4BQNA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
SMAQRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqnA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqnA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
1KO1A 4EO4A 1S1MA 1XAGA 1W85B 5LBIA 5C8ZA 2O2HA 1I6LA 5K8IA 5COAA 4A7PA 5MF6A 3GBSA 2LIPA 3ABRB 2CZQA 1K3FA 3V4VB 4KQIA 3PXGA 4S3MA 4NSNA 4NC7A 3Q7IA 2J32A 4ZOBA 4G4IA 1GNSA 2D4HA 4D3FA 5J1SB 5HOEA 1TBXA 3CDIA 2F62A 4HBLA 3C3XA 4DRXA 1D03A 3D2BA 2VI6A 3EGCA 2GBFA 1FLIA 2CSUA 5GONF 3AH8A 1YE5A 3UJAA 3BJMA 2IU6A 3E3VA 1SZDA 5CH3A 4MNUA 1E96A 4E07A 4RZ3A 2GIVA 3QU4A 2ZBUA 4S05A 2HAEA 1SGWA 4J2TA 1USSA 5BR7A 4UD2A 1X8JA 3T8YA 4KBYA 5IJ9A 2FZCA 1E3QA 1NP6A 1LPAB 1Y8QB 1P61B 3PSAA 3VNVA 1J8YF 1ZVJA 4LK3A 3V6MA 2CDCA 3H2SA 1WW8A 1E6KA 3FNBA 4YP6A 2B30A 1LZLA 2PLAA 1Y8ZA 1O0BA 3GXOA 1LFAA 2WQ7A 4IRHA 1E2BA 3TLAA 1NQXA 1ABEA 2NAZA 3HCBA 2F9LA 4OQNA 4IH9A 1WNTA 4PPYA 4F6LA 1JFRA 3KKNA 1PUEE 4PZCA 1SULA 3C7AA 3L7CA 1FP4A 1C4XA 4BE0A 4HDRA 2ZPUA 2BM1A 1AZLA 1EESA 3ZE9A 1I1OA 2BY4A 3S27A 4OQMA 4QDKA 4DB4A 4JLDA 3NOOA 4JVSB 5DNUA 1E2JA 4HLQB 3SBDA 1J4AA 3O0DA 3FCOA 4LXYA 4URYR 1XDUA 1X8LA 1DRJA 3BZ6A 2WF8A 3BYZA 1Y0NA 2ZJ4A 4PX5A 3IP3A 5F1PA 4R31A 1X86B 3M3PA 1GZ5A 4KYVA 5I9IA 1R58A 5JH7A 4WASA 2BTQB 2WWTA 1U0BB 4XB2A 4OUDA 3A1WA 3TRHA 3ABLH 2GRAA 1DPRA 4GR9A 1KDZA 1X3UA 2W8ZA 4ZYDA 4X92A 1QP4A 1H66A 5K0TA 4S1OA 4EKYA 4W97A 3PDJA 4IHSA 3DWEX 1RPAA 1VF9A 2ADOA 2VA8A 4CKEB 1UMQA 3IB6A 4A3FJ 4O63O 1UK9A 5JE8A 1Q0PA 4AT1A 2IBSA 5JXGA 2QD2A 5DP1A 1O89A 1BJAA 3EZFA 4HEQA 1T8UA 2DR2A 4YRJA 4N9HA 2R7WA 1L5YA 2PZBA 5L51A 5IN4A 3VPSA 4UV9A 4YAJA 3V55A 1RIFA 3PX3A 1UFVA 2H57A 4DMKA 4OHKA 3ZWKA 1JKPC 4HY3A 4ZD6A 4HWGA 5SY6A 5DW3A 2QUZA 2MLKA 3EIUA 1FTQA 5H3CA 2NYUA 5EXPA 5HYVA 4A1OA 3K9LA 3L7AA 1X1RA 4LEIA 4Z3OA 4C3OB 3SIWA 3LA8A 1E2GA 3G49A 2BP7A 1TCUA 1SFEA 1G0NA 5K3FA 1ZD9A 4K2EA 3I34X 5FOXA 3I4MJ 2XF6A 1VLMA 3CLOA 2DA4A 5GZ3A 2OMKA 5GONA 3RRBA 3T52A 2E21A 3PD0A 3I3LA 5IXJA 3K4MA 2ZI4A 3I04A 1BX3A 2XA9A 2J4FA 4DIMA 1A27A 1GR0A 4B3RB 3BE6A 5L3VA 4EYOA 3H83A 3E4DA 2OCDA 3I6MA 5JUWA 4N0EA 1L3CA 1EQAA 3A1NA 3GFRA 1S4QA 2HPZA 4P82A 4DAOA 1J7KA 2X40A 2WTXA 3K09A 3QFSA 3OR1C 4ETIA 2C4HA 1A9QA 3MW8A 3NAGA 1IAWA 3DDSA 3S99A 3HSYA 4OREX 4O2AA 1U2GC 5BN5B 4MW9A 3CMEI 4PZDA 4OHXA 2WP0A 1J0EA 2ZUWA 4YVFA 1D2AA 1NMXA 4NXMB 2CQXA 1J39A 4AJ2A 3JWHA 1I10A 2YHIB 4PC6A 4F3YA 4ZOEA 1XCPA 2UUAB 2HWXA 5IYZA 1BE1A 2ZSHA 3CMYA 1UQUA 1Z06A 3U2QA 3FX3A 5BNFA 1T8RA 4Q4DA 1U4OA 2O4CA 3WB2A 2OCPA 5E3NA 3UH0A 3LUHA 1XTQA 4Q1EA 4Z3KA 2YXBA 3IVAA 3D6NB 2N8GA 3OYGA 3AI2A 1YDWA 3M2PA 5KX5A 3BZBA 2IAIA 3U4QA 4DCMA 3IRQA 2O3JA 3ENZA 5CVUA 2FV8A 5BQXA 3KPHA 1MLDA 1JZTA 4OHUA 5ESXA 4Q39A 3R75A 2E5NA 4XLCA 2CY0A 2LBPA 4Y3UA 2IW3A 4LIVA 1SOVA 2V4MA 3PYMA 4X9XA 3J81Z 1Q0RA 4F12A 3ZPXA 6AT1A 4U7WA 4DJTA 1K4YA 3MOSA 1BEEA 1KEZA 1COWD 5ITZB 4UB6C 2AWNA 4EMUA 4AJPA 4QL3A 2PMBA 3ZY5A 2BMJA 4YPOA 2QXUA 3NOQA 2HIGA 3TM4A 5EJ8A 4I5FA 4GC5A 2XVZA 5FHQA 1X8XA 1RKBA 4GOND 3S2IA 3HEFA 1H89C 1GGMA 4WLUA 1VIDA 5L7YA 2W2PA 2HJWA 4XYGA 5I7SA 3HWX1 3FZYA 2O7RA 4S2EA 3AG2H 1HDZA 4BACA 4C9BA 2WIKA 1J70A 4G4SO 1GXSB 1XTKA 4I55F 3VKHA 1KQOA 2WLTA 3WBKA 2VQ6A 1C8KA 5CMLA 4NMXB 5EIFA 1V16B 4YELA 4V0QA 3DFUA 2WUDA 7MHTA 4ZJUA 1GXPA 3IVCA 4UUAA 1SKQA 3AM5A 4NCXA 3WLOA 3CUQA 1WKCA 4IFBA 4Y2TA 3R0VA 3FIJA 2PYZA 3V4FA 4GRIA 1DQYA 1FRFS 4C01A 1TZLA 4DMCA 3B3FA 4JT9A 4RDIA 2JI6A 1GCAA 4DLVA 1JLLB 1IEWA 1S7OA 4PG8A 4J0KA 2ZYRA 1XROA 3HBFA 5F9HA 3GN1A 1JXMA 3RYIA 3AX6A 3O3KA 2QUBA 2VRWA 5JCJA 1CD5A 3U7QA 3VAYA 2QIPA 1EWTA 3PV0A 1ZJYA 2FTKE 3H1EA 3HVRA 4IQFA 3EIFA 2GO7A 1D0YA 4TKZA 3LSMA 1BFUA 1EJ2A 3GO5A 5LBUA 2V97A 3V3TA 3HUEA 5T5QA 4FETA 3D54D 3S1NJ 1TJ3A 1ADBA 3CF5F 4GKKB 3LFHA 2P9HA 3SJMA 3HG7A 4U5QA 3GRAA 3CZQA 4F5WA 1ECLA 4YRDA 2OYCA 4OP1A 1RM0A 4MLOA 5CHYA 2BD0A 3TPFA 4E5NA 1IZZA 3OWOA 3OQNA 3BSFA 1P4GA 4LLLA 3B6IA 4B3GA 4UEWA 4FLMA 5FO1A 3E22B 5BMVB 3NH6A 5DCYA 3GPCA 4B4VA 1A5BB 1YDHA 3HOWJ 5JNUA 2JGLA 2B4KA 4CCAA 4EPTA 2XCIA 1NU8A 4BN4A 2IEGA 3OLWA 5D2CA 3EOBI 2VP4A 3L8MA 3P94A 4XAQA 5KVQA 4B3XA 2WAMA 2JARA 2GA1A 1YZYA 2J07A 2YFYA 2G1JA 1YL5A 2Z6QA 3QF7A 3BDAA 3VDQA 3FM9A 3LY5A 2C54A 2Q5FA 3SE0A 4RTPA 1JUSA 3OYMA 2IA0A 4Y2UA 4PJJA 3DKKA 2DQZA 1JT6A 1X15A 4KYTA 5ALVA 5HJ7A 1TM2A 1KHTA 2BFFB 1NQOA 4R3WA 1BW9B 1V71A 4F9FA 3LSRA 3EN0A 3EZLA 1V1JA 1M1YE 2F4VB 2BDUA 1YU9A 4IIJF 4TQAA 1UINA 1DINA 2RI1A 2DFDA 3R3XA 1UPFA 2JT1A 4PHHA 3GZJA 2POQX 1GO2A 2EDCA 3QG5A 4U3JB 3KPJA 2WJPA 2ZYDA 1L5MA 3TBHA 4JP1A 2OFFA 3SBXA 3DWIA 3C16C 4EHDA 4XVRA 4PXSA 4QATA 2CXSA 1PAUA 2PJUA 3ANNA 4DLSA 2VO1A 3DLIA 3EGVA 2OHJA 4MTCA 1YQXA 1GGEA 4QEDA 5LN1A 2NLOA 3V48A 4QU9A 1UAGA 2ZR8A 1L7DA 1UEXC 4BYGA 1B1CA 3EXAA 1L5SA 3WYCA 4LQ4A 1XRJA 3CA8A 2Q2VA 3GUUA 1HH4A 1TJNA 2ZK7A 4R2WA 2ZRNA 3OIVA 3CVOA 3O8LA 3U4HA 5ICSA 5ALHA 1TWHJ 3HKDB 4PZJA 2FJ0A 3ABIA 3CLSC 4ZTJA 2QL7A 1PSWA 3Q0TA 3WZ2A 4OAQA 2HNHA 4M60A 1WMDA 4QT4A 2H2HA 3CT6A 3KAJA 3O4RA 3S2UA 4G1FA 4BAGA 5JWOA 4TVSA 