4BQNA

Structural insights into wcbi, a novel polysaccharide biosynthesis enzyme. native protein.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
311
structure length
311
Chain Sequence
SMAQRKKYSVYGSCQAPALAKMLNSCPTFARDWELVEMEPCFVASEEQIDRHLAETIPKLDLFLYQPVSEGYRGEKYSSVFLRNSMPPGGNALSVQYMHWEGYHPTVNSPYGLPPHPEGYVDALIAGAVVMDVDKETYLRHLEEIGASLRIDIDEIESWCVDELKTREVGENDGGKQIDISVTDFILANCRQKRLFYTMNHPTAALMREIAARCMLALGYTYSDISFDQNLDPLDVTKMSLYPIYRDCFDFSELNRMNEYQVLYKKKAYEPYLLEQFEWFERSPKADVSAFFDRVAANRRWVRTALRRAFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Wcbi, a Novel Polysaccharide-Biosynthesis Enzyme.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transferase
molecule keywords CAPSULAR POLYSACCHARIDE BIOSYNTHESIS PROTEIN
total genus 115
structure length 311
sequence length 311
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18588 WcbI Polysaccharide biosynthesis enzyme WcbI
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2490 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4bqnA02
3.40.50.12080 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4bqnA01
4BQOA 4BQNA
chains in the Genus database with same CATH superfamily
1OTYA 3JYPA 3RKQA 3DGFC 1FS5A 1HKSA 4GC9A 1P4SA 4EJFA 1D2EA 2PRZA 2SBTA 4IUBS 4MUJA 2DQRA 1K1EA 2XPVA 4DZPA 2C96A 2R48A 1N2OA 2R7KA 1I9CA 4UUMA 3M89A 5AI5A 4E3ZA 1K78B 1RYYA 3QV2A 5I9IA 2WC1A 3O4JA 3WAKA 4FFRA 4US0R 1WMAA 4OQ4A 4EB6A 2WJ3A 1ZJJA 1Q0HA 1P6RA 2NVYJ 2YNMA 3MXOA 5AVJA 1FYFA 1NXXA 4ZVLA 5DD8A 3O3KA 2QV7A 1VCHA 1T0FA 3QKRA 1A5BB 2F6CA 5DBGA 4BNUA 5EJEA 1BW9B 2E4YA 3CCUI 1XMOB 4B4WA 2RGVA 2FZKA 2HYGD 3L84A 2GAJA 4FVTA 3ZWXA 2EFEB 3ROFA 3REQA 5I9LA 2COEA 4CU5A 3CEJA 1YFZA 3PFYA 1NZDA 2R7NA 1G8YA 2ACVA 4RPCA 2NVOA 3T34A 4BMSA 4C7MA 2ZUEA 1GHTA 5JYEA 3B9RA 3UJ8A 3RVNA 3T5XA 1PUFA 1ZA1A 1ND6A 2VQ3A 2PJRA 1MH3A 2P2YA 2AHOA 1I1OA 4TXLA 4V02A 2WM9B 2C7RA 4PX2A 5ICFA 2H17A 1UXKA 3MPUA 2FWPA 3X1WA 5DI9A 1IWBB 5AONA 1TVKA 1YT5A 3BXFA 5EWMB 2ZXWH 4OAPA 2QMZA 1FT9A 2B6NA 5FWDA 1I0LA 2GTPA 1AQJA 2EV5A 5MHTA 2FQXA 2DGDA 3B6IA 2Z16A 2V03A 4BNIA 1IRFA 3ND8A 1SOMA 3NTOA 4NFLA 5CH3A 3HQ4O 3VB2A 1D1QA 4IP0A 4I19A 2HTJA 1T8SA 2C61A 2W2VA 3ABRB 4QYWA 3WLTA 3ZJUA 4HMQA 3Q7EA 4BYMA 2FPXA 4JROA 1DBSA 3CLSC 1BRTA 1WSWA 3A6ZA 1Q7BA 3T3MB 3HCCA 3KPVA 2OTCA 3EZ7A 3FPEA 4MS4B 1T24A 5I8WA 3WK7A 3IKLA 4YHHB 2NNYA 1LXCA 2W4IA 2Y1FA 4YRJA 5M34A 5ALMA 4UNRA 1JT6A 1N25A 1T0FC 1E1LA 2Z33A 2HWWA 3ME5A 3HIFA 5E4TA 4B6JA 4Z54A 5LP6F 4B0PA 3WIUA 3P96A 4D02A 1TCBA 4MR7A 1X9IA 2BISA 4X1YA 4WK2B 4BKMA 3CLTD 2E5WA 1PVEA 4M46A 4R1UA 4ND7A 2J0EA 1KGDA 3U3OA 1OLSA 1Q84A 5CB4B 3LSMA 5ECDA 4EGFA 2KWIA 1JLMA 1L2TA 2GCOB 4QUGA 3V2GA 1KVQA 4M0MA 4MVYA 4AD8A 2R1UA 4MQVA 3PHLA 1J7JA 1CNEA 2EEPA 4XH9B 5CB6A 4PSDA 4XICA 4TTJA 5F0CA 1RCUA 1RXYA 3P7NA 4Q9AA 3FY4A 3H13A 4OXKA 5JMTA 2C9CA 2O0JA 1BOBA 2OHFA 3UMFA 1DVRA 3ESYA 4D9NA 5ITZB 1WBBA 4W99A 5LA6F 1W7AA 3NU1A 4ETNA 4CR6A 1QIEA 3O9ZA 3WODF 4CCMA 4E70A 1T36A 1T39A 3T0FA 4X64B 4UBIA 4YRIA 1K5DA 1T8RA 2FOXA 3D4BA 3FCUB 3MT7A 4A3BJ 4L5JA 4PHCA 3VAYA 2CFIA 3JRAA 3R6DA 3E3AA 3WWZA 2ZZMA 1P4WA 3FFXA 1CV2A 4DUGD 1SXJC 4L5BA 1ZLKA 3LSGA 1I50J 3DULA 1EVZA 5JWOA 3T3NA 2A14A 2BTQA 3FR8A 1BN6A 2VP0A 1EGQA 2Y0DA 3LFTA 1EH7A 4B0OA 2X1HA 4BV9A 2POQX 1E1QD 2AXPA 4G8BA 2HSJA 2CF6A 2OXFA 3EMKA 3W9UA 1KFKB 1KSJA 3MTDA 1WWXA 1QPIA 1L5YA 3CCMI 1ZC3A 4NV3A 2HOSA 2EB7A 3UMSA 2FP3A 3TRDA 1IVNA 2BLLA 3U4MA 1UWKA 2A0KA 3B1YA 2FI1A 2ZYUX 3AKCA 3IIKA 5EJFA 3RAGA 1HOXA 1W4CA 2RKHA 4EENA 5K03A 4REQA 1J8FA 4Q9JA 4WNCA 4I02A 2WTUA 4ZYZA 3S1LA 3PE3A 2Q2QA 2VKVA 2EF0A 2XEXA 1D5VA 1K79A 1JDPA 2A1UB 1OHHA 2JI9A 1IEWA 4HN9A 1AKVA 4HUJA 4NDAA 3RVLA 3NC4A 5AW9A 3FUVA 2HZTA 1DRWA 3K9LA 3KQPA 5DBIA 5F1YA 2W2PA 1G20A 1QZYA 4QDJA 2YZNA 3MKLA 2WU3A 3HSRA 3AB7A 4Q66C 2C6YA 1JDZA 3GLFE 1D4FA 5C1IA 2C4TA 2CDAA 2XB0X 2B5VA 5K0SA 5GP9A 4YUYA 2IPNA 4LE1A 2WAYA 5T8KC 1R3UA 1U0BB 3VDMA 4DDHA 2EZ9A 1NW8A 3EWSA 4CXMA 4LJ5A 4AZ3B 2NUAA 2HPMA 1PD1A 4XD7A 4F3YA 2CXRA 1B4DA 2JA8J 2VYCA 2CXUA 1KS2A 1KMNA 5A04A 1KHTA 1RIOH 2XUBA 3FXKA 3MQFA 4ROTA 5JO0A 4K9OA 4WLOA 2JK0A 4R9SA 2B7LA 3ETJA 2FFBA 4TGLA 5HDBB 3USES 4DLBA 5IS2A 1UJ6A 4KFSA 1D0ZA 2WF8A 1X3LA 1LDYA 4EV0A 4JGGA 1EFRA 1UMKA 1ZK1A 5JEDA 3U44A 1T5DX 1Q3KA 5C34B 3T7SA 4IICA 3I12A 5E6UB 1I7SB 1RLJA 2G71A 5JRJA 4YALA 2JFXA 1BE0A 2M0CA 3RG2A 3BY6A 3H36A 4F1WA 4YXWA 2CVPA 2V79A 1O5IA 4G89A 4MHGA 1GL9B 2VF7A 3GB9A 1QG2A 3CW8X 1J0CA 3IUQA 3JQFC 5D3ZA 4BY9E 5DM7F 1FBNA 2MDTA 4WCVA 2W25A 2TDXA 4PGGA 3GELA 5LZ4A 4RNCA 3RSSA 1T1SA 3OZWA 3ZTYA 4M6WA 4NBVA 1V3FA 3MGBA 4PYKA 1B3BA 1JIVA 4XLLA 2DYSH 3I5YA 2GZAA 4COOA 3K9QO 1XZCA 2RNJA 2ECKA 4GOND 4RESA 3BG6A 4LNUB 2GVNA 1USKA 4QOHA 2VQEB 3VR2D 3I4PA 1PU2A 3EB9A 1X3WB 1J20A 1N3YA 1QFXA 3KQYA 2FXIA 5EZQA 5KYUB 5C53B 4BMPB 3QJYA 4B3CA 2PLYA 4HQ0A 2D2IA 2WKPA 3IR5A 4JITA 4LAFA 2Y71A 3O8DA 3OT4A 1RFLA 3FKJA 2ZJFA 3N53A 2KIFA 3MGKA 4M76B 5GPCA 1VCMA 2J6HA 2M1BA 1E9SA 3EGXB 1GXPA 4EJTA 3O0TA 2X6YA 3T41A 1P4JA 4OSEA 5CA0B 2X1DA 4ZDKA 1XRQA 1R0BA 3FCYA 3C97A 3H84A 1JKQC 4B35A 4UUSB 4G84A 1MR3F 4UUTA 1YK0A 4I4TF 3F5DA 4J7UA 1BYUA 