3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
4QSMA 1YWGO 3VDRA 3D4NA 2EXXA 4XWYA 1P44A 2PKRA 3CIFA 3GG2A 5AXDA 1GZ6A 1TA4A 3E82A 5HM8A 5K9ZA 4QUKA 3KUXA 5HRUA 1I32A 1C0IA 5TIIA 4NBWA 4QFCA 1PJLA 4NJOA 1A9YA 1YBMA 3N7UA 1BWSA 3ZNOA 3G1TA 1NFRA 1PQPA 1SNYA 1HYEA 4LRSB 2X4GA 2X9GA 4OGWA 5IDWA 2UVDA 5GZ1A 1UZNA 1HSZA 3ITDA 3BMCB 2X6TA 5HA5A 1P1KA 1U2GA 3DBLA 3X2EA 4GX5A 1Z73A 4GMFA 2OBYA 3ZV5A 4UVGA 1DRWA 1M75A 3BMOB 1LJ8A 1CRWG 3RC9A 1NR1A 2E48A 1GL3A 3RUHA 3GH3A 1Y81A 4Z0TA 4ND4A 4BNGA 3MTGA 5JAZA 1PJBA 1XYGA 4M49A 2FHSA 2B5VA 4WEQA 4F45A 2GPTA 2FMUA 3MZ0A 2HO5A 1HE5A 4J91A 1SBYA 1V35A 3DHYA 1U3UA 3E9QA 2J5KA 2Q1TA 4PG5A 3ZV6A 2GO1A 3RIHA 1ZK1A 5AYVA 1KEUA 3PHGA 3W6UA 4EUFA 4Z6KA 2Q46A 3E5RA 1I8TA 4BQRA 1DEHA 2QRKA 3G79A 1UP7A 4HY3A 3DAFA 4CMEC 1I10A 2O2SA 3BTUA 3FRJA 3WGTA 2PFGA 2X23A 4ALLA 2Y05A 4QQRA 3BHMA 3M2PA 5KJEA 4WNIA 2AE2A 1KETA 1X0XA 2DC1A 1G0NA 5KJFA 3LZ6A 4EJMA 3JCZA 4WCDA 3WWZA 3A1NA 3E9NA 1DC3A 2J3HA 3I9KA 3QWBA 3UFXA 2IODA 5FEUA 3GLQA 4MVJD 4LW8A 5KIAA 4RF4A 3HB4X 1ADCA 3RU9A 2JFGA 1PGPA 3PFFA 1BXKA 1YONA 1PU2A 1D4FA 1Q7BA 2QG4A 1Q0HA 1J4AA 4MKXA 1IL0A 1N7HA 1SB8A 3H5NA 3PYLA 1YRLA 2W98A 1IB6A 1VI2A 5EPOA 1G0OA 4XEHA 2BD0A 4PZDA 1I36A 3INTA 2DT5A 1HE3A 3KETA 1R16A 3KVOA 2GNAA 2XXJA 3GC6A 5COQA 3NEPX 3RQSA 3MJSA 4O1MA 1IHYA 4YTEA 3FR8A 3IQDB 1XWFA 4J1SA 4YRBA 4D3SA 1NWCA 5EL0A 3GG9A 3LYLA 1MGOA 1T1SA 2FSVA 3WJ7A 2B35A 4U0JA 4GX2A 5BT9A 2ZATA 5DOVA 4CMBA 3K5PA 3BMQA 2NSDA 4CMEA 1OAAA 3I4FA 3OEYA 3DMYA 3VKVA 2H6EA 1R0KA 1EFLA 1NAIA 4C4OA 1ZK4A 4U6SA 1ZXBA 4A0SA 3WXBA 2W2LD 4JP3A 5FI5A 3GVXA 1X1TA 3FTPA 4PZEA 1Q2XA 3NTOA 1LI4A 3WJAA 1ENPA 4E2YA 4PLYA 2HLPA 2A35A 2OP1A 4KWHA 1PGJA 5CAEA 1F0YA 1I2ZA 4IJUA 3ZWNA 3I6QA 1ZMOA 5KWEA 1JKJA 4L4XA 3OQ1A 4GKVA 2EJWA 4UUOA 4F3YA 2H63A 5IZCA 2WSBA 1XDWA 3HUDA 3PVZA 4TROA 2AXQA 3RUEA 5KNLA 4LCEA 2BMAA 2HK9A 3WIDA 3H8VA 5TJ9A 4PLGA 3KB6A 2VZ8A 4AFNA 4HWKA 3VPHA 2YDXA 5DNAA 3I9LA 4YT5A 5GZ6A 3T4EA 4GLOA 1H6BA 3C3XA 5KVCA 4WE3A 3LQFA 5CPFA 4AJLA 2D8AA 4QEDA 3A28A 4ZQBA 4Q3NA 2PD3A 1PWZA 2X5KO 4EUEA 3GVIA 3I9OA 1A4UA 2C0CA 1HDOA 5A9TA 3PIDA 3ONFA 1M66A 3BAZA 4BO3A 3ZCXA 2EF1A 2JD0A 5JY1A 3P2OA 3DL2A 4F6LA 3EAGA 3L6EA 3OIFA 1B16A 3V2UA 4D42A 5C3MA 3K31A 3Q1LA 4Q3DA 4XRRA 4RF3A 1E6UA 2YFHA 3JQGA 3K6JA 1EMDA 1KS9A 3BHIA 4WOJA 3K8ZA 1VE9A 3KBOA 5A06A 4CLRA 1DIRA 3L4SO 4F6CA 3I83A 3ZN2A 2Z95A 1LRKA 4GL4A 4BV8A 3ASVA 2G76A 3VAZA 2DVMA 2JL1A 1UXKA 3PRJA 2HDHA 2PZJA 2DBQA 3G3EA 1BDBA 3TDKA 2FZWA 4D7AA 1BVRA 2PD4A 4Z3DA 3KSDO 4JCOA 1IZ9A 4R4JA 1LBEA 2NV6A 1V3TA 2J3JA 5LCXA 3RFXA 4I9UA 1SCUA 1I3KA 5FYDA 4E3ZA 1DFGA 2NQ8A 4QX6A 3H3FA 2B5WA 2QZZA 1PZEA 3GGOA 4TRJA 2IXBA 3T7CA 5T8KC 1YL5A 3EDMA 4KTVE 4N5LA 4PG8A 2V6GA 3MJ4A 5JNLA 3U5TA 2JKVA 2AQIA 4H7PA 4JJGA 1E5QA 2BELA 4OH1A 4PFJA 2QIOA 2CSUA 4IGFA 1TVEA 4XJTA 1O8CA 4W7HA 5G4KA 2F00A 2POQX 3NT4A 3PYXA 4DUPA 1KOLA 5G0VA 4PLPA 1KIFA 1ISGA 1ZCJA 4WUVA 3QJ5A 4E31A 4BGVA 1ZSNA 2DQ4A 3D0OA 1GD1O 1F8GA 3HWRA 1GZ3A 5TLSA 5I9LA 1U3TA 4U8GA 1EZ4A 3JQAA 4BKOA 2I3AA 2X9NA 3CEAA 3SJUA 1HDZA 3LSYA 2GZ1A 3MJEA 2W2KA 4DIOA 3AK4A 4I5EA 1DIGA 2I65A 4BNHA 3U4DA 3GN2A 1BHSA 5A04A 3WGOA 1EVZA 4ILKA 3AJRA 3L0DA 2Q50A 1T2FA 4DQXA 4E5KA 3B1JA 4WK6A 4X54A 3KEQA 3GHYA 4JK3A 4YT4A 4DMLA 5C5IA 5IG2A 4DMMA 5JO0A 1NYTA 4R16A 2B83A 1QKIA 1E7RA 2Y1DA 4S3MA 1GQYA 1U7HA 4XQCA 2PKQO 3EMKA 1BSVA 4ZRNA 3RD5A 4CQLB 1Y7TA 4YR9A 5T8KA 3AOEC 5JAMA 3U09A 1MLDA 4NHEA 2X0RA 3JD1A 4EITA 5BSGA 1A9ZA 1DC4A 2RHRA 4MVJH 3K73O 4EYEA 1SB9A 5TS3A 3CUKA 3PJGA 2VZ0A 3K9QO 1GTMA 1MB4A 3VVBA 4BO6A 3RU7A 4BS9A 3CPSA 1SO8A 4LRTB 5JC8A 4EGFA 1GQQA 3AUSA 4BNXA 4OHUA 1CETA 3RROA 1L1FA 2Q1WA 3GNQA 1DIHA 3EUWA 1NQTA 5IAAA 2C7GA 5CEFA 1SZJG 2O3RA 1YQDA 1NQ5A 2OXIA 3ROKA 3WOHA 4D0RA 4HXYA 1PZGA 3D1LA 4P8RA 5A03A 3A9WA 1JLLA 5EMHA 1QV6A 4B4OA 5JCXA 3V5NA 1PJTA 1IPEA 1JAXA 5C7LO 3FWNA 3OMLA 1I3NA 5LDHA 2DPHA 3ENNA 3LLSA 4MOWA 4FGWA 4MIYA 4RPKA 4R5HA 3RUFA 4L8VA 3GFGA 2YZ7A 3PK0A 5CFZA 1EUDA 5I8WA 3DMTC 3OJEA 1KC3A 2GGSA 5C7IO 3C8MA 3UF0A 3KYCB 5JAQA 3AOEA 3GDGA 3QY9A 5EQDA 3U62A 1GYPA 2Y99A 3QSGA 2DAPA 4DQUA 3FD8A 1P0CA 1NVMB 1RYEA 5TF4A 2VWQA 2D4AA 4P22A 2JFFA 1XU9A 4XYGA 2O7SA 5BSHA 2YFQA 3ANNA 1GPDG 1YQXA 3FPLA 2A9FA 5L9AA 3JQGB 5ITVA 3DHEA 3AW9A 5JCJD 4CLRB 4B4WA 3FF4A 2Y93A 2ZB4A 4XQ9A 1J5PA 4YACA 3VZSA 4XZ3A 2Y0CA 4EI2A 1E7QA 4J9UE 3LVFO 4CMIA 2PZMA 2EG9A 4DLLA 3ASUA 1K6IA 1U8XX 4D44A 5ES3A 3D5TA 4PG6A 4BGUA 1AN9A 2V65A 5BNFA 3RBXA 3GPIA 3H65A 1ISHA 1E1NA 4CL3A 3PPIA 4AJNA 3JTMA 2WYWA 4UEOA 1BGVA 2EW8A 3T7EA 4N18A 4CLOA 1VJTA 5L53A 4J3FA 4MPDA 2OL4A 1UAGA 1Q0QA 3C1AA 1HKUA 2YYYA 4HNGA 1GEEA 1V3VA 1H9BA 2OORA 2P68A 2GCGA 1H2BA 3HNPA 1YJ8A 4IY1A 4KDFA 2FR0A 2DBZA 2PD6A 4ZHSA 3PFWO 5ENDA 3R0IA 4R1NA 2Y1EA 3MTJA 4RZHA 4J49A 1E3IA 1NXQA 2YQ4A 3DMTA 3UAGA 3ULKA 4U7WA 3DWFA 3WGZA 1EQ2A 4YAIA 4J0FA 5JYDA 2LDXA 5G4KB 3VPGA 2FPIA 4JJIA 4PLVA 1YXMA 1HDYA 1FDTA 4XYEA 1NQAO 2CMDA 4BO4A 4YT2A 3O8QA 5JLAA 3AUTA 2Y1FA 3ZWYA 4J1NA 5JAIA 3ADPA 4II2A 