4M71A

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 120
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m71A01
1GHCA 4LMYA 3EQLF 1IN6A 1YO5C 2ZCWA 5ICFA 2DAOA 1H9GA 3WTYC 1ZN2A 4YIIA 1RUOA 5DUIA 3F3XA 4M9XA 3MZHA 3DEUA 3LA7A 2BBYA 3H92A 4Q4ZF 2M45A 3SZTA 2GZWA 2PN6A 4MQVA 3ZMTA 3QP6A 1AOYA 2CYYA 1G3TA 1XSVA 5D5XB 2EJRA 2KIFA 3PFIA 3E6CC 1QGPA 3KZYA 3GFMA 4M72A 5AIPA 4I02A 3GF2A 5FFZA 4EJOA 3GUDA 3ECHA 3WTZA 5E20A 3I58A 2IA1A 4BHCA 1V4RA 1HQCA 1E2XA 3M8EA 5K1YA 4KT5C 5JR3A 1K79A 4HW0A 4E70A 4M71A 2A6HF 4NQWA 3WGIA 1PUEE 3T8TA 5E1XA 2PMHA 4FT8A 4Q48A 1G3YA 5HDGA 2G9WA 3BJ6A 2LF8A 2OZUA 1ZGJA 5HLGA 4UNOA 1TW2A 4CXFA 3R0JA 5HOOA 2P7CB 2H94A 2E7WA 3KETA 2GA2A 4G9YA 3QOPA 1ULYA 1K6OA 2HQNA 4LD5A 2KRFA 4MHGA 2YU3A 2VBYA 3ZQ7A 4WXHA 4DNCA 5DV5A 2FXAA 2MA3A 3RKYA 2DBBA 2ELHA 3TO6A 2NNNA 1RIOH 3FMQA 3E5QA 3LWFA 5LHHA 2HYFA 1VTNC 2JPCA 4Y13A 1P6RA 5AONA 1ZRDA 4IHTA 2XGXA 4HYEA 1FYKA 3J81Z 2HTSA 2W24A 1BM9A 1IF1A 5DD8A 2HGCA 3SHFA 3WG9A 1R58A 2KIUA 2R7DA 4LLLA 2QENA 4CHUA 2DPDA 4ZYEA 3O2PE 3LA2A 1Z1DA 1R5GA 1U5TB 2DFIA 1ZREA 4MTEA 1TBXA 5LRSA 2FNAA 4P9FA 1IXCA 2GWRA 1SD6A 2K86A 4XSZF 1B6AA 1BBYA 2QM3A 3TDZC 1T6SA 1J0RA 5E1ZB 1KU3A 5DCMA 3CO7C 1O57A 2P6TA 3QU6A 3OV8A 5LBQA 4S05A 1ZG3A 4HX7A 2KKOA 3HRTA 2LNBA 5DDGA 5AIQA 1EH6A 1XD7A 1IN8A 3K9TA 1S8NA 1HSTA 3MZYA 4G6DA 2M87A 2C6YA 2IVMA 3R4KA 2VBXA 4EJUA 4G8XA 3RKXA 4ASNA 4EQQA 2ZNZA 3K2ZA 4UXNA 2A69F 4BNCA 5ILUA 2KIMA 3WE2A 1U5TC 3ZMZA 5BOXA 3RTRA 3RJPA 1U8RA 3V4GA 1EH7A 3GYHX 2HKOA 2YX4A 5E17F 3WU1B 4L5JA 3ERED 1OYWA 3F8CA 4KDPA 1G3SA 4OIOF 1TTYA 4WCGA 2STTA 1UB9A 3EYIA 2W84A 5DYMA 2K7LA 2NAZA 2OA4A 2PQ8A 2FNPA 3I71A 1HKQA 2L4MA 3IL2A 1ZLJA 2Y75A 5CVVA 1SMTA 4CYDA 3O6BB 4MEYF 1OPCA 5F6FA 1HBXG 3E5UA 4HOBA 3KEOA 3F21A 2ZBKA 3K69A 3KP5A 4RB2C 2X4HA 1J59A 3P9CA 4WWCA 4LB5A 4Q47A 2V1UA 1I1GA 2P7VB 1BC8C 3CUOA 4LG0A 4AD9A 2MD5A 1ZGAA 2FQ3A 2HOEA 1IN7A 5ILVA 3KP4A 4HF0A 1R22A 4Z2YA 2CSOA 2A5YB 3W6KB 2FA5A 1MJ9A 1J75A 3GO5A 1D8JA 3BJAA 5KVRA 3QPHA 3EETA 1QZZA 2QBYB 1CF7B 4OIRF 1MZBA 1IN5A 3MQ0A 2QYOA 4I0AA 5ILSA 2XAGA 3SFZA 2HTJA 2HZTA 4HBLA 1ZLKA 2VC0A 4YG2F 4WXCA 2PFBA 1LVAA 3JAMZ 5EEGA 2K02A 3RIRA 1B9MA 3TDUC 1O7FA 4A5MA 1U3EM 1XCVA 1L0OC 3D0SA 3HIFA 4UHTA 1HW2A 3V7RA 1D5VA 4M74A 1KGSA 4EM2A 2CFXA 3RYRA 2DQRA 5ICEA 1FY7A 2VC1A 1W4MA 4RAYA 5BS6A 2EV5A 4R79A 3WGGA 3KLOA 3FWEA 2EFPA 1RZ4A 5L3GA 2JZYA 4A12A 1EV7A 1FYLA 5CJ9A 4HV5A 1WKMA 2MLGA 1MGTA 1SD5A 3C7JA 3GFIA 1UFMA 3T1BA 1LB2A 2HR3A 4HX4A 1MKMA 3IKVA 1TNSA 4JBAA 1P4WA 4A2UA 2BEOA 3F72A 5J8CA 5IT9Z 1R5HA 5TJJA 2YX7A 5E8IA 4EGZA 1LEBA 3T0YA 3G3ZA 4L5IA 3ZP5A 4GCVA 1KYZA 3U9GA 3SQNA 2LDUA 1QPMA 3HOTA 4U7BA 4G7ZF 3VOEA 5FD6A 2ACJA 1ON2A 1LDJA 2MC3A 1YW8A 4A6DA 4RS8A 4EJTA 4N9IA 3WGHA 1F1ZA 2OU2A 4HLYA 2O8XA 2CG4A 4L18B 1CGPA 3P9IA 1FLIA 3ULQB 2L3DA 4M9ZA 1DPUA 5F64A 2CWEA 2FU4A 3GXOA 4HQEA 4UV8A 3KEQA 2P5KA 1ZYRF 2P5LC 1WI9A 4FX0A 4ZZLA 3V8JA 4WK8F 2HKXA 4IXAA 1PP7U 4XSXF 1FC3A 3E5XA 4GXOA 1ODDA 1WRJA 1YS7A 1QBJA 1DPRA 2EWNA 4HQMA 4ON0A 1FWZA 3GFLA 2STWA 4MNUA 4ESBA 5D4RA 2H27A 3NRVA 4ESJA 3H3UA 2ZNYA 3TO9A 5HS7A 1OYIA 3IWZA 1F4KA 1HW5A 4RGRA 1R1UA 1DDNA 1IXSB 3TO7A 2RC4A 4UVAA 3E6BA 1FP1D 1PP8F 3M1EA 2F2EA 2FEZA 1YQAA 4L9VA 2Q8KA 4P55A 1FBSA 1YS6A 5D6EA 1XN7A 3KZZA 3QU3A 1O3TA 2MLKA 2XASA 1MJBA 3F23A 4OMYA 4I7HA 2V79A 1BI2A 3I53A 4ENMA 1ZG1A 3GWZA 2YPRA 3M7GA 3IWFA 5L3BA 3GEZA 5FLXK 3U2RA 3RKWA 3MWMA 5FD5A 1XGOA 2L4AA 1FPQA 3ELKA 4LFUA 1BI3A 1SMYF 4KN4X 5J6XA 2IJLA 3L2CA 2XAHA 5F1RA 3PQKA 2ESNA 2PJPA 4XLPF 2E1CA 3QAHA 3BY6A 2EV6A 3CUQA 5D5WB 3KE2A 3ZMSA 2P4WA 2V1XA 1BI0A 3WTUC 2Z33A 4M6XA 3CDHA 2M30A 4RGSA 5L3CA 4PCQA 2H09A 4WXDA 2GA1A 2DLLA 4MGRA 5L3EA 1L3LA 4AIHA 1QNTA 2AS5F 4OMZA 3TGNA 1HKSA 1YIOA 4BQAA 4P96A 3IC7A 1DUXC 1STZA 2CW0F 1FT9A 3CTAA 3R0AA 5IT3A 5FFXA 1GVJA 4M73A 2JPBA 3GX4X 4K2EA 5BPIA 3DFGA 3QPTA 2NS0A 2Q0OA 4BHBA 3BROA 4KMUX 1YYVA 2EFOA 1I1SA 4OIPF 5FO5A 4BAYA 3R60A 1D3YA 1Z91A 4S04A 3F22A 2XIGA 1XGSA 4LLNA 4UVBA 2NYXA 3REOA 1OMIA 2EFWA 3BPXA 2RKHA 1U6GA 1J5YA 2WTEA 3DPTA 5DCFA 1GXQA 1C0WA 5ICCA 4GO1A 2VBZA 1B1BA 2PMUA 5FLXZ 1R23A 3C3WA 3JSPA 3P9KA 3DPLC 2K4BA 1Z9CA 3V8KA 2L02A 1K7AA 4BHPA 4ZYHA 5ICGA 1GXPA 2MH2A 4HAMA 2EA4A 2EFQA 1YFHA 1XMAA 3M9AA 3EYYA 2QQ9A 4I09A 2W57A 3M8FA 4N9HA 1W7PB 3JSOA 2XV4S 1OKRA 3B73A 4KIBA 4FHTA 2QUFA 3KP3A 4MEXF 4ZYDA 1IN4A 4D0PA 3BZ6A 1IUYA 1XGMA 2O6GE 1MDMB 1RI7A 4ESFA 2LF7A 2RN7A 2OAZA 1XSDA 5LHIA 3EDPA 4LJZF 4OIQF 1BN5A 5JVTA 1J7KA 1QO0D 2UXNA 1BIAA 4A6EA 4RB3C 4IPAA 2PEXA 3L7WA 2Y48A 3FXUA 2FMYA 2DO7A 3I5UA 2PLYA 5LGTA 4BXUA 4I01A 3E6DA 3ABTA 2GQQA 3IHUA 2ZMEB 4OOIA 5BPDA 1XSXA 2B0LA 3F8FA 3KP6A 2FSWA 3VODA 2ADUA 4YFXF 2EV0A 2JT1A 1KU9A 2W85A 4EGYA 1J9IA 2WWYA 2D45A 1YW7A 4KFCA 3MAJA 1LQ1A 2DW4A 4YFKF 3HTSB 1TQIA 4HF1A 1IRGA 4UVCA 3Q9SA 2VE9A 2NRAC 4H0EA 1WSUA 5JFRA 2FF4A 2FRHA 5CYVA 2R7FA 2XUBA 3GVAA 3KCCA 1JGSA 5A2QK 3K1MA 1K78B 2VOOA 2YR2A 3HTUA 3I64A 5CVIA 1ZRFA 1H9TA 5TRDA 1Z05A 2LKPA 4MQ9F 2OQGA 5KK1A 4KICA 2XKOA 4LGWA 1YG2A 2VT2A 4U0WA 3FM3A 5FB2A 1ZAOA 3FHZA 4LLGF 3ZPLA 5BMZA 3MCZA 3JAMK 2P8TA 1FSHA 1MD0A 1S7AA 3ZN0A 5K5OA 5IT9K 3I59B 5D5VB 2J5OA 2BV6A 3FZVA 3WTXC 2FBIA 1AWCA 2DT5A 1JHFA 4U7DA 1USTA 4BYYA 1NHAA 5E18F 1XB4A 3ZMVA 5JI6A 1JHHA 1IXRC 2BGCA 3NQOA 3IKTA 1BJAA 4AIJA 4G7HF 5HS8A 1P2FA 1W7PD 4HZFA 4IRGA 1RUNA 4HDUA 3U1DA 1G6NA 4KUMA 4IRIA 5JHUA 3IRQA 2IPQX 3BJOA 3F8BA 3MEXA 3TKYA 2F5EA 3FF5A 3LQQA 3JTGA 2F5FA 5CVUA 1FX7A 5HDNA 2ISZA 1U78A 1HXDA 1B9NA 4KMFA 4CDGA 1T2KA 1FNNA 2Z99A 2QWWA 2W25A 3JW4A 1ZG5A 2YSRA 1I27A 4M9SA 1YTYA 3DXJF 3HRMA 4NHJA 4A0XA 1FP2A 2V9VA 5HLHA 3WTSC 3J81K 2KJCA 2E7XA 2IP2A 2PG4A 3VB2A 5HLIA 4ENJA 5D5UB 3FMRA 3SZPA 4L0YB 4A5NA 4EJWA 4HV6A 3HOSA 3I4PA 3BDDA 3F6VA 4P9UA 2O3FA 1F9NA 4F7ZA 1U2WA 4G94A 5E8GA 2D2WA 5D8LB 2EA2A 1WWXA 2G7HA 4A0YA 3BWGA 4NB5A 4GGGA 2FOKA 3HRSA 1TNTA 4IRHA 2P6SA 5LEJA 2RQPA 4U88A 3WTVC 4Y15A 2A68F 4LK0F 5D4SA 3I54A 4I98B 4RAZA 1FOKA 3N97A 4HX8A 2ETHA 4EM1A 3HSRA 4R1HA 5A2QZ 2JSCA 2KJBA 1G3WA 2ZKZA 2VBWA 1SFUA 3LAPA 1Z7UA 2ZJ2A 4PGHA 4JQFA 4YFNF 1TLHB 4XBFA 2IA2A 4G6QA 3I0TA 5LLQA 2QLZA 4KIGA 1P92A 3HUGA 1BIBA 2XAJA 4CGZA 3ZMUA 5LEKA 1LDDA 2ZMEA 3FM5A 3WE3A 1UHMA 4KNYA 3VEPA 2BE5F 1YLFA 5K5RA 3L9FA 3CJNA 1O3QA 1S3JA 4AWXB 2DTRA 1HKTA 2IA0A 3QP5A 1K78A 3KLNA 1S7OA 1ZHFA 4I2OA 5HDKA 3ISPA 4U0YA 1REPC 2CGPA 1KQ8A 2XRNA 5LGNA 3W6JB 3ABUA 5ED4A 2EFNA 4XLNF 1JE8A 5ERIA 3DP7A 2RNJA 5DUKA 2FE3A 5H20A 3GW2A 2DPUA 2UXXA 1I6XA 3L00A 2NNYA 2QQBA 1T38A 4BH9A 3J80Z 3ECOA 4L9JA 2TDXA 1H0MA 3MFKA 1G4DA 4ZH4F 3HYIA 3DQVC 2COMA 1USSA 3BOQA 5HS9A 3H3ZA 2IW5A 3RPQA 5FGMA 3K1NA 4L9TA 4O3MA 3NEUA 3K0LA 3QRFF 3DKWA 3Q5FA 2P5VA 3P7NA 2Y0MA 1FZPB 2MH9A 1XDSA 4PZJA 1XMKA 5LRRA 2GAUA 1A04A 1FSEA 2CO5A 3EUHA 2Z9OA 1IAWA 2OZ6A 1V3FA 4N0BA 3R61A 2XAFA 2R3SA 2OBPA 1KYWA 2A6EF 3HRUA 4WF2A 1HW1A 3D5LA 5CLSA 4LG0B 4KN7X 2X0LA 1ONVA 4O6JA 2H6CA 4RB0A 2RDPA 2ZXJA 2QZ8A 3TQNA 4PGGA 2M5WA 5CVRA 3COAC 2DU9A 1X3UA 1MJAA 2WV0A 4RB1A 2O03A 1QQIA 1T39A 4QWQA 3KFWX 1FYMA 2L54A 4ENNA 2HYGD 4ZZDA 2CQKA 2GIVA 3HHGA 1TQPA 4EMSA 1R00A 2VOPA 2DI3A 2D1HA 2GXBA 2ISYA 2VXZA 5EEHA 1IZ1A 4IF4A 3GZ5A 3O3KA 4EVIA 2VONA 2HS5A 3OOPA 3V7SA 2VN2A 1ON1A 2RV8A 5LGUA 3RDIA 4HDVA 4KYWA 4HLXA 2ESHA 1LDKB 2OQRA 1B59A 3C1DA 4O5VA 3BP8A 2HQRA 3LAJA 4M6YA 4YIFA 1SFXA 3HHHA 3FXRA 2VODA 2FBHA 1T0FA 4ETSA 2WC2A 1DP7P 1JXSA 4ENKA 5BQTA 3J80K 4IJAA 4UV9A 4KIFA 1SD7A 3JTHA 2D1VA 4QLCU 1W5TA 1HSJA 3ML6A 2L01A 4AVPA 3E3VA 2F5CA 2VE8A 3ROUA 4XRFA 1O3SA 1SD4A 2JRTA 4UUVA 2DQLA 4IVNA 1ZARA 3Q9VA 2H6BA 1WQ2A 5K5QA 2JTVA 4RGUA 3LSTA 1XGNA 1ZRCA 1D8KA 1QZYA 2MBFA 2RVCA 4Y17A 2V1DA 3V7CA 1FBQA 1W5SA 4LK1F 2HWVA 1BOAA 2ZO4A 2IT0A 2DK8A 2GXGA 5J8FA 1OR7A 2HEOA 1R36A 4OINF 3RI4A 3T5XA 2V6CA 3T8RA 3F8MA 1Q1HA 1KU2A 1PDNC 3TOAA 4RGXA 4HF2A 3K1PA 1R1TA 3WTWC 3PQJA 1ZH5A 3KP2A 1P4XA 2EB7A 1TQMA 2BYVE 3GFJA 4DQ2A 4EM0B 2O0YA 3V8LA 2Z3YA 3E6MA 2RGVA 1YW9A 1EH8A 2A61A 1LEAA 5LHGA 4HA8A 2A3SA 2ZFWA 1T98A 1Y0UA 1Z6RA 3CUQC 4IHSA 4B09A 4B8XA 3GLXA 2EK5A 4KA4A 1O7LA 2M8EA 4CICA 3S2WA 1LJ9A 3LA3A 1SAXA 1XDUA 5DD4A 1KU7A 4GYGA 3FXQA 2Z5UA 1Z6TA 4Q5SF 2VT3A 1LNWA 3WTTC 5DEQA 1OYYA 2AXLA 2OD5A 3CLOA 4FX4A 3RPUA 3RYPA 4R8HA 2FBKA 2FMLA 1W7PA 2QBYA 3L09A 2PI0A 3FX3A 1S29A 1KA8A 4TV7A 3KP7A 5D8KB 1S6LA 1E17A 3CUQB 3R6SA 1KQ0A 3WU0A 1F5TA 3VFZA 4MTDA 2XHKA 4L0ZB 2HDCA 3N4MA 1MDMA 4CO8A 5H6RA 4CZZA 1BC7C 2PBIA 5D6FA 3GZ6A 2QVOA 4A0ZA 5CVJA 1KQ9A 2O61A 3HSFA 5HVQC 3ZMDA 5H6QA 4OU0A 3F8NA 2Q2EA 2XKPA 3LQRA 1XCBA 2F5DA 4GYIA 1O3RA 3FMSA 3AAFA 1IRFA 3WODF 5DCMB 1IW7F 4G7OF 3BPVA 1U5TA 4WX9A 1B4AA 4L9NA 6PAXA 4AIKA 1R1VA 2K4JA 3F6OA 1SFEA 2UZKA 3LFKA 3G73A 1TW3A 3B02A 1CF7A 2IRFG 2DK5A 2HFHA 3SXYA 4EV0A 5E1WA 2QQAA 2UWMA 4LB6B 1J2XA 3CO6C 1RNLA 2LSOA 4U0VA 1BI1A 3IRRA 3HSEA 4PDKA 4ZYGA 4P5OA 2E1NA 4EJVA 1I5ZA 4JK1X 3DF8A 2XVCA 4I0BA 2A07F 5L3FA 3E97A 2M1BA 2G7UA 2K27A 1R7JA 3DV8A 1P4AA 2XROA 1UHWA 1UCRA 3TOBA 2XAQA 5L3DA 3ZN1A 2J5PA 3I59A 3C18A 1FBUA 3J7AO
chains in the Genus database with same CATH superfamily
2LY1A 4CCLA 3W2WA 1GHCA 4LMYA 2V9KA 3EQLF 1IN6A 1YO5C 2ZCWA 1ENHA 3OOUA 2M4KA 4AUXA 5ICFA 2VJ5A 2DAOA 4XMYA 1H9GA 3WTYC 1ZN2A 4E7SA 4YIIA 5HLTA 1RUOA 5DUIA 2DMPA 1FIAA 3F3XA 4M9XA 5DM6F 3MZHA 1ETYA 2E1OA 3DEUA 3LA7A 1YJNI 2BBYA 3H92A 1B72B 4PK4A 4D7MA 1DU6A 2MFZA 2R4GA 3OS0A 2OC6A 4Q4ZF 1FJLA 2M45A 3SZTA 1QHHD 2GZWA 1PVEA 2R92J 2VI6A 2PN6A 1D5VA 2XPUA 4MQVA 3S17J 3ZMTA 3DWLE 3QP6A 1AOYA 2YS9A 2CYYA 2VQHA 2Y0SA 1G3TA 1XSVA 5D5XB 4FCYA 4OAYA 2EH3A 1UELB 4XQFA 2EJRA 2KIFA 5B1BH 1SFKA 3PFIA 3E6CC 1QGPA 3KZYA 3GFMA 4M72A 2K9MA 4W97A 3BG7A 5AIPA 4I02A 3GF2A 5FFZA 4EJOA 5LD2C 3GUDA 4ZTFA 3ECHA 2LH9A 3WTZA 2MSYA 1X1PA 5E20A 3I58A 2IA1A 2DMUA 4BHCA 1V4RA 3JRFA 3U21A 1HQCA 2XPVA 1E2XA 1MMDA 3BR2A 4RBOA 3LSRA 1RC9A 3HUGB 2WB1N 3KYDB 3M8EA 3ONQA 4RA2A 5K1YA 1X1BA 4KT5C 5JR3A 2BHYA 1K79A 4HW0A 4E70A 1GT0C 4CH7A 3QPSA 4M71A 5DS9A 2A6HF 4NQWA 3A0BC 4BACA 4XLEA 3WGIA 3RZOJ 2WY7Q 4FASD 3PO3J 1PUEE 3A03A 3T8TA 5E1XA 2R7ZJ 2F4OB 2PMHA 2XSJC 4FT8A 1G3YA 4Q48A 1MNEA 2LYCA 5HDGA 2G9WA 3BJ6A 2LF8A 2OZUA 2ZMEC 1ZGJA 2F5VA 5HLGA 4UNOA 3C2GA 2IGNA 2HXIA 1TW2A 4CXFA 1A36A 3CDIA 3R0JA 5KAIC 5HOOA 2P7CB 3PNVA 3W3CA 1CQTA 2H94A 2E7WA 1DGRM 3KETA 2GA2A 4G9YA 3QOPA 4CA0A 1ULYA 1N25A 3ZQCA 1JKQC 1K6OA 2DA2A 2HQNA 5F08A 1UZCA 4LD5A 3A4CA 2KRFA 4MHGA 4MLOA 2D5VA 1MH4A 2YU3A 2VBYA 3ZQ7A 4WXHA 4DNCA 3I55I 4RAFA 4J00A 5DV5A 2FXAA 2ZXWH 3J7AY 2MA3A 3RKYA 4OWRB 2DBBA 3AL0C 2ELHA 3UR3C 1V5EA 3TO6A 2NNNA 1RIOH 3NWTA 3FMQA 3E5QA 2EZIA 3DPUA 3LWFA 1J09A 4N4NB 5LHHA 2HYFA 3NWSA 4FE4A 1VTNC 2JPCA 2K3FA 1YI2I 1W36D 2BZTA 4Y13A 4IX7A 1P6RA 4QIWN 2ZSHB 5AONA 2H8WA 1RKWA 1ZRDA 4IHTA 1FOXA 2XGXA 2DOAA 4HYEA 1FYKA 5F1JA 3J81Z 2VL8A 4Y3OA 2HTSA 2W24A 1TT0A 4IOCF 1BM9A 1IF1A 1PYVA 5DD8A 2HGCA 4NUBA 1GVDA 3SHFA 3WG9A 3CCMI 1R58A 2JSPA 2KIUA 3QQAA 2MYSA 3RPUD 2R7DA 3CQZJ 3CDLA 4YEJA 4LLLA 2QENA 3IH2A 1PJRA 4CHUA 2DPDA 2V9PA 1R71A 2CUFA 4D5CA 4ZYEA 1GLNA 3DLAA 3O2PE 3LA2A 2LC2A 1Z1DA 1R5GA 1U5TB 2DFIA 5IP9J 5EZGA 4A3FJ 5E3MA 1ZREA 3DLLF 1Y39A 2IXSA 4MTEA 1TBXA 3LMMA 5LRSA 3AG3H 4B43A 1FIPA 2FNAA 4P9FA 2BY2A 4A3MJ 4D5FA 3A1YA 1IXCA 2GWRA 1SD6A 3OYLA 3S1QJ 2K86A 4XSZF 2IBDA 1B6AA 1BBYA 2QM3A 3TDZC 1MIJA 1T6SA 3CCYA 1J0RA 2FUG2 4BY7J 5E1ZB 1U9NA 3IP4B 3RSNA 1AA7A 5FKKA 1KU3A 5DCMA 3CO7C 1X1AA 2IGKA 1LUJB 1O57A 1MBGA 2P6TA 3QU6A 4M6VA 3OV8A 3FXJA 5LBQA 4S05A 1ZG3A 4BL0B 4HX7A 2O9LA 2KKOA 5LFAA 4DYQA 3HRTA 2LNBA 2X6XA 5J1UA 4NQWB 5DDGA 1NG6A 5AIQA 1EH6A 1MSEC 3HC7A 1MBKA 1XD7A 1IN8A 3K9TA 