5L45A 4ARZA 1NXQA 2JIDA 1XHFA 3T9EA 4P84A 1NBHA 3HRUA 4JYKA 4LGMA 5DZSA 2E1MC 3VO1A 5J4KA 3CP8A 1MPXA 4Q05A 2IEDA 2Q1SA 4BEWA 1AA9A 4DBLE 3U1VA 2FX2A 1R5HA 3ZGKA 1U3DA 2VJBA 3A70A 3K53A 4IPTA 3RWBA 4A1FA 4ZVMA 4E4YA 4FHTA 5HX7A 2D2VA 4U6SA 3WY9A 5LDHA 4HYYA 1ISHA 2OKGA 3IULA 2ZXIA 3RVBA 3WLKX 4ALKA 1TGVA 3HCWA 3HO6A 2AG5A 2OMKA 4G5XA 2Y27A 3F3YA 2IRFG 1L7QA 4YJHA 5B64A 2FK8A 3EF3A 5CK5A 2ZI7A 3LI2A 3NI2A 2NYRA 2Y2UA 1T38A 5B4TA 3PC6A 2QY9A 4IZHA 1FP1D 3KHTA 1ZS9A 1Y6QA 3LO5A 2WMOB 1RDFA 3DLPX 1DO2A 3M6XA 4DYDA 3W5AA 4BNLA 1XJ5A 2A5LA 2RDMA 1TZCA 1O4VA 2C5EA 2WLTA 2ZE6A 3FSRA 5FBLB 2QRHA 3R4KA 3AU9A 2CV1A 3VPXA 1AKMA 4HQKA 4MH0R 5LQSA 2BHLA 3URMA 3ETEA 3BERA 4UHHA 1AS2A 1DWOA 2VSXA 1N2CA 5ESRA 2WPNA 4L4ZA 4EW1A 4YRZA 3PEYA 3H9EO 1HGXA 4I09A 4CF4A 1OLXA 1UBCA 2V9ZA 3LOUA 4OL9A 4PZAA 5EDNA 5E1WA 3AR2A 5JWHA 5HNHA 4IJUA 4P7JA 1P5FA 3LSIA 3L05A 1C9DB 3J81Z 2AC7A 3DVLA 4P83A 2XRLA 4QFMA 1BWPA 4UREA 5IAEA 2Y31A 1ADGA 1XTTA 1NNLA 2TYSB 5FO0A 5BSHA 2Z99A 1XAHA 1NUSA 2OQIA 1KQGA 3MCTA 3F8CA 1TVCA 1D0IA 4N7JA 2B2CA 5A5DA 2V7WA 4IH1A 4Q39A 3HJFA 4RAYA 2JLBA 1T2FA 1SMKA 5FKMA 1N33B 1IC6A 1CWUA 1LC3A 2QR3A 2XCIA 2CLSA 2FK7A 4L57A 5AQEA 3T1QA 2DB3A 1XEAA 4M6VA 3U39A 1YOVB 5AKYA 5BR1A 1B93A 3DPIA 4C5CA 4BBSJ 1PQUA 3HYLA 1TQ4A 3F9KA 4A15A 1P8AA 3G2HA 1BMFD 2FDXA 2WJIA 3NOVA 3IAXA 3P9XA 2B78A 3NYIA 4FJ2A 3GRYA 4N49A 4LFBB 5TISC 1NI5A 4S3MA 3AVYA 1JPNA 4CLOA 1W4LA 3ZN1A 1IQ0A 1RABA 1XN7A 1Q1EA 3EVZA 5CUQA 2WKSA 1O0BA 2CLMB 3TE7A 3A0RB 3COPA 4ROSA 4B3TB 3GI1A 3EAGA 3GJ6A 3KLBA 4B47A 2R4TA 3KR1A 3OU7A 3Q9NA 2O2SA 4UAJA 4QBTA 3ZDRA 2JGDA 4HH4A 2ORYA 2CKDA 4ZXPA 1V7ZA 4DPKA 2HGZA 4NYJQ 4BFYA 4QHTA 2XGOA 1WW3A 2PSDA 3HN6A 2ZI4A 3P2OA 4UATA 1PO7A 1N5MA 2TECE 5DRTA 4DJ5X 1L8QA 3WZMA 3EDQA 4MMZB 3NVDA 4JJZA 3LHKA 2GAUA 5EKDA 4B1FA 2G8NA 1FNMA 1ES9A 5AW1A 4X7PA 4CZ2A 2X4HA 2EZKA 1YQDA 3O8NA 3TSAA 3F4LA 1A9QA 1D5CA 2P5VA 1M1ZA 2PU5A 4YCAA 5AK6A 4ETWA 1I3CA 1OBHA 1CUFA 1U7XA 3EGIA 3GTGJ 1NHGA 4TSFA 3HPQA 4D2IA 1LWOA 2D5BA 3NDPA 1QO9A 2O1SA 3ZE2B 5FX2A 3UMVA 2I76A 4RYLA 3D1VA 1SAXA 2L42A 1MBFA 2WSIA 2Z56A 3H5TA 3LZ6A 3NT4A 4I1OA 4N39A 5FUXA 1CJTC 4C1NA 2HT6A 4LISA 4K9RA 1BW9A 4PCVA 1DFGA 2G77B 3QK7A 4NENA 3K4BA 1FLVA 1RCTE 1WJ5A 3ETCA 4AWBA 1VSQA 1WKMA 4HLCA 3K5IA 1YBMA 3HJEA 2RKOA 1E89A 4YFNF 2Q3DA 3DTYA 3N2EA 4FYHA 3VSEA 4NJEB 4BX2A 4C3JJ 3JQ6A 4GBMA 2JLYA 4C7OA 2IY9A 4F52A 2BMFA 1RLIA 5I4BA 3OHPA 1OLOA 4L8FA 2RG1A 3LBIA 5ALQA 4DEYA 5KTYA 1DCTA 1MNDA 2AH5A 3W2GA 1M0SA 1VQ1A 2V8BA 2NU6A 2ST1A 2PANA 2EQAA 2ADMA 4NOLA 2ZUDA 3A6JA 4EHHA 4HI0E 5CFQA 3I56I 1A5AB 1U9ZA 2C8VA 2IYUA 2AK3A 2FEZA 1KBQA 3NATA 3PWZA 1YZKA 1T5IA 4KZKA 3FRIA 3DL7A 1U8FO 3K4PA 4G0XA 2ZSDA 1NBWB 4TYMA 2ZSFA 3RIRA 2JFZA 4O0MA 3RBAA 2IYRA 2FSSA 3RHTA 3RRMA 3WKCA 3TLYA 1MABB 5JCJD 1BGWA 4RGBA 4Z49A 5L4NA 2XKOA 2JCVA 3PPVA 4MINA 3WL6A 1W9HA 1L9KA 4BV3A 2IQ5A 1U2EA 3ILYA 4ML3A 1E3DA 2QRGA 2DW4A 4GZMA 2YCBA 3SJMA 4Y6GB 3T9CA 3CNOA 1F6WA 3RU3A 5LZ2A 3KJNA 1OXSC 1RMTA 1TU3A 3K4QA 3KQHA 3ZZTA 1XNRB 4U7GA 2FWMX 1O77A 1Y1QA 3GA7A 3M9LA 4WGGA 5ERYA 1C4XA 1JQBA 2E89A 3JW4A 1QAQA 2XHZA 5JZMA 1W36B 4IRGA 2VLBA 1SQGA 5K01A 4MHSA 4NDNE 3OTGA 4A2WA 3M3YJ 2QQ0A 1XA4A 2R25B 5JCJA 1R6UA 2C29D 3EOZA 3FTPA 3H8WA 1M1NA 1TF7A 2R8BA 1KYVA 5L4SA 1Y56A 3ASZA 4XOTA 1XA0A 3PR3A 3S7ZA 4D98A 5HQTA 5AK4A 3GGGA 1ISSA 1BX1A 4UQPA 2W43A 1CUEA 3S55A 4U5QA 4CCYA 1E1DA 2E19A 1Z34A 3D7RA 4N5LA 4WBNB 4ZGBA 5LCXA 3AHIA 5DOZA 3FGNA 2EA2A 1C9KA 1L7EA 3NTXA 5FKNA 3DJFA 4J0QA 1P2SA 1LDNA 1M0EA 4NOKA 4M73A 1ONBA 3TQNA 4AAYA 4C2TA 1NVVR 5DFAA 1JKJA 4NAVA 3VPDA 2Q5LA 2VL7A 5IFLA 1W0TA 4B1RA 1I3LA 2FEAA 2EJVA 1L7PA 2DO7A 2RGNA 3OEWA 3ZV3A 1KH1A 3P9KA 1PR0A 3IPRA 3P4XA 4R3WA 5JH7B 3RVRA 1W35A 4YRDA 3L7MA 2Z5UA 1NXWA 2X5NA 3LDHA 1PHRA 2FJ1A 1I8TA 4ESFA 1SGWA 2CZQA 1TE2A 1QKKA 2E1CA 3H16A 1RAGA 3HR4A 1G8AA 1GPWB 1ZFNA 4Q9LA 3VJKA 3K1PA 2H27A 1CY6A 1YD7A 3U26A 2QTGA 5BV7A 1K6EA 5JBNA 3WL4A 4XOIA 1UHWA 1SOVA 2HA7A 2FPUA 3E05A 1OYWA 1DC4A 4WI1A 5LZ7A 5HRAA 1Q15A 1YS7A 1ZM7A 3CLRC 1HW2A 3OF3A 3H11B 3AMVA 3WRWA 2YY6A 1L1QA 3TNDA 3H97A 4DLWA 2OY0A 3JR3A 3ZHXA 4QFCA 3PQ8A 4R01A 1Z0SA 3ITEA 4ENTA 2KS6A 4F5DA 1OH7A 5IP9J 3PFGA 3UAYA 2QSZA 2XZLA 4XQFA 1U1DA 4PZ0A 2JN6A 1DP3A 4B6RA 4CYDA 3FVWA 4RB1A 1HYBA 4OQXA 4ZRDA 2ILVA 1GG2A 3RUEA 3KAQA 1MA0A 3AJ8A 4NDLA 4H0CA 5DM60 5BUZA 5ENZA 1Y7HA 2BHSA 1C3VA 2HJSA 1K88A 2XNDA 2M34A 5E6SA 3V1UA 1R5OA 3QTTA 4DQ0A 4KK3A 3QELB 1BJZA 4GVXA 4F5ZA 1WCWA 3PVZA 4Q9KA 2FX5A 3CONA 5E6RA 3EZXA 4LVUA 2DBRA 3L02A 4HDUA 2IU3A 3CUOA 4CTJA 4I50F 5BN3B 1DQYA 1Q0LA 4DANA 4GLBA 1OB5A 2XV4S 1JECA 4AU7A 1SU4A 2YVLA 4HSGA 2P9BA 2WYOA 4C3OB 3HCDA 2P35A 1V8FA 1OCCH 2JAWA 2WHYA 2YCLA 3ERCA 1W9MA 1O6GA 1G6Q1 1WY7A 3A14A 1SUDA 2HPIA 3HKBB 4WFJA 5EUMA 4YI5A 1JI3A 3QYEA 1EFCA 1I7QB 4HNHA 3PQJA 5CX4A 4CKBB 2WIBA 4HTFA 3OIWA 2Q5JA 2XBUA 3QMWA 4JX5A 3HC7A 1EP3B 2C0PA 4H6WA 5TQ0A 1DEXA 4BX8A 4OY3A 4ECEA 1Z83A 5ADHA 1XB2A 2HX1A 1KDRA 1HEYA 4QFDA 4B7XA 2M98A 4M7OA 3W8EA 3IUJA 4L9AA 4WNAB 4UKDA 3RW9A 1CR6A 3CH4B 3DAOA 4RJTA 4NU0A 1FZQA 1Y89A 1VCOA 3NJ8A 2WY8Q 4XQEA 3IDOA 5K0NA 4ESHA 5FR2A 5K0TA 4G37A 2P3QA 4WKPA 