2W8ZA 1GAEO 5T6BA 4CV3A 2VWHA 3LK7A 4IXTA 4W9NA 3KOUA 4ZQEA 3JQAB 1OOEA 2BGLA 1ZSVA 4J16A 5COBA 1Y5RA 4NDNE 2I5PO 3H9GA 4B79A 3ONDA 1JDJA 1Y6JA 2W2KB 3KLPX 4IS2A 1B14A 3IJRA 1IHXA 4BNIA 4DXHA 3GFBA 2EGHA 5K0ZA 3H9EO 2W4QA 4CLHA 4CM8A 1YB5A 2ET6A 3VZQA 2C7VA 2WYUA 3EZLA 1U7TA 2J3IA 4PLZA 4WLUA 1ID1A 4R51A 1XQ6A 1ZMTA 2Y66A 1X15A 1A7AA 2ZIZA 2IXAA 2AG5A 2B36A 4MVJA 4DYDA 1NNUA 3DR3A 5L4SA 4NFSA 5JDIC 3DC2A 3TL3A 1ADGA 1EUZA 1Z75A 1B2LA 3P19A 1W6UA 2OOSA 1YKFA 3ETEA 4EZBA 4WKGA 4OSPA 2Q49A 3W1VA 1E77A 2YJZA 4HFJA 4NG5A 1XQ1A 3C7AA 2O48X 4JROA 1DAOA 4GI2A 2UYYA 4RO0A 4CMKA 1B3BA 4ZJUA 5DZSA 4BNMA 1OC4A 1I01A 4ZQGA 1JQBA 1W4ZA 4TMFA 1NHWA 4NJMA 1ML3A 1HL3A 1D1TA 2HU2A 4NFHA 3EY4A 3AI1A 3QWHA 5G0SA 3TZHA 1VJ0A 3IP3A 4OSOA 3E18A 3UUWA 4HADA 2PKQP 1IY8A 2Y68A 4H15A 4Z0HO 2HK7A 3V2GA 3JD0A 2IZZA 2I6TA 3EW7A 3JYLA 4G5HA 4INAA 4BNVA 3DBHB 3GGPA 1W8DA 1JVBA 4AICA 4B3JA 4TKMA 5G2OA 3RKRA 4R41A 5ICSA 1NVGA 1QMGA 4A27A 1FDSA 3L9XA 3JD2A 4OO3A 3F6YA 4I5GA 3LF1A 2BRUA 4NNJA 3GUYA 3ZWCA 1VL0A 5BNIA 3H9UA 3ZNQA 1QLJA 3TZ6A 4FFMA 5DP2A 5JDIA 3MOGA 2RH8A 3I1JA 3KXDA 4Q3EA 4UEJA 3UH1A 2C54A 2PGDA 1D8AA 4FR5A 3F47A 4YRAA 3ROPA 5KTKA 1RWBA 4O6VA 1ULSA 1UDCA 4FW8A 4JBIA 5CDYA 3PQFA 3HQ4O 1DSSG 4XIYA 1OMOA 2AQKA 4K26A 3QA9A 3PHIA 1M6HA 1E5LA 2ZYAA 3IJPA 2C5AA 3ZWOA 3VH3A 4KWIA 3Q2KA 3AWDA 1Z74A 4A03A 2ZTMA 3IIEA 5B12A 4CMIB 1P77A 3QE3A 4MJLA 1XR3A 3JYPA 2RAFA 2P9EA 4UUNA 3DFZA 3DEYX 3DOOA 2E4AA 2VWPA 4Q9NA 3OA0A 4Y8VA 1ZEMA 4CLOB 3GVHA 4XDZA 4XB1A 4D41A 1OZAA 1P31A 3AUUA 3C1TA 4PIVA 3RASA 1P33A 3WBBA 1CWUA 5JFOA 4RPLA 2VT3A 1JTVA 3CINA 1DB3A 5THKA 1JU9A 4JJFA 5DCWA 1PJ4A 1PS0A 3DAGA 2SCUA 3I23A 2PR2A 4HFMA 3ZU5A 2AQHA 3BXXA 4GQAA 4N54A 2BGMA 1I24A 2NACA 4ID9A 4NI5A 4PGFA 4CR6A 4ND3A 3NV9A 5JO9A 2VN8A 2ZB8A 1WDKA 5JXWA 1GZ4A 3ZWPA 2R00C 1VL8A 1GQ2A 2BGKA 4OXYA 4FFRA 2VUUA 1AHIA 1WVGA 3RJ5A 2EEZA 3IMFA 5TC4A 3KTDA 5DBGA 5ER6A 1HTBA 3L77A 3MEQA 3O8QB 3IC5A 4JXKA 3ZWAA 4EBFA 2VYNA 3S55A 1N5DA 4M8SA 3D3WA 1NVTA 3A14A 4WLFA 1TT5A 2HK8A 4XYMA 3ORFA 4MKZA 1YB1A 1BRMA 4BV9A 3SLKA 3KHUA 1GFSA 4OXNA 1PGQA 3NJ4A 2VNSA 1H0KA 5F1PA 4CM8B 1N1GA 1P3DA 4PG7A 1JW9B 5CDGA 1AXGA 4BNZA 3PQDA 4YAJA 1EBUA 5AXBA 1RM4A 2YDYA 2O7QA 4K6FA 4RORA 4TRNA 3FCOA 4YJDA 2GZ3A 2HRZA 2D3TA 3ABIA 1IYZA 2AEMA 1IZ0A 4E2ZA 3HDHA 5H83A 2ZCUA 1I2CA 4HP8A 4ROSA 4HV4A 5CP8A 4FQ8A 3TFOA 3JQ7A 1E92A 3O38A 4JP2A 2ZKLA 1CDOA 1XU7A 3D4PA 2EKPA 2DPGA 1JWBB 2P91A 5T64A 4IDDA 4NBVA 4IDAA 2RH4A 1XGKA 3ANMA 5U1PA 3RUCA 4DA9A 2OMEA 1C0PA 4ZRMA 4HX5A 3E1KA 4DC1A 3GMSA 1GPJA 2H5LA 3DZHA 3U4IA 4YAGA 1T26A 4GMGA 4TVBA 1C1XA 1HDGO 1LNQA 4UEKA 5CG1A 3OFSA 3U4HA 4OJNA 3FPCA 4JBHA 8ADHA 2X58A 4IDFA 5GY7A 5B4UA 4GGOA 3RUAA 3ROMA 1K89A 1GCUA 2CDCA 4U0KA 3GF4A 2NADA 4YPOA 3AY6A 2GRAA 4Y98A 1ZVMA 1ZBQA 2P4QA 2Q2WA 3WTCA 4J7UA 2G1UA 4CQMA 1LLQA 3AY7A 4FJ0A 3QW2A 3UHAA 3RUIA 3TZCA 3U9LA 4LSWA 3NX4A 4WLVA 2AA3A 1U3WA 4YB8A 1NQOA 3UXYA 1O89A 1U4OA 3AM4A 4BIIA 5A4DA 4GH5A 4MIOA 1B8PA 1NASA 3DONA 2D0IA 1PJ2A 2P9CA 2JFHA 1MXHA 1XELA 2Q1UA 4PLTA 1ORRA 4K28A 5CG2A 2GASA 3LF2A 3I9MA 3O26A 1YJQA 2NTNA 4WPGA 3WQRA 5DBFA 4D79A 2C2YA 4IINA 1F8FA 3FHLA 2ZJ1A 4JNKA 1ZH8A 2NM0A 3BMNA 4CM5A 1GYQA 3S2GA 4TRRA 2DBVO 3DO5A 1UZLA 1VKOA 2PV7A 2O3TA 3RFTA 4A10A 4ALNA 1FMCA 3GDFA 4WLEA 1QP8A 4NH4A 2PGLA 1NTOA 2I76A 5CDUA 2OP0A 2G17A 1YO6A 3H7AA 1L7EA 3S2FA 3MJCA 3DOJA 1RM3A 2CUKA 1TLTA 4CM1A 4A73A 1ADFA 3GUCA 2BI8A 4XYLA 1I5RA 3GN1A 3AM3A 2FWMX 1E3EA 3TFQA 1PS9A 2Q3EA 3ZWBA 4CLDA 5JBIA 1PTJA 5JMPA 1IULA 3B70A 5DOZA 2ZB7A 1TT7A 2H1SA 4L4SA 4OQYA 4G65A 2Q1SA 4RJTA 3GEMA 3KSZO 1C3VA 1YL6A 3E48A 1EDOA 4GAEA 4BVAA 4IMPA 5L40A 3TQHA 3JQ9C 2EW2A 3CSDA 2A94A 5JCJA 3DXFA 1MXFA 4KTTE 5I7EA 3ITKA 5F1KA 1QG6A 2OHXA 4E5YA 1DIAA 4LK3A 1CF2O 4PG4A 3RFVA 3LC2O 4OAQA 3JD3A 4YAKA 1T4DA 4AJ4A 1U5AA 4RVUA 1BXZA 3WIEA 2Q45A 4BB5A 1M76A 2JAPA 4CPDA 5EINA 3DBLB 4UAGA 4IDCA 5L3ZA 3RKUA 4BOYA 2QHXA 4A7PA 1TT5B 4Z0PA 3GRKA 4LMPA 4YA6A 4AJIA 3UGKA 3UN1A 4A26A 5U4QA 1UXJA 4L9RA 5KJCA 4DTIA 5ITWA 4M55A 3GAZA 1QV7A 2QYSA 2VTEA 4YAEA 3HN2A 3R3JA 3EGOA 4IUYA 2QYTA 2BFMA 1NPDA 1V9LA 1E1LA 4E2WA 4LISA 4CR8A 1BXGA 1YBVA 3E5MA 3WMXA 4GBJA 5AOVA 2IZ0A 4RVHA 3FNFA 3K30A 3CH6A 3F5QA 3TF5A 4NBTA 4CMAA 2VYND 4XGNA 5B4VA 2NWQA 4UVIA 1LRLA 4AJJA 3L9WA 3LU1A 1WZEA 4L76A 3AFNA 1QXSA 1Z6ZA 3PJDA 1HXHA 1ZXLA 1OFGA 3P5SA 1K5HA 2PH5A 3JQ9A 3Q3CA 4J4HA 3N74A 3HHPA 4N7RA 4RVGA 2IRWA 3JQ7B 4EJ6A 3IL2A 3RBVA 1ZK2A 2VUTA 5T67A 2HMVA 2J8ZA 1Y8RA 3OQBA 3WNVA 2B4QA 5HS6A 2DU8A 2HKIA 1PR9A 3EZYA 2O4UX 1X7GA 1H2HA 1IOLA 4IJWA 4GWKA 4BO2A 4RLHA 4YJFA 1C1XB 1HDRA 4Y67A 4YT8A 3JQ6A 3SXPA 1U4SA 4GSLA 5FF9A 4PLCA 4I9NA 2B0JA 3RCBA 1EVJA 1EVIA 4TWRA 3RI3A 3WB9A 3OSUA 2Z5LA 4IMRA 4O5OA 4HFNA 1F14A 2GN9A 4BNJA 5A5FA 1HT0A 3SC4A 3FBGA 4MVJM 4Z9FA 4CQMB 3FBTA 4QXMA 2PZLA 4M86A 3A06A 5DT9A 1HZZA 3NDJA 4NU5A 4J43A 1YDWA 3TNLA 1X7DA 3OF2A 3JQFC 4C7KA 2D2IA 1T1RA 1N9GA 1O95A 1MC4A 2Z1MA 3AI3A 2VHVA 5T5QA 2ZYGA 3HADA 4CM6A 4RLSA 3AU9A 2X5JO 4RQUA 1TB4A 