4BQNA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
SMAQRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqnA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqnA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
3NV7A 3PCXA 2FE3A 2ZKZA 2PR2A 2NYXA 4ZQCB 1QBGA 1NNSA 1U8CB 2UZAA 5CW1A 4COKA 2D1QA 1K7EB 4I0WB 2P7CB 1FRFS 1JU9A 2JHAA 3BOQA 2Q6IA 1LTQA 3CUUA 3OVMA 4G8CA 4PSAA 3TMKA 3QYPA 2PS1A 2QTVA 5I7EA 4S0HB 3K1PA 1V1RA 3ENNA 2BE9A 2J9FB 5JZ9A 3BAZA 5DGXA 5KIAA 3I01A 3DZGA 1X1CA 2PXAA 3V6MA 4BBJA 3ZXYA 2M32A 2NQ2C 3VBEA 2MU1A 2CK3A 2ZTLA 2FX3A 4ZQEA 1E1QD 4B6QA 2PX5A 2V58A 3AJRA 1LPBB 1VMAA 3IUQA 3NTUA 1VBFA 3UC5A 1ZUNB 1GFIA 4GM1A 2V3CC 3KJIA 2QQ8A 2JIMA 3S8MA 2Q9AA 2KZVA 2CNNA 4P4TA 1RXCA 1IRGA 1HE1C 2BTQB 1YUMA 3GTQJ 3LSHA 2F8LA 4LOJA 3ZXIA 1Z6AA 2VYND 4KFRA 2CNWD 4XGRA 3WY9A 3BXZA 3CLQA 3SKXA 3TQTA 5C8YB 5K09A 4II3A 3FJYA 4K9MA 2NSYA 2OPHA 2K40A 1TZ2A 3LSRA 2K4JA 3CONA 3RYRA 3DV0A 5A9SB 2GBFA 2FOWA 2CNOA 5L9AA 2BFFB 1MT0A 1WB6A 1USGA 2ENWA 2CB0A 2XMBA 3D7KA 1TYCA 3MA0A 4MGZR 4MTCA 4N82A 3PIDA 1LS6A 1XMQB 3DKWA 4TWIA 1SG9A 2Z9CA 3D02A 4H1WA 3HTXA 3A25A 4MRSA 3M9LA 1C7IA 5TQVA 1UQRA 1UBTS 2AOVA 2AFRA 4KXLA 1WOMA 5JVTA 1A36A 1KYTA 4PRYA 4FQ8A 3WL8A 4C05A 2V74B 1HXHA 1Q0ZA 1WB5A 2HHLA 4V2FA 2OORC 3B3FA 4HO1X 4J1SA 2XQKA 1M66A 4TTQA 5EYPB 5BURA 1R8YA 4IVRA 1JDSA 1TT0A 4NCJA 1X7XA 4CR6A 1SCBA 4KNYA 1Q91A 5EWMB 3U81A 5HP4A 1C7EA 4RA6A 3L6RA 2B8EA 4FFOA 4J1TC 1G8PA 3HJCA 4UCFA 4XCQA 4DJAA 1GT6A 4B34A 4CM8B 1ZVVA 1Z1DA 3FXMA 1P2UA 2XWQA 2YVUA 1P61B 1HPLA 2H11A 1QB8A 3BF8A 5EUCA 4AZ3A 1E2DA 1MHPA 3EYIA 4QTRA 1XJQA 3HCAA 3MSCA 4HXYA 3RIMA 1GPAA 2FPGA 2BMDA 1XZNA 1QOQB 3IESA 4PQYA 4RDHA 4U6QA 1PYOA 4OLHA 3D5LA 3RPUA 5FAXA 5B57C 2ZSAA 4CDGA 3GN1A 3EZNA 3ZVMA 4PG8A 1O08A 3K4HA 1L3BA 1H3NA 1V37A 2WBMA 1OLXA 4W4TA 4BIMA 4XPIA 3GO4A 4G9YA 8AT1A 1FK8A 5KTSA 2FLWA 5DN6D 4P0QB 4MKHA 3BZ6A 4L5EA 3A70A 3O2PE 5AUOB 5B3SH 2BFEA 4HAMA 4MVCA 1A9XB 1YUNA 2FRHA 2XH8A 3JATA 3PBKA 2V4MA 2XSZA 3BG9A 1I3NA 2ZUWA 1P2VA 1NPTO 2PRZA 4WNCA 1Q15A 3P7MA 5JXHA 1L5HB 2FPGB 1RQXA 3DTVD 3G2HA 3HEBA 1TC2A 2VPLA 2DHDA 3E2PA 1K4KA 3BTSA 5BOXA 3N87A 3HL0A 4P5EA 4R9RA 5B7NA 3WKCA 3GRKA 1I2MA 2FHPA 5HIMA 1T0UA 1L5RA 3BXXA 3IQIX 3OQPA 2GB4A 4G4SP 2OMKA 3QWFA 4HF7A 3BXFA 2IY7A 3L7WA 4RXTA 4YHBA 5ALGA 4G9EA 2IH2A 5AKZA 2IYXA 4NFSA 3ND9A 2GAFA 3X1YA 4HQ0A 2G9QA 2FPMA 3TRJA 1BEZA 1QNFA 4BJ1A 1OYVA 2ORED 4WOJA 1T1SA 2FEAA 3QF7A 4GSYA 5DNVA 2I5UA 3H1CA 4M71A 1MUUA 1T3HA 3N8GA 4J2OA 4JBAA 4LVCA 4NOJA 1NYLA 1P0FA 3AWDA 3WJAA 1NE2A 1XDUA 2HBRA 2ZS9A 1FXUA 3AVOA 3TRDA 1PQPA 1JV2B 1V8DA 2AMVA 2FFAA 4MNUA 1NFFA 2OXCA 2ZJ0A 4EVIA 2E3JA 1EWTA 2ZW9A 1WMAA 2RGNA 1UHSA 4AVYA 3RVOA 4C4TA 1HKTA 2J3KA 1O0SA 3HU3A 5AQ1A 4IIVA 3E03A 3KHKA 1E8MA 1KO4A 1JAZA 3NH6A 3I6MA 3WS7A 2BYTA 3GEGA 2ZJ4A 3WMRA 4BB0A 1NJFA 2XCUA 3EAGA 2NXWA 4IDGA 2QEQA 4BC1A 4L9RA 1A9OA 4YXWD 1PK8A 5AVWA 1NVBA 4ETIA 3D5QA 3L6UA 3UK2A 2CFSA 4W5OA 1ZBQA 4KUHA 2IUYA 4KQHA 1TZCA 5MN5A 1HQKA 3COPA 3ZDYB 4TQ9A 4KN5A 5G1OA 4ZTFA 3NM6B 2PAAA 2IA2A 4O3FA 1CQWA 5KEIA 2V3VA 2OOSA 2VDPB 1BXRA 1L7NA 4IRGA 3PDIB 2K9SA 4C0XA 3IQXA 1YS4A 5KQSA 1H2HA 1P92A 1YB6A 2AH5A 2IHJA 3KALA 3TB4A 1A8SA 5AM4A 5C5EA 3NNNA 1D0SA 3BTCA 3USES 1C0LA 3K2IA 3KT3A 1QRYA 4KN9S 3DMFA 3P5JA 1A9ZA 1YRAA 4DT1B 4XWTA 4UUSA 3D6FA 3IBYA 4ZT4A 1H0SA 1PTJC 3AI1A 5CNMA 2IZZA 2WT8A 1N34B 2II6A 2Q41A 1GTZA 1RWQA 1UBOS 3M5DA 4X41A 1NY6A 1COZA 1IG3A 2JJYA 3MIZA 3LZ6A 2Y68A 4QIWN 2DY0A 3FVTA 3MLEA 2RK3A 3TEMA 4EHAA 3UJ3X 1Z18A 4M53A 1ZC3A 1ML3A 2GZDA 2X3UA 2QVLA 2QSGX 3GA0A 1E1KA 2AJCA 4LGWA 3KJEA 4P80A 3EODA 4RPKA 3IWZA 1J06A 2HUPA 3ILHA 1XD9A 2IW5A 5DOZA 3LO8A 1JGGA 3B6AA 3RIXA 1QRSA 3F5DA 4X9XA 3AEKA 3LT1A 5D01A 5JMWA 1ZGGA 3T5GA 2WWYA 3P2OA 2ADOA 2H6CA 2C3YA 3C6YA 4YEJA 4BP8A 5L3QB 2XUJA 1G3YA 2Z16A 2C4HA 1QM5A 1NVVQ 2QLJA 1HOMA 4I7HA 2XKOA 4MQ6A 1A04A 1XGSA 1FP6A 1Q0LA 4WXPA 3LJKA 1SOAA 2FXVA 4KOAA 5ALIA 1R0ZA 3JWEA 3MUOA 3Q9NA 3VR5D 3I4PA 4DCJA 3EMKA 3ZJ5A 5D6EA 2V1XA 1UMKA 1B8IA 1CK4A 3IPRA 3C3XA 1ONOA 2AKYA 2B8TA 3A27A 5FO0A 2C29D 3FLEA 4D8WA 2I4IA 2LKDA 1MBKA 3UWPA 2ZRGA 1Y34E 4NCHA 5F33A 3TZ6A 3QZUA 3PGVA 4JUCA 3EA5A 1L7RA 4ARZB 3TFOA 1G1AA 4YRLA 4ZVMA 5HA5A 1I2DA 3GCGA 5DM1A 4IDAA 4PHHA 5EQJB 3DKYA 4ENRA 4PONA 4O4LF 1EVLA 1NKSA 3NNSA 1BCRB 1SU4A 3G9TA 3SHWA 3AH8A 1E18A 1U3VA 4HCJA 3S2HJ 1DRUA 4HQ6A 2XVAA 2Y2ZA 3D0OA 2OAGA 1I7PA 5BQOA 2F3PA 1YQAA 4LOKA 5IJ0B 1M6VA 2R60A 3GJ0A 3PA8A 4M9UA 3KQUA 4TZ6A 1O6CA 3HUFA 3HRMA 1SIUA 1XWFA 1D5YA 2QRVB 2ZTUA 4RGVA 2GEDA 1HBXG 3UB2A 4N9WA 2NO7A 4PPQA 4YCLA 1WTCA 1WPKA 1BSVA 2A0WA 3NUGA 5AK5A 1F20A 4LHYA 3JR7A 3KYCA 1U8RA 1L4NA 1CY8A 1XKLA 4KQCA 4BLQA 3UT0A 4R8SA 2BBOA 1PHRA 3AHDA 4F2WA 2H06A 3Q8LA 1QP4A 4RBNA 2LNBA 5KNDD 1D9XA 3CCEI 1WPRA 4KDFA 4KPYA 5CLJA 4F93B 4HEA6 3T5CA 3BL5A 2JJ2A 4IHQA 1ZFNA 1FQWA 3A6DA 2XLBA 4ZREA 2YMMA 2ZUVA 5DF1A 3SX0A 1JJAA 4C0KA 1LNZA 2BSXA 4L74A 5JS7A 1PNVA 4FR5A 4WCFC 2PZEA 5K8LA 4CLOB 1H8AC 1SPBS 2HHJA 2LC2A 1R74A 1TO2E 2B7CA 2E4UA 