3H5AA

Crystal structure of e. coli mccb
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
358
structure length
357
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKVVADLYGSEKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCGNRMLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccB protein
total genus 92
structure length 357
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5aA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5aA02
1Q1NA 2DBQA 2B35A 2DFDA 3E1KA 3PZBA 1AXEA 3NTRA 3EVNA 4XJTA 4XYGA 1ZW1A 3K2BA 4RL6A 4ALJA 4YTEA 2AE1A 4XB2A 3RKRA 4PLVA 1C1DB 3IDSA 4GVXA 2D1YA 3ZWBA 1Y6JA 1HSZA 3ZNNA 2Z5LA 1E6WA 1DRUA 1YB5A 3PWKA 3L0DA 3BMOA 2DUWA 3A28A 4FC6A 1OC2A 3Q6IA 4FJ1A 1D8AA 2O48X 3WLEA 4BMVA 3GDGA 2E37A 3SC4A 4B3HA 1WMAA 3LSYA 1YWGO 1ZK0A 2ZCVA 3NJ8A 4ZA2A 4F6LA 5I8WA 1NR1A 4IZIA 2IXBA 2POQX 3EVTA 5THQA 3GNQA 3IUPA 3LU1A 1CQIA 5IDXA 3GGOA 2E49A 1B7GO 1D7OA 1YRLA 1R4NA 3L9XA 4IZHA 5HBRA 4XDZA 1E7MA 3AWDA 2JFFA 1LLUA 4M55A 4O5OA 5DULA 3MWDB 4CLHA 1OOEA 4DPLA 3U4IA 1S6YA 4BNMA 5JLAA 1S7CA 3SLGA 3NEPX 1YXMA 1EK5A 3TZ6A 2J5RA 3DBRB 2PZJA 2PGJA 4BO8A 3HN7A 1UDCA 3FNEA 2QYTA 4Q39A 3C1TA 1F17A 3WBFA 2DAPA 3ZWVA 3MEQA 3DZFA 1Z7BA 3NUGA 5KCZA 4ALIA 1WXDA 2HJRA 3QVXA 1H0KA 4OOEA 5G4KB 3RUIA 3PQFA 3AM5A 1DJQA 1F14A 3VKUA 4CV0A 3RC7A 2I3AA 3NRCA 1M76A 1A4UA 2BFAA 4IS3A 3BTSA 3H3JA 3E9NA 1N7GA 1WLYA 4MKZA 1PEDA 2HDHA 5IXYA 2D2IA 2X5KO 4WK6A 4R9SA 1ZJZA 4WPGA 2IZ1A 5F1KA 1YQGA 5JDCA 2B83A 2ZIZA 3OSUA 3WGIA 1LEHA 1ZFNA 4YXFA 1PU2A 3U9LA 3DTTA 3DBLB 3QWIA 1XDWA 4JK3A 3GN2A 5I7SA 2CUKA 4L4RA 2YV2A 3ZGYA 1RKXA 1F8GA 1ZSNA 4J4HA 4LSWA 4ND4A 4NG5A 1VC2A 3R6DA 1HWYA 3DAPA 5A1TA 1PJ3A 1QLJA 4XR4A 4YAKA 2I67A 1QYDA 4IBOA 2HMTA 3D3EA 4IJWA 4OYRA 2AW5A 4ZQGA 4J1SA 4NBWA 4FJ2A 1EVIA 4TKLA 3EW7A 5A03A 3M1LA 1ENYA 2X58A 1PJSA 4FC7A 4A03A 5CDSA 4AJEA 1MUUA 1E0DA 3GF4A 2OO5A 3FWZA 3JYOA 5BQFA 2X9GA 2YHIA 3GZNB 3G0OA 1B8VA 4YJGA 5IFLA 4J4TA 3V1UA 2NVUA 1N92A 2C7VA 4U7WA 4B4VA 1O95A 4GMFA 3ZHYA 2V6BA 3B1JA 1IB6A 4CM9A 1AXGA 2HLPA 3R3SA 2PD4A 2RH4A 2QG4A 1KEWA 4GGOA 3GFGA 3JQ9A 2G0TA 2Y66A 4RPGA 3FI9A 3WYEA 2GPTA 4GX0A 4ITUA 4L9RA 4ALLA 2GERA 1NFFA 2JD2A 1DRVA 4ZN6A 3A06A 4YRDA 4ZQFA 2DFVA 2JCYA 5ADHA 1N9GA 2WSBA 4BNJA 1W0CA 3IKVA 2Q4BA 3DWFA 4HP8A 3H7AA 4CODB 1SNYA 3L4BA 3H9EO 3TN7A 3V1YA 2X4GA 4ND1A 3ZWXA 4R1TA 4MIYA 5IG2A 3WQRA 1P1JA 4WCDA 3I5MA 1N9GB 1SEPA 1T25A 3H6KA 1DFIA 3I9KA 3QWFA 2GDZA 3TFQA 1YBMA 3S1LA 4DUPA 1VL6A 2JFGA 4CMIB 2FSVA 3B70A 3PP8A 4XR9A 4BNWA 2C07A 3TFOA 3RUFA 3DZGA 2EP7A 2Y0DA 3DZHA 5J23A 4R3NA 1KY5A 1Y8RB 1ZEMA 1EFKA 2BELA 2ZTLA 1ISHA 1UZNA 2HK9A 5C3MA 8LDHA 5JC1A 1IOLA 3OA0A 3QIVA 4WECA 3WLFA 4B3JA 1WP4A 4GWGA 1GV1A 2HKIA 1X7GA 3JD0A 1C0IA 2NVUB 5C7OO 1TVEA 4YJGB 2GO1A 3VOSA 1PGPA 4ROSA 4WLVA 3K5PA 2OBNA 3JQ9C 4B3IA 3RUCA 3JQGA 3AUTA 4O59O 4DRYA 1RYEA 1TB4A 4RLHA 1DIGA 4U6SA 2I76A 2YZ7A 2VNAA 3C7DB 4IJUA 4JJIA 1WPQA 4D7AA 3PHGA 3STHA 4DA9A 3E9QA 5DZSA 1XWFA 3Q11A 4JJGA 3VDRA 3FF4A 4LRTB 1TA4A 3LF2A 1BVUA 1XCBA 2IRWA 1LJ8A 1X1EA 2O3RA 4RVHA 3CIFA 4BNVA 1ZUD1 2QRLA 1X14A 1IE3A 2NU9A 3VZPA 3WGQA 4L73A 2OBYA 3KXDA 1QKIA 4EW6A 1P1FA 5BSHA 2OL4A 4N18A 1EMDA 3S2FA 4U8GA 2EGHA 4JN6B 3ZNOA 2ZKLA 3RFTA 4AJOA 5A5EA 2CF6A 2HAEA 3QQPA 4J0FA 2CVOA 2ZQYA 1P0FA 3M2PA 4YAGA 4H3VA 1J49A 2V65A 2X9NA 3DBRA 3GC6A 4J9VA 2O2SA 3RBVA 4E5PA 2FSSA 3L4BC 1JQBA 2YQ4A 2VRBA 1YQDA 4EEXA 4GBJA 1Q0HA 4BGVA 1XA0A 1UXKA 3LLVA 4KTTE 3F5SA 1LDYA 3AFMA 1ULUA 4GX5A 4TWRA 3RU7A 4D79A 3GG2A 3DDNA 1UZLA 3KRTA 5H81A 5TS3A 1VJ1A 1XR3A 4XYLA 3WWZA 4AJNA 5KVCA 5ICMA 4W9NA 1P45A 4Q3AA 2X7HA 4TRNA 4CMEA 5TT1A 1JKJA 3AOGA 2OHXA 2Q99A 4CV1A 1EVZA 2Q45A 3OFSA 1R0SA 2YYYA 1LNQA 9LDTA 4PRLA 2Q49A 1WDMA 3IQDB 4JBHA 4IMPA 3VZSA 4J4BA 2JAHA 5F21A 4ALNA 2BGMA 3F1LA 2C29D 3AI1A 1Z6ZA 1GZ3A 2Z95A 1HDGO 2NADA 1QV6A 5TSDA 3WICA 3RUAA 4XRRA 5L40A 3ZW9A 1DIAA 5EERA 2FN7A 3GY0A 3T4XA 3SLKA 4YR9A 3AY7A 4XYMA 5ER6A 3TF5A 4IIUA 1E1NA 1VKNA 3TWOA 3TL2A 4DLLA 1V9LA 3RWBA 4CPDA 4XGIA 4E0BA 4RF5A 5H82A 4HUJA 3ITKA 3RIHA 2QRJA 3WIEA 2EW2A 2IXAA 4Y8VA 3BMCB 4YYZA 2CDBA 4G2NA 5DOVA 4EGFA 1IZ9A 1DEHA 3MOIA 3I9LA 3IJPA 4BKRA 4CM9D 4DL9A 1LC0A 4UVIA 2PA3A 1IHYA 3DHNA 4E2YA 8ADHA 2V7PA 1ZO8A 1MXFA 2J8ZA 3AJRA 4FFNA 4CM1A 3FBTA 3KTDA 5HWSA 2PR2A 1GD1O 1BW9A 2EIHA 2QX7A 3ETEA 2A35A 2WYUA 4M86A 3ICCA 3GR6A 1R37A 4DQUA 2CVQA 1CQJA 1YL6A 5DDIP 4GVLA 3BMQA 1YOVB 4YRAA 4JBGA 3PHHA 5IN5A 1DB3A 5FYDA 2YFHA 2Q4EA 3ZZNA 1IPEA 2VUTA 4LVUA 2C5AA 1LSJA 3NJ4A 4R3WA 4DYDA 1V3TA 4BNIA 5G0UA 2DU8A 1PS9A 3DOOA 1EBFA 4BNLA 3OQBA 1Q0QA 1RM3A 3ZV6A 3ROPA 3U49A 4BNKA 3GVCA 2WYWA 3CTMA 2GRAA 1W73A 1CEQA 3IUSA 2UUPA 5A9RA 1ZXLA 1NQOA 1HETA 1HE3A 2YFQA 2Y05A 4JNKA 5DNAA 4PG8A 5U1PA 3GDFA 1FDUA 1SAYA 4YT2A 4AJPA 4M87A 1HDRA 4WASA 4BKPA 1WNTA 2PH5A 4WLFA 3ZI0A 3BTVA 2HMWA 4KWIA 4CLOB 4YAIA 3E5RA 3I4CA 5I7FA 5CHEA 2BRUA 3NGLA 4K28A 2WEKA 2CZCA 2VT3A 1E92A 4LK3A 5TC4A 1U3UA 4II2A 3A9WA 3QHAA 1P31A 4BO5A 5IDWA 1PJ2A 3IJRA 3ZHBA 1L7DA 1LQTA 3PFWO 4IXWA 5I9NA 3FNFA 2SCUA 3ORFA 1YDWA 3JQ7B 1QORA 3GGGA 