3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
1LSSA 1R16A 1WNTA 1YS4A 1ZFNA 4IDEA 4Q3CA 1N2SA 4RZHA 1YDEA 2CDCA 2Q1TA 1PZEA 1ZK3A 5L4SA 2YHUA 1EE2A 1LSJA 2YYYA 3LC2O 4NDNE 4CLDA 4NIMA 3BMQA 3K2EA 1UZNA 3AY3A 1DB3A 2Y1GA 4AJHA 3OIFA 3ZV6A 1U4SA 4PCVA 3KYCA 4L4RA 5EL0A 1SOVA 4YJGB 4Q39A 3WYBA 3UCXA 1GYQA 2BHLA 1GUYA 1ONPA 1R12A 1ZEJA 3EZYA 2E4AA 5GY7A 3DTTA 3L6OO 1JTVA 1NHWA 2EEZA 4JJIA 4CMEA 4IDDA 2Y1CA 3EDMA 1YVEI 3K5PA 2HRBA 3GUYA 3CSDA 3BMOB 2BFOA 1HSZA 1DJQA 2HJSA 3RSHA 4EW6A 4RLHA 2NVWA 5TX7A 3GPDG 1EDZA 2PV7A 3ZWPA 3I9JA 3WBFA 1GPJA 1DEHA 3NAQA 1NR7A 3DB2A 4LMRA 3VKVA 2Q46A 4ZJUA 4F6CA 2BLLA 5IZCC 9LDBA 3CZMA 4D44A 3MWEB 3AU8A 1EUDA 1ZVMA 4CM8A 4FJ2A 5TQVA 1DHRA 3LF2A 2DUWA 1P9LA 3WGOA 5A03A 5K6AC 1MV8A 1R4NB 1KS9A 3ROQA 5ADHA 4DMMA 1QV7A 5IDWA 1NQOA 3QWBA 1O95A 4K9DA 4DQVA 3PWKA 1G0OA 3GF4A 4KQXA 3DBHA 1NTOA 1DFIA 4BGIA 3VTFA 1DLJA 2ZQZA 5CPBA 1E7RA 3D4NA 8ADHA 4B3HA 3UHAA 2C5AA 4B79A 3WGGA 1QORA 1C0PA 4BNVA 1T1RA 2JAHA 4BNTA 3HHPA 4A7PA 2XXJA 2V7PA 3FBTA 3RJ5A 2UVDA 3A9WA 1ZK2A 3E82A 4YQZA 5C5IA 4I9UA 3KHUA 4M54A 4YAJA 2QIOA 4M55A 5KVCA 2X86A 4WECA 4DA9A 3JQ8A 2NM0A 3H7AA 3ROMA 3NEPX 2PKRA 5BR7A 2DUUA 4R4JA 3DZKA 3JQAB 4LW8A 1L1FA 1PGPA 1B3RA 2BMAA 2E37A 4L76A 3HSKA 5COAA 1J0XO 1HT0A 4BVAA 3S55A 4OOFA 4XYMA 3TSCA 1GZ6A 4AVYA 1Q0LA 3WMWA 1ZUD1 4N5NA 4Q3EA 3ZGYA 2X9GA 1VLLA 2GYYA 4OO3A 4Y9DA 2D1YA 2PKQP 2O50A 4QSMA 1A4IA 1U8FO 3OSUA 1AXGA 1A4UA 1PX0A 2EW2A 2NSDA 4L73A 1KVUA 1N9GA 2FOIA 1E3IA 1HKUA 3TZ6A 5G0WA 3L9WA 3O03A 1HYGA 4A5OA 1ADCA 3TZQA 4K28A 1OI7A 5BNFA 1LQTA 1SEVA 2UUOA 4DQUA 5U4QA 4CODB 1X7HA 3X2FA 4UEJA 2PD4A 4DPMA 3FRJA 3D3WB 1AE1A 5IJZA 3DZJA 3NTQA 3KSUA 4BNMA 1V35A 1DRWA 1JW9B 1PZGA 3EY4A 4BOYA 5LCXA 2VYNA 4AL4A 1B15A 4PLVA 2A92A 4QFCA 4Y67A 3IQDB 5A9TA 4DUPA 4ALIA 1X15A 2C54A 1E5QA 2VWQA 2C5EA 3BZUA 3F1LA 4NU5A 3RFTA 4E31A 4DLLA 2EWMA 3PDUA 1GUZA 1B14A 3GZNB 1WPQA 2CNBA 2Y68A 4K6CA 5EQFA 5TRTA 5HS4A 4EEXA 2SCUA 3G79A 1YO6A 3O8QB 1KC3A 3WLFA 3SLGA 4WEOA 4BIIA 3Q3CA 5A06A 3VH1A 3K2BA 4E32A 4R3NA 2X4GA 1F8GA 1YL7A 4OHUA 4Q3AA 2NV6A 5T5QA 3HDYA 4U8GA 2XXBA 3GGOA 3BMQB 4FGWA 5T8KA 1XHLA 1UDCA 1QYVA 1W8DA 1PGJA 1YONA 1ONNA 1E1MA 1EVIA 4WLUA 1JVBA 3I83A 3SX2A 3HADA 4D43A 4E2ZA 5BSGA 3KYCB 2I99A 3G1UA 5AYVA 2O3QA 5JDCC 3MJTA 1ARZA 1FXSA 1DC6A 1IPFA 1GAEO 2XAAA 2VHVA 1GD1O 3JQFC 4AJJA 3ZNOA 1VSUA 4CL3A 3LT1A 2H1SA 1MB4A 3H4VA 1S6YA 3WMXA 1E3LA 3KYDA 1SEPA 3RBVA 4YYZA 1YRLA 1B8UA 1YB5A 5JS6A 3A14A 4N18A 4BO9A 2ZB7A 2FZWA 3PEFA 4CV3A 3PJDA 4WOJA 1HLPA 4CQLB 1IHXA 1QLJA 1LSUA 1QP8A 1IHYA 3GDGA 4NZ9A 3KB6A 4B4OA 4FOOA 1AHHA 1WVGA 3IDSA 3JD3A 2YDYA 3GQVA 2VWHA 3FNHA 4CM8B 1NP3A 1Y5RA 2HMWA 3ZWNA 3WFJA 2P9CA 5DNAA 4RO0A 1K0UA 2ZJ1A 4IINA 3IKVA 1LDMA 4WASA 4XWYA 1C3VA 1QMGA 3GA0A 1NHGA 2D59A 4HFJA 1X14A 4PLWA 4AJEA 3JYPA 4BO0A 3DBHB 2X5KO 4ZD6A 3I9KA 1YXMA 3N7UA 3FNFA 1HE3A 2Q2VA 4E13A 1QLHA 4NG5A 1ENZA 2PD3A 2UAGA 4DLAA 4U5QA 5ITWA 1FMCA 3C1TA 3AI1A 4PLGA 3QWIA 3QVOA 3PVZA 1GUFA 4YJDA 3CZRA 3ZV3A 2BI7A 5HA5A 3LK7A 2EXXA 1U28A 1DOHA 2HDHA 1MLDA 2YZ7A 4MVJP 2XOXA 5EIOA 1E3EA 3WFIA 3RUIA 3ZWYA 5FI5A 3INRA 3INGA 2EGHA 2UYYA 2NVBA 4M86A 1DLIA 4KTTE 1Y8QB 2D2IA 4R69A 4DREA 1PGNA 2VOJA 2ZCVA 2Y0DA 3WTCA 2WYVA 3DAFA 4LMPA 2PY6A 5KJ1A 3GAFA 3B1FA 4FIZA 1C0IA 4XGKA 1C1XA 3ROKA 4TZKA 3FR8A 3FSRA 4YAEA 4GPD1 1I2CA 4AJ2A 3RC9A 1G0NA 1PU2A 3OJFA 3AU9A 2YHIA 1IL0A 4RV9A 5I9MA 1JKIA 1L7EA 2DAPA 2CY0A 1E3SA 1U7TA 4FB5A 4XB1A 4EI2A 3NDRA 1U2DA 3RBXA 5IZCA 3MCVA 4QUKA 5JXWA 3GVHA 2Z1NA 2AMFA 3O9ZA 3KEOA 3FR7A 3V2HA 4B3IA 1T26A 2PR2A 2JKVA 1LBEA 1LC3A 2Q49A 3CH6A 3JYQA 2E82A 2I5PO 4IGFA 3V1YA 4YRBA 5K6AA 3LU1A 1QSGA 2VZ8A 2FMUA 2B4TO 1SZJG 4HX5A 1VKOA 1X1TA 3NJ4A 1XELA 3CIFA 4MKZA 4ALKA 3HZZA 5ER6A 4EITA 3QVWA 5B12A 5C7IO 4E0BA 4OGWA 4ND4A 1HDOA 3AY6A 1CYDA 2J3IA 4ALMA 1QRRA 4R3WA 1N1EA 2VQ3A 1Y5MA 4J0EA 1EE9A 2FN7A 4GL4A 1E1NA 4DC0A 2PLAA 4EBFA 4EGFA 2GD1O 1GEGA 1FF9A 2FSSA 4BNZA 3E9NA 4QO8A 2PWZA 3V2GA 2OP0A 3EMKA 1Z82A 2OBYA 1O94A 3RKRA 5FF9A 1WZIA 2DBZA 3DMTC 3LLSA 4P38A 3ZWXA 2Z1MA 4KWIA 1IUKA 2B0JA 2XF8A 4XQEA 4IZIA 4UEKA 4PG6A 2W4QA 3JCZA 3TZCA 2VTDA 5JBIA 2O2SA 1IOLA 5TF4A 2CF5A 1FDVA 3TPCA 3GN1A 5AXCA 1LDEA 5F21A 1PEDA 4BUCA 2WSBA 4BO5A 5HS6A 3VDRA 1DIGA 4MVJE 1BW9A 4A10A 4DC1A 3CINA 5H83A 1ADFA 2HRZA 4CQMD 2CVOA 1C0LA 1C0KA 2JD2A 1PQWA 2O2YA 1E3WA 3Q2KA 3C3XA 1LSOA 4M87A 3RAJA 2X6TA 1DFGA 3R3SA 5JPIA 5HM8A 1RM5A 3FPLA 4WLOA 5G0UA 3GH3A 1C14A 1AUPA 1GQYA 1N92A 1ZJYA 2ZK7A 2TMDA 2HMSA 4AJIA 3DOJA 1ZSVA 2EP5A 1E7YA 1T4BA 3KM0A 2X9NA 2CF6A 4LVCA 3RBZA 4WNCA 4XIJA 1GADO 3KLMX 4CLXA 4MIYA 1HDXA 3F47A 4MIEA 1ID1A 4NHEA 4BMNA 5JCJA 1H9AA 1DO8A 4XGNA 5ICMA 3U09A 1HSOA 1HRDA 4CM4A 2BFAA 1GU7A 2D8AA 2ZTVA 3LZ6A 3NTRA 4EJ6A 2EW8A 3B70A 4CMBA 4BKRA 3AFMA 3HN7A 5DN9A 5KJFA 1V8BA 3PHGA 4YT5A 4YBZA 4D0RA 5I7EA 5LC1A 5L95A 2RHCA 1KEPA 3I6QA 4H15A 4O0LA 1O8CA 4PRLA 1LRJA 3ZV5A 2GF2A 2DVMA 3BTUA 5CPFA 4E2WA 5EN4A 3AWDA 5CDTA 3L4SO 3M1AA 2W2KA 4S1VA 5FYDA 4TVBA 4C7JA 4LVUA 3C1AA 