2GLOA

Solution structure of the brinker dna binding domain in complex with the omb enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCESNLRSSVANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords 5'-D(*TP*GP*AP*GP*GP*CP*GP*TP*CP*AP*AP*C)-3'
publication title DNA recognition by the brinker repressor - an extreme case of coupling between binding and folding
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09607 BrkDBD Brinker DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gloA00
1FTZA 1I3QJ 4S0HB 4V2GA 2K40A 3BT9A 3BR6A 4G12A 2LP0A 1ZK8A 5IYDJ 3ZQGA 3RKQA 3BTCA 2DA2A 3WHBA 3LSPA 5FKNA 2JK3A 2EZLA 3BR1A 4UUSA 2Y9ZA 3GTPJ 2HI3A 1TWFJ 2DMPA 1JTXA 3HBLA 3S16J 4W1UA 5EDNA 1H89C 4IHXA 5K7HA 2XPWA 2CJJA 2TRTA 2I10A 5E3MA 4XRSG 2JJ7A 5HODA 5EGOB 2W48A 3S15J 1ZKGA 3LSGA 1WH7A 2OPTA 4M3GA 3HOXJ 5C4JJ 5F27A 3JRBA 2LD5A 5IP7J 1U9OA 1IDYA 1BL0A 1F36A 1O4XA 3F0CA 2DMUA 2MW8A 1RPWA 3E7LA 2OF7A 4JX4A 2Y9YA 4XRMA 2K9QA 5GPAA 3S14J 2HXOA 1QRYA 2MSYA 1MBJA 2LTPA 1I6HJ 2X48A 1JKRC 2Y30A 4FE7A 3BR2A 4M3BA 2ID3A 3ZQLA 4M3EA 4XIDA 4Y7NJ 3W6VA 4X6AJ 1VFCA 1X58A 2AO9A 3K2AA 4MIMA 1LFUP 3SDGA 1JGGA 2YUSA 4C3JJ 3BR3A 4A3KJ 1P7JA 2E19A 2R7ZJ 2HDDA 1GVDA 3MN2A 3JRDA 3NAUA 1T56A 2MG4A 1RETA 1OCTC 2FD5A 5IOZA 2JN6A 5DS9A 4A3EJ 1AKHA 2VUMJ 5EGOA 1WCMJ 2ECBA 1RR7A 2DA7A 3HOVJ 1LE8A 3JRHA 2LVSA 4BBSJ 5GP9A 2G0EA 2M0CA 2CQXA 3G1LA 3BTLA 1Y1WJ 5JLWA 4BY1J 4JP0A 3S1QJ 1IDZA 3H0GJ 3BQZA 3BG3A 4L5EA 3JRFA 2DA3A 4UUSB 4LOCA 3BTJA 4FTHA 1JUMA 5FKLA 2D5VA 3G1MA 2LKXA 5JLXA 1LFBA 1JT0A 4DW6A 2K9NA 1IUFA 3LNQA 4NDLA 1AHDP 1B8IA 5M5XJ 3S1RJ 1IJWC 1UHSA 3S1NJ 4AYBN 4BKXA 3A03A 5C3EJ 2HOSA 3Q0UA 5E3LA 4DYQA 1IC8A 1WPKA 2L7FP 1MSEC 3HDDA 3S2DJ 2L7MP 3FK6A 4QSHA 1FJLA 1XC5A 1ITYA 5M5YJ 1GV2A 2XB5A 3S1MJ 3IH2A 1TWHJ 3Q0WA 2DMQA 1CQTA 3FIWA 2GBYA 3UKGA 1VNDA 3NARA 2Y2ZA 3Q0VA 5F0HA 1APLC 2R5ZB 3LSRA 5EEAA 5F08A 2O7OA 2HYJA 2XGDA 1HLVA 2KT0A 2ME6A 2L0KA 3TP3A 5C44J 1OCPA 1MH4A 2LK2A 4A3FJ 2WB1N 2FQ4A 9ANTA 1GT0C 4A3BJ 2O9LA 1FTTA 1U9NA 5DTDA 1ORKA 2JWTA 2ME0A 1GUUA 1WI3A 2ZB9A 5IP9J 1ZR2A 1K83J 5J3LA 2M9HA 4A3CJ 2IEKA 1HDPA 5FKOA 4AUXA 1HCRA 1AKHB 2CU7A 4UUTA 3B6CA 2Y31A 3OSGA 1HF0A 5FJ8J 5K7ZA 1LE8B 1U78A 4C2MJ 1Q1VA 3S17J 1MBHA 4BXXJ 2LR8A 2HQ5A 4B3AA 2EH3A 2NVYJ 1ETXA 3PM1A 2EBIA 1VI0A 3LOCA 3ZOBA 2XSDC 4M3DA 5EYRA 3HKZN 2X6OA 3LSJA 3OOUA 1MH3A 2R5ZA 2NS8A 1B8IB 2IBDA 4D5FA 1FIPA 3HM5A 1JT6A 2COBA 3MVPA 5EF6A 2L7ZA 4C3IJ 2M8GX 1SFOJ 4A3DJ 5M3FJ 2QF7A 3HOWJ 2XPVA 1MBGA 5IP6A 4Y52J 2QCOA 1A5JA 4X1EA 1HDDC 1X2MA 4D7NA 1H8AC 3I4MJ 1B72A 5M5WJ 2IAIA 4JX6A 4ABZA 4EEFG 3S2HJ 4B1RA 3DCFA 4RDUA 2XPUA 4DZJA 4IHYA 2DA6A 2H8RA 3ZQCA 2DA5A 5E3OA 1RKWA 2M2EA 1S7EA 4QIWN 2EQRA 3A01B 3CQZJ 2ELKA 3RZDJ 1QPIA 1NK2P 3GTQJ 2PMZN 5FLVA 1BJZA 2DA4A 1MBEA 3L1PA 2N8GA 5IYCJ 2DA1A 5EZGA 5FKMA 1XG1A 3HOZJ 5IPAA 5BNGA 2LFBA 1NTCA 1E3OC 3BG5A 4A69C 3O8GA 2CQQA 3QPSA 2H1KA 3PO3J 1IG7A 3M3YJ 4JX5A 5K7FA 3HGGA 2HXIA 3ZQFA 3BR0A 2LY9A 1U8BA 2JA7J 3GTMJ 2GLOA 2XGCA 2EZKA 1MBKA 4JYKA 1ETYA 5C4XJ 4XRSA 2CRGA 2R93J 1JJ6C 2E2IJ 2K9SA 1FIAA 3OIOA 3GTJJ 5J1YA 1XS9A 4A3GJ 2XGEA 3HB9A 4MO7A 3GBGA 2E2JJ 1G2HA 4GFBA 1AU7A 1ZR4A 3HEFA 3I4NJ 2E1OA 1YRNB 1BA5A 1QVTA 2KDZA 3QPLA 1X2NA 3ZQHA 2YS9A 1OFCX 3BR5A 5IOYA 3MKLA 3CDLA 5J1UA 3G1OA 1FEXA 3A01A 3GTLJ 3FK7A 5FLMJ 5IYBJ 2JA6J 2R5YB 1R9TJ 1Z0XA 4BY7J 4D7MA 2L9RA 3FKIJ 3OSFA 3TP0A 4M3FA 2MGQA 3Q3SA 4QTRA 3A02A 4CYCA 4MFDA 4RBOA 1B72B 4IHVA 1QVUA 4FISA 1ZQ3P 2DMTA 2FX0A 3GTGJ 2ECCA 3PO2J 2RAEA 1TWCJ 2WV1A 1IGNA 1HOMA 3C2BA 4A3JJ 5E3NA 4C3HJ 3JRGA 3HOUJ 4D5CA 2TCTA 1UG2A 4IHWA 1JUSA 4M6VA 2AHQA 4V2FA 3BG9A 5F0FA 3O8HA 1ZTRA 2VKEA 1I50J 4J19A 3RZOJ 1YRNA 2DTZA 2CUFA 2YU9J 1TC3C 1SANA 3K7AJ 1MNMC 2NVXJ 3JRAA 3JRIA 4AC0A 2CUEA 1Y1VJ 2VKVA 3FISA 3HGYA 3SFIA 2E2HJ 1OJLA 2EZIA 1DU6A 2JA8J 1ZGWA 1A6IA 1MBFA 1T33A 1ETOA 4DZPA 1JKQC 1UMQA 4B4CA 4FE4A 4A3MJ 4MFEA 1P7IA 2R5YA 1EF4A 5M3MJ 4XICA 2ID6A 2XRLA 2M34A 3CCYA 4W97A 1GV5A 1MSFC 3QQAA 4A3IJ 1ETKA 3JRCA 3TEDA 5FKKA 1JKPC 5F04A 2VI6A 4I6ZA 4I76A 1GDTA 3CMYA 2VPRA 2HOTA 5F0CA 3RQIA 2LLKA 1PUFB 1JTYA 2X9DA 4MLOA 3HOYJ 1RKTA 2NOGA 1W0TA 2P81A 5F1JA 1Z77A 3DEWA 5EG0B 2HOAA 3GTKJ 3M4OJ 4CYCB 4A3LJ 2JA5J 3VPRA 2GM4A 2R0QC 1JUPA 1IRZA 4HNVA 5J1RA 1TWAJ 3BTIA 5EZHA 1BW6A 2O8KA 4A93J 1VF9A 4XK4A 2DMNA 2FJ1A 3GTOJ 1WGXA 3ZQIA 3TW6A 1TWGJ 1ETVA 4IEJA 2DJNA 3SJMA 2WAQN 1W0UA 3D1NI 1ETWA 3TW7A 1JJ8C 1IV6A 1DU0A 3B6AA 1ETQA 3WHCA 3IH3A 1D5YA 2NVQJ 1ENHA 1H88C 1F43A 3IH4A 4BBRJ 2B63J 2XB0X 1K61A 4FCYA 2DN0A 2JMWA 1PUFA 1JKOC 4DYRA 2EZHA 4DYCA 3IV5A 3H3VK 3BQYA 2NVTJ 1RESA 1NK3P 2Y0SN 1BW5A 1POGA 1WH5A 2NS7A 3JR9A 3JREA 2R92J 5GPCA 5EG0A
chains in the Genus database with same CATH superfamily
2D2WA 1DDNA 3OYBA 3DPTA 3SFZA 3CD6I 1FOXA 1T38A 1G3TA 1U0JA 2K40A 1ZGAA 2LP0A 1HW5A 1WJCA 4BJ6C 4X0GA 3CMMA 3GMEA 5IYDJ 3RKQA 2MFZA 2OQRA 3LSPA 2DDBA 5FKNA 1GXPA 3CDHA 2IT0A 1IV8A 3CO7C 4E4HA 1R4MB 3DLAA 4M73A 4YFNF 2Y9ZA 1BC8C 1JHHA 5E20A 2DMPA 1JTXA 4E7ZA 3OYFA 4IOAF 3GVAA 5K7HA 2Z5UA 2QKMB 4KT5C 4C30A 3H9JA 1ZAOA 2P5LC 1Z05A 3F21A 3SXYA 4A12A 2I8DA 1PYVA 3HOXJ 1WH7A 4A6DA 3MKYB 4G7OF 2KPMA 4I2OA 1G3WA 5IP7J 1ERDA 4HLYA 2EFWA 2K3PA 3OIQA 3F0CA 1UJ8A 3I0TA 5LFAA 2DCEA 3W6KB 2BZTA 1HKTA 2QKLB 1EKEA 4EGYA 5CPRB 3G71I 2OUMA 3EYIA 2NXNB 1D8JA 2P5KA 1Z3YA 1QRYA 2MSYA 3AL0C 5HS8A 2ZJRF 1I6HJ 3SZTA 5GAHJ 2CGPA 1RIOH 2OTJI 1QGPA 2MH9A 1I6XA 4FE7A 3ZPLA 3BR2A 1LVAA 1WJBA 4M3BA 2ID3A 1XX5A 3WG7H 4M3EA 3J81Z 4Y7NJ 1MMDA 3K2AA 1LFUP 4HPQA 1ACIA 1MJBA 1J2XA 3TOAA 2XAJA 2E1CA 1X1AA 1JGSA 3CCQI 1K79A 2HDDA 4JK1X 3JRDA 3NAUA 1W36C 3ZMZA 5FROA 1P9QC 1PP8F 3PSFA 2BBYA 4A3EJ 4IQ4A 5AIPA 3RI4A 1P6RA 2PJRB 4RAZA 1UHMA 2RNJA 3HOVJ 1LE8A 5GP9A 1J9IA 3I59B 3G1LA 3PQJA 4LIUA 4M74A 5ILVA 2QQ9A 1IDZA 1YJ9I 4L5EA 2VODA 4UUSB 5E17F 1JUMA 1T0FC 2GWRA 2W24A 5FKLA 2GXAA 3ZQQA 2ZO4A 1BIAA 2BY0A 2XAFA 3BZCA 3G1MA 3IC7A 3D5RC 4XONA 5JLXA 2LKXA 1QA6A 3FF5A 2K9NA 1LQ1A 1IUFA 4HF1A 1WWXA 4NDLA 4ZJZA 2QLZA 3FXLA 4KJZA 4HZFA 3CP2A 2WADA 4AYBN 2Q2EA 2W1OA 5BPIA 4H4KC 1R58A 1VQ7I 1E3HA 3HG9A 2Y69H 3HDDA 3S2DJ 4QSHA 1XCVA 1FZPB 3MAJA 4IXAA 1MMGA 5M5YJ 2H27A 1V5GA 3S1MJ 1Q1HA 3CTAA 2BW3A 3Q0WA 2DMQA 1F1ZA 4O5VA 3ZN1A 4YG2F 3A0BC 2STWA 1BOAA 2VC0A 1ZREA 1VNDA 3PL8A 3R6SA 2R7UA 2UWMA 2Y2ZA 2F5DA 3Q0VA 3BG6A 3SEQA 3LSRA 2KL4A 5F08A 5EEAA 3PIPF 2O7OA 4MHGA 2EFPA 3FMSA 5CVRA 4RLQA 4PFOA 2ME6A 3TP3A 2LK2A 2VXZA 3IWZA 1XMAA 1EA3A 2WB1N 1KYWA 1YIOA 3PUBA 3SHFA 2XAHA 1YOVB 2W57A 1B6AA 3K4MA 1FTTA 3J7AY 1WZ2A 1ZR2A 4ZH4F 4I09A 1LDJA 1X1CA 2EV5A 3TL4X 1B1BA 1Y0NA 1STZA 1Y39A 5J3LA 3ZMSA 2XRNA 5CJ9A 5AIQA 4AUXA 1KQ8A 3N4MA 1HCRA 1TZLA 4MQVA 4EM2A 1IW7F 1YW8A 1IN8A 3K70D 1B4AA 3JCUC 1QZZA 1CF7B 5IT9Z 1S7OA 4KITB 1WJ5A 1A36A 2IVMA 2XKPA 1XDSA 3ML6A 3ABKH 2NVYJ 2YX4A 4XN3A 1ETXA 3LOCA 3TMOA 3ZOBA 2EA4A 5K5QA 1NH3A 1K4SA 2DDAA 4XLNF 4RB2C 2HYFA 4L5IA 5HS7A 1Y56A 2Y48A 1VQNI 1QQIA 3TBIA 2GQQA 5FLXZ 3WTXC 1I3AA 2A6TA 1B8IB 3GLXA 3OR2C 5H6QA 2H8WA 2IBDA 2K85A 1FIPA 3HM5A 2COBA 3AG4H 3WODF 2L7ZA 3G2BA 1VQ6I 2BXZA 2Z99A 4N9IA 5M3FJ 2FOWA 1OKRA 3QPTA 5HLIA 3ONQA 2ETHA 2JT1A 2XPVA 3HZJA 3I71A 4OIQF 5IP6A 1UHWA 2JUGA 4IHTA 1X2MA 4CSWA 3I4MJ 3K70C 3OYKA 5M5WJ 4ABZA 1HW2A 1R36A 4BEHB 1I1GA 4EEFG 3PFYA 1VQ9I 4RDUA 4AYBA 4U0WA 2AXTC 2P5VA 4UHTA 3ZQCA 5HDNA 3CLOA 2LMDA 3RPQA 5E8IA 1PP7U 2EQRA 1IRXA 5E1ZB 2DYRH 4WXHA 2OTLI 2ELKA 4KFCA 1BI1A 1QPIA 3M07A 2L9SA 3L2QA 1F4KA 4PZJA 2ZMEC 4PJMA 2DA4A 1N78A 5IYCJ 3FWEA 3CC7I 1X1DA 2KZVA 2CW7A 3UNGC 1U8RA 3R4KA 4A69C 1FNNA 5IT3A 2X6WA 2QSGX 3QPSA 3FHZA 2BY3A 3PNYA 1HSJA 2TDXA 1IG7A 2L3DA 5DCMB 1S5LC 1Z1DA 4IZZA 2GXBA 4Q4ZF 3K4LA 3K69A 1MDMA 3U1DA 4HX8A 4XKWA 4JYKA 3KCCA 3C7JA 3H9GA 1MMAA 2LDUA 2F6CA 4A0XA 4CXFA 2E2IJ 1RUNA 2KHMA 2QA4I 3GO5A 4KT6A 4F91B 2XGEA 1XMXA 3FKJA 3HB9A 4A3GJ 2K5CA 3GBGA 3M9AA 4LK0F 3VSLA 2E1OA 1YRNB 4J01A 2V1XA 2BGCA 1WKMA 2YS9A 3BR5A 1OFCX 2VBYA 2CS3A 3K1NA 5ICFA 3MKLA 1QZYA 3CDLA 3F8FA 3G1OA 2ZXWH 2CYYA 3HUGA 3OIPA 5J1UA 1T2KA 3U21A 3A01A 5D6EA 5DD8A 3FK7A 4B09A 1LPQA 2CG4A 3DXJF 1DP7P 2HQAA 5KVRA 4HAMA 3JAMZ 1W7PD 1Z0XA 1ZN2A 5HNFA 2KMUA 3T8RA 2L9RA 3FKIJ 4KMUX 2VE9A 3H3UA 4M3FA 3Q3SA 2UUZA 5EEHA 1B72B 3D0SA 3F6OA 1SD5A 2GOMA 4FHTA 2O8XA 2LH9A 2OZUA 4U87A 4FASD 1OMIA 4WWCA 3OY9A 2ECCA 1OQYA 3WTZA 4RGSA 4XKBA 3JRGA 5H6RA 1K7AA 4IHWA 3S3OA 2VONA 6PAXA 5HDKA 1BN5A 1FLIA 4ZC3A 4V2FA 3BG9A 3DBHB 4NC8A 4UY8I 2R3SA 2AQEA 2DOFA 2ISYA 3HTUA 4B44A 4J19A 2DTZA 5ICCA 1Z6RA 2CUFA 4HDUA 1TC3C 2YU9J 2DT6A 4OMZA 5B3SH 3JRIA 3KEQA 2E60A 4AC0A 1OYIA 4KUMA 3SFIA 1UAAA 2AQFA 2YX7A 3CUQC 3FXOA 4PJLA 2EZIA 1K78B 3IUOA 1DU6A 2VQGA 1A6IA 5KK1A 4L9JA 4DZPA 1UMQA 1PDNC 3WE3A 