4M71A

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 120
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m71A01
1R1VA 1O3TA 5L3DA 3E5XA 3GF2A 1UHMA 1MD0A 5TJJA 2PG4A 1ZHFA 5K5OA 4OIQF 5LHHA 5EEHA 6PAXA 3CTAA 5J8FA 2GIVA 1JHHA 5ILSA 2FSWA 3W6JB 1J5YA 3ISPA 1GXPA 5L3FA 1U5TB 3T5XA 4U88A 1U5TA 2F5EA 1HSTA 2QYOA 3E6MA 3QPHA 4I98B 4EJUA 2WWYA 5E1XA 1TTYA 3R60A 5D5WB 5F64A 1P92A 2DFIA 1QO0D 5D8LB 3CLOA 2K27A 1B6AA 3L9FA 3KLOA 1KU2A 4ZYEA 3SQNA 3E97A 2ACJA 2PLYA 2KKOA 3E3VA 3TO9A 2L4AA 2M8EA 3IKVA 5FD6A 2ZFWA 5FFXA 3FMSA 2V1DA 1U8RA 4UHTA 3OOPA 1FYMA 1XGOA 3IWZA 1IXRC 4JBAA 2V1XA 2VT3A 2VXZA 2A61A 3TDZC 3TQNA 2XROA 3I64A 5LHGA 4LGWA 4S04A 2ELHA 1XSXA 3ZMUA 1R7JA 2UXNA 2W84A 3R0JA 2ZKZA 2PMHA 3COAC 2KIMA 3GO5A 4YFNF 1TQMA 3F8MA 2EJRA 3ZMVA 1TNTA 3P9CA 4P96A 1ON1A 2VOPA 3ECOA 2EFWA 3QAHA 4FT8A 5DV5A 1QQIA 2HQNA 1ZRFA 2D2WA 2YU3A 5DD4A 3S2WA 3MZHA 3ERED 1SAXA 2NRAC 3MCZA 3EETA 5DCMA 3QPTA 3HRTA 1KQ0A 3WGIA 3K1MA 5BOXA 1IXCA 4AIKA 1YS6A 4IJAA 1Z6RA 1LJ9A 2RC4A 1XSDA 3JW4A 4K2EA 1LQ1A 5AIPA 2V79A 4LMYA 3GFIA 1OPCA 4I02A 1R36A 4EJWA 4BQAA 1ZARA 2M5WA 3RYPA 3E6BA 5DEQA 2P6TA 3C18A 1GXQA 4U7BA 1UB9A 2BBYA 2Q2EA 1I6XA 3TGNA 1KA8A 1T0FA 5DUIA 4U7DA 1ONVA 2RDPA 3H3ZA 4UV9A 2YR2A 2P5VA 5CVVA 4EJVA 2DLLA 1G3SA 4UVCA 2VE8A 1ZN2A 5D4SA 1UCRA 1FBUA 2F5DA 4WXHA 2HTSA 4KIFA 3I59A 2CWEA 3HTSB 2QZ8A 2DI3A 3B02A 1QBJA 4Y13A 3H3UA 3QRFF 4L18B 2IA2A 1QZZA 3J81K 3RYRA 2RVCA 5D5XB 4F7ZA 4M73A 4P9UA 1QNTA 3KCCA 4RB2C 4MHGA 4KT5C 2PQ8A 2RQPA 2E1CA 1HKTA 4N0BA 3K69A 5CVIA 3QU3A 1YO5C 2MLGA 4EGZA 1JE8A 2STWA 5DDGA 3LA2A 2XAFA 1U3EM 3K1NA 4G6DA 2W25A 2GZWA 2PBIA 4IF4A 4HQEA 2H6CA 2HKOA 1K78B 4PCQA 2ZNYA 3HTUA 4QLCU 1D5VA 5LBQA 4B8XA 2UZKA 4LFUA 1XCVA 4H0EA 2GA1A 3WTUC 1W4MA 2P6SA 2QWWA 4YIFA 2IJLA 4WX9A 4UXNA 1RNLA 2C6YA 2LSOA 3J81Z 2DQRA 2KRFA 1A04A 2IT0A 2EA2A 1UHWA 2O0YA 1R1TA 1HBXG 2IVMA 4M74A 1S6LA 1H9TA 1MGTA 1ON2A 1V4RA 2WV0A 3BJ6A 3EUHA 3F72A 4XLNF 1QZYA 4ESFA 2L02A 2ISZA 1Z6TA 2HYFA 2P7CB 4KMFA 1S7AA 5L3EA 3I53A 1FYKA 2W24A 1IN4A 1JGSA 3LA3A 1DP7P 3LFKA 2M45A 4UNOA 3V8KA 3BJOA 1ZYRF 2CGPA 2HGCA 3QP6A 1H9GA 4HF2A 4BHCA 1FY7A 2Y75A 2FNAA 4KN4X 3AAFA 1XSVA 2ZXJA 3TOAA 2MLKA 3R61A 1WWXA 1KU9A 1T39A 1XGNA 2EV0A 3HYIA 3E6DA 3M9AA 1P2FA 5HLGA 1SD7A 5CJ9A 3CO7C 2ZO4A 3DV8A 1Q1HA 2G7HA 4HDUA 3BZ6A 2XKPA 1ZGJA 3F21A 4AD9A 4M71A 3JSPA 2J5OA 3C1DA 3VFZA 4DQ2A 1USSA 5IT9K 3M1EA 3HHGA 5TRDA 2XRNA 4GCVA 3HRMA 5E1WA 1SFXA 4XSXF 3KFWX 3BDDA 1IW7F 4HA8A 1R22A 2QBYB 1YLFA 2MH2A 1HKQA 2FMLA 5A2QK 4RB1A 3TO7A 2H09A 1LDKB 1U6GA 3WTVC 2Q8KA 4LK1F 2OBPA 5BS6A 4ZZLA 4CHUA 3ECHA 4AIHA 2HTJA 1QGPA 1YW9A 2DQLA 2PMUA 4I2OA 1ZG1A 2A3SA 4M6XA 4OIOF 4BAYA 5D4RA 3V7RA 3W6KB 1W7PA 5JFRA 4RGXA 3RJPA 3EQLF 4PDKA 3WU0A 1BC7C 2W57A 2BE5F 3HUGA 1O57A 4Q48A 3BROA 4HV6A 3QU6A 3SXYA 4KUMA 4G6QA 1KYWA 3DEUA 1PP7U 4A5NA 2G7UA 5K5QA 5ERIA 5DYMA 1HQCA 3F6OA 5ILVA 2YSRA 5ICGA 2HYGD 4WK8F 4HW0A 4MGRA 2DK5A 3HSFA 1O3QA 3FXQA 1ZH5A 1V3FA 3F8BA 5A2QZ 1H0MA 2OZ6A 2O03A 3IL2A 1R58A 1G6NA 1RUOA 5KVRA 1K79A 4HQMA 2ZMEA 5LEJA 2FMYA 3LAJA 2QQAA 4YFXF 2FBIA 2PJPA 4RB0A 2J5PA 1IAWA 2QUFA 4BHBA 2LF7A 3V7SA 3U2RA 2GAUA 3WTXC 5LHIA 4A0YA 2TDXA 5E8IA 1DDNA 1B59A 1PP8F 3R0AA 2OA4A 5ICCA 4HLXA 2O6GE 2K4BA 1ZG3A 1BC8C 2XKOA 2HFHA 5LRRA 2A5YB 1IN8A 4N9IA 4Q5SF 1MJAA 2LNBA 4ZYGA 2FBHA 2MBFA 2K02A 2H94A 3KEQA 4M9ZA 2F5FA 4ON0A 3ZN1A 1FYLA 4ETSA 1U2WA 3ZN0A 1G4DA 1NHAA 4A6DA 4BXUA 1FZPB 3TOBA 3ULQB 4CXFA 4MEXF 2Z33A 3ABTA 2M1BA 3GVAA 1S8NA 5FFZA 2OZUA 5LGUA 1B1BA 3QOPA 5F1RA 2OQRA 1U5TC 4KFCA 1BI2A 1P6RA 3KP2A 3KZYA 2VN2A 1P4AA 5E1ZB 3R6SA 5D6FA 5CVUA 2DAOA 3NQOA 4A5MA 2AS5F 1T98A 4IHSA 1F9NA 3IWFA 4XSZF 2NYXA 4RGRA 2O61A 1DPRA 2VBXA 1Z91A 1PDNC 3MWMA 3ML6A 4OU0A 1MJBA 4M9XA 3MFKA 1BI0A 4RAYA 1MDMB 1R1UA 4KYWA 4AVPA 2FU4A 3EYYA 4HX8A 3WU1B 1Z05A 4G7HF 4OMZA 1WKMA 3M7GA 3J7AO 2IA0A 2EFOA 5HOOA 1IF1A 5HDNA 2QQ9A 2VONA 5HS9A 4Z2YA 4Y15A 4ZH4F 1YYVA 3MEXA 4O5VA 2RNJA 3CJNA 4BYYA 1T2KA 4QWQA 1S3JA 1J75A 3V8JA 1ZLKA 2BV6A 3HOTA 1FX7A 3LA7A 4XLPF 1IZ1A 1IN5A 5E17F 1K6OA 3GEZA 4IRIA 3RPQA 4RGSA 4NB5A 2M87A 4BH9A 1YW8A 3P9IA 2JRTA 3Q5FA 3IRRA 4XBFA 3GLXA 4L9NA 4EGYA 4LJZF 3SFZA 1Z7UA 4O6JA 3ZPLA 1D8JA 2VBZA 2PEXA 1FOKA 4G8XA 4YIIA 1WQ2A 4MTDA 3CO6C 2OAZA 4Y17A 3R4KA 4ENKA 5J6XA 2DK8A 3K1PA 1KU3A 4EM0B 3JAMK 4OOIA 1SD6A 2AXLA 4CDGA 3IKTA 3HHHA 2NNYA 4EVIA 4ESJA 1B9MA 3ZMDA 5BPDA 3F3XA 4RB3C 4HLYA 4L0ZB 2HEOA 4KN7X 3E6CC 2D45A 2EB7A 4KIBA 2XHKA 3BWGA 5D5UB 2ISYA 3SZTA 4HYEA 3T8RA 4Q47A 1ZG5A 5CVJA 1KU7A 2IRFG 4L9JA 4R8HA 3WTYC 3CUQA 1J59A 2QQBA 3BP8A 1STZA 2F5CA 5D6EA 3WTZA 2FRHA 3HSEA 2MH9A 3KEOA 4IRGA 3FMQA 5JI6A 2H27A 1OR7A 2K7LA 1FNNA 5L3GA 2D1HA 2XAQA 2QVOA 3GZ5A 1YW7A 4LLLA 2X4HA 5D5VB 3EDPA 1R5GA 3M8FA 2P5LC 3BOQA 1UFMA 5DUKA 1OMIA 1U78A 1I1GA 1RUNA 3RTRA 1BIBA 3IHUA 3B73A 3FWEA 3ZMTA 4O3MA 3DPTA 2V9VA 5IT3A 3WODF 4KIGA 3Q9SA 4EM2A 4KDPA 1TBXA 4WCGA 3RKXA 1I5ZA 4MNUA 2FE3A 2XUBA 1QPMA 2V1UA 3GWZA 3KP7A 5K5RA 3ELKA 2P8TA 5DD8A 4HF1A 2JZYA 3KETA 1CGPA 1TW2A 2JPCA 3E5UA 1S7OA 3GUDA 2FNPA 3I5UA 1KQ9A 2K4JA 2KIUA 4PGHA 1ZRCA 2LKPA 5DCMB 4IPAA 3WE3A 3GZ6A 4WXCA 1KYZA 3KP3A 2ETHA 4FHTA 1LVAA 1FT9A 1BI1A 1OKRA 4OMYA 2VE9A 2COMA 2LDUA 1LNWA 2E7WA 3KE2A 1D8KA 2ESNA 2ZMEB 4NHJA 2B0LA 4I09A 2XGXA 1O7FA 5LGNA 3MQ0A 2PFBA 4JQFA 3WTWC 5L3BA 1Y0UA 1SMYF 2Z99A 3LSTA 4UV8A 1B9NA 3IC7A 4HBLA 4LG0A 4EQQA 3GXOA 2CG4A 3DXJF 4RS8A 1BIAA 2CSOA 2O8XA 4LG0B 2P4WA 3VB2A 3SHFA 3PFIA 3JAMZ 2VODA 3ROUA 2OQGA 1T38A 2RGVA 4RAZA 2OU2A 5E20A 3WG9A 2OD5A 2BGCA 5BQTA 5HDGA 1ZRDA 4ZYDA 2KJBA 1IRGA 4OINF 5FLXZ 1IN7A 3TKYA 5LEKA 2HR3A 2QM3A 3ABUA 4N9HA 1DUXC 4CZZA 4FX4A 3REOA 4I7HA 4HX4A 2DW4A 3GW2A 4EMSA 3RDIA 2IA1A 3NEUA 4HX7A 1REPC 1KQ8A 4G7ZF 3P9KA 1RIOH 2F2EA 3DF8A 5JHUA 1BOAA 4GYGA 2PI0A 3TDUC 4GXOA 4P5OA 1S29A 3DPLC 1DPUA 4A12A 2JTVA 3SZPA 3GFLA 2G9WA 5BPIA 2QLZA 4GGGA 2LF8A 5HS8A 5H6RA 2DPDA 1J2XA 2JT1A 2R7FA 4HZFA 3ZMSA 1WSUA 1ZAOA 5BMZA 2DPUA 4UUVA 1FBQA 2GWRA 1JHFA 2FOKA 1AOYA 1TNSA 2YX4A 5DCFA 2EWNA 1CF7A 2BEOA 2O3FA 1MJ9A 4A6EA 4L5IA 4LB5A 2IPQX 1SFUA 1XGSA 3F8FA 2XV4S 5FGMA 5F6FA 1J0RA 4LB6B 2HOEA 2L4MA 2H6BA 1BBYA 1T6SA 3BPVA 1ZREA 3V8LA 2XAHA 1XMAA 3HOSA 3FM3A 3O2PE 4UVAA 4D0PA 3VODA 1W5TA 4A2UA 1P4XA 1EH8A 3FXRA 3PQKA 5CVRA 1FP2A 4A0XA 1HSJA 4L0YB 2Z3YA 1FPQA 3L7WA 2UWMA 4U0WA 4B09A 1R23A 5LRSA 5E8GA 2ADUA 3O6BB 3BJAA 1J7KA 3G3ZA 2DTRA 3WE2A 1SMTA 3VOEA 4CGZA 3CUQB 2CFXA 3I58A 1FWZA 5HLHA 2CO5A 3F23A 4ENJA 4EM1A 2EFPA 2VT2A 1FBSA 3T1BA 2V6CA 4HOBA 3LAPA 3LQQA 1WRJA 4ZZDA 3F6VA 4FX0A 2IP2A 2EFQA 5FB2A 2Y48A 1EH7A 5JR3A 2GA2A 4M6YA 3RPUA 3BY6A 2CQKA 1XDSA 3TO6A 1SD5A 3WGHA 4PGGA 4L9VA 2Z5UA 5KK1A 3M8EA 2MC3A 4MEYF 3KZZA 1R5HA 3CUOA 3QP5A 4OIPF 4G94A 2DU9A 5ILUA 5AONA 4R1HA 1LEBA 5J8CA 2GXBA 3V7CA 4HAMA 3VEPA 4UVBA 2L3DA 1EH6A 5AIQA 4I0BA 3FM5A 2A6HF 1K7AA 4DNCA 1MKMA 1YS7A 3DQVC 5FO5A 2ZCWA 5LGTA 2P7VB 1KGSA 1AWCA 3H92A 2EV5A 3U1DA 1G3WA 4ASNA 1F1ZA 5FD5A 1ZLJA 3D0SA 2XIGA 1B4AA 1HW5A 2XASA 3K9TA 1FSEA 3WGGA 4MQ9F 2PN6A 3DFGA 4E70A 4EJTA 3N97A 2KIFA 4HF0A 2A68F 2D1VA 2GQQA 5LLQA 4TV7A 5H6QA 2FA5A 2ZBKA 3C7JA 4OIRF 3JTGA 4LLNA 3I71A 1LB2A 1HXDA 3ZQ7A 2NS0A 3IRQA 3F8CA 5D8KB 3JSOA 1W7PB 4L5JA 5ICEA 1IRFA 5ED4A 3FMRA 1ODDA 5L3CA 4CYDA 4AWXB 1ZGAA 1XDUA 1O7LA 5H20A 2RN7A 2VC1A 4WF2A 1BM9A 3KP6A 3GX4X 1SD4A 3LWFA 2IW5A 1I27A 3V4GA 2VBWA 5CLSA 2DBBA 3U9GA 5K1YA 1MZBA 2HDCA 2HQRA 1HW2A 4MTEA 1LEAA 4M9SA 3KP4A 1D3YA 3O3KA 4LK0F 2CW0F 1XD7A 4L9TA 1XGMA 1WI9A 3ZP5A 2VC0A 5ICFA 1YTYA 4P9FA 1O3SA 3J80Z 2HZTA 3WTTC 1ULYA 4GO1A 2HS5A 2EFNA 2HWVA 1G3TA 2A07F 4U0YA 3BPXA 4PZJA 2E7XA 1CF7B 4R79A 2UXXA 2KJCA 4P55A 4U0VA 3FXUA 2EA4A 2QBYA 2M30A 5EEGA 4JK1X 4Q4ZF 4A0ZA 4KMUX 1FSHA 1Z1DA 2XAGA 1FP1D 1F5TA 1W7PD 1PUEE 2FF4A 1TQIA 2JPBA 3DP7A 2DO7A 2STTA 2GXGA 2ZJ2A 3I54A 1EV7A 2X0LA 2EV6A 4CO8A 4AIJA 1IUYA 4GYIA 3T8TA 3G73A 2Q0OA 2HKXA 1YIOA 5HLIA 1XB4A 1LDJA 1YQAA 3C3WA 2YX7A 2L54A 1K78A 3P7NA 1RI7A 2BYVE 4G9YA 3RIRA 5FLXK 2ESHA 1L0OC 3HRSA 4ENMA 2A69F 1HW1A 2ZNZA 3I59B 4XRFA 1E2XA 3FZVA 2XVCA 1LDDA 2FEZA 2YPRA 3E5QA 2VBYA 1E17A 4G7OF 2NNNA 2XAJA 1OYYA 3ZMZA 4BNCA 1GVJA 3DKWA 3HRUA 3EYIA 1YG2A 3OV8A 3K0LA 4KA4A 2WC2A 1P4WA 3WTSC 1GHCA 1VTNC 4HV5A 2EK5A 4KICA 1OYWA 4YG2F 2Y0MA 1O3RA 3KLNA 3I0TA 1TW3A 3F22A 3L2CA 2JSCA 5JVTA 1I1SA 3HSRA 4IRHA 3PQJA 5CYVA 4I01A 5E18F 3I4PA 1BI3A 3FHZA 2W85A 4WWCA 1C0WA 2CYYA 4NQWA 1Z9CA 1L3LA 4M72A 4BHPA 3MAJA 3RI4A 1BJAA 4WXDA 3L00A 3NRVA 2RV8A 1MDMA 3T0YA 3GFMA 1IXSB 5HDKA 3HIFA 3CUQC 4MQVA 4S05A 3KP5A 3J80K 1XCBA 3JTHA 1JXSA 4HDVA 2FXAA 4YFKF 2MD5A 2A6EF 2P5KA 4ZYHA 1X3UA 4I0AA 1YFHA 2FQ3A 1F4KA 3RKYA 4ESBA 5HVQC 4EV0A 2RKHA 3RKWA 1SFEA 2E1NA 1FC3A 4LLGF 1OYIA 1USTA 1IN6A 2DT5A 5HS7A 1TQPA 4KNYA 2MA3A 1HKSA 1XN7A 3FF5A 3L09A 1RZ4A 3Q9VA 3N4MA 4IHTA 3K2ZA 3F8NA 1BN5A 3D5LA 4ENNA 1R00A 2FBKA 1J9IA 3GYHX 2NAZA 2K86A 1TLHB 2WTEA 3GFJA 4IVNA 2L01A 4IXAA 2VOOA 4LD5A 2R3SA 2Z9OA 3MZYA 2QENA 3CDHA 1G3YA 1XMKA 1FLIA 4RGUA 2R7DA 4CICA 1W5SA 4EJOA 3LQRA 3FX3A 5IT9Z
chains in the Genus database with same CATH superfamily
1R1VA 1O3TA 5L3DA 3LOCA 1D1BA 3GF2A 1UHMA 2H8WA 3E5XA 1MD0A 5EJCA 2JA6J 4U87A 5TJJA 2PG4A 1ZHFA 1ETOA 5F1JA 1W5CC 5K5OA 1VQMI 4OIQF 5LHHA 2K9MA 2HNHA 5EEHA 3H36A 6PAXA 3HL2A 3CTAA 2DJIA 5J8FA 2GIVA 1I39A 1JHHA 4LIVA 5ILSA 4PSXA 1VQ6I 2LBFA 2FSWA 2LG4A 3IAS2 3W6JB 4X0GA 3CC2I 2JK3A 1J5YA 1JKQC 3ISPA 1GXPA 5L3FA 1U5TB 3T5XA 4U88A 2CQQA 1U5TA 2F5EA 1HSTA 3DKXA 3LSRA 2QYOA 3E6MA 3QPHA 4I98B 4EJUA 2WWYA 5E1XA 1JUPA 4BJ6C 1TTYA 3R60A 1HLVA 4V2GA 1LE8B 5D5WB 5F64A 1P92A 1YI2I 3PNYA 1YX5A 4GFBA 2DFIA 1QO0D 3U21A 5D8LB 1X1BA 3CLOA 4XORA 4BE0A 4IHVA 2DOAA 2K27A 4F52A 2L9RA 2LFBA 1B6AA 1MNDA 1QU3A 3ZCOA 2KZVA 4B47A 4QTRA 5J4VA 3L9FA 3OYAA 2O5RA 3KLOA 4RAGA 1KU2A 1PJRA 4ZYEA 3SQNA 3E97A 2XF5A 2ACJA 2PLYA 2KKOA 3E3VA 3TO9A 2L4AA 4AM3A 2M8EA 5M5WJ 1WFXA 3IKVA 5M3MJ 5C4JJ 1A6IA 3CD6I 1E3OC 3M1CA 5FD6A 1V5EA 3OYFA 2ZFWA 5FFXA 3FMSA 2HZDA 1PYVA 4IHXA 2EIMH 3BR2A 4PJMA 5GPAA 2V1DA 1U8RA 2R7TA 1SFKA 3CMMA 4UHTA 3OOPA 1FYMA 1XGOA 3IWZA 1TWGJ 1IXRC 2HVRA 4JX6A 3CLQA 4C2MJ 1JJ6C 4JBAA 3RCOA 1T8IA 2V1XA 2VT3A 1AKHA 2VXZA 2A61A 1MSEC 2R5YB 3TDZC 3TQNA 2XROA 3SZGA 3I64A 5LHGA 2WAQA 3FBNB 4LGWA 4XRSG 2GM4A 4S04A 2ELHA 2VKHA 3OWTA 5F0FA 3FX3A 2BVMA 1SAUA 3U1KA 1OQYA 2O7OA 1IV8A 1XSXA 3ZMUA 1R7JA 2UXNA 2W84A 3R0JA 2ZKZA 2PMHA 3COAC 4B3XA 1JKRC 2KIMA 1YIJI 3GO5A 4YFNF 1MMNA 1TQMA 1B72A 2E1MB 2V9KA 3F8MA 2EJRA 5BNGA 4F93B 2KIQA 3ZMVA 2X6YA 1TNTA 4PFOA 3P9CA 4P96A 1ON1A 2O9LA 3IH4A 2VOPA 3ECOA 3K4KA 3NWTA 2EFWA 4FTHA 5CQEA 4M3GA 1MH3A 2X1CA 5H2FC 3QAHA 4FT8A 2M0MA 3GCMA 5DV5A 1G59A 2XPWA 1QQIA 3VPRA 2HQNA 3CCSI 1ZRFA 1PVEA 2X48A 2D2WA 2YU3A 3HC7A 2WB1A 5DD4A 2Z16A 3S2WA 3TW7A 3MZHA 3ERED 1ITYA 5B1BH 1SAXA 3PSIA 2YUSA 4J01A 2TRTA 1AHDP 2NRAC 3MCZA 3EETA 5DCMA 2WY7Q 3QPTA 3HRTA 2Z2SB 1KQ0A 2WA0A 3I55I 2HOSA 3WGIA 3K1MA 5BOXA 1VNDA 2Y2ZA 2VJ4A 2X51A 1IXCA 3H5NA 4C3HJ 4AIKA 2R93J 1YS6A 3GTQJ 4E6KG 2VJIA 2XF6A 1D1AA 1K61A 2IXSA 4IJAA 3A01B 1Z6RA 1T95A 3OIQA 3ABKH 5FKNA 1LJ9A 1TL8A 1I3QJ 2RC4A 1XSDA 3JW4A 1OCOH 4K2EA 4EEFG 2DN0A 1SEUA 1LQ1A 5AIPA 4XIDA 2V79A 3CDIA 2G0EA 1RRJA 4LMYA 1ETYA 3G71I 3I3LA 3OL3A 3Q0UA 3GFIA 3PM1A 1OPCA 4ZTFA 3CP2A 1R36A 4I02A 4EJWA 4BQAA 2RQQA 1ZARA 4RMNA 4X6AJ 2M5WA 3RYPA 3DBLB 3E6BA 4NC8A 5EYRA 2QQ8A 3X2QH 5DEQA 4BQQA 3OSGA 3H5AA 2P6TA 1SVLA 4BXFA 3C18A 4NBQA 3FKIJ 5F08A 3FBIB 1GXQA 3EPZA 4U7BA 1UB9A 2BBYA 2L5QA 2Q2EA 3ASOH 4E7IA 4C9YA 1I6XA 3TGNA 2W82A 1UAAA 1BR1A 1KA8A 1T0FA 5DUIA 1FIAA 5IPAA 4U7DA 2R7WA 2VI6A 1ONVA 2MABA 1W36D 2RDPA 