2DT7B

Solution structure of the second surp domain of human splicing factor sf3a120 in complex with a fragment of human splicing factor sf3a60
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
85
structure length
85
Chain Sequence
GAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Splicing factor 3A subunit 3
publication title Solution structures of the SURP domains and the subunit-assembly mechanism within the splicing factor SF3a complex in 17S U2 snRNP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 18
structure length 85
sequence length 85
ec nomenclature
pdb deposition date 2006-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01805 Surp Surp module
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.790 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2dt7B01
1X4PA 1X4OA 2DT7B 2DT6A 4DGWB 1UG0A 2E60A 2E5ZA
chains in the Genus database with same CATH superfamily
2ZKZA 2VQGA 3OYIA 3LSRA 3OIPA 2X6YA 4U88A 1O4XA 2Q8KA 2AQEA 1YW9A 3IH4A 2OD5A 1ZLKA 1WQ2A 2IGKA 2JVHA 3I64A 4I7HA 3L7WA 2IGMA 3H9QA 3SEQA 3K70C 1ZHFA 1WPKA 4FASD 3L1PA 4A3EJ 3K6GA 2COBA 1LFPA 2K3PA 2HOTA 4HF0A 2L2OA 4MEXF 2HPIA 3J7AO 4BJ6C 4RAFA 2PMHA 1Y6IA 3BOQA 2UWMA 1IDZA 3H1CA 2V6CA 2MC4A 1X3ZB 3RJPA 1MH3A 4I01A 1TQIA 2LKSA 2VN2A 4PUSA 3ESWB 1S3JA 1QPIA 1JXSA 1MJBA 2CJJA 4U0WA 2M2EA 4N4OB 2DOEA 4FX0A 4M3BA 4I98B 4CYDA 3SEZA 3BR0A 5AIPA 3H35A 2KZGA 1TBXA 1FWZA 3JAMZ 4XQFA 3CMEI 2HKOA 2AQFA 3S16J 5TRDA 4XKBA 3BZCA 2NNYA 1LDDA 3K0LA 5FLVA 1IUYA 2P5LC 5HLTA 1WRJA 1R7JA 4M3GA 1T39A 1XMXA 4OWRB 4UHTA 3HOSA 2ACJA 1RR7A 1OYWA 3EPZA 3ECHA 4RBOA 2EINH 1HBXG 1SVLA 1YX5A 1D1AA 1ETQA 3OYLA 3H9JA 3HPHA 2DDBA 4OAYA 1SANA 1SD4A 1KA8A 4OIOF 2IW5A 1K78B 2JA6J 1BIAA 4TV7A 2ZJPF 3WTTC 3CUQB 3I5UA 2H09A 2W4SA 3S2WA 1I1GA 3E6MA 3WGGA 4M6XA 4D7NA 2PJPA 1YO5C 2JSPA 5C4XJ 2EV0A 2IP2A 3JRIA 3P5JA 5J1YA 2LBFA 4NDLA 1CQTA 3FXLA 1UMQA 2QQ9A 4BHCA 2HXIA 1YIJI 1KYZA 2KT0A 2KIQA 2HTJA 3HTUA 3FKIJ 4BE2A 1J9IA 2L0KA 4BEHB 4WF2A 3B73A 5LEJA 1S5LC 3PO3J 2VBZA 1KYWA 1FMWA 1LE8B 2DI3A 4CA0A 1SAUA 1W7PA 1IUFA 1ETXA 2K9LA 2DFIA 2RREA 4UUSA 5E3OA 1G3SA 2CGPA 1Q1VA 4DQ2A 2DLLA 4A69C 4LG0A 3F8FA 2XAGA 3T0YA 2K4JA 2OV7A 1SFUA 1A36A 4XRFA 2DYRH 3OYHA 3LSJA 3IRRA 1JJ6C 1I50J 3KP2A 4M9XA 1IW7F 1HSTA 4KT5C 4KUMA 4HG2A 1TP4A 3CCRI 3KYCB 4G6TB 4O3MA 2XPWA 1ETVA 1HDDC 2BZTA 1FOKA 1D5VA 3ZQQA 2J5PA 1ZGAA 1SFKA 1LVKA 1IRGA 2L5QA 2EJRA 1GXQA 1OYYA 3FMQA 1PDNC 3C3WA 2RC4A 3RKYA 4QTRA 1LVAA 3GEZA 4PK4A 3RKWA 2CW7A 1ITYA 2MG4A 2UXXA 3FM5A 1Z3YA 5EEGA 1F1ZA 2XVCA 2A61A 2R7VA 2OA4A 4BACA 3GBGA 3HOYJ 4M3EA 2HQ5A 5F0FA 4BXFA 2A3SA 1J75A 3NARA 2DCEA 1A31A 1RPWA 2KDOA 3MQ0A 2O9LA 4M3DA 4U0VA 2MLGA 1ETKA 3S32A 5BMZA 3IH2A 2I5UA 5F0HA 1LJ9A 4M3FA 3GLLA 3UR3C 3OYDA 1J0RA 2MBFA 1X2NA 5LGTA 2DOFA 2JA2A 4BKXA 4ASNA 4LK1F 3ZMUA 4XKVA 1TQMA 1OCRH 1UG2A 1ZAOA 2EB7A 2UV1A 3R0AA 2DW4A 2ELKA 4HSRA 3W2AA 4CZZA 1DP3A 2RN7A 4RDUA 4A3BJ 2QBYA 1ZRCA 2L02A 3S1QJ 3BCAA 1IXCA 4II3A 2OUMA 5EZGA 1Z3XA 2B63J 1SVOA 1Z7LA 5E3MA 5E20A 2X6OA 4YFNF 2O7OA 1WJEA 3MN2A 3HOVJ 1B9MA 3CCSI 5FRNA 4Q47A 1G2HA 2IBDA 5ICFA 2DK5A 2NS8A 1BM9A 3ULQB 3DTKA 2LBFB 4A5NA 4EVIA 4RMNA 2E35A 1D0ZA 3ZPLA 1YW8A 2FRHA 1XD7A 1GVJA 2RGVA 4Q5SF 2J5OA 1HCRA 3N05A 4ENJA 1N78A 3HL2A 2Z2SB 2Z16A 3H92A 3QP6A 4EM0B 1QGPA 1WI9A 4P55A 2CUZA 4UVCA 4HV5A 4QIWN 1LFBA 3K69A 1MH4A 1YHQI 3GLXA 3QRFF 1P7IA 2OU2A 4X1EA 4IZZA 1R5ID 3R0JA 2W85A 1A04A 2QKMB 3W6KB 1W0TA 2HEOA 3ZP5A 4G9YA 3OYAA 2DFFA 2P8TA 3DPLC 2XV4S 1R23A 2MC3A 2EILH 3LSPA 2HYFA 2Y0SA 4O5VA 3U21A 2BOLA 1ENHA 2JRTA 5ICGA 3DTEA 4ZC3A 2WWYA 3GTQJ 1I27A 3M8JA 2P6SA 4Y13A 3AKZA 2R7QA 3BR5A 5LBQA 4ZYDA 3DF8A 1BBYA 2QVOA 3GTKJ 3CD6I 2LYCA 2JUGA 1ZGJA 5IP7J 4C30A 4CCJA 3CC7I 4MFDA 3RSNA 5CYVA 4ZYEA 4U7DA 2CQ7A 2RVCA 4PFPA 3I9V2 1FOXA 2AXLA 2QM3A 4LB6B 2D1VA 2Y75A 1N75A 5LGNA 2R7DA 3KX2A 1MMAA 3S2HJ 1ZR2A 1S6LA 4JYKA 3GYHX 2DMPA 3ZGKA 1K61A 4LK0F 4C9YA 4XONA 5A2QZ 2PMZA 3FXOA 3I71A 4YIIA 3NAUA 1WH7A 1QHGA 2ESNA 4XLPF 1E0EA 4DZPA 2R7FA 2FBIA 5HLIA 2QQAA 1VQNI 2FOWA 3I4MJ 5IY5H 4A12A 1X1AA 1ONVA 4XLAA 3KZIC 4A0XA 1N77A 1QPMA 1W5TA 2FX0A 4M73A 3WTXC 2B7EA 2JA5J 1ETOA 3HBLA 2VKEA 1MSEC 2Q0OA 3QYEA 5ILSA 2E7XA 2HOEA 2VJJA 3VODA 5DD8A 2FUG2 1TTYA 3CMAI 1SFXA 2Q2EA 3F22A 2OJED 2DJIA 5B1BH 3K4CA 2HDWA 4AUXA 3DV8A 3ZN1A 2CQQA 4CZCA 1RIOH 2H94A 4E7SA 4ZYGA 1MDMA 2D2WA 1HKSA 2F5EA 1D8KA 3E97A 3CLQA 2CU7A 4IHSA 1RESA 2M3AA 3CCQI 1JT6A 4B47A 3IL2A 4YIRX 1SD7A 3ZQIA 1OCCH 2CV2A 1GHCA 4KT6A 4ZZLA 2EQRA 3BG9A 2JN6A 2LF8A 2YU3A 1FT9A 2XPUA 3K70D 3F6OA 2W82A 2M5WA 3G1LA 4AM3A 2VODA 2JZYA 1ZG3A 3NQOA 3CLOA 1FYLA 1LFUP 4C2UA 2Y9YA 3BTIA 1K7AA 2O6GE 3E6BA 3X2QH 1Z67A 5F64A 2DODA 4YELA 4G7HF 3KYDB 2JPBA 3LQRA 3RYPA 2EZKA 2ME0A 1E17A 5C4JJ 2FMYA 4EJUA 3CC2I 4LD5A 3PM1A 1P6RA 3CF5F 2EV6A 3DCFA 1L0OC 1TLHB 3HJEA 2A5WA 3BPXA 1HA8A 2MA3A 2VUMJ 3ZQCA 2DPUA 1TWFJ 2KL4A 2DU9A 5DCMA 2OCEA 1HW5A 2WBMA 4BDZA 3ERED 3TOBA 4YFXF 5CQEA 2IVMA 3SHFA 1D1CA 1Y1WJ 1BOAA 2ESHA 3OY9A 3S1RJ 1P92A 4IXAA 1VF9A 4W97A 2HQRA 5LHGA 4I6ZA 5DEQA 1TW2A 2DA3A 2W24A 2QQBA 3S1MJ 2KRFA 3C7JA 3L2CA 1QRYA 2QSGX 1FIAA 4HNUA 3CCVI 4PSXA 1NG6A 2LP0A 2P5VA 3N4MA 2WB1N 2L4AA 3I4PA 3TW7A 3QPHA 1K83J 1A35A 2CS3A 2M4KA 3OYMA 3ASNH 4XORA 2R93J 4HEA2 4BGDA 1O3RA 3I55I 4RGUA 4D5CA 3IHUA 2E19A 3C2HA 5FRMA 2LY1A 4HV6A 1IAWA 2DXIA 3F3XA 4ZZDA 2GQQA 4OIRF 4B09A 1YIOA 5ERIA 3S8PA 4NC7A 3FDYA 1X1CA 2VJIA 1FX7A 3F0CA 1R36A 5L3GA 1KQ0A 3SZGA 1WWXA 2I10A 3KIOA 1OFCX 3ZMVA 1XGSA 1ZLJA 3VYTB 2M0CA 3HSRA 1SD6A 1E2XA 1U8BA 2R3SA 3IKTA 5EEHA 3FXMA 2R4GA 3G2BA 4WWCA 4B44A 1K6OA 3EYIA 4V2GA 4P5OA 2A05A 2NXNB 3LAJA 1R22A 1U0JA 2WAFA 4HZFA 2DT5A 1WSUA 4KITB 1KU3A 3KETA 3SFZA 1X1DA 4NQWB 1JJ8C 1YRNB 1FP2A 5HLHA 1ZREA 2YX4A 3FXJA 5E3NA 2LOOA 1UB9A 2GOXB 2F48A 2R7RA 2ELHA 1HQCA 4AC0A 4A3KJ 4LG3A 4A3DJ 1R4NB 4G8XA 1LDKB 2MSYA 2B0LA 1Y0NA 1MBKA 4HBLA 1QO0D 2PMZN 2IXSA 4HX7A 3OYBA 5EG0A 3OSFA 2HI3A 4XSZF 1ULYA 2GLOA 4PJJA 2X1CA 4QSHA 2IRFG 1FEXA 1V55H 4I0AA 4RGXA 2DAOA 5FFZA 1X19A 5C44J 3JW4A 1QA6A 3ASOH 2GIZA 3VB2A 1PUFA 4PSWA 3GFMA 4KIBA 2R5YA 3MKYB 1QQIA 1YE9A 3NRVA 4FX4A 1R4MB 3ONQA 5CQGA 2XSDC 5GAEJ 4XOPA 3K1NA 2ZNYA 1GXPA 2O8KA 5F6FA 4IRGA 4CCNA 2XGEA 5JLWA 5KNLA 3TO9A 3H0GJ 2DMQA 4HNVA 2IS6A 1ACIA 2E2JJ 4UUVA 4G7ZF 3HKZA 2EIKH 2I8DA 1VQMI 5HLGA 4UVBA 3BTLA 4YIFA 3GTMJ 2E7WA 2UZKA 4CYCB 3PNYA 4IOAF 2Y0MA 3F9KA 4S05A 1IV6A 4XLHA 3R60A 3BTJA 1Z9CA 4AIKA 1AKHB 3ZXSA 3RTRA 4RLQA 4FTHA 3CCYA 1C0WA 1TWCJ 2L9SA 2JRMA 2FD5A 2VC1A 5M5WJ 3L9FA 1R00A 1OQYA 4MTEA 1V5GA 1X1BA 1IXRC 1MBHA 3F8BA 2MYSA 1VQ5I 5D5VB 4IHVA 5J8CA 1V4RA 2VIXA 3ISPA 3DBRB 4QPOA 2FNAA 5B1AH 3LA3A 1JGSA 3WE2A 1T56A 2WADA 2L9NA 2DFHA 2KZVA 3V7SA 4BL0B 1UHWA 4EM1A 2O3FA 2BGCA 3MMYB 3OOUA 4HW0A 3I54A 4DW6A 5JHUA 4KFCA 4I99C 2X4HA 3PNTA 1R5HA 3S3OA 5J3LA 1BI0A 3VEPA 3F23A 3WTUC 4Q48A 1Y8RB 3JCUC 2X9DA 3WGHA 4XK4A 1U8RA 3O3KA 1U3EM 2BV6A 1NTCA 3Q9VA 3HPGA 1ON1A 1X3UA 1QZEA 3JTHA 5IP9J 2W84A 5CVJA 3DLLF 4O6JA 3I59A 5GTIC 3E5XA 4WXDA 4XRSG 3A1YA 3J7ZI 3HEFA 2K9QA 1MZBA 3L2VA 3IAM2 2NRAC 4F92B 2A6TA 4UNOA 1UCRA 1P4AA 4W1UA 2XAQA 1D8JA 3WTWC 3RCOA 1ZKGA 1WCMJ 2F2EA 3OR1C 1PJRA 3DQVC 3DLAA 4JX6A 3MWMA 1WGXA 2BY1A 4XOTA 5ED4A 4HA8A 3Q0VA 4IKFA 1ZH5A 1HW1A 3W6JB 3A01A 3CCJI 1WH5A 1B4AA 3JSPA 2ID3A 3OYCA 5BNGA 4LOCA 1YITI 2XF6A 2W00A 5E1WA 3PL8A 4AYBA 4HDUA 4UXNA 3M9AA 2P6TA 1Y56A 1CGPA 2JVGA 3IWZA 2IS4A 4LG0B 1IV8A 2YPRA 3WTZA 4ZTFA 2PI0A 2JUCA 3G1MA 5HOOA 4N9IA 