3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
b'MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
1RM0A 3OH8A 1F12A 1FXSA 1V35A 4RO0A 1A71A 3SLGA 1SC6A 4XYGA 5I8ZA 1T2FA 3OQ6A 2D0IA 2PKQO 2OOSA 4RORA 3LT0A 4Z3DA 4NPCA 2AMFA 5T57A 1A9YA 5IZ4A 1DFHA 1ZSVA 1NTOA 3I9NA 3ASVA 4ALLA 2CF6A 2R2GA 1NYTA 2VN8A 3O4RA 4J2HA 5T6BA 5TT0A 2C7GA 1SB8A 2WYWA 2G1UA 1FDSA 2POQX 3FSRA 4B4OA 1GY8A 3ADOA 4GSKA 9LDBA 5JO9A 2OL4A 2W4QA 4LN1A 4EEXA 1U8XX 1QV6A 2O3QA 3TSCA 3GQVA 3BMCB 3V1UA 4IMRA 5A03A 2AQKA 4J2OA 4OXKA 2PY6A 4BGVA 4WGGA 1N92A 1NPDA 4CMBA 4IQ0A 2JD2A 5JDIC 3GMSA 3ETEA 2PKQP 2Y1CA 3LQFA 1N5DA 4JJFA 3SXPA 2IEBA 2DKNA 1WDLA 3P2YA 3R3SA 4MIOA 2X0JA 4YT5A 4QO7A 2I3AA 4GWGA 3GUCA 1KEWA 1LXCA 2O4UX 4GI2A 2I99A 4D3FA 1NPTO 1IE3A 4GAEA 4DPKA 1HL3A 3LLVA 2XOXA 2YJZA 1BVRA 3KB6A 1C3VA 1D3AA 2DPHA 2VTDA 1T26A 4M86A 1E7RA 1ID1A 2DTXA 4DIOA 1LRJA 2EIHA 1PJBA 3JYLA 1CQIA 2HMUA 2P9GA 2AQ8A 1ZK1A 3JQGB 3S8MA 4JX8A 3QVXA 4TRMA 2CFCA 3KUXA 1Q0QA 3RWBA 2QIOA 3AOEA 5IN4A 3WNVA 3OFSA 3QWIA 5TGDA 1R4NA 4P4GA 4CMIB 2D59A 3ZWPA 1N7HA 4NH4A 4AFNA 2FWMX 4IMPA 2DVMA 1NWCA 5AXCA 3DO5A 1QSGA 3D4NA 2YV3A 3BMOA 1D1SA 2FOIA 5A5EA 1HZJA 3DMYA 2P68A 1UZMA 1PR9A 4PLTA 2YDYA 1XR3A 2EJWA 1UUFA 3GEDA 5DF1A 3RVDA 3ZWAA 3AWDA 1GPDG 5ITVA 1JA9A 4YJHA 2HRZA 1ML3A 4UVEA 3UCXA 3HDYA 1ZSNA 3U4HA 3EZLA 3Q0EA 3JQBC 5I7EA 1LQTA 1WAMA 2H63A 3SJ7A 3WQQA 4FIZA 1XDWA 2CMDA 3RC2A 1Y8QA 3JQ7A 3RFXA 1EVZA 4FJ0A 1PL7A 5K6AC 1EK6A 3DAGA 3FCOA 3Q3CA 3OECA 2C0CA 1DIGA 1LUAA 1VL8A 3S2FA 2UUOA 4W7IA 1C0PA 1NAHA 1Z7EA 3EYWA 3H7AA 3C3XA 1KERA 1PL8A 4HNGA 3ZU2A 3K8ZA 3VVCA 1YJ8A 4I9NA 1DC6A 3AUTA 3GVPA 2O3SA 4U6QA 2X0NA 4ZQGA 4BNFA 1NHWA 2WMDA 7ADHA 2PR2A 3PLNA 5HRUA 1YRLA 3DTYA 4GLLA 1YBMA 3VZSA 2YFQA 3I9JA 1JQBA 2X22A 1I33A 4JROA 2NU8A 5F3RA 1QYCA 2VUUA 3M1AA 3RJ9A 2NSDA 4ND3A 4NK4A 3H5NA 2G82A 1Y5MA 1Y8RA 1XU7A 5FEUA 4PRLA 3GK3A 3I9KA 4WLFA 3GNQA 2P4QA 4Q3DA 4DMMA 4PG5A 3OJLA 3LZ6A 3C1AA 3ICCA 5H83A 4CR6A 1Q7CA 2ZB3A 1H6DA 3RC1A 3H5RA 3JD4A 4QTZA 2AEFA 1N7GA 2VQ3A 4PG4A 4CMGA 3C7DB 3PQDA 1PZEA 3TFOA 4OQYA 4ZICA 4YXFA 5KJEA 5LDHA 1TXGA 3E9QA 5ILOA 2H1SA 4BO4A 4P38A 4XDYA 2C20A 2PGDA 3E5MA 3GY0A 3QRWA 5FI3A 2ZYGA 2V65A 1QLHA 2I66A 1ZK3A 2Y05A 4DWVA 4CV0A 5DCUA 4J6FA 4PLWA 3WS7A 5KIAA 3C24A 3DDNA 4Q3BA 3A4VA 5TQVA 3Q2IA 1O89A 3U4DA 3AK4A 1H6BA 4DXHA 3DZKA 3OIDA 4RPLA 1DDOA 4WEQA 1Q0HA 5H81A 1A27A 1TI7A 1ZK4A 2AHRA 2GNAA 4DQXA 5I7FA 3G1UA 5C7IO 3DZFA 2PD3A 4AJ2A 1PEDA 1GUYA 3ENNA 4IDAA 1UZLA 1UXKA 5IXSA 4J0FA 4F46A 2BI7A 1TEHA 2LDXA 3MJVA 4N7RA 3VZQA 5JAIA 4PZEA 2X58A 4PN3A 1DC5A 3AW9A 1UP6A 3KEQA 3ZWCA 5DN9A 4D3SA 1HXHA 3T7EA 1OBFO 2GN6A 1C1XA 3DAPA 4WUVA 5JCXA 1ISMA 1X0VA 3QV1A 4J91A 3N7UA 3WBBA 4F3YA 5C7OO 4TVBA 1T2EA 1OFGA 1R4NB 4KUEA 4BL5A 1JW9B 3W8DA 3DOCA 3PYLA 1I8TA 1UDBA 2O48X 2JFGA 2OORA 3BMOB 4Q3NA 1V0JA 4WLVA 4E2WA 1JU9A 4NG5A 2O2YA 3OM9A 1DOHA 1R4MB 2BI8A 3D3WB 5L51A 3DONA 3AU8A 1DFIA 3WQSB 1I2ZA 2X8LA 4NIMA 5DOVA 1MC4A 5A9TA 1J5PA 4E33A 4W7HA 2DPGA 4KMSA 1MGOA 5TX7A 1YS4A 4JNKA 1UXHA 3CSDA 2R00C 5ICMA 5KJCA 4D41A 2IRWA 3KOUA 2J3IA 2A94A 1HF3A 4E6PA 2V6MA 2ZB7A 4BQPA 1YOVB 1U7TA 4YAKA 2P9EA 1D1TA 4HKTA 3RI3A 4LGVA 5JAMA 3D1LA 1WMBA 3K2BA 1JVSA 1KVRA 2A4KA 5F5LA 2H6EA 2Z1NA 1O5IA 4TQGA 1I36A 1DO8A 3ZCXA 4GH5A 1P0CA 4R9RA 3QY9A 4LW8A 1B7GO 5FWNA 1AE1A 1E7SA 4BNTA 3WBFA 1I2BA 1CEQA 5KKAA 2GZ3A 4CM9A 4R69A 4BO7A 5GZ1A 2YZ7A 3OJOA 3AI1A 4BNGA 3ZU5A 4CL3A 1A7AA 3EGOA 3M2PA 5AQ1A 4FR5A 2FR1A 3DXFA 2PGJA 1XEAA 5DNAA 1XSEA 3M6IA 1KOLA 4NR0A 4R1UA 4E5PA 1FF9A 3DFZA 4HUJA 2BH9A 4AG3A 4A0SA 3C1TA 4R5MA 1PGOA 1O6ZA 5A05A 3O8QB 3PVZA 3K5PA 3TRIA 1SAYA 4A2CA 2EXXA 4MKZA 3RKRA 2HMTA 2PFGA 4CR8A 5F1PA 4GWKA 4ND1A 1DHTA 3VH3A 3WWYA 5IAAA 3JQFA 2WD7B 2JD0A 3PWSA 3RFTA 4CM9D 4DYVA 2P2SA 1J4AA 2NTNA 2FZWA 4NJMB 3S2EA 3S1LA 2GF2A 3RJ5A 3ZNPA 1V3TA 5KNLA 3L9WA 1PGJA 1V3VA 4OGWA 4YJGA 4JP2A 4RLSA 3RC9A 3ADPA 4I8XA 1QRRA 4F6LA 2HMSA 4KP7A 4D42A 4DGSA 1ZSYA 1O8CA 3VAZA 4AJKA 1KY4A 2O3TA 4LSMA 4C4OA 1JDJA 2B4TO 2BFOA 1CDOA 3LF2A 4ND4A 2CD9A 2VUTA 5IDWA 2Q1TA 5HBRA 4OJNA 4YTEA 4G65A 1YDEA 5IJZA 4K6FA 1AGNA 3TN7A 2Y68A 4Z6KA 1HDXA 2PV7A 2OO5A 4OIMA 5ADHA 1F8FA 2EP7A 4W99A 4BV9A 3WIDA 5B4TA 4P8RA 2Y66A 5U1PA 2IE0A 3NGXA 3TZCA 4JLWA 4RVUA 3U49A 1V3UA 1EFLA 2Q2QA 4EDFA 4J16A 1NM5A 4PG8A 1J6UA 3E9MA 3ZDFA 2PTGA 1Y1PA 2UDPA 3WJ7A 2FHSA 1CETA 3A1NA 5CDGA 4J4HA 3DHNA 3U4IA 4LVUA 3NDJA 4U7WA 1PJ4A 3WSWA 4BNMA 4FOOA 5AYVA 1T2CA 3BZUA 4AJ1A 1ZO8A 4OOFA 2QRKA 5CAEA 4L76A 3W4JA 3ENKA 3JYPA 3C7AA 5ICSA 2A9FA 1OI7A 2BMAA 4YRDA 4PLVA 1P1KA 4CLRA 3DZGA 3TOXA 4B7UA 5EINA 4RPKA 1CERA 2I3GA 4GQAA 4AJLA 4BO0A 4DBZA 1NX6A 1ZW1A 1IL0A 1P77A 4XR4A 1EK5A 3HNPA 1I32A 1HLDA 4UVHA 3RBZA 2E4AA 1C1DB 3WGQA 5JMPA 2IZ0A 4XWYA 4LCEA 3STHA 4J1QA 3ULKA 2QZZA 1HE3A 2IEDA 1X0XA 3AI3A 1CJCA 3DAFA 4UVGA 1LDMA 4JBGA 5DDIP 2NU6A 1GL3A 3AM3A 1O0SA 3FNHA 3QVWA 2J5QA 1GD1O 4E5KA 4M49A 4WKGA 4CUZA 4XYMA 3DMTC 2CVQA 1DAOA 1JWBB 2I5PO 5JAZA 4UUPA 2J5KA 2I9PA 2Q46A 4M1QA 4FBGA 4RDIA 3H3JA 4BKUA 