUA 3W2AA 5FLVA 2ELJA 4UV9A 4Y13A 2E1MC 1ZGWA 4FCYA 3HOWJ 1P4WA 1TP4A 2XC7A 1SVLA 4L9JA 2DK5A 1ZARA 3I5UA 2FD5A 4RS8A 2CRGA 3BR3A 2E2HJ 3GF2A 1YJ9I 2DFEA 3EUHC 1RETA 1S5LC 2L5QA 2E34A 2VJ5A 2H8WA 3JCUC 2GBYA 2ZB9A 3GWZA 3COAC 1R00A 2CFXA 2ZMEB 4DYRA 2JVHA 3F8MA 3H5NA 5M5WJ 2QZ8A 5JVTA 3HOUJ 3S1QJ 1KONA 4P1WA 2PJPA 1OCZH 1VZ0A 3ZQIA 1W4MA 4QPQA 1YW8A 2N8GA 3NWTA 2M45A 2L7MP 1YI2I 1BL0A 1EKEA 3K70C 2JPCA 1OYWA 2Y2ZA 4HV6A 4ASNA 3WODF 3CMMA 3QOPA 1O3SA 1H9TA 1LE8A 3P7NA 2Y0MA 3R4KA 4YELA 2DT6A 5TGTA 1KA8A 1ZG5A 2WBMA 3HBLA 1UHWA 2CQQA 5A2QK 5BPDA 3VYTB 3OL4A 4RLFA 2WWYA 2HVSA 3QU3A 2DA1A 3J7AY 2P6TA 4HPQA 1X4PA 1RIOH 5ERIA 2IAIA 5LBQA 3IAM2 1NG7A 1IXCA 2KT0A 5JVGF 1SC7A 1B8IB 3Q0VA 2WAQA 3MZYA 1XB4A 3I54A 5ICFA 4NC6A 3CDLA 4JQFA 3RJPA 1FLIA 1TT0A 1OCCH 2W57A 3J80Z 2BVLA 2RQPA 1QVUA 2K3PA 2A6EF 5D5WB 4ZYHA 4UNOA 2DTRA 5CVUA 3H5AA 4NUBA 4PGHA 5F1JA 2BY3A 2YSRA 1SFOJ 4DJAA 1K61A 1DPUA 3P5JA 3SFIA 3BG7A 1IO2A 1OMIA 4RB3C 2PG4A 2DA4A 2R7XA 5H6QA 1KYWA 2W84A 4HQEA 2O5RA 1CQTA 1B1BA 2WV0A 3P9KA 3ZQHA 2XPUA 3CP8A 3U1KA 4HDUA 2V6EA 4ZDPA 3A01A 4XBFA 2D5VA 1TNTA 2HI3A 3K1PA 4OIPF 3HL2A 1R58A 1MH4A 4G9YA 2DMTA 4XLFA 3ZMDA 2V9KA 2VE9A 2V7FA 2ZSHB 5J47A 3BTJA 3SEZA 4RDUA 1WGXA 4XL9A 4MLOA 2A61A 5K5OA 2R5YA 3DU6A 1W5SA 3BJOA 3BG5A 4RGUA 4AU7A 5EG0A 4BXFA 3L2RA 1HLVA 4V2GA 3JREA 1O4XA 2MW8A 4II3A 4ON0A 1V55H 4HZFA 2FOWA 5LGTA 1JUMA 1WH7A 1F5TA 4EJTA 4A12A 2DYSH 3KZZA 4ZC3A 4LMYA 3I59B 5HDKA 2CW0F 2V1NA 4LOCA 1C0WA 2KIQA 2LTPA 1FTTA 1GXQA 1T8IA 5LHGA 1X3WB 5GPAA 1USTA 3H36A 2JQ7A 3GFJA 5GADJ 3DKYA 1IW7F 1ZGAA 4RB0A 2YU9J 3LSGA 3K4JA 1UCRA 4A3DJ 2X85A 1FBUA 2AS5F 1I5ZA 1CF7A 1R9TJ 1RZ4A 2R4GA 2YUSA 3EYIA 2P5VA 3QRFF 2XF7A 5J4VA 2PMUA 3CCMI 4D7NA 1RKTA 3RTRA 3ABMH 2W82A 2DFFA 3GTOJ 5IT3A 1HF0A 5BPIA 5E8GA 1ZR2A 4D9JA 1MNDA 2KIFA 2VASA 3OSGA 2QSGX 5J1RA 3ZRGA 1XDSA 3OOPA 4IL6C 5F64A 3QPLA 3GYHX 3S32A 2Q8KA 2K3FA 1Y6IA 3ONQA 2ZC2A 2Z3YA 3OIPA 2XVCA 1I27A 1GVDA 1TWAJ 3PQJA 3V7SA 1YRNB 4KNYA 5LEJA 1JI8A 1T6SA 2UZKA 2QKLB 5EYRA 3CD6I 5E8IA 4RBOA 4XORA 2ELHA 3ZMSA 1JGSA 3QU6A 3TEDA 2PJRA 2WY7Q 3HG9A 2HDDA 4EJOA 3CDHA 2ISZA 4FETA 2E60A 2X48A 4XOTA 5FKOA 2EB7A 5FLMJ 2Z5UA 5DV5A 5E3MA 3KYLA 5J1UA 2QSHX 3WTTC 1T2KA 2VBYA 4Q4ZF 1V54H 5FRMA 1WCMJ 3K6GA 4BACA 2UXXA 1B9NA 2W00A 4EM1A 2JMWA 3CZ6A 5BQTA 3CCQI 5FLXZ 4R1HA 3NEUA 4HLXA 2F4MB 2DBBA 2DPUA 3WG7H 1IAWA 3O8GA 2FF4A 3C1DA 3F6OA 1MMNA 4BE0A 2P7VB 1WJFA 2RC4A 4XKVA 1T38A 2ID3A 2WAEA 4NBQA 3HOXJ 1Y1VJ 1MJAA 5L3FA 5IY5H 2VQLA 4L0ZB 4R8HA 1DU0A 3CCEI 1HSTA 3A02A 2ETHA 3H5RA 1IDYA 2NYXA 2OQGA 2B63J 3BQZA 3T1BA 4BL0B 4UUTA 5F0CA 3HPHA 1SD5A 5IYBJ 4HAMA 1SAXA 1PVEA 5JI6A 1MH3A 5EJCA 2E36A 5EZGA 3KPHA 1YE9A 5K5QA 2C6YA 2QKMB 2HXIA 3IWFA 3OSFA 1O7FA 5E3NA 4L5JA 3BG9A 1X3ZB 4HSRA 4I76A 3I4NJ 1J09A 4LJZF 2IRFG 2BXZA 4L5EA 4GRIA 4P55A 2Q1ZB 3GO5A 2VN2A 3PSIA 1D3YA 1YYVA 1I6XA 2COBA 2OAZA 2YR2A 4Z6YA 1FWZA 1OPCA 2X6YA 1ZKGA 2XUBA 2RN7A 3BP8A 4S04A 2Y69H 3G1OA 3KYDB 4LG0A 1XS9A 3BDDA 2CU7A 3BJ6A 3LQRA 1NK2P 2IGKA 3SEQA 1E2XA 3CDIA 1YG2A 2H09A 4R79A 1P6RA 2R92J 4IO9F 2B7EA 2OA4A 1SD4A 1P4AA 3K4KA 4B44A 1KU7A 1UJ8A 1DU6A 4Y15A 4CICA 1UFMA 4GDFA 3KP3A 2VKVA 2STTA 4DIQA 4ITVA 1K78B 5HLTA 3L00A 1X19A 1TNSA 2MBFA 1LB2A 1H88C 3QODA 2P8TA 4LG3A 1WFXA 1XCVA 4IOAF 3DLAA 3HYIA 2OD5A 3KFWX 2Q0OA 4WXDA 4WXHA 4MQVA 2IJLA 2CUEA 1TWHJ 2VQHA 2W48A 2X1CA 4LITA 5LRRA 2BBYA 2VJIA 2QYOA 2F4IA 1U2WA 1J5YA 3L9FA 4PJMA 2IGMA 1GXPA 2OV7A 1E0EA 1YJNI 3DBHB 1Z21A 3WE2A 4A0YA 4LLNA 2GIVA 1MDMB 1VQPI 4IQ4A 4IRHA 3BTIA 1A6QA 1IN6A 2ZMEA 4N0BA 3CQZJ 1STZA 3RZDJ 3ZMZA 4FX4A 2JTVA 3FKJA 3GW2A 3QPTA 3TO6A 5K1YA 2IVMA 1U78A 4C3HJ 1ZG3A 3VSLA 1A35A 3I56I 1YW7A 3AG2H 1Q1HA 2BY1A 3H9QA 4CUGA 1MJBA 1D5VA 1Z6TA 2Z33A 1FJLA 3D5RC 1PUFB 4BDYA 3CC4I 3VDXA 1ORKA 2BOLA 1FNNA 1MMGA 2BY2A 2OC6A 3ZMUA 4HF0A 5GTIC 3TDUC 3GX4X 4U0WA 1S72I 1F36A 3MWMA 3LNQA 3FX3A 2PI0A 2IGNA 2JN6A 4B1RA 2IS2A 4IRIA 4C2UA 4XRMA 4G6QA 2EFPA 1BI2A 3D1NI 1WPKA 1MSFC 2WAQN 2XF6A 1BM9A 1K83J 1ETVA 1T95A 3BR2A 4PDKA 1XC5A 4KIGA 4M3BA 3HXLA 4CYDA 1W0UA 2F48A 3O8HA 1PP8F 5DTDA 4UUVA 4YFXF 3KP6A 2MD5A 2DN0A 1B8IA 2H6BA 3MKWB 3W2WA 1LDKB 2ISYA 4PZJA 3FIWA 3V4GA 4XIDA 1NHAA 2ZJRF 2MABA 3OY9A 3OOUA 4HF2A 2V6CA 5EG0B 3G1MA 1ZTRA 3IUOA 2VI6A 1IV8A 3C7JA 3RYRA 2A69F 4AIKA 4HW0A 4RAGA 4A6EA 5D8KB 1T0FC 1BR1A 2L02A 4PCQA 1B4AA 2JZYA 3BTCA 2EPFA 4JP0A 5HDGA 1ZQ3P 4G7OF 2GAUA 3LMMA 2EV0A 3FMQA 4B48A 3TP3A 4OOIA 4FE4A 1G6NA 4IRGA 3G6EI 4CO8A 2DMNA 5L3DA 1S7AA 3HB9A 1USSA 2Z1DA 3M8FA 2OF7A 2R7FA 1MNMC 3BCAA 3AKZA 1CF7B 1U0JA 3SDBA 4BE2A 4ZZLA 1XN7A 2KHMA 5CQGA 1ZN2A 3HGYA 1PYVA 4YIFA 1BR4A 1IRFA 2M30A 5K7ZA 3ZQLA 1H0MA 3QYEA 4CXFA 2NAZA 5J1YA 3UKGA 1GV5A 1UAAA 3CCRI 3PO2J 4I6ZA 1E3OC 2Y9YA 2W85A 4P96A 1R23A 1G2HA 1OYIA 4NHJA 1ON2A 1LFUP 2MD0A 5IYCJ 4IF4A 3BC8A 3UR3C 4YFKF 1YFHA 4GFBA 3B02A 2W1OA 3A0HC 1VQ6I 2IS1A 4A2UA 2ZNYA 3HRUA 1ERDA 1KU9A 1EH7A 1K7AA 2PN6A 3I59A 1UHMA 5DM6F 1QZEA 1W5CC 5HLGA 3IWZA 4PSXA 2M7AA 5KVRA 5L3EA 2DAOA 1TQPA 2QEXI 2H6CA 3H92A 1Q1VA 4I99C 3GTJJ 2HKOA 1P9QC 4I0AA 1Z3XA 4EJUA 2ZMEC 1O7LA 1Y0UA 1CGPA 4HA8A 2TCTA 2DO7A 3CJNA 2EWNA 3MZHA 4V2FA 4IPAA 2M8GX 1Y8RB 4G7HF 3HTSB 2ECBA 2BW3A 3E3VA 3LOCA 3HIFA 2ESHA 1VQNI 2HTJA 2M3AA 4YFNF 1B72A 2RV8A 3PM1A 2LMDA 3PNYA 3F22A 1L3LA 2XSJC 5E17F 2DQRA 1YQAA 4ZDLA 1MD0A 5C4XJ 3F8CA 1R4MB 4G6DA 1YS7A 1VQ7I 1U5TA 4QSHA 3OR1C 2ZXWH 2X6WA 3LSTA 4KYWA 3WGIA 4IX7A 2CV2A 1ODDA 1V4RA 1G3TA 4M3GA 1E3PA 1YRNA 4L9VA 1R4NB 2E35A 4XN0A 3HOZJ 3WU2C 2XAQA 1T56A 5HODA 3T5XA 3OS0A 4BJTA 5F1RA 2WV1A 1TWCJ 1X58A 3OS2A 5EEGA 4XLNF 5ILVA 5BNGA 1FSHA 1D0YA 3S1RJ 3E5QA 4IHVA 5ICEA 2NS8A 2ME6A 2GQQA 3K69A 3OYLA 3E6DA 2VT3A 3QP5A 3FXOA 4DGWB 3MD2A 3SYTA 3FMSA 5H2FC 1ZLJA 4XRSA 4BDZA 1W36D 2CUZA 3ZQFA 3BG3A 3BJAA 4HX7A 5D5UB 2QENA 1M1EB 1AOYA 1SD7A 1V5GA 4GO1A 4A3GJ 4F7ZA 3LAJA 2XPVA 4KFCA 4XOPA 1P7IA 2Q2EB 3IH3A 3E7LA 1KYZA 2A6TA 3PUBA 2ZJQF 5F6FA 4LG0B 2XROA 3L1PA 5GP9A 5DM7F 1VQ9I 2AHQA 1TW2A 3K4NA 3AAFA 3CF2A 3DP7A 4BQNA 3RQIA 1IXRC 2LY9A 2FQ3A 2K9MA 2E1CA 3W3CA 4KA4A 1I3QJ 4PJLA 3DFGA 1P92A 3DWLE 3R0JA 1WJEA 2MG4A 2K9QA 4LB6B 4BU2A 1LNWA 3LA7A 2O03A 2XAFA 2X4HA 3ROUA 3KX2A 1UELB 1VI0A 1D5YA 2LYCA 3RQ4A 2QCOA 2RGVA 2VC1A 4AIDA 4DZJA 1PP7U 2DFHA 1TBXA 2LVSA 1IUFA 2R7OA 1J7KA 2A05A 2WA0A 4YRVA 2QUFA 4MEYF 2MH9A 2LK2A 2MYSA 3OYBA 2EFOA 2HZDA 2Z99A 4AVZA 4IOCF 4C2MJ 1X1PA 2W4SA 3R0AA 1Z3YA 3I9V2 5E79C 1PDNC 3WTYC 2PX9A 3VEPA 4LGWA 4D5CA 3OYCA 2QQBA 3QYFA 2KDOA 1S8NA 3IKVA 3ABUA 2AO9A 3EYYA 2VOPA 4G12A 3BR0A 2K9LA 4ANJA 2QQ8A 1T39A 5ICCA 5F0FA 3AG1H 2DJNA 3F3XA 4ENNA 4QTRA 5E20A 2EZIA 1K78A 2BY0A 2LH9A 3BTLA 3HEFA 4A3EJ 3GCMA 3RZOJ 3OYMA 3GVAA 2A5YB 1D1BA 4PJJA 1IG7A 2VC0A 2LP0A 2CQNA 4LIVA 2X51A 5HS8A 1QPIA 4II2A 4N9HA 1X2NA 2ECCA 3OWTA 4XKCA 5IP6A 1R1TA 1I3AA 2ME0A 2MLGA 2B0LA 2LDUA 3U1DA 3ISPA 4CH7A 3L09A 5CVJA 3DPTA 4HSTA 4ZZDA 5FD6A 3S14J 