4BQNA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
SMAQRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqnA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqnA01
4BQNA 4BQOA
chains in the Genus database with same CATH superfamily
2H29A 3O9ZA 3WIDA 2X2PA 1HDIA 2HTEA 4E2XA 5F7JA 3H86A 4PEVA 2UZ1A 4LQLA 4RY9A 4TV9F 3KSZO 2FOKA 4S3MA 7REQB 3HSYA 5FHQA 1ADBA 3BG9A 1N5DA 2X0JA 1E5VA 5DXFA 3JARA 5C7OO 3BG7A 3DMFA 1F8GA 4FMCB 1U2WA 5LC1A 1Y80A 4LUCA 4JMLA 3U5ZB 3A11A 4FOOA 3WV5A 5LIRA 13PKA 2FK7A 4JLKA 1V6CA 2PNFA 2QTRA 1LA2A 5TF4A 1E1QA 5I9IA 1NF9A 1D1SA 3CLTC 3BE5A 3V8PA 1E20A 1N77A 2PGXA 2BVNA 3IRQA 1U0BB 2D2EA 3BPVA 1PS0A 3V8BA 2XKBA 4FFBA 5EHGA 2XZPA 5LWQA 4G6ZA 3QFHA 5KVRA 3V8JA 3OU6A 3IOBA 2JAWA 3ROMA 4XWYA 1USVA 5F7ZA 4OHWA 4PN7A 4G2NA 1UBTS 2C2OA 4LOIA 4UVIA 4D4JA 4TTJA 3QPCA 3OCVA 1YSCA 2OBXA 4RGXA 2CLOB 2VHZA 2J5BA 3GLHE 1REPC 3AVUA 2R7OA 3EVFA 5F4ZA 3IP5A 4LK1F 1ZMTA 1CRWG 3KDSE 3MOSA 4L4UA 2IPMA 3RYPA 1D04A 3FUWA 2MMCA 2XMQA 4EHFA 3EXG2 2BSQA 2XV1A 3F5DA 4OI1A 3TO7A 1Y4UA 3DT8A 5J2TB 3DJFA 2Y76A 5IBCA 4B73A 4QXRA 1T8UA 4LOHA 2EZLA 4W9NA 4GE0A 5C3UA 5ES4B 1B6SA 3H5VA 1TZJA 4K7JA 4L76A 4QNMA 1SJ9A 1CS0A 4WX2B 2DWUA 4C6RA 2E5ZA 3C5EA 2HR3A 1FNBA 1QDEA 4QHTA 1Y89A 2Q6LA 1PUFA 5LP6B 2WHYA 1J0CA 3QMVA 2RAUA 5JADA 2XUBA 4AN0A 2IXBA 5IKPA 5H8WA 2OLEA 2V58A 5HQ3A 4GD3Q 4YFKF 4O5VA 2YVKA 2H0AA 1NPDA 3KWJA 1LUJB 4Q9NA 1RW4A 1T43A 3TSOA 4Z2AA 4RW0A 2ZM5A 2YFKA 2BGRA 1JI0A 4MWDA 4FDMA 4MEXF 2HF7A 4JB2A 3IKVA 1RR7A 1T1GA 4E30A 3G82C 3MXOA 3OS0A 1XNQB 1M2FA 2EFJA 5FOSA 1X14A 4TXMA 1EFUA 3W3ZB 2HMWA 4LC0A 5LJIA 4OHYA 4DCGA 3N28A 3I2HA 1Z17A 1LNZA 3WIEA 4PBSA 5GP1A 2M8EA 2O48X 3MOGA 2B37A 4RVSA 4ASNA 1ECFA 4OA8A 1WUHS 1Z88A 3EMBA 3TMKA 4M0UA 2Q4RA 2EVWX 4LYJA 1KEEB 3STVA 3GPIA 5JYEA 2HT1A 5KU7A 1BE1A 3I2IA 1MAVA 2ZANA 4LJ5A 3J81k 3OF5A 3BICA 2VSFA 2OD5A 2KKOA 1ISRA 3R0XA 4O4HF 1NVBA 4JYPA 3NM5A 4XOPA 2CUKA 5E1DA 2DPMA 3WQBA 2VSOA 4MHSA 1G38A 3PFBA 2O4CA 1WCWA 2R3SA 5IC5A 4PCQA 3ILHA 2H4HA 2E7ZA 1OXMA 3T7DA 1A1SA 4TV7A 2K9QA 3ZMVA 5E8RA 1SKMA 5IVDA 3HUGB 1H8ED 5CU7A 2E21A 4JP0A 2DB3A 3AK4A 2XGSA 1RQGA 1BHSA 1KVQA 3C6MA 3ZU2A 2A5WA 2OB1A 5G2OA 3KOMA 4A0YA 4K86A 4ATNA 1CZHA 4F5DA 4PE5B 5AXCA 2XIQA 2C98A 2PDAA 3F22A 3ENNA 3ZNOA 2XB0X 3T52A 4N5IX 4IGEA 4JEIA 5DYGA 2V7QA 2OL4A 1A2QA 4AMGA 3ZIUA 4DJEC 4DMCA 3TO9A 1PV2A 2XHKA 1SURA 1EFPB 3W1EA 3BY6A 1OF1A 3TX6A 4E1VA 2WM9B 4GMKA 2QTMA 4B3JA 2HOEA 1XZFA 4DPKA 4ENMA 4L22A 2QLFA 3DZHA 1REQB 1Z0AA 2D4AA 2RBEA 2A7XA 3A6KA 4EDHA 4WOPA 4QXPA 4BGVA 4AYXA 2YXDA 3FXKA 4KBYA 4UMEA 5IU6A 5K8CA 4FQ5A 3JAMA 5DGIA 2JNWA 4TWAA 1VYVA 1S8NA 4IV5A 4Q4AA 3I5UA 1HW2A 4KSYA 4MRNA 3IUBA 5AVWA 1MJBA 5BWCA 2EP5A 4L5CA 2CWDA 4JI7B 3HQ4O 2HV8A 1NBOA 3LVQE 1XLTA 3FPEA 2D45A 3U6BA 1N7JA 1UB9A 4HN4B 3EDOA 1HRDA 3DE3X 4P93A 5K8LA 4L0ZB 3GMIA 3IPYA 1AS2A 3DAYA 3DLIA 4PYNA 4M1TA 4WE3A 4PHFA 3UQYS 1V1RB 1T4GA 3R5KA 4INZA 1MO5A 3DE7X 1OCOH 1IIRA 1V3TA 3JTHA 2OXIA 4ENQA 2PWBA 2WR8A 3K32A 4C9YA 3HXKA 3HYCA 4IDPA 2XYHA 3BZKA 1XFAA 2ZPAA 1VHWA 2KYRA 2ZSFA 3OTQA 3FJ1A 2ZAYA 4OWRB 2BVLA 5LD2C 3TIGA 1GA1A 1ODFA 2HQBA 1SELA 1YR1A 1NN5A 2PXAA 4DR4B 1EM8A 4E12A 1ETKA 2GPSA 3RS3A 3WQQA 4UUSA 1AGPA 3ED5A 4F4FA 4J9UE 1HTTA 2FPIA 4DL9A 3K6GA 2LRHA 1R6RA 3MIIA 1W25A 3UT0A 2ZJ0A 5EJ5A 1IHOA 3D7RA 3F8WA 4NOJA 2HA0A 3K6SA 1KO5A 1FMFA 3CNQS 3CRVA 3OL4A 1H2EA 1UBCA 5HIIA 5ARDA 4C1NA 3CUQC 4EJ0A 3HJHA 4KSBA 4A0SA 1KERA 2VJ4A 3BTOA 1N2CE 2HXSA 4MB6A 4RD3A 5DOZA 1YCHA 5IPAA 3LC7O 1ECPA 1AU7A 1O08A 1KYWA 2C0PA 4WJKB 1OWLA 2WSLA 2J7PD 4MGIR 1UBHS 1RSZA 2W2VA 4CLRA 5LHHA 5CDTA 2Y0PA 1UC4B 1S5PA 3KR0A 3SBDA 2LUOA 3CX4A 3HHPA 2GN8A 1B0ZA 3IH4A 1YIJI 3FLBA 1T9ZA 3IQIX 1ULZA 4TWBA 5EERA 1BW9B 3IAM6 3LT2A 2XQVA 5HJ2A 5DB4A 4HGNA 3I09A 4Z7JA 3K8OE 3NC4A 1Q17A 4HSRA 4DA6A 3FPBA 4E7KA 2EQAA 2CFTA 4X92A 5I3CA 5CX1B 3RROA 4RXTA 1KNQA 4U8HA 1QQBA 3GG9A 4I50A 1GKUB 4ZI3A 3V97A 1VJ5A 5ERIA 1BC8C 1XP5A 1MCZA 1POWA 4YMGA 4ZOLB 2P6SA 4YJGB 2J1LA 3BRQA 3WLEA 3H4TA 1D2MA 5D85A 3SJMA 3U26A 3I6IA 3I54A 3A4NA 5IYZA 5IAOA 2QLLA 2V7GA 3ESXA 1YB2A 2DBVO 4UZFA 2HU7A 3AEUA 3LY7A 1DEOA 4RPGA 4ZFNA 2VP3A 2XGXA 1NDQA 1S3SA 2VASA 5LXTA 2BM9A 2FQQA 3BKXA 5F3RA 3KPVA 4DQ2A 1QMPA 4Y3UA 1R0KA 2KISA 4HQEA 3L05A 2YZKA 2ONKA 1ACJA 4CFSA 2O8VA 4HAZA 3LYHA 4IBOA 4L3WA 4Q5IA 1J99A 4AI6A 4KWCA 1MU0A 1YITI 2EQRA 3H8WA 1ZGBA 3OT1B 2B4TO 1YBVA 2OUMA 3CCCA 1H9BA 4P5DA 3AKEA 3WTTC 2V1UA 4LF5B 3W5UA 2RJNA 3B1ZA 3GJXC 4Z1MD 3ZUPA 2FXVA 3D31A 5EXDA 1J5XA 1UQTA 5HQTA 5HP4A 3ZJVA 4RD0A 4CF6A 3K9FC 4A3KJ 3C6YA 1DP7P 2C5GA 2Y0CA 3JZIA 4E15A 4V2FA 4FHEA 5FA8A 1KZ6A 2JGJA 5A05A 3QEJA 2WM8A 2XDVA 2DR3A 2X76A 3GRFA 1P2VA 2OXFA 4L72A 2V8BA 2XOKD 2I03A 2ZI9A 3O4JA 5D8KB 4EKNB 4F5ZA 1G8MA 1AKYA 3MPOA 4NK5A 4HAOA 3VC7A 4UUOA 3CUEF 3ZGYA 2E49A 3ONQA 2C7RA 1UWVA 1IUFA 2DW4A 3NT5A 4U9UA 3MTAA 1TM5E 3GA0A 4ZQIA 4DQVA 4B31A 4LNUB 3RBXA 4IIJB 5AM3A 4BLRA 1EUDA 1MOSA 2XOXA 4OGGA 1ZOLA 2HQNA 4KLAA 4JR0A 4GICA 4JP8A 3ND7A 3S2SA 3JQFC 2F9MA 1YXMA 2WJYA 3VSDA 1WMBA 