4KIBA

Crystal structure of methyltransferase from streptomyces hygroscopicus complexed with s-adenosyl-l-homocysteine and methylphenylpyruvic acid
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
333
structure length
333
Chain Sequence
b'VSEAQARRAVADIFNSTLASSAIGAAWELGALDELRENGKLDVSDFAVRHDLHEPAVVGMFTALASVGIVRREGATVVVGPYFDEANHHRSLFHWLNQGSGELFRRMPQVLPNENRTGKFYQRDAGAISYACREISERYFDPAFWAAVDGLGYTPTTVADLGSGSGERLIQIARRFPGVRGLGVDIADGAIAMAEKEVAAKGFGDQISFVRGDARTIDQVSARGEFAEVDLLTCFMMGHDFWPRENCVQTLRKLRAAFPNVRRFLLGDATRTVGIPDRELPVFTLGFEFGHDMMGVYLPTLDEWDGVFEEGGWRCVKKHAIDSLSVSVVFELE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methyltransferase MppJ
molecule tags Transferase
source organism Streptomyces hygroscopicus
publication title Structure and mechanism of a nonhaem-iron SAM-dependent C-methyltransferase and its engineering to a hydratase and an O-methyltransferase
pubmed doi rcsb
total genus 113
structure length 333
sequence length 333
chains with identical sequence B
ec nomenclature ec 2.1.1.281: Phenylpyruvate C(3)-methyltransferase.
pdb deposition date 2013-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13649 Methyltransf_25 Methyltransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4kibA01
4M72A 4A0YA 2OZUA 3COAC 3F22A 5HOOA 3CUOA 3F8MA 3M1EA 5D6EA 3I64A 4KN7X 2RN7A 2DW4A 2DBBA 3KP4A 3DV8A 5E1ZB 5EEGA 1SD7A 2ZMEA 4MQ9F 5TRDA 1QBJA 4MHGA 1ZARA 2PI0A 4EJOA 3FMSA 1UFMA 2HTJA 2E1CA 1QZYA 1QNTA 3C1DA 4RGXA 4M74A 1X3UA 1KQ8A 1FYKA 4BH9A 4IRGA 4P96A 3J81Z 2XAQA 2XASA 3HRUA 3J7AO 3GLXA 1YLFA 3LAPA 3EDPA 3U2RA 2PMUA 4N9IA 1DPUA 4M6XA 2HYFA 3KEOA 5ILSA 2VT2A 2Y75A 2QQ9A 1R58A 1T6SA 2ZJ2A 3MAJA 3HHGA 2DLLA 2HTSA 1DPRA 2ZO4A 1ONVA 5CVVA 4WXCA 3WGGA 1Z7UA 4L18B 3KP2A 2V1UA 2EA4A 4A5MA 4XLNF 1G6NA 1T39A 4N9HA 4S05A 1P2FA 2KIMA 3CJNA 2P5VA 1JHHA 1A04A 5DD8A 1CGPA 2VC0A 4IJAA 2HKOA 4LK0F 1RNLA 1IN8A 1IN7A 5DCMA 3SZTA 3QPHA 4TV7A 4QWQA 3KP6A 2QZ8A 2BV6A 1QGPA 2XROA 2H27A 3GW2A 3H3UA 3SHFA 3F6VA 4ZZDA 3ZMSA 1G3YA 2RC4A 4M71A 3BROA 4KNYA 4A2UA 1MGTA 2E7WA 5L3CA 2STTA 2COMA 3E6BA 2CWEA 4M73A 2W24A 2E7XA 3RPUA 3EYIA 2A6EF 2X4HA 2HQNA 2VC1A 1ZGAA 1W5TA 4HAMA 3V8KA 4HF0A 2FA5A 2QUFA 2VBWA 2XRNA 1I5ZA 1G3TA 1YYVA 3V7CA 1P92A 2PEXA 2A3SA 2MD5A 3ABTA 4GYIA 4LG0A 3MQ0A 4RB2C 5LHIA 2LSOA 1IW7F 2JSCA 2Z9OA 3HRMA 1SD6A 1HSTA 4LJZF 2D45A 5K1YA 4HDVA 1WSUA 1USSA 1IN5A 2OQGA 1FWZA 2BE5F 3BJOA 4Q5SF 2NNYA 1KA8A 1B9NA 1J75A 4G7OF 3F8CA 2LF7A 1Z6TA 1T0FA 2WC2A 2X0LA 2IA1A 1YTYA 2O03A 3WTZA 5FLXK 4B8XA 2WV0A 4L0ZB 4BYYA 1GVJA 1BIBA 1ZRCA 1BI3A 5HS8A 4NQWA 3IKTA 3BPVA 2Z33A 3EYYA 3OV8A 4OOIA 3TO6A 2QBYB 4HX8A 3FZVA 2XAFA 1BI1A 4XSXF 2K4BA 2QQAA 5TJJA 5D5WB 3I58A 3WE2A 2P6SA 1BBYA 4FT8A 1BN5A 3K0LA 3DPLC 3B02A 1YO5C 3M7GA 2VN2A 3CTAA 3BZ6A 1FP1D 4UV9A 1ULYA 4UUVA 3Q9VA 4ESFA 5ED4A 3E5UA 2FE3A 2RVCA 2MLGA 4FX0A 3TKYA 2WTEA 4I0AA 3WGHA 2W25A 4GGGA 1CF7A 1RI7A 2OD5A 3LWFA 3R0AA 1YQAA 3I4PA 1S7OA 5LBQA 5FLXZ 1PDNC 5CYVA 4RAYA 5FGMA 1ZG1A 2PJPA 2XIGA 5JVTA 1C0WA 4Q4ZF 1R36A 3DFGA 1SMTA 2ZKZA 3F8FA 3MEXA 5FFXA 5A2QZ 5ILVA 4RB1A 4KICA 1IXRC 1IUYA 2UZKA 1MJAA 3O3KA 2GZWA 2Y48A 3WTVC 1EH6A 1OKRA 3CUQA 4FX4A 4EGYA 4L0YB 2G7UA 3G73A 4HQEA 4U7DA 1XSVA 5E20A 2A69F 3F21A 5LRRA 1XCBA 1Z6RA 4LB6B 3KP3A 5LGTA 2PG4A 1ODDA 3FM3A 5D4SA 4Y15A 1DUXC 3VEPA 1S29A 3WTWC 2ZXJA 1HW2A 1H0MA 2XV4S 3MZYA 4DNCA 2HEOA 2F5EA 1I1SA 1U5TB 4I0BA 2BYVE 4G7ZF 4K2EA 5LGUA 1GXPA 4AVPA 1ZH5A 4KMFA 1R1UA 3TOBA 2B0LA 2Z3YA 1RZ4A 4EJWA 3QP5A 5DUKA 1FSEA 4PCQA 3J81K 2HDCA 4G6DA 3GEZA 1YIOA 3L2CA 2JPBA 3LQRA 3JAMK 4Z2YA 2W57A 2CG4A 3KETA 3P9CA 2NAZA 1S6LA 3C7JA 2DU9A 4BAYA 2XAHA 4GYGA 3QU6A 1W7PB 2MBFA 3U9GA 2VODA 3V7SA 1E17A 1PUEE 3IHUA 4EJVA 5HS7A 3I59B 2YX7A 1JXSA 2ESHA 5DV5A 3GX4X 4Q48A 5E1WA 2OZ6A 2CSOA 5FD6A 5AONA 5CVRA 3FMRA 3TO7A 3KZZA 2HYGD 1YG2A 3E97A 2QLZA 2L4MA 4KT5C 2YR2A 3RDIA 4KA4A 4RAZA 4HW0A 1KYWA 4HYEA 1OR7A 1ZLKA 1AWCA 4UV8A 1D5VA 3TDUC 5D4RA 2V9VA 2DK5A 5DDGA 1XSXA 2FBHA 2PFBA 4G9YA 5ICEA 3I0TA 2IA0A 3TO9A 2C6YA 2F2EA 2HFHA 3BJAA 4EJTA 2XGXA 1I27A 2PQ8A 1ON1A 5HDGA 4OIRF 4I09A 4P5OA 2HKXA 3F8BA 1FBQA 4RGUA 2FU4A 4CZZA 1LB2A 2EFWA 2ZFWA 1J5YA 1XGOA 2YSRA 2XAJA 2UWMA 4IRHA 5BQTA 2KIUA 2FBIA 3WU1B 4LB5A 2MH2A 3HHHA 1NHAA 1KYZA 4OMYA 3HSEA 1B59A 1FOKA 3I71A 4LMYA 1R23A 3ZP5A 2CO5A 3DXJF 5AIPA 2QWWA 1HW1A 3FXUA 2UXNA 1U3EM 4HLXA 4IVNA 2HS5A 3T5XA 4NB5A 4BXUA 1FC3A 3D0SA 1CF7B 2V6CA 3HTUA 2EV0A 1J2XA 4QLCU 3HOSA 2NNNA 4HZFA 1UHMA 1W5SA 2KKOA 5L3BA 2JPCA 1KQ9A 1QZZA 3RYPA 2H6CA 4KFCA 3ZMZA 4CHUA 2F5CA 4EV0A 2O3FA 4R1HA 1JGSA 5FB2A 1I1GA 3GFJA 1R1VA 1HSJA 1EH8A 1T38A 3RKYA 1I6XA 3ECOA 2DI3A 2PLYA 4WF2A 2BGCA 1Z9CA 1E2XA 3DF8A 3LFKA 4H0EA 3R0JA 3LSTA 1EH7A 1O3QA 1UCRA 3SQNA 2HR3A 2JTVA 3I53A 4G8XA 4L9NA 1IRGA 1F9NA 2J5OA 1ZG5A 5E8GA 5HDNA 3W6KB 4IRIA 3WTYC 1J59A 1WWXA 4L9TA 4BNCA 1YW9A 1J0RA 1U5TA 3FX3A 3CUQB 5HLHA 4HX7A 1XMKA 2EFPA 2DO7A 2G9WA 2M45A 5J6XA 2P7VB 4BHBA 3IWZA 1U2WA 4KIBA 2QENA 4HQMA 2O0YA 1GXQA 4L5IA 4BHCA 1YS7A 2FQ3A 4P9UA 2ZBKA 2DQLA 1MKMA 2IJLA 3BOQA 2W85A 4IHSA 3D5LA 3T8TA 3K2ZA 3F8NA 5DD4A 2NS0A 3ZN1A 3NEUA 4CYDA 3WTUC 4YFNF 5H6QA 2D1HA 4E70A 1HQCA 1U78A 2LKPA 3QAHA 3WU0A 4UVCA 4RB0A 3ECHA 3TGNA 1TTYA 2H09A 1G4DA 4ZYGA 1DDNA 2M8EA 5ICFA 2ZCWA 4LK1F 3KFWX 2EFNA 1IRFA 2GA1A 5E8IA 2EA2A 5J8CA 4BQAA 2PN6A 1SFXA 3KP5A 3KP7A 2M87A 1S3JA 2O61A 4RGSA 4M9XA 1BI2A 1FPQA 4PZJA 2XAGA 1KU3A 3E6CC 3C3WA 3EQLF 2XKPA 3RI4A 4MEXF 4MEYF 2TDXA 2Q8KA 5L3DA 3KLNA 3PQKA 4I98B 3M8EA 2FEZA 4EM0B 2XKOA 4L9JA 2OA4A 1IXSB 3O2PE 2RKHA 2VONA 1FYMA 3CO6C 3HTSB 4EJUA 1H9TA 2Z5UA 4AIJA 5DCFA 1W4MA 4HV5A 3RPQA 3NQOA 5JFRA 1QPMA 3V8JA 1SMYF 2LF8A 2XVCA 2RQPA 2EFOA 2H6BA 2HQRA 1BIAA 3TQNA 2GIVA 1SD4A 3GZ5A 3SZPA 2DPDA 2V79A 4GO1A 4B09A 3GWZA 2IP2A 2EV5A 3WGIA 1IZ1A 3CUQC 1W7PD 1B1BA 1FBUA 4JBAA 2RV8A 3ISPA 5IT9K 4KYWA 1UHWA 2QVOA 2CFXA 2EFQA 5LEKA 2STWA 5KK1A 4LFUA 3G3ZA 4HV6A 4AIHA 1MJ9A 4FHTA 4XRFA 3RJPA 5HS9A 1BJAA 1P4AA 2Z99A 2L4AA 2Q0OA 1J9IA 1KGSA 2IRFG 2V1XA 1FLIA 1TQMA 5FD5A 1KU9A 5JHUA 4ENKA 2VBXA 4PGHA 5ILUA 3MCZA 2CQKA 3R6SA 1ZG3A 3MZHA 3L00A 4R8HA 2IT0A 1XGMA 1HBXG 1K6OA 4M9SA 5JR3A 5CVIA 5CLSA 5KVRA 3E6DA 1S7AA 4LGWA 4OINF 4A0ZA 1FNNA 4P9FA 2ELHA 4U0YA 2VE9A 1IAWA 2F5FA 5LGNA 2MC3A 2HWVA 2A61A 2QQBA 3L09A 4U88A 1G3WA 2BBYA 4KIFA 3JTHA 1ZRDA 3JW4A 4ZZLA 4L9VA 1ZN2A 4Q47A 3JSOA 4L5JA 2L02A 3LAJA 4AIKA 2A68F 3FM5A 4O6JA 5K5QA 3VODA 4YFKF 2KJCA 4P55A 3ZMTA 3KE2A 2ZNZA 3JAMZ 1XGSA 3LA3A 5L3EA 2EV6A 1BI0A 2K02A 4WXHA 1XMAA 3T8RA 1WI9A 3WODF 4MQVA 3GFLA 1ZYRF 2P8TA 1D8KA 4HBLA 3R61A 3RTRA 3OOPA 1HKSA 2YU3A 3GO5A 1XDUA 2RGVA 2VOOA 1GHCA 1KU2A 3KCCA 3GFIA 4HLYA 4XLPF 3GUDA 2R3SA 5FO5A 3QOPA 5EEHA 1P4XA 3IKVA 3FMQA 2J5PA 5LEJA 5DYMA 1WKMA 3CO7C 2MLKA 3CLOA 1TNSA 1FBSA 3RYRA 2D2WA 4XBFA 3GVAA 5L3FA 3DEUA 2XHKA 4RGRA 3GYHX 1BC8C 1WRJA 1W7PA 1STZA 2RDPA 1LEBA 3B73A 4WXDA 1K78B 3GFMA 1AOYA 2FNAA 3I59A 2M30A 3H3ZA 5LHGA 4CXFA 4OIQF 2PBIA 1FSHA 4EM1A 5LRSA 2L54A 2FBKA 3E6MA 3K69A 1O3RA 3ABUA 3FF5A 2HOEA 3F3XA 1TQPA 4OMZA 5HVQC 4PDKA 1IF1A 2M5WA 4WWCA 1QO0D 1VTNC 1U5TC 4G94A 3JSPA 4A0XA 5H6RA 2OAZA 4BHPA 2GQQA 5CVUA 1O7LA 1V3FA 3PQJA 3ZMVA 4ZH4F 5CJ9A 4RB3C 2G7HA 4EM2A 3TDZC 2EK5A 3U1DA 2K86A 5ICCA 2O8XA 4DQ2A 4R79A 5HDKA 4WX9A 1Z05A 1JE8A 5D6FA 4NHJA 1ZREA 4CO8A 1USTA 1XB4A 2Y0MA 1WQ2A 4KMUX 1L0OC 1EV7A 1IXCA 2KIFA 5HLGA 1Z91A 1XDSA 4U7BA 4KDPA 1P6RA 3ERED 4AWXB 2DPUA 3K1MA 2P5LC 4YIFA 1Y0UA 5IT9Z 2ZNYA 3WTTC 4U0WA 1ZLJA 2FOKA 4ZYDA 5BS6A 3GZ6A 1F1ZA 1TW3A 2DK8A 2FF4A 2MH9A 3SXYA 3L9FA 4M9ZA 3FHZA 2P5KA 3KZYA 3S2WA 1ZRFA 1O57A 2ISZA 2P7CB 2VXZA 4ENNA 3QPTA 4JQFA 2V1DA 1OMIA 4EVIA 2FMYA 3BY6A 3K9TA 3PFIA 1P4WA 5ICGA 4IXAA 3Q5FA 