4KIBA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
333
structure length
333
Chain Sequence
VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
source organism Streptomyces hygroscopicus
molecule tags Transferase
molecule keywords Methyltransferase MppJ
total genus 113
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kibA01
4HV6A 1R5GA 1FSHA 4DNCA 1NHAA 4ZYEA 5LBQA 1Z7UA 5FD6A 3TO6A 1OYWA 2FA5A 4KMFA 4FX4A 1IXRC 3VFZA 1FYKA 3R0JA 5DEQA 2QZ8A 1FP2A 5BPDA 1QO0D 5FGMA 2HKOA 3RI4A 4L9NA 1BBYA 4P96A 3Q5FA 1MD0A 2JRTA 1Q1HA 2JPCA 3EQLF 2JPBA 2E7WA 1A04A 1XCBA 2XKOA 3VEPA 1G3YA 1H0MA 2YX4A 4L9VA 3K1NA 1ZREA 3E6MA 4HDVA 2A6EF 2V79A 3ZMVA 3IRQA 3DF8A 2O0YA 3KZZA 2ZKZA 3ZMZA 2K4JA 3SFZA 3ZMSA 2HYGD 3F8CA 5HDGA 1Z91A 4LLGF 1KU9A 2HR3A 5HLHA 3T1BA 4ENMA 5D8KB 1I6XA 2VE9A 3REOA 4I98B 1HSTA 1USSA 5HDNA 2DI3A 1ZGJA 1JE8A 1I1GA 1ZG3A 3EYYA 2P8TA 2M45A 1XSVA 1W4MA 5DV5A 3I58A 2HYFA 3D0SA 4L9TA 1ZRFA 5CVIA 5H6RA 1FYMA 2ZFWA 2ZNYA 2PMUA 1Y0UA 4EM2A 3CUQB 1AWCA 4LK1F 5ICGA 1XD7A 3G3ZA 2IA2A 2MBFA 2XAFA 3F8FA 1JHFA 1IXSB 3QAHA 3WG9A 1STZA 4H0EA 3AAFA 4FX0A 4I7HA 5LEJA 4EVIA 3GYHX 1K78A 2PFBA 4P9FA 3T0YA 2R7DA 3ERED 4XSZF 1F5TA 4S04A 4B09A 2HGCA 3T8RA 1HW5A 1UCRA 4LLNA 4FHTA 3GW2A 5HLIA 5IT9Z 2LSOA 4IVNA 5E1XA 3D5LA 1R00A 3CJNA 3O6BB 1ZARA 4LB5A 3QOPA 2YSRA 5FO5A 2NAZA 4XLNF 1SD7A 4Q5SF 2FE3A 4CHUA 3HRUA 4FT8A 3T8TA 3QPHA 1O7FA 1WI9A 3VOEA 2A07F 3RTRA 2UZKA 4I02A 1BJAA 1Z6TA 3BPXA 5DCMA 2F5DA 5L3GA 5L3BA 1D8KA 1IN6A 1YW7A 3M8EA 5E17F 1U5TA 1ZN2A 5FB2A 4Q48A 1O3QA 1ZYRF 1HW2A 4NB5A 2BGCA 4I09A 3KEOA 3GWZA 3U2RA 4UV8A 3J7AO 3IRRA 3RIRA 1CGPA 2OD5A 1UB9A 3QP5A 2YPRA 4PDKA 4EV0A 2PMHA 5AIPA 2H27A 3J80K 2EK5A 3ZQ7A 1XDSA 4QWQA 4B8XA 2QYOA 1YYVA 4WXCA 1MDMB 1T38A 2AS5F 3DEUA 1XGMA 5CVVA 1REPC 2ESNA 3R4KA 3C7JA 4HF1A 3N4MA 1GVJA 1ON2A 5L3DA 3M7GA 4MTDA 3KP3A 3K69A 4R79A 3CDHA 4OMYA 1FLIA 4G6DA 4KIFA 3RPUA 4HAMA 1C0WA 3QU6A 2YX7A 4KMUX 1B9MA 3GVAA 3KCCA 4RGRA 3HIFA 3WGHA 2W85A 3RPQA 1LVAA 1Z1DA 3HSRA 5DYMA 2FQ3A 2H94A 2A6HF 2VC0A 3KE2A 3T5XA 1YG2A 5ED4A 3LSTA 4LB6B 2VT2A 4XRFA 4IRIA 5F6FA 2F5FA 2FNPA 3JSPA 1XGSA 2ISZA 2FNAA 4OIRF 1JHHA 2P6TA 3OOPA 4UNOA 1FBUA 4KICA 4Q47A 3M8FA 2B0LA 1HSJA 1LJ9A 4U7BA 2BBYA 4CICA 1B59A 4RB2C 3OV8A 1S7OA 1V4RA 2F5CA 1XSDA 4ZH4F 5E1ZB 5LLQA 1RNLA 5H20A 3ZMUA 5DDGA 1ZRDA 1FP1D 3WTYC 3IHUA 3PQJA 2F2EA 4A2UA 5DCFA 1S29A 1TTYA 3WTZA 4A0ZA 4PGGA 4AD9A 1WWXA 4JQFA 4EJOA 2E7XA 3F8NA 2XASA 3F72A 4ESBA 3P9KA 4EJVA 4RB0A 2DPDA 1P6RA 1SMTA 2EV0A 5BOXA 3E5UA 3ULQB 2RVCA 2RKHA 1B6AA 2GXBA 1SD5A 1TLHB 2ZBKA 4ESJA 1U5TB 3LFKA 2C6YA 2ZXJA 2VC1A 2V6CA 3L00A 5D4RA 2Z99A 3W6JB 3M1EA 1TQPA 3J80Z 4M73A 1YW9A 2XIGA 1LNWA 3LA3A 3E6DA 4CYDA 3TQNA 3COAC 1U78A 2ACJA 5A2QZ 3ZPLA 2NNYA 3FXQA 3IWFA 2JTVA 2BE5F 4HV5A 2A3SA 2W24A 3F21A 1HKSA 4G9YA 5H6QA 3BP8A 3DV8A 1G6NA 2HQRA 2RNJA 1J59A 2WTEA 5LHIA 4OIPF 1J2XA 2COMA 5E8IA 3F22A 1D3YA 3FMQA 2IA1A 1ZG5A 3EUHA 5DUIA 1R36A 1FYLA 1IUYA 1T39A 4D0PA 1F9NA 3ROUA 2XVCA 1BM9A 3HSEA 2MLGA 1E17A 5LGTA 5LRSA 3WTSC 2UXNA 4IRHA 4M6YA 1MZBA 3HRTA 1ZRCA 3GX4X 2OU2A 3F3XA 4M9XA 2VT3A 1HW1A 4GYIA 2AXLA 4I2OA 4XBFA 2XUBA 4UVBA 4HOBA 5D5VB 2DQLA 2H6CA 3WE3A 2XAHA 4U0WA 4BHBA 2XAGA 4CO8A 4KIGA 2ZNZA 1J7KA 5TJJA 1U2WA 2XROA 4Y13A 1TW3A 1W5SA 1O3TA 2FF4A 3MZYA 1MDMA 4O3MA 3RYPA 2HFHA 1EH8A 1HQCA 4GXOA 1ZG1A 3J81K 1RI7A 4S05A 2YR2A 3B73A 4K2EA 2RC4A 2IW5A 2JT1A 1MJ9A 4AIHA 5L3CA 1OYIA 2VBWA 1SFUA 2CGPA 2NNNA 4WF2A 4A0YA 4HQMA 2CW0F 1LEBA 3H3ZA 4OMZA 4HYEA 2HQNA 2STWA 4P9UA 1OPCA 1FNNA 2A5YB 3MZHA 4L18B 2M1BA 2X4HA 1W7PB 1PDNC 4G7HF 1DDNA 3HSFA 2IT0A 2Y75A 2K02A 3C18A 4RAYA 3RKYA 1H9TA 2P5VA 3MEXA 5BMZA 3WODF 2P7VB 3LA2A 4CDGA 3I5UA 1GHCA 2IPQX 5CLSA 2EFQA 4MQ9F 2MH9A 2PQ8A 2NYXA 1YS6A 1XB4A 3TDZC 2Y0MA 3RKXA 4ENJA 1J5YA 4EQQA 2CG4A 2O03A 4YFXF 3GO5A 1GXQA 5K5QA 3DPLC 1K79A 2J5PA 2CWEA 1D8JA 1LDKB 2PN6A 3WTXC 3ZMTA 4U88A 4L5IA 2WV0A 3Q9SA 1MKMA 2GXGA 1SFEA 5ICCA 2QENA 3HHGA 2EFNA 4M72A 1PP8F 3RYRA 1W5TA 1G3WA 3E6CC 1KU3A 1WSUA 5KK1A 4LLLA 3P9IA 3MWMA 2CQKA 5J6XA 4A5MA 4M9SA 4UVAA 3EDPA 2DLLA 1P92A 2RQPA 2ADUA 2OQRA 1USTA 3FM5A 4XSXF 4A12A 4M71A 4WXDA 1YQAA 5DUKA 4KNYA 1ZAOA 4HLXA 1IW7F 2K4BA 5JHUA 2WC2A 4ZYGA 4LD5A 3V4GA 4E70A 1XGNA 4P5OA 5D5WB 3HHHA 1KU2A 1X3UA 3ZN0A 2VODA 1MJBA 2W25A 1IZ1A 5A2QK 3PQKA 4RGXA 5D5XB 2RV8A 1ZHFA 4YG2F 3R61A 3JTGA 4HX8A 1XDUA 3LA7A 2IA0A 1FX7A 1IN7A 4BH9A 1EH7A 4Q4ZF 1SD4A 4MNUA 1R1TA 4L9JA 4G7ZF 3LAPA 4WWCA 3E3VA 1KGSA 1TW2A 2QBYB 2M8EA 4Y15A 2FRHA 1EH6A 3GFIA 1F4KA 1ON1A 4RGUA 1BI0A 2OZ6A 2R7FA 2ETHA 4KFCA 1Z9CA 1ZLJA 3WTTC 1BOAA 5BPIA 4IHSA 1BN5A 2EJRA 1Z05A 3HOSA 4EGYA 1QPMA 1V3FA 1ULYA 1KQ0A 3F6VA 3ML6A 3FZVA 1G3SA 1DPRA 5L3FA 2G9WA 3BDDA 5D6FA 2DK8A 1HKTA 5E18F 1J0RA 3SZPA 1OMIA 1BI1A 4EM0B 4CZZA 1HBXG 4Y17A 2FSWA 2UXXA 4BYYA 5HS8A 1F1ZA 2L3DA 3IL2A 5D6EA 4ZYHA 1T2KA 4I01A 3IWZA 2XKPA 4HF0A 2Y48A 2FBHA 4AIKA 1WQ2A 3IC7A 5AIQA 2HWVA 3ZN1A 4ASNA 1FY7A 1E2XA 2H09A 1IAWA 1XN7A 4O5VA 1S6LA 3QP6A 1P4WA 4R1HA 3K2ZA 3BJOA 3BZ6A 1LQ1A 1LDDA 1PP7U 5JFRA 4HBLA 3V8LA 2JZYA 3BROA 1EV7A 1LB2A 4OOIA 1O7LA 5HOOA 1D5VA 4QLCU 3WU0A 2FBKA 4YIIA 2O61A 4AVPA 2EFPA 1O3SA 3TOAA 4RGSA 1T0FA 2HTSA 2M87A 2YU3A 3DQVC 4EM1A 4OIOF 5CJ9A 3N97A 4IXAA 4YIFA 3JAMZ 3WTWC 1FZPB 4HW0A 3DKWA 2Z9OA 2EV5A 5FFZA 4O6JA 3SHFA 3F8MA 2DFIA 4F7ZA 1FBSA 1KYWA 3WTVC 1K78B 2VONA 2X0LA 2KIFA 3BJ6A 4L0ZB 2ZO4A 2VN2A 3GF2A 2L02A 1KQ8A 1IXCA 4HDUA 2IP2A 2PJPA 1WKMA 4ENNA 2EWNA 2K27A 2D1HA 1MJAA 3GFLA 2J5OA 3FHZA 4MEYF 1IF1A 3CLOA 1O3RA 3E5XA 2Z3YA 1SAXA 1OR7A 5E8GA 3BWGA 4ZZLA 3FM3A 5DD8A 4RS8A 4A5NA 3KP6A 2EB7A 3O3KA 3BPVA 4U0VA 3IKTA 3I54A 2V1XA 2PEXA 2M5WA 1R58A 2V1DA 2EA2A 3SQNA 3F6OA 3VODA 4GYGA 4A0XA 2NRAC 4M9ZA 3CUQC 4ON0A 5BQTA 3I59B 3L2CA 3RKWA 2L4MA 1XMAA 2DO7A 3FMRA 5FD5A 2FOKA 4KIBA 4A6DA 1CF7A 4ETSA 2RDPA 2DAOA 1YW8A 3KLNA 4NQWA 1KYZA 3TGNA 2O8XA 1B1BA 3V7SA 1G3TA 4LG0A 3B02A 1R23A 2XV4S 2F5EA 4JK1X 1S3JA 4WCGA 1YTYA 3KEQA 2OA4A 3KZYA 1B4AA 1MGTA 2KKOA 3I4PA 5TRDA 2P5LC 1SMYF 3SZTA 2FBIA 1I27A 5FLXK 3BJAA 3FXUA 2HS5A 2L4AA 4NHJA 5LRRA 3BY6A 5HS7A 3KP2A 1KQ9A 4YFNF 1ZLKA 4BNCA 2ISYA 4LFUA 1S8NA 4BHPA 2D1VA 1DPUA 4JBAA 2GA2A 2HDCA 1J75A 1QZZA 4EGZA 2OBPA 2PG4A 4L0YB 5HLGA 3J81Z 2R3SA 1K7AA 3H92A 4ENKA 2O3FA 5D5UB 1BIBA 3C3WA 3G73A 5D8LB 5BS6A 4U0YA 1I5ZA 2BEOA 3GFJA 1R1VA 1VTNC 2CFXA 1SFXA 1FSEA 4MTEA 2KRFA 2KIUA 5AONA 4ZZDA 1XMKA 3M9AA 1B9NA 1T6SA 2ESHA 5JR3A 1HXDA 1R1UA 5E1WA 1Z6RA 2A68F 3I64A 5K1YA 5IT9K 3I53A 1QZYA 2TDXA 4UUVA 5JVTA 2EA4A 3GZ5A 4IPAA 3NEUA 3O2PE 4LGWA 5FFXA 1U6GA 2Z5UA 1PUEE 5E20A 3V8KA 3VB2A 3TKYA 2DTRA 4U7DA 2QUFA 1IN5A 4UHTA 3JTHA 2L54A 2DW4A 5LEKA 2DU9A 3F23A 4IRGA 1U8RA 2XHKA 2G7UA 3TDUC 2Q0OA 2P7CB 4PCQA 1OYYA 1QQIA 1H9GA 2W84A 5CVRA 1QNTA 2XGXA 1W7PD 2D2WA 4HA8A 5K5OA 2DPUA 3CUOA 3E6BA 3CO7C 1K6OA 2RN7A 3EETA 2XAQA 3HTUA 2Z33A 4KDPA 1R7JA 3V7RA 1GXPA 4YFKF 3GFMA 3KP4A 2CSOA 2XRNA 2V9VA 1QGPA 3PFIA 2RGVA 2VBYA 3QRFF 4LMYA 5ICEA 3WTUC 2QBYA 5F1RA 3IKVA 4UVCA 4GO1A 3WGIA 1L3LA 1TNSA 4MHGA 3ZMDA 4P55A 1BI2A 3DFGA 3Q9VA 1U5TC 4HLYA 1U3EM 4BXUA 1S7AA 2ZCWA 4ZYDA 4CXFA 4EJUA 5IT3A 1CF7B 4R8HA 1TNTA 2PBIA 3MAJA 1FT9A 4BQAA 2ELHA 3DP7A 4N9IA 5DD4A 1YLFA 3E5QA 5LHHA 3EYIA 3RDIA 4MGRA 5LGNA 3JAMK 3E97A 5J8CA 2DT5A 2BYVE 4AIJA 4N9HA 4HX4A 1XCVA 4AWXB 3W6KB 4LJZF 3K1PA 2QQ9A 3KP5A 2KIMA 3I71A 3R60A 4XLPF 4MEXF 2GA1A 3WU1B 2OZUA 2GIVA 4L5JA 1W7PA 1FC3A 3RJPA 2LF7A 3LQQA 2VBXA 3KP7A 3HRSA 4TV7A 2A61A 4OU0A 2IRFG 5CYVA 2HKXA 2CYYA 3V8JA 1R5HA 5F64A 1UHMA 4HZFA 3ELKA 5JI6A 2P4WA 1ODDA 2P5KA 5KVRA 2O6GE 1YIOA 2KJBA 3JSOA 1FOKA 3TO9A 4KT5C 2WWYA 5J8FA 3S2WA 2K7LA 1KA8A 5EEGA 5EEHA 1TQMA 2ZMEA 1YFHA 3L7WA 3JW4A 3LQRA 2LKPA 3V7CA 3GZ6A 3HYIA 4OIQF 2EFWA 2OAZA 1R22A 4LG0B 3C1DA 2OQGA 3QU3A 3U1DA 1XSXA 1IN8A 5ILSA 2QQAA 5CVJA 3K9TA 3ABUA 1QBJA 3P7NA 2FMLA 3WE2A 1AOYA 3HRMA 2JSCA 2VOOA 4KA4A 3GEZA 3ECHA 4WXHA 3FX3A 3QPTA 1WRJA 2DK5A 2DBBA 2GZWA 1UHWA 2HOEA 1HKQA 1T98A 3CO6C 4KYWA 4BHCA 1BI3A 1P4XA 3DXJF 4PZJA 4EMSA 1DUXC 2PLYA 1XGOA 2LNBA 3I0TA 2E1NA 2STTA 3FF5A 3FWEA 2GWRA 3GUDA 2V1UA 5DCMB 3KLOA 5CVUA 2E1CA 2VE8A 5ILVA 2W57A 3P9CA 1FBQA 1FPQA 2XAJA 4HF2A 2MH2A 3K0LA 2QM3A 3CUQA 1YO5C 3I59A 1G4DA 2A69F 2ZMEB 3H3UA 4WK8F 2ZJ2A 2BV6A 2GAUA 4RB3C 2MC3A 4WX9A 3KETA 5ERIA 3TOBA 1BC8C 4KN7X 1IN4A 3HUGA 3TO7A 1RZ4A 4EJTA 2KJCA 4G8XA 3R0AA 3SXYA 4DQ2A 4KUMA 2K86A 5ICFA 3MCZA 4I0AA 4LK0F 4UV9A 3LAJA 2L01A 3NRVA 1RIOH 1O57A 4Z2YA 1DP7P 2FU4A 3GXOA 1RUOA 1P4AA 4ESFA 4G6QA 2HZTA 3HTSB 2MLKA 4PGHA 2HTJA 2LDUA 2IJLA 1BIAA 2D45A 4UXNA 4MQVA 3ECOA 4RB1A 1ZH5A 2VXZA 2MA3A 2FEZA 3R6SA 1BC7C 4BAYA 4CGZA 3ABTA 3MFKA 3LWFA 3DPTA 5HVQC 1TBXA 3MQ0A 2P6SA 4G7OF 2FXAA 5K5RA 3CTAA 2Q8KA 2MD5A 3U9GA 2QVOA 2Q2EA 3BOQA 4HX7A 1P2FA 1UFMA 2UWMA 2QWWA 4M6XA 5D4SA 2G7HA 3WGGA 2VBZA 5HS9A 1JGSA 1ONVA 2H6BA 1SD6A 4IHTA 1JXSA 1OKRA 4GGGA 3L09A 2GQQA 1FWZA 5LGUA 2EV6A 4I0BA 5LHGA 2PI0A 3ZP5A 3KFWX 2VOPA 4M74A 4N0BA 2NS0A 4RAZA 4G94A 2IVMA 5FLXZ 4IF4A 2EFOA 1LDJA 1L0OC 3FMSA 4IJAA 1ZGAA 3F8BA 1IRGA 4A6EA 1J9IA 1RUNA 3K1MA 1KU7A 2HEOA 2LF8A 2M30A 4KN4X 2QLZA 3HOTA 3L9FA 2FMYA 2QQBA 1LEAA 6PAXA 4HQEA 1YS7A 3NQOA 1I1SA 1IRFA 2DQRA 5ILUA 4OINF 3ISPA 5HDKA 3GLXA 4EJWA 3FXRA 5L3EA 4GCVA 1TQIA 2CO5A
chains in the Genus database with same CATH superfamily
2XF5A 1R5GA 4HV6A 1S9HA 1FSHA 2K3PA 3A1YA 4DNCA 1G8XA 1NHAA 4XL9A 4ZYEA 2AQFA 3MKWB 5LBQA 1Z7UA 2V4JC 5FD6A 3B6CA 3TO6A 2QF7A 1OYWA 5IY5H 2FA5A 3BR2A 3ABMH 4KMFA 4FX4A 3A0BC 1IXRC 3HC7A 3VFZA 1FYKA 3R0JA 5DEQA 2QZ8A 1FP2A 5BPDA 1UELB 1QO0D 2O7OA 3NAUA 3OYNA 5FGMA 5B1BH 2HKOA 2FUG2 3RI4A 3OYGA 4L9NA 1VFCA 1BBYA 4P96A 4Y7NJ 1QVTA 3Q5FA 2OTJI 4IZZA 1MD0A 2JRTA 1Q1HA 2BZTA 3D1NI 2JPCA 3EQLF 4Z6YA 3K4JA 2VJ4A 2JPBA 2IGOA 2E7WA 2LLKA 1A04A 1XCBA 3ZQGA 2XKOA 3VEPA 1G3YA 3CCUI 5M3FJ 1H0MA 2YX4A 4L9VA 5KAIC 3K1NA 1ZREA 3E6MA 4HDVA 4UY8I 2A6EF 1WCMJ 4DZPA 1GT0C 2V79A 3ZMVA 2MYSA 2LKXA 2NVYJ 2YS9A 3IRQA 3DF8A 3ERMA 2O0YA 3KZZA 2ZKZA 3ZMZA 2K4JA 2ZJRF 3SFZA 3ZMSA 2HYGD 1ORKA 3F8CA 5HDGA 4Y4RA 4XN3A 1Z91A 4KJZA 4LLGF 4E4HA 2ZXWH 4XLHA 4B43A 1KU9A 1JT0A 3KX2A 1VQNI 1WHUA 2HR3A 3PSIA 5HLHA 2R7ZJ 5FJ8J 3PO2J 3T1BA 4ENMA 5D8KB 3Q0WA 1I6XA 3LNQA 3REOA 2VE9A 4I98B 1HSTA 1H89C 4NDLA 1XPXA 2DYRH 1USSA 1LFBA 5B5EC 5HDNA 2DI3A 3OYFA 1ZGJA 1T33A 2ECBA 2DODA 1JE8A 1I3AA 3VDXA 3TP0A 2DA6A 2LVSA 2X51A 1I1GA 2CH0A 2E5NA 5KNLA 3AG1H 1ZG3A 3EYYA 2P8TA 2M45A 1XSVA 3DTIA 1GV2A 3Q3SA 1W4MA 5DV5A 3U1KA 2PJRA 1RRJA 1PUFA 3DU5A 4KITB 1OFCX 3I58A 5FKNA 2HYFA 3D0SA 4L9TA 1ZRFA 2R7OA 5CVIA 5H6RA 1FYMA 2ZFWA 4PSXA 2ZNYA 2PMUA 1Y0UA 2XPUA 4EM2A 3CUQB 1AWCA 2XSDC 3A03A 1PVEA 4PJMA 4M6VA 4LK1F 5ICGA 3K4BA 4A3KJ 1XD7A 4D1QA 3WHBA 3BR0A 2JVHA 4UUSA 2CQXA 2BHZA 1S7EA 4C2MJ 3G3ZA 3S14J 2IA2A 3BG7A 1MSEC 1MNDA 2MBFA 2XAFA 3F8FA 1JHFA 3OWTA 5F0FA 3BG5A 1WJBA 1IXSB 3QAHA 2CFOA 3L2UA 3WG9A 1STZA 3IH2A 2WV1A 3HB9A 3VYSB 3AAFA 4H0EA 4FX0A 4I76A 4I7HA 5LEJA 4EVIA 1MBGA 3GYHX 1GDTA 2FD5A 2JA2A 1K78A 2PFBA 4P9FA 2FOWA 3T0YA 2R7DA 3CJQB 3NWTA 4XSZF 4DYCA 2MC4A 3ERED 1JTXA 1JTYA 3FBNB 1F5TA 1POGA 4S04A 4IEJA 2HGCA 3T8RA 1HW5A 4B09A 1UCRA 2KRCA 2QQ8A 2EZHA 4LLNA 1T95A 4FHTA 3AG2H 3GW2A 5EYRA 5HLIA 2LMDA 2HDDA 5IT9Z 1X1AA 2LSOA 4IVNA 5E1XA 3J7YJ 4F93B 2E36A 1OQYA 3D5LA 2ZJPF 1R00A 5K7FA 3CJNA 1TP4A 2VIXA 3O6BB 1ZARA 4LB5A 3SEQA 3QOPA 2E1MB 4PFPA 2YSRA 2HQAA 4B4CA 5FKKA 5FO5A 2NAZA 4XLNF 1SD7A 4Q5SF 2FE3A 4CHUA 1E0EA 1ZTRA 3HRUA 4FT8A 3T8TA 3W2VA 3QPHA 1O7FA 2F4OB 1GVDA 1WI9A 4AU7A 3VOEA 2A07F 1BA5A 3M3YJ 3RTRA 2UZKA 1JI8A 3GZNB 2QA4I 3VYRB 4I02A 1BJAA 4CYCA 1Z6TA 3OS2A 3HBLA 3BPXA 5DCMA 2WAFA 1KONA 