4KIBA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Methyltransferase MppJ
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
total genus 113
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kibA01
5DD8A 4BH9A 1OYYA 3N97A 1XB4A 4I09A 3E6BA 2LDUA 2ISZA 3DPLC 4YIIA 2K02A 3CDHA 3DKWA 1IN4A 3DV8A 2LSOA 2H09A 2TDXA 3TQNA 2DT5A 2DU9A 2F5CA 2FNPA 4JK1X 3I0TA 2W24A 5K5OA 3D0SA 2XASA 4HX8A 2RQPA 4HAMA 2L3DA 2ACJA 2O03A 4RGRA 4I0AA 3I59B 4L5JA 1SD6A 4NQWA 4G6DA 1A04A 2WWYA 1ZRCA 4QWQA 2KIFA 1GXPA 2VXZA 1HQCA 3GZ5A 2PG4A 1NHAA 1IRFA 3OV8A 1XDSA 3K1PA 1RZ4A 1TQMA 2NS0A 2BGCA 3CO7C 3D5LA 5JI6A 5HS9A 1WQ2A 3K2ZA 1MKMA 5HLGA 1G3WA 2JT1A 4R79A 1FWZA 2NNYA 4I0BA 2IJLA 2V6CA 1O7LA 1H9TA 3IWZA 3BJAA 4AIKA 4HF2A 2DPDA 2EFNA 2P5LC 2CGPA 3QP6A 1H0MA 4EJUA 3HIFA 2UWMA 4ESBA 3M7GA 5DUIA 1JHHA 2GQQA 2HQRA 1SFUA 3FMSA 4EM1A 3QP5A 1CF7A 2A3SA 1O3RA 3F8FA 1LDJA 3JAMZ 3F8NA 4KN7X 2Y75A 5D6EA 2RKHA 3GWZA 5E1XA 1XGNA 3BJ6A 4YIFA 1UCRA 2F5DA 2M87A 4M6XA 5DEQA 3E5QA 2L4AA 5H6QA 4ZH4F 1O3TA 1V4RA 4LJZF 1X3UA 1TNTA 2QENA 2OQRA 2ZNYA 2QLZA 2RGVA 2EFWA 1YG2A 1XCBA 2G9WA 3ZMUA 2BYVE 2F2EA 4BHBA 2KKOA 1R1VA 3WU0A 4IVNA 4UVCA 1EH8A 3T0YA 2VBYA 2Q8KA 2EV0A 3F72A 2D1VA 2QBYB 1USSA 1U3EM 1EH6A 1REPC 3KP7A 2KJBA 5LEJA 2FMLA 3MWMA 3BY6A 5TRDA 4IPAA 2FU4A 2FEZA 3E6DA 2UZKA 4FX4A 2IW5A 3RJPA 5LHGA 4BXUA 5DV5A 3RKWA 2W84A 2P6SA 4KFCA 1LQ1A 1I1SA 4CDGA 1KYZA 2HTJA 3VODA 3J81Z 4ZZLA 4OIRF 2XKPA 5L3BA 2O6GE 1T98A 3HSRA 2DBBA 1R7JA 2VE8A 4CZZA 1FBQA 2HZTA 4EV0A 1QBJA 1J75A 4M72A 3DP7A 1Y0UA 4P9UA 3V7CA 4K2EA 1Z6TA 3MAJA 4UVBA 1O7FA 1BI0A 3F8MA 5E1WA 2RV8A 4M71A 3F8BA 1EV7A 2EFOA 3HTUA 4EM2A 2HOEA 2GXBA 2QUFA 2XRNA 2DQRA 3ZQ7A 2K27A 3WTYC 5D4SA 3GW2A 3E3VA 3HSFA 1W5SA 2MH9A 1W7PD 2PLYA 4U88A 3RKYA 3L7WA 1FYLA 3ZMVA 1J2XA 4IRHA 3IC7A 5FD6A 3I59A 3OOPA 3WGGA 3P9KA 1PDNC 4E70A 4M9XA 3C18A 5ICCA 4R1HA 4WWCA 2XAGA 2KIMA 1E2XA 4P55A 4XRFA 1P4XA 5BMZA 2OAZA 3F23A 2O0YA 2BE5F 3QAHA 1KU7A 3MZYA 4LD5A 4XBFA 3BROA 1ZGJA 4N9HA 5HDKA 3F22A 3T8RA 2EFQA 1IXSB 1B9NA 1LVAA 3HRSA 5D5WB 3BP8A 4P9FA 1F4KA 1STZA 2P5VA 3G3ZA 3Q9SA 4L9NA 3HYIA 1FLIA 4L9JA 1YO5C 2JZYA 3WG9A 5IT9K 1I1GA 2P8TA 2BV6A 4AIJA 4BAYA 2QWWA 5LGTA 2D45A 2Y48A 4XSZF 3ABUA 4HBLA 4XLNF 1S8NA 4TV7A 4LK1F 5E8GA 4H0EA 1HW5A 3J80K 4CXFA 1T38A 1BI1A 2PEXA 5DD4A 2GA2A 3DEUA 1I6XA 3RYRA 4RB3C 1QGPA 4EGYA 2DLLA 5D8LB 1XSXA 3LSTA 2QVOA 5D5UB 1QQIA 1GHCA 3ZN0A 1YW8A 1IUYA 3H92A 2V79A 5FFZA 2EB7A 4OOIA 4CHUA 5F1RA 4CICA 4ZYGA 2L4MA 4A2UA 1USTA 4EQQA 3ZP5A 3EETA 5IT9Z 4GYGA 2XIGA 4ENKA 5H20A 3E5UA 3CUQC 1FT9A 3ZMSA 1BIBA 1HXDA 3U2RA 5AONA 2VBWA 5HS8A 2QBYA 1IN5A 1PP8F 1ZG5A 3TO9A 2V1DA 2ZO4A 4MEYF 1YW7A 1WWXA 3KP5A 2JPCA 1ZRDA 3C7JA 4CGZA 2O8XA 2J5PA 1ZG3A 3KLNA 2H6CA 5LGUA 4L18B 3W6JB 3EYIA 2O61A 3ZMZA 4B09A 2M30A 5LLQA 5LRRA 5CVRA 3NRVA 1J5YA 2YR2A 5ILUA 1RUNA 2VONA 3RYPA 3I71A 4KN4X 1BOAA 1BBYA 3M8FA 1R1TA 5L3DA 3VOEA 4FHTA 5BOXA 1SFXA 4ESJA 3TGNA 4A5MA 5CYVA 5LHIA 5ILVA 1IRGA 1IW7F 4G8XA 1TW2A 2VODA 4UUVA 1LEBA 4RS8A 4UVAA 1XMAA 2K4BA 1R36A 4UHTA 3WTSC 5KK1A 3K0LA 1Z1DA 1K6OA 4KIGA 2KRFA 2V9VA 1XSDA 2PFBA 5CVJA 4GGGA 5H6RA 1FPQA 3MCZA 4EJVA 4KICA 1JXSA 5FLXZ 2E7WA 2H94A 2EK5A 4BYYA 4D0PA 3R0AA 1TQPA 1SD5A 2G7HA 2PMUA 2VBZA 3V8LA 1QO0D 4LB5A 3GEZA 2V1UA 1L3LA 2ZCWA 3CLOA 2HEOA 3T8TA 3HRMA 1TBXA 3GFIA 1ULYA 4MGRA 4ASNA 2DFIA 2K4JA 1IF1A 4Z2YA 3I58A 4MTDA 1BI2A 4CYDA 1MGTA 4HW0A 1S3JA 1ZLJA 4AD9A 2ELHA 2VOPA 1YTYA 3JAMK 1JGSA 4KMFA 2E1NA 1P4WA 2L02A 3KP6A 1P2FA 2X0LA 1R58A 2YU3A 1HW1A 1UHWA 2Q2EA 3DPTA 4Q5SF 1B1BA 3WE2A 5HDNA 3WTXC 5LEKA 3KP2A 2JPBA 3DQVC 4EMSA 5LHHA 2E1CA 4FX0A 3Q9VA 2FSWA 1ZYRF 2DO7A 4YFNF 3GX4X 2A69F 3HUGA 5D5VB 1FX7A 2WV0A 2RDPA 2OBPA 3KP3A 2QQAA 2ZMEA 1RI7A 4HA8A 2E7XA 2ETHA 4L0ZB 4MQ9F 1IAWA 2VN2A 2JSCA 2ZFWA 2QYOA 3KEOA 2R7FA 1MD0A 3SQNA 4U0WA 1WSUA 4BHCA 4HZFA 1F1ZA 1R22A 3VFZA 3MFKA 1TQIA 4WK8F 4KNYA 3ZMTA 5J8FA 1W7PB 2STWA 2LF7A 3HOSA 1J0RA 1OR7A 2MD5A 3B73A 5DUKA 3VEPA 2Q0OA 4M9SA 1TLHB 5D4RA 3LA2A 3J81K 1RNLA 3GLXA 1D5VA 1YIOA 3CO6C 4U7BA 3KEQA 4GCVA 3F6VA 2GWRA 2GA1A 3WGHA 1HSTA 4R8HA 4GYIA 4ENNA 2MC3A 2HQNA 4LGWA 1I5ZA 3FXQA 2D2WA 3QPTA 3G73A 4I98B 4RGUA 1KQ9A 4S05A 3NEUA 5L3FA 1AWCA 4Q47A 4MNUA 3K9TA 5D6FA 1F5TA 3I4PA 3FWEA 2CO5A 1FY7A 2ZKZA 3QOPA 1DDNA 3TO6A 4N9IA 4IRGA 1ZN2A 3REOA 5HVQC 3R6SA 1XMKA 4WX9A 4G7HF 1DP7P 2C6YA 1MDMB 3CUOA 2VOOA 3I54A 1LDKB 1SAXA 1BC7C 5EEHA 1Q1HA 1G3YA 1WRJA 2CSOA 3RDIA 2CFXA 1K78B 1XSVA 4A5NA 1U6GA 4LFUA 4Q4ZF 2FBKA 3MZHA 3HHHA 3H3ZA 2RC4A 3WODF 1KYWA 4RGXA 5ILSA 5TJJA 5ICFA 1LNWA 4WCGA 2J5OA 3JTGA 3WTWC 1ON1A 1ZARA 4WXDA 3RPQA 4M9ZA 3IHUA 2XAFA 4XSXF 2HWVA 2LF8A 1HSJA 3ZPLA 5KVRA 2FNAA 2Z5UA 3E5XA 5JFRA 2NRAC 1S6LA 3BWGA 4ESFA 5A2QZ 1MJBA 1BI3A 3COAC 1GXQA 2ZBKA 4G7ZF 1BM9A 3ML6A 2FQ3A 5EEGA 4MEXF 4O6JA 4HLXA 2KIUA 2XKOA 1TW3A 3FF5A 2O3FA 1P92A 3ISPA 3ELKA 2P7CB 2FBIA 2LNBA 2OU2A 4UV8A 2AXLA 2H6BA 2GZWA 2V1XA 4KT5C 3ECOA 4UNOA 4B8XA 4G9YA 4ETSA 4YG2F 4IHSA 1D8JA 3QU3A 2VT2A 3PQJA 4WXCA 2YX7A 3V7RA 3DFGA 2YX4A 1KQ0A 2BEOA 4PGGA 3SZPA 5ED4A 4EGZA 1YFHA 2OZUA 3I5UA 1E17A 1FBSA 3M1EA 3GFLA 1MJAA 5ICEA 3IL2A 4M6YA 4GO1A 1B4AA 3N4MA 3FHZA 1GVJA 1KU3A 5FO5A 2ZJ2A 2FBHA 1FYMA 4HV6A 1R00A 4L5IA 3LA3A 1LDDA 2DAOA 1R5HA 1Z9CA 3LWFA 3GFMA 5L3EA 1ZREA 2P4WA 4RB2C 3O3KA 4A6DA 3EQLF 5K1YA 4ZYDA 4A6EA 2EFPA 2K7LA 3MQ0A 3JW4A 2FRHA 3C1DA 3RKXA 5AIPA 4EM0B 3KP4A 4HF1A 3GXOA 4RAZA 1KQ8A 3IWFA 2M45A 3CUQB 4JBAA 4M73A 1DPUA 1W7PA 4U7DA 1Z6RA 1ON2A 2W25A 3ABTA 2ESNA 4L9TA 1G6NA 1PP7U 3E6MA 2EV6A 2M8EA 3L2CA 2Z3YA 3RIRA 1UFMA 3L9FA 3O2PE 3PQKA 4KYWA 3L09A 1YW9A 4MQVA 2AS5F 2F5FA 1XN7A 4CO8A 4IRIA 1CGPA 5HOOA 3JSOA 2FE3A 4KUMA 1W4MA 1YLFA 2F5EA 4KMUX 1XGSA 3U9GA 2A5YB 2P5KA 5E18F 1XDUA 3KETA 2X4HA 2Y0MA 1MDMA 2B0LA 4LK0F 2M1BA 1OYIA 4LB6B 3ZMDA 1SMTA 3GYHX 5FLXK 2QZ8A 3WU1B 1BC8C 6PAXA 2UXNA 5J6XA 3LFKA 1QNTA 2XGXA 1HW2A 2NNNA 4AIHA 5BPDA 3HOTA 3KLOA 1C0WA 3V8JA 1O3SA 5D8KB 5LGNA 5CJ9A 1QZYA 1FSHA 3M8EA 4LLGF 2XUBA 1SD7A 2OZ6A 3FMQA 2PI0A 4PDKA 5DCMB 3FXUA 4Y15A 4HF0A 4L9VA 4KA4A 4OMYA 2XVCA 4ON0A 2MBFA 2QQ9A 2RVCA 2IA2A 1S7OA 2QM3A 3M9AA 3IRRA 3F8CA 2XAJA 4G94A 3R60A 4MHGA 3RTRA 3KZZA 3PFIA 2NYXA 1BIAA 1T0FA 4Y17A 1H9GA 4Q48A 5CVVA 2CYYA 1S29A 2XHKA 4G6QA 1U5TB 3KFWX 4MTEA 1HKTA 2L54A 4QLCU 3HTSB 4EJTA 5L3GA 3FM5A 4ZYEA 1KU2A 4LG0B 1L0OC 3E6CC 4LLLA 2OD5A 2LKPA 2Z33A 4HV5A 1O3QA 1U5TC 3SXYA 2OQGA 1B9MA 1R23A 3V7SA 2P7VB 5CVUA 2EV5A 1J59A 2UXXA 1EH7A 4PGHA 5HLHA 1R5GA 4LLNA 2Z99A 4YFKF 4KIFA 3EUHA 5D5XB 3GO5A 1FP1D 1G4DA 2DW4A 2ZNZA 1YS7A 4AWXB 1P6RA 4FT8A 3JTHA 1XGOA 4KIBA 2W57A 1ZGAA 2L01A 1BJAA 2HS5A 1P4AA 1SMYF 3QRFF 4DQ2A 1K7AA 5E17F 4NHJA 2ZXJA 2EA4A 3RPUA 3F6OA 3T1BA 2VT3A 5ERIA 3FMRA 3HRTA 2HYFA 4ZZDA 3BJOA 1MJ9A 3W6KB 5J8CA 3CUQA 1KU9A 1ZLKA 2PJPA 1B59A 1QZZA 4KDPA 1DPRA 4HQEA 4N0BA 3NQOA 2MLKA 2FMYA 3CTAA 2XV4S 1V3FA 1FNNA 2CWEA 3ZN1A 2COMA 3F21A 4Y13A 1WI9A 3AAFA 5IT3A 1YQAA 5FFXA 1TNSA 5FGMA 2YPRA 5K5QA 2Z9OA 4WF2A 2HYGD 2ISYA 4PCQA 4OIPF 5E8IA 1IN7A 3RI4A 3IKVA 5ICGA 1XCVA 2HTSA 1FYKA 5DYMA 4L0YB 4S04A 3GF2A 4ENMA 3P7NA 3GVAA 2IVMA 2A07F 4HX4A 4HX7A 2PBIA 4U0VA 2MA3A 1KA8A 4GXOA 2M5WA 3WE3A 1OPCA 2YSRA 1HBXG 3ROUA 1D8KA 1LEAA 1FOKA 3P9CA 3SHFA 4JQFA 3WTZA 3P9IA 1OYWA 1PUEE 2R3SA 1U8RA 3BDDA 2JTVA 3FM3A 4RAYA 4I7HA 1FSEA 4EJOA 4G7OF 3C3WA 3TKYA 5A2QK 1RIOH 3VB2A 2XAQA 1O57A 1LJ9A 5DDGA 3BZ6A 4BHPA 1R1UA 2JRTA 3K1MA 3B02A 2G7UA 2HR3A 3BPVA 1IN6A 2A6HF 4DNCA 4LMYA 3SZTA 1IXRC 3KCCA 3MEXA 5HLIA 5DCMA 2MH2A 2A61A 3T5XA 4UV9A 2DQLA 4U0YA 3E97A 5K5RA 4A0XA 4F7ZA 1HKSA 4OINF 2NAZA 5FD5A 2IRFG 1HKQA 3LQQA 3HSEA 2GAUA 4OIQF 2IP2A 2CG4A 1IZ1A 3IRQA 1U78A 2DK8A 3BPXA 2CW0F 2WC2A 1RUOA 3DF8A 1U5TA 2IA1A 3J7AO 4RGSA 1FC3A 1F9NA 4P96A 3TOAA 1YS6A 2HFHA 4LG0A 1JE8A 3EDPA 2BBYA 4A12A 2D1HA 2CQKA 1T2KA 4HYEA 2QQBA 1T39A 2H27A 3U1DA 2MLGA 4A0YA 2XROA 1J9IA 3V4GA 4NB5A 4BNCA 4OMZA 3ECHA 1ZHFA 3WTVC 3O6BB 5BPIA 4IXAA 3QU6A 2HKOA 4HDUA 1U2WA 2W85A 1D3YA 5F6FA 1XD7A 5HS7A 2RN7A 5JR3A 3TOBA 4I2OA 2EJRA 2ADUA 3TDZC 5E20A 4O3MA 3ULQB 1Z91A 1OKRA 4IF4A 2EA2A 3R0JA 3I64A 1IXCA 3WTUC 2VBXA 4WXHA 4HOBA 5LBQA 4XLPF 1ZRFA 3F3XA 4OIOF 3S2WA 3QPHA 5AIQA 1K79A 3L00A 4EJWA 2IT0A 4HLYA 2R7DA 1OMIA 5E1ZB 2PMHA 3K69A 4O5VA 2DTRA 2VC1A 3TO7A 1QPMA 2DI3A 1ZH5A 1W5TA 3FZVA 3HHGA 4RB0A 1ODDA 3WGIA 2HDCA 2IPQX 3ERED 1XGMA 4AVPA 2ZMEB 3WTTC 5BQTA 3GZ6A 1TTYA 1ZAOA 2FF4A 1DUXC 5BS6A 3LA7A 5F64A 2DPUA 1CF7B 2FXAA 1FP2A 2GIVA 2ESHA 5FB2A 1J7KA 3I53A 2XAHA 2FOKA 3KE2A 2HGCA 4IHTA 1AOYA 1LB2A 1T6SA 3H3UA 3GFJA 4EVIA 5JVTA 2PQ8A 2A6EF 2EWNA 1G3SA 1IN8A 1ZG1A 5JHUA 1MZBA 3IKTA 2FA5A 4IJAA 5CVIA 4HQMA 3TDUC 2P6TA 1UB9A 4BQAA 1Z7UA 1ONVA 4RB1A 3JSPA 5DCFA 1S7AA 5L3CA 1FZPB 3J80Z 3HRUA 1JHFA 4P5OA 3FXRA 1KGSA 3EYYA 2VC0A 3Q5FA 4UXNA 4ZYHA 4ENJA 4M74A 1BN5A 1G3TA 1VTNC 5CLSA 3SFZA 2GXGA 1K78A 2A68F 3K1NA 1Z05A 1I27A 1WKMA 3LAPA 3R4KA 4I01A 1YYVA 1FBUA 3KZYA 2STTA 4A0ZA 4PZJA 1SD4A 3BOQA 2VE9A 3R61A 2HKXA 4I02A 5LRSA 3LQRA 3DXJF 1UHMA 2IA0A 2WTEA 3GUDA 3FX3A 3CJNA 1SFEA 3LAJA 2DK5A 2PN6A 1B6AA 4OU0A 2OA4A 4YFXF 4HDVA 5HDGA 2KJCA 3V8KA 2RNJA 2K86A
chains in the Genus database with same CATH superfamily
5DD8A 4BH9A 2DOEA 1OYYA 3N97A 2ZXWH 1XB4A 3L2WA 4FCYA 2A6TA 4I09A 3E6BA 3BT9A 3N05A 2LDUA 2ISZA 2EZHA 3DPLC 2BVMA 1HDDC 1BR1A 4YIIA 3BC8A 2K02A 3CDHA 3DKWA 5B1BH 1OCRH 1IN4A 3DV8A 2LSOA 2H09A 2LK2A 2TDXA 3DPUA 3TQNA 1TWGJ 2DT5A 2DU9A 2F5CA 2FNPA 5FJ8J 4JK1X 3KPHA 5DS9A 3HDDA 2CU7A 2E5ZA 2L7FP 3I0TA 2W24A 5K5OA 3D0SA 3TEDA 3ABLH 3CCLI 1IO2A 3DEWA 2XASA 1RKWA 2IEKA 4HX8A 2E60A 2RQPA 4HAMA 2L3DA 3AKZA 2DFEA 2ACJA 3S93A 2O03A 4RGRA 4I0AA 1FJLA 3I59B 4L5JA 2VB6A 2ECCA 1SD6A 2AHQA 4NQWA 1NH3A 4BXXJ 3FIWA 4G6DA 1MW7A 4BBSJ 2GXAA 3ESWB 3OYJA 3JRAA 5M5WJ 2AO9A 2JWTA 1A04A 2MYSA 2WWYA 1ZRCA 2L9SA 2OJED 4QWQA 1KONA 2KIFA 1GXPA 2VXZA 1HQCA 3GZ5A 2PG4A 1NHAA 1IRFA 3OV8A 3WU2C 2VI6A 1XDSA 3K1PA 4BEHA 1RZ4A 3KX2A 3JRDA 1TQMA 1A6QA 2Z16A 2NS0A 2BGCA 3CQZJ 2IS1A 4BGDA 3VDXA 3CO7C 3Q3SA 3D5LA 5JI6A 1EA3A 1VQ7I 2MG4A 2NXNB 1LKXA 5HS9A 1WQ2A 3K2ZA 3ZQHA 4IQJA 1MKMA 5HLGA 1G3WA 2JT1A 4YRVA 4FE4A 1UG2A 3QYBA 1QVUA 4W1UA 4R79A 4IOAF 4RAFA 1FWZA 2QSHX 2NNYA 4I0BA 3JRCA 2IJLA 2V6CA 2Y2ZA 4II3A 2CV0A 2V9PA 5DM7F 1O7LA 1D0XA 1MSEC 4XNFA 3OS2A 1N77A 1JKPC 2B9SA 1H9TA 3IWZA 2M7AA 1QRYA 1E0EA 1WVRA 3BJAA 4AIKA 5IYDJ 1WH7A 4HF2A 2DPDA 4M3BA 4Z6YA 2HXIA 3HOWJ 2EFNA 3K4KA 2JQ7A 2D5VA 1HDPA 2P5LC 2IXSA 2CGPA 3QP6A 4X1EA 1H0MA 3CC7I 3AG4H 2OTLI 2GOXB 5C4JJ 4EJUA 3HIFA 2UWMA 1WJBA 4ESBA 1VQ9I 3M7GA 1PUFB 5DUIA 4BQQA 1JHHA 2GQQA 2I5UA 2HQRA 1SFUA 2K3PA 3FMSA 4EM1A 1SFOJ 3QP5A 1CF7A 3S1RJ 2A3SA 1O3RA 2ZC2A 3F8FA 1LDJA 4IQ4A 2XF5A 3JAMZ 3JRFA 2R0QC 3F8NA 4KN7X 3H9GA 4XKCA 2Y75A 2TCTA 4CCJA 5D6EA 2I10A 2RKHA 2E5NA 4KT6A 3GWZA 5E1XA 3CMEI 1XGNA 3BJ6A 3K2AA 1XTAA 1UCRA 2F5DA 2M87A 5CQGA 4YIFA 4M6XA 1T56A 3E5QA 5DEQA 1G2HA 2VQHA 2L4AA 5H6QA 4ZH4F 4HRIA 1JTYA 1O3TA 4X0GA 1V4RA 4E7IA 4LJZF 5GPAA 1X3UA 1FYLA 2R7QA 1GV5A 1R4NB 1MBJA 1TNTA 2QENA 3L2VA 3H5AA 1HLVA 2OQRA 2NVQJ 2ZNYA 2ZJQF 2JN6A 4ZYAA 2QLZA 2RGVA 2EFWA 1R5ID 1YG2A 1JJ6C 1T8IA 3G6EI 1XCBA 2YS9A 2DDBA 2G9WA 3ZMUA 4B3AA 2BYVE 1N75A 2F2EA 2LC2A 1XMXA 1RETA 3BZCA 4ZDOA 3ZOBA 4BHBA 2KKOA 2LBFA 3LFUA 1R1VA 4EEFG 3OIQA 3HL2A 5EEAA 3WU0A 4IVNA 4E7HA 4UVCA 1EH8A 1VQ6I 3T0YA 2VBYA 2Q8KA 2B7EA 1SFKA 3BG7A 2EV0A 3F72A 1VQOI 2M2EA 2D1VA 3JREA 1USSA 1U3EM 2QBYB 3VSKA 2DODA 1EH6A 3FDYA 1REPC 3KP7A 2KJBA 5LEJA 4X6AJ 2CUEA 2FMLA 3MWMA 3BY6A 5TRDA 4IPAA 4B4CA 2FU4A 2FEZA 3E6DA 2UZKA 3G1MA 4FX4A 2JA2A 4A3EJ 2IW5A 2OV7A 3RJPA 2R92J 5F27A 4ZDPA 5LHGA 4BXUA 