4KIBA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 113
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kibA01
1O57A 3FWEA 3J81K 3KZZA 4EJOA 2CGPA 2Z9OA 3BOQA 5BS6A 3TGNA 3QPHA 3O3KA 4U0YA 3VOEA 3ECOA 4XLPF 4HF1A 5ICEA 3JTHA 1RI7A 4YFNF 2A3SA 5A2QZ 2VONA 3LA3A 4HW0A 4P9UA 2D1VA 4XRFA 1JE8A 5ERIA 1QQIA 2E7WA 3RTRA 3VEPA 3ZMUA 3CUQC 3JAMK 4ASNA 1ZRDA 2JPCA 4I0BA 3S2WA 5DUKA 4O5VA 4RGXA 4ESJA 1T98A 3CTAA 5E17F 3QAHA 1ULYA 1BIAA 4BHCA 3QU3A 2MLKA 4P9FA 1FX7A 2HR3A 1SFEA 5D6FA 2H09A 1DUXC 3KLNA 4WF2A 3WTXC 3QP6A 1MZBA 2VBZA 1SMTA 1B9NA 1RZ4A 1B9MA 2HOEA 3ZMVA 1HXDA 1O3QA 4O3MA 4IPAA 5CVRA 5E8GA 4EVIA 4GXOA 4KFCA 3WTWC 5HLIA 3BROA 2FNPA 2ZKZA 2JSCA 3ZMDA 4A5NA 3DPLC 2OZ6A 2H94A 2ETHA 4HF0A 3EQLF 3F72A 2OAZA 4LGWA 2DFIA 2MD5A 2OU2A 1Z7UA 5JVTA 4S04A 4MNUA 4IRGA 1Z9CA 1SFXA 5LHHA 4G6QA 3TOAA 4JK1X 1MDMA 3R6SA 3F8BA 3V8KA 3LAJA 2QQAA 3I64A 3F22A 3FM3A 4BYYA 4EM0B 1T39A 1I1GA 5BOXA 2D1HA 2COMA 3E6MA 1K78B 1ZLKA 3HHHA 2K7LA 1YLFA 4LFUA 3ZP5A 1DPUA 5D5WB 3JW4A 1WKMA 2NAZA 1ZYRF 1FSEA 1V4RA 1D5VA 2R3SA 2H6CA 2F2EA 1S7OA 4LB6B 1XB4A 3I0TA 5LRRA 2XHKA 5HLHA 2A69F 4PCQA 3ULQB 1JXSA 4M72A 3RKYA 5L3GA 4Q48A 1HW1A 2EK5A 1IRFA 3SZTA 3TDZC 1GVJA 3IWZA 5L3BA 2IT0A 2QYOA 2GXGA 3QU6A 1Z6RA 3P7NA 3GX4X 1STZA 4RAYA 2JT1A 2EFPA 3TO9A 4CGZA 3DF8A 2CO5A 1KYWA 3P9CA 2MBFA 5HDNA 3W6KB 2XRNA 2DO7A 1LB2A 1LDJA 1ZHFA 3KEOA 4M6YA 3TKYA 3F8CA 3MEXA 3KFWX 5BPIA 2DPDA 4L9VA 4A6EA 1G3TA 2OZUA 3OOPA 3G3ZA 4H0EA 1A04A 2MH2A 1Q1HA 3J81Z 2Q0OA 2D2WA 2V79A 2EFWA 4GYIA 1R00A 4IHTA 1D8JA 4N9HA 5L3FA 4HLYA 3I54A 3RI4A 2KIMA 5ILVA 3LA2A 3SHFA 1HQCA 1SD7A 3E6BA 1OPCA 2M8EA 1U8RA 1JHHA 3E5UA 1ZRFA 1FT9A 1CF7A 3I71A 2PFBA 1LQ1A 2IPQX 2K27A 5DD8A 3VODA 3CLOA 2FSWA 3B73A 1HSTA 1AWCA 2G7UA 2F5DA 1T6SA 4HV6A 2EFNA 2ZJ2A 1BOAA 1SAXA 3HSEA 3WTVC 3F23A 4M9SA 4IJAA 3K2ZA 5ILSA 4OINF 2RNJA 3T8TA 1PP8F 2VN2A 4KDPA 2V6CA 4EMSA 5TRDA 3H92A 1HKQA 3BWGA 4MGRA 2XGXA 3U1DA 2DK8A 1ON2A 2HDCA 3HOSA 3TO6A 1LDKB 4IHSA 2CG4A 2DQRA 1FZPB 2ADUA 2C6YA 4RGSA 4JBAA 1KU9A 4A6DA 2EV5A 4PDKA 3GF2A 2P4WA 5KK1A 3SXYA 2R7FA 4M9XA 2QZ8A 4KMUX 5F6FA 2TDXA 1USSA 2ZMEB 1YS7A 5HLGA 1KQ8A 3V4GA 1XGOA 3ELKA 1EH8A 2Z3YA 2GAUA 4OIQF 2Y48A 3V8JA 3WE2A 3MCZA 4M73A 2O61A 3JSOA 2A07F 1LJ9A 4KIBA 1ZRCA 3RIRA 3HRTA 4OIPF 1SD4A 1FYMA 1FBSA 2OA4A 3HUGA 2IA2A 5AIQA 3MQ0A 4HX8A 2KIFA 3BZ6A 1GHCA 4M6XA 4XSZF 1H9TA 4FT8A 2PBIA 3LFKA 3WGGA 5E1WA 1BI2A 1O7FA 3ZQ7A 3BY6A 1H0MA 2XVCA 4HX4A 3GZ5A 1XCBA 2A68F 1YIOA 2RQPA 2Y75A 4L0YB 1R5GA 3IRRA 1P4WA 2EWNA 2LSOA 3LA7A 2DI3A 1BC7C 4BHPA 1U6GA 5D4RA 4KN4X 2VXZA 1R23A 4RAZA 2PLYA 3I4PA 1R1TA 3BJAA 3T8RA 4M74A 4I7HA 4MQ9F 2GIVA 1T0FA 5E1XA 4K2EA 2ZO4A 1KQ9A 4NB5A 2GQQA 4UVBA 1YS6A 4ZYEA 3WTSC 3NEUA 4ON0A 1SMYF 2DBBA 3MZYA 2VOOA 4P55A 1XD7A 2PMHA 1FBQA 1S7AA 3HRMA 2P7CB 2QBYB 1P92A 3TDUC 1BBYA 3DP7A 2A6HF 1QNTA 4KT5C 3SFZA 5DV5A 4IRIA 1QO0D 2KJCA 2XUBA 4HAMA 4EGYA 3R60A 1ZGAA 2UWMA 2ZNZA 4EM2A 1Y0UA 2MC3A 4UUVA 5HS9A 4A5MA 2BE5F 3FM5A 4N0BA 2NRAC 5LHIA 2DT5A 3J80K 2YU3A 2XAQA 4PGHA 4Q4ZF 4KIGA 3CUQB 2R7DA 5JR3A 1R22A 4IVNA 4Z2YA 1PDNC 3F6VA 3MFKA 2H6BA 3EYIA 3GWZA 1ZGJA 2CSOA 2EA4A 3P9IA 1B6AA 1TW2A 5L3DA 5FGMA 3IRQA 4UV9A 5AIPA 2MH9A 2K4BA 4G8XA 3REOA 1F9NA 4WXCA 3WTZA 2GA2A 2XKOA 2L4AA 1OKRA 3ZPLA 3FMRA 2ISZA 3ECHA 3CO7C 1OYIA 1MGTA 3V7SA 1K78A 4ZZDA 1H9GA 4LB5A 2P5KA 4EJVA 5TJJA 3ZMZA 4ZYGA 3T0YA 1LDDA 4R1HA 3ZMSA 3ZMTA 5LLQA 5DD4A 5FB2A 3RJPA 5D5UB 4LLGF 1HSJA 2FBKA 2QBYA 3GLXA 1E17A 2FA5A 1MDMB 1VTNC 1I1SA 2FMLA 1I6XA 1P4AA 1W5SA 2FXAA 4WXDA 1W7PD 2HKXA 5H6RA 2UZKA 3M9AA 1Z6TA 4G6DA 3RYRA 1TNSA 3QOPA 3RKXA 1YFHA 3NQOA 1XMAA 2DK5A 2JZYA 1MJ9A 4UVAA 3AAFA 2UXXA 1IXCA 2MLGA 4XBFA 4B8XA 3KP2A 2NNYA 3JTGA 2HZTA 2XV4S 3TQNA 2HWVA 4PZJA 2FOKA 3I58A 3WTTC 2QQBA 4LG0A 2QENA 1SD5A 4CYDA 1FYKA 2HQRA 1CF7B 2PQ8A 5CYVA 3FXRA 4WK8F 1D8KA 4BNCA 4B09A 2BEOA 3KP6A 3O2PE 3ABTA 1KQ0A 3GYHX 3T1BA 3PQKA 4HDUA 2O03A 1MJAA 3E6CC 1IAWA 4R79A 4L9NA 4EJWA 4YIIA 1R1UA 1Z05A 1ZARA 4AIJA 3M8FA 3TO7A 3M1EA 3CJNA 1TW3A 3FZVA 1EV7A 4HLXA 4WX9A 2YR2A 5ICFA 2EV6A 3ZN0A 1EH6A 3GFMA 4KYWA 4UVCA 1J5YA 1K7AA 3HRSA 2HQNA 3SQNA 2RN7A 2F5EA 1I27A 2L4MA 3U2RA 4L18B 3I5UA 3BPVA 4ETSA 1QZYA 2IRFG 1O3TA 2IA0A 4KICA 3C7JA 3GXOA 2ZXJA 4BXUA 2XAHA 1ZH5A 5FFZA 1T38A 2CQKA 2LKPA 5E20A 5CVVA 2QWWA 3V7RA 2DU9A 2RVCA 1HKSA 3IKVA 2JPBA 3I59B 2A61A 2XKPA 5E8IA 2J5OA 1J7KA 2IJLA 1RUOA 4XLNF 5DCFA 3Q5FA 4KIFA 3GZ6A 4HV5A 1R36A 3KP7A 4U7DA 1MJBA 3LQQA 3KLOA 4CICA 1G3WA 1U78A 2IVMA 2BYVE 3WODF 2A5YB 1FP2A 2M30A 3WG9A 5LEJA 5FLXZ 4I2OA 5CVIA 5HS7A 3KE2A 2LF7A 2ZBKA 4L9JA 3WGIA 2RKHA 5CVUA 4AIHA 2GZWA 2NS0A 4ENKA 4HQEA 5FLXK 1KGSA 1YO5C 2Z99A 2HYFA 1ZG3A 3M8EA 4ZYHA 5HS8A 4IXAA 2O6GE 1Z91A 4I02A 5HDKA 2JRTA 4RB1A 2F5FA 3COAC 1BJAA 2J5PA 5FD5A 2FU4A 5KVRA 5FD6A 3ROUA 2V1DA 1FWZA 5DUIA 2M45A 4FX4A 3KP3A 4RB0A 1ZG5A 1BC8C 1FOKA 4WWCA 2CFXA 2Z33A 3U9GA 3K69A 2YSRA 2VODA 1B4AA 1L3LA 5HVQC 4HOBA 3HRUA 2IP2A 3G73A 4LD5A 4NHJA 1ONVA 2VBWA 4KA4A 1TBXA 2W57A 5H6QA 1WWXA 4CZZA 5ILUA 2AXLA 3LWFA 4LJZF 1J0RA 2P5LC 1P6RA 1ZLJA 4MQVA 5LGTA 2VC1A 4RGRA 4A0XA 2P6SA 1J9IA 3K0LA 3HSRA 4U0VA 2HKOA 2XASA 1O3SA 5DCMB 4CDGA 3KZYA 4G94A 5F64A 4ZH4F 2L54A 3KP5A 2M1BA 2FQ3A 3EETA 2DW4A 1L0OC 1U2WA 2FRHA 4BH9A 3I59A 1JHFA 3HYIA 4G7ZF 3L00A 3E97A 1FPQA 4LMYA 1IN8A 1HBXG 1XGSA 4I09A 1OYWA 2YX7A 4HF2A 3JSPA 2RGVA 4MTEA 1YQAA 3RYPA 3TOBA 3I53A 4ENJA 2X0LA 3Q9SA 3QP5A 1K6OA 2KIUA 4IRHA 3IKTA 5HDGA 2L3DA 4CHUA 2WC2A 1IXSB 2VC0A 3HHGA 1BN5A 3V8LA 3ZN1A 2DLLA 4JQFA 1IZ1A 2QLZA 3GEZA 1FY7A 1QGPA 3DQVC 3E3VA 3HIFA 2V1XA 5ICGA 4AIKA 1YW7A 1F1ZA 1I5ZA 3KETA 2PN6A 2ESHA 2VOPA 5BQTA 3CDHA 4L5JA 4GCVA 2O0YA 1F4KA 1S3JA 2HS5A 3CO6C 2QQ9A 3VFZA 2ZMEA 4I98B 2ISYA 2CWEA 3DV8A 4XSXF 3HSFA 4KUMA 4LG0B 4MEYF 4DNCA 5K5RA 1YW8A 2QVOA 4KNYA 3JAMZ 4M9ZA 3BPXA 1XN7A 1FLIA 5A2QK 1Z1DA 3R4KA 4ENMA 5CJ9A 2RV8A 2UXNA 3BDDA 1EH7A 1TNTA 1HW5A 4PGGA 1USTA 2GWRA 3D0SA 1E2XA 4NQWA 3CUQA 2OQGA 1UHMA 2VT3A 1G3SA 1QBJA 4S05A 4BQAA 3DKWA 4UXNA 1MKMA 1S6LA 3FHZA 1B59A 5DYMA 1WI9A 4Y13A 5IT9Z 1TQPA 3B02A 4LK1F 1QPMA 2CYYA 5K5OA 2AS5F 4YFXF 1KU7A 2H27A 5DCMA 3K1PA 1TQIA 4GGGA 3E5QA 4N9IA 2VE9A 2HFHA 3OV8A 2EB7A 2V1UA 1OR7A 3ISPA 1BI0A 2ELHA 1RUNA 4CO8A 1OYYA 1C0WA 4G7HF 3KCCA 1ZAOA 3EDPA 2WV0A 4OU0A 1WSUA 1GXQA 1CGPA 2P5VA 4I01A 2OD5A 4QWQA 1K79A 3QPTA 4HDVA 5LGUA 2FEZA 4Y17A 5LEKA 1FC3A 5D6EA 2L01A 1XGNA 4M71A 3K1NA 1QZZA 1YTYA 3RDIA 3GW2A 2M87A 1WQ2A 4OMZA 2BBYA 3MZHA 5JHUA 5CVJA 3WE3A 3FXQA 4EQQA 2K86A 1SD6A 3H3ZA 2P8TA 1PUEE 2W84A 2DPUA 2HTJA 4KMFA 3L9FA 4MEXF 3RKWA 1DDNA 3NRVA 2XROA 4RS8A 3L09A 1UHWA 1RNLA 3LAPA 4E70A 5K1YA 1T2KA 4EJTA 4EJUA 5LRSA 1HKTA 1V3FA 2BV6A 4DQ2A 2PJPA 3ML6A 1IF1A 2E1NA 1WRJA 3FX3A 3J7AO 3F8MA 1MD0A 1UFMA 1XDUA 2VT2A 4LK0F 2DQLA 2VE8A 2QUFA 2HEOA 4D0PA 1UB9A 3QRFF 3K1MA 5D5XB 5E18F 1O3RA 3F21A 2G7HA 2PEXA 5J8FA 1RIOH 2XAGA 4R8HA 2E7XA 3PFIA 5CLSA 4ESFA 4FHTA 4HBLA 2XIGA 4RB3C 4HA8A 2WTEA 4HYEA 4BAYA 1IXRC 1ZG1A 3D5LA 1IRGA 4KN7X 5HOOA 1LEAA 4EV0A 4EM1A 2F5CA 3HTSB 2O8XA 3WTUC 2YX4A 1W4MA 1YG2A 3RPUA 2PI0A 2G9WA 2EJRA 2FBHA 1BI3A 4O6JA 5F1RA 1SFUA 4A2UA 4MHGA 4ZZLA 3R61A 1YYVA 5LGNA 1P2FA 2K02A 1IN5A 2KRFA 2KJBA 1G6NA 3WTYC 1LEBA 6PAXA 5H20A 4ZYDA 1IW7F 2IA1A 1IN7A 1R58A 2B0LA 2HYGD 2JTVA 3LQRA 2FNAA 5J6XA 5IT9K 3L7WA 4YIFA 2W25A 1ON1A 4MTDA 2ZCWA 3VB2A 1U5TC 2PMUA 2EFQA 3E5XA 3C3WA 1FNNA 4QLCU 2FF4A 1U5TB 1R7JA 1OMIA 2PG4A 1D3YA 3DPTA 5BMZA 1R5HA 1S29A 5E1ZB 3V7CA 1LNWA 4GYGA 2Q2EA 4P5OA 1S8NA 4RB2C 3F3XA 3J80Z 4GO1A 4AD9A 2FBIA 3FMSA 3HOTA 1F5TA 4UHTA 2WWYA 3R0AA 5D8KB 5L3EA 1B1BA 2LNBA 5J8CA 4A12A 2YPRA 3GFJA 1DPRA 1XSXA 1TLHB 2GA1A 3L2CA 4G9YA 1YW9A 1ODDA 4F7ZA 3CUOA 2HTSA 1U5TA 2DAOA 2Y0MA 1W5TA 1AOYA 1XGMA 5ED4A 2VBYA 2Z5UA 5K5QA 2FMYA 2V9VA 2VBXA 3GFLA 5BPDA 3GO5A 5IT3A 4TV7A 2LDUA 1BM9A 5DDGA 4RGUA 3WU0A 1G4DA 1TTYA 1HW2A 1KA8A 1XMKA 4OOIA 1FP1D 1IUYA 3FXUA 1KYZA 2STTA 4OIRF 3W6JB 5EEHA 2NNNA 2ACJA 3C18A 1FBUA 4UV8A 4UNOA 4BHBA 4WXHA 2RC4A 2E1CA 3BP8A 5AONA 2BGCA 5D4SA 4YG2F 3FF5A 1W7PA 4OIOF 1ZREA 1LVAA 3LSTA 3R0JA 1BIBA 1IN4A 3DXJF 1XCVA 1ZN2A 3F8FA 5FO5A 2ESNA 3T5XA 5EEGA 2DTRA 2W24A 4ENNA 3N97A 5D8LB 4CXFA 2GXBA 3Q9VA 2EFOA 1U3EM 1KU2A 3PQJA 1PP7U 3E6DA 2P6TA 2XAFA 3IL2A 2O3FA 3H3UA 2QM3A 4L0ZB 1XSVA 3DFGA 4L9TA 5JI6A 2D45A 3DEUA 4U88A 1J59A 3EYYA 2OBPA 3ERED 3IC7A 2X4HA 4A0YA 4LLNA 2P7VB 2ZNYA 1BI1A 3RPQA 2EA2A 3BJ6A 1XDSA 4G7OF 2M5WA 3KEQA 4ESBA 4I0AA 2STWA 3WGHA 2MA3A 4U0WA 4Q5SF 1FSHA 3F8NA 4HQMA 1JGSA 3MAJA 1GXPA 4HX7A 1DP7P 1FYLA 4WCGA 1IN6A 3IWFA 2FE3A 5FFXA 5JFRA 4P96A 2IW5A 2ZFWA 1XSDA 1UCRA 3HTUA 3N4MA 1REPC 2XAJA 1J75A 3IHUA 4FX0A 4AVPA 2L02A 2OQRA 1R1VA 3FMQA 1W7PB 4AWXB 3C1DA 2HGCA 1P4XA 1J2XA 5LBQA 3K9TA 2W85A 3BJOA 4HZFA 5ICCA 2NYXA 3MWMA 3GFIA 3GUDA 4OMYA 3M7GA 4EGZA 1X3UA 3EUHA 1TQMA 1KU3A 4YFKF 4LLLA 3O6BB 5L3CA 2Q8KA 2K4JA 2EV0A 4L5IA 3F6OA 4Y15A 2KKOA 4IF4A 5LHGA 4Q47A 4U7BA 4A0ZA 2A6EF 1NHAA 3P9KA 1G3YA 3WU1B 3GVAA 3KP4A 2CW0F 3ABUA 2LF8A 1O7LA 5DEQA 5D5VB 3SZPA 2RDPA
chains in the Genus database with same CATH superfamily
1O57A 1VQ4I 2BVMA 3FWEA 3WG7H 3J81K 5FJ8J 5JLWA 3KZZA 4EJOA 1ORKA 2CGPA 3KX2A 2Z9OA 4NC8A 2L9SA 3BOQA 1LFBA 5EEAA 5BS6A 2TCTA 3TGNA 4DYCA 3QPHA 3O3KA 4U0YA 3GTQJ 4BUPA 3W2AA 3VOEA 3L2WA 3ECOA 4XLPF 3BC8A 5ICEA 4HF1A 3JTHA 1RI7A 2NXNB 2EINH 1JKRC 5IP7J 3BTIA 4YFNF 2A3SA 5IYDJ 3HGGA 2P81A 5A2QZ 3ASNH 2VONA 4JX5A 3LA3A 4HW0A 4P9UA 4ENJA 2D1VA 3A0HC 4XRFA 3SJMA 2UV1A 1QQIA 2E7WA 1JTYA 5ERIA 3RTRA 3VEPA 1JE8A 1WZ2A 3ZMUA 1TWFJ 2BW3A 3CUQC 3JAMK 4ASNA 1ZRDA 3S3NA 3DU6A 2JPCA 4I0BA 5GADJ 3PIPF 2CU7A 4C30A 4CYCB 3S2WA 4JX6A 3H5RA 2MYSA 5DUKA 5FROA 4O5VA 3S1NJ 1JUMA 4RGXA 2LKSA 4ESJA 1T98A 3LMMA 5FKMA 2IGMA 3CTAA 2NS8A 5E17F 5BNGA 3QAHA 3HGYA 1P7IA 5EGOB 1D1CA 4AU7A 2WAQN 1ULYA 1A6QA 3Q0VA 3I3LA 4PSWA 1BIAA 3S15J 4BHCA 1D0YA 3QU3A 2MLKA 3PJRA 3CCVI 2M4KA 1FX7A 4P9FA 2CUJA 2HR3A 1SFEA 4LG3A 2V4JC 2LVSA 2OPTA 2W82A 5D6FA 2H09A 5J3LA 3KLNA 1DUXC 2Q1ZB 1Z77A 3TBIA 4WF2A 4PJNA 1BW5A 1TZLA 3QOEA 5K7HA 2CRGA 3WTXC 1MBKA 4IHYA 3QP6A 1MZBA 3JCUC 2LTPA 1ZR2A 2R5YA 1Q1VA 2VBZA 1SMTA 1B9NA 4NBQA 4BXXJ 1RZ4A 1B9MA 1MMGA 2XB0X 2HOEA 3ZQIA 3DLAA 3HJEA 3ZMVA 2DA4A 4B48A 1HXDA 2COBA 2DT7B 3TP3A 1GT0C 1O3QA 4H4KC 4O3MA 3OYFA 2CH0A 4CCNA 4IPAA 4LIUA 1Y6IA 3MMYB 3W2VA 5CVRA 5E8GA 2PJRB 4EVIA 2BY1A 4GXOA 4KFCA 2W4SA 2W1OA 3WTWC 4E7HA 1T08B 1TC3C 2DMNA 4YEJA 5HLIA 3BROA 5F1JA 1B8IB 4FE4A 2FNPA 2ZKZA 3BR1A 2JSCA 4E6KG 3ZMDA 4A5NA 5CPRB 3DPLC 5IOZA 2OZ6A 3HDDA 4A3IJ 3TW6A 2BHZA 1RESA 2H94A 2ETHA 4HF0A 3EQLF 3F72A 5KCMA 2OAZA 4LGWA 1XPXA 2DFIA 1I3QJ 2MD5A 2OU2A 1Z7UA 2NVUB 5JVTA 4S04A 4MNUA 4IRGA 1BJZA 2AXTC 1Z9CA 2KHMA 4C9YA 1SFXA 3GTLJ 5LHHA 1MSFC 2X6XA 4G6QA 2A05A 3TOAA 1Y8QB 4JK1X 1MDMA 3TMOA 2M7BA 4NC7A 3R6SA 4F52A 2YU9J 3F8BA 2E1MC 3V8KA 3LAJA 4DIQA 1VFCA 2QQAA 3I64A 3F22A 3FM3A 4D5CA 2R93J 4BYYA 1SANA 2R7XA 1UELB 4EM0B 1BA5A 1T39A 1I1GA 5BOXA 2D1HA 2COMA 3IH4A 2GBYA 3E6MA 5KNLA 1K6YA 2HXIA 1K78B 3K7AJ 1QA6A 1ZLKA 3HHHA 2K7LA 2JVHA 1YLFA 3CDLA 4LFUA 2WAFA 3ZR8X 3ZP5A 1DPUA 4BU2A 5D5WB 3JW4A 1WKMA 2HDWA 2NAZA 1ZYRF 1FSEA 1V4RA 5GTIC 1D5VA 2R3SA 2KZVA 3B6AA 3KPHA 4BDYA 2H6CA 2ZB9A 2F2EA 1S7OA 3A03A 4LB6B 1XB4A 3I0TA 1A36A 2WY8Q 2CW7A 5LRRA 3OSGA 3RZOJ 2XHKA 5HLHA 4RAFA 4UUSA 2A69F 4XRMA 4PCQA 1MMAA 2BZTA 3OR2C 3ULQB 2CUZA 3QPLA 3VSLA 4CCKA 4DBRA 4BE1A 3PNVA 4M72A 3QODA 3RKYA 3VYSB 5L3GA 1X2NA 5F08A 3DU5A 3PNYA 4Q48A 1HW1A 1YIJI 2EK5A 1R71A 3HB9A 1IRFA 2HNHA 3SZTA 1R4MB 4ZDLA 1GVJA 3TDZC 3IWZA 2R7UA 5L3BA 2IT0A 2QYOA 4RLQA 4IKFA 2GXGA 2MC4A 2CW8A 2IGKA 2MGQA 