1MDMA 2FX0A 4MFEA 3HSFA 4ZYAA 3LAPA 4FT8A 3OIQA 3RIRA 2O7OA 2ZSIB 5KCMA 2HS5A 5FKKA 3PJRA 1WSUA 1BIAA 2R7QA 1Z7UA 4UXNA 2ELKA 3GZ6A 2L9NA 3RKQA 1ZYRF 2R7SA 4I09A 3GTQJ 2AXTC 3ZQGA 4XQFA 4A3CJ 1TC3C 1O3RA 1W5TA 4U87A 2CQXA 1E3HA 3GFMA 1WWXA 5DUIA 1YS6A 3HHHA 1NG6A 5HNHA 2ZXIA 1PUFA 1OQYA 1SMTA 1Z91A 4NDLA 3PL8A 5HLHA 4ABZA 3N97A 4RAYA 4HNUA 4RGXA 3TQNA 3H0DA 1TLHB 2HQAA 3LQQA 1NTCA 2E2JJ 5GAGJ 1XCBA 3B6CA 4KICA 2LG4A 1FTZA 4DOZA 4PFPA 2QA4I 1GHCA 3JAMK 2CO5A 5B1AH 2HNHA 3WE3A 1BW6A 4V19K 1BJAA 3TMOA 4UHTA 3KYCB 4P5OA 3OYHA 1MSEC 4WK8F 4UVAA 1VFCA 1R7JA 1EH8A 4M9ZA 4BUPA 2GXGA 1FOYA 4LK1F 1D0ZA 1KU2A 1FX7A 4OMZA 1B9MA 2ZBKA 1JKOC 2KJCA 3HRMA 4BJ5C 5JFRA 4AC0A 2L54A 2NVXJ 3HSEA 3H3UA 4Y3OA 5CVVA 3N4MA 1RUOA 3FK6A 3KCCA 1SAUA 3X2QH 5EDNA 4W97A 1AKHA 4JYKA 4M3DA 3FF5A 2VB6A 2R7VA 1Y8QB 2EA2A 2OJED 4L9TA 3R6SA 3CC2I 5F08A 4HRIA 2DFIA 3PO3J 5CVIA 4MQ9F 3ESWB 3CUQA 1ZK8A 3KZIC 3ZPLA 3SQNA 2ZKZA 3B6AA 4D5FA 4BE1A 4QIWN 3OV8A 3K4LA 1BC7C 2DQLA 2HFHA 4Q47A 1OCOH 4E7JA 5HS9A 2HOTA 2EZHA 1H89C 1MW7A 4UB6C 3V8LA 1SFKA 2IXSA 4AWXB 3IRQA 2H8RA 4EATA 2O9LA 1OR7A 3QP6A 4PJNA 1MMSA 1S6LA 1MBEA 3S3OA 2ZXJA 1WZ2A 2UWMA 5L3CA 3K4MA 3KIOA 1DP3A 3FM5A 1E17A 3DPUA 5B66C 2IA0A 1QRYA 1HA8A 4AVPA 4C3JJ 2BW3B 2DCEA 5J6XA 3S1NJ 2DT7B 2G0EA 2FBKA 4KIFA 5CPRB 5A2QZ 1B72B 1WVRA 2LF7A 1J59A 2EZLA 3LSKA 2I10A 5ICGA 2DDAA 1YX5A 1X1BA 1XSXA 2DA2A 3QAHA 6PAXA 1H9GA 2FNAA 5FFZA 2KKOA 3UNGC 1JHFA 2R5ZA 1U5TB 2RKHA 1XD7A 3RKXA 5LGNA 2OBPA 1UZCA 3O3KA 1T08B 2KJBA 5EEAA 2E1OA 3NRVA 1WRJA 5EZHA 4D1QA 2O0YA 5IT9K 1IRXA 3M4OJ 2VPRA 3M1CA 5EEHA 2JUCA 2IA1A 3SZPA 2F5CA 2R0QC 2H1KA 2R93J 4BYYA 4I7HA 2K4JA 1ENHA 2LC2A 3FKIJ 3MKLA 3GFIA 3WGGA 3CUOA 3JRIA 4PSWA 4B47A 2IEKA 3BQYA 3OIOA 4CCOA 1A6IA 5IPAA 4XSXF 2I5UA 3CJTB 1UMQA 3CESA 3MQ0A 2O3FA 5IYDJ 4YG2F 2HZTA 3FBIB 1YIJI 3NWSA 2VBWA 3LSPA 4BY1J 1IN5A 4BBRJ 3QQAA 3H9GA 1FOKA 2CV0A 3JRDA 4XKBA 2ZFWA 3JSOA 1Z77A 2NVTJ 1A31A 4CCLA 4D7MA 1WJ5A 4XN3A 4MGRA 4J00A 1MMAA 2ZFUA 2QQAA 2XGCA 3IL2A 3S1MJ 2L9RA 1FT9A 2MSYA 4N4NB 2NS0A 3TOBA 4IHWA 3L2WA 4DQ2A 2MA3A 1SVOA 4E7LA 2HTSA 1GVJA 1G3YA 1DGWY 2MLKA 1LDDA 2VKDA 3KLNA 3FXMA 4B4CA 5IP9J 4PJ0C 1BN5A 1BI1A 3HUGB 5JHFA 5FKMA 2KQRA 3ZMTA 1HKSA 4KDPA 4DBRA 2KMUA 1K6OA 2WB1A 3ASOH 3QYBA 2XRLA 4NC7A 3JTGA 2Z16A 2L7ZA 5D5VB 3WG9A 4RGSA 4BXUA 2V9VA 2EZKA 1TWGJ 3V7CA 2BGCA 2NVUB 1P4XA 2Q2EA 3RDIA 1ZG1A 4K2EA 3HOTA 1VQ4I 3K2ZA 1TQMA 2XAUA 4OU0A 3CC7I 3BY6A 1U6GA 3C3WA 1X3UA 2JRTA 1QZYA 1OR7C 3HKZN 4GGGA 3DTIA 2R7RA 3CCJI 4BEHB 1HW5A 4CHUA 5CKTA 5K7FA 1XGMA 5IOZA 3ZXSA 1IRZA 5M5XJ 2IS6A 4O3MA 3IKTA 3A0BC 3V42A 1ITYA 4EQQA 1VQ8I 4X0GA 3RCOA 1JKRC 2ADUA 2P0WA 1JT6A 4XKWA 1XGSA 4GYGA 3J81K 1LKXA 2EFQA 1ETXA 2JUGA 1MIJA 1W36C 4KT5C 2X0LA 2XB0X 2HVRA 4W1UA 3CCUI 2M1BA 3HC7A 1NK3P 3ZGKA 3PNTA 2HDCA 4NNJA 3DKWA 1VTNC 1XSDA 1J2XA 1FZPB 2KRCA 4G8XA 2P6SA 2DA6A 3ABTA 3LSJA 5ILSA 4GCVA 3TBIA 1R36A 2EH3A 5D6FA 1MNEA 3FM3A 3KLOA 1R71A 3CLOA 4L18B 1HKTA 3JTHA 2DPDA 3ELKA 2CS3A 1HXDA 4JOMA 5EGOB 4ZH4F 4Y33A 3JW4A 4HNVA 2L0KA 3U9GA 3NAUA 5E18F 3T8RA 1HC8A 3VB2A 3GTLJ 2J5PA 1ZLKA 3E0JB 4M6VA 2DA5A 2LREA 5H20A 1ZREA 2K02A 5GPCA 2M2EA 9ANTA 2M0MA 1VQMI 4XLPF 4OIQF 3BR6A 3K1MA 3PNVA 4AUXA 1OCTC 4LK0F 2HOEA 4WX9A 3CMYA 4BXXJ 4WXCA 2HQNA 1JUPA 3RPQA 3MFKA 1ETOA 1BJZA 5H6RA 3HM5A 4F55A 1Z7LA 2HQRA 2RVCA 5M3MJ 2DT5A 4FTHA 3TOAA 3TKYA 3K4CA 1RI7A 2NNNA 2O61A 1FC3A 3AG4H 3SDGA 1J0RA 5M5YJ 5LLQA 1AA7A 4EJVA 3BZ6A 4QPOA 3JSPA 1FY7A 1JJ6C 4M9XA 4CZCA 2NXNB 3D5SC 4MTEA 2E71A 3BG6A 1WQ2A 3CJQB 4EGZA 2CH0A 1BIBA 3ZOBA 1YITI 4A0XA 2DA3A 2L4AA 3MMYB 4IXAA 4Y17A 1QQIA 1AKHB 3W6VA 5D6EA 4PUSA 2EV6A 2GXAA 2PQ8A 1X2MA 1YO5C 4BY7J 1HSJA 3GXOA 3EETA 3S17J 2ICWG 3CUQB 2JA8J 3HOVJ 4MFDA 2E5NA 4EM2A 2CJJA 1R1VA 2IGOA 4Q5SF 3I0TA 1W0TA 1YX3A 2DMUA 2BYVE 3OYKA 3H3ZA 1O3QA 1Y1WJ 4LD5A 3F9KA 3IHUA 2HKXA 4BH9A 2KZGA 3K9TA 3F8FA 5DD4A 3WTUC 3G71I 4LLGF 5F04A 5FFXA 3ZP5A 5K7HA 1BW5A 3J81Z 5D4RA 2MGQA 4NQWA 2B9SA 1WI9A 3PSFA 4S05A 1LJ9A 4OIOF 3M8EA 3LSMA 2BZTA 2PMZN 3M1EA 1SVMA 2VXDA 1OKRA 2BHYA 4MHGA 3MEXA 4EMSA 2DJIA 2LR8A 2BXYA 4ETSA 3CO7C 3F8BA 1N75A 3PUFA 1G3WA 1MGTA 4U88A 3ZQ7A 4UY8I 1MBJA 2E2IJ 2OPTA 2IBDA 3MZ8A 2R5ZB 2L9VA 4XLAA 1FIAA 2X9DA 3P9IA 1X1CA 4IEJA 1QHHD 5C44J 5C4JJ 3OYIA 2O6GE 2CW7A 4PGGA 4FX0A 5D5XB 4BNCA 2XPWA 1WHUA 5FKNA 2ACJA 3GTMJ 2L9SA 3SZTA 4IHTA 4NC8A 1BOBA 3BR5A 3CLQA 3W2VA 2EILH 4CA0A 4HX8A 4LFUA 1HOMA 1ZAOA 4DBQA 2ZJ2A 3OL3A 4LB5A 3GZNB 4XRSG 4J01A 4IQJA 3C2GA 1RKWA 3K10A 2DYRH 4EV0A 2FU4A 4B43A 1V5FA 4UV8A 1ZRDA 2KIMA 4HYEA 2RREA 1OJLA 5B1BH 5J40A 4UUSA 3KETA 4KMFA 1DUXC 1EH6A 3VFZA 4DZPA 4M6XA 2HWVA 3TL4X 3HTUA 2LD5A 4XONA 4MEXF 3IC7A 4H0EA 4UVCA 1WJAA 2JSPA 2FBIA 3KP4A 5J8FA 5F27A 1HQCA 1IZ1A 3C2HA 3G3ZA 3LSRA 3DQVC 4C2TA 2XF5A 2EIJH 2TRTA 3FK7A 3ZN1A 5BMZA 2K9NA 1U8BA 2O8KA 2HR3A 2XAHA 4XR6A 2LBFB 3F21A 3A1YA 5KK1A 4DYCA 4Q48A 5AONA 1MKMA 2LOOA 2BEOA 4A6DA 3S16J 3HPGA 2JA5J 1QBJA 3ZN0A 4CCMA 2YU3A 4BHBA 2LY2A 4E7ZA 2QLZA 1IUYA 2HEOA 1YW9A 2LKXA 3W6KB 2QVOA 2EIMH 1U8RA 2DLLA 3KEOA 2FOKA 1JXSA 1ETWA 1UHSA 3MAJA 4RAZA 1D1AA 1IF1A 3DV8A 5FRNA 1SFUA 2NOJB 1F9NA 2MFZA 5GAHJ 3RKWA 3OS1A 5CJ9A 4A5NA 3JR9A 3DCFA 4M3EA 5J8CA 4YIRX 1TZLA 5JLWA 1JTYA 3A2KA 1ZELA 2M8EA 1ACIA 3FXRA 3EUAA 4FASD 3FXJA 2FJ1A 4MO7A 5L3GA 3BPVA 1HKQA 4A5MA 2OU2A 5KNLA 3BLYA 3EDPA 4ENKA 1TT5B 2L7KA 3J80K 2FBHA 2XKOA 4L0YB 2F4OB 3BZKA 3L2VA 4MNUA 5DD8A 3JRBA 5HNFA 5LHIA 3RYPA 2PMHA 2WB1N 1I50J 1LFPA 2HOAA 2L01A 1F43A 3HKZA 4E7KA 1ZH5A 2LRDA 3HUGA 3TW7A 2Z2SB 4A93J 3DTKA 2OZUA 2K7LA 4XLCA 3TP0A 4AYBN 3G4SI 1N77A 4ENJA 3KZYA 4B3AA 4U7BA 3PFIA 1G3SA 5DS9A 3FXKA 3GTKJ 2E5ZA 5K5RA 3GMEA 2WC2A 2CQ7A 1HCRA 3ERMA 1KZHA 1J75A 1TTYA 2FSWA 2HU9A 2R7WA 1U9OA 2V1DA 2GOMA 4EM0B 5L3BA 5HVQC 2DXIA 3E5UA 3S2WA 3GTPJ 2D1HA 4CCNA 3J7AO 4ESBA 1NH3A 3Q0WA 4M9SA 1DDNA 4BQQA 2OCEA 2PEXA 4AD9A 1SD6A 2EV5A 2LFBA 2LY1A 2VBXA 3NARA 4LIUA 4M72A 3J7ZI 4BEHA 2IS4A 4HX4A 2K86A 2X1DA 4AM3A 4RM3A 4ZJZA 1J9IA 3WTXC 1WH5A 4JX6A 3Q5FA 1RPWA 3KP2A 3TDZC 3I4MJ 2I8DA 1OCPA 1BOAA 1BI0A 3L2UA 4EEFG 3OYNA 5D8LB 1YIOA 4F93B 5DDGA 2JPBA 1UG2A 4D0PA 2NNYA 1B6AA 3GUDA 2R7ZJ 2KRHA 2LSOA 2H94A 1IV6A 2DI3A 3WU0A 3E6MA 2XHKA 4CYCB 2K40A 4TV7A 4ZYGA 5AIPA 2DMQA 2BVMA 2XRNA 3E6CC 5LD2C 1U5TC 4Y4RA 4MTDA 1MMDA 3Q3SA 3WTWC 3QPHA 4PFOA 3JRAA 3TW6A 5DCFA 3CO6C 1Y39A 2CUJA 1LDJA 3VPRA 3WU1B 3CCYA 2Y75A 4RB2C 2L4MA 1XSVA 5F0HA 1FIPA 3RSNA 4E7IA 1BI3A 3I55I 1I39A 2V4JC 5HS7A 5EGOA 1KQ9A 2K4BA 5DCMA 3IRRA 2M87A 1ZGJA 2IP2A 4M6YA 4RA2A 1P2FA 5GAEJ 3GZ5A 3LWFA 2E19A 1XMXA 4BHCA 2DOAA 2E1NA 3ASNH 4BS9A 4P9FA 4AIJA 2FMLA 4FE7A 3ECOA 2KLOA 2FXAA 3GTGJ 4BAYA 4HF1A 4M74A 4HLYA 3E97A 2OTLI 4G94A 4HNTA 3I53A 4ZTFA 4IJAA 4JBAA 4WF2A 2XGDA 4IZZA 4ZTJA 3Q0UA 2P5KA 1WJDA 2VPLA 4DW6A 1P7JA 2M0CA 2VKEA 5FROA 5E3OA 3I3LA 1A04A 3JRCA 1VQLI 1KU3A 2CQKA 5KAIC 1K79A 4E70A 3QOEA 1XPXA 1VQ5I 4I2OA 2GZWA 