3IP4B 5DV5A 3RKWA 2W84A 2P6SA 1VQNI 1VQ8I 4KFCA 1LQ1A 1VNDA 1I1SA 4CDGA 1KYZA 4FETA 1W5CC 2HTJA 3VODA 1GUUA 3J81Z 2E2IJ 2HQ5A 4ZZLA 4OIRF 3DTEA 2BXYA 4A3MJ 3ONQA 1DU0A 5GTIC 1V55H 4I99C 4IO9F 2XKPA 5F04A 5L3BA 2O6GE 2DMTA 1T98A 4CCNA 3FXMA 3CMYA 3HSRA 1U9NA 2DBBA 1R7JA 2ME6A 2VE8A 4CZZA 1FBQA 3OYMA 2HZTA 4EV0A 2E71A 2VPRA 2HDDA 2X51A 3X2QH 1QBJA 1J75A 4M72A 3DP7A 1Y0UA 1DGRM 4P9UA 1N78A 1X3WB 1EKEA 1PJRA 1I6HJ 3V7CA 4K2EA 4DIQA 1Z6TA 3HEFA 3MAJA 4UVBA 1O7FA 1QVTA 2BXZA 1BI0A 3F8MA 5E1WA 4C3IJ 4HPQA 4UUTA 2K9LA 5IPAA 2RV8A 2EH3A 1WZ2A 4M71A 3F8BA 4B48A 1EV7A 2EFOA 3MN2A 1YITI 2L7ZA 2WAQA 3HTUA 5C4XJ 2NS7A 5EYRA 1D1AA 5B3SH 2OCEA 4EM2A 2HOEA 2GXBA 2QUFA 3NARA 1RPWA 3GTOJ 4B43A 2XRNA 2DQRA 3ZQ7A 1X1BA 1R71A 3G1OA 2DMQA 2K27A 3WTYC 4CZCA 3NAUA 5D4SA 3GW2A 3VWBA 3E3VA 3HSFA 1W5SA 3MKLA 3UKGA 1RR8C 2MH9A 1W7PD 4JOMA 3BTCA 3OYIA 2PLYA 4U88A 1GLNA 3RKYA 3L7WA 2BVLA 3ZQQA 1PYVA 2HOAA 3HB9A 1J2XA 3HJEA 4IRHA 3ZMVA 4AYBN 1X58A 4IL6C 4D5FA 3MKYB 2IS4A 5GADJ 2JVHA 1X2NA 5FROA 3IC7A 5FD6A 2LRDA 2VJ5A 2GBYA 3I59A 3OOPA 3WGGA 3P9KA 2X6OA 2WA0A 4NBQA 3ZRGA 5H2FC 1A35A 4BACA 1PDNC 1OQYA 4E70A 2XSJC 4M9XA 3C18A 3H1CA 5DTDA 4R1HA 5ICCA 4WWCA 1VFCA 4ZC3A 2XAGA 2KIMA 1E2XA 3HBLA 4P55A 4BL0B 2CH0A 1WJAA 4XRFA 1P4XA 3H9JA 4D5CA 1Y56A 1T0FC 5F0HA 2OAZA 5BMZA 2HVSA 3F23A 2NVYJ 2O0YA 2BE5F 3QAHA 3BLYA 4JP0A 1KU7A 3DCFA 1I3QJ 3MZYA 4LD5A 1R6RA 4XBFA 2XPUA 3BROA 1ZGJA 4N9HA 4BE1A 4PSWA 1VI0A 4D7MA 5HDKA 3F22A 1MBFA 3T8RA 4QSHA 1I39A 1TT5B 2EFQA 2JJ7A 2UUZA 1IXSB 2IBDA 4XOTA 1S7EA 2HOTA 1B9NA 5F08A 2KHMA 2MGQA 1IDYA 5FRMA 1LVAA 3HRSA 4L5EA 4J19A 5D5WB 3BP8A 4P9FA 1F4KA 1STZA 2CV1A 2P5VA 3G3ZA 3Q9SA 2NVXJ 4L9NA 3HYIA 2Q2EB 1FLIA 1ORKA 2BZTA 4B3XA 3PIPF 4L9JA 4IHWA 3ABKH 1YO5C 3DLAA 1K4TA 4XONA 3PNTA 3Q0WA 1UG0A 2JZYA 3U1KA 2M3AA 2KT0A 3WG9A 3O8HA 3ASNH 5IT9K 1PUFA 1I1GA 2P8TA 2BV6A 4RDUA 4PUSA 4AIJA 4BAYA 4XLHA 2QWWA 5LGTA 2D45A 2DA5A 2Y48A 4A3JJ 1W36C 4XSZF 3ABUA 2OPTA 4OAYA 2K9SA 3BG9A 4HBLA 5FRNA 4E7KA 3HUGB 4XLNF 1S8NA 4TV7A 4LK1F 3EUAA 3TP0A 3WHCA 1SC7A 4LITA 3EUHC 5E8GA 4H0EA 1X3ZB 1HW5A 3U21A 3J80K 4CXFA 1T38A 3K4JA 1BI1A 2PEXA 1KZHA 5DD4A 2GA2A 2VLAA 3DEUA 1I6XA 4E4HA 3GTMJ 1LVKA 3K7AJ 3RYRA 4D7NA 3S8PA 4RB3C 1QGPA 3M3YJ 4LG3A 4EGYA 2R7RA 2KRHA 2PMZN 5J3LA 2DLLA 5D8LB 3A2KA 1XSXA 3UNGC 3LSTA 2QVOA 5HODA 2M4KA 5D5UB 1QQIA 1GHCA 2GM4A 3ZN0A 5IYBJ 1YW8A 2LH9A 3VYSB 1IUYA 2G0EA 2XGCA 3H92A 3LNQA 1WJFA 1GDTA 3FXKA 2V79A 3DWLE 5FFZA 2EB7A 4OOIA 3IH4A 5F1RA 3OS1A 4CHUA 4NC6A 4CICA 4ZYGA 4DBRA 2L4MA 4A2UA 1USTA 4EQQA 3ZP5A 2WAQN 4F91B 1AKHB 2L0KA 3EETA 3K4NA 5DM6F 5IT9Z 4GYGA 1NK2P 5J4VA 2XIGA 2CS3A 4ENKA 5H20A 1B72A 3E5UA 3CUQC 5C44J 1FT9A 2LMDA 4PFPA 1DGWY 4N4OB 3QWLA 3TL4X 1WJCA 3ZMSA 1BIBA 1HXDA 4NC8A 1E3PA 3U2RA 5AONA 3HC7A 2VBWA 2BY3A 1WGXA 2W1OA 5HS8A 2QBYA 1IN5A 1AA7A 4KJZA 1BA5A 2O8KA 3KZIC 1CQTA 2EZLA 1PP8F 2EPFA 4E7ZA 4XKWA 1PVEA 3QPSA 3QYFA 1ZG5A 3HKZA 3TO9A 2V1DA 2ZO4A 3K4BA 4PSXA 4MEYF 1YW7A 4V2GA 1WJEA 1WWXA 3M07A 3KP5A 2JPCA 1MH3A 1ZGWA 4BJ6C 2VQCA 4HSTA 3OL3A 5EG0B 1ZRDA 3C7JA 3BTLA 4RLFA 2O8XA 2J5PA 4CGZA 3LSGA 1ZG3A 3FBNB 3KLNA 5GP9A 2H8RA 3DU6A 2H6CA 5LGUA 4L18B 3W6JB 3EYIA 2EIJH 2DXIA 2O61A 2X6XA 2DYSH 3ZMZA 4B09A 4S0HB 1IV6A 3PSFA 2M30A 2DA4A 2AXTC 5LLQA 3M4OJ 5LRRA 5CVRA 3NRVA 1J5YA 2YR2A 5ILUA 1RUNA 1FMVA 2VONA 3OYGA 4I6ZA 1Y8QB 2LREA 1APLC 5J1UA 1MBEA 1I50J 4F92B 3HXLA 3RYPA 2BY0A 3SZGA 3I71A 4KN4X 5HNFA 1BOAA 3CP8A 3PFYA 1BBYA 3M8FA 1R1TA 4BJTA 5L3DA 3VOEA 4FHTA 4C2MJ 5BOXA 1IGNA 1SFXA 4RBOA 4ESJA 3TGNA 4A5MA 5CYVA 5LHIA 5ILVA 3C2HA 1IW7F 1FOYA 3RZOJ 1IRGA 2Q1ZB 4XR6A 4G8XA 3PNYA 2NVUB 1TW2A 2VODA 4UUVA 3MKZA 1LEBA 2E2JJ 2R5YB 2WY7Q 4RS8A 4UVAA 1XMAA 2K4BA 1R36A 4IKFA 4IX7A 4UHTA 4AM3A 3WTSC 5KK1A 3K0LA 4PJ0C 4IOCF 3RPUD 1Z1DA 4ZTFA 3P5JA 1K6OA 1ZTRA 1JKOC 2LTPA 3H0DA 4KIGA 2KRFA 2V9VA 3OS0A 1XSDA 2PFBA 5CVJA 1XS9A 3ZQLA 3OIOA 4XMYA 3CCJI 4GGGA 5H6RA 1FPQA 3MCZA 1Z67A 2M8GX 2HI3A 9ANTA 5F1JA 1MMSA 4EJVA 2KZVA 1P7IA 3SYTA 4KICA 2R7UA 1JTXA 3SDGA 1JXSA 4BY7J 5M5YJ 5FLXZ 2E7WA 2H94A 2KIQA 3I4MJ 3QOEA 2DOAA 2EK5A 4BYYA 4D0PA 3WG7H 2Y0SN 3R0AA 1TQPA 3B6AA 1Z0XA 5FKKA 1SD5A 2G7HA 4XN3A 2PMUA 2VBZA 3V8LA 1QO0D 3ZQCA 4LB5A 4A3GJ 2HQAA 3GEZA 1RR7A 3HOVJ 2V1UA 1L3LA 2ZCWA 1R49A 3CLOA 2LD5A 2DA3A 1LFPA 2HEOA 1S5LC 3T8TA 3HRMA 2WADA 1Z3YA 2VJJA 4IHXA 2ELKA 5E3OA 1TBXA 1UAAA 1MMDA 3GFIA 4GFBA 1ULYA 4MGRA 4ASNA 2DFIA 2K4JA 3HOXJ 2ZJPF 1QPIA 1IF1A 2B63J 4Z2YA 3I58A 4MTDA 1BI2A 1LFBA 4A69C 4CCKA 4CYDA 1MGTA 2CUFA 3CCMI 4W97A 4HW0A 1S3JA 3F0CA 1JJ8C 5JLWA 1ZLJA 4AD9A 1ETYA 2ELHA 2VOPA 1MMAA 1YTYA 3JAMK 3JCUC 3K70D 1JGSA 4KMFA 1WI3A 1I3AA 2E1NA 1MBKA 1P4WA 5TGTA 1A6IA 3BR6A 2XGEA 3ZCOA 2QF7A 2L02A 3KP6A 1P2FA 3H3VK 2X0LA 1R58A 2YU3A 3UR3C 1HW1A 5M5XJ 1UHWA 2Q2EA 3DPTA 2Y69H 3BZKA 1SVLA 1K4SA 4Q5SF 1B1BA 3WE2A 5HDNA 1X1PA 3WTXC 5B5EC 5KHDA 1GVDA 2UV1A 4XIDA 5LEKA 4BXFA 2R7VA 2DFFA 3KP2A 1W0UA 2JPBA 3DQVC 4EMSA 2KFDA 5K7FA 5LHHA 2E1CA 3LSMA 4FX0A 3Q9VA 2FSWA 1ZYRF 2DO7A 4YFNF 3CDIA 3W3CA 3GX4X 2A69F 3HUGA 2LOOA 5D5VB 1FX7A 3JR9A 1OCTC 2WV0A 2RDPA 5GAEJ 2EIKH 2OBPA 2FX0A 3FKJA 2OC6A 3KP3A 1JGGA 2QQAA 2V4JC 2ZMEA 2X6YA 1RI7A 2KL4A 4XORA 3DU5A 1LE8B 2LVSA 4RAGA 1E3OC 5B1AH 4HA8A 2L9RA 2E7XA 2ETHA 2LY9A 4L0ZB 4MQ9F 3A1YA 4OWRB 1IAWA 1FIPA 2VN2A 1D5YA 2DN0A 1MMGA 2JSCA 3AG3H 2TRTA 2ZFWA 3D5RC 4XLEA 5EGOB 2BHZA 2QYOA 5FLMJ 1P9QC 3BQZA 3KEOA 2R7FA 1MD0A 1TC3C 3SQNA 2HYJA 1JKQC 4U0WA 3L1PA 1WSUA 2K3FA 2ID6A 3KIOA 3BCBA 4BHCA 5KNLA 4HZFA 3GLLA 1F1ZA 1R22A 2XPWA 3VFZA 4DBQA 1MIJA 4D9JA 2R5ZB 3GTPJ 3MFKA 1TQIA 2VJIA 3ZR8X 4WK8F 4KNYA 3ZMTA 3ABMH 2XDVA 3A02A 1AKHA 5J8FA 1W7PB 2DFHA 2STWA 3OYAA 3KEYA 2CW7A 2LF7A 1D0ZA 3HOSA 4PK4A 2K5CA 1MNMC 1J0RA 1OR7A 2MD5A 2X9DA 3B73A 5DUKA 3VEPA 2Q0OA 1WFXA 5KAIC 4M9SA 4Y4RA 1TWFJ 1TLHB 4CYCB 3IAM2 3MZ8A 5D4RA 3LA2A 4PJJA 3J81K 5CPRB 3A01B 1RNLA 3GLXA 2LFBA 4PJLA 1D5VA 4E6KG 3PIOF 3S17J 3K4MA 1YIOA 1Z21A 3CO6C 4U7BA 3KEQA 4GCVA 2W48A 3DBRB 3F6VA 2GWRA 2GA1A 3WGHA 1HSTA 3GTJJ 4R8HA 4GYIA 3CCVI 5JVGF 4ENNA 1YX5A 2MC3A 2HQNA 4J01A 4LGWA 1MSFC 4V2FA 1I5ZA 3LL7A 4XRSG 2ELJA 3FXQA 2D2WA 5GTHC 2NVTJ 2DMUA 3QPTA 3G73A 1LUJB 2KPMA 4I98B 4RGUA 2BW3B 1KQ9A 2I8DA 2DA6A 4S05A 5EG0A 2JRMA 3NEUA 5L3FA 1AWCA 2DYRH 4Q47A 3HZJA 4MNUA 3D1NI 2X1CA 3K9TA 5D6FA 3IH3A 2FOWA 1F5TA 1JUSA 3I4PA 3FWEA 1MNEA 1FY7A 2CO5A 2ZKZA 3K4LA 3AG1H 3QOPA 1ZR2A 3VPRA 3W2WA 4ANJA 4CA0A 1DDNA 3TO6A 4N9IA 4IRGA 1ZN2A 3REOA 3C2GA 1F36A 3S1MJ 3PNVA 5HVQC 3R6SA 1XMKA 3OYEA 4WX9A 4G7HF 4E7SA 2WB1A 1DP7P 1BJZA 2C6YA 3MMYB 2JUGA 1MDMB 3ZQFA 3S32A 3PL8A 3M8JA 3CUOA 4XOPA 2VOOA 3I54A 1LDKB 4DYRA 2P0WA 3VYRB 1SAXA 5EEHA 1BC7C 4M6VA 1Q1HA 1G3YA 3E1SA 3IV5A 1WRJA 2CSOA 3RDIA 2CFXA 1K78B 1XSVA 4A5NA 5IYCJ 1U6GA 1DQUA 2L9NA 4LFUA 3CLQA 3BG5A 1OCPA 3MVPA 4Q4ZF 2FBKA 5J1YA 3VYUB 3MZHA 3HHHA 3D5SC 3H3ZA 2RC4A 3WODF 1OISA 1KYWA 4RGXA 4G12A 5ILSA 5TJJA 5ICFA 2CW8A 3H35A 4UB8C 1LNWA 2R5YA 3S2HJ 3BR2A 4WCGA 4MLOA 2J5OA 1DP3A 3JTGA 2VQLA 1ZKGA 2JVGA 3WTWC 1ON1A 1ZARA 2BHYA 1NG7A 2NS8A 4WXDA 3RPQA 4M9ZA 3IHUA 2KLOA 1VQ4I 3SEZA 2XAFA 4XSXF 3SDBA 2HWVA 2LF8A 2V1NA 2X1DA 1HSJA 4LOCA 5GPCA 3ZPLA 4A3BJ 5KVRA 2RNGA 2Z5UA 2FNAA 4EATA 2A5WA 3BR0A 1D1CA 2X85A 2K9QA 3DKXA 3E5XA 1QU3A 5JFRA 2NRAC 1S6LA 1NTCA 3BWGA 4RM3A 4ESFA 5A2QZ 4BY1J 2L7MP 1MJBA 4Y52J 4II2A 1BI3A 3OYLA 3COAC 2R93J 1GXQA 2ZBKA 4G7ZF 3FISA 1BM9A 3ML6A 2EILH 1A31A 2EIMH 2FQ3A 1BW5A 3S1NJ 5EEGA 4MEXF 4MFDA 1X4PA 4O6JA 4HLXA 2KIUA 1FIAA 2XKOA 4BE2A 3LSRA 2KP6A 1TW3A 2Y31A 2L2OA 3FF5A 1VQPI 2O3FA 1P92A 3ISPA 2V26A 3ELKA 1IRXA 2MC4A 2P7CB 2FBIA 2LNBA 2OU2A 1R9TJ 4UV8A 5EZHA 1QHGA 5B66C 4IZZA 2RQQA 5E3MA 2AXLA 2H6BA 2GZWA 2V1XA 3OMYA 4KT5C 1VQMI 3ECOA 4UNOA 2KISA 5IOZA 4RMNA 3HG9A 4ZTJA 4B8XA 4G9YA 4ETSA 4YG2F 1VF9A 2GLOA 4IHSA 1D8JA 1OLTA 3QU3A 2VT2A 3PQJA 4WXCA 2V6EA 3L2UA 2JA7J 1Y1VJ 2YX7A 3V7RA 3DFGA 2YX4A 1KQ0A 2BEOA 4PGGA 3SZPA 5ED4A 4EGZA 4MO7A 1YFHA 2QA4I 2OZUA 3I5UA 1E17A 1FBSA 3M1EA 3GFLA 1MBGA 2FUG2 1MJAA 3CC4I 1SAUA 5ICEA 3IL2A 1V5FA 4B44A 5TISC 4FISA 4M6YA 2WBMA 4GO1A 5IP9J 1B4AA 3N4MA 3FHZA 4BE0A 3G71I 1GVJA 1KU3A 5FO5A 3ASOH 2O7OA 2ZJ2A 3SFIA 1X19A 2FBHA 1FYMA 4HV6A 1R00A 4L5IA 3IH2A 3LA3A 3L2QA 1LDDA 2DAOA 1WJDA 1R5HA 3RSNA 1HA8A 1MMNA 1Z9CA 3LWFA 1MNDA 1V5GA 3GFMA 5L3EA 2IGOA 2P4WA 4RB2C 4A3KJ 1ZREA 3H36A 3O3KA 3CJQB 4A6DA 3EQLF 3NWTA 1WH5A 5K1YA 4BKXA 4ZYDA 1YOVB 4QPOA 4A6EA 4CCMA 1FOWA 2EFPA 2K7LA 3OYHA 3DTKA 4F55A 1ITYA 1LE8A 3RQ4A 3MQ0A 1JI8A 3JW4A 2FRHA 3C1DA 3RKXA 2L9VA 5AIPA 4EM0B 2PX9A 3KP4A 3W2VA 4HF1A 5EGOA 2AQFA 4E7JA 2QQ8A 3JRBA 2W4SA 1G8XA 5F0FA 3CCSI 3GXOA 5IP6A 2IS2A 2M0CA 4RAZA 4AUXA 3S16J 5FLVA 1KQ8A 3E7LA 3A0BC 3IWFA 3PO2J 3CD6I 2M45A 3CUQB 4JBAA 2FD5A 2E2HJ 2CQQA 4M73A 1DPUA 1W7PA 2KRCA 4U7DA 4YELA 1Z6RA 1RRJA 1ON2A 4DW6A 2FQ4A 2W25A 3ABTA 2V9KA 2ESNA 4L9TA 1G6NA 2F48A 1PP7U 3FK6A 3E6MA 1X1AA 3AL0C 2EV6A 2M8EA 2HVQA 4CYCA 3L2CA 1FTTA 2KQRA 2EINH 3MKWB 2OUMA 2Z3YA 3J7YJ 2KDZA 3QQAA 3M1CA 4XRSA 3CCYA 3RIRA 2IGNA 2GIZA 1UFMA 4B47A 1B8IB 3L9FA 3O2PE 4CSWA 2DA2A 1S72I 3PQKA 1GT0C 4A3CJ 3VSLA 1JKRC 4KYWA 2M9HA 3G1LA 1YW9A 2JMWA 3L09A 4MQVA 2AS5F 1YRNB 3TW7A 2X6WA 1M1EB 2F5FA 1TWHJ 1XN7A 1POGA 4CO8A 1XG1A 2DTZA 1OCOH 4IRIA 1CGPA 5HOOA 4M3GA 2FE3A 3JSOA 3B6CA 4KUMA 5CKTA 1W4MA 1YLFA 2F5EA 4KMUX 4JX5A 1XGSA 2LBFB 3U9GA 1JUMA 2A5YB 2P5KA 5E18F 1XDUA 3KETA 2X4HA 2EBIA 2DJNA 2Y0MA 1MDMA 1ENHA 3PO3J 2B0LA 4LK0F 1VQ5I 2XRLA 3HGYA 4G6TB 2M1BA 2MFZA 1OYIA 4LB6B 3ZMDA 4CCLA 1SMTA 2O9LA 3DLLF 1IG7A 5FKOA 3GYHX 5FLXK 1Y0NA 1VQKI 2QZ8A 3WU1B 1BC8C 6PAXA 2OTJI 4F52A 3K70C 2UXNA 5J6XA 2VXDA 3LFKA 1QNTA 2XGXA 4MFEA 4JYKA 1HW2A 2NNNA 3ZGKA 4AIHA 5HNHA 5BPDA 3HOTA 3KLOA 3NWSA 2VIXA 4FASD 1C0WA 3V8JA 1O3SA 4LIUA 1TWAJ 3F9KA 5BNGA 3QPLA 4E7LA 2X1EA 5D8KB 5LGNA 4NDLA 5CJ9A 1MH4A 3L2RA 1JT6A 1QZYA 4KISA 1FSHA 3M8EA 4LLGF 2XUBA 1SD7A 2ICWG 2OZ6A 3FMQA 2PI0A 4PDKA 5DCMB 3FXUA 4Y15A 4HF0A 3S3OA 4HNVA 1HCRA 2OCCH 3JRGA 4L9VA 4KA4A 2DA7A 4OMYA 2XVCA 4ON0A 2MBFA 2QQ9A 4BDZA 3PSIA 2RVCA 1JT0A 2IA2A 2F6CA 1S7OA 2QM3A 2K85A 3M9AA 2HPMA 4UY8I 5KAFC 3IRRA 3F8CA 2XAJA 3S14J 4C3JJ 3CC2I 2JSPA 5LD2C 3OL4A 1BL0A 3GMEA 1OJLA 4G94A 3R60A 4MHGA 3RTRA 3KZZA 4A3LJ 4BQNA 3LOCA 3PFIA 2NYXA 1BIAA 3PUBA 5J47A 1T0FA 4Y17A 1H9GA 1BR2A 2VASA 2BY2A 4Q48A 5CVVA 2CYYA 2HOSA 1S29A 2XHKA 4G6QA 2LR8A 1Q1VA 1ZK8A 2YU9J 1U5TB 3RZDJ 3KFWX 4BBRJ 4DOZA 1X4OA 3CF5F 4MTEA 1YX3A 1U8BA 1HKTA 2ZXHA 3CP2A 2L54A 4QLCU 1IUFA 1Y8RB 3HTSB 4EJTA 5L3GA 3FM5A 4ZYEA 1KU2A 4LG0B 3ERMA 4UUSB 4D1QA 1L0OC 2QGUA 3E6CC 3LSIA 3HOZJ 2WAEA 4N4NB 2ZSIB 3GBGA 1XPXA 2VKHA 1HOMA 2Z1DA 2LKSA 4LLLA 2OD5A 3OYCA 2CQ7A 2LKPA 2CUZA 2Z33A 4HV5A 1O3QA 2RREA 1U5TC 3OR1C 3SXYA 4IEJA 2VPLA 2MW8A 2OQGA 1B9MA 5IP7J 3JRIA 1XC5A 1R23A 3V7SA 2CQNA 2P7VB 3CMAI 2VQGA 1XX5A 5HLTA 3FBIB 5CVUA 4Y7NJ 4BU2A 2EV5A 3BCAA 1J59A 1ZQ3P 1VZ0A 4XRMA 2UXXA 1IC8A 2EZKA 4FE7A 4C3HJ 1EH7A 1NK3P 3QYEA 1V54H 2PJRB 4PGHA 2BY1A 2W00A 5HLHA 1FOXA 1R5GA 3GTGJ 4LLNA 2HPIA 3HKZN 2MSYA 1X2MA 2Z99A 4YFKF 3CMMA 4FQGA 4KIFA 3EUHA 3HGGA 5D5XB 2QCOA 3GO5A 4XM3A 1G59A 2WY8Q 1FP1D 1G4DA 2DW4A 2ZNZA 1ZR4A 3PUFA 1YS7A 4AWXB 1P6RA 2Y30A 3BQYA 3E0JB 4FT8A 3JTHA 4M3FA 1XGOA 4KIBA 3H0GJ 2W57A 1ZGAA 2FJ1A 2NOGA 1BOBA 1R4MB 5JHFA 4YEJA 2Y9ZA 2L01A 1BJAA 3G4SI 3AG2H 2HS5A 1P4AA 1SMYF 1D1BA 3OOUA 4NUBA 5J40A 4HNUA 3QRFF 2EZIA 4DQ2A 4QTRA 1H88C 1K7AA 5E17F 4NHJA 2ZXJA 3CCUI 2EA4A 3RPUA 3F6OA 3T1BA 3CCEI 2VT3A 5ERIA 3FMRA 3HRTA 2HYFA 1QHHD 2RAEA 1YJWI 1W0TA 2M7BA 4ZZDA 4AIDA 2K9MA 2VKEA 3FXJA 3HPHA 4IHVA 3BJOA 1MJ9A 3W6KB 3GTLJ 5J8CA 2VJ4A 1KU9A 3CUQA 1QA6A 1ZLKA 2PJPA 1B59A 