4J1QA 4RF3A 3WIEA 3P2OA 4BGUA 5EJ2A 4LN1A 4Z0PA 1Y8RA 4H16A 3LVFO 4BNXA 4UVDA 1PWZA 2AA3A 1Y7TA 4DIOA 2HLPA 3FCOA 1VM6A 1P1FA 3DBLA 3FTPA 2O23A 4CV0A 3I23A 5FI3A 2EKLA 1HDGO 2GN4A 2VHYA 3AI2A 1IE3A 4Y8VA 4UULA 3MZ0A 1YBVA 5A05A 3E48A 5JDCA 3E5RA 1UAYA 4HADA 1YBMA 3JQFA 3KLPX 4BNGA 1T24A 3GHYA 2PA3A 1H5QA 5T57A 5BSFA 4TKLA 1C1DA 4CR7A 2BKAA 3EHEA 4J2HA 4H7PA 1C1XB 1XG5A 5JC8A 1EVJA 1LUAA 4RVGA 1YWGO 2B36A 2CD9A 4BGEA 5JO9A 5TT1A 4J2OA 4AJOA 2YHIB 2OP1A 1UP6A 5TSDA 1NM5A 1Z7BA 4BO8A 4XRGA 1M6WA 3GRKA 3TL3A 1WZEA 1X1EA 4RVSA 4XQGA 3PZBA 1AHIA 4HKTA 1N7GA 4Y6PA 2B5VA 2Q1UA 3C7DB 4FPXA 3S2EA 4WLEA 4YJFA 4J1SA 2EV9A 5DBIA 2I67A 1YBAA 4IQ8A 3Q11A 3ZWCA 1XU7A 4BO4A 4NMHA 2GERA 2DTXA 4P4GA 4PGFA 5A9SB 2PGDA 5CG1A 3ZWMA 1XEAA 2PZMA 3GRPA 2A9FA 5IF3A 1QYXA 1P44A 2JL1A 5BSHA 3WWYA 5GMOA 2VRCA 1EDOA 3QLJA 4YWJA 4A27A 4FGSA 3ZWBA 2HSDA 4GVLA 5ES3A 1HTBA 1JKJA 4PLCA 4NK5A 1OOEA 1WMBA 3GOHA 1B0AA 1WP4A 2P4HX 4AFNA 4C7KA 2C0CA 2WD8A 1T2DA 4AJNA 1WMAA 5H81A 2DFDA 1DRVA 4ZQFA 1ORRA 2YV3A 3ZHBA 2PH5A 1EMDA 4ND1A 1Y9EA 5IXSA 1D7OA 2Q45A 4U0KA 2X5JO 3DEYX 1K6JA 1FJHA 3UXYA 1UP4A 3D4OA 2FZEA 2JJYA 3UF0A 3WJAA 2VUUA 3OICA 1BW9B 3A4VA 2VHXA 3S2FA 3I4FA 1R0KA 4RF2A 1I01A 3GAZA 3H9JA 3GEMA 3K31A 4LCEA 1P1JA 2QG4A 3E03A 4OJNA 3SC4A 3V2UA 3WYCA 4JBGA 1E6UA 4G2NA 2P9EA 4K26A 3SC6A 2ZB8A 3JQEA 4R68A 5B4TA 4WCFC 4KOAA 3JQ7A 5KKCA 3GPIA 2QX7A 2O4UX 4DIBA 3OBBA 1T25A 1VL0A 4F46A 3DDNA 3EGOA 2J6IA 5JMPA 2VT2A 3ZU2A 3AUAA 3FPCA 2QRLA 4D45A 5CEEA 4BNJA 1DC5A 1Q7GA 3VPGA 2I9PA 4JXKA 5K0ZA 4PZDA 1RKXA 4BO3A 5BT9A 3ZNPA 4HP8A 3WS7A 1UZMA 4K1LA 3S8MA 4CMJA 1UXJA 1QKIA 3E6AA 4O63O 4FN4A 4BHTA 5EINA 1PR9A 1LDGA 2YDXA 5KWEA 2TMGA 2ZTUA 1YQGA 3PHLA 4IQGA 1NPDA 3DMTA 4IS3A 5DDIP 2W2KB 4MVJF 3RFVA 4TMFA 1XQ1A 2Q1WA 3D7LA 5B37A 3H3JA 2VOEA 4BKUA 4OYRA 4J1NA 2J5RA 1UXIA 3NTOA 1TEHA 2FSVA 4IM7A 5T64A 1RJWA 2QYSA 1BXZA 3NT5A 1BG6A 2A35A 4B7XA 1NVGA 2NU6A 5AXDA 3HFGA 3SBOA 3BMNA 3OA0A 1BHSA 2JFFA 1KIFA 3JQBC 3AY7A 4J4TA 2VHZA 2OMEA 3WGYA 2JHFA 3DO5A 4YT4A 1R4MB 4Q3NA 4JP2A 4KUEA 4TRNA 3RROA 4CUZA 2RAFA 2Y1OA 1P74A 2FR8A 3UGKA 4ZHSA 4IDBA 1ML3A 3SEFA 1B8VA 2HMUA 1C1DB 1CDOA 2WWRA 4R1UA 4CQMB 2NADA 4AICA 4E12A 1M6HA 3LYLA 4WLFA 1RYDA 1I3LA 3F4LA 3PDJA 3NUGA 1B3BA 3ZCXA 3SVTA 4G5HA 1HE5A 4XD2A 4DRYA 2J5KA 2VUSA 4RCVA 2GR9A 2C7GA 4OQZA 4YPOA 2BGKA 2H6EA 4EJMA 1GFSA 4M1QA 4CUKA 2NVUA 1CRWG 4CMHA 4YJFB 5F1KA 2B4RO 3OEWA 3DHEA 4G65A 4N7RA 3UUWA 4Z3DA 4XIYA 4ALNA 3WSVA 4UREA 3K92A 1I36A 1GQQA 5DF1A 4D46A 3R1IA 4DYVA 2X7HA 3UN1A 3P5SA 3QQPA 4IZHA 3D64A 5EPOA 3EUWA 4XJSA 2VYND 3V5NA 4NFSA 4UVHA 1IYZA 4FBGA 4KQWA 2X0IA 3ANMA 1UDBA 1E3JA 3BA1A 3BHJA 2O3RA 1IPEA 1LLUA 3K9QO 5IXYA 4UVEA 1KETA 1A72A 4CPDA 4B8ZA 3U5TA 3IS3A 3C8MA 3VZRA 1Q7BA 2DM6A 3V1UA 4R01A 5F5NA 5L51A 1PQPA 3WOHA 5I8ZA 3DFUA 4CR6A 4DMLA 1K6IA 4WCDA 2RH8A 3C1OA 3ULKA 3ZH2A 5B4UA 4ZA2A 4EZBA 4Y6RA 1DHTA 3KO8A 3QE3A 3WQQA 3B6ZA 5KJCA 2AE1A 2H9IA 3X2EA 2FY8A 5C3MA 2Y0CA 3KOUA 2HAEA 1F0YA 3I52A 1WWKA 1E77A 4CM7A 4ZQGA 3GMDA 4KTVE 3WJ7A 5JAMA 5L7TA 2I3AA 2CMDA 3TZKA 4E6PA 3H9QA 4PLFA 2JFGA 1I24A 2BGMA 3ZW8A 3GNSA 4HNGA 1ONOA 3AOEC 2Y1DA 2HO5A 1SC6A 4D41A 5ITVA 2NACA 2VT3A 3PHJA 3JQ7B 3MOIA 1U8XX 3HUDA 2Q2WA 2JCYA 3MJVA 3ZWWA 2POQX 4DBVO 1ZSNA 4GLOA 4FC6A 2IDZA 3HE3A 4Z0HO 3VH3A 4LCJA 5IN5A 2H63A 2ZTMA 4JGBA 5GZ6A 1ZXBA 3PJFA 2F1KA 3WQSB 4R9RA 3VPFA 1LQUA 4W6ZA 2IZZA 3W6UA 3JQGA 3VPHA 3O38A 2PGJA 1ISGA 3ABIA 3E5MA 4I1IA 5DP1A 1YJQA 4ZQBA 3ZHXA 5TIIA 1ZSYA 3JD1A 4OKIA 1P31A 2OO5A 2AW5A 3ZHYA 1NASA 1HE2A 3KETA 3L4BC 4RVFA 2GZ1A 3F1KA 3HJAA 2PGLA 2D5AA 3WX0A 2Q4EA 4EEZA 5KVSA 4IJVA 1ISIA 1FDTA 2QQ5A 3BTSA 3E9QA 4HWKA 1I3NA 3TJRA 1GV0A 3B1KA 5IDYA 3WLEA 1V3TA 3CUKA 3IUPA 4RLSA 4IDGA 4WK6A 4QFDA 2W8ZA 4YAGA 1R0LA 4E33A 3CKYA 2FWMX 1NFRA 3S1LA 2Y67A 4BNFA 3RU9A 2RH4A 4BS9A 4MOWA 4HV4A 1EUZA 3QWAA 4XKJA 4GMFA 1PJQA 2AE2A 4OIMA 3BYZA 2PZKA 1JAYA 4NI5A 5ILGA 3D0OA 4CLEA 5CEJA 1U3UA 3LSYA 4KUHA 5I8WA 3K6JA 2Y99A 1JKFA 1SBYA 3ANNA 3CEAA 1OFGA 3PHIA 3S2GA 1U3TA 3H8VA 4WJZA 3PQFA 4WCFA 3TNLA 1V0JA 1M76A 2G0TA 3F4BA 5TC4A 1B26A 2QRJA 2BFMA 3GN2A 4IS2A 3VZPA 1PJ2A 3H5NA 4I5DA 4D3SA 1KC1A 2P91A 2YFQA 1PJ3A 3GR6A 4IDAA 2BH9A 5BNIA 1VC2A 3TOXA 2F00A 3DZIA 1ISFA 4GX2A 3U62A 2PFGA 4ALLA 4CMIA 4F6LA 1EK5A 3GG2A 1IB6A 2YUTA 1WDKA 4L4XA 2C2YA 3ONFA 1U2GA 5JYEA 3UCFA 2I66A 2NVUB 3RI3A 4A2CA 3S2IA 4WEQA 3UICA 4J7CA 5KKAA 1ZIDA 3DZBA 4CJXA 4CV1A 2EJVA 5MGBA 2DTEA 3PTZA 5HBRA 4W7IA 4D79A 1BSVA 1QR6A 1UXHA 4CMCA 4LISA 2XPCA 3KZVA 5B4VA 1DIAA 2ZTLA 3DXFA 2AG5A 1HYHA 3KSDO 5IDXA 4JROA 1O89A 4FJ0A 4P8RA 4J43A 3HFSA 5JAIA 2V65A 4S3MA 3GHHA 1H6DA 3JV7A 4TROA 1H2HA 3K96A 3OFSA 1I30A 1T2FA 1U3VA 2X5OA 4RPGA 1I33A 2Q3EA 3JQBA 2OHXA 1O5IA 1DBVO 3NT2A 5THQA 3NGXA 4YDRA 3AI3A 1BMDA 4RDHA 3PQEA 1B8PA 3AM3A 4L9RA 3BHMA 4YT8A 1NQAO 3IL2A 1ULUA 3Q9NA 5C37A 4GI2A 3ICPA 2P9GA 5JY6A 1MC5A 1VKNA 1E1LA 4LRTB 4O5OA 3GDFA 2J3HA 3GVXA 2J8ZA 4L0QA 3JQ8B 1D1SA 1NBOA 3JYLA 1DAPA 1PS9A 4O6VA 3RC7A 3WICA 1JQBA 1NFQA 5DBFA 