1DAPA 1XELA 4GH5A 4S1VA 4WLUA 4B7XA 4NFHA 2DKNA 4MVJI 2D0IA 3WXBA 3FN4A 3GHHA 4B7CA 3DMTC 1JA9A 2X0IA 1ZIDA 2UAGA 2O7QA 4GMGA 4UAGA 2CD9A 3AFNA 3ZHZA 3GRKA 5G0TA 1NXQA 1KVTA 3M1AA 4QSMA 2DBRA 2Y1CA 5FI3A 4HWKA 2TMDA 4FFOA 4PFJA 1DHTA 2J5QA 4J43A 1NR7A 3MJSA 2D8AA 3BTUA 2JD1A 3G79A 3W4IA 1UUFA 4TRJA 3UAGA 5A5FA 1BXKA 2PGDA 4DBZA 2P4HX 4DREA 3GOHA 3OJOA 1UXJA 1CJCA 4FFLA 3ASUA 3KZVA 2BMAA 4RF2A 2FPGA 4ZVVA 3ZDFA 3ZWCA 4CM3A 1MG0A 3JD4A 4UVHA 4ND3A 2O4CA 3RI3A 4BUCA 5B37A 3QLJA 5CFZA 4KZPA 4BGUA 3WGOA 4KOAA 3WS7A 5IZCA 4P4GA 4ND2A 5EJ2A 4TQGA 5AQ1A 3QWBA 2V6GA 2DTXA 1K6JA 2CSUA 1PGJA 4DQXA 4OH1A 2A9FA 5DP2A 4W4TA 3KEOA 4K9DA 4RZIA 1H5QA 3LK7A 1A7AA 5AOVA 3AM3A 4WEOA 1CERA 2GD1O 4LMRA 2AA3A 3VZQA 2IZZA 3KYCB 1P44A 1K89A 4PVDA 2ILTA 1VSUA 1ZMOA 1LU9A 3DQPA 4LRSB 2UYYA 4L75A 3MJTA 3FPLA 1ADFA 2YDXA 1UDBA 2CDAA 5JCJD 4RF4A 1IZ0A 3UN1A 5U4QA 3W4KA 1V8BA 4XQ9A 3RBXA 4L76A 3GPIA 3VC7A 4BO4A 3JYNA 4GQAA 1H9BA 4H16A 4DIFA 1B26A 2PV7A 3G17A 2ZTMA 3FNHA 3Q3CA 5JCXA 4S3MA 4JBIA 3QVTA 3RASA 3EMKA 1E3IA 4MVJH 1ML3A 3WGTA 1AUPA 1TT5A 3N7UA 4OSOA 1SOWA 4YT4A 5KNLA 1B3RA 1GUFA 3INTA 4E5YA 3GVIA 1NVMB 3F6YA 1VRWA 4OXYA 1GR0A 3RROA 3DXFA 2O2YA 2EJWA 2W2KA 1GEGA 4CMCA 4UUOA 2AG5A 2GR9A 1TT5B 2ET6A 5C7LO 3OP4A 4BNUA 4TVBA 1ISFA 3ZV5A 5CDYA 4JP3A 4NI5A 1TXGA 4WCFC 2NSDA 5T5QA 3C24A 3RC9A 2WE8A 3MOGA 1SO8A 3OM9A 2VUSA 2HUNA 1KS9A 4ND5A 4E21A 5JXWA 5ILOA 2G5CA 2B5VA 3KYBA 4Q3BA 3TZKA 4BNGA 2V6FA 1HDXA 1YVEI 4CQLB 1PL7A 3RVDA 3Q2IA 3MJEA 1DDOA 2WD8A 3DBHB 3JQAA 4WEQA 1H2HA 1GCOA 3QVSA 1PR3A 3Q1LA 1YONA 2GSDA 3EHEA 1HZJA 2VHVA 3KYCA 4CLDA 3WIDA 3PXXA 4NH4A 3I9NA 2DLDA 4CJXA 3A14A 2X5OA 3HSKA 3KSZO 2H5LA 1QMGA 1T26A 3H5RA 4OSPA 4BKOA 4QFDA 3BMNA 2W98A 3CINA 1EQ2A 4LVCA 1KOLA 4EYEA 1DIBA 4O6VA 3B1FA 4WGGA 1P1IA 3H65A 4MKXA 3FD8A 2NACA 2PH3A 1GQYA 5TQVA 3IOYA 5A06A 1LBEA 3ZWAA 2DM6A 5ENVA 2GLXA 4OIMA 3TJRA 2GYYA 4CLRB 4RVFA 2H1SA 1Z45A 3IIEA 3WYCA 3E82A 5DBFA 2B4QA 2XF8A 3CXRA 1JDJA 1P0CA 1V6AA 3BHJA 3K73O 4D3SA 3UGKA 5ITVA 3VPHA 1YBAA 3GG9A 1YB1A 4GSKA 3WYBA 3PYMA 4GKVA 1MLDA 4NNJA 2ZATA 1TT7A 3CMCO 4Z9YA 4Z0TA 3GMSA 1NYTA 2B5WA 3JSAA 1AGNA 2AE2A 3HDHA 4Q3DA 2GNAA 2Y99A 3KEQA 4JP2A 1E77A 5MGBA 4QTZA 3DTYA 4BGIA 1O9BA 3CZRA 4N5MA 1H6DA 5JW6A 4LGVA 3LT4A 2FY8A 4YWJA 3S2GA 3U4DA 1GL3A 1B8PA 4PG5A 4FOOA 5F1OA 1T4DA 4CM4B 1K2WA 2RCYA 1YO6A 2P9EA 2HJSA 3D7LA 4L0QA 3D0OA 4Z6KA 2GN8A 4W82A 1BDBA 1NNUA 3TOXA 3D5QA 1OMOA 4KUGA 5GY7A 4A73A 4RPHA 1BVRA 2ZYAA 5ENDA 2OP1A 4D3FA 4WOKA 4BMSA 5T8KA 1VJ0A 2BKAA 4PZDA 2V6MA 1LQUA 2FOIA 3DFUA 3VPFA 5G2OA 4GI2A 3NT2A 3RU9A 1U4SA 1ZCJA 1DC4A 1YS4A 3P7MA 1ZEJA 4CQMD 3JD1A 3AM4A 1T2CA 1P9LA 2C2XA 3GZ4A 3LT2A 2VWPA 5FFFA 3WGZA 2Y93A 4UVDA 1EUDA 2E6UX 4AICA 4QFCA 2I5PO 4B4UA 1PSDA 2VCYA 2G1UA 1ZMTA 3AY6A 2X8LA 4R5HA 4CR6A 3BZUA 5JAZA 4HBGA 2VZ8A 1EE9A 4P8RA 3OIDA 1V35A 2W4QA 3C1AA 1FDSA 5A9SB 4J16A 4WE3A 5B1YA 3FRJA 2D5AA 1QLHA 4P4NA 1KVQA 3F46A 5CP8A 2VYVD 5AXAA 3TL3A 5FWNA 4BKUA 2YDYA 1X15A 4TRMA 4AJJA 2PZLA 2D4AA 1LLCA 5CG1A 4DIOA 5EN4A 1GV0A 1I30A 3WG9A 2CDCA 2EKQA 3JCZA 2WJPA 3VKVA 1UP4A 1M6WA 2BFOA 4FN4A 4BV9A 4KDFA 2OZPA 1HL3A 1IHXA 1AN9A 2GN4A 1Z73A 4OMUA 4Q3NA 5CDGA 3RQSA 4HFRA 5EESA 1VL8A 3AI3A 1BXGA 4YAJA 1Y5RA 3ZU3A 3N74A 2JKVA 1N8KA 4B4WA 2Q46A 1SEVA 2EKPA 2NQTA 3WR5A 3MJ4A 4XZ3A 2C0CA 5HS6A 1WZEA 1C0PA 2BF7A 3K6JA 4MINA 4CM7A 1XHLA 5IDYA 2PZMA 2X6TA 3OQ6A 1VKOA 4NR0A 4RLSA 3SEFA 4HV4A 5CEJA 2BI7A 2UUOA 1B3BA 1DIRA 5DN9A 4FFMA 1R6DA 2QYSA 2C2YA 1C14A 2EHDA 3VVBA 5JO9A 4GX1A 1PJCA 1D1SA 1W4ZA 4JJFA 1CRWG 1U7TA 1YL5A 1L1FA 4R68A 1K6XA 2A92A 3V2HA 4CL3A 5CEFA 5T8KC 5BNTA 2DT5A 3TRIA 3D4OA 3ZV4A 2ZTUA 2DC1A 3W8DA 1RM0A 4BHTA 5JYEA 5JDIA 1PS8A 4NU5A 2RAFA 5U9CA 4Y6RA 2QZ9A 3COSA 3KO8A 2H6EA 4LW8A 5AXBA 3NX4A 4CMHA 5DOZA 2GN6A 1T2FA 2OUIA 1Y8QA 4IDFA 1LXCA 1TI7A 2HMUA 3U09A 3AY3A 4FJ0A 1H2BA 4NJOA 1UXIA 1DFHA 1N2SA 1Y8QB 3MCVA 1WDLA 4BO2A 2NNLD 5TX7A 1T2DA 2FPIA 3DMYA 4XD2A 4PLFA 4CMAA 2GZ3A 3GHYA 4BB6A 2GGSA 5GZ6A 2DBVO 3ULKA 2PD6A 1BXZA 3E48A 1XIVA 1Y9EA 2JFHA 3D3WB 1O6ZA 3GVPA 5EPOA 3U5TA 1GFSA 2Q3EA 4BQRA 2X86A 1U3WA 1LDGA 3UCFA 3LC2O 3AW9A 3A1NA 4YBZA 2F1KA 3DOJA 1K5HA 1DC6A 4EDFA 5IZCC 3GNTA 1A27A 1Y81A 3I6QA 1HEUA 1VPDA 5I8ZA 1NWHA 4PIVA 3UHAA 3IL2A 5FEUA 3ZHXA 3FSRA 3OICA 3AOEA 3HFSA 1RM5A 5EMHA 4FPXA 1I32A 1BXGB 1DO8A 2FMUA 4RDHA 1PZHA 3QVWA 3WSVA 3CPSA 5T57A 1E1KA 3JQ6A 4PLCA 4RF3A 2VTDA 4PG4A 2BFPA 4XQGA 1E3LA 2P5UA 4DIBA 1LDBA 2WYVA 4NBVA 3FTNA 4NBTA 1JAYA 4BNZA 3WJAA 4UULA 5AYVA 4CMEC 4RPLA 2WDZA 1Y5MA 3UXYA 2WWRA 3MWEB 2J3KA 1M67A 4K26A 1XQ6A 4R51A 3EC7A 4XQCA 4KDEA 1KC1A 1GUYA 1AHHA 1E7RA 4NK4A 5A05A 1SOVA 1HYEA 1Y7TA 1QYWA 4NZ9A 1CETA 4NDNE 4XB1A 4XGNA 3U62A 1E3JA 1ZVMA 4FFPA 1U3TA 4UVEA 5K6AC 5DCYA 3DEYX 1I36A 4JXKA 1UP7A 1RPNA 2Y0CA 5CPFA 3VAZA 1E5QA 5TNXA 4MO2A 3C1OA 2R2GA 5A3VA 1I01A 4PRKA 5FF9A 3PRJA 4D44A 1WDKA 3BA1A 3PHJA 2YV3A 4D46A 1WAMA 3PQDA 1QYXA 1GQQA 3O26A 4ZGWA 2J5KA 1ID1A 5JO0A 4HNHA 1YQXA 5KKAA 1EEHA 2Q1UA 1HXHA 3OHSX 4I5EA 2FRDA 1E3WB 1JVBA 1I3MA 3H3FA 3I83A 3I9MA 5C5IA 3OA2A 1ONPA 