4N18A 3ANMA 4DBVO 4E13A 3PHLA 2FRDA 4JP3A 3UOGA 3RBXA 3VC7A 3OEWA 2EF1A 2BFMA 3GEGA 4Q9NA 5B4UA 2C5AA 3GVHA 2FPPA 3IP3A 3KSZO 1H94A 2XF8A 2BRUA 4DPMA 4JCOA 2Y1OA 4B8WA 4NBRA 4B4WA 4NFSA 1H0KA 3T7CA 4XYLA 2G5CA 2E6UX 1C14A 1IY8A 3U5TA 1R0SA 3WJAA 3IC5A 1NFFA 4J90A 5JAQA 3ZWMA 3CUKA 3R6DA 3DWFA 4YJGB 2GD1O 3ZNQA 3F4BA 2VHVA 4R1SA 1N2SA 3JQFC 1QV7A 1YWGO 4KDFA 3V5NA 5KTKA 3E18A 4N54A 1NFRA 2O50A 3C7CB 1P1JA 1PJTA 4IZIA 1E6EA 1YB4A 6LDHA 1R15A 3UCEA 1CF2O 1RJWA 2HMVA 9LDTA 3L4BA 4NHEA 2NU7A 3AFMA 1WVGA 3LK7A 3HQ4O 4XYEA 3P7MA 2I6TA 2HAEA 3Q9UA 4LSWA 4D44A 3PIDA 1LLDA 1LRKA 2JHFA 2VYVD 4AVYA 5EQFA 4ALKA 4CLHA 4XB1A 1P1HA 3OBBA 3LDHA 3LU1A 1B26A 4J4TA 1BDMA 1WW8A 3IP1A 4KOAA 2GN9A 3DBLA 1BW9B 4XKJA 3H8VA 2R6JA 5JDIA 1H5QA 2X9GA 5L3ZA 1I3LA 4R1NA 3RC7A 3DHYA 3OJ0A 3RUFA 2HO5A 3JCZA 4GL4A 2GN8A 4RF2A 3HWRA 3ON5A 1LJ8A 3R3JA 4XJTA 3I1JA 3HADA 4HFJA 4ZHSA 4EI2A 3F3SA 1ZEMA 3V8BA 3WMWA 2SCUA 4ZD6A 3CZRA 1H6CA 5DT9A 1TA4A 5G0TA 2FR8A 3DZHA 2VZ8A 3PZBA 3DB2A 3NJ8A 5TS3A 3ZI0A 2RH8A 3MWEB 1TB4A 1GR0A 3GT0A 3GGGA 4R1TA 1A7KA 2DC1A 4NBTA 1GZ6A 4EYEA 1M2WA 2LDBA 3QWAA 4LVCA 1QR6A 3HHPA 4PLZA 2B0JA 2I65A 2ZTLA 1WZIA 4ROSA 1XU9A 1E7MA 5U4QA 5JC1A 1LNQA 1UXIA 3WXBA 2X86A 3P2OA 1ONOA 3O9ZA 2JHGA 2HSDA 2EGHA 3WNQA 4IS2A 4R9SA 3IUSA 4BO9A 4CQMB 2XAAA 1I01A 1ADBA 3GPDG 2Q1WA 1L1FA 4KUHA 4WK6A 1T1SA 4WCDA 3WMXA 2P4HX 4J7XA 4RV9A 4PIVA 4CMIA 4IGFA 1DLIA 3EZYA 4J43A 1T2AA 5FF9A 1WDMA 3I6IA 3RFVA 2PA3A 4E30A 1YL7A 1X1EA 3ZHBA 1SEVA 3VPSA 4Y98A 1FDTA 1KS9A 4J7CA 4BNZA 4JBIA 2JFHA 1K6XA 2O3JA 4FS3A 1D7OA 4E3ZA 2TMGA 1KVUA 3KTDA 5IN5A 2PZMA 5BT9A 3TOZA 3V2GA 4CMEC 2NTVA 3D4OA 2VNSA 2ZTMA 4IDCA 1E1KA 2RHRA 2Q50A 4EZBA 3H2ZA 3BA1A 4NFHA 5KVQA 5COAA 1E1MA 1R0LA 1IHYA 1Y81A 3PRJA 4RPJA 2Y67A 2NV6A 3NJ4A 4EITA 2D5CA 5AXAA 1DC3A 2ZTVA 3GDOA 3VZPA 4WEOA 5L7WA 4CM4A 2PZJA 4JQCA 4UVDA 5TNXA 4W9NA 3ZWVA 1QYVA 4CV3A 4YRBA 5L40A 1SPXA 4EJMA 4ESOA 5ES3A 4RGBA 2GN4A 3X2FA 3DZIA 3WR5A 1GCOA 3UUWA 3FTPA 3LSYA 4J1SA 1LRLA 1IPFA 4JGBA 4Y6SA 1GYQA 5G0VA 4YQZA 5B12A 3ZV4A 5BSGA 3OJEA 2O3RA 1I24A 5F1KA 3VH1A 2Y1FA 2WYVA 4B8ZA 3CMMA 2X0RA 4GGOA 1A5ZA 2P5UA 1ZIDA 2OHXA 5FI5A 2QG4A 4O6VA 1NR7A 1T24A 4GLOA 4YBZA 3NTRA 4YQYA 2F1KA 1B8UA 3DBLB 4TMFA 3KV3O 1DC4A 2GO1A 3L4BC 4YJFB 3W8EA 2DBZA 4AJOA 1W73A 3ZWWA 3WDSA 1Y9AA 2PNFA 4ND5A 3AU9A 1OC4A 5T8KA 4MINA 5I7VA 4YVFA 2I67A 2C59A 1TT7A 3SVTA 2NVBA 3RU7A 3QSGA 1Z82A 2RIRA 2C54A 4CMKA 1XGKA 2WM3A 4FC6A 3RASA 2O2SA 4XGIA 4MO2A 4URFA 5CEFA 5C3MA 3C85A 3ITDA 3T4XA 2GYYA 3W1VA 3BMNA 5G4KB 1ISIA 1FJHA 2QQ5A 4PRKA 5T64A 2WEKA 4XA8A 1F8GA 3GRKA 3OQBA 2C29D 4UREA 1Y5RA 2X4GA 4ZVVA 1ZXBA 3DOOA 1LLQA 3HN2A 1UP7A 3EVNA 3UGKA 2NADA 3DBRA 4CM8A 2B4QA 1ZEJA 4UUOA 2NU9A 4R51A 5JY6A 4IDDA 4RL6A 1I3MA 1J49A 4ZRMA 5JXWA 3CH6A 4L74A 5L9AA 2X9NA 4DRYA 2PGLA 2X23A 2OP0A 1U1IA 2Y1DA 4TZTA 2QZ9A 3K31A 4MDHA 1ONNA 3D5QA 2DLDA 1M76A 3MJSA 3OQ1A 3OEYA 4AJHA 1E0DA 3FI9A 3T4EA 2B35A 4MVJG 3FBGA 1BDBA 4IDGA 1SNYA 2W2KA 4YT8A 2WTBA 4IJVA 5JSFA 3MJTA 5A1TA 1NQOA 4L4RA 2GZ1A 2R00A 5C5IA 1B3BA 4MIYA 4BB6A 4DPLA 3QIVA 4N5NA 3NGLA 3F5SA 3GPIA 1H2HA 2VWQA 5K9ZA 1Q1NA 3ZHZA 1ENPA 3OICA 5LCXA 1R4MA 1QKIA 3D3WA 3AUSA 4A10A 3PHGA 2JD1A 3HE3A 2HJSA 4IGEA 3H4VA 4A26A 1HDGO 3MTJA 1W6UA 2FR0A 3D7LA 3JQCA 1ISHA 2OBYA 1PQUA 4HX5A 3IQDB 1UAYA 3QE3A 4W4TA 1HE5A 3FNGA 2NM0A 4RF3A 1YOVA 4ZQFA 4L8VA 1PS9A 1RKXA 1M75A 4IM7A 2IYOA 3MWDB 3TZHA 4XDZA 3AY6A 4TRRA 4CM4B 1BMDA 1GU7A 3KSDO 2FZEA 4PFJA 2JJYA 4NFYA 3DBVO 1DJNA 2AQHA 1B0AA 1RYDA 4IS3A 1X7DA 3L6EA 2WYUA 1ENOA 1HYGA 2B5VA 4RCVA 1RM3A 4HWKA 4E5NA 4FN4A 1AN9A 4XEHA 4WLEA 5MGBA 5CDYA 8LDHA 4R41A 1GTMA 4W9NC 3D3EA 3C8MA 3G3EA 3QWBA 3ZWNA 3IS3A 5G0UA 3MJCA 4BNHA 4RF4A 2BKAA 1LDYA 3SBOA 5L95A 3F46A 2JFFA 4ZGWA 2NQTA 1V8BA 4E12A 1XLTA 2VCYA 3GOHA 3KYBA 4IIUA 3GHHA 3O8QA 4XQCA 1YE3A 3JD2A 3GC6A 1BWSA 4TWRA 3WYEA 4BNLA 1E7YA 4L0QA 1EZ4A 1FDUA 4AJEA 4I5EA 1U4OA 4EEZA 2BHLA 4W82A 3IKTA 5KVCA 2HK8A 2WD7A 1AHHA 4BO3A 5CG2A 3PP8A 1P45A 5THKA 5JLAA 4NQZA 4NJMA 1XQ1A 1CIVA 5AOVA 1WLYA 3ZU4A 3BMNB 3KYDB 3OP4A 5CEEA 4YWJA 1SOVA 3ABIA 4YEDA 5T8KC 3BTSA 1SMKA 4J4BA 3INGA 2E48A 2YDXA 3DZJA 3JD1A 4CM8B 3DBRB 1LC0A 2ZYDA 1M67A 1U2DA 1KBZA 3PIIA 4B7CA 3F5QA 4MVJA 5KVVA 4F6CA 4CM5A 3ROKA 2EWMA 3WGOA 2C2YA 3NRCA 4BO2A 3RUIA 2WD8A 1N8KA 1MG5A 3KBOA 2ZATA 4UUNA 4P4LA 5IF3A 1BXZA 1BG6A 2ZIZA 5EMHA 3GAZA 6ADHA 4YACA 4LRSB 1K6IA 3W4KA 3E5RA 4B3HA 2W2KB 2IZZA 4FFNA 5EL0A 1X14A 5IXYA 3H5AA 3ZHYA 2D8AA 2CNBA 2O7SA 2IXAA 4U0KA 3RUEA 2G76A 1MUUA 2J3KA 4LK3A 2H9IA 3LC2O 4NK5A 3UN1A 4CUKA 1E1NA 2W2LA 4OM8A 4MVJD 2AEMA 1BGVA 4D7AA 1RPNA 4U0JA 1JAXA 3I9OA 3RSHA 2PZLA 5L45A 4GMGA 3FNFA 3L77A 1P74A 4IIVA 3GZ4A 1BTOA 3V1TC 1HZZA 3HG7A 4QUKA 4FGWA 1P1IA 1IZ9A 3HB5X 2AE2A 1ZKMA 3ONEA 5DBIA 1HT0A 3U09A 3GMDA 4PLFA 3KLMX 4Y6RA 5L4LA 1EMDA 2D4AA 4OH1A 4MVJE 1T25A 2Z95A 3WYCA 2YW9A 4BIIA 3B1FA 5GZ3A 4TROA 5KJFA 1PQPA 3HN7A 1C1DA 5FYDA 2W2LD 1E6WA 2BGLA 1IULA 4HY3A 4ILKA 3TPCA 2DFDA 3UCFA 4BKQA 4DTIA 4H3VA 3DMTA 5KVSA 5JCJA 