1D07A 1GP2A 1GPLA 1X1RA 4LWOA 1GO2A 3NEPX 3VHQA 5CB6A 2ZYTX 1G9TA 3TNFA 4QYSA 4DIQA 3LPCA 4HN9A 4OP2A 2OPTA 4EEKA 2D3TA 3I9LA 2HEGA 4CCJA 1UBEA 4FD3A 3OYNA 5FOQA 2G71A 3TW4A 2KHZA 4YCLA 4RACA 3PA6A 4H3HB 1MBKA 3E35A 4RAQA 5HSGA 4BFWA 3V8MA 2DJIA 2XXJA 3UOWA 1YVDA 1RM3A 4Q3BA 2UYHA 3GP8A 2CXRA 4A3GJ 5K1ZA 5FAKA 3TLKA 4UFNA 2LMDA 3ZDCA 3FMRA 2R8OA 3R7WA 4N8DA 1ZUIA 4MKZA 4J7CA 3DO8A 4KHZA 4B34A 4XSZF 1KU0A 1ETOA 1ZKGA 4TN5A 5F77A 3DEEA 1DTWB 2HU2A 4XDHA 2O06A 5JG7A 4EPVA 2RCYA 1U65A 3TQSA 5CVTA 1OVGA 3BZWA 4BN4A 3WTZA 1K7YA 1E4YA 3AI2A 3OHPA 3U4QA 2VA9A 5DM6F 4ANFA 2QN1A 3DCFA 4IUDS 1YUMA 4KXVA 4IHTA 2A1TS 1Z74A 2BP7B 1XMIA 4W5HA 3O38A 3I12A 3NTLA 1F3OA 1FTWA 1LBSA 2YVAA 2OK7A 4C3VA 3JRXA 3QE0A 3LX5A 4YXWD 3R0AA 3SYKA 3FCCA 3I04M 3IMFA 1NLUA 4WNYA 1TJ5A 1NJGA 3BQZA 2B20A 1N6LA 2XYRA 5LXTF 4IJ5A 5K0BA 1XL0A 2O14A 3LYAA 4LWPA 5FUVA 2LVSA 1RPJA 2FB9A 3QVWA 4XLLA 3UQZA 5TISC 1TA9A 1Z3YA 3VWBA 1LX7A 5AVJA 3EEOA 4PIVA 3QM1A 3N2ZB 1LPQA 1ESDA 3GGOA 1GU1A 3VKGA 1L1QA 1PDOA 1NQAO 4O0LA 1CGPA 4PZDA 1G8GA 2PGLA 1U94A 4JC5A 3EPRA 3VR3A 1RQLA 3USCS 3JAWB 3OYAA 3VISA 1U1DA 3AUUA 4YNBA 1IQ0A 1ZCJA 4DSNA 2YVUA 2BR5A 4X44A 3BULA 3B85A 4MRVA 3SY8A 4ZI7A 1X6VA 3GDHA 2B8TA 2IS1A 2VUUA 4Q3KA 3SMQA 3VYWA 3NXSA 1Z47A 5TGTA 5AM0A 3NWJA 3Q5FA 5E2IA 2YWHA 1J24A 4C2AA 1O7LA 5TQJA 2XMBA 2HO4A 1LSOA 2NZ8A 4L8GA 2ZJRF 1TF7A 4GLJA 4US2R 2LPMA 3KOZA 1ZRNA 1TVKB 3KSRA 4P4SB 4ZICA 4L8VA 1J1ZA 1IG3A 3AFMA 2YIVX 4P4LA 5I7WA 3LSMA 2C54A 5JH7F 3FSEA 4X8LA 3CRW1 4FW9A 2XWPA 1M7BA 1RPWA 5C8VA 2PH3A 1GR0A 2FPPB 3N2NA 2IUFA 4MPJA 1C0EA 4ZVRA 3GDFA 6ABPA 1OAKA 1JG1A 1J75A 1FTGA 4HTAA 4KQ1A 4RJKA 4JBGA 4G5YA 1EWTA 3RZOJ 3AI7A 1K3FA 4QPNA 1SQ0A 2HMVA 1JUSA 3PA8A 1TT5B 3AC0A 2CL6X 1IE3A 4C5AA 3NG1A 3H04A 4HDMB 3KPWA 1J2TA 5DI9A 1MXFA 4HZUA 1Y4SA 2HA3A 3PL1A 3D7SA 2AEMA 1OW3B 4XM2A 3L40A 5EYPA 1WABA 1BEUB 2WA1A 3HKEB 1EXMA 2PUDA 1ZJJA 2YMMA 1W1UA 2XDQB 1S8AA 2IXDA 3LSYA 1QTIA 3AYXB 3X2FA 3I61A 4J0DA 3GRYA 1H1LA 1C3OB 1EJ6A 3P0EA 3RKYA 2BHLA 1JLHA 2DETA 1JKPC 1CNEA 4GU5A 4YFYA 1TUGA 5GONA 4V2UA 5EWJB 1BKDR 1DCKA 3R4VA 1NK2P 2WG1A 3U7EB 2QM0A 1YRQA 1TO1E 4D79A 3EC2A 1T2UA 4O4LA 3TR0A 4U7JA 1FYWA 3KD3A 3WJ2A 3N0RA 3GEPA 4WNIA 2B9EA 2DR2A 2PQ2A 5DGCA 4DQDA 2QBYA 4ASUA 2PUVA 3RIHA 2E1MC 2REQA 3JYLA 2IH4A 5DNYB 2YASA 4FYPA 1H2BA 1MA3A 3BZBA 2CO5A 1EWQA 4G7OF 1M2OA 1K5DA 1ZN7A 1EK1A 1PJZA 3RLFA 2RH9B 3VAYA 4G36A 1JEYB 4CYCB 2R7ZJ 2O8CB 5K3EA 2KRHA 1GEGA 1L9KA 3L0DA 3KZYA 2XMGA 4LXTA 2EHDA 4ZMRA 2Q5OA 3S3TA 1C1DA 5KYWB 4EJTA 3MS2A 4S1WA 1NI4B 5DBHX 2WW8A 3P4XA 3S8PA 5L6MB 4DM3A 4ZDIA 3Q7SA 4YMVA 5G0SA 3LCVB 2W6NA 4J6FA 2CBZA 2VCHA 4E5SA 4MA0A 3BC8A 3C1UA 4AZ0A 4PJNA 2XTMA 2EFNA 3KP4A 3PVCA 5BVGB 4AJJA 1G60A 2O2HA 1RWPA 3R8XA 3U60B 4FD2A 4DXHA 2GEFA 4QGHA 3LY8A 5AUNB 1SCJA 3DZJA 1VE1A 3LCMA 4B2LA 3WKCA 2KJBA 2RGXA 2Z3VA 2Q5FA 4IHVA 3FSRA 4NONA 3KE9A 4TKVB 1HLDA 1P45A 1G20B 4EYEA 3I2YX 2X6TA 2IOHA 3KVNA 2WIAA 4M88A 3GBSA 2IIVA 3M7IA 4ETMA 2Z95A 1LC0A 5CFNA 4Q4JA 1K89A 3OEWA 3B38A 1IV8A 3NVAA 3WYAA 4G24A 2QGFA 1IY0A 3D7MA 2OLKA 3E23A 3TL4X 4MW5A 2QVBA 4PLYA 2CVOA 2J46A 3AYZB 2ET6A 3RJ5A 3CF4A 2LF8A 1ZLJA 3GUHA 4J1QA 3K31A 1KH3A 2J08A 4H3KB 1L7QA 3QXGA 4S35A 3V7UA 2BHYA 2YXBA 5EPOA 1IEVA 1JLSA 2RH8A 2ZW9A 1GCGA 1M2JA 4EV0A 3HO6A 2D06A 4K3VA 1Q1HA 2Z2ZA 4ZO4A 5FA5A 3ZWYA 5IP6A 4OHPA 3BIOA 3EAFA 4A0XA 2C42A 1N2CB 1EHYA 4RENA 2CMGA 3RPUD 1PO7A 2EW2A 5ITWA 2QKYA 2QP3A 4NQZA 5EOVA 1G8YA 1BI3A 1LDJA 1O9HA 3ULQB 1DEHA 1I0LA 1N5OX 2CSOA 2GH1A 3SM3A 1MC1A 2C9DA 5LHIA 3AETB 2CB0A 2VJ5A 3E05A 1Z33A 4ZV7A 4E5MA 3K8ZA 3ITKA 3ZDFA 2AF4C 3L7JA 4MKGA 3ERED 4Y13A 2AO9A 2A61A 2YIDA 2DUNA 4MR8A 5SY9A 4MVCA 1M8GA 1EDOA 2VHEA 5GOTA 5E1XA 4DREA 4CQMB 2N1MA 3I52A 1IEQA 2IRWA 3I1IA 4XASA 5EZSA 3WL6A 2AQ8A 3THRA 3K71B 3EG5A 4DLLA 3ZHUA 4EL0A 2IV7A 1N7IA 2V4UA 5DCLA 1JQEA 4JDUA 3PIDA 3I58A 1W2HA 4XKJA 3ZE8A 3HIFA 4A12A 3QYBA 3H2GA 1SAUA 2P7VB 4JX8A 1XMSA 4PHTA 1E3DA 1MX3A 2O05A 4G94A 2OHJA 5AP9A 2ORED 1WJGA 5CLQA 4WOCA 4UEJA 1OHHA 3B5JA 4IMIB 3NCTA 5A7HA 1AXRA 5E6SA 3UC5A 2AR7A 2XJ4A 5JCOC 4EX6A 2QMZA 4M49A 4AX4A 1R88A 2ZRHA 3EW9A 4OUDA 4I36A 3PQ8A 1C30A 1WVIA 3OX4A 1P5FA 1APBA 4GI7A 3PL8A 3SZMA 3W2FA 3KOOA 3OR1C 3IVRA 3G0BA 5EXSA 3OKCA 4OHUA 4QUEA 4BVKA 1QFMA 3C18A 1Q7CA 3M33A 4MRAA 4B4WA 1E8NA 4EGYA 1Q1AA 4MOWA 1CT9A 1KP2A 1OFGA 3QSYA 1O03A 3JQ7A 4JBYA 1U0GA 2UYQA 3CH4B 3QWBA 2H0QA 3Q5DA 2HX1A 2NXNB 1B76A 2HXYA 2HFHA 2AFIA 3ASUA 1XD8A 3S44A 4G0UA 3MTEA 2J85A 3UJCA 2QT9A 3AOGA 4YQYA 4FEAA 3KJQA 2CFRA 2BCEA 4AWXB 1QTQA 2QYTA 3SN6A 1MB2A 3DTTA 2J4DA 1T0JB 4IZHA 2GHIA 4IMJB 1L7OA 2GRJA 3BTVA 3LNCA 4KI7A 4NZOA 4TVSA 1XTAA 1XG5A 3EA5A 3UTDA 4IF4A 3N7AA 1ODIA 1KIFA 1KO8A 2AX4A 2L0KA 2D1QA 4IJ6A 2HOSA 4ML3A 2XKKA 2GZ1A 2DHRA 1FYLA 4JLNA 1AOXA 2M1ZA 4EPTA 2IU4A 1SCUA 3NYIA 2O6LA 1MNQA 1W0TA 2J4CA 5SZKB 3CW9A 1ZSNA 2HK9A 3GFQA 3J7AY 1EWYA 2FPXA 3KXLA 1OGYA 3O3OB 4ENNA 3BA6A 3KEOA 1KTIA 3D2LA 1M66A 3K9NA 3CLRC 3KZIC 4RVGA 4CUKA 2QV7A 3LDFA 4KUMA 3ISVA 5KINB 4JD5A 3PKJA 5F64A 