4M71A

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 120
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m71A01
2K86A 5DCFA 4WCGA 2BE5F 2M30A 5FFXA 1MJBA 2A68F 3I59B 3PQJA 4A0YA 3KE2A 4S05A 3E6MA 3NEUA 2ZKZA 2DTRA 4XLNF 3QAHA 3HTSB 2GXBA 3CO7C 3FHZA 4MQVA 3MWMA 4CXFA 4N9IA 3GZ6A 3V7CA 5K5RA 5ILSA 4KFCA 5CLSA 1MGTA 3HRTA 2IPQX 1YQAA 5D4RA 3JAMK 2Q2EA 4ZYDA 2ZXJA 5DUIA 4YG2F 5LRRA 2G9WA 4L5IA 3QU6A 1O3QA 5L3CA 2FSWA 2A6HF 2GZWA 3T5XA 2D2WA 2YR2A 4HLXA 2W24A 5HVQC 4R8HA 2EJRA 3NQOA 1ZLKA 4I0AA 5DCMA 2ZBKA 2GXGA 2FF4A 4KN4X 4LMYA 2XKOA 2F5CA 1IXRC 2E7XA 1RNLA 4O3MA 2ISZA 1WKMA 3GF2A 1U5TB 4Q4ZF 4AWXB 4FX4A 5CVRA 1XSXA 1TTYA 4AVPA 4M9SA 1PP8F 1FPQA 2W25A 1PDNC 4LFUA 1Q1HA 3Q5FA 3J7AO 3V7SA 3VODA 3CUOA 1WRJA 1T98A 2HEOA 5ICGA 2MH2A 3BP8A 4UNOA 2FU4A 2RGVA 1OKRA 3CUQC 4YFNF 1R7JA 4LLNA 4EJWA 1S29A 4HQMA 2RV8A 3WE3A 4HZFA 2DK5A 1O57A 1YFHA 3F21A 3T8RA 5FD5A 2JT1A 3R60A 3TDZC 1V3FA 2ZJ2A 5K1YA 2DO7A 4U0VA 4QLCU 1ODDA 5ICEA 1ZGAA 2QLZA 1H9GA 3EQLF 2HKOA 5L3BA 5L3EA 3WTWC 1EH6A 4RAYA 5D5UB 2RKHA 1I1SA 3G3ZA 4L9NA 4FT8A 3GXOA 1XGMA 3C1DA 5IT9K 2EFNA 2CO5A 1O7LA 5FB2A 5L3GA 1KYWA 1IXSB 4L9VA 5D5WB 3KP7A 3CDHA 2IA0A 3KZZA 2D45A 4ENMA 1XMKA 3GW2A 3F72A 2D1VA 3LA3A 2R3SA 5H6QA 2OBPA 3F6VA 3P9IA 4EV0A 4Y17A 1ON2A 3L9FA 3M1EA 4ESBA 3W6JB 1R58A 2VT3A 2FRHA 1IW7F 4BXUA 1BIAA 5HOOA 5HS9A 2ZNZA 1TW2A 1WWXA 1DP7P 5LHGA 2UWMA 1U3EM 4IVNA 2O3FA 1OMIA 4IRIA 1W7PA 3HSRA 1Z6TA 3LQRA 3WGIA 5DDGA 1R5HA 2O6GE 5H20A 4I98B 2XVCA 3C3WA 2EFWA 3IKVA 3S2WA 1MJ9A 2FBKA 1BIBA 1KU7A 2STTA 1T0FA 2XGXA 1XGOA 4IRGA 2UXXA 5F1RA 1UHMA 2C6YA 1T2KA 2A07F 1IN4A 2XUBA 3GFLA 3BZ6A 1KQ0A 1UFMA 1MDMB 1IXCA 1JHFA 4LGWA 2HZTA 4BAYA 2R7FA 2XAJA 4PDKA 1U78A 3K0LA 4LLGF 1T38A 3RIRA 2OA4A 2J5PA 5LLQA 4A5MA 3RJPA 2DK8A 1D5VA 1ZHFA 4HAMA 2OAZA 5CVIA 5J8CA 1AOYA 1O3RA 1R5GA 3WU0A 2LF8A 1F1ZA 4EVIA 3MFKA 1IRFA 3D0SA 3RYRA 1B9MA 4UUVA 1R36A 1XB4A 1Y0UA 2AXLA 4M72A 2XAHA 2EV0A 3K69A 3KP3A 3T1BA 3TOBA 2UZKA 1JXSA 1JHHA 3FM5A 1KA8A 2PQ8A 1CF7A 2QBYA 3V8KA 3KETA 3F8MA 1L0OC 1HKQA 1P4XA 3WTUC 3F8BA 2V6CA 1KU9A 3FMSA 3ZMVA 1EH8A 1LEBA 3HIFA 3DP7A 1IN5A 5EEHA 1FY7A 4PZJA 4M6XA 2KIMA 1R1UA 2V1UA 1J7KA 4YFXF 5H6RA 3QPHA 1W7PB 2IA1A 3ZP5A 3F22A 2STWA 3I0TA 1J5YA 2Z9OA 2QQ9A 3D5LA 1HW2A 1FWZA 3LFKA 3GUDA 3U2RA 3L09A 4BNCA 4A0XA 2QQBA 2MLGA 5KVRA 3I59A 5KK1A 1FYLA 1YG2A 2L4MA 1PUEE 1P6RA 1J2XA 2A69F 3DKWA 1USSA 2F5FA 3ZPLA 3M7GA 3FZVA 3HRSA 3VOEA 3LA2A 1RUNA 5HLHA 3QOPA 3ZQ7A 4Q48A 4JQFA 3BJOA 4CGZA 3KP5A 4PCQA 4BH9A 1SD7A 1XCVA 1T6SA 3BDDA 2G7UA 5FLXK 4ON0A 1R22A 4HA8A 3JW4A 5DUKA 2EFQA 2ZCWA 5LEKA 1QBJA 4Q5SF 3CTAA 1SFUA 3B73A 5E1WA 2HYGD 4I09A 1I5ZA 2OQGA 3KEQA 2PN6A 2QM3A 1OR7A 4BHCA 2P5KA 1CF7B 4RGSA 2QBYB 2RC4A 3KCCA 3SQNA 3ZN0A 5LGNA 3FMQA 3N4MA 4IPAA 2BYVE 2ZMEA 2CQKA 3JAMZ 4HV6A 3BWGA 4BHBA 2BBYA 5LEJA 3TO9A 5D8LB 1RUOA 1U5TC 3WGGA 3KP2A 1H0MA 2Z5UA 1MJAA 3BJ6A 3TDUC 5HDNA 4ZYEA 3JSPA 4ZYGA 2L54A 2FXAA 1FYMA 2V1DA 2IW5A 4KMUX 2EV6A 5JHUA 4LB6B 3VFZA 1J59A 1GXQA 5D6EA 3TO7A 1IF1A 4H0EA 3ELKA 1YS7A 2KIFA 2HOEA 4EJVA 5CVJA 1O3SA 1XSVA 4LG0A 1ZYRF 4R1HA 2DBBA 2JPCA 4HX7A 1H9TA 2VT2A 3HRUA 5HDGA 1REPC 2GA1A 5TJJA 2K7LA 4BQAA 3IC7A 2HKXA 2F5EA 2ESHA 2LNBA 1J9IA 1W4MA 5CJ9A 5E20A 3O3KA 4XLPF 3GFMA 4G7HF 2FBHA 2YX4A 2EK5A 4KA4A 1FBSA 2VE8A 5ILVA 2VC1A 4P5OA 3JSOA 3V4GA 4O5VA 4IRHA 2YX7A 5A2QK 3IRRA 3I71A 1TNTA 4MTDA 2BV6A 4EM1A 3HHGA 2MD5A 5JFRA 1WI9A 3HOTA 5BOXA 5IT9Z 1BI3A 4L5JA 5FD6A 2W85A 2FEZA 1IRGA 3J80Z 5TRDA 2HQRA 1SFXA 2ZMEB 1ZH5A 1P4WA 1RI7A 2HFHA 1K7AA 2VBWA 4ESJA 1FSEA 4LLLA 3FMRA 2PEXA 1SD4A 5F6FA 2CWEA 4F7ZA 2JZYA 1LJ9A 4HBLA 2EFPA 2HDCA 2DPUA 2L02A 2XAFA 1VTNC 1S3JA 2JPBA 3K1NA 5L3FA 5D8KB 4WX9A 4ZZLA 4XSXF 1WQ2A 2P5LC 2ETHA 2P7CB 3WG9A 2HYFA 2P4WA 1P2FA 4GXOA 4HLYA 3TQNA 2WV0A 2PMHA 4P9FA 1MDMA 2QZ8A 4P9UA 1GVJA 4G8XA 4MEYF 4L0YB 1BOAA 1P4AA 2HWVA 2FQ3A 1Z6RA 4M9ZA 5DYMA 1HKTA 5JR3A 3L2CA 4MQ9F 4RS8A 5CYVA 2XROA 1XSDA 3QP5A 1B59A 2BGCA 3TOAA 4LG0B 3KZYA 3GYHX 1XN7A 1FP1D 2FOKA 5HLGA 4BYYA 2PI0A 5HLIA 2A3SA 5LHIA 3EYIA 2KIUA 3BROA 2FMYA 2V9VA 3ZMZA 2DLLA 4HF0A 2O61A 1YLFA 1IN6A 2DT5A 4M9XA 3J80K 2NS0A 5JVTA 4MTEA 1BJAA 5DD4A 2FNPA 3NRVA 1OYWA 4HV5A 2HQNA 1R23A 1XCBA 3F6OA 1CGPA 4G7ZF 1G3WA 1KU2A 3R6SA 5D6FA 4DNCA 2NNNA 4G94A 3E3VA 3DXJF 5DV5A 1D3YA 4ZZDA 3J81K 2NAZA 2HTSA 4CO8A 5LGUA 2Q8KA 3M9AA 3ZMSA 3U9GA 2LF7A 3V8JA 2GQQA 4WXDA 3K2ZA 5AIPA 2OQRA 1LDJA 1LDDA 2EB7A 5BMZA 1ZGJA 2HR3A 2K02A 2P7VB 3I54A 4P55A 3CJNA 1MZBA 1OPCA 1ZREA 3PQKA 3R4KA 3H3UA 4TV7A 1LQ1A 3AAFA 3V7RA 2DW4A 2TDXA 3IHUA 4UV9A 4A5NA 3WODF 2E1CA 3GLXA 4FX0A 2NYXA 1ZN2A 4UVCA 4U0WA 2H94A 1TNSA 2PBIA 3KLNA 1XDUA 3PFIA 4E70A 3H3ZA 3VB2A 1G3SA 4KUMA 5ED4A 4AD9A 2J5OA 3M8EA 3KFWX 4RGRA 4EMSA 1DUXC 4L18B 4ZH4F 4HF2A 1LEAA 1I1GA 2F2EA 1W5TA 5ICFA 1BI2A 2IA2A 2MC3A 3TGNA 5D5VB 2RQPA 4OU0A 4AIKA 2QWWA 4XRFA 3F23A 3FXUA 4KYWA 4YFKF 1FT9A 4IJAA 4WK8F 1GHCA 1YO5C 1O7FA 1WSUA 2EA2A 1K79A 3ERED 2VE9A 3RYPA 5FLXZ 1QQIA 1BC8C 2RNJA 4Z2YA 4KT5C 4HQEA 4M6YA 5E1ZB 2Y75A 3JTGA 1A04A 3SHFA 1F4KA 3BJAA 1QPMA 3LSTA 4IF4A 4NQWA 1FYKA 4D0PA 1ULYA 2EV5A 4I0BA 2QQAA 1IAWA 3KP6A 2HS5A 2CSOA 1J75A 2ISYA 2VBZA 3GFIA 4GGGA 3E6BA 1K78A 2K27A 2ZFWA 1ZLJA 1ON1A 2D1HA 3ROUA 5AONA 3P9KA 2ESNA 5AIQA 3EUHA 3R61A 4FHTA 3KLOA 4U7DA 1QO0D 3HSEA 3RKYA 1XD7A 2W57A 4HOBA 1YIOA 5D5XB 2Q0OA 2K4BA 3LA7A 4BHPA 2O8XA 2QVOA 2MLKA 1X3UA 2H09A 5E1XA 4I02A 3GFJA 2QENA 2PMUA 4GCVA 1ZARA 1R00A 2XRNA 3M8FA 2NNYA 3WE2A 2A5YB 2IVMA 3L00A 5E17F 4OIPF 3KEOA 3WTYC 1MKMA 2JRTA 4XSZF 2H27A 1YYVA 3E5XA 1NHAA 2KJCA 3F3XA 5IT3A 3LAJA 4A6EA 5EEGA 1DDNA 1S6LA 1JE8A 2VOOA 3ECOA 1G6NA 2M5WA 2ADUA 4G7OF 4WXCA 3C7JA 4OMYA 1DPRA 2PLYA 4CZZA 2G7HA 1FC3A 2Y48A 4N9HA 1FLIA 4EJUA 4I01A 3IL2A 3MCZA 4YIIA 2ZO4A 5A2QZ 3KP4A 2OZ6A 5CVVA 3HYIA 3QRFF 5ILUA 3FXRA 2DAOA 1HKSA 3ULQB 1LB2A 2MA3A 4R79A 3RTRA 3TO6A 2EFOA 3RKWA 1ZRCA 2EWNA 4LK0F 4KIBA 4HX8A 2PJPA 3GWZA 3TKYA 1LDKB 4OIOF 4NHJA 5LGTA 4HW0A 2DI3A 3EDPA 1K78B 3B02A 2M87A 4MGRA 4UVAA 4UXNA 1D8KA 4A6DA 3MZHA 1IN7A 4S04A 1SD5A 1KYZA 1STZA 2VODA 1C0WA 1L3LA 4WWCA 2A61A 3F8NA 5ICCA 2P6SA 2P5VA 2PG4A 3DPTA 4U0YA 3WTZA 1XDSA 3T8TA 4OOIA 2DQRA 3LAPA 2VBYA 3T0YA 1EV7A 3ABTA 4I2OA 2X0LA 1TQMA 2DFIA 2P6TA 2B0LA 3ECHA 1IUYA 1I27A 3CO6C 1BBYA 1XMAA 5CVUA 3IRQA 4IHSA 2L01A 4CICA 2M1BA 3Q9SA 1DPUA 5F64A 1HQCA 5HDKA 3WU1B 2YSRA 5HS7A 1SAXA 4YIFA 3DQVC 2IT0A 5E18F 4EM2A 1FZPB 1TLHB 2HGCA 4RGXA 4UVBA 1USTA 2FMLA 3ML6A 2H6BA 1BC7C 4G6DA 1BI0A 4EJOA 3MAJA 2DU9A 5K5OA 2O03A 1B4AA 4RGUA 4AIJA 3RPUA 1YW9A 3FWEA 2RN7A 1Z91A 4A12A 1LNWA 2ELHA 3ZMUA 4KMFA 2PFBA 4LK1F 1FSHA 3MQ0A 4A0ZA 3CLOA 2X4HA 3J81Z 1Z05A 1FX7A 1KQ9A 3W6KB 3BY6A 2P8TA 4M71A 5FGMA 3ZMTA 1U2WA 1Z7UA 1ZRDA 1U8RA 4HF1A 3BPXA 4EM0B 2E7WA 3SXYA 3I64A 3HOSA 3K1PA 5DEQA 1RIOH 1O3TA 4M73A 2GIVA 1FOKA 6PAXA 2JSCA 4OINF 1YW8A 4HDVA 4OIRF 4OIQF 4B8XA 3ABUA 2W84A 2F5DA 4UV8A 1QZZA 4RB0A 1OYIA 4U7BA 1TBXA 3CUQA 1HW1A 3HRMA 4L0ZB 2IP2A 2O0YA 4EJTA 4LB5A 2VXZA 4PGGA 1UCRA 1PP7U 1F5TA 4HYEA 2L4AA 3WTSC 3SFZA 5BS6A 1K6OA 4G9YA 2VOPA 1TQIA 5K5QA 3FX3A 1I6XA 5DD8A 2KKOA 2FNAA 3RKXA 3WTVC 4CYDA 2KJBA 5E8IA 4EGYA 5D4SA 3H92A 1FBQA 2MH9A 3GEZA 1QZYA 4ETSA 4U88A 1E17A 2BEOA 1LVAA 4CHUA 1KU3A 1ZRFA 2GAUA 1G3YA 3I5UA 2FE3A 1UHWA 2Z99A 4HDUA 4ENKA 3WTXC 3K1MA 1B1BA 3SZTA 4JK1X 5DCMB 2ACJA 2E1NA 4KNYA 3COAC 2Z33A 1AWCA 5LBQA 3DEUA 1OYYA 2VBXA 1P92A 2OU2A 1YTYA 4MNUA 4GO1A 2HTJA 2XKPA 1S8NA 1HW5A 2XV4S 2DPDA 4GYGA 2XAGA 3I53A 4PGHA 4KICA 5E8GA 2WTEA 3IWZA 5J6XA 3K9TA 1S7AA 4G6QA 1HSTA 4N0BA 3F8FA 1KGSA 2UXNA 2M8EA 2LDUA 4K2EA 3CUQB 3O6BB 3IKTA 3LWFA 4UHTA 3C18A 4NB5A 3ISPA 3FXQA 1EH7A 3LQQA 3HTUA 5FO5A 3GZ5A 4Y13A 3E97A 3FF5A 4RAZA 3E6CC 4LD5A 4OMZA 5BQTA 2V1XA 5FFZA 1J0RA 1B9NA 4ASNA 1D8JA 3MEXA 3RI4A 3P9CA 3BPVA 3QPTA 4ZYHA 1UB9A 1XGNA 4GYIA 3N97A 1ZG3A 3U1DA 4Q47A 4ESFA 1ZAOA 2Z3YA 3RPQA 2CW0F 1HSJA 2OD5A 4RB2C 1F9NA 4XBFA 2COMA 3F8CA 3BOQA 1IN8A 4M74A 2YPRA 2IJLA 4KIFA 2XHKA 3GVAA 2CFXA 2M45A 2H6CA 1TW3A 4KDPA 1Z1DA 2CGPA 4ENNA 4A2UA 4LJZF 4RB3C 1Z9CA 3DFGA 2XAQA 1SMYF 2CG4A 1G4DA 2WC2A 3HHHA 3WGHA 5JI6A 3ZMDA 1G3TA 4Y15A 4KIGA 4B09A 1BI1A 4EQQA 2DQLA 2VN2A 4I7HA 4RB1A 3I58A 3G73A 2KRFA 1SD6A 3I4PA 2ZNYA 2K4JA 2XASA 1FBUA 3HSFA 2FA5A 3GO5A 4KN7X 3P7NA 3Q9VA 2RVCA 2QUFA 5L3DA 1S7OA 5BPIA 1KQ8A 1ZG5A 4DQ2A 1W5SA 2QYOA 1B6AA 3VEPA 1FP2A 3O2PE 3R0AA 2LKPA 2A6EF 2GA2A 2AS5F 2VONA 4EGZA 1SFEA 1SMTA 5HS8A 1YW7A 4QWQA 1MD0A 3QU3A 2RDPA 1ZG1A 3L7WA 3WTTC 1JGSA 3IWFA 2GWRA 4P96A 2V79A 3OV8A 1GXPA 4MEXF 3R0JA 3E5QA 3EYYA 3REOA 3RDIA 1ONVA 3DV8A 4JBAA 1U6GA 2FBIA 3DPLC 5J8FA 4IXAA 4HX4A 1V4RA 3HUGA 5LHHA 4WXHA 2XIGA 1W7PD 3SZPA 2OZUA 4AIHA 5BPDA 5LRSA 3GX4X 1RZ4A 4O6JA 1BN5A 2JTVA 1HXDA 4CDGA 4L9JA 4WF2A 2R7DA 1TQPA 1U5TA 2WWYA 3MZYA 1R1VA 3JTHA 1QGPA 2L3DA 1FNNA 4MHGA 1IZ1A 1T39A 1HBXG 2IRFG 4IHTA 1YS6A 5ERIA 4ENJA 1QNTA 3OOPA 3FM3A 3ZN1A 3E6DA 3DF8A 1XGSA 2LSOA 1E2XA 2VC0A 3E5UA 2EA4A 3V8LA 2YU3A 1R1TA 2NRAC 2MBFA 2CYYA 3EETA 4L9TA 1BM9A 3QP6A 2Y0MA
chains in the Genus database with same CATH superfamily
1LE8B 2K86A 5DCFA 2R7WA 3HXLA 1ETYA 4WCGA 2H1KA 2BE5F 2R4GA 1YRNB 2M30A 2JJ7A 5FFXA 1MJBA 2A68F 3I59B 3PQJA 4A0YA 2VB6A 2EINH 3KE2A 3GMEA 2Y9ZA 2OJED 4S05A 2KDOA 4BJ5C 5FKMA 3E6MA 3NEUA 2ZKZA 1R6RA 2DTRA 4XLNF 3UR3C 3QAHA 3HTSB 5EF6A 2GXBA 3RQIA 3CO7C 3FHZA 3OIOA 1K83J 4JX5A 1EF4A 4MQVA 3NAUA 2R92J 2QCOA 1X1BA 3EUAA 3MWMA 4CXFA 4N9IA 3DTEA 3GZ6A 3VSKA 3V7CA 2E5NA 5K5RA 5ILSA 2L7MP 2KIQA 4KFCA 3GTOJ 5CLSA 4LITA 3IH3A 5KAIC 1MGTA 3HRTA 4XLFA 1X4OA 3Q3SA 2IPQX 1D1BA 5LFAA 1YQAA 5D4RA 3DWLE 3JAMK 2Q2EA 3RCOA 2IS6A 4ZYDA 2ZXJA 5DUIA 4YG2F 1K4TA 2AQFA 2QSFX 5LRRA 2G9WA 4ABZA 1D0ZA 1IV8A 4L5IA 3QU6A 1O3QA 1GVDA 2G0EA 2FSWA 5L3CA 2A6HF 2GZWA 2ZXWH 3T5XA 1FIPA 2D2WA 2YR2A 4DYQA 4HLXA 2W24A 5E3NA 2XB5A 5HVQC 3CMAI 4R8HA 2LD5A 2BHYA 3HUGB 4EEFG 5GAEJ 3RQ4A 5IYCJ 2EJRA 3NQOA 1ZLKA 1PJRA 4I0AA 3FHNA 3AG4H 5DCMA 4E7HA 2ZBKA 3OYDA 1JUMA 2FD5A 2FF4A 2GXGA 4KN4X 4LMYA 1JUPA 2MW8A 1X2MA 2XKOA 2F5CA 3D5SC 5KAFC 1IXRC 4G6TB 2E7XA 1DQUA 2DN0A 1A6QA 2KZGA 1WJBA 3MMYB 1RNLA 4O3MA 4XLCA 2ISZA 1UAAA 1I50J 4QSHA 1BR1A 1WKMA 2E36A 3GF2A 5E3MA 1U5TB 4Q4ZF 2DODA 4AWXB 4FX4A 2OCCH 5CVRA 3S17J 1W36D 2ID6A 1X2NA 5HODA 4CH7A 3H1CA 2UV1A 1XSXA 1TWCJ 3H5RA 1DU0A 4BY1J 4IHYA 5HNHA 1TTYA 4AVPA 2BY3A 4M9SA 1B72A 2R0QC 4B4CA 1PP8F 1QHGA 1FPQA 5IP7J 3OSFA 2W25A 1PDNC 3GZNB 4LFUA 1Q1HA 2ZXIA 4UUSA 3Q5FA 1NK2P 3J7AO 1UMQA 3SYTA 2E34A 2L0KA 3V7SA 3VODA 3CUOA 1WRJA 1T98A 2HEOA 3M4OJ 3IH4A 5K7ZA 5ICGA 2MH2A 3BP8A 3DCFA 5F08A 4UNOA 2FU4A 4M3EA 4UB6C 2RGVA 1JT0A 1PUFA 4H4KC 3I4NJ 1OKRA 3CUQC 4YFNF 5EEAA 1R7JA 1WJCA 3BG3A 4LLNA 4EJWA 4AYBA 1S29A 4HQMA 2HZDA 4BDZA 2RV8A 1UG0A 3WE3A 4HZFA 2DK5A 4PJ0C 1O57A 1Y56A 1IGNA 1YFHA 3F21A 3T8RA 5FD5A 2JT1A 4C2MJ 2KP6A 3R60A 4XICA 3TDZC 1Q1VA 3FBNB 1V3FA 2ZJ2A 4BKXA 5K1YA 1ZQ3P 2JMWA 2DO7A 4U0VA 4QLCU 1ODDA 5ICEA 1ZGAA 1T08B 2QLZA 1H9GA 3EQLF 2HKOA 5L3BA 5L3EA 3OYGA 4ITVA 5DM7F 1EH6A 5KNLA 4RAYA 3WTWC 5B66C 5D5UB 2VJJA 2RKHA 3LFUA 2CW8A 3G3ZA 4L9NA 1I1SA 4FT8A 3GXOA 1XGMA 3C1DA 5IT9K 2EFNA 1B8IA 3OYMA 2CO5A 1O7LA 2DOAA 5FB2A 5L3GA 1KYWA 1IXSB 4L9VA 5D5WB 3KP7A 3CDHA 1RR8C 2IA0A 3KZZA 2D45A 4ENMA 1XMKA 1POGA 3GW2A 4OAZA 3GTGJ 3F72A 5K7HA 2D1VA 3LA3A 2R3SA 1AU7A 2M0CA 5H6QA 2OBPA 1K4SA 1W0UA 1H89C 2Q2EB 2JVGA 4C2UA 4CCLA 3K70C 3RSNA 3CJTB 3F6VA 3P9IA 4EV0A 4Y17A 2NVQJ 4GDFA 1ON2A 1X1DA 1Z7LA 3L9FA 1TT5B 1D1AA 2B7EA 2DA7A 2K40A 3M1EA 4D5CA 4ESBA 3W6JB 1R58A 2PJRA 3IAM2 4G12A 2VT3A 1WPKA 2LP0A 2FRHA 4KITB 1IW7F 2VPRA 4BXUA 5IYDJ 1BIAA 3K4CA 