3O2PE 2DCMA 2JIRA 4PJ0C 3D8RA 3FCSB 3IERA 4CKYA 3OH8A 3ZMUA 3DQQA 5D6NA 3EK2A 3WA6A 4KA4A 1MORA 1SVNA 4ER6A 1KL7A 3BH6A 2PEYA 2VHXA 3G23A 2FQ1A 3IEMA 4PLWA 1YL5A 3EG5A 3R9KA 3W7AA 4XYEA 4ZGGA 1R8JA 3EYAA 5DI3B 2QKMB 3D7LA 4K9PA 3PDWA 5CB8A 2UUCB 1SWVA 3BOSA 3FPFA 3L4KA 2P5KA 1L4EA 2VXYA 1C9EA 3GJ3A 2V3CC 1ZIPA 4RDXA 3PBKA 2VDRB 1IY8A 2C1XA 4XYMA 1NV8A 3ZY5A 4YELA 5EUBA 1U9OA 1HUQA 3TLXA 1IPHA 2MMGA 2PZEA 1D4OA 2XPCA 3A6LA 3VVCA 4I99C 4X60A 1H6CA 2KB0A 4DAOA 4TS4A 1R9MA 4J0KA 4N0QA 3WYBA 5B2FA 2Y0BA 5L3VA 5B7NA 4RE6A 3PPIA 4L4UA 5I7SA 4A3MJ 1T0IA 4IHXA 4Y6SA 3GFTA 1U0GA 3WHBA 5CQEA 1EF4A 1IQUA 2VP3A 4OP2A 4NYIR 5HTKA 2VP4A 1X7WA 2PMBA 2R47A 1A2BA 1R15A 4MKZA 4C0LA 1Z5WA 1H23A 2EFYA 3NR2A 4XE5A 2HTSA 4CYCB 5I9BA 4RY8A 3DLTA 3V4GA 3Q12A 2ECBA 4ZQIA 5DP1A 1VDMA 2IZ6A 2DBVO 1YL6A 4XVHA 3BH7A 3OYMA 1HKQA 1DKOA 1GZSA 1VG0B 1FDIA 5GMOA 3ZDAA 1XN4A 1E0AA 2CEAA 3ZWYA 3D5LA 4PHHA 1ECLA 3VR4D 2QUFA 2NAZA 2XRNA 1OREA 2O2DA 3C5EA 1GRCA 3JR9A 5LU8A 5T7BA 5LXTF 1H05A 3V1KA 1XQYA 2I34A 4RS4A 5FCDA 1Y6FA 2MOKA 3LUHA 2J9YB 3PL8A 1CHDA 2RJOA 5KSPA 1RQGA 1T9AA 3VTZA 3X1XA 2QVXX 1W0KD 4TYQA 3C4QA 5CA1F 1NW3A 3C6MA 1QCCA 2AQ8A 3IJEB 4YB8A 3RZOJ 2EWVA 5E7JA 3BE6A 3T35A 5FPPA 3ZZMA 1RC8A 1OBOA 2IQIA 3AVPA 2FFJA 4XKJA 5AHKA 5H4HA 2PBLA 1JNXX 3GMDA 3ZS8A 1DJMA 3NBQA 4UV8A 1P4AA 2VSFA 3NYWA 1EFTA 4I9FA 4J4TA 4K03A 4N7BA 3BJAA 3ZY2A 3P8ZA 4EVIA 2QMUA 2P9YA 2YYZA 3BZKA 1Z6PA 3DW1X 3UK7A 3K4HA 1GN8A 1SZDA 1ESEA 4E7PA 5BWLA 5K5OA 4DE5A 1J97A 2A30A 3ND6A 5DNUA 1E77A 5AH0A 3FK7A 1QCZA 4D26A 1UKBA 3SIRA 4MP6A 1JBEA 5EI5A 4F12A 2UKDA 4D80A 4G85A 3KZ1E 1TRKA 4MQMA 4UTZA 1E58A 1SUAA 1MFPA 4XB1A 2Y2ZA 1R7JA 2O7NA 4YDHB 2GZHA 1T1JA 4Z0NA 3CZPA 3CR7A 2HAEA 1FMTA 3EVGA 1T08B 3ECAA 5KYXA 1O96B 2D13A 3G68A 3E1GA 4YO8A 3JTGA 1MO3A 2HCBA 2VYND 3AG4H 5LB4A 5L3SA 2K86A 3L07A 4H18A 3GCZA 3ZRGA 3HDDA 3A3NA 1WVGA 1A5SB 2VAVA 2ZBRA 3EXIB 3IEUA 3ZE7A 3S14J 1S8FA 4AM8A 4D5EA 4M83A 2B83A 1GQOA 3ENNA 4UEWA 5I7RA 3ZD6A 1S9DA 1D8KA 3CNBA 1GV0A 3CR8A 3PR2B 3N5KA 5LWQA 5IAKA 1MAAA 5DYMA 1JG7A 4MUGA 5H02A 1FXWA 2R97A 3HHHA 1NW5A 1CQJA 1X3UA 2WV0A 4JL5A 2Y1GA 1QVAA 6REQA 2DFLA 4DNCA 4LI0A 3BILA 3GXBA 1VQ9I 1NPDA 3PIPF 4H1TA 3SQWA 3A9WA 4OJKA 3TOSA 1M75A 3AR4A 4HS9A 1U8CB 3HCEA 2HH9A 2P40A 4QAQA 2NO7A 5LP6A 2M5WA 1GPH1 4G0WA 3DP7A 4YRFA 4QU0A 1QNLA 2CLLB 2QEXI 2PFSA 3AL3A 3P4UA 4NECA 1PZHA 5KYWA 1GU1A 3KEGA 1N6LA 1UPBA 3GFFA 3NV9A 3QJ5A 3THYB 4NCBA 1W4AA 3JRBA 3C6BA 2PWBA 1N6PA 2AZTA 2QG4A 3PE6A 4TUYA 1SHJA 1Z5VA 2YUTA 5MN5A 1Z5ZA 5JQGA 2X9QA 4H7FA 1KOJA 3CY6A 4UM9B 1ZJ5A 3MMXA 3BCAA 4HUTA 3G5MA 4E32A 1SC9A 1N2CB 4PPFA 1MH1A 4LVNA 3CLUD 4R6XA 1IY2A 4TT3D 1XPUA 5JFOA 1Q1HA 1EUDB 1PYGA 2MYPA 3DE5X 4OIFA 5FUQA 2GZWA 5IUNC 3K4CA 4OQQA 4LHXA 2F6RA 3PXDA 3L2VA 4PSAA 2Q8PA 3OM9A 2Z09A 1SU7A 3VPHA 1XTIA 1CHNA 4C4YA 1JMKC 5HR5A 4NH0A 4OHWA 4ETIA 4XUGB 5KSZA 4KB5A 4DPLA 4ABTA 2VBCA 3COVA 1NFQA 4U6NA 1E7YA 2XH8A 2ASVA 2JRLA 2GJ8A 4AYWA 1S5LC 1S3GA 2OD9A 3DM9B 3A3KA 3GRVA 3LU1A 1UK9A 2WSSD 4YI3A 2VZEA 5EIOA 4A8TA 3GJSA 1OYVA 3JXEA 4O0LA 1HNXB 1TW2A 3EHDA 3W9BA 5JR3A 1PEDA 5LOVA 1N9ZA 3S8YA 4R2HA 1W49A 3NIBA 4R83A 3DHYA 5LQUA 3DZJA 4GWLA 1E9FA 1MJNA 3VOBA 1QH8B 3OZDA 4OYLA 2E7WA 4BXUA 3FDZA 2V59A 1IV6A 4K3UA 1S01A 1WCXA 4GR9A 1YA8A 3LCCA 1K63A 3TZLA 2ZJBA 3LG2A 4KWCA 3F5QA 3NHYA 4OO3A 1AC5A 2V6JA 1R6TA 4G25A 1DI0A 3JD0A 1R5NA 1VIDA 3CVOA 2NW6A 3H0GJ 2VOJA 3E9RA 3CCSI 2A9FA 3M49A 4H7HA 3AU8A 3RK0A 1T56A 2O5VA 3H19A 3BZ6A 1UC4B 4GPEA 4DDVA 5HQ3A 5J2UA 1RYDA 3BD8A 1RXWA 2HK7A 3FMSA 4Q48A 2H1CA 2CUNA 2X19A 2AOVA 3CKKA 3LUJA 2NACA 4EGSA 4ZEVA 2QAGA 3GDFA 2H1HA 1ON1A 2Y75A 1Y80A 2YN4A 1F9EA 1GRVA 2G7MC 3GUZA 2K4JA 2FLVA 3QHAA 1N5DA 4MRAA 3S99A 4RTQA 5A6SB 4FFMA 5FI5A 5CVRA 1R4NB 2IPAB 3SXUB 4OMFG 3HM5A 2XV1A 3CVYA 3OOUA 1LB1B 1E2JA 4JR2A 4BFWA 1LC0A 1B1BA 4BFZA 4W5QA 3FMVA 2FMTA 1YZLA 3LX6A 4KMOA 1H3NA 1TO2E 4UE3S 2C9BA 3ZIUA 1P61B 2O1WA 3NP9A 5FUBA 5DGIA 1R4MB 3EEFA 1WQ4A 4ZEMA 3TDUC 2BM9A 2WJPA 5E2AA 4ZJUA 4L4RA 5IH3A 1RWOA 4I46A 1XNJA 3WL3A 4CV0A 1ACIA 1U0OC 4QC2A 4ZVQA 4JYMA 2QE7D 6AT1A 1E0KA 3CGGA 3NHMA 4WOPA 2Y30A 4EJWA 2R1TA 3QX9A 3CTAA 1TK3A 3ZU2A 4MK4A 2C7VA 2PG4A 1FDOA 4TXMA 2VP9A 2JUCA 1GZ5A 1ZK8A 4ODIA 4BOYA 1CXZA 3ICEA 3FK6A 1PUXA 2JGRA 4LOAA 3U7FB 1PBNA 1O03A 2BFDB 2Z2XA 3V4ZA 3VVBA 2Q5HA 3AW9A 1OR8A 1N75A 4MGEA 5JDCC 3ACDA 4I3GA 3WIOA 3DKVA 3V7FA 4HWRA 1A6IA 5BMZA 2EIXA 3VNUA 2DFFA 1E63A 2GZ2A 3M6AA 4PM4A 4GNRA 4H7EA 4LZPA 4UMEA 5CVDA 3H9QA 4KXWA 3DNFA 3QVVA 2VP2A 5JHUA 1H1TA 2RONA 2IXDA 3C70A 3OM0A 1N5OX 5TB5A 1G20B 1XGKA 2EWMA 4H4KC 2WU0A 3UY4A 2JVHA 2V7PA 4AZWA 4P0PB 4JX8A 2YHIB 2RJ3A 1ETVA 5FBRB 4AJ9A 3KSUA 4ZMRA 5FL3A 2FH5B 5KU7A 1IZZA 3NHPA 4OIRF 4PLYA 1P1CA 1RPJA 2J45A 3EVEA 1V71A 3FZVA 1A9XB 1K6MA 1RI5A 2P0EA 1I32A 2XNSA 4FFWA 4K9SA 3CN9A 3NHAA 1H9BA 1FEXA 4DCCA 3QYAA 4E5NA 3V5NA 4PTYA 4RFLA 4PU0A 5T5QA 1IRZA 4M49A 1Z63A 3BR3A 2Z58A 1U78A 4JQSA 3LSTA 2A8YA 3WLNA 5I4CA 4UPDA 1WMFA 4TQ9A 1UWLA 5IG2A 2QAIA 2G1JA 1CJKC 2O3JA 4MJ3A 1GVNB 1J06A 1PWHA 3FWPA 1DX9A 3W3AA 2V3WA 3OYIA 3D6HA 2QOEA 4BEVA 5HE8A 5KTKA 5F6FA 4AG6A 3L4JA 4BHTA 3E84A 2FE3A 4DEXA 4HX2A 