5DHRA 3U9LA 3W5VA 5KB3A 3CO5A 1U4NA 4CG3A 4PX3A 3KQKA 3GT4A 3OWTA 3JYQA 3HVRA 4CN8A 3RSHA 4KMSA 3AZQA 2RQPA 1UMCA 4LY0A 2MGQA 3VH2A 4EUFA 10MHA 2XHKA 4CEJB 5EMHA 1GAJA 2CNBA 3EDOA 4G81A 2RG7A 1EUYA 2HX1A 3TH5A 4P9FA 1P33A 1XQXA 1GJRA 1TM2A 1T8WA 2FW9A 3LK6A 2YX4A 5JYDA 3DCJA 3CRZA 1XT6A 2I7VA 2DYKA 2I4NA 4PGMA 1DTWA 1QYXA 4C2AA 1YW7A 3BIFA 1CIVA 4X7RA 3ANXA 5T3YA 3R09A 4EGCB 1HDGO 2ZIFA 3CJRA 3ICVA 4I1RA 2WHEA 4Y1EA 2OXIA 4XWKA 1JQKA 2UYHA 4PLYA 4UUSB 4EJMA 3S15J 4FDUA 1QZUA 4RY2A 2VYVA 3QY9A 1ZXXA 3S32A 5LDGA 3M6UA 4JIGA 1ULZA 2DHCA 1UBSB 1C1HA 3CVXA 3E4DA 2EWMA 3FHNA 1NBEA 2QPAA 4HDRB 2R7MA 4KKXB 4RM2A 4V3CA 2C2YA 1QP7A 1KJ8A 3ZCVA 1NRWA 3L43A 4ZEOA 3G6EI 1R0SA 5BSWA 4RB1A 3BFKA 1FP4B 3I9FA 4M76B 3KCCA 1H89C 1G7SA 3S68A 3TAHA 4EEKA 4TZ0A 2O54A 4NARA 2QSYA 4D1YA 3KFWX 4KIWA 2MINA 2UVDA 4ALMA 3F6CA 2V65A 4AJLA 1FP4A 1P3JA 4K28A 2BGWA 5EP1A 1UT8A 5TMEA 1L1QA 1Z7UA 1ZRSA 3DU6A 4BMSA 2WOJA 2IDZA 3S55A 2B99A 1LVHA 1FP1D 1OCRH 2DODA 4ILKA 4URWR 4YRCA 2OZUA 3FHCB 1UBKS 4RZXA 3SSNA 1KJ9A 4DQUA 2GZRA 4PAGA 4F6RA 5KCZA 2K4BA 5HPYB 2BDTA 4LDAA 1ZMTA 4MOWA 2YJ4A 4HKTA 1NVUQ 1UDXA 1U7HA 5T64A 2PJDA 2DXIA 4EI2A 1JEEA 1KKUA 5CYFA 5CVIA 3H04A 4PGAA 3WLKX 4LMYA 3TLGB 4HYYA 1UJNA 4MA0A 4BWYA 1MB2A 4XRRA 4BHTA 4Z2AA 1W4MA 4QUIA 4G12A 4IQJA 2WIBA 5T4EA 1TQMA 4YRFA 3WXMA 2GPTA 2IUFA 4RBOA 1OLSB 3M2TA 1K92A 3IAAA 2F62A 1XKTA 4RJKA 2ZCUA 1DP4A 3JAMK 3ELDA 1W0UA 1SKBA 3VR4H 1L0OC 1AMOA 5IG2A 5KQPA 3BYZA 4ESBA 1P2SA 3FH0A 1QLJA 4XRFA 3LAJA 3K4JA 2I6XA 1VJGA 2HQNA 2X2FA 4IV5A 2VWQA 4K3VA 4KZPA 3ZX5A 2OCIA 4Z7OB 3D2CA 2H07A 4MUIA 1KK1A 2HBZA 3V1MA 4B33A 2A1TR 5AVQA 3DYIA 1WJAA 1MD0A 2IZ7A 1SBNE 2MSNA 2WQZA 2ZJOA 4ND4A 3I58A 2XPUA 3RZDJ 4I5IA 1ICIA 2LGJA 4WEQA 1PJQA 1UBRS 2ODNA 4MW9A 5BSHA 4PR0A 1IHUA 1ZONA 2WU0A 1WV1A 3DVAB 3ZR8X 3QX8A 2VHCA 4UAJA 3VO8A 1AUQA 4D26A 3RIYA 2ADUA 4BNFA 3VNVA 3PDCA 4K0RA 2DMUA 2XMSA 3S2UA 1U0FA 2F3RA 1BS2A 2JK1A 1ZICA 3LF2A 4MGEA 4CODB 2Z6QA 1JYEA 3E8XA 3GK3A 4P6VF 3ZWXA 2NS0A 1ZUD1 2VP9A 3ZYCA 3DTVA 4OGWA 1Q1HA 3HGTA 2XKKA 2Q5EA 2WIAA 2Y67A 4EJFA 4LSWA 2DY1A 5IRCD 3Q1KA 5D4RA 1JGTA 2JFVA 3L0PA 2BZSA 5EVCA 3OCZA 3SJMA 3RNOA 1TA4A 2RMKA 4R05A 5B37A 5M3BA 3L8MA 5EWMA 1P4SA 4MJ3A 2JH8A 1W96A 3C2BA 1OZFA 2FSIA 5K3BA 3BCBA 3K9HA 4MWSA 4CVNA 1X9GA 2I6TA 4K8OA 4MARA 5HOEA 2GKSA 2VHUA 3ZY5A 1JLMA 2RI0A 3A3OA 2O2YA 4IVPA 1Z33A 3M1CA 4ECEA 4UAUA 5FULA 3UG7A 1KA9H 3FDJA 1M2HA 5LYJA 3GROA 3LUGA 4C7MA 3ANSA 2Z09A 1W59A 4X24A 3TMYA 3GMSA 1CY0A 3B52X 1GNSA 1II9A 2DYSH 3MCWA 5BWBA 5HOQA 5GMOA 5JATA 2IVZA 3B1JA 4HS4A 1CHNA 4FLEA 2HEOA 4F45A 1NHWA 2QV0A 3GW8A 5DM60 5I9NA 1YIJI 1M2FA 1JLLA 1AKMA 2R5YB 1LPNA 3QU2A 3BTUA 4NBWA 5CQEA 3QIVA 4OXNA 5C8YA 5CDYA 3LIPA 5I4BA 3NIBA 4TROA 2NVWA 5CNKA 1JN0A 2C7BA 2Y76A 4Q05A 4QOEA 1SOMA 1FYWA 3BQNB 3D3KA 3KLMX 3NC1C 1SUCA 1QNLA 1QQBA 5FWYA 4JT4A 4L0QA 1B6AA 1TZBA 3GUZA 3BL6A 5AR1A 4AUEA 1LLCA 3BQMB 5C7YA 1KJWA 2FZ4A 2DT6A 4UNNA 5KBYA 4G6TB 1TDJA 1M2OB 3DWIA 2J9GA 4DT1A 1DCFA 4DV3B 2Q1YA 2B4KA 1QFJA 3SLGA 2MW8A 1YFKA 3OSFA 1ZNZA 1Z12A 2X4GA 5HNFA 3NFRA 4XKVA 2PGNA 3K9GA 1NN1A 3ZW7A 1EBUA 5KYWA 3GLIA 1CE8B 4EABA 3U21A 1K9VF 3AETA 2AXTC 3NBQA 4QUHA 3U56A 2W6CX 1QGUA 3SX2A 4FETA 5DD4A 2GASA 3DPSA 4FB5A 5HZMA 5ECDA 1DWUA 4F4DA 3CVYA 3O6BB 3CNHA 5AKLA 4JI5B 3ZKWA 2PN6A 3TZKA 1ZH8A 5C4XJ 3AR4A 5D7BA 3LLMA 1N6LA 4H3SA 1R9JA 2XHEA 3UXHA 5JQWA 2W2TA 4LKRA 4P36A 3U39A 4N48A 3PIIA 1HG1A 2K6GA 3CKYA 1NN5A 1JUDA 3ZOKA 3ACBA 1ZN2A 3HYNA 3I6BA 2HQSA 4AMBA 3GZNA 3FBTA 3V1KA 4CLDA 3U62A 1VG8A 2ZJ3A 3SDGA 3QPLA 3OZVA 3NG1A 4AZTA 1MP0A 2EZ9A 2Q6LA 1FDOA 2PO7A 2V54A 2FSUA 2QN7A 1E9RA 1WY5A 3EDRA 1E9BA 4IDBA 4LV6A 4RORA 3WYNA 1K7XB 2ZBVA 4YRJA 2XD4A 4IZIA 1RI4A 3ORRA 2D7CA 4MUJA 5CTJA 2RGNC 5EXPA 2OQVA 1JWLA 1OIXA 3KZIC 4GOJA 2GNAA 3RV4A 4FI3F 2ZSUA 3ENZA 2E4WA 3NVDA 4EYQA 3KHSA 1CZNA 3OIVA 1PVEA 1BE8A 2M7AA 1N3BA 1VL0A 3IQGX 2IY8A 2O7VA 1OBFO 2H4ZA 4XWWA 2R7DA 4Q7LA 2WVJA 3GZ5A 4PK4A 1VBKA 4A3JJ 2E7WA 5M2QA 3THOA 4ZDIA 3DUFB 1WCV1 4YT5A 3MG9A 2FN3A 3WK6A 1MEJA 2EFPA 1K98A 1ISFA 1M0SA 2NPFA 3SXUA 4URXR 4JI8B 4CT5A 4ENPA 1FMCA 3QAHA 2EBFX 1KETA 3D0SA 1GZ5A 4FHFA 1ZGHA 3ZU5A 4DNQA 1V8OA 3PSAA 4XXHA 5COAA 1OBOA 1I51A 4N1AA 1SKYE 1XVVA 4DSNA 2PUDA 2XKBA 1KC1A 1EUZA 2GXSA 2AJLI 2WD8A 4WCFA 1J24A 5EKXA 1PT5A 1M2VA 1CCWA 2IQIA 4FMPA 4K2EA 3DS8A 4A12A 2N0SA 4A92A 3U16A 4MRMA 1U5CA 1XF1A 4NG5A 5A1TA 1GPYA 4ZMRA 5AW0A 3MK31 3MS4A 1SXPA 1MJHA 1GZ6A 4N9HA 1SEUA 1ULAA 5EF6A 1INLA 1RWPA 2BMFA 1W5FA 4LE1A 4G7HF 1V7PC 3OP1A 4Q4LA 2JKYA 4Z49A 3HR7A 2SNIE 5D1HA 4KMFA 2CLMB 1ZZGA 5B58C 2I67A 3OOPA 3C16C 4TUYF 1G8HA 4NOKA 4BVKA 2NIPA 3TGPA 4R41A 5DYMA 3HNPA 3ZCQA 3SC6A 5LMUB 3EFHA 4XVCA 3PD0A 2MWMA 2KX7A 3HS3A 2IHKA 1HTWA 1MOPA 3DZDA 4DVJA 4RVDA 4DL9A 4C1BA 4AWXB 4G24A 4AJEA 3JVEA 4G0ZA 2NU6B 2ONJA 4CM8A 4L08A 1QZZA 2QRZA 4MVXA 4X1IA 2CCGA 1CF7B 4WFQA 1UK7A 5D84A 3HPRA 5G0SA 3HXMA 1Q21A 3IRVA 3OYBA 4EGSA 2K87A 3FSGD 3MERA 3RVKA 3VI3B 4K0KB 3IDFA 1X7XB 2IZ5A 4O2AB 4D9MA 1BC8C 1FRVA 1LX7A 2BRUA 5A5GA 