3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccB protein
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
1JTVA 3IS3A 4KWHA 4XA8A 3GH3A 5K6AC 3BIOA 5A02A 2B0JA 2IE0A 2X22A 4PFJA 1DLJA 2YV1A 3PFFA 5ICMA 1LDGA 4BO4A 3GDOA 2W98A 1GPDG 4YQZA 4KDFA 3ZZNA 1RJWA 1QV7A 4BOYA 5JNLA 3GN2A 2O4CA 1U1IA 1NX6A 1C1XA 3HZZA 4OSOA 4C4OA 2NUAA 2VZ9A 4WLVA 1G0OA 1PZGA 3HFSA 2IXAA 1YO6A 3QQPA 4P38A 3K73O 3RUEA 4E4YA 4CV0A 1ENPA 1PQWA 3JQGA 5TRTA 3WG9A 3DHNA 1KEUA 2Z1MA 5IJZA 4E5YA 5KVQA 5DNAA 4CR8A 5B4TA 1EFKA 1B2LA 4GL4A 3JQBC 5DBGA 4X54A 3ZDFA 4ALNA 4DREA 4MP8A 3ZWAA 1U7HA 1BXGB 2FPPA 1M6HA 3JQ7B 2VT3A 3KYDB 1WDKA 4AJ2A 1JKIA 1FDSA 3Q2IA 3AW9A 1T4DA 1T26A 5H82A 4CMKA 9LDBA 3U3XA 1CDOA 4II2A 1OZAA 2WSBA 1LQUA 1PIWA 2WMDA 3G49A 1U2GA 2AEFA 3D5QA 1J4AA 1PJ2A 2OORA 2BKAA 3KO8A 4KUHA 1V0JA 3WBBA 1U4SA 1A7KA 2JCXA 3P2OA 5A05A 4R9SA 4ZJUA 5BSHA 4EJ0A 3MJVA 2JCVA 3KOUA 4AJOA 3GNSA 4ND4A 2B35A 4J6FA 1X1EA 1LBEA 1BXGA 2VCYA 4NDNE 4ALLA 3OFSA 2C07A 4YAIA 3JYLA 5AXCA 4XB2A 3QHAA 1A71A 1BG6A 1MUUA 2O48X 3GA0A 5G4KB 5H83A 5ILOA 4CLOB 4R01A 3FTPA 4ALKA 2C5AA 2J6IA 2Y1DA 3MJCA 4AJPA 2C5EA 3NJ8A 2DTDA 4LVUA 4BO3A 3PHLA 4PLTA 1FMCA 4R51A 1IHYA 2HKIA 1ZSYA 3RASA 3ZV6A 3RC9A 1NWCA 4L75A 5IG2A 4CL3A 4BQRA 3FCOA 3RU7A 2DUUA 1KEWA 1EVYA 3TZQA 4QFDA 3C7CB 1O5IA 1DIHA 4XJTA 2Y0CA 4EI2A 4ZQBA 2YZ7A 5CPFA 4WCFC 4R1UA 4P4LA 3S2IA 4XIYA 4BO5A 1NQ5A 3VTZA 1MG5A 3JD4A 1H93A 4FBGA 3TZCA 3HADA 4UVGA 1PGNA 1GV1A 1KERA 4NHEA 3WYCA 5KKAA 2PK3A 2WD7B 1BRMA 4W7HA 3HJAA 2PWZA 5H81A 4CM8B 4DPKA 4I08A 1Z6ZA 4KUGA 4B4VA 4AJHA 2BGLA 4AFNA 3TL3A 3F6YA 3ONDA 4U0KA 1CQJA 5IF3A 4WCDA 3DOOA 1S7CA 2JFGA 3DFZA 4HX5A 5MGBA 4H7PA 4WNIA 1PWZA 5TC4A 2ZYDA 4Z9YA 4HKTA 4HFRA 3VTFA 1B8VA 2VWPA 1XIVA 5TGDA 5TJHA 1W6UA 4BNFA 1DXYA 4DIFA 2DLDA 2JCYA 1R0LA 1HE5A 3PJEA 1B3RA 2BI7A 3JQ9A 3P5SA 4NK4A 2CD9A 1GUFA 3QIVA 4MP6A 4DL9A 4MIYA 3PLRA 4CV3A 5C7LO 3ICPA 2E48A 4PG6A 2VRCA 4J90A 3PK0A 1YJQA 2PD4A 2AE2A 4D7AA 3H9QA 1KYQA 1K5HA 4GMGA 1O89A 4RVUA 4CM3A 5T6BA 1E7QA 1SAYA 3GG2A 2PNFA 2UDPA 1M67A 2AE1A 3KSZO 3AFMA 4G65A 2VRBA 4O63O 4HV4A 4CQMB 4OMUA 3NT4A 1Z7EA 3BZUA 4MVJA 2OP1A 4CUJA 4DYDA 3PHJA 3CMCO 3ZWOA 2OHXA 3U4DA 3ZWCA 3E9NA 5G0WA 3G0OA 1SOWA 3RCBA 1DAPA 2C2XA 3HDHA 1YH3A 2BFMA 3F47A 1I5RA 3G79A 3UHAA 3OQ1A 3V1TC 1CETA 4XQ9A 2P5YA 1WPQA 3OETA 2OXIA 4MJLA 4BGEA 5A3JA 1F06A 4J1NA 3RI3A 1PU2A 4XEHA 4PLZA 3PEFA 2X86A 3OMLA 2HK7A 1ZMOA 2NM0A 2Y67A 4LN1A 3ZHZA 1Z73A 2EW8A 3KM0A 4F46A 4E21A 1RM3A 4CM8A 4U8GA 2D2IA 2WTBA 3JV7A 3I9OA 2G0TA 4PLCA 2ET6A 4N7RA 3KZVA 5K9ZA 1Z75A 1EVZA 1N92A 2Y1CA 5HRUA 3BMQA 2ZTVA 4E30A 2C29D 3RQSA 1PL8A 1GYQA 3OM9A 3RJ9A 4RV9A 1SB8A 3HUDA 4MVJM 1Y1PA 5TSDA 1ZCJA 2IODA 5IAAA 2IYPA 2WYUA 3KYCB 4JN6B 4NIMA 1FF9A 2DBVO 4OO3A 1ISHA 3E03A 1K0UA 4BO0A 1K6IA 1P1FA 4N54A 1LDBA 3EGOA 3WQSB 1F14A 3S55A 3EK2A 3E82A 1QLJA 4B8ZA 3ENNA 1W73A 4NH4A 4OIMA 3KSUA 2X0RA 3D7LA 3KB6A 3M2PA 3EVTA 4KUEA 1NFQA 4MP3A 2W2LA 3WBFA 4E5KA 1ZW1A 1BDBA 2XF8A 4NBVA 1TT5B 1JVSA 1DAOA 1N7HA 4XX0A 1E5LA 1RKXA 1E1NA 3IJPA 3QWFA 3H5RA 1CIVA 1D8AA 1RM5A 2HRBA 2W2LD 3GRKA 4CM6A 5DULA 1NQOA 2Q99A 3CKYA 2O2YA 3PXXA 4XYGA 4CQLA 2ZCUA 3TFQA 1SPXA 3FPLA 5JCJD 2Z1NA 5L7YA 5COQA 3PZRA 2Q4EA 4IY1A 3WS7A 1XG5A 1QP8A 3KEOA 4YDRA 2XPCA 2JKVA 4PGFA 2ZYAA 1HDGO 3ABIA 1LSSA 4U6SA 1BTOA 1PQUA 2DPGA 4EUFA 1GR0A 4R5MA 1KS9A 4MVJD 4OM8A 4DPMA 3L6EA 3P7MA 1GV0A 4GGPA 4R16A 1ZIDA 4XZ3A 4TRJA 3Q11A 1E3LA 4ALIA 5BSEA 1L7EA 1B14A 2BI8A 3ANLA 3MOGA 1HT0A 2GZ2A 2EJWA 2D8AA 4Z0TA 4GLOA 3ZW8A 5GMOA 4YJGA 2BF7A 5GZ3A 1N9GA 5ER6A 3QA9A 1CJCA 3FNGA 5AXDA 2FRDA 4EUHA 1IPEA 2QYTA 4BNNA 3RFXA 5EMHA 1KBZA 4EEXA 1SZJG 1X7HA 3VDRA 2X0IA 3QVSA 4LISA 3LYLA 3OEYA 1XDWA 3ETDA 1O6ZA 3AWDA 1T2CA 3GDFA 3G1TA 1A4IA 1LX6A 4BL5A 1WNTA 4Z6KA 3RUDA 1IL0A 5DZSA 4CLRB 3MJSA 3MJ4A 3JD0A 2PZLA 4Q3DA 3IL2A 4NBTA 3EW7A 4ILKA 2R2GA 2YQ4A 3FD8A 4G5HA 3SEFA 3NJ4A 4J7CA 3NT5A 4JGBA 4CM9D 1IE3A 1E3WA 3AI3A 5T8KC 4BNYA 4DMLA 2Q1UA 2X0NA 3RAJA 3H9UA 3W8EA 1NFFA 2YUTA 3I4FA 3TJRA 5IXSA 4MVJI 4Y6SA 3WGGA 2JFHA 1EEHA 5F21A 3L4SO 4BGVA 5F5LA 3QVTA 3WYEA 4CM9A 4E2WA 5CDSA 2VHVA 1RM4A 1QR6A 3K9QO 3IQDB 3VH2A 4PN3A 1ARZA 3F4BA 3GK3A 1VLLA 2QIOA 3CH6A 4ZRNA 5ES3A 3GVPA 4IUYA 1KVSA 2HDHA 2PR2A 3AUUA 1D1SA 1ZJZA 4Z0HO 4HWKA 4Y67A 3WXBA 2G1UA 3MWDB 3PHIA 4DVJA 5JE8A 2D5AA 4NFSA 2DT5A 1JAYA 3PJGA 3RVDA 1DC3A 3A1NA 3FI9A 3O8QB 4FW8A 1ZK0A 4GX2A 5DCYA 3ZNNA 1ISIA 4E31A 3QSGA 4IS2A 4AJEA 3I3OA 5HA5A 2OGUA 3IP3A 4BNTA 3D3WA 4ZRMA 1H94A 1P31A 1Y8QA 4BGUA 1WW8A 3WDSA 2FPIA 1PGQA 3JQAB 4R1SA 4PCVA 3WMXA 2CVZA 3FN4A 4GAEA 4HFJA 1C0PA 2AMFA 4XQGA 2YQ5A 5THQA 3M1AA 4Z0PA 2D3TA 3ULKA 3L0DA 4LCJA 5GZ6A 5IDXA 5EESA 5CDYA 1C0IA 1HDXA 2B36A 4JK3A 2D4AA 3S8MA 3C1TA 1V35A 9LDTA 2YJZA 4OOEA 1DFIA 4HNGA 4PG8A 3JQBA 1ADBA 3G1UA 4NU6A 2CUKA 1JKJA 2EWMA 4BHTA 1H9AA 5T67A 2X9GA 4E12A 5G4LA 4YT2A 3C1OA 1ZBQA 1U4OA 2VHXA 4XYLA 2NU8A 4NNJA 1R4NA 3ZW9A 3JD1A 2UVDA 3FR8A 4J1SA 4IINA 5T8KA 4J1QA 4TZTA 4DA9A 4GQAA 3ZU3A 1A72A 4MVJG 1U3UA 1KY4A 1YL7A 3K31A 