1I6HJ 3L2QA 3H3ZA 3QPLA 2XB5A 4UV9A 4AU7A 2YR2A 1ZR4A 2P5VA 5CVVA 4EJVA 2DLLA 1T56A 1WJEA 4ABZA 2HQAA 1G3SA 4UVCA 2VE8A 3GTOJ 1ZN2A 5D4SA 1FOWA 1UCRA 1FBUA 4IOCF 2F5DA 4WXHA 4A3EJ 3OS0A 2R7XA 2HTSA 1ENHA 2X6XA 1ACIA 2QSGX 1N77A 4KIFA 3I59A 2CWEA 2DA7A 3HTSB 1SVMA 2FUG2 3L2RA 2QZ8A 4HNVA 1ZQ3P 1BR2A 4Y33A 2DI3A 3B02A 3CMEI 1OCCH 1QBJA 1X58A 4Y13A 3H3UA 3H9GA 3QRFF 4L18B 2CQNA 1FJLA 2DTZA 2IA2A 2XSJC 1DGRM 1QZZA 5EEAA 3J81K 3RYRA 4AVZA 5J3LA 2RVCA 3EUAA 5D5XB 4F7ZA 3JREA 3UKGA 1TWFJ 2IGMA 2DOFA 2XGEA 4M73A 4P9UA 1QNTA 3ZOBA 2F4MB 4UUSA 3K70D 4J00A 3KCCA 4RB2C 4MHGA 4ANJA 2HPIA 4KT5C 3OOUA 2PQ8A 2RQPA 2E1CA 2K5CA 4RLFA 1HKTA 4N0BA 3K69A 2E1OA 1DU6A 2CQXA 5CVIA 4LG3A 3CCEI 3E7LA 3QU3A 2W7NA 3CMAI 1YO5C 2MLGA 2DDAA 1VQ8I 2XGCA 3C2HA 4EGZA 2EQRA 1JE8A 1BL0A 2STWA 5DDGA 2AO9A 1ZR2A 3LA2A 1POGA 2HOTA 2XAFA 3Q3SA 1U3EM 3K1NA 4G6DA 3K10A 2W25A 3JRFA 3I9V2 1TT5B 3HGGA 4G6TB 2GZWA 3Q0VA 1I50J 2PBIA 1D1CA 4IF4A 4HQEA 4FCYA 3QQAA 3C2GA 2H6CA 3FXOA 2BY1A 2HKOA 2QGUA 1K78B 4PCQA 1TT0A 2ZNYA 2R92J 3HTUA 4QLCU 1D5VA 4IQ4A 5LBQA 4B8XA 2UZKA 4LFUA 1R71A 1XCVA 1FMWA 4H0EA 2Y69H 3IH2A 2E2JJ 1HCRA 1LUJB 2GA1A 4XLEA 3WTUC 1W4MA 2P6SA 2QWWA 4YIFA 3RPUD 5C4XJ 2D5VA 2IJLA 1Y1VJ 2JJ7A 4WX9A 2HI3A 4UXNA 2HQ5A 1RNLA 2C6YA 1SVOA 5FLMJ 2LSOA 3J81Z 4F3QA 3BC8A 2DQRA 2KRFA 1A04A 1RR7A 2IT0A 2EA2A 2IBDA 1UHWA 1QHGA 1BW5A 2O0YA 1MBFA 5KAIC 2EBIA 1R1TA 2NVQJ 4ZTJA 1HBXG 2DMPA 1RESA 1TWHJ 2IVMA 5DM6F 1Z77A 4M74A 1S6LA 1H9TA 4HEA2 4ZDLA 1MGTA 1ON2A 1V4RA 2WV0A 3CC7I 1JI8A 3J7ZI 3BJ6A 3EUHA 3F72A 4XLNF 9ANTA 1R9TJ 1QZYA 3FDYA 4ESFA 3CC4I 2L02A 2ISZA 1U9NA 2HVQA 3CCJI 1Z6TA 2HYFA 4RDUA 1Q1VA 1XPXA 2HDWA 2P7CB 4KMFA 2CW8A 1S7AA 3QODA 5L3EA 3I53A 3AKZA 1FYKA 2RAEA 2W24A 3E1SA 2W00A 1IN4A 4XN0A 1JGSA 4Z6YA 3LA3A 1DP7P 3RZOJ 5GP9A 1VQKI 3LFKA 1IV6A 2M45A 4UNOA 2VQCA 3V8KA 2DA1A 3BJOA 2LY1A 1ZYRF 2ZMEC 1T33A 1JKPC 3CF5F 2CGPA 2HGCA 3QP6A 1H9GA 3BQZA 2OCCH 4HF2A 1XTAA 1XG1A 4BHCA 1FY7A 2Y75A 2FNAA 1WJBA 3GTJJ 2LBFB 4MO7A 4MFDA 4KN4X 3AAFA 2V6EA 1N25A 2ZXJA 1XSVA 3TOAA 1RETA 2MLKA 3R61A 2LMDA 2ZFUA 1WWXA 4BACA 3KYLA 1KU9A 1K4SA 2K3PA 2F4OB 1J09A 3CP8A 1T39A 2ECCA 1XGNA 2EV0A 3H0GJ 3FK7A 3HYIA 1T08B 3E6DA 1W0UA 3M9AA 1U8BA 1P2FA 2Y0SA 5HLGA 1SD7A 2AQFA 5E3MA 5CJ9A 3LSJA 3CO7C 4E7LA 2ZO4A 3DV8A 1Q1HA 2G7HA 1LFUP 4HDUA 3BZ6A 2F5VA 2Z1DA 2NS7A 1W0TA 2R7RA 1PUFA 2XKPA 1ZGJA 1WJFA 3F21A 2I8DA 4AD9A 4M71A 2XPVA 5DTDA 3JSPA 2J5OA 3C1DA 3VFZA 4DQ2A 1USSA 1YJ9I 5IT9K 3M1EA 4CH7A 3HHGA 5DM7F 1QHHD 2M7AA 5TRDA 1MNEA 2XRNA 4GCVA 3HRMA 5E1WA 5IOYA 1SFXA 4XSXF 2KRCA 3KFWX 3BDDA 1IW7F 4HA8A 4A3MJ 2JSPA 1B72B 2FOWA 1R22A 2QBYB 1YLFA 2MH2A 3OS2A 1K6YA 4BU2A 1NTCA 5K7HA 1HKQA 2FMLA 5F27A 5A2QK 4ZDPA 1D5YA 2ZXHA 4RB1A 3TO7A 3HUGB 2H09A 1LDKB 2M9HA 5IYDJ 2EILH 1U6GA 3WTVC 2Q8KA 3BR5A 4LK1F 4F92B 2OBPA 4HSTA 5BS6A 4ZYAA 4ZZLA 4CHUA 1JKOC 3KYDB 2L9SA 5FLVA 4CUGA 3ECHA 4DZPA 4AIHA 2HTJA 3CCLI 1QGPA 2R7OA 3SYTA 1VQ4I 4BBSJ 4UB8C 1YW9A 4X1EA 2DQLA 3IV5A 2R7ZJ 2CU7A 2PMUA 4I2OA 1X1PA 2A3SA 3KEYA 4M6XA 4UB6C 1ZG1A 4CYCB 4OIOF 4BAYA 5D4RA 4RM3A 3V7RA 3W6KB 4QPQA 1BR4A 2EZHA 1W7PA 1YRNA 3K4MA 2XGDA 3OYDA 5JFRA 4RGXA 3RJPA 1IC8A 3EQLF 1LE8A 4XLHA 4PDKA 3WU0A 1BC7C 2W57A 4BXXJ 1DGWY 2DODA 1UMQA 2BE5F 2B9SA 3HUGA 1G8XA 1O57A 2BY2A 3OL4A 4Q48A 3ZRGA 2F48A 3BROA 3CQZJ 4HV6A 3QU6A 3SXYA 3DKYA 3S15J 4BS9A 1IRXA 4KUMA 1X3WB 3DEUA 1KYWA 4G6QA 4XLFA 2HDDA 1PP7U 4A5NA 2G7UA 3LL7A 5K5QA 3H9QA 5DYMA 5ERIA 3SJMA 3I4MJ 3PUBA 4AYBN 1HQCA 3F6OA 5ILVA 3ESWB 4XKWA 2YSRA 5ICGA 2HYGD 4PSWA 4WK8F 4HW0A 4UY8I 4MGRA 2DK5A 3HSFA 3SDGA 4BY1J 1O3QA 3FXQA 3FK6A 1ZH5A 4AYBA 3WG7H 1V3FA 2HXIA 4CSWA 3F8BA 5A2QZ 5CKTA 4H4KC 1H0MA 3VSKA 2OZ6A 2O03A 3IL2A 1R58A 3QPSA 1G6NA 5GADJ 5M5YJ 1RUOA 2EZKA 3DLAA 4ZC3A 1TWCJ 1MBJA 5KVRA 1K79A 3K6GA 3M07A 4HQMA 2ZMEA 5LEJA 4IQJA 2FMYA 3BCAA 3LAJA 2QQAA 2QSHX 3BG3A 4YFXF 1X2NA 2FBIA 2L9NA 2PJPA 4RB0A 2J5PA 1IAWA 2PMZN 2M2EA 2QUFA 4BHBA 2LF7A 1YOVB 2L7FP 2A6TA 2EPFA 2HXOA 3A4CA 4XQFA 2JA7J 3S3NA 3V7SA 3U2RA 2GAUA 3WTXC 1Z3XA 3ZQLA 2OTJI 5LHIA 5JLWA 4BY7J 3AFHA 4S0HB 1VQPI 4A0YA 3DTIA 2TDXA 5E8IA 1LKXA 1H89C 1WJDA 1DDNA 4A3FJ 4JX5A 2A5WA 3TBIA 2LREA 1B59A 1PP8F 4AC0A 3R0AA 2LP0A 1MBKA 2WAFA 1JJ8C 2OA4A 5ICCA 1OLTA 4HLXA 2O6GE 2GLOA 2ZJQF 2K4BA 5GAHJ 2R4GA 1GV2A 1ZG3A 4IZZA 1BC8C 1P7IA 2XKOA 2Y0SN 2HFHA 5LRRA 2A5YB 1IN8A 1JT0A 2CJJA 3A03A 4N9IA 3TL4X 4Q5SF 1MJAA 2LNBA 4ZYGA 1UZCA 1NK2P 2FBHA 4RLQA 2JWTA 2MD0A 3MKLA 2MBFA 3VYRB 2R0QC 3ZQIA 2K02A 2H94A 3FXLA 4OAYA 3KEQA 3H5RA 4CYCA 4M9ZA 2F5FA 3JRIA 4ON0A 3ZN1A 3S16J 1FYLA 4ETSA 3JRHA 1U2WA 3ZN0A 3TW6A 1ETKA 1G4DA 1NHAA 4A6DA 2LD5A 2RNGA 4BXUA 4C3IJ 1FZPB 2LYCA 3TOBA 2XC7A 2ZSHB 4MFEA 3ULQB 3L2UA 3SFIA 4CXFA 2R5YA 4XL9A 3S8PA 4MEXF 2Z33A 3ABTA 2HOAA 2H8RA 4XR6A 1F43A 2M1BA 2JUGA 3GVAA 1S8NA 5FFZA 2OZUA 5J40A 2I5UA 5LGUA 4I6ZA 1B1BA 3QOPA 5F1RA 2GOXB 2OQRA 1U5TC 2CW7A 4KFCA 1BI2A 1P6RA 3KP2A 3KZYA 2VN2A 2VPLA 1P4AA 5E1ZB 3DBRB 2FX0A 3RKQA 4BJTA 3R6SA 5D6FA 5CVUA 2DAOA 4NUBA 3NQOA 2PX9A 3W2AA 2JVHA 4XOTA 4A5MA 4CCNA 2AS5F 1T98A 4IHSA 1XMXA 4XM3A 1F9NA 3IWFA 3KIOA 3H9JA 4XSZF 1YITI 1RC9A 2NYXA 3CJRB 4RGRA 2O61A 3NWSA 4E7SA 1DPRA 2K9LA 3HKZN 1T0FC 1Z91A 2VBXA 3MWMA 4A3KJ 1PDNC 1A36A 2ICWG 3ML6A 3O8GA 4OU0A 2IEKA 1XS9A 1MJBA 4M9XA 4KJZA 2NVXJ 3SDBA 3MFKA 1BI0A 1E0EA 2ZXWH 4L5EA 4RAYA 1MDMB 1R1UA 4KYWA 2XDVA 4AVPA 2FU4A 3CCVI 3EYYA 3DWLE 1Y1WJ 1IO2A 4HX8A 3WU1B 3A0BC 5GTHC 1Z05A 5KHDA 3VDXA 2HYJA 4G7HF 1Y8RB 2NOGA 3F0CA 4OMZA 3WU2C 1WKMA 3M7GA 3J7AO 3OMYA 2IA0A 2EFOA 3HPHA 5HOOA 1IF1A 5HDNA 3BR1A 3D5RC 2QQ9A 5K7ZA 3I4NJ 1S9HA 3A0HC 1V5GA 2VONA 3AL0C 5HS9A 1GV5A 1Y8QB 4Z2YA 4W1UA 3OYHA 1D0XA 2GBYA 4Y15A 4A3JJ 4ZH4F 1YYVA 3GMEA 3MEXA 3ZGKA 1TWAJ 2OUMA 4O5VA 2RNJA 3CJNA 2XPUA 4BYYA 1T2KA 4QWQA 3LMMA 1S3JA 1X3ZB 1J75A 1H8AC 3V8JA 1OISA 1E3PA 1ZLKA 2BV6A 1RKTA 3HOTA 1FX7A 3LA7A 4XLPF 1IZ1A 1IN5A 3HOVJ 5E17F 3ZQFA 1K6OA 3GEZA 4B3AA 4IRIA 3RPQA 4RGSA 4NB5A 1R4NB 2M87A 4BH9A 1V55H 3H1CA 1YW8A 3P9IA 3TP3A 2JRTA 3Q5FA 3A02A 3IRRA 4C3JJ 4XBFA 3GLXA 3S2HJ 3AL0B 4L9NA 5EG0B 4MIMA 2W48A 2PMZA 4EGYA 5FROA 4E7KA 3CDLA 1SC7A 4LJZF 3SFZA 1Z7UA 4DYRA 1ZGWA 4O6JA 2BZTA 2M4GA 3ZPLA 4E7ZA 4LOCA 1D8JA 2VBZA 4RBOA 2ID3A 2DFFA 2PEXA 1FOKA 4PFPA 2E36A 3L1PA 4G8XA 3PFYA 4BDZA 4DJAA 1RR8C 2FQ4A 3KPHA 4YIIA 1H88C 1WQ2A 2LRDA 4MTDA 1BW6A 1NG7A 3FHNA 4NDLA 3CO6C 2OAZA 3UNGC 3BTCA 3W3CA 1GLNA 3VYUB 3IAM2 3RSNA 2IS2A 4Y17A 4M3DA 2WBMA 5KAFC 3H0DA 2Y31A 1U9OA 3S32A 2KMUA 3R4KA 4ENKA 3K4JA 1Y0NA 5J6XA 3ZR8X 2DK8A 3K1PA 2WV1A 2H1LA 2KHMA 1KU3A 4M3EA 2DFEA 4EM0B 4Y4RA 2KLOA 3JAMK 1SFOJ 4OOIA 3OYKA 2V4JC 1SD6A 2AXLA 2K85A 4CDGA 4E7HA 4QPOA 3E0JB 3IKTA 1E3HA 3ASNH 3ABMH 3B6CA 1S7EA 3HHHA 2E1MC 2NNYA 4EVIA 4ESJA 4IX7A 1B9MA 3S17J 2L9VA 3BG9A 3ZMDA 3IP4B 4CA0A 2KQRA 4BKXA 4CCLA 5BPDA 3F3XA 3LSKA 4RB3C 4HLYA 4MLOA 4D5FA 2CFOA 4L0ZB 2HEOA 4KN7X 3MKZA 3E6CC 2F4IA 2KFDA 1WI3A 2VJJA 2D45A 3FIWA 2EB7A 4KIBA 4BGDA 3PNTA 2XHKA 3BWGA 2VKVA 5D5UB 2ISYA 1K4TA 3SZTA 3CCQI 1XX5A 3DCFA 3FXJA 4HYEA 2P0WA 4NQWB 3BG5A 5EG0A 1AKHB 2EZLA 3S3OA 3T8RA 4Q47A 3FISA 4F91B 1ZG5A 3H35A 3MVPA 5CVJA 3I56I 1KU7A 2IRFG 4L9JA 1LFPA 4R8HA 4BUPA 4NNJA 5C3EJ 3WTYC 5JLXA 3CUQA 1J59A 4JP0A 2QQBA 3BP8A 1STZA 3GTGJ 4A3GJ 4C30A 2F5CA 4D1QA 5D6EA 3WTZA 2FRHA 1DQUA 1X4OA 3HSEA 4P1WA 2MH9A 3KEOA 4IRGA 5EGOA 3FMQA 3JRAA 5JI6A 2H27A 5HNHA 1OR7A 2K7LA 2WB1N 3GTKJ 1FNNA 5L3GA 4CCKA 2D1HA 2XAQA 2QVOA 3EUHC 3GZ5A 4HNTA 1YW7A 4LLLA 2X4HA 5D5VB 5FKKA 3EDPA 1R5GA 3M8FA 5IP9J 4XOPA 2P5LC 3BOQA 1UFMA 5IYBJ 5DUKA 2I10A 2E34A 5GAEJ 5HODA 1OMIA 1U78A 2CS3A 1I1GA 2DA2A 2LY2A 1RUNA 3RTRA 1BIBA 3IHUA 3B73A 3K7AJ 3HJEA 1YHQI 1TZLA 4BBRJ 3FWEA 3HOWJ 3ZMTA 4O3MA 3DPTA 3AG4H 2V9VA 5IT3A 3WODF 4KIGA 3VYTB 1FOXA 3Q9SA 4BE2A 2B63J 1OR7C 4EM2A 5J4YA 2BOLA 1ERDA 4KDPA 2LLKA 1TBXA 2VB6A 2CUEA 4WCGA 3OR2C 5CQGA 1MMDA 2CUJA 4XMYA 2IAIA 3RKXA 1I5ZA 4MNUA 5JVGF 3CCUI 5B66C 2FE3A 2XUBA 1BOBA 1QPMA 2V1UA 2QKMB 3Q0WA 1N78A 1P7JA 3NAUA 4II2A 3GWZA 3BR0A 3KP7A 5K5RA 2M3AA 3ELKA 2ECBA 3D1NI 2P8TA 5DD8A 4HF1A 4M3BA 3MD2A 2JZYA 3ABLH 3KETA 1TW2A 2JPCA 1CGPA 5C44J 4B4CA 2CUFA 3E5UA 1S7OA 3GUDA 1ETWA 3PO3J 4C2UA 4D7NA 1MMSA 2FNPA 3I5UA 1KQ9A 1WH5A 2K3FA 5K7FA 4Y3OA 1EA3A 1R4MB 2K4JA 2KIUA 4PGHA 1ZRCA 3LSGA 1JGGA 2LKPA 3JRBA 5DCMB 1MMAA 3DPUA 4IPAA 4JOMA 3WE3A 3GZ6A 4WXCA 2R7UA 1KYZA 3KP3A 2ETHA 4FHTA 1LVAA 1FT9A 1BI1A 1OKRA 4OMYA 2VE9A 3BLYA 1FTZA 2COMA 3UR3C 2LDUA 4D9JA 1LNWA 1VFCA 2E7WA 3KE2A 3K4NA 1D8KA 3JR9A 2ESNA 4IEJA 3JRCA 2ZMEB 4NHJA 2B0LA 1VQ7I 3HBLA 2XGXA 1O7FA 4I09A 5LGNA 2DMNA 3P5JA 3MQ0A 1PUFB 2PFBA 1Y6IA 4JQFA 3WTWC 1MW7A 5L3BA 2CMPA 1MBHA 1Y0UA 5FKMA 1SMYF 1GT0C 4IKFA 1QVTA 2ZJRF 2Z99A 2KL4A 1O4XA 3LSTA 3S2DJ 3G1LA 4DW6A 1MH4A 1QA6A 4UV8A 1B9NA 2ZC2A 3IC7A 4HBLA 4LG0A 4EQQA 2YS9A 3JRGA 5GTIC 1ETXA 3GXOA 3KYCB 2CG4A 3DXJF 4RS8A 1BIAA 2CSOA 4RAFA 2O8XA 4XONA 4LG0B 2P4WA 2UV1A 2VKDA 3K2AA 3VB2A 3SHFA 3PFIA 2E5ZA 3JAMZ 2VODA 2NXNB 4HRIA 4ZDOA 3ROUA 3LFUA 2HVSA 2OQGA 1V5FA 3QYBA 1T38A 2RGVA 2A05A 4RAZA 1YE9A 5F04A 4QIWN 2MYSA 2QA4I 3CJTB 2VQHA 1ETQA 2OU2A 3GTLJ 5E20A 3WG9A 3AG2H 2OD5A 2BGCA 5BQTA 3HOXJ 2W4SA 5HDGA 2X85A 3ZXSA 1ZRDA 4ZYDA 3ERMA 2KJBA 3BR3A 1Z7LA 3LSPA 3HDDA 2UUZA 1N75A 4FETA 2JQ7A 1IRGA 3MMYB 1KZHA 4OINF 1LVKA 5FLXZ 5FRNA 5EZHA 4JX4A 1IN7A 3TKYA 4XLAA 5LEKA 2HR3A 2QM3A 3ABUA 4DBQA 4N9HA 2L0KA 1DUXC 4CZZA 1JUSA 3ONQA 1IDYA 4RM2A 4FX4A 2IS1A 4DOZA 3REOA 4I7HA 3PJRA 2KISA 4BE1A 4HX4A 4IHYA 2DW4A 3GW2A 3FXMA 4XKVA 5HLTA 4EMSA 1FMVA 3RDIA 2IA1A 3NEUA 1WCMJ 4HX7A 5EZGA 5IP6A 2BY3A 1REPC 2MGQA 2PJRA 1KQ8A 1I3AA 4G7ZF 1Y56A 3P9KA 1RIOH 1OFCX 2F2EA 3DF8A 5JHUA 1BOAA 3V42A 4GYGA 4YRVA 1X2MA 5JHFA 5HNFA 3IUOA 3MKYB 3S1MJ 2OJED 2PI0A 3TDUC 2O8KA 2ELJA 4BJ5C 4GXOA 2Y9ZA 4P5OA 1TP4A 5J1UA 1X1CA 5CPRB 4CCMA 3BT9A 1S29A 3DPLC 2WAQN 1DPUA 1GVDA 4A12A 1MMGA 2ELKA 1FEXA 3K70C 1HC8A 2JTVA 4OAZA 5FKOA 4GRIA 3SZPA 1V54H 3PIOF 3TMOA 3GFLA 2G9WA 4XK4A 4B1RA 4FISA 5BPIA 2QLZA 4GGGA 2LF8A 5HS8A 5H6RA 1J2XA 2JT1A 2R7FA 4HZFA 2FJ1A 3ZMSA 5B5EC 1WSUA 2DPDA 1ZAOA 3IH3A 2JN6A 3RQ4A 2NVTJ 4V19K 5BMZA 1WVRA 1A5JA 4YIRX 1UELB 2DPUA 2VUMJ 4UUVA 2VLAA 1FBQA 2GWRA 3CCRI 1JHFA 1VQ9I 2FOKA 1AOYA 1TNSA 3L2WA 2VJ5A 5J1RA 2MC4A 1OJLA 2QF7A 2ZXIA 1ZKGA 1G2HA 2YX4A 2XAUA 5DCFA 3HXLA 2EWNA 2VIXA 2ME0A 1CF7A 2BEOA 5GPCA 2DT6A 2O3FA 1MJ9A 2DA3A 4A6EA 4L5IA 4LB5A 1Z0XA 3PO2J 1UHSA 3RZDJ 2OC6A 2IPQX 2OPTA 3GBGA 1SFUA 3VYSB 1XGSA 2DMQA 3F8FA 3DEEA 2XV4S 1WJ5A 1JTYA 3KZIC 5FGMA 5F6FA 1J0RA 4LB6B 1MNMC 2DA6A 2HOEA 2OF7A 2L4MA 5TGTA 3LSIA 2H6BA 1BBYA 4XICA 1T6SA 2KPMA 3OYLA 2KRHA 3K4LA 2NS8A 3BPVA 2EH3A 1ZREA 1QRYA 3K4BA 2L7ZA 2MG4A 3V8LA 2PJRB 2XAHA 3M3YJ 1XMAA 3HOSA 3FM3A 2DA5A 3O2PE 4UVAA 4IOAF 4D0PA 2EZIA 2W1OA 3VODA 1W5TA 4A2UA 1P4XA 3S1NJ 1EH8A 1KONA 3FXRA 3PQKA 5CVRA 1FP2A 4A0XA 5EF6A 4A3CJ 1HSJA 3W2VA 5M3FJ 4L0YB 3G1OA 3BCBA 2Z3YA 1GUUA 1NH3A 2HPMA 4ITVA 1NG6A 1FPQA 3L7WA 3ZQCA 2UWMA 4U0WA 4B09A 2K40A 4BL0B 1R23A 5LRSA 5E8GA 2ADUA 2DOEA 3J7AY 3O6BB 3JCUC 3BJAA 4A3LJ 1J7KA 2R7VA 3G3ZA 2IS6A 2DTRA 4J19A 3WE2A 1SMTA 4A3BJ 4PK4A 3DU5A 3VOEA 4CGZA 3CUQB 1ETVA 2BXYA 2CFXA 3I58A 1FWZA 5HLHA 2CO5A 3F23A 4ENJA 4EM1A 5LD2C 3HOYJ 4FQGA 2EFPA 2ME6A 2CQ7A 3W6VA 2VT2A 1FBSA 3T1BA 5FKLA 2RREA 2ZJPF 1MSFC 2V6CA 4HOBA 3OYBA 2EIJH 3OYCA 3GLLA 4GDFA 3LAPA 3OYJA 5KCMA 3LQQA 1WRJA 2XB0X 4ZZDA 3F6VA 1EKEA 4FX0A 4IL6C 4F55A 1TC3C 3BTLA 4OWRB 2IP2A 2EFQA 5FB2A 2Y48A 3M4OJ 1EH7A 1U0JA 5JR3A 3DEWA 1R5ID 2DA4A 2GA2A 4M6YA 1Z67A 3RPUA 2LY9A 2JVGA 3BY6A 3MKWB 3OIPA 2CQKA 1XDSA 1WHUA 2XRLA 3AG1H 1FIPA 2NOJB 1SD5A 2BVLA 2WAEA 3TO6A 3WGHA 