1LTHR 4EITA 2PKRA 1JWBB 1ZBQA 3E5MA 3FWNA 3WMWA 1NPTO 2G76A 4JGBA 3L4SO 4BO1A 1SMKA 2PK3A 3NV9A 3JTMA 1H93A 3QJ5A 3HE3A 1QSGA 2VT2A 1P74A 1O5IA 4E5KA 4WLEA 4ZQEA 4CUKA 4IS2A 1PGQA 1DAOA 5L7WA 2HO5A 1PWZA 2OOSA 3UVEA 5BT9A 5ITWA 5DF1A 3PI7A 1BDMA 3PQEA 4Y67A 3KYDB 3H9QA 4IDGA 3K9QO 1B8UA 3OH8A 4I5DA 4K1LA 5A4DA 3ON5A 1I2ZA 2AQKA 4HNGA 4R54A 3ICPA 2I99A 2C82A 2IZ0A 4WNIA 3SJUA 4EUHA 2NTNA 2E48A 1R4MA 4F46A 4R1NA 2EG9A 3WOHA 2GCGA 1I0ZA 3ASVA 1ARZA 3GDOA 4CLRA 4OAQA 1I24A 4J91A 4TZKA 4YB8A 4GLLA 2WE7A 4ZU3A 3E03A 3I9OA 2EW8A 4H7PA 3R3JA 2YHIB 1J0XO 3GZNA 4QT0A 1BHSA 3FCOA 4BNFA 3Q2KA 3VPGA 1NHGA 3G1UA 4IM7A 5ER9A 4GGPA 2WMDA 4MPDA 3GRPA 4F6CA 5ES3A 1G0OA 1ZSVA 2JHGA 4MVJD 3E6AA 1SB9A 2Q1WA 1H6AA 5HTOA 4FCCA 1EUZA 3G3EA 3PVZA 5L4LA 2Y1FA 4AFNA 3LC1O 4TSKA 2J3JA 4NHEA 3WB9A 2BFMA 3P19A 3P2YA 4IGFA 5THKA 3WFJA 4FS3A 1TEHA 1BG6A 1F12A 2ZCUA 5JYDA 1I8TA 4K6CA 3JQAB 5KWEA 1LLDA 1QYCA 2X23A 3JQDA 4C7KA 4WUVA 1I33A 4J2OA 4UEOA 2X9VA 4DVJA 2XPCA 1HDYA 1GPDG 1LUAA 4IIVA 3VPXA 2Q1SA 1KETA 2BHLA 3DB2A 5FI5A 3GMDA 4BOYA 1EQUA 5L9AA 4TZTA 1U3VA 3PJEA 3SJ7A 5IZ4A 4E13A 4CM8B 3QVOA 1UXHA 2ZB8A 4N5NA 5A9TA 2PNFA 1DHRA 4IDDA 3KV3O 2DTEA 2Y68A 3F5QA 5AXDA 2I9PA 1PZFA 2AXQA 5G4KA 3KSDO 2GZ2A 4XEHA 4ZD6A 1UJMA 4IY1A 1HDCA 4D41A 4NK5A 1NPDA 3L77A 3PHIA 4MVJP 3RUDA 1EFLA 4Q9NA 1WVGA 4CV2A 1P1HA 5KKCA 4MP6A 5JE8A 3GNSA 4J9UE 1V3UA 4Q3CA 1IPFA 2X0NA 4N54A 4G65A 1LX6A 3KBOA 4AJHA 4RVDA 4MIOA 4PZEA 4R9RA 1T4BA 2Q1TA 2X5JO 1DXYA 1LDEA 5EQDA 3KLPX 3Q9NA 4UREA 1R4NB 3K8ZA 2JD0A 2NTVA 4CMGA 4MVJA 3GK3A 2IEBA 3H8VA 4R4JA 4FGWA 3OIGA 5DP1A 5LDGA 3GEDA 5COAA 4E4YA 4IDAA 3FBGA 1CF2O 1IULA 3PDJA 3JYQA 5KVVA 3L6DA 1SC6A 1DC3A 1YH3A 4Z3DA 1HE5A 3E9MA 3JYPA 4JIGA 3DC2A 5KIAA 1JVSA 1KY4A 1Y9AA 1GU7A 1F06A 5F1PA 4LSMA 1LI4A 4MKRA 1I3NA 4RPJA 3BMOB 5COBA 5KOIA 4W9NC 2I65A 5BSGA 3QW2A 4OKIA 1DRWA 2PZKA 2B36A 3PHLA 4CV3A 1Z75A 4CLEA 4J90A 3RC1A 4Y6PA 2CVZA 1QYVA 2NU6A 3R0IA 5EL0A 4YJFB 4DLBA 1MB4A 2IE0A 1FDVA 2Q2QA 1RJWA 3EDMA 3AU8A 5JSFA 4D0SA 3JQFA 4A26A 4UVGA 5H83A 3NYWA 3WGYA 4B8ZA 3TQHA 1MC4A 1PQPA 3NDJA 4Z9XA 4GAEA 4NU6A 3ONFA 5JPIA 3HG7A 1P3DA 4B79A 3LVFO 3BYZA 2W2LD 1Q7BA 2DPGA 3GAZA 1E3SA 2AG8A 1O8CA 3CH6A 1NQ5A 4B4OA 3UCEA 3WWYA 1U1IA 1V0JA 4KTVE 3QY9A 3S2IA 3W1VA 4RVUA 4MJLA 4E3ZA 3ZWYA 4ZJUA 3PJFA 1M66A 4TKMA 3KM0A 2XXBA 2YUTA 2B0JA 3CSDA 1EK6A 4KQXA 4GWKA 3ABIA 1ADGA 4IGEA 4A27A 4ONEA 4XYEA 2HU2A 1ENOA 3HDQA 5BR7A 1C1XA 4E32A 3JQ7A 2EP5A 3GEGA 1N5DA 3KSUA 1HE2A 4EUEA 3ANLA 4QXMA 1YB4A 4BO7A 2XXJA 3QE3A 4O0LA 3V8BA 3H5NA 1LLQA 2VHZA 3C7CB 4F3YA 1ULSA 2VUUA 3RCBA 1LSUA 4AL4A 1IYZA 3G1TA 3IS3A 4O63O 5HM8A 4HX5A 4BGEA 4XA8A 3AUUA 3X2FA 5TJ9A 2VTEA 3UICA 5I7VA 1CIVA 1VSVA 1FDTA 3GN1A 2NU7A 2HRZA 3UFXA 3OJ0A 3OJFA 2D3TA 3CUKA 4DXHA 2W2LA 3QA9A 4RVSA 5AVOA 2VYND 1SPXA 3GVHA 1VLLA 5DCUA 1OAAA 5GMOA 2HK8A 2X0JA 3ZWNA 4G81A 1HLPA 1HRDA 1ZJYA 4M8SA 2FR1A 5MDHA 4Y6SA 1DBVO 1MP0A 1NX6A 2GZ1A 4QECA 3ZU2A 1XSEA 3A4VA 1ISIA 4AVYA 1C1XB 4D42A 1B15A 4YEDA 1ZSYA 4IQGA 1PQUA 1WZIA 4QX6A 3OMLA 1ORRA 1PIWA 4KQWA 2HRBA 3VH2A 5TT0A 3PFFA 3PJGA 1YOVA 1U2GA 2PY6A 4J0EA 4BB5A 1I3KA 1PJBA 4YJDA 4E5NA 2AEMA 3VPSA 3AUAA 3LZ6A 4EI2A 4YQYA 2OGUA 1W8DA 5HA5A 1ONNA 1BRMA 5JY6A 1BW9B 3KUXA 2JAPA 3NDRA 4FW8A 2B69A 3OJLA 4NJMB 5K9ZA 1LDMA 2Z1NA 1GDHA 4N5LA 1GCUA 3OIFA 1NQTA 4BMNA 4YJFA 4YAEA 3NT4A 4IINA 4A0SA 1GUZA 1HF3A 2EV9A 3RD5A 3O8QA 1NBOA 3C85A 1A9ZA 4U0JA 3BMCA 2GUGA 3ANNA 2OMEA 4FD3A 3JQBA 4HKTA 4UUNA 2HK7A 2HMVA 3LQFA 4J7UA 3V2GA 1E5LA 2QRKA 3VHRA 3ZV3A 5KJ6A 1JWAB 3H9JA 3IC5A 4U6QA 5EQFA 2BH9A 5ILGA 2EJVA 5G0WA 4HY3A 4AJ1A 2IYPA 2NUAA 1KEUA 2VOJA 4I8XA 3PPIA 4RV9A 4A10A 3VTZA 3DAGA 3JV7A 2VWQA 1NWCA 3NKLA 5IJZA 4L8VA 1NFQA 3EUWA 4DYVA 4ZRMA 5F3RA 4XYBA 1C3VA 2UVDA 4K6FA 3HN2A 2O7SA 3D64A 3HHPA 4YT5A 1N1GA 1PJLA 2OP0A 4WJZA 3FHLA 1BTOA 1JAXA 4PLPA 1UAYA 3JQEA 4D43A 2ZTVA 4J1TA 3ENKA 1E3EA 4J7XA 5K6AA 4PG6A 2R00C 1YJQA 4DGSA 2YHUA 3T4EA 1XG5A 3CE6A 3DAFA 2YQ5A 2CNBA 3AI2A 2O50A 4IUYA 4P4LA 3LYLA 1AHIA 4C4OA 4E2ZA 4FBGA 4MVJE 4XX0A 4BS9A 1ZZEA 2WD7B 2VZ9A 4D45A 3DMTA 2AHRA 2O3TA 1NP3A 1X7HA 4OJNA 4BQPA 2VWHA 3C3XA 4BIIA 3ETDA 3N58A 3ZWPA 1TLTA 2J3HA 2BGKA 1E7QA 2ZB3A 5B4UA 4EZBA 4GPD1 1A7KA 1VE9A 3GH3A 4TMFA 4DC0A 2P2SA 3S55A 1A5ZA 5TGDA 1J4AA 3RUEA 3H2SA 3ZWMA 2BLLA 1HT0A 4IDCA 3T7CA 3F47A 3VZRA 5A04A 3BHIA 1RWBA 4TROA 1HKUA 4PGFA 5CPBA 3ZW8A 2W8ZA 1IL0A 3OQ1A 1XQ1A 3MZ0A 3QWHA 2P68A 2HQ1A 3F3SA 4I9NA 4RQTA 4XKJA 4J1NA 4N7RA 4Z3KA 1QR6A 2OFPA 3I6IA 1R66A 2NLOA 5BNFA 3ZH2A 4R41A 3U4CA 3R1IA 4CM8A 1KVUA 3L07A 3HNPA 3ZU4A 3AU9A 5BNIA 1PZGA 4WLOA 4D0RA 1H6CA 3DBVO 3F1KA 3OBBA 3OF2A 1VJTA 1RM4A 2FZWA 4KUHA 4Z0HO 3SBOA 5HS4A 4OGWA 3QV1A 3NGXA 4NIMA 5B12A 1KEPA 2FZEA 4J7CA 5DT9A 2G82A 1NASA 3F4LA 3PWSA 3JQGB 1MC5A 1NAIA 2Y1GA 4PG7A 4OKNA 4A7PA 2CMDA 1H6BA 2EF1A 3M2TA 3TZQA 1G6KA 5CG2A 2ZK7A 4J2HA 3WBBA 1EDZA 3KOUA 1WMBA 3U4HA 4YQZA 5L4SA 3W6ZA 3B20A 4I9UA 1D4FA 3HWRA 2O3JA 4YVFA 1XGKA 5BSEA 1HSOA 1Y8RA 4XRGA 4YCAA 3M6IA 4B8WA 3OEYA 4KMSA 1OI7A 4LCEA 2YW9A 1UZMA 2RHCA 3ADOA 5T67A 5GZ3A 