2AEJA 1R4MA 4EEZA 4NR0A 3W4IA 4D46A 3ZGYA 2GR9A 1GR0A 2PY6A 1HF3A 4O59O 3E9MA 4UVEA 2BFPA 1GCOA 3BMQB 5IZ4A 1VSUA 2GLXA 4EEXA 3GK3A 1EK6A 5TQVA 3PIIA 4BL5A 4CQMD 1WMBA 3SVTA 4OKNA 3WGGA 3BMNB 4TZKA 3B1KA 5KOIA 4FDAA 3SLGA 1E6EA 1WW8A 3GR6A 2AMFA 5B37A 4B8WA 4Y9DA 3LC7O 5KKAA 4FB5A 3JSAA 5KJ1A 4UULA 2E6UX 2ZQYA 3WFJA 1GV0A 1P0FA 1E7MA 3GHHA 3NDIA 3SX2A 3ZV4A 2EV9A 4BNWA 3ZHZA 2YV2A 3VZPA 1I3LA 1WZIA 2JAHA 1N92A 3M2TA 3NRCA 3R6DA 5DF1A 2Z1NA 1ZSYA 1S7CA 1B3RA 4WOKA 5JSFA 3DQPA 3LC1O 1Y8QA 4YRDA 2B37A 4CM7A 4J6FA 4ZD6A 1BW9A 3DTYA 2RHCA 2DBRA 2B69A 3JQFA 4Q3CA 1ISMA 1C1DA 3PZBA 3WYCA 3EC7A 2Y1CA 1LSJA 3OJ0A 1LLUA 1ZUD1 3GEDA 4YDRA 4WNCA 1YB4A 4ND2A 2CVOA 3FTNA 3ZW9A 5L7TA 1LXCA 3PI7A 5KVSA 1I3MA 2F1KA 1KEWA 3D3EA 2G0TA 4GKBA 2DTDA 1KY4A 2QQ5A 1P45A 1J49A 1WMAA 3H6KA 1HLPA 2YHIA 3E03A 2VWGA 3Q2IA 4J4TA 2EP7A 3PTZA 5TRTA 3VPSA 1H6AA 1WPQA 3A4VA 2D59A 2C5EA 4WCFC 1ENYA 1YOVA 1K0UA 1KY5A 2X8LA 4LCJA 2CY0A 4R1TA 5I7FA 2ZCVA 3GNTA 4P38A 2P4HX 2WM3A 3PGXA 3M6IA 3L6OO 1KERA 5DDIP 1JKFA 1N1EA 3S8MA 1RJWA 4CODB 5CEJA 4FGSA 4B3HA 2AEFA 3H5AA 1VC2A 3UCEA 3WICA 5L4NA 3OECA 3CMCO 3ZI0A 4RF5A 5EQFA 4PN3A 2YQ5A 2ILTA 1BXGB 2VOEA 1U5CA 4R3NA 8LDHA 1YE3A 2NU7A 2X1HA 4GX1A 1HSOA 2NQTA 2PK3A 3SEFA 2NTJA 4QO7A 2HQ1A 1DPGA 1KVUA 1IPFA 4O0LA 4L74A 2Y0DA 2NU6A 5JE8A 5GZ3A 4MINA 5KJ6A 3W8EA 3OIDA 3M1AA 2C82A 4P4GA 4DYVA 4E12A 2J5QA 3PQEA 1JN0A 4FFOA 1DOHA 1SOVA 1Y8RB 2Y67A 5IN4A 3EVNA 1ENZA 3DBRA 3TJRA 2YUTA 1EE2A 3VH4A 4JLWA 3DZKA 2Y1GA 3DZJA 1DLJA 1KVQA 2WD7A 4R1SA 4YJFB 2VHZA 3NGXA 5CEEA 2CF5A 1MFPA 5ADHA 5DCYA 4WCFA 4RVDA 4R5MA 1U1IA 1DHTA 1ISIA 2NUAA 3C85A 3H4VA 3DDNA 1QORA 5BQFA 1DLIA 1WAMA 4FN4A 1MUUA 3E6AA 3AFMA 3DZIA 3DZBA 4MIEA 3DFUA 1YS4A 2AG8A 4ONEA 7ADHA 1BMDA 3GGGA 1FDVA 1HDXA 1SC6A 3ONEA 4I5DA 3PJFA 5F5LA 4RCVA 4WGGA 5A9SA 2PLAA 4IJVA 1ARZA 1FXSA 1LTHR 2GN6A 1XHLA 4DIFA 3PHHA 1PL8A 3JV7A 1N9GB 2AQ8A 2NVWA 4R69A 4D0SA 4G2NA 4B7CA 2BFAA 1WDMA 3DB2A 5LC1A 3QQPA 1K6XA 1S6YA 1R4MB 1R4NA 4P4NA 2ZTLA 3V1YA 3BMOA 5F5NA 4BO9A 3V1UA 4CL8A 5EERA 1XSEA 3AUAA 1DC5A 4IGEA 2HMUA 2BLLA 1CEQA 3UCFA 2JJYA 2Q4EA 3GZ4A 2HRBA 3LLVA 2Q2QA 1QYCA 3PYMA 1I30A 1PZFA 3C7CB 3BYZA 3VTZA 1A5ZA 4BGIA 3CKYA 3JYOA 4BKQA 2CDAA 2CD9A 2J3KA 4FS3A 3ZWWA 2NNLD 4R9RA 4CJXA 1HZJA 1R0LA 4IIVA 3S2IA 3FNHA 4CR7A 5G0TA 1LDEA 1E1MA 3WTBA 2D5CA 2C2XA 3OH8A 1UDAA 4DGSA 4GWGA 4BKUA 5A3JA 1OC2A 1L7DA 3AY3A 3R1IA 2PNFA 2A4KA 4DC0A 4ZU3A 3JQBC 4E21A 1E3WA 4YWJA 2EERA 3WYBA 3JQ8A 3HSKA 4XQGA 3EHEA 5EESA 3JYNA 3WYEA 4GPD1 4JX8A 2EP5A 2HAEA 2I66A 4I9HA 2GZ2A 1Y8QB 4CMHA 4CMCA 5HWSA 4XA8A 3ZH2A 4ZQFA 4M1QA 3BZUA 1PL6A 3ZV3A 3F1KA 4YVFA 4HNHA 5TT0A 1C1DB 4J7CA 2ZTVA 1U8FO 4PVDA 4Q3BA 2HJRA 1FDWA 1YH3A 3NDRA 2O2YA 3IDSA 3TPCA 2OFPA 6ADHA 1Y5MA 4FJ1A 2CVQA 3IP1A 2ZTUA 1DDOA 3TZQA 5LDGA 2JD2A 5A05A 4LMRA 1QSGA 3QRWA 5KKCA 2YHUA 4Z9XA 1BDMA 1U9JA 5EJ2A 3O4RA 3QWAA 4GSKA 3OJOA 1NX6A 4FJ2A 1NPTO 1T25A 2XXBA 3CE6A 4Z3KA 1QYXA 4R9SA 3F5SA 1YOVB 1Y9AA 3QVTA 3ZWXA 3WLEA 1LC0A 2O50A 3U0BA 3S1LA 2VUSA 1WNTA 3H2SA 3K2BA 2EWMA 4WEOA 4WJZA 4FC6A 5IDXA 2WE7A 5BSEA 5B1YA 3VVCA 1H6CA 4ALMA 4ZN6A 5A02A 1Q1NA 2W90A 5H82A 4RPJA 3LT0A 1RPNA 2JCVA 1G6KA 2O3UA 3IAHA 4AJKA 4UUPA 4NBUA 3JQBA 4DPLA 2PH3A 5GMOA 3G0OA 4YCAA 2HMTA 1XG5A 4I08A 3F9IA 4AJ2A 1SEVA 4MVJG 1TI7A 4Q39A 1XCBA 4XKJA 1ZKMA 5CPBA 5L45A 3JQEA 4M89A 2O4CA 3QWIA 4CUJA 1I0ZA 2C29D 1IE3A 3OIGA 3PXXA 4AJOA 3INRA 1OI7A 3B6ZA 3WGIA 3JQDA 5JYEA 3ZDFA 2UAGA 4U5QA 4BO1A 1LX6A 1O5IA 5AQ1A 1HE4A 3HB5X 4WLNA 3T4XA 4HUJA 1ONPA 1YL7A 9LDBA 1ULUA 4KOAA 3VHRA 2E82A 3DBRB 3HFGA 4M87A 1E7SA 5C37A 4CM9D 2WD7B 1B7GO 4ALJA 1SOWA 1J6UA 3GMDA 4AJ1A 1Z82A 4BB6A 1R37A 4KUGA 4LSMA 4A2CA 4BKRA 4E0BA 4FIZA 1XEAA 4E4YA 1O6ZA 1UXHA 2VHXA 4UUMA 1VRWA 1AE1A 2GN8A 5CHEA 3WQQA 3GY0A 4E32A 1HYGA 2FRDA 3WG9A 1GUYA 4RGBA 5ILGA 1PJQA 2PZKA 1CQJA 2R2GA 3IUPA 3ZW8A 1LSUA 3ETDA 4OOFA 1K6JA 4HKTA 3DBVO 4NZ9A 4DL9A 5A9SB 3HDQA 2C59A 2Y1OA 5DN9A 2JCYA 1Y1PA 2AHRA 5THQA 1QYDA 3PZRA 2GYYA 3AU8A 3QLJA 4ZQHA 2IEDA 2UUPA 4CLXA 3K92A 4R01A 1DIBA 3L6DA 4CMJA 2GDZA 1O94A 3F4BA 5A1TA 2VTDA 2EHDA 1R4NB 4MVJP 5HS4A 4L4RA 2LDBA 1SMKA 3KYBA 4JIGA 1HETA 2RIRA 5AXAA 4ALIA 2PTGA 3F46A 2FPGA 1YQGA 5IXSA 5I7SA 2WD8A 5KVQA 1NWHA 1EVYA 4ITUA 4XJSA 4XR4A 1X1EA 3W4KA 1UXGA 1UXIA 2VRCA 2BKAA 2EGGA 2VNAA 1PIWA 4IDEA 4CV0A 2JHGA 1CIVA 1O0SA 4J1TA 3VTFA 1GUZA 4P4LA 4TKLA 1ISFA 4TRMA 3NAQA 2VT2A 1JKIA 3P2YA 4GGPA 1LDNA 4J7XA 3RC2A 2R00A 1PJCA 4XB2A 3PHJA 1ENOA 1B8VA 4J0EA 2VHWA 1EEHA 4MP8A 3NKLA 2HMWA 2XOXA 3B1FA 4NJMB 5TT1A 1UP6A 3HJAA 3OETA 3OP4A 3TN7A 4L75A 1E3WB 3ZHXA 2GD1O 4CMGA 3JQ8B 3HDYA 3PGJA 2X22A 1HYHA 1NP3A 3NT2A 4KZPA 5EIOA 1UAYA 2PGJA 3INGA 3D5QA 3NTQA 3W8DA 3WGYA 4BO5A 1A7KA 2Y0EA 1HWYA 4PRLA 4FBGA 1N2SA 3ADOA 4E6PA 4BHTA 5L7WA 3MJTA 1N7GA 1AGNA 1DFIA 1Z7BA 1EUCA 2HJSA 2IDZA 4H16A 3W4JA 4RF2A 3MWDB 2Q99A 4XRGA 3NYWA 3Q9NA 1UR5A 4HBGA 2WDZA 1MG0A 3WBFA 2DFDA 1DXYA 3I9JA 1K3TA 5TSDA 3WWYA 4FSHA 1DBVO 3WFIA 1JA9A 1QRRA 1ZK3A 4GLLA 1WDLA 3KLMX 2WE8A 2VZ9A 