1WHUA 2ZFUA 1QZZA 4KDPA 1DPRA 4HQEA 4N0BA 3DKYA 3FXLA 3GZNB 3NQOA 2MLKA 2FMYA 4AU7A 3CTAA 1SVMA 3OYNA 2XV4S 4A93J 1V3FA 1S9HA 1FNNA 2CWEA 3ZN1A 2COMA 3F21A 4Y13A 3H9QA 1WI9A 2XB5A 1ACIA 3AAFA 5IT3A 4AYBA 3RKQA 5M3MJ 1YQAA 3TP3A 2F4OB 3QODA 5FFXA 1TNSA 4Y3OA 1Z7LA 5FGMA 1WPKA 2W7NA 3OWTA 2YPRA 4JX6A 5K5QA 3BG6A 2Z9OA 2DMNA 3H5RA 4WF2A 2HYGD 2ISYA 2M34A 3OYKA 1B8IA 4PCQA 4GDFA 4OIPF 2JUCA 4A3IJ 5E8IA 3I56I 1IN7A 1SVOA 2DOFA 2ZXIA 3RI4A 3IKVA 5FKNA 2ZSHB 1ETWA 1YI2I 3BG3A 1ETKA 5ICGA 1T33A 1XCVA 2HTSA 1FYKA 1YRNA 1A5JA 4V19K 5DYMA 2MD0A 2L7KA 1TL8A 4L0YB 3JRHA 4S04A 3O8GA 3GF2A 3DBLB 2E19A 4ENMA 3WHBA 3OY9A 3P7NA 3J7AY 3S2DJ 3GVAA 2IVMA 2N8GA 3A4CA 2A07F 1SANA 2ECBA 4HX4A 2IS6A 4HX7A 4XK4A 1B72B 2PBIA 3H5NA 5FKMA 4AVZA 2CFOA 3IUOA 4U0VA 5CQEA 4AC0A 2MA3A 2QSFX 1DU6A 4C2TA 3BTIA 1KA8A 2WAFA 2CJJA 2M5WA 4GXOA 1V5EA 3DTIA 3WE3A 1OPCA 2JK3A 2YSRA 4XKVA 1HBXG 1UMQA 3IAS2 3ROUA 1HF0A 3S3NA 1D8KA 1LEAA 1X1DA 5FKLA 1FOKA 3P9CA 3SHFA 4JQFA 3WTZA 1ETOA 3K6GA 3P9IA 1OYWA 1FMWA 2VKVA 2R3SA 1PUEE 1U8RA 3BDDA 2JTVA 3FM3A 3BR3A 4RAYA 1WCMJ 4I7HA 1FSEA 4XN0A 3A0HC 2LKXA 1K6YA 3ZQIA 2MABA 4EJOA 4G7OF 2H8WA 3C3WA 3TKYA 2IGMA 1OFCX 5A2QK 1RIOH 5IY5H 3VB2A 5EF6A 4JX4A 3CESA 5EJCA 2XAQA 3OYBA 1O57A 1LJ9A 3TW6A 3LSHA 5DDGA 2LY1A 3CJTB 1UJ8A 3CF2A 2LLKA 1LPQA 3BZ6A 4BHPA 1R1UA 2JRTA 2CRGA 3K1MA 2R7WA 3B02A 1TT0A 2CQXA 1ZELA 2G7UA 2HR3A 3BPVA 1IN6A 4PFOA 2A6HF 2P81A 4DNCA 4LMYA 3SZTA 1BW6A 1IXRC 3K4CA 3KCCA 3MEXA 1JUPA 5DCMA 5HLIA 1FTZA 5KCMA 2MH2A 2A61A 4BJ5C 1AU7A 2F4IA 2HU9A 1T95A 3T5XA 4UV9A 1RKTA 3BR1A 2W82A 2DQLA 5F0CA 4U0YA 2GOMA 4M3DA 2R7SA 3E97A 3DBHB 2QKMB 5K5RA 2VUMJ 4A0XA 2PMZA 4NC7A 4F7ZA 3OSFA 1HKSA 4OINF 2NAZA 5FD5A 4XQFA 2IRFG 1HKQA 4HG2A 4HSRA 3TBIA 1U0JA 4F3QA 2Y9YA 3LQQA 5E3NA 3HSEA 2GAUA 4OIQF 2IP2A 4DGWB 2CG4A 1IZ1A 1QZEA 1H8AC 2CUJA 3IRQA 3GTKJ 1U78A 1YJNI 1IV8A 2DK8A 3BPXA 2CW0F 2WC2A 1RUOA 2ZJRF 3DF8A 1U5TA 1SEUA 2F4MB 3S3MA 2ZB9A 2IA1A 3J7AO 4RGSA 1FC3A 1F9NA 4P96A 1X1CA 4XLCA 4CUGA 1OCCH 1YHQI 4I76A 4MIMA 2DA1A 3TOAA 1YS6A 1N25A 2HFHA 4LG0A 4UUSA 1JE8A 3EDPA 1ERDA 1WJ5A 3W2AA 2DCEA 1HC8A 3CDLA 2AQEA 4ZJZA 2BBYA 1Y1WJ 1J09A 4A12A 3CJRB 2H1LA 2D1HA 2EQRA 2ID3A 2VL8A 2JA5J 2LG4A 2QSGX 3KYCB 2CQKA 1T2KA 4C2UA 4HYEA 2QQBA 1P7JA 1T39A 2H27A 3GTQJ 2LP0A 3U1DA 2MLGA 4A0YA 2XROA 2XF6A 5C3EJ 3BR5A 2DDAA 1VQLI 4C9YA 4ZDLA 3MD2A 5K7HA 2KDOA 1IRZA 5LFAA 1MBHA 2F5VA 1J9IA 3EPZA 1Z3XA 4ABZA 3V4GA 3S1QJ 4NB5A 1EJ9A 2LYCA 4A3DJ 2ME0A 4BNCA 2E35A 4OMZA 3ECHA 1ZHFA 4NQWB 2CMPA 3WTVC 3OYFA 4NNJA 3O6BB 4ITVA 2PJRA 5BPIA 4IXAA 3Q0UA 4DZPA 3QU6A 2HKOA 5E3LA 4HDUA 2R7OA 1U2WA 2W85A 1D3YA 1LFUP 2OF7A 5F6FA 4UB6C 3Q0VA 1XD7A 4XKBA 5HS7A 5J4YA 4GRIA 3GCMA 1IDZA 2RN7A 3C2BA 5JR3A 1D0YA 3TOBA 4I2OA 2QKLB 2EJRA 4BEHB 2ADUA 4XICA 3TDZC 1EF4A 5E20A 4O3MA 3ULQB 3SEQA 2V7FA 1E3HA 1Z91A 1GV2A 3TMOA 1OKRA 3CCQI 3LSPA 4IF4A 2EA2A 4F93B 3EUKL 3R0JA 3I64A 2XB0X 1IXCA 2NOJB 3WTUC 1ETQA 2VBXA 2XF7A 4WXHA 4KITB 2XSDC 4HOBA 2K40A 4DYQA 5LBQA 2E1OA 1RC9A 4XLPF 1ZRFA 2WB1N 1YIJI 3HOYJ 3F3XA 4OIOF 2A05A 3S2WA 1Y6IA 2JA6J 3QPHA 5AIQA 1H89C 3L00A 1K79A 4Y33A 3PJRA 4EJWA 1YE9A 2IT0A 4CH7A 4HLYA 1T08B 2R7DA 1OMIA 2YUSA 3K10A 4BS9A 5E1ZB 2R7ZJ 2R7TA 4XL9A 1FEXA 2PMHA 3HM5A 2CV2A 3HOUJ 4J00A 3AL0B 3K69A 1YJ9I 5GAGJ 4U87A 4O5VA 2BOLA 2DTRA 4DYCA 2XGDA 2VC1A 5J1RA 3BTJA 3TO7A 1ETXA 1QPMA 2DI3A 5K7ZA 1K83J 3SJMA 1ZH5A 2R5ZA 1W5TA 3FZVA 3HHGA 4RB0A 2VKDA 3CCRI 3OSGA 1ODDA 3WGIA 2HDCA 3DEEA 2IPQX 2O5RA 1XGMA 3ERED 4AVPA 2ZMEB 3WTTC 5BQTA 3GZ6A 1TTYA 2DT6A 1ZAOA 2FF4A 1DUXC 5BS6A 3LA7A 2R4GA 5F64A 2DPUA 1CF7B 2FXAA 1FP2A 2Y0SA 1BR4A 2GIVA 2ESHA 1TP4A 2DMPA 5FB2A 1Y39A 1J7KA 3I53A 2XAHA 2FOKA 5JLXA 3PM1A 2XC7A 3KE2A 3S15J 2HGCA 4IHTA 3A01A 2X48A 1AOYA 1ETVA 1LB2A 3ZXSA 3I9V2 1T6SA 3FXOA 3H3UA 4BDYA 3GFJA 1UZCA 4EVIA 4BUPA 5JVTA 2HXOA 1F43A 2IAIA 2PQ8A 3ZQGA 4QIWN 2KZGA 4RM2A 2E36A 2ZMEC 2A6EF 2EWNA 1G3SA 4H4KC 3I4NJ 3V42A 1IN8A 3OIPA 1ZG1A 5JHUA 1MZBA 5E79C 3IKTA 2E34A 2FA5A 4IJAA 2KMUA 5CVIA 4CCOA 4HQMA 3TDUC 2P6TA 4A3FJ 2BW3A 2XAUA 2Z2SB 1UB9A 4BQAA 1Z7UA 1ONVA 4P1WA 4RB1A 4PJMA 5IOYA 1UHSA 3JSPA 5DCFA 1RESA 3OR2C 2DJIA 2M4GA 1S7AA 5L3CA 3LMMA 4C30A 1FZPB 2M0MA 3J80Z 3G2BA 3HRUA 1JHFA 4P5OA 4BQOA 3FXRA 1KGSA 3EYYA 3I55I 4RA2A 3VYTB 2VC0A 4OAZA 3Q5FA 3LSKA 1OR7C 3HPGA 4UXNA 1TWCJ 3J7ZI 2HVRA 4ZYHA 1AHDP 4ENJA 3LSJA 4M74A 1BN5A 4FTHA 5EDNA 2K9NA 2E1MB 1G3TA 2COBA 1VTNC 1A36A 4PJNA 4B1RA 5CLSA 2H1KA 3SFZA 1IJWC 2GXGA 1K78A 1K61A 1UELB 5EZGA 2A68F 3K1NA 4M3EA 1Z05A 1I27A 1WKMA 2QEXI 3LAPA 3OYDA 3AFHA 3R4KA 4YIRX 4I01A 3FHNA 1U9OA 1YYVA 1FBUA 2LY2A 3KZYA 4QPQA 4DJAA 1Z77A 2STTA 1OCZH 3FKIJ 1W36D 2HZDA 3RCOA 4A0ZA 4PZJA 1SD4A 2E1MC 3BOQA 2VE9A 3R61A 2XPVA 2HKXA 4LIVA 4XLFA 2WV1A 1TZLA 4I02A 5LRSA 3RQIA 1NG6A 3LQRA 3DXJF 3FK7A 1UHMA 2IA0A 4HNTA 2JA8J 3KYLA 2HDWA 2R7XA 2WTEA 3GUDA 3FX3A 3CJNA 5M3FJ 1SFEA 4IHYA 2L5QA 2DT7B 3LAJA 3I3LA 2DK5A 2PN6A 1B6AA 4OU0A 1O4XA 3CZ6A 2IGKA 2OA4A 4HEA2 4YFXF 3W6VA 4XLAA 4HDVA 4DZJA 1W1WE 5HDGA 2KJCA 3V8KA 4RLQA 3A03A 3KYDB 2RNJA 2HNHA 5GAHJ 2K86A
chains in the Genus database with same CATH topology
5DD8A 4BH9A 1OYYA 3N97A 1XB4A 4I09A 3E6BA 2LDUA 2ISZA 3DPLC 4YIIA 2K02A 3CDHA 3DKWA 1IN4A 3DV8A 2LSOA 2H09A 2TDXA 3TQNA 2DT5A 2DU9A 2F5CA 2FNPA 4JK1X 3I0TA 2W24A 5K5OA 3D0SA 2XASA 4HX8A 2RQPA 4HAMA 2L3DA 2ACJA 2O03A 4RGRA 4I0AA 3I59B 4L5JA 1SD6A 4NQWA 4G6DA 1A04A 2WWYA 1ZRCA 4QWQA 2KIFA 1GXPA 2VXZA 1HQCA 3GZ5A 2PG4A 1NHAA 1IRFA 3OV8A 1XDSA 3K1PA 1RZ4A 1TQMA 2NS0A 2BGCA 3CO7C 3D5LA 5JI6A 5HS9A 1WQ2A 3K2ZA 1MKMA 5HLGA 1G3WA 2JT1A 4R79A 1FWZA 2NNYA 4I0BA 2IJLA 2V6CA 1O7LA 1H9TA 3IWZA 3BJAA 4AIKA 4HF2A 2DPDA 2EFNA 2P5LC 2CGPA 3QP6A 1H0MA 4EJUA 3HIFA 2UWMA 4ESBA 3M7GA 5DUIA 1JHHA 2GQQA 2HQRA 1SFUA 3FMSA 4EM1A 3QP5A 1CF7A 2A3SA 1O3RA 3F8FA 1LDJA 3JAMZ 3F8NA 4KN7X 2Y75A 5D6EA 2RKHA 3GWZA 5E1XA 1XGNA 3BJ6A 4YIFA 1UCRA 2F5DA 2M87A 4M6XA 5DEQA 3E5QA 2L4AA 5H6QA 4ZH4F 1O3TA 1V4RA 4LJZF 1X3UA 1TNTA 2QENA 2OQRA 2ZNYA 2QLZA 2RGVA 2EFWA 1YG2A 1XCBA 2G9WA 3ZMUA 2BYVE 2F2EA 4BHBA 2KKOA 1R1VA 3WU0A 4IVNA 4UVCA 1EH8A 3T0YA 2VBYA 2Q8KA 2EV0A 3F72A 2D1VA 2QBYB 1USSA 1U3EM 1EH6A 1REPC 3KP7A 2KJBA 5LEJA 2FMLA 3MWMA 3BY6A 5TRDA 4IPAA 2FU4A 2FEZA 3E6DA 2UZKA 4FX4A 2IW5A 3RJPA 5LHGA 4BXUA 5DV5A 3RKWA 2W84A 2P6SA 4KFCA 1LQ1A 1I1SA 4CDGA 1KYZA 2HTJA 3VODA 3J81Z 4ZZLA 4OIRF 2XKPA 5L3BA 2O6GE 1T98A 3HSRA 2DBBA 1R7JA 2VE8A 4CZZA 1FBQA 2HZTA 4EV0A 1QBJA 1J75A 4M72A 3DP7A 1Y0UA 4P9UA 3V7CA 4K2EA 1Z6TA 3MAJA 4UVBA 1O7FA 1BI0A 3F8MA 5E1WA 2RV8A 4M71A 3F8BA 1EV7A 2EFOA 3HTUA 4EM2A 2HOEA 2GXBA 2QUFA 2XRNA 2DQRA 3ZQ7A 2K27A 3WTYC 5D4SA 3GW2A 3E3VA 3HSFA 1W5SA 2MH9A 1W7PD 2PLYA 4U88A 3RKYA 3L7WA 1FYLA 3ZMVA 1J2XA 4IRHA 3IC7A 5FD6A 3I59A 3OOPA 3WGGA 3P9KA 1PDNC 4E70A 4M9XA 3C18A 5ICCA 4R1HA 4WWCA 2XAGA 2KIMA 1E2XA 4P55A 4XRFA 1P4XA 5BMZA 2OAZA 3F23A 2O0YA 2BE5F 3QAHA 1KU7A 3MZYA 4LD5A 4XBFA 3BROA 1ZGJA 4N9HA 5HDKA 3F22A 3T8RA 2EFQA 1IXSB 1B9NA 1LVAA 3HRSA 5D5WB 3BP8A 4P9FA 1F4KA 1STZA 2P5VA 3G3ZA 3Q9SA 4L9NA 3HYIA 1FLIA 4L9JA 1YO5C 2JZYA 3WG9A 5IT9K 1I1GA 2P8TA 2BV6A 4AIJA 4BAYA 2QWWA 5LGTA 2D45A 2Y48A 4XSZF 3ABUA 4HBLA 4XLNF 1S8NA 4TV7A 4LK1F 5E8GA 4H0EA 1HW5A 3J80K 4CXFA 1T38A 1BI1A 2PEXA 5DD4A 2GA2A 3DEUA 1I6XA 3RYRA 4RB3C 1QGPA 4EGYA 2DLLA 5D8LB 1XSXA 3LSTA 2QVOA 5D5UB 1QQIA 1GHCA 3ZN0A 1YW8A 1IUYA 3H92A 2V79A 5FFZA 2EB7A 4OOIA 4CHUA 5F1RA 4CICA 4ZYGA 2L4MA 4A2UA 1USTA 4EQQA 3ZP5A 3EETA 5IT9Z 4GYGA 2XIGA 4ENKA 5H20A 3E5UA 3CUQC 1FT9A 3ZMSA 1BIBA 1HXDA 3U2RA 5AONA 2VBWA 5HS8A 2QBYA 1IN5A 1PP8F 1ZG5A 3TO9A 2V1DA 2ZO4A 4MEYF 1YW7A 1WWXA 3KP5A 2JPCA 1ZRDA 3C7JA 4CGZA 2O8XA 2J5PA 1ZG3A 3KLNA 2H6CA 5LGUA 4L18B 3W6JB 3EYIA 2O61A 3ZMZA 4B09A 2M30A 5LLQA 5LRRA 5CVRA 3NRVA 1J5YA 2YR2A 5ILUA 1RUNA 2VONA 3RYPA 3I71A 4KN4X 1BOAA 1BBYA 3M8FA 1R1TA 5L3DA 3VOEA 4FHTA 5BOXA 1SFXA 4ESJA 3TGNA 4A5MA 5CYVA 5LHIA 5ILVA 1IRGA 1IW7F 4G8XA 1TW2A 2VODA 4UUVA 1LEBA 4RS8A 4UVAA 1XMAA 2K4BA 1R36A 4UHTA 3WTSC 5KK1A 3K0LA 1Z1DA 1K6OA 4KIGA 2KRFA 2V9VA 1XSDA 2PFBA 5CVJA 4GGGA 5H6RA 1FPQA 3MCZA 4EJVA 4KICA 1JXSA 5FLXZ 2E7WA 2H94A 2EK5A 4BYYA 4D0PA 3R0AA 1TQPA 1SD5A 2G7HA 2PMUA 2VBZA 3V8LA 1QO0D 4LB5A 3GEZA 2V1UA 1L3LA 2ZCWA 3CLOA 2HEOA 3T8TA 3HRMA 1TBXA 3GFIA 1ULYA 4MGRA 4ASNA 2DFIA 2K4JA 1IF1A 4Z2YA 3I58A 4MTDA 1BI2A 4CYDA 1MGTA 4HW0A 1S3JA 1ZLJA 4AD9A 2ELHA 2VOPA 1YTYA 3JAMK 1JGSA 4KMFA 2E1NA 1P4WA 2L02A 3KP6A 1P2FA 2X0LA 1R58A 2YU3A 1HW1A 1UHWA 2Q2EA 3DPTA 4Q5SF 1B1BA 3WE2A 5HDNA 3WTXC 5LEKA 3KP2A 2JPBA 3DQVC 4EMSA 5LHHA 2E1CA 4FX0A 3Q9VA 2FSWA 1ZYRF 2DO7A 4YFNF 3GX4X 2A69F 3HUGA 5D5VB 1FX7A 2WV0A 2RDPA 2OBPA 3KP3A 2QQAA 2ZMEA 1RI7A 4HA8A 2E7XA 2ETHA 4L0ZB 4MQ9F 1IAWA 2VN2A 2JSCA 2ZFWA 2QYOA 3KEOA 2R7FA 1MD0A 3SQNA 4U0WA 1WSUA 4BHCA 4HZFA 1F1ZA 1R22A 3VFZA 3MFKA 1TQIA 4WK8F 4KNYA 3ZMTA 5J8FA 1W7PB 2STWA 2LF7A 3HOSA 1J0RA 1OR7A 2MD5A 3B73A 5DUKA 3VEPA 2Q0OA 4M9SA 1TLHB 5D4RA 3LA2A 3J81K 1RNLA 3GLXA 1D5VA 1YIOA 3CO6C 4U7BA 3KEQA 4GCVA 3F6VA 2GWRA 2GA1A 3WGHA 1HSTA 4R8HA 4GYIA 4ENNA 2MC3A 2HQNA 4LGWA 1I5ZA 3FXQA 2D2WA 3QPTA 3G73A 4I98B 4RGUA 1KQ9A 4S05A 3NEUA 5L3FA 1AWCA 4Q47A 4MNUA 3K9TA 5D6FA 1F5TA 3I4PA 3FWEA 2CO5A 1FY7A 2ZKZA 3QOPA 1DDNA 3TO6A 4N9IA 4IRGA 1ZN2A 3REOA 5HVQC 3R6SA 1XMKA 4WX9A 4G7HF 1DP7P 2C6YA 1MDMB 3CUOA 2VOOA 3I54A 1LDKB 1SAXA 1BC7C 5EEHA 1Q1HA 1G3YA 1WRJA 2CSOA 3RDIA 2CFXA 1K78B 1XSVA 4A5NA 1U6GA 4LFUA 4Q4ZF 2FBKA 3MZHA 3HHHA 3H3ZA 2RC4A 3WODF 1KYWA 4RGXA 5ILSA 5TJJA 5ICFA 1LNWA 4WCGA 2J5OA 3JTGA 3WTWC 1ON1A 1ZARA 4WXDA 3RPQA 4M9ZA 3IHUA 2XAFA 4XSXF 2HWVA 2LF8A 1HSJA 3ZPLA 5KVRA 2FNAA 2Z5UA 3E5XA 5JFRA 2NRAC 1S6LA 3BWGA 4ESFA 5A2QZ 1MJBA 1BI3A 3COAC 1GXQA 2ZBKA 4G7ZF 1BM9A 3ML6A 2FQ3A 5EEGA 4MEXF 4O6JA 4HLXA 2KIUA 2XKOA 1TW3A 3FF5A 2O3FA 1P92A 3ISPA 3ELKA 2P7CB 2FBIA 2LNBA 2OU2A 4UV8A 2AXLA 2H6BA 2GZWA 2V1XA 4KT5C 3ECOA 4UNOA 4B8XA 4G9YA 4ETSA 4YG2F 4IHSA 1D8JA 3QU3A 2VT2A 3PQJA 4WXCA 2YX7A 3V7RA 3DFGA 2YX4A 1KQ0A 2BEOA 4PGGA 3SZPA 5ED4A 4EGZA 1YFHA 2OZUA 3I5UA 1E17A 1FBSA 3M1EA 3GFLA 1MJAA 5ICEA 3IL2A 4M6YA 4GO1A 1B4AA 3N4MA 3FHZA 1GVJA 1KU3A 5FO5A 2ZJ2A 2FBHA 1FYMA 4HV6A 1R00A 4L5IA 3LA3A 1LDDA 2DAOA 1R5HA 1Z9CA 3LWFA 3GFMA 5L3EA 1ZREA 2P4WA 4RB2C 3O3KA 4A6DA 3EQLF 5K1YA 4ZYDA 4A6EA 2EFPA 2K7LA 3MQ0A 3JW4A 2FRHA 3C1DA 3RKXA 5AIPA 4EM0B 3KP4A 4HF1A 3GXOA 4RAZA 1KQ8A 3IWFA 2M45A 3CUQB 4JBAA 4M73A 1DPUA 1W7PA 4U7DA 1Z6RA 1ON2A 2W25A 3ABTA 2ESNA 4L9TA 1G6NA 1PP7U 3E6MA 2EV6A 2M8EA 3L2CA 2Z3YA 3RIRA 1UFMA 3L9FA 3O2PE 3PQKA 4KYWA 3L09A 1YW9A 4MQVA 2AS5F 2F5FA 1XN7A 4CO8A 4IRIA 1CGPA 5HOOA 3JSOA 2FE3A 4KUMA 1W4MA 1YLFA 2F5EA 4KMUX 1XGSA 3U9GA 2A5YB 2P5KA 5E18F 1XDUA 3KETA 2X4HA 2Y0MA 1MDMA 2B0LA 4LK0F 2M1BA 1OYIA 4LB6B 3ZMDA 1SMTA 3GYHX 5FLXK 2QZ8A 3WU1B 1BC8C 6PAXA 2UXNA 5J6XA 3LFKA 1QNTA 2XGXA 1HW2A 2NNNA 4AIHA 5BPDA 3HOTA 3KLOA 1C0WA 3V8JA 1O3SA 5D8KB 5LGNA 5CJ9A 1QZYA 1FSHA 3M8EA 4LLGF 2XUBA 1SD7A 2OZ6A 3FMQA 2PI0A 4PDKA 5DCMB 3FXUA 4Y15A 4HF0A 4L9VA 4KA4A 4OMYA 2XVCA 4ON0A 2MBFA 2QQ9A 2RVCA 2IA2A 1S7OA 2QM3A 3M9AA 3IRRA 3F8CA 2XAJA 4G94A 3R60A 4MHGA 3RTRA 3KZZA 3PFIA 2NYXA 1BIAA 1T0FA 4Y17A 1H9GA 4Q48A 5CVVA 2CYYA 1S29A 2XHKA 4G6QA 1U5TB 3KFWX 4MTEA 1HKTA 2L54A 4QLCU 3HTSB 4EJTA 5L3GA 3FM5A 4ZYEA 1KU2A 4LG0B 1L0OC 3E6CC 4LLLA 2OD5A 2LKPA 2Z33A 4HV5A 1O3QA 1U5TC 3SXYA 2OQGA 1B9MA 1R23A 3V7SA 2P7VB 5CVUA 2EV5A 1J59A 2UXXA 1EH7A 4PGHA 5HLHA 1R5GA 4LLNA 2Z99A 4YFKF 4KIFA 3EUHA 5D5XB 3GO5A 1FP1D 1G4DA 2DW4A 2ZNZA 1YS7A 4AWXB 1P6RA 4FT8A 3JTHA 1XGOA 4KIBA 2W57A 1ZGAA 2L01A 1BJAA 2HS5A 1P4AA 1SMYF 3QRFF 4DQ2A 1K7AA 5E17F 4NHJA 2ZXJA 