4EUFA 4CMIA 4LN1A 4PLHA 1EDOA 1ISGA 3K30A 2FWMX 3PYLA 4TVOA 2PKQP 5F5NA 2PD3A 1T1SA 3H4VA 3WNVA 4RJTA 3PZRA 1EVYA 3OETA 4MIEA 3TDKA 5L45A 3KYDA 2P9CA 5G0VA 4IDEA 5JFOA 4AJ4A 1I2BA 1NHWA 3WTCA 2O3QA 2VWGA 3OJEA 3LT0A 1R4MB 3O4RA 3DHEA 2AQ8A 1ISJA 1EUCA 3H9UA 1GAEO 3PK0A 4JLWA 2EXXA 4MDHA 2FHSA 1U2DA 1GQ2A 1ONOA 4P38A 5C37A 4FFRA 2BGLA 3RC2A 4TRRA 5CEEA 1ENZA 1QG6A 5JAMA 2DUUA 4L4XA 3C8MA 3EAGA 1ZXBA 3JD3A 3I3OA 1U5CA 3ZU5A 3UCXA 4EEZA 1BGVA 1K3TA 4PLYA 1E3WA 1YBVA 2AQHA 2I3GA 3FTPA 4Z9FA 2JL1A 2ZJ1A 1YL7A 1ZH8A 1JTVA 4YJHB 2NQ8A 5CDTA 3JQAD 2Y0EA 1J5PA 1YE3A 3IP3A 1GTMA 2AEJA 1JU9A 3B6ZA 3BTOA 3MTGA 3ZWWA 1A72A 1B0AA 4BO6A 5DBIA 1FF9A 5L3ZA 3BIOA 1DSSG 1P1KA 4DPKA 4E33A 1PX0A 1UP6A 2VYNA 4NBUA 1ENPA 2UDPA 1NQAO 4OOFA 4RORA 3IAHA 2HMSA 3W6UA 9LDBA 2OXIA 3NAQA 2BI8A 2AMFA 1B2LA 3AK4A 3DZKA 3QP9A 1EE2A 1H94A 2C7GA 4Z0PA 4OQYA 1U9JA 3RFXA 4CL8A 4RDIA 2RHRA 5EINA 5F5LA 3DBLA 1PJQA 2HSDA 3GVXA 4UUMA 5I9MA 3K2EA 3MJVA 4J1QA 3ONEA 5GZ1A 3OECA 5JMPA 2C54A 2PWZA 3DZBA 1HYHA 4I5FA 2XAAA 3F9IA 1DLIA 4I08A 1GZ4A 1LRJA 1XLTA 3K92A 3QRWA 1LSSA 1U8XX 2VNSA 3ADPA 1FDWA 1KVSA 3LDHA 5JAIA 1PJ4A 4BVAA 1UH5A 1W6UA 4I1IA 1ZK2A 2O3SA 2BD0A 2ZJ0A 4PCVA 4CUZA 4YDRA 4IXTA 2C59A 1QXSA 2WTBA 3PEFA 4QO8A 3LLSA 4I9HA 3Q0EA 1HZZA 3V5NA 3WQQA 3KHUA 4R5MA 3C7AA 5TJHA 3HFGA 5JY1A 3W8EA 1X1TA 4HFJA 1OC4A 4ID9A 2TMGA 2Q2WA 1GEEA 1NM5A 3FR7A 4PLGA 4AG3A 3VH3A 4AJKA 1HE4A 4O1MA 3L9WA 4ILKA 1R0KA 4E2XA 1RYDA 4BO3A 4KWHA 4E12A 2J6IA 4WCFB 1GY8A 1VM6A 3EZLA 3WTBA 1SB8A 4E6PA 3F4BA 3DHYA 4E30A 3UKOA 1E1LA 3ZN2A 1C0KA 3ZNQA 3SVTA 4FSHA 1ZK3A 3AOEC 2I6TA 2DVMA 1U4OA 2J3IA 2PTGA 4NBRA 1LSOA 2PKQO 3KVOA 3SXPA 3I9JA 1OZAA 3NDIA 1EVJA 4XIYA 3D3WA 3VDQA 3WSWA 3GA0A 4YT8A 1PJTA 7ADHA 4IJVA 5L51A 1GYPA 1B14A 4IQ0A 4PN3A 1E7YA 4URFA 3G49A 3U0BA 4ALKA 1ADBA 4C7JA 1MX3A 1I10A 4UUPA 3DFZA 1DIHA 1UR5A 1C1DA 4GL4A 1Z74A 5L95A 4CM5A 2FR0A 4DLAA 1T2EA 3WMXA 3HDJA 3RFVA 1YDEA 4DMMA 3VH1A 3X2EA 4R16A 2DPHA 2IYOA 3I52A 3JD2A 4IJKA 4YPOA 1PZEA 4WCFA 1HTBA 1X0VA 2Z1MA 2E4AA 1FK8A 2FR8A 2ZQZA 5ICSA 4GX2A 4FQ8A 1QP8A 2P91A 2VRCA 1MV8A 4ZICA 1JW9B 2RH8A 4HFMA 4WLNA 2ZB4A 4U5QA 3L6OO 4MOWA 4UEJA 3EK2A 2D59A 4I5GA 5DBGA 1T1RA 3NTOA 4MVJG 2VHXA 3PJDA 1DC5A 4GLOA 4BV8A 3TZCA 4MVJM 4EJMA 2AQIA 3S2EA 2VN8A 3MTJA 4RPKA 1DOHA 3JQ8B 3HB5X 3DO5A 3KETA 3UH1A 1PL6A 4ZHSA 4DMLA 3TZHA 1R0LA 4L74A 3HADA 5IF3A 2EGGA 3LC7O 4JROA 3FR8A 1R16A 4HFNA 3WX0A 4CQMB 2QIOA 4JQCA 4E2WA 4ESOA 2NV6A 3GLQA 3PTZA 1I5RA 5A9SA 5IDQA 1LRKA 2O3UA 2NVBA 1ZK4A 2B4TO 2EERA 4PLZA 3IKTA 4IQ8A 2Y1EA 4GSLA 4LMPA 4XCVA 1WW8A 4AJIA 4RGBA 3RSHA 2YV1A 1X7DA 4G5HA 1K6IA 3V1TC 2A94A 3PGXA 4RCVA 4XGKA 4ALMA 2C5EA 1NTOA 1UAGA 2DBZA 4LISA 4OHUA 1O0SA 2H9IA 3HB4X 4M54A 1JKFA 1JLLA 2VQ3A 5B4VA 1MXHA 1JN0A 1LRLA 3KB6A 3O9ZA 3GT0A 3ZNPA 4WKGA 2NTJA 4AJLA 5L7TA 1NVGA 1NAHA 3PYXA 3H5AA 5L4NA 5T64A 5DCWA 4YJHA 5TRTA 1QV7A 5JMWA 2GF2A 2EKLA 4L4SA 3I4FA 4OXKA 1P33A 2HCTA 3BXXA 4CM4A 4Q3EA 3ONDA 4NQZA 3WGHA 3I1JA 2Y67A 3BAZA 4FGSA 1MG5A 2DQ4A 5COQA 3RAJA 4HXYA 1IUKA 1IY8A 2X1HA 1HYGA 5LDHA 3FPCA 1CYDA 1DPGA 1PL8A 4PVCA 2AEFA 1M6HA 4D3DA 2RIRA 2VHYA 4INAA 2VHWA 1C0LA 1MFPA 1D3AA 1WWKA 2Q50A 1LDNA 2XOXA 3ANMA 3QSGA 4W99A 2CY0A 2NM0A 3WNQA 3HZZA 5A02A 2EEZA 1KIFA 3RJ5A 5LCXA 1FXSA 2NVWA 3ZCXA 3CMMA 3KLMX 4DC1A 1T2AA 3PDUA 3FNGA 4R1SA 2ZYGA 4FIZA 2E82A 1GADO 1XU7A 5I7EA 1R12A 2CF5A 3RKUA 3K31A 4XJSA 1U7HA 3DR3A 3T7EA 1Z82A 1XEAA 3BMNB 1J6UA 1E6EA 4R01A 2F00A 4QQRA 1PQWA 4A5OA 3D4NA 1GYRA 3CZMA 4A2CA 3O03A 3SC6A 5TIIA 1I2CA 3DBHA 4Y98A 1OBFO 2A4KA 3ROQA 3RJ9A 3GUYA 4W6ZA 1SBYA 1D1TA 1T24A 4EJ6A 4P22A 3HDYA 2QW8A 2G17A 1U5AA 4MP8A 4CLXA 1U8FO 2X0RA 1PGNA 5KVQA 3GQVA 3EY4A 2Q2VA 2FPPA 1PGOA 5JDIC 2I66A 1X0XA 3V2UA 1N7HA 1EZ4A 4DWVA 4R1UA 3ST7A 3UF0A 4EBFA 4PZCA 3S8MA 3GGPA 4MVJF 4CQLA 3EZYA 4E5MA 4IPTA 2W2KB 2GN9A 3UUWA 1LC3A 4ZQBA 1FMCA 4CR8A 4IMRA 4M1QA 4F45A 4FB5A 1MGOA 4M49A 1QRRA 3TSCA 3EYWA 2PLAA 2JJYA 3RUHA 5JC8A 3PWZA 1MFZA 3WDSA 3Q9UA 4AJ2A 3D1LA 2GASA 1Q7GA 1K0UA 5I9LA 1FJHA 4FOSA 5TF4A 4CM6A 5BSFA 1G1AA 1KC3A 3CKYA 1P77A 2RBEA 5KJEA 2ZYDA 6ADHA 1E7WA 2WD7A 3I23A 4B7UA 2LDBA 3WFIA 4ZQHA 3TOZA 2LDXA 4KUEA 4DPMA 4LCJA 2ZB7A 3E18A 3H9GA 3VH4A 4E31A 5JNLA 1SCUA 2VZ0A 1I3LA 3NT5A 1PS0A 2PFGA 3HJAA 3PGJA 3PIIA 3BHMA 4R69A 3P5SA 5IN4A 1Q7CA 4PLTA 3PIDA 1F0YA 1O94A 5T6BA 3EGOA 1PR9A 1A71A 3DZJA 1HDOA 2W90A 1YJ8A 1OFGA 3HUDA 3LF1A 3O38A 2IEDA 2B4RO 4IDBA 3DONA 4J49A 1O89A 1AE1A 3D4PA 1VI2A 3JQCA 1ISMA 5JBIA 1N1EA 4OXNA 3JQFC 3U3XA 3UW3A 3ZWOA 4RO0A 4GKBA 1X13A 4BNNA 1NFRA 4BNYA 3RBZA 5JDCC 1P1RA 3O8QB 1YKFA 5G4LA 1SZJG 3TNLA 1VL0A 5L53A 1BMDA 1DFGA 7MDHA 1XKQA 1XU9A 2JCVA 3OEWA 5B4TA 5AXCA 4NJMA 3LT1A 4CMBA 5LC1A 1ZK1A 3ITDA 5L7YA 2VRCD 1Q0LA 1HDZA 1EBUA 1UDAA 1DLJA 1V3VA 3JYLA 1E6UA 3DOCA 4RVGA 3SX2A 1M75A 1PWXA 3NTQA 2PGLA 1Y1PA 1PTJA 3WGGA 5CAEA 4BKQA 4J6FA 3INGA 3INRA 4MP3A 3B1KA 1KEVA 2Y1OA 1F8FA 1M2WA 4KP7A 1KBZA 1JKIA 4WNCA 3JQBC 1U28A 5IAAA 3GUCA 4UEKA 1MA0A 4DBVO 1BSVA 2Y1DA 2B37A 1ZNQO 2JCXA 4QO7A 4II3A 2H63A 4QEDA 4HADA 3GPDG 5G0SA 