3QU6A 2HVSA 1Z6RA 3P7NA 3GX4X 4ITVA 1STZA 1XG1A 2NOGA 2IGOA 1WJEA 4C3IJ 4RAYA 2E5NA 2JT1A 2EFPA 4E7ZA 2HVQA 3TO9A 4UUSB 3FKIJ 1BW6A 3DF8A 2CO5A 4CGZA 2LY2A 1KYWA 4M3DA 4XRSG 3P9CA 5C4JJ 2B7EA 2MBFA 5HDNA 3W6KB 3S1RJ 1N77A 2XRNA 2DO7A 3MKYB 3H9QA 1LB2A 2EQRA 1LDJA 1ZHFA 4HSTA 3VYUB 3KEOA 4IX7A 4M6YA 3TKYA 1NG7A 3F8CA 2E36A 3MEXA 3KFWX 3DPUA 5BPIA 1R9TJ 2DPDA 4L9VA 4V2GA 4A6EA 2QA4I 1G3TA 1S72I 2OZUA 2MABA 3PNTA 3OOPA 5K7ZA 2VJ5A 2ZXWH 3G3ZA 4H0EA 1AA7A 4A3CJ 1A04A 4DYQA 3UNGC 2MH2A 2XRLA 1Q1HA 2DJIA 2QKLB 2EIJH 2X51A 2NOJB 3J81Z 2Q0OA 4IEJA 4QPOA 2LR8A 1Y0NA 2D2WA 2V79A 4B47A 2EFWA 4GYIA 1R00A 3CP2A 4XMYA 4D9JA 4IHTA 1A5JA 1D8JA 4N9HA 2DA6A 3X2QH 2W48A 2V6EA 4CCOA 1IV6A 3OS1A 2CMPA 2UUZA 5L3FA 5JLXA 4HLYA 4OAZA 3AG3H 3I54A 3RI4A 2KIMA 5ILVA 3LA2A 3SHFA 1HQCA 2MFZA 1JGGA 1SD7A 1E0EA 3E6BA 1OPCA 3EUAA 1TWAJ 2VQCA 2QEXI 3CCYA 2M8EA 4HSRA 4MFEA 1U8RA 1JHHA 3E5UA 1P7JA 1ZRFA 3AL0C 1FT9A 1CF7A 1RC9A 3I71A 2PFBA 1LQ1A 2IPQX 2K27A 3CQZJ 5DD8A 4ANJA 3VODA 4NQWB 3CLOA 2PX9A 3CF2A 1X4PA 1ZELA 2FSWA 3B73A 3ZGKA 4X1EA 3CMYA 4ZDPA 1N78A 1HSTA 2X1CA 1AWCA 2G7UA 4RM3A 1FOXA 2F5DA 1H89C 2EILH 1T6SA 4HV6A 1W0TA 2EFNA 2ZJ2A 1BOAA 2F6CA 2LOOA 2ZJQF 3K4BA 5EGOA 1SAXA 3HSEA 4QIWN 2NS7A 3WTVC 1E3PA 3F23A 4M9SA 5H2FC 3LL7A 4IJAA 4KITB 2WAEA 3M4OJ 3AG1H 1U9NA 3K2ZA 5ILSA 4OINF 2RNJA 1Z67A 3T8TA 1JKPC 4M6VA 1PP8F 3MVPA 1RR8C 2LBFA 5M3FJ 2XF7A 2W00A 2VN2A 4BJ6C 2E1OA 2ZC2A 4KDPA 2V6CA 1DP3A 2KDZA 4EMSA 5TRDA 4CYCA 1ZK8A 3BTJA 2QSHX 2LH9A 3H92A 2EZLA 1HKQA 2DOAA 3BWGA 1YE9A 3AFHA 3HXLA 4M3GA 2XGXA 4MGRA 2E19A 3U1DA 2DK8A 1ON2A 1W5CC 1LFUP 2HDCA 2XGEA 1ZQ3P 3HOSA 1D0XA 1Y56A 3TO6A 1GV2A 4IHVA 3OS0A 1LDKB 3FBIB 3AKZA 4IHSA 2CG4A 3QYEA 2DQRA 1FZPB 2ADUA 4AIDA 2C6YA 4RGSA 4JBAA 1KU9A 4A6DA 2EV5A 4ZTFA 4F91B 4PDKA 3GF2A 4AM3A 1LPQA 2P4WA 5KK1A 3BLYA 1FIAA 3SXYA 2R7FA 4M9XA 2QZ8A 4KMUX 5F6FA 4DZJA 3VDXA 2TDXA 1USSA 4XQFA 2ZMEB 2BHYA 1YS7A 2CUFA 1VQNI 5J4YA 2WB1N 5HLGA 1U0JA 3G4SI 1KQ8A 3V4GA 1XGOA 2OC6A 1MIJA 4CH7A 3ELKA 2JJ7A 1EH8A 2Z3YA 2GAUA 1ENHA 4OIQF 1IC8A 2Y48A 3V8JA 2DA5A 1OISA 4B44A 3WE2A 2QSGX 4FISA 3MCZA 4M73A 5EJCA 1YRNB 1GDTA 4AC0A 4PJJA 3JSOA 2O61A 4E7KA 2A07F 2X6YA 4B1RA 3K70D 1LJ9A 1V55H 4KIBA 1HLVA 1ZRCA 3RIRA 3HRTA 4OIPF 1SD4A 1FYMA 1FBSA 2KMUA 4CCJA 2OA4A 2DOFA 1FJLA 3HUGA 1YJNI 2IA2A 2IS2A 5AIQA 4Z6YA 3PL8A 3CCSI 3MQ0A 4HX8A 4M3BA 2KIFA 3CD6I 4ZJZA 4C2UA 3LSHA 4BS9A 4LIVA 3BZ6A 4HEA2 3UR3C 1GHCA 3G2BA 4M6XA 4XOTA 2Q2EB 1MBEA 3LSMA 4XSZF 4F93B 2K9QA 1X1BA 1H9TA 4FT8A 1AKHB 2PBIA 3LFKA 3H1CA 2DFFA 2PJRA 3WGGA 5E1WA 3DEEA 2M7AA 1BI2A 1O7FA 4PFPA 3ZQ7A 3BY6A 4XLAA 5M5WJ 4D5FA 1H0MA 2PMZN 2XVCA 2L7FP 3A4CA 4HX4A 4D7NA 1QVTA 3GZ5A 2KRHA 1XCBA 1HA8A 2A68F 1IRXA 1YIOA 2RQPA 5J1UA 5K7FA 2Y75A 4L0YB 1OCOH 4BY7J 3SEZA 3JRBA 1R5GA 4C2MJ 1DGRM 2ELJA 3ZOBA 4A93J 1UJ8A 3IRRA 1P4WA 2EWNA 2ZJRF 2K40A 2DDBA 2LSOA 4RM2A 3LA7A 2DI3A 1BC7C 4BE2A 1WJCA 4BHPA 2CV0A 1U6GA 5D4RA 1WGXA 1IV8A 4KN4X 4OAYA 2VXZA 2VQLA 1R23A 1GLNA 4RAZA 2PLYA 3S17J 3CCMI 3PSIA 4BY1J 5IYCJ 2CQQA 5GAGJ 4JOMA 2R7OA 2DCEA 2L9NA 3I4PA 4UUTA 4HNVA 5HLTA 1R1TA 1WJFA 2KQRA 3BJAA 3T8RA 4M74A 5DM6F 4I7HA 3H36A 4MQ9F 5E79C 2GIVA 2VQHA 4DGWB 5GTHC 1SVMA 3TW7A 2L9VA 1T0FA 5E1XA 4K2EA 3BR2A 5CQGA 2ZO4A 1KQ9A 1Z3YA 3GMEA 4NB5A 2GQQA 4F3QA 4UVBA 1YS6A 4ZYEA 3D5SC 3WTSC 4IOCF 3NEUA 4ON0A 1POGA 1SMYF 2DBBA 2LKXA 3DBHB 3MZYA 1Y39A 1I50J 2VOOA 4P55A 3S1MJ 1XD7A 5DS9A 1MBFA 1BOBA 3E0JB 2VASA 2PMHA 3TP0A 1XS9A 1FBQA 1FOYA 1S7AA 2CQNA 3HRMA 3QQAA 2P7CB 2EH3A 2VXDA 2QBYB 1P92A 2JA5J 3TDUC 2FJ1A 5GP9A 1BBYA 2EPFA 2V7FA 3DP7A 2A6HF 1QNTA 4KT5C 3SFZA 4XORA 5DV5A 4IRIA 1X3ZB 4NDLA 1VZ0A 4XLFA 4ZYAA 4RDUA 1QO0D 2KJCA 2XUBA 4HAMA 4CA0A 4CCLA 3L1PA 4EGYA 3R60A 2LY1A 2JK3A 4DJAA 3J7YJ 2O9LA 4C2TA 1ZGAA 2UWMA 2ZNZA 3OYCA 2HDDA 2E60A 4EM2A 1B72A 3DTKA 2VKEA 5C4XJ 1Y0UA 2MC3A 4UUVA 4XN0A 5HS9A 2FX0A 5F0HA 4A5MA 1MBGA 3HM5A 4PSXA 4YIRX 2BE5F 3FM5A 4N0BA 2LFBA 2NRAC 2LG4A 3WU2C 5LHIA 2HOTA 2DT5A 3J80K 2AQFA 3A01A 2YU3A 2XAQA 1YJWI 4PGHA 4Q4ZF 2KP6A 2DA1A 4KIGA 3I56I 3CUQB 2R7DA 3SEQA 5JR3A 1R22A 1F36A 5FKKA 3W2WA 1NTCA 4IVNA 2JA6J 4Z2YA 3WHCA 1G59A 1PDNC 3JR9A 3F6VA 4DOZA 4MFDA 3RQ4A 3MFKA 3DBRB 2H6BA 3HOXJ 4PK4A 3EYIA 1LVKA 4F92B 1Y1WJ 3GWZA 1WJDA 4A3MJ 1N25A 3SDGA 3KYCB 1U8BA 4J00A 1ZGJA 2CSOA 2EA4A 3P9IA 2XPVA 1B6AA 1TW2A 5L3DA 2WV1A 5FGMA 3IRQA 4UV9A 5AIPA 2MH9A 2K4BA 4G8XA 5TISC 3REOA 1IRZA 2I10A 1F9NA 3N05A 1KZHA 2WADA 1ETWA 5EG0B 1VQ8I 4E7LA 3GTMJ 4XICA 4YELA 4WXCA 1YX3A 4XONA 2H8WA 1MMDA 3WTZA 2GA2A 3VWBA 2XKOA 2XB5A 4HG2A 2L4AA 1OKRA 1DU6A 2KL4A 3ZPLA 3FMRA 2W7NA 1X2MA 3OWTA 4P1WA 4E7IA 2R5YB 2B9SA 3ECHA 2ISZA 3CO7C 1OYIA 1MGTA 4Y3OA 3FHNA 3V7SA 2O8KA 1K78A 4ZZDA 3IH3A 1X1PA 1H9GA 2DN0A 3K70C 4LB5A 3CP8A 3CMAI 2P5KA 1FIPA 3FXOA 2F4MB 4EJVA 2JWTA 3C2BA 5TJJA 3ZMZA 1WHUA 4ZYGA 2R7QA 3T0YA 1LDDA 5EDNA 4HNTA 4R1HA 3ZMSA 3ZMTA 5LLQA 3QYBA 5DD4A 2H1LA 3DBLB 3GBGA 1WJ5A 1X1CA 5FB2A 1MNMC 3RJPA 4E7SA 5D5UB 3G1MA 3F9KA 3K4KA 2MW8A 4I76A 3LSJA 4LLGF 1TWCJ 1HSJA 2FBKA 2EZIA 3VPRA 1JTXA 4PFOA 4U87A 3OYBA 2QBYA 3GLXA 1E17A 2FA5A 2OF7A 1MDMB 1H8AC 4XLEA 1VTNC 1I1SA 3BZKA 3OY9A 4HRIA 2FMLA 1I6XA 1P4AA 2MSYA 3LSGA 4IHXA 1W5SA 2FXAA 2QKMB 2CS3A 5GPAA 4WXDA 4FTHA 1W7PD 2HKXA 5F27A 5H6RA 2UZKA 3M9AA 1RETA 3S2DJ 1Z6TA 4G6DA 3RYRA 3HOUJ 2JA8J 2NVTJ 3CZ6A 3HBLA 2VIXA 1TNSA 3QOPA 3RKXA 1JUSA 3FK7A 2O7OA 1YFHA 3NQOA 1XMAA 2DK5A 5IP6A 2BY3A 2JZYA 3NARA 1MJ9A 4UVAA 3AG2H 2K9LA 1UMQA 4XK4A 2KRCA 5KAIC 3HKZA 4FETA 1X1AA 3AAFA 2UXXA 1IXCA 2MLGA 2R4GA 2DT6A 4XBFA 4B8XA 3DEWA 2R7TA 3KP2A 1OR7C 4EEFG 2NNYA 3JTGA 2HZTA 2XV4S 1HDPA 1MH3A 3TQNA 2HWVA 3ZQCA 1WCMJ 3PO2J 1ETOA 3P5JA 4PZJA 2FOKA 3I58A 3WTTC 2QQBA 4LG0A 2QENA 1SD5A 4CYDA 1PUFB 1FYKA 2Y0SN 2HQRA 1CF7B 2PQ8A 5CYVA 3FXRA 2DMTA 4WK8F 4XRSA 3L2UA 2VUMJ 1V54H 2E34A 1D8KA 4BNCA 2R7VA 1IGNA 2X48A 4B09A 2IXSA 2OUMA 1UZCA 1IUFA 4JYKA 2BEOA 2HPMA 2LP0A 2OTJI 3KP6A 3O2PE 3ABTA 1KQ0A 3GYHX 2VKVA 3T1BA 3GTJJ 3PQKA 4HDUA 1F43A 5EF6A 3OYDA 1FTTA 2O03A 3IV5A 5M5XJ 1JUPA 1MJAA 3E6CC 1IAWA 3HPGA 3OYIA 4R79A 4L9NA 1WVRA 4EJWA 4YIIA 2ECCA 3JRDA 1R1UA 1Z05A 1ZARA 2OTLI 4AIJA 3CMMA 3IAM2 3M8FA 5IY5H 3TO7A 1E3OC 4XKVA 3M1EA 3CJNA 1TW3A 3FZVA 3KZIC 2JSPA 5J40A 2CFOA 3SFIA 2OCEA 1EV7A 1IJWC 2DDAA 2EZHA 4HLXA 3OYJA 4WX9A 2YR2A 5ICFA 3MD2A 2EV6A 1PJRA 3G1LA 3ZN0A 1EH6A 3GFMA 3PUBA 3FK6A 1RKTA 4KYWA 4UVCA 1J5YA 1NH3A 4IHWA 2FUG2 2O5RA 1K7AA 1ETVA 3HRSA 5HNHA 2HQNA 2CV1A 3SQNA 2RN7A 2F5EA 1I27A 4BJTA 2L7MP 2L4MA 1T8IA 1OFCX 3TL4X 3U2RA 2P0WA 1IO2A 4L18B 4BJ5C 2Y9ZA 3OL4A 2Y69H 3I5UA 4A69C 3BPVA 4ETSA 3I4MJ 1QZYA 2WA0A 3LSIA 2IRFG 1O3TA 2IA0A 4ZTJA 2Z2SB 1EA3A 1MMNA 4XKCA 5IP9J 1LFPA 4KICA 4Y7NJ 3JREA 2VL8A 3C7JA 3GXOA 2Y31A 2ZXJA 2HQAA 4BXUA 2XAHA 1ZH5A 5FFZA 3GTGJ 4X0GA 2L2OA 2EIMH 5LD2C 1T38A 2WBMA 5E3LA 2HI3A 1G2HA 2CQKA 2LKPA 2LY9A 5E20A 3S1QJ 5CVVA 2QWWA 3V7RA 2DU9A 2RVCA 3K10A 1HKSA 5EYRA 3UKGA 3ONQA 3IKVA 2M34A 2JPBA 3I59B 2A61A 2XKPA 5E8IA 3RPUD 3BZCA 2J5OA 1CQTA 1J7KA 2IJLA 1RUOA 1I3AA 4XLNF 5DCFA 5M5YJ 3Q5FA 4KIFA 3GZ6A 2GOMA 1YX5A 4HV5A 1R36A 4BL0B 3KP7A 4W1UA 2X85A 4U7DA 1MJBA 3LQQA 3KLOA 2KFDA 3GCMA 4CICA 1G3WA 4PJ0C 1U78A 1IG7A 3CCQI 4AVZA 3S8PA 2IVMA 2BYVE 3WODF 1W36D 2A5YB 1FP2A 2M30A 3WG9A 5LEJA 2CQXA 1V5EA 3EUHC 4KT6A 5FLXZ 4IOAF 4I2OA 1OLTA 5CVIA 5HS7A 1IDZA 2R0QC 4AUXA 3KE2A 3VYRB 2LF7A 2ZBKA 4L9JA 3WGIA 3OIOA 2RKHA 5M3MJ 2TRTA 2IS4A 5CVUA 4AIHA 1ZKGA 2GZWA 2ICWG 4PJMA 2ZXIA 2NS0A 3RSNA 4ENKA 4HQEA 5FLXK 1KGSA 1YO5C 2VQGA 2Z99A 5TGTA 2HYFA 4MLOA 1ZG3A 3M8EA 5EG0A 2BVLA 4ZYHA 5HS8A 3PSFA 4IXAA 3CESA 4N4NB 1X1DA 3V42A 2O6GE 4M3EA 1Z91A 4I02A 5HDKA 2JRTA 2ZJPF 4RB1A 5E3OA 2F5FA 3COAC 3BG7A 1BJAA 2J5PA 5FD5A 2FU4A 5KVRA 3ZQHA 5FD6A 3ROUA 2V1DA 1FWZA 5DUIA 2M45A 1MNEA 4FX4A 2JA2A 3KP3A 4RB0A 1YI2I 3C2HA 1ZG5A 3ASOH 4LITA 4IZZA 1BC8C 1FOKA 3O8HA 4WWCA 2CFXA 2Z33A 3HOYJ 5JHFA 4L5EA 3U9GA 2XGDA 3K69A 2YSRA 3NWTA 2VODA 1B4AA 2H8RA 2ZFUA 5C44J 3RQIA 5HVQC 1L3LA 1A6IA 4XR6A 4HOBA 3HRUA 2IP2A 3G73A 1OJLA 4LD5A 4NHJA 1ONVA 2RAEA 2VBWA 4KA4A 2XF5A 1TBXA 5KAFC 3KIOA 4AYBA 2W57A 5H6QA 3GTOJ 2D5VA 1WWXA 4CZZA 5ILUA 3A01B 2AXLA 3LWFA 2XPUA 3OSFA 4A3KJ 1WJAA 3BT9A 1A31A 4LJZF 4BQOA 2GXAA 2NVQJ 2LREA 1J0RA 2P5LC 1P6RA 1ZLJA 1RPWA 4MQVA 5LGTA 2VC1A 4RGRA 1R6RA 2LLKA 4A0XA 5B5EC 2P6SA 1J9IA 3K0LA 3HSRA 4BGDA 3FXKA 2HU9A 2IBDA 4U0VA 3OYNA 1ITYA 1ERDA 2HQ5A 2HKOA 2WY7Q 2XASA 1V5GA 1O3SA 3W6VA 3KYLA 5DCMB 4CDGA 1OCRH 3JRIA 1AKHA 3KZYA 4G94A 5F64A 1FOWA 2DXIA 4ZH4F 2L54A 3KP5A 4BBSJ 2M1BA 3S3MA 2FQ3A 1M1EB 3EETA 4NNJA 2DW4A 1L0OC 1U2WA 3BTCA 2F5VA 2FRHA 4BH9A 1MBJA 2KPMA 3OYGA 3I59A 2R5ZB 1JHFA 3HYIA 4G7ZF 1NG6A 3L00A 3E97A 1HF0A 1FPQA 4LMYA 1IN8A 2F4IA 4D1QA 1HBXG 1XGSA 3ABLH 2IS6A 4I09A 2VJIA 1OYWA 2YX7A 3W3CA 4HF2A 3JSPA 1SEUA 4M3FA 2RGVA 4MTEA 3HPHA 3J7ZI 3EUKL 3HUGB 1VQ7I 1YQAA 3QYFA 3RYPA 3TOBA 3DKXA 1XTAA 3I53A 4GRIA 4F55A 2X0LA 3IAS2 3ERMA 3VYTB 2XSDC 4BDZA 1D1AA 3Q9SA 5B66C 1DGWY 3GLLA 3QP5A 4BBRJ 3I9V2 1MH4A 2KIUA 4IRHA 3IKTA 5HDGA 2L3DA 1K6OA 2GLOA 4CHUA 1HC8A 2DA3A 2WC2A 1B8IA 1IXSB 2VC0A 3HHGA 1BN5A 3CCLI 3V8LA 2E2IJ 3ZN1A 2DLLA 4JQFA 2Z1DA 2L7ZA 1EKEA 4QPQA 4RBOA 1IZ1A 4QSHA 2RQQA 1YOVB 2VI6A 2QLZA 3GEZA 3MKWB 1FY7A 3S3OA 1QGPA 3DQVC 4A3EJ 3E3VA 1BR2A 3HIFA 3LSKA 2V1XA 2K3PA 5ICGA 4AIKA 1SVLA 1YW7A 1F1ZA 1ZR4A 1I5ZA 3KETA 2PN6A 2ESHA 2VOPA 5BQTA 3ESWB 2XDVA 4Y4RA 1OCCH 3CDHA 1APLC 2JA7J 4BXFA 3FXMA 2KLOA 4L5JA 4GCVA 2O0YA 1F4KA 4UB8C 1S3JA 2HS5A 3CO6C 2E2HJ 2QQ9A 3VFZA 2ZMEA 4I98B 2ISYA 2CWEA 3DV8A 4XSXF 1TP4A 4D7MA 5HODA 5HNFA 5E3MA 3HSFA 4KUMA 4BACA 1U9OA 1QPIA 2QGUA 4LG0B 4MEYF 4DNCA 1TT5B 4FASD 1R5ID 5K5RA 3K4NA 1YW8A 3MKLA 4XKBA 1DQUA 3IUOA 2QVOA 3JAMZ 4KNYA 1LUJB 4M9ZA 2ME6A 3BPXA 1I39A 2OV7A 1XN7A 3ABKH 2DA2A 3H0DA 3U21A 5A2QK 1FLIA 1K61A 3CMEI 1Z1DA 3R4KA 4ENMA 1JKQC 5CJ9A 4QTRA 2RV8A 2K9NA 4N4OB 1S5LC 4LOCA 2UXNA 3BDDA 1EH7A 4XLCA 1TNTA 3TEDA 3S2HJ 1HW5A 4PGGA 1USTA 3VSKA 2GWRA 1LE8A 2NVYJ 3D0SA 1TWHJ 1E2XA 4NQWA 3CUQA 2OQGA 1UHMA 2VT3A 2MD0A 2HZDA 1G3SA 1UHSA 2ZSHB 3OL3A 2DJNA 2BY2A 2M4GA 1YRNA 2QCOA 2VLAA 4S05A 1SVOA 3OIQA 1QBJA 2Y0SA 2ZMEC 1NK3P 3OOUA 3ZQQA 4FQGA 4BQAA 3DKWA 1JI8A 1V5FA 4CZCA 5IYBJ 4S0HB 4UXNA 1MKMA 4OWRB 1XX5A 1T95A 4IL6C 1S6LA 3FHZA 1B59A 5DYMA 1WI9A 3PIOF 4Y13A 5IT9Z 1TQPA 1ETQA 3B02A 1VQMI 5CQEA 4LK1F 2DA7A 1QPMA 1X19A 2CQ7A 2CYYA 2XSJC 4CUGA 5K5OA 5FLVA 2AS5F 4YFXF 2FOWA 5DCMA 1KU7A 2H27A 3K1PA 3CDIA 1TQIA 1FEXA 3OYKA 3S93A 2BY0A 1UG2A 4GGGA 3E5QA 4N9IA 1J09A 2VE9A 2VPLA 4GDFA 2HFHA 3OV8A 3AG4H 2EB7A 2V1UA 1OR7A 2EZKA 3ISPA 4XOPA 2FD5A 3FISA 1BI0A 5FKLA 1KONA 1Y1VJ 1K4SA 2ELHA 1RUNA 4CO8A 4E4HA 1GUUA 1OYYA 3F0CA 1C0WA 4G7HF 4NUBA 3KCCA 3HOZJ 1ZAOA 3EDPA 3L2RA 1SAUA 2WV0A 4OU0A 1WSUA 1GXQA 1WH7A 1CGPA 2P5VA 3Q0UA 5F0CA 1WJBA 1OCZH 2CV2A 3DKYA 2I5UA 4I01A 1VQOI 2OD5A 4QWQA 3ZXSA 3DLLF 3BG5A 4ZC3A 3C2GA 2X1EA 1QHHD 1VF9A 3ABMH 1W1WE 3E7LA 1I6HJ 1W0UA 1K79A 3QPTA 4HDVA 1IDYA 3CCUI 2A5WA 2F48A 3BR0A 5LGUA 2FEZA 4UY8I 4Y17A 2JMWA 1FMVA 3Q0WA 1VQ9I 3A2KA 5LEKA 1FC3A 5D6EA 2L01A 1XGNA 4M71A 3ZRGA 3K1NA 2YUSA 4RA2A 3K2AA 1QZZA 1YTYA 2RREA 3PM1A 3RDIA 2K85A 3BG6A 3S32A 3M3YJ 3A0BC 2X9DA 3GW2A 2BXZA 2M87A 2X6WA 1WQ2A 3OYLA 4OMZA 5LFAA 1DU0A 2BBYA 3MZHA 2Y9YA 4IQJA 1XC5A 1VNDA 3ZQFA 4BQQA 5JHUA 3PFYA 5CVJA 3WE3A 2GIZA 3FXQA 1K4TA 4EQQA 2K86A 1SD6A 3H3ZA 2P8TA 1PUEE 2W84A 2DPUA 2HTJA 1VI0A 3ZQLA 3LFUA 4KMFA 2VKHA 3L9FA 5IPAA 3JRCA 4A3JJ 3RKWA 4MEXF 1DDNA 4I6ZA 2L9RA 3NRVA 2XROA 4RS8A 3RZDJ 2M3AA 4B4CA 3L09A 1UHWA 1RNLA 3LAPA 1QRYA 1JKOC 4E70A 5K1YA 4PUSA 3BR6A 1T2KA 4EJTA 2QF7A 1A35A 4EJUA 5LRSA 