4M71A

Mutant structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQLDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHEFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 120
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4m71A01
1BI3A 2D2WA 2DK8A 3KEQA 4JQFA 1YO5C 1HW1A 3VFZA 1W5SA 1R1TA 2FU4A 1ON1A 1P2FA 2ZXJA 2FMLA 2UZKA 1G4DA 3BWGA 3CUOA 1QQIA 1H9GA 3K2ZA 2LKPA 3HIFA 2W84A 3WE2A 2EFOA 5E18F 2CWEA 4A5NA 1IN5A 3O3KA 4A12A 4FX4A 2RN7A 2BGCA 4JBAA 1HW2A 2FSWA 1K79A 5LGTA 2GXGA 1LJ9A 3V7RA 3GFLA 1F4KA 1X3UA 2VONA 4GGGA 3RYRA 5HLHA 5FB2A 5IT9K 2PG4A 3BZ6A 3V8KA 4KN7X 3J80Z 3TO7A 2BEOA 3RKXA 3MAJA 1G3YA 1U5TB 2A68F 4LJZF 4Y15A 2JTVA 1I6XA 1ZARA 2Z33A 2KRFA 3KFWX 3WG9A 4AIHA 1D3YA 5LHHA 2HWVA 2L02A 1FYKA 3TGNA 1K78A 1IXSB 1YYVA 3E5QA 4MHGA 3BY6A 1O3TA 2GIVA 4YIIA 2D1HA 3WTSC 3L7WA 3PQKA 4O6JA 3RTRA 4EGYA 1SD5A 3FXRA 3M1EA 3VEPA 6PAXA 3TO6A 2DPDA 2K4BA 1ZN2A 3ML6A 3GX4X 4BH9A 4WK8F 4UNOA 3QU6A 1IN8A 4YFNF 3TOBA 3EYIA 1TW2A 5CVUA 1G3SA 4UXNA 3L9FA 1EH8A 1Z05A 3ZP5A 2F5EA 1UCRA 2VBXA 2HFHA 2VXZA 1SD4A 3HHHA 3HRMA 2EB7A 3L09A 5LEJA 2V6CA 5HDNA 3KP6A 1P92A 4I0AA 2ZKZA 3SXYA 4KIGA 5LBQA 5LRSA 2MLGA 4ESJA 2V1UA 2VBWA 1Z91A 4FX0A 3EYYA 1SFXA 1AWCA 3RI4A 1OMIA 2XGXA 2PQ8A 1IUYA 5JI6A 3JTGA 5D4RA 5AIQA 2OD5A 2W25A 1BI2A 4I2OA 4LFUA 3WU1B 5BPIA 2EFWA 3T1BA 3ZMDA 2ZBKA 1FY7A 3T5XA 1T38A 3JW4A 1J59A 2GZWA 2G7HA 5DD8A 4OIOF 4HLXA 2ETHA 2ISZA 5FLXK 3E6DA 5D5WB 3J81K 2VBYA 4YFXF 2MD5A 4EM0B 2JT1A 3F72A 4HAMA 5ILSA 3B73A 1FZPB 1DPRA 1ZGAA 3OOPA 1QNTA 3U2RA 1IN6A 2HQRA 4G94A 4IF4A 2CGPA 3TO9A 1I1GA 4H0EA 1HBXG 3LA7A 4R1HA 3RYPA 3BJ6A 3MZHA 3CO6C 2DT5A 1LEAA 3REOA 4HF1A 1BN5A 2YU3A 1K7AA 1R36A 4WXCA 2A6EF 4I01A 4CZZA 2LNBA 5DYMA 2HZTA 1ZRDA 1XGMA 3RKYA 3COAC 1ONVA 3OV8A 4ZYGA 5HOOA 4M9SA 2ZMEA 2X0LA 1RZ4A 1OR7A 3KEOA 5TJJA 1HSTA 3R4KA 2HEOA 4KIFA 1OKRA 1RUOA 2KKOA 1Z6TA 2XV4S 2P7CB 3T8TA 3Q9VA 1W7PB 5DCFA 4DQ2A 4I02A 1XMAA 1TBXA 4NQWA 3VB2A 2LF8A 3ZQ7A 4HF2A 4OMYA 2RVCA 5AIPA 3S2WA 2OA4A 3V4GA 2FQ3A 4G6DA 2L01A 4EM1A 2PN6A 2K27A 1FSEA 3GFJA 3HOTA 1IAWA 3ZMZA 3HHGA 1FOKA 3ABUA 2EK5A 1LDJA 2L54A 1GVJA 2OU2A 3FZVA 3KP5A 4HBLA 5LGNA 3ZMSA 2A07F 3JSPA 3R0AA 1LNWA 4N9IA 3F6VA 5DCMA 1TNSA 2DU9A 4A0XA 4XSXF 5EEGA 1LVAA 1XSDA 3E5UA 1USSA 2F5FA 3P9CA 3QP5A 5FFZA 2XHKA 3CUQC 5HLGA 1HKTA 3HSRA 3LSTA 2UWMA 4EJUA 2R7DA 1MDMB 2DFIA 3WTTC 2MLKA 2WC2A 2HYFA 2FEZA 2XAFA 1IXRC 4LK0F 3KP3A 2MH2A 1YS6A 3O2PE 4U7BA 3GLXA 3E6CC 2FA5A 4P96A 2ESNA 5LEKA 2JPBA 4L0YB 2WWYA 2DK5A 2L4AA 1LDDA 2V79A 5K5OA 4UV9A 1L0OC 3BDDA 1S6LA 4WWCA 5KVRA 1BIAA 1B1BA 1IXCA 2QZ8A 1BI1A 4Q47A 2PI0A 5D8LB 2DPUA 3DF8A 1UFMA 2PBIA 2EFNA 4LGWA 1S8NA 1KU3A 1K6OA 2FE3A 2YPRA 5J8CA 1YTYA 4XRFA 2EJRA 1AOYA 2J5PA 5F1RA 4I98B 3EQLF 2QQ9A 4LLGF 3I5UA 4LLLA 3F8CA 2XRNA 1WKMA 4HQMA 2ZO4A 4IRIA 2LDUA 4G8XA 3ZN0A 1XCVA 3TOAA 2BBYA 4RB3C 3ECHA 3F8FA 1BC8C 1D8JA 1WI9A 5FLXZ 5FGMA 5JVTA 1O7LA 1USTA 4BHBA 5DUKA 3KLNA 3J81Z 1TQIA 4KT5C 2NNYA 3ABTA 4EJOA 4LG0A 2CFXA 3IWZA 3WTZA 1Y0UA 1KYZA 5E8GA 1YS7A 1U8RA 2NRAC 4LLNA 1R5GA 1XSVA 3ZMVA 1DUXC 3RDIA 3HSEA 1I27A 4YG2F 3SQNA 1XGNA 5ED4A 1A04A 1B9NA 4WXHA 4GO1A 1K78B 1CF7A 5K5RA 2HGCA 1V4RA 2CW0F 4KNYA 1E17A 4M72A 2Y75A 2IP2A 4P9FA 1S3JA 2O3FA 1UB9A 5DDGA 1J75A 2L3DA 5LGUA 1OYIA 3V7CA 4M6YA 4QWQA 3BROA 1KU9A 3M7GA 2G9WA 5ERIA 1P4AA 1T39A 4R79A 1MD0A 1FT9A 3BOQA 2QWWA 3WE3A 2KIFA 1O3SA 1SFEA 4ESBA 1R00A 2DI3A 1FP2A 2Y0MA 3FMSA 1YIOA 2F2EA 4ZYHA 4QLCU 3LAJA 4RGRA 4GXOA 3CUQA 3M8FA 4HZFA 2DQRA 1JHFA 2XKPA 3W6KB 4L9NA 3ISPA 2GAUA 2XROA 1JGSA 5DD4A 1KQ0A 4HYEA 4OU0A 2P8TA 3KE2A 1BIBA 2KIMA 4KUMA 4P5OA 2VN2A 3IL2A 1TQMA 1EH7A 4G9YA 1Z1DA 1F5TA 4WCGA 3V8JA 3FMRA 2RGVA 1MZBA 4IRGA 1TQPA 3BPVA 1VTNC 1FWZA 4HV5A 4CO8A 1IF1A 1PUEE 3G3ZA 4JK1X 4U88A 4N9HA 2M45A 2O61A 3H92A 3C1DA 2UXNA 4GYGA 3HUGA 4IRHA 1R7JA 3PFIA 3I53A 4MEYF 3ZMTA 1KGSA 1WWXA 1RIOH 2Q8KA 2NYXA 1T2KA 2D1VA 4ESFA 4RAZA 3TDUC 2VODA 1P4WA 3SZTA 2VC0A 2DTRA 2YX4A 4PCQA 2K86A 1BC7C 1OPCA 2ZMEB 4U0VA 2ADUA 1L3LA 1LQ1A 4L18B 1LDKB 1B9MA 3C3WA 4A2UA 4ASNA 1KQ9A 1WQ2A 1BJAA 2H94A 2QBYB 4AVPA 4E70A 2Z9OA 4RB0A 1FYLA 1C0WA 1ZRFA 1ON2A 5D6FA 4KDPA 1FP1D 1QGPA 2PEXA 1S29A 3F22A 2FNPA 1QBJA 1J7KA 4RAYA 3GF2A 4UVCA 2HTJA 4DNCA 1IN4A 4HOBA 2EA4A 1RUNA 1YG2A 2FOKA 4EMSA 5IT3A 1W4MA 4KIBA 1GXPA 3M8EA 4HQEA 1KU7A 5J8FA 4P9UA 1F9NA 2KJBA 3LWFA 1HQCA 3E97A 3GWZA 3CJNA 4S05A 2QVOA 5EEHA 5ICEA 1QO0D 5CVRA 4OIRF 2H09A 5JFRA 3P9IA 3DEUA 1MJBA 2ELHA 2HS5A 1IRFA 3G73A 4LD5A 3QRFF 2TDXA 5DCMB 2Y48A 4BQAA 3MCZA 2QM3A 4CHUA 1Z7UA 4UUVA 1TW3A 3QP6A 2LSOA 2XAGA 4ZYDA 2O8XA 3MWMA 4L9TA 3U1DA 2HTSA 2M5WA 2V9VA 4Q4ZF 2EV6A 5F64A 2E1NA 4Z2YA 3E6MA 1W5TA 1O7FA 1HKSA 3V7SA 1YW7A 2P6SA 4HX8A 4ZH4F 5CJ9A 1WRJA 4F7ZA 4EV0A 5L3CA 2M1BA 1FBSA 2PMUA 1O3RA 2BYVE 3FX3A 3KZYA 4ZZLA 4KMFA 2FMYA 4ENMA 3C7JA 3WTWC 3GZ5A 2PLYA 1XB4A 5CVVA 4WF2A 1FNNA 1EV7A 1T6SA 1RI7A 3WTYC 3LA3A 2OQGA 2COMA 5HVQC 3ROUA 1SAXA 2LF7A 1J2XA 4IVNA 4KA4A 4CDGA 3E5XA 2CYYA 4UV8A 4G7HF 3GUDA 2FBIA 2L4MA 4U0WA 4IXAA 2MA3A 2RC4A 1YW9A 3WU0A 4L5IA 5BPDA 2CO5A 1R1UA 3K1MA 4M74A 2Z5UA 1PP7U 3D0SA 3I54A 1J0RA 2QQBA 2OBPA 2PJPA 1FLIA 3E3VA 1YFHA 5AONA 5KK1A 5E17F 2AXLA 1I1SA 5CYVA 3ZN1A 2Q2EA 2OZUA 5HDGA 2VC1A 5HLIA 4M9XA 2VE8A 2CSOA 2AS5F 4LG0B 1U2WA 3WGHA 1B6AA 4RGSA 3FF5A 4UVAA 2C6YA 5D5VB 4EJWA 4G7ZF 2H27A 5A2QK 1DDNA 3GXOA 4OINF 2ACJA 4M71A 1Z9CA 3W6JB 3WGGA 2ZFWA 1U3EM 1MGTA 5BQTA 5FD5A 5F6FA 4MNUA 2PFBA 3IKVA 3KCCA 2GA2A 1ZG1A 3P7NA 3T8RA 2HR3A 2IPQX 5ILUA 5K5QA 4PGHA 2BE5F 4MGRA 1R5HA 3M9AA 2R3SA 2V1XA 1W7PA 5CVIA 4MQVA 2EA2A 1JHHA 4ON0A 4BHCA 2P5KA 2OZ6A 2IRFG 4EVIA 1KA8A 3LA2A 4IHSA 3HSFA 5J6XA 3O6BB 1G6NA 2XAQA 4EJTA 3LFKA 5ICCA 4NB5A 1U78A 2KIUA 2HKXA 1NHAA 4O3MA 4L5JA 4AIKA 3D5LA 4FHTA 5H6QA 1FYMA 3V8LA 1DP7P 1SD6A 4TV7A 1QZYA 1QZZA 1G3TA 2STTA 1PDNC 3BPXA 4ENNA 3KP2A 1E2XA 2P5VA 3NRVA 4M73A 3CUQB 4MQ9F 3J7AO 3F23A 1S7OA 1KYWA 3GYHX 4B8XA 3QAHA 3B02A 1T0FA 4MEXF 1J9IA 3NQOA 4RB1A 2RNJA 2H6BA 3MEXA 1TNTA 3IRQA 1XMKA 2HOEA 4OIPF 3R61A 2Z99A 5E1XA 3CLOA 2P7VB 3VODA 5CLSA 1U5TC 3K1PA 2W24A 1ZAOA 2M87A 1P6RA 3I4PA 4L9JA 1ODDA 5FFXA 4XBFA 5L3BA 4OOIA 3HRTA 1XGOA 3RIRA 4KYWA 3TKYA 3GFMA 4LB5A 5HS8A 2RDPA 5H6RA 1XD7A 2EFPA 3GW2A 4RGUA 3I0TA 4I0BA 3PQJA 4G7OF 1IW7F 1XDSA 5HDKA 3QU3A 5LHGA 1FSHA 5HS7A 1STZA 4OMZA 1R1VA 3WGIA 2GXBA 1IZ1A 3EDPA 4M9ZA 4G6QA 2QLZA 3MFKA 4ZZDA 4HDUA 3DP7A 2DW4A 2D45A 4MTEA 2X4HA 2XAJA 4EJVA 3JSOA 3DXJF 3FXQA 2XKOA 2W57A 1TLHB 4UVBA 2HYGD 3I59A 1UHMA 2JPCA 2JZYA 1ZREA 5JHUA 2RQPA 3HOSA 3RKWA 1I5ZA 1B4AA 1IN7A 3DQVC 5H20A 3HRSA 2KJCA 5E1WA 2QQAA 3ELKA 1O3QA 3MZYA 3H3UA 2XUBA 4IHTA 4P55A 5K1YA 4LB6B 1GHCA 3GZ6A 5D4SA 1HW5A 4UHTA 1BBYA 3RPQA 3JAMZ 4PGGA 2DBBA 3VOEA 1RNLA 4XSZF 1BI0A 1XSXA 4PDKA 3I71A 3DPTA 1FC3A 1H0MA 1IRGA 4GCVA 3QPHA 2W85A 3WTXC 5E20A 2P4WA 2J5OA 2YR2A 4BNCA 4D0PA 3CDHA 4ETSA 4IPAA 2A6HF 2YSRA 1B59A 1JE8A 5BOXA 3FM3A 5A2QZ 1FBQA 2M8EA 2OAZA 1ZG5A 4I7HA 1FX7A 3BJAA 3FMQA 3CO7C 2E7WA 3TDZC 3U9GA 2V1DA 3WODF 3T0YA 4NHJA 3CTAA 3IRRA 2XIGA 4WXDA 1W7PD 4U0YA 3I58A 3BP8A 4A6DA 1KU2A 3Q5FA 2VBZA 4OIQF 2P6TA 4EGZA 1XCBA 3RPUA 3P9KA 4BAYA 1G3WA 2HQNA 2GWRA 3SZPA 1UHWA 1D8KA 1KQ8A 3GO5A 4HX7A 3N4MA 2DQLA 3BJOA 2NAZA 2A5YB 3QOPA 4BXUA 4L9VA 2Z3YA 5DV5A 3FXUA 1FPQA 1U5TA 4L0ZB 2BV6A 1H9TA 3FHZA 2M30A 2O6GE 3TQNA 1SMYF 3K0LA 4CXFA 1JXSA 4I09A 3IC7A 1PP8F 2VOOA 2H6CA 2NNNA 4AIJA 4HV6A 3ULQB 4ZYEA 3IWFA 2E1CA 1ZGJA 2ESHA 2WV0A 3H3ZA 1ZHFA 2ZNZA 2EFQA 4AWXB 3GFIA 5LHIA 5TRDA 2ISYA 3F8NA 5ILVA 2NS0A 1Z6RA 4RB2C 3DKWA 1QPMA 4CYDA 3HYIA 4EQQA 2XAHA 1EH6A 3NEUA 5D6EA 1CGPA 3DV8A 4Q48A 3ZPLA 1WSUA 2QENA 4MTDA 3ZMUA 2XVCA 4M6XA 4BHPA 4GYIA 2FF4A 2CQKA 3DFGA 2G7UA 1R22A 4XLPF 1Q1HA 1R58A 3R60A 1U6GA 2VT3A 3ECOA 2IT0A 3HTUA 2YX7A 4HW0A 1GXQA 2HKOA 5L3DA 2MBFA 2UXXA 3N97A 2DO7A 4ENJA 4RGXA 2Q0OA 4Q5SF 2FNAA 1S7AA 2F5CA 3KP4A 3KP7A 4AD9A 1SMTA 1V3FA 1SD7A 2QBYA 4O5VA 2IA1A 2GA1A 3WTVC 3Q9SA 4HX4A 2P5LC 1O57A 1ZYRF 5HS9A 2DAOA 4B09A 4A6EA 3E6BA 2B0LA 2FXAA 5L3GA 4Y17A 3QPTA 1ZRCA 4LK1F 4N0BA 1YW8A 1XGSA 3DPLC 1BM9A 1OYYA 3J80K 2O03A 4BYYA 2R7FA 1ZH5A 2ZCWA 2K7LA 3FM5A 2OQRA 3WTUC 3EUHA 5IT9Z 3L00A 2FBKA 4FT8A 3JAMK 4U7DA 3SFZA 4KICA 5LRRA 4HF0A 2JRTA 1YLFA 3LQRA 2WTEA 4YIFA 3GVAA 4R8HA 3K1NA 3IKTA 4A0YA 5D5UB 1P4XA 4XLNF 3KZZA 2IVMA 2PMHA 3L2CA 3F8MA 2EV5A 2XASA 5FO5A 3F8BA 5ICFA 4WX9A 2GQQA 4CICA 3JTHA 5D8KB 1SFUA 1HXDA 1BOAA 5DEQA 2VE9A 2O0YA 5D5XB 1CF7B 1DPUA 5LLQA 1REPC 5CVJA 1HKQA 3LQQA 2QUFA 3F21A 1T98A 3F3XA 2IA2A 5JR3A 2VT2A 2A69F 3EETA 3K9TA 2IW5A 2K02A 4Y13A 3F6OA 2HDCA 4CGZA 5BS6A 2QYOA 5BMZA 2MC3A 3I64A 2F5DA 2MH9A 1FBUA 1XN7A 4ENKA 2RKHA 1LEBA 2ZJ2A 3IHUA 1R23A 2JSCA 3KLOA 3MQ0A 2E7XA 3AAFA 1ULYA 2FRHA 1HSJA 3HTSB 1XDUA 2FBHA 2A3SA 1MJAA 3SHFA 1ZLKA 5E8IA 3K69A 3R6SA 3LAPA 2EWNA 2EV0A 3R0JA 3I59B 1D5VA 2IA0A 3RJPA 3HRUA 1J5YA 1ZLJA 5L3EA 1F1ZA 4S04A 4HLYA 5ICGA 4RS8A 3ERED 4HDVA 4KN4X 2DLLA 1TTYA 2CG4A 1LB2A 3C18A 4A0ZA 2VOPA 5FD6A 1MDMA 4YFKF 2STWA 5L3FA 2ZNYA 5E1ZB 2A61A 3FWEA 1YQAA 2RV8A 4A5MA 1ZG3A 4LMYA 4K2EA 4HA8A 4KMUX 3KETA 1MJ9A 4PZJA 4KFCA 2K4JA 1MKMA 4IJAA 4EM2A 1OYWA 3GEZA 2IJLA 5DUIA
chains in the Genus database with same CATH superfamily
1BI3A 2D2WA 2DK8A 3HUGB 2VI6A 4XR6A 3KEQA 4UB6C 1E3PA 4JQFA 1YO5C 1HW1A 1WH7A 1HCRA 2ZFUA 4NC8A 2HVSA 3VFZA 1S5LC 3JR9A 1W5SA 1R1TA 2FU4A 2ZC2A 3FIWA 4RM2A 5FLMJ 1ON1A 1P2FA 3HM5A 2ZXJA 1FOYA 2FMLA 1QHGA 5J4YA 2UZKA 4PFPA 2TRTA 3PUFA 3CCUI 1G4DA 1YJWI 2O5RA 1YJNI 3BWGA 2HVRA 1K4SA 1WCMJ 3CUOA 1QQIA 2CQXA 4E7HA 1H9GA 2E1MB 2XF5A 3K2ZA 3QYEA 2LKPA 4B48A 3HIFA 2W84A 2FQ4A 2HQ5A 2I8DA 4XL9A 3WE2A 2EFOA 5E18F 2CWEA 4A5NA 2RAEA 2CUFA 2L0KA 2BY0A 4IOAF 2WB1A 2CQQA 1IN5A 3O3KA 3SFIA 5TGTA 4A12A 2ZJRF 4FX4A 2RN7A 1T08B 3L2UA 2BGCA 4A93J 2COBA 2PX9A 4JBAA 1MMGA 1HW2A 3SDGA 2FSWA 4RAFA 1K79A 1VI0A 3H1CA 5LGTA 1QHHD 1QZEA 3GTJJ 2GXGA 1LJ9A 2KRCA 2DMUA 3V7RA 3GFLA 1F4KA 5JLWA 1FOXA 3OYDA 1X3UA 2VONA 4BEHB 4GGGA 3RYRA 5HLHA 2YU9J 1GT0C 5FB2A 4KITB 4DGWB 5IT9K 3BTJA 2LY2A 2PG4A 3BZ6A 2ZMEC 3V8KA 4KN7X 1WPKA 4RM3A 3J80Z 3TO7A 2BEOA 2WY7Q 2NOGA 2IGOA 2JK3A 3RKXA 4QTRA 2LVSA 1GLNA 3MAJA 3GTLJ 3HOYJ 1G3YA 1LPQA 1U5TB 2M3AA 4HSRA 5EDNA 2A68F 3KZIC 4LJZF 4Y15A 2JTVA 1A6IA 3I56I 1DU6A 3K4KA 1JGGA 2XGEA 1I6XA 3PO3J 1ZARA 3I55I 2AQEA 2Z33A 2KRFA 3KFWX 3WG9A 4AIHA 3OSGA 3ABMH 3WHCA 4YEJA 1D3YA 5LHHA 2HWVA 2M4KA 2L02A 1FYKA 1R6RA 5F04A 5KAIC 3RZDJ 1VFCA 3TGNA 1K78A 1IXSB 1YYVA 1WGXA 3E5QA 3HGYA 4MHGA 2HOSA 2YUSA 1ZK8A 3BY6A 2E60A 2JUGA 1O3TA 4UUTA 2GIVA 4YIIA 4IOCF 2D1HA 3HG9A 3WTSC 1AHDP 3L7WA 3ZQGA 3PQKA 4O6JA 3RTRA 1D0YA 4EGYA 4XICA 1SD5A 3FXRA 3M1EA 3VEPA 6PAXA 2ZSIB 4RLFA 5F27A 3TO6A 1ENHA 2DPDA 1VNDA 2K4BA 1ZN2A 3ML6A 3EUHC 3GX4X 4BH9A 5CQGA 4WK8F 3QU6A 1IN8A 1RRJA 4YFNF 4UNOA 1SVOA 2FOWA 3TOBA 1XMXA 3EYIA 1Z77A 1IDZA 1TW2A 4EEFG 4I6ZA 1LKXA 5CVUA 4BE1A 2CV0A 1G3SA 1MW7A 4UXNA 2MYSA 3DPUA 1BW5A 3L9FA 5HNHA 1EH8A 3D5RC 2L7KA 1Z05A 5F08A 3ZP5A 1D0XA 4NC7A 2F5EA 5FKMA 3L1PA 3D1NI 1UCRA 2VBXA 2HFHA 2VXZA 1SD4A 3HHHA 3HRMA 1W36D 2EB7A 1D1AA 2K40A 3VYUB 3L09A 3SEQA 5LEJA 2V6CA 5HDNA 3KP6A 4Y3OA 2ELKA 1P92A 1TWCJ 2DN0A 4I0AA 4LIVA 2ICWG 4PK4A 2ZKZA 3SXYA 2QQ8A 4KIGA 3TMOA 5LBQA 4BKXA 2XPUA 2QCOA 2MLGA 5LRSA 2CUJA 5K7FA 4ESJA 2V1UA 2VBWA 1Z91A 3JREA 4FX0A 3EYYA 1SFXA 4CSWA 1AWCA 2LRDA 3RI4A 1OMIA 2FD5A 2QKLB 2XGXA 2M7BA 2PQ8A 1DGWY 1IUYA 5JI6A 1FTTA 3IAS2 3JTGA 3UR3C 1PUFA 5D4RA 3TW6A 3L2WA 5AIQA 1VQNI 4FETA 5F0HA 2OD5A 1FTZA 2W25A 1BI2A 2MSYA 1U0JA 4I2OA 1WJDA 4LFUA 2LK2A 3K4NA 3WU1B 5BPIA 2EFWA 3T1BA 3HL2A 3ZMDA 1H88C 2ZBKA 4AYBA 1FY7A 3T5XA 