1R5GA 2WWYA 4UXNA 1OYYA 5LHHA 5CVJA 4ESJA 2YPRA 2L01A 1B9MA 3F6OA 4UVBA 4IHTA 1XN7A 4LLNA 1R5HA 2NRAC 5DEQA 2DFIA 4KUMA 4IPAA 1G3SA 1LDJA 3L7WA 3M9AA 1R00A 1XGNA 1BM9A 4AD9A 3ZPLA 3N4MA 3M8FA 2R7FA 4UVAA 4LD5A 4Y17A 2OQRA 3HUGA 5IT3A 2K27A 2QYOA 3LA7A 1FZPB 3K1NA 3ULQB 3IL2A 4A5NA 3BPXA 3HRSA 1SFUA 1R1TA 4HOBA 4A6DA 1F5TA 4I02A 2P4WA 1UB9A 3EETA 2K7LA 4OU0A 2A6HF 4HA8A 2FRHA 4A12A 2QBYA 1RUNA 3FWEA 3KEQA 5JI6A 2DAOA 5D5UB 1TW2A 1FX7A 1U6GA 4YG2F 2XUBA 1HXDA 4YIIA 1BOAA 4G6QA 3RIRA 2A07F 4M6YA 4EQQA 4RS8A 1SD5A 3C18A 3BP8A 2Q2EA 1R22A 3I5UA 4WCGA 3V4GA 3HRTA 2UXXA 1YFHA 4N0BA 3R4KA 1MDMA 3VOEA 5BMZA 4Y13A 1T2KA 1DP7P 2ACJA 1REPC 4I2OA 5F6FA 1IN6A 1T98A 1ON2A 2AXLA 3ML6A 4D0PA 3TOAA 3MWMA 2ZMEB 2E1NA 1B4AA 4GCVA 1B6AA 1LJ9A 3F23A 2ISYA 4PGGA 3WTXC 2LDUA 2IA2A 4ON0A 1FP2A 5L3GA 2OU2A 3E5XA 3BWGA 1K78A 1K7AA 1OYIA 1MZBA 3P9IA 3P7NA 2W84A 4UHTA 2FXAA 4HF1A 2VOPA 2AS5F 1IN4A 3CDHA 3MFKA 3QP6A 3Q9SA 3HIFA 4LLGF 4ETSA 1PP7U 6PAXA 5D8LB 2FSWA 1LVAA 3HSRA 1L3LA 3DKWA 5FFZA 4ENMA 2CW0F 2JT1A 2EJRA 1FY7A 3LQQA 3K1PA 4CDGA 3BJ6A 2M1BA 3V8LA 3N97A 3RKXA 1MJBA 3W6JB 2F5DA 2HGCA 1RUOA 3REOA 3H92A 4U0VA 3IWFA 5D8KB 5D5VB 5E18F 5D5XB 1LEAA 1J7KA 2QM3A 1LDKB 3IC7A 1PP8F 1LNWA 3QU3A 5BOXA 1YW7A 4HF2A 3IRRA 4MTEA 1SAXA 2HZTA 2OBPA 1XSDA 1MD0A 1YS6A 2LNBA 1SFEA 1XD7A 3J80Z 1K79A 3I54A 3ELKA 5H20A 4MGRA 2VE8A 3HYIA 2CYYA 4ESBA 4MTDA 3R60A 2K4JA 2GAUA 1KU7A 1O3TA 1H9GA 3HOTA 5DUIA 2DQRA 2JZYA 4ZYHA 2ETHA 1O7FA 5J8FA 4OIOF 1Z1DA 2KJBA 1HKQA 4GXOA 3ZMUA 1LDDA 5DCMB 3T0YA 2RNJA 3O6BB 3E5QA 1F4KA 3DQVC 5F1RA 4YFXF 2GXGA 3ZMDA 1D3YA 2O6GE 3HSFA 1R7JA 1Q1HA 5K5RA 1YW8A 5ERIA 5A2QK 1V4RA 4KIGA 1TQIA 1ZGJA 4XSZF 1TNTA 1ZAOA 3DP7A 3SFZA 5BPIA 1LQ1A 2VBYA 2DT5A 2IW5A 2A5YB 1XCVA 4F7ZA 2L3DA 4HX4A 5LLQA 2NYXA 3LA2A 2P6TA 3DPTA 2YX4A 3VB2A 3J80K 2GWRA 3VFZA 2ESNA 1TLHB 2PMHA 4EMSA 2FMLA 4LG0B 4EGZA 1D8JA 4MNUA 5BPDA 4LLLA 1U8RA 3P9KA 2GA2A 4O5VA 2VBZA 4A6EA 1FT9A 4ASNA 2D1VA 4UNOA 1JHFA 2MA3A 2KRFA 1ZHFA 3EUHA 4S04A 3KLOA 1QQIA 2IPQX 3GF2A 4CGZA 3E3VA 3AAFA 5HLIA 3BDDA 5E1XA 4WK8F 4OIPF 5AIQA 3IRQA 1S8NA 2R7DA 2H94A 3NRVA 3T1BA 1KQ0A 1RIOH 5E17F 2DTRA 2IVMA 1OPCA 4IF4A 5K5OA 1BC7C 3RKWA 4HDUA 3FXQA 1MDMB 3FXRA 2GXBA 4ENJA 4G7HF 3ZQ7A 2EB7A 5F64A 4I01A 3WE3A 4CICA 3QRFF 2ADUA 2VT3A 3ZN0A 1HW5A 2JRTA 3GXOA 1HKTA 4O3MA 3F72A 2BEOA 1FYLA 3JTGA 4ZYEA 3ROUA 1OYWA 1TBXA 3WTSC 2EWNA 4KN4X 1O3SA 2FNPA 3V7RA 4I7HA 2CGPA 4JK1X 3WG9A
chains in the Genus database with same CATH superfamily
4M72A 4DZPA 2V26A 2OZUA 2IXSA 4A0YA 2ECBA 1N75A 3COAC 3F22A 5HOOA 2FD5A 3CUOA 3F8MA 2WAQA 1ENHA 3M1EA 2ME6A 3GTLJ 5D6EA 4CCOA 4D5CA 2JWTA 3I64A 3FXLA 4KN7X 2RREA 2RN7A 2WY8Q 1HLVA 3CESA 2H1LA 2DW4A 2DBBA 3KP4A 2QCOA 3DV8A 5JLXA 5E1ZB 5EEGA 1SD7A 2ZMEA 4E7JA 3BLYA 4MQ9F 2R7XA 5TRDA 1QBJA 2PX9A 4MHGA 4XQFA 5B1AH 3HEFA 1ZARA 2PI0A 1LFUP 4EJOA 3FMSA 1UFMA 2HTJA 2E1CA 1QZYA 3OY9A 1QU3A 2CQXA 4FCYA 1QNTA 3TEDA 3C1DA 3KPHA 4RGXA 4M74A 1X3UA 1KQ8A 3H3VK 1FYKA 4BH9A 2G0EA 2KISA 4IRGA 4P96A 3J81Z 2XAQA 2CS3A 2XASA 3HRUA 3DPUA 3J7AO 3GLXA 4BS9A 1YLFA 3BTIA 2KRHA 3EDPA 3U2RA 3LAPA 3JRGA 2PMUA 4N9IA 1DPUA 4M6XA 2EINH 2HYFA 3B6CA 3KEOA 2VT2A 5ILSA 2Q2EB 3FIWA 2Y75A 5EGOB 1OR7C 2QQ9A 1R58A 3K4CA 1YJ9I 1T6SA 1ZR4A 2ZJ2A 4F92B 3TBIA 3MAJA 3HHGA 2DLLA 2HTSA 1DPRA 1K6YA 1ONVA 2ZO4A 5CVVA 4A3IJ 1W0UA 4WXCA 4XLFA 4M6VA 1Z7UA 3WGGA 4IHXA 4L18B 3IUOA 2K9QA 2X51A 4F93B 3S1MJ 5GAGJ 3JRHA 3KP2A 2V1UA 2EA4A 4A5MA 2LR8A 1AU7A 3PO2J 3OL3A 2CW8A 4XLNF 2HYJA 2MFZA 2XDVA 3CC4I 1G6NA 1T39A 1JJ8C 4N9HA 2BY1A 5E3NA 4C3JJ 4UB8C 4S05A 3RSNA 1P2FA 3PNYA 2KIMA 3E0JB 4JX4A 1UMQA 1RESA 4CZCA 2ZC2A 3CJNA 2P5VA 1P9QC 3K4LA 1JHHA 3LFUA 2VL8A 1K4TA 2BVMA 2ELKA 4XK4A 1IRZA 3FBNB 2PJRB 1A04A 5DD8A 1CGPA 1GUUA 2TCTA 2V7FA 1E0EA 1OCRH 2VC0A 4IJAA 2HZDA 2HKOA 5IYBJ 4ANJA 3G1OA 4S0HB 4LK0F 1RNLA 1IN7A 1IN8A 2VQLA 1VFCA 3PSIA 3LSGA 4A3CJ 1MH3A 2R5ZB 5DCMA 3SZTA 3QPHA 1EJ9A 4TV7A 2LTPA 3KP6A 4QWQA 4BU2A 1WVRA 3H1CA 3OSFA 5GAHJ 2QZ8A 4E6KG 2BV6A 1QGPA 2XROA 1XS9A 1VQKI 2H27A 3GW2A 3OIQA 3H3UA 3SHFA 2XAUA 1AHDP 1ETOA 3F6VA 4ZZDA 3ZMSA 1G3YA 2RC4A 4ZDOA 2DA5A 4M71A 1EKEA 1XX5A 3BROA 2LK2A 4KNYA 4A2UA 1MGTA 1ETQA 2E7WA 5L3CA 2STTA 1I6HJ 4YELA 3MKYB 2COMA 4HPQA 3E6BA 4DYQA 2L9RA 2CWEA 4M73A 5EDNA 2DA1A 1TZLA 3KEYA 1X1DA 2W24A 3EUAA 2E7XA 3EUKL 4XNFA 3RPUA 3EYIA 2A6EF 5IOYA 2X4HA 2HQNA 2VC1A 4A3EJ 1DU0A 2EILH 2ZSIB 1ZGAA 1W5TA 4HAMA 3V8KA 4BUPA 1T0FC 1E3PA 2DJIA 2FA5A 1LKXA 2QUFA 3DBLB 4HF0A 2VBWA 2XRNA 1GT0C 1I5ZA 2LY9A 4YEJA 3L2QA 4GFBA 1G3TA 1YYVA 3V7CA 3BR3A 4XN3A 1P92A 2PEXA 2I10A 2EIJH 2A3SA 2IS6A 2MD5A 3ABTA 4GYIA 4LG0A 2MD0A 2VQGA 3MQ0A 4RB2C 5LHIA 2LSOA 2CQQA 1FOYA 3CLQA 3S17J 4BXXJ 2VASA 1VI0A 1IW7F 2JSCA 3HGGA 1WI3A 4G6TB 2Z9OA 3S16J 5IY5H 3HRMA 1SD6A 1HSTA 4LJZF 5K1YA 2D45A 5JLWA 4HDVA 4C2TA 2BHYA 3WHCA 4C2MJ 3MKLA 2BW3B 1WSUA 1USSA 1D5YA 2V1NA 1IN5A 2OQGA 1FWZA 2BE5F 3BJOA 4Q5SF 4CCMA 2NNYA 2XGCA 4FASD 1X58A 1KA8A 2DFHA 2GOMA 4HG2A 1UG0A 1AKHB 1B9NA 1J75A 4G7OF 3F8CA 4DIQA 2KLOA 2LF7A 4NDLA 2JN6A 2O9LA 1Z6TA 2WADA 1T0FA 2WC2A 4CCKA 2X0LA 2IA1A 1YTYA 1QZEA 2O03A 3WTZA 3CDLA 1N78A 5FLXK 4B8XA 2WV0A 4L0ZB 4BYYA 1SVMA 1D1AA 1GVJA 1BIBA 1ZRCA 1RR7A 3JRCA 1BI3A 5HS8A 4NQWA 2DMNA 2NVQJ 3IKTA 3BPVA 2P81A 3BR0A 2Z33A 1JUSA 2F4OB 3EYYA 1FEXA 4D7MA 3OV8A 2ZJRF 4OOIA 2E71A 2FX0A 3TO6A 2QBYB 3BZKA 2M0MA 2DA3A 4HX8A 4BY7J 3FZVA 1T56A 2XAFA 3FKIJ 4ZDPA 3L2WA 2VJ5A 3EPZA 3D1NI 1BI1A 4XSXF 4X6AJ 3QODA 2K4BA 1JT6A 2QQAA 5CPRB 2Z1DA 5TJJA 3DLAA 5D5WB 3I58A 4II2A 3WE2A 2P6SA 2VUMJ 1S7EA 1BBYA 2KT0A 4RLFA 2NS8A 4FT8A 1UAAA 1YRNA 1BN5A 4Y7NJ 3K0LA 3DPLC 3FK7A 3B02A 1YO5C 2E35A 3M7GA 2VN2A 3CTAA 2OC6A 3BZ6A 1FP1D 2X6XA 1R4MB 4UV9A 1F36A 2VJIA 4BJTA 1WJEA 1ULYA 1P7IA 3OS2A 4UUVA 3Q9VA 5F08A 1TWGJ 1X3ZB 4ESFA 3E5UA 5ED4A 4ITVA 3D5SC 1G2HA 2EIMH 1W36D 4IQJA 2FE3A 2RVCA 2MLGA 4FX0A 3TKYA 4F55A 1KONA 2WTEA 2VQHA 4I0AA 3WGHA 3GLLA 1W1WE 5CKTA 2W25A 4GGGA 2IS2A 1CF7A 2LOOA 1RI7A 2OD5A 1HA8A 3LWFA 3JR9A 1Y8QB 3LNQA 4H4KC 3R0AA 1YQAA 3I4PA 1S7OA 1X19A 3AG2H 5LBQA 5FLXZ 1PDNC 5F0HA 5CYVA 4RAYA 5FGMA 1ZG1A 2PJPA 2H1KA 3SYTA 1BR4A 2JK3A 2XIGA 3DU5A 4HNVA 5JVTA 1C0WA 2E2IJ 4Q4ZF 1R36A 1QRYA 3KYDB 2V9PA 3DFGA 1SMTA 2ZKZA 4BQQA 3F8FA 1GV2A 3MEXA 4LIUA 5FFXA 5A2QZ 4PJMA 3P5JA 1VQ9I 5ILVA 4RB1A 4KICA 1IXRC 5LD2C 1IUYA 2O5RA 1I39A 1V55H 2UZKA 4ABZA 1MJAA 3O3KA 3M3YJ 2GZWA 4BL0B 2Y48A 3WTVC 3H5AA 2CUFA 3CUQA 1EH6A 1FIAA 1OKRA 3ZQGA 3E1SA 4FX4A 4EGYA 2E5ZA 4L0YB 1VQNI 2G7UA 3G73A 4BJ5C 4HQEA 3U1KA 4AYBA 1K83J 1BW5A 4CSWA 2A6TA 1ETXA 4U7DA 1XSVA 2KDOA 5E20A 2A69F 3DEWA 4BEHB 4DYCA 3F21A 1S5LC 3BTCA 5LRRA 1XCBA 1Z6RA 4BBSJ 4LB6B 3KP3A 4XORA 1JUMA 5LGTA 2PG4A 1U0JA 1ODDA 3FM3A 4UUSA 5D4SA 4Y15A 3CMMA 1DUXC 3I55I 1TWHJ 2E19A 3QYFA 4BACA 2HVRA 2JJ7A 3AL0B 3VEPA 2VJ4A 5FRMA 2X6WA 1D0ZA 1S29A 2YUSA 3RQ4A 4XRSG 2EPFA 1B8IB 4C9YA 5IPAA 3WTWC 3CCLI 2ZXJA 1HW2A 1H0MA 2XV4S 3MZYA 1EA3A 4OAYA 4AC0A 1Z67A 4DNCA 2HEOA 4IHWA 2F5EA 1I1SA 1U5TB 4I0BA 3G71I 2XF6A 3NWSA 3Q0VA 4HNTA 2BYVE 4G7ZF 4PJJA 4K2EA 1HOMA 1QHHD 2XGDA 1B72B 5LGUA 1OCTC 3Q0UA 4CCJA 1GXPA 5H2FC 4AVPA 2E1MC 1ZH5A 1SFOJ 4KMFA 3PUFA 1R1UA 3PSFA 3VYTB 3TOBA 2B0LA 2M9HA 2Z3YA 2CV1A 3ZXSA 3A4CA 3DKXA 3Q3SA 1RZ4A 4EJWA 2E2HJ 2KHMA 3QP5A 1JKPC 1HCRA 5DUKA 1FSEA 4PCQA 2IBDA 2M7AA 3J81K 2HDCA 4G6DA 1HC8A 3GEZA 1YIOA 3AFHA 2KQRA 3L2CA 2L0KA 2JPBA 3RPUD 2LLKA 3LQRA 3JAMK 2F4IA 4Z2YA 3SDGA 2W57A 3HZJA 2CG4A 3KETA 3P9CA 2NAZA 1S6LA 3GMEA 3C7JA 2DU9A 4BAYA 2VKHA 3AKZA 1ZR2A 4HSTA 1JTYA 2DCEA 2XAHA 1A31A 3PNTA 4GYGA 3QU6A 1W7PB 2MBFA 1MNMC 4A3BJ 2DDAA 3U9GA 2VODA 3V7SA 2X6YA 2PJRA 1E17A 1PUEE 3IHUA 2KPMA 4BQNA 3OIPA 3RZOJ 4JOMA 3FXJA 4EJVA 4IOCF 5HS7A 2EIKH 3I59B 