1S8NA 1HSTA 3MZYA 4G6DA 2R7WA 2M87A 5GAHJ 2C6YA 2IVMA 3OYIA 4E7IA 2LOOA 3R4KA 2VBXA 4EJUA 4G8XA 3RKXA 4ASNA 4EQQA 4KISA 2EINH 2ZNZA 3K2ZA 2XF7A 3ABLH 4UXNA 1POGA 2A69F 4BNCA 5ILUA 2KIMA 3WE2A 4MFEA 2V7FA 1U5TC 3JRGA 3ZMZA 2L5QA 5BOXA 3RTRA 4XKWA 4IHWA 2X6OA 3QWLA 2CQNA 3RJPA 5FKNA 1U8RA 3V4GA 1EH7A 2LY2A 3GYHX 3TW6A 5EGOA 2HKOA 2WAEA 2JA2A 2YX4A 5E17F 3GTMJ 3WU1B 2Z1DA 2LBFB 4XIDA 4L5JA 3ERED 1MH3A 2V1NA 2WADA 1OYWA 3F8CA 1ZKGA 4KDPA 4CCKA 3OYMA 1G3SA 3C2BA 4OIOF 2CW7A 1TTYA 3EUKL 4WCGA 2STTA 1UB9A 3EYIA 2VB6A 4RLFA 2W84A 2R7XA 3E7LA 5DYMA 2K7LA 2NAZA 3CCSI 2OA4A 3GTQJ 2PQ8A 2FNPA 1QVTA 2JVGA 3I71A 1HKQA 2K3PA 1H88C 1QPIA 2L4MA 3IL2A 1ZLJA 4UUSB 5E79C 2Y75A 1S5LC 3BQZA 2N8GA 2HOSA 5CVVA 1SMTA 3OYEA 4CYDA 4D7NA 3O6BB 2HOTA 4HNVA 4A3GJ 1X19A 4MEYF 1OPCA 1YRNB 5F6FA 1HBXG 2UV1A 3E5UA 4HOBA 1SVOA 2DOFA 3KEOA 3F21A 2ZBKA 3K69A 1I6HJ 3KP5A 2M0MA 2X4HA 3KX2A 4RB2C 1J59A 1SFOJ 3OIPA 3P9CA 2I8DA 1MMGA 4WWCA 1WJAA 4LB5A 1DQUA 4ZDLA 3AG1H 3S15J 1DU0A 1MBEA 2RNGA 2E5NA 3GZNB 4B3XA 3HDDA 4Q47A 3JRIA 3BT9A 2V1UA 1R9TJ 1I1GA 1AU7A 2P7VB 1BC8C 3CUOA 4LG0A 1VQ7I 4M3EA 4F93B 3L2UA 4AD9A 3FXKA 2MD5A 1IGNA 4A3JJ 5K7FA 1ZGAA 1WHUA 2FQ3A 2DA7A 2HOEA 2LR8A 4HSRA 4BDZA 1IN7A 5ILVA 3KP4A 4HF0A 1R22A 4Z2YA 2CSOA 3H3VK 2A5YB 3W6KB 2FA5A 1MJ9A 2NOGA 3N05A 1J75A 1Z3XA 1R4NB 4NC7A 3GO5A 3HPGA 1D8JA 3BJAA 5KVRA 1FOYA 3QPHA 3H5AA 4IKFA 2G0EA 2E5ZA 3EETA 3OL4A 1QZZA 3UNGC 3AKZA 2QBYB 4RDUA 1CF7B 2F4MB 3K4JA 4OIRF 1MZBA 3HG9A 1IN5A 3MQ0A 5J3LA 3LL7A 2LLKA 2QYOA 4I0AA 2QF7A 3ZXSA 3CC2I 5ILSA 2EIMH 3OR2C 2HXOA 2XAGA 3SFZA 5FKOA 2GBYA 2EILH 2HTJA 3PUFA 1NK3P 2HZTA 2L7MP 4HBLA 1ZLKA 2VC0A 4YG2F 4WXCA 2PFBA 1LVAA 3JAMZ 1DP3A 1BR2A 4PSWA 5EEGA 1B8IB 2WAQN 2FD5A 2K02A 4II2A 3RIRA 1B9MA 3TDUC 3U1KA 1O7FA 4A5MA 2VJJA 1U3EM 1XCVA 2BY3A 2Y30A 1P7IA 3S32A 2MABA 1TL8A 1L0OC 3PIPF 2V26A 3D0SA 1YX3A 3HIFA 4UHTA 4AC0A 1HW2A 2ELKA 3EPZA 1X4OA 3V7RA 4M74A 2LP0A 1KGSA 2X48A 4EM2A 1APLC 2CFXA 3RYRA 1NG7A 2DQRA 2E2JJ 2XGCA 5EEAA 5ICEA 1FY7A 2OV7A 5B66C 2VC1A 1W4MA 2A6TA 4RAYA 3OIQA 4AIDA 4CUGA 4JYKA 5BS6A 2EV5A 2IS1A 1U9OA 3BQYA 2NVTJ 3G2BA 4HPQA 1QRYA 4R79A 4IO9F 3WGGA 3KLOA 1FTTA 3S2DJ 3FWEA 2EFPA 2IGOA 1RZ4A 3DTIA 3DTEA 3CMAI 3VYSB 5KHDA 5L3GA 2JZYA 4XR6A 1UMQA 4Y33A 1EV7A 4XOTA 3GTJJ 4A12A 1FYLA 5CJ9A 1GV2A 1WGXA 4HV5A 2CUEA 1WKMA 1RRJA 2EQRA 2MLGA 1A5JA 1MGTA 1JUMA 1SD5A 2E19A 1ETOA 3C7JA 2BXZA 5EJCA 4DZJA 3GFIA 1UJ8A 5EYRA 3CCVI 1UFMA 3T1BA 3KEYA 1LB2A 2HR3A 4HX4A 1MKMA 3IKVA 1TNSA 4JBAA 1P4WA 4A2UA 2H1LA 1HOMA 3K4BA 2BEOA 1WJDA 2E1MC 3K2AA 3VPRA 5IPAA 3F72A 1GDTA 5J8CA 3GMEA 1V5FA 4BXFA 5IT9Z 4N4OB 1R5HA 2CQXA 5TJJA 2YX7A 2CQQA 5E8IA 4EGZA 1LEBA 3G1OA 1ITYA 5M5XJ 3T0YA 1XMXA 1HLVA 3G3ZA 4L5IA 3ZP5A 4GCVA 2MC4A 3H9QA 1KYZA 5K7HA 2K40A 3U9GA 3CMEI 2JVHA 3SQNA 1D1AA 2LDUA 1QPMA 3OR1C 3HOTA 2TRTA 1T8IA 3K4NA 4U7BA 3D5RC 4ZTJA 3IH4A 4G7ZF 4BU2A 3CCEI 3VOEA 5FD6A 2ACJA 1ETQA 1ON2A 1LDJA 4FETA 2KLOA 2IS2A 2MC3A 1YW8A 3E1SA 4A6DA 2X1DA 2CW8A 2ECBA 3D1NI 4RS8A 1H8AC 5B5EC 4EJTA 4N9IA 1Y8QB 2DFEA 1F1ZA 2VKHA 3WGHA 2LMDA 3MMYB 1R6RA 2OU2A 4HLYA 2JA5J 2O8XA 2CG4A 4L18B 1JTYA 1CGPA 3P9IA 2E1MB 1FLIA 3CJTB 3ULQB 3ASOH 4CCMA 3UKGA 3S2HJ 2L3DA 4M9ZA 3MZ8A 1DPUA 1RPWA 2NVYJ 4BQNA 3TBIA 2ZJRF 4EATA 2O7OA 4E7HA 5F64A 2E35A 4DIQA 2KISA 2CWEA 2FU4A 3BR3A 3GXOA 3LSMA 4HQEA 2X6YA 4UV8A 3KEQA 2P5KA 1ZYRF 1LKXA 1RR7A 2P5LC 1WI9A 1X2MA 4FX0A 3TP3A 4ZZLA 3V8JA 4WK8F 3JRCA 2HKXA 2EIKH 2Y0SN 4IXAA 4XSXF 3I56I 1PP7U 3VYTB 1FC3A 3E5XA 4GXOA 1ETVA 1ODDA 5CQGA 1WRJA 2Q1ZB 1YS7A 1QBJA 1DPRA 4IHXA 2K9QA 1LE8A 2EWNA 4MO7A 4XICA 4HQMA 4ON0A 2QKLB 1LFPA 4FTHA 2Z16A 1FWZA 1RKTA 2RQQA 1GUUA 2A05A 3GFLA 2L9RA 2STWA 3OYCA 4MNUA 4ESBA 5D4RA 1AKHA 2H27A 3NRVA 2OPTA 1BR1A 4ESJA 3H3UA 2ZNYA 3TO9A 4PJLA 5HS7A 1OYIA 3IWZA 1F4KA 1QA6A 3MKLA 3TP0A 4Y7NJ 1HW5A 4RGRA 1Y8RB 1R1UA 1DDNA 1IXSB 1XTAA 3TO7A 1MBFA 2RC4A 4UVAA 5FRMA 3E6BA 4XLHA 2ECCA 1FP1D 1PP8F 1VQMI 4BUPA 5JVGF 3K10A 3M1EA 4XLAA 2F2EA 2FEZA 3RZDJ 2DXIA 1YQAA 4L9VA 2HQ5A 2Q8KA 3S14J 4P55A 1FBSA 1VQKI 1YS6A 3HJEA 3EUAA 5D6EA 1XN7A 3KZZA 3QU3A 3OL3A 1O3TA 4UUTA 2MLKA 4HEA2 2XASA 1MJBA 4X6AJ 3HKZA 3GLLA 1Y1VJ 3PUBA 4BJ5C 4XRSG 3F23A 4OMYA 4BQOA 4I7HA 2GIZA 2V79A 5KCMA 1BI2A 5F04A 3I53A 4ENMA 1ZG1A 3GWZA 2YPRA 2W7NA 3M7GA 1WJFA 3IWFA 4BEHA 5E3NA 5L3BA 3CMYA 3GEZA 5FLXK 3U2RA 2EZHA 3RKWA 5FJ8J 2GOXB 3MWMA 3CMMA 1LPQA 2R5YB 3A2KA 5FD5A 1XGOA 1YOVB 1Y1WJ 2L4AA 1FPQA 3ELKA 4AYBN 1K83J 4LFUA 1BI3A 1SMYF 3ZQHA 4F92B 1I3QJ 4KN4X 3LFUA 3WHCA 2IJLA 5J6XA 2BXYA 3L2CA 1S7EA 5IP6A 2XAHA 5F1RA 3PQKA 2ESNA 4CSWA 3HKZN 2PJPA 4XLPF 2E1CA 3QAHA 3FK6A 5FLVA 3BY6A 2EV6A 2F6CA 2BW3A 3CUQA 5D5WB 3HOYJ 3KE2A 3ZMSA 4I76A 2P4WA 1MBHA 3GBGA 2B7EA 4RMNA 2V1XA 2HU9A 1LFBA 3CLQA 2Y9ZA 1BI0A 3WTUC 2AXTC 3PSFA 2Z33A 2R7QA 3DKXA 4M6XA 3CDHA 2M30A 4RGSA 5L3CA 4PCQA 1IG7A 1IUFA 2H09A 2W48A 4WXDA 3F0CA 1HF0A 4S0HB 2GA1A 4V19K 2DLLA 4MGRA 4E6KG 5L3EA 2KHMA 1L3LA 4AIHA 1QNTA 3ESWB 2AS5F 4OMZA 3TGNA 1HKSA 1YIOA 4BQAA 4P96A 3EUHC 3IC7A 1DUXC 2XGDA 1STZA 2R5ZA 2CW0F 2XB5A 3Q0VA 5EGOB 1A35A 4XKBA 2DA4A 1FT9A 2OF7A 3CTAA 3L2WA 3R0AA 5IT3A 5FFXA 1GVJA 3M1CA 4M73A 2JPBA 3GX4X 4K2EA 5BPIA 3DFGA 2Y31A 3QPTA 3ZQGA 2NS0A 2FQ4A 2Q0OA 4XONA 3K70C 3B6AA 5EF6A 2M3AA 4BHBA 3BROA 4KMUX 4DGWB 1YYVA 4U87A 1I50J 2EFOA 1IRZA 1I1SA 4OIPF 1LVKA 1SVLA 3CCRI 2CRGA 3QODA 5FO5A 4BAYA 3R60A 1D3YA 1Z91A 2WAQA 4S04A 3F22A 2XIGA 1XGSA 4ZYAA 1M1EB 5IYBJ 4LLNA 2UUZA 2P81A 4UVBA 1BA5A 5J40A 2NYXA 3REOA 2LREA 1IV8A 1OMIA 3PSIA 3GTKJ 4DZPA 2EFWA 3BPXA 2RKHA 2AO9A 2W82A 4GDFA 2XPWA 4UB6C 1U6GA 2DDAA 1J5YA 2WTEA 3DPTA 2OCCH 3X2QH 2KDOA 1GXQA 2KPMA 5DCFA 1R49A 1C0WA 5ICCA 3FISA 1JKPC 1X58A 3BG3A 1OFCX 1K61A 2KIQA 3DTKA 2EBIA 4GO1A 2VBZA 3P5JA 1B1BA 2PMUA 5FLXZ 1R23A 4PJNA 3C3WA 3JSPA 2ZJQF 2NVQJ 2B63J 2HZDA 3P9KA 3DPLC 2K4BA 2M0CA 1Z9CA 1VQPI 3V8KA 2L02A 4BEHB 1K7AA 4BHPA 4ZYHA 5ICGA 1GXPA 4H4KC 2MH2A 3BLYA 2X1EA 1R4MB 3L2QA 2EZLA 3HB9A 1G8XA 3K6GA 4HAMA 2EA4A 1YJ9I 2EFQA 4XRMA 1YFHA 1XMAA 2DYSH 3EYYA 2QQ9A 3M9AA 4I09A 2W57A 3M8FA 4N9HA 4V2FA 1W7PB 3PNTA 1OQYA 2DJIA 1U8BA 5FKLA 3JSOA 2XV4S 1OKRA 2JQ7A 2DT6A 3B73A 4HNUA 4KIBA 4FHTA 1OCPA 2QUFA 3KP3A 2AQFA 1OCTC 1VF9A 4MEXF 4ZYDA 4A3KJ 1IN4A 1JKRC 1UHSA 4CCNA 4D0PA 3BZ6A 5GTIC 1IUYA 1XGMA 1SAUA 1VQ9I 3LSIA 2O6GE 2Y2ZA 1MDMB 4KITB 3G71I 2OTJI 4BBSJ 3CESA 1RI7A 3BTLA 4M3FA 3TL4X 4ESFA 5GPCA 2LF7A 2RN7A 1I39A 2OAZA 1XSDA 5LHIA 1MBJA 2VASA 3H9JA 3BZCA 3EDPA 1UG2A 2LBFA 4XORA 3M3YJ 4LJZF 4OIQF 1BN5A 5JVTA 2LTPA 1J7KA 1TP4A 3BTCA 2UXNA 1QO0D 1GV5A 1BIAA 3OMYA 4IQ4A 4RM2A 4A6EA 4RB3C 2KRCA 3VYRB 2R7VA 4IPAA 2PEXA 1D1CA 3L7WA 2Y48A 3FXUA 4C3HJ 1R5ID 2FMYA 2DO7A 3JREA 1LE8B 3I5UA 2PLYA 5LGTA 3KPHA 4ZDPA 1BJZA 4BXUA 5E3OA 4I01A 4E7KA 3BR6A 3E6DA 3ABTA 2GQQA 3IHUA 3S1RJ 3ERMA 1RR8C 2ZMEB 4OOIA 1YIJI 1HC8A 5BPDA 1X4PA 1WH7A 1AKHB 3FHNA 3K4MA 1IDZA 2KL4A 4Y4RA 4F3QA 1XSXA 1N75A 2B0LA 3F9KA 3MKYB 1XPXA 3F8FA 3KP6A 2FSWA 3VODA 2ADUA 2QGUA 3G1MA 3K4LA 2W00A 5EZHA 2CMPA 2EV0A 4YFXF 3LNQA 1VI0A 2JT1A 1KU9A 2W85A 4EGYA 1K4TA 1J9IA 2WWYA 2D45A 1YW7A 1TT5B 4KFCA 5CPRB 3MAJA 1LQ1A 2DW4A 2XAUA 2WV1A 2LD5A 1JI8A 4YFKF 3HTSB 3KZIC 3OWTA 1TQIA 2QSFX 2ID3A 4HF1A 1IRGA 4BQQA 5GADJ 4UVCA 3Q9SA 1DGWY 1SEUA 2VE9A 2NRAC 4H0EA 2COBA 1WSUA 5JFRA 5GP9A 4A93J 1OCZH 1TWCJ 4JP0A 2FF4A 4YELA 2FRHA 5CYVA 2OUMA 2R7FA 2XUBA 2VQGA 3GVAA 3KCCA 1JGSA 1U0JA 2XGEA 2GOMA 5A2QK 4CYCB 3K1MA 1K78B 2VOOA 3D5SC 5BNGA 3CCUI 2YR2A 3HTUA 2HDDA 1OJLA 3I64A 5CVIA 4C3IJ 1ZRFA 2VKVA 3OIOA 1H9TA 4RLQA 4XN0A 5TRDA 1Z05A 2LKPA 2XDVA 4MQ9F 2OQGA 5KK1A 1E3OC 2JMWA 4KICA 2E2HJ 1ERDA 1TWFJ 2XKOA 1YITI 3S3MA 3PJRA 3BR5A 1JUPA 2BHZA 4LGWA 3BTIA 4DOZA 1YG2A 2AHQA 2VT2A 3FM3A 3LSHA 4U0WA 5FB2A 3K4CA 4A3DJ 1ZAOA 3FHZA 4LLGF 5HODA 2HYJA 2NVXJ 2HQAA 3J7YJ 4XLFA 3ZPLA 4AYBA 5BMZA 4YIRX 3MCZA 1EKEA 2P8TA 3JAMK 3CJQB 5IY5H 1TC3C 3GTLJ 1FSHA 5F0CA 1MD0A 1S7AA 3ZN0A 2QSHX 3S8PA 5K5OA 5IT9K 3WU2C 2NXNB 1SC7A 3I59B 2E34A 5D5VB 1E0EA 2KFDA 2J5OA 2R7TA 2BV6A 3FZVA 2WBMA 3WTXC 3HOZJ 2FBIA 1AWCA 2DT5A 1UAAA 1JHFA 4U7DA 3V42A 4BXXJ 1USTA 5CKTA 3C2HA 4FQGA 2DA1A 1NHAA 4BYYA 5E18F 1XB4A 3ZMVA 1P9QC 5JI6A 1MW7A 1JHHA 1IXRC 2BGCA 3NQOA 3ZQIA 1BJAA 3IKTA 2L0KA 4AIJA 4G7HF 5HS8A 2WAFA 2NOJB 1P2FA 3JRBA 1W7PD 4HZFA 4C2UA 4IRGA 2L9VA 1RUNA 4HDUA 3U1DA 1G6NA 4KUMA 2EZKA 4IRIA 4FISA 1VQ6I 5JHUA 3IRQA 1ZR4A 2MW8A 2IPQX 1QU3A 3BJOA 1MMSA 1HA8A 2V4JC 3F8BA 3MEXA 1W1WE 3TKYA 2F5EA 3FF5A 3LQQA 1W5CC 2LG4A 3JTGA 4QTRA 2ZSIB 2F5FA 5CVUA 1FX7A 4XKVA 5HDNA 4AVZA 2ISZA 3BR1A 1U78A 1HXDA 1X1DA 1B9NA 4KMFA 4CDGA 1G2HA 4ZDOA 4G6TB 1T2KA 1WJCA 1FNNA 2Z99A 5GAGJ 3K70D 4E7JA 2QWWA 2W25A 3PNYA 2DJNA 2E36A 5GPAA 3NAUA 3JW4A 2Z2SB 3MKZA 2YSRA 1BR4A 1ZG5A 1I27A 4M9SA 1YTYA 3DXJF 3CF2A 3HRMA 4BKXA 4NHJA 3RKQA 5M5WJ 1VQOI 4A0XA 1FP2A 1IDYA 1JT0A 2V9VA 4QPQA 5HLHA 3WTSC 4XLCA 3J81K 2KJCA 2PJRA 2HVSA 1Z3YA 3DKYA 5TISC 2JUGA 2R0QC 5C3EJ 3CF5F 2E7XA 2IP2A 2PG4A 3VB2A 4B1RA 2XF6A 1FMWA 5HLIA 5J47A 4ENJA 5D5UB 1B8IA 3FMRA 2OCEA 3TMOA 1SVMA 3CZ6A 1S9HA 4B48A 2XF5A 3B6CA 3SZPA 1ETXA 2BVMA 4L0YB 4A5NA 4JX6A 4EJWA 4HV6A 4JX4A 4HG2A 2O5RA 1WJ5A 3HOSA 3I4PA 2X85A 3LSPA 3BDDA 2CU7A 2CFOA 3F6VA 4P9UA 1ZGWA 5C4JJ 2O3FA 4PSXA 1F9NA 4PFOA 4F7ZA 1U2WA 4F55A 2ME0A 2DDBA 4G94A 5E8GA 1O4XA 2D2WA 5D8LB 3HOWJ 2EA2A 3PM1A 1WWXA 2G7HA 3SJMA 4A0YA 3BWGA 4NB5A 4GGGA 3DU6A 3SZGA 5GTHC 2YUSA 2CV0A 9ANTA 2K85A 2FOKA 3HRSA 5H2FC 4X1EA 3HL2A 4HRIA 1TNTA 1T0FC 2R7RA 4IRHA 2P6SA 4NC8A 2RQPA 5LEJA 4U88A 3WTVC 4Y15A 1MNMC 2A68F 3H0GJ 4LK0F 5D4SA 4QSHA 3I54A 4I98B 5GAEJ 4RAZA 1YRNA 1FOKA 2ZFUA 4HX8A 3N97A 1ETKA 2ETHA 5J1YA 2DN0A 4LOCA 4EM1A 3HSRA 4R1HA 2HDWA 5FKMA 3FBNB 5A2QZ 2QSGX 2JSCA 2KJBA 3HM5A 1G3WA 3VSKA 4I6ZA 2E2IJ 2CUZA 2EPFA 2JJ7A 4IZZA 2ZKZA 2VBWA 1SFUA 2AQEA 1RETA 3CD6I 3LAPA 1Z7UA 1HDPA 2PX9A 4UY8I 2ZJ2A 1VQLI 1WCMJ 5EG0B 4PGHA 4JQFA 4YFNF 1IV6A 3M07A 2K9LA 2H1KA 5IOZA 1TLHB 1H89C 4XBFA 2FOWA 2IA2A 4A3IJ 2NS8A 4G6QA 3I0TA 2CH0A 4LITA 4IL6C 1YHQI 3KYLA 4MFDA 3FIWA 5LLQA 2QLZA 4KIGA 1LFUP 1P92A 4DBRA 1OCOH 3HUGA 1BIBA 2XAJA 4CGZA 4CCJA 3ZMUA 2MD0A 5LEKA 1LDDA 4NBQA 1WFXA 4BE2A 1B72A 2ZMEA 2JA6J 4C2MJ 2Y9YA 3FM5A 4XRSA 1A6QA 1VNDA 5B1AH 2WY8Q 1PUFA 2X9DA 3WE3A 1UHMA 4KNYA 3VEPA 1ACIA 2BE5F 1YLFA 5K5RA 4XNFA 3L9FA 4RM3A 3JRHA 4XOPA 3CJNA 3L2VA 1EA3A 5IOYA 1O3QA 4D1QA 5HNFA 1S3JA 2I10A 2IGMA 4AWXB 2DTRA 4E7LA 5F0FA 4C30A 5J1RA 1D0XA 1HKTA 4G12A 3VWBA 2IA0A 3QP5A 5KNLA 1K78A 1ZQ3P 3KLNA 1S7OA 1ZHFA 4I2OA 1HDDC 5HDKA 2JRMA 3ISPA 4U0YA 1REPC 2CGPA 2KZVA 3VYUB 1KQ8A 2XRNA 3BG5A 5LGNA 3BG9A 3ZQLA 5IP7J 1E3PA 2CJJA 2LKXA 3W6JB 2CUJA 1I3AA 3ABUA 3SDBA 5ED4A 3G6EI 2EFNA 2XRLA 4XLNF 4B47A 1JE8A 5ERIA 3DP7A 4XN3A 2HOAA 2RNJA 5DUKA 4A69C 2FE3A 4L5EA 3SEZA 4XL9A 2PMZA 3GW2A 5H20A 3OY9A 2DPUA 2UXXA 1A6IA 2H8RA 2A5WA 1I6XA 3L00A 5DM7F 2NNYA 4J01A 2DODA 2IS4A 1T95A 2QQBA 5M5YJ 1T38A 2CV2A 5C4XJ 3I3LA 2LKSA 4BH9A 3J80Z 3ECOA 4L9JA 1N78A 2KMUA 2TDXA 2DA6A 3GCMA 1H0MA 1YX5A 4JX5A 3HZJA 3MFKA 3OSGA 3CC7I 1G4DA 4ZH4F 2ZB9A 3HYIA 2KP6A 2K5CA 3DQVC 3OYDA 2COMA 1OISA 1USSA 3BOQA 1T56A 1VFCA 5HS9A 3H3ZA 2IW5A 2VKDA 3RPQA 4CCOA 3OYHA 3QYEA 5FGMA 3K1NA 4L9TA 3PFYA 1F43A 4W1UA 2R5ZB 4AM3A 5J4YA 4IQJA 2M7BA 4O3MA 3H5RA 3K0LA 3NEUA 2DYRH 1W0TA 1WJBA 3QRFF 5B3SH 1D1BA 3DKWA 3Q5FA 2P5VA 3P7NA 2Y0MA 1FZPB 3H9GA 2MH9A 3K4KA 3CCJI 1XDSA 4LIVA 1F36A 4LG3A 1XMKA 4PZJA 3DCFA 3AG4H 2GAUA 5LRRA 2XSDC 4DBQA 3I9V2 1ETWA 5DTDA 1YE9A 2DA3A 3ZQFA 4BE0A 1A04A 3DBRB 1TWAJ 3OS2A 1FSEA 4LIUA 2CO5A 3EUHA 2Z9OA 1IAWA 2OZ6A 1NK2P 1V3FA 4N0BA 4J19A 2QKMB 3OS1A 3R61A 2XAFA 2VLAA 2R3SA 3SFIA 2LK2A 