5IZCC 1P9LA 2BI7A 1Q7GA 1RM5A 3QWFA 2OBNA 3TSCA 3I4CA 4OOEA 4BQPA 5G0WA 2X9VA 4IDGA 3CMMA 3KZVA 1TEHA 2PA3A 4NPCA 4IQ0A 4B7UA 1DC6A 3QIVA 3CZRA 3FWZA 3DTTA 4IQ8A 4KUEA 1AXEA 4RZIA 3VOSA 4B4VA 4I5FA 3OJLA 4NIMA 1X0VA 4RV9A 1M2WA 5MDHA 5KVVA 3FNEA 2E49A 7MDHA 1P1JA 4O63O 2QRLA 1KBZA 1E0DA 2B4TO 4CQLA 4J4BA 4PLWA 1R12A 1ISJA 4CV1A 2V6FA 2VYVD 2DUWA 3GZNA 4YJGA 3RWBA 4DLBA 4OQZA 1O9BA 1PSDA 3C1OA 3QVXA 3VKUA 2DM6A 4AL4A 3E8XA 1W73A 3B20A 2RCYA 4WASA 4K1LA 3V8BA 4EW6A 3RBZA 3VPXA 4QT0A 5A5EA 2GSDA 4NK4A 1D3AA 3IS3A 5DULA 1KVTA 1R6DA 1PQWA 1D1SA 4UVHA 4W99A 3ETGA 2C20A 3I3OA 4CLEA 1PX0A 3LT1A 3EVTA 3ICPA 5FWNA 1V0JA 1ONNA 3UKOA 4BO8A 1GU7A 1DAPA 4Y6SA 3SC6A 1EE9A 3MCVA 3WSVA 2FZEA 3U3XA 4NBRA 4BMNA 2Q2VA 1VKNA 4ZGWA 2JCXA 4C7JA 2OZPA 3BA1A 3GPDG 4LVCA 4PRKA 5IN5A 3ANLA 5F1OA 2CFCA 3DHNA 3EK2A 1E3SA 1MA0A 4J1QA 1NM5A 4LN1A 1H6DA 2YV1A 1FDUA 4XX0A 1JVSA 1A71A 4Y6RA 1LA2A 3D3WB 3PLRA 4PLHA 3RC1A 3WNQA 1LRJA 1PGOA 2E37A 5L95A 1KEPA 2UUOA 5MGBA 1LC3A 2X0NA 4D3DA 4ZICA 3NUGA 4DLAA 2O23A 1OBFO 2DTXA 1Q0LA 5JDCC 1VM6A 1T2CA 3KYCA 2FY8A 1P1IA 2DUUA 1CJCA 3X2FA 3PHLA 4D45A 5BSFA 3IKTA 1IUKA 3C7DB 3HG7A 3N58A 1MC5A 3NJ8A 2QX7A 2WJPA 2DFVA 2JHFA 4BNKA 5FI3A 4IS3A 3CXRA 3FI9A 3UW3A 2VOJA 1ZJZA 4S1VA 1LQUA 4XQEA 1PJSA 4ZA2A 5TNXA 3VH2A 4J2OA 4DIBA 1T2AA 1X7HA 1H9AA 5G4LA 2ZK7A 4ZVVA 5JY6A 1M6WA 3KRTA 3WLFA 4JGBA 3Q6IA 4LVUA 3BIOA 3TL2A 4E13A 2V6MA 1PQUA 3DZFA 3GVCA 4DBZA 3ZZNA 3PWSA 1SEPA 2QRJA 4HFRA 4FOOA 1FJHA 5I9MA 4TSKA 1MP0A 4PVCA 1LDMA 3R3SA 1BTOA 2RBEA 1MV8A 4UREA 2AE1A 3G1UA 1DRUA 3QVSA 1XLTA 4BO7A 4AJHA 3GT0A 1RKXA 4W82A 5L7YA 2FN7A 2DTEA 4MVJE 3TZKA 3MWEB 3Q9UA 4IZHA 1E3LA 1G1AA 3H9QA 2FR8A 3D4OA 3O9ZA 1Z45A 2EIHA 2HMSA 5IFLA 2ZB3A 2O3QA 4ESOA 3TOZA 1YDEA 2NVUA 1LDGA 2VRCD 3GOHA 4BKPA 3PDJA 3DOCA 3Q11A 1E7YA 4BNUA 2J6IA 5JDCA 2H9IA 2BFOA 4EUHA 2P5YA 3U49A 3RJ9A 3OBBA 2UV8A 2VQ3A 3W8FA 1P1RA 4MVJI 4R1UA 2O3SA 5T57A 3PWZA 5IJZA 2WWRA 2UDPA 4MDHA 4TVOA 4KQXA 3CTMA 3ZU3A 3NTRA 1C14A 4M54A 5DCUA 3STHA 2DLDA 1B26A 2EKQA 3QVOA 4Z9YA 3VZRA 1HLDA 3WS7A 5DP1A 3RVDA 4BNLA 3OM9A 4KUHA 5HTOA 4DPMA 4RPGA 2HUNA 4FOSA 2YW9A 1YBAA 1EQUA 3Q0EA 1ZNQO 4L73A 1NFFA 4IPTA 3RAJA 1SPXA 4DVJA 2CVZA 5C7OO 3ON5A 2BH9A 4U6QA 1ZEJA 3PJEA 1SAYA 3TRIA 3I6IA 4BNYA 1CERA 4GVLA 5CDSA 1XA0A 2XAAA 3F3SA 2I99A 3PDUA 1ZZEA 4I1IA 4OMUA 1LLCA 1C0KA 3GNSA 3KV3O 2D5AA 4XGIA 5I9NA 3QHAA 1UUFA 3PWKA 4IDBA 2G5CA 4YEDA 4W4TA 3ICCA 4CM4A 4DBVO 1XKQA 4BNNA 3QVWA 5A3VA 5K6AC 3IUSA 3V2HA 4ALKA 3GZNB 4YJGB 3MJVA 2NLOA 3AI2A 1UJMA 5TX7A 4YQYA 3DAPA 3GA0A 4JN6B 3WGQA 2B4RO 5L51A 5A9RA 1A72A 1T4BA 2IEBA 4K9DA 2P5UA 1HE2A 2TMGA 3UCXA 1ZK0A 2VHYA 3HN7A 3KO8A 3QP9A 4WECA 4NK5A 4KQWA 2V7PA 4ND1A 4MP3A 2I3GA 3K2EA 4J2HA 1P1FA 4URFA 1LEHA 1T24A 1JAYA 1XIVA 1NFQA 4W7IA 2X0JA 4BNTA 1I2BA 3ZHBA 2BF7A 1EFKA 3FR7A 4B8ZA 3KYDA 3H2ZA 2IYPA 2JD1A 3BHJA 1B8UA 5CDTA 3V1TC 4YQZA 1Z7EA 1H5QA 4KDEA 5BR7A 1I33A 4E5PA 4CV2A 1NBOA 3ZNPA 3KSUA 3KEOA 1LDYA 4AG3A 1UDBA 1VPDA 3DBHA 1DJQA 4IM7A 4F46A 3GEGA 1LQTA 2X0IA 1FK8A 3WGHA 2WMDA 3DZGA 1NR7A 5IXYA 4Q3AA 4RVFA 4N5NA 3UOGA 4BNFA 1PJ3A 2QZ9A 4DQVA 4L0QA 3L4BC 1NHGA 3RUDA 3ZWMA 4K6CA 3HFSA 4FFNA 2CF6A 2NVBA 3H3JA 2PWZA 1U2DA 3LDHA 4R3WA 2Q4BA 5AVOA 3FN4A 2ZJ0A 4FCCA 3HDJA 5K6AA 4YBZA 4II3A 2R6JA 5EN4A 4JQCA 1T2EA 4CM9A 4AJEA 2HSDA 1TXGA 4YJHA 1WLYA 1X14A 2J5RA 3K96A 4R54A 4XGKA 1UP4A 3S2EA 3ZHYA 3UVEA 1PGNA 1MG5A 2HCTA 4FFLA 3HZZA 4W9NC 1B0AA 1LSOA 1LUAA 3WSWA 2AW5A 1UZMA 1RYDA 1GV1A 4W6ZA 3ROQA 4CM3A 1ZIDA 5I8ZA 4RQTA 1CYDA 1GY8A 3CZMA 1QLHA 2IYOA 3FSRA 4FFPA 4OM8A 2VCYA 2X86A 1VSVA 4MP6A 3HE3A 4IIUA 3MOIA 3WMWA 4CUKA 1F06A 3SJ7A 4IJKA 4D3FA 4EDFA 3VC7A 5ICMA 2FOIA 4J9VA 4TQGA 3WDSA 3IOYA 1K2WA 4TZTA 3OA2A 3BTOA 2YY7A 1E6WA 2CDBA 3WR5A 4D43A 5ENVA 1YVEI 4KP7A 3ZNNA 3U4CA 2G82A 2CNBA 2NTVA 5ILOA 3I52A 4XCVA 1P74A 4IZIA 1QYVA 3H5RA 1KVSA 4E5MA 2P9GA 4MKRA 4I8XA 3L4BA 2ZYDA 4NFYA 2NVUB 1LDBA 3I5MA 1MFZA 4OL9A 4XYBA 1M67A 3IKVA 2X5OA 4CUZA 4QFDA 4RVSA 1V3UA 1DHRA 3P7MA 5TGDA 1PWXA 3PP8A 4XIJA 2X7HA 1C0LA 1HRDA 1LSSA 2XF8A 4FPXA 5G0UA 4DREA 4DPKA 3BMCA 1BVUA 2A92A 3L07A 1X13A 3F1LA 1HEUA 5JS6A 3OHSX 1ZW1A 4E5NA 1EBFA 4PCVA 1ZFNA 2V6BA 1VLLA 3RC7A 1H93A 1PS8A 3NT5A 4OIMA 1FF9A 1EDZA 4MVJF 5HBRA 5ER9A 3PLNA 3O03A 9LDTA 5IDQA 2WEKA 3TOXA 4BMVA 1ZO8A 1GEGA 1W0CA 3ZU2A 2GN4A 2OGUA 3WX0A 4B7XA 4BGEA 1AHHA 3D7LA 1P1HA 4NU6A 4OYRA 1PEDA 3VH1A 3TWOA 1KEVA 3I9NA 2FR1A 3VDQA 1EK5A 1VJ1A 2WTBA 2IE0A 5F21A 4DWVA 1DFHA 1ZJYA 4R68A 3JQAD 4H3VA 4CM4B 1V6AA 4QO8A 4UVDA 3W6ZA 4YYZA 5JW6A 4IBOA 4BO0A 1J0XO 4J90A 1R15A 2C07A 4XDYA 4IQGA 1V8BA 1CQIA 4FD3A 2I9PA 4NQZA 4EJ0A 4AJPA 5L4LA 5FFFA 4B4UA 2GUGA 1R66A 1BG6A 4QTZA 3EYWA 4ND5A 1Y9EA 1BW9B 1KYQA 3BTVA 2EKLA 3COSA 1F12A 2DKNA 4FC7A 1PL7A 5JMWA 4GX0A 5COAA 2NU9A 1E7WA 1T2DA 3GAFA 5F3RA 3ENKA 4QECA 3LT4A 4RL6A 1GDHA 2EJVA 4NMHA 5KCZA 5J23A 3GDOA 1ADBA 1ONOA 1H94A 5BNTA 3KYDB 4XD2A 2YHIB 1DO8A 1R0SA 3BTSA 4GVXA 1MX3A 1YGYA 2GERA 3F4LA 1NAHA 3PEFA 5JPIA 4N5MA 3GVPA 2VYVA 3AM5A 