3CJRB 3QOEA 2E5ZA 3PSIA 2E71A 1J0RA 5FFZA 1YLFA 2FNPA 4PJJA 3V8LA 2R5YA 1EF4A 4XM3A 2IGNA 2XRLA 2CUZA 2JRMA 4Y17A 1Y8RB 3AFHA 3OYNA 1GV5A 1LUJB 3OYHA 2HEOA 2Q8KA 3MZYA 3I56I 2Z33A 3MCZA 2R7QA 1X3ZB 3MZHA 1H0MA 2P7CB 1TW2A 2MD5A 3ZQ7A 4I76A 2VBZA 3O2PE 1R5GA 4YIFA 5L3EA 4CUGA 2XDVA 1BR4A 3EUHA 2IA1A 1TLHB 2HOEA 1WJAA 3HOYJ 1ZRFA 2COMA 2P81A 3F8MA 2L02A 2YSRA 4BHBA 4RMNA 5F1JA 4FX4A 4ENKA 3DEWA 5L3GA 4EJUA 1VTNC 2VOPA 3MD2A 4YEJA 4EATA 4CYCB 2JA5J 4HF2A 1R1UA 4ZDPA 2R0QC 3KP2A 1RRJA 1W5TA 2HFHA 4AIHA 4UB6C 3LA7A 2BEOA 1MZBA 1DGRM 1V4RA 1W7PB 3AKZA 1HW1A 4LGWA 4CDGA 4IRHA 3LA3A 1QPMA 5GTIC 3TW6A 5FO5A 2G9WA 2R7TA 3Q9VA 5EEGA 2WAQN 2KKOA 1Y8QB 4XLCA 3VYRB 4XORA 3EYYA 3TW7A 4AIKA 1BBYA 2WV0A 1DU0A 4ZDLA 1V5EA 4UNOA 4LK1F 2HVSA 1ENHA 4ASNA 4KN7X 1H88C 1FP2A 1GXQA 4UB8C 4E7JA 2A5WA 3KP7A 2B63J 3QP6A 5DEQA 3J7ZI 1S8NA 1U5TA 4DYRA 3BQYA 3CF5F 1DP3A 4YELA 3F72A 2WAEA 3JR9A 2NS7A 1ONVA 2R92J 5GPCA 5EG0A 3PFIA 4CCKA 4ENNA 2ZSHB 5JI6A 4S0HB 4HBLA 4RAFA 4V2GA 3BT9A 2PJRA 2X6YA 4L18B 1R6RA 1WRJA 2L9NA 4B47A 3ZQGA 1T08B 2MLKA 3BTCA 4CCLA 3OYCA 2RNGA 1UB9A 3L2UA 4U0YA 5E18F 4UUSA 3GTPJ 4EQQA 4L5JA 2M87A 3BJ6A 2QGUA 1J09A 3BPVA 3GF2A 2CJJA 2VASA 3K4CA 4XN0A 4KNYA 3KYCB 3FXKA 3DPLC 4GDFA 5EGOB 3VFZA 2W48A 3S8PA 2F5FA 3DQVC 3T0YA 3BC8A 3JRBA 4L9TA 4A0ZA 5CVUA 2CQKA 2F5CA 4GXOA 1USTA 1O4XA 1IF1A 1T6SA 1R1VA 4BXUA 2DMUA 4I99C 2MD0A 4YIRX 1YQAA 3CUOA 4ZZDA 4ZYAA 2BVLA 4II2A 1X1BA 2K9QA 2L7KA 3AG2H 3VYUB 3V4GA 1R5ID 1RR8C 1J75A 1A6QA 4ESJA 2X48A 3HSFA 3HXLA 2E36A 2M30A 2Y30A 1FSHA 1FPQA 4ON0A 3GZ6A 4LIVA 1FP1D 4XR6A 1IRFA 4HG2A 5TJJA 2EV0A 4XQFA 3NRVA 1X58A 3WGHA 5FFXA 1JGGA 2HDCA 2PEXA 4A3KJ 2R7ZJ 2VJ5A 1E2XA 2CW0F 1FOYA 2VL8A 1T56A 2H94A 1RETA 3BLYA 4D0PA 1OCTC 2JN6A 3IAM2 2VUMJ 5BQTA 1WCMJ 2DTRA 1CF7A 3H5AA 3IKVA 2DA7A 3LSMA 3P9CA 4LJZF 3W2WA 3JRHA 1QHGA 4RAYA 4P1WA 2G0EA 3W6JB 5K1YA 2DW4A 5LEKA 5JLWA 4BY1J 4JP0A 1IN5A 4DNCA 2M7BA 1KA8A 1E0EA 1SVMA 4FX0A 3H0GJ 3BQZA 3BG3A 4MTDA 3JRFA 1ZRCA 3GW2A 3BTJA 3ECOA 4BAYA 1SFEA 4ESBA 2NAZA 3OYAA 3M1CA 1BI0A 3RSNA 2DXIA 2FRHA 1JT0A 1MMSA 2CV0A 2R7RA 1B8IA 5K5RA 3S1RJ 1IN4A 1UHSA 3S1NJ 2LRDA 5H2FC 2DFHA 3A03A 3R0AA 5C3EJ 2KP6A 3Q0UA 2E5NA 4DYQA 4E7LA 1WJFA 1KU3A 1BI2A 1VZ0A 1SFUA 1KQ9A 5DV5A 2NNYA 2LY2A 5D6FA 1R4NB 3WU2C 1W1WE 1GV2A 2RDPA 2XB5A 2HS5A 1TWHJ 2E7WA 3CO6C 1X1PA 4BEHA 3ESWB 3FIWA 3UKGA 4BQAA 1I5ZA 2W25A 3G3ZA 5F0HA 1APLC 2R5ZB 2FUG2 3TDUC 3DTEA 5GAGJ 3WTWC 3Q9SA 3CZ6A 4MTEA 2GIVA 1HLVA 1UELB 1YJWI 2K4JA 2L0KA 2RREA 1OCPA 2A68F 5JVTA 1KONA 4IOCF 2FQ4A 9ANTA 1WQ2A 1EH6A 3BG7A 2D45A 2O9LA 3DEUA 1U9NA 3KYLA 2J5OA 5IP9J 1LB2A 1K83J 3IRRA 1P4WA 4BE1A 1MIJA 2M9HA 4A3CJ 1HDPA 4Q5SF 2CSOA 1X4OA 3ZRGA 3BY6A 4B43A 3J81K 5DCMA 1ON1A 3B6CA 5LGNA 4L9VA 3PUFA 1W36D 3H35A 5K7ZA 1W5CC 1U78A 3BWGA 2X6XA 3JSPA 4IHSA 1U5TC 5AONA 1QHHD 1BI3A 2QSHX 2L4MA 1I27A 4HEA2 4ZYGA 2BY1A 2LR8A 4IJAA 2DT5A 1VQPI 1X4PA 4YFKF 2JVHA 3QWLA 3MKZA 3ELKA 3QYBA 1YX3A 1RNLA 2ZXHA 3P9IA 3J80Z 3HHGA 1Z7LA 3FXRA 1XDUA 3KP6A 3L2CA 4DIQA 2OAZA 4NC6A 3Q5FA 2Z3YA 2UXNA 1IUYA 3CJTB 3HSRA 3MVPA 4KIFA 5EF6A 3FBIB 1LEBA 4B8XA 2QF7A 2XAUA 2F5EA 2P4WA 2IS6A 3CDIA 5L3CA 3A0HC 1WJEA 1R22A 1MNEA 5D5WB 2VB6A 2QCOA 2FU4A 2ISZA 1LJ9A 1TQMA 2E1MC 2EK5A 1OLTA 3M7GA 5CQEA 5F6FA 4AU7A 1B72A 1U6GA 4IRIA 3S2HJ 4B1RA 2KIMA 3LFKA 4UXNA 1B59A 4NUBA 2XPUA 3DKYA 4IHYA 5HDGA 5DUKA 2QZ8A 2H8RA 2M4KA 2DA5A 2RQPA 5E3OA 1XPXA 1S3JA 3MMYB 3WE2A 1S7EA 1V55H 1JXSA 1BR1A 3CQZJ 3RZDJ 2WWYA 5FLVA 2HNHA 4KICA 3DKWA 2I5UA 4RM2A 2N8GA 2VKHA 2DA1A 3RCOA 5D4SA 2FBKA 3DV8A 2EINH 2X0LA 1E3OC 2AXLA 2LNBA 2Q0OA 3L2RA 2V6CA 3AL0B 5LD2C 2FA5A 1D1AA 2H1KA 2HQRA 4C2UA 1RUOA 3CC2I 5K7FA 3HGGA 3LL7A 3ZQFA 2ZSIB 2GZWA 4UV9A 5KHDA 1T39A 1U8BA 2RVCA 3GTMJ 4I98B 2ZNZA 2A61A 1S9HA 2L2OA 4XRSA 4BH9A 1IXRC 1OYWA 1E3PA 4ITVA 4S04A 3GTJJ 3LSKA 3D5LA 5J1YA 1XS9A 2KDOA 2ELHA 3ROUA 1YITI 3K9TA 2E2JJ 2JPCA 2M4GA 4P96A 2E34A 3I4NJ 1HA8A 2HQNA 1BA5A 2KDZA 1KU9A 5CQGA 5J40A 4LB6B 4PDKA 3ZQHA 4OOIA 2LBFB 4ZYHA 5DDGA 3I4PA 1RC9A 2Y0MA 4PJ0C 3COAC 3OYEA 1I39A 1FEXA 2XGXA 3PNVA 2PQ8A 2NYXA 3CMEI 4OAZA 3GTLJ 1SAUA 2K02A 5L3DA 3F8BA 3SZPA 5IYBJ 2QBYB 4BHPA 1U2WA 1HC8A 3OOPA 3E6CC 1R9TJ 3ERED 3OSFA 4CYCA 2HDWA 1YW9A 2XHKA 4LG3A 4RGUA 1LKXA 3M8JA 4A5MA 5E8GA 3CJQB 5J6XA 2P0WA 1TWCJ 2ZXJA 1IGNA 3DWLE 2LF7A 3VOEA 2VXDA 1IO2A 3HOUJ 4HF0A 2TCTA 1UG2A 2M1BA 2H6BA 3KZYA 2O3FA 2X4HA 5LGTA 4KIGA 3F3XA 2AHQA 5JHUA 1U3EM 1VQLI 2HWVA 4I0AA 3O8HA 1IXCA 5TRDA 1I50J 3OYMA 3R0JA 2ZNYA 4QLCU 1R71A 2B0LA 4EMSA 1AOYA 1MNMC 2NVXJ 4LLLA 4DQ2A 1R7JA 2CUEA 1Y1VJ 2E2HJ 3FISA 3DU5A 1OJLA 1XGNA 4HSRA 1MBFA 5J4VA 2Y75A 3E6BA 3BZ6A 2VC1A 3K1MA 4RA2A 3VYSB 4A93J 1P4AA 5L3FA 4KA4A 2IRFG 1NG7A 3KYDB 4O3MA 2XKOA 3CCYA 1EH8A 3KPHA 4HV5A 2DFIA 2ZFWA 1MSFC 4B3XA 3QQAA 2ZJQF 1ETKA 1XGOA 3KP4A 4A3IJ 3TEDA 3H9QA 2RV8A 1P92A 3RTRA 2DODA 2OCCH 3SEZA 4I6ZA 2BHZA 4KIBA 1GDTA 1OPCA 3K1PA 4RS8A 3HRMA 2KLOA 1QO0D 2IGMA 4ZYEA 4MLOA 1RKTA 1FYKA 5J47A 2NOGA 1ZH5A 4C2TA 3WTYC 3I54A 4Y4RA 1O3TA 1Z77A 2HZTA 4YRVA 1N75A 2V7FA 1GVJA 3IRQA 3CCUI 2HOAA 4Y15A 2YU3A 4A3LJ 2OA4A 4II3A 4HNVA 4RGRA 4CZZA 2L01A 5DD4A 3BTIA 3FMQA 3GXOA 4GRIA 3K4JA 2VBWA 2XUBA 2KRFA 4PGGA 5GADJ 2LY1A 4XK4A 4XLPF 2Y0SA 1MGTA 2V9PA 3JAMK 5FRNA 2KIUA 1WGXA 1G3SA 2PFBA 3PQKA 3ZQIA 3BDDA 3UR3C 2WY8Q 3VSKA 2B7EA 2A3SA 2DT7B 2ICWG 3SJMA 1IN6A 2EILH 3SDBA 3ZGKA 1JJ8C 1FMWA 1ZG3A 2FSWA 1H9GA 2XASA 3VEPA 3WHCA 3IH3A 2DOEA 1D5YA 2OJED 2NVQJ 1Z9CA 5CKTA 5BOXA 1XB4A 4ZDOA 1F43A 4BQQA 2XB0X 2JTVA 1K61A 4JBAA 2DN0A 2DK5A 1PUFA 1YE9A 4CCJA 3ZMUA 2ZMEB 2XC7A 4ETSA 2NVTJ 2K3FA 2WBMA 4LG0A 1WH5A 1FX7A 3KETA 3REOA 4HNUA 3K4NA 2NS0A 5HLTA 2KIQA 4XKVA 3WGGA 3BR6A 2GAUA 1YW7A 5FGMA 4E7IA 1SFXA 2JA2A 2F4IA 1ZK8A 2IW5A 1D8KA 4MQ9F 3WHBA 1FYLA 3C18A 3OS0A 4ESFA 3BR1A 3KEOA 3H5NA 1OCOH 3BJAA 2HI3A 1TWFJ 3HBLA 5DM6F 2V6EA 2VLAA 5EDNA 1H89C 4F55A 4IHXA 2H1LA 1W4MA 5D5UB 3CCMI 2TRTA 2I10A 3EDPA 3EPZA 2WAFA 4XRSG 1KU7A 5HODA 3T8TA 3DTKA 4EM0B 3QU3A 1FBUA 4Y33A 2L9VA 3LSTA 2PN6A 2OPTA 3OV8A 4M3GA 2R7VA 3P5JA 5F27A 2LD5A 3ZMDA 1U9OA 1ULYA 1BL0A 2XROA 1R49A 2V1NA 3JSOA 4AVPA 2MW8A 3KE2A 4V19K 1RPWA 2V79A 4PK4A 4QPQA 3E7LA 4D1QA 4XRMA 2Y9YA 4N4OB 5HLGA 5GPAA 5ILSA 2HXOA 3EUKL 3ABUA 3HYIA 5J8FA 4CH7A 1JKRC 2ADUA 1K4TA 2HKXA 3DEEA 2R7XA 1SFKA 3ISPA 1WJDA 1AA7A 3P9KA 4XIDA 5CVVA 3KP3A 1VFCA 3RPUA 2AO9A 4MIMA 4S05A 2EFQA 3H0DA 2YUSA 4C3JJ 1TP4A 1HXDA 3BR3A 2FF4A 2E19A 3H5RA 1UCRA 1XMKA 4LB5A 1GVDA 2JUCA 2BW3B 3NEUA 2MBFA 1JHFA 2MLGA 1O3RA 1O57A 5D5XB 3HIFA 2R7OA 2FD5A 2BHYA 5IOZA 2KJBA 1RR7A 4MGRA 5E79C 5LRSA 3CUQB 4MNUA 1IZ1A 4ZTFA 2LVSA 4CZCA 3A4CA 3F22A 5CYVA 2CQXA 1V54H 2ZC2A 2PJPA 3S1QJ 3OYIA 4M9ZA 4LOCA 2KQRA 4M6XA 1XCBA 2CW8A 4U7DA 3OYDA 1BIBA 3HC7A 3IAS2 1XSDA 4RB3C 4DW6A 3ERMA 1IJWC 4G9YA 4EJTA 5A2QK 3J7AO 2O5RA 2CFOA 4BKXA 4KISA 1S29A 2YR2A 2HOSA 2V9VA 3WTUC 3JTGA 2L7FP 4RAGA 1MSEC 4CCMA 2F4MB 1IRGA 1YO5C 3C2HA 2L7MP 1YYVA 3I9V2 3OR1C 4A6EA 3CCLI 1JE8A 1FJLA 2IS4A 4HQEA 2VPLA 1PJRA 3LA2A 3IH2A 2JZYA 3G6EI 1CQTA 2VQLA 4ENJA 2QQAA 3QPHA 4HDVA 3NARA 3L09A 3ZP5A 3TO7A 4N9HA 4PSWA 1O3SA 1SD7A 2D1HA 3CCRI 2K9MA 4XLHA 2HYJA 2RN7A 3ZXSA 5DUIA 2XGDA 3RKXA 2G7HA 3QU6A 2D1VA 3TGNA 3I59A 1MH4A 3I58A 2FOKA 4A3FJ 4BDZA 4ZYDA 4XLEA 3ZMVA 2DFEA 1GT0C 4A3BJ 1D1BA 4LITA 5DTDA 2L4AA 2M5WA 1ORKA 4NC7A 2JQ7A 2JWTA 1D0ZA 1GUUA 4CGZA 5LEJA 4Z2YA 5FB2A 4HV6A 3DBRB 1R23A 4BXFA 1D5VA 1AKHB 2Y31A 2HZDA 5FJ8J 3W2VA 4XSZF 3MEXA 3FX3A 4C2MJ 1SAXA 1Q1VA 4ZZLA 4BACA 1X19A 1RI7A 2M7AA 3K2ZA 3PM1A 4G6TB 3V7CA 1SVLA 1VI0A 5FD6A 2GXGA 3WU0A 2R4GA 1J7KA 5LRRA 4L0YB 1YX5A 5EYRA 4BGDA 3HKZN 2ACJA 4CO8A 4XRFA 2EIMH 3CESA 2NS8A 2VOOA 4B48A 2L5QA 2DI3A 4XNFA 1JT6A 4Q48A 2IS1A 1YFHA 2M8GX 2L54A 5KNLA 3B73A 1J5YA 3FXUA 1VQ5I 2IA2A 3O6BB 1WSUA 4IX7A 1T0FA 2ZJPF 3RYRA 3J7YJ 3HTSB 2LF8A 1HDDC 2K7LA 4D7NA 1WFXA 1VQOI 1H8AC 4I02A 4MEXF 2HTJA 1VQKI 2IAIA 4G6QA 3TKYA 1KU2A 3DFGA 3DCFA 2PMHA 2LKPA 3BROA 3KP5A 2DA6A 3GLLA 3OMYA 2CQNA 3S93A 1A35A 5D8KB 3U9GA 3PIOF 2X1DA 2RKHA 1RKWA 2M2EA 2DYSH 3HUGB 1X3WB 2DPDA 4QIWN 2LC2A 3A01B 3WU1B 4BL0B 1NK2P 2PMZN 4GYIA 2OQGA 1BJZA 1MBEA 3L1PA 3LSHA 2V4JC 5EZGA 4G7HF 2HPMA 2HTSA 5FKMA 3HHHA 3GZ5A 2IGOA 3IP4B 1NTCA 1SD6A 3E5XA 4JOMA 2JPBA 2V1DA 2QEXI 1NG6A 3PO3J 2VJIA 4HX7A 1HSTA 2E35A 4JX5A 4IL6C 3WGIA 4XBFA 5D4RA 3BR0A 2XAQA 3FHNA 2VBXA 1LFPA 4CCOA 2JA7J 3W3CA 2XGCA 5F64A 3F6VA 1VQMI 1MBKA 3AG1H 1YI2I 3EUHC 3HRTA 4BU2A 2R93J 4M6YA 1VQ8I 3ASOH 1FIAA 1N25A 3OIOA 2H6CA 1MJAA 4GCVA 1XGSA 4E7KA 3E97A 4M72A 5EJCA 4BHCA 3DP7A 3QPLA 1X2NA 3H3ZA 2DO7A 3G4SI 1BM9A 2IGKA 1O7LA 3ABTA 4AWXB 5IOYA 5J4YA 2LKSA 2IA0A 3F8NA 3OS2A 2A05A 2F2EA 4QPOA 1V5FA 2XF7A 