4KIBA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
total genus 113
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kibA01
3FX3A 2VT2A 3WTUC 3VODA 4LG0B 5HS7A 4HQEA 2FOKA 1BI2A 4IRHA 1O3SA 2K02A 2QBYA 2BYVE 1JE8A 3M8FA 2HTJA 3GFLA 1J7KA 3HRSA 1BIBA 4OIPF 1XSVA 1SMTA 5D6EA 3FHZA 5DDGA 1HKTA 4MQ9F 3LWFA 1LB2A 2PMHA 5BS6A 2FNAA 4HBLA 2MH2A 1DP7P 2OAZA 1YLFA 2EK5A 1IXSB 5E1XA 3CUQA 3RYRA 1HSTA 1R5HA 3LA2A 2YSRA 1QNTA 1Z1DA 4GGGA 4RGSA 2O0YA 2P7CB 3P9KA 3RTRA 1HW5A 1P4XA 5FD6A 5D5VB 2QLZA 1T6SA 1ZGJA 2H27A 2Z33A 3L09A 1TNSA 4XSZF 4DQ2A 1S8NA 1WWXA 4L0YB 4ZZDA 2P4WA 1JHFA 4GYGA 3RJPA 3SZPA 2ACJA 3LAJA 2BBYA 3J7AO 5DV5A 2L4AA 2WWYA 1QO0D 3IC7A 2IVMA 1R7JA 1SFUA 4H0EA 3NQOA 3ZMVA 3SHFA 1TQIA 3BP8A 1LDDA 4KMUX 4CZZA 5ERIA 3WE3A 4YFXF 3C7JA 2IT0A 2HOEA 3ZMUA 1I5ZA 3KEQA 1IF1A 1I1GA 1YIOA 2Q2EA 3WU1B 2KIMA 2D1HA 2OZ6A 3BWGA 4OINF 3DP7A 4L5JA 1OPCA 3KP5A 2STWA 2DLLA 1LDJA 5E20A 4HAMA 4I0BA 4Q4ZF 1K79A 2DQLA 5IT9K 1RI7A 5A2QK 1XMKA 2VBYA 4RAYA 1D8KA 3L2CA 3WTTC 2IRFG 2PJPA 2ZJ2A 2COMA 5D6FA 1W4MA 3SZTA 4AIJA 3OV8A 4XSXF 2PFBA 3KZYA 2TDXA 1XB4A 2HYFA 2VBWA 3DEUA 1G6NA 2UZKA 1GXPA 4KFCA 2F2EA 1EH6A 4BHPA 5D8LB 2EJRA 3DV8A 3V7CA 2FXAA 4O5VA 4M72A 4EJVA 2O61A 4M9ZA 3VFZA 4EM1A 2JRTA 1S6LA 5CVIA 5BOXA 2V6CA 4RB1A 5DUIA 4M6YA 1Z6TA 3GLXA 1ZLJA 3MAJA 5BMZA 1AWCA 4L18B 3C1DA 4G7OF 5L3DA 2FBKA 1FOKA 3FMRA 4YG2F 4BXUA 1TBXA 1ZN2A 2L4MA 4R8HA 1B59A 2G7UA 1D8JA 3IWFA 3T1BA 3KLNA 2PG4A 1OYIA 3R0AA 2ZMEB 3PQJA 1BC7C 5DCMB 1E17A 2M30A 4YFKF 3E5XA 1UFMA 3O6BB 5E1ZB 1SD5A 3Q5FA 2ETHA 4AIHA 2VXZA 4RB0A 1YYVA 4ON0A 2XUBA 4CO8A 1IW7F 2IA1A 5H6QA 3E6BA 3J81Z 4G6DA 1XDUA 3JTHA 3N4MA 2RDPA 3O2PE 4G7HF 4Q5SF 1MKMA 5CVRA 1BN5A 2NRAC 3SXYA 1TW2A 5HOOA 3TOAA 3ECOA 1Z6RA 1KU3A 4ZYGA 3RKXA 2HDCA 3M8EA 5HLHA 4HA8A 1ZAOA 5BPIA 4ASNA 4ENKA 3FM3A 2STTA 1U5TC 1F9NA 3IKVA 2A3SA 2KKOA 3FMSA 4KNYA 4AIKA 4M9XA 1YW8A 2YU3A 4ESJA 4HYEA 1MGTA 2DK8A 5FLXZ 1LEAA 4MHGA 3S2WA 3L00A 4HV5A 1I27A 4A0XA 3V4GA 3T0YA 2FNPA 1MDMA 4BH9A 3DQVC 2DU9A 1O3QA 3F23A 3QPTA 4MTDA 2DFIA 1T2KA 2PMUA 3J80K 4QWQA 1T0FA 2MLKA 4L9NA 4M71A 2G7HA 4UV9A 3BROA 4N0BA 2P6TA 4S05A 1K78A 3MWMA 1F5TA 4HQMA 1G3YA 3L9FA 5FGMA 4UXNA 5D5WB 5HDGA 1LEBA 1QGPA 2QQAA 4U0VA 1G3WA 2HFHA 2RKHA 3I0TA 2EV5A 1ZYRF 1WSUA 2HGCA 1O7LA 2XV4S 3JSOA 2VT3A 1BJAA 4PCQA 1R58A 4KN7X 1IN7A 3COAC 3FF5A 4EGZA 3KZZA 4IRIA 3E5UA 2HWVA 2DT5A 1BI0A 2FBHA 3T5XA 4MEYF 4OMZA 4E70A 2ZMEA 1H0MA 3F8MA 5HDNA 3PFIA 3IL2A 3PQKA 1FY7A 1ONVA 3K9TA 2CFXA 4YIIA 5HLGA 1OYYA 3VB2A 4WWCA 1A04A 1ZHFA 5K1YA 1T98A 1P4AA 1OYWA 1F1ZA 1BM9A 1B6AA 3QU3A 1W7PD 2FF4A 1KGSA 3R60A 1B9NA 4XRFA 2PEXA 4P55A 2E7WA 4I01A 2GA2A 3N97A 3P9IA 4YFNF 2DBBA 3MZYA 3WTSC 3WTVC 3IHUA 2XAJA 4MGRA 4KUMA 3ZMDA 5D5XB 4ETSA 1C0WA 5LRRA 4CXFA 2MD5A 1FP1D 3DF8A 2Z3YA 5HS9A 1G3TA 2EFWA 4AWXB 2D2WA 3WODF 1CF7A 5CYVA 5LRSA 2EFPA 2JSCA 5DD4A 5BQTA 2QQBA 1Z05A 3P9CA 2RVCA 2H94A 4N9HA 2FSWA 3GFIA 3RPUA 3IRQA 3IKTA 1HW2A 2OA4A 2RV8A 4EVIA 2MLGA 5H6RA 1O3RA 4Q48A 3E6DA 3GW2A 1BC8C 4ZYDA 4BAYA 2JZYA 1Q1HA 4RB3C 1DUXC 1AOYA 4P9UA 4KIGA 1Z9CA 4L9TA 4OIQF 2GAUA 3V8JA 2OBPA 3D5LA 2D1VA 4JBAA 4HW0A 3H3ZA 4KICA 5TJJA 5E8GA 3O3KA 1UCRA 1FYKA 3R6SA 1FYLA 3TKYA 2A61A 3D0SA 3E6CC 4EV0A 2WC2A 1LVAA 2QM3A 4L9VA 1OMIA 4IHSA 4U0WA 3M9AA 1QPMA 4I02A 1IN4A 4A5MA 1QQIA 1V3FA 2IW5A 3K1NA 2J5OA 3DKWA 4WCGA 2RNJA 3JW4A 4A6EA 1W5SA 3ML6A 2Y75A 5DYMA 1IUYA 3CO6C 3JTGA 4IVNA 4LMYA 1USSA 5FB2A 1DPUA 1Y0UA 3GZ5A 2Q0OA 4NQWA 3I71A 4GXOA 1YFHA 1XD7A 2JT1A 2XKOA 2M87A 2P5VA 5DCFA 3WTWC 6PAXA 4L9JA 5CVVA 1EH7A 3KP3A 1HKQA 3ABTA 4FX0A 4ENJA 1PDNC 4RS8A 3F6VA 2L54A 2VOOA 1Z91A 5CVJA 3I59B 5FO5A 3IRRA 1QBJA 2LSOA 4XLNF 3HTUA 1FBQA 1KQ9A 4UV8A 3K1PA 2R3SA 2VOPA 1WRJA 4EMSA 1GXQA 5IT3A 4Y17A 3GZ6A 4L5IA 1KQ8A 3KFWX 2ZO4A 2IA0A 5JI6A 1R36A 4WF2A 4HX4A 1U5TA 4R79A 4XBFA 2ISYA 1XSXA 3E5QA 1XGSA 3BZ6A 3JAMZ 2HTSA 1GVJA 3K0LA 2K27A 1MDMB 1J5YA 5K5OA 2DK5A 2KJCA 1R22A 2ESNA 2CSOA 2PI0A 2VONA 3REOA 3BY6A 4P96A 1KA8A 3LQQA 1TTYA 2GWRA 3KETA 3ULQB 1K78B 1ZRFA 3HRMA 1L0OC 1PP8F 4HDVA 2Z5UA 2MBFA 3R4KA 5ICEA 5L3CA 4BYYA 4M6XA 3J81K 1UHMA 4M74A 5L3FA 2PLYA 2VC0A 5E17F 3GF2A 3FXUA 1ZARA 3K69A 3VEPA 2H09A 2GQQA 3I4PA 4HF2A 1YQAA 2K7LA 4QLCU 3FXRA 4I7HA 3F72A 2ISZA 3DPTA 1R1VA 2VODA 5FFXA 3V8KA 3NEUA 3K1MA 3WGIA 4OIOF 2W57A 3TO6A 1O3TA 2GZWA 1P2FA 5L3EA 2IJLA 5BPDA 4CGZA 2XAHA 5HLIA 2NYXA 2LF7A 3FM5A 1SD4A 3FWEA 3QPHA 3I58A 2Y48A 3U9GA 3GUDA 1ON2A 5JVTA 1R1UA 3U2RA 2A68F 4P9FA 3E3VA 3ZQ7A 3GFJA 3EETA 3I64A 4LB6B 1K7AA 1U3EM 1JGSA 4WXDA 2M8EA 2ZKZA 2ESHA 4KT5C 1FPQA 5JFRA 4WXCA 2CW0F 4IPAA 3QP5A 4EJWA 1ZRDA 4KDPA 2FQ3A 3TGNA 3KLOA 4AD9A 3TDUC 1YW7A 4U7BA 3BJOA 4OU0A 2W85A 2WTEA 3FMQA 3I59A 5K5QA 3LA3A 2ZBKA 1SAXA 3B02A 2K86A 3EYYA 4GYIA 5D4SA 1HW1A 3JSPA 4DNCA 2LDUA 5FD5A 1LDKB 3ZMZA 4XLPF 2EFQA 4NHJA 3OOPA 1K6OA 2J5PA 2EA4A 5D8KB 2CQKA 2P8TA 5ICGA 3RPQA 2GXBA 3TOBA 1CF7B 5E8IA 2DAOA 3ERED 3GVAA 3BDDA 2A07F 1W5TA 4CHUA 2P5LC 1ZREA 2P7VB 5J6XA 5F1RA 3GEZA 1J0RA 2IPQX 1IN5A 1FBSA 3LQRA 3TQNA 4N9IA 3M7GA 1XGMA 1JXSA 2E1CA 5DEQA 5CLSA 3GO5A 4EGYA 3ZN1A 1IN8A 2DO7A 2EB7A 2FMYA 2JPBA 1DPRA 5LEKA 3QP6A 2Y0MA 1IAWA 1J9IA 1S7AA 4ESFA 2NAZA 4P5OA 2XVCA 1LNWA 2UXXA 3TO9A 3KP7A 3QU6A 2R7FA 3DPLC 3HTSB 2O6GE 3T8RA 3HRUA 1MZBA 1U6GA 5LHHA 3I54A 1SD7A 4UVCA 1ZGAA 2X4HA 3AAFA 1FX7A 2FEZA 1KYZA 3V7RA 3C3WA 3LAPA 3I53A 4A2UA 2DPUA 3RYPA 3WTYC 3FXQA 3BJ6A 3H3UA 2V1DA 3H92A 3CO7C 1H9TA 1FNNA 2W24A 2E7XA 3TDZC 1SFEA 2CG4A 4K2EA 3HSFA 2OQRA 1EH8A 3ZMSA 1YS6A 4R1HA 5DD8A 4S04A 2QZ8A 2IP2A 5EEGA 1I6XA 4HF1A 1WQ2A 2EV0A 3RIRA 1FSHA 4Y13A 4Z2YA 3GWZA 2KIFA 4RAZA 3KP4A 1ZH5A 2CWEA 2DPDA 5L3BA 4LFUA 4A0YA 1ULYA 2F5DA 3ROUA 2FU4A 4I98B 1IRGA 4U0YA 2EA2A 1R23A 4G9YA 4LLLA 1WKMA 1MJBA 1U2WA 4IRGA 1P4WA 3WGGA 2ZNYA 2ZCWA 3F6OA 1MD0A 3I5UA 1MJAA 1RIOH 4KN4X 1FC3A 3DXJF 1U5TB 3TO7A 2O03A 5LGTA 4HV6A 1TQMA 3LFKA 1ZG5A 2VC1A 1KQ0A 2V9VA 3P7NA 1FT9A 4F7ZA 3RI4A 4ESBA 3EDPA 2ZXJA 3Q9SA 4HZFA 4A6DA 5LGUA 1HBXG 4OOIA 5KK1A 1FYMA 3E97A 4OIRF 1Z7UA 3GYHX 2Z99A 3W6KB 3HOTA 1RZ4A 4D0PA 2KIUA 4PGHA 3DFGA 2CYYA 5LHIA 5AONA 4WXHA 3V7SA 4KIFA 1B4AA 1P6RA 3HOSA 2AXLA 4FT8A 2VE8A 4MNUA 1FBUA 3CDHA 4PZJA 3KCCA 3EYIA 3ISPA 4LGWA 2MC3A 1OR7A 1O57A 5ILSA 4O3MA 2YPRA 4O6JA 4KA4A 2D45A 4JK1X 3F8CA 1BI3A 3V8LA 2V1UA 3HHGA 2FE3A 2XAQA 1G3SA 3RDIA 1YG2A 3MZHA 2RN7A 2CGPA 2A69F 2XRNA 5LBQA 1BI1A 4RGXA 2QWWA 1S29A 2X0LA 5ILVA 2HZTA 2IA2A 3EQLF 2V1XA 2DTRA 5L3GA 1WI9A 3E6MA 2M1BA 4AVPA 2NNYA 1SFXA 2LNBA 4HX7A 5J8FA 3GXOA 3JAMK 2M45A 1XN7A 4A12A 3F8BA 2A5YB 5H20A 2Q8KA 2K4BA 1VTNC 2WV0A 4UUVA 2L02A 2FBIA 1FWZA 3U1DA 1XGNA 5HDKA 3K2ZA 1USTA 2YX7A 4UVBA 3T8TA 3G73A 3ZN0A 4HDUA 2QENA 2P5KA 5ED4A 2BGCA 2HYGD 3ELKA 2QQ9A 3LSTA 3RKYA 5JHUA 2GIVA 3L7WA 4HF0A 4ENMA 2W25A 2QUFA 5LLQA 1D5VA 4UHTA 2NNNA 3CLOA 3WTZA 5D4RA 1DDNA 3F8FA 2KRFA 1XMAA 4PDKA 2DQRA 3GX4X 2XAFA 4EM2A 5JR3A 1PUEE 1TLHB 3BPVA 2Z9OA 4BNCA 1XGOA 2OZUA 3ZPLA 4IJAA 2F5FA 2OU2A 3MFKA 2A6HF 2FMLA 3HIFA 1P92A 2R7DA 2ZFWA 1UHWA 4RGRA 2FA5A 1T39A 2BV6A 2XGXA 4FHTA 2HS5A 5CJ9A 1TQPA 2HEOA 2LKPA 1YTYA 1I1SA 2UXNA 1E2XA 3FZVA 1ZRCA 2NS0A 4M9SA 1NHAA 2HKXA 1W7PA 3BOQA 2VBZA 2F5CA 2F5EA 4KYWA 1UB9A 5E18F 4NB5A 4LG0A 2LF8A 5TRDA 1KU9A 1QZYA 4BQAA 1IRFA 5HVQC 5F6FA 2QVOA 4A5NA 4IXAA 3MEXA 1YO5C 3KEOA 2RGVA 3CUQC 5IT9Z 1PP7U 4YIFA 4IHTA 3WTXC 5A2QZ 2E1NA 4HLXA 2M5WA 1EV7A 4CYDA 5K5RA 1LQ1A 4EM0B 2BEOA 4HX8A 3WG9A 2ADUA 2VN2A 4BHBA 4LK0F 5FLXK 5LEJA 4ZH4F 4LJZF 3EUHA 3IWZA 1XCVA 3HSRA 3HYIA 1TW3A 5CVUA 1S3JA 1IXCA 2PQ8A 5F64A 2GA1A 1SMYF 4TV7A 4GO1A 2V79A 1TNTA 1T38A 5EEHA 4LD5A 1KU7A 4KIBA 1FZPB 1F4KA 3F3XA 3G3ZA 4RB2C 1S7OA 1V4RA 2EFOA 2HKOA 2OD5A 1YS7A 1HKSA 2QYOA 4LK1F 2K4JA 3GFMA 3F8NA 4JQFA 2BE5F 1RNLA 5J8CA 4WK8F 4U88A 4GCVA 3WU0A 4HLYA 1XSDA 3R61A 4G94A 1R1TA 4BHCA 4HOBA 2GXGA 1KYWA 1J2XA 4ZYHA 4B8XA 4CICA 3HSEA 4IF4A 1B9MA 2G9WA 4B09A 2EV6A 3W6JB 1R5GA 2ELHA 3BJAA 1B1BA 1XDSA 1IZ1A 2XROA 4ZZLA 2C6YA 2MA3A 2O8XA 5ILUA 3QRFF 2W84A 4EJUA 2HQRA 1MJ9A 2XASA 4RGUA 5LHGA 1ZG1A 4U7DA 3WE2A 2HQNA 4G7ZF 3B73A 5AIPA 1ON1A 1XCBA 2VE9A 3HUGA 3WGHA 4EJOA 3SFZA 3KP2A 1U8RA 2YR2A 1HXDA 2ZNZA 2XKPA 2QBYB 1X3UA 2XAGA 2VBXA 3HHHA 2EFNA 3KP6A 1L3LA 2DW4A 5E1WA 2PBIA 1BBYA 1SD6A 2JPCA 4UVAA 4Q47A 4KMFA 2H6CA 2CO5A 1KU2A 2JTVA 3BPXA 5AIQA 1D3YA 2AS5F 2XHKA 1HQCA 3CUQB 1IN6A 4M73A 3SQNA 4I09A 3ECHA 2DI3A 3CUOA 4LLNA 4I0AA 3QAHA 2OQGA 2UWMA 1IXRC 2XIGA 3J80Z 2MH9A 1G4DA 5DCMA 1U78A 1RUOA 1QZZA 3CTAA 2KJBA 4PGGA 4ENNA 3R0JA 4OMYA 3NRVA 2A6EF 1FP2A 5ICFA 1OKRA 4UNOA 3RKWA 4FX4A 1FLIA 5KVRA 4EQQA 3MCZA 3ZP5A 1H9GA 4LB5A 1HSJA 4G8XA 5FFZA 3ZMTA 4L0ZB 2L01A 1ODDA 1ZG3A 4CDGA 1O7FA 3QOPA 3F22A 2RQPA 1J59A 5DUKA 2HR3A 1ZLKA 5LGNA 1LJ9A 4MQVA 3CJNA 4ZYEA 1FSEA 2PN6A 1CGPA 3HRTA 1RUNA 3C18A 3MQ0A 1J75A 5D5UB 1R00A 3M1EA 3VOEA 2L3DA 4WX9A 4A0ZA 3Q9VA 1YW9A 3F21A 2EWNA 4Y15A 2O3FA 4LLGF 4EJTA 2H6BA 4MEXF 1BIAA 2B0LA 1GHCA 2P6SA 4MTEA 1JHHA 2FRHA 3LA7A 2RC4A 4G6QA 1STZA 1REPC 1BOAA 3KE2A 5ICCA 3ABUA 1W7PB 2YX4A 4I2OA 5HS8A
chains in the Genus database with same CATH superfamily
3FX3A 2VT2A 5IPAA 5IYBJ 2IGMA 3H5AA 3WTUC 3VODA 4LG0B 5HS7A 4HQEA 2FOKA 1BI2A 3SYTA 2HQAA 3O8GA 3OR2C 4IRHA 1O3SA 2K02A 2QBYA 4CCLA 2BYVE 3G1LA 3S3NA 1JE8A 3M8FA 2R7XA 2HTJA 3GFLA 2EIMH 1J7KA 4M3GA 3HRSA 3H1CA 2Z2SB 4D7MA 1HF0A 1BIBA 4OIPF 3BG9A 1XSVA 1BR1A 1SMTA 5D6EA 3FHZA 1AU7A 5DDGA 2LD5A 2IS4A 1HKTA 4MQ9F 3LWFA 1LB2A 2PMHA 2K5CA 3FBIB 2JK3A 5BS6A 2M7BA 2XF7A 4BXFA 2FNAA 2AQEA 1A5JA 4HBLA 2MH2A 4QPOA 5B3SH 1DP7P 2OAZA 1HDPA 3L2RA 1YLFA 2JMWA 2EK5A 1IXSB 5E1XA 5EF6A 3CF5F 3CUQA 3RYRA 1HSTA 2BW3B 1R5HA 3LA2A 2YSRA 4ZDPA 1QNTA 3W2WA 1Z1DA 1ETXA 1IO2A 4GGGA 4RGSA 1ETQA 2O0YA 2XB0X 2P7CB 3P9KA 1SFOJ 2ZMEC 5BNGA 3CCLI 3RTRA 1P7JA 1HW5A 1P4XA 3U21A 4W1UA 5FD6A 4A3EJ 5D5VB 2QLZA 2W82A 1T6SA 3VYSB 4C2UA 1ZGJA 2H27A 1NK2P 4CYCB 2BY1A 1D0XA 2Z33A 2K85A 3CJTB 3L09A 1TNSA 2O5RA 4XSZF 2PMZN 4DQ2A 2E19A 1S8NA 2V6EA 5FJ8J 1WWXA 4L0YB 1OJLA 3HOXJ 2LOOA 4ZZDA 5DM7F 1W36D 2P4WA 1JHFA 3TL4X 4GYGA 3RJPA 3SZPA 3WHBA 4XMYA 2ACJA 5DTDA 3OYJA 3VPRA 3LAJA 2BBYA 1RKTA 2FQ4A 2M8GX 3J7AO 3QWLA 5J40A 4X1EA 5DV5A 4E7JA 2L4AA 1FTTA 1D1BA 2WWYA 1QO0D 2WBMA 1IRZA 4KT6A 3IC7A 3LSGA 2IVMA 4HEA2 1R7JA 4BS9A 3CD6I 1SFUA 3MMYB 4DBRA 4H0EA 3CCQI 3OYMA 4X6AJ 3L2VA 2DT7B 2JA2A 2VKHA 3NQOA 3ZMVA 1SVOA 1A6IA 3SHFA 4LOCA 1TQIA 3BP8A 1LDDA 4CH7A 3BQYA 4KMUX 4CZZA 5ERIA 3IAS2 3WE3A 2EINH 4XN3A 2EIKH 4A3DJ 4YFXF 3C7JA 2IT0A 2HOEA 5J3LA 3ZMUA 4CCKA 1I5ZA 2DA3A 3KEQA 1T33A 4UB8C 1IF1A 1NG7A 1I1GA 3JREA 3BR2A 4XORA 1YIOA 2XRLA 4BUPA 2Q2EA 1ZR4A 3WU1B 3SFIA 2VQHA 2KIMA 4CCJA 2D1HA 1FOXA 2VPRA 3K4MA 1EA3A 2OZ6A 3BWGA 4OINF 3DP7A 4L5JA 1OPCA 3KP5A 2LBFA 2WA0A 4XKCA 2STWA 2DLLA 1LDJA 5E20A 3OSFA 4HAMA 4XKWA 2WAQN 4I0BA 4Q4ZF 1K79A 4Y52J 1X3ZB 2DQLA 3QPSA 3LMMA 5IT9K 1FJLA 5KHDA 1ETKA 3ZQLA 1RI7A 2L9SA 2XPWA 1NK3P 4GRIA 5A2QK 1XMKA 2TCTA 2VBYA 4RAYA 1D8KA 3L2CA 1ITYA 3ZQGA 1KONA 4AIDA 5DM6F 3WTTC 2GM4A 2IRFG 2PJPA 4I6ZA 2ZJ2A 3S14J 2COMA 2CUJA 1V54H 3NWTA 5D6FA 1ZELA 1W4MA 3WU2C 4LITA 3SZTA 1K83J 1MBJA 3BTLA 4AIJA 3OV8A 4XSXF 1XG1A 2PFBA 1MMAA 3KZYA 4QSHA 4YELA 2TDXA 1XB4A 4BEHA 3HUGB 2HYFA 2R7SA 4Z6YA 2VBWA 3DEUA 4XOTA 4X0GA 1G6NA 2UZKA 1GXPA 1IJWC 3RZOJ 4KFCA 1X1CA 1EH6A 2CW7A 2F2EA 4BHPA 5D8LB 2EJRA 3DV8A 3V7CA 1BW6A 2FXAA 3K70C 4O5VA 3RQIA 2ICWG 2MC4A 4M72A 3OL4A 4EJVA 2XGDA 2MYSA 4XL9A 2O61A 3AG1H 4BQOA 2QSGX 4M9ZA 3E7LA 4JP0A 3VFZA 3LFUA 2JRTA 4EM1A 4PJ0C 2DMNA 3K7AJ 1BR2A 1S9HA 1X1AA 2O9LA 3AL0B 1S6LA 3FBNB 4PSWA 5CVIA 2L7MP 5BOXA 2A6TA 2WAEA 4PJLA 1JGGA 2V6CA 