4OKIA 2OUIA 1U3VA 4XR9A 5B4TA 3GRPA 1PR3A 4B3IA 2BHLA 3LT2A 2GF2A 1E3JA 2W2LA 4AVYA 3G17A 4JBGA 2D1YA 4WLOA 1GADO 1JWAB 1B15A 4OXKA 2TMDA 2NU8A 2FPPA 2P2SA 2QW8A 1LLDA 1N8KA 3OICA 4BUCA 3FNGA 4LGVA 5U9CA 3SBOA 1PZHA 4A5OA 4DRYA 4Y6PA 1DJNA 1NPYA 2FSSA 3ZWVA 1QR6A 2XPCA 5JC1A 3H9JA 1U28A 3JD4A 5H81A 1KC1A 2ZQZA 4E30A 5IDYA 3OEWA 4IXWA 3QV1A 2VRBA 4YJHB 5I7VA 1WWKA 2FP4A 4PZCA 4RDIA 1D7OA 1RM0A 2CZCA 3D64A 4KMSA 1LU9A 1GUFA 4E33A 3JQCA 3G49A 4PLFA 1DRVA 1A4IA 3M1LA 3NGLA 1VL6A 3RSHA 4E2XA 3GQVA 2I67A 3ZU4A 2YV3A 1GYRA 2IZ1A 1WXDA 1F17A 2WYVA 1E1KA 2OO5A 3WQSB 1QYWA 6LDHA 1WP4A 5TJHA 4RDHA 4MO2A 5IF3A 3VPFA 3KM0A 4G81A 1KVRA 3OJFA 3UICA 1A27A 3C24A 3ST7A 2O3JA 1UH5A 1AUPA 4WCFB 3JYQA 4RPHA 4BMSA 4YXFA 1HDCA 3OQ6A 5AXCA 5DBIA 1Q7CA 3AOGA
chains in the Genus database with same CATH superfamily
1PW5A 4LXGA 3VDRA 2KZVA 3B82A 4XWYA 2VRNA 4V24A 4QG3A 1QH8B 5HRUA 1FTYA 3ND5A 4DV6B 2V7GA 4AJ9A 3F8SA 4OXXA 3KHKA 1I4LD 1L5QA 4X0EA 1U2GA 4GX5A 1MB2A 3ZV5A 3OS0A 1Z3XA 5CX1B 4OJQA 2BDTA 4Z0TA 4YXWA 2YS9A 1FP4B 1PJBA 3MZ0A 5F2NA 1Y1WJ 1L1RA 2FSVC 3RVJA 4R9UC 5DD8A 4CMEC 4YH1A 3WGTA 4QQRA 4ZAZA 1SXGA 4JVMA 3JRNA 2D7DA 4LW8A 4K6MA 3ZJ4A 3VHXB 3R5SA 5HK9A 1PGPA 4LQCA 1D4FA 1SUSA 1N7HA 1WXEA 3HOYJ 4V0QA 4D80A 3RYPA 4DSZA 1K4YA 1CZNA 5COQA 3MJSA 3O4JA 4B3SB 5EL0A 5TPWA 3FJYA 2ZYIA 2N47A 4JBYA 4B2PA 1RZ3A 3KOXA 4NQWA 3WXBA 3FTPA 3LLMA 2HLPA 1G4DA 5CAEA 3AVPA 3RIMA 4TTRA 1JAZA 4AQYB 2H63A 4AU1A 3OO0A 5DNYB 4P4TA 1JHZA 4LCEA 4EH1A 4FETA 4GPTA 3WAKA 1VQNI 2VDQB 5FOTA 1U3FA 4OBWA 5BWNA 1OX4A 4X93A 3L18A 3N70A 3CDIA 3PR1A 5LFAA 4UNQA 2BE7A 3BCAA 4M9UA 3EAGA 3HKZN 2IYXA 2I10A 3V2UA 3I56I 3DDWA 2BZTA 1XRLA 2R7AA 2I4MA 1I1SA 2JHAA 2C2HA 2F3QA 1CS4C 2IE8A 1Z38A 4P3NA 2XUHA 2GYUA 2K9MA 3NWSA 2QTCA 1XTAA 4HUTA 3Q9SA 3S17J 2G83A 3R6LA 3IE0A 1PZEA 1IXRC 3MJ4A 2ID6A 2R8RA 1XPUA 1MF7A 3K1ZA 3PUYA 1O8CA 5C53B 3L2QA 5G0VA 5KWIA 1PFQA 3CH4B 1J33A 1KIAA 3IUEA 4BVBA 1AGPA 5AKJA 5BY2A 4U9UA 5JUWA 1Q1BA 2GCOB 2P3SA 5LYJF 4F96A 4G0QA 2R5NA 3ICQB 1VJCA 3OWXA 2H18A 1N9ZA 3PUIA 5IEBA 5JHGB 4ILKA 4ZO6A 3VKFA 1CJTC 4CIVA 1H4TA 4B6SA 4GD3Q 5JSHA 3HCEA 3OO1A 1ZGZA 2CNKA 5IAOA 4ZRNA 1GVHA 1T8WA 1G8AA 4B46A 2X0RA 5B3JA 4C14A 2BEWB 3K9QO 5KNBA 2H2IA 3BL6A 1KONA 4EMTA 3CW8X 1X6VA 5DYTA 3UJAA 3DPIA 4KG7A 5JATA 3CPJB 3W3ZB 1ORDA 3GYBA 3O84A 3QM1A 3CCVI 2FRHA 3L6RA 2QUKA 3FK6A 4LWOA 5A71A 1QTIA 4HAOA 4QDTA 3JRDA 1YZHA 1F9NA 1RWWA 2YZ7A 4QIWN 2XT6A 3OJEA 3CEMA 3PUVA 3GDGA 5E6UA 4RXMA 2Y99A 5GVRA 5TMPA 3HYRA 2EHJA 2L2OA 2A9FA 2I03A 2QRGA 1GXQA 5FHQA 3T06B 1GXSB 2PSJA 2PZMA 1K6IA 1M8FA 1O6CA 4I3GA 4N18A 5DRYA 4D8VA 2EKBA 4G6TB 1XAJA 3DOUA 3VPBA 5ENDA 2CCJA 1O4XA 3DMTA 1MMFB 4U7WA 4YAIA 3E5UA 1P60A 1TKRA 5H9VA 2VJIA 4DGQA 3L00A 3MTQA 2W0SA 2C1XA 3I28A 4XONA 4K81B 1USKA 1FLVA 5T6BA 2VWHA 3GPCA 3LPAA 4J16A 1PK9A 2W2KB 3IJRA 3GFBA 4F2DA 3H9EO 2RD2A 4CLHA 4BU0A 3JWGA 2I9KA 4R51A 3YASA 2ZIZA 4Y2XA 1RVDA 2V45A 3TZEA 4Z4IA 1MBFA 3TL3A 4C20A 3CZ4A 1OFUA 3P19A 4JZKA 1V8DA 1G6OA 2YJZA 4NG5A 2VJKA 4Z4HA 3AR4A 4BNMA 1JQBA 1MEJA 2YJ3A 3A6DA 3T7KA 2HU2A 2BZ0A 3TTSA 5K8UA 2WA0A 2A0XA 1JKPC 4PC7A 3E18A 2FQWA 5FWXB 3LHKA 2PVCA 2WJVA 2Z6QA 2N46A 4EJSA 3JD2A 2O0KA 4D6YA 4PO9A 2JRTA 1O54A 4MEAA 3E6MA 3TZ6A 5JQWA 5KSWB 4EAAA 2LVBA 1D8AA 1F0NA 3E9ZA 5CM8B 1JSXA 3QLVC 1OR7A 1IV8A 1U0LA 3NBUA 4BFVA 1I6LA 1RRFA 4K26A 3QA9A 5FWYA 1E5LA 1WW2A 5DFAA 4ZO4A 2XDQB 1P77A 4F7ZA 2W6JA 3L1PA 2GCNA 2P9EA 2RGWA 3UOAB 4LNUA 2R3SA 1WZNA 2RB5A 2YXBA 3I6ZA 1J2EA 2HH9A 1LEBA 2ZUVA 1XLWA 1A2QA 4PBRA 1KGSA 4W5QA 2OAQ1 4DA8A 3IA7A 2BTOA 3ED1A 5AO9A 1EHCA 2BFFA 2WY8Q 2FPIB 2XF6A 1WDKA 3ZWPA 1LE8A 3TEDA 4WRRA 4KGZA 2PS0A 2QDKA 3K70C 4M8SA 5FRDA 3WK8A 4WLFA 4KDRA 1Z77A 5FNZA 1YB6A 4HEHA 4O4LB 2XMSA 5KS2A 1E1QD 1H0KA 5F1PA 3FRIA 2P6PA 1OFCX 4LI0A 2ZUUA 2MLGA 3KE9A 1L7PA 1OYWA 3AEQA 3GI1A 2J30A 3BGIA 1H3FA 1OX5A 4Q9HA 1ETQA 4AN0A 3UO8B 3KYLA 1DJOA 2R6AA 3IQHX 2H27A 4IX9A 4EG3A 3DZHA 4DSNA 3TBKA 4YAGA 4GMGA 3FSGA 4IV0A 4ZVTA 4TYWA 2TYSB 3AY6A 2ANCA 2GRAA 1DXOA 2BR3A 2E5WA 3S5UA 3B73A 3VR4A 3PL8A 2P4QA 1RSZA 3G1OA 1A31A 4MVYA 2ZE8A 3ECCA 1WDWB 3TUZC 1O89A 3PEVA 4BEJA 3OHPA 4A5MA 2Q3JA 1PJ2A 4PLTA 2B0LA 3AILA 2ZVDA 3SPXA 4PAWA 1FPQA 5DWDA 1P39A 4HF7A 3DLTA 1JFVA 2I7TA 1ZCFA 4L4UA 2PV7A 4QEKA 3VU8A 2YWGA 1SUDA 3FLBA 4C0BA 3H7AA 2H16A 2Y2ZA 1DKNA 3CCYA 1ADFA 4QA9A 4CLDA 1MV5A 3BF8A 2H1SA 1MB3A 3N86A 1XI2A 3MMNA 5EJ9A 4O02B 2X8WA 2EW2A 4P84A 1RBMA 1XZCA 1S72I 2VJMA 5LKRA 3B60A 4IVNA 4RVUA 1KKMA 3DW3X 1J99A 3PB3A 2EC5A 1BI2A 4PWYA 1BA2A 1JKMA 4LMPA 3MWFA 1RHJA 4I50B 3K7AJ 3HYCA 3MRTA 1JT9A 5ESRA 2AN5A 2LD4A 4U8HA 1MR3F 3WL4A 1MZVA 4RBNA 5DH9A 1VGVA 4Q37A 2VDRB 2N9UA 4P0TA 5B4VA 3MQ4A 2IPAB 3DMHA 4MHOA 1HMYA 3OLYA 3Q3CA 4RA2A 2GTHA 1ZC4A 2WIJA 3DE6X 5AHKA 2KSQA 3G82C 3RPUA 3ABMH 2IHUA 4YJFA 4P2GA 2QSZA 4GSLA 3K70B 3PNMA 3SHTA 2V9VA 1MBEA 1KYYA 4ID3A 2YN0A 1EVIA 3AIMA 4DJJA 3CZQA 5CH8A 2VT7A 1XMKA 2OV7A 4WFQA 5F52A 2I2BA 1WPXA 3DGEC 2NNYA 1M2NA 3NQOA 3M6WA 1NY6A 2EFPA 1E4YA 2VJNA 3K20A 