2H1LA 4ZYAA 3K7AJ 3J80Z 1Y39A 2VT2A 2ZJ2A 3I58A 2O8XA 1RZ4A 3PJRA 5JR3A 1U5TB 1PP8F 5IT9K 2X6WA 4IRIA 3S15J 3L00A 2WAQA 5EJCA 3G4SI 3EDPA 2TDXA 2NYXA 1AHDP 4BE0A 5J1UA 4AWXB 2LKXA 2H1KA 4MFEA 3HRTA 2RQQA 1G6NA 4HQEA 3GZ6A 3BG5A 3I3LA 2K5CA 1SC7A 4XN3A 2XRNA 4DYQA 2VI6A 2HVSA 2EFWA 2KP6A 1E3PA 3LSKA 3ABKH 3OR2C 1TWGJ 2Y30A 2VLAA 4XKWA 2MD0A 3ML6A 1PYVA 5B5EC 3B6CA 5DV5A 4A2UA 2QKLB 4A6EA 1DPRA 2FBHA 4K2EA 5EGOA 1HF0A 2OCCH 4OIPF 2BXZA 1Z7UA 4E7HA 3SYTA 5GP9A 3KP5A 5K7HA 2ETHA 3FIWA 2EZHA 3WGIA 3CO6C 3HSEA 1YS7A 3ZN0A 1G3WA 2GBYA 3CCEI 2DMNA 1MMSA 1TZLA 2CFXA 3PNVA 1JI8A 3FWEA 1YI2I 1VQ4I 2E5NA 3V42A 5K7ZA 3CMYA 5FO5A 5BOXA 3MKZA 2QBYB 2X85A 2K85A 4OIQF 3PSIA 3FHNA 4IVNA 1RRJA 3EUHA 2HGCA 3KP4A 1LPQA 1WFXA 4P9FA 3A2KA 3BR6A 2Z99A 1U9OA 3W3CA 3LSTA 3Q0UA 1OJLA 1EH8A 3HKZN 4PZJA 3QAHA 1VTNC 1KU9A 5FLMJ 3ZMZA 2WA0A 5IT3A 4B43A 9ANTA 3RQIA 1T8IA 3BR1A 1G4DA 4HYEA 3HOZJ 4ITVA 2X6XA 3W6VA 4A0ZA 1ZTRA 5GAGJ 3V7RA 2K7LA 2W25A 4EQQA 1LEAA 3RKQA 4GFBA 4Y15A 4FETA 4IOCF 4F3QA 3ZOBA 3WTSC 1J09A 1USTA 1J5YA 2ZMEB 4EM2A 1QZZA 3F8NA 2E2IJ 1IRFA 4IHTA 3AG4H 4R1HA 3GVAA 3QOPA 5CVIA 1WKMA 2JT1A 1VQ8I 5LGUA 3HDDA 2YX7A 3VSKA 3TDUC 2W48A 2ZFUA 4N4NB 1MSFC 2ISYA 3KZZA 1B72B 3DEWA 1B1BA 5JI6A 2DPDA 3LSMA 4C3JJ 1V54H 3PUFA 1IZ1A 1SMYF 5FD6A 1W1WE 3OS0A 1FYKA 1TW3A 4UB8C 3KFWX 3P9KA 3FHZA 1P2FA 1MBFA 3JRCA 2KFDA 4FHTA 5D4SA 4U87A 4E7KA 1WHUA 4CH7A 1FIPA 3F6VA 4A3MJ 2EA4A 2QWWA 4WXCA 4NUBA 2FOKA 1Z0XA 2DDAA 4N0BA 3J7AY 1YOVB 3ABUA 4P9UA 2Z3YA 3J7YJ 1OISA 1WJCA 5HS7A 3JAMK 3N97A 3IV5A 3KEQA 1FOWA 1YJ9I 1GT0C 4UB6C 3LA2A 3PSFA 2GXGA 2XRLA 3VOEA 2STWA 3F8MA 2EH3A 2VQCA 2YU9J 3FZVA 3GFJA 4FE7A 4HSTA 2VBYA 2OAZA 5CLSA 2OQRA 4PGGA 2QUFA 1B59A 1JKPC 2JWTA 2VPLA 4M74A 2XAJA 4M72A 4E7JA 1SFOJ 1R1UA 3WHCA 3HM5A 1ZELA 3BG3A 3C2BA 1K78A 2LKPA 1DGRM 4XL9A 2DA2A 1EJ9A 1E3HA 3P7NA 5DM7F 4AYBN 5BS6A 1XGNA 4NC8A 5KVRA 3K2ZA 1AA7A 2HVQA 2ISZA 3QODA 1ETWA 3TOAA 2QENA 3FX3A 1TC3C 1S7OA 2QYOA 4BYYA 2G7HA 2RQPA 2L7ZA 3QP5A 1BJAA 3GFLA 2TRTA 4DJAA 4BEHA 2FA5A 2K27A 2Z33A 1IGNA 1USSA 3JRDA 2L4MA 2PX9A 5F27A 4BU2A 1RR8C 1FTTA 1VI0A 2HDDA 4I76A 1LE8A 4B3AA 3E3VA 2A07F 2Q2EB 5LEKA 4IO9F 2XC7A 2GA2A 3HRUA 2IS2A 1H9GA 2WAQN 2V6EA 5GPCA 2FXAA 4M9SA 3VDXA 3CCLI 1JTYA 1VNDA 1YW7A 1MDMB 2DTZA 4GO1A 5D6FA 3WE3A 3F21A 5HDGA 3H36A 2LY2A 3BZKA 1LNWA 3ECOA 2DYSH 4BQQA 5ICEA 1BR1A 3KP3A 4M9ZA 5CVUA 2BHZA 2MABA 3GZNB 2GOMA 4HAMA 5KAIC 3SXYA 2HVRA 2KJCA 5F1JA 4A6DA 3I0TA 3KPHA 3UNGC 1EA3A 5K5OA 2E1OA 1S8NA 2FEZA 3CC4I 2KLOA 2R7SA 2HOAA 2XUBA 2DA1A 2R92J 5EEAA 4PJ0C 1B6AA 1ZRFA 1W5CC 3C2GA 2AXTC 3BR2A 3KP6A 2V1UA 1D1BA 1JHFA 1VQPI 2A68F 4D9JA 2P5KA 3GTJJ 5E79C 2OTLI 3RZOJ 3QWLA 5HS9A 4XIDA 2OBPA 4CGZA 3M1EA 4FCYA 4PDKA 3V8KA 3BT9A 3E5QA 3LWFA 3DXJF 4MO7A 5DUKA 4EEFG 1WVRA 3H5RA 2KIFA 2ZNZA 5K7FA 4NNJA 1B9NA 5HNHA 1W0UA 4F52A 3BJOA 1FBSA 5B66C 5BPDA 1RUOA 2D1HA 1MNEA 2VC0A 1JE8A 5DCMB 1K4TA 3O8GA 3C18A 3BC8A 3LSIA 1DU6A 1Z1DA 4BH9A 2XAUA 3EUKL 3OIOA 5IOYA 4L9JA 4DBQA 2V1NA 4ZJZA 3TO6A 4XRSA 4MQ9F 1XSXA 3LFKA 3H9GA 4A3LJ 2DFEA 3ZRGA 2V1DA 4JQFA 4RM3A 1HDPA 4X6AJ 5AONA 3D0SA 3RKXA 1UAAA 1FBUA 5FKLA 4B8XA 1B8IB 2XSJC 6PAXA 3LNQA 1IN8A 4U7BA 1MNDA 4BS9A 4D5FA 5DUIA 2DT7B 2DBBA 3PIPF 2FJ1A 2M4GA 5L3BA 3CJNA 3K4BA 5FB2A 2R7XA 1BN5A 4UUTA 1MKMA 2FNPA 2V7FA 3ZQHA 4F7ZA 2HOSA 1XSDA 4WXHA 4PJNA 2CUEA 4KYWA 2WC2A 2JTVA 2XGDA 3QYFA 4EJOA 3QQAA 2COMA 5DCFA 1W36C 2ZC2A 2K9NA 1R71A 1H0MA 5FFXA 2KRHA 2B9SA 1VQOI 3HTSB 1MBJA 5H6QA 2X51A 1FP1D 4ENKA 1BA5A 2ZJQF 1DQUA 1D5YA 3VYRB 1RETA 4ESFA 1FSEA 2MW8A 2R5ZA 1FMVA 4CCMA 4D1QA 3AAFA 2JPCA 3T1BA 3L2UA 3WG9A 1ZQ3P 4IPAA 1XB4A 2CUJA 3KYLA 3NWTA 2ZB9A 3ABMH 4L0YB 3J81Z 3HIFA 4GDFA 1HKTA 2HPMA 5CJ9A 2GIVA 2CQNA 1O57A 1APLC 3OMYA 3HZJA 2IS1A 2WV1A 4A0YA 1SMTA 3KCCA 2ZFWA 2ZSIB 3VYUB 1XS9A 2K9SA 1R5GA 1XTAA 2KIMA 5HNFA 2GM4A 3FK7A 2LLKA 3K9TA 4L18B 2MH2A 2HQNA 3PFYA 3FK6A 3S2DJ 1HSJA 1PUFB 2L01A 2R7WA 2R7UA 4JK1X 2FU4A 3E7LA 1XCBA 1ODDA 2F5DA 1IJWC 1MMDA 1BR2A 1R58A 3C1DA 4KMUX 1MBEA 5F1RA 2PMUA 3SDGA 3HOXJ 4OU0A 2YUSA 3ZCOA 2STTA 3RIRA 1OPCA 5A2QK 3BCBA 3BG7A 4E7LA 2WY8Q 4MIMA 2VB6A 2NVYJ 3H3VK 5D5XB 1D0YA 2DK8A 4HX4A 4LJZF 3RYRA 3RPQA 4MNUA 1X4OA 3LL7A 3SFIA 5FLXZ 1G3YA 3ERMA 2OF7A 5FROA 2P7VB 4CCLA 3M07A 3MKLA 3AL0C 4ABZA 2KIUA 3QYBA 5M3FJ 4BY1J 2VXDA 2XGCA 4Y33A 1A5JA 3K2AA 1WJAA 4YG2F 1G3TA 4H4KC 3Q9SA 3BQZA 2E60A 1PUEE 2K02A 2Y0SN 2M9HA 2BYVE 3EUHC 3JREA 2BY3A 3MD2A 4JBAA 3ZR8X 4LB5A 1T0FA 2F6CA 3EETA 5E8IA 2LRDA 4XMYA 2C6YA 2H8WA 2PJRA 4C2MJ 1JUSA 5J4VA 1YX3A 4XR6A 3CJTB 4L5EA 3REOA 5DS9A 3S3MA 1BL0A 5LLQA 3TQNA 2VOOA 2X0LA 1TT0A 3DEEA 3BJ6A 3MZ8A 3DFGA 5KHDA 1R49A 2GZWA 4ZH4F 2VASA 1Q1HA 1OLTA 4PJLA 2LREA 1R6RA 3TW6A 3A03A 2N8GA 1XCVA 1IF1A 3IKVA 3BR3A 2LMDA 2M8GX 3I59B 4KJZA 1A6IA 1FYMA 1BOBA 2LSOA 3GWZA 5FKMA 4S04A 4A3JJ 1AU7A 2M1BA 3JR9A 4IHWA 3VFZA 2Z9OA 1WI3A 3K1PA 4OMYA 2G0EA 2KJBA 4B4CA 4A93J 2CG4A 4FQGA 4XN0A 1CF7B 5D5WB 1VFCA 1PVEA 2HDCA 4RB0A 1V5FA 4EGYA 1W5SA 2LY9A 5M5XJ 4L9TA 1HXDA 1I6HJ 3M4OJ 2HKXA 4IQ4A 3A0BC 4RLFA 1XC5A 2JMWA 3PQKA 1W4MA 4BXXJ 4HDVA 3RDIA 2H8RA 2IJLA 2BEOA 2BW3B 1PP7U 4L0ZB 4L5JA 5GAHJ 2D5VA 4AIHA 2YS9A 2W57A 3CMMA 2HR3A 3KEOA 1D0XA 2QSFX 5K5RA 1OR7A 4QPQA 4F91B 2XAHA 4ESJA 4FE4A 3O6BB 2Y2ZA 4EGZA 1QVTA 1HW2A 1I3AA 3OL4A 2EWNA 4M71A 1EH7A 3IC7A 1WZ2A 3E5UA 1D3YA 3UKGA 1LUJB 1UJ8A 3QPSA 2NVUB 5IPAA 3IRQA 4BJ5C 5HDNA 3DU5A 2Z1DA 2AS5F 5H6RA 5GPAA 1ZG1A 1GVDA 3ABLH 4DIQA 1FY7A 4ENMA 4XNFA 2EFOA 4BXUA 3HGYA 5TISC 4XLFA 3L2QA 4AD9A 4RB3C 3SZPA 1FTZA 3TDZC 2K4BA 3HUGA 3S1NJ 4G6DA 4BE1A 4GGGA 4XSXF 3FMRA 5FKKA 2R0QC 2QZ8A 3LOCA 1SEUA 2MLKA 5IYDJ 2RNGA 3WU0A 1HOMA 1UZCA 1T2KA 4UVAA 3DPTA 3M8FA 4CHUA 4GCVA 4ETSA 5LRSA 1FSHA 5L3CA 2EIJH 4RB1A 4S0HB 5JVTA 3V8LA 1RKTA 2ADUA 3TL4X 2M0MA 3KLNA 1G59A 2X1EA 2M87A 4G12A 1YJWI 1VZ0A 4CUGA 5FKNA 1R9TJ 3BTCA 5CVRA 2ZXWH 5EGOB 5J47A 2JJ7A 3LAPA 4R79A 3RPUD 3WU2C 2PN6A 2FQ3A 3U9GA 1F4KA 3M3YJ 2ELJA 3FKJA 4EJTA 2CSOA 1IO2A 3CTAA 1DP7P 5HODA 4LLGF 1V3FA 1EF4A 3JTGA 3FMSA 5EYRA 3CP8A 3U1KA 3OSGA 1NK2P 5LRRA 4NQWA 2FQ4A 5IP6A 4F55A 2QGUA 4AU7A 1J2XA 3OS1A 2K3FA 4YRVA 5EDNA 5LHIA 2LH9A 2XKPA 4GYIA 2VQHA 4CXFA 2CV0A 1NH3A 3BP8A 1IN7A 1S9HA 2XKOA 4A5MA 3HB9A 2LNBA 1W7PB 4BBRJ 3R4KA 3U2RA 4DNCA 3ZMTA 4XRMA 4C3HJ 1NK3P 1XX5A 1Y0UA 2O61A 2JA8J 4UUSB 3A02A 1I6XA 5TGTA 5ICCA 1NG7A 1YJNI 3LA7A 3MZHA 1KQ9A 3A4CA 4YEJA 2DOAA 4B3XA 2LG4A 1FZPB 2BBYA 4KICA 3KZYA 3OOPA 4M6VA 3LQQA 2LTPA 3RQ4A 4EJWA 3GFIA 3DTIA 3G3ZA 4KMFA 2VE9A 2OZUA 1OCZH 4Y7NJ 3HHHA 4ANJA 3HRSA 2UUZA 2KDZA 1UELB 1X3WB 4PJMA 3ELKA 4CICA 3BQYA 1ZN2A 5LFAA 2OZ6A 4DZJA 2L9RA 2P0WA 4HQMA 5LHHA 4CYCA 3OYFA 2CRGA 2XB0X 3TGNA 3JRHA 1VQ9I 1DGWY 2ECBA 4IHXA 2XASA 2M7BA 1JKOC 2G9WA 4MTDA 1AKHA 3WTYC 3SZTA 4GYGA 4QLCU 1BI2A 1XMKA 3T5XA 4HOBA 3DKXA 1TQPA 2FF4A 1QBJA 1MJ9A 2CUFA 5CPRB 1IC8A 4BY7J 4CCOA 4JX5A 2HU9A 3K4NA 4C3IJ 3H5AA 4PGHA 2HNHA 2LDUA 3G73A 3R61A 5HDKA 4WX9A 4BBSJ 2M7AA 2NS7A 2QSHX 1JKRC 1P4WA 3A0HC 1O7LA 1Z21A 3LFUA 4IF4A 3S93A 3QPTA 2ZSHB 2ID6A 2DTRA 3CO7C 2VKDA 2L54A 1R1TA 1Z6RA 2DA4A 3GF2A 3JRFA 1W36D 3OYNA 5GTHC 3EUAA 4V19K 1WJFA 3PQJA 4RGRA 1XG1A 1QHHD 4E4HA 1IDYA 1BI1A 5IYBJ 5GADJ 2M45A 5DTDA 4BQOA 5CKTA 1H8AC 2CV1A 1YFHA 3BZ6A 4EJVA 4A3IJ 1BW5A 2YR2A 2BHYA 1QU3A 2V1XA 1Z6TA 4U0YA 1DU0A 3HOUJ 5F0CA 2V9PA 3PO2J 4XLCA 3GTLJ 3HGGA 3OYKA 2E1CA 2HYGD 2R7OA 5E17F 1OCTC 4BQAA 1XDUA 2UXNA 2EZIA 3G6EI 3E6CC 4IX7A 5E18F 2V4JC 1DUXC 3KP7A 4Y17A 2YSRA 2LR8A 4XLNF 2VOPA 