1VJ1A 1WZEA 1XKQA 4NBWA 2NTJA 2JCYA 4DLAA 8ADHA 3WGIA 4BKOA 3COSA 1ZH8A 4CL8A 3AJRA 3QWFA 2Q3EA 4Q39A 1EE9A 1R66A 4RVDA 4KDEA 3NYWA 1NFQA 3PTZA 5A3VA 3DZBA 1EQUA 4OHUA 2DBRA 2PH3A 3Q11A 1PGQA 4WCFB 2VRBA 2Z1MA 1LDEA 4CLOA 1HDOA 5DCWA 5LDGA 3BYZA 5BNTA 3U3XA 3KVOA 3GR6A 2HU2A 2X7HA 3RUCA 4FW8A 2DFVA 1U7HA 3ASUA 4J1NA 2C07A 5A4DA 3JD3A 5G0SA 1GQQA 2GPTA 4BNJA 1Z73A 4MP3A 1P0FA 2EP5A 5JCJD 4WCFC 5JO0A 5L4SA 1GV1A 1PJCA 3JQAA 1P1RA 3CTMA 3GDGA 4RQUA 4E31A 2C5EA 3ZHXA 4QX6A 1V9LA 2O23A 4LMPA 4DA9A 4I9UA 1XIVA 2CDCA 4CMHA 1MP0A 2VZ9A 3H9JA 3I3OA 2C7VA 1U5AA 5BSEA 1TT5A 4QSMA 5DOZA 3B20A 4WLOA 3VTFA 5I9NA 3QA9A 3PGJA 4QEDA 3GDFA 4G81A 4E21A 2ZCVA 2V6BA 4RPGA 5KOIA 1P3DA 2PZKA 3MCVA 1I10A 2BLLA 3H2SA 3ROPA 5KJ1A 4BNNA 1LA2A 2P5YA 1NVGA 4N5LA 2AG8A 2PK3A 1GDHA 1AUPA 1E7WA 4KTTE 4O0LA 3JQAD 1TVEA 4OKIA 4DYDA 3ZGYA 3U62A 3SX2A 4IDFA 1I5RA 5JY1A 3EY4A 5ER9A 1GFSA 1QORA 3V1YA 2ZCUA 4W6ZA 5ER6A 4KUGA 3I52A 1PJ2A 3LYLA 1VJTA 1R16A 4K26A 1K3TA 4L9RA 2H5LA 3D64A 1C0KA 1PS8A 4RLHA 4BMSA 2HK7A 4FFOA 1BW9A 4GBJA 4BMVA 2ZB4A 4B3IA 4I9HA 4E2YA 1FK8A 4GX2A 1M6HA 1F06A 2GDZA 3PK0A 5JYEA 1E3SA 4YAJA 1ORRA 1DAPA 1R12A 4TVOA 2YUTA 3AFNA 1VKNA 1HYEA 2FSVA 3MTGA 4KQWA 1LU9A 5AVOA 2EV9A 4PLCA 3KRTA 4IDEA 1UXJA 4ZRNA 3QWHA 1MV8A 5C7LO 1VSVA 4HXYA 1VI2A 1ADCA 4IQ8A 4YJDA 1WWKA 3ZNOA 1SEPA 4R3NA 2AQIA 5HWSA 1G1AA 2DAPA 2X0IA 5DP1A 3UHAA 2RH4A 4XGKA 4A27A 4EUFA 1GUFA 4DVJA 2AW5A 1MX3A 2IDZA 3FPLA 3QVOA 1GADO 1QMGA 1IZ0A 4IINA 3TF5A 2BGMA 1VKOA 3KSUA 4CJXA 3GFBA 2A92A 2OGUA 3FTNA 4WLUA 1RM4A 2GSDA 4HNHA 1YVEI 3LT4A 5TLSA 1HYHA 4ZN6A 3LVFO 3OA0A 1JN0A 2DTDA 3BMQB 3KO8A 4AICA 4CQLB 2TMDA 5A9SB 3E9NA 3KLPX 4XGNA 2VUSA 3ZWYA 4CQMA 2ZTUA 3NT5A 2YY7A 2ZB8A 3TL3A 4IUYA 1X7HA 4CM6A 2ET6A 3WGZA 4CMEA 1EDOA 4S1VA 1PGNA 4B4VA 4CLOB 1X1TA 4M54A 3QHAA 1G6KA 2EGGA 2X1HA 4YR9A 3CZMA 2EW2A 4D3DA 1Z7BA 5ILGA 4R3WA 4BKRA 3ZH2A 4YAGA 4I5DA 3ZV6A 4J7UA 1DHRA 1F17A 4OKNA 4CMAA 2B4RO 3JQ9A 3WG9A 2B37A 1JWAB 1PJLA 2C2XA 2W98A 3TZKA 3VPXA 3GA0A 3JQAB 1M6WA 3DC2A 1IYZA 2ILTA 4CQMD 5BQFA 4YYZA 4F45A 4HFRA 2RHCA 1EVIA 2VYVA 3MJ4A 3OA2A 3PWKA 3NTQA 3N74A 2DBQA 4HV4A 3L4SO 1CQJA 1M66A 1Z75A 1TT5B 3FD8A 2JAPA 2E37A 4HADA 3SLKA 4IJUA 5CEJA 4QFCA 2B5WA 3G49A 2GLXA 4TRJA 3IJRA 4HP8A 4MPDA 1UXGA 3SC6A 2RAFA 4YAIA 5L53A 1R6DA 4EJ6A 4EBFA 4AJPA 2OFPA 3OSUA 2VWPA 1D4FA 2O4CA 3UH1A 3VKUA 3OMLA 3EVTA 3W6ZA 1KVTA 1YDWA 3PQFA 5F1OA 3WYBA 1DEHA 1P44A 1CRWG 4CUJA 1NP3A 2IXBA 2OMEA 1BRMA 1YH3A 1LEHA 1PL6A 1E3IA 1DIRA 5IDQA 4GKBA 4DMLA 2YV1A 1E6UA 1HKUA 4E2ZA 5COBA 1DJQA 1U8FO 3FPCA 3ITKA 2GR9A 3GRPA 4YJFA 3VPHA 3EDMA 3F1KA 4BO8A 5G0WA 1KVQA 4BHTA 4OYRA 3O26A 3BTVA 5DP2A 4E32A 1EVYA 4DQUA 3SJUA 1YBAA 5TRTA 1HSOA 4RF5A 3ZV5A 1F14A 1SCUA 1L7DA 3BHJA 3GGPA 1PGPA 4HFMA 4PLGA 1B8VA 1NVMB 4BVAA 1Z45A 3QQPA 5G4KA 2PKRA 5BNIA 1YQDA 4PZCA 5IDXA 2D1YA 4E2XA 2Y0CA 2CDBA 3D0OA 3ROQA 3I9LA 2CUKA 4FCCA 3VVBA 1ZMOA 3JYQA 4IXTA 4O1MA 5TT1A 4CR7A 1C0IA 3GVIA 2AEJA 4OAQA 3HDHA 3DR3A 1DIHA 2VOJA 4YAEA 2GCGA 3FRJA 4J1TA 1W4ZA 3WB9A 2CSUA 3B6ZA 3HJAA 4C7KA 4M8SA 5I7SA 3PGXA 5GY7A 4K6CA 3CXRA 4DL9A 3PJFA 5HA5A 3LT1A 4BQRA 1YO6A 5L7YA 3F47A 3GHYA 2HLPA 1YL6A 2VHWA 3GLQA 2YHUA 1E3WA 1HETA 4XIJA 3IUPA 1VL6A 3PPIA 4D43A 2JCVA 1Q7GA 1H93A 2CF5A 2J3HA 4QECA 1EFKA 1KVSA 1QYDA 3GVCA 5A04A 2NNLD 4XJSA 3L6DA 2EKQA 3H65A 4KWIA 5DZSA 3WOHA 2EKLA 2VHYA 2X9VA 3E8XA 4BGEA 2QYSA 3DQPA 4G5HA 2JKVA 3EK2A 5TSDA 3PFFA 3WGTA 5BR7A 2Q1SA 2VYNA 2X5OA 3EAGA 1NNUA 3BHIA 4RQTA 1YQXA 1Q2XA 1WPQA 2Q49A 2NACA 3G0OA 2D2IA 4GPD1 1K6JA 1YKFA 4DUPA 1EQ2A 4WOJA 4XZ3A 4B3JA 1DSSG 3QVSA 1P1FA 1KY5A 4ALIA 4WECA 1EEHA 5CDUA 3E03A 5MDHA 1LDGA 3RUHA 4PZDA 3I6QA 1U3UA 4XRGA 1U9JA 1U3VA 1CYDA 3UKOA 5KKCA 3Q9NA 5DBFA 4OOEA 4XIYA 1NHGA 4RVGA 3JQ9C 2E82A 2FMUA 4BNIA 4MP6A 2RCYA 1T4BA 4Y67A 4FGSA 2VYND 2Q99A 1MC5A 5JDCA 2NWQA 2EHDA 3K9QO 2V6GA 1MXFA 1Y6JA 2JAHA 4PLHA 2FY8A 3JQ8A 3BXXA 5BSFA 3JQ6A 4ND2A 4XB2A 4L4SA 4ONEA 4U6SA 4AJIA 5IFLA 3ETGA 3EHEA 4QT0A 1DFGA 4MVJP 1AHIA 3AY7A 2Q4EA 2GASA 4PGFA 4RPHA 3UFXA 3K2EA 5KWEA 1MA0A 5JBIA 1VSUA 3NAQA 3VDQA 4NBUA 1H9BA 1UR5A 5EESA 1MLDA 2IYPA 4L73A 4XD2A 4FJ1A 1BHSA 4MKXA 3RAJA 3UICA 1I3NA 3A28A 3JYNA 1E77A 3FHLA 4M87A 4DLLA 4NI5A 3KM0A 3RU9A 5DCYA 3W4IA 3AM4A 3VH4A 2X5KO 3L0DA 3BAZA 3RKUA 4A03A 1EVJA 4RVFA 4PG7A 1QYXA 4GX1A 1OMOA 4PVCA 1F0YA 1LSOA 1YXMA 3DBHA 4MOWA 5ITWA 4Z0TA 4I1IA 5JYDA 1H9AA 2VRCA 1LSJA 3GN1A 3KYDA 4TRNA 1QP8A 1KYQA 4TZKA 3IL2A 1KC1A 1LC3A 3M1LA 2Q2VA 1C0LA 2VWGA 3LC7O 3E82A 1NBOA 4CLDA 3MJEA 5HTOA 3ZW9A 1ZNQO 1OC2A 3AY3A 3EC7A 4JJGA 4P22A 4XCVA 3NT2A 3C1OA 4DC1A 1JLLA 3G79A 4YRAA 1GZ4A 1LDBA 5I9MA 2UVDA 5F5NA 1HEUA 1BXKA 3QVTA 3CEAA 3IIEA 2VTEA 4PLPA 5A3JA 1G0NA 5BSHA 1P9LA 5H82A 1VLLA 4PCVA 4OSPA 3JQEA 3LC1O 3KETA 1FMCA 2BD0A 2VRCD 2W90A 1DRUA 1E3WB 3BTUA 3E6AA 3JSAA 2GZ2A 3I23A 2C82A 4GMFA 4ZQEA 3MOIA 1DBVO 2FPGA 1R37A 1QXSA 4LRTB 1VRWA 2BFAA 2B36A 4I5FA 5TJ9A 3UW3A 4RJTA 4MVJI 2Y1EA 3S55A 3TZ6A 1MXHA 3NEPX 3UXYA 4D0RA 4XR9A 4CLXA 5CPBA 2OP1A 4Z0PA 5ENDA 