4A3IJ 1K6EA 4Y2QA 4NV0A 3GJYA 1AO0A 3TJZA 2IX3A 4N3CA 3FXUA 5BSGA 4R7ZA 1G21E 1B73A 5EMHA 3SS7X 5C52B 2JN6A 3CMMA 1FU7A 2ZR9A 2OZVA 4UTZA 5DNWA 3AKYA 4PQEA 5E6RB 4RJTA 2C03A 4ZU3A 2NS7A 4JFRA 2Z3ZA 3CIFA 3LW7A 3H5WA 5A4FS 2G40A 3UUGA 3FUUA 3CKLA 4IGAA 1TTYA 3AJEA 4AYBN 3GO4A 1U7XA 2HADA 4IYJA 3L8GA 4E7PA 3RTCA 3CC4I 3MRXA 1BWPA 4QDOA 3EXG1 2OZUA 4Q01A 4I76A 4OPMA 4NBLA 2CXSA 3ST7A 1CR0A 5T64A 5K51A 2QZZA 1YR9A 2PL1A 1Y8QA 3OTHA 5FWYA 3RC3A 1AMNA 3IEKA 2IVZA 5AK0A 3BREA 1INLA 3CRRA 5JECA 2A57A 3EASA 4RF4A 1V45E 4UCQA 2CMPA 5L3BA 1E94E 1YB4A 4M83A 1ONSA 3FOZA 3SQLA 2Y1EA 3M6WA 2VK8A 1PNVA 4QUGA 3FCXA 4ZU6X 3HI4A 3HN7A 5E4TA 1II8B 4OGFA 1OR8A 4X1YA 1ODSA 3TD2A 2C2MA 4WERA 4AN1A 1P92A 1Q14A 2WYOA 2IXEA 4DIOA 3H11A 3VOEA 2BKLA 2BEKA 3ZMSA 2HRZA 3J81K 2H1OA 5FP0A 4D9EA 4YUZA 3GOQA 4G09A 2YOFA 3HEAA 2UVPA 3Q7PA 1AHNA 2DQ4A 2L3DA 5CM2Z 3DU5A 1EG7A 4Y18A 5DXAA 1Y3FE 4GP9A 1DCMA 3KPJA 1W30A 2QTTA 2OQ2A 2JLXA 1ETWA 4G0QA 1Y3IA 1E9RA 2Y6VA 5JE8A 2HY7A 3S1LA 4RGVA 1IHYA 3O1LA 1G8PA 3JZDA 5MFPA 3FIJA 3O21A 1PTKA 4Q4HB 1EGAA 3H2IA 3DV0B 5BQOA 2QDXA 5CM8B 2G04A 1P0FA 2CXTA 4AX8A 3ACDA 3AFGA 3DHVA 3WLJA 3JCUC 2POCA 3X1WA 2QOEA 3FVQA 3S55A 2EATA 1W4LA 4PICA 2Z8YM 2XMZA 3DBLA 4AJNA 1PYGA 1O96B 1A9PA 4Q9JA 2GN0A 2PZLA 1PT5A 2R60A 2XTZA 4FFWA 1VJRA 2WJZB 4CN8A 1ZMBA 4GBED 5F9MA 2VNHA 4AWBA 4CV2A 1YRAA 2HFJA 3DO6A 2ZP1A 2B9SA 2W83A 4ETSA 1DKUA 4JSTA 1PI3A 1RYFA 1K2VN 1OYWA 1YQTA 4H17A 2HQOA 4UDNA 1ECJA 1WSWA 1FIPA 4D43A 4EDFA 1CJSA 3U31A 4ERNA 5KC9A 1U3UA 4FXPA 5BSEA 4XD7D 3PM1A 3K4LA 3TKLA 4MV9A 2AOTA 2J5QA 1KU7A 4CFZA 2KBEA 3QKTA 4MRRA 3ZR4B 4GM0A 3KYBA 3B20A 2CUNA 5FLXA 4HGYA 4RBNA 4MGKR 2W90A 3U1VA 1PYOA 3G8AA 1FUYB 2OENG 2RDMA 1Z22A 2D2VA 1RBMA 4MVJH 2RGCA 1DPRA 5FBZA 3WIOA 1ARZA 2VS1A 4PX2A 2IXSA 3RW9A 4PLGA 3HOVJ 3WRYA 4KP7A 2GO1A 2J48A 3E81A 1CUEA 4IG9A 2FCRA 4AM3A 2WU0A 4B85A 4D9JA 2CLCX 3URKA 2BZTA 3UK7A 1KPGA 1G3YA 4HV4A 3I71A 4NCJA 2WHXA 4AC0A 4TVKA 2CHGA 3KXKA 1P4AA 4Y7CA 5ILQA 4QDZA 1ECLA 1HE8B 1KOFA 2M7AA 2XDYA 2ZSIA 4JJKA 2NOGA 4QZVA 4NPAA 2JHCA 2YOGA 3AG4H 3LOUA 2YJ3A 4ZOAA 3SHWA 4BBAA 2HMAA 5C7YA 4EJMA 1DG3A 2YN4A 4EG0A 4OIQF 3Q40A 2VUHB 4HWGA 4QBFA 5DHRA 3IMEA 2XF5A 1YIDA 2BLNA 5F76A 3PWKA 2FSPA 5DGXA 4M8KA 1NC1A 1RRPA 1JFLA 4BLVA 3I64A 1L3LA 1QS0B 1MP0A 2C2ZA 5KWVA 3RGGA 2KPMA 2P5YA 3QAHA 3A32A 2FWNA 5A6SA 4I55A 3BS4A 2CLHB 2X0IA 3BB3A 5LKAA 1YR8A 3F1KA 2V0GA 4QEZA 5T6BA 3R7AA 1YB6A 2VWPA 4BKMA 4IOMA 2IWRA 2PLAA 1NQVA 1IU9A 1SFUA 2QVXX 1E4VA 4B3SB 3I23A 1X7WB 2CLEB 4GMGA 2RKHA 2HYDA 1XA4A 4JLMA 4OREX 4G07A 3SSNA 3D81A 4ZYVA 4MUKA 2BN4A 2V6IA 2DUWA 4OYLA 3KKMA 4TMTA 4HVLA 5ITSA 5BR4A 2IZOA 5BV2P 2QN3A 4EYGA 1IUPA 3ICCA 5K7ZA 2A5JA 2Z2YA 2BGGA 5TY0A 1U3WA 1JU3A 2G9UA 2HIMA 1CQWA 3MMYB 5IJ9B 3MK31 4AVPA 1XEXB 3T34A 5CPFA 4H7FA 1RWNA 2ZNZA 2WHPB 2XUFA 2HA4A 3ZNNA 1AMOA 3K1AB 4QG7A 4DNXA 2FEAA 4FYXA 1AH2A 4BAGA 5B30A 4BO8A 1J1UA 5AKEA 1ZGCA 4HFJA 4J0EA 1Z68A 2GPBA 1CC1S 3F8TA 4KSCA 2W58A 3K9HA 5KHAA 4ZAXA 4CI0B 1TNTA 3N2KA 2W6OA 2L17A 4D6XA 4C2UA 1NUTA 4O6JA 4ZO7A 3F9RA 4PCLA 1FS5A 2NU8B 3U3XA 5AICA 1SVNA 4CIXA 2G06A 3FZYA 3ZU5A 3ITDA 4MQLA 3TIXB 2PL9A 4I2OA 2VP4A 3FCOA 4YMSA 1H93A 1UK6A 3HLYA 3O8RA 4KAFA 3A9RA 4EHLA 2QVLA 4G5SA 1SCKA 4OQ4A 3M5DA 3TSAA 4D99A 4Y2UA 3ZJ5A 5JRDS 1AQYA 1WCV1 5BNGA 2CD7A 4F46A 4YFVA 4DCVA 3IUPA 3TSCA 5DLYA 5LZ7A 3QVXA 4IDOA 3NHZA 3OLYA 1ZD4A 1XZNA 2NP6A 2H5IA 1YH3A 3OZ7A 2J67A 4U0KA 5JD6A 2YS7A 5D00A 2G3YA 4R2MA 1C7ZA 4LV5B 5GAGJ 5DO9A 3N0XA 2F8MA 4M74A 1UMKA 4ZTFA 1BOOA 3F67A 4PG8A 4CKWB 4N8EA 2PJPA 1X2BA 4MP6A 5IT9A 1XYVA 1JT6A 4ZK6A 1L4FA 1YF3A 3CBQA 2WFZA 1GUDA 1WZIA 4D8VA 3MWEB 3BPSA 5TLSA 3RS9A 4HGQA 3G0HA 1QUFA 2XUJA 3QI7A 2MJLA 1Z06A 3T38A 4WF2A 5BW8A 5DEIA 2VJQA 3I62A 4A5OA 4XRRA 2Z4TA 3LA3A 3ZHCA 5ECYA 5CTAA 4IHJA 4U7WA 5FJIA 4ZYZA 5DIZA 3PQ5A 3KBBA 4F9FA 3G6WA 1H94A 1QANA 3IAAA 2P69A 2X77A 3M7GA 4JYKA 1PRYA 4W5WA 3NDJA 3MZYA 2ADFA 1PQUA 2NIPA 1JF8A 2D3WA 4B7AA 1LDYA 1NUQA 3NKLA 2FVYA 1FJLA 2OILA 4J01A 5JASA 4KL8S 4M9ZA 1BR4A 4P84A 4TMXA 1USUA 5BPFA 3PR1A 1XLTC 4X20B 4LG0B 3IOMA 1JFVA 5BN3A 3MINA 3BTSA 4HX7A 5IT5A 3B2NA 1SOUA 5FB2A 2XYQA 2X9NA 4BFXA 2CWWA 1F1ZA 2ECFA 1RIIA 4ZCIA 3B78A 5KK1A 1E99A 5TXGA 1AQIA 3K3PA 1QYCA 3ZBTA 1ZXBA 5HS4A 2HA2A 1HNWB 1BS9A 3DOJA 5F5NA 2ZPTX 5EMMA 2CN1A 2B1GA 3FCEA 4HB4A 3AL0B 3B48A 2VUSA 3W5CA 2FWJA 3EUAA 5T57A 1R2QA 4XORA 1FTZA 1BYIA 4BASA 4G23A 3HEBA 1BR2A 4JOCA 4GDFA 4PTZA 2ZUEA 1ZK0A 1IVSA 1SN7A 2R0QC 2EHJA 1XB4A 4JVSB 2D7CA 2OG1A 3W0LB 1UXKA 4QAJA 1HE5A 3QEOA 3P0FA 4EHNA 5AXBA 5AH0A 3RM3A 2WT4A 2L42A 2R79A 5BORA 3T9FA 4J0CA 3NTRA 4RVOA 2YS9A 1PJ3A 2H94A 1HKHA 4EB6A 1PLJA 2D5AA 3QUSA 4DG9A 2AI1A 4BQFA 3NGMA 3E1GA 3PEWA 4H4DA 1V9LA 2ARKA 4EPWA 1HCRA 1JWAB 4B8XA 3V1YA 4W4TA 1GFIA 3CZPA 2IVMA 3R5JA 4WCGA 4KREA 2QZ4A 1C8KA 3C6KA 2VAPA 4EG4A 4YAOA 4EG6A 3BP8A 2F67A 5IDYA 3V4RA 1E3IA 5LR6A 3EDYA 2KJQA 3HB0A 2KRCA 5H02A 1UOOA 3KP1A 2O3TA 3AI1A 1GZHB 2P4UA 3OZXA 2CVHA 1ITYA 3ES9A 2HDOA 3HKDB 1W34A 2GAOA 4JP1A 5TX7A 