5LDGA 3UW3A 2YYYA 1GFSA 4PLGA 5LC1A 2X0JA 3RU9A 2PD6A 5L45A 5G4KA 1XELA 2P68A 3FSRA 2FP4A 4QO8A 2ZB3A 5BNTA 1ADFA 2NV6A 1EBFA 4FC7A 3SLKA 4ZU3A 4ZQEA 1I3NA 3Q9UA 3N7UA 3NX4A 3S2EA 3ZGYA 5BSGA 3W4JA 1HYEA 4JP2A 5B12A 3NRCA 2QHXA 1R16A 1TT5A 1J49A 4I5FA 2VZ0A 5CEFA 1LUAA 1DOHA 3QVOA 2A9FA 4RPLA 2NVWA 1NR1A 3BXXA 2X1HA 3DZJA 1XQ1A 3NTQA 1HEUA 4XDYA 2JL1A 4D3DA 4KZPA 4LMPA 1KEVA 2IEBA 1DIBA 1EUCA 1HETA 4S3MA 4YRAA 2O3TA 2BLLA 2D5CA 4YJFB 4WECA 4GGOA 2P91A 3L4BC 3OIFA 3BMCB 2OZPA 4BUCA 2GN9A 4JIGA 3LLVA 2I99A 2C7VA 2VOEA 4IM7A 1VM6A 3ZWWA 2C59A 3DOJA 1HYGA 1VJ1A 2HJSA 2CVQA 3KLPX 1OC4A 2DFVA 1MLDA 4PZDA 3OP4A 4RVGA 2YDYA 5THKA 3WNVA 2VYVD 3HDQA 5EQDA 1LJ8A 1OOEA 1KOLA 5ADHA 2FR0A 4JX8A 4XGKA 2W2KA 4J1TA 2Q1TA 8LDHA 3GVIA 1ZEJA 1GADO 4CMIA 4NU5A 1GQYA 1HSZA 2GN6A 4BNWA 2JAHA 3PQFA 4RO0A 4YT5A 4DQVA 1DC6A 1EZ4A 1XU9A 4WOKA 4BNVA 3H4VA 3IJRA 3ZWNA 4Z3DA 1NTOA 3U49A 1QYDA 4YJDA 3V1YA 4RPKA 2X7HA 1YKFA 3F1LA 4FDAA 3BA1A 3FHLA 4A03A 4TMFA 3U4HA 4GWKA 2O3UA 1GZ6A 2CMDA 4L4RA 5HM8A 1NASA 1T4BA 4R1TA 4R69A 2ZB4A 1LRJA 1LRLA 1T2DA 3R0IA 4FJ0A 1C14A 1N5DA 3U09A 1GD1O 2W90A 1D1TA 4CM7A 5B4VA 4PLYA 4AJ1A 3C85A 4B7UA 3RFVA 1VJ0A 4CMGA 2YFQA 3INTA 3SC4A 4XB1A 4K28A 4U6QA 3U5TA 3HN7A 2VHYA 1LXCA 2BRUA 2VZ8A 5CP8A 3W8DA 4DBZA 4L4XA 1B8PA 4J7UA 3H5NA 1ISFA 1F17A 2IRWA 2X6TA 3OJFA 2YDXA 1QV6A 1WWKA 5G2OA 3BMNB 4IXTA 1IB6A 1IUKA 3LF1A 4ZICA 2O3JA 3FNHA 1I3MA 1X13A 4JLWA 1J5PA 3L4BA 4D3SA 4EUEA 4D44A 4CJXA 3GUYA 1E3WB 3DMTC 3FTNA 3NDIA 1Y5RA 2IEDA 3PDJA 3OIGA 3QJ5A 5C5IA 3DBLA 5KNLA 1ML3A 2GD1O 1GQ2A 1UP6A 1XR3A 2AW5A 3DZFA 2O3QA 1M75A 3KLMX 2EERA 2EP5A 1T1RA 1I24A 3I6QA 1T2FA 3ITKA 3V5NA 3DQPA 1L1FA 1XHLA 3DZIA 5ENVA 4Y6RA 4R9RA 3GAFA 3QWBA 3JQ6A 2EEZA 1E3JA 3VH4A 4CLHA 3WFJA 4IMRA 1LC0A 3LU1A 2Q46A 2EGGA 1M66A 2HU2A 4NFHA 3QW2A 3KBOA 3H9JA 1EK6A 2W2KB 4CLEA 1EBUA 2HQ1A 4BNIA 4LSWA 4LCEA 5T57A 4EJMA 4NI5A 3UFXA 4KTTE 4URFA 5F1PA 1B8UA 3RC1A 2I9PA 2ZB7A 3TQHA 3H9GA 5CDTA 4CL8A 2I3GA 4OSPA 3K6JA 5BNIA 2GERA 3GEMA 3B1KA 1VL6A 4NMHA 4E6PA 2FR8A 1YL5A 1TI7A 1YQGA 1PGOA 3DAPA 1YOVA 4YJGB 1Y81A 3PJFA 4IZIA 4FD3A 5TS3A 1DRUA 3TWOA 3ZWYA 1A27A 1MV8A 1W0CA 4MIOA 1ISMA 1DJQA 5DBFA 3TZHA 3ANNA 3VPFA 3OJEA 1JN0A 4ZQHA 5JAMA 1LRKA 4CMAA 1DFGA 5CG1A 1VI2A 4RPGA 4ZD6A 3OH8A 1P1JA 4WCFA 2GNAA 1JVBA 1OFGA 2C20A 4U5QA 3MTGA 1KVTA 2Z5LA 1PS8A 4GMFA 4RLHA 3NT2A 5TNXA 1HXHA 3H7AA 3VOSA 2PKRA 4E32A 3ZCXA 3LSYA 5JCXA 4CLXA 5A9RA 3QWIA 5B37A 3DO5A 1LLDA 4QX6A 2E4AA 4YCAA 3JSAA 5COBA 3X2EA 4IDCA 4DMMA 2BHLA 2BH9A 4A73A 3I23A 1I2ZA 4J4BA 1ADCA 2GZ3A 4LMRA 5A3VA 1GL3A 2WE7A 2BD0A 3PLNA 5TJ9A 3SXPA 2E37A 3VHRA 5CEJA 5EINA 4ALMA 4XYMA 5I7EA 5DCWA 4A7PA 4YYZA 1ZXLA 1DBVO 3N74A 3DAGA 1B7GO 2WWRA 2X9VA 1E92A 2V6MA 1DFHA 3ZWBA 2VRCD 4IIUA 2FWMX 3H2SA 1H6CA 1BSVA 2O4UX 5ITWA 2NTJA 1XEAA 2PZKA 4QUKA 4RCVA 4YBZA 1ZK3A 5KJ6A 4WLFA 1I2CA 2FZWA 1XU7A 2ZQZA 2Y68A 3CXRA 5I8ZA 5IZCC 1V8BA 1N1EA 3D3WB 3GNQA 4I5DA 1BWSA 3JQFC 3H8VA 4WEOA 4RQUA 3JYOA 5CEEA 3IUPA 1R4NB 1ZZEA 1EE2A 2C7GA 4KDEA 4KOAA 1PJ4A 3AM3A 1GTMA 3I83A 3O8QA 4IS3A 4U0JA 1X7GA 3AU9A 3INRA 4GVLA 2B5WA 4WK6A 1DC4A 3JYNA 4AVYA 1HTBA 5KTKA 3PYLA 4N5MA 4YRBA 1MA0A 3GT0A 1JKFA 2OFPA 4UVIA 4TRRA 4RORA 2Y0EA 4ID9A 5L9AA 1NPDA 5TLSA 2O7SA 2C54A 5FI3A 1DIGA 4O59O 2GN8A 3UH1A 3GEDA 3RBVA 1GEGA 1SB9A 3ADPA 1LSJA 1YXMA 3TOXA 1A5ZA 5U9CA 2P9CA 1K6JA 3UN1A 3IDSA 1V3VA 4PZEA 3RFTA 5A04A 3RSHA 4O6VA 3CIFA 4HFNA 4FJ2A 4MVJF 1C3VA 2QX7A 1DHRA 4PVCA 1ZSNA 1GU7A 2VTDA 3EDMA 2X5JO 3JQ8B 3N58A 1H9BA 4XR9A 3VZPA 4BO1A 5KJ1A 1NXQA 2WYWA 2BGKA 1N8KA 3TRIA 1NQAO 1UXIA 3F9IA 4FSHA 4JROA 1I10A 3RBXA 2QRJA 3B70A 2PFGA 4YJHB 4PG7A 3S1LA 4XQEA 2Y1EA 1LI4A 2GDZA 5TF4A 4M54A 3WLFA 4GH5A 3DBVO 2YHIA 4LRSB 2DTXA 3GY0A 4WNCA 3RC2A 4GVXA 1U5CA 1AGNA 1G1AA 4CR6A 2XXJA 1IULA 2ZTUA 1J0XO 1V6AA 2HLPA 4PLVA 3EMKA 1D3AA 2OUIA 3QP9A 1U3VA 5L51A 3Q3CA 4CMEA 1EK5A 4WLUA 2EKPA 1JU9A 3BHIA 4BB5A 1QYXA 3MTJA 3I9LA 3KEQA 4IMPA 1PS9A 1OI7A 1UAGA 3AOGA 4XIJA 2Q1SA 3WGTA 3GR6A 4EW6A 3WGZA 3ROQA 4OHUA 3VZSA 1E3EA 1T2EA 4OQZA 2CDAA 2Q49A 2LDBA 4O0LA 4Q3NA 3W8FA 4H15A 3ZNQA 4BMVA 1UXHA 2NWQA 1ORRA 4BNXA 1PQPA 2XAAA 3KUXA 2FR1A 3K2BA 2NU7A 1IPFA 4PLWA 2DBRA 3KRTA 1UXGA 2NTNA 5FI5A 2IZ1A 3UF0A 4CQLB 2GLXA 3O4RA 4AJNA 2B4TO 3G17A 1PWXA 1VC2A 3I9MA 1QSGA 3ZHBA 3WWZA 4TROA 4R4JA 3T7EA 4ONEA 3I1JA 2AQKA 4YVFA 3R1IA 4LRTB 2TMDA 1I01A 2X9NA 4TZKA 4WLEA 1CWUA 3PQDA 4I5GA 3TL2A 2HCTA 5A1TA 3VZQA 1RPNA 3MWEB 1SOVA 3KV3O 4YXFA 2B37A 2BFPA 3V2UA 4GSKA 4XD2A 4O1MA 4I9HA 4TWRA 1X0VA 4GKVA 1XCBA 3DMYA 4BGIA 1MB4A 5BSFA 3A28A 3ROPA 3TZKA 4W7IA 5KJFA 3JQDA 3NDJA 3R6DA 5HS6A 5I9LA 4DUPA 4DC1A 3JD3A 3I9NA 2VUSA 4BKQA 4CLOA 2HK9A 1HE4A 1E7YA 2Q45A 4FCCA 2R00C 4FN4A 4ZVVA 1GZ3A 4INAA 5DP2A 1P45A 3RIHA 4TRNA 1E1KA 4WLOA 3ZU2A 4M89A 2PTGA 4LVCA 1LU9A 4DPLA 5KVSA 2V6FA 4YT4A 4AG3A 3H5AA 1P9LA 1HWYA 4JXKA 1NAIA 1Z74A 1P44A 3ONFA 3BHJA 3FBTA 1I0ZA 3GVXA 1VE9A 2I76A 1Q7BA 4RVSA 5HBRA 3ST7A 2C2YA 4D45A 4AJJA 3AI1A 3L07A 3PGJA 4QECA 2IXBA 5IDQA 2PGDA 4OQYA 