1Z4OA 4WK6A 1Z2DA 3DE7X 1EFCA 3NHFA 5LQSA 4BY1J 1C2TA 4L4RA 1UM9B 3RVBA 5IF3A 1LDYA 4NPCA 1IDYA 2IYEA 3EBLA 3HVHA 2EB7A 3UJDA 4IQ4A 3M4XA 4HAWA 1ZEJA 2A0YA 1KRHA 1IJBA 5AVYA 3T1TA 1B8VA 1RKWA 3RO7A 3I9V6 2NAZA 1KBZA 2C9OA 4BMPB 4BE7B 1E9AA 1GUFA 2WJWA 3SYTA 1NULA 4M7RA 3GAFA 4DG5A 1YIAA 1YRYE 2QORA 1XZHA 1XA0A 1ZM9A 3P19A 2XVYA 4KQ2A 4U7PB 4AULA 4RENA 1N75A 3NNDA 4NMMA 3DV0B 4CM3A 3LQRA 1D04A 5D8LB 3NJ4A 4WASA 5KYXB 3VOSA 3PDJA 3W1VA 2R1TA 2FMYA 3WHLA 4BMZA 1XS9A 2EZUA 2BKAA 3GTKJ 2J48A 3PFIA 3JWGA 4N3NA 3WA7A 4DB2A 1G20B 2C59A 3U1BA 1UK8A 1TQHA 3B13B 4UPDA 2OAQ1 3CY6A 5FNVA 3W3ZB 3WK8A 4G1UC 5DRYA 3MIIA 4C6HA 3W2IA 4DBQA 1XG5A 1UMDA 3WMXA 3VSCA 4GMDA 1XFAA 4P0TA 4RPIA 4XSXF 4CR7A 2Z2SB 3J80K 1GNVA 2FRDA 1C80A 2PD6A 4KXWA 1K6OA 5HZKA 1UINA 2RH9B 3BCUA 4ZARA 5K3FA 1V1RB 1FX0A 5CVVA 1J1IA 1YVEI 1XNJA 1ZEMA 1TI7A 2L0XA 4N0DA 4MSUA 1J56A 2RB4A 1W7PA 1I7LA 2OJED 4YI3A 3ZWWA 4ZODA 4B0OA 5T8KC 4AYTA 1OR7A 1GYQA 2ICAA 4ZCRA 2VTKA 3MILA 1ZTRA 4UARA 4JC0A 2A92A 2W6QA 3A2KA 1WCIB 4ZYGA 4AP9A 4ECAA 4IXTA 2Y0EA 1W29A 1G38A 2V7TA 4N0PA 4RSRA 3CO0S 2OC4A 3LL4A 4DMMA 1SXJB 3K0AA 4WKOA 3FOCA 4IYRA 4MPDA 3WIOA 1PFQA 3RUFA 2ZDGA 4KMUX 5A7FA 4RD4A 1JEOA 2V8BA 3E9CA 3H1FA 4FYWA 4G1CA 2D2IA 3C5WP 4O08A 4QXQA 4RADA 4EJSA 3K9FC 4KIBA 4HATA 1XEAA 4N7RA 3OQHA 2JVIA 3H0DA 4RPJA 4B3TB 3GTJJ 1KQ8A 3C14C 1XTAA 5EHQA 2DWPA 3TEJA 2FETA 1X15A 1BDMA 1VI2A 4FGLA 3TLAA 1PT8A 3H2KA 4GZMA 2VNAA 1GCGA 1T6XA 1JJ6C 4H77A 4JNCA 3KSBC 4HAXA 4PXAA 4R6XA 3ZCPA 2C4WA 4OOIA 3HZZA 3HJRA 1U1FA 2ZKLA 3HB4X 4MKIA 4BJ6C 2WUFA 3HOZJ 4ID9A 3LNQA 4XTRA 5E4FA 3UXEA 2CW7A 2FEWB 3VTZA 3D1JA 2VBYA 5DNUA 4J16C 4RW0A 1G4AE 1RKVA 4O0MA 3HHGA 3KZXA 4RZ3A 3VMFA 4BO2A 4CHTA 2EJTA 3IC7A 1TCUA 5AW9A 1YE3A 2F3SA 3FCYA 3WGQA 2AFIA 3E9DA 5CDHA 3H3VK 1ARZA 1PR9A 1RIIA 3RHFA 4RVGA 1GPUA 2SCUB 5EIBD 2OFOA 1W9HA 8ADHA 3WBKA 2OWDA 5KDOA 4MCHA 4PRLA 5AHRA 4LZWA 1D8KA 4KVZA 5DMHA 1W36D 1E3WA 3B3GA 4EJWA 3FLAA 4A3IJ 1LDJA 3H1AA 4Q1AA 3CCMI 4R6WA 5J63A 2EBWA 2M6LA 1DBIA 1NE7A 3N6XA 5A6SA 4YRTA 5HG0A 4N0QA 4HLYA 2OCYC 4B4DA 4EKDA 3NXSA 1L4BA 3H35A 1VLZA 2CHEA 4NF2A 4OI1A 4I4TF 1EB8A 4U2EA 5BV0A 2ZYHA 4O1HA 4M1EA 3DHYA 1FMJA 3JD2A 4BUPA 2LXNA 2OXRA 3LBAA 4X8LA 1LD3A 4B4WA 2VP5A 4G8JA 3HM9A 4WF2A 2PGJA 3FFAA 3CDIA 3SFZA 3G3EA 4QE3A 4XDGA 1P2GA 4LIUA 4JCCA 5DIFA 2PZGA 3T3OA 3C3KA 4UEOA 2W6JD 1K78A 1YS7A 1KY5A 1W0JD 2WM2A 2JBAB 4HZUB 2QN1A 2XGGA 3DFFA 5LZ7A 1RSZA 4A0YA 1RJDA 1P9QC 2YYYA 1Q7BA 5F6FA 4C3UA 1UUFA 3MWMA 3LQYA 2R48A 1MZBA 2P30A 4XRSG 1RQRA 3C6MA 3NEYA 4K2HA 4A8JB 3T3MB 1EFLA 3LE8A 4OXRA 4HWTA 5CBPB 2AWNA 4JR2A 2IYQA 1DWQA 2X40A 2XUPA 3B7GA 2E2WA 3F7MA 4YN3A 1ORVA 4G85A 5H2FC 5IKOA 4D0NA 2ILTA 1U31A 1N6IA 5B7PA 3AVYA 1M2KA 5JFGA 5KVRA 3WHCA 1YVRA 1V5WA 1LVKA 2H1CA 3B3JA 3E4CA 3FYHA 4WZBE 2VDOB 1EESA 4A3MJ 4DQXA 2AZTA 2PH7A 3JAKA 1ETQA 4B2LA 2XB2A 1GAEO 1KI9A 2Y93A 2QPLA 1QCCA 2Y1CA 2Y4OA 3L00A 3FF4A 2IYRA 3QLJA 4LYFA 2XGMA 4V2UA 1DI0A 1DKRA 1H8HA 4MRVA 4U9UA 4G0XA 2YV2A 2KWIA 2B20A 2W71A 3G9QA 3OR1C 1GU1A 3NORA 3VYTB 5IUNC 5F98A 5JHGB 3PQ4A 3KU1A 1Z5WA 1YRNB 2E55A 5AI0A 3SS7X 5KNCA 1GTSA 3S17J 5CEFA 4ZAXA 2I62A 4KQKA 2XAJA 4CCJA 2DOKA 2G17A 2I76A 2J85A 3N0VA 4Q7JB 2X2OA 3TLJA 4BAZA 2ZLBA 4XVUA 5HTOA 3DOEA 3WGJA 3CC7I 4JOSA 2Z9DA 4E09A 1WNTA 4E13A 1IYZA 1QV7A 2DC1A 2GBPA 2JK0A 2EJCA 4LJYA 1QUEA 1O6ZA 1S96A 1XXHA 2NXJA 1NPDA 2WZDA 4IGFA 1EA3A 4JQFA 4LE2A 5AM0A 5TEWA 5GP1A 4PHTA 4EW3A 1U11A 1JWBB 3BR5A 2DWOA 4N7JA 1HOTA 4V2IA 2ZXWH 1RRJA 1EP3B 3LF1A 3WB0A 4A2QA 1BWQA 1NQVA 2DAPA 2KMLA 3AW8A 3PWSA 4KAJA 5E3JA 4N12A 2YOGA 3S2FA 1VSBA 2R5NA 4W7IA 2VNSA 2WTNA 4YAUA 1NATA 4MR8B 4QPQA 2Q6KA 2CC2A 3LXMA 1U7PA 3OTHA 3QRWA 3L9WA 4UKDA 3TOXA 4Q9JA 2IGOA 4OHRA 3LMMA 1HI9A 4EF4A 4Y15A 2ZJRF 4II2A 4EM0B 2HRQA 4DMGA 1FZQA 3FKQA 4MR7B 1SKQA 1J9ZA 3WB2A 4YDQA 2D8AA 2F2TA 3PNVA 2V6FA 4D0RA 2XLCA 5H59A 4CG0A 4RTOA 5E95A 2WAAA 5BSRA 3RK0A 5F9HA 2PRSA 4JEHA 1FNNA 2ZJYA 2HK9A 3RKUA 4RGQA 3S4YA 3T3GA 5JMTA 4RPGA 1ILWA 1H5NA 2HXIA 1XJCA 1JE8A 3BDAA 3SBEA 1CEQA 1CG6A 1Z25A 1P8AA 2OWEA 1ZRHA 2YRWA 3ZOZA 2O1WA 3Q0EA 1Q1ZA 4R9SA 4W6QA 3TAUA 4D42A 2WSLA 1APBA 4Z4QA 4QBKA 3PKIA 4RETA 3R0AA 3K8OE 2LY2A 3VX4A 5FKMA 2HK8A 1MH1A 1UBCA 1US8A 1LSSA 3ETHA 4CYCB 2I78A 3ZV5A 8ABPA 3HYIA 2A4MA 3OHPA 2HNHA 4ENVA 1YR2A 3U80A 5IKPA 4HNTA 2QRQA 1Q0RA 4LW8A 5KO2A 3NT2A 3K6SA 1ZGJA 1BH2A 1NASA 1YFLA 1NF3A 2Y9ZA 4YMWA 1BMFD 2PBZA 4FHDA 2C8VA 1C3OB 4KAAA 4RS4A 1EP9A 1FTSA 1XROA 2G77B 1Z4KA 2PWAA 2R6AA 3KEGA 1YQ9A 3JQ6A 4HMOA 3ZWYA 1KJQA 5TC4A 4PICA 2Q5HA 3KC2A 3SQMA 3CLUC 3OZGA 3L7AA 1I3QJ 4PBSA 1PZFA 3FCOA 3K0EA 4IKEA 2BBSA 3V8PA 4DHEA 3MOSA 1CT9A 2B36A 3NBFA 1MSFC 2PXHA 1JQEA 4R1SA 3IE1A 5KSOA 1SBHA 1FRQA 4BZWA 1R27A 3M3DA 2VDVE 2GHTA 3C1AA 2ZETA 2XF8A 3F3SA 1HQYE 3QELA 4PZCA 5TLSA 4I81A 4K1XA 4M55A 4CU5A 2XBUA 1E7MA 1HYGA 1T9HA 2IHYA 3DPIA 3T15A 2XCSB 4UOQA 1E7WA 2VK4A 2PMUA 4M54A 1G3MA 2RSLA 3IUMA 3K0LA 1FBSA 1CDZA 1YWGO 3KYDA 3WSWA 5HDNA 5DBHX 4BQRA 3V2IA 1RXVA 4AIIA 1TRHA 4LRSB 1CQPA 4B6RA 