4RB1A 4V19K 3S93A 1J09A 5DUIA 2FJ1A 4I99C 2RQQA 4M6YA 2BZTA 1Z6TA 2BY2A 5F0CA 2HNHA 3GLXA 1ZLJA 3MAJA 5BMZA 1I39A 2H8WA 1AWCA 4M3FA 4L18B 3C1DA 4B3AA 4G7OF 5L3DA 2FBKA 1FOKA 3FMRA 4YG2F 4BXUA 3W2VA 1TBXA 1ZN2A 2L4MA 4R8HA 1B59A 2G7UA 1D8JA 3G1MA 3OIOA 3IWFA 3T1BA 3KLNA 2PG4A 2F4IA 1B8IB 1OYIA 4A3FJ 3R0AA 2ZMEB 4BDZA 3VSLA 3PQJA 1BC7C 5DCMB 1E17A 2M30A 4YFKF 1JT6A 3E5XA 4J19A 3K10A 4CYCA 3S2DJ 2L9VA 1UFMA 1LFPA 3O6BB 4ABZA 5E1ZB 1X1DA 2KZGA 1SD5A 3Q5FA 2LKSA 2DMPA 2ETHA 4AIHA 2VXZA 4RB0A 3CCRI 1YYVA 2HOSA 2V1NA 2CQXA 4ON0A 2EPFA 2XUBA 4CO8A 1IW7F 2IA1A 5H6QA 2CV0A 3E6BA 3J81Z 4BE1A 4G6DA 4BL0B 1XDUA 1RR8C 4RLFA 3G2BA 1R49A 3FISA 3JTHA 1D0YA 2RDPA 3N4MA 5IOZA 3O2PE 4G7HF 4Q5SF 1MKMA 5CVRA 2DJNA 2FOWA 2VB6A 2XPUA 5J4YA 4MIMA 1BN5A 3HEFA 2JVGA 2VJ5A 2NRAC 2PMZA 4FISA 3SXYA 3A01A 1TT0A 4BACA 1TW2A 5HOOA 3B6AA 3TOAA 1O4XA 2VPLA 2X1CA 3ECOA 3PM1A 1Z6RA 1KU3A 4ZYGA 2L7KA 4DW6A 4DZJA 4A3GJ 3FIWA 3CMMA 3RKXA 2HDCA 1VQ6I 3JR9A 4IO9F 3RZDJ 3K4NA 2CRGA 3M8EA 5HLHA 3AG2H 4U87A 3GTOJ 1JT0A 4HA8A 1ZAOA 5BPIA 5B66C 4ASNA 2KFDA 3IP4B 4ENKA 1UG0A 4E7ZA 3FM3A 2STTA 1FIPA 1U5TC 1F9NA 5CKTA 1HA8A 3IKVA 4HNVA 2Y9YA 2A3SA 2KKOA 3FMSA 3KYLA 2H1KA 4KNYA 3LSRA 4M9XA 4AIKA 3HM5A 1YW8A 2YU3A 4ESJA 2E71A 2LVSA 4HYEA 4F91B 1MGTA 2DDAA 2DK8A 5FLXZ 1H88C 2CV1A 4FE7A 2DA1A 1EF4A 3HC7A 1LEAA 1U8BA 4MHGA 4JX6A 3S2WA 3L00A 1QHHD 4DZPA 4HV5A 1JKOC 1I27A 2MW8A 3VWBA 2K9NA 4A0XA 2M34A 1E3PA 3V4GA 3T0YA 3M4OJ 2FNPA 3BG5A 1MDMA 1ACIA 4BJ5C 3HOUJ 1QVTA 4BH9A 4IHXA 5EG0A 1GVDA 3DQVC 2DU9A 2HOTA 1O3QA 3CMYA 3F23A 2WAQA 3QPTA 4MTDA 2DFIA 3JRGA 2PMUA 3KX2A 1T2KA 2CUEA 3J80K 4QWQA 1T0FA 2X51A 2MLKA 2DMTA 3KYCB 2DOFA 2DA7A 4L9NA 4M71A 2VJJA 5KCMA 4KJZA 1X19A 2G7HA 2RNGA 4DYCA 2E1OA 4UV9A 3PSIA 3GLLA 3BROA 4N0BA 1RESA 2P6TA 4S05A 1K78A 2JA8J 1E3OC 3MWMA 1F5TA 4HQMA 3B6CA 1G3YA 3L9FA 1JKPC 1FMVA 2NVUB 2I8DA 5FGMA 4UXNA 2E1MB 2Y0SN 1MMDA 5D5WB 5HDGA 1UELB 1LEBA 1UG2A 1WH7A 1QGPA 2VQLA 2E5NA 2QQAA 4U0VA 1G3WA 3H9JA 2HFHA 2RKHA 3I0TA 2EV5A 1ZYRF 2LFBA 1WSUA 1GDTA 4GDFA 2HGCA 1O7LA 4RAFA 1XS9A 4BGDA 2XV4S 3JSOA 1R6RA 3PNYA 2RAEA 3S1QJ 3S8PA 1DQUA 1BOBA 2VT3A 2QGUA 1BJAA 1MIJA 4PCQA 1R58A 2LRDA 2Z1DA 4KN7X 4BBRJ 1IN7A 3OYCA 3COAC 5E79C 3FF5A 4HSTA 2GIZA 4EGZA 1Y1WJ 2ZJPF 3KZZA 4IRIA 1A36A 3E5UA 4RLQA 2HWVA 2CQNA 3HOWJ 2DT5A 1BI0A 2FBHA 2W4SA 3T5XA 1FTZA 4MEYF 4OMZA 3H5RA 1YIJI 4A3BJ 4E70A 1ETWA 2ZMEA 1H0MA 3F8MA 4Y4RA 2HDWA 3LSHA 2EZKA 5HDNA 3PFIA 3IL2A 2X1EA 4UY8I 3PQKA 3CF2A 1FY7A 5FRMA 1ONVA 3K9TA 5J1UA 2CFXA 4ZJZA 4YIIA 4C2MJ 1GV5A 3DU5A 5HLGA 1OYYA 3OYFA 3P5JA 3E1SA 1V5FA 3JRCA 3MVPA 2ZFUA 1F36A 2HVQA 3VB2A 4WWCA 1A04A 1ZHFA 5K1YA 3OS0A 1SEUA 4F92B 3CDLA 4AM3A 4QPQA 2V4JC 4HNTA 1T98A 3PNTA 2WB1N 2V26A 1P4AA 2X9DA 1OYWA 2VQCA 1F1ZA 4CA0A 1BM9A 1B6AA 1HLVA 4LIUA 1PVEA 3QU3A 1W7PD 4UUSA 2FF4A 1KGSA 2FUG2 3R60A 2X6WA 4UUTA 2F5VA 2KZVA 2QF7A 1B9NA 3CDIA 4XRFA 2PEXA 4P55A 2E7WA 3BTIA 1SVLA 4I01A 1ZTRA 3W6VA 2GA2A 2OUMA 2VIXA 4LG3A 3P9IA 3N97A 2IS1A 4YFNF 2DBBA 2IXSA 4IEJA 3FK6A 3MZYA 2BXYA 5K7FA 1Y0NA 2MFZA 2HPIA 3WTSC 3WTVC 3IHUA 2XAJA 1IDYA 2DMQA 1OCTC 2DFFA 1LFUP 4MGRA 1QHGA 4KUMA 3ZMDA 1XC5A 4RMNA 1JJ8C 1LE8A 1S72I 2LBFB 1BL0A 5D5XB 4ETSA 1C0WA 5LRRA 2X6OA 4CXFA 3DWLE 2MD5A 2KRCA 1FP1D 2BHYA 3HKZN 3D5SC 2R0QC 3A4CA 5GAHJ 3DF8A 2Z3YA 5HS9A 1N75A 2HXIA 2L9NA 3OYHA 1G3TA 2EFWA 4AWXB 2D2WA 4NDLA 2LR8A 3WODF 1SAUA 2EIJH 3PJRA 5F08A 1CF7A 5CYVA 5LRSA 2EFPA 2JSCA 4CZCA 5DD4A 2OTJI 4JX5A 3CESA 1QRYA 2QQBA 1Z05A 3P9CA 5BQTA 4HG2A 5CQEA 2RVCA 2H94A 2LYCA 4N9HA 4BE2A 2FSWA 2FX0A 3GFIA 2LY2A 4BEHB 5EZHA 2UUZA 3RPUA 5M3MJ 1CQTA 1WGXA 3IV5A 2JA7J 3IRQA 2QKMB 3IKTA 3CZ6A 3ZCOA 1HW2A 2OA4A 3ABMH 3QYEA 2RV8A 4EVIA 2MLGA 2BY0A 5H6RA 1O3RA 3HBLA 2N8GA 4Q48A 2E35A 3E6DA 3GW2A 3BR0A 5B1BH 3OYNA 4ZYDA 4BAYA 3PIPF 1BC8C 2HVRA 1F43A 2JZYA 1Q1HA 4RB3C 1DUXC 2LK2A 1AOYA 3H0GJ 2LMDA 4P9UA 4KIGA 2L2OA 1Z9CA 4L9TA 4OIQF 3FXJA 2GAUA 4RM2A 1D0ZA 3V8JA 1HC8A 2AO9A 2OBPA 3D5LA 5K7HA 2D1VA 1BR4A 4JBAA 4HW0A 3H3ZA 2NVTJ 4KICA 5TJJA 5E8GA 3O3KA 1UCRA 2L7FP 3S3MA 1FYKA 3UKGA 3R6SA 3K6GA 3CCYA 2AQFA 1FYLA 1MNDA 1OCOH 2JQ7A 4XR6A 3TKYA 2A61A 2V7FA 3D0SA 2VLAA 5E3NA 3E6CC 4BJTA 3SJMA 1JUPA 2HDDA 2DYSH 4EV0A 3CP2A 5C4XJ 2WC2A 1LVAA 2Y0SA 2QM3A 4L9VA 1OMIA 4IHSA 4U0WA 3M9AA 2LP0A 2X85A 1QPMA 4I02A 1IN4A 2M7AA 4A5MA 1QQIA 1V3FA 2IW5A 3K1NA 5J1RA 4ITVA 3MN2A 4B44A 1Z7LA 2J5OA 2X6XA 3OIQA 1WJ5A 3DKWA 5TGTA 4WCGA 2RNJA 3JW4A 4A6EA 1W5SA 2NOGA 2KIQA 3ML6A 1G59A 2Y75A 3HGYA 2CFOA 3K4LA 5DYMA 9ANTA 2IAIA 1IUYA 3CO6C 2X1DA 4FCYA 4FTHA 1D1CA 3DEEA 3A1YA 2OCCH 3JTGA 4IVNA 3HOYJ 4LMYA 1USSA 5FB2A 1DPUA 1Y0UA 1FIAA 3GZ5A 2Q0OA 4IL6C 1JTYA 4NQWA 3I71A 3JRBA 3BTCA 3SEZA 4BY7J 4AC0A 1MBHA 4GXOA 1UHSA 2DA2A 1YFHA 2P0WA 1XD7A 4BE0A 2JT1A 2XKOA 1D5YA 2M2EA 2M87A 3BG6A 2P5VA 5DCFA 3WTWC 6PAXA 4Y33A 2JSPA 1WI3A 2EZHA 4L9JA 5CVVA 1VQ9I 2DJIA 1EH7A 3KP3A 3S2HJ 1HKQA 3ABTA 4FX0A 1JTXA 4J00A 3A01B 2COBA 1VQ5I 4ENJA 1PDNC 4XLFA 4RS8A 1OLTA 3G6EI 5HLTA 2E36A 5E3OA 3F6VA 1TP4A 2L0KA 4N4OB 2L54A 1X3WB 4DJAA 1VI0A 2VOOA 1Z91A 5CVJA 3I59B 5FO5A 1NG6A 3IRRA 1QBJA 1GUUA 3RQ4A 4EATA 2LSOA 2ZSHB 4XLNF 3HTUA 4L5EA 1FBQA 1KQ9A 3GTKJ 2BOLA 2ZC2A 4UV8A 2ZJQF 1H89C 1OCCH 3K1PA 2R3SA 2VOPA 1WRJA 4EMSA 3OYEA 1GXQA 5IT3A 4Y17A 3GZ6A 2L7ZA 2MGQA 2B9SA 2LC2A 4L5IA 4OAZA 3KFWX 2ZO4A 4AYBN 3PSFA 1KQ8A 3QOEA 2IA0A 5JI6A 4P1WA 2XC7A 1V5GA 1R36A 2M3AA 2GLOA 3FK7A 4WF2A 4B48A 4HX4A 2YU9J 1U5TA 4R79A 4XBFA 2ISYA 3IAM2 4DIQA 1XSXA 2E2IJ 2CV2A 3E5QA 1G8XA 3OYGA 4DGWB 1XGSA 3BZ6A 5FKNA 1EJ9A 3JAMZ 2VJ4A 2HTSA 2HVSA 1LUJB 1GVJA 4D1QA 2DYRH 3K0LA 3HGGA 2K27A 5JVGF 3G4SI 1MDMB 1J5YA 2VUMJ 1ORKA 5K5OA 5EG0B 2DK5A 2KJCA 5E3LA 1R22A 2ESNA 3PIOF 3HKZA 3HXLA 2CSOA 1BW5A 5C3EJ 4KITB 2EZIA 3C2BA 2PI0A 1YJWI 4DOZA 2VONA 3OR1C 3REOA 3BY6A 4P96A 1KA8A 3LQQA 3TMOA 1WFXA 4IQJA 1WCMJ 3ZR8X 1TTYA 2GWRA 4EEFG 2IS2A 3KETA 3ULQB 1PUFA 1K78B 1ZRFA 1LPQA 3HRMA 1L0OC 5F0FA 3GMEA 1PP8F 4HDVA 2XF6A 2Z5UA 3DKXA 2MBFA 3R4KA 2VI6A 3ZQCA 5ICEA 3CC2I 3ABKH 5L3CA 5IOYA 3AKZA 4BYYA 3QYFA 4M6XA 3J81K 3CQZJ 2B63J 1OR7C 3GZNB 3GTGJ 3M07A 4M3DA 1JUMA 1UHMA 4M74A 1KZHA 4IQ4A 3DTIA 4M6VA 5L3FA 2PLYA 2VC0A 4IHWA 4IZZA 5E17F 1MBGA 1YX5A 5IP6A 3GF2A 1VQ8I 3FXUA 2K9QA 1ZARA 4D9JA 3K69A 3VEPA 3Q0VA 3PNVA 2H09A 2GQQA 3I4PA 1G2HA 4HF2A 1OQYA 3CCUI 1YQAA 2K7LA 4QLCU 4XICA 2XB5A 3FXRA 3GTMJ 4PK4A 3IH2A 5E3MA 2RREA 4I7HA 3F72A 5IY5H 1AHDP 1QU3A 3CCEI 2ISZA 3DPTA 3A0HC 1R1VA 4RBOA 2IS6A 2VODA 5FFXA 3V8KA 4JYKA 4BKXA 3NEUA 3K1MA 3I55I 3WGIA 4OIOF 2R7OA 2W57A 3TO6A 1O3TA 1BA5A 1OCRH 2GZWA 1P2FA 1YI2I 5L3EA 2IJLA 2R7QA 5BPDA 4CGZA 2XAHA 2MD0A 5HLIA 1A35A 2TRTA 4RM3A 2NYXA 2LF7A 3BR3A 3FM5A 3OS1A 1SD4A 4PFOA 2DA6A 3FWEA 3QPHA 3HJEA 3AG3H 5FKLA 3I58A 3CP8A 2Y48A 1I50J 3U9GA 3GUDA 4AUXA 1ON2A 5JVTA 1R1UA 3U2RA 1Y56A 2DOAA 2KL4A 5TISC 2A68F 4P9FA 1D1AA 3E3VA 3ZQ7A 1HOMA 3GFJA 3EUAA 2KMUA 5B5EC 1XMXA 3G1OA 4V2GA 3EETA 3I64A 4LB6B 4MFDA 3I4MJ 1K7AA 1U3EM 3V42A 1JGSA 4A3IJ 3S17J 1IDZA 4WXDA 2M8EA 1JJ6C 3UR3C 1H8AC 1JKQC 2Y30A 2ZKZA 2ESHA 3S1NJ 4KT5C 1FPQA 4V2FA 4C9YA 5JFRA 2B7EA 4WXCA 2CW0F 2A05A 4IPAA 3RPUD 4QTRA 4UUSB 3QP5A 2VJIA 4EJWA 3X2QH 2W00A 3H3VK 3FKJA 1ZRDA 2P81A 4KDPA 1WZ2A 2FQ3A 1R4MB 3TGNA 3KLOA 2OV7A 4AD9A 2R7WA 2LLKA 3TDUC 2EZLA 2KDOA 1FOYA 2DMUA 3NWSA 1YW7A 3H9GA 1MMGA 4XN0A 4Y3OA 4U7BA 3BJOA 3FDYA 4OU0A 2W85A 2WTEA 3FMQA 3I59A 5K5QA 5EGOA 3LA3A 3BCAA 3CC7I 4BXXJ 2ZBKA 1SAXA 3K70D 3B02A 5JHFA 2K86A 3EYYA 2DFEA 4GYIA 1DU6A 4F55A 5D4SA 1HW1A 1MBFA 3MKWB 3JSPA 1WJEA 4DNCA 1LE8B 2LDUA 3FXKA 3KZIC 4PJNA 5FD5A 1XPXA 1LDKB 2K9LA 5C4JJ 3CMAI 2DN0A 3ZMZA 4J01A 4B43A 2EFQA 4XLPF 4NHJA 3S15J 3OOPA 1K6OA 2J5PA 3CCSI 2CW8A 2EA4A 1NH3A 3MKLA 1IG7A 5D8KB 5EEAA 2CQKA 2P8TA 3I4NJ 5ICGA 3RPQA 3BR6A 3LL7A 4BJ6C 2KPMA 2GXBA 3TOBA 1CF7B 5E8IA 2LH9A 1IRXA 4A3MJ 2DAOA 1ETOA 2IEKA 3ERED 3GVAA 3BDDA 2A07F 3VYTB 1Z3YA 1IC8A 1MBKA 2HZDA 3BG3A 1ZKGA 4HSRA 2JUGA 3OYAA 3GTJJ 1W5TA 4AYBA 1B72B 4CHUA 4NC7A 5F04A 2P5LC 1ZREA 2P7VB 3F9KA 5J6XA 5F1RA 1MW7A 3GEZA 1J0RA 2IPQX 1IN5A 1FBSA 3LSKA 3LQRA 3TQNA 3GCMA 4OAYA 4N9IA 3M7GA 1XGMA 1JXSA 2K9MA 3OY9A 1TWGJ 2E1CA 3DBHB 1AA7A 5DEQA 2R93J 5CLSA 3GO5A 3DEWA 4EGYA 3ZN1A 1TL8A 1IN8A 2DO7A 4QIWN 2KRHA 2EB7A 2FMYA 2JPBA 3FXLA 4CUGA 2LTPA 1DPRA 1TT5B 3ZXSA 4HPQA 1ZQ3P 3IH3A 4GFBA 5LEKA 4N4NB 3QP6A 2ECBA 2Y0MA 1IAWA 3MD2A 2R7VA 4PSXA 1J9IA 3H35A 1S7AA 1X2MA 3JRDA 4ESFA 2NAZA 4P5OA 4E7LA 2DA4A 2XVCA 1LNWA 2LY1A 2HOAA 2UXXA 3TO9A 3KP7A 3D1NI 3QU6A 1WVRA 2R7FA 1RR7A 3I56I 1XTAA 2O7OA 3DPLC 1Q1VA 1WHUA 3HTSB 3IH4A 2O6GE 3ASNH 2DODA 3T8RA 2W1OA 3HRUA 1MZBA 1U6GA 5LHHA 4BDYA 3I54A 1SD7A 2XF5A 4UVCA 2ZXHA 1ZGAA 1OCZH 2X4HA 2JUCA 3AAFA 1FX7A 2FEZA 1YX3A 4G6TB 4A3CJ 1KYZA 2Y31A 3V7RA 2KDZA 2M0MA 3C3WA 4XRSG 3LAPA 3I53A 2EILH 4A2UA 2DPUA 1Z21A 4DBQA 1I3AA 3BZKA 3OYBA 3RYPA 3WTYC 3EUHC 3FXQA 1T08B 2CUZA 3BJ6A 4IOAF 1MBEA 3H3UA 2V1DA 2VXDA 2WY8Q 3BTJA 3H92A 1MMSA 1IV6A 3CO7C 1H9TA 1FNNA 1YE9A 2W24A 4NQWB 2E7XA 3ZQFA 2Y2ZA 3TDZC 3ZQIA 5IYCJ 4C30A 1R4NB 1SFEA 4A69C 2CG4A 1Y6IA 3HSFA 2OQRA 4K2EA 1EH8A 3D5RC 3RCOA 3ZMSA 4XKVA 5F1JA 3Q0UA 1YS6A 4C3HJ 1ZK8A 4R1HA 5GP9A 5DD8A 4S04A 2QZ8A 2IP2A 5EEGA 1I6XA 4HF1A 1WQ2A 2EV0A 3RIRA 1FMWA 4F3QA 3J7ZI 4OWRB 1RPWA 1FSHA 4G12A 2XSDC 1I6HJ 3OIPA 4Y13A 2ELKA 4IX7A 5FKMA 4Z2YA 3GWZA 1SFKA 2KIFA 4MO7A 4RAZA 3KP4A 2HYJA 1ZH5A 3CC4I 2CWEA 2DPDA 5L3BA 4LFUA 1M1EB 4A0YA 1ULYA 2F5DA 3ROUA 2FU4A 4I98B 2K3FA 1IRGA 4XLCA 1UZCA 4U0YA 1TC3C 2EA2A 1R23A 4G9YA 4LLLA 1QPIA 2VKVA 1WKMA 1MJBA 1MNEA 1U2WA 4IRGA 2ID3A 1QZEA 1P4WA 2VQGA 3WGGA 2ZNYA 1MSEC 3HOVJ 2ZCWA 3F6OA 1MD0A 2F6CA 4YEJA 3I5UA 1MJAA 1X4PA 2KP6A 3CJQB 3MZ8A 3PO3J 1RIOH 4KN4X 3AG4H 1E3HA 1FC3A 3DXJF 3GBGA 1Y1VJ 1U5TB 3W2AA 3TO7A 2O03A 5LGTA 1VQMI 4DYRA 4B47A 2R5YA 4HV6A 3ZQHA 2WAFA 1TQMA 3LFKA 1ZG5A 1WH5A 2VC1A 1KQ0A 2V9VA 4M3BA 3P7NA 1FT9A 2QSHX 1IGNA 4F7ZA 3RI4A 3OYIA 1UMQA 4ESBA 3EDPA 2ZXJA 3Q9SA 3QQAA 4HZFA 4A6DA 5LGUA 1HBXG 4OOIA 5KK1A 1FYMA 1DU0A 3E97A 2HPMA 1W36C 4OIRF 1Z7UA 3GYHX 3DLLF 5FLMJ 2Z99A 3M8JA 3W6KB 1B72A 5LD2C 3HOTA 1RZ4A 4D0PA 1W0UA 4RA2A 5M3FJ 2KIUA 4PGHA 3WHCA 1FOWA 1VQOI 3DFGA 2CYYA 3BCBA 3EUKL 5LHIA 3WG7H 2LY9A 3OWTA 5AONA 4WXHA 1PUFB 4HNUA 3V7SA 4KIFA 1B4AA 1P6RA 3HOSA 2AXLA 1VNDA 2JWTA 4FT8A 4B4CA 4XOPA 2VE8A 1WJFA 2E2HJ 4MNUA 4Y7NJ 3TP0A 4F93B 4BQQA 1FBUA 2ELJA 3CDHA 1V5EA 1VQ7I 5J4VA 4PZJA 3KCCA 3E0JB 4A3JJ 3EYIA 3ISPA 4LGWA 4FASD 2MC3A 3S32A 1OR7A 1O57A 4W97A 5ILSA 1N78A 2BXZA 3AL0C 2BVMA 5F0HA 3PUBA 3OOUA 2JRMA 2CH0A 4O3MA 2YPRA 4O6JA 4KA4A 5J47A 3JRHA 2E5ZA 5J1YA 2D45A 3L2QA 3A2KA 3HB9A 4JK1X 3H0DA 3SDGA 3F8CA 2HI3A 2ID6A 1BI3A 3K4CA 2NS8A 2GOMA 3V8LA 2V1UA 3HHGA 1Y8QB 2FE3A 2XAQA 2CJJA 1G3SA 3K2AA 2CUFA 1ZGWA 3RDIA 3CMEI 1YG2A 3U1KA 3MZHA 2RN7A 2CGPA 1TWAJ 2A69F 2XRNA 4II2A 5LBQA 4XONA 5JLWA 3HOZJ 4A3KJ 1BI1A 4RGXA 1T95A 1VZ0A 2QWWA 2R5ZA 1S29A 4A93J 1MH3A 2X0LA 5ILVA 1WJDA 2HZTA 2IA2A 3EQLF 2V1XA 2QCOA 3LOCA 4NUBA 5M5YJ 2DTRA 4PFPA 1A6QA 5L3GA 1WI9A 3E6MA 5IYDJ 3JRFA 3PUFA 2M1BA 3K4BA 1APLC 1EKEA 3DBLB 3ASOH 4AVPA 3HL2A 2NNYA 1SFXA 3LSJA 5HNHA 3OSGA 4D5CA 2QA4I 2LNBA 4HX7A 5J8FA 1X58A 3ERMA 3ZRGA 3VYUB 5CPRB 3GXOA 1X2NA 3JAMK 2M45A 4M3EA 2LKXA 1XN7A 4A12A 3F8BA 2A5YB 5H20A 2Q8KA 1SVMA 2K4BA 1MH4A 5LFAA 1VTNC 2WV0A 4NBQA 4UUVA 2L02A 2FBIA 1FWZA 4E7HA 3U1DA 1XGNA 3S1RJ 4JOMA 1RKWA 5HDKA 2E2JJ 2R7UA 3K2ZA 4NC6A 1USTA 2YX7A 3A0BC 4UVBA 1U0JA 3T8TA 1XX5A 1Y8RB 2LREA 3MKZA 3G73A 3ZN0A 3RSNA 4HDUA 3QODA 2QENA 3A03A 2P5KA 1YRNA 5ED4A 3LSIA 2BGCA 2HYGD 2DOEA 3ELKA 2QQ9A 2V9PA 3LSTA 3RKYA 5JHUA 2GIVA 3L7WA 4HF0A 4BY1J 4ENMA 