1J0XO 4XRRA 1I3KA 4Y8VA 4WNCA 4EW6A 1NQAO 1EUCA 2ZK7A 1JKFA 4YB8A 1T4DA 4K28A 3DHEA 1NXQA 1O94A 2WWRA 1E7QA 2OBNA 4KWHA 5I9LA 1V6AA 4D45A 4J3FA 2HK9A 2FSSA 1GPJA 3B70A 3U4CA 3I9MA 5F21A 2J6IA 2VHXA 3QW2A 3RUAA 2DT5A 1IUKA 5BNFA 1E3EA 2PLAA 3V2UA 1ENZA 1WP4A 3HSKA 3QJ5A 4RVSA 1HDZA 3Q6IA 2BELA 4A5OA 4OSOA 1HDRA 3EMKA 3ZZNA 5CG1A 2Q45A 1K0UA 4KTVE 3CINA 4E5YA 1PJSA 1WDKA 2WE8A 3FR8A 5JS6A 3IKVA 4WPGA 4J49A 3JQ8B 5CP8A 3W8FA 4CM3A 3A14A 3IJPA 2B83A 2CVOA 2QHXA 1P33A 3PHJA 2X6TA 3DFUA 4WCFA 2IZ1A 1YGYA 1QLJA 1U28A 1ZZEA 1B15A 2HDHA 3KYCB 4LISA 3TL2A 4I08A 3H9GA 5JDCC 1WXDA 3BIOA 1ISGA 3ICPA 4TSKA 4MVJH 1OOEA 3IAHA 4NU6A 3DEYX 3MEQA 3G17A 3KHUA 1PZHA 4BNVA 2D5AA 1D8AA 1PU2A 2Y0DA 3PJEA 3WSVA 4J9VA 4ALJA 4BNWA 1X13A 1GYRA 1I30A 1ZK2A 3O03A 2G0TA 4UVIA 1WNTA 3S2IA 3WGYA 4DC0A 1HLPA 2WDZA 1GQ2A 4J9UE 4EJ0A 3DBHB 3NUGA 3PQEA 1ZBQA 4H16A 3F1LA 4FFLA 1SOWA 2W8ZA 4FJ2A 4FSHA 4YA6A 1A9ZA 1LLUA 2E49A 2JCXA 5JPIA 2PH5A 3K30A 2ZYAA 1O95A 3UAGA 3RIHA 5KJ6A 2B69A 1PZFA 4WASA 1ZFNA 3NV9A 4JIGA 2NVWA 3VPGA 2DM6A 4D0SA 2J3JA 1N9GA 4L4XA 5EERA 1PWZA 3NTOA 3GGOA 2BFPA 4XYBA 4NDNE 3V2HA 1DB3A 1HTBA 1NASA 2ZJ1A 3OIGA 2D3TA 3H9UA 2P9CA 1T2DA 3FN4A 3CMCO 1Z6ZA 3ZU3A 4R54A 5TC4A 1ENYA 1S6YA 1B3RA 4ALNA 1G0OA 2QYTA 3WGGA 3WGHA 4IBOA 2DTEA 1LX6A 2ZKLA 4XQGA 1EBFA 3K73O 1EUZA 2QRJA 2UV8A 5T67A 1GEEA 3JQDA 4FDAA 4UEKA 1R0KA 5LC1A 4IPTA 1DRWA 2VHZA 5JFOA 1EDZA 2AA3A 3RD5A 3PHIA 4Z9YA 1PQWA 5ENVA 1TLTA 1XYGA 4E0BA 1KC3A 1HE4A 5U9CA 1PJQA 1YBVA 4ZA2A 3GNTA 3NT4A 4CODB 2VZ0A 3U0BA 3PFWO 3PJGA 5KCZA 3PWZA 3WTBA 4YT4A 4TKLA 1DIAA 3NDRA 4FC7A 3LLSA 1XG5A 4YCAA 1VJ0A 2CVZA 3GZNA 4NZ9A 3TZQA 3CIFA 3OETA 1GUZA 4AL4A 1EUDA 2EW8A 3AOEC 4YJHB 3GNSA 4IY1A 4I5GA 5AXDA 2YFHA 3OHSX 4DREA 3BMQA 4CQLA 1Y9EA 1SO8A 5A9SA 1XQ6A 1Y8QB 4XQEA 3JQ7B 2WJPA 5A06A 2UYYA 3PDJA 1U2GA 3NX4A 4FPXA 2CDAA 2VOEA 4OXNA 2G17A 4JBHA 3TDKA 1U3WA 1LQUA 4O59O 2YHIA 2ZJ0A 1ARZA 2VT2A 3O38A 3ORFA 4MIEA 4MJLA 4BMNA 4NMHA 2GUGA 4IXWA 4RZIA 2DBVO 1LBEA 4WNIA 3AUUA 1BXGA 3AUAA 4R16A 3WLEA 3WICA 4WLNA 1VL0A 4UEJA 3WLFA 1KEPA 4R68A 5I8WA 5G2OA 3BHMA 4TKMA 1UP4A 1RM5A 5CFZA 1CWUA 4YT2A 1IPEA 1DPGA 3DL2A 1GCUA 4Z0HO 1Y8RB 3HFGA 3I5MA 3JD0A 3NDIA 4YPOA 4BV8A 3CPSA 5IZCA 1ADGA 2AG5A 4JJIA 4BGIA 3IOYA 3RCBA 3WX0A 1PX0A 2EJVA 2QRLA 1OAAA 2PD6A 4FD3A 4BUCA 1YB5A 5B1YA 1A72A 4J0EA 4GVXA 3CKYA 3FBTA 3M2TA 3I83A 5HS4A 1ULSA 1MFPA 2Y99A 2O3UA 4OL9A 3VTZA 2DUUA 1P31A 1LI4A 3GH3A 4DIFA 3PHHA 3PXXA 1UDAA 2UUPA 3L6OO 3TJRA 5CDSA 4UUMA 4UULA 2GGSA 5TF4A 3X2EA 1H6AA 1YQGA 2OUIA 1BSVA 3L9XA 1N9GB 1B16A 3OIFA 2QX7A 4BS9A 3H3FA 4Y6PA 2HQ1A 4MVJF 5A02A 3DOJA 5EPOA 4KQXA 3H9QA 1PTJA 4FQ8A 1GAEO 4R01A 2NVUA 3RROA 3P19A 1ISFA 3FNEA 4U8GA 1N1EA 3ANLA 1U4SA 4FFMA 1E92A 1KEVA 1FDWA 1PIWA 1UH5A 3H9EO 3E48A 3JYOA 4IQGA 4RDHA 2VT3A 2Q1UA 4GX0A 4INAA 4GSLA 3GG9A 2JL1A 5COQA 4EUEA 5HM8A 2Q4BA 5FFFA 1IHXA 2V6FA 3ZWOA 4CLEA 4ZU3A 3AOGA 5C37A 3D5TA 2Z5LA 4HFNA 4MVJM 1KIFA 3ZWXA 2BF7A 1ZJZA 2FN7A 4YDRA 4ALMA 3GG2A 4AJ4A 1QG6A 1C1XB 2DU8A 5JW6A 3F4LA 2HKIA 4H7PA 4DLBA 2CY0A 1Z74A 1E3LA 1HDYA 5EN4A 4BNKA 4BNYA 1Q7BA 4B79A 3GVXA 4B7XA 1UDCA 1PS0A 5G4LA 3PI7A 4WE3A 1LSSA 4BO5A 1EE2A 3GZNB 3AM5A 5JE8A 3WTCA 5CDTA 4R5HA 3D4PA 1IOLA 3MZ0A 2UAGA 2Q2WA 2YV2A 2AXQA 3UF0A 5DULA 1LTHR 1VE9A 1B14A 1HSZA 2GRAA 4UEOA 1HWYA 4M55A 1K89A 3TQHA 3H6KA 4OQZA 1B2LA 4BO6A 4GKVA 4RVHA 1MB4A 1GV0A 3E1KA 2YYYA 2YHIB 1ZCJA 1XCBA 1T1RA 1ADFA 2V7PA 1LDNA 1E1LA 2XXJA 3A9WA 4IZHA 4UAGA 1NQ5A 4CM1A 2HMWA 3LT2A 1BXGB 1FDVA 1SB9A 4BNUA 4Z3KA 3HUDA 3RUDA 4QQRA 3L07A 1HRDA 1X15A 2FP4A 3BTOA 3HDQA 3K96A 2J8ZA 4OO3A 1VM6A 5JMWA 1E5QA 3SEFA 1AXGA 1RWBA 3ETDA 4U5QA 3WFJA 4MP8A 4B4UA 2EKPA 3W6UA 1RYEA 1W0CA 4FB5A 3I4CA 4NNJA 3PLRA 3KXDA 3SC4A 3VHRA 2XPCA 1K2WA 4MKRA 2NLOA 1S7CA 1PJ3A 2X5JO 3FWNA 3WIEA 4GX5A 1XELA 1E3JA 4JXKA 4JN6B 2NUAA 1LLCA 1GQYA 1DRVA 3VOSA 3P5SA 1ULUA 1NWHA 1SBYA 5J23A 4PG6A 3R0IA 3INTA 3HFSA 3RQSA 1A4IA 2IODA 5JC8A 1JVBA 4E5MA 5TIIA 2RBEA 5IZCC 4CV2A 1X7GA 4XQ9A 4A73A 3PYXA 2OZPA 1B8PA 3EUWA 1H2BA 4ITUA 3ONFA 4NU5A 4L75A 1W8DA 1NPYA 4X54A 4IJWA 5K0ZA 5HS6A 4EUHA 3ANNA 2VNAA 4QXMA 2ZQYA 3PYMA 1ZUD1 2XXBA 2I76A 5GZ6A 5L7TA 3RBVA 2NVUB 4BNXA 3WQRA 3EW7A 3PJDA 1EBUA 1DXYA 3AI2A 4R4JA 5EIOA 3S2GA 4CV1A 1VPDA 2HJRA 3I4FA 1BVUA 1I0ZA 3GAFA 3HDJA 7MDHA 1UZNA 2GERA 1NR1A 1XHLA 1HE2A 4C7JA 3IMFA 1XA0A 5IDYA 4OXYA 1LSUA 3B1KA 2FPIA 4WOKA 3HZZA 1QYWA 1E5LA 1GZ3A 1JAYA 4Q3CA 3U9LA 1NQTA 2WE7A 2Y0EA 2F00A 2P91A 3NKLA 3ROMA 3TNLA 4BB5A 3GN2A 4II3A 4DQVA 3LF1A 3PDUA 1GYPA 3FF4A 4Z9XA 2HUNA 2YQ4A 4IDBA 3VH2A 3DTTA 3IDSA 2Y93A 3Q1LA 4CMCA 4GVLA 3BMCA 3MOGA 2OXIA 3PZRA 3F9IA 1KETA 4A7PA 2PD4A 4KZPA 2BGKA 2ZQZA 1PWXA 3TWOA 3QP9A 2NQ8A 1DLJA 4NJOA 1ZVMA 2EEZA 1ISJA 2HCTA 4K9DA 3B1JA 1JTVA 4O63O 3PEFA 1DIBA 5EQDA 3GUYA 2EERA 3WFIA 1OZAA 3GFGA 1NVTA 1KEUA 3HB4X 4CLRB 1NAIA 3QLJA 5THQA 5B4VA 3OJFA 1K5HA 1YB1A 5AXBA 5CPFA 5A9RA 4RZHA 3JV7A 1GEGA 3ZV3A 4ZQBA 1PZGA 3VZRA 1SZJG 1WMAA 1XWFA 5B37A 5TJHA 5T5QA 5JNLA 2EG9A 4N5MA 4Q3AA 