4HNUA 1D0YA 4PGGA 2TCTA 4L9VA 1A35A 2FD5A 2Z5UA 5KK1A 2DFHA 3M8EA 4V2FA 2MC3A 4MEYF 3KZZA 1R5HA 3CUOA 3S93A 3QP5A 4OIPF 4G94A 4E7JA 4YELA 2DU9A 1YRNB 1Y39A 1RKWA 5ILUA 3ZQGA 5AONA 4R1HA 2X6WA 1LEBA 2QCOA 2JRMA 2GXAA 5J8CA 2Q1ZB 3SEZA 2GXBA 3V7CA 3BG7A 4HAMA 2DXIA 4C2TA 2X1DA 1OCZH 1UJ8A 3VEPA 4UVBA 4IO9F 2E2IJ 2L3DA 1EH6A 2LVSA 2VQLA 2M34A 5AIQA 3S1RJ 4I0BA 3FM5A 2A6HF 4M3FA 1K7AA 4DNCA 1MKMA 5EGOB 1YS7A 3RQIA 4QSHA 3DQVC 1ORKA 2M8GX 1ZK8A 1WJAA 5FO5A 2DDBA 2DYSH 2ZCWA 2AQEA 1ZELA 4XNFA 5LGTA 2MSYA 3WHCA 2P7VB 5E3OA 1WZ2A 4RA2A 1KGSA 3PNVA 1AWCA 3NARA 3H92A 2EV5A 2KT0A 3U1DA 1G3WA 3DTKA 4ASNA 1F1ZA 4KISA 2BW3B 3MN2A 5FD5A 1A6QA 1ZLJA 2E71A 1VI0A 3D0SA 4YEJA 2XIGA 1B4AA 1HW5A 3G1MA 2XASA 3K9TA 2CRGA 5B1AH 1FSEA 3H3VK 4LITA 2V26A 1QPIA 3B6AA 1K83J 4HSRA 2ZSIB 3WGGA 4AIDA 1OCRH 4MQ9F 2PN6A 3DFGA 4E70A 5LFAA 3GTPJ 3HOZJ 5E79C 4EJTA 3N97A 1APLC 2KIFA 4HF0A 2A68F 2D1VA 2GQQA 4BEHA 5LLQA 3KX2A 4TV7A 1HA8A 5H6QA 3CCMI 2FA5A 1VQ5I 2CV1A 2ZBKA 4AUXA 3C7JA 4HPQA 3A2KA 1UG0A 2K9QA 4OIRF 3JTGA 3VWBA 4LLNA 3I71A 1LB2A 1WGXA 2VPRA 1HXDA 4N4OB 3ZQ7A 5FJ8J 2NS0A 4M6VA 3IRQA 1YX3A 2LR8A 3F8CA 5D8KB 4ZJZA 3JSOA 1W7PB 1VF9A 4L5JA 2R5ZA 4W97A 1W1WE 5ICEA 2H1KA 2VASA 1IRFA 2JUCA 5ED4A 3FMRA 1ODDA 5L3CA 4CYDA 3CF2A 4AWXB 2VL8A 1ZGAA 1XDUA 1RPWA 1LPQA 1O7LA 5H20A 2RN7A 2VC1A 4WF2A 4A69C 2E5NA 3QYFA 3ZQHA 1BM9A 3KP6A 4B43A 3GX4X 1HDDC 3OYGA 1SD4A 3LWFA 2IW5A 2K9SA 1I27A 3V4GA 4DYQA 2VBWA 1R49A 1EJ9A 5CLSA 1F36A 2DBBA 3DBHB 3U9GA 5J1YA 4KT6A 5K1YA 1MZBA 2HDCA 2HQRA 1HW2A 2WADA 2Q2EB 1WH7A 4MTEA 4G12A 1LEAA 1IUFA 3KP4A 2VXDA 4M9SA 3HZJA 1D3YA 3O3KA 4XRSA 4LK0F 2CW0F 1XD7A 5GAGJ 4XRMA 3SEQA 3TEDA 1M1EB 1WPKA 2DJNA 4L9TA 1IDZA 1XGMA 1WI9A 3M8JA 3ZP5A 2CUZA 2VC0A 5ICFA 1YTYA 1HF0A 4P9FA 1JTXA 1EF4A 1O3SA 3J80Z 1YJNI 2HZTA 3PSFA 3QYEA 4DBRA 1X1DA 2BY0A 2NVUB 3WTTC 4BQOA 1ULYA 4GO1A 2HS5A 2EFNA 4BDYA 2HWVA 1G3TA 2A07F 5IYCJ 4BEHB 4U0YA 3BPXA 3O8HA 4PZJA 3K4CA 2E7XA 1CF7B 3HB9A 4R79A 2UXXA 2MFZA 2KJCA 4P55A 4U0VA 4PJ0C 2BXZA 4PJLA 3FXUA 2EA4A 2QBYA 2M30A 2VKEA 4E4HA 2CV2A 5EEGA 4JK1X 4Q4ZF 4A0ZA 4KMUX 3CESA 2BW3A 1FSHA 1UG2A 2OTLI 1Z1DA 2XAGA 3DU6A 2ID6A 1JT6A 3L2VA 3BG6A 4XLCA 4A3DJ 1FP1D 3OR1C 3LSMA 2HU9A 3G4SI 1F5TA 1W7PD 1PUEE 1NK3P 2FF4A 1TQIA 2JPBA 3BTIA 3PL8A 3A01A 2R7SA 3CMYA 3OYMA 3DP7A 2DCEA 1D0ZA 2JMWA 3AG3H 3OIOA 1VQLI 2DO7A 5KNLA 2STTA 2GXGA 1IRZA 2ZJ2A 2CV0A 3I54A 1EV7A 2X0LA 2EV6A 4CO8A 4AIJA 1IUYA 4GYIA 3HKZA 3OS1A 3T8TA 4DYCA 4JYKA 1VQOI 2K9NA 2B7EA 3G73A 1R6RA 1X19A 2Q0OA 4CCOA 1Z21A 4DZJA 3OSFA 1QVUA 2R5ZB 4XN3A 2HKXA 1YIOA 5HLIA 2DT7B 4D5CA 3DTEA 3QOEA 1XB4A 1LDJA 1YQAA 2IGOA 3C3WA 2L7KA 2YX7A 4FE4A 1OCTC 2L54A 5IP7J 2OV7A 1K78A 3GZNB 3P7NA 3HOUJ 2YU9J 1RI7A 2V1NA 2BYVE 1CQTA 4G9YA 3TP0A 2E19A 3RIRA 5FLXK 4D7MA 2ESHA 1L0OC 1HOMA 3HRSA 4ENMA 2A69F 1HW1A 2ZNZA 3I59B 1OCPA 4XRFA 4KITB 1E2XA 3FZVA 3S14J 2XVCA 1LDDA 2M0CA 2FEZA 2YPRA 2VQGA 3S3MA 3E5QA 2NVYJ 1XC5A 2VBYA 1E17A 4G7OF 2NNNA 1S72I 4XKBA 2XAJA 4DGWB 1DP3A 1OYYA 1IGNA 2LK2A 3VSLA 2AHQA 3ZMZA 4BNCA 3OY9A 1GVJA 3DKWA 1S5LC 1SANA 3HRUA 3EYIA 3EUKL 4I99C 1YG2A 4Y52J 3OV8A 3FXKA 3CJQB 3K0LA 2WY8Q 4KA4A 3PIPF 2WC2A 5TISC 1P4WA 3WTSC 1GHCA 2BHZA 1VTNC 4LIUA 4HV5A 2EK5A 4DIQA 1VQNI 4UUTA 3BR6A 2LH9A 2XF7A 4KICA 1OYWA 2GIZA 4YG2F 3D5SC 2JA8J 2Y0MA 3HM5A 2XSDC 1O3RA 1FTTA 4PJNA 5E3NA 3KLNA 4FASD 2COBA 1QZEA 3I0TA 1TW3A 3F22A 3L2CA 2JSCA 3CZ6A 2V9PA 5JVTA 1BA5A 2IGKA 2Y30A 3OYEA 4CZCA 2X6OA 4IHWA 3HSRA 3G2BA 1I1SA 5IOZA 4IRHA 3PQJA 5CYVA 4I01A 2LTPA 5E18F 3I4PA 1BI3A 3JRDA 1W36C 4XKCA 3FHZA 3LNQA 2W85A 2LKXA 4WWCA 1C0WA 3HGYA 2CYYA 2JA5J 4NQWA 2E35A 1Z9CA 1JUMA 1L3LA 4M72A 4BHPA 3MAJA 3RI4A 3C2BA 1BJAA 2KDOA 2KP6A 2L7MP 2P81A 3PUFA 2DMTA 2JA2A 2X9DA 2M7BA 3QWLA 4WXDA 3LSHA 3L00A 4CCJA 4I76A 1DU0A 1A31A 3NRVA 3HEFA 2RV8A 3J7YJ 3T0YA 1MDMA 1MBEA 3GFMA 1IXSB 5HDKA 4II3A 2AXTC 2Y9YA 3HIFA 3CUQC 4MQVA 4S05A 2X1EA 3KP5A 2IGNA 3J80K 2MW8A 1XCBA 3JTHA 1VZ0A 3MZ8A 5J47A 1B8IA 1JXSA 4HDVA 1Z3YA 2CH0A 2FXAA 2LKSA 4YFKF 2MD5A 3HPGA 2BHYA 2A6EF 2P5KA 2LOOA 4ZYHA 3BQYA 1X3UA 4I0AA 1YFHA 2EINH 2FQ3A 1F4KA 1AU7A 3RKYA 3F9KA 5F0HA 3W2WA 4ESBA 3S1QJ 1MBGA 5HVQC 4EV0A 2RKHA 4N4NB 3G6EI 3RKWA 1SFEA 2E1NA 4FE7A 4UUSB 1FC3A 4LLGF 1OYIA 1USTA 1IN6A 4PJJA 2V7FA 2DT5A 3ZQQA 5HS7A 1TQPA 4KNYA 4A3IJ 2MA3A 3BZCA 1HKSA 1XN7A 3FF5A 3L09A 4B48A 2N8GA 2ZB9A 2E60A 1RZ4A 4PUSA 3Q9VA 2LC2A 1MIJA 4A93J 3N4MA 4IHTA 3K2ZA 3F8NA 1BN5A 1AA7A 2R7QA 4NC6A 3D5LA 4ENNA 1R00A 2FBKA 1J9IA 3GYHX 1X1AA 5M5XJ 2NAZA 3FKJA 1WJCA 2K86A 3OYIA 2OCEA 5E3LA 1TLHB 2WTEA 3A1YA 1HDPA 2F6CA 3GTMJ 2DYRH 2EIKH 2KDZA 3GFJA 1BJZA 1LFBA 1IJWC 4IVNA 2GOMA 1FOYA 3N05A 1ZTRA 4EATA 2L01A 1GDTA 3BTJA 4IXAA 2QEXI 5B3SH 2VOOA 4LD5A 4HG2A 2R3SA 3BZKA 3CCYA 3WHBA 1P9QC 5EDNA 1X4PA 2Z9OA 2DMUA 2QSFX 4B44A 4Y7NJ 3OYNA 3MZYA 2E2HJ 3DLLF 4BQNA 2QENA 5DS9A 5FRMA 3CDHA 1G3YA 2M4KA 1XMKA 2KZGA 4NC7A 5F0CA 1FLIA 2QKLB 5IY5H 4RGUA 1B8IB 2R7DA 2IS4A 4CICA 1W5SA 2L2OA 4EJOA 3LQRA 1YJWI 3HG9A 5IT9Z 1IG7A
chains in the Genus database with same CATH topology
1R1VA 1O3TA 5L3DA 3E5XA 3GF2A 1UHMA 1MD0A 5TJJA 2PG4A 1ZHFA 5K5OA 4OIQF 5LHHA 5EEHA 6PAXA 3CTAA 5J8FA 2GIVA 1JHHA 5ILSA 2FSWA 3W6JB 1J5YA 3ISPA 1GXPA 5L3FA 1U5TB 3T5XA 4U88A 1U5TA 2F5EA 1HSTA 2QYOA 3E6MA 3QPHA 4I98B 4EJUA 2WWYA 5E1XA 1TTYA 3R60A 5D5WB 5F64A 1P92A 2DFIA 1QO0D 5D8LB 3CLOA 2K27A 1B6AA 3L9FA 3KLOA 1KU2A 4ZYEA 3SQNA 3E97A 2ACJA 2PLYA 2KKOA 3E3VA 3TO9A 2L4AA 2M8EA 3IKVA 5FD6A 2ZFWA 5FFXA 3FMSA 2V1DA 1U8RA 4UHTA 3OOPA 1FYMA 1XGOA 3IWZA 1IXRC 4JBAA 2V1XA 2VT3A 2VXZA 2A61A 3TDZC 3TQNA 2XROA 3I64A 5LHGA 4LGWA 4S04A 2ELHA 1XSXA 3ZMUA 1R7JA 2UXNA 2W84A 3R0JA 2ZKZA 2PMHA 3COAC 2KIMA 3GO5A 4YFNF 1TQMA 3F8MA 2EJRA 3ZMVA 1TNTA 3P9CA 4P96A 1ON1A 2VOPA 3ECOA 2EFWA 3QAHA 4FT8A 5DV5A 1QQIA 2HQNA 1ZRFA 2D2WA 2YU3A 5DD4A 3S2WA 3MZHA 3ERED 1SAXA 2NRAC 3MCZA 3EETA 5DCMA 3QPTA 3HRTA 1KQ0A 3WGIA 3K1MA 5BOXA 1IXCA 4AIKA 1YS6A 4IJAA 1Z6RA 1LJ9A 2RC4A 1XSDA 3JW4A 4K2EA 1LQ1A 5AIPA 2V79A 4LMYA 3GFIA 1OPCA 4I02A 1R36A 4EJWA 4BQAA 1ZARA 2M5WA 3RYPA 3E6BA 5DEQA 2P6TA 3C18A 1GXQA 4U7BA 1UB9A 2BBYA 2Q2EA 1I6XA 3TGNA 1KA8A 1T0FA 5DUIA 4U7DA 1ONVA 2RDPA 3H3ZA 4UV9A 2YR2A 2P5VA 5CVVA 4EJVA 2DLLA 1G3SA 4UVCA 2VE8A 1ZN2A 5D4SA 1UCRA 1FBUA 2F5DA 4WXHA 2HTSA 4KIFA 3I59A 2CWEA 3HTSB 2QZ8A 2DI3A 3B02A 1QBJA 4Y13A 3H3UA 3QRFF 4L18B 2IA2A 1QZZA 3J81K 3RYRA 2RVCA 5D5XB 4F7ZA 4M73A 4P9UA 1QNTA 3KCCA 4RB2C 4MHGA 4KT5C 2PQ8A 2RQPA 2E1CA 1HKTA 4N0BA 3K69A 5CVIA 3QU3A 1YO5C 2MLGA 4EGZA 1JE8A 2STWA 5DDGA 3LA2A 2XAFA 1U3EM 3K1NA 4G6DA 2W25A 2GZWA 2PBIA 4IF4A 4HQEA 2H6CA 2HKOA 1K78B 4PCQA 2ZNYA 3HTUA 4QLCU 1D5VA 5LBQA 4B8XA 2UZKA 4LFUA 1XCVA 4H0EA 2GA1A 3WTUC 1W4MA 2P6SA 2QWWA 4YIFA 2IJLA 4WX9A 4UXNA 1RNLA 2C6YA 2LSOA 3J81Z 2DQRA 2KRFA 1A04A 2IT0A 2EA2A 1UHWA 2O0YA 1R1TA 1HBXG 2IVMA 4M74A 1S6LA 1H9TA 1MGTA 1ON2A 1V4RA 2WV0A 3BJ6A 3EUHA 3F72A 4XLNF 1QZYA 4ESFA 2L02A 2ISZA 1Z6TA 2HYFA 2P7CB 4KMFA 1S7AA 5L3EA 3I53A 1FYKA 2W24A 1IN4A 1JGSA 3LA3A 1DP7P 3LFKA 2M45A 4UNOA 3V8KA 3BJOA 1ZYRF 2CGPA 2HGCA 3QP6A 1H9GA 4HF2A 4BHCA 1FY7A 2Y75A 2FNAA 4KN4X 3AAFA 1XSVA 2ZXJA 3TOAA 2MLKA 3R61A 1WWXA 1KU9A 1T39A 1XGNA 2EV0A 3HYIA 3E6DA 3M9AA 1P2FA 5HLGA 1SD7A 5CJ9A 3CO7C 2ZO4A 3DV8A 1Q1HA 2G7HA 4HDUA 3BZ6A 2XKPA 1ZGJA 3F21A 4AD9A 4M71A 3JSPA 2J5OA 3C1DA 3VFZA 4DQ2A 1USSA 5IT9K 3M1EA 3HHGA 5TRDA 2XRNA 4GCVA 3HRMA 5E1WA 1SFXA 4XSXF 3KFWX 3BDDA 1IW7F 4HA8A 1R22A 2QBYB 1YLFA 2MH2A 1HKQA 2FMLA 5A2QK 4RB1A 3TO7A 2H09A 1LDKB 1U6GA 3WTVC 2Q8KA 4LK1F 2OBPA 5BS6A 4ZZLA 4CHUA 3ECHA 4AIHA 2HTJA 1QGPA 1YW9A 2DQLA 2PMUA 4I2OA 1ZG1A 2A3SA 4M6XA 4OIOF 4BAYA 5D4RA 3V7RA 3W6KB 1W7PA 5JFRA 4RGXA 3RJPA 3EQLF 4PDKA 3WU0A 1BC7C 2W57A 2BE5F 3HUGA 1O57A 4Q48A 3BROA 4HV6A 3QU6A 3SXYA 4KUMA 4G6QA 1KYWA 3DEUA 1PP7U 4A5NA 2G7UA 5K5QA 5ERIA 5DYMA 1HQCA 3F6OA 5ILVA 2YSRA 5ICGA 2HYGD 4WK8F 4HW0A 4MGRA 2DK5A 3HSFA 1O3QA 3FXQA 1ZH5A 1V3FA 3F8BA 5A2QZ 1H0MA 2OZ6A 2O03A 3IL2A 1R58A 1G6NA 1RUOA 5KVRA 1K79A 4HQMA 2ZMEA 5LEJA 2FMYA 3LAJA 2QQAA 4YFXF 2FBIA 2PJPA 4RB0A 2J5PA 1IAWA 2QUFA 4BHBA 2LF7A 3V7SA 3U2RA 2GAUA 3WTXC 5LHIA 4A0YA 2TDXA 5E8IA 1DDNA 1B59A 1PP8F 3R0AA 2OA4A 5ICCA 4HLXA 2O6GE 2K4BA 1ZG3A 1BC8C 2XKOA 2HFHA 5LRRA 2A5YB 1IN8A 4N9IA 4Q5SF 1MJAA 2LNBA 4ZYGA 2FBHA 2MBFA 2K02A 2H94A 3KEQA 4M9ZA 2F5FA 4ON0A 3ZN1A 1FYLA 4ETSA 1U2WA 3ZN0A 1G4DA 1NHAA 4A6DA 4BXUA 1FZPB 3TOBA 3ULQB 4CXFA 4MEXF 2Z33A 3ABTA 2M1BA 3GVAA 1S8NA 5FFZA 2OZUA 5LGUA 1B1BA 3QOPA 5F1RA 2OQRA 1U5TC 4KFCA 1BI2A 1P6RA 3KP2A 3KZYA 2VN2A 1P4AA 5E1ZB 3R6SA 5D6FA 5CVUA 2DAOA 3NQOA 4A5MA 2AS5F 1T98A 4IHSA 1F9NA 3IWFA 4XSZF 2NYXA 4RGRA 2O61A 1DPRA 2VBXA 1Z91A 1PDNC 3MWMA 3ML6A 4OU0A 1MJBA 4M9XA 3MFKA 1BI0A 4RAYA 1MDMB 1R1UA 4KYWA 4AVPA 2FU4A 3EYYA 4HX8A 3WU1B 1Z05A 4G7HF 4OMZA 1WKMA 3M7GA 3J7AO 2IA0A 2EFOA 5HOOA 1IF1A 5HDNA 2QQ9A 2VONA 5HS9A 4Z2YA 4Y15A 4ZH4F 1YYVA 3MEXA 4O5VA 2RNJA 3CJNA 4BYYA 1T2KA 4QWQA 1S3JA 1J75A 3V8JA 1ZLKA 2BV6A 3HOTA 1FX7A 3LA7A 4XLPF 1IZ1A 1IN5A 5E17F 1K6OA 3GEZA 4IRIA 3RPQA 4RGSA 4NB5A 2M87A 4BH9A 1YW8A 3P9IA 2JRTA 3Q5FA 3IRRA 4XBFA 3GLXA 4L9NA 4EGYA 4LJZF 3SFZA 1Z7UA 4O6JA 3ZPLA 1D8JA 2VBZA 2PEXA 1FOKA 4G8XA 4YIIA 1WQ2A 4MTDA 3CO6C 2OAZA 4Y17A 3R4KA 4ENKA 5J6XA 2DK8A 3K1PA 1KU3A 4EM0B 3JAMK 4OOIA 1SD6A 2AXLA 4CDGA 3IKTA 3HHHA 2NNYA 4EVIA 4ESJA 1B9MA 3ZMDA 5BPDA 3F3XA 4RB3C 4HLYA 4L0ZB 2HEOA 4KN7X 3E6CC 2D45A 2EB7A 4KIBA 2XHKA 3BWGA 5D5UB 2ISYA 3SZTA 4HYEA 3T8RA 4Q47A 1ZG5A 5CVJA 1KU7A 2IRFG 4L9JA 4R8HA 3WTYC 3CUQA 1J59A 2QQBA 3BP8A 1STZA 2F5CA 5D6EA 3WTZA 2FRHA 3HSEA 2MH9A 3KEOA 4IRGA 3FMQA 5JI6A 2H27A 1OR7A 2K7LA 1FNNA 5L3GA 2D1HA 2XAQA 2QVOA 3GZ5A 1YW7A 4LLLA 2X4HA 5D5VB 3EDPA 1R5GA 3M8FA 2P5LC 3BOQA 1UFMA 5DUKA 1OMIA 1U78A 1I1GA 1RUNA 3RTRA 1BIBA 3IHUA 3B73A 3FWEA 3ZMTA 4O3MA 3DPTA 2V9VA 5IT3A 3WODF 4KIGA 3Q9SA 4EM2A 4KDPA 1TBXA 4WCGA 3RKXA 1I5ZA 4MNUA 2FE3A 2XUBA 1QPMA 2V1UA 3GWZA 3KP7A 5K5RA 3ELKA 2P8TA 5DD8A 4HF1A 2JZYA 3KETA 1CGPA 1TW2A 2JPCA 3E5UA 1S7OA 3GUDA 2FNPA 3I5UA 1KQ9A 2K4JA 2KIUA 4PGHA 1ZRCA 2LKPA 5DCMB 4IPAA 3WE3A 3GZ6A 4WXCA 1KYZA 3KP3A 2ETHA 4FHTA 1LVAA 1FT9A 1BI1A 1OKRA 4OMYA 2VE9A 2COMA 2LDUA 1LNWA 2E7WA 3KE2A 1D8KA 2ESNA 2ZMEB 4NHJA 2B0LA 4I09A 2XGXA 1O7FA 5LGNA 3MQ0A 2PFBA 4JQFA 3WTWC 5L3BA 1Y0UA 1SMYF 2Z99A 3LSTA 4UV8A 1B9NA 3IC7A 4HBLA 4LG0A 4EQQA 3GXOA 2CG4A 3DXJF 4RS8A 1BIAA 2CSOA 2O8XA 4LG0B 2P4WA 3VB2A 3SHFA 3PFIA 3JAMZ 2VODA 3ROUA 2OQGA 1T38A 2RGVA 4RAZA 2OU2A 5E20A 3WG9A 2OD5A 2BGCA 5BQTA 5HDGA 1ZRDA 4ZYDA 2KJBA 1IRGA 4OINF 5FLXZ 1IN7A 3TKYA 5LEKA 2HR3A 2QM3A 3ABUA 4N9HA 1DUXC 4CZZA 4FX4A 3REOA 4I7HA 4HX4A 2DW4A 3GW2A 4EMSA 3RDIA 2IA1A 3NEUA 4HX7A 1REPC 1KQ8A 4G7ZF 3P9KA 1RIOH 2F2EA 3DF8A 5JHUA 1BOAA 4GYGA 2PI0A 3TDUC 4GXOA 4P5OA 1S29A 3DPLC 1DPUA 4A12A 2JTVA 3SZPA 3GFLA 2G9WA 5BPIA 2QLZA 4GGGA 2LF8A 5HS8A 5H6RA 2DPDA 1J2XA 2JT1A 2R7FA 4HZFA 3ZMSA 1WSUA 1ZAOA 5BMZA 2DPUA 4UUVA 1FBQA 2GWRA 1JHFA 2FOKA 1AOYA 1TNSA 2YX4A 5DCFA 2EWNA 1CF7A 2BEOA 2O3FA 1MJ9A 4A6EA 4L5IA 4LB5A 2IPQX 1SFUA 1XGSA 3F8FA 2XV4S 5FGMA 5F6FA 1J0RA 4LB6B 2HOEA 2L4MA 2H6BA 1BBYA 1T6SA 3BPVA 1ZREA 3V8LA 2XAHA 1XMAA 3HOSA 3FM3A 3O2PE 4UVAA 4D0PA 3VODA 1W5TA 4A2UA 1P4XA 1EH8A 3FXRA 3PQKA 5CVRA 1FP2A 4A0XA 1HSJA 4L0YB 2Z3YA 1FPQA 3L7WA 2UWMA 4U0WA 4B09A 1R23A 5LRSA 5E8GA 2ADUA 3O6BB 3BJAA 1J7KA 3G3ZA 2DTRA 3WE2A 1SMTA 3VOEA 4CGZA 3CUQB 2CFXA 3I58A 1FWZA 5HLHA 2CO5A 3F23A 4ENJA 4EM1A 2EFPA 2VT2A 1FBSA 3T1BA 2V6CA 4HOBA 3LAPA 3LQQA 1WRJA 4ZZDA 3F6VA 4FX0A 2IP2A 2EFQA 5FB2A 2Y48A 1EH7A 5JR3A 2GA2A 4M6YA 3RPUA 3BY6A 2CQKA 1XDSA 3TO6A 1SD5A 