2JK3A 2OBPA 2VQLA 3HPHA 1KYWA 2ELJA 2A6EF 2DA5A 3IH3A 3HRUA 5IYCJ 1JUSA 2DCEA 4WF2A 1TWGJ 1HW1A 4FE7A 3D5LA 5CLSA 4LG0B 3QYBA 4JOMA 4ANJA 4KN7X 2X0LA 1ONVA 4D9JA 4GFBA 5FRNA 4KJZA 3G4SI 4O6JA 2H6CA 1NH3A 4RB0A 2RDPA 3PIOF 2ZXJA 4DJAA 1D5YA 2QZ8A 1V55H 4V2GA 3HBLA 5J4VA 2Y69H 1JTXA 3BZKA 1MMAA 3TQNA 2QQ8A 4PGGA 2M5WA 3BTJA 5CVRA 2VQCA 1X2NA 3A02A 2K9SA 3COAC 2DU9A 4PJJA 2HPIA 2E71A 1WVRA 1X3UA 2PMZN 5K7ZA 4CZCA 3MD2A 5FLMJ 1MJAA 2WV0A 3SYTA 2ICWG 4RB1A 4DYCA 2GM4A 2O03A 1QQIA 2WB1A 3HOUJ 1T39A 3CJRB 4QWQA 3KFWX 1FYMA 2L54A 4ENNA 3H36A 2HYGD 3CCQI 4ZZDA 2CQKA 2GIVA 1XC5A 4NDLA 4XKCA 3HHGA 1TQPA 4EMSA 1R00A 2VOPA 4ITVA 3OYAA 2LFBA 1V54H 3I4MJ 1QZEA 4UB8C 2DI3A 2D1HA 2GXBA 3OYGA 2ISYA 2VXZA 3OYJA 5M3MJ 3DU5A 2L9NA 5EEHA 3FDYA 3OYKA 3FKIJ 1IZ1A 4IF4A 3KYCB 3GZ5A 2HPMA 2FJ1A 3O3KA 3GTPJ 4EVIA 2VONA 2L2OA 4DW6A 4P1WA 2HS5A 3HEFA 3OOPA 3SDGA 3V7SA 2VN2A 1BW6A 1X1CA 1TZLA 3Q0WA 2W4SA 4B4CA 3Q0UA 1ON1A 2RV8A 2W1OA 5LGUA 3RDIA 4F91B 4E4HA 4HDVA 4HLXA 4KYWA 1FOWA 3HXLA 2ESHA 1LDKB 2M34A 4PJMA 1ZELA 2OQRA 2VUMJ 1B59A 3S1NJ 3S1MJ 3C1DA 1FTZA 1X3ZB 1ZTRA 3TEDA 4O5VA 3S93A 3BP8A 3NARA 2QA4I 2HQRA 3ASNH 3LAJA 2P0WA 4M6YA 4B44A 4M3BA 4YIFA 1SFXA 3HHHA 3A01B 3FXRA 1Z0XA 2FBHA 2VODA 4ABZA 5EDNA 1T0FA 4M3GA 1P7JA 4ETSA 3IUOA 3HGGA 2R5YA 1Q1VA 3TW7A 2MGQA 5KAFC 2WC2A 1DP7P 1JXSA 3FK7A 3JCUC 3FXLA 3VDXA 4ENKA 5BQTA 3J80K 4IJAA 4UV9A 4KIFA 2VKEA 2IS6A 2WA0A 1SD7A 3JTHA 2D1VA 3OYBA 4QLCU 1W5TA 2QCOA 1HSJA 4F52A 3ML6A 2L01A 4AVPA 2VXDA 1D0ZA 1FEXA 2RAEA 3E3VA 4PUSA 4X0GA 3DBLB 2F5CA 1XX5A 2VE8A 2NVUB 3ROUA 4XRFA 1W36C 3FBIB 3CP8A 2KT0A 4QPOA 1O3SA 4PJ0C 1VQ4I 3H5NA 2HNHA 3AG2H 1SD4A 2JRTA 4UUVA 2B9SA 2DQLA 4IVNA 1ZARA 1IRXA 3I4NJ 4BJ6C 3LSKA 1JT6A 1T08B 2GXAA 2VPLA 4BS9A 3J7ZI 3Q9VA 2H6BA 1WQ2A 3HGYA 1Y6IA 1K4SA 5K5QA 2F4IA 2JTVA 4RGUA 1MNDA 1VQ8I 3LSTA 3LSJA 1KONA 4ZC3A 2LY9A 1XGNA 1ZRCA 1D8KA 1QZYA 1N77A 2MBFA 2RVCA 1OR7C 4Y17A 1JJ8C 4IHVA 3MN2A 3LOCA 2V1DA 1W0UA 1BOBA 2BY1A 5M3FJ 3JR9A 1HCRA 2QEXI 3V7CA 1FBQA 3O8HA 1W5SA 2VJ4A 3ZGKA 1VZ0A 3BG6A 2DMQA 4LK1F 4C9YA 3ZQQA 1D0YA 5EG0A 2HWVA 3M4OJ 3HOVJ 1BOAA 1V5GA 2NS7A 2ZO4A 2DK8A 5J8FA 2GXGA 3BR0A 1OR7A 3K7AJ 3S3NA 2HEOA 2IT0A 3BCBA 1R36A 4OINF 4ZJZA 3RI4A 3ABKH 2V6CA 3T5XA 1MSFC 3OYNA 3T8RA 3F8MA 3W2AA 1Q1HA 1Z77A 3OYFA 2L9SA 1KU2A 1PDNC 2YU9J 2M8GX 3TOAA 4RGXA 4HF2A 3K1PA 1T33A 1R1TA 2Q2EB 3WTWC 4A3BJ 3PQJA 1AHDP 2IEKA 4BGDA 2HI3A 4YRVA 1ZH5A 3KP2A 1P4XA 2EB7A 2M2EA 3IAM2 1TQMA 3ZR8X 2BYVE 1Z67A 3GFJA 5TGTA 4DQ2A 2CS3A 4EM0B 2R7SA 2O0YA 3V8LA 1IC8A 1XS9A 2Z3YA 3E6MA 2RGVA 1YW9A 1EH8A 2XB0X 2A61A 3RCOA 1LEAA 2KRHA 2CQ7A 4XK4A 5LHGA 2EIJH 4BE1A 1Z21A 5JLWA 3W2VA 4HA8A 3ZRGA 2A3SA 4KT6A 3O8GA 2I5UA 2ZFWA 1X3WB 3S16J 1T98A 2ME6A 1Y0UA 3CUQC 1Z6RA 2ZC2A 4B09A 4IHSA 3WG7H 3SEQA 4B8XA 3GLXA 2EK5A 4KA4A 4BY1J 3QPLA 1O7LA 2M8EA 4CICA 4Y52J 3S2WA 3CC4I 1LJ9A 2E60A 1QVUA 3LA3A 3JRDA 2KDZA 1SAXA 2JWTA 2JA7J 4MIMA 1XDUA 3HOXJ 4I99C 5DD4A 2LVSA 3A0HC 1KU7A 1WH5A 3RQIA 4GYGA 3FXQA 5JHFA 2Z5UA 1Z6TA 2DT7B 4Q5SF 2VT3A 3W6VA 3FXOA 2M4GA 1LNWA 3WTTC 5DEQA 3H1CA 2V6EA 2DFFA 2ZJPF 2PJRB 1OYYA 2AXLA 2OD5A 3CP2A 3FXMA 2DTZA 1OCRH 2ID6A 2OJED 3CLOA 4FX4A 3RPUA 3RYPA 4R8HA 4EEFG 2FBKA 2FMLA 1W7PA 1XG1A 2QBYA 3ZOBA 2DFHA 2MG4A 3FX3A 3L09A 5FROA 3S3OA 2PI0A 1S29A 2LRDA 1JJ6C 5CQEA 1KA8A 4TV7A 1ORKA 3KP7A 1VQNI 3E0JB 4NC6A 5D8KB 2K9NA 1S6LA 2XC7A 1E17A 3Q3SA 1WJEA 3L2RA 3DEWA 3CUQB 1G59A 1Y56A 3R6SA 1KQ0A 3DEEA 3WU0A 1FMVA 3IV5A 1SANA 1WI3A 4M3DA 1F5TA 3VFZA 4MTDA 4AU7A 4CYCA 2XHKA 4L0ZB 3GTOJ 1BL0A 1EF4A 2HDCA 3N4MA 1MDMA 1MMNA 2M7AA 4CO8A 4A3EJ 3WHBA 5H6RA 2ZXHA 3QOEA 4CZZA 1EJ9A 1BC7C 2PBIA 4II3A 5C44J 5D6FA 1RESA 3GZ6A 2BW3B 2QVOA 4A0ZA 3LSGA 5CVJA 4PFPA 1KQ9A 5JLXA 1YJWI 2O61A 3HSFA 5HVQC 3ZMDA 5H6QA 4OU0A 3F8NA 2R7UA 2Q2EA 2XKPA 3LQRA 1XCBA 2M9HA 2O8KA 3FKJA 2F5DA 3M8JA 4GYIA 2KQRA 3FMSA 1O3RA 3AAFA 2TCTA 2BY0A 3OSFA 3KIOA 1IRFA 3A01A 3WODF 4DYRA 5DCMB 5IYDJ 1OCCH 1IW7F 4E7ZA 4Z6YA 3BCAA 4G7OF 2VIXA 2JUCA 3BPVA 3IAS2 1U5TA 2JN6A 3RQ4A 4B3AA 4WX9A 1JGGA 4C3JJ 2FX0A 2L7FP 3AFHA 1B4AA 2JA8J 3ZCOA 2HVRA 3GTGJ 4OAZA 4L9NA 4XM3A 5E3LA 1E3HA 1PUFB 6PAXA 4AIKA 4A3CJ 1R1VA 2K4JA 3F6OA 3QYFA 4C2TA 2OTLI 3H35A 1SFEA 2ZXIA 3G73A 3LFKA 1ZK8A 3DBHB 2X1CA 2UZKA 1TW3A 3B02A 2L7KA 2L7ZA 2KZGA 1CF7A 2IRFG 4IHYA 4IEJA 2F48A 2HVQA 5F0HA 1VQ5I 2DK5A 1Y0NA 2HFHA 3SXYA 2VPRA 4EV0A 3MKWB 3BC8A 5E1WA 1IJWC 1TWHJ 4IOAF 3JRAA 4A3LJ 2QQAA 2UWMA 4LB6B 3PO2J 1IO2A 3MVPA 1J2XA 4BDYA 3CO6C 2R93J 1BW5A 1OLTA 1RNLA 2DMTA 2DOEA 4NNJA 2LSOA 2RREA 1BI1A 4U0VA 1ZR2A 1NTCA 2VJIA 3IRRA 3AL0B 3HSEA 4BBRJ 3ABMH 4PDKA 1Z7LA 3L1PA 3H0DA 4ZYGA 2R7OA 1WZ2A 5F27A 1UG0A 1S72I 1JKOC 4P5OA 2E1NA 5HNHA 4EJVA 1I5ZA 2IAIA 4JK1X 3DF8A 2CV1A 2DMNA 4GRIA 2XVCA 1WPKA 1QHGA 4I0BA 2A07F 4BJTA 5L3FA 3E97A 2M1BA 3CCLI 1KZHA 2G7UA 2K27A 1R7JA 3DV8A 2BOLA 3PL8A 1A31A 2GLOA 4RAGA 1P4AA 2XROA 1UHWA 1UCRA 3TOBA 4UUSA 2XAQA 2BVLA 5L3DA 1K6YA 4HSTA 3ZN1A 2J5PA 3I59A 3C18A 1FBUA 3G1LA 2X6WA 2X51A 4HNTA 3J7AO 3VSLA
chains in the Genus database with same CATH topology
1GHCA 4LMYA 3EQLF 1IN6A 1YO5C 2ZCWA 5ICFA 2DAOA 1H9GA 3WTYC 1ZN2A 4YIIA 1RUOA 5DUIA 3F3XA 4M9XA 3MZHA 3DEUA 3LA7A 2BBYA 3H92A 4Q4ZF 2M45A 3SZTA 2GZWA 2PN6A 4MQVA 3ZMTA 3QP6A 1AOYA 2CYYA 1G3TA 1XSVA 5D5XB 2EJRA 2KIFA 3PFIA 3E6CC 1QGPA 3KZYA 3GFMA 4M72A 5AIPA 4I02A 3GF2A 5FFZA 4EJOA 3GUDA 3ECHA 3WTZA 5E20A 3I58A 2IA1A 4BHCA 1V4RA 1HQCA 1E2XA 3M8EA 5K1YA 4KT5C 5JR3A 1K79A 4HW0A 4E70A 4M71A 2A6HF 4NQWA 3WGIA 1PUEE 3T8TA 5E1XA 2PMHA 4FT8A 4Q48A 1G3YA 5HDGA 2G9WA 3BJ6A 2LF8A 2OZUA 1ZGJA 5HLGA 4UNOA 1TW2A 4CXFA 3R0JA 5HOOA 2P7CB 2H94A 2E7WA 3KETA 2GA2A 4G9YA 3QOPA 1ULYA 1K6OA 2HQNA 4LD5A 2KRFA 4MHGA 2YU3A 2VBYA 3ZQ7A 4WXHA 4DNCA 5DV5A 2FXAA 2MA3A 3RKYA 2DBBA 2ELHA 3TO6A 2NNNA 1RIOH 3FMQA 3E5QA 3LWFA 5LHHA 2HYFA 1VTNC 2JPCA 4Y13A 1P6RA 5AONA 1ZRDA 4IHTA 2XGXA 4HYEA 1FYKA 3J81Z 2HTSA 2W24A 1BM9A 1IF1A 5DD8A 2HGCA 3SHFA 3WG9A 1R58A 2KIUA 2R7DA 4LLLA 2QENA 4CHUA 2DPDA 4ZYEA 3O2PE 3LA2A 1Z1DA 1R5GA 1U5TB 2DFIA 1ZREA 4MTEA 1TBXA 5LRSA 2FNAA 4P9FA 1IXCA 2GWRA 1SD6A 2K86A 4XSZF 1B6AA 1BBYA 2QM3A 3TDZC 1T6SA 1J0RA 5E1ZB 1KU3A 5DCMA 3CO7C 1O57A 2P6TA 3QU6A 3OV8A 5LBQA 4S05A 1ZG3A 4HX7A 2KKOA 3HRTA 2LNBA 5DDGA 5AIQA 1EH6A 1XD7A 1IN8A 3K9TA 1S8NA 1HSTA 3MZYA 4G6DA 2M87A 2C6YA 2IVMA 3R4KA 2VBXA 4EJUA 4G8XA 3RKXA 4ASNA 4EQQA 2ZNZA 3K2ZA 4UXNA 2A69F 4BNCA 5ILUA 2KIMA 3WE2A 1U5TC 3ZMZA 5BOXA 3RTRA 3RJPA 1U8RA 3V4GA 1EH7A 3GYHX 2HKOA 2YX4A 5E17F 3WU1B 4L5JA 3ERED 1OYWA 3F8CA 4KDPA 1G3SA 4OIOF 1TTYA 4WCGA 2STTA 1UB9A 3EYIA 2W84A 5DYMA 2K7LA 2NAZA 2OA4A 2PQ8A 2FNPA 3I71A 1HKQA 2L4MA 3IL2A 1ZLJA 2Y75A 5CVVA 1SMTA 4CYDA 3O6BB 4MEYF 1OPCA 5F6FA 1HBXG 3E5UA 4HOBA 3KEOA 3F21A 2ZBKA 3K69A 3KP5A 4RB2C 2X4HA 1J59A 3P9CA 4WWCA 4LB5A 4Q47A 2V1UA 1I1GA 2P7VB 1BC8C 3CUOA 4LG0A 4AD9A 2MD5A 1ZGAA 2FQ3A 2HOEA 1IN7A 5ILVA 3KP4A 4HF0A 1R22A 4Z2YA 2CSOA 2A5YB 3W6KB 2FA5A 1MJ9A 1J75A 3GO5A 1D8JA 3BJAA 5KVRA 3QPHA 3EETA 1QZZA 2QBYB 1CF7B 4OIRF 1MZBA 1IN5A 3MQ0A 2QYOA 4I0AA 5ILSA 2XAGA 3SFZA 2HTJA 2HZTA 4HBLA 1ZLKA 2VC0A 4YG2F 4WXCA 2PFBA 1LVAA 3JAMZ 5EEGA 2K02A 3RIRA 1B9MA 3TDUC 1O7FA 4A5MA 1U3EM 1XCVA 1L0OC 3D0SA 3HIFA 4UHTA 1HW2A 3V7RA 1D5VA 4M74A 1KGSA 4EM2A 2CFXA 3RYRA 2DQRA 5ICEA 1FY7A 2VC1A 1W4MA 4RAYA 5BS6A 2EV5A 4R79A 3WGGA 3KLOA 3FWEA 2EFPA 1RZ4A 5L3GA 2JZYA 4A12A 1EV7A 1FYLA 5CJ9A 4HV5A 1WKMA 2MLGA 1MGTA 1SD5A 3C7JA 3GFIA 1UFMA 3T1BA 1LB2A 2HR3A 4HX4A 1MKMA 3IKVA 1TNSA 4JBAA 1P4WA 4A2UA 2BEOA 3F72A 5J8CA 5IT9Z 1R5HA 5TJJA 2YX7A 5E8IA 4EGZA 1LEBA 3T0YA 3G3ZA 4L5IA 3ZP5A 4GCVA 1KYZA 3U9GA 3SQNA 2LDUA 1QPMA 3HOTA 4U7BA 4G7ZF 3VOEA 5FD6A 2ACJA 1ON2A 1LDJA 2MC3A 1YW8A 4A6DA 4RS8A 4EJTA 4N9IA 3WGHA 1F1ZA 2OU2A 4HLYA 2O8XA 2CG4A 4L18B 1CGPA 3P9IA 1FLIA 3ULQB 2L3DA 4M9ZA 1DPUA 5F64A 2CWEA 2FU4A 3GXOA 4HQEA 4UV8A 3KEQA 2P5KA 1ZYRF 2P5LC 1WI9A 4FX0A 4ZZLA 3V8JA 4WK8F 2HKXA 4IXAA 1PP7U 4XSXF 1FC3A 3E5XA 4GXOA 1ODDA 1WRJA 1YS7A 1QBJA 1DPRA 2EWNA 4HQMA 4ON0A 1FWZA 3GFLA 2STWA 4MNUA 4ESBA 5D4RA 2H27A 3NRVA 4ESJA 3H3UA 2ZNYA 3TO9A 5HS7A 1OYIA 3IWZA 1F4KA 1HW5A 4RGRA 1R1UA 1DDNA 1IXSB 3TO7A 2RC4A 4UVAA 3E6BA 1FP1D 1PP8F 3M1EA 2F2EA 2FEZA 1YQAA 4L9VA 2Q8KA 4P55A 1FBSA 1YS6A 5D6EA 1XN7A 3KZZA 3QU3A 1O3TA 2MLKA 2XASA 1MJBA 3F23A 4OMYA 4I7HA 2V79A 1BI2A 3I53A 4ENMA 1ZG1A 3GWZA 2YPRA 3M7GA 3IWFA 5L3BA 3GEZA 5FLXK 3U2RA 3RKWA 3MWMA 5FD5A 1XGOA 2L4AA 1FPQA 3ELKA 4LFUA 1BI3A 1SMYF 4KN4X 5J6XA 2IJLA 3L2CA 2XAHA 5F1RA 3PQKA 2ESNA 2PJPA 4XLPF 2E1CA 3QAHA 3BY6A 2EV6A 3CUQA 5D5WB 3KE2A 3ZMSA 2P4WA 2V1XA 1BI0A 3WTUC 2Z33A 4M6XA 3CDHA 2M30A 4RGSA 5L3CA 4PCQA 2H09A 4WXDA 2GA1A 2DLLA 4MGRA 5L3EA 1L3LA 4AIHA 1QNTA 2AS5F 4OMZA 3TGNA 1HKSA 1YIOA 4BQAA 4P96A 3IC7A 1DUXC 1STZA 2CW0F 1FT9A 3CTAA 3R0AA 5IT3A 5FFXA 1GVJA 4M73A 2JPBA 3GX4X 4K2EA 5BPIA 3DFGA 3QPTA 2NS0A 2Q0OA 4BHBA 3BROA 4KMUX 1YYVA 2EFOA 1I1SA 4OIPF 5FO5A 4BAYA 3R60A 1D3YA 1Z91A 4S04A 3F22A 2XIGA 1XGSA 4LLNA 4UVBA 2NYXA 3REOA 1OMIA 2EFWA 3BPXA 2RKHA 1U6GA 1J5YA 2WTEA 3DPTA 5DCFA 1GXQA 1C0WA 5ICCA 4GO1A 2VBZA 1B1BA 2PMUA 5FLXZ 1R23A 3C3WA 3JSPA 3P9KA 3DPLC 2K4BA 1Z9CA 3V8KA 2L02A 1K7AA 4BHPA 4ZYHA 5ICGA 1GXPA 2MH2A 4HAMA 2EA4A 2EFQA 1YFHA 1XMAA 3M9AA 3EYYA 2QQ9A 4I09A 2W57A 3M8FA 4N9HA 1W7PB 3JSOA 2XV4S 1OKRA 3B73A 4KIBA 4FHTA 2QUFA 3KP3A 4MEXF 4ZYDA 1IN4A 4D0PA 3BZ6A 1IUYA 1XGMA 2O6GE 1MDMB 1RI7A 4ESFA 2LF7A 2RN7A 2OAZA 1XSDA 5LHIA 3EDPA 4LJZF 4OIQF 1BN5A 5JVTA 1J7KA 1QO0D 2UXNA 1BIAA 4A6EA 4RB3C 4IPAA 2PEXA 3L7WA 2Y48A 3FXUA 2FMYA 2DO7A 3I5UA 2PLYA 5LGTA 4BXUA 4I01A 3E6DA 3ABTA 2GQQA 3IHUA 2ZMEB 4OOIA 5BPDA 1XSXA 2B0LA 3F8FA 3KP6A 2FSWA 3VODA 2ADUA 4YFXF 2EV0A 2JT1A 1KU9A 2W85A 4EGYA 1J9IA 2WWYA 2D45A 1YW7A 4KFCA 3MAJA 1LQ1A 2DW4A 4YFKF 3HTSB 1TQIA 4HF1A 1IRGA 4UVCA 3Q9SA 2VE9A 2NRAC 4H0EA 1WSUA 5JFRA 2FF4A 2FRHA 5CYVA 2R7FA 2XUBA 3GVAA 3KCCA 1JGSA 5A2QK 3K1MA 1K78B 2VOOA 2YR2A 3HTUA 3I64A 5CVIA 1ZRFA 1H9TA 5TRDA 1Z05A 2LKPA 4MQ9F 2OQGA 5KK1A 4KICA 2XKOA 4LGWA 1YG2A 2VT2A 4U0WA 3FM3A 5FB2A 1ZAOA 3FHZA 4LLGF 3ZPLA 5BMZA 3MCZA 3JAMK 2P8TA 1FSHA 1MD0A 1S7AA 3ZN0A 5K5OA 5IT9K 3I59B 5D5VB 2J5OA 2BV6A 3FZVA 3WTXC 2FBIA 1AWCA 2DT5A 1JHFA 4U7DA 1USTA 4BYYA 1NHAA 5E18F 1XB4A 3ZMVA 5JI6A 1JHHA 1IXRC 2BGCA 3NQOA 3IKTA 1BJAA 4AIJA 4G7HF 5HS8A 1P2FA 1W7PD 4HZFA 4IRGA 1RUNA 4HDUA 3U1DA 1G6NA 4KUMA 4IRIA 5JHUA 3IRQA 2IPQX 3BJOA 3F8BA 3MEXA 3TKYA 2F5EA 3FF5A 3LQQA 3JTGA 2F5FA 5CVUA 1FX7A 5HDNA 2ISZA 1U78A 1HXDA 1B9NA 4KMFA 4CDGA 1T2KA 1FNNA 2Z99A 2QWWA 2W25A 3JW4A 1ZG5A 2YSRA 1I27A 4M9SA 1YTYA 3DXJF 3HRMA 4NHJA 4A0XA 1FP2A 2V9VA 5HLHA 3WTSC 3J81K 2KJCA 2E7XA 2IP2A 2PG4A 3VB2A 5HLIA 4ENJA 5D5UB 3FMRA 3SZPA 4L0YB 4A5NA 4EJWA 4HV6A 3HOSA 3I4PA 3BDDA 3F6VA 4P9UA 2O3FA 1F9NA 4F7ZA 1U2WA 4G94A 5E8GA 2D2WA 5D8LB 2EA2A 1WWXA 2G7HA 4A0YA 3BWGA 4NB5A 4GGGA 2FOKA 3HRSA 1TNTA 4IRHA 2P6SA 5LEJA 2RQPA 4U88A 3WTVC 4Y15A 2A68F 4LK0F 5D4SA 3I54A 4I98B 4RAZA 1FOKA 3N97A 4HX8A 2ETHA 4EM1A 3HSRA 4R1HA 5A2QZ 2JSCA 2KJBA 1G3WA 2ZKZA 2VBWA 1SFUA 3LAPA 1Z7UA 2ZJ2A 4PGHA 4JQFA 4YFNF 1TLHB 4XBFA 2IA2A 4G6QA 3I0TA 5LLQA 2QLZA 4KIGA 1P92A 3HUGA 1BIBA 2XAJA 4CGZA 3ZMUA 5LEKA 1LDDA 2ZMEA 3FM5A 3WE3A 1UHMA 4KNYA 3VEPA 2BE5F 1YLFA 5K5RA 3L9FA 3CJNA 1O3QA 1S3JA 4AWXB 2DTRA 1HKTA 2IA0A 3QP5A 1K78A 3KLNA 1S7OA 1ZHFA 4I2OA 5HDKA 3ISPA 4U0YA 1REPC 2CGPA 1KQ8A 2XRNA 5LGNA 3W6JB 3ABUA 5ED4A 2EFNA 4XLNF 1JE8A 5ERIA 3DP7A 2RNJA 5DUKA 2FE3A 5H20A 3GW2A 2DPUA 2UXXA 1I6XA 3L00A 2NNYA 2QQBA 1T38A 4BH9A 3J80Z 3ECOA 4L9JA 2TDXA 1H0MA 3MFKA 1G4DA 4ZH4F 3HYIA 3DQVC 2COMA 1USSA 3BOQA 5HS9A 3H3ZA 2IW5A 3RPQA 