4D46A 1F8GA 2DTEA 2AEMA 4XDZA 3GVHA 2QRLA 3D5TA 1HDCA 5C3MA 3NTRA 1TVEA 1YOVB 2J8ZA 4L0QA 4WCFB 4E2ZA 3PVZA 3JQFA 3W4KA 5A03A 1SNYA 4CMHA 1ZVMA 3U4IA 5JAIA 3EY4A 2GGSA 5L4LA 1UZLA 1KC1A 2J5KA 5CHEA 3WSVA 1S6YA 3OQBA 1VL0A 1UDAA 2ZATA 5CPBA 5L53A 2I66A 4XWYA 1VRWA 1RWBA 3V1UA 4CUKA 1SEVA 3ZNPA 1UDCA 4JNKA 1LC3A 1IZ0A 2DPHA 4G2NA 5EJ2A 3ASUA 5FF9A 5DF1A 5JAZA 3AK4A 1HE2A 4EJ6A 1HDZA 3W6UA 1ID1A 1C1DB 1Y8RB 1H6BA 1KETA 1LTHR 4MIEA 5F1OA 2P4HX 3OA0A 4GSLA 1I32A 2GN4A 1NVTA 3WOHA 2D59A 4EEZA 1U7TA 5K0ZA 1HDOA 1PL6A 2NVBA 3K8ZA 3ZWXA 2HK8A 3A4VA 4DTIA 1XKQA 5JDCC 3LC7O 3RBZA 4M87A 1R37A 1YONA 3UCXA 3FRJA 3CSDA 1PJQA 2PGJA 3JQAD 2I5PO 1ISGA 4E5MA 2QZZA 1YL6A 4FC6A 4I9NA 5C37A 5ICSA 1E7RA 2R00A 3CZMA 1WDMA 4WLNA 5EN4A 4GWGA 3ORFA 4MINA 2OBNA 4PVDA 1PX0A 1E77A 4K1LA 1TB4A 1MXFA 3B6ZA 5L4SA 1NAHA 6LDHA 1LLQA 2PKQP 4Q3CA 3H65A 3L9XA 3SJUA 1M76A 4L76A 4CM1A 2AQHA 1QYWA 4IBOA 3RUFA 3TDKA 3GZNA 4UUPA 4UVDA 1AXEA 3PTZA 1SMKA 5HTOA 3KTDA 3NGXA 3SLGA 3FBGA 4BNZA 4E5PA 2Y1FA 3IOYA 4HBGA 4GI2A 4U7WA 3CPSA 4NZ9A 4D42A 1NQTA 3AY3A 3DFUA 4MKRA 1ENOA 5EPOA 5L4NA 1FJHA 3AFNA 3HN2A 1YQXA 4MO2A 5L7TA 5I9NA 3JYQA 5IZ4A 4IDEA 2JAPA 2PZMA 5EQFA 1DPGA 3ZU4A 3PDUA 5DOVA 3AU8A 3P2YA 3I4CA 4A27A 4OXNA 5HS4A 2G82A 3PYXA 3K2EA 3K30A 3ZH2A 2J5QA 1IZ9A 4FFOA 1EUDA 4NPCA 3LZ6A 1V3UA 4IDDA 4WOJA 1MG0A 3RUAA 4BMNA 2Q2WA 3DBRB 2UV8A 3SVTA 2ZB8A 2H5LA 3VVBA 3DEYX 1P1RA 3A9WA 1EMDA 1VPDA 4JJIA 2Q3EA 5G0VA 3CTMA 1Z7BA 2J3JA 4GBJA 4JQCA 4YB8A 4E2YA 1LDYA 5ITVA 5JSFA 4IDAA 2FMUA 4HY3A 1LDEA 3AY6A 3QLJA 2WDZA 1O94A 3FF4A 2ZJ1A 1WLYA 3VZRA 2EG9A 4FPXA 2EV9A 2I3AA 3E1KA 2QRKA 1G6KA 4NFYA 4OKNA 3WQRA 3TN7A 1GPJA 4OAQA 4Z9XA 1U9JA 4CMCA 4YPOA 5U4QA 5JC8A 4BO6A 2ZK7A 3DZKA 3V8BA 3WB9A 2IYOA 2H63A 4Q3BA 4CMEC 3ZHXA 4EGFA 1HDRA 4QTZA 5JO9A 5GZ1A 4RDHA 2CZCA 3BMCA 1NNUA 3KHUA 4CPDA 3FPCA 5AXAA 2FSVA 4BO7A 4BIIA 4I8XA 1TLTA 1VJTA 4Z3KA 3JQGB 1T2AA 4L73A 5F3RA 1ZK4A 5J23A 5BR7A 4FQ8A 2PA3A 3CMMA 2VUTA 2OO5A 3FNEA 5KOIA 1U8XX 2FY8A 3DTTA 3LDHA 3LLSA 4P4GA 3HG7A 2V7PA 4J0EA 4DLLA 3UKOA 2F1KA 3FWNA 1C1DA 1UDBA 1Y8RA 4CLDA 2EKQA 4Y9DA 5IDYA 4KQWA 3WJ7A 1XYGA 4GLLA 4RPHA 4CR7A 4CLRA 2JD0A 3KXDA 3I9KA 2CDBA 5IXYA 4UUNA 4JBIA 2BFOA 1E0DA 2P2SA 3TZ6A 7ADHA 4BV9A 1PJTA 1ZKMA 3V2GA 4IPTA 4LK3A 2D0IA 4J2HA 3DB2A 3JTMA 5FYDA 4EZBA 1SEPA 3F4LA 3RKRA 3OEWA 4FFNA 4CM5A 4A10A 1IY8A 5DP1A 2EKLA 1P0FA 1GEEA 1NP3A 3JQCA 1GAEO 4RLSA 3WLEA 4J49A 1EQUA 2TMGA 2AXQA 3OA2A 4PIVA 5A9SB 2HMSA 2O3SA 4FGSA 3U4CA 1QKIA 4YRDA 1R15A 1CERA 3GGPA 1NYTA 1X7DA 3E9MA 2I6TA 3R3JA 3QE3A 4CQMD 4A0SA 4E13A 3OICA 3E5RA 2GF2A 3DAFA 2O3RA 3GHYA 3IKVA 4ESOA 1XLTA 3D1LA 1PZHA 1PGPA 1MC5A 3KYCA 4ZHSA 4IGEA 4RF2A 1OC2A 3BTOA 2YW9A 5BNFA 5TQVA 5JMPA 1P1IA 1U3TA 2PLAA 3B20A 1F8FA 4B7CA 1BGVA 1VL8A 5G0UA 2YHUA 4R68A 2V6BA 1UH5A 1U5AA 3LF2A 5I8WA 3VPXA 1HZZA 4ND3A 4DXHA 4IXWA 3DR3A 1R4MA 4NJMA 4TSKA 1AUPA 4HP8A 1WMBA 2G17A 2J3HA 1T1SA 3B1FA 4DLAA 4N5LA 1D7OA 1QMGA 4J2OA 5ER9A 1O9BA 4EDFA 4Q3AA 1YDEA 2ZTMA 3OIDA 1UXJA 4MVJE 1Q0LA 3H3FA 3ZV4A 4R1NA 4DC0A 1XGKA 3GHHA 3WX0A 5C7IO 4IJWA 1Q7CA 5I7SA 1JWBB 4B4UA 4XGIA 1I30A 4N18A 1N1GA 3T7CA 1KVRA 2X4GA 1A9YA 3ZWPA 4IGFA 2UYYA 2DBQA 4I1IA 1DO8A 1ZEMA 4BNJA 1V9LA 1NWHA 4GPD1 2HO5A 2Y0DA 1ULUA 1PR9A 1E6UA 1Q1NA 3HDYA 3LT0A 2A35A 4IDFA 3SC6A 3VH3A 3PQEA 4OYRA 3ROKA 2FSSA 3RUHA 5U1PA 4GKBA 4S1VA 1E5QA 4IJVA 1QLHA 3VAZA 4FFPA 4JJFA 3ETEA 4K9DA 3M1LA 1JQBA 4AJIA 3QWHA 1E6WA 3GN1A 3KVOA 3MZ0A 4GX0A 1Y5MA 3T4XA 1PS0A 3RC7A 5KIAA 3NGLA 4TQGA 1ZK1A 4M49A 4F45A 1P77A 5G0TA 3X2FA 2DQ4A 4E0BA 2VTEA 4OOFA 2AA3A 4J16A 2DM6A 2FHSA 4BV8A 2ZCVA 4RZIA 1NM5A 1DC5A 2VQ3A 3C1AA 1ISJA 3DC2A 4J3FA 4UVHA 3WICA 4A26A 4XYEA 2Q4BA 5JYDA 3WIEA 4CQMA 3MJTA 4W9NA 3PHHA 4KTVE 3TSCA 1WXDA 2NU9A 2H9IA 3K92A 3NYWA 2GCGA 4RL6A 2RBEA 3PYMA 3WIDA 4E3ZA 4YA6A 1EDZA 1M2WA 4YAKA 1XQ6A 3CINA 4J4HA 4Y98A 2WD7A 4KP7A 4RJTA 4FS3A 3WTCA 3HNPA 4JBGA 5ENDA 3IKTA 2VNAA 4HXYA 1ZMTA 2GR9A 2BELA 3OHSX 3PP8A 3QVWA 2ZKLA 2Y05A 5JPIA 4B8WA 2GYYA 4CV1A 1ONNA 2HMVA 3WGIA 1OBFO 4P4NA 3H6KA 1Q0QA 1SC6A 3ONEA 1R4MB 5IN4A 4D79A 1E1LA 3BTUA 3W6ZA 4CM4B 4RZHA 1I8TA 2I65A 4NBWA 1UXKA 1E3IA 1SCUA 2E6UX 1B3BA 4LW8A 4B4OA 4F6LA 1IHXA 3PIDA 1GY8A 1FXSA 2POQX 2X5OA 2VWHA 3D0OA 3DDNA 3DHEA 4KQXA 5CFZA 3PWSA 4ZQFA 1DDOA 3JCZA 4NBRA 7MDHA 3ZWVA 1E1MA 1HE3A 1HLDA 2VWQA 4YAEA 3PHGA 4B79A 4JCOA 2EIHA 1MGOA 2WJPA 4MOWA 3RUCA 4OXYA 2VOJA 5A4DA 4MVJH 3E9QA 3TOZA 1ZH8A 2P9GA 1BW9B 1HL3A 3AUAA 3PWKA 1I2BA 4ITUA 1HSOA 4QFCA 1DIRA 2VT2A 2DAPA 3PWZA 3W4IA 4FIZA 4WUVA 4DQUA 3LC1O 3R3SA 3VKVA 5CAEA 1JWAB 3WGOA 1R66A 4LSMA 1GYRA 1T24A 2JD2A 1Z82A 3QWAA 4TKLA 4UEJA 3WQQA 3PI7A 1W4ZA 4KMSA 5AXBA 3Q6IA 3TF5A 4K6CA 1NVGA 4E33A 2V6GA 2Y1OA 1LDMA 1A7AA 1UUFA 5I7VA 3GGOA 2Z95A 3GFBA 2Q2QA 2GUGA 3ZU5A 3KYBA 1IYZA 1VSUA 3ITDA 2R6JA 3FR7A 4DIOA 1YBVA 2I67A 3C24A 2XOXA 1K89A 3I5MA 4XJSA 2CF6A 3CE6A 3S2FA 3WYBA 3VC7A 3P19A 2CFCA 2AG5A 2OP0A 4K6FA 3RD5A 3BMOA 3UCEA 3BTVA 5L40A 3H2ZA 2EW2A 1XWFA 3ENKA 5DOZA 5DN9A 1QYCA 1B26A 3C7AA 5EL0A 