3JD1A 3WWOA 3V1UA 5FQOA 2XGJA 5DP1A 1KBZA 1NQ5A 3FNRA 3CF6R 2JDIA 1X8KA 2CF5A 5A02A 4CMEA 5E3OA 1T5BA 3VR5H 2V26A 4RAFA 2ODWA 4O33A 4JVLA 5CDFE 1S7AA 3WGZA 2F43A 3NP9A 3WOVA 1SCQA 4OB8A 2VDJA 4CG2A 3HZJA 2A94A 3CPEA 2OLJA 3DDUA 2CCJA 4MI6A 1M8FA 5D51S 2I7CA 4DRYA 4ODIA 3EVZA 4YV1A 4G7ZF 2XDAA 1NVVR 1E2LA 3HXTA 3LAWA 2J31A 1OCEA 4TM8A 1PGJA 3AV0B 3D5RC 3MAGA 1XGKA 5JAIA 4IL5A 1L5OA 1UBUS 5ELLA 5TT1A 5CG1A 2FQYA 2OXCA 2LKCA 2H65A 3HBMA 1EP1B 2FSSA 2MSLA 4M0FA 3WU0A 3ZDRA 2GLXA 2AJ8A 4IHJF 3ULKA 4HXEB 1OYOA 3ZP5A 5IDQA 3DD1A 1VFCA 3B6JA 4FP9A 1QIFA 1KO1A 1RJDA 2IEBA 4ARIA 3A58B 3A4VA 4EGAA 4DA0A 4EJVA 5K6AA 5GPBA 3KSDO 1Z05A 2WUFA 1Q1EA 2WI8A 3OOHA 4BJTA 3RQSA 4XRMA 1HLPA 4AUNA 2FPKA 4LNHA 4HH3C 1VC2A 4XCQA 1RM4A 1S96A 4H6VA 3KZVA 8ATCA 3TW8B 1L5ZA 2FN9A 3S1AB 2IHBA 4LXHA 1O9BA 1SD6A 2SECE 3ZVLA 4U9HS 2QRLA 1T8IA 1K7CA 3E58A 2NUAB 2JAHA 5B1EA 4XA8A 3IALA 4XICA 2BMJA 5FWXA 5K0FA 3BRWD 5ILGA 2CJFA 3I6QA 4NQWA 3M6LA 5HTOA 4BNCA 1K8QA 1QX3A 4F4CA 4YRCA 4JOSA 1PWHA 5IM4F 1J00A 1PFKA 4HKTA 4PNZA 3SR3A 2X13A 1WQ1R 3BR5A 1K6OA 2AOWA 1ZH8A 1T9DA 2Y9YA 1EJBA 1YJNI 2P8SA 3R6SA 3IO3A 4CL3A 1LK7A 2RJ3A 3PDJA 4B7UA 4C4XA 4JA2A 2ZJQF 3UMBA 1U9IA 1YJWI 3BGIA 1ETXA 2XKOA 4YRNA 3LGXA 3TQIA 2DFVA 4F45A 1KAQA 1R5OA 4BGIA 2EFHB 4F56A 3LAJA 3RVQA 5TJHA 4U2KA 4B0OA 1Q92A 4PPGA 2CK3D 2FPOA 1TCCA 1G4UR 4CMBA 5EKSA 1VHJA 5FD8A 5KOJB 3PHJA 3GZJA 3H9QA 3OG9A 3WLMA 4H7DA 1IUOA 3QWFA 3FYTA 3AR3A 2KI5A 2VSNA 5T8KA 2GOMA 3VB2A 3LQ1A 4F52A 5CEEA 3DDCA 4ZVQA 1RQ2A 4ZAFA 2ISZA 2BF7A 5KOHA 2O0KA 3VR5D 5K8UA 4AP9A 1BHJA 1FFSA 3WWDA 2H18A 5FI3A 3GFIA 1P2BA 3KPYA 1C3EA 3RRYA 1YAJA 4RMNA 1QCZA 1A82A 2A9OA 5CH8A 3RYTC 5A3JA 4BKRA 1W88A 4RH1A 5BS6A 1Z13A 3JX9A 1TW3A 5ALSA 4JX5A 2VE9A 1ODKA 3OLWA 3Q9LA 1X1DA 1CUWA 3EJ6A 2HS5A 5CAEB 1JJFA 1O87A 3SS8A 1VQMI 2YR2A 4BL0B 3MJVA 2DCUA 4Z0PA 1SXJB 3U4IA 4QGBA 4BQIA 3JALB 4RSMA 4MTDA 3A28A 3D3KA 4M54A 4MSUA 4NYIQ 3E0QA 3P9ZA 2K4MA 2RGNA 2IY8A 2NUPB 3U5TA 1G7RA 2K87A 1YIOA 3BDDA 1QZUA 3LPDA 1YFHA 4BB0A 5JYBA 1I51A 1ULAA 3IQZA 3VKFA 1OWMA 4OHVA 3AG6A 4BDZA 1DG1G 2QX8A 4ZAGA 3HV2A 1DARA 2BOVA 5I7VA 4V0OA 3CJQA 2W2LD 4QT0A 2VC0A 1Q95A 1IN8A 4ITUA 4B4VA 4V0MA 2P2YA 1NXPA 4CTOA 1RRMA 4WXPA 4UPVA 5HF6A 5CVVA 3IMKA 3WMGA 4WINA 4W5OA 3ADOA 1LNSA 4ZDPA 3RC8A 4B6OA 3PSAA 4PLCA 3JD4A 2OV8A 2O5RA 3Q6NA 3WGUA 1R6XA 2J0EA 2DKFA 721PA 3HGQA 4D1QA 3RS8A 1UPBA 1KMQA 3CWQA 1EAMA 4F9GA 2R5WA 2R7KA 4YROA 2PJRA 3GR6A 2B8WA 4P0TA 4AIKA 1WUKS 3G2PA 4K26A 1RTTA 2Y9MB 2DJNA 4R1MA 3OQ6A 5H6QA 4CFYA 4KDEA 1AKUA 1XXHE 4RS8A 4BV9A 5FADA 2NTNA 3AKDA 4WUTA 3KLPX 2NVWA 5GAHJ 4PCVA 5AW8A 3P5BA 2YMQA 2JFPA 3QHAA 1I1NA 3JPYA 1XAIA 1JIQA 5BR1A 1SVOA 1DXHA 4QRIA 1ERDA 1ZL0A 1FFEA 4IW3B 4RKRA 1EBBA 4LFAB 3HOTA 5JRZA 3OQIA 2WY8Q 4BHPA 1PNOA 1H0KA 2DA3A 4BAYA 1MNMC 1UZCA 3G2KA 1SFKA 3FISA 4MJ3A 2JT1A 2VDRB 3BQ9A 1CUFA 2VKEA 3RYCB 2JLUA 4DT1B 1SXIA 3UYKA 1A9SA 3UJAA 2WPDD 2Y77A 2DFTA 3IE2A 2HNBA 1MX5A 4P9UA 4ESJA 2VKQA 1GTJ1 2Q49A 2XNHA 1B6GA 1TLFA 5AVZA 1UBJS 2E89A 3JQAA 3ZQ6A 5HX7A 2BY3A 3DMRA 4HQMA 4B32A 1JI8A 3GTKJ 3DPLC 4BFUA 4UNIA 4WFIA 3AIKA 3TS1A 4R69A 3L18A 5K45A 2GCOA 1FVHA 4CZ2A 1N2JA 4V19K 3A25A 2O57A 3EGDB 4AB1A 3ABOB 1GCAA 4M36A 4HWSA 2IYFA 4A3MJ 1DAIA 3NBZC 5AOBA 3PYXA 3LT4A 3FFAA 3H1AA 2IA0A 4RVFA 5GTIC 1XAJA 1JLLB 1YBFA 2LD4A 4MKRA 3PUBA 3T5MA 3CQZJ 4N03A 4BO9A 3FYUA 4PXYA 2VK1A 3IR6A 2YWFA 3OZRA 1BEZA 4MQMA 2E87A 2IITA 1L2TA 1YJ9I 4KA4A 1C4KA 2E34A 5FLYA 1ULHA 3HDVA 1KC1A 3N58A 4GR9A 3EFBA 3R7FA 2AK2A 2FRDA 1YR2A 3TZHA 3QOYA 4KBGA 2C4KA 2OQIA 4BNHA 3QX8A 1Y48E 4XSHA 1CG6A 4ILKA 4POAA 5FLMJ 5DCFA 2R5YB 4DF3A 1ESNA 3NUGA 4Q0MA 2VG8A 4LX8A 2C57A 3OWTA 1NU8A 4Y2GA 1KSJA 4ER3A 1ZM4A 2XVZA 2PMDA 2W6JA 2FE4A 5G3ZA 3EEYA 4GH5A 4PLHA 4HL6A 4JC4A 2GA2A 5D86A 3KBOA 3T7KA 1OB5A 3L0IB 1WB4A 4DMHA 1T3GA 4CXFA 3GUCA 2TMDA 3OMYA 3DTYA 3NHFA 1W4AA 1UFMA 4O2AB 1Y1LA 5ESDA 2RAPA 3M8JA 5KNCD 3G68A 3IIMA 4F72A 1FDTA 1TTHA 5FORA 2I1QA 5FPKA 4CM6A 2ZDQA 2YS6A 1Z73A 3N7TA 1P4XA 1ZW1A 3GEBA 4C7XA 3PXDA 4YA6A 3KLNA 2GFHA 4GO1A 3VC2A 5MGNA 3CT6A 2VTEA 2Y71A 4HWPA 2XB5A 3ZZ0A 1XTTA 3PVZA 3M4OJ 3B7PA 5BQXA 1F9AA 2QQAA 4CM1A 3MN1A 4M8LA 4URYR 3TYXA 2Q3HA 1RMQA 2J5RA 2ZYAA 2HBYA 3SDBA 2HHJA 5ED0A 2JIPA 4PSCA 3PO2J 4JB8A 1A9QA 3LZCA 2PLYA 1R0WA 1IM5A 1G4AE 4LG1A 3FBGA 3ICPA 4GVXA 2QZ8A 4F12A 4MO7A 3ROEA 4N4AA 3NOQA 5CJPA 4WGFA 2GMWA 5A06A 3A03A 1G1AA 3A3KA 4E03A 2V8OA 3GRRA 4U6NA 1GV0A 1XF1A 2OXRA 3PLAE 4XWOA 2ZJ7A 3BTIA 3VBEA 2EIJH 3JW8A 2BFNA 3K16A 1RJGA 3KJFA 1OFTA 1EFRA 3NHMA 3RAJA 1T4DA 1ZARA 1P7WA 3G88A 4JZYA 5BUCA 5KSWB 4FYKA 4AJEA 3S14J 4B44A 4URFA 4K8RB 1XZBA 4JUAA 1OXKB 4IKEA 2QTHA 4PN3A 1P6UA 4BNKA 3U4GA 3MB8A 1MSEC 1QG4A 1IVNA 1EWRA 3HM9A 5ER6A 4YUWA 4G6QA 1Z83A 4QOIA 3NHKA 3HEMA 5IHXA 3P19A 3M6XA 4DJTA 3ZDDA 4QBKA 3OCXA 4LF8B 2CJJA 3GVHA 2QS9A 4EIWA 1NYRA 1I5OA 1PT7A 3FCAA 3TDKA 3E3LA 3B73A 3S5UA 4I50F 3NEUA 3F4LA 1ZX1A 3GLHB 2Z58A 1TW2A 5GWXA 2BMAA 2QLNA 2W6ZA 3FRJA 3UOGA 4DDUA 4UBIA 3BR3A 1KL7A 5IYZF 1CYDA 3ZZTA 2JFWA 3WK7A 