3WGHA 4PGGA 4L9VA 2Z5UA 5KK1A 3M8EA 2MC3A 4MEYF 3KZZA 1R5HA 3CUOA 3QP5A 4OIPF 4G94A 2DU9A 5ILUA 5AONA 4R1HA 1LEBA 5J8CA 2GXBA 3V7CA 4HAMA 3VEPA 4UVBA 2L3DA 1EH6A 5AIQA 4I0BA 3FM5A 2A6HF 1K7AA 4DNCA 1MKMA 1YS7A 3DQVC 5FO5A 2ZCWA 5LGTA 2P7VB 1KGSA 1AWCA 3H92A 2EV5A 3U1DA 1G3WA 4ASNA 1F1ZA 5FD5A 1ZLJA 3D0SA 2XIGA 1B4AA 1HW5A 2XASA 3K9TA 1FSEA 3WGGA 4MQ9F 2PN6A 3DFGA 4E70A 4EJTA 3N97A 2KIFA 4HF0A 2A68F 2D1VA 2GQQA 5LLQA 4TV7A 5H6QA 2FA5A 2ZBKA 3C7JA 4OIRF 3JTGA 4LLNA 3I71A 1LB2A 1HXDA 3ZQ7A 2NS0A 3IRQA 3F8CA 5D8KB 3JSOA 1W7PB 4L5JA 5ICEA 1IRFA 5ED4A 3FMRA 1ODDA 5L3CA 4CYDA 4AWXB 1ZGAA 1XDUA 1O7LA 5H20A 2RN7A 2VC1A 4WF2A 1BM9A 3KP6A 3GX4X 1SD4A 3LWFA 2IW5A 1I27A 3V4GA 2VBWA 5CLSA 2DBBA 3U9GA 5K1YA 1MZBA 2HDCA 2HQRA 1HW2A 4MTEA 1LEAA 4M9SA 3KP4A 1D3YA 3O3KA 4LK0F 2CW0F 1XD7A 4L9TA 1XGMA 1WI9A 3ZP5A 2VC0A 5ICFA 1YTYA 4P9FA 1O3SA 3J80Z 2HZTA 3WTTC 1ULYA 4GO1A 2HS5A 2EFNA 2HWVA 1G3TA 2A07F 4U0YA 3BPXA 4PZJA 2E7XA 1CF7B 4R79A 2UXXA 2KJCA 4P55A 4U0VA 3FXUA 2EA4A 2QBYA 2M30A 5EEGA 4JK1X 4Q4ZF 4A0ZA 4KMUX 1FSHA 1Z1DA 2XAGA 1FP1D 1F5TA 1W7PD 1PUEE 2FF4A 1TQIA 2JPBA 3DP7A 2DO7A 2STTA 2GXGA 2ZJ2A 3I54A 1EV7A 2X0LA 2EV6A 4CO8A 4AIJA 1IUYA 4GYIA 3T8TA 3G73A 2Q0OA 2HKXA 1YIOA 5HLIA 1XB4A 1LDJA 1YQAA 3C3WA 2YX7A 2L54A 1K78A 3P7NA 1RI7A 2BYVE 4G9YA 3RIRA 5FLXK 2ESHA 1L0OC 3HRSA 4ENMA 2A69F 1HW1A 2ZNZA 3I59B 4XRFA 1E2XA 3FZVA 2XVCA 1LDDA 2FEZA 2YPRA 3E5QA 2VBYA 1E17A 4G7OF 2NNNA 2XAJA 1OYYA 3ZMZA 4BNCA 1GVJA 3DKWA 3HRUA 3EYIA 1YG2A 3OV8A 3K0LA 4KA4A 2WC2A 1P4WA 3WTSC 1GHCA 1VTNC 4HV5A 2EK5A 4KICA 1OYWA 4YG2F 2Y0MA 1O3RA 3KLNA 3I0TA 1TW3A 3F22A 3L2CA 2JSCA 5JVTA 1I1SA 3HSRA 4IRHA 3PQJA 5CYVA 4I01A 5E18F 3I4PA 1BI3A 3FHZA 2W85A 4WWCA 1C0WA 2CYYA 4NQWA 1Z9CA 1L3LA 4M72A 4BHPA 3MAJA 3RI4A 1BJAA 4WXDA 3L00A 3NRVA 2RV8A 1MDMA 3T0YA 3GFMA 1IXSB 5HDKA 3HIFA 3CUQC 4MQVA 4S05A 3KP5A 3J80K 1XCBA 3JTHA 1JXSA 4HDVA 2FXAA 4YFKF 2MD5A 2A6EF 2P5KA 4ZYHA 1X3UA 4I0AA 1YFHA 2FQ3A 1F4KA 3RKYA 4ESBA 5HVQC 4EV0A 2RKHA 3RKWA 1SFEA 2E1NA 1FC3A 4LLGF 1OYIA 1USTA 1IN6A 2DT5A 5HS7A 1TQPA 4KNYA 2MA3A 1HKSA 1XN7A 3FF5A 3L09A 1RZ4A 3Q9VA 3N4MA 4IHTA 3K2ZA 3F8NA 1BN5A 3D5LA 4ENNA 1R00A 2FBKA 1J9IA 3GYHX 2NAZA 2K86A 1TLHB 2WTEA 3GFJA 4IVNA 2L01A 4IXAA 2VOOA 4LD5A 2R3SA 2Z9OA 3MZYA 2QENA 3CDHA 1G3YA 1XMKA 1FLIA 4RGUA 2R7DA 4CICA 1W5SA 4EJOA 3LQRA 3FX3A 5IT9Z
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R1V A;  1O3T A;  5L3D A;  3E5X A;  3GF2 A;  1UHM A;  1MD0 A;  5TJJ A;  2PG4 A;  1ZHF A;  5K5O A;  4OIQ F;  5LHH A;  5EEH A;  6PAX A;  3CTA A;  5J8F A;  2GIV A;  1JHH A;  5ILS A;  2FSW A;  3W6J B;  1J5Y A;  3ISP A;  1GXP A;  5L3F A;  1U5T B;  3T5X A;  4U88 A;  1U5T A;  2F5E A;  1HST A;  2QYO A;  3E6M A;  3QPH A;  4I98 B;  4EJU A;  2WWY A;  5E1X A;  1TTY A;  3R60 A;  5D5W B;  5F64 A;  1P92 A;  2DFI A;  1QO0 D;  5D8L B;  3CLO A;  2K27 A;  1B6A A;  3L9F A;  3KLO A;  1KU2 A;  4ZYE A;  3SQN A;  3E97 A;  2ACJ A;  2PLY A;  2KKO A;  3E3V A;  3TO9 A;  2L4A A;  2M8E A;  3IKV A;  5FD6 A;  2ZFW A;  5FFX A;  3FMS A;  2V1D A;  1U8R A;  4UHT A;  3OOP A;  1FYM A;  1XGO A;  3IWZ A;  1IXR C;  4JBA A;  2V1X A;  2VT3 A;  2VXZ A;  2A61 A;  3TDZ C;  3TQN A;  2XRO A;  3I64 A;  5LHG A;  4LGW A;  4S04 A;  2ELH A;  1XSX A;  3ZMU A;  1R7J A;  2UXN A;  2W84 A;  3R0J A;  2ZKZ A;  2PMH A;  3COA C;  2KIM A;  3GO5 A;  4YFN F;  1TQM A;  3F8M A;  2EJR A;  3ZMV A;  1TNT A;  3P9C A;  4P96 A;  1ON1 A;  2VOP A;  3ECO A;  2EFW A;  3QAH A;  4FT8 A;  5DV5 A;  1QQI A;  2HQN A;  1ZRF A;  2D2W A;  2YU3 A;  5DD4 A;  3S2W A;  3MZH A;  3ERE D;  1SAX A;  2NRA C;  3MCZ A;  3EET A;  5DCM A;  3QPT A;  3HRT A;  1KQ0 A;  3WGI A;  3K1M A;  5BOX A;  1IXC A;  4AIK A;  1YS6 A;  4IJA A;  1Z6R A;  1LJ9 A;  2RC4 A;  1XSD A;  3JW4 A;  4K2E A;  1LQ1 A;  5AIP A;  2V79 A;  4LMY A;  3GFI A;  1OPC A;  4I02 A;  1R36 A;  4EJW A;  4BQA A;  1ZAR A;  2M5W A;  3RYP A;  3E6B A;  5DEQ A;  2P6T A;  3C18 A;  1GXQ A;  4U7B A;  1UB9 A;  2BBY A;  2Q2E A;  1I6X A;  3TGN A;  1KA8 A;  1T0F A;  5DUI A;  4U7D A;  1ONV A;  2RDP A;  3H3Z A;  4UV9 A;  2YR2 A;  2P5V A;  5CVV A;  4EJV A;  2DLL A;  1G3S A;  4UVC A;  2VE8 A;  1ZN2 A;  5D4S A;  1UCR A;  1FBU A;  2F5D A;  4WXH A;  2HTS A;  4KIF A;  3I59 A;  2CWE A;  3HTS B;  2QZ8 A;  2DI3 A;  3B02 A;  1QBJ A;  4Y13 A;  3H3U A;  3QRF F;  4L18 B;  2IA2 A;  1QZZ A;  3J81 K;  3RYR A;  2RVC A;  5D5X B;  4F7Z A;  4M73 A;  4P9U A;  1QNT A;  3KCC A;  4RB2 C;  4MHG A;  4KT5 C;  2PQ8 A;  2RQP A;  2E1C A;  1HKT A;  4N0B A;  3K69 A;  5CVI A;  3QU3 A;  1YO5 C;  2MLG A;  4EGZ A;  1JE8 A;  2STW A;  5DDG A;  3LA2 A;  2XAF A;  1U3E M;  3K1N A;  4G6D A;  2W25 A;  2GZW A;  2PBI A;  4IF4 A;  4HQE A;  2H6C A;  2HKO A;  1K78 B;  4PCQ A;  2ZNY A;  3HTU A;  4QLC U;  1D5V A;  5LBQ A;  4B8X A;  2UZK A;  4LFU A;  1XCV A;  4H0E A;  2GA1 A;  3WTU C;  1W4M A;  2P6S A;  2QWW A;  4YIF A;  2IJL A;  4WX9 A;  4UXN A;  1RNL A;  2C6Y A;  2LSO A;  3J81 Z;  2DQR A;  2KRF A;  1A04 A;  2IT0 A;  2EA2 A;  1UHW A;  2O0Y A;  1R1T A;  1HBX G;  2IVM A;  4M74 A;  1S6L A;  1H9T A;  1MGT A;  1ON2 A;  1V4R A;  2WV0 A;  3BJ6 A;  3EUH A;  3F72 A;  4XLN F;  1QZY A;  4ESF A;  2L02 A;  2ISZ A;  1Z6T A;  2HYF A;  2P7C B;  4KMF A;  1S7A A;  5L3E A;  3I53 A;  1FYK A;  2W24 A;  1IN4 A;  1JGS A;  3LA3 A;  1DP7 P;  3LFK A;  2M45 A;  4UNO A;  3V8K A;  3BJO A;  1ZYR F;  2CGP A;  2HGC A;  3QP6 A;  1H9G A;  4HF2 A;  4BHC A;  1FY7 A;  2Y75 A;  2FNA A;  4KN4 X;  3AAF A;  1XSV A;  2ZXJ A;  3TOA A;  2MLK A;  3R61 A;  1WWX A;  1KU9 A;  1T39 A;  1XGN A;  2EV0 A;  3HYI A;  3E6D A;  3M9A A;  1P2F A;  5HLG A;  1SD7 A;  5CJ9 A;  3CO7 C;  2ZO4 A;  3DV8 A;  1Q1H A;  2G7H A;  4HDU A;  3BZ6 A;  2XKP A;  1ZGJ A;  3F21 A;  4AD9 A;  4M71 A;  3JSP A;  2J5O A;  3C1D A;  3VFZ A;  4DQ2 A;  1USS A;  5IT9 K;  3M1E A;  3HHG A;  5TRD A;  2XRN A;  4GCV A;  3HRM A;  5E1W A;  1SFX A;  4XSX F;  3KFW X;  3BDD A;  1IW7 F;  4HA8 A;  1R22 A;  2QBY B;  1YLF A;  2MH2 A;  1HKQ A;  2FML A;  5A2Q K;  4RB1 A;  3TO7 A;  2H09 A;  1LDK B;  1U6G A;  3WTV C;  2Q8K A;  4LK1 F;  2OBP A;  5BS6 A;  4ZZL A;  4CHU A;  3ECH A;  4AIH A;  2HTJ A;  1QGP A;  1YW9 A;  2DQL A;  2PMU A;  4I2O A;  1ZG1 A;  2A3S A;  4M6X A;  4OIO F;  4BAY A;  5D4R A;  3V7R A;  3W6K B;  1W7P A;  5JFR A;  4RGX A;  3RJP A;  3EQL F;  4PDK A;  3WU0 A;  1BC7 C;  2W57 A;  2BE5 F;  3HUG A;  1O57 A;  4Q48 A;  3BRO A;  4HV6 A;  3QU6 A;  3SXY A;  4KUM A;  4G6Q A;  1KYW A;  3DEU A;  1PP7 U;  4A5N A;  2G7U A;  5K5Q A;  5ERI A;  5DYM A;  1HQC A;  3F6O A;  5ILV A;  2YSR A;  5ICG A;  2HYG D;  4WK8 F;  4HW0 A;  4MGR A;  2DK5 A;  3HSF A;  1O3Q A;  3FXQ A;  1ZH5 A;  1V3F A;  3F8B A;  5A2Q Z;  1H0M A;  2OZ6 A;  2O03 A;  3IL2 A;  1R58 A;  1G6N A;  1RUO A;  5KVR A;  1K79 A;  4HQM A;  2ZME A;  5LEJ A;  2FMY A;  3LAJ A;  2QQA A;  4YFX F;  2FBI A;  2PJP A;  4RB0 A;  2J5P A;  1IAW A;  2QUF A;  4BHB A;  2LF7 A;  3V7S A;  3U2R A;  2GAU A;  3WTX C;  5LHI A;  4A0Y A;  2TDX A;  5E8I A;  1DDN A;  1B59 A;  1PP8 F;  3R0A A;  2OA4 A;  5ICC A;  4HLX A;  2O6G E;  2K4B A;  1ZG3 A;  1BC8 C;  2XKO A;  2HFH A;  5LRR A;  2A5Y B;  1IN8 A;  4N9I A;  4Q5S F;  1MJA A;  2LNB A;  4ZYG A;  2FBH A;  2MBF A;  2K02 A;  2H94 A;  3KEQ A;  4M9Z A;  2F5F A;  4ON0 A;  3ZN1 A;  1FYL A;  4ETS A;  1U2W A;  3ZN0 A;  1G4D A;  1NHA A;  4A6D A;  4BXU A;  1FZP B;  3TOB A;  3ULQ B;  4CXF A;  4MEX F;  2Z33 A;  3ABT A;  2M1B A;  3GVA A;  1S8N A;  5FFZ A;  2OZU A;  5LGU A;  1B1B A;  3QOP A;  5F1R A;  2OQR A;  1U5T C;  4KFC A;  1BI2 A;  1P6R A;  3KP2 A;  3KZY A;  2VN2 A;  1P4A A;  5E1Z B;  3R6S A;  5D6F A;  5CVU A;  2DAO A;  3NQO A;  4A5M A;  2AS5 F;  1T98 A;  4IHS A;  1F9N A;  3IWF A;  4XSZ F;  2NYX A;  4RGR A;  2O61 A;  1DPR A;  2VBX A;  1Z91 A;  1PDN C;  3MWM A;  3ML6 A;  4OU0 A;  1MJB A;  4M9X A;  3MFK A;  1BI0 A;  4RAY A;  1MDM B;  1R1U A;  4KYW A;  4AVP A;  2FU4 A;  3EYY A;  4HX8 A;  3WU1 B;  1Z05 A;  4G7H F;  4OMZ A;  1WKM A;  3M7G A;  3J7A O;  2IA0 A;  2EFO A;  5HOO A;  1IF1 A;  5HDN A;  2QQ9 A;  2VON A;  5HS9 A;  4Z2Y A;  4Y15 A;  4ZH4 F;  1YYV A;  3MEX A;  4O5V A;  2RNJ A;  3CJN A;  4BYY A;  1T2K A;  4QWQ A;  1S3J A;  1J75 A;  3V8J A;  1ZLK A;  2BV6 A;  3HOT A;  1FX7 A;  3LA7 A;  4XLP F;  1IZ1 A;  1IN5 A;  5E17 F;  1K6O A;  3GEZ A;  4IRI A;  3RPQ A;  4RGS A;  4NB5 A;  2M87 A;  4BH9 A;  1YW8 A;  3P9I A;  2JRT A;  3Q5F A;  3IRR A;  4XBF A;  3GLX A;  4L9N A;  4EGY A;  4LJZ F;  3SFZ A;  1Z7U A;  4O6J A;  3ZPL A;  1D8J A;  2VBZ A;  2PEX A;  1FOK A;  4G8X A;  4YII A;  1WQ2 A;  4MTD A;  3CO6 C;  2OAZ A;  4Y17 A;  3R4K A;  4ENK A;  5J6X A;  2DK8 A;  3K1P A;  1KU3 A;  4EM0 B;  3JAM K;  4OOI A;  1SD6 A;  2AXL A;  4CDG A;  3IKT A;  3HHH A;  2NNY A;  4EVI A;  4ESJ A;  1B9M A;  3ZMD A;  5BPD A;  3F3X A;  4RB3 C;  4HLY A;  4L0Z B;  2HEO A;  4KN7 X;  3E6C C;  2D45 A;  2EB7 A;  4KIB A;  2XHK A;  3BWG A;  5D5U B;  2ISY A;  3SZT A;  4HYE A;  3T8R A;  4Q47 A;  1ZG5 A;  5CVJ A;  1KU7 A;  2IRF G;  4L9J A;  4R8H A;  3WTY C;  3CUQ A;  1J59 A;  2QQB A;  3BP8 A;  1STZ A;  2F5C A;  5D6E A;  3WTZ A;  2FRH A;  3HSE A;  2MH9 A;  3KEO A;  4IRG A;  3FMQ A;  5JI6 A;  2H27 A;  1OR7 A;  2K7L A;  1FNN A;  5L3G A;  2D1H A;  2XAQ A;  2QVO A;  3GZ5 A;  1YW7 A;  4LLL A;  2X4H A;  5D5V B;  3EDP A;  1R5G A;  3M8F A;  2P5L C;  3BOQ A;  1UFM A;  5DUK A;  1OMI A;  1U78 A;  1I1G A;  1RUN A;  3RTR A;  1BIB A;  3IHU A;  3B73 A;  3FWE A;  3ZMT A;  4O3M A;  3DPT A;  2V9V A;  5IT3 A;  3WOD F;  4KIG A;  3Q9S A;  4EM2 A;  4KDP A;  1TBX A;  4WCG A;  3RKX A;  1I5Z A;  4MNU A;  2FE3 A;  2XUB A;  1QPM A;  2V1U A;  3GWZ A;  3KP7 A;  5K5R A;  3ELK A;  2P8T A;  5DD8 A;  4HF1 A;  2JZY A;  3KET A;  1CGP A;  1TW2 A;  2JPC A;  3E5U A;  1S7O A;  3GUD A;  2FNP A;  3I5U A;  1KQ9 A;  2K4J A;  2KIU A;  4PGH A;  1ZRC A;  2LKP A;  5DCM B;  4IPA A;  3WE3 A;  3GZ6 A;  4WXC A;  1KYZ A;  3KP3 A;  2ETH A;  4FHT A;  1LVA A;  1FT9 A;  1BI1 A;  1OKR A;  4OMY A;  2VE9 A;  2COM A;  2LDU A;  1LNW A;  2E7W A;  3KE2 A;  1D8K A;  2ESN A;  2ZME B;  4NHJ A;  2B0L A;  4I09 A;  2XGX A;  1O7F A;  5LGN A;  3MQ0 A;  2PFB A;  4JQF A;  3WTW C;  5L3B A;  1Y0U A;  1SMY F;  2Z99 A;  3LST A;  4UV8 A;  1B9N A;  3IC7 A;  4HBL A;  4LG0 A;  4EQQ A;  3GXO A;  2CG4 A;  3DXJ F;  4RS8 A;  1BIA A;  2CSO A;  2O8X A;  4LG0 B;  2P4W A;  3VB2 A;  3SHF A;  3PFI A;  3JAM Z;  2VOD A;  3ROU A;  2OQG A;  1T38 A;  2RGV A;  4RAZ A;  2OU2 A;  5E20 A;  3WG9 A;  2OD5 A;  2BGC A;  5BQT A;  5HDG A;  1ZRD A;  4ZYD A;  2KJB A;  1IRG A;  4OIN F;  5FLX Z;  1IN7 A;  3TKY A;  5LEK A;  2HR3 A;  2QM3 A;  3ABU A;  4N9H A;  1DUX C;  4CZZ A;  4FX4 A;  3REO A;  4I7H A;  4HX4 A;  2DW4 A;  3GW2 A;  4EMS A;  3RDI A;  2IA1 A;  3NEU A;  4HX7 A;  1REP C;  1KQ8 A;  4G7Z F;  3P9K A;  1RIO H;  2F2E A;  3DF8 A;  5JHU A;  1BOA A;  4GYG A;  2PI0 A;  3TDU C;  4GXO A;  4P5O A;  1S29 A;  3DPL C;  1DPU A;  4A12 A;  2JTV A;  3SZP A;  3GFL A;  2G9W A;  5BPI A;  2QLZ A;  4GGG A;  2LF8 A;  5HS8 A;  5H6R A;  2DPD A;  1J2X A;  2JT1 A;  2R7F A;  4HZF A;  3ZMS A;  1WSU A;  1ZAO A;  5BMZ A;  2DPU A;  4UUV A;  1FBQ A;  2GWR A;  1JHF A;  2FOK A;  1AOY A;  1TNS A;  2YX4 A;  5DCF A;  2EWN A;  1CF7 A;  2BEO A;  2O3F A;  1MJ9 A;  4A6E A;  4L5I A;  4LB5 A;  2IPQ X;  1SFU A;  1XGS A;  3F8F A;  2XV4 S;  5FGM A;  5F6F A;  1J0R A;  4LB6 B;  2HOE A;  2L4M A;  2H6B A;  1BBY A;  1T6S A;  3BPV A;  1ZRE A;  3V8L A;  2XAH A;  1XMA A;  3HOS A;  3FM3 A;  3O2P E;  4UVA A;  4D0P A;  3VOD A;  1W5T A;  