1IJWC 2TDXA 1DP7P 5E1ZB 2XAJA 4GYIA 4NQWB 4O5VA 2YX4A 1SEUA 5TJJA 2HYFA 3DEUA 3S3MA 4IHSA 5CVRA 4RLQA 2WADA 2QQ9A 5FLXK 3ABLH 1U9NA 3WHCA 2IPQX 4OWRB 4F91B 3ZCOA 2V79A 3V7RA 1ETKA 2K27A 2RNGA 1SFEA 1REPC 2PMZA 3MCZA 3HOSA 2Y9ZA 1YTYA 3GEZA 2G9WA 1IN8A 5B5EC 1MZBA 3LFKA 3S2HJ 5FB2A 3SJMA 1RESA 3I58A 3L2QA 1W1WE 2M7BA 4BGDA 4A3JJ 2CGPA 3H3VK 1BBYA 2KFDA 1VF9A 3U21A 2JA7J 2DDBA 1QO0D 2HXOA 4CDGA 4ESJA 2LLKA 3HGGA 4I0BA 2P4WA 2CSOA 3VOEA 2MH2A 1PUEE 1X1DA 1ON1A 2E1MB 2WY8Q 3EPZA 3QPSA 3LSIA 3DF8A 4ZYEA 3M07A 3K4BA 1R22A 3R61A 5E1XA 3W6JB 3OYEA 2HOSA 2X6XA 2DOEA 2MC3A 2A3SA 1HW2A 2M4KA 3BCBA 5CLSA 2HDWA 4UUSB 2W7NA 2R3SA 1Z0XA 5JHUA 1LPQA 2DK8A 5JLXA 3VSKA 2GWRA 3L7WA 4OAZA 3BOQA 3PIPF 3G1LA 2W25A 3EQLF 1QA6A 1XG1A 1ZRFA 2Y0SA 2RQQA 5J3LA 1MBGA 3DTEA 3CCSI 2Z9OA 4U7DA 2PLYA 1LFBA 2YS9A 1R6RA 3FHNA 3RPUD 1MJ9A 2FUG2 2KIUA 1AHDP 2PBIA 1ZHFA 2YX7A 2LKSA 4CGZA 1D8KA 1S3JA 2EQRA 2UUZA 2GA1A 1GV2A 3DPLC 2F5FA 3U2RA 3CMEI 3FMRA 2VLAA 2A07F 3E5XA 4M71A 2KRFA 3QWLA 3ZMVA 4U0YA 2K5CA 5FD5A 1WI3A 2E7WA 4IVNA 1SFXA 1GT0C 3IH2A 2L3DA 3AFHA 2A6HF 2COMA 3V8KA 2JT1A 4ZYDA 4XNFA 3IV5A 2P7CB 1X1AA 3S3NA 2VXZA 3G2BA 2D2WA 4HV5A 3M7GA 1Y0NA 1IN4A 2XASA 4I01A 3J7YJ 4XLHA 2VL8A 2IA2A 3OYJA 3DKXA 5IOYA 5FJ8J 5AIQA 3JAMZ 1TL8A 1ONVA 4C3IJ 4KT6A 4A0ZA 4BHPA 3D5LA 4EGYA 1BC8C 3CP2A 4A3MJ 4RM2A 5E3LA 2EJRA 1K6YA 2OCCH 3M9AA 4AIHA 4KN4X 2JK3A 3OYAA 1I1SA 3F0CA 4IHXA 1VQKI 4HQMA 4E7HA 1O3TA 2FE3A 5LHHA 2V26A 2LF8A 3BT9A 3MN2A 3S93A 2FA5A 1HW1A 2LBFA 4U0VA 4A3FJ 3OYDA 4GXOA 3WHBA 1APLC 2QBYA 2JA2A 2KPMA 1R5HA
chains in the Genus database with same CATH topology
4PUSA 3SYTA 3MKZA 4DJAA 4BDZA 1W36D 2CUZA 4BQOA 3BG7A 1V5GA 2R7XA 4XOPA 3LSHA 2E5NA 2O5RA 2IGOA 2Q2EB 2A6TA 3PUBA 4HG2A 1YX3A 3CP8A 2KZVA 4F92B 2V6EA 4ZDPA 3OYKA 4AYBA 2CFOA 3LFUA 3HL2A 3K4NA 3CF2A 3F9KA 4XLFA 4BQNA 2K9MA 2V9KA 3W3CA 4KITB 1D0XA 2V7FA 2ZSHB 3VYUB 3SEZA 4XL9A 4MLOA 4PJLA 3DWLE 1WJEA 4CCKA 3DU6A 2JVGA 4AU7A 1S9HA 3PSFA 4PK4A 4BXFA 3L2RA 2GOXB 3LSMA 4BU2A 2ZXHA 3K70D 3VWBA 3A4CA 2VXDA 4II3A 3KX2A 1UELB 2DJIA 1G8XA 4ZC3A 2LYCA 1N75A 3RQ4A 2R7UA 4N4OB 2V1NA 2VKHA 1GLNA 4XLAA 2R7OA 3N05A 1X1CA 2WA0A 1QHHD 5CQEA 4YRVA 3OYIA 2M4GA 2CW7A 3DKYA 1FMWA 3LSGA 3K4JA 3PFYA 2MYSA 1QHGA 3OYBA 2X85A 2F5VA 2HZDA 2L9SA 2R4GA 4NC8A 4XMYA 4AVZA 1BOBA 3OYFA 2XF7A 2W4SA 3W2VA 1Z3YA 3I9V2 4CA0A 3RTRA 2W82A 4DBQA 3OYCA 3OL3A 3QYFA 2KDOA 4D9JA 1MNDA 4J01A 2VASA 2K9LA 1D1CA 4ANJA 4IQJA 3C2GA 3ZRGA 3K10A 3S8PA 4B43A 1V5FA 3S32A 2RREA 3KEYA 1Y6IA 2LH9A 3ONQA 4CSWA 3OIPA 3OYMA 4XLEA 2CW8A 1D1BA 4PJJA 3TL4X 3DEEA 2WAFA 4LIVA 2X51A 1JI8A 1EA3A 4II2A 3OWTA 2QKLB 4XKCA 4XONA 4XORA 1WJAA 2JSPA 2PJRA 2WY7Q 3HG9A 4CH7A 3DPTA 4HSTA 4FETA 2E60A 3C2HA 3FBNB 3DQVC 4XOTA 4C2TA 2XF5A 2HVQA 4ZYAA 3KYLA 3OIQA 3PJRA 2ZSIB 5KCMA 4XR6A 2LBFB 3VYSB 3A1YA 2R7QA 5FRMA 3K6GA 4BACA 2L9NA 2R7SA 2LOOA 2VQGA 2W00A 3CZ6A 3HPGA 4XQFA 1X4OA 4CCMA 2LY2A 4U87A 3AL0C 4E7ZA 4E6KG 3OMYA 1NG6A 5HNHA 2ZXIA 2KP6A 1MMNA 4XM3A 4BE0A 3PL8A 1WJFA 4XKVA 4HNUA 2WAEA 3IP4B 3H0DA 2HQAA 2VQLA 2VJJA 1D1AA 3H5RA 2LG4A 5FRNA 2NOJB 4DOZA 4PFPA 4BL0B 3OR2C 2HNHA 4C9YA 3HPHA 3TMOA 2MFZA 3OS1A 4P5OA 3OYHA 1TZLA 3A2KA 1ZELA 4BUPA 3EUAA 4FASD 4KJZA 1D0ZA 1YE9A 4BJ6C 1UG0A 5KNLA 2QKMB 3BLYA 2L7KA 4BJ5C 3L2VA 4HEA2 5HNFA 4HSRA 4Y3OA 1LFPA 1J09A 1SAUA 3HKZA 4E7KA 4C30A 4GRIA 2Q1ZB 2VB6A 2LRDA 1WJBA 2R7VA 2Z2SB 3DTKA 4XLCA 3PSIA 1N77A 4HRIA 4E4HA 2VJ4A 2VIXA 3VYRB 4U7BA 2X6YA 1G59A 3E1SA 2E5ZA 2MC4A 4BE1A 2X1EA 3K4LA 3IAS2 3SZGA 3ZQQA 2IGKA 4E7JA 2HU9A 2R7WA 2XDVA 3SEQA 1MW7A 2GOMA 1SFKA 2IXSA 5HVQC 2DXIA 4R79A 1BR2A 4EATA 4CCNA 4B44A 3K4KA 4G6TB 3M8JA 4PJNA 3S3OA 2UWMA 2R7TA 3K4MA 1DP3A 1FMVA 4RMNA 3DPUA 4BQQA 4DIQA 4ITVA 4F3QA 1HA8A 4LIUA 2IS4A 2LY1A 2BW3B 2DCEA 2DT7B 4BEHA 1X19A 5HLTA 2AQEA 3QODA 4LG3A 1LVKA 1WFXA 1QU3A 3DLAA 5CPRB 4CCJA 2X1DA 4RM3A 4YEJA 4ZJZA 2CMPA 2I8DA 3LSKA 3L2UA 1YX5A 2VQHA 3OYNA 1X1BA 4LITA 2X1CA 2AQFA 2VJIA 2F4IA 3EUKL 3UNGC 4F93B 4PJMA 2PJRB 2IGMA 2KRHA 2OV7A 1E0EA 1Z21A 2BVMA 4IQ4A 5LD2C 4Y4RA 4D1QA 1IRXA 3M1CA 1MMDA 4PFOA 5KHDA 2LC2A 1PJRA 3FKJA 4KISA 1N78A 2CUJA 3H35A 4PSWA 3VSLA 4B47A 4CCOA 4CUGA 3H9QA 3RSNA 3GBGA 4E7IA 3CESA 2V4JC 3AL0B 3D5RC 2A5WA 4BDYA 3VDXA 1DGRM 5LFAA 2BOLA 3FBIB 4B3XA 1MMGA 2OC6A 4IKFA 3NWSA 2DOAA 4BS9A 2IGNA 3H9GA 2CV0A 2UV1A 4XKBA 2IS2A 2KLOA 4C2UA 4F52A 4CCLA 1WJ5A 3FDYA 4XN3A 3MKYB 2XF6A 4J00A 1MMAA 2OUMA 1T95A 4HNTA 4ZTFA 4ZDOA 4ZTJA 2ZFUA 4IZZA 3HXLA 2HPMA 1WJDA 2VPLA 1OLTA 4N4NB 5FROA 3I3LA 3L2WA 2KL4A 4H4KC 3MKWB 3QOEA 4E7LA 3H9JA 3W2WA 1LDKB 4E7SA 1DGWY 2VKDA 2MABA 4NQWB 3OY9A 3OOUA 3CJRB 3S3MA 3IUOA 3HUGB 4RLQA 5JHFA 1V5EA 3LL7A 3ZR8X 2WADA 1T0FC 2KQRA 1BR1A 4OWRB 4F91B 4DBRA 2KMUA 2WB1A 3ZCOA 2F6CA 3QYBA 4NC7A 3LMMA 2RNGA 4B48A 2Z16A 1Y56A 2PMZA 3HOSA 3DU5A 2CV1A 5HOOA 2VQCA 2Z1DA 4OAYA 3L2QA 2M7BA 4BGDA 3BCAA 3AKZA 3OYGA 1U0JA 3SDBA 2HPIA 3U21A 3HOTA 4BE2A 2KHMA 5CQGA 2XAUA 1PYVA 2L2OA 1BR4A 1OR7C 3DTIA 2R7RA 1DQUA 1X1DA 2E1MB 2WY8Q 4BEHB 3EPZA 5CKTA 3QYEA 3LSIA 1WJCA 3ZXSA 2IS6A 3V42A 1UAAA 3K4BA 4X0GA 3RCOA 3OYEA 2P0WA 3W2AA 2X6XA 2ELJA 2E1MC 4XKWA 2M4KA 1LKXA 2JUGA 2MD0A 3BCBA 1W36C 2HDWA 2XC7A 3BC8A 2W7NA 3UR3C 2W1OA 2HVRA 2IS1A 3VSKA 1ERDA 4OAZA 3HC7A 3EUHC 3PNTA 3ZGKA 2L5QA 2VJ5A 2Y0SA 4NNJA 2RQQA 2KRCA 3DTEA 4PSXA 2M7AA 3TBIA 2JVHA 3H5NA 1MNEA 1R6RA 1KONA 3FHNA 1P9QC 2FUG2 1VZ0A 4P1WA 1Z3XA 3RPUD 4QPQA 2UUZA 3DPLC 3NWTA 2VLAA 2CS3A 4JOMA 3K70C 4Y33A 3CMMA 2BW3A 2K5CA 3E0JB 4YELA 2M3AA 2DT6A 5TGTA 2WBMA 3AFHA 2LREA 3PNYA 2XSJC 4XNFA 4ZDLA 3VYTB 1X1AA 3OL4A 3S3NA 2M0MA 4RLFA 2VXZA 3G2BA 2HVSA 3PNVA 3OR1C 4XLHA 2X6WA 2VL8A 4IX7A 3J7AY 3OYJA 4HPQA 2CV2A 3DKXA 1X4PA 4KT6A 3D5LA 1NG7A 3IAM2 3CP2A 4XN0A 4RM2A 1K6YA 2WAQA 3OS0A 4F55A 4BJTA 1Z7LA 3OYAA 4JQFA 3K4CA 4E7HA 3OS2A 2V26A 1TT0A 1AA7A 4QPOA 3S93A 2BVLA 4CZCA 1D0YA 2K3PA 2LBFA 3D5SC 3BG6A 3CJQB 3OYDA 2CH0A 3H5AA 3OYLA 4NUBA 3MMYB 2JA2A 4DGWB 3MD2A 2KPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DT6 A;  1X4O A;  2E5Z A;  1X4P A;  1UG0 A;  4DGW B;  2DT7 B;  2E60 A; 
#chains in the Genus database with same CATH topology