5HOOA 5HS9A 1ENHA 2X6WA 2OTJI 2IXSA 2ZNZA 4NUBA 2CW7A 1TW2A 1WWXA 1DP7P 1XS9A 5LHGA 2UWMA 2JK3A 1U3EM 4IVNA 2O3FA 1OMIA 4IRIA 1W7PA 3HSRA 1Z6TA 4AC0A 3LQRA 3J7AY 3JCUC 3S2HJ 1QA6A 3WGIA 2H1LA 4IEJA 3QYFA 5DDGA 1HC8A 2L2OA 3BTLA 1R5HA 2O6GE 3MN2A 2E1MB 2WADA 3W2AA 3HGGA 5H20A 4I98B 2XVCA 1X3WB 1B72B 3C3WA 3SJMA 3E0JB 2EFWA 3HC7A 2V4JC 2WAEA 3IKVA 3S2WA 2E19A 3PO3J 1MJ9A 2FBKA 5JLWA 1BIBA 1RPWA 3PUFA 3LL7A 1KU7A 3PL8A 4IL6C 2STTA 4V2GA 2WAQA 1T0FA 2XGXA 1XGOA 4IRGA 2UXXA 1RETA 5F1RA 1UHMA 1VQKI 2C6YA 2QSHX 3G2BA 1T2KA 2A07F 1IN4A 2XUBA 3GFLA 3BZ6A 4ZDOA 1KQ0A 1UFMA 3LSIA 1MDMB 1IXCA 1JHFA 4LGWA 2HZTA 1HF0A 1UZCA 2R7FA 4BAYA 2XAJA 4PDKA 3NWTA 1PUFB 3HPHA 4F55A 1U78A 3K0LA 4CCJA 4LLGF 2ECBA 1T38A 2W00A 3G1LA 4XN3A 2GXAA 3HOUJ 1VF9A 3BC8A 3RIRA 2OA4A 5C4XJ 2J5PA 5LLQA 3A4CA 4BQNA 1VQ7I 3AG1H 4A5MA 3RJPA 2DK8A 1D5VA 1ZHFA 4HAMA 1X3ZB 1MSEC 2OAZA 5CVIA 3PNTA 5J8CA 1AOYA 1O3RA 1OLTA 1R5GA 2HOSA 2M9HA 2DYSH 3WU0A 2LF8A 1F1ZA 4EVIA 3MFKA 1IRFA 2CV2A 3D0SA 2ZJQF 4YRVA 3RYRA 3LOCA 1B9MA 4HSTA 4UUVA 2V6EA 1G2HA 1R36A 2ZFUA 1XB4A 2EZIA 1JJ8C 3JRDA 2HPMA 1Y0UA 2AXLA 4M72A 3O8GA 1ETVA 2XAHA 4LIUA 2EV0A 2LKXA 3CESA 3CDLA 3N05A 2RAEA 3K69A 3KP3A 2DFEA 3T1BA 3D1NI 2X48A 2DMPA 1B8IB 4F52A 3TOBA 1OCCH 1TT0A 3DKYA 3F0CA 4IZZA 3G1OA 1FTTA 2DT7B 1QVTA 1U0JA 5IP6A 2UZKA 5IYBJ 1JXSA 1JHHA 3FM5A 1KA8A 2PQ8A 1CF7A 2QBYA 3V8KA 3LSGA 2BVLA 3KETA 3F8MA 2KZVA 2Y0SN 1OCTC 1MBHA 1L0OC 5GADJ 1HKQA 1P4XA 3WTUC 4BUPA 2E60A 3F8BA 2V6CA 2OCEA 1WI3A 1KU9A 3FMSA 3QODA 3ZMVA 3DEEA 4XOPA 2JN6A 2FJ1A 1EH8A 1OCZH 2WB1N 1LEBA 3HIFA 3LSRA 3Q0UA 1VQ8I 3DP7A 1IN5A 2ZSIB 1FY7A 5EEHA 1VQLI 4PZJA 4M6XA 2KIMA 2X1EA 1R1UA 2V1UA 1J7KA 4MIMA 3PNVA 5FKKA 4YFXF 4M3FA 2EBIA 2W4SA 5H6RA 3QPHA 3FXOA 3MD2A 5EZHA 1W7PB 2IA1A 3ZP5A 3CLQA 3F22A 2STWA 3CCEI 4QTRA 1V54H 3I0TA 1J5YA 2Z9OA 3ZQQA 3ZGKA 2IGKA 2QQ9A 2ECCA 2MABA 5KCMA 3D5LA 1MBGA 1HW2A 2IS4A 1FWZA 3HGYA 3FXJA 3LFKA 3DBRB 3GUDA 3L09A 3U2RA 1LE8A 4F92B 4BE1A 4A0XA 1NH3A 4BNCA 2QQBA 2MLGA 1YRNA 2WY7Q 1YITI 2DOEA 1OFCX 5KVRA 3I59A 5KK1A 2D5VA 1MIJA 1X1PA 3AL0B 1FYLA 3ZOBA 4DIQA 1IDZA 1YG2A 2L4MA 4BXXJ 1N77A 3AG3H 1PUEE 1P6RA 2HU9A 1J2XA 2A69F 3DKWA 2L7ZA 1USSA 1BW6A 1MW7A 2RREA 2F5FA 1JUSA 2Y30A 3ZPLA 4DBQA 3M7GA 2F5VA 3H5AA 3FZVA 3CCLI 1WJAA 3HRSA 4ZC3A 3VOEA 2CRGA 3LA2A 1RUNA 5HLHA 3QOPA 3ZQ7A 2GIZA 2KRHA 4Q48A 4NDLA 4JQFA 3OR1C 3BJOA 3BZKA 2KQRA 4CGZA 3KP5A 2PMZA 1Z21A 4PCQA 3X2QH 4BH9A 1X19A 1SD7A 1XCVA 1T6SA 2M2EA 1VQNI 3BDDA 2G7UA 2X9DA 4ON0A 5FLXK 3K6GA 1RKTA 2R7UA 1R22A 2A6TA 3JW4A 4HA8A 3Q0WA 3NARA 2IGOA 5DUKA 1GUUA 2EFQA 4CCNA 4D7MA 1IRZA 1YHQI 2ZCWA 5LEKA 3LSKA 2ZXHA 1QBJA 4Q5SF 3CTAA 5J47A 5M3MJ 1SFUA 3B73A 1D0YA 5E1WA 2HYGD 3DKXA 2VKVA 4I09A 1I5ZA 4XLEA 4C30A 4RAGA 2OQGA 3KEQA 3W2VA 2PN6A 4CCOA 3G6EI 3OL3A 2BY0A 2HDWA 3DLAA 2QM3A 2RQQA 1OR7A 3CF2A 1VQ6I 3DU5A 4BHCA 2XF6A 2P5KA 1CF7B 1QPIA 4FQGA 4RGSA 2QBYB 5M3FJ 2RC4A 3BG6A 4C3IJ 3KCCA 2E2HJ 3SQNA 3ZN0A 5LGNA 3MVPA 3FMQA 3N4MA 4IPAA 2BYVE 2ZMEA 2CQKA 3C2HA 1OR7C 3JAMZ 4BACA 4HV6A 2UUZA 3BWGA 3L2QA 2QSGX 1G8XA 4XRMA 4BHBA 4XNFA 4IOCF 2BBYA 2ZB9A 5LEJA 3SEQA 3VYTB 3TO9A 3U1KA 3HOXJ 3RKQA 3HL2A 5D8LB 1HLVA 1RUOA 2EIKH 2VJ4A 2ZMEC 1WGXA 2DMNA 3OR2C 1U5TC 3G71I 4HRIA 2BW3A 3KP2A 3WGGA 2IBDA 1VQPI 4B48A 3V42A 4A3BJ 2M8GX 1H0MA 4Y3OA 1XTAA 4PJNA 2Z5UA 1FOWA 5J3LA 1MJAA 1T56A 3BJ6A 3OIQA 2L9VA 3TDUC 4ZYEA 5HDNA 3JSPA 1YIJI 1WH7A 1BR2A 4ZYGA 2L54A 4ZTFA 5FRMA 2F4OB 1Y1VJ 2FXAA 1FYMA 1OJLA 3PNYA 1T8IA 3GTKJ 2DJNA 2V1DA 2K9SA 3TW6A 2IW5A 2EILH 4KMUX 2EV6A 5JHUA 4ANJA 4LB6B 2DCEA 3VFZA 3A0HC 3BZCA 1J59A 1GXQA 5D6EA 2LYCA 3TO7A 1IF1A 5GAGJ 2R5ZB 4H0EA 1I6HJ 2E2IJ 3ELKA 1YS7A 2KIFA 2HOEA 4EJVA 4QPQA 5CVJA 4BQQA 4BU2A 1XSVA 4I6ZA 2ZJPF 1O3SA 3ZQCA 1U9NA 1ZYRF 2BY2A 4LG0A 3OIPA 3L2RA 4R1HA 4IHVA 2DBBA 2JSPA 2JPCA 2AO9A 2Z1DA 2VQLA 4HX7A 2HXOA 1YJNI 1H9TA 2VT2A 2CMPA 2VLAA 4KISA 3HRUA 5HDGA 1REPC 2GA1A 4NNJA 5TJJA 2K7LA 4BQAA 3IC7A 2HKXA 2F5EA 2DA2A 2ESHA 2LNBA 4FASD 3IV5A 1J9IA 4W1UA 1XPXA 1W4MA 5CJ9A 5E20A 3O3KA 4XLPF 3FDYA 1ORKA 5EDNA 3GFMA 4G7HF 2FBHA 4JX6A 3FKJA 3S93A 1VI0A 2EZLA 4OWRB 3CMEI 4J19A 2HVRA 3RZOJ 3B6AA 4A3KJ 2YX4A 1R5ID 2EK5A 4KA4A 1FBSA 2VE8A 5ILVA 2COBA 2VC1A 3I9V2 4P5OA 4EATA 1HDPA 3BR5A 3JSOA 2XSJC 3V4GA 1TL8A 3ZQIA 4O5VA 1IO2A 4IRHA 2YX7A 5A2QK 2EZKA 3IRRA 4I99C 3ZQGA 5FKOA 1J09A 3I71A 5F0CA 2KRCA 4JOMA 3KZIC 4X6AJ 1TNTA 3PIPF 2TRTA 4MTDA 2BV6A 4EM1A 2BOLA 2IS2A 3K7AJ 3HHGA 3OY9A 1EKEA 2MD5A 2MG4A 2K9QA 5JFRA 1WI9A 3HOTA 2CV0A 5BOXA 2VQHA 5IT9Z 1WJ5A 1BL0A 1BI3A 4L5JA 5FD6A 2W85A 1MMAA 4F91B 3B6CA 2FEZA 1N78A 1I3QJ 1IRGA 3S3MA 3J80Z 5TRDA 3GTJJ 1GT0C 3HB9A 2HQRA 1GV2A 1R4MB 4XORA 1SFXA 2ZMEB 2AXTC 2CUZA 1ZH5A 2LKSA 1P4WA 1RI7A 2HFHA 1K7AA 3OYHA 2VBWA 3DBLB 4XKBA 1FSEA 4ESJA 3GTQJ 3A03A 4LLLA 1T33A 3FMRA 1ZGWA 4BE0A 2PEXA 3BCAA 3S1RJ 4IQJA 1SD4A 5F6FA 2CWEA 1JT6A 4F7ZA 3S15J 1Y1WJ 2JZYA 3A1YA 4GFBA 3UNGC 1LJ9A 1WJFA 4HBLA 2EFPA 2BW3B 1IJWC 2HDCA 4PJJA 2DPUA 2L02A 2XAFA 5GPAA 1VTNC 1S3JA 3DPUA 1G59A 2JPBA 3K1NA 5L3FA 2MFZA 2E1MC 5D8KB 4WX9A 2O9LA 4ZZLA 4XSXF 3BQZA 1JJ6C 2K85A 4B3AA 2M4KA 4QPOA 4XKVA 4ZTJA 4XIDA 1WQ2A 2P5LC 1LFUP 2ETHA 3CP8A 2P7CB 3WG9A 2HYFA 2XDVA 2P4WA 1P2FA 4GXOA 3BR6A 4HLYA 3TQNA 2WV0A 2PMHA 3HKZA 4P9FA 2K5CA 2R7OA 1MDMA 3OYBA 2MYSA 1VQOI 2QZ8A 4P9UA 1GVJA 1R49A 4G8XA 4MEYF 4AUXA 4L0YB 1BOAA 1P4AA 2HWVA 4E7SA 2RNGA 3H5NA 2FQ3A 5FROA 1Z6RA 1Y6IA 2E1OA 4M9ZA 4V2FA 4IO9F 5DYMA 1HKTA 2DMUA 1V5FA 5IPAA 5JR3A 4RDUA 3L2CA 4MQ9F 4RS8A 5CYVA 2XROA 1XSDA 4MO7A 1Z3XA 3QP5A 1B59A 3BG9A 4JP0A 2BGCA 2KDZA 3TOAA 4LG0B 3GBGA 3KZYA 3GYHX 5E3LA 1R71A 4BJ6C 1XN7A 2H8WA 3S3NA 1FP1D 2FOKA 5HLGA 4BYYA 2E2JJ 2PI0A 2JRMA 4XMYA 5HLIA 4BJTA 2A3SA 5LHIA 2XB0X 4BBRJ 3EYIA 2KIUA 2NOJB 5IOZA 3BROA 4YIRX 1SFOJ 2FMYA 2V9VA 3ZMZA 2DLLA 4A3JJ 4HF0A 4RLFA 2V26A 4FE7A 1NG6A 4PFOA 3ZQFA 2O61A 1YLFA 4BL0B 1IN6A 2DT5A 3HDDA 4M9XA 2HVSA 4B43A 1TWGJ 3QPLA 3J80K 2NS0A 2LC2A 2R7QA 5JVTA 3LSJA 3KEYA 2LY9A 4MTEA 1BJAA 5DD4A 2FNPA 1WHUA 3VDXA 3NRVA 5EJCA 1OYWA 1RRJA 4HV5A 2HQNA 1R23A 4C9YA 1XCBA 3F6OA 2L9SA 1CGPA 4Y33A 5IOYA 4X0GA 1Y8QB 4G7ZF 3CC2I 1G3WA 1KU2A 2DT6A 2LY1A 2DTZA 2VKEA 3R6SA 1DU6A 1E0EA 2BXYA 5D6FA 4DNCA 5F0FA 2NNNA 3BR2A 4G94A 3K4LA 3SDBA 2R5YB 1N25A 3E3VA 3DXJF 2LTPA 2QKLB 3S32A 5DV5A 1D3YA 4B47A 4ZZDA 3J81K 2Y9YA 2NAZA 2HTSA 4B1RA 1MSFC 2L7KA 2ID3A 4CO8A 1WVRA 4PSWA 3H0DA 3OOUA 5LGUA 5M5YJ 3S1MJ 2Q8KA 3M9AA 3ZMSA 3U9GA 2W48A 3PIOF 3P5JA 2LF7A 3V8JA 3GTPJ 3JRGA 2GQQA 4WXDA 1YI2I 2ELKA 3K2ZA 5AIPA 4RM2A 2OQRA 3I4MJ 5FKNA 1LDJA 4E4HA 1LDDA 1H88C 1NK3P 2EB7A 3ZQHA 4XRSA 5BMZA 1ZGJA 1S9HA 2F48A 2CFOA 2HR3A 2K02A 3ASOH 2P7VB 3I54A 4P55A 3CJNA 5TGTA 1MZBA 1OPCA 2O7OA 3L2UA 1ZREA 2X1DA 3PQKA 3CF5F 1TP4A 3R4KA 3O8HA 3FXKA 3H3UA 4TV7A 3H9QA 1LQ1A 3SZGA 3DBHB 3AAFA 1ETOA 3V7RA 4XL9A 1X58A 2DW4A 3OYJA 2TDXA 5TISC 4XR6A 3IHUA 4KJZA 4UV9A 4D5FA 4M6VA 1MMNA 4DZPA 2MGQA 4A5NA 3S2DJ 1ETKA 3WODF 2E1CA 2JA5J 4NC8A 3GLXA 4FX0A 2NYXA 1ZN2A 4UVCA 4NC6A 2VASA 1TC3C 4U0WA 1VZ0A 2H94A 1QHHD 1TNSA 2PBIA 3KLNA 1XDUA 5J40A 3FKIJ 4Y4RA 2AHQA 1P9QC 3D5RC 2NS8A 3PFIA 4E70A 3H3ZA 5GPCA 2NVUB 3AL0C 3VB2A 1T0FC 4L5EA 4E7ZA 4A3CJ 1G3SA 4KUMA 4XKCA 5ED4A 4AD9A 3TL4X 2J5OA 3M8EA 3K4MA 1VNDA 3KFWX 5FRNA 4HG2A 4FE4A 4RGRA 4EMSA 1DUXC 2HYJA 2EIJH 4L18B 4ZYAA 2TCTA 4ZH4F 3VYSB 1D0XA 2KFDA 3AKZA 4UY8I 1FOYA 4HF2A 1LEAA 1I1GA 2F2EA 3RZDJ 1W5TA 1ERDA 3ZR8X 2M7AA 4A3LJ 3OWTA 5ICFA 1BI2A 2IA2A 2MC3A 1NG7A 3PSFA 5EYRA 3TBIA 3TGNA 2RQPA 5D5VB 3S3OA 1AA7A 2X6XA 3PUBA 1XMXA 2VKDA 2HQ5A 4OU0A 3KPHA 4BS9A 1WH5A 2CUJA 3MKZA 4AIKA 3MKYB 4IQ4A 2VXDA 2X6OA 2QWWA 4XRFA 3F23A 2CQXA 3KX2A 4D9JA 3FXUA 4KYWA 4CA0A 4YFKF 4CYCB 1FT9A 4IJAA 1AKHA 4BY7J 4WK8F 1GHCA 1JTXA 1YO5C 1MNEA 1O7FA 1WSUA 1CQTA 5JLXA 2A5WA 2JA8J 1WJEA 2EA2A 1K79A 2LBFA 3RPUD 3ERED 1ITYA 2VE9A 2WAFA 3RYPA 4FISA 3OYEA 2JA7J 2KHMA 3CD6I 3FK7A 5FLXZ 1QQIA 1BC8C 1VQ4I 2RNJA 4Z2YA 4KT5C 4HQEA 4M6YA 5E1ZB 2Y75A 3JTGA 1A04A 3SHFA 1F4KA 1JKPC 3BJAA 3TW7A 5C4JJ 1QPMA 3LSTA 5E3OA 4RM3A 4IF4A 1YJWI 4NQWA 1FYKA 3KYCB 4D0PA 3L2WA 1ULYA 2EV5A 4I0BA 4DOZA 2QQAA 3K10A 1K61A 1IAWA 1OCOH 3KP6A 1YX3A 2HS5A 2CSOA 1J75A 4F93B 1V55H 2A05A 2ISYA 3C2BA 2VBZA 2L9NA 4GGGA 3GFIA 3E6BA 2B9SA 1K78A 1KONA 2K27A 2Z2SB 2ZFWA 4XK4A 1ZLJA 2L7FP 4E7KA 1BW5A 1ON1A 2D1HA 3ROUA 3VSLA 3LMMA 2XPVA 5AONA 1P7JA 3P9KA 2L5QA 2ESNA 2IGNA 5AIQA 2LR8A 3EUHA 5EGOA 2VJ5A 2OC6A 3R61A 3WHCA 4AYBN 2DDBA 1W1WE 4FHTA 3KLOA 4U7DA 3GTLJ 4A3DJ 1QO0D 3ONQA 3HSEA 3RKYA 2R5ZA 1XD7A 2W57A 4HOBA 1EJ9A 3EUKL 2CU7A 5JVGF 1ZKGA 3EUHC 2HVQA 3S1NJ 1YIOA 1SVOA 5D5XB 2Q0OA 2NVTJ 2K4BA 3LA7A 1A6IA 5CQGA 4BHPA 4Z6YA 3OS1A 3J7ZI 2P0WA 1W36C 2VIXA 3JRBA 2MD0A 4NBQA 2O8XA 1FTZA 2QVOA 2MLKA 3OS2A 5LD2C 2I5UA 1X3UA 2H09A 2F6CA 4I02A 5E1XA 3GFJA 2DFFA 2QENA 2PMUA 4GCVA 1ZARA 4FETA 1R00A 4CCMA 2XRNA 2GOXB 3M8FA 4NC7A 2NNYA 3WE2A 3AG2H 2A5YB 2IVMA 3ASNH 5IP9J 3L00A 5E17F 3JRHA 4OIPF 2VPLA 3KEOA 3WTYC 2GM4A 3ZCOA 1MKMA 1Z3YA 2CQQA 2JRTA 3HM5A 4XSZF 2H27A 2M3AA 2ICWG 1YYVA 3E5XA 1NHAA 2ME0A 5B3SH 2KJCA 3Q0VA 3F3XA 2VUMJ 3K70D 3WHBA 4AVZA 2BVMA 2BXZA 5IT3A 3LAJA 3TEDA 4A6EA 5EEGA 1O4XA 1DDNA 1S6LA 1Z0XA 3TP0A 1JE8A 1X1CA 5J1UA 2XRLA 2VOOA 1YE9A 1E3OC 3ECOA 2V1NA 1G6NA 3ERMA 4FCYA 2M5WA 2ADUA 3OYNA 1IG7A 4G7OF 3IP4B 4WXCA 1DGWY 3C7JA 2CH0A 4OMYA 5EZGA 1DPRA 2PLYA 4CZZA 1VQ5I 2G7HA 1XC5A 1FC3A 1IV6A 1AKHB 2Y48A 4N9HA 1FLIA 2E35A 4V19K 4EJUA 3S16J 2EH3A 4U87A 5B5EC 2XC7A 2LBFB 4BGDA 4I01A 3IL2A 3MCZA 4YIIA 3CCYA 1BOBA 2K3FA 1MBFA 2ZO4A 3S8PA 3JRFA 5A2QZ 3KP4A 2OZ6A 4II3A 3CCJI 1JKQC 5CVVA 3HYIA 3QRFF 5ILUA 3FXRA 2DAOA 5FJ8J 5DTDA 1HKSA 3ULQB 1LB2A 2O8KA 2MA3A 2XPUA 4R79A 2YU9J 5KHDA 1W5CC 1IRXA 3RTRA 3TO6A 3OYCA 1UJ8A 2EFOA 1TZLA 2CQNA 4NQWB 1BR4A 3RKWA 1ZRCA 2EWNA 4LK0F 4KIBA 4HX8A 2PJPA 3GWZA 2NVYJ 3TKYA 1ETQA 1LDKB 3BG7A 4OIOF 4NHJA 5LGTA 2WAQN 3DTKA 4II2A 4HW0A 2JA6J 2DI3A 2NXNB 3EDPA 1K78B 3B02A 2M87A 3DLLF 4MGRA 4ZJZA 4UVAA 1A31A 4UXNA 1GV5A 1D8KA 5F27A 5F0HA 1F43A 2ZSHB 2IGMA 4A6DA 3OYLA 3MZHA 2X1CA 1IN7A 4S04A 3J7YJ 1SD5A 1KYZA 1STZA 2X85A 4BEHA 1MBKA 2LVSA 4UB8C 1ZTRA 5EGOB 3OS0A 1LFPA 5IY5H 2VODA 1C0WA 1BA5A 4ZDLA 1L3LA 4WWCA 3L2VA 5HLTA 2EIMH 2A61A 1X1AA 4PUSA 2DYRH 1SVMA 2HQAA 3F8NA 5ICCA 1JKRC 2P6SA 2P5VA 5CKTA 2PG4A 3K4JA 3VYRB 2JWTA 3DPTA 4U0YA 3WTZA 1FEXA 1WFXA 1XDSA 3T8TA 4OOIA 2DQRA 3LAPA 2CQ7A 2M0MA 2VBYA 4XM3A 3T0YA 1EV7A 3ABTA 4I2OA 2X0LA 1TQMA 4JYKA 2XSDC 3HOVJ 3JREA 2LFBA 2DMQA 2DFIA 2P6TA 1A35A 3EPZA 2B0LA 3ECHA 1IUYA 1I27A 2V7FA 3CO6C 3PO2J 4A3IJ 2LOOA 5FLMJ 2QKMB 4PSXA 2W1OA 3HZJA 5GTHC 4OAYA 1BBYA 4HSRA 1XMAA 1LKXA 5CVUA 3HJEA 3IRQA 2FX0A 4IHSA 2L01A 4C3HJ 3ZRGA 3C2GA 3WU2C 3CQZJ 4CICA 2M1BA 3Q9SA 2DFHA 1DPUA 2CUEA 5F64A 1ZELA 2GLOA 1HQCA 4N4NB 5HDKA 1ZR2A 3WU1B 2YSRA 2ZC2A 5HS7A 3W3CA 1SAXA 2BHZA 4YIFA 2VI6A 2HOAA 3DQVC 3H35A 3JRAA 1VQ9I 2IT0A 4XQFA 2R5YA 4YELA 2ZJRF 2CJJA 5E18F 3JR9A 4EM2A 5FLVA 1LFBA 5B1BH 1FZPB 1K6YA 1TLHB 2HGCA 2JUCA 4RGXA 4UVBA 4HEA2 2MC4A 1USTA 2FMLA 3ML6A 2H6BA 3HOZJ 2CV1A 3CCSI 1BC7C 3CMMA 4G6DA 1BI0A 4EJOA 3MAJA 3BTJA 3ABMH 1Y39A 2YS9A 2DU9A 2XAUA 3DTIA 3VYUB 5K5OA 3KIOA 3FBIB 2O03A 1B4AA 4RGUA 3UKGA 5CPRB 5CQEA 2VQCA 1SC7A 4AIJA 3SEZA 3RPUA 1YW9A 3FWEA 4XONA 2M4GA 2RN7A 1Z91A 4A12A 1LNWA 2ELHA 1WZ2A 3ZMUA 4KMFA 2PFBA 5C3EJ 4LK1F 1FSHA 2QF7A 3MQ0A 4ZDPA 4A0ZA 1FJLA 3CLOA 2X4HA 3J81Z 1IC8A 2WBMA 1Z05A 4DZJA 1FX7A 1KQ9A 3W6KB 3BY6A 2P8TA 4LIVA 4M71A 5FGMA 3ZMTA 2Y0SA 3BR1A 5J1RA 2E71A 1U2WA 3BTCA 1Z7UA 1ZRDA 3AFHA 1U8RA 3BPXA 3OSGA 4HF1A 4EM0B 3CCUI 2E7WA 3SXYA 4AU7A 3I64A 1KZHA 5GP9A 3HOSA 3K1PA 9ANTA 2K9NA 