2F5DA 2R0QC 2IS2A 5L3GA 5L3BA 1D8KA 1IN6A 1YW7A 3J7ZI 3M8EA 3CJTB 3JR9A 2DJNA 2ECCA 3OYBA 1U5TA 5E17F 1ZN2A 2D5VA 5B1AH 5FB2A 4Q48A 3SYTA 1OCRH 1O3QA 1ZYRF 1HW2A 1XX5A 1G59A 1H8AC 2QCOA 4NB5A 2BGCA 3BTIA 2IAIA 4I09A 3OL4A 3KEOA 3GWZA 1G2HA 3U2RA 4UV8A 5B3SH 1IO2A 2LREA 3ONQA 3LSPA 3CC2I 2VKVA 2OUMA 2WY7Q 3J7AO 3IRRA 3RIRA 5KHDA 1P7JA 1E3PA 2DA7A 2BW3B 1CGPA 4V2FA 2CRGA 2OD5A 1HLVA 4D5CA 1A6QA 3S16J 1UB9A 3ZQHA 3QP5A 2YPRA 4XRMA 5B66C 4PDKA 2ZB9A 4EV0A 3OMYA 2PMHA 5AIPA 1MIJA 2H27A 3J80K 2R5YB 2EK5A 3PJRA 2EIKH 3ZQ7A 1XDSA 4QWQA 4B8XA 3G1LA 4JOMA 3PIOF 2QYOA 1YYVA 4WXCA 3IUOA 2E1MC 1MDMB 1T38A 3BG9A 1D1AA 3E1SA 2AS5F 4A3GJ 1RETA 3DEUA 3BLYA 4XN0A 3PM1A 5EF6A 1XGMA 5CVVA 1REPC 2ESNA 3R4KA 3C7JA 4HF1A 2GBYA 3N4MA 4CSWA 4BDZA 1GVJA 1B8IA 2MSYA 1ON2A 4HSTA 5L3DA 3M7GA 3HOVJ 1OCPA 4MTDA 2HXOA 3KP3A 3K69A 4R79A 3CDHA 2ME6A 4OMYA 1FLIA 4BU2A 1RKTA 2CQQA 4G6DA 4KIFA 1KZHA 3FXJA 3RPUA 2O5RA 1VQOI 1S5LC 3P5JA 4C9YA 4HAMA 3OIPA 1C0WA 3QU6A 2YX7A 4KMUX 1B9MA 3GVAA 4F92B 3KCCA 3FHNA 4RGRA 3HIFA 3LOCA 3WGHA 4FE7A 2L5QA 2W85A 3RPQA 4B3XA 1LVAA 1Z1DA 3HSRA 5DYMA 2FQ3A 2H94A 2A6HF 2VC0A 2ZSHB 1WGXA 3KE2A 3T5XA 1ZELA 1FJLA 2BY2A 1YG2A 3DEWA 4J01A 5ED4A 3LSTA 4LB6B 5EGOA 1N75A 2VT2A 1VZ0A 4XRFA 4IRIA 5F6FA 1RKWA 2F5FA 2FNPA 3JSPA 1XGSA 2ISZA 2FNAA 4OIRF 3BZKA 2JQ7A 3HGYA 5F0CA 4I6ZA 1JHHA 2P6TA 3OOPA 5EZHA 4BEHB 5EZGA 4UNOA 1FBUA 2DT6A 4KICA 4Q47A 2FX0A 3M8FA 2ZSIB 1U0JA 3GBGA 4NUBA 2B0LA 1HSJA 1LJ9A 4U7BA 1B72A 2MD0A 2BBYA 4CICA 1ETOA 1B59A 4RB2C 3OV8A 1S7OA 1V4RA 2Z16A 2F5CA 4RM3A 1XSDA 5CQGA 2JRMA 4ZH4F 1K4TA 5E1ZB 5LLQA 1RNLA 2ZMEC 3S1RJ 4A93J 5H20A 3FISA 3ESWB 1F36A 2DA2A 3ZMUA 5DDGA 2NS7A 1D1BA 1ZRDA 1FP1D 3WTYC 2X6XA 1ZR4A 5E3NA 3OYIA 3IHUA 3PQJA 2LTPA 3BCBA 2F2EA 4A2UA 5DCFA 1Z67A 1S29A 1TTYA 2R5YA 3WTZA 3CDIA 1HDPA 3BR5A 2KISA 3CCJI 4A0ZA 1YX3A 2OCEA 4XR6A 3FKJA 4PGGA 4AD9A 3RQ4A 1WWXA 3QOEA 2BOLA 4JQFA 4EJOA 2E7XA 4AUXA 3F8NA 3GTOJ 2XASA 3F72A 1MMGA 4ESBA 3P9KA 4EJVA 2DMTA 3K10A 3C2HA 3S2HJ 2M2EA 4NC7A 4RB0A 2I8DA 4DBQA 3L2VA 2R7RA 1P6RA 2DPDA 1SMTA 2K9SA 2EV0A 4RM2A 5BOXA 1R6RA 3HG9A 3E5UA 3ULQB 2RVCA 2RKHA 1B6AA 3AFHA 2GXBA 1SD5A 1TLHB 4E7LA 2WAQN 2ZBKA 2YU9J 5GAHJ 4ESJA 3JRFA 3DBRB 2TRTA 2Y30A 1U5TB 3LFKA 2C6YA 2ZXJA 2CMPA 2W82A 2VC1A 2V6CA 3CCEI 3L00A 3UNGC 2HYJA 5D4RA 2Z99A 3W6JB 3M1EA 1TQPA 1B72B 3J80Z 3VSKA 1UJ8A 2JMWA 4M73A 1VQ8I 2VLAA 1YW9A 2XIGA 3WHCA 1LNWA 2F6CA 4C30A 2LK2A 1NTCA 3LSMA 3LA3A 5FROA 3E6DA 3HDDA 1YRNA 3HXLA 4CYDA 1QA6A 3TQNA 3ZCOA 3COAC 1U78A 4G6TB 3FDYA 2ACJA 5A2QZ 3ZPLA 2Y31A 2NNYA 2XC7A 5GP9A 3FXQA 3LL7A 2DT7B 3IWFA 5J1UA 2R5ZB 2JTVA 2K9LA 2BE5F 4HV5A 4ZC3A 2YUSA 2A3SA 1BR2A 1GUUA 2W24A 3PFYA 1VQPI 1IV8A 3F21A 1WJ5A 4B1RA 3D5SC 1HKSA 4G9YA 1FOYA 5H6QA 2VJIA 3CF2A 3BP8A 3DV8A 2M9HA 1G6NA 2HQRA 2DA3A 2B7EA 4YEJA 1U8BA 3H1CA 2RNJA 4A3EJ 1J59A 2WTEA 5LHIA 4OIPF 1J2XA 2COMA 3VSLA 5E8IA 3F22A 1D3YA 3HEFA 1RR8C 1WJDA 1Z3YA 2X6WA 1E3HA 4OAZA 3FMQA 3OYEA 1QVUA 5EGOB 2IA1A 1ZG5A 2WAQA 4GFBA 2HU9A 1U9NA 3EUHA 5DUIA 1R36A 1FYLA 2DMPA 1IUYA 1T39A 2CUFA 4JYKA 4EATA 3IAS2 2IBDA 1IGNA 4D0PA 1F9NA 1ETKA 3ROUA 3FXOA 4DYRA 4XLFA 1LE8B 2XVCA 2KIQA 2CW7A 2JA6J 4CH7A 1BM9A 3HSEA 2MLGA 4E7SA 2EILH 1E17A 5LGTA 2OC6A 5LRSA 3WTSC 2UXNA 4IRHA 3K7AJ 3KYDB 4M6YA 1MZBA 2LBFB 3HRTA 2M0MA 1SVOA 3GX4X 2OU2A 3BT9A 3F3XA 1ZRCA 1JUSA 4M9XA 2VT3A 1HW1A 4GYIA 1N78A 2E35A 2AXLA 4L5EA 1VQLI 1XMXA 4I2OA 3W3CA 2XSJC 1W36C 4XBFA 2FQ4A 2XUBA 2OJED 4UVBA 4HOBA 1SVMA 2GOXB 4JX4A 5D5VB 2DQLA 2H6CA 3WE3A 2XAHA 4F55A 2F48A 4U0WA 3PUBA 4BHBA 1P7IA 1WI3A 1EA3A 3MN2A 5JHFA 2XAGA 4CO8A 4KIGA 2V9KA 5K7ZA 1FTTA 2K85A 2ZNZA 2DMUA 1J7KA 2I5UA 3LFUA 5TJJA 1SAUA 1R49A 1U2WA 2XROA 4Y13A 2JJ7A 1VF9A 3M4OJ 2CQNA 1TW3A 3CMYA 2CV2A 4LIUA 2NS8A 2H1LA 3HM5A 4ZYAA 1W5SA 4E7HA 1O3TA 4DIQA 1TWHJ 2FF4A 1ETYA 3MZYA 1U9OA 1UG2A 1MDMA 1QPIA 4O3MA 3S1NJ 3RYPA 4YIRX 2HFHA 1EH8A 4BGDA 4RA2A 3S1MJ 2K9QA 1HQCA 4GXOA 1ZG1A 3J81K 1RI7A 4S05A 2YR2A 2BW3A 1S72I 3CLQA 1V5GA 3B73A 1MH4A 4FISA 4QTRA 3HKZN 4K2EA 2RC4A 5M3MJ 2IW5A 2DFHA 3HOWJ 2JT1A 1MJ9A 4C2TA 4AIHA 4CCNA 5L3CA 5E3OA 3TMOA 2JUCA 1OYIA 1QHHD 1ETVA 2VBWA 1SFUA 2CGPA 4IHXA 2NNNA 5DS9A 4II3A 4BDYA 4ZJZA 3CCVI 4XQFA 4F52A 4WF2A 4A0YA 4HQMA 2R7WA 2CW0F 1LEBA 3H3ZA 4OMZA 1AKHB 4HYEA 2HQNA 2RQQA 1M1EB 2E60A 2BY0A 3BTLA 4P9UA 2STWA 3EUKL 1OPCA 1FNNA 2A5YB 4BE2A 3MZHA 3W2WA 2XPWA 4AYBA 1MH3A 5GAGJ 2M1BA 4L18B 1V5FA 2X4HA 1W7PB 1PDNC 4G7HF 1DDNA 1MBKA 3HSFA 3OSGA 2IT0A 2Y75A 2GIZA 2K02A 3C18A 4RAYA 3RKYA 1H9TA 3VYUB 2FJ1A 2P5VA 3MEXA 5BMZA 4XORA 3G6EI 1IG7A 3WODF 2P7VB 3GMEA 4S0HB 3LA2A 4CDGA 3HOUJ 4XKCA 1WVRA 5J3LA 2E2HJ 4ZDOA 3HPGA 3I5UA 1GHCA 4XICA 5GAEJ 2IPQX 5CLSA 2BHYA 2NOGA 1PUFB 2EFQA 3RQIA 5M5WJ 4MQ9F 2MH9A 3HZJA 2PQ8A 2LBFA 4XKBA 2NYXA 1YS6A 1XB4A 1WJCA 4E7KA 4CCOA 3TDZC 2Y0MA 3RKXA 4ENJA 1X2MA 1ZQ3P 1J5YA 4EQQA 3DLAA 2CG4A 1WFXA 2O03A 4YFXF 3GO5A 1GXQA 5K5QA 2EINH 3DPLC 5EEAA 3A0HC 1K79A 2J5PA 1WH7A 2CWEA 3H5AA 2MW8A 4XRSG 1FOWA 1LDKB 1D8JA 2PN6A 3WTXC 4CCLA 2Y9YA 3ZMTA 4U88A 4L5IA 1HF0A 4B44A 2WV0A 3Q9SA 3EPZA 1MKMA 2GXGA 2ZJQF 3KZIC 5K7HA 3LSHA 3BG6A 1OCZH 1SFEA 3O8HA 1Y1WJ 2L7MP 2VKHA 5ICCA 1DQUA 3PNTA 2JA7J 2Y69H 1Q1VA 2X6YA 2QENA 3DTEA 3HHGA 3PNYA 1BOBA 5J40A 5C3EJ 3O8GA 1CQTA 3S8PA 2L7FP 2EFNA 3N05A 4M72A 3KPHA 3TEDA 4A3CJ 4ZDPA 1PP8F 3RYRA 4CUGA 2KQRA 1W5TA 5CQEA 1G3WA 3E6CC 1KU3A 4M3FA 5KK1A 1WSUA 4LLLA 3P9IA 3MWMA 2CQKA 5J6XA 5IYDJ 4A5MA 1Z21A 4M9SA 2GXAA 4UVAA 4N4NB 3EDPA 2Q1ZB 4D7MA 2HPMA 4DBRA 1OCTC 2DLLA 3JRBA 1P92A 2RQPA 2ADUA 4HG2A 2OQRA 4JX6A 1USTA 3F0CA 2PX9A 3FM5A 4XSXF 4A12A 1NK3P 4M3DA 2RNGA 5IPAA 9ANTA 2L9VA 4G12A 4M71A 4WXDA 1YQAA 5DUKA 4A3IJ 2XPVA 4KNYA 2DFEA 1ZAOA 4HLXA 1IW7F 2K4BA 5JHUA 2WC2A 4ZYGA 4LD5A 3OYKA 2F4IA 3V4GA 1XGNA 4E70A 4P5OA 5D5WB 3CC7I 3DKXA 3HHHA 1KU2A 1TT5B 1X3UA 2KZVA 1T08B 3ZN0A 4OAYA 2VODA 2DA5A 2L0KA 4BE0A 3S2DJ 1MJBA 1TZLA 2W25A 2KDOA 1IZ1A 1X3ZB 2LY9A 2DOFA 5A2QK 3PQKA 4RGXA 5D5XB 2RV8A 3OYAA 3ZGKA 5LFAA 1W5CC 1ZHFA 2X85A 4YG2F 3R61A 3JTGA 1QU3A 1LPQA 4HX8A 2DOEA 2DA4A 1XDUA 3LA7A 4XONA 4HNUA 2VUMJ 1VQ7I 2IA0A 4PK4A 1FX7A 1IN7A 4BH9A 3RKQA 1EH7A 4PJJA 4Q4ZF 2QSFX 3H9GA 1SD4A 2DCEA 4MNUA 4B47A 2B9SA 2VKDA 2L9NA 1R1TA 1FIPA 3KYCB 4L9JA 2LR8A 4G7ZF 1Z7LA 1XTAA 4FCYA 4MFDA 2KHMA 3LAPA 5GTHC 4WWCA 2R5ZA 2R7TA 3HOXJ 3OSFA 2XDVA 3E3VA 4F3QA 1KGSA 1TW2A 2NVQJ 1TC3C 4DJAA 2QBYB 1BW5A 2M8EA 4Y15A 2FRHA 3GTMJ 1HC8A 2R92J 1YX5A 1EH6A 2P0WA 3GFIA 1F4KA 2WAEA 2QGUA 1ON1A 4IOAF 4RGUA 1BI0A 4V19K 2OZ6A 3BZCA 3LMMA 1SEUA 2CUJA 4CZCA 1N77A 2R7FA 2ETHA 2XGCA 1D0XA 3ZQLA 2LC2A 2W1OA 4KFCA 3CCMI 2DOAA 1Z9CA 1YIJI 1ZLJA 3DBHB 2M34A 3WTTC 1A31A 1BOAA 5C44J 5BPIA 2M4KA 4FQGA 3TW6A 1A36A 4IHSA 3BR1A 1BN5A 2H8RA 1W1WE 1W0TA 2EJRA 4KT6A 5HLTA 2CV0A 1DGWY 1Z05A 3TP3A 4HSRA 5C4JJ 3HOSA 4EGYA 1QPMA 1ZK8A 5J4VA 2HQ5A 1V3FA 1ULYA 1KQ0A 3F6VA 3ML6A 4XLCA 3FZVA 1G3SA 2DMNA 1O4XA 1DPRA 3FIWA 5L3FA 2G9WA 3BDDA 5D6FA 2VQLA 2L7KA 3OY9A 2IGKA 1YJNI 2DK8A 1HKTA 5E18F 2LD5A 1J0RA 4Y33A 3SZPA 1OMIA 1BI1A 2W00A 4AM3A 4J19A 4EM0B 4CZZA 1HBXG 2HDWA 1IRXA 4Y17A 2FSWA 2UXXA 4BYYA 5HS8A 1F1ZA 2Y0SN 2PMZA 1TWAJ 3DKYA 1R4NB 1TT0A 1VQMI 2L3DA 3IL2A 3J7AY 5D6EA 1T56A 4ZYHA 1T2KA 4I01A 4UUTA 1Z0XA 4NC8A 3IWZA 2LH9A 2XKPA 2L7ZA 4HF0A 2VPRA 4RAGA 4EEFG 3QQAA 4F91B 2Y48A 2FBHA 1IC8A 4AIKA 3GLLA 2UV1A 4IHYA 2X1DA 1J09A 2W4SA 1WQ2A 1TL8A 4OWRB 1VNDA 1OR7C 3IC7A 1SFOJ 5AIQA 2HWVA 3ZN1A 4ASNA 1FY7A 1N25A 2AO9A 1MBJA 1E2XA 2ID3A 3CF5F 2H09A 1IAWA 1X4OA 1XN7A 4O5VA 1S6LA 2IS1A 4M3BA 4V2GA 3QP6A 1P4WA 1Y39A 4R1HA 3K2ZA 3JRGA 1APLC 3BJOA 3VPRA 2K9NA 3BZ6A 1LQ1A 1LDDA 4XOTA 2K5CA 1PP7U 3D5RC 4D9JA 1MSFC 4CYCB 1MNEA 5JFRA 4HBLA 1K6YA 2VKEA 3V8LA 2JZYA 3BROA 1EV7A 4BXFA 1LB2A 2DA1A 4OOIA 3DU6A 3AG4H 2ELKA 1O7LA 5HOOA 2M8GX 1D5VA 4BJTA 4QLCU 3WU0A 2NVXJ 1ETWA 2FBKA 4YIIA 2O61A 1OJLA 2R4GA 4C3HJ 2MG4A 2OTLI 2F4MB 4AVPA 2EFPA 1O3SA 3ZQFA 3AL0C 3TOAA 4RGSA 2BY1A 1V55H 4BE1A 2X6OA 1YHQI 1T0FA 1FOXA 4PJ0C 2HTSA 2M87A 2ZFUA 2YU3A 3K2AA 3DQVC 4EM1A 4BJ5C 4OIOF 1FEXA 2JSPA 5CJ9A 3N97A 2VL8A 4IXAA 4YIFA 2Y2ZA 2CV1A 4A3FJ 3G2BA 1R5ID 3JAMZ 3WTWC 1FZPB 4HW0A 3DLLF 3DKWA 3HUGB 2Z9OA 2EV5A 5FFZA 1UMQA 4O6JA 3SHFA 2X9DA 4A3DJ 2XF6A 3F8MA 3OYJA 2DFIA 4F7ZA 1FBSA 1KYWA 1ITYA 1SANA 2ID6A 2ZC2A 3WTVC 2L2OA 1K78B 2JA8J 4QIWN 2OPTA 1OISA 2VONA 2X0LA 2KIFA 3OYLA 3BJ6A 3L2WA 4L0ZB 2ZO4A 3ZQIA 2VN2A 3GF2A 2L02A 1KQ8A 3BC8A 1IXCA 4HDUA 2IP2A 2PJPA 1WKMA 3TL4X 4ENNA 2EWNA 2K27A 5FRNA 1VQ6I 1W36D 2E34A 2D1HA 1MJAA 3GFLA 3QYBA 2KL4A 2LP0A 2J5OA 1IRZA 2R7UA 3RZDJ 1A6IA 3FHZA 1K83J 5JLWA 2Y9ZA 4M3GA 4MEYF 1IF1A 3CLOA 1O3RA 1HA8A 3E5XA 2DYSH 2VQGA 2AXTC 2Z3YA 4HNVA 2KDZA 3SJMA 3TBIA 1SAXA 1OR7A 5E8GA 3BWGA 5KCMA 3C2BA 4IHWA 3K4NA 4ZZLA 3FM3A 5DD8A 4RS8A 5FLMJ 4A5NA 3KP6A 2EB7A 3O3KA 3BPVA 4U0VA 3IKTA 3I54A 4BY1J 5DM7F 1FIAA 3UR3C 2V1XA 2PEXA 4LOCA 2M5WA 4A69C 1R58A 2V1DA 2EA2A 3SQNA 3F6OA 3VODA 2KT0A 3M07A 1DU0A 2LFBA 4JP0A 2VB6A 3HGGA 4GYGA 4A0XA 3JRHA 4LIVA 5LD2C 2NRAC 2NOJB 4M9ZA 3CUQC 4CA0A 3OR2C 1BR1A 2XB5A 1TWCJ 4ON0A 3HJEA 5BQTA 3I59B 4ITVA 4IO9F 3L2CA 3RKWA 3PNVA 1X4PA 5E79C 2L4MA 1XMAA 2DO7A 3FMRA 5IP9J 2XAUA 5FD5A 4BACA 2FOKA 4KIBA 4A6DA 4ETSA 1CF7A 2RDPA 2DAOA 5M5XJ 2PJRB 1YW8A 3KLNA 4NQWA 1KYZA 1IV6A 3TGNA 3S3NA 2JUGA 1X19A 1D1CA 2O8XA 1B1BA 3WG7H 3ASNH 3V7SA 1G3TA 2E71A 2EZLA 3CESA 2PMZN 4LG0A 1IJWC 4ZDLA 5FRMA 3B02A 1R23A 2XV4S 2F5EA 4JK1X 3B6AA 1S3JA 3OR1C 4WCGA 1YTYA 4W1UA 1MNMC 3KEQA 2ZXHA 5J47A 2OA4A 3KZYA 1B4AA 3CCRI 3QYFA 1MGTA 2KKOA 4XIDA 3I4PA 2JWTA 5TRDA 2P5LC 1MBEA 1SMYF 1JKRC 3OS1A 3S17J 1X58A 3SZTA 2FBIA 1WJFA 1I27A 5FLXK 4AIDA 2WBMA 3BJAA 2HS5A 3FXUA 2DJIA 2L4AA 4CCJA 4NHJA 5LRRA 3BY6A 3PO3J 5HS7A 3KP2A 4Y52J 1KQ9A 4RMNA 4YRVA 3NWSA 3U21A 4YFNF 3MKLA 1ZLKA 1Y8RB 2HXIA 2VI6A 2QEXI 1Y0NA 2WY8Q 2E2IJ 4BNCA 2ISYA 2EIJH 1S8NA 4LFUA 3SDGA 3H0DA 1W0UA 1RPWA 4BHPA 2D1VA 4XMYA 4JBAA 1DPUA 2GA2A 4FE4A 4BQNA 1J75A 2HDCA 3L1PA 1QZZA 2A5WA 2X1EA 2CJJA 3H35A 1OCCH 2VQCA 3BG3A 4EGZA 2OBPA 2K9MA 3DEEA 2PG4A 3QYEA 4L0YB 4XLEA 5HLGA 3J81Z 4GDFA 2R3SA 3AG3H 1K7AA 3CP8A 3H92A 1LKXA 4NNJA 4ENKA 2O3FA 5D5UB 1BIBA 1R9TJ 2G0EA 3DWLE 3ZXSA 3C3WA 2BVMA 3G73A 1D5YA 2E1OA 5D8LB 5BS6A 4U0YA 1I5ZA 2BEOA 3GFJA 2KRHA 4KISA 1R1VA 1VTNC 2QKLB 4PJLA 2CFXA 1SFXA 1FSEA 2DMQA 4MTEA 2KRFA 2KIUA 5IOYA 5AONA 3H5NA 4ZZDA 3HL2A 2CU7A 1XMKA 3M9AA 1B9NA 1T6SA 2ESHA 5JR3A 1HXDA 2EBIA 1R1UA 2LOOA 1MBHA 5E1WA 2EIMH 3G1MA 2GLOA 1A5JA 1Z6RA 3PSFA 3JCUC 3OYMA 1ZKGA 1MBFA 2A68F 3I64A 4XK4A 2WB1A 3A2KA 1LE8A 3IH3A 1GLNA 5K1YA 5IT9K 4MO7A 3MZ8A 1D0ZA 3CMEI 4A3BJ 3QPSA 2EQRA 3I53A 1QZYA 1ZR2A 5FLVA 2TDXA 3FXLA 1HDDC 5IYCJ 4J00A 4UUVA 3JRCA 3S93A 1Z3XA 2O8KA 4DOZA 2HPIA 2Z2SB 5JVTA 2EA4A 3GZ5A 4IPAA 3CC4I 3QPLA 1VQ9I 3NEUA 4P1WA 3CCSI 1YJ9I 3O2PE 4LGWA 4PJNA 5FFXA 1U6GA 3GTPJ 4I99C 3UKGA 4IL6C 3HPHA 2Z5UA 2KP6A 1PUEE 2KLOA 4RBOA 4M3EA 3PIPF 2M4GA 5E20A 3JREA 2VQHA 4RAFA 3V8KA 3VB2A 3LSKA 1RR7A 1H88C 3TKYA 4HPQA 2JN6A 4CCMA 2DTRA 4U7DA 2QUFA 1IN5A 2HI3A 4UHTA 3JTHA 4IKFA 1I6HJ 1SC7A 2L54A 2CUZA 1UG0A 2DW4A 2CQ7A 4UB6C 2XGDA 5LEKA 1NG6A 2DU9A 3CD6I 1XG1A 5BNGA 3GTJJ 3F23A 3DPUA 4IRGA 1U8RA 3BR6A 2XHKA 2G7UA 3TDUC 2AQEA 2Q0OA 2P7CB 4PCQA 1OYYA 1F43A 1QQIA 2L9RA 1OLTA 2IGMA 2UUZA 4D5FA 1H9GA 2W84A 3ABKH 5CVRA 4BS9A 1QNTA 1IUFA 2X48A 2XGXA 1JJ6C 1FTZA 1W7PD 2D2WA 4HA8A 3GCMA 5K5OA 2DPUA 1ERDA 4DGWB 2BXYA 3CUOA 1E3OC 3E6BA 3LSRA 4RLQA 3CO7C 1K6OA 2RN7A 2H1KA 3EETA 2XAQA 5J4YA 1QRYA 5GPCA 5IYBJ 1JT6A 3HTUA 2Z33A 2MGQA 3IH4A 1SVLA 4KDPA 5EG0B 1R7JA 2BY3A 4XKWA 3V7RA 3RPUD 1GXPA 4YFKF 2RAEA 3LSGA 2IS4A 3V42A 3GFMA 3KP4A 2CSOA 2DDAA 2XRNA 2V9VA 5FKMA 