1W35A 3VPXA 3LSHA 4W6QA 2GETA 3MA0A 1X80A 1SY7A 4HDSB 4RV9A 4CCWA 3CZ4A 1U5TC 5J43A 1FVOA 4ESEA 1W36B 5HWSA 1JU4A 3LWDA 2CEAA 3K9GA 2YTZA 4N9QA 5F2KA 1KJNA 3PZRA 4D4IA 1SEUA 5EJ2A 1B42A 3LQQA 5LB2A 4JQOA 3HZRA 4WDRA 1A8HA 3A01A 4FYMA 2KDZA 1PEYA 3GFOA 3OY2A 5F5XA 1TL8A 4C0XA 3OMLA 4NY1A 7ADHA 3GRZA 1XO1A 5I7EA 4MNUA 1ZMOA 3KQLA 1KQ0A 3KE8A 2G09A 2QAIA 3D2CA 2ESRA 3EUKL 3WG9A 1XA3A 2PUAA 2EOAA 4C29A 3GUDA 1M6VA 5FUWA 3TQQA 1WV1A 4OFBA 5FNVB 2XWQA 4MYSA 4EF6A 2XRMA 4L0DA 3WL4A 1T08B 1LD3A 1DJNA 3QEBZ 5IF9A 1PT8A 5EGSA 3EIXA 2QD4A 4M22A 2OYCA 2PRKA 1ZGJA 4PC3A 1UBFA 3S2UA 1FFAA 5LA6B 3TZKA 1BR1A 1ZHFA 1UAGA 2RARA 2KMUA 1E2UA 1NMZA 4LHYA 3CUTA 2ZXJA 2DA6A 1P1FA 3NRBA 5EHQA 3OCUA 2OFOA 3DT6A 4WKCA 1LX6A 4G12A 3FDFA 3DGFC 1N5LA 3FTFA 5KB3A 1S2IA 1SVIA 2FRHA 4UE6A 3B8HA 1Y8ZA 1E1CA 3CD6I 4FS8A 5TJ9A 1IC6A 3S8EA 3BYZA 4D42A 3UGQA 4BIIA 5CA1A 1XJWA 3F0CA 2CE2X 1NR1A 3L5OA 4D92A 4MV1A 4MWEA 2VDQB 4G37A 2PKYX 1V71A 2FEXA 4WLOA 3F2VA 3JAMZ 1LQTA 3FF1A 2RFLA 3CTAA 3BCHA 1SEPA 1JS1X 1DKLA 3CVOA 3HJFA 4IHQA 3GTMJ 1OJ7A 4FISA 1QVAA 4GNRA 2P0YA 3R23A 3DEWA 1D0XA 1WPXA 1MZBA 3MVPA 3U7QA 2IKSA 1BXGB 2PBZA 4PSWA 4E94A 3JYNA 5BMOA 3NEYA 3VVCA 2ZULA 1VQ4I 2QTAA 1ADGA 1M6WA 1ZVJA 4GRAA 1OQYA 3MQ2A 4TL8A 1MMNA 3FWKA 1G6NA 1H2ZA 1UBRS 2VP6A 4TVBA 3COWA 2AHOA 3S70A 3RABA 4I7HA 3IHLA 2JI8A 2H92A 4MFDA 2VZ0A 5HVNA 4F9EA 3Q3SA 2WHQA 4TYPA 1N6IA 3L1HA 3A6JA 2JZNA 2HUPA 5IK2D 1CF2O 4HWTA 2C6YA 3VJKA 2R5NA 1MB4A 5MF6A 2JA5J 4LTNA 2HCRA 4C3OB 2O7RA 1NDUA 1E3LA 2XKJE 3Q87B 1KGSA 3MTGA 2VP5A 3MZHA 3O7MA 3RJMA 4MEYF 2C2WA 3RU7A 1NUPA 4UC0A 4DN6A 4BMPB 3VGJA 1L6IA 1Y42X 1DRUA 1CULC 1GQYA 2QMQA 4EA8A 5A6VA 1EQUA 3BWMA 2AYXA 4D57A 2ZBDA 2JUGA 1G9XA 1RHRA 5ARBA 3GAFA 2GBLA 2R86A 1BX1A 1XBTA 5J2UA 3QP6A 1OLXA 4ZYYA 2WB1A 1U0NA 4LTMA 3EZLA 1J9GA 4XK4A 4CQMD 4BVHA 3SNKA 4FB4A 3KJIA 3WB9A 2ELKA 3OIWA 3H17A 2A9QA 2WIFA 4JQFA 5JYCA 1OLOA 5K0LA 4MROA 4HADA 4GDMA 1GZ7A 4IMPA 3RI3A 4AIDA 2PUBA 4C88A 2J5PA 3C6XA 1JB1A 3DW1X 4YTEA 1Z45A 4ZOBA 1YA4A 1J0EA 3GDWA 2ECPA 3IERA 3KQTA 4V38A 3WBJA 1K7SN 1YS1X 5IABA 2CDAA 4TPKA 3CHYA 4GPAA 2GD1O 2MINA 4ZI7F 3KOXA 3BGVA 3SR4A 1QM5A 4KKVA 4ZVMA 5AK5A 1SIWA 3OUUA 1U7DA 4YRRA 1XVTA 3HA3A 3SKYA 3G2NA 1ZVMA 1W7PA 2AMJA 4QU5A 4PO3X 3LK6A 1I94B 2GLOA 1IY9A 4D9KA 5TPWB 2ACJA 4KUEA 5LDGA 5LZ8A 5FV4A 5EQFA 3PUXA 3BMCA 4JXZA 2GYYA 2V7EA 3CX6A 5HKKA 2R1UA 4G89A 3MS7A 3FJOA 1R36A 1UMCA 4HLCA 1IN7A 3D5QA 1NMYA 3QUCA 4P32A 1QZEA 1HZZA 4QLCU 2DC1A 3KV1A 5H68A 3K09A 3PUWA 1G98A 3WK5A 3G85A 4BUJA 2EZIA 1LU9A 1YACA 2GA1A 5G0VA 4V2GA 1EJ2A 1DS6A 2GAJA 1Z2NX 4L2IA 5CA1F 4M21A 5JU6A 2HKOA 1JGGA 1GUFA 2PT7A 1JMYA 4CTJA 4IIEA 3MGGA 1P9QC 4I6EA 4PZEA 1THZA 5BUSA 1A97A 2I6XA 3BGSA 3HDQA 5TB5A 4TSFD 3HDDA 4DYQA 4JI3B 4UNNA 3UT6A 1CY7A 3AVQA 2CCGA 4NVRA 1TZ2A 4UVGA 3F3SA 4M1WA 5HRCA 3GCGA 1NKSA 1PR2A 2DPDA 3MT7A 3W2IA 1E2XA 1N92A 1T5IA 4BRWA 4LXXA 3WZ2A 2FWBA 3OQHA 3MHPA 5EMKA 4J6EA 1A2BA 4FR0A 4HQKA 3BWCA 4CN9A 3TH5A 1ZZEA 5DDIP 2WWHA 1MSFC 1NNEA 2CNDA 4JQYA 2ZVQX 2BD0A 4ZT4A 1FJHA 1BQ3A 2F90A 3I4CA 4KUGA 1NRIA 3FOWA 2DPXA 2PUHA 2JVHA 2BONA 2NYVA 4GBMA 1IOWA 4E13A 2ZDHA 5GONF 1N3LA 1VBNA 2HF2A 3DXFA 4AQ7A 4NCBA 4IVQA 1QDLB 3AF4A 2DT7B 4Q3OA 2E2HJ 2NVUB 2Z56A 4IEEA 5JNTA 3QX3A 1UBSB 2R2AA 4O4LF 1JA1A 1CJCA 3RNLA 4RGBA 1K4YA 4YP6A 1UJNA 1Q0ZA 4C2MJ 1YG2A 2ASEA 3BGWA 2F3RA 4ECEA 3H8VA 3SC6A 5FD5A 2PL3A 4G8CA 3WGVA 3CVUA 3EUWA 5A04A 5JSUA 1K7AA 2PZBA 5B7NA 4RLSA 1URPA 2W4MA 1WEHA 3SIXA 3ESQA 5TT0A 2LYCA 1LPPA 5JJ5A 1WI9A 1NNLA 1TYBE 3ETGA 3N1UA 2KQUA 2IT0A 4YPVA 1OXVA 2B83A 4L6AA 3MT8A 3IAM1 3ZPXA 4BO2A 1V7PC 2V4ZA 5IUNC 3JATA 3ZX5A 4F3TA 2BR3A 4F04A 5NLLA 3ANXA 4G63A 1PWYE 2ZZKA 5J2UF 1WNTA 1ZUD1 1Y7IA 3D8RA 2QZPA 4LIUA 4N0BA 2AD5A 3A1TA 2G7ZA 3IIIA 2ZIEA 3EVDA 3T41A 4RQUA 5LQRA 1E3EA 4HP8A 4MS1A 2WKRA 3FHJA 2AFRA 3IEPA 2RQQA 1JG7A 1IAQA 4ZH4F 1PR1A 3VV2A 2X1VA 3QOXA 2XC7A 1QLWA 4BMCA 4AF6A 3NIBA 4AY4A 4PANA 2ETHA 1A76A 2P7IA 4UHBA 3M3YJ 2B1IA 4WNAA 4BXFA 5GM2A 3H5TA 3Q3GE 4ZEVA 1U2DC 4BRSA 4FT2A 3U4HA 2JGMA 4N48A 1SBCA 4GC9A 4RU1A 1FTNA 4XDYA 1PS9A 4FR2A 1JSXA 4FILA 2VQCA 3P20A 1JEJA 4WESA 2C9ZA 3A9WA 4MQFA 3EHDA 3W3AA 3TP3A 3BC1A 1JR3D 1AS3A 3HRSA 1RE1A 1JEDA 1KFKB 4MICA 5EIBC 3WKBA 2VOJA 4M7PA 3GB9A 1PZMA 3BB4A 2D5LA 2HD4A 3M1EA 4BVFA 3PC4A 3AUTA 4ZC8A 5C4IA 3I32A 3MCUA 4H27A 5BWLA 4KR2A 5A9RA 3INNA 2H8KA 1DCFA 4IWNA 1FNNA 1MFPA 3PDUA 1ISJA 1SVSA 1AX9A 2MC4A 1O6GA 3ORHA 2Q1XA 3FR8A 1EH7A 4TZ6A 1FMLA 1I30A 2FQ1A 3IJPA 2QUFA 1C7JA 4H1TA 4JHXA 2R92J 3C24A 3TGPA 1E0KA 1S2GA 1XROA 1E4EA 1A4UA 4GOOD 3FNIA 3PQ3A 2LFBA 1JDBC 4S1PA 5AUQA 1VJGA 3LECA 3D4IA 3KKNA 2IEIA 6NULA 2WUDA 5HOEA 3T3HA 2DODA 1TCBA 1Y3CE 3MTQA 1U7UA 1Y8RA 2DCMA 1EFLA 2WKSA 4XB1A 3O75A 4V0SA 3UV7A 2YC4C 3AVYA 4M4SA 3OT4A 4LFBB 5JHUA 1U0FA 1LH0A 4IJQA 4YBZA 2R4GA 1G8FA 2ZSJA 2HMTA 2OCYC 3IEUA 1HC8A 4ZT5A 3BERA 1B6RA 4ZO8A 4KT6A 4YRSA 5EKTA 2YUTA 3ZY5A 3MJHA 3S2HJ 5AR1A 5KYXA 3DAOA 5C31A 1LBQA 2QRZA 3IVGA 1FA9A 4DY4A 1DCTA 4XTCS 1PNTA 2VJYA 4GNKA 3I1YA 3D4OA 