3GLHA 5GONB 4QSHA 1DIGA 1GPJA 4BB5A 2GXBA 4JP3A 1BWRA 1G3TA 3B6MA 4DXHA 2HF9A 1SUSA 2QYSA 4H7DA 4NK4A 4NVRA 4PHGA 2GN0A 4ZI2A 2PO5A 4DNFA 1GZ4A 3GBPA 4BCDA 2VPRA 4PFOA 1MABB 1V6SA 3D6HA 4NNPA 4RE6A 3DQPA 4HDSB 1F8XA 4F5ZA 3JRHA 4YRGA 3GHHA 1ZCBA 3HXKA 4YHHB 1XE3A 4BGVA 3A3PA 3COWA 2RC6A 4Q00A 5DM2A 2ZFWA 1MX9A 1CUXA 2BGCA 3H9QA 1GGHA 3W4IA 1M67A 3IX7A 1RI5A 2IU3A 1GZHB 3FMRA 3MMPA 3OO0A 2RHGB 3DE0X 5LUAA 1BXGA 2YMQA 3DUFA 3BJEA 4ZEMA 3K69A 4X6UA 3WBJA 2F7SA 3HFSA 3ZGZA 4DIEA 2PLYA 1H6BA 4LRXA 2XUBA 3TO9A 4RPCA 5ARDA 5E9QA 1KP2A 3FSGA 4JELA 3ZQ6A 5LQCA 1J00A 1LNWA 4PFSA 2FPPB 4P3KA 3WG7H 6GPBA 3IAS6 4XQCA 1RRVA 5A9TA 2OUIA 2PQMA 2WWXA 3CEMA 1OCOH 1FQKA 3ML1A 3QXXA 4IO0A 4TVBA 1LRKA 4B2PA 2JLWA 3TJMA 3WTVC 2NZJA 2HDWA 3PPXA 1XGOA 2OYCA 5AONA 1APLC 3JSOA 1KFKB 2BMAA 2O2GA 2VHJA 2WM3A 3EXFB 3UJNA 1Q3TA 1Y80A 2VFAA 1NX9A 2M30A 1GKUB 1BI2A 1RKTA 1H0RA 1O95D 5LMNB 5C4IA 3R5SA 5KC8A 3AERA 4URUR 2D2VA 1WP4A 3TW6A 4GYGA 1B43A 2ASVA 1HA8A 3PI6A 3DBRB 3MWDA 4HFJA 3ZG6A 3QU9A 4LS3A 3RUDA 4ANFA 1L0BA 2DKOA 2D0DA 3H5OA 1WU8A 3GYBA 3R3JA 1HYHA 2YINC 4FXOA 1Y1KE 4UHHA 1SHUX 2ERXA 1XDBA 5H1YA 4FMCB 1U3UA 1CUJA 2WWIA 4HVCA 2Z3ZA 1AHPA 5HCUA 3WOVA 3B6CA 3CLRC 1HDCA 3R9WA 4P96A 2PX4A 2QUHA 3OX2A 1KQGA 4FCYA 4DC9A 1D6SA 3N2KB 1KE2A 3MOIA 2HOQA 2PRIA 4CF6A 4TVSA 1UMQA 1ETXA 1CWUA 1PZEA 2BGUA 2HRRA 2OD9A 2QE6A 3GLIB 3AERB 1C50A 1XZPA 3QJ5A 1J8DA 4HQFA 4J16A 5BYKA 2EZKA 3AESA 2W90A 4QLOA 4YUVA 1T0FA 2FR8C 2KS6A 2B25A 3AXSA 3I9NA 2ZSEA 4ABTA 4E2WA 1FT9A 5CDSA 2Q1ZB 1CUYA 1NYRA 1ZU5A 4Z4CA 4FZ5A 1WD7A 2EDAA 4J7XA 3UKOA 2JI9A 3DR3A 4B2IA 4OLJA 1ZCFA 3ER8A 4ENUA 2I4LA 3SC2A 4NCAA 3HC7A 4NOLA 2V9CA 2XKJE 3D4OA 1JEYB 1SIBE 1S7GA 4XYEA 2VKHA 1UKZA 1HE2A 5HIIA 1FYDA 1JZTA 1DCMA 2HO4A 3L3BA 3HOSA 5AOAA 5FBWB 3SF8B 5L3SA 4F7WA 3LL7A 1GPH1 3EMDA 3K2EA 1NTRA 1WJ5A 1HDOA 3D6AA 2AI3A 4FT2A 2PLWA 1MXHA 1XEFA 2BOLA 2HUNA 4G23A 4MYSA 3ZE9A 3OOSA 3HU1A 3L8DA 2M1XA 4HC4A 2NW6A 2PD4A 4JVSB 4N6OA 3PNTA 1EZ4A 3G8AA 8GPBA 1BI1A 1G0NA 1TFRA 1V4BA 3A4YA 3WK4A 3SR3A 2A9PA 2H8WA 3PDWA 1U1EA 4M9SA 4N8DA 2D6FA 4NZYA 1H4QA 2GLXA 4B4CA 1VL1A 3BBPA 3ELUA 4E1AA 3GGJA 3SK0A 3P94A 4JUDX 1O4WA 2R65A 3RJMA 2VPYA 4N0MA 3TS1A 1J09A 1WF6A 3VNQA 4X3PA 5A4KA 3WRXC 4UTVA 3LS2A 3PXBA 1Y7PA 2J4CA 4FX5A 4WZBA 4V1CI 2DLDA 3H19A 4EI9A 2XDWA 3OQOA 5DNAA 2CXTA 1AD2A 4MCJA 3T9EA 1Q1NA 4XSVA 1DC6A 2OHOA 3ZJUA 1S72I 2H1OA 3A1UA 5CT8A 2QN9A 4D5CA 1R00A 1R0XA 2GO1A 3DOUA 4AZSA 4FE4A 2R1VA 3ZWKA 3T7TA 1ZOPA 1T9GR 2HOAA 2EWVA 3GLHB 5GONA 1L1FA 3EPZA 1GTVA 4OXKA 3TWOA 5BQXA 3KE9A 2CSOA 1T9ZA 1L5QA 1RR7A 2ZYGA 3PU6A 5IARA 1SKUA 3RARA 3LLVA 1E9FA 5HS7A 1YHZA 4KI7A 3SAJA 1WMEA 1HT2E 1FOYA 4WESB 5BUZA 2RH4A 3E6AA 2CQ7A 2HO5A 1L1EA 3MFYA 3FXRA 2XNDD 3TTSA 5A2QZ 1IHOA 3A14A 3IQWA 1AT1A 1SMYF 2ZMEB 3TOZA 1ZGAA 2PSSA 3OV8A 1R0BA 4C7JA 1LDMA 2IXFA 1F9AA 1OLUB 1NBME 4IX9A 2HXGA 3VI4B 4A3LJ 1HLDA 1W4BA 1G2QA 1WXEA 1KHTA 1SIWA 2C8JA 3IBTA 4G0OA 4WKPA 3UJHA 3DTNA 3DVAA 4Y0VA 3WMEA 4B3GA 2Y0PA 3C8ZA 5LB2A 4IIFA 6NULA 1BM9A 1HFEL 5FA8A 3ZGLA 1CF9A 4CFYA 4OJYA 4IEEA 4M0CA 4BNUA 1PS0A 4RJJA 3DAHA 2UYQA 2WILA 3UJ6A 5K4HA 4JUBA 1NIPA 2YFKA 2JLXA 1SD2A 2F2EA 1YK0A 2N9UA 4XA8A 3QUSA 2CE2X 2WP8J 5A1JA 3AEQA 3HDYA 4RAQA 5JMPA 2PV7A 1C9EA 5IAEA 3K6SB 1EQAA 2MSCB 2PL5A 4AYWA 2R5ZA 2HNKA 3DL2A 4N65A 1F4VA 2Q9BA 1Y5MA 1OLSA 3M70A 1AGXA 1VL6A 4NQWA 2JGIA 2ZT6A 4P1WA 4UQOA 4UHKA 1E1CA 3FETA 5DNCA 4I9UA 3T4PA 4OH7A 1FNDA 5KTRA 3P2YA 1J5EB 1IAWA 1HE5A 4BKOA 1MNQA 2XHZA 2QQAA 4QGHA 4TQGA 4D7NA 3I64A 1B4AA 1FTNA 1J7JA 2V26A 3T0YA 2OCKA 3LY7A 1U3FA 4HPJB 3L6BA 4NU6A 4PQRA 4QG7A 1UH5A 4M0MA 3WKDA 1VHDA 5DBFA 2CLIB 3CRRA 5I5EA 3Q0WA 2GN1A 3ESXA 3QHAA 4LDNA 1WI3A 3BG5A 1Q7TA 3S1RJ 4NR0A 4ZIRA 4MICA 3OZUA 4N03A 1FSEA 1V41E 3GDGA 3VMMA 3L0BA 3QRFF 4LHWA 4V0SA 4AXXA 4F6RB 1HKQA 2HJVA 2WUWE 1X9IA 2XA2A 4FK8A 4JJ8A 4BMCA 4YFKF 2EP5A 4MS1A 5CW2A 3TBKA 2ZREA 2W42A 3QPWA 4U5QA 3IQDB 4ZVSA 1VG0B 4FGJA 4ZDKA 2QB5A 1TKBA 3IOMA 4ZGBA 5IXSA 1H4SA 3LSYA 4KICA 1SQ5A 1TD1A 1YQQA 4CQMA 4TTVA 5BNTA 3CQZJ 2X86A 3N7UA 1XN1A 3G0BA 3OA0A 4FOSA 3SCZA 1I1SA 5BUSA 3WL7A 2O6LA 1C0WA 3CEAA 1W34A 3GELA 1TB4A 2RNJA 3JQEA 4TLMB 3ZV6A 1X74A 2M6SA 1FIPA 1SQ0A 1E4VA 3EFOB 4FT4A 5AKIA 3CCUI 2BONA 1O4XA 4HJXA 4LXHA 3B8HA 4BUCA 1KQFA 5DX0A 1YB7A 5DSTA 4LIVA 1CY6A 1GY8A 1OXMA 1ZNYA 2OGWA 3E5NA 4HFNA 4FHEA 2SICE 3SSOA 3PNOA 4PAWA 4UVHA 2B34A 3M9XA 4M0PA 2PBIA 3TDKA 2GJ9A 3HXOA 4C0AC 2XVMA 5K3OA 1NJ5A 3AL2A 3B85A 3ZZ1A 1NAHA 6AT1A 1UZLA 3DG9A 1EX6A 4FSXA 2YW2A 1OH8A 1Q1GA 2VWGA 4BZZA 4TKVA 1LJLA 2Z99A 1DUSA 4QDXA 4UTXA 5IVIA 4J01A 5KREA 5FROA 4TV7A 1VRVA 3EIXA 4EY3A 3ZDBA 2BGTA 2ONZA 4Q6WA 3ASOH 1XC7A 2GN4A 5H20A 2YVLA 3KXDA 3UJCA 3D81A 4OEHA 3UR3C 5A2QK 2AS5F 2BMJA 2FLVA 1C0KA 4D43A 3OYJA 2NSDA 4PV7A 3W3AD 3CB4A 1O4VA 4YAOA 5SYMA 3ZZ0A 2EF1A 3KEOA 2QU7A 4Z0HO 3NC0C 1E1YA 1FUKA 4HTFA 1FJHA 4UHEA 2GPWA 3WNCA 1QSGA 5DM7F 2YVKA 2JH3A 4A3EJ 1D1TA 3H42B 1NJ6A 5I7HA 1PV1A 4AU1A 2YKGA 1GUUA 3VNRA 3LFUA 1C2YA 3PQ3A 4YB8A 2J7KA 4NK5A 3LFHA 4BASA 