3M07A 5DEQA 1M1EB 1RIOH 4E7LA 1O3TA 4M73A 2E5ZA 2GIVA 1FOKA 6PAXA 3A01B 2WB1A 1RC9A 2JSCA 3VPRA 4RMNA 4DYRA 4OINF 4BEHB 1YW8A 4HDVA 4OIRF 4OIQF 4B8XA 3ABUA 5B1AH 4A3EJ 3CCRI 2W84A 3S14J 2F5DA 3IUOA 4UV8A 1QZZA 5GAHJ 1TWHJ 1A5JA 4CSWA 4RB0A 1OYIA 1V5EA 4U7BA 1TBXA 3CUQA 2WY8Q 2KPMA 2PMZN 4N4OB 1HW1A 1S72I 3HRMA 5J4VA 4L0ZB 2XF7A 3KYDB 2IP2A 3NWSA 3K2AA 2O0YA 1WJDA 2I10A 3QQAA 4EJTA 4LB5A 2VXZA 3G4SI 2Y2ZA 4PGGA 1UCRA 1N75A 1PP7U 4RA2A 1NTCA 1F5TA 2R7XA 1MMDA 4HYEA 2L4AA 1BJZA 4QIWN 1QVUA 2R7TA 3CC7I 3WTSC 1JGGA 3H0GJ 3FIWA 3SFZA 2KLOA 5BS6A 1K6OA 2K3PA 3MZ8A 4G9YA 2VOPA 1Y0NA 1TQIA 3E7LA 4B3XA 5K5QA 4CYCA 1I3AA 3LNQA 3ESWB 3ABKH 2XPWA 3FX3A 4XOTA 3QYEA 1QRYA 2HNHA 4CZCA 4UUTA 1I6XA 5DD8A 2KKOA 1PYVA 2Y69H 3GLLA 3H9GA 2Q1ZB 2DA3A 2F4IA 2VQGA 2FNAA 2QEXI 4AIDA 3BR0A 3RKXA 2CS3A 3H36A 1RKWA 3WTVC 3GTMJ 4CYDA 2KJBA 5E8IA 1TWFJ 4M3BA 3PFYA 1VQMI 4EGYA 5D4SA 4C2TA 3CMYA 4E7IA 4XLAA 5F1JA 3H92A 1FBQA 2MH9A 3OMYA 4HPQA 3H9JA 4A93J 3GEZA 1QZYA 2IEKA 4ETSA 4U88A 1Z67A 1Z77A 3CJRB 2DA1A 1E17A 2W82A 2BEOA 1SEUA 1LVAA 3U21A 4CHUA 3HG9A 2EPFA 4HNTA 1KU3A 2R7SA 1ZRFA 2GAUA 1G3YA 3QWLA 3I5UA 2FE3A 1UHWA 2Z99A 2DDAA 4HDUA 4ENKA 2R93J 4BBSJ 4LOCA 3WTXC 3K1MA 3PM1A 1SFKA 1T95A 2XGEA 1B1BA 3OYFA 2OTLI 5C44J 3SZTA 1MMSA 1ZR4A 5F04A 4DGWB 2M34A 3G1MA 2JVHA 4E7JA 2PX9A 2X51A 1DGRM 5EG0A 4JK1X 5DCMB 2EQRA 2ACJA 1R4NB 2E1NA 4KNYA 3COAC 2Z33A 3GCMA 3WG7H 1AWCA 5LBQA 3A02A 4IHXA 3DEUA 1OYYA 1UHSA 2VBXA 3TP3A 4C3JJ 1P92A 1ETXA 1SVLA 2GBYA 2M7BA 2OU2A 1YTYA 3CCMI 4BXFA 4MNUA 1YJ9I 4GO1A 1OCRH 2HTJA 2XKPA 1S8NA 1HW5A 5M5XJ 2XV4S 4LG3A 2DPDA 4GYGA 1LPQA 5HNFA 5DM6F 2JUGA 2XAGA 3I53A 3I56I 4PGHA 1JI8A 4KICA 3OYIA 5E8GA 1MBJA 2WTEA 4IOAF 1RR7A 4PK4A 2LH9A 3IWZA 4DBRA 3QPSA 3FXLA 3CCQI 3E1SA 2AQEA 5J6XA 3K9TA 1S7AA 4PFPA 4G6QA 1HSTA 1HCRA 3ABLH 3BCBA 4N0BA 2DXIA 4KT6A 4RAFA 4UUSB 2XF5A 2NVXJ 3F8FA 1KGSA 2UXNA 2M8EA 2LDUA 4K2EA 1V5GA 2VJIA 3CUQB 2BY1A 3O6BB 3IKTA 5J4YA 2LK2A 3LWFA 3S1QJ 4UHTA 3C18A 4NB5A 3W6VA 1FMVA 3IH2A 4J01A 1TWAJ 3ISPA 3FXQA 1OQYA 2JA2A 1EH7A 2DOFA 3I55I 3LQQA 1XG1A 3HTUA 5FO5A 1D1CA 3KYLA 3GZ5A 4IKFA 1FMWA 1MMGA 4Y13A 3E97A 3FF5A 4RAZA 1EA3A 3E6CC 2NS7A 3QOEA 1SAUA 3CP2A 3M3YJ 2GOMA 4LD5A 2B63J 4OMZA 1UELB 2BZTA 3I3LA 5BQTA 1MNMC 1JKOC 3OYKA 3K4KA 2V1XA 1IDYA 5FFZA 1J0RA 1B9NA 4GRIA 4XKWA 4ASNA 1D8JA 2KL4A 3MEXA 2KT0A 3RI4A 3A0BC 3P9CA 3BPVA 2FOWA 3QPTA 4ZYHA 4XLHA 1UB9A 1XGNA 4GYIA 1VFCA 2VKHA 3N97A 1JTYA 1ZG3A 4BDYA 3U1DA 4Q47A 4ESFA 4D7NA 3OL4A 1ZAOA 2Z3YA 3RPQA 2CW0F 4FTHA 3M1CA 3L1PA 1HSJA 2OD5A 1APLC 2FUG2 4RB2C 1F9NA 2YUSA 4JX4A 4XN0A 4XBFA 2EZHA 2COMA 1LUJB 3F8CA 3BOQA 3VWBA 1IN8A 4M74A 2LY2A 2YPRA 1FOXA 2IJLA 5FKLA 3JRCA 4KIFA 2HDDA 5J1YA 2XHKA 2KMUA 3GVAA 3K4BA 4M3GA 2CFXA 2H8RA 2M45A 4E6KG 2H6CA 2LMDA 4IX7A 3BQYA 1TW3A 4KDPA 2DA4A 1Z1DA 2CGPA 1YOVB 2L9RA 2FQ4A 2OF7A 3BR3A 4ENNA 4CUGA 1P7IA 4LJZF 4A2UA 4RB3C 3F9KA 3HKZN 2PJRB 1Z9CA 3DFGA 2XAQA 1SMYF 1E3PA 2CG4A 2F4MB 4D1QA 2ME6A 5EG0B 5BNGA 3FXMA 1A36A 5DS9A 2IAIA 1PVEA 1U9OA 1G4DA 2WC2A 3HEFA 2K9MA 3HHHA 3WGHA 5JI6A 4HNUA 1W0TA 3ZMDA 4Y7NJ 1G3TA 4BQOA 4Y15A 1HA8A 1ETWA 4KIGA 3BTIA 4B09A 1BI1A 4EQQA 2DQLA 3LSMA 2VN2A 4I7HA 4PJLA 4RB1A 3I58A 2DJIA 3G73A 1H8AC 1FIAA 2KRFA 2R7VA 1GLNA 1SD6A 3I4PA 5GTIC 2ZNYA 3FK6A 2K4JA 4X1EA 3JRIA 2LG4A 2N8GA 2DA5A 2XASA 1FBUA 3HSFA 2HXIA 4A3MJ 2FA5A 3GO5A 4KN7X 3HPGA 3P7NA 3K4NA 3Q9VA 4I76A 1S5LC 2RVCA 1X4PA 3ZQLA 4DYCA 2QUFA 5L3DA 1S7OA 1ACIA 3DEWA 3PJRA 2KISA 1RESA 5BPIA 1KQ8A 3BT9A 3LSHA 3HOWJ 1ZG5A 1U8BA 3OYAA 4DQ2A 2WA0A 3LSPA 4Y52J 1W5SA 2LRDA 2QYOA 1B6AA 3VEPA 3DU6A 1FP2A 4DW6A 2HPIA 3O2PE 3R0AA 2LKPA 2A6EF 2MSYA 2GA2A 2K9LA 3SDGA 2AS5F 4S0HB 2VONA 1QU3A 4EGZA 1SFEA 1F36A 1SMTA 5HS8A 1YW7A 4QWQA 1HOMA 1MD0A 1IUFA 1MBEA 3QU3A 1LVKA 2V9KA 2RDPA 5JHFA 1S7EA 3CCVI 1ZG1A 5M5WJ 3L7WA 1MH3A 3CC4I 3TMOA 3WTTC 1JGSA 3IWFA 2GWRA 2XGDA 1DP3A 4CCKA 4P96A 3HOYJ 2LREA 2V79A 4M3DA 3OV8A 2DMTA 2QGUA 1GXPA 4MEXF 3R0JA 3E5QA 2OUMA 3EYYA 1Y8RB 3REOA 3BG5A 4F3QA 3QYBA 3RDIA 1ONVA 3DV8A 4XRSG 1OCPA 4JBAA 2DA6A 2X6YA 1XX5A 1U6GA 3CZ6A 2FBIA 3DPLC 4A3FJ 5J8FA 2Y31A 4IXAA 4HX4A 1V4RA 3HUGA 3CJQB 2R7RA 3BLYA 5LHHA 5E79C 4WXHA 2XIGA 1R9TJ 4A3GJ 4A69C 1W7PD 3SZPA 4P1WA 1OISA 2I8DA 2OZUA 4AIHA 4RBOA 5LRSA 3GX4X 2W7NA 5BPDA 2JQ7A 4B44A 1RZ4A 4J00A 4O6JA 1BN5A 2JTVA 1HXDA 4BE2A 4MFEA 4CDGA 4L9JA 3W2WA 2XGCA 4WF2A 2OPTA 2R7DA 1TQPA 1U5TA 5K7FA 2WWYA 2R7ZJ 3MZYA 4DJAA 4IHWA 1ZK8A 1R1VA 2QA4I 3JTHA 1QGPA 2LLKA 4MFDA 2L3DA 1FNNA 3H3VK 4MHGA 1IZ1A 1T39A 1HBXG 2IRFG 1GDTA 4IHTA 4RLQA 1MNDA 1QZEA 1YX5A 3SFIA 2QQ8A 1I39A 1YS6A 1AHDP 3A01A 3HBLA 5ERIA 4ENJA 2VL8A 4W97A 1WCMJ 3IAS2 4PJMA 1QNTA 2O5RA 3OOPA 3FM3A 3ZN1A 3M8JA 2ELJA 2NOGA 3E6DA 3CDIA 3DF8A 1XGSA 2CUFA 2LSOA 2V9PA 3MKLA 4HNVA 1E2XA 2VC0A 3MKWB 3E5UA 4MLOA 3FISA 2EA4A 3V8LA 2YU3A 5H2FC 3A2KA 1UG2A 2P81A 3PSIA 1R1TA 1SANA 2OV7A 2Z16A 4YEJA 1MH4A 2NRAC 1E3HA 2MBFA 2CYYA 3EETA 4L9TA 3ZXSA 1BM9A 2WV1A 1HDDC 3QP6A 4AM3A 2IS1A 1D5YA 2HI3A 2HOTA 2Y0MA
chains in the Genus database with same CATH topology
2K86A 5DCFA 4WCGA 2BE5F 2M30A 5FFXA 1MJBA 2A68F 3I59B 3PQJA 4A0YA 3KE2A 4S05A 3E6MA 3NEUA 2ZKZA 2DTRA 4XLNF 3QAHA 3HTSB 2GXBA 3CO7C 3FHZA 4MQVA 3MWMA 4CXFA 4N9IA 3GZ6A 3V7CA 5K5RA 5ILSA 4KFCA 5CLSA 1MGTA 3HRTA 2IPQX 1YQAA 5D4RA 3JAMK 2Q2EA 4ZYDA 2ZXJA 5DUIA 4YG2F 5LRRA 2G9WA 4L5IA 3QU6A 1O3QA 5L3CA 2FSWA 2A6HF 2GZWA 3T5XA 2D2WA 2YR2A 4HLXA 2W24A 5HVQC 4R8HA 2EJRA 3NQOA 1ZLKA 4I0AA 5DCMA 2ZBKA 2GXGA 2FF4A 4KN4X 4LMYA 2XKOA 2F5CA 1IXRC 2E7XA 1RNLA 4O3MA 2ISZA 1WKMA 3GF2A 1U5TB 4Q4ZF 4AWXB 4FX4A 5CVRA 1XSXA 1TTYA 4AVPA 4M9SA 1PP8F 1FPQA 2W25A 1PDNC 4LFUA 1Q1HA 3Q5FA 3J7AO 3V7SA 3VODA 3CUOA 1WRJA 1T98A 2HEOA 5ICGA 2MH2A 3BP8A 4UNOA 2FU4A 2RGVA 1OKRA 3CUQC 4YFNF 1R7JA 4LLNA 4EJWA 1S29A 4HQMA 2RV8A 3WE3A 4HZFA 2DK5A 1O57A 1YFHA 3F21A 3T8RA 5FD5A 2JT1A 3R60A 3TDZC 1V3FA 2ZJ2A 5K1YA 2DO7A 4U0VA 4QLCU 1ODDA 5ICEA 1ZGAA 2QLZA 1H9GA 3EQLF 2HKOA 5L3BA 5L3EA 3WTWC 1EH6A 4RAYA 5D5UB 2RKHA 1I1SA 3G3ZA 4L9NA 4FT8A 3GXOA 1XGMA 3C1DA 5IT9K 2EFNA 2CO5A 1O7LA 5FB2A 5L3GA 1KYWA 1IXSB 4L9VA 5D5WB 3KP7A 3CDHA 2IA0A 3KZZA 2D45A 4ENMA 1XMKA 3GW2A 3F72A 2D1VA 3LA3A 2R3SA 5H6QA 2OBPA 3F6VA 3P9IA 4EV0A 4Y17A 1ON2A 3L9FA 3M1EA 4ESBA 3W6JB 1R58A 2VT3A 2FRHA 1IW7F 4BXUA 1BIAA 5HOOA 5HS9A 2ZNZA 1TW2A 1WWXA 1DP7P 5LHGA 2UWMA 1U3EM 4IVNA 2O3FA 1OMIA 4IRIA 1W7PA 3HSRA 1Z6TA 3LQRA 3WGIA 5DDGA 1R5HA 2O6GE 5H20A 4I98B 2XVCA 3C3WA 2EFWA 3IKVA 3S2WA 1MJ9A 2FBKA 1BIBA 1KU7A 2STTA 1T0FA 2XGXA 1XGOA 4IRGA 2UXXA 5F1RA 1UHMA 2C6YA 1T2KA 2A07F 1IN4A 2XUBA 3GFLA 3BZ6A 1KQ0A 1UFMA 1MDMB 1IXCA 1JHFA 4LGWA 2HZTA 4BAYA 2R7FA 2XAJA 4PDKA 1U78A 3K0LA 4LLGF 1T38A 3RIRA 2OA4A 2J5PA 5LLQA 4A5MA 3RJPA 2DK8A 1D5VA 1ZHFA 4HAMA 2OAZA 5CVIA 5J8CA 1AOYA 1O3RA 1R5GA 3WU0A 2LF8A 1F1ZA 4EVIA 3MFKA 1IRFA 3D0SA 3RYRA 1B9MA 4UUVA 1R36A 1XB4A 1Y0UA 2AXLA 4M72A 2XAHA 2EV0A 3K69A 3KP3A 3T1BA 3TOBA 2UZKA 1JXSA 1JHHA 3FM5A 1KA8A 2PQ8A 1CF7A 2QBYA 3V8KA 3KETA 3F8MA 1L0OC 1HKQA 1P4XA 3WTUC 3F8BA 2V6CA 1KU9A 3FMSA 3ZMVA 1EH8A 1LEBA 3HIFA 3DP7A 1IN5A 5EEHA 1FY7A 4PZJA 4M6XA 2KIMA 1R1UA 2V1UA 1J7KA 4YFXF 5H6RA 3QPHA 1W7PB 2IA1A 3ZP5A 3F22A 2STWA 3I0TA 1J5YA 2Z9OA 2QQ9A 3D5LA 1HW2A 1FWZA 3LFKA 3GUDA 3U2RA 3L09A 4BNCA 4A0XA 2QQBA 2MLGA 5KVRA 3I59A 5KK1A 1FYLA 1YG2A 2L4MA 1PUEE 1P6RA 1J2XA 2A69F 3DKWA 1USSA 2F5FA 3ZPLA 3M7GA 3FZVA 3HRSA 3VOEA 3LA2A 1RUNA 5HLHA 3QOPA 3ZQ7A 4Q48A 4JQFA 3BJOA 4CGZA 3KP5A 4PCQA 4BH9A 1SD7A 1XCVA 1T6SA 3BDDA 2G7UA 5FLXK 4ON0A 1R22A 4HA8A 3JW4A 5DUKA 2EFQA 2ZCWA 5LEKA 1QBJA 4Q5SF 3CTAA 1SFUA 3B73A 5E1WA 2HYGD 4I09A 1I5ZA 2OQGA 3KEQA 2PN6A 2QM3A 1OR7A 4BHCA 2P5KA 1CF7B 4RGSA 2QBYB 2RC4A 3KCCA 3SQNA 3ZN0A 5LGNA 3FMQA 3N4MA 4IPAA 2BYVE 2ZMEA 2CQKA 3JAMZ 4HV6A 3BWGA 4BHBA 2BBYA 5LEJA 3TO9A 5D8LB 1RUOA 1U5TC 3WGGA 3KP2A 1H0MA 2Z5UA 1MJAA 3BJ6A 3TDUC 5HDNA 4ZYEA 3JSPA 4ZYGA 2L54A 2FXAA 1FYMA 2V1DA 2IW5A 4KMUX 2EV6A 5JHUA 4LB6B 3VFZA 1J59A 1GXQA 5D6EA 3TO7A 1IF1A 4H0EA 3ELKA 1YS7A 2KIFA 2HOEA 4EJVA 5CVJA 1O3SA 1XSVA 4LG0A 1ZYRF 4R1HA 2DBBA 2JPCA 4HX7A 1H9TA 2VT2A 3HRUA 5HDGA 1REPC 2GA1A 5TJJA 2K7LA 4BQAA 3IC7A 2HKXA 2F5EA 2ESHA 2LNBA 1J9IA 1W4MA 5CJ9A 5E20A 3O3KA 4XLPF 3GFMA 4G7HF 2FBHA 2YX4A 2EK5A 4KA4A 1FBSA 2VE8A 5ILVA 2VC1A 4P5OA 3JSOA 3V4GA 4O5VA 4IRHA 2YX7A 5A2QK 3IRRA 3I71A 1TNTA 4MTDA 2BV6A 4EM1A 3HHGA 2MD5A 5JFRA 1WI9A 3HOTA 5BOXA 5IT9Z 1BI3A 4L5JA 5FD6A 2W85A 2FEZA 1IRGA 3J80Z 5TRDA 2HQRA 1SFXA 2ZMEB 1ZH5A 1P4WA 1RI7A 2HFHA 1K7AA 2VBWA 4ESJA 1FSEA 4LLLA 3FMRA 2PEXA 1SD4A 5F6FA 2CWEA 4F7ZA 2JZYA 1LJ9A 4HBLA 2EFPA 2HDCA 2DPUA 2L02A 2XAFA 1VTNC 1S3JA 2JPBA 3K1NA 5L3FA 5D8KB 4WX9A 4ZZLA 4XSXF 1WQ2A 2P5LC 2ETHA 2P7CB 3WG9A 2HYFA 2P4WA 1P2FA 4GXOA 4HLYA 3TQNA 2WV0A 2PMHA 4P9FA 1MDMA 2QZ8A 4P9UA 1GVJA 4G8XA 4MEYF 4L0YB 1BOAA 1P4AA 2HWVA 2FQ3A 1Z6RA 4M9ZA 5DYMA 1HKTA 5JR3A 3L2CA 4MQ9F 4RS8A 5CYVA 2XROA 1XSDA 3QP5A 1B59A 2BGCA 3TOAA 4LG0B 3KZYA 3GYHX 1XN7A 1FP1D 2FOKA 5HLGA 4BYYA 2PI0A 5HLIA 2A3SA 5LHIA 3EYIA 2KIUA 3BROA 2FMYA 2V9VA 3ZMZA 2DLLA 4HF0A 2O61A 1YLFA 1IN6A 2DT5A 4M9XA 3J80K 2NS0A 5JVTA 4MTEA 1BJAA 5DD4A 2FNPA 3NRVA 1OYWA 4HV5A 2HQNA 1R23A 1XCBA 3F6OA 1CGPA 4G7ZF 1G3WA 1KU2A 3R6SA 5D6FA 4DNCA 2NNNA 4G94A 3E3VA 3DXJF 5DV5A 1D3YA 4ZZDA 3J81K 2NAZA 2HTSA 4CO8A 5LGUA 2Q8KA 3M9AA 3ZMSA 3U9GA 2LF7A 3V8JA 2GQQA 4WXDA 3K2ZA 5AIPA 2OQRA 1LDJA 1LDDA 2EB7A 5BMZA 1ZGJA 2HR3A 2K02A 2P7VB 3I54A 4P55A 3CJNA 1MZBA 1OPCA 1ZREA 3PQKA 3R4KA 3H3UA 4TV7A 1LQ1A 3AAFA 3V7RA 2DW4A 2TDXA 3IHUA 4UV9A 4A5NA 3WODF 2E1CA 3GLXA 4FX0A 2NYXA 1ZN2A 4UVCA 4U0WA 2H94A 1TNSA 2PBIA 3KLNA 1XDUA 3PFIA 4E70A 3H3ZA 3VB2A 1G3SA 4KUMA 5ED4A 4AD9A 2J5OA 3M8EA 3KFWX 4RGRA 4EMSA 1DUXC 4L18B 4ZH4F 4HF2A 1LEAA 1I1GA 2F2EA 1W5TA 5ICFA 1BI2A 2IA2A 2MC3A 3TGNA 5D5VB 2RQPA 4OU0A 4AIKA 2QWWA 4XRFA 3F23A 3FXUA 4KYWA 4YFKF 1FT9A 4IJAA 4WK8F 1GHCA 1YO5C 1O7FA 1WSUA 2EA2A 1K79A 3ERED 2VE9A 3RYPA 5FLXZ 1QQIA 1BC8C 2RNJA 4Z2YA 4KT5C 4HQEA 4M6YA 5E1ZB 2Y75A 3JTGA 1A04A 3SHFA 1F4KA 3BJAA 1QPMA 3LSTA 4IF4A 4NQWA 1FYKA 4D0PA 1ULYA 2EV5A 4I0BA 2QQAA 1IAWA 3KP6A 2HS5A 2CSOA 1J75A 2ISYA 2VBZA 3GFIA 4GGGA 3E6BA 1K78A 2K27A 2ZFWA 1ZLJA 1ON1A 2D1HA 3ROUA 5AONA 3P9KA 2ESNA 5AIQA 3EUHA 3R61A 4FHTA 3KLOA 4U7DA 1QO0D 3HSEA 3RKYA 1XD7A 2W57A 4HOBA 1YIOA 5D5XB 2Q0OA 2K4BA 3LA7A 4BHPA 2O8XA 2QVOA 2MLKA 1X3UA 2H09A 5E1XA 4I02A 3GFJA 2QENA 2PMUA 4GCVA 1ZARA 1R00A 2XRNA 3M8FA 2NNYA 3WE2A 2A5YB 2IVMA 3L00A 5E17F 4OIPF 3KEOA 3WTYC 1MKMA 2JRTA 4XSZF 2H27A 1YYVA 3E5XA 1NHAA 2KJCA 3F3XA 5IT3A 3LAJA 4A6EA 5EEGA 1DDNA 1S6LA 1JE8A 2VOOA 3ECOA 1G6NA 2M5WA 2ADUA 4G7OF 4WXCA 3C7JA 4OMYA 1DPRA 2PLYA 4CZZA 2G7HA 1FC3A 2Y48A 4N9HA 1FLIA 4EJUA 4I01A 3IL2A 3MCZA 4YIIA 2ZO4A 5A2QZ 3KP4A 2OZ6A 5CVVA 3HYIA 3QRFF 5ILUA 3FXRA 2DAOA 1HKSA 3ULQB 1LB2A 2MA3A 4R79A 3RTRA 3TO6A 2EFOA 3RKWA 1ZRCA 2EWNA 4LK0F 4KIBA 4HX8A 2PJPA 3GWZA 3TKYA 1LDKB 4OIOF 4NHJA 5LGTA 4HW0A 2DI3A 3EDPA 1K78B 3B02A 2M87A 4MGRA 4UVAA 4UXNA 1D8KA 4A6DA 3MZHA 1IN7A 4S04A 1SD5A 1KYZA 1STZA 2VODA 1C0WA 1L3LA 4WWCA 2A61A 3F8NA 5ICCA 2P6SA 2P5VA 2PG4A 3DPTA 4U0YA 3WTZA 1XDSA 3T8TA 4OOIA 2DQRA 3LAPA 2VBYA 3T0YA 1EV7A 3ABTA 4I2OA 2X0LA 1TQMA 2DFIA 2P6TA 2B0LA 3ECHA 1IUYA 1I27A 3CO6C 1BBYA 1XMAA 5CVUA 3IRQA 4IHSA 2L01A 4CICA 2M1BA 3Q9SA 1DPUA 5F64A 1HQCA 5HDKA 3WU1B 2YSRA 5HS7A 1SAXA 4YIFA 3DQVC 2IT0A 5E18F 4EM2A 1FZPB 1TLHB 2HGCA 4RGXA 4UVBA 1USTA 2FMLA 3ML6A 2H6BA 1BC7C 4G6DA 1BI0A 4EJOA 3MAJA 2DU9A 5K5OA 2O03A 1B4AA 4RGUA 4AIJA 3RPUA 1YW9A 3FWEA 2RN7A 1Z91A 4A12A 1LNWA 2ELHA 3ZMUA 4KMFA 2PFBA 4LK1F 1FSHA 3MQ0A 4A0ZA 