5HWSA 1NR7A 3GUCA 3WFIA 1P1KA 4P8RA 1YB5A 4OL9A 2IZ0A 2NLOA 2NVUA 3KYDA 4AICA 1MX3A 3EUWA 5A9TA 1PJSA 2NNLD 2AG8A 2PV7A 5FEUA 2UAGA 4EYEA 5L3ZA 2VN8A 4QEDA 1ENYA 4FFMA 4II3A 1WVGA 4BNUA 4LGVA 3WMWA 2PZJA 1ZO8A 3JQ8A 5T64A 1LDNA 4D0RA 1BXKA 2OOSA 5JBIA 1KC3A 4BO9A 1BXZA 1EVIA 3CZRA 1PJLA 3EAGA 4AL4A 2X5KO 4NJOA 1KVUA 4FR5A 1C0KA 2LDXA 4NR0A 1FDWA 5JCJA 4F3YA 4J43A 1MFPA 3JQ7A 4R3NA 4R41A 3SX2A 3SJ7A 4DLBA 4DYVA 1WZEA 4R3WA 1ZFNA 1H2HA 3GOHA 3NV9A 4ZQGA 4MDHA 3U9LA 1GUYA 4BNGA 4M55A 3GZNB 4IQ8A 4ZGWA 1O95A 4W9NC 2QW8A 1HLPA 2JD1A 4FGWA 3MEQA 1WZIA 3GNTA 1IOLA 1UJMA 4EBFA 3HB4X 3H9EO 3EVNA 3NEPX 1NVMB 1PTJA 4XCVA 1BDMA 4YWJA 5DDIP 4Z9FA 5BT9A 4BS9A 4G81A 3GPDG 3A06A 2V65A 2E82A 1YBAA 3D4PA 4B4WA 3GMDA 3ZV5A 4IZHA 4RDIA 1MXHA 3F3SA 3QY9A 5B4UA 3GGGA 2H6EA 1GDHA 1ZUD1 1QG6A 1H5QA 1O0SA 4UUMA 5AVOA 3EZLA 5I9MA 3DOCA 1X15A 2D1YA 1E3SA 1KY5A 3DBRA 3HQ4O 3QRWA 1X0XA 2A4KA 1GCUA 2FPGA 2GPTA 3RJ5A 4TVBA 4EITA 1HRDA 5TIIA 1J6UA 4B3JA 4B3IA 1UR5A 3AOEA 1I3LA 2X8LA 4HFMA 3JD2A 5LDHA 2EP7A 2G5CA 3O26A 3DONA 3VPHA 3QVXA 3ZWMA 2VYNA 3ZI0A 2FOIA 1Y7TA 3UUWA 1ZK2A 3PRJA 3LT4A 4HUJA 4F6CA 5BQFA 2PD3A 1D4FA 4Q39A 5IZCA 3GAZA 1ADGA 3E5MA 3Q9NA 2IZZA 3HSKA 3JQEA 1LLCA 2RH8A 3C8MA 4HNHA 3EHEA 4C7KA 3OJOA 1NPTO 6ADHA 5JLAA 1EE9A 2WD8A 2JHFA 1WDLA 4YTEA 1NPYA 1VSVA 1GYPA 2PGLA 4J7XA 4L4SA 3L9WA 5F5NA 3OF2A 5CDGA 3LT2A 4CMBA 1AE1A 4MPDA 4PLPA 2W8ZA 1F0YA 1LA2A 2RHCA 1B15A 2CNBA 3G3EA 3GZ4A 4FFLA 1VKOA 2O7QA 4PG4A 3AY7A 1UZNA 2NVUB 2AQ8A 2BFAA 5AYVA 4FOSA 3COSA 5G0SA 1PJCA 3DBHA 1DHTA 4UEKA 4AJ4A 4JBHA 2YV2A 3H3JA 5FWNA 3AM4A 3CEAA 4FJ1A 4W6ZA 4P22A 4AJKA 5F1KA 4FFRA 3GG9A 4GX1A 4BKPA 1M6WA 1P74A 3JYPA 4GX5A 3F1KA 3F46A 1NHGA 3ZV3A 3LK7A 4XKJA 4L8VA 4IDGA 1QYVA 2E49A 3D64A 4OXKA 2VHZA 4W99A 3W1VA 4WASA 4D0SA 1A4UA 3B1JA 3LQFA 3NDRA 1T25A 2CF5A 1FDUA 3GMSA 3OQ6A 4Q9NA 1TXGA 2RIRA 3IMFA 1OAAA 1R0KA 1XA0A 1DIAA 3L6DA 1TA4A 1AN9A 1R6DA 3OBBA 4XGNA 3UOGA 3GVCA 3C3XA 3T4EA 2JJYA 3GQVA 3LC2O 1CF2O 4O5OA 3JQ9C 3AM5A 2CY0A 2P4QA 4BNMA 2G76A 1N7GA 1X1TA 1ZXBA 2HAEA 2QQ5A 2Y93A 4NG5A 4Y8VA 3GRPA 3KETA 1E6EA 3PGXA 3DZBA 4PZCA 5CG2A 1DB3A 3DZGA 2YY7A 4IQ0A 1Q0HA 1N9GB 1ZJYA 3DBHB 4OKIA 1EUZA 4NJMB 2VUUA 4J9UE 1K6XA 5A06A 2VNSA 2VYND 3K5PA 4W82A 2RHRA 3WSWA 2Q1WA 5TX7A 5I7FA 2ZQYA 4H3VA 1AHIA 4BMSA 1NFRA 3CUKA 1HZJA 3UAGA 4YT8A 2NACA 5COAA 1CEQA 1ONOA 3O9ZA 2WYVA 1DSSG 4DWVA 5JDIA 4DRYA 4PLHA 3FWZA 2B4QA 4NK5A 5EIOA 1OMOA 2HJRA 3HFGA 1JW9B 2HMTA 4ND5A 4PRLA 1FDVA 3DTYA 1Y9AA 3OSUA 1H6DA 4UEOA 1W8DA 3HE3A 4BKRA 3FNFA 1U28A 2ILTA 1KEPA 3HB5X 3GFGA 5JFOA 5FFFA 4BB6A 2NU6A 1SBYA 3BAZA 3BMQB 3NUGA 2JHGA 4YQYA 5A9SA 1C1XB 2Q50A 3Q2KA 4ZN6A 4Y6PA 4RQTA 3GDGA 1K2WA 2DBZA 3JQAA 3WGYA 1YVEI 2HSDA 3BHMA 5L95A 3EC7A 1F12A 1LSOA 2DFDA 3O38A 2A94A 4J0FA 3M2TA 1I3KA 1PZEA 2HUNA 3UVEA 4CUZA 3E6AA 3TNLA 3BTSA 2VHWA 1BHSA 5IN5A 1P3DA 2HRZA 5JY6A 2O50A 3WTBA 2FN7A 1PL7A 4IJKA 1WAMA 4IIVA 2VYVA 1A9ZA 4RGBA 5DBIA 3ASVA 1ONPA 4ALJA 2ZTLA 4PG5A 4YEDA 1I33A 2AQIA 3UCFA 4C7JA 2C82A 1C0LA 3GPIA 1DRWA 4XRGA 3K96A 1FK8A 1U3WA 4AJLA 5T5QA 2AHRA 1YQDA 5JDCA 4RPJA 4UVEA 1NBOA 2QG4A 3DHYA 4WE3A 1HF3A 1PR3A 3D3EA 4Q3EA 3L77A 3RWBA 2FZEA 3L6OO 3V2HA 4M1QA 2B69A 2B5VA 4YAGA 2Q2VA 1YRLA 4DGSA 1HKUA 3ETGA 2BMAA 2C0CA 5MDHA 3AOEC 1X14A 1H6AA 5KVCA 3VVCA 1BVUA 3NTOA 4I9UA 3NKLA 1JLLA 3U62A 4UREA 2ZYGA 4YJFA 3UXYA 2EHDA 2NTVA 4TKMA 2HMUA 4OH1A 1SO8A 1Z45A 3KSDO 1RYEA 1DRVA 4J4TA 4M86A 4BQPA 5IFLA 5JW6A 1TEHA 4CMIB 1WMAA 1B0AA 1TT7A 4BO8A 3DMTA 2GRAA 1H2BA 1YDWA 3C7DB 4WPGA 4XYBA 4MKXA 3GEGA 4WGGA 1BVRA 1KVQA 4JJGA 2J5RA 4DBVO 2ZJ0A 1K3TA 4L9RA 3LVFO 3E48A 3O03A 1YJ8A 4BNKA 1ENZA 2WM3A 3BMOB 4WKGA 3IUSA 3VH1A 1JA9A 1N2SA 1BMDA 1U2DA 2RH4A 4D3FA 1FDTA 2VWGA 3A14A 1E7WA 1BW9A 3DBLB 3NAQA 3WWYA 5A5FA 4TVOA 5JDIC 5K6AA 4DIBA 5CDUA 2CVOA 3DXFA 3E18A 4IQGA 4OJNA 4BNLA 1O8CA 2H1SA 2ZIZA 4MKZA 1RYDA 5KCZA 4N5NA 2DKNA 3ANMA 4JP3A 4L74A 2PKQO 4K26A 3S2GA 2Y1GA 3WGQA 4IDBA 4TRMA 2P5UA 2SCUA 4QO7A 1AXGA 1Y6JA 2NQTA 2WE8A 3WGHA 2DUWA 2X58A 3WR5A 1B16A 5JAQA 4UAGA 3PJDA 1EQ2A 3OECA 2YFHA 4CM4A 1YWGO 2P9EA 3ON5A 3HHPA 3MCVA 3UGKA 4ND2A 3ZNOA 2CDCA 1YE3A 2QYSA 4E2XA 2EF1A 2GASA 5GY7A 3TFOA 4CMJA 3INGA 1GUZA 1PSDA 3RKUA 1LNQA 1LEHA 2O2SA 2O23A 4YACA 5C7OO 5IDWA 5TT1A 4M8SA 4YR9A 1JAXA 4XQCA 5DT9A 3OJLA 4RVHA 3DL2A 2PH3A 1LQTA 4NQZA 2RCYA 4J91A 1ZNQO 4RVFA 3F5SA 4CODB 3Q1LA 4NBUA 5DCUA 5LCXA 5B1YA 3ADOA 3BYZA 3GC6A 3QV1A 4MVJP 2B4RO 1I36A 3PPIA 4WEQA 4ZA2A 1MP0A 2RAFA 2DU8A 1YB4A 3RROA 3LT1A 5ILGA 4B3HA 4QT0A 3D4NA 1RM0A 1V3TA 1Q2XA 4R5HA 3VPSA 1E7SA 2NQ8A 4FOOA 1QRRA 3EZYA 1DEHA 1DLIA 1YBMA 3PFWO 1H0KA 2Y99A 4BKUA 4FB5A 5KJEA 2EGHA 4WJZA 3OJ0A 2WEKA 4J9VA 4ROSA 2YHIB 3STHA 3D4OA 3HWRA 3DZHA 4YAJA 5JMWA 5KVVA 4A5OA 5AQ1A 3SBOA 5JY1A 1E7MA 3IC5A 1P33A 2YV3A 1Q7GA 1GQQA 2GO1A 1PGJA 2QZ9A 4PLFA 3RUIA 2J3KA 4BO2A 5KKCA 1WP4A 1HDYA 2HMWA 2JFFA 4BNHA 1LLUA 4B7XA 4RF4A 4XRRA 2AEJA 1ZSVA 3IIEA 1PJ3A 4I5EA 3HDJA 2A92A 1G0NA 2NSDA 4ND1A 1L7DA 2IDZA 4IJUA 4UULA 1UP7A 2J3IA 1XSEA 4H16A 