4DARA 2JSCA 1NUHA 2PS9A 1M6YA 3W5AA 2VRNA 1NG9A 1ID8A 4NG5A 1ZH6A 5E9QA 1V11A 4EG1A 3DP9A 1GPNA 4OP3A 2VUUA 3ESYA 1NSYA 1NA5A 2BFCA 5I7UA 1UC4B 3BRSA 6NULA 4G56A 4KIWA 2VIIA 1BI2A 3BE5A 1LRKA 3EUAA 3OOSA 1ZUHA 3HI6A 2Z8YA 2Q41A 3L7NA 4C04A 3JSAA 3DW1X 3FM3A 3OS2A 5LDGA 2RHLA 2Y1GA 1Z8HA 3D7RA 1E1RD 2W4SA 3UCFA 2BOLA 1M2EA 2B7CA 2VF8A 1YTYA 3I61A 2DR3A 1JAZA 4OWRB 1QYXA 3BG7A 3GFVA 4RSRA 2F8TA 3NHAA 3NVDA 2W4QA 5CX1B 1WW2A 5G0WA 3EODA 4TSFA 1F9AA 5MFZA 1YZFA 2VQFB 4FX2A 1NF3A 1ZCZA 3BT7A 2IV7A 2VJDA 2FWIA 4WKBA 2BFWA 2I3GA 5ERXA 3JTHA 1LTHR 4CKXA 3NKVA 2VSYA 3OA2A 3HPRA 5A2GA 3PL5A 1OZAA 3IH2A 2YV1A 3WADA 4ZU1X 4YMUA 2PRJA 3EA4A 2AUMA 1MO5A 2NGRA 4BFTA 2J5OA 3CCQI 1A9XA 3BMNB 1GV1A 4YONB 3HCOA 2OV2A 3FOZA 4YCJA 3RS2A 4TYQA 3ZWPA 2HIMA 4FZJA 5CX4A 4RMGA 3V8BA 1F20A 4L5YA 3CNQS 4OLJA 2FB9A 3M6UA 4RVSA 4OIRF 1OB2A 1TZBA 4WMLA 1C3OA 1F4LA 3VUEA 4YB8A 2ACEA 3HQ4O 4DW8A 1LBIA 1B76A 4CSWA 3KOXA 4K6HA 2FNPA 4P0TA 5K5QA 1FFDA 5B1HA 1B8NA 2OTLI 1MGOA 4MWTA 4D9KA 3W9UA 3C2BA 1P92A 3F6YA 2NO9A 2A9RA 1KJZA 1P0MA 2WNHA 3O26A 2RONA 2RH4A 4QDJA 3VBCA 2ROQA 4IWNA 4A3MJ 1RCUA 4H6WA 2NUAA 3OTIA 5ILGA 2CDNA 3OPYB 3GEGA 3PC7A 1HT3A 4JMPA 4MVJG 1L0OC 4D9MA 3DFFA 5K0BA 1V8DA 1R5ID 4OU0A 1RPTA 1W19A 2ADUA 1V26A 3A6JA 1X80A 2L4MA 1U28C 4QUAA 2MGQA 2EX4A 3R9XB 4Q4HA 1ZLKA 1DC6A 3I56I 2NZYA 4RH1A 4IKFA 3H3UA 2VJOA 1TX4B 3QX8A 3RVQA 1RM5A 5LJIA 3K4QA 3ZW8A 5IDXA 1KFKB 2C03A 4CLHA 1JA9A 2BEUB 2LNBA 2CLSA 4OL9A 4IDGA 2ZIGA 4AO8A 3HSFA 1SWWA 1I2ZA 2X4IA 5FD5A 1J1ZA 4IEFB 3ET4A 3ZY6A 1JHZA 2H63A 2YASA 2KT0A 3NGXA 2R2GA 3G2QA 2IEBA 3PKJA 1J24A 4Q5SF 1WTCA 3X2SA 4J1SA 1Y8RB 2Z2IA 1WCYA 4D5GA 1EHCA 1SUEA 4Z9YA 4M3DA 4YJGB 4XB6B 4XTCS 3GFSA 1Z5NA 4DYDA 3KJIA 2QUHA 1GNRA 3K35A 3EK2A 2C2GA 1ZOIA 2QY6A 3KP6A 1MRZA 1DI0A 4HQEA 2IYRA 2OHOA 4F4UA 4CCMA 1E7MA 1LWOA 3DV9A 2E4XA 2OZKA 3ZDBA 4QQKA 2XUZA 1IJKA 3AL0B 5KNLA 4RWZA 3FXUA 5LP6B 1UPXA 3UJCA 1D7OA 3HTUA 4NTZA 2YV4A 3LUGA 1ETWA 1KHHA 4NDLA 3JQGB 4WKOA 4NPHA 1XV5A 1N9KA 4AUNA 4MFEA 1J25A 3OKAA 3I9LA 1X7YB 3BPVA 3WRXC 5FQOA 2P6UA 1G38A 2DA3A 2VF5X 3P26A 4OXQA 4LC1A 3BXGA 3MMSA 1YFLA 1MSEC 2Q1WA 4U63A 3WWDA 2ID6A 2BGLA 2SKDA 2Q7DA 3RDPA 1JHFA 2H52A 2XUDA 2ODEA 3L0OA 1CS4C 2R6FA 3K15A 4DWWA 2JRLA 3BR0A 3BTIA 5THXA 3OI7A 4PRKA 4BWYA 1FS5A 2HQ1A 4PG7A 1YF3A 1CE8B 3I53A 5EYPA 5MN6A 1IUPA 5CNMA 1JFFA 3TNYA 1WUIS 1E2DA 2QOEA 1U1EA 4P7JA 1D4FA 3SP1A 4JC5A 5IHPA 3DNMA 3ZHZA 3F4LA 2V58A 3DCYA 4FI3F 1RRKA 5AW3A 1ZH2A 1XB2A 1UOPA 2J9YB 3O94A 5E38A 1VMKA 2B7LA 1QTNA 2AZ4A 3M6MD 4WJKB 2OQ2A 1G21E 2X0DA 1T2CA 3VVCA 3QE9Y 3ZZ1A 1U90A 4GP7A 1AIPA 5D8KB 2QUAA 4NC6A 3B13B 1O97D 4HNQA 1ZVMA 4DDMA 4AY3A 2QN6A 2AFRA 4O0LA 2NUTA 3T95A 4N3BA 4KGZA 3X1ZA 5AQ1A 3NC4A 2N47A 4KX5A 2F8SA 2WIJA 1JV2B 2J6IA 4Q15A 3DC2A 1YIJI 1DJLA 4UULA 2C1XA 2BYVE 4DTIA 2JBAA 5ESWA 1AWCA 4R05A 2QS9A 2QLZA 3T7IA 4DQKA 4ND8A 1MD0A 3VYRB 4OUKX 1BJRE 2PMCA 1F3OA 2F8LA 3QPTA 1TE2A 2WB2A 3DTYA 3IAEA 3K9BA 5HFAA 3G82C 5DKFA 2PJDA 1XVUA 3FCCA 1L8XA 2Y92A 1T8IA 3TLCA 4W7SA 4PCAA 1M8PA 3KOWA 1ZOOA 1K6OA 1WL8A 3M1LA 1OKKD 3B6JA 4OSPA 4RPJA 4PWYA 4ZYUA 4AYBA 2E2HJ 2QRGA 1PTJA 4X7PA 1ZSNA 2JPBA 5A0VA 5CLSA 5AM5A 4E51A 5BSHA 2LKXA 1B6GA 1C9JA 4RZUA 2ZRJA 1S2GA 4F5DA 3D6TB 4NENB 2R00C 5AXDA 1G5IA 4DSAA 4PRLA 3GBGA 3EUWA 3DXJF 2XOXA 2FGKA 1T4DA 3DEUA 5HRUA 3GUVA 3BSYA 1YX3A 3PGMA 4CMHA 1PR3A 1Q7EA 3ML6A 1YB4A 3UENA 2Q4TA 2ADFA 4XUDA 4R1LA 3MG9A 4ISBA 1V0JA 1RRGA 4ZICA 3H5TA 1D5WA 2VBYA 4FNOA 3RHSA 2LDXA 4DZJA 3LO5A 2KHMA 4ZANA 5K6TA 2L01A 1TT5B 2QW8A 4IL5A 5KVSA 2ZYWX 1SD1A 1BI0A 4ND4A 1HURA 1FSPA 2WU0A 3S6JA 2B7BA 4D0SA 4TTSA 5K8UA 1JDUA 4IIXA 3JYPA 3EIWA 3VC2A 2Q8QA 1FFHA 4RKYA 5CB8A 1PN3A 1M67A 2W2LD 1GKYA 2H5EA 1E6EA 3G9QA 3QF4A 2TRTA 3IDFA 5I3CA 4IX7A 4XVUA 1JIJA 4BX9A 1J0XO 1AKQA 4YYZA 4DLLA 4YIRX 2VPTA 3OSGA 2WU8A 1KJIA 3UAOA 3K1AB 2KMLA 1OPRA 2ZUCA 4QVKA 3ILHA 4D9BA 1B6SA 2Q5IA 1NSTA 1O03A 2ZUEA 1NSFA 4LZPA 2FX5A 4EO7A 1X7DA 5SV2A 3E7LA 2BBYA 3H8VA 4WCDA 2HEGA 3QYEA 3LHIA 3KFVA 2QRNA 4GOOD 3SIRA 2W6JD 2WAQN 2BKUA 3C4VA 4LDAA 2SKCA 3OSUA 2PPLA 3X1KA 5LXTF 4PC2A 5FO0A 3ZCQA 3AL2A 4NS1A 4CW7A 5JMPA 5KTKA 1GKLA 2ZIFA 3GLGA 4L78A 5LZ4A 1HW2A 4GMXA 2ZXFA 4HO1X 4EYKA 3TAXA 5LP1A 5CEJA 4M7PA 1KU3A 1NBMA 1NX9A 2FUEA 4RQTA 4X5OA 1G8MA 3AY7A 2J3IA 1CF7B 4F5YA 4FC7A 1F9NA 4KT5C 2WD8A 2J9ZB 3SDZA 2O8EB 4B8YA 4ZVMA 4AK9A 3DMPA 3KQHA 2JJYA 1KYZA 1QZUA 1N0IA 4RMJA 3C3DA 4EI8A 2I3ZA 2K4JA 1ODKA 4M88A 5HUJA 3E3NA 2OESA 3K6SA 2O2JA 4MITA 2C42A 2O2GA 3AB8A 4LZNA 2ZXHA 2Y48A 4NVRA 1W36D 1QO0A 3TFOA 1HKTA 2IIVA 5EJCA 4KO1S 4GNRA 5J2UF 3CURA 3E9NA 3BWEA 1D09A 3ANYB 5KWJA 1H4QA 2WZDA 1V1MA 4K0KB 4HP8A 2WNIA 3BXEA 1ZX1A 1XWIA 4MRSA 1UDAA 4AIHA 1KK1A 8MHTA 4NJMA 5F9FA 3MZ8A 3DEHA 2VOEA 5HKAA 1NVFA 4I1UA 2PQ8A 4U9IS 2VHUA 2JVJA 1XVTA 1XCMA 3AV0B 2OORC 1WO8A 4X97A 2FUNB 5KVRA 1FX0B 4MEAA 5KNBD 1RHQA 1O57A 1MO4A 1WKVA 3IEPA 3UWSA 2MSCB 2HGSA 2V9VA 3F73A 4J4TA 1LQ1A 4R16A 3HPGA 2WPDD 1GLGA 2C3YA 3JR9A 2W8BA 4BGUA 1C5KA 4XR9A 1EFRA 1U3DA 1RYNA 1ZISA 2XIGA 