5FGMA 3K1NA 4L9TA 4O3MA 3NEUA 3K0LA 3QRFF 3DKWA 3Q5FA 2P5VA 3P7NA 2Y0MA 1FZPB 2MH9A 1XDSA 4PZJA 1XMKA 5LRRA 2GAUA 1A04A 1FSEA 2CO5A 3EUHA 2Z9OA 1IAWA 2OZ6A 1V3FA 4N0BA 3R61A 2XAFA 2R3SA 2OBPA 1KYWA 2A6EF 3HRUA 4WF2A 1HW1A 3D5LA 5CLSA 4LG0B 4KN7X 2X0LA 1ONVA 4O6JA 2H6CA 4RB0A 2RDPA 2ZXJA 2QZ8A 3TQNA 4PGGA 2M5WA 5CVRA 3COAC 2DU9A 1X3UA 1MJAA 2WV0A 4RB1A 2O03A 1QQIA 1T39A 4QWQA 3KFWX 1FYMA 2L54A 4ENNA 2HYGD 4ZZDA 2CQKA 2GIVA 3HHGA 1TQPA 4EMSA 1R00A 2VOPA 2DI3A 2D1HA 2GXBA 2ISYA 2VXZA 5EEHA 1IZ1A 4IF4A 3GZ5A 3O3KA 4EVIA 2VONA 2HS5A 3OOPA 3V7SA 2VN2A 1ON1A 2RV8A 5LGUA 3RDIA 4HDVA 4KYWA 4HLXA 2ESHA 1LDKB 2OQRA 1B59A 3C1DA 4O5VA 3BP8A 2HQRA 3LAJA 4M6YA 4YIFA 1SFXA 3HHHA 3FXRA 2VODA 2FBHA 1T0FA 4ETSA 2WC2A 1DP7P 1JXSA 4ENKA 5BQTA 3J80K 4IJAA 4UV9A 4KIFA 1SD7A 3JTHA 2D1VA 4QLCU 1W5TA 1HSJA 3ML6A 2L01A 4AVPA 3E3VA 2F5CA 2VE8A 3ROUA 4XRFA 1O3SA 1SD4A 2JRTA 4UUVA 2DQLA 4IVNA 1ZARA 3Q9VA 2H6BA 1WQ2A 5K5QA 2JTVA 4RGUA 3LSTA 1XGNA 1ZRCA 1D8KA 1QZYA 2MBFA 2RVCA 4Y17A 2V1DA 3V7CA 1FBQA 1W5SA 4LK1F 2HWVA 1BOAA 2ZO4A 2IT0A 2DK8A 2GXGA 5J8FA 1OR7A 2HEOA 1R36A 4OINF 3RI4A 3T5XA 2V6CA 3T8RA 3F8MA 1Q1HA 1KU2A 1PDNC 3TOAA 4RGXA 4HF2A 3K1PA 1R1TA 3WTWC 3PQJA 1ZH5A 3KP2A 1P4XA 2EB7A 1TQMA 2BYVE 3GFJA 4DQ2A 4EM0B 2O0YA 3V8LA 2Z3YA 3E6MA 2RGVA 1YW9A 1EH8A 2A61A 1LEAA 5LHGA 4HA8A 2A3SA 2ZFWA 1T98A 1Y0UA 1Z6RA 3CUQC 4IHSA 4B09A 4B8XA 3GLXA 2EK5A 4KA4A 1O7LA 2M8EA 4CICA 3S2WA 1LJ9A 3LA3A 1SAXA 1XDUA 5DD4A 1KU7A 4GYGA 3FXQA 2Z5UA 1Z6TA 4Q5SF 2VT3A 1LNWA 3WTTC 5DEQA 1OYYA 2AXLA 2OD5A 3CLOA 4FX4A 3RPUA 3RYPA 4R8HA 2FBKA 2FMLA 1W7PA 2QBYA 3L09A 2PI0A 3FX3A 1S29A 1KA8A 4TV7A 3KP7A 5D8KB 1S6LA 1E17A 3CUQB 3R6SA 1KQ0A 3WU0A 1F5TA 3VFZA 4MTDA 2XHKA 4L0ZB 2HDCA 3N4MA 1MDMA 4CO8A 5H6RA 4CZZA 1BC7C 2PBIA 5D6FA 3GZ6A 2QVOA 4A0ZA 5CVJA 1KQ9A 2O61A 3HSFA 5HVQC 3ZMDA 5H6QA 4OU0A 3F8NA 2Q2EA 2XKPA 3LQRA 1XCBA 2F5DA 4GYIA 1O3RA 3FMSA 3AAFA 1IRFA 3WODF 5DCMB 1IW7F 4G7OF 3BPVA 1U5TA 4WX9A 1B4AA 4L9NA 6PAXA 4AIKA 1R1VA 2K4JA 3F6OA 1SFEA 2UZKA 3LFKA 3G73A 1TW3A 3B02A 1CF7A 2IRFG 2DK5A 2HFHA 3SXYA 4EV0A 5E1WA 2QQAA 2UWMA 4LB6B 1J2XA 3CO6C 1RNLA 2LSOA 4U0VA 1BI1A 3IRRA 3HSEA 4PDKA 4ZYGA 4P5OA 2E1NA 4EJVA 1I5ZA 4JK1X 3DF8A 2XVCA 4I0BA 2A07F 5L3FA 3E97A 2M1BA 2G7UA 2K27A 1R7JA 3DV8A 1P4AA 2XROA 1UHWA 1UCRA 3TOBA 2XAQA 5L3DA 3ZN1A 2J5PA 3I59A 3C18A 1FBUA 3J7AO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHC A;  4LMY A;  3EQL F;  1IN6 A;  1YO5 C;  2ZCW A;  5ICF A;  2DAO A;  1H9G A;  3WTY C;  1ZN2 A;  4YII A;  1RUO A;  5DUI A;  3F3X A;  4M9X A;  3MZH A;  3DEU A;  3LA7 A;  2BBY A;  3H92 A;  4Q4Z F;  2M45 A;  3SZT A;  2GZW A;  2PN6 A;  4MQV A;  3ZMT A;  3QP6 A;  1AOY A;  2CYY A;  1G3T A;  1XSV A;  5D5X B;  2EJR A;  2KIF A;  3PFI A;  3E6C C;  1QGP A;  3KZY A;  3GFM A;  4M72 A;  5AIP A;  4I02 A;  3GF2 A;  5FFZ A;  4EJO A;  3GUD A;  3ECH A;  3WTZ A;  5E20 A;  3I58 A;  2IA1 A;  4BHC A;  1V4R A;  1HQC A;  1E2X A;  3M8E A;  5K1Y A;  4KT5 C;  5JR3 A;  1K79 A;  4HW0 A;  4E70 A;  4M71 A;  2A6H F;  4NQW A;  3WGI A;  1PUE E;  3T8T A;  5E1X A;  2PMH A;  4FT8 A;  4Q48 A;  1G3Y A;  5HDG A;  2G9W A;  3BJ6 A;  2LF8 A;  2OZU A;  1ZGJ A;  5HLG A;  4UNO A;  1TW2 A;  4CXF A;  3R0J A;  5HOO A;  2P7C B;  2H94 A;  2E7W A;  3KET A;  2GA2 A;  4G9Y A;  3QOP A;  1ULY A;  1K6O A;  2HQN A;  4LD5 A;  2KRF A;  4MHG A;  2YU3 A;  2VBY A;  3ZQ7 A;  4WXH A;  4DNC A;  5DV5 A;  2FXA A;  2MA3 A;  3RKY A;  2DBB A;  2ELH A;  3TO6 A;  2NNN A;  1RIO H;  3FMQ A;  3E5Q A;  3LWF A;  5LHH A;  2HYF A;  1VTN C;  2JPC A;  4Y13 A;  1P6R A;  5AON A;  1ZRD A;  4IHT A;  2XGX A;  4HYE A;  1FYK A;  3J81 Z;  2HTS A;  2W24 A;  1BM9 A;  1IF1 A;  5DD8 A;  2HGC A;  3SHF A;  3WG9 A;  1R58 A;  2KIU A;  2R7D A;  4LLL A;  2QEN A;  4CHU A;  2DPD A;  4ZYE A;  3O2P E;  3LA2 A;  1Z1D A;  1R5G A;  1U5T B;  2DFI A;  1ZRE A;  4MTE A;  1TBX A;  5LRS A;  2FNA A;  4P9F A;  1IXC A;  2GWR A;  1SD6 A;  2K86 A;  4XSZ F;  1B6A A;  1BBY A;  2QM3 A;  3TDZ C;  1T6S A;  1J0R A;  5E1Z B;  1KU3 A;  5DCM A;  3CO7 C;  1O57 A;  2P6T A;  3QU6 A;  3OV8 A;  5LBQ A;  4S05 A;  1ZG3 A;  4HX7 A;  2KKO A;  3HRT A;  2LNB A;  5DDG A;  5AIQ A;  1EH6 A;  1XD7 A;  1IN8 A;  3K9T A;  1S8N A;  1HST A;  3MZY A;  4G6D A;  2M87 A;  2C6Y A;  2IVM A;  3R4K A;  2VBX A;  4EJU A;  4G8X A;  3RKX A;  4ASN A;  4EQQ A;  2ZNZ A;  3K2Z A;  4UXN A;  2A69 F;  4BNC A;  5ILU A;  2KIM A;  3WE2 A;  1U5T C;  3ZMZ A;  5BOX A;  3RTR A;  3RJP A;  1U8R A;  3V4G A;  1EH7 A;  3GYH X;  2HKO A;  2YX4 A;  5E17 F;  3WU1 B;  4L5J A;  3ERE D;  1OYW A;  3F8C A;  4KDP A;  1G3S A;  4OIO F;  1TTY A;  4WCG A;  2STT A;  1UB9 A;  3EYI A;  2W84 A;  5DYM A;  2K7L A;  2NAZ A;  2OA4 A;  2PQ8 A;  2FNP A;  3I71 A;  1HKQ A;  2L4M A;  3IL2 A;  1ZLJ A;  2Y75 A;  5CVV A;  1SMT A;  4CYD A;  3O6B B;  4MEY F;  1OPC A;  5F6F A;  1HBX G;  3E5U A;  4HOB A;  3KEO A;  3F21 A;  2ZBK A;  3K69 A;  3KP5 A;  4RB2 C;  2X4H A;  1J59 A;  3P9C A;  4WWC A;  4LB5 A;  4Q47 A;  2V1U A;  1I1G A;  2P7V B;  1BC8 C;  3CUO A;  4LG0 A;  4AD9 A;  2MD5 A;  1ZGA A;  2FQ3 A;  2HOE A;  1IN7 A;  5ILV A;  3KP4 A;  4HF0 A;  1R22 A;  4Z2Y A;  2CSO A;  2A5Y B;  3W6K B;  2FA5 A;  1MJ9 A;  1J75 A;  3GO5 A;  1D8J A;  3BJA A;  5KVR A;  3QPH A;  3EET A;  1QZZ A;  2QBY B;  1CF7 B;  4OIR F;  1MZB A;  1IN5 A;  3MQ0 A;  2QYO A;  4I0A A;  5ILS A;  2XAG A;  3SFZ A;  2HTJ A;  2HZT A;  4HBL A;  1ZLK A;  2VC0 A;  4YG2 F;  4WXC A;  2PFB A;  1LVA A;  3JAM Z;  5EEG A;  2K02 A;  3RIR A;  1B9M A;  3TDU C;  1O7F A;  4A5M A;  1U3E M;  1XCV A;  1L0O C;  3D0S A;  3HIF A;  4UHT A;  1HW2 A;  3V7R A;  1D5V A;  4M74 A;  1KGS A;  4EM2 A;  2CFX A;  3RYR A;  2DQR A;  5ICE A;  1FY7 A;  2VC1 A;  1W4M A;  4RAY A;  5BS6 A;  2EV5 A;  4R79 A;  3WGG A;  3KLO A;  3FWE A;  2EFP A;  1RZ4 A;  5L3G A;  2JZY A;  4A12 A;  1EV7 A;  1FYL A;  5CJ9 A;  4HV5 A;  1WKM A;  2MLG A;  1MGT A;  1SD5 A;  3C7J A;  3GFI A;  1UFM A;  3T1B A;  1LB2 A;  2HR3 A;  4HX4 A;  1MKM A;  3IKV A;  1TNS A;  4JBA A;  1P4W A;  4A2U A;  2BEO A;  3F72 A;  5J8C A;  5IT9 Z;  1R5H A;  5TJJ A;  2YX7 A;  5E8I A;  4EGZ A;  1LEB A;  3T0Y A;  3G3Z A;  4L5I A;  3ZP5 A;  4GCV A;  1KYZ A;  3U9G A;  3SQN A;  2LDU A;  1QPM A;  3HOT A;  4U7B A;  4G7Z F;  3VOE A;  5FD6 A;  2ACJ A;  1ON2 A;  1LDJ A;  2MC3 A;  1YW8 A;  4A6D A;  4RS8 A;  4EJT A;  4N9I A;  3WGH A;  1F1Z A;  2OU2 A;  4HLY A;  2O8X A;  2CG4 A;  4L18 B;  1CGP A;  3P9I A;  1FLI A;  3ULQ B;  2L3D A;  4M9Z A;  1DPU A;  5F64 A;  2CWE A;  2FU4 A;  3GXO A;  4HQE A;  4UV8 A;  3KEQ A;  2P5K A;  1ZYR F;  2P5L C;  1WI9 A;  4FX0 A;  4ZZL A;  3V8J A;  4WK8 F;  2HKX A;  4IXA A;  1PP7 U;  4XSX F;  1FC3 A;  3E5X A;  4GXO A;  1ODD A;  1WRJ A;  1YS7 A;  1QBJ A;  1DPR A;  2EWN A;  4HQM A;  4ON0 A;  1FWZ A;  3GFL A;  2STW A;  4MNU A;  4ESB A;  5D4R A;  2H27 A;  3NRV A;  4ESJ A;  3H3U A;  2ZNY A;  3TO9 A;  5HS7 A;  1OYI A;  3IWZ A;  1F4K A;  1HW5 A;  4RGR A;  1R1U A;  1DDN A;  1IXS B;  3TO7 A;  2RC4 A;  4UVA A;  3E6B A;  1FP1 D;  1PP8 F;  3M1E A;  2F2E A;  2FEZ A;  1YQA A;  4L9V A;  2Q8K A;  4P55 A;  1FBS A;  1YS6 A;  5D6E A;  1XN7 A;  3KZZ A;  3QU3 A;  1O3T A;  2MLK A;  2XAS A;  1MJB A;  3F23 A;  4OMY A;  4I7H A;  2V79 A;  1BI2 A;  3I53 A;  4ENM A;  1ZG1 A;  3GWZ A;  2YPR A;  3M7G A;  3IWF A;  5L3B A;  3GEZ A;  5FLX K;  3U2R A;  3RKW A;  3MWM A;  5FD5 A;  1XGO A;  2L4A A;  1FPQ A;  3ELK A;  4LFU A;  1BI3 A;  1SMY F;  4KN4 X;  5J6X A;  2IJL A;  3L2C A;  2XAH A;  5F1R A;  3PQK A;  2ESN A;  2PJP A;  4XLP F;  2E1C A;  3QAH A;  3BY6 A;  2EV6 A;  3CUQ A;  5D5W B;  3KE2 A;  3ZMS A;  2P4W A;  2V1X A;  1BI0 A;  3WTU C;  2Z33 A;  4M6X A;  3CDH A;  2M30 A;  4RGS A;  5L3C A;  4PCQ A;  2H09 A;  4WXD A;  2GA1 A;  2DLL A;  4MGR A;  5L3E A;  1L3L A;  4AIH A;  1QNT A;  2AS5 F;  4OMZ A;  3TGN A;  1HKS A;  1YIO A;  4BQA A;  4P96 A;  3IC7 A;  1DUX C;  1STZ A;  2CW0 F;  1FT9 A;  3CTA A;  3R0A A;  5IT3 A;  5FFX A;  1GVJ A;  4M73 A;  2JPB A;  3GX4 X;  4K2E A;  5BPI A;  3DFG A;  3QPT A;  2NS0 A;  2Q0O A;  4BHB A;  3BRO A;  4KMU X;  1YYV A;  2EFO A;  1I1S A;  4OIP F;  5FO5 A;  4BAY A;  3R60 A;  1D3Y A;  1Z91 A;  4S04 A;  3F22 A;  2XIG A;  1XGS A;  4LLN A;  4UVB A;  2NYX A;  3REO A;  1OMI A;  2EFW A;  3BPX A;  2RKH A;  1U6G A;  1J5Y A;  2WTE A;  3DPT A;  5DCF A;  1GXQ A;  1C0W A;  5ICC A;  4GO1 A;  2VBZ A;  1B1B A;  2PMU A;  5FLX Z;  1R23 A;  3C3W A;  3JSP A;  3P9K A;  3DPL C;  2K4B A;  1Z9C A;  3V8K A;  2L02 A;  1K7A A;  4BHP A;  4ZYH A;  5ICG A;  1GXP A;  2MH2 A;  4HAM A;  2EA4 A;  2EFQ A;  1YFH A;  1XMA A;  3M9A A;  3EYY A;  2QQ9 A;  4I09 A;  2W57 A;  3M8F A;  4N9H A;  1W7P B;  3JSO A;  2XV4 S;  1OKR A;  3B73 A;  4KIB A;  4FHT A;  2QUF A;  3KP3 A;  4MEX F;  4ZYD A;  1IN4 A;  4D0P A;  3BZ6 A;  1IUY A;  1XGM A;  2O6G E;  1MDM B;  1RI7 A;  4ESF A;  2LF7 A;  2RN7 A;  2OAZ A;  1XSD A;  5LHI A;  3EDP A;  4LJZ F;  4OIQ F;  1BN5 A;  5JVT A;  1J7K A;  1QO0 D;  2UXN A;  1BIA A;  4A6E A;  4RB3 C;  4IPA A;  2PEX A;  3L7W A;  2Y48 A;  3FXU A;  2FMY A;  2DO7 A;  3I5U A;  2PLY A;  5LGT A;  4BXU A;  4I01 A;  3E6D A;  3ABT A;  2GQQ A;  3IHU A;  2ZME B;  4OOI A;  5BPD A;  1XSX A;  2B0L A;  3F8F A;  3KP6 A;  2FSW A;  3VOD A;  2ADU A;  4YFX F;  2EV0 A;  2JT1 A;  1KU9 A;  2W85 A;  4EGY A;  1J9I A;  2WWY A;  2D45 A;  1YW7 A;  4KFC A;  3MAJ A;  1LQ1 A;  2DW4 A;  4YFK F;  3HTS B;  1TQI A;  4HF1 A;  1IRG A;  4UVC A;  3Q9S A;  2VE9 A;  2NRA C;  4H0E A;  1WSU A;  5JFR A;  2FF4 A;  2FRH A;  5CYV A;  2R7F A;  2XUB A;  3GVA A;  3KCC A;  1JGS A;  5A2Q K;  3K1M A;  1K78 B;  2VOO A;  2YR2 A;  3HTU A;  3I64 A;  5CVI A;  1ZRF A;  1H9T A;  5TRD A;  1Z05 A;  2LKP A;  4MQ9 F;  2OQG A;  5KK1 A;  4KIC A;  2XKO A;  4LGW A;  1YG2 A;  2VT2 A;  4U0W A;  3FM3 A;  5FB2 A;  1ZAO A;  3FHZ A;  4LLG F;  3ZPL A;  5BMZ A;  3MCZ A;  3JAM K;  2P8T A;  1FSH A;  1MD0 A;  1S7A A;  3ZN0 A;  5K5O A;  5IT9 K;  3I59 B;  5D5V B;  2J5O A;  2BV6 A;  3FZV A;  3WTX C;  2FBI A;  1AWC A;  2DT5 A;  1JHF A;  4U7D A;  1UST A;  4BYY A;  1NHA A;  5E18 F;  1XB4 A;  3ZMV A;  5JI6 A;  1JHH A;  1IXR C;  2BGC A;  3NQO A;  3IKT A;  1BJA A;  4AIJ A;  4G7H F;  5HS8 A;  1P2F A;  1W7P D;  4HZF A;  4IRG A;  1RUN A;  4HDU A;  3U1D A;  1G6N A;  4KUM A;  4IRI A;  5JHU A;  3IRQ A;  2IPQ X;  3BJO A;  3F8B A;  3MEX A;  3TKY A;  2F5E A;  3FF5 A;  3LQQ A;  3JTG A;  2F5F A;  5CVU A;  1FX7 A;  5HDN A;  2ISZ A;  1U78 A;  1HXD A;  1B9N A;  4KMF A;  4CDG A;  1T2K A;  1FNN A;  2Z99 A;  2QWW A;  2W25 A;  3JW4 A;  1ZG5 A;  2YSR A;  1I27 A;  4M9S A;  1YTY A;  3DXJ F;  3HRM A;  4NHJ A;  4A0X A;  1FP2 A;  2V9V A;  5HLH A;  3WTS C;  3J81 K;  2KJC A;  2E7X A;  2IP2 A;  2PG4 A;  3VB2 A;  5HLI A;  4ENJ A;  5D5U B;  3FMR A;  3SZP A;  4L0Y B;  4A5N A;  4EJW A;  4HV6 A;  3HOS A;  3I4P A;  3BDD A;  3F6V A;  4P9U A;  2O3F A;  1F9N A;  4F7Z A;  1U2W A;  4G94 A;  5E8G A;  2D2W A;  5D8L B;  2EA2 A;  1WWX A;  2G7H A;  4A0Y A;  3BWG A;  4NB5 A;  4GGG A;  2FOK A;  3HRS A;  1TNT A;  4IRH A;  2P6S A;  5LEJ A;  2RQP A;  4U88 A;  3WTV C;  4Y15 A;  2A68 F;  4LK0 F;  5D4S A;  3I54 A;  4I98 B;  4RAZ A;  1FOK A;  3N97 A;  4HX8 A;  2ETH A;  4EM1 A;  3HSR A;  4R1H A;  5A2Q Z;  2JSC A;  2KJB A;  1G3W A;  2ZKZ A;  2VBW A;  1SFU A;  3LAP A;  1Z7U A;  2ZJ2 A;  4PGH A;  4JQF A;  4YFN F;  1TLH B;  4XBF A;  2IA2 A;  4G6Q A;  3I0T A;  5LLQ A;  2QLZ A;  4KIG A;  1P92 A;  3HUG A;  1BIB A;  2XAJ A;  4CGZ A;  3ZMU A;  5LEK A;  1LDD A;  2ZME A;  3FM5 A;  3WE3 A;  1UHM A;  4KNY A;  