5EGOB 5FKKA 2W25A 3DTKA 2QUFA 5LLQA 2XSJC 1D5VA 1YOVB 2IGKA 4UHTA 2WB1A 2NNNA 4BBSJ 2XGCA 3CLOA 2CMPA 3WTZA 5D4RA 3ONQA 1DDNA 3F8FA 1W5CC 2KRFA 1XMAA 4PDKA 2DQRA 3GX4X 1SC7A 2XAFA 1W1WE 2NS7A 2XAUA 4EM2A 1TLHB 3BPVA 4XQFA 5JR3A 1PUEE 1XGOA 2Z9OA 4BNCA 2DDBA 2OZUA 2KISA 1AKHA 3ZPLA 4IJAA 2F5FA 1Z0XA 2OU2A 2PJRA 1SANA 3MFKA 2X48A 2A6HF 3GTLJ 3GTQJ 2FMLA 3HIFA 3J7AY 1DP3A 1Z77A 4C3JJ 5GAGJ 2OTLI 1P92A 2R7DA 1S5LC 3HPHA 5KAIC 3CCJI 3S16J 3K4KA 3BLYA 1RC9A 2VL8A 2NVQJ 1TWCJ 4CCOA 2ZFWA 5EYRA 5KAFC 2HQ5A 2ZXIA 4XLEA 3SDBA 3ZQQA 3CCMI 2F48A 4XIDA 5GPAA 1UHWA 4RGRA 2FA5A 3TEDA 4D7NA 2BV6A 2XGXA 1T8IA 1T39A 4FHTA 4ZYAA 2HS5A 5CJ9A 1TQPA 2HEOA 5EDNA 2LKPA 3ABLH 2Y9ZA 3L2WA 1YTYA 4FE4A 1I1SA 3NAUA 1N77A 1JUSA 2UXNA 1E2XA 5DS9A 4A3LJ 4IHYA 3FZVA 3OMYA 1FEXA 3KIOA 2NS0A 5IP9J 1ZRCA 4M9SA 1NHAA 2HKXA 2OC6A 1E0EA 2GOXB 1LFBA 4C3IJ 1W7PA 3BOQA 2QKLB 4H4KC 2VBZA 2F5CA 4E7SA 2F5EA 2KQRA 3PO2J 3BT9A 3PFYA 4DYQA 3OL3A 4KYWA 1UB9A 2M4GA 2L5QA 5E18F 4NB5A 4LG0A 2LF8A 5TRDA 1KU9A 4XK4A 3VSKA 2E1MC 3H36A 2ZJRF 5EJCA 1S7EA 5F27A 5K7ZA 1QZYA 4BQAA 1IRFA 2BVLA 2YUSA 5HVQC 2HXOA 2LG4A 4RAGA 2QVOA 5F6FA 2JA5J 4A5NA 2I10A 4IXAA 4XNFA 2Q1ZB 2O8KA 3MEXA 1YO5C 3Q0WA 1HCRA 3SZGA 3KEOA 2X6YA 5FKOA 2RGVA 2AHQA 3CUQC 3EPZA 5IT9Z 1PP7U 1I3QJ 4YIFA 2GXAA 2CU7A 3G71I 4AVZA 4IHTA 3WTXC 1WJCA 5A2QZ 3JCUC 2E1NA 4HLXA 2NXNB 2R4GA 2M5WA 1EV7A 1RRJA 4CYDA 3OYDA 2BW3A 2NVYJ 5K5RA 3PL8A 1LQ1A 4EM0B 1OFCX 2BEOA 4HRIA 4HX8A 3WG9A 2R7TA 1UJ8A 3L1PA 1LVKA 3LNQA 2ADUA 2VN2A 4BHBA 2KHMA 4LK0F 1RETA 5FLXK 5LEJA 4ZH4F 4LJZF 3EUHA 3IWZA 1XCVA 3S1MJ 3HSRA 3HYIA 3IUOA 1IV8A 1OISA 3TW7A 1TW3A 3C2HA 5CVUA 1S3JA 1IXCA 2A5WA 1WJBA 4AU7A 3J7YJ 2PQ8A 2ECCA 3CCVI 3DKYA 4CCMA 5F64A 2GA1A 1SMYF 4TV7A 2Y69H 4CSWA 4GO1A 3RKQA 2KLOA 1GT0C 1K4SA 1ERDA 2V79A 3OS2A 2EBIA 1R9TJ 1TNTA 3O8HA 1T38A 5EEHA 2EH3A 3H9QA 4LD5A 1KU7A 4KIBA 4UB6C 1FZPB 1F4KA 4E7KA 3F3XA 1VQ4I 3DLAA 3G3ZA 1PYVA 4RB2C 1S7OA 1V4RA 2EFOA 2QSFX 2VASA 5GADJ 2HKOA 2WADA 2H8RA 2OD5A 1YS7A 1HKSA 2QYOA 2CQQA 1U9OA 3AFHA 4ANJA 4I76A 1VQPI 4BQNA 1Y39A 4ZDOA 4LK1F 2K4JA 3FXMA 3F8NA 2W48A 3GFMA 2BE5F 1RNLA 4JQFA 5J8CA 5FLVA 2I5UA 4WK8F 4U88A 2DXIA 4IKFA 1N25A 4GCVA 3WU0A 5FROA 3I3LA 4E7IA 1ETVA 2XGEA 2GBYA 4HLYA 1XSDA 3FHNA 3FXOA 4IOCF 1TZLA 3R61A 3I9V2 3TBIA 2ZSIB 1LKXA 1JKRC 4G94A 1R1TA 1W0TA 4BHCA 4HOBA 2GXGA 5H2FC 2DA5A 2R5YB 1KYWA 3VDXA 4BU2A 1J2XA 1U9NA 3BC8A 3LSPA 4XM3A 4ZYHA 4B8XA 2K3PA 4CICA 3HSEA 4IF4A 4ZDLA 2D5VA 1B9MA 2G9WA 2AXTC 4B09A 3C2GA 2EV6A 2DT6A 3W6JB 4XLHA 3JRAA 1R5GA 1MNMC 1YJNI 2E34A 2K40A 2OJED 2IGNA 2ELHA 3BJAA 3BG7A 1B1BA 2DFHA 4NC8A 2IBDA 3VYRB 2F4OB 1T56A 1XDSA 2R7RA 5IP7J 1IZ1A 2XROA 4ZZLA 3HZJA 1K61A 2H1LA 2C6YA 2MA3A 2O8XA 5ILUA 4C2TA 3QRFF 2W84A 2R92J 4EJUA 3L2UA 2R7ZJ 3H5NA 2HQRA 1MJ9A 2XASA 4RGUA 5LHGA 1ZG1A 4U7DA 3WE2A 2HQNA 2XPVA 4G7ZF 3B73A 5AIPA 1ON1A 1QVUA 2HU9A 1XCBA 2VE9A 5GTIC 3HUGA 3WGHA 4EJOA 1X1BA 3SFZA 2VKEA 5HODA 1P9QC 2M0CA 3BR5A 1VQNI 1MMNA 3KP2A 1U8RA 2YR2A 1ZR2A 4B1RA 1HXDA 2ZNZA 3KPHA 3ZOBA 2XKPA 2QBYB 1X3UA 3CLQA 4LIVA 3TP3A 1WJAA 2XAGA 2F4MB 2M9HA 1VQKI 4F52A 2OPTA 2VBXA 2XDVA 3HHHA 2EFNA 1HDDC 2W7NA 3KP6A 1DGRM 1L3LA 2DW4A 5E1WA 3QYBA 3GTPJ 2PBIA 1BBYA 2DCEA 1VF9A 4XKBA 1SD6A 2JJ7A 2JPCA 2JA6J 4XLAA 3ZGKA 4UVAA 3M1CA 4Q47A 5GAEJ 4KMFA 2H6CA 1Z3XA 2CO5A 1KU2A 3HG9A 3OYKA 4JX4A 4YRVA 2JTVA 3BPXA 5AIQA 1D3YA 4S0HB 2AS5F 2XHKA 1UAAA 1HQCA 3CJRB 3CUQB 3HDDA 1IUFA 3N05A 2R5ZB 1IN6A 3OYLA 4M73A 5JLXA 2ME0A 3SQNA 4I09A 1P7IA 3W3CA 1VQLI 4ZC3A 3ECHA 2CS3A 2DI3A 3JRIA 3CUOA 3Q3SA 3UNGC 3LSMA 4LLNA 2DTZA 4I0AA 3DCFA 1X1PA 3QAHA 2JN6A 3K4JA 5M5XJ 2OQGA 2UWMA 1IXRC 2EQRA 2QQ8A 2XIGA 2L9RA 2MH9A 3J80Z 2WY7Q 1B8IA 2WV1A 1TWFJ 2MABA 4KISA 1G4DA 4PUSA 5DCMA 1U78A 1RUOA 1QZZA 3CTAA 2KJBA 1NTCA 1ENHA 5CQGA 2OF7A 4PGGA 4ENNA 3R0JA 4OMYA 2E60A 2ME6A 3FKIJ 1POGA 3NRVA 4FQGA 2BHZA 2A6EF 1FP2A 1OCPA 5ICFA 4IHVA 4RDUA 1OKRA 1MSFC 4UNOA 1JI8A 2MSYA 3RKWA 4E4HA 4FX4A 1FLIA 1Z67A 1K4TA 5KVRA 4EQQA 3DPUA 3MCZA 3S3OA 3ZP5A 1YRNB 2ZB9A 3SEQA 1VFCA 1H9GA 3DU6A 3M3YJ 2JVHA 4LB5A 2VKDA 1HSJA 4G8XA 4YIRX 2V9KA 5FFZA 3ZMTA 1QA6A 3BQZA 4L0ZB 2L01A 1ETYA 1PJRA 1ODDA 2M4KA 1ZG3A 4CDGA 1V55H 1TWHJ 1O7FA 3QOPA 4D5FA 3F22A 5GPCA 2RQPA 1K6YA 2PX9A 4MFEA 4MLOA 1BJZA 2FD5A 5DUKA 1R71A 1J59A 2HR3A 5FRNA 1ZLKA 5EZGA 5LGNA 1LJ9A 4MQVA 3CJNA 3BR1A 4ZYEA 5C44J 1FSEA 2Z16A 4PJJA 2PN6A 2QEXI 1CGPA 1A31A 3HRTA 1RUNA 5M5WJ 3C18A 4B3XA 2CQ7A 3MQ0A 1AKHB 3TW6A 5D5UB 1J75A 1R00A 3M1EA 3VOEA 2L3DA 2YS9A 3Q9VA 4A0ZA 4WX9A 2PJRB 3NARA 2Q2EB 1YW9A 3F21A 4XRSA 2EWNA 4II3A 4Y15A 4ZTJA 3HPGA 1WPKA 2O3FA 4LLGF 3DTEA 3KYDB 5KNLA 5GTHC 4EJTA 3DBRB 2H6BA 2K9SA 2G0EA 2ZXWH 4MEXF 1X4OA 4CCNA 1BIAA 1GV2A 2B0LA 2NVXJ 1YITI 1R5ID 3BZCA 1GHCA 1YJ9I 4ZTFA 1DGWY 3MKYB 1GLNA 3QPLA 4NNJA 4XRMA 2P6SA 5B1AH 2OCEA 4MTEA 2KT0A 1YHQI 1JHHA 2FRHA 2MG4A 3LA7A 4FETA 4PJMA 2RC4A 4G6QA 2UV1A 1STZA 3A02A 1T0FC 4E6KG 5HNFA 3KEYA 1REPC 2IGOA 3ESWB 1BOAA 3KE2A 5ICCA 3ABUA 3F0CA 1W7PB 2YX4A 2NOJB 2BY3A 4I2OA 5HS8A
chains in the Genus database with same CATH topology
3FX3A 2VT2A 3WTUC 3VODA 4LG0B 5HS7A 4HQEA 2FOKA 1BI2A 4IRHA 1O3SA 2K02A 2QBYA 2BYVE 1JE8A 3M8FA 2HTJA 3GFLA 1J7KA 3HRSA 1BIBA 4OIPF 1XSVA 1SMTA 5D6EA 3FHZA 5DDGA 1HKTA 4MQ9F 3LWFA 1LB2A 2PMHA 5BS6A 2FNAA 4HBLA 2MH2A 1DP7P 2OAZA 1YLFA 2EK5A 1IXSB 5E1XA 3CUQA 3RYRA 1HSTA 1R5HA 3LA2A 2YSRA 1QNTA 1Z1DA 4GGGA 4RGSA 2O0YA 2P7CB 3P9KA 3RTRA 1HW5A 1P4XA 5FD6A 5D5VB 2QLZA 1T6SA 1ZGJA 2H27A 2Z33A 3L09A 1TNSA 4XSZF 4DQ2A 1S8NA 1WWXA 4L0YB 4ZZDA 2P4WA 1JHFA 4GYGA 3RJPA 3SZPA 2ACJA 3LAJA 2BBYA 3J7AO 5DV5A 2L4AA 2WWYA 1QO0D 3IC7A 2IVMA 1R7JA 1SFUA 4H0EA 3NQOA 3ZMVA 3SHFA 1TQIA 3BP8A 1LDDA 4KMUX 4CZZA 5ERIA 3WE3A 4YFXF 3C7JA 2IT0A 2HOEA 3ZMUA 1I5ZA 3KEQA 1IF1A 1I1GA 1YIOA 2Q2EA 3WU1B 2KIMA 2D1HA 2OZ6A 3BWGA 4OINF 3DP7A 4L5JA 1OPCA 3KP5A 2STWA 2DLLA 1LDJA 5E20A 4HAMA 4I0BA 4Q4ZF 1K79A 2DQLA 5IT9K 1RI7A 5A2QK 1XMKA 2VBYA 4RAYA 1D8KA 3L2CA 3WTTC 2IRFG 2PJPA 2ZJ2A 2COMA 5D6FA 1W4MA 3SZTA 4AIJA 3OV8A 4XSXF 2PFBA 3KZYA 2TDXA 1XB4A 2HYFA 2VBWA 3DEUA 1G6NA 2UZKA 1GXPA 4KFCA 2F2EA 1EH6A 4BHPA 5D8LB 2EJRA 3DV8A 3V7CA 2FXAA 4O5VA 4M72A 4EJVA 2O61A 4M9ZA 3VFZA 4EM1A 2JRTA 1S6LA 5CVIA 5BOXA 2V6CA 4RB1A 5DUIA 4M6YA 1Z6TA 3GLXA 1ZLJA 3MAJA 5BMZA 1AWCA 4L18B 3C1DA 4G7OF 5L3DA 2FBKA 1FOKA 3FMRA 4YG2F 4BXUA 1TBXA 1ZN2A 2L4MA 4R8HA 1B59A 2G7UA 1D8JA 3IWFA 3T1BA 3KLNA 2PG4A 1OYIA 3R0AA 2ZMEB 3PQJA 1BC7C 5DCMB 1E17A 2M30A 4YFKF 3E5XA 1UFMA 3O6BB 5E1ZB 1SD5A 3Q5FA 2ETHA 4AIHA 2VXZA 4RB0A 1YYVA 4ON0A 2XUBA 4CO8A 1IW7F 2IA1A 5H6QA 3E6BA 3J81Z 4G6DA 1XDUA 3JTHA 3N4MA 2RDPA 3O2PE 4G7HF 4Q5SF 1MKMA 5CVRA 1BN5A 2NRAC 3SXYA 1TW2A 5HOOA 3TOAA 3ECOA 1Z6RA 1KU3A 4ZYGA 3RKXA 2HDCA 3M8EA 5HLHA 4HA8A 1ZAOA 5BPIA 4ASNA 4ENKA 3FM3A 2STTA 1U5TC 1F9NA 3IKVA 2A3SA 2KKOA 3FMSA 4KNYA 4AIKA 4M9XA 1YW8A 2YU3A 4ESJA 4HYEA 1MGTA 2DK8A 5FLXZ 1LEAA 4MHGA 3S2WA 3L00A 4HV5A 1I27A 4A0XA 3V4GA 3T0YA 2FNPA 1MDMA 4BH9A 3DQVC 2DU9A 1O3QA 3F23A 3QPTA 4MTDA 2DFIA 1T2KA 2PMUA 3J80K 4QWQA 1T0FA 2MLKA 4L9NA 4M71A 2G7HA 4UV9A 3BROA 4N0BA 2P6TA 4S05A 1K78A 3MWMA 1F5TA 4HQMA 1G3YA 3L9FA 5FGMA 4UXNA 5D5WB 5HDGA 1LEBA 1QGPA 2QQAA 4U0VA 1G3WA 2HFHA 2RKHA 3I0TA 2EV5A 1ZYRF 1WSUA 2HGCA 1O7LA 2XV4S 3JSOA 2VT3A 1BJAA 4PCQA 1R58A 4KN7X 1IN7A 3COAC 3FF5A 4EGZA 3KZZA 4IRIA 3E5UA 2HWVA 2DT5A 1BI0A 2FBHA 3T5XA 4MEYF 4OMZA 4E70A 2ZMEA 1H0MA 3F8MA 5HDNA 3PFIA 3IL2A 3PQKA 1FY7A 1ONVA 3K9TA 2CFXA 4YIIA 5HLGA 1OYYA 3VB2A 4WWCA 1A04A 1ZHFA 5K1YA 1T98A 1P4AA 1OYWA 1F1ZA 1BM9A 1B6AA 3QU3A 1W7PD 2FF4A 1KGSA 3R60A 1B9NA 4XRFA 2PEXA 4P55A 2E7WA 4I01A 2GA2A 3N97A 3P9IA 4YFNF 2DBBA 3MZYA 3WTSC 3WTVC 3IHUA 2XAJA 4MGRA 4KUMA 3ZMDA 5D5XB 4ETSA 1C0WA 5LRRA 4CXFA 2MD5A 1FP1D 3DF8A 2Z3YA 5HS9A 1G3TA 2EFWA 4AWXB 2D2WA 3WODF 1CF7A 5CYVA 5LRSA 2EFPA 2JSCA 5DD4A 5BQTA 2QQBA 1Z05A 3P9CA 2RVCA 2H94A 4N9HA 2FSWA 3GFIA 3RPUA 3IRQA 3IKTA 1HW2A 2OA4A 2RV8A 4EVIA 2MLGA 5H6RA 1O3RA 4Q48A 3E6DA 3GW2A 1BC8C 4ZYDA 4BAYA 2JZYA 1Q1HA 4RB3C 1DUXC 1AOYA 4P9UA 4KIGA 1Z9CA 4L9TA 4OIQF 2GAUA 3V8JA 2OBPA 3D5LA 2D1VA 4JBAA 4HW0A 3H3ZA 4KICA 5TJJA 5E8GA 3O3KA 1UCRA 1FYKA 3R6SA 1FYLA 3TKYA 2A61A 3D0SA 3E6CC 4EV0A 2WC2A 1LVAA 2QM3A 4L9VA 1OMIA 4IHSA 4U0WA 3M9AA 1QPMA 4I02A 1IN4A 4A5MA 1QQIA 1V3FA 2IW5A 3K1NA 2J5OA 3DKWA 4WCGA 2RNJA 3JW4A 4A6EA 1W5SA 3ML6A 2Y75A 5DYMA 1IUYA 3CO6C 3JTGA 4IVNA 4LMYA 1USSA 5FB2A 1DPUA 1Y0UA 3GZ5A 2Q0OA 4NQWA 3I71A 4GXOA 1YFHA 1XD7A 2JT1A 2XKOA 2M87A 2P5VA 5DCFA 3WTWC 6PAXA 4L9JA 5CVVA 1EH7A 3KP3A 1HKQA 3ABTA 4FX0A 4ENJA 1PDNC 4RS8A 3F6VA 2L54A 2VOOA 1Z91A 5CVJA 3I59B 5FO5A 3IRRA 1QBJA 2LSOA 4XLNF 3HTUA 1FBQA 1KQ9A 4UV8A 3K1PA 2R3SA 2VOPA 1WRJA 4EMSA 1GXQA 5IT3A 4Y17A 3GZ6A 4L5IA 1KQ8A 3KFWX 2ZO4A 2IA0A 5JI6A 1R36A 4WF2A 4HX4A 1U5TA 4R79A 4XBFA 2ISYA 1XSXA 3E5QA 1XGSA 3BZ6A 3JAMZ 2HTSA 1GVJA 3K0LA 2K27A 1MDMB 1J5YA 5K5OA 2DK5A 2KJCA 1R22A 2ESNA 2CSOA 2PI0A 2VONA 3REOA 3BY6A 4P96A 1KA8A 3LQQA 1TTYA 2GWRA 3KETA 3ULQB 1K78B 1ZRFA 3HRMA 1L0OC 1PP8F 4HDVA 2Z5UA 2MBFA 3R4KA 5ICEA 5L3CA 4BYYA 4M6XA 3J81K 1UHMA 4M74A 5L3FA 2PLYA 2VC0A 5E17F 3GF2A 3FXUA 1ZARA 3K69A 3VEPA 2H09A 2GQQA 3I4PA 4HF2A 1YQAA 2K7LA 4QLCU 3FXRA 4I7HA 3F72A 2ISZA 3DPTA 1R1VA 2VODA 5FFXA 3V8KA 3NEUA 3K1MA 3WGIA 4OIOF 2W57A 3TO6A 1O3TA 2GZWA 1P2FA 5L3EA 2IJLA 5BPDA 4CGZA 2XAHA 5HLIA 2NYXA 2LF7A 3FM5A 1SD4A 3FWEA 3QPHA 3I58A 2Y48A 3U9GA 3GUDA 1ON2A 5JVTA 1R1UA 3U2RA 2A68F 4P9FA 3E3VA 3ZQ7A 3GFJA 3EETA 3I64A 4LB6B 1K7AA 1U3EM 1JGSA 4WXDA 2M8EA 2ZKZA 2ESHA 4KT5C 1FPQA 5JFRA 4WXCA 2CW0F 4IPAA 3QP5A 4EJWA 1ZRDA 4KDPA 2FQ3A 3TGNA 3KLOA 4AD9A 3TDUC 1YW7A 4U7BA 3BJOA 4OU0A 2W85A 2WTEA 3FMQA 3I59A 5K5QA 3LA3A 2ZBKA 1SAXA 3B02A 2K86A 3EYYA 4GYIA 5D4SA 1HW1A 3JSPA 4DNCA 2LDUA 5FD5A 1LDKB 3ZMZA 4XLPF 2EFQA 4NHJA 3OOPA 1K6OA 2J5PA 2EA4A 5D8KB 2CQKA 2P8TA 5ICGA 3RPQA 2GXBA 3TOBA 1CF7B 5E8IA 2DAOA 3ERED 3GVAA 3BDDA 2A07F 1W5TA 4CHUA 2P5LC 1ZREA 2P7VB 5J6XA 5F1RA 3GEZA 1J0RA 2IPQX 1IN5A 1FBSA 3LQRA 3TQNA 4N9IA 3M7GA 1XGMA 1JXSA 2E1CA 5DEQA 5CLSA 3GO5A 4EGYA 3ZN1A 1IN8A 2DO7A 2EB7A 2FMYA 2JPBA 1DPRA 5LEKA 3QP6A 2Y0MA 1IAWA 1J9IA 1S7AA 4ESFA 2NAZA 4P5OA 2XVCA 1LNWA 2UXXA 3TO9A 3KP7A 3QU6A 2R7FA 3DPLC 3HTSB 2O6GE 3T8RA 3HRUA 1MZBA 1U6GA 5LHHA 3I54A 1SD7A 4UVCA 1ZGAA 2X4HA 3AAFA 1FX7A 2FEZA 1KYZA 3V7RA 3C3WA 3LAPA 3I53A 4A2UA 2DPUA 3RYPA 3WTYC 3FXQA 3BJ6A 3H3UA 2V1DA 3H92A 3CO7C 1H9TA 1FNNA 2W24A 2E7XA 3TDZC 1SFEA 2CG4A 4K2EA 3HSFA 2OQRA 1EH8A 3ZMSA 1YS6A 4R1HA 5DD8A 4S04A 2QZ8A 2IP2A 5EEGA 1I6XA 4HF1A 1WQ2A 2EV0A 3RIRA 1FSHA 4Y13A 4Z2YA 3GWZA 2KIFA 4RAZA 3KP4A 1ZH5A 2CWEA 2DPDA 5L3BA 4LFUA 4A0YA 1ULYA 2F5DA 3ROUA 2FU4A 4I98B 1IRGA 4U0YA 2EA2A 1R23A 4G9YA 4LLLA 1WKMA 1MJBA 1U2WA 4IRGA 1P4WA 3WGGA 2ZNYA 2ZCWA 3F6OA 1MD0A 3I5UA 1MJAA 1RIOH 4KN4X 1FC3A 3DXJF 1U5TB 3TO7A 2O03A 5LGTA 4HV6A 1TQMA 3LFKA 1ZG5A 2VC1A 1KQ0A 2V9VA 3P7NA 1FT9A 4F7ZA 3RI4A 4ESBA 3EDPA 2ZXJA 3Q9SA 4HZFA 4A6DA 5LGUA 1HBXG 4OOIA 5KK1A 1FYMA 3E97A 4OIRF 1Z7UA 3GYHX 2Z99A 3W6KB 3HOTA 1RZ4A 4D0PA 2KIUA 4PGHA 3DFGA 2CYYA 5LHIA 5AONA 4WXHA 3V7SA 4KIFA 1B4AA 1P6RA 3HOSA 2AXLA 4FT8A 2VE8A 4MNUA 1FBUA 3CDHA 4PZJA 3KCCA 3EYIA 3ISPA 4LGWA 2MC3A 1OR7A 1O57A 5ILSA 4O3MA 2YPRA 4O6JA 4KA4A 2D45A 4JK1X 3F8CA 1BI3A 3V8LA 2V1UA 3HHGA 2FE3A 2XAQA 1G3SA 3RDIA 1YG2A 3MZHA 2RN7A 2CGPA 2A69F 2XRNA 5LBQA 1BI1A 4RGXA 2QWWA 1S29A 2X0LA 5ILVA 2HZTA 2IA2A 3EQLF 2V1XA 2DTRA 5L3GA 1WI9A 3E6MA 2M1BA 4AVPA 2NNYA 1SFXA 2LNBA 4HX7A 5J8FA 3GXOA 3JAMK 2M45A 1XN7A 4A12A 3F8BA 2A5YB 5H20A 2Q8KA 2K4BA 1VTNC 2WV0A 4UUVA 2L02A 2FBIA 1FWZA 3U1DA 1XGNA 5HDKA 3K2ZA 