3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
1NYTA 2FR8A 4CMCA 4W4TA 3AFMA 3PEFA 4CLOB 4BNYA 3OF2A 2BRUA 4W9NC 1J4AA 4Y98A 1ULUA 1BRMA 1PSDA 4OXNA 2J8ZA 4K9DA 2WD7A 1F0YA 4OKNA 4NJOA 2GN4A 1LUAA 3OJOA 3JYLA 5L4SA 1YB1A 5IG2A 3INTA 2XF8A 5ER9A 1PJBA 4GH5A 2W8ZA 3L77A 1NNUA 4Q3BA 1UXHA 1A4UA 1Z7EA 4AJ2A 1YBMA 4OL9A 2EXXA 1DB3A 4J3FA 3K5PA 4BNIA 2QIOA 3GHYA 4Z6KA 1E1NA 1I8TA 3P2YA 3I9OA 3F4BA 5C7LO 1GZ3A 1IZ0A 4R1TA 4CLEA 3UHAA 2CMDA 4YQZA 3KSDO 2ZCUA 3JQBA 3ULKA 2QZ9A 3SEFA 2ZIZA 3BXXA 4KWHA 3JYQA 2E82A 2E49A 4KUGA 1KIFA 1WPQA 3S8MA 1CJCA 5JY1A 5C3MA 4Z3KA 2W2KB 1C1DB 1DRVA 3HE3A 5KKCA 2WSBA 2NWQA 3KYDB 4K1LA 4Y9DA 3TJRA 1LTHR 2GGSA 3HN7A 1MGOA 2HK9A 2ZTLA 5C7OO 1EBUA 4LSWA 3R1IA 1I32A 4GL4A 3ONEA 2GNAA 4R41A 3SLGA 5EPOA 4CQMA 1BMDA 4B4VA 1B15A 1O89A 3PJEA 1U5CA 5L51A 4NQZA 3CXRA 3ICPA 1ENOA 5T64A 1WZIA 4EDFA 3GHHA 2VHXA 4G65A 1DJNA 3SC4A 5I8WA 3QY9A 2GLXA 2UVDA 3RUEA 4MVJA 4XYBA 1JU9A 3Q2IA 5JMWA 1EQUA 4U5QA 3CSDA 3LYLA 2W4QA 2PFGA 1MX3A 4Q9NA 5DP1A 4LMRA 4DC1A 5JCJA 3I1JA 4IIUA 4PLHA 1GDHA 4IM7A 1EEHA 3QJ5A 4DPMA 1H2BA 2NQTA 1U8XX 4UVIA 1CETA 3JQ7A 1K2WA 1N5DA 2JJYA 1ADFA 1NQAO 3TF5A 4ZQGA 2J6IA 1ZEJA 3F46A 2YV2A 3VKVA 1ZK4A 4IDAA 1E3EA 5A5FA 3D4PA 1MLDA 3MTJA 4D7AA 5CG1A 3B1JA 2O2YA 4OQZA 5COAA 3TZHA 5IN4A 4AG3A 1VJ0A 3ZH2A 4LVUA 2FOIA 3E5RA 3ZWXA 2NTJA 3VAZA 3RIHA 3H9JA 1Y9AA 3JSAA 5BT9A 2DBRA 1ORRA 2CDCA 3NEPX 4IDCA 3RD5A 1SB9A 4TRRA 1YBVA 1ONNA 3DB2A 3RC1A 2JD0A 1LDYA 1IULA 4R4JA 3RU9A 3PP8A 2CF6A 3H9UA 3EZYA 2UAGA 4P8RA 1LLUA 1VL8A 5ILGA 4RVSA 3AY7A 4N5NA 1UXGA 3PJDA 4BVAA 1M76A 1C1XA 1E1LA 2IRWA 3FF4A 2WEKA 3PQEA 4W99A 2C0CA 3AUSA 1YH3A 4ZRNA 4NFHA 3DC2A 1O5IA 5ICMA 2UDPA 4BKQA 4FCCA 5JSFA 4CLXA 8LDHA 3O38A 4CMJA 3H5RA 1GEEA 5F5NA 3BTVA 3JCZA 1E7SA 4PLWA 4RVGA 4YR9A 4WCFA 1LRJA 4J4TA 2VHZA 4YCAA 2RIRA 5F3RA 1R0LA 2JFHA 2QRLA 3F6YA 4R54A 1IHXA 3O8QA 1BGVA 4WOKA 1OBFO 3WQQA 5K6AA 4WNCA 3I6IA 4C7KA 4LGVA 4LK3A 2GPTA 4IXWA 2X86A 4R9SA 1R0SA 1F14A 3WGOA 5JC1A 2EW2A 2GZ1A 4RZIA 3DR3A 1YL5A 4XQCA 3W6ZA 3ZCXA 1T24A 1UAGA 2IZZA 3PIIA 4QEDA 4IJKA 4XQ9A 1R6DA 1ADBA 3BA1A 3LZ6A 4JBGA 2Y1CA 4DQUA 3DOJA 4IINA 4YT2A 3HN2A 3WGYA 4BKRA 2GSDA 1O0SA 1SPXA 2DTEA 4MINA 4NI5A 1WAMA 4KOAA 3MJEA 1HRDA 3GGPA 3JQ6A 4CUJA 3L9WA 3ANNA 1QYXA 2DTDA 3RBVA 3FHLA 1JA9A 2O3JA 1XU7A 3DHNA 3ETDA 5CPFA 3FD8A 1RYEA 4RVFA 3VVCA 3X2EA 4TZTA 1W4ZA 4L76A 1E3SA 2WE7A 4CLRB 2DUUA 1FDVA 2Q3EA 3M2TA 1NWHA 1AHIA 1PJQA 2NVUA 4IQGA 4U6SA 1W0CA 3WFJA 5F1PA 4M1QA 3FN4A 1GUFA 3RBZA 5T57A 3R3SA 1DOHA 3I5MA 3WIDA 4GX1A 3FNFA 2F00A 2IEBA 2Q4EA 4H7PA 3H65A 3ON5A 3VTZA 1CYDA 4Q3DA 4JLWA 2VYND 3GF4A 5KIAA 4OQYA 3KTDA 5IZ4A 2FPIA 4GSKA 1MXFA 3ONDA 4E33A 1UP6A 4PGFA 4AL4A 1YONA 1M67A 4BMSA 1PGPA 2H5LA 3KZVA 5A9SA 2Y93A 2JHGA 1I01A 4MKZA 4YJFA 4YVFA 3PPIA 2H9IA 2VRCD 2NNLD 2O7QA 3NJ4A 2Q1WA 1VL0A 3U49A 1NM5A 4E30A 4FGSA 4IMRA 5L7TA 1IPEA 2G76A 2C5AA 4ITUA 3MJ4A 4O59O 1ZSYA 2HJRA 1HL3A 4CLDA 4QSMA 4DPLA 1PZHA 2JAPA 4WLNA 2X9VA 4K26A 4N18A 1CQJA 3GC6A 1R0KA 1DLIA 2IYPA 1PGOA 5JY6A 3JQAB 4MP8A 2P2SA 4CMEA 3NDRA 1C0LA 1X0XA 2CUKA 4R9RA 3JYNA 3DBHA 3FPLA 3FTNA 1P1FA 2VNAA 4UVGA 4L4XA 3D3WA 3OJLA 2BFAA 2AHRA 5TT0A 1N1GA 4CM8A 2VUSA 1PJLA 1I0ZA 2DQ4A 1MC5A 3AU8A 3OFSA 4ND4A 1PL7A 4RPGA 2G17A 4ESOA 2DPGA 3V1UA 3AI2A 4IY1A 4FIZA 3VH2A 3AOGA 4J4HA 4UUNA 2DPHA 2VHYA 4P4LA 4LVCA 4Y6PA 1LJ8A 4FFNA 3PJGA 1ZVMA 1TA4A 5EESA 1NFFA 1UDBA 2DT5A 4D46A 4GLOA 3VPGA 3GUYA 5G0TA 4YPOA 4HBGA 1X14A 4UUMA 4HY3A 3VPHA 2QW8A 1BW9A 4O6VA 4RVHA 2FY8A 3KVOA 3OBBA 4MDHA 3BHIA 3DL2A 4TKLA 3GEGA 9LDTA 3H9GA 1KEWA 4MVJH 5JO0A 4YACA 4DC0A 3S2FA 4CM9A 4YRDA 5DCWA 5I7VA 3RJ9A 5A1TA 2YDXA 5THQA 2V6FA 4AJPA 2D1YA 3WYCA 1A9ZA 4CUZA 4PG5A 4FS3A 3VH4A 4XQEA 4H16A 1GTMA 4E5YA 1JDJA 4MJLA 1X7HA 3U4HA 1NFQA 1ZEMA 4CQLB 1M66A 1BSVA 1H6CA 1N1EA 1LQUA 1YWGO 4ZHSA 2G82A 3ZU2A 3GFGA 2I5PO 1R37A 2J5RA 2OGUA 1ISHA 1PU2A 4KZPA 3V2HA 1VI2A 1VLLA 3A06A 4NK4A 4DBVO 5BSGA 2DVMA 3OQBA 1W6UA 1M6HA 1PEDA 4IJUA 1XA0A 2C54A 4MP3A 5TS3A 2NM0A 1E5QA 4FJ1A 5AVOA 1P3DA 2C20A 1YS4A 2Z1NA 2JAHA 4IS3A 1B2LA 1FF9A 5K9ZA 1E6WA 2P4HX 4RPLA 4L8VA 2W98A 1U4OA 3WLFA 4PN3A 3C7DB 1P77A 3WYEA 1ISGA 5EL0A 3A1NA 1QXSA 2AE2A 3SLKA 1BWSA 3V1TC 4D0RA 5AOVA 4OAQA 1ADGA 3E1KA 3FBTA 4E2XA 1PWZA 5A03A 1MG0A 1U3TA 3H4VA 1XLTA 2VOEA 1HT0A 1YE3A 5CEJA 4M87A 4OGWA 1ZIDA 4DXHA 4ND3A 1SAYA 4FQ8A 4HFNA 4ZVVA 4AJIA 1U1IA 3GNTA 2P9EA 2Z1MA 3D64A 3WWYA 1HE4A 5BSFA 1LDGA 4XJTA 3RSHA 4F3YA 3DZIA 4AJ4A 1P74A 4B4UA 5AYVA 3H5AA 1GFSA 3CMMA 4Z3DA 4AVYA 5C5IA 1PZFA 1YRLA 4NIMA 2IZ0A 1F06A 5JDIA 4II3A 3ZU4A 4FFOA 1GL3A 2ZYAA 1E3JA 3WGIA 4PLFA 3G49A 4YRBA 3UICA 3MJCA 4DGSA 3E6AA 5ENVA 3IUPA 2I99A 1BHSA 1N92A 2LDXA 3O4RA 1Z74A 5TIIA 5F1KA 3GRPA 1NAIA 3JQGA 5C7IO 1DBVO 3GGGA 4TRMA 3RKUA 1PR9A 4KQXA 3CEAA 1DAOA 2OP0A 2AXQA 1IY8A 3E9QA 4GMFA 4XGIA 1EVYA 3I9JA 2HMTA 4RJTA 4AJLA 3IP1A 4YRAA 2OBYA 3BMNB 2BFMA 2VWGA 3IS3A 3GLQA 5AXCA 3AM3A 3IOYA 3ZWBA 4CL3A 4YT4A 1WZEA 3Q6IA 3ZDFA 4NH4A 5KVSA 4HNHA 4CMHA 1NPYA 3I3OA 4XWYA 