3GTQJ 1QGPA 3PFIA 1QZEA 3SEZA 2RGVA 2VBYA 3WU2C 3QRFF 4YELA 5TGTA 4LMYA 5ICEA 3WTUC 2QBYA 2MABA 3K70D 4Y3OA 2JA5J 1JUMA 5F1RA 3I4NJ 5FKLA 3IKVA 2R7VA 4UVCA 4GO1A 4ANJA 3WGIA 2V26A 4X1EA 1L3LA 1TNSA 3G1OA 3I9V2 4MHGA 2LY1A 3ZMDA 2DTZA 3EUAA 4PFOA 4P55A 1BI2A 3FKIJ 3DFGA 3Q9VA 1U5TC 3IP4B 4BJ6C 5IP7J 4HLYA 2V7FA 3A01A 1U3EM 3GTGJ 4BXUA 3BQZA 2V9PA 1DU6A 3ASOH 1S7AA 2ZCWA 3A02A 4ZYDA 2CUEA 2W7NA 4CXFA 4EJUA 2M7BA 4U87A 1Y6IA 3ABLH 4XNFA 5IP6A 1ENHA 5IT3A 1YE9A 3IV5A 1CF7B 1IDZA 1WJAA 4R8HA 1TNTA 4BBRJ 2PBIA 2LRDA 2KMUA 5F0HA 3X2QH 2B63J 3MAJA 1FT9A 3S3OA 2ELHA 4BQAA 3VWBA 2ZXIA 3MD2A 4BEHA 3H5RA 3DP7A 4N9IA 5DD4A 1YLFA 4C3JJ 4E7IA 4MLOA 3FK7A 5F1JA 3S3MA 3E5QA 4BL0B 5LHHA 3RCOA 3EYIA 3M8JA 3RDIA 1B8IB 4MGRA 5LGNA 3JAMK 3E97A 5J8CA 2DT5A 2BYVE 4AIJA 4N9HA 1I39A 4BY7J 4NBQA 3I4MJ 4HX4A 5JVGF 1XCVA 4AWXB 2EH3A 4IX7A 3W6KB 4LJZF 4IOCF 1ETQA 3K1PA 1QHGA 1JKPC 3PL8A 2QQ9A 3KP5A 1MMNA 3K70C 1YI2I 1Y8QB 2OV7A 3SZGA 2QSGX 3IAM2 3W2AA 2KIMA 4N4OB 3I71A 2HZDA 3R60A 4AYBN 1RESA 4XLPF 2HNHA 4MEXF 2NVUB 2COBA 1V5EA 1VQ4I 2GA1A 3WU1B 2OZUA 2GIVA 2ELJA 4L5JA 1W7PA 2E5ZA 1YJWI 4BQQA 2XF7A 1FC3A 4GRIA 4H4KC 1A35A 3RJPA 2AHQA 2LF7A 1AU7A 3OYCA 5HODA 4AC0A 1X1DA 5F08A 3LQQA 2VBXA 3DCFA 3KP7A 3HRSA 4TV7A 2A61A 4A3JJ 1T8IA 3QODA 5E3LA 4OU0A 2IRFG 5CYVA 2HKXA 1FMVA 1TWGJ 1TWFJ 2R93J 1LVKA 2CYYA 1PJRA 3V8JA 5J1YA 1R5HA 5F64A 2EZKA 1GV5A 4HEA2 2R7QA 3DTKA 5EJCA 1LFUP 1UHMA 4HZFA 3H3VK 3ELKA 5JI6A 2P4WA 1ODDA 2P5KA 4JX5A 2WADA 5KVRA 5HNHA 2CW8A 2O6GE 1YIOA 2KJBA 3JSOA 4E6KG 1FOKA 3TO9A 4KT5C 2WWYA 5J8FA 3KIOA 1BR4A 4NQWB 2VPLA 2E19A 3S1QJ 4ZTJA 4UUSB 3CMAI 4RDUA 3FXKA 3S2WA 3MMYB 2K7LA 1KA8A 1MW7A 3S32A 5EEGA 1HOMA 3K6GA 4E7ZA 5EEHA 1TQMA 2R7XA 2ZMEA 2LYCA 1I50J 1YFHA 3L7WA 3JW4A 3LQRA 4PUSA 5KAFC 2LKPA 1XC5A 2F5VA 3CDLA 3VYTB 3V7CA 1UAAA 3GZ6A 4HRIA 3HYIA 4OIQF 3CQZJ 1AA7A 4BKXA 2OAZA 2ME0A 2EFWA 1FMWA 1R22A 3Q0UA 4LG0B 4DW6A 3C1DA 2OQGA 1YITI 3QU3A 3U1DA 1XSXA 1IN8A 5ILSA 2QQAA 1EKEA 2DN0A 2VJJA 5CVJA 4DYQA 3K9TA 1SFKA 3ABUA 1QBJA 3P7NA 2FMLA 4BXXJ 2HOAA 3WE2A 1AOYA 2IXSA 2H8WA 3HRMA 2JSCA 4A3MJ 2KZGA 2VOOA 4KA4A 2K3FA 3GEZA 2HVRA 1T0FC 5F04A 5TISC 2K40A 1I3QJ 3ECHA 4WXHA 3FX3A 2VXDA 4BQOA 3QPTA 3TW7A 4CCKA 1D0YA 1WRJA 2DK5A 2DBBA 2TCTA 1LFPA 4BUPA 2E2JJ 2GZWA 3AKZA 3OL3A 3H0GJ 1UHWA 3CJRB 2HOEA 3A01B 2XB0X 3Q0VA 1WPKA 1HKQA 1T98A 3KEYA 3CO6C 4KYWA 4BHCA 1BI3A 1P4XA 3OIQA 3DXJF 4PZJA 1MMDA 4EMSA 1DGRM 2CS3A 1DUXC 2PLYA 1XGOA 1HCRA 2LNBA 4QSHA 1YOVB 3I0TA 2E1NA 3SDBA 1X2NA 5F27A 2STTA 2HOTA 3FF5A 3FWEA 2GWRA 4BBSJ 3GUDA 2V1UA 1UZCA 4W97A 3RSNA 4A3LJ 2LKSA 5DCMB 4QPQA 3KLOA 3NARA 5CVUA 3CCQI 2E1CA 3C2GA 2VE8A 1WJEA 3BQYA 2V6EA 1JUPA 2NVTJ 5CPRB 4XLAA 4XM3A 5M5YJ 2M0CA 5ILVA 2W57A 3P9CA 1FBQA 1FPQA 2BVLA 2XAJA 4RLFA 3ZQQA 3JRIA 4HF2A 3GTKJ 1EF4A 2MH2A 3K0LA 1VQKI 5H2FC 4E7JA 2QM3A 3CUQA 2P81A 1JKQC 1YO5C 3I59A 1NG7A 2HVSA 1G4DA 3CCYA 2A69F 2ZMEB 2DFFA 3CZ6A 3H3UA 4FASD 4WK8F 2M7AA 2XRLA 2ZJ2A 4LG3A 2BV6A 2GAUA 4RB3C 2JK3A 2MC3A 4WX9A 3KETA 3CCLI 1VQ5I 4XKVA 5ERIA 3TOBA 1BC8C 3BR3A 2NXNB 3HOYJ 4KN7X 2HOSA 1IN4A 3HUGA 1JGGA 1ETXA 3TO7A 1RZ4A 4EJTA 1WZ2A 2KJCA 4G8XA 4DZJA 1AKHA 3R0AA 3OYDA 3HKZA 3SXYA 3M1CA 3G71I 4KUMA 4DQ2A 2Z1DA 4ZTFA 1Y56A 4X0GA 4LITA 4PSWA 2K86A 1NH3A 5ICFA 3MCZA 1R71A 2A05A 4I0AA 4LK0F 3MKZA 4UV9A 5J1RA 3SFIA 2QSHX 3LAJA 2L01A 3K4LA 4QPOA 3NRVA 1RIOH 1K61A 3G4SI 4IHVA 1O57A 5CKTA 3QWLA 4Z2YA 5FKOA 1DP7P 3HOZJ 2FU4A 1BJZA 3K4KA 3FBIB 3GXOA 1BW6A 1VI0A 1RUOA 1P4AA 4ESFA 2N8GA 4G6QA 5EDNA 5HNFA 3K4MA 2HZTA 3I3LA 4II2A 3BTCA 4D7NA 3HTSB 1PYVA 2MLKA 3W6VA 4PGHA 2HTJA 2XGEA 5GTIC 2LDUA 5GADJ 4AVZA 2IJLA 4B48A 1BIAA 2RREA 2WB1N 2LY2A 1P9QC 2D45A 3ZR8X 2EPFA 1XS9A 1UHSA 1YRNB 4C2UA 4UXNA 4MQVA 2HVQA 3ECOA 4RB1A 1ZH5A 4IQ4A 2MFZA 3I55I 4XOPA 2DXIA 2VXZA 3E0JB 2MA3A 1K4SA 5DM6F 2FEZA 3R6SA 1BC7C 1IDYA 4BAYA 3F9KA 3OYHA 5C4XJ 1LUJB 3JRAA 3L2RA 4CGZA 3ABTA 1MMAA 2I10A 3ZOBA 3MFKA 4MIMA 2VJ5A 3LWFA 1X1BA 3DPTA 3ZRGA 5HVQC 1TBXA 1OCOH 3RZOJ 3MQ0A 2P6SA 3MVPA 4XRSA 4G7OF 2FXAA 3FK6A 1BL0A 5K5RA 1JJ8C 3CTAA 2Q8KA 2MD5A 3OOUA 2IS6A 3E7LA 2KFDA 2LG4A 3U9GA 2QVOA 2Q2EA 3BOQA 4HX7A 1UFMA 1P2FA 1R4MB 3CMMA 2QWWA 4M6XA 5D4SA 1X1CA 3JRDA 2UWMA 2G7HA 2ICWG 1X1PA 3K4CA 3WGGA 3ZQCA 1EJ9A 3AL0B 2IGNA 2VBZA 5HS9A 4FETA 2O9LA 2EZIA 4HNTA 1JGSA 1ONVA 2H6BA 1NK2P 1ACIA 2QKMB 1SD6A 3MKYB 3OIOA 1AHDP 4IHTA 1JXSA 1OKRA 1Y1VJ 4GGGA 3L09A 4UB8C 2GQQA 4ABZA 1JKOC 3LSJA 5IOZA 2WA0A 1FWZA 5LGUA 2EV6A 4I0BA 5LHGA 4FTHA 2PI0A 3ZP5A 3KFWX 3EUHC 3H9JA 3LSIA 2VOPA 4IQJA 4M74A 2L9SA 4N0BA 3OS0A 2NS0A 4RAZA 4G94A 2IVMA 5FLXZ 3I56I 4IF4A 2EFOA 1RC9A 2BXZA 1LDJA 3DBLB 5EG0A 1L0OC 3FMSA 3S15J 4IJAA 1ZGAA 3F8BA 1IRGA 4A6EA 1J9IA 1RUNA 3L2QA 2KPMA 3K1MA 2A6TA 1KU7A 2M3AA 2HEOA 5E3MA 3GTLJ 3A4CA 1V54H 5GPAA 2OF7A 5JLXA 2LF8A 2M30A 4KN4X 2QLZA 2GM4A 3HOTA 3L9FA 4B3AA 2FMYA 2QQBA 1LEAA 2Y0SA 6PAXA 1WH5A 4HQEA 4X6AJ 2R7SA 2OCCH 1YS7A 4MFEA 4NC6A 3NQOA 3PUFA 3CP2A 1MMSA 1IRFA 2VASA 1I1SA 2DQRA 2V1NA 5ILUA 1DP3A 4OINF 2X1CA 2GOMA 2DDBA 1Z77A 2IEKA 2W48A 3ISPA 2JVGA 5HDKA 3GLXA 4EJWA 3BTJA 3H9QA 1ZGWA 3FXMA 3H36A 2Q2EB 3FXRA 3BCAA 4C3IJ 5DTDA 1X3WB 5L3EA 3KYLA 4GCVA 1TQIA 2CO5A
chains in the Genus database with same CATH topology
4HV6A 1R5GA 1FSHA 4DNCA 1NHAA 4ZYEA 5LBQA 1Z7UA 5FD6A 3TO6A 1OYWA 2FA5A 4KMFA 4FX4A 1IXRC 3VFZA 1FYKA 3R0JA 5DEQA 2QZ8A 1FP2A 5BPDA 1QO0D 5FGMA 2HKOA 3RI4A 4L9NA 1BBYA 4P96A 3Q5FA 1MD0A 2JRTA 1Q1HA 2JPCA 3EQLF 2JPBA 2E7WA 1A04A 1XCBA 2XKOA 3VEPA 1G3YA 1H0MA 2YX4A 4L9VA 3K1NA 1ZREA 3E6MA 4HDVA 2A6EF 2V79A 3ZMVA 3IRQA 3DF8A 2O0YA 3KZZA 2ZKZA 3ZMZA 2K4JA 3SFZA 3ZMSA 2HYGD 3F8CA 5HDGA 1Z91A 4LLGF 1KU9A 2HR3A 5HLHA 3T1BA 4ENMA 5D8KB 1I6XA 2VE9A 3REOA 4I98B 1HSTA 1USSA 5HDNA 2DI3A 1ZGJA 1JE8A 1I1GA 1ZG3A 3EYYA 2P8TA 2M45A 1XSVA 1W4MA 5DV5A 3I58A 2HYFA 3D0SA 4L9TA 1ZRFA 5CVIA 5H6RA 1FYMA 2ZFWA 2ZNYA 2PMUA 1Y0UA 4EM2A 3CUQB 1AWCA 4LK1F 5ICGA 1XD7A 3G3ZA 2IA2A 2MBFA 2XAFA 3F8FA 1JHFA 1IXSB 3QAHA 3WG9A 1STZA 4H0EA 3AAFA 4FX0A 4I7HA 5LEJA 4EVIA 3GYHX 1K78A 2PFBA 4P9FA 3T0YA 2R7DA 3ERED 4XSZF 1F5TA 4S04A 4B09A 2HGCA 3T8RA 1HW5A 1UCRA 4LLNA 4FHTA 3GW2A 5HLIA 5IT9Z 2LSOA 4IVNA 5E1XA 3D5LA 1R00A 3CJNA 3O6BB 1ZARA 4LB5A 3QOPA 2YSRA 5FO5A 2NAZA 4XLNF 1SD7A 4Q5SF 2FE3A 4CHUA 3HRUA 4FT8A 3T8TA 3QPHA 1O7FA 1WI9A 3VOEA 2A07F 3RTRA 2UZKA 4I02A 1BJAA 1Z6TA 3BPXA 5DCMA 2F5DA 5L3GA 5L3BA 1D8KA 1IN6A 1YW7A 3M8EA 5E17F 1U5TA 1ZN2A 5FB2A 4Q48A 1O3QA 1ZYRF 1HW2A 4NB5A 2BGCA 4I09A 3KEOA 3GWZA 3U2RA 4UV8A 3J7AO 3IRRA 3RIRA 1CGPA 2OD5A 1UB9A 3QP5A 2YPRA 4PDKA 4EV0A 2PMHA 5AIPA 2H27A 3J80K 2EK5A 3ZQ7A 1XDSA 4QWQA 4B8XA 2QYOA 1YYVA 4WXCA 1MDMB 1T38A 2AS5F 3DEUA 1XGMA 5CVVA 1REPC 2ESNA 3R4KA 3C7JA 4HF1A 3N4MA 1GVJA 1ON2A 5L3DA 3M7GA 4MTDA 3KP3A 3K69A 4R79A 3CDHA 4OMYA 1FLIA 4G6DA 4KIFA 3RPUA 4HAMA 1C0WA 3QU6A 2YX7A 4KMUX 1B9MA 3GVAA 3KCCA 4RGRA 3HIFA 3WGHA 2W85A 3RPQA 1LVAA 1Z1DA 3HSRA 5DYMA 2FQ3A 2H94A 2A6HF 2VC0A 3KE2A 3T5XA 1YG2A 5ED4A 3LSTA 4LB6B 2VT2A 4XRFA 4IRIA 5F6FA 2F5FA 2FNPA 3JSPA 1XGSA 2ISZA 2FNAA 4OIRF 1JHHA 2P6TA 3OOPA 4UNOA 1FBUA 4KICA 4Q47A 3M8FA 2B0LA 1HSJA 1LJ9A 4U7BA 2BBYA 4CICA 1B59A 4RB2C 3OV8A 1S7OA 1V4RA 2F5CA 1XSDA 4ZH4F 5E1ZB 5LLQA 1RNLA 5H20A 3ZMUA 5DDGA 1ZRDA 1FP1D 3WTYC 3IHUA 3PQJA 2F2EA 4A2UA 5DCFA 1S29A 1TTYA 3WTZA 4A0ZA 4PGGA 4AD9A 1WWXA 4JQFA 4EJOA 2E7XA 3F8NA 2XASA 3F72A 4ESBA 3P9KA 4EJVA 4RB0A 2DPDA 1P6RA 1SMTA 2EV0A 5BOXA 3E5UA 3ULQB 2RVCA 2RKHA 1B6AA 2GXBA 1SD5A 1TLHB 2ZBKA 4ESJA 1U5TB 3LFKA 2C6YA 2ZXJA 2VC1A 2V6CA 3L00A 5D4RA 2Z99A 3W6JB 3M1EA 1TQPA 3J80Z 4M73A 1YW9A 2XIGA 1LNWA 3LA3A 3E6DA 4CYDA 3TQNA 3COAC 1U78A 2ACJA 5A2QZ 3ZPLA 2NNYA 3FXQA 3IWFA 2JTVA 2BE5F 4HV5A 2A3SA 2W24A 3F21A 1HKSA 4G9YA 5H6QA 3BP8A 3DV8A 1G6NA 2HQRA 2RNJA 1J59A 2WTEA 5LHIA 4OIPF 1J2XA 2COMA 5E8IA 3F22A 1D3YA 3FMQA 2IA1A 1ZG5A 3EUHA 5DUIA 1R36A 1FYLA 1IUYA 1T39A 4D0PA 1F9NA 3ROUA 2XVCA 1BM9A 3HSEA 2MLGA 1E17A 5LGTA 5LRSA 3WTSC 2UXNA 4IRHA 4M6YA 1MZBA 3HRTA 1ZRCA 3GX4X 2OU2A 3F3XA 4M9XA 2VT3A 1HW1A 4GYIA 2AXLA 4I2OA 4XBFA 2XUBA 4UVBA 4HOBA 5D5VB 2DQLA 2H6CA 3WE3A 2XAHA 4U0WA 4BHBA 2XAGA 4CO8A 4KIGA 2ZNZA 1J7KA 5TJJA 1U2WA 2XROA 4Y13A 1TW3A 1W5SA 1O3TA 2FF4A 3MZYA 1MDMA 4O3MA 3RYPA 2HFHA 1EH8A 1HQCA 4GXOA 1ZG1A 3J81K 1RI7A 4S05A 2YR2A 3B73A 4K2EA 2RC4A 2IW5A 2JT1A 1MJ9A 4AIHA 5L3CA 1OYIA 2VBWA 1SFUA 2CGPA 2NNNA 4WF2A 4A0YA 4HQMA 2CW0F 1LEBA 3H3ZA 4OMZA 4HYEA 2HQNA 2STWA 4P9UA 1OPCA 1FNNA 2A5YB 3MZHA 4L18B 2M1BA 2X4HA 1W7PB 1PDNC 4G7HF 1DDNA 3HSFA 2IT0A 2Y75A 2K02A 3C18A 4RAYA 3RKYA 1H9TA 2P5VA 3MEXA 5BMZA 3WODF 2P7VB 3LA2A 4CDGA 3I5UA 1GHCA 2IPQX 5CLSA 2EFQA 4MQ9F 2MH9A 2PQ8A 2NYXA 1YS6A 1XB4A 3TDZC 2Y0MA 3RKXA 4ENJA 1J5YA 4EQQA 2CG4A 2O03A 4YFXF 3GO5A 1GXQA 5K5QA 3DPLC 1K79A 2J5PA 2CWEA 1D8JA 1LDKB 2PN6A 3WTXC 3ZMTA 4U88A 4L5IA 2WV0A 3Q9SA 1MKMA 2GXGA 1SFEA 5ICCA 2QENA 3HHGA 2EFNA 4M72A 1PP8F 3RYRA 1W5TA 1G3WA 3E6CC 1KU3A 1WSUA 5KK1A 4LLLA 3P9IA 3MWMA 2CQKA 5J6XA 4A5MA 4M9SA 4UVAA 3EDPA 2DLLA 1P92A 2RQPA 2ADUA 2OQRA 1USTA 3FM5A 4XSXF 4A12A 4M71A 4WXDA 1YQAA 5DUKA 4KNYA 1ZAOA 4HLXA 1IW7F 2K4BA 5JHUA 2WC2A 4ZYGA 4LD5A 3V4GA 4E70A 1XGNA 4P5OA 5D5WB 3HHHA 1KU2A 1X3UA 3ZN0A 2VODA 1MJBA 2W25A 1IZ1A 5A2QK 3PQKA 4RGXA 5D5XB 2RV8A 1ZHFA 4YG2F 3R61A 3JTGA 4HX8A 1XDUA 3LA7A 2IA0A 1FX7A 1IN7A 4BH9A 1EH7A 4Q4ZF 1SD4A 4MNUA 1R1TA 4L9JA 4G7ZF 3LAPA 4WWCA 3E3VA 1KGSA 1TW2A 2QBYB 2M8EA 4Y15A 2FRHA 1EH6A 3GFIA 1F4KA 1ON1A 4RGUA 1BI0A 2OZ6A 2R7FA 2ETHA 4KFCA 1Z9CA 1ZLJA 3WTTC 1BOAA 5BPIA 4IHSA 1BN5A 2EJRA 1Z05A 3HOSA 4EGYA 1QPMA 1V3FA 1ULYA 1KQ0A 3F6VA 3ML6A 3FZVA 1G3SA 1DPRA 5L3FA 2G9WA 3BDDA 5D6FA 2DK8A 1HKTA 5E18F 1J0RA 3SZPA 1OMIA 1BI1A 4EM0B 4CZZA 1HBXG 4Y17A 2FSWA 2UXXA 4BYYA 5HS8A 1F1ZA 2L3DA 3IL2A 5D6EA 4ZYHA 1T2KA 4I01A 3IWZA 2XKPA 4HF0A 2Y48A 2FBHA 4AIKA 1WQ2A 3IC7A 5AIQA 2HWVA 3ZN1A 4ASNA 1FY7A 1E2XA 2H09A 1IAWA 1XN7A 4O5VA 1S6LA 3QP6A 1P4WA 4R1HA 3K2ZA 3BJOA 3BZ6A 1LQ1A 1LDDA 1PP7U 5JFRA 4HBLA 3V8LA 2JZYA 3BROA 1EV7A 1LB2A 4OOIA 1O7LA 5HOOA 1D5VA 4QLCU 3WU0A 2FBKA 4YIIA 2O61A 4AVPA 2EFPA 1O3SA 3TOAA 4RGSA 1T0FA 2HTSA 2M87A 2YU3A 3DQVC 4EM1A 4OIOF 5CJ9A 3N97A 4IXAA 4YIFA 3JAMZ 3WTWC 1FZPB 4HW0A 3DKWA 2Z9OA 2EV5A 5FFZA 4O6JA 3SHFA 3F8MA 2DFIA 4F7ZA 1FBSA 1KYWA 3WTVC 1K78B 2VONA 2X0LA 2KIFA 3BJ6A 4L0ZB 2ZO4A 2VN2A 3GF2A 2L02A 1KQ8A 1IXCA 4HDUA 2IP2A 2PJPA 1WKMA 4ENNA 2EWNA 2K27A 2D1HA 1MJAA 3GFLA 2J5OA 3FHZA 4MEYF 1IF1A 3CLOA 1O3RA 3E5XA 2Z3YA 1SAXA 1OR7A 5E8GA 3BWGA 4ZZLA 3FM3A 5DD8A 4RS8A 4A5NA 3KP6A 2EB7A 3O3KA 3BPVA 4U0VA 3IKTA 3I54A 2V1XA 2PEXA 2M5WA 1R58A 2V1DA 2EA2A 3SQNA 3F6OA 3VODA 4GYGA 4A0XA 2NRAC 4M9ZA 3CUQC 4ON0A 5BQTA 3I59B 3L2CA 3RKWA 2L4MA 1XMAA 2DO7A 3FMRA 5FD5A 2FOKA 4KIBA 4A6DA 1CF7A 4ETSA 2RDPA 2DAOA 1YW8A 3KLNA 4NQWA 1KYZA 3TGNA 2O8XA 1B1BA 3V7SA 1G3TA 4LG0A 3B02A 1R23A 2XV4S 2F5EA 4JK1X 1S3JA 4WCGA 1YTYA 3KEQA 2OA4A 3KZYA 1B4AA 1MGTA 2KKOA 3I4PA 5TRDA 2P5LC 1SMYF 3SZTA 2FBIA 1I27A 5FLXK 3BJAA 3FXUA 2HS5A 2L4AA 4NHJA 5LRRA 3BY6A 5HS7A 3KP2A 1KQ9A 4YFNF 1ZLKA 4BNCA 2ISYA 4LFUA 1S8NA 4BHPA 2D1VA 1DPUA 4JBAA 2GA2A 2HDCA 1J75A 1QZZA 4EGZA 2OBPA 2PG4A 4L0YB 5HLGA 3J81Z 2R3SA 1K7AA 3H92A 4ENKA 2O3FA 5D5UB 1BIBA 3C3WA 3G73A 5D8LB 5BS6A 4U0YA 1I5ZA 2BEOA 3GFJA 1R1VA 1VTNC 2CFXA 1SFXA 1FSEA 4MTEA 2KRFA 2KIUA 5AONA 4ZZDA 1XMKA 3M9AA 1B9NA 1T6SA 2ESHA 5JR3A 1HXDA 1R1UA 5E1WA 1Z6RA 2A68F 3I64A 5K1YA 5IT9K 3I53A 1QZYA 2TDXA 4UUVA 5JVTA 2EA4A 3GZ5A 4IPAA 3NEUA 3O2PE 4LGWA 5FFXA 1U6GA 2Z5UA 1PUEE 5E20A 3V8KA 3VB2A 3TKYA 2DTRA 4U7DA 2QUFA 1IN5A 4UHTA 3JTHA 2L54A 2DW4A 5LEKA 2DU9A 3F23A 4IRGA 1U8RA 2XHKA 2G7UA 3TDUC 2Q0OA 2P7CB 