2GLOA

Solution structure of the brinker dna binding domain in complex with the omb enhancer
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
59
structure length
59
Chain Sequence
GSRRIFTPHFKLQVLESYRNDNDCKGNQRATARKYNIHRRQIQKWLQCESNLRSSVANN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*GP*AP*GP*GP*CP*GP*TP*CP*AP*AP*C)-3'
publication title DNA recognition by the brinker repressor - an extreme case of coupling between binding and folding
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 17
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2006-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09607 BrkDBD Brinker DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2gloA00
5M3MJ 1TWFJ 2DMPA 1A5JA 2DMQA 2XPVA 1VF9A 3HOVJ 2XB0X 3Q0WA 1MH4A 3SFIA 1U78A 1OJLA 2HXOA 2M34A 2VKEA 2MW8A 5J3LA 1UMQA 5K7FA 2HQ5A 3S14J 1AU7A 4FE7A 1BW5A 2OPTA 2IEKA 1UHSA 4JX6A 1A6IA 3OSFA 4C2MJ 5E3NA 3S17J 3LSRA 3IV5A 3TP0A 3NARA 5FKOA 1IC8A 5F0HA 2ME6A 1MH3A 1HF0A 1GT0C 4FE4A 5GP9A 4FTHA 1ZK8A 3LSJA 1VI0A 2H1KA 3ZQHA 3HOZJ 1T56A 4A3LJ 4W1UA 1JKQC 3LSPA 2HXIA 4M3FA 2O7OA 1GDTA 3JRAA 2W48A 5IYDJ 3E7LA 2IBDA 4IHYA 1H89C 3HBLA 2RAEA 5F1JA 4HNVA 2LVSA 4B3AA 2X48A 3BG9A 1TWCJ 4AC0A 4B1RA 1MSFC 3HGYA 2R7ZJ 2FJ1A 1Y1WJ 5FKMA 1IG7A 2R92J 3HB9A 2CRGA 2DTZA 4IEJA 3QPSA 3FKIJ 2VUMJ 4MFEA 4IHWA 1JGGA 1QPIA 1JJ6C 1G2HA 3B6AA 1X2MA 1JUPA 2CQQA 1ETWA 2R5ZB 1YRNA 1E3OC 3DEWA 4I76A 2Y0SN 2HOAA 5IOZA 2M8GX 3BR3A 1FTTA 4BKXA 3JRIA 3FK7A 4DW6A 2JA6J 3BR0A 1FIPA 1OFCX 3QQAA 1YRNB 4RDUA 1QRYA 2R0QC 3HOXJ 2D5VA 3HM5A 3BQYA 2Y30A 3JRHA 2GBYA 4RBOA 4XK4A 3S1QJ 3IH4A 1NTCA 2TCTA 4XICA 2Y31A 1MBHA 2ZB9A 2JK3A 2XRLA 3S16J 1JT0A 3FK6A 1ZR2A 3SDGA 2COBA 3GTQJ 4A93J 2WB1N 1ETKA 1WCMJ 2EH3A 2CJJA 4C3JJ 1SANA 3HOWJ 2DMUA 2CQXA 2L7MP 4BY1J 3BR5A 1JKOC 2IAIA 2K9SA 3TEDA 2DMNA 3S2DJ 2JN6A 2EBIA 1F36A 3JRBA 2DJNA 3BG3A 2HDDA 2K9QA 4Y52J 1DU0A 1GVDA 4I6ZA 1X2NA 1ZGWA 4A3EJ 2Y9YA 2LFBA 1Z0XA 5EGOB 4V2FA 2MSYA 5J1UA 1B72B 2GLOA 3CMYA 3I4MJ 3GTKJ 1U9OA 2GM4A 1XC5A 5IOYA 2JJ7A 2R5YA 3K2AA 4MLOA 2K40A 5EG0B 5K7ZA 1IDZA 4L5EA 2EQRA 2E2IJ 1LFBA 1BW6A 2DA3A 2VKVA 3WHCA 1AKHB 4QIWN 2R5YB 1NK2P 1RPWA 2EZIA 1IGNA 3JRFA 2YS9A 3ZQFA 3BTJA 1GUUA 5M5XJ 1RKWA 1ZTRA 2K9NA 3A03A 3G1MA 1RETA 2NVTJ 3JRDA 2HOTA 4EEFG 2WV1A 3MKLA 2ECCA 4A3IJ 2DA6A 3ZOBA 3JRCA 3H0GJ 2B63J 4X1EA 3S2HJ 3DCFA 1U9NA 5IPAA 2DA1A 3BT9A 2L7ZA 5M5WJ 5DTDA 3PO3J 3ZQLA 5EF6A 2AO9A 3Q3SA 1PUFA 3M3YJ 3LSGA 1P7JA 2QF7A 1ZKGA 2MG4A 2JMWA 2NOGA 5FKNA 2LY9A 1O4XA 9ANTA 1F43A 4J19A 2G0EA 2E1OA 2AHQA 1PUFB 2R5ZA 4BBRJ 4GFBA 5IP9J 1W0UA 1WH5A 4A3JJ 2YU9J 4DYQA 5IP7J 2EZHA 5EYRA 4NDLA 5HODA 1W0TA 5IYBJ 5F0FA 4XRMA 1AHDP 2R93J 2FD5A 3L1PA 1APLC 4D5CA 1T33A 3GTLJ 1I6HJ 3O8GA 4M3EA 5EZHA 1NK3P 1LFUP 3BR1A 4M6VA 3QPLA 5FJ8J 1GV5A 2P81A 1IUFA 2LLKA 3BR2A 3CCYA 2XPWA 5F04A 1BA5A 2LKXA 2CUEA 1Z77A 5F0CA 4AUXA 1WH7A 1WGXA 1JTYA 3K7AJ 5J1YA 2DN0A 1B8IB 4QTRA 1FTZA 3B6CA 3MN2A 4QSHA 2ID6A 5DS9A 5EDNA 1IDYA 2LR8A 3F0CA 1MBFA 4MO7A 5M3FJ 4DZJA 3NAUA 1ITYA 2MGQA 1CQTA 3JREA 1JKPC 2NVYJ 1ETVA 4JX4A 3TW6A 4V2GA 5M5YJ 1LE8A 4CYCB 4FCYA 1R9TJ 4JP0A 3FIWA 1MBJA 3Q0VA 1XS9A 1IJWC 1D5YA 3S1MJ 3G1LA 1OCTC 1BL0A 1S7EA 4DYRA 2X6OA 2Y9ZA 1LE8B 4LOCA 1JUSA 1H8AC 3A01B 3RQIA 5EGOA 3GTGJ 3ZQIA 2M9HA 1K61A 3CDLA 1MBGA 2XGCA 1B72A 3A02A 5F08A 5E3OA 5K7HA 3UKGA 1HDDC 3RZOJ 3HOUJ 2NS8A 2FX0A 5GPAA 2Y2ZA 5C4XJ 2FQ4A 4C3IJ 3JR9A 2I10A 4DZPA 2YUSA 5IP6A 2ECBA 2L7FP 5JLXA 5JLWA 5EG0A 2VI6A 2E19A 1ETOA 2LD5A 1I50J 3HEFA 1JKRC 5J1RA 3GTPJ 1MBKA 3I4NJ 2XGDA 1AKHA 1WPKA 3GBGA 3OSGA 2DA7A 2XGEA 1H88C 4A3KJ 2LP0A 2E2JJ 4M3GA 1P7IA 5FKKA 3OOUA 5FLVA 3PM1A 2NS7A 3GTMJ 1VNDA 2DA4A 4XIDA 1U8BA 2H8RA 2O9LA 1ETYA 2HOSA 4UUTA 4BY7J 3BTCA 4C3HJ 4Y7NJ 5E3MA 1I3QJ 4UUSA 1ZR4A 2WAQN 3ZQCA 2NVXJ 1K83J 1EF4A 5C3EJ 1QVUA 4UUSB 3IH3A 4DYCA 2EZKA 2ID3A 3HKZN 2L0KA 3LOCA 5F27A 3TW7A 1VFCA 1QVTA 3MVPA 3GTOJ 3IH2A 2LTPA 2JWTA 4D7MA 4JYKA 1ORKA 2JA7J 1UG2A 5C44J 2M0CA 1ETQA 3ZQGA 3OIOA 1ETXA 3BG5A 4JX5A 1ENHA 2CU7A 1BJZA 1MSEC 2PMZN 1GV2A 2DMTA 2ELKA 2EZLA 2X9DA 2NVQJ 4IHVA 1B8IA 1FIAA 4ABZA 3BTIA 4BXXJ 2KDZA 2DA2A 5GPCA 3D1NI 3FISA 3S15J 4A3DJ 3CQZJ 3H3VK 1TWHJ 1IRZA 4D5FA 1TWGJ 2VPRA 1TWAJ 3RKQA 1HLVA 1HDPA 1HCRA 3BQZA 3RZDJ 1FJLA 2OF7A 5E3LA 4CYCA 2E2HJ 4M3DA 4A3GJ 1TC3C 3GTJJ 4AYBN 2O8KA 3O8HA 3G1OA 5FKLA 3WHBA 1SFOJ 1MBEA 4W97A 5BNGA 1JT6A 2M2EA 1RESA 4MFDA 3VPRA 3A01A 1ZQ3P 1JUMA 3PO2J 5IYCJ 4A3FJ 3HGGA 1IV6A 2CUFA 5EEAA 3S1RJ 2L9RA 4G12A 2XSDC 1RR7A 2N8GA 4MIMA 4A3MJ 3C2BA 1Q1VA 1JJ8C 4M3BA 4IHXA 3HOYJ 4S0HB 3S1NJ 1DU6A 3BTLA 1MNMC 1HOMA 5FLMJ 2HYJA 4XRSA 3Q0UA 3JRGA 1POGA 2XB5A 4FISA 2KT0A 1FEXA 1XG1A 4BBSJ 1Y1VJ 3W6VA 2ME0A 4X6AJ 3HDDA 2XPUA 2JA5J 1OCPA 3LNQA 3M4OJ 1X58A 5EZGA 4A3CJ 3BR6A 3TP3A 1RKTA 1JTXA 1WI3A 4D7NA 2LK2A 2TRTA 4B4CA 2HI3A 3SJMA 2JA8J 4XRSG 2DA5A 2QCOA 4A69C 5C4JJ 4A3BJ
chains in the Genus database with same CATH superfamily
3WE2A 3TBIA 1TWFJ 3TDZC 1EKEA 2M3AA 3GLXA 4I0AA 3HOVJ 3Q0WA 3T8TA 2YX7A 1W5CC 1MH4A 3MAJA 2HXOA 1SD5A 2X1DA 2A61A 3GZ6A 3K10A 2RN7A 4RB0A 5HLIA 2X1EA 1FWZA 5J3LA 4A0YA 4CCNA 3U1KA 1UMQA 2XDVA 2DU9A 3L09A 1VQNI 2A5WA 2A68F 3U1DA 2C6YA 2DQLA 4XNFA 2BOLA 2ESNA 4CCOA 4HRIA 2COMA 1XB4A 3ECOA 4JX6A 1A6IA 4R8HA 2WAFA 4C2MJ 4Y3OA 5BPDA 5DCMA 5D8KB 3RTRA 3WGIA 1VQKI 2IS6A 3P9IA 3K4JA 1X1BA 1LJ9A 4ZYGA 3NARA 2R7TA 2FBIA 4U7BA 3BPVA 1HBXG 4FTHA 4RLFA 2NS0A 1VI0A 2VXZA 1T56A 3T1BA 3BJ6A 3R4KA 4M9SA 1NG7A 2ZFUA 3Q9SA 2I8DA 2KLOA 4M3FA 3SXYA 2W48A 3JRAA 5LGTA 3HKZA 3I55I 5CKTA 4XKBA 4BHCA 1RRJA 1IXSB 4MQ9F 3E6CC 1UHMA 2OU2A 1TWCJ 2FXAA 1FOWA 1C0WA 3HGYA 1K78B 1VQ4I 1SMTA 2VASA 2R92J 5FKMA 2XKPA 3KYDB 1G6NA 1OR7C 2DTZA 3EUAA 2E1CA 2MFZA 2XVCA 1ZH5A 1Y8QB 1JGGA 1IO2A 1WVRA 3H5AA 3IC7A 4Z6YA 3IWZA 1JJ6C 1VQ6I 1JUPA 4UV8A 1OKRA 1ETWA 3QYBA 1MMAA 3G2BA 1E3OC 1T6SA 3DEWA 4BYYA 2M8GX 3KFWX 2CUJA 3HSRA 2VKHA 3MD2A 1K7AA 3ZRGA 1FIPA 3H0DA 5A2QK 2ELHA 2RC4A 4CH7A 1R36A 3HRSA 3ZQQA 1YX3A 5AIQA 4QPQA 3IHUA 4UNOA 3QU6A 1ZHFA 3AG3H 2QWWA 4C30A 2Y31A 4IXAA 1MBHA 3E5XA 1Y0UA 2KRFA 4CYDA 4S04A 3OYLA 2K4BA 3SDGA 2IRFG 1WHUA 3KP2A 2EH3A 3CC4I 2KIMA 4C3JJ 1SANA 2CW0F 4TV7A 2LNBA 4IX7A 4V19K 1YW9A 3FZVA 3R0AA 2K9SA 2VBYA 5B66C 5HNFA 3IRQA 4S05A 5ILSA 3TEDA 2HR3A 3JW4A 1YOVB 3S2DJ 1FNNA 1HQCA 5FROA 2EBIA 1E2XA 4UB8C 4L9VA 4HSRA 4HDVA 5ERIA 3JRBA 2HS5A 2DJNA 3HOTA 4I6ZA 1UFMA 2R7FA 2QLZA 4ZYAA 2F5CA 3CMAI 2F5FA 4Q4ZF 2ZSHB 2OCCH 5EGOB 2YR2A 5K5OA 2WY8Q 2IPQX 1Y6IA 4UB6C 4B47A 3ZMTA 5IOYA 3S93A 4KFCA 2KDOA 1IDZA 3NEUA 2EQRA 3CCMI 1KU2A 2DDAA 4XN3A 1HC8A 2NRAC 1ERDA 4HYEA 2VKVA 3WHCA 1ZGAA 1CGPA 2R5YB 1IRGA 3V7SA 1E3HA 5J40A 5CQEA 4PJNA 3RSNA 3ERMA 3F8MA 1TL8A 1IGNA 3TMOA 4Y15A 3BTJA 1RKWA 2K9NA 3G1MA 3M8FA 2QBYA 1RETA 1E0EA 3BCAA 4ZTJA 1ZG5A 1YIOA 4C2UA 3HSFA 1BI0A 1I5ZA 3BC8A 3MKLA 1A6QA 3QOEA 3QP6A 4A5NA 4YFKF 2NXNB 5J6XA 3J81Z 2DA6A 3H0GJ 5HOOA 2PJRB 3W2WA 3W3CA 2DA1A 3BT9A 3D5LA 3K1MA 2A05A 1U5TC 5EF6A 2AO9A 2IS1A 2STTA 1E17A 2LF7A 2VBWA 3I54A 4FHTA 4PJMA 2O5RA 2VJ4A 2EIJH 3S3OA 3WU2C 3V42A 3OS0A 2Z9OA 2MG4A 2VOOA 1I27A 2HPMA 3F8NA 5FKNA 2A69F 1S9HA 1NH3A 1ZRDA 9ANTA 1V5GA 2G0EA 1PUFB 2R5ZA 4Q47A 5DYMA 4RB1A 1X1CA 3I4PA 3ZN1A 2EFWA 2YU9J 4PFPA 3BJAA 4U0WA 3WTYC 1YITI 2EZHA 4NDLA 2R7WA 5F0FA 4NNJA 2P0WA 1FBSA 1Z67A 2FD5A 1I6HJ 1WQ2A 3PUFA 5BS6A 4JBAA 3I59B 3I56I 2VJJA 3L2CA 5EZHA 4UXNA 1NK3P 3CCRI 2DPDA 4M6VA 3FXJA 3W6JB 3OYDA 2M0MA 3NRVA 1O3QA 2V1UA 1LB2A 3BR2A 2E1NA 3WTSC 3CDIA 2CUEA 3K69A 1Z77A 1T2KA 2Y69H 2A07F 3KZYA 5LGUA 5IY5H 2RDPA 1LKXA 1QQIA 3B6CA 1IN7A 3EUHC 4YFNF 3VSKA 4WK8F 5EDNA 4XSXF 2PQ8A 1SFUA 4MO7A 1Q1HA 3NAUA 2MGQA 1Z7LA 2V1XA 2R7QA 1QHGA 1R1UA 2NVYJ 2QENA 4JX4A 3CF5F 2DFEA 5M5YJ 2VB6A 1A36A 1RC9A 1XCBA 1V5EA 4CYCB 4ZTFA 3FIWA 1MBJA 4K2EA 1D5YA 5A2QZ 1KYZA 2GXAA 2D1VA 4ZZDA 1UCRA 1P4AA 1FYLA 4DYRA 2PX9A 1JUSA 2EA2A 5HS8A 3J80K 2M4KA 2K27A 2KP6A 3X2QH 2JVHA 3ZMZA 3EETA 3RQIA 2HKXA 3ERED 3GTGJ 3DQVC 3I71A 1MBGA 4LGWA 4PSWA 3SZTA 1B72A 4L0YB 3CZ6A 2E7WA 3UKGA 4AU7A 2NS8A 1R6RA 3E6MA 2Y2ZA 3ZP5A 4KYWA 2FRHA 3ABMH 5CLSA 3FWEA 2L7FP 5JLWA 5EG0A 1UG0A 2VI6A 5E20A 1SVMA 2E19A 2E1MC 3NWTA 3UR3C 4RM3A 4BL0B 1I50J 1X4OA 3HEFA 3TO6A 5J1RA 3HYIA 1MBKA 1OQYA 3GTPJ 4EJTA 3GBGA 1XMXA 4A0XA 2VE9A 3MZ8A 4E7KA 1MIJA 2A5YB 1HKSA 2FBKA 1JGSA 1P7IA 4M3GA 5HLGA 2E7XA 1ZRCA 5E1ZB 2FF4A 4Z2YA 4BUPA 2IGMA 1A31A 4L18B 3K1PA 4HV5A 1ON1A 2DFHA 1UB9A 2M45A 2HOSA 2WC2A 2O03A 4BHPA 5LHGA 2Q2EA 3BTCA 1I1SA 4Y7NJ 1TNTA 1KU7A 2MBFA 2R7XA 1LQ1A 5J47A 3OYBA 1I3QJ 4RGRA 5FRNA 2CQKA 4OU0A 1YJNI 2OTJI 3SDBA 3ZQCA 5D5WB 2NVXJ 1BOBA 1K83J 3MEXA 4MEXF 4WCGA 2NNYA 2XF7A 1EF4A 5C3EJ 1QVUA 4UUSB 3IKVA 2HVQA 2ID3A 3HKZN 2ICWG 4YIIA 1YW8A 