3V8JA 4DOZA 2JQ7A 2O0YA 3BLYA 3DWLE 4MHGA 2R7TA 3CDHA 3SQNA 1FNNA 5M3MJ 2E36A 2P81A 2Y48A 3HRMA 4N9HA 3TP0A 2K86A 2ZXIA 4AVPA 1ZYRF 2DJNA 3LSHA 4E70A 4RA2A 5D8KB 3E1SA 3J80K 5JLXA 4HF1A 5M5YJ 2Z5UA 1YYVA 1AOYA 1U5TA 1K6YA 3FXKA 3FM3A 2JSCA 2IA1A 4HLXA 4BHPA 1I5ZA 2BVLA 3IP4B 3OL3A 4HX8A 3CDLA 5K5QA 5B3SH 2IGNA 1YTYA 1X2MA 2OPTA 3IAS2 4PCQA 4BUPA 1DDNA 3OS2A 4NC6A 3K4KA 4KN7X 4IHYA 1SAXA 3M7GA 2A6EF 3CJQB 3AG2H 3TP3A 1KU2A 4AVZA 2LC2A 1FBQA 3CF2A 2M30A 2KKOA 1Y8QB 3WU1B 2O5RA 3COAC 2M34A 5K1YA 2G7UA 4OINF 3G71I 3V4GA 3CCMI 3OYJA 4ENNA 1SVMA 2JK3A 4HRIA 2XDVA 2P4WA 1RNLA 1STZA 3CUQA 3GTOJ 4RAGA 2EPFA 1W7PD 4Z6YA 2K40A 1Z91A 3TBIA 5IOZA 4Y3OA 2Q1ZB 1T0FC 3ZQFA 4Z2YA 2NOGA 1REPC 4M6YA 2A69F 5BPIA 4V2FA 2GXAA 2DMUA 4ESBA 3BPVA 2CYYA 2BY2A 2W7NA 1ZR4A 4UY8I 1GDTA 4G7OF 2PEXA 4Y4RA 1WJDA 2EFQA 1BIBA 2HZDA 5DDGA 4BNCA 1HLVA 2KQRA 1MJAA 2X48A 1JKQC 2TCTA 3ZMSA 2VE8A 3K1MA 1LB2A 1RUNA 4HNTA 4J19A 2NOJB 2H6BA 5EZHA 3TKYA 4FISA 2FE3A 1IN6A 1GLNA 1MGTA 1DPUA 2A5YB 5L3EA 3HHGA 2QA4I 3I4NJ 1F36A 5F04A 1O3TA 2V26A 3E6DA 1VQ6I 2Y9ZA 2M8EA 2OTJI 1OCOH 1T98A 4MGRA 1G8XA 2FSWA 3ZQGA 4D7MA 3JSOA 4I2OA 4PFOA 1POGA 3H3ZA 2O03A 2ZMEA 1KQ8A 1WJBA 2DT6A 4G6QA 2WB1A 3DEUA 1U9NA 3DKWA 1OMIA 2ME6A 2OC6A 5BQTA 2QEXI 4RM2A 3EQLF 1IRXA 2GWRA 1OR7C 2BE5F 1QNTA 2LK2A 4EMSA 1B72A 4KDPA 4B1RA 5ILVA 2R5ZB 1V5EA 2DA5A 1HC8A 1J7KA 3PFIA 2XPVA 4UV9A 2EFPA 4NBQA 3VYSB 1ZARA 4ZDLA 1A6QA 1JT0A 1MMNA 1YLFA 2IAIA 1OKRA 3CP2A 4C2TA 2GA1A 5D4RA 3U1DA 1IN4A 1EH6A 1I1SA 3W2VA 4CSWA 1WJ5A 3ABTA 2AHQA 1Z77A 2ICWG 3Q3SA 1Z05A 1ORKA 3O2PE 2EBIA 3CZ6A 3PUBA 2LFBA 3AG1H 2CH0A 4E7ZA 4HPQA 3NEUA 2LF7A 4RS8A 2F5FA 1M1EB 4BJTA 4NB5A 3SJMA 2F4MB 4Q4ZF 3LMMA 4CCKA 1AWCA 5KAFC 4EATA 4L9VA 3GCMA 4D0PA 1T38A 4WCGA 1XMAA 2WV0A 1EKEA 2MFZA 1BC8C 1XSVA 3B02A 2MD5A 3R6SA 4XLEA 1U2WA 3GTPJ 4Y52J 2CWEA 2PQ8A 5J6XA 3RI4A 3GW2A 2XGXA 4LMYA 5J1RA 2EFNA 1H89C 5JHFA 5H2FC 2NAZA 4LFUA 3B6AA 2XAFA 5JFRA 1H88C 4HF2A 1I39A 3S3NA 4LLNA 5DD4A 3WHBA 4A3CJ 2CQKA 2OQGA 2BVMA 2VXZA 2V79A 3DP7A 3NWSA 3PIOF 4JP0A 1VQLI 2FMLA 2EZLA 2L7MP 2MGQA 1XGMA 4I0BA 3BWGA 3K4LA 3QU3A 3ZQ7A 1K4SA 5FKOA 2HZTA 3K4MA 5J8FA 2QF7A 2KPMA 2FBKA 2L7KA 3VWBA 2NNNA 4KIFA 3GMEA 2BY0A 1YG2A 1LKXA 2V9VA 2XHKA 4X0GA 2PJRB 4IJAA 2HYJA 5E3LA 1S72I 2DA7A 1XN7A 2HTSA 2KISA 3F72A 3OYEA 4DYCA 5LD2C 1E3OC 4WK8F 2D45A 4LLLA 3JRAA 1JHHA 2VKHA 3DBLB 1UHSA 1LEBA 2E1MC 1LQ1A 1P4XA 2VBWA 3CESA 2RDPA 2EIMH 3QPLA 3DU6A 1T6SA 2CQXA 5L3FA 2LVSA 2CW8A 4J00A 5IYCJ 2XF7A 5J40A 3KE2A 1XDSA 1JUPA 3G1OA 3OIQA 3FBNB 3ZQLA 3GTGJ 4UV8A 4A3GJ 4ZDOA 2RNJA 1K79A 2VPRA 4XICA 2DA6A 3SDBA 1MD0A 5F08A 5EG0B 2DQLA 3K10A 1X4PA 3MAJA 2HFHA 1RC9A 4II2A 3D5SC 1R1VA 5D8LB 1P9QC 1TWHJ 1QVUA 2QQ8A 2LD5A 1FC3A 3P9IA 1TNSA 3KEYA 1BI3A 2QCOA 1XGOA 4DBRA 2R5YB 4RB2C 1GV2A 3CUOA 3BROA 1TL8A 4P1WA 3GUDA 3IUOA 2L3DA 4IRHA 2NVTJ 2K9MA 3T8RA 2CFOA 4LITA 3H0DA 4GXOA 3AG3H 3O8HA 5H20A 4ZTJA 2CMPA 4JX4A 2XB5A 2NVXJ 3HG9A 3M1CA 2RV8A 2MH9A 1KZHA 1J59A 1JTXA 3HOTA 2VQLA 2DQRA 2IPQX 3H5NA 2Y31A 2ECCA 3BG6A 3OYGA 2EK5A 3RZDJ 4J01A 1F9NA 4IL6C 3AFHA 3WG7H 3TMOA 2EV5A 3D1NI 2F5VA 5CVVA 2PG4A 2E34A 1KONA 4IEJA 3IH3A 3FBIB 2DMTA 1N25A 4RAYA 5KK1A 3QOEA 2AO9A 4I09A 1SD5A 2ZBKA 2XROA 2E5ZA 1SFEA 2XIGA 4HLYA 4KNYA 5TJJA 3DPUA 2IA0A 4L9NA 2XF5A 3CDIA 5HVQC 2JA7J 1IRZA 2KRCA 1B8IA 3HC7A 1ERDA 3HUGB 4MLOA 4KISA 1T95A 3BY6A 3DKYA 3Q5FA 2F4IA 2F5CA 1UFMA 3OWTA 3JRBA 1MBGA 4P96A 1KU7A 3TO7A 3L2RA 1MW7A 2RKHA 4OOIA 4YFKF 4CO8A 3S14J 1YQAA 1IN5A 3WODF 1YS6A 3K4JA 2HWVA 1XPXA 2QLZA 3F8CA 5FD5A 1BC7C 2DN0A 5AIQA 4KIGA 5KCMA 4XKCA 2W1OA 2GAUA 3W2WA 3J81K 4NHJA 2Y69H 5E8GA 1F5TA 1MNMC 1TNTA 2IA2A 1T08B 1TT5B 2L7FP 3ZMDA 2WTEA 2X1DA 2A6HF 1FJLA 1ZGWA 3A01B 4E6KG 2RAEA 1U5TC 3MFKA 1JGGA 4XBFA 5C3EJ 2VL8A 2DO7A 3D5RC 1MIJA 1X58A 3BDDA 3RPUA 2ZO4A 4KA4A 3H3UA 3FF5A 3CCUI 3L2WA 3L09A 3JRGA 4BHBA 1FLIA 2H27A 1H9TA 2KHMA 5J4YA 2E2HJ 2NS0A 4XM3A 1O3QA 1S7AA 4EV0A 5E1XA 2E1MB 1HKQA 3VSLA 1LDJA 3CQZJ 2PFBA 2ZJRF 3FXRA 3S17J 4MQVA 4R8HA 1TWAJ 1QZYA 2ZCWA 2H6CA 2HS5A 3V7CA 2V9KA 1O7FA 4LGWA 4F93B 3Q0WA 1JUMA 2CO5A 5FJ8J 5IT9Z 3HYIA 2IT0A 1Y1VJ 1OCPA 1GV5A 2IEKA 1L3LA 4ON0A 1P7JA 4RGSA 4MEYF 3CUQC 1RI7A 1U78A 4I02A 2VT3A 3M8EA 1ZG5A 5ILUA 4AIDA 4ZDPA 3FXQA 3MCZA 4FT8A 5FLXK 1UHMA 4G94A 2WY7Q 4LIVA 3BJAA 3OV8A 3T8TA 2NVQJ 3GZ5A 5D5UB 3CJRB 1FPQA 5FGMA 4B48A 4AIJA 1O3SA 2PBIA 4BAYA 3E0JB 4BDYA 2BXYA 3LSGA 1IG7A 4OAZA 1VQ7I 1NHAA 4KN4X 3GXOA 3D5LA 2F4OB 2VJ4A 1IXSB 2E71A 4A3FJ 5DYMA 1ZRDA 3HXLA 3HSFA 1UG0A 3DBHB 2R7ZJ 3P9CA 3I53A 3VPRA 4RAZA 3GX4X 5DM6F 1ETYA 4IQJA 3MEXA 1VQKI 4L5IA 3GO5A 4LIUA 1YRNA 3AL0B 1U6GA 4OMZA 2HQAA 2GXBA 2E1NA 3EYYA 1OYIA 3MVPA 1I3QJ 2VBXA 3TEDA 1FOYA 1S29A 1EV7A 2ZMEC 4E7IA 3WTVC 3FISA 4BQNA 1GUUA 2IGOA 3MKWB 2VONA 1X1PA 1S7EA 3QU6A 2PLYA 1BJZA 4ZYHA 2HXOA 2VKVA 4H0EA 2P7CB 3ROUA 2EA2A 4DGWB 1MMGA 3KLOA 1CF7A 2VJ5A 3IWFA 3MZYA 1T33A 2ZXJA 5E1ZB 1ZK8A 5HS8A 1ON2A 1KGSA 4GRIA 4QWQA 3I56I 2L9VA 4DYRA 5EF6A 3FXUA 2WAEA 5L3DA 2KMUA 5JVGF 1BW6A 3HOWJ 4CDGA 1RKWA 2ZXHA 2CW0F 4JOMA 1F43A 5D6EA 1BR4A 2BW3A
chains in the Genus database with same CATH topology
3K4KA 2VQGA 3ZRGA 3OYIA 3OIPA 4JQFA 4RM3A 4B44A 2X6YA 4P5OA 3CJQB 1U0JA 2AQEA 2WAFA 1UAAA 4AVZA 4KITB 2IGKA 2JVHA 2LC2A 1X1DA 3CF2A 4NQWB 2XSJC 2IGMA 2O5RA 3H9QA 3SEQA 4U7BA 3K70C 1MNDA 4BS9A 4FASD 2DT7B 3K6GA 2LOOA 3OYJA 2GOXB 1LFPA 2K3PA 2M4GA 2R7RA 4HRIA 2L2OA 2XDVA 4LG3A 2HPIA 3K4BA 2R7XA 1LDKB 4BJ6C 2V7FA 3TBIA 2IXSA 1Y6IA 3OYBA 4Y3OA 2Q1ZB 4PJNA 2UWMA 1T0FC 2MC4A 3QYFA 4PJJA 4PUSA 1W36C 2X1CA 2KRHA 4N4OB 1X19A 3SEZA 2X51A 4PSWA 3H35A 2W7NA 1DQUA 3MKYB 4Y4RA 4XQFA 1WJDA 1YE9A 3VYRB 2AQFA 2HZDA 3ONQA 5CQGA 4XKBA 4XOPA 2KQRA 1FMVA 4CCMA 4D1QA 5HLTA 3L2UA 4CCNA 5KNLA 4HNTA 2CUJA 4OWRB 3KYLA 2NOJB 3NWTA 3HOSA 2IS6A 3EPZA 1YX5A 3HKZA 1D1AA 2I8DA 3OYLA 3H9JA 1GLNA 3HPHA 2HPMA 4OAYA 3PNYA 3F9KA 2V26A 4XLHA 3OMYA 2IS1A 2W4SA 3ZXSA 1G8XA 3RTRA 4RLQA 2ZSIB 3VYUB 2L9SA 4PFOA 2JSPA 5HNFA 1V5GA 1WJBA 2DT6A 1X1BA 2LBFA 2WB1A 2MYSA 3PFYA 2OC6A 2VIXA 4QPOA 2R7WA 4RM2A 2R7UA 1IRXA 1OR7C 4BE2A 1MMDA 1BR2A 4BEHB 2WADA 2L9NA 4BL0B 2KZVA 1V5EA 3MMYB 3OOUA 3ZCOA 3PNTA 3BCBA 1FMWA 3BG7A 3VYSB 3S3OA 4E7LA 2WY8Q 4CA0A 1SAUA 4ZDLA 2VB6A 1MMNA 2K9LA 2RREA 1D0YA 3CP2A 4C2TA 3HPGA 3W2VA 4CSWA 1WJ5A 1X4OA 3LL7A 2OV7A 5FROA 3A1YA 3OYHA 4CCLA 3CZ6A 3L2VA 3IAM2 3AL0C 4F92B 3PUBA 2A6TA 3QYBA 2CH0A 4HG2A 4E7ZA 4HPQA 2VXDA 3RCOA 4Y33A 4G6TB 1WJAA 3OR1C 4H4KC 1PJRA 3DQVC 3DLAA 4XOTA 2LBFB 4BJTA 2E60A 3ZQQA 4IKFA 3LMMA 4CCKA 3EUHC 3MD2A 3ZR8X 4EATA 1SFKA 1LVKA 2F6CA 2LRDA 2L5QA 4XMYA 3OYCA 2PJRA 2MFZA 1YX3A 4XR6A 2XF6A 3S3MA 2W00A 3PL8A 1TT0A 3DEEA 4AYBA 4XLEA 4PK4A 2CW7A 1Y56A 1Z3YA 5JHFA 2JVGA 5KHDA 2VASA 2IS4A 4PJLA 1OLTA 2R7VA 2LREA 1R6RA 4BACA 3GBGA 4KJZA 4ZTFA 3S3NA 4BXFA 1BOBA 5HOOA 2VXZA 2BVMA 4ZYAA 2DCEA 2KDOA 3NWSA 3S32A 3PJRA 3K4LA 4XN0A 3OYDA 3UR3C 2X6WA 1V5FA 2JA2A 3K4MA 2KPMA 2WAQA 2L7KA 3VWBA 4IQ4A 4RLFA 4XKVA 1LKXA 2UV1A 4BE0A 3W2AA 4HSRA 4X0GA 1DP3A 2RQQA 2PJRB 3I3LA 2BW3B 2K5CA 5LD2C 3OYEA 4XN3A 3BCAA 3CMMA 4II3A 2OUMA 2VKHA 2HVSA 1D0XA 1Z3XA 2KP6A 1Z7LA 2E1MC 3LSKA 4QPQA 3CESA 3OR2C 4F91B 1WJEA 2VLAA 4XKWA 2MD0A 3DU6A 1PYVA 5FRNA 2QKLB 2CW8A 4J00A 3OL4A 2XF7A 3DTKA 4RMNA 4E7HA 1D0ZA 3OIQA 3FBNB 3SYTA 4ZDOA 4BJ5C 3SDBA 3DU5A 2Z1DA 3K10A 1X4PA 4II2A 4DIQA 3N05A 1N78A 3D5SC 4XNFA 3HL2A 2Z2SB 2Z16A 4XLFA 1P9QC 3L2QA 1TZLA 3KEYA 2CUZA 3PNVA 1JI8A 4BE1A 4DBRA 2E5NA 3V42A 2RNGA 4IZZA 