4BEHA 3ZJ4A 4R71A 5K0EA 3NQ41 4UHBA 4ONEA 4A16A 3ZWAA 1XRLA 4EF6A 2NN3C 3PUXA 3GCWA 4MCIA 3GFVA 3K6RA 4U8GA 3WIEA 1KEEB 3D8TA 1HDPA 1DJOA 3OLWA 4IV0A 2ZUUA 1T36B 4LYEA 3VAAA 1W4MA 4KYWA 1NP6A 3GVCA 5HF9A 5KJFA 2P7CB 3N8DA 4RMIA 1SOUA 2OXEA 4IVRA 2RI6A 1D2NA 3WRVA 3K9TA 1N7IA 1PZEA 4FQ5A 1OH5A 2DC1A 3CLRD 5ARDA 4I5FA 4BECA 4JFRA 3D5EA 3FZYA 3TOVA 2ZWPA 2Q4RA 3CINA 2A05A 1H66A 2XIJA 3E03A 1KC1A 3EJ6A 1I4LD 3Q72A 4JNCA 3K1MA 1S6YA 2CDCA 3QI2A 2JCGA 3GO4A 5KX5B 5FXMA 1GZ4A 4FYXA 4JGIA 3A1YA 4ZDWA 1KEUA 1NMZA 1VLVA 5BN4A 2V96A 3RIHA 2H5LA 5BS6A 2FTKE 3AUAA 5ALWA 2GO7A 1JWLA 2FYTA 4K05A 2JIZD 3LUFA 2K4BA 3Q3EA 2YU3A 1A4XA 1JDSA 2VUTA 4XGIA 2F3SA 3THOA 3L92A 1NQUA 4PHFA 1DRVA 3KOUA 3HA5A 3LT0A 2OQ2A 4M60A 3KP4A 2OT3B 4F4UA 1B15A 1VBFA 1W8IA 5I7FA 1ONPA 4MYTA 3HJNA 5F21A 3PDIB 3TR0A 5EGOB 4A0RA 1QH9A 2PEZA 4CL0A 2PAFA 1QS0A 2Z4TA 1VGVA 3OA2A 5CXQA 3E3LA 1R2QA 4Y0AA 5BNFA 2R5ZB 3CUSA 1ECGA 4ME6A 4R1PA 1HLVA 1FXUA 2OZUA 4HUQA 1EUYA 4J01A 4Y15A 2XZDA 2CLEB 1DAGA 5BV8A 4V19K 1CB7A 3LY7A 2H5IA 3H9UA 2NXEA 3OM1A 4QBKA 4EMUA 1NHWA 1W0JD 4LG0B 3V8KA 5ITSA 4F92B 2QPAA 2NS0A 1YR9A 1MW7A 5K0JA 4YRSA 1BN7A 4QG7A 3KYJB 2P62A 2BY1A 1BSVA 1KI3A 2LP4Y 1XZEA 2RBEA 4B4DA 4B34A 4AZ0B 2EFJA 3IXLA 5JSZB 3LAWA 3I53A 4G5HA 2E3JA 2DHDA 2Q4EA 4UBJA 4B8ZA 4CEIA 3U60B 1N2SA 2WT9A 2C57A 1QP7A 4EA9A 4S35A 2Z1DA 1SKYB 1MDMB 1M54A 1PVOA 1BQEA 3HA7A 3L6BA 1EEHA 1ACLA 3OX3A 1P0IA 1HSTA 1N7HA 3IR6A 3EZ6A 4LXUA 4BFTA 5FTNA 5FUMA 1YMVA 1RAEA 2PE5A 2WIFA 3A9CA 1IONA 1SPXA 2DMTA 1S72I 1TEHA 2GHRA 3IBCA 3NCTA 3VPSA 1IZYA 3JD2A 2LKPA 3KCQA 1JL3A 4OP3A 4JENA 2XODA 4UCWA 3MERA 2JJ2D 4JVSB 2EKBA 4LWZA 4POOA 4IXWA 2CO5A 3NETA 4ZCLA 1SUIA 4DJDC 3VOTA 2F5CA 2COMA 1BGVA 4DSTA 1M74A 2WDZA 1PJAA 2FUG1 2Q5CA 2Z9CA 1E79A 1XYGA 3SXPA 1SUWA 2CF5A 3QEOA 3RVSA 2UU9B 5EZGA 1SURA 2H1OA 2ZRQA 1JQJC 2HKXA 4ITVA 1NDHA 3LZDA 1DKQA 2I3GA 4R79A 1QK5A 2YYAA 3DZ8A 3E4CA 4MIYA 3HBJA 2C0CA 3MOIA 3FKSD 4ZARA 4E5DA 3PFKA 2Y69H 1ORVA 1Z22A 3TBFA 1A69A 1C80A 1U3CA 2F00A 3E70C 3JAKA 1XG1A 1G64A 1U3GA 3DUFB 2BDUA 2WR8A 3ZHTA 5JAPA 3DLHA 3DP9A 4RF4A 2CVFA 2FEXA 1E92A 3AGQA 4AL4A 3Q5EA 2DZDA 4XRGA 3AUSA 3FM5A 4NG5A 2OPHA 2ZUTA 3HUUA 3IDZA 4IYRA 1TMOA 3JQ9C 1DAOA 4DYVA 2O8DA 3FROA 2N8GA 1WDLA 4FQ8A 4QGGA 4NU5A 2IDKA 2HDOA 4OKIA 5DLEA 4BUJA 5A0VA 3F21A 1V0JA 4UBMA 5HIKA 3MCUA 1QVTA 4KR9A 2PSHA 4A93J 1O3RA 5H7XA 4XWYA 1DZ3A 3FWZA 3H18A 4RTKA 1PDVA 3X2SA 2HKOA 1LBQA 4W4TA 2H92A 5HJEA 1QV9A 3I9OA 1XE3A 1GQYA 1K86A 2YXNA 1H6BA 4YECA 5GONB 5IU6A 4IF4A 2HF2A 1FE8A 2FX0A 2HD4A 1S4QA 4RH3A 4LB6B 4CMJA 5JNWA 2CZGA 1CY7A 2XYVA 2HU8A 2ZRLA 2Q3CA 3EPRA 2H5EA 2DT7B 4QQNA 1L5QA 1GGMA 3UKOA 4FYIA 4UASA 1CIJA 3U9TA 1NSTA 1SEVA 4RTRA 2DULA 2HXOA 4I3HA 5JSQA 2HSGA 1S5PA 4GMFA 4OWRB 2YBEA 3IESA 3LQ2A 3P45A 1M8PA 5AW8A 1MO6A 5CDYA 1AGRA 2XYQA 4TRJA 5C8XA 1FTYA 4P31A 5JG7A 2VT3A 1G5RA 2IHBA 3GFOA 1UT6A 1F2VA 1MVNA 2W71A 4LF5B 4AUMA 2RIRA 3DMDA 3KELA 4L3WA 1Z05A 3K69A 1TI7A 4PVCA 4ZT4A 4R3NA 3OCWA 3RGWS 3HV0A 4DXHA 2MYSA 1SUSA 4NV1A 1P17A 4DCUA 4BACA 4QU8A 4MVJE 4KWHA 5B3KA 3CZ9A 3HV2A 3MJRA 1ZZEA 3ILVA 2Y92A 3OE4A 4IHAA 2EV6A 2ZU0C 1VXOA 2UZKA 2VN2A 4NMMA 5CRIA 5B3JA 5L3GA 3V8VA 5BOSA 3A6DA 3S81A 3PFNA 4QATA 1HLGA 1C7RA 1FNSA 2GVDC 2P0AA 5HF6A 2J4CA 1P19A 1RJGA 2D7JA 3D7KA 4AFNA 3NWTA 5DSTA 1BFDA 2CCGA 4WWHA 4EHIA 3AL0C 5KVVA 2FPIB 1TT7A 3L0YA 5KWSA 4LK0F 3EQ9A 3MTJA 3TXYA 2ZWVA 3H1FA 2VKHA 2D0OB 2P2CA 4E1AA 3LPNA 1BS2A 1RZRD 1FFWA 1NBME 4A3IJ 4XLPF 5DT2A 1THGA 2ZI6A 3TIIA 1QOZA 2VT6A 4MUHA 3DV2A 3AIIA 1Z17A 2PNJA 3TGPA 4UZFA 3SYMA 1OX6A 3WK6A 1BEZA 4YUVA 2I78A 4OQDA 3JX9A 3OIQA 1ONOA 3WK5A 3FXMA 2Y0SN 4YV1A 4JLKA 4J00A 2OZLA 3L0ZA 2Q8QA 3R3UA 4FMPA 2QPLA 2D0DA 2ZYDA 4AECA 3H1TA 4HDRB 2CXHA 5J4YA 3OZ7A 4BLSA 4OX9B 2PH3A 2VTKA 2YMMA 3EXG2 4PFQA 1RKVA 3UPUA 3TLEA 2CFSA 1UFQA 2PSEA 3IHLA 4FE4A 1GKLA 3D5RC 1UJ8A 3AJAA 1BDHA 1CQTA 3PQ7A 2RFLA 2PYIA 1Z74A 2B1IA 1T9DA 2NT3A 1EB9A 4FWIB 4D9IA 4WXDA 2P2NA 1E3PA 1L3IA 2CS3A 2G63A 1B8IB 1Q0UA 3KEFA 3LUAA 3FBWA 4X3CA 4YNBA 4HD8A 3SJZA 2JJYA 3V6MA 3L9FA 4L9WA 2YFYA 3BIJA 1FFDA 2CMKA 3M6MD 2HLDD 1E7MA 3ER6A 3KC2A 4DRZA 5IBPA 2QTWB 1MKYA 4L50A 5D2CA 2BMEA 2OFPA 1FVOA 2HGSA 1U3VA 4B3AA 3R0ZA 4BKXA 4ZTFA 5EGOA 2OCPA 4LJ6A 2ZMEA 1FA9A 1SKAA 2X9GA 3WMGA 4E07A 2ZSBA 3IAHA 5K3SA 1U5TB 3RSNA 1QRRA 5GADJ 2BFCA 2X3YA 1KMIY 1V11B 3UCXA 4PAOA 1KOLA 4CF5A 2JGLA 3UMRA 3L7CA 3M34A 3NKLA 2BR3A 3D43A 4G86A 3FVRA 4M9QA 4EB0A 3BL5A 2HLPA 3VHXB 4AJLA 3BTLA 3FRHA 5FKJA 4L2IB 2IHJA 4ND6A 3TPFA 1V6CA 3MKZA 1YE8A 1RHUA 2XUQA 3DAGA 3B53X 2ZYWX 4XRFA 1V5WA 1AKHA 1CG6A 3HXTA 3PEVA 3JSOA 1NE2A 4FCTA 4PZYA 4R7GA 3JZIA 3UTCA 3HYIA 1M2VA 1TGYA 1SQ0A 1Z4MA 3AG5A 1R23A 2QQ9A 2XSJC 1E17A 3ASVA 3H2KA 3V6LA 1QHFA 6CHYA 2H94A 4B7ZA 4ESBA 4FE7A 4RA9B 4BVBA 1WAMA 3S40A 5T4FA 1R1UA 5CH5A 1PZGA 2GYYA 1V1RA 3OP4A 2VTBA 2QQ8A 3NT2A 5EXXA 3NKFA 4OBBA 5ALJA 3ZMTA 3D2CA 1H42A 3WTWC 3I3OA 3WX0A 5B1EA 4B6GA 2CUZA 3GZJA 3KQNA 1I5OA 3HJRA 4FSHA 3UEOA 3JVDA 3H11A 1Q3TA 1EI9A 1Y8QB 3DO5A 1TZBA 3CUTA 4B3GA 4Y2GA 3SVTA 2ADUA 1RWVA 1YZQA 1YZUA 3SC2B 2G17A 4FMDF 4AVPA 1QQTA 5LWHA 1YDFA 3QE9Y 4QPNA 1K4TA 2I87A 2IA2A 