3VEP A;  2BE5 F;  1YLF A;  5K5R A;  3L9F A;  3CJN A;  1O3Q A;  1S3J A;  4AWX B;  2DTR A;  1HKT A;  2IA0 A;  3QP5 A;  1K78 A;  3KLN A;  1S7O A;  1ZHF A;  4I2O A;  5HDK A;  3ISP A;  4U0Y A;  1REP C;  2CGP A;  1KQ8 A;  2XRN A;  5LGN A;  3W6J B;  3ABU A;  5ED4 A;  2EFN A;  4XLN F;  1JE8 A;  5ERI A;  3DP7 A;  2RNJ A;  5DUK A;  2FE3 A;  5H20 A;  3GW2 A;  2DPU A;  2UXX A;  1I6X A;  3L00 A;  2NNY A;  2QQB A;  1T38 A;  4BH9 A;  3J80 Z;  3ECO A;  4L9J A;  2TDX A;  1H0M A;  3MFK A;  1G4D A;  4ZH4 F;  3HYI A;  3DQV C;  2COM A;  1USS A;  3BOQ A;  5HS9 A;  3H3Z A;  2IW5 A;  3RPQ A;  5FGM A;  3K1N A;  4L9T A;  4O3M A;  3NEU A;  3K0L A;  3QRF F;  3DKW A;  3Q5F A;  2P5V A;  3P7N A;  2Y0M A;  1FZP B;  2MH9 A;  1XDS A;  4PZJ A;  1XMK A;  5LRR A;  2GAU A;  1A04 A;  1FSE A;  2CO5 A;  3EUH A;  2Z9O A;  1IAW A;  2OZ6 A;  1V3F A;  4N0B A;  3R61 A;  2XAF A;  2R3S A;  2OBP A;  1KYW A;  2A6E F;  3HRU A;  4WF2 A;  1HW1 A;  3D5L A;  5CLS A;  4LG0 B;  4KN7 X;  2X0L A;  1ONV A;  4O6J A;  2H6C A;  4RB0 A;  2RDP A;  2ZXJ A;  2QZ8 A;  3TQN A;  4PGG A;  2M5W A;  5CVR A;  3COA C;  2DU9 A;  1X3U A;  1MJA A;  2WV0 A;  4RB1 A;  2O03 A;  1QQI A;  1T39 A;  4QWQ A;  3KFW X;  1FYM A;  2L54 A;  4ENN A;  2HYG D;  4ZZD A;  2CQK A;  2GIV A;  3HHG A;  1TQP A;  4EMS A;  1R00 A;  2VOP A;  2DI3 A;  2D1H A;  2GXB A;  2ISY A;  2VXZ A;  5EEH A;  1IZ1 A;  4IF4 A;  3GZ5 A;  3O3K A;  4EVI A;  2VON A;  2HS5 A;  3OOP A;  3V7S A;  2VN2 A;  1ON1 A;  2RV8 A;  5LGU A;  3RDI A;  4HDV A;  4KYW A;  4HLX A;  2ESH A;  1LDK B;  2OQR A;  1B59 A;  3C1D A;  4O5V A;  3BP8 A;  2HQR A;  3LAJ A;  4M6Y A;  4YIF A;  1SFX A;  3HHH A;  3FXR A;  2VOD A;  2FBH A;  1T0F A;  4ETS A;  2WC2 A;  1DP7 P;  1JXS A;  4ENK A;  5BQT A;  3J80 K;  4IJA A;  4UV9 A;  4KIF A;  1SD7 A;  3JTH A;  2D1V A;  4QLC U;  1W5T A;  1HSJ A;  3ML6 A;  2L01 A;  4AVP A;  3E3V A;  2F5C A;  2VE8 A;  3ROU A;  4XRF A;  1O3S A;  1SD4 A;  2JRT A;  4UUV A;  2DQL A;  4IVN A;  1ZAR A;  3Q9V A;  2H6B A;  1WQ2 A;  5K5Q A;  2JTV A;  4RGU A;  3LST A;  1XGN A;  1ZRC A;  1D8K A;  1QZY A;  2MBF A;  2RVC A;  4Y17 A;  2V1D A;  3V7C A;  1FBQ A;  1W5S A;  4LK1 F;  2HWV A;  1BOA A;  2ZO4 A;  2IT0 A;  2DK8 A;  2GXG A;  5J8F A;  1OR7 A;  2HEO A;  1R36 A;  4OIN F;  3RI4 A;  3T5X A;  2V6C A;  3T8R A;  3F8M A;  1Q1H A;  1KU2 A;  1PDN C;  3TOA A;  4RGX A;  4HF2 A;  3K1P A;  1R1T A;  3WTW C;  3PQJ A;  1ZH5 A;  3KP2 A;  1P4X A;  2EB7 A;  1TQM A;  2BYV E;  3GFJ A;  4DQ2 A;  4EM0 B;  2O0Y A;  3V8L A;  2Z3Y A;  3E6M A;  2RGV A;  1YW9 A;  1EH8 A;  2A61 A;  1LEA A;  5LHG A;  4HA8 A;  2A3S A;  2ZFW A;  1T98 A;  1Y0U A;  1Z6R A;  3CUQ C;  4IHS A;  4B09 A;  4B8X A;  3GLX A;  2EK5 A;  4KA4 A;  1O7L A;  2M8E A;  4CIC A;  3S2W A;  1LJ9 A;  3LA3 A;  1SAX A;  1XDU A;  5DD4 A;  1KU7 A;  4GYG A;  3FXQ A;  2Z5U A;  1Z6T A;  4Q5S F;  2VT3 A;  1LNW A;  3WTT C;  5DEQ A;  1OYY A;  2AXL A;  2OD5 A;  3CLO A;  4FX4 A;  3RPU A;  3RYP A;  4R8H A;  2FBK A;  2FML A;  1W7P A;  2QBY A;  3L09 A;  2PI0 A;  3FX3 A;  1S29 A;  1KA8 A;  4TV7 A;  3KP7 A;  5D8K B;  1S6L A;  1E17 A;  3CUQ B;  3R6S A;  1KQ0 A;  3WU0 A;  1F5T A;  3VFZ A;  4MTD A;  2XHK A;  4L0Z B;  2HDC A;  3N4M A;  1MDM A;  4CO8 A;  5H6R A;  4CZZ A;  1BC7 C;  2PBI A;  5D6F A;  3GZ6 A;  2QVO A;  4A0Z A;  5CVJ A;  1KQ9 A;  2O61 A;  3HSF A;  5HVQ C;  3ZMD A;  5H6Q A;  4OU0 A;  3F8N A;  2Q2E A;  2XKP A;  3LQR A;  1XCB A;  2F5D A;  4GYI A;  1O3R A;  3FMS A;  3AAF A;  1IRF A;  3WOD F;  5DCM B;  1IW7 F;  4G7O F;  3BPV A;  1U5T A;  4WX9 A;  1B4A A;  4L9N A;  6PAX A;  4AIK A;  1R1V A;  2K4J A;  3F6O A;  1SFE A;  2UZK A;  3LFK A;  3G73 A;  1TW3 A;  3B02 A;  1CF7 A;  2IRF G;  2DK5 A;  2HFH A;  3SXY A;  4EV0 A;  5E1W A;  2QQA A;  2UWM A;  4LB6 B;  1J2X A;  3CO6 C;  1RNL A;  2LSO A;  4U0V A;  1BI1 A;  3IRR A;  3HSE A;  4PDK A;  4ZYG A;  4P5O A;  2E1N A;  4EJV A;  1I5Z A;  4JK1 X;  3DF8 A;  2XVC A;  4I0B A;  2A07 F;  5L3F A;  3E97 A;  2M1B A;  2G7U A;  2K27 A;  1R7J A;  3DV8 A;  1P4A A;  2XRO A;  1UHW A;  1UCR A;  3TOB A;  2XAQ A;  5L3D A;  3ZN1 A;  2J5P A;  3I59 A;  3C18 A;  1FBU A;  3J7A O; 
#chains in the Genus database with same CATH topology
 2LY1 A;  4CCL A;  3W2W A;  1GHC A;  4LMY A;  2V9K A;  3EQL F;  1IN6 A;  1YO5 C;  2ZCW A;  1ENH A;  3OOU A;  2M4K A;  4AUX A;  5ICF A;  2VJ5 A;  2DAO A;  4XMY A;  1H9G A;  3WTY C;  1ZN2 A;  4E7S A;  4YII A;  5HLT A;  1RUO A;  5DUI A;  2DMP A;  1FIA A;  3F3X A;  4M9X A;  5DM6 F;  3MZH A;  1ETY A;  2E1O A;  3DEU A;  3LA7 A;  1YJN I;  2BBY A;  3H92 A;  1B72 B;  4PK4 A;  4D7M A;  1DU6 A;  2MFZ A;  2R4G A;  3OS0 A;  2OC6 A;  4Q4Z F;  1FJL A;  2M45 A;  3SZT A;  1QHH D;  2GZW A;  1PVE A;  2R92 J;  2VI6 A;  2PN6 A;  1D5V A;  2XPU A;  4MQV A;  3S17 J;  3ZMT A;  3DWL E;  3QP6 A;  1AOY A;  2YS9 A;  2CYY A;  2VQH A;  2Y0S A;  1G3T A;  1XSV A;  5D5X B;  4FCY A;  4OAY A;  2EH3 A;  1UEL B;  4XQF A;  2EJR A;  2KIF A;  5B1B H;  1SFK A;  3PFI A;  3E6C C;  1QGP A;  3KZY A;  3GFM A;  4M72 A;  2K9M A;  4W97 A;  3BG7 A;  5AIP A;  4I02 A;  3GF2 A;  5FFZ A;  4EJO A;  5LD2 C;  3GUD A;  4ZTF A;  3ECH A;  2LH9 A;  3WTZ A;  2MSY A;  1X1P A;  5E20 A;  3I58 A;  2IA1 A;  2DMU A;  4BHC A;  1V4R A;  3JRF A;  3U21 A;  1HQC A;  2XPV A;  1E2X A;  1MMD A;  3BR2 A;  4RBO A;  3LSR A;  1RC9 A;  3HUG B;  2WB1 N;  3KYD B;  3M8E A;  3ONQ A;  4RA2 A;  5K1Y A;  1X1B A;  4KT5 C;  5JR3 A;  2BHY A;  1K79 A;  4HW0 A;  4E70 A;  1GT0 C;  4CH7 A;  3QPS A;  4M71 A;  5DS9 A;  2A6H F;  4NQW A;  3A0B C;  4BAC A;  4XLE A;  3WGI A;  3RZO J;  2WY7 Q;  4FAS D;  3PO3 J;  1PUE E;  3A03 A;  3T8T A;  5E1X A;  2R7Z J;  2F4O B;  2PMH A;  2XSJ C;  4FT8 A;  1G3Y A;  4Q48 A;  1MNE A;  2LYC A;  5HDG A;  2G9W A;  3BJ6 A;  2LF8 A;  2OZU A;  2ZME C;  1ZGJ A;  2F5V A;  5HLG A;  4UNO A;  3C2G A;  2IGN A;  2HXI A;  1TW2 A;  4CXF A;  1A36 A;  3CDI A;  3R0J A;  5KAI C;  5HOO A;  2P7C B;  3PNV A;  3W3C A;  1CQT A;  2H94 A;  2E7W A;  1DGR M;  3KET A;  2GA2 A;  4G9Y A;  3QOP A;  4CA0 A;  1ULY A;  1N25 A;  3ZQC A;  1JKQ C;  1K6O A;  2DA2 A;  2HQN A;  5F08 A;  1UZC A;  4LD5 A;  3A4C A;  2KRF A;  4MHG A;  4MLO A;  2D5V A;  1MH4 A;  2YU3 A;  2VBY A;  3ZQ7 A;  4WXH A;  4DNC A;  3I55 I;  4RAF A;  4J00 A;  5DV5 A;  2FXA A;  2ZXW H;  3J7A Y;  2MA3 A;  3RKY A;  4OWR B;  2DBB A;  3AL0 C;  2ELH A;  3UR3 C;  1V5E A;  3TO6 A;  2NNN A;  1RIO H;  3NWT A;  3FMQ A;  3E5Q A;  2EZI A;  3DPU A;  3LWF A;  1J09 A;  4N4N B;  5LHH A;  2HYF A;  3NWS A;  4FE4 A;  1VTN C;  2JPC A;  2K3F A;  1YI2 I;  1W36 D;  2BZT A;  4Y13 A;  4IX7 A;  1P6R A;  4QIW N;  2ZSH B;  5AON A;  2H8W A;  1RKW A;  1ZRD A;  4IHT A;  1FOX A;  2XGX A;  2DOA A;  4HYE A;  1FYK A;  5F1J A;  3J81 Z;  2VL8 A;  4Y3O A;  2HTS A;  2W24 A;  1TT0 A;  4IOC F;  1BM9 A;  1IF1 A;  1PYV A;  5DD8 A;  2HGC A;  4NUB A;  1GVD A;  3SHF A;  3WG9 A;  3CCM I;  1R58 A;  2JSP A;  2KIU A;  3QQA A;  2MYS A;  3RPU D;  2R7D A;  3CQZ J;  3CDL A;  4YEJ A;  4LLL A;  2QEN A;  3IH2 A;  1PJR A;  4CHU A;  2DPD A;  2V9P A;  1R71 A;  2CUF A;  4D5C A;  4ZYE A;  1GLN A;  3DLA A;  3O2P E;  3LA2 A;  2LC2 A;  1Z1D A;  1R5G A;  1U5T B;  2DFI A;  5IP9 J;  5EZG A;  4A3F J;  5E3M A;  1ZRE A;  3DLL F;  1Y39 A;  2IXS A;  4MTE A;  1TBX A;  3LMM A;  5LRS A;  3AG3 H;  4B43 A;  1FIP A;  2FNA A;  4P9F A;  2BY2 A;  4A3M J;  4D5F A;  3A1Y A;  1IXC A;  2GWR A;  1SD6 A;  3OYL A;  3S1Q J;  2K86 A;  4XSZ F;  2IBD A;  1B6A A;  1BBY A;  2QM3 A;  3TDZ C;  1MIJ A;  1T6S A;  3CCY A;  1J0R A;  2FUG 2;  4BY7 J;  5E1Z B;  1U9N A;  3IP4 B;  3RSN A;  1AA7 A;  5FKK A;  1KU3 A;  5DCM A;  3CO7 C;  1X1A A;  2IGK A;  1LUJ B;  1O57 A;  1MBG A;  2P6T A;  3QU6 A;  4M6V A;  3OV8 A;  3FXJ A;  5LBQ A;  4S05 A;  1ZG3 A;  4BL0 B;  4HX7 A;  2O9L A;  2KKO A;  5LFA A;  4DYQ A;  3HRT A;  2LNB A;  2X6X A;  5J1U A;  4NQW B;  5DDG A;  1NG6 A;  5AIQ A;  1EH6 A;  1MSE C;  3HC7 A;  1MBK A;  1XD7 A;  1IN8 A;  3K9T A;  1S8N A;  1HST A;  3MZY A;  4G6D A;  2R7W A;  2M87 A;  5GAH J;  2C6Y A;  2IVM A;  3OYI A;  4E7I A;  2LOO A;  3R4K A;  2VBX A;  4EJU A;  4G8X A;  3RKX A;  4ASN A;  4EQQ A;  4KIS A;  2EIN H;  2ZNZ A;  3K2Z A;  2XF7 A;  3ABL H;  4UXN A;  1POG A;  2A69 F;  4BNC A;  5ILU A;  2KIM A;  3WE2 A;  4MFE A;  2V7F A;  1U5T C;  3JRG A;  3ZMZ A;  2L5Q A;  5BOX A;  3RTR A;  4XKW A;  4IHW A;  2X6O A;  3QWL A;  2CQN A;  3RJP A;  5FKN A;  1U8R A;  3V4G A;  1EH7 A;  2LY2 A;  3GYH X;  3TW6 A;  5EGO A;  2HKO A;  2WAE A;  2JA2 A;  2YX4 A;  5E17 F;  3GTM J;  3WU1 B;  2Z1D A;  2LBF B;  4XID A;  4L5J A;  3ERE D;  1MH3 A;  2V1N A;  2WAD A;  1OYW A;  3F8C A;  1ZKG A;  4KDP A;  4CCK A;  3OYM A;  1G3S A;  3C2B A;  4OIO F;  2CW7 A;  1TTY A;  3EUK L;  4WCG A;  2STT A;  1UB9 A;  3EYI A;  2VB6 A;  4RLF A;  2W84 A;  2R7X A;  3E7L A;  5DYM A;  2K7L A;  2NAZ A;  3CCS I;  2OA4 A;  3GTQ J;  2PQ8 A;  2FNP A;  1QVT A;  2JVG A;  3I71 A;  1HKQ A;  2K3P A;  1H88 C;  1QPI A;  2L4M A;  3IL2 A;  1ZLJ A;  4UUS B;  5E79 C;  2Y75 A;  1S5L C;  3BQZ A;  2N8G A;  2HOS A;  5CVV A;  1SMT A;  3OYE A;  4CYD A;  4D7N A;  3O6B B;  2HOT A;  4HNV A;  4A3G J;  1X19 A;  4MEY F;  1OPC A;  1YRN B;  5F6F A;  1HBX G;  2UV1 A;  3E5U A;  4HOB A;  1SVO A;  2DOF A;  3KEO A;  3F21 A;  2ZBK A;  3K69 A;  1I6H J;  3KP5 A;  2M0M A;  2X4H A;  3KX2 A;  4RB2 C;  1J59 A;  1SFO J;  3OIP A;  3P9C A;  2I8D A;  1MMG A;  4WWC A;  1WJA A;  4LB5 A;  1DQU A;  4ZDL A;  3AG1 H;  3S15 J;  1DU0 A;  1MBE A;  2RNG A;  2E5N A;  3GZN B;  4B3X A;  3HDD A;  4Q47 A;  3JRI A;  3BT9 A;  2V1U A;  1R9T J;  1I1G A;  1AU7 A;  2P7V B;  1BC8 C;  3CUO A;  4LG0 A;  1VQ7 I;  4M3E A;  4F93 B;  3L2U A;  4AD9 A;  3FXK A;  2MD5 A;  1IGN A;  4A3J J;  5K7F A;  1ZGA A;  1WHU A;  2FQ3 A;  2DA7 A;  2HOE A;  2LR8 A;  4HSR A;  4BDZ A;  1IN7 A;  5ILV A;  3KP4 A;  4HF0 A;  1R22 A;  4Z2Y A;  2CSO A;  3H3V K;  2A5Y B;  3W6K B;  2FA5 A;  1MJ9 A;  2NOG A;  3N05 A;  1J75 A;  1Z3X A;  1R4N B;  4NC7 A;  3GO5 A;  3HPG A;  1D8J A;  3BJA A;  5KVR A;  1FOY A;  3QPH A;  3H5A A;  4IKF A;  2G0E A;  2E5Z A;  3EET A;  3OL4 A;  1QZZ A;  3UNG C;  3AKZ A;  2QBY B;  4RDU A;  1CF7 B;  2F4M B;  3K4J A;  4OIR F;  1MZB A;  3HG9 A;  1IN5 A;  3MQ0 A;  5J3L A;  3LL7 A;  2LLK A;  2QYO A;  4I0A A;  2QF7 A;  3ZXS A;  3CC2 I;  5ILS A;  2EIM H;  3OR2 C;  2HXO A;  2XAG A;  3SFZ A;  5FKO A;  2GBY A;  2EIL H;  2HTJ A;  3PUF A;  1NK3 P;  2HZT A;  2L7M P;  4HBL A;  1ZLK A;  2VC0 A;  4YG2 F;  4WXC A;  2PFB A;  1LVA A;  3JAM Z;  1DP3 A;  1BR2 A;  4PSW A;  5EEG A;  1B8I B;  2WAQ N;  2FD5 A;  2K02 A;  4II2 A;  3RIR A;  1B9M A;  3TDU C;  3U1K A;  1O7F A;  4A5M A;  2VJJ A;  1U3E M;  1XCV A;  2BY3 A;  2Y30 A;  1P7I A;  3S32 A;  2MAB A;  1TL8 A;  1L0O C;  3PIP F;  2V26 A;  3D0S A;  1YX3 A;  3HIF A;  4UHT A;  4AC0 A;  1HW2 A;  2ELK A;  3EPZ A;  1X4O A;  3V7R A;  4M74 A;  2LP0 A;  1KGS A;  2X48 A;  4EM2 A;  1APL C;  2CFX A;  3RYR A;  1NG7 A;  2DQR A;  2E2J J;  2XGC A;  5EEA A;  5ICE A;  1FY7 A;  2OV7 A;  5B66 C;  2VC1 A;  1W4M A;  2A6T A;  4RAY A;  3OIQ A;  4AID A;  4CUG A;  4JYK A;  5BS6 A;  2EV5 A;  2IS1 A;  1U9O A;  3BQY A;  2NVT J;  3G2B A;  4HPQ A;  1QRY A;  4R79 A;  4IO9 F;  3WGG A;  3KLO A;  1FTT A;  3S2D J;  3FWE A;  2EFP A;  2IGO A;  1RZ4 A;  3DTI A;  3DTE A;  3CMA I;  3VYS B;  5KHD A;  5L3G A;  2JZY A;  4XR6 A;  1UMQ A;  4Y33 A;  1EV7 A;  4XOT A;  3GTJ J;  4A12 A;  1FYL A;  5CJ9 A;  1GV2 A;  1WGX A;  4HV5 A;  2CUE A;  1WKM A;  1RRJ A;  2EQR A;  2MLG A;  1A5J A;  1MGT A;  1JUM A;  1SD5 A;  