1MC4A 3MBOA 1QQ6A 3AI3A 3A2LA 2E71A 2O0YA 5JJIA 4AMUA 5C81A 3ASYA 4JLBA 2FEZA 4BAUA 1JBKA 4BVKA 2J0EA 1IXYA 4OLHA 3OC6A 4HLNA 2AFIB 2PBZA 3ZV4A 3TP0A 1USSA 2VSOA 4UNOA 3FFWA 2FQXA 4DAOA 5FUXA 4WOKA 4WKOA 2WMNB 4G24A 3NIDB 3VSKA 1NRXA 4MQ4A 3WYCA 1E8DA 3R8XA 1T3LA 3NBAA 1I13A 1I3MA 3I01M 2DTDA 3RSQA 1ZMRA 1JA0A 3E03A 4J4TA 2EP7A 2RG7A 2PWAA 2RBGA 1SXIA 4ZZ1A 1AKWA 3RARA 3CCQI 4PS1A 1DXHA 3GTGJ 5FV7A 1WX1A 3D7RA 4L8YA 4FGSA 2KI5A 2FJUA 3C3WA 4Y6GB 4HGZA 2IUTA 2YFKA 3FYTA 4AZ0B 2JGAA 5AVQA 3AERA 4PPYA 1M1UA 2XMRA 2NTJA 3GBVA 10MHA 4YIKA 3K8OE 2SKDA 3SICE 4K03A 1CRZA 2DLCX 5KHAA 1K97A 1U8AA 1ENZA 2AKEA 5GTDA 4LYFA 1A9PA 5DCYA 4EHNA 2P62A 3BKXA 2OSVA 1DLIA 1MUUA 3UJ9A 2ZXIA 3BC8A 3ZGLA 3RK1A 3VC1A 5D85A 1G3WA 1P0QA 2E85A 3ONEA 4I5DA 1DBRA 1W88B 4OQMA 4RCVA 3QMVA 2LBFA 3PHHA 1WKCA 4S1PA 1GGHA 2BHRA 4G1MB 5KMGA 5ICEA 1LJUA 3OOJA 4FZ3A 3X44A 2FEPA 4BO9A 1KA8A 2V9ZA 1N2CE 4LD5A 1ZNYA 1ENHA 1BZYA 2Q6LA 4LLGF 4F21A 3ZWWA 2NNLD 4HXFB 5G0TA 4UY8I 2D06A 2C2XA 1CU1A 2RHLA 2F4OB 3SGLA 4AXXA 4DLZA 1N5IA 1T35A 4GPD1 2MHCA 3F72A 2QN9A 4KO2S 4F4JA 5E4YA 5CVIA 4Q3BA 1FDWA 4LDNA 2QVYX 3U4GA 3TIGA 1GN9A 2BKEA 5AI6A 1ZXXA 1Y9AA 3RANA 4KIJA 2B94A 1CJKC 3R0ZA 1RUNA 1G8MA 4XSGA 4NPAA 1JR4A 1Q1NA 4W63A 4BJ6A 1UZCA 4UUPA 3G0OA 2G9NA 2HMTA 4AJ2A 3IT0A 3SYKA 1Y1QA 5LQCA 4CUJA 4MEJA 5KNDH 4AJOA 1SVMA 2YOFA 3WGIA 3KP1A 5KAFC 1O9GA 1QE0A 2UAGA 2KX7A 1SXJE 3TLGB 1FPMA 1L2TA 4HQ0A 4ZO9A 1YRYE 4C0QC 3BJIC 3WO1A 2VRWA 5HZHA 1WUKS 1KU9A 2X15A 4IR7A 3VI3B 3AF5A 3H2BA 3DWIA 1DAKA 2VI5A 3GY0A 2LXNA 4XFJA 3WG9A 2E7WA 4FK8A 3ZW8A 1QC5A 1U0NA 2O8DB 4PSAA 3JASA 3F6RA 3DBVO 4OI1A 5K3BA 1IUOA 1QYDA 3HA5A 2WR8A 4M1KA 4NZPA 4LOAA 4G23A 1NJ6A 1N2ZA 3NPAA 2VTDA 4EHLA 1IJFA 1QHNA 2Z8YM 3IP7A 2GBPA 2WD8A 4QHTA 4UTVA 1QQAA 1Q1GA 4LYYA 2MR5A 4IDEA 3WHPA 4MWSA 3LBIA 1JFRA 3SBXA 4WY5A 2P6UA 3KT6A 3A02A 1KDRA 3IV7A 2Z08A 1KAEA 1MJ5A 4JSTA 2ZRMA 1E3WB 4JDPA 2QTAA 4KH1A 3MWEA 2CV0A 4QLBA 3H9CA 3G9UA 2H17A 2O06A 1HWYA 4FBGA 1G3IA 4E6PA 1GSHA 4YCDA 3Q9NA 4BFUA 2DFDA 5TSDA 5AHWA 4MWTA 3C39A 1SUIA 1WSUA 2GM9A 1XZKA 3O8DA 2PEZA 3I4CA 3RDPA 1MO2A 4AZVA 4G4JA 4R6XA 5E8RA 4H1TA 4A3BJ 2IBTA 5JAPA 2ZDQA 3FOEC 1BHO1 5LLSA 3LUHA 1H3NA 4TYYA 3U7RA 2OO7A 2IYVA 4LXYA 2JA2A 4AVZA 3VKUA 3S8EA 3E8XA 1LZLA 3KR0A 4LYJA 3DEUA 3HCDA 1YQEA 1PX0A 3IQWA 2EL7A 2L17A 4F3QA 5FO5A 4DHEA 3WBKA 1BDHA 1RYZA 4AAYA 1UBUS 5J1UA 1ZVKA 4AKEA 3ZDYB 4NTZA 4UM5A 2Q3HA 4JBXA 4U2KA 2XB4A 3PSAA 5D8DA 2FUG1 2EV0A 2Q6KA 3NP9A 2G6BA 1PI3A 4MV0A 4C4ZA 1P17A 2Q4DA 1E8MA 3C1UA 1IUKA 2WIFA 3THWA 2QX7A 2WJPA 1T5LA 2VPZA 5HLIA 3Q7PA 4EQ6A 2BM1A 1IWPB 1EFPB 2OYRA 4WZ6A 2GBLC 4J94A 5AH0A 5C8ZA 2WQZA 4UE3S 4D26A 4DEVA 4W5WA 1PQUA 2KMLA 3IDOA 4INOA 5IH7A 4ZOQI 2DHCA 2EBUA 3VNQA 2AE1A 1CUGA 1YR8A 4V2UA 1V54H 1PR2A 4G25A 2X1LA 4WK4B 4Q5IA 3RJ9A 2VP9A 3IH2A 3DT9A 3ZU3A 3NTRA 1HBJA 1C14A 3NKVA 3WRWA 4I55A 1N33B 3NBFA 3K0EA 3LX8A 5HTOA 1XCJA 1E20A 3GRUA 3Q0EA 3I39X 4V1CI 3WHBA 4Y9TA 4CFSA 3TRIA 3I6IA 2I5UA 1CERA 5HZMA 1JT6A 5ALXA 2WA1A 1TW3A 4XGIA 2W43A 3FHTA 4NC9A 5EIBC 3ICCA 4BJ1A 4UAUA 1O0BA 2O8NA 1DWOA 4PZ9A 4HAVA 1GN8A 3ABRB 2IUFA 3LVBA 3BT9A 1H2RS 4FZJA 2V7PA 4MP3A 1MTOA 4TYNA 1P1FA 3NHSA 4EHAA 3GLIA 2FPRA 4KGXA 5TPZD 3DEKA 1G21B 1EFKA 1H42A 2WU1A 4Y9SA 1CVRA 2XUGA 3CRMA 3DL0A 3KZXA 3GTOJ 1NBOA 4F5EA 1UDBA 1WHUA 1FK8A 3VYTB 3T1QA 4LOHA 4OJYA 3OY9A 2L0KA 4DQVA 1LJLA 1G3UA 3BH0A 3ZWMA 2GO7A 5AQEA 4RQBA 1JYEA 4S04A 1JIXA 4PJMA 2NPFA 4KN5A 1KGDA 3PGMA 4P83A 3T9DA 1TXGA 1X14A 3NCHA 2F67A 4L9SA 4QPDA 4Z8YA 4YCMA 4A6DA 3A9TA 2QVBA 1X3UA 3HLTA 2ZW9A 3CC8A 2FDXA 4REQA 1KS2A 1F06A 3HZOA 4IJKA 1KOGA 4EGZA 3KWMA 2ZPTX 2DX7A 2IXTA 1S7AA 1IONA 4MKRA 3X1KA 3STTA 1OAOC 1LDJA 2QEXI 1O96B 5EJIA 3NBYC 4FUTA 4KPUB 1PF7E 5TGDA 1UOQA 5I9BA 3M83A 2I34A 2DFLA 4EFDA 5LZ7A 5K3FB 1VLJA 1HEUA 4Z7OB 4HPJB 2P6SA 1NVBA 3A37A 5FLKA 1P62B 2P2CA 4YUWA 3TOXA 2QP3A 3HXTA 1TZLA 4B7XA 2Q5FA 1ZMBA 1AB5A 4ZCPA 5EXXA 1GVDA 3DXXA 5LWHA 3RH0A 2FR1A 3O0DA 1VSBA 2YN4A 2HHCA 4HLCA 1P9WA 3AHHA 4H3VA 1V6AA 3CR8A 2AX4A 3QLEA 1GGFA 4EY5A 4N4NB 2D1SA 4X9XA 4AJPA 3GLSA 1ZONA 4ENVA 1Z26A 1WF3A 2Y77A 1ZM7A 3MS2A 2NU9A 1VI6A 4MUYA 1F36A 1ZLXA 4NMHA 5BNTA 1KAMA 4J0JA 2OB1A 3BJRA 1LKZA 3E9RA 3G6KA 4OHFA 3GRPA 4AYWA 3FAZA 5LVAA 1M8KA 5KSOA 4FHFA 4BUCA 4IOCF 5U9CA 3K9HA 3H9JA 2CUNA 2D45A 2ZQZA 5HP4A 1HDIA 2GEFA 1QIFA 2CMFA 1E3HA 2WJJA 4ZT3A 2TCTA 4E2XA 3VMMA 2FBKA 1Q15A 2FW8A 1IRXA 1GCGA 3E7XA 5EIBD 1BDIA 4LF9B 1J8VA 1NG6A 4MUHA 4CCAA 1EHYA 4L8WB 3S93A 4MHGA 4K6OA 1WY7A 1UH5A 5K4HA 4RPHA 4YXFA 1L5SA 1D2GA 2B63J 2IEAA 3DMFA 2IS2A 3BWGA 2F43B 5LYYA 2I4TA 1LZKA 1XL1A 4Q19A 4QFCA 4NJOA 2OGWA 3N7UA 4YO8A 5JEEA 4CWAA 1OCEA 3MNFA 4ACAA 5CDFA 3BMCB 4WWHA 1LB1B 3VGJA 4CF6A 1ANKA 1XDBA 4QNNA 4F8YA 4G9EA 1CRWG 4HDNB 2LF7A 5D6NA 2GHTA 4ND4A 2PFSA 3AEXA 4JYKA 4M49A 1D5YA 3S70A 2R7OA 4PZLA 4LHVA 1HE5A 3DHYA 3E5XA 3E9QA 1SCBA 4W5RA 3IVRA 1POXA 2Z09A 3NW9A 1WJBA 1YZQA 3OPQA 1THGA 1RQPA 3CDLA 1HLFA 3QWBA 5IVKA 5KQRA 2ASVA 4XRMA 5FEUA 4A0XA 2G1PA 3VR5H 