2RGRA 3WJ2A 3RVMA 4AJ9A 4IVNA 4AWXB 2HYFA 4EVQA 1ZDMA 3NBKA 1XGKA 1I27A 1K92A 1TUGA 5IUNC 3P1JA 3IOMA 4M1ZA 2I7TA 4EL5A 3AR6A 1W0UA 2J5BA 2X0KA 4Y3OA 1KZ6A 2CEKA 2CVOA 2QTVA 5BR4A 2XMCA 3ROKA 4YJ2B 4HQRA 3SYMA 4QECA 5KTTA 4Q01A 2ADMA 2QM0A 1UZCA 5F3DA 2Q8KA 4RQUA 3TH5A 4RGRA 3UJPA 5CITA 4WUVA 1NG1A 1QVRA 3PUIA 3O93A 1OYYA 2DFLA 3WK7A 1TEXA 3H9QA 1NF8A 1UHSA 2FUCA 2P9JA 3BD8A 1UIMA 1C1DB 5BSRA 1J2TA 2ZJ8A 2APJA 1KU0A 1E5QA 1FF9A 2Z3YA 5IOYA 3V1UA 1EWYA 3BWVA 3JALA 3Q10A 2IP4A 1YS6A 1ULAA 4L85A 3OQIA 3SS7X 3OMXA 4Q7JB 3TNLA 3IVRA 4G24A 3I9V2 1T8SA 4LWOA 4D4MA 5LPNA 4HRYA 2AOXA 4PTYA 5LKAA 4G8JA 3RT1A 4EGQA 5LL6P 1UMBA 3AP3A 1BS2A 4K9PA 3KZNA 2C3PA 4HB0A 2I4NA 5IY5H 5HCNA 4HX4A 1SUDA 2DZDA 3V4SA 3CZMA 4ZXPA 1Y9AA 4ZEMA 3KP7A 2WHPB 5HDBB 2OF7A 4JT8A 3BMCB 4NL4H 1SK9A 2WUWE 1TYCA 4C2MJ 1PZGA 3T3DA 2HPIA 5K1ZA 4ENPA 1V8BA 3R7AA 2QQ8A 4R9SA 3TSZA 1NE7A 4BBAA 1RJGA 1P5RA 3VR0A 2DHQA 3BVPA 4DM7A 4H7PA 4FHZA 5HLGA 4DLAA 5JROA 4RY2A 1PT7A 4QQNA 2JIRA 3H1CA 5TY0A 1XZHA 4C6SA 3F72A 1XSDA 4JWTA 4IPTA 1RSZA 4G0NA 4BP8A 3QWIA 3A1FA 3FR8A 3K6KA 1B72A 1E3MA 2AKYA 3IMEA 3TJMA 1TU3A 4PZAA 3A1DA 4XIFA 1HMYA 2A5WA 3QV2A 4F8EA 3KSBC 3LQYA 4DA4A 5G0UA 5AIAA 3U4IA 4F96A 4GVXA 4MWGA 3Q98A 3PNOA 4MV1A 2IW5A 5DWDA 1Z07A 4LHEA 1PDOA 4L76A 1TVKA 3I2KA 3WTWC 4LOIA 1QHFA 2F5CA 4CETA 2JGKA 1W4AA 4E33A 3UMCA 4URHA 5M29A 2B6NA 4KO4S 3CLUD 3T3PB 2ONYA 1N0HA 2OGZA 1PF7E 4ND3A 1GLNA 3I1FA 3R7SA 3HHGA 4EG0A 3RVBA 3V8NA 2R7MA 3PP8A 3JQEA 1VSUA 2DERA 3M1CA 1Q22A 2HV9A 4L8LA 1AS3A 3A9VA 5J8FA 3KDAA 2XB5A 4J1NA 2IEIA 3WR5A 1UFMA 3IE1A 2Z58A 3HSRA 4G5SA 3G0HA 2OPTA 1E8DA 5GV8A 3LE8A 4KCGA 2OCYC 4WLFA 4G1EB 3IR7A 1Q0SA 1XJ5A 1R64A 4NYMR 4AMGA 4ESOA 4YYEA 2SHKA 2NVWA 4Z0PA 3TD2A 3UK1A 2PUJA 1JDBB 1QG2A 1X1DA 3CFYA 3PQ8A 4HA8A 2O7NA 5EDNA 3OPQA 6REQB 2Q2NA 4AUXA 1U2TA 4QWWA 1QKIA 4JX9A 2R92J 4Y2YA 3I9OA 2N1BA 4OOIA 5HUHA 4HN9A 3T54A 1QLJA 4H0CA 4DCJA 3BM5A 3FDFA 2IL1A 2FPUA 1U02A 2JI4A 2JK1A 3GT7A 2CXXA 4RW0A 3SF8A 3GG9A 1SCDA 2VPXA 2PANA 3C4JA 5DI3B 5I01A 1NBHA 1MW9X 2PUBA 5HRAA 1N6RA 5FR2A 3P0JA 4BNIA 5AESA 5CA1B 2O14A 1NQTA 4KFUA 1T0UA 5KTYA 2IGTA 3L2QA 4DV0B 4M3BA 2DMTA 1E6WA 1WRBA 3PJDA 3ROTA 2VNHA 1MDFA 4HLYA 2DWUA 2BONA 2D0IA 4ILEA 1VYUA 4FD2A 3DBHB 1K1EA 1ZMRA 3CD6I 1L7XA 1RDFA 4HZUA 4WCGA 3HWSA 2XMDA 5EPEA 1PG0A 1HE5A 3L0DA 3ROUA 3I9NA 4IIGA 3GP8A 3IDSA 4FYWA 2WZBA 5DLPA 2DPMA 4LF5B 2BHSA 3E3MA 1CS0A 5EP3A 3S2WA 1X7WA 2QENA 4ZGGA 1B74A 5C8XA 2HLPA 3DF9A 2NP6A 2FFQA 4GI2A 1O7JA 1DX6A 1NOKA 4JCCA 2YUIA 1QGDA 5DM6F 3K8OE 4RGUA 4Q3NA 3KZKA 3BILA 4M9RA 4K2AA 1IOWA 4A2UA 1FJLA 1NZJA 3RKQA 2ONCA 3L1UA 4ZZIA 1M74A 4HADA 1F12A 4HTAA 1MXHA 4BIMA 4PYRA 2PUTA 3GUCA 3QE4A 3BG3A 1NZDA 2OUKA 2VL8A 3LCUA 3DOEA 1Y1PA 3BROA 1SWVA 2DA6A 4C6HA 4WFJA 5SYNA 2PKCA 3B36A 3NLLA 3E1SA 2JZNA 4OH7A 3J7YJ 4NBWA 4BVFA 5I8WA 1ZH0A 2R48A 3P96A 4M74A 2V3CC 4GPEA 4LWQA 4NULA 1U2DC 4TROA 3RRMA 2D1RA 3ZK8A 2UZAA 2HHJA 1LLUA 1H0RA 2WP8J 3TF5A 1HMPA 3JQDA 4PCVA 4NAHA 1W25A 2DFVA 3OSFA 1BKYA 3V6LA 4B3MB 1ES9A 4AP6A 5ANRB 5EL0A 3PE4A 4FT8A 2GUWA 5FTNA 4RKRA 3ZK7A 4AVPA 2IXBA 3RT7A 2EJCA 3FFWA 3BFXA 4PR0A 1ZH4A 4O2RA 3CJRB 3VPBA 3E5NA 4J0EA 1J9ZA 1MO2A 5G40A 3W7BA 1XTAA 2WG0A 4KXVA 1CUYA 3OIDA 1WP4A 3C18A 3DQPA 3LBIA 4EKDA 4H7JA 4V0SA 4UNNA 1QQ6A 1QUFA 1W48A 4CKBA 2STTA 1VHTA 4HW0A 2H2WA 2ZAGA 4CEHA 3AESA 1G20B 1I7DA 4PYOA 2ID8A 2V0GA 1FDUA 1B41A 2ZRMA 1VQMI 4Y2VA 1NIJA 2G08A 4BY7J 2CMHA 4J7XA 1UBJS 3AKEA 4Y2PA 4ERXA 3OKPA 2A84A 3T4PA 2Q9UA 7ABPA 2WVHA 1Y9ZA 2HM7A 2FPIB 1RKWA 1MT0A 1DJOA 5FTJA 2PUEA 3JRAA 3AVOA 2EIKH 4CKYA 3G6WA 5H59A 1E7QA 5ISMA 4U6NA 3AUSA 3MWMA 2C1ZA 2GRUA 4ZO8A 3CLVA 4QGFA 3JAWA 2ECKA 3VSLA 5EFOA 3PQEA 3V8KA 4KNWA 1RMTA 1ZGJA 3BXPA 1U9NA 4EOGA 3ONQA 1Z4NA 1ZA2A 3IXLA 2COKA 3BTLA 3MWEA 3SIPA 2VKHA 1Z13A 4DT1B 1RXSA 2I4TA 1EV7A 3CKYA 4WZAB 1VL8A 1V9CA 2CQQA 3NS7A 3EIXA 1SCKA 2KW5A 3F46A 4A10A 2XHZA 2J7KA 1N5LA 5EJMA 3F3MA 1MHTA 2ALJA 2C20A 1JE8A 2QVLA 3W2GA 3NHKA 2V5UA 1GT0C 5ERYA 4RD0A 5DASA 4DR3B 4ISCA 5FULA 4WKPA 3V00A 3V8QA 3HOVJ 4ZIRA 4JP5A 5FTLA 3M9LA 4Z8YA 5KQPA 4GO1A 1OT3A 1Q3KA 4KLNA 1E3SA 1L1FA 4CKCA 1KQFA 3VR6A 5IVPA 5ITWA 3AEZA 3EDQA 1K6YA 4JQSA 1FOWA 4BC0A 3JQBC 3OETA 2PQ2A 3OAAA 3R5KA 2A0KA 3OYIA 2WV1A 2BFBB 4XOPA 4JJEA 1DQPA 3OIPA 4PZ9A 1GKKA 3PQ2A 2QQFA 3BXHA 3L9WA 2QZZA 3AHDA 2F7SA 2ZO4A 3FOFC 1R1DA 4DDTA 1IIBA 2AWOA 3L7BA 1CJCA 3L4EA 3LVRE 5EE9A 4PX3A 2IH5A 2X0NA 3N70A 3OQ6A 2HXOA 1Q1GA 5LHGA 3QTBA 2Y0SN 4MW6A 3L1IA 3HKZN 4V0OA 1EUQA 1XZMA 1BN5A 3LFKA 1I30A 5B1DA 2HB6A 3BMOB 3QXXA 1R3UA 3NNDA 2J0VA 1WDTA 1FYWA 1SXHA 2EFWA 5LB2A 1YB1A 2CO5A 3J7AO 1CP3A 2GRJA 3G9TA 4TUYB 1D5CA 3OOPA 4LFUA 1JTYA 3DTVB 2OHGA 5TQ0B 5PGMA 3WWYA 4W9MC 3QGMA 2IY7A 4QYTA 3D6HA 2C84A 3LK7A 1YUBA 3CC2I 3GA7A 1BJZA 4BDYA 4ZVSA 4BQPA 1HNNA 1KWGA 2JAPA 5INTA 2OVBA 3N59A 1S72I 1S01A 2FWBA 4OLBA 5C7YA 4U0KA 1J75A 1P4JA 1L4BA 3FPCA 4UHFA 1IY0A 2EV6A 2ZM5A 1F9EA 4EG8A 3G71I 1T5IA 2AEJA 4YMVA 1Z15A 3C5WP 5JSUA 4AX8A 3FXMA 3PA8A 4LXTA 1SQ6A 2H1RA 3B2EA 