2E19 A;  1ETO A;  3C7J A;  2BXZ A;  5EJC A;  4DZJ A;  3GFI A;  1UJ8 A;  5EYR A;  3CCV I;  1UFM A;  3T1B A;  3KEY A;  1LB2 A;  2HR3 A;  4HX4 A;  1MKM A;  3IKV A;  1TNS A;  4JBA A;  1P4W A;  4A2U A;  2H1L A;  1HOM A;  3K4B A;  2BEO A;  1WJD A;  2E1M C;  3K2A A;  3VPR A;  5IPA A;  3F72 A;  1GDT A;  5J8C A;  3GME A;  1V5F A;  4BXF A;  5IT9 Z;  4N4O B;  1R5H A;  2CQX A;  5TJJ A;  2YX7 A;  2CQQ A;  5E8I A;  4EGZ A;  1LEB A;  3G1O A;  1ITY A;  5M5X J;  3T0Y A;  1XMX A;  1HLV A;  3G3Z A;  4L5I A;  3ZP5 A;  4GCV A;  2MC4 A;  3H9Q A;  1KYZ A;  5K7H A;  2K40 A;  3U9G A;  3CME I;  2JVH A;  3SQN A;  1D1A A;  2LDU A;  1QPM A;  3OR1 C;  3HOT A;  2TRT A;  1T8I A;  3K4N A;  4U7B A;  3D5R C;  4ZTJ A;  3IH4 A;  4G7Z F;  4BU2 A;  3CCE I;  3VOE A;  5FD6 A;  2ACJ A;  1ETQ A;  1ON2 A;  1LDJ A;  4FET A;  2KLO A;  2IS2 A;  2MC3 A;  1YW8 A;  3E1S A;  4A6D A;  2X1D A;  2CW8 A;  2ECB A;  3D1N I;  4RS8 A;  1H8A C;  5B5E C;  4EJT A;  4N9I A;  1Y8Q B;  2DFE A;  1F1Z A;  2VKH A;  3WGH A;  2LMD A;  3MMY B;  1R6R A;  2OU2 A;  4HLY A;  2JA5 J;  2O8X A;  2CG4 A;  4L18 B;  1JTY A;  1CGP A;  3P9I A;  2E1M B;  1FLI A;  3CJT B;  3ULQ B;  3ASO H;  4CCM A;  3UKG A;  3S2H J;  2L3D A;  4M9Z A;  3MZ8 A;  1DPU A;  1RPW A;  2NVY J;  4BQN A;  3TBI A;  2ZJR F;  4EAT A;  2O7O A;  4E7H A;  5F64 A;  2E35 A;  4DIQ A;  2KIS A;  2CWE A;  2FU4 A;  3BR3 A;  3GXO A;  3LSM A;  4HQE A;  2X6Y A;  4UV8 A;  3KEQ A;  2P5K A;  1ZYR F;  1LKX A;  1RR7 A;  2P5L C;  1WI9 A;  1X2M A;  4FX0 A;  3TP3 A;  4ZZL A;  3V8J A;  4WK8 F;  3JRC A;  2HKX A;  2EIK H;  2Y0S N;  4IXA A;  4XSX F;  3I56 I;  1PP7 U;  3VYT B;  1FC3 A;  3E5X A;  4GXO A;  1ETV A;  1ODD A;  5CQG A;  1WRJ A;  2Q1Z B;  1YS7 A;  1QBJ A;  1DPR A;  4IHX A;  2K9Q A;  1LE8 A;  2EWN A;  4MO7 A;  4XIC A;  4HQM A;  4ON0 A;  2QKL B;  1LFP A;  4FTH A;  2Z16 A;  1FWZ A;  1RKT A;  2RQQ A;  1GUU A;  2A05 A;  3GFL A;  2L9R A;  2STW A;  3OYC A;  4MNU A;  4ESB A;  5D4R A;  1AKH A;  2H27 A;  3NRV A;  2OPT A;  1BR1 A;  4ESJ A;  3H3U A;  2ZNY A;  3TO9 A;  4PJL A;  5HS7 A;  1OYI A;  3IWZ A;  1F4K A;  1QA6 A;  3MKL A;  3TP0 A;  4Y7N J;  1HW5 A;  4RGR A;  1Y8R B;  1R1U A;  1DDN A;  1IXS B;  1XTA A;  3TO7 A;  1MBF A;  2RC4 A;  4UVA A;  5FRM A;  3E6B A;  4XLH A;  2ECC A;  1FP1 D;  1PP8 F;  1VQM I;  4BUP A;  5JVG F;  3K10 A;  3M1E A;  4XLA A;  2F2E A;  2FEZ A;  3RZD J;  2DXI A;  1YQA A;  4L9V A;  2HQ5 A;  2Q8K A;  3S14 J;  4P55 A;  1FBS A;  1VQK I;  1YS6 A;  3HJE A;  3EUA A;  5D6E A;  1XN7 A;  3KZZ A;  3QU3 A;  3OL3 A;  1O3T A;  4UUT A;  2MLK A;  4HEA 2;  2XAS A;  1MJB A;  4X6A J;  3HKZ A;  3GLL A;  1Y1V J;  3PUB A;  4BJ5 C;  4XRS G;  3F23 A;  4OMY A;  4BQO A;  4I7H A;  2GIZ A;  2V79 A;  5KCM A;  1BI2 A;  5F04 A;  3I53 A;  4ENM A;  1ZG1 A;  3GWZ A;  2YPR A;  2W7N A;  3M7G A;  1WJF A;  3IWF A;  4BEH A;  5E3N A;  5L3B A;  3CMY A;  3GEZ A;  5FLX K;  3U2R A;  2EZH A;  3RKW A;  5FJ8 J;  2GOX B;  3MWM A;  3CMM A;  1LPQ A;  2R5Y B;  3A2K A;  5FD5 A;  1XGO A;  1YOV B;  1Y1W J;  2L4A A;  1FPQ A;  3ELK A;  4AYB N;  1K83 J;  4LFU A;  1BI3 A;  1SMY F;  3ZQH A;  4F92 B;  1I3Q J;  4KN4 X;  3LFU A;  3WHC A;  2IJL A;  5J6X A;  2BXY A;  3L2C A;  1S7E A;  5IP6 A;  2XAH A;  5F1R A;  3PQK A;  2ESN A;  4CSW A;  3HKZ N;  2PJP A;  4XLP F;  2E1C A;  3QAH A;  3FK6 A;  5FLV A;  3BY6 A;  2EV6 A;  2F6C A;  2BW3 A;  3CUQ A;  5D5W B;  3HOY J;  3KE2 A;  3ZMS A;  4I76 A;  2P4W A;  1MBH A;  3GBG A;  2B7E A;  4RMN A;  2V1X A;  2HU9 A;  1LFB A;  3CLQ A;  2Y9Z A;  1BI0 A;  3WTU C;  2AXT C;  3PSF A;  2Z33 A;  2R7Q A;  3DKX A;  4M6X A;  3CDH A;  2M30 A;  4RGS A;  5L3C A;  4PCQ A;  1IG7 A;  1IUF A;  2H09 A;  2W48 A;  4WXD A;  3F0C A;  1HF0 A;  4S0H B;  2GA1 A;  4V19 K;  2DLL A;  4MGR A;  4E6K G;  5L3E A;  2KHM A;  1L3L A;  4AIH A;  1QNT A;  3ESW B;  2AS5 F;  4OMZ A;  3TGN A;  1HKS A;  1YIO A;  4BQA A;  4P96 A;  3EUH C;  3IC7 A;  1DUX C;  2XGD A;  1STZ A;  2R5Z A;  2CW0 F;  2XB5 A;  3Q0V A;  5EGO B;  1A35 A;  4XKB A;  2DA4 A;  1FT9 A;  2OF7 A;  3CTA A;  3L2W A;  3R0A A;  5IT3 A;  5FFX A;  1GVJ A;  3M1C A;  4M73 A;  2JPB A;  3GX4 X;  4K2E A;  5BPI A;  3DFG A;  2Y31 A;  3QPT A;  3ZQG A;  2NS0 A;  2FQ4 A;  2Q0O A;  4XON A;  3K70 C;  3B6A A;  5EF6 A;  2M3A A;  4BHB A;  3BRO A;  4KMU X;  4DGW B;  1YYV A;  4U87 A;  1I50 J;  2EFO A;  1IRZ A;  1I1S A;  4OIP F;  1LVK A;  1SVL A;  3CCR I;  2CRG A;  3QOD A;  5FO5 A;  4BAY A;  3R60 A;  1D3Y A;  1Z91 A;  2WAQ A;  4S04 A;  3F22 A;  2XIG A;  1XGS A;  4ZYA A;  1M1E B;  5IYB J;  4LLN A;  2UUZ A;  2P81 A;  4UVB A;  1BA5 A;  5J40 A;  2NYX A;  3REO A;  2LRE A;  1IV8 A;  1OMI A;  3PSI A;  3GTK J;  4DZP A;  2EFW A;  3BPX A;  2RKH A;  2AO9 A;  2W82 A;  4GDF A;  2XPW A;  4UB6 C;  1U6G A;  2DDA A;  1J5Y A;  2WTE A;  3DPT A;  2OCC H;  3X2Q H;  2KDO A;  1GXQ A;  2KPM A;  5DCF A;  1R49 A;  1C0W A;  5ICC A;  3FIS A;  1JKP C;  1X58 A;  3BG3 A;  1OFC X;  1K61 A;  2KIQ A;  3DTK A;  2EBI A;  4GO1 A;  2VBZ A;  3P5J A;  1B1B A;  2PMU A;  5FLX Z;  1R23 A;  4PJN A;  3C3W A;  3JSP A;  2ZJQ F;  2NVQ J;  2B63 J;  2HZD A;  3P9K A;  3DPL C;  2K4B A;  2M0C A;  1Z9C A;  1VQP I;  3V8K A;  2L02 A;  4BEH B;  1K7A A;  4BHP A;  4ZYH A;  5ICG A;  1GXP A;  4H4K C;  2MH2 A;  3BLY A;  2X1E A;  1R4M B;  3L2Q A;  2EZL A;  3HB9 A;  1G8X A;  3K6G A;  4HAM A;  2EA4 A;  1YJ9 I;  2EFQ A;  4XRM A;  1YFH A;  1XMA A;  2DYS H;  3EYY A;  2QQ9 A;  3M9A A;  4I09 A;  2W57 A;  3M8F A;  4N9H A;  4V2F A;  1W7P B;  3PNT A;  1OQY A;  2DJI A;  1U8B A;  5FKL A;  3JSO A;  2XV4 S;  1OKR A;  2JQ7 A;  2DT6 A;  3B73 A;  4HNU A;  4KIB A;  4FHT A;  1OCP A;  2QUF A;  3KP3 A;  2AQF A;  1OCT C;  1VF9 A;  4MEX F;  4ZYD A;  4A3K J;  1IN4 A;  1JKR C;  1UHS A;  4CCN A;  4D0P A;  3BZ6 A;  5GTI C;  1IUY A;  1XGM A;  1SAU A;  1VQ9 I;  3LSI A;  2O6G E;  2Y2Z A;  1MDM B;  4KIT B;  3G71 I;  2OTJ I;  4BBS J;  3CES A;  1RI7 A;  3BTL A;  4M3F A;  3TL4 X;  4ESF A;  5GPC A;  2LF7 A;  2RN7 A;  1I39 A;  2OAZ A;  1XSD A;  5LHI A;  1MBJ A;  2VAS A;  3H9J A;  3BZC A;  3EDP A;  1UG2 A;  2LBF A;  4XOR A;  3M3Y J;  4LJZ F;  4OIQ F;  1BN5 A;  5JVT A;  2LTP A;  1J7K A;  1TP4 A;  3BTC A;  2UXN A;  1QO0 D;  1GV5 A;  1BIA A;  3OMY A;  4IQ4 A;  4RM2 A;  4A6E A;  4RB3 C;  2KRC A;  3VYR B;  2R7V A;  4IPA A;  2PEX A;  1D1C A;  3L7W A;  2Y48 A;  3FXU A;  4C3H J;  1R5I D;  2FMY A;  2DO7 A;  3JRE A;  1LE8 B;  3I5U A;  2PLY A;  5LGT A;  3KPH A;  4ZDP A;  1BJZ A;  4BXU A;  5E3O A;  4I01 A;  4E7K A;  3BR6 A;  3E6D A;  3ABT A;  2GQQ A;  3IHU A;  3S1R J;  3ERM A;  1RR8 C;  2ZME B;  4OOI A;  1YIJ I;  1HC8 A;  5BPD A;  1X4P A;  1WH7 A;  1AKH B;  3FHN A;  3K4M A;  1IDZ A;  2KL4 A;  4Y4R A;  4F3Q A;  1XSX A;  1N75 A;  2B0L A;  3F9K A;  3MKY B;  1XPX A;  3F8F A;  3KP6 A;  2FSW A;  3VOD A;  2ADU A;  2QGU A;  3G1M A;  3K4L A;  2W00 A;  5EZH A;  2CMP A;  2EV0 A;  4YFX F;  3LNQ A;  1VI0 A;  2JT1 A;  1KU9 A;  2W85 A;  4EGY A;  1K4T A;  1J9I A;  2WWY A;  2D45 A;  1YW7 A;  1TT5 B;  4KFC A;  5CPR B;  3MAJ A;  1LQ1 A;  2DW4 A;  2XAU A;  2WV1 A;  2LD5 A;  1JI8 A;  4YFK F;  3HTS B;  3KZI C;  3OWT A;  1TQI A;  2QSF X;  2ID3 A;  4HF1 A;  1IRG A;  4BQQ A;  5GAD J;  4UVC A;  3Q9S A;  1DGW Y;  1SEU A;  2VE9 A;  2NRA C;  4H0E A;  2COB A;  1WSU A;  5JFR A;  5GP9 A;  4A93 J;  1OCZ H;  1TWC J;  4JP0 A;  2FF4 A;  4YEL A;  2FRH A;  5CYV A;  2OUM A;  2R7F A;  2XUB A;  2VQG A;  3GVA A;  3KCC A;  1JGS A;  1U0J A;  2XGE A;  2GOM A;  5A2Q K;  4CYC B;  3K1M A;  1K78 B;  2VOO A;  3D5S C;  5BNG A;  3CCU I;  2YR2 A;  3HTU A;  2HDD A;  1OJL A;  3I64 A;  5CVI A;  4C3I J;  1ZRF A;  2VKV A;  3OIO A;  1H9T A;  4RLQ A;  4XN0 A;  5TRD A;  1Z05 A;  2LKP A;  2XDV A;  4MQ9 F;  2OQG A;  5KK1 A;  1E3O C;  2JMW A;  4KIC A;  2E2H J;  1ERD A;  1TWF J;  2XKO A;  1YIT I;  3S3M A;  3PJR A;  3BR5 A;  1JUP A;  2BHZ A;  4LGW A;  3BTI A;  4DOZ A;  1YG2 A;  2AHQ A;  2VT2 A;  3FM3 A;  3LSH A;  4U0W A;  5FB2 A;  3K4C A;  4A3D J;  1ZAO A;  3FHZ A;  4LLG F;  5HOD A;  2HYJ A;  2NVX J;  2HQA A;  3J7Y J;  4XLF A;  3ZPL A;  4AYB A;  5BMZ A;  4YIR X;  3MCZ A;  1EKE A;  2P8T A;  3JAM K;  3CJQ B;  5IY5 H;  1TC3 C;  3GTL J;  1FSH A;  5F0C A;  1MD0 A;  1S7A A;  3ZN0 A;  2QSH X;  3S8P A;  5K5O A;  5IT9 K;  3WU2 C;  2NXN B;  1SC7 A;  3I59 B;  2E34 A;  5D5V B;  1E0E A;  2KFD A;  2J5O A;  2R7T A;  2BV6 A;  3FZV A;  2WBM A;  3WTX C;  3HOZ J;  2FBI A;  1AWC A;  2DT5 A;  1UAA A;  1JHF A;  4U7D A;  3V42 A;  4BXX J;  1UST A;  5CKT A;  3C2H A;  4FQG A;  2DA1 A;  1NHA A;  4BYY A;  5E18 F;  1XB4 A;  3ZMV A;  1P9Q C;  5JI6 A;  1MW7 A;  1JHH A;  1IXR C;  2BGC A;  3NQO A;  3ZQI A;  1BJA A;  3IKT A;  2L0K A;  4AIJ A;  4G7H F;  5HS8 A;  2WAF A;  2NOJ B;  1P2F A;  3JRB A;  1W7P D;  4HZF A;  4C2U A;  4IRG A;  2L9V A;  1RUN A;  4HDU A;  3U1D A;  1G6N A;  4KUM A;  2EZK A;  4IRI A;  4FIS A;  1VQ6 I;  5JHU A;  3IRQ A;  1ZR4 A;  2MW8 A;  2IPQ X;  1QU3 A;  3BJO A;  1MMS A;  1HA8 A;  2V4J C;  3F8B A;  3MEX A;  1W1W E;  3TKY A;  2F5E A;  3FF5 A;  3LQQ A;  1W5C C;  2LG4 A;  3JTG A;  4QTR A;  2ZSI B;  2F5F A;  5CVU A;  1FX7 A;  4XKV A;  5HDN A;  4AVZ A;  2ISZ A;  3BR1 A;  1U78 A;  1HXD A;  1X1D A;  1B9N A;  4KMF A;  4CDG A;  1G2H A;  4ZDO A;  4G6T B;  1T2K A;  1WJC A;  1FNN A;  2Z99 A;  5GAG J;  3K70 D;  4E7J A;  2QWW A;  2W25 A;  3PNY A;  2DJN A;  2E36 A;  5GPA A;  3NAU A;  3JW4 A;  2Z2S B;  3MKZ A;  2YSR A;  1BR4 A;  1ZG5 A;  1I27 A;  4M9S A;  1YTY A;  3DXJ F;  3CF2 A;  3HRM A;  4BKX A;  4NHJ A;  3RKQ A;  5M5W J;  1VQO I;  4A0X A;  1FP2 A;  1IDY A;  1JT0 A;  2V9V A;  4QPQ A;  5HLH A;  3WTS C;  4XLC A;  3J81 K;  2KJC A;  2PJR A;  2HVS A;  1Z3Y A;  3DKY A;  5TIS C;  2JUG A;  2R0Q C;  5C3E J;  3CF5 F;  2E7X A;  2IP2 A;  2PG4 A;  3VB2 A;  4B1R A;  2XF6 A;  1FMW A;  5HLI A;  5J47 A;  4ENJ A;  5D5U B;  1B8I A;  3FMR A;  2OCE A;  3TMO A;  1SVM A;  3CZ6 A;  1S9H A;  4B48 A;  2XF5 A;  3B6C A;  3SZP A;  1ETX A;  2BVM A;  4L0Y B;  4A5N A;  4JX6 A;  4EJW A;  4HV6 A;  4JX4 A;  4HG2 A;  2O5R A;  1WJ5 A;  3HOS A;  3I4P A;  2X85 A;  3LSP A;  3BDD A;  2CU7 A;  2CFO A;  3F6V A;  4P9U A;  1ZGW A;  5C4J J;  2O3F A;  4PSX A;  1F9N A;  4PFO A;  4F7Z A;  1U2W A;  4F55 A;  2ME0 A;  2DDB A;  4G94 A;  5E8G A;  1O4X A;  2D2W A;  5D8L B;  3HOW J;  2EA2 A;  3PM1 A;  1WWX A;  2G7H A;  3SJM A;  4A0Y A;  3BWG A;  4NB5 A;  4GGG A;  3DU6 A;  3SZG A;  5GTH C;  2YUS A;  2CV0 A;  9ANT A;  2K85 A;  2FOK A;  3HRS A;  5H2F C;  4X1E A;  3HL2 A;  4HRI A;  1TNT A;  1T0F C;  2R7R A;  4IRH A;  2P6S A;  4NC8 A;  2RQP A;  5LEJ A;  4U88 A;  3WTV C;  4Y15 A;  1MNM C;  2A68 F;  3H0G J;  4LK0 F;  5D4S A;  4QSH A;  3I54 A;  4I98 B;  5GAE J;  4RAZ A;  1YRN A;  1FOK A;  2ZFU A;  4HX8 A;  3N97 A;  1ETK A;  2ETH A;  5J1Y A;  2DN0 A;  4LOC A;  4EM1 A;  3HSR A;  4R1H A;  2HDW A;  5FKM A;  3FBN B;  5A2Q Z;  2QSG X;  2JSC A;  2KJB A;  3HM5 A;  1G3W A;  3VSK A;  4I6Z A;  2E2I J;  2CUZ A;  2EPF A;  2JJ7 A;  4IZZ A;  2ZKZ A;  2VBW A;  1SFU A;  2AQE A;  1RET A;  3CD6 I;  3LAP A;  1Z7U A;  1HDP A;  2PX9 A;  4UY8 I;  2ZJ2 A;  1VQL I;  1WCM J;  5EG0 B;  4PGH A;  4JQF A;  4YFN F;  1IV6 A;  3M07 A;  2K9L A;  2H1K A;  5IOZ A;  1TLH B;  1H89 C;  4XBF A;  2FOW A;  2IA2 A;  4A3I J;  2NS8 A;  4G6Q A;  3I0T A;  2CH0 A;  4LIT A;  4IL6 C;  1YHQ I;  3KYL A;  4MFD A;  3FIW A;  5LLQ A;  2QLZ A;  4KIG A;  1LFU P;  1P92 A;  4DBR A;  1OCO H;  3HUG A;  1BIB A;  2XAJ A;  4CGZ A;  4CCJ A;  3ZMU A;  2MD0 A;  5LEK A;  1LDD A;  4NBQ A;  1WFX A;  4BE2 A;  1B72 A;  