1N9GA 3TL2A 3E48A 1NR7A 4OXYA 2X0IA 3F5SA 5G0UA 3Q3CA 1IPFA 2HQ1A 5IDWA 5ILOA 1P31A 2EF1A 3U3XA 4INAA 4RGBA 2AEJA 3GQVA 4IDGA 3Q1LA 3C7AA 1T2EA 1BVUA 4RQUA 4WEQA 4XIJA 3GZNB 3PYLA 2X5JO 3TZ6A 2Z5LA 5CFZA 2DBZA 3FRJA 3KBOA 3BTOA 3PHIA 4PZDA 2I3AA 2AW5A 3C85A 4FOOA 4RF5A 4Z0PA 3TOXA 4D3FA 4PG4A 1NP3A 3TQHA 1BXGA 3S2GA 5I7FA 3KHUA 1NTOA 1AUPA 3G1UA 3UCFA 1R16A 4A10A 3F47A 3WDSA 1B14A 1MP0A 2OO5A 1ONPA 2YQ4A 3T7CA 4BO6A 1B16A 3B6ZA 1Y8QB 1LSJA 1A7KA 3NTQA 2PNFA 4MIOA 1Q7CA 3UW3A 3LQFA 4CL8A 3PIDA 1AGNA 3H7AA 2Y99A 1EVZA 3BZUA 3JQAD 4YBZA 3QW2A 1K0UA 4YJHB 4F45A 2ZB7A 3ZV3A 3JQ9C 4BO9A 3FTPA 4EJ0A 5JYDA 3JQ8B 1DLJA 1HE3A 1HLDA 1QV7A 1Z7BA 2IEDA 4ZQEA 1IE3A 4PLCA 1D1TA 1NAHA 4RORA 2E6UX 1XYGA 1GY8A 2X1HA 3DTTA 2BH9A 4ND1A 2FR1A 2I3GA 1AXGA 3JD3A 3INRA 3DBLA 3GN1A 4MVJP 3WNVA 1QMGA 5KVVA 3BMQA 3DZBA 1KS9A 2ZJ1A 4UREA 5AXDA 2ZATA 1Z75A 4K28A 4YJGA 2NU9A 1ZMOA 4XEHA 3GH3A 1KEVA 3GK3A 2W2LD 3RKRA 4OO3A 3TZQA 4XQGA 1LXCA 3ZGYA 5A9RA 2VCYA 5HS6A 1EE2A 2J5QA 1LEHA 2NU8A 2VUTA 3G3EA 4JCOA 4DTIA 3Q0EA 1ZJYA 4BO1A 1JWAB 3VH3A 2ZB8A 4RVUA 1EVIA 3KV3O 2IODA 3EAGA 3KO8A 2OL4A 4JBHA 3KYCA 4DBZA 5A06A 4DRYA 2D59A 3PDJA 4PG7A 3RBXA 5FEUA 4MKXA 5B37A 1TVEA 3DHEA 2GDZA 4QX6A 4TVOA 3FR8A 4R69A 1T25A 2LDBA 4WJZA 2OXIA 1EQ2A 2B83A 3G0OA 2QHXA 1P33A 2VZ8A 4I08A 4AFNA 4FFPA 4YTEA 1A72A 1ZCJA 2VYVA 4NK5A 2VTEA 3NX4A 1FXSA 4PLGA 1Z73A 4BKUA 3PTZA 2RH8A 4GQAA 3SJ7A 3W1VA 4FC7A 1J0XO 2HAEA 1N8KA 2OOSA 2AA3A 5KOIA 1I24A 2FPGA 5BSEA 1YBAA 3LT2A 4MP6A 1N2SA 2O3QA 1PR3A 1AN9A 1EUDA 2XXBA 1MB4A 2XOXA 1GUYA 1RM5A 3PVZA 3EHEA 5JDCC 2PH5A 1UAYA 2VYNA 2C7GA 3RC7A 4YYZA 2HRBA 2C2YA 2JD1A 4UEKA 1CDOA 1GV1A 2Y05A 3GY0A 5U9CA 2Q99A 4MOWA 3K31A 4TQGA 2BD0A 3CZMA 1DXYA 3CMCO 4OSOA 4G2NA 1KEPA 2V6MA 2YJZA 4A0SA 2QRJA 1HYEA 3GPIA 3ROMA 5L40A 1U4SA 2TMGA 3RUFA 4B79A 1FDUA 4WLEA 2DM6A 3GMSA 2PA3A 2FRDA 3DBRB 1NPDA 3E5MA 1KVQA 4BNJA 4ZICA 4BL5A 5HTOA 2ZJ0A 1KERA 4XCVA 5EJ2A 1ZXLA 3QVTA 1PJ4A 2DBQA 5A5EA 4HUJA 4A5OA 2VQ3A 1C1DA 1D8AA 3VC7A 3KYDA 4CUKA 4E12A 1CEQA 2AEMA 3QHAA 3D4NA 4WECA 2PGJA 1ZK0A 4RVDA 4B3HA 4WGGA 2PZKA 2BELA 4CM4A 1TEHA 3D5TA 1QORA 2Q46A 3MTGA 2B4RO 4I9NA 1Q7BA 3AI3A 3HSKA 3JYPA 3AWDA 2PZJA 3VZSA 4OIMA 5MDHA 5DN9A 2FZWA 4ALMA 1E7YA 2GZ2A 3FNHA 2HJSA 4NMHA 5I7SA 1X0VA 2X0RA 4NBWA 4E31A 4DREA 1T2DA 5EN4A 1HSZA 3HWRA 4I8XA 3FNEA 4CV2A 5ES3A 4TRJA 1CWUA 1GQQA 3MJTA 1P9LA 4Z0HO 4J6FA 3JQCA 2NVBA 3K8ZA 1XWFA 3H2ZA 2B37A 4WCDA 3L4BC 1HDGO 5HWSA 2NACA 5DT9A 1BTOA 1M75A 1Y8RA 3KRTA 3KEOA 4E5NA 2Q50A 1MUUA 3WTBA 1MFPA 1G0NA 5JS6A 3DO5A 3U09A 1QLHA 4JQCA 2OORA 1V3TA 4XA8A 1AXEA 2VN8A 2R00C 5HA5A 3ZWWA 5LDHA 3ZHZA 4NDNE 1KYQA 1KC3A 1LI4A 3NRCA 4QO8A 1U3VA 2RH4A 3DONA 3ZZNA 2BGKA 1IUKA 4UAGA 4DLAA 3ETGA 2CDBA 3R3JA 1PGNA 5I9LA 1LLDA 3AU9A 4XYGA 1YDEA 2CF5A 5FF9A 4LSMA 1QYVA 5G2OA 1X7GA 2WD7B 1KVSA 1W8DA 3WIEA 1R12A 4NBUA 4PLVA 2WDZA 3F4LA 2P91A 4GAEA 3A9WA 4IZHA 1V3VA 3ZWYA 3I4CA 4J90A 1D7OA 1GYQA 2EHDA 2Y1EA 2ZKLA 4Z9FA 3WX0A 4L74A 1XU9A 5L3ZA 1HETA 2VWPA 4YAGA 3SX2A 1QG6A 4JN6B 2GD1O 1HDRA 1JTVA 3OICA 4P4GA 3LT0A 2P68A 1JKJA 2Y67A 4M86A 3V8BA 4EZBA 3KSZO 5DBFA 2WE8A 4QQRA 5G4LA 1SCUA 1T1RA 2V7PA 3O26A 2FMUA 1E7WA 3UFXA 3ITDA 4Z9XA 4YJDA 3DMTA 5JLAA 2PZMA 2DUWA 3GEMA 1H94A 1C14A 3IDSA 1PWXA 4ONEA 5FWNA 4A27A 4DQXA 1JLLA 2XXJA 4ZN6A 1Q1NA 4GWGA 5TX7A 4Q3AA 2VTDA 1NWCA 1NFRA 3L4SO 4K6FA 3SVTA 4HXYA 2QQ5A 4E2YA 3ASUA 3WJ7A 1YJQA 3EVTA 3PQDA 2NADA 3QVSA 3DHYA 4IBOA 1V6AA 2HUNA 5THKA 3LLVA 1DIRA 2NU7A 3AOEC 2YHUA 3UCEA 3NAQA 1LDMA 2EJVA 5EQFA 4EYEA 2RBEA 5BSHA 4N7RA 1EUCA 4J0FA 2ZYDA 1CRWG 3EDMA 3RUIA 3OA2A 4EW6A 3K96A 1HYGA 4HNGA 4A7PA 3H2SA 4AJ1A 3WGQA 4NJMA 3KB6A 4IDDA 4GI2A 4J16A 1YVEI 4E5MA 4N54A 5U1PA 4A26A 5IZCC 1EDZA 2PH3A 1E3LA 1Y6JA 3GRKA 2AQIA 1E7RA 3B70A 1DIBA 3JQ7B 4OHUA 2DLDA 3NKLA 3W4IA 1R4NA 5L7YA 4CMIA 3QWIA 3INGA 1PQUA 3UVEA 5DF1A 4CV0A 4J2OA 5J23A 4FDAA 3RUHA 1OFGA 4J49A 4BGUA 1E1KA 4YAIA 2P9CA 3DQPA 2DBVO 4CV1A 3OHSX 1Y81A 5A04A 5B12A 1VSUA 1XEAA 1PQWA 2B4QA 2C82A 1UXKA 4WE3A 3ZHBA 4WPGA 3K9QO 3ZHYA 2GASA 3OM9A 2EG9A 3ONFA 4ZJUA 1A71A 5I9MA 2O50A 3PHLA 1ZK2A 2D5CA 1VM6A 2IZ1A 1EVJA 4Q3EA 1DO8A 2HMVA 1XG5A 1DSSG 3GA0A 2P4QA 2BGLA 2D8AA 4BO0A 2X5OA 2VZ9A 1LLCA 5TRTA 3WMXA 3FR7A 4ND5A 1F12A 1DPGA 1C1XB 4ZU3A 3ZNQA 4HP8A 5B4VA 2ZB4A 3GNSA 1BDMA 5L53A 1Q7GA 1BVRA 2TMDA 3QP9A 1DRWA 2OZPA 2I66A 4CJXA 3CUKA 1IOLA 3PRJA 3DZFA 4MVJF 2CZCA 4MVJE 4UULA 4WCFB 2EEZA 1P45A 5TF4A 2JCXA 4BKPA 4PG6A 3NGLA 9LDBA 3GMDA 1MA0A 2O2SA 3HB4X 1S6YA 1P0CA 1PZEA 2X6TA 2C59A 1VKNA 3O8QB 1GPJA 3ANLA 3PHGA 4DYVA 5DOZA 1WVGA 4BGVA 1JN0A 4IUYA 1VC2A 3WQRA 2VWHA 3TL3A 4TROA 4WLVA 4ALLA 2O48X 1QRRA 4M54A 3MJVA 1R15A 2YHIB 1WW8A 4AJHA 3F1KA 2ZTVA 2GO1A 3VDQA 3C1OA 5T8KA 3GVCA 4TVBA 2W2LA 4RPHA 2HLPA 5IAAA 4CPDA 1YL7A 3HUDA 1BXKA 3GG2A 4GX2A 3AI1A 4BNLA 1DIAA 1HDZA 1Z6ZA 4ROSA 4XIYA 3OA0A 2DC1A 5KKAA 5FYDA 2X9GA 1H5QA 1KC1A 4L73A 1Q0LA 4JXKA 1L1FA 3QSGA 4QTZA 5CDUA 4EGFA 4R1SA 4RV9A 3VZQA 4HADA 3QE3A 3WNQA 5I9NA 3HJAA 4IGFA 1J49A 