4NFYA 4FDAA 4BNHA 2O4UX 4NFSA 5KJ1A 1NVTA 4ZRNA 3IMFA 5JS6A 1A9YA 3PLRA 2D5CA 4U0KA 1GZ6A 1NPYA 2YY7A 1G0NA 2QHXA 1H9AA 4RZHA 4M89A 4YRBA 4CLOA 2QZZA 4BNTA 5IXSA 1GYQA 4PLWA 1HLDA 6LDHA 3ROMA 2YJZA 4XWYA 2VOEA 3WJ7A 4JX8A 4BNXA 5HRUA 1E7SA 2VYVA 5KJCA 4NMHA 5JCJA 3QWAA 4XDYA 1Q2XA 3HQ4O 1L7EA 5K0ZA 2X22A 3ETGA 1GPJA 2QQ5A 4XIJA 2DTDA 1UXGA 4OQZA 3TPCA 3W8FA 2P9GA 3GEMA 1DJNA 5KVSA 1KYQA 4JCOA 4OL9A 1ADCA 1B16A 1ZKMA 2NU8A 4BL5A 1YGYA 3GAFA 4CQMA 4OO3A 2UV8A 3GFBA 2OORA 3E8XA 2R00A 3DZIA 3DL2A 3BMQB 4Y9DA 2JHFA 1CDOA 3PLNA 1KVRA 1CWUA 2O23A 2P5YA 3H2ZA 4BO9A 5A3JA 3L6EA 5C7IO 4OM8A 4CR7A 4CMJA 1BWSA 3ROKA 3CEAA 3IP1A 1XYGA 3JQ8A 4J3FA 4QUKA 4XQEA 1Z7EA 3VTFA 3VVCA 5CDUA 4YACA 4BO0A 3UOGA 2FP4A 4DQVA 1A4IA 3P2OA 3ENNA 2IODA 5KJFA 4W7IA 3AUSA 4CMKA 5KTKA 4EJ0A 4RQUA 2C20A 1E1MA 4NPCA 1R15A 2CFCA 4W7HA 5EIOA 3MJCA 3W4JA 4H15A 1LA2A 2P4QA 4WOJA 5TLSA 2EWMA 5JAQA 3K96A 2IDZA 1KERA 2WM3A 4CUJA 2R6JA 3WQSB 2NWQA 4FR5A 4X54A 4DTIA 4YA6A 3D5TA
chains in the Genus database with same CATH superfamily
1Q1NA 1T0JB 1W88A 4UUVA 1U1DA 1YCFA 4GZ3A 3NTRA 2K4BA 3OY9A 1UBKS 1YUBA 2DP4E 3EVNA 1EFPB 5B1AH 4XJTA 1YA6A 3TFWA 4CKBA 2IGMA 3SP1A 3EBPA 2AE1A 4GWLA 3RKRA 1LNZA 4BTEA 4NYMR 4R8LA 2DCEA 4UBIA 2DQSA 2QQ8A 3IDSA 4L27A 2D1YA 1BKDR 4PLVA 5TPWA 3ZNNA 5K45A 2Z5LA 4QIHA 2AOTB 3NC0C 3QYFA 5D3KA 2XGMA 5FO1A 3R9XB 3F67A 2DUWA 4UW9A 2WJ6A 3QXCA 1REPC 4JQOA 4KVZA 1D8AA 5EOVA 1XI2A 2O48X 3NC4A 2PSSA 2ZCJA 4UHBA 4A8JC 2XWPA 4TS1A 1WMAA 1J25A 2R66A 2ZCVA 1TKCA 4FYYA 4QASA 4X71A 5KTYA 1Z5VA 3EEYA 3WDLA 1KJIA 2MG4A 5KTTA 4OHCA 2JF0A 2POQX 3RQ4A 3LU1A 1CQIA 2HSGA 4CDGA 3LNTA 1L7BA 1ZD5A 2W22A 3W04A 2VG8A 2E49A 2DJIA 3S14J 2WSIA 2XNHA 3RU2A 4XTCS 2N42A 4IZHA 4MUJA 2VPRA 2PUEA 1GUDA 4H7KA 1E7MA 3G2QA 2JFFA 2WSYB 2JAOA 2J4FA 3Q0WA 5FD6A 1RHQA 1HOMA 1S4MA 2FU5C 2Y0PA 1S6YA 4G4GA 2QR3A 3VM6A 4FQ7A 1CUUA 1O7FA 2FV8A 4KV7A 5JLAA 4D0LB 3BJ6A 3K1NA 2XE4A 1DAFA 3IWFA 3ET5A 4HN4B 2FZKA 4D7NA 3HN7A 3SBEA 4NXMB 2BISA 2BMEA 2QYTA 4Q39A 3C1TA 4XRSA 4P81A 1ZH2A 1R71A 1G5HA 2PJDA 3MXTA 1GAXA 2DAPA 1FTSA 3FLAA 4DDUA 2MW8A 3FWEA 1T36B 1Z3CA 3DZFA 3CHYA 3NUGA 4ALIA 2YPRA 4A3LJ 1P5HA 2VF8A 3AF2A 2QX6A 2HJRA 1O4XA 3HBNA 3PC6A 5M29A 4N01A 1QGUA 4GFBA 1Q11A 2A9OA 2XB8A 4MEXF 1TK3A 3QVXA 5CR9A 5F7ZA 4EYQA 5KDDA 2ZWVA 2OORC 3PQFA 3S32A 4CEJA 1TMOA 2CLIB 3LI2A 2XF5A 1R50A 4XIGS 4EHLA 3TL4X 5FJ8J 3GLGA 2UXCB 1OXTA 3NRCA 1P7IA 3S2HJ 3OOPA 3V42A 3J80K 1YFHA 3LCVB 3WYDA 5T6MA 4Q0MA 4C89A 5CA1F 4PYJA 1C0WA 2IS6A 1BGWA 1ZJZA 1RHUA 4H31A 1BWQA 2JPDA 2DH5A 2QR2A 4BWVA 5IVPA 3QE0A 4IIXA 4DNCA 1VMAA 4UNNA 1YQGA 2IYYA 2B83A 1DQNA 2GZWA 3C15C 2DQRA 3JAKA 1NVUQ 1JIJA 2A84A 4QULA 4MH0R 1FLAA 2H00A 3DTTA 1USKA 3DBLB 3ANXA 4PYNA 1QH9A 3QWIA 5REQB 1IUOA 3WLAA 5JYCA 1VIYA 5EIXA 3P9CA 1OTYA 5C4XJ 3E7DA 1XDWA 2KYRA 1U1GA 2J46A 4JK3A 1MKYA 4L4RA 1R74A 2ETHA 4J4HA 5HYVA 3H8SA 1TQMA 2ZRQA 1HWYA 4NU0A 4XR4A 4YAKA 4D4JA 1A1VA 4DCNA 3LFTA 4IJWA 1M83A 1RQNA 5K8IA 2AW5A 4UTZA 2V9VA 1O94C 3P4XA 1H2AS 4P3NA 3BGDA 4WBNA 4M1EA 3DDUA 2QA4I 2H4WA 1DWUA 1XZAA 4I55B 3A2LA 1ENYA 1NYRA 2UZAA 1D0IA 5AIBA 3ELBA 4L9VA 4RGUA 1WW3A 5AHXA 4A03A 5CDSA 1MNQA 2B8WA 2PX8A 3PU6A 4MLCA 5ES4B 2GAIA 3FWZA 5BQFA 5K8UA 1OGIA 1DGQA 5BYAA 3DWLE 4OL0A 1F8YA 5IFLA 5AKHA 2QSUA 2XUIA 3V1UA 3HS3A 5IM5A 4S2UA 4U7WA 3HCDA 1UK9A 5EIFA 3P9XA 1IB6A 2YWRA 3MN2A 2Z2SB 5FLMJ 2DY0A 2KLBA 2LLKA 5IAOA 1W49A 1XXHE 4JLNA 1BWRA 3HM5A 1W29A 4UCWA 2G0TA 2KIQA 1RWVA 2ADMA 3BX1A 5BSKA 2YNMC 1YS9A 1EJ0A 1B42A 3CLUC 3WYEA 2GPTA 4MRRA 3IHLA 3QBEA 4LITA 2C0QA 4U3JA 1NFFA 2ZSKA 1L8LA 3A01B 5DVZA 4AYWA 2NV2B 3M5CA 5EJ7A 3CRRA 1H69A 1OFIA 2DFVA 4G1BA 1J8MF 1POWA 2P6NA 4JLDA 4QOGA 1KQ9A 1P2FA 2FK8A 3LPAA 4LV8B 4XIFA 5JLJA 5A4IS 2WABA 4JR0A 1K88A 2QYHA 3T5GA 4NZNA 4D9KA 3PUYA 4GE0A 1I7SB 1N1MA 1GJRA 1JUPA 1QFJA 1W94A 3IMGA 3H9EO 3V1YA 1E3HA 4L7VA 4EVIA 4MCIA 1RNLA 5JHGB 2W71A 3GLFE 2H85A 4G5SA 5JZOA 3I5MA 3R0AA 3IA7A 2L02A 3NHAA 4BYMA 1T25A 2YC2C 4YV1A 4Z4FA 2GDZA 5LOVB 4Z49A 5HW0A 1FY2A 3TFQA 2XUQA 4KH0A 4TV8F 4UB6C 3A4TA 4CMIB 3ZE7A 2HQOA 3BD8A 2BWJA 4G7HF 5AK5A 4XR9A 2NVQJ 1DPFA 3JRAA 1G8HA 1QHHD 4LI3X 4KPUB 4XCQA 3TP3A 2VHUA 4UPDA 3LBAA 1AO0A 3DZGA 1XSXA 5JCPA 4E7LA 2Y0DA 3FNIA 3OOUA 1XUOA 3QEJA 3QPCA 1UF9A 1YR9A 3S2ZA 3GQBA 4KQ6A 4RTPA 4RSRA 5GIPE 3LSKA 1ISHA 5JC1A 3T3GA 4KOEC 3OA0A 4I6ZA 2O7NA 3QIVA 2GAJA 2CQXA 3B2QA 3DEHA 2CE2X 1VKHA 2HKIA 1PUEE 3IHKA 1PLLA 2G7MC 1E6CA 3B3JA 4KH1A 2PT5A 2CCKA 4Y30A 4DNQA 2HHHB 3ORYA 2JVIA 3ZQKA 4FMCB 4YJGB 1JTFA 1XL1A 1Q7TA 2L17A 3CX3A 5GTDA 3AHDA 4EMSA 1DG3A 1SFUA 2OBNA 2P9TA 4NG4A 4B3IA 1I7DA 2W6MA 5ALHA 5K1ZA 2C2GA 4X93A 4C0SA 2L0KA 3HRKA 2QQBA 5ULLA 1CQTA 1NVAA 4WBNB 3C98A 2I76A 3J81Z 1G3QA 4OAPA 3H5OA 1QO7A 3C7DB 3IBFA 2OV4A 3QFSA 4IJUA 1MB0A 1HR0B 1CZRA 4EMBA 3STHA 3D02A 5HNKA 2B25A 2HRQA 4S35A 4D6XA 1V5GA 1RVDA 3TD2A 1Z6TA 4PC3A 4DMRA 4OIRF 1YULA 1NMZA 2FF5A 1MIJA 1ZR2A 1YQEA 3AR6A 3LUCA 1XDZA 2FCRA 4LRTB 1E2MA 2Y77A 1T08B 3PF8A 4QYIB 3FISA 2A8YA 2PXHA 2EOAA 1XXLA 3UNGC 3AP2A 5CTJA 4AIIA 4BNVA 5HPYB 1KS2A 4OPMA 3ZLUA 