1O9BA 3INRA 3N58A 2HRBA 1Y7TA 3A06A 2J5RA 4CM7A 4D79A 1U3TA 4HBGA 4G2NA 4ZQHA 3JQGA 3KEOA 3VPFA 4K1LA 5CHEA 3G1TA 5EJ2A 4IJKA 4ZJUA 4ID9A 3ZN2A 4NBVA 1U5CA 1UAGA 4XX0A 1Q0LA 2A35A 1JKIA 3ONDA 3JQBA 1YJQA 3K6JA 1L7EA 3WWZA 1PSDA 3F6YA 4D46A 2VWHA 3GF4A 3VKVA 3K92A 1YONA 2AE1A 4Z9FA 5K6AA 4FFPA 3ZWBA 4AJJA 2CZCA 4WJZA 4AJNA 4FOSA 5L4NA 4EGFA 3JTMA 3ST7A 1JKJA 4H15A 4M89A 5GMOA 3ZNNA 3VDRA 1I2CA 3TFQA 4PLYA 1ZXLA 4BGUA 1YL5A 4OMUA 3R1IA 4Q3EA 2DQ4A 2PWZA 4GGPA 4JK3A 3Q2KA 4CMJA 3ZW8A 2Y1GA 4QFDA 4BOYA 2YQ5A 4II2A 1VC2A 1UJMA 1ZK0A 4O5OA 4P4NA 4FFRA 4QO8A 1IB6A 2DUWA 4S3MA 1ZMTA 3FWZA 4BKPA 1MFZA 1MG0A 3FR7A 2QW8A 4E4YA 3KYCA 1AXEA 4Y9DA 1HDCA 1ONPA 3UVEA 1ZJYA 4LMRA 3CE6A 4PVDA 5IG2A 1A4UA 3KZVA 4LCJA 4CPDA 4DIBA 3GEMA 4BO1A 3OF2A 5A5FA 2WSBA 1N1GA 2O7QA 5DBGA 1PR3A
chains in the Genus database with same CATH superfamily
5IAEA 4KGVA 1VPEA 4JLUA 1EGVB 2NU7B 2WUVA 3QLVA 4BTEA 2CF6A 4AKTA 3MGKA 3PC7A 2C7GA 2LKXA 2V26A 2P9HA 1C4OA 2EZKA 1XQ9A 1X2NA 2GLTA 1QIEA 1SHZA 3KJXA 3V1UA 2KQUA 2QK4A 3JQQA 2HY7A 1GWNA 4ZVUA 1GRQA 4CMBA 3TI9A 2OCEA 5LHGA 3QLEA 1OT3A 2A3SA 2H92A 3P8ZA 5SZIA 3VR2A 1XPOA 5IBPA 2OB1A 4WUTA 4D3FA 1DEKA 4OJKA 3ZKWB 3TI7A 2Z3YA 1E1RA 1RWNA 2CLMB 3ZQFA 5CLHA 3TRJA 4P0QB 3NORA 5KQGA 3WNVA 3QWIA 4NH4A 2FWMX 4OQLA 3ODPA 1MOQA 5I6DA 5AJUA 3CVYA 3VDMA 4GDMA 3ZWAA 5IWAB 2R4QA 3BEOA 1NVBA 4RY9A 4QBKA 2BSQA 1NW8A 3Q0EA 3FM5A 4WN3A 4F3CA 1TKRA 1DIGA 3R3XA 2GZDA 1VL8A 3GFIA 2ZDQA 4R2XA 1FRVA 3H7AA 1GPLA 4LQLA 2FW1A 2GO7A 1X7WA 2VS1A 2I3ZA 1WH5A 3B1ZA 3BOQA 4NRDA 4CFYA 2CXSA 5FBWB 1I33A 5F3RA 4LNUA 1KEEB 2J9ZB 1Y98A 2VR1A 3ZXYA 5J4LA 3ZHSA 3C7TA 2ESNA 5EMKA 1X4OA 1JTFA 2AEFA 4EHLA 1QP7A 3PQDA 1GG5A 2A3RA 2H1SA 3GFRA 4XDYA 1NK3P 4Q9KA 3QRWA 5FI3A 3DVAB 1IEQA 4M3NA 1GSIA 4JJ6A 2ECCA 5B36A 1MABB 1J2YA 4JD5A 1F6DA 1DZ3A 1JR3E 4DQXA 1NOJA 4AKSA 3WC4A 3I2YX 2QLBA 1X3SA 4BXXJ 4A5MA 1LPOA 4JYBA 4I2NA 3ZHUA 2HLNA 2J0UB 2PKEA 2ZRIA 1ISMA 4J91A 1M2GA 3N7UA 4KAFA 5C7OO 2QZSA 2JA7J 4KUEA 1JW9B 1UDBA 3PUKA 4G7OF 2YC4C 4Q3NA 1LI5A 2JGDB 4QHSA 5DOVA 1J5PA 1G3MA 1MGOA 4PAOA 3GFMA 1AA7A 4QU9A 1L5QA 1EGAA 1ESEA 3QFTA 2FK8A 1FX0B 2AF3C 3ET5A 1Z12A 4HKTA 4YFXF 2PKXA 3ONVA 3ORYA 3D43A 2JEOA 1R9JA 3LTNC 1NSYA 4GH5A 3IXLA 3RTRA 4IPAA 4GYGA 4YASA 5T4EA 1DBPA 4E5PA 1FF9A 3QU6A 5A05A 1MH3A 3LQ4A 4PBRA 2E7ZA 2DQSA 2RGGA 2PN6A 1WUYA 3SZ3A 2FUG6 2WKSA 4NCIA 3WTZA 3RJ5A 2K3PA 5AW2A 4H1UA 3U1KA 1CBUA 2AXTC 1VQ1A 1V3VA 2QA4I 2HQAA 4JP2A 3CJNA 3EGXB 4EI8A 2XTJA 1UPXA 2H5IA 1DC7A 4AY6A 3CC8A 4EENA 1JDJA 2QE7D 1BKYA 5IDWA 3AQ4A 4YTEA 5EZYF 1AGNA 4RZ2A 4GECA 4YIKA 4IOJA 4W99A 2OFWA 2XWPA 2QX9A 1V3UA 1AQ6A 2LDUA 1TZMA 4OUKX 5B6PA 1CJTC 1WF3A 3U4IA 2P2CA 1M1XB 4WL0A 4G7ZF 1K68A 3QFSA 3G2IA 3JYPA 3GJQA 2Z43A 1GTG1 4FZRA 1XF1A 1LFPA 3WTVC 3LNCA 2DA2A 5EGOA 1IIRA 3K5IA 1G5QA 1HQKA 2FUNB 4XWYA 2OC4A 3KKNA 1X0XA 3DAFA 1JDSA 3M82A 5DDIP 3ZD9A 1WOMA 2HHAA 1O0SA 3QVWA 4NKRA 2V6JA 4XYMA 1EGQA 2GZRA 2I5PO 3FSGD 2I9PA 3L4KA 4MI1A 4IYJA 5HHTA 1DDGA 2JH8A 5FWXA 3ZWQA 4A23A 1YTUA 3GVHA 1V39A 4NSNA 1P5ZB 2KFDA 2G9QA 2VF2A 1E9EA 4BYMA 4J0JA 2E6UX 4CTKA 2R8ZA 4EGSA 1NVDA 5AJHA 3D6HA 3WNZA 2BMFA 3HL4A 3R6DA 2ZT5A 4DV2B 3ZNQA 3J81K 2UZ1A 3TQCA 1N2SA 3AR8A 4ZOCA 4QLOA 3FCXA 5MHTA 4XIGS 3OD5A 3G2OA 1WXEA 2KT0A 3HYLA 3M1EA 2B94A 3LU1A 4R84A 1NBHA 3THWB 4DJJA 2JUGA 4AKHA 1H5QA 2IGNA 3PS9A 3AEUA 3SXYA 3CLSD 1X7ZB 2EFJA 1LPBB 4LDJA 4XLHA 3AT1A 3IRVA 1RJ9B 4ZHSA 3G7SA 2ZXHA 3IBGA 3HFRA 1FP7A 4NB5A 2J59A 5A7FA 4R31A 1NM5C 4Q24A 1NBIA 3PZBA 1T6NA 2IHUA 3NJ8A 3T5TA 4TQ9A 3VSCA 1NN3A 3TTSA 4EYEA 4JJZA 4I9GA 3UAZA 3QWAA 1T9CA 1UM8A 2E1CA 2X86A 1IV8A 4DDKA 3KDSE 1NUSA 4MQ5A 4TN1A 5JI6A 4G8JA 1TKAA 1E17A 3BWDD 4KAJA 1JUDA 5K0CA 1S8FA 1RI1A 4WMLA 1X1EA 5FOQA 1OAKA 1N2CB 8ATCA 4B3TB 3TOZA 1ILWA 3UYLA 2PI0A 1FJ2A 4QUBA 3UB4A 2OD7A 4ETIA 2JB9A 2F4IA 2RAVA 1CQJB 3SICE 2V7XA 2RGYA 3DLCA 2HU7A 1C2TA 1XZJA 5FUVA 4IGKA 4FVTA 3IDFA 2QJTA 3C15C 3QX3A 2ZITA 4ESHA 2NW6A 1X3WB 4DRXA 4X95A 4GGOA 3IOBA 7AT1A 4ENTA 4A93J 3V4VB 1F3OA 1NZJA 3L4BC 2CH0A 4AJOA 1J70A 3GL9A 2IYQA 4NYMQ 2GJ4A 4CMKA 1QNTA 5CNMA 4DIQA 3QQAA 1BMFA 1H9GA 4NESA 4CHTA 1HC7A 1Y5RA 1GJRA 1MX5A 3DOOA 1JHUA 5AKYA 3WZLA 2P27A 3EGDA 1QR2A 1E60A 3NCTA 1IK6A 2NPOA 4QELA 2JI4A 1U1IA 4TZTA 5F7OA 3L8ZA 4GPTA 4YN3A 2RGEA 3FBGA 3JALA 2G3YA 3M6XA 2WADA 4UHHA 1AIPA 3II6X 1PUIA 1HQDA 3PGMA 1UEJA 3H36A 3QE3A 5DKFA 2DULA 2AQHA 5JXGA 3R3HA 1CR2A 1ODLA 2ORED 2OZUA 5A4AA 5C44J 1QVRA 5MGBA 2ZJ7A 4XOPA 2X0FA 4GRAA 3NUQA 3M4YA 2H51A 2VC1A 3C8MA 3G3EA 1CIPA 5K6RA 2Y8EA 3M8FA 5FNVA 4DG5A 2WV7A 1TTQB 3F7NA 2CNWA 4I5EA 1U4OA 1RAGA 4MXDA 5EZGA 3IQIX 2R4UA 1SKYE 3N8GA 3K4LA 2GCOB 4RHTA 5IVHA 2YC2C 1VQ8I 1ETVA 2FX2A 4KBFA 3BTSA 4ZCTA 2B21A 3PDHA 5C4MA 2XUFA 1SKUA 4PYMA 4PM4A 3EZ2A 2FPLA 3NRCA 3LUAA 1XTUA 2WD8A 3TXXA 4PO9A 4RTKA 5HP4A 4B82A 3GQBB 2IZZA 1Y3IA 3HJBA 1JMKC 4YLYA 3UWKA 1MUUA 2J3KA 2H9IA 1V4VA 3V1LA 4CUKA 3ZY3A 1WNFA 1BW5A 5LGNA 5AK6A 5BMOA 2BKXA 3IOEA 1FVXA 1H4VB 3KB8A 4JQOA 3W2AA 3U09A 3SXJA 3WBKA 1O6BA 4CHUA 