4PCQA 1OYYA 1QQIA 1H9GA 2W84A 5CVRA 1QNTA 2XGXA 1W7PD 2D2WA 4HA8A 5K5OA 2DPUA 3CUOA 3E6BA 3CO7C 1K6OA 2RN7A 3EETA 2XAQA 3HTUA 2Z33A 4KDPA 1R7JA 3V7RA 1GXPA 4YFKF 3GFMA 3KP4A 2CSOA 2XRNA 2V9VA 1QGPA 3PFIA 2RGVA 2VBYA 3QRFF 4LMYA 5ICEA 3WTUC 2QBYA 5F1RA 3IKVA 4UVCA 4GO1A 3WGIA 1L3LA 1TNSA 4MHGA 3ZMDA 4P55A 1BI2A 3DFGA 3Q9VA 1U5TC 4HLYA 1U3EM 4BXUA 1S7AA 2ZCWA 4ZYDA 4CXFA 4EJUA 5IT3A 1CF7B 4R8HA 1TNTA 2PBIA 3MAJA 1FT9A 4BQAA 2ELHA 3DP7A 4N9IA 5DD4A 1YLFA 3E5QA 5LHHA 3EYIA 3RDIA 4MGRA 5LGNA 3JAMK 3E97A 5J8CA 2DT5A 2BYVE 4AIJA 4N9HA 4HX4A 1XCVA 4AWXB 3W6KB 4LJZF 3K1PA 2QQ9A 3KP5A 2KIMA 3I71A 3R60A 4XLPF 4MEXF 2GA1A 3WU1B 2OZUA 2GIVA 4L5JA 1W7PA 1FC3A 3RJPA 2LF7A 3LQQA 2VBXA 3KP7A 3HRSA 4TV7A 2A61A 4OU0A 2IRFG 5CYVA 2HKXA 2CYYA 3V8JA 1R5HA 5F64A 1UHMA 4HZFA 3ELKA 5JI6A 2P4WA 1ODDA 2P5KA 5KVRA 2O6GE 1YIOA 2KJBA 3JSOA 1FOKA 3TO9A 4KT5C 2WWYA 5J8FA 3S2WA 2K7LA 1KA8A 5EEGA 5EEHA 1TQMA 2ZMEA 1YFHA 3L7WA 3JW4A 3LQRA 2LKPA 3V7CA 3GZ6A 3HYIA 4OIQF 2EFWA 2OAZA 1R22A 4LG0B 3C1DA 2OQGA 3QU3A 3U1DA 1XSXA 1IN8A 5ILSA 2QQAA 5CVJA 3K9TA 3ABUA 1QBJA 3P7NA 2FMLA 3WE2A 1AOYA 3HRMA 2JSCA 2VOOA 4KA4A 3GEZA 3ECHA 4WXHA 3FX3A 3QPTA 1WRJA 2DK5A 2DBBA 2GZWA 1UHWA 2HOEA 1HKQA 1T98A 3CO6C 4KYWA 4BHCA 1BI3A 1P4XA 3DXJF 4PZJA 4EMSA 1DUXC 2PLYA 1XGOA 2LNBA 3I0TA 2E1NA 2STTA 3FF5A 3FWEA 2GWRA 3GUDA 2V1UA 5DCMB 3KLOA 5CVUA 2E1CA 2VE8A 5ILVA 2W57A 3P9CA 1FBQA 1FPQA 2XAJA 4HF2A 2MH2A 3K0LA 2QM3A 3CUQA 1YO5C 3I59A 1G4DA 2A69F 2ZMEB 3H3UA 4WK8F 2ZJ2A 2BV6A 2GAUA 4RB3C 2MC3A 4WX9A 3KETA 5ERIA 3TOBA 1BC8C 4KN7X 1IN4A 3HUGA 3TO7A 1RZ4A 4EJTA 2KJCA 4G8XA 3R0AA 3SXYA 4DQ2A 4KUMA 2K86A 5ICFA 3MCZA 4I0AA 4LK0F 4UV9A 3LAJA 2L01A 3NRVA 1RIOH 1O57A 4Z2YA 1DP7P 2FU4A 3GXOA 1RUOA 1P4AA 4ESFA 4G6QA 2HZTA 3HTSB 2MLKA 4PGHA 2HTJA 2LDUA 2IJLA 1BIAA 2D45A 4UXNA 4MQVA 3ECOA 4RB1A 1ZH5A 2VXZA 2MA3A 2FEZA 3R6SA 1BC7C 4BAYA 4CGZA 3ABTA 3MFKA 3LWFA 3DPTA 5HVQC 1TBXA 3MQ0A 2P6SA 4G7OF 2FXAA 5K5RA 3CTAA 2Q8KA 2MD5A 3U9GA 2QVOA 2Q2EA 3BOQA 4HX7A 1P2FA 1UFMA 2UWMA 2QWWA 4M6XA 5D4SA 2G7HA 3WGGA 2VBZA 5HS9A 1JGSA 1ONVA 2H6BA 1SD6A 4IHTA 1JXSA 1OKRA 4GGGA 3L09A 2GQQA 1FWZA 5LGUA 2EV6A 4I0BA 5LHGA 2PI0A 3ZP5A 3KFWX 2VOPA 4M74A 4N0BA 2NS0A 4RAZA 4G94A 2IVMA 5FLXZ 4IF4A 2EFOA 1LDJA 1L0OC 3FMSA 4IJAA 1ZGAA 3F8BA 1IRGA 4A6EA 1J9IA 1RUNA 3K1MA 1KU7A 2HEOA 2LF8A 2M30A 4KN4X 2QLZA 3HOTA 3L9FA 2FMYA 2QQBA 1LEAA 6PAXA 4HQEA 1YS7A 3NQOA 1I1SA 1IRFA 2DQRA 5ILUA 4OINF 3ISPA 5HDKA 3GLXA 4EJWA 3FXRA 5L3EA 4GCVA 1TQIA 2CO5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HV6 A;  1R5G A;  1FSH A;  4DNC A;  1NHA A;  4ZYE A;  5LBQ A;  1Z7U A;  5FD6 A;  3TO6 A;  1OYW A;  2FA5 A;  4KMF A;  4FX4 A;  1IXR C;  3VFZ A;  1FYK A;  3R0J A;  5DEQ A;  2QZ8 A;  1FP2 A;  5BPD A;  1QO0 D;  5FGM A;  2HKO A;  3RI4 A;  4L9N A;  1BBY A;  4P96 A;  3Q5F A;  1MD0 A;  2JRT A;  1Q1H A;  2JPC A;  3EQL F;  2JPB A;  2E7W A;  1A04 A;  1XCB A;  2XKO A;  3VEP A;  1G3Y A;  1H0M A;  2YX4 A;  4L9V A;  3K1N A;  1ZRE A;  3E6M A;  4HDV A;  2A6E F;  2V79 A;  3ZMV A;  3IRQ A;  3DF8 A;  2O0Y A;  3KZZ A;  2ZKZ A;  3ZMZ A;  2K4J A;  3SFZ A;  3ZMS A;  2HYG D;  3F8C A;  5HDG A;  1Z91 A;  4LLG F;  1KU9 A;  2HR3 A;  5HLH A;  3T1B A;  4ENM A;  5D8K B;  1I6X A;  2VE9 A;  3REO A;  4I98 B;  1HST A;  1USS A;  5HDN A;  2DI3 A;  1ZGJ A;  1JE8 A;  1I1G A;  1ZG3 A;  3EYY A;  2P8T A;  2M45 A;  1XSV A;  1W4M A;  5DV5 A;  3I58 A;  2HYF A;  3D0S A;  4L9T A;  1ZRF A;  5CVI A;  5H6R A;  1FYM A;  2ZFW A;  2ZNY A;  2PMU A;  1Y0U A;  4EM2 A;  3CUQ B;  1AWC A;  4LK1 F;  5ICG A;  1XD7 A;  3G3Z A;  2IA2 A;  2MBF A;  2XAF A;  3F8F A;  1JHF A;  1IXS B;  3QAH A;  3WG9 A;  1STZ A;  4H0E A;  3AAF A;  4FX0 A;  4I7H A;  5LEJ A;  4EVI A;  3GYH X;  1K78 A;  2PFB A;  4P9F A;  3T0Y A;  2R7D A;  3ERE D;  4XSZ F;  1F5T A;  4S04 A;  4B09 A;  2HGC A;  3T8R A;  1HW5 A;  1UCR A;  4LLN A;  4FHT A;  3GW2 A;  5HLI A;  5IT9 Z;  2LSO A;  4IVN A;  5E1X A;  3D5L A;  1R00 A;  3CJN A;  3O6B B;  1ZAR A;  4LB5 A;  3QOP A;  2YSR A;  5FO5 A;  2NAZ A;  4XLN F;  1SD7 A;  4Q5S F;  2FE3 A;  4CHU A;  3HRU A;  4FT8 A;  3T8T A;  3QPH A;  1O7F A;  1WI9 A;  3VOE A;  2A07 F;  3RTR A;  2UZK A;  4I02 A;  1BJA A;  1Z6T A;  3BPX A;  5DCM A;  2F5D A;  5L3G A;  5L3B A;  1D8K A;  1IN6 A;  1YW7 A;  3M8E A;  5E17 F;  1U5T A;  1ZN2 A;  5FB2 A;  4Q48 A;  1O3Q A;  1ZYR F;  1HW2 A;  4NB5 A;  2BGC A;  4I09 A;  3KEO A;  3GWZ A;  3U2R A;  4UV8 A;  3J7A O;  3IRR A;  3RIR A;  1CGP A;  2OD5 A;  1UB9 A;  3QP5 A;  2YPR A;  4PDK A;  4EV0 A;  2PMH A;  5AIP A;  2H27 A;  3J80 K;  2EK5 A;  3ZQ7 A;  1XDS A;  4QWQ A;  4B8X A;  2QYO A;  1YYV A;  4WXC A;  1MDM B;  1T38 A;  2AS5 F;  3DEU A;  1XGM A;  5CVV A;  1REP C;  2ESN A;  3R4K A;  3C7J A;  4HF1 A;  3N4M A;  1GVJ A;  1ON2 A;  5L3D A;  3M7G A;  4MTD A;  3KP3 A;  3K69 A;  4R79 A;  3CDH A;  4OMY A;  1FLI A;  4G6D A;  4KIF A;  3RPU A;  4HAM A;  1C0W A;  3QU6 A;  2YX7 A;  4KMU X;  1B9M A;  3GVA A;  3KCC A;  4RGR A;  3HIF A;  3WGH A;  2W85 A;  3RPQ A;  1LVA A;  1Z1D A;  3HSR A;  5DYM A;  2FQ3 A;  2H94 A;  2A6H F;  2VC0 A;  3KE2 A;  3T5X A;  1YG2 A;  5ED4 A;  3LST A;  4LB6 B;  2VT2 A;  4XRF A;  4IRI A;  5F6F A;  2F5F A;  2FNP A;  3JSP A;  1XGS A;  2ISZ A;  2FNA A;  4OIR F;  1JHH A;  2P6T A;  3OOP A;  4UNO A;  1FBU A;  4KIC A;  4Q47 A;  3M8F A;  2B0L A;  1HSJ A;  1LJ9 A;  4U7B A;  2BBY A;  4CIC A;  1B59 A;  4RB2 C;  3OV8 A;  1S7O A;  1V4R A;  2F5C A;  1XSD A;  4ZH4 F;  5E1Z B;  5LLQ A;  1RNL A;  5H20 A;  3ZMU A;  5DDG A;  1ZRD A;  1FP1 D;  3WTY C;  3IHU A;  3PQJ A;  2F2E A;  4A2U A;  5DCF A;  1S29 A;  1TTY A;  3WTZ A;  4A0Z A;  4PGG A;  4AD9 A;  1WWX A;  4JQF A;  4EJO A;  2E7X A;  3F8N A;  2XAS A;  3F72 A;  4ESB A;  3P9K A;  4EJV A;  4RB0 A;  2DPD A;  1P6R A;  1SMT A;  2EV0 A;  5BOX A;  3E5U A;  3ULQ B;  2RVC A;  2RKH A;  1B6A A;  2GXB A;  1SD5 A;  1TLH B;  2ZBK A;  4ESJ A;  1U5T B;  3LFK A;  2C6Y A;  2ZXJ A;  2VC1 A;  2V6C A;  3L00 A;  5D4R A;  2Z99 A;  3W6J B;  3M1E A;  1TQP A;  3J80 Z;  4M73 A;  1YW9 A;  2XIG A;  1LNW A;  3LA3 A;  3E6D A;  4CYD A;  3TQN A;  3COA C;  1U78 A;  2ACJ A;  5A2Q Z;  3ZPL A;  2NNY A;  3FXQ A;  3IWF A;  2JTV A;  2BE5 F;  4HV5 A;  2A3S A;  2W24 A;  3F21 A;  1HKS A;  4G9Y A;  5H6Q A;  3BP8 A;  3DV8 A;  1G6N A;  2HQR A;  2RNJ A;  1J59 A;  2WTE A;  5LHI A;  4OIP F;  1J2X A;  2COM A;  5E8I A;  3F22 A;  1D3Y A;  3FMQ A;  2IA1 A;  1ZG5 A;  3EUH A;  5DUI A;  1R36 A;  1FYL A;  1IUY A;  1T39 A;  4D0P A;  1F9N A;  3ROU A;  2XVC A;  1BM9 A;  3HSE A;  2MLG A;  1E17 A;  5LGT A;  5LRS A;  3WTS C;  2UXN A;  4IRH A;  4M6Y A;  1MZB A;  3HRT A;  1ZRC A;  3GX4 X;  2OU2 A;  3F3X A;  4M9X A;  2VT3 A;  1HW1 A;  4GYI A;  2AXL A;  4I2O A;  4XBF A;  2XUB A;  4UVB A;  4HOB A;  5D5V B;  2DQL A;  2H6C A;  3WE3 A;  2XAH A;  4U0W A;  4BHB A;  2XAG A;  4CO8 A;  4KIG A;  2ZNZ A;  1J7K A;  5TJJ A;  1U2W A;  2XRO A;  4Y13 A;  1TW3 A;  1W5S A;  1O3T A;  2FF4 A;  3MZY A;  1MDM A;  4O3M A;  3RYP A;  2HFH A;  1EH8 A;  1HQC A;  4GXO A;  1ZG1 A;  3J81 K;  1RI7 A;  4S05 A;  2YR2 A;  3B73 A;  4K2E A;  2RC4 A;  2IW5 A;  2JT1 A;  1MJ9 A;  4AIH A;  5L3C A;  1OYI A;  2VBW A;  1SFU A;  2CGP A;  2NNN A;  4WF2 A;  4A0Y A;  4HQM A;  2CW0 F;  1LEB A;  3H3Z A;  4OMZ A;  4HYE A;  2HQN A;  2STW A;  4P9U A;  1OPC A;  1FNN A;  2A5Y B;  3MZH A;  4L18 B;  2M1B A;  2X4H A;  1W7P B;  1PDN C;  4G7H F;  1DDN A;  3HSF A;  2IT0 A;  2Y75 A;  2K02 A;  3C18 A;  4RAY A;  3RKY A;  1H9T A;  2P5V A;  3MEX A;  5BMZ A;  3WOD F;  2P7V B;  3LA2 A;  4CDG A;  3I5U A;  1GHC A;  2IPQ X;  5CLS A;  2EFQ A;  4MQ9 F;  2MH9 A;  2PQ8 A;  2NYX A;  1YS6 A;  1XB4 A;  3TDZ C;  2Y0M A;  3RKX A;  4ENJ A;  1J5Y A;  4EQQ A;  2CG4 A;  2O03 A;  4YFX F;  3GO5 A;  1GXQ A;  5K5Q A;  3DPL C;  1K79 A;  2J5P A;  2CWE A;  1D8J A;  1LDK B;  2PN6 A;  3WTX C;  3ZMT A;  4U88 A;  4L5I A;  2WV0 A;  3Q9S A;  1MKM A;  2GXG A;  1SFE A;  5ICC A;  2QEN A;  3HHG A;  2EFN A;  4M72 A;  1PP8 F;  3RYR A;  1W5T A;  1G3W A;  3E6C C;  1KU3 A;  1WSU A;  5KK1 A;  4LLL A;  3P9I A;  3MWM A;  2CQK A;  5J6X A;  4A5M A;  4M9S A;  4UVA A;  3EDP A;  2DLL A;  1P92 A;  2RQP A;  2ADU A;  2OQR A;  1UST A;  3FM5 A;  4XSX F;  4A12 A;  4M71 A;  4WXD A;  1YQA A;  5DUK A;  4KNY A;  1ZAO A;  4HLX A;  1IW7 F;  2K4B A;  5JHU A;  2WC2 A;  4ZYG A;  4LD5 A;  3V4G A;  4E70 A;  1XGN A;  4P5O A;  5D5W B;  3HHH A;  1KU2 A;  1X3U A;  3ZN0 A;  2VOD A;  1MJB A;  2W25 A;  1IZ1 A;  5A2Q K;  3PQK A;  4RGX A;  5D5X B;  2RV8 A;  1ZHF A;  4YG2 F;  3R61 A;  3JTG A;  4HX8 A;  1XDU A;  3LA7 A;  2IA0 A;  1FX7 A;  1IN7 A;  4BH9 A;  1EH7 A;  4Q4Z F;  1SD4 A;  4MNU A;  1R1T A;  4L9J A;  4G7Z F;  3LAP A;  4WWC A;  3E3V A;  1KGS A;  1TW2 A;  2QBY B;  2M8E A;  4Y15 A;  2FRH A;  1EH6 A;  3GFI A;  1F4K A;  1ON1 A;  4RGU A;  1BI0 A;  2OZ6 A;  2R7F A;  2ETH A;  4KFC A;  1Z9C A;  1ZLJ A;  3WTT C;  1BOA A;  5BPI A;  4IHS A;  1BN5 A;  2EJR A;  1Z05 A;  3HOS A;  4EGY A;  1QPM A;  1V3F A;  1ULY A;  1KQ0 A;  3F6V A;  3ML6 A;  3FZV A;  1G3S A;  1DPR A;  5L3F A;  2G9W A;  3BDD A;  5D6F A;  2DK8 A;  1HKT A;  5E18 F;  1J0R A;  3SZP A;  1OMI A;  1BI1 A;  4EM0 B;  4CZZ A;  1HBX G;  4Y17 A;  2FSW A;  2UXX A;  4BYY A;  5HS8 A;  1F1Z A;  2L3D A;  3IL2 A;  5D6E A;  4ZYH A;  1T2K A;  4I01 A;  3IWZ A;  2XKP A;  4HF0 A;  2Y48 A;  2FBH A;  4AIK A;  1WQ2 A;  3IC7 A;  5AIQ A;  2HWV A;  3ZN1 A;  4ASN A;  1FY7 A;  1E2X A;  2H09 A;  1IAW A;  1XN7 A;  4O5V A;  1S6L A;  3QP6 A;  1P4W A;  4R1H A;  3K2Z A;  3BJO A;  3BZ6 A;  1LQ1 A;  1LDD A;  1PP7 U;  5JFR A;  4HBL A;  3V8L A;  2JZY A;  3BRO A;  1EV7 A;  1LB2 A;  4OOI A;  1O7L A;  5HOO A;  1D5V A;  4QLC U;  3WU0 A;  2FBK A;  4YII A;  2O61 A;  4AVP A;  2EFP A;  1O3S A;  3TOA A;  4RGS A;  1T0F A;  2HTS A;  2M87 A;  2YU3 A;  3DQV C;  4EM1 A;  4OIO F;  5CJ9 A;  3N97 A;  4IXA A;  4YIF A;  3JAM Z;  3WTW C;  1FZP B;  4HW0 A;  3DKW A;  2Z9O A;  2EV5 A;  5FFZ A;  4O6J A;  3SHF A;  3F8M A;  2DFI A;  4F7Z A;  1FBS A;  1KYW A;  3WTV C;  1K78 B;  2VON A;  2X0L A;  2KIF A;  3BJ6 A;  4L0Z B;  2ZO4 A;  2VN2 A;  3GF2 A;  2L02 A;  1KQ8 A;  1IXC A;  4HDU A;  2IP2 A;  2PJP A;  1WKM A;  4ENN A;  2EWN A;  2K27 A;  2D1H A;  1MJA A;  3GFL A;  2J5O A;  3FHZ A;  4MEY F;  1IF1 A;  3CLO A;  1O3R A;  3E5X A;  2Z3Y A;  1SAX A;  1OR7 A;  5E8G A;  3BWG A;  4ZZL A;  3FM3 A;  5DD8 A;  4RS8 A;  4A5N A;  3KP6 A;  2EB7 A;  3O3K A;  3BPV A;  4U0V A;  3IKT A;  3I54 A;  2V1X A;  2PEX A;  2M5W A;  1R58 A;  2V1D A;  2EA2 A;  3SQN A;  3F6O A;  3VOD A;  4GYG A;  4A0X A;  2NRA C;  4M9Z A;  3CUQ C;  4ON0 A;  5BQT A;  3I59 B;  3L2C A;  3RKW A;  2L4M A;  1XMA A;  2DO7 A;  3FMR A;  5FD5 A;  2FOK A;  4KIB A;  4A6D A;  1CF7 A;  4ETS A;  2RDP A;  2DAO A;  1YW8 A;  3KLN A;  4NQW A;  1KYZ A;  3TGN A;  2O8X A;  1B1B A;  3V7S A;  1G3T A;  4LG0 A;  3B02 A;  1R23 A;  2XV4 S;  2F5E A;  4JK1 X;  1S3J A;  4WCG A;  1YTY A;  3KEQ A;  2OA4 A;  3KZY A;  1B4A A;  1MGT A;  2KKO A;  3I4P A;  5TRD A;  2P5L C;  1SMY F;  3SZT A;  2FBI A;  1I27 A;  5FLX K;  3BJA A;  3FXU A;  2HS5 A;  2L4A A;  4NHJ A;  5LRR A;  3BY6 A;  5HS7 A;  3KP2 A;  1KQ9 A;  4YFN F;  1ZLK A;  4BNC A;  2ISY A;  4LFU A;  1S8N A;  4BHP A;  2D1V A;  1DPU A;  4JBA A;  2GA2 A;  2HDC A;  1J75 A;  1QZZ A;  4EGZ A;  2OBP A;  2PG4 A;  4L0Y B;  5HLG A;  3J81 Z;  2R3S A;  1K7A A;  3H92 A;  4ENK A;  2O3F A;  5D5U B;  1BIB A;  3C3W A;  3G73 A;  5D8L B;  5BS6 A;  4U0Y A;  1I5Z A;  2BEO A;  3GFJ A;  1R1V A;  1VTN C;  2CFX A;  1SFX A;  1FSE A;  4MTE A;  2KRF A;  2KIU A;  