2OBYA 4QXMA 4D41A 3VKUA 3U0BA 2CSUA 1HYHA 4BVAA 1PEDA 2W4QA 4BKOA 2EXXA 1PZFA 1YGYA 5EERA 1P1HA 3M6IA 1R12A 1EVJA 1CQIA 3MJEA 2XXBA 2OMEA 1Y9EA 4UUOA 2F00A 2X23A 2GZ1A 5JC1A 3WJAA 5L7WA 1MC4A 1GZ4A 4R54A 3UICA 4KWIA 3E8XA 4YJHA 3I9JA 3PIIA 1JDJA 5JYEA 3MOIA 3VDQA 3AUTA 5JS6A 1UP4A 5A5EA 1CYDA 3Q0EA 4W4TA 5AOVA 1CRWG 1P0CA 2BGMA 2PY6A 2UUPA 1AHHA 4QQRA 3TPCA 3WNQA 4RVDA 5JXWA 5KJCA 1PJBA 1U8FO 3EYWA 3IP1A 4QSMA 1EDOA 1YB1A 1LSUA 3ICCA 1QXSA 3BMNA 8ADHA 4E5NA 4DQXA 1MFZA 1GCOA 5JO0A 1NHWA 2Y66A 3PZBA 2DVMA 2NADA 4HADA 4CV2A 3ZN2A 4XR4A 3AJRA 3AUSA 1ULSA 3F5QA 1UAYA 1VKNA 1QORA 1R0SA 3AI2A 2OL4A 3I6IA 4RF3A 2B83A 2UUOA 1UZMA 4OGWA 4PRKA 2EJVA 2GSDA 4A2CA 1DJNA 1YS4A 3I52A 3GLQA 1EFLA 5KWEA 3VPGA 3DWFA 2PH5A 3GF4A 3ZHYA 2DC1A 4RF5A 1Y8QB 3IAHA 1KIFA 4D43A 3ROMA 5TT0A
chains in the Genus database with same CATH superfamily
1IAWA 4QJ3A 2VSNA 5A02A 1OYYA 1JH8A 1DLJA 3Q0UA 1K68A 1Y6RA 1XD7A 3HXLA 4PSUA 4ARVA 5CB4A 1R0WA 2GN1A 4JJ7A 4MAMA 2HJ9A 4KQMA 5ICMA 1BR2A 1TZBA 5IS2A 4Q01A 1SK8A 2VNKA 2A3NA 3N6XA 1IC6A 3PLAE 3TIFA 5EVJA 4YQZA 2VDOB 2XB8A 4UXNA 1YK0A 4KDFA 4TN1A 1WQ3A 3ZZNA 4EHHA 1Z62A 2GD0A 3GN2A 2XAUA 3E5NA 4OGLA 1NX6A 1SOUA 1C1XA 2HTFA 4Q7MB 3ZE8A 4PSWA 4C4OA 3K2IA 1RHJA 3W7BA 2VZ9A 1YS9A 3OTHA 4WLVA 2GBGA 4OUKX 1YO6A 3CLRD 3DULA 3S2UA 4BBPA 5JANA 2OCIA 4IKOA 4PAMA 1ENPA 2R93J 4I76A 1TMYA 3G4SI 5TRTA 3F8NA 1DJPA 1ZWKA 3DHNA 3L1IA 1LJ9A 4C0AC 5KVQA 4CR8A 4AWXB 3REFA 4E5YA 1N1MA 3ZE1B 2E2WA 3MGCA 3QKUA 1V25A 3MUNA 4GL4A 1SKYE 2XMSA 3M3HA 4K5QA 2WHRA 2ID3A 5D6FA 4BYMA 3DE2X 1M6YA 2RI6A 5H9VA 4CN9A 5IVKA 1SHLA 2C9MA 3M6FA 4G0VA 4OHXA 1WCMJ 3JQ7B 3U9SA 4E07A 1KTIA 5CDFE 1WDKA 3EDYA 1BJAA 3S1RJ 1QHHD 4LV5B 3AW9A 1V16B 3CZ4A 4BQSA 4XWOA 3ZJ5A 5BWMA 4LXXA 4WXRA 3ZGOA 4II2A 3V2IA 9LDBA 4YWHA 3IV6A 4HRAA 4MROA 3FBWA 621PA 3PEVA 1C50A 2CL0X 1TZ2A 1MEJA 1USWA 2FZGA 3FJ1A 2PZ8A 1J4AA 2P90A 3E5XA 2IKQA 2NSLA 3DAHA 2BHSA 2C2WA 4KUHA 4KXNA 3WBBA 4AQDA 1A7KA 1L4MA 2JCXA 3PQ3A 2Q21A 3MC1A 5A05A 5GAGJ 3SM3A 1H69A 4EJ0A 5BSHA 2HZTA 5EEHA 2YRXA 3B36A 3MJVA 4N6NA 5F52A 1VYHA 3T7TA 1LPMA 3KJFA 4YLEA 3RU3A 1QFSA 4A69C 5FH9A 3EBOA 4J6FA 5E4FA 4NDNE 5CB4F 3MJFA 3JYLA 3MHPA 4GXQA 4D81A 1F7UA 2O48X 2YJ6A 3GA0A 4Y2VA 5ILOA 3CN9A 2ECPA 2QN2A 3NO4A 1QZEA 5LHIA 4ENWA 2XKJE 4TPKA 3ZMDA 5SYNA 2C5AA 2AN4A 3CUWA 3MJCA 5F77A 5EP4A 5EGOB 4V1CA 5FGMA 3BN3A 3K4NA 3BDAA 5HF8A 3BC1A 2XQJA 2O8DB 3GLTA 1MB2A 3OT5A 3EVFA 3CCEI 4IXMA 3NWOA 4KB5A 4ZOCA 2HKIA 4MNTA 3ZV6A 1R6VA 6NULA 1L7QA 1RAAA 3R61A 4XW2A 4E5VA 2IS6A 4WMLA 3CC8A 5IAJA 1CNMA 1QG0A 5AI9A 1KPHA 4CL3A 4F2PA 3NQ41 1IN1A 2NO0A 1GZ5A 5CVRA 4G89A 4A3DJ 4YNBA 3TZQA 1N1DA 1TW3A 4PGHA 3HMQA 3MT7A 4JLOA 1L6IA 2WVGA 3ZQ7A 1O5IA 5CJJA 4XJTA 5HE9A 1JFTA 1IVSA 3ZKWA 4GR5A 4ZQBA 1KIMA 3P9SA 3SICE 2JJ1D 2PX3A 4R1UA 1YZFA 3S2IA 1GILA 2XUIA 1X2MA 1XQVA 5EE5B 3JAKA 4E4RA 1UBHS 4PSAA 4TLCA 1W85B 3FTCA 4XIYA 2R1UA 1D8KA 5K8LA 5K0GA 2IW3A 2YW2A 3AEKB 1JH9A 3CLTD 3MD0A 3NBYC 2QDXA 2C42A 3DM9B 4QYIA 2WU4A 2CDRA 2GKGA 3IO3A 3H19A 4DSNA 5I4IA 5GTHC 2MSNA 1KERA 2BTEA 3WYCA 5LQUA 4EPTA 1UBOS 2PK3A 2SKCA 4M1KA 2ZKZA 3HJAA 1W30A 4W7HA 5BVHA 5EIEA 3KSAC 5J5VA 3MMXA 1Z6ZA 3KU4A 4DPKA 2I4MA 4AFNA 5K20A 1EGHA 5D5UB 1RAIA 1DQRA 1P81A 2J7KA 3PQ2A 4XDYA 4XLZA 1RKBA 3DOOA 1EB9A 3VR3D 4DIEA 2COBA 1S7CA 3D31A 1YGPA 2NT4A 2Y2ZA 1EFTA 3DFZA 4BO0A 3ELDA 1WM1A 5ALHA 1W0TA 5JH7B 4RA2A 5E1OA 3WDLA 4E6EA 5G40A 3V8VA 1B6GA 1CRQA 3FPHA 3IELA 4UASA 3S29A 3NASA 5ISMA 1FLAA 2GM4A 4HKTA 3NEUA 1B8VA 3TEDA 1Q0RA 2VWPA 4F3CA 4WK8F 1BWRA 2QBYB 4LD5A 3E9EA 2IPXA 1HW2A 3WLJA 1W6UA 1DXYA 1P2UA 1HDDC 3K1JA 4R0VA 3RH0A 2XB2A 3IUOA 2DLDA 4DABA 1R0LA 2CL5A 3JZAA 2R8EA 1JLMA 3PJEA 4KC0A 1B3RA 1NXTA 1TLFA 3LXMA 2IHJA 3RNOA 4A8JB 4NK4A 3P5SA 1YMQA 4P55A 1G20E 4RVNA 1FP4B 2EZ4A 2FU4A 2ADOA 1ODJA 3U1BA 1KIAA 1GUFA 2F48A 5DU2A 4ZKDA 4DMHA 1SWVA 1T5TA 2VH1A 5C7LO 4U0YA 3ICPA 1W9HA 2E48A 3QYAA 4F84A 1C30B 4J90A 3O2QB 4YUWA 3TAUA 1WJEA 1EJ9A 2Q9UA 1E2KA 4RPCA 2QQ8A 4LGYA 5IC6A 3X1WA 4EYGA 5JFRA 5EWMB 1V54H 1E7QA 3E2MA 4QNMA 2FOLA 3JZFA 5SY6A 5EYRA 2AE1A 1E4OA 3KSZO 2XUOA 4C3OB 2VRBA 2M6SA 2O1SA 4BJTA 1LDDA 2J9FA 1LBQA 2PPLA 4LOAA 3PI6A 4OMUA 2FGJA 4QTUB 3DTEA 1QIIA 3GBVA 3DKYA 2BM9A 1QMPA 3FW1A 2W2PA 2QA5A 3G2KA 1OU4A 2JI8A 4YAFA 4CUJA 3PHJA 4FXPA 3J80Z 4FYYA 4QARA 3ZWOA 1G38A 3MILA 4B2IA 3ZWCA 4QFBA 3E9NA 4FEAA 4MWDA 4DVGA 3TO6A 4YRJA 3GFMA 1E1QA 4JFAA 2E1MB 2W6NA 4BE9A 2E7XA 1B0ZA 3LSIA 2A9QA 2BFMA 2C8VA 2P6PA 3A6EA 3QOPA 2JI6A 2FX5A 3F47A 5DX8A 1QIFA 5EXPA 3UHAA 1KY3A 1WPQA 1UDRA 1BJKA 3ANYB 2IPOA 1F06A 4HEA2 3FHZA 4GM0A 4MJLA 4BXFA 3ZHTA 4XEHA 1Y6GA 2PX9A 1QZTA 2X8JB 2QD5A 4LSGA 3CVWA 1KPGA 4LN1A 2GA9A 3NBZC 4BQAA 2Q3LA 3PRHA 3SIPA 1Z73A 2WSLA 4W63A 1S2IA 4L4YA 1F4KA 2QX6A 3DZ8A 4D99A 2D2IA 5JNRA 4RJIA 4L51A 4DNCA 2ET6A 3IYLW 1FVOA 4Z7QB 4KMFA 1QGUB 2CB9A 2ZW9A 3F78A 1X8XA 4OTZA 1XYYA 3BMQA 4HLUA 1AGYA 3ZVLA 2G8NA 4E30A 1O77A 2CLDX 2WM8A 1DMSA 1PL8A 4G7OF 1PYOA 2DA7A 2B1IA 3KWMA 3HUDA 3OM9A 3RJ9A 2XC7A 5TSDA 3LWFA 1FOEB 