1VHWA 3PQDA 2JKYA 2ZZMA 3RU9A 1WCMJ 4M7RA 4DC0A 4DG8A 4NJEA 2B5OA 4US0R 5REQA 3VTKA 2G71A 3BWCA 3ORYA 2XGDA 4MLPA 4MS4A 3PUFA 4MIKA 2O19A 2BY3A 2Y71A 1USGA 3BWYA 3P4UA 4EGJA 2OC4A 2OOKA 3KJFA 2QHXA 3WGOA 4RJ2A 2PWZA 4K8RB 3QKSA 4TTRA 3E8SA 3HDTA 4Q7LA 2Z5LA 3SNHA 3CLTC 3LZDA 3NBYC 3P0HA 4I66A 4QO8A 1TEVA 1IZYA 3LAJA 4CV1A 1EBBA 3FSGA 3T1QA 2TCTA 2PX0A 4F4JA 3O03A 4OYYA 2C7PA 1MV8A 4O2AF 5H1YA 2CHFA 2ZATA 3FNEA 4GPZA 2GBYA 1DFHA 4HB3A 4EY5A 4LHSA 5DYIA 1IQ0A 4IHWA 3IDZA 5JASA 4JAVC 4JCOA 4U00A 5JXHA 3PDIA 5I7WA 1FLDA 4H6VA 1XU9A 5IYZF 5CVVA 3HKBA 4JUDX 1NMZA 2H8KA 2QL9A 4ROTA 4ZAVA 3U4CA 2CXRA 4XMYA 4IOKA 3I9FA 1GZDA 3HPQA 3E5QA 2VJCA 5KX5F 3M1AA 2IU0A 1KDYA 1C0IA 1T5TA 3AKCA 5DK4A 3BC1A 2VODA 1LPPA 3TSAA 1ZK1A 4LF8B 5E4JA 1XVIA 5B1EA 1FBQA 1J0BA 2W7NA 4PLZA 1NNEA 5E4YA 1WXIA 4KI7A 1ZYUA 1TUEA 1BO6A 5I8ZA 4XJSA 5AVXA 3A4IA 1P80A 3RVJA 2YRXA 3TUJC 2AXTC 1PE0A 4RD2A 1NXTA 3R7WA 1LQTA 3TQSA 4BNMA 1WULS 3ZBTA 5KNCA 1A4IA 1VFCA 3RWOA 1VCMA 2DW4A 3PR2B 2ZS8A 3T9EA 4E13A 4XX0B 2IS4A 4PO3X 1Z35A 4KREA 2A0FA 5ADHA 1FTZA 2MG4A 1W7PD 5COQA 2B8WA 5EMKA 3ZE1B 1KMCA 1NUTA 1EAYA 2GXSA 4OVKA 2FXAA 2OY0A 2P9CA 4LNHA 1V4BA 4MQBA 4FGWA 2Y0PA 4PEVA 4A3GJ 4EHLA 3F6PA 1G3WA 4FHGA 3MCZA 4GQIA 3N8GA 1ZW1A 2PUCA 4UVCA 1T56A 5DSXA 2YRFA 4C4OA 1BC7C 1I6WA 4CM7A 5B2EA 2C83A 1P2VA 1QF7A 4G5XA 1Z1DA 3FIWA 4CMIB 3EY4A 1JH9A 5E79C 1ZAYA 2OVFA 4G4SP 2HOQA 2IKQA 3IT1A 1OGIA 3OE1A 2QT1A 4XYLA 5EJ6A 3SFVA 1JMKC 4X8OA 3CC7I 4E1BA 5F08A 1ICIA 2GJ8A 3B02A 1QYVA 1YB5A 3QLJA 3WA6A 1QRUA 1DJPA 1QM5A 2F1OA 2ZJPF 1VOTA 1QQBA 3TX6A 1KF0A 5L3QA 3A58B 2KJQA 1MVLA 2XKOA 2QMQA 2Z5VA 3ASVA 3ZGVA 4OQXA 2I55A 1Z0FA 3D02A 2B4TO 4P7GA 1FRNA 1PUFB 2ZT7A 2CT8A 2Z2JA 1W0KA 2BOVA 3TG2A 3UAYA 4XRRA 5EMHA 2WJ4A 3CKKA 4PHGA 4FX4A 3OE5A 4HRXA 1EEXB 3M8EA 4QFMA 3I8SA 3CUUA 1H6AA 3WLHA 3MJ4A 3EXIB 3GPDG 3K4CA 4OATA 2UYHA 2COUA 2ZNZA 2EA4A 3AUKA 3GRPA 2QD1A 4HQOA 1VE7A 2QM8A 1UADA 3PEVA 4HPXB 4GR5A 4A5OA 2VC2B 3QE3A 4DBLC 1PNRA 3F6BX 2PCLA 3B9PA 5H83A 3H19A 3A6PC 4GM1A 1ZZEA 2J4DA 4HHEA 4AB1A 6PAXA 5E3MA 4YASA 4BHBA 5F4BA 3BMQB 3TKYA 1T91A 5B5EC 5KZMB 4QBIA 1FFXA 1P44A 1QAMA 3BTJA 3QPHA 1R0RE 3KHKA 1RYDA 2WIAA 1R5HA 1I51A 3OZWA 4J16C 4BV3A 5K0CA 3ZCXA 2YW2A 1UKCA 5CT9A 2BI7A 4AJLA 1E66A 1G7SA 1RI2A 2LCIA 3CW8X 5KYYA 5KOHA 4ZYYA 4NMHA 1MPTA 2BBTA 1M0TA 5AI4A 1D0ZA 2DLDA 1JTXA 3BUSA 3WZLA 4JC8A 3U13A 2RHRA 3KWMA 3LBHA 4E4RA 4D9HA 2XJ9A 5E8IA 2HCRA 3FKSA 2V96A 3IERA 2P75A 1VB3A 2L9SA 4GPIB 4Q1DA 4G4GA 2M7BA 4JYMA 1ULTA 3GJ7A 3ZD6A 1QH1A 2KKOA 1EK1A 3U7EB 3NTRA 2FOLA 4P4SA 5D4SA 3OCJA 4O5AA 1LX7A 1E2XA 2C2XA 2OWEA 1FFEA 3LQRA 4CMEC 4KH0A 1MOZA 1J97A 3MT8A 5AW5A 4P32A 4YNBA 4GLBA 4L7QA 2MTBA 4HUQB 1XZGA 4PV7A 2ZIXA 3DF7A 4XIIA 3VNRA 3EASA 2V7WA 1Y1QA 4N8EA 4I7EA 3T15A 3DEYX 5D5WB 2QX4A 2IGKA 4WCFA 3UB3A 5HRCA 1TEHA 4DUPA 2NU8B 1WVMA 3CY6A 1IU9A 3VPHA 2ZUFA 2G0TA 4LXHA 2A3NA 3OIQA 1T0FA 2ET6A 3ZTYA 1GNQA 3CRRA 4URFA 1MBFA 4JKYA 4YY3B 2LLKA 1E2MA 1P7ZA 1OKRA 3RRJA 2ZSFA 4MKHA 2R1TB 2MT9A 1Z0AA 2CXPA 3B6AA 4I8IA 1ULUA 1QR6A 1L3BA 5C81A 3ZQQA 2RDPA 2H07A 4MGKR 3U40A 3VR1A 2V0NA 2RGNA 2H4ZA 1D0IA 1UWLA 1ZNZA 1UODA 1TQ4A 1K68A 3BCBA 1H88C 2QG4A 5JTTA 4PICA 5CJ2A 2PUDA 4U7FA 2CGEA 4JHLA 1H2WA 4CGZA 1SKAA 3MZYA 3SXPA 4FFBB 2Z3VA 1FE8A 3RBXA 4A3CJ 2YIMA 4FX5A 1SMYF 3MGKA 3GNQA 4PTLA 5AKHA 1J33A 2W4MA 1CV2A 1M2KA 3NBXX 4FJ2A 3FG9A 2XA2A 2R7LA 4GM0A 4B5KA 2ZBQA 1IGNA 4E5DA 3TOAA 1GUYA 4EIWA 5DV5A 3DQVC 4OK3A 4OFBA 4PVDA 4GBED 4OA5A 1SUAA 3MNFA 5EHQA 2X1MA 3NDPA 4JFRA 2M6SA 2H08A 4YIIA 1QJCA 1XEAA 2CZGA 3TLGB 4AMUA 1MJFA 2FFAA 2QRPA 5BV7A 4MI9A 4KR7A 3BR2A 4UAJA 4RMIA 2V9ZA 1R4ZA 1R6AA 1TOAA 3R4CA 4LJ5A 2O5RA 4ZAXA 1RE1A 2DH5A 1MENA 3U9GA 3E7FA 4AD8A 4MWOA 2MSNA 4RUKA 2UZ3A 2Y6UA 3RKYA 1DRVA 3EFHA 5JXIA 1Z82A 1N2CE 1W7AA 4YRFA 5CT5A 5F77A 1FVXA 3EAQA 4KBFA 1RI3A 2VDKB 4QGHA 1I5RA 4O02B 1S89A 1QFSA 1UP6A 3QPUA 3E7DA 2YXNA 3AJ8A 2V4ZA 3BH0A 2KDZA 2FPGA 5BYJA 1SXJD 1Y5LA 1IN6A 4KN7X 2V8OA 1Y7HA 3EZXA 2XKKA 4LG1A 3FF1A 1T38A 1L4GA 1GR1A 1RNLA 4UUNA 4BX2A 2GJSA 3H8SA 3DBRA 2NV2B 4PYKA 3MGAA 1R22A 3KSZO 4Q4AA 3GLTA 2WU1A 3IE0A 3LKZA 3WWEA 3DTTA 4G2NA 3BD7A 3CCYA 4XX1A 4E7HA 1JUPA 3SFIA 1J90A 4WD3A 2H4JA 2REXB 3C87A 5LYJF 1DRUA 4D3XA 4ZZLA 3IJEB 2BHYA 4YT4A 4WERA 1O77A 2JCXA 1MNEA 5AP9A 4C2UA 4FP9A 5LUBA 4PHFA 1EPUA 4Y52J 1A96A 1M54A 4LF6B 3H5LA 1YJBA 2PQ6A 3QX3A 5E8JA 1ETHA 1PDNC 1Z0DA 3SDGA 2JZYA 4W1PA 4YJ3A 2OE2A 4D5FA 2VNSA 3X1DA 3A7EA 1V55H 1MDMB 3VVMA 4TS3A 1OLUB 2UVQA 2VJMA 4B76A 4MIYA 2IDMA 2YQZA 2QUFA 5ALXA 4C1NA 2XE8A 3WSVA 3NAMA 4RWEA 4BMNA 2GKOA 3NDIA 3RRNA 3T0IA 4TX1A 1IC6A 2O2SA 3GMEA 3W78A 3VPDA 4KGDA 3S93A 3H5WA 2H6CA 2BGIA 4CIBA 2NXCA 3A9WA 3A0UA 5A4JA 4E11A 5A03A 3DEAA 3FYUB 2XXAA 5A2QZ 1W5AA 1UJ5A 1Y4SA 2P69A 2Q1XA 3OQVA 5CHEA 2QR3A 5FPTA 5EWLB 3LHDA 1HOMA 1X9GA 1U4SA 3KPVA 2B3TA 3ROQA 3LDGA 2P1DA 4DIKA 1T5SA 2AHQA 4HYTA 2EGUA 1PKXA 5FWYA 2F4OB 1NHGA 3PR1A 1JKJB 3JATB 5G4KB 4M6XA 3NUGA 1XJCA 3CUEF 4Z0TA 2PKYX 5H5JA 5GP9A 4WH0A 1OUMA 1VBMA 1T98A 1HY3A 