4CL8A 4CV2A 1ZCJA 5THKA 1NVMB 3MJSA 1VJTA 2VYVA 1TB4A 1XKQA 2B37A 4EYEA 3QVXA 1P33A 1MG0A 2Y0EA 1HE4A 3LC1O 4YACA 1GY8A 4NBWA 2W2LA 4R5HA 1MC4A 4B4VA 1GYRA 1K6XA 2IZ0A 2Q99A 4CM3A 3HG7A 2VNAA 4M8SA 3PP8A 1YJ8A 3Q0EA 1G6KA 5JCJD 4NPCA 4GAEA 3Q9UA 4IMPA 4PZCA 3LT4A 1A5ZA 3AOGA 4JBIA 5CAEA 1N9GB 2VCYA 1MXHA 4MVJM 3QV1A 3F5SA 5DCYA 1OMOA 3QHAA 5L45A 1DRUA 4J91A 1DC4A 4GWKA 4J7UA 1W6UA 2IYOA 4I8XA 4J3FA 4W9NC 1WDMA 2BELA 1EUCA 1E6EA 3NDJA 4D3FA 2A94A 1KBZA 2X0JA 2Y1FA 3OQ6A 5A3VA 1PZFA 3DOOA 4IDCA 4YCAA 1U9JA 1X7GA 5ENDA 3RKUA 3WBBA 4WLVA 4CM9A 2GCGA 1A7AA 4DVJA 5H82A 3VVBA 3D4PA 3GVPA 3ZNQA 1YH3A 3H9GA 1ZW1A 2QZ9A 3FNEA 1XSEA 4YA6A 3SJUA 1PJCA 1R15A 4J4HA 4XR4A 2O3SA 2P2SA 3PIIA 4NJOA 4TRJA 1MXFA 5K9ZA 1DIBA 1OBFO 4UUOA 4BNIA 4ESOA 3PGXA 1SAYA 1KEUA 1M66A 4FJ1A 5DP2A 2IYPA 3AOEA 4C4OA 4RF5A 2D0IA 4HFRA 1OC2A 3GVCA 4IUYA 1TVEA 5L53A 3HQ4O 1UXGA 4JN6B 4Y98A 1ZJZA 5EERA 4E21A 5F5LA 5MDHA 2UUPA 2AEJA 4WCFB 3W1VA 5I7VA 4TQGA 4IGEA 1ADBA 3D3EA 5DZSA 1H0KA 4FDAA 4XYLA 3AM5A 3WSWA 4J49A 5JCXA 3JTMA 1Q2XA 4ZN6A 4WPGA 2B69A 2V6GA 3F6YA 3OJLA 3VKUA 2VN8A 4KUGA 3ZWVA 3IC5A 1EQUA 1VI2A 4XQ9A 2D5CA 1BDBA 3ONEA 3DQPA 2NTJA 2OFPA 3VH2A 3MJ4A 3KYDB 3MWDB 4GMGA 1CQIA 2X22A 4EUHA 5CG2A 3U4CA 1LLDA 5TJ9A 2GSDA 4NH4A 4BNHA 4OSOA 1Z75A 2BRUA 3L4BA 4CLRA 3JQDA 1ZBQA 4JJFA 3HB4X 3JYOA 2EJWA 3NV9A 2VRCD 3F9IA 4KWHA 1P45A 2Z95A 4NJMA 1X7DA 4R1NA 3G1TA 3R6DA 3PFFA 3WR5A 3OA2A 2DTDA 1E7MA 3A28A 3WTBA 5HWSA 3GEDA 4PG8A 2R2GA 3ZI0A 2O7SA 1HYEA 3GLQA 1PJ4A 4IXWA 1NAHA 1AGNA 4RGBA 3PWZA 5JMWA 3LQFA 2ZB4A 3VH4A 4Q3BA 5KNLA 3WGTA 3QP9A 1WDLA 3R0IA 2E6UX 4UEOA 3RWBA 1YE3A 4RF4A 4PVCA 1PR3A 3L9XA 2RCYA 2DBRA 3C7CB 2FP4A 4J9VA 2FRDA 1KVQA 4OOEA 5EQDA 4XYEA 2R00C 4RQTA 3ASUA 3PPIA 5C7LO 1FDWA 2DBQA 3AW9A 3ZWAA 4F45A 5DBGA 4OXKA 3VZQA 5I7SA 2BI8A 2CVZA 2Y05A 4RZIA 4YB8A 4D0SA 3IOYA 1BRMA 4FFPA 4L4SA 2IRWA 1ZK1A 2LDBA 4K6FA 4FCCA 2ZQYA 5A3JA 2VUTA 4JP3A 4PIVA 3QWFA 3H2SA 1TT5A 1BWSA 2WDZA 2D4AA 3GG9A 4BKPA 3DONA 1RPNA 3RQSA 3R3JA 3ZDFA 4BO7A 1VRWA 5GZ3A 3F5QA 4AJPA 1HEUA 2BGLA 2B5WA 2P5UA 3ORFA 4OSPA 3FWZA 3JD0A 2NTVA 1NWCA 4PFJA 3UFXA 4BQRA 1HWYA 4ILKA 3QVTA 1ADGA 2VRBA 3T7CA 3O4RA 4TZTA 4U6SA 4YJGA 5IFLA 5JY1A 1J5PA 2PKQO 4IBOA 2G82A 3A06A 4I9HA 3U4DA 3UOGA 1LRLA 2O3UA 3VC7A 3KXDA 4PG7A 3MEQA 3HWRA 2NQTA 1MGOA 2NU8A 3BMOA 4HBGA 5G0SA 3EVNA 3GY0A 2NQ8A 3HNPA 2J3JA 4PLYA 1MUUA 3FI9A 5TNXA 1A9YA 2IEDA 3GZ4A 1QV6A 1A9ZA 3I9MA 4MKXA 2OL4A 5FFFA 2JCXA 4TSKA 3RJ9A 3W6ZA 1H6CA 2YFHA 1RM4A 4TRRA 3SJ7A 2FPIA 2HQ1A 5TLSA 1UDAA 1YQDA 3NX4A 4GX5A 1JVSA 3HDQA 1LXCA 1FDSA 1GR0A 1N1GA 4ITUA 1VL8A 3QIVA 5EESA 1QG6A 1K2WA 1NX6A 2Q2QA 1XIVA 3PQDA 2A4KA 1R4NA 3N58A 5U1PA 1Z73A 1K3TA 2HK8A 4P4LA 3RUEA 3UAGA 3P19A 2G1UA 3RU7A 5JAZA 1BDMA 3O26A 4MDHA 4Z9FA 3U3XA 1ZXLA 3IKTA 4NFYA 4BNUA 1HZJA 4TRMA 6ADHA 1UH5A 3OIDA 4NU6A 1E3WB 2E49A 2PD6A 4TKMA 2EIHA 2ZIZA 3EAGA 2AQKA 1I3MA 1MFZA 4XQCA 4KDEA 4R1SA 1KVRA 2FPPA 8LDHA 1A27A 3ADPA 4CM5A 1UR5A 1W73A 5B1YA 2QZZA 4KDFA 1X13A 1HF3A 2OUIA 5I7FA 4YR9A 2Y1EA 4OAQA 3UW3A 4W9NA 2HMVA 4ID9A 2HU2A 2ZB3A 4LSWA 4UUMA 3W8DA 1WLYA 3H9UA 2B35A 1W0CA 4O59O 4CM4B 4L74A 4JNKA 2DPHA 3FF4A 2C82A 3I9NA 1Y81A 1CWUA 2X8LA 3JQAA 3RUHA 1QYCA 4FFNA 5KCZA 4UAGA 5A5FA 2PK3A 4E2XA 3F46A 3FWNA 2NU7A 1YOVA 1HDCA 2EHDA 4PRKA 4RVHA 3TFQA 1ZMOA 1LA2A 3ENKA 1YB4A 1J6UA 4BB5A 3RASA 2HJRA 1YDWA 4U0JA 3IIEA 3MJCA 3STHA 2ET6A 2HCTA 4MVJA 4BV9A 1D8AA 1I3KA 1Y8RB 3ADOA 3DFZA 4EUEA 2DU8A 1P1RA 3PLRA 3WNVA 3HB5X 2HUNA 2IE0A 3ETDA 4GSKA 4E5MA 4GH5A 3ZWOA 2GPTA 1SCUA 3DBLB 3L0DA 1S7CA 2DT5A 4NQZA 1U7HA 3GVIA 2CUKA 3FD8A 4PLPA 1PJLA 2CDAA 2GN9A 2WYWA 3W4IA 5A1TA 1T4DA 4J1TA 4UVGA 1VJ0A 3DZFA 3RC2A 2OBNA 5JNLA 1ENPA 4JJGA 3GT0A 1F14A 3JSAA 1EZ4A 3TDKA 1YKFA 3AUTA 3OETA 5L4NA 5TJHA 3CTMA 1GDHA 4HFMA 4OM8A 3I1JA 5JDIC 2EERA 4BO2A 4AG3A 1O9BA 2O4CA 3I9LA 1D3AA 3EVTA 4R54A 5C7OO 2FPGA 1HDRA 3NT4A 3O8QA 4XEHA 1Y1PA 1GTMA 5CEFA 1TT5B 2CVQA 4GX1A 3ZV4A 2Z5LA 4DPKA 1SO8A 2HMTA 3GMSA 2PZJA 4N54A 2OORA 2G17A 5JE8A 5AQ1A 3WXBA 4QXMA 3GC6A 1JN0A 1BXKA 3L07A 2OXIA 5IDQA 4RVUA 3WB9A 5FWNA 1YGYA 3I4CA 2EG9A 3L77A 3DAGA 2GO1A 2GUGA 4RJTA 4IJWA 3QVSA 4R5MA 4XGIA 1F8FA 3TZHA 4I5EA 2WD7A 5L9AA 3TQHA 5KVVA 1LI4A 1CQJA 4ZGWA 1TLTA 3CPSA 4XRRA 1R66A 4XB2A 4GWGA 2JD1A 4WGGA 4A73A 4MO2A 3ETEA 1ZMTA 2IEBA 5AXAA 4BV8A 4LSMA 1LDNA 5ER9A 2X58A 1UJMA 3MJEA 3OEYA 5LDGA 3KEQA 3PWSA 1DFHA 5DCUA 1P0CA 3VVCA 2G5CA 1IZ0A 2YQ4A 4DYDA 1ZK0A 2WJPA 4WKGA 3MOGA 4CQLA 3VZSA 1P1IA 1N5DA 2GZ2A 4MVJI 5DULA 2X1HA 3PK0A 1WW8A 1I5RA 3LF1A 3C7AA 3HDJA 3GUCA 3L6EA 1RM0A 3ZZNA 3RUCA 2R00A 3DZGA 4DL9A 1E7QA 3ICCA 4CLOA 3ZNNA 2GASA 7MDHA 3TOZA 1LJ8A 4GGOA 5JYDA 2P5YA 1KEVA 2X0RA 4GQAA 4PVDA 2GGSA 1OAAA 4MKRA 4R1TA 5A04A 1JLLA 3K30A 4A26A 4ALJA 3E18A 4DTIA 1EK6A 4FW8A 3UCEA 4E4YA 4YQYA 4MVJG 2ZYDA 3AM4A 4KP7A 4ZRMA 5JW6A 3NYWA 1I8TA 3LDHA 1GEEA 3NGLA 3W4KA 3OM9A 3DBRA 3GDOA 4CMAA 4OL9A 5T67A 4OXYA 1TA4A 1P77A 1TT7A 3IJPA 3FHLA 4ZICA 2O3JA 5DCWA 3ITKA 3IAHA 1NNUA 4XR9A 3RFXA 3ONDA 3PFWO 