2ZME A;  2JA6 J;  4C2M J;  2Y9Y A;  3FM5 A;  4XRS A;  1A6Q A;  1VND A;  5B1A H;  2WY8 Q;  1PUF A;  2X9D A;  3WE3 A;  1UHM A;  4KNY A;  3VEP A;  1ACI A;  2BE5 F;  1YLF A;  5K5R A;  4XNF A;  3L9F A;  4RM3 A;  3JRH A;  4XOP A;  3CJN A;  3L2V A;  1EA3 A;  5IOY A;  1O3Q A;  4D1Q A;  5HNF A;  1S3J A;  2I10 A;  2IGM A;  4AWX B;  2DTR A;  4E7L A;  5F0F A;  4C30 A;  5J1R A;  1D0X A;  1HKT A;  4G12 A;  3VWB A;  2IA0 A;  3QP5 A;  5KNL A;  1K78 A;  1ZQ3 P;  3KLN A;  1S7O A;  1ZHF A;  4I2O A;  1HDD C;  5HDK A;  2JRM A;  3ISP A;  4U0Y A;  1REP C;  2CGP A;  2KZV A;  3VYU B;  1KQ8 A;  2XRN A;  3BG5 A;  5LGN A;  3BG9 A;  3ZQL A;  5IP7 J;  1E3P A;  2CJJ A;  2LKX A;  3W6J B;  2CUJ A;  1I3A A;  3ABU A;  3SDB A;  5ED4 A;  3G6E I;  2EFN A;  2XRL A;  4XLN F;  4B47 A;  1JE8 A;  5ERI A;  3DP7 A;  4XN3 A;  2HOA A;  2RNJ A;  5DUK A;  4A69 C;  2FE3 A;  4L5E A;  3SEZ A;  4XL9 A;  2PMZ A;  3GW2 A;  5H20 A;  3OY9 A;  2DPU A;  2UXX A;  1A6I A;  2H8R A;  2A5W A;  1I6X A;  3L00 A;  5DM7 F;  2NNY A;  4J01 A;  2DOD A;  2IS4 A;  1T95 A;  2QQB A;  5M5Y J;  1T38 A;  2CV2 A;  5C4X J;  3I3L A;  2LKS A;  4BH9 A;  3J80 Z;  3ECO A;  4L9J A;  1N78 A;  2KMU A;  2TDX A;  2DA6 A;  3GCM A;  1H0M A;  1YX5 A;  4JX5 A;  3HZJ A;  3MFK A;  3OSG A;  3CC7 I;  1G4D A;  4ZH4 F;  2ZB9 A;  3HYI A;  2KP6 A;  2K5C A;  3DQV C;  3OYD A;  2COM A;  1OIS A;  1USS A;  3BOQ A;  1T56 A;  1VFC A;  5HS9 A;  3H3Z A;  2IW5 A;  2VKD A;  3RPQ A;  4CCO A;  3OYH A;  3QYE A;  5FGM A;  3K1N A;  4L9T A;  3PFY A;  1F43 A;  4W1U A;  2R5Z B;  4AM3 A;  5J4Y A;  4IQJ A;  2M7B A;  4O3M A;  3H5R A;  3K0L A;  3NEU A;  2DYR H;  1W0T A;  1WJB A;  3QRF F;  5B3S H;  1D1B A;  3DKW A;  3Q5F A;  2P5V A;  3P7N A;  2Y0M A;  1FZP B;  3H9G A;  2MH9 A;  3K4K A;  3CCJ I;  1XDS A;  4LIV A;  1F36 A;  4LG3 A;  1XMK A;  4PZJ A;  3DCF A;  3AG4 H;  2GAU A;  5LRR A;  2XSD C;  4DBQ A;  3I9V 2;  1ETW A;  5DTD A;  1YE9 A;  2DA3 A;  3ZQF A;  4BE0 A;  1A04 A;  3DBR B;  1TWA J;  3OS2 A;  1FSE A;  4LIU A;  2CO5 A;  3EUH A;  2Z9O A;  1IAW A;  2OZ6 A;  1NK2 P;  1V3F A;  4N0B A;  4J19 A;  2QKM B;  3OS1 A;  3R61 A;  2XAF A;  2VLA A;  2R3S A;  3SFI A;  2LK2 A;  2JK3 A;  2OBP A;  2VQL A;  3HPH A;  1KYW A;  2ELJ A;  2A6E F;  2DA5 A;  3IH3 A;  3HRU A;  5IYC J;  1JUS A;  2DCE A;  4WF2 A;  1TWG J;  1HW1 A;  4FE7 A;  3D5L A;  5CLS A;  4LG0 B;  3QYB A;  4JOM A;  4ANJ A;  4KN7 X;  2X0L A;  1ONV A;  4D9J A;  4GFB A;  5FRN A;  4KJZ A;  3G4S I;  4O6J A;  2H6C A;  1NH3 A;  4RB0 A;  2RDP A;  3PIO F;  2ZXJ A;  4DJA A;  1D5Y A;  2QZ8 A;  1V55 H;  4V2G A;  3HBL A;  5J4V A;  2Y69 H;  1JTX A;  3BZK A;  1MMA A;  3TQN A;  2QQ8 A;  4PGG A;  2M5W A;  3BTJ A;  5CVR A;  2VQC A;  1X2N A;  3A02 A;  2K9S A;  3COA C;  2DU9 A;  4PJJ A;  2HPI A;  2E71 A;  1WVR A;  1X3U A;  2PMZ N;  5K7Z A;  4CZC A;  3MD2 A;  5FLM J;  1MJA A;  2WV0 A;  3SYT A;  2ICW G;  4RB1 A;  4DYC A;  2GM4 A;  2O03 A;  1QQI A;  2WB1 A;  3HOU J;  1T39 A;  3CJR B;  4QWQ A;  3KFW X;  1FYM A;  2L54 A;  4ENN A;  3H36 A;  2HYG D;  3CCQ I;  4ZZD A;  2CQK A;  2GIV A;  1XC5 A;  4NDL A;  4XKC A;  3HHG A;  1TQP A;  4EMS A;  1R00 A;  2VOP A;  4ITV A;  3OYA A;  2LFB A;  1V54 H;  3I4M J;  1QZE A;  4UB8 C;  2DI3 A;  2D1H A;  2GXB A;  3OYG A;  2ISY A;  2VXZ A;  3OYJ A;  5M3M J;  3DU5 A;  2L9N A;  5EEH A;  3FDY A;  3OYK A;  3FKI J;  1IZ1 A;  4IF4 A;  3KYC B;  3GZ5 A;  2HPM A;  2FJ1 A;  3O3K A;  3GTP J;  4EVI A;  2VON A;  2L2O A;  4DW6 A;  4P1W A;  2HS5 A;  3HEF A;  3OOP A;  3SDG A;  3V7S A;  2VN2 A;  1BW6 A;  1X1C A;  1TZL A;  3Q0W A;  2W4S A;  4B4C A;  3Q0U A;  1ON1 A;  2RV8 A;  2W1O A;  5LGU A;  3RDI A;  4F91 B;  4E4H A;  4HDV A;  4HLX A;  4KYW A;  1FOW A;  3HXL A;  2ESH A;  1LDK B;  2M34 A;  4PJM A;  1ZEL A;  2OQR A;  2VUM J;  1B59 A;  3S1N J;  3S1M J;  3C1D A;  1FTZ A;  1X3Z B;  1ZTR A;  3TED A;  4O5V A;  3S93 A;  3BP8 A;  3NAR A;  2QA4 I;  2HQR A;  3ASN H;  3LAJ A;  2P0W A;  4M6Y A;  4B44 A;  4M3B A;  4YIF A;  1SFX A;  3HHH A;  3A01 B;  3FXR A;  1Z0X A;  2FBH A;  2VOD A;  4ABZ A;  5EDN A;  1T0F A;  4M3G A;  1P7J A;  4ETS A;  3IUO A;  3HGG A;  2R5Y A;  1Q1V A;  3TW7 A;  2MGQ A;  5KAF C;  2WC2 A;  1DP7 P;  1JXS A;  3FK7 A;  3JCU C;  3FXL A;  3VDX A;  4ENK A;  5BQT A;  3J80 K;  4IJA A;  4UV9 A;  4KIF A;  2VKE A;  2IS6 A;  2WA0 A;  1SD7 A;  3JTH A;  2D1V A;  3OYB A;  4QLC U;  1W5T A;  2QCO A;  1HSJ A;  4F52 A;  3ML6 A;  2L01 A;  4AVP A;  2VXD A;  1D0Z A;  1FEX A;  2RAE A;  3E3V A;  4PUS A;  4X0G A;  3DBL B;  2F5C A;  1XX5 A;  2VE8 A;  2NVU B;  3ROU A;  4XRF A;  1W36 C;  3FBI B;  3CP8 A;  2KT0 A;  4QPO A;  1O3S A;  4PJ0 C;  1VQ4 I;  3H5N A;  2HNH A;  3AG2 H;  1SD4 A;  2JRT A;  4UUV A;  2B9S A;  2DQL A;  4IVN A;  1ZAR A;  1IRX A;  3I4N J;  4BJ6 C;  3LSK A;  1JT6 A;  1T08 B;  2GXA A;  2VPL A;  4BS9 A;  3J7Z I;  3Q9V A;  2H6B A;  1WQ2 A;  3HGY A;  1Y6I A;  1K4S A;  5K5Q A;  2F4I A;  2JTV A;  4RGU A;  1MND A;  1VQ8 I;  3LST A;  3LSJ A;  1KON A;  4ZC3 A;  2LY9 A;  1XGN A;  1ZRC A;  1D8K A;  1QZY A;  1N77 A;  2MBF A;  2RVC A;  1OR7 C;  4Y17 A;  1JJ8 C;  4IHV A;  3MN2 A;  3LOC A;  2V1D A;  1W0U A;  1BOB A;  2BY1 A;  5M3F J;  3JR9 A;  1HCR A;  2QEX I;  3V7C A;  1FBQ A;  3O8H A;  1W5S A;  2VJ4 A;  3ZGK A;  1VZ0 A;  3BG6 A;  2DMQ A;  4LK1 F;  4C9Y A;  3ZQQ A;  1D0Y A;  5EG0 A;  2HWV A;  3M4O J;  3HOV J;  1BOA A;  1V5G A;  2NS7 A;  2ZO4 A;  2DK8 A;  5J8F A;  2GXG A;  3BR0 A;  1OR7 A;  3K7A J;  3S3N A;  2HEO A;  2IT0 A;  3BCB A;  1R36 A;  4OIN F;  4ZJZ A;  3RI4 A;  3ABK H;  2V6C A;  3T5X A;  1MSF C;  3OYN A;  3T8R A;  3F8M A;  3W2A A;  1Q1H A;  1Z77 A;  3OYF A;  2L9S A;  1KU2 A;  1PDN C;  2YU9 J;  2M8G X;  3TOA A;  4RGX A;  4HF2 A;  3K1P A;  1T33 A;  1R1T A;  2Q2E B;  3WTW C;  4A3B J;  3PQJ A;  1AHD P;  2IEK A;  4BGD A;  2HI3 A;  4YRV A;  1ZH5 A;  3KP2 A;  1P4X A;  2EB7 A;  2M2E A;  3IAM 2;  1TQM A;  3ZR8 X;  2BYV E;  1Z67 A;  3GFJ A;  5TGT A;  4DQ2 A;  2CS3 A;  4EM0 B;  2R7S A;  2O0Y A;  3V8L A;  1IC8 A;  1XS9 A;  2Z3Y A;  3E6M A;  2RGV A;  1YW9 A;  1EH8 A;  2XB0 X;  2A61 A;  3RCO A;  1LEA A;  2KRH A;  2CQ7 A;  4XK4 A;  5LHG A;  2EIJ H;  4BE1 A;  1Z21 A;  5JLW A;  3W2V A;  4HA8 A;  3ZRG A;  2A3S A;  4KT6 A;  3O8G A;  2I5U A;  2ZFW A;  1X3W B;  3S16 J;  1T98 A;  2ME6 A;  1Y0U A;  3CUQ C;  1Z6R A;  2ZC2 A;  4B09 A;  4IHS A;  3WG7 H;  3SEQ A;  4B8X A;  3GLX A;  2EK5 A;  4KA4 A;  4BY1 J;  3QPL A;  1O7L A;  2M8E A;  4CIC A;  4Y52 J;  3S2W A;  3CC4 I;  1LJ9 A;  2E60 A;  1QVU A;  3LA3 A;  3JRD A;  2KDZ A;  1SAX A;  2JWT A;  2JA7 J;  4MIM A;  1XDU A;  3HOX J;  4I99 C;  5DD4 A;  2LVS A;  3A0H C;  1KU7 A;  1WH5 A;  3RQI A;  4GYG A;  3FXQ A;  5JHF A;  2Z5U A;  1Z6T A;  2DT7 B;  4Q5S F;  2VT3 A;  3W6V A;  3FXO A;  2M4G A;  1LNW A;  3WTT C;  5DEQ A;  3H1C A;  2V6E A;  2DFF A;  2ZJP F;  2PJR B;  1OYY A;  2AXL A;  2OD5 A;  3CP2 A;  3FXM A;  2DTZ A;  1OCR H;  2ID6 A;  2OJE D;  3CLO A;  4FX4 A;  3RPU A;  3RYP A;  4R8H A;  4EEF G;  2FBK A;  2FML A;  1W7P A;  1XG1 A;  2QBY A;  3ZOB A;  2DFH A;  2MG4 A;  3FX3 A;  3L09 A;  5FRO A;  3S3O A;  2PI0 A;  1S29 A;  2LRD A;  1JJ6 C;  5CQE A;  1KA8 A;  4TV7 A;  1ORK A;  3KP7 A;  1VQN I;  3E0J B;  4NC6 A;  5D8K B;  2K9N A;  1S6L A;  2XC7 A;  1E17 A;  3Q3S A;  1WJE A;  3L2R A;  3DEW A;  3CUQ B;  1G59 A;  1Y56 A;  3R6S A;  1KQ0 A;  3DEE A;  3WU0 A;  1FMV A;  3IV5 A;  1SAN A;  1WI3 A;  4M3D A;  1F5T A;  3VFZ A;  4MTD A;  4AU7 A;  4CYC A;  2XHK A;  4L0Z B;  3GTO J;  1BL0 A;  1EF4 A;  2HDC A;  3N4M A;  1MDM A;  1MMN A;  2M7A A;  4CO8 A;  4A3E J;  3WHB A;  5H6R A;  2ZXH A;  3QOE A;  4CZZ A;  1EJ9 A;  1BC7 C;  2PBI A;  4II3 A;  5C44 J;  5D6F A;  1RES A;  3GZ6 A;  2BW3 B;  2QVO A;  4A0Z A;  3LSG A;  5CVJ A;  4PFP A;  1KQ9 A;  5JLX A;  1YJW I;  2O61 A;  3HSF A;  5HVQ C;  3ZMD A;  5H6Q A;  4OU0 A;  3F8N A;  2R7U A;  2Q2E A;  2XKP A;  3LQR A;  1XCB A;  2M9H A;  2O8K A;  3FKJ A;  2F5D A;  3M8J A;  4GYI A;  2KQR A;  3FMS A;  1O3R A;  3AAF A;  2TCT A;  2BY0 A;  3OSF A;  3KIO A;  1IRF A;  3A01 A;  3WOD F;  4DYR A;  5DCM B;  5IYD J;  1OCC H;  1IW7 F;  4E7Z A;  4Z6Y A;  3BCA A;  4G7O F;  2VIX A;  2JUC A;  3BPV A;  3IAS 2;  1U5T A;  2JN6 A;  3RQ4 A;  4B3A A;  4WX9 A;  1JGG A;  4C3J J;  2FX0 A;  2L7F P;  3AFH A;  1B4A A;  2JA8 J;  3ZCO A;  2HVR A;  3GTG J;  4OAZ A;  4L9N A;  4XM3 A;  5E3L A;  1E3H A;  1PUF B;  6PAX A;  4AIK A;  4A3C J;  1R1V A;  2K4J A;  3F6O A;  3QYF A;  4C2T A;  2OTL I;  3H35 A;  1SFE A;  2ZXI A;  3G73 A;  3LFK A;  1ZK8 A;  3DBH B;  2X1C A;  2UZK A;  1TW3 A;  3B02 A;  2L7K A;  2L7Z A;  2KZG A;  1CF7 A;  2IRF G;  4IHY A;  4IEJ A;  2F48 A;  2HVQ A;  5F0H A;  1VQ5 I;  2DK5 A;  1Y0N A;  2HFH A;  3SXY A;  2VPR A;  4EV0 A;  3MKW B;  3BC8 A;  5E1W A;  1IJW C;  1TWH J;  4IOA F;  3JRA A;  4A3L J;  2QQA A;  2UWM A;  4LB6 B;  3PO2 J;  1IO2 A;  3MVP A;  1J2X A;  4BDY A;  3CO6 C;  2R93 J;  1BW5 A;  1OLT A;  1RNL A;  2DMT A;  2DOE A;  4NNJ A;  2LSO A;  2RRE A;  1BI1 A;  4U0V A;  1ZR2 A;  1NTC A;  2VJI A;  3IRR A;  3AL0 B;  3HSE A;  4BBR J;  3ABM H;  4PDK A;  1Z7L A;  3L1P A;  3H0D A;  4ZYG A;  2R7O A;  1WZ2 A;  5F27 A;  1UG0 A;  1S72 I;  1JKO C;  4P5O A;  2E1N A;  5HNH A;  4EJV A;  1I5Z A;  2IAI A;  4JK1 X;  3DF8 A;  2CV1 A;  2DMN A;  4GRI A;  2XVC A;  1WPK A;  1QHG A;  4I0B A;  2A07 F;  4BJT A;  5L3F A;  3E97 A;  2M1B A;  3CCL I;  1KZH A;  2G7U A;  2K27 A;  1R7J A;  3DV8 A;  2BOL A;  3PL8 A;  1A31 A;  2GLO A;  4RAG A;  1P4A A;  2XRO A;  1UHW A;  1UCR A;  3TOB A;  4UUS A;  2XAQ A;  2BVL A;  5L3D A;  1K6Y A;  4HST A;  3ZN1 A;  2J5P A;  3I59 A;  3C18 A;  1FBU A;  3G1L A;  2X6W A;  2X51 A;  4HNT A;  3J7A O;  3VSL A; 
#chains in the Genus database with same CATH homology
 1GHC A;  4LMY A;  3EQL F;  1IN6 A;  1YO5 C;  2ZCW A;  5ICF A;  2DAO A;  1H9G A;  3WTY C;  1ZN2 A;  4YII A;  1RUO A;  5DUI A;  3F3X A;  4M9X A;  3MZH A;  3DEU A;  3LA7 A;  2BBY A;  3H92 A;  4Q4Z F;  2M45 A;  3SZT A;  2GZW A;  2PN6 A;  4MQV A;  3ZMT A;  3QP6 A;  1AOY A;  2CYY A;  1G3T A;  1XSV A;  5D5X B;  2EJR A;  2KIF A;  3PFI A;  3E6C C;  1QGP A;  3KZY A;  3GFM A;  4M72 A;  5AIP A;  4I02 A;  3GF2 A;  5FFZ A;  4EJO A;  3GUD A;  3ECH A;  3WTZ A;  5E20 A;  3I58 A;  2IA1 A;  4BHC A;  1V4R A;  1HQC A;  1E2X A;  3M8E A;  5K1Y A;  4KT5 C;  5JR3 A;  1K79 A;  4HW0 A;  4E70 A;  4M71 A;  2A6H F;  4NQW A;  3WGI A;  1PUE E;  3T8T A;  5E1X A;  2PMH A;  4FT8 A;  4Q48 A;  1G3Y A;  5HDG A;  2G9W A;  3BJ6 A;  2LF8 A;  2OZU A;  1ZGJ A;  5HLG A;  4UNO A;  1TW2 A;  4CXF A;  3R0J A;  5HOO A;  2P7C B;  2H94 A;  2E7W A;  3KET A;  2GA2 A;  4G9Y A;  3QOP A;  1ULY A;  1K6O A;  2HQN A;  4LD5 A;  2KRF A;  4MHG A;  2YU3 A;  2VBY A;  3ZQ7 A;  4WXH A;  4DNC A;  5DV5 A;  2FXA A;  2MA3 A;  3RKY A;  2DBB A;  2ELH A;  3TO6 A;  2NNN A;  1RIO H;  3FMQ A;  3E5Q A;  3LWF A;  5LHH A;  2HYF A;  1VTN C;  2JPC A;  4Y13 A;  1P6R A;  5AON A;  1ZRD A;  4IHT A;  2XGX A;  4HYE A;  1FYK A;  3J81 Z;  2HTS A;  2W24 A;  1BM9 A;  1IF1 A;  5DD8 A;  2HGC A;  3SHF A;  3WG9 A;  1R58 A;  2KIU A;  2R7D A;  4LLL A;  2QEN A;  4CHU A;  2DPD A;  4ZYE A;  3O2P E;  3LA2 A;  1Z1D A;  1R5G A;  1U5T B;  2DFI A;  1ZRE A;  4MTE A;  1TBX A;  5LRS A;  2FNA A;  4P9F A;  1IXC A;  2GWR A;  1SD6 A;  2K86 A;  4XSZ F;  1B6A A;  1BBY A;  2QM3 A;  3TDZ C;  1T6S A;  1J0R A;  5E1Z B;  1KU3 A;  5DCM A;  3CO7 C;  1O57 A;  2P6T A;  3QU6 A;  3OV8 A;  5LBQ A;  4S05 A;  1ZG3 A;  4HX7 A;  2KKO A;  3HRT A;  2LNB A;  5DDG A;  5AIQ A;  1EH6 A;  1XD7 A;  1IN8 A;  