2X51A 2EV6A 3C18A 5CVIA 2WAQA 3O6BB 4KITB 2LTPA 3TO7A 4OIRF 1D1AA 2JA7J 1BM9A 3PL8A 4Q5SF 3AL0B 5HVQC 2M0CA 2GOXB 3FXUA 3LSMA 2K9LA 5BMZA 1JXSA 5ED4A 2P5KA 1HXDA 1BJZA 4I98B 5D5VB 2KJBA 1MSEC 4PJLA 5E17F 2F5DA 4IQJA 2QGUA 3GFIA 1ZLKA 3WG7H 2BVLA 5BPIA 1TQIA 3GWZA 2MABA 1LDJA 2KHMA 5TJJA 1FIAA 4N0BA 5DV5A 2KDZA 3S15J 4BE1A 3CQZJ 2F2EA 4J01A 1TWGJ 1P6RA 2EK5A 2ZXWH 3RKQA 1HLVA 1HCRA 3QPHA 3DV8A 4B3XA 4E7JA 3I64A 3OYJA 1X3UA 2OC6A 1FJLA 4A2UA 1D0ZA 1D8JA 2XAJA 2BE5F 2CW8A 3RKXA 1NHAA 3GVAA 3I9V2 3K4BA 3MKWB 4KN4X 5BNGA 2R4GA 1JT6A 4HQEA 4UUVA 2P7VB 3VPRA 3IAS2 1ZQ3P 3CMEI 2A3SA 1JUMA 3WU0A 3PO2J 4EMSA 2R7UA 4MGRA 1IV6A 2DDBA 3CUQA 1I3AA 4KMFA 3S1RJ 2DOAA 3L00A 2M30A 2QKLB 4XLPF 2D2WA 1RR7A 2N8GA 3FHZA 3WTXC 1J7KA 1B4AA 4XONA 2TDXA 3RKYA 4BXFA 5FLXK 3C2BA 3H3ZA 5IT9K 4ZDPA 4M6XA 3U9GA 5K5QA 2VPLA 2VT2A 4FISA 4E70A 2Z16A 3ABKH 4QWQA 1YLFA 3S3MA 5GAEJ 2FBHA 2ME0A 3W6VA 4X6AJ 3HDDA 3TDUC 2K4JA 3OOPA 3QWLA 4EM1A 5EZGA 4ZC3A 1BR1A 2LK2A 4CCKA 4DBQA 3LQQA 5CPRB 4XRSG 3R0JA 4ANJA 4L5JA 1MMDA 4A69C 3J80Z 1R49A 5D6FA 1WJBA 5GTIC 4LLNA 5L3BA 1FX7A 2DMQA 2EFQA 2QVOA 1VQ8I 3MZYA 1VF9A 2XB0X 2KISA 2K3PA 3LSKA 2QKMB 1OJLA 4HV6A 4NQWA 2R7OA 5EEHA 1W7PA 3BDDA 3SFIA 4MTEA 4EJWA 2VKEA 1FOKA 4OIOF 5TRDA 1BIAA 2VJ5A 2E35A 4CCJA 1R4MB 3ABUA 1AU7A 4FE7A 1BW5A 2OPTA 1E3PA 4N9IA 2BZTA 2RV8A 2IEKA 2FU4A 2JRTA 2FUG2 2VT3A 1JI8A 3OSFA 3E0JB 1RR8C 4II3A 5L3EA 2F4OB 1T38A 2VKDA 2WBMA 2W82A 5FKOA 4ZZLA 1IC8A 1FSHA 2G9WA 2HKOA 4RMNA 4XLFA 1X1DA 2IA1A 3HTUA 2W84A 3DBLB 1MDMB 1GT0C 4F55A 1WJCA 2XAUA 1LDKB 5GP9A 1D1BA 2V9KA 4U87A 1ZK8A 2K5CA 3LSJA 5EEGA 3R6SA 3ZQHA 4PGHA 3O3KA 1XSDA 1FZPB 5BOXA 3H9QA 3H9JA 3DEUA 1JKQC 4BEHA 2O7OA 5IYDJ 2WADA 3S2WA 4IHYA 2IBDA 1LVKA 5FFZA 1RUNA 3ISPA 4KA4A 3PIOF 3CCUI 4HNVA 2XAGA 3WTTC 3F6VA 4B1RA 4CGZA 4LG0B 1BR2A 2EFOA 2FJ1A 1YX5A 4CXFA 2J5PA 4I7HA 3OYKA 3E5QA 5FFXA 2VUMJ 4MFEA 4ZH4F 2R7VA 2IGKA 1A35A 2KL4A 3H92A 4HX4A 6PAXA 1G2HA 1F4KA 3QRFF 2R5ZB 3L2UA 1R22A 1YRNA 2L02A 1KYWA 4IHTA 4KT5C 4BQOA 3K4CA 4HDUA 4BXUA 2JA6J 4DW6A 3BR0A 1OFCX 2ZXHA 3EUKL 2YU3A 3LA7A 4RDUA 4A0ZA 4U0YA 1SFEA 3HOXJ 4OOIA 4ZYDA 2D5VA 3LA2A 4XMYA 1B9NA 4O6JA 2Y0SA 3Q5FA 1B1BA 2Y30A 3JRHA 3H5NA 1Z6RA 4PFOA 1H9GA 2GBYA 2UV1A 3FXOA 3IH4A 1TTYA 4BAYA 3BCBA 3SZPA 2E71A 5HLHA 4RS8A 3V7CA 2UUZA 1PP8F 4M9XA 1USSA 1UJ8A 3FK6A 3KYCB 5TGTA 1OCRH 1ZR2A 2F4IA 2WB1N 1ETKA 3G3ZA 2STWA 4UY8I 2BY3A 3HOWJ 4G6TB 5ICFA 1YJWI 2DMUA 3BR5A 3HPHA 2G7HA 2DQRA 2X4HA 1J2XA 1B59A 1BI3A 1RI7A 2MYSA 1QZZA 1O57A 2JN6A 4HLYA 1F36A 2D45A 3V7RA 4XLCA 1XDSA 1G4DA 2HDDA 4MEYF 4DJAA 5DUKA 3DLAA 1DU0A 5GAGJ 5B1AH 2EB7A 1ZRFA 4RA2A 1DGRM 1X19A 2Z5UA 1OR7A 3ZCOA 2F6CA 3CCEI 2B9SA 1IZ1A 2EFPA 5E8GA 2P8TA 2BXZA 5E1WA 5J1UA 1B72B 3CMYA 3WTZA 4NC7A 3I4MJ 1J59A 1OMIA 4RAGA 3I0TA 4XQFA 4E7HA 1JHHA 4KNYA 4F91B 1SAUA 5IT3A 5EG0B 4YG2F 2PBIA 3K4LA 1LFBA 1BW6A 2V4JC 3GEZA 3TGNA 4F92B 3OWTA 1JE8A 3L7WA 2ZC2A 1RPWA 2CG4A 1Y8RB 2QSHX 3JRFA 2FSWA 2YS9A 4H0EA 3BG6A 4RAYA 3SQNA 1GUUA 3A0BC 1ZTRA 3HRMA 4F7ZA 1IF1A 2HOTA 1FY7A 2ZJ2A 2VQLA 4A3IJ 3JRCA 3QPTA 3PJRA 2JZYA 4GXOA 4UV9A 4X1EA 4YIRX 3CESA 2VLAA 2QM3A 2NVUB 2L7ZA 4UVBA 1A04A 1IN5A 4EM2A 3OL3A 4HBLA 4OAZA 5FD5A 3TKYA 2QF7A 4EGZA 3V8JA 4RB2C 2MLKA 2LY9A 3BP8A 2FEZA 2D1HA 2E36A 1OCCH 4J19A 1PYVA 1WWXA 2AHQA 2E1OA 3IL2A 3SEQA 1J75A 3OS1A 4AD9A 1FMWA 2XF6A 2HDWA 3DEEA 2EWNA 2OCEA 2P5LC 1XGNA 1X3WB 2ZSIB 4DYQA 5IP7J 5HODA 1W0TA 4F52A 2R93J 1UHWA 2O6GE 1QZYA 4D5CA 3HRTA 2CV0A 1T33A 3GTLJ 4WX9A 1YG2A 3RPUD 4RB3C 2Z33A 4KIGA 3ZXSA 2L9VA 5FJ8J 1GV5A 3A1YA 4II2A 3AAFA 3FMQA 1IUFA 1Z91A 2OQGA 1BA5A 2LKXA 1UAAA 4AUXA 4A5MA 1TT0A 2FMLA 2L9SA 4BJTA 1WH7A 2LSOA 5LHIA 4I2OA 3DFGA 1JTYA 2E5NA 2HQNA 2V9VA 1FTZA 5DS9A 1FSEA 3SYTA 1IDYA 4RGUA 2LR8A 2LH9A 2WV0A 1EJ9A 4G6DA 4L9NA 1GHCA 3HC7A 1T39A 3JREA 1JKPC 1XD7A 1LE8A 1FT9A 3ABLH 1R5HA 3U2RA 2ZCWA 3K4KA 5E79C 1XS9A 1QNTA 1MGTA 3AL0C 1MJ9A 4AVPA 1BL0A 3T8RA 5AONA 4L0ZB 3RYRA 1XGOA 4GYGA 2VC1A 3HPGA 3OY9A 5BQTA 3ZQIA 2M9HA 3CDLA 1YQAA 4PSXA 4BACA 5K7HA 2VN2A 3RZOJ 2FX0A 1DUXC 1IUYA 1T08B 2CO5A 2NAZA 2CSOA 2XF5A 4RGXA 2FQ4A 3M07A 3DTKA 2YUSA 2ACJA 4Y13A 2ZNZA 3M7GA 2VQGA 1WZ2A 2IA0A 4EJUA 2X1CA 1ETOA 3GYHX 1XMAA 3HHGA 4GCVA 3F8FA 3OIQA 1JKRC 2RNGA 3I4NJ 1EH7A 3M9AA 4NB5A 4LB6B 1AKHA 1WPKA 3TOAA 2DOFA 3OSGA 3A2KA 1P2FA 2DA7A 1VTNC 3BZCA 3MKYB 4XKCA 2LP0A 2LKPA 2EILH 3ECHA 4RM2A 1ZREA 2G7UA 2R7SA 3CCSI 2B7EA 1U8BA 4XIDA 1YS7A 3KX2A 3F8CA 4C3HJ 1LUJB 3F21A 3P5JA 1G3WA 1J5YA 1DP7P 2HGCA 1QO0D 2HVRA 1D5VA 2R3SA 3BPXA 4NQWB 1W7PB 1B6AA 2M4GA 4LMYA 2HQRA 1HSJA 3VYRB 2HZTA 4A12A 3IH3A 4EJOA 4AIHA 1R7JA 3OYNA 1AOYA 1BI1A 1MMNA 3EDPA 4I0BA 5KNLA 3E5UA 1N75A 4BH9A 3TW7A 3VOEA 1VZ0A 4KUMA 1VFCA 2MD0A 2OJED 4LFUA 4ESFA 3GTOJ 3HIFA 3IH2A 2JWTA 4D7MA 4YRVA 1ORKA 2LREA 2W85A 3C7JA 5F64A 3T5XA 5C44J 1GXQA 3UNGC 3HG9A 4BJ5C 4N9HA 3RQ4A 1R23A 3LAJA 3IAM2 2VIXA 5FO5A 3OIPA 2CW7A 1Z9CA 4IJAA 4P1WA 3G6EI 3HHHA 1U2WA 1K6YA 4GO1A 1Y0NA 2EZLA 1S8NA 2X9DA 3MQ0A 4BEHB 4G9YA 4RLQA 3KYLA 3A0HC 1WRJA 1B8IA 2ZJPF 4FQGA 3FMRA 4U0VA 5DUIA 2P6TA 2IGNA 2DA2A 3K4MA 5GPCA 4A3DJ 4LB5A 3CMMA 4XSZF 3ML6A 3H3VK 1TWHJ 4A6EA 2CUZA 2OZ6A 4D5FA 1G3YA 4AWXB 4M9ZA 4CICA 3LSHA 1O3SA 4BQQA 2B0LA 5LLQA 1ZAOA 1IXCA 2Y48A 1R4NB 5E3LA 4IRHA 4M3DA 4A3GJ 1CF7A 4HSTA 2EA4A 2L4MA 5H6RA 3G1OA 3WHBA 2VL8A 2OD5A 4G6QA 4BS9A 1MBEA 4LITA 3OYIA 1MNEA 2VOPA 3GMEA 2O8XA 2XAHA 3D5SC 2ZMEA 1X1PA 4HF0A 3RKWA 3HZJA 1REPC 1YS6A 3VYTB 4AYBA 5EEAA 4G12A 1L0OC 5ICEA 5ICCA 2IP2A 1RNLA 1MZBA 4HW0A 2V6EA 4A3MJ 3FBNB 3VYUB 1Z1DA 1T95A 3T0YA 1Q1VA 1O3TA 1DU6A 4IVNA 3KCCA 3FXMA 4XRSA 2VQCA 3Q0UA 1QU3A 2XB5A 4B09A 2DFIA 4ITVA 5CJ9A 2KT0A 1FEXA 4GGGA 2QEXI 3F8BA 3VFZA 4IKFA 1OCPA 4NHJA 3KP5A 3TQNA 2ZJQF 3BR6A 1G8XA 3GX4X 1JTXA 3OS2A 1QA6A 1ULYA 1XCVA 5KCMA 2XV4S 2CV2A 3CP2A 4LG3A 2HI3A 4B4CA 5HNHA 1R1VA 4UVCA 3SJMA 4PJJA 1VQ7I 2DJIA 5K5RA 4PGGA 5C4JJ 1USTA 3OYHA 5M3MJ 1A5JA 4PZJA 2RGVA 4JOMA 4H4KC 2XPVA 4KJZA 3F3XA 1VQOI 3QAHA 3PFIA 1U78A 4KIFA 5J4YA 2L9NA 2M34A 3CCQI 4GYIA 1XMKA 3GFLA 5K7FA 5H6QA 1TQMA 3S14J 1TNSA 3I3LA 1G3TA 1IXRC 2H6CA 1LFPA 3RCOA 1EV7A 1XPXA 1U8RA 1UZCA 2QZ8A 2QUFA 4XN0A 1PUEE 4NC6A 2XAFA 2DFFA 2HPIA 3S17J 3PIPF 3IV5A 2HDCA 3TP0A 2BVMA 5F0HA 2HZDA 2X6WA 2ME6A 3KP3A 1MH3A 1X1AA 2KFDA 1N25A 2V9PA 5DCMB 2L3DA 1I1GA 3DP7A 3HOZJ 5CYVA 2F48A 1PJRA 2JSPA 4ZYHA 4A3LJ 2ETHA 3W2VA 1U0JA 1F5TA 2BW3A 3AG2H 4DNCA 1HW5A 2HXIA 1BR4A 3GZNB 1K78A 1GDTA 2GXBA 3E7LA 3ONQA 1H89C 2LYCA 2LDUA 2ELJA 3P9CA 5F1JA 5L3CA 2BY2A 3ZGKA 2Q0OA 2LC2A 2LVSA 3BG9A 4XKVA 3J7AO 2YX4A 1P4XA 3PQJA 5LBQA 4WXDA 1Y1WJ 2DXIA 1YTYA 1D1CA 1V55H 3LA3A 3HB9A 3GF2A 1D3YA 3QPSA 4KICA 2K9MA 4IHWA 5F1RA 4XLEA 3C3WA 1QPIA 3B6AA 1X2MA 2J5OA 2I5UA 3MFKA 2CQQA 2HOAA 1OISA 3K9TA 2DTRA 3BR3A 1FTTA 3CJQB 4BKXA 3LSTA 3JRIA 3EPZA 1MD0A 3AG1H 3FK7A 4BU2A 4BQAA 3H36A 1J0RA 3CCJI 4IRGA 4XKWA 5CVVA 1Z7UA 2KKOA 3V8KA 3QYEA 3G73A 3HM5A 1UELB 2JT1A 3N97A 4HF1A 4ENNA 4XORA 2KJCA 4XK4A 3S1QJ 3COAC 2TCTA 2KIFA 4IQ4A 3WGGA 4XICA 2IS2A 3VSLA 3OYMA 1OYIA 2F4MB 3P9KA 5DCFA 1ON2A 3JTHA 2W57A 4CSWA 3S16J 3JCUC 5KAIC 2K86A 2COBA 2FOKA 1D0XA 1WCMJ 2XRNA 1Y39A 2CJJA 1IV8A 3CC2I 3CO6C 1QGPA 5GTHC 4E7LA 5KVRA 4D9JA 4BY1J 2VC0A 1B9MA 4HNUA 2DMNA 1RIOH 4CA0A 2Z2SB 1PDNC 1YJ9I 1TBXA 2X85A 3LFKA 3VODA 4PK4A 2K9QA 4Y52J 4LK0F 4NUBA 4X0GA 1ZGWA 3KEYA 4A3EJ 2OUMA 3C1DA 2LFBA 1Z0XA 3QODA 2MSYA 4UVAA 2CMPA 2KIUA 5ILUA 2GLOA 2PEXA 2GAUA 1U9OA 4F93B 3ELKA 5DDGA 2JJ7A 3IRRA 2R5YA 3TL4X 4MLOA 1ZGJA 1T0FA 4L5EA 3ULQB 1ZG1A 4Y17A 3CLQA 4I02A 2ZNYA 4PDKA 2E2IJ 1BOAA 2DA3A 2KZGA 3AG4H 1BJAA 4G7HF 1AKHB 5L3FA 4QIWN 2EZIA 4BDYA 1FP1D 1HW1A 4B8XA 2PJRA 1VQPI 3ZQFA 2OAZA 1HSTA 3OR2C 5M5XJ 5HS7A 1ZELA 2NVTJ 2O3FA 4EEFG 4OWRB 3ZOBA 3KETA 3DCFA 3S2HJ 5D8LB 5IPAA 3M1CA 5M5WJ 3PO3J 3ZQLA 2QBYB 3CUQC 5CVRA 4BQNA 3Q3SA 2DOEA 2L5QA 1PUFA 3J7AY 3M3YJ 3AKZA 1EH8A 3M8EA 3V4GA 1P7JA 2XHKA 5LFAA 1ZKGA 2JMWA 2NOGA 3FM3A 2UXXA 1LPQA 1W36C 1WI9A 4G7OF 1BC7C 3W6KB 4BBRJ 4GFBA 2EV0A 3ABTA 1WH5A 5D4SA 3BY6A 1J9IA 2BEOA 1D0YA 1F9NA 1FMVA 2DW4A 4U7DA 2HNHA 2NNNA 2V6CA 1HA8A 2UWMA 2CQ7A 3FX3A 5IYBJ 3P7NA 1GLNA 2K7LA 1AHDP 4HOBA 2WWYA 3L1PA 4FETA 4LIVA 4XLHA 2V1DA 1IAWA 3FM5A 2Q8KA 2XKOA 3N4MA 2XGXA 3CP8A 3GLLA 4HEA2 2F5EA 1LFUP 3BR1A 1TT5B 3QPLA 1V4RA 2Q1ZB 2OZUA 4DOZA 3RDIA 4OINF 5L3GA 2GIVA 2X0LA 2P81A 3CCYA 5F04A 2XPWA 1BIBA 3DPUA 3RJPA 5CQGA 5F0CA 5LGNA 2BHZA 3LWFA 5FB2A 1WGXA 4HZFA 2DN0A 2JPBA 1B8IB 4QTRA 2HWVA 1VQLI 2ESHA 2EJRA 3MN2A 1OPCA 2ID6A 4ZYEA 4P9FA 4QPOA 4MNUA 1FC3A 5M3FJ 3HXLA 4DZJA 1ITYA 1CQTA 1V3FA 3NWSA 2JUCA 1ETVA 2DYSH 4HA8A 3E1SA 2Z99A 2XASA 5K1YA 3BG7A 4MHGA 1T8IA 1O7FA 3ESWB 4JP0A 3Q0VA 4M74A 1IJWC 2RREA 3S1MJ 2QSFX 3TO9A 