1HKTA 1V3FA 2BV6A 1T0FC 1QZEA 3H9GA 1PYVA 4DQ2A 2PJPA 1VQPI 3ML6A 1IF1A 2E1NA 1WRJA 3FX3A 3J7AO 3F8MA 5J1RA 2ZXHA 1MD0A 3HG9A 1UFMA 1XDUA 2VT2A 4LK0F 1JJ6C 2ID3A 3A1YA 1RKWA 2XAUA 2DQLA 2VE8A 3CLQA 2DMUA 2QUFA 2HEOA 2VPRA 2IGNA 3BCAA 4D0PA 1UB9A 3FKJA 3CC2I 3QRFF 3K1MA 5D5XB 5E18F 1O3RA 3F21A 2G7HA 2PEXA 2XGCA 2M9HA 2XAGA 3M1CA 5J8FA 3SZGA 1RIOH 3K6GA 3HC7A 4R8HA 1R4NB 2E7XA 3PFIA 5CLSA 2HPIA 3QWLA 4ESFA 3MN2A 2LK2A 4FHTA 4HBLA 2XIGA 4RB3C 4HA8A 3BG3A 3SYTA 3DTEA 2WTEA 4HYEA 5J4VA 4BAYA 3HZJA 4Y52J 1IXRC 1ZG1A 2DODA 2DYSH 3D5LA 3MZ8A 4RAGA 3HOVJ 4FCYA 3M07A 1IRGA 4KN7X 5HOOA 1LEAA 4EV0A 4EM1A 2F5CA 3HTSB 2Z16A 4B43A 2K9MA 2OCCH 2O8XA 5B1BH 2DMPA 2AO9A 5F0FA 3CJQB 1OQYA 2H1KA 2HOSA 2Y2ZA 3WTUC 1ETXA 5EZGA 4CSWA 2YX4A 3OMYA 4RMNA 1W4MA 1YG2A 3RPUA 2M0CA 5KHDA 2PMZA 1VQ5I 4BEHA 2PI0A 2G9WA 5DM7F 2EJRA 2FBHA 2E71A 1BI3A 4XN3A 3U1KA 1Y8RB 5C3EJ 4O6JA 5F1RA 3JRAA 1SFUA 4A2UA 4XIDA 3K4JA 4MHGA 4XL9A 3ZCOA 1ETKA 1WI3A 3R61A 4ZZLA 1PVEA 1YYVA 3BR5A 3LSPA 5LGNA 2YS9A 2X1DA 2XC7A 1P2FA 3M8JA 2K02A 4GFBA 1IN5A 2ID6A 2KJBA 2KRFA 3BQZA 4A3DJ 1G6NA 1HOMA 3WTYC 1LEBA 6PAXA 5H20A 4ZYDA 4XM3A 2WB1A 1IW7F 2IA1A 1IN7A 1R58A 1OCPA 2B0LA 2HYGD 2JTVA 3LQRA 2FNAA 5J6XA 2E35A 5IT9K 4HNUA 4DYRA 3L7WA 4YIFA 9ANTA 1TWGJ 2W25A 2XF6A 2K5CA 1ON1A 1XMXA 3K4MA 2L0KA 4MTDA 2ZCWA 1ETYA 3EPZA 2R7WA 3CC4I 3VB2A 4Y33A 3S16J 1U5TC 2PMUA 2EFQA 3K4CA 3E5XA 3C3WA 1GVDA 1FNNA 4QLCU 2FF4A 1U5TB 1R7JA 1UAAA 2KZGA 1OMIA 1ZTRA 2PG4A 3MKZA 1D3YA 3DPTA 5BMZA 1R5HA 1HDDC 1S29A 3PUFA 1UG0A 5E1ZB 3V7CA 1LNWA 4KISA 2JN6A 3J7AY 3HOWJ 3K4LA 1SFOJ 1O4XA 4GYGA 3O8GA 2Q2EA 4ABZA 2M8GX 4P5OA 2LD5A 2BW3B 2I8DA 2BOLA 1T33A 1S8NA 4RB2C 2ZSIB 3OYEA 3BR3A 3F3XA 3Q3SA 1VQ6I 3J80Z 4GO1A 4AD9A 2Y30A 3OIPA 2FBIA 3FMSA 3HOTA 1W36C 1F5TA 3HEFA 2JUGA 3BTLA 1LE8B 1VQKI 2A6TA 4UHTA 2ECBA 3IP4B 2WWYA 3R0AA 5D8KB 5L3EA 1B1BA 2LNBA 5J8CA 1R49A 4A12A 2YPRA 4C3HJ 1QHGA 3GFJA 1DPRA 1XSXA 1PUFA 1TLHB 3OR1C 2GA1A 4BEHB 1FMWA 4PJLA 3L2CA 4G9YA 2DYRH 1YW9A 1NK2P 3FBNB 3NAUA 3L2VA 1ODDA 5FRNA 2R7ZJ 3G1OA 4KJZA 4F7ZA 1Z3XA 1Z7LA 4C3JJ 1BR4A 3I55I 5FKOA 3CUOA 5DTDA 2HTSA 3LSRA 3OS2A 1U5TA 1MW7A 2DAOA 2Y0MA 1W5TA 1AOYA 1XGMA 5ED4A 2VBYA 2Z5UA 2DMQA 5K5QA 2FMYA 3ZQGA 1G8XA 5GPCA 2V9VA 1ZGWA 3CCRI 2VBXA 3GFLA 3E1SA 5BPDA 3GO5A 2R7RA 5IT3A 4TV7A 2LDUA 5IOYA 2V1NA 1Z21A 1BM9A 2CJJA 5DDGA 4JX4A 4RGUA 4II3A 3S14J 3DWLE 3WU0A 1G4DA 1TTYA 1WFXA 4XNFA 1HW2A 1YJ9I 2JQ7A 2VKDA 1KA8A 1XMKA 2VB6A 2QSFX 4OOIA 1FP1D 4A3LJ 3FXUA 1KYZA 2STTA 1IUYA 4OIRF 4G12A 3W6JB 5EEHA 1MSEC 2NNNA 2ACJA 2ME0A 3GTKJ 3C18A 3BCBA 1FBUA 4UV8A 4UNOA 3OYAA 1WH5A 4BHBA 2LYCA 4WXHA 2RC4A 3GZNB 1EF4A 5J47A 2E1CA 3BP8A 5AONA 2BGCA 3HKZN 3CCEI 4X6AJ 5D4SA 5E3NA 4YG2F 3JRFA 1S9HA 3FF5A 1D1BA 3BQYA 2GM4A 1W7PA 4OIOF 1ZREA 1LVAA 3FXLA 3LSTA 1MBHA 4I99C 3R0JA 3H9JA 5GAEJ 3L2QA 2JUCA 5EZHA 3RCOA 1BIBA 1IN4A 3DXJF 1XCVA 1ZN2A 5FLMJ 4IQ4A 3F8FA 3CJRB 4BKXA 4YRVA 5FO5A 2ESNA 2E1MB 3T5XA 4EATA 5EEGA 1X58A 2DTRA 2W24A 3FIWA 3H35A 2LBFB 4ENNA 2V9KA 3N97A 1VQLI 5D8LB 2B63J 1WPKA 3CF5F 4CXFA 2GXBA 2L7KA 3Q9VA 1TL8A 4JP0A 2KT0A 4E7JA 4A3BJ 2R5ZA 2AQEA 2EFOA 1KU2A 4W97A 1U3EM 3QPSA 3RKQA 3PQJA 2FQ4A 1PP7U 3E6DA 2P6TA 2XAFA 3FDYA 4J01A 2RNGA 3IL2A 1RR7A 3H3UA 2O3FA 5CKTA 1S7EA 3JRHA 4V19K 2QM3A 4L0ZB 1TT0A 3D5RC 3G6EI 2HOAA 5J1YA 1D5YA 1AU7A 3SDBA 3CCJI 1XSVA 3DFGA 4L9TA 5JI6A 2D45A 3DEUA 4U88A 1J59A 3EYYA 2OBPA 3ERED 3IC7A 1LKXA 4CCMA 3GTPJ 2LC2A 1D0ZA 2X4HA 4A0YA 4DBQA 1N75A 4B3AA 4LLNA 1H88C 5B1AH 2P7VB 2ZNYA 1AHDP 4II2A 1RRJA 4AYBN 1BI1A 3RPQA 2EA2A 2HYJA 3BJ6A 1XDSA 4G7OF 2M5WA 3KEQA 4ESBA 4DZPA 4I0AA 2DFEA 2STWA 1BL0A 3WGHA 2IEKA 1P9QC 2MA3A 4U0WA 4ZDOA 4Q5SF 3HL2A 2E2JJ 1B72B 2ELKA 3H0GJ 2GOXB 1X4OA 1HCRA 1FSHA 3F8NA 4HQMA 2HVRA 1JGSA 1YHQI 2IS1A 2F4OB 3MAJA 1QVUA 4NC6A 4V2FA 1GXPA 2E5ZA 4HX7A 1JT6A 2K3FA 4IO9F 2QQ8A 4G6TB 4DW6A 1YITI 1EJ9A 1DP7P 1FYLA 4FE7A 4HPQA 2OJED 3D1NI 4WCGA 1BR1A 3BG9A 5JVGF 4J19A 1IN6A 2DFHA 5FRMA 3IWFA 1MNDA 3CJTB 2FE3A 2VJJA 5FFXA 5JFRA 2DOEA 4P96A 1K83J 2IW5A 2ZFWA 2VJ4A 1XSDA 1JJ8C 1UCRA 2LRDA 3HTUA 3NWSA 3N4MA 3IH2A 1REPC 1SFKA 3WHBA 2XAJA 4MO7A 3IHUA 4FX0A 1GV5A 1J75A 4AVPA 4BQNA 2L02A 2OQRA 2V9PA 5FKNA 3KYDB 3OYHA 2R7SA 1FTZA 1R1VA 3H3VK 4XLHA 3FMQA 1W7PB 4AWXB 3C1DA 4B3XA 2R92J 3LOCA 2CUEA 3A02A 2HGCA 3OYMA 1P4XA 1SC7A 1MMSA 1J2XA 1X3WB 5LBQA 2LMDA 2W85A 2HXOA 2WAQA 3K9TA 3LNQA 5F04A 3BJOA 4HZFA 5ICCA 1JT0A 2NVXJ 2NYXA 4RLFA 3I4NJ 3MWMA 3GFIA 3GUDA 2G0EA 2V26A 3M7GA 2XPWA 4EGZA 1X3UA 4OMYA 1QU3A 1JXSA 3EUHA 1TQMA 1KU3A 4YFKF 2IAIA 2DTZA 4LLLA 3B6CA 4BE0A 2KIQA 3O6BB 2KDOA 3KEYA 4A3FJ 5L3CA 5B3SH 2Q8KA 4UB6C 2K4JA 2EV0A 4L5IA 2L5QA 2X6OA 2JRMA 3F6OA 3AL0B 4Y15A 2M0MA 2KISA 4MIMA 4A3GJ 2KKOA 4IF4A 5LHGA 1T56A 2AHQA 1E3HA 3DTIA 1Z0XA 2BXYA 2N8GA 4Q47A 2M2EA 4U7BA 3JRGA 3H5AA 4A0ZA 2A6EF 1NHAA 3P9KA 5GAHJ 1G3YA 3WU1B 3GVAA 4XKWA 3PO3J 3KP4A 2EBIA 2CW0F 2K9SA 3ABUA 1ACIA 2LF8A 1O7LA 5DEQA 2JVGA 3DCFA 2MG4A 2EIKH 3FXJA 1OCTC 5D5VB 3G71I 3SZPA 2RDPA 3H5NA 3CC7I
chains in the Genus database with same CATH topology
1O57A 3FWEA 3J81K 3KZZA 4EJOA 2CGPA 2Z9OA 3BOQA 5BS6A 3TGNA 3QPHA 3O3KA 4U0YA 3VOEA 3ECOA 4XLPF 4HF1A 5ICEA 3JTHA 1RI7A 4YFNF 2A3SA 5A2QZ 2VONA 3LA3A 4HW0A 4P9UA 2D1VA 4XRFA 1JE8A 5ERIA 1QQIA 2E7WA 3RTRA 3VEPA 3ZMUA 3CUQC 3JAMK 4ASNA 1ZRDA 2JPCA 4I0BA 3S2WA 5DUKA 4O5VA 4RGXA 4ESJA 1T98A 3CTAA 5E17F 3QAHA 1ULYA 1BIAA 4BHCA 3QU3A 2MLKA 4P9FA 1FX7A 2HR3A 1SFEA 5D6FA 2H09A 1DUXC 3KLNA 4WF2A 3WTXC 3QP6A 1MZBA 2VBZA 1SMTA 1B9NA 1RZ4A 1B9MA 2HOEA 3ZMVA 1HXDA 1O3QA 4O3MA 4IPAA 5CVRA 5E8GA 4EVIA 4GXOA 4KFCA 3WTWC 5HLIA 3BROA 2FNPA 2ZKZA 2JSCA 3ZMDA 4A5NA 3DPLC 2OZ6A 2H94A 2ETHA 4HF0A 3EQLF 3F72A 2OAZA 4LGWA 2DFIA 2MD5A 2OU2A 1Z7UA 5JVTA 4S04A 4MNUA 4IRGA 1Z9CA 1SFXA 5LHHA 4G6QA 3TOAA 4JK1X 1MDMA 3R6SA 3F8BA 3V8KA 3LAJA 2QQAA 3I64A 3F22A 3FM3A 4BYYA 4EM0B 1T39A 1I1GA 5BOXA 2D1HA 2COMA 3E6MA 1K78B 1ZLKA 3HHHA 2K7LA 1YLFA 4LFUA 3ZP5A 1DPUA 5D5WB 3JW4A 1WKMA 2NAZA 1ZYRF 1FSEA 1V4RA 1D5VA 2R3SA 2H6CA 2F2EA 1S7OA 4LB6B 1XB4A 3I0TA 5LRRA 2XHKA 5HLHA 2A69F 4PCQA 3ULQB 1JXSA 4M72A 3RKYA 5L3GA 4Q48A 1HW1A 2EK5A 1IRFA 3SZTA 3TDZC 1GVJA 3IWZA 5L3BA 2IT0A 2QYOA 2GXGA 3QU6A 1Z6RA 3P7NA 3GX4X 1STZA 4RAYA 2JT1A 2EFPA 3TO9A 4CGZA 3DF8A 2CO5A 1KYWA 3P9CA 2MBFA 5HDNA 3W6KB 2XRNA 2DO7A 1LB2A 1LDJA 1ZHFA 3KEOA 4M6YA 3TKYA 3F8CA 3MEXA 3KFWX 5BPIA 2DPDA 4L9VA 4A6EA 1G3TA 2OZUA 3OOPA 3G3ZA 4H0EA 1A04A 2MH2A 1Q1HA 3J81Z 2Q0OA 2D2WA 2V79A 2EFWA 4GYIA 1R00A 4IHTA 1D8JA 4N9HA 5L3FA 4HLYA 3I54A 3RI4A 2KIMA 5ILVA 3LA2A 3SHFA 1HQCA 1SD7A 3E6BA 1OPCA 2M8EA 1U8RA 1JHHA 3E5UA 1ZRFA 1FT9A 1CF7A 3I71A 2PFBA 1LQ1A 2IPQX 2K27A 5DD8A 3VODA 3CLOA 2FSWA 3B73A 1HSTA 1AWCA 2G7UA 2F5DA 1T6SA 4HV6A 2EFNA 2ZJ2A 1BOAA 1SAXA 3HSEA 3WTVC 3F23A 4M9SA 4IJAA 3K2ZA 5ILSA 4OINF 2RNJA 3T8TA 1PP8F 2VN2A 4KDPA 2V6CA 4EMSA 5TRDA 3H92A 1HKQA 3BWGA 4MGRA 2XGXA 3U1DA 2DK8A 1ON2A 2HDCA 3HOSA 3TO6A 1LDKB 4IHSA 2CG4A 2DQRA 1FZPB 2ADUA 2C6YA 4RGSA 4JBAA 1KU9A 4A6DA 2EV5A 4PDKA 3GF2A 2P4WA 5KK1A 3SXYA 2R7FA 4M9XA 2QZ8A 4KMUX 5F6FA 2TDXA 1USSA 2ZMEB 1YS7A 5HLGA 1KQ8A 3V4GA 1XGOA 3ELKA 1EH8A 2Z3YA 2GAUA 4OIQF 2Y48A 3V8JA 3WE2A 3MCZA 4M73A 2O61A 3JSOA 2A07F 1LJ9A 4KIBA 1ZRCA 3RIRA 3HRTA 4OIPF 1SD4A 1FYMA 1FBSA 2OA4A 3HUGA 2IA2A 5AIQA 3MQ0A 4HX8A 2KIFA 3BZ6A 1GHCA 4M6XA 4XSZF 1H9TA 4FT8A 2PBIA 3LFKA 3WGGA 5E1WA 1BI2A 1O7FA 3ZQ7A 3BY6A 1H0MA 2XVCA 4HX4A 3GZ5A 1XCBA 2A68F 1YIOA 2RQPA 2Y75A 4L0YB 1R5GA 3IRRA 1P4WA 2EWNA 2LSOA 3LA7A 2DI3A 1BC7C 4BHPA 1U6GA 5D4RA 4KN4X 2VXZA 1R23A 4RAZA 2PLYA 3I4PA 1R1TA 3BJAA 3T8RA 4M74A 4I7HA 4MQ9F 2GIVA 1T0FA 5E1XA 4K2EA 2ZO4A 1KQ9A 4NB5A 2GQQA 4UVBA 1YS6A 4ZYEA 3WTSC 3NEUA 4ON0A 1SMYF 2DBBA 3MZYA 2VOOA 4P55A 1XD7A 2PMHA 1FBQA 1S7AA 3HRMA 2P7CB 2QBYB 1P92A 3TDUC 1BBYA 3DP7A 2A6HF 1QNTA 4KT5C 3SFZA 5DV5A 4IRIA 1QO0D 2KJCA 2XUBA 4HAMA 4EGYA 3R60A 1ZGAA 2UWMA 2ZNZA 4EM2A 1Y0UA 2MC3A 4UUVA 5HS9A 4A5MA 2BE5F 3FM5A 4N0BA 2NRAC 5LHIA 2DT5A 3J80K 2YU3A 2XAQA 4PGHA 4Q4ZF 4KIGA 3CUQB 2R7DA 5JR3A 1R22A 4IVNA 4Z2YA 1PDNC 3F6VA 3MFKA 2H6BA 3EYIA 3GWZA 1ZGJA 2CSOA 2EA4A 3P9IA 1B6AA 1TW2A 5L3DA 5FGMA 3IRQA 4UV9A 5AIPA 2MH9A 2K4BA 4G8XA 3REOA 1F9NA 4WXCA 3WTZA 2GA2A 2XKOA 2L4AA 1OKRA 3ZPLA 3FMRA 2ISZA 3ECHA 3CO7C 1OYIA 1MGTA 3V7SA 1K78A 4ZZDA 1H9GA 4LB5A 2P5KA 4EJVA 5TJJA 3ZMZA 4ZYGA 3T0YA 1LDDA 4R1HA 3ZMSA 3ZMTA 5LLQA 5DD4A 5FB2A 3RJPA 5D5UB 4LLGF 1HSJA 2FBKA 2QBYA 3GLXA 1E17A 2FA5A 1MDMB 1VTNC 1I1SA 2FMLA 1I6XA 1P4AA 1W5SA 2FXAA 4WXDA 1W7PD 2HKXA 5H6RA 2UZKA 3M9AA 1Z6TA 4G6DA 3RYRA 1TNSA 3QOPA 3RKXA 1YFHA 3NQOA 1XMAA 2DK5A 2JZYA 1MJ9A 4UVAA 3AAFA 2UXXA 1IXCA 2MLGA 4XBFA 4B8XA 3KP2A 2NNYA 3JTGA 2HZTA 2XV4S 3TQNA 2HWVA 4PZJA 2FOKA 3I58A 3WTTC 2QQBA 4LG0A 2QENA 1SD5A 4CYDA 1FYKA 2HQRA 1CF7B 2PQ8A 5CYVA 3FXRA 4WK8F 1D8KA 4BNCA 4B09A 2BEOA 3KP6A 3O2PE 3ABTA 1KQ0A 3GYHX 3T1BA 3PQKA 4HDUA 2O03A 1MJAA 3E6CC 1IAWA 4R79A 4L9NA 4EJWA 4YIIA 1R1UA 1Z05A 1ZARA 4AIJA 3M8FA 3TO7A 3M1EA 3CJNA 1TW3A 3FZVA 1EV7A 4HLXA 4WX9A 2YR2A 5ICFA 2EV6A 3ZN0A 1EH6A 3GFMA 4KYWA 4UVCA 1J5YA 1K7AA 3HRSA 2HQNA 3SQNA 2RN7A 2F5EA 1I27A 2L4MA 3U2RA 4L18B 3I5UA 3BPVA 4ETSA 1QZYA 2IRFG 1O3TA 2IA0A 4KICA 3C7JA 3GXOA 2ZXJA 4BXUA 2XAHA 1ZH5A 5FFZA 1T38A 2CQKA 2LKPA 5E20A 5CVVA 2QWWA 3V7RA 2DU9A 2RVCA 1HKSA 3IKVA 2JPBA 3I59B 2A61A 2XKPA 5E8IA 2J5OA 1J7KA 2IJLA 1RUOA 4XLNF 5DCFA 3Q5FA 4KIFA 3GZ6A 4HV5A 1R36A 3KP7A 4U7DA 1MJBA 3LQQA 3KLOA 4CICA 1G3WA 1U78A 2IVMA 2BYVE 3WODF 2A5YB 1FP2A 2M30A 3WG9A 5LEJA 5FLXZ 4I2OA 5CVIA 5HS7A 3KE2A 2LF7A 2ZBKA 4L9JA 3WGIA 2RKHA 5CVUA 4AIHA 2GZWA 2NS0A 4ENKA 4HQEA 5FLXK 1KGSA 1YO5C 2Z99A 2HYFA 1ZG3A 3M8EA 4ZYHA 5HS8A 4IXAA 2O6GE 1Z91A 4I02A 5HDKA 2JRTA 4RB1A 2F5FA 3COAC 1BJAA 2J5PA 5FD5A 2FU4A 5KVRA 5FD6A 3ROUA 2V1DA 1FWZA 5DUIA 2M45A 4FX4A 3KP3A 4RB0A 1ZG5A 1BC8C 1FOKA 4WWCA 2CFXA 2Z33A 3U9GA 3K69A 2YSRA 2VODA 1B4AA 1L3LA 5HVQC 4HOBA 3HRUA 2IP2A 3G73A 4LD5A 4NHJA 1ONVA 2VBWA 4KA4A 1TBXA 2W57A 5H6QA 1WWXA 4CZZA 5ILUA 2AXLA 3LWFA 4LJZF 1J0RA 2P5LC 1P6RA 1ZLJA 4MQVA 5LGTA 2VC1A 4RGRA 4A0XA 2P6SA 1J9IA 3K0LA 3HSRA 4U0VA 2HKOA 2XASA 1O3SA 5DCMB 4CDGA 3KZYA 4G94A 5F64A 4ZH4F 2L54A 3KP5A 2M1BA 2FQ3A 3EETA 2DW4A 1L0OC 1U2WA 2FRHA 4BH9A 3I59A 1JHFA 3HYIA 4G7ZF 3L00A 3E97A 1FPQA 4LMYA 1IN8A 1HBXG 1XGSA 4I09A 1OYWA 2YX7A 4HF2A 3JSPA 2RGVA 4MTEA 1YQAA 3RYPA 3TOBA 3I53A 4ENJA 2X0LA 3Q9SA 3QP5A 1K6OA 2KIUA 4IRHA 3IKTA 5HDGA 2L3DA 4CHUA 2WC2A 1IXSB 2VC0A 3HHGA 1BN5A 3V8LA 3ZN1A 2DLLA 4JQFA 1IZ1A 2QLZA 3GEZA 1FY7A 1QGPA 3DQVC 3E3VA 3HIFA 2V1XA 5ICGA 4AIKA 1YW7A 1F1ZA 1I5ZA 3KETA 2PN6A 2ESHA 2VOPA 5BQTA 3CDHA 4L5JA 4GCVA 2O0YA 1F4KA 1S3JA 2HS5A 3CO6C 2QQ9A 3VFZA 2ZMEA 4I98B 2ISYA 2CWEA 3DV8A 4XSXF 3HSFA 4KUMA 4LG0B 4MEYF 4DNCA 5K5RA 1YW8A 2QVOA 4KNYA 3JAMZ 4M9ZA 3BPXA 1XN7A 1FLIA 5A2QK 1Z1DA 3R4KA 4ENMA 5CJ9A 2RV8A 2UXNA 3BDDA 1EH7A 1TNTA 1HW5A 4PGGA 1USTA 2GWRA 3D0SA 1E2XA 4NQWA 3CUQA 2OQGA 1UHMA 2VT3A 1G3SA 1QBJA 4S05A 4BQAA 3DKWA 4UXNA 1MKMA 1S6LA 3FHZA 1B59A 5DYMA 1WI9A 4Y13A 5IT9Z 1TQPA 3B02A 4LK1F 1QPMA 2CYYA 5K5OA 2AS5F 4YFXF 1KU7A 2H27A 5DCMA 3K1PA 1TQIA 4GGGA 3E5QA 4N9IA 2VE9A 2HFHA 3OV8A 2EB7A 2V1UA 1OR7A 3ISPA 1BI0A 2ELHA 1RUNA 4CO8A 1OYYA 1C0WA 4G7HF 3KCCA 1ZAOA 3EDPA 2WV0A 4OU0A 1WSUA 1GXQA 1CGPA 2P5VA 4I01A 2OD5A 4QWQA 1K79A 3QPTA 4HDVA 5LGUA 2FEZA 4Y17A 5LEKA 1FC3A 5D6EA 2L01A 1XGNA 4M71A 3K1NA 1QZZA 1YTYA 3RDIA 3GW2A 2M87A 1WQ2A 4OMZA 2BBYA 3MZHA 5JHUA 5CVJA 3WE3A 3FXQA 4EQQA 2K86A 1SD6A 3H3ZA 2P8TA 1PUEE 2W84A 2DPUA 2HTJA 4KMFA 3L9FA 4MEXF 3RKWA 1DDNA 3NRVA 2XROA 4RS8A 3L09A 1UHWA 1RNLA 3LAPA 4E70A 5K1YA 