4TROA 5ALHA 1V8ZA 1QIJA 2HWWA 4NBWA 1JF8A 4MWSA 4DLAA 1ZH8A 3WTWC 4J0IA 2NSLA 3ABSB 3QA3E 3URKA 2GBFA 1R49A 3U3XA 5DCLA 1OH5A 2V5UA 2Z04A 2PG3A 4MW7A 2GPTA 3E3MA 2FMTA 1W35A 4I1SA 1K9VF 2E9SA 3CTMA 2OT3B 4DA9A 1T0JB 3AERB 4BUJA 3FUTA 3LGSA 4E21A 4QEDA 4G81A 4OV6B 2V6BA 2WA0A 2Y2VA 1VZ3A 4LQ4A 4UDNA 1D2NA 1I5RA 3LMKA 2XGJA 2Z9CA 2XUAA 3EXIA 1BW9A 2R3SA 3H1PA 4B3IA 1QE5A 4RDUA 5TGZA 2DFEA 4N49A 2EIKH 4TVOA 5JAHA 4BASA 1N34B 3HB1A 1HYEA 1H5UA 1DBIA 2HYIC 1IN1A 1VI2A 1L4YA 1AGXA 5LLSA 3ADBA 4E03A 2RB4A 3BR6A 2RKBA 1IOZA 2A0YA 3ZGVA 4R1QA 4F2WA 3S15J 1VIDA 3TF5A 1W2GA 3CZQA 4ZPJA 1ZU5A 2GAUA 5K3DA 3MAJA 1YNSA 5LJIA 3VI4B 1NK2P 1VZ2A 3GF2A 3IKLA 3TL3A 4EYGA 1O7JA 3ENWA 5KCMA 4MKFA 2HSGA 2EGGA 2WIAA 2VXCA 3ZIAA 5ILGA 3MA0A 1QGZA 2REBA 1QQTA 3KKKA 6PFKA 4GUDA 1I5EA 1KSFX 2ZUFA 1Q91A 5DIFA 3H17A 4MS4B 3S2YA 3MUFA 3VOEA 1EVIA 3MJ4A 4P92A 4CE6A 5AIPA 2QUKA 1J06A 1SA0A 2YY6A 4RULA 4QFCA 3BB1A 4ETWA 5JNSA 1A5SB 1TAGA 4I01A 3B2EA 1J1ZA 2O4CA 2IHZA 3KVYA 4COKA 4I50F 3PQKA 1TWHJ 1TM5E 1FSZA 2PKCA 5SYMA 4G24A 4E2ZA 1DCFA 4ED9A 4OYRA 1SKMA 4E32A 2CUNA 1L7DA 3IR5A 1NVMB 1A6QA 3CB2A 1Z45A 3GELA 2N1BA 3K0CA 3JYQA 3LOQA 3GUDA 3B89A 4LLLA 2C4KA 3TL6A 3ZVMA 2PM8A 1ZD4A 1GV2A 4M8SA 4ZAFA 2HGZA 2HLDA 3EOZA 4JOSA 4XK4A 3GLTA 5HA5A 2VTBA 1YO6A 1Z7GA 1XXHE 2Q7DA 1STZA 1N25A 3G2LA 3HDDA 3GEHA 3LHKA 4JWTA 4DUYB 3CRMA 4BDZA 4FE7A 1NIJA 1RS0A 5DZSA 3BWBA 3N2GB 1MDMB 3OCZA 4Y2TA 4V0NA 1KSJA 3GZJA 4WFIA 1FLAA 4OAOA 4ZZ3A 1Z4JA 2MWMA 5MDHA 1EYZA 3N5CA 1HCRA 5KNCA 1OLUB 2E82A 5ALJA 1ESNA 4Y67A 4XKBA 3QE9Y 3VR6A 3EXFB 3K9QO 3W6NA 4LCBA 1M9NA 5FLXA 1IV6A 4TL6A 4POAA 3G5LA 4ADSG 1DFGA 4RGVA 1QZXA 2GASA 1V43A 4BWVA 3WB0A 3SZOA 2PIDA 2P6RA 2PMKA 3QFRA 3MQ2A 3RC3A 4V2GA 2ZIGA 3KM0A 3RU9A 1T6XA 1WLSA 3HSSA 3W4IA 3UK0A 2XF5A 1Z4IA 4PG7A 2FZCA 4YCCA 4Z0TA 1U3CA 2VRCA 2UZ4A 1EZ1A 3UO8B 1KYQA 3W5AA 1RLOA 1QB7A 2M32A 4F56A 4US2R 3O83A 4NECA 1SKQA 3R09A 2WJVA 3OFND 4KO1S 2D2XA 2FF4A 1OMIA 5JQGA 3I4PA 4WXPA 2V9CA 2KIUA 2GZ2A 3HYNA 4XLAA 2R85A 3AL3A 1UOPA 4NDLA 2XB9A 3TZ6A 2EFNA 1A2QA 5JSHA 5EKUA 3PQ2A 3HCFA 4X62B 1JKFA 1JJIA 3UMVA 5YASA 3JQPA 4C4TA 4U6NA 2L4MA 4PYJA 5CR9A 3HOTA 3QW2A 4TZ0A 4UXJA 2Y3IA 1PFUA 1AK2A 4HDKA 1JDUA 4A1OA 3AX6A 1K0UA 4MGZR 3ECOA 4KE9A 3C3CA 1W36D 1WDKA 3TSZA 4M21A 4RBOA 1VLMA 3W8FA 1I4LD 3HY3A 3WLMA 3IP9A 1YUMA 3L01A 2EBIA 1ISGA 3RT7A 4C29A 4M3DA 1G98A 3MEQA 1Q84A 1ZDMA 4FHZA 1Z13A 2B4YA 3Q0UA 1I30A 3GROA 3X1DA 1NOKA 2BY3A 1ZBQA 1KI8A 3R7SA 3RRFA 3P7NA 1LLUA 4LNHA 3BDVA 3QVVA 3U31A 5DVZA 2PH5A 4CGYA 3OQNA 4ZQIA 1T0IA 1EFVB 3BG3A 4U02A 2B69A 4JA0A 3NV9A 3QU5A 4JIGA 5IJWA 2NVWA 3ESBA 5IT0A 5D01A 2CUZA 4MEAA 1Y6FA 1HTBA 1HH4A 2WQ6A 2D3TA 2REOA 3CMCO 1NMSA 3GDHA 4OJYA 4J76A 4RD2A 2F59A 2FWAA 2O1SA 2BSAA 5ALOA 5K3AA 2FJ0A 2UV8A 2GN1A 3SHTA 2C4TA 3CX4A 1L1RA 1EDZA 3F22A 2WAMA 3W3AH 2X9DA 2PU7A 4ACBA 1G4DA 1Y4DE 3GUUA 3ITEA 1QB8A 3EZXA 2M1BA 4TSFD 1G8GA 4HB4A 4GE3A 4YCAA 1ORTA 4Q37A 1S2GA 5AI0A 5LYJA 3EPJA 1XPJA 4JX6A 3CRVA 3MGAA 2I2CA 3COAC 1A4RA 4DA4A 1EV7A 3H0KA 5AJVB 3WLQA 1RP1A 4EG5A 5FNVF 4YLGA 1P17A 1S1CA 2EZTA 721PA 5IZCA 2AG5A 3H4TA 3RCBA 3WX0A 2QRLA 5BV2P 4RK1A 4A15A 3BRQA 2PO5A 4C0LA 1JI0A 3O4FA 4WZBA 1B76A 3G8CA 2I1WA 2KLOA 5AD1A 3O92A 1T1IA 4ZCQA 4A82A 3E5HA 1TJ3A 1MMFB 3ZCTA 2GXSA 1AG9A 4M8KA 4IQGA 2ZT6A 2D54A 3AEYA 3ZWOA 2WWIA 3E4DA 4V0SA 5BQ3A 3PHCA 1KIFA 4LHEA 1RYNA 4ALMA 4MMXB 1C1XB 3FTDA 1P4XA 3V8PA 5CDFE 2GMWA 1TIBA 1HDPA 3DZDA 2KPOA 1JPJA 5EMJA 2NYUA 5TB5A 5H02A 1T5OA 3WYGA 5DULA 1W6RA 1B14A 2L5QA 3ZE8A 2MINB 1HWYA 1VB5A 3IH5A 2K2WA 4EVQA 4QGAA 1GCGA 3H1FA 1T1RA 3QVMA 5FRNA 2ZJQF 4RGQA 3QEJA 3L07A 1HRDA 2OWDA 1FQKA 5THXA 2GQQA 4QEZA 4AMGA 5F5XA 1SC9A 3R77A 3EDCA 5SZJA 2FE1A 1V16B 2LREA 3HFSA 4K40A 5FGMA 2LIVA 1WKCA 1VYHA 3L41A 3ONFA 2WB4A 1NPYA 2Q0XA 1YF3A 2P4UA 1VKHA 1UDRA 4MEBA 1BVUA 2MABA 1XZHA 4HVCA 1XT6A 2IC5A 2HJWA 3K53A 4ZEOA 1I3AA 3UMRA 1E0SA 2J67A 5A7GA 3WNDA 3GGJA 1BE6A 3L1HA 4CKBA 3PDUA 2RHBA 2YQ4A 3ZMDA 1NONA 3BMCA 2OXIA 2DE0X 5AT1A 2JHAA 3GZTB 4JL5A 1F8UA 3FPKA 4NJOA 1ZVMA 4J16C 2ESHA 4LDQA 1OZAA 3O2JA 1GTRA 4AUNA 3E5UA 4CLRB 5BNWA 3T5BA 1FFHA 1K5HA 7REQB 1B1CA 5F51A 3JV7A 1ELOA 3AKCA 3MTIA 3DKIA 1Z2NX 3M6AA 1O9BA 2HRBA 1X8LA 1IC6A 3KOWA 4D7MA 3PXGA 1NX9A 4XUCA 2LBFA 2YPRA 1L6RA 3OX2A 5A5GA 2BEOA 3BMXA 2RG1A 1T33A 4YREA 3UT6A 3SWWA 1T3HA 5K6AA 3TBFA 4AJJA 1G7SA 5H9VA 1N2IA 1IONA 1KBOA 4ZT7A 5FRMA 1SURA 1P4SA 3RS3A 4BGUA 2CXPA 3R1IA 4L9NA 1BWRA 2Z8YA 4JK3A 4MUNA 1XWIA 2DFKB 2CMGA 2OAGA 4B71A 3CO5A 3FYDA 1D1AA 4DBQA 1SC6A 4XYGA 1WUIS 4EAQA 3F7MA 4MQEA 3IVCA 1XJQA 2ZT7A 1NXTA 1FBNA 1XKTA 4LWPA 4OGLA 4N9IA 4YQFA 3I2JA 3A6PC 4ZP1A 4UNRA 3CF4G 3GLKA 4K9LA 2VJPA 4TQAA 4OXKA 2E5ZA 5AHKA 1SXGA 3ZCOA 3QAHA 4IXAA 2PN1A 4EF6A 2V0GA 2VUIB 5CVVA 3VAAA 2Y1CA 4HJRA 1GNTA 1WDLA 1P7CA 4L6CA 4QO7A 3VU9A 5AOAA 4FI3F 4OJMX 4NEQA 4I36A 4DPKA 4XFKA 2YJZA 2JPCA 2NRAC 5FTNA 1E7RA 1YZHA 4JDPA 4QUDA 2QN3A 3T5MA 4QUHA 4PAMA 4WACA 1ZK1A 4C2MJ 1QQ6A 1HC8A 1GITA 1J9IA 3WLIA 1R4NA 1Z0SA 1ZUHA 3SVZA 4HDNB 