2EA4A 3RPUA 3F6OA 3T1BA 2VT3A 5ERIA 3FMRA 3HRTA 2HYFA 4ZZDA 3BJOA 1MJ9A 3W6KB 5J8CA 3CUQA 1KU9A 1ZLKA 2PJPA 1B59A 1QZZA 4KDPA 1DPRA 4HQEA 4N0BA 3NQOA 2MLKA 2FMYA 3CTAA 2XV4S 1V3FA 1FNNA 2CWEA 3ZN1A 2COMA 3F21A 4Y13A 1WI9A 3AAFA 5IT3A 1YQAA 5FFXA 1TNSA 5FGMA 2YPRA 5K5QA 2Z9OA 4WF2A 2HYGD 2ISYA 4PCQA 4OIPF 5E8IA 1IN7A 3RI4A 3IKVA 5ICGA 1XCVA 2HTSA 1FYKA 5DYMA 4L0YB 4S04A 3GF2A 4ENMA 3P7NA 3GVAA 2IVMA 2A07F 4HX4A 4HX7A 2PBIA 4U0VA 2MA3A 1KA8A 4GXOA 2M5WA 3WE3A 1OPCA 2YSRA 1HBXG 3ROUA 1D8KA 1LEAA 1FOKA 3P9CA 3SHFA 4JQFA 3WTZA 3P9IA 1OYWA 1PUEE 2R3SA 1U8RA 3BDDA 2JTVA 3FM3A 4RAYA 4I7HA 1FSEA 4EJOA 4G7OF 3C3WA 3TKYA 5A2QK 1RIOH 3VB2A 2XAQA 1O57A 1LJ9A 5DDGA 3BZ6A 4BHPA 1R1UA 2JRTA 3K1MA 3B02A 2G7UA 2HR3A 3BPVA 1IN6A 2A6HF 4DNCA 4LMYA 3SZTA 1IXRC 3KCCA 3MEXA 5HLIA 5DCMA 2MH2A 2A61A 3T5XA 4UV9A 2DQLA 4U0YA 3E97A 5K5RA 4A0XA 4F7ZA 1HKSA 4OINF 2NAZA 5FD5A 2IRFG 1HKQA 3LQQA 3HSEA 2GAUA 4OIQF 2IP2A 2CG4A 1IZ1A 3IRQA 1U78A 2DK8A 3BPXA 2CW0F 2WC2A 1RUOA 3DF8A 1U5TA 2IA1A 3J7AO 4RGSA 1FC3A 1F9NA 4P96A 3TOAA 1YS6A 2HFHA 4LG0A 1JE8A 3EDPA 2BBYA 4A12A 2D1HA 2CQKA 1T2KA 4HYEA 2QQBA 1T39A 2H27A 3U1DA 2MLGA 4A0YA 2XROA 1J9IA 3V4GA 4NB5A 4BNCA 4OMZA 3ECHA 1ZHFA 3WTVC 3O6BB 5BPIA 4IXAA 3QU6A 2HKOA 4HDUA 1U2WA 2W85A 1D3YA 5F6FA 1XD7A 5HS7A 2RN7A 5JR3A 3TOBA 4I2OA 2EJRA 2ADUA 3TDZC 5E20A 4O3MA 3ULQB 1Z91A 1OKRA 4IF4A 2EA2A 3R0JA 3I64A 1IXCA 3WTUC 2VBXA 4WXHA 4HOBA 5LBQA 4XLPF 1ZRFA 3F3XA 4OIOF 3S2WA 3QPHA 5AIQA 1K79A 3L00A 4EJWA 2IT0A 4HLYA 2R7DA 1OMIA 5E1ZB 2PMHA 3K69A 4O5VA 2DTRA 2VC1A 3TO7A 1QPMA 2DI3A 1ZH5A 1W5TA 3FZVA 3HHGA 4RB0A 1ODDA 3WGIA 2HDCA 2IPQX 3ERED 1XGMA 4AVPA 2ZMEB 3WTTC 5BQTA 3GZ6A 1TTYA 1ZAOA 2FF4A 1DUXC 5BS6A 3LA7A 5F64A 2DPUA 1CF7B 2FXAA 1FP2A 2GIVA 2ESHA 5FB2A 1J7KA 3I53A 2XAHA 2FOKA 3KE2A 2HGCA 4IHTA 1AOYA 1LB2A 1T6SA 3H3UA 3GFJA 4EVIA 5JVTA 2PQ8A 2A6EF 2EWNA 1G3SA 1IN8A 1ZG1A 5JHUA 1MZBA 3IKTA 2FA5A 4IJAA 5CVIA 4HQMA 3TDUC 2P6TA 1UB9A 4BQAA 1Z7UA 1ONVA 4RB1A 3JSPA 5DCFA 1S7AA 5L3CA 1FZPB 3J80Z 3HRUA 1JHFA 4P5OA 3FXRA 1KGSA 3EYYA 2VC0A 3Q5FA 4UXNA 4ZYHA 4ENJA 4M74A 1BN5A 1G3TA 1VTNC 5CLSA 3SFZA 2GXGA 1K78A 2A68F 3K1NA 1Z05A 1I27A 1WKMA 3LAPA 3R4KA 4I01A 1YYVA 1FBUA 3KZYA 2STTA 4A0ZA 4PZJA 1SD4A 3BOQA 2VE9A 3R61A 2HKXA 4I02A 5LRSA 3LQRA 3DXJF 1UHMA 2IA0A 2WTEA 3GUDA 3FX3A 3CJNA 1SFEA 3LAJA 2DK5A 2PN6A 1B6AA 4OU0A 2OA4A 4YFXF 4HDVA 5HDGA 2KJCA 3V8KA 2RNJA 2K86A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DD8 A;  4BH9 A;  1OYY A;  3N97 A;  1XB4 A;  4I09 A;  3E6B A;  2LDU A;  2ISZ A;  3DPL C;  4YII A;  2K02 A;  3CDH A;  3DKW A;  1IN4 A;  3DV8 A;  2LSO A;  2H09 A;  2TDX A;  3TQN A;  2DT5 A;  2DU9 A;  2F5C A;  2FNP A;  4JK1 X;  3I0T A;  2W24 A;  5K5O A;  3D0S A;  2XAS A;  4HX8 A;  2RQP A;  4HAM A;  2L3D A;  2ACJ A;  2O03 A;  4RGR A;  4I0A A;  3I59 B;  4L5J A;  1SD6 A;  4NQW A;  4G6D A;  1A04 A;  2WWY A;  1ZRC A;  4QWQ A;  2KIF A;  1GXP A;  2VXZ A;  1HQC A;  3GZ5 A;  2PG4 A;  1NHA A;  1IRF A;  3OV8 A;  1XDS A;  3K1P A;  1RZ4 A;  1TQM A;  2NS0 A;  2BGC A;  3CO7 C;  3D5L A;  5JI6 A;  5HS9 A;  1WQ2 A;  3K2Z A;  1MKM A;  5HLG A;  1G3W A;  2JT1 A;  4R79 A;  1FWZ A;  2NNY A;  4I0B A;  2IJL A;  2V6C A;  1O7L A;  1H9T A;  3IWZ A;  3BJA A;  4AIK A;  4HF2 A;  2DPD A;  2EFN A;  2P5L C;  2CGP A;  3QP6 A;  1H0M A;  4EJU A;  3HIF A;  2UWM A;  4ESB A;  3M7G A;  5DUI A;  1JHH A;  2GQQ A;  2HQR A;  1SFU A;  3FMS A;  4EM1 A;  3QP5 A;  1CF7 A;  2A3S A;  1O3R A;  3F8F A;  1LDJ A;  3JAM Z;  3F8N A;  4KN7 X;  2Y75 A;  5D6E A;  2RKH A;  3GWZ A;  5E1X A;  1XGN A;  3BJ6 A;  4YIF A;  1UCR A;  2F5D A;  2M87 A;  4M6X A;  5DEQ A;  3E5Q A;  2L4A A;  5H6Q A;  4ZH4 F;  1O3T A;  1V4R A;  4LJZ F;  1X3U A;  1TNT A;  2QEN A;  2OQR A;  2ZNY A;  2QLZ A;  2RGV A;  2EFW A;  1YG2 A;  1XCB A;  2G9W A;  3ZMU A;  2BYV E;  2F2E A;  4BHB A;  2KKO A;  1R1V A;  3WU0 A;  4IVN A;  4UVC A;  1EH8 A;  3T0Y A;  2VBY A;  2Q8K A;  2EV0 A;  3F72 A;  2D1V A;  2QBY B;  1USS A;  1U3E M;  1EH6 A;  1REP C;  3KP7 A;  2KJB A;  5LEJ A;  2FML A;  3MWM A;  3BY6 A;  5TRD A;  4IPA A;  2FU4 A;  2FEZ A;  3E6D A;  2UZK A;  4FX4 A;  2IW5 A;  3RJP A;  5LHG A;  4BXU A;  5DV5 A;  3RKW A;  2W84 A;  2P6S A;  4KFC A;  1LQ1 A;  1I1S A;  4CDG A;  1KYZ A;  2HTJ A;  3VOD A;  3J81 Z;  4ZZL A;  4OIR F;  2XKP A;  5L3B A;  2O6G E;  1T98 A;  3HSR A;  2DBB A;  1R7J A;  2VE8 A;  4CZZ A;  1FBQ A;  2HZT A;  4EV0 A;  1QBJ A;  1J75 A;  4M72 A;  3DP7 A;  1Y0U A;  4P9U A;  3V7C A;  4K2E A;  1Z6T A;  3MAJ A;  4UVB A;  1O7F A;  1BI0 A;  3F8M A;  5E1W A;  2RV8 A;  4M71 A;  3F8B A;  1EV7 A;  2EFO A;  3HTU A;  4EM2 A;  2HOE A;  2GXB A;  2QUF A;  2XRN A;  2DQR A;  3ZQ7 A;  2K27 A;  3WTY C;  5D4S A;  3GW2 A;  3E3V A;  3HSF A;  1W5S A;  2MH9 A;  1W7P D;  2PLY A;  4U88 A;  3RKY A;  3L7W A;  1FYL A;  3ZMV A;  1J2X A;  4IRH A;  3IC7 A;  5FD6 A;  3I59 A;  3OOP A;  3WGG A;  3P9K A;  1PDN C;  4E70 A;  4M9X A;  3C18 A;  5ICC A;  4R1H A;  4WWC A;  2XAG A;  2KIM A;  1E2X A;  4P55 A;  4XRF A;  1P4X A;  5BMZ A;  2OAZ A;  3F23 A;  2O0Y A;  2BE5 F;  3QAH A;  1KU7 A;  3MZY A;  4LD5 A;  4XBF A;  3BRO A;  1ZGJ A;  4N9H A;  5HDK A;  3F22 A;  3T8R A;  2EFQ A;  1IXS B;  1B9N A;  1LVA A;  3HRS A;  5D5W B;  3BP8 A;  4P9F A;  1F4K A;  1STZ A;  2P5V A;  3G3Z A;  3Q9S A;  4L9N A;  3HYI A;  1FLI A;  4L9J A;  1YO5 C;  2JZY A;  3WG9 A;  5IT9 K;  1I1G A;  2P8T A;  2BV6 A;  4AIJ A;  4BAY A;  2QWW A;  5LGT A;  2D45 A;  2Y48 A;  4XSZ F;  3ABU A;  4HBL A;  4XLN F;  1S8N A;  4TV7 A;  4LK1 F;  5E8G A;  4H0E A;  1HW5 A;  3J80 K;  4CXF A;  1T38 A;  1BI1 A;  2PEX A;  5DD4 A;  2GA2 A;  3DEU A;  1I6X A;  3RYR A;  4RB3 C;  1QGP A;  4EGY A;  2DLL A;  5D8L B;  1XSX A;  3LST A;  2QVO A;  5D5U B;  1QQI A;  1GHC A;  3ZN0 A;  1YW8 A;  1IUY A;  3H92 A;  2V79 A;  5FFZ A;  2EB7 A;  4OOI A;  4CHU A;  5F1R A;  4CIC A;  4ZYG A;  2L4M A;  4A2U A;  1UST A;  4EQQ A;  3ZP5 A;  3EET A;  5IT9 Z;  4GYG A;  2XIG A;  4ENK A;  5H20 A;  3E5U A;  3CUQ C;  1FT9 A;  3ZMS A;  1BIB A;  1HXD A;  3U2R A;  5AON A;  2VBW A;  5HS8 A;  2QBY A;  1IN5 A;  1PP8 F;  1ZG5 A;  3TO9 A;  2V1D A;  2ZO4 A;  4MEY F;  1YW7 A;  1WWX A;  3KP5 A;  2JPC A;  1ZRD A;  3C7J A;  4CGZ A;  2O8X A;  2J5P A;  1ZG3 A;  3KLN A;  2H6C A;  5LGU A;  4L18 B;  3W6J B;  3EYI A;  2O61 A;  3ZMZ A;  4B09 A;  2M30 A;  5LLQ A;  5LRR A;  5CVR A;  3NRV A;  1J5Y A;  2YR2 A;  5ILU A;  1RUN A;  2VON A;  3RYP A;  3I71 A;  4KN4 X;  1BOA A;  1BBY A;  3M8F A;  1R1T A;  5L3D A;  3VOE A;  4FHT A;  5BOX A;  1SFX A;  4ESJ A;  3TGN A;  4A5M A;  5CYV A;  5LHI A;  5ILV A;  1IRG A;  1IW7 F;  4G8X A;  1TW2 A;  2VOD A;  4UUV A;  1LEB A;  4RS8 A;  4UVA A;  1XMA A;  2K4B A;  1R36 A;  4UHT A;  3WTS C;  5KK1 A;  3K0L A;  1Z1D A;  1K6O A;  4KIG A;  2KRF A;  2V9V A;  1XSD A;  2PFB A;  5CVJ A;  4GGG A;  5H6R A;  1FPQ A;  3MCZ A;  4EJV A;  4KIC A;  1JXS A;  5FLX Z;  2E7W A;  2H94 A;  2EK5 A;  4BYY A;  4D0P A;  3R0A A;  1TQP A;  1SD5 A;  2G7H A;  2PMU A;  2VBZ A;  3V8L A;  1QO0 D;  4LB5 A;  3GEZ A;  2V1U A;  1L3L A;  2ZCW A;  3CLO A;  2HEO A;  3T8T A;  3HRM A;  1TBX A;  3GFI A;  1ULY A;  4MGR A;  4ASN A;  2DFI A;  2K4J A;  1IF1 A;  4Z2Y A;  3I58 A;  4MTD A;  1BI2 A;  4CYD A;  1MGT A;  4HW0 A;  1S3J A;  1ZLJ A;  4AD9 A;  2ELH A;  2VOP A;  1YTY A;  3JAM K;  1JGS A;  4KMF A;  2E1N A;  1P4W A;  2L02 A;  3KP6 A;  1P2F A;  2X0L A;  1R58 A;  2YU3 A;  1HW1 A;  1UHW A;  2Q2E A;  3DPT A;  4Q5S F;  1B1B A;  3WE2 A;  5HDN A;  3WTX C;  5LEK A;  3KP2 A;  2JPB A;  3DQV C;  4EMS A;  5LHH A;  2E1C A;  4FX0 A;  3Q9V A;  2FSW A;  1ZYR F;  2DO7 A;  4YFN F;  3GX4 X;  2A69 F;  3HUG A;  5D5V B;  1FX7 A;  2WV0 A;  2RDP A;  2OBP A;  3KP3 A;  2QQA A;  2ZME A;  1RI7 A;  4HA8 A;  2E7X A;  2ETH A;  4L0Z B;  4MQ9 F;  1IAW A;  2VN2 A;  2JSC A;  2ZFW A;  2QYO A;  3KEO A;  2R7F A;  1MD0 A;  3SQN A;  4U0W A;  1WSU A;  4BHC A;  4HZF A;  1F1Z A;  1R22 A;  3VFZ A;  3MFK A;  1TQI A;  4WK8 F;  4KNY A;  3ZMT A;  5J8F A;  1W7P B;  2STW A;  2LF7 A;  3HOS A;  1J0R A;  1OR7 A;  2MD5 A;  3B73 A;  5DUK A;  3VEP A;  2Q0O A;  4M9S A;  1TLH B;  5D4R A;  3LA2 A;  3J81 K;  1RNL A;  3GLX A;  1D5V A;  1YIO A;  3CO6 C;  4U7B A;  3KEQ A;  4GCV A;  3F6V A;  2GWR A;  2GA1 A;  3WGH A;  1HST A;  4R8H A;  4GYI A;  4ENN A;  2MC3 A;  2HQN A;  4LGW A;  1I5Z A;  3FXQ A;  2D2W A;  3QPT A;  3G73 A;  4I98 B;  4RGU A;  1KQ9 A;  4S05 A;  3NEU A;  5L3F A;  1AWC A;  4Q47 A;  4MNU A;  3K9T A;  5D6F A;  1F5T A;  3I4P A;  3FWE A;  2CO5 A;  1FY7 A;  2ZKZ A;  3QOP A;  1DDN A;  3TO6 A;  4N9I A;  4IRG A;  1ZN2 A;  3REO A;  5HVQ C;  3R6S A;  1XMK A;  4WX9 A;  4G7H F;  1DP7 P;  2C6Y A;  1MDM B;  3CUO A;  2VOO A;  3I54 A;  1LDK B;  1SAX A;  1BC7 C;  5EEH A;  1Q1H A;  1G3Y A;  1WRJ A;  2CSO A;  3RDI A;  2CFX A;  1K78 B;  1XSV A;  4A5N A;  1U6G A;  4LFU A;  4Q4Z F;  2FBK A;  3MZH A;  3HHH A;  3H3Z A;  2RC4 A;  3WOD F;  1KYW A;  4RGX A;  5ILS A;  5TJJ A;  5ICF A;  1LNW A;  4WCG A;  2J5O A;  3JTG A;  3WTW C;  1ON1 A;  1ZAR A;  4WXD A;  3RPQ A;  4M9Z A;  3IHU A;  2XAF A;  4XSX F;  2HWV A;  2LF8 A;  1HSJ A;  3ZPL A;  5KVR A;  2FNA A;  2Z5U A;  3E5X A;  5JFR A;  2NRA C;  1S6L A;  3BWG A;  4ESF A;  5A2Q Z;  1MJB A;  1BI3 A;  3COA C;  1GXQ A;  2ZBK A;  4G7Z F;  1BM9 A;  3ML6 A;  2FQ3 A;  5EEG A;  4MEX F;  4O6J A;  4HLX A;  2KIU A;  2XKO A;  1TW3 A;  3FF5 A;  2O3F A;  1P92 A;  3ISP A;  3ELK A;  2P7C B;  2FBI A;  2LNB A;  2OU2 A;  4UV8 A;  2AXL A;  2H6B A;  2GZW A;  2V1X A;  4KT5 C;  3ECO A;  4UNO A;  4B8X A;  4G9Y A;  4ETS A;  4YG2 F;  4IHS A;  1D8J A;  3QU3 A;  2VT2 A;  3PQJ A;  4WXC A;  2YX7 A;  3V7R A;  3DFG A;  2YX4 A;  1KQ0 A;  2BEO A;  4PGG A;  3SZP A;  5ED4 A;  4EGZ A;  1YFH A;  2OZU A;  3I5U A;  1E17 A;  1FBS A;  3M1E A;  3GFL A;  1MJA A;  5ICE A;  3IL2 A;  4M6Y A;  4GO1 A;  1B4A A;  3N4M A;  3FHZ A;  1GVJ A;  1KU3 A;  5FO5 A;  2ZJ2 A;  2FBH A;  1FYM A;  4HV6 A;  1R00 A;  4L5I A;  3LA3 A;  1LDD A;  2DAO A;  1R5H A;  1Z9C A;  3LWF A;  3GFM A;  5L3E A;  1ZRE A;  2P4W A;  4RB2 C;  3O3K A;  4A6D A;  3EQL F;  5K1Y A;  4ZYD A;  4A6E A;  2EFP A;  2K7L A;  3MQ0 A;  3JW4 A;  2FRH A;  3C1D A;  3RKX A;  5AIP A;  4EM0 B;  3KP4 A;  4HF1 A;  3GXO A;  4RAZ A;  1KQ8 A;  3IWF A;  2M45 A;  3CUQ B;  4JBA A;  4M73 A;  1DPU A;  1W7P A;  4U7D A;  1Z6R A;  1ON2 A;  2W25 A;  3ABT A;  2ESN A;  4L9T A;  1G6N A;  1PP7 U;  3E6M A;  2EV6 A;  2M8E A;  3L2C A;  2Z3Y A;  3RIR A;  1UFM A;  3L9F A;  3O2P E;  3PQK A;  4KYW A;  3L09 A;  1YW9 A;  4MQV A;  2AS5 F;  2F5F A;  1XN7 A;  4CO8 A;  4IRI A;  1CGP A;  5HOO A;  3JSO A;  2FE3 A;  4KUM A;  1W4M A;  1YLF A;  2F5E A;  4KMU X;  1XGS A;  3U9G A;  2A5Y B;  2P5K A;  5E18 F;  1XDU A;  3KET A;  2X4H A;  2Y0M A;  1MDM A;  2B0L A;  4LK0 F;  2M1B A;  1OYI A;  4LB6 B;  3ZMD A;  1SMT A;  3GYH X;  5FLX K;  2QZ8 A;  3WU1 B;  1BC8 C;  6PAX A;  2UXN A;  5J6X A;  3LFK A;  1QNT A;  2XGX A;  1HW2 A;  2NNN A;  4AIH A;  5BPD A;  3HOT A;  3KLO A;  1C0W A;  3V8J A;  1O3S A;  5D8K B;  5LGN A;  5CJ9 A;  1QZY A;  1FSH A;  3M8E A;  4LLG F;  2XUB A;  1SD7 A;  2OZ6 A;  3FMQ A;  2PI0 A;  4PDK A;  5DCM B;  3FXU A;  4Y15 A;  4HF0 A;  4L9V A;  4KA4 A;  4OMY A;  2XVC A;  4ON0 A;  2MBF A;  2QQ9 A;  2RVC A;  2IA2 A;  1S7O A;  2QM3 A;  3M9A A;  3IRR A;  3F8C A;  2XAJ A;  4G94 A;  3R60 A;  4MHG A;  3RTR A;  3KZZ A;  3PFI A;  2NYX A;  1BIA A;  1T0F A;  4Y17 A;  1H9G A;  4Q48 A;  5CVV A;  2CYY A;  1S29 A;  2XHK A;  4G6Q A;  1U5T B;  3KFW X;  4MTE A;  1HKT A;  2L54 A;  4QLC U;  3HTS B;  