4M9XA 2LOOA 1R5HA 3H36A 5LHHA 4U7BA 2BOLA 5FLMJ 4IO9F 5GTHC 2MC4A 4LFUA 2CO5A 2R5YB 1FC3A 2ZJ2A 4HW0A 4D7MA 4UVCA 2OD5A 3HKZA 3J80K 4RBOA 4MFDA 5TGTA 1D0XA 3CJNA 3L2VA 2FEZA 1ZQ3P 3ULQB 4BQNA 3IHUA 1KQ0A 3GTGJ 1FSEA 2FMYA 2FNAA 1XSXA 3V8KA 4GO1A 4M9SA 4G8XA 3WG9A 2RAEA 2WV1A 4HQMA 1HOMA 1QBJA 1KGSA 1S7AA 4ANJA 4D5CA 2P6TA 4AIDA 3V7RA 2R7WA 1TBXA 3IL2A 4EV0A 2BE5F 3H92A 3FXMA 1EV7A 5F0FA 4KYWA 4LLNA 4EJOA 3GEZA 1ZTRA 2VKEA 2WY7Q 4UVAA 2HYGD 5FRMA 1YRNA 1MJ9A 5DYMA 5JVGF 1SANA 3K7AJ 1ZG5A 2VKVA 1OCRH 3ASNH 4BYYA 1T33A 2O03A 1PUEE 2PMZA 2ZMEA 3RQ4A 4BE2A 3CMAI 2QQBA 2W00A 3VYTB 2Q1ZB 3L00A 4I0BA 1P7IA 1YG2A 5M3MJ 4XICA 2XIGA 3SQNA 4W97A 2BXYA 3TQNA 2RC4A 1T98A 2KRCA 2HR3A 3QYEA 3F23A 3FZVA 5F04A 1JKPC 2VI6A 2FE3A 3CMYA 3HRSA 3L2WA 4XL9A 1D3YA 5F0CA 3RQIA 1U5TB 4N0BA 1TTYA 4BNCA 2W4SA 2X51A 1Z21A 3FXJA 3WTSC 4IKFA 3KZIC 4WCGA 2X1EA 4PCQA 4E7HA 1I1SA 2HGCA 3OYLA 5EG0B 1YIJI 2BYVE 1KYZA 1TNSA 4NQWB 3ZMTA 3GYHX 3KLOA 3M4OJ 2EIJH 3VPRA 2GM4A 1JUPA 3R61A 2EJRA 2DJIA 3MWMA 1DGWY 4L0ZB 4E7SA 3RKWA 2PMUA 1BW6A 5TISC 3RYPA 2VT3A 1K78A 4K2EA 3GWZA 5E1WA 2A5YB 3M8FA 1ODDA 4R79A 1EH7A 4PSXA 5BMZA 2FJ1A 2J5PA 1GLNA 3GTOJ 1TW3A 5ICGA 1TWGJ 1ETVA 1L3LA 2DJNA 2JSCA 2ZCWA 3K4BA 4O6JA 2WC2A 1W0UA 3D1NI 2E1MB 2EV6A 4Q47A 2XF5A 1WVRA 4F7ZA 1GHCA 3TO6A 3E3VA 5LHGA 2Z9OA 3I64A 4UVBA 2XVCA 4E70A 1K6YA 1S72I 2MABA 4RB0A 3KX2A 3F8CA 1M1EB 5IT9K 3W2AA 4P9UA 2XAGA 4F93B 2EFNA 2P7VB 4BQOA 4BDYA 1K6OA 4OIPF 1QU3A 4FCYA 2KZGA 1NHAA 3MFKA 2VQCA 2EZHA 4DYCA 3IV5A 1TQIA 2A69F 4FETA 4HYEA 4EGZA 4AM3A 1RESA 3OS1A 3MZ8A 4KMFA 3BPXA 2Y0SN 1BW5A 3LMMA 1FT9A 2DU9A 2UXXA 5FLXK 3LAPA 4R1HA 1FTZA 1I3QJ 4EM1A 1YTYA 2F4OB 3DBLB 3I53A 3N97A 3OWTA 1IXSB 2DLLA 4RM3A 2O6GE 4G12A 3RIRA 3CUQA 5JFRA 3FDYA 1MD0A 1ZRDA 1W7PA 2DA2A 5HOOA 3LQRA 2JK3A 2EZLA 4IPAA 2DOAA 2DFFA 2M45A 4BJ5C 1JI8A 3AG3H 1Z7UA 2R7FA 2VKDA 3S16J 2PBIA 2DAOA 4W1UA 5IY5H 2XPWA 2BY2A 2KJCA 3CCEI 4CICA 5E3MA 2Z16A 2JJ7A 3CLQA 2RQQA 2MH2A 3S15J 2EPFA 3FM5A 1ZKGA 1FBQA 4IF4A 1A04A 3LSGA 1AWCA 4RGXA 5C4JJ 1SEUA 2NRAC 4A5NA 1HKSA 2DPUA 1IDYA 1F36A 2LYCA 4EJWA 4P55A 5KAIC 3HRUA 4XSXF 3GCMA 3HL2A 2KRHA 2OF7A 4JX4A 4YFXF 1DQUA 3S14J 1O3QA 4NB5A 4AD9A 1MBJA 2LTPA 1TNTA 3DLLF 3VODA 4PJNA 1G4DA 3NWSA 3HJEA 5E1XA 1MKMA 2YPRA 1HBXG 2VJ4A 3U1KA 2FMLA 3ZQLA 4DBRA 3W6VA 4YIIA 1FWZA 4X6AJ 3T1BA 4E6KG 5CLSA 1USSA 3RKYA 1FY7A 3SDGA 1L0OC 1DPRA 2F48A 3DTIA 1P7JA 5B1AH 3AAFA 1XN7A 1ZG1A 5H20A 2OC6A 2VJJA 2B9SA 3MN2A 3IWFA 2EA2A 2MG4A 2WTEA 5DS9A 1S6LA 1SMYF 1AKHA 5KAFC 5B66C 2ZFUA 5EGOA 2ECBA 1SMTA 2ESNA 4LMYA 3V7SA 4F52A 1LVKA 4U88A 3FM3A 1YS7A 1WI9A 4BBSJ 3HSEA 2FBIA 5LBQA 3CP8A 1G59A 1SC7A 2KFDA 2M0CA 4U0VA 4XLFA 4HOBA 1ZYRF 3BTLA 5LHIA 1Y1WJ 4RLFA 3DPUA 1OR7A 2PX9A 2DA3A 2OZ6A 1HQCA 3KFWX 4FTHA 1DUXC 2D5VA 2CV1A 2X1CA 5LLQA 3OL4A 2OBPA 1LFBA 3SZGA 1YHQI 3M1EA 3LNQA 3R60A 2QYOA 4Y3OA 1AHDP 3S3NA 3H1CA 5M5XJ 5B1BH 2VQHA 3BJOA 3NQOA 4WF2A 2WB1A 2FXAA 4AIJA 2LG4A 4KN4X 5E3LA 3GFIA 1WPKA 2GOXB 1IC8A 1XGMA 2NNNA 2WA0A 3FK6A 4HSTA 1XC5A 1ITYA 2ZXIA 4CCNA 3QAHA 3FXQA 1QZEA 1Z67A 2M3AA 2GBYA 2CH0A 2DBBA 2OU2A 5F1RA 4WK8F 2R7DA 5BS6A 2K4BA 5K5OA 3I5UA 4DOZA 2FQ3A 3EUAA 2PI0A 2CQ7A 2KT0A 3BCBA 1BOBA 2R7SA 3M8EA 1ZELA 1X3UA 4BJTA 5C44J 4DBQA 2K86A 3ABMH 2V9KA 4M71A 1YS6A 1F5TA 3QYFA 3SYTA 2DK8A 2ME0A 1WI3A 2ZB9A 3E5QA 4N4NB 3S3MA 4P9FA 2IEKA 3L7WA 5FKOA 3CCSI 1ZLJA 2LSOA 5ED4A 3VWBA 2CU7A 4UUTA 4XKCA 2IJLA 2MA3A 3OSGA 2G7UA 1HF0A 2IXSA 3KEYA 2O0YA 2X85A 1TL8A 1LE8B 1BC7C 2GIZA 3CCVI 1XTAA 3RJPA 2HPIA 1MBHA 3S17J 2O61A 3FBNB 4BXXJ 2BVMA 1P2FA 4OAYA 2HQ5A 2M8EA 1Z6TA 2EH3A 4B3AA 3P7NA 2A07F 3CC4I 3LFUA 2EBIA 3V42A 3NWTA 4OU0A 2P8TA 1G3YA 4R8HA 2XSDC 1W5SA 4M3DA 2UV1A 3LSIA 2X6OA 3QP5A 3LSJA 3OOUA 2EFOA 4J00A 1MH3A 2R5ZA 4G7ZF 2RGVA 1B9MA 2CWEA 1FYMA 1OCCH 4D5FA 2P6SA 2Q2EB 3TDZC 4CYDA 1H9TA 4MEYF 4C3IJ 1SFOJ 4A3DJ 3BP8A 3PNTA 3K6GA 4IQJA 4DGWB 3GUDA 3HOWJ 1MBGA 4C9YA 4Y52J 1R00A 4AVZA 1A5JA 4X1EA 4H0EA 2HU9A 4G94A 1J59A 4QWQA 4ENMA 3EQLF 1SD4A 1OYYA 2EWNA 2H09A 1G6NA 3F9KA 4XLAA 4JX6A 4WX9A 1EJ9A 5HNHA 2NVUB 4LLGF 1Y0UA 5FD5A 4HNTA 4DZJA 4CA0A 5D5VB 4DJAA 2A6HF 1REPC 4HA8A 3S32A 4TV7A 5HLHA 2QSFX 2STTA 3JW4A 5HS9A 3GTQJ 4BE0A 4BS9A 2W7NA 3K0LA 4OIRF 1XD7A 1XG1A 3O3KA 3HOZJ 5IPAA 5BNGA 2LFBA 2XF6A 1LDKB 4OMYA 3BG5A 4F92B 3BCAA 2EIKH 2CQQA 3C2GA 3O8GA 4PFPA 4EJVA 1MW7A 1A31A 4XMYA 1Z91A 5LGUA 3IKTA 3M3YJ 2KISA 4PUSA 2HXIA 1E17A 2LY9A 1R1TA 1UG0A 4NHJA 2GLOA 2K9LA 3TO9A 1G8XA 2EZKA 2OV7A 4WXCA 2CFXA 1ETYA 3I3LA 5C4XJ 3MQ0A 2CRGA 2CMPA 5KCMA 3TOBA 1LNWA 1JJ6C 1TT0A 2K9SA 5ILUA 1XSVA 3GX4X 1QNTA 2PG4A 2QVOA 3QOPA 4IVNA 2KIFA 4MO7A 3B02A 1G2HA 3U2RA 1ON2A 1AU7A 1ZR4A 3HEFA 4GFBA 2MYSA 3FMRA 1QVTA 5HVQC 3A1YA 2VT2A 3LAJA 2ESHA 2V26A 4G6DA 1MNDA 3ABLH 2GA1A 2CV2A 1BJAA 2W82A 3OYGA 2EB7A 4EVIA 1CGPA 1YJNI 3E6MA 1LEAA 1P4XA 2JA6J 2QENA 4XOTA 4FT8A 1BR2A 1OR7C 2C6YA 1RZ4A 1FOWA 4BY7J 4IRGA 4ZTJA 4JQFA 4NQWA 3GFLA 3TP0A 2MGQA 4QTRA 2PLYA 3A02A 4IHVA 1C0WA 2A6EF 3ZCOA 1QVUA 2F5VA 4FISA 1SVOA 4P5OA 4BUPA 3C3WA 2Z1DA 2DMTA 2VN2A 2FX0A 4I7HA 3CF2A 2JVGA 1D1CA 3PO2J 1UZCA 5A2QZ 2Z2SB 3C2BA 3QRFF 4A3JJ 5E3NA 2MC3A 1KZHA 4C3HJ 1FBSA 3DF8A 2XSJC 1JUSA 4FQGA 2IP2A 4M6VA 5J8CA 5JR3A 3KIOA 3D5SC 4UV8A 4NNJA 3HPHA 2NOJB 3WTTC 5CVJA 3A2KA 2HVRA 3ECHA 4RB1A 1HKQA 1UFMA 2E7XA 3RZOJ 3V8JA 1DPUA 5DCFA 4Z6YA 2QM3A 3KLNA 2LBFA 2IPQX 3JRAA 2ELJA 5B5EC 4CHUA 2DQRA 3HGYA 1MDMB 2JA8J 3DKXA 4WXDA 1ZGWA 1ZGJA 1ETOA 3K10A 1JKQC 4B4CA 3PJRA 4UUVA 4FE4A 2UZKA 3LWFA 1ZLKA 1D0YA 4A3MJ 2M0MA 2K27A 2QBYA 5CVIA 5ICEA 4MFEA 3MKWB 1TQPA 3BOQA 2ID6A 2M34A 2ZKZA 4OWRB 2IS2A 2VE8A 3HOTA 1FMVA 3JRCA 3L9FA 5D8LB 3RPUD 5BPDA 5JHFA 5FKKA 4D9JA 5GAEJ 3GFMA 1IAWA 2VPRA 3VB2A 1B9NA 2HOTA 3CCJI 2LLKA 1PUFB 4HLXA 1JTYA 2X9DA 1LDDA 4A2UA 2WAQA 2AS5F 2W85A 2QQ8A 2FBHA 1W0TA 2XV4S 1ZHFA 4LG0B 3ZR8X 4GYGA 3K4KA 3JTHA 3GTKJ 3ZN0A 3QODA 3S2WA 1VQ4I 1N77A 1O7FA 2JRTA 1IRZA 3EETA 5J1RA 1TWAJ 2JSPA 2BV6A 2LREA 3E1SA 4I01A 5EZHA 4HRIA 5DM7F 4OIOF 5L3BA 5ERIA 3OL3A 4LD5A 1VF9A 3C1DA 2ZBKA 1V3FA 2DMNA 2O8KA 1PVEA 2DQLA 3E0JB 3OYJA 4IEJA 4L9NA 2V1UA 4F3QA 4PGHA 3X2QH 4XOPA 4A0YA 1Y6IA 3DU6A 1IN7A 1ETWA 1F9NA 1OISA 2GA2A 2HKOA 3KZZA 1WHUA 4OINF 1T8IA 1IV6A 3N05A 3B6AA 2QWWA 1ETQA 3GZNB 3HPGA 4GGGA 2E1NA 3E6DA 2QUFA 3BZKA 3VDXA 3IH4A 1FOKA 4BBRJ 1MMNA 3LQQA 4HX4A 3I55I 2JMWA 1JKOC 1OCZH 2VIXA 4Y13A 2HVQA 3H3VK 3G73A 3T5XA 3GFJA 1T95A 2W84A 1NK3P 4NBQA 3E5UA 4KDPA 1POGA 3RDIA 1Z3XA 3JREA 3HOSA 2CUJA 1ZARA 1TT5B 2OCEA 3WTVC
chains in the Genus database with same CATH topology
1FTZA 1I3QJ 4S0HB 4V2GA 2K40A 3BT9A 3BR6A 4G12A 2LP0A 1ZK8A 5IYDJ 3ZQGA 3RKQA 3BTCA 2DA2A 3WHBA 3LSPA 5FKNA 2JK3A 2EZLA 3BR1A 4UUSA 2Y9ZA 3GTPJ 2HI3A 1TWFJ 2DMPA 1JTXA 3HBLA 3S16J 4W1UA 5EDNA 1H89C 4IHXA 5K7HA 2XPWA 2CJJA 2TRTA 2I10A 5E3MA 4XRSG 2JJ7A 5HODA 5EGOB 2W48A 3S15J 1ZKGA 3LSGA 1WH7A 2OPTA 4M3GA 3HOXJ 5C4JJ 5F27A 3JRBA 2LD5A 5IP7J 1U9OA 1IDYA 1BL0A 1F36A 1O4XA 3F0CA 2DMUA 2MW8A 1RPWA 3E7LA 2OF7A 4JX4A 2Y9YA 4XRMA 2K9QA 5GPAA 3S14J 2HXOA 1QRYA 2MSYA 1MBJA 2LTPA 1I6HJ 2X48A 1JKRC 2Y30A 4FE7A 3BR2A 4M3BA 2ID3A 3ZQLA 4M3EA 4XIDA 4Y7NJ 3W6VA 4X6AJ 1VFCA 1X58A 2AO9A 3K2AA 4MIMA 1LFUP 3SDGA 1JGGA 2YUSA 4C3JJ 3BR3A 4A3KJ 1P7JA 2E19A 2R7ZJ 2HDDA 1GVDA 3MN2A 3JRDA 3NAUA 1T56A 2MG4A 1RETA 1OCTC 2FD5A 5IOZA 2JN6A 5DS9A 4A3EJ 1AKHA 2VUMJ 5EGOA 1WCMJ 2ECBA 1RR7A 2DA7A 3HOVJ 1LE8A 3JRHA 2LVSA 4BBSJ 5GP9A 2G0EA 2M0CA 2CQXA 3G1LA 3BTLA 1Y1WJ 5JLWA 4BY1J 4JP0A 3S1QJ 1IDZA 3H0GJ 3BQZA 3BG3A 4L5EA 3JRFA 2DA3A 4UUSB 4LOCA 3BTJA 4FTHA 1JUMA 5FKLA 2D5VA 3G1MA 2LKXA 5JLXA 1LFBA 1JT0A 4DW6A 2K9NA 1IUFA 3LNQA 4NDLA 1AHDP 1B8IA 5M5XJ 3S1RJ 1IJWC 1UHSA 3S1NJ 4AYBN 4BKXA 3A03A 5C3EJ 2HOSA 3Q0UA 5E3LA 4DYQA 1IC8A 1WPKA 2L7FP 1MSEC 3HDDA 3S2DJ 2L7MP 3FK6A 4QSHA 1FJLA 1XC5A 1ITYA 5M5YJ 1GV2A 2XB5A 3S1MJ 3IH2A 1TWHJ 3Q0WA 2DMQA 1CQTA 3FIWA 2GBYA 3UKGA 1VNDA 3NARA 2Y2ZA 3Q0VA 5F0HA 1APLC 2R5ZB 3LSRA 5EEAA 5F08A 2O7OA 2HYJA 2XGDA 1HLVA 2KT0A 2ME6A 2L0KA 3TP3A 5C44J 1OCPA 1MH4A 2LK2A 4A3FJ 2WB1N 2FQ4A 9ANTA 1GT0C 4A3BJ 2O9LA 1FTTA 1U9NA 5DTDA 1ORKA 2JWTA 2ME0A 1GUUA 1WI3A 2ZB9A 5IP9J 1ZR2A 1K83J 5J3LA 2M9HA 4A3CJ 2IEKA 1HDPA 5FKOA 4AUXA 1HCRA 1AKHB 2CU7A 4UUTA 3B6CA 2Y31A 3OSGA 1HF0A 5FJ8J 5K7ZA 1LE8B 1U78A 4C2MJ 1Q1VA 3S17J 1MBHA 4BXXJ 2LR8A 2HQ5A 4B3AA 2EH3A 2NVYJ 1ETXA 3PM1A 2EBIA 1VI0A 3LOCA 3ZOBA 2XSDC 4M3DA 5EYRA 3HKZN 2X6OA 3LSJA 3OOUA 1MH3A 2R5ZA 2NS8A 1B8IB 2IBDA 4D5FA 1FIPA 3HM5A 1JT6A 2COBA 3MVPA 5EF6A 2L7ZA 4C3IJ 2M8GX 1SFOJ 4A3DJ 5M3FJ 2QF7A 3HOWJ 2XPVA 1MBGA 5IP6A 4Y52J 2QCOA 1A5JA 4X1EA 1HDDC 1X2MA 4D7NA 1H8AC 3I4MJ 1B72A 5M5WJ 2IAIA 4JX6A 4ABZA 4EEFG 3S2HJ 4B1RA 