1USTA 2YX7A 4UVBA 3T8TA 3G73A 3ZN0A 4HDUA 2QENA 2P5KA 5ED4A 2BGCA 2HYGD 3ELKA 2QQ9A 3LSTA 3RKYA 5JHUA 2GIVA 3L7WA 4HF0A 4ENMA 2W25A 2QUFA 5LLQA 1D5VA 4UHTA 2NNNA 3CLOA 3WTZA 5D4RA 1DDNA 3F8FA 2KRFA 1XMAA 4PDKA 2DQRA 3GX4X 2XAFA 4EM2A 5JR3A 1PUEE 1TLHB 3BPVA 2Z9OA 4BNCA 1XGOA 2OZUA 3ZPLA 4IJAA 2F5FA 2OU2A 3MFKA 2A6HF 2FMLA 3HIFA 1P92A 2R7DA 2ZFWA 1UHWA 4RGRA 2FA5A 1T39A 2BV6A 2XGXA 4FHTA 2HS5A 5CJ9A 1TQPA 2HEOA 2LKPA 1YTYA 1I1SA 2UXNA 1E2XA 3FZVA 1ZRCA 2NS0A 4M9SA 1NHAA 2HKXA 1W7PA 3BOQA 2VBZA 2F5CA 2F5EA 4KYWA 1UB9A 5E18F 4NB5A 4LG0A 2LF8A 5TRDA 1KU9A 1QZYA 4BQAA 1IRFA 5HVQC 5F6FA 2QVOA 4A5NA 4IXAA 3MEXA 1YO5C 3KEOA 2RGVA 3CUQC 5IT9Z 1PP7U 4YIFA 4IHTA 3WTXC 5A2QZ 2E1NA 4HLXA 2M5WA 1EV7A 4CYDA 5K5RA 1LQ1A 4EM0B 2BEOA 4HX8A 3WG9A 2ADUA 2VN2A 4BHBA 4LK0F 5FLXK 5LEJA 4ZH4F 4LJZF 3EUHA 3IWZA 1XCVA 3HSRA 3HYIA 1TW3A 5CVUA 1S3JA 1IXCA 2PQ8A 5F64A 2GA1A 1SMYF 4TV7A 4GO1A 2V79A 1TNTA 1T38A 5EEHA 4LD5A 1KU7A 4KIBA 1FZPB 1F4KA 3F3XA 3G3ZA 4RB2C 1S7OA 1V4RA 2EFOA 2HKOA 2OD5A 1YS7A 1HKSA 2QYOA 4LK1F 2K4JA 3GFMA 3F8NA 4JQFA 2BE5F 1RNLA 5J8CA 4WK8F 4U88A 4GCVA 3WU0A 4HLYA 1XSDA 3R61A 4G94A 1R1TA 4BHCA 4HOBA 2GXGA 1KYWA 1J2XA 4ZYHA 4B8XA 4CICA 3HSEA 4IF4A 1B9MA 2G9WA 4B09A 2EV6A 3W6JB 1R5GA 2ELHA 3BJAA 1B1BA 1XDSA 1IZ1A 2XROA 4ZZLA 2C6YA 2MA3A 2O8XA 5ILUA 3QRFF 2W84A 4EJUA 2HQRA 1MJ9A 2XASA 4RGUA 5LHGA 1ZG1A 4U7DA 3WE2A 2HQNA 4G7ZF 3B73A 5AIPA 1ON1A 1XCBA 2VE9A 3HUGA 3WGHA 4EJOA 3SFZA 3KP2A 1U8RA 2YR2A 1HXDA 2ZNZA 2XKPA 2QBYB 1X3UA 2XAGA 2VBXA 3HHHA 2EFNA 3KP6A 1L3LA 2DW4A 5E1WA 2PBIA 1BBYA 1SD6A 2JPCA 4UVAA 4Q47A 4KMFA 2H6CA 2CO5A 1KU2A 2JTVA 3BPXA 5AIQA 1D3YA 2AS5F 2XHKA 1HQCA 3CUQB 1IN6A 4M73A 3SQNA 4I09A 3ECHA 2DI3A 3CUOA 4LLNA 4I0AA 3QAHA 2OQGA 2UWMA 1IXRC 2XIGA 3J80Z 2MH9A 1G4DA 5DCMA 1U78A 1RUOA 1QZZA 3CTAA 2KJBA 4PGGA 4ENNA 3R0JA 4OMYA 3NRVA 2A6EF 1FP2A 5ICFA 1OKRA 4UNOA 3RKWA 4FX4A 1FLIA 5KVRA 4EQQA 3MCZA 3ZP5A 1H9GA 4LB5A 1HSJA 4G8XA 5FFZA 3ZMTA 4L0ZB 2L01A 1ODDA 1ZG3A 4CDGA 1O7FA 3QOPA 3F22A 2RQPA 1J59A 5DUKA 2HR3A 1ZLKA 5LGNA 1LJ9A 4MQVA 3CJNA 4ZYEA 1FSEA 2PN6A 1CGPA 3HRTA 1RUNA 3C18A 3MQ0A 1J75A 5D5UB 1R00A 3M1EA 3VOEA 2L3DA 4WX9A 4A0ZA 3Q9VA 1YW9A 3F21A 2EWNA 4Y15A 2O3FA 4LLGF 4EJTA 2H6BA 4MEXF 1BIAA 2B0LA 1GHCA 2P6SA 4MTEA 1JHHA 2FRHA 3LA7A 2RC4A 4G6QA 1STZA 1REPC 1BOAA 3KE2A 5ICCA 3ABUA 1W7PB 2YX4A 4I2OA 5HS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FX3 A;  2VT2 A;  3WTU C;  3VOD A;  4LG0 B;  5HS7 A;  4HQE A;  2FOK A;  1BI2 A;  4IRH A;  1O3S A;  2K02 A;  2QBY A;  2BYV E;  1JE8 A;  3M8F A;  2HTJ A;  3GFL A;  1J7K A;  3HRS A;  1BIB A;  4OIP F;  1XSV A;  1SMT A;  5D6E A;  3FHZ A;  5DDG A;  1HKT A;  4MQ9 F;  3LWF A;  1LB2 A;  2PMH A;  5BS6 A;  2FNA A;  4HBL A;  2MH2 A;  1DP7 P;  2OAZ A;  1YLF A;  2EK5 A;  1IXS B;  5E1X A;  3CUQ A;  3RYR A;  1HST A;  1R5H A;  3LA2 A;  2YSR A;  1QNT A;  1Z1D A;  4GGG A;  4RGS A;  2O0Y A;  2P7C B;  3P9K A;  3RTR A;  1HW5 A;  1P4X A;  5FD6 A;  5D5V B;  2QLZ A;  1T6S A;  1ZGJ A;  2H27 A;  2Z33 A;  3L09 A;  1TNS A;  4XSZ F;  4DQ2 A;  1S8N A;  1WWX A;  4L0Y B;  4ZZD A;  2P4W A;  1JHF A;  4GYG A;  3RJP A;  3SZP A;  2ACJ A;  3LAJ A;  2BBY A;  3J7A O;  5DV5 A;  2L4A A;  2WWY A;  1QO0 D;  3IC7 A;  2IVM A;  1R7J A;  1SFU A;  4H0E A;  3NQO A;  3ZMV A;  3SHF A;  1TQI A;  3BP8 A;  1LDD A;  4KMU X;  4CZZ A;  5ERI A;  3WE3 A;  4YFX F;  3C7J A;  2IT0 A;  2HOE A;  3ZMU A;  1I5Z A;  3KEQ A;  1IF1 A;  1I1G A;  1YIO A;  2Q2E A;  3WU1 B;  2KIM A;  2D1H A;  2OZ6 A;  3BWG A;  4OIN F;  3DP7 A;  4L5J A;  1OPC A;  3KP5 A;  2STW A;  2DLL A;  1LDJ A;  5E20 A;  4HAM A;  4I0B A;  4Q4Z F;  1K79 A;  2DQL A;  5IT9 K;  1RI7 A;  5A2Q K;  1XMK A;  2VBY A;  4RAY A;  1D8K A;  3L2C A;  3WTT C;  2IRF G;  2PJP A;  2ZJ2 A;  2COM A;  5D6F A;  1W4M A;  3SZT A;  4AIJ A;  3OV8 A;  4XSX F;  2PFB A;  3KZY A;  2TDX A;  1XB4 A;  2HYF A;  2VBW A;  3DEU A;  1G6N A;  2UZK A;  1GXP A;  4KFC A;  2F2E A;  1EH6 A;  4BHP A;  5D8L B;  2EJR A;  3DV8 A;  3V7C A;  2FXA A;  4O5V A;  4M72 A;  4EJV A;  2O61 A;  4M9Z A;  3VFZ A;  4EM1 A;  2JRT A;  1S6L A;  5CVI A;  5BOX A;  2V6C A;  4RB1 A;  5DUI A;  4M6Y A;  1Z6T A;  3GLX A;  1ZLJ A;  3MAJ A;  5BMZ A;  1AWC A;  4L18 B;  3C1D A;  4G7O F;  5L3D A;  2FBK A;  1FOK A;  3FMR A;  4YG2 F;  4BXU A;  1TBX A;  1ZN2 A;  2L4M A;  4R8H A;  1B59 A;  2G7U A;  1D8J A;  3IWF A;  3T1B A;  3KLN A;  2PG4 A;  1OYI A;  3R0A A;  2ZME B;  3PQJ A;  1BC7 C;  5DCM B;  1E17 A;  2M30 A;  4YFK F;  3E5X A;  1UFM A;  3O6B B;  5E1Z B;  1SD5 A;  3Q5F A;  2ETH A;  4AIH A;  2VXZ A;  4RB0 A;  1YYV A;  4ON0 A;  2XUB A;  4CO8 A;  1IW7 F;  2IA1 A;  5H6Q A;  3E6B A;  3J81 Z;  4G6D A;  1XDU A;  3JTH A;  3N4M A;  2RDP A;  3O2P E;  4G7H F;  4Q5S F;  1MKM A;  5CVR A;  1BN5 A;  2NRA C;  3SXY A;  1TW2 A;  5HOO A;  3TOA A;  3ECO A;  1Z6R A;  1KU3 A;  4ZYG A;  3RKX A;  2HDC A;  3M8E A;  5HLH A;  4HA8 A;  1ZAO A;  5BPI A;  4ASN A;  4ENK A;  3FM3 A;  2STT A;  1U5T C;  1F9N A;  3IKV A;  2A3S A;  2KKO A;  3FMS A;  4KNY A;  4AIK A;  4M9X A;  1YW8 A;  2YU3 A;  4ESJ A;  4HYE A;  1MGT A;  2DK8 A;  5FLX Z;  1LEA A;  4MHG A;  3S2W A;  3L00 A;  4HV5 A;  1I27 A;  4A0X A;  3V4G A;  3T0Y A;  2FNP A;  1MDM A;  4BH9 A;  3DQV C;  2DU9 A;  1O3Q A;  3F23 A;  3QPT A;  4MTD A;  2DFI A;  1T2K A;  2PMU A;  3J80 K;  4QWQ A;  1T0F A;  2MLK A;  4L9N A;  4M71 A;  2G7H A;  4UV9 A;  3BRO A;  4N0B A;  2P6T A;  4S05 A;  1K78 A;  3MWM A;  1F5T A;  4HQM A;  1G3Y A;  3L9F A;  5FGM A;  4UXN A;  5D5W B;  5HDG A;  1LEB A;  1QGP A;  2QQA A;  4U0V A;  1G3W A;  2HFH A;  2RKH A;  3I0T A;  2EV5 A;  1ZYR F;  1WSU A;  2HGC A;  1O7L A;  2XV4 S;  3JSO A;  2VT3 A;  1BJA A;  4PCQ A;  1R58 A;  4KN7 X;  1IN7 A;  3COA C;  3FF5 A;  4EGZ A;  3KZZ A;  4IRI A;  3E5U A;  2HWV A;  2DT5 A;  1BI0 A;  2FBH A;  3T5X A;  4MEY F;  4OMZ A;  4E70 A;  2ZME A;  1H0M A;  3F8M A;  5HDN A;  3PFI A;  3IL2 A;  3PQK A;  1FY7 A;  1ONV A;  3K9T A;  2CFX A;  4YII A;  5HLG A;  1OYY A;  3VB2 A;  4WWC A;  1A04 A;  1ZHF A;  5K1Y A;  1T98 A;  1P4A A;  1OYW A;  1F1Z A;  1BM9 A;  1B6A A;  3QU3 A;  1W7P D;  2FF4 A;  1KGS A;  3R60 A;  1B9N A;  4XRF A;  2PEX A;  4P55 A;  2E7W A;  4I01 A;  2GA2 A;  3N97 A;  3P9I A;  4YFN F;  2DBB A;  3MZY A;  3WTS C;  3WTV C;  3IHU A;  2XAJ A;  4MGR A;  4KUM A;  3ZMD A;  5D5X B;  4ETS A;  1C0W A;  5LRR A;  4CXF A;  2MD5 A;  1FP1 D;  3DF8 A;  2Z3Y A;  5HS9 A;  1G3T A;  2EFW A;  4AWX B;  2D2W A;  3WOD F;  1CF7 A;  5CYV A;  5LRS A;  2EFP A;  2JSC A;  5DD4 A;  5BQT A;  2QQB A;  1Z05 A;  3P9C A;  2RVC A;  2H94 A;  4N9H A;  2FSW A;  3GFI A;  3RPU A;  3IRQ A;  3IKT A;  1HW2 A;  2OA4 A;  2RV8 A;  4EVI A;  2MLG A;  5H6R A;  1O3R A;  4Q48 A;  3E6D A;  3GW2 A;  1BC8 C;  4ZYD A;  4BAY A;  2JZY A;  1Q1H A;  4RB3 C;  1DUX C;  1AOY A;  4P9U A;  4KIG A;  1Z9C A;  4L9T A;  4OIQ F;  2GAU A;  3V8J A;  2OBP A;  3D5L A;  2D1V A;  4JBA A;  4HW0 A;  3H3Z A;  4KIC A;  5TJJ A;  5E8G A;  3O3K A;  1UCR A;  1FYK A;  3R6S A;  1FYL A;  3TKY A;  2A61 A;  3D0S A;  3E6C C;  4EV0 A;  2WC2 A;  1LVA A;  2QM3 A;  4L9V A;  1OMI A;  4IHS A;  4U0W A;  3M9A A;  1QPM A;  4I02 A;  1IN4 A;  4A5M A;  1QQI A;  1V3F A;  2IW5 A;  3K1N A;  2J5O A;  3DKW A;  4WCG A;  2RNJ A;  3JW4 A;  4A6E A;  1W5S A;  3ML6 A;  2Y75 A;  5DYM A;  1IUY A;  3CO6 C;  3JTG A;  4IVN A;  4LMY A;  1USS A;  5FB2 A;  1DPU A;  1Y0U A;  3GZ5 A;  2Q0O A;  4NQW A;  3I71 A;  4GXO A;  1YFH A;  1XD7 A;  2JT1 A;  2XKO A;  2M87 A;  2P5V A;  5DCF A;  3WTW C;  6PAX A;  4L9J A;  5CVV A;  1EH7 A;  3KP3 A;  1HKQ A;  3ABT A;  4FX0 A;  4ENJ A;  1PDN C;  4RS8 A;  3F6V A;  2L54 A;  2VOO A;  1Z91 A;  5CVJ A;  3I59 B;  5FO5 A;  3IRR A;  1QBJ A;  2LSO A;  4XLN F;  3HTU A;  1FBQ A;  1KQ9 A;  4UV8 A;  3K1P A;  2R3S A;  2VOP A;  1WRJ A;  4EMS A;  1GXQ A;  5IT3 A;  4Y17 A;  3GZ6 A;  4L5I A;  1KQ8 A;  3KFW X;  2ZO4 A;  2IA0 A;  5JI6 A;  1R36 A;  4WF2 A;  4HX4 A;  1U5T A;  4R79 A;  4XBF A;  2ISY A;  1XSX A;  3E5Q A;  1XGS A;  3BZ6 A;  3JAM Z;  2HTS A;  1GVJ A;  3K0L A;  2K27 A;  1MDM B;  1J5Y A;  5K5O A;  2DK5 A;  2KJC A;  1R22 A;  2ESN A;  2CSO A;  2PI0 A;  2VON A;  3REO A;  3BY6 A;  4P96 A;  1KA8 A;  3LQQ A;  1TTY A;  2GWR A;  3KET A;  3ULQ B;  1K78 B;  1ZRF A;  3HRM A;  1L0O C;  1PP8 F;  4HDV A;  2Z5U A;  2MBF A;  3R4K A;  5ICE A;  5L3C A;  4BYY A;  4M6X A;  3J81 K;  1UHM A;  4M74 A;  5L3F A;  2PLY A;  2VC0 A;  5E17 F;  3GF2 A;  3FXU A;  1ZAR A;  3K69 A;  3VEP A;  2H09 A;  2GQQ A;  3I4P A;  4HF2 A;  1YQA A;  2K7L A;  4QLC U;  3FXR A;  4I7H A;  3F72 A;  2ISZ A;  3DPT A;  1R1V A;  2VOD A;  5FFX A;  3V8K A;  3NEU A;  3K1M A;  3WGI A;  4OIO F;  2W57 A;  3TO6 A;  1O3T A;  2GZW A;  1P2F A;  5L3E A;  2IJL A;  5BPD A;  4CGZ A;  2XAH A;  5HLI A;  2NYX A;  2LF7 A;  3FM5 A;  1SD4 A;  3FWE A;  3QPH A;  3I58 A;  2Y48 A;  3U9G A;  3GUD A;  1ON2 A;  5JVT A;  1R1U A;  3U2R A;  2A68 F;  4P9F A;  3E3V A;  3ZQ7 A;  3GFJ A;  3EET A;  3I64 A;  4LB6 B;  1K7A A;  1U3E M;  1JGS A;  4WXD A;  2M8E A;  2ZKZ A;  2ESH A;  4KT5 C;  1FPQ A;  5JFR A;  4WXC A;  2CW0 F;  4IPA A;  3QP5 A;  4EJW A;  1ZRD A;  4KDP A;  2FQ3 A;  3TGN A;  3KLO A;  4AD9 A;  3TDU C;  1YW7 A;  4U7B A;  3BJO A;  4OU0 A;  2W85 A;  2WTE A;  3FMQ A;  3I59 A;  5K5Q A;  3LA3 A;  2ZBK A;  1SAX A;  3B02 A;  2K86 A;  3EYY A;  4GYI A;  5D4S A;  1HW1 A;  3JSP A;  4DNC A;  2LDU A;  5FD5 A;  1LDK B;  3ZMZ A;  4XLP F;  2EFQ A;  4NHJ A;  3OOP A;  1K6O A;  2J5P A;  2EA4 A;  5D8K B;  2CQK A;  2P8T A;  5ICG A;  3RPQ A;  2GXB A;  3TOB A;  1CF7 B;  5E8I A;  2DAO A;  3ERE D;  3GVA A;  3BDD A;  2A07 F;  1W5T A;  4CHU A;  2P5L C;  1ZRE A;  2P7V B;  5J6X A;  5F1R A;  3GEZ A;  1J0R A;  2IPQ X;  1IN5 A;  1FBS A;  3LQR A;  3TQN A;  4N9I A;  3M7G A;  1XGM A;  1JXS A;  2E1C A;  5DEQ A;  5CLS A;  3GO5 A;  4EGY A;  3ZN1 A;  1IN8 A;  2DO7 A;  2EB7 A;  2FMY A;  2JPB A;  1DPR A;  5LEK A;  3QP6 A;  2Y0M A;  1IAW A;  1J9I A;  1S7A A;  4ESF A;  2NAZ A;  4P5O A;  2XVC A;  1LNW A;  2UXX A;  3TO9 A;  3KP7 A;  3QU6 A;  2R7F A;  3DPL C;  3HTS B;  2O6G E;  3T8R A;  3HRU A;  1MZB A;  1U6G A;  5LHH A;  3I54 A;  1SD7 A;  4UVC A;  1ZGA A;  2X4H A;  3AAF A;  1FX7 A;  2FEZ A;  1KYZ A;  3V7R A;  3C3W A;  3LAP A;  3I53 A;  4A2U A;  2DPU A;  3RYP A;  3WTY C;  3FXQ A;  3BJ6 A;  3H3U A;  2V1D A;  3H92 A;  3CO7 C;  1H9T A;  1FNN A;  2W24 A;  2E7X A;  3TDZ C;  1SFE A;  2CG4 A;  4K2E A;  3HSF A;  2OQR A;  1EH8 A;  3ZMS A;  1YS6 A;  4R1H A;  5DD8 A;  4S04 A;  2QZ8 A;  2IP2 A;  5EEG A;  1I6X A;  4HF1 A;  1WQ2 A;  2EV0 A;  3RIR A;  1FSH A;  4Y13 A;  4Z2Y A;  3GWZ A;  2KIF A;  4RAZ A;  3KP4 A;  1ZH5 A;  2CWE A;  2DPD A;  5L3B A;  4LFU A;  4A0Y A;  1ULY A;  2F5D A;  3ROU A;  2FU4 A;  4I98 B;  1IRG A;  4U0Y A;  2EA2 A;  1R23 A;  4G9Y A;  4LLL A;  1WKM A;  1MJB A;  1U2W A;  4IRG A;  1P4W A;  3WGG A;  2ZNY A;  2ZCW A;  3F6O A;  1MD0 A;  3I5U A;  1MJA A;  1RIO H;  4KN4 X;  1FC3 A;  3DXJ F;  1U5T B;  3TO7 A;  2O03 A;  5LGT A;  4HV6 A;  1TQM A;  3LFK A;  1ZG5 A;  2VC1 A;  1KQ0 A;  2V9V A;  3P7N A;  1FT9 A;  4F7Z A;  3RI4 A;  4ESB A;  3EDP A;  2ZXJ A;  3Q9S A;  4HZF A;  4A6D A;  5LGU A;  1HBX G;  4OOI A;  5KK1 A;  1FYM A;  3E97 A;  4OIR F;  1Z7U A;  3GYH X;  2Z99 A;  3W6K B;  3HOT A;  1RZ4 A;  4D0P A;  2KIU A;  4PGH A;  3DFG A;  2CYY A;  5LHI A;  5AON A;  4WXH A;  3V7S A;  4KIF A;  1B4A A;  1P6R A;  3HOS A;  2AXL A;  4FT8 A;  2VE8 A;  4MNU A;  1FBU A;  3CDH A;  4PZJ A;  3KCC A;  3EYI A;  3ISP A;  4LGW A;  2MC3 A;  1OR7 A;  1O57 A;  5ILS