3LL7A 1TT0A 1T38A 3JW4A 5K7ZA 1J59A 2GZWA 2G7HA 5DD8A 4OIOF 4HLXA 2ETHA 3B6AA 2ISZA 2R7OA 1I50J 5FLXK 4A3BJ 3DCFA 4CA0A 3E6DA 5D5WB 3S1NJ 3J81K 4B4CA 1FIAA 4BE0A 2VBYA 2Y2ZA 4YFXF 3LSRA 5GTIC 2DMQA 3KPHA 4XM3A 2CFOA 2A5WA 2MD5A 2OCCH 2Z16A 4EM0B 3SJMA 2JT1A 3F72A 4HAMA 5ILSA 3B73A 1FZPB 2CUZA 1DPRA 2KQRA 2XGCA 1ZGAA 2R7SA 3OOPA 1QNTA 2CU7A 3U2RA 1IN6A 2HQRA 3OWTA 3ZR8X 4D7NA 4IHXA 4E7KA 1W5CC 4G94A 2XDVA 4IF4A 2CGPA 4E4HA 2R5ZB 1YHQI 3TO9A 1I1GA 4H0EA 2Q2EB 1UG0A 1HBXG 3LA7A 4R1HA 4G6TB 3QOEA 5J4VA 3RYPA 1XX5A 3BJ6A 2WA0A 4XRMA 4C9YA 4CH7A 1ZQ3P 3MZHA 3SYTA 2DT5A 1LEAA 2XB0X 3CO6C 4FQGA 5TISC 3REOA 1XG1A 2ECBA 4HF1A 5BNGA 2AHQA 2HPIA 3BR0A 1MH3A 1BN5A 1A35A 2YU3A 1K7AA 3OYAA 1R36A 3X2QH 2ELJA 4WXCA 2A6EF 2KMUA 4I01A 2VLAA 4CZZA 2LNBA 5DYMA 2HZTA 4KISA 1ZRDA 2NVUB 5EGOB 1XGMA 3RKYA 3COAC 3FKJA 5IYCJ 1ONVA 3OV8A 3HOZJ 4ZYGA 5HOOA 4M9SA 2E71A 2ZMEA 2QA4I 2X0LA 2AXTC 1FEXA 1RZ4A 2CH0A 1OR7A 3KEOA 5TJJA 4M3EA 2DXIA 1HSTA 3EUAA 1JJ8C 3R4KA 1NK2P 1APLC 2HEOA 1MMDA 4QPOA 3CCMI 3BQYA 1ZELA 2E36A 4KIFA 4OAYA 1OKRA 1RUOA 3VYSB 3CCEI 2KKOA 1Z6TA 2XV4S 3MKLA 2X6OA 5J3LA 2P7CB 4E6KG 2MABA 3T8TA 3Q9VA 3BTLA 4M6VA 4A3GJ 3P5JA 1W7PB 3JRFA 5DCFA 4BBSJ 2JA2A 3LSMA 4DQ2A 3G71I 4I02A 1S9HA 2E34A 2MFZA 1XMAA 1LFBA 4Y7NJ 2F48A 4DZJA 1TBXA 4Z6YA 2M34A 1Z21A 4C3IJ 5B3SH 1MBJA 2K9MA 3IH4A 1JUMA 4NQWA 3VB2A 3LNQA 2O7OA 1OLTA 2LF8A 3OYKA 3ZQ7A 4HF2A 4OMYA 2DA2A 2ECCA 2RVCA 3CP2A 1MNMC 5AIPA 3S2WA 2OA4A 2DDAA 5GP9A 3V4GA 2FQ3A 4G6DA 2KISA 2L01A 2VUMJ 4EM1A 2Y69H 2PN6A 4C2TA 1ETKA 2K27A 1FSEA 1MMAA 3GFJA 3K2AA 2QGUA 1B72A 3HOTA 1IAWA 3ZMZA 3HHGA 1FOKA 2RQQA 1HDPA 3ABUA 1ERDA 2EK5A 3HOVJ 2X6YA 1H8AC 1LDJA 2L54A 1GVJA 2OU2A 2CQ7A 1X2NA 3FZVA 3KP5A 4HBLA 5LGNA 4XNFA 3ZMSA 3VYRB 2A07F 3JSPA 3E0JB 3R0AA 1LNWA 1YITI 1XS9A 4B44A 4UY8I 4N9IA 2V9KA 3DTKA 1H89C 1U9OA 3S3MA 3F6VA 3LMMA 5DCMA 1TNSA 3OIQA 2DU9A 4A0XA 2I10A 2VKEA 4XSXF 4F55A 1SVLA 5EEGA 1LVAA 2OV7A 1XSDA 3E5UA 1USSA 2F5FA 3P9CA 3QP5A 4DZPA 1AKHA 5FFZA 1R49A 2XHKA 3CUQC 5HLGA 1HKTA 3PM1A 1ZR2A 3HSRA 3LSTA 2UWMA 3HOWJ 2KFDA 2EIKH 3DLAA 2HZDA 2ZXWH 4EJUA 1ETQA 1K4TA 2R7DA 1MDMB 2DFIA 3WTTC 5LFAA 2OF7A 3G1OA 3GTGJ 2MLKA 2WC2A 2R7RA 3S1MJ 2VQLA 5E3LA 2HYFA 3CD6I 4JOMA 2BHZA 2FEZA 4FE7A 1N75A 3BZCA 3I4MJ 1IXRC 2XAFA 3M07A 1E0EA 3CCQI 1D1CA 3MZ8A 4LK0F 3KP3A 1LFPA 1UMQA 1WZ2A 2MH2A 1YS6A 3O2PE 2KZVA 1WJFA 4U7BA 3GLXA 3I9V2 3E6CC 1HOMA 2FA5A 2VASA 4P96A 3CF2A 2QSFX 2ESNA 1B8IA 5LEKA 2JPBA 3PJRA 4L0YB 2WWYA 3S16J 2DK5A 2L4AA 1IUFA 1SFKA 4BGDA 3GZNB 1RPWA 4RLQA 4A3EJ 1LDDA 2V79A 5K5OA 3CCVI 3S17J 4UV9A 2XPVA 1L0OC 3A01B 3BDDA 1S6LA 5DM6F 2ZSHB 3QPLA 4WWCA 5B1BH 1GDTA 2X85A 4PSXA 5KVRA 1BIAA 1B1BA 1IXCA 5KAFC 2QZ8A 1BI1A 3O8GA 4Q47A 3OYHA 2PI0A 4X6AJ 3S8PA 5D8LB 3DF8A 1UFMA 2F4MB 2DPUA 2PBIA 2EFNA 4LGWA 3DKXA 2X6XA 1S8NA 1KU3A 1K6OA 2FE3A 2YPRA 5J8CA 2K9NA 5KHDA 1YTYA 4XRFA 2EJRA 1AOYA 2J5PA 5F1RA 4I98B 3EQLF 5EZGA 2QQ9A 4LLGF 3I5UA 2HVQA 2MD0A 4LLLA 2HNHA 4BU2A 4QIWN 3F8CA 2XRNA 1WKMA 3BG3A 4HQMA 4QPQA 5M3FJ 1X4PA 1KONA 3LSHA 2DMNA 2ZO4A 3ZQQA 1BL0A 4IRIA 2R7UA 5GAHJ 2LDUA 2Z2SB 4G8XA 3ZN0A 4A69C 1XCVA 3TOAA 5GADJ 4HPQA 4M3FA 2D5VA 2DT6A 2BBYA 4RB3C 3VPRA 3KEYA 4XLCA 3ECHA 3F8FA 4IL6C 4QSHA 1BC8C 1D8JA 2ZJQF 1WI9A 2Y0SN 5FLXZ 1QVTA 5FGMA 5JVTA 1O7LA 1USTA 4BHBA 5DUKA 3KLNA 3J81Z 1I3QJ 1TQIA 3DTEA 3SZGA 4A3DJ 4KT5C 2NNYA 3CMEI 2FJ1A 3ABTA 2VPRA 3FISA 4V19K 4EJOA 4YIRX 4PSWA 1ACIA 4BDYA 4ZTFA 2KDZA 4LG0A 2CFXA 5FRNA 3IWZA 3WTZA 1WH5A 1Y0UA 3HKZN 1KYZA 2WY8Q 5E8GA 4BJ5C 1YS7A 1U8RA 2DJIA 2NRAC 4LLNA 2XRLA 1R5GA 1XSVA 4F3QA 1OJLA 3G2BA 3ZMVA 1DUXC 2OTJI 3K4MA 3HSEA 3RDIA 3DBRB 1I27A 4YG2F 2L7MP 3SQNA 5K7HA 1XGNA 2JVGA 3WHBA 5ED4A 2F5VA 1A04A 1N25A 1RKTA 1B9NA 2EZLA 2M7AA 3CP8A 2R7ZJ 4WXHA 4GO1A 1K78B 4OAZA 1CF7A 5K5RA 5C44J 2LREA 2HGCA 1Y6IA 1V4RA 2CW0F 1RC9A 2CW8A 4AU7A 4KNYA 3BCBA 3CMMA 3CLQA 1E17A 1JT6A 2WBMA 1TT5B 5CKTA 4M72A 4B47A 2Y75A 4FISA 3W2WA 2OUMA 2IP2A 4P9FA 4D5CA 1S3JA 4RBOA 5B5EC 1HA8A 2O3FA 1UB9A 5DDGA 3JRAA 1IJWC 1J75A 2GM4A 4DJAA 2L3DA 5LGUA 1OYIA 4FTHA 2VJ5A 3V7CA 1K6YA 4N4NB 4MFDA 4JX5A 4M6YA 4QWQA 3BROA 1UJ8A 1KU9A 3CESA 3M7GA 1RR8C 2G9WA 1IG7A 3OYCA 3OIPA 5ERIA 5EG0A 3OS1A 3DLLF 4MFEA 1NH3A 1P4AA 2O8KA 2VQHA 1T39A 4R79A 2OJED 1MD0A 2RNGA 2LP0A 1FT9A 3BOQA 4X0GA 2QWWA 3WE3A 4XIDA 1UG2A 2K9QA 1UELB 2KIFA 1O3SA 1SFEA 4DYCA 1OCTC 4ESBA 2BY1A 2XGDA 4UUSA 3ZQLA 1R00A 2DI3A 4DYRA 2JSPA 1FP2A 5FLVA 3CQZJ 1VQKI 1BJZA 2Y0MA 3FMSA 2BXZA 4RAGA 2LD5A 2VPLA 1YIOA 1HLVA 2F2EA 3A4CA 4E7ZA 4ZYHA 2EZKA 4QLCU 5GTHC 1V55H 3H0DA 2R5YA 3GMEA 4AIDA 1R71A 4LG3A 4XONA 4IHWA 3LAJA 3FXKA 3RCOA 4RGRA 1Z3YA 3LSJA 4GXOA 3F0CA 3G6EI 3CUQA 2CMPA 3M8FA 4HZFA 2K85A 1OR7C 2DQRA 4XN3A 3IP4B 1JHFA 1DGRM 2XKPA 3W6KB 1R4MB 5E3OA 4L9NA 3ISPA 2GAUA 2XROA 2B9SA 3H5AA 2X1DA 1JGSA 2IS4A 5DD4A 1KQ0A 3M8JA 4HYEA 4OU0A 3QODA 2CW7A 3CC2I 4BBRJ 2P8TA 3KE2A 4DOZA 1BIBA 4RA2A 2KIMA 4KUMA 2VKVA 4P5OA 4BQQA 2VN2A 2DOEA 3IL2A 2L5QA 1TQMA 1EH7A 1IRZA 4G9YA 1Z1DA 1QVUA 2JWTA 1UHSA 4J19A 1F5TA 3V8JA 2L7ZA 4WCGA 3FMRA 4F92B 1VQ7I 2RGVA 1MZBA 4RMNA 3RZOJ 4IRGA 1TQPA 3BPVA 1VTNC 1FWZA 3BR6A 4HV5A 1X3ZB 1MSFC 3Q0WA 4CO8A 1IF1A 1PUEE 3G3ZA 2EZIA 4JK1X 4U88A 3E7LA 2E2IJ 4N9HA 2M45A 5E3MA 2O61A 3BG7A 3H92A 1A36A 2L7FP 3C1DA 2UXNA 4RDUA 4GYGA 3HUGA 4IRHA 2HU9A 1R7JA 3PFIA 2LYCA 3I53A 4MEYF 3ZMTA 2IS2A 1KGSA 2KLOA 2DJNA 3CCYA 4XK4A 1WWXA 4EATA 1HC8A 1ETVA 1V54H 1MBEA 2WADA 2E5NA 1RIOH 4ZYAA 2XB5A 2Q8KA 2NYXA 3JRGA 1T2KA 3AG3H 2D1VA 4DYQA 4ESFA 2BW3A 4W97A 2BOLA 4F52A 5E79C 3VYTB 5HNFA 4GRIA 1W0UA 3KYLA 4RAZA 3TDUC 2LY1A 2VODA 1E3OC 1P4WA 3SZTA 1EF4A 2VC0A 5FKOA 2DTRA 5E3NA 1MNEA 3CC7I 3ZQHA 2YX4A 4PCQA 4XKWA 2K86A 3S3OA 3K6GA 1JKOC 3J7AY 4YRVA 1BC7C 1OPCA 2ZMEB 4U0VA 2ADUA 5F0FA 1WFXA 1LQ1A 1L3LA 1R9TJ 3FXMA 4D9JA 4L18B 1LDKB 2FUG2 2H8RA 1NK3P 1B9MA 1V5EA 3C3WA 5IYBJ 4A2UA 4ASNA 1KQ9A 2EINH 2CRGA 2KPMA 1OISA 1WQ2A 1BJAA 2H94A 3OOUA 3HOUJ 2QBYB 4BQOA 4AVPA 2BZTA 4E70A 1BR4A 2Z9OA 4RB0A 3TEDA 1FYLA 5IOYA 2N8GA 4BEHA 1C0WA 2H8WA 1ZRFA 3HDDA 3PSFA 1NG7A 1P7JA 2P81A 1ON2A 5D6FA 4KDPA 1FP1D 1QGPA 1X1AA 4C2UA 2PEXA 3EPZA 2QSGX 2A6TA 3PNYA 3GLLA 1S29A 3OYIA 1EJ9A 5C4XJ 3H36A 4NDLA 3F22A 4NC6A 2FNPA 2E1OA 1G59A 4BJTA 2M4GA 1LFUP 2DMTA 5J47A 1QBJA 1J7KA 5J1RA 1LVKA 4RAYA 3GF2A 4UVCA 3BZKA 3GCMA 2HTJA 3OL3A 4DNCA 4JX6A 1IN4A 3A2KA 3S15J 4HOBA 4NQWB 2OPTA 2EA4A 1RUNA 1YG2A 2FOKA 4EMSA 2UUZA 2WV1A 5IT3A 2KT0A 1W4MA 1SVMA 2YS9A 4KIBA 2DODA 1GXPA 3ZGKA 3M8EA 4HQEA 3OYNA 3GTOJ 2RREA 1SC7A 1KU7A 2BVLA 5J8FA 4P9UA 1F9NA 1Y8QB 2KJBA 3LWFA 1HQCA 3E97A 3GWZA 3CJNA 1RETA 2A05A 3O8HA 4S05A 2QVOA 5EEHA 3TW7A 3M3YJ 5GPAA 4D5FA 2IBDA 5ICEA 1QO0D 2NS7A 3CDIA 5CVRA 4W1UA 4KJZA 4OIRF 2H09A 3CCSI 3EUKL 4GFBA 5JFRA 3P9IA 3K10A 2Z1DA 3DEUA 4A3MJ 1MJBA 3DTIA 2ELHA 2HS5A 3DU5A 1IRFA 2PJRA 3G73A 4LD5A 3QRFF 2TDXA 5DCMB 2Y48A 4BQAA 3MCZA 1HDDC 4IHYA 2QM3A 4CHUA 1Z7UA 2H1LA 5M5WJ 4UUVA 4F93B 4PFOA 1TW3A 1AKHB 1VF9A 4Y4RA 2EIJH 3NAUA 3QP6A 2LSOA 2XAGA 4ZYDA 2Y0SA 2O8XA 3K4JA 1JKRC 3MWMA 4L9TA 3U1DA 2HTSA 1JUPA 1Y1WJ 1I6HJ 2M5WA 2V9VA 2VJJA 4Q4ZF 2DDBA 5FKNA 4H4KC 3AL0C 2EV6A 2MW8A 3DWLE 5F64A 3L2VA 4Y52J 3RQIA 2E1NA 4Z2YA 3E6MA 1W5TA 3C2HA 1O7FA 4NNJA 4NUBA 1HKSA 4PJMA 2R7WA 3V7SA 1YW7A 2P6SA 4HX8A 4IQ4A 3KX2A 4ZH4F 5CJ9A 1WRJA 3JRBA 4F7ZA 4EV0A 5L3CA 2M1BA 4D1QA 1Y1VJ 1FBSA 2LTPA 2PMUA 1O3RA 2BYVE 3FX3A 3KZYA 2EH3A 4ZZLA 1B8IB 4KMFA 2XF6A 5KCMA 2FMYA 4ENMA 3C7JA 3PNVA 3M1CA 4M3GA 3GZ5A 5J40A 3ZOBA 3G1MA 4AC0A 5JHFA 1XB4A 3WTWC 2PLYA 4P1WA 1OQYA 2CQNA 4II3A 2WAFA 5CVVA 1TL8A 2JJ7A 4WF2A 2DFEA 1FNNA 2HQAA 1EV7A 3BC8A 2HXIA 5J1YA 1T6SA 4HSTA 4UB8C 1RI7A 3WTYC 3LA3A 1YOVB 2OQGA 4JP0A 2COMA 3S1QJ 5HVQC 3ROUA 1SAXA 2LF7A 1V5GA 1J2XA 4IVNA 1VZ0A 4KA4A 4CDGA 3E5XA 2CYYA 4UV8A 3SDBA 4IHVA 1A5JA 4G7HF 4XKCA 2VJ4A 3GUDA 3NWSA 2FBIA 2L4MA 4U0WA 4A3KJ 4IXAA 3OYJA 3ZQCA 2MGQA 3HPHA 3S1RJ 2MA3A 2E2JJ 2RC4A 1YW9A 3WU0A 4L5IA 5BPDA 2CO5A 1GV2A 1R1UA 3K1MA 1U8BA 4M74A 1WI3A 3I3LA 2Z5UA 1PP7U 1Z7LA 3AFHA 3D0SA 3H9QA 3I54A 1J0RA 2QQBA 3E1SA 4AM3A 4CCKA 2OBPA 3CJQB 2JA8J 2B7EA 2PJPA 1FLIA 1IV8A 3E3VA 1YFHA 3ASOH 1R5ID 5HODA 5AONA 5KK1A 2E19A 5E17F 2AXLA 1I1SA 2M8GX 2IAIA 5CYVA 2VL8A 1RKWA 1FMWA 3ZN1A 1X1CA 2Q2EA 4XLHA 2OZUA 5HDGA 5M5XJ 3CMAI 4JYKA 2VC1A 3PNTA 3VSLA 2AQFA 1LE8A 1N78A 3QYBA 5HLIA 4M9XA 2VE8A 3DBLB 3BLYA 2CSOA 3TP0A 3A0HC 3HJEA 2AS5F 1JTXA 1JTYA 1U2WA 2IEKA 3WGHA 4LG0B 1B6AA 4RGSA 3VDXA 3FF5A 4DIQA 4HRIA 4UVAA 1WVRA 1ZKGA 2NVYJ 2C6YA 3CDLA 3BG5A 5D5VB 4EJWA 4G7ZF 2H27A 5A2QK 1DDNA 3GXOA 3LOCA 4OINF 2ACJA 1HF0A 4XLFA 4M71A 1Z9CA 3CCRI 1R4NB 5KNLA 3W6JB 3WGGA 1TWAJ 1U9NA 3HEFA 2ZFWA 1X4OA 1U3EM 1MGTA 5HLTA 2CV2A 1BA5A 5BQTA 4IKFA 5FD5A 5F6FA 2E2HJ 4MNUA 2PFBA 3IKVA 4IO9F 3KCCA 2GA2A 1ZG1A 1Y56A 4C2MJ 3P7NA 1ETOA 3FXJA 3T8RA 3PO2J 1X19A 2HR3A 2IPQX 5ILUA 5K5QA 3LSIA 5H2FC 4PGHA 1IRXA 2BE5F 3BG6A 4AYBN 2R7XA 4MGRA 1R5HA 1MBKA 3TL4X 2GBYA 3M9AA 2R3SA 1T8IA 3BT9A 2V1XA 4V2GA 1W7PA 5CVIA 3W3CA 4CCJA 4CCNA 2NS8A 4MQVA 2EA2A 1JHHA 3H0GJ 5B66C 4E7JA 2Y30A 3MKYB 4ON0A 4BHCA 4J00A 2MC4A 2P5KA 2VQGA 2OZ6A 2IRFG 2KIQA 4EVIA 1KA8A 1F36A 1J09A 3LA2A 4IHSA 5IP6A 3HSFA 5J6XA 3O6BB 1G6NA 2XAQA 2R0QC 4EJTA 3LFKA 5C3EJ 1BR2A 2DYSH 1OCRH 3BCAA 4D7MA 4MIMA 5ICCA 1X1PA 4UUSB 4NB5A 4DBQA 2OTLI 1U78A 2KIUA 2HKXA 1NHAA 1Y8RB 4O3MA 1N77A 4ZDOA 4JX4A 4L5JA 3A03A 4AIKA 3ABLH 3OYMA 1TWGJ 3D5LA 4FHTA 5H6QA 1FYMA 3V8LA 1DP7P 1SD6A 4TV7A 1YE9A 1QZYA 1QZZA 2E1MC 1D5YA 5M5YJ 1G3TA 2X9DA 2STTA 1G8XA 1PDNC 3BPXA 4ENNA 3KP2A 5M3MJ 1E2XA 5EEAA 4AVZA 2P5VA 5GPCA 3OS2A 1A6QA 3NRVA 2LBFA 4M73A 4XOTA 1EKEA 4XLAA 3CUQB 3F9KA 4MQ9F 3J7AO 1TWHJ 3F23A 1S7OA 1KYWA 1SEUA 2BHYA 3GYHX 2I5UA 4B8XA 3QAHA 3B02A 5LD2C 2DFFA 2JA6J 1T0FA 5EF6A 1IV6A 3NQOA 4RB1A 4MEXF 4FE4A 1J9IA 5IYDJ 2RNJA 1FOWA 2H6BA 1WHUA 5B1AH 3MEXA 4HNUA 1TNTA 3J7YJ 3OY9A 2KP6A 3IRQA 1XMKA 4F91B 3L2QA 2HOEA 3DBHB 4OIPF 3R61A 3BTIA 2DA3A 2Z99A 1IC8A 5E1XA 3RSNA 3I4NJ 3CLOA 2P7VB 3LFUA 3VODA 5CLSA 1U5TC 2CJJA 2JVHA 3K1PA 4PJNA 2W24A 4V2FA 2IGMA 1ZAOA 4LOCA 3ZCOA 1POGA 2GXAA 1JUSA 2M87A 2JQ7A 1P6RA 3I4PA 4L9JA 4BDZA 1ODDA 5FFXA 4XBFA 4DBRA 3S2HJ 5FKLA 5L3BA 4OOIA 3HRTA 1G2HA 2JA5J 3UNGC 1VQ8I 1XGOA 5FKKA 3RIRA 4KYWA 3TKYA 3GFMA 3PIPF 3JRDA 5HS8A 4LB5A 2RDPA 4AUXA 3BTCA 1MBGA 4MLOA 3OR2C 3IH2A 5H6RA 1XD7A 1OCOH 2EFPA 3GW2A 3U1KA 1NG6A 3LSKA 4RGUA 3CC4I 3I0TA 3A01A 3FKIJ 4I0BA 4X1EA 5IP7J 2DA1A 2R4GA 3PQJA 4G7OF 1IW7F 1XDSA 5HDKA 3QU3A 5LHGA 1FSHA 5HS7A 2DA7A 3LSPA 1JKQC 1STZA 1YI2I 1IDYA 2X48A 3MD2A 3ZQIA 4OMZA 1R1VA 3WU2C 3WGIA 2GXBA 1IZ1A 3EDPA 1IGNA 4M9ZA 3FHNA 4M3BA 4G6QA 4BE2A 2QLZA 1UAAA 3MFKA 1ETYA 2ZXIA 4ZZDA 2BW3B 4HDUA 3DP7A 4CUGA 3GTMJ 2DW4A 4B3XA 3HOXJ 4MTEA 2X4HA 2D45A 1W0TA 2XAJA 4EJVA 1T95A 3JSOA 2DTZA 1P7IA 5EYRA 3ESWB 4CYCA 5IY5H 3DXJF 3FXQA 1D1BA 2XKOA 2W57A 1TLHB 5DM7F 4UVBA 2LY9A 2HYGD 3I59A 4B43A 4LITA 2EILH 1UHMA 3H5NA 2JPCA 2JZYA 3QPSA 2VKHA 1ZREA 5JHUA 4XORA 2W4SA 2Y9ZA 2L9RA 2RQPA 5JVGF 1PUFB 2R7QA 2X1EA 2DOAA 3IV5A 3ZQFA 4B3AA 3HOSA 3RKWA 1I5ZA 1B4AA 4G12A 2R7VA 1QA6A 2GIZA 1IN7A 1MMSA 3DQVC 1K83J 4ZC3A 1ZTRA 5H20A 3HRSA 4C3HJ 2KJCA 4ZDPA 2QEXI 2XSDC 5E1WA 3K4BA 1GUUA 2QQAA 1QRYA 3ELKA 1Y39A 1MMNA 1OCCH 2V6EA 4ABZA 1O3QA 3MZYA 2KZGA 2XUBA 3H3UA 2K5CA 2KHMA 4BUPA 4P55A 4IHTA 5K1YA 3OIOA 4LB6B 3V42A 2WAQN 2F4IA 4XQFA 1GHCA 3GZ6A 1TZLA 3HC7A 5D4SA 1HW5A 3BR5A 1X1BA 4UHTA 1BBYA 2PMZN 3ABKH 3RPQA 3JAMZ 1A31A 4PGGA 2DBBA 3VOEA 3NARA 2LKSA 1RNLA 2XC7A 4XSZF 5IP9J 2P0WA 2VIXA 1XC5A 1BI0A 1XSXA 4PDKA 3I71A 3DPTA 1FC3A 1H0MA 2JN6A 2Q1ZB 3W6VA 2ME6A 1IRGA 1Y0NA 4GCVA 3QPHA 2W85A 4NBQA 3WTXC 3OYGA 1YRNA 