5K6AC 3JZIA 3NANA 2PEXA 3D5SC 1NR7A 3S1SA 1CNFA 3DC7A 3KPYA 5B5EC 4TT8A 1B42A 3T7JA 5CG1A 2JBAA 4GWKA 1RWMA 3LCCA 3NGXA 1UAYA 4QTUB 4XJTA 3W5DA 3MKLA 1JG4A 2QRLA 4M2LA 5KWVA 1ZESA 1S7CA 2R11A 4H0EA 3B1KA 1UFMA 4RZQA 2JC3A 4DWVA 4X3CA 4ZK2A 3RPUD 5FT9A 2QOEA 1MRSA 1WDKA 4UMDA 1U3GA 1M7HA 4G8DA 3R7LA 4OOFA 2L5QA 1NV9A 1Q7RA 1NX6A 1QH0A 1QHHB 2VEDA 3AT1A 3AU8A 2J6IA 4E94A 4J4TA 5CB8A 1PGNA 3SZRA 3CP8A 5I9SA 2VHWA 3ZY3A 2CYCA 2OHHA 4BNVA 4XPZA 4X45A 3KKKA 5CJJA 5IFLA 2ECFA 3GNQA 2FAXA 1RXIA 1Y1TA 3FOEC 2FSPA 3AUJB 2RGUA 1QF7A 1R4AA 5FP0A 5B4VA 3ND8A 5AUNB 5EIEA 3GGDA 1WUKS 2XGCA 2CJXA 4S0XA 4FC7A 2O8EA 4DSAA 1G21A 4R2LA 4FI3C 4IDQA 5JY1A 4QGGA 1Z8HA 1G5HA 2WKRA 4KGVA 5DWVA 1TK3A 3TPFA 1RC8A 2LOOA 1P29A 2PSFA 3SQXA 4KO4S 3FKIJ 2VLBA 4M8LA 4A26A 1BGWA 1X1QA 2Q4EA 3OESA 5JTTA 3IRUA 2A9JA 4KRXA 3BRCA 4Y6QA 2O7RA 5CYOA 1V5EA 2AXNA 1L8XA 5T4HA 4AKTA 5U4XA 2B30A 4J07A 1VCOA 3CNNA 3E35A 2ZCWA 3NHJA 4PW0A 5G40A 1S8OA 2BUAA 3G2NA 2XMPA 3GVIA 5HKLA 2I2BA 3U7EB 3OMYA 2IEIA 1E9VA 1M1EB 1OASA 2Q9UA 1DOZA 5C46F 1IB0A 3FUVA 1L7XA 1BDBA 3L0DA 3OSGA 1Q44A 3QF4B 3S6JA 2VQHA 4BIIA 5CX1A 1YBMA 5CH5A 3NEPX 5EIAA 5F1PA 2IE8A 1FIUA 1Q1QA 1NT2A 3KAJA 3MN1A 1ZXLA 2FUEA 5DNDA 2HB6A 5AMXA 3IUNA 4M46A 1FY7A 1OFCX 1D7AA 2ACWA 5HUJA 4M88A 4FNGA 5C2JB 1XK6A 4R3NA 3UAZA 2J0UB 2Q4TA 4DZTA 1N57A 1GHTA 2QJOA 4URZR 2DFKB 1U81A 2CUKA 3QY0A 3K4KA 3RV3A 1LDBA 3ZPLA 4GYYA 4QXPA 1PL6A 4QEKA 4XL9A 2P4QA 3R41A 1ZLXA 1KVRA 1T4MA 4EQQA 1VQKI 1RPAA 1T5SA 2CWWA 2H18A 2HMUA 1N2OA 2J3IA 4QODA 1XWWA 3EQ2A 1K6YA 1FBTA 2R2GA 3ZBPA 5DRTA 3L1HA 2JA8J 4BVHA 2XVCA 4MA5A 3UZUA 5KOYA 3RK4A 4LZZA 1D2AA 5G3ZA 1T8TA 4NDNE 4HHEA 3VPDA 1JI8A 3SQNA 3BJZA 2VAPA 3S2ZA 4ZN6A 2XOXA 1W7PD 4DR1B 4ENJA 4HGNA 4B46A 4FZVA 4FTHA 2J3QA 4NQZA 3GNLA 2MMGA 2ZP1A 1E1QA 4IKOA 4X63A 3RFTA 4LHSA 5CKTA 4DLAA 5INTA 4DR2B 4AI6A 1B3RA 4UREA 4CCKA 1Q0QA 1BX1A 5TMDA 2P90A 3BEDA 2HYGD 1SVNA 1QUFA 2IV3A 4I01A 2C2XA 5CM2Z 1FXSA 1MJGM 4ZOLB 5JNWA 4DM3A 1AN0A 8LDHA 1ZHOA 4KFTA 1O9BA 4A3BJ 2ZTHA 3HYRA 3IO5A 3RYTC 3O47A 3PFNA 3THYA 4CZ2A 1GQYA 3KZNA 2JHPA 5ESRA 2C5HA 1XAJA 3R0QA 1LQ1A 4A16A 4WNIA 5ALEA 5DBIA 3E0XA 3HJGA 2DTEA 2OFFA 3L7NA 3FUCA 4WBXC 1YR9A 3ZV3A 3KPHA 4C87A 1CR0A 3ZDFA 3ZV4A 4IO9F 1V6CA 3Q0IA 2W70A 1A4IA 1OCCH 2VONA 1U1GA 3OZAA 4EB8A 4QG3A 4CL0A 4D8XA 2NRAC 4GYWA 1VQMI 3LPDA 2HMTA 4PFPA 2P9CA 3GMIA 3LHDA 4GKKB 3L18A 3RSCA 4A03A 3O0TA 5LA6F 5DD8A 2D4AA 5TJHA 4KDRA 1PDWA 3B38A 2XB9A 1T2VA 2B8NA 3CF0A 1G3QA 8MHTA 2OV8A 3KM0A 3N5KA 3WLJA 2V9KA 2OP0A 3JQFC 2XT9A 4N7MA 3W5CA 4YRSA 2JI6A 1YJ9I 3P9XA 4WZAB 4JI1B 1TU3A 1K08A 4OJNA 1PUJA 5D3MB 1YZKA 3H86A 4OYHA 4TV8B 4D9JA 1QPBA 4MS3A 3SP1A 4MMYB 3A1NA 3RAJA 2MYUA 3LZDA 1GPDG 5J5CA 2P5SA 4BU0A 2W2LA 1DRKA 1NVDA 5B1HA 5TGTA 1N2JA 1WW8A 2R6ZA 3GJTA 4F46A 4DOZA 4C4YA 1WDLA 4YJ2B 4BO6A 3SHFA 3Q8WA 4DBLC 4FJ1A 1KR5A 4R5MA 3A6EA 3OS1A 1QMPA 3TG2A 4O2BA 3UAXA 4NYJQ 3ZWDA 4DZZA 2HA6A 5JVDA 2ETVA 1U0JA 2W6NA 5JXIA 2WYUA 2BFBA 4DLNA 4FINA 4UW9A 5LKAA 2AJ8A 1BC5A 4MV0A 3ZEAA 5CLGA 2O7OA 1W0KD 1AGRA 3VU3A 4C89A 4RQBA 2M2EA 2QMQA 3EDYA 2CKDA 2BFNA 3OD5A 3SE7A 2NZYA 4BZPA 2O2CA 2ONYA 6Q21A 3HOVJ 4G01B 3J7ZI 4EKEA 3F97A 4L9TA 4HV5A 2G07A 2PX6A 4QUJA 1DAHA 4KO3S 5H3CA 4C21A 4BQOA 4FONA 1Y4ZA 4YJ2A 3K35A 1W0TA 4JU9A 5AHWA 4QPCA 3LQ1A 5P21A 2WSSA 4D5EA 2JJ2D 3ZTTA 1HKUA 3V42A 1W94A 1AF4A 1ZUIA 3DVRX 1ZIDA 4OHCA 2YJZA 4L8LA 4RKEA 2ZPUA 1CS0A 3LY8A 521PA 2YBEA 1RUNA 1JNXX 2VXCA 3DVQX 4HGRA 3SMVA 3WK9A 3CGGA 3HCRA 4AJOA 4DV7B 1I4WA 3I1IA 2HSJA 1DEAA 2Q8QA 1GUAA 2IEAA 5D51S 3UT5A 3BTLA 2WVGA 1YJ8A 4OIOF 4IJ5A 4CWAA 1IV8A 3GX1A 1POXA 7ADHA 3LY9A 3ZH2A 4QDJA 5EYPA 4JYMA 3QX3A 4C76A 5GADl 3LKDA 4OINF 3GV0A 3VPFA 5EYRA 1IK6A 2BY2A 2DA6A 2B3TA 2OYSA 3P5BA 1L5OA 4DLUA 4PYNA 5LLTA 5FKOA 4CPDA 1DV1A 2RJ3A 3JASB 2ORVA 1B3BA 5J2TB 5BWMA 1RACA 3PG5A 1RYFA 4Q5IA 5M34A 1PL8A 1K3TA 1VSUA 4FFPA 4J4BA 4K6OA 4U2KA 1AMUA 1OZAA 3DXJF 2E9SA 5JZBA 1E5XA 1OXUA 1V8PA 5JECA 2GD2A 3NZEA 5BSFA 1QX3A 2QVGA 3VKHA 2NVYJ 1LDEA 3Q5GA 3QMPA 3WK7A 3OYMA 2XGDA 2WLTA 2ZS8A 3JWIA 4DILA 4MP3A 3SU8A 1H5UA 3EIQA 4YP5A 3IMFA 2ZNYA 3DPUA 2RQQA 3Q12A 2ZJPF 4Y7CA 4A0HA 4YAGA 1AKTA 1R1UA 2VL8A 1Q19A 1P0CA 1N7HA 5BW8A 3CMAI 5LBUA 3HV0A 2HRBA 1Y8QB 4PUSA 2PFGA 1HSOA 3FPEA 3IVRA 4RA9A 5EKDA 1HYQA 4AUNA 4EY5A 1JSCA 4YV1A 2IF2A 5IBRA 4UASA 2HPZA 4NESA 3SOPA 3FBGA 4K6MA 4OAOA 4IG4A 1CY2A 5ISMA 2NVUA 4P3PA 3COJA 3NTXA 1SHLA 4ZAYA 2R79A 2FKAA 2CVOA 3M89A 1YRLA 5EUBA 1EFTA 1FEZA 3SHTA 3VZCA 1BMTA 3PR1A 1TQ6A 1R49A 1M2OA 2Q3LA 4YS6A 4BNGA 1WSBA 4DIKA 7YASA 3GVPA 3TXAA 2F9MA 1SZJG 1DOHA 1I14A 3CVJA 3B53X 1OJ7A 4EG0A 1A8HA 2J46A 5TMBA 2DVMA 2C6YA 2G6BA 3TXYA 3FGPA 1MB0A 4CBVA 2JD1A 1IMOA 1T5OA 3AFGA 1V1MA 1MDMA 2L2QA 3LXRA 2JGMA 3COSA 3LUKA 3NOXA 5GZ3A 5JYCA 4J75A 3MB5A 4CF3A 2PSDA 4KQMA 3SMQA 4DEVA 2IV7A 3H92A 3AUFA 4QOFA 3V32A 4XCXA 1F1ZA 5HQ3A 3MKYB 3TPCA 5EJ4A 3L7LA 4Y1RA 1Q3KA 4ED9A 3E6DA 4F97A 3NRJA 2BP7A 2Y0SA 3TLYA 3QYFA 4PSUA 2C7QA 2G7HA 4ZVUA 3DJYA 1ZYRF 2L2OA 4A5OA 2IVFA 2IFTA 1CQIB 