1LQTA 4OH1A 4XB1A 3EW7A 4W9NA 1ZKMA 5T6BA 1ZJZA 2NVUB 4J0EA 3PLNA 3U4CA 3ENNA 4F6LA 5TC4A 3WTCA 4DIBA 2VHVA 3C3XA 4MKRA 2UUOA 4L4SA 3VZPA 3ZWAA 1I3NA 2E48A 5CDTA 3K6JA 1P1RA 2G0TA 5BQFA 2DTXA 4KTTE 3HB5X 3MJSA 5GZ1A 5KCZA 4WUVA 2DU8A 4II2A 4KWIA 4RF3A 1ZH8A 4PVDA 3U0BA 3V2GA 1QYWA 2A94A 4JJFA 3WXBA 1KVTA 1D3AA 4NPCA 4CM3A 5H83A 5L95A 4J43A 3JD4A 3JD1A 4JP2A 1TXGA 2VT3A 4YJFB 3HHPA 3P7MA 4NU6A 5A4DA 3AFNA 1HE2A 2X0NA 5KWEA 1FDSA 1J6UA 4FJ2A 1V3UA 2UUPA 4QECA 3M1LA 1G1AA 1HDYA 1CIVA 5ITWA 3WGGA 2AG8A 2B36A 4S1VA 4C7JA 5HS4A 5KJEA 4BNVA 3GZ4A 3HG7A 3TWOA 3ZWOA 4J9UE 4OM8A 5L7WA 4GGOA 1O95A 2C7VA 2H63A 2BMAA 3W4KA 5HBRA 4ILKA 2QX7A 1DEHA 2J3HA 4PLZA 4MIEA 1YGYA 4U0JA 3F5QA 4J1NA 2AMFA 3DBHB 4LN1A 4WLOA 2EGGA 3PFWO 3UAGA 5I7EA 2O7SA 1IB6A 1ARZA 3A14A 3D3WB 5IJZA 4B3JA 3D7LA 4L9RA 5AQ1A 1VRWA 5JBIA 1B8VA 4PRKA 2WYUA 1PL6A 3NV9A 4CM8B 4BUCA 1GCUA 1ZZEA 1GUZA 1Z82A 1ZK1A 2HDHA 3I9MA 3QWAA 1GEGA 5DBIA 4LRSB 4EEXA 3QQPA 4NFYA 4O1MA 4BNHA 1EK6A 4FSHA 4EJMA 5FI3A 1EDOA 3H6KA 1VPDA 1PJ3A 3BMOA 1YO6A 3FPCA 2FSVA 4GX5A 4QT0A 5H82A 3N7UA 4MVJM 2NVWA 2CD9A 5JCJD 3C7CB 4BHTA 2A92A 2XPCA 1GZ4A 3CZRA 1SOWA 2GCGA 1K6IA 4R01A 1BW9B 5L9AA 4R5MA 1Q0HA 1X13A 2GN8A 4KMSA 3V1YA 1A27A 3GAFA 4DIFA 3LK7A 4H15A 3JQBC 4E5PA 4E3ZA 3TSCA 3GUCA 5TLSA 5TJ9A 3EZLA 1C0IA 3VPXA 3RUDA 5ICSA 2X5KO 3BHJA 5CP8A 1ENYA 1K5HA 3HFSA 3L6DA 1DHRA 4NU5A 4AJKA 5DNAA 5I8ZA 2O23A 4EUHA 5G0VA 1Y7TA 1YQDA 4XDYA 5FI5A 2PD3A 1QP8A 2NV6A 3O9ZA 1NVMB 2CSUA 3DMYA 3PWKA 4M8SA 1JW9B 2ZB3A 3IKTA 1P1HA 3QWHA 2VUUA 4JJGA 5COQA 1V8BA 5AXAA 3GZNA 3ICCA 3DDNA 4J7CA 3DFUA 3HQ4O 4I9UA 2IYOA 4BNFA 1RM4A 5COBA 1JWBB 2BI7A 4PLTA 3WFIA 5KJCA 3IL2A 5DCYA 1ZMTA 2JKVA 3ASVA 1JAXA 1LDEA 1RJWA 5A05A 3PWSA 3W6UA 2NQ8A 3BMCA 3KM0A 3L0DA 1KETA 2Y1FA 5T67A 2ZTMA 4UUPA 5JCXA 1Y8QA 1UXIA 5GZ6A 4WLFA 5DP2A 1J5PA 1WWKA 2J3KA 1T1SA 1F8FA 1HSOA 3E03A 1VKOA 2O3SA 3GDFA 3HDHA 3I4FA 2BI8A 2WYWA 2ZYGA 4ALIA 2DAPA 2F1KA 2NU6A 4PFJA 3CPSA 2A9FA 2X4GA 2D5AA 4BNMA 1RYDA 5KJFA 3H9QA 1G6KA 3NT5A 4XB2A 5JMPA 5H81A 1PS9A 3TPCA 3DFZA 1QV6A 2A4KA 4GLLA 1D4FA 1ZFNA 2WM3A 1KEUA 1N7HA 1ENZA 1XDWA 5TQVA 3VDRA 1HEUA 2OBNA 1LRKA 4I5GA 1F8GA 3EY4A 1JKFA 4B4WA 1T2FA 4FD3A 3WGZA 4WOJA 3ZWPA 4A73A 1E3WA 2Y66A 3CE6A 4Z9YA 3U9LA 1QR6A 2EKLA 3U5TA 3JQEA 3GDOA 3JQGB 1XSEA 1L7DA 2D4AA 4E2ZA 2ZCVA 3ST7A 3F3SA 4PLPA 1V0JA 4BNNA 4J1TA 5JPIA 4DQVA 2FPPA 2HSDA 4DMLA 1TT5A 4ALJA 3D0OA 3PGXA 4W7IA 2FR0A 3OMLA 1DHTA 4BGEA 3S1LA 4Y6SA 4FC6A 3F9IA 1GCOA 4MVJG 3RU7A 3IIEA 3QRWA 3DWFA 4J9VA 1EBFA 2P5UA 3ROPA 3E9MA 4RF4A 3B1KA 3KXDA 2JHFA 3PHJA 1K6JA 7MDHA 3RROA 2Q1SA 4B7XA 4WCFC 8ADHA 5KNLA 1N9GB 3UH1A 1VE9A 2YW9A 1YOVB 4PZCA 4M55A 1DC3A 3RVDA 1A5ZA 3V5NA 5G4KA 3G79A 1B8UA 2PKQP 5DOVA 3TOZA 4JGBA 4D44A 1NVTA 1ONOA 1U3WA 3RQSA 5K6AC 2V6GA 2B69A 5TT1A 2QYTA 1C0KA 1HE5A 1ZNQO 4YAEA 1NHGA 3RC2A 4AJJA 3GN2A 5GZ3A 4QXMA 1LSUA 2ET6A 5ITVA 1BXGB 3Q11A 2JD2A 3OJEA 2O3UA 5AXBA 1SEVA 1ENPA 3RWBA 1O8CA 1EZ4A 4GX0A 4IMPA 2NLOA 4BMNA 4OOFA 4DL9A 3L6EA 4IJVA 4XGKA 5JW6A 4JBIA 3OIGA 4IDEA 4FBGA 3PZBA 1R4MA 2B0JA 1E6UA 4OKIA 3DBRA 1M6WA 5T5QA 2WYVA 2I9PA 4R16A 2HK7A 3N74A 2B35A 3I9KA 2QYSA 5JAQA 4DVJA 2BKAA 3L9XA 5L45A 2H1SA 4CLOA 5EQDA 3ZN2A 1O9BA 3D5QA 2VHWA 3ZWNA 5KJ1A 5G0WA 4Z0TA 2EJWA 4XD2A 4PZEA 4BV9A 3KYBA 4BB6A 3GT0A 3MZ0A 5A3JA 5IF3A 3DBLB 4PIVA 4J91A 3VZRA 5CAEA 3ABIA 3QA9A 5DDIP 1Y9EA 4JROA 4PG8A 1A9YA 1SEPA 1JVBA 2GF2A 4W6ZA 5JAIA 3W8FA 2PY6A 1Q2XA 4URFA 4YJGB 1GQYA 4UUOA 3T4EA 5L4NA 4YAKA 1SBYA 2Y1GA 2YFHA 3PLRA 3F1LA 4BO4A 1WP4A 3RASA 3TZCA 2Y1OA 4NBTA 4NG5A 3G1TA 3VHRA 1I10A 2QG4A 4XYLA 1QSGA 3IQDB 3SXPA 1QLJA 1RM3A 4MIYA 2VRCA 6ADHA 3PJFA 4CM5A 3KYCB 4GKBA 5HM8A 3DOCA 3UUWA 1XR3A 2J5KA 3O03A 3EVNA 1EFKA 3RFTA 1NX6A 3K2EA 3GAZA 2EERA 3UOGA 1WMAA 1UH5A 4KUHA 2W2KA 2YUTA 4XRRA 4J4BA 4HV4A 1PTJA 3NGXA 4BKOA 2GYYA 2PGLA 3Q9NA 4CM9D 2E4AA 1I30A 4DPKA 5BNTA 2HCTA 3RCBA 4ZGWA 4WLUA 5TGDA 1E1MA 3ROQA 4RL6A 3TN7A 4JK3A 3TDKA 4YA6A 1DIHA 3N58A 4WK6A 4RLSA 4U0KA 4QUKA 1K3TA 4HWKA 1HDCA 4R5HA 2GN6A 3OECA 4HFJA 3ETEA 4CMEC 3BHMA 5JAMA 3C1TA 4PLYA 3SJUA 4OOEA 1HLPA 5JNLA 3VH1A 5KTKA 2O4CA 4WASA 4E21A 4FGWA 4J7UA 3K73O 2HMSA 3GG9A 1T4DA 1UZMA 1X1TA 2GRAA 1GR0A 3RAJA 3A28A 3BTSA 4L0QA 3CKYA 4E4YA 2NUAA 3VTFA 2ZK7A 3IP3A 4BMVA 3RFVA 5B4TA 1NHWA 4BNGA 2YV1A 3JQDA 4GPD1 3HZZA 3M1AA 4BQPA 4B7UA 1JKIA 4XZ3A 5IXSA 1KOLA 4UVDA 4CLHA 5KVCA 4UEOA 5TJHA 4CR6A 1EMDA 4J1QA 4XX0A 4ZQHA 3VPSA 3CH6A 1E3IA 4EI2A 3SC6A 3ADPA 1DC5A 3PI7A 3HDYA 4O63O 1SZJG 4GVLA 1DDOA 5IFLA 1PX0A 4UVHA 3TNLA 3QWBA 1SB8A 2E37A 3LVFO 3NDIA 1SNYA 2X0JA 4NFSA 2I6TA 4XDZA 1RM0A 3ROKA 1SMKA 4IIVA 3WBFA 4BNUA 3H5NA 4CM4B 4D79A 4E6PA 3E8XA 4HFRA 4LMPA 4EJ6A 1NBOA 1P1JA 1PGJA 2PV7A 3OH8A 4OSPA 3CTMA 3NJ8A 5B1YA 5ER6A 1MFZA 3CIFA 1WDMA 4BV8A 2JCYA 3EUWA 2D3TA 1DJQA 2IXAA 3DTYA 1E6EA 3H9EO 1DIGA 3MOGA 3JQFC 4LCJA 3ZWCA 3NUGA 3Q2KA 2G5CA 2WMDA 3AUUA 4CR7A 2QZZA 4D3DA 3HNPA 2PD4A 3IUSA 4CM6A 3HADA 2V6BA 3KLMX 4F6CA 1XCBA 1LA2A 2UYYA 1Q0QA 5A9TA 2OUIA 3U62A 2Y0DA 