5AON A;  4ZZD A;  1XMK A;  3M9A A;  1B9N A;  1T6S A;  2ESH A;  5JR3 A;  1HXD A;  1R1U A;  5E1W A;  1Z6R A;  2A68 F;  3I64 A;  5K1Y A;  5IT9 K;  3I53 A;  1QZY A;  2TDX A;  4UUV A;  5JVT A;  2EA4 A;  3GZ5 A;  4IPA A;  3NEU A;  3O2P E;  4LGW A;  5FFX A;  1U6G A;  2Z5U A;  1PUE E;  5E20 A;  3V8K A;  3VB2 A;  3TKY A;  2DTR A;  4U7D A;  2QUF A;  1IN5 A;  4UHT A;  3JTH A;  2L54 A;  2DW4 A;  5LEK A;  2DU9 A;  3F23 A;  4IRG A;  1U8R A;  2XHK A;  2G7U A;  3TDU C;  2Q0O A;  2P7C B;  4PCQ A;  1OYY A;  1QQI A;  1H9G A;  2W84 A;  5CVR A;  1QNT A;  2XGX A;  1W7P D;  2D2W A;  4HA8 A;  5K5O A;  2DPU A;  3CUO A;  3E6B A;  3CO7 C;  1K6O A;  2RN7 A;  3EET A;  2XAQ A;  3HTU A;  2Z33 A;  4KDP A;  1R7J A;  3V7R A;  1GXP A;  4YFK F;  3GFM A;  3KP4 A;  2CSO A;  2XRN A;  2V9V A;  1QGP A;  3PFI A;  2RGV A;  2VBY A;  3QRF F;  4LMY A;  5ICE A;  3WTU C;  2QBY A;  5F1R A;  3IKV A;  4UVC A;  4GO1 A;  3WGI A;  1L3L A;  1TNS A;  4MHG A;  3ZMD A;  4P55 A;  1BI2 A;  3DFG A;  3Q9V A;  1U5T C;  4HLY A;  1U3E M;  4BXU A;  1S7A A;  2ZCW A;  4ZYD A;  4CXF A;  4EJU A;  5IT3 A;  1CF7 B;  4R8H A;  1TNT A;  2PBI A;  3MAJ A;  1FT9 A;  4BQA A;  2ELH A;  3DP7 A;  4N9I A;  5DD4 A;  1YLF A;  3E5Q A;  5LHH A;  3EYI A;  3RDI A;  4MGR A;  5LGN A;  3JAM K;  3E97 A;  5J8C A;  2DT5 A;  2BYV E;  4AIJ A;  4N9H A;  4HX4 A;  1XCV A;  4AWX B;  3W6K B;  4LJZ F;  3K1P A;  2QQ9 A;  3KP5 A;  2KIM A;  3I71 A;  3R60 A;  4XLP F;  4MEX F;  2GA1 A;  3WU1 B;  2OZU A;  2GIV A;  4L5J A;  1W7P A;  1FC3 A;  3RJP A;  2LF7 A;  3LQQ A;  2VBX A;  3KP7 A;  3HRS A;  4TV7 A;  2A61 A;  4OU0 A;  2IRF G;  5CYV A;  2HKX A;  2CYY A;  3V8J A;  1R5H A;  5F64 A;  1UHM A;  4HZF A;  3ELK A;  5JI6 A;  2P4W A;  1ODD A;  2P5K A;  5KVR A;  2O6G E;  1YIO A;  2KJB A;  3JSO A;  1FOK A;  3TO9 A;  4KT5 C;  2WWY A;  5J8F A;  3S2W A;  2K7L A;  1KA8 A;  5EEG A;  5EEH A;  1TQM A;  2ZME A;  1YFH A;  3L7W A;  3JW4 A;  3LQR A;  2LKP A;  3V7C A;  3GZ6 A;  3HYI A;  4OIQ F;  2EFW A;  2OAZ A;  1R22 A;  4LG0 B;  3C1D A;  2OQG A;  3QU3 A;  3U1D A;  1XSX A;  1IN8 A;  5ILS A;  2QQA A;  5CVJ A;  3K9T A;  3ABU A;  1QBJ A;  3P7N A;  2FML A;  3WE2 A;  1AOY A;  3HRM A;  2JSC A;  2VOO A;  4KA4 A;  3GEZ A;  3ECH A;  4WXH A;  3FX3 A;  3QPT A;  1WRJ A;  2DK5 A;  2DBB A;  2GZW A;  1UHW A;  2HOE A;  1HKQ A;  1T98 A;  3CO6 C;  4KYW A;  4BHC A;  1BI3 A;  1P4X A;  3DXJ F;  4PZJ A;  4EMS A;  1DUX C;  2PLY A;  1XGO A;  2LNB A;  3I0T A;  2E1N A;  2STT A;  3FF5 A;  3FWE A;  2GWR A;  3GUD A;  2V1U A;  5DCM B;  3KLO A;  5CVU A;  2E1C A;  2VE8 A;  5ILV A;  2W57 A;  3P9C A;  1FBQ A;  1FPQ A;  2XAJ A;  4HF2 A;  2MH2 A;  3K0L A;  2QM3 A;  3CUQ A;  1YO5 C;  3I59 A;  1G4D A;  2A69 F;  2ZME B;  3H3U A;  4WK8 F;  2ZJ2 A;  2BV6 A;  2GAU A;  4RB3 C;  2MC3 A;  4WX9 A;  3KET A;  5ERI A;  3TOB A;  1BC8 C;  4KN7 X;  1IN4 A;  3HUG A;  3TO7 A;  1RZ4 A;  4EJT A;  2KJC A;  4G8X A;  3R0A A;  3SXY A;  4DQ2 A;  4KUM A;  2K86 A;  5ICF A;  3MCZ A;  4I0A A;  4LK0 F;  4UV9 A;  3LAJ A;  2L01 A;  3NRV A;  1RIO H;  1O57 A;  4Z2Y A;  1DP7 P;  2FU4 A;  3GXO A;  1RUO A;  1P4A A;  4ESF A;  4G6Q A;  2HZT A;  3HTS B;  2MLK A;  4PGH A;  2HTJ A;  2LDU A;  2IJL A;  1BIA A;  2D45 A;  4UXN A;  4MQV A;  3ECO A;  4RB1 A;  1ZH5 A;  2VXZ A;  2MA3 A;  2FEZ A;  3R6S A;  1BC7 C;  4BAY A;  4CGZ A;  3ABT A;  3MFK A;  3LWF A;  3DPT A;  5HVQ C;  1TBX A;  3MQ0 A;  2P6S A;  4G7O F;  2FXA A;  5K5R A;  3CTA A;  2Q8K A;  2MD5 A;  3U9G A;  2QVO A;  2Q2E A;  3BOQ A;  4HX7 A;  1P2F A;  1UFM A;  2UWM A;  2QWW A;  4M6X A;  5D4S A;  2G7H A;  3WGG A;  2VBZ A;  5HS9 A;  1JGS A;  1ONV A;  2H6B A;  1SD6 A;  4IHT A;  1JXS A;  1OKR A;  4GGG A;  3L09 A;  2GQQ A;  1FWZ A;  5LGU A;  2EV6 A;  4I0B A;  5LHG A;  2PI0 A;  3ZP5 A;  3KFW X;  2VOP A;  4M74 A;  4N0B A;  2NS0 A;  4RAZ A;  4G94 A;  2IVM A;  5FLX Z;  4IF4 A;  2EFO A;  1LDJ A;  1L0O C;  3FMS A;  4IJA A;  1ZGA A;  3F8B A;  1IRG A;  4A6E A;  1J9I A;  1RUN A;  3K1M A;  1KU7 A;  2HEO A;  2LF8 A;  2M30 A;  4KN4 X;  2QLZ A;  3HOT A;  3L9F A;  2FMY A;  2QQB A;  1LEA A;  6PAX A;  4HQE A;  1YS7 A;  3NQO A;  1I1S A;  1IRF A;  2DQR A;  5ILU A;  4OIN F;  3ISP A;  5HDK A;  3GLX A;  4EJW A;  3FXR A;  5L3E A;  4GCV A;  1TQI A;  2CO5 A; 
#chains in the Genus database with same CATH topology
 2XF5 A;  1R5G A;  4HV6 A;  1S9H A;  1FSH A;  2K3P A;  3A1Y A;  4DNC A;  1G8X A;  1NHA A;  4XL9 A;  4ZYE A;  2AQF A;  3MKW B;  5LBQ A;  1Z7U A;  2V4J C;  5FD6 A;  3B6C A;  3TO6 A;  2QF7 A;  1OYW A;  5IY5 H;  2FA5 A;  3BR2 A;  3ABM H;  4KMF A;  4FX4 A;  3A0B C;  1IXR C;  3HC7 A;  3VFZ A;  1FYK A;  3R0J A;  5DEQ A;  2QZ8 A;  1FP2 A;  5BPD A;  1UEL B;  1QO0 D;  2O7O A;  3NAU A;  3OYN A;  5FGM A;  5B1B H;  2HKO A;  2FUG 2;  3RI4 A;  3OYG A;  4L9N A;  1VFC A;  1BBY A;  4P96 A;  4Y7N J;  1QVT A;  3Q5F A;  2OTJ I;  4IZZ A;  1MD0 A;  2JRT A;  1Q1H A;  2BZT A;  3D1N I;  2JPC A;  3EQL F;  4Z6Y A;  3K4J A;  2VJ4 A;  2JPB A;  2IGO A;  2E7W A;  2LLK A;  1A04 A;  1XCB A;  3ZQG A;  2XKO A;  3VEP A;  1G3Y A;  3CCU I;  5M3F J;  1H0M A;  2YX4 A;  4L9V A;  5KAI C;  3K1N A;  1ZRE A;  3E6M A;  4HDV A;  4UY8 I;  2A6E F;  1WCM J;  4DZP A;  1GT0 C;  2V79 A;  3ZMV A;  2MYS A;  2LKX A;  2NVY J;  2YS9 A;  3IRQ A;  3DF8 A;  3ERM A;  2O0Y A;  3KZZ A;  2ZKZ A;  3ZMZ A;  2K4J A;  2ZJR F;  3SFZ A;  3ZMS A;  2HYG D;  1ORK A;  3F8C A;  5HDG A;  4Y4R A;  4XN3 A;  1Z91 A;  4KJZ A;  4LLG F;  4E4H A;  2ZXW H;  4XLH A;  4B43 A;  1KU9 A;  1JT0 A;  3KX2 A;  1VQN I;  1WHU A;  2HR3 A;  3PSI A;  5HLH A;  2R7Z J;  5FJ8 J;  3PO2 J;  3T1B A;  4ENM A;  5D8K B;  3Q0W A;  1I6X A;  3LNQ A;  3REO A;  2VE9 A;  4I98 B;  1HST A;  1H89 C;  4NDL A;  1XPX A;  2DYR H;  1USS A;  1LFB A;  5B5E C;  5HDN A;  2DI3 A;  3OYF A;  1ZGJ A;  1T33 A;  2ECB A;  2DOD A;  1JE8 A;  1I3A A;  3VDX A;  3TP0 A;  2DA6 A;  2LVS A;  2X51 A;  1I1G A;  2CH0 A;  2E5N A;  5KNL A;  3AG1 H;  1ZG3 A;  3EYY A;  2P8T A;  2M45 A;  1XSV A;  3DTI A;  1GV2 A;  3Q3S A;  1W4M A;  5DV5 A;  3U1K A;  2PJR A;  1RRJ A;  1PUF A;  3DU5 A;  4KIT B;  1OFC X;  3I58 A;  5FKN A;  2HYF A;  3D0S A;  4L9T A;  1ZRF A;  2R7O A;  5CVI A;  5H6R A;  1FYM A;  2ZFW A;  4PSX A;  2ZNY A;  2PMU A;  1Y0U A;  2XPU A;  4EM2 A;  3CUQ B;  1AWC A;  2XSD C;  3A03 A;  1PVE A;  4PJM A;  4M6V A;  4LK1 F;  5ICG A;  3K4B A;  4A3K J;  1XD7 A;  4D1Q A;  3WHB A;  3BR0 A;  2JVH A;  4UUS A;  2CQX A;  2BHZ A;  1S7E A;  4C2M J;  3G3Z A;  3S14 J;  2IA2 A;  3BG7 A;  1MSE C;  1MND A;  2MBF A;  2XAF A;  3F8F A;  1JHF A;  3OWT A;  5F0F A;  3BG5 A;  1WJB A;  1IXS B;  3QAH A;  2CFO A;  3L2U A;  3WG9 A;  1STZ A;  3IH2 A;  2WV1 A;  3HB9 A;  3VYS B;  3AAF A;  4H0E A;  4FX0 A;  4I76 A;  4I7H A;  5LEJ A;  4EVI A;  1MBG A;  3GYH X;  1GDT A;  2FD5 A;  2JA2 A;  1K78 A;  2PFB A;  4P9F A;  2FOW A;  3T0Y A;  2R7D A;  3CJQ B;  3NWT A;  4XSZ F;  4DYC A;  2MC4 A;  3ERE D;  1JTX A;  1JTY A;  3FBN B;  1F5T A;  1POG A;  4S04 A;  4IEJ A;  2HGC A;  3T8R A;  1HW5 A;  4B09 A;  1UCR A;  2KRC A;  2QQ8 A;  2EZH A;  4LLN A;  1T95 A;  4FHT A;  3AG2 H;  3GW2 A;  5EYR A;  5HLI A;  2LMD A;  2HDD A;  5IT9 Z;  1X1A A;  2LSO A;  4IVN A;  5E1X A;  3J7Y J;  4F93 B;  2E36 A;  1OQY A;  3D5L A;  2ZJP F;  1R00 A;  5K7F A;  3CJN A;  1TP4 A;  2VIX A;  3O6B B;  1ZAR A;  4LB5 A;  3SEQ A;  3QOP A;  2E1M B;  4PFP A;  2YSR A;  2HQA A;  4B4C A;  5FKK A;  5FO5 A;  2NAZ A;  4XLN F;  1SD7 A;  4Q5S F;  2FE3 A;  4CHU A;  1E0E A;  1ZTR A;  3HRU A;  4FT8 A;  3T8T A;  3W2V A;  3QPH A;  1O7F A;  2F4O B;  1GVD A;  1WI9 A;  4AU7 A;  3VOE A;  2A07 F;  1BA5 A;  3M3Y J;  3RTR A;  2UZK A;  1JI8 A;  3GZN B;  2QA4 I;  3VYR B;  4I02 A;  1BJA A;  4CYC A;  1Z6T A;  3OS2 A;  3HBL A;  3BPX A;  5DCM A;  2WAF A;  1KON A;  2F5D A;  2R0Q C;  2IS2 A;  5L3G A;  5L3B A;  1D8K A;  1IN6 A;  1YW7 A;  3J7Z I;  3M8E A;  3CJT B;  3JR9 A;  2DJN A;  2ECC A;  3OYB A;  1U5T A;  5E17 F;  1ZN2 A;  2D5V A;  5B1A H;  5FB2 A;  4Q48 A;  3SYT A;  1OCR H;  1O3Q A;  1ZYR F;  1HW2 A;  1XX5 A;  1G59 A;  1H8A C;  2QCO A;  4NB5 A;  2BGC A;  3BTI A;  2IAI A;  4I09 A;  3OL4 A;  3KEO A;  3GWZ A;  1G2H A;  3U2R A;  4UV8 A;  5B3S H;  1IO2 A;  2LRE A;  3ONQ A;  3LSP A;  3CC2 I;  2VKV A;  2OUM A;  2WY7 Q;  3J7A O;  3IRR A;  3RIR A;  5KHD A;  1P7J A;  1E3P A;  2DA7 A;  2BW3 B;  1CGP A;  4V2F A;  2CRG A;  2OD5 A;  1HLV A;  4D5C A;  1A6Q A;  3S16 J;  1UB9 A;  3ZQH A;  3QP5 A;  2YPR A;  4XRM A;  5B66 C;  4PDK A;  2ZB9 A;  4EV0 A;  3OMY A;  2PMH A;  5AIP A;  1MIJ A;  2H27 A;  3J80 K;  2R5Y B;  2EK5 A;  3PJR A;  2EIK H;  3ZQ7 A;  1XDS A;  4QWQ A;  4B8X A;  3G1L A;  4JOM A;  3PIO F;  2QYO A;  1YYV A;  4WXC A;  3IUO A;  2E1M C;  1MDM B;  1T38 A;  3BG9 A;  1D1A A;  3E1S A;  2AS5 F;  4A3G J;  1RET A;  3DEU A;  3BLY A;  4XN0 A;  3PM1 A;  5EF6 A;  1XGM A;  5CVV A;  1REP C;  2ESN A;  3R4K A;  3C7J A;  4HF1 A;  2GBY A;  3N4M A;  4CSW A;  4BDZ A;  1GVJ A;  1B8I A;  2MSY A;  1ON2 A;  4HST A;  5L3D A;  3M7G A;  3HOV J;  1OCP A;  4MTD A;  2HXO A;  3KP3 A;  3K69 A;  4R79 A;  3CDH A;  2ME6 A;  4OMY A;  1FLI A;  4BU2 A;  1RKT A;  2CQQ A;  4G6D A;  4KIF A;  1KZH A;  3FXJ A;  3RPU A;  2O5R A;  1VQO I;  1S5L C;  3P5J A;  4C9Y A;  4HAM A;  3OIP A;  1C0W A;  3QU6 A;  2YX7 A;  4KMU X;  1B9M A;  3GVA A;  4F92 B;  3KCC A;  3FHN A;  4RGR A;  3HIF A;  3LOC A;  3WGH A;  4FE7 A;  2L5Q A;  2W85 A;  3RPQ A;  4B3X A;  1LVA A;  1Z1D A;  3HSR A;  5DYM A;  2FQ3 A;  2H94 A;  2A6H F;  2VC0 A;  2ZSH B;  1WGX A;  3KE2 A;  3T5X A;  1ZEL A;  1FJL A;  2BY2 A;  1YG2 A;  3DEW A;  4J01 A;  5ED4 A;  3LST A;  4LB6 B;  5EGO A;  1N75 A;  2VT2 A;  1VZ0 A;  4XRF A;  4IRI A;  5F6F A;  1RKW A;  2F5F A;  2FNP A;  3JSP A;  1XGS A;  2ISZ A;  2FNA A;  4OIR F;  3BZK A;  2JQ7 A;  3HGY A;  5F0C A;  4I6Z A;  1JHH A;  2P6T A;  3OOP A;  5EZH A;  4BEH B;  5EZG A;  4UNO A;  1FBU A;  2DT6 A;  4KIC A;  4Q47 A;  2FX0 A;  3M8F A;  2ZSI B;  1U0J A;  3GBG A;  4NUB A;  2B0L A;  1HSJ A;  1LJ9 A;  4U7B A;  1B72 A;  2MD0 A;  2BBY A;  4CIC A;  1ETO A;  1B59 A;  4RB2 C;  3OV8 A;  1S7O A;  1V4R A;  2Z16 A;  2F5C A;  4RM3 A;  1XSD A;  5CQG A;  2JRM A;  4ZH4 F;  1K4T A;  5E1Z B;  5LLQ A;  1RNL A;  2ZME C;  3S1R J;  4A93 J;  5H20 A;  3FIS A;  3ESW B;  1F36 A;  2DA2 A;  3ZMU A;  5DDG A;  2NS7 A;  1D1B A;  1ZRD A;  1FP1 D;  3WTY C;  2X6X A;  1ZR4 A;  5E3N A;  3OYI A;  3IHU A;  3PQJ A;  2LTP A;  3BCB A;  2F2E A;  4A2U A;  5DCF A;  1Z67 A;  1S29 A;  1TTY A;  2R5Y A;  3WTZ A;  3CDI A;  1HDP A;  3BR5 A;  2KIS A;  3CCJ I;  4A0Z A;  1YX3 A;  2OCE A;  4XR6 A;  3FKJ A;  4PGG A;  4AD9 A;  3RQ4 A;  1WWX A;  3QOE A;  2BOL A;  4JQF A;  4EJO A;  2E7X A;  4AUX A;  3F8N A;  3GTO J;  2XAS A;  3F72 A;  1MMG A;  4ESB A;  3P9K A;  4EJV A;  2DMT A;  3K10 A;  3C2H A;  3S2H J;  2M2E A;  4NC7 A;  4RB0 A;  2I8D A;  4DBQ A;  3L2V A;  2R7R A;  1P6R A;  2DPD A;  1SMT A;  2K9S A;  2EV0 A;  4RM2 A;  5BOX A;  1R6R A;  3HG9 A;  3E5U A;  3ULQ B;  2RVC A;  2RKH A;  1B6A A;  3AFH A;  2GXB A;  1SD5 A;  1TLH B;  4E7L A;  2WAQ N;  2ZBK A;  2YU9 J;  5GAH J;  4ESJ A;  3JRF A;  3DBR B;  2TRT A;  2Y30 A;  1U5T B;  3LFK A;  2C6Y A;  2ZXJ A;  2CMP A;  2W82 A;  2VC1 A;  2V6C A;  3CCE I;  3L00 A;  3UNG C;  2HYJ A;  5D4R A;  2Z99 A;  3W6J B;  3M1E A;  1TQP A;  1B72 B;  3J80 Z;  3VSK A;  1UJ8 A;  2JMW A;  4M73 A;  1VQ8 I;  2VLA A;  1YW9 A;  2XIG A;  3WHC A;  1LNW A;  2F6C A;  4C30 A;  2LK2 A;  1NTC A;  3LSM A;  3LA3 A;  5FRO A;  3E6D A;  3HDD A;  1YRN A;  3HXL A;  4CYD A;  1QA6 A;  3TQN A;  3ZCO A;  3COA C;  1U78 A;  