2F1KA 2WB4A 4QWWA 1S3IA 5DHPA 5F1RA 3F8CA 3VOBA 4Y2PA 1RW4A 2NZUG 3VR5A 3AG4H 1H23A 3HKZA 2Z5UA 5DI3A 3ZDQA 4DLXA 3L1JA 4YJ2F 4RLSA 3GT0A 2P69A 4AS2A 3WL4A 4BLVA 3QEAZ 3LCMA 3AUUA 3OFSA 2EW8A 4DLZA 1OD6A 3T95A 3VR3D 2IDMA 3IURA 2YVQA 2IX3A 3RRYA 3MTBA 4UHDA 3CUTA 2CUFA 5EJ7A 3WV4A 2PJRA 2AD5A 3M8EA 3GTLJ 2O23A 3FWZA 3UAYA 2EGGA 3IDQA 3PUXA 4Y30A 1X87A 4QJIA 4UFPA 4JHXA 4FR0A 1ZN8A 2JZYA 3ZQQA 1WZNA 1R23A 1Z6XA 2QP9X 3FTCA 3OJLA 2K3PA 1U2GC 3LOPA 1JHDA 4X1KA 4PJMA 1N77A 4BY7J 2CXXA 2WUVA 2WY7Q 2OD5A 2X0LA 4Q34A 3CX6A 1X7WB 4Y2VA 5HE8A 2GA2A 4I5DA 5LFAA 4L0ZB 4U02A 3LUFA 3WLMA 1TM5E 2OM2A 2YNMA 3Q0TA 3VYWA 4LVUA 1N2CE 1T1JA 5J43A 1MRNA 3NHBA 4H17A 4JXKA 3SIPA 4B6JA 1VGRA 4HNVA 2A69F 1T0PA 4MW7A 1C3XA 1W47A 4Z8XA 2TSYB 2CHFA 3VVCA 2PBFA 4AJPA 4YY3B 4HYEA 1SCNE 3PPVA 2WF6A 2GZ1A 4J2TA 4WXMA 4BHCA 2HSZA 1AQUA 2VH2A 3BQYA 1A2QA 2Y99A 3H5VA 4OHVA 1JR3E 2VIXA 1TKRA 2XUAA 2Q1UA 3O8NA 3CZQA 4ILEA 2CS3A 4OQYA 2AVNA 4LJAA 3PNQA 4CIAA 3UMCA 4RTPA 2YU9J 1MTZA 1F60A 2BRUC 2IEDA 2PVPA 1P18A 3B1WA 3WLHA 5HX7A 3PJDA 2XD9A 4JEMA 2C78A 2J5KA 5GV7A 2OYRA 1CJTC 3IA7A 3EAQA 3CWQA 4KFSA 4OJMX 1KL7A 3VU8A 3BCHA 2A6HF 1HNNA 2AQ8A 2RB5A 4MW6A 4O59O 2ZXHA 3PXEA 4MINA 1P9OA 2Q0XA 1VECA 3GFOA 2FPKA 1AXEA 3DMRA 4IHSA 1WQ4A 4FFRA 1FLIA 2BXYA 2OSVA 4HLUA 2RHHA 5ED4A 5LZ8A 2IXAA 2Q0OA 1C30B 2X13A 2LCQA 3A05A 1YH3A 4BBPA 5AFSA 2YWHA 4OSOA 2GEJA 2OEPA 4OX9B 1W85A 5E6SA 2ZBEA 1N92A 4DCTA 1NLFA 2BBTA 4FD2A 3V9PA 4GRIA 5KTOA 3KVYA 3AHEA 3RC7A 4LQDA 1G2PA 1U2QA 3AI2A 5D3QA 4C5AA 5HM8A 4N9IA 3J80Z 4LWZA 1R6XA 4HNRA 3LBIA 5PNTA 2QAIA 3PC6A 3DXXA 2FN4A 4IIGA 4Z2YA 1IQRA 3BMOA 2ZTSA 3EK2A 3N8DA 3NQ41 3OLVA 4GPEA 4KLRA 3A2NA 3L82B 3QVXA 4GXOA 4XGKA 1Z4NA 1U6JA 5I8ZA 5EUMA 2HJGA 4K2AA 3IJRA 2OBBA 2OCGA 4NI5A 3WZ2A 3S2WA 4DQLA 4OQMA 2FP4B 1KU6A 3PHHA 2I29A 4DPLA 2HYDA 1R7RA 2ZDQA 3LW8A 3QVJA 2Z6UA 3GGOA 3PP8A 1FVXA 4KJXA 4NAHA 4NJMA 5JRZA 1X8JA 2QUIA 3IKJA 2N8GA 2HDCA 2KW5A 1ESMA 2P1ZA 3D7RA 2VDLB 3G2OA 4AIRA 1W6UA 1K5HA 5AVTA 1R7JA 2L02A 3HXLA 1QDLB 1NC1A 1TC1A 2W58A 4U7TB 4XLCA 3GFGA 2LF8A 5ANRB 3HJFA 3FPGA 5HBRA 3EC1A 3H8WA 4UU8A 4EF6A 3FWKA 2GFHA 1DO8A 1KDPA 2CKMA 2ZAMA 4PQEA 4R9VA 121PA 2ZVJA 5KHAA 2FN9A 1U6IA 2WD7B 1USUA 1CETA 3R60A 3WYGA 4M3NA 1K7YA 4GVXA 5E1MA 3A1WA 5D2CA 3EF0A 4CMAA 3ITEA 4RC9A 1RIFA 1VIYA 5TPWB 3LQ2A 4E07A 2P5UA 1JIIA 2QLMA 3JARB 4RK1A 3B6ZA 6REQB 4TTTS 4LQLA 3GUHA 5ULLA 1L8OA 5BW5A 2P62A 2EJRA 1CVLA 2L3DA 1T8PA 1X14A 5M5BA 2DT8A 3GARA 3NHMA 2HT1A 4R0NA 1RZUA 1MNDA 1XSEA 2P41A 3F6SA 4OQZA 1BJTA 1J42A 3KX2A 2OTCA 4OMDA 1Z2EA 2AW5A 1JU3A 4CM5A 5AUPB 3RROA 5C1BA 4LTMA 3LSMA 3V8KA 4V24A 2YY6A 3LCUA 3MQ2A 4J76A 3F8MA 3VAAA 2V1NA 2D5LA 3GJ8A 4B7AA 2M4GA 3HMQA 4H7HA 5AI4A 1I4TD 1O58A 5JJKA 1Z4PX 4EPVA 5LXTA 4OIMA 2MSKA 1LLDA 4F3TA 1GL7A 5LP6C 3TBHA 1Q57A 1D2CA 2ZBGA 3U40A 1EFDN 3WIUA 4AY4A 4AJKA 5B3JC 5KDDA 2EEZA 2IS6A 3OURA 2X9NA 3WOHA 3EHDA 4PNEA 4QVGA 1W7AA 1KYQA 2QK4A 4XRSA 1C8KA 2C9YA 3AEQB 4EHJA 4FQ7A 5H6RA 3DMDA 5JJCA 3CCFA 2J08A 1RP1A 4TMXA 3V3KA 1FSGA 4O2RA 1P7YA 3BDDA 4K9DA 4Q3KA 5I7UA 3E9NA 3N6VA 4KDEA 4OGGA 5KYGA 5GIPE 4Z4IA 1I6MA 4Q7KA 3FTFA 1H4TA 4CQNA 3ZHXA 4DQ2A 2C0CA 3LX4A 2B82A 4CCYB 4EQZA 4LCJA 3FXLA 2W4SA 3K3PA 3NYRA 4LV5B 3SE0A 2KDOA 5IOZA 2CSXA 3BIJA 2GIVA 1QFYA 5EG5A 3O83A 2BCEA 4E14A 5CB4B 7ABPA 4B09A 4X7PA 4OVKA 1KO5A 4F4JA 2AI1A 2WJYA 1VGVA 2DR3A 4Q19A 4OK6A 3MGGA 4UHCA 4X6LA 5GY7A 4KR2A 3V1LA 4EH1A 2G1AA 3F3XA 3T1BA 1BMDA 2QP3A 1IATA 2Y05A 1A1VA 2IODA 1XSDA 1UWKA 2WD9A 2WJ3A 2FJ1A 2HC9A 2XR1A 3IOEA 4OBBA 5HF6A 1AA9A 1F2UA 1RI1A 4AG3A 1ZK1A 2QWXA 2VNJA 3OIWA 4ZZ1A 3W04A 2I5PO 2QXUA 4H31A 3DGFC 4RELA 3RBVA 2WZQA 1PZHA 2VRNA 4MGHA 4YRRA 3QPDA 3OT4A 2CMKA 3BJMA 3NIWA 4KX3A 4KQGA 4AC9A 1VJCA 1UEXC 2YMPA 4JD5A 5LBTA 1I5ZA 1B6SA 2G8NA 3SYRA 5IT5A 3EGCA 4BQSA 1MAHA 2D06A 3OPYB 4GSLA 4Q3BA 3YASA 2PQ0A 3U7IA 1V47A 2HPMA 1EXMA 3FW1A 4QDUA 4DLBA 4E12A 3TD9A 3K6GA 2GK3A 4YBRA 4FLMA 1K6IA 4LXGA 1Q20A 3HLTA 3O2SB 3M5WA 3BY6A 4BGIA 1FMFA 2QAGB 1WSWA 2X5KO 3AKYA 3H84A 3WYAA 4TS4A 5CDTA 2D1HA 2J8ZA 3DE5X 1UP7A 1ZSVA 2FW8A 3IDSA 1ZS9A 4JBHA 3PGMA 4OHMA 5LNK1 1JIUA 3FTDA 5J4KA 1EJ6A 1RPJA 3IUYA 2VDWB 3ZTWA 2PZFA 4OA8A 5F2OA 4UBNA 3E9MA 2NUTB 3N4MA 2IC5A 2HQ5A 2P6OA 3B82A 2IEKA 3AEKB 3BMXA 2BZ0A 2H1VA 4MRRA 3JSXA 5KSWB 1XL1A 4OHBA 3TOAA 3GLFE 3CKKA 3RS4A 3PE3A 3TL4X 4RGXA 2NS8A 1FVOA 1YDMA 3STTA 4NUBA 3CB2A 3QENA 4B8YA 1W25A 1J0RA 5DCUA 4V2GA 3T7IA 4BE2A 1DUXC 3R3VA 3MGAA 5K0FA 1XNRB 2WMDA 3F8BA 3K09A 1GUZA 3MJTA 2D3WA 4JWKA 4QAJA 1N5MA 1JAXA 3DNFA 3FZNA 3HDQA 1SH7A 4H7KA 3DCFA 3DLCA 3SS8A 3ZWOA 4B6OA 4F6CA 2AXPA 4Y8VA 4DBLE 1FLNA 1KO1A 4FW8A 1ON1A 1D9ZA 1BHQ1 1WMSA 1ZH6A 3C24A 3EARA 3F7OA 3AP2A 3GBVA 4FTWA 4LI0A 1H0KA 3S7TA 4R2JA 4P7FA 4MHTA 2XGXA 2LREA 1CGPA 4IKFA 1KNQA 3RKXA 2GYYA 5KNDH 3UTCA 1Z0IA 1M72A 1V3UA 1SEPA 5I01A 3I42A 4EKIA 1JHYA 4BMVA 4J2HA 3TZHA 4LHVA 2G06A 1NJ8A 3CZMA 2QVCA 4BKQA 2KL4A 2HKXA 3V7RA 1PJLA 3JQ7B 5K2OA 3PXUA 3RTGA 5KOHB 3ESWB 5E2BA 4FASD 2YHAA 1L7QA 3L4BC 5EERA 1SCUB 3VDMA 