4A2U A;  1P4X A;  1EH8 A;  3FXR A;  3PQK A;  5CVR A;  1FP2 A;  4A0X A;  1HSJ A;  4L0Y B;  2Z3Y A;  1FPQ A;  3L7W A;  2UWM A;  4U0W A;  4B09 A;  1R23 A;  5LRS A;  5E8G A;  2ADU A;  3O6B B;  3BJA A;  1J7K A;  3G3Z A;  2DTR A;  3WE2 A;  1SMT A;  3VOE A;  4CGZ A;  3CUQ B;  2CFX A;  3I58 A;  1FWZ A;  5HLH A;  2CO5 A;  3F23 A;  4ENJ A;  4EM1 A;  2EFP A;  2VT2 A;  1FBS A;  3T1B A;  2V6C A;  4HOB A;  3LAP A;  3LQQ A;  1WRJ A;  4ZZD A;  3F6V A;  4FX0 A;  2IP2 A;  2EFQ A;  5FB2 A;  2Y48 A;  1EH7 A;  5JR3 A;  2GA2 A;  4M6Y A;  3RPU A;  3BY6 A;  2CQK A;  1XDS A;  3TO6 A;  1SD5 A;  3WGH A;  4PGG A;  4L9V A;  2Z5U A;  5KK1 A;  3M8E A;  2MC3 A;  4MEY F;  3KZZ A;  1R5H A;  3CUO A;  3QP5 A;  4OIP F;  4G94 A;  2DU9 A;  5ILU A;  5AON A;  4R1H A;  1LEB A;  5J8C A;  2GXB A;  3V7C A;  4HAM A;  3VEP A;  4UVB A;  2L3D A;  1EH6 A;  5AIQ A;  4I0B A;  3FM5 A;  2A6H F;  1K7A A;  4DNC A;  1MKM A;  1YS7 A;  3DQV C;  5FO5 A;  2ZCW A;  5LGT A;  2P7V B;  1KGS A;  1AWC A;  3H92 A;  2EV5 A;  3U1D A;  1G3W A;  4ASN A;  1F1Z A;  5FD5 A;  1ZLJ A;  3D0S A;  2XIG A;  1B4A A;  1HW5 A;  2XAS A;  3K9T A;  1FSE A;  3WGG A;  4MQ9 F;  2PN6 A;  3DFG A;  4E70 A;  4EJT A;  3N97 A;  2KIF A;  4HF0 A;  2A68 F;  2D1V A;  2GQQ A;  5LLQ A;  4TV7 A;  5H6Q A;  2FA5 A;  2ZBK A;  3C7J A;  4OIR F;  3JTG A;  4LLN A;  3I71 A;  1LB2 A;  1HXD A;  3ZQ7 A;  2NS0 A;  3IRQ A;  3F8C A;  5D8K B;  3JSO A;  1W7P B;  4L5J A;  5ICE A;  1IRF A;  5ED4 A;  3FMR A;  1ODD A;  5L3C A;  4CYD A;  4AWX B;  1ZGA A;  1XDU A;  1O7L A;  5H20 A;  2RN7 A;  2VC1 A;  4WF2 A;  1BM9 A;  3KP6 A;  3GX4 X;  1SD4 A;  3LWF A;  2IW5 A;  1I27 A;  3V4G A;  2VBW A;  5CLS A;  2DBB A;  3U9G A;  5K1Y A;  1MZB A;  2HDC A;  2HQR A;  1HW2 A;  4MTE A;  1LEA A;  4M9S A;  3KP4 A;  1D3Y A;  3O3K A;  4LK0 F;  2CW0 F;  1XD7 A;  4L9T A;  1XGM A;  1WI9 A;  3ZP5 A;  2VC0 A;  5ICF A;  1YTY A;  4P9F A;  1O3S A;  3J80 Z;  2HZT A;  3WTT C;  1ULY A;  4GO1 A;  2HS5 A;  2EFN A;  2HWV A;  1G3T A;  2A07 F;  4U0Y A;  3BPX A;  4PZJ A;  2E7X A;  1CF7 B;  4R79 A;  2UXX A;  2KJC A;  4P55 A;  4U0V A;  3FXU A;  2EA4 A;  2QBY A;  2M30 A;  5EEG A;  4JK1 X;  4Q4Z F;  4A0Z A;  4KMU X;  1FSH A;  1Z1D A;  2XAG A;  1FP1 D;  1F5T A;  1W7P D;  1PUE E;  2FF4 A;  1TQI A;  2JPB A;  3DP7 A;  2DO7 A;  2STT A;  2GXG A;  2ZJ2 A;  3I54 A;  1EV7 A;  2X0L A;  2EV6 A;  4CO8 A;  4AIJ A;  1IUY A;  4GYI A;  3T8T A;  3G73 A;  2Q0O A;  2HKX A;  1YIO A;  5HLI A;  1XB4 A;  1LDJ A;  1YQA A;  3C3W A;  2YX7 A;  2L54 A;  1K78 A;  3P7N A;  1RI7 A;  2BYV E;  4G9Y A;  3RIR A;  5FLX K;  2ESH A;  1L0O C;  3HRS A;  4ENM A;  2A69 F;  1HW1 A;  2ZNZ A;  3I59 B;  4XRF A;  1E2X A;  3FZV A;  2XVC A;  1LDD A;  2FEZ A;  2YPR A;  3E5Q A;  2VBY A;  1E17 A;  4G7O F;  2NNN A;  2XAJ A;  1OYY A;  3ZMZ A;  4BNC A;  1GVJ A;  3DKW A;  3HRU A;  3EYI A;  1YG2 A;  3OV8 A;  3K0L A;  4KA4 A;  2WC2 A;  1P4W A;  3WTS C;  1GHC A;  1VTN C;  4HV5 A;  2EK5 A;  4KIC A;  1OYW A;  4YG2 F;  2Y0M A;  1O3R A;  3KLN A;  3I0T A;  1TW3 A;  3F22 A;  3L2C A;  2JSC A;  5JVT A;  1I1S A;  3HSR A;  4IRH A;  3PQJ A;  5CYV A;  4I01 A;  5E18 F;  3I4P A;  1BI3 A;  3FHZ A;  2W85 A;  4WWC A;  1C0W A;  2CYY A;  4NQW A;  1Z9C A;  1L3L A;  4M72 A;  4BHP A;  3MAJ A;  3RI4 A;  1BJA A;  4WXD A;  3L00 A;  3NRV A;  2RV8 A;  1MDM A;  3T0Y A;  3GFM A;  1IXS B;  5HDK A;  3HIF A;  3CUQ C;  4MQV A;  4S05 A;  3KP5 A;  3J80 K;  1XCB A;  3JTH A;  1JXS A;  4HDV A;  2FXA A;  4YFK F;  2MD5 A;  2A6E F;  2P5K A;  4ZYH A;  1X3U A;  4I0A A;  1YFH A;  2FQ3 A;  1F4K A;  3RKY A;  4ESB A;  5HVQ C;  4EV0 A;  2RKH A;  3RKW A;  1SFE A;  2E1N A;  1FC3 A;  4LLG F;  1OYI A;  1UST A;  1IN6 A;  2DT5 A;  5HS7 A;  1TQP A;  4KNY A;  2MA3 A;  1HKS A;  1XN7 A;  3FF5 A;  3L09 A;  1RZ4 A;  3Q9V A;  3N4M A;  4IHT A;  3K2Z A;  3F8N A;  1BN5 A;  3D5L A;  4ENN A;  1R00 A;  2FBK A;  1J9I A;  3GYH X;  2NAZ A;  2K86 A;  1TLH B;  2WTE A;  3GFJ A;  4IVN A;  2L01 A;  4IXA A;  2VOO A;  4LD5 A;  2R3S A;  2Z9O A;  3MZY A;  2QEN A;  3CDH A;  1G3Y A;  1XMK A;  1FLI A;  4RGU A;  2R7D A;  4CIC A;  1W5S A;  4EJO A;  3LQR A;  3FX3 A;  5IT9 Z; 
#chains in the Genus database with same CATH topology
 1R1V A;  1O3T A;  5L3D A;  3LOC A;  1D1B A;  3GF2 A;  1UHM A;  2H8W A;  3E5X A;  1MD0 A;  5EJC A;  2JA6 J;  4U87 A;  5TJJ A;  2PG4 A;  1ZHF A;  1ETO A;  5F1J A;  1W5C C;  5K5O A;  1VQM I;  4OIQ F;  5LHH A;  2K9M A;  2HNH A;  5EEH A;  3H36 A;  6PAX A;  3HL2 A;  3CTA A;  2DJI A;  5J8F A;  2GIV A;  1I39 A;  1JHH A;  4LIV A;  5ILS A;  4PSX A;  1VQ6 I;  2LBF A;  2FSW A;  2LG4 A;  3IAS 2;  3W6J B;  4X0G A;  3CC2 I;  2JK3 A;  1J5Y A;  1JKQ C;  3ISP A;  1GXP A;  5L3F A;  1U5T B;  3T5X A;  4U88 A;  2CQQ A;  1U5T A;  2F5E A;  1HST A;  3DKX A;  3LSR A;  2QYO A;  3E6M A;  3QPH A;  4I98 B;  4EJU A;  2WWY A;  5E1X A;  1JUP A;  4BJ6 C;  1TTY A;  3R60 A;  1HLV A;  4V2G A;  1LE8 B;  5D5W B;  5F64 A;  1P92 A;  1YI2 I;  3PNY A;  1YX5 A;  4GFB A;  2DFI A;  1QO0 D;  3U21 A;  5D8L B;  1X1B A;  3CLO A;  4XOR A;  4BE0 A;  4IHV A;  2DOA A;  2K27 A;  4F52 A;  2L9R A;  2LFB A;  1B6A A;  1MND A;  1QU3 A;  3ZCO A;  2KZV A;  4B47 A;  4QTR A;  5J4V A;  3L9F A;  3OYA A;  2O5R A;  3KLO A;  4RAG A;  1KU2 A;  1PJR A;  4ZYE A;  3SQN A;  3E97 A;  2XF5 A;  2ACJ A;  2PLY A;  2KKO A;  3E3V A;  3TO9 A;  2L4A A;  4AM3 A;  2M8E A;  5M5W J;  1WFX A;  3IKV A;  5M3M J;  5C4J J;  1A6I A;  3CD6 I;  1E3O C;  3M1C A;  5FD6 A;  1V5E A;  3OYF A;  2ZFW A;  5FFX A;  3FMS A;  2HZD A;  1PYV A;  4IHX A;  2EIM H;  3BR2 A;  4PJM A;  5GPA A;  2V1D A;  1U8R A;  2R7T A;  1SFK A;  3CMM A;  4UHT A;  3OOP A;  1FYM A;  1XGO A;  3IWZ A;  1TWG J;  1IXR C;  2HVR A;  4JX6 A;  3CLQ A;  4C2M J;  1JJ6 C;  4JBA A;  3RCO A;  1T8I A;  2V1X A;  2VT3 A;  1AKH A;  2VXZ A;  2A61 A;  1MSE C;  2R5Y B;  3TDZ C;  3TQN A;  2XRO A;  3SZG A;  3I64 A;  5LHG A;  2WAQ A;  3FBN B;  4LGW A;  4XRS G;  2GM4 A;  4S04 A;  2ELH A;  2VKH A;  3OWT A;  5F0F A;  3FX3 A;  2BVM A;  1SAU A;  3U1K A;  1OQY A;  2O7O A;  1IV8 A;  1XSX A;  3ZMU A;  1R7J A;  2UXN A;  2W84 A;  3R0J A;  2ZKZ A;  2PMH A;  3COA C;  4B3X A;  1JKR C;  2KIM A;  1YIJ I;  3GO5 A;  4YFN F;  1MMN A;  1TQM A;  1B72 A;  2E1M B;  2V9K A;  3F8M A;  2EJR A;  5BNG A;  4F93 B;  2KIQ A;  3ZMV A;  2X6Y A;  1TNT A;  4PFO A;  3P9C A;  4P96 A;  1ON1 A;  2O9L A;  3IH4 A;  2VOP A;  3ECO A;  3K4K A;  3NWT A;  2EFW A;  4FTH A;  5CQE A;  4M3G A;  1MH3 A;  2X1C A;  5H2F C;  3QAH A;  4FT8 A;  2M0M A;  3GCM A;  5DV5 A;  1G59 A;  2XPW A;  1QQI A;  3VPR A;  2HQN A;  3CCS I;  1ZRF A;  1PVE A;  2X48 A;  2D2W A;  2YU3 A;  3HC7 A;  2WB1 A;  5DD4 A;  2Z16 A;  3S2W A;  3TW7 A;  3MZH A;  3ERE D;  1ITY A;  5B1B H;  1SAX A;  3PSI A;  2YUS A;  4J01 A;  2TRT A;  1AHD P;  2NRA C;  3MCZ A;  3EET A;  5DCM A;  2WY7 Q;  3QPT A;  3HRT A;  2Z2S B;  1KQ0 A;  2WA0 A;  3I55 I;  2HOS A;  3WGI A;  3K1M A;  5BOX A;  1VND A;  2Y2Z A;  2VJ4 A;  2X51 A;  1IXC A;  3H5N A;  4C3H J;  4AIK A;  2R93 J;  1YS6 A;  3GTQ J;  4E6K G;  2VJI A;  2XF6 A;  1D1A A;  1K61 A;  2IXS A;  4IJA A;  3A01 B;  1Z6R A;  1T95 A;  3OIQ A;  3ABK H;  5FKN A;  1LJ9 A;  1TL8 A;  1I3Q J;  2RC4 A;  1XSD A;  3JW4 A;  1OCO H;  4K2E A;  4EEF G;  2DN0 A;  1SEU A;  1LQ1 A;  5AIP A;  4XID A;  2V79 A;  3CDI A;  2G0E A;  1RRJ A;  4LMY A;  1ETY A;  3G71 I;  3I3L A;  3OL3 A;  3Q0U A;  3GFI A;  3PM1 A;  1OPC A;  4ZTF A;  3CP2 A;  1R36 A;  4I02 A;  4EJW A;  4BQA A;  2RQQ A;  1ZAR A;  4RMN A;  4X6A J;  2M5W A;  3RYP A;  3DBL B;  3E6B A;  4NC8 A;  5EYR A;  2QQ8 A;  3X2Q H;  5DEQ A;  4BQQ A;  3OSG A;  3H5A A;  2P6T A;  1SVL A;  4BXF A;  3C18 A;  4NBQ A;  3FKI J;  5F08 A;  3FBI B;  1GXQ A;  3EPZ A;  4U7B A;  1UB9 A;  2BBY A;  2L5Q A;  2Q2E A;  3ASO H;  4E7I A;  4C9Y A;  1I6X A;  3TGN A;  2W82 A;  1UAA A;  1BR1 A;  1KA8 A;  1T0F A;  5DUI A;  1FIA A;  5IPA A;  4U7D A;  2R7W A;  2VI6 A;  1ONV A;  2MAB A;  1W36 D;  2RDP A;  1I6H J;  3L2Q A;  3H3Z A;  3QPL A;  2XB5 A;  4UV9 A;  4AU7 A;  2YR2 A;  1ZR4 A;  2P5V A;  5CVV A;  4EJV A;  2DLL A;  1T56 A;  1WJE A;  4ABZ A;  2HQA A;  1G3S A;  4UVC A;  2VE8 A;  3GTO J;  1ZN2 A;  5D4S A;  1FOW A;  1UCR A;  1FBU A;  4IOC F;  2F5D A;  4WXH A;  4A3E J;  3OS0 A;  2R7X A;  2HTS A;  1ENH A;  2X6X A;  1ACI A;  2QSG X;  1N77 A;  4KIF A;  3I59 A;  2CWE A;  2DA7 A;  3HTS B;  1SVM A;  2FUG 2;  3L2R A;  2QZ8 A;  4HNV A;  1ZQ3 P;  1BR2 A;  4Y33 A;  2DI3 A;  3B02 A;  3CME I;  1OCC H;  1QBJ A;  1X58 A;  4Y13 A;  3H3U A;  3H9G A;  3QRF F;  4L18 B;  2CQN A;  1FJL A;  2DTZ A;  2IA2 A;  2XSJ C;  1DGR M;  1QZZ A;  5EEA A;  3J81 K;  3RYR A;  4AVZ A;  5J3L A;  2RVC A;  3EUA A;  5D5X B;  4F7Z A;  3JRE A;  3UKG A;  1TWF J;  2IGM A;  2DOF A;  2XGE A;  4M73 A;  4P9U A;  1QNT A;  3ZOB A;  2F4M B;  4UUS A;  3K70 D;  4J00 A;  3KCC A;  4RB2 C;  4MHG A;  4ANJ A;  2HPI A;  4KT5 C;  3OOU A;  2PQ8 A;  2RQP A;  2E1C A;  2K5C A;  4RLF A;  1HKT A;  4N0B A;  3K69 A;  2E1O A;  1DU6 A;  2CQX A;  5CVI A;  4LG3 A;  3CCE I;  3E7L A;  3QU3 A;  2W7N A;  3CMA I;  1YO5 C;  2MLG A;  2DDA A;  1VQ8 I;  2XGC A;  3C2H A;  4EGZ A;  2EQR A;  1JE8 A;  1BL0 A;  2STW A;  5DDG A;  2AO9 A;  1ZR2 A;  3LA2 A;  1POG A;  2HOT A;  2XAF A;  3Q3S A;  1U3E M;  3K1N A;  4G6D A;  3K10 A;  2W25 A;  3JRF A;  3I9V 2;  1TT5 B;  3HGG A;  4G6T B;  2GZW A;  3Q0V A;  1I50 J;  2PBI A;  1D1C A;  4IF4 A;  4HQE A;  4FCY A;  3QQA A;  3C2G A;  2H6C A;  3FXO A;  2BY1 A;  2HKO A;  2QGU A;  1K78 B;  4PCQ A;  1TT0 A;  2ZNY A;  2R92 J;  3HTU A;  4QLC U;  1D5V A;  4IQ4 A;  5LBQ A;  4B8X A;  2UZK A;  4LFU A;  1R71 A;  1XCV A;  1FMW A;  4H0E A;  2Y69 H;  3IH2 A;  2E2J J;  1HCR A;  1LUJ B;  2GA1 A;  4XLE A;  3WTU C;  1W4M A;  2P6S A;  2QWW A;  4YIF A;  3RPU D;  5C4X J;  2D5V A;  2IJL A;  1Y1V J;  2JJ7 A;  4WX9 A;  2HI3 A;  4UXN A;  2HQ5 A;  1RNL A;  2C6Y A;  1SVO A;  5FLM J;  2LSO A;  3J81 Z;  4F3Q A;  3BC8 A;  2DQR A;  2KRF A;  1A04 A;  1RR7 A;  2IT0 A;  2EA2 A;  2IBD A;  1UHW A;  1QHG A;  1BW5 A;  2O0Y A;  1MBF A;  5KAI C;  2EBI A;  1R1T A;  2NVQ J;  4ZTJ A;  1HBX G;  2DMP A;  1RES A;  1TWH J;  2IVM A;  5DM6 F;  1Z77 A;  4M74 A;  1S6L A;  1H9T A;  4HEA 2;  4ZDL A;  1MGT A;  1ON2 A;  1V4R A;  2WV0 A;  3CC7 I;  1JI8 A;  3J7Z I;  3BJ6 A;  3EUH A;  3F72 A;  4XLN F;  9ANT A;  1R9T J;  1QZY A;  3FDY A;  4ESF A;  3CC4 I;  2L02 A;  2ISZ A;  1U9N A;  2HVQ A;  3CCJ I;  1Z6T A;  2HYF A;  4RDU A;  1Q1V A;  1XPX A;  2HDW A;  2P7C B;  4KMF A;  2CW8 A;  1S7A A;  3QOD A;  5L3E A;  3I53 A;  3AKZ A;  1FYK A;  2RAE A;  2W24 A;  3E1S A;  2W00 A;  1IN4 A;  4XN0 A;  1JGS A;  4Z6Y A;  3LA3 A;  1DP7 P;  3RZO J;  5GP9 A;  1VQK I;  3LFK A;  1IV6 A;  2M45 A;  4UNO A;  2VQC A;  3V8K A;  2DA1 A;  3BJO A;  2LY1 A;  1ZYR F;  2ZME C;  1T33 A;  1JKP C;  3CF5 F;  2CGP A;  2HGC A;  3QP6 A;  1H9G A;  3BQZ A;  2OCC H;  4HF2 A;  1XTA A;  1XG1 A;  4BHC A;  1FY7 A;  2Y75 A;  2FNA A;  1WJB A;  3GTJ J;  2LBF B;  4MO7 A;  4MFD A;  4KN4 X;  3AAF A;  2V6E A;  1N25 A;  2ZXJ A;  1XSV A;  3TOA A;  1RET A;  2MLK A;  3R61 A;  2LMD A;  2ZFU A;  1WWX A;  4BAC A;  3KYL A;  1KU9 A;  1K4S A;  2K3P A;  2F4O B;  1J09 A;  3CP8 A;  1T39 A;  2ECC A;  1XGN A;  2EV0 A;  3H0G J;  3FK7 A;  3HYI A;  1T08 B;  3E6D A;  1W0U A;  3M9A A;  1U8B A;  1P2F A;  2Y0S A;  5HLG A;  1SD7 A;  2AQF A;  5E3M A;  5CJ9 A;  3LSJ A;  3CO7 C;  4E7L A;  2ZO4 A;  3DV8 A;  1Q1H A;  2G7H A;  1LFU P;  4HDU A;  3BZ6 A;  2F5V A;  2Z1D A;  2NS7 A;  1W0T A;  2R7R A;  1PUF A;  2XKP A;  1ZGJ A;  