 1HBX G;  5IP7 J;  2NOG A;  3ABK H;  5DYM A;  3MKZ A;  3JRG A;  5D4S A;  4BQO A;  3LA3 A;  2ZNZ A;  2HQ5 A;  2QM3 A;  1XTA A;  3Q9S A;  4JX4 A;  3LSH A;  4JX5 A;  4ESF A;  3I64 A;  4HG2 A;  3K1N A;  2KZV A;  3BRO A;  4F92 B;  2HGC A;  3KE2 A;  3CUQ C;  4AYB A;  1DPR A;  1POG A;  2CFO A;  3CTA A;  3LFU A;  1F1Z A;  1LUJ B;  4QWQ A;  3F8N A;  2RNJ A;  4X1E A;  2FQ4 A;  1W7P B;  4KIT B;  2G7U A;  1D0X A;  3VYU B;  1FOW A;  2EIN H;  1T0F A;  2WTE A;  1Z67 A;  2XKP A;  3WTZ A;  4CCK A;  2JVG A;  1S9H A;  4KIB A;  4PK4 A;  3M3Y J;  3VWB A;  2GOX B;  3K70 D;  2ZXH A;  3A4C A;  5J4Y A;  3I4P A;  2P81 A;  1LEA A;  4EJW A;  1LEB A;  3E6B A;  1G8X A;  3RI4 A;  2ESN A;  1N25 A;  3LA2 A;  5HDN A;  2DW4 A;  2R7U A;  4N4O B;  4HBL A;  1S29 A;  1IXS B;  2O8X A;  4MIM A;  1R49 A;  4J19 A;  2VKH A;  3CMA I;  1GLN A;  3FZV A;  1YOV B;  2CYY A;  1AWC A;  3N05 A;  5CQE A;  2FNP A;  1MBK A;  2M9H A;  2M4G A;  1B59 A;  2XGX A;  1FMW A;  1FBQ A;  5C3E J;  3PFY A;  5IT9 Z;  1QHG A;  2CUF A;  4G7Z F;  1FYK A;  2D1V A;  2M34 A;  3WTV C;  3KEQ A;  2F5V A;  4XMY A;  2X6O A;  3OYF A;  4JK1 X;  3GFL A;  2KIS A;  4DNC A;  1QVT A;  2XB5 A;  5LEK A;  4LLL A;  1LE8 B;  3WGH A;  3SHF A;  2IT0 A;  2J5O A;  1EV7 A;  1TQI A;  2G7H A;  1R5G A;  3FWE A;  4UVB A;  1D1C A;  1AU7 A;  4P9U A;  3ULQ B;  2DOD A;  1GDT A;  1EF4 A;  3S8P A;  1XX5 A;  5DCM B;  4BBS J;  1R1U A;  1U3E M;  3P9C A;  4Y52 J;  2F2E A;  4B09 A;  2D45 A;  3KEY A;  4CSW A;  3FHZ A;  3TGN A;  3PQK A;  1JKP C;  2DMP A;  3ML6 A;  4XLE A;  2QF7 A;  1SAN A;  2CW8 A;  3HHG A;  3DBL B;  1YHQ I;  3H0G J;  3DEE A;  1T33 A;  2WAF A;  2QWW A;  1G4D A;  1EA3 A;  1RR7 A;  5ILU A;  4BQA A;  1FSE A;  1IRG A;  3JRF A;  4RAF A;  3V8J A;  2RDP A;  2VE8 A;  2Y31 A;  1JHH A;  3HDD A;  1Z9C A;  2L7F P;  2Y48 A;  4HOB A;  3GLX A;  1HDP A;  2XIG A;  4CYC A;  3FBN B;  2EA4 A;  3G73 A;  4ENM A;  4A3K J;  2VT2 A;  1FEX A;  2HVQ A;  1A36 A;  5M3F J;  3HRS A;  5B3S H;  1JE8 A;  3VYS B;  1R5I D;  3BPX A;  1ZRC A;  2VQG A;  1ULY A;  2PFB A;  5JR3 A;  4I98 B;  1X4O A;  1XMK A;  3SFZ A;  2CWE A;  2JJ7 A;  1W7P D;  1FPQ A;  3AL0 C;  2EIK H;  4E6K G;  3OMY A;  2K9S A;  1JJ8 C;  2KP6 A;  5DUK A;  4XM3 A;  2XGE A;  3FXL A;  3KP7 A;  1QZZ A;  3D0S A;  2GA2 A;  3IP4 B;  1V3F A;  1XMA A;  2NVQ J;  2VJJ A;  3HJE A;  2VBZ A;  1LVA A;  3A01 B;  3DBR B;  3RPU A;  3B73 A;  5LRS A;  5FGM A;  1A5J A;  4KUM A;  2NS7 A;  3OR2 C;  2CG4 A;  4C9Y A;  1VQO I;  2K85 A;  2GM4 A;  3DXJ F;  3TO7 A;  1RUN A;  1I1G A;  4WWC A;  2R5Y B;  2GLO A;  4B8X A;  4KMU X;  1FYM A;  1MBF A;  4KJZ A;  1VND A;  3O6B B;  5HLI A;  4BJ6 C;  1UG0 A;  2E7X A;  1I6H J;  2QGU A;  4BKX A;  2FEZ A;  2ID6 A;  2M5W A;  4S0H B;  4HEA 2;  3KP5 A;  2W24 A;  5E1W A;  1ETY A;  4YII A;  3REO A;  2DA7 A;  3C2B A;  4C30 A;  2R7D A;  1WJB A;  1FBS A;  4FHT A;  2YPR A;  1F4K A;  3O2P E;  2RAE A;  2XSD C;  5GTH C;  4E4H A;  5TIS C;  2VJ4 A;  2VIX A;  4Z2Y A;  3VYR B;  2LNB A;  1RNL A;  3HZJ A;  1G59 A;  3E1S A;  3FIS A;  3DLL F;  1JGG A;  2MC4 A;  2X1E A;  3IAS 2;  1O57 A;  3R60 A;  3SZG A;  3ZQQ A;  5KAF C;  5LGU A;  4X6A J;  2V1U A;  2HYJ A;  2KDZ A;  1K4S A;  2XDV A;  2HYG D;  3C18 A;  4XSZ F;  5FO5 A;  4M3F A;  3WTS C;  1BR2 A;  2NVY J;  2BE5 F;  4A3B J;  4G6T B;  2BV6 A;  4RB1 A;  3M8J A;  1IN7 A;  2ZO4 A;  2R7T A;  1KQ8 A;  1FMV A;  4RMN A;  4F3Q A;  2V1X A;  2V9P A;  2AQE A;  2JWT A;  1KQ0 A;  1TWF J;  2EFN A;  2ZJP F;  1LVK A;  1QU3 A;  4CCJ A;  3S2D J;  1EJ9 A;  4YEJ A;  2JA6 J;  2A68 F;  2CMP A;  4XRF A;  2NRA C;  1OIS A;  3RKY A;  2Y0S N;  1IDZ A;  4WCG A;  1SMY F;  3Q9V A;  3ECH A;  4CZZ A;  3EUH A;  2AQF A;  3EUK L;  1K4T A;  2H27 A;  5ED4 A;  2EBI A;  2PJR B;  2FMY A;  3K0L A;  1LQ1 A;  2VON A;  2STW A;  1QPM A;  1MBH A;  1Z05 A;  3ZQC A;  2JSC A;  4KN7 X;  2IW5 A;  1FYL A;  1JTX A;  3JRH A;  1FP1 D;  3BZC A;  1JUS A;  1T98 A;  2VUM J;  1RR8 C;  1L0O C;  5KHD A;  1PJR A;  1N78 A;  3A03 A;  4O6J A;  4A69 C;  4KIS A;  2FRH A;  3PIO F;  3H35 A;  5CYV A;  1YJW I;  1OFC X;  1UB9 A;  2Y30 A;  2OTJ I;  1OCR H;  1IC8 A;  3GBG A;  2XV4 S;  3AL0 B;  1WKM A;  1ZR4 A;  2A5W A;  3AG3 H;  5BS6 A;  3S15 J;  1DGR M;  5LFA A;  3BR1 A;  4B3X A;  2UXN A;  2DU9 A;  1H8A C;  4OIN F;  1S7E A;  5FKL A;  4OIR F;  2QBY B;  4IKF A;  4Y7N J;  3CF5 F;  1S7O A;  5DEQ A;  3VOD A;  3FXQ A;  2UV1 A;  3DEW A;  1OYY A;  4A3I J;  3HRT A;  5BOX A;  4FQG A;  4F52 A;  4XIC A;  3FDY A;  3TO9 A;  3MKY B;  2OUM A;  1RRJ A;  4ZDO A;  1YLF A;  3BWG A;  2HPM A;  3K7A J;  4QLC U;  1OLT A;  4EVI A;  1RC9 A;  1IGN A;  2KL4 A;  2XAG A;  4H4K C;  1XDU A;  3H9J A;  5EF6 A;  2P5L C;  3HSR A;  4L9N A;  2JRM A;  4XK4 A;  3L2C A;  4E7S A;  3I71 A;  3T0Y A;  2ZCW A;  1QGP A;  4FIS A;  1TW3 A;  3CJR B;  4OMY A;  1Z6R A;  1V5E A;  3LL7 A;  3ZR8 X;  1JKQ C;  2F5D A;  2VOO A;  1D8J A;  4A3L J;  1ETQ A;  3F6V A;  1JT0 A;  3H1C A;  3CCV I;  2F6C A;  2OZ6 A;  2DTZ A;  2GIZ A;  4M73 A;  3GLL A;  2BHZ A;  4N9I A;  2GXB A;  1Y56 A;  1KGS A;  4UB8 C;  3SXY A;  3CCL I;  3NQO A;  4RGR A;  3HOY J;  2DOF A;  1GUU A;  2H1L A;  1Z1D A;  3DU5 A;  2CV1 A;  5TRD A;  5HOO A;  2VQC A;  4HDV A;  3T8T A;  3IH4 A;  4I02 A;  4NB5 A;  2F5E A;  3ERE D;  4OAY A;  2OQR A;  2LKP A;  3OYG A;  1FOX A;  2HPI A;  1XGO A;  2EFW A;  1FP2 A;  1HDD C;  1XGN A;  2L2O A;  2EK5 A;  4DYQ A;  4IHY A;  3MVP A;  1DQU A;  3F23 A;  1WJC A;  2VOD A;  4L5I A;  1W7P A;  3F72 A;  2QSF X;  1QNT A;  1BA5 A;  2AXL A;  3K2A A;  3FXU A;  3W2A A;  5FLV A;  2ELJ A;  4UV9 A;  4Y13 A;  2E1M C;  1ZGW A;  4FCY A;  3HOW J;  1P4W A;  1TP4 A;  2XC7 A;  1SVL A;  4L9J A;  2DK5 A;  1ZAR A;  3I5U A;  2FD5 A;  4RS8 A;  2CRG A;  3BR3 A;  2E2H J;  3GF2 A;  1YJ9 I;  2DFE A;  3EUH C;  1RET A;  1S5L C;  2L5Q A;  2E34 A;  2VJ5 A;  2H8W A;  3JCU C;  2GBY A;  2ZB9 A;  3GWZ A;  3COA C;  1R00 A;  2CFX A;  2ZME B;  4DYR A;  2JVH A;  3F8M A;  3H5N A;  5M5W J;  2QZ8 A;  5JVT A;  3HOU J;  3S1Q J;  1KON A;  4P1W A;  2PJP A;  1OCZ H;  1VZ0 A;  3ZQI A;  1W4M A;  4QPQ A;  1YW8 A;  2N8G A;  3NWT A;  2M45 A;  2L7M P;  1YI2 I;  1BL0 A;  1EKE A;  3K70 C;  2JPC A;  1OYW A;  2Y2Z A;  4HV6 A;  4ASN A;  3WOD F;  3CMM A;  3QOP A;  1O3S A;  1H9T A;  1LE8 A;  3P7N A;  2Y0M A;  3R4K A;  4YEL A;  2DT6 A;  5TGT A;  1KA8 A;  1ZG5 A;  2WBM A;  3HBL A;  1UHW A;  2CQQ A;  5A2Q K;  5BPD A;  3VYT B;  3OL4 A;  4RLF A;  2WWY A;  2HVS A;  3QU3 A;  2DA1 A;  3J7A Y;  2P6T A;  4HPQ A;  1X4P A;  1RIO H;  5ERI A;  2IAI A;  5LBQ A;  3IAM 2;  1NG7 A;  1IXC A;  2KT0 A;  5JVG F;  1SC7 A;  1B8I B;  3Q0V A;  2WAQ A;  3MZY A;  1XB4 A;  3I54 A;  5ICF A;  4NC6 A;  3CDL A;  4JQF A;  3RJP A;  1FLI A;  1TT0 A;  1OCC H;  2W57 A;  3J80 Z;  2BVL A;  2RQP A;  1QVU A;  2K3P A;  2A6E F;  5D5W B;  4ZYH A;  4UNO A;  2DTR A;  5CVU A;  3H5A A;  4NUB A;  4PGH A;  5F1J A;  2BY3 A;  2YSR A;  1SFO J;  4DJA A;  1K61 A;  1DPU A;  3P5J A;  3SFI A;  3BG7 A;  1IO2 A;  1OMI A;  4RB3 C;  2PG4 A;  2DA4 A;  2R7X A;  5H6Q A;  1KYW A;  2W84 A;  4HQE A;  2O5R A;  1CQT A;  1B1B A;  2WV0 A;  3P9K A;  3ZQH A;  2XPU A;  3CP8 A;  3U1K A;  4HDU A;  2V6E A;  4ZDP A;  3A01 A;  4XBF A;  2D5V A;  1TNT A;  2HI3 A;  3K1P A;  4OIP F;  3HL2 A;  1R58 A;  1MH4 A;  4G9Y A;  2DMT A;  4XLF A;  3ZMD A;  2V9K A;  2VE9 A;  2V7F A;  2ZSH B;  5J47 A;  3BTJ A;  3SEZ A;  4RDU A;  1WGX A;  4XL9 A;  4MLO A;  2A61 A;  5K5O A;  2R5Y A;  3DU6 A;  1W5S A;  3BJO A;  3BG5 A;  4RGU A;  4AU7 A;  5EG0 A;  4BXF A;  3L2R A;  1HLV A;  4V2G A;  3JRE A;  1O4X A;  2MW8 A;  4II3 A;  4ON0 A;  