1KZHA 1R58A 1SFKA 1H8AC 2Y9ZA 4LOCA 2AQEA 3VB2A 2HTJA 3H5RA 2ZBKA 1PP7U 2ZMEB 4M72A 1WKMA 1IN8A 2XGCA 3A02A 4YEJA 5F08A 3TOBA 5E3OA 4GDFA 4M71A 5DEQA 5GPAA 2E34A 4EQQA 2Z3YA 2ZXIA 4DZPA 1MW7A 2NOJB 2DI3A 2ECBA 3MMYB 4N4OB 1MJAA 5FLXZ 2IJLA 5IT9Z 2RNJA 3CJTB 4M6YA 2LD5A 1DGWY 1BC8C 1LNWA 4NBQA 4YIFA 3BLYA 3WG9A 4BJ6C 2FE3A 1SEUA 2EIKH 3RPQA 3CC7I 1U6GA 4HQMA 5J8FA 3DKXA 1TW3A 2E60A 3FXQA 3GCMA 1T98A 1HKQA 1PVEA 3ASOH 4P9UA 3OOUA 5JVGF 3PM1A 2LMDA 3J81K 3A4CA 2HQAA 5GAHJ 2LRDA 5DM7F 3IKTA 3E6BA 1FYKA 1IRXA 4XBFA 4UUTA 1R71A 3DKYA 3M1EA 4KDPA 1ZYRF 3C2HA 4UUSA 1MJBA 2WAQN 3DPTA 5LD2C 2Q2EB 1TP4A 4F3QA 2RQPA 5DD4A 4EJVA 3IUOA 4FASD 1Y56A 4WWCA 3IWFA 1KQ9A 2LY1A 5JHUA 3HJEA 3K1NA 2PLYA 1H0MA 2JVGA 3OYGA 4G94A 3KP4A 1QVTA 3MVPA 4HX7A 4CCLA 4JYKA 3WTUC 2QQAA 2QQBA 1UG2A 5E18F 5H2FC 2X6XA 3WODF 4IL6C 1ETQA 5B5EC 2BV6A 2L4AA 3ZQGA 1ETXA 4JX5A 1ENHA 2CU7A 3GO5A 2FQ3A 3DF8A 4HLXA 4LIUA 1GV2A 2HU9A 1O7LA 3F9KA 2BW3B 2R7RA 1YHQI 4IO9F 3KLOA 3K70C 5KAFC 4E6KG 2CFOA 1P9QC 4ABZA 3BTIA 4BXXJ 2H94A 3GFMA 4XOTA 1LEAA 4BE0A 1ONVA 3FISA 1SD7A 2H6BA 5GADJ 4FX0A 2GXGA 5KHDA 2BYVE 2CV1A 1TWAJ 5JFRA 1HDPA 1Z3XA 1FLIA 3BQZA 2VJIA 4CZCA 5J8CA 2KRHA 2KZVA 5B1BH 1DPUA 1O3RA 2FNAA 1TC3C 2GIZA 3GTJJ 2PJPA 3O8HA 5FKLA 1SFOJ 2A6TA 2MA3A 4W97A 2A6HF 3J7ZI 1RESA 1TQPA 4GRIA 5EJCA 2FMYA 2W7NA 3A01A 3FXLA 2M5WA 1U5TA 3EQLF 5IYCJ 3HGGA 4KIBA 4DIQA 3K0LA 3H3UA 3ZR8X 3OYAA 3NQOA 2L9RA 3FXKA 3OL4A 2RVCA 2GWRA 4P55A 2XSDC 1FOXA 2JPCA 4ENMA 1ACIA 4KMUX 1JJ8C 3HOYJ 4IHXA 1J09A 3CUQB 4S0HB 5D4RA 1Z21A 3PNVA 3J7YJ 1Z05A 2DBBA 3BWGA 2A6EF 5FLMJ 2HYJA 3JRGA 1POGA 2DYRH 2OA4A 4I09A 1XG1A 3B73A 3BOQA 1Y1VJ 2DT7B 4BBSJ 2KMUA 3DPLC 2XPUA 2MC3A 4HF2A 3CJRB 3M4OJ 1X58A 3FDYA 1RKTA 4G8XA 4D7NA 2TRTA 3K2ZA 1AWCA 2JA8J 2X6YA 2DA5A 2EV5A 2LBFA 3PFYA 3F23A 4A3BJ 5FGMA 4IOAF 2DMPA 2M8EA 3H35A 1KQ0A 2GA1A 2OTLI 2F5VA 2WA0A 1QZEA 3HRUA 4QLCU 3EUHA 2MW8A 3CTAA 4DBRA 3B02A 2OQRA 2MD5A 3M8JA 3KEOA 4NC8A 2HQ5A 3KLNA 4D1QA 1DPRA 1BN5A 3EYIA 3VEPA 4P5OA 1VQMI 1MMGA 1UHSA 1MDMA 1ODDA 3D5RC 3LMMA 1YW7A 5E3NA 3LSRA 4EVIA 5JR3A 2JQ7A 2CFXA 4HX8A 2CQNA 1HF0A 3RYPA 1TLHB 3E6DA 4R1HA 4BGDA 4FE4A 1K79A 1RUOA 1MKMA 3R60A 4EGYA 2H1KA 1FYMA 2W4SA 3MWMA 2YPRA 4W1UA 2EPFA 2QYOA 2Z1DA 3LSPA 3OR1C 4LG0A 4E7IA 1YIJI 3GXOA 2W24A 1DQUA 3HBLA 2H1LA 3HTSB 2RAEA 2M7AA 2H09A 3JSOA 4IF4A 4B3AA 2X48A 5AIPA 4AC0A 2ZJRF 1MSFC 3RPUA 2IXSA 2R7ZJ 3S3NA 1BI2A 1IG7A 1Z6TA 2CRGA 4IEJA 2PI0A 3FKIJ 3PNYA 2ISZA 3C2GA 4OMYA 1TW2A 2LKSA 1DDNA 2PMZA 2NYXA 2DCEA 2ISYA 3CO7C 4C2TA 1U3EM 1WJDA 2HYGD 1KU9A 5E8IA 2V26A 1XSXA 2Y0SN 4I76A 2LG4A 2BY1A 5IOZA 1I39A 3IP4B 5B3SH 2ZXJA 3ZN0A 1WSUA 2XUBA 1OCOH 3PQKA 4CCMA 1BBYA 2AXLA 3QQAA 4BHBA 1YRNB 1QRYA 4A6DA 2R0QC 1SFXA 3I58A 5LHHA 4B44A 3BQYA 4DQ2A 1FOYA 1X3ZB 4EM0B 2IW5A 1XX5A 5HDGA 1W1WE 3HOSA 1ZN2A 4RBOA 3FXRA 1NTCA 2FOWA 3HUGA 3OYCA 3OYFA 2ZB9A 3F72A 3OMYA 2JK3A 2XRLA 3BJOA 4J00A 2JTVA 1SVOA 1JT0A 3S8PA 3GTQJ 4A93J 1WJEA 2CH0A 3GZ5A 2WTEA 2GZWA 2W1OA 1R1TA 1YO5C 4ZDOA 4AIDA 4HG2A 1L3LA 3FBIB 1FPQA 2CQXA 2L7MP 1JKOC 4I01A 2IAIA 5LEJA 3JAMK 1W4MA 2VONA 5L3DA 3D0SA 2WB1A 3LFUA 1WJAA 3MKZA 1NG6A 2HTSA 3BG3A 1W36D 1GVDA 1OYYA 2AXTC 4AM3A 1X2NA 2CGPA 1TZLA 2EFNA 3F6OA 3WTWC 1SAXA 2Y9YA 1K6OA 3REOA 3K6GA 4V2FA 2XAQA 2XIGA 3ZMVA 1V5FA 1M1EB 3GTKJ 2GM4A 2L01A 1XC5A 4KISA 3VYSB 5HDKA 3KIOA 3K2AA 2JSCA 2K40A 3BZ6A 5K7ZA 3OYEA 3SEZA 1XGSA 1RZ4A 2DK8A 3FKJA 4KT6A 4IOCF 2ZFWA 3FHNA 2XROA 3L2RA 5LEKA 3DBRB 2P4WA 5F6FA 4LK1F 1NK2P 1K4TA 2DLLA 3ROUA 4ASNA 2IA2A 2DK5A 4YFXF 3DKWA 2QSGX 4IRIA 3EYYA 3CDHA 2WAEA 4MTDA 3A03A 5LRRA 1KU3A 1W7PD 2QA4I 3GFJA 2R7DA 2BXYA 2K02A 3JRDA 1MMSA 3RI4A 2WV1A 2ECCA 4M73A 3WTVC 1S3JA 3I53A 2MH2A 3O2PE 2B63J 4I99C 1OYWA 1ZLJA 1U9NA 2ZKZA 1IRFA 2BGCA 1ZG3A 2ZMEC 2IVMA 4LLLA 5DTDA 5HS9A 1LVAA 3PUBA 2XSJC 1OLTA 3DTEA 4ESJA 3KP7A 1YI2I 4U88A 3LSGA 5D5XB 3FF5A 2Y75A 4LLGF 1STZA 2XC7A 1O4XA 1GVJA 1F43A 2QQ9A 2CS3A 2GOMA 4Y33A 1QPMA 3WE3A 3VDXA 2PFBA 5ILVA 2HYFA 4E7ZA 4RAFA 3WU1B 5IP9J 2P6SA 2H8WA 3MCZA 1W0UA 2VE8A 3GUDA 3ZMDA 4B48A 2QQ8A 4MQVA 4A3JJ 1K4SA 4BDZA 5JHFA 5EYRA 3HL2A 4XRMA 2CWEA 4LD5A 4R79A 2ZO4A 3LSIA 1APLC 3N05A 1YE9A 3SZGA 4ON0A 2O61A 4UHTA 4C9YA 4FX4A 5FD6A 1Z3YA 3LQRA 3O8GA 4M3EA 1FBQA 2DT5A 3RIRA 3U21A 1SVLA 3KE2A 5J4VA 2P5VA 1W5SA 4O5VA 1S5LC 2JUGA 1MNDA 2LLKA 4AVZA 4G7ZF 3FMSA 4CUGA 2YSRA 4ETSA 2DT6A 3JTGA 1V54H 2DAOA 3K7AJ 5J1YA 1QHHD 1S7OA 3DXJF 1IN4A 3SFZA 4QSHA 4CDGA 3DTIA 1N77A 2BY0A 3F0CA 1MBFA 3E3VA 1VQ5I 3KP6A 2VBZA 3V8LA 2DPUA 2PN6A 1KONA 3SHFA 3TW6A 4V2GA 5HDNA 4IPAA 4L9TA 2HOEA 1XDUA 1N78A 5HLTA 5DM6F 4RGSA 5E1XA 4FCYA 1R9TJ 2H27A 3CCVI 3CLOA 4E4HA 4XM3A 2RQQA 3G1LA 3F22A 1S6LA 1OCTC 1P4WA 1S7EA 2X6OA 1LE8B 2O0YA 2Y0MA 3HSEA 4PUSA 3A01B 1I6XA 4HNTA 1KGSA 1OCZH 2VBXA 1S29A 5EGOA 1U5TB 3E97A 4FT8A 5TISC 3ZMUA 5JVTA 1K61A 4WXHA 1R00A 3KZIC 3DU5A 1HDDC 3HOUJ 1WJFA 5ICGA 2IT0A 5C4XJ 1VQ9I 4C3IJ 3JR9A 2I10A 1GXPA 4AIJA 2PMHA 2FNPA 2BHYA 2P7CB 5IP6A 1FBUA 2JA2A 5JLXA 4XOPA 3DWLE 2EIMH 3CCLI 4RAZA 4XLNF 2FA5A 4PCQA 2HEOA 2LF8A 2V1NA 2XGDA 2M87A 2AS5F 4E7SA 4ENJA 4WXCA 2XGEA 1H88C 2L7KA 2HFHA 3Q9VA 3K70D 1EH6A 3JAMZ 3K4NA 2GQQA 4CHUA 3QOPA 4A3KJ 2E2JJ 2CYYA 5FKKA 5FLVA 4JK1X 2K3FA 2KIQA 3CJNA 2NS7A 3GTMJ 1DP3A 1QBJA 1VNDA 1WFXA 3KZZA 1XSVA 2DA4A 4D0PA 2H8RA 2O9LA 1ETYA 1KA8A 1HW2A 2BBYA 2LBFB 4BY7J 3KPHA 1EA3A 5D6EA 4PJ0C 4L9JA 3BZKA 5E3MA 1SMYF 5KK1A 3QYFA 2PMUA 3OV8A 1YYVA 2LY2A 2OBPA 1KQ8A 4XR6A 1ZR4A 3L2WA 1D8KA 2VQHA 4EATA 4ZJZA 3DBHB 1W5TA 2MLGA 3L2VA 2DO7A 1AA7A 3ZMSA 2IGOA 3BROA 2GA2A 3AFHA 3PSFA 4DYCA 2M7BA 2EZKA 2WY7Q 1XGMA 2L0KA 4N4NB 3LOCA 5D5UB 2AQFA 5F27A 3ZPLA 1F1ZA 4OIQF 3W2AA 1SD4A 2L54A 2W00A 4IHSA 3I59A 1YFHA 4O3MA 2V79A 3L2QA 3OIOA 3KEQA 1X4PA 3BG5A 3ZQ7A 5DD8A 3PSIA 2OV7A 2PMZN 2DMTA 3MZHA 2ELKA 4XRFA 1S72I 4ENKA 1JHFA 1G3SA 4IZZA 5LRSA 4Q48A 4IHVA 2NVQJ 2VXDA 4XLAA 3CUOA 4DGWB 4BNCA 3G71I 3GW2A 3LL7A 3ASNH 1IW7F 2KQRA 1ZARA 2UXNA 3D1NI 2E1MB 1IRZA 4B43A 4WF2A 4XL9A 4OIPF 1IN6A 2VPRA 2M1BA 2JRMA 2KPMA 1XN7A 2KRCA 3RZDJ 3L9FA 2DODA 2OF7A 4CYCA 2E2HJ 1P92A 2MC4A 1LDDA 2E5ZA 2LOOA 1T0FC 3DU6A 3JSPA 4AYBN 4ZDLA 5JI6A 3S32A 1FP2A 4AIKA 2O8KA 1R5GA 5CVUA 4YELA 2M2EA 4KN7X 4MFDA 3G4SI 2MH9A 5CVJA 1CF7B 4OMZA 4OAYA 4P96A 3QU3A 4LJZF 4A3FJ 3CD6I 4HAMA 4Y4RA 4ESBA 2CUFA 1H9TA 2VODA 1S7AA 4BE2A 1SD6A 2L2OA 1R5ID 3R61A 4MIMA 3VWBA 2EINH 4CZZA 3H1CA 4M3BA 4JQFA 3S1NJ 2W25A 3HUGB 3BTLA 1MNMC 3LAPA 4L5IA 1HOMA 1G59A 2K85A 1XTAA 5H20A 1WJ5A 3QP5A 3WGHA 3I5UA 3PNTA 2RKHA 5FRMA 2PG4A 1LEBA 2JA5J 3LNQA 2IS4A 4A3CJ 3DLLF 3TP3A 2UZKA 4EV0A 1HKTA 1WI3A 2ADUA 3CF2A 4HPQA 4CO8A 2QCOA 1SC7A 3H9GA 2V7FA 2HVSA
chains in the Genus database with same CATH topology
5M3MJ 1TWFJ 2DMPA 1A5JA 2DMQA 2XPVA 1VF9A 3HOVJ 2XB0X 3Q0WA 1MH4A 3SFIA 1U78A 1OJLA 2HXOA 2M34A 2VKEA 2MW8A 5J3LA 1UMQA 5K7FA 2HQ5A 3S14J 1AU7A 4FE7A 1BW5A 2OPTA 2IEKA 1UHSA 4JX6A 1A6IA 3OSFA 4C2MJ 5E3NA 3S17J 3LSRA 3IV5A 3TP0A 3NARA 5FKOA 1IC8A 5F0HA 2ME6A 1MH3A 1HF0A 1GT0C 4FE4A 5GP9A 4FTHA 1ZK8A 3LSJA 1VI0A 2H1KA 3ZQHA 3HOZJ 1T56A 4A3LJ 4W1UA 1JKQC 3LSPA 2HXIA 4M3FA 2O7OA 1GDTA 3JRAA 2W48A 5IYDJ 3E7LA 2IBDA 4IHYA 1H89C 3HBLA 2RAEA 5F1JA 4HNVA 2LVSA 4B3AA 2X48A 3BG9A 1TWCJ 4AC0A 4B1RA 1MSFC 3HGYA 2R7ZJ 2FJ1A 1Y1WJ 5FKMA 1IG7A 2R92J 3HB9A 2CRGA 2DTZA 4IEJA 3QPSA 3FKIJ 2VUMJ 4MFEA 4IHWA 1JGGA 1QPIA 1JJ6C 1G2HA 3B6AA 1X2MA 1JUPA 2CQQA 1ETWA 2R5ZB 1YRNA 1E3OC 3DEWA 4I76A 2Y0SN 2HOAA 5IOZA 2M8GX 3BR3A 1FTTA 4BKXA 3JRIA 3FK7A 4DW6A 2JA6J 3BR0A 1FIPA 1OFCX 3QQAA 1YRNB 4RDUA 1QRYA 2R0QC 3HOXJ 2D5VA 3HM5A 3BQYA 2Y30A 3JRHA 2GBYA 4RBOA 4XK4A 3S1QJ 3IH4A 1NTCA 2TCTA 4XICA 2Y31A 1MBHA 2ZB9A 2JK3A 2XRLA 3S16J 1JT0A 3FK6A 1ZR2A 3SDGA 2COBA 3GTQJ 4A93J 2WB1N 1ETKA 1WCMJ 2EH3A 2CJJA 4C3JJ 1SANA 3HOWJ 2DMUA 2CQXA 2L7MP 4BY1J 3BR5A 1JKOC 2IAIA 2K9SA 3TEDA 2DMNA 3S2DJ 2JN6A 2EBIA 1F36A 3JRBA 2DJNA 3BG3A 2HDDA 2K9QA 4Y52J 1DU0A 1GVDA 4I6ZA 1X2NA 1ZGWA 4A3EJ 2Y9YA 2LFBA 1Z0XA 5EGOB 4V2FA 2MSYA 5J1UA 1B72B 2GLOA 3CMYA 3I4MJ 3GTKJ 1U9OA 2GM4A 1XC5A 5IOYA 2JJ7A 2R5YA 3K2AA 4MLOA 2K40A 5EG0B 5K7ZA 1IDZA 4L5EA 2EQRA 2E2IJ 1LFBA 1BW6A 2DA3A 2VKVA 3WHCA 1AKHB 4QIWN 2R5YB 1NK2P 1RPWA 2EZIA 1IGNA 3JRFA 2YS9A 3ZQFA 3BTJA 1GUUA 5M5XJ 1RKWA 1ZTRA 2K9NA 3A03A 3G1MA 1RETA 2NVTJ 3JRDA 2HOTA 4EEFG 2WV1A 3MKLA 2ECCA 4A3IJ 2DA6A 3ZOBA 3JRCA 3H0GJ 2B63J 4X1EA 3S2HJ 3DCFA 1U9NA 5IPAA 2DA1A 3BT9A 2L7ZA 5M5WJ 5DTDA 3PO3J 3ZQLA 5EF6A 2AO9A 3Q3SA 1PUFA 3M3YJ 3LSGA 1P7JA 2QF7A 1ZKGA 2MG4A 2JMWA 2NOGA 5FKNA 2LY9A 1O4XA 9ANTA 1F43A 4J19A 2G0EA 2E1OA 2AHQA 1PUFB 2R5ZA 4BBRJ 4GFBA 5IP9J 1W0UA 1WH5A 4A3JJ 2YU9J 4DYQA 5IP7J 2EZHA 5EYRA 4NDLA 5HODA 1W0TA 5IYBJ 5F0FA 4XRMA 1AHDP 2R93J 2FD5A 