3EYWA 1KYQA 1NPTO 5L7YA 3TWOA 4MP3A 3EC7A 1Y8QA 1JWBB 2HK9A 1A71A 4Z3KA 4FOSA 3AUUA 3GNTA 4QQRA 3BXXA 1EFKA 4D42A 3WYEA 1NFFA 1H6AA 4QT0A 2VZ9A 1E1KA 4KMSA 4MINA 4BO6A 3ASVA 5HTOA 2WYUA 3T7EA 2EF1A 1YOVB 2YV1A 3U9LA 1J4AA 3TL2A 4B3JA 2GNAA 3IJRA 3G49A 1XLTA 3DMYA 3EZLA 4OMUA 1MA0A 4PLZA 4HXYA 2VHWA 1B16A 2ZYAA 3H5AA 3DHNA 4DGSA 4RVDA 3KRTA 4Q3DA 3TRIA 1H6BA 2X23A 4BNYA 3C85A 1CF2O 2YV2A 1X0XA 1PS0A 5L3ZA 2WEKA 4MPDA 4IQ0A 1NR1A 2JD0A 3NKLA 3H3FA 1QYWA 4OH1A 1LLQA 3DTYA 4L75A 1PS8A 1JAXA 1DXYA 4GKVA 3Q1LA 3BMNB 4Z9YA 2FR0A 3AK4A 4RORA 1DJNA 4TWRA 3I6IA 1EBUA 2D3TA 5G0VA 5BQFA 2O7QA 3MTJA 3TN7A 1ZZEA 5ICSA 3FNGA 1AN9A 1B2LA 1DPGA 1YL6A 4QEDA 5G2OA 1GPDG 3GGGA 3WQRA 2VYVD 4JBHA 1FK8A 4A0SA 2DQ4A 4U7WA 3T4XA 1GZ4A 1U3WA 4RQUA 4XZ3A 3ZHZA 4B7UA 3RUFA 2W2LD 3GGPA 1N8KA 2DKNA 2Q1SA 3GK3A 4YTEA 4NFHA 5KIAA 3TFOA 4IDFA 2NU9A 4M89A 1O0SA 4UVIA 1XDWA 4AJ1A 1XR3A 2I3GA 1H9BA 2VNSA 3NJ8A 3B20A 4FS3A 3OQBA 3SXPA 4B4UA 5GZ1A 4YAIA 3JD2A 5LDHA 4II3A 1GCOA 1Z74A 1NXQA 5DOZA 4QX6A 3QRWA 1WAMA 2PH3A 4ZQHA 1ZH8A 1PIWA 4WUVA 3A1NA 2WD7B 4H3VA 5TGDA 1Q0HA 1KEWA 4QECA 1PJBA 4I5FA 4FD3A 4DLBA 2EGGA 4JK3A 1SB9A 4CMKA 3PJGA 3UKOA 4BGVA 1U4OA 1TI7A 3PI7A 1D4FA 2NWQA 4N5LA 4CM9D 4G81A 2B83A 4JX8A 2B4QA 4NBUA 1A7KA 1CIVA 1PSDA 4EUFA 4L8VA 1QXSA 3H6KA 3VDQA 5CFZA 1KY4A 2QRKA 3WIDA 1E7WA 4FQ8A 2JCVA 4TVOA 5IAAA 3OHSX 6LDHA 5I9NA 1EFLA 1DDOA 1YL5A 4YXFA 1LU9A 3AUSA 1UP7A 2FHSA 4PN3A 1E0DA 4J0FA 4CLOB 5JAQA 3WGHA 4AJ4A 5L40A 3BHIA 4JLWA 1GYPA 3RCBA 1M2WA 5L7WA 1Y9AA 2HK7A 4HY3A 5JDIA 2C07A 4OQYA 4DQXA 2C2XA 5KJ6A 1E5LA 3GFBA 2RHRA 1ENOA 4P22A 1Z7EA 3WWZA 2PZLA 3JQ9C 3T4EA 1EVZA 3V1TC 4B8WA 5KJEA 1BXGA 1P1HA 1VE9A 2ZATA 4E5KA 1KERA 3DHYA 4GLLA 1M67A 1I32A 3DR3A 3DBRB 5F1PA 3ROPA 2I65A 4XDZA 4IPTA 5AVOA 1BTOA 2I6TA 3CXRA 5AOVA 1CETA 3OQ1A 1CERA 3CE6A 4IJKA 1HDZA 3INTA 5A4DA 1QYDA 7ADHA 3ZU5A 1LX6A 1HXHA 1PGOA 1ZKMA 3QY9A 3KBOA 4ND3A 5ILOA 1PJTA 3D5TA 4XX0A 3BMCA 3JQGB 1GV1A 1IY8A 3D5QA 2AEMA 5HRUA 1MX3A 3C24A 2DFVA 4LGVA 3MTGA 4XDYA 2JFHA 2IXBA 2G76A 2Q4BA 2C59A 4BQPA 3DL2A 4PLTA 5CHEA 1ZO8A 4GBJA 1M75A 1T2AA 3ENNA 3GNQA 4J7XA 4MVJH 3OECA 1RWBA 1U5AA 3IUSA 3JYNA 4GX0A 4W99A 5IG2A 2E48A 3RUDA 4HNHA 2VWPA 5COBA 4NBVA 4NBTA 2NTNA 3PLNA 4QTZA 2IODA 4ROSA 3QW2A 3RVDA 5A9SA 1Z6ZA 4INAA 5KVQA 4E3ZA 4J16A 4RPJA 1HL3A 1X0VA 4DWVA 2OOSA 4XYBA 5JSFA 4YAKA 1NWHA 1R6DA 1LC0A 1XU9A 4UUNA 1OZAA 2OZPA 2GN8A 3OJ0A 1SPXA 1ZNQO 4Z6KA 3DOCA 4RL6A 2GDZA 2J3KA 3P7MA 3U0BA 3Q6IA 2ZCUA 4IXTA 1J49A 1I10A 1T2EA 5FEUA 4OXNA 1HLDA 3PYMA 2IXAA 4KZPA 2W98A 4R9SA 5G4KA 1JA9A 2C7VA 1V9LA 4PG4A 3I9OA 3HDHA 1BGVA 3QJ5A 3F3SA 5T6BA 1U1IA 4Z9XA 5COQA 2GN6A 4MIOA 4Y6SA 1XGKA 1EBFA 1RYEA 5EMHA 1Y6JA 5TS3A 1OC4A 2J5QA 4WNIA 2CFCA 5A9RA 5CDGA 3PGJA 5KOIA 4RPHA 2UDPA 2W90A 4J9UE 4CMIB 4PLHA 2QHXA 1IZ9A 1I2BA 1LDBA 3QWHA 5A5EA 1I2ZA 5KTKA 4YRAA 3OJOA 3V8BA 4ZU3A 3VHRA 3RUAA 3U4HA 1B7GO 2EKPA 2O3TA 2P68A 4IY1A 4R51A 4BNNA 1MFPA 1F17A 3K8ZA 1NPYA 4ND2A 1H94A 3L6DA 3D1LA 2ZYGA 3OJEA 4W82A 1MP0A 2OGUA 3TF5A 2WMDA 1DSSG 3PYXA 3H2ZA 1PL6A 2AG8A 2P4QA 5DT9A 3SLKA 3ZN2A 1NQ5A 1CJCA 4YJHA 4ZRNA 3ST7A 2AEFA 1LTHR 1I0ZA 4BKOA 1T2CA 1BVUA 3H65A 1N7HA 1JDJA 4IJUA 1RM3A 3B1JA 4EJ0A 1YB1A 5L4LA 1PGQA 4GSLA 4NK4A 5CDUA 1ISHA 1E6WA 1CEQA 3JQ6A 3QSGA 2BFPA 2GRAA 3RC1A 3AFNA 3BTVA 1ISJA 4CMEC 4OKNA 3G0OA 5DOVA 2HKIA 2DPGA 4MP8A 1T1SA 1H93A 2LDXA 4UUPA 3JD4A 4XA8A 4RPKA 4B4WA 3IMFA 3KVOA 1Q7CA 4FR5A 3W8EA 2X9VA 1Q0QA 2YQ5A 3M6IA 5JO0A 1GL3A 3VOSA 4DBZA 2O48X 4U6QA 4ONEA 3BAZA 3H5RA 3FN4A 3FBGA 4YRDA 1UXKA 4JIGA 3W8FA 1BXGB 4E5PA 1E92A 1AXEA 3HN2A 3I3OA 4WOKA 4FC7A 1XQ6A 1PZHA 2JHGA 2EP7A 1SNYA 3M1LA 5U9CA 4D7AA 3WGZA 1LDYA 4BNKA 1LNQA 1GCUA 2Q50A 2YJZA 3E8XA 3KUXA 4J6FA 5CDYA 1HZZA 2VTEA 4W7HA 1R4MA 3LT2A 1UUFA 3OH8A 3QA9A 3P2YA 2PNFA 5F3RA 1GQ2A 2Y66A 3PXXA 4FFOA 3JQAD 4F3YA 2H5LA 3PHHA 1L7DA 1ZEMA 2C20A 1NQTA 3DWFA 1P0FA 4P4NA 4BMVA 4CQMA 1D1TA 3BIOA 2RIRA 3BMCB 5JC1A 3VTZA 3DZHA 1Z45A 4RDIA 3M2PA 4CR8A 3EW7A 5BNTA 1PL8A 1E7SA 3NDIA 1K89A 3ZU4A 4Z0TA 1LEHA 1PWXA 3OIGA 5TT0A 4PZEA 4DPLA 3KV3O 2Y93A 4NBRA 1PTJA 2VZ0A 4FSHA 4B7CA 3E1KA 1EQ2A 4MVJD 3ANLA 4BMSA 3ZU3A 1O6ZA 3RIHA 3WGQA 4E5NA 3K73O 4W4TA 2NNLD 4ZVVA 5G4LA 1XA0A 3JQCA 3N74A 4WLNA 1V6AA 3OP4A 1DIRA 1EVYA 3U49A 4FFRA 5CDSA 1TXGA 2QYTA 4I08A 4N5MA 5IN4A 4XCVA 2CSUA 4E30A 2GZ3A 3JQ9A 1LLCA 1SMKA 5JFOA 4ZQEA 4II2A 3WNQA 4O1MA 4IIUA 1ENYA 1VSVA 4BNWA 2AQHA 4LK3A 2CZCA 4X54A 1DAOA 4BB6A 1NYTA 5BSEA 2UV8A 4XJTA 4NR0A 5G4KB 3AJRA 1DC3A 2DLDA 3IP1A 2X0NA 3G17A 3PIDA 2YY7A 3RD5A 4E5YA 2GLXA 2V6BA 4HUJA 3CMMA 2AXQA 3UH1A 4FFLA 2IZ1A 4YVFA 5ENVA 3W4JA 3COSA 4DXHA 3WGIA 1LRKA 3IP3A 1ULSA 3M2TA 3PZRA 4MP6A 4NNJA 3WG9A 1PQUA 4I9NA 2RBEA 3PYLA 3GEGA 3UVEA 4BL5A 4GGPA 3E9MA 2PTGA 3KYBA 3LT0A 1W4ZA 4CM6A 1R0SA 2ILTA 4IIVA 3GFGA 4J4BA 1JU9A 4CMGA 1P3DA 3I5MA 1XWFA 1WXDA 1PL7A 1VJ1A 4RPLA 2NUAA 2YW9A 4ND5A 4YT2A 2WE8A 1GZ3A 4JQCA 3OF2A 1ISMA 2VWGA 3DC2A 4MJLA 1KY5A 4CLRB 1SB8A 2V6FA 1IULA 1BVRA 4A03A 3CMCO 4LRSB 2R6JA 