1R9TJ 2YX7A 1JXSA 3OYGA 4XONA 1N25A 5GPAA 2ESHA 2DA6A 5DV5A 3GX4X 5E3MA 2VPLA 4Q48A 5DTDA 1KZHA 5E1WA 2OZ6A 2CSOA 5KAIC 5FD6A 5AONA 5CVRA 2UV1A 2O7OA 5B5EC 2M34A 3FMRA 3CD6I 1WJDA 1JI8A 1IGNA 3TO7A 3KZZA 2HYGD 5EG0B 1YG2A 3E97A 2QLZA 4X0GA 2L4MA 2FJ1A 3QYEA 4KITB 4KT5C 3S93A 2YR2A 3L2VA 3PL8A 3RDIA 4KA4A 4RAZA 4HW0A 1KYWA 4HYEA 1RKTA 1D0XA 1OR7A 3BTLA 1ZLKA 1ZKGA 1AWCA 3BT9A 4UV8A 5GP9A 5EZGA 1FIPA 3HOYJ 3WHBA 3ZCOA 3TDUC 1D5VA 5D4RA 2V9VA 3ZRGA 1DGRM 2DK5A 5DDGA 2HVSA 3OL4A 3OOUA 1XSXA 2FBHA 4YIRX 2PFBA 2JA5J 4G9YA 5ICEA 3I0TA 2IA0A 2GIZA 3TO9A 3B6AA 2C6YA 4DW6A 2F2EA 2HFHA 3BJAA 1T8IA 2DT6A 4EJTA 3KYLA 1PYVA 2XGXA 1I27A 3CCJI 3VSLA 2PQ8A 4YRVA 2QKLB 1ON1A 5HDGA 4A3MJ 3GBGA 4OIRF 4I09A 2R7RA 3BR2A 3FBIB 4P5OA 2HKXA 3F8BA 1AA7A 1FBQA 4RGUA 2FU4A 1BJZA 2P0WA 4CZZA 3J7YJ 1LB2A 3IP4B 2EFWA 3HC7A 2ZFWA 4LOCA 3UKGA 1J5YA 3MKWB 1XGOA 2YSRA 2KMUA 4HEA2 1P7JA 5J4VA 2XAJA 5J3LA 5FJ8J 2UWMA 1GVDA 1OISA 4IRHA 5BQTA 2JA6J 2KIUA 3JRBA 2FBIA 3WU1B 2R4GA 2XPUA 4LB5A 2MH2A 3VYRB 3HHHA 2AXTC 4A3FJ 1NHAA 1KYZA 2JQ7A 4OMYA 3HSEA 4V19K 1B59A 5TISC 3H35A 1FOKA 3DBRB 5IYDJ 3I71A 4E4HA 2X9DA 4LMYA 1R23A 3OYCA 3LSPA 3ZP5A 4CCNA 3TW6A 4EEFG 2E60A 3K4BA 2CO5A 3DXJF 5AIPA 2YS9A 3DCFA 2QWWA 4BDZA 1HW1A 4M3GA 4NQWB 4QTRA 1JKQC 1SAUA 3FXUA 5IYCJ 2UXNA 2JVGA 1U3EM 4HLXA 5KCMA 4IVNA 1V5EA 2HS5A 5EF6A 3T5XA 4NB5A 3ZQCA 4BXUA 3BR5A 1FC3A 3D0SA 1ZTRA 1CF7B 4JX6A 2K85A 2V6CA 4B48A 3CQZJ 2H8RA 3HTUA 2EV0A 1UELB 5FKNA 4KJZA 1J2XA 4QLCU 2R7VA 4Y52J 3IAM2 3HOSA 2NNNA 4HZFA 1UHMA 1W5SA 2KKOA 4RAFA 1HDPA 1AKHA 1WJCA 3H0GJ 5L3BA 2JPCA 1KQ9A 2QA4I 1QZZA 3RYPA 2H6CA 4KFCA 3ZMZA 1MMAA 4HSRA 1U8BA 4DBQA 4CHUA 2F5CA 1VQ6I 5KAFC 1DU6A 4EV0A 2O3FA 1WJBA 4R1HA 2JVHA 1JGSA 5FB2A 1I1GA 3GFJA 4QPOA 1R1VA 3ONQA 3D5RC 1HSJA 2XGEA 1EH8A 2E34A 3SZGA 2X1DA 1T38A 3RKYA 5K7HA 3OYJA 1GV5A 1I6XA 1E3HA 3ECOA 2NXNB 3PIPF 3JRIA 3CCQI 4RA2A 5FKMA 4NC7A 2KZGA 2DI3A 3CF5F 2PLYA 4WF2A 2BGCA 2LKSA 1E2XA 3DF8A 1Z9CA 3LFKA 4AVZA 4H0EA 3LL7A 1PUFA 1HDDC 4BE1A 3R0JA 3LSTA 1EH7A 4B3AA 2DXIA 1I3QJ 3HUGB 1O3QA 3K2AA 1MNEA 2CUEA 1UCRA 3CF2A 3SQNA 2L7KA 4QIWN 2HR3A 5HLTA 2JTVA 3I53A 4G8XA 4L9NA 1IRGA 1VF9A 4FE4A 1F9NA 2J5OA 1ZG5A 5E8GA 2R0QC 5HDNA 3W6KB 2WB1A 4IRIA 2L7ZA 1TT5B 3NAUA 2DMTA 3WTYC 3JREA 4HNUA 3S1QJ 1J59A 1WWXA 2R93J 1QHGA 4L9TA 4BNCA 1YW9A 1J0RA 4UUTA 3C2HA 2M3AA 5F04A 1K61A 1U9NA 1U5TA 3TMOA 3FX3A 3CUQB 3K4KA 3WU2C 5HLHA 4BDYA 1BOBA 2LY1A 1Z77A 4HX7A 4XN0A 1XMKA 2VB6A 3S15J 1B72A 2OUMA 5F1JA 2EFPA 2NS7A 2DO7A 2G9WA 5EYRA 2ECCA 2M45A 5J6XA 1A6IA 1ITYA 2P7VB 4BHBA 4RMNA 3IWZA 1U2WA 4KIBA 2QENA 4HQMA 3BQZA 2O0YA 1YJNI 2NVYJ 2K9LA 1MMSA 1GXQA 2KFDA 3SFIA 4UUSB 4V2GA 4L5IA 4BHCA 1YS7A 2EBIA 2FQ3A 4P9UA 4IX7A 2ZBKA 1JT0A 2DQLA 1MKMA 2KP6A 2XB0X 2CQ7A 4A3JJ 1WH7A 4JP0A 4A3KJ 2IJLA 3BOQA 2W85A 4IHSA 3HG9A 3S32A 3TP0A 2B7EA 2WV1A 3D5LA 3S3NA 4Z6YA 2A5WA 2RNGA 3CJRB 1POGA 5M5XJ 3KX2A 4NBQA 4FTHA 2L9NA 3T8TA 4MFEA 3K2ZA 3OS0A 4M3FA 1A35A 4U87A 5E79C 3F8NA 5DD4A 2NS0A 3ZN1A 3NEUA 5HODA 2ZSHB 2HNHA 4CYDA 2DMQA 3WTUC 4YFNF 4XLCA 3IV5A 2WB1N 5H6QA 3BG9A 2D1HA 3CCEI 2LRDA 5DM7F 4E70A 2ME0A 1HQCA 4ZTJA 2LKPA 1U78A 2DOAA 2L2OA 1ZK8A 5IP6A 3QAHA 1R71A 3WU0A 4UVCA 2CV2A 4RB0A 3ECHA 3TGNA 1TTYA 2V4JC 2H09A 5K7ZA 1G4DA 2DN0A 4ZYGA 3K6GA 1DDNA 3ABKH 2M8EA 5ICFA 1DQUA 2BOLA 2ZCWA 3KFWX 2EFNA 4LK1F 1IRFA 1Y0NA 1MW7A 2GA1A 5E8IA 3HBLA 2L5QA 1MMDA 2EA2A 1TWCJ 3BZCA 4F91B 1N77A 4N4OB 4CA0A 5J8CA 2ID6A 1LPQA 4BQAA 1U9OA 9ANTA 2PN6A 2MSYA 1OCZH 1SFXA 3KP5A 3KP7A 2M87A 2I5UA 1V5GA 1S3JA 2O61A 2AQFA 4A3LJ 2M4GA 4GRIA 4RGSA 4M9XA 3PNVA 2IAIA 1BI2A 4RM2A 1FPQA 3N05A 4DGWB 3K7AJ 4PZJA 1R6RA 2XAGA 1KU3A 1TWAJ 4NC6A 3E6CC 3C3WA 3EQLF 2XKPA 3RI4A 4MEXF 2LFBA 4MEYF 2TDXA 3SDBA 2Q8KA 2BW3A 5L3DA 3KLNA 2E5NA 2LKXA 3I4MJ 3PQKA 4I98B 3W2WA 4XICA 1WFXA 3M8EA 2FEZA 3QQAA 2AO9A 4PFPA 2KZVA 2K9NA 4E7HA 4MO7A 4EM0B 3VYUB 1XMXA 2XKOA 4L9JA 3ZOBA 3ZQHA 2HOSA 2BY2A 2QGUA 2DMUA 2OA4A 3M4OJ 1IXSB 2EQRA 2DOFA 3WG7H 3O2PE 3QPSA 4B47A 2RKHA 2VONA 3CC7I 5GTHC 1FYMA 3HOVJ 1Z7LA 1FMVA 3CO6C 3HTSB 4Y3OA 4XRMA 2WAQN 4G12A 4EJUA 2E36A 3AG3H 4DOZA 1H9TA 2Z5UA 4AIJA 5DCFA 1MBJA 1W4MA 4XR6A 4HV5A 3RPQA 3NQOA 5JFRA 1QPMA 3V8JA 1SMYF 2LF8A 1X1PA 2RQPA 2XVCA 2EFOA 2H6BA 3UR3C 2JA8J 2HQRA 2MYSA 3GZNB 1BIAA 4PSWA 3TQNA 3LSMA 1VQ8I 3HOUJ 2GIVA 2XRLA 2JA7J 1SD4A 3E7LA 4C2UA 2Y30A 3BG3A 3GZ5A 3SZPA 2V79A 4E7LA 2DPDA 1OCPA 4GO1A 3OYMA 1X2NA 4B09A 3GWZA 2L7MP 2IP2A 1YE9A 1BW6A 2KIQA 2EV5A 3WGIA 1IZ1A 2IGKA 3TW7A 2K3PA 5K7FA 3CUQC 1W7PD 1B1BA 2DA4A 1FBUA 4JBAA 2RV8A 3CZ6A 3ISPA 2DA7A 5IT9K 4D1QA 3UNGC 4ZYAA 4KYWA 1UHWA 3A03A 2HQAA 2QVOA 2CFXA 2R5YA 2L7FP 5EJCA 2M4KA 2DDBA 2EFQA 3H9JA 5LEKA 2STWA 5KK1A 1BR1A 3K4MA 3G4SI 4LFUA 4CYCA 1GLNA 2K3FA 3G3ZA 4HV6A 2O8KA 1GDTA 1MJ9A 1WJ5A 3KIOA 4FHTA 4XRFA 3RJPA 4AIHA 2LVSA 1BJAA 1P4AA 5HS9A 1FTZA 2Z99A 1S72I 4M3DA 2L4AA 2Q0OA 3ZR8X 3A0BC 1J9IA 5C3EJ 1KGSA 3L2RA 2IRFG 1S9HA 2V1XA 4I6ZA 1FLIA 1TQMA 5FD5A 1KU9A 2H8WA 5JHUA 4UB6C 4ENKA 1W5CC 1IG7A 3OYDA 2R7SA 3ZQIA 1VQ7I 2ZMEC 3FXKA 1VQLI 2VBXA 4PGHA 5ILUA 3MCZA 2CQKA 3J7AY 5LFAA 3M1CA 1ZG3A 3CJQB 3R6SA 3MZHA 3W3CA 5M3FJ 3L00A 4R8HA 3CMEI 2IT0A 1XGMA 5IOZA 4BKXA 3FXOA 1HBXG 4RAGA 1H8AC 1K6OA 4M9SA 2Y0SN 5JR3A 5CVIA 1WCMJ 2F5VA 5CLSA 5KVRA 1MIJA 3E6DA 4A93J 3ASOH 4RLQA 5J4YA 1S7AA 2CFOA 2Y69H 1W36C 4LGWA 4OINF 4A0ZA 1DP3A 1F43A 1FNNA 4P9FA 1OCOH 3HKZA 1VQMI 2HXIA 2ELHA 1PUFB 4U0YA 3OIOA 3H5RA 3OSGA 5DS9A 4C3IJ 2HQ5A 3QOEA 2VE9A 2HDWA 2F5FA 2Z2SB 5LGNA 1IAWA 2MC3A 1Z0XA 2HWVA 4F3QA 2A61A 2QQBA 3S2HJ 3CJTB 3GTGJ 5FROA 3L09A 4U88A 1NH3A 1G3WA 2BBYA 2WA0A 1LFPA 2QEXI 4KIFA 1OQYA 3JTHA 4BEHA 1ZRDA 2ZXWH 3OWTA 4F52A 1H88C 1WPKA 3JW4A 2DFFA 4ZZLA 5JVGF 4L9VA 1ZN2A 4Q47A 1R5ID 2OTJI 4E7SA 3JSOA 4L5JA 2L02A 3LAJA 4AIKA 2A68F 3ABMH 3FM5A 4O6JA 4W1UA 3BG6A 2D5VA 5K5QA 2Y9YA 4KT6A 3VODA 1MSEC 4IL6C 4YFKF 2KJCA 2XF5A 2OV7A 2CJJA 4P55A 3ZMTA 3OR1C 3KE2A 2ZNZA 3JAMZ 1XGSA 3LA3A 5L3EA 2EV6A 1BI0A 2K02A 4WXHA 1XMAA 3T8RA 3MD2A 5E3OA 1WI9A 1ACIA 3VYSB 4MQVA 3WODF 4QSHA 4A3GJ 2XF7A 5J40A 3HPHA 2EZIA 3GFLA 3ZGKA 3OYHA 1ZYRF 1VQ4I 2P8TA 3H9QA 1Y6IA 1D8KA 4HBLA 3R61A 3RTRA 3OOPA 2R7TA 1HKSA 2X1CA 3HDDA 3CMYA 2YU3A 3GO5A 2HI3A 1XDUA 5CQGA 2RGVA 2VOOA 1WHUA 1GHCA 3GTKJ 1KU2A 3S2DJ 3KCCA 3GFIA 4IZZA 4HLYA 1IC8A 4XLPF 5GAEJ 3GUDA 2R3SA 5FO5A 3QOPA 4XOPA 4C3HJ 5EEHA 2LBFB 4JX5A 1P4XA 3IKVA 3FMQA 2J5PA 1ETYA 3ZQFA 2XPWA 5LEJA 2PMZA 3KZIC 5DYMA 4AUXA 1WKMA 3CO7C 4XKCA 2MLKA 2M8GX 3CLOA 1TNSA 2RQQA 3X2QH 3NARA 1FBSA 2MGQA 3RYRA 2D2WA 4XBFA 3GVAA 2RAEA 2LP0A 5FKKA 3FISA 2BXYA 5JHFA 3DEUA 4BJ6C 5L3FA 2XHKA 3CCMI 3OR2C 4RGRA 1MMNA 1IO2A 3GYHX 1BC8C 1WRJA 1W7PA 1DGWY 2KL4A 1STZA 4XLHA 3KYCB 2RDPA 2N8GA 2OCCH 1LEBA 3B73A 3G2BA 4WXDA 1NG7A 1K78B 3DLLF 3PFYA 2A05A 3GFMA 1MNDA 3BC8A 1AOYA 1TWFJ 4ZJZA 2FNAA 2JSPA 3I9V2 1G8XA 3I59A 2M30A 3H3ZA 2CMPA 5LHGA 1YX5A 5J1RA 2EZLA 2R7ZJ 4CXFA 4OIQF 2NVUB 2PBIA 2WY7Q 5EZHA 3MKZA 2EZKA 2DODA 2ID3A 4LG3A 3M8JA 3W2VA 1FSHA 2AHQA 2HXOA 4EM1A 3FDYA 5LRSA 2IGNA 2L54A 2FBKA 5GADJ 3E6MA 1JKRC 2K9MA 3K69A 2BXZA 1IV6A 1O3RA 3HKZN 3ABUA 1Q1VA 2I8DA 3FF5A 3IAS2 2HOEA 2JA2A 3W6VA 1OLTA 2VIXA 2BY0A 2R7UA 4II3A 2Y0SA 3F3XA 1TQPA 4RDUA 4OMZA 5HVQC 2W00A 4FQGA 4PDKA 1IF1A 2B63J 3GTPJ 2M5WA 4WWCA 1QO0D 1VTNC 5C4XJ 1U5TC 3IH3A 4G94A 5EGOA 2ELJA 1QVUA 3JSPA 2CV0A 2OF7A 2BVLA 1FMWA 4A0XA 3BR1A 5H6RA 1R4NB 2OAZA 3BQYA 5CVUA 2GQQA 4BHPA 2XC7A 1O7LA 1V3FA 3PQJA 3ZMVA 4ZH4F 5CJ9A 4RB3C 2QSGX 2G7HA 2K40A 3FXMA 4EM2A 1ETKA 3TDZC 3A01A 2EK5A 3A1YA 1JGGA 3U1DA 2K86A 2BY3A 5ICCA 2O8XA 4DQ2A 4R79A 5HDKA 4WX9A 4PK4A 2QKMB 1YHQI 1Z05A 1JE8A 3HPGA 1XG1A 1YJWI 4AIDA 2PMZN 3AG4H 5D6FA 2X85A 4NHJA 4IHYA 2ICWG 1ZREA 5E3LA 1ETVA 4CO8A 1XC5A 