3L1PA 1APLC 4D5CA 1T33A 3GTLJ 1I6HJ 3O8GA 4M3EA 5EZHA 1NK3P 1LFUP 3BR1A 4M6VA 3QPLA 5FJ8J 1GV5A 2P81A 1IUFA 2LLKA 3BR2A 3CCYA 2XPWA 5F04A 1BA5A 2LKXA 2CUEA 1Z77A 5F0CA 4AUXA 1WH7A 1WGXA 1JTYA 3K7AJ 5J1YA 2DN0A 1B8IB 4QTRA 1FTZA 3B6CA 3MN2A 4QSHA 2ID6A 5DS9A 5EDNA 1IDYA 2LR8A 3F0CA 1MBFA 4MO7A 5M3FJ 4DZJA 3NAUA 1ITYA 2MGQA 1CQTA 3JREA 1JKPC 2NVYJ 1ETVA 4JX4A 3TW6A 4V2GA 5M5YJ 1LE8A 4CYCB 4FCYA 1R9TJ 4JP0A 3FIWA 1MBJA 3Q0VA 1XS9A 1IJWC 1D5YA 3S1MJ 3G1LA 1OCTC 1BL0A 1S7EA 4DYRA 2X6OA 2Y9ZA 1LE8B 4LOCA 1JUSA 1H8AC 3A01B 3RQIA 5EGOA 3GTGJ 3ZQIA 2M9HA 1K61A 3CDLA 1MBGA 2XGCA 1B72A 3A02A 5F08A 5E3OA 5K7HA 3UKGA 1HDDC 3RZOJ 3HOUJ 2NS8A 2FX0A 5GPAA 2Y2ZA 5C4XJ 2FQ4A 4C3IJ 3JR9A 2I10A 4DZPA 2YUSA 5IP6A 2ECBA 2L7FP 5JLXA 5JLWA 5EG0A 2VI6A 2E19A 1ETOA 2LD5A 1I50J 3HEFA 1JKRC 5J1RA 3GTPJ 1MBKA 3I4NJ 2XGDA 1AKHA 1WPKA 3GBGA 3OSGA 2DA7A 2XGEA 1H88C 4A3KJ 2LP0A 2E2JJ 4M3GA 1P7IA 5FKKA 3OOUA 5FLVA 3PM1A 2NS7A 3GTMJ 1VNDA 2DA4A 4XIDA 1U8BA 2H8RA 2O9LA 1ETYA 2HOSA 4UUTA 4BY7J 3BTCA 4C3HJ 4Y7NJ 5E3MA 1I3QJ 4UUSA 1ZR4A 2WAQN 3ZQCA 2NVXJ 1K83J 1EF4A 5C3EJ 1QVUA 4UUSB 3IH3A 4DYCA 2EZKA 2ID3A 3HKZN 2L0KA 3LOCA 5F27A 3TW7A 1VFCA 1QVTA 3MVPA 3GTOJ 3IH2A 2LTPA 2JWTA 4D7MA 4JYKA 1ORKA 2JA7J 1UG2A 5C44J 2M0CA 1ETQA 3ZQGA 3OIOA 1ETXA 3BG5A 4JX5A 1ENHA 2CU7A 1BJZA 1MSEC 2PMZN 1GV2A 2DMTA 2ELKA 2EZLA 2X9DA 2NVQJ 4IHVA 1B8IA 1FIAA 4ABZA 3BTIA 4BXXJ 2KDZA 2DA2A 5GPCA 3D1NI 3FISA 3S15J 4A3DJ 3CQZJ 3H3VK 1TWHJ 1IRZA 4D5FA 1TWGJ 2VPRA 1TWAJ 3RKQA 1HLVA 1HDPA 1HCRA 3BQZA 3RZDJ 1FJLA 2OF7A 5E3LA 4CYCA 2E2HJ 4M3DA 4A3GJ 1TC3C 3GTJJ 4AYBN 2O8KA 3O8HA 3G1OA 5FKLA 3WHBA 1SFOJ 1MBEA 4W97A 5BNGA 1JT6A 2M2EA 1RESA 4MFDA 3VPRA 3A01A 1ZQ3P 1JUMA 3PO2J 5IYCJ 4A3FJ 3HGGA 1IV6A 2CUFA 5EEAA 3S1RJ 2L9RA 4G12A 2XSDC 1RR7A 2N8GA 4MIMA 4A3MJ 3C2BA 1Q1VA 1JJ8C 4M3BA 4IHXA 3HOYJ 4S0HB 3S1NJ 1DU6A 3BTLA 1MNMC 1HOMA 5FLMJ 2HYJA 4XRSA 3Q0UA 3JRGA 1POGA 2XB5A 4FISA 2KT0A 1FEXA 1XG1A 4BBSJ 1Y1VJ 3W6VA 2ME0A 4X6AJ 3HDDA 2XPUA 2JA5J 1OCPA 3LNQA 3M4OJ 1X58A 5EZGA 4A3CJ 3BR6A 3TP3A 1RKTA 1JTXA 1WI3A 4D7NA 2LK2A 2TRTA 4B4CA 2HI3A 3SJMA 2JA8J 4XRSG 2DA5A 2QCOA 4A69C 5C4JJ 4A3BJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M3M J;  1TWF J;  2DMP A;  1A5J A;  2DMQ A;  2XPV A;  1VF9 A;  3HOV J;  2XB0 X;  3Q0W A;  1MH4 A;  3SFI A;  1U78 A;  1OJL A;  2HXO A;  2M34 A;  2VKE A;  2MW8 A;  5J3L A;  1UMQ A;  5K7F A;  2HQ5 A;  3S14 J;  1AU7 A;  4FE7 A;  1BW5 A;  2OPT A;  2IEK A;  1UHS A;  4JX6 A;  1A6I A;  3OSF A;  4C2M J;  5E3N A;  3S17 J;  3LSR A;  3IV5 A;  3TP0 A;  3NAR A;  5FKO A;  1IC8 A;  5F0H A;  2ME6 A;  1MH3 A;  1HF0 A;  1GT0 C;  4FE4 A;  5GP9 A;  4FTH A;  1ZK8 A;  3LSJ A;  1VI0 A;  2H1K A;  3ZQH A;  3HOZ J;  1T56 A;  4A3L J;  4W1U A;  1JKQ C;  3LSP A;  2HXI A;  4M3F A;  2O7O A;  1GDT A;  3JRA A;  2W48 A;  5IYD J;  3E7L A;  2IBD A;  4IHY A;  1H89 C;  3HBL A;  2RAE A;  5F1J A;  4HNV A;  2LVS A;  4B3A A;  2X48 A;  3BG9 A;  1TWC J;  4AC0 A;  4B1R A;  1MSF C;  3HGY A;  2R7Z J;  2FJ1 A;  1Y1W J;  5FKM A;  1IG7 A;  2R92 J;  3HB9 A;  2CRG A;  2DTZ A;  4IEJ A;  3QPS A;  3FKI J;  2VUM J;  4MFE A;  4IHW A;  1JGG A;  1QPI A;  1JJ6 C;  1G2H A;  3B6A A;  1X2M A;  1JUP A;  2CQQ A;  1ETW A;  2R5Z B;  1YRN A;  1E3O C;  3DEW A;  4I76 A;  2Y0S N;  2HOA A;  5IOZ A;  2M8G X;  3BR3 A;  1FTT A;  4BKX A;  3JRI A;  3FK7 A;  4DW6 A;  2JA6 J;  3BR0 A;  1FIP A;  1OFC X;  3QQA A;  1YRN B;  4RDU A;  1QRY A;  2R0Q C;  3HOX J;  2D5V A;  3HM5 A;  3BQY A;  2Y30 A;  3JRH A;  2GBY A;  4RBO A;  4XK4 A;  3S1Q J;  3IH4 A;  1NTC A;  2TCT A;  4XIC A;  2Y31 A;  1MBH A;  2ZB9 A;  2JK3 A;  2XRL A;  3S16 J;  1JT0 A;  3FK6 A;  1ZR2 A;  3SDG A;  2COB A;  3GTQ J;  4A93 J;  2WB1 N;  1ETK A;  1WCM J;  2EH3 A;  2CJJ A;  4C3J J;  1SAN A;  3HOW J;  2DMU A;  2CQX A;  2L7M P;  4BY1 J;  3BR5 A;  1JKO C;  2IAI A;  2K9S A;  3TED A;  2DMN A;  3S2D J;  2JN6 A;  2EBI A;  1F36 A;  3JRB A;  2DJN A;  3BG3 A;  2HDD A;  2K9Q A;  4Y52 J;  1DU0 A;  1GVD A;  4I6Z A;  1X2N A;  1ZGW A;  4A3E J;  2Y9Y A;  2LFB A;  1Z0X A;  5EGO B;  4V2F A;  2MSY A;  5J1U A;  1B72 B;  2GLO A;  3CMY A;  3I4M J;  3GTK J;  1U9O A;  2GM4 A;  1XC5 A;  5IOY A;  2JJ7 A;  2R5Y A;  3K2A A;  4MLO A;  2K40 A;  5EG0 B;  5K7Z A;  1IDZ A;  4L5E A;  2EQR A;  2E2I J;  1LFB A;  1BW6 A;  2DA3 A;  2VKV A;  3WHC A;  1AKH B;  4QIW N;  2R5Y B;  1NK2 P;  1RPW A;  2EZI A;  1IGN A;  3JRF A;  2YS9 A;  3ZQF A;  3BTJ A;  1GUU A;  5M5X J;  1RKW A;  1ZTR A;  2K9N A;  3A03 A;  3G1M A;  1RET A;  2NVT J;  3JRD A;  2HOT A;  4EEF G;  2WV1 A;  3MKL A;  2ECC A;  4A3I J;  2DA6 A;  3ZOB A;  3JRC A;  3H0G J;  2B63 J;  4X1E A;  3S2H J;  3DCF A;  1U9N A;  5IPA A;  2DA1 A;  3BT9 A;  2L7Z A;  5M5W J;  5DTD A;  3PO3 J;  3ZQL A;  5EF6 A;  2AO9 A;  3Q3S A;  1PUF A;  3M3Y J;  3LSG A;  1P7J A;  2QF7 A;  1ZKG A;  2MG4 A;  2JMW A;  2NOG A;  5FKN A;  2LY9 A;  1O4X A;  9ANT A;  1F43 A;  4J19 A;  2G0E A;  2E1O A;  2AHQ A;  1PUF B;  2R5Z A;  4BBR J;  4GFB A;  5IP9 J;  1W0U A;  1WH5 A;  4A3J J;  2YU9 J;  4DYQ A;  5IP7 J;  2EZH A;  5EYR A;  4NDL A;  5HOD A;  1W0T A;  5IYB J;  5F0F A;  4XRM A;  1AHD P;  2R93 J;  2FD5 A;  3L1P A;  1APL C;  4D5C A;  1T33 A;  3GTL J;  1I6H J;  3O8G A;  4M3E A;  5EZH A;  1NK3 P;  1LFU P;  3BR1 A;  4M6V A;  3QPL A;  5FJ8 J;  1GV5 A;  2P81 A;  1IUF A;  2LLK A;  3BR2 A;  3CCY A;  2XPW A;  5F04 A;  1BA5 A;  2LKX A;  2CUE A;  1Z77 A;  5F0C A;  4AUX A;  1WH7 A;  1WGX A;  1JTY A;  3K7A J;  5J1Y A;  2DN0 A;  1B8I B;  4QTR A;  1FTZ A;  3B6C A;  3MN2 A;  4QSH A;  2ID6 A;  5DS9 A;  5EDN A;  1IDY A;  2LR8 A;  3F0C A;  1MBF A;  4MO7 A;  5M3F J;  4DZJ A;  3NAU A;  1ITY A;  2MGQ A;  1CQT A;  3JRE A;  1JKP C;  2NVY J;  1ETV A;  4JX4 A;  3TW6 A;  4V2G A;  5M5Y J;  1LE8 A;  4CYC B;  4FCY A;  1R9T J;  4JP0 A;  3FIW A;  1MBJ A;  3Q0V A;  1XS9 A;  1IJW C;  1D5Y A;  3S1M J;  3G1L A;  1OCT C;  1BL0 A;  1S7E A;  4DYR A;  2X6O A;  2Y9Z A;  1LE8 B;  4LOC A;  1JUS A;  1H8A C;  3A01 B;  3RQI A;  5EGO A;  3GTG J;  3ZQI A;  2M9H A;  1K61 A;  3CDL A;  1MBG A;  2XGC A;  1B72 A;  3A02 A;  5F08 A;  5E3O A;  5K7H A;  3UKG A;  1HDD C;  3RZO J;  3HOU J;  2NS8 A;  2FX0 A;  5GPA A;  2Y2Z A;  5C4X J;  2FQ4 A;  4C3I J;  3JR9 A;  2I10 A;  4DZP A;  2YUS A;  5IP6 A;  2ECB A;  2L7F P;  5JLX A;  5JLW A;  5EG0 A;  2VI6 A;  2E19 A;  1ETO A;  2LD5 A;  1I50 J;  3HEF A;  1JKR C;  5J1R A;  3GTP J;  1MBK A;  3I4N J;  2XGD A;  1AKH A;  1WPK A;  3GBG A;  3OSG A;  2DA7 A;  2XGE A;  1H88 C;  4A3K J;  2LP0 A;  2E2J J;  4M3G A;  1P7I A;  5FKK A;  3OOU A;  5FLV A;  3PM1 A;  2NS7 A;  3GTM J;  1VND A;  2DA4 A;  4XID A;  1U8B A;  2H8R A;  2O9L A;  1ETY A;  2HOS A;  4UUT A;  4BY7 J;  3BTC A;  4C3H J;  4Y7N J;  5E3M A;  1I3Q J;  4UUS A;  1ZR4 A;  2WAQ N;  3ZQC A;  2NVX J;  1K83 J;  1EF4 A;  5C3E J;  1QVU A;  4UUS B;  3IH3 A;  4DYC A;  2EZK A;  2ID3 A;  3HKZ N;  2L0K A;  3LOC A;  5F27 A;  3TW7 A;  1VFC A;  1QVT A;  3MVP A;  3GTO J;  3IH2 A;  2LTP A;  2JWT A;  4D7M A;  4JYK A;  1ORK A;  2JA7 J;  1UG2 A;  5C44 J;  2M0C A;  1ETQ A;  3ZQG A;  3OIO A;  1ETX A;  3BG5 A;  4JX5 A;  1ENH A;  2CU7 A;  1BJZ A;  1MSE C;  2PMZ N;  1GV2 A;  2DMT A;  2ELK A;  2EZL A;  2X9D A;  2NVQ J;  4IHV A;  1B8I A;  1FIA A;  4ABZ A;  3BTI A;  4BXX J;  2KDZ A;  2DA2 A;  5GPC A;  3D1N I;  3FIS A;  3S15 J;  4A3D J;  3CQZ J;  3H3V K;  1TWH J;  1IRZ A;  4D5F A;  1TWG J;  2VPR A;  1TWA J;  3RKQ A;  1HLV A;  1HDP A;  1HCR A;  3BQZ A;  3RZD J;  1FJL A;  2OF7 A;  5E3L A;  4CYC A;  2E2H J;  4M3D A;  4A3G J;  1TC3 C;  3GTJ J;  4AYB N;  2O8K A;  3O8H A;  3G1O A;  5FKL A;  3WHB A;  1SFO J;  1MBE A;  4W97 A;  5BNG A;  1JT6 A;  2M2E A;  1RES A;  4MFD A;  3VPR A;  3A01 A;  1ZQ3 P;  1JUM A;  3PO2 J;  5IYC J;  4A3F J;  3HGG A;  1IV6 A;  2CUF A;  5EEA A;  3S1R J;  2L9R A;  4G12 A;  2XSD C;  1RR7 A;  2N8G A;  4MIM A;  4A3M J;  3C2B A;  1Q1V A;  1JJ8 C;  4M3B A;  4IHX A;  3HOY J;  4S0H B;  3S1N J;  1DU6 A;  3BTL A;  1MNM C;  1HOM A;  5FLM J;  2HYJ A;  4XRS A;  3Q0U A;  3JRG A;  1POG A;  2XB5 A;  4FIS A;  2KT0 A;  1FEX A;  1XG1 A;  4BBS J;  1Y1V J;  3W6V A;  2ME0 A;  4X6A J;  3HDD A;  2XPU A;  2JA5 J;  1OCP A;  3LNQ A;  3M4O J;  1X58 A;  5EZG A;  4A3C J;  3BR6 A;  3TP3 A;  1RKT A;  1JTX A;  1WI3 A;  4D7N A;  2LK2 A;  2TRT A;  4B4C A;  2HI3 A;  3SJM A;  2JA8 J;  4XRS G;  2DA5 A;  2QCO A;  4A69 C;  5C4J J;  4A3B J; 
#chains in the Genus database with same CATH topology