1SOWA 1DIHA 3H9EO 3ON5A 3Q2IA 1Q1NA 2I76A 3KSZO 4NJMB 1HDYA 1R37A 1NVTA 2DBVO 5F1OA 4XYGA 1NAIA 5T8KC 3WDSA 4URFA 4E2YA 4EDFA 4Q9NA 3DAPA 4YJHB 4AJLA 5IZ4A 1P1KA 4AJKA 4BNLA 1G1AA 4JCOA 4HFNA 3KTDA 5J23A 1F12A 5AXBA 4IMRA 1KOLA 3ITDA 3NRCA 4QO7A 4CM1A 1UAGA 1H2BA 2DC1A 1EEHA 2FR1A 1VPDA 2JAPA 5I9LA 4BO1A 4DIFA 3U4IA 1JWAB 2WTBA 1UZLA 3ETGA 4FFMA 2AHRA 4R16A 1F06A 2V6MA 4J90A 2WM3A 3D3WA 3DBVO 9LDTA 3PRJA 4GKBA 1V3VA 5G0TA 4CUJA 1PJSA 1U5CA 4CLHA 1MG5A 2ZJ0A 1FDUA 2BF7A 1YQXA 5CP8A 1K5HA 2EKQA 4PG5A 3FTNA 2AQIA 2CDBA 2QW8A 3ZW9A 1VL6A 5A02A 3PJEA 4M49A 1V3UA 1KVSA 2AQ8A 2NLOA 3LLVA 4GVXA 3BTOA 3GZNA 3VAZA 2WE7A 5JLAA 3G3EA 2ZKLA 1HETA 2C29D 1XCBA 1ZK4A 4I5GA 3EK2A 3OMLA 4WE3A 4D3DA 2BD0A 1KVTA 3VPSA 1XYGA 4BKQA 4R41A 4YEDA 3VPXA 3LC7O
chains in the Genus database with same CATH superfamily
4UM8B 3D5SC 4NIMA 4QOIA 5BXQC 4HLYA 1J07A 1Q92A 4Q39A 1ZEJA 3EZYA 4U00A 3DTTA 4G1FA 3SZRA 4D5EA 2Y1CA 2KPOA 2ZWPA 3CSDA 3W2GA 1W87A 3A4IA 5FD8A 1P91A 1XRSB 3TCKA 1EDZA 5F1JA 4MB0A 2W84A 1G9XA 3PD0A 3CA8A 3K9LA 1X39A 3NHWA 4U7BA 3F4KA 2GCNA 4M1KA 3IGFA 4DR3B 3WTTC 2GN1A 3H1EA 5A1JA 5ADHA 4BAUA 3ABOB 3LE8A 3QLEA 3H9BA 1E7RA 4ZV7A 3WGGA 2ZXHA 3UC5A 1SXHA 4X8MA 2JGNA 4RVNA 5TARA 1ZS9A 2NUAB 3ODPA 3PF9A 1SUCA 2QYHA 2DU9A 3OP1A 1YK1A 3DGEC 4RTQA 4WZZA 2J0QA 1W4LA 4AVYA 5M34A 4Y9DA 1U0JA 3OX4A 4IF4A 2D1YA 3TINA 4QTXA 2H4JA 3ESRA 1J42A 1HKUA 4OCZA 4AZ3A 1JT0A 3LL4A 2PD4A 4E7SA 2RARA 4PY2A 5F78A 4BX0A 4RJJA 2BW3B 1PZGA 5ED0A 4RVCA 5FRMA 3ZMSA 2DWPA 1JEYA 3GZNB 4K6CA 4C9YA 2FF5A 3WK6A 3ERMA 2SCUA 4E32A 1VPEA 3ZQKA 4GBGA 4IX7A 1G4UR 4OHUA 5DK4A 4MCIA 4EJUA 2L69A 1Z2CA 2UKDA 2J6CA 4FR0A 5AHWA 1ZCFA 2G28A 1LUJB 4P82A 1KZ1A 1SUWA 1QGDA 5DD8A 1GD1O 3AQIA 3OUZA 4G5GA 2PWPA 1ZAKA 2VQLA 2ONZA 5HCNA 3WFJA 2P9CA 3UYLA 1L1QA 5EQTA 1B6RA 4M8KA 4U0WA 5B1BH 3ZCSA 2X5KO 3I9KA 1QP4A 2Q2VA 3GZ5A 1VQNI 1OH8A 3KYIB 1ENZA 3LCVB 4BHBA 1KQ8A 1NJ6A 1KMHB 3PVZA 1C7FA 3SOPA 3IOMA 4K9PA 3EUEA 3LK7A 3OHPA 1XT6A 3CTAA 5G53C 4R1MA 3DTNA 4KTTE 2ZYVX 4O08A 2YMQA 3WTCA 3DAFA 4N47A 2C5LA 2GETA 2G5PA 4MW4A 3DZCA 4KFSA 4GZMA 1G0NA 3ZRGA 5LZ4A 2DAPA 2Q8KA 1NG1A 4JD5A 1DRJA 4RENA 4A3CJ 5JXWA 3FR7A 1IDOA 2IXTA 1CDDA 2XKJE 4CT0A 4JEUA 1U04A 5CA1F 1MJ9A 2HVRA 5AVWA 1XD9A 1Z5NA 2PS1A 2R6CA 3GT3A 4ALMA 1MJFA 4R3WA 3Q7RA 1TEZA 2EV0A 4ZAGA 4XFKA 1Z3IX 3NHPA 3T9DA 1C8BA 5D5WB 3DMTC 1TPZA 1S3IA 2VTDA 3E0QA 3ZDRA 2F3PA 3HOUJ 3QVGA 4QPPA 5BUQA 3HM2A 4WTOA 2I91A 1RXCA 3UQZA 4MV3A 3T5CA 1ZXXA 1VQ4I 1NUTA 4W1RA 1EWKA 4IHYA 5FNVA 2C4NA 2TMDA 1X1DA 2FWRA 3TGLA 1G66A 1J8YF 1YHYA 1XP8A 4NC9A 4DCJA 2LR8A 4DCTA 1P7YA 2W2OA 1FBSA 5CXXA 4ZU1X 5IP5A 1L7PA 1W75A 3C70A 5CJPA 3BTCA 3L1HA 1YAJA 2G09A 3KK0A 4IHSA 3WU2C 1O97C 4PQEA 4BGUA 2LP4Y 3M3PA 2OBBA 1UELB 4WZAB 1D2RA 2P9HA 5HJ5A 5FI3A 4LI3X 1IE3A 3BZBA 5IYDJ 4MTLA 1NOIA 2WNHA 4LZLA 4WWCA 4JX6A 4NBSA 4RD4A 1B72A 2FMFA 1C2YA 1TEXA 1JS1X 1TQ6A 3CTPA 3EHEA 4FILA 2CNWA 2WMNB 5I6DA 2H59A 1S02A 1YWGO 2CD9A 4MHTA 2GCPA 1IN5A 1BOFA 3JATB 1XMPA 5DHPA 1ZVJA 2CLIB 3TW6A 4RD0A 2Q1UA 3HSYA 1DGWY 1XVUA 2QPLA 5ULLA 2UYQA 1CNFA 2KB0A 3NM5A 4XLTA 3QU5A 1XEAA 5HOEA 2JAWA 2XWSA 1GPMA 3HJGA 3WKBA 4YONB 2EATA 1NQXA 2VQHA 1SFUA 1T36A 4BX9A 5LZ2A 4A91A 2PH5A 3R5TA 1F0PA 1NBWB 1II8B 3L2RA 2XE8A 2D2WA 3TBKA 1X3WB 2JLBA 2IGMA 1HSTA 2LOOA 4PHHA 4I99C 5ALUA 4MWSA 1Z37A 3WE7A 4GUDA 2P9EA 4V38A 4H3HB 1T9AA 3QBTA 5BVGB 1OAOC 4W5NA 1VL0A 3OVMA 5CCDA 2ZE5A 3AIMA 3BTIA 1Z5UA 2OCDA 3AUAA 2GBLC 4GYGA 2JBAA 3HNRA 1EG2A 4OBXA 4NBQA 1AKUA 1IPHA 1DINA 5ECDA 1FNNA 5JYCA 3ZQFA 4O63O 1R6BX 3OE5A 4BHTA 4Z1OA 4YMWA 3DMTA 2QLLA 3PC4A 2N0SA 4KGVA 5KB3A 2WV9A 4RA9A 1BXZA 4JYKA 2PEXA 2AC7A 2OVFA 5EEHA 4LZNA 5LBUA 1WCYA 1NJFA 2QUHA 2NYXA 4LDRA 3IH2A 3ASNH 5AUPB 2W6JD 2WNIA 4FDUA 2HMUA 4R05A 4ZQCB 1G60A 4IX1A 3PXAA 4D9CA 3MMSA 2FMYA 3S16J 1FOYA 1PJ8A 1GGJA 1HE5A 4RS8A 3OCJA 4EJMA 4X93A 2C4MA 2CB9A 1UOPA 4I01A 2LYCA 1AM4D 2VK4A 1G3YA 4DNFA 1RQLA 2P9YA 2NPOA 3WDMA 1YRYE 1RKTA 5EPOA 4P34A 4ZVNA 2FPRA 2D6FA 1GWNA 1IPEA 4LECA 4KPGA 1RLUA 2XDQB 4B8ZA 2IEIA 4TTAA 5KZMB 4FM9A 1QRTA 1P3Y1 3L0BA 3GFTA 2FRVA 4DLTA 1N8TA 4G0MA 5SY4A 2YWFA 2PGOA 2FSGA 4M9RA 1ACIA 3SKXA 4QYIB 3X2EA 3K70B 2YFKA 2F64A 4I98B 4KTVE 3WJ7A 2JFGA 4HAMA 5PNTA 2GIZA 3EZGA 1JEEA 4OINF 1AGPA 3MOIA 2JCYA 1QIDA 5IY5H 3R5KA 4U3JA 3LX5A 3VKHA 4RTMA 2J09A 5DSXA 3VH3A 4NNOA 3SHQA 4CN8A 1RZVA 1USGA 1LVHA 2GAUA 3M8JA 3E9DA 3PJFA 1E0EA 5I9BA 1ADYA 2IZZA 3JQGA 4A2WA 1T2VA 5DP1A 3PC3A 3GLHE 1B00A 1A7UA 2XKBA 4C7XA 4JJKA 3HJAA 3L02A 3BG9A 4IJVA 4LJSA 2YYSA 3KFVA 5KDDA 4RLSA 2ZVPX 3QYPA 4RB3C 1IM2A 1RS0A 1TQIA 1P6UA 4O1IA 2WJZB 3CF4A 4D9HA 4ZTJA 1GFWA 2XEXA 4I99A 3GA5A 1LKXA 4X0EA 5CEJA 3RF7A 1OAOA 2G0TA 3LOUA 1S2OA 4NCBA 5DLYA 4Q5SF 4TQ9A 4DV3B 1C7IA 1L7BA 5AIBA 2AD1A 2GBLA 2R66A 3VC1A 5JUWA 2XMCA 3A9VA 3H0DA 3H2KA 3DLIA 3L7JA 5JYEA 2OLEA 4YRVA 5KS2A 3T5XA 1SXJD 3T3HA 1TCBA 3KZVA 4UJ3A 2AG5A 1D6MA 2Z57A 1XD2A 3K2ZA 3CR3C 2VT7A 3VU3A 1K78B 2H94A 3OYDA 1EDBA 3IXLA 1QZXA 2O8FB 1L5LA 4EY8A 2YMPA 2LKCA 3KJFA 