3CLOA 2X4HA 3J81Z 1Z05A 1FX7A 1KQ9A 3W6KB 3BY6A 2P8TA 4M71A 5FGMA 3ZMTA 1U2WA 1Z7UA 1ZRDA 1U8RA 4HF1A 3BPXA 4EM0B 2E7WA 3SXYA 3I64A 3HOSA 3K1PA 5DEQA 1RIOH 1O3TA 4M73A 2GIVA 1FOKA 6PAXA 2JSCA 4OINF 1YW8A 4HDVA 4OIRF 4OIQF 4B8XA 3ABUA 2W84A 2F5DA 4UV8A 1QZZA 4RB0A 1OYIA 4U7BA 1TBXA 3CUQA 1HW1A 3HRMA 4L0ZB 2IP2A 2O0YA 4EJTA 4LB5A 2VXZA 4PGGA 1UCRA 1PP7U 1F5TA 4HYEA 2L4AA 3WTSC 3SFZA 5BS6A 1K6OA 4G9YA 2VOPA 1TQIA 5K5QA 3FX3A 1I6XA 5DD8A 2KKOA 2FNAA 3RKXA 3WTVC 4CYDA 2KJBA 5E8IA 4EGYA 5D4SA 3H92A 1FBQA 2MH9A 3GEZA 1QZYA 4ETSA 4U88A 1E17A 2BEOA 1LVAA 4CHUA 1KU3A 1ZRFA 2GAUA 1G3YA 3I5UA 2FE3A 1UHWA 2Z99A 4HDUA 4ENKA 3WTXC 3K1MA 1B1BA 3SZTA 4JK1X 5DCMB 2ACJA 2E1NA 4KNYA 3COAC 2Z33A 1AWCA 5LBQA 3DEUA 1OYYA 2VBXA 1P92A 2OU2A 1YTYA 4MNUA 4GO1A 2HTJA 2XKPA 1S8NA 1HW5A 2XV4S 2DPDA 4GYGA 2XAGA 3I53A 4PGHA 4KICA 5E8GA 2WTEA 3IWZA 5J6XA 3K9TA 1S7AA 4G6QA 1HSTA 4N0BA 3F8FA 1KGSA 2UXNA 2M8EA 2LDUA 4K2EA 3CUQB 3O6BB 3IKTA 3LWFA 4UHTA 3C18A 4NB5A 3ISPA 3FXQA 1EH7A 3LQQA 3HTUA 5FO5A 3GZ5A 4Y13A 3E97A 3FF5A 4RAZA 3E6CC 4LD5A 4OMZA 5BQTA 2V1XA 5FFZA 1J0RA 1B9NA 4ASNA 1D8JA 3MEXA 3RI4A 3P9CA 3BPVA 3QPTA 4ZYHA 1UB9A 1XGNA 4GYIA 3N97A 1ZG3A 3U1DA 4Q47A 4ESFA 1ZAOA 2Z3YA 3RPQA 2CW0F 1HSJA 2OD5A 4RB2C 1F9NA 4XBFA 2COMA 3F8CA 3BOQA 1IN8A 4M74A 2YPRA 2IJLA 4KIFA 2XHKA 3GVAA 2CFXA 2M45A 2H6CA 1TW3A 4KDPA 1Z1DA 2CGPA 4ENNA 4A2UA 4LJZF 4RB3C 1Z9CA 3DFGA 2XAQA 1SMYF 2CG4A 1G4DA 2WC2A 3HHHA 3WGHA 5JI6A 3ZMDA 1G3TA 4Y15A 4KIGA 4B09A 1BI1A 4EQQA 2DQLA 2VN2A 4I7HA 4RB1A 3I58A 3G73A 2KRFA 1SD6A 3I4PA 2ZNYA 2K4JA 2XASA 1FBUA 3HSFA 2FA5A 3GO5A 4KN7X 3P7NA 3Q9VA 2RVCA 2QUFA 5L3DA 1S7OA 5BPIA 1KQ8A 1ZG5A 4DQ2A 1W5SA 2QYOA 1B6AA 3VEPA 1FP2A 3O2PE 3R0AA 2LKPA 2A6EF 2GA2A 2AS5F 2VONA 4EGZA 1SFEA 1SMTA 5HS8A 1YW7A 4QWQA 1MD0A 3QU3A 2RDPA 1ZG1A 3L7WA 3WTTC 1JGSA 3IWFA 2GWRA 4P96A 2V79A 3OV8A 1GXPA 4MEXF 3R0JA 3E5QA 3EYYA 3REOA 3RDIA 1ONVA 3DV8A 4JBAA 1U6GA 2FBIA 3DPLC 5J8FA 4IXAA 4HX4A 1V4RA 3HUGA 5LHHA 4WXHA 2XIGA 1W7PD 3SZPA 2OZUA 4AIHA 5BPDA 5LRSA 3GX4X 1RZ4A 4O6JA 1BN5A 2JTVA 1HXDA 4CDGA 4L9JA 4WF2A 2R7DA 1TQPA 1U5TA 2WWYA 3MZYA 1R1VA 3JTHA 1QGPA 2L3DA 1FNNA 4MHGA 1IZ1A 1T39A 1HBXG 2IRFG 4IHTA 1YS6A 5ERIA 4ENJA 1QNTA 3OOPA 3FM3A 3ZN1A 3E6DA 3DF8A 1XGSA 2LSOA 1E2XA 2VC0A 3E5UA 2EA4A 3V8LA 2YU3A 1R1TA 2NRAC 2MBFA 2CYYA 3EETA 4L9TA 1BM9A 3QP6A 2Y0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K86 A;  5DCF A;  4WCG A;  2BE5 F;  2M30 A;  5FFX A;  1MJB A;  2A68 F;  3I59 B;  3PQJ A;  4A0Y A;  3KE2 A;  4S05 A;  3E6M A;  3NEU A;  2ZKZ A;  2DTR A;  4XLN F;  3QAH A;  3HTS B;  2GXB A;  3CO7 C;  3FHZ A;  4MQV A;  3MWM A;  4CXF A;  4N9I A;  3GZ6 A;  3V7C A;  5K5R A;  5ILS A;  4KFC A;  5CLS A;  1MGT A;  3HRT A;  2IPQ X;  1YQA A;  5D4R A;  3JAM K;  2Q2E A;  4ZYD A;  2ZXJ A;  5DUI A;  4YG2 F;  5LRR A;  2G9W A;  4L5I A;  3QU6 A;  1O3Q A;  5L3C A;  2FSW A;  2A6H F;  2GZW A;  3T5X A;  2D2W A;  2YR2 A;  4HLX A;  2W24 A;  5HVQ C;  4R8H A;  2EJR A;  3NQO A;  1ZLK A;  4I0A A;  5DCM A;  2ZBK A;  2GXG A;  2FF4 A;  4KN4 X;  4LMY A;  2XKO A;  2F5C A;  1IXR C;  2E7X A;  1RNL A;  4O3M A;  2ISZ A;  1WKM A;  3GF2 A;  1U5T B;  4Q4Z F;  4AWX B;  4FX4 A;  5CVR A;  1XSX A;  1TTY A;  4AVP A;  4M9S A;  1PP8 F;  1FPQ A;  2W25 A;  1PDN C;  4LFU A;  1Q1H A;  3Q5F A;  3J7A O;  3V7S A;  3VOD A;  3CUO A;  1WRJ A;  1T98 A;  2HEO A;  5ICG A;  2MH2 A;  3BP8 A;  4UNO A;  2FU4 A;  2RGV A;  1OKR A;  3CUQ C;  4YFN F;  1R7J A;  4LLN A;  4EJW A;  1S29 A;  4HQM A;  2RV8 A;  3WE3 A;  4HZF A;  2DK5 A;  1O57 A;  1YFH A;  3F21 A;  3T8R A;  5FD5 A;  2JT1 A;  3R60 A;  3TDZ C;  1V3F A;  2ZJ2 A;  5K1Y A;  2DO7 A;  4U0V A;  4QLC U;  1ODD A;  5ICE A;  1ZGA A;  2QLZ A;  1H9G A;  3EQL F;  2HKO A;  5L3B A;  5L3E A;  3WTW C;  1EH6 A;  4RAY A;  5D5U B;  2RKH A;  1I1S A;  3G3Z A;  4L9N A;  4FT8 A;  3GXO A;  1XGM A;  3C1D A;  5IT9 K;  2EFN A;  2CO5 A;  1O7L A;  5FB2 A;  5L3G A;  1KYW A;  1IXS B;  4L9V A;  5D5W B;  3KP7 A;  3CDH A;  2IA0 A;  3KZZ A;  2D45 A;  4ENM A;  1XMK A;  3GW2 A;  3F72 A;  2D1V A;  3LA3 A;  2R3S A;  5H6Q A;  2OBP A;  3F6V A;  3P9I A;  4EV0 A;  4Y17 A;  1ON2 A;  3L9F A;  3M1E A;  4ESB A;  3W6J B;  1R58 A;  2VT3 A;  2FRH A;  1IW7 F;  4BXU A;  1BIA A;  5HOO A;  5HS9 A;  2ZNZ A;  1TW2 A;  1WWX A;  1DP7 P;  5LHG A;  2UWM A;  1U3E M;  4IVN A;  2O3F A;  1OMI A;  4IRI A;  1W7P A;  3HSR A;  1Z6T A;  3LQR A;  3WGI A;  5DDG A;  1R5H A;  2O6G E;  5H20 A;  4I98 B;  2XVC A;  3C3W A;  2EFW A;  3IKV A;  3S2W A;  1MJ9 A;  2FBK A;  1BIB A;  1KU7 A;  2STT A;  1T0F A;  2XGX A;  1XGO A;  4IRG A;  2UXX A;  5F1R A;  1UHM A;  2C6Y A;  1T2K A;  2A07 F;  1IN4 A;  2XUB A;  3GFL A;  3BZ6 A;  1KQ0 A;  1UFM A;  1MDM B;  1IXC A;  1JHF A;  4LGW A;  2HZT A;  4BAY A;  2R7F A;  2XAJ A;  4PDK A;  1U78 A;  3K0L A;  4LLG F;  1T38 A;  3RIR A;  2OA4 A;  2J5P A;  5LLQ A;  4A5M A;  3RJP A;  2DK8 A;  1D5V A;  1ZHF A;  4HAM A;  2OAZ A;  5CVI A;  5J8C A;  1AOY A;  1O3R A;  1R5G A;  3WU0 A;  2LF8 A;  1F1Z A;  4EVI A;  3MFK A;  1IRF A;  3D0S A;  3RYR A;  1B9M A;  4UUV A;  1R36 A;  1XB4 A;  1Y0U A;  2AXL A;  4M72 A;  2XAH A;  2EV0 A;  3K69 A;  3KP3 A;  3T1B A;  3TOB A;  2UZK A;  1JXS A;  1JHH A;  3FM5 A;  1KA8 A;  2PQ8 A;  1CF7 A;  2QBY A;  3V8K A;  3KET A;  3F8M A;  1L0O C;  1HKQ A;  1P4X A;  3WTU C;  3F8B A;  2V6C A;  1KU9 A;  3FMS A;  3ZMV A;  1EH8 A;  1LEB A;  3HIF A;  3DP7 A;  1IN5 A;  5EEH A;  1FY7 A;  4PZJ A;  4M6X A;  2KIM A;  1R1U A;  2V1U A;  1J7K A;  4YFX F;  5H6R A;  3QPH A;  1W7P B;  2IA1 A;  3ZP5 A;  3F22 A;  2STW A;  3I0T A;  1J5Y A;  2Z9O A;  2QQ9 A;  3D5L A;  1HW2 A;  1FWZ A;  3LFK A;  3GUD A;  3U2R A;  3L09 A;  4BNC A;  4A0X A;  2QQB A;  2MLG A;  5KVR A;  3I59 A;  5KK1 A;  1FYL A;  1YG2 A;  2L4M A;  1PUE E;  1P6R A;  1J2X A;  2A69 F;  3DKW A;  1USS A;  2F5F A;  3ZPL A;  3M7G A;  3FZV A;  3HRS A;  3VOE A;  3LA2 A;  1RUN A;  5HLH A;  3QOP A;  3ZQ7 A;  4Q48 A;  4JQF A;  3BJO A;  4CGZ A;  3KP5 A;  4PCQ A;  4BH9 A;  1SD7 A;  1XCV A;  1T6S A;  3BDD A;  2G7U A;  5FLX K;  4ON0 A;  1R22 A;  4HA8 A;  3JW4 A;  5DUK A;  2EFQ A;  2ZCW A;  5LEK A;  1QBJ A;  4Q5S F;  3CTA A;  1SFU A;  3B73 A;  5E1W A;  2HYG D;  4I09 A;  1I5Z A;  2OQG A;  3KEQ A;  2PN6 A;  2QM3 A;  1OR7 A;  4BHC A;  2P5K A;  1CF7 B;  4RGS A;  2QBY B;  2RC4 A;  3KCC A;  3SQN A;  3ZN0 A;  5LGN A;  3FMQ A;  3N4M A;  4IPA A;  2BYV E;  2ZME A;  2CQK A;  3JAM Z;  4HV6 A;  3BWG A;  4BHB A;  2BBY A;  5LEJ A;  3TO9 A;  5D8L B;  1RUO A;  1U5T C;  3WGG A;  3KP2 A;  1H0M A;  2Z5U A;  1MJA A;  3BJ6 A;  3TDU C;  5HDN A;  4ZYE A;  3JSP A;  4ZYG A;  2L54 A;  2FXA A;  1FYM A;  2V1D A;  2IW5 A;  4KMU X;  2EV6 A;  5JHU A;  4LB6 B;  3VFZ A;  1J59 A;  1GXQ A;  5D6E A;  3TO7 A;  1IF1 A;  4H0E A;  3ELK A;  1YS7 A;  2KIF A;  2HOE A;  4EJV A;  5CVJ A;  1O3S A;  1XSV A;  4LG0 A;  1ZYR F;  4R1H A;  2DBB A;  2JPC A;  4HX7 A;  1H9T A;  2VT2 A;  3HRU A;  5HDG A;  1REP C;  2GA1 A;  5TJJ A;  2K7L A;  4BQA A;  3IC7 A;  2HKX A;  2F5E A;  2ESH A;  2LNB A;  1J9I A;  1W4M A;  5CJ9 A;  5E20 A;  3O3K A;  4XLP F;  3GFM A;  4G7H F;  2FBH A;  2YX4 A;  2EK5 A;  4KA4 A;  1FBS A;  2VE8 A;  5ILV A;  2VC1 A;  4P5O A;  3JSO A;  3V4G A;  4O5V A;  4IRH A;  2YX7 A;  5A2Q K;  3IRR A;  3I71 A;  1TNT A;  4MTD A;  2BV6 A;  4EM1 A;  3HHG A;  2MD5 A;  5JFR A;  1WI9 A;  3HOT A;  5BOX A;  5IT9 Z;  1BI3 A;  4L5J A;  5FD6 A;  2W85 A;  2FEZ A;  1IRG A;  3J80 Z;  5TRD A;  2HQR A;  1SFX A;  2ZME B;  1ZH5 A;  1P4W A;  1RI7 A;  2HFH A;  1K7A A;  2VBW A;  4ESJ A;  1FSE A;  4LLL A;  3FMR A;  2PEX A;  1SD4 A;  5F6F A;  2CWE A;  4F7Z A;  2JZY A;  1LJ9 A;  4HBL A;  2EFP A;  2HDC A;  2DPU A;  2L02 A;  2XAF A;  1VTN C;  1S3J A;  2JPB A;  3K1N A;  5L3F A;  5D8K B;  4WX9 A;  4ZZL A;  4XSX F;  1WQ2 A;  2P5L C;  2ETH A;  2P7C B;  3WG9 A;  2HYF A;  2P4W A;  1P2F A;  4GXO A;  4HLY A;  3TQN A;  2WV0 A;  2PMH A;  4P9F A;  1MDM A;  2QZ8 A;  4P9U A;  1GVJ A;  4G8X A;  4MEY F;  4L0Y B;  1BOA A;  1P4A A;  2HWV A;  2FQ3 A;  1Z6R A;  4M9Z A;  5DYM A;  1HKT A;  5JR3 A;  3L2C A;  4MQ9 F;  4RS8 A;  5CYV A;  2XRO A;  1XSD A;  3QP5 A;  1B59 A;  2BGC A;  3TOA A;  4LG0 B;  3KZY A;  3GYH X;  1XN7 A;  1FP1 D;  2FOK A;  5HLG A;  4BYY A;  2PI0 A;  5HLI A;  2A3S A;  5LHI A;  3EYI A;  2KIU A;  3BRO A;  2FMY A;  2V9V A;  3ZMZ A;  2DLL A;  4HF0 A;  2O61 A;  1YLF A;  1IN6 A;  2DT5 A;  4M9X A;  3J80 K;  2NS0 A;  5JVT A;  4MTE A;  1BJA A;  5DD4 A;  2FNP A;  3NRV A;  1OYW A;  4HV5 A;  2HQN A;  1R23 A;  1XCB A;  3F6O A;  1CGP A;  4G7Z F;  1G3W A;  1KU2 A;  3R6S A;  5D6F A;  4DNC A;  2NNN A;  4G94 A;  3E3V A;  3DXJ F;  5DV5 A;  1D3Y A;  4ZZD A;  3J81 K;  2NAZ A;  2HTS A;  4CO8 A;  5LGU A;  2Q8K A;  3M9A A;  3ZMS A;  3U9G A;  2LF7 A;  3V8J A;  2GQQ A;  4WXD A;  3K2Z A;  5AIP A;  2OQR A;  1LDJ A;  1LDD A;  2EB7 A;  5BMZ A;  1ZGJ A;  2HR3 A;  2K02 A;  2P7V B;  3I54 A;  4P55 A;  3CJN A;  1MZB A;  1OPC A;  1ZRE A;  3PQK A;  3R4K A;  3H3U A;  4TV7 A;  1LQ1 A;  3AAF A;  3V7R A;  2DW4 A;  2TDX A;  3IHU A;  4UV9 A;  4A5N A;  3WOD F;  2E1C A;  3GLX A;  4FX0 A;  2NYX A;  1ZN2 A;  4UVC A;  4U0W A;  2H94 A;  1TNS A;  2PBI A;  3KLN A;  1XDU A;  3PFI A;  4E70 A;  3H3Z A;  3VB2 A;  1G3S A;  4KUM A;  5ED4 A;  4AD9 A;  2J5O A;  3M8E A;  3KFW X;  4RGR A;  4EMS A;  1DUX C;  4L18 B;  4ZH4 F;  4HF2 A;  1LEA A;  1I1G A;  2F2E A;  1W5T A;  5ICF A;  1BI2 A;  2IA2 A;  2MC3 A;  3TGN A;  5D5V B;  2RQP A;  4OU0 A;  4AIK A;  2QWW A;  4XRF A;  3F23 A;  3FXU A;  4KYW A;  4YFK F;  1FT9 A;  4IJA A;  4WK8 F;  1GHC A;  1YO5 C;  1O7F A;  1WSU A;  2EA2 A;  1K79 A;  3ERE D;  2VE9 A;  3RYP A;  5FLX Z;  1QQI A;  1BC8 C;  2RNJ A;  4Z2Y A;  4KT5 C;  4HQE A;  4M6Y A;  5E1Z B;  2Y75 A;  3JTG A;  1A04 A;  3SHF A;  1F4K A;  3BJA A;  1QPM A;  3LST A;  4IF4 A;  4NQW A;  1FYK A;  4D0P A;  1ULY A;  2EV5 A;  4I0B A;  2QQA A;  1IAW A;  3KP6 A;  2HS5 A;  2CSO A;  1J75 A;  2ISY A;  2VBZ A;  3GFI A;  4GGG A;  3E6B A;  1K78 A;  2K27 A;  2ZFW A;  1ZLJ A;  1ON1 A;  2D1H A;  3ROU A;  5AON A;  3P9K A;  2ESN A;  5AIQ A;  3EUH A;  3R61 A;  4FHT A;  3KLO A;  4U7D A;  1QO0 D;  3HSE A;  3RKY A;  1XD7 A;  2W57 A;  4HOB A;  1YIO A;  5D5X B;  2Q0O A;  2K4B A;  3LA7 A;  4BHP A;  2O8X A;  2QVO A;  2MLK A;  1X3U A;  2H09 A;  5E1X A;  4I02 A;  3GFJ A;  2QEN A;  2PMU A;  4GCV A;  1ZAR A;  1R00 A;  2XRN A;  3M8F A;  2NNY A;  3WE2 A;  2A5Y B;  2IVM A;  3L00 A;  5E17 F;  4OIP F;  3KEO A;  3WTY C;  1MKM A;  2JRT A;  4XSZ F;  2H27 A;  1YYV A;  3E5X A;  1NHA A;  2KJC A;  3F3X A;  5IT3 A;  3LAJ A;  4A6E A;  5EEG A;  1DDN A;  1S6L A;  1JE8 A;  2VOO A;  3ECO A;  1G6N A;  2M5W A;  2ADU A;  4G7O F;  4WXC A;  3C7J A;  4OMY A;  1DPR A;  2PLY A;  4CZZ A;  2G7H A;  1FC3 A;  2Y48 A;  4N9H A;  1FLI A;  4EJU A;  4I01 A;  3IL2 A;  3MCZ A;  4YII A;  2ZO4 A;  5A2Q Z;  3KP4 A;  2OZ6 A;  5CVV A;  3HYI A;  3QRF F;  5ILU A;  3FXR A;  2DAO A;  1HKS A;  3ULQ B;  1LB2 A;  2MA3 A;  4R79 A;  3RTR A;  3TO6 A;  2EFO A;  3RKW A;  1ZRC A;  2EWN A;  4LK0 F;  4KIB A;  4HX8 A;  2PJP A;  3GWZ A;  3TKY A;  1LDK B;  4OIO F;  4NHJ A;  5LGT A;  4HW0 A;  2DI3 A;  3EDP A;  1K78 B;  3B02 A;  2M87 A;  4MGR A;  4UVA A;  4UXN A;  1D8K A;  4A6D A;  3MZH A;  1IN7 A;  4S04 A;  1SD5 A;  1KYZ A;  1STZ A;  2VOD A;  1C0W A;  1L3L A;  4WWC A;  2A61 A;  3F8N A;  5ICC A;  2P6S A;  2P5V A;  2PG4 A;  3DPT A;  4U0Y A;  3WTZ A;  1XDS A;  3T8T A;  4OOI A;  2DQR A;  3LAP A;  2VBY A;  3T0Y A;  1EV7 A;  3ABT A;  4I2O A;  2X0L A;  1TQM A;  