3MKZA 4P1WA 2X85A 3IUOA 3DPTA 2QKMB 2K9MA 3PSIA 2CFOA 3FHNA 4LITA 3H0DA 3OYAA 2CMPA 4ZTJA 1WFXA 3HG9A 3A2KA 3M1CA 3DPLC 3TL4X 2M0MA 1G59A 2X1EA 3W3CA 3HOTA 2VQLA 3H5NA 3OYGA 2WA0A 3BG6A 1VZ0A 2Y0SA 4B43A 4CUGA 4J01A 3AFHA 3TMOA 3U21A 2F5VA 2BOLA 3DTEA 4ZC3A 3RPUD 4R79A 3M8JA 3AKZA 1KONA 4ITVA 2R7QA 2X6XA 3FBIB 2ELJA 3FKJA 3QOEA 2LYCA 4FETA 4F3QA 2JUGA 1J09A 4C30A 4CCJA 2E5ZA 3RSNA 4PFPA 3I9V2 3DPUA 3CP8A 2XF5A 5HVQC 2KRCA 3HC7A 1ERDA 1N75A 3HUGB 4F55A 3VSKA 4AU7A 2ZFUA 4N4NB 4MLOA 4KISA 3KX2A 1T95A 1MMAA 3OS1A 3DKYA 2F4IA 3ZGKA 4YRVA 3OWTA 3LSMA 2LH9A 3L2RA 4C9YA 2VQHA 1MW7A 4XONA 3OS0A 2CV0A 2PMZA 1S9HA 1QHGA 1E0EA 4E7KA 4U87A 4CH7A 4NUBA 5TGTA 1NG7A 3J7AY 1X1AA 3K4JA 3A4CA 4XLAA 4YEJA 2DOAA 1WJCA 4B3XA 1N77A 2LG4A 3RQ4A 3PSFA 3DTIA 2VQCA 3QYEA 5KCMA 4XKCA 2VJJA 4ANJA 2W1OA 2UUZA 4HSTA 3OS2A 1UELB 2FUG2 4PJMA 3W2WA 5LFAA 2DJIA 2VPLA 2P0WA 2X1DA 4E7JA 3K4CA 2HDWA 4E6KG 3OYFA 1ZELA 1DGWY 2VL8A 1DGRM 4CZCA 2M7BA 3D5RC 4XL9A 4E7SA 3L2WA 2M3AA 3DKXA 4B47A 4NC8A 2KHMA 2CV2A 1AA7A 2HVQA 4XM3A 5CPRB 4CCOA 3QODA 2HU9A 3K4NA 4KT6A 3H5AA 2E1MB 2HNHA 3VSLA 3K70D 2W82A 4DJAA 4BEHA 2M7AA 4C2UA 2V9KA 1Z21A 4BU2A 3LFUA 3S93A 4F93B 2ZSHB 2Q2EB 2VKDA 2XC7A 2IS2A 4YELA 2V6EA 1W36D 3OYNA 3VDXA 3EUAA 4ZDPA 1WJFA 1QHHD 4E4HA 2WY7Q 4LIVA 4BQOA 3CJRB 2A5WA 2LY2A 1HA8A 4B48A 5CKTA 2KL4A 2CV1A 4BQQA 1BR1A 3E0JB 2MABA 2HVRA 2GOMA 1BR4A 1QU3A 4BDYA 4BDZA 2WBMA 3LSGA 4OAZA 4XLCA 3UNGC 5CQEA 1EA3A 1D1CA 3OY9A 3D5LA 3OYKA 2VJ4A 2R7SA 2KLOA 2R7OA 3HXLA 1UG0A 4IX7A 2V4JC 3C2GA 4HNUA 4PSXA 1NG6A 4IQJA 1D1BA 4DOZA 4LIUA 3AL0B 3BLYA 3DWLE 2CS3A 2HQAA 2M4KA 4D9JA 3OYMA 4XORA 2R7TA 4HEA2 4BGDA 3C2HA 5FRMA 2LY1A 4E7IA 2DXIA 2ZXIA 4BQNA 2IGOA 3MKWB 3LSHA 3E1SA 3H5RA 4NNJA 5HNHA 3S8PA 4NC7A 3FDYA 4F52A 4DGWB 1X1CA 1MMGA 2VJIA 2VJ5A 1MNEA 1K6YA 3BC8A 3LSIA 3SZGA 4GRIA 2XAUA 3EUKL 2BVLA 3IP4B 3OL3A 2WAEA 2IGNA 2KMUA 3VYTB 3IAS2 4DBQA 2V1NA 4BUPA 4ZJZA 2ZXHA 4JOMA 3H9GA 2R4GA 3G2BA 2BW3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X4P A;  1X4O A;  2DT7 B;  2DT6 A;  4DGW B;  1UG0 A;  2E60 A;  2E5Z A; 
#chains in the Genus database with same CATH topology
 2ZKZ A;  2VQG A;  3OYI A;  3LSR A;  3OIP A;  2X6Y A;  4U88 A;  1O4X A;  2Q8K A;  2AQE A;  1YW9 A;  3IH4 A;  2OD5 A;  1ZLK A;  1WQ2 A;  2IGK A;  2JVH A;  3I64 A;  4I7H A;  3L7W A;  2IGM A;  3H9Q A;  3SEQ A;  3K70 C;  1ZHF A;  1WPK A;  4FAS D;  3L1P A;  4A3E J;  3K6G A;  2COB A;  1LFP A;  2K3P A;  2HOT A;  4HF0 A;  2L2O A;  4MEX F;  2HPI A;  3J7A O;  4BJ6 C;  4RAF A;  2PMH A;  1Y6I A;  3BOQ A;  2UWM A;  1IDZ A;  3H1C A;  2V6C A;  2MC4 A;  1X3Z B;  3RJP A;  1MH3 A;  4I01 A;  1TQI A;  2LKS A;  2VN2 A;  4PUS A;  3ESW B;  1S3J A;  1QPI A;  1JXS A;  1MJB A;  2CJJ A;  4U0W A;  2M2E A;  4N4O B;  2DOE A;  4FX0 A;  4M3B A;  4I98 B;  4CYD A;  3SEZ A;  3BR0 A;  5AIP A;  3H35 A;  2KZG A;  1TBX A;  1FWZ A;  3JAM Z;  4XQF A;  3CME I;  2HKO A;  2AQF A;  3S16 J;  5TRD A;  4XKB A;  3BZC A;  2NNY A;  1LDD A;  3K0L A;  5FLV A;  1IUY A;  2P5L C;  5HLT A;  1WRJ A;  1R7J A;  4M3G A;  1T39 A;  1XMX A;  4OWR B;  4UHT A;  3HOS A;  2ACJ A;  1RR7 A;  1OYW A;  3EPZ A;  3ECH A;  4RBO A;  2EIN H;  1HBX G;  1SVL A;  1YX5 A;  1D1A A;  1ETQ A;  3OYL A;  3H9J A;  3HPH A;  2DDB A;  4OAY A;  1SAN A;  1SD4 A;  1KA8 A;  4OIO F;  2IW5 A;  1K78 B;  2JA6 J;  1BIA A;  4TV7 A;  2ZJP F;  3WTT C;  3CUQ B;  3I5U A;  2H09 A;  2W4S A;  3S2W A;  1I1G A;  3E6M A;  3WGG A;  4M6X A;  4D7N A;  2PJP A;  1YO5 C;  2JSP A;  5C4X J;  2EV0 A;  2IP2 A;  3JRI A;  3P5J A;  5J1Y A;  2LBF A;  4NDL A;  1CQT A;  3FXL A;  1UMQ A;  2QQ9 A;  4BHC A;  2HXI A;  1YIJ I;  1KYZ A;  2KT0 A;  2KIQ A;  2HTJ A;  3HTU A;  3FKI J;  4BE2 A;  1J9I A;  2L0K A;  4BEH B;  4WF2 A;  3B73 A;  5LEJ A;  1S5L C;  3PO3 J;  2VBZ A;  1KYW A;  1FMW A;  1LE8 B;  2DI3 A;  4CA0 A;  1SAU A;  1W7P A;  1IUF A;  1ETX A;  2K9L A;  2DFI A;  2RRE A;  4UUS A;  5E3O A;  1G3S A;  2CGP A;  1Q1V A;  4DQ2 A;  2DLL A;  4A69 C;  4LG0 A;  3F8F A;  2XAG A;  3T0Y A;  2K4J A;  2OV7 A;  1SFU A;  1A36 A;  4XRF A;  2DYR H;  3OYH A;  3LSJ A;  3IRR A;  1JJ6 C;  1I50 J;  3KP2 A;  4M9X A;  1IW7 F;  1HST A;  4KT5 C;  4KUM A;  4HG2 A;  1TP4 A;  3CCR I;  3KYC B;  4G6T B;  4O3M A;  2XPW A;  1ETV A;  1HDD C;  2BZT A;  1FOK A;  1D5V A;  3ZQQ A;  2J5P A;  1ZGA A;  1SFK A;  1LVK A;  1IRG A;  2L5Q A;  2EJR A;  1GXQ A;  1OYY A;  3FMQ A;  1PDN C;  3C3W A;  2RC4 A;  3RKY A;  4QTR A;  1LVA A;  3GEZ A;  4PK4 A;  3RKW A;  2CW7 A;  1ITY A;  2MG4 A;  2UXX A;  3FM5 A;  1Z3Y A;  5EEG A;  1F1Z A;  2XVC A;  2A61 A;  2R7V A;  2OA4 A;  4BAC A;  3GBG A;  3HOY J;  4M3E A;  2HQ5 A;  5F0F A;  4BXF A;  2A3S A;  1J75 A;  3NAR A;  2DCE A;  1A31 A;  1RPW A;  2KDO A;  3MQ0 A;  2O9L A;  4M3D A;  4U0V A;  2MLG A;  1ETK A;  3S32 A;  5BMZ A;  3IH2 A;  2I5U A;  5F0H A;  1LJ9 A;  4M3F A;  3GLL A;  3UR3 C;  3OYD A;  1J0R A;  2MBF A;  1X2N A;  5LGT A;  2DOF A;  2JA2 A;  4BKX A;  4ASN A;  4LK1 F;  3ZMU A;  4XKV A;  1TQM A;  1OCR H;  1UG2 A;  1ZAO A;  2EB7 A;  2UV1 A;  3R0A A;  2DW4 A;  2ELK A;  4HSR A;  3W2A A;  4CZZ A;  1DP3 A;  2RN7 A;  4RDU A;  4A3B J;  2QBY A;  1ZRC A;  2L02 A;  3S1Q J;  3BCA A;  1IXC A;  4II3 A;  2OUM A;  5EZG A;  1Z3X A;  2B63 J;  1SVO A;  1Z7L A;  5E3M A;  5E20 A;  2X6O A;  4YFN F;  2O7O A;  1WJE A;  3MN2 A;  3HOV J;  1B9M A;  3CCS I;  5FRN A;  4Q47 A;  1G2H A;  2IBD A;  5ICF A;  2DK5 A;  2NS8 A;  1BM9 A;  3ULQ B;  3DTK A;  2LBF B;  4A5N A;  4EVI A;  4RMN A;  2E35 A;  1D0Z A;  3ZPL A;  1YW8 A;  2FRH A;  1XD7 A;  1GVJ A;  2RGV A;  4Q5S F;  2J5O A;  1HCR A;  3N05 A;  4ENJ A;  1N78 A;  3HL2 A;  2Z2S B;  2Z16 A;  3H92 A;  3QP6 A;  4EM0 B;  1QGP A;  1WI9 A;  4P55 A;  2CUZ A;  4UVC A;  4HV5 A;  4QIW N;  1LFB A;  3K69 A;  1MH4 A;  1YHQ I;  3GLX A;  3QRF F;  1P7I A;  2OU2 A;  4X1E A;  4IZZ A;  1R5I D;  3R0J A;  2W85 A;  1A04 A;  2QKM B;  3W6K B;  1W0T A;  2HEO A;  3ZP5 A;  4G9Y A;  3OYA A;  2DFF A;  2P8T A;  3DPL C;  2XV4 S;  1R23 A;  2MC3 A;  2EIL H;  3LSP A;  2HYF A;  2Y0S A;  4O5V A;  3U21 A;  2BOL A;  1ENH A;  2JRT A;  5ICG A;  3DTE A;  4ZC3 A;  2WWY A;  3GTQ J;  1I27 A;  3M8J A;  2P6S A;  4Y13 A;  3AKZ A;  2R7Q A;  3BR5 A;  5LBQ A;  4ZYD A;  3DF8 A;  1BBY A;  2QVO A;  3GTK J;  3CD6 I;  2LYC A;  2JUG A;  1ZGJ A;  5IP7 J;  4C30 A;  4CCJ A;  3CC7 I;  4MFD A;  3RSN A;  5CYV A;  4ZYE A;  4U7D A;  2CQ7 A;  2RVC A;  4PFP A;  3I9V 2;  1FOX A;  2AXL A;  2QM3 A;  4LB6 B;  2D1V A;  2Y75 A;  1N75 A;  5LGN A;  2R7D A;  3KX2 A;  1MMA A;  3S2H J;  1ZR2 A;  1S6L A;  4JYK A;  3GYH X;  2DMP A;  3ZGK A;  1K61 A;  4LK0 F;  4C9Y A;  4XON A;  5A2Q Z;  2PMZ A;  3FXO A;  3I71 A;  4YII A;  3NAU A;  1WH7 A;  1QHG A;  2ESN A;  4XLP F;  1E0E A;  4DZP A;  2R7F A;  2FBI A;  5HLI A;  2QQA A;  1VQN I;  2FOW A;  3I4M J;  5IY5 H;  4A12 A;  1X1A A;  1ONV A;  4XLA A;  3KZI C;  4A0X A;  1N77 A;  1QPM A;  1W5T A;  2FX0 A;  4M73 A;  3WTX C;  2B7E A;  2JA5 J;  1ETO A;  3HBL A;  2VKE A;  1MSE C;  2Q0O A;  3QYE A;  5ILS A;  2E7X A;  2HOE A;  2VJJ A;  3VOD A;  5DD8 A;  2FUG 2;  1TTY A;  3CMA I;  1SFX A;  2Q2E A;  3F22 A;  2OJE D;  2DJI A;  5B1B H;  3K4C A;  2HDW A;  4AUX A;  3DV8 A;  3ZN1 A;  2CQQ A;  4CZC A;  1RIO H;  2H94 A;  4E7S A;  4ZYG A;  1MDM A;  2D2W A;  1HKS A;  2F5E A;  1D8K A;  3E97 A;  3CLQ A;  2CU7 A;  4IHS A;  1RES A;  2M3A A;  3CCQ I;  1JT6 A;  4B47 A;  3IL2 A;  4YIR X;  1SD7 A;  3ZQI A;  1OCC