4R8KA 2VZ9A 4UDOA 3KPYA 1HDYA 2C5HA 1Q1NA 2YSRA 1UXGA 1QMGA 5G1PA 1QYIA 1WIWA 2QLTA 5F1KA 3WRVA 2IPLA 2PVPA 4JIMA 1RFLA 1C81A 4TTJA 1Y4UA 1Q74A 2KQUA 1OWMA 2R751 3G0GA 4ZOLB 4PC1A 3HJAA 4PSDA 2P0WA 2AYZA 4K2HA 5B2ZA 3ZDZB 4K9SA 5ARCA 3ER8A 4HMPA 1YYVA 1MGTA 1GSIA 4WVFA 1NNUA 1TWAJ 2WSYB 4NWIA 3N76A 2V3WA 1ULZA 3GUYA 1VIYA 1EFTA 3V4ZA 1X70A 3PC8C 1CKEA 3M4XA 1CW2B 2F43A 3G1WA 1A72A 1XCOA 4I0AA 3TGNA 3VR5A 4R3NA 4ON0A 4C7OA 1FYVA 1P7VA 1Q12A 1E2UA 3KKMA 3FB4A 1OH5A 4HTFB 3CV3A 1Z0IA 4QSMA 3PM1A 2HF8A 3B89A 4DV4B 4Z0HO 1XZPA 4DNCA 4C21A 4YRMA 4K9NA 3P9NA 4MUBA 3EPRA 4CDRA 2V26A 3PIIA 3IYLW 1XJQA 5CVTA 5JHGB 3TW8A 4B85A 3HY4A 2RIRA 5LYJA 3TCXB 1Z26A 5GGYA 4D56A 1CT9A 2NSLA 2QQ0A 1UKYA 2PTHA 5F5LA 3ZBPA 1SVUA 1OFCX 1KEEB 2H27A 2FQWA 3ASZA 5T67A 3STYA 4EEKA 3HJFA 3DZKA 3G85A 3UK7A 4RLFA 3UTCA 4D25A 4I09A 4DV6B 1DBWA 3CJNA 1E2EA 3NTOA 4W5NA 4BE4A 1BA5A 1GXQA 4DMLA 3AHHA 1YNOA 8LDHA 2R87A 1XU7A 1NUSA 4EECA 4Q00A 3NM6B 4M9QA 1XB4A 5IKOA 1CR4A 2J6HA 4YXWD 2VN8A 3M70A 4A5SA 5CA0B 2XYQA 1X1AA 2VZLA 2EERA 3ZWOA 2FRXA 1XGMA 4WXCA 1REQB 3B1WA 1P1HA 5CXXA 1WP9A 3A26A 4FILA 3GELA 3CTPA 3GT4A 3WB0A 3CC8A 4RGXA 2HQAA 4E5KA 2OHFA 4L15A 3G2JA 3ZHOA 1L1RA 5A9SB 4BEHB 2V03A 2GAFA 3KT8A 1EFUA 5GTHC 2Q6KA 1QGOA 1RHRA 4MA0A 3NV7A 4O6VA 3CCMI 4PYJA 2PH5A 5ECWA 3JWGA 2XTMA 5D84A 4WN3A 2ZMEB 1WXGA 4YIFA 5FBWB 1U8EA 4RFVA 4B3TB 3T35A 2C8VA 4CDGA 1JR2A 4D9NA 3CCEI 3GLXA 5CH5A 2UXXA 4AX4A 1KKLA 3GFGA 4MCHA 5T3YA 4HLCA 3DFKA 3OPVA 4FHFA 5HBGA 3VNBA 2CJPA 3LNTA 3ADKA 4EUHA 5BOSB 3L6CA 2QRZA 1F5NA 1E32A 3E82A 2PSEA 4HDVA 3T1OA 2DDAA 1XS9A 4JEHA 1NW3A 5TXGA 4C76A 2Q8NA 2Y9MB 3IESA 4L0MA 4DA7A 4IX1A 4F7WA 2J46A 2HTJA 1JI0A 1D3YA 4HFJA 2JFWA 1G8AA 2BMEA 1GKUB 3C3CA 3VH3A 4M8KA 1ZNWA 1USTA 3JPWA 2BGGA 5FJJA 3J81K 1U2GA 4EB6A 4EARA 2GXGA 1RPNA 2EFGA 4J03A 5EEAA 1N0UA 3JRHA 5C5EA 1CSEE 1WQ4A 3O4VA 2VTDA 1USVA 1BFDA 4MPDA 2AK2A 4I0WB 4MUGA 1U0HC 3IBCA 1DBVO 2HO5A 3IBSA 3D2LA 4FBMA 4Z2AA 3I5AA 4DC1A 3E9MA 2XUFA 2FOKA 4ZVNA 1CLEA 3W2EA 1TK2A 1L1QA 4UEKA 2Z56A 3JWEA 2ZR0A 1EFLA 4XLHA 1Y6QA 1SVSA 4BNGA 3P32A 1U3TA 3IQFA 3UKOA 3CWZA 4TS9A 1RBYA 5AOCA 4Q7EA 4IJVA 4C4PA 1QVWA 1ECPA 2FWAA 2J3KA 2NZVG 3GOHA 3PPXA 1TAGA 3OLYA 5B57C 2PWPA 1WUHS 3RIYA 2GK6A 1YWGO 5BNZA 2I87A 5IKPA 3HU1A 3L46A 1LPQA 1VRVA 4WHMA 5AI8A 3KWLA 3MWKA 2A5JA 1T34A 5HIKA 4OHWA 2XTNA 3STTA 2YWFA 5E4TA 3FOAA 4OBXA 4R2JA 4PFQA 3UKJA 2HK8A 2M4GA 4YRCA 4Z1OA 3UY4A 1FVFA 1ECFA 1KMHB 2RHCA 4E1VA 2O3QA 3W3ZB 4JKIA 4KRYA 2NUPA 3IALA 4AZWA 7GPBA 2OSBA 1SBHA 2UU9B 3QE0A 4E7KA 2V54A 4HLUC 1OYIA 4KTVE 1JU9A 5L3EA 4UM9D 3KZIC 2QJWA 2RHTA 4KWEA 4S1TA 4H35A 5JANA 4JBHA 2PH7A 4WESA 1TA4A 1XP8A 2BUAA 3N7TA 4YJFB 2V7FA 5CAEB 2VSOA 4RANA 4G81A 1DIRA 2QVXX 3U4MA 4J0HA 3W4KA 2A5LA 2I66A 4MPJA 2OZLB 4OIFA 3S29A 4RPLA 1M5UA 2QWWA 2YTZA 3G9ZA 5KJ6A 2QQAA 1D2GA 2PYDA 4OXIA 1A35A 5ESDA 2XZPA 4TN5A 1GGVA 3PVZA 1A7AA 1WXQA 1GFZA 3TFWA 4EW3A 2ECCA 3BQYA 2VR1A 3ZYZA 2R6JA 5IZ4A 5LHHA 4XVHA 5EZSA 5CTJA 4LJLA 1YMVA 3ROEA 1KYWA 2BMAA 3KUDA 3UKGA 1AV6A 1O94D 3BDIA 1E0KA 2LTPA 3EIQA 3NC0C 3EAFA 3UGKA 4I4IA 1XSXA 1QTIA 3TQCA 3BTUA 2UYOA 3HP1A 1ZARA 1E5LA 1JKFA 5A0FA 2GUGA 2VKDA 5TJJA 2L7KA 2Q3EA 3ZZTA 3K70D 2X85A 1R8SA 1SA0B 2RGEA 2L42A 3RIXA 1FVHA 3TP3A 1U5TA 4ENNA 3ZH2A 1KMIY 3UR3C 3L7DA 5L9AA 4F2WA 2J4CA 5FX2A 4MYDA 4N39A 1GSAA 4NK4A 1TZKA 3MJFA 1LV7A 1G60A 2C5FA 4WECA 3LHKA 4MVWA 3A27A 1EDBA 5EXXA 1ZEJA 1QRYA 5JRZA 1T0PA 1RE0A 4YQEA 3N8KA 1XZJA 1Q7TA 2V55B 4RL6A 3DONA 1TJYA 5KVCA 2OBMA 3TTVA 3FLEA 1AXGA 5CCBA 3LSHA 3DPTA 3P4XA 3FFTA 2R6GA 4PU0A 1KVUA 4MR8B 4M9ZA 5J1RA 2GESA 2GNAA 4OM8A 4NMWA 5CVJA 1AK1A 2ZCUA 1OI2A 2L82A 4PCUA 2GD6A 1A8QA 4FGZA 4K6FA 1ETQA 3FOCA 3RW9A 4FNGA 4UDXX 3LMMA 1I3OA 4B40A 3NATA 4H3VA 4AZSA 3LNQA 3VV2A 4JQOA 3GFMA 3K4JA 4LX8A 3FMQA 4P9UA 4KPUB 4S04A 2WSSA 3O95A 3R4VA 2FKNA 4AF8A 4A8TA 1VP9A 1Y7TA 3UUWA 5CB0A 1W88B 3ZCPA 3NAUA 3H04A 2AN9A 5TDHA 2OXIA 4OHCA 3ENNA 1I8TA 5DCUA 4M76B 1AOYA 4WA8A 4OMFG 3ECSA 2EATA 1ZMTA 3FBTA 2O0MA 1NJ6A 3TDMA 2QU8A 2QW0X 3DU6A 3BERA 2TMYA 1A2OA 2I4IA 4H6XA 5AVZA 5JVDA 2YIVX 3G6KA 1YU6A 2K02A 3R6DA 2AJLI 1V3FA 4LCJA 2C4KA 1YR2A 3T4XA 3RS0A 4KXQA 1PLKA 3M5DA 1K7SN 1SMTA 1ZUNB 3ER9A 2Q9BA 3A1TA 1IPEA 1ZRSA 1FZPB 4ZYGA 3LW8A 2JDIA 3AYXB 3AWDA 1SHLA 4BNUA 5FFXA 2GZ3A 3TVDA 3VU9A 2XB0X 1G6OA 3IMGA 1DS6A 4GM4A 1C7ZA 3ZU2A 4PZ0A 4PS1A 3C8DA 3FDZB 5CVDA 2VUMJ 2GCOB 2Q7XA 1VRCA 5E6RB 1FUKA 3QFTA 4U7DA 2VKQA 2QE7A 3NXSA 4Y13A 1P33A 1D4ZA 4EY3A 2EYUA 4KXFB 2XAJA 1IHXA 3V4GA 3NWEA 3CT4A 1E1LA 2E1RA 3GZNB 3I0MA 3MQ2A 1F8XA 1T13A 2FPKA 4EZIA 2C9BA 4OIPF 3K2EA 1TB4A 4O33A 3FDJA 4B17A 3F3SA 3UW1A 4CQMD 1TRKA 2DUUA 1YITI 3KNZA 1SIOA 5ALJA 3PITA 4LZZA 4Q9NA 2Q4EA 1PDWA 2EZ8A 3C1OA 1XRMA 4E5SA 3NHYA 5FPSA 2HK7A 1JXAA 3K5HA 3FZQA 5HA5A 2Z99A 1BMTA 3N7UA 5AM1A 1UBKS 2FQ3A 1D9ZA 5DHPA 4ZP1A 3RTDA 4GXNA 4W1RA 1X92A 5DTEA 3IVXA 4L6CA 4EWLA 2R7KA 3HCWA 4BNTA 1AGXA 2Y0CA 2V74B 3IX7A 3MBIA 4ENKA 1UXOA 5B4VA 3UFXA 4FD3A 1KA8A 1IWPB 3GZ6A 1RU3A 3DCJA 2HRRA 3K6RA 