4EJT A;  5L3G A;  3FM5 A;  4ZYE A;  1KU2 A;  4LG0 B;  1L0O C;  3E6C C;  4LLL A;  2OD5 A;  2LKP A;  2Z33 A;  4HV5 A;  1O3Q A;  1U5T C;  3SXY A;  2OQG A;  1B9M A;  1R23 A;  3V7S A;  2P7V B;  5CVU A;  2EV5 A;  1J59 A;  2UXX A;  1EH7 A;  4PGH A;  5HLH A;  1R5G A;  4LLN A;  2Z99 A;  4YFK F;  4KIF A;  3EUH A;  5D5X B;  3GO5 A;  1FP1 D;  1G4D A;  2DW4 A;  2ZNZ A;  1YS7 A;  4AWX B;  1P6R A;  4FT8 A;  3JTH A;  1XGO A;  4KIB A;  2W57 A;  1ZGA A;  2L01 A;  1BJA A;  2HS5 A;  1P4A A;  1SMY F;  3QRF F;  4DQ2 A;  1K7A A;  5E17 F;  4NHJ A;  2ZXJ A;  2EA4 A;  3RPU A;  3F6O A;  3T1B A;  2VT3 A;  5ERI A;  3FMR A;  3HRT A;  2HYF A;  4ZZD A;  3BJO A;  1MJ9 A;  3W6K B;  5J8C A;  3CUQ A;  1KU9 A;  1ZLK A;  2PJP A;  1B59 A;  1QZZ A;  4KDP A;  1DPR A;  4HQE A;  4N0B A;  3NQO A;  2MLK A;  2FMY A;  3CTA A;  2XV4 S;  1V3F A;  1FNN A;  2CWE A;  3ZN1 A;  2COM A;  3F21 A;  4Y13 A;  1WI9 A;  3AAF A;  5IT3 A;  1YQA A;  5FFX A;  1TNS A;  5FGM A;  2YPR A;  5K5Q A;  2Z9O A;  4WF2 A;  2HYG D;  2ISY A;  4PCQ A;  4OIP F;  5E8I A;  1IN7 A;  3RI4 A;  3IKV A;  5ICG A;  1XCV A;  2HTS A;  1FYK A;  5DYM A;  4L0Y B;  4S04 A;  3GF2 A;  4ENM A;  3P7N A;  3GVA A;  2IVM A;  2A07 F;  4HX4 A;  4HX7 A;  2PBI A;  4U0V A;  2MA3 A;  1KA8 A;  4GXO A;  2M5W A;  3WE3 A;  1OPC A;  2YSR A;  1HBX G;  3ROU A;  1D8K A;  1LEA A;  1FOK A;  3P9C A;  3SHF A;  4JQF A;  3WTZ A;  3P9I A;  1OYW A;  1PUE E;  2R3S A;  1U8R A;  3BDD A;  2JTV A;  3FM3 A;  4RAY A;  4I7H A;  1FSE A;  4EJO A;  4G7O F;  3C3W A;  3TKY A;  5A2Q K;  1RIO H;  3VB2 A;  2XAQ A;  1O57 A;  1LJ9 A;  5DDG A;  3BZ6 A;  4BHP A;  1R1U A;  2JRT A;  3K1M A;  3B02 A;  2G7U A;  2HR3 A;  3BPV A;  1IN6 A;  2A6H F;  4DNC A;  4LMY A;  3SZT A;  1IXR C;  3KCC A;  3MEX A;  5HLI A;  5DCM A;  2MH2 A;  2A61 A;  3T5X A;  4UV9 A;  2DQL A;  4U0Y A;  3E97 A;  5K5R A;  4A0X A;  4F7Z A;  1HKS A;  4OIN F;  2NAZ A;  5FD5 A;  2IRF G;  1HKQ A;  3LQQ A;  3HSE A;  2GAU A;  4OIQ F;  2IP2 A;  2CG4 A;  1IZ1 A;  3IRQ A;  1U78 A;  2DK8 A;  3BPX A;  2CW0 F;  2WC2 A;  1RUO A;  3DF8 A;  1U5T A;  2IA1 A;  3J7A O;  4RGS A;  1FC3 A;  1F9N A;  4P96 A;  3TOA A;  1YS6 A;  2HFH A;  4LG0 A;  1JE8 A;  3EDP A;  2BBY A;  4A12 A;  2D1H A;  2CQK A;  1T2K A;  4HYE A;  2QQB A;  1T39 A;  2H27 A;  3U1D A;  2MLG A;  4A0Y A;  2XRO A;  1J9I A;  3V4G A;  4NB5 A;  4BNC A;  4OMZ A;  3ECH A;  1ZHF A;  3WTV C;  3O6B B;  5BPI A;  4IXA A;  3QU6 A;  2HKO A;  4HDU A;  1U2W A;  2W85 A;  1D3Y A;  5F6F A;  1XD7 A;  5HS7 A;  2RN7 A;  5JR3 A;  3TOB A;  4I2O A;  2EJR A;  2ADU A;  3TDZ C;  5E20 A;  4O3M A;  3ULQ B;  1Z91 A;  1OKR A;  4IF4 A;  2EA2 A;  3R0J A;  3I64 A;  1IXC A;  3WTU C;  2VBX A;  4WXH A;  4HOB A;  5LBQ A;  4XLP F;  1ZRF A;  3F3X A;  4OIO F;  3S2W A;  3QPH A;  5AIQ A;  1K79 A;  3L00 A;  4EJW A;  2IT0 A;  4HLY A;  2R7D A;  1OMI A;  5E1Z B;  2PMH A;  3K69 A;  4O5V A;  2DTR A;  2VC1 A;  3TO7 A;  1QPM A;  2DI3 A;  1ZH5 A;  1W5T A;  3FZV A;  3HHG A;  4RB0 A;  1ODD A;  3WGI A;  2HDC A;  2IPQ X;  3ERE D;  1XGM A;  4AVP A;  2ZME B;  3WTT C;  5BQT A;  3GZ6 A;  1TTY A;  1ZAO A;  2FF4 A;  1DUX C;  5BS6 A;  3LA7 A;  5F64 A;  2DPU A;  1CF7 B;  2FXA A;  1FP2 A;  2GIV A;  2ESH A;  5FB2 A;  1J7K A;  3I53 A;  2XAH A;  2FOK A;  3KE2 A;  2HGC A;  4IHT A;  1AOY A;  1LB2 A;  1T6S A;  3H3U A;  3GFJ A;  4EVI A;  5JVT A;  2PQ8 A;  2A6E F;  2EWN A;  1G3S A;  1IN8 A;  1ZG1 A;  5JHU A;  1MZB A;  3IKT A;  2FA5 A;  4IJA A;  5CVI A;  4HQM A;  3TDU C;  2P6T A;  1UB9 A;  4BQA A;  1Z7U A;  1ONV A;  4RB1 A;  3JSP A;  5DCF A;  1S7A A;  5L3C A;  1FZP B;  3J80 Z;  3HRU A;  1JHF A;  4P5O A;  3FXR A;  1KGS A;  3EYY A;  2VC0 A;  3Q5F A;  4UXN A;  4ZYH A;  4ENJ A;  4M74 A;  1BN5 A;  1G3T A;  1VTN C;  5CLS A;  3SFZ A;  2GXG A;  1K78 A;  2A68 F;  3K1N A;  1Z05 A;  1I27 A;  1WKM A;  3LAP A;  3R4K A;  4I01 A;  1YYV A;  1FBU A;  3KZY A;  2STT A;  4A0Z A;  4PZJ A;  1SD4 A;  3BOQ A;  2VE9 A;  3R61 A;  2HKX A;  4I02 A;  5LRS A;  3LQR A;  3DXJ F;  1UHM A;  2IA0 A;  2WTE A;  3GUD A;  3FX3 A;  3CJN A;  1SFE A;  3LAJ A;  2DK5 A;  2PN6 A;  1B6A A;  4OU0 A;  2OA4 A;  4YFX F;  4HDV A;  5HDG A;  2KJC A;  3V8K A;  2RNJ A;  2K86 A; 
#chains in the Genus database with same CATH topology
 5DD8 A;  4BH9 A;  2DOE A;  1OYY A;  3N97 A;  2ZXW H;  1XB4 A;  3L2W A;  4FCY A;  2A6T A;  4I09 A;  3E6B A;  3BT9 A;  3N05 A;  2LDU A;  2ISZ A;  2EZH A;  3DPL C;  2BVM A;  1HDD C;  1BR1 A;  4YII A;  3BC8 A;  2K02 A;  3CDH A;  3DKW A;  5B1B H;  1OCR H;  1IN4 A;  3DV8 A;  2LSO A;  2H09 A;  2LK2 A;  2TDX A;  3DPU A;  3TQN A;  1TWG J;  2DT5 A;  2DU9 A;  2F5C A;  2FNP A;  5FJ8 J;  4JK1 X;  3KPH A;  5DS9 A;  3HDD A;  2CU7 A;  2E5Z A;  2L7F P;  3I0T A;  2W24 A;  5K5O A;  3D0S A;  3TED A;  3ABL H;  3CCL I;  1IO2 A;  3DEW A;  2XAS A;  1RKW A;  2IEK A;  4HX8 A;  2E60 A;  2RQP A;  4HAM A;  2L3D A;  3AKZ A;  2DFE A;  2ACJ A;  3S93 A;  2O03 A;  4RGR A;  4I0A A;  1FJL A;  3I59 B;  4L5J A;  2VB6 A;  2ECC A;  1SD6 A;  2AHQ A;  4NQW A;  1NH3 A;  4BXX J;  3FIW A;  4G6D A;  1MW7 A;  4BBS J;  2GXA A;  3ESW B;  3OYJ A;  3JRA A;  5M5W J;  2AO9 A;  2JWT A;  1A04 A;  2MYS A;  2WWY A;  1ZRC A;  2L9S A;  2OJE D;  4QWQ A;  1KON A;  2KIF A;  1GXP A;  2VXZ A;  1HQC A;  3GZ5 A;  2PG4 A;  1NHA A;  1IRF A;  3OV8 A;  3WU2 C;  2VI6 A;  1XDS A;  3K1P A;  4BEH A;  1RZ4 A;  3KX2 A;  3JRD A;  1TQM A;  1A6Q A;  2Z16 A;  2NS0 A;  2BGC A;  3CQZ J;  2IS1 A;  4BGD A;  3VDX A;  3CO7 C;  3Q3S A;  3D5L A;  5JI6 A;  1EA3 A;  1VQ7 I;  2MG4 A;  2NXN B;  1LKX A;  5HS9 A;  1WQ2 A;  3K2Z A;  3ZQH A;  4IQJ A;  1MKM A;  5HLG A;  1G3W A;  2JT1 A;  4YRV A;  4FE4 A;  1UG2 A;  3QYB A;  1QVU A;  4W1U A;  4R79 A;  4IOA F;  4RAF A;  1FWZ A;  2QSH X;  2NNY A;  4I0B A;  3JRC A;  2IJL A;  2V6C A;  2Y2Z A;  4II3 A;  2CV0 A;  2V9P A;  5DM7 F;  1O7L A;  1D0X A;  1MSE C;  4XNF A;  3OS2 A;  1N77 A;  1JKP C;  2B9S A;  1H9T A;  3IWZ A;  2M7A A;  1QRY A;  1E0E A;  1WVR A;  3BJA A;  4AIK A;  5IYD J;  1WH7 A;  4HF2 A;  2DPD A;  4M3B A;  4Z6Y A;  2HXI A;  3HOW J;  2EFN A;  3K4K A;  2JQ7 A;  2D5V A;  1HDP A;  2P5L C;  2IXS A;  2CGP A;  3QP6 A;  4X1E A;  1H0M A;  3CC7 I;  3AG4 H;  2OTL I;  2GOX B;  5C4J J;  4EJU A;  3HIF A;  2UWM A;  1WJB A;  4ESB A;  1VQ9 I;  3M7G A;  1PUF B;  5DUI A;  4BQQ A;  1JHH A;  2GQQ A;  2I5U A;  2HQR A;  1SFU A;  2K3P A;  3FMS A;  4EM1 A;  1SFO J;  3QP5 A;  1CF7 A;  3S1R J;  2A3S A;  1O3R A;  2ZC2 A;  3F8F A;  1LDJ A;  4IQ4 A;  2XF5 A;  3JAM Z;  3JRF A;  2R0Q C;  3F8N A;  4KN7 X;  3H9G A;  4XKC A;  2Y75 A;  2TCT A;  4CCJ A;  5D6E A;  2I10 A;  2RKH A;  2E5N A;  4KT6 A;  3GWZ A;  5E1X A;  3CME I;  1XGN A;  3BJ6 A;  3K2A A;  1XTA A;  1UCR A;  2F5D A;  2M87 A;  5CQG A;  4YIF A;  4M6X A;  1T56 A;  3E5Q A;  5DEQ A;  1G2H A;  2VQH A;  2L4A A;  5H6Q A;  4ZH4 F;  4HRI A;  1JTY A;  1O3T A;  4X0G A;  1V4R A;  4E7I A;  4LJZ F;  5GPA A;  1X3U A;  1FYL A;  2R7Q A;  1GV5 A;  1R4N B;  1MBJ A;  1TNT A;  2QEN A;  3L2V A;  3H5A A;  1HLV A;  2OQR A;  2NVQ J;  2ZNY A;  2ZJQ F;  2JN6 A;  4ZYA A;  2QLZ A;  2RGV A;  2EFW A;  1R5I D;  1YG2 A;  1JJ6 C;  1T8I A;  3G6E I;  1XCB A;  2YS9 A;  2DDB A;  2G9W A;  3ZMU A;  4B3A A;  2BYV E;  1N75 A;  2F2E A;  2LC2 A;  1XMX A;  1RET A;  3BZC A;  4ZDO A;  3ZOB A;  4BHB A;  2KKO A;  2LBF A;  3LFU A;  1R1V A;  4EEF G;  3OIQ A;  3HL2 A;  5EEA A;  3WU0 A;  4IVN A;  4E7H A;  4UVC A;  1EH8 A;  1VQ6 I;  3T0Y A;  2VBY A;  2Q8K A;  2B7E A;  1SFK A;  3BG7 A;  2EV0 A;  3F72 A;  1VQO I;  2M2E A;  2D1V A;  3JRE A;  1USS A;  1U3E M;  2QBY B;  3VSK A;  2DOD A;  1EH6 A;  3FDY A;  1REP C;  3KP7 A;  2KJB A;  5LEJ A;  4X6A J;  2CUE A;  2FML A;  3MWM A;  3BY6 A;  5TRD A;  4IPA A;  4B4C A;  2FU4 A;  2FEZ A;  3E6D A;  2UZK A;  3G1M A;  4FX4 A;  2JA2 A;  4A3E J;  2IW5 A;  2OV7 A;  3RJP A;  2R92 J;  5F27 A;  4ZDP A;  5LHG A;  4BXU A;  3IP4 B;  5DV5 A;  3RKW A;  2W84 A;  2P6S A;  1VQN I;  1VQ8 I;  4KFC A;  1LQ1 A;  1VND A;  1I1S A;  4CDG A;  1KYZ A;  4FET A;  1W5C C;  2HTJ A;  3VOD A;  1GUU A;  3J81 Z;  2E2I J;  2HQ5 A;  4ZZL A;  4OIR F;  3DTE A;  2BXY A;  4A3M J;  3ONQ A;  1DU0 A;  5GTI C;  1V55 H;  4I99 C;  4IO9 F;  2XKP A;  5F04 A;  5L3B A;  2O6G E;  2DMT A;  1T98 A;  4CCN A;  3FXM A;  3CMY A;  3HSR A;  1U9N A;  2DBB A;  1R7J A;  2ME6 A;  2VE8 A;  4CZZ A;  1FBQ A;  3OYM A;  2HZT A;  4EV0 A;  2E71 A;  2VPR A;  2HDD A;  2X51 A;  3X2Q H;  1QBJ A;  1J75 A;  4M72 A;  3DP7 A;  1Y0U A;  1DGR M;  4P9U A;  1N78 A;  1X3W B;  1EKE A;  1PJR A;  1I6H J;  3V7C A;  4K2E A;  4DIQ A;  1Z6T A;  3HEF A;  3MAJ A;  4UVB A;  1O7F A;  1QVT A;  2BXZ A;  1BI0 A;  3F8M A;  5E1W A;  4C3I J;  4HPQ A;  4UUT A;  2K9L A;  5IPA A;  2RV8 A;  2EH3 A;  1WZ2 A;  4M71 A;  3F8B A;  4B48 A;  1EV7 A;  2EFO A;  3MN2 A;  1YIT I;  2L7Z A;  2WAQ A;  3HTU A;  5C4X J;  2NS7 A;  5EYR A;  1D1A A;  5B3S H;  2OCE A;  4EM2 A;  2HOE A;  2GXB A;  2QUF A;  3NAR A;  1RPW A;  3GTO J;  4B43 A;  2XRN A;  2DQR A;  3ZQ7 A;  1X1B A;  1R71 A;  3G1O A;  2DMQ A;  2K27 A;  3WTY C;  4CZC A;  3NAU A;  5D4S A;  3GW2 A;  3VWB A;  3E3V A;  3HSF A;  1W5S A;  3MKL A;  3UKG A;  1RR8 C;  2MH9 A;  1W7P D;  4JOM A;  3BTC A;  3OYI A;  2PLY A;  4U88 A;  1GLN A;  3RKY A;  3L7W A;  2BVL A;  3ZQQ A;  1PYV A;  2HOA A;  3HB9 A;  1J2X A;  3HJE A;  4IRH A;  3ZMV A;  4AYB N;  1X58 A;  4IL6 C;  4D5F A;  3MKY B;  2IS4 A;  5GAD J;  2JVH A;  1X2N A;  5FRO A;  3IC7 A;  5FD6 A;  2LRD A;  2VJ5 A;  2GBY A;  3I59 A;  3OOP A;  3WGG A;  3P9K A;  2X6O A;  2WA0 A;  4NBQ A;  3ZRG A;  5H2F C;  1A35 A;  4BAC A;  1PDN C;  1OQY A;  4E70 A;  2XSJ C;  4M9X A;  3C18 A;  3H1C A;  5DTD A;  4R1H A;  5ICC A;  4WWC A;  1VFC A;  4ZC3 A;  2XAG A;  2KIM A;  1E2X A;  3HBL A;  4P55 A;  4BL0 B;  2CH0 A;  1WJA A;  4XRF A;  1P4X A;  3H9J A;  4D5C A;  1Y56 A;  1T0F C;  5F0H A;  2OAZ A;  5BMZ A;  2HVS A;  3F23 A;  2NVY J;  2O0Y A;  2BE5 F;  3QAH A;  3BLY A;  4JP0 A;  1KU7 A;  3DCF A;  1I3Q J;  3MZY A;  4LD5 A;  1R6R A;  4XBF A;  2XPU A;  3BRO A;  1ZGJ A;  4N9H A;  4BE1 A;  4PSW A;  1VI0 A;  4D7M A;  5HDK A;  3F22 A;  1MBF A;  3T8R A;  4QSH A;  1I39 A;  1TT5 B;  2EFQ A;  2JJ7 A;  2UUZ A;  1IXS B;  2IBD A;  4XOT A;  1S7E A;  2HOT A;  1B9N A;  5F08 A;  2KHM A;  2MGQ A;  1IDY A;  5FRM A;  1LVA A;  3HRS A;  4L5E A;  4J19 A;  5D5W B;  3BP8 A;  4P9F A;  1F4K A;  1STZ A;  2CV1 A;  2P5V A;  3G3Z A;  3Q9S A;  2NVX J;  4L9N A;  3HYI A;  2Q2E B;  1FLI A;  1ORK A;  2BZT A;  4B3X A;  3PIP F;  4L9J A;  4IHW A;  3ABK H;  1YO5 C;  3DLA A;  1K4T A;  4XON A;  3PNT A;  3Q0W A;  1UG0 A;  2JZY A;  3U1K A;  2M3A A;  2KT0 A;  3WG9 A;  3O8H A;  3ASN H;  5IT9 K;  1PUF A;  1I1G A;  2P8T A;  2BV6 A;  4RDU A;  4PUS A;  4AIJ A;  4BAY A;  4XLH A;  2QWW A;  5LGT A;  2D45 A;  2DA5 A;  2Y48 A;  4A3J J;  1W36 C;  4XSZ F;  3ABU A;  2OPT A;  4OAY A;  2K9S A;  3BG9 A;  4HBL A;  5FRN A;  4E7K A;  3HUG B;  4XLN F;  1S8N A;  4TV7 A;  4LK1 F;  3EUA A;  3TP0 A;  3WHC A;  1SC7 A;  4LIT A;  3EUH C;  5E8G A;  4H0E A;  1X3Z B;  1HW5 A;  3U21 A;  3J80 K;  4CXF A;  1T38 A;  3K4J A;  1BI1 A;  2PEX A;  1KZH A;  5DD4 A;  2GA2 A;  2VLA A;  3DEU A;  1I6X A;  4E4H A;  3GTM J;  1LVK A;  3K7A J;  3RYR A;  4D7N A;  3S8P A;  4RB3 C;  1QGP A;  3M3Y J;  4LG3 A;  4EGY A;  2R7R A;  2KRH A;  2PMZ N;  5J3L A;  2DLL A;  5D8L B;  3A2K A;  1XSX A;  3UNG C;  3LST A;  2QVO A;  5HOD A;  2M4K A;  5D5U B;  1QQI A;  1GHC A;  2GM4 A;  3ZN0 A;  5IYB J;  1YW8 A;  2LH9 A;  3VYS B;  1IUY A;  2G0E A;  2XGC A;  3H92 A;  3LNQ A;  1WJF A;  1GDT