4G6T B;  3FDY A;  2ACJ A;  5A2Q Z;  3ZPL A;  2Y31 A;  2NNY A;  2XC7 A;  5GP9 A;  3FXQ A;  3LL7 A;  2DT7 B;  3IWF A;  5J1U A;  2R5Z B;  2JTV A;  2K9L A;  2BE5 F;  4HV5 A;  4ZC3 A;  2YUS A;  2A3S A;  1BR2 A;  1GUU A;  2W24 A;  3PFY A;  1VQP I;  1IV8 A;  3F21 A;  1WJ5 A;  4B1R A;  3D5S C;  1HKS A;  4G9Y A;  1FOY A;  5H6Q A;  2VJI A;  3CF2 A;  3BP8 A;  3DV8 A;  2M9H A;  1G6N A;  2HQR A;  2DA3 A;  2B7E A;  4YEJ A;  1U8B A;  3H1C A;  2RNJ A;  4A3E J;  1J59 A;  2WTE A;  5LHI A;  4OIP F;  1J2X A;  2COM A;  3VSL A;  5E8I A;  3F22 A;  1D3Y A;  3HEF A;  1RR8 C;  1WJD A;  1Z3Y A;  2X6W A;  1E3H A;  4OAZ A;  3FMQ A;  3OYE A;  1QVU A;  5EGO B;  2IA1 A;  1ZG5 A;  2WAQ A;  4GFB A;  2HU9 A;  1U9N A;  3EUH A;  5DUI A;  1R36 A;  1FYL A;  2DMP A;  1IUY A;  1T39 A;  2CUF A;  4JYK A;  4EAT A;  3IAS 2;  2IBD A;  1IGN A;  4D0P A;  1F9N A;  1ETK A;  3ROU A;  3FXO A;  4DYR A;  4XLF A;  1LE8 B;  2XVC A;  2KIQ A;  2CW7 A;  2JA6 J;  4CH7 A;  1BM9 A;  3HSE A;  2MLG A;  4E7S A;  2EIL H;  1E17 A;  5LGT A;  2OC6 A;  5LRS A;  3WTS C;  2UXN A;  4IRH A;  3K7A J;  3KYD B;  4M6Y A;  1MZB A;  2LBF B;  3HRT A;  2M0M A;  1SVO A;  3GX4 X;  2OU2 A;  3BT9 A;  3F3X A;  1ZRC A;  1JUS A;  4M9X A;  2VT3 A;  1HW1 A;  4GYI A;  1N78 A;  2E35 A;  2AXL A;  4L5E A;  1VQL I;  1XMX A;  4I2O A;  3W3C A;  2XSJ C;  1W36 C;  4XBF A;  2FQ4 A;  2XUB A;  2OJE D;  4UVB A;  4HOB A;  1SVM A;  2GOX B;  4JX4 A;  5D5V B;  2DQL A;  2H6C A;  3WE3 A;  2XAH A;  4F55 A;  2F48 A;  4U0W A;  3PUB A;  4BHB A;  1P7I A;  1WI3 A;  1EA3 A;  3MN2 A;  5JHF A;  2XAG A;  4CO8 A;  4KIG A;  2V9K A;  5K7Z A;  1FTT A;  2K85 A;  2ZNZ A;  2DMU A;  1J7K A;  2I5U A;  3LFU A;  5TJJ A;  1SAU A;  1R49 A;  1U2W A;  2XRO A;  4Y13 A;  2JJ7 A;  1VF9 A;  3M4O J;  2CQN A;  1TW3 A;  3CMY A;  2CV2 A;  4LIU A;  2NS8 A;  2H1L A;  3HM5 A;  4ZYA A;  1W5S A;  4E7H A;  1O3T A;  4DIQ A;  1TWH J;  2FF4 A;  1ETY A;  3MZY A;  1U9O A;  1UG2 A;  1MDM A;  1QPI A;  4O3M A;  3S1N J;  3RYP A;  4YIR X;  2HFH A;  1EH8 A;  4BGD A;  4RA2 A;  3S1M J;  2K9Q A;  1HQC A;  4GXO A;  1ZG1 A;  3J81 K;  1RI7 A;  4S05 A;  2YR2 A;  2BW3 A;  1S72 I;  3CLQ A;  1V5G A;  3B73 A;  1MH4 A;  4FIS A;  4QTR A;  3HKZ N;  4K2E A;  2RC4 A;  5M3M J;  2IW5 A;  2DFH A;  3HOW J;  2JT1 A;  1MJ9 A;  4C2T A;  4AIH A;  4CCN A;  5L3C A;  5E3O A;  3TMO A;  2JUC A;  1OYI A;  1QHH D;  1ETV A;  2VBW A;  1SFU A;  2CGP A;  4IHX A;  2NNN A;  5DS9 A;  4II3 A;  4BDY A;  4ZJZ A;  3CCV I;  4XQF A;  4F52 A;  4WF2 A;  4A0Y A;  4HQM A;  2R7W A;  2CW0 F;  1LEB A;  3H3Z A;  4OMZ A;  1AKH B;  4HYE A;  2HQN A;  2RQQ A;  1M1E B;  2E60 A;  2BY0 A;  3BTL A;  4P9U A;  2STW A;  3EUK L;  1OPC A;  1FNN A;  2A5Y B;  4BE2 A;  3MZH A;  3W2W A;  2XPW A;  4AYB A;  1MH3 A;  5GAG J;  2M1B A;  4L18 B;  1V5F A;  2X4H A;  1W7P B;  1PDN C;  4G7H F;  1DDN A;  1MBK A;  3HSF A;  3OSG A;  2IT0 A;  2Y75 A;  2GIZ A;  2K02 A;  3C18 A;  4RAY A;  3RKY A;  1H9T A;  3VYU B;  2FJ1 A;  2P5V A;  3MEX A;  5BMZ A;  4XOR A;  3G6E I;  1IG7 A;  3WOD F;  2P7V B;  3GME A;  4S0H B;  3LA2 A;  4CDG A;  3HOU J;  4XKC A;  1WVR A;  5J3L A;  2E2H J;  4ZDO A;  3HPG A;  3I5U A;  1GHC A;  4XIC A;  5GAE J;  2IPQ X;  5CLS A;  2BHY A;  2NOG A;  1PUF B;  2EFQ A;  3RQI A;  5M5W J;  4MQ9 F;  2MH9 A;  3HZJ A;  2PQ8 A;  2LBF A;  4XKB A;  2NYX A;  1YS6 A;  1XB4 A;  1WJC A;  4E7K A;  4CCO A;  3TDZ C;  2Y0M A;  3RKX A;  4ENJ A;  1X2M A;  1ZQ3 P;  1J5Y A;  4EQQ A;  3DLA A;  2CG4 A;  1WFX A;  2O03 A;  4YFX F;  3GO5 A;  1GXQ A;  5K5Q A;  2EIN H;  3DPL C;  5EEA A;  3A0H C;  1K79 A;  2J5P A;  1WH7 A;  2CWE A;  3H5A A;  2MW8 A;  4XRS G;  1FOW A;  1LDK B;  1D8J A;  2PN6 A;  3WTX C;  4CCL A;  2Y9Y A;  3ZMT A;  4U88 A;  4L5I A;  1HF0 A;  4B44 A;  2WV0 A;  3Q9S A;  3EPZ A;  1MKM A;  2GXG A;  2ZJQ F;  3KZI C;  5K7H A;  3LSH A;  3BG6 A;  1OCZ H;  1SFE A;  3O8H A;  1Y1W J;  2L7M P;  2VKH A;  5ICC A;  1DQU A;  3PNT A;  2JA7 J;  2Y69 H;  1Q1V A;  2X6Y A;  2QEN A;  3DTE A;  3HHG A;  3PNY A;  1BOB A;  5J40 A;  5C3E J;  3O8G A;  1CQT A;  3S8P A;  2L7F P;  2EFN A;  3N05 A;  4M72 A;  3KPH A;  3TED A;  4A3C J;  4ZDP A;  1PP8 F;  3RYR A;  4CUG A;  2KQR A;  1W5T A;  5CQE A;  1G3W A;  3E6C C;  1KU3 A;  4M3F A;  5KK1 A;  1WSU A;  4LLL A;  3P9I A;  3MWM A;  2CQK A;  5J6X A;  5IYD J;  4A5M A;  1Z21 A;  4M9S A;  2GXA A;  4UVA A;  4N4N B;  3EDP A;  2Q1Z B;  4D7M A;  2HPM A;  4DBR A;  1OCT C;  2DLL A;  3JRB A;  1P92 A;  2RQP A;  2ADU A;  4HG2 A;  2OQR A;  4JX6 A;  1UST A;  3F0C A;  2PX9 A;  3FM5 A;  4XSX F;  4A12 A;  1NK3 P;  4M3D A;  2RNG A;  5IPA A;  9ANT A;  2L9V A;  4G12 A;  4M71 A;  4WXD A;  1YQA A;  5DUK A;  4A3I J;  2XPV A;  4KNY A;  2DFE A;  1ZAO A;  4HLX A;  1IW7 F;  2K4B A;  5JHU A;  2WC2 A;  4ZYG A;  4LD5 A;  3OYK A;  2F4I A;  3V4G A;  1XGN A;  4E70 A;  4P5O A;  5D5W B;  3CC7 I;  3DKX A;  3HHH A;  1KU2 A;  1TT5 B;  1X3U A;  2KZV A;  1T08 B;  3ZN0 A;  4OAY A;  2VOD A;  2DA5 A;  2L0K A;  4BE0 A;  3S2D J;  1MJB A;  1TZL A;  2W25 A;  2KDO A;  1IZ1 A;  1X3Z B;  2LY9 A;  2DOF A;  5A2Q K;  3PQK A;  4RGX A;  5D5X B;  2RV8 A;  3OYA A;  3ZGK A;  5LFA A;  1W5C C;  1ZHF A;  2X85 A;  4YG2 F;  3R61 A;  3JTG A;  1QU3 A;  1LPQ A;  4HX8 A;  2DOE A;  2DA4 A;  1XDU A;  3LA7 A;  4XON A;  4HNU A;  2VUM J;  1VQ7 I;  2IA0 A;  4PK4 A;  1FX7 A;  1IN7 A;  4BH9 A;  3RKQ A;  1EH7 A;  4PJJ A;  4Q4Z F;  2QSF X;  3H9G A;  1SD4 A;  2DCE A;  4MNU A;  4B47 A;  2B9S A;  2VKD A;  2L9N A;  1R1T A;  1FIP A;  3KYC B;  4L9J A;  2LR8 A;  4G7Z F;  1Z7L A;  1XTA A;  4FCY A;  4MFD A;  2KHM A;  3LAP A;  5GTH C;  4WWC A;  2R5Z A;  2R7T A;  3HOX J;  3OSF A;  2XDV A;  3E3V A;  4F3Q A;  1KGS A;  1TW2 A;  2NVQ J;  1TC3 C;  4DJA A;  2QBY B;  1BW5 A;  2M8E A;  4Y15 A;  2FRH A;  3GTM J;  1HC8 A;  2R92 J;  1YX5 A;  1EH6 A;  2P0W A;  3GFI A;  1F4K A;  2WAE A;  2QGU A;  1ON1 A;  4IOA F;  4RGU A;  1BI0 A;  4V19 K;  2OZ6 A;  3BZC A;  3LMM A;  1SEU A;  2CUJ A;  4CZC A;  1N77 A;  2R7F A;  2ETH A;  2XGC A;  1D0X A;  3ZQL A;  2LC2 A;  2W1O A;  4KFC A;  3CCM I;  2DOA A;  1Z9C A;  1YIJ I;  1ZLJ A;  3DBH B;  2M34 A;  3WTT C;  1A31 A;  1BOA A;  5C44 J;  5BPI A;  2M4K A;  4FQG A;  3TW6 A;  1A36 A;  4IHS A;  3BR1 A;  1BN5 A;  2H8R A;  1W1W E;  1W0T A;  2EJR A;  4KT6 A;  5HLT A;  2CV0 A;  1DGW Y;  1Z05 A;  3TP3 A;  4HSR A;  5C4J J;  3HOS A;  4EGY A;  1QPM A;  1ZK8 A;  5J4V A;  2HQ5 A;  1V3F A;  1ULY A;  1KQ0 A;  3F6V A;  3ML6 A;  4XLC A;  3FZV A;  1G3S A;  2DMN A;  1O4X A;  1DPR A;  3FIW A;  5L3F A;  2G9W A;  3BDD A;  5D6F A;  2VQL A;  2L7K A;  3OY9 A;  2IGK A;  1YJN I;  2DK8 A;  1HKT A;  5E18 F;  2LD5 A;  1J0R A;  4Y33 A;  3SZP A;  1OMI A;  1BI1 A;  2W00 A;  4AM3 A;  4J19 A;  4EM0 B;  4CZZ A;  1HBX G;  2HDW A;  1IRX A;  4Y17 A;  2FSW A;  2UXX A;  4BYY A;  5HS8 A;  1F1Z A;  2Y0S N;  2PMZ A;  1TWA J;  3DKY A;  1R4N B;  1TT0 A;  1VQM I;  2L3D A;  3IL2 A;  3J7A Y;  5D6E A;  1T56 A;  4ZYH A;  1T2K A;  4I01 A;  4UUT A;  1Z0X A;  4NC8 A;  3IWZ A;  2LH9 A;  2XKP A;  2L7Z A;  4HF0 A;  2VPR A;  4RAG A;  4EEF G;  3QQA A;  4F91 B;  2Y48 A;  2FBH A;  1IC8 A;  4AIK A;  3GLL A;  2UV1 A;  4IHY A;  2X1D A;  1J09 A;  2W4S A;  1WQ2 A;  1TL8 A;  4OWR B;  1VND A;  1OR7 C;  3IC7 A;  1SFO J;  5AIQ A;  2HWV A;  3ZN1 A;  4ASN A;  1FY7 A;  1N25 A;  2AO9 A;  1MBJ A;  1E2X A;  2ID3 A;  3CF5 F;  2H09 A;  1IAW A;  1X4O A;  1XN7 A;  4O5V A;  1S6L A;  2IS1 A;  4M3B A;  4V2G A;  3QP6 A;  1P4W A;  1Y39 A;  4R1H A;  3K2Z A;  3JRG A;  1APL C;  3BJO A;  3VPR A;  2K9N A;  3BZ6 A;  1LQ1 A;  1LDD A;  4XOT A;  2K5C A;  1PP7 U;  3D5R C;  4D9J A;  1MSF C;  4CYC B;  1MNE A;  5JFR A;  4HBL A;  1K6Y A;  2VKE A;  3V8L A;  2JZY A;  3BRO A;  1EV7 A;  4BXF A;  1LB2 A;  2DA1 A;  4OOI A;  3DU6 A;  3AG4 H;  2ELK A;  1O7L A;  5HOO A;  2M8G X;  1D5V A;  4BJT A;  4QLC U;  3WU0 A;  2NVX J;  1ETW A;  2FBK A;  4YII A;  2O61 A;  1OJL A;  2R4G A;  4C3H J;  2MG4 A;  2OTL I;  2F4M B;  4AVP A;  2EFP A;  1O3S A;  3ZQF A;  3AL0 C;  3TOA A;  4RGS A;  2BY1 A;  1V55 H;  4BE1 A;  2X6O A;  1YHQ I;  1T0F A;  1FOX A;  4PJ0 C;  2HTS A;  2M87 A;  2ZFU A;  2YU3 A;  3K2A A;  3DQV C;  4EM1 A;  4BJ5 C;  4OIO F;  1FEX A;  2JSP A;  5CJ9 A;  3N97 A;  2VL8 A;  4IXA A;  4YIF A;  2Y2Z A;  2CV1 A;  4A3F J;  3G2B A;  1R5I D;  3JAM Z;  3WTW C;  1FZP B;  4HW0 A;  3DLL F;  3DKW A;  3HUG B;  2Z9O A;  2EV5 A;  5FFZ A;  1UMQ A;  4O6J A;  3SHF A;  2X9D A;  4A3D J;  2XF6 A;  3F8M A;  3OYJ A;  2DFI A;  4F7Z A;  1FBS A;  1KYW A;  1ITY A;  1SAN A;  2ID6 A;  2ZC2 A;  3WTV C;  2L2O A;  1K78 B;  2JA8 J;  4QIW N;  2OPT A;  1OIS A;  2VON A;  2X0L A;  2KIF A;  3OYL A;  3BJ6 A;  3L2W A;  4L0Z B;  2ZO4 A;  3ZQI A;  2VN2 A;  3GF2 A;  2L02 A;  1KQ8 A;  3BC8 A;  1IXC A;  4HDU A;  2IP2 A;  2PJP A;  1WKM A;  3TL4 X;  4ENN A;  2EWN A;  2K27 A;  5FRN A;  1VQ6 I;  1W36 D;  2E34 A;  2D1H A;  1MJA A;  3GFL A;  3QYB A;  2KL4 A;  2LP0 A;  2J5O A;  1IRZ A;  2R7U A;  3RZD J;  1A6I A;  3FHZ A;  1K83 J;  5JLW A;  2Y9Z A;  4M3G A;  4MEY F;  1IF1 A;  3CLO A;  1O3R A;  1HA8 A;  3E5X A;  2DYS H;  2VQG A;  2AXT C;  2Z3Y A;  4HNV A;  2KDZ A;  3SJM A;  3TBI A;  1SAX A;  1OR7 A;  5E8G A;  3BWG A;  5KCM A;  3C2B A;  4IHW A;  3K4N A;  4ZZL A;  3FM3 A;  5DD8 A;  4RS8 A;  5FLM J;  4A5N A;  3KP6 A;  2EB7 A;  3O3K A;  3BPV A;  4U0V A;  3IKT A;  3I54 A;  4BY1 J;  5DM7 F;  1FIA A;  3UR3 C;  2V1X A;  2PEX A;  4LOC A;  2M5W A;  4A69 C;  1R58 A;  2V1D A;  2EA2 A;  3SQN A;  3F6O A;  3VOD A;  2KT0 A;  3M07 A;  1DU0 A;  2LFB A;  4JP0 A;  2VB6 A;  3HGG A;  4GYG A;  4A0X A;  3JRH A;  4LIV A;  5LD2 C;  2NRA C;  2NOJ B;  4M9Z A;  3CUQ C;  4CA0 A;  3OR2 C;  1BR1 A;  2XB5 A;  1TWC J;  4ON0 A;  3HJE A;  5BQT A;  3I59 B;  4ITV A;  4IO9 F;  3L2C A;  3RKW A;  3PNV A;  1X4P A;  5E79 C;  2L4M A;  1XMA A;  2DO7 A;  3FMR A;  5IP9 J;  2XAU A;  5FD5 A;  4BAC A;  2FOK A;  4KIB A;  4A6D A;  4ETS A;  1CF7 A;  2RDP A;  2DAO A;  5M5X J;  2PJR B;  1YW8 A;  3KLN A;  4NQW A;  1KYZ A;  1IV6 A;  3TGN A;  3S3N A;  2JUG A;  1X19 A;  1D1C A;  2O8X A;  1B1B A;  3WG7 H;  3ASN H;  3V7S A;  1G3T A;  2E71 A;  2EZL A;  3CES A;  2PMZ N;  4LG0 A;  1IJW C;  4ZDL A;  5FRM A;  3B02 A;  1R23 A;  2XV4 S;  2F5E A;  4JK1 X;  3B6A A;  1S3J A;  3OR1 C;  4WCG A;  1YTY A;  4W1U A;  1MNM C;  3KEQ A;  2ZXH A;  5J47 A;  2OA4 A;  3KZY A;  1B4A A;  3CCR I;  3QYF A;  1MGT A;  2KKO A;  4XID A;  3I4P A;  2JWT A;  5TRD A;  2P5L C;  1MBE A;  1SMY F;  1JKR C;  3OS1 A;  3S17 J;  1X58 A;  3SZT A;  2FBI A;  1WJF A;  1I27 A;  5FLX K;  4AID A;  2WBM A;  3BJA A;  2HS5 A;  3FXU A;  2DJI A;  2L4A A;  4CCJ A;  4NHJ A;  5LRR A;  3BY6 A;  3PO3 J;  5HS7 A;  3KP2 A;  4Y52 J;  1KQ9 A;  4RMN A;  4YRV A;  3NWS A;  3U21 A;  4YFN F;  3MKL A;  1ZLK A;  1Y8R B;  2HXI A;  2VI6 A;  2QEX I;  1Y0N A;  2WY8 Q;  2E2I J;  4BNC A;  2ISY A;  2EIJ H;  1S8N A;  4LFU A;  3SDG A;  3H0D A;  1W0U A;  1RPW A;  4BHP A;  2D1V A;  4XMY A;  4JBA A;  1DPU A;  2GA2 A;  4FE4 A;  4BQN A;  1J75 A;  2HDC A;  3L1P A;  1QZZ A;  2A5W A;  2X1E A;  2CJJ A;  3H35 A;  1OCC H;  2VQC A;  3BG3 A;  4EGZ A;  2OBP A;  2K9M A;  3DEE A;  2PG4 A;  3QYE A;  4L0Y B;  4XLE A;  5HLG A;  3J81 Z;  4GDF A;  2R3S A;  3AG3 H;  1K7A A;  3CP8 A;  3H92 A;  1LKX A;  4NNJ A;  4ENK A;  2O3F A;  5D5U B;  1BIB A;  1R9T J;  2G0E A;  3DWL E;  3ZXS A;  3C3W A;  2BVM A;  3G73 A;  1D5Y A;  2E1O A;  5D8L B;  5BS6 A;  4U0Y A;  1I5Z A;  2BEO A;  3GFJ A;  2KRH A;  4KIS A;  1R1V A;  1VTN C;  2QKL B;  4PJL A;  2CFX A;  1SFX A;  1FSE A;  2DMQ A;  4MTE A;  2KRF A;  