5H4HA 5JFRA 1G5IA 1UINA 3KXDA 1DZIA 2CYCA 2KJCA 3GO4A 5AESA 4EW6A 2QU8A 3F7TA 4GR4A 4ASUA 2HJHA 4N18A 4QC2A 4DCPA 1S9HA 3K1YA 1UPFA 3OU6A 3OOHA 2IDJA 1FTGA 5M04A 2EU8A 3ZNOA 4KI7A 4C29A 4POOA 5DXAA 4ESEA 2CF6A 3Q5FA 2HAEA 4J0FA 4E6EA 1VKJA 2N9UA 3STYA 5KDOA 4AX8A 1C8BA 3IBGA 821PA 3VKGA 2YKGA 1EAYA 2H1VA 2V65A 2X9NA 2AYZA 3DBRA 3PD0A 4MB0A 3AY0A 4TS9A 5D8DA 2WY8Q 3GLGB 2FSSA 1KBQA 2IC5A 1JQBA 3AUFA 2W00A 2VRBA 1TM3E 5B1HA 1SXJC 4EPWA 2GNOA 2PLNA 4LECA 5FAXA 3RLIA 3SJ7A 3Q98A 3RVBA 2E0IA 1UJNA 4TL6A 3RAGA 1LDYA 4TWRA 1H2YA 1WKMA 1XKLA 2IGTA 2NO9A 3GG2A 4IHJA 5EIAA 3TIVA 4RZXA 5TS3A 1VJ1A 4XYLA 5KVCA 3HNOA 4G8JA 4X5OA 1TZJA 4AJNA 4D9BA 4A36A 3K5WA 3FM5A 1GKUB 1SBIA 4TRNA 3GD7A 4TN1A 5ALWA 3UJHA 3UQYS 5K8TA 1PEKE 3WODF 2Q99A 3CR8A 4CV1A 2I54A 3QKSB 2AK2A 4UTVA 1R0SA 1PR0A 1MU0A 1LNQA 9LDTA 4XLFA 4MWEA 3FOFC 2Q49A 2YSRA 3VZSA 1YVRA 2M0CA 4IMPA 1TUGA 3URKA 4U7DA 5AVVA 4OQFA 4ETMA 1GPKA 1GL6A 3C6BA 2C29D 3FPAA 1R7RA 5TPZD 4OU0A 1MEEA 1FEZA 2OQRA 1E9EA 3SIXA 2LG4A 4RD4A 4X7RA 3WICA 1UC5B 1YHNA 2BH2A 3RUAA 1KPIA 4HV5A 2GA8A 4KN5A 1CQIB 1OXKB 1O58A 3DWGA 3OPQA 1J2YA 3JU3A 4G1FA 4GC5A 3AERB 4MVXA 1U5TB 1E18A 1P2DA 2PLFA 2PT9A 5HS9A 3GY0A 3QLVC 4HAYA 5CVDA 1GNQA 1V11A 3LM8A 3UWOA 3AY7A 3E5UA 4FHCA 3B85A 4ZDLA 5HCIA 2NW6A 1E6MA 4AF6A 1ZDMA 1FDOA 3TWOA 4UASA 3TL2A 3KR2A 4DLLA 1V9LA 3WA7A 3RWBA 4L5CA 2JANA 4H18A 3E5NA 4JODA 4XGIA 2CJXA 4BTVA 1NJGA 2FJ1A 1FYWA 5LQCA 4JLMA 4OGKA 4W5QA 2GF0A 3LSMA 4JBXA 4OV6B 1KYXA 2Q29A 4P86A 4QUJA 3U40A 2WHRA 4D96A 5FFMA 1W4AA 3P9RA 2EW2A 2ECBA 1C9MA 1ZYUA 4NZMA 2H1OA 1AKVA 2P2DA 3Q7PA 3BKWA 2CDBA 1GN8A 2G6BA 4G2NA 4OLAA 1FU8A 1DEHA 1DI0A 1XZCA 2XEDA 3PPWA 3IJPA 1NW8A 4CM9D 1U2TA 4H3SA 1KAEA 3W90A 3E3OA 4UVIA 2ZETA 4D8YA 1IHYA 1CFZA 3AFHA 2GPJA 4ANJA 1UPTA 2YX7A 2V7PA 1MXFA 1EFHA 3AJRA 3KCNA 3MGKA 1E2BA 4HSRA 4C30A 1QAQA 1V7CA 2PUDA 4LXXA 4WSOA 2V7EA 3IIMA 5A62A 1JG6A 1U9IA 3ETEA 1EFVA 4PHGA 2K27A 2A35A 3G8CA 1KI9A 1JUSA 2BKEA 3ICCA 4Q4LA 3MC1A 1K97A 5AIAA 5E7QA 5K51A 4C7BA 1CQJA 2CVQA 3KR0A 5DDIP 3CUQB 2ZJ7A 1YOVB 4YRAA 2BW3A 3PO3J 1WLSA 2GEDA 1CVRA 3FNRA 3B1VA 2MBFA 4LHXA 5FYDA 3TPZA 4ARBA 2BMWA 2HB6A 3ESYA 1U65A 2K9MA 3G88A 3M1YA 4M1YA 3W5SA 1FFXA 1A7UA 1RXVA 4HX4A 4WFKA 2C5AA 1LSJA 4V2UA 3NJ4A 4XPIA 2GK4A 2VF5X 3MQ0A 3I3LA 2NV0A 3FRHA 4G23A 4R3WA 4BNIA 4E1VA 1KYVA 2CV1A 5DSZA 2REXB 3BF8A 4WK8F 2YR0A 3DOOA 4PCLA 5GIOE 2XNDA 3OQBA 4FFBA 3I6MA 5KNDD 1FJXA 3L4JA 1N78A 2OCIA 1H1LA 5A2QK 1RTKA 4L50A 4LRXA 4ZT4A 2IAIA 1BVYF 1ZJ4A 2WFLB 3GVCA 4TUYA 5SY4A 2JLVA 1MJGA 4Z6YA 1M2NA 1W73A 2GRAA 1V4NA 3IUSA 1JV2B 4O0MA 4BFTA 4RULA 1HE3A 2AOVA 1UZAA 2XLCA 4FMPA 3VR4A 2DA3A 2LREA 3G0BA 4GNKA 1AT1A 4XLLA 5DNAA 5U1PA 1FDUA 2GKOA 2QN8A 4I66A 3F3YA 3WLSA 5JRZA 5JXHA 1X1CA 4QJ3A 4FWBA 2J4DA 2WT9A 2ZLBA 3QVJA 4ZOEA 5E7IA 3LS2A 4WLFA 3A32A 3OZGA 5JS7A 4QXPA 4DV7B 3E5RA 4ZCTA 2FBKA 2QVZX 4GGGA 2Y9ZA 3ABRB 5CHEA 3VJMA 3H1FA 5T4FA 4BP3A 2WEKA 2Q9AA 4H1VA 2OTJI 4NLLA 2ANCA 1II0A 2VT3A 2ASEA 3L46A 4Q5IA 5EYPB 4C4XA 3F8FA 4JU9A 1E92A 3BJIC 2YRFA 5TC4A 2IBTA 1SQ5A 2CMFA 3IOEA 4TMWA 3ZS8A 2VQFB 3QHAA 3LKDA 2WHXA 2BFEA 1WCV1 1QPMA 4D25A 1LNSA 1VF9A 2JI8A 2ZRHA 3PFWO 4G24A 1U1FA 4XUDA 4MLZA 3KEYA 1T43A 1VHTA 5FTWA 1GZ5A 2Q0XA 2FW7A 2EFJA 3WLOA 1GQOA 2DOKA 1XELA 2OAQ1 3IA2A 4AY4A 3NXKA 5I51A 3KP4A 2GCPA 4KFRA 1NVWQ 4MVJI 1E3DA 3GX1A 4ERNA 4RD3A 1E2PA 3WXBA 4J0JA 4OU5A 5KMGB 3VYTB 4JT4A 3T5PA 3R8CA 4DY6A 4JD5A 4MUIA 1NVEA 5EG5A 2M30A 1ECPA 1JA9A 1Z5ZA 3BWVA 1TWCJ 1TGVA 1P2GA 4I7HA 2PN1A 1ZIDA 2Y48A 1HKQA 4KYWA 2VSNA 3C39A 3FWYA 3IRUA 4B3AA 1FFHA 2O7QA 3OL3A 3EGXA 4GMGA 4LUCA 4JZKA 2CD9A 4LV6A 5EA2A 4QU9A 1FBSA 4PCAA 1NGSA 1GOTA 5G0TA 4F52A 1NXQA 3G7UA 3WSTA 3U7GA 2W6JD 5IYZB 2AJBA 4BXUA 2CJWB 4CKEB 4LI0A 5FI3A 1KGDA 4Y2QA 4X62B 5DNWA 4YRTA 4HUQA 5H80A 4EDHA 3WTZA 4J43A 2AHOA 3ADCA 4P0QB 3HKCA 4KT6A 5E2IA 3MJSA 2HXOA 5AHKA 1MRNA 2A30A 2D8AA 3FHNA 3P7NA 2QWXA 3G79A 3CX8A 1QIEA 1W5TA 10MHA 2SICE 2X3FA 4AM3A 1E5TA 4UTXA 5K3BA 1FA9A 4ROTA 1CHDA 3E2PA 2VDQB 3NGMA 3EFBA 5K3AA 5JAUA 4Z4GA 3BPXA 5P21A 4UTOA 3C4VA 4FT2A 3ZE1B 1JU3A 2Z9BA 3C4JA 4UHCA 1CJCA 1ODTC 5GWXA 4K9NA 5E6UB 2JNWA 3EQZA 4FFLA 3AHHA 3KZVA 1D1PA 4G9GA 4RF2A 1HMPA 5KQPA 1DKLA 2FPGA 1NBME 1Z6AA 1ISSA 3IBCA 3OFKA 3ZDFA 2VKEA 2IHZA 5AM4A 3P0JA 2VHTA 3RI3A 1QV9A 2P7VB 3U6KA 1J97A 1ACJA 3JWPA 2FU4A 1V54H 3VB2A 2P0AA 2WJ3A 2XGOA 2BUCA 1HFWA 1P9WA 3B13B 4P4GA 2XMDA 4O5VA 3NS7A 5F5XA 5JCZA 1G7CA 4FFVA 2C88A 4N8EA 3CVUA 3QWBA 2YJTD 1O95C 3H84A 2XTJA 3L8YA 1UM9B 1XDBA 2CSUA 2WWGA 4F96A 5DP2A 2V26A 2I22A 3HB7A 1WCWA 2BV3A 4OHYA 4LHYA 3TMOA 1IBRA 1EXMA 2HVSA 5B3JC 4OD0A 3Q3SA 1C41A 1P44A 1FL9A 3PKZA 1RQLA 2ILTA 2H9AA 1AGXA 4QJBA 5JVDF 1ZMOA 1LU9A 4LF4B 1GU0A 4LIUA 2ZNYA 1LWNA 2Q6LA 1H8EA 3Q7TA 2JDIA 5C31A 2MDTA 3L8HA 3ZEAA 4NCAA 3DFKA 3MJTA 4FYHA 3RPEA 2AN5A 5HZKA 1I6XA 4BBSJ 1Y4UA 3FPLA 3VR1A 2QXYA 2YDXA 2IW5A 1UDBA 1OT3A 4M8NE 2LNBA 1A8HA 1C2TA 4RF4A 2QL9A 3UN1A 4O33A 5B36A 2JEYA 3SE7A 3W4KA 3WOVA 1SBTA 1YB2A 2BCGY 3N28A 2CHGA 4XQ9A 1EJ2A 5CAEB 3WYNA 4NB5A 4E88A 2XGXA 4C43A 