A;  3FXK A;  2V79 A;  3DWL E;  5FFZ A;  2EB7 A;  4OOI A;  3IH4 A;  5F1R A;  3OS1 A;  4CHU A;  4NC6 A;  4CIC A;  4ZYG A;  4DBR A;  2L4M A;  4A2U A;  1UST A;  4EQQ A;  3ZP5 A;  2WAQ N;  4F91 B;  1AKH B;  2L0K A;  3EET A;  3K4N A;  5DM6 F;  5IT9 Z;  4GYG A;  1NK2 P;  5J4V A;  2XIG A;  2CS3 A;  4ENK A;  5H20 A;  1B72 A;  3E5U A;  3CUQ C;  5C44 J;  1FT9 A;  2LMD A;  4PFP A;  1DGW Y;  4N4O B;  3QWL A;  3TL4 X;  1WJC A;  3ZMS A;  1BIB A;  1HXD A;  4NC8 A;  1E3P A;  3U2R A;  5AON A;  3HC7 A;  2VBW A;  2BY3 A;  1WGX A;  2W1O A;  5HS8 A;  2QBY A;  1IN5 A;  1AA7 A;  4KJZ A;  1BA5 A;  2O8K A;  3KZI C;  1CQT A;  2EZL A;  1PP8 F;  2EPF A;  4E7Z A;  4XKW A;  1PVE A;  3QPS A;  3QYF A;  1ZG5 A;  3HKZ A;  3TO9 A;  2V1D A;  2ZO4 A;  3K4B A;  4PSX A;  4MEY F;  1YW7 A;  4V2G A;  1WJE A;  1WWX A;  3M07 A;  3KP5 A;  2JPC A;  1MH3 A;  1ZGW A;  4BJ6 C;  2VQC A;  4HST A;  3OL3 A;  5EG0 B;  1ZRD A;  3C7J A;  3BTL A;  4RLF A;  2O8X A;  2J5P A;  4CGZ A;  3LSG A;  1ZG3 A;  3FBN B;  3KLN A;  5GP9 A;  2H8R A;  3DU6 A;  2H6C A;  5LGU A;  4L18 B;  3W6J B;  3EYI A;  2EIJ H;  2DXI A;  2O61 A;  2X6X A;  2DYS H;  3ZMZ A;  4B09 A;  4S0H B;  1IV6 A;  3PSF A;  2M30 A;  2DA4 A;  2AXT C;  5LLQ A;  3M4O J;  5LRR A;  5CVR A;  3NRV A;  1J5Y A;  2YR2 A;  5ILU A;  1RUN A;  1FMV A;  2VON A;  3OYG A;  4I6Z A;  1Y8Q B;  2LRE A;  1APL C;  5J1U A;  1MBE A;  1I50 J;  4F92 B;  3HXL A;  3RYP A;  2BY0 A;  3SZG A;  3I71 A;  4KN4 X;  5HNF A;  1BOA A;  3CP8 A;  3PFY A;  1BBY A;  3M8F A;  1R1T A;  4BJT A;  5L3D A;  3VOE A;  4FHT A;  4C2M J;  5BOX A;  1IGN A;  1SFX A;  4RBO A;  4ESJ A;  3TGN A;  4A5M A;  5CYV A;  5LHI A;  5ILV A;  3C2H A;  1IW7 F;  1FOY A;  3RZO J;  1IRG A;  2Q1Z B;  4XR6 A;  4G8X A;  3PNY A;  2NVU B;  1TW2 A;  2VOD A;  4UUV A;  3MKZ A;  1LEB A;  2E2J J;  2R5Y B;  2WY7 Q;  4RS8 A;  4UVA A;  1XMA A;  2K4B A;  1R36 A;  4IKF A;  4IX7 A;  4UHT A;  4AM3 A;  3WTS C;  5KK1 A;  3K0L A;  4PJ0 C;  4IOC F;  3RPU D;  1Z1D A;  4ZTF A;  3P5J A;  1K6O A;  1ZTR A;  1JKO C;  2LTP A;  3H0D A;  4KIG A;  2KRF A;  2V9V A;  3OS0 A;  1XSD A;  2PFB A;  5CVJ A;  1XS9 A;  3ZQL A;  3OIO A;  4XMY A;  3CCJ I;  4GGG A;  5H6R A;  1FPQ A;  3MCZ A;  1Z67 A;  2M8G X;  2HI3 A;  9ANT A;  5F1J A;  1MMS A;  4EJV A;  2KZV A;  1P7I A;  3SYT A;  4KIC A;  2R7U A;  1JTX A;  3SDG A;  1JXS A;  4BY7 J;  5M5Y J;  5FLX Z;  2E7W A;  2H94 A;  2KIQ A;  3I4M J;  3QOE A;  2DOA A;  2EK5 A;  4BYY A;  4D0P A;  3WG7 H;  2Y0S N;  3R0A A;  1TQP A;  3B6A A;  1Z0X A;  5FKK A;  1SD5 A;  2G7H A;  4XN3 A;  2PMU A;  2VBZ A;  3V8L A;  1QO0 D;  3ZQC A;  4LB5 A;  4A3G J;  2HQA A;  3GEZ A;  1RR7 A;  3HOV J;  2V1U A;  1L3L A;  2ZCW A;  1R49 A;  3CLO A;  2LD5 A;  2DA3 A;  1LFP A;  2HEO A;  1S5L C;  3T8T A;  3HRM A;  2WAD A;  1Z3Y A;  2VJJ A;  4IHX A;  2ELK A;  5E3O A;  1TBX A;  1UAA A;  1MMD A;  3GFI A;  4GFB A;  1ULY A;  4MGR A;  4ASN A;  2DFI A;  2K4J A;  3HOX J;  2ZJP F;  1QPI A;  1IF1 A;  2B63 J;  4Z2Y A;  3I58 A;  4MTD A;  1BI2 A;  1LFB A;  4A69 C;  4CCK A;  4CYD A;  1MGT A;  2CUF A;  3CCM I;  4W97 A;  4HW0 A;  1S3J A;  3F0C A;  1JJ8 C;  5JLW A;  1ZLJ A;  4AD9 A;  1ETY A;  2ELH A;  2VOP A;  1MMA A;  1YTY A;  3JAM K;  3JCU C;  3K70 D;  1JGS A;  4KMF A;  1WI3 A;  1I3A A;  2E1N A;  1MBK A;  1P4W A;  5TGT A;  1A6I A;  3BR6 A;  2XGE A;  3ZCO A;  2QF7 A;  2L02 A;  3KP6 A;  1P2F A;  3H3V K;  2X0L A;  1R58 A;  2YU3 A;  3UR3 C;  1HW1 A;  5M5X J;  1UHW A;  2Q2E A;  3DPT A;  2Y69 H;  3BZK A;  1SVL A;  1K4S A;  4Q5S F;  1B1B A;  3WE2 A;  5HDN A;  1X1P A;  3WTX C;  5B5E C;  5KHD A;  1GVD A;  2UV1 A;  4XID A;  5LEK A;  4BXF A;  2R7V A;  2DFF A;  3KP2 A;  1W0U A;  2JPB A;  3DQV C;  4EMS A;  2KFD A;  5K7F A;  5LHH A;  2E1C A;  3LSM A;  4FX0 A;  3Q9V A;  2FSW A;  1ZYR F;  2DO7 A;  4YFN F;  3CDI A;  3W3C A;  3GX4 X;  2A69 F;  3HUG A;  2LOO A;  5D5V B;  1FX7 A;  3JR9 A;  1OCT C;  2WV0 A;  2RDP A;  5GAE J;  2EIK H;  2OBP A;  2FX0 A;  3FKJ A;  2OC6 A;  3KP3 A;  1JGG A;  2QQA A;  2V4J C;  2ZME A;  2X6Y A;  1RI7 A;  2KL4 A;  4XOR A;  3DU5 A;  1LE8 B;  2LVS A;  4RAG A;  1E3O C;  5B1A H;  4HA8 A;  2L9R A;  2E7X A;  2ETH A;  2LY9 A;  4L0Z B;  4MQ9 F;  3A1Y A;  4OWR B;  1IAW A;  1FIP A;  2VN2 A;  1D5Y A;  2DN0 A;  1MMG A;  2JSC A;  3AG3 H;  2TRT A;  2ZFW A;  3D5R C;  4XLE A;  5EGO B;  2BHZ A;  2QYO A;  5FLM J;  1P9Q C;  3BQZ A;  3KEO A;  2R7F A;  1MD0 A;  1TC3 C;  3SQN A;  2HYJ A;  1JKQ C;  4U0W A;  3L1P A;  1WSU A;  2K3F A;  2ID6 A;  3KIO A;  3BCB A;  4BHC A;  5KNL A;  4HZF A;  3GLL A;  1F1Z A;  1R22 A;  2XPW A;  3VFZ A;  4DBQ A;  1MIJ A;  4D9J A;  2R5Z B;  3GTP J;  3MFK A;  1TQI A;  2VJI A;  3ZR8 X;  4WK8 F;  4KNY A;  3ZMT A;  3ABM H;  2XDV A;  3A02 A;  1AKH A;  5J8F A;  1W7P B;  2DFH A;  2STW A;  3OYA A;  3KEY A;  2CW7 A;  2LF7 A;  1D0Z A;  3HOS A;  4PK4 A;  2K5C A;  1MNM C;  1J0R A;  1OR7 A;  2MD5 A;  2X9D A;  3B73 A;  5DUK A;  3VEP A;  2Q0O A;  1WFX A;  5KAI C;  4M9S A;  4Y4R A;  1TWF J;  1TLH B;  4CYC B;  3IAM 2;  3MZ8 A;  5D4R A;  3LA2 A;  4PJJ A;  3J81 K;  5CPR B;  3A01 B;  1RNL A;  3GLX A;  2LFB A;  4PJL A;  1D5V A;  4E6K G;  3PIO F;  3S17 J;  3K4M A;  1YIO A;  1Z21 A;  3CO6 C;  4U7B A;  3KEQ A;  4GCV A;  2W48 A;  3DBR B;  3F6V A;  2GWR A;  2GA1 A;  3WGH A;  1HST A;  3GTJ J;  4R8H A;  4GYI A;  3CCV I;  5JVG F;  4ENN A;  1YX5 A;  2MC3 A;  2HQN A;  4J01 A;  4LGW A;  1MSF C;  4V2F A;  1I5Z A;  3LL7 A;  4XRS G;  2ELJ A;  3FXQ A;  2D2W A;  5GTH C;  2NVT J;  2DMU A;  3QPT A;  3G73 A;  1LUJ B;  2KPM A;  4I98 B;  4RGU A;  2BW3 B;  1KQ9 A;  2I8D A;  2DA6 A;  4S05 A;  5EG0 A;  2JRM A;  3NEU A;  5L3F A;  1AWC A;  2DYR H;  4Q47 A;  3HZJ A;  4MNU A;  3D1N I;  2X1C A;  3K9T A;  5D6F A;  3IH3 A;  2FOW A;  1F5T A;  1JUS A;  3I4P A;  3FWE A;  1MNE A;  1FY7 A;  2CO5 A;  2ZKZ A;  3K4L A;  3AG1 H;  3QOP A;  1ZR2 A;  3VPR A;  3W2W A;  4ANJ A;  4CA0 A;  1DDN A;  3TO6 A;  4N9I A;  4IRG A;  1ZN2 A;  3REO A;  3C2G A;  1F36 A;  3S1M J;  3PNV A;  5HVQ C;  3R6S A;  1XMK A;  3OYE A;  4WX9 A;  4G7H F;  4E7S A;  2WB1 A;  1DP7 P;  1BJZ A;  2C6Y A;  3MMY B;  2JUG A;  1MDM B;  3ZQF A;  3S32 A;  3PL8 A;  3M8J A;  3CUO A;  4XOP A;  2VOO A;  3I54 A;  1LDK B;  4DYR A;  2P0W A;  3VYR B;  1SAX A;  5EEH A;  1BC7 C;  4M6V A;  1Q1H A;  1G3Y A;  3E1S A;  3IV5 A;  1WRJ A;  2CSO A;  3RDI A;  2CFX A;  1K78 B;  1XSV A;  4A5N A;  5IYC J;  1U6G A;  1DQU A;  2L9N A;  4LFU A;  3CLQ A;  3BG5 A;  1OCP A;  3MVP A;  4Q4Z F;  2FBK A;  5J1Y A;  3VYU B;  3MZH A;  3HHH A;  3D5S C;  3H3Z A;  2RC4 A;  3WOD F;  1OIS A;  1KYW A;  4RGX A;  4G12 A;  5ILS A;  5TJJ A;  5ICF A;  2CW8 A;  3H35 A;  4UB8 C;  1LNW A;  2R5Y A;  3S2H J;  3BR2 A;  4WCG A;  4MLO A;  2J5O A;  1DP3 A;  3JTG A;  2VQL A;  1ZKG A;  2JVG A;  3WTW C;  1ON1 A;  1ZAR A;  2BHY A;  1NG7 A;  2NS8 A;  4WXD A;  3RPQ A;  4M9Z A;  3IHU A;  2KLO A;  1VQ4 I;  3SEZ A;  2XAF A;  4XSX F;  3SDB A;  2HWV A;  2LF8 A;  2V1N A;  2X1D A;  1HSJ A;  4LOC A;  5GPC A;  3ZPL A;  4A3B J;  5KVR A;  2RNG A;  2Z5U A;  2FNA A;  4EAT A;  2A5W A;  3BR0 A;  1D1C A;  2X85 A;  2K9Q A;  3DKX A;  3E5X A;  1QU3 A;  5JFR A;  2NRA C;  1S6L A;  1NTC A;  3BWG A;  4RM3 A;  4ESF A;  5A2Q Z;  4BY1 J;  2L7M P;  1MJB A;  4Y52 J;  4II2 A;  1BI3 A;  3OYL A;  3COA C;  2R93 J;  1GXQ A;  2ZBK A;  4G7Z F;  3FIS A;  1BM9 A;  3ML6 A;  2EIL H;  1A31 A;  2EIM H;  2FQ3 A;  1BW5 A;  3S1N J;  5EEG A;  4MEX F;  4MFD A;  1X4P A;  4O6J A;  4HLX A;  2KIU A;  1FIA A;  2XKO A;  4BE2 A;  3LSR A;  2KP6 A;  1TW3 A;  2Y31 A;  2L2O A;  3FF5 A;  1VQP I;  2O3F A;  1P92 A;  3ISP A;  2V26 A;  3ELK A;  1IRX A;  2MC4 A;  2P7C B;  2FBI A;  2LNB A;  2OU2 A;  1R9T J;  4UV8 A;  5EZH A;  1QHG A;  5B66 C;  4IZZ A;  2RQQ A;  5E3M A;  2AXL A;  2H6B A;  2GZW A;  2V1X A;  3OMY A;  4KT5 C;  1VQM I;  3ECO A;  4UNO A;  2KIS A;  5IOZ A;  4RMN A;  3HG9 A;  4ZTJ A;  4B8X A;  4G9Y A;  4ETS A;  4YG2 F;  1VF9 A;  2GLO A;  4IHS A;  1D8J A;  1OLT A;  3QU3 A;  2VT2 A;  3PQJ A;  4WXC A;  2V6E A;  3L2U A;  2JA7 J;  1Y1V J;  2YX7 A;  3V7R A;  3DFG A;  2YX4 A;  1KQ0 A;  2BEO A;  4PGG A;  3SZP A;  5ED4 A;  4EGZ A;  4MO7 A;  1YFH A;  2QA4 I;  2OZU A;  3I5U A;  1E17 A;  1FBS A;  3M1E A;  3GFL A;  1MBG A;  2FUG 2;  1MJA A;  3CC4 I;  1SAU A;  5ICE A;  3IL2 A;  1V5F A;  4B44 A;  5TIS C;  4FIS A;  4M6Y A;  2WBM A;  4GO1 A;  5IP9 J;  1B4A A;  3N4M A;  3FHZ A;  4BE0 A;  3G71 I;  1GVJ A;  1KU3 A;  5FO5 A;  3ASO H;  2O7O A;  2ZJ2 A;  3SFI A;  1X19 A;  2FBH A;  1FYM A;  4HV6 A;  1R00 A;  4L5I A;  3IH2 A;  3LA3 A;  3L2Q A;  1LDD A;  2DAO A;  1WJD A;  1R5H A;  3RSN A;  1HA8 A;  1MMN A;  1Z9C A;  3LWF A;  1MND A;  1V5G A;  3GFM A;  5L3E A;  2IGO A;  2P4W A;  4RB2 C;  4A3K J;  1ZRE A;  3H36 A;  3O3K A;  3CJQ B;  4A6D A;  3EQL F;  3NWT A;  1WH5 A;  5K1Y A;  4BKX A;  4ZYD A;  1YOV B;  4QPO A;  4A6E A;  4CCM A;  1FOW A;  2EFP A;  2K7L A;  3OYH A;  3DTK A;  4F55 A;  1ITY A;  1LE8 A;  3RQ4 A;  3MQ0 A;  1JI8 A;  3JW4 A;  2FRH A;  3C1D A;  3RKX A;  2L9V A;  5AIP A;  4EM0 B;  2PX9 A;  3KP4 A;  3W2V A;  4HF1 A;  5EGO A;  2AQF A;  4E7J A;  2QQ8 A;  3JRB A;  2W4S A;  1G8X A;  5F0F A;  3CCS I;  3GXO A;  5IP6 A;  2IS2 A;  2M0C A;  4RAZ A;  4AUX A;  3S16 J;  5FLV A;  1KQ8 A;  3E7L A;  3A0B C;  3IWF A;  3PO2 J;  3CD6 I;  2M45 A;  3CUQ B;  4JBA A;  2FD5 A;  2E2H J;  2CQQ A;  4M73 A;  1DPU A;  1W7P A;  2KRC A;  4U7D A;  4YEL A;  1Z6R A;  1RRJ A;  1ON2 A;  4DW6 A;  2FQ4 A;  2W25 A;  3ABT A;  2V9K A;  2ESN A;  4L9T A;  1G6N A;  2F48 A;  1PP7 U;  3FK6 A;  3E6M A;  1X1A A;  3AL0 C;  2EV6 A;  2M8E A;  2HVQ A;  4CYC A;  3L2C A;  1FTT A;  2KQR A;  2EIN H;  3MKW B;  2OUM A;  2Z3Y A;  3J7Y J;  2KDZ A;  3QQA A;  3M1C A;  4XRS A;  3CCY A;  3RIR A;  2IGN A;  2GIZ A;  1UFM A;  4B47 A;  1B8I B;  3L9F A;  3O2P E;  4CSW A;  2DA2 A;  1S72 I;  3PQK A;  1GT0 C;  4A3C J;  3VSL A;  1JKR C;  4KYW A;  2M9H A;  3G1L A;  1YW9 A;  2JMW A;  3L09 A;  4MQV A;  2AS5 F;  1YRN B;  3TW7 A;  2X6W A;  1M1E B;  2F5F A;  1TWH J;  1XN7 A;  1POG A;  4CO8 A;  1XG1 A;  2DTZ A;  1OCO H;  4IRI A;  1CGP A;  5HOO A;  4M3G A;  2FE3 A;  3JSO A;  3B6C A;  4KUM A;  5CKT A;  1W4M A;  1YLF A;  2F5E A;  4KMU X;  4JX5 A;  1XGS A;  2LBF B;  3U9G A;  1JUM A;  2A5Y B;  2P5K A;  5E18 F;  1XDU A;  3KET A;  2X4H A;  2EBI A;  2DJN A;  2Y0M A;  1MDM A;  1ENH A;  3PO3 J;  2B0L A;  4LK0 F;  1VQ5 I;  2XRL A;  3HGY A;  4G6T B;  2M1B A;  2MFZ A;  1OYI A;  4LB6 B;  3ZMD A;  4CCL A;  1SMT A;  2O9L A;  3DLL F;  1IG7 A;  5FKO A;  3GYH X;  5FLX K;  1Y0N A;  1VQK I;  2QZ8 A;  3WU1 B;  1BC8 C;  6PAX A;  2OTJ I;  4F52 A;  3K70 C;  2UXN A;  5J6X A;  2VXD A;  3LFK A;  1QNT A;  2XGX A;  4MFE A;  4JYK A;  1HW2 A;  2NNN A;  3ZGK A;  4AIH A;  5HNH A;  5BPD A;  3HOT A;  3KLO A;  3NWS A;  2VIX A;  4FAS D;  1C0W A;  3V8J A;  1O3S A;  4LIU A;  1TWA J;  3F9K A;  5BNG A;  3QPL A;  4E7L A;  2X1E A;  5D8K B;  5LGN A;  4NDL A;  5CJ9 A;  1MH4 A;  3L2R A;  1JT6 A;  1QZY A;  4KIS A;  1FSH A;  3M8E A;  4LLG F;  2XUB A;  1SD7 A;  2ICW G;  2OZ6 A;  3FMQ A;  2PI0 A;  4PDK A;  5DCM B;  3FXU A;  4Y15 A;  4HF0 A;  3S3O A;  4HNV A;  1HCR A;  2OCC H;  3JRG A;  4L9V A;  4KA4 A;  2DA7 A;  4OMY A;  2XVC A;  4ON0 A;  2MBF A;  2QQ9 A;  4BDZ A;  3PSI A;  2RVC A;  1JT0 A;  2IA2 A;  2F6C A;  1S7O A;  2QM3 A;  2K85 A;  3M9A A;  2HPM A;  4UY8 I;  5KAF C;  3IRR A;  3F8C A;  2XAJ A;  3S14 J;  4C3J J;  3CC2 I;  2JSP A;  5LD2 C;  3OL4 A;  1BL0 A;  3GME A;  1OJL A;  4G94 A;  3R60 A;  4MHG A;  3RTR A;  3KZZ A;  4A3L