1WJF A;  3F21 A;  2I8D A;  4AD9 A;  4M71 A;  2XPV A;  5DTD A;  3JSP A;  2J5O A;  3C1D A;  3VFZ A;  4DQ2 A;  1USS A;  1YJ9 I;  5IT9 K;  3M1E A;  4CH7 A;  3HHG A;  5DM7 F;  1QHH D;  2M7A A;  5TRD A;  1MNE A;  2XRN A;  4GCV A;  3HRM A;  5E1W A;  5IOY A;  1SFX A;  4XSX F;  2KRC A;  3KFW X;  3BDD A;  1IW7 F;  4HA8 A;  4A3M J;  2JSP A;  1B72 B;  2FOW A;  1R22 A;  2QBY B;  1YLF A;  2MH2 A;  3OS2 A;  1K6Y A;  4BU2 A;  1NTC A;  5K7H A;  1HKQ A;  2FML A;  5F27 A;  5A2Q K;  4ZDP A;  1D5Y A;  2ZXH A;  4RB1 A;  3TO7 A;  3HUG B;  2H09 A;  1LDK B;  2M9H A;  5IYD J;  2EIL H;  1U6G A;  3WTV C;  2Q8K A;  3BR5 A;  4LK1 F;  4F92 B;  2OBP A;  4HST A;  5BS6 A;  4ZYA A;  4ZZL A;  4CHU A;  1JKO C;  3KYD B;  2L9S A;  5FLV A;  4CUG A;  3ECH A;  4DZP A;  4AIH A;  2HTJ A;  3CCL I;  1QGP A;  2R7O A;  3SYT A;  1VQ4 I;  4BBS J;  4UB8 C;  1YW9 A;  4X1E A;  2DQL A;  3IV5 A;  2R7Z J;  2CU7 A;  2PMU A;  4I2O A;  1X1P A;  2A3S A;  3KEY A;  4M6X A;  4UB6 C;  1ZG1 A;  4CYC B;  4OIO F;  4BAY A;  5D4R A;  4RM3 A;  3V7R A;  3W6K B;  4QPQ A;  1BR4 A;  2EZH A;  1W7P A;  1YRN A;  3K4M A;  2XGD A;  3OYD A;  5JFR A;  4RGX A;  3RJP A;  1IC8 A;  3EQL F;  1LE8 A;  4XLH A;  4PDK A;  3WU0 A;  1BC7 C;  2W57 A;  4BXX J;  1DGW Y;  2DOD A;  1UMQ A;  2BE5 F;  2B9S A;  3HUG A;  1G8X A;  1O57 A;  2BY2 A;  3OL4 A;  4Q48 A;  3ZRG A;  2F48 A;  3BRO A;  3CQZ J;  4HV6 A;  3QU6 A;  3SXY A;  3DKY A;  3S15 J;  4BS9 A;  1IRX A;  4KUM A;  1X3W B;  3DEU A;  1KYW A;  4G6Q A;  4XLF A;  2HDD A;  1PP7 U;  4A5N A;  2G7U A;  3LL7 A;  5K5Q A;  3H9Q A;  5DYM A;  5ERI A;  3SJM A;  3I4M J;  3PUB A;  4AYB N;  1HQC A;  3F6O A;  5ILV A;  3ESW B;  4XKW A;  2YSR A;  5ICG A;  2HYG D;  4PSW A;  4WK8 F;  4HW0 A;  4UY8 I;  4MGR A;  2DK5 A;  3HSF A;  3SDG A;  4BY1 J;  1O3Q A;  3FXQ A;  3FK6 A;  1ZH5 A;  4AYB A;  3WG7 H;  1V3F A;  2HXI A;  4CSW A;  3F8B A;  5A2Q Z;  5CKT A;  4H4K C;  1H0M A;  3VSK A;  2OZ6 A;  2O03 A;  3IL2 A;  1R58 A;  3QPS A;  1G6N A;  5GAD J;  5M5Y J;  1RUO A;  2EZK A;  3DLA A;  4ZC3 A;  1TWC J;  1MBJ A;  5KVR A;  1K79 A;  3K6G A;  3M07 A;  4HQM A;  2ZME A;  5LEJ A;  4IQJ A;  2FMY A;  3BCA A;  3LAJ A;  2QQA A;  2QSH X;  3BG3 A;  4YFX F;  1X2N A;  2FBI A;  2L9N A;  2PJP A;  4RB0 A;  2J5P A;  1IAW A;  2PMZ N;  2M2E A;  2QUF A;  4BHB A;  2LF7 A;  1YOV B;  2L7F P;  2A6T A;  2EPF A;  2HXO A;  3A4C A;  4XQF A;  2JA7 J;  3S3N A;  3V7S A;  3U2R A;  2GAU A;  3WTX C;  1Z3X A;  3ZQL A;  2OTJ I;  5LHI A;  5JLW A;  4BY7 J;  3AFH A;  4S0H B;  1VQP I;  4A0Y A;  3DTI A;  2TDX A;  5E8I A;  1LKX A;  1H89 C;  1WJD A;  1DDN A;  4A3F J;  4JX5 A;  2A5W A;  3TBI A;  2LRE A;  1B59 A;  1PP8 F;  4AC0 A;  3R0A A;  2LP0 A;  1MBK A;  2WAF A;  1JJ8 C;  2OA4 A;  5ICC A;  1OLT A;  4HLX A;  2O6G E;  2GLO A;  2ZJQ F;  2K4B A;  5GAH J;  2R4G A;  1GV2 A;  1ZG3 A;  4IZZ A;  1BC8 C;  1P7I A;  2XKO A;  2Y0S N;  2HFH A;  5LRR A;  2A5Y B;  1IN8 A;  1JT0 A;  2CJJ A;  3A03 A;  4N9I A;  3TL4 X;  4Q5S F;  1MJA A;  2LNB A;  4ZYG A;  1UZC A;  1NK2 P;  2FBH A;  4RLQ A;  2JWT A;  2MD0 A;  3MKL A;  2MBF A;  3VYR B;  2R0Q C;  3ZQI A;  2K02 A;  2H94 A;  3FXL A;  4OAY A;  3KEQ A;  3H5R A;  4CYC A;  4M9Z A;  2F5F A;  3JRI A;  4ON0 A;  3ZN1 A;  3S16 J;  1FYL A;  4ETS A;  3JRH A;  1U2W A;  3ZN0 A;  3TW6 A;  1ETK A;  1G4D A;  1NHA A;  4A6D A;  2LD5 A;  2RNG A;  4BXU A;  4C3I J;  1FZP B;  2LYC A;  3TOB A;  2XC7 A;  2ZSH B;  4MFE A;  3ULQ B;  3L2U A;  3SFI A;  4CXF A;  2R5Y A;  4XL9 A;  3S8P A;  4MEX F;  2Z33 A;  3ABT A;  2HOA A;  2H8R A;  4XR6 A;  1F43 A;  2M1B A;  2JUG A;  3GVA A;  1S8N A;  5FFZ A;  2OZU A;  5J40 A;  2I5U A;  5LGU A;  4I6Z A;  1B1B A;  3QOP A;  5F1R A;  2GOX B;  2OQR A;  1U5T C;  2CW7 A;  4KFC A;  1BI2 A;  1P6R A;  3KP2 A;  3KZY A;  2VN2 A;  2VPL A;  1P4A A;  5E1Z B;  3DBR B;  2FX0 A;  3RKQ A;  4BJT A;  3R6S A;  5D6F A;  5CVU A;  2DAO A;  4NUB A;  3NQO A;  2PX9 A;  3W2A A;  2JVH A;  4XOT A;  4A5M A;  4CCN A;  2AS5 F;  1T98 A;  4IHS A;  1XMX A;  4XM3 A;  1F9N A;  3IWF A;  3KIO A;  3H9J A;  4XSZ F;  1YIT I;  1RC9 A;  2NYX A;  3CJR B;  4RGR A;  2O61 A;  3NWS A;  4E7S A;  1DPR A;  2K9L A;  3HKZ N;  1T0F C;  1Z91 A;  2VBX A;  3MWM A;  4A3K J;  1PDN C;  1A36 A;  2ICW G;  3ML6 A;  3O8G A;  4OU0 A;  2IEK A;  1XS9 A;  1MJB A;  4M9X A;  4KJZ A;  2NVX J;  3SDB A;  3MFK A;  1BI0 A;  1E0E A;  2ZXW H;  4L5E A;  4RAY A;  1MDM B;  1R1U A;  4KYW A;  2XDV A;  4AVP A;  2FU4 A;  3CCV I;  3EYY A;  3DWL E;  1Y1W J;  1IO2 A;  4HX8 A;  3WU1 B;  3A0B C;  5GTH C;  1Z05 A;  5KHD A;  3VDX A;  2HYJ A;  4G7H F;  1Y8R B;  2NOG A;  3F0C A;  4OMZ A;  3WU2 C;  1WKM A;  3M7G A;  3J7A O;  3OMY A;  2IA0 A;  2EFO A;  3HPH A;  5HOO A;  1IF1 A;  5HDN A;  3BR1 A;  3D5R C;  2QQ9 A;  5K7Z A;  3I4N J;  1S9H A;  3A0H C;  1V5G A;  2VON A;  3AL0 C;  5HS9 A;  1GV5 A;  1Y8Q B;  4Z2Y A;  4W1U A;  3OYH A;  1D0X A;  2GBY A;  4Y15 A;  4A3J J;  4ZH4 F;  1YYV A;  3GME A;  3MEX A;  3ZGK A;  1TWA J;  2OUM A;  4O5V A;  2RNJ A;  3CJN A;  2XPU A;  4BYY A;  1T2K A;  4QWQ A;  3LMM A;  1S3J A;  1X3Z B;  1J75 A;  1H8A C;  3V8J A;  1OIS A;  1E3P A;  1ZLK A;  2BV6 A;  1RKT A;  3HOT A;  1FX7 A;  3LA7 A;  4XLP F;  1IZ1 A;  1IN5 A;  3HOV J;  5E17 F;  3ZQF A;  1K6O A;  3GEZ A;  4B3A A;  4IRI A;  3RPQ A;  4RGS A;  4NB5 A;  1R4N B;  2M87 A;  4BH9 A;  1V55 H;  3H1C A;  1YW8 A;  3P9I A;  3TP3 A;  2JRT A;  3Q5F A;  3A02 A;  3IRR A;  4C3J J;  4XBF A;  3GLX A;  3S2H J;  3AL0 B;  4L9N A;  5EG0 B;  4MIM A;  2W48 A;  2PMZ A;  4EGY A;  5FRO A;  4E7K A;  3CDL A;  1SC7 A;  4LJZ F;  3SFZ A;  1Z7U A;  4DYR A;  1ZGW A;  4O6J A;  2BZT A;  2M4G A;  3ZPL A;  4E7Z A;  4LOC A;  1D8J A;  2VBZ A;  4RBO A;  2ID3 A;  2DFF A;  2PEX A;  1FOK A;  4PFP A;  2E36 A;  3L1P A;  4G8X A;  3PFY A;  4BDZ A;  4DJA A;  1RR8 C;  2FQ4 A;  3KPH A;  4YII A;  1H88 C;  1WQ2 A;  2LRD A;  4MTD A;  1BW6 A;  1NG7 A;  3FHN A;  4NDL A;  3CO6 C;  2OAZ A;  3UNG C;  3BTC A;  3W3C A;  1GLN A;  3VYU B;  3IAM 2;  3RSN A;  2IS2 A;  4Y17 A;  4M3D A;  2WBM A;  5KAF C;  3H0D A;  2Y31 A;  1U9O A;  3S32 A;  2KMU A;  3R4K A;  4ENK A;  3K4J A;  1Y0N A;  5J6X A;  3ZR8 X;  2DK8 A;  3K1P A;  2WV1 A;  2H1L A;  2KHM A;  1KU3 A;  4M3E A;  2DFE A;  4EM0 B;  4Y4R A;  2KLO A;  3JAM K;  1SFO J;  4OOI A;  3OYK A;  2V4J C;  1SD6 A;  2AXL A;  2K85 A;  4CDG A;  4E7H A;  4QPO A;  3E0J B;  3IKT A;  1E3H A;  3ASN H;  3ABM H;  3B6C A;  1S7E A;  3HHH A;  2E1M C;  2NNY A;  4EVI A;  4ESJ A;  4IX7 A;  1B9M A;  3S17 J;  2L9V A;  3BG9 A;  3ZMD A;  3IP4 B;  4CA0 A;  2KQR A;  4BKX A;  4CCL A;  5BPD A;  3F3X A;  3LSK A;  4RB3 C;  4HLY A;  4MLO A;  4D5F A;  2CFO A;  4L0Z B;  2HEO A;  4KN7 X;  3MKZ A;  3E6C C;  2F4I A;  2KFD A;  1WI3 A;  2VJJ A;  2D45 A;  3FIW A;  2EB7 A;  4KIB A;  4BGD A;  3PNT A;  2XHK A;  3BWG A;  2VKV A;  5D5U B;  2ISY A;  1K4T A;  3SZT A;  3CCQ I;  1XX5 A;  3DCF A;  3FXJ A;  4HYE A;  2P0W A;  4NQW B;  3BG5 A;  5EG0 A;  1AKH B;  2EZL A;  3S3O A;  3T8R A;  4Q47 A;  3FIS A;  4F91 B;  1ZG5 A;  3H35 A;  3MVP A;  5CVJ A;  3I56 I;  1KU7 A;  2IRF G;  4L9J A;  1LFP A;  4R8H A;  4BUP A;  4NNJ A;  5C3E J;  3WTY C;  5JLX A;  3CUQ A;  1J59 A;  4JP0 A;  2QQB A;  3BP8 A;  1STZ A;  3GTG J;  4A3G J;  4C30 A;  2F5C A;  4D1Q A;  5D6E A;  3WTZ A;  2FRH A;  1DQU A;  1X4O A;  3HSE A;  4P1W A;  2MH9 A;  3KEO A;  4IRG A;  5EGO A;  3FMQ A;  3JRA A;  5JI6 A;  2H27 A;  5HNH A;  1OR7 A;  2K7L A;  2WB1 N;  3GTK J;  1FNN A;  5L3G A;  4CCK A;  2D1H A;  2XAQ A;  2QVO A;  3EUH C;  3GZ5 A;  4HNT A;  1YW7 A;  4LLL A;  2X4H A;  5D5V B;  5FKK A;  3EDP A;  1R5G A;  3M8F A;  5IP9 J;  4XOP A;  2P5L C;  3BOQ A;  1UFM A;  5IYB J;  5DUK A;  2I10 A;  2E34 A;  5GAE J;  5HOD A;  1OMI A;  1U78 A;  2CS3 A;  1I1G A;  2DA2 A;  2LY2 A;  1RUN A;  3RTR A;  1BIB A;  3IHU A;  3B73 A;  3K7A J;  3HJE A;  1YHQ I;  1TZL A;  4BBR J;  3FWE A;  3HOW J;  3ZMT A;  4O3M A;  3DPT A;  3AG4 H;  2V9V A;  5IT3 A;  3WOD F;  4KIG A;  3VYT B;  1FOX A;  3Q9S A;  4BE2 A;  2B63 J;  1OR7 C;  4EM2 A;  5J4Y A;  2BOL A;  1ERD A;  4KDP A;  2LLK A;  1TBX A;  2VB6 A;  2CUE A;  4WCG A;  3OR2 C;  5CQG A;  1MMD A;  2CUJ A;  4XMY A;  2IAI A;  3RKX A;  1I5Z A;  4MNU A;  5JVG F;  3CCU I;  5B66 C;  2FE3 A;  2XUB A;  1BOB A;  1QPM A;  2V1U A;  2QKM B;  3Q0W A;  1N78 A;  1P7J A;  3NAU A;  4II2 A;  3GWZ A;  3BR0 A;  3KP7 A;  5K5R A;  2M3A A;  3ELK A;  2ECB A;  3D1N I;  2P8T A;  5DD8 A;  4HF1 A;  4M3B A;  3MD2 A;  2JZY A;  3ABL H;  3KET A;  1TW2 A;  2JPC A;  1CGP A;  5C44 J;  4B4C A;  2CUF A;  3E5U A;  1S7O A;  3GUD A;  1ETW A;  3PO3 J;  4C2U A;  4D7N A;  1MMS A;  2FNP A;  3I5U A;  1KQ9 A;  1WH5 A;  2K3F A;  5K7F A;  4Y3O A;  1EA3 A;  1R4M B;  2K4J A;  2KIU A;  4PGH A;  1ZRC A;  3LSG A;  1JGG A;  2LKP A;  3JRB A;  5DCM B;  1MMA A;  3DPU A;  4IPA A;  4JOM A;  3WE3 A;  3GZ6 A;  4WXC A;  2R7U A;  1KYZ A;  3KP3 A;  2ETH A;  4FHT A;  1LVA A;  1FT9 A;  1BI1 A;  1OKR A;  4OMY A;  2VE9 A;  3BLY A;  1FTZ A;  2COM A;  3UR3 C;  2LDU A;  4D9J A;  1LNW A;  1VFC A;  2E7W A;  3KE2 A;  3K4N A;  1D8K A;  3JR9 A;  2ESN A;  4IEJ A;  3JRC A;  2ZME B;  4NHJ A;  2B0L A;  1VQ7 I;  3HBL A;  2XGX A;  1O7F A;  4I09 A;  5LGN A;  2DMN A;  3P5J A;  3MQ0 A;  1PUF B;  2PFB A;  1Y6I A;  4JQF A;  3WTW C;  1MW7 A;  5L3B A;  2CMP A;  1MBH A;  1Y0U A;  5FKM A;  1SMY F;  1GT0 C;  4IKF A;  1QVT A;  2ZJR F;  2Z99 A;  2KL4 A;  1O4X A;  3LST A;  3S2D J;  3G1L A;  4DW6 A;  1MH4 A;  1QA6 A;  4UV8 A;  1B9N A;  2ZC2 A;  3IC7 A;  4HBL A;  4LG0 A;  4EQQ A;  2YS9 A;  3JRG A;  5GTI C;  1ETX A;  3GXO A;  3KYC B;  2CG4 A;  3DXJ F;  4RS8 A;  1BIA A;  2CSO A;  4RAF A;  2O8X A;  4XON A;  4LG0 B;  2P4W A;  2UV1 A;  2VKD A;  3K2A A;  3VB2 A;  3SHF A;  3PFI A;  2E5Z A;  3JAM Z;  2VOD A;  2NXN B;  4HRI A;  4ZDO A;  3ROU A;  3LFU A;  2HVS A;  2OQG A;  1V5F A;  3QYB A;  1T38 A;  2RGV A;  2A05 A;  4RAZ A;  1YE9 A;  5F04 A;  4QIW N;  2MYS A;  2QA4 I;  3CJT B;  2VQH A;  1ETQ A;  2OU2 A;  3GTL J;  5E20 A;  3WG9 A;  3AG2 H;  2OD5 A;  2BGC A;  5BQT A;  3HOX J;  2W4S A;  5HDG A;  2X85 A;  3ZXS A;  1ZRD A;  4ZYD A;  3ERM A;  2KJB A;  3BR3 A;  1Z7L A;  3LSP A;  3HDD A;  2UUZ A;  1N75 A;  4FET A;  2JQ7 A;  1IRG A;  3MMY B;  1KZH A;  4OIN F;  1LVK A;  5FLX Z;  5FRN A;  5EZH A;  4JX4 A;  1IN7 A;  3TKY A;  4XLA A;  5LEK A;  2HR3 A;  2QM3 A;  3ABU A;  4DBQ A;  4N9H A;  2L0K A;  1DUX C;  4CZZ A;  1JUS A;  3ONQ A;  1IDY A;  4RM2 A;  4FX4 A;  2IS1 A;  4DOZ A;  3REO A;  4I7H A;  3PJR A;  2KIS A;  4BE1 A;  4HX4 A;  4IHY A;  2DW4 A;  3GW2 A;  3FXM A;  4XKV A;  5HLT A;  4EMS A;  1FMV A;  3RDI A;  2IA1 A;  3NEU A;  1WCM J;  4HX7 A;  5EZG A;  5IP6 A;  2BY3 A;  1REP C;  2MGQ A;  2PJR A;  1KQ8 A;  1I3A A;  4G7Z F;  1Y56 A;  3P9K A;  1RIO H;  1OFC X;  2F2E A;  3DF8 A;  5JHU A;  1BOA A;  3V42 A;  4GYG A;  4YRV A;  1X2M A;  5JHF A;  5HNF A;  3IUO A;  3MKY B;  3S1M J;  2OJE D;  2PI0 A;  3TDU C;  2O8K A;  2ELJ A;  4BJ5 C;  4GXO A;  2Y9Z A;  4P5O A;  1TP4 A;  5J1U A;  1X1C A;  5CPR B;  4CCM A;  3BT9 A;  1S29 A;  3DPL C;  2WAQ N;  1DPU A;  1GVD A;  4A12 A;  1MMG A;  2ELK A;  1FEX A;  3K70 C;  1HC8 A;  2JTV A;  4OAZ A;  5FKO A;  4GRI A;  3SZP A;  1V54 H;  3PIO F;  3TMO A;  3GFL A;  2G9W A;  4XK4 A;  4B1R A;  4FIS A;  5BPI A;  2QLZ A;  4GGG A;  2LF8 A;  5HS8 A;  5H6R A;  1J2X A;  2JT1 A;  2R7F A;  4HZF A;  2FJ1 A;  3ZMS A;  5B5E C;  1WSU A;  2DPD A;  1ZAO A;  3IH3 A;  2JN6 A;  3RQ4 A;  2NVT J;  4V19 K;  5BMZ A;  1WVR A;  1A5J A;  4YIR X;  1UEL B;  2DPU A;  2VUM J;  