4G36A 1BBYA 3LUAA 5FNZA 1XFAA 1KP2A 4L2IB 2R1ZA 3Q1KA 1OAKA 5BUZA 5CVRA 4L0QA 1D1SA 3J81K 3DMNA 3W3AD 4EYEA 1XKXA 3PP8A 3GMIA 4DANA 3NH9A 1C3JA 3IEIA 2Y1WA 4MTDA 3DOFA 3PJRA 1JMVA 1SA0B 2VCYA 3JSXA 5CB8A 4O4LA 4HLCA 5AIAA 1NJSA 4NBKA 3ZE2B 2PLRA 5BWLA 1EUCA 4D3FA 3THXA 3BFJA 3O1HB 1VKRA 4Q4ZF 2OTJI 2FGJA 5IVHA 2E5ZA 3GBGA 4ZHQF 2UYHA 2QGNA 3AHFA 2Y1LA 3JR9A 3CC7I 1ZW1A 4FYWA 1JG2A 2QUFA 1Y4AE 3SPXA 4L3VA 2REQA 4TRJA 2P7CB 1Y7IA 2XROA 4FASD 3S5JA 3M5DA 1KEUA 1I3AA 4UUSB 4HFRA 4D97A 5L53A 5MDHA 4Q9KA 3ZE9A 1AD2A 3IVMA 4E7KA 2JLAA 4FDAA 4ZOBA 1LB2A 5JCXA 4CW7A 3HWX1 2OLJA 2V6GA 4OJKA 4EF6A 1HNZB 1LLDA 1Z33A 4O4HB 4OSOA 5IHPA 5FORA 2XR1A 3OFJA 1JDNA 2GJ9A 4UOZA 3R5HA 5E4YA 4LF8B 4RGBA 1PUFA 3EWSA 3ZMTA 5ALJA 2Z3WA 5E6SA 1HX7A 3LFHA 1KFCB 1PHPA 4Z4GA 3W78A 3C7CB 4PHGA 3CGGA 4KU4A 3TM4A 2I2CA 3U4QA 1KVQA 2WKQA 2AG1A 2ZXEA 3ZWAA 4F45A 3OJXA 4TTSA 4ZODA 4JI6B 4YRLA 5C31A 2GF0A 3H2SA 2XWPA 1KEKA 2KMUA 3EXEB 4BO7A 3WMRA 3OZBA 3QXGA 4AUEA 3C5EA 1IJEA 3JD0A 2VTVA 1G8SA 1HWYA 4QVKA 5L3GA 4U6SA 4ZIRA 4NZZA 3UOGA 3OLZA 3AR7A 4YGXB 1MGOA 1FNCA 2CV2A 1OW3B 2O6GE 5B1SA 1XKTA 4TXMA 1C81A 4XLFA 1PAUA 3AF6A 3CB4A 1FQOA 3PLAE 3D2LA 1AS2A 4UCFA 1QG6A 1XIVA 2Y2ZA 1I6HJ 3G82C 5LP1A 1A4XA 3R20A 1KO8A 2DQZA 2EIHA 4F3RA 3UWOA 1I3MA 5IMSA 4RBNA 2G1PA 3OYKA 4YCNA 1AHNA 2ONCA 5FPKA 3I3SR 2AJDA 2GKGA 5DV5A 1WLYA 5K8IA 3I42A 4Y15A 2QB5A 3CJTB 4ASNA 5F7XA 1P1BA 4WK4B 3FWNA 4GC9A 4PRKA 2QLBA 4KR9A 2IXDA 3F97A 4RTLA 5ALYA 3CNLA 2ZI7A 2CKDA 1U11A 1Y5LA 2XJ9A 2HUNA 2FFAA 1CJTC 2ZSIB 4LNHA 4DWOA 4M0EA 3A3KA 1OX4B 3NNNA 3DEHA 1UBCA 3O83A 4HQKA 2Q3DA 5EMNA 3H3VK 3GT0A 2NAZA 3HGTA 3V1LA 4GOMD 1A97A 1YMQA 2HHHB 2XECA 3AL0B 1HDRA 3QUAA 1P0MA 1Y1PA 1Q44A 4UUQA 3H2BA 1TGYA 3BFKA 4O25A 4RBOA 2OGTA 3E0JB 3GC6A 1YIJI 1W94A 3KWFA 4EX7A 3GAAA 4RJTA 2Q1ZB 1R5JA 3W06A 5AT1A 4P3XA 1ZMTA 2JRLA 2MSLA 2EQAA 5ER9A 4J94A 4HQEA 3HCAA 2OCEA 2OV6A 2OXEA 3RS0A 2FPKA 4WIAA 1OX6A 3K0FA 2H57A 3RGGA 8GPBA 3A27A 3HA2A 3UATA 5JS7A 4GQAA 3WWDA 5KU7A 4J16C 1THGA 1Z38A 4ALJA 3SFIA 2N46A 3AM4A 1W44A 4DMKA 3RTDA 3OM9A 4FNAA 4OL9A 1ZP6A 4XR9A 4X24A 1KK0A 3PFWO 1PVOA 4BC1A 3DULA 3PF8A 3UJNA 1IZ8A 4Q1CA 1O96B 3H2HA 2GAAA 3KEYA 1E1KA 3SN6A 2XKOA 5F9HA 1Z5ZA 1A9RA 2I7VA 2JPCA 1MX1A 2XD4A 3CXUA 3EWAA 4EYGA 3SJZA 4Q3DA 2XB0X 1H6BA 2CXTA 4XOPA 4EYOA 4UNNA 1MKYA 1Y1TA 4HPQA 3TPZA 4BJ5C 2LKPA 1PS8A 2BKVA 1DJNA 4YRPA 5DKFA 4F0JA 3L4JA 1B1AA 3K4PA 3KP7A 3OJCA 4WXHA 1Y98A 1SVSA 1DP7P 3KFWX 3ZHZA 1EAMA 3LKZA 2W2LD 2MG4A 4KRYA 4Y33A 3T3EA 4O4IA 3JZIA 3GLSA 3N8IA 3BD6A 3NBQA 4OREX 4ZT2A 5IJXA 3E97A 1A8QA 3PNLA 4CMKA 4QPJC 3PI7A 4RMNA 1SD4A 1R6AA 1A98A 2ZUBA 1EF4A 3G2HA 5CMLA 4B44A 3HLYA 4PZUA 2X1EA 1OH6A 3U6BA 1E0DA 1M3SA 1FT9A 4YJ2B 3OI7A 3K9HA 4UE2A 4M6VA 3V4LA 5I5GA 4QT4A 1DDGA 3V1TC 5IULC 1AQYA 4UNSA 1Y1SA 1YT5A 1UZAA 2G7HA 5GONA 3E7XA 4ARAA 2X14A 2GA9A 3SKVA 3V4RA 1HXHA 1PGOA 4ABZA 3UNXA 4U2DA 5EYPB 1OVMA 5BOSB 5JOQA 2GCOA 3D5QA 3LGXA 3C24A 4LXHA 2GSWA 4MV6A 2G0NA 3ZS8A 2O19A 1KYVA 4CIAA 1RWBA 1YJ9I 1LDJA 3MCAA 3CEJA 3VPDA 4KAFA 3OJWA 4J16A 1F3LA 16PKA 1HKQA 3LLCA 4TQAA 2JA6J 4HJXA 1R6DA 4UHKA 5FD6A 2R8ZA 2IJGX 5CK4A 4GRIA 3A0BC 3A3OA 4A15A 2L4AA 3AIIA 4XM0A 2YHBA 3CVVA 3TOAA 1JVNA 1WB4A 1N2ZA 4Z2AA 4PLHA 2OPHA 4ZPXA 3FW1A 4Q66C 5D5UB 3A6FA 2C77A 4F38A 4X6AJ 4G0VA 2AJTA 2XCIA 4KNWA 2FW0A 1U5TB 2V3VA 2MD0A 4MJXA 1HQYE 4BX3A 1DSSG 4UU1A 2AG8A 3SLKA 4K9KA 1NQ5A 3G1MA 3WB1A 4MRMA 1RM3A 2QX8A 2QNRA 1FQKA 3FETA 1GPH1 2N8GA 1BVHA 3JQQA 4COKA 1BL0A 1GTG1 3JD4A 4XA8A 2IA5A 2WD9A 3CRNA 4ENMA 4ENNA 2O0YA 3DE0X 1VB5A 3MUFA 3G0GA 1OMIA 4U6QA 1PUIA 3JAWA 1NXXA 1H05A 4IJ5A 1ZI8A 1YZKA 4WOKA 4FC7A 2P27A 1AZTA 1CZKA 2YR2A 1NVEA 4Y2GA 2KIMA 2ZIFA 2A78A 3PXXA 1R9NA 4C6TA 4UB8C 2IHBA 4FN5A 2YYZA 3BMCB 3FYUB 3MQ4A 3DZHA 5LUAA 4ZJYA 3OYIA 4A6PA 2AS5F 3PQCA 5MFPA 4GMHA 2DKFA 5TT0A 1MJBA 2WI8A 4LSZA 1AF7A 3GWGA 4B76A 3KSAC 3TIIA 3F3XA 4QJ4A 3OP4A 1G5QA 3IULA 2OK7A 1GPKA 4XCVA 2VJMA 2QL5A 2JGDA 3MWEA 4UHEA 1ZQ1A 4IIUA 3UMYA 4BNWA 1DAOA 3QTTA 4JI2B 5BSEA 3N39C 2RJ3A 2ZUSA 1DC3A 3IP1A 1CJVC 3D7MA 4MP6A 2GEDA 1K86A 1Q74A 1Z7YA 4LG1A 2ILTA 4IIVA 5FWAA 1OLSA 1WXDA 3EIOA 4YFNF 3OKPA 4A3LJ 4CI9A 2EIJH 3RRJA 3NFYA 3H9EO 3ON5A 2IYRA 4NZPA 4MR9A 5JVTA 4R8MA 3R23A 4RHCA 2JAOA 1NBIA 2O0LA 1OTHA 4Z4CA 3QE2A 5KHDA 4B33A 1R4AA 1VHJA 4MICA 3TX2A 1L7OA 3GLLA 3PEEA 1L0BA 5TPZA 1CCWA 2W6NA 3OCUA 4CYCB 2QX4A 1BOAA 1FTTA 1L4MA 1HDIA 4GU5A 1K5HA 3ZW9A 3D0QA 3OOUA 2Z8ZA 3LA6A 1KVSA 1NSTA 3LY7A 4AMZA 1HETA 4WE3A 3IBGA 4I5GA 4B73A 4MQUA 4DY4A 3EZ2A 3HZHA 4HAUA 4X62B 3HZRA 1NVWQ 1YDEA 3LC2O 1EE2A 1ITZA 1FFBA 2X4IA 3PA8A 4OUKX 2AOVA 1DB3A 2B94A 4HDSA 5A71A 4X90A 4ACAA 3ZQCA 1CY4A 3OC6A 4AK9A 1ZR2A 3CRZA 2GA1A 3UUGA 1ND5A 2HTEA 1Z35A 1T9BA 5SY6A 1S2MA 3AM1A 3BMOB 2HJSA 2BEUB 5AKJA 2ESHA 4PFPA 1GPJA 4QM6A 1Y1LA 4ZJUA 3C5VA 2K5UA 1IJFA 2DUWA 3WGOA 1HMPA 3MN1A 2ZG6A 1KS9A 1QV7A 5HM6A 4BHPA 2O8XA 2F3TA 4RLFA 2QD4A 4DCMA 2X9LA 4ML3A 2HJ9A 5A4FS 3DYVA 4A7PA 2ESNA 3AAFA 3FBTA 4B4KA 3MFQA 2J4FA 5IBQA 1NMQA 