2OCAA 3JYNA 1RSZA 4II7A 1IRXA 1N2JA 1QHYA 3WL8A 3DM9B 3CESA 5BS6A 1J1UA 2IT0A 3GL9A 5BYJA 1M54A 1X58A 2JRMA 4JBIA 3RG8A 3CC7I 3KTOA 5FBRB 2DT7B 3UTCA 3UJ7A 2JGDB 5E1DA 1AUPA 2FMIA 2HTJA 3V8LA 5AONA 1GPNA 5ERYA 4AS2A 3IR5A 4B3XA 3EF0A 3JATA 2FN3A 4LWPA 4UZFA 1IJEA 3W8NA 2WA2A 4OQEA 4HZUB 5EPUA 2YWEA 3ABZA 4PAOA 5JEEA 1VRWA 2F64A 4GMXA 4OXYA 1IOWA 3VZCA 1KJZA 2IS1A 3KQQA 2OV8A 5H3LA 4DBLE 1X3UA 1OISA 3ZE6A 1DOZA 2W2KA 4PX5A 1RTTA 3WISA 4B31A 4CMCA 4UUOA 1Z68A 2W48A 3OP4A 2FFAA 4H6PA 3IKJA 4GPTA 2G7ZA 4W1SA 4BNUA 2XIQA 3U4QA 1AURA 2IVMA 2JJ1A 5EHNA 4BP1A 1OE0A 2KKOA 1WABA 2F3SA 3MT7A 3AILA 4PSCA 1Z5PA 1TXGA 2NSDA 3RC9A 2OBMA 3REGA 3FXJA 4IDPA 2HA2A 1JT0A 2PT6A 4JJAA 4TKVA 1SVKA 2NSLA 2BGTA 3RTRA 3SOPA 5DDGA 4U63A 4XI9A 1IXSB 3U81A 1CUZA 4E21A 3KP2A 2G5CA 3IH4A 1ZD3A 4X6LA 4NZYA 3IO5A 3HP1A 3VO2A 3RIEA 4Q5SF 4LG3A 1YVEI 4FLFA 4G5OA 3AVWA 3VYVA 4BHBA 4OBXA 4JYAB 4K86A 3GLSA 4HYTA 3V4SA 3Q2IA 3WQHA 3MJEA 4L28A 4KR6A 5BWLA 4JUAA 1CUWA 2ZB2A 3NM6B 3X43A 1A98A 4BC0A 2IF2A 1KZGB 4WEQA 7REQA 4DMCA 2NZVG 3Q1LA 1BD3A 2I71A 2WJHA 4FVTA 1D8KA 2AB0A 2VHVA 4CLDA 4JVNA 1PP8F 4E7HA 1RWQA 3K6SB 4ZI7B 3A14A 3HSKA 1XF9A 4EG8A 3OCUA 3GDWA 4JKIA 1K66A 4G37A 3SM9A 4YO7A 1K8RA 1QFZA 2PWYA 4PQGA 4M6VA 2QSYA 3CINA 1EQ2A 3B5EA 1YJWI 4V38A 3RO7A 4M37A 1BC8C 4DV4B 1YF3A 1C3EA 3BM5A 3HA7A 3LUAA 4ZGBA 4G0UA 2LY9A 5BN5A 2YMMA 1ZL0A 2CMPA 3OIVA 2IV3A 1G60A 2YHAA 5D5WB 2XH8A 2HEOA 2AT1A 3ASYA 3ZN0A 2E1MC 4DBLC 3KOOA 4TLBA 2C57A 2VPPA 4RQAA 1EA3A 5TQVA 5JANA 3NEJA 1LBEA 2FMLA 3GLRA 3JWJA 1R6AA 2GLXA 1NF3A 3TJRA 2DLCX 1TNSA 3IRQA 1G41A 3LPDA 3MXOA 3N8KA 4X1KA 3GCMA 1S9DA 1MPXA 1WUHS 2ZRMA 3K73O 2ZU6A 4OGGA 1P0CA 1V6AA 4G5QA 4D3SA 1N9KA 1FLVA 5HF6A 4UDNA 4RFVA 2APJA 3SX0A 4B6RA 1ABFA 1RP7A 3LUFA 4B3DA 3CVYA 1CUHA 4I76A 1IRIA 5AH0A 1MLDA 4LRUA 5LZ2A 1EINA 4XX1A 2ZATA 4B6EA 4F3KA 4QOSA 4C2AA 4Z0TA 2B5WA 2XWSA 3H2KA 3F23A 5FLXK 1R6XA 3KKQA 3LYUA 3S1RJ 3MIIA 3OZTA 1QOZA 3WAKA 3G5AA 3KEQA 4JP2A 1G7SA 4RSMA 4DJFC 2CJWA 3DTYA 5MGBA 5J3JA 1VQLI 4BJ6C 1TU3A 3CZRA 2WBLC 3I6BA 4CKZA 1TQ8A 2GVDC 5HUQA 2QY6A 3LT4A 1E6LA 4YWJA 5ECYA 2P4WA 1GL3A 4X6XA 3AQIA 1J8DA 2D2EA 3BXGA 3DNFA 3GEBA 2QTWB 3GRUA 3O4IA 4PG5A 3VU9B 1E4VA 4OHVA 2V3VA 3A1TA 4HF0A 1IW7F 2Z6QA 1K2WA 3K69A 1NN5A 2A1TR 1TF5A 3MWFA 2H92A 2GM5A 5ALVA 2IYVA 4L0QA 2WKPA 5ICFA 4QQKA 2PFBA 2CZGA 1BDBA 1NNUA 2YZGA 3PS9A 4WXYB 5K1YA 3TOXA 5HVNA 4KMUX 3FNBA 1BVRA 1XZGA 1L7QA 3IDAA 2O5VA 3AFOA 3NDPA 3VJRA 2H4JA 4WINA 1VLHA 3STXA 2H2IA 4YX9A 4UXJA 4BBPA 1R5OA 1N3LA 5T8KA 3TMKA 2W5UA 1LBSA 5FKKA 4URWR 3HIFA 1L5QA 2X1VA 3JSPA 2FOIA 2BFEB 1UWVA 2PRZA 2XDYA 3DFUA 1YE9A 3DA8A 2NXCA 3ZZUA 1RZRA 2XRZA 3OWXA 3M7IA 3WK6A 4BE9A 4DEXA 1YS4A 4ENRA 4MWBA 3AM4A 3KAPA 3TW8A 1TCUA 2H1KA 2AXPA 3V9PA 1KYWA 1SFRA 1VI0A 3H0KA 3O75A 4LDAA 2VWPA 5FFFA 4UAVA 3IH2A 4MQLA 5C34B 1RRJA 1GKLA 2BTQB 4QVKA 1KXJA 3OPYB 5F6FA 2E6UX 4EF6A 2VVTA 3TCKA 3A31A 4O4JF 2H4YA 3LAWA 2AYYA 4R5HA 2X8LA 1GTVA 5JAZA 2I4MA 4YELA 3FM3A 3BZUA 4QTXA 5J4LA 1T3ZA 4F9TA 1ZC3A 1BA5A 1UPBA 1RI4A 3P9IA 2L7FP 2W4QA 2PGNA 3OZEA 4EB0A 5DM70 5ILUA 4F92B 2D5AA 2YRXA 3C41J 3CLRD 3F46A 1NHAA 3TYXA 3ZIAD 1ZHOA 3THXB 1TJ4A 2JARA 3CNLA 4HH0A 4PZ0A 4DT1B 4EHNA 1RWPA 4X8HA 4TRMA 2YUSA 1FMJA 4LJ9A 3V55A 4L8WB 2PZLA 3NVDA 1BR2A 3OPXA 3W5IA 2D4AA 4OQQA 1OIXA 1U8ZA 1U78A 5A2GA 2BKXA 2KMUA 2LV8A 3MWEA 1NL3A 2PS0A 2UYOA 4RGYA 5EN4A 1GV0A 2VPTA 4CL2A 3OZ7A 3JCZA 4D80A 3VKVA 2J5XA 1NNLA 1S5PA 2WJPA 4J76A 4N0DA 3DZ8A 3MRXA 3HYCA 5DLYA 2G9QA 4B44A 2EFEB 2H2AA 2XVYA 3I32A 4P3OA 5FTMA 2JZCA 2OZPA 1P29A 2WT8A 3EVDA 3SHFA 3O1JC 4J0CA 1IHXA 3MEXA 1AN9A 3EEFA 3O1IC 3DLBA 2DCMA 2YC4C 3GZJA 2L54A 4MW1A 5EESA 1QQBA 3L6BA 2EILH 1BXGA 2IPNA 1RAEA 3DQQA 3JWHA 2JKVA 3WHBA 1N8KA 4HH3C 3CNNA 3UAOA 1YSCA 3I6ZA 5M7EA 2E1MB 4E7ZA 1RLMA 3MJ4A 2W83A 4XZ3A 3BWDD 5HS6A 1Q95A 1ILWA 5K3DA 4J6EA 3KQOA 4CM7A 2QB5A 3D31A 4RZUA 4DSNA 5JWOA 2A07F 5B58C 4KVFA 3GP3A 1K7CA 4IAOA 1RKWA 1RXYA 2NXNA 4UM5A 1MCZA 1B3BA 1LS6A 1V9CA 2GARA 3GFLA 1R6DA 1WHSA 1SU7A 2EHDA 2J7PD 5IAKA 3BG9A 3KUKA 1QCYA 1D2AA 3GJQA 5AO9A 1D1SA 1W4ZA 2X6YA 5EJCA 2H1RA 3GARA 3HU3A 3KLBA 1YL5A 3LPMA 4FGUA 1DQSA 1K6XA 4J3JA 2HNBA 4R68A 4ZCLA 3SPXA 4AY3A 5T8KC 4E09A 2DQLA 3FVQA 2DT5A 3D4IA 3IGFA 5EPEA 3TRIA 4OLBA 3K7EA 1MN6A 1D4OA 3ZV4A 4LF9B 2DC1A 5FDFA 4B80A 4BHTA 4ZALA 3SMQA 2QJWA 2WWHA 3K09A 1CIPA 1TQPA 1BU5A 1CLEA 4RMNA 1ZISA 2Z5UA 3CO0S 4IIYA 4NU5A 5DM2A 1Y3IA 1YU9A 2QZ9A 5AXBA 5E3NA 4TX1A 3NX4A 5DHTA 3FMFA 1KOGA 4OA5A 2DU9A 1KNQA 2ZIVB 4Q9AA 2FPKA 3UUGA 4I4IA 4RFLA 1WJBA 1H89C 1B72A 3DJYA 1BCRA 1TC1A 4AYBA 4HAZA 1Y8QB 2JGRA 2YZKA 5JS8A 2NNLD 1JT2A 4XD2A 1L4LA 1UC8A 3EJ6A 3GEPA 1DKUA 3LBNA 1N32B 2GZ3A 3RRFA 1X1PA 3GHYA 3K16A 4PZYA 1R0CA 4LYFA 1E5XA 3G2KA 3FCYA 1ZKGA 4QPQA 3GTJJ 3AVPA 3C8HA 1FJ2A 3E48A 2E1CA 4OJQA 1MB2A 3VTAA 1Y9EA 1YRNB 1FVOA 3K10A 1Q0PA 5SYMA 3TTVA 4KLRA 5JEDA 2O8FB 2KT0A 1II8B 2C42A 5F9MA 1B6RA 1S2OA 2JEOA 4HYEA 1S01A 1WPRA 4ZTJA 1V71A 1GL7A 1XRLA 2DKFA 4QWMA 2P2LA 3KLNA 5GTIC 3A1NA 3K20A 3VR6A 1PNOA 3SICE 3KKEA 1K5HA 1DC6A 5AKKA 4XM0A 