2A6HF 1UDAA 2F8MA 2NNWB 2ZJ7A 3SYNA 5JIBA 1VLJA 3AG3H 5DHQA 3UHPA 2AOTA 4MEXF 2H8GA 4G0VA 1VPTA 2JZOA 3DFGA 3ZI4A 1KRHA 1T0UA 1QVRA 3MYYA 4J43A 3A9RA 4XR6A 1HL3A 1I5RA 1MQ8B 1Q0RA 3QFCA 4K6FA 1Q7CA 2P9FA 4MWEA 4XWAA 3VI4B 4YK7A 3X2FA 4C0QC 1DB3A 2XRYA 4CKBA 1KP9A 4RM2A 2QTZA 4B4UA 1MBEA 5IT4A 2QRLA 3G5LA 1IH8A 1NQAO 2C88A 4C6TB 1IBMB 1NZFA 2GBLC 4PZLA 5KYYB 5EYPA 1YFJA 1TL8A 1Y5MA 4EO7A 3B52X 1DV2A 2XXBA 4GKVA 4OU5A 3HKEB 3GLKA 3HKCA 3AR5A 4J16A 4Y2PA 1GNSA 4C30A 3I55I 5M2QA 2OYSA 1A2OA 2RKBA 5KTPA 4LMBA 1D1PA 2RGXA 4ALNA 1B14A 3VZBA 2I3DA 2PMUA 2D3WA 2M6KA 3S6JA 4CG1A 3OPQA 4MVCA 3JRFA 1VQKI 4LIUA 2Q2EB 1ADFA 1JLLA 1YAHA 1X70A 3AEXA 3HEFA 3LOQA 4IIJB 3ESWB 4N5IX 4A0QA 4C7BA 4M9UA 1QF6A 2FRHA 4J1SA 4PQEA 4FI3C 5KQLA 4XL9A 1M1XB 3ITNA 1YITI 1MKMA 2J48A 2YZ2A 3BSSA 3DOHA 1U8AA 3F46A 2F1IA 4RXMA 3SQOA 3FMQA 3SBEA 1UELB 2R1TB 3EDOA 4V3BA 4FT2A 2EP7A 3VPBA 4J1QA 3C1OA 5JBQA 4LJYA 5DHTA 1TYBE 2VHJA 4B6SA 2M8EA 5M3FJ 4AVZA 2Q07A 1L8OA 3A9UA 4D0RA 5EJ2A 1QX3A 4D1YA 1AMOA 3MTEA 1K7EB 3E7WA 2CXQA 4IIBA 1B0AA 1NT4A 2QTNA 4XSHA 4ZAWA 4E31A 1LSJA 3BFJA 5A3JA 4JELA 3PPXA 4BKRA 1FL9A 4LN1A 4WZAA 5JVDB 1QTIA 4KBYA 4KXMA 1VIMA 2H06A 4OUKX 1XZKA 3AY0A 2Q5FA 4ZJZA 1VQ8I 2JHGA 2W2QA 3CNHA 2QLBA 2AZMA 2FEPA 1H2BA 4OGGA 3OOJA 1IRIA 4QEDA 4XNFA 3ZJ5A 5JDIA 1X7ZB 4X54A 1PDOA 5A5FA 1Q1ZA 1UBRS 1E3HA 3EW7A 5EESA 1WJDA 2GMWA 2Q2NA 4J6FA 2W8BA 4ENUA 4RC9A 1NAIA 2IBSA 3H3JA 4D43A 4BS9A 1ZI6A 3B8EA 4DMUB 3O8GA 4UUAA 2IYSA 2GPTA 4FONA 2P2LA 2P77A 1E5VA 1EHCA 5PNTA 1NGSA 2FSVC 1AQ6A 1YDGA 2LCFA 3CW9A 2B63J 1UKZA 2PJZA 2FPPA 2WT8A 1ZRCA 3KB1A 3IUYA 3OC6A 1GV1A 3R8FA 1SD5A 1XXHE 1J9EA 1I6MA 4F3KA 2BC9A 4BHBA 3PIIA 1XNQB 3CS3A 1AHNA 4IKEA 3NVKI 1XGOA 4Z0TA 2LBFA 2RGBA 3BJRA 4MRSA 1YIJI 2BUAA 2Y9YA 3ESCA 2QJOA 3JASB 5AJZA 4R9VA 2SKCA 1LDJA 2B3DA 4G4JA 1UZCA 3EEQA 4BTVA 2W84A 2RKWA 3FKQA 3STTA 4WJLA 5IWCA 4CMGA 5GWXA 2GN6A 5EFZA 1GO2A 1WV1A 2DDBA 5KVRA 1FVXA 1G20E 2ZRNA 1Q50A 3RH0A 2BJWA 5A4KA 5JLXA 10MHA 2JHFA 4CM8A 4YBRA 3G02A 4M6YA 1WSBA 2BDTA 3LBAA 1W76A 3O4FA 1H8AC 3LC7O 4MLPA 4C43A 1SU6A 2V58A 2WE8A 3I4FA 1MOPA 4M0CA 2H52A 4I9NA 4NCHA 3PQ5A 4XN3A 1GCOA 1HE1C 2PY6A 1BE8A 1R8SA 3GWGA 4PXAA 1LDGA 4M3NA 5F2EA 3SX4A 4JI4B 5HNKA 4L9VA 2C5SA 2JFUA 1WX1A 4AKSA 5MDHA 2A2ZA 1A9ZA 2V54A 3DFZA 3N70A 4QXPA 2CT8A 1KHHA 2ZUBA 1EUDA 2CG4A 4URZR 1TT5B 4JAVC 4Z7QB 3DBVO 4BNMA 2CL7X 4HYEA 1A5JA 4YONB 3U31A 3AR7A 4Y6RA 3RAFC 3DKXA 2CXXA 2NOAA 2VUUA 4JOBA 4FDTA 3TVYA 1ZW1A 1V8ZA 3R4VA 4HPJB 5IJ9B 1CY0A 2I9KA 3DBRA 4XIYA 2RGNC 1UMDA 4EEZA 3NEJA 2QXTA 2PD6A 1UPCA 2R62A 1ZH4A 5JCXA 3V7CA 3UXHA 4CKZA 2NXJA 3ICQB 1GL3A 3HKDA 3GA0A 3RSQA 3HWSA 4EI8A 2YX7A 3SXYA 4KNYA 2FN7A 4L1KA 2F8SA 3EEIA 2X5KO 3ABZA 3UB4A 2HFHA 1R5GA 1C9MA 4REOA 1A8IA 2WSSA 3A25A 3C3KA 3O8OA 2UYYA 2HHJA 1OXTA 1C8LA 3GTMJ 2REQB 3UMJA 4Z8YA 5EZHA 3BDAA 1SA0B 1VFPA 6NULA 4AKTA 1FIAA 3TEDA 4J16C 1GQSA 4P7FA 3V7RA 3C6YA 4RHUA 2AN9A 1GD1O 2WABA 1NJ8A 2W58A 4Q7KA 1IBSA 1OAOA 3FA2A 3RWMB 4J29A 2W8ZA 4P4GA 3ELDA 3JQ7A 3DEUA 4PZUA 3MWYW 3NDRA 5DSXA 1NXOA 4TLDA 2PUWA 4DMRA 1MBZA 1J5YA 2G8LA 4OFZA 2QM8A 1LPMA 3ET4A 3QUSA 4PJLA 1JQAA 3ZP5A 2IYQA 3LE8A 4RPHA 3E9NA 3I64A 3SBDA 3BORA 2YVKA 4AB1A 3HBMA 1XNHA 2VLIA 3VPGA 3E2PA 2OUIA 3THRA 4D0LB 4DABA 3PGMA 1A9OA 4ZP1A 4WZAB 5JVDA 4XUEA 1MTOA 4RKRA 4E12A 3CVVA 5FWYB 3CZ6A 2UXCB 4TTQA 4RU1A 1FTGA 2RAVA 2IY7A 4JQYA 4DQXA 1G2IA 3JWHA 3OCJA 2QT9A 5FD5A 1R16A 4A2PA 4AIIA 4BGIA 3K9BA 2WNHA 3LWNA 3W6UA 4ZVRA 4UHJA 4L22A 1WB4A 1U5AA 2CEKA 1XQWA 4PSKA 1IAVA 1TTTA 4LF6B 3BIOA 4XUCA 5AW2A 2AC2A 2IIQA 3ABSB 1CS4C 1LSOA 4L85A 3OS2A 1ATZA 1U8EA 2G82A 4V24A 5GPBA 4U6QA 4GOJA 4K2EA 1YZHA 4E3WA 2B4KA 3UA4A 3CLOA 1NSYA 3D3JA 4HNGA 4IDQA 2WNIA 2OO3A 1G3QA 1VE1A 2OK8A 1EG7A 2R1ZA 1ZAOA 2FU4A 1IG3A 1XROA 1UXHA 3P9NA 4RL6A 4DA8A 3SM3A 4DC0A 4Z1MA 3A3PA 3N3AC 4OH7A 4JLJA 4PIMA 1UEJA 2VJQA 5WRFA 3RYIA 2E7XA 1TQ2A 2FW6A 5D3MA 1IOVA 4BP8A 3B1XA 1TQPA 3DLAA 5GV8A 3EVNA 3H1CA 4RV5A 3OLQA 3T9DA 3ZPXA 1KSHA 2P7HA 3LPMA 4DLPA 6Q21A 1Y1KE 2QCOA 2K02A 4DJEC 2OHGA 3TMOA 3OWOA 1VA4A 2MSDB 2XB9A 3IBYA 3RKUA 4BQSA 4LPKA 4DB2A 1GQ2A 1Q1BA 1ZMOA 2PZAA 2QD1A 1YASA 2FLWA 3M4NA 3S2EA 2QRVA 3K0KA 4MW6A 4C0XA 7REQA 1MGOA 2ZJRF 2BGGA 1NNSA 2PRIA 5U9CA 1DKLA 4WOBA 4Q9NA 4RO0A 3MMZA 3CMAI 1OC2A 5AM2A 3CF6R 1YWGO 2H2GA 2ZREA 1G19A 4F2PA 3R7WA 4I5GA 1QE0A 3UICA 4WXMA 3W4JA 4F5EA 3K70B 4LZAA 3VR3D 5FLVA 2Y76A 1RRCA 3QFSA 5CNIA 2DCEA 2H18A 3L7BA 2HCJB 2HR3A 4MRVA 3NAMA 1JKRC 3F6BX 1BWRA 3K1NA 1ZINA 5FB3A 1KTIA 3BB1A 4W9NC 4CFYA 1RFGE 2RD2A 3AEKA 3N2NA 3QWLA 3I5XA 5CG1A 1EQUA 1ZNQO 1FP4A 3WRXC 3OS0A 1T8WA 3QWBA 4QBHA 4OYHA 4RQBA 3KJQA 5LP1A 1V43A 2Q7XA 2PL9A 3PKJA 3QKTA 2ATEA 3YASA 1H2AS 1GVJA 1II8B 1CJCA 1R0SA 2PGJA 4DFDA 3COZA 1RQ2A 3AXSA 3FIUA 1QRYA 2HZDA 1HT0A 4MUYA 3CG0A 3K10A 2JVKA 4QDXA 4YRBA 4H59A 2Q5EA 5LFAA 3ABTA 2X58A 4BN4A 5JH7F 2GRAA 1JSZA 4R69A 4MQ5A 2O03A 2QQEA 4GBGA 4XSGA 3DCFA 5TJJA 1LPQA 3GJYA 3WB2A 2QORA 2EW1A 3BREA 2ZJ5A 3L4SO 3C0KA 1UJMA 4AJNA 4BP1A 4D4IA 5KTSA 1MX9A 2R7SA 3GVXA 2D5AA 3RVJA 2WLSA 2FCRA 1TQDA 2QZZA 4YXWD 4I8IA 3CH6A 3KFLA 4LTDA 5LQJA 3CCFA 1R49A 2HYFA 3CC2I 1U9NA 