H;  2CV2 A;  1GHC A;  4KT6 A;  4ZZL A;  2EQR A;  3BG9 A;  2JN6 A;  2LF8 A;  2YU3 A;  1FT9 A;  2XPU A;  3K70 D;  3F6O A;  2W82 A;  2M5W A;  3G1L A;  4AM3 A;  2VOD A;  2JZY A;  1ZG3 A;  3NQO A;  3CLO A;  1FYL A;  1LFU P;  4C2U A;  2Y9Y A;  3BTI A;  1K7A A;  2O6G E;  3E6B A;  3X2Q H;  1Z67 A;  5F64 A;  2DOD A;  4YEL A;  4G7H F;  3KYD B;  2JPB A;  3LQR A;  3RYP A;  2EZK A;  2ME0 A;  1E17 A;  5C4J J;  2FMY A;  4EJU A;  3CC2 I;  4LD5 A;  3PM1 A;  1P6R A;  3CF5 F;  2EV6 A;  3DCF A;  1L0O C;  1TLH B;  3HJE A;  2A5W A;  3BPX A;  1HA8 A;  2MA3 A;  2VUM J;  3ZQC A;  2DPU A;  1TWF J;  2KL4 A;  2DU9 A;  5DCM A;  2OCE A;  1HW5 A;  2WBM A;  4BDZ A;  3ERE D;  3TOB A;  4YFX F;  5CQE A;  2IVM A;  3SHF A;  1D1C A;  1Y1W J;  1BOA A;  2ESH A;  3OY9 A;  3S1R J;  1P92 A;  4IXA A;  1VF9 A;  4W97 A;  2HQR A;  5LHG A;  4I6Z A;  5DEQ A;  1TW2 A;  2DA3 A;  2W24 A;  2QQB A;  3S1M J;  2KRF A;  3C7J A;  3L2C A;  1QRY A;  2QSG X;  1FIA A;  4HNU A;  3CCV I;  4PSX A;  1NG6 A;  2LP0 A;  2P5V A;  3N4M A;  2WB1 N;  2L4A A;  3I4P A;  3TW7 A;  3QPH A;  1K83 J;  1A35 A;  2CS3 A;  2M4K A;  3OYM A;  3ASN H;  4XOR A;  2R93 J;  4HEA 2;  4BGD A;  1O3R A;  3I55 I;  4RGU A;  4D5C A;  3IHU A;  2E19 A;  3C2H A;  5FRM A;  2LY1 A;  4HV6 A;  1IAW A;  2DXI A;  3F3X A;  4ZZD A;  2GQQ A;  4OIR F;  4B09 A;  1YIO A;  5ERI A;  3S8P A;  4NC7 A;  3FDY A;  1X1C A;  2VJI A;  1FX7 A;  3F0C A;  1R36 A;  5L3G A;  1KQ0 A;  3SZG A;  1WWX A;  2I10 A;  3KIO A;  1OFC X;  3ZMV A;  1XGS A;  1ZLJ A;  3VYT B;  2M0C A;  3HSR A;  1SD6 A;  1E2X A;  1U8B A;  2R3S A;  3IKT A;  5EEH A;  3FXM A;  2R4G A;  3G2B A;  4WWC A;  4B44 A;  1K6O A;  3EYI A;  4V2G A;  4P5O A;  2A05 A;  2NXN B;  3LAJ A;  1R22 A;  1U0J A;  2WAF A;  4HZF A;  2DT5 A;  1WSU A;  4KIT B;  1KU3 A;  3KET A;  3SFZ A;  1X1D A;  4NQW B;  1JJ8 C;  1YRN B;  1FP2 A;  5HLH A;  1ZRE A;  2YX4 A;  3FXJ A;  5E3N A;  2LOO A;  1UB9 A;  2GOX B;  2F48 A;  2R7R A;  2ELH A;  1HQC A;  4AC0 A;  4A3K J;  4LG3 A;  4A3D J;  1R4N B;  4G8X A;  1LDK B;  2MSY A;  2B0L A;  1Y0N A;  1MBK A;  4HBL A;  1QO0 D;  2PMZ N;  2IXS A;  4HX7 A;  3OYB A;  5EG0 A;  3OSF A;  2HI3 A;  4XSZ F;  1ULY A;  2GLO A;  4PJJ A;  2X1C A;  4QSH A;  2IRF G;  1FEX A;  1V55 H;  4I0A A;  4RGX A;  2DAO A;  5FFZ A;  1X19 A;  5C44 J;  3JW4 A;  1QA6 A;  3ASO H;  2GIZ A;  3VB2 A;  1PUF A;  4PSW A;  3GFM A;  4KIB A;  2R5Y A;  3MKY B;  1QQI A;  1YE9 A;  3NRV A;  4FX4 A;  1R4M B;  3ONQ A;  5CQG A;  2XSD C;  5GAE J;  4XOP A;  3K1N A;  2ZNY A;  1GXP A;  2O8K A;  5F6F A;  4IRG A;  4CCN A;  2XGE A;  5JLW A;  5KNL A;  3TO9 A;  3H0G J;  2DMQ A;  4HNV A;  2IS6 A;  1ACI A;  2E2J J;  4UUV A;  4G7Z F;  3HKZ A;  2EIK H;  2I8D A;  1VQM I;  5HLG A;  4UVB A;  3BTL A;  4YIF A;  3GTM J;  2E7W A;  2UZK A;  4CYC B;  3PNY A;  4IOA F;  2Y0M A;  3F9K A;  4S05 A;  1IV6 A;  4XLH A;  3R60 A;  3BTJ A;  1Z9C A;  4AIK A;  1AKH B;  3ZXS A;  3RTR A;  4RLQ A;  4FTH A;  3CCY A;  1C0W A;  1TWC J;  2L9S A;  2JRM A;  2FD5 A;  2VC1 A;  5M5W J;  3L9F A;  1R00 A;  1OQY A;  4MTE A;  1V5G A;  1X1B A;  1IXR C;  1MBH A;  3F8B A;  2MYS A;  1VQ5 I;  5D5V B;  4IHV A;  5J8C A;  1V4R A;  2VIX A;  3ISP A;  3DBR B;  4QPO A;  2FNA A;  5B1A H;  3LA3 A;  1JGS A;  3WE2 A;  1T56 A;  2WAD A;  2L9N A;  2DFH A;  2KZV A;  3V7S A;  4BL0 B;  1UHW A;  4EM1 A;  2O3F A;  2BGC A;  3MMY B;  3OOU A;  4HW0 A;  3I54 A;  4DW6 A;  5JHU A;  4KFC A;  4I99 C;  2X4H A;  3PNT A;  1R5H A;  3S3O A;  5J3L A;  1BI0 A;  3VEP A;  3F23 A;  3WTU C;  4Q48 A;  1Y8R B;  3JCU C;  2X9D A;  3WGH A;  4XK4 A;  1U8R A;  3O3K A;  1U3E M;  2BV6 A;  1NTC A;  3Q9V A;  3HPG A;  1ON1 A;  1X3U A;  1QZE A;  3JTH A;  5IP9 J;  2W84 A;  5CVJ A;  3DLL F;  4O6J A;  3I59 A;  5GTI C;  3E5X A;  4WXD A;  4XRS G;  3A1Y A;  3J7Z I;  3HEF A;  2K9Q A;  1MZB A;  3L2V A;  3IAM 2;  2NRA C;  4F92 B;  2A6T A;  4UNO A;  1UCR A;  1P4A A;  4W1U A;  2XAQ A;  1D8J A;  3WTW C;  3RCO A;  1ZKG A;  1WCM J;  2F2E A;  3OR1 C;  1PJR A;  3DQV C;  3DLA A;  4JX6 A;  3MWM A;  1WGX A;  2BY1 A;  4XOT A;  5ED4 A;  4HA8 A;  3Q0V A;  4IKF A;  1ZH5 A;  1HW1 A;  3W6J B;  3A01 A;  3CCJ I;  1WH5 A;  1B4A A;  3JSP A;  2ID3 A;  3OYC A;  5BNG A;  4LOC A;  1YIT I;  2XF6 A;  2W00 A;  5E1W A;  3PL8 A;  4AYB A;  4HDU A;  4UXN A;  3M9A A;  2P6T A;  1Y56 A;  1CGP A;  2JVG A;  3IWZ A;  2IS4 A;  4LG0 B;  1IV8 A;  2YPR A;  3WTZ A;  4ZTF A;  2PI0 A;  2JUC A;  3G1M A;  5HOO A;  4N9I A;  2H1L A;  4ZYA A;  3K7A J;  3J80 Z;  1Y39 A;  2VT2 A;  2ZJ2 A;  3I58 A;  2O8X A;  1RZ4 A;  3PJR A;  5JR3 A;  1U5T B;  1PP8 F;  5IT9 K;  2X6W A;  4IRI A;  3S15 J;  3L00 A;  2WAQ A;  5EJC A;  3G4S I;  3EDP A;  2TDX A;  2NYX A;  1AHD P;  4BE0 A;  5J1U A;  4AWX B;  2LKX A;  2H1K A;  4MFE A;  3HRT A;  2RQQ A;  1G6N A;  4HQE A;  3GZ6 A;  3BG5 A;  3I3L A;  2K5C A;  1SC7 A;  4XN3 A;  2XRN A;  4DYQ A;  2VI6 A;  2HVS A;  2EFW A;  2KP6 A;  1E3P A;  3LSK A;  3ABK H;  3OR2 C;  1TWG J;  2Y30 A;  2VLA A;  4XKW A;  2MD0 A;  3ML6 A;  1PYV A;  5B5E C;  3B6C A;  5DV5 A;  4A2U A;  2QKL B;  4A6E A;  1DPR A;  2FBH A;  4K2E A;  5EGO A;  1HF0 A;  2OCC H;  4OIP F;  2BXZ A;  1Z7U A;  4E7H A;  3SYT A;  5GP9 A;  3KP5 A;  5K7H A;  2ETH A;  3FIW A;  2EZH A;  3WGI A;  3CO6 C;  3HSE A;  1YS7 A;  3ZN0 A;  1G3W A;  2GBY A;  3CCE I;  2DMN A;  1MMS A;  1TZL A;  2CFX A;  3PNV A;  1JI8 A;  3FWE A;  1YI2 I;  1VQ4 I;  2E5N A;  3V42 A;  5K7Z A;  3CMY A;  5FO5 A;  5BOX A;  3MKZ A;  2QBY B;  2X85 A;  2K85 A;  4OIQ F;  3PSI A;  3FHN A;  4IVN A;  1RRJ A;  3EUH A;  2HGC A;  3KP4 A;  1LPQ A;  1WFX A;  4P9F A;  3A2K A;  3BR6 A;  2Z99 A;  1U9O A;  3W3C A;  3LST A;  3Q0U A;  1OJL A;  1EH8 A;  3HKZ N;  4PZJ A;  3QAH A;  1VTN C;  1KU9 A;  5FLM J;  3ZMZ A;  2WA0 A;  5IT3 A;  4B43 A;  9ANT A;  3RQI A;  1T8I A;  3BR1 A;  1G4D A;  4HYE A;  3HOZ J;  4ITV A;  2X6X A;  3W6V A;  4A0Z A;  1ZTR A;  5GAG J;  3V7R A;  2K7L A;  2W25 A;  4EQQ A;  1LEA A;  3RKQ A;  4GFB A;  4Y15 A;  4FET A;  4IOC F;  4F3Q A;  3ZOB A;  3WTS C;  1J09 A;  1UST A;  1J5Y A;  2ZME B;  4EM2 A;  1QZZ A;  3F8N A;  2E2I J;  1IRF A;  4IHT A;  3AG4 H;  4R1H A;  3GVA A;  3QOP A;  5CVI A;  1WKM A;  2JT1 A;  1VQ8 I;  5LGU A;  3HDD A;  2YX7 A;  3VSK A;  3TDU C;  2W48 A;  2ZFU A;  4N4N B;  1MSF C;  2ISY A;  3KZZ A;  1B72 B;  3DEW A;  1B1B A;  5JI6 A;  2DPD A;  3LSM A;  4C3J J;  1V54 H;  3PUF A;  1IZ1 A;  1SMY F;  5FD6 A;  1W1W E;  3OS0 A;  1FYK A;  1TW3 A;  4UB8 C;  3KFW X;  3P9K A;  3FHZ A;  1P2F A;  1MBF A;  3JRC A;  2KFD A;  4FHT A;  5D4S A;  4U87 A;  4E7K A;  1WHU A;  4CH7 A;  1FIP A;  3F6V A;  4A3M J;  2EA4 A;  2QWW A;  4WXC A;  4NUB A;  2FOK A;  1Z0X A;  2DDA A;  4N0B A;  3J7A Y;  1YOV B;  3ABU A;  4P9U A;  2Z3Y A;  3J7Y J;  1OIS A;  1WJC A;  5HS7 A;  3JAM K;  3N97 A;  3IV5 A;  3KEQ A;  1FOW A;  1YJ9 I;  1GT0 C;  4UB6 C;  3LA2 A;  3PSF A;  2GXG A;  2XRL A;  3VOE A;  2STW A;  3F8M A;  2EH3 A;  2VQC A;  2YU9 J;  3FZV A;  3GFJ A;  4FE7 A;  4HST A;  2VBY A;  2OAZ A;  5CLS A;  2OQR A;  4PGG A;  2QUF A;  1B59 A;  1JKP C;  2JWT A;  2VPL A;  4M74 A;  2XAJ A;  4M72 A;  4E7J A;  1SFO J;  1R1U A;  3WHC A;  3HM5 A;  1ZEL A;  3BG3 A;  3C2B A;  1K78 A;  2LKP A;  1DGR M;  4XL9 A;  2DA2 A;  1EJ9 A;  1E3H A;  3P7N A;  5DM7 F;  4AYB N;  5BS6 A;  1XGN A;  4NC8 A;  5KVR A;  3K2Z A;  1AA7 A;  2HVQ A;  2ISZ A;  3QOD A;  1ETW A;  3TOA A;  2QEN A;  3FX3 A;  1TC3 C;  1S7O A;  2QYO A;  4BYY A;  2G7H A;  2RQP