4WZZA 2Q0OA 4R83A 2RAEA 5KIAA 3HB4X 1BXKA 2QG4A 3SCZA 2CJYA 3THYA 3IXMA 1XEXB 4AYXA 2AR7A 2II6A 2FVXA 2C57A 4LY0A 2GN2A 4ZZLA 1R16A 3P5JA 1MMSA 3ONNA 1DKPA 3WJ7A 1W5TA 3LRXA 4WGFA 1GJRA 1GPNA 4AZWA 3AUYA 2KRCA 1BS1A 1EFLA 2CW8A 3L1VA 3ZXSA 3TAUA 4E2YA 2D2WA 3L7MA 2HR1A 1JIVA 4L4XA 1CRPA 5FRNA 1HNZB 2G08A 4FONA 3SZTA 2AK3A 4WA7A 2VKDA 3QTLA 2EYUA 5KYYB 1U2RA 5A1JA 4M73A 3OU7A 4EUEA 2X2OA 1YZYA 2BGUA 2DULA 2WU8A 4K9OA 5GADJ 2V79A 5K3CA 4BO3A 4AIKA 5CLGA 3P2OA 5CQEA 1B16A 3ONVA 2UZ1A 2AF3C 4WOJA 4QDKA 2RG1A 1V1RB 2RNJA 5K1YA 2BTQB 2JL1A 1H8HD 4FKMA 3TLMA 3AVUA 1B2RA 3FZEA 3TDKA 2XIQA 4C7XA 4WOPA 4R4JA 2JGDA 1SCUA 4XL9A 1ZN9A 2K85A 4N5LA 3CW9A 1E5QA 3DMDA 1YULA 3NT4A 4QOSA 2QVOA 3NS7A 3DFFA 3EFEA 2HOAA 1SEUA 4H1HA 2O2XA 3DUFA 2VA9A 1U1DA 1BE8A 2WB2A 5FFMA 5CVVA 1L0OC 2RK6A 1FTQA 4ZMBA 2AZMA 4PGGA 2IHYA 2VKTA 3U4DA 2BBTA 1FS4A 5DUIA 5AVYA 3QXHA 4HNAA 3SEQA 1TDJA 3DBIA 4PV7A 4TYMA 3HMQA 5EKXA 2ZR7A 2WJ4A 3LWBA 5T8KA 3AOEC 4N7JA 1XUOA 3PRHA 2RHRA 4OCZA 3KQOA 3LSGA 1OCOH 1MW9X 3CLVA 1Z39A 2JIZD 1P1BA 3ZCRA 5IAAA 3CKMA 4FNMA 2GZWA 2OXIA 1LTQA 4D0RA 4X3PA 3GA7A 1T9BA 2MH2A 3TM5A 1BJZA 3UWSA 3M8JA 1AKYA 2AOTB 1MVNA 3TCXB 2OORC 2VAWA 3VU9A 1C3OB 3ROTA 3FTFA 2XPVA 1WI3A 1U0FA 3DZCA 2LW7A 3C8MA 4UATA 3UNGC 2E87A 4XR6A 1D5CA 3QUSA 4DQUA 4A2QA 2O8EA 4XYGA 3F98A 1A8QA 5K51A 5JCJD 3DYBA 2QJWA 1RWVA 1E7QA 4DIMA 5DNEA 4CMIA 4B32A 3GJTA 3D5TA 4DMCA 3AEUA 3HP4A 3PPIA 3HXOA 3QPWA 3G0DA 4UEOA 2GYWA 1SC3A 3ERMA 4IVQA 2FJ0A 4HSEA 1LFBA 2CL7X 2J0UB 4ZHSA 2L3DA 3MTJA 1G7CA 1WJAA 4IEFB 4PPNA 1WCWA 3UNXA 1NRWA 3CRW1 4Q18A 1IMJA 4U3JB 2IWRA 3P7NA 2CMDA 3LQKA 2GZHA 4F8EA 2QUZA 5D4RA 5AM3A 4RE5A 1YVRA 3ADBA 3I61A 1CBUA 4C3OB 1CP3A 2AR9A 2J09A 5AUQA 3EZNA 3WDKA 5HODA 5E2AA 4XCXA 2XAHA 1EKEA 5JDIC 4IDOA 2BBYA 1M5RA 4YREA 3WIBA 2C3MA 4FR0A 3U3JA 2Q0QA 4LCBA 1ILEA 4XWTA 1OVGA 2OK8A 1H65A 4RO0A 4C6TA 4YI3A 4D5FA 4XLTA 1RR6A 3BWXA 1TU4A 3T1VA 2GMWA 1Z0XA 2C3UA 4IXAA 4NJMA 3RK0A 4EM6A 1IY8A 3AF4A 1JP7A 5IP7J 4MR7A 5GWXA 2N8GA 3TPZA 4A27A 4WJLA 4UTZA 5M3BA 1QHHA 1MO5A 5AM2A 3ZBTA 3N07A 3S1MJ 1UDCA 2XW6A 3ZD9A 1L5HB 4ZEMA 1CJSA 3DEFA 1DQYA 3DDSA 2FX3A 3D6NB 3ROGA 1DUVG 3DFZA 3DEYX 3ZD7A 3CRVA 4DBRA 5JH7B 3TTWA 1Z12A 1YW8A 3GVHA 1UMBB 3W2AA 2LP4Y 3L7AA 1OB2A 5KREA 4UDXX 2CCKA 2NO5A 4JSYA 2DFFA 3ZU5A 4GKJB 4JGIA 3GU3A 5JO9A 2FPWA 3RV4A 4Z4QA 3MEQA 4D74A 1J0RA 1TT5A 2K9NA 1T4CB 4MKZA 2XGJA 4BV9A 1SKMA 1ZARA 3RZDJ 2G0NA 3VYWA 4ZYWA 3FKSD 2VNSA 3L49A 1IK4A 1U1GA 2E2HJ 3B6JA 3QHQA 2J33A 2ETXA 3W6OA 2AJCA 4L6CA 1G38A 2DGDA 1T34A 3FCOA 1A8UA 2DMRA 2QRVB 5AKKA 4GR9A 3BGVA 1B74A 2R1VB 3LOPA 521PA 3TFOA 4C3UA 3PNQA 4Q4HB 2B25A 3GRVA 4IDAA 3UXHA 5FAXA 3QVVA 1M2OB 4KQKA 5BMOA 1Z4QA 1XCVA 5C5CA 1QGPA 2ZSIB 3OJWA 1PAUA 3N7TA 2QRZA 5M5BA 4FCYA 3WHCA 1PN3A 3F0CA 3UHAA 1KDZA 3TZCA 1XWWA 4FHTA 5AJXA 3AM4A 2JH8A 1I4WA 4XLNF 1Z83A 3QKWA 5B1SA 1WH5A 4K28A 3PUWA 3I9MA 3VSCA 3HU2A 4TM7A 5JECA 2ZJ1A 1IHUA 4R1QA 4XWGA 3BIWA 1P2FA 4XSZF 5CLIA 1FMCA 4TL7A 4ALNA 2XYRA 4NH4A 3Q6MA 1P2GA 3CV3A 2JEZA 1NZFA 3RFCA 5IKOA 1TLTA 1NW8A 2Q3EA 1KIMA 2J3QA 2DBYA 4DA0A 1VCNA 2FW1A 1RP1A 4RJTA 4MV4A 1IFXA 3BGWA 3MQ0A 2VEOA 4ED9A 5L40A 1WMEA 5CH5A 2PKWA 1V1MB 3JU3A 1M34B 1WBBA 1RRKA 3H3VK 4Z0PA 4ZI3A 4AJIA 3KKQA 4KPYA 1W7PD 4L9RA 2P7HA 3Q8XB 4M55A 4KDPA 5AVVA 3W8RA 4QTRA 3H05A 5CB6A 2BLNA 1VLQA 3EEOA 1GG2A 2W25A 4LF7B 1YUBA 3QOWA 3F6EX 2FFBA 1MB9A 4DHWA 3P5SA 1TIBA 5DASA 5K3EA 2DRIA 1PO7A 3IL2A 2YW2A 4B3RB 3OQBA 5F9HA 1M6YA 2GZRA 1X7GA 5DI3A 1IVSA 4FLEA 4RLHA 1C1XB 2WM8A 3DEWA 2ZVPX 4JNCA 2IGTA 3QKRB 3EQ7A 4R2MA 4V2GA 2AI3A 3U21A 2QA5A 1QRUA 4YJ2F 4JHLA 2VH2A 2HXSA 3OZWA 4LXQA 1UDWA 4KRXA 1N5RA 1MIOA 2BKXA 4HMPA 4RLSA 1I80A 2AEJA 3SDBA 4FE3A 2IA1A 1TEZA 2PY6A 2IPNA 3SHQA 1BN6A 1EK6A 4OKNA 1SFEA 1ZKDA 1S3FA 3AONB 4IJ5A 1JT2A 3CR7A 3PXAA 1JG2A 2WV0A 1JUMA 2E6UX 4KAAA 4FTHA 3HFJA 4HAZA 2A6TA 3EXFB 1OLSA 1FOXA 3CM0A 3VZPA 2JAHA 1U9YA 2V26A 2DZDA 2IHZA 4WH0A 3PO2J 4LOIA 3OR2C 3O47A 3ZTWA 3DAHA 2RHCA 3OYKA 4ZCTA 3GX1A 1APBA 2QTWB 1YOBA 2CVOA 3ZW9A 1XJ5A 3W5HA 1CJVC 2IA0A 1OH5A 4X91A 5IK2A 1UBKS 2D59A 2IEYA 1QANA 4M83A 1GWNA 4IFTA 3MZYA 1KY5A 3GNTA 1D1QA 1FTGA 4R0MA 2ZR8A 2BYTA 1AKNA 4KWCA 1NBWB 1CP2A 2DOFA 5FH9A 4EA6A 1AF7A 3S99A 2I6SA 2ZCWA 1REQA 3JQRA 2L01A 1FUYB 1JI8A 3ISPA 4FFBA 1I5EA 2CLEB 1ZNWA 4OHVA 2B8EA 1MBGA 3X1YA 2WKPA 3L0OA 1DOHA 2HV8A 2Y67A 1SGWA 2O1WA 4Z49A 2QB5A 3NVDA 2VHZA 1BOBA 3UWKA 4P3YA 2R1ZA 1R8QA 1MD0A 4L5IA 3MZHA 3LP8A 3WBJA 2AN9A 5BW4A 2CDRA 3PCRB 5DCMA 4XGQA 4RH1A 1DT5A 1Y1LA 2BGWA 4Q34A 2DYKA 4LTDA 3I45A 3A4LA 1XSEA 3AUAA 3UW1A 2OB2A 4IGEA 3ROXA 4EW3A 1R3DA 3SNHA 3W2HA 3W6JB 2QGNA 2QVGA 2R8BA 2XGMA 2Y2UA 2TECE 5A2GA 4QU0A 4KFSA 3EC2A 2XNKA 4I9FA 1AMOA 5JZVA 2VKHA 2D74A 2J4CA 4PFPA 1GAJA 4RD2A 2WVAA 3BA6A 1Z62A 4MI6A 2OG2A 2NT4A 2ZXHA 4V0NA 3WYEA 3L06A 1NURA 3O8LA 1NIPA 1UKBA 1QHFA 1ZGWA 3PL5A 4ZU1X 4UB6C 2R7SA 1KDOA 1EKXA 4EA9A 2AXEA 4E70A 3NBZC 4IIGA 2R25B 2J67A 4LUCA 1DAGA 1Q57A 5IT9K 2XXBA 3CF2A 2E1CA 3QVTA 5BP7A 3S29A 4HVAA 3K9LA 