4ZEXA 5LZ4A 3ER9A 3N0RA 1VPDA 2YASA 1NWHA 4P84A 3UHAA 1Z8FA 3W3CA 4LY0A 3BICA 2JBWA 3CLHA 3ZHXA 5KOHB 3ZR4B 3OICA 1PE0A 3TQOA 1K63A 2A5FA 2ORWA 3SX4A 4FPXA 3V32A 4P5DA 2EZKA 4MV8A 3CEJA 2HCRA 1ABEA 4R79A 1JB1A 1BXGB 2RHBA 3MCAA 4A2WA 1DO8A 1SZDA 3KVRA 1PZHA 4RDHA 3QXSA 2CV0A 5D5PA 5BMVA 1DIOB 1NDHA 4Z4EA 2CXPA 1E1KA 1ZCFA 4PLCA 4V24A 4DLSA 4R6XA 1AA6A 4DA4A 1E3LA 1FRFS 1E2EA 5J4VA 2ZR8A 4DIBA 5DMHA 1LDBA 1U3GA 3FTNA 4TV8B 2XQFA 3CCRI 1LPOA 3WQBA 3ELWA 1E61A 2MMCA 4H59A 1C29B 4UULA 5AYVA 3TTSA 5JCOC 5AW2A 1F7VA 3IELA 4U1RA 3EZFA 5HEKA 2WWRA 3CM0A 3MWEB 4HN9A 3PV0A 4L22A 4CH7A 4R51A 2DFNA 5EUBA 3UJNA 3AGPA 4XQCA 1WSAA 1TFRA 1XKXA 4HL6A 4BQAA 1N57A 1KC1A 1TGYA 5AM3A 2PLRA 2ZWOA 1ZJWA 2F8SA 1HPLA 1HYEA 5L3BA 4TQAA 1QYWA 3NLLA 1TZ2A 4RK5A 4XB1A 2P5TB 4WNAB 3U62A 5LXTF 4DT1A 4FFPA 1SGWA 5KREA 4UVEA 1MQAA 5K6AC 3NTUA 3UC9A 1OWLA 3AHCA 2GD6A 4P0TA 1IBLB 3C5EA 3LDAA 1T5DX 1BYUA 2LW7A 3VAZA 1Z4MA 1PJZA 2NS7A 4MO2A 2R2GA 1I01A 2WSSD 2XYGA 4PRKA 3SSAA 5E95A 1G6NA 1W48A 2WNSA 1PO7A 4HRIA 1DXQA 2J5KA 1ID1A 4QWWA 4RK0A 2ZAMA 1RXWA 2IPLA 2ZVQX 3LBHA 4I50B 2RE8A 4DLPA 5D6NA 1XVUA 1Z08A 2RGYA 4JV5B 4HA8A 1TJ5A 1XTBA 4MW7A 4TMVA 4P1WA 2Q6OA 3WK9A 1E1DA 4I5EA 5HKKA 2VJPA 4BNCA 1E3WB 1AV7A 2BDUA 3K5HA 4N65A 4PSAA 3CS3A 2ID9A 3ZQLA 3UWKA 4H7IA 3CCQI 2CXSA 4FE3A 2O59A 4OXXA 1RYYA 3S7TA 2ID6A 1Z1DA 1KJ9A 2O1EA 3GCZA 4PS1A 1KI6B 5A6SA 1M7HA 4OQNA 2QJRA 4BFWA 1V48A 2VBFA 1P5RA 4ESHA 5FD5A 1I6HJ 5L8VA 1AQLA 3LY5A 1NPTO 2O20A 2H52A 3O4FA 1QRTA 1N5MA 5T4EA 5TMDA 3HSRA 1IG3A 1SMKA 3BGWA 2B1JA 3JTMA 3NV9A 4X20A 3X1XA 4QIWN 2WOOA 3GFJA 3AHEA 3K9GA 3WO0A 3S1AA 1WEHA 5HLHA 2CUJA 1CR0A 1P74A 2W6QA 1O5IA 2YJ6A 1YRQA 1GLNA 1NVVR 2VDWA 4CUKA 4ER3A 4E4TA 1FIUA 2HO5A 1PWZA 5DF1A 2MLGA 1NDUA 3IPAA 4HX9A 4YRDA 5F7XA 5C5DA 2ZJZA 3DEAA 1C50A 3H9QA 3T7RA 1XTJA 5LZ5A 1B8UA 2O7OA 2WV7A 1PBTA 3L0BA 3ON5A 3T61A 1S3GA 1SA0A 4DLRA 1CEXA 2Q6KA 3OZDA 1JQ3A 1TW2A 2JI7A 2YX1A 3FI0A 4Y6LA 2C82A 4BE4A 4ZMRA 1SD7A 2Q2EB 4PWZA 4L9JA 2BHRA 3HVUA 5E3MA 1UMQA 4F46A 4P4SB 1PYGA 2EG9A 3EXFB 3KHSA 3SMVA 1GG8A 4GRIA 2WQ6A 3DR5A 3U3DA 4L0CA 5I47A 4DC0A 1ARZA 2EP8A 3GDOA 3MWLA 3N6XA 4IV0A 2EFGA 4QEKA 4G8BA 5I5EA 3PF9A 2SKEA 1K4KA 4IFTA 4TZKA 1LNWA 1KQPA 1AQYA 4OQXA 2ZIFA 3BQYA 3E03A 2P3QA 3RARA 3ZY6A 4YCJA 5HQ3A 3GZNA 1ZLYA 4AYTA 1XBTA 4L6CA 3IAS2 3ML6A 4CE6A 2J3DA 5C80A 1JHFA 2WT4A 3QLTA 5J1YA 3NNDA 3G1UA 4IM7A 3C5WP 1FYEA 1NW7A 3BH0A 4I55A 3DFIA 5ES3A 5KDLA 1YJNI 4MI9A 1L5VA 1I6WA 3E6AA 3FUVA 5EZYB 5LA6A 4MR7B 5HTOA 1EUZA 3G1OA 1AU9A 2QPLA 3PVZA 4PHHA 1JE0A 5AJUA 2DMUA 4B45A 4US2R 1FRQA 3KL4A 1ZTRA 1OV6A 1D6JA 3P2YA 1BX1A 5THKA 4FS3A 2AFIE 3B6JA 3K2IA 4Q1EA 1WU8A 4HDMA 3WYGA 1B6SA 4EUKA 2VAVA 3JQDA 2QUJA 3DT6A 2BZGA 5C8XA 4YLGA 1F51E 1XRJA 1GITA 1I33A 1FNDA 2IIBA 1EYZA 4XH9B 3I4LA 4N6GA 3TNYA 2IUYA 4KV9A 4UEOA 2XPCA 1IZ7A 5ALJA 4C0JA 3BCAA 1BZYA 1LUAA 3L7LA 4IIVA 4KU4A 4P92A 4P4UA 3RSSA 1M2KA 3FSJX 3R5HA 3VPXA 3T5MA 1GRQA 4P9FA 2Q1SA 3H0CA 3TS1A 2BHLA 3GFSA 3G2OA 4FB4A 4L3WA 3GMDA 2AFHA 1DINA 3P9QA 1PW7A 2HCJB 2CLKB 5L9AA 4XVRA 1LFPA 1MJAA 1STZA 4BE2A 1ZD2P 4IWXA 4CM8B 4E13A 4EEKA 1O96A 3G2LA 3QVOA 4FQ5A 6AT1A 5LVAA 4TYWA 2P6TA 4A0ZA 2ZB8A 4N5NA 4U7HA 5A9TA 4DZZA 5AUQA 4IDDA 1MJGM 5E1OA 4AYBN 3ZQQA 2Y68A 2YMLA 2ZIEA 3KIPA 1PZFA 4DNFA 3BCBA 1UFKA 2MYTA 3DFMA 3ZJYA 4CEJB 2JGEA 3CYFA 2R85A 3OS2A 5LWQA 4IY1A 3I12A 1FB5A 2VJOA 4FGJA 3PHIA 3S1NJ 2FGJA 2ZGVA 1G3UA 1VIDA 2FQQA 2G9RA 2QENA 3S29A 1YKSA 1RU3A 3G2MA 5C4JJ 4CV2A 1P1HA 3HP4A 2FFBA 3Q8XB 5CJ9A 1B0ZA 1EVEA 3GPBA 3KSMA 3T35A 2O8CB 2JHPA 3BIFA 3ZIDA 621PA 2F5FA 5JFGA 1LX6A 2ZZKA 2WAEA 1MW9X 4ZC1A 1FOXA 2IVFA 3KBOA 2VXDA 5ICCA 3RIYA 4EFNA 1MR3F 3FJOA 2NP7A 5BV2P 4X6AJ 2H17A 3LZCA 2YXLA 3B7WA 2IQ5A 3WAGA 2VRNA 1DXYA 1PG0A 4LJ8A 5EP4A 1EP9A 3KLPX 5FXMA 4ETNA 4XGQA 2CHQA 2J3QA 1OB2A 1R4NB 1KDTA 1Y4AE 1SG9A 4K2EA 4M1MA 4MVJA 2R8EA 2GCOB 1FBQA 1C4OA 1VXRA 1J9GA 1IRZA 1WD7A 3ID6C 4FGWA 5DP1A 1U1CA 5COAA 3H92A 4WKOA 2CL6X 3ZS9A 2B63J 4CNQA 1IULA 1H8HD 4IEFB 3QEBZ 4HTFA 1K79A 1I7QB 4JBAA 3TLAA 2HIMA 1KJNA 3OP1A 4UMDA 2RCNA 1FS4A 3ISVA 2IITA 2IEKA 3BCSA 4OQLA 1PLKA 2FWRA 3RVSA 1CLUA 1QG0A 3KQVA 1GU7A 2GUWA 3S70A 1UM9A 3EGWA 3R2JA 3QQ5A 4LSMA 4UM9D 1LI4A 2CQNA 1Y3DE 3T0GA 5B6JA 3K71B 1FFEA 2AS0A 2WJWA 5COBA 3H3UA 4W9NC 5BSGA 5D5UB 3TD6A 2I6GA 4CG3A 4TVSA 1XMQB 2GA2A 1ZA1A 3QW2A 3R9XA 4RTKA 4OKIA 2PZKA 4F55A 3RABA 2B36A 3BK1A 3PHLA 3G7NA 4CV3A 4QRIA 1V6SA 2Z08A 5K2MA 1Z75A 4X24A 4ARVA 5KUTA 2RNJA 3K8YA 4Y6PA 2Y31A 1IBCA 5JH7F 1Y4DE 4P36A 4Q1VA 3TKLA 2NO1A 4D97A 3LMMA 4LYJA 1MB4A 3E9ZA 3SGLA 2IE0A 4I2NA 4IX7A 1FDVA 2Q2QA 4L5EA 4PYLA 1USIA 5L3CA 1RJWA 3COVA 3VR5D 1HDEA 4BO3A 1D1QA 2J5BA 2Q8NA 5JSFA 5BR1A 2LMDA 2Z0MA 3JQFA 3NWTA 1SCNE 2DUMA 4A26A 2JC3A 4JB8A 4ZXPA 5I48A 2PQMA 4I09A 1DJMA 1T5BA 2IDMA 4GAEA 4NU6A 3ONFA 3HB1A 2HQ5A 4B79A 2AQEA 3HKCB 3LVFO 3O7WA 1BE8A 4LRQA 2JGKA 5I4BA 4EZEA 2ZYWX 1FUEA 1P0IA 3FFTA 5WRFA 2AG8A 1UFMA 1O8CA 2ZBFA 1YMUA 4A6EA 1CDEA 4B4OA 4ZOQI 1Q0SA 2QN2A 3DCFA 4KIFA 5FLYA 8GPBA 4KTVE 1QIKA 1JHZA 4MYUA 2FDCA 4A23A 1N3BA