3A01A 2FWPA 5EXDA 5K3EA 1ZRDA 3C3MA 1KXJA 4OB6A 1W1UA 1ODCA 4NDLA 1X1PA 3KV3O 1NW4A 4G4JA 1HW5A 5E38A 4WWCA 1OW3B 2KLHA 2X9VA 4WECA 3EYAA 3OU7A 1NXOA 1YO6A 4F4CA 5HR5A 3VSDA 3WQRA 2GNPA 4IQFA 4Q3EA 4TTRA 1GKLA 2BH2A 2XF6A 4LLGF 1IJWC 4BU1A 1VIDA 3HBNA 4D96A 3T7CA 3JQCA 3RYHA 1X7YB 1IJKA 3FM3A 1IEVA 1EA5A 2AZXA 1JHZA 2AYYA 2LV8A 2A9VA 2DPGA 3KLPX 1J21A 4BNZA 1E5TA 3VPCA 3QKSB 5C51B 2PKCA 3RFVA 2XC7A 1JX6A 1KJNA 4YMLA 2E7XA 3CC4I 3IVXA 4KK4A 3WDMA 5ICSA 3AJ8A 4JJGA 5H3LA 5L40A 2WJHA 4JLDA 5EMJA 3RU2A 2IUUA 4YC7A 5EXTA 3NS7A 3VO9A 1DQZA 4QOIA 4EPWA 5BWNA 4ZYZA 2G0TA 2G5GX 3O4GA 2IYYA 5CR9A 3AC0A 1KVSA 1XLTC 1V55H 3GGGA 1MH4A 1Z37A 3QWHA 3TUIC 4K6FA 1YKSA 4UVBA 4MWBA 3KPJA 4YT2A 4O63O 4BATA 1IBSA 2D0OB 1SHKA 1X1DA 1NUQA 1PVVA 2OGTA 2XV4S 1Y3DE 2PMCA 4TXMA 2W43A 1HM5A 1K4SA 1B72B 3K1AB 2FTKE 3LA2A 2JFXA 3D8RA 3PNYA 2JA2A 3T7KA 1OJLA 1TA0A 2V7QA 3KR1A 3W6VA 1EVJA 3NGMA 4EW6A 1OUMA 4TXJA 3JW8A 1TVKB 4XUCA 1NKTA 3LUBA 1O0CA 1M34B 3DWLE 3HSFA 1I5EA 3JATB 3E0JB 1ZL0A 3M9WA 1HF3A 4M0LA 5CHEA 4LZLA 4CQLA 4EY8A 3U4HA 1ZELA 2HQOA 5C81A 1M6WA 1C0PA 2ES4A 2HSDA 3OC0A 4JA2A 1GCIA 2JIRA 3QMWA 4BEHA 3NARA 2IZOA 4A27A 4ETMA 2EFNA 1BIAA 4JI0B 4CT4B 5DCMA 2PMWB 4KNWA 4CIYA 4ENMA 2JF0A 1ZUHA 3JAMZ 2DQZA 4JOQA 4O4HB 4M6YA 3HJAA 2OV2A 4RY9A 1YULA 5D1NA 3W9BA 2CLFB 4CLXA 4HMPA 3LVFO 1OC2A 4XR4A 3S1MJ 2DJ5A 3FWHA 1OLOA 3RFCA 2NNLD 4EGZA 2E1NA 3D5EA 2X8LA 3INRA 3BTVA 5AVZA 1YOBA 4QBGB 1SU8A 3G5AA 4WAUA 3UAWA 3KFLA 3L2UA 1W0JA 2FEKA 3UBTA 5I9IA 4I50B 1CLEA 1N2CA 2Z2XA 4MVJI 2X8AA 2ZXIA 3A1YA 3L2OB 5KU7A 1WDMA 4EOGA 3AVXA 2AR0A 4LBWA 4P58A 4P53A 5ALLA 5K0TA 1KU9A 1TQ4A 4E33A 1O5OA 2IAIA 3HCEA 2FEOA 4D02A 3W5BA 5B5SA 5BVHA 5HIAA 2OK8A 1W5BA 4ZYHA 4OU5A 1TPZA 1NMQA 1CYDA 2PDAA 1WRJA 5UKDA 1RCUA 1PT7A 2QX4A 4UXHA 1N9GB 2ID8A 4MA4A 4KB5A 4Z54A 5AK6A 4D74A 1G3UA 2BFPA 1MGPA 1PSWA 3IP6A 5FFZA 5DULA 3MD2A 3CVWA 4JJIA 5GOZA 2E5LB 2ZULA 4RDCA 3UC9A 2EJVA 2XDQB 5HVQC 3IUEA 4PANA 2CDBA 1QWOA 3IUPA 2MSWA 3RVRA 4X8MA 3R5HA 3VHLB 5SZHB 5ELXA 2Q62A 4GWGA 3HYTA 5C32A 5IJWA 4ZRNA 3ZDEA 3OE7A 1WBDA 1KRXA 1D1SA 1Y8RB 1W4RA 2JEZA 2P1DA 4GYKA 3EOZA 1F43A 4JC8A 1N0IA 4TMFA 3EQLF 2I3ZA 1E3QA 2L7KA 3TFQA 3B5JA 5ESWA 3TQRA 4H7PA 2G28A 4GRDA 2XECA 2YNMC 4N49A 1ESNA 2Z4SA 4LI3X 4O2AF 4S05A 3CJTB 2WP0A 2ZSJA 3TJZA 2K85A 4JXJA 2HTSA 2XTMA 3KE2A 3UG6A 5K8UA 1Z35A 1GGFA 3SXYA 2FPRA 2FDXA 4IKPA 3K71B 1NW7A 3F0TA 3RYIA 2VCYA 5F21A 2H9AA 3E5RA 2BBYA 3ZGKA 2F4IA 2XCIA 2ZE7A 2ZUFA 4WBSA 3CUQA 1M5UA 2DWCA 2VBZA 1R4NA 4HEA1 3CKMA 3AIKA 2YWXA 3ASZA 3C3AA 2ZIGA 4S2EA 3TL3A 4C1NA 1F2DA 2VAWA 1EFVB 5BMZA 4I9HA 4IS3A 2H1LA 2C07A 3RKWA 2XB4A 1M5RA 1E58A 3ESYA 5CPRB 4L8VA 3LX5A 4QU9A 4YJGA 3ADOA 2PT5A 5HDQA 3WSTA 1E3PA 1JPVA 2HPAA 3L7KA 1T5LA 2WB2A 1JAIA 1NNLA 1UWVA 3PC7A 1RJFA 3EW9A 2NVQJ 1WQ1R 3AJ9A 3E6CC 3GWGA 4ZYDA 1JH8A 2HPVA 3FPSA 3ITKA 3PTLA 3EVFA 4RF2A 1ZW6A 2GXGA 3UW3A 3A2LA 3WDLA 1EFRD 2HKOA 4TXLA 5DYNA 1X3WB 4KQIA 1U0NA 1PE0A 5HCNA 3WDKA 1QS0A 3DOJA 2XPVA 4BEJA 3LQKA 2G80A 1JQJC 5EDNA 2QM0A 3PVZA 1N9KA 4HH0A 4B3AA 4X84A 3T7DA 1HC8A 1JSXA 1CR6A 3HUGB 3H99A 3KDAA 4H3HB 5DP1A 2JUGA 1R1DA 2D2EA 3SZLA 6CHYA 3RWOA 5IVKA 4QRHA 3V4PB 2XXJA 2A1UB 2X5JO 3GUUA 2YSRA 1Y42X 4L5AA 5A7GA 3E8SA 1MQ8B 2XWSA 2HXSA 3EQ7A 3MT0A 4I08A 3UFXB 2IU4A 1SVIA 2NLOA 1PJSA 1E1RD 4RLQA 1PJ2A 1V26A 2IX9A 3FY4A 1U5AA 4HH4A 1GAWA 3B36A 2QRGA 3G6WA 3Q2IA 4TMTA 4V1CB 5FTNA 4XONA 2QNIA 3DW3X 3I30X 3A03A 3PHLA 2GESA 4G7ZF 3EZ9A 2ZIWB 3MCTA 4DLYA 4M86A 2YYAA 3WLEA 5U4QA 1KOGA 3R23A 4QU0A 3VR3A 1IY0A 3G2JA 5KSZA 5KYTA 3R0XA 1JFSA 2TMKA 3O84A 3OH8A 1P1CA 1Z7BA 3HYSA 3K9LA 2J4DA 1ODKA 3LUAA 3TI7A 1GNQA 2P2YA 4R4JA 3UCEA 2BHSA 5C8DA 2KSQA 1KC3A 2IBSA 3H1PA 2VF4X 3QEMB 4KPEC 2FDCA 1CRWG 4E5VA 2VBCA 2C3OA 4MQVA 4X66B 1R4ZA 4P54A 3ELBA 3NM5A 2YWFA 5ICGA 2BWJA 2AEFA 2CXUA 2J3HA 3F8TA 3NWBA 1VBMA 5IOYA 1SELA 4KYWA 1H05A 4Q1FA 1G21E 1COWA 1TTTA 3TSYA 4WN3A 4F7ZA 2WB1N 1JDNA 2FBIA 1TJPB 1XZJA 1D2MA 2BW0A 1MQAA 1Z62A 4TV9B 5E2IA 1OB5A 3C4VA 2VDUE 4U3JA 4RD3A 1XCMA 4ZDLA 4OPMA 4UE2A 3MGCA 3AY3A 4ICIA 1J75A 1WOYA 3RGGA 4PM4A 3G2LA 3BH0A 3QEMA 2IGBA 3OE5A 4KJZA 5DEOA 3TCNA 2KDZA 3O95A 4ER5A 4AC0A 2V9VA 4P82A 4LSZA 4W6ZA 3EXEA 1R4MB 2KFDA 4EP1A 2YHIB 3FYUA 3NUQA 4OHPA 1XB4A 1Y1VJ 2RGBA 1M76A 1Y48E 4BYYA 4ZCIA 3OIYA 4OG2A 2GWRA 2QE7D 4Q24A 3BL8A 4UQLA 2GA8A 3RVLA 5LR6A 1RM4A 4OOEA 1E5VA 3HSEA 1KAHA 3BXGA 1LW6E 3J7TA 4ZQFA 3REQB 4LVOA 5HEKA 3JWPA 4UY8I 2A0KA 4DBVO 3M6WA 1MHTA 2J0QA 1V16A 2CMFA 1X7GA 4R3WA 3U7FB 1VL5A 2H9YA 5A7HA 3DYVA 1M6YA 1REQB 5D4SA 4HWKA 4DR4B 2JJMA 2R1ZA 3FTEA 2COBA 1SBCA 1SCQA 4FPXA 5ILSA 5HSGA 5JSZB 5FKJA 4B3CA 1KMIY 1V25A 1N0WA 2PX9A 5BNIA 3ER9A 3TKYA 3QQ5A 2BTEA 3IAS2 4U7WA 4B2YA 3TO6A 3OL4A 4BHPA 4D0GA 5EJEA 3AW9A 4LJ9A 3QFFA 2Y0SN 1PFVA 4RFLA 5J2TA 1S4QA 2ZRJA 5F23A 5IX8A 1G2OA 1RJ9B 1CRQA 2HWXA 3IV7A 3QVTA 4QGSA 2ICWG 2XX3A 4HY3A 3DULA 3GDWA 2C0PA 4CM7A 2CQXA 4RAOA 1GD1O 5GTIC 1KEWA 3MQ4A 2IS2A 1OX6A 2A5WA 1TNSA 1K8XB 3OHSX 5F51A 3UUFA 2GEBA 3HM2A 4QYXA 4X1EA 2JFUA 