 3WE2 A;  3TBI A;  1TWF J;  3TDZ C;  1EKE A;  2M3A A;  3GLX A;  4I0A A;  3HOV J;  3Q0W A;  3T8T A;  2YX7 A;  1W5C C;  1MH4 A;  3MAJ A;  2HXO A;  1SD5 A;  2X1D A;  2A61 A;  3GZ6 A;  3K10 A;  2RN7 A;  4RB0 A;  5HLI A;  2X1E A;  1FWZ A;  5J3L A;  4A0Y A;  4CCN A;  3U1K A;  1UMQ A;  2XDV A;  2DU9 A;  3L09 A;  1VQN I;  2A5W A;  2A68 F;  3U1D A;  2C6Y A;  2DQL A;  4XNF A;  2BOL A;  2ESN A;  4CCO A;  4HRI A;  2COM A;  1XB4 A;  3ECO A;  4JX6 A;  1A6I A;  4R8H A;  2WAF A;  4C2M J;  4Y3O A;  5BPD A;  5DCM A;  5D8K B;  3RTR A;  3WGI A;  1VQK I;  2IS6 A;  3P9I A;  3K4J A;  1X1B A;  1LJ9 A;  4ZYG A;  3NAR A;  2R7T A;  2FBI A;  4U7B A;  3BPV A;  1HBX G;  4FTH A;  4RLF A;  2NS0 A;  1VI0 A;  2VXZ A;  1T56 A;  3T1B A;  3BJ6 A;  3R4K A;  4M9S A;  1NG7 A;  2ZFU A;  3Q9S A;  2I8D A;  2KLO A;  4M3F A;  3SXY A;  2W48 A;  3JRA A;  5LGT A;  3HKZ A;  3I55 I;  5CKT A;  4XKB A;  4BHC A;  1RRJ A;  1IXS B;  4MQ9 F;  3E6C C;  1UHM A;  2OU2 A;  1TWC J;  2FXA A;  1FOW A;  1C0W A;  3HGY A;  1K78 B;  1VQ4 I;  1SMT A;  2VAS A;  2R92 J;  5FKM A;  2XKP A;  3KYD B;  1G6N A;  1OR7 C;  2DTZ A;  3EUA A;  2E1C A;  2MFZ A;  2XVC A;  1ZH5 A;  1Y8Q B;  1JGG A;  1IO2 A;  1WVR A;  3H5A A;  3IC7 A;  4Z6Y A;  3IWZ A;  1JJ6 C;  1VQ6 I;  1JUP A;  4UV8 A;  1OKR A;  1ETW A;  3QYB A;  1MMA A;  3G2B A;  1E3O C;  1T6S A;  3DEW A;  4BYY A;  2M8G X;  3KFW X;  2CUJ A;  3HSR A;  2VKH A;  3MD2 A;  1K7A A;  3ZRG A;  1FIP A;  3H0D A;  5A2Q K;  2ELH A;  2RC4 A;  4CH7 A;  1R36 A;  3HRS A;  3ZQQ A;  1YX3 A;  5AIQ A;  4QPQ A;  3IHU A;  4UNO A;  3QU6 A;  1ZHF A;  3AG3 H;  2QWW A;  4C30 A;  2Y31 A;  4IXA A;  1MBH A;  3E5X A;  1Y0U A;  2KRF A;  4CYD A;  4S04 A;  3OYL A;  2K4B A;  3SDG A;  2IRF G;  1WHU A;  3KP2 A;  2EH3 A;  3CC4 I;  2KIM A;  4C3J J;  1SAN A;  2CW0 F;  4TV7 A;  2LNB A;  4IX7 A;  4V19 K;  1YW9 A;  3FZV A;  3R0A A;  2K9S A;  2VBY A;  5B66 C;  5HNF A;  3IRQ A;  4S05 A;  5ILS A;  3TED A;  2HR3 A;  3JW4 A;  1YOV B;  3S2D J;  1FNN A;  1HQC A;  5FRO A;  2EBI A;  1E2X A;  4UB8 C;  4L9V A;  4HSR A;  4HDV A;  5ERI A;  3JRB A;  2HS5 A;  2DJN A;  3HOT A;  4I6Z A;  1UFM A;  2R7F A;  2QLZ A;  4ZYA A;  2F5C A;  3CMA I;  2F5F A;  4Q4Z F;  2ZSH B;  2OCC H;  5EGO B;  2YR2 A;  5K5O A;  2WY8 Q;  2IPQ X;  1Y6I A;  4UB6 C;  4B47 A;  3ZMT A;  5IOY A;  3S93 A;  4KFC A;  2KDO A;  1IDZ A;  3NEU A;  2EQR A;  3CCM I;  1KU2 A;  2DDA A;  4XN3 A;  1HC8 A;  2NRA C;  1ERD A;  4HYE A;  2VKV A;  3WHC A;  1ZGA A;  1CGP A;  2R5Y B;  1IRG A;  3V7S A;  1E3H A;  5J40 A;  5CQE A;  4PJN A;  3RSN A;  3ERM A;  3F8M A;  1TL8 A;  1IGN A;  3TMO A;  4Y15 A;  3BTJ A;  1RKW A;  2K9N A;  3G1M A;  3M8F A;  2QBY A;  1RET A;  1E0E A;  3BCA A;  4ZTJ A;  1ZG5 A;  1YIO A;  4C2U A;  3HSF A;  1BI0 A;  1I5Z A;  3BC8 A;  3MKL A;  1A6Q A;  3QOE A;  3QP6 A;  4A5N A;  4YFK F;  2NXN B;  5J6X A;  3J81 Z;  2DA6 A;  3H0G J;  5HOO A;  2PJR B;  3W2W A;  3W3C A;  2DA1 A;  3BT9 A;  3D5L A;  3K1M A;  2A05 A;  1U5T C;  5EF6 A;  2AO9 A;  2IS1 A;  2STT A;  1E17 A;  2LF7 A;  2VBW A;  3I54 A;  4FHT A;  4PJM A;  2O5R A;  2VJ4 A;  2EIJ H;  3S3O A;  3WU2 C;  3V42 A;  3OS0 A;  2Z9O A;  2MG4 A;  2VOO A;  1I27 A;  2HPM A;  3F8N A;  5FKN A;  2A69 F;  1S9H A;  1NH3 A;  1ZRD A;  9ANT A;  1V5G A;  2G0E A;  1PUF B;  2R5Z A;  4Q47 A;  5DYM A;  4RB1 A;  1X1C A;  3I4P A;  3ZN1 A;  2EFW A;  2YU9 J;  4PFP A;  3BJA A;  4U0W A;  3WTY C;  1YIT I;  2EZH A;  4NDL A;  2R7W A;  5F0F A;  4NNJ A;  2P0W A;  1FBS A;  1Z67 A;  2FD5 A;  1I6H J;  1WQ2 A;  3PUF A;  5BS6 A;  4JBA A;  3I59 B;  3I56 I;  2VJJ A;  3L2C A;  5EZH A;  4UXN A;  1NK3 P;  3CCR I;  2DPD A;  4M6V A;  3FXJ A;  3W6J B;  3OYD A;  2M0M A;  3NRV A;  1O3Q A;  2V1U A;  1LB2 A;  3BR2 A;  2E1N A;  3WTS C;  3CDI A;  2CUE A;  3K69 A;  1Z77 A;  1T2K A;  2Y69 H;  2A07 F;  3KZY A;  5LGU A;  5IY5 H;  2RDP A;  1LKX A;  1QQI A;  3B6C A;  1IN7 A;  3EUH C;  4YFN F;  3VSK A;  4WK8 F;  5EDN A;  4XSX F;  2PQ8 A;  1SFU A;  4MO7 A;  1Q1H A;  3NAU A;  2MGQ A;  1Z7L A;  2V1X A;  2R7Q A;  1QHG A;  1R1U A;  2NVY J;  2QEN A;  4JX4 A;  3CF5 F;  2DFE A;  5M5Y J;  2VB6 A;  1A36 A;  1RC9 A;  1XCB A;  1V5E A;  4CYC B;  4ZTF A;  3FIW A;  1MBJ A;  4K2E A;  1D5Y A;  5A2Q Z;  1KYZ A;  2GXA A;  2D1V A;  4ZZD A;  1UCR A;  1P4A A;  1FYL A;  4DYR A;  2PX9 A;  1JUS A;  2EA2 A;  5HS8 A;  3J80 K;  2M4K A;  2K27 A;  2KP6 A;  3X2Q H;  2JVH A;  3ZMZ A;  3EET A;  3RQI A;  2HKX A;  3ERE D;  3GTG J;  3DQV C;  3I71 A;  1MBG A;  4LGW A;  4PSW A;  3SZT A;  1B72 A;  4L0Y B;  3CZ6 A;  2E7W A;  3UKG A;  4AU7 A;  2NS8 A;  1R6R A;  3E6M A;  2Y2Z A;  3ZP5 A;  4KYW A;  2FRH A;  3ABM H;  5CLS A;  3FWE A;  2L7F P;  5JLW A;  5EG0 A;  1UG0 A;  2VI6 A;  5E20 A;  1SVM A;  2E19 A;  2E1M C;  3NWT A;  3UR3 C;  4RM3 A;  4BL0 B;  1I50 J;  1X4O A;  3HEF A;  3TO6 A;  5J1R A;  3HYI A;  1MBK A;  1OQY A;  3GTP J;  4EJT A;  3GBG A;  1XMX A;  4A0X A;  2VE9 A;  3MZ8 A;  4E7K A;  1MIJ A;  2A5Y B;  1HKS A;  2FBK A;  1JGS A;  1P7I A;  4M3G A;  5HLG A;  2E7X A;  1ZRC A;  5E1Z B;  2FF4 A;  4Z2Y A;  4BUP A;  2IGM A;  1A31 A;  4L18 B;  3K1P A;  4HV5 A;  1ON1 A;  2DFH A;  1UB9 A;  2M45 A;  2HOS A;  2WC2 A;  2O03 A;  4BHP A;  5LHG A;  2Q2E A;  3BTC A;  1I1S A;  4Y7N J;  1TNT A;  1KU7 A;  2MBF A;  2R7X A;  1LQ1 A;  5J47 A;  3OYB A;  1I3Q J;  4RGR A;  5FRN A;  2CQK A;  4OU0 A;  1YJN I;  2OTJ I;  3SDB A;  3ZQC A;  5D5W B;  2NVX J;  1BOB A;  1K83 J;  3MEX A;  4MEX F;  4WCG A;  2NNY A;  2XF7 A;  1EF4 A;  5C3E J;  1QVU A;  4UUS B;  3IKV A;  2HVQ A;  2ID3 A;  3HKZ N;  2ICW G;  4YII A;  1YW8 A;  2X51 A;  2EV6 A;  3C18 A;  5CVI A;  2WAQ A;  3O6B B;  4KIT B;  2LTP A;  3TO7 A;  4OIR F;  1D1A A;  2JA7 J;  1BM9 A;  3PL8 A;  4Q5S F;  3AL0 B;  5HVQ C;  2M0C A;  2GOX B;  3FXU A;  3LSM A;  2K9L A;  5BMZ A;  1JXS A;  5ED4 A;  2P5K A;  1HXD A;  1BJZ A;  4I98 B;  5D5V B;  2KJB A;  1MSE C;  4PJL A;  5E17 F;  2F5D A;  4IQJ A;  2QGU A;  3GFI A;  1ZLK A;  3WG7 H;  2BVL A;  5BPI A;  1TQI A;  3GWZ A;  2MAB A;  1LDJ A;  2KHM A;  5TJJ A;  1FIA A;  4N0B A;  5DV5 A;  2KDZ A;  3S15 J;  4BE1 A;  3CQZ J;  2F2E A;  4J01 A;  1TWG J;  1P6R A;  2EK5 A;  2ZXW H;  3RKQ A;  1HLV A;  1HCR A;  3QPH A;  3DV8 A;  4B3X A;  4E7J A;  3I64 A;  3OYJ A;  1X3U A;  2OC6 A;  1FJL A;  4A2U A;  1D0Z A;  1D8J A;  2XAJ A;  2BE5 F;  2CW8 A;  3RKX A;  1NHA A;  3GVA A;  3I9V 2;  3K4B A;  3MKW B;  4KN4 X;  5BNG A;  2R4G A;  1JT6 A;  4HQE A;  4UUV A;  2P7V B;  3VPR A;  3IAS 2;  1ZQ3 P;  3CME I;  2A3S A;  1JUM A;  3WU0 A;  3PO2 J;  4EMS A;  2R7U A;  4MGR A;  1IV6 A;  2DDB A;  3CUQ A;  1I3A A;  4KMF A;  3S1R J;  2DOA A;  3L00 A;  2M30 A;  2QKL B;  4XLP F;  2D2W A;  1RR7 A;  2N8G A;  3FHZ A;  3WTX C;  1J7K A;  1B4A A;  4XON A;  2TDX A;  3RKY A;  4BXF A;  5FLX K;  3C2B A;  3H3Z A;  5IT9 K;  4ZDP A;  4M6X A;  3U9G A;  5K5Q A;  2VPL A;  2VT2 A;  4FIS A;  4E70 A;  2Z16 A;  3ABK H;  4QWQ A;  1YLF A;  3S3M A;  5GAE J;  2FBH A;  2ME0 A;  3W6V A;  4X6A J;  3HDD A;  3TDU C;  2K4J A;  3OOP A;  3QWL A;  4EM1 A;  5EZG A;  4ZC3 A;  1BR1 A;  2LK2 A;  4CCK A;  4DBQ A;  3LQQ A;  5CPR B;  4XRS G;  3R0J A;  4ANJ A;  4L5J A;  1MMD A;  4A69 C;  3J80 Z;  1R49 A;  5D6F A;  1WJB A;  5GTI C;  4LLN A;  5L3B A;  1FX7 A;  2DMQ A;  2EFQ A;  2QVO A;  1VQ8 I;  3MZY A;  1VF9 A;  2XB0 X;  2KIS A;  2K3P A;  3LSK A;  2QKM B;  1OJL A;  4HV6 A;  4NQW A;  2R7O A;  5EEH A;  1W7P A;  3BDD A;  3SFI A;  4MTE A;  4EJW A;  2VKE A;  1FOK A;  4OIO F;  5TRD A;  1BIA A;  2VJ5 A;  2E35 A;  4CCJ A;  1R4M B;  3ABU A;  1AU7 A;  4FE7 A;  1BW5 A;  2OPT A;  1E3P A;  4N9I A;  2BZT A;  2RV8 A;  2IEK A;  2FU4 A;  2JRT A;  2FUG 2;  2VT3 A;  1JI8 A;  3OSF A;  3E0J B;  1RR8 C;  4II3 A;  5L3E A;  2F4O B;  1T38 A;  2VKD A;  2WBM A;  2W82 A;  5FKO A;  4ZZL A;  1IC8 A;  1FSH A;  2G9W A;  2HKO A;  4RMN A;  4XLF A;  1X1D A;  2IA1 A;  3HTU A;  2W84 A;  3DBL B;  1MDM B;  1GT0 C;  4F55 A;  1WJC A;  2XAU A;  1LDK B;  5GP9 A;  1D1B A;  2V9K A;  4U87 A;  1ZK8 A;  2K5C A;  3LSJ A;  5EEG A;  3R6S A;  3ZQH A;  4PGH A;  3O3K A;  1XSD A;  1FZP B;  5BOX A;  3H9Q A;  3H9J A;  3DEU A;  1JKQ C;  4BEH A;  2O7O A;  5IYD J;  2WAD A;  3S2W A;  4IHY A;  2IBD A;  1LVK A;  5FFZ A;  1RUN A;  3ISP A;  4KA4 A;  3PIO F;  3CCU I;  4HNV A;  2XAG A;  3WTT C;  3F6V A;  4B1R A;  4CGZ A;  4LG0 B;  1BR2 A;  2EFO A;  2FJ1 A;  1YX5 A;  4CXF A;  2J5P A;  4I7H A;  3OYK A;  3E5Q A;  5FFX A;  2VUM J;  4MFE A;  4ZH4 F;  2R7V A;  2IGK A;  1A35 A;  2KL4 A;  3H92 A;  4HX4 A;  6PAX A;  1G2H A;  1F4K A;  3QRF F;  2R5Z B;  3L2U A;  1R22 A;  1YRN A;  2L02 A;  1KYW A;  4IHT A;  4KT5 C;  4BQO A;  3K4C A;  4HDU A;  4BXU A;  2JA6 J;  4DW6 A;  3BR0 A;  1OFC X;  2ZXH A;  3EUK L;  2YU3 A;  3LA7 A;  4RDU A;  4A0Z A;  4U0Y A;  1SFE A;  3HOX J;  4OOI A;  4ZYD A;  2D5V A;  3LA2 A;  4XMY A;  1B9N A;  4O6J A;  2Y0S