4L4RA 1Y8RB 3WB9A 2PKRA 3RUCA 4TWRA 4GMGA 4RZHA 3WJAA 3E18A 2GN9A 3DEYX 1UZLA 3WQSB 1B26A 5BNFA 1WNTA 5CPBA 4QFDA 1DAPA 3WG9A 2I76A 2X7HA 3RFXA 1W73A 1UUFA 3HDJA 4CQMB 1DFGA 1YB4A 3GNQA 3PFFA 1T2CA 2W90A 5IDXA 4DWVA 4E13A 1RPNA 4O0LA 2XAAA 1V9LA 3ITKA 2PGDA 4FOSA 1UR5A 2NTNA 4WEOA 4UVEA 5FFFA 4BO8A 4A2CA 2FSSA 4KQWA 4PRLA 1HTBA 3WOHA 3TFOA 5CDGA 1I2ZA 3L07A 1YQGA 4U8GA 3KOUA 1I2CA 5G0SA 1I2BA 5EINA 1K6XA 4Q3CA 2D2IA 1MV8A 5JDIC 5IDQA 1MG5A 2CVOA 1GAEO 2YZ7A 4H3VA 4FW8A 5HRUA 1YQXA 3JQ9A 3HDQA 2ZTUA 2GERA 2EV9A 3JYOA 1AE1A 3WSWA 4IGEA 3S55A 2EGHA 4M89A 2Y68A 4CLRA 4IZIA 4C4OA 2I65A 5JYEA 3KEQA 3WGTA 1XHLA 2BFPA 3I52A 3GPDG 3T7EA 1U5AA 1FDWA 3PQFA 2IE0A 3SBOA 2Q1UA 2POQX 3PHHA 1LDBA 3M6IA 3KLPX 5F1OA 1BXZA 1H2HA 1T4BA 2G1UA 2EP7A 1WDKA 2X23A 3ANMA 3JTMA 2J3IA 1NQ5A 1EE9A 5C37A 3NTRA 4CMGA 4R51A 1RKXA 4AJOA 1B7GO 4P4NA 3JV7A 3ZWMA 4IDBA 4JIGA 4CM1A 3OP4A 4MVJI 2WWRA 4BNKA 1UP4A 2EKPA 4Q39A 3LDHA 3WS7A 1JQBA 3IJRA 1FJHA 4ND2A 4WNIA 1MC4A 1NQOA 1LNQA 3I9LA 3MCVA 1ZXBA 1U28A 4LISA 4BB5A 4BO5A 1HKUA 4FFRA 2YHIA 3G17A 3ZWVA 1E0DA 2P9GA 3EMKA 1GU7A 2YFQA 5IDYA 1KY5A 3QLJA 2NTVA 1Y1PA 2C2XA 3QVXA 4E2WA 2QRKA 1UDAA 4CMAA 3GDGA 2HKIA 3LT4A 4J2HA 4D42A 1OC2A 1YJ8A 4HKTA 2Y0EA 2FWMX 3E82A 1X7DA 4NJMB 4R68A 3UN1A 1ISJA 2DFDA 3IC5A 3M2PA 3C8MA 2AQKA 3JQAA 1N7GA 1PL8A 1VJ1A 2VYVD 4RLHA 1ISMA 1G0OA 3TRIA 3BAZA 4E32A 5EERA 4NBRA 3ZW8A 3EC7A 1R4NB 1U3UA 1H6BA 3H8VA 4CMIB 2GR9A 4BNTA 1Y5MA 1JVSA 4EEZA 3DAFA 3E9NA 1LSSA 1ADCA 1ULSA 2BF7A 1U8FO 5JDCA 3ZNNA 1Y5RA 2Q2WA 4FFLA 4JX8A 3S2IA 2PWZA 4GWKA 4CM7A 1NXQA 1I3MA 2EP5A 5ADHA 4OJNA 1OC4A 4G81A 1H9AA 5LDGA 5A02A 4YT5A 2C5EA 4PVCA 3ZU5A 2AE1A 4DMMA 3EK2A 4XR4A 4IJWA 1QYDA 4GVXA 1ZO8A 1O6ZA 4HX5A 4D41A 3NT4A 1GYPA 4YAJA 2Q1TA 4X54A 4AICA 2AQHA 1KBZA 2RHCA 1XQ1A 3AK4A 4IPTA 4FB5A 3B20A 4TSKA 2B5VA 4LW8A 4DLBA 1JAYA 4BOYA 4RO0A 4D3SA 1MXHA 2X8LA 4P38A 1C0PA 1YDWA 1GZ6A 3DAPA 3PZRA 3ZNOA 5CDSA 3P5SA 1LRLA 3WR5A 1T2AA 1CERA 3VOSA 3ZHXA 2BFOA 5KJ6A 2VWQA 4KUEA 2HMWA 3AM5A 3I9NA 4CODB 3H3FA 2X9NA 1LC0A 1ZW1A 4R1UA 4Y67A 5GY7A 3TZKA 3ZNPA 3OQ1A 4EUFA 1SC6A 3MWEB 3NDJA 3U4DA 1FMCA 1NASA 1EFLA 4KTVE 3JD2A 1QKIA 3DXFA 4BO7A 4J7XA 3NT2A 1XQ6A 3K92A 1H9BA 4FFMA 1CF2O 5A9SB 2EWMA 4CQLA 4IQ8A 4TRNA 3B1FA 3FWZA 1YXMA 2RCYA 3OJ0A 2YY7A 4N5LA 2RHRA 2GZ3A 3DAGA 1E77A 4WKGA 1SOVA 4FJ0A 5TNXA 2HU2A 3L4BA 4DYDA 5BR7A 5GMOA 2A35A 1WDLA 4R3NA 1AHHA 4GSLA 3FI9A 3NYWA 1I33A 3C24A 3D4OA 1HZJA 3K2BA 3OIFA 4XYMA 2BGMA 2P5YA 1ZSVA 4I1IA 4XYEA 2PD6A 1S7CA 4MO2A 2R2GA 2PKQO 1TI7A 1I3KA 2R00A 4BS9A 4IDFA 4NNJA 5CG2A 2O3RA 3ZV6A 1GD1O 3AM4A 3WBBA 1ZK3A 3DZJA 2Q45A 3JD0A 1U7HA 3ZU3A 1H0KA 2X22A 1XGKA 4CQMD 4ZD6A 1OI7A 4N5MA 1BG6A 1VSVA 3BYZA 1U2GA 5IXYA 2JCVA 1LLQA 1HWYA 5JAZA 5IN5A 1A4IA 1B8PA 4IS2A 1HDXA 4BGIA 3EGOA 4AJEA 2VNSA 1TB4A 4O5OA 2CFCA 7ADHA 2AEFA 2AQ8A 3ADOA 3AY6A 3PK0A 1ID1A 5DBGA 4FPXA 2JFFA 4RPKA 3ZV4A 4YT8A 4MVJD 1NR1A 2VT2A 3OQ6A 4BNWA 4RPJA 4K6CA 6LDHA 3ZI0A 1T26A 3AY3A 4B3IA 3JQFA 1ML3A 4I5DA 5A3VA 2WD8A 2Q4BA 1PJTA 3D1LA 1Z45A 1PIWA 2PLAA 3W4JA 2CDAA 1ISIA 4BQRA 4NZ9A 1O94A 2VZ0A 1XELA 2B4TO 2FN7A 3GEDA 5JC8A 1VL6A 3H3JA 4ZQFA 3RC9A 3IJPA 4EITA 2FP4A 4PCVA 4TMFA 1GQ2A 1P44A 1EUZA 3U4IA 5JE8A 1U2DA 2EW8A 1E5LA 3I83A 4FR5A 1DFIA 3BMNA 1YB5A 1E7QA 1NQTA 3IMFA 1GV0A 4QFCA 4NBVA 4DA9A 3UGKA 1EK5A 2RAFA 4G5HA 2PK3A 3FWNA 1TT7A 4GKVA 2OFPA 4ID9A 2JL1A 4OMUA 3KUXA 1H93A 1C3VA 3PWZA 3S2EA 1H6AA 3EYWA 1UDCA 3R6DA 4D0SA 3ORFA 2VRBA 1IHYA 3DZKA 3LT1A 4RDHA 3GVPA 1X15A 2YV3A 3TFQA 4BNZA 4M49A 2FZEA 4BIIA 4I9HA 3A4VA 4BO2A 3AOEA 4ALKA 3RUAA 2BLLA 3T4XA 3VPFA 4B4OA 2R6JA 3QIVA 5JFOA 1HXHA 2B5WA 1PS8A 3QVOA 1U9JA 3GVXA 5JXWA 4OYRA 4RDIA 1B3RA 4DLLA 4BO3A 4JNKA 4BNXA 5EMHA 4KDFA 4CV3A 3BMOB 1PS0A 1UXJA 5IZCA 2H6EA 1D1SA 1WMBA 4ZQBA 4Y8VA 1LU9A 3GOHA 2X58A 1CQIA 4ZRMA 1P0FA 3ENKA 3LC2O 4YJHA 4Q3NA 3MEQA 4RCVA 2Y1DA 1LC3A 3Q9UA 4ZA2A 3GGOA 2VOJA 3GFBA 3DZHA 3JQ8A 5L4LA 1B0AA 2Q2QA 5DZSA 1NVGA 4XRGA 3MWDB 1OMOA 2IDZA 4R1NA 1HDOA 1I3LA 3OEWA 2Q2VA 4U6QA 1H6DA 2IXBA 3GVIA 3PYXA 4CMKA 4JJIA 3DMTC 1ZUD1 4LRTB 1FDTA 1DFHA 2PZLA 2PTGA 1XIVA 2OHXA 4F46A 2NSDA 3COSA 1A7AA 1PJ2A 4KDEA 3PGJA 3DBVO 4ALNA 3DZGA 1PGQA 1LX6A 3UXYA 3LF1A 5F21A 5JO9A 1YOVA 3X2FA 4L75A 3OEYA 3GVHA 4KP7A 1V35A 1NPTO 3PXXA 3OIDA 2GUGA 2DFVA 3QV1A 2CNBA 3P2OA 4W82A 4D45A 4XJSA 3AW9A 1GADO 1FK8A 1LDNA 1E7MA 1OZAA 4B7CA 4U7WA 3RJ5A 4A03A 2I67A 4RF2A 4CR8A 1YKFA 2C07A 4J1SA 2YYYA 3LF2A 1K89A 3BMCB 4E5KA 4FN4A 3WICA 4JP3A 1B3BA 4RQTA 3KETA 3UF0A 3AUAA 1PQPA 3R0IA 3WGHA 4QO7A 1HZZA 2CVZA 4OXKA 1SO8A 3I6QA 3NTOA 5DCUA 1DC6A 3CINA 5EIOA 3WWZA 5K0ZA 4TKMA 3KSUA 1UZNA 2YDYA 2YQ5A 3WMWA 1IYZA 1GPDG 2O4UX 5LCXA 4YXFA 4GGPA 3VVBA 4D43A 1DRUA 2EKQA 4R3WA 3IAHA 3IKVA 3QVWA 4AJNA 2HK8A 4EBFA 3OJFA 2HRZA 5DULA 3LC7O 2DKNA 4YDRA 1KVRA 3D3EA 1I5RA 2ZQYA 3C1AA 3I23A 4YWJA 3AJRA 4I5FA 3UKOA 1E3WB 1VJTA 5LC1A 1GYRA 1E92A 4UEJA 1WXDA 3DOOA 4DIOA 2WTBA 3FNGA 4YQYA 3WLEA 2Y0CA 1RWBA 2Q49A 1LSOA 4E0BA 3HFGA 2CVQA 1ZBQA 4EUEA 2D0IA 