3KHUA 3FCAA 3V32A 4R6WA 1QS0A 2BUCA 3H7AA 5BQ3A 2RSLA 1W5SA 4C2MJ 4L57A 2H8GA 3N4MA 2NO0A 3A8TA 2NU7B 2E1OA 2C57A 2BLNA 4NOMA 1IW7F 1KA9H 1OH5A 4CIDA 2EFQA 1E3IA 3ZJUA 5GJCA 5EKTA 4JOBA 3HUGB 1P75A 1C9EA 4G4GA 2RK4A 5JBNA 5EIWA 2ZVDA 1O5TA 4PLVA 5CTAA 1E2LA 4I81A 5L3DA 3PEYA 5C3EJ 4AY3A 1JEJA 5KQLA 4WEOA 2EW1A 4R3NA 1T3TA 4X95A 3OF3A 3TD6A 1WCXA 3K4KA 4JKOA 1UDCA 1M83A 2A5LA 1VIAA 3HADA 1U8UA 5SZKB 5TQJA 1XD7A 3TBHA 2FHPA 2PMKA 1D5CA 3NDBB 3OZVA 3T6KA 3OX1A 3ZR4B 2PJZA 2Q0SA 1X4PA 3UKJA 2XTMA 2ECOA 1YA6A 1QH0A 1VP9A 2F3RA 3OT5A 1OE0A 3BQNB 1IZ7A 3VOAA 1K0UA 4N0EA 5K0SA 1JHZA 2LNDA 1QMGA 1H9GA 4IEJA 4E7OA 1XWWA 1KKLA 4F4CA 1R10A 2ELHA 4ZZ0A 3M1CA 1A31A 2FUNB 5DYGA 4YRFA 1Y3HA 1DOHA 1KYYA 3N53A 4LYGA 5EIOA 1E1QA 5FI5A 3RIGA 5CLIA 3KQNA 3LHIA 1G9SA 3EGXA 4JSTA 2WUEA 3ADDA 2Q3HA 4P9UA 3STYA 3FXMA 2QRVB 2PWBA 4GPD1 3UA3A 2C94A 3OD1A 3H2IA 1J2TA 3W7VA 4FB5A 4XB1A 8ABPA 4RY0A 3V4SA 3M9LA 3DB1A 2VLAA 4IIGA 1PYDA 3JVIA 2G8NA 5IDVA 3OPYI 4JODA 4D56A 1WHSB 2OCBA 1UL1X 4NYMQ 3PUKA 5CNMA 1Y5MA 4GL4A 2V03A 4Y2QA 1RAHA 2H8KA 1DQUA 2DMTA 3V2GA 1CR2A 3OQOA 5JH7A 2ZBGA 2H4ZA 2YZGA 4B3AA 4ZVQA 5EI5A 1V26A 1I7NA 3JCZA 3TZCA 1BN7A 2PUCA 2D1RA 5FPHA 3CINA 2HPMA 5H83A 1QIJA 2HRZA 4URYR 3R3SA 1WB6A 1D04A 2EP5A 4M1YA 5JHFA 2V55B 5AW8A 2AOTA 1J9ZA 4DYCA 3GTOJ 5AK0A 4X85A 3K8YA 1HRDA 1OY1A 1CY1A 4YT5A 1E6LA 1L0OC 1ZN8A 5EXXA 3G1OA 1Z2AA 4YREA 2ZFUA 5ILVA 3U81A 5FOVA 1O1YA 2VJYA 4FHFA 1J2EA 4G5SA 1JRLA 1GG9A 4BQEA 2HD4A 3ZCVA 3P2MA 4QQFA 4UVDA 4DIOA 4M9UA 4ZAXA 2GN4A 4Y6LA 2AX4A 1SURA 1IWBB 1KA8A 3C14C 3J81k 3GHYA 4E5VA 5T57A 4J2HA 3MINA 4MW0A 2V6CA 2L42A 4DM7A 3O3CA 3TTVA 2OHFA 1ESCA 1A8PA 1AUOA 3PCXA 1G55A 1BXRA 1IF1A 2HOQA 1IY2A 1P44A 4GEGA 5LU8A 4MUFA 1RW4A 4ZAYA 1YTYA 2IP4A 4S2EA 3Q7EA 1JR3A 4ON9A 2VBIA 5DEQA 4WD3A 1B8IA 4IVRA 1JDSA 1A2BA 2XOKA 2ZTSA 3FTDA 5HJ2A 3ROGA 2VQ6A 4L8WB 4ND1A 1R8QA 2JIMA 1TQMA 1R0WA 3UF0A 5IVDA 3A4VA 4QVIA 2JLXA 4M3NA 3OYFA 3MLBA 1PR2A 3ML6A 4TS4A 3CESA 4B82A 3G7SA 2OCPA 1Z6TA 4J8PA 4JYAB 2CUEA 3H1AA 3JQEA 4R68A 3GPIA 5AM5A 3PENA 1H23A 3R77A 4GICA 3DDNA 4HRXA 1E9BA 5JMPA 1R0BA 4HRVA 4CCJA 4ZEXA 1K92A 4CCLA 2QTWB 5K0ZA 3BB1A 1RKXA 5LZ7A 3TR5A 1HQKA 4K1LA 4L9AA 1NJ2A 1GZUA 2JJ1D 3LPDA 2Z16A 1YIDA 2X2OA 5CA0A 3VR6H 2ZTUA 5LU9A 3N2KB 5DDIP 2G9NA 3JAKA 2GAFA 5J2TF 1Y4ZA 4K0RA 2KDOA 2PLYA 1UMDA 1BHJA 2WKSA 3SS8A 3BVPA 4BVGA 4U6NA 4LV5B 3G5UA 4MZXA 2VHZA 3WGYA 4EHNA 3D4BA 4PGMA 5E4JA 5KX5F 2X40A 4WKPA 1P74A 1IXKA 4HA8A 1CDOA 4AICA 3PDJA 4AC0A 3N2IA 4OAPA 4AC9A 4OQZA 2RAVA 1GFSA 3R0JA 1KJQA 2OHGA 4ZXPA 4E5DA 2ZRNA 3VM6A 5AVXA 5TMBA 3RLFA 3P5SA 2P4UA 3PE3A 5DWQA 3NOOA 3NTXA 1UDBA 4L9SA 5E20A 3K9QO 3U5TA 3X1JA 2NW6A 3ZXSA 3BJAA 2A68F 1P73A 1PNOA 1KYXA 4BBPA 5LEJA 1LPNA 1QVAA 2JVIA 3DEKA 2LREA 4PPQA 5BOXA 4B1FA 2TECE 1N2XA 1J7KA 4QAJA 4EPXA 3L18A 4D41A 4B3GA 2H54A 1K7FB 2VT3A 3JQ7B 5C8DA 3S8YA 3F96A 3LHSA 5GTDA 4J3NA 5FB3A 1IBKB 4R9RA 2IE8A 3ZG6A 5B3LA 4Q9LA 2BOLA 4W6ZA 1S2GA 2QRZA 3L01A 3ABIA 3M6FA 4ZQBA 3FPHA 1NASA 4DBRA 2J46A 3MRXA 4FHGA 3WX0A 1E4YA 3V8KA 3T5BA 3E9QA 5CW1A 3T0IA 3PX7A 1JI8A 1XSDA 2HKXA 2RH4A 1M2OB 4HV4A 5ALQA 2CCGA 4GMFA 3GMTA 3KXKA 1PT7A 2ZVJA 1NBAA 5CYGA 4DXDA 5B5SA 1QK3A 3PHIA 4WJZA 4KRGA 1L8AA 3FCYA 2VTBA 2BFMA 1DPRA 2FRDC 1W85B 4IS2A 4TV9A 1K4SA 3ESYA 2FW9A 3OYLA 3MXOA 2C99A 4D96A 3U62A 1P61B 1W0KD 4G26A 3UCFA 4GKJB 4A2CA 3WYNA 3M7IA 3W6PA 4ZGGA 4YRQA 1PE0A 2JJ2D 1EP3B 1UXHA 2OB1A 3I34X 3PS9A 1L5HA 4J43A 3TNJA 4FK8A 4A8TA 2V65A 4S3MA 4KDCA 5FOTA 2CHUA 4MULA 2EIMH 2ZPTX 3DDCA 3IKLA 2RMKA 5F0HA 3X3HA 4QUIA 4ZVPA 2QXUA 3DTIA 3GFPA 1WZCA 3M1EA 4TM7A 1ULZA 3Q8XB 2QBYA 1AV6A 2UYGA 1VLMA 1VKNA 2VJAA 4O5OA 4WBNA 2J3HA 2IT1A 4CL8A 3MUOA 2DPXA 3RS7A 1GAJA 3KJGA 1P33A 1J23A 2XW6A 2R8PA 5BV1A 4NYIQ 4JBIA 2WADA 3CKMA 2W83A 3GTGJ 4O1HA 4Q05A 2CQ7A 1Z3XA 1E6EA 1KYTA 1QDUA 2ST1A 4IDCA 3F9CA 3IQWA 4P3NA 4GP9A 1UZCA 3VVBA 3BJRA 5KU1A 3ZXXA 1A5JA 2WUGA 1II0A 4FJ1A 4Q7QA 3CLTC 4IUYA 5LQAA 5F5LA 2K9MA 4D74A 3HYLA 3ISPA 3ZXIA 3WTVC 1NW9B 3KR1A 3CZ6A 3J81A 4M0MA 3V80A 1N2CB 5FOSA 2W6QA 1J59A 3BUSA 4F8EA 2CB0A 2BH2A 3FJ1A 4DKXA 1MBEA 2R5YA 2PS3A 4CLRA 4CTOA 1W36D 1AVTA 2E71A 3HBAA 2I4RA 3CZ9A 1X7DA 3G1TA 3OYEA 1QF9A 2ZKIA 3CH5A 1L8LA 4BLOA 4B4CA 3AI7A 2DQYA 4A8JC 2XCQA 1VXRA 5AM1A 5AJZA 2AIRA 5CT6A 3UGQA 1KO4A 1YE3A 3YASA 4PVCA 5JZSA 5EJFA 1MOQA 2FRDA 3D5RC 5KAFC 2IWHA 4C14A 3PPIA 5A2QK 2XVMA 3KJZA 2Y0MA 4L4SA 3WB2A 5HKKA 1TC2A 2NXNA 2VUTA 4G0YA 3GLIB 3OD5A 1MMFB 3NTVA 5KQPA 3JWPA 1OIXA 1W1WA 3HHEA 4G8CA 3IBSA 4TL7A 3E1SA 1NWCA 1VECA 3LIIA 4AIRA 4W1SA 2YPRA 5LP6C 3E5QA 3Q0VA 4P0TA 1ZD5A 5G0SA 1MUUA 3GMEA 1T0IA 3GFFA 3RJ9A 1H6CA 3PX2A 4PQRA 1KK2A 4LWPA 3FOEC 2O1XA 3HDQA 4N9HA 4KO2S 2CL7X 2K3FA 1VJ5A 2IEAA 2GKSA 1E18A 3UAGA 4IEEA 2PYIA 4N3GA 1ZXLA 4BLWA 3IKTA 4Q6WA 4MV7A 4KXUA 4OX9B 4X1KA 2PVCA 6REQB 1XTAA 2XAGA 4HDQB 3ADPA 5HNHA 4P4TA 5J63A 2OUIA 2EKZA 1P19A 1HYQA 4JJ4A 4LSWA 2OG2A 1QAQA 4CM4B 1ETQA 3VEPA 2Y69H 2JI4A 4A0GA 1YOVA 3TO9A 3EX7C 4HT3B 2BEKA 4G24A 4HJRA 1JDBB 3W2TA 