1V55 H;  4HZF A;  2FOW A;  5LGT A;  1JUM A;  1WH7 A;  1F5T A;  4EJT A;  4A12 A;  2DYS H;  3KZZ A;  4ZC3 A;  4LMY A;  3I59 B;  5HDK A;  2CW0 F;  2V1N A;  4LOC A;  1C0W A;  2KIQ A;  2LTP A;  1FTT A;  1GXQ A;  1T8I A;  5LHG A;  1X3W B;  5GPA A;  1UST A;  3H36 A;  2JQ7 A;  3GFJ A;  5GAD J;  3DKY A;  1IW7 F;  1ZGA A;  4RB0 A;  2YU9 J;  3LSG A;  3K4J A;  1UCR A;  4A3D J;  2X85 A;  1FBU A;  2AS5 F;  1I5Z A;  1CF7 A;  1R9T J;  1RZ4 A;  2R4G A;  2YUS A;  3EYI A;  2P5V A;  3QRF F;  2XF7 A;  5J4V A;  2PMU A;  3CCM I;  4D7N A;  1RKT A;  3RTR A;  3ABM H;  2W82 A;  2DFF A;  3GTO J;  5IT3 A;  1HF0 A;  5BPI A;  5E8G A;  1ZR2 A;  4D9J A;  1MND A;  2KIF A;  2VAS A;  3OSG A;  2QSG X;  5J1R A;  3ZRG A;  1XDS A;  3OOP A;  4IL6 C;  5F64 A;  3QPL A;  3GYH X;  3S32 A;  2Q8K A;  2K3F A;  1Y6I A;  3ONQ A;  2ZC2 A;  2Z3Y A;  3OIP A;  2XVC A;  1I27 A;  1GVD A;  1TWA J;  3PQJ A;  3V7S A;  1YRN B;  4KNY A;  5LEJ A;  1JI8 A;  1T6S A;  2UZK A;  2QKL B;  5EYR A;  3CD6 I;  5E8I A;  4RBO A;  4XOR A;  2ELH A;  3ZMS A;  1JGS A;  3QU6 A;  3TED A;  2PJR A;  2WY7 Q;  3HG9 A;  2HDD A;  4EJO A;  3CDH A;  2ISZ A;  4FET A;  2E60 A;  2X48 A;  4XOT A;  5FKO A;  2EB7 A;  5FLM J;  2Z5U A;  5DV5 A;  5E3M A;  3KYL A;  5J1U A;  2QSH X;  3WTT C;  1T2K A;  2VBY A;  4Q4Z F;  1V54 H;  5FRM A;  1WCM J;  3K6G A;  4BAC A;  2UXX A;  1B9N A;  2W00 A;  4EM1 A;  2JMW A;  3CZ6 A;  5BQT A;  3CCQ I;  5FLX Z;  4R1H A;  3NEU A;  4HLX A;  2F4M B;  2DBB A;  2DPU A;  3WG7 H;  1IAW A;  3O8G A;  2FF4 A;  3C1D A;  3F6O A;  1MMN A;  4BE0 A;  2P7V B;  1WJF A;  2RC4 A;  4XKV A;  1T38 A;  2ID3 A;  2WAE A;  4NBQ A;  3HOX J;  1Y1V J;  1MJA A;  5L3F A;  5IY5 H;  2VQL A;  4L0Z B;  4R8H A;  1DU0 A;  3CCE I;  1HST A;  3A02 A;  2ETH A;  3H5R A;  1IDY A;  2NYX A;  2OQG A;  2B63 J;  3BQZ A;  3T1B A;  4BL0 B;  4UUT A;  5F0C A;  3HPH A;  1SD5 A;  5IYB J;  4HAM A;  1SAX A;  1PVE A;  5JI6 A;  1MH3 A;  5EJC A;  2E36 A;  5EZG A;  3KPH A;  1YE9 A;  5K5Q A;  2C6Y A;  2QKM B;  2HXI A;  3IWF A;  3OSF A;  1O7F A;  5E3N A;  4L5J A;  3BG9 A;  1X3Z B;  4HSR A;  4I76 A;  3I4N J;  1J09 A;  4LJZ F;  2IRF G;  2BXZ A;  4L5E A;  4GRI A;  4P55 A;  2Q1Z B;  3GO5 A;  2VN2 A;  3PSI A;  1D3Y A;  1YYV A;  1I6X A;  2COB A;  2OAZ A;  2YR2 A;  4Z6Y A;  1FWZ A;  1OPC A;  2X6Y A;  1ZKG A;  2XUB A;  2RN7 A;  3BP8 A;  4S04 A;  2Y69 H;  3G1O A;  3KYD B;  4LG0 A;  1XS9 A;  3BDD A;  2CU7 A;  3BJ6 A;  3LQR A;  1NK2 P;  2IGK A;  3SEQ A;  1E2X A;  3CDI A;  1YG2 A;  2H09 A;  4R79 A;  1P6R A;  2R92 J;  4IO9 F;  2B7E A;  2OA4 A;  1SD4 A;  1P4A A;  3K4K A;  4B44 A;  1KU7 A;  1UJ8 A;  1DU6 A;  4Y15 A;  4CIC A;  1UFM A;  4GDF A;  3KP3 A;  2VKV A;  2STT A;  4DIQ A;  4ITV A;  1K78 B;  5HLT A;  3L00 A;  1X19 A;  1TNS A;  2MBF A;  1LB2 A;  1H88 C;  3QOD A;  2P8T A;  4LG3 A;  1WFX A;  1XCV A;  4IOA F;  3DLA A;  3HYI A;  2OD5 A;  3KFW X;  2Q0O A;  4WXD A;  4WXH A;  4MQV A;  2IJL A;  2CUE A;  1TWH J;  2VQH A;  2W48 A;  2X1C A;  4LIT A;  5LRR A;  2BBY A;  2VJI A;  2QYO A;  2F4I A;  1U2W A;  1J5Y A;  3L9F A;  4PJM A;  2IGM A;  1GXP A;  2OV7 A;  1E0E A;  1YJN I;  3DBH B;  1Z21 A;  3WE2 A;  4A0Y A;  4LLN A;  2GIV A;  1MDM B;  1VQP I;  4IQ4 A;  4IRH A;  3BTI A;  1A6Q A;  1IN6 A;  2ZME A;  4N0B A;  3CQZ J;  1STZ A;  3RZD J;  3ZMZ A;  4FX4 A;  2JTV A;  3FKJ A;  3GW2 A;  3QPT A;  3TO6 A;  5K1Y A;  2IVM A;  1U78 A;  4C3H J;  1ZG3 A;  3VSL A;  1A35 A;  3I56 I;  1YW7 A;  3AG2 H;  1Q1H A;  2BY1 A;  3H9Q A;  4CUG A;  1MJB A;  1D5V A;  1Z6T A;  2Z33 A;  1FJL A;  3D5R C;  1PUF B;  4BDY A;  3CC4 I;  3VDX A;  1ORK A;  2BOL A;  1FNN A;  1MMG A;  2BY2 A;  2OC6 A;  3ZMU A;  4HF0 A;  5GTI C;  3TDU C;  3GX4 X;  4U0W A;  1S72 I;  1F36 A;  3MWM A;  3LNQ A;  3FX3 A;  2PI0 A;  2IGN A;  2JN6 A;  4B1R A;  2IS2 A;  4IRI A;  4C2U A;  4XRM A;  4G6Q A;  2EFP A;  1BI2 A;  3D1N I;  1WPK A;  1MSF C;  2WAQ N;  2XF6 A;  1BM9 A;  1K83 J;  1ETV A;  1T95 A;  3BR2 A;  4PDK A;  1XC5 A;  4KIG A;  4M3B A;  3HXL A;  4CYD A;  1W0U A;  2F48 A;  3O8H A;  1PP8 F;  5DTD A;  4UUV A;  4YFX F;  3KP6 A;  2MD5 A;  2DN0 A;  1B8I A;  2H6B A;  3MKW B;  3W2W A;  1LDK B;  2ISY A;  4PZJ A;  3FIW A;  3V4G A;  4XID A;  1NHA A;  2ZJR F;  2MAB A;  3OY9 A;  3OOU A;  4HF2 A;  2V6C A;  5EG0 B;  3G1M A;  1ZTR A;  3IUO A;  2VI6 A;  1IV8 A;  3C7J A;  3RYR A;  2A69 F;  4AIK A;  4HW0 A;  4RAG A;  4A6E A;  5D8K B;  1T0F C;  1BR1 A;  2L02 A;  4PCQ A;  1B4A A;  2JZY A;  3BTC A;  2EPF A;  4JP0 A;  5HDG A;  1ZQ3 P;  4G7O F;  2GAU A;  3LMM A;  2EV0 A;  3FMQ A;  4B48 A;  3TP3 A;  4OOI A;  4FE4 A;  1G6N A;  4IRG A;  3G6E I;  4CO8 A;  2DMN A;  5L3D A;  1S7A A;  3HB9 A;  1USS A;  2Z1D A;  3M8F A;  2OF7 A;  2R7F A;  1MNM C;  3BCA A;  3AKZ A;  1CF7 B;  1U0J A;  3SDB A;  4BE2 A;  4ZZL A;  1XN7 A;  2KHM A;  5CQG A;  1ZN2 A;  3HGY A;  1PYV A;  4YIF A;  1BR4 A;  1IRF A;  2M30 A;  5K7Z A;  3ZQL A;  1H0M A;  3QYE A;  4CXF A;  2NAZ A;  5J1Y A;  3UKG A;  1GV5 A;  1UAA A;  3CCR I;  3PO2 J;  4I6Z A;  1E3O C;  2Y9Y A;  2W85 A;  4P96 A;  1R23 A;  1G2H A;  1OYI A;  4NHJ A;  1ON2 A;  1LFU P;  2MD0 A;  5IYC J;  4IF4 A;  3BC8 A;  3UR3 C;  4YFK F;  1YFH A;  4GFB A;  3B02 A;  2W1O A;  3A0H C;  1VQ6 I;  2IS1 A;  4A2U A;  2ZNY A;  3HRU A;  1ERD A;  1KU9 A;  1EH7 A;  1K7A A;  2PN6 A;  3I59 A;  1UHM A;  5DM6 F;  1QZE A;  1W5C C;  5HLG A;  3IWZ A;  4PSX A;  2M7A A;  5KVR A;  5L3E A;  2DAO A;  1TQP A;  2QEX I;  2H6C A;  3H92 A;  1Q1V A;  4I99 C;  3GTJ J;  2HKO A;  1P9Q C;  4I0A A;  1Z3X A;  4EJU A;  2ZME C;  1O7L A;  1Y0U A;  1CGP A;  4HA8 A;  2TCT A;  2DO7 A;  3CJN A;  2EWN A;  3MZH A;  4V2F A;  4IPA A;  2M8G X;  1Y8R B;  4G7H F;  3HTS B;  2ECB A;  2BW3 A;  3E3V A;  3LOC A;  3HIF A;  2ESH A;  1VQN I;  2HTJ A;  2M3A A;  4YFN F;  1B72 A;  2RV8 A;  3PM1 A;  2LMD A;  3PNY A;  3F22 A;  1L3L A;  2XSJ C;  5E17 F;  2DQR A;  1YQA A;  4ZDL A;  1MD0 A;  5C4X J;  3F8C A;  1R4M B;  4G6D A;  1YS7 A;  1VQ7 I;  1U5T A;  4QSH A;  3OR1 C;  2ZXW H;  2X6W A;  3LST A;  4KYW A;  3WGI A;  4IX7 A;  2CV2 A;  1ODD A;  1V4R A;  1G3T A;  4M3G A;  1E3P A;  1YRN A;  4L9V A;  1R4N B;  2E35 A;  4XN0 A;  3HOZ J;  3WU2 C;  2XAQ A;  1T56 A;  5HOD A;  3T5X A;  3OS0 A;  4BJT A;  5F1R A;  2WV1 A;  1TWC J;  1X58 A;  3OS2 A;  5EEG A;  4XLN F;  5ILV A;  5BNG A;  1FSH A;  1D0Y A;  3S1R J;  3E5Q A;  4IHV A;  5ICE A;  2NS8 A;  2ME6 A;  2GQQ A;  3K69 A;  3OYL A;  3E6D A;  2VT3 A;  3QP5 A;  3FXO A;  4DGW B;  3MD2 A;  3SYT A;  3FMS A;  5H2F C;  1ZLJ A;  4XRS A;  4BDZ A;  1W36 D;  2CUZ A;  3ZQF A;  3BG3 A;  3BJA A;  4HX7 A;  5D5U B;  2QEN A;  1M1E B;  1AOY A;  1SD7 A;  1V5G A;  4GO1 A;  4A3G J;  4F7Z A;  3LAJ A;  2XPV A;  4KFC A;  4XOP A;  1P7I A;  2Q2E B;  3IH3 A;  3E7L A;  1KYZ A;  2A6T A;  3PUB A;  2ZJQ F;  5F6F A;  4LG0 B;  2XRO A;  3L1P A;  5GP9 A;  5DM7 F;  1VQ9 I;  2AHQ A;  1TW2 