J;  4BQN A;  3LOC A;  3PFI A;  2NYX A;  1BIA A;  3PUB A;  5J47 A;  1T0F A;  4Y17 A;  1H9G A;  1BR2 A;  2VAS A;  2BY2 A;  4Q48 A;  5CVV A;  2CYY A;  2HOS A;  1S29 A;  2XHK A;  4G6Q A;  2LR8 A;  1Q1V A;  1ZK8 A;  2YU9 J;  1U5T B;  3RZD J;  3KFW X;  4BBR J;  4DOZ A;  1X4O A;  3CF5 F;  4MTE A;  1YX3 A;  1U8B A;  1HKT A;  2ZXH A;  3CP2 A;  2L54 A;  4QLC U;  1IUF A;  1Y8R B;  3HTS B;  4EJT A;  5L3G A;  3FM5 A;  4ZYE A;  1KU2 A;  4LG0 B;  3ERM A;  4UUS B;  4D1Q A;  1L0O C;  2QGU A;  3E6C C;  3LSI A;  3HOZ J;  2WAE A;  4N4N B;  2ZSI B;  3GBG A;  1XPX A;  2VKH A;  1HOM A;  2Z1D A;  2LKS A;  4LLL A;  2OD5 A;  3OYC A;  2CQ7 A;  2LKP A;  2CUZ A;  2Z33 A;  4HV5 A;  1O3Q A;  2RRE A;  1U5T C;  3OR1 C;  3SXY A;  4IEJ A;  2VPL A;  2MW8 A;  2OQG A;  1B9M A;  5IP7 J;  3JRI A;  1XC5 A;  1R23 A;  3V7S A;  2CQN A;  2P7V B;  3CMA I;  2VQG A;  1XX5 A;  5HLT A;  3FBI B;  5CVU A;  4Y7N J;  4BU2 A;  2EV5 A;  3BCA A;  1J59 A;  1ZQ3 P;  1VZ0 A;  4XRM A;  2UXX A;  1IC8 A;  2EZK A;  4FE7 A;  4C3H J;  1EH7 A;  1NK3 P;  3QYE A;  1V54 H;  2PJR B;  4PGH A;  2BY1 A;  2W00 A;  5HLH A;  1FOX A;  1R5G A;  3GTG J;  4LLN A;  2HPI A;  3HKZ N;  2MSY A;  1X2M A;  2Z99 A;  4YFK F;  3CMM A;  4FQG A;  4KIF A;  3EUH A;  3HGG A;  5D5X B;  2QCO A;  3GO5 A;  4XM3 A;  1G59 A;  2WY8 Q;  1FP1 D;  1G4D A;  2DW4 A;  2ZNZ A;  1ZR4 A;  3PUF A;  1YS7 A;  4AWX B;  1P6R A;  2Y30 A;  3BQY A;  3E0J B;  4FT8 A;  3JTH A;  4M3F A;  1XGO A;  4KIB A;  3H0G J;  2W57 A;  1ZGA A;  2FJ1 A;  2NOG A;  1BOB A;  1R4M B;  5JHF A;  4YEJ A;  2Y9Z A;  2L01 A;  1BJA A;  3G4S I;  3AG2 H;  2HS5 A;  1P4A A;  1SMY F;  1D1B A;  3OOU A;  4NUB A;  5J40 A;  4HNU A;  3QRF F;  2EZI A;  4DQ2 A;  4QTR A;  1H88 C;  1K7A A;  5E17 F;  4NHJ A;  2ZXJ A;  3CCU I;  2EA4 A;  3RPU A;  3F6O A;  3T1B A;  3CCE I;  2VT3 A;  5ERI A;  3FMR A;  3HRT A;  2HYF A;  1QHH D;  2RAE A;  1YJW I;  1W0T A;  2M7B A;  4ZZD A;  4AID A;  2K9M A;  2VKE A;  3FXJ A;  3HPH A;  4IHV A;  3BJO A;  1MJ9 A;  3W6K B;  3GTL J;  5J8C A;  2VJ4 A;  1KU9 A;  3CUQ A;  1QA6 A;  1ZLK A;  2PJP A;  1B59 A;  1WHU A;  2ZFU A;  1QZZ A;  4KDP A;  1DPR A;  4HQE A;  4N0B A;  3DKY A;  3FXL A;  3GZN B;  3NQO A;  2MLK A;  2FMY A;  4AU7 A;  3CTA A;  1SVM A;  3OYN A;  2XV4 S;  4A93 J;  1V3F A;  1S9H A;  1FNN A;  2CWE A;  3ZN1 A;  2COM A;  3F21 A;  4Y13 A;  3H9Q A;  1WI9 A;  2XB5 A;  1ACI A;  3AAF A;  5IT3 A;  4AYB A;  3RKQ A;  5M3M J;  1YQA A;  3TP3 A;  2F4O B;  3QOD A;  5FFX A;  1TNS A;  4Y3O A;  1Z7L A;  5FGM A;  1WPK A;  2W7N A;  3OWT A;  2YPR A;  4JX6 A;  5K5Q A;  3BG6 A;  2Z9O A;  2DMN A;  3H5R A;  4WF2 A;  2HYG D;  2ISY A;  2M34 A;  3OYK A;  1B8I A;  4PCQ A;  4GDF A;  4OIP F;  2JUC A;  4A3I J;  5E8I A;  3I56 I;  1IN7 A;  1SVO A;  2DOF A;  2ZXI A;  3RI4 A;  3IKV A;  5FKN A;  2ZSH B;  1ETW A;  1YI2 I;  3BG3 A;  1ETK A;  5ICG A;  1T33 A;  1XCV A;  2HTS A;  1FYK A;  1YRN A;  1A5J A;  4V19 K;  5DYM A;  2MD0 A;  2L7K A;  1TL8 A;  4L0Y B;  3JRH A;  4S04 A;  3O8G A;  3GF2 A;  3DBL B;  2E19 A;  4ENM A;  3WHB A;  3OY9 A;  3P7N A;  3J7A Y;  3S2D J;  3GVA A;  2IVM A;  2N8G A;  3A4C A;  2A07 F;  1SAN A;  2ECB A;  4HX4 A;  2IS6 A;  4HX7 A;  4XK4 A;  1B72 B;  2PBI A;  3H5N A;  5FKM A;  4AVZ A;  2CFO A;  3IUO A;  4U0V A;  5CQE A;  4AC0 A;  2MA3 A;  2QSF X;  1DU6 A;  4C2T A;  3BTI A;  1KA8 A;  2WAF A;  2CJJ A;  2M5W A;  4GXO A;  1V5E A;  3DTI A;  3WE3 A;  1OPC A;  2JK3 A;  2YSR A;  4XKV A;  1HBX G;  1UMQ A;  3IAS 2;  3ROU A;  1HF0 A;  3S3N A;  1D8K A;  1LEA A;  1X1D A;  5FKL A;  1FOK A;  3P9C A;  3SHF A;  4JQF A;  3WTZ A;  1ETO A;  3K6G A;  3P9I A;  1OYW A;  1FMW A;  2VKV A;  2R3S A;  1PUE E;  1U8R A;  3BDD A;  2JTV A;  3FM3 A;  3BR3 A;  4RAY A;  1WCM J;  4I7H A;  1FSE A;  4XN0 A;  3A0H C;  2LKX A;  1K6Y A;  3ZQI A;  2MAB A;  4EJO A;  4G7O F;  2H8W A;  3C3W A;  3TKY A;  2IGM A;  1OFC X;  5A2Q K;  1RIO H;  5IY5 H;  3VB2 A;  5EF6 A;  4JX4 A;  3CES A;  5EJC A;  2XAQ A;  3OYB A;  1O57 A;  1LJ9 A;  3TW6 A;  3LSH A;  5DDG A;  2LY1 A;  3CJT B;  1UJ8 A;  3CF2 A;  2LLK A;  1LPQ A;  3BZ6 A;  4BHP A;  1R1U A;  2JRT A;  2CRG A;  3K1M A;  2R7W A;  3B02 A;  1TT0 A;  2CQX A;  1ZEL A;  2G7U A;  2HR3 A;  3BPV A;  1IN6 A;  4PFO A;  2A6H F;  2P81 A;  4DNC A;  4LMY A;  3SZT A;  1BW6 A;  1IXR C;  3K4C A;  3KCC A;  3MEX A;  1JUP A;  5DCM A;  5HLI A;  1FTZ A;  5KCM A;  2MH2 A;  2A61 A;  4BJ5 C;  1AU7 A;  2F4I A;  2HU9 A;  1T95 A;  3T5X A;  4UV9 A;  1RKT A;  3BR1 A;  2W82 A;  2DQL A;  5F0C A;  4U0Y A;  2GOM A;  4M3D A;  2R7S A;  3E97 A;  3DBH B;  2QKM B;  5K5R A;  2VUM J;  4A0X A;  2PMZ A;  4NC7 A;  4F7Z A;  3OSF A;  1HKS A;  4OIN F;  2NAZ A;  5FD5 A;  4XQF A;  2IRF G;  1HKQ A;  4HG2 A;  4HSR A;  3TBI A;  1U0J A;  4F3Q A;  2Y9Y A;  3LQQ A;  5E3N A;  3HSE A;  2GAU A;  4OIQ F;  2IP2 A;  4DGW B;  2CG4 A;  1IZ1 A;  1QZE A;  1H8A C;  2CUJ A;  3IRQ A;  3GTK J;  1U78 A;  1YJN I;  1IV8 A;  2DK8 A;  3BPX A;  2CW0 F;  2WC2 A;  1RUO A;  2ZJR F;  3DF8 A;  1U5T A;  1SEU A;  2F4M B;  3S3M A;  2ZB9 A;  2IA1 A;  3J7A O;  4RGS A;  1FC3 A;  1F9N A;  4P96 A;  1X1C A;  4XLC A;  4CUG A;  1OCC H;  1YHQ I;  4I76 A;  4MIM A;  2DA1 A;  3TOA A;  1YS6 A;  1N25 A;  2HFH A;  4LG0 A;  4UUS A;  1JE8 A;  3EDP A;  1ERD A;  1WJ5 A;  3W2A A;  2DCE A;  1HC8 A;  3CDL A;  2AQE A;  4ZJZ A;  2BBY A;  1Y1W J;  1J09 A;  4A12 A;  3CJR B;  2H1L A;  2D1H A;  2EQR A;  2ID3 A;  2VL8 A;  2JA5 J;  2LG4 A;  2QSG X;  3KYC B;  2CQK A;  1T2K A;  4C2U A;  4HYE A;  2QQB A;  1P7J A;  1T39 A;  2H27 A;  3GTQ J;  2LP0 A;  3U1D A;  2MLG A;  4A0Y A;  2XRO A;  2XF6 A;  5C3E J;  3BR5 A;  2DDA A;  1VQL I;  4C9Y A;  4ZDL A;  3MD2 A;  5K7H A;  2KDO A;  1IRZ A;  5LFA A;  1MBH A;  2F5V A;  1J9I A;  3EPZ A;  1Z3X A;  4ABZ A;  3V4G A;  3S1Q J;  4NB5 A;  1EJ9 A;  2LYC A;  4A3D J;  2ME0 A;  4BNC A;  2E35 A;  4OMZ A;  3ECH A;  1ZHF A;  4NQW B;  2CMP A;  3WTV C;  3OYF A;  4NNJ A;  3O6B B;  4ITV A;  2PJR A;  5BPI A;  4IXA A;  3Q0U A;  4DZP A;  3QU6 A;  2HKO A;  5E3L A;  4HDU A;  2R7O A;  1U2W A;  2W85 A;  1D3Y A;  1LFU P;  2OF7 A;  5F6F A;  4UB6 C;  3Q0V A;  1XD7 A;  4XKB A;  5HS7 A;  5J4Y A;  4GRI A;  3GCM A;  1IDZ A;  2RN7 A;  3C2B A;  5JR3 A;  1D0Y A;  3TOB A;  4I2O A;  2QKL B;  2EJR A;  4BEH B;  2ADU A;  4XIC A;  3TDZ C;  1EF4 A;  5E20 A;  4O3M A;  3ULQ B;  3SEQ A;  2V7F A;  1E3H A;  1Z91 A;  1GV2 A;  3TMO A;  1OKR A;  3CCQ I;  3LSP A;  4IF4 A;  2EA2 A;  4F93 B;  3EUK L;  3R0J A;  3I64 A;  2XB0 X;  1IXC A;  2NOJ B;  3WTU C;  1ETQ A;  2VBX A;  2XF7 A;  4WXH A;  4KIT B;  2XSD C;  4HOB A;  2K40 A;  4DYQ A;  5LBQ A;  2E1O A;  1RC9 A;  4XLP F;  1ZRF A;  2WB1 N;  1YIJ I;  3HOY J;  3F3X A;  4OIO F;  2A05 A;  3S2W A;  1Y6I A;  2JA6 J;  3QPH A;  5AIQ A;  1H89 C;  3L00 A;  1K79 A;  4Y33 A;  3PJR A;  4EJW A;  1YE9 A;  2IT0 A;  4CH7 A;  4HLY A;  1T08 B;  2R7D A;  1OMI A;  2YUS A;  3K10 A;  4BS9 A;  5E1Z B;  2R7Z J;  2R7T A;  4XL9 A;  1FEX A;  2PMH A;  3HM5 A;  2CV2 A;  3HOU J;  4J00 A;  3AL0 B;  3K69 A;  1YJ9 I;  5GAG J;  4U87 A;  4O5V A;  2BOL A;  2DTR A;  4DYC A;  2XGD A;  2VC1 A;  5J1R A;  3BTJ A;  3TO7 A;  1ETX A;  1QPM A;  2DI3 A;  5K7Z A;  1K83 J;  3SJM A;  1ZH5 A;  2R5Z A;  1W5T A;  3FZV A;  3HHG A;  4RB0 A;  2VKD A;  3CCR I;  3OSG A;  1ODD A;  3WGI A;  2HDC A;  3DEE A;  2IPQ X;  2O5R A;  1XGM A;  3ERE D;  4AVP A;  2ZME B;  3WTT C;  5BQT A;  3GZ6 A;  1TTY A;  2DT6 A;  1ZAO A;  2FF4 A;  1DUX C;  5BS6 A;  3LA7 A;  2R4G A;  5F64 A;  2DPU A;  1CF7 B;  2FXA A;  1FP2 A;  2Y0S A;  1BR4 A;  2GIV A;  2ESH A;  1TP4 A;  2DMP A;  5FB2 A;  1Y39 A;  1J7K A;  3I53 A;  2XAH A;  2FOK A;  5JLX A;  3PM1 A;  2XC7 A;  3KE2 A;  3S15 J;  2HGC A;  4IHT A;  3A01 A;  2X48 A;  1AOY A;  1ETV A;  1LB2 A;  3ZXS A;  3I9V 2;  1T6S A;  3FXO A;  3H3U A;  4BDY A;  3GFJ A;  1UZC A;  4EVI A;  4BUP A;  5JVT A;  2HXO A;  1F43 A;  2IAI A;  2PQ8 A;  3ZQG A;  4QIW N;  2KZG A;  4RM2 A;  2E36 A;  2ZME C;  2A6E F;  2EWN A;  1G3S A;  4H4K C;  3I4N J;  3V42 A;  1IN8 A;  3OIP A;  1ZG1 A;  5JHU A;  1MZB A;  5E79 C;  3IKT A;  2E34 A;  2FA5 A;  4IJA A;  2KMU A;  5CVI A;  4CCO A;  4HQM A;  3TDU C;  2P6T A;  4A3F J;  2BW3 A;  2XAU A;  2Z2S B;  1UB9 A;  4BQA A;  1Z7U A;  1ONV A;  4P1W A;  4RB1 A;  4PJM A;  5IOY A;  1UHS A;  3JSP A;  5DCF A;  1RES A;  3OR2 C;  2DJI A;  2M4G A;  1S7A A;  5L3C A;  3LMM A;  4C30 A;  1FZP B;  2M0M A;  3J80 Z;  3G2B A;  3HRU A;  1JHF A;  4P5O A;  4BQO A;  3FXR A;  1KGS A;  3EYY A;  3I55 I;  4RA2 A;  3VYT B;  2VC0 A;  4OAZ A;  3Q5F A;  3LSK A;  1OR7 C;  3HPG A;  4UXN A;  1TWC J;  3J7Z I;  2HVR A;  4ZYH A;  1AHD P;  4ENJ A;  3LSJ A;  4M74 A;  1BN5 A;  4FTH A;  5EDN A;  2K9N A;  2E1M B;  1G3T A;  2COB A;  1VTN C;  1A36 A;  4PJN A;  4B1R A;  5CLS A;  2H1K A;  3SFZ A;  1IJW C;  2GXG A;  1K78 A;  1K61 A;  1UEL B;  5EZG A;  2A68 F;  3K1N A;  4M3E A;  1Z05 A;  1I27 A;  1WKM A;  2QEX I;  3LAP A;  3OYD A;  3AFH A;  3R4K A;  4YIR X;  4I01 A;  3FHN A;  1U9O A;  1YYV A;  1FBU A;  2LY2 A;  3KZY A;  4QPQ A;  4DJA A;  1Z77 A;  2STT A;  1OCZ H;  3FKI J;  1W36 D;  2HZD A;  3RCO A;  4A0Z A;  4PZJ A;  1SD4 A;  2E1M C;  3BOQ A;  2VE9 A;  3R61 A;  2XPV A;  2HKX A;  4LIV A;  4XLF A;  2WV1 A;  1TZL A;  4I02 A;  5LRS A;  3RQI A;  1NG6 A;  3LQR A;  3DXJ F;  3FK7 A;  1UHM A;  2IA0 A;  4HNT A;  2JA8 J;  3KYL A;  2HDW A;  2R7X A;  2WTE A;  3GUD A;  3FX3 A;  3CJN A;  5M3F J;  1SFE A;  4IHY A;  2L5Q A;  2DT7 B;  3LAJ A;  3I3L A;  2DK5 A;  2PN6 A;  1B6A A;  4OU0 A;  1O4X A;  3CZ6 A;  2IGK A;  2OA4 A;  4HEA 2;  4YFX F;  3W6V A;  4XLA A;  4HDV A;  4DZJ A;  1W1W E;  5HDG A;  2KJC A;  3V8K A;  4RLQ A;  3A03 A;  3KYD B;  2RNJ A;  2HNH A;  5GAH J;  2K86 A; 
#chains in the Genus database with same CATH homology
 5DD8 A;  4BH9 A;  1OYY A;  3N97 A;  1XB4 A;  4I09 A;  3E6B A;  2LDU A;  2ISZ A;  3DPL C;  4YII A;  2K02 A;  3CDH A;  3DKW A;  1IN4 A;  3DV8 A;  2LSO A;  2H09 A;  2TDX A;  3TQN A;  2DT5 A;  2DU9 A;  2F5C A;  2FNP A;  4JK1 X;  3I0T A;  2W24 A;  5K5O A;  3D0S A;  2XAS A;  4HX8 A;  2RQP A;  4HAM A;  2L3D A;  2ACJ A;  2O03 A;  4RGR A;  4I0A A;  3I59 B;  4L5J A;  1SD6 A;  4NQW A;  4G6D A;  1A04 A;  2WWY A;  1ZRC A;  4QWQ A;  2KIF A;  1GXP A;  2VXZ A;  1HQC A;  3GZ5 A;  2PG4 A;  1NHA A;  1IRF A;  3OV8 A;  1XDS A;  3K1P A;  1RZ4 A;  1TQM A;  2NS0 A;  2BGC A;  3CO7 C;  3D5L A;  5JI6 A;  5HS9 A;  1WQ2 A;  3K2Z A;  1MKM A;  5HLG A;  1G3W A;  2JT1 A;  4R79 A;  1FWZ A;  2NNY A;  4I0B A;  2IJL A;  2V6C A;  1O7L A;  1H9T A;  3IWZ A;  3BJA A;  4AIK A;  4HF2 A;  2DPD A;  2EFN A;  2P5L C;  2CGP A;  3QP6 A;  1H0M A;  4EJU A;  3HIF A;  2UWM A;  4ESB A;  3M7G A;  5DUI A;  1JHH A;  2GQQ A;  2HQR A;  1SFU A;  3FMS A;  4EM1 A;  3QP5 A;  1CF7 A;  2A3S A;  1O3R A;  3F8F A;  1LDJ A;  3JAM Z;  3F8N A;  4KN7 X;  2Y75 A;  5D6E A;  2RKH A;  3GWZ A;  5E1X A;  1XGN A;  3BJ6 A;  4YIF A;  1UCR A;  2F5D A;  2M87 A;  4M6X A;  5DEQ A;  3E5Q A;  2L4A A;  5H6Q A;  4ZH4 F;  1O3T A;  1V4R A;  4LJZ F;  1X3U A;  1TNT A;  2QEN A;  2OQR A;  2ZNY A;  2QLZ A;  2RGV A;  2EFW A;  1YG2 A;  1XCB A;  2G9W A;  3ZMU A;  2BYV E;  2F2E A;  4BHB A;  2KKO A;  1R1V A;  3WU0 A;  4IVN A;  4UVC A;  1EH8 A;  3T0Y A;  2VBY A;  2Q8K A;  2EV0 A;  3F72 A;  2D1V A;  2QBY B;  1USS A;  1U3E M;  1EH6 A;  1REP C;  3KP7 A;  2KJB A;  5LEJ A;  2FML A;  3MWM A;  3BY6 A;  5TRD A;  4IPA A;  2FU4 A;  2FEZ A;  3E6D A;  2UZK A;  4FX4 A;  2IW5 A;  3RJP A;  5LHG A;  4BXU A;  5DV5 A;  3RKW A;  2W84 A;  2P6S A;  4KFC A;  1LQ1 A;  1I1S A;  4CDG