A;  3Q5F A;  1B1B A;  2Y30 A;  3JRH A;  3H5N A;  1Z6R A;  4PFO A;  1H9G A;  2GBY A;  2UV1 A;  3FXO A;  3IH4 A;  1TTY A;  4BAY A;  3BCB A;  3SZP A;  2E71 A;  5HLH A;  4RS8 A;  3V7C A;  2UUZ A;  1PP8 F;  4M9X A;  1USS A;  1UJ8 A;  3FK6 A;  3KYC B;  5TGT A;  1OCR H;  1ZR2 A;  2F4I A;  2WB1 N;  1ETK A;  3G3Z A;  2STW A;  4UY8 I;  2BY3 A;  3HOW J;  4G6T B;  5ICF A;  1YJW I;  2DMU A;  3BR5 A;  3HPH A;  2G7H A;  2DQR A;  2X4H A;  1J2X A;  1B59 A;  1BI3 A;  1RI7 A;  2MYS A;  1QZZ A;  1O57 A;  2JN6 A;  4HLY A;  1F36 A;  2D45 A;  3V7R A;  4XLC A;  1XDS A;  1G4D A;  2HDD A;  4MEY F;  4DJA A;  5DUK A;  3DLA A;  1DU0 A;  5GAG J;  5B1A H;  2EB7 A;  1ZRF A;  4RA2 A;  1DGR M;  1X19 A;  2Z5U A;  1OR7 A;  3ZCO A;  2F6C A;  3CCE I;  2B9S A;  1IZ1 A;  2EFP A;  5E8G A;  2P8T A;  2BXZ A;  5E1W A;  5J1U A;  1B72 B;  3CMY A;  3WTZ A;  4NC7 A;  3I4M J;  1J59 A;  1OMI A;  4RAG A;  3I0T A;  4XQF A;  4E7H A;  1JHH A;  4KNY A;  4F91 B;  1SAU A;  5IT3 A;  5EG0 B;  4YG2 F;  2PBI A;  3K4L A;  1LFB A;  1BW6 A;  2V4J C;  3GEZ A;  3TGN A;  4F92 B;  3OWT A;  1JE8 A;  3L7W A;  2ZC2 A;  1RPW A;  2CG4 A;  1Y8R B;  2QSH X;  3JRF A;  2FSW A;  2YS9 A;  4H0E A;  3BG6 A;  4RAY A;  3SQN A;  1GUU A;  3A0B C;  1ZTR A;  3HRM A;  4F7Z A;  1IF1 A;  2HOT A;  1FY7 A;  2ZJ2 A;  2VQL A;  4A3I J;  3JRC A;  3QPT A;  3PJR A;  2JZY A;  4GXO A;  4UV9 A;  4X1E A;  4YIR X;  3CES A;  2VLA A;  2QM3 A;  2NVU B;  2L7Z A;  4UVB A;  1A04 A;  1IN5 A;  4EM2 A;  3OL3 A;  4HBL A;  4OAZ A;  5FD5 A;  3TKY A;  2QF7 A;  4EGZ A;  3V8J A;  4RB2 C;  2MLK A;  2LY9 A;  3BP8 A;  2FEZ A;  2D1H A;  2E36 A;  1OCC H;  4J19 A;  1PYV A;  1WWX A;  2AHQ A;  2E1O A;  3IL2 A;  3SEQ A;  1J75 A;  3OS1 A;  4AD9 A;  1FMW A;  2XF6 A;  2HDW A;  3DEE A;  2EWN A;  2OCE A;  2P5L C;  1XGN A;  1X3W B;  2ZSI B;  4DYQ A;  5IP7 J;  5HOD A;  1W0T A;  4F52 A;  2R93 J;  1UHW A;  2O6G E;  1QZY A;  4D5C A;  3HRT A;  2CV0 A;  1T33 A;  3GTL J;  4WX9 A;  1YG2 A;  3RPU D;  4RB3 C;  2Z33 A;  4KIG A;  3ZXS A;  2L9V A;  5FJ8 J;  1GV5 A;  3A1Y A;  4II2 A;  3AAF A;  3FMQ A;  1IUF A;  1Z91 A;  2OQG A;  1BA5 A;  2LKX A;  1UAA A;  4AUX A;  4A5M A;  1TT0 A;  2FML A;  2L9S A;  4BJT A;  1WH7 A;  2LSO A;  5LHI A;  4I2O A;  3DFG A;  1JTY A;  2E5N A;  2HQN A;  2V9V A;  1FTZ A;  5DS9 A;  1FSE A;  3SYT A;  1IDY A;  4RGU A;  2LR8 A;  2LH9 A;  2WV0 A;  1EJ9 A;  4G6D A;  4L9N A;  1GHC A;  3HC7 A;  1T39 A;  3JRE A;  1JKP C;  1XD7 A;  1LE8 A;  1FT9 A;  3ABL H;  1R5H A;  3U2R A;  2ZCW A;  3K4K A;  5E79 C;  1XS9 A;  1QNT A;  1MGT A;  3AL0 C;  1MJ9 A;  4AVP A;  1BL0 A;  3T8R A;  5AON A;  4L0Z B;  3RYR A;  1XGO A;  4GYG A;  2VC1 A;  3HPG A;  3OY9 A;  5BQT A;  3ZQI A;  2M9H A;  3CDL A;  1YQA A;  4PSX A;  4BAC A;  5K7H A;  2VN2 A;  3RZO J;  2FX0 A;  1DUX C;  1IUY A;  1T08 B;  2CO5 A;  2NAZ A;  2CSO A;  2XF5 A;  4RGX A;  2FQ4 A;  3M07 A;  3DTK A;  2YUS A;  2ACJ A;  4Y13 A;  2ZNZ A;  3M7G A;  2VQG A;  1WZ2 A;  2IA0 A;  4EJU A;  2X1C A;  1ETO A;  3GYH X;  1XMA A;  3HHG A;  4GCV A;  3F8F A;  3OIQ A;  1JKR C;  2RNG A;  3I4N J;  1EH7 A;  3M9A A;  4NB5 A;  4LB6 B;  1AKH A;  1WPK A;  3TOA A;  2DOF A;  3OSG A;  3A2K A;  1P2F A;  2DA7 A;  1VTN C;  3BZC A;  3MKY B;  4XKC A;  2LP0 A;  2LKP A;  2EIL H;  3ECH A;  4RM2 A;  1ZRE A;  2G7U A;  2R7S A;  3CCS I;  2B7E A;  1U8B A;  4XID A;  1YS7 A;  3KX2 A;  3F8C A;  4C3H J;  1LUJ B;  3F21 A;  3P5J A;  1G3W A;  1J5Y A;  1DP7 P;  2HGC A;  1QO0 D;  2HVR A;  1D5V A;  2R3S A;  3BPX A;  4NQW B;  1W7P B;  1B6A A;  2M4G A;  4LMY A;  2HQR A;  1HSJ A;  3VYR B;  2HZT A;  4A12 A;  3IH3 A;  4EJO A;  4AIH A;  1R7J A;  3OYN A;  1AOY A;  1BI1 A;  1MMN A;  3EDP A;  4I0B A;  5KNL A;  3E5U A;  1N75 A;  4BH9 A;  3TW7 A;  3VOE A;  1VZ0 A;  4KUM A;  1VFC A;  2MD0 A;  2OJE D;  4LFU A;  4ESF A;  3GTO J;  3HIF A;  3IH2 A;  2JWT A;  4D7M A;  4YRV A;  1ORK A;  2LRE A;  2W85 A;  3C7J A;  5F64 A;  3T5X A;  5C44 J;  1GXQ A;  3UNG C;  3HG9 A;  4BJ5 C;  4N9H A;  3RQ4 A;  1R23 A;  3LAJ A;  3IAM 2;  2VIX A;  5FO5 A;  3OIP A;  2CW7 A;  1Z9C A;  4IJA A;  4P1W A;  3G6E I;  3HHH A;  1U2W A;  1K6Y A;  4GO1 A;  1Y0N A;  2EZL A;  1S8N A;  2X9D A;  3MQ0 A;  4BEH B;  4G9Y A;  4RLQ A;  3KYL A;  3A0H C;  1WRJ A;  1B8I A;  2ZJP F;  4FQG A;  3FMR A;  4U0V A;  5DUI A;  2P6T A;  2IGN A;  2DA2 A;  3K4M A;  5GPC A;  4A3D J;  4LB5 A;  3CMM A;  4XSZ F;  3ML6 A;  3H3V K;  1TWH J;  4A6E A;  2CUZ A;  2OZ6 A;  4D5F A;  1G3Y A;  4AWX B;  4M9Z A;  4CIC A;  3LSH A;  1O3S A;  4BQQ A;  2B0L A;  5LLQ A;  1ZAO A;  1IXC A;  2Y48 A;  1R4N B;  5E3L A;  4IRH A;  4M3D A;  4A3G J;  1CF7 A;  4HST A;  2EA4 A;  2L4M A;  5H6R A;  3G1O A;  3WHB A;  2VL8 A;  2OD5 A;  4G6Q A;  4BS9 A;  1MBE A;  4LIT A;  3OYI A;  1MNE A;  2VOP A;  3GME A;  2O8X A;  2XAH A;  3D5S C;  2ZME A;  1X1P A;  4HF0 A;  3RKW A;  3HZJ A;  1REP C;  1YS6 A;  3VYT B;  4AYB A;  5EEA A;  4G12 A;  1L0O C;  5ICE A;  5ICC A;  2IP2 A;  1RNL A;  1MZB A;  4HW0 A;  2V6E A;  4A3M J;  3FBN B;  3VYU B;  1Z1D A;  1T95 A;  3T0Y A;  1Q1V A;  1O3T A;  1DU6 A;  4IVN A;  3KCC A;  3FXM A;  4XRS A;  2VQC A;  3Q0U A;  1QU3 A;  2XB5 A;  4B09 A;  2DFI A;  4ITV A;  5CJ9 A;  2KT0 A;  1FEX A;  4GGG A;  2QEX I;  3F8B A;  3VFZ A;  4IKF A;  1OCP A;  4NHJ A;  3KP5 A;  3TQN A;  2ZJQ F;  3BR6 A;  1G8X A;  3GX4 X;  1JTX A;  3OS2 A;  1QA6 A;  1ULY A;  1XCV A;  5KCM A;  2XV4 S;  2CV2 A;  3CP2 A;  4LG3 A;  2HI3 A;  4B4C A;  5HNH A;  1R1V A;  4UVC A;  3SJM A;  4PJJ A;  1VQ7 I;  2DJI A;  5K5R A;  4PGG A;  5C4J J;  1UST A;  3OYH A;  5M3M J;  1A5J A;  4PZJ A;  2RGV A;  4JOM A;  4H4K C;  2XPV A;  4KJZ A;  3F3X A;  1VQO I;  3QAH A;  3PFI A;  1U78 A;  4KIF A;  5J4Y A;  2L9N A;  2M34 A;  3CCQ I;  4GYI A;  1XMK A;  3GFL A;  5K7F A;  5H6Q A;  1TQM A;  3S14 J;  1TNS A;  3I3L A;  1G3T A;  1IXR C;  2H6C A;  1LFP A;  3RCO A;  1EV7 A;  1XPX A;  1U8R A;  1UZC A;  2QZ8 A;  2QUF A;  4XN0 A;  1PUE E;  4NC6 A;  2XAF A;  2DFF A;  2HPI A;  3S17 J;  3PIP F;  3IV5 A;  2HDC A;  3TP0 A;  2BVM A;  5F0H A;  2HZD A;  2X6W A;  2ME6 A;  3KP3 A;  1MH3 A;  1X1A A;  2KFD A;  1N25 A;  2V9P A;  5DCM B;  2L3D A;  1I1G A;  3DP7 A;  3HOZ J;  5CYV A;  2F48 A;  1PJR A;  2JSP A;  4ZYH A;  4A3L J;  2ETH A;  3W2V A;  1U0J A;  1F5T A;  2BW3 A;  3AG2 H;  4DNC A;  1HW5 A;  2HXI A;  1BR4 A;  3GZN B;  1K78 A;  1GDT A;  2GXB A;  3E7L A;  3ONQ A;  1H89 C;  2LYC A;  2LDU A;  2ELJ A;  3P9C A;  5F1J A;  5L3C A;  2BY2 A;  3ZGK A;  2Q0O A;  2LC2 A;  2LVS A;  3BG9 A;  4XKV A;  3J7A O;  2YX4 A;  1P4X A;  3PQJ A;  5LBQ A;  4WXD A;  1Y1W J;  2DXI A;  1YTY A;  1D1C A;  1V55 H;  3LA3 A;  3HB9 A;  3GF2 A;  1D3Y A;  3QPS A;  4KIC A;  2K9M A;  4IHW A;  5F1R A;  4XLE A;  3C3W A;  1QPI A;  3B6A A;  1X2M A;  2J5O A;  2I5U A;  3MFK A;  2CQQ A;  2HOA A;  1OIS A;  3K9T A;  2DTR A;  3BR3 A;  1FTT A;  3CJQ B;  4BKX A;  3LST A;  3JRI A;  3EPZ A;  1MD0 A;  3AG1 H;  3FK7 A;  4BU2 A;  4BQA A;  3H36 A;  1J0R A;  3CCJ I;  4IRG A;  4XKW A;  5CVV A;  1Z7U A;  2KKO A;  3V8K A;  3QYE A;  3G73 A;  3HM5 A;  1UEL B;  2JT1 A;  3N97 A;  4HF1 A;  4ENN A;  4XOR A;  2KJC A;  4XK4 A;  3S1Q J;  3COA C;  2TCT A;  2KIF A;  4IQ4 A;  3WGG A;  4XIC A;  2IS2 A;  3VSL A;  3OYM A;  1OYI A;  2F4M B;  3P9K A;  5DCF A;  1ON2 A;  3JTH A;  2W57 A;  4CSW A;  3S16 J;  3JCU C;  5KAI C;  2K86 A;  2COB A;  2FOK A;  1D0X A;  1WCM J;  2XRN A;  1Y39 A;  2CJJ A;  1IV8 A;  3CC2 I;  3CO6 C;  1QGP A;  5GTH C;  4E7L A;  5KVR A;  4D9J A;  4BY1 J;  2VC0 A;  1B9M A;  4HNU A;  2DMN A;  1RIO H;  4CA0 A;  2Z2S B;  1PDN C;  1YJ9 I;  1TBX A;  2X85 A;  3LFK A;  3VOD A;  4PK4 A;  2K9Q A;  4Y52 J;  4LK0 F;  4NUB A;  4X0G A;  1ZGW A;  3KEY A;  4A3E J;  2OUM A;  3C1D A;  2LFB A;  1Z0X A;  3QOD A;  2MSY A;  4UVA A;  2CMP A;  2KIU A;  5ILU A;  2GLO A;  2PEX A;  2GAU A;  1U9O A;  4F93 B;  3ELK A;  5DDG A;  2JJ7 A;  3IRR A;  2R5Y A;  3TL4 X;  4MLO A;  1ZGJ A;  1T0F A;  4L5E A;  3ULQ B;  1ZG1 A;  4Y17 A;  3CLQ A;  4I02 A;  2ZNY A;  4PDK A;  2E2I J;  1BOA A;  2DA3 A;  2KZG A;  3AG4 H;  1BJA A;  4G7H F;  1AKH B;  5L3F A;  4QIW N;  2EZI A;  4BDY A;  1FP1 D;  1HW1 A;  4B8X A;  2PJR A;  1VQP I;  3ZQF A;  2OAZ A;  1HST A;  3OR2 C;  5M5X J;  5HS7 A;  1ZEL A;  2NVT J;  2O3F A;  4EEF G;  4OWR B;  3ZOB A;  3KET A;  3DCF A;  3S2H J;  5D8L B;  5IPA A;  3M1C A;  5M5W J;  3PO3 J;  3ZQL A;  2QBY B;  3CUQ C;  5CVR A;  4BQN A;  3Q3S A;  2DOE A;  2L5Q A;  1PUF A;  3J7A Y;  3M3Y J;  3AKZ A;  1EH8 A;  3M8E A;  3V4G A;  1P7J A;  2XHK A;  5LFA A;  1ZKG A;  2JMW A;  2NOG A;  3FM3 A;  2UXX A;  1LPQ A;  1W36 C;  1WI9 A;  4G7O F;  1BC7 C;  3W6K B;  4BBR J;  4GFB A;  2EV0 