A;  4O3M A;  2YPR A;  4O6J A;  4KA4 A;  2D45 A;  4JK1 X;  3F8C A;  1BI3 A;  3V8L A;  2V1U A;  3HHG A;  2FE3 A;  2XAQ A;  1G3S A;  3RDI A;  1YG2 A;  3MZH A;  2RN7 A;  2CGP A;  2A69 F;  2XRN A;  5LBQ A;  1BI1 A;  4RGX A;  2QWW A;  1S29 A;  2X0L A;  5ILV A;  2HZT A;  2IA2 A;  3EQL F;  2V1X A;  2DTR A;  5L3G A;  1WI9 A;  3E6M A;  2M1B A;  4AVP A;  2NNY A;  1SFX A;  2LNB A;  4HX7 A;  5J8F A;  3GXO A;  3JAM K;  2M45 A;  1XN7 A;  4A12 A;  3F8B A;  2A5Y B;  5H20 A;  2Q8K A;  2K4B A;  1VTN C;  2WV0 A;  4UUV A;  2L02 A;  2FBI A;  1FWZ A;  3U1D A;  1XGN A;  5HDK A;  3K2Z A;  1UST A;  2YX7 A;  4UVB A;  3T8T A;  3G73 A;  3ZN0 A;  4HDU A;  2QEN A;  2P5K A;  5ED4 A;  2BGC A;  2HYG D;  3ELK A;  2QQ9 A;  3LST A;  3RKY A;  5JHU A;  2GIV A;  3L7W A;  4HF0 A;  4ENM A;  2W25 A;  2QUF A;  5LLQ A;  1D5V A;  4UHT A;  2NNN A;  3CLO A;  3WTZ A;  5D4R A;  1DDN A;  3F8F A;  2KRF A;  1XMA A;  4PDK A;  2DQR A;  3GX4 X;  2XAF A;  4EM2 A;  5JR3 A;  1PUE E;  1TLH B;  3BPV A;  2Z9O A;  4BNC A;  1XGO A;  2OZU A;  3ZPL A;  4IJA A;  2F5F A;  2OU2 A;  3MFK A;  2A6H F;  2FML A;  3HIF A;  1P92 A;  2R7D A;  2ZFW A;  1UHW A;  4RGR A;  2FA5 A;  1T39 A;  2BV6 A;  2XGX A;  4FHT A;  2HS5 A;  5CJ9 A;  1TQP A;  2HEO A;  2LKP A;  1YTY A;  1I1S A;  2UXN A;  1E2X A;  3FZV A;  1ZRC A;  2NS0 A;  4M9S A;  1NHA A;  2HKX A;  1W7P A;  3BOQ A;  2VBZ A;  2F5C A;  2F5E A;  4KYW A;  1UB9 A;  5E18 F;  4NB5 A;  4LG0 A;  2LF8 A;  5TRD A;  1KU9 A;  1QZY A;  4BQA A;  1IRF A;  5HVQ C;  5F6F A;  2QVO A;  4A5N A;  4IXA A;  3MEX A;  1YO5 C;  3KEO A;  2RGV A;  3CUQ C;  5IT9 Z;  1PP7 U;  4YIF A;  4IHT A;  3WTX C;  5A2Q Z;  2E1N A;  4HLX A;  2M5W A;  1EV7 A;  4CYD A;  5K5R A;  1LQ1 A;  4EM0 B;  2BEO A;  4HX8 A;  3WG9 A;  2ADU A;  2VN2 A;  4BHB A;  4LK0 F;  5FLX K;  5LEJ A;  4ZH4 F;  4LJZ F;  3EUH A;  3IWZ A;  1XCV A;  3HSR A;  3HYI A;  1TW3 A;  5CVU A;  1S3J A;  1IXC A;  2PQ8 A;  5F64 A;  2GA1 A;  1SMY F;  4TV7 A;  4GO1 A;  2V79 A;  1TNT A;  1T38 A;  5EEH A;  4LD5 A;  1KU7 A;  4KIB A;  1FZP B;  1F4K A;  3F3X A;  3G3Z A;  4RB2 C;  1S7O A;  1V4R A;  2EFO A;  2HKO A;  2OD5 A;  1YS7 A;  1HKS A;  2QYO A;  4LK1 F;  2K4J A;  3GFM A;  3F8N A;  4JQF A;  2BE5 F;  1RNL A;  5J8C A;  4WK8 F;  4U88 A;  4GCV A;  3WU0 A;  4HLY A;  1XSD A;  3R61 A;  4G94 A;  1R1T A;  4BHC A;  4HOB A;  2GXG A;  1KYW A;  1J2X A;  4ZYH A;  4B8X A;  4CIC A;  3HSE A;  4IF4 A;  1B9M A;  2G9W A;  4B09 A;  2EV6 A;  3W6J B;  1R5G A;  2ELH A;  3BJA A;  1B1B A;  1XDS A;  1IZ1 A;  2XRO A;  4ZZL A;  2C6Y A;  2MA3 A;  2O8X A;  5ILU A;  3QRF F;  2W84 A;  4EJU A;  2HQR A;  1MJ9 A;  2XAS A;  4RGU A;  5LHG A;  1ZG1 A;  4U7D A;  3WE2 A;  2HQN A;  4G7Z F;  3B73 A;  5AIP A;  1ON1 A;  1XCB A;  2VE9 A;  3HUG A;  3WGH A;  4EJO A;  3SFZ A;  3KP2 A;  1U8R A;  2YR2 A;  1HXD A;  2ZNZ A;  2XKP A;  2QBY B;  1X3U A;  2XAG A;  2VBX A;  3HHH A;  2EFN A;  3KP6 A;  1L3L A;  2DW4 A;  5E1W A;  2PBI A;  1BBY A;  1SD6 A;  2JPC A;  4UVA A;  4Q47 A;  4KMF A;  2H6C A;  2CO5 A;  1KU2 A;  2JTV A;  3BPX A;  5AIQ A;  1D3Y A;  2AS5 F;  2XHK A;  1HQC A;  3CUQ B;  1IN6 A;  4M73 A;  3SQN A;  4I09 A;  3ECH A;  2DI3 A;  3CUO A;  4LLN A;  4I0A A;  3QAH A;  2OQG A;  2UWM A;  1IXR C;  2XIG A;  3J80 Z;  2MH9 A;  1G4D A;  5DCM A;  1U78 A;  1RUO A;  1QZZ A;  3CTA A;  2KJB A;  4PGG A;  4ENN A;  3R0J A;  4OMY A;  3NRV A;  2A6E F;  1FP2 A;  5ICF A;  1OKR A;  4UNO A;  3RKW A;  4FX4 A;  1FLI A;  5KVR A;  4EQQ A;  3MCZ A;  3ZP5 A;  1H9G A;  4LB5 A;  1HSJ A;  4G8X A;  5FFZ A;  3ZMT A;  4L0Z B;  2L01 A;  1ODD A;  1ZG3 A;  4CDG A;  1O7F A;  3QOP A;  3F22 A;  2RQP A;  1J59 A;  5DUK A;  2HR3 A;  1ZLK A;  5LGN A;  1LJ9 A;  4MQV A;  3CJN A;  4ZYE A;  1FSE A;  2PN6 A;  1CGP A;  3HRT A;  1RUN A;  3C18 A;  3MQ0 A;  1J75 A;  5D5U B;  1R00 A;  3M1E A;  3VOE A;  2L3D A;  4WX9 A;  4A0Z A;  3Q9V A;  1YW9 A;  3F21 A;  2EWN A;  4Y15 A;  2O3F A;  4LLG F;  4EJT A;  2H6B A;  4MEX F;  1BIA A;  2B0L A;  1GHC A;  2P6S A;  4MTE A;  1JHH A;  2FRH A;  3LA7 A;  2RC4 A;  4G6Q A;  1STZ A;  1REP C;  1BOA A;  3KE2 A;  5ICC A;  3ABU A;  1W7P B;  2YX4 A;  4I2O A;  5HS8 A; 
#chains in the Genus database with same CATH topology
 3FX3 A;  2VT2 A;  5IPA A;  5IYB J;  2IGM A;  3H5A A;  3WTU C;  3VOD A;  4LG0 B;  5HS7 A;  4HQE A;  2FOK A;  1BI2 A;  3SYT A;  2HQA A;  3O8G A;  3OR2 C;  4IRH A;  1O3S A;  2K02 A;  2QBY A;  4CCL A;  2BYV E;  3G1L A;  3S3N A;  1JE8 A;  3M8F A;  2R7X A;  2HTJ A;  3GFL A;  2EIM H;  1J7K A;  4M3G A;  3HRS A;  3H1C A;  2Z2S B;  4D7M A;  1HF0 A;  1BIB A;  4OIP F;  3BG9 A;  1XSV A;  1BR1 A;  1SMT A;  5D6E A;  3FHZ A;  1AU7 A;  5DDG A;  2LD5 A;  2IS4 A;  1HKT A;  4MQ9 F;  3LWF A;  1LB2 A;  2PMH A;  2K5C A;  3FBI B;  2JK3 A;  5BS6 A;  2M7B A;  2XF7 A;  4BXF A;  2FNA A;  2AQE A;  1A5J A;  4HBL A;  2MH2 A;  4QPO A;  5B3S H;  1DP7 P;  2OAZ A;  1HDP A;  3L2R A;  1YLF A;  2JMW A;  2EK5 A;  1IXS B;  5E1X A;  5EF6 A;  3CF5 F;  3CUQ A;  3RYR A;  1HST A;  2BW3 B;  1R5H A;  3LA2 A;  2YSR A;  4ZDP A;  1QNT A;  3W2W A;  1Z1D A;  1ETX A;  1IO2 A;  4GGG A;  4RGS A;  1ETQ A;  2O0Y A;  2XB0 X;  2P7C B;  3P9K A;  1SFO J;  2ZME C;  5BNG A;  3CCL I;  3RTR A;  1P7J A;  1HW5 A;  1P4X A;  3U21 A;  4W1U A;  5FD6 A;  4A3E J;  5D5V B;  2QLZ A;  2W82 A;  1T6S A;  3VYS B;  4C2U A;  1ZGJ A;  2H27 A;  1NK2 P;  4CYC B;  2BY1 A;  1D0X A;  2Z33 A;  2K85 A;  3CJT B;  3L09 A;  1TNS A;  2O5R A;  4XSZ F;  2PMZ N;  4DQ2 A;  2E19 A;  1S8N A;  2V6E A;  5FJ8 J;  1WWX A;  4L0Y B;  1OJL A;  3HOX J;  2LOO A;  4ZZD A;  5DM7 F;  1W36 D;  2P4W A;  1JHF A;  3TL4 X;  4GYG A;  3RJP A;  3SZP A;  3WHB A;  4XMY A;  2ACJ A;  5DTD A;  3OYJ A;  3VPR A;  3LAJ A;  2BBY A;  1RKT A;  2FQ4 A;  2M8G X;  3J7A O;  3QWL A;  5J40 A;  4X1E A;  5DV5 A;  4E7J A;  2L4A A;  1FTT A;  1D1B A;  2WWY A;  1QO0 D;  2WBM A;  1IRZ A;  4KT6 A;  3IC7 A;  3LSG A;  2IVM A;  4HEA 2;  1R7J A;  4BS9 A;  3CD6 I;  1SFU A;  3MMY B;  4DBR A;  4H0E A;  3CCQ I;  3OYM A;  4X6A J;  3L2V A;  2DT7 B;  2JA2 A;  2VKH A;  3NQO A;  3ZMV A;  1SVO A;  1A6I A;  3SHF A;  4LOC A;  1TQI A;  3BP8 A;  1LDD A;  4CH7 A;  3BQY A;  4KMU X;  4CZZ A;  5ERI A;  3IAS 2;  3WE3 A;  2EIN H;  4XN3 A;  2EIK H;  4A3D J;  4YFX F;  3C7J A;  2IT0 A;  2HOE A;  5J3L A;  3ZMU A;  4CCK A;  1I5Z A;  2DA3 A;  3KEQ A;  1T33 A;  4UB8 C;  1IF1 A;  1NG7 A;  1I1G A;  3JRE A;  3BR2 A;  4XOR A;  1YIO A;  2XRL A;  4BUP A;  2Q2E A;  1ZR4 A;  3WU1 B;  3SFI A;  2VQH A;  2KIM A;  4CCJ A;  2D1H A;  1FOX A;  2VPR A;  3K4M A;  1EA3 A;  2OZ6 A;  3BWG A;  4OIN F;  3DP7 A;  4L5J A;  1OPC A;  3KP5 A;  2LBF A;  2WA0 A;  4XKC A;  2STW A;  2DLL A;  1LDJ A;  5E20 A;  3OSF A;  4HAM A;  4XKW A;  2WAQ N;  4I0B A;  4Q4Z F;  1K79 A;  4Y52 J;  1X3Z B;  2DQL A;  3QPS A;  3LMM A;  5IT9 K;  1FJL A;  5KHD A;  1ETK A;  3ZQL A;  1RI7 A;  2L9S A;  2XPW A;  1NK3 P;  4GRI A;  5A2Q K;  1XMK A;  2TCT A;  2VBY A;  4RAY A;  1D8K A;  3L2C A;  1ITY A;  3ZQG A;  1KON A;  4AID A;  5DM6 F;  3WTT C;  2GM4 A;  2IRF G;  2PJP A;  4I6Z A;  2ZJ2 A;  3S14 J;  2COM A;  2CUJ A;  1V54 H;  3NWT A;  5D6F A;  1ZEL A;  1W4M A;  3WU2 C;  4LIT A;  3SZT A;  1K83 J;  1MBJ A;  3BTL A;  4AIJ A;  3OV8 A;  4XSX F;  1XG1 A;  2PFB A;  1MMA A;  3KZY A;  4QSH A;  4YEL A;  2TDX A;  1XB4 A;  4BEH A;  3HUG B;  2HYF A;  2R7S A;  4Z6Y A;  2VBW A;  3DEU A;  4XOT A;  4X0G A;  1G6N A;  2UZK A;  1GXP A;  1IJW C;  3RZO J;  4KFC A;  1X1C A;  1EH6 A;  2CW7 A;  2F2E A;  4BHP A;  5D8L B;  2EJR A;  3DV8 A;  3V7C A;  1BW6 A;  2FXA A;  3K70 C;  4O5V A;  3RQI A;  2ICW G;  2MC4 A;  4M72 A;  3OL4 A;  4EJV A;  2XGD A;  2MYS A;  4XL9 A;  2O61 A;  3AG1 H;  4BQO A;  2QSG X;  4M9Z A;  3E7L A;  4JP0 A;  3VFZ A;  3LFU A;  2JRT A;  4EM1 A;  4PJ0 C;  2DMN A;  3K7A J;  1BR2 A;  1S9H A;  1X1A A;  2O9L A;  3AL0 B;  1S6L A;  3FBN B;  4PSW A;  5CVI A;  2L7M P;  5BOX A;  2A6T A;  2WAE A;  4PJL A;  1JGG A;  2V6C A;  4RB1 A;  4V19 K;  3S93 A;  1J09 A;  5DUI A;  2FJ1 A;  4I99 C;  2RQQ A;  4M6Y A;  2BZT A;  1Z6T A;  2BY2 A;  5F0C A;  2HNH A;  3GLX A;  1ZLJ A;  3MAJ A;  5BMZ A;  1I39 A;  2H8W A;  1AWC A;  4M3F A;  4L18 B;  3C1D A;  4B3A A;  4G7O F;  5L3D A;  2FBK A;  1FOK A;  3FMR A;  4YG2 F;  4BXU A;  3W2V A;  1TBX A;  1ZN2 A;  2L4M A;  4R8H A;  1B59 A;  2G7U A;  1D8J A;  3G1M A;  3OIO A;  3IWF A;  3T1B A;  3KLN A;  2PG4 A;  2F4I A;  1B8I B;  1OYI A;  4A3F J;  3R0A A;  2ZME B;  4BDZ A;  3VSL A;  3PQJ A;  1BC7 C;  5DCM B;  1E17 A;  2M30 A;  4YFK F;  1JT6 A;  3E5X A;  4J19 A;  3K10 A;  4CYC A;  3S2D J;  2L9V A;  1UFM A;  1LFP A;  3O6B B;  4ABZ A;  5E1Z B;  1X1D A;  2KZG A;  1SD5 A;  3Q5F A;  2LKS A;  2DMP A;  2ETH A;  4AIH A;  2VXZ A;  4RB0 A;  3CCR I;  1YYV A;  2HOS A;  2V1N A;  2CQX A;  4ON0 A;  2EPF A;  2XUB A;  4CO8 A;  1IW7 F;  2IA1 A;  5H6Q A;  2CV0 A;  3E6B A;  3J81 Z;  4BE1 A;  4G6D A;  4BL0 B;  1XDU A;  1RR8 C;  4RLF A;  3G2B A;  1R49 A;  3FIS A;  3JTH A;  1D0Y A;  2RDP A;  3N4M A;  5IOZ A;  3O2P E;  4G7H F;  4Q5S F;  1MKM A;  5CVR A;  2DJN A;  2FOW A;  2VB6 A;  2XPU A;  5J4Y A;  4MIM A;  1BN5 A;  3HEF A;  2JVG A;  2VJ5 A;  2NRA C;  2PMZ A;  4FIS A;  3SXY A;  3A01 A;  1TT0 A;  4BAC A;  1TW2 A;  5HOO A;  3B6A A;  3TOA A;  1O4X A;  2VPL A;  2X1C A;  3ECO A;  3PM1 A;  1Z6R A;  1KU3 A;  4ZYG A;  2L7K A;  4DW6 A;  4DZJ A;  4A3G J;  3FIW A;  3CMM A;  3RKX A;  2HDC A;  1VQ6 I;  3JR9 A;  4IO9 F;  3RZD J;  3K4N A;  2CRG A;  3M8E A;  5HLH A;  3AG2 H;  4U87 A;  3GTO J;  1JT0 A;  4HA8 A;  1ZAO A;  5BPI A;  5B66 C;  4ASN A;  2KFD A;  3IP4 B;  4ENK A;  1UG0 A;  4E7Z A;  3FM3 A;  2STT A;  1FIP A;  1U5T C;  1F9N A;  5CKT A;  1HA8 A;  3IKV A;  4HNV A;  2Y9Y A;  2A3S A;  2KKO A;  3FMS A;  3KYL A;  2H1K A;  4KNY A;  3LSR A;  4M9X A;  4AIK A;  3HM5 A;  1YW8 A;  2YU3 A;  4ESJ A;  2E71 A;  2LVS A;  4HYE A;  4F91 B;  1MGT A;  2DDA A;  2DK8 A;  5FLX Z;  1H88 C;  2CV1 A;  4FE7 A;  2DA1 A;  1EF4 A;  3HC7 A;  1LEA A;  1U8B A;  4MHG A;  4JX6 A;  3S2W A;  3L00 A;  1QHH D;  4DZP A;  4HV5 A;  1JKO C;  1I27 A;  2MW8 A;  3VWB A;  2K9N A;  4A0X A;  2M34 A;  1E3P A;  3V4G A;  3T0Y A;  3M4O J;  2FNP A;  3BG5 A;  1MDM A;  1ACI A;  4BJ5 C;  3HOU J;  1QVT A;  4BH9 A;  4IHX A;  5EG0 A;  1GVD A;  3DQV C;  2DU9 A;  2HOT A;  1O3Q A;  3CMY A;  3F23 A;  2WAQ A;  3QPT A;  4MTD A;  2DFI A;  3JRG A;  2PMU A;  3KX2 A;  1T2K A;  2CUE A;  3J80 K;  4QWQ A;  1T0F A;  2X51 A;  2MLK A;  2DMT A;  3KYC B;  2DOF A;  2DA7 A;  4L9N A;  4M71 A;  2VJJ A;  5KCM A;  4KJZ A;  1X19 A;  2G7H A;  2RNG A;  4DYC A;  2E1O A;  4UV9 A;  3PSI A;  3GLL A;  3BRO A;  4N0B A;  1RES A;  2P6T A;  4S05 A;  1K78 A;  2JA8 J;  1E3O C;  3MWM A;  1F5T A;  4HQM A;  3B6C A;  1G3Y A;  3L9F A;  1JKP C;  1FMV A;  2NVU B;  2I8D A;  5FGM A;  4UXN A;  2E1M B;  2Y0S N;  1MMD A;  5D5W B;  5HDG A;  1UEL B;  1LEB A;  1UG2 A;  1WH7 A;  1QGP A;  2VQL A;  2E5N A;  2QQA A;  4U0V A;  1G3W A;  3H9J A;  2HFH A;  2RKH A;  3I0T A;  2EV5 A;  1ZYR F;  2LFB A;  1WSU A;  1GDT A;  4GDF A;  2HGC A;  1O7L A;  4RAF A;  1XS9 A;  4BGD A;  2XV4 S;  3JSO A;  1R6R A;  3PNY A;  2RAE A;  3S1Q J;  3S8P A;  1DQU A;  1BOB A;  2VT3 A;  2QGU A;  1BJA A;  1MIJ A;  4PCQ A;  1R58 A;  2LRD A;  2Z1D A;  4KN7 X;  4BBR J;  1IN7 A;  3OYC A;  3COA C;  5E79 C;  3FF5 A;  4HST A;  2GIZ A;  4EGZ A;  1Y1W J;  2ZJP F;  3KZZ A;  4IRI A;  1A36 A;  3E5U A;  4RLQ A;  2HWV A;  2CQN A;  3HOW J;  2DT5 A;  1BI0 A;  2FBH A;  2W4S A;  3T5X A;  1FTZ A;  4MEY F;  4OMZ A;  3H5R A;  1YIJ I;  4A3B J;  4E70 