1T2KA 4EJTA 4EJUA 5LRSA 1HKTA 1V3FA 2BV6A 4DQ2A 2PJPA 3ML6A 1IF1A 2E1NA 1WRJA 3FX3A 3J7AO 3F8MA 1MD0A 1UFMA 1XDUA 2VT2A 4LK0F 2DQLA 2VE8A 2QUFA 2HEOA 4D0PA 1UB9A 3QRFF 3K1MA 5D5XB 5E18F 1O3RA 3F21A 2G7HA 2PEXA 5J8FA 1RIOH 2XAGA 4R8HA 2E7XA 3PFIA 5CLSA 4ESFA 4FHTA 4HBLA 2XIGA 4RB3C 4HA8A 2WTEA 4HYEA 4BAYA 1IXRC 1ZG1A 3D5LA 1IRGA 4KN7X 5HOOA 1LEAA 4EV0A 4EM1A 2F5CA 3HTSB 2O8XA 3WTUC 2YX4A 1W4MA 1YG2A 3RPUA 2PI0A 2G9WA 2EJRA 2FBHA 1BI3A 4O6JA 5F1RA 1SFUA 4A2UA 4MHGA 4ZZLA 3R61A 1YYVA 5LGNA 1P2FA 2K02A 1IN5A 2KRFA 2KJBA 1G6NA 3WTYC 1LEBA 6PAXA 5H20A 4ZYDA 1IW7F 2IA1A 1IN7A 1R58A 2B0LA 2HYGD 2JTVA 3LQRA 2FNAA 5J6XA 5IT9K 3L7WA 4YIFA 2W25A 1ON1A 4MTDA 2ZCWA 3VB2A 1U5TC 2PMUA 2EFQA 3E5XA 3C3WA 1FNNA 4QLCU 2FF4A 1U5TB 1R7JA 1OMIA 2PG4A 1D3YA 3DPTA 5BMZA 1R5HA 1S29A 5E1ZB 3V7CA 1LNWA 4GYGA 2Q2EA 4P5OA 1S8NA 4RB2C 3F3XA 3J80Z 4GO1A 4AD9A 2FBIA 3FMSA 3HOTA 1F5TA 4UHTA 2WWYA 3R0AA 5D8KB 5L3EA 1B1BA 2LNBA 5J8CA 4A12A 2YPRA 3GFJA 1DPRA 1XSXA 1TLHB 2GA1A 3L2CA 4G9YA 1YW9A 1ODDA 4F7ZA 3CUOA 2HTSA 1U5TA 2DAOA 2Y0MA 1W5TA 1AOYA 1XGMA 5ED4A 2VBYA 2Z5UA 5K5QA 2FMYA 2V9VA 2VBXA 3GFLA 5BPDA 3GO5A 5IT3A 4TV7A 2LDUA 1BM9A 5DDGA 4RGUA 3WU0A 1G4DA 1TTYA 1HW2A 1KA8A 1XMKA 4OOIA 1FP1D 1IUYA 3FXUA 1KYZA 2STTA 4OIRF 3W6JB 5EEHA 2NNNA 2ACJA 3C18A 1FBUA 4UV8A 4UNOA 4BHBA 4WXHA 2RC4A 2E1CA 3BP8A 5AONA 2BGCA 5D4SA 4YG2F 3FF5A 1W7PA 4OIOF 1ZREA 1LVAA 3LSTA 3R0JA 1BIBA 1IN4A 3DXJF 1XCVA 1ZN2A 3F8FA 5FO5A 2ESNA 3T5XA 5EEGA 2DTRA 2W24A 4ENNA 3N97A 5D8LB 4CXFA 2GXBA 3Q9VA 2EFOA 1U3EM 1KU2A 3PQJA 1PP7U 3E6DA 2P6TA 2XAFA 3IL2A 2O3FA 3H3UA 2QM3A 4L0ZB 1XSVA 3DFGA 4L9TA 5JI6A 2D45A 3DEUA 4U88A 1J59A 3EYYA 2OBPA 3ERED 3IC7A 2X4HA 4A0YA 4LLNA 2P7VB 2ZNYA 1BI1A 3RPQA 2EA2A 3BJ6A 1XDSA 4G7OF 2M5WA 3KEQA 4ESBA 4I0AA 2STWA 3WGHA 2MA3A 4U0WA 4Q5SF 1FSHA 3F8NA 4HQMA 1JGSA 3MAJA 1GXPA 4HX7A 1DP7P 1FYLA 4WCGA 1IN6A 3IWFA 2FE3A 5FFXA 5JFRA 4P96A 2IW5A 2ZFWA 1XSDA 1UCRA 3HTUA 3N4MA 1REPC 2XAJA 1J75A 3IHUA 4FX0A 4AVPA 2L02A 2OQRA 1R1VA 3FMQA 1W7PB 4AWXB 3C1DA 2HGCA 1P4XA 1J2XA 5LBQA 3K9TA 2W85A 3BJOA 4HZFA 5ICCA 2NYXA 3MWMA 3GFIA 3GUDA 4OMYA 3M7GA 4EGZA 1X3UA 3EUHA 1TQMA 1KU3A 4YFKF 4LLLA 3O6BB 5L3CA 2Q8KA 2K4JA 2EV0A 4L5IA 3F6OA 4Y15A 2KKOA 4IF4A 5LHGA 4Q47A 4U7BA 4A0ZA 2A6EF 1NHAA 3P9KA 1G3YA 3WU1B 3GVAA 3KP4A 2CW0F 3ABUA 2LF8A 1O7LA 5DEQA 5D5VB 3SZPA 2RDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O57 A;  3FWE A;  3J81 K;  3KZZ A;  4EJO A;  2CGP A;  2Z9O A;  3BOQ A;  5BS6 A;  3TGN A;  3QPH A;  3O3K A;  4U0Y A;  3VOE A;  3ECO A;  4XLP F;  4HF1 A;  5ICE A;  3JTH A;  1RI7 A;  4YFN F;  2A3S A;  5A2Q Z;  2VON A;  3LA3 A;  4HW0 A;  4P9U A;  2D1V A;  4XRF A;  1JE8 A;  5ERI A;  1QQI A;  2E7W A;  3RTR A;  3VEP A;  3ZMU A;  3CUQ C;  3JAM K;  4ASN A;  1ZRD A;  2JPC A;  4I0B A;  3S2W A;  5DUK A;  4O5V A;  4RGX A;  4ESJ A;  1T98 A;  3CTA A;  5E17 F;  3QAH A;  1ULY A;  1BIA A;  4BHC A;  3QU3 A;  2MLK A;  4P9F A;  1FX7 A;  2HR3 A;  1SFE A;  5D6F A;  2H09 A;  1DUX C;  3KLN A;  4WF2 A;  3WTX C;  3QP6 A;  1MZB A;  2VBZ A;  1SMT A;  1B9N A;  1RZ4 A;  1B9M A;  2HOE A;  3ZMV A;  1HXD A;  1O3Q A;  4O3M A;  4IPA A;  5CVR A;  5E8G A;  4EVI A;  4GXO A;  4KFC A;  3WTW C;  5HLI A;  3BRO A;  2FNP A;  2ZKZ A;  2JSC A;  3ZMD A;  4A5N A;  3DPL C;  2OZ6 A;  2H94 A;  2ETH A;  4HF0 A;  3EQL F;  3F72 A;  2OAZ A;  4LGW A;  2DFI A;  2MD5 A;  2OU2 A;  1Z7U A;  5JVT A;  4S04 A;  4MNU A;  4IRG A;  1Z9C A;  1SFX A;  5LHH A;  4G6Q A;  3TOA A;  4JK1 X;  1MDM A;  3R6S A;  3F8B A;  3V8K A;  3LAJ A;  2QQA A;  3I64 A;  3F22 A;  3FM3 A;  4BYY A;  4EM0 B;  1T39 A;  1I1G A;  5BOX A;  2D1H A;  2COM A;  3E6M A;  1K78 B;  1ZLK A;  3HHH A;  2K7L A;  1YLF A;  4LFU A;  3ZP5 A;  1DPU A;  5D5W B;  3JW4 A;  1WKM A;  2NAZ A;  1ZYR F;  1FSE A;  1V4R A;  1D5V A;  2R3S A;  2H6C A;  2F2E A;  1S7O A;  4LB6 B;  1XB4 A;  3I0T A;  5LRR A;  2XHK A;  5HLH A;  2A69 F;  4PCQ A;  3ULQ B;  1JXS A;  4M72 A;  3RKY A;  5L3G A;  4Q48 A;  1HW1 A;  2EK5 A;  1IRF A;  3SZT A;  3TDZ C;  1GVJ A;  3IWZ A;  5L3B A;  2IT0 A;  2QYO A;  2GXG A;  3QU6 A;  1Z6R A;  3P7N A;  3GX4 X;  1STZ A;  4RAY A;  2JT1 A;  2EFP A;  3TO9 A;  4CGZ A;  3DF8 A;  2CO5 A;  1KYW A;  3P9C A;  2MBF A;  5HDN A;  3W6K B;  2XRN A;  2DO7 A;  1LB2 A;  1LDJ A;  1ZHF A;  3KEO A;  4M6Y A;  3TKY A;  3F8C A;  3MEX A;  3KFW X;  5BPI A;  2DPD A;  4L9V A;  4A6E A;  1G3T A;  2OZU A;  3OOP A;  3G3Z A;  4H0E A;  1A04 A;  2MH2 A;  1Q1H A;  3J81 Z;  2Q0O A;  2D2W A;  2V79 A;  2EFW A;  4GYI A;  1R00 A;  4IHT A;  1D8J A;  4N9H A;  5L3F A;  4HLY A;  3I54 A;  3RI4 A;  2KIM A;  5ILV A;  3LA2 A;  3SHF A;  1HQC A;  1SD7 A;  3E6B A;  1OPC A;  2M8E A;  1U8R A;  1JHH A;  3E5U A;  1ZRF A;  1FT9 A;  1CF7 A;  3I71 A;  2PFB A;  1LQ1 A;  2IPQ X;  2K27 A;  5DD8 A;  3VOD A;  3CLO A;  2FSW A;  3B73 A;  1HST A;  1AWC A;  2G7U A;  2F5D A;  1T6S A;  4HV6 A;  2EFN A;  2ZJ2 A;  1BOA A;  1SAX A;  3HSE A;  3WTV C;  3F23 A;  4M9S A;  4IJA A;  3K2Z A;  5ILS A;  4OIN F;  2RNJ A;  3T8T A;  1PP8 F;  2VN2 A;  4KDP A;  2V6C A;  4EMS A;  5TRD A;  3H92 A;  1HKQ A;  3BWG A;  4MGR A;  2XGX A;  3U1D A;  2DK8 A;  1ON2 A;  2HDC A;  3HOS A;  3TO6 A;  1LDK B;  4IHS A;  2CG4 A;  2DQR A;  1FZP B;  2ADU A;  2C6Y A;  4RGS A;  4JBA A;  1KU9 A;  4A6D A;  2EV5 A;  4PDK A;  3GF2 A;  2P4W A;  5KK1 A;  3SXY A;  2R7F A;  4M9X A;  2QZ8 A;  4KMU X;  5F6F A;  2TDX A;  1USS A;  2ZME B;  1YS7 A;  5HLG A;  1KQ8 A;  3V4G A;  1XGO A;  3ELK A;  1EH8 A;  2Z3Y A;  2GAU A;  4OIQ F;  2Y48 A;  3V8J A;  3WE2 A;  3MCZ A;  4M73 A;  2O61 A;  3JSO A;  2A07 F;  1LJ9 A;  4KIB A;  1ZRC A;  3RIR A;  3HRT A;  4OIP F;  1SD4 A;  1FYM A;  1FBS A;  2OA4 A;  3HUG A;  2IA2 A;  5AIQ A;  3MQ0 A;  4HX8 A;  2KIF A;  3BZ6 A;  1GHC A;  4M6X A;  4XSZ F;  1H9T A;  4FT8 A;  2PBI A;  3LFK A;  3WGG A;  5E1W A;  1BI2 A;  1O7F A;  3ZQ7 A;  3BY6 A;  1H0M A;  2XVC A;  4HX4 A;  3GZ5 A;  1XCB A;  2A68 F;  1YIO A;  2RQP A;  2Y75 A;  4L0Y B;  1R5G A;  3IRR A;  1P4W A;  2EWN A;  2LSO A;  3LA7 A;  2DI3 A;  1BC7 C;  4BHP A;  1U6G A;  5D4R A;  4KN4 X;  2VXZ A;  1R23 A;  4RAZ A;  2PLY A;  3I4P A;  1R1T A;  3BJA A;  3T8R A;  4M74 A;  4I7H A;  4MQ9 F;  2GIV A;  1T0F A;  5E1X A;  4K2E A;  2ZO4 A;  1KQ9 A;  4NB5 A;  2GQQ A;  4UVB A;  1YS6 A;  4ZYE A;  3WTS C;  3NEU A;  4ON0 A;  1SMY F;  2DBB A;  3MZY A;  2VOO A;  4P55 A;  1XD7 A;  2PMH A;  1FBQ A;  1S7A A;  3HRM A;  2P7C B;  2QBY B;  1P92 A;  3TDU C;  1BBY A;  3DP7 A;  2A6H F;  1QNT A;  4KT5 C;  3SFZ A;  5DV5 A;  4IRI A;  1QO0 D;  2KJC A;  2XUB A;  4HAM A;  4EGY A;  3R60 A;  1ZGA A;  2UWM A;  2ZNZ A;  4EM2 A;  1Y0U A;  2MC3 A;  4UUV A;  5HS9 A;  4A5M A;  2BE5 F;  3FM5 A;  4N0B A;  2NRA C;  5LHI A;  2DT5 A;  3J80 K;  2YU3 A;  2XAQ A;  4PGH A;  4Q4Z F;  4KIG A;  3CUQ B;  2R7D A;  5JR3 A;  1R22 A;  4IVN A;  4Z2Y A;  1PDN C;  3F6V A;  3MFK A;  2H6B A;  3EYI A;  3GWZ A;  1ZGJ A;  2CSO A;  2EA4 A;  3P9I A;  1B6A A;  1TW2 A;  5L3D A;  5FGM A;  3IRQ A;  4UV9 A;  5AIP A;  2MH9 A;  2K4B A;  4G8X A;  3REO A;  1F9N A;  4WXC A;  3WTZ A;  2GA2 A;  2XKO A;  2L4A A;  1OKR A;  3ZPL A;  3FMR A;  2ISZ A;  3ECH A;  3CO7 C;  1OYI A;  1MGT A;  3V7S A;  1K78 A;  4ZZD A;  1H9G A;  4LB5 A;  2P5K A;  4EJV A;  5TJJ A;  3ZMZ A;  4ZYG A;  3T0Y A;  1LDD A;  4R1H A;  3ZMS A;  3ZMT A;  5LLQ A;  5DD4 A;  5FB2 A;  3RJP A;  5D5U B;  4LLG F;  1HSJ A;  2FBK A;  2QBY A;  3GLX A;  1E17 A;  2FA5 A;  1MDM B;  1VTN C;  1I1S A;  2FML A;  1I6X A;  1P4A A;  1W5S A;  2FXA A;  4WXD A;  1W7P D;  2HKX A;  5H6R A;  2UZK A;  3M9A A;  1Z6T A;  4G6D A;  3RYR A;  1TNS A;  3QOP A;  3RKX A;  1YFH A;  3NQO A;  1XMA A;  2DK5 A;  2JZY A;  1MJ9 A;  4UVA A;  3AAF A;  2UXX A;  1IXC A;  2MLG A;  4XBF A;  4B8X A;  3KP2 A;  2NNY A;  3JTG A;  2HZT A;  2XV4 S;  3TQN A;  2HWV A;  4PZJ A;  2FOK A;  3I58 A;  3WTT C;  2QQB A;  4LG0 A;  2QEN A;  1SD5 A;  4CYD A;  1FYK A;  2HQR A;  1CF7 B;  2PQ8 A;  5CYV A;  3FXR A;  4WK8 F;  1D8K A;  4BNC A;  4B09 A;  2BEO A;  3KP6 A;  3O2P E;  3ABT A;  1KQ0 A;  3GYH X;  3T1B A;  3PQK A;  4HDU A;  2O03 A;  1MJA A;  3E6C C;  1IAW A;  4R79 A;  4L9N A;  4EJW A;  4YII A;  1R1U A;  1Z05 A;  1ZAR A;  4AIJ A;  3M8F A;  3TO7 A;  3M1E A;  3CJN A;  1TW3 A;  3FZV A;  1EV7 A;  4HLX A;  4WX9 A;  2YR2 A;  5ICF A;  2EV6 A;  3ZN0 A;  1EH6 A;  3GFM A;  4KYW A;  4UVC A;  1J5Y A;  1K7A A;  3HRS A;  2HQN A;  3SQN A;  2RN7 A;  2F5E A;  1I27 A;  2L4M A;  3U2R A;  4L18 B;  3I5U A;  3BPV A;  4ETS A;  1QZY A;  2IRF G;  1O3T A;  2IA0 A;  4KIC A;  3C7J A;  3GXO A;  2ZXJ A;  4BXU A;  2XAH A;  1ZH5 A;  5FFZ A;  1T38 A;  2CQK A;  2LKP A;  5E20 A;  5CVV A;  2QWW A;  3V7R A;  2DU9 A;  2RVC A;  1HKS A;  3IKV A;  2JPB A;  3I59 B;  2A61 A;  2XKP A;  5E8I A;  2J5O A;  1J7K A;  2IJL A;  1RUO A;  4XLN F;  5DCF A;  3Q5F A;  4KIF A;  3GZ6 A;  4HV5 A;  1R36 A;  3KP7 A;  4U7D A;  1MJB A;  3LQQ A;  3KLO A;  4CIC A;  1G3W A;  1U78 A;  2IVM A;  2BYV E;  3WOD F;  2A5Y B;  1FP2 A;  2M30 A;  3WG9 A;  5LEJ A;  5FLX Z;  4I2O A;  5CVI A;  5HS7 A;  3KE2 A;  2LF7 A;  2ZBK A;  4L9J A;  3WGI A;  2RKH A;  5CVU A;  4AIH A;  2GZW A;  2NS0 A;  4ENK A;  4HQE A;  5FLX K;  1KGS A;  1YO5 C;  2Z99 A;  2HYF A;  1ZG3 A;  3M8E A;  4ZYH A;  5HS8 A;  4IXA A;  2O6G E;  1Z91 A;  4I02 A;  5HDK A;  2JRT A;  4RB1 A;  2F5F A;  3COA C;  1BJA A;  2J5P A;  5FD5 A;  2FU4 A;  5KVR A;  5FD6 A;  3ROU A;  2V1D A;  1FWZ A;  5DUI A;  2M45 A;  4FX4 A;  3KP3 A;  4RB0 A;  1ZG5 A;  1BC8 C;  1FOK A;  4WWC A;  2CFX A;  2Z33 A;  3U9G A;  3K69 A;  2YSR A;  2VOD A;  1B4A A;  1L3L A;  5HVQ C;  4HOB A;  3HRU A;  2IP2 A;  3G73 A;  4LD5 A;  4NHJ A;  1ONV A;  2VBW A;  4KA4 A;  1TBX A;  2W57 A;  5H6Q A;  1WWX A;  4CZZ A;  5ILU A;  2AXL A;  3LWF A;  4LJZ F;  1J0R A;  2P5L C;  1P6R A;  1ZLJ A;  4MQV A;  5LGT A;  2VC1 A;  4RGR A;  4A0X A;  2P6S A;  1J9I A;  3K0L A;  3HSR A;  4U0V A;  2HKO A;  2XAS A;  1O3S A;  5DCM B;  4CDG A;  3KZY A;  4G94 A;  5F64 A;  4ZH4 F;  2L54 A;  3KP5 A;  2M1B A;  2FQ3 A;  3EET A;  2DW4 A;  1L0O C;  1U2W A;  2FRH A;  4BH9 A;  3I59 A;  1JHF A;  3HYI A;  4G7Z F;  3L00 A;  3E97 A;  1FPQ A;  4LMY A;  1IN8 A;  1HBX G;  1XGS A;  4I09 A;  1OYW A;  2YX7 A;  4HF2 A;  3JSP A;  2RGV A;  4MTE A;  1YQA A;  3RYP A;  3TOB A;  3I53 A;  4ENJ A;  2X0L A;  3Q9S A;  3QP5 A;  1K6O A;  2KIU A;  4IRH A;  3IKT A;  5HDG A;  2L3D A;  4CHU A;  2WC2 A;  1IXS B;  2VC0 A;  3HHG A;  1BN5 A;  3V8L A;  3ZN1 A;  2DLL A;  4JQF A;  1IZ1 A;  2QLZ A;  3GEZ A;  1FY7 A;  1QGP A;  3DQV C;  3E3V A;  3HIF A;  2V1X A;  5ICG A;  4AIK A;  1YW7 A;  1F1Z A;  1I5Z A;  3KET A;  2PN6 A;  2ESH A;  2VOP A;  5BQT A;  3CDH A;  4L5J A;  4GCV A;  2O0Y A;  1F4K A;  1S3J A;  2HS5 A;  3CO6 C;  2QQ9 A;  3VFZ A;  2ZME A;  4I98 B;  2ISY A;  2CWE A;  3DV8 A;  4XSX F;  3HSF A;  4KUM A;  4LG0 B;  4MEY F;  4DNC A;  5K5R A;  1YW8 A;  2QVO A;  4KNY A;  3JAM Z;  4M9Z A;  3BPX A;  1XN7 A;  1FLI A;  5A2Q K;  1Z1D A;  3R4K A;  4ENM A;  5CJ9 A;  2RV8 A;  2UXN A;  3BDD A;  1EH7 A;  1TNT A;  1HW5 A;  4PGG A;  1UST A;  2GWR A;  3D0S A;  1E2X A;  4NQW A;  3CUQ A;  2OQG A;  1UHM A;  2VT3 A;  1G3S A;  1QBJ A;  4S05 A;  4BQA A;  3DKW A;  4UXN A;  1MKM A;  1S6L A;  3FHZ A;  1B59 A;  5DYM A;  1WI9 A;  4Y13 A;  5IT9 Z;  1TQP A;  3B02 A;  4LK1 F;  1QPM A;  2CYY A;  5K5O A;  2AS5 F;  4YFX F;  1KU7 A;  2H27 A;  5DCM A;  3K1P A;  1TQI A;  4GGG A;  3E5Q A;  4N9I A;  2VE9 A;  2HFH A;  3OV8 A;  2EB7 A;  2V1U A;  1OR7 A;  3ISP A;  1BI0 A;  2ELH A;  1RUN A;  4CO8 A;  