1VQLI 3BG9A 1ETXA 5E20A 3K70D 2QSHX 2P4WA 3AG4H 1YX3A 2J5OA 2YR2A 3QYFA 1D0ZA 1Z67A 4BNCA 1BOBA 3OSFA 1JJ6C 2E35A 3DKYA 4D0PA 3CDHA 4ETSA 4IPAA 3CJRB 3HBLA 3ASNH 2IS6A 2A6HF 4PJJA 1FJLA 2YSRA 2IGKA 1B59A 1JE8A 3HPGA 4J01A 5BOXA 3FM3A 1DQUA 5A2QZ 1CQTA 1FBQA 2QKMB 3H9GA 2W00A 2R7TA 2M8EA 2OAZA 2VXDA 1T56A 1ZG5A 4IQJA 4I7HA 4C30A 1FX7A 3BJAA 2Y31A 2PJRB 2JUCA 3FMQA 3CO7C 2E7WA 2FX0A 2X51A 3TDZC 3U9GA 3VSKA 2V1DA 2WAEA 3WODF 1DU0A 3T0YA 4NHJA 2BY2A 3CTAA 3IRRA 2XPWA 1AU7A 2XIGA 1WJ5A 2W48A 4WXDA 3OYBA 1W7PD 1ZGWA 4U0YA 4ANJA 3I58A 4OWRB 2DA6A 1TC3C 3BP8A 2V9PA 4A6DA 3S14J 4A3FJ 3GTPJ 1KU2A 3Q5FA 2VBZA 4U87A 2LG4A 1OFCX 3S32A 5C4JJ 4PJLA 4OIQF 2P6TA 2IS1A 2L9NA 1VQ5I 4EGZA 2V26A 1XCBA 3N05A 4XMYA 3RPUA 3P9KA 4BAYA 5F1JA 1G3WA 3K70C 2HQNA 2HDWA 4II2A 5CQEA 2GWRA 2CUEA 3S93A 3CCLI 3SZPA 1UHWA 1X3WB 3FDYA 1D8KA 4BQNA 4M3DA 1KQ8A 3GO5A 3CF5F 5JLXA 4HX7A 2BVMA 3C2BA 3OR1C 3N4MA 2DQLA 2GOMA 2LC2A 3BJOA 3OL4A 3ERMA 2NAZA 2A5YB 2ID3A 5DS9A 3MKWB 1SFOJ 3QOPA 4BXUA 4L9VA 4BXFA 2Z3YA 5DV5A 3FXUA 1FPQA 3KYDB 1U5TA 2DOFA 4IX7A 4L0ZB 2BV6A 3B6CA 1H9TA 3FHZA 3GTQJ 2M30A 2O6GE 2HPMA 1F43A 4CCLA 3TQNA 2L9VA 2X1CA 1SMYF 3K0LA 4CXFA 1JXSA 4I09A 3AKZA 3IC7A 1PP8F 2KDOA 4XKBA 2VOOA 2H6CA 2NNNA 4AIJA 1Q1VA 3K7AJ 4HV6A 1W36C 3ULQB 4ZYEA 3IWFA 3JRHA 2E1CA 1ZGJA 4B1RA 2HOTA 1K61A 2ESHA 2ZXHA 2WV0A 4BACA 1GV5A 2LFBA 3H3ZA 1B72B 1ZHFA 1BR1A 2ZNZA 2EFQA 4AWXB 3GFIA 5LHIA 4S0HB 5TRDA 4LIUA 2ISYA 3F8NA 5ILVA 2NS0A 4CCMA 1FMVA 1Z6RA 4RB2C 3FBIB 3RKQA 4BY7J 2CS3A 3DKWA 1JKPC 2LR8A 2IGNA 1EA3A 1QPMA 2V1NA 4CYDA 2NVQJ 4ZDLA 2H1KA 2ZB9A 3HYIA 1ZR4A 4EQQA 2XAHA 1EH6A 3NEUA 5D6EA 1CGPA 3DV8A 4Q48A 3ZPLA 1WSUA 2QENA 1AA7A 1SANA 2DA4A 3ZMUA 4MTDA 2W82A 2XVCA 3K4LA 4M6XA 4BHPA 4IZZA 3ZXSA 2WB1N 4GYIA 5J1UA 3C2GA 2FF4A 4XLEA 2CQKA 3DFGA 5FJ8J 2G7UA 1LE8B 1R22A 4XLPF 1VQ9I 1Q1HA 2JMWA 1R58A 3R60A 1U6GA 2VT3A 3ECOA 1JI8A 3JRIA 1MNDA 1BW6A 2IT0A 3HTUA 3IUOA 3PL8A 2LOOA 4HG2A 2ZJPF 4I76A 2YX7A 4HW0A 1GXQA 1TP4A 1DP3A 3OYLA 1T0FC 1VQMI 1QU3A 2HKOA 2EQRA 5L3DA 1GVDA 2MBFA 2MG4A 2HYJA 4PJ0C 1I39A 3HKZA 2R93J 1O4XA 2UXXA 3DU6A 2IXSA 3N97A 3CJTB 2DO7A 4ENJA 1ORKA 4IEJA 4RGXA 2Q0OA 4Q5SF 2FNAA 1S7AA 2F5CA 2VQCA 3M4OJ 3KP4A 2M0MA 2O9LA 2K3PA 2K9LA 3H5RA 3KP7A 4AD9A 1SMTA 4Y33A 1VQOI 1V3FA 4FCYA 3DEWA 1IO2A 2XSJC 3RQ4A 3G4SI 1SD7A 1NTCA 1S72I 5F0CA 4XRSG 1OCPA 3HXLA 3H9JA 2QBYA 4BY1J 4O5VA 2EPFA 2IA1A 2BY3A 2GA1A 3WTVC 1YJ9I 3Q9SA 4HX4A 2P5LC 1O57A 1ZYRF 3Q0UA 3QQAA 1MIJA 5HS9A 2EBIA 2DAOA 4B09A 4A6EA 4E7SA 3FK7A 3E6BA 2B0LA 2FXAA 5L3GA 4Y17A 2XAUA 4A3JJ 3QPTA 2XF7A 5GAGJ 3H3VK 1ZRCA 4LK1F 2HI3A 3FXOA 4N0BA 2B63J 2L9SA 1MH4A 3Q0VA 1YW8A 4ZTJA 2HDDA 1XGSA 3PFYA 1PYVA 3DPLC 1BM9A 1YX5A 1OYYA 3G1LA 4XN0A 4ZJZA 3J80K 2O03A 2GLOA 1KZHA 2BXYA 2W1OA 4BYYA 2R7FA 3HGGA 1ZH5A 2GOXB 1X1DA 2ZCWA 3AG2H 2K7LA 3FM5A 2OQRA 4MO7A 3WTUC 1E3HA 3IH3A 3EUHA 5IT9Z 1ETWA 3FXLA 3UKGA 4C3JJ 3L00A 2FBKA 2KRHA 2DYRH 4FT8A 3JAMK 3D5SC 4U7DA 1ITYA 3HZJA 3PSIA 3SFZA 2NVTJ 1OCZH 4A3LJ 4KICA 2R5ZA 5LRRA 3ZRGA 4HF0A 3BR2A 2DA5A 4GDFA 2JRTA 1WJEA 4XOPA 3GTKJ 2LBFB 4BL0B 1YLFA 3LQRA 2QF7A 2WTEA 4YIFA 3U21A 3GVAA 4R8HA 4E7LA 3K1NA 5DTDA 3IKTA 4A0YA 1X58A 5D5UB 2M9HA 3CCJI 3HB9A 1P4XA 2LMDA 2OC6A 4XLNF 3OYEA 2VKDA 1P9QC 3KZZA 3CZ6A 1VQPI 3AL0B 1QPIA 2IVMA 2PMHA 2V7FA 3W2VA 4XRSA 3L2CA 3J7ZI 3F8MA 2EV5A 2XASA 5FO5A 2TCTA 3F8BA 5ICFA 4WX9A 1T33A 2DT7B 4PUSA 2GQQA 1PJRA 3MN2A 4BS9A 4CICA 3MMYB 2F6CA 3JTHA 1PVEA 2DCEA 1S7EA 5D8KB 1SFUA 1HXDA 3BR3A 1WJAA 3MKZA 1BOAA 5EGOA 1M1EB 5DEQA 2VE9A 2O0YA 1VQ4I 5D5XB 5IPAA 3JRCA 5LLQA 1CF7B 1DPUA 1REPC 5CVJA 1HKQA 3LQQA 3BQZA 1MBFA 2QUFA 1V5FA 2HXOA 3F21A 1T98A 3NWTA 3F3XA 2V4JC 2IA2A 4HEA2 1XTAA 5JR3A 3OYFA 2JA7J 2VT2A 2WAQA 1I3AA 2A69F 2HOAA 2NOJB 2PMZA 3BR1A 3EETA 3K9TA 3PIOF 2IW5A 2LLKA 4CCOA 2K02A 2ID6A 4Y13A 3W2AA 1Z0XA 3IAM2 2LKXA 4BXXJ 3F6OA 3RPUD 3H35A 2X6WA 2HDCA 3MVPA 4HNTA 4FASD 4CGZA 2VB6A 5EG0B 3ONQA 5FRMA 3A1YA 3OS0A 5BS6A 3JCUC 4I99C 2QYOA 3S2DJ 2LH9A 1UZCA 5BMZA 2MC3A 3WG7H 2OCEA 3I64A 2F5DA 4KT6A 4YELA 1SAUA 1LUJB 2MH9A 1FBUA 1XN7A 5IOZA 3PUBA 1MSEC 2NVXJ 3SEZA 1RESA 2ME0A 3Q3SA 4ENKA 2RKHA 2K9SA 4L5EA 1LEBA 2K3FA 2KL4A 2ZJ2A 1R23A 2M2EA 3IHUA 2JSCA 3TBIA 3KLOA 3MQ0A 2E7XA 5CPRB 2G0EA 1Z3XA 3AAFA 5GAEJ 1ULYA 4CZCA 4N4OB 1FIPA 1HSJA 2FRHA 3A02A 3HTSB 1XDUA 2FBHA 2W7NA 2R5YB 2A3SA 2JRMA 1MJAA 2DMPA 3SHFA 1ZLKA 4CYCB 4E7IA 5E8IA 3K69A 3R6SA 1RR7A 3LAPA 4A3CJ 2EWNA 2EV0A 3R0JA 4ITVA 3I59B 2UV1A 4A3IJ 4HNVA 1D5VA 2IA0A 3GBGA 5EJCA 3RJPA 3HRUA 1J5YA 1ZLJA 5L3EA 1F1ZA 4S04A 4HLYA 5ICGA 1W1WE 3LSGA 2AO9A 3AG1H 4RS8A 3ERED 1WJCA 2NXNB 4XKVA 4HDVA 4KN4X 2F4OB 3OMYA 2DLLA 1X2MA 3A0BC 1TTYA 2CV1A 9ANTA 2VJIA 1YIJI 2CG4A 1LB2A 3C18A 3QWLA 2EZHA 4BJ6C 4A0ZA 2VOPA 3TP3A 1XPXA 3FK6A 1JT0A 2DFHA 3VWBA 5FD6A 4DW6A 1MDMA 4YFKF 2Y9YA 2STWA 5L3FA 2ZNYA 3L2RA 5E1ZB 2A61A 1WJBA 3FWEA 5FROA 3DEEA 1YQAA 2RV8A 3KIOA 4A5MA 1ZG3A 4LMYA 3K4CA 4K2EA 2L2OA 4HA8A 4KMUX 3KETA 1MBHA 1MJ9A 3FBNB 4PZJA 2E5ZA 4KFCA 2K4JA 5EZHA 2M0CA 2EIMH 1MKMA 3S3NA 4IJAA 2R92J 1YRNB 4EM2A 1OYWA 3GEZA 1VQ6I 2IJLA 1TWFJ 5DUIA 3CMYA 3KYCB
chains in the Genus database with same CATH topology
1BI3A 2D2WA 2DK8A 3KEQA 4JQFA 1YO5C 1HW1A 3VFZA 1W5SA 1R1TA 2FU4A 1ON1A 1P2FA 2ZXJA 2FMLA 2UZKA 1G4DA 3BWGA 3CUOA 1QQIA 1H9GA 3K2ZA 2LKPA 3HIFA 2W84A 3WE2A 2EFOA 5E18F 2CWEA 4A5NA 1IN5A 3O3KA 4A12A 4FX4A 2RN7A 2BGCA 4JBAA 1HW2A 2FSWA 1K79A 5LGTA 2GXGA 1LJ9A 3V7RA 3GFLA 1F4KA 1X3UA 2VONA 4GGGA 3RYRA 5HLHA 5FB2A 5IT9K 2PG4A 3BZ6A 3V8KA 4KN7X 3J80Z 3TO7A 2BEOA 3RKXA 3MAJA 1G3YA 1U5TB 2A68F 4LJZF 4Y15A 2JTVA 1I6XA 1ZARA 2Z33A 2KRFA 3KFWX 3WG9A 4AIHA 1D3YA 5LHHA 2HWVA 2L02A 1FYKA 3TGNA 1K78A 1IXSB 1YYVA 3E5QA 4MHGA 3BY6A 1O3TA 2GIVA 4YIIA 2D1HA 3WTSC 3L7WA 3PQKA 4O6JA 3RTRA 4EGYA 1SD5A 3FXRA 3M1EA 3VEPA 6PAXA 3TO6A 2DPDA 2K4BA 1ZN2A 3ML6A 3GX4X 4BH9A 4WK8F 4UNOA 3QU6A 1IN8A 4YFNF 3TOBA 3EYIA 1TW2A 5CVUA 1G3SA 4UXNA 3L9FA 1EH8A 1Z05A 3ZP5A 2F5EA 1UCRA 2VBXA 2HFHA 2VXZA 1SD4A 3HHHA 3HRMA 2EB7A 3L09A 5LEJA 2V6CA 5HDNA 3KP6A 1P92A 4I0AA 2ZKZA 3SXYA 4KIGA 5LBQA 5LRSA 2MLGA 4ESJA 2V1UA 2VBWA 1Z91A 4FX0A 3EYYA 1SFXA 1AWCA 3RI4A 1OMIA 2XGXA 2PQ8A 1IUYA 5JI6A 3JTGA 5D4RA 5AIQA 2OD5A 2W25A 1BI2A 4I2OA 4LFUA 3WU1B 5BPIA 2EFWA 3T1BA 3ZMDA 2ZBKA 1FY7A 3T5XA 1T38A 3JW4A 1J59A 2GZWA 2G7HA 5DD8A 4OIOF 4HLXA 2ETHA 2ISZA 5FLXK 3E6DA 5D5WB 3J81K 2VBYA 4YFXF 2MD5A 4EM0B 2JT1A 3F72A 4HAMA 5ILSA 3B73A 1FZPB 1DPRA 1ZGAA 3OOPA 1QNTA 3U2RA 1IN6A 2HQRA 4G94A 4IF4A 2CGPA 3TO9A 1I1GA 4H0EA 1HBXG 3LA7A 4R1HA 3RYPA 3BJ6A 3MZHA 3CO6C 2DT5A 1LEAA 3REOA 4HF1A 1BN5A 2YU3A 1K7AA 1R36A 4WXCA 2A6EF 4I01A 4CZZA 2LNBA 5DYMA 2HZTA 1ZRDA 1XGMA 3RKYA 3COAC 1ONVA 3OV8A 4ZYGA 5HOOA 4M9SA 2ZMEA 2X0LA 1RZ4A 1OR7A 3KEOA 5TJJA 1HSTA 3R4KA 2HEOA 4KIFA 1OKRA 1RUOA 2KKOA 1Z6TA 2XV4S 2P7CB 3T8TA 3Q9VA 1W7PB 5DCFA 4DQ2A 4I02A 1XMAA 1TBXA 4NQWA 3VB2A 2LF8A 3ZQ7A 4HF2A 4OMYA 2RVCA 5AIPA 3S2WA 2OA4A 3V4GA 2FQ3A 4G6DA 2L01A 4EM1A 2PN6A 2K27A 1FSEA 3GFJA 3HOTA 1IAWA 3ZMZA 3HHGA 1FOKA 3ABUA 2EK5A 1LDJA 2L54A 1GVJA 2OU2A 3FZVA 3KP5A 4HBLA 5LGNA 3ZMSA 2A07F 3JSPA 3R0AA 1LNWA 4N9IA 3F6VA 5DCMA 1TNSA 2DU9A 4A0XA 4XSXF 5EEGA 1LVAA 1XSDA 3E5UA 1USSA 2F5FA 3P9CA 3QP5A 5FFZA 2XHKA 3CUQC 5HLGA 1HKTA 3HSRA 3LSTA 2UWMA 4EJUA 2R7DA 1MDMB 2DFIA 3WTTC 2MLKA 2WC2A 2HYFA 2FEZA 2XAFA 1IXRC 4LK0F 3KP3A 2MH2A 1YS6A 3O2PE 4U7BA 3GLXA 3E6CC 2FA5A 4P96A 2ESNA 5LEKA 2JPBA 4L0YB 2WWYA 2DK5A 2L4AA 1LDDA 2V79A 5K5OA 4UV9A 1L0OC 3BDDA 1S6LA 4WWCA 5KVRA 1BIAA 1B1BA 1IXCA 2QZ8A 1BI1A 4Q47A 2PI0A 5D8LB 2DPUA 3DF8A 1UFMA 2PBIA 2EFNA 4LGWA 1S8NA 1KU3A 1K6OA 2FE3A 2YPRA 5J8CA 1YTYA 4XRFA 2EJRA 1AOYA 2J5PA 5F1RA 4I98B 3EQLF 2QQ9A 4LLGF 3I5UA 4LLLA 3F8CA 2XRNA 1WKMA 4HQMA 2ZO4A 4IRIA 2LDUA 4G8XA 3ZN0A 1XCVA 3TOAA 2BBYA 4RB3C 3ECHA 3F8FA 1BC8C 1D8JA 1WI9A 5FLXZ 5FGMA 5JVTA 1O7LA 1USTA 4BHBA 5DUKA 3KLNA 3J81Z 1TQIA 4KT5C 2NNYA 3ABTA 4EJOA 4LG0A 2CFXA 3IWZA 3WTZA 1Y0UA 1KYZA 5E8GA 1YS7A 1U8RA 2NRAC 4LLNA 1R5GA 1XSVA 3ZMVA 1DUXC 3RDIA 3HSEA 1I27A 4YG2F 3SQNA 1XGNA 5ED4A 1A04A 1B9NA 4WXHA 4GO1A 1K78B 1CF7A 5K5RA 2HGCA 1V4RA 2CW0F 4KNYA 1E17A 4M72A 2Y75A 2IP2A 4P9FA 1S3JA 2O3FA 1UB9A 5DDGA 1J75A 2L3DA 5LGUA 1OYIA 3V7CA 4M6YA 4QWQA 3BROA 1KU9A 3M7GA 2G9WA 5ERIA 1P4AA 1T39A 4R79A 1MD0A 1FT9A 3BOQA 2QWWA 3WE3A 2KIFA 1O3SA 1SFEA 4ESBA 1R00A 2DI3A 1FP2A 2Y0MA 3FMSA 1YIOA 2F2EA 4ZYHA 4QLCU 3LAJA 4RGRA 4GXOA 3CUQA 3M8FA 4HZFA 2DQRA 1JHFA 2XKPA 3W6KB 4L9NA 3ISPA 2GAUA 2XROA 1JGSA 5DD4A 1KQ0A 4HYEA 4OU0A 2P8TA 3KE2A 1BIBA 2KIMA 4KUMA 4P5OA 2VN2A 3IL2A 1TQMA 1EH7A 4G9YA 1Z1DA 1F5TA 4WCGA 3V8JA 3FMRA 2RGVA 1MZBA 4IRGA 1TQPA 3BPVA 1VTNC 1FWZA 4HV5A 4CO8A 1IF1A 1PUEE 3G3ZA 4JK1X 4U88A 4N9HA 2M45A 2O61A 3H92A 3C1DA 2UXNA 4GYGA 3HUGA 4IRHA 1R7JA 3PFIA 3I53A 4MEYF 3ZMTA 1KGSA 1WWXA 1RIOH 2Q8KA 2NYXA 1T2KA 2D1VA 4ESFA 4RAZA 3TDUC 2VODA 1P4WA 3SZTA 2VC0A 2DTRA 2YX4A 4PCQA 2K86A 1BC7C 1OPCA 2ZMEB 4U0VA 2ADUA 1L3LA 1LQ1A 4L18B 1LDKB 1B9MA 3C3WA 4A2UA 4ASNA 1KQ9A 1WQ2A 1BJAA 2H94A 2QBYB 4AVPA 4E70A 2Z9OA 4RB0A 1FYLA 1C0WA 1ZRFA 1ON2A 5D6FA 4KDPA 1FP1D 1QGPA 2PEXA 1S29A 3F22A 2FNPA 1QBJA 1J7KA 4RAYA 3GF2A 4UVCA 2HTJA 4DNCA 1IN4A 4HOBA 2EA4A 1RUNA 1YG2A 2FOKA 4EMSA 5IT3A 1W4MA 4KIBA 1GXPA 3M8EA 4HQEA 1KU7A 5J8FA 4P9UA 1F9NA 2KJBA 3LWFA 1HQCA 3E97A 3GWZA 3CJNA 4S05A 2QVOA 5EEHA 5ICEA 1QO0D 5CVRA 4OIRF 2H09A 5JFRA 3P9IA 3DEUA 1MJBA 2ELHA 2HS5A 1IRFA 3G73A 4LD5A 3QRFF 2TDXA 5DCMB 2Y48A 4BQAA 3MCZA 2QM3A 4CHUA 1Z7UA 4UUVA 1TW3A 3QP6A 2LSOA 2XAGA 4ZYDA 2O8XA 3MWMA 4L9TA 3U1DA 2HTSA 2M5WA 2V9VA 4Q4ZF 2EV6A 5F64A 2E1NA 4Z2YA 3E6MA 1W5TA 1O7FA 1HKSA 3V7SA 1YW7A 2P6SA 4HX8A 4ZH4F 5CJ9A 1WRJA 4F7ZA 4EV0A 5L3CA 2M1BA 1FBSA 2PMUA 1O3RA 2BYVE 3FX3A 3KZYA 4ZZLA 4KMFA 2FMYA 4ENMA 3C7JA 3WTWC 3GZ5A 2PLYA 1XB4A 5CVVA 4WF2A 1FNNA 1EV7A 1T6SA 1RI7A 3WTYC 3LA3A 2OQGA 2COMA 5HVQC 3ROUA 1SAXA 2LF7A 1J2XA 4IVNA 4KA4A 4CDGA 3E5XA 2CYYA 4UV8A 4G7HF 3GUDA 2FBIA 2L4MA 4U0WA 4IXAA 2MA3A 2RC4A 1YW9A 3WU0A 4L5IA 5BPDA 2CO5A 1R1UA 3K1MA 4M74A 2Z5UA 1PP7U 3D0SA 3I54A 1J0RA 2QQBA 2OBPA 2PJPA 1FLIA 3E3VA 1YFHA 5AONA 5KK1A 5E17F 2AXLA 1I1SA 5CYVA 3ZN1A 2Q2EA 2OZUA 5HDGA 2VC1A 5HLIA 4M9XA 2VE8A 2CSOA 2AS5F 4LG0B 1U2WA 3WGHA 1B6AA 4RGSA 3FF5A 4UVAA 2C6YA 5D5VB 4EJWA 4G7ZF 2H27A 5A2QK 1DDNA 3GXOA 4OINF 2ACJA 4M71A 1Z9CA 3W6JB 3WGGA 2ZFWA 1U3EM 1MGTA 5BQTA 5FD5A 5F6FA 4MNUA 2PFBA 3IKVA 3KCCA 2GA2A 1ZG1A 3P7NA 3T8RA 2HR3A 2IPQX 5ILUA 5K5QA 4PGHA 2BE5F 4MGRA 1R5HA 3M9AA 2R3SA 2V1XA 1W7PA 5CVIA 4MQVA 2EA2A 1JHHA 4ON0A 4BHCA 2P5KA 2OZ6A 2IRFG 4EVIA 1KA8A 3LA2A 4IHSA 3HSFA 5J6XA 3O6BB 1G6NA 2XAQA 4EJTA 3LFKA 5ICCA 4NB5A 1U78A 2KIUA 2HKXA 1NHAA 4O3MA 4L5JA 4AIKA 3D5LA 4FHTA 5H6QA 1FYMA 3V8LA 1DP7P 1SD6A 4TV7A 1QZYA 1QZZA 1G3TA 2STTA 1PDNC 3BPXA 4ENNA 3KP2A 1E2XA 2P5VA 3NRVA 4M73A 3CUQB 4MQ9F 3J7AO 3F23A 1S7OA 1KYWA 3GYHX 4B8XA 3QAHA 3B02A 1T0FA 4MEXF 1J9IA 3NQOA 4RB1A 2RNJA 2H6BA 3MEXA 1TNTA 3IRQA 1XMKA 2HOEA 4OIPF 3R61A 2Z99A 5E1XA 3CLOA 2P7VB 3VODA 5CLSA 1U5TC 3K1PA 2W24A 1ZAOA 2M87A 1P6RA 3I4PA 4L9JA 1ODDA 5FFXA 4XBFA 5L3BA 4OOIA 3HRTA 1XGOA 3RIRA 4KYWA 3TKYA 3GFMA 4LB5A 5HS8A 2RDPA 5H6RA 1XD7A 2EFPA 3GW2A 4RGUA 3I0TA 4I0BA 3PQJA 4G7OF 1IW7F 1XDSA 5HDKA 3QU3A 5LHGA 1FSHA 5HS7A 1STZA 4OMZA 1R1VA 3WGIA 2GXBA 1IZ1A 3EDPA 4M9ZA 4G6QA 2QLZA 3MFKA 4ZZDA 4HDUA 3DP7A 2DW4A 2D45A 4MTEA 2X4HA 2XAJA 4EJVA 3JSOA 3DXJF 3FXQA 2XKOA 2W57A 1TLHB 4UVBA 2HYGD 3I59A 1UHMA 2JPCA 2JZYA 1ZREA 5JHUA 2RQPA 3HOSA 3RKWA 1I5ZA 1B4AA 1IN7A 3DQVC 5H20A 3HRSA 2KJCA 5E1WA 2QQAA 3ELKA 1O3QA 3MZYA 3H3UA 2XUBA 4IHTA 4P55A 5K1YA 4LB6B 1GHCA 3GZ6A 5D4SA 1HW5A 