2ZQZA 4XR9A 5CDYA 3V2UA 3W8EA 1KY4A 3VKUA 2OMEA 1TT5B 2SCUA 3GR6A 2V65A 4IQ0A 3UCXA 5CEFA 1U7TA 3BTUA 1ZSNA 2HMUA 1DC4A 1BDBA 5KVQA 3AUTA 3WSVA 1M2WA 1XKQA 3L6OO 5U4QA 1I36A 1PZGA 1PJCA 4NR0A 5ENDA 3W8DA 4P22A 1WLYA 1UJMA 3BMQB 4HFMA 3ZV5A 1YL6A 3OETA 5CHEA 2BHLA 3ZW9A 3FBGA 2O3TA 1HYHA 1R66A 1UP7A 2J3JA 3LSYA 3BIOA 4I5EA 3K30A 3QWFA 5G4KB 4YEDA 4XKJA 2C29D 2UV8A 5BNIA 4CMBA 1F17A 4Y6RA 2PR2A 2JFGA 1P1IA 3PDUA 4TZKA 4LCEA 4XGNA 3P19A 4B8ZA 5CEEA 1TLTA 4W7HA 4MPDA 3WYBA 1L7EA 5MGBA 2CY0A 4S3MA 2AG5A 5T8KC 1IL0A 2FHSA 2OP1A 1KVUA 1ISFA 1HF3A 2HO5A 3PYMA 4GBJA 5TSDA 1P1KA 4DUPA 2ILTA 1OAAA 5F5LA 3RI3A 2Z95A 3STHA 3MOIA 3FCOA 3OSUA 4YB8A 1R4MB 1OOEA 3LU1A 5B4UA 3LLSA 1LBEA 2EIHA 1QYCA 3LC1O 1PJSA 4IXTA 1IZ9A 3FSRA 4NHEA 2WJPA 4B8WA 1X1EA
chains in the Genus database with same CATH superfamily
3SQLA 1YAHA 4NBKA 3NBMA 3SCZA 1YU9A 4KFCA 4N0BA 4HQRA 1UXHA 1GARA 3NNNA 2M87A 3UATA 3BIFA 2WTEA 1DB3A 5AKLA 2VJ4A 2FMLA 4YMHA 4HQFA 1QIHA 1ZIPA 5IXJA 3WU1B 5K45A 3FSGA 3E2PA 3V4GA 4D8UA 2QA4I 3S8MA 4C0JA 1M1NB 1I9CA 5HQ3B 4WKOA 1FDIA 2HK9A 3BD7A 4GI7A 1B15A 2V8BA 3DF7A 3BPVA 3GEIA 1Z8NA 2X9DA 3IQEA 3SC4A 1MX3A 4TV8B 4BNDB 2ZUDA 2IWRA 1EEHA 2NQTA 2ADMA 2C4TA 3ZGXA 4HRXA 1G9SA 1QIMA 4X61A 4ILEA 3GUDA 3IILA 1ZEJA 2BCJQ 5AOCA 1ZUNB 1VG9B 5GP1A 5EMKA 1KMMA 3M70A 1XDBA 2Q6IA 5EJEA 4X1YB 3MD0A 1XZEA 2RK4A 3QXGA 1B1CA 3P94A 1NJ1A 1YI8A 3BXEA 3FUVA 2CF6A 3K4CA 2I10A 4GGGA 4IG4A 1NZJA 3ABZA 1E1LA 3DL7A 3O84A 2Y0SN 1JLHA 1WFXA 3G8DA 2MCFA 3THWB 1AQNA 5KYGA 1KYZA 2Z6UA 4QWQA 2RIRA 3ILXA 1ZHFA 1UK7A 3I05A 4LITA 1X94A 2DEUA 3LSIA 3N2IA 3WGOA 3ESCA 3LXUX 1T24A 4M1TA 3KEYA 1BFDA 1CUAA 1HRKA 3FPSA 3D1JA 2XCTB 3SE7A 1O0SA 1M2VB 3W3AH 4OFWA 2QGNA 2ONYA 3UUEA 2O8XA 1KZ9A 4S35A 2R7LA 4M1QA 2FWIA 4GRAA 1XZBA 3ROXA 1CULC 3QFCA 2WBMA 3COJA 5HLHA 4Q7LA 1MX1A 1RJ9B 3FXMA 3AR9A 3LH5A 1QAQA 2ZAOA 3KTDA 5D7NA 4PAWA 1UOOA 1Q17A 3AHJA 5LGTA 1PNOA 5KHAA 4UHJA 2ZRIA 3Q10A 4FMDF 4MRMB 3AIMA 3C6QA 5DEIA 1A8QA 2G76A 2HJRA 1AM4D 1DOZA 4GPIB 2BSXA 4HAOA 2YJ3A 3T95A 2X9VA 4ETNA 3H3XA 4N18A 3GC6A 2Z2JA 5JY6A 2LKPA 4PWYA 5BMOA 1RLJA 3JU3A 3E5HA 4HUTA 2WILA 5GJCA 4YJKA 3D3KA 4UDXX 4L02A 1AGPA 2E7XA 1N1GA 4JNCA 1KKUA 4ND4A 2IH5A 3BDVA 2YBEA 2QJWA 2DPGA 1SD5A 1JLRA 5MHTA 3F6OA 3VNSA 4E08A 4GLOA 1PKXA 3QFSA 1VBMA 2XRYA 4QYIB 1DJMA 4K1XA 2PFSA 4AUEA 5LEJA 1BMTA 5BYJA 5TISC 2DFIA 2IPNA 4TKLA 3U44A 1ZGBA 3U7HB 4QLCU 2WIAA 1NW6A 1OFTA 5M7EA 3HM9A 3SJZA 4MCIA 4O4JA 4ZOLB 2YSRA 3L4EA 4F4UA 3TBKA 1Y6FA 3SSOA 1FYKA 3ZDAA 4XTRA 3OQBA 1W6UA 1PEDA 4MP3A 2P9BA 3S6JA 1RQLA 1EJBA 3EX7C 3N6VA 1YE9A 3USCS 2P4HX 1U4OA 1BR1A 3C7DB 1ZVVA 3AR6A 1KSJA 5EGNA 2AE2A 2ZYSA 1BWSA 2PZGA 2PG3A 5AW8A 2CU7A 4I36A 3LUJA 3MJRA 4OAZA 1SCBA 5DDGA 5C8YF 3MZHA 5I47A 1NE7A 4FEYA 4NG4A 3GNTA 5LZ7A 4YRRA 1RMQA 1KJ9A 1S7EA 4QASA 4AJ4A 5AYVA 3SSNA 1FNSA 1MX9A 3FXJA 4H6VA 4HH1A 4L2IB 3VV2A 4WZAE 3MZ8A 1T8TA 2AS0A 3EUHC 1GZ7A 1SC7A 4GMFA 3NHPA 4RJTA 3D5RC 2W2QA 2W6MA 5AXCA 2WY7Q 3AM3A 2FUEA 2DQLA 1WL8A 1NSFA 2XIJA 1PLJA 5K6TA 4XWYA 2WLSA 2QLTA 2G4CA 4ER6A 5JQGF 4INAA 1RKUA 2JGLA 4XIJA 3QYPA 5KNBH 3AESA 2Z5LA 2Q3LA 4HYTA 5C32A 3KHUA 1AF4A 4A10A 1FS6A 3PA8A 1B16A 1XZQA 1WZUA 3DB1A 1AGNA 2Y99A 2XUZA 3R8XA 3BZUA 4AIKA 4FLFA 4GMHA 3JQ9C 2YXDA 3AX6A 1HLDA 1GY8A 1DQZA 2E2JJ 3ZGYA 2Q5EA 4DILA 4BXOB 5H6QA 3G3EA 5ECDA 5HQTA 4A6PA 3UMGA 2XZTA 4RK7A 3JVIA 3KO8A 2CFIA 3MCAA 2CCKA 4LMBA 5JS1A 2D1TA 5FEUA 4BFZA 5B37A 2OA4A 5CJJA 4Q7JB 4UFPA 2I7TA 2B83A 5TARA 2PL5A 4AFNA 3BWEA 2WAAA 1MNAA 4ZKEA 5LMZA 3K0FB 3A05A 4HDSA 1J0DA 2ISYA 1JZSA 4F2WA 2CFRA 2VH1A 5KTRA 1NT4A 3WG7H 4YYZA 2DR0A 2COBA 2HRBA 4P6VF 4MKGA 3BEDA 1MB3A 4FETA 2V96A 5U9CA 3L04A 3FHOA 4DBQA 2BKLA 1U4SA 3WHLA 3IAAA 4EK9A 2YWJA 3DBRB 2DQRA 4P53A 4HX8A 2XUKA 2VQ3A 4WHMA 4B3DA 3KYDA 4CUKA 3CT6A 2AEMA 1NYLA 2ODQA 3A0BC 2JDID 3KVNA 1VG1A 3HSKA 3GARA 3KQKA 2GA1A 4X90A 3V8NA 2HPZA 1A8HA 1PUEE 1TZMA 2QYOA 4OK5A 3LWZA 4PBTA 4MRVA 3UEOA 4OXXA 4NZYA 1ZNZA 3L4BC 4RXMA 2QVXX 4C21A 1VCMA 2OORA 1V3TA 5ES4B 1CY1A 3AWIA 4WK8F 4WZ6A 4DLAA 3QU9A 3NWBA 4Y9UA 5GAHJ 2CF5A 5FF9A 1NQVA 3M5CA 4UHHA 3HA5A 3TIFA 3BTIA 5H1YA 2ORIA 2EHDA 5BPHA 2ZRJA 3KDPA 6PAXA 3D02A 4ZU1X 5IK2A 1GPAA 3N87A 2P68A 2WHQA 1T1RA 1X8KA 1TK3A 3O26A 2CFOA 4UASA 2DUWA 5FFZA 2BP7B 1C14A 1GSIA 3T1BA 2BFCB 1W48A 2J9ZB 3P0HA 1N36B 1MCZA 1H9TA 4LDNA 4Q3AA 4KMMA 1THZA 4EA6A 3QBJA 4KHZA 3JWHA 1IZYA 1CYEA 5LB4A 1OLOA 2BBSA 2J3DA 4GSYA 4EG7A 2PWBA 4JKOA 5SY9A 3FAKA 4I4NA 4BY7J 1TTTA 4IRUB 4J0DA 1Q50A 3RIEA 2ZIXA 2C0PA 3FPHA 4ZYXA 4UVBA 2Z98A 4B2LA 5E2BA 3INGA 4QREA 3B9RA 1LLFA 2J7KA 1MDBA 1HT1E 4CZCA 5J4YA 2Z1DA 1W93A 5J58A 3K9QO 4FZVA 5M5WJ 1K97A 2HIGA 4G25A 2O50A 3PHLA 1LJ9A 1DPFA 5JOQA 2HLDD 1AO0A 3LP6A 1NVVR 3K1MA 5TRTA 3X0DA 2FW0A 1S3GA 2C96A 2PIDA 2D62A 4NB5A 1ZAYA 3CLRC 2WADA 1QZEA 2I66A 3SN6A 3O8BA 1YRQA 3R6SA 3K4HA 4G0MA 1H2FA 2EEZA 3FFXA 4ZOEA 3NB0A 4DYVA 2VAPA 1JN0A 1P3JA 5K0NA 3RWMB 2CHFA 1SBZA 1F2UB 1XNGA 1WJDA 2QENA 3M4XA 4RE6A 3GEEA 4JASB 3H3VK 2HLPA 4BP3A 4XKBA 4Y7NJ 