2DFI A;  2P6T A;  2B0L A;  3ECH A;  1IUY A;  1I27 A;  3CO6 C;  1BBY A;  1XMA A;  5CVU A;  3IRQ A;  4IHS A;  2L01 A;  4CIC A;  2M1B A;  3Q9S A;  1DPU A;  5F64 A;  1HQC A;  5HDK A;  3WU1 B;  2YSR A;  5HS7 A;  1SAX A;  4YIF A;  3DQV C;  2IT0 A;  5E18 F;  4EM2 A;  1FZP B;  1TLH B;  2HGC A;  4RGX A;  4UVB A;  1UST A;  2FML A;  3ML6 A;  2H6B A;  1BC7 C;  4G6D A;  1BI0 A;  4EJO A;  3MAJ A;  2DU9 A;  5K5O A;  2O03 A;  1B4A A;  4RGU A;  4AIJ A;  3RPU A;  1YW9 A;  3FWE A;  2RN7 A;  1Z91 A;  4A12 A;  1LNW A;  2ELH A;  3ZMU A;  4KMF A;  2PFB A;  4LK1 F;  1FSH A;  3MQ0 A;  4A0Z A;  3CLO A;  2X4H A;  3J81 Z;  1Z05 A;  1FX7 A;  1KQ9 A;  3W6K B;  3BY6 A;  2P8T A;  4M71 A;  5FGM A;  3ZMT A;  1U2W A;  1Z7U A;  1ZRD A;  1U8R A;  4HF1 A;  3BPX A;  4EM0 B;  2E7W A;  3SXY A;  3I64 A;  3HOS A;  3K1P A;  5DEQ A;  1RIO H;  1O3T A;  4M73 A;  2GIV A;  1FOK A;  6PAX A;  2JSC A;  4OIN F;  1YW8 A;  4HDV A;  4OIR F;  4OIQ F;  4B8X A;  3ABU A;  2W84 A;  2F5D A;  4UV8 A;  1QZZ A;  4RB0 A;  1OYI A;  4U7B A;  1TBX A;  3CUQ A;  1HW1 A;  3HRM A;  4L0Z B;  2IP2 A;  2O0Y A;  4EJT A;  4LB5 A;  2VXZ A;  4PGG A;  1UCR A;  1PP7 U;  1F5T A;  4HYE A;  2L4A A;  3WTS C;  3SFZ A;  5BS6 A;  1K6O A;  4G9Y A;  2VOP A;  1TQI A;  5K5Q A;  3FX3 A;  1I6X A;  5DD8 A;  2KKO A;  2FNA A;  3RKX A;  3WTV C;  4CYD A;  2KJB A;  5E8I A;  4EGY A;  5D4S A;  3H92 A;  1FBQ A;  2MH9 A;  3GEZ A;  1QZY A;  4ETS A;  4U88 A;  1E17 A;  2BEO A;  1LVA A;  4CHU A;  1KU3 A;  1ZRF A;  2GAU A;  1G3Y A;  3I5U A;  2FE3 A;  1UHW A;  2Z99 A;  4HDU A;  4ENK A;  3WTX C;  3K1M A;  1B1B A;  3SZT A;  4JK1 X;  5DCM B;  2ACJ A;  2E1N A;  4KNY A;  3COA C;  2Z33 A;  1AWC A;  5LBQ A;  3DEU A;  1OYY A;  2VBX A;  1P92 A;  2OU2 A;  1YTY A;  4MNU A;  4GO1 A;  2HTJ A;  2XKP A;  1S8N A;  1HW5 A;  2XV4 S;  2DPD A;  4GYG A;  2XAG A;  3I53 A;  4PGH A;  4KIC A;  5E8G A;  2WTE A;  3IWZ A;  5J6X A;  3K9T A;  1S7A A;  4G6Q A;  1HST A;  4N0B A;  3F8F A;  1KGS A;  2UXN A;  2M8E A;  2LDU A;  4K2E A;  3CUQ B;  3O6B B;  3IKT A;  3LWF A;  4UHT A;  3C18 A;  4NB5 A;  3ISP A;  3FXQ A;  1EH7 A;  3LQQ A;  3HTU A;  5FO5 A;  3GZ5 A;  4Y13 A;  3E97 A;  3FF5 A;  4RAZ A;  3E6C C;  4LD5 A;  4OMZ A;  5BQT A;  2V1X A;  5FFZ A;  1J0R A;  1B9N A;  4ASN A;  1D8J A;  3MEX A;  3RI4 A;  3P9C A;  3BPV A;  3QPT A;  4ZYH A;  1UB9 A;  1XGN A;  4GYI A;  3N97 A;  1ZG3 A;  3U1D A;  4Q47 A;  4ESF A;  1ZAO A;  2Z3Y A;  3RPQ A;  2CW0 F;  1HSJ A;  2OD5 A;  4RB2 C;  1F9N A;  4XBF A;  2COM A;  3F8C A;  3BOQ A;  1IN8 A;  4M74 A;  2YPR A;  2IJL A;  4KIF A;  2XHK A;  3GVA A;  2CFX A;  2M45 A;  2H6C A;  1TW3 A;  4KDP A;  1Z1D A;  2CGP A;  4ENN A;  4A2U A;  4LJZ F;  4RB3 C;  1Z9C A;  3DFG A;  2XAQ A;  1SMY F;  2CG4 A;  1G4D A;  2WC2 A;  3HHH A;  3WGH A;  5JI6 A;  3ZMD A;  1G3T A;  4Y15 A;  4KIG A;  4B09 A;  1BI1 A;  4EQQ A;  2DQL A;  2VN2 A;  4I7H A;  4RB1 A;  3I58 A;  3G73 A;  2KRF A;  1SD6 A;  3I4P A;  2ZNY A;  2K4J A;  2XAS A;  1FBU A;  3HSF A;  2FA5 A;  3GO5 A;  4KN7 X;  3P7N A;  3Q9V A;  2RVC A;  2QUF A;  5L3D A;  1S7O A;  5BPI A;  1KQ8 A;  1ZG5 A;  4DQ2 A;  1W5S A;  2QYO A;  1B6A A;  3VEP A;  1FP2 A;  3O2P E;  3R0A A;  2LKP A;  2A6E F;  2GA2 A;  2AS5 F;  2VON A;  4EGZ A;  1SFE A;  1SMT A;  5HS8 A;  1YW7 A;  4QWQ A;  1MD0 A;  3QU3 A;  2RDP A;  1ZG1 A;  3L7W A;  3WTT C;  1JGS A;  3IWF A;  2GWR A;  4P96 A;  2V79 A;  3OV8 A;  1GXP A;  4MEX F;  3R0J A;  3E5Q A;  3EYY A;  3REO A;  3RDI A;  1ONV A;  3DV8 A;  4JBA A;  1U6G A;  2FBI A;  3DPL C;  5J8F A;  4IXA A;  4HX4 A;  1V4R A;  3HUG A;  5LHH A;  4WXH A;  2XIG A;  1W7P D;  3SZP A;  2OZU A;  4AIH A;  5BPD A;  5LRS A;  3GX4 X;  1RZ4 A;  4O6J A;  1BN5 A;  2JTV A;  1HXD A;  4CDG A;  4L9J A;  4WF2 A;  2R7D A;  1TQP A;  1U5T A;  2WWY A;  3MZY A;  1R1V A;  3JTH A;  1QGP A;  2L3D A;  1FNN A;  4MHG A;  1IZ1 A;  1T39 A;  1HBX G;  2IRF G;  4IHT A;  1YS6 A;  5ERI A;  4ENJ A;  1QNT A;  3OOP A;  3FM3 A;  3ZN1 A;  3E6D A;  3DF8 A;  1XGS A;  2LSO A;  1E2X A;  2VC0 A;  3E5U A;  2EA4 A;  3V8L A;  2YU3 A;  1R1T A;  2NRA C;  2MBF A;  2CYY A;  3EET A;  4L9T A;  1BM9 A;  3QP6 A;  2Y0M A; 
#chains in the Genus database with same CATH topology
 1LE8 B;  2K86 A;  5DCF A;  2R7W A;  3HXL A;  1ETY A;  4WCG A;  2H1K A;  2BE5 F;  2R4G A;  1YRN B;  2M30 A;  2JJ7 A;  5FFX A;  1MJB A;  2A68 F;  3I59 B;  3PQJ A;  4A0Y A;  2VB6 A;  2EIN H;  3KE2 A;  3GME A;  2Y9Z A;  2OJE D;  4S05 A;  2KDO A;  4BJ5 C;  5FKM A;  3E6M A;  3NEU A;  2ZKZ A;  1R6R A;  2DTR A;  4XLN F;  3UR3 C;  3QAH A;  3HTS B;  5EF6 A;  2GXB A;  3RQI A;  3CO7 C;  3FHZ A;  3OIO A;  1K83 J;  4JX5 A;  1EF4 A;  4MQV A;  3NAU A;  2R92 J;  2QCO A;  1X1B A;  3EUA A;  3MWM A;  4CXF A;  4N9I A;  3DTE A;  3GZ6 A;  3VSK A;  3V7C A;  2E5N A;  5K5R A;  5ILS A;  2L7M P;  2KIQ A;  4KFC A;  3GTO J;  5CLS A;  4LIT A;  3IH3 A;  5KAI C;  1MGT A;  3HRT A;  4XLF A;  1X4O A;  3Q3S A;  2IPQ X;  1D1B A;  5LFA A;  1YQA A;  5D4R A;  3DWL E;  3JAM K;  2Q2E A;  3RCO A;  2IS6 A;  4ZYD A;  2ZXJ A;  5DUI A;  4YG2 F;  1K4T A;  2AQF A;  2QSF X;  5LRR A;  2G9W A;  4ABZ A;  1D0Z A;  1IV8 A;  4L5I A;  3QU6 A;  1O3Q A;  1GVD A;  2G0E A;  2FSW A;  5L3C A;  2A6H F;  2GZW A;  2ZXW H;  3T5X A;  1FIP A;  2D2W A;  2YR2 A;  4DYQ A;  4HLX A;  2W24 A;  5E3N A;  2XB5 A;  5HVQ C;  3CMA I;  4R8H A;  2LD5 A;  2BHY A;  3HUG B;  4EEF G;  5GAE J;  3RQ4 A;  5IYC J;  2EJR A;  3NQO A;  1ZLK A;  1PJR A;  4I0A A;  3FHN A;  3AG4 H;  5DCM A;  4E7H A;  2ZBK A;  3OYD A;  1JUM A;  2FD5 A;  2FF4 A;  2GXG A;  4KN4 X;  4LMY A;  1JUP A;  2MW8 A;  1X2M A;  2XKO A;  2F5C A;  3D5S C;  5KAF C;  1IXR C;  4G6T B;  2E7X A;  1DQU A;  2DN0 A;  1A6Q A;  2KZG A;  1WJB A;  3MMY B;  1RNL A;  4O3M A;  4XLC A;  2ISZ A;  1UAA A;  1I50 J;  4QSH A;  1BR1 A;  1WKM A;  2E36 A;  3GF2 A;  5E3M A;  1U5T B;  4Q4Z F;  2DOD A;  4AWX B;  4FX4 A;  2OCC H;  5CVR A;  3S17 J;  1W36 D;  2ID6 A;  1X2N A;  5HOD A;  4CH7 A;  3H1C A;  2UV1 A;  1XSX A;  1TWC J;  3H5R A;  1DU0 A;  4BY1 J;  4IHY A;  5HNH A;  1TTY A;  4AVP A;  2BY3 A;  4M9S A;  1B72 A;  2R0Q C;  4B4C A;  1PP8 F;  1QHG A;  1FPQ A;  5IP7 J;  3OSF A;  2W25 A;  1PDN C;  3GZN B;  4LFU A;  1Q1H A;  2ZXI A;  4UUS A;  3Q5F A;  1NK2 P;  3J7A O;  1UMQ A;  3SYT A;  2E34 A;  2L0K A;  3V7S A;  3VOD A;  3CUO A;  1WRJ A;  1T98 A;  2HEO A;  3M4O J;  3IH4 A;  5K7Z A;  5ICG A;  2MH2 A;  3BP8 A;  3DCF A;  5F08 A;  4UNO A;  2FU4 A;  4M3E A;  4UB6 C;  2RGV A;  1JT0 A;  1PUF A;  4H4K C;  3I4N J;  1OKR A;  3CUQ C;  4YFN F;  5EEA A;  1R7J A;  1WJC A;  3BG3 A;  4LLN A;  4EJW A;  4AYB A;  1S29 A;  4HQM A;  2HZD A;  4BDZ A;  2RV8 A;  1UG0 A;  3WE3 A;  4HZF A;  2DK5 A;  4PJ0 C;  1O57 A;  1Y56 A;  1IGN A;  1YFH A;  3F21 A;  3T8R A;  5FD5 A;  2JT1 A;  4C2M J;  2KP6 A;  3R60 A;  4XIC A;  3TDZ C;  1Q1V A;  3FBN B;  1V3F A;  2ZJ2 A;  4BKX A;  5K1Y A;  1ZQ3 P;  2JMW A;  2DO7 A;  4U0V A;  4QLC U;  1ODD A;  5ICE A;  1ZGA A;  1T08 B;  2QLZ A;  1H9G A;  3EQL F;  2HKO A;  5L3B A;  5L3E A;  3OYG A;  4ITV A;  5DM7 F;  1EH6 A;  5KNL A;  4RAY A;  3WTW C;  5B66 C;  5D5U B;  2VJJ A;  2RKH A;  3LFU A;  2CW8 A;  3G3Z A;  4L9N A;  1I1S A;  4FT8 A;  3GXO A;  1XGM A;  3C1D A;  5IT9 K;  2EFN A;  1B8I A;  3OYM A;  2CO5 A;  1O7L A;  2DOA A;  5FB2 A;  5L3G A;  1KYW A;  1IXS B;  4L9V A;  5D5W B;  3KP7 A;  3CDH A;  1RR8 C;  2IA0 A;  3KZZ A;  2D45 A;  4ENM A;  1XMK A;  1POG A;  3GW2 A;  4OAZ A;  3GTG J;  3F72 A;  5K7H A;  2D1V A;  3LA3 A;  2R3S A;  1AU7 A;  2M0C A;  5H6Q A;  2OBP A;  1K4S A;  1W0U A;  1H89 C;  2Q2E B;  2JVG A;  4C2U A;  4CCL A;  3K70 C;  3RSN A;  3CJT B;  3F6V A;  3P9I A;  4EV0 A;  4Y17 A;  2NVQ J;  4GDF A;  1ON2 A;  1X1D A;  1Z7L A;  3L9F A;  1TT5 B;  1D1A A;  2B7E A;  2DA7 A;  2K40 A;  3M1E A;  4D5C A;  4ESB A;  3W6J B;  1R58 A;  2PJR A;  3IAM 2;  4G12 A;  2VT3 A;  1WPK A;  2LP0 A;  2FRH A;  4KIT B;  1IW7 F;  2VPR A;  4BXU A;  5IYD J;  1BIA A;  3K4C A;  5HOO A;  5HS9 A;  1ENH A;  2X6W A;  2OTJ I;  2IXS A;  2ZNZ A;  4NUB A;  2CW7 A;  1TW2 A;  1WWX A;  1DP7 P;  1XS9 A;  5LHG A;  2UWM A;  2JK3 A;  1U3E M;  4IVN A;  2O3F A;  1OMI A;  4IRI A;  1W7P A;  3HSR A;  1Z6T A;  4AC0 A;  3LQR A;  3J7A Y;  3JCU C;  3S2H J;  1QA6 A;  3WGI A;  2H1L A;  4IEJ A;  3QYF A;  5DDG A;  1HC8 A;  2L2O A;  3BTL A;  1R5H A;  2O6G E;  3MN2 A;  2E1M B;  2WAD A;  3W2A A;  3HGG A;  5H20 A;  4I98 B;  2XVC A;  1X3W B;  1B72 B;  3C3W A;  3SJM A;  3E0J B;  2EFW A;  3HC7 A;  2V4J C;  2WAE A;  3IKV A;  3S2W A;  2E19 A;  3PO3 J;  1MJ9 A;  2FBK A;  5JLW A;  1BIB A;  1RPW A;  3PUF A;  3LL7 A;  1KU7 A;  3PL8 A;  4IL6 C;  2STT A;  4V2G A;  2WAQ A;  1T0F A;  2XGX A;  1XGO A;  4IRG A;  2UXX A;  1RET A;  5F1R A;  1UHM A;  1VQK I;  2C6Y A;  2QSH X;  3G2B A;  1T2K A;  2A07 F;  1IN4 A;  2XUB A;  3GFL A;  3BZ6 A;  4ZDO A;  1KQ0 A;  1UFM A;  3LSI A;  1MDM B;  1IXC A;  1JHF A;  4LGW A;  2HZT A;  1HF0 A;  1UZC A;  2R7F A;  4BAY A;  2XAJ A;  4PDK A;  3NWT A;  1PUF B;  3HPH A;  4F55 A;  1U78 A;  3K0L A;  4CCJ A;  4LLG F;  2ECB A;  1T38 A;  2W00 A;  3G1L A;  4XN3 A;  2GXA A;  3HOU J;  1VF9 A;  3BC8 A;  3RIR A;  2OA4 A;  5C4X J;  2J5P A;  5LLQ A;  3A4C A;  4BQN A;  1VQ7 I;  3AG1 H;  4A5M A;  3RJP A;  2DK8 A;  1D5V A;  1ZHF A;  4HAM A;  1X3Z B;  1MSE C;  2OAZ A;  5CVI A;  3PNT A;  5J8C A;  1AOY A;  1O3R A;  1OLT A;  1R5G A;  2HOS A;  2M9H A;  2DYS H;  3WU0 A;  2LF8 A;  1F1Z A;  4EVI A;  3MFK A;  1IRF A;  2CV2 A;  3D0S A;  2ZJQ F;  4YRV A;  3RYR A;  3LOC A;  1B9M A;  4HST A;  4UUV A;  2V6E A;  1G2H A;  1R36 A;  2ZFU A;  1XB4 A;  2EZI A;  1JJ8 C;  3JRD A;  2HPM A;  1Y0U A;  2AXL A;  4M72 A;  3O8G A;  1ETV A;  2XAH A;  4LIU A;  2EV0 A;  2LKX A;  3CES A;  3CDL A;  3N05 A;  2RAE A;  3K69 A;  3KP3 A;  2DFE A;  3T1B A;  3D1N I;  2X48 A;  2DMP A;  1B8I B;  4F52 A;  3TOB A;  1OCC H;  1TT0 A;  3DKY A;  3F0C A;  4IZZ A;  3G1O A;  1FTT A;  2DT7 B;  1QVT A;  1U0J A;  5IP6 A;  2UZK A;  5IYB J;  1JXS A;  1JHH A;  3FM5 A;  1KA8 A;  2PQ8 A;  1CF7 A;  2QBY A;  3V8K A;  3LSG A;  2BVL A;  3KET A;  3F8M A;  2KZV A;  2Y0S N;  1OCT C;  1MBH A;  1L0O C;  5GAD J;  1HKQ A;  1P4X A;  3WTU C;  4BUP A;  2E60 A;  3F8B A;  2V6C A;  2OCE A;  1WI3 A;  1KU9 A;  3FMS A;  3QOD A;  3ZMV A;  3DEE A;  4XOP A;  2JN6 A;  2FJ1 A;  1EH8 A;  1OCZ H;  2WB1 N;  1LEB A;  3HIF A;  3LSR A;  3Q0U A;  1VQ8 I;  3DP7 A;  1IN5 A;  2ZSI B;  1FY7 A;  5EEH A;  1VQL I;  4PZJ A;  4M6X A;  2KIM A;  2X1E A;  1R1U A;  2V1U A;  1J7K A;  4MIM A;  3PNV A;  5FKK A;  4YFX F;  4M3F A;  2EBI A;  2W4S A;  5H6R A;  3QPH A;  3FXO A;  3MD2 A;  5EZH A;  1W7P B;  2IA1 A;  3ZP5 A;  3CLQ A;  3F22 A;  2STW A;  3CCE I;  4QTR A;  1V54 H;  3I0T A;  1J5Y A;  2Z9O A;  3ZQQ A;  3ZGK A;  2IGK A;  2QQ9 A;  2ECC A;  2MAB A;  5KCM A;  3D5L A;  1MBG A;  1HW2 A;  2IS4 A;  1FWZ A;  3HGY A;  3FXJ A;  3LFK A;  3DBR B;  3GUD A;  3L09 A;  3U2R A;  1LE8 A;  4F92 B;  4BE1 A;  4A0X A;  1NH3 A;  4BNC A;  2QQB A;  2MLG A;  1YRN A;  2WY7 Q;  1YIT I;  2DOE A;  1OFC X;  5KVR A;  3I59 A;  5KK1 A;  2D5V A;  1MIJ A;  1X1P A;  3AL0 B;  1FYL A;  3ZOB A;  4DIQ A;  1IDZ A;  1YG2 A;  2L4M A;  4BXX J;  1N77 A;  3AG3 H;  1PUE E;  1P6R A;  2HU9 A;  1J2X A;  2A69 F;  3DKW A;  2L7Z A;  1USS A;  1BW6 A;  1MW7 A;  2RRE A;  2F5F A;  1JUS A;  2Y30 A;  3ZPL A;  4DBQ A;  3M7G A;  2F5V A;  3H5A A;  3FZV A;  3CCL I;  1WJA A;  3HRS A;  4ZC3 A;  3VOE A;  2CRG A;  3LA2 A;  1RUN A;  5HLH A;  3QOP A;  3ZQ7 A;  2GIZ A;  2KRH A;  4Q48 A;  4NDL A;  4JQF A;  3OR1 C;  