3DCFA 4RDUA 2XPUA 4DZJA 4IHYA 2DA6A 2H8RA 3ZQCA 2DA5A 5E3OA 1RKWA 2M2EA 1S7EA 4QIWN 2EQRA 3A01B 3CQZJ 2ELKA 3RZDJ 1QPIA 1NK2P 3GTQJ 2PMZN 5FLVA 1BJZA 2DA4A 1MBEA 3L1PA 2N8GA 5IYCJ 2DA1A 5EZGA 5FKMA 1XG1A 3HOZJ 5IPAA 5BNGA 2LFBA 1NTCA 1E3OC 3BG5A 4A69C 3O8GA 2CQQA 3QPSA 2H1KA 3PO3J 1IG7A 3M3YJ 4JX5A 5K7FA 3HGGA 2HXIA 3ZQFA 3BR0A 2LY9A 1U8BA 2JA7J 3GTMJ 2GLOA 2XGCA 2EZKA 1MBKA 4JYKA 1ETYA 5C4XJ 4XRSA 2CRGA 2R93J 1JJ6C 2E2IJ 2K9SA 1FIAA 3OIOA 3GTJJ 5J1YA 1XS9A 4A3GJ 2XGEA 3HB9A 4MO7A 3GBGA 2E2JJ 1G2HA 4GFBA 1AU7A 1ZR4A 3HEFA 3I4NJ 2E1OA 1YRNB 1BA5A 1QVTA 2KDZA 3QPLA 1X2NA 3ZQHA 2YS9A 1OFCX 3BR5A 5IOYA 3MKLA 3CDLA 5J1UA 3G1OA 1FEXA 3A01A 3GTLJ 3FK7A 5FLMJ 5IYBJ 2JA6J 2R5YB 1R9TJ 1Z0XA 4BY7J 4D7MA 2L9RA 3FKIJ 3OSFA 3TP0A 4M3FA 2MGQA 3Q3SA 4QTRA 3A02A 4CYCA 4MFDA 4RBOA 1B72B 4IHVA 1QVUA 4FISA 1ZQ3P 2DMTA 2FX0A 3GTGJ 2ECCA 3PO2J 2RAEA 1TWCJ 2WV1A 1IGNA 1HOMA 3C2BA 4A3JJ 5E3NA 4C3HJ 3JRGA 3HOUJ 4D5CA 2TCTA 1UG2A 4IHWA 1JUSA 4M6VA 2AHQA 4V2FA 3BG9A 5F0FA 3O8HA 1ZTRA 2VKEA 1I50J 4J19A 3RZOJ 1YRNA 2DTZA 2CUFA 2YU9J 1TC3C 1SANA 3K7AJ 1MNMC 2NVXJ 3JRAA 3JRIA 4AC0A 2CUEA 1Y1VJ 2VKVA 3FISA 3HGYA 3SFIA 2E2HJ 1OJLA 2EZIA 1DU6A 2JA8J 1ZGWA 1A6IA 1MBFA 1T33A 1ETOA 4DZPA 1JKQC 1UMQA 4B4CA 4FE4A 4A3MJ 4MFEA 1P7IA 2R5YA 1EF4A 5M3MJ 4XICA 2ID6A 2XRLA 2M34A 3CCYA 4W97A 1GV5A 1MSFC 3QQAA 4A3IJ 1ETKA 3JRCA 3TEDA 5FKKA 1JKPC 5F04A 2VI6A 4I6ZA 4I76A 1GDTA 3CMYA 2VPRA 2HOTA 5F0CA 3RQIA 2LLKA 1PUFB 1JTYA 2X9DA 4MLOA 3HOYJ 1RKTA 2NOGA 1W0TA 2P81A 5F1JA 1Z77A 3DEWA 5EG0B 2HOAA 3GTKJ 3M4OJ 4CYCB 4A3LJ 2JA5J 3VPRA 2GM4A 2R0QC 1JUPA 1IRZA 4HNVA 5J1RA 1TWAJ 3BTIA 5EZHA 1BW6A 2O8KA 4A93J 1VF9A 4XK4A 2DMNA 2FJ1A 3GTOJ 1WGXA 3ZQIA 3TW6A 1TWGJ 1ETVA 4IEJA 2DJNA 3SJMA 2WAQN 1W0UA 3D1NI 1ETWA 3TW7A 1JJ8C 1IV6A 1DU0A 3B6AA 1ETQA 3WHCA 3IH3A 1D5YA 2NVQJ 1ENHA 1H88C 1F43A 3IH4A 4BBRJ 2B63J 2XB0X 1K61A 4FCYA 2DN0A 2JMWA 1PUFA 1JKOC 4DYRA 2EZHA 4DYCA 3IV5A 3H3VK 3BQYA 2NVTJ 1RESA 1NK3P 2Y0SN 1BW5A 1POGA 1WH5A 2NS7A 3JR9A 3JREA 2R92J 5GPCA 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTZ A;  1I3Q J;  4S0H B;  4V2G A;  2K40 A;  3BT9 A;  3BR6 A;  4G12 A;  2LP0 A;  1ZK8 A;  5IYD J;  3ZQG A;  3RKQ A;  3BTC A;  2DA2 A;  3WHB A;  3LSP A;  5FKN A;  2JK3 A;  2EZL A;  3BR1 A;  4UUS A;  2Y9Z A;  3GTP J;  2HI3 A;  1TWF J;  2DMP A;  1JTX A;  3HBL A;  3S16 J;  4W1U A;  5EDN A;  1H89 C;  4IHX A;  5K7H A;  2XPW A;  2CJJ A;  2TRT A;  2I10 A;  5E3M A;  4XRS G;  2JJ7 A;  5HOD A;  5EGO B;  2W48 A;  3S15 J;  1ZKG A;  3LSG A;  1WH7 A;  2OPT A;  4M3G A;  3HOX J;  5C4J J;  5F27 A;  3JRB A;  2LD5 A;  5IP7 J;  1U9O A;  1IDY A;  1BL0 A;  1F36 A;  1O4X A;  3F0C A;  2DMU A;  2MW8 A;  1RPW A;  3E7L A;  2OF7 A;  4JX4 A;  2Y9Y A;  4XRM A;  2K9Q A;  5GPA A;  3S14 J;  2HXO A;  1QRY A;  2MSY A;  1MBJ A;  2LTP A;  1I6H J;  2X48 A;  1JKR C;  2Y30 A;  4FE7 A;  3BR2 A;  4M3B A;  2ID3 A;  3ZQL A;  4M3E A;  4XID A;  4Y7N J;  3W6V A;  4X6A J;  1VFC A;  1X58 A;  2AO9 A;  3K2A A;  4MIM A;  1LFU P;  3SDG A;  1JGG A;  2YUS A;  4C3J J;  3BR3 A;  4A3K J;  1P7J A;  2E19 A;  2R7Z J;  2HDD A;  1GVD A;  3MN2 A;  3JRD A;  3NAU A;  1T56 A;  2MG4 A;  1RET A;  1OCT C;  2FD5 A;  5IOZ A;  2JN6 A;  5DS9 A;  4A3E J;  1AKH A;  2VUM J;  5EGO A;  1WCM J;  2ECB A;  1RR7 A;  2DA7 A;  3HOV J;  1LE8 A;  3JRH A;  2LVS A;  4BBS J;  5GP9 A;  2G0E A;  2M0C A;  2CQX A;  3G1L A;  3BTL A;  1Y1W J;  5JLW A;  4BY1 J;  4JP0 A;  3S1Q J;  1IDZ A;  3H0G J;  3BQZ A;  3BG3 A;  4L5E A;  3JRF A;  2DA3 A;  4UUS B;  4LOC A;  3BTJ A;  4FTH A;  1JUM A;  5FKL A;  2D5V A;  3G1M A;  2LKX A;  5JLX A;  1LFB A;  1JT0 A;  4DW6 A;  2K9N A;  1IUF A;  3LNQ A;  4NDL A;  1AHD P;  1B8I A;  5M5X J;  3S1R J;  1IJW C;  1UHS A;  3S1N J;  4AYB N;  4BKX A;  3A03 A;  5C3E J;  2HOS A;  3Q0U A;  5E3L A;  4DYQ A;  1IC8 A;  1WPK A;  2L7F P;  1MSE C;  3HDD A;  3S2D J;  2L7M P;  3FK6 A;  4QSH A;  1FJL A;  1XC5 A;  1ITY A;  5M5Y J;  1GV2 A;  2XB5 A;  3S1M J;  3IH2 A;  1TWH J;  3Q0W A;  2DMQ A;  1CQT A;  3FIW A;  2GBY A;  3UKG A;  1VND A;  3NAR A;  2Y2Z A;  3Q0V A;  5F0H A;  1APL C;  2R5Z B;  3LSR A;  5EEA A;  5F08 A;  2O7O A;  2HYJ A;  2XGD A;  1HLV A;  2KT0 A;  2ME6 A;  2L0K A;  3TP3 A;  5C44 J;  1OCP A;  1MH4 A;  2LK2 A;  4A3F J;  2WB1 N;  2FQ4 A;  9ANT A;  1GT0 C;  4A3B J;  2O9L A;  1FTT A;  1U9N A;  5DTD A;  1ORK A;  2JWT A;  2ME0 A;  1GUU A;  1WI3 A;  2ZB9 A;  5IP9 J;  1ZR2 A;  1K83 J;  5J3L A;  2M9H A;  4A3C J;  2IEK A;  1HDP A;  5FKO A;  4AUX A;  1HCR A;  1AKH B;  2CU7 A;  4UUT A;  3B6C A;  2Y31 A;  3OSG A;  1HF0 A;  5FJ8 J;  5K7Z A;  1LE8 B;  1U78 A;  4C2M J;  1Q1V A;  3S17 J;  1MBH A;  4BXX J;  2LR8 A;  2HQ5 A;  4B3A A;  2EH3 A;  2NVY J;  1ETX A;  3PM1 A;  2EBI A;  1VI0 A;  3LOC A;  3ZOB A;  2XSD C;  4M3D A;  5EYR A;  3HKZ N;  2X6O A;  3LSJ A;  3OOU A;  1MH3 A;  2R5Z A;  2NS8 A;  1B8I B;  2IBD A;  4D5F A;  1FIP A;  3HM5 A;  1JT6 A;  2COB A;  3MVP A;  5EF6 A;  2L7Z A;  4C3I J;  2M8G X;  1SFO J;  4A3D J;  5M3F J;  2QF7 A;  3HOW J;  2XPV A;  1MBG A;  5IP6 A;  4Y52 J;  2QCO A;  1A5J A;  4X1E A;  1HDD C;  1X2M A;  4D7N A;  1H8A C;  3I4M J;  1B72 A;  5M5W J;  2IAI A;  4JX6 A;  4ABZ A;  4EEF G;  3S2H J;  4B1R A;  3DCF A;  4RDU A;  2XPU A;  4DZJ A;  4IHY A;  2DA6 A;  2H8R A;  3ZQC A;  2DA5 A;  5E3O A;  1RKW A;  2M2E A;  1S7E A;  4QIW N;  2EQR A;  3A01 B;  3CQZ J;  2ELK A;  3RZD J;  1QPI A;  1NK2 P;  3GTQ J;  2PMZ N;  5FLV A;  1BJZ A;  2DA4 A;  1MBE A;  3L1P A;  2N8G A;  5IYC J;  2DA1 A;  5EZG A;  5FKM A;  1XG1 A;  3HOZ J;  5IPA A;  5BNG A;  2LFB A;  1NTC A;  1E3O C;  3BG5 A;  4A69 C;  3O8G A;  2CQQ A;  3QPS A;  2H1K A;  3PO3 J;  1IG7 A;  3M3Y J;  4JX5 A;  5K7F A;  3HGG A;  2HXI A;  3ZQF A;  3BR0 A;  2LY9 A;  1U8B A;  2JA7 J;  3GTM J;  2GLO A;  2XGC A;  2EZK A;  1MBK A;  4JYK A;  1ETY A;  5C4X J;  4XRS A;  2CRG A;  2R93 J;  1JJ6 C;  2E2I J;  2K9S A;  1FIA A;  3OIO A;  3GTJ J;  5J1Y A;  1XS9 A;  4A3G J;  2XGE A;  3HB9 A;  4MO7 A;  3GBG A;  2E2J J;  1G2H A;  4GFB A;  1AU7 A;  1ZR4 A;  3HEF A;  3I4N J;  2E1O A;  1YRN B;  1BA5 A;  1QVT A;  2KDZ A;  3QPL A;  1X2N A;  3ZQH A;  2YS9 A;  1OFC X;  3BR5 A;  5IOY A;  3MKL A;  3CDL A;  5J1U A;  3G1O A;  1FEX A;  3A01 A;  3GTL J;  3FK7 A;  5FLM J;  5IYB J;  2JA6 J;  2R5Y B;  1R9T J;  1Z0X A;  4BY7 J;  4D7M A;  2L9R A;  3FKI J;  3OSF A;  3TP0 A;  4M3F A;  2MGQ A;  3Q3S A;  4QTR A;  3A02 A;  4CYC A;  4MFD A;  4RBO A;  1B72 B;  4IHV A;  1QVU A;  4FIS A;  1ZQ3 P;  2DMT A;  2FX0 A;  3GTG J;  2ECC A;  3PO2 J;  2RAE A;  1TWC J;  2WV1 A;  1IGN A;  1HOM A;  3C2B A;  4A3J J;  5E3N A;  4C3H J;  3JRG A;  3HOU J;  4D5C A;  2TCT A;  1UG2 A;  4IHW A;  1JUS A;  4M6V A;  2AHQ A;  4V2F A;  3BG9 A;  5F0F A;  3O8H A;  1ZTR A;  2VKE A;  1I50 J;  4J19 A;  3RZO J;  1YRN A;  2DTZ A;  2CUF A;  2YU9 J;  1TC3 C;  1SAN A;  3K7A J;  1MNM C;  2NVX J;  3JRA A;  3JRI A;  4AC0 A;  2CUE A;  1Y1V J;  2VKV A;  3FIS A;  3HGY A;  3SFI A;  2E2H J;  1OJL A;  2EZI A;  1DU6 A;  2JA8 J;  1ZGW A;  1A6I A;  1MBF A;  1T33 A;  1ETO A;  4DZP A;  1JKQ C;  1UMQ A;  4B4C A;  4FE4 A;  4A3M J;  4MFE A;  1P7I A;  2R5Y A;  1EF4 A;  5M3M J;  4XIC A;  2ID6 A;  2XRL A;  2M34 A;  3CCY A;  4W97 A;  1GV5 A;  1MSF C;  3QQA A;  4A3I J;  1ETK A;  3JRC A;  3TED A;  5FKK A;  1JKP C;  5F04 A;  2VI6 A;  4I6Z A;  4I76 A;  1GDT A;  3CMY A;  2VPR A;  2HOT A;  5F0C A;  3RQI A;  2LLK A;  1PUF B;  1JTY A;  2X9D A;  4MLO A;  3HOY J;  1RKT A;  2NOG A;  1W0T A;  2P81 A;  5F1J A;  1Z77 A;  3DEW A;  5EG0 B;  2HOA A;  3GTK J;  3M4O J;  4CYC B;  4A3L J;  2JA5 J;  3VPR A;  2GM4 A;  2R0Q C;  1JUP A;  1IRZ A;  4HNV A;  5J1R A;  1TWA J;  3BTI A;  5EZH A;  1BW6 A;  2O8K A;  4A93 J;  1VF9 A;  4XK4 A;  2DMN A;  2FJ1 A;  3GTO J;  1WGX A;  3ZQI A;  3TW6 A;  1TWG J;  1ETV A;  4IEJ A;  2DJN A;  3SJM A;  2WAQ N;  1W0U A;  3D1N I;  1ETW A;  3TW7 A;  1JJ8 C;  1IV6 A;  1DU0 A;  3B6A A;  1ETQ A;  3WHC A;  3IH3 A;  1D5Y A;  2NVQ J;  1ENH A;  1H88 C;  1F43 A;  3IH4 A;  4BBR J;  2B63 J;  2XB0 X;  1K61 A;  4FCY A;  2DN0 A;  2JMW A;  1PUF A;  1JKO C;  4DYR A;  2EZH A;  4DYC A;  3IV5 A;  3H3V K;  3BQY A;  2NVT J;  1RES A;  1NK3 P;  2Y0S N;  1BW5 A;  1POG A;  1WH5 A;  2NS7 A;  3JR9 A;  3JRE A;  2R92 J;  5GPC A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 2D2W A;  1DDN A;  3OYB A;  3DPT A;  3SFZ A;  3CD6 I;  1FOX A;  1T38 A;  1G3T A;  1U0J A;  2K40 A;  1ZGA A;  2LP0 A;  1HW5 A;  1WJC A;  4BJ6 C;  4X0G A;  3CMM A;  3GME A;  5IYD J;  3RKQ A;  2MFZ A;  2OQR A;  3LSP A;  2DDB A;  5FKN A;  1GXP A;  3CDH A;  2IT0 A;  1IV8 A;  3CO7 C;  4E4H A;  1R4M