1OYY A;  1C0W A;  4G7H F;  3KCC A;  1ZAO A;  3EDP A;  2WV0 A;  4OU0 A;  1WSU A;  1GXQ A;  1CGP A;  2P5V A;  4I01 A;  2OD5 A;  4QWQ A;  1K79 A;  3QPT A;  4HDV A;  5LGU A;  2FEZ A;  4Y17 A;  5LEK A;  1FC3 A;  5D6E A;  2L01 A;  1XGN A;  4M71 A;  3K1N A;  1QZZ A;  1YTY A;  3RDI A;  3GW2 A;  2M87 A;  1WQ2 A;  4OMZ A;  2BBY A;  3MZH A;  5JHU A;  5CVJ A;  3WE3 A;  3FXQ A;  4EQQ A;  2K86 A;  1SD6 A;  3H3Z A;  2P8T A;  1PUE E;  2W84 A;  2DPU A;  2HTJ A;  4KMF A;  3L9F A;  4MEX F;  3RKW A;  1DDN A;  3NRV A;  2XRO A;  4RS8 A;  3L09 A;  1UHW A;  1RNL A;  3LAP A;  4E70 A;  5K1Y A;  1T2K A;  4EJT A;  4EJU A;  5LRS A;  1HKT A;  1V3F A;  2BV6 A;  4DQ2 A;  2PJP A;  3ML6 A;  1IF1 A;  2E1N A;  1WRJ A;  3FX3 A;  3J7A O;  3F8M A;  1MD0 A;  1UFM A;  1XDU A;  2VT2 A;  4LK0 F;  2DQL A;  2VE8 A;  2QUF A;  2HEO A;  4D0P A;  1UB9 A;  3QRF F;  3K1M A;  5D5X B;  5E18 F;  1O3R A;  3F21 A;  2G7H A;  2PEX A;  5J8F A;  1RIO H;  2XAG A;  4R8H A;  2E7X A;  3PFI A;  5CLS A;  4ESF A;  4FHT A;  4HBL A;  2XIG A;  4RB3 C;  4HA8 A;  2WTE A;  4HYE A;  4BAY A;  1IXR C;  1ZG1 A;  3D5L A;  1IRG A;  4KN7 X;  5HOO A;  1LEA A;  4EV0 A;  4EM1 A;  2F5C A;  3HTS B;  2O8X A;  3WTU C;  2YX4 A;  1W4M A;  1YG2 A;  3RPU A;  2PI0 A;  2G9W A;  2EJR A;  2FBH A;  1BI3 A;  4O6J A;  5F1R A;  1SFU A;  4A2U A;  4MHG A;  4ZZL A;  3R61 A;  1YYV A;  5LGN A;  1P2F A;  2K02 A;  1IN5 A;  2KRF A;  2KJB A;  1G6N A;  3WTY C;  1LEB A;  6PAX A;  5H20 A;  4ZYD A;  1IW7 F;  2IA1 A;  1IN7 A;  1R58 A;  2B0L A;  2HYG D;  2JTV A;  3LQR A;  2FNA A;  5J6X A;  5IT9 K;  3L7W A;  4YIF A;  2W25 A;  1ON1 A;  4MTD A;  2ZCW A;  3VB2 A;  1U5T C;  2PMU A;  2EFQ A;  3E5X A;  3C3W A;  1FNN A;  4QLC U;  2FF4 A;  1U5T B;  1R7J A;  1OMI A;  2PG4 A;  1D3Y A;  3DPT A;  5BMZ A;  1R5H A;  1S29 A;  5E1Z B;  3V7C A;  1LNW A;  4GYG A;  2Q2E A;  4P5O A;  1S8N A;  4RB2 C;  3F3X A;  3J80 Z;  4GO1 A;  4AD9 A;  2FBI A;  3FMS A;  3HOT A;  1F5T A;  4UHT A;  2WWY A;  3R0A A;  5D8K B;  5L3E A;  1B1B A;  2LNB A;  5J8C A;  4A12 A;  2YPR A;  3GFJ A;  1DPR A;  1XSX A;  1TLH B;  2GA1 A;  3L2C A;  4G9Y A;  1YW9 A;  1ODD A;  4F7Z A;  3CUO A;  2HTS A;  1U5T A;  2DAO A;  2Y0M A;  1W5T A;  1AOY A;  1XGM A;  5ED4 A;  2VBY A;  2Z5U A;  5K5Q A;  2FMY A;  2V9V A;  2VBX A;  3GFL A;  5BPD A;  3GO5 A;  5IT3 A;  4TV7 A;  2LDU A;  1BM9 A;  5DDG A;  4RGU A;  3WU0 A;  1G4D A;  1TTY A;  1HW2 A;  1KA8 A;  1XMK A;  4OOI A;  1FP1 D;  1IUY A;  3FXU A;  1KYZ A;  2STT A;  4OIR F;  3W6J B;  5EEH A;  2NNN A;  2ACJ A;  3C18 A;  1FBU A;  4UV8 A;  4UNO A;  4BHB A;  4WXH A;  2RC4 A;  2E1C A;  3BP8 A;  5AON A;  2BGC A;  5D4S A;  4YG2 F;  3FF5 A;  1W7P A;  4OIO F;  1ZRE A;  1LVA A;  3LST A;  3R0J A;  1BIB A;  1IN4 A;  3DXJ F;  1XCV A;  1ZN2 A;  3F8F A;  5FO5 A;  2ESN A;  3T5X A;  5EEG A;  2DTR A;  2W24 A;  4ENN A;  3N97 A;  5D8L B;  4CXF A;  2GXB A;  3Q9V A;  2EFO A;  1U3E M;  1KU2 A;  3PQJ A;  1PP7 U;  3E6D A;  2P6T A;  2XAF A;  3IL2 A;  2O3F A;  3H3U A;  2QM3 A;  4L0Z B;  1XSV A;  3DFG A;  4L9T A;  5JI6 A;  2D45 A;  3DEU A;  4U88 A;  1J59 A;  3EYY A;  2OBP A;  3ERE D;  3IC7 A;  2X4H A;  4A0Y A;  4LLN A;  2P7V B;  2ZNY A;  1BI1 A;  3RPQ A;  2EA2 A;  3BJ6 A;  1XDS A;  4G7O F;  2M5W A;  3KEQ A;  4ESB A;  4I0A A;  2STW A;  3WGH A;  2MA3 A;  4U0W A;  4Q5S F;  1FSH A;  3F8N A;  4HQM A;  1JGS A;  3MAJ A;  1GXP A;  4HX7 A;  1DP7 P;  1FYL A;  4WCG A;  1IN6 A;  3IWF A;  2FE3 A;  5FFX A;  5JFR A;  4P96 A;  2IW5 A;  2ZFW A;  1XSD A;  1UCR A;  3HTU A;  3N4M A;  1REP C;  2XAJ A;  1J75 A;  3IHU A;  4FX0 A;  4AVP A;  2L02 A;  2OQR A;  1R1V A;  3FMQ A;  1W7P B;  4AWX B;  3C1D A;  2HGC A;  1P4X A;  1J2X A;  5LBQ A;  3K9T A;  2W85 A;  3BJO A;  4HZF A;  5ICC A;  2NYX A;  3MWM A;  3GFI A;  3GUD A;  4OMY A;  3M7G A;  4EGZ A;  1X3U A;  3EUH A;  1TQM A;  1KU3 A;  4YFK F;  4LLL A;  3O6B B;  5L3C A;  2Q8K A;  2K4J A;  2EV0 A;  4L5I A;  3F6O A;  4Y15 A;  2KKO A;  4IF4 A;  5LHG A;  4Q47 A;  4U7B A;  4A0Z A;  2A6E F;  1NHA A;  3P9K A;  1G3Y A;  3WU1 B;  3GVA A;  3KP4 A;  2CW0 F;  3ABU A;  2LF8 A;  1O7L A;  5DEQ A;  5D5V B;  3SZP A;  2RDP A; 
#chains in the Genus database with same CATH topology
 1O57 A;  1VQ4 I;  2BVM A;  3FWE A;  3WG7 H;  3J81 K;  5FJ8 J;  5JLW A;  3KZZ A;  4EJO A;  1ORK A;  2CGP A;  3KX2 A;  2Z9O A;  4NC8 A;  2L9S A;  3BOQ A;  1LFB A;  5EEA A;  5BS6 A;  2TCT A;  3TGN A;  4DYC A;  3QPH A;  3O3K A;  4U0Y A;  3GTQ J;  4BUP A;  3W2A A;  3VOE A;  3L2W A;  3ECO A;  4XLP F;  3BC8 A;  5ICE A;  4HF1 A;  3JTH A;  1RI7 A;  2NXN B;  2EIN H;  1JKR C;  5IP7 J;  3BTI A;  4YFN F;  2A3S A;  5IYD J;  3HGG A;  2P81 A;  5A2Q Z;  3ASN H;  2VON A;  4JX5 A;  3LA3 A;  4HW0 A;  4P9U A;  4ENJ A;  2D1V A;  3A0H C;  4XRF A;  3SJM A;  2UV1 A;  1QQI A;  2E7W A;  1JTY A;  5ERI A;  3RTR A;  3VEP A;  1JE8 A;  1WZ2 A;  3ZMU A;  1TWF J;  2BW3 A;  3CUQ C;  3JAM K;  4ASN A;  1ZRD A;  3S3N A;  3DU6 A;  2JPC A;  4I0B A;  5GAD J;  3PIP F;  2CU7 A;  4C30 A;  4CYC B;  3S2W A;  4JX6 A;  3H5R A;  2MYS A;  5DUK A;  5FRO A;  4O5V A;  3S1N J;  1JUM A;  4RGX A;  2LKS A;  4ESJ A;  1T98 A;  3LMM A;  5FKM A;  2IGM A;  3CTA A;  2NS8 A;  5E17 F;  5BNG A;  3QAH A;  3HGY A;  1P7I A;  5EGO B;  1D1C A;  4AU7 A;  2WAQ N;  1ULY A;  1A6Q A;  3Q0V A;  3I3L A;  4PSW A;  1BIA A;  3S15 J;  4BHC A;  1D0Y A;  3QU3 A;  2MLK A;  3PJR A;  3CCV I;  2M4K A;  1FX7 A;  4P9F A;  2CUJ A;  2HR3 A;  1SFE A;  4LG3 A;  2V4J C;  2LVS A;  2OPT A;  2W82 A;  5D6F A;  2H09 A;  5J3L A;  3KLN A;  1DUX C;  2Q1Z B;  1Z77 A;  3TBI A;  4WF2 A;  4PJN A;  1BW5 A;  1TZL A;  3QOE A;  5K7H A;  2CRG A;  3WTX C;  1MBK A;  4IHY A;  3QP6 A;  1MZB A;  3JCU C;  2LTP A;  1ZR2 A;  2R5Y A;  1Q1V A;  2VBZ A;  1SMT A;  1B9N A;  4NBQ A;  4BXX J;  1RZ4 A;  1B9M A;  1MMG A;  2XB0 X;  2HOE A;  3ZQI A;  3DLA A;  3HJE A;  3ZMV A;  2DA4 A;  4B48 A;  1HXD A;  2COB A;  2DT7 B;  3TP3 A;  1GT0 C;  1O3Q A;  4H4K C;  4O3M A;  3OYF A;  2CH0 A;  4CCN A;  4IPA A;  4LIU A;  1Y6I A;  3MMY B;  3W2V A;  5CVR A;  5E8G A;  2PJR B;  4EVI A;  2BY1 A;  4GXO A;  4KFC A;  2W4S A;  2W1O A;  3WTW C;  4E7H A;  1T08 B;  1TC3 C;  2DMN A;  4YEJ A;  5HLI A;  3BRO A;  5F1J A;  1B8I B;  4FE4 A;  2FNP A;  2ZKZ A;  3BR1 A;  2JSC A;  4E6K G;  3ZMD A;  4A5N A;  5CPR B;  3DPL C;  5IOZ A;  2OZ6 A;  3HDD A;  4A3I J;  3TW6 A;  2BHZ A;  1RES A;  2H94 A;  2ETH A;  4HF0 A;  3EQL F;  3F72 A;  5KCM A;  2OAZ A;  4LGW A;  1XPX A;  2DFI A;  1I3Q J;  2MD5 A;  2OU2 A;  1Z7U A;  2NVU B;  5JVT A;  4S04 A;  4MNU A;  4IRG A;  1BJZ A;  2AXT C;  1Z9C A;  2KHM A;  4C9Y A;  1SFX A;  3GTL J;  5LHH A;  1MSF C;  2X6X A;  4G6Q A;  2A05 A;  3TOA A;  1Y8Q B;  4JK1 X;  1MDM A;  3TMO A;  2M7B A;  4NC7 A;  3R6S A;  4F52 A;  2YU9 J;  3F8B A;  2E1M C;  3V8K A;  3LAJ A;  4DIQ A;  1VFC A;  2QQA A;  3I64 A;  3F22 A;  3FM3 A;  4D5C A;  2R93 J;  4BYY A;  1SAN A;  2R7X A;  1UEL B;  4EM0 B;  1BA5 A;  1T39 A;  1I1G A;  5BOX A;  2D1H A;  2COM A;  3IH4 A;  2GBY A;  3E6M A;  5KNL A;  1K6Y A;  2HXI A;  1K78 B;  3K7A J;  1QA6 A;  1ZLK A;  3HHH A;  2K7L A;  2JVH A;  1YLF A;  3CDL A;  4LFU A;  2WAF A;  3ZR8 X;  3ZP5 A;  1DPU A;  4BU2 A;  5D5W B;  3JW4 A;  1WKM A;  2HDW A;  2NAZ A;  1ZYR F;  1FSE A;  1V4R A;  5GTI C;  1D5V A;  2R3S A;  2KZV A;  3B6A A;  3KPH A;  4BDY A;  2H6C A;  2ZB9 A;  2F2E A;  1S7O A;  3A03 A;  4LB6 B;  1XB4 A;  3I0T A;  1A36 A;  2WY8 Q;  2CW7 A;  5LRR A;  3OSG A;  3RZO J;  2XHK A;  5HLH A;  4RAF A;  4UUS A;  2A69 F;  4XRM A;  4PCQ A;  1MMA A;  2BZT A;  3OR2 C;  3ULQ B;  2CUZ A;  3QPL A;  3VSL A;  4CCK A;  4DBR A;  4BE1 A;  3PNV A;  4M72 A;  3QOD A;  3RKY A;  3VYS B;  5L3G A;  1X2N A;  5F08 A;  3DU5 A;  3PNY A;  4Q48 A;  1HW1 A;  1YIJ I;  2EK5 A;  1R71 A;  3HB9 A;  1IRF A;  2HNH A;  3SZT A;  1R4M B;  4ZDL A;  1GVJ A;  3TDZ C;  3IWZ A;  2R7U A;  5L3B A;  2IT0 A;  2QYO A;  4RLQ A;  4IKF A;  2GXG A;  2MC4 A;  2CW8 A;  2IGK A;  2MGQ A;  3QU6 A;  2HVS A;  1Z6R A;  3P7N A;  3GX4 X;  4ITV A;  1STZ A;  1XG1 A;  2NOG A;  2IGO A;  1WJE A;  4C3I J;  4RAY A;  2E5N A;  2JT1 A;  2EFP A;  4E7Z A;  2HVQ A;  3TO9 A;  4UUS B;  3FKI J;  1BW6 A;  3DF8 A;  2CO5 A;  4CGZ A;  2LY2 A;  1KYW A;  4M3D A;  4XRS G;  3P9C A;  5C4J J;  2B7E A;  2MBF A;  5HDN A;  3W6K B;  3S1R J;  1N77 A;  2XRN A;  2DO7 A;  3MKY B;  3H9Q A;  1LB2 A;  2EQR A;  1LDJ A;  1ZHF A;  4HST A;  3VYU B;  3KEO A;  4IX7 A;  4M6Y A;  3TKY A;  1NG7 A;  3F8C A;  2E36 A;  3MEX A;  3KFW X;  3DPU A;  5BPI A;  1R9T J;  2DPD A;  4L9V A;  4V2G A;  4A6E A;  2QA4 I;  1G3T A;  1S72 I;  2OZU A;  2MAB A;  3PNT A;  3OOP A;  5K7Z A;  2VJ5 A;  2ZXW H;  3G3Z A;  4H0E A;  1AA7 A;  4A3C J;  1A04 A;  4DYQ A;  3UNG C;  2MH2 A;  2XRL A;  1Q1H A;  2DJI A;  2QKL B;  2EIJ H;  2X51 A;  2NOJ B;  3J81 Z;  2Q0O A;  4IEJ A;  4QPO A;  2LR8 A;  1Y0N A;  2D2W A;  2V79 A;  4B47 A;  2EFW A;  4GYI A;  1R00 A;  3CP2 A;  4XMY A;  4D9J A;  4IHT A;  1A5J A;  1D8J A;  4N9H A;  2DA6 A;  3X2Q H;  2W48 A;  2V6E A;  4CCO A;  1IV6 A;  3OS1 A;  2CMP A;  2UUZ A;  5L3F A;  5JLX A;  4HLY A;  4OAZ A;  3AG3 H;  3I54 A;  3RI4 A;  2KIM A;  5ILV A;  3LA2 A;  3SHF A;  1HQC A;  2MFZ A;  1JGG A;  1SD7 A;  1E0E A;  3E6B A;  1OPC A;  3EUA A;  1TWA J;  2VQC A;  2QEX I;  3CCY A;  2M8E A;  4HSR A;  4MFE A;  1U8R A;  1JHH A;  3E5U A;  1P7J A;  1ZRF A;  3AL0 C;  1FT9 A;  1CF7 A;  1RC9 A;  3I71 A;  2PFB A;  1LQ1 A;  2IPQ X;  2K27 A;  3CQZ J;  5DD8 A;  4ANJ A;  3VOD A;  4NQW B;  3CLO A;  2PX9 A;  3CF2 A;  1X4P A;  1ZEL A;  2FSW A;  3B73 A;  3ZGK A;  4X1E A;  3CMY A;  4ZDP A;  1N78 A;  1HST A;  2X1C A;  1AWC A;  2G7U A;  4RM3 A;  1FOX A;  2F5D A;  1H89 C;  2EIL H;  1T6S A;  4HV6 A;  1W0T A;  2EFN A;  2ZJ2 A;  1BOA A;  2F6C A;  2LOO A;  2ZJQ F;  3K4B A;  5EGO A;  1SAX A;  3HSE A;  4QIW N;  2NS7 A;  3WTV C;  1E3P A;  3F23 A;  4M9S A;  5H2F C;  3LL7 A;  4IJA A;  4KIT B;  2WAE A;  3M4O J;  3AG1 H;  1U9N A;  3K2Z A;  5ILS A;  4OIN F;  2RNJ A;  1Z67 A;  3T8T A;  1JKP C;  4M6V A;  1PP8 F;  3MVP A;  1RR8 C;  2LBF A;  5M3F J;  2XF7 A;  2W00 A;  2VN2 A;  4BJ6 C;  2E1O A;  2ZC2 A;  4KDP A;  2V6C A;  1DP3 A;  2KDZ A;  4EMS A;  5TRD A;  4CYC A;  1ZK8 A;  3BTJ A;  2QSH X;  2LH9 A;  3H92 A;  2EZL A;  1HKQ A;  2DOA A;  3BWG A;  1YE9 A;  3AFH A;  3HXL A;  4M3G A;  2XGX A;  4MGR A;  2E19 A;  3U1D A;  2DK8 A;  1ON2 A;  1W5C C;  1LFU P;  2HDC A;  2XGE A;  1ZQ3 P;  3HOS A;  1D0X A;  1Y56 A;  3TO6 A;  1GV2 A;  4IHV A;  3OS0 A;  1LDK B;  3FBI B;  3AKZ A;  4IHS A;  2CG4 A;  3QYE A;  2DQR A;  1FZP B;  2ADU A;  4AID A;  2C6Y A;  4RGS A;  4JBA A;  1KU9 A;  4A6D A;  2EV5 A;  4ZTF A;  4F91 B;  4PDK A;  3GF2 A;  4AM3 A;  1LPQ A;  2P4W A;  5KK1 A;  3BLY A;  1FIA A;  3SXY A;  2R7F A;  4M9X A;  2QZ8 A;  4KMU X;  5F6F A;  4DZJ A;  3VDX A;  2TDX A;  1USS A;  4XQF A;  2ZME B;  2BHY A;  1YS7 A;  2CUF A;  1VQN I;  5J4Y A;  2WB1 N;  5HLG A;  1U0J A;  3G4S I;  1KQ8 A;  3V4G A;  1XGO A;  2OC6 A;  1MIJ A;  4CH7 A;  3ELK A;  2JJ7 A;  1EH8 A;  2Z3Y A;  2GAU A;  1ENH A;  4OIQ F;  1IC8 A;  2Y48 A;  3V8J A;  2DA5 A;  1OIS A;  4B44 A;  3WE2 A;  2QSG X;  4FIS A;  3MCZ A;  4M73 A;  5EJC A;  1YRN B;  1GDT A;  4AC0 A;  4PJJ A;  3JSO A;  2O61 A;  4E7K A;  2A07 F;  2X6Y A;  4B1R A;  3K70 D;  1LJ9 A;  1V55 H;  4KIB A;  1HLV A;  1ZRC A;  3RIR A;  3HRT A;  4OIP F;  1SD4 A;  1FYM A;  1FBS A;  2KMU A;  4CCJ A;  2OA4 A;  2DOF A;  1FJL A;  3HUG A;  1YJN I;  2IA2 A;  2IS2 A;  5AIQ A;  4Z6Y A;  3PL8 A;  3CCS I;  3MQ0 A;  4HX8 A;  4M3B A;  2KIF A;  