4UHTA 1BBYA 3RPQA 3JAMZ 4PGGA 2DBBA 3VOEA 1RNLA 4XSZF 1BI0A 1XSXA 4PDKA 3I71A 3DPTA 1FC3A 1H0MA 1IRGA 4GCVA 3QPHA 2W85A 3WTXC 5E20A 2P4WA 2J5OA 2YR2A 4BNCA 4D0PA 3CDHA 4ETSA 4IPAA 2A6HF 2YSRA 1B59A 1JE8A 5BOXA 3FM3A 5A2QZ 1FBQA 2M8EA 2OAZA 1ZG5A 4I7HA 1FX7A 3BJAA 3FMQA 3CO7C 2E7WA 3TDZC 3U9GA 2V1DA 3WODF 3T0YA 4NHJA 3CTAA 3IRRA 2XIGA 4WXDA 1W7PD 4U0YA 3I58A 3BP8A 4A6DA 1KU2A 3Q5FA 2VBZA 4OIQF 2P6TA 4EGZA 1XCBA 3RPUA 3P9KA 4BAYA 1G3WA 2HQNA 2GWRA 3SZPA 1UHWA 1D8KA 1KQ8A 3GO5A 4HX7A 3N4MA 2DQLA 3BJOA 2NAZA 2A5YB 3QOPA 4BXUA 4L9VA 2Z3YA 5DV5A 3FXUA 1FPQA 1U5TA 4L0ZB 2BV6A 1H9TA 3FHZA 2M30A 2O6GE 3TQNA 1SMYF 3K0LA 4CXFA 1JXSA 4I09A 3IC7A 1PP8F 2VOOA 2H6CA 2NNNA 4AIJA 4HV6A 3ULQB 4ZYEA 3IWFA 2E1CA 1ZGJA 2ESHA 2WV0A 3H3ZA 1ZHFA 2ZNZA 2EFQA 4AWXB 3GFIA 5LHIA 5TRDA 2ISYA 3F8NA 5ILVA 2NS0A 1Z6RA 4RB2C 3DKWA 1QPMA 4CYDA 3HYIA 4EQQA 2XAHA 1EH6A 3NEUA 5D6EA 1CGPA 3DV8A 4Q48A 3ZPLA 1WSUA 2QENA 4MTDA 3ZMUA 2XVCA 4M6XA 4BHPA 4GYIA 2FF4A 2CQKA 3DFGA 2G7UA 1R22A 4XLPF 1Q1HA 1R58A 3R60A 1U6GA 2VT3A 3ECOA 2IT0A 3HTUA 2YX7A 4HW0A 1GXQA 2HKOA 5L3DA 2MBFA 2UXXA 3N97A 2DO7A 4ENJA 4RGXA 2Q0OA 4Q5SF 2FNAA 1S7AA 2F5CA 3KP4A 3KP7A 4AD9A 1SMTA 1V3FA 1SD7A 2QBYA 4O5VA 2IA1A 2GA1A 3WTVC 3Q9SA 4HX4A 2P5LC 1O57A 1ZYRF 5HS9A 2DAOA 4B09A 4A6EA 3E6BA 2B0LA 2FXAA 5L3GA 4Y17A 3QPTA 1ZRCA 4LK1F 4N0BA 1YW8A 1XGSA 3DPLC 1BM9A 1OYYA 3J80K 2O03A 4BYYA 2R7FA 1ZH5A 2ZCWA 2K7LA 3FM5A 2OQRA 3WTUC 3EUHA 5IT9Z 3L00A 2FBKA 4FT8A 3JAMK 4U7DA 3SFZA 4KICA 5LRRA 4HF0A 2JRTA 1YLFA 3LQRA 2WTEA 4YIFA 3GVAA 4R8HA 3K1NA 3IKTA 4A0YA 5D5UB 1P4XA 4XLNF 3KZZA 2IVMA 2PMHA 3L2CA 3F8MA 2EV5A 2XASA 5FO5A 3F8BA 5ICFA 4WX9A 2GQQA 4CICA 3JTHA 5D8KB 1SFUA 1HXDA 1BOAA 5DEQA 2VE9A 2O0YA 5D5XB 1CF7B 1DPUA 5LLQA 1REPC 5CVJA 1HKQA 3LQQA 2QUFA 3F21A 1T98A 3F3XA 2IA2A 5JR3A 2VT2A 2A69F 3EETA 3K9TA 2IW5A 2K02A 4Y13A 3F6OA 2HDCA 4CGZA 5BS6A 2QYOA 5BMZA 2MC3A 3I64A 2F5DA 2MH9A 1FBUA 1XN7A 4ENKA 2RKHA 1LEBA 2ZJ2A 3IHUA 1R23A 2JSCA 3KLOA 3MQ0A 2E7XA 3AAFA 1ULYA 2FRHA 1HSJA 3HTSB 1XDUA 2FBHA 2A3SA 1MJAA 3SHFA 1ZLKA 5E8IA 3K69A 3R6SA 3LAPA 2EWNA 2EV0A 3R0JA 3I59B 1D5VA 2IA0A 3RJPA 3HRUA 1J5YA 1ZLJA 5L3EA 1F1ZA 4S04A 4HLYA 5ICGA 4RS8A 3ERED 4HDVA 4KN4X 2DLLA 1TTYA 2CG4A 1LB2A 3C18A 4A0ZA 2VOPA 5FD6A 1MDMA 4YFKF 2STWA 5L3FA 2ZNYA 5E1ZB 2A61A 3FWEA 1YQAA 2RV8A 4A5MA 1ZG3A 4LMYA 4K2EA 4HA8A 4KMUX 3KETA 1MJ9A 4PZJA 4KFCA 2K4JA 1MKMA 4IJAA 4EM2A 1OYWA 3GEZA 2IJLA 5DUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BI3 A;  2D2W A;  2DK8 A;  3KEQ A;  4JQF A;  1YO5 C;  1HW1 A;  3VFZ A;  1W5S A;  1R1T A;  2FU4 A;  1ON1 A;  1P2F A;  2ZXJ A;  2FML A;  2UZK A;  1G4D A;  3BWG A;  3CUO A;  1QQI A;  1H9G A;  3K2Z A;  2LKP A;  3HIF A;  2W84 A;  3WE2 A;  2EFO A;  5E18 F;  2CWE A;  4A5N A;  1IN5 A;  3O3K A;  4A12 A;  4FX4 A;  2RN7 A;  2BGC A;  4JBA A;  1HW2 A;  2FSW A;  1K79 A;  5LGT A;  2GXG A;  1LJ9 A;  3V7R A;  3GFL A;  1F4K A;  1X3U A;  2VON A;  4GGG A;  3RYR A;  5HLH A;  5FB2 A;  5IT9 K;  2PG4 A;  3BZ6 A;  3V8K A;  4KN7 X;  3J80 Z;  3TO7 A;  2BEO A;  3RKX A;  3MAJ A;  1G3Y A;  1U5T B;  2A68 F;  4LJZ F;  4Y15 A;  2JTV A;  1I6X A;  1ZAR A;  2Z33 A;  2KRF A;  3KFW X;  3WG9 A;  4AIH A;  1D3Y A;  5LHH A;  2HWV A;  2L02 A;  1FYK A;  3TGN A;  1K78 A;  1IXS B;  1YYV A;  3E5Q A;  4MHG A;  3BY6 A;  1O3T A;  2GIV A;  4YII A;  2D1H A;  3WTS C;  3L7W A;  3PQK A;  4O6J A;  3RTR A;  4EGY A;  1SD5 A;  3FXR A;  3M1E A;  3VEP A;  6PAX A;  3TO6 A;  2DPD A;  2K4B A;  1ZN2 A;  3ML6 A;  3GX4 X;  4BH9 A;  4WK8 F;  4UNO A;  3QU6 A;  1IN8 A;  4YFN F;  3TOB A;  3EYI A;  1TW2 A;  5CVU A;  1G3S A;  4UXN A;  3L9F A;  1EH8 A;  1Z05 A;  3ZP5 A;  2F5E A;  1UCR A;  2VBX A;  2HFH A;  2VXZ A;  1SD4 A;  3HHH A;  3HRM A;  2EB7 A;  3L09 A;  5LEJ A;  2V6C A;  5HDN A;  3KP6 A;  1P92 A;  4I0A A;  2ZKZ A;  3SXY A;  4KIG A;  5LBQ A;  5LRS A;  2MLG A;  4ESJ A;  2V1U A;  2VBW A;  1Z91 A;  4FX0 A;  3EYY A;  1SFX A;  1AWC A;  3RI4 A;  1OMI A;  2XGX A;  2PQ8 A;  1IUY A;  5JI6 A;  3JTG A;  5D4R A;  5AIQ A;  2OD5 A;  2W25 A;  1BI2 A;  4I2O A;  4LFU A;  3WU1 B;  5BPI A;  2EFW A;  3T1B A;  3ZMD A;  2ZBK A;  1FY7 A;  3T5X A;  1T38 A;  3JW4 A;  1J59 A;  2GZW A;  2G7H A;  5DD8 A;  4OIO F;  4HLX A;  2ETH A;  2ISZ A;  5FLX K;  3E6D A;  5D5W B;  3J81 K;  2VBY A;  4YFX F;  2MD5 A;  4EM0 B;  2JT1 A;  3F72 A;  4HAM A;  5ILS A;  3B73 A;  1FZP B;  1DPR A;  1ZGA A;  3OOP A;  1QNT A;  3U2R A;  1IN6 A;  2HQR A;  4G94 A;  4IF4 A;  2CGP A;  3TO9 A;  1I1G A;  4H0E A;  1HBX G;  3LA7 A;  4R1H A;  3RYP A;  3BJ6 A;  3MZH A;  3CO6 C;  2DT5 A;  1LEA A;  3REO A;  4HF1 A;  1BN5 A;  2YU3 A;  1K7A A;  1R36 A;  4WXC A;  2A6E F;  4I01 A;  4CZZ A;  2LNB A;  5DYM A;  2HZT A;  1ZRD A;  1XGM A;  3RKY A;  3COA C;  1ONV A;  3OV8 A;  4ZYG A;  5HOO A;  4M9S A;  2ZME A;  2X0L A;  1RZ4 A;  1OR7 A;  3KEO A;  5TJJ A;  1HST A;  3R4K A;  2HEO A;  4KIF A;  1OKR A;  1RUO A;  2KKO A;  1Z6T A;  2XV4 S;  2P7C B;  3T8T A;  3Q9V A;  1W7P B;  5DCF A;  4DQ2 A;  4I02 A;  1XMA A;  1TBX A;  4NQW A;  3VB2 A;  2LF8 A;  3ZQ7 A;  4HF2 A;  4OMY A;  2RVC A;  5AIP A;  3S2W A;  2OA4 A;  3V4G A;  2FQ3 A;  4G6D A;  2L01 A;  4EM1 A;  2PN6 A;  2K27 A;  1FSE A;  3GFJ A;  3HOT A;  1IAW A;  3ZMZ A;  3HHG A;  1FOK A;  3ABU A;  2EK5 A;  1LDJ A;  2L54 A;  1GVJ A;  2OU2 A;  3FZV A;  3KP5 A;  4HBL A;  5LGN A;  3ZMS A;  2A07 F;  3JSP A;  3R0A A;  1LNW A;  4N9I A;  3F6V A;  5DCM A;  1TNS A;  2DU9 A;  4A0X A;  4XSX F;  5EEG A;  1LVA A;  1XSD A;  3E5U A;  1USS A;  2F5F A;  3P9C A;  3QP5 A;  5FFZ A;  2XHK A;  3CUQ C;  5HLG A;  1HKT A;  3HSR A;  3LST A;  2UWM A;  4EJU A;  2R7D A;  1MDM B;  2DFI A;  3WTT C;  2MLK A;  2WC2 A;  2HYF A;  2FEZ A;  2XAF A;  1IXR C;  4LK0 F;  3KP3 A;  2MH2 A;  1YS6 A;  3O2P E;  4U7B A;  3GLX A;  3E6C C;  2FA5 A;  4P96 A;  2ESN A;  5LEK A;  2JPB A;  4L0Y B;  2WWY A;  2DK5 A;  2L4A A;  1LDD A;  2V79 A;  5K5O A;  4UV9 A;  1L0O C;  3BDD A;  1S6L A;  4WWC A;  5KVR A;  1BIA A;  1B1B A;  1IXC A;  2QZ8 A;  1BI1 A;  4Q47 A;  2PI0 A;  5D8L B;  2DPU A;  3DF8 A;  1UFM A;  2PBI A;  2EFN A;  4LGW A;  1S8N A;  1KU3 A;  1K6O A;  2FE3 A;  2YPR A;  5J8C A;  1YTY A;  4XRF A;  2EJR A;  1AOY A;  2J5P A;  5F1R A;  4I98 B;  3EQL F;  2QQ9 A;  4LLG F;  3I5U A;  4LLL A;  3F8C A;  2XRN A;  1WKM A;  4HQM A;  2ZO4 A;  4IRI A;  2LDU A;  4G8X A;  3ZN0 A;  1XCV A;  3TOA A;  2BBY A;  4RB3 C;  3ECH A;  3F8F A;  1BC8 C;  1D8J A;  1WI9 A;  5FLX Z;  5FGM A;  5JVT A;  1O7L A;  1UST A;  4BHB A;  5DUK A;  3KLN A;  3J81 Z;  1TQI A;  4KT5 C;  2NNY A;  3ABT A;  4EJO A;  4LG0 A;  2CFX A;  3IWZ A;  3WTZ A;  1Y0U A;  1KYZ A;  5E8G A;  1YS7 A;  1U8R A;  2NRA C;  4LLN A;  1R5G A;  1XSV A;  3ZMV A;  1DUX C;  3RDI A;  3HSE A;  1I27 A;  4YG2 F;  3SQN A;  1XGN A;  5ED4 A;  1A04 A;  1B9N A;  4WXH A;  4GO1 A;  1K78 B;  1CF7 A;  5K5R A;  2HGC A;  1V4R A;  2CW0 F;  4KNY A;  1E17 A;  4M72 A;  2Y75 A;  2IP2 A;  4P9F A;  1S3J A;  2O3F A;  1UB9 A;  5DDG A;  1J75 A;  2L3D A;  5LGU A;  1OYI A;  3V7C A;  4M6Y A;  4QWQ A;  3BRO A;  1KU9 A;  3M7G A;  2G9W A;  5ERI A;  1P4A A;  1T39 A;  4R79 A;  1MD0 A;  1FT9 A;  3BOQ A;  2QWW A;  3WE3 A;  2KIF A;  1O3S A;  1SFE A;  4ESB A;  1R00 A;  2DI3 A;  1FP2 A;  2Y0M A;  3FMS A;  1YIO A;  2F2E A;  4ZYH A;  4QLC U;  3LAJ A;  4RGR A;  4GXO A;  3CUQ A;  3M8F A;  4HZF A;  2DQR A;  1JHF A;  2XKP A;  3W6K B;  4L9N A;  3ISP A;  2GAU A;  2XRO A;  1JGS A;  5DD4 A;  1KQ0 A;  4HYE A;  4OU0 A;  2P8T A;  3KE2 A;  1BIB A;  2KIM A;  4KUM A;  4P5O A;  2VN2 A;  3IL2 A;  1TQM A;  1EH7 A;  4G9Y A;  1Z1D A;  1F5T A;  4WCG A;  3V8J A;  3FMR A;  2RGV A;  1MZB A;  4IRG A;  1TQP A;  3BPV A;  1VTN C;  1FWZ A;  4HV5 A;  4CO8 A;  1IF1 A;  1PUE E;  3G3Z A;  4JK1 X;  4U88 A;  4N9H A;  2M45 A;  2O61 A;  3H92 A;  3C1D A;  2UXN A;  4GYG A;  3HUG A;  4IRH A;  1R7J A;  3PFI A;  3I53 A;  4MEY F;  3ZMT A;  1KGS A;  1WWX A;  1RIO H;  2Q8K A;  2NYX A;  1T2K A;  2D1V A;  4ESF A;  4RAZ A;  3TDU C;  2VOD A;  1P4W A;  3SZT A;  2VC0 A;  2DTR A;  2YX4 A;  4PCQ A;  2K86 A;  1BC7 C;  1OPC A;  2ZME B;  4U0V A;  2ADU A;  1L3L A;  1LQ1 A;  4L18 B;  1LDK B;  1B9M A;  3C3W A;  4A2U A;  4ASN A;  1KQ9 A;  1WQ2 A;  1BJA A;  2H94 A;  2QBY B;  4AVP A;  4E70 A;  2Z9O A;  4RB0 A;  1FYL A;  1C0W A;  1ZRF A;  1ON2 A;  5D6F A;  4KDP A;  1FP1 D;  1QGP A;  2PEX A;  1S29 A;  3F22 A;  2FNP A;  1QBJ A;  1J7K A;  4RAY A;  3GF2 A;  4UVC A;  2HTJ A;  4DNC A;  1IN4 A;  4HOB A;  2EA4 A;  1RUN A;  1YG2 A;  2FOK A;  4EMS A;  5IT3 A;  1W4M A;  4KIB A;  1GXP A;  3M8E A;  4HQE A;  1KU7 A;  5J8F A;  4P9U A;  1F9N A;  2KJB A;  3LWF A;  1HQC A;  3E97 A;  3GWZ A;  3CJN A;  4S05 A;  2QVO A;  5EEH A;  5ICE A;  1QO0 D;  5CVR A;  4OIR F;  2H09 A;  5JFR A;  3P9I A;  3DEU A;  1MJB A;  2ELH A;  2HS5 A;  1IRF A;  3G73 A;  4LD5 A;  3QRF F;  2TDX A;  5DCM B;  2Y48 A;  4BQA A;  3MCZ A;  2QM3 A;  4CHU A;  1Z7U A;  4UUV A;  1TW3 A;  3QP6 A;  2LSO A;  2XAG A;  4ZYD A;  2O8X A;  3MWM A;  4L9T A;  3U1D A;  2HTS A;  2M5W A;  2V9V A;  4Q4Z F;  2EV6 A;  5F64 A;  2E1N A;  4Z2Y A;  3E6M A;  1W5T A;  1O7F A;  1HKS A;  3V7S A;  1YW7 A;  2P6S A;  4HX8 A;  4ZH4 F;  5CJ9 A;  1WRJ A;  4F7Z A;  4EV0 A;  5L3C A;  2M1B A;  1FBS A;  2PMU A;  1O3R A;  2BYV E;  3FX3 A;  3KZY A;  4ZZL A;  4KMF A;  2FMY A;  4ENM A;  3C7J A;  3WTW C;  3GZ5 A;  2PLY A;  1XB4 A;  5CVV A;  4WF2 A;  1FNN A;  1EV7 A;  1T6S A;  1RI7 A;  3WTY C;  3LA3 A;  2OQG A;  2COM A;  5HVQ C;  3ROU A;  1SAX A;  2LF7 A;  1J2X A;  4IVN A;  4KA4 A;  4CDG A;  3E5X A;  2CYY A;  4UV8 A;  4G7H F;  3GUD A;  2FBI A;  2L4M A;  4U0W A;  4IXA A;  2MA3 A;  2RC4 A;  1YW9 A;  3WU0 A;  4L5I A;  5BPD A;  2CO5 A;  1R1U A;  3K1M A;  4M74 A;  2Z5U A;  1PP7 U;  3D0S A;  3I54 A;  1J0R A;  2QQB A;  2OBP A;  2PJP A;  1FLI A;  3E3V A;  1YFH A;  5AON A;  5KK1 A;  5E17 F;  2AXL A;  1I1S A;  5CYV A;  3ZN1 A;  2Q2E A;  2OZU A;  5HDG A;  2VC1 A;  5HLI A;  4M9X A;  2VE8 A;  2CSO A;  2AS5 F;  4LG0 B;  1U2W A;  3WGH A;  1B6A A;  4RGS A;  3FF5 A;  4UVA A;  2C6Y A;  5D5V B;  4EJW A;  4G7Z F;  2H27 A;  5A2Q K;  1DDN A;  3GXO A;  4OIN F;  2ACJ A;  4M71 A;  1Z9C A;  3W6J B;  3WGG A;  2ZFW A;  1U3E M;  1MGT A;  5BQT A;  5FD5 A;  5F6F A;  4MNU A;  2PFB A;  3IKV A;  3KCC A;  2GA2 A;  1ZG1 A;  3P7N A;  3T8R A;  2HR3 A;  2IPQ X;  5ILU A;  5K5Q A;  4PGH A;  2BE5 F;  4MGR A;  1R5H A;  3M9A A;  2R3S A;  2V1X A;  1W7P A;  5CVI A;  4MQV A;  2EA2 A;  1JHH A;  4ON0 A;  4BHC A;  2P5K A;  2OZ6 A;  2IRF G;  4EVI A;  1KA8 A;  3LA2 A;  4IHS A;  3HSF A;  5J6X A;  3O6B B;  1G6N A;  2XAQ A;  4EJT A;  3LFK A;  5ICC A;  4NB5 A;  1U78 A;  2KIU A;  2HKX A;  1NHA A;  4O3M A;  4L5J A;  4AIK A;  3D5L A;  4FHT A;  5H6Q A;  1FYM A;  3V8L A;  1DP7 P;  1SD6 A;  4TV7 A;  1QZY A;  1QZZ A;  1G3T A;  2STT A;  1PDN C;  3BPX A;  4ENN A;  3KP2 A;  1E2X A;  2P5V A;  3NRV A;  4M73 A;  3CUQ B;  4MQ9 F;  3J7A O;  3F23 A;  1S7O A;  1KYW A;  3GYH X;  4B8X A;  3QAH A;  3B02 A;  1T0F A;  4MEX F;  1J9I A;  3NQO A;  4RB1 A;  2RNJ A;  2H6B A;  3MEX A;  1TNT A;  3IRQ A;  1XMK A;  2HOE A;  4OIP F;  3R61 A;  2Z99 A;  5E1X A;  3CLO A;  2P7V B;  3VOD A;  5CLS A;  1U5T C;  3K1P A;  2W24 A;  1ZAO A;  2M87 A;  1P6R A;  3I4P A;  4L9J A;  1ODD A;  5FFX A;  4XBF A;  5L3B A;  4OOI A;  3HRT A;  1XGO A;  3RIR A;  4KYW A;  3TKY A;  3GFM A;  4LB5 A;  5HS8 A;  2RDP A;  5H6R A;  1XD7 A;  2EFP A;  3GW2 A;  4RGU A;  3I0T A;  4I0B A;  3PQJ A;  4G7O F;  1IW7 F;  1XDS A;  5HDK A;  3QU3 A;  5LHG A;  1FSH A;  5HS7 A;  1STZ A;  