3PXXA 4RKFA 1V2GA 4ZT2A 3GK3A 4RSRA 1E32A 3HNPA 5DN9A 1HXDA 2EGUA 1SBTA 4L08A 5J59A 3EX7C 2CLDX 2CNBA 2FF4A 3PEFA 3QMMA 3VOAA 4AKIA 4KN8A 1Z07A 5EHGA 1N8NA 4HATA 4U3JB 1PSDA 4QYIB 2YMPA 2MJLA 2XTZA 3I9JA 1M8JA 1JAYA 2ZIFA 4OA8A 5EP3A 2BELA 3TGNA 1U11A 2DH5A 2GH1A 1ENYA 4CMEA 4F4FA 2VPRA 1U0NA 4UTVA 5JRZA 1JHHA 3PG5A 1UBKS 2G9QA 3U2RA 3OX2A 2ATVA 2I7XA 1BCSB 3DXZA 3FPLA 2VDPB 2XYGA 2W4MA 4JASB 3V4LA 2BXZA 2MBFA 2OG2A 3RKXA 3OFKA 4KACA 1HDRA 4DM7A 4EO9A 4A0FA 3RYHB 4IW3B 3ZOBA 2AQIA 2OD7A 1E1QA 2B2XA 3JAWB 3L0SA 4UAUA 2M45A 3LF2A 1JG6A 3WKEA 1MEOA 5HLIA 1L3CA 5EIFA 1R64A 4LXYA 1XU4A 2II6A 3AX6A 2IBMA 3L3BA 3TK1A 2J5OA 4H2DA 1KA8A 1B8IA 3KP1A 2J6BA 1UMCB 4UEOA 2VIXA 1U0JA 5IYZF 3KSZO 2PX2A 4J76A 4BMCA 2WFLB 5DN6A 4ZEOA 3DMHA 2M0MA 3D4NA 4OFXA 3R3XA 4G41A 3Q5FA 3K94A 3ER8A 4PLZA 4B6FA 1WB6A 1Z5PA 2AMLA 3AR6A 3TVTA 1E2PA 1LCIA 2R0QC 2J5XA 1E3QA 1ZD3A 3N05A 3QNUA 4JVOA 4TN1A 1Q17A 2EF1A 13PKA 1Z4OA 1H2ZA 5FI3A 4D0PA 3I1FA 2OQRA 2QVLA 3LY8A 1CF9A 1VPVA 3OZGA 3QU2A 1YZ3A 1RRMA 2YWHA 3DMNA 4YLYA 1TJNA 4GKBA 2OBMA 3VR5H 2RC4A 1DL5A 2WAFA 1TU0A 2I2AA 4TWRA 3E6DA 3R3WA 4KJZA 1QC5A 2HPVA 4HGZA 2EVWX 1YJQA 2WADA 2POCA 3L6CA 2C2ZA 4X1KA 2OESA 2PZJA 5J2UF 4Q4LA 3D3WA 2VAXA 1G8PA 2NU7B 4DDMA 3RK4A 4IFTA 2LE0A 5LHGA 1F4PA 2O54A 2XPWA 1LI4A 2XCUA 3LUDA 3QRFF 4Y2XA 3VISA 4Q15A 3BWCA 1VIYA 1B00A 3QZUA 4NC7A 4ZZLA 1YDHA 2X40A 3DGEC 5AJYA 4ZVSA 5J43A 3KQUA 4RSMA 4D41A 2BFPA 2RI0A 5K8UA 3PVSA 5AKLA 2ZKZA 3IHUA 4M7RA 4G5GA 2G1PA 1KO7A 4MTLA 4HVCA 2FAXA 1O9BA 4UHKA 4DQ2A 4DA9A 1NPYA 4HVTA 3ZW8A 4PLCA 4CCSA 1NUHA 3HU2A 4YAEA 2PBIA 2FQYA 1JKJB 1FJHA 4JS0A 2DPXA 5A5GA 4BWVA 3O1JC 2I2FA 3DDOA 2GKOA 2QQFA 2RK4A 4GI5A 3PUWA 3OYDA 3FMOB 2ZW9A 3GAMA 3PEUA 3JW8A 4YUZA 5A06A 3IOBA 3HNRA 1RQRA 3AHDA 1KQNA 2MC4A 3EIXA 1C3JA 3SHVA 1XTUA 1HXHA 1XTJA 3I6QA 4U2CA 1D7OA 1EWQA 1GUBA 2CXSA 3N2KA 3W3AH 1QO0A 3BR0A 2DPMA 1ZCBA 2LK2A 1E1CA 3RIMA 2D0IA 2O3SA 5BV2P 4RBOA 4TS1A 2QBYA 2BR4A 3EBLA 2F9MA 4RL4A 3ZX4A 3AUTA 3RZDJ 1LVKA 1DUIA 3PFBA 1Z68A 4HNAA 2JG3A 4W1QA 1WJAA 2P9GA 1FRNA 1WFXA 1ZKDA 1CIVA 1UQTA 3LHSA 3INRA 1PGNA 4UE6A 2P9EA 4EY7A 2HMYB 2EFHB 4KOEC 2O0MA 4PQFA 1XCVA 1SCNE 4PLVA 3SE7A 3ZR8X 2EIHA 1J22A 3IPLA 3TRJA 5F04A 2GA9A 5B3AA 1VSUA 1BU8A 3KCCA 1BZYA 4JB0A 3WGQA 4FOLA 3FNBA 3JQQA 3FIWA 4U7DA 3F3SA 1QWSA 1S02A 4ND8B 1IFXA 1QTNA 2CHUA 2VHTA 4M1MA 3TM4A 1W87A 4QELA 3GIDA 1GTJ1 3N76A 1DBRA 5J5VA 2O8EA 2GIZA 2AFHA 3U0VA 4RJKA 4V0SA 4EB6B 3M8FA 3VDXA 4CL8A 3UJ6A 4Y9TA 5FNVB 3RCBA 4TROA 4BJ6A 4GM1A 4B7UA 4OXXA 1PLJA 4JQCA 1KSGA 1D1AA 1E6CA 1PJ8A 2XRFA 2PLRA 3AINA 1NXVA 1BJRE 3KAJA 1EFAA 4PDKA 1LKZA 2AJBA 4FC6A 2GCGA 4FCYA 3Q9UA 3VRHA 2EDCA 3EFEA 3LQFA 3GDWA 4F4CA 3TQHA 1Z6ZA 2Z5FA 3BE4A 3QU4A 4UBNA 2LSOA 2PAAA 3FGOA 4HPQA 2RGWA 3VHQA 3SZOA 2W83A 3NBXX 3D9QX 4ND3A 4TXJA 1HZZA 2O8EB 1AN9A 2UYGA 4MJXA 1RHKA 1VQOI 3F6RA 4TTRA 1QYRA 2M4KA 4BX0A 1YC5A 2ZRMA 4JNKA 4CKEB 1TVKB 5FGMA 1H0HA 2CBZA 3OQ6A 2E9SA 2HMTA 3GBGA 1YW9A 1WLSA 5G0TA 1C0IA 2GBYA 2VTVA 3P0IA 4O6VA 5AOAA 3IMFA 4DUZB 2OA0A 2ZVQX 5CU7A 2AOUA 3EFBA 5CFMA 3HOWJ 4XSZF 4EGZA 1RWKA 1TJ4A 3TQCA 5K6RA 1C2YA 3AVWA 2PPLA 4JCOA 5CAEB 2ZBUA 3H5OA 3SDBA 3K2EA 4RORA 5KQGA 1JE0A 1XCOA 2HSWA 5KYGA 2XASA 4E5KA 4KR0A 1T5LA 3AAFA 2YWCA 2F5VA 3UV3A 4CGYA 5KHOC 2QVCA 1Y9JA 3G1MA 4AIJA 1LJUA 2GAOA 3N0RA 3A02A 4CEIB 2H6CA 1L5FA 1M33A 5JSZA 1TWCJ 5EP1A 2EIMH 3KZKA 3OMWA 3EW9A 3FLEA 2O4CA 5CYFA 4Q03A 4EG6A 3PXUA 2NU9B 2AMYA 2GN0A 2Y77A 3EIUA 1JJ6C 1FYDA 1D6JA 1K6XA 1WUHS 3KZNA 4M55A 1BDJA 3T0GA 5ADVA 3L4BA 2CQ7A 5JNLA 1R8XA 3ST7A 3P52A 4UV9A 2HYDA 3UK1A 2COBA 4LLNA 1ODCA 2IELA 3OG9A 1XD7A 3IA2A 2ZJZA 3QLJA 2LOOA 4LQLA 2A9JA 2R7AA 3P71T 2C5BA 2ZBPA 4OL0A 3C3AA 5FPYA 4XOUA 1ESDA 1VPLA 2J32A 2QM0A 5F9HA 1XAJA 3O2QB 1O7FA 5K7HA 4I8DA 1L4MA 4PNZA 3GPBA 5ALVA 4G12A 1OI3A 4XZ3A 2R65A 2BCJQ 3VYSB 3HN7A 2I33A 1U5BB 4JR1A 3V8RA 2YXBA 2KQUA 4ER0A 4WGFA 4Y1RB 3INTA 1P31A 5D51S 5EVCA 1ON2A 1NLMA 3LSPA 1UPXA 5KHAA 5GVSA 2IH4A 5B6IA 3NHBA 1XELA 2BMJA 1P62B 4C78A 2XKJE 4ZCTA 1ZK0A 3E5HA 5B2EA 3CLVA 2RHTA 3CNEA 2HPAA 3HBFA 4R68A 3KZMA 4YV2A 3IL2A 3NBFA 1M1YA 2DSNA 2Y67A 3HJHA 5KVAA 1RJFA 4F5YA 3DU6A 1HO3A 4D7NA 1TM1E 1GR1A 1MDFA 1KEZA 3ND5A 3OZEA 4GQBA 4NFYA 2WKQA 2XWBF 3PQFA 2AWNA 5E4FA 1RNLA 1MQ9A 1THZA 5HFJA 4NULA 4LY3A 3ZWPA 2GN4A 7GPBA 5JC1A 2XYPA 2ASEA 3HBLA 3KZYA 1ZRMA 4H1VA 3V8EA 5DDIP 1II9A 3ONEA 4R0NA 5F23A 4JX9A 4MDFA 5B1HA 4WAUA 4YHBA 3HXKA 5HZKA 3L04A 2LRHA 4W5HA 1UAAA 4CUKA 3DBOB 2ZQZA 1SVKA 3E4DA 3M5CA 3OY7A 5BYBA 2VYVA 4RD3A 3CX3A 3B2QA 2QRZA 2BR5A 3HL4A 1DWUA 3AF5A 4FMBB 4NFSA 1TKRA 2QVOA 1VHDA 2FVXA 2P5YA 1RWWA 3L01A 4J9UE 2YASA 3W2VA 5LPNA 1UF9A 1F8XA 3QODA 1XZMA 3CTPA 5FHQA 3ZDCA 4K1LA 4RVSA 3RO7A 2SICE 4C4XA 3ZCSA 3I3LA 3DPUA 3GF4A 1ZH2A 5D1NA 5K51A 4E6KG 1ZRFA 3CZCA 5ALSA 4BLOA 4MW2A 4CF3A 2KLHA 2X6TA 4OYYA 1T6YA 2FWNA 2IYAA 2XT0A 3K4LA 4GKKB 3Q41A 1A98A 3IUPA 4G0NA 1O7LA 1G5HA 4XA8A 2WAEA 1FDSA 1X7YB 3F3MA 5FI0B 5BRNA 1L8XA 1R74A 2CVHA 3R76A 1G2PA 2Y9ZA 2XD4A 5GJWC 3TLGB 3WC4A 1BXGA 1YYVA 2C4UA 2P1DA 2ID4A 4IWXA 1W44A 4KXYA 3L1VA 1D8JA 3R20A 4G65A 1M6VB 1OMIA 1U4NA 3M6UA 3MMYB 5K5QA 1MBJA 