2KIU A;  5IOY A;  5AON A;  3H5N A;  4ZZD A;  3HL2 A;  2CU7 A;  1XMK A;  3M9A A;  1B9N A;  1T6S A;  2ESH A;  5JR3 A;  1HXD A;  2EBI A;  1R1U A;  2LOO A;  1MBH A;  5E1W A;  2EIM H;  3G1M A;  2GLO A;  1A5J A;  1Z6R A;  3PSF A;  3JCU C;  3OYM A;  1ZKG A;  1MBF A;  2A68 F;  3I64 A;  4XK4 A;  2WB1 A;  3A2K A;  1LE8 A;  3IH3 A;  1GLN A;  5K1Y A;  5IT9 K;  4MO7 A;  3MZ8 A;  1D0Z A;  3CME I;  4A3B J;  3QPS A;  2EQR A;  3I53 A;  1QZY A;  1ZR2 A;  5FLV A;  2TDX A;  3FXL A;  1HDD C;  5IYC J;  4J00 A;  4UUV A;  3JRC A;  3S93 A;  1Z3X A;  2O8K A;  4DOZ A;  2HPI A;  2Z2S B;  5JVT A;  2EA4 A;  3GZ5 A;  4IPA A;  3CC4 I;  3QPL A;  1VQ9 I;  3NEU A;  4P1W A;  3CCS I;  1YJ9 I;  3O2P E;  4LGW A;  4PJN A;  5FFX A;  1U6G A;  3GTP J;  4I99 C;  3UKG A;  4IL6 C;  3HPH A;  2Z5U A;  2KP6 A;  1PUE E;  2KLO A;  4RBO A;  4M3E A;  3PIP F;  2M4G A;  5E20 A;  3JRE A;  2VQH A;  4RAF A;  3V8K A;  3VB2 A;  3LSK A;  1RR7 A;  1H88 C;  3TKY A;  4HPQ A;  2JN6 A;  4CCM A;  2DTR A;  4U7D A;  2QUF A;  1IN5 A;  2HI3 A;  4UHT A;  3JTH A;  4IKF A;  1I6H J;  1SC7 A;  2L54 A;  2CUZ A;  1UG0 A;  2DW4 A;  2CQ7 A;  4UB6 C;  2XGD A;  5LEK A;  1NG6 A;  2DU9 A;  3CD6 I;  1XG1 A;  5BNG A;  3GTJ J;  3F23 A;  3DPU A;  4IRG A;  1U8R A;  3BR6 A;  2XHK A;  2G7U A;  3TDU C;  2AQE A;  2Q0O A;  2P7C B;  4PCQ A;  1OYY A;  1F43 A;  1QQI A;  2L9R A;  1OLT A;  2IGM A;  2UUZ A;  4D5F A;  1H9G A;  2W84 A;  3ABK H;  5CVR A;  4BS9 A;  1QNT A;  1IUF A;  2X48 A;  2XGX A;  1JJ6 C;  1FTZ A;  1W7P D;  2D2W A;  4HA8 A;  3GCM A;  5K5O A;  2DPU A;  1ERD A;  4DGW B;  2BXY A;  3CUO A;  1E3O C;  3E6B A;  3LSR A;  4RLQ A;  3CO7 C;  1K6O A;  2RN7 A;  2H1K A;  3EET A;  2XAQ A;  5J4Y A;  1QRY A;  5GPC A;  5IYB J;  1JT6 A;  3HTU A;  2Z33 A;  2MGQ A;  3IH4 A;  1SVL A;  4KDP A;  5EG0 B;  1R7J A;  2BY3 A;  4XKW A;  3V7R A;  3RPU D;  1GXP A;  4YFK F;  2RAE A;  3LSG A;  2IS4 A;  3V42 A;  3GFM A;  3KP4 A;  2CSO A;  2DDA A;  2XRN A;  2V9V A;  5FKM A;  3GTQ J;  1QGP A;  3PFI A;  1QZE A;  3SEZ A;  2RGV A;  2VBY A;  3WU2 C;  3QRF F;  4YEL A;  5TGT A;  4LMY A;  5ICE A;  3WTU C;  2QBY A;  2MAB A;  3K70 D;  4Y3O A;  2JA5 J;  1JUM A;  5F1R A;  3I4N J;  5FKL A;  3IKV A;  2R7V A;  4UVC A;  4GO1 A;  4ANJ A;  3WGI A;  2V26 A;  4X1E A;  1L3L A;  1TNS A;  3G1O A;  3I9V 2;  4MHG A;  2LY1 A;  3ZMD A;  2DTZ A;  3EUA A;  4PFO A;  4P55 A;  1BI2 A;  3FKI J;  3DFG A;  3Q9V A;  1U5T C;  3IP4 B;  4BJ6 C;  5IP7 J;  4HLY A;  2V7F A;  3A01 A;  1U3E M;  3GTG J;  4BXU A;  3BQZ A;  2V9P A;  1DU6 A;  3ASO H;  1S7A A;  2ZCW A;  3A02 A;  4ZYD A;  2CUE A;  2W7N A;  4CXF A;  4EJU A;  2M7B A;  4U87 A;  1Y6I A;  3ABL H;  4XNF A;  5IP6 A;  1ENH A;  5IT3 A;  1YE9 A;  3IV5 A;  1CF7 B;  1IDZ A;  1WJA A;  4R8H A;  1TNT A;  4BBR J;  2PBI A;  2LRD A;  2KMU A;  5F0H A;  3X2Q H;  2B63 J;  3MAJ A;  1FT9 A;  3S3O A;  2ELH A;  4BQA A;  3VWB A;  2ZXI A;  3MD2 A;  4BEH A;  3H5R A;  3DP7 A;  4N9I A;  5DD4 A;  1YLF A;  4C3J J;  4E7I A;  4MLO A;  3FK7 A;  5F1J A;  3S3M A;  3E5Q A;  4BL0 B;  5LHH A;  3RCO A;  3EYI A;  3M8J A;  3RDI A;  1B8I B;  4MGR A;  5LGN A;  3JAM K;  3E97 A;  5J8C A;  2DT5 A;  2BYV E;  4AIJ A;  4N9H A;  1I39 A;  4BY7 J;  4NBQ A;  3I4M J;  4HX4 A;  5JVG F;  1XCV A;  4AWX B;  2EH3 A;  4IX7 A;  3W6K B;  4LJZ F;  4IOC F;  1ETQ A;  3K1P A;  1QHG A;  1JKP C;  3PL8 A;  2QQ9 A;  3KP5 A;  1MMN A;  3K70 C;  1YI2 I;  1Y8Q B;  2OV7 A;  3SZG A;  2QSG X;  3IAM 2;  3W2A A;  2KIM A;  4N4O B;  3I71 A;  2HZD A;  3R60 A;  4AYB N;  1RES A;  4XLP F;  2HNH A;  4MEX F;  2NVU B;  2COB A;  1V5E A;  1VQ4 I;  2GA1 A;  3WU1 B;  2OZU A;  2GIV A;  2ELJ A;  4L5J A;  1W7P A;  2E5Z A;  1YJW I;  4BQQ A;  2XF7 A;  1FC3 A;  4GRI A;  4H4K C;  1A35 A;  3RJP A;  2AHQ A;  2LF7 A;  1AU7 A;  3OYC A;  5HOD A;  4AC0 A;  1X1D A;  5F08 A;  3LQQ A;  2VBX A;  3DCF A;  3KP7 A;  3HRS A;  4TV7 A;  2A61 A;  4A3J J;  1T8I A;  3QOD A;  5E3L A;  4OU0 A;  2IRF G;  5CYV A;  2HKX A;  1FMV A;  1TWG J;  1TWF J;  2R93 J;  1LVK A;  2CYY A;  1PJR A;  3V8J A;  5J1Y A;  1R5H A;  5F64 A;  2EZK A;  1GV5 A;  4HEA 2;  2R7Q A;  3DTK A;  5EJC A;  1LFU P;  1UHM A;  4HZF A;  3H3V K;  3ELK A;  5JI6 A;  2P4W A;  1ODD A;  2P5K A;  4JX5 A;  2WAD A;  5KVR A;  5HNH A;  2CW8 A;  2O6G E;  1YIO A;  2KJB A;  3JSO A;  4E6K G;  1FOK A;  3TO9 A;  4KT5 C;  2WWY A;  5J8F A;  3KIO A;  1BR4 A;  4NQW B;  2VPL A;  2E19 A;  3S1Q J;  4ZTJ A;  4UUS B;  3CMA I;  4RDU A;  3FXK A;  3S2W A;  3MMY B;  2K7L A;  1KA8 A;  1MW7 A;  3S32 A;  5EEG A;  1HOM A;  3K6G A;  4E7Z A;  5EEH A;  1TQM A;  2R7X A;  2ZME A;  2LYC A;  1I50 J;  1YFH A;  3L7W A;  3JW4 A;  3LQR A;  4PUS A;  5KAF C;  2LKP A;  1XC5 A;  2F5V A;  3CDL A;  3VYT B;  3V7C A;  1UAA A;  3GZ6 A;  4HRI A;  3HYI A;  4OIQ F;  3CQZ J;  1AA7 A;  4BKX A;  2OAZ A;  2ME0 A;  2EFW A;  1FMW A;  1R22 A;  3Q0U A;  4LG0 B;  4DW6 A;  3C1D A;  2OQG A;  1YIT I;  3QU3 A;  3U1D A;  1XSX A;  1IN8 A;  5ILS A;  2QQA A;  1EKE A;  2DN0 A;  2VJJ A;  5CVJ A;  4DYQ A;  3K9T A;  1SFK A;  3ABU A;  1QBJ A;  3P7N A;  2FML A;  4BXX J;  2HOA A;  3WE2 A;  1AOY A;  2IXS A;  2H8W A;  3HRM A;  2JSC A;  4A3M J;  2KZG A;  2VOO A;  4KA4 A;  2K3F A;  3GEZ A;  2HVR A;  1T0F C;  5F04 A;  5TIS C;  2K40 A;  1I3Q J;  3ECH A;  4WXH A;  3FX3 A;  2VXD A;  4BQO A;  3QPT A;  3TW7 A;  4CCK A;  1D0Y A;  1WRJ A;  2DK5 A;  2DBB A;  2TCT A;  1LFP A;  4BUP A;  2E2J J;  2GZW A;  3AKZ A;  3OL3 A;  3H0G J;  1UHW A;  3CJR B;  2HOE A;  3A01 B;  2XB0 X;  3Q0V A;  1WPK A;  1HKQ A;  1T98 A;  3KEY A;  3CO6 C;  4KYW A;  4BHC A;  1BI3 A;  1P4X A;  3OIQ A;  3DXJ F;  4PZJ A;  1MMD A;  4EMS A;  1DGR M;  2CS3 A;  1DUX C;  2PLY A;  1XGO A;  1HCR A;  2LNB A;  4QSH A;  1YOV B;  3I0T A;  2E1N A;  3SDB A;  1X2N A;  5F27 A;  2STT A;  2HOT A;  3FF5 A;  3FWE A;  2GWR A;  4BBS J;  3GUD A;  2V1U A;  1UZC A;  4W97 A;  3RSN A;  4A3L J;  2LKS A;  5DCM B;  4QPQ A;  3KLO A;  3NAR A;  5CVU A;  3CCQ I;  2E1C A;  3C2G A;  2VE8 A;  1WJE A;  3BQY A;  2V6E A;  1JUP A;  2NVT J;  5CPR B;  4XLA A;  4XM3 A;  5M5Y J;  2M0C A;  5ILV A;  2W57 A;  3P9C A;  1FBQ A;  1FPQ A;  2BVL A;  2XAJ A;  4RLF A;  3ZQQ A;  3JRI A;  4HF2 A;  3GTK J;  1EF4 A;  2MH2 A;  3K0L A;  1VQK I;  5H2F C;  4E7J A;  2QM3 A;  3CUQ A;  2P81 A;  1JKQ C;  1YO5 C;  3I59 A;  1NG7 A;  2HVS A;  1G4D A;  3CCY A;  2A69 F;  2ZME B;  2DFF A;  3CZ6 A;  3H3U A;  4FAS D;  4WK8 F;  2M7A A;  2XRL A;  2ZJ2 A;  4LG3 A;  2BV6 A;  2GAU A;  4RB3 C;  2JK3 A;  2MC3 A;  4WX9 A;  3KET A;  3CCL I;  1VQ5 I;  4XKV A;  5ERI A;  3TOB A;  1BC8 C;  3BR3 A;  2NXN B;  3HOY J;  4KN7 X;  2HOS A;  1IN4 A;  3HUG A;  1JGG A;  1ETX A;  3TO7 A;  1RZ4 A;  4EJT A;  1WZ2 A;  2KJC A;  4G8X A;  4DZJ A;  1AKH A;  3R0A A;  3OYD A;  3HKZ A;  3SXY A;  3M1C A;  3G71 I;  4KUM A;  4DQ2 A;  2Z1D A;  4ZTF A;  1Y56 A;  4X0G A;  4LIT A;  4PSW A;  2K86 A;  1NH3 A;  5ICF A;  3MCZ A;  1R71 A;  2A05 A;  4I0A A;  4LK0 F;  3MKZ A;  4UV9 A;  5J1R A;  3SFI A;  2QSH X;  3LAJ A;  2L01 A;  3K4L A;  4QPO A;  3NRV A;  1RIO H;  1K61 A;  3G4S I;  4IHV A;  1O57 A;  5CKT A;  3QWL A;  4Z2Y A;  5FKO A;  1DP7 P;  3HOZ J;  2FU4 A;  1BJZ A;  3K4K A;  3FBI B;  3GXO A;  1BW6 A;  1VI0 A;  1RUO A;  1P4A A;  4ESF A;  2N8G A;  4G6Q A;  5EDN A;  5HNF A;  3K4M A;  2HZT A;  3I3L A;  4II2 A;  3BTC A;  4D7N A;  3HTS B;  1PYV A;  2MLK A;  3W6V A;  4PGH A;  2HTJ A;  2XGE A;  5GTI C;  2LDU A;  5GAD J;  4AVZ A;  2IJL A;  4B48 A;  1BIA A;  2RRE A;  2WB1 N;  2LY2 A;  1P9Q C;  2D45 A;  3ZR8 X;  2EPF A;  1XS9 A;  1UHS A;  1YRN B;  4C2U A;  4UXN A;  4MQV A;  2HVQ A;  3ECO A;  4RB1 A;  1ZH5 A;  4IQ4 A;  2MFZ A;  3I55 I;  4XOP A;  2DXI A;  2VXZ A;  3E0J B;  2MA3 A;  1K4S A;  5DM6 F;  2FEZ A;  3R6S A;  1BC7 C;  1IDY A;  4BAY A;  3F9K A;  3OYH A;  5C4X J;  1LUJ B;  3JRA A;  3L2R A;  4CGZ A;  3ABT A;  1MMA A;  2I10 A;  3ZOB A;  3MFK A;  4MIM A;  2VJ5 A;  3LWF A;  1X1B A;  3DPT A;  3ZRG A;  5HVQ C;  1TBX A;  1OCO H;  3RZO J;  3MQ0 A;  2P6S A;  3MVP A;  4XRS A;  4G7O F;  2FXA A;  3FK6 A;  1BL0 A;  5K5R A;  1JJ8 C;  3CTA A;  2Q8K A;  2MD5 A;  3OOU A;  2IS6 A;  3E7L A;  2KFD A;  2LG4 A;  3U9G A;  2QVO A;  2Q2E A;  3BOQ A;  4HX7 A;  1UFM A;  1P2F A;  1R4M B;  3CMM A;  2QWW A;  4M6X A;  5D4S A;  1X1C A;  3JRD A;  2UWM A;  2G7H A;  2ICW G;  1X1P A;  3K4C A;  3WGG A;  3ZQC A;  1EJ9 A;  3AL0 B;  2IGN A;  2VBZ A;  5HS9 A;  4FET A;  2O9L A;  2EZI A;  4HNT A;  1JGS A;  1ONV A;  2H6B A;  1NK2 P;  1ACI A;  2QKM B;  1SD6 A;  3MKY B;  3OIO A;  1AHD P;  4IHT A;  1JXS A;  1OKR A;  1Y1V J;  4GGG A;  3L09 A;  4UB8 C;  2GQQ A;  4ABZ A;  1JKO C;  3LSJ A;  5IOZ A;  2WA0 A;  1FWZ A;  5LGU A;  2EV6 A;  4I0B A;  5LHG A;  4FTH A;  2PI0 A;  3ZP5 A;  3KFW X;  3EUH C;  3H9J A;  3LSI A;  2VOP A;  4IQJ A;  4M74 A;  2L9S A;  4N0B A;  3OS0 A;  2NS0 A;  4RAZ A;  4G94 A;  2IVM A;  5FLX Z;  3I56 I;  4IF4 A;  2EFO A;  1RC9 A;  2BXZ A;  1LDJ A;  3DBL B;  5EG0 A;  1L0O C;  3FMS A;  3S15 J;  4IJA A;  1ZGA A;  3F8B A;  1IRG A;  4A6E A;  1J9I A;  1RUN A;  3L2Q A;  2KPM A;  3K1M A;  2A6T A;  1KU7 A;  2M3A A;  2HEO A;  5E3M A;  3GTL J;  3A4C A;  1V54 H;  5GPA A;  2OF7 A;  5JLX A;  2LF8 A;  2M30 A;  4KN4 X;  2QLZ A;  2GM4 A;  3HOT A;  3L9F A;  4B3A A;  2FMY A;  2QQB A;  1LEA A;  2Y0S A;  6PAX A;  1WH5 A;  4HQE A;  4X6A J;  2R7S A;  2OCC H;  1YS7 A;  4MFE A;  4NC6 A;  3NQO A;  3PUF A;  3CP2 A;  1MMS A;  1IRF A;  2VAS A;  1I1S A;  2DQR A;  2V1N A;  5ILU A;  1DP3 A;  4OIN F;  2X1C A;  2GOM A;  2DDB A;  1Z77 A;  2IEK A;  2W48 A;  3ISP A;  2JVG A;  5HDK A;  3GLX A;  4EJW A;  3BTJ A;  3H9Q A;  1ZGW A;  3FXM A;  3H36 A;  2Q2E B;  3FXR A;  3BCA A;  4C3I J;  5DTD A;  1X3W B;  5L3E A;  3KYL A;  4GCV A;  1TQI A;  2CO5 A; 
#chains in the Genus database with same CATH homology
 4HV6 A;  1R5G A;  1FSH A;  4DNC A;  1NHA A;  4ZYE A;  5LBQ A;  1Z7U A;  5FD6 A;  3TO6 A;  1OYW A;  2FA5 A;  4KMF A;  4FX4 A;  1IXR C;  3VFZ A;  1FYK A;  3R0J A;  5DEQ A;  2QZ8 A;  1FP2 A;  5BPD A;  1QO0 D;  5FGM A;  2HKO A;  3RI4 A;  4L9N A;  1BBY A;  4P96 A;  3Q5F A;  1MD0 A;  2JRT A;  1Q1H A;  2JPC A;  3EQL F;  2JPB A;  2E7W A;  1A04 A;  1XCB A;  2XKO A;  3VEP A;  1G3Y A;  1H0M A;  2YX4 A;  4L9V A;  3K1N A;  1ZRE A;  3E6M A;  4HDV A;  2A6E F;  2V79 A;  3ZMV A;  3IRQ A;  3DF8 A;  2O0Y A;  3KZZ A;  2ZKZ A;  3ZMZ A;  2K4J A;  3SFZ A;  3ZMS A;  2HYG D;  3F8C A;  5HDG A;  1Z91 A;  4LLG F;  1KU9 A;  2HR3 A;  5HLH A;  3T1B A;  4ENM A;  5D8K B;  1I6X A;  2VE9 A;  3REO A;  4I98 B;  1HST A;  1USS A;  5HDN A;  2DI3 A;  1ZGJ A;  1JE8 A;  1I1G A;  1ZG3 A;  3EYY A;  2P8T A;  2M45 A;  1XSV A;  1W4M A;  5DV5 A;  3I58 A;  2HYF A;  3D0S A;  4L9T A;  1ZRF A;  5CVI A;  5H6R A;  1FYM A;  2ZFW A;  2ZNY A;  2PMU A;  1Y0U A;  4EM2 A;  3CUQ B;  1AWC A;  4LK1 F;  5ICG A;  1XD7 A;  3G3Z A;  2IA2 A;  2MBF A;  2XAF A;  3F8F A;  1JHF A;  1IXS B;  3QAH A;  3WG9 A;  1STZ A;  4H0E A;  3AAF A;  4FX0 A;  4I7H A;  5LEJ A;  4EVI A;  3GYH X;  1K78 A;  2PFB A;  4P9F A;  3T0Y A;  2R7D A;  3ERE D;  4XSZ F;  1F5T A;  4S04 A;  4B09 A;  2HGC A;  3T8R A;  1HW5 A;  1UCR A;  4LLN A;  4FHT A;  3GW2 A;  5HLI A;  5IT9 Z;  2LSO A;  4IVN A;  5E1X A;  3D5L A;  1R00 A;  3CJN A;  3O6B B;  1ZAR A;  4LB5 A;  3QOP A;  2YSR A;  5FO5 A;  2NAZ A;  4XLN F;  1SD7 A;  4Q5S F;  2FE3 A;  4CHU A;  3HRU A;  4FT8 A;  3T8T A;  3QPH A;  1O7F A;  1WI9 A;  3VOE A;  2A07 F;  3RTR A;  2UZK A;  4I02 A;  1BJA A;  1Z6T A;  3BPX A;  5DCM A;  2F5D A;  5L3G A;  5L3B A;  1D8K A;  1IN6 A;  1YW7 A;  3M8E A;  5E17 F;  1U5T