A;  2L7Z A;  3QP5 A;  1BJA A;  3GFL A;  2TRT A;  4DJA A;  4BEH A;  2FA5 A;  2K27 A;  2Z33 A;  1IGN A;  1USS A;  3JRD A;  2L4M A;  2PX9 A;  5F27 A;  4BU2 A;  1RR8 C;  1FTT A;  1VI0 A;  2HDD A;  4I76 A;  1LE8 A;  4B3A A;  3E3V A;  2A07 F;  2Q2E B;  5LEK A;  4IO9 F;  2XC7 A;  2GA2 A;  3HRU A;  2IS2 A;  1H9G A;  2WAQ N;  2V6E A;  5GPC A;  2FXA A;  4M9S A;  3VDX A;  3CCL I;  1JTY A;  1VND A;  1YW7 A;  1MDM B;  2DTZ A;  4GO1 A;  5D6F A;  3WE3 A;  3F21 A;  5HDG A;  3H36 A;  2LY2 A;  3BZK A;  1LNW A;  3ECO A;  2DYS H;  4BQQ A;  5ICE A;  1BR1 A;  3KP3 A;  4M9Z A;  5CVU A;  2BHZ A;  2MAB A;  3GZN B;  2GOM A;  4HAM A;  5KAI C;  3SXY A;  2HVR A;  2KJC A;  5F1J A;  4A6D A;  3I0T A;  3KPH A;  3UNG C;  1EA3 A;  5K5O A;  2E1O A;  1S8N A;  2FEZ A;  3CC4 I;  2KLO A;  2R7S A;  2HOA A;  2XUB A;  2DA1 A;  2R92 J;  5EEA A;  4PJ0 C;  1B6A A;  1ZRF A;  1W5C C;  3C2G A;  2AXT C;  3BR2 A;  3KP6 A;  2V1U A;  1D1B A;  1JHF A;  1VQP I;  2A68 F;  4D9J A;  2P5K A;  3GTJ J;  5E79 C;  2OTL I;  3RZO J;  3QWL A;  5HS9 A;  4XID A;  2OBP A;  4CGZ A;  3M1E A;  4FCY A;  4PDK A;  3V8K A;  3BT9 A;  3E5Q A;  3LWF A;  3DXJ F;  4MO7 A;  5DUK A;  4EEF G;  1WVR A;  3H5R A;  2KIF A;  2ZNZ A;  5K7F A;  4NNJ A;  1B9N A;  5HNH A;  1W0U A;  4F52 A;  3BJO A;  1FBS A;  5B66 C;  5BPD A;  1RUO A;  2D1H A;  1MNE A;  2VC0 A;  1JE8 A;  5DCM B;  1K4T A;  3O8G A;  3C18 A;  3BC8 A;  3LSI A;  1DU6 A;  1Z1D A;  4BH9 A;  2XAU A;  3EUK L;  3OIO A;  5IOY A;  4L9J A;  4DBQ A;  2V1N A;  4ZJZ A;  3TO6 A;  4XRS A;  4MQ9 F;  1XSX A;  3LFK A;  3H9G A;  4A3L J;  2DFE A;  3ZRG A;  2V1D A;  4JQF A;  4RM3 A;  1HDP A;  4X6A J;  5AON A;  3D0S A;  3RKX A;  1UAA A;  1FBU A;  5FKL A;  4B8X A;  1B8I B;  2XSJ C;  6PAX A;  3LNQ A;  1IN8 A;  4U7B A;  1MND A;  4BS9 A;  4D5F A;  5DUI A;  2DT7 B;  2DBB A;  3PIP F;  2FJ1 A;  2M4G A;  5L3B A;  3CJN A;  3K4B A;  5FB2 A;  2R7X A;  1BN5 A;  4UUT A;  1MKM A;  2FNP A;  2V7F A;  3ZQH A;  4F7Z A;  2HOS A;  1XSD A;  4WXH A;  4PJN A;  2CUE A;  4KYW A;  2WC2 A;  2JTV A;  2XGD A;  3QYF A;  4EJO A;  3QQA A;  2COM A;  5DCF A;  1W36 C;  2ZC2 A;  2K9N A;  1R71 A;  1H0M A;  5FFX A;  2KRH A;  2B9S A;  1VQO I;  3HTS B;  1MBJ A;  5H6Q A;  2X51 A;  1FP1 D;  4ENK A;  1BA5 A;  2ZJQ F;  1DQU A;  1D5Y A;  3VYR B;  1RET A;  4ESF A;  1FSE A;  2MW8 A;  2R5Z A;  1FMV A;  4CCM A;  4D1Q A;  3AAF A;  2JPC A;  3T1B A;  3L2U A;  3WG9 A;  1ZQ3 P;  4IPA A;  1XB4 A;  2CUJ A;  3KYL A;  3NWT A;  2ZB9 A;  3ABM H;  4L0Y B;  3J81 Z;  3HIF A;  4GDF A;  1HKT A;  2HPM A;  5CJ9 A;  2GIV A;  2CQN A;  1O57 A;  1APL C;  3OMY A;  3HZJ A;  2IS1 A;  2WV1 A;  4A0Y A;  1SMT A;  3KCC A;  2ZFW A;  2ZSI B;  3VYU B;  1XS9 A;  2K9S A;  1R5G A;  1XTA A;  2KIM A;  5HNF A;  2GM4 A;  3FK7 A;  2LLK A;  3K9T A;  4L18 B;  2MH2 A;  2HQN A;  3PFY A;  3FK6 A;  3S2D J;  1HSJ A;  1PUF B;  2L01 A;  2R7W A;  2R7U A;  4JK1 X;  2FU4 A;  3E7L A;  1XCB A;  1ODD A;  2F5D A;  1IJW C;  1MMD A;  1BR2 A;  1R58 A;  3C1D A;  4KMU X;  1MBE A;  5F1R A;  2PMU A;  3SDG A;  3HOX J;  4OU0 A;  2YUS A;  3ZCO A;  2STT A;  3RIR A;  1OPC A;  5A2Q K;  3BCB A;  3BG7 A;  4E7L A;  2WY8 Q;  4MIM A;  2VB6 A;  2NVY J;  3H3V K;  5D5X B;  1D0Y A;  2DK8 A;  4HX4 A;  4LJZ F;  3RYR A;  3RPQ A;  4MNU A;  1X4O A;  3LL7 A;  3SFI A;  5FLX Z;  1G3Y A;  3ERM A;  2OF7 A;  5FRO A;  2P7V B;  4CCL A;  3M07 A;  3MKL A;  3AL0 C;  4ABZ A;  2KIU A;  3QYB A;  5M3F J;  4BY1 J;  2VXD A;  2XGC A;  4Y33 A;  1A5J A;  3K2A A;  1WJA A;  4YG2 F;  1G3T A;  4H4K C;  3Q9S A;  3BQZ A;  2E60 A;  1PUE E;  2K02 A;  2Y0S N;  2M9H A;  2BYV E;  3EUH C;  3JRE A;  2BY3 A;  3MD2 A;  4JBA A;  3ZR8 X;  4LB5 A;  1T0F A;  2F6C A;  3EET A;  5E8I A;  2LRD A;  4XMY A;  2C6Y A;  2H8W A;  2PJR A;  4C2M J;  1JUS A;  5J4V A;  1YX3 A;  4XR6 A;  3CJT B;  4L5E A;  3REO A;  5DS9 A;  3S3M A;  1BL0 A;  5LLQ A;  3TQN A;  2VOO A;  2X0L A;  1TT0 A;  3DEE A;  3BJ6 A;  3MZ8 A;  3DFG A;  5KHD A;  1R49 A;  2GZW A;  4ZH4 F;  2VAS A;  1Q1H A;  1OLT A;  4PJL A;  2LRE A;  1R6R A;  3TW6 A;  3A03 A;  2N8G A;  1XCV A;  1IF1 A;  3IKV A;  3BR3 A;  2LMD A;  2M8G X;  3I59 B;  4KJZ A;  1A6I A;  1FYM A;  1BOB A;  2LSO A;  3GWZ A;  5FKM A;  4S04 A;  4A3J J;  1AU7 A;  2M1B A;  3JR9 A;  4IHW A;  3VFZ A;  2Z9O A;  1WI3 A;  3K1P A;  4OMY A;  2G0E A;  2KJB A;  4B4C A;  4A93 J;  2CG4 A;  4FQG A;  4XN0 A;  1CF7 B;  5D5W B;  1VFC A;  1PVE A;  2HDC A;  4RB0 A;  1V5F A;  4EGY A;  1W5S A;  2LY9 A;  5M5X J;  4L9T A;  1HXD A;  1I6H J;  3M4O J;  2HKX A;  4IQ4 A;  3A0B C;  4RLF A;  1XC5 A;  2JMW A;  3PQK A;  1W4M A;  4BXX J;  4HDV A;  3RDI A;  2H8R A;  2IJL A;  2BEO A;  2BW3 B;  1PP7 U;  4L0Z B;  4L5J A;  5GAH J;  2D5V A;  4AIH A;  2YS9 A;  2W57 A;  3CMM A;  2HR3 A;  3KEO A;  1D0X A;  2QSF X;  5K5R A;  1OR7 A;  4QPQ A;  4F91 B;  2XAH A;  4ESJ A;  4FE4 A;  3O6B B;  2Y2Z A;  4EGZ A;  1QVT A;  1HW2 A;  1I3A A;  3OL4 A;  2EWN A;  4M71 A;  1EH7 A;  3IC7 A;  1WZ2 A;  3E5U A;  1D3Y A;  3UKG A;  1LUJ B;  1UJ8 A;  3QPS A;  2NVU B;  5IPA A;  3IRQ A;  4BJ5 C;  5HDN A;  3DU5 A;  2Z1D A;  2AS5 F;  5H6R A;  5GPA A;  1ZG1 A;  1GVD A;  3ABL H;  4DIQ A;  1FY7 A;  4ENM A;  4XNF A;  2EFO A;  4BXU A;  3HGY A;  5TIS C;  4XLF A;  3L2Q A;  4AD9 A;  4RB3 C;  3SZP A;  1FTZ A;  3TDZ C;  2K4B A;  3HUG A;  3S1N J;  4G6D A;  4BE1 A;  4GGG A;  4XSX F;  3FMR A;  5FKK A;  2R0Q C;  2QZ8 A;  3LOC A;  1SEU A;  2MLK A;  5IYD J;  2RNG A;  3WU0 A;  1HOM A;  1UZC A;  1T2K A;  4UVA A;  3DPT A;  3M8F A;  4CHU A;  4GCV A;  4ETS A;  5LRS A;  1FSH A;  5L3C A;  2EIJ H;  4RB1 A;  4S0H B;  5JVT A;  3V8L A;  1RKT A;  2ADU A;  3TL4 X;  2M0M A;  3KLN A;  1G59 A;  2X1E A;  2M87 A;  4G12 A;  1YJW I;  1VZ0 A;  4CUG A;  5FKN A;  1R9T J;  3BTC A;  5CVR A;  2ZXW H;  5EGO B;  5J47 A;  2JJ7 A;  3LAP A;  4R79 A;  3RPU D;  3WU2 C;  2PN6 A;  2FQ3 A;  3U9G A;  1F4K A;  3M3Y J;  2ELJ A;  3FKJ A;  4EJT A;  2CSO A;  1IO2 A;  3CTA A;  1DP7 P;  5HOD A;  4LLG F;  1V3F A;  1EF4 A;  3JTG A;  3FMS A;  5EYR A;  3CP8 A;  3U1K A;  3OSG A;  1NK2 P;  5LRR A;  4NQW A;  2FQ4 A;  5IP6 A;  4F55 A;  2QGU A;  4AU7 A;  1J2X A;  3OS1 A;  2K3F A;  4YRV A;  5EDN A;  5LHI A;  2LH9 A;  2XKP A;  4GYI A;  2VQH A;  4CXF A;  2CV0 A;  1NH3 A;  3BP8 A;  1IN7 A;  1S9H A;  2XKO A;  4A5M A;  3HB9 A;  2LNB A;  1W7P B;  4BBR J;  3R4K A;  3U2R A;  4DNC A;  3ZMT A;  4XRM A;  4C3H J;  1NK3 P;  1XX5 A;  1Y0U A;  2O61 A;  2JA8 J;  4UUS B;  3A02 A;  1I6X A;  5TGT A;  5ICC A;  1NG7 A;  1YJN I;  3LA7 A;  3MZH A;  1KQ9 A;  3A4C A;  4YEJ A;  2DOA A;  4B3X A;  2LG4 A;  1FZP B;  2BBY A;  4KIC A;  3KZY A;  3OOP A;  4M6V A;  3LQQ A;  2LTP A;  3RQ4 A;  4EJW A;  3GFI A;  3DTI A;  3G3Z A;  4KMF A;  2VE9 A;  2OZU A;  1OCZ H;  4Y7N J;  3HHH A;  4ANJ A;  3HRS A;  2UUZ A;  2KDZ A;  1UEL B;  1X3W B;  4PJM A;  3ELK A;  4CIC A;  3BQY A;  1ZN2 A;  5LFA A;  2OZ6 A;  4DZJ A;  2L9R A;  2P0W A;  4HQM A;  5LHH A;  4CYC A;  3OYF A;  2CRG A;  2XB0 X;  3TGN A;  3JRH A;  1VQ9 I;  1DGW Y;  2ECB A;  4IHX A;  2XAS A;  2M7B A;  1JKO C;  2G9W A;  4MTD A;  1AKH A;  3WTY C;  3SZT A;  4GYG A;  4QLC U;  1BI2 A;  1XMK A;  3T5X A;  4HOB A;  3DKX A;  1TQP A;  2FF4 A;  1QBJ A;  1MJ9 A;  2CUF A;  5CPR B;  1IC8 A;  4BY7 J;  4CCO A;  4JX5 A;  2HU9 A;  3K4N A;  4C3I J;  3H5A A;  4PGH A;  2HNH A;  2LDU A;  3G73 A;  3R61 A;  5HDK A;  4WX9 A;  4BBS J;  2M7A A;  2NS7 A;  2QSH X;  1JKR C;  1P4W A;  3A0H C;  1O7L A;  