3K9T A;  1S8N A;  1HST A;  3MZY A;  4G6D A;  2M87 A;  2C6Y A;  2IVM A;  3R4K A;  2VBX A;  4EJU A;  4G8X A;  3RKX A;  4ASN A;  4EQQ A;  2ZNZ A;  3K2Z A;  4UXN A;  2A69 F;  4BNC A;  5ILU A;  2KIM A;  3WE2 A;  1U5T C;  3ZMZ A;  5BOX A;  3RTR A;  3RJP A;  1U8R A;  3V4G A;  1EH7 A;  3GYH X;  2HKO A;  2YX4 A;  5E17 F;  3WU1 B;  4L5J A;  3ERE D;  1OYW A;  3F8C A;  4KDP A;  1G3S A;  4OIO F;  1TTY A;  4WCG A;  2STT A;  1UB9 A;  3EYI A;  2W84 A;  5DYM A;  2K7L A;  2NAZ A;  2OA4 A;  2PQ8 A;  2FNP A;  3I71 A;  1HKQ A;  2L4M A;  3IL2 A;  1ZLJ A;  2Y75 A;  5CVV A;  1SMT A;  4CYD A;  3O6B B;  4MEY F;  1OPC A;  5F6F A;  1HBX G;  3E5U A;  4HOB A;  3KEO A;  3F21 A;  2ZBK A;  3K69 A;  3KP5 A;  4RB2 C;  2X4H A;  1J59 A;  3P9C A;  4WWC A;  4LB5 A;  4Q47 A;  2V1U A;  1I1G A;  2P7V B;  1BC8 C;  3CUO A;  4LG0 A;  4AD9 A;  2MD5 A;  1ZGA A;  2FQ3 A;  2HOE A;  1IN7 A;  5ILV A;  3KP4 A;  4HF0 A;  1R22 A;  4Z2Y A;  2CSO A;  2A5Y B;  3W6K B;  2FA5 A;  1MJ9 A;  1J75 A;  3GO5 A;  1D8J A;  3BJA A;  5KVR A;  3QPH A;  3EET A;  1QZZ A;  2QBY B;  1CF7 B;  4OIR F;  1MZB A;  1IN5 A;  3MQ0 A;  2QYO A;  4I0A A;  5ILS A;  2XAG A;  3SFZ A;  2HTJ A;  2HZT A;  4HBL A;  1ZLK A;  2VC0 A;  4YG2 F;  4WXC A;  2PFB A;  1LVA A;  3JAM Z;  5EEG A;  2K02 A;  3RIR A;  1B9M A;  3TDU C;  1O7F A;  4A5M A;  1U3E M;  1XCV A;  1L0O C;  3D0S A;  3HIF A;  4UHT A;  1HW2 A;  3V7R A;  1D5V A;  4M74 A;  1KGS A;  4EM2 A;  2CFX A;  3RYR A;  2DQR A;  5ICE A;  1FY7 A;  2VC1 A;  1W4M A;  4RAY A;  5BS6 A;  2EV5 A;  4R79 A;  3WGG A;  3KLO A;  3FWE A;  2EFP A;  1RZ4 A;  5L3G A;  2JZY A;  4A12 A;  1EV7 A;  1FYL A;  5CJ9 A;  4HV5 A;  1WKM A;  2MLG A;  1MGT A;  1SD5 A;  3C7J A;  3GFI A;  1UFM A;  3T1B A;  1LB2 A;  2HR3 A;  4HX4 A;  1MKM A;  3IKV A;  1TNS A;  4JBA A;  1P4W A;  4A2U A;  2BEO A;  3F72 A;  5J8C A;  5IT9 Z;  1R5H A;  5TJJ A;  2YX7 A;  5E8I A;  4EGZ A;  1LEB A;  3T0Y A;  3G3Z A;  4L5I A;  3ZP5 A;  4GCV A;  1KYZ A;  3U9G A;  3SQN A;  2LDU A;  1QPM A;  3HOT A;  4U7B A;  4G7Z F;  3VOE A;  5FD6 A;  2ACJ A;  1ON2 A;  1LDJ A;  2MC3 A;  1YW8 A;  4A6D A;  4RS8 A;  4EJT A;  4N9I A;  3WGH A;  1F1Z A;  2OU2 A;  4HLY A;  2O8X A;  2CG4 A;  4L18 B;  1CGP A;  3P9I A;  1FLI A;  3ULQ B;  2L3D A;  4M9Z A;  1DPU A;  5F64 A;  2CWE A;  2FU4 A;  3GXO A;  4HQE A;  4UV8 A;  3KEQ A;  2P5K A;  1ZYR F;  2P5L C;  1WI9 A;  4FX0 A;  4ZZL A;  3V8J A;  4WK8 F;  2HKX A;  4IXA A;  1PP7 U;  4XSX F;  1FC3 A;  3E5X A;  4GXO A;  1ODD A;  1WRJ A;  1YS7 A;  1QBJ A;  1DPR A;  2EWN A;  4HQM A;  4ON0 A;  1FWZ A;  3GFL A;  2STW A;  4MNU A;  4ESB A;  5D4R A;  2H27 A;  3NRV A;  4ESJ A;  3H3U A;  2ZNY A;  3TO9 A;  5HS7 A;  1OYI A;  3IWZ A;  1F4K A;  1HW5 A;  4RGR A;  1R1U A;  1DDN A;  1IXS B;  3TO7 A;  2RC4 A;  4UVA A;  3E6B A;  1FP1 D;  1PP8 F;  3M1E A;  2F2E A;  2FEZ A;  1YQA A;  4L9V A;  2Q8K A;  4P55 A;  1FBS A;  1YS6 A;  5D6E A;  1XN7 A;  3KZZ A;  3QU3 A;  1O3T A;  2MLK A;  2XAS A;  1MJB A;  3F23 A;  4OMY A;  4I7H A;  2V79 A;  1BI2 A;  3I53 A;  4ENM A;  1ZG1 A;  3GWZ A;  2YPR A;  3M7G A;  3IWF A;  5L3B A;  3GEZ A;  5FLX K;  3U2R A;  3RKW A;  3MWM A;  5FD5 A;  1XGO A;  2L4A A;  1FPQ A;  3ELK A;  4LFU A;  1BI3 A;  1SMY F;  4KN4 X;  5J6X A;  2IJL A;  3L2C A;  2XAH A;  5F1R A;  3PQK A;  2ESN A;  2PJP A;  4XLP F;  2E1C A;  3QAH A;  3BY6 A;  2EV6 A;  3CUQ A;  5D5W B;  3KE2 A;  3ZMS A;  2P4W A;  2V1X A;  1BI0 A;  3WTU C;  2Z33 A;  4M6X A;  3CDH A;  2M30 A;  4RGS A;  5L3C A;  4PCQ A;  2H09 A;  4WXD A;  2GA1 A;  2DLL A;  4MGR A;  5L3E A;  1L3L A;  4AIH A;  1QNT A;  2AS5 F;  4OMZ A;  3TGN A;  1HKS A;  1YIO A;  4BQA A;  4P96 A;  3IC7 A;  1DUX C;  1STZ A;  2CW0 F;  1FT9 A;  3CTA A;  3R0A A;  5IT3 A;  5FFX A;  1GVJ A;  4M73 A;  2JPB A;  3GX4 X;  4K2E A;  5BPI A;  3DFG A;  3QPT A;  2NS0 A;  2Q0O A;  4BHB A;  3BRO A;  4KMU X;  1YYV A;  2EFO A;  1I1S A;  4OIP F;  5FO5 A;  4BAY A;  3R60 A;  1D3Y A;  1Z91 A;  4S04 A;  3F22 A;  2XIG A;  1XGS A;  4LLN A;  4UVB A;  2NYX A;  3REO A;  1OMI A;  2EFW A;  3BPX A;  2RKH A;  1U6G A;  1J5Y A;  2WTE A;  3DPT A;  5DCF A;  1GXQ A;  1C0W A;  5ICC A;  4GO1 A;  2VBZ A;  1B1B A;  2PMU A;  5FLX Z;  1R23 A;  3C3W A;  3JSP A;  3P9K A;  3DPL C;  2K4B A;  1Z9C A;  3V8K A;  2L02 A;  1K7A A;  4BHP A;  4ZYH A;  5ICG A;  1GXP A;  2MH2 A;  4HAM A;  2EA4 A;  2EFQ A;  1YFH A;  1XMA A;  3M9A A;  3EYY A;  2QQ9 A;  4I09 A;  2W57 A;  3M8F A;  4N9H A;  1W7P B;  3JSO A;  2XV4 S;  1OKR A;  3B73 A;  4KIB A;  4FHT A;  2QUF A;  3KP3 A;  4MEX F;  4ZYD A;  1IN4 A;  4D0P A;  3BZ6 A;  1IUY A;  1XGM A;  2O6G E;  1MDM B;  1RI7 A;  4ESF A;  2LF7 A;  2RN7 A;  2OAZ A;  1XSD A;  5LHI A;  3EDP A;  4LJZ F;  4OIQ F;  1BN5 A;  5JVT A;  1J7K A;  1QO0 D;  2UXN A;  1BIA A;  4A6E A;  4RB3 C;  4IPA A;  2PEX A;  3L7W A;  2Y48 A;  3FXU A;  2FMY A;  2DO7 A;  3I5U A;  2PLY A;  5LGT A;  4BXU A;  4I01 A;  3E6D A;  3ABT A;  2GQQ A;  3IHU A;  2ZME B;  4OOI A;  5BPD A;  1XSX A;  2B0L A;  3F8F A;  3KP6 A;  2FSW A;  3VOD A;  2ADU A;  4YFX F;  2EV0 A;  2JT1 A;  1KU9 A;  2W85 A;  4EGY A;  1J9I A;  2WWY A;  2D45 A;  1YW7 A;  4KFC A;  3MAJ A;  1LQ1 A;  2DW4 A;  4YFK F;  3HTS B;  1TQI A;  4HF1 A;  1IRG A;  4UVC A;  3Q9S A;  2VE9 A;  2NRA C;  4H0E A;  1WSU A;  5JFR A;  2FF4 A;  2FRH A;  5CYV A;  2R7F A;  2XUB A;  3GVA A;  3KCC A;  1JGS A;  5A2Q K;  3K1M A;  1K78 B;  2VOO A;  2YR2 A;  3HTU A;  3I64 A;  5CVI A;  1ZRF A;  1H9T A;  5TRD A;  1Z05 A;  2LKP A;  4MQ9 F;  2OQG A;  5KK1 A;  4KIC A;  2XKO A;  4LGW A;  1YG2 A;  2VT2 A;  4U0W A;  3FM3 A;  5FB2 A;  1ZAO A;  3FHZ A;  4LLG F;  3ZPL A;  5BMZ A;  3MCZ A;  3JAM K;  2P8T A;  1FSH A;  1MD0 A;  1S7A A;  3ZN0 A;  5K5O A;  5IT9 K;  3I59 B;  5D5V B;  2J5O A;  2BV6 A;  3FZV A;  3WTX C;  2FBI A;  1AWC A;  2DT5 A;  1JHF A;  4U7D A;  1UST A;  4BYY A;  1NHA A;  5E18 F;  1XB4 A;  3ZMV A;  5JI6 A;  1JHH A;  1IXR C;  2BGC A;  3NQO A;  3IKT A;  1BJA A;  4AIJ A;  4G7H F;  5HS8 A;  1P2F A;  1W7P D;  4HZF A;  4IRG A;  1RUN A;  4HDU A;  3U1D A;  1G6N A;  4KUM A;  4IRI A;  5JHU A;  3IRQ A;  2IPQ X;  3BJO A;  3F8B A;  3MEX A;  3TKY A;  2F5E A;  3FF5 A;  3LQQ A;  3JTG A;  2F5F A;  5CVU A;  1FX7 A;  5HDN A;  2ISZ A;  1U78 A;  1HXD A;  1B9N A;  4KMF A;  4CDG A;  1T2K A;  1FNN A;  2Z99 A;  2QWW A;  2W25 A;  3JW4 A;  1ZG5 A;  2YSR A;  1I27 A;  4M9S A;  1YTY A;  3DXJ F;  3HRM A;  4NHJ A;  4A0X A;  1FP2 A;  2V9V A;  5HLH A;  3WTS C;  3J81 K;  2KJC A;  2E7X A;  2IP2 A;  2PG4 A;  3VB2 A;  5HLI A;  4ENJ A;  5D5U B;  3FMR A;  3SZP A;  4L0Y B;  4A5N A;  4EJW A;  4HV6 A;  3HOS A;  3I4P A;  3BDD A;  3F6V A;  4P9U A;  2O3F A;  1F9N A;  4F7Z A;  1U2W A;  4G94 A;  5E8G A;  2D2W A;  5D8L B;  2EA2 A;  1WWX A;  2G7H A;  4A0Y A;  3BWG A;  4NB5 A;  4GGG A;  2FOK A;  3HRS A;  1TNT A;  4IRH A;  2P6S A;  5LEJ A;  2RQP A;  4U88 A;  3WTV C;  4Y15 A;  2A68 F;  4LK0 F;  5D4S A;  3I54 A;  4I98 B;  4RAZ A;  1FOK A;  3N97 A;  4HX8 A;  2ETH A;  4EM1 A;  3HSR A;  4R1H A;  5A2Q Z;  2JSC A;  2KJB A;  1G3W A;  2ZKZ A;  2VBW A;  1SFU A;  3LAP A;  1Z7U A;  2ZJ2 A;  4PGH A;  4JQF A;  4YFN F;  1TLH B;  4XBF A;  2IA2 A;  4G6Q A;  3I0T A;  5LLQ A;  2QLZ A;  4KIG A;  1P92 A;  3HUG A;  1BIB A;  2XAJ A;  4CGZ A;  3ZMU A;  5LEK A;  1LDD A;  2ZME A;  3FM5 A;  3WE3 A;  1UHM A;  4KNY A;  3VEP A;  2BE5 F;  1YLF A;  5K5R A;  3L9F A;  3CJN A;  1O3Q A;  1S3J A;  4AWX B;  2DTR A;  1HKT A;  2IA0 A;  3QP5 A;  1K78 A;  3KLN A;  1S7O A;  1ZHF A;  4I2O A;  5HDK A;  3ISP A;  4U0Y A;  1REP C;  2CGP A;  1KQ8 A;  2XRN A;  5LGN A;  3W6J B;  3ABU A;  5ED4 A;  2EFN A;  4XLN F;  1JE8 A;  5ERI A;  3DP7 A;  2RNJ A;  5DUK A;  2FE3 A;  5H20 A;  3GW2 A;  2DPU A;  2UXX A;  1I6X A;  3L00 A;  2NNY A;  2QQB A;  1T38 A;  4BH9 A;  3J80 Z;  3ECO A;  4L9J A;  2TDX A;  1H0M A;  3MFK A;  1G4D A;  4ZH4 F;  3HYI A;  3DQV C;  2COM A;  1USS A;  3BOQ A;  5HS9 A;  3H3Z A;  2IW5 A;  3RPQ A;  5FGM A;  3K1N A;  4L9T A;  4O3M A;  3NEU A;  3K0L A;  3QRF F;  3DKW A;  3Q5F A;  2P5V A;  3P7N A;  2Y0M A;  1FZP B;  2MH9 A;  1XDS A;  4PZJ A;  1XMK A;  5LRR A;  2GAU A;  1A04 A;  1FSE A;  2CO5 A;  3EUH A;  2Z9O A;  1IAW A;  2OZ6 A;  1V3F A;  4N0B A;  3R61 A;  2XAF A;  2R3S A;  2OBP A;  1KYW A;  2A6E F;  3HRU A;  4WF2 A;  1HW1 A;  3D5L A;  5CLS A;  4LG0 B;  4KN7 X;  2X0L A;  1ONV A;  4O6J A;  2H6C A;  4RB0 A;  2RDP A;  2ZXJ A;  2QZ8 A;  3TQN A;  4PGG A;  2M5W A;  5CVR A;  3COA C;  2DU9 A;  1X3U A;  1MJA A;  2WV0 A;  4RB1 A;  2O03 A;  1QQI A;  1T39 A;  4QWQ A;  3KFW X;  1FYM A;  2L54 A;  4ENN A;  2HYG D;  4ZZD A;  2CQK A;  2GIV A;  3HHG A;  1TQP A;  4EMS A;  1R00 A;  2VOP A;  2DI3 A;  2D1H A;  2GXB A;  2ISY A;  2VXZ A;  5EEH A;  1IZ1 A;  4IF4 A;  3GZ5 A;  3O3K A;  4EVI A;  2VON A;  2HS5 A;  3OOP A;  3V7S A;  2VN2 A;  1ON1 A;  2RV8 A;  5LGU A;  3RDI A;  4HDV A;  4KYW A;  4HLX A;  2ESH A;  1LDK B;  2OQR A;  1B59 A;  3C1D A;  4O5V A;  3BP8 A;  2HQR A;  3LAJ A;  4M6Y A;  4YIF A;  1SFX A;  3HHH A;  3FXR A;  2VOD A;  2FBH A;  1T0F A;  4ETS A;  2WC2 A;  1DP7 P;  1JXS A;  4ENK A;  5BQT A;  3J80 K;  4IJA A;  4UV9 A;  4KIF A;  1SD7 A;  3JTH A;  2D1V A;  4QLC U;  1W5T A;  1HSJ A;  3ML6 A;  2L01 A;  4AVP A;  3E3V A;  2F5C A;  2VE8 A;  3ROU A;  4XRF A;  1O3S A;  1SD4 A;  2JRT A;  4UUV A;  2DQL A;  4IVN A;  1ZAR A;  3Q9V A;  2H6B A;  1WQ2 A;  5K5Q A;  2JTV A;  4RGU A;  3LST A;  1XGN A;  1ZRC A;  1D8K A;  1QZY A;  2MBF A;  2RVC A;  4Y17 A;  2V1D A;  3V7C A;  1FBQ A;  1W5S A;  4LK1 F;  2HWV A;  1BOA A;  2ZO4 A;  2IT0 A;  2DK8 A;  2GXG A;  5J8F A;  1OR7 A;  2HEO A;  1R36 A;  4OIN F;  3RI4 A;  3T5X A;  2V6C A;  3T8R A;  3F8M A;  1Q1H A;  1KU2 A;  1PDN C;  3TOA A;  4RGX A;  4HF2 A;  3K1P A;  1R1T A;  3WTW C;  3PQJ A;  1ZH5 A;  3KP2 A;  1P4X A;  2EB7 A;  1TQM A;  2BYV E;  3GFJ A;  4DQ2 A;  4EM0 B;  2O0Y A;  3V8L A;  2Z3Y A;  3E6M A;  2RGV A;  1YW9 A;  1EH8 A;  2A61 A;  1LEA A;  5LHG A;  4HA8 A;  2A3S A;  2ZFW A;  1T98 A;  1Y0U A;  1Z6R A;  3CUQ C;  4IHS A;  4B09 A;  4B8X A;  3GLX A;  2EK5 A;  4KA4 A;  1O7L A;  2M8E A;  4CIC A;  3S2W A;  1LJ9 A;  3LA3 A;  1SAX A;  1XDU A;  5DD4 A;  1KU7 A;  4GYG A;  3FXQ A;  2Z5U A;  1Z6T A;  4Q5S F;  2VT3 A;  1LNW A;  3WTT C;  5DEQ A;  1OYY A;  2AXL A;  2OD5 A;  3CLO A;  4FX4 A;  3RPU A;  3RYP A;  4R8H A;  2FBK A;  2FML A;  1W7P A;  2QBY A;  3L09 A;  2PI0 A;  3FX3 A;  1S29 A;  1KA8 A;  4TV7 A;  3KP7 A;  5D8K B;  1S6L A;  1E17 A;  3CUQ B;  3R6S A;  1KQ0 A;  3WU0 A;  1F5T A;  3VFZ A;  4MTD A;  2XHK A;  4L0Z B;  2HDC A;  3N4M A;  1MDM A;  4CO8 A;  5H6R A;  4CZZ A;  1BC7 C;  2PBI A;  5D6F A;  3GZ6 A;  2QVO A;  4A0Z A;  5CVJ A;  1KQ9 A;  2O61 A;  3HSF A;  5HVQ C;  3ZMD A;  5H6Q A;  4OU0 A;  3F8N A;  2Q2E A;  2XKP A;  3LQR A;  1XCB A;  2F5D A;  4GYI A;  1O3R A;  3FMS A;  3AAF A;  1IRF A;  3WOD F;  5DCM B;  1IW7 F;  4G7O F;  3BPV A;  1U5T A;  4WX9 A;  1B4A A;  4L9N A;  6PAX A;  4AIK A;  1R1V A;  2K4J A;  3F6O A;  1SFE A;  2UZK A;  3LFK A;  3G73 A;  1TW3 A;  3B02 A;  1CF7 A;  2IRF G;  2DK5 A;  2HFH A;  3SXY A;  4EV0 A;  5E1W A;  2QQA A;  2UWM A;  4LB6 B;  1J2X A;  3CO6 C;  1RNL A;  2LSO A;  4U0V A;  1BI1 A;  3IRR A;  3HSE A;  4PDK A;  4ZYG A;  4P5O A;  2E1N A;  4EJV A;  1I5Z A;  4JK1 X;  3DF8 A;  2XVC A;  4I0B A;  2A07 F;  5L3F A;  3E97 A;  2M1B A;  2G7U A;  2K27 A;  1R7J A;  3DV8 A;  1P4A A;  2XRO A;  1UHW A;  1UCR A;  3TOB A;  2XAQ A;  5L3D A;  3ZN1 A;  2J5P A;  3I59 A;  3C18 A;  1FBU A;  3J7A O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...