3H8WA 1AK1A 3IIIA 4XVHA 1CY2A 1T36B 1PL0A 1NLYA 2HI3A 5E3NA 4NIMA 3OYKA 3RAFC 2YWXA 4AW9A 1E3HA 1JG4A 4WXEA 5J4KA 4YY3B 4DXAA 2PYZA 1TUEA 5FLXA 4BVFA 5D5VB 3D6AA 1BCSB 1LDBA 4C2TA 4RMNA 1F14A 1WULS 3C3PA 4I50A 5GVRA 1RZUA 3E82A 1RI7A 1H8ED 1NF8A 1QLJA 5EWLB 5EZ6B 3ZD8A 421PA 1W73A 2ZJBA 1Y37A 1CY0A 2HB6A 3KB6A 4LNHA 3EVTA 5FB3A 1KHHA 1A1SA 4KJXA 4TWAA 4FQGA 1AK2A 2EKBA 3WBFA 3KYLA 1Z06A 1ZGCA 2YZ2A 4I4IA 4Y6LA 1FTGA 1OROA 3OIUA 2BZ0A 2XF8A 4EKGA 5AH0A 4DZTA 3THYB 3CC2I 1M6VB 2YASA 2A9KA 3EA4A 4IRHA 2F43B 1RWKA 3IFSA 2XPVA 1N7HA 1XEWX 3ZJYA 2OTCA 4Y33A 1C2YA 1GNRA 3CUQB 1Q15A 1WXIA 2GB4A 2IDKA 4EJWA 2ACVA 1U8CB 3PV0A 1E1NA 2V4JC 2IS4A 4BCDA 1G20A 2W2LD 2DFTA 2WHYA 2XGOA 3BZKA 1MH4A 2D13A 5I8PA 4EMTA 3OLXA 4V2UA 2I3DA 4HWRA 2Q99A 2WA1A 1G41A 3BTCA 1BQ3A 1JT2A 3M5PA 1VPVA 4HTFA 3KKKA 2AB0A 3RCOA 2O2YA 4YDSA 1N2CA 4C0LA 3HO6A 5DXAA 2DMPA 4EHJA 4JB0A 2LY9A 4M74A 2QZ8A 1SCQA 3HRTA 3E70C 2Z1NA 3A04A 5ALFA 1E3PA 5L7YA 3CF2A 3WHBA 2HMYB 4GMHA 4QLOA 2TMYA 1XG5A 4RCYA 3P4XA 4QXRA 2JKVA 4PGFA 4OQLA 1LSSA 1T8YA 4U6SA 3EISA 2SKDA 5DASA 1FIPA 2HJWA 4G6QA 1GR0A 2X8WA 4CKEB 4R5MA 5ARDA 4OM8A 2FWBA 3ZMZA 1GV0A 3S40A 1IJBA 5F9FA 3P20A 2FQ3A 2Q1XA 2QTFA 4R16A 3JR9A 1R36A 1JA0A 1ZIDA 4KPFC 1PNVA 3NPMA 3EZYA 1E3LA 3BE4A 5BSEA 1WCWA 3AEUA 5BMVB 1Y8CA 1ZGAA 1UIMA 3ANLA 1HT0A 1ZOOA 2HWUA 2JFQA 5CW1A 3ZMTA 3SHOA 3UUFA 1MJAA 3G2BA 2D8AA 4F3TA 2OLEA 1GAXA 1OW3B 3UYKA 1FXWF 1MVOA 4LX8A 4P6VF 2BF7A 4YJGA 2AKAB 5GMOA 1U9IC 1ZICA 1JXSA 2PH7A 3QA9A 4YJ2F 1SKQA 3VPAA 3IRUA 5CM2Z 3OZCA 4D1YA 3DGEC 1A6QA 4KYUA 3IKMB 4GKJB 4LOIA 2QYTA 4M8KA 2CT8A 2PSJA 3K20A 3RFXA 5BWBA 3THOA 1KAGA 2GA1A 1X7HA 1XZPA 2AIRA 3VDRA 2EX0A 5M04A 3CZAA 3QVSA 1SANA 3LYLA 5CH3A 3W3ZB 1XDWA 3UPTA 1KU9A 3HZJA 5D86A 3AWDA 4V24A 2M30A 1XNQB 2AMVA 3NFRA 3E9YA 3V42A 2G5TA 1KI3A 4JKYA 3S2YA 4F1JA 5DT2A 4RFSB 1T1EA 1GCAA 5TXGA 3A7DA 5A6VA 4WK2B 3MJ4A 1CJBA 5HILA 1P8AA 2XB9A 2PZLA 4Q3DA 3I53A 4CYCB 3OX3A 4QPPA 4ITVA 2ZYWX 3F8TA 3OI7A 4R1PA 1HH4A 4ZOBA 1A82A 2GRUA 4G5HA 1FYXA 3LCJA 3BM5A 1I1SA 3LOQA 3NT5A 2VDRB 4JGBA 3V7NA 4BNYA 2ZT6A 5IYDJ 1QDUA 3R5XA 5T8KC 2X0NA 4C4ZA 2V3CC 2E1OA 1XS9A 3O1JC 3TAHA 1T13A 2P6UA 1IWOA 1X70A 2OCAA 2YUTA 1HMYA 3R4KA 5CX1A 2H1FA 4PN7A 4MCAA 3ZH9B 2A5FA 3WGGA 1ZN8A 3GTMJ 1EEHA 4XSZF 2XDQA 5EUMA 2DY1A 3OO1A 2K7LA 4KISA 1YRQA 3WRWA 2VSFA 1HSTA 1N6LA 1U8ZA 1Z3IX 4WN9A 3N1UA 5CDSA 3H1EA 2YJ4A 3HI6A 5DKFA 4NCBA 1QR6A 3K9QO 3T9EA 2DEUA 2DWPA 3VH2A 4J19A 2Z6UA 4E22A 2P3OA 2OV4A 3K1NA 1ODTC 3C5WP 1WD7A 3RVMA 3G7NA 4OLBA 5EEGA 1XNRB 4WN9B 5AD1A 3B85A 1XZHA 1XJWA 3OZBA 4YCBA 3HB9A 2R7UA 4IUYA 5FTKA 3AUUA 3PVSA 2QXYA 1D1SA 2IEAA 1EFPA 2Q6LA 4A15A 4QXQA 1ONBA 3BXZA 4BNDA 2YKGA 4QD3A 13PKA 1S7GA 2F1RA 4DVJA 1C8KA 2DT5A 1Z6PA 2L82A 3JVDA 3VO8A 2W2MA 4UB8C 1TM5E 4X20A 1DC8A 1ZI6A 3SKYA 1KU0A 4UUSB 1ZK0A 3DC7A 4N39A 2YSRA 4LX0A 5LZ4A 2VTBA 3I3OA 4Q1VA 5FIUA 4FQ7A 3RV3A 1Z8DA 4AO8A 3IV5A 3QVKA 3IP3A 3GJSA 4HS4A 4LF9B 1K66A 1P31A 3VSAA 2GIZA 4BGUA 1PKEA 1XZFA 1ILEA 2FPIA 5DNVA 4PCVA 4EHLA 5FWYB 1W7PD 4OBXA 1Z22A 1W0KA 1U65A 1DKPA 5H0IA 5GPBA 2BEKA 3HSEA 3FN4A 4HFJA 4KO3S 1VBNA 3IUMA 4Z0PA 1PD0A 1JKOC 2EARA 3L0DA 1BC5A 1JG2A 1EJ2A 3MUEA 4LCJA 4M1TA 4BFTA 5KTMA 3WSTA 3G71I 4JK3A 2EA2A 5FI1B 2D4AA 3L1JA 2R7ZJ 3B3QA 3S8MA 3C1TA 3CXUA 4LTNA 2XHEA 9LDTA 4B44A 1KXZA 3W5DA 2YJZA 4OOEA 2ZSDA 2F2TA 4HNGA 3EC2A 3GRAA 2V7VA 5J2UA 1MZBA 2NAZA 4NU6A 1JFSA 5BR8B 1BX3A 3K4MA 1ULYA 1U04A 4DR6B 1H9AA 3CWQA 4YRIA 3ESWB 2Z8YA 3DXJF 1KYYA 1JKQC 1E2HA 2H08A 2LRHA 2MSYA 1W581 3ONVA 1BS2A 5IH3A 3TUZC 3LDUA 4RU1A 5MN4A 3JRCA 4O4LA 1JHUA 4FGKA 4LHVA 2VHXA 3BG3A 1KWKA 1QNTA 4WI1A 2P40A 3AV0B 3CCSI 1CUFA 2CGEA 3ZY4A 3PS9A 3RC3A 2HR1A 2K27A 3KCNA 4IGAA 4IINA 3I2HA 1S2MA 4J1SA 5A71A 1RIOH 2AOTB 2LMDA 2C88A 4J1QA 1O0BA 3DU5A 3ES9A 1KI1A 2ODEA 3M6LA 4MW0A 3U4MA 4MVJG 4XOPA 1U3UA 1YL7A 2I6UA 4K6GA 1SXQA 2VBCA 2GM9A 4QICA 4PLGA 1P2DA 4BZPA 1RQLA 1W4MA 2AQEA 3E7XA 1UC5B 1RYMA 3TGNA 2G07A 3QAHA 3GUZA 3ACDA 2H5JA 2P68A 1PG2A 4DLXA 3IEMA 1QVVA 1Z4JA 2JQ7A 2ZIEA 3KD3A 1HNXB 2QR5A 3NBFA 3E9DA 1JFFB 3SLKA 5EIXA 5J1SB 1V26A 3UQYS 2OV7A 1ESEA 4DW8A 4QM6A 1P2GA 4FKMA 2D7CA 1ZP6A 4XICA 2GEVA 2BKEA 3N7UA 3O1HB 1QK5A 3B6EA 3WK7A 3CUQA 4O25A 4IQFA 3VO2A 2QHXA 1QFMA 2DSNA 1JHRA 1HGXA 3LHDA 4I5FA 2JTVA 2VZ0A 3JY6A 2UUZA 3IP4B 2XVZA 4C2AA 521PA 3X0DA 3BR5A 4QA9A 3KHKA 3QVOA 2A9FA 1X74A 3NHMA 2R8OA 3KP5A 4LQ4A 1JUSA 2SHKA 1O95D 1K6YA 3KXIA 2NVWA 1Z7UA 4ZC3A 3BXXA 5JVDB 3N9IA 1SCBA 2GLOA 1Z5WA 5IW8A 1K7FB 3PUZA 1RAEA 4L78A 2IA2A 5C8XA 2XHZA 3KKPA 2YC2C 2XDWA 4PX2A 4F12A 4GMKA 2R6R1 3VYSB 1KEVA 4LMPA 2WP8J 2ZSIA 1DIBA 4FUTA 2OQGA 1DAIA 2E4XA 1E9RA 2WTUA 3OLZA 4FDTA 4WECA 1NVDA 4LRUA 3G9XA 4AKSA 3GOQA 2OHGA 3KQQA 4BZWA 5LIRA 3MZHA 3DJYA 1UXOA 3IXQA 4WX2B 4CF3A 2AOTA 2XTZA 1V45E 1GRRA 3N2GA 3VNSA 4PJNA 2OYSA 3HKBA 4OQ4A 3ZUGA 4BP8A 4C4AA 5KNBD 3C5CA 1VM6A 1J8MF 2BVLA 2WJHA 4RTNA 4U88A 1HYGA 4LYYA 3KLPX 3HKEA 2XJ4A 2ACEA 1DKUA 1JHPA 3QEOA 1YDMA 2WJWA 5BQTA 4HOYA 1U3GA 2VYVD 3HDQA 2CNLA 3VU8A 