2QE6A 2NADA 1RKUA 4E3WA 2IP1A 3MMXA 2A88A 3DEIA 2ZWVA 1NSYA 1CPYA 3KLOA 4F6LA 2LG4A 4M7OA 1Z4NA 2QD3A 3WGTA 2PHZA 3OCCA 2CUJA 2QD2A 5FOTA 3GT7A 2A05A 1XMKA 1ENZA 1V37A 3DYIA 1IXKA 2EFGA 7MHTA 4RPIA 1TEZA 1YO6A 4AUEA 3TOCA 3MD2A 1Z39A 2GVNA 3LOPA 1JBKA 4AMYA 3MKYB 5T4EA 4F8EA 1U3CA 1R9JA 4L0QA 5CDUA 1XB2A 2GKGA 2AJLI 1V11A 2FPGB 4EQ6A 2BE9A 5PGMA 4JUBA 1Z29A 4ZEOA 3DLBA 4HZFA 1X2MA 2MW8A 3MSXA 3G7UA 2RVCA 3N2GA 2FW9A 4JV5B 1AS0A 4HSTA 3TTWA 3NH9A 1JWLA 3PPYA 1UOQA 1Y6IA 3IAHA 1RMTA 2QK4A 3TPFA 3OZSA 1XDDA 2H3HA 2EZ9A 2G1KA 1QGDA 3PDCA 2DMQA 3EQLF 8OHMA 3KOUA 1V3VA 3PYMA 4C1BA 1QORA 4KEAA 3W9UA 4XVHA 3GH3A 1QRAA 3ZD6A 5GAJA 1KXZA 3I30X 3EBOA 3NALA 2QPTA 1M1NA 2OZ6A 3Q9UA 3K9QO 4X1IA 5KO2A 1IQUA 3KQHA 5JFGA 2MSWA 3OI7A 3PNPA 3A3OA 3TXYA 1JSRA 2O8EB 5F51A 2XPVA 5CB0A 3GFBA 4W7SA 3ZWOA 3HTXA 4EYOA 1V96A 1C9JA 3R6DA 3R6GA 2N8GA 5CNJA 4BKUA 2OQRA 4X85A 3KCNA 2H8RA 1D8AA 1R9GA 4C7KA 4MPPA 2W8BA 2PNJA 3AR4A 3VDRA 2X1EA 4NKRA 3RWOA 4LN1A 1X9GA 1I6MA 4Z8XA 1XZGA 1B0UA 2PSJA 4UAGA 2ACEA 4N47A 1JN0A 1K7XB 2QE7A 3L93A 1CEEA 3T7IA 5H4GA 1XLUA 5G1PA 1D3AA 3OZIA 5A2QK 3OPMA 1G1MA 2Z99A 5HKOA 4YJHA 3RADC 3F3KA 1N6KA 3QIVA 1QTNA 3LHDA 2EV5A 2WPNA 4NENB 5AHRA 3UXHA 2GZHA 1N32B 4JXKA 2UXNA 4QPZA 4G4SP 1JKQC 3V33A 4FN5A 4XGNA 2YICA 1E8MA 3ZV4A 3OC0A 1NF2A 5CITA 4JBLA 1PJ4A 1RKBA 2OZLB 3WQRA 2RI0A 2XBMA 4LOJA 3AVOA 1GAJA 4IM7A 2OM2A 2V7BA 1J8DA 2OFWA 5FL7D 5EPUA 5I9TA 3ZCPA 2EH3A 3CS3A 5KYNA 4O2LA 4UXHA 4MEBA 1ZUWA 3HJUA 3BGOS 4HUTA 3ZOBA 1IRGA 3RKRA 2BHRA 2NM0A 2PKQO 3QZUA 2BJWA 4BNFA 1LF5A 3QBTA 4J94A 1ESZA 4BKQA 3OOSA 2BGJA 4J43A 3W6UA 4BU2A 4TL9A 1P3DA 5C8XA 2AG0A 2QUKA 1EE2A 4WXMA 1DQRA 2V79A 4W9NC 2I29A 3NBUA 1DBQA 1I5RA 2NO6A 4BJHB 4LOAA 2QIOA 4W99A 2RHMA 1ATZA 2I0FA 2AE1A 3G2LA 1CJKC 4PTLA 4LHZA 2ZYGA 1SVKA 2OCLA 1NR5A 4MS4B 3JWIA 2WMYA 2NGRA 4GZLA 5KS2A 1K8YB 1WPRA 2RSLA 3D8HA 1IN1A 3OURA 3JR3A 3IR5A 1AKTA 1XHEA 1R1VA 2XMRA 2W84A 4PYJA 5JBQA 3WVNA 1M1XB 5F04A 1DC3A 3ECOA 1VKOA 4ESBA 4C0LA 3L92A 4HY3A 4BTVA 1FTYA 3GRCA 2PH5A 2EX1A 3CCSI 3J80A 2WA0A 4LRUA 3O8QA 2QMOA 5M3BA 3TM4A 1WP4A 3DCNA 2O2YA 4M55A 2PD4A 3ZMDA 4IIBA 5L9AA 2JGEA 2G08A 4QTXA 1T24A 1Z9CA 1WKBA 2QN8A 3LK7A 1S7OA 2OCKA 3M82A 1JFSA 4PVCA 4EZEA 3L0SA 2AX3A 2Z6VA 3S1MJ 1M8JA 1V3FA 2GAUA 1S72I 2ZIZA 1J2XA 4N5DA 1WXXA 1ZC4A 1TCAA 1A8PA 4LVOA 4M6XA 1GGEA 1X94A 1UG0A 4YJDA 2H4FA 2YHAA 4KC0A 4MS3B 4UNQA 3PC3A 3PFGA 4LMPA 2VYND 4RJ2A 4DG8A 4P2BA 1GT0C 2K2QB 1BKSB 5F0FA 4ARZB 1QQIA 3H8JA 4F6RB 2I2DA 3HKBA 4L95C 3RSLA 1OGJA 2V65A 3JQ8A 5G0TA 4D74A 4IINA 3CKYA 3GVXA 2QVZX 2VHUA 3TKYA 3IQFA 1EXNA 2VOPA 4PJ0C 1FNCA 1FX7A 2OMKA 4LD5A 4DRZA 1ZW6A 5A5GA 2R6HA 2Y27A 4IDDA 4H7PA 4MGRA 1JECA 3RRXA 5HRUA 2X42A 4V1CI 3FJYA 3BH0A 1J06A 4GPBA 1U9IC 2J33A 1UXHA 4F55A 2PANA 4F5YA 3AHEA 2VI6A 1CV2A 1AKQA 3DFGA 1A35A 4WIAA 3CQ9A 3V4OA 1NFRA 1E1RD 3U4CA 2D1TA 1ZFNA 4M6YA 5EWMA 2XUQA 1EVEA 1GEEA 1DU0A 4Z5XA 3D1JA 1FMWA 1UHSA 3GVPA 3NWEA 2J5XA 4LF6B 4HD8A 4IQJA 3BZCA 2R7DA 4YT8A 2LKXA 4LC1A 1KDVA 3BXZA 4JUCA 2Q7OE 5T8KC 1Z15A 5CYGA 2FWRA 2L2QA 1U9CA 3PNSA 4HAUA 2HOTA 5P21A 1T36B 4ZYHA 5DHUA 3O4RA 1G3QA 1B43A 1P2TA 2ZVPX 2C9YA 1E2DA 1NBEA 1DKMA 1WHSA 4PWZA 2P79A 1T2CA 1E2PA 3SOZA 2I2WA 2YHIB 3SYNA 2GUGA 1II9A 2JFBA 2DBZA 2VJOA 2AFIE 1BDMA 5AVQA 1GSIA 1YB5A 2VSXA 3P1JA 4TT3A 1T2DA 3G2QA 3ZU3A 1O2DA 4ZZ0A 1IDN1 1ZITA 2D74A 2DG2A 3PTAA 4MV3A 1F1JA 2EGUA 2VNIA 4TTRA 2V0CA 1IG7A 4CTMA 1LE8A 4FZRA 1KNXA 4DV0B 5G3YA 4DBZA 1RBQA 1PWXA 4BUPA 2RGNC 5LEJA 3MSCA 1RJ9B 3T06B 2M2IA 3FLEA 3I55I 3OT5A 2JFGA 4I55F 3WGJA 1U1IA 4NDNE 2GZWA 5K3FB 1VQLI 2HMSA 1WDTA 3GD7A 3O8OA 3FUCA 5D5PA 1KDRA 1XGSA 3LFHA 2PFSA 5FUYA 4OHOA 4TYWA 1XTSA 1T9BA 1BI0A 1SUPA 3G5AA 4DR3B 3NI2A 4I8XA 2Y0BA 1HW5A 4BS9A 1ZHOA 3V8QA 4JP3A 4Q3LA 2DWCA 4ZQCB 3OIFA 5IBPA 3A0UA 4Z7OB 1ODDA 4V2IA 3DE2X 3AR9A 1SWWA 5I51A 4W1QA 4DBQA 4MRPA 1NXWA 1WB5A 5FUXA 2Q7XA 1QFSA 4BBZA 1GZDA 4UMFA 2DY1A 4DQUA 1N5MA 1TK3A 5MN6A 5LFAA 3R6WA 4C4YA 3X3HA 4DCPA 3LDUA 4OCZA 4E14A 4D0PA 2DJ5A 1GZ4A 1KJIA 2I2XB 4JUFA 4CV3A 4FBMA 2VCEA 2C4UA 3DWFA 2NZ2A 4DEYA 1VHTA 4AZVA 4KIGA 4MR9B 1GL9B 3K9CA 1LRJA 3KJZA 4MARA 2LWIA 1NK3P 3NKFA 4I99A 1CUHA 2XT9A 1SU6A 3VBCA 1FB5A 3FXQA 3IWZA 4D0SA 4V0RA 2GIZA 5E4JA 2ZJFA 2A59A 3DL0A 3LBIA 1WWKA 4AMUA 3CVYA 1LFAA 1J8FA 3V1LA 4ZQFA 2IPLA 1CF4A 4R3UC 2OA0A 2OVBA 4BNTA 4ZV4A 3T5AA 3RTAA 2BBWA 4BZZA 1L5VA 1X42A 5D87A 2Q3FA 4RSHA 1SBYA 4KQ2A 2OC9A 4I5DA 4G1FA 5EE1A 2CSUA 1JT0A 1C3LA 1XRQA 4QEKA 1N4AA 3D3WA 3JRHA 2CJWA 3LBYA 5JSZB 1FX0A 3VU0A 4EA7A 1G21B 4QWWA 1QOPB 5HS6A 4J2TA 5B2FA 1G8JA 1CR1A 3HL4A 3DBVO 1X7XB 4D9BA 3X2QH 5DZSA 4F7DA 2UXBB 4WK6A 3NUQA 2PKRA 1N5IA 1EUQA 2R4TA 3F5MA 1WCIB 3WSTA 1Q0RA 3HY4A 2OAEA 3TJRA 3FDJA 1PHPA 1G0OA 2V3VA 4K6MA 2WFLB 4P5EA 3LVBA 2ST1A 1WTAA 3JAKB 1R4NB 3I01A 2Q6IA 2WYHA 3D6NB 4GGPA 4X6UA 1DOHA 5ALKA 3AHHA 3WA7A 3F71A 5DTRA 5DCMB 4FSDA 1MAUA 2EIHA 4OH7A 2KLBA 1JDVA 1Y63A 3B6EA 4JUIA 3ESAA 3GDGA 1QZTA 4C4RA 1U9YA 3HG7A 5LD2B 2PEXA 1P0IA 1MPXA 2K02A 4XWWA 1YDFA 1CUCA 4U6QA 