1Q84A 4YGYA 1FFHA 5B64A 1ZJJA 4YUZA 2XA1A 2FNAA 2FPLA 1G4UR 4YAOA 4OH1A 4XB1A 3AVXA 5SV2A 2DRIA 3EC1A 5IUNC 4IRIA 2BJVA 3NHSA 3LCMA 4O25A 4N47A 1RUOA 1ZH8A 3T1HB 3KTAA 3HY4A 4HZGA 4TLEA 4RKWA 2JN6A 4UATA 2D45A 1TXGA 3WLOA 4NU6A 3HLYA 5HRAA 4DCJA 1DDIA 1V3UA 1Z83A 3M1LA 2TS1A 2NNYA 2JHPA 1XZMA 1AD2A 4DMCA 4HAMA 2LIPA 3ZWOA 2IA0A 1P73A 4ILKA 4LN1A 4JI6B 1SIOA 2O54A 4N3NA 3R7BA 1DAIA 2ORWA 4A0YA 2JDIA 4NYJQ 2VBXA 2HDHA 2AKYA 4K2EA 1AU9A 2XX3A 3PFBA 1WHSA 2A92A 2X41A 4MVWA 2GCGA 2CL7X 3GAFA 4DIFA 3LK7A 1O54A 4KAXA 3RS0A 4E3ZA 5P8WA 2CJXA 3HOXJ 1C0IA 1ZVKA 4JOSA 1KO8A 3EIFA 1TCCA 1U0TA 4JJAA 4E22A 2ASEA 4LHZA 3M89A 3OU6A 2QR3A 1ZINA 4FX4A 1Z6YA 2NV6A 1M6VB 2CSUA 4W1SA 3P0RA 3VDMA 1WY5A 2DYSH 4R1OA 4EW3A 2AI2A 4NC7A 5AO9A 4BNFA 2B9EA 4C9YA 4F7DA 3O9VA 1ML4A 3B73A 5JCXA 1RWOA 1JPJA 1XS9A 1AK1A 2IV2X 4NQRA 1T1SA 3F4KA 4ALIA 4MUEA 5LRSA 3UV7A 5IS2A 5IJXA 1WRJA 2A4KA 3L6BA 1T5SA 1T56A 9ABPA 1WQ1R 4RTMA 1F8GA 5DBHX 5A2QA 2DK8A 1GZDA 1BE8A 4UXHA 3DXZA 1S96A 4LS3A 2CV0A 4O3FA 3N2GB 3UOAB 3DQQA 3BR5A 1TT5A 4TV9F 3G2BA 3PGXA 1JHQA 4L5JA 1SUBA 4PYRA 3F9IA 1OYYA 5DASA 3A3YA 4WCGA 3FNBA 4RF4A 3B1KA 3PHJA 2M98A 3OSFA 3SX4A 2IHYA 4OD0A 4D4LA 5CMLA 1B8UA 1K4MA 4JGBA 1OX4A 3V7CA 3IUJA 1ZD8A 5TT1A 2QYTA 3PFNA 2WF7A 1XSDA 5AXBA 1SEVA 2VUIB 1C8LA 2HLDA 5AKEA 3LDGA 4LRYA 5T4HA 1Q15A 4B9AA 4AY5A 5L45A 5AUQA 4CLOA 3KOOA 4LWZA 4C0QC 3E8SA 2GHQA 4KQIA 3L7WA 2Y1GA 3LL7A 2FFBA 3G1TA 3VHRA 1O9HA 4KAJA 2GILA 2PBFA 4DEVA 1RAEA 4BVGA 4E4TA 2FFQA 1WW2A 3HP4A 1WMAA 2PZEA 1H85A 1V25A 3WB2A 2ETVA 3QOWA 1RRJA 5CVUA 5AH0A 1R9GA 4RL6A 2Y2ZA 1DXOA 3I01A 3MNFA 4Q3OA 1TM3E 5BT8A 5JI6A 5LD2C 3QPDA 3IR7A 1YR8A 2FZ4A 5KTKA 3A2KA 4E21A 4Q02A 4GP9A 1DT5A 3CKYA 2DODA 4NPAA 1JKIA 3FRHA 1U78A 2NS8A 4UEOA 2SECE 1RUNA 3DFGA 1D2MA 4CR6A 3WE2A 4XX0A 3HDGA 2FWBA 2I6GA 2X85A 1WV1A 1CLUA 4PX5A 3CS3A 1EA7A 2WHXA 2C3YA 2GNOA 3NDIA 1NRIA 1XDUA 1M8JA 1EFAA 4HFRA 3NVDA 1G4HA 9GPBA 1W36B 4MNTA 2SKCA 3S1SA 4HWPA 4IGKA 3UOWA 1QIJA 2WMDA 4QTUB 5HKOA 4D3DA 1OPXA 1TDJA 4CYCB 3T3HA 5FKLA 2X0LA 2OUIA 4L4RA 3P4XA 5C4JJ 1WZ2A 1YS9A 4RZHA 4G5OA 1B26A 3EOBI 4MTLA 4D3XA 3HZJA 1XQVA 2XOKD 1RWNA 3WG9A 3CC7I 3UKJA 4U9IS 2G25A 3JATB 4UNQA 1ADJA 4FOSA 1HV8A 1Z08A 3OCUA 4D92A 3MN2A 5AW2A 2QUZA 1PVVA 5HK9A 5K4GA 1J22A 1FYXA 3N6RA 2CLIB 5HRUA 5F1JA 1YQXA 5DE3A 2AOVA 3VAYA 2IQIA 4QG7A 3GAMA 1YASA 1Z35A 4TTQA 1VA5A 2Q1UA 3PHHA 1LDBA 1WDKA 2XT6A 4P92A 4HXFB 5CB0A 4TV8F 1KK0A 2QJOA 2NXJA 2WIGA 1L7VC 1QP4A 1GT0C 2KJCA 2V7VA 2PEYA 4IDBA 4CM1A 4MS3A 1N0IA 1HEIA 4DQDA 4NYJR 1HKUA 1O0CA 3S1QJ 2YHIA 3G17A 3ZY5A 4RDCA 1XA3A 4X6AJ 1UDAA 5A62A 3RADC 2ZBFA 5GADl 3AY0A 3MKYB 2RC4A 3E5XA 2ELKA 5D5XB 4GDFA 2IPAB 3CVWA 3K4BA 4RVCA 3WE3A 2Z57A 1F7UA 3W3AD 5HS7A 4Q9AA 1RW4A 2QT0A 1W88A 3ACBA 2DN0A 5DUKA 2CV2A 4AY4A 1GRNA 2OB2A 3VR3D 2R2AA 4AUNA 4G81A 2IF0A 2EZTA 3JARB 4E70A 4KDCA 4ME6A 4YAJA 5D5PA 4WVLA 1UBEA 2AFHE 2X8LA 4HMOA 4N7BA 3LDUA 3U2QA 3B6CA 3N05A 3UMSA 4QUAA 3AVWA 4MGIR 4KTVE 2AS5F 1UINA 1USIA 1H9BA 2FN3A 5G1PA 2JFQA 1JGSA 4WGFA 3LHIA 3HA7A 3D43A 4H08A 5GMOA 3ZDZB 3TLCA 1HZJA 3FBIB 3L6UA 4YCSA 1CDZA 2R2GA 3GPLA 4ZZLA 3ZCSA 4Y7CA 1XGKA 3R9XA 4I09A 2DG2A 3QTLA 3AKZA 4Q37A 4QUGA 3MB5A 5KYYA 3VSAA 3NHUA 4AJEA 3SG0A 4BHPA 3Q0IA 4BNWA 2EFWA 1XAGA 3KFWX 1E64A 1YE5A 5A3VA 4MQUA 4GCVA 1X87A 2F1JA 4B1FA 2PMFA 5JC8A 1MABB 2FP4A 4HPQA 3U44B 3U4IA 4UM9D 2YHAA 1KRXA 4MGYR 4QFCA 5ED0A 2NO6A 4NBVA 2IGOA 1TT7A 5JZBA 2PSFA 1SUSA 2C1EA 3NBFA 1VQMI 1K5DA 1OH5A 3QK7A 4RDHA 2VQFB 4M49A 2P81A 2GN2A 3V8VA 4IQ4A 3B6KA 1V8ZA 4RBOA 4PYJA 4DYRA 1NONA 4MQFB 3HKEA 3UJDA 1OREA 1TAHA 3O95A 2VF2A 1ZGAA 3LC2O 1VIDA 5AI5A 5EJAA 3OM8A 5LXTB 4I1RA 3JQ8A 4BMCA 3QJGA 1IQUA 1QCYA 2X2FA 4J0QA 2H8KA 2CHUA 1GNQA 4WKPA 4LRTB 2XOKA 2PTGA 4FGLA 4BJHB 3O2JA 3USES 4KP7A 1NPTO 3GXOA 1T1GA 2CMKA 3T9BA 3QU3A 1FK8A 2G88A 3C87A 1P81A 4B7CA 1VRCA 1WXHA 4U7WA 2I67A 1ZQ1A 3A1FA 4E5KA 5KNBD 3E3OA 3L79A 16PKA 2P77A 4RB2C 2J30A 3EEQA 2DSTA 4HVLA 3FPAA 3WWEA 3HJBA 3AR7A 4I2OA 1P8JA 2AF4C 3I6QA 3NHWA 3A1YA 3CINA 2XPUA 2XMBA 5EUCA 4N1AA 2NZ8A 4D0LB 3A0HC 3AESB 1Y6ZA 1O7LA 3K9NA 3M6XA 1OPRA 3KP7A 1FB5A 1PL0A 2HWKA 4EG5A 1P75A 2Q49A 4BVHA 2W0SA 2YASA 1ZCAA 1YZGA 2CXXA 5BNZA 4PZUA 4DRZA 4LHEA 1TWHJ 1WSWA 2HU9A 1I36A 3V7WA 4P22A 4C3ZA 1C81A 1WQ3A 5IKPA 3AZQA 3W3AA 3PNMA 4UB8C 3QWFA 5AKIA 3NAGA 1UHWA 4XKJA 3U3JA 1SCAA 1AQJA 2CXOA 2PR2A 1PCXA 4TL6A 3P19A 5FBWB 3IT1A 2DAOA 1J5XA 3SS7X 1K8RA 1K8ZB 4LZPA 1IL0A 1ZKDA 3GA7A 5TV2A 1SD7A 2XVZA 4DUPA 2X4DA 1DQSA 3RYHA 1YRNB 3IMGA 4KO3S 4HDSB 4UDNA 1YJCA 2C1XA 3H0CA 3KQHA 2CW5A 3T1VA 4NJOA 3Q8WA 1PJBA 4I01A 3O8LA 1H66A 4DS3A 2HNBA 4PSAA 3RVMA 4Y1GA 1EDBA 5A5GA 3ZQGA 4Q1CA 3FF5A 3W2GA 3KSDO 3L8EA 1TP4A 4YDQA 5J4HA 2Q0SA 1P1CA 2ZBKA 5JY1A 4D81A 2GEFA 3FWKA 3MEXA 4RE5A 4XOUA 3KYDB 2H48A 3WQHA 5CIWA 1TL8A 2CHEA 2JGAA 2C5HA 4QJBA 4BEHB 1QGDA 3I2HA 1EGQA 3LBYA 4R31A 4MPJA 2IHVA 1WZIA 2W82A 1F6BA 1UKZA 4N0PA 2BMEA 4XYBA 3Q2IA 4IX9A 2VJMA 2BBTA 4IDQA 2JTVA 3IUYA 2A3SA 3MS4A 4LC0A 5AVKA 3MFYA 