2YV3A 3HPQA 3WLRA 4CDRA 2NXEA 4DNFA 3SF0A 1UZMA 4PLTA 1N5MA 1UMKA 3U4HA 3K69A 4CA0A 5CBKA 1SUPA 1EVZA 2M9HA 2B2XA 5EIHA 1NBME 3GRVA 3PG5A 4PXAA 3U37A 1QGDA 4F4HA 3RYCB 1PL8A 5JS8A 1O1YA 5HXAA 2A9JA 1KDTA 4U9UA 4BNFA 2VE8A 1A5TA 4KWEA 3TR0A 1B8IA 3UFBA 2QGNA 2VKHA 3JR7A 2VUUA 3ZCSA 2IA2A 4RSHA 4ML3A 3MRXA 4OMZA 1WHTB 5BR8B 3K4CA 1TL8A 2GRJA 2P6PA 1Z5ZA 5HDQA 3M8EA 2E1RA 4UNIA 1DAEA 1WA5A 2FUCA 1GUAA 1MEOA 1Z36A 2H11A 5JQGF 3FDIA 1MJHA 3CN9A 3RIMA 3KAQA 1Q0HA 4Y4RA 3AO0B 3SPXA 1G21B 2G1AA 4XQ0A 4BN0A 2HJHA 3N0XA 3G73A 2KYRA 2WV0A 3PIPF 1MTZA 3L8GA 3P71T 4UUTA 3STVA 3BTCA 1W85A 2R11A 5BT8A 1XTIA 2UZIR 4EQQA 1GUUA 5HZMA 1IXZA 3BMOB 3BPVA 3DONA 3WQSB 2XW6A 2MLKA 1I2ZA 2FF7A 3OPYA 1H4SA 1QJ4A 4Q9HA 4MQFA 3K0BA 4Q02A 2A94A 1KO1A 3T3PB 4X8HA 3DT8A 2CL0X 5LZ9A 1DE0A 4YAKA 5LLDA 1KMHA 4ASUD 4R9UC 3M9LA 2BMWA 4F3TA 2ADMA 4YRIA 2V7EA 1BEZA 1UJ2A 3I64A 4QOFA 5FWNA 4Y15A 1AE1A 1S3GA 3OJOA 1X19A 4ZT5A 3RFCA 4Z4IA 3IHWA 2DGDA 2ZI7A 4ZCMA 3L6UA 2BH9A 4AG3A 4U7FA 3O8QB 5IASA 2D13A 2HMTA 1WQ2A 3CGWA 3WWYA 2G28A 4M7PA 5IAAA 2IY9A 4HDMA 1MSEC 5FLYA 3MLBA 1KF0A 1N6LA 4XSHA 2NXJA 4IOLA 3A6KA 5CVUA 2C1EA 4F8EA 3HABA 2KMLA 4HWPA 1NC1A 2VOPA 4NCNA 4G65A 3EJ6A 3DTVB 2R7XA 4KRGA 3KYIB 4FETA 1AHPA 5KWVA 1XAGA 4X3OA 2OQRA 3PVCA 4C4AA 5AQEA 4PTLA 3A1NA 3NOOA 1QANA 1C81A 4PSWA 2PG4A 3MXOA 2IX9A 3CEJA 4OXXA 4KE8A 5JZVA 5CAEA 4DNXA 3THOA 3A1VA 1P1KA 1OXMA 1U0LA 2Z6VA 2PXCA 4YPVA 4NYJQ 4PONA 4JB3A 5LYJF 2XT9A 2SECE 4FHTA 3SGLA 1PKEA 4UHFA 1GD1O 3UG6A 2UUCB 4XLZA 2VBCA 3M8JA 5BV1A 4YHHB 3MLEA 3U44B 4WZZA 2HBQA 3T9CA 3ZH9B 5AVKA 2G9WA 2IYXA 3DPTA 1C7JA 1V4BA 2ZRHA 3AW8A 5TPZD 3O84A 1GDDA 1ODTC 3QTBA 2FQYA 3E5XA 3F8MA 4Y2YA 1P3JA 1KMNA 1VBNA 3E18A 2V0CA 1VF9A 3T7DA 1W2HA 2DWOA 4G4GA 4YDQA 4ALKA 1SXJB 1ID8A 121PA 4UXIA 2WWFA 1UKZA 3V7RA 4UUBA 5JDIA 1DRJA 1XTQA 3L0SA 3GJZA 2XCLA 2FWRA 3BRCA 5ILQA 5I3CA 4KU4A 3WL5A 4HFJA 2R7LA 1N2ZA 5E3HA 2LF7A 3RC8A 1SUFA 3PM1A 1T0FA 3M07A 2E89A 1TB4A 3DLHA 3CPEA 5FPYA 4YRNA 1M2WA 4DCNA 4LWZA 1W34A 3C14C 4CQJA 2YJ6A 2ZTLA 4LYAA 2STWA 1O9HA 1L4NA 2ZKZA 1D2MA 1GCIA 1Z7LA 2WAXA 5DBOA 4CQMB 4ZDKA 1I01A 1MJGM 3GRUA 1M34E 2PZGA 1RI3A 1T2AA 3VO2A 1C7QA 3HO6A 3VPSA 4Y98A 3HFJA 2RAEA 2H57A 2O3JA 1TU3A 1D7OA 2TMGA 3EQ8A 1KVUA 4XD7A 1UG2A 4HLCA 2JSPA 2RHRA 5HS9A 1LI7A 3SMVA 5LEJA 2GAJA 4OHZA 1ORWA 4I09A 4MW5A 4AF6A 4F52A 2GN4A 3FMFA 3GARA 5A6SB 2HHCA 4LD5A 3LSYA 1DJMA 5AJTA 4CDGA 3OX4A 5KPDA 3F67A 1I24A 3AEKB 2P9QA 1TZBA 2ZUDA 3F3MA 1WCIA 4AY2A 3AEZA 2P4SA 4BBZA 1BFUA 4G1FA 1FFXA 3OQHA 4O4LA 5KBYA 1G6OA 4ND5A 5EIXA 1OC4A 4IEEA 3QUBA 4YVFA 5GPBA 3SIRA 1ZD2P 4JT8A 4RFSB 4QOSA 2P9BA 1XEXB 4GGMX 2JJ2A 1MJFA 3NH6A 3DXXA 1X2MA 2WSLA 2A6EF 1R3DA 4MUAA 3D8SA 1A8QA 1AUQA 2QTMA 2B4QA 3AHCA 2NU9A 3V7NA 3LY7A 5CXQA 2XYHA 1BE8A 1EZZA 1VCOA 4JMPA 4M99A 4AN1A 4IDGA 2BDEA 2FGJA 4NMWA 1K7EB 2YXBA 3MJTA 1L9XA 1B1BA 2GZ1A 3S7ZA 2ZM5A 1U2ZA 3WAGA 1S5LC 3ZHZA 1JE1A 4EYKA 2F3QA 2WFLB 4V2FA 2ZRNA 5HJ2A 1JFFB 5B58C 3C98A 4RF3A 4URZR 1PS9A 3TZHA 1DGWY 3C18A 1B0AA 2RJOA 1T15A 3PGLA 1X7DA 3FXOA 2O19A 3AIOA 4ZZDA 1C30B 4R2JA 2QF7A 2ZUUA 4BNHA 2X1EA 3SBOA 4ID3A 2M6LA 4G7HF 4IIJB 4QOEA 3UGTA 4F71A 1FDUA 5D3MA 4W82A 5KVCA 5FOSA 4YJ2B 4ES6A 4A36A 4OIRF 3P0HA 5L3QB 1DQRA 5JMOA 1F6WA 5A6VA 4YEDA 5T8KC 3F4KA 3BGDA 2GK4A 2EC5A 3HK2A 1Z4OA 4HC4A 2WFAA 1X1RA 5JFRA 4PX3A 1SVOA 4P4LA 5IF3A 4KHZA 4G2TA 3EF1A 4YV0A 3OF3A 3QOWA 5B5SA 3OYFA 4FOTA 2IY8A 5IXYA 5AIAA 1A9QA 4MIMA 2O7SA 3FLBA 2GAAA 2LY9A 2CWEA 2GYWA 3RSHA 3A4CA 1H4QA 1NOIA 3ONEA 3RH0A 3OVMA 3RYFA 1P9WA 2PX2A 1O94C 4BLUA 3WGUA 5KVSA 4EPTA 1VJ1A 4JQFA 1XKQA 3GFOA 1OZHA 4KSYA 4BKOA 1D2AA 3FOBA 1NFQA 3PTZA 2XVYA 1XTTA 3OKFA 3QTTA 3PKIA 3MRTA 5L6LB 1UBUS 1E2FA 2OLJA 2FD5A 3IHUA 5JCJD 5CFMA 1SPBS 2IU0A 4IAOA 4ZVKA 4MDEA 4AT1A 3W77A 2R8PA 4Y3UA 1F7UA 5T41A 1H8HA 2XRLA 3K0KA 1SUIA 4MTCA 3VTFA 4KIUA 3OE1A 4N5LA 4JOQA 2HEOA 3C6QA 3JQAD 1XMSA 4RMGA 3ZBTA 2RHOA 4M1YA 4BXFA 3V1YA 1U98A 2ZCUA 4RKYA 8MHTA 4C88A 4GBJA 4G07A 4YY3B 4BLOA 1JIUA 1FK8A 2GDZA 2Q0QA 2JFUA 2VNHA 4ISCA 2QTVA 4FX5A 8GPBA 4YRKA 2XYQA 3KRTA 4NPHA 4EQZA 4RJKA 4AO6A 5AW9A 4CICA 3I6ZA 4Y2GA 4EUFA 4M9RA 4KR6A 3K9TA 2IGBA 2IDZA 1GADO 3DEFA 1G9SA 2I4RA 2XB0X 1JN0A 5B6JA 1MHTA 1WSUA 4YRLA 4IWNA 3CPHA 3ESCA 5B57C 4X6AJ 2OXCA 3QHAA 5T6MA 2EW2A 3S2HJ 4X8LA 2CNLA 3QUCA 3H18A 1PFQA 3CUEF 4PANA 1QE0A 2W82A 2B6HA 3JQAB 3I09A 1IYZA 2WU1A 4YYZA 2DX7A 2ZS7A 4BLQA 4A0HA 1TYAE 1QRAA 2RHCA 1Z4MA 3OA2A 3PWKA 4UUSB 4QUAA 4A0YA 3NARA 3RSSA 3FD8A 3KKZA 3IWZA 4AS3A 2PJZA 4YAIA 5EFZA 2NXNB 2I6QA 4MZXA 1ZQ9A 2JRTA 5DSZA 3UH1A 4HZFA 1SOUA 1YDWA 2R93J 4AZ3A 5KQSA 1SC4A 1PJ8A 5COBA 2OLKA 2PUEA 4XL9A 4OQDA 4RGXA 1TK9A 3O26A 4M0PA 4FBLA 2YBDA 4M1MA 1SCUA 3BHJA 3CDLA 1G4AE 5BNIA 1YQDA 4D9FA 3U4MA 1U94A 2UUBB 1T10A 2BE5F 5HG0A 2A4MA 3UNGC 5ALDA 4RELA 1YR9A 4J1TA 2MMGA 2VLIA 2ZLBA 2QU7A 1T91A 3PGXA 3PJFA 2OV4A 1IZ7A 4WBNA 1KVSA 5C5EA 1TO1E 1SIOA 2EKQA 4FR2A 3HKCB 3H65A 3HCRA 1AQNA 2AOTA 3QKWA 4V0KA 3DQPA 4XCQA 2J87A 1KK1A 2WT4A 3ECSA 4BKMA 3SZMA 