3AZOA 1ISJA 4DKXA 1ESEA 3RH0A 5L4SA 2GZAA 1E2LA 2YJTD 1EVQA 3ZHXA 3QEMB 1RPJA 3EXHA 4OIMA 4AJNA 4G65A 3NZEA 4EJSB 4DYCA 4WZBE 4L6IA 5DRYA 5AOBA 1JJBA 1DBPA 1N9ZA 2G63A 1N34B 4GLJA 2ZUTA 2N0SA 4IZHA 1AHNA 3UG6A 3V3KA 5CFPA 2PBZA 4AC0A 3CVXA 2BY1A 4CEIB 1O95C 3WGHA 4L0DA 4UHEA 4YRIA 2FMIA 4MGYR 4Q1VA 3QUCA 4EHIA 3MMPA 2EKLA 1P4RA 1MW8X 1U28A 4UARA 2QJRA 2KLBA 1N78A 1LCIA 4CDMA 3OHPA 1SCJA 1E99A 5J2TF 4EUSA 2P7CB 4CCSA 1EA3A 3CF2A 2NACA 1TI7A 1HSZA 1OD6A 3CDLA 4JJ7A 3NARA 1H0SA 2P91A 1CVRA 4Q3CA 2RAEA 4MQ9F 5BN1A 1JHOA 1FLNA 1N2BA 1FBTA 1I0LA 4QPDA 3S81A 5AUQA 4BZQA 1U2EA 1C9MA 5DNEA 1TJPB 4J3JA 1TYEB 4P4GA 2LRDA 2HWKA 3EQZA 2WJZB 2HA6A 3DMGA 3WO1A 4UPVA 1MMAA 2EFOA 4ZAZA 4KQXA 1KYYA 2W48A 3L84A 4XQFA 2PX3A 2O8KA 1QYRA 4F9TA 5I3ZA 2HHCA 3RG8A 1VJRA 3KKOA 5F23A 1I33A 1TL7C 4AF6A 3DAOA 4HATA 4CG3A 2XD4A 1W46A 1TZCA 4CQLA 1XU4A 1A7KA 5F1JA 1I3CA 4Q6WA 4HGOA 2VHEA 2ZXJA 4QAJA 1ZWKA 4KVZA 4IUCS 2XTAA 4R8LA 1VTNC 1L0BA 3NWPA 3CO6C 4HEJA 5B3JC 1J6UA 2QGNA 4OJMX 1VIAA 3C8UA 4XQEA 4J2OA 4DGQA 3MT7A 2XAQA 4B8WA 5HTOA 4BWFB 3H2BA 3CO7C 3WRXA 4ACAA 4EA8A 2Z33A 1SNYA 3HOSA 1YB6A 1X1SA 1ZJ5A 1V5FA 4LDRA 4MYRA 3G2NA 2CYAA 2WFLB 3ERMA 3Q3SA 1WVIA 4Y1RB 1LLDA 3MS2A 4LE1A 1PO7A 1GAJA 2JZCA 4B7CA 1QXSA 3A4VA 4CL0A 4C4AA 3JQPA 3EVAA 3I0ZA 5EJ9A 3I9V1 4IXTA 4RMHA 3HOYJ 4FCVA 2LE0A 2O2YA 2ATIA 5BP7A 1W2WB 1RHMA 3ZLJA 1KFCB 2PUAA 2IGBA 1NY5A 3OZGA 3V4RA 1C30A 3F8TA 1FFBA 2DULA 5JS8A 4D5CA 1Y3HA 4M1KA 3R23A 3OO1A 1CTQA 4RF4A 3FPHA 2O4UX 1RZ3A 5JY1A 5EPUA 3TW7A 3FJ1A 1VCNA 2A5GA 1N1EA 2QUJA 1MFZA 4QVIA 4IDDA 5D51S 4EHBA 1KOGA 1H65A 2J1LA 3RTAA 2IE8A 4DLTA 2BGKA 4OHOA 4IIVA 2DBQA 1VBFA 5CVIA 3HZZA 2HEOA 1BBYA 1G4DA 4I6ZA 5J2TA 4XRGA 1T8TA 3OZCA 1I7LA 2HNAA 4Z6YA 1QBGA 4RVFA 2LWIA 2JIDA 1RXIA 3HNRA 1N0VC 2LR0A 2ZXEA 3KJQA 1MA0A 2A6HF 1NQVA 4JI5B 1ESCA 4LQLA 3SR4A 3ABOB 3R3VA 2D0PB 1OMOA 3HYCA 1J5YA 3UMSA 2JSPA 5I9BA 2HSDA 2EJTA 3U7JA 5AOVA 2CSXA 2UUZA 1H2ZA 2HBZA 1L7RA 1NMQA 5HQJA 4FFRA 3FSJX 3WKCA 3X1YA 1N4DA 1R37A 4QTRA 2DCUA 3JRXA 4DMFA 5K4HA 3T3MB 4YGXB 2ENWA 2NNYA 4MAMA 2COMA 3RC9A 1OREA 3UA3A 2INGX 4EM1A 1KZHA 3E1KA 2WT4A 3E5MA 1URPA 2AI3A 3RIHA 3FWHA 3PD1A 2H1CA 4OH1A 4KODA 4X7BA 4Q34A 4CYCB 5C1PA 1JP7A 3QVGB 2P62A 4V1CI 3DV0A 3R3YA 3BZWA 5JSFA 4EHJA 3R5TA 2R00A 1U7UA 1KAEA 1WLSA 4UHTA 3NALA 1ZL2A 2XVYA 4WNIA 2Q45A 3OFNA 4QUBA 1ZC3A 2H1FA 3JVEA 1SFOJ 2VPYA 2EX0A 2A35A 5LZ5A 3CVJA 4L16A 4ND5A 2HCFA 1P9QC 1XZNA 1B8IB 2XDQB 4XKJA 1XRSB 4XR4A 4I0BA 1MRSA 3D6FA 4J01A 3USCS 4DYQA 3A4MA 1W35A 2R25B 2CLFB 3W6UA 3T5TA 1J56A 1KDTA 4KMSA 5CFRA 1N5IA 5DV9A 3D3KA 3IA7A 4YRSA 4A0ZA 2VJ4A 4KSCA 1RKUA 3TM5A 2OOSA 2ZCVA 3D5LA 3P2IA 4NICA 1ZGHA 4LK1F 2OYSA 1F7UA 3H13A 4YLYA 3P19A 2F48A 1CHDA 4LHYA 1E6LA 4JJ4A 2IXEA 4K3VA 4ER5A 1YZUA 3QVJA 2KMUA 4AF7A 2X3YA 4UUOA 5M7EA 2RHHA 4ZZ2A 3OG9A 3PUJA 1IUFA 2G09A 4HBGA 2H06A 4W9NC 1XD7A 4OYRA 3DKRA 3WHCA 4HNHA 2HJGA 1ONNA 4WJLA 1E89A 3TYXA 4BLOA 3KSAC 1HE3A 3EFEA 3KE2A 3ILYA 1N7IA 2WYOA 3JAMA 2IT0A 3PJEA 5BN4A 3DL0A 1U8RA 1RWXA 1QTQA 5LQJA 1Z5OA 3TJRA 4G7ZF 3VMFA 1UKBA 2DI3A 4LJ9A 2PR2A 1X4OA 3CWQA 1RKXA 1NX6A 1W5EA 3TDZC 5B7QA 1QH8A 1YJQA 3S1RJ 1QR2A 4FS3A 2RGVA 4KQMA 4H18A 2M34A 1Z2CA 2J59A 5TV2A 2C4MA 1SIWA 4I3GA 2P8TA 1F8UA 1VQ9I 1BOAA 3JQ8A 2A5FA 5KTPA 1GCGA 4NF2A 4M6WB 3ZQJA 3IP5A 4ALNA 5B2FA 4X1KA 1JGSA 1R4MB 2L5QA 1M3SA 1U2PA 1U7HA 1OF1A 1CC1S 1PJZA 2H48A 4EJ6A 3VNUA 5JBIA 2LCQA 3W8DA 2O5CA 4J0GA 3S3MA 4CPDA 3LAPA 2ZU0C 2WC2A 3MN2A 1DU0A 4MCAA 3Q0VA 4AG6A 1BGXT 1JYSA 4QXOA 5JI3E 4H1HA 5KJFA 3AO0B 3BA6A 2CFIA 4Q3LA 3FAZA 4V0ME 3NHFA 1UUFA 4V3BA 1MMSA 4L2IB 1JSZA 2GF0A 4B81A 1VI5A 4CU2A 1XI2A 4M2LA 3T7TA 3IQGX 2PKWA 3ZQKA 4KR3A 4C0SA 4TMFA 5B7NA 5BSEA 2HMVA 3ICCA 1TKRA 2FVYA 3AU9A 4DLUA 4DADA 1ORKA 1KQPA 2GR9A 2AMFA 3E61A 2HGZA 4M1QA 3NONA 4BLUA 3GEIA 3TQOA 3BREA 3JS5A 2RFLA 5EKXA 3Q6IA 3JD0A 1ONOA 2FZGA 3W2VA 4WOBA 1PQPA 2OD2A 2C7RA 1VGQA 1E20A 2HIHA 5JBQA 3H3FA 2OORA 3EGIA 1PHRA 2GN9A 2AX4A 3OJCA 3LQ2A 5G1NA 2I03A 2R5ZA 3KOZA 2I3DA 1AV7A 1CEQA 1Y1VJ 4HDSA 1GQ2A 3MTJA 3R8FA 2XGJA 4OI2A 1USWA 1HT2E 2JLUA 4YCDA 3ONDA 3S14J 1IZ9A 5IC5A 3ZVMA 4L9WA 1YFHA 4EF4A 3QFFA 1WMAA 3L18A 1FP2A 1F5SA 2BHLA 5DGDA 3U37A 3MJRA 3FNIA 3H1GA 1JR3D 5ADWA 5M04A 3P2MA 3A10A 3PWSA 1V3TA 4X62B 2RDMA 4ZVLA 3HB5X 5H3LA 2HQ5A 2MINA 3JVUA 3V9PA 3ZQ4A 2HF2A 1KO7A 2GQQA 3KE9A 1YC2A 3L8FA 5F2OA 2QPLA 1H8ED 2BXZA 4H1WA 4HK4A 4MDEA 4MR7A 3CNEA 3R09A 4WI1A 3U0VA 1W76A 2E71A 2X13A 4M0CA 4S12A 5J4KA 4CE6A 3D4NA 4EF5A 3DDWA 2B5WA 5F04A 3VODA 3FCUB 3T3GA 2NOGA 2XASA 2BDTA 3I37X 4DNQA 5IJ0A 1TC2A 2YWRA 1RI7A 3O1LA 2XUGA 4CWAA 1XTPA 4BVHA 1KSJA 5CBPB 4KUGA 2B2NA 3PC6A 4PZYA 4FONA 3ELYA 3GLIE 2XF2A 4Q47A 5J9FA 3FXRA 1LTKA 1G5PA 3I9V6 4I81A 3L40A 4FGLA 3I72A 1DV1A 3ENVA 1OXTA 3MOIA 4MH0R 2E85A 4O0MA 3HMQA 3A6HA 1Z91A 4YREA 4YLGA 3ITNA 4AZ3A 3GRCA 2HLNA 1EB9A 1SD7A 1W5BA 9LDTA 4IDHA 1KRHA 2VCEA 3JQ9A 1E7WA 4PGMA 1EX7A 2B5VA 1Q6YA 5HF8A 4AUEA 5C0OE 5A7GA 3KWFA 1SOAA 4IFTA 5DNDA 3ZUPA 4XRFA 4M83A 2RGBA 1RYBA 4K28A 4ZTBA 