A;  1ETW A;  2ZME A;  1H0M A;  3F8M A;  4Y4R A;  2HDW A;  3LSH A;  2EZK A;  5HDN A;  3PFI A;  3IL2 A;  2X1E A;  4UY8 I;  3PQK A;  3CF2 A;  1FY7 A;  5FRM A;  1ONV A;  3K9T A;  5J1U A;  2CFX A;  4ZJZ A;  4YII A;  4C2M J;  1GV5 A;  3DU5 A;  5HLG A;  1OYY A;  3OYF A;  3P5J A;  3E1S A;  1V5F A;  3JRC A;  3MVP A;  2ZFU A;  1F36 A;  2HVQ A;  3VB2 A;  4WWC A;  1A04 A;  1ZHF A;  5K1Y A;  3OS0 A;  1SEU A;  4F92 B;  3CDL A;  4AM3 A;  4QPQ A;  2V4J C;  4HNT A;  1T98 A;  3PNT A;  2WB1 N;  2V26 A;  1P4A A;  2X9D A;  1OYW A;  2VQC A;  1F1Z A;  4CA0 A;  1BM9 A;  1B6A A;  1HLV A;  4LIU A;  1PVE A;  3QU3 A;  1W7P D;  4UUS A;  2FF4 A;  1KGS A;  2FUG 2;  3R60 A;  2X6W A;  4UUT A;  2F5V A;  2KZV A;  2QF7 A;  1B9N A;  3CDI A;  4XRF A;  2PEX A;  4P55 A;  2E7W A;  3BTI A;  1SVL A;  4I01 A;  1ZTR A;  3W6V A;  2GA2 A;  2OUM A;  2VIX A;  4LG3 A;  3P9I A;  3N97 A;  2IS1 A;  4YFN F;  2DBB A;  2IXS A;  4IEJ A;  3FK6 A;  3MZY A;  2BXY A;  5K7F A;  1Y0N A;  2MFZ A;  2HPI A;  3WTS C;  3WTV C;  3IHU A;  2XAJ A;  1IDY A;  2DMQ A;  1OCT C;  2DFF A;  1LFU P;  4MGR A;  1QHG A;  4KUM A;  3ZMD A;  1XC5 A;  4RMN A;  1JJ8 C;  1LE8 A;  1S72 I;  2LBF B;  1BL0 A;  5D5X B;  4ETS A;  1C0W A;  5LRR A;  2X6O A;  4CXF A;  3DWL E;  2MD5 A;  2KRC A;  1FP1 D;  2BHY A;  3HKZ N;  3D5S C;  2R0Q C;  3A4C A;  5GAH J;  3DF8 A;  2Z3Y A;  5HS9 A;  1N75 A;  2HXI A;  2L9N A;  3OYH A;  1G3T A;  2EFW A;  4AWX B;  2D2W A;  4NDL A;  2LR8 A;  3WOD F;  1SAU A;  2EIJ H;  3PJR A;  5F08 A;  1CF7 A;  5CYV A;  5LRS A;  2EFP A;  2JSC A;  4CZC A;  5DD4 A;  2OTJ I;  4JX5 A;  3CES A;  1QRY A;  2QQB A;  1Z05 A;  3P9C A;  5BQT A;  4HG2 A;  5CQE A;  2RVC A;  2H94 A;  2LYC A;  4N9H A;  4BE2 A;  2FSW A;  2FX0 A;  3GFI A;  2LY2 A;  4BEH B;  5EZH A;  2UUZ A;  3RPU A;  5M3M J;  1CQT A;  1WGX A;  3IV5 A;  2JA7 J;  3IRQ A;  2QKM B;  3IKT A;  3CZ6 A;  3ZCO A;  1HW2 A;  2OA4 A;  3ABM H;  3QYE A;  2RV8 A;  4EVI A;  2MLG A;  2BY0 A;  5H6R A;  1O3R A;  3HBL A;  2N8G A;  4Q48 A;  2E35 A;  3E6D A;  3GW2 A;  3BR0 A;  5B1B H;  3OYN A;  4ZYD A;  4BAY A;  3PIP F;  1BC8 C;  2HVR A;  1F43 A;  2JZY A;  1Q1H A;  4RB3 C;  1DUX C;  2LK2 A;  1AOY A;  3H0G J;  2LMD A;  4P9U A;  4KIG A;  2L2O A;  1Z9C A;  4L9T A;  4OIQ F;  3FXJ A;  2GAU A;  4RM2 A;  1D0Z A;  3V8J A;  1HC8 A;  2AO9 A;  2OBP A;  3D5L A;  5K7H A;  2D1V A;  1BR4 A;  4JBA A;  4HW0 A;  3H3Z A;  2NVT J;  4KIC A;  5TJJ A;  5E8G A;  3O3K A;  1UCR A;  2L7F P;  3S3M A;  1FYK A;  3UKG A;  3R6S A;  3K6G A;  3CCY A;  2AQF A;  1FYL A;  1MND A;  1OCO H;  2JQ7 A;  4XR6 A;  3TKY A;  2A61 A;  2V7F A;  3D0S A;  2VLA A;  5E3N A;  3E6C C;  4BJT A;  3SJM A;  1JUP A;  2HDD A;  2DYS H;  4EV0 A;  3CP2 A;  5C4X J;  2WC2 A;  1LVA A;  2Y0S A;  2QM3 A;  4L9V A;  1OMI A;  4IHS A;  4U0W A;  3M9A A;  2LP0 A;  2X85 A;  1QPM A;  4I02 A;  1IN4 A;  2M7A A;  4A5M A;  1QQI A;  1V3F A;  2IW5 A;  3K1N A;  5J1R A;  4ITV A;  3MN2 A;  4B44 A;  1Z7L A;  2J5O A;  2X6X A;  3OIQ A;  1WJ5 A;  3DKW A;  5TGT A;  4WCG A;  2RNJ A;  3JW4 A;  4A6E A;  1W5S A;  2NOG A;  2KIQ A;  3ML6 A;  1G59 A;  2Y75 A;  3HGY A;  2CFO A;  3K4L A;  5DYM A;  9ANT A;  2IAI A;  1IUY A;  3CO6 C;  2X1D A;  4FCY A;  4FTH A;  1D1C A;  3DEE A;  3A1Y A;  2OCC H;  3JTG A;  4IVN A;  3HOY J;  4LMY A;  1USS A;  5FB2 A;  1DPU A;  1Y0U A;  1FIA A;  3GZ5 A;  2Q0O A;  4IL6 C;  1JTY A;  4NQW A;  3I71 A;  3JRB A;  3BTC A;  3SEZ A;  4BY7 J;  4AC0 A;  1MBH A;  4GXO A;  1UHS A;  2DA2 A;  1YFH A;  2P0W A;  1XD7 A;  4BE0 A;  2JT1 A;  2XKO A;  1D5Y A;  2M2E A;  2M87 A;  3BG6 A;  2P5V A;  5DCF A;  3WTW C;  6PAX A;  4Y33 A;  2JSP A;  1WI3 A;  2EZH A;  4L9J A;  5CVV A;  1VQ9 I;  2DJI A;  1EH7 A;  3KP3 A;  3S2H J;  1HKQ A;  3ABT A;  4FX0 A;  1JTX A;  4J00 A;  3A01 B;  2COB A;  1VQ5 I;  4ENJ A;  1PDN C;  4XLF A;  4RS8 A;  1OLT A;  3G6E I;  5HLT A;  2E36 A;  5E3O A;  3F6V A;  1TP4 A;  2L0K A;  4N4O B;  2L54 A;  1X3W B;  4DJA A;  1VI0 A;  2VOO A;  1Z91 A;  5CVJ A;  3I59 B;  5FO5 A;  1NG6 A;  3IRR A;  1QBJ A;  1GUU A;  3RQ4 A;  4EAT A;  2LSO A;  2ZSH B;  4XLN F;  3HTU A;  4L5E A;  1FBQ A;  1KQ9 A;  3GTK J;  2BOL A;  2ZC2 A;  4UV8 A;  2ZJQ F;  1H89 C;  1OCC H;  3K1P A;  2R3S A;  2VOP A;  1WRJ A;  4EMS A;  3OYE A;  1GXQ A;  5IT3 A;  4Y17 A;  3GZ6 A;  2L7Z A;  2MGQ A;  2B9S A;  2LC2 A;  4L5I A;  4OAZ A;  3KFW X;  2ZO4 A;  4AYB N;  3PSF A;  1KQ8 A;  3QOE A;  2IA0 A;  5JI6 A;  4P1W A;  2XC7 A;  1V5G A;  1R36 A;  2M3A A;  2GLO A;  3FK7 A;  4WF2 A;  4B48 A;  4HX4 A;  2YU9 J;  1U5T A;  4R79 A;  4XBF A;  2ISY A;  3IAM 2;  4DIQ A;  1XSX A;  2E2I J;  2CV2 A;  3E5Q A;  1G8X A;  3OYG A;  4DGW B;  1XGS A;  3BZ6 A;  5FKN A;  1EJ9 A;  3JAM Z;  2VJ4 A;  2HTS A;  2HVS A;  1LUJ B;  1GVJ A;  4D1Q A;  2DYR H;  3K0L A;  3HGG A;  2K27 A;  5JVG F;  3G4S I;  1MDM B;  1J5Y A;  2VUM J;  1ORK A;  5K5O A;  5EG0 B;  2DK5 A;  2KJC A;  5E3L A;  1R22 A;  2ESN A;  3PIO F;  3HKZ A;  3HXL A;  2CSO A;  1BW5 A;  5C3E J;  4KIT B;  2EZI A;  3C2B A;  2PI0 A;  1YJW I;  4DOZ A;  2VON A;  3OR1 C;  3REO A;  3BY6 A;  4P96 A;  1KA8 A;  3LQQ A;  3TMO A;  1WFX A;  4IQJ A;  1WCM J;  3ZR8 X;  1TTY A;  2GWR A;  4EEF G;  2IS2 A;  3KET A;  3ULQ B;  1PUF A;  1K78 B;  1ZRF A;  1LPQ A;  3HRM A;  1L0O C;  5F0F A;  3GME A;  1PP8 F;  4HDV A;  2XF6 A;  2Z5U A;  3DKX A;  2MBF A;  3R4K A;  2VI6 A;  3ZQC A;  5ICE A;  3CC2 I;  3ABK H;  5L3C A;  5IOY A;  3AKZ A;  4BYY A;  3QYF A;  4M6X A;  3J81 K;  3CQZ J;  2B63 J;  1OR7 C;  3GZN B;  3GTG J;  3M07 A;  4M3D A;  1JUM A;  1UHM A;  4M74 A;  1KZH A;  4IQ4 A;  3DTI A;  4M6V A;  5L3F A;  2PLY A;  2VC0 A;  4IHW A;  4IZZ A;  5E17 F;  1MBG A;  1YX5 A;  5IP6 A;  3GF2 A;  1VQ8 I;  3FXU A;  2K9Q A;  1ZAR A;  4D9J A;  3K69 A;  3VEP A;  3Q0V A;  3PNV A;  2H09 A;  2GQQ A;  3I4P A;  1G2H A;  4HF2 A;  1OQY A;  3CCU I;  1YQA A;  2K7L A;  4QLC U;  4XIC A;  2XB5 A;  3FXR A;  3GTM J;  4PK4 A;  3IH2 A;  5E3M A;  2RRE A;  4I7H A;  3F72 A;  5IY5 H;  1AHD P;  1QU3 A;  3CCE I;  2ISZ A;  3DPT A;  3A0H C;  1R1V A;  4RBO A;  2IS6 A;  2VOD A;  5FFX A;  3V8K A;  4JYK A;  4BKX A;  3NEU A;  3K1M A;  3I55 I;  3WGI A;  4OIO F;  2R7O A;  2W57 A;  3TO6 A;  1O3T A;  1BA5 A;  1OCR H;  2GZW A;  1P2F A;  1YI2 I;  5L3E A;  2IJL A;  2R7Q A;  5BPD A;  4CGZ A;  2XAH A;  2MD0 A;  5HLI A;  1A35 A;  2TRT A;  4RM3 A;  2NYX A;  2LF7 A;  3BR3 A;  3FM5 A;  3OS1 A;  1SD4 A;  4PFO A;  2DA6 A;  3FWE A;  3QPH A;  3HJE A;  3AG3 H;  5FKL A;  3I58 A;  3CP8 A;  2Y48 A;  1I50 J;  3U9G A;  3GUD A;  4AUX A;  1ON2 A;  5JVT A;  1R1U A;  3U2R A;  1Y56 A;  2DOA A;  2KL4 A;  5TIS C;  2A68 F;  4P9F A;  1D1A A;  3E3V A;  3ZQ7 A;  1HOM A;  3GFJ A;  3EUA A;  2KMU A;  5B5E C;  1XMX A;  3G1O A;  4V2G A;  3EET A;  3I64 A;  4LB6 B;  4MFD A;  3I4M J;  1K7A A;  1U3E M;  3V42 A;  1JGS A;  4A3I J;  3S17 J;  1IDZ A;  4WXD A;  2M8E A;  1JJ6 C;  3UR3 C;  1H8A C;  1JKQ C;  2Y30 A;  2ZKZ A;  2ESH A;  3S1N J;  4KT5 C;  1FPQ A;  4V2F A;  4C9Y A;  5JFR A;  2B7E A;  4WXC A;  2CW0 F;  2A05 A;  4IPA A;  3RPU D;  4QTR A;  4UUS B;  3QP5 A;  2VJI A;  4EJW A;  3X2Q H;  2W00 A;  3H3V K;  3FKJ A;  1ZRD A;  2P81 A;  4KDP A;  1WZ2 A;  2FQ3 A;  1R4M B;  3TGN A;  3KLO A;  2OV7 A;  4AD9 A;  2R7W A;  2LLK A;  3TDU C;  2EZL A;  2KDO A;  1FOY A;  2DMU A;  3NWS A;  1YW7 A;  3H9G A;  1MMG A;  4XN0 A;  4Y3O A;  4U7B A;  3BJO A;  3FDY A;  4OU0 A;  2W85 A;  2WTE A;  3FMQ A;  3I59 A;  5K5Q A;  5EGO A;  3LA3 A;  3BCA A;  3CC7 I;  4BXX J;  2ZBK A;  1SAX A;  3K70 D;  3B02 A;  5JHF A;  2K86 A;  3EYY A;  2DFE A;  4GYI A;  1DU6 A;  4F55 A;  5D4S A;  1HW1 A;  1MBF A;  3MKW B;  3JSP A;  1WJE A;  4DNC A;  1LE8 B;  2LDU A;  3FXK A;  3KZI C;  4PJN A;  5FD5 A;  1XPX A;  1LDK B;  2K9L A;  5C4J J;  3CMA I;  2DN0 A;  3ZMZ A;  4J01 A;  4B43 A;  2EFQ A;  4XLP F;  4NHJ A;  3S15 J;  3OOP A;  1K6O A;  2J5P A;  3CCS I;  2CW8 A;  2EA4 A;  1NH3 A;  3MKL A;  1IG7 A;  5D8K B;  5EEA A;  2CQK A;  2P8T A;  3I4N J;  5ICG A;  3RPQ A;  3BR6 A;  3LL7 A;  4BJ6 C;  2KPM A;  2GXB A;  3TOB A;  1CF7 B;  5E8I A;  2LH9 A;  1IRX A;  4A3M J;  2DAO A;  1ETO A;  2IEK A;  3ERE D;  3GVA A;  3BDD A;  2A07 F;  3VYT B;  1Z3Y A;  1IC8 A;  1MBK A;  2HZD A;  3BG3 A;  1ZKG A;  4HSR A;  2JUG A;  3OYA A;  3GTJ J;  1W5T A;  4AYB A;  1B72 B;  4CHU A;  4NC7 A;  5F04 A;  2P5L C;  1ZRE A;  2P7V B;  3F9K A;  5J6X A;  5F1R A;  1MW7 A;  3GEZ A;  1J0R A;  2IPQ X;  1IN5 A;  1FBS A;  3LSK A;  3LQR A;  3TQN A;  3GCM A;  4OAY A;  4N9I A;  3M7G A;  1XGM A;  1JXS A;  2K9M A;  3OY9 A;  1TWG J;  2E1C A;  3DBH B;  1AA7 A;  5DEQ A;  2R93 J;  5CLS A;  3GO5 A;  3DEW A;  4EGY A;  3ZN1 A;  1TL8 A;  1IN8 A;  2DO7 A;  4QIW N;  2KRH A;  2EB7 A;  2FMY A;  2JPB A;  3FXL A;  4CUG A;  2LTP A;  1DPR A;  1TT5 B;  3ZXS A;  4HPQ A;  1ZQ3 P;  3IH3 A;  4GFB A;  5LEK A;  4N4N B;  3QP6 A;  2ECB A;  2Y0M A;  1IAW A;  3MD2 A;  2R7V A;  4PSX A;  1J9I A;  3H35 A;  1S7A A;  1X2M A;  3JRD A;  4ESF A;  2NAZ A;  4P5O A;  4E7L A;  2DA4 A;  2XVC A;  1LNW A;  2LY1 A;  2HOA A;  2UXX A;  3TO9 A;  3KP7 A;  3D1N I;  3QU6 A;  1WVR A;  2R7F A;  1RR7 A;  3I56 I;  1XTA A;  2O7O A;  3DPL C;  1Q1V A;  1WHU A;  3HTS B;  3IH4 A;  2O6G E;  3ASN H;  2DOD A;  3T8R A;  2W1O A;  3HRU A;  1MZB A;  1U6G A;  5LHH A;  4BDY A;  3I54 A;  1SD7 A;  2XF5 A;  4UVC A;  2ZXH A;  1ZGA A;  1OCZ H;  2X4H A;  2JUC A;  3AAF A;  1FX7 A;  2FEZ A;  1YX3 A;  4G6T B;  4A3C J;  1KYZ A;  2Y31 A;  3V7R A;  2KDZ A;  2M0M A;  3C3W A;  4XRS G;  3LAP A;  3I53 A;  2EIL H;  4A2U A;  2DPU A;  1Z21 A;  4DBQ A;  1I3A A;  3BZK A;  3OYB A;  3RYP A;  3WTY C;  3EUH C;  3FXQ A;  1T08 B;  2CUZ A;  3BJ6 A;  4IOA F;  1MBE A;  3H3U A;  2V1D A;  2VXD A;  2WY8 Q;  3BTJ A;  3H92 A;  1MMS A;  1IV6 A;  3CO7 C;  1H9T A;  1FNN A;  1YE9 A;  2W24 A;  4NQW B;  2E7X A;  3ZQF A;  2Y2Z A;  3TDZ C;  3ZQI A;  5IYC J;  4C30 A;  1R4N B;  1SFE A;  4A69 C;  2CG4 A;  1Y6I A;  3HSF A;  2OQR A;  4K2E A;  1EH8 A;  3D5R C;  3RCO A;  3ZMS A;  4XKV A;  5F1J A;  3Q0U A;  1YS6 A;  4C3H J;  1ZK8 A;  4R1H A;  5GP9 A;  5DD8 A;  4S04 A;  2QZ8 A;  2IP2 A;  5EEG A;  1I6X A;  4HF1 A;  1WQ2 A;  2EV0 A;  3RIR A;  1FMW A;  4F3Q A;  3J7Z I;  4OWR B;  1RPW A;  1FSH A;  4G12 A;  2XSD C;  1I6H J;  3OIP A;  4Y13 A;  2ELK A;  4IX7 A;  5FKM A;  4Z2Y A;  3GWZ A;  1SFK A;  2KIF A;  4MO7 A;  4RAZ A;  3KP4 A;  2HYJ A;  1ZH5 A;  3CC4 I;  2CWE A;  2DPD A;  5L3B A;  4LFU A;  1M1E B;  4A0Y A;  1ULY A;  2F5D A;  3ROU A;  2FU4 A;  4I98 B;  2K3F A;  1IRG A;  4XLC A;  1UZC A;  4U0Y A;  1TC3 C;  2EA2 A;  1R23 A;  4G9Y A;  4LLL A;  1QPI A;  2VKV A;  1WKM A;  1MJB A;  1MNE A;  1U2W A;  4IRG A;  2ID3 A;  1QZE A;  1P4W A;  2VQG A;  3WGG A;  2ZNY A;  1MSE C;  3HOV J;  2ZCW A;  3F6O A;  1MD0 A;  2F6C A;  4YEJ A;  3I5U A;  1MJA A;  1X4P A;  2KP6 A;  3CJQ B;  3MZ8 A;  3PO3 J;  1RIO H;  4KN4 X;  3AG4 H;  1E3H A;  1FC3 A;  3DXJ F;  3GBG A;  1Y1V J;  1U5T B;  3W2A A;  3TO7 A;  2O03 A;  5LGT A;  1VQM I;  4DYR A;  4B47 A;  2R5Y A;  4HV6 A;  3ZQH A;  2WAF A;  1TQM A;  3LFK A;  1ZG5 A;  1WH5 A;  2VC1 A;  1KQ0 A;  2V9V A;  4M3B A;  3P7N A;  1FT9 A;  2QSH X;  1IGN A;  4F7Z A;  3RI4 A;  3OYI A;  1UMQ A;  4ESB A;  3EDP A;  2ZXJ A;  3Q9S A;  3QQA A;  4HZF A;  4A6D A;  5LGU A;  1HBX G;  4OOI A;  5KK1 A;  1FYM A;  1DU0 A;  3E97 A;  2HPM A;  1W36 C;  4OIR F;  1Z7U A;  3GYH X;  3DLL F;  5FLM J;  2Z99 A;  3M8J A;  3W6K B;  1B72 A;  5LD2 C;  3HOT A;  1RZ4 A;  4D0P A;  1W0U A;  4RA2 A;  5M3F J;  2KIU A;  4PGH A;  3WHC A;  1FOW A;  1VQO I;  3DFG