4UUV A;  2VLA A;  1FBQ A;  2GWR A;  3CCR I;  1JHF A;  1VQ9 I;  2FOK A;  1AOY A;  1TNS A;  3L2W A;  2VJ5 A;  5J1R A;  2MC4 A;  1OJL A;  2QF7 A;  2ZXI A;  1ZKG A;  1G2H A;  2YX4 A;  2XAU A;  5DCF A;  3HXL A;  2EWN A;  2VIX A;  2ME0 A;  1CF7 A;  2BEO A;  5GPC A;  2DT6 A;  2O3F A;  1MJ9 A;  2DA3 A;  4A6E A;  4L5I A;  4LB5 A;  1Z0X A;  3PO2 J;  1UHS A;  3RZD J;  2OC6 A;  2IPQ X;  2OPT A;  3GBG A;  1SFU A;  3VYS B;  1XGS A;  2DMQ A;  3F8F A;  3DEE A;  2XV4 S;  1WJ5 A;  1JTY A;  3KZI C;  5FGM A;  5F6F A;  1J0R A;  4LB6 B;  1MNM C;  2DA6 A;  2HOE A;  2OF7 A;  2L4M A;  5TGT A;  3LSI A;  2H6B A;  1BBY A;  4XIC A;  1T6S A;  2KPM A;  3OYL A;  2KRH A;  3K4L A;  2NS8 A;  3BPV A;  2EH3 A;  1ZRE A;  1QRY A;  3K4B A;  2L7Z A;  2MG4 A;  3V8L A;  2PJR B;  2XAH A;  3M3Y J;  1XMA A;  3HOS A;  3FM3 A;  2DA5 A;  3O2P E;  4UVA A;  4IOA F;  4D0P A;  2EZI A;  2W1O A;  3VOD A;  1W5T A;  4A2U A;  1P4X A;  3S1N J;  1EH8 A;  1KON A;  3FXR A;  3PQK A;  5CVR A;  1FP2 A;  4A0X A;  5EF6 A;  4A3C J;  1HSJ A;  3W2V A;  5M3F J;  4L0Y B;  3G1O A;  3BCB A;  2Z3Y A;  1GUU A;  1NH3 A;  2HPM A;  4ITV A;  1NG6 A;  1FPQ A;  3L7W A;  3ZQC A;  2UWM A;  4U0W A;  4B09 A;  2K40 A;  4BL0 B;  1R23 A;  5LRS A;  5E8G A;  2ADU A;  2DOE A;  3J7A Y;  3O6B B;  3JCU C;  3BJA A;  4A3L J;  1J7K A;  2R7V A;  3G3Z A;  2IS6 A;  2DTR A;  4J19 A;  3WE2 A;  1SMT A;  4A3B J;  4PK4 A;  3DU5 A;  3VOE A;  4CGZ A;  3CUQ B;  1ETV A;  2BXY A;  2CFX A;  3I58 A;  1FWZ A;  5HLH A;  2CO5 A;  3F23 A;  4ENJ A;  4EM1 A;  5LD2 C;  3HOY J;  4FQG A;  2EFP A;  2ME6 A;  2CQ7 A;  3W6V A;  2VT2 A;  1FBS A;  3T1B A;  5FKL A;  2RRE A;  2ZJP F;  1MSF C;  2V6C A;  4HOB A;  3OYB A;  2EIJ H;  3OYC A;  3GLL A;  4GDF A;  3LAP A;  3OYJ A;  5KCM A;  3LQQ A;  1WRJ A;  2XB0 X;  4ZZD A;  3F6V A;  1EKE A;  4FX0 A;  4IL6 C;  4F55 A;  1TC3 C;  3BTL A;  4OWR B;  2IP2 A;  2EFQ A;  5FB2 A;  2Y48 A;  3M4O J;  1EH7 A;  1U0J A;  5JR3 A;  3DEW A;  1R5I D;  2DA4 A;  2GA2 A;  4M6Y A;  1Z67 A;  3RPU A;  2LY9 A;  2JVG A;  3BY6 A;  3MKW B;  3OIP A;  2CQK A;  1XDS A;  1WHU A;  2XRL A;  3AG1 H;  1FIP A;  2NOJ B;  1SD5 A;  2BVL A;  2WAE A;  3TO6 A;  3WGH A;  4HNU A;  1D0Y A;  4PGG A;  2TCT A;  4L9V A;  1A35 A;  2FD5 A;  2Z5U A;  5KK1 A;  2DFH A;  3M8E A;  4V2F A;  2MC3 A;  4MEY F;  3KZZ A;  1R5H A;  3CUO A;  3S93 A;  3QP5 A;  4OIP F;  4G94 A;  4E7J A;  4YEL A;  2DU9 A;  1YRN B;  1Y39 A;  1RKW A;  5ILU A;  3ZQG A;  5AON A;  4R1H A;  2X6W A;  1LEB A;  2QCO A;  2JRM A;  2GXA A;  5J8C A;  2Q1Z B;  3SEZ A;  2GXB A;  3V7C A;  3BG7 A;  4HAM A;  2DXI A;  4C2T A;  2X1D A;  1OCZ H;  1UJ8 A;  3VEP A;  4UVB A;  4IO9 F;  2E2I J;  2L3D A;  1EH6 A;  2LVS A;  2VQL A;  2M34 A;  5AIQ A;  3S1R J;  4I0B A;  3FM5 A;  2A6H F;  4M3F A;  1K7A A;  4DNC A;  1MKM A;  5EGO B;  1YS7 A;  3RQI A;  4QSH A;  3DQV C;  1ORK A;  2M8G X;  1ZK8 A;  1WJA A;  5FO5 A;  2DDB A;  2DYS H;  2ZCW A;  2AQE A;  1ZEL A;  4XNF A;  5LGT A;  2MSY A;  3WHC A;  2P7V B;  5E3O A;  1WZ2 A;  4RA2 A;  1KGS A;  3PNV A;  1AWC A;  3NAR A;  3H92 A;  2EV5 A;  2KT0 A;  3U1D A;  1G3W A;  3DTK A;  4ASN A;  1F1Z A;  4KIS A;  2BW3 B;  3MN2 A;  5FD5 A;  1A6Q A;  1ZLJ A;  2E71 A;  1VI0 A;  3D0S A;  4YEJ A;  2XIG A;  1B4A A;  1HW5 A;  3G1M A;  2XAS A;  3K9T A;  2CRG A;  5B1A H;  1FSE A;  3H3V K;  4LIT A;  2V26 A;  1QPI A;  3B6A A;  1K83 J;  4HSR A;  2ZSI B;  3WGG A;  4AID A;  1OCR H;  4MQ9 F;  2PN6 A;  3DFG A;  4E70 A;  5LFA A;  3GTP J;  3HOZ J;  5E79 C;  4EJT A;  3N97 A;  1APL C;  2KIF A;  4HF0 A;  2A68 F;  2D1V A;  2GQQ A;  4BEH A;  5LLQ A;  3KX2 A;  4TV7 A;  1HA8 A;  5H6Q A;  3CCM I;  2FA5 A;  1VQ5 I;  2CV1 A;  2ZBK A;  4AUX A;  3C7J A;  4HPQ A;  3A2K A;  1UG0 A;  2K9Q A;  4OIR F;  3JTG A;  3VWB A;  4LLN A;  3I71 A;  1LB2 A;  1WGX A;  2VPR A;  1HXD A;  4N4O B;  3ZQ7 A;  5FJ8 J;  2NS0 A;  4M6V A;  3IRQ A;  1YX3 A;  2LR8 A;  3F8C A;  5D8K B;  4ZJZ A;  3JSO A;  1W7P B;  1VF9 A;  4L5J A;  2R5Z A;  4W97 A;  1W1W E;  5ICE A;  2H1K A;  2VAS A;  1IRF A;  2JUC A;  5ED4 A;  3FMR A;  1ODD A;  5L3C A;  4CYD A;  3CF2 A;  4AWX B;  2VL8 A;  1ZGA A;  1XDU A;  1RPW A;  1LPQ A;  1O7L A;  5H20 A;  2RN7 A;  2VC1 A;  4WF2 A;  4A69 C;  2E5N A;  3QYF A;  3ZQH A;  1BM9 A;  3KP6 A;  4B43 A;  3GX4 X;  1HDD C;  3OYG A;  1SD4 A;  3LWF A;  2IW5 A;  2K9S A;  1I27 A;  3V4G A;  4DYQ A;  2VBW A;  1R49 A;  1EJ9 A;  5CLS A;  1F36 A;  2DBB A;  3DBH B;  3U9G A;  5J1Y A;  4KT6 A;  5K1Y A;  1MZB A;  2HDC A;  2HQR A;  1HW2 A;  2WAD A;  2Q2E B;  1WH7 A;  4MTE A;  4G12 A;  1LEA A;  1IUF A;  3KP4 A;  2VXD A;  4M9S A;  3HZJ A;  1D3Y A;  3O3K A;  4XRS A;  4LK0 F;  2CW0 F;  1XD7 A;  5GAG J;  4XRM A;  3SEQ A;  3TED A;  1M1E B;  1WPK A;  2DJN A;  4L9T A;  1IDZ A;  1XGM A;  1WI9 A;  3M8J A;  3ZP5 A;  2CUZ A;  2VC0 A;  5ICF A;  1YTY A;  1HF0 A;  4P9F A;  1JTX A;  1EF4 A;  1O3S A;  3J80 Z;  1YJN I;  2HZT A;  3PSF A;  3QYE A;  4DBR A;  1X1D A;  2BY0 A;  2NVU B;  3WTT C;  4BQO A;  1ULY A;  4GO1 A;  2HS5 A;  2EFN A;  4BDY A;  2HWV A;  1G3T A;  2A07 F;  5IYC J;  4BEH B;  4U0Y A;  3BPX A;  3O8H A;  4PZJ A;  3K4C A;  2E7X A;  1CF7 B;  3HB9 A;  4R79 A;  2UXX A;  2MFZ A;  2KJC A;  4P55 A;  4U0V A;  4PJ0 C;  2BXZ A;  4PJL A;  3FXU A;  2EA4 A;  2QBY A;  2M30 A;  2VKE A;  4E4H A;  2CV2 A;  5EEG A;  4JK1 X;  4Q4Z F;  4A0Z A;  4KMU X;  3CES A;  2BW3 A;  1FSH A;  1UG2 A;  2OTL I;  1Z1D A;  2XAG A;  3DU6 A;  2ID6 A;  1JT6 A;  3L2V A;  3BG6 A;  4XLC A;  4A3D J;  1FP1 D;  3OR1 C;  3LSM A;  2HU9 A;  3G4S I;  1F5T A;  1W7P D;  1PUE E;  1NK3 P;  2FF4 A;  1TQI A;  2JPB A;  3BTI A;  3PL8 A;  3A01 A;  2R7S A;  3CMY A;  3OYM A;  3DP7 A;  2DCE A;  1D0Z A;  2JMW A;  3AG3 H;  3OIO A;  1VQL I;  2DO7 A;  5KNL A;  2STT A;  2GXG A;  1IRZ A;  2ZJ2 A;  2CV0 A;  3I54 A;  1EV7 A;  2X0L A;  2EV6 A;  4CO8 A;  4AIJ A;  1IUY A;  4GYI A;  3HKZ A;  3OS1 A;  3T8T A;  4DYC A;  4JYK A;  1VQO I;  2K9N A;  2B7E A;  3G73 A;  1R6R A;  1X19 A;  2Q0O A;  4CCO A;  1Z21 A;  4DZJ A;  3OSF A;  1QVU A;  2R5Z B;  4XN3 A;  2HKX A;  1YIO A;  5HLI A;  2DT7 B;  4D5C A;  3DTE A;  3QOE A;  1XB4 A;  1LDJ A;  1YQA A;  2IGO A;  3C3W A;  2L7K A;  2YX7 A;  4FE4 A;  1OCT C;  2L54 A;  5IP7 J;  2OV7 A;  1K78 A;  3GZN B;  3P7N A;  3HOU J;  2YU9 J;  1RI7 A;  2V1N A;  2BYV E;  1CQT A;  4G9Y A;  3TP0 A;  2E19 A;  3RIR A;  5FLX K;  4D7M A;  2ESH A;  1L0O C;  1HOM A;  3HRS A;  4ENM A;  2A69 F;  1HW1 A;  2ZNZ A;  3I59 B;  1OCP A;  4XRF A;  4KIT B;  1E2X A;  3FZV A;  3S14 J;  2XVC A;  1LDD A;  2M0C A;  2FEZ A;  2YPR A;  2VQG A;  3S3M A;  3E5Q A;  2NVY J;  1XC5 A;  2VBY A;  1E17 A;  4G7O F;  2NNN A;  1S72 I;  4XKB A;  2XAJ A;  4DGW B;  1DP3 A;  1OYY A;  1IGN A;  2LK2 A;  3VSL A;  2AHQ A;  3ZMZ A;  4BNC A;  3OY9 A;  1GVJ A;  3DKW A;  1S5L C;  1SAN A;  3HRU A;  3EYI A;  3EUK L;  4I99 C;  1YG2 A;  4Y52 J;  3OV8 A;  3FXK A;  3CJQ B;  3K0L A;  2WY8 Q;  4KA4 A;  3PIP F;  2WC2 A;  5TIS C;  1P4W A;  3WTS C;  1GHC A;  2BHZ A;  1VTN C;  4LIU A;  4HV5 A;  2EK5 A;  4DIQ A;  1VQN I;  4UUT A;  3BR6 A;  2LH9 A;  2XF7 A;  4KIC A;  1OYW A;  2GIZ A;  4YG2 F;  3D5S C;  2JA8 J;  2Y0M A;  3HM5 A;  2XSD C;  1O3R A;  1FTT A;  4PJN A;  5E3N A;  3KLN A;  4FAS D;  2COB A;  1QZE A;  3I0T A;  1TW3 A;  3F22 A;  3L2C A;  2JSC A;  3CZ6 A;  2V9P A;  5JVT A;  1BA5 A;  2IGK A;  2Y30 A;  3OYE A;  4CZC A;  2X6O A;  4IHW A;  3HSR A;  3G2B A;  1I1S A;  5IOZ A;  4IRH A;  3PQJ A;  5CYV A;  4I01 A;  2LTP A;  5E18 F;  3I4P A;  1BI3 A;  3JRD A;  1W36 C;  4XKC A;  3FHZ A;  3LNQ A;  2W85 A;  2LKX A;  4WWC A;  1C0W A;  3HGY A;  2CYY A;  2JA5 J;  4NQW A;  2E35 A;  1Z9C A;  1JUM A;  1L3L A;  4M72 A;  4BHP A;  3MAJ A;  3RI4 A;  3C2B A;  1BJA A;  2KDO A;  2KP6 A;  2L7M P;  2P81 A;  3PUF A;  2DMT A;  2JA2 A;  2X9D A;  2M7B A;  3QWL A;  4WXD A;  3LSH A;  3L00 A;  4CCJ A;  4I76 A;  1DU0 A;  1A31 A;  3NRV A;  3HEF A;  2RV8 A;  3J7Y J;  3T0Y A;  1MDM A;  1MBE A;  3GFM A;  1IXS B;  5HDK A;  4II3 A;  2AXT C;  2Y9Y A;  3HIF A;  3CUQ C;  4MQV A;  4S05 A;  2X1E A;  3KP5 A;  2IGN A;  3J80 K;  2MW8 A;  1XCB A;  3JTH A;  1VZ0 A;  3MZ8 A;  5J47 A;  1B8I A;  1JXS A;  4HDV A;  1Z3Y A;  2CH0 A;  2FXA A;  2LKS A;  4YFK F;  2MD5 A;  3HPG A;  2BHY A;  2A6E F;  2P5K A;  2LOO A;  4ZYH A;  3BQY A;  1X3U A;  4I0A A;  1YFH A;  2EIN H;  2FQ3 A;  1F4K A;  1AU7 A;  3RKY A;  3F9K A;  5F0H A;  3W2W A;  4ESB A;  3S1Q J;  1MBG A;  5HVQ C;  4EV0 A;  2RKH A;  4N4N B;  3G6E I;  3RKW A;  1SFE A;  2E1N A;  4FE7 A;  4UUS B;  1FC3 A;  4LLG F;  1OYI A;  1UST A;  1IN6 A;  4PJJ A;  2V7F A;  2DT5 A;  3ZQQ A;  5HS7 A;  1TQP A;  4KNY A;  4A3I J;  2MA3 A;  3BZC A;  1HKS A;  1XN7 A;  3FF5 A;  3L09 A;  4B48 A;  2N8G A;  2ZB9 A;  2E60 A;  1RZ4 A;  4PUS A;  3Q9V A;  2LC2 A;  1MIJ A;  4A93 J;  3N4M A;  4IHT A;  3K2Z A;  3F8N A;  1BN5 A;  1AA7 A;  2R7Q A;  4NC6 A;  3D5L A;  4ENN A;  1R00 A;  2FBK A;  1J9I A;  3GYH X;  1X1A A;  5M5X J;  2NAZ A;  3FKJ A;  1WJC A;  2K86 A;  3OYI A;  2OCE A;  5E3L A;  1TLH B;  2WTE A;  3A1Y A;  1HDP A;  2F6C A;  3GTM J;  2DYR H;  2EIK H;  2KDZ A;  3GFJ A;  1BJZ A;  1LFB A;  1IJW C;  4IVN A;  2GOM A;  1FOY A;  3N05 A;  1ZTR A;  4EAT A;  2L01 A;  1GDT A;  3BTJ A;  4IXA A;  2QEX I;  5B3S H;  2VOO A;  4LD5 A;  4HG2 A;  2R3S A;  3BZK A;  3CCY A;  3WHB A;  1P9Q C;  5EDN A;  1X4P A;  2Z9O A;  2DMU A;  2QSF X;  4B44 A;  4Y7N J;  3OYN A;  3MZY A;  2E2H J;  3DLL F;  4BQN A;  2QEN A;  5DS9 A;  5FRM A;  3CDH A;  1G3Y A;  2M4K A;  1XMK A;  2KZG A;  4NC7 A;  5F0C A;  1FLI A;  2QKL B;  5IY5 H;  4RGU A;  1B8I B;  2R7D A;  2IS4 A;  4CIC A;  1W5S A;  2L2O A;  4EJO A;  3LQR A;  1YJW I;  3HG9 A;  5IT9 Z;  1IG7 A; 
#chains in the Genus database with same CATH homology
 1R1V A;  1O3T A;  5L3D A;  3E5X A;  3GF2 A;  1UHM A;  1MD0 A;  5TJJ A;  2PG4 A;  1ZHF A;  5K5O A;  4OIQ F;  5LHH A;  5EEH A;  6PAX A;  3CTA A;  5J8F A;  2GIV A;  1JHH A;  5ILS A;  2FSW A;  3W6J B;  1J5Y A;  3ISP A;  1GXP A;  5L3F A;  1U5T B;  3T5X A;  4U88 A;  1U5T A;  2F5E A;  1HST A;  2QYO A;  3E6M A;  3QPH A;  4I98 B;  4EJU A;  2WWY A;  5E1X A;  1TTY A;  3R60 A;  5D5W B;  5F64 A;  1P92 A;  2DFI A;  1QO0 D;  5D8L B;  3CLO A;  2K27 A;  1B6A A;  3L9F A;  3KLO A;  1KU2 A;  4ZYE A;  3SQN A;  3E97 A;  2ACJ A;  2PLY A;  2KKO A;  3E3V A;  3TO9 A;  2L4A A;  2M8E A;  3IKV A;  5FD6 A;  2ZFW A;  5FFX A;  3FMS A;  2V1D A;  1U8R A;  4UHT A;  3OOP A;  1FYM A;  1XGO A;  3IWZ A;  1IXR C;  4JBA A;  2V1X A;  2VT3 A;  2VXZ A;  2A61 A;  3TDZ C;  3TQN A;  2XRO A;  3I64 A;  5LHG A;  4LGW A;  4S04 A;  2ELH A;  1XSX A;  3ZMU A;  1R7J A;  2UXN A;  2W84 A;  3R0J A;  2ZKZ A;  2PMH A;  3COA C;  2KIM A;  3GO5 A;  4YFN F;  1TQM A;  3F8M A;  2EJR A;  3ZMV A;  1TNT A;  3P9C A;  4P96 A;  1ON1 A;  2VOP A;  3ECO A;  2EFW A;  3QAH A;  4FT8 A;  5DV5 A;  1QQI A;  2HQN A;  1ZRF A;  2D2W A;  2YU3 A;  5DD4 A;  3S2W A;  3MZH A;  3ERE D;  1SAX A;  2NRA C;  3MCZ A;  3EET A;  5DCM A;  3QPT A;  3HRT A;  1KQ0 A;  3WGI A;  3K1M A;  5BOX A;  1IXC A;  4AIK A;  1YS6 A;  4IJA A;  1Z6R A;  1LJ9 A;  2RC4 A;  1XSD A;  3JW4 A;  4K2E A;  1LQ1 A;  5AIP A;  2V79 A;  4LMY A;  3GFI A;  1OPC A;  4I02 A;  1R36 A;  4EJW A;  4BQA A;  1ZAR A;  2M5W A;  3RYP A;  3E6B A;  5DEQ A;  2P6T A;  3C18 A;  1GXQ A;  4U7B A;  1UB9 A;  2BBY A;  2Q2E A;  1I6X A;  3TGN A;  1KA8 A;  1T0F A;  5DUI A;  4U7D A;  1ONV A;  2RDP A;  3H3Z A;  4UV9 A;  2YR2 A;  2P5V A;  5CVV A;  4EJV A;  2DLL A;  1G3S A;  4UVC A;  2VE8 A;  1ZN2 A;  5D4S A;  1UCR A;  1FBU