A;  3K4N A;  3AAF A;  3CF2 A;  3DP7 A;  4BQN A;  3RQI A;  1IXR C;  2LY9 A;  2FQ3 A;  2K9M A;  2E1C A;  3W3C A;  4KA4 A;  1I3Q J;  4PJL A;  3DFG A;  1P92 A;  3DWL E;  3R0J A;  1WJE A;  2MG4 A;  2K9Q A;  4LB6 B;  4BU2 A;  1LNW A;  3LA7 A;  2O03 A;  2XAF A;  2X4H A;  3ROU A;  3KX2 A;  1UEL B;  1VI0 A;  1D5Y A;  2LYC A;  3RQ4 A;  2QCO A;  2RGV A;  2VC1 A;  4AID A;  4DZJ A;  1PP7 U;  2DFH A;  1TBX A;  2LVS A;  1IUF A;  2R7O A;  1J7K A;  2A05 A;  2WA0 A;  4YRV A;  2QUF A;  4MEY F;  2MH9 A;  2LK2 A;  2MYS A;  3OYB A;  2EFO A;  2HZD A;  2Z99 A;  4AVZ A;  4IOC F;  4C2M J;  1X1P A;  2W4S A;  3R0A A;  1Z3Y A;  3I9V 2;  5E79 C;  1PDN C;  3WTY C;  2PX9 A;  3VEP A;  4LGW A;  4D5C A;  3OYC A;  2QQB A;  3QYF A;  2KDO A;  1S8N A;  3IKV A;  3ABU A;  2AO9 A;  3EYY A;  2VOP A;  4G12 A;  3BR0 A;  2K9L A;  4ANJ A;  2QQ8 A;  1T39 A;  5ICC A;  5F0F A;  3AG1 H;  2DJN A;  3F3X A;  4ENN A;  4QTR A;  5E20 A;  2EZI A;  1K78 A;  2BY0 A;  2LH9 A;  3BTL A;  3HEF A;  4A3E J;  3GCM A;  3RZO J;  3OYM A;  3GVA A;  2A5Y B;  1D1B A;  4PJJ A;  1IG7 A;  2VC0 A;  2LP0 A;  2CQN A;  4LIV A;  2X51 A;  5HS8 A;  1QPI A;  4II2 A;  4N9H A;  1X2N A;  2ECC A;  3OWT A;  4XKC A;  5IP6 A;  1R1T A;  1I3A A;  2ME0 A;  2MLG A;  2B0L A;  2LDU A;  3U1D A;  3ISP A;  4CH7 A;  3L09 A;  5CVJ A;  3DPT A;  4HST A;  4ZZD A;  5FD6 A;  3S14 J;  1MDM A;  2FX0 A;  4MFE A;  3HSF A;  4ZYA A;  3LAP A;  4FT8 A;  3OIQ A;  3RIR A;  2O7O A;  2ZSI B;  5KCM A;  2HS5 A;  5FKK A;  3PJR A;  1WSU A;  1BIA A;  2R7Q A;  1Z7U A;  4UXN A;  2ELK A;  3GZ6 A;  2L9N A;  3RKQ A;  1ZYR F;  2R7S A;  4I09 A;  3GTQ J;  2AXT C;  3ZQG A;  4XQF A;  4A3C J;  1TC3 C;  1O3R A;  1W5T A;  4U87 A;  2CQX A;  1E3H A;  3GFM A;  1WWX A;  5DUI A;  1YS6 A;  3HHH A;  1NG6 A;  5HNH A;  2ZXI A;  1PUF A;  1OQY A;  1SMT A;  1Z91 A;  4NDL A;  3PL8 A;  5HLH A;  4ABZ A;  3N97 A;  4RAY A;  4HNU A;  4RGX A;  3TQN A;  3H0D A;  1TLH B;  2HQA A;  3LQQ A;  1NTC A;  2E2J J;  5GAG J;  1XCB A;  3B6C A;  4KIC A;  2LG4 A;  1FTZ A;  4DOZ A;  4PFP A;  2QA4 I;  1GHC A;  3JAM K;  2CO5 A;  5B1A H;  2HNH A;  3WE3 A;  1BW6 A;  4V19 K;  1BJA A;  3TMO A;  4UHT A;  3KYC B;  4P5O A;  3OYH A;  1MSE C;  4WK8 F;  4UVA A;  1VFC A;  1R7J A;  1EH8 A;  4M9Z A;  4BUP A;  2GXG A;  1FOY A;  4LK1 F;  1D0Z A;  1KU2 A;  1FX7 A;  4OMZ A;  1B9M A;  2ZBK A;  1JKO C;  2KJC A;  3HRM A;  4BJ5 C;  5JFR A;  4AC0 A;  2L54 A;  2NVX J;  3HSE A;  3H3U A;  4Y3O A;  5CVV A;  3N4M A;  1RUO A;  3FK6 A;  3KCC A;  1SAU A;  3X2Q H;  5EDN A;  4W97 A;  1AKH A;  4JYK A;  4M3D A;  3FF5 A;  2VB6 A;  2R7V A;  1Y8Q B;  2EA2 A;  2OJE D;  4L9T A;  3R6S A;  3CC2 I;  5F08 A;  4HRI A;  2DFI A;  3PO3 J;  5CVI A;  4MQ9 F;  3ESW B;  3CUQ A;  1ZK8 A;  3KZI C;  3ZPL A;  3SQN A;  2ZKZ A;  3B6A A;  4D5F A;  4BE1 A;  4QIW N;  3OV8 A;  3K4L A;  1BC7 C;  2DQL A;  2HFH A;  4Q47 A;  1OCO H;  4E7J A;  5HS9 A;  2HOT A;  2EZH A;  1H89 C;  1MW7 A;  4UB6 C;  3V8L A;  1SFK A;  2IXS A;  4AWX B;  3IRQ A;  2H8R A;  4EAT A;  2O9L A;  1OR7 A;  3QP6 A;  4PJN A;  1MMS A;  1S6L A;  1MBE A;  3S3O A;  2ZXJ A;  1WZ2 A;  2UWM A;  5L3C A;  3K4M A;  3KIO A;  1DP3 A;  3FM5 A;  1E17 A;  3DPU A;  5B66 C;  2IA0 A;  1QRY A;  1HA8 A;  4AVP A;  4C3J J;  2BW3 B;  2DCE A;  5J6X A;  3S1N J;  2DT7 B;  2G0E A;  2FBK A;  4KIF A;  5CPR B;  5A2Q Z;  1B72 B;  1WVR A;  2LF7 A;  1J59 A;  2EZL A;  3LSK A;  2I10 A;  5ICG A;  2DDA A;  1YX5 A;  1X1B A;  1XSX A;  2DA2 A;  3QAH A;  6PAX A;  1H9G A;  2FNA A;  5FFZ A;  2KKO A;  3UNG C;  1JHF A;  2R5Z A;  1U5T B;  2RKH A;  1XD7 A;  3RKX A;  5LGN A;  2OBP A;  1UZC A;  3O3K A;  1T08 B;  2KJB A;  5EEA A;  2E1O A;  3NRV A;  1WRJ A;  5EZH A;  4D1Q A;  2O0Y A;  5IT9 K;  1IRX A;  3M4O J;  2VPR A;  3M1C A;  5EEH A;  2JUC A;  2IA1 A;  3SZP A;  2F5C A;  2R0Q C;  2H1K A;  2R93 J;  4BYY A;  4I7H A;  2K4J A;  1ENH A;  2LC2 A;  3FKI J;  3MKL A;  3GFI A;  3WGG A;  3CUO A;  3JRI A;  4PSW A;  4B47 A;  2IEK A;  3BQY A;  3OIO A;  4CCO A;  1A6I A;  5IPA A;  4XSX F;  2I5U A;  3CJT B;  1UMQ A;  3CES A;  3MQ0 A;  2O3F A;  5IYD J;  4YG2 F;  2HZT A;  3FBI B;  1YIJ I;  3NWS A;  2VBW A;  3LSP A;  4BY1 J;  1IN5 A;  4BBR J;  3QQA A;  3H9G A;  1FOK A;  2CV0 A;  3JRD A;  4XKB A;  2ZFW A;  3JSO A;  1Z77 A;  2NVT J;  1A31 A;  4CCL A;  4D7M A;  1WJ5 A;  4XN3 A;  4MGR A;  4J00 A;  1MMA A;  2ZFU A;  2QQA A;  2XGC A;  3IL2 A;  3S1M J;  2L9R A;  1FT9 A;  2MSY A;  4N4N B;  2NS0 A;  3TOB A;  4IHW A;  3L2W A;  4DQ2 A;  2MA3 A;  1SVO A;  4E7L A;  2HTS A;  1GVJ A;  1G3Y A;  1DGW Y;  2MLK A;  1LDD A;  2VKD A;  3KLN A;  3FXM A;  4B4C A;  5IP9 J;  4PJ0 C;  1BN5 A;  1BI1 A;  3HUG B;  5JHF A;  5FKM A;  2KQR A;  3ZMT A;  1HKS A;  4KDP A;  4DBR A;  2KMU A;  1K6O A;  2WB1 A;  3ASO H;  3QYB A;  2XRL A;  4NC7 A;  3JTG A;  2Z16 A;  2L7Z A;  5D5V B;  3WG9 A;  4RGS A;  4BXU A;  2V9V A;  2EZK A;  1TWG J;  3V7C A;  2BGC A;  2NVU B;  1P4X A;  2Q2E A;  3RDI A;  1ZG1 A;  4K2E A;  3HOT A;  1VQ4 I;  3K2Z A;  1TQM A;  2XAU A;  4OU0 A;  3CC7 I;  3BY6 A;  1U6G A;  3C3W A;  1X3U A;  2JRT A;  1QZY A;  1OR7 C;  3HKZ N;  4GGG A;  3DTI A;  2R7R A;  3CCJ I;  4BEH B;  1HW5 A;  4CHU A;  5CKT A;  5K7F A;  1XGM A;  5IOZ A;  3ZXS A;  1IRZ A;  5M5X J;  2IS6 A;  4O3M A;  3IKT A;  3A0B C;  3V42 A;  1ITY A;  4EQQ A;  1VQ8 I;  4X0G A;  3RCO A;  1JKR C;  2ADU A;  2P0W A;  1JT6 A;  4XKW A;  1XGS A;  4GYG A;  3J81 K;  1LKX A;  2EFQ A;  1ETX A;  2JUG A;  1MIJ A;  1W36 C;  4KT5 C;  2X0L A;  2XB0 X;  2HVR A;  4W1U A;  3CCU I;  2M1B A;  3HC7 A;  1NK3 P;  3ZGK A;  3PNT A;  2HDC A;  4NNJ A;  3DKW A;  1VTN C;  1XSD A;  1J2X A;  1FZP B;  2KRC A;  4G8X A;  2P6S A;  2DA6 A;  3ABT A;  3LSJ A;  5ILS A;  4GCV A;  3TBI A;  1R36 A;  2EH3 A;  5D6F A;  1MNE A;  3FM3 A;  3KLO A;  1R71 A;  3CLO A;  4L18 B;  1HKT A;  3JTH A;  2DPD A;  3ELK A;  2CS3 A;  1HXD A;  4JOM A;  5EGO B;  4ZH4 F;  4Y33 A;  3JW4 A;  4HNV A;  2L0K A;  3U9G A;  3NAU A;  5E18 F;  3T8R A;  1HC8 A;  3VB2 A;  3GTL J;  2J5P A;  1ZLK A;  3E0J B;  4M6V A;  2DA5 A;  2LRE A;  5H20 A;  1ZRE A;  2K02 A;  5GPC A;  2M2E A;  9ANT A;  2M0M A;  1VQM I;  4XLP F;  4OIQ F;  3BR6 A;  3K1M A;  3PNV A;  4AUX A;  1OCT C;  4LK0 F;  2HOE A;  4WX9 A;  3CMY A;  4BXX J;  4WXC A;  2HQN A;  1JUP A;  3RPQ A;  3MFK A;  1ETO A;  1BJZ A;  5H6R A;  3HM5 A;  4F55 A;  1Z7L A;  2HQR A;  2RVC A;  5M3M J;  2DT5 A;  4FTH A;  3TOA A;  3TKY A;  3K4C A;  1RI7 A;  2NNN A;  2O61 A;  1FC3 A;  3AG4 H;  3SDG A;  1J0R A;  5M5Y J;  5LLQ A;  1AA7 A;  4EJV A;  3BZ6 A;  4QPO A;  3JSP A;  1FY7 A;  1JJ6 C;  4M9X A;  4CZC A;  2NXN B;  3D5S C;  4MTE A;  2E71 A;  3BG6 A;  1WQ2 A;  3CJQ B;  4EGZ A;  2CH0 A;  1BIB A;  3ZOB A;  1YIT I;  4A0X A;  2DA3 A;  2L4A A;  3MMY B;  4IXA A;  4Y17 A;  1QQI A;  1AKH B;  3W6V A;  5D6E A;  4PUS A;  2EV6 A;  2GXA A;  2PQ8 A;  1X2M A;  1YO5 C;  