B;  3DLA A;  4M73 A;  4YFN F;  2Y9Z A;  1BC8 C;  1JHH A;  5E20 A;  2DMP A;  1JTX A;  4E7Z A;  3OYF A;  4IOA F;  3GVA A;  5K7H A;  2Z5U A;  2QKM B;  4KT5 C;  4C30 A;  3H9J A;  1ZAO A;  2P5L C;  1Z05 A;  3F21 A;  3SXY A;  4A12 A;  2I8D A;  1PYV A;  3HOX J;  1WH7 A;  4A6D A;  3MKY B;  4G7O F;  2KPM A;  4I2O A;  1G3W A;  5IP7 J;  1ERD A;  4HLY A;  2EFW A;  2K3P A;  3OIQ A;  3F0C A;  1UJ8 A;  3I0T A;  5LFA A;  2DCE A;  3W6K B;  2BZT A;  1HKT A;  2QKL B;  1EKE A;  4EGY A;  5CPR B;  3G71 I;  2OUM A;  3EYI A;  2NXN B;  1D8J A;  2P5K A;  1Z3Y A;  1QRY A;  2MSY A;  3AL0 C;  5HS8 A;  2ZJR F;  1I6H J;  3SZT A;  5GAH J;  2CGP A;  1RIO H;  2OTJ I;  1QGP A;  2MH9 A;  1I6X A;  4FE7 A;  3ZPL A;  3BR2 A;  1LVA A;  1WJB A;  4M3B A;  2ID3 A;  1XX5 A;  3WG7 H;  4M3E A;  3J81 Z;  4Y7N J;  1MMD A;  3K2A A;  1LFU P;  4HPQ A;  1ACI A;  1MJB A;  1J2X A;  3TOA A;  2XAJ A;  2E1C A;  1X1A A;  1JGS A;  3CCQ I;  1K79 A;  2HDD A;  4JK1 X;  3JRD A;  3NAU A;  1W36 C;  3ZMZ A;  5FRO A;  1P9Q C;  1PP8 F;  3PSF A;  2BBY A;  4A3E J;  4IQ4 A;  5AIP A;  3RI4 A;  1P6R A;  2PJR B;  4RAZ A;  1UHM A;  2RNJ A;  3HOV J;  1LE8 A;  5GP9 A;  1J9I A;  3I59 B;  3G1L A;  3PQJ A;  4LIU A;  4M74 A;  5ILV A;  2QQ9 A;  1IDZ A;  1YJ9 I;  4L5E A;  2VOD A;  4UUS B;  5E17 F;  1JUM A;  1T0F C;  2GWR A;  2W24 A;  5FKL A;  2GXA A;  3ZQQ A;  2ZO4 A;  1BIA A;  2BY0 A;  2XAF A;  3BZC A;  3G1M A;  3IC7 A;  3D5R C;  4XON A;  5JLX A;  2LKX A;  1QA6 A;  3FF5 A;  2K9N A;  1LQ1 A;  1IUF A;  4HF1 A;  1WWX A;  4NDL A;  4ZJZ A;  2QLZ A;  3FXL A;  4KJZ A;  4HZF A;  3CP2 A;  2WAD A;  4AYB N;  2Q2E A;  2W1O A;  5BPI A;  4H4K C;  1R58 A;  1VQ7 I;  1E3H A;  3HG9 A;  2Y69 H;  3HDD A;  3S2D J;  4QSH A;  1XCV A;  1FZP B;  3MAJ A;  4IXA A;  1MMG A;  5M5Y J;  2H27 A;  1V5G A;  3S1M J;  1Q1H A;  3CTA A;  2BW3 A;  3Q0W A;  2DMQ A;  1F1Z A;  4O5V A;  3ZN1 A;  4YG2 F;  3A0B C;  2STW A;  1BOA A;  2VC0 A;  1ZRE A;  1VND A;  3PL8 A;  3R6S A;  2R7U A;  2UWM A;  2Y2Z A;  2F5D A;  3Q0V A;  3BG6 A;  3SEQ A;  3LSR A;  2KL4 A;  5F08 A;  5EEA A;  3PIP F;  2O7O A;  4MHG A;  2EFP A;  3FMS A;  5CVR A;  4RLQ A;  4PFO A;  2ME6 A;  3TP3 A;  2LK2 A;  2VXZ A;  3IWZ A;  1XMA A;  1EA3 A;  2WB1 N;  1KYW A;  1YIO A;  3PUB A;  3SHF A;  2XAH A;  1YOV B;  2W57 A;  1B6A A;  3K4M A;  1FTT A;  3J7A Y;  1WZ2 A;  1ZR2 A;  4ZH4 F;  4I09 A;  1LDJ A;  1X1C A;  2EV5 A;  3TL4 X;  1B1B A;  1Y0N A;  1STZ A;  1Y39 A;  5J3L A;  3ZMS A;  2XRN A;  5CJ9 A;  5AIQ A;  4AUX A;  1KQ8 A;  3N4M A;  1HCR A;  1TZL A;  4MQV A;  4EM2 A;  1IW7 F;  1YW8 A;  1IN8 A;  3K70 D;  1B4A A;  3JCU C;  1QZZ A;  1CF7 B;  5IT9 Z;  1S7O A;  4KIT B;  1WJ5 A;  1A36 A;  2IVM A;  2XKP A;  1XDS A;  3ML6 A;  3ABK H;  2NVY J;  2YX4 A;  4XN3 A;  1ETX A;  3LOC A;  3TMO A;  3ZOB A;  2EA4 A;  5K5Q A;  1NH3 A;  1K4S A;  2DDA A;  4XLN F;  4RB2 C;  2HYF A;  4L5I A;  5HS7 A;  1Y56 A;  2Y48 A;  1VQN I;  1QQI A;  3TBI A;  2GQQ A;  5FLX Z;  3WTX C;  1I3A A;  2A6T A;  1B8I B;  3GLX A;  3OR2 C;  5H6Q A;  2H8W A;  2IBD A;  2K85 A;  1FIP A;  3HM5 A;  2COB A;  3AG4 H;  3WOD F;  2L7Z A;  3G2B A;  1VQ6 I;  2BXZ A;  2Z99 A;  4N9I A;  5M3F J;  2FOW A;  1OKR A;  3QPT A;  5HLI A;  3ONQ A;  2ETH A;  2JT1 A;  2XPV A;  3HZJ A;  3I71 A;  4OIQ F;  5IP6 A;  1UHW A;  2JUG A;  4IHT A;  1X2M A;  4CSW A;  3I4M J;  3K70 C;  3OYK A;  5M5W J;  4ABZ A;  1HW2 A;  1R36 A;  4BEH B;  1I1G A;  4EEF G;  3PFY A;  1VQ9 I;  4RDU A;  4AYB A;  4U0W A;  2AXT C;  2P5V A;  4UHT A;  3ZQC A;  5HDN A;  3CLO A;  2LMD A;  3RPQ A;  5E8I A;  1PP7 U;  2EQR A;  1IRX A;  5E1Z B;  2DYR H;  4WXH A;  2OTL I;  2ELK A;  4KFC A;  1BI1 A;  1QPI A;  3M07 A;  2L9S A;  3L2Q A;  1F4K A;  4PZJ A;  2ZME C;  4PJM A;  2DA4 A;  1N78 A;  5IYC J;  3FWE A;  3CC7 I;  1X1D A;  2KZV A;  2CW7 A;  3UNG C;  1U8R A;  3R4K A;  4A69 C;  1FNN A;  5IT3 A;  2X6W A;  2QSG X;  3QPS A;  3FHZ A;  2BY3 A;  3PNY A;  1HSJ A;  2TDX A;  1IG7 A;  2L3D A;  5DCM B;  1S5L C;  1Z1D A;  4IZZ A;  2GXB A;  4Q4Z F;  3K4L A;  3K69 A;  1MDM A;  3U1D A;  4HX8 A;  4XKW A;  4JYK A;  3KCC A;  3C7J A;  3H9G A;  1MMA A;  2LDU A;  2F6C A;  4A0X A;  4CXF A;  2E2I J;  1RUN A;  2KHM A;  2QA4 I;  3GO5 A;  4KT6 A;  4F91 B;  2XGE A;  1XMX A;  3FKJ A;  3HB9 A;  4A3G J;  2K5C A;  3GBG A;  3M9A A;  4LK0 F;  3VSL A;  2E1O A;  1YRN B;  4J01 A;  2V1X A;  2BGC A;  1WKM A;  2YS9 A;  3BR5 A;  1OFC X;  2VBY A;  2CS3 A;  3K1N A;  5ICF A;  3MKL A;  1QZY A;  3CDL A;  3F8F A;  3G1O A;  2ZXW H;  2CYY A;  3HUG A;  3OIP A;  5J1U A;  1T2K A;  3U21 A;  3A01 A;  5D6E A;  5DD8 A;  3FK7 A;  4B09 A;  1LPQ A;  2CG4 A;  3DXJ F;  1DP7 P;  2HQA A;  5KVR A;  4HAM A;  3JAM Z;  1W7P D;  1Z0X A;  1ZN2 A;  5HNF A;  2KMU A;  3T8R A;  2L9R A;  3FKI J;  4KMU X;  2VE9 A;  3H3U A;  4M3F A;  3Q3S A;  2UUZ A;  5EEH A;  1B72 B;  3D0S A;  3F6O A;  1SD5 A;  2GOM A;  4FHT A;  2O8X A;  2LH9 A;  2OZU A;  4U87 A;  4FAS D;  1OMI A;  4WWC A;  3OY9 A;  2ECC A;  1OQY A;  3WTZ A;  4RGS A;  4XKB A;  3JRG A;  5H6R A;  1K7A A;  4IHW A;  3S3O A;  2VON A;  6PAX A;  5HDK A;  1BN5 A;  1FLI A;  4ZC3 A;  4V2F A;  3BG9 A;  3DBH B;  4NC8 A;  4UY8 I;  2R3S A;  2AQE A;  2DOF A;  2ISY A;  3HTU A;  4B44 A;  4J19 A;  2DTZ A;  5ICC A;  1Z6R A;  2CUF A;  4HDU A;  1TC3 C;  2YU9 J;  2DT6 A;  4OMZ A;  5B3S H;  3JRI A;  3KEQ A;  2E60 A;  4AC0 A;  1OYI A;  4KUM A;  3SFI A;  1UAA A;  2AQF A;  2YX7 A;  3CUQ C;  3FXO A;  4PJL A;  2EZI A;  1K78 B;  3IUO A;  1DU6 A;  2VQG A;  1A6I A;  5KK1 A;  4L9J A;  4DZP A;  1UMQ A;  1PDN C;  3WE3 A;  3CJR B;  3QOE A;  2E5Z A;  3PSI A;  2E71 A;  1J0R A;  5FFZ A;  1YLF A;  2FNP A;  4PJJ A;  3V8L A;  2R5Y A;  1EF4 A;  4XM3 A;  2IGN A;  2XRL A;  2CUZ A;  2JRM A;  4Y17 A;  1Y8R B;  3AFH A;  3OYN A;  1GV5 A;  1LUJ B;  3OYH A;  2HEO A;  2Q8K A;  3MZY A;  3I56 I;  2Z33 A;  3MCZ A;  2R7Q A;  1X3Z B;  3MZH A;  1H0M A;  2P7C B;  1TW2 A;  2MD5 A;  3ZQ7 A;  4I76 A;  2VBZ A;  3O2P E;  1R5G A;  4YIF A;  5L3E A;  4CUG A;  2XDV A;  1BR4 A;  3EUH A;  2IA1 A;  1TLH B;  2HOE A;  1WJA A;  3HOY J;  1ZRF A;  2COM A;  2P81 A;  3F8M A;  2L02 A;  2YSR A;  4BHB A;  4RMN A;  5F1J A;  4FX4 A;  4ENK A;  3DEW A;  5L3G A;  4EJU A;  1VTN C;  2VOP A;  3MD2 A;  4YEJ A;  4EAT A;  4CYC B;  2JA5 J;  4HF2 A;  1R1U A;  4ZDP A;  2R0Q C;  3KP2 A;  1RRJ A;  1W5T A;  2HFH A;  4AIH A;  4UB6 C;  3LA7 A;  2BEO A;  1MZB A;  1DGR M;  1V4R A;  1W7P B;  3AKZ A;  1HW1 A;  4LGW A;  4CDG A;  4IRH A;  3LA3 A;  1QPM A;  5GTI C;  3TW6 A;  5FO5 A;  2G9W A;  2R7T A;  3Q9V A;  5EEG A;  2WAQ N;  2KKO A;  1Y8Q B;  4XLC A;  3VYR B;  4XOR A;  3EYY A;  3TW7 A;  4AIK A;  1BBY A;  2WV0 A;  1DU0 A;  4ZDL A;  1V5E A;  4UNO A;  4LK1 F;  2HVS A;  1ENH A;  4ASN A;  4KN7 X;  1H88 C;  1FP2 A;  1GXQ A;  4UB8 C;  4E7J A;  2A5W A;  3KP7 A;  2B63 J;  3QP6 A;  5DEQ A;  3J7Z I;  1S8N A;  1U5T A;  4DYR A;  3BQY A;  3CF5 F;  1DP3 A;  4YEL A;  3F72 A;  2WAE A;  3JR9 A;  2NS7 A;  1ONV A;  2R92 J;  5GPC A;  5EG0 A;  3PFI A;  4CCK A;  4ENN A;  2ZSH B;  5JI6 A;  4S0H B;  4HBL A;  4RAF A;  4V2G A;  3BT9 A;  2PJR A;  2X6Y A;  4L18 B;  1R6R A;  1WRJ A;  2L9N A;  4B47 A;  3ZQG A;  1T08 B;  2MLK A;  3BTC A;  4CCL A;  3OYC A;  2RNG A;  1UB9 A;  3L2U A;  4U0Y A;  5E18 F;  4UUS A;  3GTP J;  4EQQ A;  4L5J A;  2M87 A;  3BJ6 A;  2QGU A;  1J09 A;  3BPV A;  3GF2 A;  2CJJ A;  2VAS A;  3K4C A;  4XN0 A;  4KNY A;  3KYC B;  3FXK A;  3DPL C;  4GDF A;  5EGO B;  3VFZ A;  2W48 A;  3S8P A;  2F5F A;  3DQV C;  3T0Y A;  3BC8 A;  3JRB A;  4L9T A;  4A0Z A;  5CVU A;  2CQK A;  2F5C A;  4GXO A;  1UST A;  1O4X A;  1IF1 A;  1T6S A;  1R1V A;  4BXU A;  2DMU A;  4I99 C;  2MD0 A;  4YIR X;  1YQA A;  3CUO A;  4ZZD A;  4ZYA A;  2BVL A;  4II2 A;  1X1B A;  2K9Q A;  2L7K A;  3AG2 H;  3VYU B;  3V4G A;  1R5I D;  1RR8 C;  1J75 A;  1A6Q A;  4ESJ A;  2X48 A;  3HSF A;  3HXL A;  2E36 A;  2M30 A;  2Y30 A;  1FSH A;  1FPQ A;  4ON0 A;  3GZ6 A;  4LIV A;  1FP1 D;  4XR6 A;  1IRF A;  4HG2 A;  5TJJ A;  2EV0 A;  4XQF A;  3NRV A;  1X58 A;  3WGH A;  5FFX A;  1JGG A;  2HDC A;  2PEX A;  4A3K J;  2R7Z J;  2VJ5 A;  1E2X A;  2CW0 F;  1FOY A;  2VL8 A;  1T56 A;  2H94 A;  1RET A;  3BLY A;  4D0P A;  1OCT C;  2JN6 A;  3IAM 2;  2VUM J;  5BQT A;  1WCM J;  2DTR A;  1CF7 A;  3H5A A;  3IKV A;  2DA7 A;  3LSM A;  3P9C A;  4LJZ F;  3W2W A;  3JRH A;  1QHG A;  4RAY A;  4P1W A;  2G0E A;  3W6J B;  5K1Y A;  2DW4 A;  5LEK A;  5JLW A;  4BY1 J;  4JP0 A;  1IN5 A;  4DNC A;  2M7B A;  1KA8 A;  1E0E A;  1SVM A;  4FX0 A;  3H0G J;  3BQZ A;  3BG3 A;  4MTD A;  3JRF A;  1ZRC A;  3GW2 A;  3BTJ A;  3ECO A;  4BAY A;  1SFE A;  4ESB A;  2NAZ A;  