4OMZ A;  1R1V A;  3WGI A;  2GXB A;  1IZ1 A;  3EDP A;  4M9Z A;  4G6Q A;  2QLZ A;  3MFK A;  4ZZD A;  4HDU A;  3DP7 A;  2DW4 A;  2D45 A;  4MTE A;  2X4H A;  2XAJ A;  4EJV A;  3JSO A;  3DXJ F;  3FXQ A;  2XKO A;  2W57 A;  1TLH B;  4UVB A;  2HYG D;  3I59 A;  1UHM A;  2JPC A;  2JZY A;  1ZRE A;  5JHU A;  2RQP A;  3HOS A;  3RKW A;  1I5Z A;  1B4A A;  1IN7 A;  3DQV C;  5H20 A;  3HRS A;  2KJC A;  5E1W A;  2QQA A;  3ELK A;  1O3Q A;  3MZY A;  3H3U A;  2XUB A;  4IHT A;  4P55 A;  5K1Y A;  4LB6 B;  1GHC A;  3GZ6 A;  5D4S A;  1HW5 A;  4UHT A;  1BBY A;  3RPQ A;  3JAM Z;  4PGG A;  2DBB A;  3VOE A;  1RNL A;  4XSZ F;  1BI0 A;  1XSX A;  4PDK A;  3I71 A;  3DPT A;  1FC3 A;  1H0M A;  1IRG A;  4GCV A;  3QPH A;  2W85 A;  3WTX C;  5E20 A;  2P4W A;  2J5O A;  2YR2 A;  4BNC A;  4D0P A;  3CDH A;  4ETS A;  4IPA A;  2A6H F;  2YSR A;  1B59 A;  1JE8 A;  5BOX A;  3FM3 A;  5A2Q Z;  1FBQ A;  2M8E A;  2OAZ A;  1ZG5 A;  4I7H A;  1FX7 A;  3BJA A;  3FMQ A;  3CO7 C;  2E7W A;  3TDZ C;  3U9G A;  2V1D A;  3WOD F;  3T0Y A;  4NHJ A;  3CTA A;  3IRR A;  2XIG A;  4WXD A;  1W7P D;  4U0Y A;  3I58 A;  3BP8 A;  4A6D A;  1KU2 A;  3Q5F A;  2VBZ A;  4OIQ F;  2P6T A;  4EGZ A;  1XCB A;  3RPU A;  3P9K A;  4BAY A;  1G3W A;  2HQN A;  2GWR A;  3SZP A;  1UHW A;  1D8K A;  1KQ8 A;  3GO5 A;  4HX7 A;  3N4M A;  2DQL A;  3BJO A;  2NAZ A;  2A5Y B;  3QOP A;  4BXU A;  4L9V A;  2Z3Y A;  5DV5 A;  3FXU A;  1FPQ A;  1U5T A;  4L0Z B;  2BV6 A;  1H9T A;  3FHZ A;  2M30 A;  2O6G E;  3TQN A;  1SMY F;  3K0L A;  4CXF A;  1JXS A;  4I09 A;  3IC7 A;  1PP8 F;  2VOO A;  2H6C A;  2NNN A;  4AIJ A;  4HV6 A;  3ULQ B;  4ZYE A;  3IWF A;  2E1C A;  1ZGJ A;  2ESH A;  2WV0 A;  3H3Z A;  1ZHF A;  2ZNZ A;  2EFQ A;  4AWX B;  3GFI A;  5LHI A;  5TRD A;  2ISY A;  3F8N A;  5ILV A;  2NS0 A;  1Z6R A;  4RB2 C;  3DKW A;  1QPM A;  4CYD A;  3HYI A;  4EQQ A;  2XAH A;  1EH6 A;  3NEU A;  5D6E A;  1CGP A;  3DV8 A;  4Q48 A;  3ZPL A;  1WSU A;  2QEN A;  4MTD A;  3ZMU A;  2XVC A;  4M6X A;  4BHP A;  4GYI A;  2FF4 A;  2CQK A;  3DFG A;  2G7U A;  1R22 A;  4XLP F;  1Q1H A;  1R58 A;  3R60 A;  1U6G A;  2VT3 A;  3ECO A;  2IT0 A;  3HTU A;  2YX7 A;  4HW0 A;  1GXQ A;  2HKO A;  5L3D A;  2MBF A;  2UXX A;  3N97 A;  2DO7 A;  4ENJ A;  4RGX A;  2Q0O A;  4Q5S F;  2FNA A;  1S7A A;  2F5C A;  3KP4 A;  3KP7 A;  4AD9 A;  1SMT A;  1V3F A;  1SD7 A;  2QBY A;  4O5V A;  2IA1 A;  2GA1 A;  3WTV C;  3Q9S A;  4HX4 A;  2P5L C;  1O57 A;  1ZYR F;  5HS9 A;  2DAO A;  4B09 A;  4A6E A;  3E6B A;  2B0L A;  2FXA A;  5L3G A;  4Y17 A;  3QPT A;  1ZRC A;  4LK1 F;  4N0B A;  1YW8 A;  1XGS A;  3DPL C;  1BM9 A;  1OYY A;  3J80 K;  2O03 A;  4BYY A;  2R7F A;  1ZH5 A;  2ZCW A;  2K7L A;  3FM5 A;  2OQR A;  3WTU C;  3EUH A;  5IT9 Z;  3L00 A;  2FBK A;  4FT8 A;  3JAM K;  4U7D A;  3SFZ A;  4KIC A;  5LRR A;  4HF0 A;  2JRT A;  1YLF A;  3LQR A;  2WTE A;  4YIF A;  3GVA A;  4R8H A;  3K1N A;  3IKT A;  4A0Y A;  5D5U B;  1P4X A;  4XLN F;  3KZZ A;  2IVM A;  2PMH A;  3L2C A;  3F8M A;  2EV5 A;  2XAS A;  5FO5 A;  3F8B A;  5ICF A;  4WX9 A;  2GQQ A;  4CIC A;  3JTH A;  5D8K B;  1SFU A;  1HXD A;  1BOA A;  5DEQ A;  2VE9 A;  2O0Y A;  5D5X B;  1CF7 B;  1DPU A;  5LLQ A;  1REP C;  5CVJ A;  1HKQ A;  3LQQ A;  2QUF A;  3F21 A;  1T98 A;  3F3X A;  2IA2 A;  5JR3 A;  2VT2 A;  2A69 F;  3EET A;  3K9T A;  2IW5 A;  2K02 A;  4Y13 A;  3F6O A;  2HDC A;  4CGZ A;  5BS6 A;  2QYO A;  5BMZ A;  2MC3 A;  3I64 A;  2F5D A;  2MH9 A;  1FBU A;  1XN7 A;  4ENK A;  2RKH A;  1LEB A;  2ZJ2 A;  3IHU A;  1R23 A;  2JSC A;  3KLO A;  3MQ0 A;  2E7X A;  3AAF A;  1ULY A;  2FRH A;  1HSJ A;  3HTS B;  1XDU A;  2FBH A;  2A3S A;  1MJA A;  3SHF A;  1ZLK A;  5E8I A;  3K69 A;  3R6S A;  3LAP A;  2EWN A;  2EV0 A;  3R0J A;  3I59 B;  1D5V A;  2IA0 A;  3RJP A;  3HRU A;  1J5Y A;  1ZLJ A;  5L3E A;  1F1Z A;  4S04 A;  4HLY A;  5ICG A;  4RS8 A;  3ERE D;  4HDV A;  4KN4 X;  2DLL A;  1TTY A;  2CG4 A;  1LB2 A;  3C18 A;  4A0Z A;  2VOP A;  5FD6 A;  1MDM A;  4YFK F;  2STW A;  5L3F A;  2ZNY A;  5E1Z B;  2A61 A;  3FWE A;  1YQA A;  2RV8 A;  4A5M A;  1ZG3 A;  4LMY A;  4K2E A;  4HA8 A;  4KMU X;  3KET A;  1MJ9 A;  4PZJ A;  4KFC A;  2K4J A;  1MKM A;  4IJA A;  4EM2 A;  1OYW A;  3GEZ A;  2IJL A;  5DUI A; 
#chains in the Genus database with same CATH topology
 1BI3 A;  2D2W A;  2DK8 A;  3HUG B;  2VI6 A;  4XR6 A;  3KEQ A;  4UB6 C;  1E3P A;  4JQF A;  1YO5 C;  1HW1 A;  1WH7 A;  1HCR A;  2ZFU A;  4NC8 A;  2HVS A;  3VFZ A;  1S5L C;  3JR9 A;  1W5S A;  1R1T A;  2FU4 A;  2ZC2 A;  3FIW A;  4RM2 A;  5FLM J;  1ON1 A;  1P2F A;  3HM5 A;  2ZXJ A;  1FOY A;  2FML A;  1QHG A;  5J4Y A;  2UZK A;  4PFP A;  2TRT A;  3PUF A;  3CCU I;  1G4D A;  1YJW I;  2O5R A;  1YJN I;  3BWG A;  2HVR A;  1K4S A;  1WCM J;  3CUO A;  1QQI A;  2CQX A;  4E7H A;  1H9G A;  2E1M B;  2XF5 A;  3K2Z A;  3QYE A;  2LKP A;  4B48 A;  3HIF A;  2W84 A;  2FQ4 A;  2HQ5 A;  2I8D A;  4XL9 A;  3WE2 A;  2EFO A;  5E18 F;  2CWE A;  4A5N A;  2RAE A;  2CUF A;  2L0K A;  2BY0 A;  4IOA F;  2WB1 A;  2CQQ A;  1IN5 A;  3O3K A;  3SFI A;  5TGT A;  4A12 A;  2ZJR F;  4FX4 A;  2RN7 A;  1T08 B;  3L2U A;  2BGC A;  4A93 J;  2COB A;  2PX9 A;  4JBA A;  1MMG A;  1HW2 A;  3SDG A;  2FSW A;  4RAF A;  1K79 A;  1VI0 A;  3H1C A;  5LGT A;  1QHH D;  1QZE A;  3GTJ J;  2GXG A;  1LJ9 A;  2KRC A;  2DMU A;  3V7R A;  3GFL A;  1F4K A;  5JLW A;  1FOX A;  3OYD A;  1X3U A;  2VON A;  4BEH B;  4GGG A;  3RYR A;  5HLH A;  2YU9 J;  1GT0 C;  5FB2 A;  4KIT B;  4DGW B;  5IT9 K;  3BTJ A;  2LY2 A;  2PG4 A;  3BZ6 A;  2ZME C;  3V8K A;  4KN7 X;  1WPK A;  4RM3 A;  3J80 Z;  3TO7 A;  2BEO A;  2WY7 Q;  2NOG A;  2IGO A;  2JK3 A;  3RKX A;  4QTR A;  2LVS A;  1GLN A;  3MAJ A;  3GTL J;  3HOY J;  1G3Y A;  1LPQ A;  1U5T B;  2M3A A;  4HSR A;  5EDN A;  2A68 F;  3KZI C;  4LJZ F;  4Y15 A;  2JTV A;  1A6I A;  3I56 I;  1DU6 A;  3K4K A;  1JGG A;  2XGE A;  1I6X A;  3PO3 J;  1ZAR A;  3I55 I;  2AQE A;  2Z33 A;  2KRF A;  3KFW X;  3WG9 A;  4AIH A;  3OSG A;  3ABM H;  3WHC A;  4YEJ A;  1D3Y A;  5LHH A;  2HWV A;  2M4K A;  2L02 A;  1FYK A;  1R6R A;  5F04 A;  5KAI C;  3RZD J;  1VFC A;  3TGN A;  1K78 A;  1IXS B;  1YYV A;  1WGX A;  3E5Q A;  3HGY A;  4MHG A;  2HOS A;  2YUS A;  1ZK8 A;  3BY6 A;  2E60 A;  2JUG A;  1O3T A;  4UUT A;  2GIV A;  4YII A;  4IOC F;  2D1H A;  3HG9 A;  3WTS C;  1AHD P;  3L7W A;  3ZQG A;  3PQK A;  4O6J A;  3RTR A;  1D0Y A;  4EGY A;  4XIC A;  1SD5 A;  3FXR A;  3M1E A;  3VEP A;  6PAX A;  2ZSI B;  4RLF A;  5F27 A;  3TO6 A;  1ENH A;  2DPD A;  1VND A;  2K4B A;  1ZN2 A;  3ML6 A;  3EUH C;  3GX4 X;  4BH9 A;  5CQG A;  4WK8 F;  3QU6 A;  1IN8 A;  1RRJ A;  4YFN F;  4UNO A;  1SVO A;  2FOW A;  3TOB A;  1XMX A;  3EYI A;  1Z77 A;  1IDZ A;  1TW2 A;  4EEF G;  4I6Z A;  1LKX A;  5CVU A;  4BE1 A;  2CV0 A;  1G3S A;  1MW7 A;  4UXN A;  2MYS A;  3DPU A;  1BW5 A;  3L9F A;  5HNH A;  1EH8 A;  3D5R C;  2L7K A;  1Z05 A;  5F08 A;  3ZP5 A;  1D0X A;  4NC7 A;  2F5E A;  5FKM A;  3L1P A;  3D1N I;  1UCR A;  2VBX A;  2HFH A;  2VXZ A;  1SD4 A;  3HHH A;  3HRM A;  1W36 D;  2EB7 A;  1D1A A;  2K40 A;  3VYU B;  3L09 A;  3SEQ A;  5LEJ A;  2V6C A;  5HDN A;  3KP6 A;  4Y3O A;  2ELK A;  1P92 A;  1TWC J;  2DN0 A;  4I0A A;  4LIV A;  2ICW G;  4PK4 A;  2ZKZ A;  3SXY A;  2QQ8 A;  4KIG A;  3TMO A;  5LBQ A;  4BKX A;  2XPU A;  2QCO A;  2MLG A;  5LRS A;  2CUJ A;  5K7F A;  4ESJ A;  2V1U A;  2VBW A;  1Z91 A;  3JRE A;  4FX0 A;  3EYY A;  1SFX A;  4CSW A;  1AWC A;  2LRD A;  3RI4 A;  1OMI A;  2FD5 A;  2QKL B;  2XGX A;  2M7B A;  2PQ8 A;  1DGW Y;  1IUY A;  5JI6 A;  1FTT A;  3IAS 2;  3JTG A;  3UR3 C;  1PUF A;  5D4R A;  3TW6 A;  3L2W A;  5AIQ A;  1VQN I;  4FET A;  5F0H A;  2OD5 A;  1FTZ A;  2W25 A;  1BI2 A;  2MSY A;  1U0J A;  4I2O A;  1WJD A;  4LFU A;  2LK2 A;  3K4N A;  3WU1 B;  5BPI A;  2EFW A;  3T1B A;  3HL2 A;  3ZMD A;  1H88 C;  2ZBK A;  4AYB A;  1FY7 A;  3T5X A;  3LL7 A;  1TT0 A;  1T38 A;  3JW4 A;  5K7Z A;  1J59 A;  2GZW A;  2G7H A;  5DD8 A;  4OIO F;  4HLX A;  2ETH A;  3B6A A;  2ISZ A;  2R7O A;  1I50 J;  5FLX K;  4A3B J;  3DCF A;  4CA0 A;  3E6D A;  5D5W B;  3S1N J;  3J81 K;  4B4C A;  1FIA A;  4BE0 A;  2VBY A;  2Y2Z A;  4YFX F;  3LSR A;  5GTI C;  2DMQ A;  3KPH A;  4XM3 A;  2CFO A;  2A5W A;  2MD5 A;  2OCC H;  2Z16 A;  4EM0 B;  3SJM A;  2JT1 A;  3F72 A;  4HAM A;  5ILS A;  3B73 A;  1FZP B;  2CUZ A;  1DPR A;  2KQR A;  2XGC A;  1ZGA A;  2R7S A;  3OOP A;  1QNT A;  2CU7 A;  3U2R A;  1IN6 A;  2HQR A;  3OWT A;  3ZR8 X;  4D7N A;  4IHX A;  4E7K A;  1W5C C;  4G94 A;  2XDV A;  4IF4 A;  2CGP A;  4E4H A;  2R5Z B;  1YHQ I;  3TO9 A;  1I1G A;  4H0E A;  2Q2E B;  1UG0 A;  1HBX G;  3LA7 A;  4R1H A;  4G6T B;  3QOE A;  5J4V A;  3RYP A;  1XX5 A;  3BJ6 A;  2WA0 A;  4XRM A;  4C9Y A;  4CH7 A;  1ZQ3 P;  3MZH A;  3SYT A;  2DT5 A;  1LEA A;  2XB0 X;  3CO6 C;  4FQG A;  5TIS C;  3REO A;  1XG1 A;  2ECB A;  4HF1 A;  5BNG A;  2AHQ A;  2HPI A;  3BR0 A;  1MH3 A;  1BN5 A;  1A35 A;  2YU3 A;  1K7A A;  3OYA A;  1R36 A;  3X2Q H;  2ELJ A;  4WXC A;  2A6E F;  2KMU A;  4I01 A;  2VLA A;  4CZZ A;  2LNB A;  5DYM A;  2HZT A;  4KIS A;  1ZRD A;  2NVU B;  5EGO B;  1XGM A;  3RKY A;  3COA C;  3FKJ A;  5IYC J;  1ONV A;  3OV8 A;  3HOZ J;  4ZYG A;  5HOO A;  4M9S A;  2E71 A;  2ZME A;  2QA4 I;  2X0L A;  2AXT C;  1FEX A;  1RZ4 A;  2CH0 A;  1OR7 A;  3KEO A;  5TJJ A;  4M3E A;  2DXI A;  1HST A;  3EUA A;  1JJ8 C;  3R4K A;  1NK2 P;  1APL C;  2HEO A;  1MMD A;  4QPO A;  3CCM I;  3BQY A;  1ZEL A;  2E36 A;  4KIF A;  4OAY A;  1OKR A;  1RUO A;  3VYS B;  3CCE I;  2KKO A;  1Z6T A;  2XV4 S;  3MKL A;  2X6O A;  5J3L A;  2P7C B;  4E6K G;  2MAB A;  3T8T A;  3Q9V A;  3BTL A;  4M6V A;  4A3G J;  3P5J A;  1W7P B;  3JRF A;  5DCF A;  4BBS J;  2JA2 A;  3LSM A;  4DQ2 A;  3G71 I;  4I02 A;  1S9H A;  2E34 A;  2MFZ A;  1XMA A;  1LFB A;  4Y7N J;  2F48 A;  4DZJ A;  1TBX A;  4Z6Y A;  2M34 A;  1Z21 A;  4C3I J;  5B3S H;  1MBJ A;  2K9M A;  3IH4 A;  1JUM A;  4NQW A;  3VB2 A;  3LNQ A;  2O7O A;  1OLT A;  2LF8 A;  3OYK A;  3ZQ7 A;  4HF2 A;  4OMY A;  2DA2 A;  2ECC A;  2RVC A;  3CP2 A;  1MNM C;  5AIP A;  3S2W A;  2OA4 A;  2DDA A;  5GP9 A;  3V4G A;  2FQ3 A;  4G6D A;  2KIS A;  2L01 A;  2VUM J;  4EM1 A;  2Y69 H;  2PN6 A;  4C2T A;  1ETK A;  2K27 A;  1FSE A;  1MMA A;  3GFJ A;  3K2A A;  2QGU A;  1B72 A;  3HOT A;  1IAW A;  3ZMZ A;  3HHG A;  1FOK A;  2RQQ A;  1HDP A;  3ABU A;  1ERD A;  2EK5 A;  3HOV J;  2X6Y A;  1H8A C;  1LDJ A;  2L54 A;  1GVJ A;  2OU2 A;  2CQ7 A;  1X2N A;  3FZV A;  3KP5 A;  4HBL A;  5LGN A;  4XNF A;  3ZMS A;  3VYR B;  2A07 F;  3JSP A;  3E0J B;  3R0A A;  1LNW A;  1YIT I;  1XS9 A;  4B44 A;  4UY8 I;  4N9I A;  2V9K A;  3DTK A;  1H89 C;  1U9O A;  3S3M A;  3F6V A;  3LMM A;  5DCM A;  1TNS A;  3OIQ A;  2DU9 A;  4A0X A;  2I10 A;  2VKE A;  4XSX F;  4F55 A;  1SVL A;  5EEG A;  1LVA A;  2OV7 A;  1XSD A;  3E5U A;  1USS A;  2F5F A;  3P9C A;  3QP5 A;  4DZP A;  1AKH A;  5FFZ A;  1R49 A;  2XHK A;  3CUQ C;  5HLG A;  1HKT A;  3PM1 A;  1ZR2 A;  3HSR A;  3LST A;  2UWM A;  3HOW J;  2KFD A;  2EIK H;  3DLA A;  2HZD A;  2ZXW H;  4EJU A;  1ETQ A;  1K4T A;  2R7D A;  1MDM B;  2DFI A;  3WTT C;  5LFA A;  2OF7 A;  3G1O A;  3GTG J;  2MLK A;  2WC2 A;  2R7R A;  3S1M J;  2VQL A;  5E3L A;  2HYF A;  3CD6 I;  4JOM A;  2BHZ A;  2FEZ A;  4FE7 A;  1N75 A;  3BZC A;  3I4M J;  1IXR C;  2XAF A;  3M07 A;  1E0E A;  3CCQ I;  1D1C A;  3MZ8 A;  4LK0 F;  3KP3 A;  1LFP A;  1UMQ A;  1WZ2 A;  2MH2 A;  1YS6 A;  3O2P E;  2KZV A;  1WJF A;  4U7B A;  3GLX A;  3I9V 2;  3E6C C;  1HOM A;  2FA5 A;  2VAS A;  4P96 A;  3CF2 A;  2QSF X;  2ESN A;  1B8I A;  5LEK A;  2JPB