A;  2CYY A;  3BCB A;  3EUK L;  5LHI A;  3WG7 H;  2LY9 A;  3OWT A;  5AON A;  4WXH A;  1PUF B;  4HNU A;  3V7S A;  4KIF A;  1B4A A;  1P6R A;  3HOS A;  2AXL A;  1VND A;  2JWT A;  4FT8 A;  4B4C A;  4XOP A;  2VE8 A;  1WJF A;  2E2H J;  4MNU A;  4Y7N J;  3TP0 A;  4F93 B;  4BQQ A;  1FBU A;  2ELJ A;  3CDH A;  1V5E A;  1VQ7 I;  5J4V A;  4PZJ A;  3KCC A;  3E0J B;  4A3J J;  3EYI A;  3ISP A;  4LGW A;  4FAS D;  2MC3 A;  3S32 A;  1OR7 A;  1O57 A;  4W97 A;  5ILS A;  1N78 A;  2BXZ A;  3AL0 C;  2BVM A;  5F0H A;  3PUB A;  3OOU A;  2JRM A;  2CH0 A;  4O3M A;  2YPR A;  4O6J A;  4KA4 A;  5J47 A;  3JRH A;  2E5Z A;  5J1Y A;  2D45 A;  3L2Q A;  3A2K A;  3HB9 A;  4JK1 X;  3H0D A;  3SDG A;  3F8C A;  2HI3 A;  2ID6 A;  1BI3 A;  3K4C A;  2NS8 A;  2GOM A;  3V8L A;  2V1U A;  3HHG A;  1Y8Q B;  2FE3 A;  2XAQ A;  2CJJ A;  1G3S A;  3K2A A;  2CUF A;  1ZGW A;  3RDI A;  3CME I;  1YG2 A;  3U1K A;  3MZH A;  2RN7 A;  2CGP A;  1TWA J;  2A69 F;  2XRN A;  4II2 A;  5LBQ A;  4XON A;  5JLW A;  3HOZ J;  4A3K J;  1BI1 A;  4RGX A;  1T95 A;  1VZ0 A;  2QWW A;  2R5Z A;  1S29 A;  4A93 J;  1MH3 A;  2X0L A;  5ILV A;  1WJD A;  2HZT A;  2IA2 A;  3EQL F;  2V1X A;  2QCO A;  3LOC A;  4NUB A;  5M5Y J;  2DTR A;  4PFP A;  1A6Q A;  5L3G A;  1WI9 A;  3E6M A;  5IYD J;  3JRF A;  3PUF A;  2M1B A;  3K4B A;  1APL C;  1EKE A;  3DBL B;  3ASO H;  4AVP A;  3HL2 A;  2NNY A;  1SFX A;  3LSJ A;  5HNH A;  3OSG A;  4D5C A;  2QA4 I;  2LNB A;  4HX7 A;  5J8F A;  1X58 A;  3ERM A;  3ZRG A;  3VYU B;  5CPR B;  3GXO A;  1X2N A;  3JAM K;  2M45 A;  4M3E A;  2LKX A;  1XN7 A;  4A12 A;  3F8B A;  2A5Y B;  5H20 A;  2Q8K A;  1SVM A;  2K4B A;  1MH4 A;  5LFA A;  1VTN C;  2WV0 A;  4NBQ A;  4UUV A;  2L02 A;  2FBI A;  1FWZ A;  4E7H A;  3U1D A;  1XGN A;  3S1R J;  4JOM A;  1RKW A;  5HDK A;  2E2J J;  2R7U A;  3K2Z A;  4NC6 A;  1UST A;  2YX7 A;  3A0B C;  4UVB A;  1U0J A;  3T8T A;  1XX5 A;  1Y8R B;  2LRE A;  3MKZ A;  3G73 A;  3ZN0 A;  3RSN A;  4HDU A;  3QOD A;  2QEN A;  3A03 A;  2P5K A;  1YRN A;  5ED4 A;  3LSI A;  2BGC A;  2HYG D;  2DOE A;  3ELK A;  2QQ9 A;  2V9P A;  3LST A;  3RKY A;  5JHU A;  2GIV A;  3L7W A;  4HF0 A;  4BY1 J;  4ENM A;  5EGO B;  5FKK A;  2W25 A;  3DTK A;  2QUF A;  5LLQ A;  2XSJ C;  1D5V A;  1YOV B;  2IGK A;  4UHT A;  2WB1 A;  2NNN A;  4BBS J;  2XGC A;  3CLO A;  2CMP A;  3WTZ A;  5D4R A;  3ONQ A;  1DDN A;  3F8F A;  1W5C C;  2KRF A;  1XMA A;  4PDK A;  2DQR A;  3GX4 X;  1SC7 A;  2XAF A;  1W1W E;  2NS7 A;  2XAU A;  4EM2 A;  1TLH B;  3BPV A;  4XQF A;  5JR3 A;  1PUE E;  1XGO A;  2Z9O A;  4BNC A;  2DDB A;  2OZU A;  2KIS A;  1AKH A;  3ZPL A;  4IJA A;  2F5F A;  1Z0X A;  2OU2 A;  2PJR A;  1SAN A;  3MFK A;  2X48 A;  2A6H F;  3GTL J;  3GTQ J;  2FML A;  3HIF A;  3J7A Y;  1DP3 A;  1Z77 A;  4C3J J;  5GAG J;  2OTL I;  1P92 A;  2R7D A;  1S5L C;  3HPH A;  5KAI C;  3CCJ I;  3S16 J;  3K4K A;  3BLY A;  1RC9 A;  2VL8 A;  2NVQ J;  1TWC J;  4CCO A;  2ZFW A;  5EYR A;  5KAF C;  2HQ5 A;  2ZXI A;  4XLE A;  3SDB A;  3ZQQ A;  3CCM I;  2F48 A;  4XID A;  5GPA A;  1UHW A;  4RGR A;  2FA5 A;  3TED A;  4D7N A;  2BV6 A;  2XGX A;  1T8I A;  1T39 A;  4FHT A;  4ZYA A;  2HS5 A;  5CJ9 A;  1TQP A;  2HEO A;  5EDN A;  2LKP A;  3ABL H;  2Y9Z A;  3L2W A;  1YTY A;  4FE4 A;  1I1S A;  3NAU A;  1N77 A;  1JUS A;  2UXN A;  1E2X A;  5DS9 A;  4A3L J;  4IHY A;  3FZV A;  3OMY A;  1FEX A;  3KIO A;  2NS0 A;  5IP9 J;  1ZRC A;  4M9S A;  1NHA A;  2HKX A;  2OC6 A;  1E0E A;  2GOX B;  1LFB A;  4C3I J;  1W7P A;  3BOQ A;  2QKL B;  4H4K C;  2VBZ A;  2F5C A;  4E7S A;  2F5E A;  2KQR A;  3PO2 J;  3BT9 A;  3PFY A;  4DYQ A;  3OL3 A;  4KYW A;  1UB9 A;  2M4G A;  2L5Q A;  5E18 F;  4NB5 A;  4LG0 A;  2LF8 A;  5TRD A;  1KU9 A;  4XK4 A;  3VSK A;  2E1M C;  3H36 A;  2ZJR F;  5EJC A;  1S7E A;  5F27 A;  5K7Z A;  1QZY A;  4BQA A;  1IRF A;  2BVL A;  2YUS A;  5HVQ C;  2HXO A;  2LG4 A;  4RAG A;  2QVO A;  5F6F A;  2JA5 J;  4A5N A;  2I10 A;  4IXA A;  4XNF A;  2Q1Z B;  2O8K A;  3MEX A;  1YO5 C;  3Q0W A;  1HCR A;  3SZG A;  3KEO A;  2X6Y A;  5FKO A;  2RGV A;  2AHQ A;  3CUQ C;  3EPZ A;  5IT9 Z;  1PP7 U;  1I3Q J;  4YIF A;  2GXA A;  2CU7 A;  3G71 I;  4AVZ A;  4IHT A;  3WTX C;  1WJC A;  5A2Q Z;  3JCU C;  2E1N A;  4HLX A;  2NXN B;  2R4G A;  2M5W A;  1EV7 A;  1RRJ A;  4CYD A;  3OYD A;  2BW3 A;  2NVY J;  5K5R A;  3PL8 A;  1LQ1 A;  4EM0 B;  1OFC X;  2BEO A;  4HRI A;  4HX8 A;  3WG9 A;  2R7T A;  1UJ8 A;  3L1P A;  1LVK A;  3LNQ A;  2ADU A;  2VN2 A;  4BHB A;  2KHM A;  4LK0 F;  1RET A;  5FLX K;  5LEJ A;  4ZH4 F;  4LJZ F;  3EUH A;  3IWZ A;  1XCV A;  3S1M J;  3HSR A;  3HYI A;  3IUO A;  1IV8 A;  1OIS A;  3TW7 A;  1TW3 A;  3C2H A;  5CVU A;  1S3J A;  1IXC A;  2A5W A;  1WJB A;  4AU7 A;  3J7Y J;  2PQ8 A;  2ECC A;  3CCV I;  3DKY A;  4CCM A;  5F64 A;  2GA1 A;  1SMY F;  4TV7 A;  2Y69 H;  4CSW A;  4GO1 A;  3RKQ A;  2KLO A;  1GT0 C;  1K4S A;  1ERD A;  2V79 A;  3OS2 A;  2EBI A;  1R9T J;  1TNT A;  3O8H A;  1T38 A;  5EEH A;  2EH3 A;  3H9Q A;  4LD5 A;  1KU7 A;  4KIB A;  4UB6 C;  1FZP B;  1F4K A;  4E7K A;  3F3X A;  1VQ4 I;  3DLA A;  3G3Z A;  1PYV A;  4RB2 C;  1S7O A;  1V4R A;  2EFO A;  2QSF X;  2VAS A;  5GAD J;  2HKO A;  2WAD A;  2H8R A;  2OD5 A;  1YS7 A;  1HKS A;  2QYO A;  2CQQ A;  1U9O A;  3AFH A;  4ANJ A;  4I76 A;  1VQP I;  4BQN A;  1Y39 A;  4ZDO A;  4LK1 F;  2K4J A;  3FXM A;  3F8N A;  2W48 A;  3GFM A;  2BE5 F;  1RNL A;  4JQF A;  5J8C A;  5FLV A;  2I5U A;  4WK8 F;  4U88 A;  2DXI A;  4IKF A;  1N25 A;  4GCV A;  3WU0 A;  5FRO A;  3I3L A;  4E7I A;  1ETV A;  2XGE A;  2GBY A;  4HLY A;  1XSD A;  3FHN A;  3FXO A;  4IOC F;  1TZL A;  3R61 A;  3I9V 2;  3TBI A;  2ZSI B;  1LKX A;  1JKR C;  4G94 A;  1R1T A;  1W0T A;  4BHC A;  4HOB A;  2GXG A;  5H2F C;  2DA5 A;  2R5Y B;  1KYW A;  3VDX A;  4BU2 A;  1J2X A;  1U9N A;  3BC8 A;  3LSP A;  4XM3 A;  4ZYH A;  4B8X A;  2K3P A;  4CIC A;  3HSE A;  4IF4 A;  4ZDL A;  2D5V A;  1B9M A;  2G9W A;  2AXT C;  4B09 A;  3C2G A;  2EV6 A;  2DT6 A;  3W6J B;  4XLH A;  3JRA A;  1R5G A;  1MNM C;  1YJN I;  2E34 A;  2K40 A;  2OJE D;  2IGN A;  2ELH A;  3BJA A;  3BG7 A;  1B1B A;  2DFH A;  4NC8 A;  2IBD A;  3VYR B;  2F4O B;  1T56 A;  1XDS A;  2R7R A;  5IP7 J;  1IZ1 A;  2XRO A;  4ZZL A;  3HZJ A;  1K61 A;  2H1L A;  2C6Y A;  2MA3 A;  2O8X A;  5ILU A;  4C2T A;  3QRF F;  2W84 A;  2R92 J;  4EJU A;  3L2U A;  2R7Z J;  3H5N A;  2HQR A;  1MJ9 A;  2XAS A;  4RGU A;  5LHG A;  1ZG1 A;  4U7D A;  3WE2 A;  2HQN A;  2XPV A;  4G7Z F;  3B73 A;  5AIP A;  1ON1 A;  1QVU A;  2HU9 A;  1XCB A;  2VE9 A;  5GTI C;  3HUG A;  3WGH A;  4EJO A;  1X1B A;  3SFZ A;  2VKE A;  5HOD A;  1P9Q C;  2M0C A;  3BR5 A;  1VQN I;  1MMN A;  3KP2 A;  1U8R A;  2YR2 A;  1ZR2 A;  4B1R A;  1HXD A;  2ZNZ A;  3KPH A;  3ZOB A;  2XKP A;  2QBY B;  1X3U A;  3CLQ A;  4LIV A;  3TP3 A;  1WJA A;  2XAG A;  2F4M B;  2M9H A;  1VQK I;  4F52 A;  2OPT A;  2VBX A;  2XDV A;  3HHH A;  2EFN A;  1HDD C;  2W7N A;  3KP6 A;  1DGR M;  1L3L A;  2DW4 A;  5E1W A;  3QYB A;  3GTP J;  2PBI A;  1BBY A;  2DCE A;  1VF9 A;  4XKB A;  1SD6 A;  2JJ7 A;  2JPC A;  2JA6 J;  4XLA A;  3ZGK A;  4UVA A;  3M1C A;  4Q47 A;  5GAE J;  4KMF A;  2H6C A;  1Z3X A;  2CO5 A;  1KU2 A;  3HG9 A;  3OYK A;  4JX4 A;  4YRV A;  2JTV A;  3BPX A;  5AIQ A;  1D3Y A;  4S0H B;  2AS5 F;  2XHK A;  1UAA A;  1HQC A;  3CJR B;  3CUQ B;  3HDD A;  1IUF A;  3N05 A;  2R5Z B;  1IN6 A;  3OYL A;  4M73 A;  5JLX A;  2ME0 A;  3SQN A;  4I09 A;  1P7I A;  3W3C A;  1VQL I;  4ZC3 A;  3ECH A;  2CS3 A;  2DI3 A;  3JRI A;  3CUO A;  3Q3S A;  3UNG C;  3LSM A;  4LLN A;  2DTZ A;  4I0A A;  3DCF A;  1X1P A;  3QAH A;  2JN6 A;  3K4J A;  5M5X J;  2OQG A;  2UWM A;  1IXR C;  2EQR A;  2QQ8 A;  2XIG A;  2L9R A;  2MH9 A;  3J80 Z;  2WY7 Q;  1B8I A;  2WV1 A;  1TWF J;  2MAB A;  4KIS A;  1G4D A;  4PUS A;  5DCM A;  1U78 A;  1RUO A;  1QZZ A;  3CTA A;  2KJB A;  1NTC A;  1ENH A;  5CQG A;  2OF7 A;  4PGG A;  4ENN A;  3R0J A;  4OMY A;  2E60 A;  2ME6 A;  3FKI J;  1POG A;  3NRV A;  4FQG A;  2BHZ A;  2A6E F;  1FP2 A;  1OCP A;  5ICF A;  4IHV A;  4RDU A;  1OKR A;  1MSF C;  4UNO A;  1JI8 A;  2MSY A;  3RKW A;  4E4H A;  4FX4 A;  1FLI A;  1Z67 A;  1K4T A;  5KVR A;  4EQQ A;  3DPU A;  3MCZ A;  3S3O A;  3ZP5 A;  1YRN B;  2ZB9 A;  3SEQ A;  1VFC A;  1H9G A;  3DU6 A;  3M3Y J;  2JVH A;  4LB5 A;  2VKD A;  1HSJ A;  4G8X A;  4YIR X;  2V9K A;  5FFZ A;  3ZMT A;  1QA6 A;  3BQZ A;  4L0Z B;  2L01 A;  1ETY A;  1PJR A;  1ODD A;  2M4K A;  1ZG3 A;  4CDG A;  1V55 H;  1TWH J;  1O7F A;  3QOP A;  4D5F A;  3F22 A;  5GPC A;  2RQP A;  1K6Y A;  2PX9 A;  4MFE A;  4MLO A;  1BJZ A;  2FD5 A;  5DUK A;  1R71 A;  1J59 A;  2HR3 A;  5FRN A;  1ZLK A;  5EZG A;  5LGN A;  1LJ9 A;  4MQV A;  3CJN A;  3BR1 A;  4ZYE A;  5C44 J;  1FSE A;  2Z16 A;  4PJJ A;  2PN6 A;  2QEX I;  1CGP A;  1A31 A;  3HRT A;  1RUN A;  5M5W J;  3C18 A;  4B3X A;  2CQ7 A;  3MQ0 A;  1AKH B;  3TW6 A;  5D5U B;  1J75 A;  1R00 A;  3M1E A;  3VOE A;  2L3D A;  2YS9 A;  3Q9V A;  4A0Z A;  4WX9 A;  2PJR B;  3NAR A;  2Q2E B;  1YW9 A;  3F21 A;  4XRS A;  2EWN A;  4II3 A;  4Y15 A;  4ZTJ A;  3HPG A;  1WPK A;  2O3F A;  4LLG F;  3DTE A;  3KYD B;  5KNL A;  5GTH C;  4EJT A;  3DBR B;  2H6B A;  2K9S A;  2G0E A;  2ZXW H;  4MEX F;  1X4O A;  4CCN A;  1BIA A;  1GV2 A;  2B0L A;  2NVX J;  1YIT I;  1R5I D;  3BZC A;  1GHC A;  1YJ9 I;  4ZTF A;  1DGW Y;  3MKY B;  1GLN A;  3QPL A;  4NNJ A;  4XRM A;  2P6S A;  5B1A H;  2OCE A;  4MTE A;  2KT0 A;  1YHQ I;  1JHH A;  2FRH A;  2MG4 A;  3LA7 A;  4FET A;  4PJM A;  2RC4 A;  4G6Q A;  2UV1 A;  1STZ A;  3A02 A;  1T0F C;  4E6K G;  5HNF A;  3KEY A;  1REP C;  2IGO A;  3ESW B;  1BOA A;  3KE2 A;  5ICC A;  3ABU A;  3F0C A;  1W7P B;  2YX4 A;  2NOJ B;  2BY3 A;  4I2O A;  5HS8 A; 
#chains in the Genus database with same CATH homology
 3FX3 A;  2VT2 A;  3WTU C;  3VOD A;  4LG0 B;  5HS7 A;  4HQE A;  2FOK A;  1BI2 A;  4IRH A;  1O3S A;  2K02 A;  2QBY A;  2BYV E;  1JE8 A;  3M8F A;  2HTJ A;  3GFL A;  1J7K A;  3HRS A;  1BIB A;  4OIP F;  1XSV A;  1SMT A;  5D6E A;  3FHZ A;  5DDG A;  1HKT A;  4MQ9 F;  3LWF A;  1LB2 A;  2PMH A;  5BS6 A;  2FNA A;  4HBL A;  2MH2 A;  1DP7 P;  2OAZ A;  1YLF A;  2EK5 A;  1IXS B;  5E1X A;  3CUQ A;  3RYR A;  1HST A;  1R5H A;  3LA2 A;  2YSR A;  1QNT A;  1Z1D A;  4GGG A;  4RGS A;  2O0Y A;  2P7C B;  3P9K A;  3RTR A;  1HW5 A;  1P4X A;  5FD6 A;  5D5V B;  2QLZ A;  1T6S A;  1ZGJ A;  2H27 A;  2Z33 A;  3L09 A;  1TNS A;  4XSZ F;  4DQ2 A;  1S8N A;  1WWX A;  4L0Y B;  4ZZD A;  2P4W A;  1JHF A;  4GYG A;  3RJP A;  3SZP A;  2ACJ A;  3LAJ A;  2BBY A;  3J7A O;  5DV5 A;  2L4A A;  2WWY A;  1QO0 D;  3IC7 A;  2IVM A;  1R7J A;  1SFU A;  4H0E A;  3NQO A;  3ZMV A;  3SHF A;  1TQI A;  3BP8 A;  1LDD A;  4KMU X;  4CZZ A;  5ERI A;  3WE3 A;  4YFX F;  3C7J A;  2IT0 A;  2HOE A;  3ZMU A;  1I5Z A;  3KEQ A;  1IF1 A;  1I1G A;  1YIO A;  2Q2E A;  3WU1 B;  2KIM A;  2D1H A;  2OZ6 A;  3BWG A;  4OIN F;  3DP7 A;  4L5J A;  1OPC A;  3KP5 A;  2STW A;  2DLL A;  1LDJ A;  5E20 A;  4HAM A;  4I0B A;  4Q4Z F;  1K79 A;  2DQL A;  5IT9 K;  1RI7 A;  5A2Q K;  1XMK A;  2VBY A;  4RAY A;  1D8K A;  3L2C A;  3WTT C;  2IRF G;  2PJP A;  2ZJ2 A;  2COM A;  5D6F A;  1W4M A;  3SZT A;  4AIJ A;  3OV8 A;  4XSX F;  2PFB A;  3KZY A;  2TDX A;  1XB4 A;  2HYF A;  2VBW A;  3DEU A;  1G6N A;  2UZK A;  1GXP A;  4KFC A;  2F2E A;  1EH6 A;  4BHP A;  5D8L B;  2EJR A;  3DV8 A;  3V7C A;  2FXA A;  4O5V A;  4M72 A;  4EJV A;  2O61 A;  4M9Z A;  3VFZ A;  4EM1 A;  2JRT A;  1S6L A;  5CVI A;  5BOX A;  2V6C A;  4RB1 A;  5DUI A;  4M6Y A;  1Z6T A;  3GLX A;  1ZLJ A;  3MAJ A;  5BMZ A;  1AWC A;  4L18 B;  3C1D A;  4G7O F;  5L3D A;  2FBK A;  1FOK A;  3FMR A;  4YG2 F;  4BXU A;  1TBX A;  1ZN2 A;  2L4M A;  4R8H A;  1B59 A;  2G7U A;  1D8J A;  3IWF A;  3T1B A;  3KLN A;  2PG4 A;  1OYI A;  3R0A A;  2ZME B;  3PQJ A;  1BC7 C;  5DCM B;  1E17 A;  2M30 A;  4YFK F;  3E5X A;  1UFM A;  3O6B B;  5E1Z B;  1SD5 A;  3Q5F A;  2ETH A;  4AIH A;  2VXZ A;  4RB0 A;  1YYV A;  4ON0 A;  2XUB A;  4CO8 A;  1IW7 F;  2IA1 A;  5H6Q A;  3E6B A;  3J81 Z;  4G6D A;  1XDU A;  3JTH A;  3N4M A;  2RDP A;  3O2P E;  4G7H F;  4Q5S F;  1MKM A;  5CVR A;  1BN5 A;  2NRA C;  3SXY A;  1TW2 A;  5HOO A;  3TOA A;  3ECO A;  1Z6R A;  1KU3 A;  4ZYG A;  3RKX A;  2HDC A;  3M8E A;  5HLH A;  4HA8 A;  1ZAO A;  5BPI A;  4ASN A;  4ENK A;  3FM3 A;  2STT A;  1U5T C;  1F9N A;  3IKV A;  2A3S A;  2KKO A;  3FMS A;  4KNY A;  4AIK A;  4M9X A;  1YW8 A;  2YU3 A;  4ESJ A;  4HYE A;  1MGT A;  2DK8 A;  5FLX Z;  1LEA A;  4MHG A;  3S2W A;  3L00 A;  4HV5 A;  1I27 A;  4A0X A;  3V4G A;  3T0Y A;  2FNP A;  1MDM A;  4BH9 A;  3DQV C;  2DU9 A;  1O3Q A;  3F23 A;  3QPT A;  4MTD A;  2DFI A;  1T2K A;  2PMU A;  3J80 K;  4QWQ A;  1T0F A;  2MLK A;  4L9N A;  4M71 A;  2G7H A;  4UV9 A;  3BRO A;  4N0B A;  2P6T A;  4S05 A;  1K78 A;  3MWM A;  1F5T A;  4HQM A;  1G3Y A;  3L9F A;  5FGM A;  4UXN A;  5D5W B;  5HDG A;  1LEB A;  1QGP A;  2QQA A;  4U0V A;  1G3W A;  2HFH A;  2RKH A;  3I0T A;  2EV5 A;  1ZYR F;  1WSU A;  2HGC A;  1O7L A;  2XV4 S;  3JSO A;  2VT3 A;  1BJA A;  4PCQ A;  1R58 A;  4KN7 X;  1IN7 A;  3COA C;  3FF5 A;  4EGZ A;  3KZZ A;  4IRI A;  3E5U A;  2HWV A;  2DT5 A;  1BI0 A;  2FBH A;  3T5X A;  4MEY F;  4OMZ A;  4E70 A;  2ZME A;  1H0M A;  3F8M A;  5HDN A;  3PFI A;  3IL2 A;  3PQK A;  1FY7 A;  1ONV A;  3K9T A;  2CFX A;  4YII A;  5HLG A;  1OYY A;  3VB2 A;  4WWC A;  1A04 A;  1ZHF A;  5K1Y A;  1T98 A;  1P4A A;  1OYW A;  1F1Z A;  1BM9 A;  1B6A A;  3QU3 A;  1W7P D;  2FF4 A;  1KGS A;  3R60 A;  1B9N A;  4XRF A;  2PEX A;  4P55 A;  2E7W A;  4I01 A;  2GA2 A;  3N97 A;  3P9I A;  4YFN F;  2DBB A;  3MZY A;  3WTS C;  3WTV C;  3IHU A;  2XAJ A;  4MGR A;  4KUM A;  3ZMD A;  5D5X B;  4ETS A;  1C0W A;  5LRR A;  4CXF A;  2MD5 A;  1FP1 D;  3DF8 A;  2Z3Y A;  5HS9 A;  1G3T A;  2EFW A;  4AWX B;  2D2W A;  3WOD F;  1CF7 A;  5CYV A;  5LRS A;  2EFP A;  2JSC A;  5DD4 A;  5BQT A;  2QQB A;  1Z05 A;  3P9C A;  2RVC A;  2H94 A;  4N9H A;  2FSW A;  3GFI A;  3RPU A;  3IRQ A;  3IKT A;  1HW2 A;  2OA4 A;  2RV8 A;  4EVI A;  2MLG A;  5H6R A;  1O3R A;  4Q48 A;  3E6D A;  3GW2 A;  1BC8 C;  4ZYD A;  4BAY A;  2JZY A;  1Q1H A;  4RB3 C;  1DUX C;  1AOY A;  4P9U A;  4KIG A;  1Z9C A;  4L9T A;  4OIQ F;  2GAU A;  3V8J A;  2OBP A;  3D5L A;  2D1V A;  4JBA A;  4HW0 A;  3H3Z A;  4KIC A;  5TJJ A;  5E8G A;  3O3K A;  1UCR A;  1FYK A;  3R6S A;  1FYL A;  3TKY A;  2A61 A;  3D0S A;  3E6C C;  4EV0 A;  2WC2 A;  1LVA A;  2QM3 A;  4L9V A;  1OMI A;  4IHS A;  4U0W A;  3M9A A;  1QPM A;  4I02 A;  1IN4 A;  4A5M A;  1QQI A;  1V3F A;  2IW5 A;  3K1N A;  2J5O A;  3DKW A;  4WCG A;  2RNJ A;  3JW4 A;  4A6E A;  1W5S A;  3ML6 A;  2Y75 A;  5DYM A;  1IUY A;  3CO6 C;  3JTG A;  4IVN A;  4LMY A;  1USS A;  5FB2 A;  1DPU A;  1Y0U A;  3GZ5 A;  2Q0O A;  4NQW A;  3I71 A;  4GXO A;  1YFH A;  1XD7 A;  2JT1 A;  2XKO A;  2M87 A;  2P5V A;  5DCF A;  3WTW C;  6PAX A;  4L9J A;  5CVV A;  1EH7 A;  3KP3 A;  1HKQ A;  3ABT A;  4FX0 A;  4ENJ A;  1PDN C;  4RS8 A;  3F6V A;  2L54 A;  2VOO A;  1Z91 A;  5CVJ A;  3I59 B;  5FO5 A;  3IRR A;  1QBJ A;  2LSO A;  4XLN F;  3HTU A;  1FBQ A;  1KQ9 A;  4UV8 A;  3K1P A;  2R3S A;  2VOP A;  1WRJ A;  4EMS A;  1GXQ A;  5IT3 A;  4Y17 A;  3GZ6 A;  4L5I A;  1KQ8 A;  3KFW X;  2ZO4 A;  2IA0 A;  5JI6 A;  1R36 A;  4WF2 A;  4HX4 A;  1U5T A;  4R79 A;  4XBF A;  2ISY A;  1XSX A;  3E5Q A;  1XGS A;  3BZ6 A;  3JAM Z;  2HTS A;  1GVJ A;  3K0L A;  2K27 A;  1MDM B;  1J5Y A;  5K5O A;  2DK5 A;  2KJC A;  1R22 A;  2ESN A;  2CSO A;  2PI0 A;  2VON A;  3REO A;  3BY6 A;  4P96 A;  1KA8 A;  3LQQ A;  1TTY A;  2GWR A;  3KET A;  3ULQ B;  1K78 B;  1ZRF A;  3HRM A;  1L0O C;  1PP8 F;  4HDV A;  2Z5U A;  2MBF A;  3R4K A;  5ICE A;  5L3C A;  4BYY A;  4M6X A;  3J81 K;  1UHM A;  4M74 A;  5L3F A;  2PLY A;  2VC0 A;  5E17 F;  3GF2 A;  3FXU A;  1ZAR A;  3K69 A;  3VEP A;  2H09 A;  2GQQ A;  3I4P A;  4HF2 A;  1YQA A;  2K7L A;  4QLC U;  3FXR A;  4I7H A;  3F72 A;  2ISZ A;  3DPT A;  1R1V A;  2VOD A;  5FFX A;  3V8K A;  3NEU A;  3K1M A;  3WGI A;  4OIO F;  2W57 A;  3TO6 A;  1O3T A;  2GZW A;  1P2F A;  5L3E A;  2IJL A;  5BPD A;  4CGZ A;  2XAH A;  5HLI A;  2NYX A;  2LF7 A;  3FM5 A;  1SD4 A;  3FWE A;  3QPH A;  3I58 A;  2Y48 A;  3U9G A;  3GUD A;  1ON2 A;  5JVT A;  1R1U A;  3U2R A;  2A68 F;  4P9F A;  3E3V A;  3ZQ7 A;  3GFJ A;  3EET A;  3I64 A;  4LB6 B;  1K7A A;  1U3E M;  1JGS A;  4WXD A;  2M8E A;  2ZKZ A;  2ESH A;  4KT5 C;  1FPQ A;  5JFR A;  4WXC A;  2CW0 F;  4IPA A;  3QP5 A;  4EJW A;  1ZRD A;  4KDP A;  2FQ3 A;  3TGN A;  3KLO A;  4AD9 A;  3TDU C;  1YW7 A;  4U7B A;  3BJO A;  4OU0 A;  2W85 A;  2WTE A;  3FMQ A;  3I59 A;  5K5Q A;  3LA3 A;  2ZBK A;  1SAX A;  3B02 A;  2K86 A;  3EYY A;  4GYI A;  5D4S A;  1HW1 A;  3JSP A;  4DNC A;  2LDU A;  5FD5 A;  1LDK B;  3ZMZ A;  4XLP F;  2EFQ A;  4NHJ A;  3OOP A;  1K6O A;  2J5P A;  2EA4 A;  5D8K B;  2CQK A;  2P8T A;  5ICG A;  3RPQ A;  2GXB A;  3TOB A;  1CF7 B;  5E8I A;  2DAO A;  3ERE D;  3GVA A;  3BDD A;  2A07 F;  1W5T A;  4CHU A;  2P5L C;  1ZRE A;  2P7V B;  5J6X A;  5F1R A;  3GEZ A;  1J0R A;  2IPQ X;  1IN5 A;  1FBS A;  3LQR A;  3TQN A;  4N9I A;  3M7G A;  1XGM A;  1JXS A;  2E1C A;  5DEQ A;  5CLS A;  3GO5 A;  4EGY A;  3ZN1 A;  1IN8 A;  2DO7 A;  2EB7 A;  2FMY A;  2JPB A;  1DPR A;  5LEK A;  3QP6 A;  2Y0M A;  1IAW A;  1J9I A;  1S7A A;  4ESF A;  2NAZ A;  4P5O A;  2XVC A;  1LNW A;  2UXX A;  3TO9 A;  3KP7 A;  3QU6 A;  2R7F A;  3DPL C;  3HTS B;  2O6G E;  3T8R A;  3HRU A;  1MZB A;  1U6G A;  5LHH A;  3I54 A;  1SD7 A;  4UVC A;  1ZGA A;  2X4H A;  3AAF A;  1FX7 A;  2FEZ A;  1KYZ A;  3V7R A;  3C3W A;  3LAP A;  3I53 A;  4A2U A;  2DPU A;  3RYP A;  3WTY C;  3FXQ A;  3BJ6 A;  3H3U A;  2V1D A;  3H92 A;  3CO7 C;  1H9T A;  1FNN A;  2W24 A;  2E7X A;  3TDZ C;  1SFE A;  2CG4 A;  4K2E A;  3HSF A;  2OQR A;  1EH8 A;  3ZMS A;  1YS6 A;  4R1H A;  5DD8 A;  4S04 A;  2QZ8 A;  2IP2 A;  5EEG A;  1I6X A;  4HF1 A;  1WQ2 A;  2EV0 A;  3RIR A;  1FSH A;  4Y13 A;  4Z2Y A;  3GWZ A;  2KIF A;  4RAZ A;  3KP4 A;  1ZH5 A;  2CWE A;  2DPD A;  5L3B A;  4LFU A;  4A0Y A;  1ULY A;  2F5D A;  3ROU A;  2FU4 A;  4I98 B;  1IRG A;  4U0Y A;  2EA2 A;  1R23 A;  4G9Y A;  4LLL A;  1WKM A;  1MJB A;  1U2W A;  4IRG A;  1P4W A;  3WGG A;  2ZNY A;  2ZCW A;  3F6O A;  1MD0 A;  3I5U A;  1MJA A;  1RIO H;  4KN4 X;  1FC3 A;  3DXJ F;  1U5T B;  3TO7 A;  2O03 A;  5LGT A;  4HV6 A;  1TQM A;  3LFK A;  1ZG5 A;  2VC1 A;  1KQ0 A;  2V9V A;  3P7N A;  1FT9 A;  4F7Z A;  3RI4 A;  4ESB A;  3EDP A;  2ZXJ A;  3Q9S A;  4HZF A;  4A6D A;  5LGU A;  1HBX G;  4OOI A;  5KK1 A;  1FYM A;  3E97 A;  4OIR F;  1Z7U A;  3GYH X;  2Z99 A;  3W6K B;  3HOT A;  1RZ4 A;  4D0P A;  2KIU A;  4PGH A;  3DFG A;  2CYY A;  5LHI A;  5AON A;  4WXH A;  3V7S A;  4KIF A;  1B4A A;  1P6R A;  3HOS A;  2AXL A;  4FT8 A;  2VE8 A;  4MNU A;  1FBU A;  3CDH A;  4PZJ A;  3KCC A;  3EYI A;  3ISP A;  4LGW A;  2MC3 A;  1OR7 A;  1O57 A;  5ILS A;  4O3M A;  2YPR A;  4O6J A;  4KA4 A;  2D45 A;  4JK1 X;  3F8C A;  1BI3 A;  3V8L A;  2V1U A;  3HHG A;  2FE3 A;  2XAQ A;  1G3S A;  3RDI A;  1YG2 A;  3MZH A;  2RN7 A;  2CGP A;  2A69 F;  2XRN A;  5LBQ A;  1BI1 A;  4RGX A;  2QWW A;  1S29 A;  2X0L A;  5ILV A;  2HZT A;  2IA2 A;  3EQL F;  2V1X A;  2DTR A;  5L3G A;  1WI9 A;  3E6M A;  2M1B A;  4AVP A;  2NNY A;  1SFX A;  2LNB A;  4HX7 A;  5J8F A;  3GXO A;  3JAM K;  2M45 A;  1XN7 A;  4A12 A;  3F8B A;  2A5Y B;  5H20 A;  2Q8K A;  2K4B A;  1VTN C;  2WV0 A;  4UUV A;  2L02 A;  2FBI A;  1FWZ A;  3U1D A;  1XGN A;  5HDK A;  3K2Z A;  1UST A;  2YX7 A;  4UVB A;  3T8T A;  3G73 A;  3ZN0 A;  4HDU A;  2QEN A;  2P5K A;  5ED4 A;  2BGC A;  2HYG D;  3ELK A;  2QQ9 A;  3LST A;  3RKY A;  5JHU A;  2GIV A;  3L7W A;  4HF0 A;  4ENM A;  2W25 A;  2QUF A;  5LLQ A;  1D5V A;  4UHT A;  2NNN A;  3CLO A;  3WTZ A;  5D4R A;  1DDN A;  3F8F A;  2KRF A;  1XMA A;  4PDK A;  2DQR A;  3GX4 X;  2XAF A;  4EM2 A;  5JR3 A;  1PUE E;  1TLH B;  3BPV A;  2Z9O A;  4BNC A;  1XGO A;  2OZU A;  3ZPL A;  4IJA A;  2F5F A;  2OU2 A;  3MFK A;  2A6H F;  2FML A;  3HIF A;  1P92 A;  2R7D A;  2ZFW A;  1UHW A;  4RGR A;  2FA5 A;  1T39 A;  2BV6 A;  2XGX A;  4FHT A;  2HS5 A;  5CJ9 A;  1TQP A;  2HEO A;  2LKP A;  1YTY A;  1I1S A;  2UXN A;  1E2X A;  3FZV A;  1ZRC A;  2NS0 A;  4M9S A;  1NHA A;  2HKX A;  1W7P A;  3BOQ A;  2VBZ A;  2F5C A;  2F5E A;  4KYW A;  1UB9 A;  5E18 F;  4NB5 A;  4LG0 A;  2LF8 A;  5TRD A;  1KU9 A;  1QZY A;  4BQA A;  1IRF A;  5HVQ C;  5F6F A;  2QVO A;  4A5N A;  4IXA A;  3MEX A;  1YO5 C;  3KEO A;  2RGV A;  3CUQ C;  5IT9 Z;  1PP7 U;  4YIF A;  4IHT A;  3WTX C;  5A2Q Z;  2E1N A;  4HLX A;  2M5W A;  1EV7 A;  4CYD A;  5K5R A;  1LQ1 A;  4EM0 B;  2BEO A;  4HX8 A;  3WG9 A;  2ADU A;  2VN2 A;  4BHB A;  4LK0 F;  5FLX K;  5LEJ A;  4ZH4 F;  4LJZ F;  3EUH A;  3IWZ A;  1XCV A;  3HSR A;  3HYI A;  1TW3 A;  5CVU A;  1S3J A;  1IXC A;  2PQ8 A;  5F64 A;  2GA1 A;  1SMY F;  4TV7 A;  4GO1 A;  2V79 A;  1TNT A;  1T38 A;  5EEH A;  4LD5 A;  1KU7 A;  4KIB A;  1FZP B;  1F4K A;  3F3X A;  3G3Z A;  4RB2 C;  1S7O A;  1V4R A;  2EFO A;  2HKO A;  2OD5 A;  1YS7 A;  1HKS A;  2QYO A;  4LK1 F;  2K4J A;  3GFM A;  3F8N A;  4JQF A;  2BE5 F;  1RNL A;  5J8C A;  4WK8 F;  4U88 A;  4GCV A;  3WU0 A;  4HLY A;  1XSD A;  3R61 A;  4G94 A;  1R1T A;  4BHC A;  4HOB A;  2GXG A;  1KYW A;  1J2X A;  4ZYH A;  4B8X A;  4CIC A;  3HSE A;  4IF4 A;  1B9M A;  2G9W A;  4B09 A;  2EV6 A;  3W6J B;  1R5G A;  2ELH A;  3BJA A;  1B1B A;  1XDS A;  1IZ1 A;  2XRO A;  4ZZL A;  2C6Y A;  2MA3 A;  2O8X A;  5ILU A;  3QRF F;  2W84 A;  4EJU A;  2HQR A;  1MJ9 A;  2XAS A;  4RGU A;  5LHG A;  1ZG1 A;  4U7D A;  3WE2 A;  2HQN A;  4G7Z F;  3B73 A;  5AIP A;  1ON1 A;  1XCB A;  2VE9 A;  3HUG A;  3WGH A;  4EJO A;  3SFZ A;  3KP2 A;  1U8R A;  2YR2 A;  1HXD A;  2ZNZ A;  2XKP A;  2QBY B;  1X3U A;  2XAG A;  2VBX A;  3HHH A;  2EFN A;  3KP6 A;  1L3L A;  2DW4 A;  5E1W A;  2PBI A;  1BBY A;  1SD6 A;  2JPC A;  4UVA A;  4Q47 A;  4KMF A;  2H6C A;  2CO5 A;  1KU2 A;  2JTV A;  3BPX A;  5AIQ A;  1D3Y A;  2AS5 F;  2XHK A;  1HQC A;  3CUQ B;  1IN6 A;  4M73 A;  3SQN A;  4I09 A;  3ECH A;  2DI3 A;  3CUO A;  4LLN A;  4I0A A;  3QAH A;  2OQG A;  2UWM A;  1IXR C;  2XIG A;  3J80 Z;  2MH9 A;  1G4D A;  5DCM A;  1U78 A;  1RUO A;  1QZZ A;  3CTA A;  2KJB A;  4PGG A;  4ENN A;  3R0J A;  4OMY A;  3NRV A;  2A6E F;  1FP2 A;  5ICF A;  1OKR A;  4UNO A;  3RKW A;  4FX4 A;  1FLI A;  5KVR A;  4EQQ A;  3MCZ A;  3ZP5 A;  1H9G A;  4LB5 A;  1HSJ A;  4G8X A;  5FFZ A;  3ZMT A;  4L0Z B;  2L01 A;  1ODD A;  1ZG3 A;  4CDG A;  1O7F A;  3QOP A;  3F22 A;  2RQP A;  1J59 A;  5DUK A;  2HR3 A;  1ZLK A;  5LGN A;  1LJ9 A;  4MQV A;  3CJN A;  4ZYE A;  1FSE A;  2PN6 A;  1CGP A;  3HRT A;  1RUN A;  3C18 A;  3MQ0 A;  1J75 A;  5D5U B;  1R00 A;  3M1E A;  3VOE A;  2L3D A;  4WX9 A;  4A0Z A;  3Q9V A;  1YW9 A;  3F21 A;  2EWN A;  4Y15 A;  2O3F A;  4LLG F;  4EJT A;  2H6B A;  4MEX F;  1BIA A;  2B0L A;  1GHC A;  2P6S A;  4MTE A;  1JHH A;  2FRH A;  3LA7 A;  2RC4 A;  4G6Q A;  1STZ A;  1REP C;  1BOA A;  3KE2 A;  5ICC A;  3ABU A;  1W7P B;  2YX4 A;  4I2O A;  5HS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...