3BJO A;  3BZK A;  2KQR A;  4CGZ A;  3KP5 A;  2PMZ A;  1Z21 A;  4PCQ A;  3X2Q H;  4BH9 A;  1X19 A;  1SD7 A;  1XCV A;  1T6S A;  2M2E A;  1VQN I;  3BDD A;  2G7U A;  2X9D A;  4ON0 A;  5FLX K;  3K6G A;  1RKT A;  2R7U A;  1R22 A;  2A6T A;  3JW4 A;  4HA8 A;  3Q0W A;  3NAR A;  2IGO A;  5DUK A;  1GUU A;  2EFQ A;  4CCN A;  4D7M A;  1IRZ A;  1YHQ I;  2ZCW A;  5LEK A;  3LSK A;  2ZXH A;  1QBJ A;  4Q5S F;  3CTA A;  5J47 A;  5M3M J;  1SFU A;  3B73 A;  1D0Y A;  5E1W A;  2HYG D;  3DKX A;  2VKV A;  4I09 A;  1I5Z A;  4XLE A;  4C30 A;  4RAG A;  2OQG A;  3KEQ A;  3W2V A;  2PN6 A;  4CCO A;  3G6E I;  3OL3 A;  2BY0 A;  2HDW A;  3DLA A;  2QM3 A;  2RQQ A;  1OR7 A;  3CF2 A;  1VQ6 I;  3DU5 A;  4BHC A;  2XF6 A;  2P5K A;  1CF7 B;  1QPI A;  4FQG A;  4RGS A;  2QBY B;  5M3F J;  2RC4 A;  3BG6 A;  4C3I J;  3KCC A;  2E2H J;  3SQN A;  3ZN0 A;  5LGN A;  3MVP A;  3FMQ A;  3N4M A;  4IPA A;  2BYV E;  2ZME A;  2CQK A;  3C2H A;  1OR7 C;  3JAM Z;  4BAC A;  4HV6 A;  2UUZ A;  3BWG A;  3L2Q A;  2QSG X;  1G8X A;  4XRM A;  4BHB A;  4XNF A;  4IOC F;  2BBY A;  2ZB9 A;  5LEJ A;  3SEQ A;  3VYT B;  3TO9 A;  3U1K A;  3HOX J;  3RKQ A;  3HL2 A;  5D8L B;  1HLV A;  1RUO A;  2EIK H;  2VJ4 A;  2ZME C;  1WGX A;  2DMN A;  3OR2 C;  1U5T C;  3G71 I;  4HRI A;  2BW3 A;  3KP2 A;  3WGG A;  2IBD A;  1VQP I;  4B48 A;  3V42 A;  4A3B J;  2M8G X;  1H0M A;  4Y3O A;  1XTA A;  4PJN A;  2Z5U A;  1FOW A;  5J3L A;  1MJA A;  1T56 A;  3BJ6 A;  3OIQ A;  2L9V A;  3TDU C;  4ZYE A;  5HDN A;  3JSP A;  1YIJ I;  1WH7 A;  1BR2 A;  4ZYG A;  2L54 A;  4ZTF A;  5FRM A;  2F4O B;  1Y1V J;  2FXA A;  1FYM A;  1OJL A;  3PNY A;  1T8I A;  3GTK J;  2DJN A;  2V1D A;  2K9S A;  3TW6 A;  2IW5 A;  2EIL H;  4KMU X;  2EV6 A;  5JHU A;  4ANJ A;  4LB6 B;  2DCE A;  3VFZ A;  3A0H C;  3BZC A;  1J59 A;  1GXQ A;  5D6E A;  2LYC A;  3TO7 A;  1IF1 A;  5GAG J;  2R5Z B;  4H0E A;  1I6H J;  2E2I J;  3ELK A;  1YS7 A;  2KIF A;  2HOE A;  4EJV A;  4QPQ A;  5CVJ A;  4BQQ A;  4BU2 A;  1XSV A;  4I6Z A;  2ZJP F;  1O3S A;  3ZQC A;  1U9N A;  1ZYR F;  2BY2 A;  4LG0 A;  3OIP A;  3L2R A;  4R1H A;  4IHV A;  2DBB A;  2JSP A;  2JPC A;  2AO9 A;  2Z1D A;  2VQL A;  4HX7 A;  2HXO A;  1YJN I;  1H9T A;  2VT2 A;  2CMP A;  2VLA A;  4KIS A;  3HRU A;  5HDG A;  1REP C;  2GA1 A;  4NNJ A;  5TJJ A;  2K7L A;  4BQA A;  3IC7 A;  2HKX A;  2F5E A;  2DA2 A;  2ESH A;  2LNB A;  4FAS D;  3IV5 A;  1J9I A;  4W1U A;  1XPX A;  1W4M A;  5CJ9 A;  5E20 A;  3O3K A;  4XLP F;  3FDY A;  1ORK A;  5EDN A;  3GFM A;  4G7H F;  2FBH A;  4JX6 A;  3FKJ A;  3S93 A;  1VI0 A;  2EZL A;  4OWR B;  3CME I;  4J19 A;  2HVR A;  3RZO J;  3B6A A;  4A3K J;  2YX4 A;  1R5I D;  2EK5 A;  4KA4 A;  1FBS A;  2VE8 A;  5ILV A;  2COB A;  2VC1 A;  3I9V 2;  4P5O A;  4EAT A;  1HDP A;  3BR5 A;  3JSO A;  2XSJ C;  3V4G A;  1TL8 A;  3ZQI A;  4O5V A;  1IO2 A;  4IRH A;  2YX7 A;  5A2Q K;  2EZK A;  3IRR A;  4I99 C;  3ZQG A;  5FKO A;  1J09 A;  3I71 A;  5F0C A;  2KRC A;  4JOM A;  3KZI C;  4X6A J;  1TNT A;  3PIP F;  2TRT A;  4MTD A;  2BV6 A;  4EM1 A;  2BOL A;  2IS2 A;  3K7A J;  3HHG A;  3OY9 A;  1EKE A;  2MD5 A;  2MG4 A;  2K9Q A;  5JFR A;  1WI9 A;  3HOT A;  2CV0 A;  5BOX A;  2VQH A;  5IT9 Z;  1WJ5 A;  1BL0 A;  1BI3 A;  4L5J A;  5FD6 A;  2W85 A;  1MMA A;  4F91 B;  3B6C A;  2FEZ A;  1N78 A;  1I3Q J;  1IRG A;  3S3M A;  3J80 Z;  5TRD A;  3GTJ J;  1GT0 C;  3HB9 A;  2HQR A;  1GV2 A;  1R4M B;  4XOR A;  1SFX A;  2ZME B;  2AXT C;  2CUZ A;  1ZH5 A;  2LKS A;  1P4W A;  1RI7 A;  2HFH A;  1K7A A;  3OYH A;  2VBW A;  3DBL B;  4XKB A;  1FSE A;  4ESJ A;  3GTQ J;  3A03 A;  4LLL A;  1T33 A;  3FMR A;  1ZGW A;  4BE0 A;  2PEX A;  3BCA A;  3S1R J;  4IQJ A;  1SD4 A;  5F6F A;  2CWE A;  1JT6 A;  4F7Z A;  3S15 J;  1Y1W J;  2JZY A;  3A1Y A;  4GFB A;  3UNG C;  1LJ9 A;  1WJF A;  4HBL A;  2EFP A;  2BW3 B;  1IJW C;  2HDC A;  4PJJ A;  2DPU A;  2L02 A;  2XAF A;  5GPA A;  1VTN C;  1S3J A;  3DPU A;  1G59 A;  2JPB A;  3K1N A;  5L3F A;  2MFZ A;  2E1M C;  5D8K B;  4WX9 A;  2O9L A;  4ZZL A;  4XSX F;  3BQZ A;  1JJ6 C;  2K85 A;  4B3A A;  2M4K A;  4QPO A;  4XKV A;  4ZTJ A;  4XID A;  1WQ2 A;  2P5L C;  1LFU P;  2ETH A;  3CP8 A;  2P7C B;  3WG9 A;  2HYF A;  2XDV A;  2P4W A;  1P2F A;  4GXO A;  3BR6 A;  4HLY A;  3TQN A;  2WV0 A;  2PMH A;  3HKZ A;  4P9F A;  2K5C A;  2R7O A;  1MDM A;  3OYB A;  2MYS A;  1VQO I;  2QZ8 A;  4P9U A;  1GVJ A;  1R49 A;  4G8X A;  4MEY F;  4AUX A;  4L0Y B;  1BOA A;  1P4A A;  2HWV A;  4E7S A;  2RNG A;  3H5N A;  2FQ3 A;  5FRO A;  1Z6R A;  1Y6I A;  2E1O A;  4M9Z A;  4V2F A;  4IO9 F;  5DYM A;  1HKT A;  2DMU A;  1V5F A;  5IPA A;  5JR3 A;  4RDU A;  3L2C A;  4MQ9 F;  4RS8 A;  5CYV A;  2XRO A;  1XSD A;  4MO7 A;  1Z3X A;  3QP5 A;  1B59 A;  3BG9 A;  4JP0 A;  2BGC A;  2KDZ A;  3TOA A;  4LG0 B;  3GBG A;  3KZY A;  3GYH X;  5E3L A;  1R71 A;  4BJ6 C;  1XN7 A;  2H8W A;  3S3N A;  1FP1 D;  2FOK A;  5HLG A;  4BYY A;  2E2J J;  2PI0 A;  2JRM A;  4XMY A;  5HLI A;  4BJT A;  2A3S A;  5LHI A;  2XB0 X;  4BBR J;  3EYI A;  2KIU A;  2NOJ B;  5IOZ A;  3BRO A;  4YIR X;  1SFO J;  2FMY A;  2V9V A;  3ZMZ A;  2DLL A;  4A3J J;  4HF0 A;  4RLF A;  2V26 A;  4FE7 A;  1NG6 A;  4PFO A;  3ZQF A;  2O61 A;  1YLF A;  4BL0 B;  1IN6 A;  2DT5 A;  3HDD A;  4M9X A;  2HVS A;  4B43 A;  1TWG J;  3QPL A;  3J80 K;  2NS0 A;  2LC2 A;  2R7Q A;  5JVT A;  3LSJ A;  3KEY A;  2LY9 A;  4MTE A;  1BJA A;  5DD4 A;  2FNP A;  1WHU A;  3VDX A;  3NRV A;  5EJC A;  1OYW A;  1RRJ A;  4HV5 A;  2HQN A;  1R23 A;  4C9Y A;  1XCB A;  3F6O A;  2L9S A;  1CGP A;  4Y33 A;  5IOY A;  4X0G A;  1Y8Q B;  4G7Z F;  3CC2 I;  1G3W A;  1KU2 A;  2DT6 A;  2LY1 A;  2DTZ A;  2VKE A;  3R6S A;  1DU6 A;  1E0E A;  2BXY A;  5D6F A;  4DNC A;  5F0F A;  2NNN A;  3BR2 A;  4G94 A;  3K4L A;  3SDB A;  2R5Y B;  1N25 A;  3E3V A;  3DXJ F;  2LTP A;  2QKL B;  3S32 A;  5DV5 A;  1D3Y A;  4B47 A;  4ZZD A;  3J81 K;  2Y9Y A;  2NAZ A;  2HTS A;  4B1R A;  1MSF C;  2L7K A;  2ID3 A;  4CO8 A;  1WVR A;  4PSW A;  3H0D A;  3OOU A;  5LGU A;  5M5Y J;  3S1M J;  2Q8K A;  3M9A A;  3ZMS A;  3U9G A;  2W48 A;  3PIO F;  3P5J A;  2LF7 A;  3V8J A;  3GTP J;  3JRG A;  2GQQ A;  4WXD A;  1YI2 I;  2ELK A;  3K2Z A;  5AIP A;  4RM2 A;  2OQR A;  3I4M J;  5FKN A;  1LDJ A;  4E4H A;  1LDD A;  1H88 C;  1NK3 P;  2EB7 A;  3ZQH A;  4XRS A;  5BMZ A;  1ZGJ A;  1S9H A;  2F48 A;  2CFO A;  2HR3 A;  2K02 A;  3ASO H;  2P7V B;  3I54 A;  4P55 A;  3CJN A;  5TGT A;  1MZB A;  1OPC A;  2O7O A;  3L2U A;  1ZRE A;  2X1D A;  3PQK A;  3CF5 F;  1TP4 A;  3R4K A;  3O8H A;  3FXK A;  3H3U A;  4TV7 A;  3H9Q A;  1LQ1 A;  3SZG A;  3DBH B;  3AAF A;  1ETO A;  3V7R A;  4XL9 A;  1X58 A;  2DW4 A;  3OYJ A;  2TDX A;  5TIS C;  4XR6 A;  3IHU A;  4KJZ A;  4UV9 A;  4D5F A;  4M6V A;  1MMN A;  4DZP A;  2MGQ A;  4A5N A;  3S2D J;  1ETK A;  3WOD F;  2E1C A;  2JA5 J;  4NC8 A;  3GLX A;  4FX0 A;  2NYX A;  1ZN2 A;  4UVC A;  4NC6 A;  2VAS A;  1TC3 C;  4U0W A;  1VZ0 A;  2H94 A;  1QHH D;  1TNS A;  2PBI A;  3KLN A;  1XDU A;  5J40 A;  3FKI J;  4Y4R A;  2AHQ A;  1P9Q C;  3D5R C;  2NS8 A;  3PFI A;  4E70 A;  3H3Z A;  5GPC A;  2NVU B;  3AL0 C;  3VB2 A;  1T0F C;  4L5E A;  4E7Z A;  4A3C J;  1G3S A;  4KUM A;  4XKC A;  5ED4 A;  4AD9 A;  3TL4 X;  2J5O A;  3M8E A;  3K4M A;  1VND A;  3KFW X;  5FRN A;  4HG2 A;  4FE4 A;  4RGR A;  4EMS A;  1DUX C;  2HYJ A;  2EIJ H;  4L18 B;  4ZYA A;  2TCT A;  4ZH4 F;  3VYS B;  1D0X A;  2KFD A;  3AKZ A;  4UY8 I;  1FOY A;  4HF2 A;  1LEA A;  1I1G A;  2F2E A;  3RZD J;  1W5T A;  1ERD A;  3ZR8 X;  2M7A A;  4A3L J;  3OWT A;  5ICF A;  1BI2 A;  2IA2 A;  2MC3 A;  1NG7 A;  3PSF A;  5EYR A;  3TBI A;  3TGN A;  2RQP A;  5D5V B;  3S3O A;  1AA7 A;  2X6X A;  3PUB A;  1XMX A;  2VKD A;  2HQ5 A;  4OU0 A;  3KPH A;  4BS9 A;  1WH5 A;  2CUJ A;  3MKZ A;  4AIK A;  3MKY B;  4IQ4 A;  2VXD A;  2X6O A;  2QWW A;  4XRF A;  3F23 A;  2CQX A;  3KX2 A;  4D9J A;  3FXU A;  4KYW A;  4CA0 A;  4YFK F;  4CYC B;  1FT9 A;  4IJA A;  1AKH A;  4BY7 J;  4WK8 F;  1GHC A;  1JTX A;  1YO5 C;  1MNE A;  1O7F A;  1WSU A;  1CQT A;  5JLX A;  2A5W A;  2JA8 J;  1WJE A;  2EA2 A;  1K79 A;  2LBF A;  3RPU D;  3ERE D;  1ITY A;  2VE9 A;  2WAF A;  3RYP A;  4FIS A;  3OYE A;  2JA7 J;  2KHM A;  3CD6 I;  3FK7 A;  5FLX Z;  1QQI A;  1BC8 C;  1VQ4 I;  2RNJ A;  4Z2Y A;  4KT5 C;  4HQE A;  4M6Y A;  5E1Z B;  2Y75 A;  3JTG A;  1A04 A;  3SHF A;  1F4K A;  1JKP C;  3BJA A;  3TW7 A;  5C4J J;  1QPM A;  3LST A;  5E3O A;  4RM3 A;  4IF4 A;  1YJW I;  4NQW A;  1FYK A;  3KYC B;  4D0P A;  3L2W A;  1ULY A;  2EV5 A;  4I0B A;  4DOZ A;  2QQA A;  3K10 A;  1K61 A;  1IAW A;  1OCO H;  3KP6 A;  1YX3 A;  2HS5 A;  2CSO A;  1J75 A;  4F93 B;  1V55 H;  2A05 A;  2ISY A;  3C2B A;  2VBZ A;  2L9N A;  4GGG A;  3GFI A;  3E6B A;  2B9S A;  1K78 A;  1KON A;  2K27 A;  2Z2S B;  2ZFW A;  4XK4 A;  1ZLJ A;  2L7F P;  4E7K A;  1BW5 A;  1ON1 A;  2D1H A;  3ROU A;  3VSL A;  3LMM A;  2XPV A;  5AON A;  1P7J A;  3P9K A;  2L5Q A;  2ESN A;  2IGN A;  5AIQ A;  2LR8 A;  3EUH A;  5EGO A;  2VJ5 A;  2OC6 A;  3R61 A;  3WHC A;  4AYB N;  2DDB A;  1W1W E;  4FHT A;  3KLO A;  4U7D A;  3GTL J;  4A3D J;  1QO0 D;  3ONQ A;  3HSE A;  3RKY A;  2R5Z A;  1XD7 A;  2W57 A;  4HOB A;  1EJ9 A;  3EUK L;  2CU7 A;  5JVG F;  1ZKG A;  3EUH C;  2HVQ A;  3S1N J;  1YIO A;  1SVO A;  5D5X B;  2Q0O A;  2NVT J;  2K4B A;  3LA7 A;  1A6I A;  5CQG A;  4BHP A;  4Z6Y A;  3OS1 A;  3J7Z I;  2P0W A;  1W36 C;  2VIX A;  3JRB A;  2MD0 A;  4NBQ A;  2O8X A;  1FTZ A;  2QVO A;  2MLK A;  3OS2 A;  5LD2 C;  2I5U A;  1X3U A;  2H09 A;  2F6C A;  4I02 A;  5E1X A;  3GFJ A;  2DFF A;  2QEN A;  2PMU A;  4GCV A;  1ZAR A;  4FET A;  1R00 A;  4CCM A;  2XRN A;  2GOX B;  3M8F A;  4NC7 A;  2NNY A;  3WE2 A;  3AG2 H;  2A5Y B;  2IVM A;  3ASN H;  5IP9 J;  3L00 A;  5E17 F;  3JRH A;  4OIP F;  2VPL A;  3KEO A;  3WTY C;  2GM4 A;  3ZCO A;  1MKM A;  1Z3Y A;  2CQQ A;  2JRT A;  3HM5 A;  4XSZ F;  2H27 A;  2M3A A;  2ICW G;  1YYV A;  3E5X A;  1NHA A;  2ME0 A;  5B3S H;  2KJC A;  3Q0V A;  3F3X A;  2VUM J;  3K70 D;  3WHB A;  4AVZ A;  2BVM A;  2BXZ A;  5IT3 A;  3LAJ A;  3TED A;  4A6E A;  5EEG A;  1O4X A;  1DDN A;  1S6L A;  1Z0X A;  3TP0 A;  1JE8 A;  1X1C A;  5J1U A;  2XRL A;  2VOO A;  1YE9 A;  1E3O C;  3ECO A;  2V1N A;  1G6N A;  3ERM A;  4FCY A;  2M5W A;  2ADU A;  3OYN A;  1IG7 A;  4G7O F;  3IP4 B;  4WXC A;  1DGW Y;  3C7J A;  2CH0 A;  4OMY A;  5EZG A;  1DPR A;  2PLY A;  4CZZ A;  1VQ5 I;  2G7H A;  1XC5 A;  1FC3 A;  1IV6 A;  1AKH B;  2Y48 A;  4N9H A;  1FLI A;  2E35 A;  4V19 K;  4EJU A;  3S16 J;  2EH3 A;  4U87 A;  5B5E C;  2XC7 A;  2LBF B;  4BGD A;  4I01 A;  3IL2 A;  3MCZ A;  4YII A;  3CCY A;  1BOB A;  2K3F A;  1MBF A;  2ZO4 A;  3S8P A;  3JRF A;  5A2Q Z;  3KP4 A;  2OZ6 A;  4II3 A;  3CCJ I;  1JKQ C;  5CVV A;  3HYI A;  3QRF F;  5ILU A;  3FXR A;  2DAO A;  5FJ8 J;  5DTD A;  1HKS A;  3ULQ B;  1LB2 A;  2O8K A;  2MA3 A;  2XPU A;  4R79 A;  2YU9 J;  5KHD A;  1W5C C;  1IRX A;  3RTR A;  3TO6 A;  3OYC A;  1UJ8 A;  2EFO A;  1TZL A;  2CQN A;  4NQW B;  1BR4 A;  3RKW A;  1ZRC A;  2EWN A;  4LK0 F;  4KIB A;  4HX8 A;  2PJP A;  3GWZ A;  2NVY J;  3TKY A;  1ETQ A;  1LDK B;  3BG7 A;  4OIO F;  4NHJ A;  5LGT A;  2WAQ N;  3DTK A;  4II2 A;  4HW0 A;  2JA6 J;  2DI3 A;  2NXN B;  3EDP A;  1K78 B;  3B02 A;  2M87 A;  3DLL F;  4MGR A;  4ZJZ A;  4UVA A;  1A31 A;  4UXN A;  1GV5 A;  1D8K A;  5F27 A;  5F0H A;  1F43 A;  2ZSH B;  2IGM A;  4A6D A;  3OYL A;  3MZH A;  2X1C A;  1IN7 A;  4S04 A;  3J7Y J;  1SD5 A;  1KYZ A;  1STZ A;  2X85 A;  4BEH A;  1MBK A;  2LVS A;  4UB8 C;  1ZTR A;  5EGO B;  3OS0 A;  1LFP A;  5IY5 H;  2VOD A;  1C0W A;  1BA5 A;  4ZDL A;  1L3L A;  4WWC A;  3L2V A;  5HLT A;  2EIM H;  2A61 A;  1X1A A;  4PUS A;  2DYR H;  1SVM A;  2HQA A;  3F8N A;  5ICC A;  1JKR C;  2P6S A;  2P5V A;  5CKT A;  2PG4 A;  3K4J A;  3VYR B;  2JWT A;  3DPT A;  4U0Y A;  3WTZ A;  1FEX A;  1WFX A;  1XDS A;  3T8T A;  4OOI A;  2DQR A;  3LAP A;  2CQ7 A;  2M0M A;  2VBY A;  4XM3 A;  3T0Y A;  1EV7 A;  3ABT A;  4I2O A;  2X0L A;  1TQM A;  4JYK A;  2XSD C;  3HOV J;  3JRE A;  2LFB A;  2DMQ A;  2DFI A;  2P6T A;  1A35 A;  3EPZ A;  2B0L A;  3ECH A;  1IUY A;  1I27 A;  2V7F A;  3CO6 C;  3PO2 J;  4A3I J;  2LOO A;  5FLM J;  2QKM B;  4PSX A;  2W1O A;  3HZJ A;  5GTH C;  4OAY A;  1BBY A;  4HSR A;  1XMA A;  1LKX A;  5CVU A;  3HJE A;  3IRQ A;  2FX0 A;  4IHS A;  2L01 A;  4C3H J;  3ZRG A;  3C2G A;  3WU2 C;  3CQZ J;  4CIC A;  2M1B A;  3Q9S A;  2DFH A;  1DPU A;  2CUE A;  5F64 A;  1ZEL A;  2GLO A;  1HQC A;  4N4N B;  5HDK A;  1ZR2 A;  3WU1 B;  2YSR A;  2ZC2 A;  5HS7 A;  3W3C A;  1SAX A;  2BHZ A;  4YIF A;  2VI6 A;  2HOA A;  3DQV C;  3H35 A;  3JRA A;  1VQ9 I;  2IT0 A;  4XQF A;  2R5Y A;  4YEL A;  2ZJR F;  2CJJ A;  5E18 F;  3JR9 A;  4EM2 A;  5FLV A;  1LFB A;  5B1B H;  1FZP B;  1K6Y A;  1TLH B;  2HGC A;  2JUC A;  4RGX A;  4UVB A;  4HEA 2;  2MC4 A;  1UST A;  2FML A;  3ML6 A;  2H6B A;  3HOZ J;  2CV1 A;  3CCS I;  1BC7 C;  3CMM A;  4G6D A;  1BI0 A;  4EJO A;  3MAJ A;  3BTJ A;  3ABM H;  1Y39 A;  2YS9 A;  2DU9 A;  2XAU A;  3DTI A;  3VYU B;  5K5O A;  3KIO A;  3FBI B;  2O03 A;  1B4A A;  4RGU A;  3UKG A;  5CPR B;  5CQE A;  2VQC A;  1SC7 A;  4AIJ A;  3SEZ A;  3RPU A;  1YW9 A;  3FWE A;  4XON A;  2M4G A;  2RN7 A;  1Z91 A;  4A12 A;  1LNW A;  2ELH A;  1WZ2 A;  3ZMU A;  4KMF A;  2PFB A;  5C3E J;  4LK1 F;  1FSH A;  2QF7 A;  3MQ0 A;  4ZDP A;  4A0Z A;  1FJL A;  3CLO A;  2X4H A;  3J81 Z;  1IC8 A;  2WBM A;  1Z05 A;  4DZJ A;  1FX7 A;  1KQ9 A;  3W6K B;  3BY6 A;  2P8T A;  4LIV A;  4M71 A;  5FGM A;  3ZMT A;  2Y0S A;  3BR1 A;  5J1R A;  2E71 A;  1U2W A;  3BTC A;  1Z7U A;  1ZRD A;  3AFH A;  1U8R A;  3BPX A;  3OSG A;  4HF1 A;  4EM0 B;  3CCU I;  2E7W A;  3SXY A;  4AU7 A;  3I64 A;  1KZH A;  5GP9 A;  3HOS A;  3K1P A;  9ANT A;  2K9N A;  3M07 A;  5DEQ A;  1M1E B;  1RIO H;  4E7L A;  1O3T A;  4M73 A;  2E5Z A;  2GIV A;  1FOK A;  6PAX A;  3A01 B;  2WB1 A;  1RC9 A;  2JSC A;  3VPR A;  4RMN A;  4DYR A;  4OIN F;  4BEH B;  1YW8 A;  4HDV A;  4OIR F;  4OIQ F;  4B8X A;  3ABU A;  5B1A H;  4A3E J;  3CCR I;  2W84 A;  3S14 J;  2F5D A;  3IUO A;  4UV8 A;  1QZZ A;  5GAH J;  1TWH J;  1A5J A;  4CSW A;  4RB0 A;  1OYI A;  1V5E A;  4U7B A;  1TBX A;  3CUQ A;  2WY8 Q;  2KPM A;  2PMZ N;  4N4O B;  1HW1 A;  1S72 I;  3HRM A;  5J4V A;  4L0Z B;  2XF7 A;  3KYD B;  2IP2 A;  3NWS A;  3K2A A;  2O0Y A;  1WJD A;  2I10 A;  3QQA A;  4EJT A;  4LB5 A;  2VXZ A;  3G4S I;  2Y2Z A;  4PGG A;  1UCR A;  1N75 A;  1PP7 U;  4RA2 A;  1NTC A;  1F5T A;  2R7X A;  1MMD A;  4HYE A;  2L4A A;  1BJZ A;  4QIW N;  1QVU A;  2R7T A;  3CC7 I;  3WTS C;  1JGG A;  3H0G J;  3FIW A;  3SFZ A;  2KLO A;  5BS6 A;  1K6O A;  2K3P A;  3MZ8 A;  4G9Y A;  2VOP A;  1Y0N A;  1TQI A;  3E7L A;  4B3X A;  5K5Q A;  4CYC A;  1I3A A;  3LNQ A;  3ESW B;  3ABK H;  2XPW A;  3FX3 A;  4XOT A;  3QYE A;  1QRY A;  2HNH A;  4CZC A;  4UUT A;  1I6X A;  5DD8 A;  2KKO A;  1PYV A;  2Y69 H;  3GLL A;  3H9G A;  2Q1Z B;  2DA3 A;  2F4I A;  2VQG A;  2FNA A;  2QEX I;  4AID A;  3BR0 A;  3RKX A;  2CS3 A;  3H36 A;  1RKW A;  3WTV C;  3GTM J;  4CYD A;  2KJB A;  5E8I A;  1TWF J;  4M3B A;  3PFY A;  1VQM I;  4EGY A;  5D4S A;  4C2T A;  3CMY A;  4E7I A;  4XLA A;  5F1J A;  3H92 A;  1FBQ A;  2MH9 A;  3OMY A;  4HPQ A;  3H9J A;  4A93 J;  3GEZ A;  1QZY A;  2IEK A;  4ETS A;  4U88 A;  1Z67 A;  1Z77 A;  3CJR B;  2DA1 A;  1E17 A;  2W82 A;  2BEO A;  1SEU A;  1LVA A;  3U21 A;  4CHU A;  3HG9 A;  2EPF A;  4HNT A;  1KU3 A;  2R7S A;  1ZRF A;  2GAU A;  1G3Y A;  3QWL A;  3I5U A;  2FE3 A;  1UHW A;  2Z99 A;  2DDA A;  4HDU A;  4ENK A;  2R93 J;  4BBS J;  4LOC A;  3WTX C;  3K1M A;  3PM1 A;  1SFK A;  1T95 A;  2XGE A;  1B1B A;  3OYF A;  2OTL I;  5C44 J;  3SZT A;  1MMS A;  1ZR4 A;  5F04 A;  4DGW B;  2M34 A;  3G1M A;  2JVH A;  4E7J A;  2PX9 A;  2X51 A;  1DGR M;  5EG0 A;  4JK1 X;  5DCM B;  2EQR A;  2ACJ A;  1R4N B;  2E1N A;  4KNY A;  3COA C;  2Z33 A;  3GCM A;  3WG7 H;  1AWC A;  5LBQ A;  3A02 A;  4IHX A;  3DEU A;  1OYY A;  1UHS A;  2VBX A;  3TP3 A;  4C3J J;  1P92 A;  1ETX A;  1SVL A;  2GBY A;  2M7B A;  2OU2 A;  1YTY A;  3CCM I;  4BXF A;  4MNU A;  1YJ9 I;  4GO1 A;  1OCR H;  2HTJ A;  2XKP A;  1S8N A;  1HW5 A;  5M5X J;  2XV4 S;  4LG3 A;  2DPD A;  4GYG A;  1LPQ A;  5HNF A;  5DM6 F;  2JUG A;  2XAG A;  3I53 A;  3I56 I;  4PGH A;  1JI8 A;  4KIC A;  3OYI A;  5E8G A;  1MBJ A;  2WTE A;  4IOA F;  1RR7 A;  4PK4 A;  2LH9 A;  3IWZ A;  4DBR A;  3QPS A;  3FXL A;  3CCQ I;  3E1S A;  2AQE A;  5J6X A;  3K9T A;  1S7A A;  4PFP A;  4G6Q A;  1HST A;  1HCR A;  3ABL H;  3BCB A;  4N0B A;  2DXI A;  4KT6 A;  4RAF A;  4UUS B;  2XF5 A;  2NVX J;  3F8F A;  1KGS A;  2UXN A;  2M8E A;  2LDU A;  4K2E A;  1V5G A;  2VJI A;  3CUQ B;  2BY1 A;  3O6B B;  3IKT A;  5J4Y A;  2LK2 A;  3LWF A;  3S1Q J;  4UHT A;  3C18 A;  4NB5 A;  3W6V A;  1FMV A;  3IH2 A;  4J01 A;  1TWA J;  3ISP A;  3FXQ A;  1OQY A;  2JA2 A;  1EH7 A;  2DOF A;  3I55 I;  3LQQ A;  1XG1 A;  3HTU A;  5FO5 A;  1D1C A;  3KYL A;  3GZ5 A;  4IKF A;  1FMW A;  1MMG A;  4Y13 A;  3E97 A;  3FF5 A;  4RAZ A;  1EA3 A;  3E6C C;  2NS7 A;  3QOE A;  1SAU A;  3CP2 A;  3M3Y J;  2GOM A;  4LD5 A;  2B63 J;  4OMZ A;  1UEL B;  2BZT A;  3I3L A;  5BQT A;  1MNM C;  1JKO C;  3OYK A;  3K4K A;  2V1X A;  1IDY A;  5FFZ A;  1J0R A;  1B9N A;  4GRI A;  4XKW A;  4ASN A;  1D8J A;  2KL4 A;  3MEX A;  2KT0 A;  3RI4 A;  3A0B C;  3P9C A;  3BPV A;  2FOW A;  3QPT A;  4ZYH A;  4XLH A;  1UB9 A;  1XGN A;  4GYI A;  1VFC A;  2VKH A;  3N97 A;  1JTY A;  1ZG3 A;  4BDY A;  3U1D A;  4Q47 A;  4ESF A;  4D7N A;  3OL4 A;  1ZAO A;  2Z3Y A;  3RPQ A;  2CW0 F;  4FTH A;  3M1C A;  3L1P A;  1HSJ A;  2OD5 A;  1APL C;  2FUG 2;  4RB2 C;  1F9N A;  2YUS A;  4JX4 A;  4XN0 A;  4XBF A;  2EZH A;  2COM A;  1LUJ B;  3F8C A;  3BOQ A;  3VWB A;  1IN8 A;  4M74 A;  2LY2 A;  2YPR A;  1FOX A;  2IJL A;  5FKL A;  3JRC A;  4KIF A;  2HDD A;  5J1Y A;  2XHK A;  2KMU A;  3GVA A;  3K4B A;  4M3G A;  2CFX A;  2H8R A;  2M45 A;  4E6K G;  2H6C A;  2LMD A;  4IX7 A;  3BQY A;  1TW3 A;  4KDP A;  2DA4 A;  1Z1D A;  2CGP A;  1YOV B;  2L9R A;  2FQ4 A;  2OF7 A;  3BR3 A;  4ENN A;  4CUG A;  1P7I A;  4LJZ F;  4A2U A;  4RB3 C;  3F9K A;  3HKZ N;  2PJR B;  1Z9C A;  3DFG A;  2XAQ A;  1SMY F;  1E3P A;  2CG4 A;  2F4M B;  4D1Q A;  2ME6 A;  5EG0 B;  5BNG A;  3FXM A;  1A36 A;  5DS9 A;  2IAI A;  1PVE A;  1U9O A;  1G4D A;  2WC2 A;  3HEF A;  2K9M A;  3HHH A;  3WGH A;  5JI6 A;  4HNU A;  1W0T A;  3ZMD A;  4Y7N J;  1G3T A;  4BQO A;  4Y15 A;  1HA8 A;  1ETW A;  4KIG A;  3BTI A;  4B09 A;  1BI1 A;  4EQQ A;  2DQL A;  3LSM A;  2VN2 A;  4I7H A;  4PJL A;  4RB1 A;  3I58 A;  2DJI A;  3G73 A;  1H8A C;  1FIA A;  2KRF A;  2R7V A;  1GLN A;  1SD6 A;  3I4P A;  5GTI C;  2ZNY A;  3FK6 A;  2K4J A;  4X1E A;  3JRI A;  2LG4 A;  2N8G A;  2DA5 A;  2XAS A;  1FBU A;  3HSF A;  2HXI A;  4A3M J;  2FA5 A;  3GO5 A;  4KN7 X;  3HPG A;  3P7N A;  3K4N A;  3Q9V A;  4I76 A;  1S5L C;  2RVC A;  1X4P A;  3ZQL A;  4DYC A;  2QUF A;  5L3D A;  1S7O A;  1ACI A;  3DEW A;  3PJR A;  2KIS A;  1RES A;  5BPI A;  1KQ8 A;  3BT9 A;  3LSH A;  3HOW J;  1ZG5 A;  1U8B A;  3OYA A;  4DQ2 A;  2WA0 A;  3LSP A;  4Y52 J;  1W5S A;  2LRD A;  2QYO A;  1B6A A;  3VEP A;  3DU6 A;  1FP2 A;  4DW6 A;  2HPI A;  3O2P E;  3R0A A;  2LKP A;  2A6E F;  2MSY A;  2GA2 A;  2K9L A;  3SDG A;  2AS5 F;  4S0H B;  2VON A;  1QU3 A;  4EGZ A;  1SFE A;  1F36 A;  1SMT A;  5HS8 A;  1YW7 A;  4QWQ A;  1HOM A;  1MD0 A;  1IUF A;  1MBE A;  3QU3 A;  1LVK A;  2V9K A;  2RDP A;  5JHF A;  1S7E A;  3CCV I;  1ZG1 A;  5M5W J;  3L7W A;  1MH3 A;  3CC4 I;  3TMO A;  3WTT C;  1JGS A;  3IWF A;  2GWR A;  2XGD A;  1DP3 A;  4CCK A;  4P96 A;  3HOY J;  2LRE A;  2V79 A;  4M3D A;  3OV8 A;  2DMT A;  2QGU A;  1GXP A;  4MEX F;  3R0J A;  3E5Q A;  2OUM A;  3EYY A;  1Y8R B;  3REO A;  3BG5 A;  4F3Q A;  3QYB A;  3RDI A;  1ONV A;  3DV8 A;  4XRS G;  1OCP A;  4JBA A;  2DA6 A;  2X6Y A;  1XX5 A;  1U6G A;  3CZ6 A;  2FBI A;  3DPL C;  4A3F J;  5J8F A;  2Y31 A;  4IXA A;  4HX4 A;  1V4R A;  3HUG A;  3CJQ B;  2R7R A;  3BLY A;  5LHH A;  5E79 C;  4WXH A;  2XIG A;  1R9T J;  4A3G J;  4A69 C;  1W7P D;  3SZP A;  4P1W A;  1OIS A;  2I8D A;  2OZU A;  4AIH A;  4RBO A;  5LRS A;  3GX4 X;  2W7N A;  5BPD A;  2JQ7 A;  4B44 A;  1RZ4 A;  4J00 A;  4O6J A;  1BN5 A;  2JTV A;  1HXD A;  4BE2 A;  4MFE A;  4CDG A;  4L9J A;  3W2W A;  2XGC A;  4WF2 A;  2OPT A;  2R7D A;  1TQP A;  1U5T A;  5K7F A;  2WWY A;  2R7Z J;  3MZY A;  4DJA A;  4IHW A;  1ZK8 A;  1R1V A;  2QA4 I;  3JTH A;  1QGP A;  2LLK A;  4MFD A;  2L3D A;  1FNN A;  3H3V K;  4MHG A;  1IZ1 A;  1T39 A;  1HBX G;  2IRF G;  1GDT A;  4IHT A;  4RLQ A;  1MND A;  1QZE A;  1YX5 A;  3SFI A;  2QQ8 A;  1I39 A;  1YS6 A;  1AHD P;  3A01 A;  3HBL A;  5ERI A;  4ENJ A;  2VL8 A;  4W97 A;  1WCM J;  3IAS 2;  4PJM A;  1QNT A;  2O5R A;  3OOP A;  3FM3 A;  3ZN1 A;  3M8J A;  2ELJ A;  2NOG A;  3E6D A;  3CDI A;  3DF8 A;  1XGS A;  2CUF A;  2LSO A;  2V9P A;  3MKL A;  4HNV A;  1E2X A;  2VC0 A;  3MKW B;  3E5U A;  4MLO A;  3FIS A;  2EA4 A;  3V8L A;  2YU3 A;  5H2F C;  3A2K A;  1UG2 A;  2P81 A;  3PSI A;  1R1T A;  1SAN A;  2OV7 A;  2Z16 A;  4YEJ A;  1MH4 A;  2NRA C;  1E3H A;  2MBF A;  2CYY A;  3EET A;  4L9T A;  3ZXS A;  1BM9 A;  2WV1 A;  1HDD C;  3QP6 A;  4AM3 A;  2IS1 A;  1D5Y A;  2HI3 A;  2HOT A;  2Y0M A; 
#chains in the Genus database with same CATH homology
 2K86 A;  5DCF A;  4WCG A;  2BE5 F;  2M30 A;  5FFX A;  1MJB A;  2A68 F;  3I59 B;  3PQJ A;  4A0Y A;  3KE2 A;  4S05 A;  3E6M A;  3NEU A;  2ZKZ A;  2DTR A;  4XLN F;  3QAH A;  3HTS B;  2GXB A;  3CO7 C;  3FHZ A;  4MQV A;  3MWM A;  4CXF A;  4N9I A;  3GZ6 A;  3V7C A;  5K5R A;  5ILS A;  4KFC A;  5CLS A;  1MGT A;  3HRT A;  2IPQ X;  1YQA A;  5D4R A;  3JAM K;  2Q2E A;  4ZYD A;  2ZXJ A;  5DUI A;  4YG2 F;  5LRR A;  2G9W A;  4L5I A;  3QU6 A;  1O3Q A;  5L3C A;  2FSW A;  2A6H F;  2GZW A;  3T5X A;  2D2W A;  2YR2 A;  4HLX A;  2W24 A;  5HVQ C;  4R8H A;  2EJR A;  3NQO A;  1ZLK A;  4I0A A;  5DCM A;  2ZBK A;  2GXG A;  2FF4 A;  4KN4 X;  4LMY A;  2XKO A;  2F5C A;  1IXR C;  2E7X A;  1RNL A;  4O3M A;  2ISZ A;  1WKM A;  3GF2 A;  1U5T B;  4Q4Z F;  4AWX B;  4FX4 A;  5CVR A;  1XSX A;  1TTY A;  4AVP A;  4M9S A;  1PP8 F;  1FPQ A;  2W25 A;  1PDN C;  4LFU A;  1Q1H A;  3Q5F A;  3J7A O;  3V7S A;  3VOD A;  3CUO A;  1WRJ A;  1T98 A;  2HEO A;  5ICG A;  2MH2 A;  3BP8 A;  4UNO A;  2FU4 A;  2RGV A;  1OKR A;  3CUQ C;  4YFN F;  1R7J A;  4LLN A;  4EJW A;  1S29 A;  4HQM A;  2RV8 A;  3WE3 A;  4HZF A;  2DK5 A;  1O57 A;  1YFH A;  3F21 A;  3T8R A;  5FD5 A;  2JT1 A;  3R60 A;  3TDZ C;  1V3F A;  2ZJ2 A;  5K1Y A;  2DO7 A;  4U0V A;  4QLC U;  1ODD A;  5ICE A;  1ZGA A;  2QLZ A;  1H9G A;  3EQL F;  2HKO A;  5L3B A;  5L3E A;  3WTW C;  1EH6 A;  4RAY A;  5D5U B;  2RKH A;  1I1S A;  3G3Z A;  4L9N A;  4FT8 A;  3GXO A;  1XGM A;  3C1D A;  5IT9 K;  2EFN A;  2CO5 A;  1O7L A;  5FB2 A;  5L3G A;  1KYW A;  1IXS B;  4L9V A;  5D5W B;  3KP7 A;  3CDH A;  2IA0 A;  3KZZ A;  2D45 A;  4ENM A;  1XMK A;  3GW2 A;  3F72 A;  2D1V A;  3LA3 A;  2R3S A;  5H6Q A;  2OBP A;  3F6V A;  3P9I A;  4EV0 A;  4Y17 A;  1ON2 A;  3L9F A;  3M1E A;  4ESB A;  3W6J B;  1R58 