1Z21 A;  3LFU A;  4IF4 A;  3S93 A;  3QPT A;  2ZSH B;  2ID6 A;  2DTR A;  3CO7 C;  2VKD A;  2L54 A;  1R1T A;  1Z6R A;  2DA4 A;  3GF2 A;  3JRF A;  1W36 D;  3OYN A;  5GTH C;  3EUA A;  4V19 K;  1WJF A;  3PQJ A;  4RGR A;  1XG1 A;  1QHH D;  4E4H A;  1IDY A;  1BI1 A;  5IYB J;  5GAD J;  2M45 A;  5DTD A;  4BQO A;  5CKT A;  1H8A C;  2CV1 A;  1YFH A;  3BZ6 A;  4EJV A;  4A3I J;  1BW5 A;  2YR2 A;  2BHY A;  1QU3 A;  2V1X A;  1Z6T A;  4U0Y A;  1DU0 A;  3HOU J;  5F0C A;  2V9P A;  3PO2 J;  4XLC A;  3GTL J;  3HGG A;  3OYK A;  2E1C A;  2HYG D;  2R7O A;  5E17 F;  1OCT C;  4BQA A;  1XDU A;  2UXN A;  2EZI A;  3G6E I;  3E6C C;  4IX7 A;  5E18 F;  2V4J C;  1DUX C;  3KP7 A;  4Y17 A;  2YSR A;  2LR8 A;  4XLN F;  2VOP A;  3V8J A;  4DOZ A;  2JQ7 A;  2O0Y A;  3BLY A;  3DWL E;  4MHG A;  2R7T A;  3CDH A;  3SQN A;  1FNN A;  5M3M J;  2E36 A;  2P81 A;  2Y48 A;  3HRM A;  4N9H A;  3TP0 A;  2K86 A;  2ZXI A;  4AVP A;  1ZYR F;  2DJN A;  3LSH A;  4E70 A;  4RA2 A;  5D8K B;  3E1S A;  3J80 K;  5JLX A;  4HF1 A;  5M5Y J;  2Z5U A;  1YYV A;  1AOY A;  1U5T A;  1K6Y A;  3FXK A;  3FM3 A;  2JSC A;  2IA1 A;  4HLX A;  4BHP A;  1I5Z A;  2BVL A;  3IP4 B;  3OL3 A;  4HX8 A;  3CDL A;  5K5Q A;  5B3S H;  2IGN A;  1YTY A;  1X2M A;  2OPT A;  3IAS 2;  4PCQ A;  4BUP A;  1DDN A;  3OS2 A;  4NC6 A;  3K4K A;  4KN7 X;  4IHY A;  1SAX A;  3M7G A;  2A6E F;  3CJQ B;  3AG2 H;  3TP3 A;  1KU2 A;  4AVZ A;  2LC2 A;  1FBQ A;  3CF2 A;  2M30 A;  2KKO A;  1Y8Q B;  3WU1 B;  2O5R A;  3COA C;  2M34 A;  5K1Y A;  2G7U A;  4OIN F;  3G71 I;  3V4G A;  3CCM I;  3OYJ A;  4ENN A;  1SVM A;  2JK3 A;  4HRI A;  2XDV A;  2P4W A;  1RNL A;  1STZ A;  3CUQ A;  3GTO J;  4RAG A;  2EPF A;  1W7P D;  4Z6Y A;  2K40 A;  1Z91 A;  3TBI A;  5IOZ A;  4Y3O A;  2Q1Z B;  1T0F C;  3ZQF A;  4Z2Y A;  2NOG A;  1REP C;  4M6Y A;  2A69 F;  5BPI A;  4V2F A;  2GXA A;  2DMU A;  4ESB A;  3BPV A;  2CYY A;  2BY2 A;  2W7N A;  1ZR4 A;  4UY8 I;  1GDT A;  4G7O F;  2PEX A;  4Y4R A;  1WJD A;  2EFQ A;  1BIB A;  2HZD A;  5DDG A;  4BNC A;  1HLV A;  2KQR A;  1MJA A;  2X48 A;  1JKQ C;  2TCT A;  3ZMS A;  2VE8 A;  3K1M A;  1LB2 A;  1RUN A;  4HNT A;  4J19 A;  2NOJ B;  2H6B A;  5EZH A;  3TKY A;  4FIS A;  2FE3 A;  1IN6 A;  1GLN A;  1MGT A;  1DPU A;  2A5Y B;  5L3E A;  3HHG A;  2QA4 I;  3I4N J;  1F36 A;  5F04 A;  1O3T A;  2V26 A;  3E6D A;  1VQ6 I;  2Y9Z A;  2M8E A;  2OTJ I;  1OCO H;  1T98 A;  4MGR A;  1G8X A;  2FSW A;  3ZQG A;  4D7M A;  3JSO A;  4I2O A;  4PFO A;  1POG A;  3H3Z A;  2O03 A;  2ZME A;  1KQ8 A;  1WJB A;  2DT6 A;  4G6Q A;  2WB1 A;  3DEU A;  1U9N A;  3DKW A;  1OMI A;  2ME6 A;  2OC6 A;  5BQT A;  2QEX I;  4RM2 A;  3EQL F;  1IRX A;  2GWR A;  1OR7 C;  2BE5 F;  1QNT A;  2LK2 A;  4EMS A;  1B72 A;  4KDP A;  4B1R A;  5ILV A;  2R5Z B;  1V5E A;  2DA5 A;  1HC8 A;  1J7K A;  3PFI A;  2XPV A;  4UV9 A;  2EFP A;  4NBQ A;  3VYS B;  1ZAR A;  4ZDL A;  1A6Q A;  1JT0 A;  1MMN A;  1YLF A;  2IAI A;  1OKR A;  3CP2 A;  4C2T A;  2GA1 A;  5D4R A;  3U1D A;  1IN4 A;  1EH6 A;  1I1S A;  3W2V A;  4CSW A;  1WJ5 A;  3ABT A;  2AHQ A;  1Z77 A;  2ICW G;  3Q3S A;  1Z05 A;  1ORK A;  3O2P E;  2EBI A;  3CZ6 A;  3PUB A;  2LFB A;  3AG1 H;  2CH0 A;  4E7Z A;  4HPQ A;  3NEU A;  2LF7 A;  4RS8 A;  2F5F A;  1M1E B;  4BJT A;  4NB5 A;  3SJM A;  2F4M B;  4Q4Z F;  3LMM A;  4CCK A;  1AWC A;  5KAF C;  4EAT A;  4L9V A;  3GCM A;  4D0P A;  1T38 A;  4WCG A;  1XMA A;  2WV0 A;  1EKE A;  2MFZ A;  1BC8 C;  1XSV A;  3B02 A;  2MD5 A;  3R6S A;  4XLE A;  1U2W A;  3GTP J;  4Y52 J;  2CWE A;  2PQ8 A;  5J6X A;  3RI4 A;  3GW2 A;  2XGX A;  4LMY A;  5J1R A;  2EFN A;  1H89 C;  5JHF A;  5H2F C;  2NAZ A;  4LFU A;  3B6A A;  2XAF A;  5JFR A;  1H88 C;  4HF2 A;  1I39 A;  3S3N A;  4LLN A;  5DD4 A;  3WHB A;  4A3C J;  2CQK A;  2OQG A;  2BVM A;  2VXZ A;  2V79 A;  3DP7 A;  3NWS A;  3PIO F;  4JP0 A;  1VQL I;  2FML A;  2EZL A;  2L7M P;  2MGQ A;  1XGM A;  4I0B A;  3BWG A;  3K4L A;  3QU3 A;  3ZQ7 A;  1K4S A;  5FKO A;  2HZT A;  3K4M A;  5J8F A;  2QF7 A;  2KPM A;  2FBK A;  2L7K A;  3VWB A;  2NNN A;  4KIF A;  3GME A;  2BY0 A;  1YG2 A;  1LKX A;  2V9V A;  2XHK A;  4X0G A;  2PJR B;  4IJA A;  2HYJ A;  5E3L A;  1S72 I;  2DA7 A;  1XN7 A;  2HTS A;  2KIS A;  3F72 A;  3OYE A;  4DYC A;  5LD2 C;  1E3O C;  4WK8 F;  2D45 A;  4LLL A;  3JRA A;  1JHH A;  2VKH A;  3DBL B;  1UHS A;  1LEB A;  2E1M C;  1LQ1 A;  1P4X A;  2VBW A;  3CES A;  2RDP A;  2EIM H;  3QPL A;  3DU6 A;  1T6S A;  2CQX A;  5L3F A;  2LVS A;  2CW8 A;  4J00 A;  5IYC J;  2XF7 A;  5J40 A;  3KE2 A;  1XDS A;  1JUP A;  3G1O A;  3OIQ A;  3FBN B;  3ZQL A;  3GTG J;  4UV8 A;  4A3G J;  4ZDO A;  2RNJ A;  1K79 A;  2VPR A;  4XIC A;  2DA6 A;  3SDB A;  1MD0 A;  5F08 A;  5EG0 B;  2DQL A;  3K10 A;  1X4P A;  3MAJ A;  2HFH A;  1RC9 A;  4II2 A;  3D5S C;  1R1V A;  5D8L B;  1P9Q C;  1TWH J;  1QVU A;  2QQ8 A;  2LD5 A;  1FC3 A;  3P9I A;  1TNS A;  3KEY A;  1BI3 A;  2QCO A;  1XGO A;  4DBR A;  2R5Y B;  4RB2 C;  1GV2 A;  3CUO A;  3BRO A;  1TL8 A;  4P1W A;  3GUD A;  3IUO A;  2L3D A;  4IRH A;  2NVT J;  2K9M A;  3T8R A;  2CFO A;  4LIT A;  3H0D A;  4GXO A;  3AG3 H;  3O8H A;  5H20 A;  4ZTJ A;  2CMP A;  4JX4 A;  2XB5 A;  2NVX J;  3HG9 A;  3M1C A;  2RV8 A;  2MH9 A;  1KZH A;  1J59 A;  1JTX A;  3HOT A;  2VQL A;  2DQR A;  2IPQ X;  3H5N A;  2Y31 A;  2ECC A;  3BG6 A;  3OYG A;  2EK5 A;  3RZD J;  4J01 A;  1F9N A;  4IL6 C;  3AFH A;  3WG7 H;  3TMO A;  2EV5 A;  3D1N I;  2F5V A;  5CVV A;  2PG4 A;  2E34 A;  1KON A;  4IEJ A;  3IH3 A;  3FBI B;  2DMT A;  1N25 A;  4RAY A;  5KK1 A;  3QOE A;  2AO9 A;  4I09 A;  1SD5 A;  2ZBK A;  2XRO A;  2E5Z A;  1SFE A;  2XIG A;  4HLY A;  4KNY A;  5TJJ A;  3DPU A;  2IA0 A;  4L9N A;  2XF5 A;  3CDI A;  5HVQ C;  2JA7 J;  1IRZ A;  2KRC A;  1B8I A;  3HC7 A;  1ERD A;  3HUG B;  4MLO A;  4KIS A;  1T95 A;  3BY6 A;  3DKY A;  3Q5F A;  2F4I A;  2F5C A;  1UFM A;  3OWT A;  3JRB A;  1MBG A;  4P96 A;  1KU7 A;  3TO7 A;  3L2R A;  1MW7 A;  2RKH A;  4OOI A;  4YFK F;  4CO8 A;  3S14 J;  1YQA A;  1IN5 A;  3WOD F;  1YS6 A;  3K4J A;  2HWV A;  1XPX A;  2QLZ A;  3F8C A;  5FD5 A;  1BC7 C;  2DN0 A;  5AIQ A;  4KIG A;  5KCM A;  4XKC A;  2W1O A;  2GAU A;  3W2W A;  3J81 K;  4NHJ A;  2Y69 H;  5E8G A;  1F5T A;  1MNM C;  1TNT A;  2IA2 A;  1T08 B;  1TT5 B;  2L7F P;  3ZMD A;  2WTE A;  2X1D A;  2A6H F;  1FJL A;  1ZGW A;  3A01 B;  4E6K G;  2RAE A;  1U5T C;  3MFK A;  1JGG A;  4XBF A;  5C3E J;  2VL8 A;  2DO7 A;  3D5R C;  1MIJ A;  1X58 A;  3BDD A;  3RPU A;  2ZO4 A;  4KA4 A;  3H3U A;  3FF5 A;  3CCU I;  3L2W A;  3L09 A;  3JRG A;  4BHB A;  1FLI A;  2H27 A;  1H9T A;  2KHM A;  5J4Y A;  2E2H J;  2NS0 A;  4XM3 A;  1O3Q A;  1S7A A;  4EV0 A;  5E1X A;  2E1M B;  1HKQ A;  3VSL A;  1LDJ A;  3CQZ J;  2PFB A;  2ZJR F;  3FXR A;  3S17 J;  4MQV A;  4R8H A;  1TWA J;  1QZY A;  2ZCW A;  2H6C A;  2HS5 A;  3V7C A;  2V9K A;  1O7F A;  4LGW A;  4F93 B;  3Q0W A;  1JUM A;  2CO5 A;  5FJ8 J;  5IT9 Z;  3HYI A;  2IT0 A;  1Y1V J;  1OCP A;  1GV5 A;  2IEK A;  1L3L A;  4ON0 A;  1P7J A;  4RGS A;  4MEY F;  3CUQ C;  1RI7 A;  1U78 A;  4I02 A;  2VT3 A;  3M8E A;  1ZG5 A;  5ILU A;  4AID A;  4ZDP A;  3FXQ A;  3MCZ A;  4FT8 A;  5FLX K;  1UHM A;  4G94 A;  2WY7 Q;  4LIV A;  3BJA A;  3OV8 A;  3T8T A;  2NVQ J;  3GZ5 A;  5D5U B;  3CJR B;  1FPQ A;  5FGM A;  4B48 A;  4AIJ A;  1O3S A;  2PBI A;  4BAY A;  3E0J B;  4BDY A;  2BXY A;  3LSG A;  1IG7 A;  4OAZ A;  1VQ7 I;  1NHA A;  4KN4 X;  3GXO A;  3D5L A;  2F4O B;  2VJ4 A;  1IXS B;  2E71 A;  4A3F J;  5DYM A;  1ZRD A;  3HXL A;  3HSF A;  1UG0 A;  3DBH B;  2R7Z J;  3P9C A;  3I53 A;  3VPR A;  4RAZ A;  3GX4 X;  5DM6 F;  1ETY A;  4IQJ A;  3MEX A;  1VQK I;  4L5I A;  3GO5 A;  4LIU A;  1YRN A;  3AL0 B;  1U6G A;  4OMZ A;  2HQA A;  2GXB A;  2E1N A;  3EYY A;  1OYI A;  3MVP A;  1I3Q J;  2VBX A;  3TED A;  1FOY A;  1S29 A;  1EV7 A;  2ZME C;  4E7I A;  3WTV C;  3FIS A;  4BQN A;  1GUU A;  2IGO A;  3MKW B;  2VON A;  1X1P A;  1S7E A;  3QU6 A;  2PLY A;  1BJZ A;  4ZYH A;  2HXO A;  2VKV A;  4H0E A;  2P7C B;  3ROU A;  2EA2 A;  4DGW B;  1MMG A;  3KLO A;  1CF7 A;  2VJ5 A;  3IWF A;  3MZY A;  1T33 A;  2ZXJ A;  5E1Z B;  1ZK8 A;  5HS8 A;  1ON2 A;  1KGS A;  4GRI A;  4QWQ A;  3I56 I;  2L9V A;  4DYR A;  5EF6 A;  3FXU A;  2WAE A;  5L3D A;  2KMU A;  5JVG F;  1BW6 A;  3HOW J;  4CDG A;  1RKW A;  2ZXH A;  2CW0 F;  4JOM A;  1F43 A;  5D6E A;  1BR4 A;  2BW3 A; 