A;  3ABT A;  1WH5 A;  5D4S A;  3BY6 A;  1J9I A;  2BEO A;  1D0Y A;  1F9N A;  1FMV A;  2DW4 A;  4U7D A;  2HNH A;  2NNN A;  2V6C A;  1HA8 A;  2UWM A;  2CQ7 A;  3FX3 A;  5IYB J;  3P7N A;  1GLN A;  2K7L A;  1AHD P;  4HOB A;  2WWY A;  3L1P A;  4FET A;  4LIV A;  4XLH A;  2V1D A;  1IAW A;  3FM5 A;  2Q8K A;  2XKO A;  3N4M A;  2XGX A;  3CP8 A;  3GLL A;  4HEA 2;  2F5E A;  1LFU P;  3BR1 A;  1TT5 B;  3QPL A;  1V4R A;  2Q1Z B;  2OZU A;  4DOZ A;  3RDI A;  4OIN F;  5L3G A;  2GIV A;  2X0L A;  2P81 A;  3CCY A;  5F04 A;  2XPW A;  1BIB A;  3DPU A;  3RJP A;  5CQG A;  5F0C A;  5LGN A;  2BHZ A;  3LWF A;  5FB2 A;  1WGX A;  4HZF A;  2DN0 A;  2JPB A;  1B8I B;  4QTR A;  2HWV A;  1VQL I;  2ESH A;  2EJR A;  3MN2 A;  1OPC A;  2ID6 A;  4ZYE A;  4P9F A;  4QPO A;  4MNU A;  1FC3 A;  5M3F J;  3HXL A;  4DZJ A;  1ITY A;  1CQT A;  1V3F A;  3NWS A;  2JUC A;  1ETV A;  2DYS H;  4HA8 A;  3E1S A;  2Z99 A;  2XAS A;  5K1Y A;  3BG7 A;  4MHG A;  1T8I A;  1O7F A;  3ESW B;  4JP0 A;  3Q0V A;  4M74 A;  1IJW C;  2RRE A;  3S1M J;  2QSF X;  3TO9 A;  1KZH A;  1R58 A;  1SFK A;  1H8A C;  2Y9Z A;  4LOC A;  2AQE A;  3VB2 A;  2HTJ A;  3H5R A;  2ZBK A;  1PP7 U;  2ZME B;  4M72 A;  1WKM A;  1IN8 A;  2XGC A;  3A02 A;  4YEJ A;  5F08 A;  3TOB A;  5E3O A;  4GDF A;  4M71 A;  5DEQ A;  5GPA A;  2E34 A;  4EQQ A;  2Z3Y A;  2ZXI A;  4DZP A;  1MW7 A;  2NOJ B;  2DI3 A;  2ECB A;  3MMY B;  4N4O B;  1MJA A;  5FLX Z;  2IJL A;  5IT9 Z;  2RNJ A;  3CJT B;  4M6Y A;  2LD5 A;  1DGW Y;  1BC8 C;  1LNW A;  4NBQ A;  4YIF A;  3BLY A;  3WG9 A;  4BJ6 C;  2FE3 A;  1SEU A;  2EIK H;  3RPQ A;  3CC7 I;  1U6G A;  4HQM A;  5J8F A;  3DKX A;  1TW3 A;  2E60 A;  3FXQ A;  3GCM A;  1T98 A;  1HKQ A;  1PVE A;  3ASO H;  4P9U A;  3OOU A;  5JVG F;  3PM1 A;  2LMD A;  3J81 K;  3A4C A;  2HQA A;  5GAH J;  2LRD A;  5DM7 F;  3IKT A;  3E6B A;  1FYK A;  1IRX A;  4XBF A;  4UUT A;  1R71 A;  3DKY A;  3M1E A;  4KDP A;  1ZYR F;  3C2H A;  4UUS A;  1MJB A;  2WAQ N;  3DPT A;  5LD2 C;  2Q2E B;  1TP4 A;  4F3Q A;  2RQP A;  5DD4 A;  4EJV A;  3IUO A;  4FAS D;  1Y56 A;  4WWC A;  3IWF A;  1KQ9 A;  2LY1 A;  5JHU A;  3HJE A;  3K1N A;  2PLY A;  1H0M A;  2JVG A;  3OYG A;  4G94 A;  3KP4 A;  1QVT A;  3MVP A;  4HX7 A;  4CCL A;  4JYK A;  3WTU C;  2QQA A;  2QQB A;  1UG2 A;  5E18 F;  5H2F C;  2X6X A;  3WOD F;  4IL6 C;  1ETQ A;  5B5E C;  2BV6 A;  2L4A A;  3ZQG A;  1ETX A;  4JX5 A;  1ENH A;  2CU7 A;  3GO5 A;  2FQ3 A;  3DF8 A;  4HLX A;  4LIU A;  1GV2 A;  2HU9 A;  1O7L A;  3F9K A;  2BW3 B;  2R7R A;  1YHQ I;  4IO9 F;  3KLO A;  3K70 C;  5KAF C;  4E6K G;  2CFO A;  1P9Q C;  4ABZ A;  3BTI A;  4BXX J;  2H94 A;  3GFM A;  4XOT A;  1LEA A;  4BE0 A;  1ONV A;  3FIS A;  1SD7 A;  2H6B A;  5GAD J;  4FX0 A;  2GXG A;  5KHD A;  2BYV E;  2CV1 A;  1TWA J;  5JFR A;  1HDP A;  1Z3X A;  1FLI A;  3BQZ A;  2VJI A;  4CZC A;  5J8C A;  2KRH A;  2KZV A;  5B1B H;  1DPU A;  1O3R A;  2FNA A;  1TC3 C;  2GIZ A;  3GTJ J;  2PJP A;  3O8H A;  5FKL A;  1SFO J;  2A6T A;  2MA3 A;  4W97 A;  2A6H F;  3J7Z I;  1RES A;  1TQP A;  4GRI A;  5EJC A;  2FMY A;  2W7N A;  3A01 A;  3FXL A;  2M5W A;  1U5T A;  3EQL F;  5IYC J;  3HGG A;  4KIB A;  4DIQ A;  3K0L A;  3H3U A;  3ZR8 X;  3OYA A;  3NQO A;  2L9R A;  3FXK A;  3OL4 A;  2RVC A;  2GWR A;  4P55 A;  2XSD C;  1FOX A;  2JPC A;  4ENM A;  1ACI A;  4KMU X;  1JJ8 C;  3HOY J;  4IHX A;  1J09 A;  3CUQ B;  4S0H B;  5D4R A;  1Z21 A;  3PNV A;  3J7Y J;  1Z05 A;  2DBB A;  3BWG A;  2A6E F;  5FLM J;  2HYJ A;  3JRG A;  1POG A;  2DYR H;  2OA4 A;  4I09 A;  1XG1 A;  3B73 A;  3BOQ A;  1Y1V J;  2DT7 B;  4BBS J;  2KMU A;  3DPL C;  2XPU A;  2MC3 A;  4HF2 A;  3CJR B;  3M4O J;  1X58 A;  3FDY A;  1RKT A;  4G8X A;  4D7N A;  2TRT A;  3K2Z A;  1AWC A;  2JA8 J;  2X6Y A;  2DA5 A;  2EV5 A;  2LBF A;  3PFY A;  3F23 A;  4A3B J;  5FGM A;  4IOA F;  2DMP A;  2M8E A;  3H35 A;  1KQ0 A;  2GA1 A;  2OTL I;  2F5V A;  2WA0 A;  1QZE A;  3HRU A;  4QLC U;  3EUH A;  2MW8 A;  3CTA A;  4DBR A;  3B02 A;  2OQR A;  2MD5 A;  3M8J A;  3KEO A;  4NC8 A;  2HQ5 A;  3KLN A;  4D1Q A;  1DPR A;  1BN5 A;  3EYI A;  3VEP A;  4P5O A;  1VQM I;  1MMG A;  1UHS A;  1MDM A;  1ODD A;  3D5R C;  3LMM A;  1YW7 A;  5E3N A;  3LSR A;  4EVI A;  5JR3 A;  2JQ7 A;  2CFX A;  4HX8 A;  2CQN A;  1HF0 A;  3RYP A;  1TLH B;  3E6D A;  4R1H A;  4BGD A;  4FE4 A;  1K79 A;  1RUO A;  1MKM A;  3R60 A;  4EGY A;  2H1K A;  1FYM A;  2W4S A;  3MWM A;  2YPR A;  4W1U A;  2EPF A;  2QYO A;  2Z1D A;  3LSP A;  3OR1 C;  4LG0 A;  4E7I A;  1YIJ I;  3GXO A;  2W24 A;  1DQU A;  3HBL A;  2H1L A;  3HTS B;  2RAE A;  2M7A A;  2H09 A;  3JSO A;  4IF4 A;  4B3A A;  2X48 A;  5AIP A;  4AC0 A;  2ZJR F;  1MSF C;  3RPU A;  2IXS A;  2R7Z J;  3S3N A;  1BI2 A;  1IG7 A;  1Z6T A;  2CRG A;  4IEJ A;  2PI0 A;  3FKI J;  3PNY A;  2ISZ A;  3C2G A;  4OMY A;  1TW2 A;  2LKS A;  1DDN A;  2PMZ A;  2NYX A;  2DCE A;  2ISY A;  3CO7 C;  4C2T A;  1U3E M;  1WJD A;  2HYG D;  1KU9 A;  5E8I A;  2V26 A;  1XSX A;  2Y0S N;  4I76 A;  2LG4 A;  2BY1 A;  5IOZ A;  1I39 A;  3IP4 B;  5B3S H;  2ZXJ A;  3ZN0 A;  1WSU A;  2XUB A;  1OCO H;  3PQK A;  4CCM A;  1BBY A;  2AXL A;  3QQA A;  4BHB A;  1YRN B;  1QRY A;  4A6D A;  2R0Q C;  1SFX A;  3I58 A;  5LHH A;  4B44 A;  3BQY A;  4DQ2 A;  1FOY A;  1X3Z B;  4EM0 B;  2IW5 A;  1XX5 A;  5HDG A;  1W1W E;  3HOS A;  1ZN2 A;  4RBO A;  3FXR A;  1NTC A;  2FOW A;  3HUG A;  3OYC A;  3OYF A;  2ZB9 A;  3F72 A;  3OMY A;  2JK3 A;  2XRL A;  3BJO A;  4J00 A;  2JTV A;  1SVO A;  1JT0 A;  3S8P A;  3GTQ J;  4A93 J;  1WJE A;  2CH0 A;  3GZ5 A;  2WTE A;  2GZW A;  2W1O A;  1R1T A;  1YO5 C;  4ZDO A;  4AID A;  4HG2 A;  1L3L A;  3FBI B;  1FPQ A;  2CQX A;  2L7M P;  1JKO C;  4I01 A;  2IAI A;  5LEJ A;  3JAM K;  1W4M A;  2VON A;  5L3D A;  3D0S A;  2WB1 A;  3LFU A;  1WJA A;  3MKZ A;  1NG6 A;  2HTS A;  3BG3 A;  1W36 D;  1GVD A;  1OYY A;  2AXT C;  4AM3 A;  1X2N A;  2CGP A;  1TZL A;  2EFN A;  3F6O A;  3WTW C;  1SAX A;  2Y9Y A;  1K6O A;  3REO A;  3K6G A;  4V2F A;  2XAQ A;  2XIG A;  3ZMV A;  1V5F A;  1M1E B;  3GTK J;  2GM4 A;  2L01 A;  1XC5 A;  4KIS A;  3VYS B;  5HDK A;  3KIO A;  3K2A A;  2JSC A;  2K40 A;  3BZ6 A;  5K7Z A;  3OYE A;  3SEZ A;  1XGS A;  1RZ4 A;  2DK8 A;  3FKJ A;  4KT6 A;  4IOC F;  2ZFW A;  3FHN A;  2XRO A;  3L2R A;  5LEK A;  3DBR B;  2P4W A;  5F6F A;  4LK1 F;  1NK2 P;  1K4T A;  2DLL A;  3ROU A;  4ASN A;  2IA2 A;  2DK5 A;  4YFX F;  3DKW A;  2QSG X;  4IRI A;  3EYY A;  3CDH A;  2WAE A;  4MTD A;  3A03 A;  5LRR A;  1KU3 A;  1W7P D;  2QA4 I;  3GFJ A;  2R7D A;  2BXY A;  2K02 A;  3JRD A;  1MMS A;  3RI4 A;  2WV1 A;  2ECC A;  4M73 A;  3WTV C;  1S3J A;  3I53 A;  2MH2 A;  3O2P E;  2B63 J;  4I99 C;  1OYW A;  1ZLJ A;  1U9N A;  2ZKZ A;  1IRF A;  2BGC A;  1ZG3 A;  2ZME C;  2IVM A;  4LLL A;  5DTD A;  5HS9 A;  1LVA A;  3PUB A;  2XSJ C;  1OLT A;  3DTE A;  4ESJ A;  3KP7 A;  1YI2 I;  4U88 A;  3LSG A;  5D5X B;  3FF5 A;  2Y75 A;  4LLG F;  1STZ A;  2XC7 A;  1O4X A;  1GVJ A;  1F43 A;  2QQ9 A;  2CS3 A;  2GOM A;  4Y33 A;  1QPM A;  3WE3 A;  3VDX A;  2PFB A;  5ILV A;  2HYF A;  4E7Z A;  4RAF A;  3WU1 B;  5IP9 J;  2P6S A;  2H8W A;  3MCZ A;  1W0U A;  2VE8 A;  3GUD A;  3ZMD A;  4B48 A;  2QQ8 A;  4MQV A;  4A3J J;  1K4S A;  4BDZ A;  5JHF A;  5EYR A;  3HL2 A;  4XRM A;  2CWE A;  4LD5 A;  4R79 A;  2ZO4 A;  3LSI A;  1APL C;  3N05 A;  1YE9 A;  3SZG A;  4ON0 A;  2O61 A;  4UHT A;  4C9Y A;  4FX4 A;  5FD6 A;  1Z3Y A;  3LQR A;  3O8G A;  4M3E A;  1FBQ A;  2DT5 A;  3RIR A;  3U21 A;  1SVL A;  3KE2 A;  5J4V A;  2P5V A;  1W5S A;  4O5V A;  1S5L C;  2JUG A;  1MND A;  2LLK A;  4AVZ A;  4G7Z F;  3FMS A;  4CUG A;  2YSR A;  4ETS A;  2DT6 A;  3JTG A;  1V54 H;  2DAO A;  3K7A J;  5J1Y A;  1QHH D;  1S7O A;  3DXJ F;  1IN4 A;  3SFZ A;  4QSH A;  4CDG A;  3DTI A;  1N77 A;  2BY0 A;  3F0C A;  1MBF A;  3E3V A;  1VQ5 I;  3KP6 A;  2VBZ A;  3V8L A;  2DPU A;  2PN6 A;  1KON A;  3SHF A;  3TW6 A;  4V2G A;  5HDN A;  4IPA A;  4L9T A;  2HOE A;  1XDU A;  1N78 A;  5HLT A;  5DM6 F;  4RGS A;  5E1X A;  4FCY A;  1R9T J;  2H27 A;  3CCV I;  3CLO A;  4E4H A;  4XM3 A;  2RQQ A;  3G1L A;  3F22 A;  1S6L A;  1OCT C;  1P4W A;  1S7E A;  2X6O A;  1LE8 B;  2O0Y A;  2Y0M A;  3HSE A;  4PUS A;  3A01 B;  1I6X A;  4HNT A;  1KGS A;  1OCZ H;  2VBX A;  1S29 A;  5EGO A;  1U5T B;  3E97 A;  4FT8 A;  5TIS C;  3ZMU A;  5JVT A;  1K61 A;  4WXH A;  1R00 A;  3KZI C;  3DU5 A;  1HDD C;  3HOU J;  1WJF A;  5ICG A;  2IT0 A;  5C4X J;  1VQ9 I;  4C3I J;  3JR9 A;  2I10 A;  1GXP A;  4AIJ A;  2PMH A;  2FNP A;  2BHY A;  2P7C B;  5IP6 A;  1FBU A;  2JA2 A;  5JLX A;  4XOP A;  3DWL E;  2EIM H;  3CCL I;  4RAZ A;  4XLN F;  2FA5 A;  4PCQ A;  2HEO A;  2LF8 A;  2V1N A;  2XGD A;  2M87 A;  