4BY7 J;  1HSJ A;  3GXO A;  3EET A;  3S17 J;  2ICW G;  3CUQ B;  2JA8 J;  3HOV J;  4MFD A;  2E5N A;  4EM2 A;  2CJJ A;  1R1V A;  2IGO A;  4Q5S F;  3I0T A;  1W0T A;  1YX3 A;  2DMU A;  2BYV E;  3OYK A;  3H3Z A;  1O3Q A;  1Y1W J;  4LD5 A;  3F9K A;  3IHU A;  2HKX A;  4BH9 A;  2KZG A;  3K9T A;  3F8F A;  5DD4 A;  3WTU C;  3G71 I;  4LLG F;  5F04 A;  5FFX A;  3ZP5 A;  5K7H A;  1BW5 A;  3J81 Z;  5D4R A;  2MGQ A;  4NQW A;  2B9S A;  1WI9 A;  3PSF A;  4S05 A;  1LJ9 A;  4OIO F;  3M8E A;  3LSM A;  2BZT A;  2PMZ N;  3M1E A;  1SVM A;  2VXD A;  1OKR A;  2BHY A;  4MHG A;  3MEX A;  4EMS A;  2DJI A;  2LR8 A;  2BXY A;  4ETS A;  3CO7 C;  3F8B A;  1N75 A;  3PUF A;  1G3W A;  1MGT A;  4U88 A;  3ZQ7 A;  4UY8 I;  1MBJ A;  2E2I J;  2OPT A;  2IBD A;  3MZ8 A;  2R5Z B;  2L9V A;  4XLA A;  1FIA A;  2X9D A;  3P9I A;  1X1C A;  4IEJ A;  1QHH D;  5C44 J;  5C4J J;  3OYI A;  2O6G E;  2CW7 A;  4PGG A;  4FX0 A;  5D5X B;  4BNC A;  2XPW A;  1WHU A;  5FKN A;  2ACJ A;  3GTM J;  2L9S A;  3SZT A;  4IHT A;  4NC8 A;  1BOB A;  3BR5 A;  3CLQ A;  3W2V A;  2EIL H;  4CA0 A;  4HX8 A;  4LFU A;  1HOM A;  1ZAO A;  4DBQ A;  2ZJ2 A;  3OL3 A;  4LB5 A;  3GZN B;  4XRS G;  4J01 A;  4IQJ A;  3C2G A;  1RKW A;  3K10 A;  2DYR H;  4EV0 A;  2FU4 A;  4B43 A;  1V5F A;  4UV8 A;  1ZRD A;  2KIM A;  4HYE A;  2RRE A;  1OJL A;  5B1B H;  5J40 A;  4UUS A;  3KET A;  4KMF A;  1DUX C;  1EH6 A;  3VFZ A;  4DZP A;  4M6X A;  2HWV A;  3TL4 X;  3HTU A;  2LD5 A;  4XON A;  4MEX F;  3IC7 A;  4H0E A;  4UVC A;  1WJA A;  2JSP A;  2FBI A;  3KP4 A;  5J8F A;  5F27 A;  1HQC A;  1IZ1 A;  3C2H A;  3G3Z A;  3LSR A;  3DQV C;  4C2T A;  2XF5 A;  2EIJ H;  2TRT A;  3FK7 A;  3ZN1 A;  5BMZ A;  2K9N A;  1U8B A;  2O8K A;  2HR3 A;  2XAH A;  4XR6 A;  2LBF B;  3F21 A;  3A1Y A;  5KK1 A;  4DYC A;  4Q48 A;  5AON A;  1MKM A;  2LOO A;  2BEO A;  4A6D A;  3S16 J;  3HPG A;  2JA5 J;  1QBJ A;  3ZN0 A;  4CCM A;  2YU3 A;  4BHB A;  2LY2 A;  4E7Z A;  2QLZ A;  1IUY A;  2HEO A;  1YW9 A;  2LKX A;  3W6K B;  2QVO A;  2EIM H;  1U8R A;  2DLL A;  3KEO A;  2FOK A;  1JXS A;  1ETW A;  1UHS A;  3MAJ A;  4RAZ A;  1D1A A;  1IF1 A;  3DV8 A;  5FRN A;  1SFU A;  2NOJ B;  1F9N A;  2MFZ A;  5GAH J;  3RKW A;  3OS1 A;  5CJ9 A;  4A5N A;  3JR9 A;  3DCF A;  4M3E A;  5J8C A;  4YIR X;  1TZL A;  5JLW A;  1JTY A;  3A2K A;  1ZEL A;  2M8E A;  1ACI A;  3FXR A;  3EUA A;  4FAS D;  3FXJ A;  2FJ1 A;  4MO7 A;  5L3G A;  3BPV A;  1HKQ A;  4A5M A;  2OU2 A;  5KNL A;  3BLY A;  3EDP A;  4ENK A;  1TT5 B;  2L7K A;  3J80 K;  2FBH A;  2XKO A;  4L0Y B;  2F4O B;  3BZK A;  3L2V A;  4MNU A;  5DD8 A;  3JRB A;  5HNF A;  5LHI A;  3RYP A;  2PMH A;  2WB1 N;  1I50 J;  1LFP A;  2HOA A;  2L01 A;  1F43 A;  3HKZ A;  4E7K A;  1ZH5 A;  2LRD A;  3HUG A;  3TW7 A;  2Z2S B;  4A93 J;  3DTK A;  2OZU A;  2K7L A;  4XLC A;  3TP0 A;  4AYB N;  3G4S I;  1N77 A;  4ENJ A;  3KZY A;  4B3A A;  4U7B A;  3PFI A;  1G3S A;  5DS9 A;  3FXK A;  3GTK J;  2E5Z A;  5K5R A;  3GME A;  2WC2 A;  2CQ7 A;  1HCR A;  3ERM A;  1KZH A;  1J75 A;  1TTY A;  2FSW A;  2HU9 A;  2R7W A;  1U9O A;  2V1D A;  2GOM A;  4EM0 B;  5L3B A;  5HVQ C;  2DXI A;  3E5U A;  3S2W A;  3GTP J;  2D1H A;  4CCN A;  3J7A O;  4ESB A;  1NH3 A;  3Q0W A;  4M9S A;  1DDN A;  4BQQ A;  2OCE A;  2PEX A;  4AD9 A;  1SD6 A;  2EV5 A;  2LFB A;  2LY1 A;  2VBX A;  3NAR A;  4LIU A;  4M72 A;  3J7Z I;  4BEH A;  2IS4 A;  4HX4 A;  2K86 A;  2X1D A;  4AM3 A;  4RM3 A;  4ZJZ A;  1J9I A;  3WTX C;  1WH5 A;  4JX6 A;  3Q5F A;  1RPW A;  3KP2 A;  3TDZ C;  3I4M J;  2I8D A;  1OCP A;  1BOA A;  1BI0 A;  3L2U A;  4EEF G;  3OYN A;  5D8L B;  1YIO A;  4F93 B;  5DDG A;  2JPB A;  1UG2 A;  4D0P A;  2NNY A;  1B6A A;  3GUD A;  2R7Z J;  2KRH A;  2LSO A;  2H94 A;  1IV6 A;  2DI3 A;  3WU0 A;  3E6M A;  2XHK A;  4CYC B;  2K40 A;  4TV7 A;  4ZYG A;  5AIP A;  2DMQ A;  2BVM A;  2XRN A;  3E6C C;  5LD2 C;  1U5T C;  4Y4R A;  4MTD A;  1MMD A;  3Q3S A;  3WTW C;  3QPH A;  4PFO A;  3JRA A;  3TW6 A;  5DCF A;  3CO6 C;  1Y39 A;  2CUJ A;  1LDJ A;  3VPR A;  3WU1 B;  3CCY A;  2Y75 A;  4RB2 C;  2L4M A;  1XSV A;  5F0H A;  1FIP A;  3RSN A;  4E7I A;  1BI3 A;  3I55 I;  1I39 A;  2V4J C;  5HS7 A;  5EGO A;  1KQ9 A;  2K4B A;  5DCM A;  3IRR A;  2M87 A;  1ZGJ A;  2IP2 A;  4M6Y A;  4RA2 A;  1P2F A;  5GAE J;  3GZ5 A;  3LWF A;  2E19 A;  1XMX A;  4BHC A;  2DOA A;  2E1N A;  3ASN H;  4BS9 A;  4P9F A;  4AIJ A;  2FML A;  4FE7 A;  3ECO A;  2KLO A;  2FXA A;  3GTG J;  4BAY A;  4HF1 A;  4M74 A;  4HLY A;  3E97 A;  2OTL I;  4G94 A;  4HNT A;  3I53 A;  4ZTF A;  4IJA A;  4JBA A;  4WF2 A;  2XGD A;  4IZZ A;  4ZTJ A;  3Q0U A;  2P5K A;  1WJD A;  2VPL A;  4DW6 A;  1P7J A;  2M0C A;  2VKE A;  5FRO A;  5E3O A;  3I3L A;  1A04 A;  3JRC A;  1VQL I;  1KU3 A;  2CQK A;  5KAI C;  1K79 A;  4E70 A;  3QOE A;  1XPX A;  1VQ5 I;  4I2O A;  2GZW A;  1IJW C;  2TDX A;  1DP7 P;  5E1Z B;  2XAJ A;  4GYI A;  4NQW B;  4O5V A;  2YX4 A;  1SEU A;  5TJJ A;  2HYF A;  3DEU A;  3S3M A;  4IHS A;  5CVR A;  4RLQ A;  2WAD A;  2QQ9 A;  5FLX K;  3ABL H;  1U9N A;  3WHC A;  2IPQ X;  4OWR B;  4F91 B;  3ZCO A;  2V79 A;  3V7R A;  1ETK A;  2K27 A;  2RNG A;  1SFE A;  1REP C;  2PMZ A;  3MCZ A;  3HOS A;  2Y9Z A;  1YTY A;  3GEZ A;  2G9W A;  1IN8 A;  5B5E C;  1MZB A;  3LFK A;  3S2H J;  5FB2 A;  3SJM A;  1RES A;  3I58 A;  3L2Q A;  1W1W E;  2M7B A;  4BGD A;  4A3J J;  2CGP A;  3H3V K;  1BBY A;  2KFD A;  1VF9 A;  3U21 A;  2JA7 J;  2DDB A;  1QO0 D;  2HXO A;  4CDG A;  4ESJ A;  2LLK A;  3HGG A;  4I0B A;  2P4W A;  2CSO A;  3VOE A;  2MH2 A;  1PUE E;  1X1D A;  1ON1 A;  2E1M B;  2WY8 Q;  3EPZ A;  3QPS A;  3LSI A;  3DF8 A;  4ZYE A;  3M07 A;  3K4B A;  1R22 A;  3R61 A;  5E1X A;  3W6J B;  3OYE A;  2HOS A;  2X6X A;  2DOE A;  2MC3 A;  2A3S A;  1HW2 A;  2M4K A;  3BCB A;  5CLS A;  2HDW A;  4UUS B;  2W7N A;  2R3S A;  1Z0X A;  5JHU A;  1LPQ A;  2DK8 A;  5JLX A;  3VSK A;  2GWR A;  3L7W A;  4OAZ A;  3BOQ A;  3PIP F;  3G1L A;  2W25 A;  3EQL F;  1QA6 A;  1XG1 A;  1ZRF A;  2Y0S A;  2RQQ A;  5J3L A;  1MBG A;  3DTE A;  3CCS I;  2Z9O A;  4U7D A;  2PLY A;  1LFB A;  2YS9 A;  1R6R A;  3FHN A;  3RPU D;  1MJ9 A;  2FUG 2;  2KIU A;  1AHD P;  2PBI A;  1ZHF A;  2YX7 A;  2LKS A;  4CGZ A;  1D8K A;  1S3J A;  2EQR A;  2UUZ A;  2GA1 A;  1GV2 A;  3DPL C;  2F5F A;  3U2R A;  3CME I;  3FMR A;  2VLA A;  2A07 F;  3E5X A;  4M71 A;  2KRF A;  3QWL A;  3ZMV A;  4U0Y A;  2K5C A;  5FD5 A;  1WI3 A;  2E7W A;  4IVN A;  1SFX A;  1GT0 C;  3IH2 A;  2L3D A;  3AFH A;  2A6H F;  2COM A;  3V8K A;  2JT1 A;  4ZYD A;  4XNF A;  3IV5 A;  2P7C B;  1X1A A;  3S3N A;  2VXZ A;  3G2B A;  2D2W A;  4HV5 A;  3M7G A;  1Y0N A;  1IN4 A;  2XAS A;  4I01 A;  3J7Y J;  4XLH A;  2VL8 A;  2IA2 A;  3OYJ A;  3DKX A;  5IOY A;  5FJ8 J;  5AIQ A;  3JAM Z;  1TL8 A;  1ONV A;  4C3I J;  4KT6 A;  4A0Z A;  4BHP A;  3D5L A;  4EGY A;  1BC8 C;  3CP2 A;  4A3M J;  4RM2 A;  5E3L A;  2EJR A;  1K6Y A;  2OCC H;  3M9A A;  4AIH A;  4KN4 X;  2JK3 A;  3OYA A;  1I1S A;  3F0C A;  4IHX A;  1VQK I;  4HQM A;  4E7H A;  1O3T A;  2FE3 A;  5LHH A;  2V26 A;  2LF8 A;  3BT9 A;  3MN2 A;  3S93 A;  2FA5 A;  1HW1 A;  2LBF A;  4U0V A;  4A3F J;  3OYD A;  4GXO A;  3WHB A;  1APL C;  2QBY A;  2JA2 A;  2KPM A;  1R5H A; 