#chains in the Genus database with same CATH homology
 3K4K A;  2VQG A;  3ZRG A;  3OYI A;  3OIP A;  4JQF A;  4RM3 A;  4B44 A;  2X6Y A;  4P5O A;  3CJQ B;  1U0J A;  2AQE A;  2WAF A;  1UAA A;  4AVZ A;  4KIT B;  2IGK A;  2JVH A;  2LC2 A;  1X1D A;  3CF2 A;  4NQW B;  2XSJ C;  2IGM A;  2O5R A;  3H9Q A;  3SEQ A;  4U7B A;  3K70 C;  1MND A;  4BS9 A;  4FAS D;  2DT7 B;  3K6G A;  2LOO A;  3OYJ A;  2GOX B;  1LFP A;  2K3P A;  2M4G A;  2R7R A;  4HRI A;  2L2O A;  2XDV A;  4LG3 A;  2HPI A;  3K4B A;  2R7X A;  1LDK B;  4BJ6 C;  2V7F A;  3TBI A;  2IXS A;  1Y6I A;  3OYB A;  4Y3O A;  2Q1Z B;  4PJN A;  2UWM A;  1T0F C;  2MC4 A;  3QYF A;  4PJJ A;  4PUS A;  1W36 C;  2X1C A;  2KRH A;  4N4O B;  1X19 A;  3SEZ A;  2X51 A;  4PSW A;  3H35 A;  2W7N A;  1DQU A;  3MKY B;  4Y4R A;  4XQF A;  1WJD A;  1YE9 A;  3VYR B;  2AQF A;  2HZD A;  3ONQ A;  5CQG A;  4XKB A;  4XOP A;  2KQR A;  1FMV A;  4CCM A;  4D1Q A;  5HLT A;  3L2U A;  4CCN A;  5KNL A;  4HNT A;  2CUJ A;  4OWR B;  3KYL A;  2NOJ B;  3NWT A;  3HOS A;  2IS6 A;  3EPZ A;  1YX5 A;  3HKZ A;  1D1A A;  2I8D A;  3OYL A;  3H9J A;  1GLN A;  3HPH A;  2HPM A;  4OAY A;  3PNY A;  3F9K A;  2V26 A;  4XLH A;  3OMY A;  2IS1 A;  2W4S A;  3ZXS A;  1G8X A;  3RTR A;  4RLQ A;  2ZSI B;  3VYU B;  2L9S A;  4PFO A;  2JSP A;  5HNF A;  1V5G A;  1WJB A;  2DT6 A;  1X1B A;  2LBF A;  2WB1 A;  2MYS A;  3PFY A;  2OC6 A;  2VIX A;  4QPO A;  2R7W A;  4RM2 A;  2R7U A;  1IRX A;  1OR7 C;  4BE2 A;  1MMD A;  1BR2 A;  4BEH B;  2WAD A;  2L9N A;  4BL0 B;  2KZV A;  1V5E A;  3MMY B;  3OOU A;  3ZCO A;  3PNT A;  3BCB A;  1FMW A;  3BG7 A;  3VYS B;  3S3O A;  4E7L A;  2WY8 Q;  4CA0 A;  1SAU A;  4ZDL A;  2VB6 A;  1MMN A;  2K9L A;  2RRE A;  1D0Y A;  3CP2 A;  4C2T A;  3HPG A;  3W2V A;  4CSW A;  1WJ5 A;  1X4O A;  3LL7 A;  2OV7 A;  5FRO A;  3A1Y A;  3OYH A;  4CCL A;  3CZ6 A;  3L2V A;  3IAM 2;  3AL0 C;  4F92 B;  3PUB A;  2A6T A;  3QYB A;  2CH0 A;  4HG2 A;  4E7Z A;  4HPQ A;  2VXD A;  3RCO A;  4Y33 A;  4G6T B;  1WJA A;  3OR1 C;  4H4K C;  1PJR A;  3DQV C;  3DLA A;  4XOT A;  2LBF B;  4BJT A;  2E60 A;  3ZQQ A;  4IKF A;  3LMM A;  4CCK A;  3EUH C;  3MD2 A;  3ZR8 X;  4EAT A;  1SFK A;  1LVK A;  2F6C A;  2LRD A;  2L5Q A;  4XMY A;  3OYC A;  2PJR A;  2MFZ A;  1YX3 A;  4XR6 A;  2XF6 A;  3S3M A;  2W00 A;  3PL8 A;  1TT0 A;  3DEE A;  4AYB A;  4XLE A;  4PK4 A;  2CW7 A;  1Y56 A;  1Z3Y A;  5JHF A;  2JVG A;  5KHD A;  2VAS A;  2IS4 A;  4PJL A;  1OLT A;  2R7V A;  2LRE A;  1R6R A;  4BAC A;  3GBG A;  4KJZ A;  4ZTF A;  3S3N A;  4BXF A;  1BOB A;  5HOO A;  2VXZ A;  2BVM A;  4ZYA A;  2DCE A;  2KDO A;  3NWS A;  3S32 A;  3PJR A;  3K4L A;  4XN0 A;  3OYD A;  3UR3 C;  2X6W A;  1V5F A;  2JA2 A;  3K4M A;  2KPM A;  2WAQ A;  2L7K A;  3VWB A;  4IQ4 A;  4RLF A;  4XKV A;  1LKX A;  2UV1 A;  4BE0 A;  3W2A A;  4HSR A;  4X0G A;  1DP3 A;  2RQQ A;  2PJR B;  3I3L A;  2BW3 B;  2K5C A;  5LD2 C;  3OYE A;  4XN3 A;  3BCA A;  3CMM A;  4II3 A;  2OUM A;  2VKH A;  2HVS A;  1D0X A;  1Z3X A;  2KP6 A;  1Z7L A;  2E1M C;  3LSK A;  4QPQ A;  3CES A;  3OR2 C;  4F91 B;  1WJE A;  2VLA A;  4XKW A;  2MD0 A;  3DU6 A;  1PYV A;  5FRN A;  2QKL B;  2CW8 A;  4J00 A;  3OL4 A;  2XF7 A;  3DTK A;  4RMN A;  4E7H A;  1D0Z A;  3OIQ A;  3FBN B;  3SYT A;  4ZDO A;  4BJ5 C;  3SDB A;  3DU5 A;  2Z1D A;  3K10 A;  1X4P A;  4II2 A;  4DIQ A;  3N05 A;  1N78 A;  3D5S C;  4XNF A;  3HL2 A;  2Z2S B;  2Z16 A;  4XLF A;  1P9Q C;  3L2Q A;  1TZL A;  3KEY A;  2CUZ A;  3PNV A;  1JI8 A;  4BE1 A;  4DBR A;  2E5N A;  3V42 A;  2RNG A;  4IZZ A;  3MKZ A;  4P1W A;  2X85 A;  3IUO A;  3DPT A;  2QKM B;  2K9M A;  3PSI A;  2CFO A;  3FHN A;  4LIT A;  3H0D A;  3OYA A;  2CMP A;  4ZTJ A;  1WFX A;  3HG9 A;  3A2K A;  3M1C A;  3DPL C;  3TL4 X;  2M0M A;  1G59 A;  2X1E A;  3W3C A;  3HOT A;  2VQL A;  3H5N A;  3OYG A;  2WA0 A;  3BG6 A;  1VZ0 A;  2Y0S A;  4B43 A;  4CUG A;  4J01 A;  3AFH A;  3TMO A;  3U21 A;  2F5V A;  2BOL A;  3DTE A;  4ZC3 A;  3RPU D;  4R79 A;  3M8J A;  3AKZ A;  1KON A;  4ITV A;  2R7Q A;  2X6X A;  3FBI B;  2ELJ A;  3FKJ A;  3QOE A;  2LYC A;  4FET A;  4F3Q A;  2JUG A;  1J09 A;  4C30 A;  4CCJ A;  2E5Z A;  3RSN A;  4PFP A;  3I9V 2;  3DPU A;  3CP8 A;  2XF5 A;  5HVQ C;  2KRC A;  3HC7 A;  1ERD A;  1N75 A;  3HUG B;  4F55 A;  3VSK A;  4AU7 A;  2ZFU A;  4N4N B;  4MLO A;  4KIS A;  3KX2 A;  1T95 A;  1MMA A;  3OS1 A;  3DKY A;  2F4I A;  3ZGK A;  4YRV A;  3OWT A;  3LSM A;  2LH9 A;  3L2R A;  4C9Y A;  2VQH A;  1MW7 A;  4XON A;  3OS0 A;  2CV0 A;  2PMZ A;  1S9H A;  1QHG A;  1E0E A;  4E7K A;  4U87 A;  4CH7 A;  4NUB A;  5TGT A;  1NG7 A;  3J7A Y;  1X1A A;  3K4J A;  3A4C A;  4XLA A;  4YEJ A;  2DOA A;  1WJC A;  4B3X A;  1N77 A;  2LG4 A;  3RQ4 A;  3PSF A;  3DTI A;  2VQC A;  3QYE A;  5KCM A;  4XKC A;  2VJJ A;  4ANJ A;  2W1O A;  2UUZ A;  4HST A;  3OS2 A;  1UEL B;  2FUG 2;  4PJM A;  3W2W A;  5LFA A;  2DJI A;  2VPL A;  2P0W A;  2X1D A;  4E7J A;  3K4C A;  2HDW A;  4E6K G;  3OYF A;  1ZEL A;  1DGW Y;  2VL8 A;  1DGR M;  4CZC A;  2M7B A;  3D5R C;  4XL9 A;  4E7S A;  3L2W A;  2M3A A;  3DKX A;  4B47 A;  4NC8 A;  2KHM A;  2CV2 A;  1AA7 A;  2HVQ A;  4XM3 A;  5CPR B;  4CCO A;  3QOD A;  2HU9 A;  3K4N A;  4KT6 A;  3H5A A;  2E1M B;  2HNH A;  3VSL A;  3K70 D;  2W82 A;  4DJA A;  4BEH A;  2M7A A;  4C2U A;  2V9K A;  1Z21 A;  4BU2 A;  3LFU A;  3S93 A;  4F93 B;  2ZSH B;  2Q2E B;  2VKD A;  2XC7 A;  2IS2 A;  4YEL A;  2V6E A;  1W36 D;  3OYN A;  3VDX A;  3EUA A;  4ZDP A;  1WJF A;  1QHH D;  4E4H A;  2WY7 Q;  4LIV A;  4BQO A;  3CJR B;  2A5W A;  2LY2 A;  1HA8 A;  4B48 A;  5CKT A;  2KL4 A;  2CV1 A;  4BQQ A;  1BR1 A;  3E0J B;  2MAB A;  2HVR A;  2GOM A;  1BR4 A;  1QU3 A;  4BDY A;  4BDZ A;  2WBM A;  3LSG A;  4OAZ A;  4XLC A;  3UNG C;  5CQE A;  1EA3 A;  1D1C A;  3OY9 A;  3D5L A;  3OYK A;  2VJ4 A;  2R7S A;  2KLO A;  2R7O A;  3HXL A;  1UG0 A;  4IX7 A;  2V4J C;  3C2G A;  4HNU A;  4PSX A;  1NG6 A;  4IQJ A;  1D1B A;  4DOZ A;  4LIU A;  3AL0 B;  3BLY A;  3DWL E;  2CS3 A;  2HQA A;  2M4K A;  4D9J A;  3OYM A;  4XOR A;  2R7T A;  4HEA 2;  4BGD A;  3C2H A;  5FRM A;  2LY1 A;  4E7I A;  2DXI A;  2ZXI A;  4BQN A;  2IGO A;  3MKW B;  3LSH A;  3E1S A;  3H5R A;  4NNJ A;  5HNH A;  3S8P A;  4NC7 A;  3FDY A;  4F52 A;  4DGW B;  1X1C A;  1MMG A;  2VJI A;  2VJ5 A;  1MNE A;  1K6Y A;  3BC8 A;  3LSI A;  3SZG A;  4GRI A;  2XAU A;  3EUK L;  2BVL A;  3IP4 B;  3OL3 A;  2WAE A;  2IGN A;  2KMU A;  3VYT B;  3IAS 2;  4DBQ A;  2V1N A;  4BUP A;  4ZJZ A;  2ZXH A;  4JOM A;  3H9G A;  2R4G A;  3G2B A;  2BW3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...