2FOWA 1USTA 1XB4A 2Y0MA 1WQ2A 1LE8A 4KMUX 5J47A 4BY1J 1FTTA 1L0OC 1EV7A 4I76A 1IXCA 2KIFA 5HLGA 1Z91A 1XDSA 2B9SA 2OPTA 5EEAA 4U7BA 1YITI 1WZ2A 1I50J 4KDPA 1MBGA 1P6RA 4D7NA 3ERED 3HXLA 2EZHA 4AWXB 2DPUA 2LYCA 3K1MA 2P5LC 3I3LA 4YIFA 3CMAI 1Y0UA 5IT9Z 2ZNYA 4IQ4A 4IOAF 2K9SA 3G1LA 3WTTC 4U0WA 4BE0A 1K4SA 4MIMA 3VSKA 1ZLJA 2FOKA 4ZYDA 5BS6A 2UUZA 1F1ZA 1TW3A 3GZ6A 3K4NA 1X2MA 3GCMA 3BG5A 1JUPA 1VQOI 2DK8A 3NWTA 3LSJA 2Q1ZB 3OYBA 2FF4A 3SEZA 1T95A 2XPVA 2MH9A 3SXYA 3L9FA 4M9ZA 4LITA 3ZQQA 3FHZA 2V6EA 2P5KA 3KZYA 4B1RA 2V9KA 3S2WA 1ZRFA 1O57A 2WAEA 3LSHA 2ISZA 2P7CB 2VXZA 3ASNH 2YU9J 4ENNA 1BL0A 3QPTA 4JQFA 2V1DA 3OS1A 1OMIA 4EVIA 1G59A 3S3MA 1RR8C 2IGMA 2FMYA 3BY6A 4Y33A 3K9TA 3PFIA 1P4WA 5ICGA 4IXAA 2VLAA 3Q5FA 1R5GA 5B66C 2WWYA 1I3AA 4CH7A 4UXNA 2LH9A 1X4OA 1OYYA 3QPLA 3H0DA 3C2BA 5LHHA 5CVJA 2W48A 4XRSA 4ESJA 1SVOA 2L01A 2YPRA 1B9MA 3F6OA 4B4CA 4UVBA 4CYCB 4IHTA 1XN7A 1VQPI 5IP9J 4MFDA 4LLNA 5C44J 3A2KA 1R5HA 2NRAC 5FLVA 2ZB9A 2LY2A 2X1EA 5DEQA 1RRJA 2R7WA 1JKOC 2DFIA 2Y2ZA 4IPAA 4KUMA 1G3SA 3S1RJ 1Z3YA 1LDJA 3L7WA 4DBRA 3M9AA 3DEEA 1XGNA 3ABLH 1R00A 1BM9A 3PUBA 4AD9A 3ZPLA 3HM5A 3N4MA 3M8FA 2R7FA 3CCRI 4UVAA 4LD5A 1HF0A 2QSHX 1SFKA 3H5NA 4Y17A 2OQRA 1BA5A 3HUGA 1H89C 1WJAA 5IT3A 2NVXJ 2K27A 2ZXIA 1Z3XA 2QYOA 3LA7A 3VWBA 1FZPB 3K1NA 3ULQB 4A5NA 3OYNA 3IL2A 5CQEA 3BPXA 3Q0WA 3HRSA 1SFUA 3IH4A 1R1TA 4HOBA 3OYKA 4A6DA 3LSRA 1IUFA 1F5TA 4IHVA 4I02A 4PFOA 2X48A 4CUGA 2P4WA 1JTXA 1UB9A 2GOXB 2K7LA 3EETA 1RETA 2A6HF 1V5FA 4HA8A 4OU0A 2FRHA 1T08B 4ZDLA 4A12A 1UHSA 2MABA 2R7OA 4XLEA 2DT7B 1CQTA 1NK2P 3GTMJ 5DM6F 2QBYA 1RUNA 3FWEA 3KEQA 1TL8A 1NK3P 3RCOA 5JI6A 3O8HA 3W2AA 2DAOA 2ZFUA 3QWLA 5D5UB 4OWRB 1TW2A 1FX7A 1U6GA 1E3OC 4YG2F 1W0TA 3HGYA 1Y39A 4E7KA 2XUBA 1HXDA 1M1EB 1BR2A 4YIIA 5M5YJ 2MG4A 1BOAA 4G6QA 3RIRA 2A07F 1VQ5I 4M6YA 3PJRA 1JJ6C 3M07A 5J1YA 3ESWB 3TL4X 4EQQA 3JRAA 4RS8A 1SD5A 1YI2I 3C18A 3OYAA 2EH3A 3BP8A 2GM4A 2Q2EA 1R22A 3I5UA 4WCGA 1OCCH 3V4GA 2IS1A 3DTKA 3J7ZI 2LBFA 3HRTA 2UXXA 1YFHA 4N0BA 4QPQA 2DYSH 2WAFA 1V54H 3R4KA 1MDMA 3VOEA 2LG4A 5BMZA 5F0FA 4Y13A 2M2EA 1T2KA 2BZTA 1SC7A 1DP7P 2ACJA 1REPC 2HOTA 4I2OA 5F6FA 1IN6A 2XB5A 2W7NA 1T98A 2DA2A 1ON2A 2AXLA 1UZCA 3ML6A 4D0PA 4RBOA 3TOAA 2DYRH 3MWMA 4AM3A 3S8PA 2ZMEB 2E1NA 1B4AA 4GCVA 1B6AA 1LJ9A 1Y56A 3F23A 2ISYA 3FHNA 4PGGA 3JRFA 2ZJQF 3WTXC 1X4PA 2LDUA 2IA2A 1EF4A 4ON0A 1FP2A 3WG9A 5L3GA 1Y8RB 2K5CA 2OU2A 4X1EA 4IEJA 2ZXHA 4BXFA 1ZGWA 2HPMA 2OCEA 3E5XA 3BWGA 3S3OA 1K78A 4A3DJ 1K7AA 1OYIA 2CRGA 2JMWA 2HPIA 3BCAA 1MZBA 4B43A 2F48A 1MBFA 3P9IA 3P7NA 2W84A 3AL0C 4UHTA 3S1NJ 2FXAA 3I56I 4HF1A 2VOPA 2L9VA 2AS5F 3L1PA 2R5ZA 1TP4A 3GTOJ 1IN4A 3JRDA 2OJED 4IKFA 5F27A 3OYFA 3LMMA 2BHZA 3CDHA 1IDYA 3V42A 5C4JJ 4E7IA 1IV8A 4PUSA 2GBYA 3MFKA 1X3WB 3QP6A 3CC2I 3BR6A 2W1OA 3Q9SA 2L9SA 2CU7A 3HIFA 1Y1WJ 4LLGF 4ETSA 1PP7U 2E1OA 6PAXA 5D8LB 2FSWA 4XL9A 1LVAA 1UJ8A 2MW8A 5TGTA 3HSRA 4J00A 1L3LA 4DYRA 1APLC 5FRNA 3CP8A 5J1UA 3DKWA 2E2JJ 5FFZA 3DTIA 4ENMA 3H36A 2CW0F 3K70C 2JT1A 2DJNA 2E1MB 4NUBA 5B1BH 1SEUA 4FETA 4Y4RA 2EJRA 1FY7A 3O8GA 2Y9ZA 3LQQA 2TRTA 1MH4A 2QF7A 3K1PA 2GXAA 3VPRA 4CDGA 3MN2A 1MMGA 2OTLI 3BJ6A 2M1BA 4IO9F 3MZ8A 1QVTA 1WGXA 4W97A 3V8LA 2VPRA 3N97A 3RKXA 1MJBA 3W6JB 2F5DA 1B8IA 4KISA 2HGCA 1RUOA 3REOA 3H92A 2GLOA 4U0VA 3IWFA 1VZ0A 5D8KB 5D5VB 1WJFA 3F0CA 1IJWC 5E18F 5D5XB 2W82A 3RKQA 3A01B 1IRXA 4B3XA 1LEAA 1J7KA 2QM3A 1LDKB 2CW7A 3IC7A 2VJJA 1LNWA 1X1BA 3QU3A 5BOXA 1PP8F 4MLOA 1YW7A 4HF2A 3IRRA 4MTEA 1SAXA 2HZTA 2OBPA 1XSDA 1RKWA 1MD0A 1Z21A 1YS6A 4XKWA 2CUZA 2LNBA 1SFEA 1XD7A 2JUGA 3HJEA 4C30A 3J80Z 3I54A 1K79A 1NTCA 3ELKA 3BG7A 5H20A 4MGRA 4DZJA 1LVKA 2VE8A 3PO3J 3HYIA 2X6OA 2XSJC 3GTJJ 3K70D 4EATA 2CYYA 4NNJA 1QPIA 4ESBA 4MTDA 3R60A 2K4JA 2GAUA 2DFEA 1O3TA 1KU7A 1H9GA 3HOTA 3GTQJ 1SANA 4XM3A 2KRCA 5DUIA 5KNLA 2NVTJ 4FE7A 4LIVA 3DWLE 2DQRA 2JZYA 2F6CA 2ETHA 1O7FA 4ZYHA 5J8FA 2QSFX 2FQ4A 4OIOF 1Z1DA 2KJBA 1HKQA 4GXOA 5FKLA 4GDFA 2IGOA 4UY8I 1FOWA 2CQNA 1LDDA 3ZMUA 3ZQLA 5M3MJ 5DCMB 1X1AA 3T0YA 2VQCA 4V2FA 2RNJA 3O6BB 3LSKA 1YOVB 3E5QA 2QQ8A 4D5FA 1VNDA 3DQVC 1F4KA 5F1RA 2CUJA 2R5YB 4YFXF 1J09A 1D0YA 2GXGA 3ZMDA 1D3YA 2O6GE 1LUJB 3U21A 1QA6A 2VXDA 3OYIA 3HSFA 4D9JA 1R7JA 1Q1HA 4M3EA 3BTJA 2JUCA 5K5RA 4BQOA 3S14J 1YW8A 5ERIA 5A2QK 4L5EA 1V4RA 2R7QA 4RM3A 4M3BA 4KIGA 1TQIA 1ZGJA 1FOXA 4XSZF 1NG6A 3A02A 1TNTA 1ZAOA 2WBMA 3DP7A 1D1CA 3RQIA 3SFZA 2IS4A 5BPIA 1LQ1A 2VBYA 2DT5A 2IW5A 1FJLA 2A5YB 1XCVA 4F7ZA 3C2GA 3G1MA 2L3DA 3RZDJ 3DBHB 4HX4A 1T33A 1ZQ3P 2DOEA 1MBEA 3SJMA 4AU7A 5LLQA 2NYXA 4I99C 2FUG2 3LA2A 4A69C 4B44A 5EG0A 2P6TA 3EUHC 4OAZA 3DPTA 4AYBN 2YX4A 2HOAA 5IP7J 4N4NB 3VB2A 2GWRA 3J80K 3HL2A 3VFZA 3CP2A 1A36A 2ESNA 1TLHB 2PMHA 4EMSA 1O4XA 1OFCX 4PSXA 5F0CA 1R49A 2FMLA 1X1CA 2VKEA 3HB9A 2AQEA 4LG0B 2HU9A 3DTEA 4EGZA 2JRMA 1D8JA 4DJAA 2M0CA 2NOJB 4MNUA 2W4SA 1A6QA 2LC2A 1SVLA 5BPDA 4XKBA 4LLLA 3JCUC 1U8RA 3CCVI 3P9KA 3CCYA 5HNHA 3LSIA 3SEQA 4BE2A 1D1BA 2GA2A 2M7BA 3AG1H 4XOTA 4XIDA 1ETWA 2Y31A 3ERMA 3HOWJ 4O5VA 1RC9A 2VBZA 1RPWA 3FKJA 5BNGA 1LE8B 4A6EA 2HDDA 3FK6A 1A5JA 1FT9A 1MSFC 4ASNA 2D1VA 2LD5A 2NOGA 1MBHA 3CCUI 1LFBA 4UNOA 2IEKA 3CCSI 4XLAA 1JHFA 2F4MB 2MA3A 2KRFA 1ZHFA 2R92J 1ZELA 3EUHA 4S04A 4PJLA 4XKVA 2COBA 3KLOA 1ORKA 3A0HC 3BCBA 1QQIA 1TC3C 1YRNB 2IPQX 3GF2A 3I4NJ 1XTAA 4CGZA 3E3VA 3AAFA 5HLIA 3CDIA 3BDDA 5E1XA 3HOZJ 3MVPA 3K4JA 4WK8F 3DKYA 4OIPF 4HRIA 4PJ0C 3IH2A 4BBRJ 3K10A 1ERDA 4ZC3A 5AIQA 3IRQA 2LMDA 2ZJPF 1XPXA 1S8NA 2R7DA 3PIOF 4JYKA 5M5WJ 2H94A 3NRVA 2DTZA 3T1BA 3F9KA 1KQ0A 1RIOH 2LREA 4PJNA 3H9GA 5E17F 2VKVA 2DTRA 1YX3A 2IVMA 5KHDA 1OPCA 5GPCA 3OYEA 4IF4A 3TP3A 5K5OA 1YIJI 2CH0A 2MC4A 1BC7C 3RKWA 4HDUA 2Z16A 3FXQA 3L2UA 1MDMB 3FXRA 2GXBA 3OMYA 3DU6A 4ENJA 4P1WA 3HOXJ 1MBKA 4J19A 1OJLA 4G7HF 3ZQ7A 2EB7A 1WH5A 5F64A 4J01A 4E7ZA 2XSDC 2HVQA 1Y1VJ 4I01A 3WE3A 4CICA 4ZTFA 3QRFF 2VI6A 2ADUA 2VT3A 1PVEA 3ZN0A 1IDZA 1HW5A 2JRTA 3GXOA 4NC8A 3OYLA 2KDZA 1HKTA 2DMPA 1UG2A 4CCLA 4O3MA 3F72A 5HNFA 3MMYB 2BEOA 1FYLA 4BGDA 3JTGA 3VDXA 4ZYEA 2VKDA 3ROUA 5FLMJ 1OYWA 4XMYA 1TBXA 3WTSC 3PM1A 2EWNA 3LOCA 4KN4X 5FKOA 1O3SA 2FNPA 1TT0A 3V7RA 4FISA 5B3SH 4I7HA 2CGPA 3G6EI 5GTIC 4JK1X 1PJRA 3QYBA
chains in the Genus database with same CATH topology
4M72A 4A0YA 2OZUA 3COAC 3F22A 5HOOA 3CUOA 3F8MA 3M1EA 5D6EA 3I64A 4KN7X 2RN7A 2DW4A 2DBBA 3KP4A 3DV8A 5E1ZB 5EEGA 1SD7A 2ZMEA 4MQ9F 5TRDA 1QBJA 4MHGA 1ZARA 2PI0A 4EJOA 3FMSA 1UFMA 2HTJA 2E1CA 1QZYA 1QNTA 3C1DA 4RGXA 4M74A 1X3UA 1KQ8A 1FYKA 4BH9A 4IRGA 4P96A 3J81Z 2XAQA 2XASA 3HRUA 3J7AO 3GLXA 1YLFA 3LAPA 3EDPA 3U2RA 2PMUA 4N9IA 1DPUA 4M6XA 2HYFA 3KEOA 5ILSA 2VT2A 2Y75A 2QQ9A 1R58A 1T6SA 2ZJ2A 3MAJA 3HHGA 2DLLA 2HTSA 1DPRA 2ZO4A 1ONVA 5CVVA 4WXCA 3WGGA 1Z7UA 4L18B 3KP2A 2V1UA 2EA4A 4A5MA 4XLNF 1G6NA 1T39A 4N9HA 4S05A 1P2FA 2KIMA 3CJNA 2P5VA 1JHHA 1A04A 5DD8A 1CGPA 2VC0A 4IJAA 2HKOA 4LK0F 1RNLA 1IN8A 1IN7A 5DCMA 3SZTA 3QPHA 4TV7A 4QWQA 3KP6A 2QZ8A 2BV6A 1QGPA 2XROA 2H27A 3GW2A 3H3UA 3SHFA 3F6VA 4ZZDA 3ZMSA 1G3YA 2RC4A 4M71A 3BROA 4KNYA 4A2UA 1MGTA 2E7WA 5L3CA 2STTA 2COMA 3E6BA 2CWEA 4M73A 2W24A 2E7XA 3RPUA 3EYIA 2A6EF 2X4HA 2HQNA 2VC1A 1ZGAA 1W5TA 4HAMA 3V8KA 4HF0A 2FA5A 2QUFA 2VBWA 2XRNA 1I5ZA 1G3TA 1YYVA 3V7CA 1P92A 2PEXA 2A3SA 2MD5A 3ABTA 4GYIA 4LG0A 3MQ0A 4RB2C 5LHIA 2LSOA 1IW7F 2JSCA 2Z9OA 3HRMA 1SD6A 1HSTA 4LJZF 2D45A 5K1YA 4HDVA 1WSUA 1USSA 1IN5A 2OQGA 1FWZA 2BE5F 3BJOA 4Q5SF 2NNYA 1KA8A 1B9NA 1J75A 4G7OF 3F8CA 2LF7A 1Z6TA 1T0FA 2WC2A 2X0LA 2IA1A 1YTYA 2O03A 3WTZA 5FLXK 4B8XA 2WV0A 4L0ZB 4BYYA 1GVJA 1BIBA 1ZRCA 1BI3A 5HS8A 4NQWA 3IKTA 3BPVA 2Z33A 3EYYA 3OV8A 4OOIA 3TO6A 2QBYB 4HX8A 3FZVA 2XAFA 1BI1A 4XSXF 2K4BA 2QQAA 5TJJA 5D5WB 3I58A 3WE2A 2P6SA 