2ANCA 3FZGA 3CCFA 5EP1A 4A0RA 2CG4A 3M1CA 3BTUA 3D0OA 5JVTA 3IOEA 1K63A 1LFPA 4XB6B 1FRFS 5FLXZ 2X41A 1CJVC 1L4LA 2FRDC 3NTVA 2COUA 4EITA 1STOA 3KTOA 2HOAA 2SICE 3KFLA 4IEJA 1KK0A 1NG1A 4DDVA 1I2ZA 3CUQB 4JIGA 1USIA 3V4VB 3JW4A 4RVDA 5J59A 5B4UA 3K4MA 1CD5A 6ADHA 4D6PA 1VB5A 3W6ZA 4ID9A 3QJ5A 3L0ZA 1PR4A 1MBFA 1Y7HA 4L74A 1U04A 5IT3A 4B3HA 1YFJA 3CLQA 1SXJD 4ENRA 4RQAA 3IH3A 5ALWA 3L46A 4JVOA 4JBAA 1SA0B 1J25A 4HQLA 4AUMA 1RWMA 3WLQA 3TBHA 4K9QA 3V3TA 1BL0A 3Q41A 3O3CA 1XSDA 4ENWA 1R0RE 4HA8A 5M04A 1ZJ6A 3FTEA 4U7HA 3PEFA 2L54A 3JYHA 1X1QA 2WTEA 2KP6A 1W47A 4C4TA 4XKVA 5J4KA 3B3GA 4LY6A 3KQUA 4OI0A 2ZE7A 3V55A 5ITVA 1FOXA 3FKQA 3RSZA 5K6RA 4YUAA 2C3UA 5CURA 4OQLA 4KRGA 4ZCLA 2H51A 4RA6B 3GLQA 4WLNA 3GWGA 4UUBA 1UBGA 5KOIA 3HLKA 5HCIA 2YHBA 2VZ8A 2VP0A 2X7XA 4B3IA 1ZUNB 2ACKA 3GLXA 3FMVA 2ID7A 4YUVA 3AEKB 3UK0A 4LAFA 1H85A 1DQSA 4UE3S 4A3EJ 1MDMA 4I14A 4QIHA 3IH2A 1KQ9A 2ORWA 4NJOA 1E79D 4UM5A 3IVXA 4GRDA 4DKXA 1QIEA 2M98A 1M6NA 5AMXA 2VDNB 3M9XA 3T9EA 1D4FA 2WDZA 2QLBA 4JQSA 4FDLA 3RDPA 3HXPA 3VO2A 4LWZA 5JPDA 3TLXA 2WWTA 4MP3A 5GPCA 3PEYA 4B7ZA 3GGDA 3CCJI 4OJNA 4Q3AA 4I2NA 1D5VA 4YYEA 5KPJA 1RYEA 4BNGA 1T4BA 1DAPA 5A5FA 1JHQA 5GV7A 5KPDA 1WXDA 1E5DA 4BNJA 3GNQA 1E3TA 5IAGA 2PY6A 1SMTA 4QSMA 4LOLA 3FUVA 4AJOA 1SGWA 1QXSA 3C8MA 1P9NA 4I98B 1BMDA 3C6BA 3HO8A 1KFEB 3W6KB 3TB6A 1FXUA 2N47A 2BW3B 5HYVA 3OM9A 4XKWA 3EVNA 4XDGA 2FE1A 4IZIA 3EG9A 1WXGA 2A5LA 5D3MB 3T5BA 4X94A 4EWLA 3V48A 1SRRA 1GA4A 2NOJB 3WLOA 2HEOA 3FI0A 2O07A 1N1MA 5IKXA 3CLUD 3GP5A 3GAAA 3RLIA 4Q02A 1UT6A 3NVMB 4A92A 3T61A 3QENA 2OQVA 5F98A 3ESRA 3AIIA 3LA7A 1JHVA 2B0LA 1K6IA 2HLDA 4FMDB 1PQ4A 3A8TA 1ZD1A 1F2TB 1L5LA 3D3EA 3TG2A 3DZCA 4ABTA 1L7RA 4NABA 1Z75A 3H19A 1R37A 3HJNA 5GGXA 5ELXA 1Q7GA 3UXYA 3G5MA 4BNIA 4CGYA 1CZLA 5C8YB 1EX7A 1W52X 2E4XA 4RGSA 4OLAA 1NLFA 1PR5A 1PJ8A 1TJ3A 2Q5LA 2QMUA 4DUZB 4N0MA 1SG9A 3I4PA 3AP1A 3A6LA 3EDPA 3M5CA 3JWHA 5KNCH 1P77A 1GXSB 5J5CA 3CCMI 3F5QA 4Q00A 3QLUA 4R7GA 4JVMA 1RC1A 5SY4A 3ABKH 5DX1A 2HIAA 5ALQA 3IPAA 4K9KA 3UICA 1D4OA 4G1CA 1Z6YA 2I1LA 1PR3A 4KPYA 2Q45A 4EI9A 4M6VA 2JA1A 4P7BA 3RSCA 4YUXA 5KJEA 4L3VA 3SOPA 1LNWA 3VR4D 3ND8A 5IT9Z 4UXJA 4TKZA 1R1UA 4JU9A 1AKHB 5IULC 5KNLA 4URVR 2VHWA 2QTLA 3GFTA 1ZG5A 1G6KA 1BW6A 4RULA 1ZK1A 4MEJA 1KY2A 4CEJA 3BXGA 2JLWA 4K6OA 1PFYA 1U0HC 4JJ4A 4UMDA 2VBCA 1XFDA 4AAYA 2MHCA 3ENQA 4Y2SA 3ANYB 3EULA 2A5FA 1AKNA 5IMBA 3MQFA 2WJHA 3MGBA 1ODTC 1GNVA 2WKWA 3WRXA 2CDCA 1RUOA 2DE0X 2ECOA 3HGYA 4Q3DA 1T0UA 5JS6A 3CM0A 1KVUA 2QW0X 3FBIB 1LS6A 3R7NA 3RFCA 5C34B 2YY7A 3GT3A 2Y68A 1NR7A 3V00A 1AQLA 2VQEB 4PSDA 3EY9A 2LCFA 3PR3A 3RCBA 2WJAA 1QIHA 4XYBA 1B3RA 2VE8A 1CDOA 1IUKA 4GIBA 2I8DA 2QRPA 4Z1OA 4BCDA 4MDFA 2C78A 5H6RA 1ZBQA 3A9CA 1WW8A 1NM5A 3W04A 3DKXA 3DKYA 3HYLA 2W0MA 4TLCA 2KSQA 1KDZA 4IQ4A 1AU9A 2A6PA 1NW4A 2ZG6A 3C74A 3UNXA 3WAGA 2FRVA 4E1BA 2EGHA 4ZDJA 4NP6A 3OPQA 4XI9A 1D03A 5ENDA 2BELA 5EVCA 3N74A 3OZBA 1Y6RA 2ODPA 4JQCA 2XQKA 2AFVA 2IDMA 3RI4A 3K4NA 4LFCB 4XLCA 5C1BA 3IP8A 3QU5A 3SHQA 3LXXA 4B45A 1U6JA 1QIMA 2FUG2 3EA0A 4AYTA 5FLVA 2VJCA 4BNLA 3G2JA 1IATA 4YDQA 4RESA 1SRQA 3JASA 5AJWA 1VQ8I 1P0PA 2VJPA 3C3BA 3ZV7A 2JFVA 4BL5A 3GZ5A 5AIBA 2I3GA 2Y1OA 5JFTA 2ZVDA 1H5QA 2XXAB 1XS9A 1KJJA 4NL4H 4NDAA 5KMGB 3HP4A 2K4JA 3LCUA 4UZEA 2AJCA 3O93A 2XADA 2GBLC 4DHEA 5ANRB 3OAAD 3DTKA 1UJ4A 1SQGA 3I45A 2VQ6A 1LCIA 4O1HA 3QPTA 1GU0A 1HDZA 4JXJA 1X87A 2WZCA 4I1UA 1OBHA 4AJ1A 4Y3OA 1OWNA 5H4HA 3HFJA 2F4MB 3AR6A 4JKYA 5E79C 3PSHA 1Q12A 1MG0A 2CSXA 1ABEA 3EWIA 3WK6A 1MRZA 3BD8A 4DW6A 1Y0NA 3U44B 1E0SA 3H05A 2G4CA 4QOHA 5JI2E 4D4KA 4CHUA 3CX8A 2HAEA 4GL4A 1OVMA 1EVYA 1EWKA 4Z4FA 4HGZA 2NU6B 1HT2E 2AXEA 1KQPA 4NNOA 1FUUA 2N9UA 1JSLA 2HDDA 2BEVB 3FPHA 2ZSHA 2JGNA 1P75A 4PPFA 5DGDA 5IBQA 2K40A 2ICAA 2P6TA 2Z3YA 3OF3A 3PNMA 1KI6A 3OX3A 4DLTA 2LIPA 3DOOA 4Z9FA 1U81A 3GA7A 1C0WA 1OWPA 4D0GA 1F4PA 3ZCXA 2FOXA 4N49A 3EJWA 4IRUB 2N3ZA 2G1UA 5C2JB 4R79A 2Q5EA 4BAZA 4PSVA 1SIOA 4O8ZA 3ESDA 1RHJA 5LZ2A 1V95A 1XSEA 2X4DA 3QHPA 1G3MA 2AVDA 3WTBA 2E1MB 4CCYA 5HNFA 5KVAA 1I7LA 2OT3B 3K09C 1ZLKA 3LKBA 4JI2B 121PA 2XDWA 1TKAA 1XWIA 2X4HA 1M1YA 4P55A 4JOMA 3CH6A 1NNI1 4JY7A 2ZOSA 5F78A 1WZEA 3UK1A 5EAIA 2K7ZA 4RMGA 1H0SA 4XQCA 3HGMA 4KPGA 2H7XA 3B7WA 2FEKA 4NFLA 1BCSB 3FE2A 3EGCA 4I9FA 4Y2HA 3PEEA 3LTNC 1JE0A 2Z1MA 4B87A 5LQKA 4ZCQA 1VMKA 2PGAA 3ROTA 1X3UA 2JK1A 4HK4A 2NU9A 1P73A 1SFXA 2P9EA 1TBXA 4U0VA 3BSFA 2PU7A 4MX8A 1Z38A 2QY9A 3A6GA 2V7FA 2W6IA 4DDTA 2OGWA 2IL1A 4HNHA 1K8ZB 1YKFA 1GG9A 4IKOA 2Z98A 1SUAA 4MP8A 2PBFA 1TM2A 3NHJA 4EZIA 4KRXA 1C1YA 3MJTA 1XN4A 1OFVA 5AJZA 2CXHA 3U7JA 1T4CA 1QVWA 4UPEA 2Q5JA 4R5MA 2YX1A 3FETA 4RS4A 3I39X 3HLTA 3JVUA 1ZOIA 4JI1B 2I1WA 4EJFA 1I4EB 5A5VA 4XLEA 1IC8A 3CLOA 2INGX 4NS1A 1R0LA 4P54A 4R40A 2XGOA 2X4IA 4YMIA 1Z3XA 1NLMA 3T5XA 2ZGVA 3VZQA 3K73O 3MCVA 2FX0A 1G7SA 3RG8A 2NMVA 4OFWA 4JITA 2EZHA 1ZISA 3G8BA 4FE3A 3DDHA 2YUIA 2YZGA 3ZQLA 2YNMA 4CUJA 2OAQ1 3RU9A 4LF4B 1OPRA 1EUCB 3AGPA 3ZY6A 2QNIA 1HNXB 3CVXA 1KZ7B 3KO8A 2V4MA 4MWCA 3E15A 