3OYA A;  3M1C A;  1BI0 A;  3RSN A;  2DXI A;  2FRH A;  1JT0 A;  1MMS A;  2CV0 A;  2R7R A;  1B8I A;  5K5R A;  3S1R J;  1IN4 A;  1UHS A;  3S1N J;  2LRD A;  5H2F C;  2DFH A;  3A03 A;  3R0A A;  5C3E J;  2KP6 A;  3Q0U A;  2E5N A;  4DYQ A;  4E7L A;  1WJF A;  1KU3 A;  1BI2 A;  1VZ0 A;  1SFU A;  1KQ9 A;  5DV5 A;  2NNY A;  2LY2 A;  5D6F A;  1R4N B;  3WU2 C;  1W1W E;  1GV2 A;  2RDP A;  2XB5 A;  2HS5 A;  1TWH J;  2E7W A;  3CO6 C;  1X1P A;  4BEH A;  3ESW B;  3FIW A;  3UKG A;  4BQA A;  1I5Z A;  2W25 A;  3G3Z A;  5F0H A;  1APL C;  2R5Z B;  2FUG 2;  3TDU C;  3DTE A;  5GAG J;  3WTW C;  3Q9S A;  3CZ6 A;  4MTE A;  2GIV A;  1HLV A;  1UEL B;  1YJW I;  2K4J A;  2L0K A;  2RRE A;  1OCP A;  2A68 F;  5JVT A;  1KON A;  4IOC F;  2FQ4 A;  9ANT A;  1WQ2 A;  1EH6 A;  3BG7 A;  2D45 A;  2O9L A;  3DEU A;  1U9N A;  3KYL A;  2J5O A;  5IP9 J;  1LB2 A;  1K83 J;  3IRR A;  1P4W A;  4BE1 A;  1MIJ A;  2M9H A;  4A3C J;  1HDP A;  4Q5S F;  2CSO A;  1X4O A;  3ZRG A;  3BY6 A;  4B43 A;  3J81 K;  5DCM A;  1ON1 A;  3B6C A;  5LGN A;  4L9V A;  3PUF A;  1W36 D;  3H35 A;  5K7Z A;  1W5C C;  1U78 A;  3BWG A;  2X6X A;  3JSP A;  4IHS A;  1U5T C;  5AON A;  1QHH D;  1BI3 A;  2QSH X;  2L4M A;  1I27 A;  4HEA 2;  4ZYG A;  2BY1 A;  2LR8 A;  4IJA A;  2DT5 A;  1VQP I;  1X4P A;  4YFK F;  2JVH A;  3QWL A;  3MKZ A;  3ELK A;  3QYB A;  1YX3 A;  1RNL A;  2ZXH A;  3P9I A;  3J80 Z;  3HHG A;  1Z7L A;  3FXR A;  1XDU A;  3KP6 A;  3L2C A;  4DIQ A;  2OAZ A;  4NC6 A;  3Q5F A;  2Z3Y A;  2UXN A;  1IUY A;  3CJT B;  3HSR A;  3MVP A;  4KIF A;  5EF6 A;  3FBI B;  1LEB A;  4B8X A;  2QF7 A;  2XAU A;  2F5E A;  2P4W A;  2IS6 A;  3CDI A;  5L3C A;  3A0H C;  1WJE A;  1R22 A;  1MNE A;  5D5W B;  2VB6 A;  2QCO A;  2FU4 A;  2ISZ A;  1LJ9 A;  1TQM A;  2E1M C;  2EK5 A;  1OLT A;  3M7G A;  5CQE A;  5F6F A;  4AU7 A;  1B72 A;  1U6G A;  4IRI A;  3S2H J;  4B1R A;  2KIM A;  3LFK A;  4UXN A;  1B59 A;  4NUB A;  2XPU A;  3DKY A;  4IHY A;  5HDG A;  5DUK A;  2QZ8 A;  2H8R A;  2M4K A;  2DA5 A;  2RQP A;  5E3O A;  1XPX A;  1S3J A;  3MMY B;  3WE2 A;  1S7E A;  1V55 H;  1JXS A;  1BR1 A;  3CQZ J;  3RZD J;  2WWY A;  5FLV A;  2HNH A;  4KIC A;  3DKW A;  2I5U A;  4RM2 A;  2N8G A;  2VKH A;  2DA1 A;  3RCO A;  5D4S A;  2FBK A;  3DV8 A;  2EIN H;  2X0L A;  1E3O C;  2AXL A;  2LNB A;  2Q0O A;  3L2R A;  2V6C A;  3AL0 B;  5LD2 C;  2FA5 A;  1D1A A;  2H1K A;  2HQR A;  4C2U A;  1RUO A;  3CC2 I;  5K7F A;  3HGG A;  3LL7 A;  3ZQF A;  2ZSI B;  2GZW A;  4UV9 A;  5KHD A;  1T39 A;  1U8B A;  2RVC A;  3GTM J;  4I98 B;  2ZNZ A;  2A61 A;  1S9H A;  2L2O A;  4XRS A;  4BH9 A;  1IXR C;  1OYW A;  1E3P A;  4ITV A;  4S04 A;  3GTJ J;  3LSK A;  3D5L A;  5J1Y A;  1XS9 A;  2KDO A;  2ELH A;  3ROU A;  1YIT I;  3K9T A;  2E2J J;  2JPC A;  2M4G A;  4P96 A;  2E34 A;  3I4N J;  1HA8 A;  2HQN A;  1BA5 A;  2KDZ A;  1KU9 A;  5CQG A;  5J40 A;  4LB6 B;  4PDK A;  3ZQH A;  4OOI A;  2LBF B;  4ZYH A;  5DDG A;  3I4P A;  1RC9 A;  2Y0M A;  4PJ0 C;  3COA C;  3OYE A;  1I39 A;  1FEX A;  2XGX A;  3PNV A;  2PQ8 A;  2NYX A;  3CME I;  4OAZ A;  3GTL J;  1SAU A;  2K02 A;  5L3D A;  3F8B A;  3SZP A;  5IYB J;  2QBY B;  4BHP A;  1U2W A;  1HC8 A;  3OOP A;  3E6C C;  1R9T J;  3ERE D;  3OSF A;  4CYC A;  2HDW A;  1YW9 A;  2XHK A;  4LG3 A;  4RGU A;  1LKX A;  3M8J A;  4A5M A;  5E8G A;  3CJQ B;  5J6X A;  2P0W A;  1TWC J;  2ZXJ A;  1IGN A;  3DWL E;  2LF7 A;  3VOE A;  2VXD A;  1IO2 A;  3HOU J;  4HF0 A;  2TCT A;  1UG2 A;  2M1B A;  2H6B A;  3KZY A;  2O3F A;  2X4H A;  5LGT A;  4KIG A;  3F3X A;  2AHQ A;  5JHU A;  1U3E M;  1VQL I;  2HWV A;  4I0A A;  3O8H A;  1IXC A;  5TRD A;  1I50 J;  3OYM A;  3R0J A;  2ZNY A;  4QLC U;  1R71 A;  2B0L A;  4EMS A;  1AOY A;  1MNM C;  2NVX J;  4LLL A;  4DQ2 A;  1R7J A;  2CUE A;  1Y1V J;  2E2H J;  3FIS A;  3DU5 A;  1OJL A;  1XGN A;  4HSR A;  1MBF A;  5J4V A;  2Y75 A;  3E6B A;  3BZ6 A;  2VC1 A;  3K1M A;  4RA2 A;  3VYS B;  4A93 J;  1P4A A;  5L3F A;  4KA4 A;  2IRF G;  1NG7 A;  3KYD B;  4O3M A;  2XKO A;  3CCY A;  1EH8 A;  3KPH A;  4HV5 A;  2DFI A;  2ZFW A;  1MSF C;  4B3X A;  3QQA A;  2ZJQ F;  1ETK A;  1XGO A;  3KP4 A;  4A3I J;  3TED A;  3H9Q A;  2RV8 A;  1P92 A;  3RTR A;  2DOD A;  2OCC H;  3SEZ A;  4I6Z A;  2BHZ A;  4KIB A;  1GDT A;  1OPC A;  3K1P A;  4RS8 A;  3HRM A;  2KLO A;  1QO0 D;  2IGM A;  4ZYE A;  4MLO A;  1RKT A;  1FYK A;  5J47 A;  2NOG A;  1ZH5 A;  4C2T A;  3WTY C;  3I54 A;  4Y4R A;  1O3T A;  1Z77 A;  2HZT A;  4YRV A;  1N75 A;  2V7F A;  1GVJ A;  3IRQ A;  3CCU I;  2HOA A;  4Y15 A;  2YU3 A;  4A3L J;  2OA4 A;  4II3 A;  4HNV A;  4RGR A;  4CZZ A;  2L01 A;  5DD4 A;  3BTI A;  3FMQ A;  3GXO A;  4GRI A;  3K4J A;  2VBW A;  2XUB A;  2KRF A;  4PGG A;  5GAD J;  2LY1 A;  4XK4 A;  4XLP F;  2Y0S A;  1MGT A;  2V9P A;  3JAM K;  5FRN A;  2KIU A;  1WGX A;  1G3S A;  2PFB A;  3PQK A;  3ZQI A;  3BDD A;  3UR3 C;  2WY8 Q;  3VSK A;  2B7E A;  2A3S A;  2DT7 B;  2ICW G;  3SJM A;  1IN6 A;  2EIL H;  3SDB A;  3ZGK A;  1JJ8 C;  1FMW A;  1ZG3 A;  2FSW A;  1H9G A;  2XAS A;  3VEP A;  3WHC A;  3IH3 A;  2DOE A;  1D5Y A;  2OJE D;  2NVQ J;  1Z9C A;  5CKT A;  5BOX A;  1XB4 A;  4ZDO A;  1F43 A;  4BQQ A;  2XB0 X;  2JTV A;  1K61 A;  4JBA A;  2DN0 A;  2DK5 A;  1PUF A;  1YE9 A;  4CCJ A;  3ZMU A;  2ZME B;  2XC7 A;  4ETS A;  2NVT J;  2K3F A;  2WBM A;  4LG0 A;  1WH5 A;  1FX7 A;  3KET A;  3REO A;  4HNU A;  3K4N A;  2NS0 A;  5HLT A;  2KIQ A;  4XKV A;  3WGG A;  3BR6 A;  2GAU A;  1YW7 A;  5FGM A;  4E7I A;  1SFX A;  2JA2 A;  2F4I A;  1ZK8 A;  2IW5 A;  1D8K A;  4MQ9 F;  3WHB A;  1FYL A;  3C18 A;  3OS0 A;  4ESF A;  3BR1 A;  3KEO A;  3H5N A;  1OCO H;  3BJA A;  2HI3 A;  1TWF J;  3HBL A;  5DM6 F;  2V6E A;  2VLA A;  5EDN A;  1H89 C;  4F55 A;  4IHX A;  2H1L A;  1W4M A;  5D5U B;  3CCM I;  2TRT A;  2I10 A;  3EDP A;  3EPZ A;  2WAF A;  4XRS G;  1KU7 A;  5HOD A;  3T8T A;  3DTK A;  4EM0 B;  3QU3 A;  1FBU A;  4Y33 A;  2L9V A;  3LST A;  2PN6 A;  2OPT A;  3OV8 A;  4M3G A;  2R7V A;  3P5J A;  5F27 A;  2LD5 A;  3ZMD A;  1U9O A;  1ULY A;  1BL0 A;  2XRO A;  1R49 A;  2V1N A;  3JSO A;  4AVP A;  2MW8 A;  3KE2 A;  4V19 K;  1RPW A;  2V79 A;  4PK4 A;  4QPQ A;  3E7L A;  4D1Q A;  4XRM A;  2Y9Y A;  4N4O B;  5HLG A;  5GPA A;  5ILS A;  2HXO A;  3EUK L;  3ABU A;  3HYI A;  5J8F A;  4CH7 A;  1JKR C;  2ADU A;  1K4T A;  2HKX A;  3DEE A;  2R7X A;  1SFK A;  3ISP A;  1WJD A;  1AA7 A;  3P9K A;  4XID A;  5CVV A;  3KP3 A;  1VFC A;  3RPU A;  2AO9 A;  4MIM A;  4S05 A;  2EFQ A;  3H0D A;  2YUS A;  4C3J J;  1TP4 A;  1HXD A;  3BR3 A;  2FF4 A;  2E19 A;  3H5R A;  1UCR A;  1XMK A;  4LB5 A;  1GVD A;  2JUC A;  2BW3 B;  3NEU A;  2MBF A;  1JHF A;  2MLG A;  1O3R A;  1O57 A;  5D5X B;  3HIF A;  2R7O A;  2FD5 A;  2BHY A;  5IOZ A;  2KJB A;  1RR7 A;  4MGR A;  5E79 C;  5LRS A;  3CUQ B;  4MNU A;  1IZ1 A;  4ZTF A;  2LVS A;  4CZC A;  3A4C A;  3F22 A;  5CYV A;  2CQX A;  1V54 H;  2ZC2 A;  2PJP A;  3S1Q J;  3OYI A;  4M9Z A;  4LOC A;  2KQR A;  4M6X A;  1XCB A;  2CW8 A;  4U7D A;  3OYD A;  1BIB A;  3HC7 A;  3IAS 2;  1XSD A;  4RB3 C;  4DW6 A;  3ERM A;  1IJW C;  4G9Y A;  4EJT A;  5A2Q K;  3J7A O;  2O5R A;  2CFO A;  4BKX A;  4KIS A;  1S29 A;  2YR2 A;  2HOS A;  2V9V A;  3WTU C;  3JTG A;  2L7F P;  4RAG A;  1MSE C;  4CCM A;  2F4M B;  1IRG A;  1YO5 C;  3C2H A;  2L7M P;  1YYV A;  3I9V 2;  3OR1 C;  4A6E A;  3CCL I;  1JE8 A;  1FJL A;  2IS4 A;  4HQE A;  2VPL A;  1PJR A;  3LA2 A;  3IH2 A;  2JZY A;  3G6E I;  1CQT A;  2VQL A;  4ENJ A;  2QQA A;  3QPH A;  4HDV A;  3NAR A;  3L09 A;  3ZP5 A;  3TO7 A;  4N9H A;  4PSW A;  1O3S A;  1SD7 A;  2D1H A;  3CCR I;  2K9M A;  4XLH A;  2HYJ A;  2RN7 A;  3ZXS A;  5DUI A;  2XGD A;  3RKX A;  2G7H A;  3QU6 A;  2D1V A;  3TGN A;  3I59 A;  1MH4 A;  3I58 A;  2FOK A;  4A3F J;  4BDZ A;  4ZYD A;  4XLE A;  3ZMV A;  2DFE A;  1GT0 C;  4A3B J;  1D1B A;  4LIT A;  5DTD A;  2L4A A;  2M5W A;  1ORK A;  4NC7 A;  2JQ7 A;  2JWT A;  1D0Z A;  1GUU A;  4CGZ A;  5LEJ A;  4Z2Y A;  5FB2 A;  4HV6 A;  3DBR B;  1R23 A;  4BXF A;  1D5V A;  1AKH B;  2Y31 A;  2HZD A;  5FJ8 J;  3W2V A;  4XSZ F;  3MEX A;  3FX3 A;  4C2M J;  1SAX A;  1Q1V A;  4ZZL A;  4BAC A;  1X19 A;  1RI7 A;  2M7A A;  3K2Z A;  3PM1 A;  4G6T B;  3V7C A;  1SVL A;  1VI0 A;  5FD6 A;  2GXG A;  3WU0 A;  2R4G A;  1J7K A;  5LRR A;  4L0Y B;  1YX5 A;  5EYR A;  4BGD A;  3HKZ N;  2ACJ A;  4CO8 A;  4XRF A;  2EIM H;  3CES A;  2NS8 A;  2VOO A;  4B48 A;  2L5Q A;  2DI3 A;  4XNF A;  1JT6 A;  4Q48 A;  2IS1 A;  1YFH A;  2M8G X;  2L54 A;  5KNL A;  3B73 A;  1J5Y A;  3FXU A;  1VQ5 I;  2IA2 A;  3O6B B;  1WSU A;  4IX7 A;  1T0F A;  2ZJP F;  3RYR A;  3J7Y J;  3HTS B;  2LF8 A;  1HDD C;  2K7L A;  4D7N A;  