#chains in the Genus database with same CATH homology
 4PUS A;  3SYT A;  3MKZ A;  4DJA A;  4BDZ A;  1W36 D;  2CUZ A;  4BQO A;  3BG7 A;  1V5G A;  2R7X A;  4XOP A;  3LSH A;  2E5N A;  2O5R A;  2IGO A;  2Q2E B;  2A6T A;  3PUB A;  4HG2 A;  1YX3 A;  3CP8 A;  2KZV A;  4F92 B;  2V6E A;  4ZDP A;  3OYK A;  4AYB A;  2CFO A;  3LFU A;  3HL2 A;  3K4N A;  3CF2 A;  3F9K A;  4XLF A;  4BQN A;  2K9M A;  2V9K A;  3W3C A;  4KIT B;  1D0X A;  2V7F A;  2ZSH B;  3VYU B;  3SEZ A;  4XL9 A;  4MLO A;  4PJL A;  3DWL E;  1WJE A;  4CCK A;  3DU6 A;  2JVG A;  4AU7 A;  1S9H A;  3PSF A;  4PK4 A;  4BXF A;  3L2R A;  2GOX B;  3LSM A;  4BU2 A;  2ZXH A;  3K70 D;  3VWB A;  3A4C A;  2VXD A;  4II3 A;  3KX2 A;  1UEL B;  2DJI A;  1G8X A;  4ZC3 A;  2LYC A;  1N75 A;  3RQ4 A;  2R7U A;  4N4O B;  2V1N A;  2VKH A;  1GLN A;  4XLA A;  2R7O A;  3N05 A;  1X1C A;  2WA0 A;  1QHH D;  5CQE A;  4YRV A;  3OYI A;  2M4G A;  2CW7 A;  3DKY A;  1FMW A;  3LSG A;  3K4J A;  3PFY A;  2MYS A;  1QHG A;  3OYB A;  2X85 A;  2F5V A;  2HZD A;  2L9S A;  2R4G A;  4NC8 A;  4XMY A;  4AVZ A;  1BOB A;  3OYF A;  2XF7 A;  2W4S A;  3W2V A;  1Z3Y A;  3I9V 2;  4CA0 A;  3RTR A;  2W82 A;  4DBQ A;  3OYC A;  3OL3 A;  3QYF A;  2KDO A;  4D9J A;  1MND A;  4J01 A;  2VAS A;  2K9L A;  1D1C A;  4ANJ A;  4IQJ A;  3C2G A;  3ZRG A;  3K10 A;  3S8P A;  4B43 A;  1V5F A;  3S32 A;  2RRE A;  3KEY A;  1Y6I A;  2LH9 A;  3ONQ A;  4CSW A;  3OIP A;  3OYM A;  4XLE A;  2CW8 A;  1D1B A;  4PJJ A;  3TL4 X;  3DEE A;  2WAF A;  4LIV A;  2X51 A;  1JI8 A;  1EA3 A;  4II2 A;  3OWT A;  2QKL B;  4XKC A;  4XON A;  4XOR A;  1WJA A;  2JSP A;  2PJR A;  2WY7 Q;  3HG9 A;  4CH7 A;  3DPT A;  4HST A;  4FET A;  2E60 A;  3C2H A;  3FBN B;  3DQV C;  4XOT A;  4C2T A;  2XF5 A;  2HVQ A;  4ZYA A;  3KYL A;  3OIQ A;  3PJR A;  2ZSI B;  5KCM A;  4XR6 A;  2LBF B;  3VYS B;  3A1Y A;  2R7Q A;  5FRM A;  3K6G A;  4BAC A;  2L9N A;  2R7S A;  2LOO A;  2VQG A;  2W00 A;  3CZ6 A;  3HPG A;  4XQF A;  1X4O A;  4CCM A;  2LY2 A;  4U87 A;  3AL0 C;  4E7Z A;  4E6K G;  3OMY A;  1NG6 A;  5HNH A;  2ZXI A;  2KP6 A;  1MMN A;  4XM3 A;  4BE0 A;  3PL8 A;  1WJF A;  4XKV A;  4HNU A;  2WAE A;  3IP4 B;  3H0D A;  2HQA A;  2VQL A;  2VJJ A;  1D1A A;  3H5R A;  2LG4 A;  5FRN A;  2NOJ B;  4DOZ A;  4PFP A;  4BL0 B;  3OR2 C;  2HNH A;  4C9Y A;  3HPH A;  3TMO A;  2MFZ A;  3OS1 A;  4P5O A;  3OYH A;  1TZL A;  3A2K A;  1ZEL A;  4BUP A;  3EUA A;  4FAS D;  4KJZ A;  1D0Z A;  1YE9 A;  4BJ6 C;  1UG0 A;  5KNL A;  2QKM B;  3BLY A;  2L7K A;  4BJ5 C;  3L2V A;  4HEA 2;  5HNF A;  4HSR A;  4Y3O A;  1LFP A;  1J09 A;  1SAU A;  3HKZ A;  4E7K A;  4C30 A;  4GRI A;  2Q1Z B;  2VB6 A;  2LRD A;  1WJB A;  2R7V A;  2Z2S B;  3DTK A;  4XLC A;  3PSI A;  1N77 A;  4HRI A;  4E4H A;  2VJ4 A;  2VIX A;  3VYR B;  4U7B A;  2X6Y A;  1G59 A;  3E1S A;  2E5Z A;  2MC4 A;  4BE1 A;  2X1E A;  3K4L A;  3IAS 2;  3SZG A;  3ZQQ A;  2IGK A;  4E7J A;  2HU9 A;  2R7W A;  2XDV A;  3SEQ A;  1MW7 A;  2GOM A;  1SFK A;  2IXS A;  5HVQ C;  2DXI A;  4R79 A;  1BR2 A;  4EAT A;  4CCN A;  4B44 A;  3K4K A;  4G6T B;  3M8J A;  4PJN A;  3S3O A;  2UWM A;  2R7T A;  3K4M A;  1DP3 A;  1FMV A;  4RMN A;  3DPU A;  4BQQ A;  4DIQ A;  4ITV A;  4F3Q A;  1HA8 A;  4LIU A;  2IS4 A;  2LY1 A;  2BW3 B;  2DCE A;  2DT7 B;  4BEH A;  1X19 A;  5HLT A;  2AQE A;  3QOD A;  4LG3 A;  1LVK A;  1WFX A;  1QU3 A;  3DLA A;  5CPR B;  4CCJ A;  2X1D A;  4RM3 A;  4YEJ A;  4ZJZ A;  2CMP A;  2I8D A;  3LSK A;  3L2U A;  1YX5 A;  2VQH A;  3OYN A;  1X1B A;  4LIT A;  2X1C A;  2AQF A;  2VJI A;  2F4I A;  3EUK L;  3UNG C;  4F93 B;  4PJM A;  2PJR B;  2IGM A;  2KRH A;  2OV7 A;  1E0E A;  1Z21 A;  2BVM A;  4IQ4 A;  5LD2 C;  4Y4R A;  4D1Q A;  1IRX A;  3M1C A;  1MMD A;  4PFO A;  5KHD A;  2LC2 A;  1PJR A;  3FKJ A;  4KIS A;  1N78 A;  2CUJ A;  3H35 A;  4PSW A;  3VSL A;  4B47 A;  4CCO A;  4CUG A;  3H9Q A;  3RSN A;  3GBG A;  4E7I A;  3CES A;  2V4J C;  3AL0 B;  3D5R C;  2A5W A;  4BDY A;  3VDX A;  1DGR M;  5LFA A;  2BOL A;  3FBI B;  4B3X A;  1MMG A;  2OC6 A;  4IKF A;  3NWS A;  2DOA A;  4BS9 A;  2IGN A;  3H9G A;  2CV0 A;  2UV1 A;  4XKB A;  2IS2 A;  2KLO A;  4C2U A;  4F52 A;  4CCL A;  1WJ5 A;  3FDY A;  4XN3 A;  3MKY B;  2XF6 A;  4J00 A;  1MMA A;  2OUM A;  1T95 A;  4HNT A;  4ZTF A;  4ZDO A;  4ZTJ A;  2ZFU A;  4IZZ A;  3HXL A;  2HPM A;  1WJD A;  2VPL A;  1OLT A;  4N4N B;  5FRO A;  3I3L A;  3L2W A;  2KL4 A;  4H4K C;  3MKW B;  3QOE A;  4E7L A;  3H9J A;  3W2W A;  1LDK B;  4E7S A;  1DGW Y;  2VKD A;  2MAB A;  4NQW B;  3OY9 A;  3OOU A;  3CJR B;  3S3M A;  3IUO A;  3HUG B;  4RLQ A;  5JHF A;  1V5E A;  3LL7 A;  3ZR8 X;  2WAD A;  1T0F C;  2KQR A;  1BR1 A;  4OWR B;  4F91 B;  4DBR A;  2KMU A;  2WB1 A;  3ZCO A;  2F6C A;  3QYB A;  4NC7 A;  3LMM A;  2RNG A;  4B48 A;  2Z16 A;  1Y56 A;  2PMZ A;  3HOS A;  3DU5 A;  2CV1 A;  5HOO A;  2VQC A;  2Z1D A;  4OAY A;  3L2Q A;  2M7B A;  4BGD A;  3BCA A;  3AKZ A;  3OYG A;  1U0J A;  3SDB A;  2HPI A;  3U21 A;  3HOT A;  4BE2 A;  2KHM A;  5CQG A;  2XAU A;  1PYV A;  2L2O A;  1BR4 A;  1OR7 C;  3DTI A;  2R7R A;  1DQU A;  1X1D A;  2E1M B;  2WY8 Q;  4BEH B;  3EPZ A;  5CKT A;  3QYE A;  3LSI A;  1WJC A;  3ZXS A;  2IS6 A;  3V42 A;  1UAA A;  3K4B A;  4X0G A;  3RCO A;  3OYE A;  2P0W A;  3W2A A;  2X6X A;  2ELJ A;  2E1M C;  4XKW A;  2M4K A;  1LKX A;  2JUG A;  2MD0 A;  3BCB A;  1W36 C;  2HDW A;  2XC7 A;  3BC8 A;  2W7N A;  3UR3 C;  2W1O A;  2HVR A;  2IS1 A;  3VSK A;  1ERD A;  4OAZ A;  3HC7 A;  3EUH C;  3PNT A;  3ZGK A;  2L5Q A;  2VJ5 A;  2Y0S A;  4NNJ A;  2RQQ A;  2KRC A;  3DTE A;  4PSX A;  2M7A A;  3TBI A;  2JVH A;  3H5N A;  1MNE A;  1R6R A;  1KON A;  3FHN A;  1P9Q C;  2FUG 2;  1VZ0 A;  4P1W A;  1Z3X A;  3RPU D;  4QPQ A;  2UUZ A;  3DPL C;  3NWT A;  2VLA A;  2CS3 A;  4JOM A;  3K70 C;  4Y33 A;  3CMM A;  2BW3 A;  2K5C A;  3E0J B;  4YEL A;  2M3A A;  2DT6 A;  5TGT A;  2WBM A;  3AFH A;  2LRE A;  3PNY A;  2XSJ C;  4XNF A;  4ZDL A;  3VYT B;  1X1A A;  3OL4 A;  3S3N A;  2M0M A;  4RLF A;  2VXZ A;  3G2B A;  2HVS A;  3PNV A;  3OR1 C;  4XLH A;  2X6W A;  2VL8 A;  4IX7 A;  3J7A Y;  3OYJ A;  4HPQ A;  2CV2 A;  3DKX A;  1X4P A;  4KT6 A;  3D5L A;  1NG7 A;  3IAM 2;  3CP2 A;  4XN0 A;  4RM2 A;  1K6Y A;  2WAQ A;  3OS0 A;  4F55 A;  4BJT A;  1Z7L A;  3OYA A;  4JQF A;  3K4C A;  4E7H A;  3OS2 A;  2V26 A;  1TT0 A;  1AA7 A;  4QPO A;  3S93 A;  2BVL A;  4CZC A;  1D0Y A;  2K3P A;  2LBF A;  3D5S C;  3BG6 A;  3CJQ B;  3OYD A;  2CH0 A;  3H5A A;  3OYL A;  4NUB A;  3MMY B;  2JA2 A;  4DGW B;  3MD2 A;  2KPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...