3VGJA 4CBVA 3GLFA 2I6XA 4XDZA 3DEJA 4BKPA 1Z39A 2R4GA 4L6CA 4LDNA 3N7TA 3ZQUA 4WACA 4N9HA 1PF7E 3WGHA 2WWFA 1IY9A 3LT2A 3M82A 5CT4A 2N46A 4G6QA 4HZUB 3N2GB 2RV8A 1G63A 1KAQA 3G8CA 1VMDA 2PRJA 4G09A 5DF1A 1LDKB 4UM8B 4FISA 4QWMA 3AM1A 3BXPA 4M1KA 2OZEA 3RRFA 4CI9A 3CGWA 1SHUX 4K40A 5LVAA 1LTQA 5UKDA 4BB6A 2Z2SB 5J3LA 5JNRA 3NARA 2QMQA 3L9XA 3EXEB 4CHUA 3HOVJ 4QAJA 3UGJA 2MSNA 4PC2A 1KAOA 1HA8A 2H07A 5EL0A 2AN4A 2R6DA 1ZRDA 2GAIA 3RRJA 5GIPE 3ZBQA 3U56A 3W6OA 2QRPA 2D1HA 5ILUA 1GSIA 3JCZA 5GTIC 1U9JA 3W6ZA 2PRYA 3MBKA 3MMNA 4PLTA 2V1NA 3C7JA 4GD3Q 3WLRA 1P7YA 3ZLJA 3T0IA 2VAPA 1J33A 3WGOA 6YASA 5JUWA 2XGDA 1IIBA 2A7XA 1W5BA 2WYVA 2DT8A 5HS9A 4LBZA 4M4SA 1U8RA 3KJXA 3QKIA 2AN1A 2DUMA 3T1HB 2AHQA 3IALA 5D8KB 2ACWA 4XYGA 1B6TA 2IKSA 2X7HA 2BGTA 2A5JA 3UCFA 1XUOA 3UJDA 3UKJA 3ZD7A 4QO8A 2NS8A 3AYXB 1L5KA 2QRMA 5DYYA 4IDHA 2C2BA 1IN6A 1DHTA 2JZYA 2JHAA 2YV2A 3B3AA 3PQ2A 4BNJA 2PWYA 1NF2A 3O21A 3R41A 4I4LA 2L9VA 1IN1A 3FTCA 1OGIA 2IC5A 4U0WA 2XA9A 1OIVA 1VI6A 3PDCA 4LGVA 2R7WA 2XGCA 3A6FA 4FUQA 5K1YA 4QASA 2VPWA 3K4MA 3KKOA 4IDBA 2ZIXA 4JWKA 4MQ6A 1E0SA 4J9VA 4MVJH 5J1TB 1A9XA 4A2QA 5JT1A 3Q3CA 2VPYA 5BSEA 1J9IA 4RFVA 1WCIB 3UYLA 3UH0A 2HF8A 3X43A 3QHPA 3TDZC 3BMCB 5IBCA 2R8EA 3BGWA 2WIDA 1Z5NA 3DE2X 7REQB 2PUVA 4ENNA 4AIDA 1N8TA 1ZCZA 1G18A 1F8FA 1YX5A 2W2LA 4W5TA 4PSXA 2CV0A 3IMGA 1X1BA 1LEBA 1ISMA 1TVEA 1XCJA 2D1FA 2BVLA 3BJMA 1SULA 2YX4A 5D86A 3E7DA 2WSMA 3PXBA 3T8RA 3UNGC 1WWKA 3FLBA 4TLBA 2KP6A 5JNVA 2DN0A 2RGCA 1OA0A 5GAHJ 3WTBA 4JODA 3UHJA 1V3QE 3JTEA 3GG9A 2DUNA 4F9GA 4IS2A 5ESWA 1R36A 1GTZA 1NVWQ 3KUXA 3MWGA 4M1OA 3WNDA 3ZBUA 4RVHA 2BFMA 1NRJB 3WGNA 3TMAA 2L0XA 1SHLA 1JG4A 3ZE9A 3ETLA 1GV2A 3SEZA 4K9KA 3SJBA 3OYCA 5LD2C 4KQ1A 2M1XA 4KPEC 4AMVA 2QVGA 2R11A 1J70A 2XCOA 5BVHB 1D4ZA 1PIWA 3WJ2A 1NLYA 3J7ZI 4IZZA 3EUHC 4RGUA 2UZ3A 4FYJA 1D8TA 5JD6A 1ISJA 3F78A 3RC3A 2YH2A 1RSZA 1KJIA 3FDXA 4GX0A 5HZMA 1DTSA 1FFXB 2L02A 1I30A 1L5OA 2IKQA 5EIWA 5K0BA 1JA1A 1ZNYA 1SAUA 2WAOA 3R6SA 1VGQA 2QD2A 2NZVG 2Z6QA 1PD0A 1VYVA 2HWXA 1OCTC 3VBEA 2RDPA 1ZQ3P 2RGEA 2QV0A 3VXKA 3K8OE 4N9QA 1SB8A 1GLNA 5B5EC 3MELA 4BDSA 3B70A 3OZTA 4WMLA 4OOFA 1OLTA 4DDWA 3PSFA 4DCSA 1EV7A 2GQQA 3U4HA 1LUAA 2C4NA 1DEAA 2G9WA 3ND7A 3AF4A 2W5UA 3AUFA 5L53A 2NO5A 2EQRA 2MA3A 1JX6A 2R8XA 3CJNA 1T8PA 2A9KA 2GM4A 3EARA 4J0HA 4WXRA 4C20A 1CJBA 2G7UA 2O9LA 3Q0UA 2E2WA 1ZH6A 4L6AA 5E20A 3NUQA 4N6GA 1TD1A 4OHUA 4ASUD 5D1HA 3W05A 5LR6A 1H89C 4GVLA 3ZZNA 2XE6A 4L5YA 1QHHA 1XGSA 1QORA 1OVGA 1KK3A 2ZSIB 2PJDA 5CYOA 4RFSB 2XUGA 3OY9A 2Z3ZA 1N8SA 3UV7A 5GVRA 3CWZA 5TPZA 5K3EA 2XGXA 5HDQA 2JIMA 3IKTA 3CXUA 3K5WA 5CMLA 1ZGAA 1L7MA 3U2QA 4PN7A 5KYWB 4TVKA 4ZYWA 2H11A 3H4MA 3LA2A 2V7GA 4PSUA 4MOWA 4D3XA 3BHNA 4BU2A 3HYSA 5LDGA 5DX1A 3Q98A 4UUPA 1GNQA 1BE1A 2AJ8A 5L7TA 3BRQA 4ASUA 3OTQA 3GQBA 5J4VA 4QTRA 1XWWA 3C5VA 4D6XA 1ZM4A 5I7EA 3CD6I 1ZVMA 4FHZA 3ZR4B 4PFOA 4MV7A 3K5PA 3V2HA 2LC2A 3BD6A 1PGPA 3GBVA 6PFKA 3ONQA 1M6NA 4YDQA 2BGKA 3G9ZA 4ER3A 3U4QA 3JZAA 1IUPA 1O4WA 2OV7A 2HBYA 4DMGA 1URPA 2E4ZA 4M99A 1R0LA 5G4KA 1D0YA 5HKBA 1MBGA 1L4GA 1IVYA 4HBZA 1WF6A 1XLTC 1JDVA 1P7WA 2DBYA 1WZUA 4QT0A 1E2BA 2X3UA 5LLSA 1PG5A 1S7AA 1XMPA 1QQIA 4IQGA 1O96A 2CK3A 4TL8A 1M2FA 4BJ3A 2DVMA 4CKCB 2DM6A 3OQIB 1FSEA 1I7DA 2RB4A 1FSPA 3VKGA 2YQ5A 5TMPA 3FHTA 1VP9A 2GZ3A 3NWBA 4M3GA 1XHLA 1ZEJA 4JI5B 4B3DA 2IW1A 5KEIA 1BIAA 4TLLB 1FMVA 1PAUA 1B0ZA 3H0KA 4CQJA 2YV1A 5IKPA 4TWZA 3HP7A 1I1QB 4FS3A 4M0PA 3H5AA 2JARA 1GPNA 5ALPA 4CF7A 4W9MC 1JDBB 2ZAOA 3H8JA 3HU1A 3LY9A 2QMYA 3QUTA 4J7XA 1G3RA 3RF7A 1RYHA 4DMKA 4EM1A 2QZ8A 3CX4A 4CV3A 3HEBA 3CUQC 1JDNA 1JQEA 2LR0A 1JZTA 3BZWA 2GCNA 2KRFA 1Y5NA 3C7KA 3A36A 3CPHA 3SU8A 4B76A 3UGKA 4EF4A 2IS6A 5B58C 4CCKA 3KEYA 1XEWX 4EECA 4J4HA 1N4AA 1DFIA 4XUDA 4F86A 2QSHX 2XF8A 4NNJA 2Z0MA 4P3YA 2MCFA 2FSGA 1FDTA 2RMKA 4QJIA 2IHTA 3KSBC 1PR9A 3LKDA 3FOCA 5IDVA 5AFSA 1EP9A 2GXUA 4ZANA 4F0JA 3RB8A 5IYZA 3RRZA 3HOUJ 4XIIA 3UT5A 3K15A 3FCAA 3RABA 4PHGA 3KLNA 1JVBA 1Z7UA 4WK4B 5IDYA 1TO1E 3BQZA 4WCFB 2RCNA 2I6UA 3UJCA 1AKNA 3V9AA 4LGWA 1FDVA 1HQDA 2GK7A 3K92A 2NYXA 4UXJA 1JFFA 3R74A 5ILQA 3T4XA 1X77A 3UOAB 2A0UA 3T52A 5L9AA 1BX3A 1J5XA 2P67A 2CYYA 1I3MA 2FN3A 2CLKB 4YA6A 2XAJA 2YY7A 1SUCA 1AOXA 3Q7IA 3QWHA 3DB2A 3R0IA 4NQRA 4JV5B 2OEPA 2HQ1A 5AHOA 1SHKA 4CR8A 5K0GA 3TIVA 1UM9B 1WVIA 1SUBA 1FU8A 4GYIA 1CY1A 1RLTA 4RZ2A 1UFKA 2KHMA 1WKVA 5DGHA 2OFFA 3IYLW 4F9EA 4G5SA 1KH3A 4HHEA 3UNXA 3BP8A 4J19A 1TUBB 1DAIA 1S2DA 4HRIA 1SMTA 1XLUA 4KAFA 4BLRA 3THWA 4ALMA 1AO0A 4BPBA 4PCQA 4Q4JA 3JVUA 2VS1A 1XYYA 5KKNB 1LRKA 3WLMA 2ATXA 1QVVA 3OUTA 4FMCF 2YV5A 4QQ8A 4PZCA 3AP2A 4IIGA 4G4IA 3D7NA 2DFHA 1LLDA 2EW2A 4PO3X 4CPDA 3MTBA 3L8DA 5G0VA 5DNVA 4B81A 1XK7A 4YQFA 1WSAA 4EAQA 4R2KA 4XLCA 2NO1A 4IIJA 3ZUPA 1L7NA 5IASA 3TAXA 3GDHA 4JSYA 4QICA 1EFRD 2ZS7A 3QBTA 4H60A 3RG8A 2ISZA 1TJ3A 2V7BA 3QLUA 1GG9A 1XTZA 4PG6A 4Y1EA 3U48A 2F48A 1SIOA 1FRZA 1I4WA 2PBZA 2PX3A 2RCYA 2VDOB 4BJ6C 2PCLA 2KYRA 4DBRA 3VFZA 1FX0B 1ULBA 2J5RA 1EJ0A 2YMQA 4G1BA 1JG1A 4IHKA 4LQCA 3RREA 3MINA 2CUEA 3R0JA 1JVSA 1XMIA 4X9XA 4BNDB 1ZCAA 4KMRA 4TZKA 3FHNA 1N1GA 3DBLA 1HF0A 4TV9F 3ADDA 2IS2A 3LUPA 