3TG8A 3LBYA 2FEAA 4ZOQI 4AXBA 4DIQA 1T8TA 3WMFA 4Q1AA 3QODA 2AYZA 5EIBD 3GVIA 4DAOA 4L0YB 3DOHA 4MS1B 4JYCA 3FX3A 2H6BA 1U8BA 5TJHA 1K0FA 5JROA 5KTOA 3W9BA 3I1JA 4D5CA 4BO2A 1O9BA 1VL1A 3EVTA 3EJWA 4R54A 2YIDA 5DHAA 4KDPA 1P8JA 1D0ZA 5C8YA 5JE8A 2YXPX 1H66A 3WB9A 4MNUA 3OE7D 3BREA 4H0EA 2J6BA 5CTJA 3LKDA 4G67A 3GRYA 4A8JA 5KVVA 1CQJA 2BFCB 1TLTA 2P69A 4XRRA 1TF7A 5AXAA 3EVCA 4LSMA 4L5JA 2H8RA 4EB0A 5F52A 5JISA 2ZSUA 3VO9A 5EIEA 2FNPA 1GZHB 4FINA 2VAPA 2FETA 4GC5A 3HDJA 2P3OA 3DZGA 1GCAA 1JKOC 1XZLA 2BHNA 3Q41A 2IPOA 5JYDA 3OYMA 1JIXA 5D87A 4X45A 4ZDWA 1YS6A 4S1WA 3P0JA 3VGPA 1Z8NA 2I7CA 4KP7A 4YJ3A 2NXCA 1X2NA 3DBRA 4IDQA 4LDJA 3F22A 1TJYA 1P77A 4L7VA 3RFXA 5LP6A 1UMCA 3OQIB 4UNRA 2RKWA 1RPZA 3ASVA 1U8EA 1Z2NX 4CYMA 4F8YA 4ARUA 1R18A 3AG2H 2HA2A 2GNAA 4G37A 3EBPA 1FDIA 3LI2A 1RHJA 1B16A 1RWKA 3N3BC 2YIMA 4BNYA 1CF2O 1QIKA 2HYIC 4IZ6A 4BUPA 1PEAA 3EZFA 4FYJA 5D7NA 2YWDA 4Z9BA 4CEJB 1BOOA 1QH1B 3BE6A 5B64A 5JSQA 3ZMVA 3HPHA 3TZLA 3KIOA 5HSGA 1OZGA 5G0VA 1GVJA 1D9ZA 5G2OA 4BLRA 4G5OA 2VYVD 4G56A 1PVDA 3F3MA 1GZ4A 1XQXA 1YS9A 1JT9A 4HEHA 5IW8A 2XZTA 3FNQA 1P81A 4HGOA 4HD8A 4KQGA 1K06A 5DOZA 4AURA 1MNMC 4ZQHA 2AN1A 1PJBA 4OHPA 1KF0A 4BGVA 2QRNA 4ESVA 5DM60 3P8ZA 3AXTA 4JYZA 3RTCA 3HRHA 5FROA 4EI7A 4TVOA 1Z0DA 1DDOA 3UENA 2MINB 4FE3A 2C4KA 1FPQA 2FHSA 2D2FA 2HK7A 2QAJA 1E64A 4MVXA 4RMGA 2P8SA 3G59A 3GIDA 3HWSA 1GXPA 1ZI9A 1M73E 1DO0A 1P1HA 1T6NA 2OXFA 5CB4F 2WTXA 2XB6A 2CW7A 3GJSA 2GIVA 1SBZA 2RHGB 2WW8A 3DLBA 1CERA 4I6GA 1FNSA 3INTA 3ND5A 5SZHB 3KG2A 2AKEA 1LX6A 2VKHA 2ZRLA 5EZYB 1ZHOA 2WAMA 2R5ZB 4FDTA 3KP6A 3HSEA 4UFOA 2BMFA 5AOBA 5KYTA 2BSAA 3L09A 3DL2A 4MI9A 1ZO8A 3F9KA 1M75A 4RKQA 4LRQA 4WN9B 4YRGA 2QORA 2VWPA 3PLNA 1JFFA 4INAA 4RGVA 2BTOA 5KTPA 3DBIA 3SDSA 1IAWA 2O20A 1KAQA 4IXNA 3OJ0A 4Z6KA 3EYIA 4TYWA 2OFFA 5G4KA 2C7VA 4EO9A 3F3SA 2Y75A 2GN6A 4R2XA 2BR3A 3A6JA 2C03A 2PR7A 2BKXA 1BMFD 4FZRA 5KTKA 4IZOA 4MQ9F 4BQQA 3DNFA 3O3NB 3P26A 4N7MA 4IY1A 3MNFA 4BY1J 5FBHA 4Q01A 3PYXA 1CC1S 4IOMA 1G4DA 1FYKA 1Y9JA 4BKOA 1FVHA 3EF0A 2P7IA 2Q5QA 1KZ9A 3OQVA 4UZFA 1UBMS 1S5LC 4UCWA 5DOVA 1HOTA 2DPGA 1H93A 2Q9CA 2GEUA 3AF5A 1V11A 3Q3GE 1ISSA 5JO0A 3F67A 1UC4B 1SQGA 1QV9A 4IIFA 1K4KA 4DYRA 5C3UA 3L1JA 2Q8QA 1ZGJA 1JQLB 2DK5A 5DTIA 2C95A 5J4YA 2XF7A 3EXIA 3RU3A 4D7AA 3H11A 3TLJA 5BUSA 2XRZA 1TNTA 1IK4A 1YV9A 2JSCA 3B3AA 5CDYA 1NG6A 3BXFA 4XEUA 4NPHA 4UTPA 3MS7A 1RJFA 1BC8C 2D8MA 1SUBA 4NQWA 2X3UA 4CQMA 4EQZA 5JC1A 3LWBA 4Z0TA 2ZRIA 2FZKA 4KQIA 4G0XA 1QFXA 3O8CA 4NBRA 3CSSA 4L07A 1XF9A 4MVJD 2KS6A 4AG6A 2IHKA 1B41A 3N74A 1FNBA 2FEXA 4BVLA 5L3RA 1G98A 3GFOA 4C0XA 1U99A 3O95A 3MILA 3ZLJA 3FZQA 2I62A 3S4YA 1TU3A 3MWFA 1PP8F 3BOSA 5FP0A 6PAXA 2WTUA 3GTPJ 3JU3A 2BHRA 5ENVA 2N42A 4HQ6A 5B5EC 3PYLA 5F5XA 3LT0A 1Z5WA 3LSRA 5D85A 2KE5A 1PL7A 2QQ9A 2AFHB 2ZT6A 4AY4A 3K7AJ 3CC2I 1OA1A 3COWA 3X1XA 2R6JA 2FVYA 5E1WA 5C8VA 2QUKA 2G06A 4YS6A 4XLZA 3QX8A 4CKYA 3PUBA 5ALFA 4XRSA 5D4RA 5GIPE 2OZEA 2DAOA 1D09A 5J23A 1WP9A 3L3BA 4HZIA 1SKQA 1J0CA 1NMEA 4M6WB 4LJLA 4EVIA 3UT5A 2AHRA 2I4NA 2HJGA 3EODA 3IELA 2NN3C 4RMJA 1F2VA 4BJ6C 4KGXA 4W8HA 3HVJA 4F52A 2CDBA 2PMDA 5FUQA 4DR5B 4EX6A 1V3UA 3LLVA 4KACA 1YFKA 1XQ9A 2I2WA 2FPWA 1TOAA 2H4FA 2CDCA 2WTMA 3ZQHA 2WPNA 2OV4A 3G0CA 2BR5A 4DJAA 1T4MA 1VKJA 5IYBJ 4OBWA 2R6GA 2HRBA 1WNFA 1FIPA 4LMBA 2R86A 3KSRA 5K3SA 2EWNA 2VQGA 4DJDC 3HEFA 2OZUA 5TGZA 5A4KA 1XV5A 4GPZA 3MW8A 3DB2A 1F2TA 3WI7A 3M4XA 5LGUA 5K5OA 3GTMJ 3MYYA 4PWZA 5IABA 1MV8A 3QOPA 4DMMA 4C0KA 3NQ41 4DQVA 4O4JF 3HM9A 3SX4A 1U3CA 3AHGA 2ZR0A 1VE3A 5CPBA 4I1VA 1XNJA 1C0PA 4BNVA 4V0MA 1TMOA 3HHPA 2WWYA 3K0BA 5DSTA 1ZK2A 2WB4A 4YAJA 1XLUA 1U7XA 3JQ8A 4E4HA 2JJMA 2XVAA 3PDHA 3DZKA 5K8LA 3HSKA 2ONKA 3RSFA 1GZ6A 1UMBA 3ZGYA 1WPKA 1X7YB 2X42A 3C2GA 2RHBA 4OEHA 5GAGJ 2ZJ5A 3NNDA 4LZOA 1PX0A 2LSOA 4OLBA 4OXXA 1N9GA 1J2XA 3O03A 2P65A 3OTQA 1LQTA 4JH0A 1KS2A 1BR1A 2BT4A 1C3EA 1L8QA 2VXCA 3U19A 2I1VB 2GM4A 3EGVA 4KKXB 4M74A 5GP9A 4HNUA 3BZWA 1NVVR 1PJZA 3WTZA 4EGQA 4LAFA 4H31A 3EEYA 1X7WB 3QXHA 4CI0B 5KNBD 1XPUA 3EGIA 4FGWA 2CYCA 2NTEA 4TXJA 1B6TA 4ZK6A 3IV9A 3HKBB 3SVZA 5AW7A 5CT9A 2IYNA 2BFFA 4XL9A 4DG5A 4G1MB 1KIAA 2A1TS 4LK1F 1XZNA 1S89A 2X3YA 4CV3A 2O5RA 3BKWA 3IP9A 4MQEA 4KSBA 3G3ZA 4NZ9A 4DJJA 4BJ6A 3QLTA 2PJDA 1A9QA 4PM4A 2YH2A 2ZJ1A 3HZOA 3IKVA 3ZN0A 4MB2A 1NHGA 1JLLB 3EPKA 3GCDA 1YXMA 3WLJA 3FNFA 2RI0A 3SHVA 4DJFC 3K6SB 4WFIA 3AI1A 3NP7A 3QWIA 3L8DA 4JUCA 4Q4JB 2CXSA 3FM9A 2VPQA 3K4MA 4ZYYA 2GDJA 2XOXA 5ITZA 1E3EA 2VDKB 3INGA 2XUBA 4XUCA 2B1QA 2ZCVA 1ECJA 1YZLA 3HACA 2LTAA 5CYOA 3ILHA 2HQ5A 4EI2A 4B1RA 3RBXA 3DDZX 3ZIDA 4R2HA 4C03A 1CG6A 2JKVA 1LC3A 4YMTA 3TI7A 3LU1A 1RMYA 2VZ8A 4OM7A 2B2CA 4DHWA 3AL3A 5C7IO 2B4AA 1BIBA 1LZKA 4LGWA 2IHNA 4PCAA 2QZPA 4IIEA 2HV9A 1Y9DA 4EGFA 4EBFA 5I7WA 1XK6A 3DP7A 2A5FA 3EIUA 3CW9A 2CD7A 3A7DA 3OIOA 3REQA 1T4GA 4X6YA 2WM8A 2HY7A 3IUBA 1KZGB 5EWJB 4ARIA 4PG6A 2LBFB 4ASUA 1X80B 3I64A 5JBIA 2CF5A 2B7EA 4BUCA 3LX6A 4H7FA 4G41A 1PQWA 2I4OA 4XTRA 2OWDA 1G19A 4DADA 1WKMA 4LOHA