5KI6A 1XMVA 1K2WA 2QLBA 3C7KA 1NF2A 1ZK4A 1UFMA 2XMSA 3TZHA 4LVUA 3U2RA 4HDNB 2WIDA 2NTJA 3ZBPA 1Y9AA 3RD5A 4WN9A 1ONNA 1N0VC 4R4JA 2KE5A 3TIXB 3BIJA 1YQAA 3BZ6A 1OA1A 2QV7A 4BVAA 2WEKA 4L78A 2CL5A 2KL4A 1RQNA 5JSFA 1LBIA 3UQYS 4HWGA 2XPWA 3VKFA 1IVSA 2I8AA 2OC9A 4J0CA 4QDKA 2KIFA 4Q4HB 1RCFA 3HO8A 2GWHA 4FMDB 4HAYA 1SKMA 1OBFO 2H85A 3WHCA 5FOWA 1CNEA 2HOQA 1VMDA 3OS1A 2AF3C 3TLGB 3BA1A 1ODCA 2V3CC 1I2MA 3HN2A 2XUDA 1R9NA 3MJEA 4L50A 3P32A 2ZIXB 3ETDA 5LBTA 2XKBA 4DXAA 5SYNA 1GCAA 2DUUA 2WWXA 2R92J 2P8TA 3O21A 4QUJA 5K0TA 3A6KA 3HLTA 1DOHA 3OD5A 1X58A 4ZVKA 4JVSB 1C9NA 2LMDA 3H2HA 5E8RA 1XZHA 2H8RA 2X1EA 3LQ4A 3DV0A 3DPLC 2P6OA 1Y8CA 2XE6A 5K0BA 4YEJA 1W2HA 4KKVA 4R83A 2A0WA 2WA1A 3NHMA 3EA0A 5AM2A 2DMTA 2L42A 4FN5A 1XMKA 3JYNA 2JGMA 2HGSA 2PR7A 1JI8A 2BFAA 3ROUA 1EKEA 3K0AA 5BXQC 3AU8A 3TAHA 3QYEA 2W37A 3U7QA 3W6JB 2P41A 4ENSA 3PQ4A 4IFEA 1QM5A 1ACJA 1VQNI 4D46A 3PRHA 2Y2UA 2H1LA 2AJ8A 1XWWA 2Y9YA 2QW8A 1J5EB 3RVOA 3DEKA 4P93A 3UXHA 4LY6A 3DL2A 5D84A 1E2GA 9LDTA 4MVJH 4D99A 2XKKA 4BLQA 3IRQA 5AJTA 2V6FA 3BDDA 2B6NA 1F8YA 4N40A 3QYJA 4AP5A 2XA9A 4OGFA 3HUGA 3HMQA 3U40A 3ZMDA 1N1EA 3DMNA 4OK6A 2EWWA 3AILA 2GDJA 1ISHA 1MIJA 4RQBA 3TJZA 3FPJA 1EXMA 1FPMA 2Z1NA 1FF9A 2XWPA 3NWSA 3CCSI 2CD7A 1KAQA 1QXSA 1VJ5A 2GQ0A 3GFIA 3EZXA 1MNMC 3HTXA 4EQ6B 2K3PA 2R3SA 1UKCA 1KKLA 4EY6A 1MG0A 3H4VA 5JXJA 4UTZA 3HWSA 5AVZA 4I1UA 1PT5A 3NUQA 5FPSA 4HFNA 3BH7A 2P9EA 4ZTBA 3TL6A 5ILUA 1HE4A 2V7QA 2EQRA 3RSHA 2V7BA 1XYYA 5KO2A 1JHAA 4RCZA 1ZAKA 3UICA 4B3TB 3BJEA 4B09A 1FMWA 3P9XA 5FA5A 2R5ZA 4LYAA 3QG1A 2C3OA 1T4MA 2BFMA 2MD0A 4DBLE 3TGLA 1WZEA 1U3CA 3ZDFA 3CF4A 4HNHA 1KO1A 1A31A 3BBPA 3CW2A 4QHTA 4OXYA 3P26A 1I1OA 4RQUA 1EK2A 2UZKA 5FOQA 4HEA1 2M0MA 5B58C 1RRVA 4A92A 1ONPA 3FYUA 1JIKA 2FE1A 1A7KA 3UWOA 2WABA 4OHVA 1SUIA 5CLIA 3QFTA 2JW5A 4K9OA 4F45A 1P7IA 3KR1A 4EI9A 3FKQA 4L6AA 1SD2A 2ZGVA 3CLVA 1I4DD 4J29A 4LXHA 3W04A 5BSRA 4AMGA 2Q6TA 4K28A 4V1CB 2W2LD 1LVAA 3GIWA 3GDHA 1T8PA 3PE6A 1X92A 3G3ZA 4J01A 1EG2A 4CKCB 1JWAB 4L3WA 3ESBA 4JBHA 5K8VA 3WWOA 1P4JA 2P1ZA 2ZSBA 4FFPA 1Z73A 1ZYRF 4ZWNA 4OIPF 3SJBA 1N8KA 1U8UA 3LT2A 1PR3A 3PVZA 2XE8A 1CDOA 2OGTA 1GV1A 2Y05A 4H7EA 2XSDC 3AH8A 5GONB 5LQCA 2VP9A 3NM5A 4HQEA 4QXQA 1FDUA 2H5JA 3BR3A 1FOKA 4HH0A 4WSOA 1ETWA 1JHFA 1HI9A 3ZQ6A 5JH7A 5FRDA 4ZO8A 1XB4A 4D4KA 2RHGB 4FFBB 3FJOA 1GDTA 5EXEA 3L0BA 3PIOF 3V6LA 4LG3A 3ZHCA 5SYMA 3C7JA 1X0VA 4OMDA 4IHAA 1LFDB 2CB0A 4EYQA 3H2ZA 4D5GA 4ZYVA 4OOIA 3KEOA 2GJ4A 1AT1A 2X3YA 3ZTYA 2V0CA 1HMYA 1U9CA 5EHNA 3ZWWA 3P7NA 4RTPA 1JEYA 2FQXA 3HUTA 2MDTA 2R6HA 4L22A 4EYOA 2P67A 1G2OA 1L4NA 3W7VA 4Q7QA 4AUMA 2Z9BA 4ZOBA 1XTVA 2CLDX 1SCUA 2OV7A 1XQWA 3AUJB 4DLSA 2IS4A 1JKRC 2GIVA 1JLLA 3O8RA 2CXTA 5TE9A 4X95A 1Q7RA 1NFRA 3SLRA 1Z2EA 3CCEI 3FFWA 1FRZA 4LF5B 3CJRB 3GT7A 3KDSE 5BWCA 2A05A 2ZYDA 3EDMA 1KOJA 5CDFE 1ETKA 2HH9A 3O75A 4Z4CA 1QZZA 2RAVA 4RSHA 2UYHA 4D4JA 3EIXA 4XRMA 5B2FA 1S3FA 3CB2A 3RUHA 3NAMA 3CZQA 2PQ6A 2C82A 5C1PA 1UBTS 4KDPA 1IOWA 2IZ1A 4BJ5C 1FFGA 3HIFA 4MUHA 4V19K 3ZDCA 1WF6A 2VTBA 1DPGA 2PEXA 2Y0SA 5C31A 2ZB4A 2YU9J 3RAEC 1YIDA 3SZGA 2TMDA 1NXVA 1GRRA 2WJ4A 3BD6A 3UWPA 3IEIA 3I73A 3NG1A 4RFSA 4PAMA 3GMDA 4GOLD 4URYR 1L5ZA 1W76A 2Y76A 4Y2QA 2VJJA 2EV6A 4DT1A 2YHIB 1UBKS 5IP5A 3VDQA 2RREA 3B7PA 2W2LA 4YXWD 3EQLF 3IDOA 4KBGA 2H1VA 1HDZA 4GZMA 5KKAA 2EJCA 4XUEA 3VC1A 2HIHA 5IKMA 1KIMA 3OZVA 3W34A 4MEAA 1MSEC 1UF9A 4A2PA 3OYIA 1W88B 2CDNA 4L4SA 2M1BA 1RBYA 5BQFA 2DTXA 4TWZA 4KTTE 2QVYX 5CHYA 1ZD3A 3AYXB 4KWIA 4KXWA 2GEJA 3PB3A 3E6BA 3WXBA 4ZYZA 2E1MC 3WISA 2XB6A 1NW9B 2JGNA 3JD4A 2UZ1B 5HNHA 3EMVA 5C9ZA 3FSGD 1W4AA 1RCUA 1CJUC 4CUGA 3TDMA 1KRHA 2XGSA 4WUTA 1JBEA 2O7NA 2XB8A 4J9UE 2C7VA 3D5SC 3NALA 4G41A 2QX7A 4MW2A 2UUAB 2WHPA 2YKGA 2WA2A 2RKHA 4H7HA 1UKEA 2R751 3V7UA 1H0RA 2ZOSA 3V33A 1L4GA 4MW6A 1ECGA 5LBIA 5C2JB 5J3LA 1YO6A 3CC2I 1GT91 2CD9A 4KHPB 3S68A 1JUMA 5KPJA 4C7VA 3EZLA 1ODDA 1B72A 2ZAIA 3LVBA 4DM7A 2MC4A 3I5AA 3E97A 3FJ1A 2V45A 1DAHA 3C3CA 3LSPA 3O9ZA 2FKAA 3UMFA 1FIUA 1JW9B 2V4UA 3V1MA 4TV9B 2VUUA 1JZQA 5E3HA 2FP4B 4DMUB 4RK1A 5JPCA 1Y3DE 3REFA 3E9DA 1MH3A 1ZONA 3PSHA 1HSOA 1IBKB 1VKOA 3U9SA 1LI7A 4HWSA 2WYWA 3OLYA 5CXSA 2DAPA 3BGWA 2IYZA 3AG3H 3CRMA 2V1DA 2ONCA 4I7HA 1C2YA 5KJFA 3DLAA 3TPCA 3ES9A 2AUMA 1P9OA 1OWPA 4GLLA 1US8A 3CA8A 5E6RB 2JAOA 2OHJA 4I5GA 5JMTA 2V03A 4PYKA 3HKEB 3EWAA 4Z54A 2ZRFA 5IP7J 5JBQA 3U9LA 3BRCA 1OFVA 4O4JF 4A0HA 1I1HA 5JU6A 3ZIAD 4J1TA 4UAUA 4HEQA 3EWNA 4RK6A 4DR6B 4AMVA 2G7UA 2PUJA 4U6NA 2ZXIA 5DLDA 2IDJA 3UH1A 3GTPJ 2YW9A 4FD2A 5AUOB 2HS5A 5E0KB 2D0OB 1W29A 3HVHA 5LXTF 2L17A 4IH9A 3GNLA 4YAEA 2VEDA 4KR0A 4C1BA 2BEJA 2QDKA 5FRNA 1AKWA 3GLHB 1Z36A 1SUAA 1EZ4A 3IUOA 1X7WB 4FBGA 1E9DA 1YKSA 1RMYA 2PT6A 5HNFA 5TGTA 2BKAA 4S0ZA 4V0OA 4LJKA 3HKDA 1QHGA 3MBOA 4PZEA 1PK8A 1JUDA 1T13A 4Z4GA 3H36A 3SXPA 3ND5A 4D6PA 4R8MA 1EFKA 3RFTA 2BI4A 4GQBA 5K5EA 1VYTA 2MSCB 4J4BA 4HV4A 3IP8A 1O4XA 2PGLA 3Q9NA 5KSZA 3C5VA 4K46A 3TDKA 1BS2A 4WK6A 2J9RA 3QXSA 4PYNA 4QUKA 4R5HA 1UIRA 2GN6A 2FW7A 