1WFX A;  1VQO I;  1H8A C;  4I02 A;  4MEX F;  2HTJ A;  1VQK I;  2IAI A;  4G6Q A;  3TKY A;  1KU2 A;  3DFG A;  3DCF A;  2PMH A;  2LKP A;  3BRO A;  3KP5 A;  2DA6 A;  3GLL A;  3OMY A;  2CQN A;  3S93 A;  1A35 A;  5D8K B;  3U9G A;  3PIO F;  2X1D A;  2RKH A;  1RKW A;  2M2E A;  2DYS H;  3HUG B;  1X3W B;  2DPD A;  4QIW N;  2LC2 A;  3A01 B;  3WU1 B;  4BL0 B;  1NK2 P;  2PMZ N;  4GYI A;  2OQG A;  1BJZ A;  1MBE A;  3L1P A;  3LSH A;  2V4J C;  5EZG A;  4G7H F;  2HPM A;  2HTS A;  5FKM A;  3HHH A;  3GZ5 A;  2IGO A;  3IP4 B;  1NTC A;  1SD6 A;  3E5X A;  4JOM A;  2JPB A;  2V1D A;  2QEX I;  1NG6 A;  3PO3 J;  2VJI A;  4HX7 A;  1HST A;  2E35 A;  4JX5 A;  4IL6 C;  3WGI A;  4XBF A;  5D4R A;  3BR0 A;  2XAQ A;  3FHN A;  2VBX A;  1LFP A;  4CCO A;  2JA7 J;  3W3C A;  2XGC A;  5F64 A;  3F6V A;  1VQM I;  1MBK A;  3AG1 H;  1YI2 I;  3EUH C;  3HRT A;  4BU2 A;  2R93 J;  4M6Y A;  1VQ8 I;  3ASO H;  1FIA A;  1N25 A;  3OIO A;  2H6C A;  1MJA A;  4GCV A;  1XGS A;  4E7K A;  3E97 A;  4M72 A;  5EJC A;  4BHC A;  3DP7 A;  3QPL A;  1X2N A;  3H3Z A;  2DO7 A;  3G4S I;  1BM9 A;  2IGK A;  1O7L A;  3ABT A;  4AWX B;  5IOY A;  5J4Y A;  2LKS A;  2IA0 A;  3F8N A;  3OS2 A;  2A05 A;  2F2E A;  4QPO A;  1V5F A;  2XF7 A;  4M9X A;  2LOO A;  1R5H A;  3H36 A;  5LHH A;  4U7B A;  2BOL A;  5FLM J;  4IO9 F;  5GTH C;  2MC4 A;  4LFU A;  2CO5 A;  2R5Y B;  1FC3 A;  2ZJ2 A;  4HW0 A;  4D7M A;  4UVC A;  2OD5 A;  3HKZ A;  3J80 K;  4RBO A;  4MFD A;  5TGT A;  1D0X A;  3CJN A;  3L2V A;  2FEZ A;  1ZQ3 P;  3ULQ B;  4BQN A;  3IHU A;  1KQ0 A;  3GTG J;  1FSE A;  2FMY A;  2FNA A;  1XSX A;  3V8K A;  4GO1 A;  4M9S A;  4G8X A;  3WG9 A;  2RAE A;  2WV1 A;  4HQM A;  1HOM A;  1QBJ A;  1KGS A;  1S7A A;  4ANJ A;  4D5C A;  2P6T A;  4AID A;  3V7R A;  2R7W A;  1TBX A;  3IL2 A;  4EV0 A;  2BE5 F;  3H92 A;  3FXM A;  1EV7 A;  5F0F A;  4KYW A;  4LLN A;  4EJO A;  3GEZ A;  1ZTR A;  2VKE A;  2WY7 Q;  4UVA A;  2HYG D;  5FRM A;  1YRN A;  1MJ9 A;  5DYM A;  5JVG F;  1SAN A;  3K7A J;  1ZG5 A;  2VKV A;  1OCR H;  3ASN H;  4BYY A;  1T33 A;  2O03 A;  1PUE E;  2PMZ A;  2ZME A;  3RQ4 A;  4BE2 A;  3CMA I;  2QQB A;  2W00 A;  3VYT B;  2Q1Z B;  3L00 A;  4I0B A;  1P7I A;  1YG2 A;  5M3M J;  4XIC A;  2XIG A;  3SQN A;  4W97 A;  2BXY A;  3TQN A;  2RC4 A;  1T98 A;  2KRC A;  2HR3 A;  3QYE A;  3F23 A;  3FZV A;  5F04 A;  1JKP C;  2VI6 A;  2FE3 A;  3CMY A;  3HRS A;  3L2W A;  4XL9 A;  1D3Y A;  5F0C A;  3RQI A;  1U5T B;  4N0B A;  1TTY A;  4BNC A;  2W4S A;  2X51 A;  1Z21 A;  3FXJ A;  3WTS C;  4IKF A;  3KZI C;  4WCG A;  2X1E A;  4PCQ A;  4E7H A;  1I1S A;  2HGC A;  3OYL A;  5EG0 B;  1YIJ I;  2BYV E;  1KYZ A;  1TNS A;  4NQW B;  3ZMT A;  3GYH X;  3KLO A;  3M4O J;  2EIJ H;  3VPR A;  2GM4 A;  1JUP A;  3R61 A;  2EJR A;  2DJI A;  3MWM A;  1DGW Y;  4L0Z B;  4E7S A;  3RKW A;  2PMU A;  1BW6 A;  5TIS C;  3RYP A;  2VT3 A;  1K78 A;  4K2E A;  3GWZ A;  5E1W A;  2A5Y B;  3M8F A;  1ODD A;  4R79 A;  1EH7 A;  4PSX A;  5BMZ A;  2FJ1 A;  2J5P A;  1GLN A;  3GTO J;  1TW3 A;  5ICG A;  1TWG J;  1ETV A;  1L3L A;  2DJN A;  2JSC A;  2ZCW A;  3K4B A;  4O6J A;  2WC2 A;  1W0U A;  3D1N I;  2E1M B;  2EV6 A;  4Q47 A;  2XF5 A;  1WVR A;  4F7Z A;  1GHC A;  3TO6 A;  3E3V A;  5LHG A;  2Z9O A;  3I64 A;  4UVB A;  2XVC A;  4E70 A;  1K6Y A;  1S72 I;  2MAB A;  4RB0 A;  3KX2 A;  3F8C A;  1M1E B;  5IT9 K;  3W2A A;  4P9U A;  2XAG A;  4F93 B;  2EFN A;  2P7V B;  4BQO A;  4BDY A;  1K6O A;  4OIP F;  1QU3 A;  4FCY A;  2KZG A;  1NHA A;  3MFK A;  2VQC A;  2EZH A;  4DYC A;  3IV5 A;  1TQI A;  2A69 F;  4FET A;  4HYE A;  4EGZ A;  4AM3 A;  1RES A;  3OS1 A;  3MZ8 A;  4KMF A;  3BPX A;  2Y0S N;  1BW5 A;  3LMM A;  1FT9 A;  2DU9 A;  2UXX A;  5FLX K;  3LAP A;  4R1H A;  1FTZ A;  1I3Q J;  4EM1 A;  1YTY A;  2F4O B;  3DBL B;  3I53 A;  3N97 A;  3OWT A;  1IXS B;  2DLL A;  4RM3 A;  2O6G E;  4G12 A;  3RIR A;  3CUQ A;  5JFR A;  3FDY A;  1MD0 A;  1ZRD A;  1W7P A;  2DA2 A;  5HOO A;  3LQR A;  2JK3 A;  2EZL A;  4IPA A;  2DOA A;  2DFF A;  2M45 A;  4BJ5 C;  1JI8 A;  3AG3 H;  1Z7U A;  2R7F A;  2VKD A;  3S16 J;  2PBI A;  2DAO A;  4W1U A;  5IY5 H;  2XPW A;  2BY2 A;  2KJC A;  3CCE I;  4CIC A;  5E3M A;  2Z16 A;  2JJ7 A;  3CLQ A;  2RQQ A;  2MH2 A;  3S15 J;  2EPF A;  3FM5 A;  1ZKG A;  1FBQ A;  4IF4 A;  1A04 A;  3LSG A;  1AWC A;  4RGX A;  5C4J J;  1SEU A;  2NRA C;  4A5N A;  1HKS A;  2DPU A;  1IDY A;  1F36 A;  2LYC A;  4EJW A;  4P55 A;  5KAI C;  3HRU A;  4XSX F;  3GCM A;  3HL2 A;  2KRH A;  2OF7 A;  4JX4 A;  4YFX F;  1DQU A;  3S14 J;  1O3Q A;  4NB5 A;  4AD9 A;  1MBJ A;  2LTP A;  1TNT A;  3DLL F;  3VOD A;  4PJN A;  1G4D A;  3NWS A;  3HJE A;  5E1X A;  1MKM A;  2YPR A;  1HBX G;  2VJ4 A;  3U1K A;  2FML A;  3ZQL A;  4DBR A;  3W6V A;  4YII A;  1FWZ A;  4X6A J;  3T1B A;  4E6K G;  5CLS A;  1USS A;  3RKY A;  1FY7 A;  3SDG A;  1L0O C;  1DPR A;  2F48 A;  3DTI A;  1P7J A;  5B1A H;  3AAF A;  1XN7 A;  1ZG1 A;  5H20 A;  2OC6 A;  2VJJ A;  2B9S A;  3MN2 A;  3IWF A;  2EA2 A;  2MG4 A;  2WTE A;  5DS9 A;  1S6L A;  1SMY F;  1AKH A;  5KAF C;  5B66 C;  2ZFU A;  5EGO A;  2ECB A;  1SMT A;  2ESN A;  4LMY A;  3V7S A;  4F52 A;  1LVK A;  4U88 A;  3FM3 A;  1YS7 A;  1WI9 A;  4BBS J;  3HSE A;  2FBI A;  5LBQ A;  3CP8 A;  1G59 A;  1SC7 A;  2KFD A;  2M0C A;  4U0V A;  4XLF A;  4HOB A;  1ZYR F;  3BTL A;  5LHI A;  1Y1W J;  4RLF A;  3DPU A;  1OR7 A;  2PX9 A;  2DA3 A;  2OZ6 A;  1HQC A;  3KFW X;  4FTH A;  1DUX C;  2D5V A;  2CV1 A;  2X1C A;  5LLQ A;  3OL4 A;  2OBP A;  1LFB A;  3SZG A;  1YHQ I;  3M1E A;  3LNQ A;  3R60 A;  2QYO A;  4Y3O A;  1AHD P;  3S3N A;  3H1C A;  5M5X J;  5B1B H;  2VQH A;  3BJO A;  3NQO A;  4WF2 A;  2WB1 A;  2FXA A;  4AIJ A;  2LG4 A;  4KN4 X;  5E3L A;  3GFI A;  1WPK A;  2GOX B;  1IC8 A;  1XGM A;  2NNN A;  2WA0 A;  3FK6 A;  4HST A;  1XC5 A;  1ITY A;  2ZXI A;  4CCN A;  3QAH A;  3FXQ A;  1QZE A;  1Z67 A;  2M3A A;  2GBY A;  2CH0 A;  2DBB A;  2OU2 A;  5F1R A;  4WK8 F;  2R7D A;  5BS6 A;  2K4B A;  5K5O A;  3I5U A;  4DOZ A;  2FQ3 A;  3EUA A;  2PI0 A;  2CQ7 A;  2KT0 A;  3BCB A;  1BOB A;  2R7S A;  3M8E A;  1ZEL A;  1X3U A;  4BJT A;  5C44 J;  4DBQ A;  2K86 A;  3ABM H;  2V9K A;  4M71 A;  1YS6 A;  1F5T A;  3QYF A;  3SYT A;  2DK8 A;  2ME0 A;  1WI3 A;  2ZB9 A;  3E5Q A;  4N4N B;  3S3M A;  4P9F A;  2IEK A;  3L7W A;  5FKO A;  3CCS I;  1ZLJ A;  2LSO A;  5ED4 A;  3VWB A;  2CU7 A;  4UUT A;  4XKC A;  2IJL A;  2MA3 A;  3OSG A;  2G7U A;  1HF0 A;  2IXS A;  3KEY A;  2O0Y A;  2X85 A;  1TL8 A;  1LE8 B;  1BC7 C;  2GIZ A;  3CCV I;  1XTA A;  3RJP A;  2HPI A;  1MBH A;  3S17 J;  2O61 A;  3FBN B;  4BXX J;  2BVM A;  1P2F A;  4OAY A;  2HQ5 A;  2M8E A;  1Z6T A;  2EH3 A;  4B3A A;  3P7N A;  2A07 F;  3CC4 I;  3LFU A;  2EBI A;  3V42 A;  3NWT A;  4OU0 A;  2P8T A;  1G3Y A;  4R8H A;  2XSD C;  1W5S A;  4M3D A;  2UV1 A;  3LSI A;  2X6O A;  3QP5 A;  3LSJ A;  3OOU A;  2EFO A;  4J00 A;  1MH3 A;  2R5Z A;  4G7Z F;  2RGV A;  1B9M A;  2CWE A;  1FYM A;  1OCC H;  4D5F A;  2P6S A;  2Q2E B;  3TDZ C;  4CYD A;  1H9T A;  4MEY F;  4C3I J;  1SFO J;  4A3D J;  3BP8 A;  3PNT A;  3K6G A;  4IQJ A;  4DGW B;  3GUD A;  3HOW J;  1MBG A;  4C9Y A;  4Y52 J;  1R00 A;  4AVZ A;  1A5J A;  4X1E A;  4H0E A;  2HU9 A;  4G94 A;  1J59 A;  4QWQ A;  4ENM A;  3EQL F;  1SD4 A;  1OYY A;  2EWN A;  2H09 A;  1G6N A;  3F9K A;  4XLA A;  4JX6 A;  4WX9 A;  1EJ9 A;  5HNH A;  2NVU B;  4LLG F;  1Y0U A;  5FD5 A;  4HNT A;  4DZJ A;  4CA0 A;  5D5V B;  4DJA A;  2A6H F;  1REP C;  4HA8 A;  3S32 A;  4TV7 A;  5HLH A;  2QSF X;  2STT A;  3JW4 A;  5HS9 A;  3GTQ J;  4BE0 A;  4BS9 A;  2W7N A;  3K0L A;  4OIR F;  1XD7 A;  1XG1 A;  3O3K A;  3HOZ J;  5IPA A;  5BNG A;  2LFB A;  2XF6 A;  1LDK B;  4OMY A;  3BG5 A;  4F92 B;  3BCA A;  2EIK H;  2CQQ A;  3C2G A;  3O8G A;  4PFP A;  4EJV A;  1MW7 A;  1A31 A;  4XMY A;  1Z91 A;  5LGU A;  3IKT A;  3M3Y J;  2KIS A;  4PUS A;  2HXI A;  1E17 A;  2LY9 A;  1R1T A;  1UG0 A;  4NHJ A;  2GLO A;  2K9L A;  3TO9 A;  1G8X A;  2EZK A;  2OV7 A;  4WXC A;  2CFX A;  1ETY A;  3I3L A;  5C4X J;  3MQ0 A;  2CRG A;  2CMP A;  5KCM A;  3TOB A;  1LNW A;  1JJ6 C;  1TT0 A;  2K9S A;  5ILU A;  1XSV A;  3GX4 X;  1QNT A;  2PG4 A;  2QVO A;  3QOP A;  4IVN A;  2KIF A;  4MO7 A;  3B02 A;  1G2H A;  3U2R A;  1ON2 A;  1AU7 A;  1ZR4 A;  3HEF A;  4GFB A;  2MYS A;  3FMR A;  1QVT A;  5HVQ C;  3A1Y A;  2VT2 A;  3LAJ A;  2ESH A;  2V26 A;  4G6D A;  1MND A;  3ABL H;  2GA1 A;  2CV2 A;  1BJA A;  2W82 A;  3OYG A;  2EB7 A;  4EVI A;  1CGP A;  1YJN I;  3E6M A;  1LEA A;  1P4X A;  2JA6 J;  2QEN A;  4XOT A;  4FT8 A;  1BR2 A;  1OR7 C;  2C6Y A;  1RZ4 A;  1FOW A;  4BY7 J;  4IRG A;  4ZTJ A;  4JQF A;  4NQW A;  3GFL A;  