A;  1ZN2 A;  5FB2 A;  4Q48 A;  1O3Q A;  1ZYR F;  1HW2 A;  4NB5 A;  2BGC A;  4I09 A;  3KEO A;  3GWZ A;  3U2R A;  4UV8 A;  3J7A O;  3IRR A;  3RIR A;  1CGP A;  2OD5 A;  1UB9 A;  3QP5 A;  2YPR A;  4PDK A;  4EV0 A;  2PMH A;  5AIP A;  2H27 A;  3J80 K;  2EK5 A;  3ZQ7 A;  1XDS A;  4QWQ A;  4B8X A;  2QYO A;  1YYV A;  4WXC A;  1MDM B;  1T38 A;  2AS5 F;  3DEU A;  1XGM A;  5CVV A;  1REP C;  2ESN A;  3R4K A;  3C7J A;  4HF1 A;  3N4M A;  1GVJ A;  1ON2 A;  5L3D A;  3M7G A;  4MTD A;  3KP3 A;  3K69 A;  4R79 A;  3CDH A;  4OMY A;  1FLI A;  4G6D A;  4KIF A;  3RPU A;  4HAM A;  1C0W A;  3QU6 A;  2YX7 A;  4KMU X;  1B9M A;  3GVA A;  3KCC A;  4RGR A;  3HIF A;  3WGH A;  2W85 A;  3RPQ A;  1LVA A;  1Z1D A;  3HSR A;  5DYM A;  2FQ3 A;  2H94 A;  2A6H F;  2VC0 A;  3KE2 A;  3T5X A;  1YG2 A;  5ED4 A;  3LST A;  4LB6 B;  2VT2 A;  4XRF A;  4IRI A;  5F6F A;  2F5F A;  2FNP A;  3JSP A;  1XGS A;  2ISZ A;  2FNA A;  4OIR F;  1JHH A;  2P6T A;  3OOP A;  4UNO A;  1FBU A;  4KIC A;  4Q47 A;  3M8F A;  2B0L A;  1HSJ A;  1LJ9 A;  4U7B A;  2BBY A;  4CIC A;  1B59 A;  4RB2 C;  3OV8 A;  1S7O A;  1V4R A;  2F5C A;  1XSD A;  4ZH4 F;  5E1Z B;  5LLQ A;  1RNL A;  5H20 A;  3ZMU A;  5DDG A;  1ZRD A;  1FP1 D;  3WTY C;  3IHU A;  3PQJ A;  2F2E A;  4A2U A;  5DCF A;  1S29 A;  1TTY A;  3WTZ A;  4A0Z A;  4PGG A;  4AD9 A;  1WWX A;  4JQF A;  4EJO A;  2E7X A;  3F8N A;  2XAS A;  3F72 A;  4ESB A;  3P9K A;  4EJV A;  4RB0 A;  2DPD A;  1P6R A;  1SMT A;  2EV0 A;  5BOX A;  3E5U A;  3ULQ B;  2RVC A;  2RKH A;  1B6A A;  2GXB A;  1SD5 A;  1TLH B;  2ZBK A;  4ESJ A;  1U5T B;  3LFK A;  2C6Y A;  2ZXJ A;  2VC1 A;  2V6C A;  3L00 A;  5D4R A;  2Z99 A;  3W6J B;  3M1E A;  1TQP A;  3J80 Z;  4M73 A;  1YW9 A;  2XIG A;  1LNW A;  3LA3 A;  3E6D A;  4CYD A;  3TQN A;  3COA C;  1U78 A;  2ACJ A;  5A2Q Z;  3ZPL A;  2NNY A;  3FXQ A;  3IWF A;  2JTV A;  2BE5 F;  4HV5 A;  2A3S A;  2W24 A;  3F21 A;  1HKS A;  4G9Y A;  5H6Q A;  3BP8 A;  3DV8 A;  1G6N A;  2HQR A;  2RNJ A;  1J59 A;  2WTE A;  5LHI A;  4OIP F;  1J2X A;  2COM A;  5E8I A;  3F22 A;  1D3Y A;  3FMQ A;  2IA1 A;  1ZG5 A;  3EUH A;  5DUI A;  1R36 A;  1FYL A;  1IUY A;  1T39 A;  4D0P A;  1F9N A;  3ROU A;  2XVC A;  1BM9 A;  3HSE A;  2MLG A;  1E17 A;  5LGT A;  5LRS A;  3WTS C;  2UXN A;  4IRH A;  4M6Y A;  1MZB A;  3HRT A;  1ZRC A;  3GX4 X;  2OU2 A;  3F3X A;  4M9X A;  2VT3 A;  1HW1 A;  4GYI A;  2AXL A;  4I2O A;  4XBF A;  2XUB A;  4UVB A;  4HOB A;  5D5V B;  2DQL A;  2H6C A;  3WE3 A;  2XAH A;  4U0W A;  4BHB A;  2XAG A;  4CO8 A;  4KIG A;  2ZNZ A;  1J7K A;  5TJJ A;  1U2W A;  2XRO A;  4Y13 A;  1TW3 A;  1W5S A;  1O3T A;  2FF4 A;  3MZY A;  1MDM A;  4O3M A;  3RYP A;  2HFH A;  1EH8 A;  1HQC A;  4GXO A;  1ZG1 A;  3J81 K;  1RI7 A;  4S05 A;  2YR2 A;  3B73 A;  4K2E A;  2RC4 A;  2IW5 A;  2JT1 A;  1MJ9 A;  4AIH A;  5L3C A;  1OYI A;  2VBW A;  1SFU A;  2CGP A;  2NNN A;  4WF2 A;  4A0Y A;  4HQM A;  2CW0 F;  1LEB A;  3H3Z A;  4OMZ A;  4HYE A;  2HQN A;  2STW A;  4P9U A;  1OPC A;  1FNN A;  2A5Y B;  3MZH A;  4L18 B;  2M1B A;  2X4H A;  1W7P B;  1PDN C;  4G7H F;  1DDN A;  3HSF A;  2IT0 A;  2Y75 A;  2K02 A;  3C18 A;  4RAY A;  3RKY A;  1H9T A;  2P5V A;  3MEX A;  5BMZ A;  3WOD F;  2P7V B;  3LA2 A;  4CDG A;  3I5U A;  1GHC A;  2IPQ X;  5CLS A;  2EFQ A;  4MQ9 F;  2MH9 A;  2PQ8 A;  2NYX A;  1YS6 A;  1XB4 A;  3TDZ C;  2Y0M A;  3RKX A;  4ENJ A;  1J5Y A;  4EQQ A;  2CG4 A;  2O03 A;  4YFX F;  3GO5 A;  1GXQ A;  5K5Q A;  3DPL C;  1K79 A;  2J5P A;  2CWE A;  1D8J A;  1LDK B;  2PN6 A;  3WTX C;  3ZMT A;  4U88 A;  4L5I A;  2WV0 A;  3Q9S A;  1MKM A;  2GXG A;  1SFE A;  5ICC A;  2QEN A;  3HHG A;  2EFN A;  4M72 A;  1PP8 F;  3RYR A;  1W5T A;  1G3W A;  3E6C C;  1KU3 A;  1WSU A;  5KK1 A;  4LLL A;  3P9I A;  3MWM A;  2CQK A;  5J6X A;  4A5M A;  4M9S A;  4UVA A;  3EDP A;  2DLL A;  1P92 A;  2RQP A;  2ADU A;  2OQR A;  1UST A;  3FM5 A;  4XSX F;  4A12 A;  4M71 A;  4WXD A;  1YQA A;  5DUK A;  4KNY A;  1ZAO A;  4HLX A;  1IW7 F;  2K4B A;  5JHU A;  2WC2 A;  4ZYG A;  4LD5 A;  3V4G A;  4E70 A;  1XGN A;  4P5O A;  5D5W B;  3HHH A;  1KU2 A;  1X3U A;  3ZN0 A;  2VOD A;  1MJB A;  2W25 A;  1IZ1 A;  5A2Q K;  3PQK A;  4RGX A;  5D5X B;  2RV8 A;  1ZHF A;  4YG2 F;  3R61 A;  3JTG A;  4HX8 A;  1XDU A;  3LA7 A;  2IA0 A;  1FX7 A;  1IN7 A;  4BH9 A;  1EH7 A;  4Q4Z F;  1SD4 A;  4MNU A;  1R1T A;  4L9J A;  4G7Z F;  3LAP A;  4WWC A;  3E3V A;  1KGS A;  1TW2 A;  2QBY B;  2M8E A;  4Y15 A;  2FRH A;  1EH6 A;  3GFI A;  1F4K A;  1ON1 A;  4RGU A;  1BI0 A;  2OZ6 A;  2R7F A;  2ETH A;  4KFC A;  1Z9C A;  1ZLJ A;  3WTT C;  1BOA A;  5BPI A;  4IHS A;  1BN5 A;  2EJR A;  1Z05 A;  3HOS A;  4EGY A;  1QPM A;  1V3F A;  1ULY A;  1KQ0 A;  3F6V A;  3ML6 A;  3FZV A;  1G3S A;  1DPR A;  5L3F A;  2G9W A;  3BDD A;  5D6F A;  2DK8 A;  1HKT A;  5E18 F;  1J0R A;  3SZP A;  1OMI A;  1BI1 A;  4EM0 B;  4CZZ A;  1HBX G;  4Y17 A;  2FSW A;  2UXX A;  4BYY A;  5HS8 A;  1F1Z A;  2L3D A;  3IL2 A;  5D6E A;  4ZYH A;  1T2K A;  4I01 A;  3IWZ A;  2XKP A;  4HF0 A;  2Y48 A;  2FBH A;  4AIK A;  1WQ2 A;  3IC7 A;  5AIQ A;  2HWV A;  3ZN1 A;  4ASN A;  1FY7 A;  1E2X A;  2H09 A;  1IAW A;  1XN7 A;  4O5V A;  1S6L A;  3QP6 A;  1P4W A;  4R1H A;  3K2Z A;  3BJO A;  3BZ6 A;  1LQ1 A;  1LDD A;  1PP7 U;  5JFR A;  4HBL A;  3V8L A;  2JZY A;  3BRO A;  1EV7 A;  1LB2 A;  4OOI A;  1O7L A;  5HOO A;  1D5V A;  4QLC U;  3WU0 A;  2FBK A;  4YII A;  2O61 A;  4AVP A;  2EFP A;  1O3S A;  3TOA A;  4RGS A;  1T0F A;  2HTS A;  2M87 A;  2YU3 A;  3DQV C;  4EM1 A;  4OIO F;  5CJ9 A;  3N97 A;  4IXA A;  4YIF A;  3JAM Z;  3WTW C;  1FZP B;  4HW0 A;  3DKW A;  2Z9O A;  2EV5 A;  5FFZ A;  4O6J A;  3SHF A;  3F8M A;  2DFI A;  4F7Z A;  1FBS A;  1KYW A;  3WTV C;  1K78 B;  2VON A;  2X0L A;  2KIF A;  3BJ6 A;  4L0Z B;  2ZO4 A;  2VN2 A;  3GF2 A;  2L02 A;  1KQ8 A;  1IXC A;  4HDU A;  2IP2 A;  2PJP A;  1WKM A;  4ENN A;  2EWN A;  2K27 A;  2D1H A;  1MJA A;  3GFL A;  2J5O A;  3FHZ A;  4MEY F;  1IF1 A;  3CLO A;  1O3R A;  3E5X A;  2Z3Y A;  1SAX A;  1OR7 A;  5E8G A;  3BWG A;  4ZZL A;  3FM3 A;  5DD8 A;  4RS8 A;  4A5N A;  3KP6 A;  2EB7 A;  3O3K A;  3BPV A;  4U0V A;  3IKT A;  3I54 A;  2V1X A;  2PEX A;  2M5W A;  1R58 A;  2V1D A;  2EA2 A;  3SQN A;  3F6O A;  3VOD A;  4GYG A;  4A0X A;  2NRA C;  4M9Z A;  3CUQ C;  4ON0 A;  5BQT A;  3I59 B;  3L2C A;  3RKW A;  2L4M A;  1XMA A;  2DO7 A;  3FMR A;  5FD5 A;  2FOK A;  4KIB A;  4A6D A;  1CF7 A;  4ETS A;  2RDP A;  2DAO A;  1YW8 A;  3KLN A;  4NQW A;  1KYZ A;  3TGN A;  2O8X A;  1B1B A;  3V7S A;  1G3T A;  4LG0 A;  3B02 A;  1R23 A;  2XV4 S;  2F5E A;  4JK1 X;  1S3J A;  4WCG A;  1YTY A;  3KEQ A;  2OA4 A;  3KZY A;  1B4A A;  1MGT A;  2KKO A;  3I4P A;  5TRD A;  2P5L C;  1SMY F;  3SZT A;  2FBI A;  1I27 A;  5FLX K;  3BJA A;  3FXU A;  2HS5 A;  2L4A A;  4NHJ A;  5LRR A;  3BY6 A;  5HS7 A;  3KP2 A;  1KQ9 A;  4YFN F;  1ZLK A;  4BNC A;  2ISY A;  4LFU A;  1S8N A;  4BHP A;  2D1V A;  1DPU A;  4JBA A;  2GA2 A;  2HDC A;  1J75 A;  1QZZ A;  4EGZ A;  2OBP A;  2PG4 A;  4L0Y B;  5HLG A;  3J81 Z;  2R3S A;  1K7A A;  3H92 A;  4ENK A;  2O3F A;  5D5U B;  1BIB A;  3C3W A;  3G73 A;  5D8L B;  5BS6 A;  4U0Y A;  1I5Z A;  2BEO A;  3GFJ A;  1R1V A;  1VTN C;  2CFX A;  1SFX A;  1FSE A;  4MTE A;  2KRF A;  2KIU A;  5AON A;  4ZZD A;  1XMK A;  3M9A A;  1B9N A;  1T6S A;  2ESH A;  5JR3 A;  1HXD A;  1R1U A;  5E1W A;  1Z6R A;  2A68 F;  3I64 A;  5K1Y A;  5IT9 K;  3I53 A;  1QZY A;  2TDX A;  4UUV A;  5JVT A;  2EA4 A;  3GZ5 A;  4IPA A;  3NEU A;  3O2P E;  4LGW A;  5FFX A;  1U6G A;  2Z5U A;  1PUE E;  5E20 A;  3V8K A;  3VB2 A;  3TKY A;  2DTR A;  4U7D A;  2QUF A;  1IN5 A;  4UHT A;  3JTH A;  2L54 A;  2DW4 A;  5LEK A;  2DU9 A;  3F23 A;  4IRG A;  1U8R A;  2XHK A;  2G7U A;  3TDU C;  2Q0O A;  2P7C B;  4PCQ A;  1OYY A;  1QQI A;  1H9G A;  2W84 A;  5CVR A;  1QNT A;  2XGX A;  1W7P D;  2D2W A;  4HA8 A;  5K5O A;  2DPU A;  3CUO A;  3E6B A;  3CO7 C;  1K6O A;  2RN7 A;  3EET A;  2XAQ A;  3HTU A;  2Z33 A;  4KDP A;  1R7J A;  3V7R A;  1GXP A;  4YFK F;  3GFM A;  3KP4 A;  2CSO A;  2XRN A;  2V9V A;  1QGP A;  3PFI A;  2RGV A;  2VBY A;  3QRF F;  4LMY A;  5ICE A;  3WTU C;  2QBY A;  5F1R A;  3IKV A;  4UVC A;  4GO1 A;  3WGI A;  1L3L A;  1TNS A;  4MHG A;  3ZMD A;  4P55 A;  1BI2 A;  3DFG A;  3Q9V A;  1U5T C;  4HLY A;  1U3E M;  4BXU A;  1S7A A;  2ZCW A;  4ZYD A;  4CXF A;  4EJU A;  5IT3 A;  1CF7 B;  4R8H A;  1TNT A;  2PBI A;  3MAJ A;  1FT9 A;  4BQA A;  2ELH A;  3DP7 A;  4N9I A;  5DD4 A;  1YLF A;  3E5Q A;  5LHH A;  3EYI A;  3RDI A;  4MGR A;  5LGN A;  3JAM K;  3E97 A;  5J8C A;  2DT5 A;  2BYV E;  4AIJ A;  4N9H A;  4HX4 A;  1XCV A;  4AWX B;  3W6K B;  4LJZ F;  3K1P A;  2QQ9 A;  3KP5 A;  2KIM A;  3I71 A;  3R60 A;  4XLP F;  4MEX F;  2GA1 A;  3WU1 B;  2OZU A;  2GIV A;  4L5J A;  1W7P A;  1FC3 A;  3RJP A;  2LF7 A;  3LQQ A;  2VBX A;  3KP7 A;  3HRS A;  4TV7 A;  2A61 A;  4OU0 A;  2IRF G;  5CYV A;  2HKX A;  2CYY A;  3V8J A;  1R5H A;  5F64 A;  1UHM A;  4HZF A;  3ELK A;  5JI6 A;  2P4W A;  1ODD A;  2P5K A;  5KVR A;  2O6G E;  1YIO A;  2KJB A;  3JSO A;  1FOK A;  3TO9 A;  4KT5 C;  2WWY A;  5J8F A;  3S2W A;  2K7L A;  1KA8 A;  5EEG A;  5EEH A;  1TQM A;  2ZME A;  1YFH A;  3L7W A;  3JW4 A;  3LQR A;  2LKP A;  3V7C A;  3GZ6 A;  3HYI A;  4OIQ F;  2EFW A;  2OAZ A;  1R22 A;  4LG0 B;  3C1D A;  2OQG A;  3QU3 A;  3U1D A;  1XSX A;  1IN8 A;  5ILS A;  2QQA A;  5CVJ A;  3K9T A;  3ABU A;  1QBJ A;  3P7N A;  2FML A;  3WE2 A;  1AOY A;  3HRM A;  2JSC A;  2VOO A;  4KA4 A;  3GEZ A;  3ECH A;  4WXH A;  3FX3 A;  3QPT A;  1WRJ A;  2DK5 A;  2DBB A;  2GZW A;  1UHW A;  2HOE A;  1HKQ A;  1T98 A;  3CO6 C;  4KYW A;  4BHC A;  1BI3 A;  1P4X A;  3DXJ F;  4PZJ A;  4EMS A;  1DUX C;  2PLY A;  1XGO A;  2LNB A;  3I0T A;  2E1N A;  2STT A;  3FF5 A;  3FWE A;  2GWR A;  3GUD A;  2V1U A;  5DCM B;  3KLO A;  5CVU A;  2E1C A;  2VE8 A;  5ILV A;  2W57 A;  3P9C A;  1FBQ A;  1FPQ A;  2XAJ A;  4HF2 A;  2MH2 A;  3K0L A;  2QM3 A;  3CUQ A;  1YO5 C;  3I59 A;  1G4D A;  2A69 F;  2ZME B;  3H3U A;  4WK8 F;  2ZJ2 A;  2BV6 A;  2GAU A;  4RB3 C;  2MC3 A;  4WX9 A;  3KET A;  5ERI A;  3TOB A;  1BC8 C;  4KN7 X;  1IN4 A;  3HUG A;  3TO7 A;  1RZ4 A;  4EJT A;  2KJC A;  4G8X A;  3R0A A;  3SXY A;  4DQ2 A;  4KUM A;  2K86 A;  5ICF A;  3MCZ A;  4I0A A;  4LK0 F;  4UV9 A;  3LAJ A;  2L01 A;  3NRV A;  1RIO H;  1O57 A;  4Z2Y A;  1DP7 P;  2FU4 A;  3GXO A;  1RUO A;  1P4A A;  4ESF A;  4G6Q A;  2HZT A;  3HTS B;  2MLK A;  4PGH A;  2HTJ A;  2LDU A;  2IJL A;  1BIA A;  2D45 A;  4UXN A;  4MQV A;  3ECO A;  4RB1 A;  1ZH5 A;  2VXZ A;  2MA3 A;  2FEZ A;  3R6S A;  1BC7 C;  4BAY A;  4CGZ A;  3ABT A;  3MFK A;  3LWF A;  3DPT A;  5HVQ C;  1TBX A;  3MQ0 A;  2P6S A;  4G7O F;  2FXA A;  5K5R A;  3CTA A;  2Q8K A;  2MD5 A;  3U9G A;  2QVO A;  2Q2E A;  3BOQ A;  4HX7 A;  1P2F A;  1UFM A;  2UWM A;  2QWW A;  4M6X A;  5D4S A;  2G7H A;  3WGG A;  2VBZ A;  5HS9 A;  1JGS A;  1ONV A;  2H6B A;  1SD6 A;  4IHT A;  1JXS A;  1OKR A;  4GGG A;  3L09 A;  2GQQ A;  1FWZ A;  5LGU A;  2EV6 A;  4I0B A;  5LHG A;  2PI0 A;  3ZP5 A;  3KFW X;  2VOP A;  4M74 A;  4N0B A;  2NS0 A;  4RAZ A;  4G94 A;  2IVM A;  5FLX Z;  4IF4 A;  2EFO A;  1LDJ A;  1L0O C;  3FMS A;  4IJA A;  1ZGA A;  3F8B A;  1IRG A;  4A6E A;  1J9I A;  1RUN A;  3K1M A;  1KU7 A;  2HEO A;  2LF8 A;  2M30 A;  4KN4 X;  2QLZ A;  3HOT A;  3L9F A;  2FMY A;  2QQB A;  1LEA A;  6PAX A;  4HQE A;  1YS7 A;  3NQO A;  1I1S A;  1IRF A;  2DQR A;  5ILU A;  4OIN F;  3ISP A;  5HDK A;  3GLX A;  4EJW A;  3FXR A;  5L3E A;  4GCV A;  1TQI A;  2CO5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...