2AMLA 1NOJA 1BXRA 3TVYA 1MJ5A 4CT0A 1T6NA 2ZRHA 4EL5A 3K7EA 4H4EA 4KC0A 3FZEA 3AGPA 5DTQA 4GZ6A 1KOLA 4U2DA 3CF2A 4LFBB 1ZHOA 4S1OA 4E7OA 3RYHB 4NCAA 2XNHA 3UT0A 4YV0A 3JS5A 3OZEA 3H99A 2A9RA 2ZI3A 1RM0A 4C4TA 4F1JA 1J8FA 4AI6A 3F8CA 1VSQA 2V54A 2Y69H 4C4PA 3A01B 1L7RA 1DIGA 4LCJA 4N4OB 3OU7A 1DDGA 4CFSA 3Q2KA 3CPJB 3HUFA 4RBNA 4MMZB 4YV2A 2VDWB 3U62A 3E6CC 3Q72A 1Y1QA 1SZDA 5A4KA 2C4VA 2ROQA 4HB2A 2IK8A 1X42A 2W90A 1QZXA 3C4JA 3FTCA 1VQ4I 1FSZA 2R6FA 3QYFA 2NTNA 1JLSA 3EA5A 4X3CA 3DPSA 4A2CA 1ZRSA 2OBFA 5CVCA 3YASA 4ZAWA 1LQ2A 2JLVA 4Q3CA 3TQNA 2A07F 3PC2A 4H3VA 2DU9A 5EHZA 2GERA 3JYOA 1JKJB 2XSZD 3HA2A 2OHOA 5SZIA 3S55A 4FTHA 2I65A 1GPLA 4JOBA 4KYIB 3V97A 5I6DA 1FSPA 1U5AA 3H11B 3M6IA 3KLBA 2G1UA 1GAJA 1L7OA 2AFIB 3ANMA 4CMGA 1Y63A 5KSPA 1S9DA 2IPOA 3QP6A 3RVRA 1MJFA 2H1KA 1FMLA 1XEXA 4G1UC 3NYIA 1W4RA 5IDYA 3GROA 2FPXA 1OKKD 3H35A 5C80A 1TCBA 2HKIA 1QGUA 3SYLA 4P5DA 5LHGA 3CJQA 3TB4A 2Q5LA 4EA9A 2E4VA 2NYAA 1JFFB 2WFZA 3W2IA 3ZIAA 2YVKA 2Z04A 3H8VA 3T3OA 5CNIA 5LRRA 5JDCA 4FFLA 2QX8A 2JPBA 3KLNA 4LX0A 2GXUA 2OG2A 3SXUB 1KI6B 4ZYWA 3WC4A 4ODIA 4D41A 3DCIA 3AL2A 3E8MA 3BH6A 5WRFA 2IEIA 1XL0A 1MXHA 3OX2A 4BRWA 1EP9A 3FDXA 1T2AA 2FZKA 4KT5C 4QL3A 3DTEA 3U4DA 4BO7A 3NH9A 3SQWA 4OFZA 4FFMA 1W4MA 2AX4A 2EWMA 4ZEOA 1T5TA 1N5KA 2WTAA 3IP5A 1RIIA 3W6PA 1GGMA 2M2EA 3K2BA 3OIFA 1CZRA 3VUFA 2C61A 3SHVA 3ISJA 3O8DA 1XD2A 3KYIB 1S7CA 5FHQA 1QOQB 2G36A 2DA4A 1JSRA 1ST2A 4RWEA 2AK2A 3X1ZA 4CQMD 1OI7A 2ZJOA 3HK2A 4WXMA 2HPAA 4IS2A 1YU6A 1T0IA 4O5OA 4KQ2A 3H17A 1RC9A 3PK0A 5DBGA 3U7QB 2JZYA 4MVJD 3JWEA 1QH1A 4P7JA 4M9XA 4XOTA 3ZPLA 1P0PA 4X97A 1J25A 5DCLA 2ZW9A 5IK2D 4NZ9A 3KR9A 4UCFA 5LM3A 1QO0D 5D3ZA 4FZ3A 3I83A 1E5LA 3SC2B 1IRXA 1JTYA 2EZIA 2QMUA 1BKYA 3BUSA 2AMVA 1R5HA 4GYGA 5IX8A 5LQDA 2IU4A 5KPDA 1Z18A 4F52A 4DZRA 2PZFA 4X94A 4BNZA 4YMTA 3AOEA 4H1HA 4EA8A 3JRBA 1UXOA 3PD7A 1K92A 5JFOA 1I9GA 1HXHA 4AYBN 2LCQA 1R64A 2A3RA 5B7QA 4KDFA 5IZCA 2JUCA 3TMAA 4B3GA 3RT9A 1P0FA 4Q3NA 3MEQA 1VCHA 4ZA2A 3GUHA 1B0AA 2WUDA 3GRAA 3KE9A 3OEWA 4RESA 2C94A 1S2GA 4BHCA 4GOND 3OOUA 3WP0A 1KK1A 3PGJA 3WVNA 3A1SA 3TLJA 1XOIA 3KUCA 3G7NA 2IGMA 3NNDA 1WJAA 1ETOA 3J80K 1DL5A 1QPBA 4CR8A 1CSEE 1K89A 1C0WA 5DPMA 1ETYA 3ACCA 2AOTA 3UF0A 4IUCS 3PO2J 2XB2A 2EP8A 4ZC1A 2L19A 2V6JA 2XSZA 3BB4A 5C1BA 5JXIA 2W24A 1R8XA 3OOEA 2B8NA 4Q4AB 2R1ZA 1Z0AA 1KMNA 4KFUA 5HODA 1OAOC 4CG2A 1P6UA 3CP8A 4UDYX 4G24A 4AKEA 4PWZA 4YDRA 2FFRA 2R6AA 3I23A 3IIMA 5D3QA 1WZNA 1PO7A 4Y33A 2C04A 4R0VA 1ILEA 1E92A 1RSZA 2PUTA 1OLSB 4E5SA 3ZZUA 2O8KA 3K05A 4MQ5A 1OKKA 2JB9A 1ZU4A 2O59A 1U7TA 2FEOA 1AV7A 3WSVA 1M2WA 2JLXA 3K1NA 2BW3A 3I1YA 4MWGA 4E15A 1UJMA 4BC0A 1AX9A 1TM5E 2CCJA 3OETA 4IGAA 4MJXA 2WKRA 4INOA 5G4KB 4YEDA 1WS6A 1FQOA 2AYXA 2AYYA 2WWFA 4XLLA 4TQUS 1OCZH 1L5GB 1YE8A 3C2QA 1IN4A 1YNSA 2X1LA 1JMKC 2GCOB 3NUZA 2F3SA 1TADA 1HSTA 1L5WA 1KNQA 1JL3A 5B4UA 3IYLW 3HKBA 4RXTA 2WJPA 2FR8A 4WV3A 1VBNA 1H2ZA 4JBNA 4EO7A 1ZG1A 5ER9A 2W8ZA 3L7CA 4UOEA 3PU6A 4OL9A 1HW5A 2PT7A 3GLGA 1YULA 3F4BA 2IWHA 3BGIA 2WIBA 1Q22A 2C4NA 3JQBA 4LDZA 1B1BA 2ZRNA 4KUGA 2XGXA 5LYJA 3RARA 2O7OA 1JPUA 2J48A 2HSJA 1LTHR 2IIQA 2WNHA 3FCEA 5GONF 5ALJA 4HI0E 4CQMA 1Q12A 4DEYA 3T7DA 5H3HA 3FM5A 2QXUA 2ZE8A 4EDFA 2K4BA 5DM6F 2FXVA 4MEBA 1JFLA 4G65A 1TZJA 5JRDS 3HSRA 3B6IA 4A69C 4MVJA 2RGXA 3BREA 2R7FA 3GQBA 4J2TA 3ER9A 4BEWA 5JCJA 4IIUA 5FL7D 2R8RA 4ZEVA 1QO0A 1JEYB 3EFBA 3MAAC 4LHXA 2BYVE 1ZJ6A 3RFCA 1U8AA 3UJNA 3P0EA 4P3YA 5COAA 4AG3A 5I9TA 1PDOA 3EW9A 1FFAA 3IH3A 4F9EA 3QKUA 3JSAA 4U2BA 2JGJA 3PRKE 3RC1A 3RU9A 2YMPA 3H9UA 1GA1A 2IYVA 1Y1LA 5JASA 1JV2B 3FMGA 1BE6A 4J19A 2IF2A 1GEEA 1T4CB 3K0CA 5G41A 3M1EA 1JLLB 4JLBA 2VBWA 1B8IB 1EQAA 3L8YA 1VQPI 2JLZA 3EVGA 2GPTA 5LOVB 2QBYA 2ACJA 3OLWA 5JPDA 2FZ5A 3IDFA 4MHGA 1V8PA 2CMGA 4EJTA 4DQUA 4K3UA 3QXJA 1JA0A 4BKRA 2DTEA 1HQDA 5KOJB 4RD0A 3ANNA 5FWXA 4MLOA 2HA0A 1OB5A 1E3SA 4V03A 1AHIA 4YRGA 3TL4X 3OM0A 1FU7A 5FUQA 5EIFA 1TQPA 2Q9BA 1KR2A 1QNLA 5KIAA 1Y4ZA 5IZ4A 2HSWA 4MHTA 1U2QA 3HJGA 3KQPA 4QNRA 3IXLA 2PMHA 3Q6MA 5L7TA 2NPFA 4G5FA 5I01A 4BE4A 3G59A 1T9ZA 5UKDA 2JAPA 1Z7YA 4NABA 4CTMA 4E1BA 4RFSB 3LBFA 3TW8B 3D8TA 3FTNA 5B55A 2B2NA 3D3WA 4PSVA 1JQEA 3I01M 4IFBA 2CUNA 1PJLA 3AKEA 4YLGA 3NQOA 4JB2A 4GXNA 4RPGA 4ESOA 4NMLA 3J80Z 1NZFA 3JWPA 1W94A 5ELMA 4B34A 1R71A 4E7HA 3IRVA 2FY8A 2XCQA 4OHWA 4KVGA 4QHSA 4ABYA 3VU0A 2RK3A 5ALVA 1Z0IA 1UKAA 4CUZA 3VH4A 5IOYA 4H16A 3H8SA 2V7GA 1RXWA 2LREA 2VI5A 3FBNB 3U4HA 4AVZA 2IGTA 2ZI5A 3KKNA 5F6FA 3MSXA 4CQLB 4A0ZA 1GG8A 5IPAA 4BCBA 4YJ2A 4M1OA 3A27A 3QVMA 1ZLXA 3R3VA 1U1EA 4L8VA 3A6FA 2GCEA 3C3KA 4NNPA 1Z0FA 2WHPB 4ZVVA 4C4AA 4RHUA 2O2HA 4TLBA 4WI1A 1UC5B 2I9KA 3RRZA 4CCKA 5ENVA 1GG2A 3W1WA 4X6YA 1DBVO 1QE5A 1X1DA 3NW9A 3L1UA 4EJSA 5LQMA 1M1YB 3ZE1B 1O3SA 5FKKA 4RIFA 4M0MA 4CMHA 5FL7A 1NPYA 1U7XA 4PZ0A 2JKZA 3U9GA 2VA8A 1BU5A 4M3EA 3I3SR 2HQ1A 2EF1A 4RGBA 3AHFA 3NCTA 2PSEA 4NU8X 4YRLA 2R8BA 1XVAA 2WM8A 3QFRA 1UMDB 5KYKA 5KNCD 1B14A 2P5VA 2GD2A 3OV8A 4MIOA 3UW3A 3GJ0A 1CQIB 1IC6A