5JPCA 1KEZA 1Z45A 1J2YA 2SBTA 3MEQA 3D7MA 3DNMA 1GAQA 4XLZA 3GYGA 5CIQA 2PANA 3KS9A 5FD8A 3AB3A 3TSOA 2DM6A 4ZVNA 2R8RA 1Z73A 4M7PA 2JPBA 3S2DJ 1TA9A 4NJEB 5E3IA 4NBQA 1QZXA 3CNOA 1ZHHA 2DHEA 4PZAA 2WVAA 3KUCA 3B73A 2VASA 2CXHA 2XDVA 1CFZA 4NJEA 1JKJA 2GBIA 4OAPA 4IIBA 1MX3A 3KOUA 1NWHA 1YOVA 1IRFA 2CXNA 3OOEA 4ZCQA 2C2ZA 3FNBA 5CD9A 1QZTA 3RJ5A 3ZMVA 4WXDA 2EVWX 1OQAA 1KSHA 1MPXA 1STOA 1M1YA 1MW9X 2PZAA 1GGMA 1DQPA 1G19A 2CW0F 3GA7A 4MX8A 4UV9A 3WGOA 1P1FA 2FPXA 1PR4A 4IV0A 1OYOA 4LC1A 5I3CA 4NE2A 4A6DA 1YZ3A 3FTPA 4XJXA 5K7FA 2VP0A 2BKVA 1DMRA 2C5LA 1V6AA 3FSEA 1KI8A 1KMHA 4NTZA 4WNAA 1MMDA 1Y9EA 2EQRA 2D4HA 3S3MA 1YB1A 2CUJA 2NX2A 2YZ2A 3MTJA 2ELHA 4BS9A 2HA3A 3I8OA 3TZQA 3QOPA 5DMXA 3DEKA 1A98A 1E2FA 3KQVA 5ADWA 4WFJA 1UDWA 2GJAA 3A4NA 4R2MA 3PXAA 3ZCTA 4PTZA 3BD6A 2QX9A 4GOND 1KBQA 2RI6A 3DLTA 3MWGA 4JLKA 4D9CA 4IM7A 2C98A 1U7OA 3L93A 5JNUA 2JLBA 3VH4A 1N2XA 1DP3A 3QTLA 4HX5A 1S3FA 3NTVA 3TE7A 2GKGA 3FF1A 3NAZA 1IH8A 3OAAA 3PQKA 2HQRA 2VRBA 1G8FA 4KYIB 4XYMA 2VZ0A 2VPXA 2ID6A 3GTOJ 3AYXB 3AMVA 1H9TA 4JFAA 2BGGA 4O4LB 4HVAA 4JN6B 4BC0A 1WJGA 4OFWA 3REQA 3T7AA 5F1JA 2OFPA 3OOYA 4HDNB 4OUDA 4UBMA 4BH9A 2X42A 2CYYA 3SJ7A 4CLRB 4DJ5X 2GETA 4RJTA 2NO1A 1YAJA 5LP1A 1BROA 4REMA 4BRSA 4C30A 1GA6A 1TYBE 4DMUB 2HS5A 4X1IB 1XX5A 4R84A 5AK4A 3TMOA 4MV4A 1CQZA 1IPHA 1IC8A 2BF7A 2FMIA 3CFYA 4N40A 3WJ2A 5CA1A 4X65B 3J81A 2FPSA 2B98A 1S8NA 2JFOA 2OGUA 2RK6A 3EE6A 1WM1A 4FDAA 4HB3A 3U0BA 1SD6A 1HUQA 1Y63A 2DQSA 3UH1A 3SVLA 1H42A 4KOEC 3UGKA 4WCGA 2I22A 2VJMA 2GHQA 3QP6A 3L9XA 1VKHA 2JAQA 1EUCA 3BTOA 3NTQA 3TQSA 2DWQA 2EX0A 2R7SA 2I1QA 4R1LA 2D74A 5IMSA 4X20B 3O91A 4HDMB 2PQ8A 2NZ8A 1Z0DA 3AIOA 4HNAA 1Q0UA 1NBMA 3FM5A 4HRYA 5COBA 3L8ZA 4BQEA 3U4QB 1XTBA 2AUTA 5AXAA 1KRWA 2CFCA 3THRA 3RSOA 4XNFA 3ENQA 2P6NA 3LYUA 3GUCA 5ERYA 1Z0ZA 2X0NA 3TIVA 3ZD9A 3OX3A 3TUZC 2B7LA 1KZGB 1YL7A 2G04A 3LPAA 4FBGA 3BQZA 4HUJA 4LN1A 4RABA 4RSGA 5A6SB 1XLWA 2G9UA 2FZEA 2FZVA 3ANYB 4RPHA 1Y3IA 2I1WA 3OQJA 4DZPA 2JFNA 2TMYA 4QNNA 1P6RA 2IK8A 5CH3A 3WWZA 1QVZA 3ABTA 4UNIA 1XZBA 1ODLA 2QZZA 5ETJA 2FN8A 1KFCB 1QVUA 1SBQA 2NO5A 2BHRA 3CIOA 4FZJA 4H7IA 4EJ0A 4TN1A 4ZYVA 3FUUA 5CPBA 4YONB 4LRQA 1U2SA 1OI7A 4GQBA 4PG4A 2IZ6A 4V0MA 1DQSA 1I32A 1A4RA 1LBHA 2XB6A 4JP8A 5IAAA 3N07A 2J59A 1UOEA 3KQWA 4JVNA 1IN8A 2ABWA 1OCEA 1P7IA 4L5CA 3W1WA 4AY3A 1PT9A 4FZ3A 4RGYA 2VUUA 3WL3A 2QZ4A 3P52A 3VYSB 4YPVA 4IIJF 4E2ZA 1A6QA 1EGVB 1QC5A 1W88B 2HU7A 1CJSA 2XQJA 3I9V1 3K4QA 4Y2XA 5E1DA 3OTOB 4Y1GA 2V4ZA 1E77A 2FPWA 1JDPA 2N47A 5GZ1A 3ZH9B 3TQQA 2NXEA 1ABBA 1XEWX 4TZKA 2LNDA 1TCVA 3V8LA 1DBQA 2R44A 4Q7MB 3WHBA 4DWOA 1TL7C 1QPGA 5KC9A 3BZBA 1HNXB 1QK5A 1V95A 1Z4MA 3DO8A 4E2XA 4BJHB 3QPSA 2F3TA 2O0JA 3T4XA 3VJKA 3Q41A 4XIDA 3VJLA 2Q2EA 1HNZB 3KO8A 2KRHA 4M0EA 2DHQA 3D9QX 1NLUA 1CV2A 1JHRA 5HFAA 3SDSA 1M7BA 2RFLA 1QIEA 1P7VA 4AZ0B 4WUTA 1WH7A 3NX4A 1QX4A 3QMMA 1BIBA 1PR3A 3WO1A 4FFBA 1QHGA 1QO7A 4CM4B 2XMRA 2FXAA 2DT7B 4CQMD 5F12A 4CKEA 1FSPA 2ESNA 5AKKA 3B7WA 1UC9A 2DBYA 1EFVA 1PR5A 1XALA 2JBWA 5EZ5A 3IKTA 3PEVA 4LV8B 1KYZA 3MPUA 4LWOA 2VQ3A 4TS3A 2OFXA 5LL6P 4AVZA 1LUJB 1QAQA 1Y3FE 3JW4A 1P2DA 3H13A 5DXAA 4MH0R 5FOVA 1EWVA 1D5WA 3LOQA 1JQBA 1WP9A 2Q3FA 5T57A 3UGTA 3O3KA 3R5TA 3K92A 5CCXA 4JJKA 4E30A 4AS1A 2ZI7A 3CZAA 3HDJA 3ZWQA 4U4AA 2ILVA 4RAFA 4MV1A 4UEJA 3WQBA 4B47A 4FSDA 4KGZA 4YXFA 3HBMA 2FRXA 3K0CA 4JYZA 1U8BA 1X3SA 3CO7C 3H5IA 5ALVA 1CZRA 3CS3A 2OV3A 4MQMA 2QGUA 4TLEA 3O26A 3DAOA 3DONA 5L51A 3DF7A 2VHZA 5CK5A 5J3LA 2ZRDA 2PWBA 2XMQA 3IJPA 5CDUA 2XPWA 1FNSA 2QTMA 3KTAB 4O29A 1FDTA 3MOGA 1WW3A 1Z0AA 5C7OO 2Q7DA 3CCJI 3DV2A 3KEFA 2DOAA 1T3LA 4GU5A 3RU3A 3ZWVA 2G1JA 1SC1A 1V4RA 2BEOA 3PQ8A 5CFLA 4Q6BA 2X9QA 3Q5DA 3SYNA 3A1DA 4DLTA 2RHMA 2P8TA 4J0JA 1XDSA 2TRTA 4GOLD 4M1OA 2IYWA 1DFGA 1CR2A 3GOHA 4LF7B 1EIZA 3VAYA 5L3CA 1JYSA 3N0RA 2Q29A 4AJNA 2DPYA 2XB8A 4NENA 3DLLF 3JX9A 1MD9A 2BFMA 3KB8A 4NZZA 1DIAA 2MTBA 4ZZ2A 3F47A 4KR0A 4A6PA 5C53B 1DJQA 4IGKA 2DBRA 3VKUA 5KYUB 3OFKA 3ZW8A 3L5KA 1QTIA 4DV0B 4LF9B 1U5BA 2A0FA 3BWEA 2OVFA 4CICA 3BVPA 2O5RA 1GNLA 1I1NA 3EZYA 5F9FA 3JVIA 2ERYA 2R6FA 4FKMA 4JQOA 5DKFA 3RRNA 2MSLA 1M5TA 1ZLJA 3OLWA 4HX8A 1NBHA 4FIZA 4AQYB 4MS4A 2OORA 2W2OA 5FB2A 2NYUA 5D85A 4QPJC 1J8VA 2QV7A 4LBYA 5BOVA 4K9QA 1ZAKA 1SD4A 1YBAA 3U4DA 2RGVA 4IDHA 1TMOA 4MKRA 3HEFA 2YS9A 1EGAA 3NU1A 3FKSD 4Y6LA 2ZBPA 5TB5A 3ZI0A 3MKWB 1U98A 4ESOA 3REOA 4P84A 4LYHA 5G4KB 1AHHA 2Q2WA 2QRNA 4B6EA 5DTEA 3RAEC 4JCOA 1GGEA 2Q5JA 2W98A 4KO8A 4JLJA 1MA0A 4S04A 5AESA 4JDUA 3WFZA 2O3SA 3VKGA 1A9SA 1GUBA 5GJVC 1FW8A 1RRKA 2YN4A 3PNPA 4IBOA 2WHYA 3C1TA 4UV8A 4GNRA 4D9KA 5LP6F 3CN7A 2ET6A 2QNBA 3IHLA 4QFDA 3KD2A 5BYBA 3L0OA 1NW8A 5ALZA 1VLQA 4TMVA 4ZJPA 1RS0A 1ST3A 2UAGA 4G1EB 1YGYA 3Q0VA 4D6PA 5IDVA 4MHOA 2ZJFA 2SHKA 1T8SA 2QBYB 2HI0A 1NN3A 4PC1A 4V39A 4D3DA 3U4IA 5BOSA 3BSSA 1MCZA 2W2PA 4MQ9F 1RT9A 1F4LA 3TD2A 5JCOC 2PKRA 3VOEA 1ZHFA 1LA2A 1VHLA 4O4HF 4CFSA 4N76A 4TYPA 2DZDA 3BE5A 3I4CA 1T5HX 3P0IA 3QOWA 1X19A 4MR9A 4OHOA 5CFMA 1MPTA 1J97A 1SU7A 1XEXA