3WNVA 4RF2A 3GLIB 3KQWA 2W2QA 2XGMA 4PSCA 4F8YA 2C61A 1KH1A 3PNOA 3G0BA 4JX8A 4BFCA 2W2KA 2GHTA 3J7YJ 3SS9X 4EL0A 2Q1TA 2WT9A 4OYLA 8LDHA 1C7FA 1Z2PX 2V1XA 1TCVA 1ZEJA 3GVIA 4GOMD 3REQA 4CMIA 2JG3A 3HVRA 4BNWA 1T4CA 1SMTA 2JA8J 4OWRB 2JCGA 1Y7HA 3AR4A 3C3BA 3FA2A 3R5JA 4ON9A 1GLGA 3TSZA 2W0SA 5A2QK 3EARA 4WOKA 4A3EJ 5KOHB 3IJRA 2CYYA 2GPYA 3IX7A 1K4SA 1NTOA 4Z3DA 4QPOA 1RAGA 3AL0B 2XUDA 3V1YA 1DCFA 4YDQA 3U6BA 4H7KA 1UC8A 5BRNA 2CO5A 3QOYA 4RD0A 5AKYA 2G7MC 4H18A 5EIHA 1YKFA 3DL7A 3VJMA 1NSYA 5CW2A 1O3YA 2E87A 3L7DA 5CYFA 1XO1A 1U9IA 4GGMX 1YZ3A 4IP0A 1Z4NA 2X4DA 2JJ2D 1DCTA 3MN1A 2FMKA 3K5WA 2FEAA 3BJZA 3LY8A 3NALA 4GQIA 1OH7A 2V9ZA 4N03A 4RDXA 2O3UA 5KHLB 3N2NA 2DYKA 3KJGA 5HM8A 1T4BA 4R69A 2VJ5A 2CW8A 1JA1A 1KH3A 1GRVA 3QVVA 5HLTA 4RGRA 4C0JA 4E7OA 3LTNC 3BCBA 4EQ6A 4WQMA 2AFHB 4CRWB 3CUQC 5EJ8A 3U09A 1CBUA 2E1NA 1JZTA 1J06A 1D1TA 1ZOLA 3DGFC 4M53A 4PLYA 3RGWS 5KTPA 3GFRA 5DLQC 3DCNA 2ZBRA 3KFWX 5JLXA 2E21A 3CMYA 2QW1A 2RGGA 3A8TA 1K3UB 4QRDA 4Y2RA 3SC4A 3LD9A 3KFVA 3KIOA 1KJIA 2BRUA 2Q5CA 2J85A 1KP9A 2P7IA 3UB2A 4NECA 4QGFA 2JBAA 4XLHA 2AN1A 3MJDA 3IC7A 2FN4A 1R3DA 4J7UA 3UHJA 2B7LA 4ENVA 3PUXA 3CCMI 2WWTA 4HF0A 3W79A 1F17A 3K4HA 4JH0A 3UC9A 4RAQA 5HKOA 2Q0SA 4UDXX 2C7OA 2G4VA 3BMNB 3JR7A 2VL7A 1XTRA 3LF1A 4BC1A 4F52A 4BN0A 4B7AA 2FSFA 3Q2OA 1R0ZA 1YTUA 3ODPA 4PZPA 4JLWA 1DUSA 2H48A 2Q4RA 4H7DA 4QWWA 1KMNA 4ZI3A 5HHTA 2C4WA 2VJOA 4EUEA 3DEJA 2I2WA 4HLDA 4L27A 3WK5A 3PSAA 5LU9A 5I3ZA 2QUBA 4IF4A 1L7XA 3DQVC 2MINB 1A95A 1CD5A 2XKAA 1JNYA 5KNLA 2W6OA 3DBLA 4R8RA 1MMFB 1UPXA 1WP9A 1UP6A 2P9FA 4UM8B 3DEUA 1QPIA 3DMFA 2CHQA 1M75A 3QNMA 4K9LA 4C3UA 1U5BB 2EERA 2R1ZA 2W24A 4F4DA 3F6PA 3I6QA 1T2FA 4P2GA 1HM5A 1RJFA 1G21A 4UUTA 3TW7A 4ENMA 1SKUA 2GWHA 3DF9A 3DQPA 3IR5A 2LW7A 4O4JA 3R0ZA 4EB0A 1FW8A 5D1HA 4YRPA 1PDNC 3ORQA 1WZ2A 4GNRA 2ZSHB 4R9RA 4O4HB 2GH1A 4UQPA 4G1EB 4HUQB 1YYVA 2LGJA 4AYXA 4C01A 4QVIA 1JRLA 3EA5A 4RK6A 4RM3A 3EUKL 2G0EA 1RRFA 1J33A 2Q46A 2IEIA 4A0ZA 4YFKF 1NG7A 1JPJA 4CCLA 1QFZA 2HU2A 2OQIA 3KBOA 3QW2A 1R8SA 3UAYA 4F3RA 5CD1A 4Q4LA 1FC3A 3WNZA 1GL9B 5JD4A 2IOQA 3GJXC 4BNIA 1NKVA 1JFVA 2R9VA 1NNSA 1XGSA 4LSWA 2AC4A 4P5PA 2QT0A 4EJMA 1PK8A 6REQB 3I76A 4NI5A 1D6MA 2O3FA 2V45A 1C7QA 4LJAA 1TK3A 4URFA 5F1PA 2BHTA 4W7SA 3ZG6A 3BJOA 1SM4A 1XD9A 5CYGA 1FJLA 2I9PA 3TQHA 3OL3A 1TC1A 1V4RA 4CLHA 2RHBA 2XDVA 4CL8A 1BVHA 2DFFA 2D62A 4PZLA 1V7CA 2A6HF 3MBOA 3K6JA 2JH8A 3GEMA 3ZCVA 1N34B 1GLVA 1VL6A 5TPWA 1RQ7A 3MCWA 1JQ5A 3GFJA 2R1VB 4Q7JB 1MORA 4JJZA 3BB4A 5K3FB 4E6PA 3KELA 4MAAA 2HYJA 1IRIA 5DI9A 1MQ8B 1U6GA 5EF6A 2Z3WA 3ESYA 4QYWA 3TDNA 1U0BB 1OZ0A 3PJFA 4IZIA 4MV8A 2YUSA 4M2LA 2EINH 4FD3A 3OKCA 2ZIGA 4MI1A 4AN4A 3VJRA 2ZBPA 3ZDBA 1W0CA 2RSLA 2B9SA 3TZHA 3ANNA 3F9RA 3VPFA 4RS3A 3X1DA 1AKNA 3OV8A 1JN0A 1LPSA 1ZN9A 3TJZA 1SD5A 2VDQB 5CG1A 4RPGA 3SIXA 3OYNA 1OA0A 3ABQB 4GECA 3BT9A 3L1HA 4JT8A 4Y7CA 4ZD6A 5KSYA 2VCEA 3RG8A 3LVRE 4WCFA 4ECEA 2JH9A 4X24A 2KMUA 2WI8A 3B8EA 1M1XB 4OGFA 3CRZA 4U5QA 2VUMJ 1GG9A 1VMKA 1P7JA 2PWPA 2Z5LA 2XODA 2O8FB 4ANJA 1G8AA 2XPWA 1BN7A 4U2DA 4M6YA 4DF3A 2J46A 2H1OA 1BKYA 4K9SA 4HI0E 1DEOA 1SULA 1O9HA 2C9CA 1X3ZB 1L5RA 1UODA 2WWVD 4O0MA 5TEWA 4C0HA 1SCUB 2FE4A 3DO5A 3ETNA 4OXQA 2ZPAA 4QX6A 4ZYUA 1QTRA 4FNAA 4UTZA 1XNJA 2X8BA 4HQEA 1V5GA 1H66A 2QP9X 2C98A 4L5JA 3ABOB 3FZYA 4E7SA 1NW5A 4JDPA 3BG5A 4KPYA 4S24A 3T5TA 1VCOA 2BHLA 2BH9A 4MUFA 5FTNA 1ORKA 1TVKB 1U2EA 4CGZA 2HU7A 3ELUA 3MCUA 1ND6A 1IU9A 3NWEA 4LMRA 1GL3A 1JT9A 4KYTA 2BD0A 5I7EA 3BCAA 1KBQA 1O4WA 4MTCA 5JAUA 5EINA 3KP3A 4XYMA 4IJ6A 1H85A 1NOIA 1Y1QA 4JKIA 2ZZNA 3THYA 1OBOA 3CRW1 1M0EA 1A9TA 2V6MA 1DFHA 3ZWBA 2VRCD 4EF5A 4UUQA 2OQVA 5HUHA 2JA5J 4HPXB 1L3CA 1X7XB 4HSEA 1QWOA 3IUQA 3P32A 2HZBA 2WWXA 3A1WA 4OJMX 1G20B 4QUKA 2N1MA 5EVCA 3Q8KA 2MG4A 1TUBA 3L79A 4FI3C 4Y0VA 1D2GA 1ZY2A 2FZWA 5HCIA 1RQNA 3U0VA 1E4EA 1YR2A 4MUBA 3KOWA 4X90A 4W1QA 1HKHA 1ZH2A 1SVLA 1N0IA 3D3WB 2AVDA 2ZUWA 5IZCC 2WPDD 2BDEA 3JYOA 3SX0A 3D3NA 4TYMA 4PRYA 3IUPA 1Z47A 3C3KA 1R4NB 4BN4A 1OFUA 1YE8A 3KTOA 4X1OA 4YAOA 4EHFA 2XUPA 2YMLA 3IDAA 2C7GA 4B75A 2QMZA 1RFLA 3O2PE 3FMRA 2COMA 5E2IA 3NC1C 3O8QA 4I9FA 5FQOA 4NE7A 3DEIA 2X0LA 4AKTA 5DM7F 4ARAA 1MO2A 4U0JA 5LPNA 1JDSA 4W5NA 3INRA 4HF2A 4F91B 2IA1A 1LE8B 1BCSA 5T41A 2XQFA 4WK6A 3M3PA 1DT5A 4AMGA 4M1ZA 1DC4A 1IEVA 3LUFA 4PS0A 5EFOA 3WL4A 5BV2P 4JX5A 3OSGA 2ON6A 4WSOA 1VBFA 1J23A 3NBXX 3MEXA 5FPQA 5ES4B 2NP6A 1JTEA 4IV5A 4LDQA 4WVLA 3WYAA 4UVIA 4B3MB 3C3DA 1A4RA 2H2GA 5J8FA 3NIDB 1Y63A 1RR6A 2JAUA 2OBFA 1X38A 4UDYX 2M7AA 1Z6YA 3D7MA 1II8A 2F3PA 2Z5GA 2I4OA 3GZTB 3TLCA 2W6JA 1RLTA 2PMHA 5AJUA 4LNAA 1R5HA 3Q12A 3GEDA 1P4AA 1H3EA 3VKHA 1X1QA 3DYVA 5JPDA 5CFRA 1SB9A 3BCRA 1JG7A 2I7TA 1NNLA 3ADPA 5K4HA 1M7HA 3CDIA 4UU1A 3TOXA 1O57A 3I37X 3Q9SA 1O6FA 5CJ2A 2EYQA 1KQNA 5BUSA 5LN1A 1Z05A 3I6ZA 3K6KA 1YRNB 1V3VA 3W05A 3JWPA 1NYRA 5C4GB 1MABA 1T8RA 4MRMA 4QOGA 1VPEA 2I62A 4INOA 1DP4A 1P9RA 4UMDA 1UK7A 4L9JA 4MW7A 4QJBA 1GU7A 3EDMA 3JQ8B 2HTSA 4XR9A 3A7EA 3A11A 1XSXA 1NXQA 2ETVA 