A;  3PJR A;  4L0Y B;  2WWY A;  3S16 J;  2DK5 A;  2L4A A;  1IUF A;  1SFK A;  4BGD A;  3GZN B;  1RPW A;  4RLQ A;  4A3E J;  1LDD A;  2V79 A;  5K5O A;  3CCV I;  3S17 J;  4UV9 A;  2XPV A;  1L0O C;  3A01 B;  3BDD A;  1S6L A;  5DM6 F;  2ZSH B;  3QPL A;  4WWC A;  5B1B H;  1GDT A;  2X85 A;  4PSX A;  5KVR A;  1BIA A;  1B1B A;  1IXC A;  5KAF C;  2QZ8 A;  1BI1 A;  3O8G A;  4Q47 A;  3OYH A;  2PI0 A;  4X6A J;  3S8P A;  5D8L B;  3DF8 A;  1UFM A;  2F4M B;  2DPU A;  2PBI A;  2EFN A;  4LGW A;  3DKX A;  2X6X A;  1S8N A;  1KU3 A;  1K6O A;  2FE3 A;  2YPR A;  5J8C A;  2K9N A;  5KHD A;  1YTY A;  4XRF A;  2EJR A;  1AOY A;  2J5P A;  5F1R A;  4I98 B;  3EQL F;  5EZG A;  2QQ9 A;  4LLG F;  3I5U A;  2HVQ A;  2MD0 A;  4LLL A;  2HNH A;  4BU2 A;  4QIW N;  3F8C A;  2XRN A;  1WKM A;  3BG3 A;  4HQM A;  4QPQ A;  5M3F J;  1X4P A;  1KON A;  3LSH A;  2DMN A;  2ZO4 A;  3ZQQ A;  1BL0 A;  4IRI A;  2R7U A;  5GAH J;  2LDU A;  2Z2S B;  4G8X A;  3ZN0 A;  4A69 C;  1XCV A;  3TOA A;  5GAD J;  4HPQ A;  4M3F A;  2D5V A;  2DT6 A;  2BBY A;  4RB3 C;  3VPR A;  3KEY A;  4XLC A;  3ECH A;  3F8F A;  4IL6 C;  4QSH A;  1BC8 C;  1D8J A;  2ZJQ F;  1WI9 A;  2Y0S N;  5FLX Z;  1QVT A;  5FGM A;  5JVT A;  1O7L A;  1UST A;  4BHB A;  5DUK A;  3KLN A;  3J81 Z;  1I3Q J;  1TQI A;  3DTE A;  3SZG A;  4A3D J;  4KT5 C;  2NNY A;  3CME I;  2FJ1 A;  3ABT A;  2VPR A;  3FIS A;  4V19 K;  4EJO A;  4YIR X;  4PSW A;  1ACI A;  4BDY A;  4ZTF A;  2KDZ A;  4LG0 A;  2CFX A;  5FRN A;  3IWZ A;  3WTZ A;  1WH5 A;  1Y0U A;  3HKZ N;  1KYZ A;  2WY8 Q;  5E8G A;  4BJ5 C;  1YS7 A;  1U8R A;  2DJI A;  2NRA C;  4LLN A;  2XRL A;  1R5G A;  1XSV A;  4F3Q A;  1OJL A;  3G2B A;  3ZMV A;  1DUX C;  2OTJ I;  3K4M A;  3HSE A;  3RDI A;  3DBR B;  1I27 A;  4YG2 F;  2L7M P;  3SQN A;  5K7H A;  1XGN A;  2JVG A;  3WHB A;  5ED4 A;  2F5V A;  1A04 A;  1N25 A;  1RKT A;  1B9N A;  2EZL A;  2M7A A;  3CP8 A;  2R7Z J;  4WXH A;  4GO1 A;  1K78 B;  4OAZ A;  1CF7 A;  5K5R A;  5C44 J;  2LRE A;  2HGC A;  1Y6I A;  1V4R A;  2CW0 F;  1RC9 A;  2CW8 A;  4AU7 A;  4KNY A;  3BCB A;  3CMM A;  3CLQ A;  1E17 A;  1JT6 A;  2WBM A;  1TT5 B;  5CKT A;  4M72 A;  4B47 A;  2Y75 A;  4FIS A;  3W2W A;  2OUM A;  2IP2 A;  4P9F A;  4D5C A;  1S3J A;  4RBO A;  5B5E C;  1HA8 A;  2O3F A;  1UB9 A;  5DDG A;  3JRA A;  1IJW C;  1J75 A;  2GM4 A;  4DJA A;  2L3D A;  5LGU A;  1OYI A;  4FTH A;  2VJ5 A;  3V7C A;  1K6Y A;  4N4N B;  4MFD A;  4JX5 A;  4M6Y A;  4QWQ A;  3BRO A;  1UJ8 A;  1KU9 A;  3CES A;  3M7G A;  1RR8 C;  2G9W A;  1IG7 A;  3OYC A;  3OIP A;  5ERI A;  5EG0 A;  3OS1 A;  3DLL F;  4MFE A;  1NH3 A;  1P4A A;  2O8K A;  2VQH A;  1T39 A;  4R79 A;  2OJE D;  1MD0 A;  2RNG A;  2LP0 A;  1FT9 A;  3BOQ A;  4X0G A;  2QWW A;  3WE3 A;  4XID A;  1UG2 A;  2K9Q A;  1UEL B;  2KIF A;  1O3S A;  1SFE A;  4DYC A;  1OCT C;  4ESB A;  2BY1 A;  2XGD A;  4UUS A;  3ZQL A;  1R00 A;  2DI3 A;  4DYR A;  2JSP A;  1FP2 A;  5FLV A;  3CQZ J;  1VQK I;  1BJZ A;  2Y0M A;  3FMS A;  2BXZ A;  4RAG A;  2LD5 A;  2VPL A;  1YIO A;  1HLV A;  2F2E A;  3A4C A;  4E7Z A;  4ZYH A;  2EZK A;  4QLC U;  5GTH C;  1V55 H;  3H0D A;  2R5Y A;  3GME A;  4AID A;  1R71 A;  4LG3 A;  4XON A;  4IHW A;  3LAJ A;  3FXK A;  3RCO A;  4RGR A;  1Z3Y A;  3LSJ A;  4GXO A;  3F0C A;  3G6E I;  3CUQ A;  2CMP A;  3M8F A;  4HZF A;  2K85 A;  1OR7 C;  2DQR A;  4XN3 A;  3IP4 B;  1JHF A;  1DGR M;  2XKP A;  3W6K B;  1R4M B;  5E3O A;  4L9N A;  3ISP A;  2GAU A;  2XRO A;  2B9S A;  3H5A A;  2X1D A;  1JGS A;  2IS4 A;  5DD4 A;  1KQ0 A;  3M8J A;  4HYE A;  4OU0 A;  3QOD A;  2CW7 A;  3CC2 I;  4BBR J;  2P8T A;  3KE2 A;  4DOZ A;  1BIB A;  4RA2 A;  2KIM A;  4KUM A;  2VKV A;  4P5O A;  4BQQ A;  2VN2 A;  2DOE A;  3IL2 A;  2L5Q A;  1TQM A;  1EH7 A;  1IRZ A;  4G9Y A;  1Z1D A;  1QVU A;  2JWT A;  1UHS A;  4J19 A;  1F5T A;  3V8J A;  2L7Z A;  4WCG A;  3FMR A;  4F92 B;  1VQ7 I;  2RGV A;  1MZB A;  4RMN A;  3RZO J;  4IRG A;  1TQP A;  3BPV A;  1VTN C;  1FWZ A;  3BR6 A;  4HV5 A;  1X3Z B;  1MSF C;  3Q0W A;  4CO8 A;  1IF1 A;  1PUE E;  3G3Z A;  2EZI A;  4JK1 X;  4U88 A;  3E7L A;  2E2I J;  4N9H A;  2M45 A;  5E3M A;  2O61 A;  3BG7 A;  3H92 A;  1A36 A;  2L7F P;  3C1D A;  2UXN A;  4RDU A;  4GYG A;  3HUG A;  4IRH A;  2HU9 A;  1R7J A;  3PFI A;  2LYC A;  3I53 A;  4MEY F;  3ZMT A;  2IS2 A;  1KGS A;  2KLO A;  2DJN A;  3CCY A;  4XK4 A;  1WWX A;  4EAT A;  1HC8 A;  1ETV A;  1V54 H;  1MBE A;  2WAD A;  2E5N A;  1RIO H;  4ZYA A;  2XB5 A;  2Q8K A;  2NYX A;  3JRG A;  1T2K A;  3AG3 H;  2D1V A;  4DYQ A;  4ESF A;  2BW3 A;  4W97 A;  2BOL A;  4F52 A;  5E79 C;  3VYT B;  5HNF A;  4GRI A;  1W0U A;  3KYL A;  4RAZ A;  3TDU C;  2LY1 A;  2VOD A;  1E3O C;  1P4W A;  3SZT A;  1EF4 A;  2VC0 A;  5FKO A;  2DTR A;  5E3N A;  1MNE A;  3CC7 I;  3ZQH A;  2YX4 A;  4PCQ A;  4XKW A;  2K86 A;  3S3O A;  3K6G A;  1JKO C;  3J7A Y;  4YRV A;  1BC7 C;  1OPC A;  2ZME B;  4U0V A;  2ADU A;  5F0F A;  1WFX A;  1LQ1 A;  1L3L A;  1R9T J;  3FXM A;  4D9J A;  4L18 B;  1LDK B;  2FUG 2;  2H8R A;  1NK3 P;  1B9M A;  1V5E A;  3C3W A;  5IYB J;  4A2U A;  4ASN A;  1KQ9 A;  2EIN H;  2CRG A;  2KPM A;  1OIS A;  1WQ2 A;  1BJA A;  2H94 A;  3OOU A;  3HOU J;  2QBY B;  4BQO A;  4AVP A;  2BZT A;  4E70 A;  1BR4 A;  2Z9O A;  4RB0 A;  3TED A;  1FYL A;  5IOY A;  2N8G A;  4BEH A;  1C0W A;  2H8W A;  1ZRF A;  3HDD A;  3PSF A;  1NG7 A;  1P7J A;  2P81 A;  1ON2 A;  5D6F A;  4KDP A;  1FP1 D;  1QGP A;  1X1A A;  4C2U A;  2PEX A;  3EPZ A;  2QSG X;  2A6T A;  3PNY A;  3GLL A;  1S29 A;  3OYI A;  1EJ9 A;  5C4X J;  3H36 A;  4NDL A;  3F22 A;  4NC6 A;  2FNP A;  2E1O A;  1G59 A;  4BJT A;  2M4G A;  1LFU P;  2DMT A;  5J47 A;  1QBJ A;  1J7K A;  5J1R A;  1LVK A;  4RAY A;  3GF2 A;  4UVC A;  3BZK A;  3GCM A;  2HTJ A;  3OL3 A;  4DNC A;  4JX6 A;  1IN4 A;  3A2K A;  3S15 J;  4HOB A;  4NQW B;  2OPT A;  2EA4 A;  1RUN A;  1YG2 A;  2FOK A;  4EMS A;  2UUZ A;  2WV1 A;  5IT3 A;  2KT0 A;  1W4M A;  1SVM A;  2YS9 A;  4KIB A;  2DOD A;  1GXP A;  3ZGK A;  3M8E A;  4HQE A;  3OYN A;  3GTO J;  2RRE A;  1SC7 A;  1KU7 A;  2BVL A;  5J8F A;  4P9U A;  1F9N A;  1Y8Q B;  2KJB A;  3LWF A;  1HQC A;  3E97 A;  3GWZ A;  3CJN A;  1RET A;  2A05 A;  3O8H A;  4S05 A;  2QVO A;  5EEH A;  3TW7 A;  3M3Y J;  5GPA A;  4D5F A;  2IBD A;  5ICE A;  1QO0 D;  2NS7 A;  3CDI A;  5CVR A;  4W1U A;  4KJZ A;  4OIR F;  2H09 A;  3CCS I;  3EUK L;  4GFB A;  5JFR A;  3P9I A;  3K10 A;  2Z1D A;  3DEU A;  4A3M J;  1MJB A;  3DTI A;  2ELH A;  2HS5 A;  3DU5 A;  1IRF A;  2PJR A;  3G73 A;  4LD5 A;  3QRF F;  2TDX A;  5DCM B;  2Y48 A;  4BQA A;  3MCZ A;  1HDD C;  4IHY A;  2QM3 A;  4CHU A;  1Z7U A;  2H1L A;  5M5W J;  4UUV A;  4F93 B;  4PFO A;  1TW3 A;  1AKH B;  1VF9 A;  4Y4R A;  2EIJ H;  3NAU A;  3QP6 A;  2LSO A;  2XAG A;  4ZYD A;  2Y0S A;  2O8X A;  3K4J A;  1JKR C;  3MWM A;  4L9T A;  3U1D A;  2HTS A;  1JUP A;  1Y1W J;  1I6H J;  2M5W A;  2V9V A;  2VJJ A;  4Q4Z F;  2DDB A;  5FKN A;  4H4K C;  3AL0 C;  2EV6 A;  2MW8 A;  3DWL E;  5F64 A;  3L2V A;  4Y52 J;  3RQI A;  2E1N A;  4Z2Y A;  3E6M A;  1W5T A;  3C2H A;  1O7F A;  4NNJ A;  4NUB A;  1HKS A;  4PJM A;  2R7W A;  3V7S A;  1YW7 A;  2P6S A;  4HX8 A;  4IQ4 A;  3KX2 A;  4ZH4 F;  5CJ9 A;  1WRJ A;  3JRB A;  4F7Z A;  4EV0 A;  5L3C A;  2M1B A;  4D1Q A;  1Y1V J;  1FBS A;  2LTP A;  2PMU A;  1O3R A;  2BYV E;  3FX3 A;  3KZY A;  2EH3 A;  4ZZL A;  1B8I B;  4KMF A;  2XF6 A;  5KCM A;  2FMY A;  4ENM A;  3C7J A;  3PNV A;  3M1C A;  4M3G A;  3GZ5 A;  5J40 A;  3ZOB A;  3G1M A;  4AC0 A;  5JHF A;  1XB4 A;  3WTW C;  2PLY A;  4P1W A;  1OQY A;  2CQN A;  4II3 A;  2WAF A;  5CVV A;  1TL8 A;  2JJ7 A;  4WF2 A;  2DFE A;  1FNN A;  2HQA A;  1EV7 A;  3BC8 A;  2HXI A;  5J1Y A;  1T6S A;  4HST A;  4UB8 C;  1RI7 A;  3WTY C;  3LA3 A;  1YOV B;  2OQG A;  4JP0 A;  2COM A;  3S1Q J;  5HVQ C;  3ROU A;  1SAX A;  2LF7 A;  1V5G A;  1J2X A;  4IVN A;  1VZ0 A;  4KA4 A;  4CDG A;  3E5X A;  2CYY A;  4UV8 A;  3SDB A;  4IHV A;  1A5J A;  4G7H F;  4XKC A;  2VJ4 A;  3GUD A;  3NWS A;  2FBI A;  2L4M A;  4U0W A;  4A3K J;  4IXA A;  3OYJ A;  3ZQC A;  2MGQ A;  3HPH A;  3S1R J;  2MA3 A;  2E2J J;  2RC4 A;  1YW9 A;  3WU0 A;  4L5I A;  5BPD A;  2CO5 A;  1GV2 A;  1R1U A;  3K1M A;  1U8B A;  4M74 A;  1WI3 A;  3I3L A;  2Z5U A;  1PP7 U;  1Z7L A;  3AFH A;  3D0S A;  3H9Q A;  3I54 A;  1J0R A;  2QQB A;  3E1S A;  4AM3 A;  4CCK A;  2OBP A;  3CJQ B;  2JA8 J;  2B7E A;  2PJP A;  1FLI A;  1IV8 A;  3E3V A;  1YFH A;  3ASO H;  1R5I D;  5HOD A;  5AON A;  5KK1 A;  2E19 A;  5E17 F;  2AXL A;  1I1S A;  2M8G X;  2IAI A;  5CYV A;  2VL8 A;  1RKW A;  1FMW A;  3ZN1 A;  1X1C A;  2Q2E A;  4XLH A;  2OZU A;  5HDG A;  5M5X J;  3CMA I;  4JYK A;  2VC1 A;  3PNT A;  3VSL A;  2AQF A;  1LE8 A;  1N78 A;  3QYB A;  5HLI A;  4M9X A;  2VE8 A;  3DBL B;  3BLY A;  2CSO A;  3TP0 A;  3A0H C;  3HJE A;  2AS5 F;  1JTX A;  1JTY A;  1U2W A;  2IEK A;  3WGH A;  4LG0 B;  1B6A A;  4RGS A;  3VDX A;  3FF5 A;  4DIQ A;  4HRI A;  4UVA A;  1WVR A;  1ZKG A;  2NVY J;  2C6Y A;  3CDL A;  3BG5 A;  5D5V B;  4EJW A;  4G7Z F;  2H27 A;  5A2Q K;  1DDN A;  3GXO A;  3LOC A;  4OIN F;  2ACJ A;  1HF0 A;  4XLF A;  4M71 A;  1Z9C A;  3CCR I;  1R4N B;  5KNL A;  3W6J B;  3WGG A;  1TWA J;  1U9N A;  3HEF A;  2ZFW A;  1X4O A;  1U3E M;  1MGT A;  5HLT A;  2CV2 A;  1BA5 A;  5BQT A;  4IKF A;  5FD5 A;  5F6F A;  2E2H J;  4MNU A;  2PFB A;  3IKV A;  4IO9 F;  3KCC A;  2GA2 A;  1ZG1 A;  1Y56 A;  4C2M J;  3P7N A;  1ETO A;  3FXJ A;  3T8R A;  3PO2 J;  1X19 A;  2HR3 A;  2IPQ X;  5ILU A;  5K5Q A;  3LSI A;  5H2F C;  4PGH A;  1IRX A;  2BE5 F;  3BG6 A;  4AYB N;  2R7X A;  4MGR A;  1R5H A;  1MBK A;  3TL4 X;  2GBY A;  3M9A A;  2R3S A;  1T8I A;  3BT9 A;  2V1X A;  4V2G A;  1W7P A;  5CVI A;  3W3C A;  4CCJ A;  4CCN A;  2NS8 A;  4MQV A;  2EA2 A;  1JHH A;  3H0G J;  5B66 C;  4E7J A;  2Y30 A;  3MKY B;  4ON0 A;  4BHC A;  4J00 A;  2MC4 A;  2P5K A;  2VQG A;  2OZ6 A;  2IRF G;  2KIQ A;  4EVI A;  1KA8 A;  1F36 A;  1J09 A;  3LA2 A;  4IHS A;  5IP6 A;  3HSF A;  5J6X A;  3O6B B;  1G6N A;  2XAQ A;  2R0Q C;  4EJT A;  3LFK A;  5C3E J;  1BR2 A;  2DYS H;  1OCR H;  3BCA A;  4D7M A;  4MIM A;  5ICC A;  1X1P A;  4UUS B;  4NB5 A;  4DBQ A;  2OTL I;  1U78 A;  2KIU A;  2HKX A;  1NHA A;  1Y8R B;  4O3M A;  1N77 A;  4ZDO A;  4JX4 A;  4L5J A;  3A03 A;  4AIK A;  3ABL H;  3OYM A;  1TWG J;  3D5L A;  4FHT A;  5H6Q A;  1FYM A;  3V8L A;  1DP7 P;  1SD6 A;  4TV7 A;  1YE9 A;  1QZY A;  1QZZ A;  2E1M C;  1D5Y A;  5M5Y J;  1G3T A;  2X9D A;  2STT A;  1G8X A;  1PDN C;  3BPX A;  4ENN A;  3KP2 A;  5M3M J;  1E2X A;  5EEA A;  4AVZ A;  2P5V A;  5GPC A;  3OS2 A;  1A6Q A;  3NRV A;  2LBF A;  4M73 A;  4XOT A;  1EKE A;  4XLA A;  3CUQ B;  3F9K A;  4MQ9 F;  3J7A O;  1TWH J;  3F23 A;  1S7O A;  1KYW A;  1SEU A;  2BHY A;  3GYH X;  2I5U A;  4B8X A;  3QAH A;  3B02 A;  5LD2 C;  2DFF A;  2JA6 J;  1T0F A;  5EF6 A;  1IV6 A;  3NQO A;  4RB1 A;  4MEX F;  4FE4 A;  1J9I A;  5IYD J;  2RNJ A;  1FOW A;  2H6B A;  1WHU A;  5B1A H;  3MEX A;  4HNU A;  1TNT A;  3J7Y J;  3OY9 A;  2KP6 A;  3IRQ A;  1XMK A;  4F91 B;  3L2Q A;  2HOE A;  3DBH B;  4OIP F;  3R61 A;  3BTI A;  2DA3 A;  2Z99 A;  1IC8 A;  5E1X A;  3RSN A;  3I4N J;  3CLO A;  2P7V B;  3LFU A;  3VOD A;  5CLS A;  1U5T C;  2CJJ A;  2JVH A;  3K1P A;  4PJN A;  2W24 A;  4V2F A;  2IGM A;  1ZAO A;  4LOC A;  3ZCO A;  1POG A;  2GXA A;  1JUS A;  2M87 A;  2JQ7 A;  1P6R A;  3I4P A;  4L9J A;  4BDZ A;  1ODD A;  5FFX A;  4XBF A;  4DBR A;  3S2H J;  5FKL A;  5L3B A;  4OOI A;  3HRT A;  1G2H A;  2JA5 J;  3UNG C;  1VQ8 I;  1XGO A;  5FKK A;  3RIR A;  4KYW A;  3TKY A;  3GFM A;  