5IP6A 4HNGA 4JLNA 5JFOA 3F78A 5A4AA 3OX3A 1YRHA 2P9EA 3G0IA 4P58A 3K1ZA 4D8WA 3QP6A 1JJFA 3KR2A 2R5WA 2A1UB 2H0QA 1DELA 2CUJA 3G0OA 3H9BA 3KYCA 1XDBA 1M6VB 3CNOA 1Y80A 1ZVKA 4F9GA 1JDBC 4XCXA 2ERXA 2XI4A 2O3SA 3OJOA 1MNQA 2FN8A 2C2YA 4L9NA 1ILEA 1C8LA 2C0CA 1IBKB 2JIZD 5C7IO 1IAVA 2D2IA 2C4WA 5FPHA 4H27A 1OGJA 4O25A 3KKLA 3IH5A 1TO1E 1TYBE 1GADO 2X9NA 4GP9A 4FFMA 1WSAA 1RJ9B 1GYPA 1D2CA 1XMOB 1NVKA 2XUAA 2QROA 3M6VA 1IF1A 1Y4DE 4EBFA 3DKIA 2DAPA 5EUQB 2WVJA 4IJMA 5CJ9A 1LEHA 2JWTA 2ONJA 1XTTA 4J0FA 2ZTHA 1LGYA 1BSVA 4GECA 2AXEA 3KIOA 1KFBB 5CK4A 2G06A 4ZT7A 3LOUA 3RTEA 2Z04A 1HRKA 1XMSA 5FWXA 2CVZA 4D3YA 4QTUB 4OA8A 2WFMA 4JJFA 5C18A 5LZ8A 1P6QA 3F5MA 5CYGA 1F1ZA 2EW2A 1I2MA 3DMDA 1XRPA 2E2IJ 3L7LA 3CWCA 4ECEA 2ECPA 4MHSA 4X71A 2MR6A 1KZYC 4UHKA 2RC5A 2OPHA 3TDNA 4AZ0B 2DFIA 4YO8A 3IHUA 3LIIA 4JYCA 3PUBA 5AI9A 1ISPA 2ZUUA 3BD6A 2D3WA 5CDUA 2JH3A 1VECA 3TZBA 1T25A 4M54A 4OMDA 4A4DA 3WTXC 3DKVA 3MEQA 3O8GA 2WOJA 3ZQ6A 3O8QA 4X65B 1V1RB 5B7PA 5IKEA 1YS4A 5EQFA 3W2FA 2QSHX 3IBFA 2VQHA 3R8XA 4MKXA 3MF4A 1KP3A 2CDBA 3JU3A 1QGAA 3VI4B 3AG6A 5HXAA 4JQYA 5AKYA 1IC8A 2PLNA 4RULA 3KU4A 1O58A 3P9PA 3QPCA 2BM9A 4XUCA 1ETKA 1GRQA 1L2TA 3TS1A 1GQYA 1JIXA 1GNVA 2HSGA 4CM8B 2QYHA 4KQCA 2NZWA 3GD7A 2BCEA 3W8FA 1IEXA 1U3WA 4LA4A 1T4BA 2E1MB 1KA9H 2IDZA 4Z51A 1XALA 5I48A 4C78A 1HOTA 2H09A 1AGPA 1SVNA 1N7JA 4R3UC 1R88A 3THWB 3GP3A 3BGWA 4DSZA 3FOEC 1X13A 3OZFA 4N18A 1QPMA 4LWPA 1P1IA 3QLUC 2HYGD 1A95A 4RK4A 4D8XA 2OZPA 2FZVA 3VB2A 2EC5A 4PK4A 2VXOA 5DMXA 3GTJJ 2Q2EA 2YN2A 4QGAA 2KIQA 1BR4A 1C7EA 1XPOA 2X8JB 1K89A 1CFJA 3WYFA 3B70A 3HFSA 3KXDA 1HYBA 2YR2A 3BBLA 3MPOA 5DNWA 5A4FS 4KIGA 4LVUA 2GSDA 3K72B 3OJLA 3WODF 2UUPA 3L05A 1BXRA 4MW5A 3UK0A 3V34A 2YW9A 2O23A 3DAGA 3TQFA 8GPBA 4F86A 4RA9B 3UT6A 3UGQA 5EFZA 1P18A 3FDIA 4KA4A 2QSFX 1E17A 4IGAA 4GT1A 5DM60 4QOGA 4B73A 3JQAD 4XNFA 1XD9A 3SQLA 1IV8A 3JR3A 4QPZA 1FJHA 3M81A 2OCEA 2A7QA 3PGA1 2O2IA 3OUZA 2ES4A 1LSOA 2D1SA 3BTVA 4ZVTA 4M1EA 4BE7B 2QB5A 4D0LB 3BWGA 4H16A 1EIZA 4DUZB 3NCHA 1KBQA 3NV9A 1XKTA 3E6BA 1EWRA 3BEDA 2VEDA 1GL6A 4NFHA 3DOOA 3ICQB 4ZYVA 3R6TA 1U2DA 4MV6A 2R5YA 3CH5A 2VAPA 1LDNA 3GMSA 4QUGA 4PR3A 1LDYA 3ZJTA 1O5IA 2GZHA 2FJ1A 4M0PA 3C43A 1ZD5A 2CMDA 4UU0A 3EVTA 1AQIA 1R9JA 1FDTA 3JYLA 3INRA 1SRRA 2F67A 1WWKA 4TTIA 2Y1FA 1ISIA 2O5VA 3OOJA 3ASOH 1KS2A 5GPAA 2JLQA 4KLZA 3GJSA 3WGNA 2BSQA 3WHPA 3IOCA 2W37A 3HNOA 1CR2A 4ZC1A 3IQWA 1GTZA 2J5RA 2CUNA 4B6OA 2PFKA 1TAQA 1UPCA 3TKAA 1U9IA 1W8DA 1WV1A 3M8KA 5CURA 4YJ3F 2W98A 4E7IA 1YVPA 4PGGA 3AU8A 2MDTA 3O74A 3M3YJ 2WTEA 2LUOA 1JKIA 3NT5A 3LA2A 1ZJZA 1BWPA 5M3MJ 1DAKA 1OHHA 4IG4A 3TZLA 3UKDA 4LG0A 2WNSA 3GARA 4QT0A 4RLHA 1I1SA 4DXHA 1VLZA 4BIIA 1Y5NA 5TE9A 4GQBA 1IQRA 1SXJE 4UY8I 4O29A 3PT9A 4YJKA 1FIPA 1DDNA 3UB4A 4A82A 5IPFA 5HNHA 3P9ZA 1IDOA 1NMEA 1R49A 2B1QA 2VG8A 3EWAA 4PGAA 3I5YA 2O2ZA 3ED1A 4PLCA 5JMOA 4D42A 2H3HA 4TZ0A 2W6ID 2OXCA 2O0LA 1NXWA 1USIA 4F84A 3WLNA 3NMUF 1XTSA 1PV4A 1MVNA 1SEVA 2XNKA 3ICWA 2F1IA 4HLDA 3CCUI 1U80A 4OKIA 1HT0A 2FPPA 1GCUA 4FYIA 2JH8A 2J6BA 3RB8A 4P3NA 1VL5A 4BB9A 2YU3A 5CKTA 3MKZA 1W49A 4K03A 1B16A 2EQAA 2HQOA 4J91A 5LNK1 5F4ZA 3FKJA 1P1KA 3KLOA 2WTNA 1XQWA 5IDYA 3F9KA 3UXYA 4AJ4A 1SUCA 2QYOA 2NU7B 4JQCA 5ILVA 3KK0A 2Q4BA 3UMMA 4V3CA 3Q0UA 1OWOA 5LDHA 4NX2A 4OQYA 5HSGA 4XTRA 4G2TA 5DFAA 3ILVA 4RA6A 3QMWA 3PC3A 1OSNA 4AN0A 3GLFA 1PZXA 2A30A 3W6JB 2V59A 3L04A 5KPDA 2A3SA 5EI5A 3FXKA 2FW7A 1SKYE 3VOEA 2A0XA 4UATA 3UBMA 1WBJB 3RYHA 1XZBA 4K6OA 1B93A 1CNFA 4I76A 3JQBA 5EVCA 2DE0X 3WTTC 3ZQHA 3VU0A 5E7MA 3VDXA 2X1VA 1H2FA 2ODBA 2QF7A 2ETVA 1E98A 1YLFA 4Z1MA 1HT1E 4OJQA 3B60A 3SC6A 4ZJPA 3I5XA 4BO9A 5HS8A 4BJ6A 3B9BA 3LZCA 4Z5XA 2X5OA 3N2IA 4JMLA 3ZDEA 3AG5A 3HMKA 1GCOA 4YAIA 4OAYA 4P36A 4CA0A 1W1WA 1H2BA 1U63A 4ZQEA 3CQ9A 2Q2WA 4QYXA 3DB2A 3AHJA 1E2NA 2EPFA 2VZ0A 1YZNA 2NTNA 2BEVA 2F4NA 1LDDA 1PQ4A 3GQVA 3PVSA 1VHQA 5CT4A 5HR5A 2HD4A 4GXTA 5CB4F 1U78A 4TKUA 1E4OA 3LLVA 3AF0A 3GVIA 1YQ9A 3T0FA 4IHQA 3I4CA 2QMOA 5U4QA 5JYCA 3W5CA 2Y2VA 2H11A 2CZCA 1G9XA 1SHUX 1NK3P 1NN0A 1U8XX 4HGQA 3GAMA 1GARA 1LVGA 1IN8A 4M0MA 3CP2A 4YRGA 1NP7A 1XMPA 2CJWB 1MAWA 1JUMA 1K98A 4WRRA 2RH9B 1AKNA 3E3AA 2IYOA 2O06A 2Z6AA 4P2GA 1WZUA 3DR5A 2BW3A 1LVAA 5EQDA 1NRWA 4ZHQA 2DUWA 3I0NA 2WJWA 5LFAA 3F4BA 2ZRQA 3E18A 5IAKA 2V1XA 2A69F 2XCQA 4W7HA 2R7XA 2Z5GA 4NNJA 4N41A 2PL1A 2MR5A 2NG1A 5CDHA 1S7GA 2IX3A 4A6EA 1WB9A 4KQEA 1S5LC 2C3OA 3K2ZA 4LYDA 4B43A 5IEBA 1V6AA 1OX6A 2IYEA 5ESRA 4MQMA 4I5GA 3H2ZA 1EZZA 2A1TS 2SCUB 1Y81A 4J4HA 4KR6A 5E20A 2N9UA 3IILA 2WHQA 4X6YA 5FWAA 2VT2A 2QNBA 4IIDA 5CFQA 3PXUA 1NULA 1ZI9A 4JS0A 3GLVA 2HRCA 4ARAA 5IXYA 4RM2A 2HZBA 4A5NA 5EG0A 5L3CA 5E3JA 3PYXA 1NI5A 3GEHA 2HO4A 1YTLA 4B8ZA 2UXCB 1L7EA 3IURA 4I9GA 3OZIA 2XLCA 2DWOA 3JRIA 2XDAA 4Y98A 3QYFA 4JFAA 2BY0A 5I9MA 1OTYA 1WUTA 3SXYA 4DGSA 1I3MA 4PLFA 1N9GB 1JU3A 3NIDB 4MKIA 4C3ZA 3K69A 1IL0A 2C59A 5J1TB 2O8VA 4JR0A 1T24A 4A26A 4LBZA 2AI2A 3DYIA 4P53A 3LF1A 4R79A 1ZRMA 5KDOA 3ECHA 4H9GA 3JSXA 4ZU3A 3HA7A 4Z99A 4A2CA 