3CD6 I;  4ZJZ A;  4C2U A;  3LSH A;  4BS9 A;  4LIV A;  3BZ6 A;  4HEA 2;  3UR3 C;  1GHC A;  3G2B A;  4M6X A;  4XOT A;  2Q2E B;  1MBE A;  3LSM A;  4XSZ F;  4F93 B;  2K9Q A;  1X1B A;  1H9T A;  4FT8 A;  1AKH B;  2PBI A;  3LFK A;  3H1C A;  2DFF A;  2PJR A;  3WGG A;  5E1W A;  3DEE A;  2M7A A;  1BI2 A;  1O7F A;  4PFP A;  3ZQ7 A;  3BY6 A;  4XLA A;  5M5W J;  4D5F A;  1H0M A;  2PMZ N;  2XVC A;  2L7F P;  3A4C A;  4HX4 A;  4D7N A;  1QVT A;  3GZ5 A;  2KRH A;  1XCB A;  1HA8 A;  2A68 F;  1IRX A;  1YIO A;  2RQP A;  5J1U A;  5K7F A;  2Y75 A;  4L0Y B;  1OCO H;  4BY7 J;  3SEZ A;  3JRB A;  1R5G A;  4C2M J;  1DGR M;  2ELJ A;  3ZOB A;  4A93 J;  1UJ8 A;  3IRR A;  1P4W A;  2EWN A;  2ZJR F;  2K40 A;  2DDB A;  2LSO A;  4RM2 A;  3LA7 A;  2DI3 A;  1BC7 C;  4BE2 A;  1WJC A;  4BHP A;  2CV0 A;  1U6G A;  5D4R A;  1WGX A;  1IV8 A;  4KN4 X;  4OAY A;  2VXZ A;  2VQL A;  1R23 A;  1GLN A;  4RAZ A;  2PLY A;  3S17 J;  3CCM I;  3PSI A;  4BY1 J;  5IYC J;  2CQQ A;  5GAG J;  4JOM A;  2R7O A;  2DCE A;  2L9N A;  3I4P A;  4UUT A;  4HNV A;  5HLT A;  1R1T A;  1WJF A;  2KQR A;  3BJA A;  3T8R A;  4M74 A;  5DM6 F;  4I7H A;  3H36 A;  4MQ9 F;  5E79 C;  2GIV A;  2VQH A;  4DGW B;  5GTH C;  1SVM A;  3TW7 A;  2L9V A;  1T0F A;  5E1X A;  4K2E A;  3BR2 A;  5CQG A;  2ZO4 A;  1KQ9 A;  1Z3Y A;  3GME A;  4NB5 A;  2GQQ A;  4F3Q A;  4UVB A;  1YS6 A;  4ZYE A;  3D5S C;  3WTS C;  4IOC F;  3NEU A;  4ON0 A;  1POG A;  1SMY F;  2DBB A;  2LKX A;  3DBH B;  3MZY A;  1Y39 A;  1I50 J;  2VOO A;  4P55 A;  3S1M J;  1XD7 A;  5DS9 A;  1MBF A;  1BOB A;  3E0J B;  2VAS A;  2PMH A;  3TP0 A;  1XS9 A;  1FBQ A;  1FOY A;  1S7A A;  2CQN A;  3HRM A;  3QQA A;  2P7C B;  2EH3 A;  2VXD A;  2QBY B;  1P92 A;  2JA5 J;  3TDU C;  2FJ1 A;  5GP9 A;  1BBY A;  2EPF A;  2V7F A;  3DP7 A;  2A6H F;  1QNT A;  4KT5 C;  3SFZ A;  4XOR A;  5DV5 A;  4IRI A;  1X3Z B;  4NDL A;  1VZ0 A;  4XLF A;  4ZYA A;  4RDU A;  1QO0 D;  2KJC A;  2XUB A;  4HAM A;  4CA0 A;  4CCL A;  3L1P A;  4EGY A;  3R60 A;  2LY1 A;  2JK3 A;  4DJA A;  3J7Y J;  2O9L A;  4C2T A;  1ZGA A;  2UWM A;  2ZNZ A;  3OYC A;  2HDD A;  2E60 A;  4EM2 A;  1B72 A;  3DTK A;  2VKE A;  5C4X J;  1Y0U A;  2MC3 A;  4UUV A;  4XN0 A;  5HS9 A;  2FX0 A;  5F0H A;  4A5M A;  1MBG A;  3HM5 A;  4PSX A;  4YIR X;  2BE5 F;  3FM5 A;  4N0B A;  2LFB A;  2NRA C;  2LG4 A;  3WU2 C;  5LHI A;  2HOT A;  2DT5 A;  3J80 K;  2AQF A;  3A01 A;  2YU3 A;  2XAQ A;  1YJW I;  4PGH A;  4Q4Z F;  2KP6 A;  2DA1 A;  4KIG A;  3I56 I;  3CUQ B;  2R7D A;  3SEQ A;  5JR3 A;  1R22 A;  1F36 A;  5FKK A;  3W2W A;  1NTC A;  4IVN A;  2JA6 J;  4Z2Y A;  3WHC A;  1G59 A;  1PDN C;  3JR9 A;  3F6V A;  4DOZ A;  4MFD A;  3RQ4 A;  3MFK A;  3DBR B;  2H6B A;  3HOX J;  4PK4 A;  3EYI A;  1LVK A;  4F92 B;  1Y1W J;  3GWZ A;  1WJD A;  4A3M J;  1N25 A;  3SDG A;  3KYC B;  1U8B A;  4J00 A;  1ZGJ A;  2CSO A;  2EA4 A;  3P9I A;  2XPV A;  1B6A A;  1TW2 A;  5L3D A;  2WV1 A;  5FGM A;  3IRQ A;  4UV9 A;  5AIP A;  2MH9 A;  2K4B A;  4G8X A;  5TIS C;  3REO A;  1IRZ A;  2I10 A;  1F9N A;  3N05 A;  1KZH A;  2WAD A;  1ETW A;  5EG0 B;  1VQ8 I;  4E7L A;  3GTM J;  4XIC A;  4YEL A;  4WXC A;  1YX3 A;  4XON A;  2H8W A;  1MMD A;  3WTZ A;  2GA2 A;  3VWB A;  2XKO A;  2XB5 A;  4HG2 A;  2L4A A;  1OKR A;  1DU6 A;  2KL4 A;  3ZPL A;  3FMR A;  2W7N A;  1X2M A;  3OWT A;  4P1W A;  4E7I A;  2R5Y B;  2B9S A;  3ECH A;  2ISZ A;  3CO7 C;  1OYI A;  1MGT A;  4Y3O A;  3FHN A;  3V7S A;  2O8K A;  1K78 A;  4ZZD A;  3IH3 A;  1X1P A;  1H9G A;  2DN0 A;  3K70 C;  4LB5 A;  3CP8 A;  3CMA I;  2P5K A;  1FIP A;  3FXO A;  2F4M B;  4EJV A;  2JWT A;  3C2B A;  5TJJ A;  3ZMZ A;  1WHU A;  4ZYG A;  2R7Q A;  3T0Y A;  1LDD A;  5EDN A;  4HNT A;  4R1H A;  3ZMS A;  3ZMT A;  5LLQ A;  3QYB A;  5DD4 A;  2H1L A;  3DBL B;  3GBG A;  1WJ5 A;  1X1C A;  5FB2 A;  1MNM C;  3RJP A;  4E7S A;  5D5U B;  3G1M A;  3F9K A;  3K4K A;  2MW8 A;  4I76 A;  3LSJ A;  4LLG F;  1TWC J;  1HSJ A;  2FBK A;  2EZI A;  3VPR A;  1JTX A;  4PFO A;  4U87 A;  3OYB A;  2QBY A;  3GLX A;  1E17 A;  2FA5 A;  2OF7 A;  1MDM B;  1H8A C;  4XLE A;  1VTN C;  1I1S A;  3BZK A;  3OY9 A;  4HRI A;  2FML A;  1I6X A;  1P4A A;  2MSY A;  3LSG A;  4IHX A;  1W5S A;  2FXA A;  2QKM B;  2CS3 A;  5GPA A;  4WXD A;  4FTH A;  1W7P D;  2HKX A;  5F27 A;  5H6R A;  2UZK A;  3M9A A;  1RET A;  3S2D J;  1Z6T A;  4G6D A;  3RYR A;  3HOU J;  2JA8 J;  2NVT J;  3CZ6 A;  3HBL A;  2VIX A;  1TNS A;  3QOP A;  3RKX A;  1JUS A;  3FK7 A;  2O7O A;  1YFH A;  3NQO A;  1XMA A;  2DK5 A;  5IP6 A;  2BY3 A;  2JZY A;  3NAR A;  1MJ9 A;  4UVA A;  3AG2 H;  2K9L A;  1UMQ A;  4XK4 A;  2KRC A;  5KAI C;  3HKZ A;  4FET A;  1X1A A;  3AAF A;  2UXX A;  1IXC A;  2MLG A;  2R4G A;  2DT6 A;  4XBF A;  4B8X A;  3DEW A;  2R7T A;  3KP2 A;  1OR7 C;  4EEF G;  2NNY A;  3JTG A;  2HZT A;  2XV4 S;  1HDP A;  1MH3 A;  3TQN A;  2HWV A;  3ZQC A;  1WCM J;  3PO2 J;  1ETO A;  3P5J A;  4PZJ A;  2FOK A;  3I58 A;  3WTT C;  2QQB A;  4LG0 A;  2QEN A;  1SD5 A;  4CYD A;  1PUF B;  1FYK A;  2Y0S N;  2HQR A;  1CF7 B;  2PQ8 A;  5CYV A;  3FXR A;  2DMT A;  4WK8 F;  4XRS A;  3L2U A;  2VUM J;  1V54 H;  2E34 A;  1D8K A;  4BNC A;  2R7V A;  1IGN A;  2X48 A;  4B09 A;  2IXS A;  2OUM A;  1UZC A;  1IUF A;  4JYK A;  2BEO A;  2HPM A;  2LP0 A;  2OTJ I;  3KP6 A;  3O2P E;  3ABT A;  1KQ0 A;  3GYH X;  2VKV A;  3T1B A;  3GTJ J;  3PQK A;  4HDU A;  1F43 A;  5EF6 A;  3OYD A;  1FTT A;  2O03 A;  3IV5 A;  5M5X J;  1JUP A;  1MJA A;  3E6C C;  1IAW A;  3HPG A;  3OYI A;  4R79 A;  4L9N A;  1WVR A;  4EJW A;  4YII A;  2ECC A;  3JRD A;  1R1U A;  1Z05 A;  1ZAR A;  2OTL I;  4AIJ A;  3CMM A;  3IAM 2;  3M8F A;  5IY5 H;  3TO7 A;  1E3O C;  4XKV A;  3M1E A;  3CJN A;  1TW3 A;  3FZV A;  3KZI C;  2JSP A;  5J40 A;  2CFO A;  3SFI A;  2OCE A;  1EV7 A;  1IJW C;  2DDA A;  2EZH A;  4HLX A;  3OYJ A;  4WX9 A;  2YR2 A;  5ICF A;  3MD2 A;  2EV6 A;  1PJR A;  3G1L A;  3ZN0 A;  1EH6 A;  3GFM A;  3PUB A;  3FK6 A;  1RKT A;  4KYW A;  4UVC A;  1J5Y A;  1NH3 A;  4IHW A;  2FUG 2;  2O5R A;  1K7A A;  1ETV A;  3HRS A;  5HNH A;  2HQN A;  2CV1 A;  3SQN A;  2RN7 A;  2F5E A;  1I27 A;  4BJT A;  2L7M P;  2L4M A;  1T8I A;  1OFC X;  3TL4 X;  3U2R A;  2P0W A;  1IO2 A;  4L18 B;  4BJ5 C;  2Y9Z A;  3OL4 A;  2Y69 H;  3I5U A;  4A69 C;  3BPV A;  4ETS A;  3I4M J;  1QZY A;  2WA0 A;  3LSI A;  2IRF G;  1O3T A;  2IA0 A;  4ZTJ A;  2Z2S B;  1EA3 A;  1MMN A;  4XKC A;  5IP9 J;  1LFP A;  4KIC A;  4Y7N J;  3JRE A;  2VL8 A;  3C7J A;  3GXO A;  2Y31 A;  2ZXJ A;  2HQA A;  4BXU A;  2XAH A;  1ZH5 A;  5FFZ A;  3GTG J;  4X0G A;  2L2O A;  2EIM H;  5LD2 C;  1T38 A;  2WBM A;  5E3L A;  2HI3 A;  1G2H A;  2CQK A;  2LKP A;  2LY9 A;  5E20 A;  3S1Q J;  5CVV A;  2QWW A;  3V7R A;  2DU9 A;  2RVC A;  3K10 A;  1HKS A;  5EYR A;  3UKG A;  3ONQ A;  3IKV A;  2M34 A;  2JPB A;  3I59 B;  2A61 A;  2XKP A;  5E8I A;  3RPU D;  3BZC A;  2J5O A;  1CQT A;  1J7K A;  2IJL A;  1RUO A;  1I3A A;  4XLN F;  5DCF A;  5M5Y J;  3Q5F A;  4KIF A;  3GZ6 A;  2GOM A;  1YX5 A;  4HV5 A;  1R36 A;  4BL0 B;  3KP7 A;  4W1U A;  2X85 A;  4U7D A;  1MJB A;  3LQQ A;  3KLO A;  2KFD A;  3GCM A;  4CIC A;  1G3W A;  4PJ0 C;  1U78 A;  1IG7 A;  3CCQ I;  4AVZ A;  3S8P A;  2IVM A;  2BYV E;  3WOD F;  1W36 D;  2A5Y B;  1FP2 A;  2M30 A;  3WG9 A;  5LEJ A;  2CQX A;  1V5E A;  3EUH C;  4KT6 A;  5FLX Z;  4IOA F;  4I2O A;  1OLT A;  5CVI A;  5HS7 A;  1IDZ A;  2R0Q C;  4AUX A;  3KE2 A;  3VYR B;  2LF7 A;  2ZBK A;  4L9J A;  3WGI A;  3OIO A;  2RKH A;  5M3M J;  2TRT A;  2IS4 A;  5CVU A;  4AIH A;  1ZKG A;  2GZW A;  2ICW G;  4PJM A;  2ZXI A;  2NS0 A;  3RSN A;  4ENK A;  4HQE A;  5FLX K;  1KGS A;  1YO5 C;  2VQG A;  2Z99 A;  5TGT A;  2HYF A;  4MLO A;  1ZG3 A;  3M8E A;  5EG0 A;  2BVL A;  4ZYH A;  5HS8 A;  3PSF A;  4IXA A;  3CES A;  4N4N B;  1X1D A;  3V42 A;  2O6G E;  4M3E A;  1Z91 A;  4I02 A;  5HDK A;  2JRT A;  2ZJP F;  4RB1 A;  5E3O A;  2F5F A;  3COA C;  3BG7 A;  1BJA A;  2J5P A;  5FD5 A;  2FU4 A;  5KVR A;  3ZQH A;  5FD6 A;  3ROU A;  2V1D A;  1FWZ A;  5DUI A;  2M45 A;  1MNE A;  4FX4 A;  2JA2 A;  3KP3 A;  4RB0 A;  1YI2 I;  3C2H A;  1ZG5 A;  3ASO H;  4LIT A;  4IZZ A;  1BC8 C;  1FOK A;  3O8H A;  4WWC A;  2CFX A;  2Z33 A;  3HOY J;  5JHF A;  4L5E A;  3U9G A;  2XGD A;  3K69 A;  2YSR A;  3NWT A;  2VOD A;  1B4A A;  2H8R A;  2ZFU A;  5C44 J;  3RQI A;  5HVQ C;  1L3L A;  1A6I A;  4XR6 A;  4HOB A;  3HRU A;  2IP2 A;  3G73 A;  1OJL A;  4LD5 A;  4NHJ A;  1ONV A;  2RAE A;  2VBW A;  4KA4 A;  2XF5 A;  1TBX A;  5KAF C;  3KIO A;  4AYB A;  2W57 A;  5H6Q A;  3GTO J;  2D5V A;  1WWX A;  4CZZ A;  5ILU A;  3A01 B;  2AXL A;  3LWF A;  2XPU A;  3OSF A;  4A3K J;  1WJA A;  3BT9 A;  1A31 A;  4LJZ F;  4BQO A;  2GXA A;  2NVQ J;  2LRE A;  1J0R A;  2P5L C;  1P6R A;  1ZLJ A;  1RPW A;  4MQV A;  5LGT A;  2VC1 A;  4RGR A;  1R6R A;  2LLK A;  4A0X A;  5B5E C;  2P6S A;  1J9I A;  3K0L A;  3HSR A;  4BGD A;  3FXK A;  2HU9 A;  2IBD A;  4U0V A;  3OYN A;  1ITY A;  1ERD A;  2HQ5 A;  2HKO A;  2WY7 Q;  2XAS A;  1V5G A;  1O3S A;  3W6V A;  3KYL A;  5DCM B;  4CDG A;  1OCR H;  3JRI A;  1AKH A;  3KZY A;  4G94 A;  5F64 A;  1FOW A;  2DXI A;  4ZH4 F;  2L54 A;  3KP5 A;  4BBS J;  2M1B A;  3S3M A;  2FQ3 A;  1M1E B;  3EET A;  4NNJ A;  2DW4 A;  1L0O C;  1U2W A;  3BTC A;  2F5V A;  2FRH A;  4BH9 A;  1MBJ A;  2KPM A;  3OYG A;  3I59 A;  2R5Z B;  1JHF A;  3HYI A;  4G7Z F;  1NG6 A;  3L00 A;  3E97 A;  1HF0 A;  1FPQ A;  4LMY A;  1IN8 A;  2F4I A;  4D1Q A;  1HBX G;  1XGS A;  3ABL H;  2IS6 A;  4I09 A;  2VJI A;  1OYW A;  2YX7 A;  3W3C A;  4HF2 A;  3JSP A;  1SEU A;  4M3F A;  2RGV A;  4MTE A;  3HPH A;  3J7Z I;  3EUK L;  3HUG B;  1VQ7 I;  1YQA A;  3QYF A;  3RYP A;  3TOB A;  3DKX A;  1XTA A;  3I53 A;  4GRI A;  4F55 A;  2X0L A;  3IAS 2;  3ERM A;  3VYT B;  2XSD C;  4BDZ A;  1D1A A;  3Q9S A;  5B66 C;  1DGW Y;  3GLL A;  3QP5 A;  4BBR J;  3I9V 2;  1MH4 A;  2KIU A;  4IRH A;  3IKT A;  5HDG A;  2L3D A;  1K6O A;  2GLO A;  4CHU A;  1HC8 A;  2DA3 A;  2WC2 A;  1B8I A;  1IXS B;  2VC0 A;  3HHG A;  1BN5 A;  3CCL I;  3V8L A;  2E2I J;  3ZN1 A;  2DLL A;  4JQF A;  2Z1D A;  2L7Z A;  1EKE A;  4QPQ A;  4RBO A;  1IZ1 A;  4QSH A;  2RQQ A;  1YOV B;  2VI6 A;  2QLZ A;  3GEZ A;  3MKW B;  1FY7 A;  3S3O A;  1QGP A;  3DQV C;  4A3E J;  3E3V A;  1BR2 A;  3HIF A;  3LSK A;  2V1X A;  2K3P A;  5ICG A;  4AIK A;  1SVL A;  1YW7 A;  1F1Z A;  1ZR4 A;  1I5Z A;  3KET A;  2PN6 A;  2ESH A;  2VOP A;  5BQT A;  3ESW B;  2XDV A;  4Y4R A;  1OCC H;  3CDH A;  1APL C;  2JA7 J;  4BXF A;  3FXM A;  2KLO A;  4L5J A;  4GCV A;  2O0Y A;  1F4K A;  4UB8 C;  1S3J A;  2HS5 A;  3CO6 C;  2E2H J;  2QQ9 A;  3VFZ A;  2ZME A;  4I98 B;  2ISY A;  2CWE A;  3DV8 A;  4XSX F;  1TP4 A;  4D7M A;  5HOD A;  5HNF A;  5E3M A;  3HSF A;  4KUM A;  4BAC A;  1U9O A;  1QPI A;  2QGU A;  4LG0 B;  4MEY F;  4DNC A;  1TT5 B;  4FAS D;  1R5I D;  5K5R A;  3K4N A;  1YW8 A;  3MKL A;  4XKB A;  1DQU A;  3IUO A;  2QVO A;  3JAM Z;  4KNY A;  1LUJ B;  4M9Z A;  2ME6 A;  3BPX A;  1I39 A;  2OV7 A;  1XN7 A;  3ABK H;  2DA2 A;  3H0D A;  3U21 A;  5A2Q K;  1FLI A;  1K61 A;  3CME I;  1Z1D A;  3R4K A;  4ENM A;  1JKQ C;  5CJ9 A;  4QTR A;  2RV8 A;  2K9N A;  4N4O B;  1S5L C;  4LOC A;  2UXN A;  3BDD A;  1EH7 A;  4XLC A;  1TNT A;  3TED A;  3S2H J;  1HW5 A;  4PGG A;  1UST A;  3VSK A;  2GWR A;  1LE8 A;  2NVY J;  3D0S A;  1TWH J;  1E2X A;  4NQW A;  3CUQ A;  2OQG A;  1UHM A;  2VT3 A;  2MD0 A;  2HZD A;  1G3S A;  1UHS A;  2ZSH B;  3OL3 A;  2DJN A;  2BY2 A;  2M4G A;  1YRN A;  2QCO A;  2VLA A;  4S05 A;  1SVO A;  3OIQ A;  1QBJ A;  2Y0S A;  2ZME C;  1NK3 P;  