3PIP F;  3JRD A;  5HS8 A;  4LB5 A;  2RDP A;  4AUX A;  3BTC A;  1MBG A;  4MLO A;  3OR2 C;  3IH2 A;  5H6R A;  1XD7 A;  1OCO H;  2EFP A;  3GW2 A;  3U1K A;  1NG6 A;  3LSK A;  4RGU A;  3CC4 I;  3I0T A;  3A01 A;  3FKI J;  4I0B A;  4X1E A;  5IP7 J;  2DA1 A;  2R4G A;  3PQJ A;  4G7O F;  1IW7 F;  1XDS A;  5HDK A;  3QU3 A;  5LHG A;  1FSH A;  5HS7 A;  2DA7 A;  3LSP A;  1JKQ C;  1STZ A;  1YI2 I;  1IDY A;  2X48 A;  3MD2 A;  3ZQI A;  4OMZ A;  1R1V A;  3WU2 C;  3WGI A;  2GXB A;  1IZ1 A;  3EDP A;  1IGN A;  4M9Z A;  3FHN A;  4M3B A;  4G6Q A;  4BE2 A;  2QLZ A;  1UAA A;  3MFK A;  1ETY A;  2ZXI A;  4ZZD A;  2BW3 B;  4HDU A;  3DP7 A;  4CUG A;  3GTM J;  2DW4 A;  4B3X A;  3HOX J;  4MTE A;  2X4H A;  2D45 A;  1W0T A;  2XAJ A;  4EJV A;  1T95 A;  3JSO A;  2DTZ A;  1P7I A;  5EYR A;  3ESW B;  4CYC A;  5IY5 H;  3DXJ F;  3FXQ A;  1D1B A;  2XKO A;  2W57 A;  1TLH B;  5DM7 F;  4UVB A;  2LY9 A;  2HYG D;  3I59 A;  4B43 A;  4LIT A;  2EIL H;  1UHM A;  3H5N A;  2JPC A;  2JZY A;  3QPS A;  2VKH A;  1ZRE A;  5JHU A;  4XOR A;  2W4S A;  2Y9Z A;  2L9R A;  2RQP A;  5JVG F;  1PUF B;  2R7Q A;  2X1E A;  2DOA A;  3IV5 A;  3ZQF A;  4B3A A;  3HOS A;  3RKW A;  1I5Z A;  1B4A A;  4G12 A;  2R7V A;  1QA6 A;  2GIZ A;  1IN7 A;  1MMS A;  3DQV C;  1K83 J;  4ZC3 A;  1ZTR A;  5H20 A;  3HRS A;  4C3H J;  2KJC A;  4ZDP A;  2QEX I;  2XSD C;  5E1W A;  3K4B A;  1GUU A;  2QQA A;  1QRY A;  3ELK A;  1Y39 A;  1MMN A;  1OCC H;  2V6E A;  4ABZ A;  1O3Q A;  3MZY A;  2KZG A;  2XUB A;  3H3U A;  2K5C A;  2KHM A;  4BUP A;  4P55 A;  4IHT A;  5K1Y A;  3OIO A;  4LB6 B;  3V42 A;  2WAQ N;  2F4I A;  4XQF A;  1GHC A;  3GZ6 A;  1TZL A;  3HC7 A;  5D4S A;  1HW5 A;  3BR5 A;  1X1B A;  4UHT A;  1BBY A;  2PMZ N;  3ABK H;  3RPQ A;  3JAM Z;  1A31 A;  4PGG A;  2DBB A;  3VOE A;  3NAR A;  2LKS A;  1RNL A;  2XC7 A;  4XSZ F;  5IP9 J;  2P0W A;  2VIX A;  1XC5 A;  1BI0 A;  1XSX A;  4PDK A;  3I71 A;  3DPT A;  1FC3 A;  1H0M A;  2JN6 A;  2Q1Z B;  3W6V A;  2ME6 A;  1IRG A;  1Y0N A;  4GCV A;  3QPH A;  2W85 A;  4NBQ A;  3WTX C;  3OYG A;  1YRN A;  1VQL I;  3BG9 A;  1ETX A;  5E20 A;  3K70 D;  2QSH X;  2P4W A;  3AG4 H;  1YX3 A;  2J5O A;  2YR2 A;  3QYF A;  1D0Z A;  1Z67 A;  4BNC A;  1BOB A;  3OSF A;  1JJ6 C;  2E35 A;  3DKY A;  4D0P A;  3CDH A;  4ETS A;  4IPA A;  3CJR B;  3HBL A;  3ASN H;  2IS6 A;  2A6H F;  4PJJ A;  1FJL A;  2YSR A;  2IGK A;  1B59 A;  1JE8 A;  3HPG A;  4J01 A;  5BOX A;  3FM3 A;  1DQU A;  5A2Q Z;  1CQT A;  1FBQ A;  2QKM B;  3H9G A;  2W00 A;  2R7T A;  2M8E A;  2OAZ A;  2VXD A;  1T56 A;  1ZG5 A;  4IQJ A;  4I7H A;  4C30 A;  1FX7 A;  3BJA A;  2Y31 A;  2PJR B;  2JUC A;  3FMQ A;  3CO7 C;  2E7W A;  2FX0 A;  2X51 A;  3TDZ C;  3U9G A;  3VSK A;  2V1D A;  2WAE A;  3WOD F;  1DU0 A;  3T0Y A;  4NHJ A;  2BY2 A;  3CTA A;  3IRR A;  2XPW A;  1AU7 A;  2XIG A;  1WJ5 A;  2W48 A;  4WXD A;  3OYB A;  1W7P D;  1ZGW A;  4U0Y A;  4ANJ A;  3I58 A;  4OWR B;  2DA6 A;  1TC3 C;  3BP8 A;  2V9P A;  4A6D A;  3S14 J;  4A3F J;  3GTP J;  1KU2 A;  3Q5F A;  2VBZ A;  4U87 A;  2LG4 A;  1OFC X;  3S32 A;  5C4J J;  4PJL A;  4OIQ F;  2P6T A;  2IS1 A;  2L9N A;  1VQ5 I;  4EGZ A;  2V26 A;  1XCB A;  3N05 A;  4XMY A;  3RPU A;  3P9K A;  4BAY A;  5F1J A;  1G3W A;  3K70 C;  2HQN A;  2HDW A;  4II2 A;  5CQE A;  2GWR A;  2CUE A;  3S93 A;  3CCL I;  3SZP A;  1UHW A;  1X3W B;  3FDY A;  1D8K A;  4BQN A;  4M3D A;  1KQ8 A;  3GO5 A;  3CF5 F;  5JLX A;  4HX7 A;  2BVM A;  3C2B A;  3OR1 C;  3N4M A;  2DQL A;  2GOM A;  2LC2 A;  3BJO A;  3OL4 A;  3ERM A;  2NAZ A;  2A5Y B;  2ID3 A;  5DS9 A;  3MKW B;  1SFO J;  3QOP A;  4BXU A;  4L9V A;  4BXF A;  2Z3Y A;  5DV5 A;  3FXU A;  1FPQ A;  3KYD B;  1U5T A;  2DOF A;  4IX7 A;  4L0Z B;  2BV6 A;  3B6C A;  1H9T A;  3FHZ A;  3GTQ J;  2M30 A;  2O6G E;  2HPM A;  1F43 A;  4CCL A;  3TQN A;  2L9V A;  2X1C A;  1SMY F;  3K0L A;  4CXF A;  1JXS A;  4I09 A;  3AKZ A;  3IC7 A;  1PP8 F;  2KDO A;  4XKB A;  2VOO A;  2H6C A;  2NNN A;  4AIJ A;  1Q1V A;  3K7A J;  4HV6 A;  1W36 C;  3ULQ B;  4ZYE A;  3IWF A;  3JRH A;  2E1C A;  1ZGJ A;  4B1R A;  2HOT A;  1K61 A;  2ESH A;  2ZXH A;  2WV0 A;  4BAC A;  1GV5 A;  2LFB A;  3H3Z A;  1B72 B;  1ZHF A;  1BR1 A;  2ZNZ A;  2EFQ A;  4AWX B;  3GFI A;  5LHI A;  4S0H B;  5TRD A;  4LIU A;  2ISY A;  3F8N A;  5ILV A;  2NS0 A;  4CCM A;  1FMV A;  1Z6R A;  4RB2 C;  3FBI B;  3RKQ A;  4BY7 J;  2CS3 A;  3DKW A;  1JKP C;  2LR8 A;  2IGN A;  1EA3 A;  1QPM A;  2V1N A;  4CYD A;  2NVQ J;  4ZDL A;  2H1K A;  2ZB9 A;  3HYI A;  1ZR4 A;  4EQQ A;  2XAH A;  1EH6 A;  3NEU A;  5D6E A;  1CGP A;  3DV8 A;  4Q48 A;  3ZPL A;  1WSU A;  2QEN A;  1AA7 A;  1SAN A;  2DA4 A;  3ZMU A;  4MTD A;  2W82 A;  2XVC A;  3K4L A;  4M6X A;  4BHP A;  4IZZ A;  3ZXS A;  2WB1 N;  4GYI A;  5J1U A;  3C2G A;  2FF4 A;  4XLE A;  2CQK A;  3DFG A;  5FJ8 J;  2G7U A;  1LE8 B;  1R22 A;  4XLP F;  1VQ9 I;  1Q1H A;  2JMW A;  1R58 A;  3R60 A;  1U6G A;  2VT3 A;  3ECO A;  1JI8 A;  3JRI A;  1MND A;  1BW6 A;  2IT0 A;  3HTU A;  3IUO A;  3PL8 A;  2LOO A;  4HG2 A;  2ZJP F;  4I76 A;  2YX7 A;  4HW0 A;  1GXQ A;  1TP4 A;  1DP3 A;  3OYL A;  1T0F C;  1VQM I;  1QU3 A;  2HKO A;  2EQR A;  5L3D A;  1GVD A;  2MBF A;  2MG4 A;  2HYJ A;  4PJ0 C;  1I39 A;  3HKZ A;  2R93 J;  1O4X A;  2UXX A;  3DU6 A;  2IXS A;  3N97 A;  3CJT B;  2DO7 A;  4ENJ A;  1ORK A;  4IEJ A;  4RGX A;  2Q0O A;  4Q5S F;  2FNA A;  1S7A A;  2F5C A;  2VQC A;  3M4O J;  3KP4 A;  2M0M A;  2O9L A;  2K3P A;  2K9L A;  3H5R A;  3KP7 A;  4AD9 A;  1SMT A;  4Y33 A;  1VQO I;  1V3F A;  4FCY A;  3DEW A;  1IO2 A;  2XSJ C;  3RQ4 A;  3G4S I;  1SD7 A;  1NTC A;  1S72 I;  5F0C A;  4XRS G;  1OCP A;  3HXL A;  3H9J A;  2QBY A;  4BY1 J;  4O5V A;  2EPF A;  2IA1 A;  2BY3 A;  2GA1 A;  3WTV C;  1YJ9 I;  3Q9S A;  4HX4 A;  2P5L C;  1O57 A;  1ZYR F;  3Q0U A;  3QQA A;  1MIJ A;  5HS9 A;  2EBI A;  2DAO A;  4B09 A;  4A6E A;  4E7S A;  3FK7 A;  3E6B A;  2B0L A;  2FXA A;  5L3G A;  4Y17 A;  2XAU A;  4A3J J;  3QPT A;  2XF7 A;  5GAG J;  3H3V K;  1ZRC A;  4LK1 F;  2HI3 A;  3FXO A;  4N0B A;  2B63 J;  2L9S A;  1MH4 A;  3Q0V A;  1YW8 A;  4ZTJ A;  2HDD A;  1XGS A;  3PFY A;  1PYV A;  3DPL C;  1BM9 A;  1YX5 A;  1OYY A;  3G1L A;  4XN0 A;  4ZJZ A;  3J80 K;  2O03 A;  2GLO A;  1KZH A;  2BXY A;  2W1O A;  4BYY A;  2R7F A;  3HGG A;  1ZH5 A;  2GOX B;  1X1D A;  2ZCW A;  3AG2 H;  2K7L A;  3FM5 A;  2OQR A;  4MO7 A;  3WTU C;  1E3H A;  3IH3 A;  3EUH A;  5IT9 Z;  1ETW A;  3FXL A;  3UKG A;  4C3J J;  3L00 A;  2FBK A;  2KRH A;  2DYR H;  4FT8 A;  3JAM K;  3D5S C;  4U7D A;  1ITY A;  3HZJ A;  3PSI A;  3SFZ A;  2NVT J;  1OCZ H;  4A3L J;  4KIC A;  2R5Z A;  5LRR A;  3ZRG A;  4HF0 A;  3BR2 A;  2DA5 A;  4GDF A;  2JRT A;  1WJE A;  4XOP A;  3GTK J;  2LBF B;  4BL0 B;  1YLF A;  3LQR A;  2QF7 A;  2WTE A;  4YIF A;  3U21 A;  3GVA A;  4R8H A;  4E7L A;  3K1N A;  5DTD A;  3IKT A;  4A0Y A;  1X58 A;  5D5U B;  2M9H A;  3CCJ I;  3HB9 A;  1P4X A;  2LMD A;  2OC6 A;  4XLN F;  3OYE A;  2VKD A;  1P9Q C;  3KZZ A;  3CZ6 A;  1VQP I;  3AL0 B;  1QPI A;  2IVM A;  2PMH A;  2V7F A;  3W2V A;  4XRS A;  3L2C A;  3J7Z I;  3F8M A;  2EV5 A;  2XAS A;  5FO5 A;  2TCT A;  3F8B A;  5ICF A;  4WX9 A;  1T33 A;  2DT7 B;  4PUS A;  2GQQ A;  1PJR A;  3MN2 A;  4BS9 A;  4CIC A;  3MMY B;  2F6C A;  3JTH A;  1PVE A;  2DCE A;  1S7E A;  5D8K B;  1SFU A;  1HXD A;  3BR3 A;  1WJA A;  3MKZ A;  1BOA A;  5EGO A;  1M1E B;  5DEQ A;  2VE9 A;  2O0Y A;  1VQ4 I;  5D5X B;  5IPA A;  3JRC A;  5LLQ A;  1CF7 B;  1DPU A;  1REP C;  5CVJ A;  1HKQ A;  3LQQ A;  3BQZ A;  1MBF A;  2QUF A;  1V5F A;  2HXO A;  3F21 A;  1T98 A;  3NWT A;  3F3X A;  2V4J C;  2IA2 A;  4HEA 2;  1XTA A;  5JR3 A;  3OYF A;  2JA7 J;  2VT2 A;  2WAQ A;  1I3A A;  2A69 F;  2HOA A;  2NOJ B;  2PMZ A;  3BR1 A;  3EET A;  3K9T A;  3PIO F;  2IW5 A;  2LLK A;  4CCO A;  2K02 A;  2ID6 A;  4Y13 A;  3W2A A;  1Z0X A;  3IAM 2;  2LKX A;  4BXX J;  3F6O A;  3RPU D;  3H35 A;  2X6W A;  2HDC A;  3MVP A;  4HNT A;  4FAS D;  4CGZ A;  2VB6 A;  5EG0 B;  3ONQ A;  5FRM A;  3A1Y A;  3OS0 A;  5BS6 A;  3JCU C;  4I99 C;  2QYO A;  3S2D J;  2LH9 A;  1UZC A;  5BMZ A;  2MC3 A;  3WG7 H;  2OCE A;  3I64 A;  2F5D A;  4KT6 A;  4YEL A;  1SAU A;  1LUJ B;  2MH9 A;  1FBU A;  1XN7 A;  5IOZ A;  3PUB A;  1MSE C;  2NVX J;  3SEZ A;  1RES A;  2ME0 A;  3Q3S A;  4ENK A;  2RKH A;  2K9S A;  4L5E A;  1LEB A;  2K3F A;  2KL4 A;  2ZJ2 A;  1R23 A;  2M2E A;  3IHU A;  2JSC A;  3TBI A;  3KLO A;  3MQ0 A;  2E7X A;  5CPR B;  2G0E A;  1Z3X A;  3AAF A;  5GAE J;  1ULY A;  4CZC A;  4N4O B;  1FIP A;  1HSJ A;  2FRH A;  3A02 A;  3HTS B;  1XDU A;  2FBH A;  2W7N A;  2R5Y B;  2A3S A;  2JRM A;  1MJA A;  2DMP A;  3SHF A;  1ZLK A;  4CYC B;  4E7I A;  5E8I A;  3K69 A;  3R6S A;  1RR7 A;  3LAP A;  4A3C J;  2EWN A;  2EV0 A;  3R0J A;  4ITV A;  3I59 B;  2UV1 A;  4A3I J;  4HNV A;  1D5V A;  2IA0 A;  3GBG A;  5EJC A;  3RJP A;  3HRU A;  1J5Y A;  1ZLJ A;  5L3E A;  1F1Z A;  4S04 A;  4HLY A;  5ICG A;  1W1W E;  3LSG A;  2AO9 A;  3AG1 H;  4RS8 A;  3ERE D;  1WJC A;  2NXN B;  4XKV A;  4HDV A;  4KN4 X;  2F4O B;  3OMY A;  2DLL A;  1X2M A;  3A0B C;  1TTY A;  2CV1 A;  9ANT A;  2VJI A;  1YIJ I;  2CG4 A;  1LB2 A;  3C18 A;  3QWL A;  2EZH A;  4BJ6 C;  4A0Z A;  2VOP A;  3TP3 A;  1XPX A;  3FK6 A;  1JT0 A;  2DFH A;  3VWB A;  5FD6 A;  4DW6 A;  1MDM A;  4YFK F;  2Y9Y A;  2STW A;  5L3F A;  2ZNY A;  3L2R A;  5E1Z B;  2A61 A;  1WJB A;  3FWE A;  5FRO A;  3DEE A;  1YQA A;  2RV8 A;  3KIO A;  4A5M A;  1ZG3 A;  4LMY A;  3K4C A;  4K2E A;  2L2O A;  4HA8 A;  4KMU X;  3KET A;  1MBH A;  1MJ9 A;  3FBN B;  4PZJ A;  2E5Z A;  4KFC A;  2K4J A;  5EZH A;  2M0C A;  2EIM H;  1MKM A;  3S3N A;  4IJA A;  2R92 J;  1YRN B;  4EM2 A;  1OYW A;  3GEZ A;  1VQ6 I;  2IJL A;  1TWF J;  5DUI A;  3CMY A;  3KYC B; 
#chains in the Genus database with same CATH homology
 1BI3 A;  2D2W A;  2DK8 A;  3KEQ A;  4JQF A;  1YO5 C;  1HW1 A;  3VFZ A;  1W5S A;  1R1T A;  2FU4 A;  1ON1 A;  1P2F A;  2ZXJ A;  2FML A;  2UZK A;  1G4D A;  3BWG A;  3CUO A;  1QQI A;  1H9G A;  3K2Z A;  2LKP A;  3HIF A;  2W84 A;  3WE2 A;  2EFO A;  5E18 F;  2CWE A;  4A5N A;  1IN5 A;  3O3K A;  4A12 A;  4FX4 A;  2RN7 A;  2BGC A;  4JBA A;  1HW2 A;  2FSW A;  1K79 A;  5LGT A;  2GXG A;  1LJ9 A;  3V7R A;  3GFL A;  1F4K A;  1X3U A;  2VON A;  4GGG A;  3RYR A;  5HLH A;  5FB2 A;  5IT9 K;  2PG4 A;  3BZ6 A;  3V8K A;  4KN7 X;  3J80 Z;  3TO7 A;  2BEO A;  3RKX A;  3MAJ A;  1G3Y A;  1U5T B;  2A68 F;  4LJZ F;  4Y15 A;  2JTV A;  1I6X A;  1ZAR A;  2Z33 A;  2KRF A;  3KFW X;  3WG9 A;  4AIH A;  1D3Y A;  5LHH A;  2HWV A;  2L02 A;  1FYK A;  3TGN A;  1K78 A;  1IXS B;  1YYV A;  3E5Q A;  4MHG A;  3BY6 A;  1O3T A;  2GIV A;  4YII A;  2D1H A;  3WTS C;  3L7W A;  3PQK A;  4O6J A;  3RTR A;  4EGY A;  1SD5 A;  3FXR A;  3M1E A;  3VEP A;  6PAX A;  3TO6 A;  2DPD A;  2K4B A;  1ZN2 A;  3ML6 A;  3GX4 X;  4BH9 A;  4WK8 F;  4UNO A;  3QU6 A;  1IN8 A;  4YFN F;  3TOB A;  3EYI A;  1TW2 A;  5CVU A;  1G3S A;  4UXN A;  3L9F A;  1EH8 A;  1Z05 A;  3ZP5 A;  2F5E A;  1UCR A;  2VBX A;  2HFH A;  2VXZ A;  1SD4 A;  3HHH A;  3HRM A;  2EB7 A;  3L09 A;  5LEJ A;  2V6C A;  5HDN A;  3KP6 A;  1P92 A;  4I0A A;  2ZKZ A;  3SXY A;  4KIG A;  5LBQ A;  5LRS A;  2MLG A;  4ESJ A;  2V1U A;  2VBW A;  1Z91 A;  4FX0 A;  3EYY A;  1SFX A;  1AWC A;  3RI4 A;  1OMI A;  2XGX A;  2PQ8 A;  1IUY A;  5JI6 A;  3JTG A;  5D4R A;  5AIQ A;  2OD5 A;  2W25 A;  1BI2 A;  4I2O A;  4LFU A;  3WU1 B;  5BPI A;  2EFW A;  3T1B A;  3ZMD A;  2ZBK A;  1FY7 A;  3T5X A;  1T38 A;  3JW4 A;  1J59 A;  2GZW A;  2G7H A;  5DD8 A;  4OIO F;  4HLX A;  2ETH A;  2ISZ A;  5FLX K;  