1BBYA 4FT8A 1BN5A 3K0LA 3DPLC 3B02A 1YO5C 3M7GA 2VN2A 3CTAA 3BZ6A 1FP1D 4UV9A 1ULYA 4UUVA 3Q9VA 4ESFA 5ED4A 3E5UA 2FE3A 2RVCA 2MLGA 4FX0A 3TKYA 2WTEA 4I0AA 3WGHA 2W25A 4GGGA 1CF7A 1RI7A 2OD5A 3LWFA 3R0AA 1YQAA 3I4PA 1S7OA 5LBQA 5FLXZ 1PDNC 5CYVA 4RAYA 5FGMA 1ZG1A 2PJPA 2XIGA 5JVTA 1C0WA 4Q4ZF 1R36A 3DFGA 1SMTA 2ZKZA 3F8FA 3MEXA 5FFXA 5A2QZ 5ILVA 4RB1A 4KICA 1IXRC 1IUYA 2UZKA 1MJAA 3O3KA 2GZWA 2Y48A 3WTVC 1EH6A 1OKRA 3CUQA 4FX4A 4EGYA 4L0YB 2G7UA 3G73A 4HQEA 4U7DA 1XSVA 5E20A 2A69F 3F21A 5LRRA 1XCBA 1Z6RA 4LB6B 3KP3A 5LGTA 2PG4A 1ODDA 3FM3A 5D4SA 4Y15A 1DUXC 3VEPA 1S29A 3WTWC 2ZXJA 1HW2A 1H0MA 2XV4S 3MZYA 4DNCA 2HEOA 2F5EA 1I1SA 1U5TB 4I0BA 2BYVE 4G7ZF 4K2EA 5LGUA 1GXPA 4AVPA 1ZH5A 4KMFA 1R1UA 3TOBA 2B0LA 2Z3YA 1RZ4A 4EJWA 3QP5A 5DUKA 1FSEA 4PCQA 3J81K 2HDCA 4G6DA 3GEZA 1YIOA 3L2CA 2JPBA 3LQRA 3JAMK 4Z2YA 2W57A 2CG4A 3KETA 3P9CA 2NAZA 1S6LA 3C7JA 2DU9A 4BAYA 2XAHA 4GYGA 3QU6A 1W7PB 2MBFA 3U9GA 2VODA 3V7SA 1E17A 1PUEE 3IHUA 4EJVA 5HS7A 3I59B 2YX7A 1JXSA 2ESHA 5DV5A 3GX4X 4Q48A 5E1WA 2OZ6A 2CSOA 5FD6A 5AONA 5CVRA 3FMRA 3TO7A 3KZZA 2HYGD 1YG2A 3E97A 2QLZA 2L4MA 4KT5C 2YR2A 3RDIA 4KA4A 4RAZA 4HW0A 1KYWA 4HYEA 1OR7A 1ZLKA 1AWCA 4UV8A 1D5VA 3TDUC 5D4RA 2V9VA 2DK5A 5DDGA 1XSXA 2FBHA 2PFBA 4G9YA 5ICEA 3I0TA 2IA0A 3TO9A 2C6YA 2F2EA 2HFHA 3BJAA 4EJTA 2XGXA 1I27A 2PQ8A 1ON1A 5HDGA 4OIRF 4I09A 4P5OA 2HKXA 3F8BA 1FBQA 4RGUA 2FU4A 4CZZA 1LB2A 2EFWA 2ZFWA 1J5YA 1XGOA 2YSRA 2XAJA 2UWMA 4IRHA 5BQTA 2KIUA 2FBIA 3WU1B 4LB5A 2MH2A 3HHHA 1NHAA 1KYZA 4OMYA 3HSEA 1B59A 1FOKA 3I71A 4LMYA 1R23A 3ZP5A 2CO5A 3DXJF 5AIPA 2QWWA 1HW1A 3FXUA 2UXNA 1U3EM 4HLXA 4IVNA 2HS5A 3T5XA 4NB5A 4BXUA 1FC3A 3D0SA 1CF7B 2V6CA 3HTUA 2EV0A 1J2XA 4QLCU 3HOSA 2NNNA 4HZFA 1UHMA 1W5SA 2KKOA 5L3BA 2JPCA 1KQ9A 1QZZA 3RYPA 2H6CA 4KFCA 3ZMZA 4CHUA 2F5CA 4EV0A 2O3FA 4R1HA 1JGSA 5FB2A 1I1GA 3GFJA 1R1VA 1HSJA 1EH8A 1T38A 3RKYA 1I6XA 3ECOA 2DI3A 2PLYA 4WF2A 2BGCA 1Z9CA 1E2XA 3DF8A 3LFKA 4H0EA 3R0JA 3LSTA 1EH7A 1O3QA 1UCRA 3SQNA 2HR3A 2JTVA 3I53A 4G8XA 4L9NA 1IRGA 1F9NA 2J5OA 1ZG5A 5E8GA 5HDNA 3W6KB 4IRIA 3WTYC 1J59A 1WWXA 4L9TA 4BNCA 1YW9A 1J0RA 1U5TA 3FX3A 3CUQB 5HLHA 4HX7A 1XMKA 2EFPA 2DO7A 2G9WA 2M45A 5J6XA 2P7VB 4BHBA 3IWZA 1U2WA 4KIBA 2QENA 4HQMA 2O0YA 1GXQA 4L5IA 4BHCA 1YS7A 2FQ3A 4P9UA 2ZBKA 2DQLA 1MKMA 2IJLA 3BOQA 2W85A 4IHSA 3D5LA 3T8TA 3K2ZA 3F8NA 5DD4A 2NS0A 3ZN1A 3NEUA 4CYDA 3WTUC 4YFNF 5H6QA 2D1HA 4E70A 1HQCA 1U78A 2LKPA 3QAHA 3WU0A 4UVCA 4RB0A 3ECHA 3TGNA 1TTYA 2H09A 1G4DA 4ZYGA 1DDNA 2M8EA 5ICFA 2ZCWA 4LK1F 3KFWX 2EFNA 1IRFA 2GA1A 5E8IA 2EA2A 5J8CA 4BQAA 2PN6A 1SFXA 3KP5A 3KP7A 2M87A 1S3JA 2O61A 4RGSA 4M9XA 1BI2A 1FPQA 4PZJA 2XAGA 1KU3A 3E6CC 3C3WA 3EQLF 2XKPA 3RI4A 4MEXF 4MEYF 2TDXA 2Q8KA 5L3DA 3KLNA 3PQKA 4I98B 3M8EA 2FEZA 4EM0B 2XKOA 4L9JA 2OA4A 1IXSB 3O2PE 2RKHA 2VONA 1FYMA 3CO6C 3HTSB 4EJUA 1H9TA 2Z5UA 4AIJA 5DCFA 1W4MA 4HV5A 3RPQA 3NQOA 5JFRA 1QPMA 3V8JA 1SMYF 2LF8A 2XVCA 2RQPA 2EFOA 2H6BA 2HQRA 1BIAA 3TQNA 2GIVA 1SD4A 3GZ5A 3SZPA 2DPDA 2V79A 4GO1A 4B09A 3GWZA 2IP2A 2EV5A 3WGIA 1IZ1A 3CUQC 1W7PD 1B1BA 1FBUA 4JBAA 2RV8A 3ISPA 5IT9K 4KYWA 1UHWA 2QVOA 2CFXA 2EFQA 5LEKA 2STWA 5KK1A 4LFUA 3G3ZA 4HV6A 4AIHA 1MJ9A 4FHTA 4XRFA 3RJPA 5HS9A 1BJAA 1P4AA 2Z99A 2L4AA 2Q0OA 1J9IA 1KGSA 2IRFG 2V1XA 1FLIA 1TQMA 5FD5A 1KU9A 5JHUA 4ENKA 2VBXA 4PGHA 5ILUA 3MCZA 2CQKA 3R6SA 1ZG3A 3MZHA 3L00A 4R8HA 2IT0A 1XGMA 1HBXG 1K6OA 4M9SA 5JR3A 5CVIA 5CLSA 5KVRA 3E6DA 1S7AA 4LGWA 4OINF 4A0ZA 1FNNA 4P9FA 2ELHA 4U0YA 2VE9A 1IAWA 2F5FA 5LGNA 2MC3A 2HWVA 2A61A 2QQBA 3L09A 4U88A 1G3WA 2BBYA 4KIFA 3JTHA 1ZRDA 3JW4A 4ZZLA 4L9VA 1ZN2A 4Q47A 3JSOA 4L5JA 2L02A 3LAJA 4AIKA 2A68F 3FM5A 4O6JA 5K5QA 3VODA 4YFKF 2KJCA 4P55A 3ZMTA 3KE2A 2ZNZA 3JAMZ 1XGSA 3LA3A 5L3EA 2EV6A 1BI0A 2K02A 4WXHA 1XMAA 3T8RA 1WI9A 3WODF 4MQVA 3GFLA 1ZYRF 2P8TA 1D8KA 4HBLA 3R61A 3RTRA 3OOPA 1HKSA 2YU3A 3GO5A 1XDUA 2RGVA 2VOOA 1GHCA 1KU2A 3KCCA 3GFIA 4HLYA 4XLPF 3GUDA 2R3SA 5FO5A 3QOPA 5EEHA 1P4XA 3IKVA 3FMQA 2J5PA 5LEJA 5DYMA 1WKMA 3CO7C 2MLKA 3CLOA 1TNSA 1FBSA 3RYRA 2D2WA 4XBFA 3GVAA 5L3FA 3DEUA 2XHKA 4RGRA 3GYHX 1BC8C 1WRJA 1W7PA 1STZA 2RDPA 1LEBA 3B73A 4WXDA 1K78B 3GFMA 1AOYA 2FNAA 3I59A 2M30A 3H3ZA 5LHGA 4CXFA 4OIQF 2PBIA 1FSHA 4EM1A 5LRSA 2L54A 2FBKA 3E6MA 3K69A 1O3RA 3ABUA 3FF5A 2HOEA 3F3XA 1TQPA 4OMZA 5HVQC 4PDKA 1IF1A 2M5WA 4WWCA 1QO0D 1VTNC 1U5TC 4G94A 3JSPA 4A0XA 5H6RA 2OAZA 4BHPA 2GQQA 5CVUA 1O7LA 1V3FA 3PQJA 3ZMVA 4ZH4F 5CJ9A 4RB3C 2G7HA 4EM2A 3TDZC 2EK5A 3U1DA 2K86A 5ICCA 2O8XA 4DQ2A 4R79A 5HDKA 4WX9A 1Z05A 1JE8A 5D6FA 4NHJA 1ZREA 4CO8A 1USTA 1XB4A 2Y0MA 1WQ2A 4KMUX 1L0OC 1EV7A 1IXCA 2KIFA 5HLGA 1Z91A 1XDSA 4U7BA 4KDPA 1P6RA 3ERED 4AWXB 2DPUA 3K1MA 2P5LC 4YIFA 1Y0UA 5IT9Z 2ZNYA 3WTTC 4U0WA 1ZLJA 2FOKA 4ZYDA 5BS6A 3GZ6A 1F1ZA 1TW3A 2DK8A 2FF4A 2MH9A 3SXYA 3L9FA 4M9ZA 3FHZA 2P5KA 3KZYA 3S2WA 1ZRFA 1O57A 2ISZA 2P7CB 2VXZA 4ENNA 3QPTA 4JQFA 2V1DA 1OMIA 4EVIA 2FMYA 3BY6A 3K9TA 3PFIA 1P4WA 5ICGA 4IXAA 3Q5FA 1R5GA 2WWYA 4UXNA 1OYYA 5LHHA 5CVJA 4ESJA 2YPRA 2L01A 1B9MA 3F6OA 4UVBA 4IHTA 1XN7A 4LLNA 1R5HA 2NRAC 5DEQA 2DFIA 4KUMA 4IPAA 1G3SA 1LDJA 3L7WA 3M9AA 1R00A 1XGNA 1BM9A 4AD9A 3ZPLA 3N4MA 3M8FA 2R7FA 4UVAA 4LD5A 4Y17A 2OQRA 3HUGA 5IT3A 2K27A 2QYOA 3LA7A 1FZPB 3K1NA 3ULQB 3IL2A 4A5NA 3BPXA 3HRSA 1SFUA 1R1TA 4HOBA 4A6DA 1F5TA 4I02A 2P4WA 1UB9A 3EETA 2K7LA 4OU0A 2A6HF 4HA8A 2FRHA 4A12A 2QBYA 1RUNA 3FWEA 3KEQA 5JI6A 2DAOA 5D5UB 1TW2A 1FX7A 1U6GA 4YG2F 2XUBA 1HXDA 4YIIA 1BOAA 4G6QA 3RIRA 2A07F 4M6YA 4EQQA 4RS8A 1SD5A 3C18A 3BP8A 2Q2EA 1R22A 3I5UA 4WCGA 3V4GA 3HRTA 2UXXA 1YFHA 4N0BA 3R4KA 1MDMA 3VOEA 5BMZA 4Y13A 1T2KA 1DP7P 2ACJA 1REPC 4I2OA 5F6FA 1IN6A 1T98A 1ON2A 2AXLA 3ML6A 4D0PA 3TOAA 3MWMA 2ZMEB 2E1NA 1B4AA 4GCVA 1B6AA 1LJ9A 3F23A 2ISYA 4PGGA 3WTXC 2LDUA 2IA2A 4ON0A 1FP2A 5L3GA 2OU2A 3E5XA 3BWGA 1K78A 1K7AA 1OYIA 1MZBA 3P9IA 3P7NA 2W84A 4UHTA 2FXAA 4HF1A 2VOPA 2AS5F 1IN4A 3CDHA 3MFKA 3QP6A 3Q9SA 3HIFA 4LLGF 4ETSA 1PP7U 6PAXA 5D8LB 2FSWA 1LVAA 3HSRA 1L3LA 3DKWA 5FFZA 4ENMA 2CW0F 2JT1A 2EJRA 1FY7A 3LQQA 3K1PA 4CDGA 3BJ6A 2M1BA 3V8LA 3N97A 3RKXA 1MJBA 3W6JB 2F5DA 2HGCA 1RUOA 3REOA 3H92A 4U0VA 3IWFA 5D8KB 5D5VB 5E18F 5D5XB 1LEAA 1J7KA 2QM3A 1LDKB 3IC7A 1PP8F 1LNWA 3QU3A 5BOXA 1YW7A 4HF2A 3IRRA 4MTEA 1SAXA 2HZTA 2OBPA 1XSDA 1MD0A 1YS6A 2LNBA 1SFEA 1XD7A 3J80Z 1K79A 3I54A 3ELKA 5H20A 4MGRA 2VE8A 3HYIA 2CYYA 4ESBA 4MTDA 3R60A 2K4JA 2GAUA 1KU7A 1O3TA 1H9GA 3HOTA 5DUIA 2DQRA 2JZYA 4ZYHA 2ETHA 1O7FA 5J8FA 4OIOF 1Z1DA 2KJBA 1HKQA 4GXOA 3ZMUA 1LDDA 5DCMB 3T0YA 2RNJA 3O6BB 3E5QA 1F4KA 3DQVC 5F1RA 4YFXF 2GXGA 3ZMDA 1D3YA 2O6GE 3HSFA 1R7JA 1Q1HA 5K5RA 1YW8A 5ERIA 5A2QK 1V4RA 4KIGA 1TQIA 1ZGJA 4XSZF 1TNTA 1ZAOA 3DP7A 3SFZA 5BPIA 1LQ1A 2VBYA 2DT5A 2IW5A 2A5YB 1XCVA 4F7ZA 2L3DA 4HX4A 5LLQA 2NYXA 3LA2A 2P6TA 3DPTA 2YX4A 3VB2A 3J80K 2GWRA 3VFZA 2ESNA 1TLHB 2PMHA 4EMSA 2FMLA 4LG0B 4EGZA 1D8JA 4MNUA 5BPDA 4LLLA 1U8RA 3P9KA 2GA2A 4O5VA 2VBZA 4A6EA 1FT9A 4ASNA 2D1VA 4UNOA 1JHFA 2MA3A 2KRFA 1ZHFA 3EUHA 4S04A 3KLOA 1QQIA 2IPQX 3GF2A 4CGZA 3E3VA 3AAFA 5HLIA 3BDDA 5E1XA 4WK8F 4OIPF 5AIQA 3IRQA 1S8NA 2R7DA 2H94A 3NRVA 3T1BA 1KQ0A 1RIOH 5E17F 2DTRA 2IVMA 1OPCA 4IF4A 5K5OA 1BC7C 3RKWA 4HDUA 3FXQA 1MDMB 3FXRA 2GXBA 4ENJA 4G7HF 3ZQ7A 2EB7A 5F64A 4I01A 3WE3A 4CICA 3QRFF 2ADUA 2VT3A 3ZN0A 1HW5A 2JRTA 3GXOA 1HKTA 4O3MA 3F72A 2BEOA 1FYLA 3JTGA 4ZYEA 3ROUA 1OYWA 1TBXA 3WTSC 2EWNA 4KN4X 1O3SA 2FNPA 3V7RA 4I7HA 2CGPA 4JK1X 3WG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M72 A;  4A0Y A;  2OZU A;  3COA C;  3F22 A;  5HOO A;  3CUO A;  3F8M A;  3M1E A;  5D6E A;  3I64 A;  4KN7 X;  2RN7 A;  2DW4 A;  2DBB A;  3KP4 A;  3DV8 A;  5E1Z B;  5EEG A;  1SD7 A;  2ZME A;  4MQ9 F;  5TRD A;  1QBJ A;  4MHG