3OOU A;  3ZQQ A;  4FQG A;  4BQA A;  3DKW A;  1JI8 A;  1V5F A;  4CZC A;  5IYB J;  4S0H B;  4UXN A;  1MKM A;  4OWR B;  1XX5 A;  1T95 A;  4IL6 C;  1S6L A;  3FHZ A;  1B59 A;  5DYM A;  1WI9 A;  3PIO F;  4Y13 A;  5IT9 Z;  1TQP A;  1ETQ A;  3B02 A;  1VQM I;  5CQE A;  4LK1 F;  2DA7 A;  1QPM A;  1X19 A;  2CQ7 A;  2CYY A;  2XSJ C;  4CUG A;  5K5O A;  5FLV A;  2AS5 F;  4YFX F;  2FOW A;  5DCM A;  1KU7 A;  2H27 A;  3K1P A;  3CDI A;  1TQI A;  1FEX A;  3OYK A;  3S93 A;  2BY0 A;  1UG2 A;  4GGG A;  3E5Q A;  4N9I A;  1J09 A;  2VE9 A;  2VPL A;  4GDF A;  2HFH A;  3OV8 A;  3AG4 H;  2EB7 A;  2V1U A;  1OR7 A;  2EZK A;  3ISP A;  4XOP A;  2FD5 A;  3FIS A;  1BI0 A;  5FKL A;  1KON A;  1Y1V J;  1K4S A;  2ELH A;  1RUN A;  4CO8 A;  4E4H A;  1GUU A;  1OYY A;  3F0C A;  1C0W A;  4G7H F;  4NUB A;  3KCC A;  3HOZ J;  1ZAO A;  3EDP A;  3L2R A;  1SAU A;  2WV0 A;  4OU0 A;  1WSU A;  1GXQ A;  1WH7 A;  1CGP A;  2P5V A;  3Q0U A;  5F0C A;  1WJB A;  1OCZ H;  2CV2 A;  3DKY A;  2I5U A;  4I01 A;  1VQO I;  2OD5 A;  4QWQ A;  3ZXS A;  3DLL F;  3BG5 A;  4ZC3 A;  3C2G A;  2X1E A;  1QHH D;  1VF9 A;  3ABM H;  1W1W E;  3E7L A;  1I6H J;  1W0U A;  1K79 A;  3QPT A;  4HDV A;  1IDY A;  3CCU I;  2A5W A;  2F48 A;  3BR0 A;  5LGU A;  2FEZ A;  4UY8 I;  4Y17 A;  2JMW A;  1FMV A;  3Q0W A;  1VQ9 I;  3A2K A;  5LEK A;  1FC3 A;  5D6E A;  2L01 A;  1XGN A;  4M71 A;  3ZRG A;  3K1N A;  2YUS A;  4RA2 A;  3K2A A;  1QZZ A;  1YTY A;  2RRE A;  3PM1 A;  3RDI A;  2K85 A;  3BG6 A;  3S32 A;  3M3Y J;  3A0B C;  2X9D A;  3GW2 A;  2BXZ A;  2M87 A;  2X6W A;  1WQ2 A;  3OYL A;  4OMZ A;  5LFA A;  1DU0 A;  2BBY A;  3MZH A;  2Y9Y A;  4IQJ A;  1XC5 A;  1VND A;  3ZQF A;  4BQQ A;  5JHU A;  3PFY A;  5CVJ A;  3WE3 A;  2GIZ A;  3FXQ A;  1K4T A;  4EQQ A;  2K86 A;  1SD6 A;  3H3Z A;  2P8T A;  1PUE E;  2W84 A;  2DPU A;  2HTJ A;  1VI0 A;  3ZQL A;  3LFU A;  4KMF A;  2VKH A;  3L9F A;  5IPA A;  3JRC A;  4A3J J;  3RKW A;  4MEX F;  1DDN A;  4I6Z A;  2L9R A;  3NRV A;  2XRO A;  4RS8 A;  3RZD J;  2M3A A;  4B4C A;  3L09 A;  1UHW A;  1RNL A;  3LAP A;  1QRY A;  1JKO C;  4E70 A;  5K1Y A;  4PUS A;  3BR6 A;  1T2K A;  4EJT A;  2QF7 A;  1A35 A;  4EJU A;  5LRS A;  1HKT A;  1V3F A;  2BV6 A;  1T0F C;  1QZE A;  3H9G A;  1PYV A;  4DQ2 A;  2PJP A;  1VQP I;  3ML6 A;  1IF1 A;  2E1N A;  1WRJ A;  3FX3 A;  3J7A O;  3F8M A;  5J1R A;  2ZXH A;  1MD0 A;  3HG9 A;  1UFM A;  1XDU A;  2VT2 A;  4LK0 F;  1JJ6 C;  2ID3 A;  3A1Y A;  1RKW A;  2XAU A;  2DQL A;  2VE8 A;  3CLQ A;  2DMU A;  2QUF A;  2HEO A;  2VPR A;  2IGN A;  3BCA A;  4D0P A;  1UB9 A;  3FKJ A;  3CC2 I;  3QRF F;  3K1M A;  5D5X B;  5E18 F;  1O3R A;  3F21 A;  2G7H A;  2PEX A;  2XGC A;  2M9H A;  2XAG A;  3M1C A;  5J8F A;  3SZG A;  1RIO H;  3K6G A;  3HC7 A;  4R8H A;  1R4N B;  2E7X A;  3PFI A;  5CLS A;  2HPI A;  3QWL A;  4ESF A;  3MN2 A;  2LK2 A;  4FHT A;  4HBL A;  2XIG A;  4RB3 C;  4HA8 A;  3BG3 A;  3SYT A;  3DTE A;  2WTE A;  4HYE A;  5J4V A;  4BAY A;  3HZJ A;  4Y52 J;  1IXR C;  1ZG1 A;  2DOD A;  2DYS H;  3D5L A;  3MZ8 A;  4RAG A;  3HOV J;  4FCY A;  3M07 A;  1IRG A;  4KN7 X;  5HOO A;  1LEA A;  4EV0 A;  4EM1 A;  2F5C A;  3HTS B;  2Z16 A;  4B43 A;  2K9M A;  2OCC H;  2O8X A;  5B1B H;  2DMP A;  2AO9 A;  5F0F A;  3CJQ B;  1OQY A;  2H1K A;  2HOS A;  2Y2Z A;  3WTU C;  1ETX A;  5EZG A;  4CSW A;  2YX4 A;  3OMY A;  4RMN A;  1W4M A;  1YG2 A;  3RPU A;  2M0C A;  5KHD A;  2PMZ A;  1VQ5 I;  4BEH A;  2PI0 A;  2G9W A;  5DM7 F;  2EJR A;  2FBH A;  2E71 A;  1BI3 A;  4XN3 A;  3U1K A;  1Y8R B;  5C3E J;  4O6J A;  5F1R A;  3JRA A;  1SFU A;  4A2U A;  4XID A;  3K4J A;  4MHG A;  4XL9 A;  3ZCO A;  1ETK A;  1WI3 A;  3R61 A;  4ZZL A;  1PVE A;  1YYV A;  3BR5 A;  3LSP A;  5LGN A;  2YS9 A;  2X1D A;  2XC7 A;  1P2F A;  3M8J A;  2K02 A;  4GFB A;  1IN5 A;  2ID6 A;  2KJB A;  2KRF A;  3BQZ A;  4A3D J;  1G6N A;  1HOM A;  3WTY C;  1LEB A;  6PAX A;  5H20 A;  4ZYD A;  4XM3 A;  2WB1 A;  1IW7 F;  2IA1 A;  1IN7 A;  1R58 A;  1OCP A;  2B0L A;  2HYG D;  2JTV A;  3LQR A;  2FNA A;  5J6X A;  2E35 A;  5IT9 K;  4HNU A;  4DYR A;  3L7W A;  4YIF A;  9ANT A;  1TWG J;  2W25 A;  2XF6 A;  2K5C A;  1ON1 A;  1XMX A;  3K4M A;  2L0K A;  4MTD A;  2ZCW A;  1ETY A;  3EPZ A;  2R7W A;  3CC4 I;  3VB2 A;  4Y33 A;  3S16 J;  1U5T C;  2PMU A;  2EFQ A;  3K4C A;  3E5X A;  3C3W A;  1GVD A;  1FNN A;  4QLC U;  2FF4 A;  1U5T B;  1R7J A;  1UAA A;  2KZG A;  1OMI A;  1ZTR A;  2PG4 A;  3MKZ A;  1D3Y A;  3DPT A;  5BMZ A;  1R5H A;  1HDD C;  1S29 A;  3PUF A;  1UG0 A;  5E1Z B;  3V7C A;  1LNW A;  4KIS A;  2JN6 A;  3J7A Y;  3HOW J;  3K4L A;  1SFO J;  1O4X A;  4GYG A;  3O8G A;  2Q2E A;  4ABZ A;  2M8G X;  4P5O A;  2LD5 A;  2BW3 B;  2I8D A;  2BOL A;  1T33 A;  1S8N A;  4RB2 C;  2ZSI B;  3OYE A;  3BR3 A;  3F3X A;  3Q3S A;  1VQ6 I;  3J80 Z;  4GO1 A;  4AD9 A;  2Y30 A;  3OIP A;  2FBI A;  3FMS A;  3HOT A;  1W36 C;  1F5T A;  3HEF A;  2JUG A;  3BTL A;  1LE8 B;  1VQK I;  2A6T A;  4UHT A;  2ECB A;  3IP4 B;  2WWY A;  3R0A A;  5D8K B;  5L3E A;  1B1B A;  2LNB A;  5J8C A;  1R49 A;  4A12 A;  2YPR A;  4C3H J;  1QHG A;  3GFJ A;  1DPR A;  1XSX A;  1PUF A;  1TLH B;  3OR1 C;  2GA1 A;  4BEH B;  1FMW A;  4PJL A;  3L2C A;  4G9Y A;  2DYR H;  1YW9 A;  1NK2 P;  3FBN B;  3NAU A;  3L2V A;  1ODD A;  5FRN A;  2R7Z J;  3G1O A;  4KJZ A;  4F7Z A;  1Z3X A;  1Z7L A;  4C3J J;  1BR4 A;  3I55 I;  5FKO A;  3CUO A;  5DTD A;  2HTS A;  3LSR A;  3OS2 A;  1U5T A;  1MW7 A;  2DAO A;  2Y0M A;  1W5T A;  1AOY A;  1XGM A;  5ED4 A;  2VBY A;  2Z5U A;  2DMQ A;  5K5Q A;  2FMY A;  3ZQG A;  1G8X A;  5GPC A;  2V9V A;  1ZGW A;  3CCR I;  2VBX A;  3GFL A;  3E1S A;  5BPD A;  3GO5 A;  2R7R A;  5IT3 A;  4TV7 A;  2LDU A;  5IOY A;  2V1N A;  1Z21 A;  1BM9 A;  2CJJ A;  5DDG A;  4JX4 A;  4RGU A;  4II3 A;  3S14 J;  3DWL E;  3WU0 A;  1G4D A;  1TTY A;  1WFX A;  4XNF A;  1HW2 A;  1YJ9 I;  2JQ7 A;  2VKD A;  1KA8 A;  1XMK A;  2VB6 A;  2QSF X;  4OOI A;  1FP1 D;  4A3L J;  3FXU A;  1KYZ A;  2STT A;  1IUY A;  4OIR F;  4G12 A;  3W6J B;  5EEH A;  1MSE C;  2NNN A;  2ACJ A;  2ME0 A;  3GTK J;  3C18 A;  3BCB A;  1FBU A;  4UV8 A;  4UNO A;  3OYA A;  1WH5 A;  4BHB A;  2LYC A;  4WXH A;  2RC4 A;  3GZN B;  1EF4 A;  5J47 A;  2E1C A;  3BP8 A;  5AON A;  2BGC A;  3HKZ N;  3CCE I;  4X6A J;  5D4S A;  5E3N A;  4YG2 F;  3JRF A;  1S9H A;  3FF5 A;  1D1B A;  3BQY A;  2GM4 A;  1W7P A;  4OIO F;  1ZRE A;  1LVA A;  3FXL A;  3LST A;  1MBH A;  4I99 C;  3R0J A;  3H9J A;  5GAE J;  3L2Q A;  2JUC A;  5EZH A;  3RCO A;  1BIB A;  1IN4 A;  3DXJ F;  1XCV A;  1ZN2 A;  5FLM J;  4IQ4 A;  3F8F A;  3CJR B;  4BKX A;  4YRV A;  5FO5 A;  2ESN A;  2E1M B;  3T5X A;  4EAT A;  5EEG A;  1X58 A;  2DTR A;  2W24 A;  3FIW A;  3H35 A;  2LBF B;  4ENN A;  2V9K A;  3N97 A;  1VQL I;  5D8L B;  2B63 J;  1WPK A;  3CF5 F;  4CXF A;  2GXB A;  2L7K A;  3Q9V A;  1TL8 A;  4JP0 A;  2KT0 A;  4E7J A;  4A3B J;  2R5Z A;  2AQE A;  2EFO A;  1KU2 A;  4W97 A;  1U3E M;  3QPS A;  3RKQ A;  3PQJ A;  2FQ4 A;  1PP7 U;  3E6D A;  2P6T A;  2XAF A;  3FDY A;  4J01 A;  2RNG A;  3IL2 A;  1RR7 A;  3H3U A;  2O3F A;  5CKT A;  1S7E A;  3JRH A;  4V19 K;  2QM3 A;  4L0Z B;  1TT0 A;  3D5R C;  3G6E I;  2HOA A;  5J1Y A;  1D5Y A;  1AU7 A;  3SDB A;  3CCJ I;  1XSV A;  3DFG A;  4L9T A;  5JI6 A;  2D45 A;  3DEU A;  4U88 A;  1J59 A;  3EYY A;  2OBP A;  3ERE D;  3IC7 A;  1LKX A;  4CCM A;  3GTP J;  2LC2 A;  1D0Z A;  2X4H A;  4A0Y A;  4DBQ A;  1N75 A;  4B3A A;  4LLN A;  1H88 C;  5B1A H;  2P7V B;  2ZNY A;  1AHD P;  4II2 A;  1RRJ A;  4AYB N;  1BI1 A;  3RPQ A;  2EA2 A;  2HYJ A;  3BJ6 A;  1XDS A;  4G7O F;  2M5W A;  3KEQ A;  4ESB A;  4DZP A;  4I0A A;  2DFE A;  2STW A;  1BL0 A;  3WGH A;  2IEK A;  1P9Q C;  2MA3 A;  4U0W A;  4ZDO A;  4Q5S F;  3HL2 A;  2E2J J;  1B72 B;  2ELK A;  3H0G J;  2GOX B;  1X4O A;  1HCR A;  1FSH A;  3F8N A;  4HQM A;  2HVR A;  1JGS A;  1YHQ I;  2IS1 A;  2F4O B;  3MAJ A;  1QVU A;  4NC6 A;  4V2F A;  1GXP A;  2E5Z A;  4HX7 A;  1JT6 A;  2K3F A;  4IO9 F;  2QQ8 A;  4G6T B;  4DW6 A;  1YIT I;  1EJ9 A;  1DP7 P;  1FYL A;  4FE7 A;  4HPQ A;  2OJE D;  3D1N I;  4WCG A;  1BR1 A;  3BG9 A;  5JVG F;  4J19 A;  1IN6 A;  2DFH A;  5FRM A;  3IWF A;  1MND A;  3CJT B;  2FE3 A;  2VJJ A;  5FFX A;  5JFR A;  2DOE A;  4P96 A;  1K83 J;  2IW5 A;  2ZFW A;  2VJ4 A;  1XSD A;  1JJ8 C;  1UCR A;  2LRD A;  3HTU A;  3NWS A;  3N4M A;  3IH2 A;  1REP C;  1SFK A;  3WHB A;  2XAJ A;  4MO7 A;  3IHU A;  4FX0 A;  1GV5 A;  1J75 A;  4AVP A;  4BQN A;  2L02 A;  2OQR A;  2V9P A;  5FKN A;  3KYD B;  3OYH A;  2R7S A;  1FTZ A;  1R1V A;  3H3V K;  4XLH A;  3FMQ A;  1W7P B;  4AWX B;  3C1D A;  4B3X A;  2R92 J;  3LOC A;  2CUE A;  3A02 A;  2HGC A;  3OYM A;  1P4X A;  1SC7 A;  1MMS A;  1J2X A;  1X3W B;  5LBQ A;  2LMD A;  2W85 A;  2HXO A;  2WAQ A;  3K9T A;  3LNQ A;  5F04 A;  3BJO A;  4HZF A;  5ICC A;  1JT0 A;  2NVX J;  2NYX A;  4RLF A;  3I4N J;  3MWM A;  3GFI A;  3GUD A;  2G0E A;  2V26 A;  3M7G A;  2XPW A;  4EGZ A;  1X3U A;  4OMY A;  1QU3 A;  1JXS A;  3EUH A;  1TQM A;  1KU3 A;  4YFK F;  2IAI A;  2DTZ A;  4LLL A;  3B6C A;  4BE0 A;  2KIQ A;  3O6B B;  2KDO A;  3KEY A;  4A3F J;  5L3C A;  5B3S H;  2Q8K A;  4UB6 C;  2K4J A;  2EV0 A;  4L5I A;  2L5Q A;  2X6O A;  2JRM A;  3F6O A;  3AL0 B;  4Y15 A;  2M0M A;  2KIS A;  4MIM A;  4A3G J;  2KKO A;  4IF4 A;  5LHG A;  1T56 A;  2AHQ A;  1E3H A;  3DTI A;  1Z0X A;  2BXY A;  2N8G A;  4Q47 A;  2M2E A;  4U7B A;  3JRG A;  3H5A A;  4A0Z A;  2A6E F;  1NHA A;  3P9K A;  5GAH J;  1G3Y A;  3WU1 B;  3GVA A;  4XKW A;  3PO3 J;  3KP4 A;  2EBI A;  2CW0 F;  2K9S A;  3ABU A;  1ACI A;  2LF8 A;  1O7L A;  5DEQ A;  2JVG A;  3DCF A;  2MG4 A;  2EIK H;  3FXJ A;  1OCT C;  5D5V B;  3G71 I;  3SZP A;  2RDP A;  3H5N A;  3CC7 I; 
#chains in the Genus database with same CATH homology
 1O57 A;  3FWE A;  3J81 K;  3KZZ A;  4EJO A;  2CGP A;  2Z9O A;  3BOQ A;  5BS6 A;  3TGN A;  3QPH A;  3O3K A;  4U0Y A;  3VOE A;  3ECO A;  4XLP F;  4HF1 A;  5ICE A;  3JTH A;  1RI7 A;  4YFN F;  2A3S A;  5A2Q Z;  2VON A;  3LA3 A;  4HW0 A;  4P9U A;  2D1V A;  4XRF A;  1JE8 A;  5ERI A;  1QQI A;  2E7W A;  3RTR A;  3VEP A;  3ZMU A;  3CUQ C;  3JAM K;  4ASN A;  1ZRD A;  2JPC A;  4I0B A;  3S2W A;  5DUK A;  4O5V A;  4RGX A;  4ESJ A;  1T98 A;  3CTA A;  5E17 F;  3QAH A;  1ULY A;  1BIA A;  4BHC A;  3QU3 A;  2MLK A;  4P9F A;  1FX7 A;  2HR3 A;  1SFE A;  5D6F A;  2H09 A;  1DUX C;  3KLN A;  4WF2 A;  3WTX C;  3QP6 A;  1MZB A;  2VBZ A;  1SMT A;  1B9N A;  1RZ4 A;  1B9M A;  2HOE A;  3ZMV A;  1HXD A;  1O3Q A;  4O3M A;  4IPA A;  5CVR A;  5E8G A;  4EVI A;  4GXO A;  4KFC A;  3WTW C;  5HLI A;  3BRO A;  2FNP A;  2ZKZ A;  2JSC A;  3ZMD A;  4A5N A;  3DPL C;  2OZ6 A;  2H94 A;  2ETH A;  4HF0 A;  3EQL F;  3F72 A;  2OAZ A;  4LGW A;  2DFI A;  2MD5 A;  2OU2 A;  1Z7U A;  5JVT A;  4S04 A;  4MNU A;  4IRG A;  1Z9C A;  1SFX A;  5LHH A;  4G6Q A;  3TOA A;  4JK1 X;  1MDM A;  3R6S A;  3F8B A;  3V8K A;  3LAJ A;  2QQA A;  3I64 A;  3F22 A;  3FM3 A;  4BYY A;  4EM0 B;  1T39 A;  1I1G A;  5BOX A;  2D1H A;  2COM A;  3E6M A;  1K78 B;  1ZLK A;  3HHH A;  2K7L A;  1YLF A;  4LFU A;  3ZP5 A;  1DPU A;  5D5W B;  3JW4 A;  1WKM A;  2NAZ A;  1ZYR F;  1FSE A;  1V4R A;  1D5V A;  2R3S A;  2H6C A;  2F2E A;  1S7O A;  4LB6 B;  1XB4 A;  3I0T A;  5LRR A;  2XHK A;  5HLH A;  2A69 F;  4PCQ A;  3ULQ B;  1JXS A;  4M72 A;  3RKY A;  5L3G A;  4Q48 A;  1HW1 A;  2EK5 A;  1IRF A;  3SZT A;  3TDZ C;  1GVJ A;  3IWZ A;  5L3B A;  2IT0 A;  2QYO A;  2GXG A;  3QU6 A;  1Z6R A;  3P7N A;  3GX4 X;  1STZ A;  4RAY A;  2JT1 A;  2EFP A;  3TO9 A;  4CGZ A;  3DF8 A;  2CO5 