4WEOA 1OFVA 5IPFA 1SZPA 4UZSA 1TJYA 4C21A 4IRHA 2A05A 2EKDA 5KX5A 1KFBB 1DKUA 2EFYA 2WFZA 5LHIA 2JJMA 3CLOA 1QDUA 4AQ7A 2BCJQ 3QU7A 4Y0VA 1IE3A 1OI7A 5JVDB 3LCJA 4MTDA 1YK0A 1RD4A 3LWFA 3ICOA 1YL7A 3DPSA 4HDMA 2AS0A 4FDLA 3PIPF 1UK6A 2H29A 1B7GO 2DG2A 4ZRDA 4A2CA 1GRNA 2NUAB 3RIRA 2F6RA 5DD4A 2PGXA 4K2AA 4UUMA 4CSWA 2GN8A 4QJBA 3ZMDA 1HYGA 1DP3A 1OF1A 4A0HA 4BTLA 2Y1OA 1R7RA 1XZIA 3EISA 5EJCA 2GYYA 4BVJA 5TMBA 2EWNA 3E15A 3VC3A 3FPGA 3DV9A 1E5DA 1X2MA 3THXA 1QQ7A 5J1TB 5JMTA 3RYFA 3FLMA 3TEMA 2CV2A 1JB1A 4YGXB 1XMPA 5IYCJ 1CYEA 3V9AA 4XR4A 3T5CA 3OQOA 3TKYA 1NXPA 4I66A 4P4LA 2DAOA 2JAXA 3NAQA 3G1WA 4NXMB 3GFFA 4XB2A 2POCA 1ENOA 4U39A 1HR0B 2VHWA 2HBYA 2HMWA 3LC0A 3OETA 3D54D 1YI8A 1BN5A 4CMGA 1QUFA 4DA6A 1NP3A 2FN3A 1CUBA 2KZGA 2G25A 4PRLA 1Z7BA 2OV8A 4I46A 4XUEA 3MWDB 2ERCA 4XRGA 3K4LA 3CPEA 4W1SA 2XKBA 3GA5A 4JT4A 1FXWF 2WAMA 1G8FA 2OBLA 3CMMA 3KZVA 1CIJA 1U63A 1FXWA 3QIVA 1QVRA 2JAQA 3HKEB 3VOSA 4YJ3B 1ZY2A 3FNEA 4DIDA 4G1BA 3IEUA 3EIEA 1FDIA 3KQSA 4B1RA 1ZI9A 4DLBA 4NZMA 4PSDA 2OQGA 3MKWB 4L3WA 4XK4A 1QBGA 4K1LA 2BUCA 3SFVA 2GSDA 4I4TF 2IJGX 3U7EB 2P8SA 2C20A 2XUKA 4L07A 1DKRA 4AYTA 2BP7A 3H3ZA 4I4TA 2JCXA 2QTRA 4FU0A 1VLZA 1ZHHA 4D2IA 1T9KA 3G8AA 1LPAB 3C8UA 3PLRA 1DEKA 3UYKA 1LRJA 1CQJB 4MQVA 2RNGA 1ITZA 1VDZA 1E2HA 1VM6A 1T2CA 4D45A 1CJCA 3ML6A 1FYMA 4ZKEA 5K0TA 1Y9JA 1T0BA 2X41A 1MRNA 3TIXB 3Q6IA 3DZFA 2FPMA 2C88A 4FOOA 4PW0A 4TSKA 1KDVA 3HJFA 3HZHA 2CFOA 4IZHA 4V2IA 1JHFA 1XG1A 3TLZA 4ESVA 3GOHA 3PDJA 3OPNA 2OZVA 2VQ3A 4XVRA 2CZGA 3VO8A 2UZ4A 1P1RA 3FVRA 1DQSA 2LE0A 2WZQA 1Z6YA 4JOSA 1P81A 1SG6A 3DEIA 4RM3A 3M8FA 4AO6A 2EKQA 4J3JA 3WS7A 3QUQA 1C7IA 1YJBA 3UBMA 3TR6A 2WLTA 2BH9A 3DM9B 5JD6A 2X2PA 2DWUA 5B1HA 2D5AA 2P5KA 1MT0A 1ESDA 4CM4A 5A3VA 5K6AC 5CIYA 1YTYA 3SYLA 3AI2A 1XAGA 1QF7A 3GA0A 2IEBA 2C83A 4Q24A 2C9CA 1HE2A 3WISA 4PO1A 4OU4A 5T6MA 2H57A 3MGKA 1VI0A 3QPCA 4L5EA 4JJZA 3ZBUA 3S2UA 2ZJ6A 1QOPB 3UPDA 3OOSA 2WK1A 2QZJA 3A9SA 2K5CA 2I8LA 5PGMA 4ZI7F 3KEOA 1DJQA 3TXXA 1Z07A 2GNPA 1G2OA 3EIXA 2MD5A 1GSAA 1FOWA 1N75A 2P5VA 3OZDA 2WI8A 1ORTA 1ZD5A 4ZI7A 3VODA 3HUGA 3IEXA 4C0XA 3O82A 2IJLA 1TM4E 2NVBA 4Q4AB 4K9SA 2AJLI 4YQEA 4F4IA 1RQRA 2BE9A 3RGWS 1QZUA 2JVHA 3FSJX 4LYHA 4D8UA 3EIUA 4MI1A 1D0SA 3ROQA 2XUOA 1QGAA 1CYDA 3KB8A 1Z4OA 3CZMA 4FFPA 4CYMA 4Y9RA 4IIUA 2FK8A 2FWPA 4D3FA 3ZY5A 4BN5A 3IOYA 4TZTA 1XXHA 3OA2A 3OPYA 5ENVA 4BC1A 1J2TA 1ETUA 3RSZA 4YIIA 1JDPA 4A5SA 4IZIA 1I14A 5DTEA 3PX3A 1K7AA 1ZYRF 3BC1A 2X5OA 1RAFA 3HB0A 2E7XA 1MC1A 1DHRA 2OV2A 2Z30A 4PYIA 1YW7A 2DWPA 5ER9A 2M8GX 1Q92A 5BV8A 1AXRA 2Y2VA 3I9NA 2DUNA 2BV6A 2WTBA 1J8FA 2AN3A 3PTAA 9GPBA 4UV8A 3MINA 4F6RA 4XDYA 3LQ2A 2I9PA 4PBSA 1JLKA 2ZXFA 3TG2A 4B4UA 5IAJA 1Y9EA 4JAVC 3FX2A 2IZOA 4WAUA 1W0JD 3Q3JB 1KU6A 2YJ5A 4HGYA 1HDDC 3ENKA 1H94A 3KYDB 4U0VA 4IAOA 3HOWJ 4LHSA 2YU3A 4Z8XA 3SF0A 1YQ9A 3RVBA 5JWOA 1US8A 3LWZA 2W48A 2CUEA 3P5BA 4NF2A 2P0EA 3CF4G 3PDCA 1QNTA 3I05A 2SBTA 2NU8A 4EDHA 1L8LA 4RB3C 3EIFA 4DY6A 4QKQA 1VMKA 1PZHA 3AL0C 4A5OA 3RRXA 3LUPA 3HJGA 2HQNA 1U28A 5HHTA 2GBFA 5I9TA 4KVFA 2OV1A 3Q5EA 5GPCA 4MDFA 4QDJA 1NG1A 1SHKA 5DCFA 4PSVA 4ZDWA 4Y17A 1G8HA 4M0EA 4NCBA 1VKRA 5B58T 3EWAA 3L2RA 3KM0A 1XJ0A 1KVRA 1K3FA 4CU2A 2QU7A 1AUPA 2Q27A 3T41A 2OZUA 1QPIA 2X0LA 2HCJB 2PKRA 1OVMA 2XOKD 1CR6A 3G8YA 4YIFA 3GVAA 4LJ9A 4BMCA 2IGNA 3ZGOA 2QD3A 1KI6A 1P1KA 1Z73A 1ODSA 2E48A 2PMDA 4JR1A 2PDAA 3FX3A 2PL9A 2JGFA 1U7XA 1DQPA 2HU8A 1TVKB 1FUIA 3MN1A 3LSJA 2HDWA 5AJTA 4MPPA 1KEUA 3PHGA 2WTMA 4N3NA 3RIEA 1I8TA 1L1QA 1CQIB 1JV2B 3PGLA 1XMAA 3PVSA 2B20A 4C0LA 1W94A 1XZAA 1K6YA 3UFXA 2IODA 4UHEA 4BZQA 4LVNA 1KOJA 2BL4A 2YC4C 1E62A 1WXWA 1TCBA 1W36C 3L0IB 1NUSA 1H9GA 1MOPA 3G2JA 1Z25A 5M2QA 3GLFB 2WV1A 1EWTA 4PSUA 1VE3A 3AR6A 2FD5A 4RKYA 2GN1A 3GC6A 2DT6A 2DKFA 1Z68A 3HHHA 2WMOB 3COYA 2Y6UA 3LYLA 2QX4A 4NOKA 5JIBA 3VKVA 3IUQA 1Z6XA 1NF3A 2DTZA 3SXUA 3O0TA 2W2LD 5KTYA 1K92A 1N5JA 1X1TA 3P94A 4PZEA 1Q2XA 3WLKX 3DKRA 3A3NA 1PGJA 4ETWA 2H2WA 4Q66C 3UPUA 2UZ3A 2JN6A 3OQ1A 1QS0A 5JXIA 4AY5A 4RFVA 1QCZA 2AXQA 3OSGA 1GZ7A 3ZK7A 1CUAA 2ODAA 4EA8A 3I9LA 1G8KA 2UZKA 1YDGA 2J7PD 2OBBA 4ENTA 3AL0B 1SU6A 1NW5A 1EFCA 2IHTA 4D3ZA 3CU5A 2LTAA 2Z1DA 5LSAA 5JARA 1MMAA 1O8BA 3OIFA 3RYCA 4XRRA 2F5DA 1FBNA 1C30B 1OIXA 3LVQE 2UVPA 2DVMA 1ZQ3P 1DGWY 2OTJI 2ZS7A 1GGKA 3RTEA 3X1JA 1S7OA 2RGRA 1GKKA 2PD4A 1NBME 4E5UA 3B3GA 5DM1A 3AFHA 5FYDA 3M1CA 5F27A 3DVRX 4GXNA 2OWDA 1J1ZA 3OY2A 1JQ3A 4IIEA 2KLHA 4IGFA 1UM9A 4W7HA 4RGRA 2BN4A 4PLPA 3ZHSA 4JI2B 4WUVA 4J76A 1NU8A 2I1QA 1L9KA 2H7XA 1N5MA 4BKOA 2VBIA 5B7QA 3PNPA 2E2IJ 4CKCB 3P9RA 1GAXA 1TO6A 1UK7A 1T2FA 3B1JA 1UM8A 3Q12A 3K70D 4OINF 1NYTA 2B83A 1WI9A 3K0FB 3MCWA 4PJJA 4ZC8A 3RD5A 3O9VA 5ICGA 1Y7TA 1JG3A 4Z4GA 5BSGA 1KH3A 2CWWA 4C7VA 2UZ0A 3CUKA 2VZ0A 1GTMA 3HBJA 4PNHA 1GQQA 1L1FA 4TV9B 4UAJA 3GNQA 1CFZA 3G0BA 2E5NA 1QCCA 4AECA 4QUDA 1W36B 2Q4RA 3F7OA 5A03A 4FFVA 1JAXA 5C7LO 2DI3A 1KI1A 4FGWA 2H54A 4O29A 1DQRA 4WACA 5HFAA 1GZUA 4BZWA 4P7FA 1WWXA 5FP0A 1FC3A 2WSSA 1NVMB 1KJJA 3ZCOA