A;  1ZAR A;  2PI0 A;  4EJO A;  3FMS A;  1UFM A;  2HTJ A;  2E1C A;  1QZY A;  1QNT A;  3C1D A;  4RGX A;  4M74 A;  1X3U A;  1KQ8 A;  1FYK A;  4BH9 A;  4IRG A;  4P96 A;  3J81 Z;  2XAQ A;  2XAS A;  3HRU A;  3J7A O;  3GLX A;  1YLF A;  3LAP A;  3EDP A;  3U2R A;  2PMU A;  4N9I A;  1DPU A;  4M6X A;  2HYF A;  3KEO A;  5ILS A;  2VT2 A;  2Y75 A;  2QQ9 A;  1R58 A;  1T6S A;  2ZJ2 A;  3MAJ A;  3HHG A;  2DLL A;  2HTS A;  1DPR A;  2ZO4 A;  1ONV A;  5CVV A;  4WXC A;  3WGG A;  1Z7U A;  4L18 B;  3KP2 A;  2V1U A;  2EA4 A;  4A5M A;  4XLN F;  1G6N A;  1T39 A;  4N9H A;  4S05 A;  1P2F A;  2KIM A;  3CJN A;  2P5V A;  1JHH A;  1A04 A;  5DD8 A;  1CGP A;  2VC0 A;  4IJA A;  2HKO A;  4LK0 F;  1RNL A;  1IN8 A;  1IN7 A;  5DCM A;  3SZT A;  3QPH A;  4TV7 A;  4QWQ A;  3KP6 A;  2QZ8 A;  2BV6 A;  1QGP A;  2XRO A;  2H27 A;  3GW2 A;  3H3U A;  3SHF A;  3F6V A;  4ZZD A;  3ZMS A;  1G3Y A;  2RC4 A;  4M71 A;  3BRO A;  4KNY A;  4A2U A;  1MGT A;  2E7W A;  5L3C A;  2STT A;  2COM A;  3E6B A;  2CWE A;  4M73 A;  2W24 A;  2E7X A;  3RPU A;  3EYI A;  2A6E F;  2X4H A;  2HQN A;  2VC1 A;  1ZGA A;  1W5T A;  4HAM A;  3V8K A;  4HF0 A;  2FA5 A;  2QUF A;  2VBW A;  2XRN A;  1I5Z A;  1G3T A;  1YYV A;  3V7C A;  1P92 A;  2PEX A;  2A3S A;  2MD5 A;  3ABT A;  4GYI A;  4LG0 A;  3MQ0 A;  4RB2 C;  5LHI A;  2LSO A;  1IW7 F;  2JSC A;  2Z9O A;  3HRM A;  1SD6 A;  1HST A;  4LJZ F;  2D45 A;  5K1Y A;  4HDV A;  1WSU A;  1USS A;  1IN5 A;  2OQG A;  1FWZ A;  2BE5 F;  3BJO A;  4Q5S F;  2NNY A;  1KA8 A;  1B9N A;  1J75 A;  4G7O F;  3F8C A;  2LF7 A;  1Z6T A;  1T0F A;  2WC2 A;  2X0L A;  2IA1 A;  1YTY A;  2O03 A;  3WTZ A;  5FLX K;  4B8X A;  2WV0 A;  4L0Z B;  4BYY A;  1GVJ A;  1BIB A;  1ZRC A;  1BI3 A;  5HS8 A;  4NQW A;  3IKT A;  3BPV A;  2Z33 A;  3EYY A;  3OV8 A;  4OOI A;  3TO6 A;  2QBY B;  4HX8 A;  3FZV A;  2XAF A;  1BI1 A;  4XSX F;  2K4B A;  2QQA A;  5TJJ A;  5D5W B;  3I58 A;  3WE2 A;  2P6S A;  1BBY A;  4FT8 A;  1BN5 A;  3K0L A;  3DPL C;  3B02 A;  1YO5 C;  3M7G A;  2VN2 A;  3CTA A;  3BZ6 A;  1FP1 D;  4UV9 A;  1ULY A;  4UUV A;  3Q9V A;  4ESF A;  5ED4 A;  3E5U A;  2FE3 A;  2RVC A;  2MLG A;  4FX0 A;  3TKY A;  2WTE A;  4I0A A;  3WGH A;  2W25 A;  4GGG A;  1CF7 A;  1RI7 A;  2OD5 A;  3LWF A;  3R0A A;  1YQA A;  3I4P A;  1S7O A;  5LBQ A;  5FLX Z;  1PDN C;  5CYV A;  4RAY A;  5FGM A;  1ZG1 A;  2PJP A;  2XIG A;  5JVT A;  1C0W A;  4Q4Z F;  1R36 A;  3DFG A;  1SMT A;  2ZKZ A;  3F8F A;  3MEX A;  5FFX A;  5A2Q Z;  5ILV A;  4RB1 A;  4KIC A;  1IXR C;  1IUY A;  2UZK A;  1MJA A;  3O3K A;  2GZW A;  2Y48 A;  3WTV C;  1EH6 A;  1OKR A;  3CUQ A;  4FX4 A;  4EGY A;  4L0Y B;  2G7U A;  3G73 A;  4HQE A;  4U7D A;  1XSV A;  5E20 A;  2A69 F;  3F21 A;  5LRR A;  1XCB A;  1Z6R A;  4LB6 B;  3KP3 A;  5LGT A;  2PG4 A;  1ODD A;  3FM3 A;  5D4S A;  4Y15 A;  1DUX C;  3VEP A;  1S29 A;  3WTW C;  2ZXJ A;  1HW2 A;  1H0M A;  2XV4 S;  3MZY A;  4DNC A;  2HEO A;  2F5E A;  1I1S A;  1U5T B;  4I0B A;  2BYV E;  4G7Z F;  4K2E A;  5LGU A;  1GXP A;  4AVP A;  1ZH5 A;  4KMF A;  1R1U A;  3TOB A;  2B0L A;  2Z3Y A;  1RZ4 A;  4EJW A;  3QP5 A;  5DUK A;  1FSE A;  4PCQ A;  3J81 K;  2HDC A;  4G6D A;  3GEZ A;  1YIO A;  3L2C A;  2JPB A;  3LQR A;  3JAM K;  4Z2Y A;  2W57 A;  2CG4 A;  3KET A;  3P9C A;  2NAZ A;  1S6L A;  3C7J A;  2DU9 A;  4BAY A;  2XAH A;  4GYG A;  3QU6 A;  1W7P B;  2MBF A;  3U9G A;  2VOD A;  3V7S A;  1E17 A;  1PUE E;  3IHU A;  4EJV A;  5HS7 A;  3I59 B;  2YX7 A;  1JXS A;  2ESH A;  5DV5 A;  3GX4 X;  4Q48 A;  5E1W A;  2OZ6 A;  2CSO A;  5FD6 A;  5AON A;  5CVR A;  3FMR A;  3TO7 A;  3KZZ A;  2HYG D;  1YG2 A;  3E97 A;  2QLZ A;  2L4M A;  4KT5 C;  2YR2 A;  3RDI A;  4KA4 A;  4RAZ A;  4HW0 A;  1KYW A;  4HYE A;  1OR7 A;  1ZLK A;  1AWC A;  4UV8 A;  1D5V A;  3TDU C;  5D4R A;  2V9V A;  2DK5 A;  5DDG A;  1XSX A;  2FBH A;  2PFB A;  4G9Y A;  5ICE A;  3I0T A;  2IA0 A;  3TO9 A;  2C6Y A;  2F2E A;  2HFH A;  3BJA A;  4EJT A;  2XGX A;  1I27 A;  2PQ8 A;  1ON1 A;  5HDG A;  4OIR F;  4I09 A;  4P5O A;  2HKX A;  3F8B A;  1FBQ A;  4RGU A;  2FU4 A;  4CZZ A;  1LB2 A;  2EFW A;  2ZFW A;  1J5Y A;  1XGO A;  2YSR A;  2XAJ A;  2UWM A;  4IRH A;  5BQT A;  2KIU A;  2FBI A;  3WU1 B;  4LB5 A;  2MH2 A;  3HHH A;  1NHA A;  1KYZ A;  4OMY A;  3HSE A;  1B59 A;  1FOK A;  3I71 A;  4LMY A;  1R23 A;  3ZP5 A;  2CO5 A;  3DXJ F;  5AIP A;  2QWW A;  1HW1 A;  3FXU A;  2UXN A;  1U3E M;  4HLX A;  4IVN A;  2HS5 A;  3T5X A;  4NB5 A;  4BXU A;  1FC3 A;  3D0S A;  1CF7 B;  2V6C A;  3HTU A;  2EV0 A;  1J2X A;  4QLC U;  3HOS A;  2NNN A;  4HZF A;  1UHM A;  1W5S A;  2KKO A;  5L3B A;  2JPC A;  1KQ9 A;  1QZZ A;  3RYP A;  2H6C A;  4KFC A;  3ZMZ A;  4CHU A;  2F5C A;  4EV0 A;  2O3F A;  4R1H A;  1JGS A;  5FB2 A;  1I1G A;  3GFJ A;  1R1V A;  1HSJ A;  1EH8 A;  1T38 A;  3RKY A;  1I6X A;  3ECO A;  2DI3 A;  2PLY A;  4WF2 A;  2BGC A;  1Z9C A;  1E2X A;  3DF8 A;  3LFK A;  4H0E A;  3R0J A;  3LST A;  1EH7 A;  1O3Q A;  1UCR A;  3SQN A;  2HR3 A;  2JTV A;  3I53 A;  4G8X A;  4L9N A;  1IRG A;  1F9N A;  2J5O A;  1ZG5 A;  5E8G A;  5HDN A;  3W6K B;  4IRI A;  3WTY C;  1J59 A;  1WWX A;  4L9T A;  4BNC A;  1YW9 A;  1J0R A;  1U5T A;  3FX3 A;  3CUQ B;  5HLH A;  4HX7 A;  1XMK A;  2EFP A;  2DO7 A;  2G9W A;  2M45 A;  5J6X A;  2P7V B;  4BHB A;  3IWZ A;  1U2W A;  4KIB A;  2QEN A;  4HQM A;  2O0Y A;  1GXQ A;  4L5I A;  4BHC A;  1YS7 A;  2FQ3 A;  4P9U A;  2ZBK A;  2DQL A;  1MKM A;  2IJL A;  3BOQ A;  2W85 A;  4IHS A;  3D5L A;  3T8T A;  3K2Z A;  3F8N A;  5DD4 A;  2NS0 A;  3ZN1 A;  3NEU A;  4CYD A;  3WTU C;  4YFN F;  5H6Q A;  2D1H A;  4E70 A;  1HQC A;  1U78 A;  2LKP A;  3QAH A;  3WU0 A;  4UVC A;  4RB0 A;  3ECH A;  3TGN A;  1TTY A;  2H09 A;  1G4D A;  4ZYG A;  1DDN A;  2M8E A;  5ICF A;  2ZCW A;  4LK1 F;  3KFW X;  2EFN A;  1IRF A;  2GA1 A;  5E8I A;  2EA2 A;  5J8C A;  4BQA A;  2PN6 A;  1SFX A;  3KP5 A;  3KP7 A;  2M87 A;  1S3J A;  2O61 A;  4RGS A;  4M9X A;  1BI2 A;  1FPQ A;  4PZJ A;  2XAG A;  1KU3 A;  3E6C C;  3C3W A;  3EQL F;  2XKP A;  3RI4 A;  4MEX F;  4MEY F;  2TDX A;  2Q8K A;  5L3D A;  3KLN A;  3PQK A;  4I98 B;  3M8E A;  2FEZ A;  4EM0 B;  2XKO A;  4L9J A;  2OA4 A;  1IXS B;  3O2P E;  2RKH A;  2VON A;  1FYM A;  3CO6 C;  3HTS B;  4EJU A;  1H9T A;  2Z5U A;  4AIJ A;  5DCF A;  1W4M A;  4HV5 A;  3RPQ A;  3NQO A;  5JFR A;  1QPM A;  3V8J A;  1SMY F;  2LF8 A;  2XVC A;  2RQP A;  2EFO A;  2H6B A;  2HQR A;  1BIA A;  3TQN A;  2GIV A;  1SD4 A;  3GZ5 A;  3SZP A;  2DPD A;  2V79 A;  4GO1 A;  4B09 A;  3GWZ A;  2IP2 A;  2EV5 A;  3WGI A;  1IZ1 A;  3CUQ C;  1W7P D;  1B1B A;  1FBU A;  4JBA A;  2RV8 A;  3ISP A;  5IT9 K;  4KYW A;  1UHW A;  2QVO A;  2CFX A;  2EFQ A;  5LEK A;  2STW A;  5KK1 A;  4LFU A;  3G3Z A;  4HV6 A;  4AIH A;  1MJ9 A;  4FHT A;  4XRF A;  3RJP A;  5HS9 A;  1BJA A;  1P4A A;  2Z99 A;  2L4A A;  2Q0O A;  1J9I A;  1KGS A;  2IRF G;  2V1X A;  1FLI A;  1TQM A;  5FD5 A;  1KU9 A;  5JHU A;  4ENK A;  2VBX A;  4PGH A;  5ILU A;  3MCZ A;  2CQK A;  3R6S A;  1ZG3 A;  3MZH A;  3L00 A;  4R8H A;  2IT0 A;  1XGM A;  1HBX G;  1K6O A;  4M9S A;  5JR3 A;  5CVI A;  5CLS A;  5KVR A;  3E6D A;  1S7A A;  4LGW A;  4OIN F;  4A0Z A;  1FNN A;  4P9F A;  2ELH A;  4U0Y A;  2VE9 A;  1IAW A;  2F5F A;  5LGN A;  2MC3 A;  2HWV A;  2A61 A;  2QQB A;  3L09 A;  4U88 A;  1G3W A;  2BBY A;  4KIF A;  3JTH A;  1ZRD A;  3JW4 A;  4ZZL A;  4L9V A;  1ZN2 A;  4Q47 A;  3JSO A;  4L5J A;  2L02 A;  3LAJ A;  4AIK A;  2A68 F;  3FM5 A;  4O6J A;  5K5Q A;  3VOD A;  4YFK F;  2KJC A;  4P55 A;  3ZMT A;  3KE2 A;  2ZNZ A;  3JAM Z;  1XGS A;  3LA3 A;  5L3E A;  2EV6 A;  1BI0 A;  2K02 A;  4WXH A;  1XMA A;  3T8R A;  1WI9 A;  3WOD F;  4MQV A;  3GFL A;  1ZYR F;  2P8T A;  1D8K A;  4HBL A;  