A;  1KYW A;  3P9C A;  2MBF A;  5HDN A;  3W6K B;  2XRN A;  2DO7 A;  1LB2 A;  1LDJ A;  1ZHF A;  3KEO A;  4M6Y A;  3TKY A;  3F8C A;  3MEX A;  3KFW X;  5BPI A;  2DPD A;  4L9V A;  4A6E A;  1G3T A;  2OZU A;  3OOP A;  3G3Z A;  4H0E A;  1A04 A;  2MH2 A;  1Q1H A;  3J81 Z;  2Q0O A;  2D2W A;  2V79 A;  2EFW A;  4GYI A;  1R00 A;  4IHT A;  1D8J A;  4N9H A;  5L3F A;  4HLY A;  3I54 A;  3RI4 A;  2KIM A;  5ILV A;  3LA2 A;  3SHF A;  1HQC A;  1SD7 A;  3E6B A;  1OPC A;  2M8E A;  1U8R A;  1JHH A;  3E5U A;  1ZRF A;  1FT9 A;  1CF7 A;  3I71 A;  2PFB A;  1LQ1 A;  2IPQ X;  2K27 A;  5DD8 A;  3VOD A;  3CLO A;  2FSW A;  3B73 A;  1HST A;  1AWC A;  2G7U A;  2F5D A;  1T6S A;  4HV6 A;  2EFN A;  2ZJ2 A;  1BOA A;  1SAX A;  3HSE A;  3WTV C;  3F23 A;  4M9S A;  4IJA A;  3K2Z A;  5ILS A;  4OIN F;  2RNJ A;  3T8T A;  1PP8 F;  2VN2 A;  4KDP A;  2V6C A;  4EMS A;  5TRD A;  3H92 A;  1HKQ A;  3BWG A;  4MGR A;  2XGX A;  3U1D A;  2DK8 A;  1ON2 A;  2HDC A;  3HOS A;  3TO6 A;  1LDK B;  4IHS A;  2CG4 A;  2DQR A;  1FZP B;  2ADU A;  2C6Y A;  4RGS A;  4JBA A;  1KU9 A;  4A6D A;  2EV5 A;  4PDK A;  3GF2 A;  2P4W A;  5KK1 A;  3SXY A;  2R7F A;  4M9X A;  2QZ8 A;  4KMU X;  5F6F A;  2TDX A;  1USS A;  2ZME B;  1YS7 A;  5HLG A;  1KQ8 A;  3V4G A;  1XGO A;  3ELK A;  1EH8 A;  2Z3Y A;  2GAU A;  4OIQ F;  2Y48 A;  3V8J A;  3WE2 A;  3MCZ A;  4M73 A;  2O61 A;  3JSO A;  2A07 F;  1LJ9 A;  4KIB A;  1ZRC A;  3RIR A;  3HRT A;  4OIP F;  1SD4 A;  1FYM A;  1FBS A;  2OA4 A;  3HUG A;  2IA2 A;  5AIQ A;  3MQ0 A;  4HX8 A;  2KIF A;  3BZ6 A;  1GHC A;  4M6X A;  4XSZ F;  1H9T A;  4FT8 A;  2PBI A;  3LFK A;  3WGG A;  5E1W A;  1BI2 A;  1O7F A;  3ZQ7 A;  3BY6 A;  1H0M A;  2XVC A;  4HX4 A;  3GZ5 A;  1XCB A;  2A68 F;  1YIO A;  2RQP A;  2Y75 A;  4L0Y B;  1R5G A;  3IRR A;  1P4W A;  2EWN A;  2LSO A;  3LA7 A;  2DI3 A;  1BC7 C;  4BHP A;  1U6G A;  5D4R A;  4KN4 X;  2VXZ A;  1R23 A;  4RAZ A;  2PLY A;  3I4P A;  1R1T A;  3BJA A;  3T8R A;  4M74 A;  4I7H A;  4MQ9 F;  2GIV A;  1T0F A;  5E1X A;  4K2E A;  2ZO4 A;  1KQ9 A;  4NB5 A;  2GQQ A;  4UVB A;  1YS6 A;  4ZYE A;  3WTS C;  3NEU A;  4ON0 A;  1SMY F;  2DBB A;  3MZY A;  2VOO A;  4P55 A;  1XD7 A;  2PMH A;  1FBQ A;  1S7A A;  3HRM A;  2P7C B;  2QBY B;  1P92 A;  3TDU C;  1BBY A;  3DP7 A;  2A6H F;  1QNT A;  4KT5 C;  3SFZ A;  5DV5 A;  4IRI A;  1QO0 D;  2KJC A;  2XUB A;  4HAM A;  4EGY A;  3R60 A;  1ZGA A;  2UWM A;  2ZNZ A;  4EM2 A;  1Y0U A;  2MC3 A;  4UUV A;  5HS9 A;  4A5M A;  2BE5 F;  3FM5 A;  4N0B A;  2NRA C;  5LHI A;  2DT5 A;  3J80 K;  2YU3 A;  2XAQ A;  4PGH A;  4Q4Z F;  4KIG A;  3CUQ B;  2R7D A;  5JR3 A;  1R22 A;  4IVN A;  4Z2Y A;  1PDN C;  3F6V A;  3MFK A;  2H6B A;  3EYI A;  3GWZ A;  1ZGJ A;  2CSO A;  2EA4 A;  3P9I A;  1B6A A;  1TW2 A;  5L3D A;  5FGM A;  3IRQ A;  4UV9 A;  5AIP A;  2MH9 A;  2K4B A;  4G8X A;  3REO A;  1F9N A;  4WXC A;  3WTZ A;  2GA2 A;  2XKO A;  2L4A A;  1OKR A;  3ZPL A;  3FMR A;  2ISZ A;  3ECH A;  3CO7 C;  1OYI A;  1MGT A;  3V7S A;  1K78 A;  4ZZD A;  1H9G A;  4LB5 A;  2P5K A;  4EJV A;  5TJJ A;  3ZMZ A;  4ZYG A;  3T0Y A;  1LDD A;  4R1H A;  3ZMS A;  3ZMT A;  5LLQ A;  5DD4 A;  5FB2 A;  3RJP A;  5D5U B;  4LLG F;  1HSJ A;  2FBK A;  2QBY A;  3GLX A;  1E17 A;  2FA5 A;  1MDM B;  1VTN C;  1I1S A;  2FML A;  1I6X A;  1P4A A;  1W5S A;  2FXA A;  4WXD A;  1W7P D;  2HKX A;  5H6R A;  2UZK A;  3M9A A;  1Z6T A;  4G6D A;  3RYR A;  1TNS A;  3QOP A;  3RKX A;  1YFH A;  3NQO A;  1XMA A;  2DK5 A;  2JZY A;  1MJ9 A;  4UVA A;  3AAF A;  2UXX A;  1IXC A;  2MLG A;  4XBF A;  4B8X A;  3KP2 A;  2NNY A;  3JTG A;  2HZT A;  2XV4 S;  3TQN A;  2HWV A;  4PZJ A;  2FOK A;  3I58 A;  3WTT C;  2QQB A;  4LG0 A;  2QEN A;  1SD5 A;  4CYD A;  1FYK A;  2HQR A;  1CF7 B;  2PQ8 A;  5CYV A;  3FXR A;  4WK8 F;  1D8K A;  4BNC A;  4B09 A;  2BEO A;  3KP6 A;  3O2P E;  3ABT A;  1KQ0 A;  3GYH X;  3T1B A;  3PQK A;  4HDU A;  2O03 A;  1MJA A;  3E6C C;  1IAW A;  4R79 A;  4L9N A;  4EJW A;  4YII A;  1R1U A;  1Z05 A;  1ZAR A;  4AIJ A;  3M8F A;  3TO7 A;  3M1E A;  3CJN A;  1TW3 A;  3FZV A;  1EV7 A;  4HLX A;  4WX9 A;  2YR2 A;  5ICF A;  2EV6 A;  3ZN0 A;  1EH6 A;  3GFM A;  4KYW A;  4UVC A;  1J5Y A;  1K7A A;  3HRS A;  2HQN A;  3SQN A;  2RN7 A;  2F5E A;  1I27 A;  2L4M A;  3U2R A;  4L18 B;  3I5U A;  3BPV A;  4ETS A;  1QZY A;  2IRF G;  1O3T A;  2IA0 A;  4KIC A;  3C7J A;  3GXO A;  2ZXJ A;  4BXU A;  2XAH A;  1ZH5 A;  5FFZ A;  1T38 A;  2CQK A;  2LKP A;  5E20 A;  5CVV A;  2QWW A;  3V7R A;  2DU9 A;  2RVC A;  1HKS A;  3IKV A;  2JPB A;  3I59 B;  2A61 A;  2XKP A;  5E8I A;  2J5O A;  1J7K A;  2IJL A;  1RUO A;  4XLN F;  5DCF A;  3Q5F A;  4KIF A;  3GZ6 A;  4HV5 A;  1R36 A;  3KP7 A;  4U7D A;  1MJB A;  3LQQ A;  3KLO A;  4CIC A;  1G3W A;  1U78 A;  2IVM A;  2BYV E;  3WOD F;  2A5Y B;  1FP2 A;  2M30 A;  3WG9 A;  5LEJ A;  5FLX Z;  4I2O A;  5CVI A;  5HS7 A;  3KE2 A;  2LF7 A;  2ZBK A;  4L9J A;  3WGI A;  2RKH A;  5CVU A;  4AIH A;  2GZW A;  2NS0 A;  4ENK A;  4HQE A;  5FLX K;  1KGS A;  1YO5 C;  2Z99 A;  2HYF A;  1ZG3 A;  3M8E A;  4ZYH A;  5HS8 A;  4IXA A;  2O6G E;  1Z91 A;  4I02 A;  5HDK A;  2JRT A;  4RB1 A;  2F5F A;  3COA C;  1BJA A;  2J5P A;  5FD5 A;  2FU4 A;  5KVR A;  5FD6 A;  3ROU A;  2V1D A;  1FWZ A;  5DUI A;  2M45 A;  4FX4 A;  3KP3 A;  4RB0 A;  1ZG5 A;  1BC8 C;  1FOK A;  4WWC A;  2CFX A;  2Z33 A;  3U9G A;  3K69 A;  2YSR A;  2VOD A;  1B4A A;  1L3L A;  5HVQ C;  4HOB A;  3HRU A;  2IP2 A;  3G73 A;  4LD5 A;  4NHJ A;  1ONV A;  2VBW A;  4KA4 A;  1TBX A;  2W57 A;  5H6Q A;  1WWX A;  4CZZ A;  5ILU A;  2AXL A;  3LWF A;  4LJZ F;  1J0R A;  2P5L C;  1P6R A;  1ZLJ A;  4MQV A;  5LGT A;  2VC1 A;  4RGR A;  4A0X A;  2P6S A;  1J9I A;  3K0L A;  3HSR A;  4U0V A;  2HKO A;  2XAS A;  1O3S A;  5DCM B;  4CDG A;  3KZY A;  4G94 A;  5F64 A;  4ZH4 F;  2L54 A;  3KP5 A;  2M1B A;  2FQ3 A;  3EET A;  2DW4 A;  1L0O C;  1U2W A;  2FRH A;  4BH9 A;  3I59 A;  1JHF A;  3HYI A;  4G7Z F;  3L00 A;  3E97 A;  1FPQ A;  4LMY A;  1IN8 A;  1HBX G;  1XGS A;  4I09 A;  1OYW A;  2YX7 A;  4HF2 A;  3JSP A;  2RGV A;  4MTE A;  1YQA A;  3RYP A;  3TOB A;  3I53 A;  4ENJ A;  2X0L A;  3Q9S A;  3QP5 A;  1K6O A;  2KIU A;  4IRH A;  3IKT A;  5HDG A;  2L3D A;  4CHU A;  2WC2 A;  1IXS B;  2VC0 A;  3HHG A;  1BN5 A;  3V8L A;  3ZN1 A;  2DLL A;  4JQF A;  1IZ1 A;  2QLZ A;  3GEZ A;  1FY7 A;  1QGP A;  3DQV C;  3E3V A;  3HIF A;  2V1X A;  5ICG A;  4AIK A;  1YW7 A;  1F1Z A;  1I5Z A;  3KET A;  2PN6 A;  2ESH A;  2VOP A;  5BQT A;  3CDH A;  4L5J A;  4GCV A;  2O0Y A;  1F4K A;  1S3J A;  2HS5 A;  3CO6 C;  2QQ9 A;  3VFZ A;  2ZME A;  4I98 B;  2ISY A;  2CWE A;  3DV8 A;  4XSX F;  3HSF A;  4KUM A;  4LG0 B;  4MEY F;  4DNC A;  5K5R A;  1YW8 A;  2QVO A;  4KNY A;  3JAM Z;  4M9Z A;  3BPX A;  1XN7 A;  1FLI A;  5A2Q K;  1Z1D A;  3R4K A;  4ENM A;  5CJ9 A;  2RV8 A;  2UXN A;  3BDD A;  1EH7 A;  1TNT A;  1HW5 A;  4PGG A;  1UST A;  2GWR A;  3D0S A;  1E2X A;  4NQW A;  3CUQ A;  2OQG A;  1UHM A;  2VT3 A;  1G3S A;  1QBJ A;  4S05 A;  4BQA A;  3DKW A;  4UXN A;  1MKM A;  1S6L A;  3FHZ A;  1B59 A;  5DYM A;  1WI9 A;  4Y13 A;  5IT9 Z;  1TQP A;  3B02 A;  4LK1 F;  1QPM A;  2CYY A;  5K5O A;  2AS5 F;  4YFX F;  1KU7 A;  2H27 A;  5DCM A;  3K1P A;  1TQI A;  4GGG A;  3E5Q A;  4N9I A;  2VE9 A;  2HFH A;  3OV8 A;  2EB7 A;  2V1U A;  1OR7 A;  3ISP A;  1BI0 A;  2ELH A;  1RUN A;  4CO8 A;  1OYY A;  1C0W A;  4G7H F;  3KCC A;  1ZAO A;  3EDP A;  2WV0 A;  4OU0 A;  1WSU A;  1GXQ A;  1CGP A;  2P5V A;  4I01 A;  2OD5 A;  4QWQ A;  1K79 A;  3QPT A;  4HDV A;  5LGU A;  2FEZ A;  4Y17 A;  5LEK A;  1FC3 A;  5D6E A;  2L01 A;  1XGN A;  4M71 A;  3K1N A;  1QZZ A;  1YTY A;  3RDI A;  3GW2 A;  2M87 A;  1WQ2 A;  4OMZ A;  2BBY A;  3MZH A;  5JHU A;  5CVJ A;  3WE3 A;  3FXQ A;  4EQQ A;  2K86 A;  1SD6 A;  3H3Z A;  2P8T A;  1PUE E;  2W84 A;  2DPU A;  2HTJ A;  4KMF A;  3L9F A;  4MEX F;  3RKW A;  1DDN A;  3NRV A;  2XRO A;  4RS8 A;  3L09 A;  1UHW A;  1RNL A;  3LAP A;  4E70 A;  5K1Y A;  1T2K A;  4EJT A;  4EJU A;  5LRS A;  1HKT A;  1V3F A;  2BV6 A;  4DQ2 A;  2PJP A;  3ML6 A;  1IF1 A;  2E1N A;  1WRJ A;  3FX3 A;  3J7A O;  3F8M A;  1MD0 A;  1UFM A;  1XDU A;  2VT2 A;  4LK0 F;  2DQL A;  2VE8 A;  2QUF A;  2HEO A;  4D0P A;  1UB9 A;  3QRF F;  3K1M A;  5D5X B;  5E18 F;  1O3R A;  3F21 A;  2G7H A;  2PEX A;  5J8F A;  1RIO H;  2XAG A;  4R8H A;  2E7X A;  3PFI A;  5CLS A;  4ESF A;  4FHT A;  4HBL A;  2XIG A;  4RB3 C;  4HA8 A;  2WTE A;  4HYE A;  4BAY A;  1IXR C;  1ZG1 A;  3D5L A;  1IRG A;  4KN7 X;  5HOO A;  1LEA A;  4EV0 A;  4EM1 A;  2F5C A;  3HTS B;  2O8X A;  3WTU C;  2YX4 A;  1W4M A;  1YG2 A;  3RPU A;  2PI0 A;  2G9W A;  2EJR A;  2FBH A;  1BI3 A;  4O6J A;  5F1R A;  1SFU A;  4A2U A;  4MHG A;  4ZZL A;  3R61 A;  1YYV A;  5LGN A;  1P2F A;  2K02 A;  1IN5 A;  2KRF A;  2KJB A;  1G6N A;  3WTY C;  1LEB A;  6PAX A;  5H20 A;  4ZYD A;  1IW7 F;  2IA1 A;  1IN7 A;  1R58 A;  2B0L A;  2HYG D;  2JTV A;  3LQR A;  2FNA A;  5J6X A;  5IT9 K;  3L7W A;  4YIF A;  2W25 A;  1ON1 A;  4MTD A;  2ZCW A;  3VB2 A;  1U5T C;  2PMU A;  2EFQ A;  3E5X A;  3C3W A;  1FNN A;  4QLC U;  2FF4 A;  1U5T B;  1R7J A;  1OMI A;  2PG4 A;  1D3Y A;  3DPT A;  5BMZ A;  1R5H A;  1S29 A;  5E1Z B;  3V7C A;  1LNW A;  4GYG A;  2Q2E A;  4P5O A;  1S8N A;  4RB2 C;  3F3X A;  3J80 Z;  4GO1 A;  4AD9 A;  2FBI A;  3FMS A;  3HOT A;  1F5T A;  4UHT A;  2WWY A;  3R0A A;  5D8K B;  5L3E A;  1B1B A;  2LNB A;  5J8C A;  4A12 A;  2YPR A;  3GFJ A;  1DPR A;  1XSX A;  1TLH B;  2GA1 A;  3L2C A;  4G9Y A;  1YW9 A;  1ODD A;  4F7Z A;  3CUO A;  2HTS A;  1U5T A;  2DAO A;  2Y0M A;  1W5T A;  1AOY A;  1XGM A;  5ED4 A;  2VBY A;  2Z5U A;  5K5Q A;  2FMY A;  2V9V A;  2VBX A;  3GFL A;  5BPD A;  3GO5 A;  5IT3 A;  4TV7 A;  2LDU A;  1BM9 A;  5DDG A;  4RGU A;  3WU0 A;  1G4D A;  1TTY A;  1HW2 A;  1KA8 A;  1XMK A;  4OOI A;  1FP1 D;  1IUY A;  3FXU A;  1KYZ A;  2STT A;  4OIR F;  3W6J B;  5EEH A;  2NNN A;  2ACJ A;  3C18 A;  1FBU A;  4UV8 A;  4UNO A;  4BHB A;  4WXH A;  2RC4 A;  2E1C A;  3BP8 A;  5AON A;  2BGC A;  5D4S A;  4YG2 F;  3FF5 A;  1W7P A;  4OIO F;  1ZRE A;  1LVA A;  3LST A;  3R0J A;  1BIB A;  1IN4 A;  3DXJ F;  1XCV A;  1ZN2 A;  3F8F A;  5FO5 A;  2ESN A;  3T5X A;  5EEG A;  2DTR A;  2W24 A;  4ENN A;  3N97 A;  5D8L B;  4CXF A;  2GXB A;  3Q9V A;  2EFO A;  1U3E M;  1KU2 A;  3PQJ A;  1PP7 U;  3E6D A;  2P6T A;  2XAF A;  3IL2 A;  2O3F A;  3H3U A;  2QM3 A;  4L0Z B;  1XSV A;  3DFG A;  4L9T A;  5JI6 A;  2D45 A;  3DEU A;  4U88 A;  1J59 A;  3EYY A;  2OBP A;  3ERE D;  3IC7 A;  2X4H A;  4A0Y A;  4LLN A;  2P7V B;  2ZNY A;  1BI1 A;  3RPQ A;  2EA2 A;  3BJ6 A;  1XDS A;  4G7O F;  2M5W A;  3KEQ A;  4ESB A;  4I0A A;  2STW A;  3WGH A;  2MA3 A;  4U0W A;  4Q5S F;  1FSH A;  3F8N A;  4HQM A;  1JGS A;  3MAJ A;  1GXP A;  4HX7 A;  1DP7 P;  1FYL A;  4WCG A;  1IN6 A;  3IWF A;  2FE3 A;  5FFX A;  5JFR A;  4P96 A;  2IW5 A;  2ZFW A;  1XSD A;  1UCR A;  3HTU A;  3N4M A;  1REP C;  2XAJ A;  1J75 A;  3IHU A;  4FX0 A;  4AVP A;  2L02 A;  2OQR A;  1R1V A;  3FMQ A;  1W7P B;  4AWX B;  3C1D A;  2HGC A;  1P4X A;  1J2X A;  5LBQ A;  3K9T A;  2W85 A;  3BJO A;  4HZF A;  5ICC A;  2NYX A;  3MWM A;  3GFI A;  3GUD A;  4OMY A;  3M7G A;  4EGZ A;  1X3U A;  3EUH A;  1TQM A;  1KU3 A;  4YFK F;  4LLL A;  3O6B B;  5L3C A;  2Q8K A;  2K4J A;  2EV0 A;  4L5I A;  3F6O A;  4Y15 A;  2KKO A;  4IF4 A;  5LHG A;  4Q47 A;  4U7B A;  4A0Z A;  2A6E F;  1NHA A;  3P9K A;  1G3Y A;  3WU1 B;  3GVA A;  3KP4 A;  2CW0 F;  3ABU A;  2LF8 A;  1O7L A;  5DEQ A;  5D5V B;  3SZP A;  2RDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...