1C41A 2RGDA 1E3IA 3UAGA 1DAHA 3Q9VA 3JWPA 2B5OA 2V5UA 3CZMA 3NDJA 2PR7A 3I9NA 1EAMA 3EBOA 3QW2A 4IUDS 4JJEA 4PYRA 2HR1A 2GPSA 3IP6A 1EIWA 4M9SA 2DK5A 4U7BA 2YOFA 5B1IA 3I76A 1P0PA 4HDKB 4OQNA 4JA2A 2ARKA 2JC3A 4LHVA 4XQCA 4ZOCA 1OFIA 3H2SA 3SD7A 3SKXA 4UXHA 5JNSA 1X2BA 3AR8A 3AVUA 4M86A 1XR3A 1ENPA 2GDJA 1W36C 1VQLI 2NZ8A 3GWZA 3GZTB 3HCOA 3ZKAA 2AB0A 4F38A 2X77A 2M8GX 3LBFA 3EDCA 4ZYAA 3SI7A 4M3DA 1CQXA 2ALJA 2PZ8A 4KGZA 4MYSA 3OQMA 3DCJA 1V6AA 5F64A 1GUYA 3I1JA 4GOMD 3DTKA 2PA0A 2CFTA 4I2NA 1EHIA 3G2NA 1LFBA 4M72A 4GPD1 4WSOA 4UTOA 2LD4A 3HDTA 3KZCA 4XLEA 1MRNA 1TYCA 2BD0A 2KT0A 4E0BA 5HM6A 3D2LA 1L5VA 2P3SA 4EX7A 2V0CA 3GTPJ 1W5CC 1FFGA 5LEKA 2FEWB 4RETA 5KPJA 5AK0A 2A35A 1UWCA 4QUHA 4ND5A 4V1CI 3V8LA 1ABEA 3SICE 4BDYA 3OLZA 1IRXA 4R41A 4KW7A 1YIOA 3AEKB 3MTIA 3RIEA 3T3EA 3UO8B 3WKAA 4BAGA 4II2A 1SVWA 4NOMA 5KNCA 1JYEA 5AHWA 2FSPA 2PGOA 3KJGA 1MNMC 4IDOA 1L6IA 5J2TA 3PPWA 4G6TB 1J8QA 4DUPA 2JSPA 1J6UA 3UBTA 1E3TA 4Z53A 5KQPA 4D97A 3DV0B 3O8HA 1GFZA 3MW8A 5FA6A 4RA9A 1DTWA 7ADHA 3RYTC 1NVXQ 2QB5A 4DNPA 1Y48E 1ZH8A 1KZ1A 3JAMA 2EFOA 2OFOA 3HNOA 1SUFA 3MS7A 1NY6A 4WCFA 2ECCA 2C7BA 2IOFK 5K3FB 4QTYA 2VQLA 1PYVA 3EPZA 4JK1X 1A4IA 2I66A 4OFWA 3SZMA 4X85A 3VM6A 4BWGA 4Y2UA 4OQFA 1V7QA 2WJWA 2AUMA 1EK6A 1GTMA 1XVVA 3ED1A 3E2MA 4INJA 3WR5A 3FDYA 4YRPA 4HVAA 5NLLA 4BASA 4FFNA 4R8SA 4KPUA 1VTNC 4J8PA 5LZ9A 3HPHA 1V45E 3DEKA 3AUJB 4FOSA 4FW9A 2AKYA 3I73A 4MRMA 4MS1A 3CG4A 4JXKA 1R37A 1WDTA 1IHXA 1Z8HA 4OI1A 2J9GA 3L5OA 1YA6A 4EDHA 4Z51A 5KC9A 4DR7B 2W4SA 4MR9A 1HZJA 4YRRA 5HNFA 3C4JA 5JH7A 5JS1A 3E3NA 4EUFA 5EJ8A 3QJGA 1W85A 2HQBA 5K2OA 4AKHA 3DZCA 2WOOA 2CKMA 3M1AA 5TR9A 3BMQB 2VE8A 3CH7A 3G2QA 3DDZX 4HQEA 1QMGA 2IOYA 3AHGA 1L4UA 3C3MA 5A3SA 4IIYA 2E2IJ 3OEYA 1WJBA 3VNSA 4C3IJ 1ZM9A 1JAIA 1IZ7A 4MA0A 1KR5A 1R7RA 5IK2D 4G9EA 4CH7A 1CRPA 2A9OA 3IEIA 1V55H 2WJVA 4EG3A 4OQMA 3L43A 1GQRA 3IGFA 9LDTA 3MSCA 4AD9A 2W6ID 3K1JA 2ZK7A 2HZBA 5JTTA 2G1UA 4HN2A 3GOQA 4G2NA 4BB5A 4TPKA 1HETA 3D0SA 1ZD4A 2ZG6A 1FS6A 3AERA 3HSFA 4L76A 1RIFA 4M3EA 1GUFA 2OV4A 4I9HA 4RJJA 3A4IA 2TS1A 4PZDA 4B45A 1NK3P 1Z7EA 3QUQA 1OHHD 4GF5A 5AJTA 3OV8A 4Z2AA 2OZ6A 2SKDA 2QN7A 3AP3A 2DPDA 4HX8A 4CG3A 2PPVA 3MS4A 2WNSA 2P6SA 4TMWA 3LSHA 2R7LA 4WOKA 2FFHA 3MLEA 4LZNA 1AJEA 2NO0A 1DQNA 1ZVJA 3MWLA 4DHEA 4XRMA 3OQNA 3A6KA 3KYLA 2NPOA 4OU4A 2G4LA 2P7IA 5JXGA 1LNSA 2XVYA 2LTAA 1X14A 3QQAA 1L7OA 1CZKA 2PUJA 3GROA 3Q7PA 3R09A 3B85A 4H4CA 3SGLA 2N1BA 1GTG1 3EODA 3OMLA 4X97A 4F3RA 5CFNA 3SQNA 2ZZNA 3P2EA 4QO7A 1WXDA 3LBYA 1VNDA 5DULA 2WAQN 4D42A 1W4BA 4RVDA 1O8CA 1HT3A 4BVKA 2ZB7A 2VXOA 1KDZA 5DLYA 3GUDA 2AG8A 2CQXA 2QTRA 2WF9A 2GXBA 4KX3A 5AK5A 3QKSA 4DLSA 1B41A 4KCGA 2BIFA 2HMUA 5EUCA 5BUSA 1AN0A 4C88A 1IOWA 1BWSA 3O31A 4ZVNA 2CBXA 3I28A 2EIKH 3MN2A 1JDJA 2QL7A 5AUPB 4IDCA 5LL6P 4C7OB 3QKUA 2ZSKA 1J4AA 2IDJA 5G2OA 1DEKA 3OOYA 2IHZA 4CXFA 3VDNB 7AT1A 4QLAA 1SMYF 3QWFA 1XEWY 2R6HA 2CJPA 4ZQEA 5DTMA 3ZIDA 1CP3A 3ZTWA 2LKSA 4E5YA 4IJ5A 5FL7D 2A0FA 1OWLA 4XGKA 1S3SA 2ERCA 4Q00A 1V5EA 1DRUA 1YFKA 4RZQA 1XV5A 4D8XA 1GL7A 5M3MJ 4KNWA 4W5WA 3EGDA 3WWCA 2PMFA 1QZEA 1KPGA 5FOTA 3MOSA 4UM5A 4Q3BA 2JK1A 1N1DA 3T7JA 2QD3A 3PYXA 3FTFA 2CNDA 1E6LA 2HNKA 2W7NA 2PWAA 3GT3A 2DI3A 3DPTA 3K0HA 2AEEA 3PICA 2OP1A 2ZR8A 2VT7A 5BNIA 1WHTB 2R9VA 1HLPA 2JAPA 5HUQA 2IRWA 1U6GA 3O47A 1LFDB 5D3KA 2JJ1A 4PONA 4AXXA 1BMDA 4CTNA 2B94A 3O9MA 1KS9A 1I39A 4FKZA 3CB2A 3FSJX 2PMZN 2FPLA 3CT4A 3ERED 1TU4A 3E1SA 5F33A 3OZXA 4G4SP 3RTDA 1E1KA 2LZ0A 3WWEA 1Y6JA 3VPRA 2PQMA 1TDJA 1W0CA 4I55B 1UHSA 4ZYDA 4RK1A 1LNQA 1IU9A 2WU8A 1J49A 3B2EA 2PX6A 3H1PA 5C4GB 5BSGA 4YJ3F 1D6NA 2IYNA 1FLIA 1YI2I 1E6WA 2H7YA 3ENQA 4S1NA 5L40A 2IEAA 5AW6A 1L5HB 2AZ4A 1T3TA 5DCMB 3GLHB 4RPLA 2QQ5A 4D8TA 5K4AA 1NV9A 1YI8A 1TADA 2J5KA 4OOIA 3IBFA 3KLPX 5AJXA 3W2TA 1PT7A 3UH1A 4DA6A 5AP9A 4X6AJ 3GRAA 3PRYA 5DEQA 4B7CA 2ZI3A 2J3MA 3PC3A 5AVRA 3HGYA 4BZZA 1ONVA 3GRUA 4KDPA 2BKVA 3ZWBA 3WMXA 1KXJA 1P77A 1BOAA 3IH4A 5JMOA 4A69C 3PGKA 2XJ4A 1CR2A 2OMEA 1A2KC 3K96A 1Y3FE 3MJSA 5AKXA 3ABOB 3KUUA 4I4CA 2IYLD 2WWXA 4GGGA 4P82A 2ZC2A 4EABA 4NXMB 1U1GA 3PHBE 3DOFA 2AX4A 1IB0A 4EVQA 3JSPA 2J87A 3EUFA 5K8CA 3N8HA 2CUTA 5TQ2A 3C8ZA 2QRQA 2J67A 3GLHE 1MIJA 1I5ZA 1W6UA 3DT9A 4RENA 1BG6A 3DL2A 3H1AA 4HB4A 3L41A 3T7IA 4A0SA 5BMOA 5IKXA 2OZVA 4QU9A 1N2XA 3PHJA 2V9PA 5F0HA 1G5TA 1IZ8A 2OFWA 2OCEA 2ZS8A 1EBFA 3BWYA 2ZLBA 2HPZA 2ZE5A 4ZWNA 4ED9A 5BW4A 3W34A 4U2FA 1MG0A 3ED5A 1P1IA 4LG3A 3F7NA 4XDHA 1DSSG 1K3UB 4MDEA 4I9UA 4JEMA 1DWQA 1XJQA 2D54A 1B6AA 3S1QJ 3AW8A 2X6XA 4NSNA 4CDRA 4LNAA 4Y52J 2HQRA 5L8VA 1OX4A 5B1SA 3AVQA 2P41A 2CHQA 1NQ5A 4MR8B 2CXOA 4FFLA 4WN9A 4D57A 3TFOA 3BDDA 3UPTA 3T7CA 2HJGA 1Y4DE 1T5SA 2X51A 2NSDA 1J5PA 2CJWA 1FIPA 2DMRA 2QTLA 1G8SA 1ZXXA 3QVXA 4LYDA 4TLMB 1U7OA 3MUEA 5JO9A 2PJUA 2XWSA 1C8KA 3ORFA 4X95A 4IX9A 4RF2A 3SG0A 2NZJA 3TLBA 3EFHA 1QS0B 3FYDA 1L4FA 3W90A 2QRUA 1I6LA 3A1DA 5BR7A 1D6SA 9ATCA 4ZCSA 1XTAA 3K4KA 1F2TB 1PGQA 1UBOS 4YG2F 3BIFA 4HK4A 3QX7A 3D3EA 4KQ9A 4NEGA 4ACAA 2NRAC 5BNTA 1F20A 3N0WA 5ELXA 3KTAB 4TRRA 1BS1A 4XLTA 3F9IA 3TMKA 2H2FA 2V4MA 1SCKA 3M1EA 1GSOA 2ZB2A 2X0KA 3BMCA 3HOXJ 5G1PA 1HE8B