3R61 A;  3RTR A;  3OOP A;  1HKS A;  2YU3 A;  3GO5 A;  1XDU A;  2RGV A;  2VOO A;  1GHC A;  1KU2 A;  3KCC A;  3GFI A;  4HLY A;  4XLP F;  3GUD A;  2R3S A;  5FO5 A;  3QOP A;  5EEH A;  1P4X A;  3IKV A;  3FMQ A;  2J5P A;  5LEJ A;  5DYM A;  1WKM A;  3CO7 C;  2MLK A;  3CLO A;  1TNS A;  1FBS A;  3RYR A;  2D2W A;  4XBF A;  3GVA A;  5L3F A;  3DEU A;  2XHK A;  4RGR A;  3GYH X;  1BC8 C;  1WRJ A;  1W7P A;  1STZ A;  2RDP A;  1LEB A;  3B73 A;  4WXD A;  1K78 B;  3GFM A;  1AOY A;  2FNA A;  3I59 A;  2M30 A;  3H3Z A;  5LHG A;  4CXF A;  4OIQ F;  2PBI A;  1FSH A;  4EM1 A;  5LRS A;  2L54 A;  2FBK A;  3E6M A;  3K69 A;  1O3R A;  3ABU A;  3FF5 A;  2HOE A;  3F3X A;  1TQP A;  4OMZ A;  5HVQ C;  4PDK A;  1IF1 A;  2M5W A;  4WWC A;  1QO0 D;  1VTN C;  1U5T C;  4G94 A;  3JSP A;  4A0X A;  5H6R A;  2OAZ A;  4BHP A;  2GQQ A;  5CVU A;  1O7L A;  1V3F A;  3PQJ A;  3ZMV A;  4ZH4 F;  5CJ9 A;  4RB3 C;  2G7H A;  4EM2 A;  3TDZ C;  2EK5 A;  3U1D A;  2K86 A;  5ICC A;  2O8X A;  4DQ2 A;  4R79 A;  5HDK A;  4WX9 A;  1Z05 A;  1JE8 A;  5D6F A;  4NHJ A;  1ZRE A;  4CO8 A;  1UST A;  1XB4 A;  2Y0M A;  1WQ2 A;  4KMU X;  1L0O C;  1EV7 A;  1IXC A;  2KIF A;  5HLG A;  1Z91 A;  1XDS A;  4U7B A;  4KDP A;  1P6R A;  3ERE D;  4AWX B;  2DPU A;  3K1M A;  2P5L C;  4YIF A;  1Y0U A;  5IT9 Z;  2ZNY A;  3WTT C;  4U0W A;  1ZLJ A;  2FOK A;  4ZYD A;  5BS6 A;  3GZ6 A;  1F1Z A;  1TW3 A;  2DK8 A;  2FF4 A;  2MH9 A;  3SXY A;  3L9F A;  4M9Z A;  3FHZ A;  2P5K A;  3KZY A;  3S2W A;  1ZRF A;  1O57 A;  2ISZ A;  2P7C B;  2VXZ A;  4ENN A;  3QPT A;  4JQF A;  2V1D A;  1OMI A;  4EVI A;  2FMY A;  3BY6 A;  3K9T A;  3PFI A;  1P4W A;  5ICG A;  4IXA A;  3Q5F A;  1R5G A;  2WWY A;  4UXN A;  1OYY A;  5LHH A;  5CVJ A;  4ESJ A;  2YPR A;  2L01 A;  1B9M A;  3F6O A;  4UVB A;  4IHT A;  1XN7 A;  4LLN A;  1R5H A;  2NRA C;  5DEQ A;  2DFI A;  4KUM A;  4IPA A;  1G3S A;  1LDJ A;  3L7W A;  3M9A A;  1R00 A;  1XGN A;  1BM9 A;  4AD9 A;  3ZPL A;  3N4M A;  3M8F A;  2R7F A;  4UVA A;  4LD5 A;  4Y17 A;  2OQR A;  3HUG A;  5IT3 A;  2K27 A;  2QYO A;  3LA7 A;  1FZP B;  3K1N A;  3ULQ B;  3IL2 A;  4A5N A;  3BPX A;  3HRS A;  1SFU A;  1R1T A;  4HOB A;  4A6D A;  1F5T A;  4I02 A;  2P4W A;  1UB9 A;  3EET A;  2K7L A;  4OU0 A;  2A6H F;  4HA8 A;  2FRH A;  4A12 A;  2QBY A;  1RUN A;  3FWE A;  3KEQ A;  5JI6 A;  2DAO A;  5D5U B;  1TW2 A;  1FX7 A;  1U6G A;  4YG2 F;  2XUB A;  1HXD A;  4YII A;  1BOA A;  4G6Q A;  3RIR A;  2A07 F;  4M6Y A;  4EQQ A;  4RS8 A;  1SD5 A;  3C18 A;  3BP8 A;  2Q2E A;  1R22 A;  3I5U A;  4WCG A;  3V4G A;  3HRT A;  2UXX A;  1YFH A;  4N0B A;  3R4K A;  1MDM A;  3VOE A;  5BMZ A;  4Y13 A;  1T2K A;  1DP7 P;  2ACJ A;  1REP C;  4I2O A;  5F6F A;  1IN6 A;  1T98 A;  1ON2 A;  2AXL A;  3ML6 A;  4D0P A;  3TOA A;  3MWM A;  2ZME B;  2E1N A;  1B4A A;  4GCV A;  1B6A A;  1LJ9 A;  3F23 A;  2ISY A;  4PGG A;  3WTX C;  2LDU A;  2IA2 A;  4ON0 A;  1FP2 A;  5L3G A;  2OU2 A;  3E5X A;  3BWG A;  1K78 A;  1K7A A;  1OYI A;  1MZB A;  3P9I A;  3P7N A;  2W84 A;  4UHT A;  2FXA A;  4HF1 A;  2VOP A;  2AS5 F;  1IN4 A;  3CDH A;  3MFK A;  3QP6 A;  3Q9S A;  3HIF A;  4LLG F;  4ETS A;  1PP7 U;  6PAX A;  5D8L B;  2FSW A;  1LVA A;  3HSR A;  1L3L A;  3DKW A;  5FFZ A;  4ENM A;  2CW0 F;  2JT1 A;  2EJR A;  1FY7 A;  3LQQ A;  3K1P A;  4CDG A;  3BJ6 A;  2M1B A;  3V8L A;  3N97 A;  3RKX A;  1MJB A;  3W6J B;  2F5D A;  2HGC A;  1RUO A;  3REO A;  3H92 A;  4U0V A;  3IWF A;  5D8K B;  5D5V B;  5E18 F;  5D5X B;  1LEA A;  1J7K A;  2QM3 A;  1LDK B;  3IC7 A;  1PP8 F;  1LNW A;  3QU3 A;  5BOX A;  1YW7 A;  4HF2 A;  3IRR A;  4MTE A;  1SAX A;  2HZT A;  2OBP A;  1XSD A;  1MD0 A;  1YS6 A;  2LNB A;  1SFE A;  1XD7 A;  3J80 Z;  1K79 A;  3I54 A;  3ELK A;  5H20 A;  4MGR A;  2VE8 A;  3HYI A;  2CYY A;  4ESB A;  4MTD A;  3R60 A;  2K4J A;  2GAU A;  1KU7 A;  1O3T A;  1H9G A;  3HOT A;  5DUI A;  2DQR A;  2JZY A;  4ZYH A;  2ETH A;  1O7F A;  5J8F A;  4OIO F;  1Z1D A;  2KJB A;  1HKQ A;  4GXO A;  3ZMU A;  1LDD A;  5DCM B;  3T0Y A;  2RNJ A;  3O6B B;  3E5Q A;  1F4K A;  3DQV C;  5F1R A;  4YFX F;  2GXG A;  3ZMD A;  1D3Y A;  2O6G E;  3HSF A;  1R7J A;  1Q1H A;  5K5R A;  1YW8 A;  5ERI A;  5A2Q K;  1V4R A;  4KIG A;  1TQI A;  1ZGJ A;  4XSZ F;  1TNT A;  1ZAO A;  3DP7 A;  3SFZ A;  5BPI A;  1LQ1 A;  2VBY A;  2DT5 A;  2IW5 A;  2A5Y B;  1XCV A;  4F7Z A;  2L3D A;  4HX4 A;  5LLQ A;  2NYX A;  3LA2 A;  2P6T A;  3DPT A;  2YX4 A;  3VB2 A;  3J80 K;  2GWR A;  3VFZ A;  2ESN A;  1TLH B;  2PMH A;  4EMS A;  2FML A;  4LG0 B;  4EGZ A;  1D8J A;  4MNU A;  5BPD A;  4LLL A;  1U8R A;  3P9K A;  2GA2 A;  4O5V A;  2VBZ A;  4A6E A;  1FT9 A;  4ASN A;  2D1V A;  4UNO A;  1JHF A;  2MA3 A;  2KRF A;  1ZHF A;  3EUH A;  4S04 A;  3KLO A;  1QQI A;  2IPQ X;  3GF2 A;  4CGZ A;  3E3V A;  3AAF A;  5HLI A;  3BDD A;  5E1X A;  4WK8 F;  4OIP F;  5AIQ A;  3IRQ A;  1S8N A;  2R7D A;  2H94 A;  3NRV A;  3T1B A;  1KQ0 A;  1RIO H;  5E17 F;  2DTR A;  2IVM A;  1OPC A;  4IF4 A;  5K5O A;  1BC7 C;  3RKW A;  4HDU A;  3FXQ A;  1MDM B;  3FXR A;  2GXB A;  4ENJ A;  4G7H F;  3ZQ7 A;  2EB7 A;  5F64 A;  4I01 A;  3WE3 A;  4CIC A;  3QRF F;  2ADU A;  2VT3 A;  3ZN0 A;  1HW5 A;  2JRT A;  3GXO A;  1HKT A;  4O3M A;  3F72 A;  2BEO A;  1FYL A;  3JTG A;  4ZYE A;  3ROU A;  1OYW A;  1TBX A;  3WTS C;  2EWN A;  4KN4 X;  1O3S A;  2FNP A;  3V7R A;  4I7H A;  2CGP A;  4JK1 X;  3WG9 A; 
#chains in the Genus database with same CATH topology
 4M72 A;  4DZP A;  2V26 A;  2OZU A;  2IXS A;  4A0Y A;  2ECB A;  1N75 A;  3COA C;  3F22 A;  5HOO A;  2FD5 A;  3CUO A;  3F8M A;  2WAQ A;  1ENH A;  3M1E A;  2ME6 A;  3GTL J;  5D6E A;  4CCO A;  4D5C A;  2JWT A;  3I64 A;  3FXL A;  4KN7 X;  2RRE A;  2RN7 A;  2WY8 Q;  1HLV A;  3CES A;  2H1L A;  2DW4 A;  2DBB A;  3KP4 A;  2QCO A;  3DV8 A;  5JLX A;  5E1Z B;  5EEG A;  1SD7 A;  2ZME A;  4E7J A;  3BLY A;  4MQ9 F;  2R7X A;  5TRD A;  1QBJ A;  2PX9 A;  4MHG A;  4XQF A;  5B1A H;  3HEF A;  1ZAR A;  2PI0 A;  1LFU P;  4EJO A;  3FMS A;  1UFM A;  2HTJ A;  2E1C A;  1QZY A;  3OY9 A;  1QU3 A;  2CQX A;  4FCY A;  1QNT A;  3TED A;  3C1D A;  3KPH A;  4RGX A;  4M74 A;  1X3U A;  1KQ8 A;  3H3V K;  1FYK A;  4BH9 A;  2G0E A;  2KIS A;  4IRG A;  4P96 A;  3J81 Z;  2XAQ A;  2CS3 A;  2XAS A;  3HRU A;  3DPU A;  3J7A O;  3GLX A;  4BS9 A;  1YLF A;  3BTI A;  2KRH A;  3EDP A;  3U2R A;  3LAP A;  3JRG A;  2PMU A;  4N9I A;  1DPU A;  4M6X A;  2EIN H;  2HYF A;  3B6C A;  3KEO A;  2VT2 A;  5ILS A;  2Q2E B;  3FIW A;  2Y75 A;  5EGO B;  1OR7 C;  2QQ9 A;  1R58 A;  3K4C A;  1YJ9 I;  1T6S A;  1ZR4 A;  2ZJ2 A;  4F92 B;  3TBI A;  3MAJ A;  3HHG A;  2DLL A;  2HTS A;  1DPR A;  1K6Y A;  1ONV A;  2ZO4 A;  5CVV A;  4A3I J;  1W0U A;  4WXC A;  4XLF A;  4M6V A;  1Z7U A;  3WGG A;  4IHX A;  4L18 B;  3IUO A;  2K9Q A;  2X51 A;  4F93 B;  3S1M J;  5GAG J;  3JRH A;  3KP2 A;  2V1U A;  2EA4 A;  4A5M A;  2LR8 A;  1AU7 A;  3PO2 J;  3OL3 A;  2CW8 A;  4XLN F;  2HYJ A;  2MFZ A;  2XDV A;  3CC4 I;  1G6N A;  1T39 A;  1JJ8 C;  4N9H A;  2BY1 A;  5E3N A;  4C3J J;  4UB8 C;  4S05 A;  3RSN A;  1P2F A;  3PNY A;  2KIM A;  3E0J B;  4JX4 A;  1UMQ A;  1RES A;  4CZC A;  2ZC2 A;  3CJN A;  2P5V A;  1P9Q C;  3K4L A;  1JHH A;  3LFU A;  2VL8 A;  1K4T A;  2BVM A;  2ELK A;  4XK4 A;  1IRZ A;  3FBN B;  2PJR B;  1A04 A;  5DD8 A;  1CGP A;  1GUU A;  2TCT A;  2V7F A;  1E0E A;  1OCR H;  2VC0 A;  4IJA A;  2HZD A;  2HKO A;  5IYB J;  4ANJ A;  3G1O A;  4S0H B;  4LK0 F;  1RNL A;  1IN7 A;  1IN8 A;  2VQL A;  1VFC A;  3PSI A;  3LSG A;  4A3C J;  1MH3 A;  2R5Z B;  5DCM A;  3SZT A;  3QPH A;  1EJ9 A;  4TV7 A;  2LTP A;  3KP6 A;  4QWQ A;  4BU2 A;  1WVR A;  3H1C A;  3OSF A;  5GAH J;  2QZ8 A;  4E6K G;  2BV6 A;  1QGP A;  2XRO A;  1XS9 A;  