3E6D A;  5D5W B;  3J81 K;  2VBY A;  4YFX F;  2MD5 A;  4EM0 B;  2JT1 A;  3F72 A;  4HAM A;  5ILS A;  3B73 A;  1FZP B;  1DPR A;  1ZGA A;  3OOP A;  1QNT A;  3U2R A;  1IN6 A;  2HQR A;  4G94 A;  4IF4 A;  2CGP A;  3TO9 A;  1I1G A;  4H0E A;  1HBX G;  3LA7 A;  4R1H A;  3RYP A;  3BJ6 A;  3MZH A;  3CO6 C;  2DT5 A;  1LEA A;  3REO A;  4HF1 A;  1BN5 A;  2YU3 A;  1K7A A;  1R36 A;  4WXC A;  2A6E F;  4I01 A;  4CZZ A;  2LNB A;  5DYM A;  2HZT A;  1ZRD A;  1XGM A;  3RKY A;  3COA C;  1ONV A;  3OV8 A;  4ZYG A;  5HOO A;  4M9S A;  2ZME A;  2X0L A;  1RZ4 A;  1OR7 A;  3KEO A;  5TJJ A;  1HST A;  3R4K A;  2HEO A;  4KIF A;  1OKR A;  1RUO A;  2KKO A;  1Z6T A;  2XV4 S;  2P7C B;  3T8T A;  3Q9V A;  1W7P B;  5DCF A;  4DQ2 A;  4I02 A;  1XMA A;  1TBX A;  4NQW A;  3VB2 A;  2LF8 A;  3ZQ7 A;  4HF2 A;  4OMY A;  2RVC A;  5AIP A;  3S2W A;  2OA4 A;  3V4G A;  2FQ3 A;  4G6D A;  2L01 A;  4EM1 A;  2PN6 A;  2K27 A;  1FSE A;  3GFJ A;  3HOT A;  1IAW A;  3ZMZ A;  3HHG A;  1FOK A;  3ABU A;  2EK5 A;  1LDJ A;  2L54 A;  1GVJ A;  2OU2 A;  3FZV A;  3KP5 A;  4HBL A;  5LGN A;  3ZMS A;  2A07 F;  3JSP A;  3R0A A;  1LNW A;  4N9I A;  3F6V A;  5DCM A;  1TNS A;  2DU9 A;  4A0X A;  4XSX F;  5EEG A;  1LVA A;  1XSD A;  3E5U A;  1USS A;  2F5F A;  3P9C A;  3QP5 A;  5FFZ A;  2XHK A;  3CUQ C;  5HLG A;  1HKT A;  3HSR A;  3LST A;  2UWM A;  4EJU A;  2R7D A;  1MDM B;  2DFI A;  3WTT C;  2MLK A;  2WC2 A;  2HYF A;  2FEZ A;  2XAF A;  1IXR C;  4LK0 F;  3KP3 A;  2MH2 A;  1YS6 A;  3O2P E;  4U7B A;  3GLX A;  3E6C C;  2FA5 A;  4P96 A;  2ESN A;  5LEK A;  2JPB A;  4L0Y B;  2WWY A;  2DK5 A;  2L4A A;  1LDD A;  2V79 A;  5K5O A;  4UV9 A;  1L0O C;  3BDD A;  1S6L A;  4WWC A;  5KVR A;  1BIA A;  1B1B A;  1IXC A;  2QZ8 A;  1BI1 A;  4Q47 A;  2PI0 A;  5D8L B;  2DPU A;  3DF8 A;  1UFM A;  2PBI A;  2EFN A;  4LGW A;  1S8N A;  1KU3 A;  1K6O A;  2FE3 A;  2YPR A;  5J8C A;  1YTY A;  4XRF A;  2EJR A;  1AOY A;  2J5P A;  5F1R A;  4I98 B;  3EQL F;  2QQ9 A;  4LLG F;  3I5U A;  4LLL A;  3F8C A;  2XRN A;  1WKM A;  4HQM A;  2ZO4 A;  4IRI A;  2LDU A;  4G8X A;  3ZN0 A;  1XCV A;  3TOA A;  2BBY A;  4RB3 C;  3ECH A;  3F8F A;  1BC8 C;  1D8J A;  1WI9 A;  5FLX Z;  5FGM A;  5JVT A;  1O7L A;  1UST A;  4BHB A;  5DUK A;  3KLN A;  3J81 Z;  1TQI A;  4KT5 C;  2NNY A;  3ABT A;  4EJO A;  4LG0 A;  2CFX A;  3IWZ A;  3WTZ A;  1Y0U A;  1KYZ A;  5E8G A;  1YS7 A;  1U8R A;  2NRA C;  4LLN A;  1R5G A;  1XSV A;  3ZMV A;  1DUX C;  3RDI A;  3HSE A;  1I27 A;  4YG2 F;  3SQN A;  1XGN A;  5ED4 A;  1A04 A;  1B9N A;  4WXH A;  4GO1 A;  1K78 B;  1CF7 A;  5K5R A;  2HGC A;  1V4R A;  2CW0 F;  4KNY A;  1E17 A;  4M72 A;  2Y75 A;  2IP2 A;  4P9F A;  1S3J A;  2O3F A;  1UB9 A;  5DDG A;  1J75 A;  2L3D A;  5LGU A;  1OYI A;  3V7C A;  4M6Y A;  4QWQ A;  3BRO A;  1KU9 A;  3M7G A;  2G9W A;  5ERI A;  1P4A A;  1T39 A;  4R79 A;  1MD0 A;  1FT9 A;  3BOQ A;  2QWW A;  3WE3 A;  2KIF A;  1O3S A;  1SFE A;  4ESB A;  1R00 A;  2DI3 A;  1FP2 A;  2Y0M A;  3FMS A;  1YIO A;  2F2E A;  4ZYH A;  4QLC U;  3LAJ A;  4RGR A;  4GXO A;  3CUQ A;  3M8F A;  4HZF A;  2DQR A;  1JHF A;  2XKP A;  3W6K B;  4L9N A;  3ISP A;  2GAU A;  2XRO A;  1JGS A;  5DD4 A;  1KQ0 A;  4HYE A;  4OU0 A;  2P8T A;  3KE2 A;  1BIB A;  2KIM A;  4KUM A;  4P5O A;  2VN2 A;  3IL2 A;  1TQM A;  1EH7 A;  4G9Y A;  1Z1D A;  1F5T A;  4WCG A;  3V8J A;  3FMR A;  2RGV A;  1MZB A;  4IRG A;  1TQP A;  3BPV A;  1VTN C;  1FWZ A;  4HV5 A;  4CO8 A;  1IF1 A;  1PUE E;  3G3Z A;  4JK1 X;  4U88 A;  4N9H A;  2M45 A;  2O61 A;  3H92 A;  3C1D A;  2UXN A;  4GYG A;  3HUG A;  4IRH A;  1R7J A;  3PFI A;  3I53 A;  4MEY F;  3ZMT A;  1KGS A;  1WWX A;  1RIO H;  2Q8K A;  2NYX A;  1T2K A;  2D1V A;  4ESF A;  4RAZ A;  3TDU C;  2VOD A;  1P4W A;  3SZT A;  2VC0 A;  2DTR A;  2YX4 A;  4PCQ A;  2K86 A;  1BC7 C;  1OPC A;  2ZME B;  4U0V A;  2ADU A;  1L3L A;  1LQ1 A;  4L18 B;  1LDK B;  1B9M A;  3C3W A;  4A2U A;  4ASN A;  1KQ9 A;  1WQ2 A;  1BJA A;  2H94 A;  2QBY B;  4AVP A;  4E70 A;  2Z9O A;  4RB0 A;  1FYL A;  1C0W A;  1ZRF A;  1ON2 A;  5D6F A;  4KDP A;  1FP1 D;  1QGP A;  2PEX A;  1S29 A;  3F22 A;  2FNP A;  1QBJ A;  1J7K A;  4RAY A;  3GF2 A;  4UVC A;  2HTJ A;  4DNC A;  1IN4 A;  4HOB A;  2EA4 A;  1RUN A;  1YG2 A;  2FOK A;  4EMS A;  5IT3 A;  1W4M A;  4KIB A;  1GXP A;  3M8E A;  4HQE A;  1KU7 A;  5J8F A;  4P9U A;  1F9N A;  2KJB A;  3LWF A;  1HQC A;  3E97 A;  3GWZ A;  3CJN A;  4S05 A;  2QVO A;  5EEH A;  5ICE A;  1QO0 D;  5CVR A;  4OIR F;  2H09 A;  5JFR A;  3P9I A;  3DEU A;  1MJB A;  2ELH A;  2HS5 A;  1IRF A;  3G73 A;  4LD5 A;  3QRF F;  2TDX A;  5DCM B;  2Y48 A;  4BQA A;  3MCZ A;  2QM3 A;  4CHU A;  1Z7U A;  4UUV A;  1TW3 A;  3QP6 A;  2LSO A;  2XAG A;  4ZYD A;  2O8X A;  3MWM A;  4L9T A;  3U1D A;  2HTS A;  2M5W A;  2V9V A;  4Q4Z F;  2EV6 A;  5F64 A;  2E1N A;  4Z2Y A;  3E6M A;  1W5T A;  1O7F A;  1HKS A;  3V7S A;  1YW7 A;  2P6S A;  4HX8 A;  4ZH4 F;  5CJ9 A;  1WRJ A;  4F7Z A;  4EV0 A;  5L3C A;  2M1B A;  1FBS A;  2PMU A;  1O3R A;  2BYV E;  3FX3 A;  3KZY A;  4ZZL A;  4KMF A;  2FMY A;  4ENM A;  3C7J A;  3WTW C;  3GZ5 A;  2PLY A;  1XB4 A;  5CVV A;  4WF2 A;  1FNN A;  1EV7 A;  1T6S A;  1RI7 A;  3WTY C;  3LA3 A;  2OQG A;  2COM A;  5HVQ C;  3ROU A;  1SAX A;  2LF7 A;  1J2X A;  4IVN A;  4KA4 A;  4CDG A;  3E5X A;  2CYY A;  4UV8 A;  4G7H F;  3GUD A;  2FBI A;  2L4M A;  4U0W A;  4IXA A;  2MA3 A;  2RC4 A;  1YW9 A;  3WU0 A;  4L5I A;  5BPD A;  2CO5 A;  1R1U A;  3K1M A;  4M74 A;  2Z5U A;  1PP7 U;  3D0S A;  3I54 A;  1J0R A;  2QQB A;  2OBP A;  2PJP A;  1FLI A;  3E3V A;  1YFH A;  5AON A;  5KK1 A;  5E17 F;  2AXL A;  1I1S A;  5CYV A;  3ZN1 A;  2Q2E A;  2OZU A;  5HDG A;  2VC1 A;  5HLI A;  4M9X A;  2VE8 A;  2CSO A;  2AS5 F;  4LG0 B;  1U2W A;  3WGH A;  1B6A A;  4RGS A;  3FF5 A;  4UVA A;  2C6Y A;  5D5V B;  4EJW A;  4G7Z F;  2H27 A;  5A2Q K;  1DDN A;  3GXO A;  4OIN F;  2ACJ A;  4M71 A;  1Z9C A;  3W6J B;  3WGG A;  2ZFW A;  1U3E M;  1MGT A;  5BQT A;  5FD5 A;  5F6F A;  4MNU A;  2PFB A;  3IKV A;  3KCC A;  2GA2 A;  1ZG1 A;  3P7N A;  3T8R A;  2HR3 A;  2IPQ X;  5ILU A;  5K5Q A;  4PGH A;  2BE5 F;  4MGR A;  1R5H A;  3M9A A;  2R3S A;  2V1X A;  1W7P A;  5CVI A;  4MQV A;  2EA2 A;  1JHH A;  4ON0 A;  4BHC A;  2P5K A;  2OZ6 A;  2IRF G;  4EVI A;  1KA8 A;  3LA2 A;  4IHS A;  3HSF A;  5J6X A;  3O6B B;  1G6N A;  2XAQ A;  4EJT A;  3LFK A;  5ICC A;  4NB5 A;  1U78 A;  2KIU A;  2HKX A;  1NHA A;  4O3M A;  4L5J A;  4AIK A;  3D5L A;  4FHT A;  5H6Q A;  1FYM A;  3V8L A;  1DP7 P;  1SD6 A;  4TV7 A;  1QZY A;  1QZZ A;  1G3T A;  2STT A;  1PDN C;  3BPX A;  4ENN A;  3KP2 A;  1E2X A;  2P5V A;  3NRV A;  4M73 A;  3CUQ B;  4MQ9 F;  3J7A O;  3F23 A;  1S7O A;  1KYW A;  3GYH X;  4B8X A;  3QAH A;  3B02 A;  1T0F A;  4MEX F;  1J9I A;  3NQO A;  4RB1 A;  2RNJ A;  2H6B A;  3MEX A;  1TNT A;  3IRQ A;  1XMK A;  2HOE A;  4OIP F;  3R61 A;  2Z99 A;  5E1X A;  3CLO A;  2P7V B;  3VOD A;  5CLS A;  1U5T C;  3K1P A;  2W24 A;  1ZAO A;  2M87 A;  1P6R A;  3I4P A;  4L9J A;  1ODD A;  5FFX A;  4XBF A;  5L3B A;  4OOI A;  3HRT A;  1XGO A;  3RIR A;  4KYW A;  3TKY A;  3GFM A;  4LB5 A;  5HS8 A;  2RDP A;  5H6R A;  1XD7 A;  2EFP A;  3GW2 A;  4RGU A;  3I0T A;  4I0B A;  3PQJ A;  4G7O F;  1IW7 F;  1XDS A;  5HDK A;  3QU3 A;  5LHG A;  1FSH A;  5HS7 A;  1STZ A;  4OMZ A;  1R1V A;  3WGI A;  2GXB A;  1IZ1 A;  3EDP A;  4M9Z A;  4G6Q A;  2QLZ A;  3MFK A;  4ZZD A;  4HDU A;  3DP7 A;  2DW4 A;  2D45 A;  4MTE A;  2X4H A;  2XAJ A;  4EJV A;  3JSO A;  3DXJ F;  3FXQ A;  2XKO A;  2W57 A;  1TLH B;  4UVB A;  2HYG D;  3I59 A;  1UHM A;  2JPC A;  2JZY A;  1ZRE A;  5JHU A;  2RQP A;  3HOS A;  3RKW A;  1I5Z A;  1B4A A;  1IN7 A;  3DQV C;  5H20 A;  3HRS A;  2KJC A;  5E1W A;  2QQA A;  3ELK A;  1O3Q A;  3MZY A;  3H3U A;  2XUB A;  4IHT A;  4P55 A;  5K1Y A;  4LB6 B;  1GHC A;  3GZ6 A;  5D4S A;  1HW5 A;  4UHT A;  1BBY A;  3RPQ A;  3JAM Z;  4PGG A;  2DBB A;  3VOE A;  1RNL A;  4XSZ F;  1BI0 A;  1XSX A;  4PDK A;  3I71 A;  3DPT A;  1FC3 A;  1H0M A;  1IRG A;  4GCV A;  3QPH A;  2W85 A;  3WTX C;  5E20 A;  2P4W A;  2J5O A;  2YR2 A;  4BNC A;  4D0P A;  3CDH A;  4ETS A;  4IPA A;  2A6H F;  2YSR A;  1B59 A;  1JE8 A;  5BOX A;  3FM3 A;  5A2Q Z;  1FBQ A;  2M8E A;  2OAZ A;  1ZG5 A;  4I7H A;  1FX7 A;  3BJA A;  3FMQ A;  3CO7 C;  2E7W A;  3TDZ C;  3U9G A;  2V1D A;  3WOD F;  3T0Y A;  4NHJ A;  3CTA A;  3IRR A;  2XIG A;  4WXD A;  1W7P D;  4U0Y A;  3I58 A;  3BP8 A;  4A6D A;  1KU2 A;  3Q5F A;  2VBZ A;  4OIQ F;  2P6T A;  4EGZ A;  1XCB A;  3RPU A;  3P9K A;  4BAY A;  1G3W A;  2HQN A;  2GWR A;  3SZP A;  1UHW A;  1D8K A;  1KQ8 A;  3GO5 A;  4HX7 A;  3N4M A;  2DQL A;  3BJO A;  2NAZ A;  2A5Y B;  3QOP A;  4BXU A;  4L9V A;  2Z3Y A;  5DV5 A;  3FXU A;  1FPQ A;  1U5T A;  4L0Z B;  2BV6 A;  1H9T A;  3FHZ A;  2M30 A;  2O6G E;  3TQN A;  1SMY F;  3K0L A;  4CXF A;  1JXS A;  4I09 A;  3IC7 A;  1PP8 F;  2VOO A;  2H6C A;  2NNN A;  4AIJ A;  4HV6 A;  3ULQ B;  4ZYE A;  3IWF A;  2E1C A;  1ZGJ A;  2ESH A;  2WV0 A;  3H3Z A;  1ZHF A;  2ZNZ A;  2EFQ A;  4AWX B;  3GFI A;  5LHI A;  5TRD A;  2ISY A;  3F8N A;  5ILV A;  2NS0 A;  1Z6R A;  4RB2 C;  3DKW A;  1QPM A;  4CYD A;  3HYI A;  4EQQ A;  2XAH A;  1EH6 A;  3NEU A;  5D6E A;  1CGP A;  3DV8 A;  4Q48 A;  3ZPL A;  1WSU A;  2QEN A;  4MTD A;  3ZMU A;  2XVC A;  4M6X A;  4BHP A;  4GYI A;  2FF4 A;  2CQK A;  3DFG A;  2G7U A;  1R22 A;  4XLP F;  1Q1H A;  1R58 A;  3R60 A;  1U6G A;  2VT3 A;  3ECO A;  2IT0 A;  3HTU A;  2YX7 A;  4HW0 A;  1GXQ A;  2HKO A;  5L3D A;  2MBF A;  2UXX A;  3N97 A;  2DO7 A;  4ENJ A;  4RGX A;  2Q0O A;  4Q5S F;  2FNA A;  1S7A A;  2F5C A;  3KP4 A;  3KP7 A;  4AD9 A;  1SMT A;  1V3F A;  1SD7 A;  2QBY A;  4O5V A;  2IA1 A;  2GA1 A;  3WTV C;  3Q9S A;  4HX4 A;  2P5L C;  1O57 A;  1ZYR F;  5HS9 A;  2DAO A;  4B09 A;  4A6E A;  3E6B A;  2B0L A;  2FXA A;  5L3G A;  4Y17 A;  3QPT A;  1ZRC A;  4LK1 F;  4N0B A;  1YW8 A;  1XGS A;  3DPL C;  1BM9 A;  1OYY A;  3J80 K;  2O03 A;  4BYY A;  2R7F A;  1ZH5 A;  2ZCW A;  2K7L A;  3FM5 A;  2OQR A;  3WTU C;  3EUH A;  5IT9 Z;  3L00 A;  2FBK A;  4FT8 A;  3JAM K;  4U7D A;  3SFZ A;  4KIC A;  5LRR A;  4HF0 A;  2JRT A;  1YLF A;  3LQR A;  2WTE A;  4YIF A;  3GVA A;  4R8H A;  3K1N A;  3IKT A;  4A0Y A;  5D5U B;  1P4X A;  4XLN F;  3KZZ A;  2IVM A;  2PMH A;  3L2C A;  3F8M A;  2EV5 A;  2XAS A;  5FO5 A;  3F8B A;  5ICF A;  4WX9 A;  2GQQ A;  4CIC A;  3JTH A;  5D8K B;  1SFU A;  1HXD A;  1BOA A;  5DEQ A;  2VE9 A;  2O0Y A;  5D5X B;  1CF7 B;  1DPU A;  5LLQ A;  1REP C;  5CVJ A;  1HKQ A;  3LQQ A;  2QUF A;  3F21 A;  1T98 A;  3F3X A;  2IA2 A;  5JR3 A;  2VT2 A;  2A69 F;  3EET A;  3K9T A;  2IW5 A;  2K02 A;  4Y13 A;  3F6O A;  2HDC A;  4CGZ A;  5BS6 A;  2QYO A;  5BMZ A;  2MC3 A;  3I64 A;  2F5D A;  2MH9 A;  1FBU A;  1XN7 A;  4ENK A;  2RKH A;  1LEB A;  2ZJ2 A;  3IHU A;  1R23 A;  2JSC A;  3KLO A;  3MQ0 A;  2E7X A;  3AAF A;  1ULY A;  2FRH A;  1HSJ A;  3HTS B;  1XDU A;  2FBH A;  2A3S A;  1MJA A;  3SHF A;  1ZLK A;  5E8I A;  3K69 A;  3R6S A;  3LAP A;  2EWN A;  2EV0 A;  3R0J A;  3I59 B;  1D5V A;  2IA0 A;  3RJP A;  3HRU A;  1J5Y A;  1ZLJ A;  5L3E A;  1F1Z A;  4S04 A;  4HLY A;  5ICG A;  4RS8 A;  3ERE D;  4HDV A;  4KN4 X;  2DLL A;  1TTY A;  2CG4 A;  1LB2 A;  3C18 A;  4A0Z A;  2VOP A;  5FD6 A;  1MDM A;  4YFK F;  2STW A;  5L3F A;  2ZNY A;  5E1Z B;  2A61 A;  3FWE A;  1YQA A;  2RV8 A;  4A5M A;  1ZG3 A;  4LMY A;  4K2E A;  4HA8 A;  4KMU X;  3KET A;  1MJ9 A;  4PZJ A;  4KFC A;  2K4J A;  1MKM A;  4IJA A;  4EM2 A;  1OYW A;  3GEZ A;  2IJL A;  5DUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...