2AS5 F;  4E7S A;  4ENJ A;  4WXC A;  2XGE A;  1H88 C;  2L7K A;  2HFH A;  3Q9V A;  3K70 D;  1EH6 A;  3JAM Z;  3K4N A;  2GQQ A;  4CHU A;  3QOP A;  4A3K J;  2E2J J;  2CYY A;  5FKK A;  5FLV A;  4JK1 X;  2K3F A;  2KIQ A;  3CJN A;  2NS7 A;  3GTM J;  1DP3 A;  1QBJ A;  1VND A;  1WFX A;  3KZZ A;  1XSV A;  2DA4 A;  4D0P A;  2H8R A;  2O9L A;  1ETY A;  1KA8 A;  1HW2 A;  2BBY A;  2LBF B;  4BY7 J;  3KPH A;  1EA3 A;  5D6E A;  4PJ0 C;  4L9J A;  3BZK A;  5E3M A;  1SMY F;  5KK1 A;  3QYF A;  2PMU A;  3OV8 A;  1YYV A;  2LY2 A;  2OBP A;  1KQ8 A;  4XR6 A;  1ZR4 A;  3L2W A;  1D8K A;  2VQH A;  4EAT A;  4ZJZ A;  3DBH B;  1W5T A;  2MLG A;  3L2V A;  2DO7 A;  1AA7 A;  3ZMS A;  2IGO A;  3BRO A;  2GA2 A;  3AFH A;  3PSF A;  4DYC A;  2M7B A;  2EZK A;  2WY7 Q;  1XGM A;  2L0K A;  4N4N B;  3LOC A;  5D5U B;  2AQF A;  5F27 A;  3ZPL A;  1F1Z A;  4OIQ F;  3W2A A;  1SD4 A;  2L54 A;  2W00 A;  4IHS A;  3I59 A;  1YFH A;  4O3M A;  2V79 A;  3L2Q A;  3OIO A;  3KEQ A;  1X4P A;  3BG5 A;  3ZQ7 A;  5DD8 A;  3PSI A;  2OV7 A;  2PMZ N;  2DMT A;  3MZH A;  2ELK A;  4XRF A;  1S72 I;  4ENK A;  1JHF A;  1G3S A;  4IZZ A;  5LRS A;  4Q48 A;  4IHV A;  2NVQ J;  2VXD A;  4XLA A;  3CUO A;  4DGW B;  4BNC A;  3G71 I;  3GW2 A;  3LL7 A;  3ASN H;  1IW7 F;  2KQR A;  1ZAR A;  2UXN A;  3D1N I;  2E1M B;  1IRZ A;  4B43 A;  4WF2 A;  4XL9 A;  4OIP F;  1IN6 A;  2VPR A;  2M1B A;  2JRM A;  2KPM A;  1XN7 A;  2KRC A;  3RZD J;  3L9F A;  2DOD A;  2OF7 A;  4CYC A;  2E2H J;  1P92 A;  2MC4 A;  1LDD A;  2E5Z A;  2LOO A;  1T0F C;  3DU6 A;  3JSP A;  4AYB N;  4ZDL A;  5JI6 A;  3S32 A;  1FP2 A;  4AIK A;  2O8K A;  1R5G A;  5CVU A;  4YEL A;  2M2E A;  4KN7 X;  4MFD A;  3G4S I;  2MH9 A;  5CVJ A;  1CF7 B;  4OMZ A;  4OAY A;  4P96 A;  3QU3 A;  4LJZ F;  4A3F J;  3CD6 I;  4HAM A;  4Y4R A;  4ESB A;  2CUF A;  1H9T A;  2VOD A;  1S7A A;  4BE2 A;  1SD6 A;  2L2O A;  1R5I D;  3R61 A;  4MIM A;  3VWB A;  2EIN H;  4CZZ A;  3H1C A;  4M3B A;  4JQF A;  3S1N J;  2W25 A;  3HUG B;  3BTL A;  1MNM C;  3LAP A;  4L5I A;  1HOM A;  1G59 A;  2K85 A;  1XTA A;  5H20 A;  1WJ5 A;  3QP5 A;  3WGH A;  3I5U A;  3PNT A;  2RKH A;  5FRM A;  2PG4 A;  1LEB A;  2JA5 J;  3LNQ A;  2IS4 A;  4A3C J;  3DLL F;  3TP3 A;  2UZK A;  4EV0 A;  1HKT A;  1WI3 A;  2ADU A;  3CF2 A;  4HPQ A;  4CO8 A;  2QCO A;  1SC7 A;  3H9G A;  2V7F A;  2HVS A; 
#chains in the Genus database with same CATH homology
 5M3M J;  1TWF J;  2DMP A;  1A5J A;  2DMQ A;  2XPV A;  1VF9 A;  3HOV J;  2XB0 X;  3Q0W A;  1MH4 A;  3SFI A;  1U78 A;  1OJL A;  2HXO A;  2M34 A;  2VKE A;  2MW8 A;  5J3L A;  1UMQ A;  5K7F A;  2HQ5 A;  3S14 J;  1AU7 A;  4FE7 A;  1BW5 A;  2OPT A;  2IEK A;  1UHS A;  4JX6 A;  1A6I A;  3OSF A;  4C2M J;  5E3N A;  3S17 J;  3LSR A;  3IV5 A;  3TP0 A;  3NAR A;  5FKO A;  1IC8 A;  5F0H A;  2ME6 A;  1MH3 A;  1HF0 A;  1GT0 C;  4FE4 A;  5GP9 A;  4FTH A;  1ZK8 A;  3LSJ A;  1VI0 A;  2H1K A;  3ZQH A;  3HOZ J;  1T56 A;  4A3L J;  4W1U A;  1JKQ C;  3LSP A;  2HXI A;  4M3F A;  2O7O A;  1GDT A;  3JRA A;  2W48 A;  5IYD J;  3E7L A;  2IBD A;  4IHY A;  1H89 C;  3HBL A;  2RAE A;  5F1J A;  4HNV A;  2LVS A;  4B3A A;  2X48 A;  3BG9 A;  1TWC J;  4AC0 A;  4B1R A;  1MSF C;  3HGY A;  2R7Z J;  2FJ1 A;  1Y1W J;  5FKM A;  1IG7 A;  2R92 J;  3HB9 A;  2CRG A;  2DTZ A;  4IEJ A;  3QPS A;  3FKI J;  2VUM J;  4MFE A;  4IHW A;  1JGG A;  1QPI A;  1JJ6 C;  1G2H A;  3B6A A;  1X2M A;  1JUP A;  2CQQ A;  1ETW A;  2R5Z B;  1YRN A;  1E3O C;  3DEW A;  4I76 A;  2Y0S N;  2HOA A;  5IOZ A;  2M8G X;  3BR3 A;  1FTT A;  4BKX A;  3JRI A;  3FK7 A;  4DW6 A;  2JA6 J;  3BR0 A;  1FIP A;  1OFC X;  3QQA A;  1YRN B;  4RDU A;  1QRY A;  2R0Q C;  3HOX J;  2D5V A;  3HM5 A;  3BQY A;  2Y30 A;  3JRH A;  2GBY A;  4RBO A;  4XK4 A;  3S1Q J;  3IH4 A;  1NTC A;  2TCT A;  4XIC A;  2Y31 A;  1MBH A;  2ZB9 A;  2JK3 A;  2XRL A;  3S16 J;  1JT0 A;  3FK6 A;  1ZR2 A;  3SDG A;  2COB A;  3GTQ J;  4A93 J;  2WB1 N;  1ETK A;  1WCM J;  2EH3 A;  2CJJ A;  4C3J J;  1SAN A;  3HOW J;  2DMU A;  2CQX A;  2L7M P;  4BY1 J;  3BR5 A;  1JKO C;  2IAI A;  2K9S A;  3TED A;  2DMN A;  3S2D J;  2JN6 A;  2EBI A;  1F36 A;  3JRB A;  2DJN A;  3BG3 A;  2HDD A;  2K9Q A;  4Y52 J;  1DU0 A;  1GVD A;  4I6Z A;  1X2N A;  1ZGW A;  4A3E J;  2Y9Y A;  2LFB A;  1Z0X A;  5EGO B;  4V2F A;  2MSY A;  5J1U A;  1B72 B;  2GLO A;  3CMY A;  3I4M J;  3GTK J;  1U9O A;  2GM4 A;  1XC5 A;  5IOY A;  2JJ7 A;  2R5Y A;  3K2A A;  4MLO A;  2K40 A;  5EG0 B;  5K7Z A;  1IDZ A;  4L5E A;  2EQR A;  2E2I J;  1LFB A;  1BW6 A;  2DA3 A;  2VKV A;  3WHC A;  1AKH B;  4QIW N;  2R5Y B;  1NK2 P;  1RPW A;  2EZI A;  1IGN A;  3JRF A;  2YS9 A;  3ZQF A;  3BTJ A;  1GUU A;  5M5X J;  1RKW A;  1ZTR A;  2K9N A;  3A03 A;  3G1M A;  1RET A;  2NVT J;  3JRD A;  2HOT A;  4EEF G;  2WV1 A;  3MKL A;  2ECC A;  4A3I J;  2DA6 A;  3ZOB A;  3JRC A;  3H0G J;  2B63 J;  4X1E A;  3S2H J;  3DCF A;  1U9N A;  5IPA A;  2DA1 A;  3BT9 A;  2L7Z A;  5M5W J;  5DTD A;  3PO3 J;  3ZQL A;  5EF6 A;  2AO9 A;  3Q3S A;  1PUF A;  3M3Y J;  3LSG A;  1P7J A;  2QF7 A;  1ZKG A;  2MG4 A;  2JMW A;  2NOG A;  5FKN A;  2LY9 A;  1O4X A;  9ANT A;  1F43 A;  4J19 A;  2G0E A;  2E1O A;  2AHQ A;  1PUF B;  2R5Z A;  4BBR J;  4GFB A;  5IP9 J;  1W0U A;  1WH5 A;  4A3J J;  2YU9 J;  4DYQ A;  5IP7 J;  2EZH A;  5EYR A;  4NDL A;  5HOD A;  1W0T A;  5IYB J;  5F0F A;  4XRM A;  1AHD P;  2R93 J;  2FD5 A;  3L1P A;  1APL C;  4D5C A;  1T33 A;  3GTL J;  1I6H J;  3O8G A;  4M3E A;  5EZH A;  1NK3 P;  1LFU P;  3BR1 A;  4M6V A;  3QPL A;  5FJ8 J;  1GV5 A;  2P81 A;  1IUF A;  2LLK A;  3BR2 A;  3CCY A;  2XPW A;  5F04 A;  1BA5 A;  2LKX A;  2CUE A;  1Z77 A;  5F0C A;  4AUX A;  1WH7 A;  1WGX A;  1JTY A;  3K7A J;  5J1Y A;  2DN0 A;  1B8I B;  4QTR A;  1FTZ A;  3B6C A;  3MN2 A;  4QSH A;  2ID6 A;  5DS9 A;  5EDN A;  1IDY A;  2LR8 A;  3F0C A;  1MBF A;  4MO7 A;  5M3F J;  4DZJ A;  3NAU A;  1ITY A;  2MGQ A;  1CQT A;  3JRE A;  1JKP C;  2NVY J;  1ETV A;  4JX4 A;  3TW6 A;  4V2G A;  5M5Y J;  1LE8 A;  4CYC B;  4FCY A;  1R9T J;  4JP0 A;  3FIW A;  1MBJ A;  3Q0V A;  1XS9 A;  1IJW C;  1D5Y A;  3S1M J;  3G1L A;  1OCT C;  1BL0 A;  1S7E A;  4DYR A;  2X6O A;  2Y9Z A;  1LE8 B;  4LOC A;  1JUS A;  1H8A C;  3A01 B;  3RQI A;  5EGO A;  3GTG J;  3ZQI A;  2M9H A;  1K61 A;  3CDL A;  1MBG A;  2XGC A;  1B72 A;  3A02 A;  5F08 A;  5E3O A;  5K7H A;  3UKG A;  1HDD C;  3RZO J;  3HOU J;  2NS8 A;  2FX0 A;  5GPA A;  2Y2Z A;  5C4X J;  2FQ4 A;  4C3I J;  3JR9 A;  2I10 A;  4DZP A;  2YUS A;  5IP6 A;  2ECB A;  2L7F P;  5JLX A;  5JLW A;  5EG0 A;  2VI6 A;  2E19 A;  1ETO A;  2LD5 A;  1I50 J;  3HEF A;  1JKR C;  5J1R A;  3GTP J;  1MBK A;  3I4N J;  2XGD A;  1AKH A;  1WPK A;  3GBG A;  3OSG A;  2DA7 A;  2XGE A;  1H88 C;  4A3K J;  2LP0 A;  2E2J J;  4M3G A;  1P7I A;  5FKK A;  3OOU A;  5FLV A;  3PM1 A;  2NS7 A;  3GTM J;  1VND A;  2DA4 A;  4XID A;  1U8B A;  2H8R A;  2O9L A;  1ETY A;  2HOS A;  4UUT A;  4BY7 J;  3BTC A;  4C3H J;  4Y7N J;  5E3M A;  1I3Q J;  4UUS A;  1ZR4 A;  2WAQ N;  3ZQC A;  2NVX J;  1K83 J;  1EF4 A;  5C3E J;  1QVU A;  4UUS B;  3IH3 A;  4DYC A;  2EZK A;  2ID3 A;  3HKZ N;  2L0K A;  3LOC A;  5F27 A;  3TW7 A;  1VFC A;  1QVT A;  3MVP A;  3GTO J;  3IH2 A;  2LTP A;  2JWT A;  4D7M A;  4JYK A;  1ORK A;  2JA7 J;  1UG2 A;  5C44 J;  2M0C A;  1ETQ A;  3ZQG A;  3OIO A;  1ETX A;  3BG5 A;  4JX5 A;  1ENH A;  2CU7 A;  1BJZ A;  1MSE C;  2PMZ N;  1GV2 A;  2DMT A;  2ELK A;  2EZL A;  2X9D A;  2NVQ J;  4IHV A;  1B8I A;  1FIA A;  4ABZ A;  3BTI A;  4BXX J;  2KDZ A;  2DA2 A;  5GPC A;  3D1N I;  3FIS A;  3S15 J;  4A3D J;  3CQZ J;  3H3V K;  1TWH J;  1IRZ A;  4D5F A;  1TWG J;  2VPR A;  1TWA J;  3RKQ A;  1HLV A;  1HDP A;  1HCR A;  3BQZ A;  3RZD J;  1FJL A;  2OF7 A;  5E3L A;  4CYC A;  2E2H J;  4M3D A;  4A3G J;  1TC3 C;  3GTJ J;  4AYB N;  2O8K A;  3O8H A;  3G1O A;  5FKL A;  3WHB A;  1SFO J;  1MBE A;  4W97 A;  5BNG A;  1JT6 A;  2M2E A;  1RES A;  4MFD A;  3VPR A;  3A01 A;  1ZQ3 P;  1JUM A;  3PO2 J;  5IYC J;  4A3F J;  3HGG A;  1IV6 A;  2CUF A;  5EEA A;  3S1R J;  2L9R A;  4G12 A;  2XSD C;  1RR7 A;  2N8G A;  4MIM A;  4A3M J;  3C2B A;  1Q1V A;  1JJ8 C;  4M3B A;  4IHX A;  3HOY J;  4S0H B;  3S1N J;  1DU6 A;  3BTL A;  1MNM C;  1HOM A;  5FLM J;  2HYJ A;  4XRS A;  3Q0U A;  3JRG A;  1POG A;  2XB5 A;  4FIS A;  2KT0 A;  1FEX A;  1XG1 A;  4BBS J;  1Y1V J;  3W6V A;  2ME0 A;  4X6A J;  3HDD A;  2XPU A;  2JA5 J;  1OCP A;  3LNQ A;  3M4O J;  1X58 A;  5EZG A;  4A3C J;  3BR6 A;  3TP3 A;  1RKT A;  1JTX A;  1WI3 A;  4D7N A;  2LK2 A;  2TRT A;  4B4C A;  2HI3 A;  3SJM A;  2JA8 J;  4XRS G;  2DA5 A;  2QCO A;  4A69 C;  5C4J J;  4A3B J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...