A;  1KYZ A;  2HTJ A;  3VOD A;  3J81 Z;  4ZZL A;  4OIR F;  2XKP A;  5L3B A;  2O6G E;  1T98 A;  3HSR A;  2DBB A;  1R7J A;  2VE8 A;  4CZZ A;  1FBQ A;  2HZT A;  4EV0 A;  1QBJ A;  1J75 A;  4M72 A;  3DP7 A;  1Y0U A;  4P9U A;  3V7C A;  4K2E A;  1Z6T A;  3MAJ A;  4UVB A;  1O7F A;  1BI0 A;  3F8M A;  5E1W A;  2RV8 A;  4M71 A;  3F8B A;  1EV7 A;  2EFO A;  3HTU A;  4EM2 A;  2HOE A;  2GXB A;  2QUF A;  2XRN A;  2DQR A;  3ZQ7 A;  2K27 A;  3WTY C;  5D4S A;  3GW2 A;  3E3V A;  3HSF A;  1W5S A;  2MH9 A;  1W7P D;  2PLY A;  4U88 A;  3RKY A;  3L7W A;  1FYL A;  3ZMV A;  1J2X A;  4IRH A;  3IC7 A;  5FD6 A;  3I59 A;  3OOP A;  3WGG A;  3P9K A;  1PDN C;  4E70 A;  4M9X A;  3C18 A;  5ICC A;  4R1H A;  4WWC A;  2XAG A;  2KIM A;  1E2X A;  4P55 A;  4XRF A;  1P4X A;  5BMZ A;  2OAZ A;  3F23 A;  2O0Y A;  2BE5 F;  3QAH A;  1KU7 A;  3MZY A;  4LD5 A;  4XBF A;  3BRO A;  1ZGJ A;  4N9H A;  5HDK A;  3F22 A;  3T8R A;  2EFQ A;  1IXS B;  1B9N A;  1LVA A;  3HRS A;  5D5W B;  3BP8 A;  4P9F A;  1F4K A;  1STZ A;  2P5V A;  3G3Z A;  3Q9S A;  4L9N A;  3HYI A;  1FLI A;  4L9J A;  1YO5 C;  2JZY A;  3WG9 A;  5IT9 K;  1I1G A;  2P8T A;  2BV6 A;  4AIJ A;  4BAY A;  2QWW A;  5LGT A;  2D45 A;  2Y48 A;  4XSZ F;  3ABU A;  4HBL A;  4XLN F;  1S8N A;  4TV7 A;  4LK1 F;  5E8G A;  4H0E A;  1HW5 A;  3J80 K;  4CXF A;  1T38 A;  1BI1 A;  2PEX A;  5DD4 A;  2GA2 A;  3DEU A;  1I6X A;  3RYR A;  4RB3 C;  1QGP A;  4EGY A;  2DLL A;  5D8L B;  1XSX A;  3LST A;  2QVO A;  5D5U B;  1QQI A;  1GHC A;  3ZN0 A;  1YW8 A;  1IUY A;  3H92 A;  2V79 A;  5FFZ A;  2EB7 A;  4OOI A;  4CHU A;  5F1R A;  4CIC A;  4ZYG A;  2L4M A;  4A2U A;  1UST A;  4EQQ A;  3ZP5 A;  3EET A;  5IT9 Z;  4GYG A;  2XIG A;  4ENK A;  5H20 A;  3E5U A;  3CUQ C;  1FT9 A;  3ZMS A;  1BIB A;  1HXD A;  3U2R A;  5AON A;  2VBW A;  5HS8 A;  2QBY A;  1IN5 A;  1PP8 F;  1ZG5 A;  3TO9 A;  2V1D A;  2ZO4 A;  4MEY F;  1YW7 A;  1WWX A;  3KP5 A;  2JPC A;  1ZRD A;  3C7J A;  4CGZ A;  2O8X A;  2J5P A;  1ZG3 A;  3KLN A;  2H6C A;  5LGU A;  4L18 B;  3W6J B;  3EYI A;  2O61 A;  3ZMZ A;  4B09 A;  2M30 A;  5LLQ A;  5LRR A;  5CVR A;  3NRV A;  1J5Y A;  2YR2 A;  5ILU A;  1RUN A;  2VON A;  3RYP A;  3I71 A;  4KN4 X;  1BOA A;  1BBY A;  3M8F A;  1R1T A;  5L3D A;  3VOE A;  4FHT A;  5BOX A;  1SFX A;  4ESJ A;  3TGN A;  4A5M A;  5CYV A;  5LHI A;  5ILV A;  1IRG A;  1IW7 F;  4G8X A;  1TW2 A;  2VOD A;  4UUV A;  1LEB A;  4RS8 A;  4UVA A;  1XMA A;  2K4B A;  1R36 A;  4UHT A;  3WTS C;  5KK1 A;  3K0L A;  1Z1D A;  1K6O A;  4KIG A;  2KRF A;  2V9V A;  1XSD A;  2PFB A;  5CVJ A;  4GGG A;  5H6R A;  1FPQ A;  3MCZ A;  4EJV A;  4KIC A;  1JXS A;  5FLX Z;  2E7W A;  2H94 A;  2EK5 A;  4BYY A;  4D0P A;  3R0A A;  1TQP A;  1SD5 A;  2G7H A;  2PMU A;  2VBZ A;  3V8L A;  1QO0 D;  4LB5 A;  3GEZ A;  2V1U A;  1L3L A;  2ZCW A;  3CLO A;  2HEO A;  3T8T A;  3HRM A;  1TBX A;  3GFI A;  1ULY A;  4MGR A;  4ASN A;  2DFI A;  2K4J A;  1IF1 A;  4Z2Y A;  3I58 A;  4MTD A;  1BI2 A;  4CYD A;  1MGT A;  4HW0 A;  1S3J A;  1ZLJ A;  4AD9 A;  2ELH A;  2VOP A;  1YTY A;  3JAM K;  1JGS A;  4KMF A;  2E1N A;  1P4W A;  2L02 A;  3KP6 A;  1P2F A;  2X0L A;  1R58 A;  2YU3 A;  1HW1 A;  1UHW A;  2Q2E A;  3DPT A;  4Q5S F;  1B1B A;  3WE2 A;  5HDN A;  3WTX C;  5LEK A;  3KP2 A;  2JPB A;  3DQV C;  4EMS A;  5LHH A;  2E1C A;  4FX0 A;  3Q9V A;  2FSW A;  1ZYR F;  2DO7 A;  4YFN F;  3GX4 X;  2A69 F;  3HUG A;  5D5V B;  1FX7 A;  2WV0 A;  2RDP A;  2OBP A;  3KP3 A;  2QQA A;  2ZME A;  1RI7 A;  4HA8 A;  2E7X A;  2ETH A;  4L0Z B;  4MQ9 F;  1IAW A;  2VN2 A;  2JSC A;  2ZFW A;  2QYO A;  3KEO A;  2R7F A;  1MD0 A;  3SQN A;  4U0W A;  1WSU A;  4BHC A;  4HZF A;  1F1Z A;  1R22 A;  3VFZ A;  3MFK A;  1TQI A;  4WK8 F;  4KNY A;  3ZMT A;  5J8F A;  1W7P B;  2STW A;  2LF7 A;  3HOS A;  1J0R A;  1OR7 A;  2MD5 A;  3B73 A;  5DUK A;  3VEP A;  2Q0O A;  4M9S A;  1TLH B;  5D4R A;  3LA2 A;  3J81 K;  1RNL A;  3GLX A;  1D5V A;  1YIO A;  3CO6 C;  4U7B A;  3KEQ A;  4GCV A;  3F6V A;  2GWR A;  2GA1 A;  3WGH A;  1HST A;  4R8H A;  4GYI A;  4ENN A;  2MC3 A;  2HQN A;  4LGW A;  1I5Z A;  3FXQ A;  2D2W A;  3QPT A;  3G73 A;  4I98 B;  4RGU A;  1KQ9 A;  4S05 A;  3NEU A;  5L3F A;  1AWC A;  4Q47 A;  4MNU A;  3K9T A;  5D6F A;  1F5T A;  3I4P A;  3FWE A;  2CO5 A;  1FY7 A;  2ZKZ A;  3QOP A;  1DDN A;  3TO6 A;  4N9I A;  4IRG A;  1ZN2 A;  3REO A;  5HVQ C;  3R6S A;  1XMK A;  4WX9 A;  4G7H F;  1DP7 P;  2C6Y A;  1MDM B;  3CUO A;  2VOO A;  3I54 A;  1LDK B;  1SAX A;  1BC7 C;  5EEH A;  1Q1H A;  1G3Y A;  1WRJ A;  2CSO A;  3RDI A;  2CFX A;  1K78 B;  1XSV A;  4A5N A;  1U6G A;  4LFU A;  4Q4Z F;  2FBK A;  3MZH A;  3HHH A;  3H3Z A;  2RC4 A;  3WOD F;  1KYW A;  4RGX A;  5ILS A;  5TJJ A;  5ICF A;  1LNW A;  4WCG A;  2J5O A;  3JTG A;  3WTW C;  1ON1 A;  1ZAR A;  4WXD A;  3RPQ A;  4M9Z A;  3IHU A;  2XAF A;  4XSX F;  2HWV A;  2LF8 A;  1HSJ A;  3ZPL A;  5KVR A;  2FNA A;  2Z5U A;  3E5X A;  5JFR A;  2NRA C;  1S6L A;  3BWG A;  4ESF A;  5A2Q Z;  1MJB A;  1BI3 A;  3COA C;  1GXQ A;  2ZBK A;  4G7Z F;  1BM9 A;  3ML6 A;  2FQ3 A;  5EEG A;  4MEX F;  4O6J A;  4HLX A;  2KIU A;  2XKO A;  1TW3 A;  3FF5 A;  2O3F A;  1P92 A;  3ISP A;  3ELK A;  2P7C B;  2FBI A;  2LNB A;  2OU2 A;  4UV8 A;  2AXL A;  2H6B A;  2GZW A;  2V1X A;  4KT5 C;  3ECO A;  4UNO A;  4B8X A;  4G9Y A;  4ETS A;  4YG2 F;  4IHS A;  1D8J A;  3QU3 A;  2VT2 A;  3PQJ A;  4WXC A;  2YX7 A;  3V7R A;  3DFG A;  2YX4 A;  1KQ0 A;  2BEO A;  4PGG A;  3SZP A;  5ED4 A;  4EGZ A;  1YFH A;  2OZU A;  3I5U A;  1E17 A;  1FBS A;  3M1E A;  3GFL A;  1MJA A;  5ICE A;  3IL2 A;  4M6Y A;  4GO1 A;  1B4A A;  3N4M A;  3FHZ A;  1GVJ A;  1KU3 A;  5FO5 A;  2ZJ2 A;  2FBH A;  1FYM A;  4HV6 A;  1R00 A;  4L5I A;  3LA3 A;  1LDD A;  2DAO A;  1R5H A;  1Z9C A;  3LWF A;  3GFM A;  5L3E A;  1ZRE A;  2P4W A;  4RB2 C;  3O3K A;  4A6D A;  3EQL F;  5K1Y A;  4ZYD A;  4A6E A;  2EFP A;  2K7L A;  3MQ0 A;  3JW4 A;  2FRH A;  3C1D A;  3RKX A;  5AIP A;  4EM0 B;  3KP4 A;  4HF1 A;  3GXO A;  4RAZ A;  1KQ8 A;  3IWF A;  2M45 A;  3CUQ B;  4JBA A;  4M73 A;  1DPU A;  1W7P A;  4U7D A;  1Z6R A;  1ON2 A;  2W25 A;  3ABT A;  2ESN A;  4L9T A;  1G6N A;  1PP7 U;  3E6M A;  2EV6 A;  2M8E A;  3L2C A;  2Z3Y A;  3RIR A;  1UFM A;  3L9F A;  3O2P E;  3PQK A;  4KYW A;  3L09 A;  1YW9 A;  4MQV A;  2AS5 F;  2F5F A;  1XN7 A;  4CO8 A;  4IRI A;  1CGP A;  5HOO A;  3JSO A;  2FE3 A;  4KUM A;  1W4M A;  1YLF A;  2F5E A;  4KMU X;  1XGS A;  3U9G A;  2A5Y B;  2P5K A;  5E18 F;  1XDU A;  3KET A;  2X4H A;  2Y0M A;  1MDM A;  2B0L A;  4LK0 F;  2M1B A;  1OYI A;  4LB6 B;  3ZMD A;  1SMT A;  3GYH X;  5FLX K;  2QZ8 A;  3WU1 B;  1BC8 C;  6PAX A;  2UXN A;  5J6X A;  3LFK A;  1QNT A;  2XGX A;  1HW2 A;  2NNN A;  4AIH A;  5BPD A;  3HOT A;  3KLO A;  1C0W A;  3V8J A;  1O3S A;  5D8K B;  5LGN A;  5CJ9 A;  1QZY A;  1FSH A;  3M8E A;  4LLG F;  2XUB A;  1SD7 A;  2OZ6 A;  3FMQ A;  2PI0 A;  4PDK A;  5DCM B;  3FXU A;  4Y15 A;  4HF0 A;  4L9V A;  4KA4 A;  4OMY A;  2XVC A;  4ON0 A;  2MBF A;  2QQ9 A;  2RVC A;  2IA2 A;  1S7O A;  2QM3 A;  3M9A A;  3IRR A;  3F8C A;  2XAJ A;  4G94 A;  3R60 A;  4MHG A;  3RTR A;  3KZZ A;  3PFI A;  2NYX A;  1BIA A;  1T0F A;  4Y17 A;  1H9G A;  4Q48 A;  5CVV A;  2CYY A;  1S29 A;  2XHK A;  4G6Q A;  1U5T B;  3KFW X;  4MTE A;  1HKT A;  2L54 A;  4QLC U;  3HTS B;  4EJT A;  5L3G A;  3FM5 A;  4ZYE A;  1KU2 A;  4LG0 B;  1L0O C;  3E6C C;  4LLL A;  2OD5 A;  2LKP A;  2Z33 A;  4HV5 A;  1O3Q A;  1U5T C;  3SXY A;  2OQG A;  1B9M A;  1R23 A;  3V7S A;  2P7V B;  5CVU A;  2EV5 A;  1J59 A;  2UXX A;  1EH7 A;  4PGH A;  5HLH A;  1R5G A;  4LLN A;  2Z99 A;  4YFK F;  4KIF A;  3EUH A;  5D5X B;  3GO5 A;  1FP1 D;  1G4D A;  2DW4 A;  2ZNZ A;  1YS7 A;  4AWX B;  1P6R A;  4FT8 A;  3JTH A;  1XGO A;  4KIB A;  2W57 A;  1ZGA A;  2L01 A;  1BJA A;  2HS5 A;  1P4A A;  1SMY F;  3QRF F;  4DQ2 A;  1K7A A;  5E17 F;  4NHJ A;  2ZXJ A;  2EA4 A;  3RPU A;  3F6O A;  3T1B A;  2VT3 A;  5ERI A;  3FMR A;  3HRT A;  2HYF A;  4ZZD A;  3BJO A;  1MJ9 A;  3W6K B;  5J8C A;  3CUQ A;  1KU9 A;  1ZLK A;  2PJP A;  1B59 A;  1QZZ A;  4KDP A;  1DPR A;  4HQE A;  4N0B A;  3NQO A;  2MLK A;  2FMY A;  3CTA A;  2XV4 S;  1V3F A;  1FNN A;  2CWE A;  3ZN1 A;  2COM A;  3F21 A;  4Y13 A;  1WI9 A;  3AAF A;  5IT3 A;  1YQA A;  5FFX A;  1TNS A;  5FGM A;  2YPR A;  5K5Q A;  2Z9O A;  4WF2 A;  2HYG D;  2ISY A;  4PCQ A;  4OIP F;  5E8I A;  1IN7 A;  3RI4 A;  3IKV A;  5ICG A;  1XCV A;  2HTS A;  1FYK A;  5DYM A;  4L0Y B;  4S04 A;  3GF2 A;  4ENM A;  3P7N A;  3GVA A;  2IVM A;  2A07 F;  4HX4 A;  4HX7 A;  2PBI A;  4U0V A;  2MA3 A;  1KA8 A;  4GXO A;  2M5W A;  3WE3 A;  1OPC A;  2YSR A;  1HBX G;  3ROU A;  1D8K A;  1LEA A;  1FOK A;  3P9C A;  3SHF A;  4JQF A;  3WTZ A;  3P9I A;  1OYW A;  1PUE E;  2R3S A;  1U8R A;  3BDD A;  2JTV A;  3FM3 A;  4RAY A;  4I7H A;  1FSE A;  4EJO A;  4G7O F;  3C3W A;  3TKY A;  5A2Q K;  1RIO H;  3VB2 A;  2XAQ A;  1O57 A;  1LJ9 A;  5DDG A;  3BZ6 A;  4BHP A;  1R1U A;  2JRT A;  3K1M A;  3B02 A;  2G7U A;  2HR3 A;  3BPV A;  1IN6 A;  2A6H F;  4DNC A;  4LMY A;  3SZT A;  1IXR C;  3KCC A;  3MEX A;  5HLI A;  5DCM A;  2MH2 A;  2A61 A;  3T5X A;  4UV9 A;  2DQL A;  4U0Y A;  3E97 A;  5K5R A;  4A0X A;  4F7Z A;  1HKS A;  4OIN F;  2NAZ A;  5FD5 A;  2IRF G;  1HKQ A;  3LQQ A;  3HSE A;  2GAU A;  4OIQ F;  2IP2 A;  2CG4 A;  1IZ1 A;  3IRQ A;  1U78 A;  2DK8 A;  3BPX A;  2CW0 F;  2WC2 A;  1RUO A;  3DF8 A;  1U5T A;  2IA1 A;  3J7A O;  4RGS A;  1FC3 A;  1F9N A;  4P96 A;  3TOA A;  1YS6 A;  2HFH A;  4LG0 A;  1JE8 A;  3EDP A;  2BBY A;  4A12 A;  2D1H A;  2CQK A;  1T2K A;  4HYE A;  2QQB A;  1T39 A;  2H27 A;  3U1D A;  2MLG A;  4A0Y A;  2XRO A;  1J9I A;  3V4G A;  4NB5 A;  4BNC A;  4OMZ A;  3ECH A;  1ZHF A;  3WTV C;  3O6B B;  5BPI A;  4IXA A;  3QU6 A;  2HKO A;  4HDU A;  1U2W A;  2W85 A;  1D3Y A;  5F6F A;  1XD7 A;  5HS7 A;  2RN7 A;  5JR3 A;  3TOB A;  4I2O A;  2EJR A;  2ADU A;  3TDZ C;  5E20 A;  4O3M A;  3ULQ B;  1Z91 A;  1OKR A;  4IF4 A;  2EA2 A;  3R0J A;  3I64 A;  1IXC A;  3WTU C;  2VBX A;  4WXH A;  4HOB A;  5LBQ A;  4XLP F;  1ZRF A;  3F3X A;  4OIO F;  3S2W A;  3QPH A;  5AIQ A;  1K79 A;  3L00 A;  4EJW A;  2IT0 A;  4HLY A;  2R7D A;  1OMI A;  5E1Z B;  2PMH A;  3K69 A;  4O5V A;  2DTR A;  2VC1 A;  3TO7 A;  1QPM A;  2DI3 A;  1ZH5 A;  1W5T A;  3FZV A;  3HHG A;  4RB0 A;  1ODD A;  3WGI A;  2HDC A;  2IPQ X;  3ERE D;  1XGM A;  4AVP A;  2ZME B;  3WTT C;  5BQT A;  3GZ6 A;  1TTY A;  1ZAO A;  2FF4 A;  1DUX C;  5BS6 A;  3LA7 A;  5F64 A;  2DPU A;  1CF7 B;  2FXA A;  1FP2 A;  2GIV A;  2ESH A;  5FB2 A;  1J7K A;  3I53 A;  2XAH A;  2FOK A;  3KE2 A;  2HGC A;  4IHT A;  1AOY A;  1LB2 A;  1T6S A;  3H3U A;  3GFJ A;  4EVI A;  5JVT A;  2PQ8 A;  2A6E F;  2EWN A;  1G3S A;  1IN8 A;  1ZG1 A;  5JHU A;  1MZB A;  3IKT A;  2FA5 A;  4IJA A;  5CVI A;  4HQM A;  3TDU C;  2P6T A;  1UB9 A;  4BQA A;  1Z7U A;  1ONV A;  4RB1 A;  3JSP A;  5DCF A;  1S7A A;  5L3C A;  1FZP B;  3J80 Z;  3HRU A;  1JHF A;  4P5O A;  3FXR A;  1KGS A;  3EYY A;  2VC0 A;  3Q5F A;  4UXN A;  4ZYH A;  4ENJ A;  4M74 A;  1BN5 A;  1G3T A;  1VTN C;  5CLS A;  3SFZ A;  2GXG A;  1K78 A;  2A68 F;  3K1N A;  1Z05 A;  1I27 A;  1WKM A;  3LAP A;  3R4K A;  4I01 A;  1YYV A;  1FBU A;  3KZY A;  2STT A;  4A0Z A;  4PZJ A;  1SD4 A;  3BOQ A;  2VE9 A;  3R61 A;  2HKX A;  4I02 A;  5LRS A;  3LQR A;  3DXJ F;  1UHM A;  2IA0 A;  2WTE A;  3GUD A;  3FX3 A;  3CJN A;  1SFE A;  3LAJ A;  2DK5 A;  2PN6 A;  1B6A A;  4OU0 A;  2OA4 A;  4YFX F;  4HDV A;  5HDG A;  2KJC A;  3V8K A;  2RNJ A;  2K86 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...