1YVPA 1O0SA 5J6XA 2XF7A 2AI3A 2XB2A 2NACA 4V24A 2YQ5A 2G9RA 3LUBA 4O2BA 5AVRA 4JLDA 3QA9A 2QM7A 3ICEA 3K1NA 3FM3A 1ORTA 4CCKA 3HPHA 3KSUA 4CH7A 1IO2A 1Z7BA 5GVRA 2BV6A 4KR9A 4RHCA 4GI3A 4U7GA 4LEIA 4AJLA 1P3JA 1UM8A 1P0CA 1USKA 3MQ4A 4NCIA 1Y98A 3KL4A 1F2VA 3IVCA 4N5MA 3T4XA 3UFBA 1TQ8A 3GARA 4QC2A 2X1HA 4B76A 5B12A 2C2XA 3KKOA 2QN9A 2VATA 3CYFA 3MJDA 1HOXA 3FPLA 1RAIA 2ZWIA 4EJSA 3KT6A 1YQQA 4F7WA 3HSFA 4YRAA 4Y9SA 1MABA 4AECA 2B1RA 2WD7B 3V46A 4LMRA 1VP3A 4J1TA 4KE7A 1MVLA 2W2TA 1IB0A 4UU7A 1DFIA 4ZDWA 2CYCA 2XPUA 3IVAA 4RKYA 2GF9A 1L3IA 1XQWA 3CCEI 1WTCA 4UM7A 1SG6A 1BGWA 4K05A 2A9KA 1ZXLA 4ETIA 3FFTA 4ZCPA 1V39A 2FN3A 2EV6A 3OKPA 4C4AA 1P7ZA 4DIUA 1LW7A 1MFZA 4FB5A 1ZVVA 1CUVA 2AW5A 3OZAA 5K3BA 2E4AA 3EZXA 2WAEA 3LYUA 2E18A 2J9XB 3JQRA 4M1SA 4IRGA 1KOGA 2B4YA 1OZ0A 1FOEB 2OD2A 3F73A 4GZ3A 3ZCTA 3PXCX 3WTVC 5A4MS 2AG8A 1I7DA 3STHA 4EPXA 2J4FA 3NNDA 3GCWA 4QHSA 4KVZA 5E2AA 3UW1A 2ZBKA 4JIMA 4IXAA 1E2BA 1XDGA 4CYMA 5KTKA 4KRFA 2WTXA 2CL0X 1LJLA 1C80A 2C4VA 1VE9A 3NHUA 1Z6QA 3CZRA 4BPRA 3CNLA 3V4FA 3K1PA 3KPUA 4UEQA 1MB9A 2FG7C 4AYWA 3TBKA 3J7TA 3DDSA 4NYIR 4Y6SA 4ZXFA 3AU9A 2OTLI 3NAMA 2X2FA 4DABA 2QX7A 1ZG1A 1Y1WJ 5C35A 4DJ5X 1TTTA 2PUJA 2APJA 3NOVA 4PNEA 2TYSB 4E32A 3NUZA 4FYVA 2BMFA 2G0TA 5IPFA 2X14A 4KN5A 2GSDA 3PT5A 5AW7A 1K86A 4EKIA 3E7FA 5JCJD 3B9QA 3TVTA 5EINA 3SSOA 4XLNF 4UNPA 1UPTA 3X0DA 1FP2A 5IJWA 2XBLA 3AF6A 1I50J 3M4JA 2VF8A 4QA9A 4WBNA 3QWAA 4TV9B 1ZCFA 1XVLA 3CT4A 4XXHA 3S3MA 3ZHSA 1IULA 3OM8A 1X7HA 1KI7A 1GTRA 4N3GA 3S7TA 1B16A 1WSBA 4EM1A 4DC1A 5M2QA 2FUG6 1PUJA 2PO5A 2WIGA 3BEDA 1Z7UA 2JA6J 3G1UA 3VR2D 3HSKA 2ZXIA 2PMZN 4QICA 3PRYA 2C00A 3CSSA 3OC6A 1HYEA 4HFNA 3HACA 3ELDA 1EVLA 1XVIA 4QXQA 3TAHA 3F5FA 4L9WA 2ZRPA 3QGMA 4KH1A 5H9VA 3IKJA 2DY0A 3JQBA 4XPZA 2AZMA 3L9WA 2YWRA 3ND9A 5I47A 4FLFA 1JTVA 4DZPA 3U7RA 4J7XA 5L3DA 4AIRA 1ZOPA 4KNWA 4O2BF 5IVIA 1O95A 3H1CA 3MEQA 2AMVA 4PYRA 2AA3A 1DXOA 1ZELA 1XXHB 1GPNA 4XX0A 2ECKA 2P1DA 1G59A 3N6RA 4M9UA 3UAGA 4HLDA 4FHZA 2EYQA 3NORA 4AZ3B 2YX4A 5H2FC 2BGUA 4RORA 1WD5A 4NJMA 1UJ6A 4N41A 5I4IA 3L01A 1B93A 2ZZNA 3EQ7A 2B2CA 5B7QA 4Z53A 3T0YA 2GXBA 3SX0A 4R8SA 3Q7TA 3UENA 1QIKA 3DBRA 1QB8A 1XRLA 3CDIA 2DFDA 3FVTA 3WRYC 3JRWA 2PN1A 3E5QA 3LLMA 5G1NA 1ABFA 1X3LA 2RAVA 1P0MA 3BHJA 2NT4A 2B4KA 1NBWB 4Z3DA 3H8SA 1AB6A 2OK8A 3JRGA 3HCEA 1O3RA 2QA4I 5J8FA 4HDNB 3V4LA 4KWEA 2Z0MA 2GT1A 2Q4BA 3OEYA 2CUZA 2VK2A 3CMYA 4LVUA 4DDKA 3N53A 4EI8A 2OOKA 2VPPA 3K0EA 5EUBA 5IJXA 5EC8A 1HXHA 4XIIA 1ZKMA 5JQGA 3BE8A 5LBTA 3L3BA 2O7NA 4NEGA 4ZJUA 3BMXA 1V2HE 4TLEA 1J7JA 3AUAA 3RANA 2AZXA 3VR6A 2H9YA 5JZBA 1QYXA 2MYSA 1OLSA 2FSWA 3DBHB 3PXBA 4A3JJ 4K87A 1HY3A 3NBFA 5JAPA 5IANA 1SHZA 2QR5A 4LIVA 1YJ8A 1R0SA 1DKRA 1XQ1A 2ZBUA 4BC1A 3UCXA 4HAXA 3U62A 3UBTA 2QJFA 4IX1A 2P8TA 4X3PA 2K5UA 5L45A 1K97A 2EFOA 4N9IA 1RPZA 4I4LA 1OAOA 3SX2A 3GW2A 3RREA 3CUSA 1VI2A 3RSSA 4DCMA 2QL9A 1W73A 3IT1A 1AKVA 2UUZA 4O4HB 3I34X 4DQKA 3RAEC 5HGXA 1VE5A 1Q7EA 2ZUVA 3OECA 4AY2A 3AY7A 5DS9A 3N70A 3TE6A 3LXUX 3RS0A 1PQWA 4X71A 2O8DA 3B1JA 4RCZA 4HVCA 5I7OA 3B1YA 4ABZA 5I8PA 5BRNA 2M9MA 3UEOA 3G79A 1W0KA 2E5LB 5ADUS 1E60A 2ZKZA 3JXEA 3O8DA 4KJXA 2V9CA 2IUSA 4GMDA 4RZUA 2UZ1B 4X6AJ 1UFRA 5ALXA 1ZSYA 2QPOA 1BQ4A 1BTOA 1C0LA 4XW2A 4HDOB 5FPPA 2Y1DA 1EZ4A 1TQIA 4IQ0A 1LNQA 1UPCA 2XHEA 2H4JA 3JARB 5IOZA 4EMSA 3IC5A 1FJGB 5DASA 3H9GA 4TWJA 2XMCA 1SUBA 2H52A 4ZEMA 4YRLA 5C81A 4L02A 1J97A 3V6MA 4AU1A 1CIPA 2PRSA 3IV5A 5LQJA 5KCZA 3OJFA 2I10A 1RADA 4G8XA 1U1GA 4NE2A 1UPUA 3LLCA 1CEXA 2HCTA 4ALNA 1EF4A 2MTBA 1U98A 3E03A 5AESA 3NVKI 3RNOA 4I6GA 1BZYA 3O3MB 2AW3A 1NULA 1BN7A 3T9AA 3OA2A 2QSZA 3ESCA 3KJEA 4XH9B 2FSUA 7AT1A 1J2YA 3ZHVA 1G3RA 3CNEA 3RK1A 4HMQA 3EGWA 4MZDA 2Z5UA 3ZU4A 3VPHA 2EZKA 2H2DA 1DXQA 3IL2A 1GQ2A 1V26A 2J0SA 4RB1A 2IU0A 3ZGKA 4BRZA 1NQOA 1PR9A 4QDKA 2J3JA 1K5GA 3HADA 2RAFA 1YGYA 1WE2A 3C1DA 4MJXA 4ON0A 1Q0UA 2FW0A 3RUHA 1GQFA 2UV1A 3CC7I 1P4SA 4X64B 4NDLA 3IBTA 1FRQA 5DXJA 3GROA 2IDJA 4PFOA 1Y0BA 4K40A 1IZ8A 4PGHA 5REQA 4BP1A 4YRMA 1GAEO 3H0KA 3ZGOA 1YJQA 1PUFB 3NJRA 3ZJTA 2YWJA 1VYHA 1UT5A 3DE6X 5E7MA 3CURA 3IHUA 3PD1A 5HCUA 3CCLI 1MZPA 1NX9A 3HN6A 1UP7A 1YRLA 3K0FA 2IYZA 3FWHA 5EXTA 1H8HA 4MAFA 3BGDA 3W7BA 1PSWA 1XG1A 3TO6A 3BAFA 4K3UA 2X51A 2E35A 3RODA 3EPLA 2BHSA 4MW7A 2VPLA 2IYNA 2WNSA 3HYIA 3PWSA 5ALFA 2YRXA 1QV6A 5UKDA 2VT6A 1RWXA 3A4MA 5AK4A 3IQGX 3Q8XB 4MI9A 4OKIA 2AVNA 5HXAA 3FHOA 1BHO1 3ZI7A 4AVZA 3DC2A 2P9JA 1IXYA 2VKVA 3O83A 1KFBB 1L5MA 1LFBA 3IRVA 1AC5A 2XYPA 3WGMA 1L5GB 4YY3B 2XYGA 3H6GA 1AGXA 4PYLA 3GJSA 2YUSA 3KAJA 4C22A 4KHPB 1G42A 1K75A 5CTJA 5BW6B 2IELA 3EPHA 4J49A 1K6YA 3M4NA 1TGYA 2AQHA 1FBSA 2NAZA 4UOQA 3JQGB 1OFCX 1W4RA 4BVLA 1VQ5I 2Q28A 1AB5A 5JSHA 1D6NA 3EZ9A 2AQEA 5F2EA 2BHNA 3CXUA 1UDBA 3LG2A 3ZQQA 2C8VA 3RS7A 2J09A 4XLHA 1RR6A 1RZ3A 4RMIA 3IUOA 2Q2QA 1Y1QA 1BX0A 1Y0UA 5F9FA 4HBGA 2FNPA 2QVYX 2EYUA 4OF4A 1BIFA 4RUKA 2DU9A 1OX4B 1ZD8A 1VSQA 4OOEA 3FBTA 3PDHA 4OQQA 4W9MC 1R4MB 1H05A 4EHIA 3JSAA 3RWBA 2JSPA 3LC1O 2AN1A 4KTVE 3AKCA 2OTJI 1TZCA