4DWJA 2FPWA 1X2EA 3KTOA 3IP6A 1O9GA 1YZHA 3N2EA 1P60A 1ZESA 4A16A 2M3AA 2QSJA 4EY7A 1DARA 3L6DA 4NYIQ 3RLFA 3ND6A 2YZMA 2H0RA 3FHCB 3JV7A 2JLZA 4F5EA 2WE8A 2VT3A 2P0AA 4G1MB 3KV3O 1X2BA 2X7HA 4QPPA 5CB4A 4DLPA 3A6EA 1BYUA 5K8LA 3KZ1E 3NQOA 1J09A 1XVAA 2G0AA 2Y0SA 4X3CA 5ALFA 3DWLE 2DSNA 1FMTA 2PD6A 2MW8A 2VXBA 3RANA 1GVDA 3PC2A 5AUPB 4QOEA 1Z6XA 3S68A 1KL7A 2CEAA 2IP1A 4RK0A 3FMIA 4F9EA 4D9FA 3KXPA 3MSCA 2WMDA 4CU5A 4OQZA 1V25A 2XWJI 1RXYA 5BPHA 5CU7A 4WK4B 5ETJA 1DKOA 2PEZA 1L5GB 3RYFB 5JXJA 3WL8A 2DFPA 2OGSA 5DE3A 3ZV5A 1ZREA 3F3KA 3A2KA 2VXCA 3L2CA 1SZJG 1PL7A 2QSUA 2W6QA 3W5DA 1EQUA 4XK4A 5ER9A 2X2OA 2VRBA 4FN5A 1Y98A 5JSYA 2QWXA 4CNBA 2F3QA 3TLYA 3ERED 1VJ5A 4DV7B 2BPOA 3JQCA 3AG4H 4NH0A 3D5QA 1WDWB 1FW6A 3F97A 4DZPA 2EH3A 1AA7A 3AVYA 4NG4A 2PBLA 1JJVA 3T1NA 3B1VA 2JLVA 3PJGA 1OMIA 5B7GA 2G77B 5TGTA 4NCHA 3LDHA 3VTZA 3WHBA 1DP3A 1VBKA 1I2CA 1VJCA 3HFJA 4UOEA 3KHSA 2TMGA 5ALNA 4P80A 1YDGA 2O8BB 3W5SA 3SLRA 2GAOA 4BV8A 5KYXB 4XCVA 2REBA 3SEAA 1UOEA 1YONA 4UFOA 2JN6A 4ASUA 4BO0A 4MQFA 3FFBA 4KW7A 3B6MA 1ODTC 4C7VA 3OPNA 1WXWA 2ONZA 4RAZA 3HN2A 1XYGA 1C0KA 3B6EA 4RCZA 5J59A 3V7CA 5D4RA 2LF8A 4UUPA 3CONA 1OJ7A 4MV0A 5AKXA 3H97A 1Q77A 5L4LA 1TM1E 4CV3A 2O3RA 3N5KA 4YAWA 2YIDA 3UWOA 4P6VF 2PU5A 5IPAA 2ZFUA 5JNWA 5M2QA 4WV3A 1JLRA 3SSMA 3NX4A 4WOPA 4BQRA 4QJ3A 1J1UA 3IOEA 2RJNA 1N5RA 4AU1A 4DR7B 4QBGB 1DOZA 2GEJA 3PFIA 2ZYTX 1FX7A 2BRUC 1F51E 4BFZA 1HYEA 4GOXA 2HJSA 4PAQA 3HL0A 4L4XA 1VQ5I 3VC3A 3BD9A 1WD5A 3D6MA 4O2BB 2IELA 3M5PA 1E1MA 1U5BA 5AW1A 4XSHA 1R9MA 1AU7A 5C8YB 2FP3A 3PKIA 3QMVA 1N36B 4XFJA 3CBGA 2P3OA 1UT8A 1M76A 1DEOA 3U3XA 2X1LA 2XNDA 3SHQA 4L3OA 3V32A 3ESZA 2D7JA 2JFPA 121PA 3TL2A 2H1IA 2J6CA 4NOLA 1ZGZA 2DCMA 4QFBA 1V45E 4IIYA 1EX1A 3HRHA 2I4MA 5EIBD 3LT2A 2DRIA 2LNDA 3W6PA 3J7AC 4J16A 4MUIA 1DIGA 4LC9A 2IV3A 1BI1A 1IV6A 1SIUA 3ZU5A 2Y31A 1UF9A 2XA1A 3E1GA 4X7RA 1BCRB 4YMLA 1U3CA 1P17A 2AQEA 2IEKA 5JAZA 1QIJA 2ZBDA 5UKDA 1WHTB 2M87A 4HXYA 3GRKA 2NS8A 1QO9A 2UUOA 1S9DA 3TL6A 3AM4A 2JUGA 4R9VA 2A1TR 4P31A 3FF4A 5JAOA 2LD5A 2PI0A 3W9YA 4EO9A 2IEZA 5DN6A 2EZ9A 1IJWC 4FOLA 2AFHB 1B42A 2CF5A 4IXWA 4UTXA 3LIPA 1QYDA 2ZRKA 5IUKC 3SVZA 3C3EA 3STXA 4B79A 3FGZA 4CM5A 1KZ1A 2Z43A 3H7AA 1M2NA 2JZOA 4CM4A 5K9ZA 2PN1A 5F1OA 2C4NA 3NETA 5AIPA 4CMEA 5EJ5A 4LRQA 3FWEA 5BVHB 3QMPA 2LR8A 1Q7BA 5D87A 2X8AA 4IWYA 4Q1CA 5JVDF 1E0SA 3VAAA 1WABA 3BULA 3I71A 2X9QA 1EJ6A 1CQJB 3AJRA 3LMKA 7ADHA 1FW8A 3E9CA 1K8RA 3IXQA 3N2KA 2OZUA 3BN3A 3B1ZA 4GRDA 5FI0B 3AEUA 3KUXA 2FWPA 3TRDA 3R0ZA 3RVPA 2B4QA 4LOHA 3L7MA 4YWHA 4HN2A 1SKUA 2W71A 3QX9A 2IEYA 1GPAA 1HYHA 3H3ZA 5K51A 3EVCA 4LN1A 2ZULA 4LTMA 1Y42X 4YBZA 1MZVA 5J5VA 3PU6A 2YICA 4FM9A 2ZGVA 2E4YA 3DZDA 4G07A 3ZHYA 3PX7A 4BMVA 4UUBA 1Z0KA 1JT0A 1X38A 2RHOA 2FR8C 1UG0A 1ETOA 1NVVQ 3W7VA 1XVVA 1SVIA 3ZZUA 3G4SI 3A3NA 4PLYA 1ULBA 2ZB3A 1B0ZA 3P9YA 4KWIA 3QOYA 1EVKA 3HPHA 2BL4A 1II8A 1EGHA 4UTOA 4U7TB 4MVJH 4KAXA 5AI0A 4CG0A 1S6YA 3HCPA 3S5UA 1LBQA 1Y34E 4P38A 2IH4A 3L1HA 2VYQA 3V4OA 4Z6KA 4YCAA 4TXNA 3FHTA 4BFUA 3WQSB 5F0FA 1T3LA 4JGIA 1XZQA 4YMWA 4C5AA 5IT4A 3NORA 5EP1A 1IVYA 1Z2DA 2AO9A 1LZKA 3S1LA 2CVQA 2D2VA 3IBYA 2I76A 4X64B 1RQPA 1JE0A 3LI2A 1PGPA 3AFGA 3BJAA 3HDDA 1Z77A 3TW0A 1L4FA 4OK6A 4U2EA 1B15A 4ZT6A 2I71A 1RAHA 5EMMA 3F1KA 3SJZA 5H9VA 3D7LA 3WTSC 4DIQA 3FTCA 4PW0A 1Z88A 1Z6AA 5KWSA 3L00A 2P2LA 5GAEJ 2KIFA 1XK7A 2HLDD 4DIFA 2Q5EA 5AW0A 4C4ZA 4EG3A 4PYMA 2WAOA 3I0TA 2IWRA 1TQ2A 1TLHB 1GTL1 2N1MA 3PSHA 1JYEA 5IAEA 4UVGA 1J00A 1CUGA 3IWFA 5AKIA 5FOQA 1M1NB 1KOFA 1E0JA 3PVCA 4DV3B 2UZ1B 2XVAA 1IOLA 5C5DA 1LPMA 4NXNB 1P7PA 5GVRA 1ZIDA 4WGGA 2K27A 3VR2D 3WRWA 4FOPA 3DG9A 1XCJA 4MYUA 5A2QK 2O0JA 2CNLA 2ZIZA 3MUOA 1JI3A 1P77A 1L5FA 4HV4A 4V1CA 2BM8A 2BMWA 3NHZA 1L5RA 3FUCA 3RS3A 1FU7A 3RF7A 2Z3WA 3D0OA 2QEXI 1GD1O 1FEZA 4HPJB 2EFJA 5LBQA 1ETUA 5LZ2A 4RKWA 3NWSA 3O2QB 3ZGOA 2XOKA 5IU6A 5AKEA 4WNAB 2XJ4A 1JXOA 4JUBA 2QRVB 4C08A 5B36A 2WYVA 5A05A 2XROA 4QICA 4IMIB 1MZBA 4B44A 1WXDA 4XH9B 3KVRA 4KITB 1PK8A 2WVGA 4FR5A 2X7JA 4DBQA 3IUQA 2LIVA 3NRVA 3B9QA 4ZOQI 4RABA 3W90A 4XKVA 3LBYA 3PQ3A 1YE9A 4NYJR 1DXHA 4X6LA 3UQYS 3V42A 3U19A 5KEIA 2BMVA 1NQWA 3CHYA 5CW1A 2ZRBA 3TGLA 3I76A 4GYYA 4BB6A 3N39C 2YKGA 3T5MA 4KQJA 4PZLA 3DLLF 3WV5A 1RWPA 2IYZA 2PL9A 5IJWA 3N2GB 5FDFA 1REPC 1QGED 4KQHA 5FLVA 1LUJB 4NQWB 1S8OA 2AFIE 4JB0A 3WGMA 2XTJA 2G80A 4ND7A 1EFVA 3OYCA 2QGFA 2B83A 2V6EA 3IEXA 2XEDA 4F21A 2G4LA 2CW5A 3JWJA 1KI6B 2W84A 5H7XA 2ME6A 3MS7A 3QSYA 3ZLVA 4LI0A 4UMVA 4HGPA 3T34A 3JR7A 3GNLA 1DKPA 1BMFD 1L8OA 1KR5A 1XBTA 1IDN1 3HEBA 3EBOA 4MW4A 4PQEA 4BBZA 1RC8A 1QRTA 4TWJA 4QDTA 3BJEA 3ENKA 3OQMA 4HWSA 3GK3A 2E0IA 3AL0C 4B74A 5FF9A 1EBUA 2G70A 3PC8A 5LP6C 4MVXA 3R3JA 3HBLA 2B4YA 1U31A 1U1GA 1U8BA 2VSFA 1UAYA 4YJHA 2XSZA 3A70A 4LOJA 3WMGA 2R8ZA 3VZPA 1THGA 1QX4A 4RJTA 5K3DA 1KEWA 2DAOA 1DOHA 4CLRB 2M0CA 5D6FA 3ESBA 2QVOA 4L74A 5LQCA 1UKEA 1TO2E 2O54A 3Q0EA 4FISA 1RLJA 2LH9A 2ZMEC 4NU8X 3NW9A 3QJGA 1CIJA 3QEKA 1M6WA 3MMNA 4ZDLA 1SBCA 2E5ZA 3FMRA 1D1CA 4JDPA 4IQ0A