1ND5A 1EAMA 2WYWA 1N8KA 3CSUA 3EEOA 2A86A 4FSHA 2XF2A 4JROA 5ETJA 2GQ0A 3GNLA 1EFHA 5M3MJ 3L46A 1F4PA 4XQEA 2Y1EA 2W70A 2GDZA 5TF4A 3ZTWA 4M54A 5AUOB 5H5JA 3R7LA 3WQBA 2PYDA 1K8YB 3HXKA 1N4DA 3INYA 1P9WA 1BD3A 4LRSB 5LZ2A 8ABPA 4Z49A 2HVSA 1SHJA 1E0KA 3G68A 4GM1A 1U5CA 2IY9A 1AD2A 3JRDA 1CY1A 2DE0X 5BSMA 2XXJA 1IULA 2PVCA 1J0XO 2NO5A 2WDPA 3DD5A 4BLUA 2PKWA 4PLVA 1QNFA 1MNDA 1ES9A 1D3AA 2GVDC 2JIOA 4P7BA 2CVHA 2WYIA 5L51A 2C2GA 2M6RA 1AMUA 2D0PB 1TD9A 2ZUBA 3LY7A 1VIDA 3Q3CA 4WLUA 1JU9A 2E60A 4HNSA 4MB2A 4X1YA 2GOXB 3CO7C 1QYXA 1R2QA 2QKLB 1RLOA 4CHUA 1B8OA 1F51E 1Q5PA 1NBMA 1YNSA 1YS1X 2ETXA 4CKCA 3I2YX 4RMJA 4YGYA 2G80A 4KAXA 2N9UA 2H2FA 2F9LA 3WGTA 1FEXA 3I5AA 3SDSA 2WNIA 2F4NA 3BWGA 1ZM9A 3KCQA 5AJTA 1IRXA 3RB8A 2HL6A 4EHIA 4KYIB 4N8DA 1UZCA 1C4OA 3DF8A 1K63A 4O0LA 3W8FA 1C9KA 2C77A 1UXHA 3D8TA 1ORRA 3F5FA 4QELA 4RHEA 1Q84A 4RY8A 4OYHA 2Q8PA 5FV4A 3WG7H 2Z58A 4G63A 3TBFA 4B48A 1IPFA 2C5LA 5KTNA 1JBKA 5JJLA 3V8LA 1KJQA 2OWEA 3EPJA 1ODSA 3ML6A 3KRTA 1FSGA 1UXGA 3P9ZA 3VU3A 5DV5A 4CQLB 3V8JA 3BE6A 4H7JA 3V8EA 5KYXA 4Q4ZF 5FROA 1PWXA 3UK6A 1Z25A 1E20A 1XHFA 2PYIA 3ZHBA 1F20A 2ERYA 3N87A 3PL5A 1W0KD 2AQKA 2NQ2C 3QHPA 4MMYB 4LRTB 3SJCA 2OCYC 4H9GA 3CLVA 3CT4A 4RHTA 3TL2A 1BRTA 1WKBA 2H18A 1ORWA 3TQIA 3VZQA 3IQEA 1PK9A 3RWOA 3F6BX 4JEUA 4UAUA 4J0CA 1M0TA 1FDOA 1VIYA 2BFPA 3MSCA 2M87A 4IUCS 3TZLA 3V2UA 2QYOA 2RAPA 2SCUB 1OT5A 3KVVA 3CLOA 2HOTA 3I1FA 3CCJI 2ENWA 2WZCA 4U8HA 4X3CA 1J2TA 1G63A 3HU1A 5DNCA 3AVTA 4R2LA 2XGSA 5BN1A 1RYNA 3IQZA 5BN3B 3A28A 3EGVA 4WY2A 2VKDA 5DBEX 3TZKA 4C0SA 5IEJA 2ISYA 3E2IA 1XN7A 1G2OA 1DGRM 2XOKA 3JQDA 1Y4DE 1H88C 3NDJA 4HMQA 3UFBA 3VWBA 5BXQC 1ZCAA 1Z7GA 1IXYA 3LYUA 1IG3A 4DUPA 1MQAA 3MERA 2BM0A 5EG5A 4BKQA 2KM1A 3PE4A 3FCCA 3QPVA 1ORDA 4CLOA 5ALIA 5DM4A 2R7SA 1NQUA 4ENSA 3AR5A 3QKSB 4ZVVA 5F0HA 4PINA 1H65A 1DQPA 4JELA 5DP2A 3SNKA 3WE7A 3JVVA 1OCPA 1E1KA 1N0VC 4H1VA 4TRNA 3RLIA 4MUKA 5M5WJ 2H7CA 4LJ8A 1CR1A 4W9MC 2HO4A 1XRPA 2VP2A 4LVCA 3MFKA 2OAZA 4XWWA 4P2BA 4YT4A 3MMZA 1P9LA 1NW8A 3C4JA 5H16A 5BN4B 4D3ZA 4WJLA 1VMIA 3BHJA 3FBTA 1CE8A 1I0ZA 3EZNA 3T5MA 4N8EA 3GVXA 4U7PB 2IRFG 1XLUA 2ZYSA 2H9YA 4G9BA 5DI3A 2XBMA 4KYWA 1G3RA 2DP4E 3EQZA 3JVUA 5DYTA 5CFPA 3ST7A 1ACLA 3NEJA 4D45A 3H4TA 3AI1A 5EPEA 3SSAA 1JLRA 2V4UA 5IDQA 2PGDA 4X9XA 1X6VA 1PUFA 2DTEA 5FORA 2GCIA 3HGTA 1BAPA 1E3QA 1I4OA 1W4CA 3M3YJ 2QTHA 3D5TA 3QYFA 2BXYA 5C3MA 3IP7A 1ETHA 5CXXA 1OLSA 3PKZA 4NAHA 5A03A 5KZMB 1XROA 2YL2A 3MF4A 1SNYA 2ZDHA 4MQFA 5FPTA 4EIWA 5HGJA 1ZRSA 3U4IA 3EY4A 3DT6A 5JAIA 4ARCA 2FEWB 4Z4EA 4KSBA 3LKVA 4QE3A 4GC9A 1UZLA 1ATIA 2J5KA 4RYLA 2R84A 2AR0A 1GJRA 4DLVA 3A1YA 1E96A 2PBFA 1SXJC 4RXUA 1T5LA 3I5XA 1YQ9A 4KH1A 1CF4A 5JAOA 1NHAA 1TQDA 1K5GA 9GPBA 2C7PA 4OATA 5HRAA 4IEIA 4NNPA 1VRWA 4C7BA 1V11A 3AUXA 1UJNA 3A4LA 3I1IA 1LC3A 4JBYA 4JNKA 2FMIA 3ZNPA 3ASUA 4EG6A 1WHSA 4Q7LA 3KXLA 1GL6A 2JGFA 4N9WA 4IMJB 5FF9A 3O94A 3RS4A 1HDZA 2X7JA 1ID1A 2IYTA 3D8UA 1C1DB 3G2MA 1X1SA 3N0TA 4LWQA 4D6YA 1TKRA 1RBQA 5K4AA 2NU9B 3WE2A 4FZRA 2GM3A 5H7XA 4MA5A 1Q1EA 1ZI9A 4O8CA 5EHIA 2G6BA 1DADA 4M7RA 2GN4A 1NVTA 3NXSA 3RYTC 5FT9A 2DA1A 1D6NA 3S5UA 4ESVA 4V0OA 3VOBA 3VYWA 1THGA 1UPUA 2Q3DA 3K8ZA 2XV1A 3HU5A 3GUDA 1VA5A 3ZBPA 2JLWA 5JDCC 4KNVA 2ZB9A 1SQFA 2CNNA 2QTNA 1D4AA 3CTPA 3FDYA 1WVIA 3EEYA 3NWBA 1PJQA 2PGJA 1L7OA 3DEAA 2H0AA 4QTYA 1OPXA 5EKSA 1UBLS 2VNHA 3NBQA 3VAAA 3RKQA 1JAZA 3NHLA 2KZGA 1E9BA 1YL6A 1SR8A 2H4FA 3OP1A 1E7RA 2VXYA 4QQNA 3CZMA 3C1UA 1UADA 1X1BA 2CVPA 2PL5A 5ESXA 4US2R 3KJNA 3F23A 2NTYC 4KQIA 4XWTA 4XN0A 5ED0A 2ZPUA 2FMYA 4L9SA 2OBNA 2W6JD 1G5RA 1PX0A 1X7ZA 4KMUX 1FE8A 5ELLA 4B3DA 4C14A 3OPYI 4YIHA 1JDVA 1MEEA 3LXXA 6LDHA 4ERNA 4TXHA 4Q3CA 1YVUA 5K3CA 5E6SB 2WG1A 5D5XB 3SJUA 3H2GA 3OZXA 2EIMH 4L76A 4L6IA 4CM1A 3LX8A 1YR8A 2PZAA 4Y0AA 2QAGC 3I04M 4UVDA 1XN1A 7YASA 2OFFA 1A9OA 4G9YA 2OMKA 1S9HA 3TDUC 1SU8A 1MX1A 2JMWA 3QVJA 4E3WA 1WB9A 4RGVA 1F36A 3SLGA 1TYAE 4A2UA 2UVQA 3ICEA 3JALB 3IOYA 4HBGA 4U7WA 3DPLC 4XLFA 3CPSA 1NQTA 5CR9A 3DFUA 1RPZA 1ENOA 2BPOA 5EPOA 2FZ4A 1FJHA 2VOOA 3AFNA 1APLC 4RKRA 5ILQA 4MS3A 4PO1A 3HNOA 3N07A 5FLKA 5I9NA 3KQHA 3DTVD 3JYQA 3L2QA 4IDEA 1W5AA 5EQFA 4F85A 3V8MA 1LBIA 1OWMA 1UB9A 5JEEA 2XOEA 4UHCA 5DOVA 1IM8A 1UQTA 3AU8A 4HV5A 3I4CA 3P2YA 4KX5A 1EFVA 2FG5A 1LFBA 2G82A 3PYXA 4OXNA 3K2EA 3G2QA 2XIGA 3K8QA 4TS1A 2VODA 4BUJA 4GYWA 1O08A 2J5QA 1IZ9A 1AHPA 2D6FA 4FFOA 4Q05A 2COEA 2DJ5A 3G5MA 3QTLA 3TW0A 3ZZTA 3IH2A 4EA7A 2YC4C 3RW9A 1K98A 2QN8A 2B5OA 2PX4A 3P5BA 4AMUA 1NBAA 3D9QX 4B9AA 1Y39A 2ZT5A 1OBCA 1ESZA 1SVWA 3H3ZA 1F2TB 4L9WA 5ALKA 2DKFA 4JITA 4AM8A 3K0CA 4DM7A 3CCCA 3ZGVA 4JYZA 2O2XA 3LFUA 1JALA 2QPLA 2QUAA 3KJEA 5H02A 4IIJF 1PNTA 5JR3A 1LDYA 5H59A 4N9HA 2P0YA 5ITVA 3AT1A 5JS8A 4X1KA 1OI2A 3ZXSA 1C7ZA 2V97A 4CCYB 5IP6A 1VDZA 4A1FA 1O94A 4WWHA 1WLYA 4CMIB 5JI3E 2GZHA 3IWZA 3SP1A 4JNCA 4WK4B 2O8XA 1WMSA 3FROA 4FCWA 1MQ9A 1EWKA 2R48A 4M60A 3RIEA 4FFDA 4MV4A 1RKVA 4OQXA 5IT4A 1FYKA 4DA4A 4CEJB 1FUKA 3VR2D 3MINA 1R23A 2JRCA 1NJ8A 4L7QA 2XAHA 3BWCA