A;  2F5D A;  4WXH A;  2HTS A;  4KIF A;  3I59 A;  2CWE A;  3HTS B;  2QZ8 A;  2DI3 A;  3B02 A;  1QBJ A;  4Y13 A;  3H3U A;  3QRF F;  4L18 B;  2IA2 A;  1QZZ A;  3J81 K;  3RYR A;  2RVC A;  5D5X B;  4F7Z A;  4M73 A;  4P9U A;  1QNT A;  3KCC A;  4RB2 C;  4MHG A;  4KT5 C;  2PQ8 A;  2RQP A;  2E1C A;  1HKT A;  4N0B A;  3K69 A;  5CVI A;  3QU3 A;  1YO5 C;  2MLG A;  4EGZ A;  1JE8 A;  2STW A;  5DDG A;  3LA2 A;  2XAF A;  1U3E M;  3K1N A;  4G6D A;  2W25 A;  2GZW A;  2PBI A;  4IF4 A;  4HQE A;  2H6C A;  2HKO A;  1K78 B;  4PCQ A;  2ZNY A;  3HTU A;  4QLC U;  1D5V A;  5LBQ A;  4B8X A;  2UZK A;  4LFU A;  1XCV A;  4H0E A;  2GA1 A;  3WTU C;  1W4M A;  2P6S A;  2QWW A;  4YIF A;  2IJL A;  4WX9 A;  4UXN A;  1RNL A;  2C6Y A;  2LSO A;  3J81 Z;  2DQR A;  2KRF A;  1A04 A;  2IT0 A;  2EA2 A;  1UHW A;  2O0Y A;  1R1T A;  1HBX G;  2IVM A;  4M74 A;  1S6L A;  1H9T A;  1MGT A;  1ON2 A;  1V4R A;  2WV0 A;  3BJ6 A;  3EUH A;  3F72 A;  4XLN F;  1QZY A;  4ESF A;  2L02 A;  2ISZ A;  1Z6T A;  2HYF A;  2P7C B;  4KMF A;  1S7A A;  5L3E A;  3I53 A;  1FYK A;  2W24 A;  1IN4 A;  1JGS A;  3LA3 A;  1DP7 P;  3LFK A;  2M45 A;  4UNO A;  3V8K A;  3BJO A;  1ZYR F;  2CGP A;  2HGC A;  3QP6 A;  1H9G A;  4HF2 A;  4BHC A;  1FY7 A;  2Y75 A;  2FNA A;  4KN4 X;  3AAF A;  1XSV A;  2ZXJ A;  3TOA A;  2MLK A;  3R61 A;  1WWX A;  1KU9 A;  1T39 A;  1XGN A;  2EV0 A;  3HYI A;  3E6D A;  3M9A A;  1P2F A;  5HLG A;  1SD7 A;  5CJ9 A;  3CO7 C;  2ZO4 A;  3DV8 A;  1Q1H A;  2G7H A;  4HDU A;  3BZ6 A;  2XKP A;  1ZGJ A;  3F21 A;  4AD9 A;  4M71 A;  3JSP A;  2J5O A;  3C1D A;  3VFZ A;  4DQ2 A;  1USS A;  5IT9 K;  3M1E A;  3HHG A;  5TRD A;  2XRN A;  4GCV A;  3HRM A;  5E1W A;  1SFX A;  4XSX F;  3KFW X;  3BDD A;  1IW7 F;  4HA8 A;  1R22 A;  2QBY B;  1YLF A;  2MH2 A;  1HKQ A;  2FML A;  5A2Q K;  4RB1 A;  3TO7 A;  2H09 A;  1LDK B;  1U6G A;  3WTV C;  2Q8K A;  4LK1 F;  2OBP A;  5BS6 A;  4ZZL A;  4CHU A;  3ECH A;  4AIH A;  2HTJ A;  1QGP A;  1YW9 A;  2DQL A;  2PMU A;  4I2O A;  1ZG1 A;  2A3S A;  4M6X A;  4OIO F;  4BAY A;  5D4R A;  3V7R A;  3W6K B;  1W7P A;  5JFR A;  4RGX A;  3RJP A;  3EQL F;  4PDK A;  3WU0 A;  1BC7 C;  2W57 A;  2BE5 F;  3HUG A;  1O57 A;  4Q48 A;  3BRO A;  4HV6 A;  3QU6 A;  3SXY A;  4KUM A;  4G6Q A;  1KYW A;  3DEU A;  1PP7 U;  4A5N A;  2G7U A;  5K5Q A;  5ERI A;  5DYM A;  1HQC A;  3F6O A;  5ILV A;  2YSR A;  5ICG A;  2HYG D;  4WK8 F;  4HW0 A;  4MGR A;  2DK5 A;  3HSF A;  1O3Q A;  3FXQ A;  1ZH5 A;  1V3F A;  3F8B A;  5A2Q Z;  1H0M A;  2OZ6 A;  2O03 A;  3IL2 A;  1R58 A;  1G6N A;  1RUO A;  5KVR A;  1K79 A;  4HQM A;  2ZME A;  5LEJ A;  2FMY A;  3LAJ A;  2QQA A;  4YFX F;  2FBI A;  2PJP A;  4RB0 A;  2J5P A;  1IAW A;  2QUF A;  4BHB A;  2LF7 A;  3V7S A;  3U2R A;  2GAU A;  3WTX C;  5LHI A;  4A0Y A;  2TDX A;  5E8I A;  1DDN A;  1B59 A;  1PP8 F;  3R0A A;  2OA4 A;  5ICC A;  4HLX A;  2O6G E;  2K4B A;  1ZG3 A;  1BC8 C;  2XKO A;  2HFH A;  5LRR A;  2A5Y B;  1IN8 A;  4N9I A;  4Q5S F;  1MJA A;  2LNB A;  4ZYG A;  2FBH A;  2MBF A;  2K02 A;  2H94 A;  3KEQ A;  4M9Z A;  2F5F A;  4ON0 A;  3ZN1 A;  1FYL A;  4ETS A;  1U2W A;  3ZN0 A;  1G4D A;  1NHA A;  4A6D A;  4BXU A;  1FZP B;  3TOB A;  3ULQ B;  4CXF A;  4MEX F;  2Z33 A;  3ABT A;  2M1B A;  3GVA A;  1S8N A;  5FFZ A;  2OZU A;  5LGU A;  1B1B A;  3QOP A;  5F1R A;  2OQR A;  1U5T C;  4KFC A;  1BI2 A;  1P6R A;  3KP2 A;  3KZY A;  2VN2 A;  1P4A A;  5E1Z B;  3R6S A;  5D6F A;  5CVU A;  2DAO A;  3NQO A;  4A5M A;  2AS5 F;  1T98 A;  4IHS A;  1F9N A;  3IWF A;  4XSZ F;  2NYX A;  4RGR A;  2O61 A;  1DPR A;  2VBX A;  1Z91 A;  1PDN C;  3MWM A;  3ML6 A;  4OU0 A;  1MJB A;  4M9X A;  3MFK A;  1BI0 A;  4RAY A;  1MDM B;  1R1U A;  4KYW A;  4AVP A;  2FU4 A;  3EYY A;  4HX8 A;  3WU1 B;  1Z05 A;  4G7H F;  4OMZ A;  1WKM A;  3M7G A;  3J7A O;  2IA0 A;  2EFO A;  5HOO A;  1IF1 A;  5HDN A;  2QQ9 A;  2VON A;  5HS9 A;  4Z2Y A;  4Y15 A;  4ZH4 F;  1YYV A;  3MEX A;  4O5V A;  2RNJ A;  3CJN A;  4BYY A;  1T2K A;  4QWQ A;  1S3J A;  1J75 A;  3V8J A;  1ZLK A;  2BV6 A;  3HOT A;  1FX7 A;  3LA7 A;  4XLP F;  1IZ1 A;  1IN5 A;  5E17 F;  1K6O A;  3GEZ A;  4IRI A;  3RPQ A;  4RGS A;  4NB5 A;  2M87 A;  4BH9 A;  1YW8 A;  3P9I A;  2JRT A;  3Q5F A;  3IRR A;  4XBF A;  3GLX A;  4L9N A;  4EGY A;  4LJZ F;  3SFZ A;  1Z7U A;  4O6J A;  3ZPL A;  1D8J A;  2VBZ A;  2PEX A;  1FOK A;  4G8X A;  4YII A;  1WQ2 A;  4MTD A;  3CO6 C;  2OAZ A;  4Y17 A;  3R4K A;  4ENK A;  5J6X A;  2DK8 A;  3K1P A;  1KU3 A;  4EM0 B;  3JAM K;  4OOI A;  1SD6 A;  2AXL A;  4CDG A;  3IKT A;  3HHH A;  2NNY A;  4EVI A;  4ESJ A;  1B9M A;  3ZMD A;  5BPD A;  3F3X A;  4RB3 C;  4HLY A;  4L0Z B;  2HEO A;  4KN7 X;  3E6C C;  2D45 A;  2EB7 A;  4KIB A;  2XHK A;  3BWG A;  5D5U B;  2ISY A;  3SZT A;  4HYE A;  3T8R A;  4Q47 A;  1ZG5 A;  5CVJ A;  1KU7 A;  2IRF G;  4L9J A;  4R8H A;  3WTY C;  3CUQ A;  1J59 A;  2QQB A;  3BP8 A;  1STZ A;  2F5C A;  5D6E A;  3WTZ A;  2FRH A;  3HSE A;  2MH9 A;  3KEO A;  4IRG A;  3FMQ A;  5JI6 A;  2H27 A;  1OR7 A;  2K7L A;  1FNN A;  5L3G A;  2D1H A;  2XAQ A;  2QVO A;  3GZ5 A;  1YW7 A;  4LLL A;  2X4H A;  5D5V B;  3EDP A;  1R5G A;  3M8F A;  2P5L C;  3BOQ A;  1UFM A;  5DUK A;  1OMI A;  1U78 A;  1I1G A;  1RUN A;  3RTR A;  1BIB A;  3IHU A;  3B73 A;  3FWE A;  3ZMT A;  4O3M A;  3DPT A;  2V9V A;  5IT3 A;  3WOD F;  4KIG A;  3Q9S A;  4EM2 A;  4KDP A;  1TBX A;  4WCG A;  3RKX A;  1I5Z A;  4MNU A;  2FE3 A;  2XUB A;  1QPM A;  2V1U A;  3GWZ A;  3KP7 A;  5K5R A;  3ELK A;  2P8T A;  5DD8 A;  4HF1 A;  2JZY A;  3KET A;  1CGP A;  1TW2 A;  2JPC A;  3E5U A;  1S7O A;  3GUD A;  2FNP A;  3I5U A;  1KQ9 A;  2K4J A;  2KIU A;  4PGH A;  1ZRC A;  2LKP A;  5DCM B;  4IPA A;  3WE3 A;  3GZ6 A;  4WXC A;  1KYZ A;  3KP3 A;  2ETH A;  4FHT A;  1LVA A;  1FT9 A;  1BI1 A;  1OKR A;  4OMY A;  2VE9 A;  2COM A;  2LDU A;  1LNW A;  2E7W A;  3KE2 A;  1D8K A;  2ESN A;  2ZME B;  4NHJ A;  2B0L A;  4I09 A;  2XGX A;  1O7F A;  5LGN A;  3MQ0 A;  2PFB A;  4JQF A;  3WTW C;  5L3B A;  1Y0U A;  1SMY F;  2Z99 A;  3LST A;  4UV8 A;  1B9N A;  3IC7 A;  4HBL A;  4LG0 A;  4EQQ A;  3GXO A;  2CG4 A;  3DXJ F;  4RS8 A;  1BIA A;  2CSO A;  2O8X A;  4LG0 B;  2P4W A;  3VB2 A;  3SHF A;  3PFI A;  3JAM Z;  2VOD A;  3ROU A;  2OQG A;  1T38 A;  2RGV A;  4RAZ A;  2OU2 A;  5E20 A;  3WG9 A;  2OD5 A;  2BGC A;  5BQT A;  5HDG A;  1ZRD A;  4ZYD A;  2KJB A;  1IRG A;  4OIN F;  5FLX Z;  1IN7 A;  3TKY A;  5LEK A;  2HR3 A;  2QM3 A;  3ABU A;  4N9H A;  1DUX C;  4CZZ A;  4FX4 A;  3REO A;  4I7H A;  4HX4 A;  2DW4 A;  3GW2 A;  4EMS A;  3RDI A;  2IA1 A;  3NEU A;  4HX7 A;  1REP C;  1KQ8 A;  4G7Z F;  3P9K A;  1RIO H;  2F2E A;  3DF8 A;  5JHU A;  1BOA A;  4GYG A;  2PI0 A;  3TDU C;  4GXO A;  4P5O A;  1S29 A;  3DPL C;  1DPU A;  4A12 A;  2JTV A;  3SZP A;  3GFL A;  2G9W A;  5BPI A;  2QLZ A;  4GGG A;  2LF8 A;  5HS8 A;  5H6R A;  2DPD A;  1J2X A;  2JT1 A;  2R7F A;  4HZF A;  3ZMS A;  1WSU A;  1ZAO A;  5BMZ A;  2DPU A;  4UUV A;  1FBQ A;  2GWR A;  1JHF A;  2FOK A;  1AOY A;  1TNS A;  2YX4 A;  5DCF A;  2EWN A;  1CF7 A;  2BEO A;  2O3F A;  1MJ9 A;  4A6E A;  4L5I A;  4LB5 A;  2IPQ X;  1SFU A;  1XGS A;  3F8F A;  2XV4 S;  5FGM A;  5F6F A;  1J0R A;  4LB6 B;  2HOE A;  2L4M A;  2H6B A;  1BBY A;  1T6S A;  3BPV A;  1ZRE A;  3V8L A;  2XAH A;  1XMA A;  3HOS A;  3FM3 A;  3O2P E;  4UVA A;  4D0P A;  3VOD A;  1W5T A;  4A2U A;  1P4X A;  1EH8 A;  3FXR A;  3PQK A;  5CVR A;  1FP2 A;  4A0X A;  1HSJ A;  4L0Y B;  2Z3Y A;  1FPQ A;  3L7W A;  2UWM A;  4U0W A;  4B09 A;  1R23 A;  5LRS A;  5E8G A;  2ADU A;  3O6B B;  3BJA A;  1J7K A;  3G3Z A;  2DTR A;  3WE2 A;  1SMT A;  3VOE A;  4CGZ A;  3CUQ B;  2CFX A;  3I58 A;  1FWZ A;  5HLH A;  2CO5 A;  3F23 A;  4ENJ A;  4EM1 A;  2EFP A;  2VT2 A;  1FBS A;  3T1B A;  2V6C A;  4HOB A;  3LAP A;  3LQQ A;  1WRJ A;  4ZZD A;  3F6V A;  4FX0 A;  2IP2 A;  2EFQ A;  5FB2 A;  2Y48 A;  1EH7 A;  5JR3 A;  2GA2 A;  4M6Y A;  3RPU A;  3BY6 A;  2CQK A;  1XDS A;  3TO6 A;  1SD5 A;  3WGH A;  4PGG A;  4L9V A;  2Z5U A;  5KK1 A;  3M8E A;  2MC3 A;  4MEY F;  3KZZ A;  1R5H A;  3CUO A;  3QP5 A;  4OIP F;  4G94 A;  2DU9 A;  5ILU A;  5AON A;  4R1H A;  1LEB A;  5J8C A;  2GXB A;  3V7C A;  4HAM A;  3VEP A;  4UVB A;  2L3D A;  1EH6 A;  5AIQ A;  4I0B A;  3FM5 A;  2A6H F;  1K7A A;  4DNC A;  1MKM A;  1YS7 A;  3DQV C;  5FO5 A;  2ZCW A;  5LGT A;  2P7V B;  1KGS A;  1AWC A;  3H92 A;  2EV5 A;  3U1D A;  1G3W A;  4ASN A;  1F1Z A;  5FD5 A;  1ZLJ A;  3D0S A;  2XIG A;  1B4A A;  1HW5 A;  2XAS A;  3K9T A;  1FSE A;  3WGG A;  4MQ9 F;  2PN6 A;  3DFG A;  4E70 A;  4EJT A;  3N97 A;  2KIF A;  4HF0 A;  2A68 F;  2D1V A;  2GQQ A;  5LLQ A;  4TV7 A;  5H6Q A;  2FA5 A;  2ZBK A;  3C7J A;  4OIR F;  3JTG A;  4LLN A;  3I71 A;  1LB2 A;  1HXD A;  3ZQ7 A;  2NS0 A;  3IRQ A;  3F8C A;  5D8K B;  3JSO A;  1W7P B;  4L5J A;  5ICE A;  1IRF A;  5ED4 A;  3FMR A;  1ODD A;  5L3C A;  4CYD A;  4AWX B;  1ZGA A;  1XDU A;  1O7L A;  5H20 A;  2RN7 A;  2VC1 A;  4WF2 A;  1BM9 A;  3KP6 A;  3GX4 X;  1SD4 A;  3LWF A;  2IW5 A;  1I27 A;  3V4G A;  2VBW A;  5CLS A;  2DBB A;  3U9G A;  5K1Y A;  1MZB A;  2HDC A;  2HQR A;  1HW2 A;  4MTE A;  1LEA A;  4M9S A;  3KP4 A;  1D3Y A;  3O3K A;  4LK0 F;  2CW0 F;  1XD7 A;  4L9T A;  1XGM A;  1WI9 A;  3ZP5 A;  2VC0 A;  5ICF A;  1YTY A;  4P9F A;  1O3S A;  3J80 Z;  2HZT A;  3WTT C;  1ULY A;  4GO1 A;  2HS5 A;  2EFN A;  2HWV A;  1G3T A;  2A07 F;  4U0Y A;  3BPX A;  4PZJ A;  2E7X A;  1CF7 B;  4R79 A;  2UXX A;  2KJC A;  4P55 A;  4U0V A;  3FXU A;  2EA4 A;  2QBY A;  2M30 A;  5EEG A;  4JK1 X;  4Q4Z F;  4A0Z A;  4KMU X;  1FSH A;  1Z1D A;  2XAG A;  1FP1 D;  1F5T A;  1W7P D;  1PUE E;  2FF4 A;  1TQI A;  2JPB A;  3DP7 A;  2DO7 A;  2STT A;  2GXG A;  2ZJ2 A;  3I54 A;  1EV7 A;  2X0L A;  2EV6 A;  4CO8 A;  4AIJ A;  1IUY A;  4GYI A;  3T8T A;  3G73 A;  2Q0O A;  2HKX A;  1YIO A;  5HLI A;  1XB4 A;  1LDJ A;  1YQA A;  3C3W A;  2YX7 A;  2L54 A;  1K78 A;  3P7N A;  1RI7 A;  2BYV E;  4G9Y A;  3RIR A;  5FLX K;  2ESH A;  1L0O C;  3HRS A;  4ENM A;  2A69 F;  1HW1 A;  2ZNZ A;  3I59 B;  4XRF A;  1E2X A;  3FZV A;  2XVC A;  1LDD A;  2FEZ A;  2YPR A;  3E5Q A;  2VBY A;  1E17 A;  4G7O F;  2NNN A;  2XAJ A;  1OYY A;  3ZMZ A;  4BNC A;  1GVJ A;  3DKW A;  3HRU A;  3EYI A;  1YG2 A;  3OV8 A;  3K0L A;  4KA4 A;  2WC2 A;  1P4W A;  3WTS C;  1GHC A;  1VTN C;  4HV5 A;  2EK5 A;  4KIC A;  1OYW A;  4YG2 F;  2Y0M A;  1O3R A;  3KLN A;  3I0T A;  1TW3 A;  3F22 A;  3L2C A;  2JSC A;  5JVT A;  1I1S A;  3HSR A;  4IRH A;  3PQJ A;  5CYV A;  4I01 A;  5E18 F;  3I4P A;  1BI3 A;  3FHZ A;  2W85 A;  4WWC A;  1C0W A;  2CYY A;  4NQW A;  1Z9C A;  1L3L A;  4M72 A;  4BHP A;  3MAJ A;  3RI4 A;  1BJA A;  4WXD A;  3L00 A;  3NRV A;  2RV8 A;  1MDM A;  3T0Y A;  3GFM A;  1IXS B;  5HDK A;  3HIF A;  3CUQ C;  4MQV A;  4S05 A;  3KP5 A;  3J80 K;  1XCB A;  3JTH A;  1JXS A;  4HDV A;  2FXA A;  4YFK F;  2MD5 A;  2A6E F;  2P5K A;  4ZYH A;  1X3U A;  4I0A A;  1YFH A;  2FQ3 A;  1F4K A;  3RKY A;  4ESB A;  5HVQ C;  4EV0 A;  2RKH A;  3RKW A;  1SFE A;  2E1N A;  1FC3 A;  4LLG F;  1OYI A;  1UST A;  1IN6 A;  2DT5 A;  5HS7 A;  1TQP A;  4KNY A;  2MA3 A;  1HKS A;  1XN7 A;  3FF5 A;  3L09 A;  1RZ4 A;  3Q9V A;  3N4M A;  4IHT A;  3K2Z A;  3F8N A;  1BN5 A;  3D5L A;  4ENN A;  1R00 A;  2FBK A;  1J9I A;  3GYH X;  2NAZ A;  2K86 A;  1TLH B;  2WTE A;  3GFJ A;  4IVN A;  2L01 A;  4IXA A;  2VOO A;  4LD5 A;  2R3S A;  2Z9O A;  3MZY A;  2QEN A;  3CDH A;  1G3Y A;  1XMK A;  1FLI A;  4RGU A;  2R7D A;  4CIC A;  1W5S A;  4EJO A;  3LQR A;  3FX3 A;  5IT9 Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...