3TP0 A;  2MGQ A;  4QTR A;  2PLY A;  3A02 A;  4IHV A;  1C0W A;  2A6E F;  3ZCO A;  1QVU A;  2F5V A;  4FIS A;  1SVO A;  4P5O A;  4BUP A;  3C3W A;  2Z1D A;  2DMT A;  2VN2 A;  2FX0 A;  4I7H A;  3CF2 A;  2JVG A;  1D1C A;  3PO2 J;  1UZC A;  5A2Q Z;  2Z2S B;  3C2B A;  3QRF F;  4A3J J;  5E3N A;  2MC3 A;  1KZH A;  4C3H J;  1FBS A;  3DF8 A;  2XSJ C;  1JUS A;  4FQG A;  2IP2 A;  4M6V A;  5J8C A;  5JR3 A;  3KIO A;  3D5S C;  4UV8 A;  4NNJ A;  3HPH A;  2NOJ B;  3WTT C;  5CVJ A;  3A2K A;  2HVR A;  3ECH A;  4RB1 A;  1HKQ A;  1UFM A;  2E7X A;  3RZO J;  3V8J A;  1DPU A;  5DCF A;  4Z6Y A;  2QM3 A;  3KLN A;  2LBF A;  2IPQ X;  3JRA A;  2ELJ A;  5B5E C;  4CHU A;  2DQR A;  3HGY A;  1MDM B;  2JA8 J;  3DKX A;  4WXD A;  1ZGW A;  1ZGJ A;  1ETO A;  3K10 A;  1JKQ C;  4B4C A;  3PJR A;  4UUV A;  4FE4 A;  2UZK A;  3LWF A;  1ZLK A;  1D0Y A;  4A3M J;  2M0M A;  2K27 A;  2QBY A;  5CVI A;  5ICE A;  4MFE A;  3MKW B;  1TQP A;  3BOQ A;  2ID6 A;  2M34 A;  2ZKZ A;  4OWR B;  2IS2 A;  2VE8 A;  3HOT A;  1FMV A;  3JRC A;  3L9F A;  5D8L B;  3RPU D;  5BPD A;  5JHF A;  5FKK A;  4D9J A;  5GAE J;  3GFM A;  1IAW A;  2VPR A;  3VB2 A;  1B9N A;  2HOT A;  3CCJ I;  2LLK A;  1PUF B;  4HLX A;  1JTY A;  2X9D A;  1LDD A;  4A2U A;  2WAQ A;  2AS5 F;  2W85 A;  2QQ8 A;  2FBH A;  1W0T A;  2XV4 S;  1ZHF A;  4LG0 B;  3ZR8 X;  4GYG A;  3K4K A;  3JTH A;  3GTK J;  3ZN0 A;  3QOD A;  3S2W A;  1VQ4 I;  1N77 A;  1O7F A;  2JRT A;  1IRZ A;  3EET A;  5J1R A;  1TWA J;  2JSP A;  2BV6 A;  2LRE A;  3E1S A;  4I01 A;  5EZH A;  4HRI A;  5DM7 F;  4OIO F;  5L3B A;  5ERI A;  3OL3 A;  4LD5 A;  1VF9 A;  3C1D A;  2ZBK A;  1V3F A;  2DMN A;  2O8K A;  1PVE A;  2DQL A;  3E0J B;  3OYJ A;  4IEJ A;  4L9N A;  2V1U A;  4F3Q A;  4PGH A;  3X2Q H;  4XOP A;  4A0Y A;  1Y6I A;  3DU6 A;  1IN7 A;  1ETW A;  1F9N A;  1OIS A;  2GA2 A;  2HKO A;  3KZZ A;  1WHU A;  4OIN F;  1T8I A;  1IV6 A;  3N05 A;  3B6A A;  2QWW A;  1ETQ A;  3GZN B;  3HPG A;  4GGG A;  2E1N A;  3E6D A;  2QUF A;  3BZK A;  3VDX A;  3IH4 A;  1FOK A;  4BBR J;  1MMN A;  3LQQ A;  4HX4 A;  3I55 I;  2JMW A;  1JKO C;  1OCZ H;  2VIX A;  4Y13 A;  2HVQ A;  3H3V K;  3G73 A;  3T5X A;  3GFJ A;  1T95 A;  2W84 A;  1NK3 P;  4NBQ A;  3E5U A;  4KDP A;  1POG A;  3RDI A;  1Z3X A;  3JRE A;  3HOS A;  2CUJ A;  1ZAR A;  1TT5 B;  2OCE A;  3WTV C; 
#chains in the Genus database with same CATH homology
 1FTZ A;  1I3Q J;  4S0H B;  4V2G A;  2K40 A;  3BT9 A;  3BR6 A;  4G12 A;  2LP0 A;  1ZK8 A;  5IYD J;  3ZQG A;  3RKQ A;  3BTC A;  2DA2 A;  3WHB A;  3LSP A;  5FKN A;  2JK3 A;  2EZL A;  3BR1 A;  4UUS A;  2Y9Z A;  3GTP J;  2HI3 A;  1TWF J;  2DMP A;  1JTX A;  3HBL A;  3S16 J;  4W1U A;  5EDN A;  1H89 C;  4IHX A;  5K7H A;  2XPW A;  2CJJ A;  2TRT A;  2I10 A;  5E3M A;  4XRS G;  2JJ7 A;  5HOD A;  5EGO B;  2W48 A;  3S15 J;  1ZKG A;  3LSG A;  1WH7 A;  2OPT A;  4M3G A;  3HOX J;  5C4J J;  5F27 A;  3JRB A;  2LD5 A;  5IP7 J;  1U9O A;  1IDY A;  1BL0 A;  1F36 A;  1O4X A;  3F0C A;  2DMU A;  2MW8 A;  1RPW A;  3E7L A;  2OF7 A;  4JX4 A;  2Y9Y A;  4XRM A;  2K9Q A;  5GPA A;  3S14 J;  2HXO A;  1QRY A;  2MSY A;  1MBJ A;  2LTP A;  1I6H J;  2X48 A;  1JKR C;  2Y30 A;  4FE7 A;  3BR2 A;  4M3B A;  2ID3 A;  3ZQL A;  4M3E A;  4XID A;  4Y7N J;  3W6V A;  4X6A J;  1VFC A;  1X58 A;  2AO9 A;  3K2A A;  4MIM A;  1LFU P;  3SDG A;  1JGG A;  2YUS A;  4C3J J;  3BR3 A;  4A3K J;  1P7J A;  2E19 A;  2R7Z J;  2HDD A;  1GVD A;  3MN2 A;  3JRD A;  3NAU A;  1T56 A;  2MG4 A;  1RET A;  1OCT C;  2FD5 A;  5IOZ A;  2JN6 A;  5DS9 A;  4A3E J;  1AKH A;  2VUM J;  5EGO A;  1WCM J;  2ECB A;  1RR7 A;  2DA7 A;  3HOV J;  1LE8 A;  3JRH A;  2LVS A;  4BBS J;  5GP9 A;  2G0E A;  2M0C A;  2CQX A;  3G1L A;  3BTL A;  1Y1W J;  5JLW A;  4BY1 J;  4JP0 A;  3S1Q J;  1IDZ A;  3H0G J;  3BQZ A;  3BG3 A;  4L5E A;  3JRF A;  2DA3 A;  4UUS B;  4LOC A;  3BTJ A;  4FTH A;  1JUM A;  5FKL A;  2D5V A;  3G1M A;  2LKX A;  5JLX A;  1LFB A;  1JT0 A;  4DW6 A;  2K9N A;  1IUF A;  3LNQ A;  4NDL A;  1AHD P;  1B8I A;  5M5X J;  3S1R J;  1IJW C;  1UHS A;  3S1N J;  4AYB N;  4BKX A;  3A03 A;  5C3E J;  2HOS A;  3Q0U A;  5E3L A;  4DYQ A;  1IC8 A;  1WPK A;  2L7F P;  1MSE C;  3HDD A;  3S2D J;  2L7M P;  3FK6 A;  4QSH A;  1FJL A;  1XC5 A;  1ITY A;  5M5Y J;  1GV2 A;  2XB5 A;  3S1M J;  3IH2 A;  1TWH J;  3Q0W A;  2DMQ A;  1CQT A;  3FIW A;  2GBY A;  3UKG A;  1VND A;  3NAR A;  2Y2Z A;  3Q0V A;  5F0H A;  1APL C;  2R5Z B;  3LSR A;  5EEA A;  5F08 A;  2O7O A;  2HYJ A;  2XGD A;  1HLV A;  2KT0 A;  2ME6 A;  2L0K A;  3TP3 A;  5C44 J;  1OCP A;  1MH4 A;  2LK2 A;  4A3F J;  2WB1 N;  2FQ4 A;  9ANT A;  1GT0 C;  4A3B J;  2O9L A;  1FTT A;  1U9N A;  5DTD A;  1ORK A;  2JWT A;  2ME0 A;  1GUU A;  1WI3 A;  2ZB9 A;  5IP9 J;  1ZR2 A;  1K83 J;  5J3L A;  2M9H A;  4A3C J;  2IEK A;  1HDP A;  5FKO A;  4AUX A;  1HCR A;  1AKH B;  2CU7 A;  4UUT A;  3B6C A;  2Y31 A;  3OSG A;  1HF0 A;  5FJ8 J;  5K7Z A;  1LE8 B;  1U78 A;  4C2M J;  1Q1V A;  3S17 J;  1MBH A;  4BXX J;  2LR8 A;  2HQ5 A;  4B3A A;  2EH3 A;  2NVY J;  1ETX A;  3PM1 A;  2EBI A;  1VI0 A;  3LOC A;  3ZOB A;  2XSD C;  4M3D A;  5EYR A;  3HKZ N;  2X6O A;  3LSJ A;  3OOU A;  1MH3 A;  2R5Z A;  2NS8 A;  1B8I B;  2IBD A;  4D5F A;  1FIP A;  3HM5 A;  1JT6 A;  2COB A;  3MVP A;  5EF6 A;  2L7Z A;  4C3I J;  2M8G X;  1SFO J;  4A3D J;  5M3F J;  2QF7 A;  3HOW J;  2XPV A;  1MBG A;  5IP6 A;  4Y52 J;  2QCO A;  1A5J A;  4X1E A;  1HDD C;  1X2M A;  4D7N A;  1H8A C;  3I4M J;  1B72 A;  5M5W J;  2IAI A;  4JX6 A;  4ABZ A;  4EEF G;  3S2H J;  4B1R A;  3DCF A;  4RDU A;  2XPU A;  4DZJ A;  4IHY A;  2DA6 A;  2H8R A;  3ZQC A;  2DA5 A;  5E3O A;  1RKW A;  2M2E A;  1S7E A;  4QIW N;  2EQR A;  3A01 B;  3CQZ J;  2ELK A;  3RZD J;  1QPI A;  1NK2 P;  3GTQ J;  2PMZ N;  5FLV A;  1BJZ A;  2DA4 A;  1MBE A;  3L1P A;  2N8G A;  5IYC J;  2DA1 A;  5EZG A;  5FKM A;  1XG1 A;  3HOZ J;  5IPA A;  5BNG A;  2LFB A;  1NTC A;  1E3O C;  3BG5 A;  4A69 C;  3O8G A;  2CQQ A;  3QPS A;  2H1K A;  3PO3 J;  1IG7 A;  3M3Y J;  4JX5 A;  5K7F A;  3HGG A;  2HXI A;  3ZQF A;  3BR0 A;  2LY9 A;  1U8B A;  2JA7 J;  3GTM J;  2GLO A;  2XGC A;  2EZK A;  1MBK A;  4JYK A;  1ETY A;  5C4X J;  4XRS A;  2CRG A;  2R93 J;  1JJ6 C;  2E2I J;  2K9S A;  1FIA A;  3OIO A;  3GTJ J;  5J1Y A;  1XS9 A;  4A3G J;  2XGE A;  3HB9 A;  4MO7 A;  3GBG A;  2E2J J;  1G2H A;  4GFB A;  1AU7 A;  1ZR4 A;  3HEF A;  3I4N J;  2E1O A;  1YRN B;  1BA5 A;  1QVT A;  2KDZ A;  3QPL A;  1X2N A;  3ZQH A;  2YS9 A;  1OFC X;  3BR5 A;  5IOY A;  3MKL A;  3CDL A;  5J1U A;  3G1O A;  1FEX A;  3A01 A;  3GTL J;  3FK7 A;  5FLM J;  5IYB J;  2JA6 J;  2R5Y B;  1R9T J;  1Z0X A;  4BY7 J;  4D7M A;  2L9R A;  3FKI J;  3OSF A;  3TP0 A;  4M3F A;  2MGQ A;  3Q3S A;  4QTR A;  3A02 A;  4CYC A;  4MFD A;  4RBO A;  1B72 B;  4IHV A;  1QVU A;  4FIS A;  1ZQ3 P;  2DMT A;  2FX0 A;  3GTG J;  2ECC A;  3PO2 J;  2RAE A;  1TWC J;  2WV1 A;  1IGN A;  1HOM A;  3C2B A;  4A3J J;  5E3N A;  4C3H J;  3JRG A;  3HOU J;  4D5C A;  2TCT A;  1UG2 A;  4IHW A;  1JUS A;  4M6V A;  2AHQ A;  4V2F A;  3BG9 A;  5F0F A;  3O8H A;  1ZTR A;  2VKE A;  1I50 J;  4J19 A;  3RZO J;  1YRN A;  2DTZ A;  2CUF A;  2YU9 J;  1TC3 C;  1SAN A;  3K7A J;  1MNM C;  2NVX J;  3JRA A;  3JRI A;  4AC0 A;  2CUE A;  1Y1V J;  2VKV A;  3FIS A;  3HGY A;  3SFI A;  2E2H J;  1OJL A;  2EZI A;  1DU6 A;  2JA8 J;  1ZGW A;  1A6I A;  1MBF A;  1T33 A;  1ETO A;  4DZP A;  1JKQ C;  1UMQ A;  4B4C A;  4FE4 A;  4A3M J;  4MFE A;  1P7I A;  2R5Y A;  1EF4 A;  5M3M J;  4XIC A;  2ID6 A;  2XRL A;  2M34 A;  3CCY A;  4W97 A;  1GV5 A;  1MSF C;  3QQA A;  4A3I J;  1ETK A;  3JRC A;  3TED A;  5FKK A;  1JKP C;  5F04 A;  2VI6 A;  4I6Z A;  4I76 A;  1GDT A;  3CMY A;  2VPR A;  2HOT A;  5F0C A;  3RQI A;  2LLK A;  1PUF B;  1JTY A;  2X9D A;  4MLO A;  3HOY J;  1RKT A;  2NOG A;  1W0T A;  2P81 A;  5F1J A;  1Z77 A;  3DEW A;  5EG0 B;  2HOA A;  3GTK J;  3M4O J;  4CYC B;  4A3L J;  2JA5 J;  3VPR A;  2GM4 A;  2R0Q C;  1JUP A;  1IRZ A;  4HNV A;  5J1R A;  1TWA J;  3BTI A;  5EZH A;  1BW6 A;  2O8K A;  4A93 J;  1VF9 A;  4XK4 A;  2DMN A;  2FJ1 A;  3GTO J;  1WGX A;  3ZQI A;  3TW6 A;  1TWG J;  1ETV A;  4IEJ A;  2DJN A;  3SJM A;  2WAQ N;  1W0U A;  3D1N I;  1ETW A;  3TW7 A;  1JJ8 C;  1IV6 A;  1DU0 A;  3B6A A;  1ETQ A;  3WHC A;  3IH3 A;  1D5Y A;  2NVQ J;  1ENH A;  1H88 C;  1F43 A;  3IH4 A;  4BBR J;  2B63 J;  2XB0 X;  1K61 A;  4FCY A;  2DN0 A;  2JMW A;  1PUF A;  1JKO C;  4DYR A;  2EZH A;  4DYC A;  3IV5 A;  3H3V K;  3BQY A;  2NVT J;  1RES A;  1NK3 P;  2Y0S N;  1BW5 A;  1POG A;  1WH5 A;  2NS7 A;  3JR9 A;  3JRE A;  2R92 J;  5GPC A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...