A;  2VT3 A;  2FRH A;  1IW7 F;  4BXU A;  1BIA A;  5HOO A;  5HS9 A;  2ZNZ A;  1TW2 A;  1WWX A;  1DP7 P;  5LHG A;  2UWM A;  1U3E M;  4IVN A;  2O3F A;  1OMI A;  4IRI A;  1W7P A;  3HSR A;  1Z6T A;  3LQR A;  3WGI A;  5DDG A;  1R5H A;  2O6G E;  5H20 A;  4I98 B;  2XVC A;  3C3W A;  2EFW A;  3IKV A;  3S2W A;  1MJ9 A;  2FBK A;  1BIB A;  1KU7 A;  2STT A;  1T0F A;  2XGX A;  1XGO A;  4IRG A;  2UXX A;  5F1R A;  1UHM A;  2C6Y A;  1T2K A;  2A07 F;  1IN4 A;  2XUB A;  3GFL A;  3BZ6 A;  1KQ0 A;  1UFM A;  1MDM B;  1IXC A;  1JHF A;  4LGW A;  2HZT A;  4BAY A;  2R7F A;  2XAJ A;  4PDK A;  1U78 A;  3K0L A;  4LLG F;  1T38 A;  3RIR A;  2OA4 A;  2J5P A;  5LLQ A;  4A5M A;  3RJP A;  2DK8 A;  1D5V A;  1ZHF A;  4HAM A;  2OAZ A;  5CVI A;  5J8C A;  1AOY A;  1O3R A;  1R5G A;  3WU0 A;  2LF8 A;  1F1Z A;  4EVI A;  3MFK A;  1IRF A;  3D0S A;  3RYR A;  1B9M A;  4UUV A;  1R36 A;  1XB4 A;  1Y0U A;  2AXL A;  4M72 A;  2XAH A;  2EV0 A;  3K69 A;  3KP3 A;  3T1B A;  3TOB A;  2UZK A;  1JXS A;  1JHH A;  3FM5 A;  1KA8 A;  2PQ8 A;  1CF7 A;  2QBY A;  3V8K A;  3KET A;  3F8M A;  1L0O C;  1HKQ A;  1P4X A;  3WTU C;  3F8B A;  2V6C A;  1KU9 A;  3FMS A;  3ZMV A;  1EH8 A;  1LEB A;  3HIF A;  3DP7 A;  1IN5 A;  5EEH A;  1FY7 A;  4PZJ A;  4M6X A;  2KIM A;  1R1U A;  2V1U A;  1J7K A;  4YFX F;  5H6R A;  3QPH A;  1W7P B;  2IA1 A;  3ZP5 A;  3F22 A;  2STW A;  3I0T A;  1J5Y A;  2Z9O A;  2QQ9 A;  3D5L A;  1HW2 A;  1FWZ A;  3LFK A;  3GUD A;  3U2R A;  3L09 A;  4BNC A;  4A0X A;  2QQB A;  2MLG A;  5KVR A;  3I59 A;  5KK1 A;  1FYL A;  1YG2 A;  2L4M A;  1PUE E;  1P6R A;  1J2X A;  2A69 F;  3DKW A;  1USS A;  2F5F A;  3ZPL A;  3M7G A;  3FZV A;  3HRS A;  3VOE A;  3LA2 A;  1RUN A;  5HLH A;  3QOP A;  3ZQ7 A;  4Q48 A;  4JQF A;  3BJO A;  4CGZ A;  3KP5 A;  4PCQ A;  4BH9 A;  1SD7 A;  1XCV A;  1T6S A;  3BDD A;  2G7U A;  5FLX K;  4ON0 A;  1R22 A;  4HA8 A;  3JW4 A;  5DUK A;  2EFQ A;  2ZCW A;  5LEK A;  1QBJ A;  4Q5S F;  3CTA A;  1SFU A;  3B73 A;  5E1W A;  2HYG D;  4I09 A;  1I5Z A;  2OQG A;  3KEQ A;  2PN6 A;  2QM3 A;  1OR7 A;  4BHC A;  2P5K A;  1CF7 B;  4RGS A;  2QBY B;  2RC4 A;  3KCC A;  3SQN A;  3ZN0 A;  5LGN A;  3FMQ A;  3N4M A;  4IPA A;  2BYV E;  2ZME A;  2CQK A;  3JAM Z;  4HV6 A;  3BWG A;  4BHB A;  2BBY A;  5LEJ A;  3TO9 A;  5D8L B;  1RUO A;  1U5T C;  3WGG A;  3KP2 A;  1H0M A;  2Z5U A;  1MJA A;  3BJ6 A;  3TDU C;  5HDN A;  4ZYE A;  3JSP A;  4ZYG A;  2L54 A;  2FXA A;  1FYM A;  2V1D A;  2IW5 A;  4KMU X;  2EV6 A;  5JHU A;  4LB6 B;  3VFZ A;  1J59 A;  1GXQ A;  5D6E A;  3TO7 A;  1IF1 A;  4H0E A;  3ELK A;  1YS7 A;  2KIF A;  2HOE A;  4EJV A;  5CVJ A;  1O3S A;  1XSV A;  4LG0 A;  1ZYR F;  4R1H A;  2DBB A;  2JPC A;  4HX7 A;  1H9T A;  2VT2 A;  3HRU A;  5HDG A;  1REP C;  2GA1 A;  5TJJ A;  2K7L A;  4BQA A;  3IC7 A;  2HKX A;  2F5E A;  2ESH A;  2LNB A;  1J9I A;  1W4M A;  5CJ9 A;  5E20 A;  3O3K A;  4XLP F;  3GFM A;  4G7H F;  2FBH A;  2YX4 A;  2EK5 A;  4KA4 A;  1FBS A;  2VE8 A;  5ILV A;  2VC1 A;  4P5O A;  3JSO A;  3V4G A;  4O5V A;  4IRH A;  2YX7 A;  5A2Q K;  3IRR A;  3I71 A;  1TNT A;  4MTD A;  2BV6 A;  4EM1 A;  3HHG A;  2MD5 A;  5JFR A;  1WI9 A;  3HOT A;  5BOX A;  5IT9 Z;  1BI3 A;  4L5J A;  5FD6 A;  2W85 A;  2FEZ A;  1IRG A;  3J80 Z;  5TRD A;  2HQR A;  1SFX A;  2ZME B;  1ZH5 A;  1P4W A;  1RI7 A;  2HFH A;  1K7A A;  2VBW A;  4ESJ A;  1FSE A;  4LLL A;  3FMR A;  2PEX A;  1SD4 A;  5F6F A;  2CWE A;  4F7Z A;  2JZY A;  1LJ9 A;  4HBL A;  2EFP A;  2HDC A;  2DPU A;  2L02 A;  2XAF A;  1VTN C;  1S3J A;  2JPB A;  3K1N A;  5L3F A;  5D8K B;  4WX9 A;  4ZZL A;  4XSX F;  1WQ2 A;  2P5L C;  2ETH A;  2P7C B;  3WG9 A;  2HYF A;  2P4W A;  1P2F A;  4GXO A;  4HLY A;  3TQN A;  2WV0 A;  2PMH A;  4P9F A;  1MDM A;  2QZ8 A;  4P9U A;  1GVJ A;  4G8X A;  4MEY F;  4L0Y B;  1BOA A;  1P4A A;  2HWV A;  2FQ3 A;  1Z6R A;  4M9Z A;  5DYM A;  1HKT A;  5JR3 A;  3L2C A;  4MQ9 F;  4RS8 A;  5CYV A;  2XRO A;  1XSD A;  3QP5 A;  1B59 A;  2BGC A;  3TOA A;  4LG0 B;  3KZY A;  3GYH X;  1XN7 A;  1FP1 D;  2FOK A;  5HLG A;  4BYY A;  2PI0 A;  5HLI A;  2A3S A;  5LHI A;  3EYI A;  2KIU A;  3BRO A;  2FMY A;  2V9V A;  3ZMZ A;  2DLL A;  4HF0 A;  2O61 A;  1YLF A;  1IN6 A;  2DT5 A;  4M9X A;  3J80 K;  2NS0 A;  5JVT A;  4MTE A;  1BJA A;  5DD4 A;  2FNP A;  3NRV A;  1OYW A;  4HV5 A;  2HQN A;  1R23 A;  1XCB A;  3F6O A;  1CGP A;  4G7Z F;  1G3W A;  1KU2 A;  3R6S A;  5D6F A;  4DNC A;  2NNN A;  4G94 A;  3E3V A;  3DXJ F;  5DV5 A;  1D3Y A;  4ZZD A;  3J81 K;  2NAZ A;  2HTS A;  4CO8 A;  5LGU A;  2Q8K A;  3M9A A;  3ZMS A;  3U9G A;  2LF7 A;  3V8J A;  2GQQ A;  4WXD A;  3K2Z A;  5AIP A;  2OQR A;  1LDJ A;  1LDD A;  2EB7 A;  5BMZ A;  1ZGJ A;  2HR3 A;  2K02 A;  2P7V B;  3I54 A;  4P55 A;  3CJN A;  1MZB A;  1OPC A;  1ZRE A;  3PQK A;  3R4K A;  3H3U A;  4TV7 A;  1LQ1 A;  3AAF A;  3V7R A;  2DW4 A;  2TDX A;  3IHU A;  4UV9 A;  4A5N A;  3WOD F;  2E1C A;  3GLX A;  4FX0 A;  2NYX A;  1ZN2 A;  4UVC A;  4U0W A;  2H94 A;  1TNS A;  2PBI A;  3KLN A;  1XDU A;  3PFI A;  4E70 A;  3H3Z A;  3VB2 A;  1G3S A;  4KUM A;  5ED4 A;  4AD9 A;  2J5O A;  3M8E A;  3KFW X;  4RGR A;  4EMS A;  1DUX C;  4L18 B;  4ZH4 F;  4HF2 A;  1LEA A;  1I1G A;  2F2E A;  1W5T A;  5ICF A;  1BI2 A;  2IA2 A;  2MC3 A;  3TGN A;  5D5V B;  2RQP A;  4OU0 A;  4AIK A;  2QWW A;  4XRF A;  3F23 A;  3FXU A;  4KYW A;  4YFK F;  1FT9 A;  4IJA A;  4WK8 F;  1GHC A;  1YO5 C;  1O7F A;  1WSU A;  2EA2 A;  1K79 A;  3ERE D;  2VE9 A;  3RYP A;  5FLX Z;  1QQI A;  1BC8 C;  2RNJ A;  4Z2Y A;  4KT5 C;  4HQE A;  4M6Y A;  5E1Z B;  2Y75 A;  3JTG A;  1A04 A;  3SHF A;  1F4K A;  3BJA A;  1QPM A;  3LST A;  4IF4 A;  4NQW A;  1FYK A;  4D0P A;  1ULY A;  2EV5 A;  4I0B A;  2QQA A;  1IAW A;  3KP6 A;  2HS5 A;  2CSO A;  1J75 A;  2ISY A;  2VBZ A;  3GFI A;  4GGG A;  3E6B A;  1K78 A;  2K27 A;  2ZFW A;  1ZLJ A;  1ON1 A;  2D1H A;  3ROU A;  5AON A;  3P9K A;  2ESN A;  5AIQ A;  3EUH A;  3R61 A;  4FHT A;  3KLO A;  4U7D A;  1QO0 D;  3HSE A;  3RKY A;  1XD7 A;  2W57 A;  4HOB A;  1YIO A;  5D5X B;  2Q0O A;  2K4B A;  3LA7 A;  4BHP A;  2O8X A;  2QVO A;  2MLK A;  1X3U A;  2H09 A;  5E1X A;  4I02 A;  3GFJ A;  2QEN A;  2PMU A;  4GCV A;  1ZAR A;  1R00 A;  2XRN A;  3M8F A;  2NNY A;  3WE2 A;  2A5Y B;  2IVM A;  3L00 A;  5E17 F;  4OIP F;  3KEO A;  3WTY C;  1MKM A;  2JRT A;  4XSZ F;  2H27 A;  1YYV A;  3E5X A;  1NHA A;  2KJC A;  3F3X A;  5IT3 A;  3LAJ A;  4A6E A;  5EEG A;  1DDN A;  1S6L A;  1JE8 A;  2VOO A;  3ECO A;  1G6N A;  2M5W A;  2ADU A;  4G7O F;  4WXC A;  3C7J A;  4OMY A;  1DPR A;  2PLY A;  4CZZ A;  2G7H A;  1FC3 A;  2Y48 A;  4N9H A;  1FLI A;  4EJU A;  4I01 A;  3IL2 A;  3MCZ A;  4YII A;  2ZO4 A;  5A2Q Z;  3KP4 A;  2OZ6 A;  5CVV A;  3HYI A;  3QRF F;  5ILU A;  3FXR A;  2DAO A;  1HKS A;  3ULQ B;  1LB2 A;  2MA3 A;  4R79 A;  3RTR A;  3TO6 A;  2EFO A;  3RKW A;  1ZRC A;  2EWN A;  4LK0 F;  4KIB A;  4HX8 A;  2PJP A;  3GWZ A;  3TKY A;  1LDK B;  4OIO F;  4NHJ A;  5LGT A;  4HW0 A;  2DI3 A;  3EDP A;  1K78 B;  3B02 A;  2M87 A;  4MGR A;  4UVA A;  4UXN A;  1D8K A;  4A6D A;  3MZH A;  1IN7 A;  4S04 A;  1SD5 A;  1KYZ A;  1STZ A;  2VOD A;  1C0W A;  1L3L A;  4WWC A;  2A61 A;  3F8N A;  5ICC A;  2P6S A;  2P5V A;  2PG4 A;  3DPT A;  4U0Y A;  3WTZ A;  1XDS A;  3T8T A;  4OOI A;  2DQR A;  3LAP A;  2VBY A;  3T0Y A;  1EV7 A;  3ABT A;  4I2O A;  2X0L A;  1TQM A;  2DFI A;  2P6T A;  2B0L A;  3ECH A;  1IUY A;  1I27 A;  3CO6 C;  1BBY A;  1XMA A;  5CVU A;  3IRQ A;  4IHS A;  2L01 A;  4CIC A;  2M1B A;  3Q9S A;  1DPU A;  5F64 A;  1HQC A;  5HDK A;  3WU1 B;  2YSR A;  5HS7 A;  1SAX A;  4YIF A;  3DQV C;  2IT0 A;  5E18 F;  4EM2 A;  1FZP B;  1TLH B;  2HGC A;  4RGX A;  4UVB A;  1UST A;  2FML A;  3ML6 A;  2H6B A;  1BC7 C;  4G6D A;  1BI0 A;  4EJO A;  3MAJ A;  2DU9 A;  5K5O A;  2O03 A;  1B4A A;  4RGU A;  4AIJ A;  3RPU A;  1YW9 A;  3FWE A;  2RN7 A;  1Z91 A;  4A12 A;  1LNW A;  2ELH A;  3ZMU A;  4KMF A;  2PFB A;  4LK1 F;  1FSH A;  3MQ0 A;  4A0Z A;  3CLO A;  2X4H A;  3J81 Z;  1Z05 A;  1FX7 A;  1KQ9 A;  3W6K B;  3BY6 A;  2P8T A;  4M71 A;  5FGM A;  3ZMT A;  1U2W A;  1Z7U A;  1ZRD A;  1U8R A;  4HF1 A;  3BPX A;  4EM0 B;  2E7W A;  3SXY A;  3I64 A;  3HOS A;  3K1P A;  5DEQ A;  1RIO H;  1O3T A;  4M73 A;  2GIV A;  1FOK A;  6PAX A;  2JSC A;  4OIN F;  1YW8 A;  4HDV A;  4OIR F;  4OIQ F;  4B8X A;  3ABU A;  2W84 A;  2F5D A;  4UV8 A;  1QZZ A;  4RB0 A;  1OYI A;  4U7B A;  1TBX A;  3CUQ A;  1HW1 A;  3HRM A;  4L0Z B;  2IP2 A;  2O0Y A;  4EJT A;  4LB5 A;  2VXZ A;  4PGG A;  1UCR A;  1PP7 U;  1F5T A;  4HYE A;  2L4A A;  3WTS C;  3SFZ A;  5BS6 A;  1K6O A;  4G9Y A;  2VOP A;  1TQI A;  5K5Q A;  3FX3 A;  1I6X A;  5DD8 A;  2KKO A;  2FNA A;  3RKX A;  3WTV C;  4CYD A;  2KJB A;  5E8I A;  4EGY A;  5D4S A;  3H92 A;  1FBQ A;  2MH9 A;  3GEZ A;  1QZY A;  4ETS A;  4U88 A;  1E17 A;  2BEO A;  1LVA A;  4CHU A;  1KU3 A;  1ZRF A;  2GAU A;  1G3Y A;  3I5U A;  2FE3 A;  1UHW A;  2Z99 A;  4HDU A;  4ENK A;  3WTX C;  3K1M A;  1B1B A;  3SZT A;  4JK1 X;  5DCM B;  2ACJ A;  2E1N A;  4KNY A;  3COA C;  2Z33 A;  1AWC A;  5LBQ A;  3DEU A;  1OYY A;  2VBX A;  1P92 A;  2OU2 A;  1YTY A;  4MNU A;  4GO1 A;  2HTJ A;  2XKP A;  1S8N A;  1HW5 A;  2XV4 S;  2DPD A;  4GYG A;  2XAG A;  3I53 A;  4PGH A;  4KIC A;  5E8G A;  2WTE A;  3IWZ A;  5J6X A;  3K9T A;  1S7A A;  4G6Q A;  1HST A;  4N0B A;  3F8F A;  1KGS A;  2UXN A;  2M8E A;  2LDU A;  4K2E A;  3CUQ B;  3O6B B;  3IKT A;  3LWF A;  4UHT A;  3C18 A;  4NB5 A;  3ISP A;  3FXQ A;  1EH7 A;  3LQQ A;  3HTU A;  5FO5 A;  3GZ5 A;  4Y13 A;  3E97 A;  3FF5 A;  4RAZ A;  3E6C C;  4LD5 A;  4OMZ A;  5BQT A;  2V1X A;  5FFZ A;  1J0R A;  1B9N A;  4ASN A;  1D8J A;  3MEX A;  3RI4 A;  3P9C A;  3BPV A;  3QPT A;  4ZYH A;  1UB9 A;  1XGN A;  4GYI A;  3N97 A;  1ZG3 A;  3U1D A;  4Q47 A;  4ESF A;  1ZAO A;  2Z3Y A;  3RPQ A;  2CW0 F;  1HSJ A;  2OD5 A;  4RB2 C;  1F9N A;  4XBF A;  2COM A;  3F8C A;  3BOQ A;  1IN8 A;  4M74 A;  2YPR A;  2IJL A;  4KIF A;  2XHK A;  3GVA A;  2CFX A;  2M45 A;  2H6C A;  1TW3 A;  4KDP A;  1Z1D A;  2CGP A;  4ENN A;  4A2U A;  4LJZ F;  4RB3 C;  1Z9C A;  3DFG A;  2XAQ A;  1SMY F;  2CG4 A;  1G4D A;  2WC2 A;  3HHH A;  3WGH A;  5JI6 A;  3ZMD A;  1G3T A;  4Y15 A;  4KIG A;  4B09 A;  1BI1 A;  4EQQ A;  2DQL A;  2VN2 A;  4I7H A;  4RB1 A;  3I58 A;  3G73 A;  2KRF A;  1SD6 A;  3I4P A;  2ZNY A;  2K4J A;  2XAS A;  1FBU A;  3HSF A;  2FA5 A;  3GO5 A;  4KN7 X;  3P7N A;  3Q9V A;  2RVC A;  2QUF A;  5L3D A;  1S7O A;  5BPI A;  1KQ8 A;  1ZG5 A;  4DQ2 A;  1W5S A;  2QYO A;  1B6A A;  3VEP A;  1FP2 A;  3O2P E;  3R0A A;  2LKP A;  2A6E F;  2GA2 A;  2AS5 F;  2VON A;  4EGZ A;  1SFE A;  1SMT A;  5HS8 A;  1YW7 A;  4QWQ A;  1MD0 A;  3QU3 A;  2RDP A;  1ZG1 A;  3L7W A;  3WTT C;  1JGS A;  3IWF A;  2GWR A;  4P96 A;  2V79 A;  3OV8 A;  1GXP A;  4MEX F;  3R0J A;  3E5Q A;  3EYY A;  3REO A;  3RDI A;  1ONV A;  3DV8 A;  4JBA A;  1U6G A;  2FBI A;  3DPL C;  5J8F A;  4IXA A;  4HX4 A;  1V4R A;  3HUG A;  5LHH A;  4WXH A;  2XIG A;  1W7P D;  3SZP A;  2OZU A;  4AIH A;  5BPD A;  5LRS A;  3GX4 X;  1RZ4 A;  4O6J A;  1BN5 A;  2JTV A;  1HXD A;  4CDG A;  4L9J A;  4WF2 A;  2R7D A;  1TQP A;  1U5T A;  2WWY A;  3MZY A;  1R1V A;  3JTH A;  1QGP A;  2L3D A;  1FNN A;  4MHG A;  1IZ1 A;  1T39 A;  1HBX G;  2IRF G;  4IHT A;  1YS6 A;  5ERI A;  4ENJ A;  1QNT A;  3OOP A;  3FM3 A;  3ZN1 A;  3E6D A;  3DF8 A;  1XGS A;  2LSO A;  1E2X A;  2VC0 A;  3E5U A;  2EA4 A;  3V8L A;  2YU3 A;  1R1T A;  2NRA C;  2MBF A;  2CYY A;  3EET A;  4L9T A;  1BM9 A;  3QP6 A;  2Y0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...