1Q2XA 2YIDA 5LOVB 5HOQA 2JLUA 3O2PE 1H2WA 1V1MB 3HGGA 2OFXA 1Y34E 4XONA 3S2DJ 3UKOA 5DBFA 4GLJA 4TV8A 3JQ9C 2RSLA 2NZWA 4NXNB 2VYND 1EA5A 4NU8X 3JQ6A 4EM0B 2ZWVA 3ETGA 3DWIA 3EHEA 4MVJP 5AVSA 3O0DA 4A8TA 3LKBA 1AA6A 4BMZA 2IYPA 3UICA 3D6TB 1F38A 4NI5A 5J58A 2ORIA 1IMJA 1CY1A 2DW4A 2VUMJ 3PX2A 5CITA 2PMUA 4I1IA 4CTNA 4LOAA 3LQ2A 1SVSA 2K9SA 1QO0D 4JKYA 3GPBA 3SXUA 4LXXA 4YRAA 5EJMA 5CNIA 3LA7A 4H1WA 2WTMA 1DRUA 2C82A 1UMBB 1NVUQ 4EB8A 2B99A 3ZDDA 4KQ2A 5AW7A 4QLAA 1R6BX 4YMIA 3BPSA 3PUHA 1XDGA 3L8FA 5CX1B 3CT6A 4Z0PA 5K8VA 2R5ZA 4XRRA 3W79A 1E7QA 5KMGB 2HK9A 5AJWA 1FLDA 4REQA 3RHSA 3EPPA 1QHYA 1ENZA 4ZAGA 2VBIA 4ZU6X 4XUEA 1Q74A 2WE8A 4YCMA 4MGRA 4DMUB 2N9UA 3JW8A 5H80A 1USGA 2DLNA 1V95A 2WSMA 5KTRA 3BIOA 4FEYA 2OA0A 5KOJB 1A31A 3PR2B 2PO7A 2OA4A 1ZARA 2ODAA 5SZKB 2L69A 1FTGA 3ES9A 4RD0A 2PMEA 2X0KA 3TOBA 1WNTA 2X19A 3OLYA 5ADUS 2DB3A 2BGGA 3LCJA 4LLNA 3T1VA 4IJQA 3CV3A 1JIXA 2KSQA 2J9YB 2JAQA 5JPIA 2O2CA 1FFGA 1MOZA 1I6XA 4JSTA 3ZY6A 3LLCA 3T3NA 3NLLA 3H5LA 4L4XA 2ZCWA 2BFPA 3KVRA 3V2HA 1YC5A 2WIBA 2OQIA 2PJUA 3FN4A 3LUJA 2EZ4A 2POCA 1TQDA 3EFHA 3GCMA 4FE4A 4GI5A 4HQMA 2ZKLA 2XCSB 2EZUA 2O8EA 2BH2A 4LK1F 4KAAA 5LC1A 4YUWA 3F7OA 2IJGX 4PHFA 2PMFA 1QDEA 3CNBA 3PJGA 1XDZA 4Q4JA 3J80K 3P0FA 2H1IA 5J1UA 5K3OA 4IY1A 2ZO4A 4FMPA 2UYGA 3RZDJ 5FJ8J 4B80A 5F6FA 2OBMA 2VOEA 3Q5FA 3R2JA 3B9RA 4WSOA 3QPWA 4GKAA 3WRXA 1OASA 1C9YA 2EBFX 3TCXB 1H89C 3WLFA 1X8JA 2G09A 2ZR8A 4G25A 3I04A 4JVLA 3VYSB 1WE2A 5IYDJ 1SHUX 4HNTA 1KH2A 3HO1A 1WSDA 2Q0HA 3M8KA 2ISSD 1JFRA 2HU9A 4GVXA 3L06A 4GM4A 4DIFA 3G3ZA 1CQZA 3TGNA 3LIPA 5IU6A 3L9XA 4XFDA 2L0XA 4PHCA 1D7AA 3OIFA 4BS9A 4ACAA 1LS6A 3GUHA 2XOKD 2E7WA 2HPHA 4P80A 1PTJA 3QELB 1R9NA 1JT2A 4G56A 3TDMA 1Z9CA 1FDWA 4ZOAA 3CSSA 2JL1A 3GNLA 5KUTA 2QL6A 2QY9A 5H3LA 1WUTA 3Q8MA 3DEIA 1ZGZA 1O58A 4J75A 2C7OA 1E2NA 1KJZA 2XNSA 4WZBE 1U2PA 3X1KA 2IUUA 3GVXA 4V3CA 1U3EM 3QM1A 4RTMA 1F51E 2RE8A 3PI7A 2GBPA 4URUR 4R5HA 4HYTA 3ZY2A 3U81A 2J45A 1GP2A 4XM3A 1RAAA 5D5QA 1K89A 4EPRA 5E6SB 2R6GA 1XD2B 1TUIA 2O7NA 1ADFA 4QARA 2XXJA 4UAGA 3FWYA 3HUDA 3RUDA 3L49A 1FEZA 3UPTA 4OO3A 1KQ8A 1VM6A 5AVXA 1E5QA 1AXGA 3FMQA 3RSFA 2CW8A 1UC9A 4LDAA 1T36A 1PJ3A 5KVRA 1KI2A 4QTTB 4FGZA 1L5HA 2NUAA 1FFCA 1NWHA 1WJFA 2WKRA 2DWCA 3AG6A 1VGVA 4O02B 4QOGA 4CV2A 4A73A 4CFSA 4ITUA 3JTGA 1KYZA 4IIEA 4I1OA 2V55B 2ZQYA 4IH4A 2WOJA 1TVKB 3PQ3A 3LL4A 2WWTA 4EO4A 7MDHA 1UZUA 1ZNWA 3HEBA 2FPIA 2BHRA 3DKYA 3ZZ1A 2V7WA 3KPUA 3TQTA 2QTBA 4RD3A 2ZSUA 2AWNA 2N3ZA 2C4NA 1DKRA 2LY1A 1G3TA 2GSWA 2R1UA 1RR7A 3GI1A 2YWDA 3BREA 1JHDA 4TLEA 4WFKA 2GXUA 4O63O 3HM9A 1CY7A 1NJ1A 1Z2EA 2IQ5A 3IHLA 4MHGA 4QJBA 4B2LA 2XKOA 1Y5IA 3INRA 1Y7TA 5ALSA 5DK4A 1NSTA 4QWQA 5CHEA 4FWIB 2PBFA 1U5CA 1FRNA 3TAHA 1GG2A 5KTSA 5IJ0A 3WWZA 2BGTA 4D46A 4D57A 1YS7A 1Z2CA 2MW8A 1EEXB 1J24A 1XGSA 5GMOA 1U0GA 1ZLYA 3OU2A 2NVYJ 1JT9A 3JARA 4L3WA 3WWOA 1YL5A 3RK4A 5AM0A 2GIVA 2DUWA 3FWZA 4E4YA 3RSZA 1AXEA 1KZ4A 4L8WB 2C6YA 4FCVA 1OKRA 4B6SA 1F12A 2EDCA 3KVNA 3ODGA 5I7AA 4QPDA 4RORA 3HBNA 2AMFA 2GM4A 1ML4A 2AQEA 4DEYA 4KQ9A 4EHBA 5IMSA 2JLRA 1KO8A 3BFVA 1M74A 4D0NA 1E0AA 1T8PA 3NHWA 1OIVA 3QMWA 4WBXC 4BLRA 1XCVA 1AS3A 4TKVB 2PY6A 5H7XA 4R1HA 3PC2A 3OEHD 3ZHCA 1KAMA 5CQEA 2R6FA 3O1IC 1E2MA 1XB4A 2ZRGA 4IQ4A 4C3HJ 1IE3A 4IJAA 3S1SA 1KI9A 2XOXA 2QUHA 3IV6A 4H18A 4LEIA 3S3OA 3ZDYB 1DTWA 1EWTA 4WBNF 2FI1A 3FUCA 2WBMA 3EVGA 1R10A 4ZEMA 4MQ6A 5D85A 4A8JB 3ZP5A 2A9VA 3OFSA 3WWEA 2JJ8A 3IUNA 1V25A 2YX7A 4KQCA 3ZPLA 3UCXA 2D8MA 1WAMA 4TV8F 3A1CA 2I2BA 5M2QA 1JJFA 3WE3A 1KI6B 1YVDA 4M71A 1DG1G 2DKOA 1U04A 4U6QA 3AESB 5I5GA 4QIWN 1NHWA 4Q4HB 1L0BA 1WHSB 4XIFA 3BWMA 1QYCA 4NCKA 5EWLB 3M6LA 4ENMA 1I27A 1YTYA 2XX3A 4GNKA 3CEMA 5FBHA 4UE2A 1JILA 1VQPI 3R3YA 4ZT4A 2VJIA 1AOYA 2VQ3A 5IFKA 1D5VA 4PQFA 3OLVA 1ICEA 5LDHA 5EEGA 1RETA 4PPQA 4XQFA 5B1BH 2WINI 3DZCA 3V7CA 1FQJA 3DZKA 2X6YA 5DTJA 2EJUA 3SU8A 1WCWA 2W0SA 1N3LA 4FGLA 1ATZA 3DB1A 2IBMA 3KP3A 1KHTA 1K7FB 5B2FA 4WUVA 3UGJA 1C9DB 3W2TA 4R8HA 5CPRB 4TTIA 5EYPA 2FG5A 2P0YA 2VJOA 4JKOA 1HA8A 1JE0A 1T5TA 3OM9A 1DOHA 1R4MB 3T7RA 2XNDD 2O8XA 1JLHA 4E33A 3SY8A 2DPGA 4KMSA 4UE6A 5KJCA 2LTPA 1QQAA 3ZQ7A 2P9EA 2A6HF 3RI3A 3IVXA 1SCNE 1IZYA 4H3KB 5C4GB 1THMA 3KB2A 4TXLA 4ZKEA 1QOZA 3WBFA 5IKOA 4FHGA 4R69A 4LLGF 4BNGA 5LXTA 2MYSA 1KOLA 2ADUA 4IHYA 1XNGA 3CE9A 4XRFA 5M34A 4R5MA 5H68A 3NFYA 4LTNA 2EXXA 4MKZA 2JJ7A 3I2KA 4GP6A 5TVGA 2ERCA 1WWXA 2PJRA 2GF2A 1YFJA 2OVFA 4LZWA 1XA3A 2HPIA 1VGQA 3OO1A 2FKNA 1O8CA 1DEOA 2O3TA 3LX6A 4X00A 4HDSA 2H1WA 3DEUA 1TWAJ 3AHDA 2BEWA 4IV8A 4XOUA 5B4TA 3GLIA 5C0OE 3QMPA 4JZYA 2HNKA 5AVWA 1TU4A 2VDLB 2FFJA 3ABRB 3HGMA 3WJ7A 1S1MA 3P5BA 5CDGA 1RUOA 1LVKA 2PFSA 5BPDA 1C9JA 4HN2A 1X87A 3WL7A 2VBGA 3C7AA 5KOHB 4IO1A 1WZ2A 3VR5H 4GICA 8OHMA 4QIHA 4PZ0A 4UB6C 3V8RA 1CUYA 3CEPB 3QQ5A 3VOAA 2Z0MA 3LM8A 3IERA 5JMPA 1LB2A 4J1QA 1BN6A 4C1NA 2JVIA 2TDXA 4DOMA 2WQ7A 4UVGA 2OC9A 5FV7A 2E2WA 1RCUA 3AM3A 1IVSA 4AAYA 2J5QA 3AXTA 3C16C 1Z83A 4AK9A 1ETOA 3BGIA 3LNTA 3AR5A 4G1UC 4QBTA 4D9KA 2FRDA 3P9XA 3RBXA