1VQK I;  2H27 A;  3GW2 A;  3OIQ A;  3H3U A;  3SHF A;  2XAU A;  1AHD P;  1ETO A;  3F6V A;  4ZZD A;  3ZMS A;  1G3Y A;  2RC4 A;  4ZDO A;  2DA5 A;  4M71 A;  1EKE A;  1XX5 A;  3BRO A;  2LK2 A;  4KNY A;  4A2U A;  1MGT A;  1ETQ A;  2E7W A;  5L3C A;  2STT A;  1I6H J;  4YEL A;  3MKY B;  2COM A;  4HPQ A;  3E6B A;  4DYQ A;  2L9R A;  2CWE A;  4M73 A;  5EDN A;  2DA1 A;  1TZL A;  3KEY A;  1X1D A;  2W24 A;  3EUA A;  2E7X A;  3EUK L;  4XNF A;  3RPU A;  3EYI A;  2A6E F;  5IOY A;  2X4H A;  2HQN A;  2VC1 A;  4A3E J;  1DU0 A;  2EIL H;  2ZSI B;  1ZGA A;  1W5T A;  4HAM A;  3V8K A;  4BUP A;  1T0F C;  1E3P A;  2DJI A;  2FA5 A;  1LKX A;  2QUF A;  3DBL B;  4HF0 A;  2VBW A;  2XRN A;  1GT0 C;  1I5Z A;  2LY9 A;  4YEJ A;  3L2Q A;  4GFB A;  1G3T A;  1YYV A;  3V7C A;  3BR3 A;  4XN3 A;  1P92 A;  2PEX A;  2I10 A;  2EIJ H;  2A3S A;  2IS6 A;  2MD5 A;  3ABT A;  4GYI A;  4LG0 A;  2MD0 A;  2VQG A;  3MQ0 A;  4RB2 C;  5LHI A;  2LSO A;  2CQQ A;  1FOY A;  3CLQ A;  3S17 J;  4BXX J;  2VAS A;  1VI0 A;  1IW7 F;  2JSC A;  3HGG A;  1WI3 A;  4G6T B;  2Z9O A;  3S16 J;  5IY5 H;  3HRM A;  1SD6 A;  1HST A;  4LJZ F;  5K1Y A;  2D45 A;  5JLW A;  4HDV A;  4C2T A;  2BHY A;  3WHC A;  4C2M J;  3MKL A;  2BW3 B;  1WSU A;  1USS A;  1D5Y A;  2V1N A;  1IN5 A;  2OQG A;  1FWZ A;  2BE5 F;  3BJO A;  4Q5S F;  4CCM A;  2NNY A;  2XGC A;  4FAS D;  1X58 A;  1KA8 A;  2DFH A;  2GOM A;  4HG2 A;  1UG0 A;  1AKH B;  1B9N A;  1J75 A;  4G7O F;  3F8C A;  4DIQ A;  2KLO A;  2LF7 A;  4NDL A;  2JN6 A;  2O9L A;  1Z6T A;  2WAD A;  1T0F A;  2WC2 A;  4CCK A;  2X0L A;  2IA1 A;  1YTY A;  1QZE A;  2O03 A;  3WTZ A;  3CDL A;  1N78 A;  5FLX K;  4B8X A;  2WV0 A;  4L0Z B;  4BYY A;  1SVM A;  1D1A A;  1GVJ A;  1BIB A;  1ZRC A;  1RR7 A;  3JRC A;  1BI3 A;  5HS8 A;  4NQW A;  2DMN A;  2NVQ J;  3IKT A;  3BPV A;  2P81 A;  3BR0 A;  2Z33 A;  1JUS A;  2F4O B;  3EYY A;  1FEX A;  4D7M A;  3OV8 A;  2ZJR F;  4OOI A;  2E71 A;  2FX0 A;  3TO6 A;  2QBY B;  3BZK A;  2M0M A;  2DA3 A;  4HX8 A;  4BY7 J;  3FZV A;  1T56 A;  2XAF A;  3FKI J;  4ZDP A;  3L2W A;  2VJ5 A;  3EPZ A;  3D1N I;  1BI1 A;  4XSX F;  4X6A J;  3QOD A;  2K4B A;  1JT6 A;  2QQA A;  5CPR B;  2Z1D A;  5TJJ A;  3DLA A;  5D5W B;  3I58 A;  4II2 A;  3WE2 A;  2P6S A;  2VUM J;  1S7E A;  1BBY A;  2KT0 A;  4RLF A;  2NS8 A;  4FT8 A;  1UAA A;  1YRN A;  1BN5 A;  4Y7N J;  3K0L A;  3DPL C;  3FK7 A;  3B02 A;  1YO5 C;  2E35 A;  3M7G A;  2VN2 A;  3CTA A;  2OC6 A;  3BZ6 A;  1FP1 D;  2X6X A;  1R4M B;  4UV9 A;  1F36 A;  2VJI A;  4BJT A;  1WJE A;  1ULY A;  1P7I A;  3OS2 A;  4UUV A;  3Q9V A;  5F08 A;  1TWG J;  1X3Z B;  4ESF A;  3E5U A;  5ED4 A;  4ITV A;  3D5S C;  1G2H A;  2EIM H;  1W36 D;  4IQJ A;  2FE3 A;  2RVC A;  2MLG A;  4FX0 A;  3TKY A;  4F55 A;  1KON A;  2WTE A;  2VQH A;  4I0A A;  3WGH A;  3GLL A;  1W1W E;  5CKT A;  2W25 A;  4GGG A;  2IS2 A;  1CF7 A;  2LOO A;  1RI7 A;  2OD5 A;  1HA8 A;  3LWF A;  3JR9 A;  1Y8Q B;  3LNQ A;  4H4K C;  3R0A A;  1YQA A;  3I4P A;  1S7O A;  1X19 A;  3AG2 H;  5LBQ A;  5FLX Z;  1PDN C;  5F0H A;  5CYV A;  4RAY A;  5FGM A;  1ZG1 A;  2PJP A;  2H1K A;  3SYT A;  1BR4 A;  2JK3 A;  2XIG A;  3DU5 A;  4HNV A;  5JVT A;  1C0W A;  2E2I J;  4Q4Z F;  1R36 A;  1QRY A;  3KYD B;  2V9P A;  3DFG A;  1SMT A;  2ZKZ A;  4BQQ A;  3F8F A;  1GV2 A;  3MEX A;  4LIU A;  5FFX A;  5A2Q Z;  4PJM A;  3P5J A;  1VQ9 I;  5ILV A;  4RB1 A;  4KIC A;  1IXR C;  5LD2 C;  1IUY A;  2O5R A;  1I39 A;  1V55 H;  2UZK A;  4ABZ A;  1MJA A;  3O3K A;  3M3Y J;  2GZW A;  4BL0 B;  2Y48 A;  3WTV C;  3H5A A;  2CUF A;  3CUQ A;  1EH6 A;  1FIA A;  1OKR A;  3ZQG A;  3E1S A;  4FX4 A;  4EGY A;  2E5Z A;  4L0Y B;  1VQN I;  2G7U A;  3G73 A;  4BJ5 C;  4HQE A;  3U1K A;  4AYB A;  1K83 J;  1BW5 A;  4CSW A;  2A6T A;  1ETX A;  4U7D A;  1XSV A;  2KDO A;  5E20 A;  2A69 F;  3DEW A;  4BEH B;  4DYC A;  3F21 A;  1S5L C;  3BTC A;  5LRR A;  1XCB A;  1Z6R A;  4BBS J;  4LB6 B;  3KP3 A;  4XOR A;  1JUM A;  5LGT A;  2PG4 A;  1U0J A;  1ODD A;  3FM3 A;  4UUS A;  5D4S A;  4Y15 A;  3CMM A;  1DUX C;  3I55 I;  1TWH J;  2E19 A;  3QYF A;  4BAC A;  2HVR A;  2JJ7 A;  3AL0 B;  3VEP A;  2VJ4 A;  5FRM A;  2X6W A;  1D0Z A;  1S29 A;  2YUS A;  3RQ4 A;  4XRS G;  2EPF A;  1B8I B;  4C9Y A;  5IPA A;  3WTW C;  3CCL I;  2ZXJ A;  1HW2 A;  1H0M A;  2XV4 S;  3MZY A;  1EA3 A;  4OAY A;  4AC0 A;  1Z67 A;  4DNC A;  2HEO A;  4IHW A;  2F5E A;  1I1S A;  1U5T B;  4I0B A;  3G71 I;  2XF6 A;  3NWS A;  3Q0V A;  4HNT A;  2BYV E;  4G7Z F;  4PJJ A;  4K2E A;  1HOM A;  1QHH D;  2XGD A;  1B72 B;  5LGU A;  1OCT C;  3Q0U A;  4CCJ A;  1GXP A;  5H2F C;  4AVP A;  2E1M C;  1ZH5 A;  1SFO J;  4KMF A;  3PUF A;  1R1U A;  3PSF A;  3VYT B;  3TOB A;  2B0L A;  2M9H A;  2Z3Y A;  2CV1 A;  3ZXS A;  3A4C A;  3DKX A;  3Q3S A;  1RZ4 A;  4EJW A;  2E2H J;  2KHM A;  3QP5 A;  1JKP C;  1HCR A;  5DUK A;  1FSE A;  4PCQ A;  2IBD A;  2M7A A;  3J81 K;  2HDC A;  4G6D A;  1HC8 A;  3GEZ A;  1YIO A;  3AFH A;  2KQR A;  3L2C A;  2L0K A;  2JPB A;  3RPU D;  2LLK A;  3LQR A;  3JAM K;  2F4I A;  4Z2Y A;  3SDG A;  2W57 A;  3HZJ A;  2CG4 A;  3KET A;  3P9C A;  2NAZ A;  1S6L A;  3GME A;  3C7J A;  2DU9 A;  4BAY A;  2VKH A;  3AKZ A;  1ZR2 A;  4HST A;  1JTY A;  2DCE A;  2XAH A;  1A31 A;  3PNT A;  4GYG A;  3QU6 A;  1W7P B;  2MBF A;  1MNM C;  4A3B J;  2DDA A;  3U9G A;  2VOD A;  3V7S A;  2X6Y A;  2PJR A;  1E17 A;  1PUE E;  3IHU A;  2KPM A;  4BQN A;  3OIP A;  3RZO J;  4JOM A;  3FXJ A;  4EJV A;  4IOC F;  5HS7 A;  2EIK H;  3I59 B;  1R9T J;  2YX7 A;  1JXS A;  3OYG A;  4XON A;  1N25 A;  5GPA A;  2ESH A;  2DA6 A;  5DV5 A;  3GX4 X;  5E3M A;  2VPL A;  4Q48 A;  5DTD A;  1KZH A;  5E1W A;  2OZ6 A;  2CSO A;  5KAI C;  5FD6 A;  5AON A;  5CVR A;  2UV1 A;  2O7O A;  5B5E C;  2M34 A;  3FMR A;  3CD6 I;  1WJD A;  1JI8 A;  1IGN A;  3TO7 A;  3KZZ A;  2HYG D;  5EG0 B;  1YG2 A;  3E97 A;  2QLZ A;  4X0G A;  2L4M A;  2FJ1 A;  3QYE A;  4KIT B;  4KT5 C;  3S93 A;  2YR2 A;  3L2V A;  3PL8 A;  3RDI A;  4KA4 A;  4RAZ A;  4HW0 A;  1KYW A;  4HYE A;  1RKT A;  1D0X A;  1OR7 A;  3BTL A;  1ZLK A;  1ZKG A;  1AWC A;  3BT9 A;  4UV8 A;  5GP9 A;  5EZG A;  1FIP A;  3HOY J;  3WHB A;  3ZCO A;  3TDU C;  1D5V A;  5D4R A;  2V9V A;  3ZRG A;  1DGR M;  2DK5 A;  5DDG A;  2HVS A;  3OL4 A;  3OOU A;  1XSX A;  2FBH A;  4YIR X;  2PFB A;  2JA5 J;  4G9Y A;  5ICE A;  3I0T A;  2IA0 A;  2GIZ A;  3TO9 A;  3B6A A;  2C6Y A;  4DW6 A;  2F2E A;  2HFH A;  3BJA A;  1T8I A;  2DT6 A;  4EJT A;  3KYL A;  1PYV A;  2XGX A;  1I27 A;  3CCJ I;  3VSL A;  2PQ8 A;  4YRV A;  2QKL B;  1ON1 A;  5HDG A;  4A3M J;  3GBG A;  4OIR F;  4I09 A;  2R7R A;  3BR2 A;  3FBI B;  4P5O A;  2HKX A;  3F8B A;  1AA7 A;  1FBQ A;  4RGU A;  2FU4 A;  1BJZ A;  2P0W A;  4CZZ A;  3J7Y J;  1LB2 A;  3IP4 B;  2EFW A;  3HC7 A;  2ZFW A;  4LOC A;  3UKG A;  1J5Y A;  3MKW B;  1XGO A;  2YSR A;  2KMU A;  4HEA 2;  1P7J A;  5J4V A;  2XAJ A;  5J3L A;  5FJ8 J;  2UWM A;  1GVD A;  1OIS A;  4IRH A;  5BQT A;  2JA6 J;  2KIU A;  3JRB A;  2FBI A;  3WU1 B;  2R4G A;  2XPU A;  4LB5 A;  2MH2 A;  3VYR B;  3HHH A;  2AXT C;  4A3F J;  1NHA A;  1KYZ A;  2JQ7 A;  4OMY A;  3HSE A;  4V19 K;  1B59 A;  5TIS C;  3H35 A;  1FOK A;  3DBR B;  5IYD J;  3I71 A;  4E4H A;  2X9D A;  4LMY A;  1R23 A;  3OYC A;  3LSP A;  3ZP5 A;  4CCN A;  3TW6 A;  4EEF G;  2E60 A;  3K4B A;  2CO5 A;  3DXJ F;  5AIP A;  2YS9 A;  3DCF A;  2QWW A;  4BDZ A;  1HW1 A;  4M3G A;  4NQW B;  4QTR A;  1JKQ C;  1SAU A;  3FXU A;  5IYC J;  2UXN A;  2JVG A;  1U3E M;  4HLX A;  5KCM A;  4IVN A;  1V5E A;  2HS5 A;  5EF6 A;  3T5X A;  4NB5 A;  3ZQC A;  4BXU A;  3BR5 A;  1FC3 A;  3D0S A;  1ZTR A;  1CF7 B;  4JX6 A;  2K85 A;  2V6C A;  4B48 A;  3CQZ J;  2H8R A;  3HTU A;  2EV0 A;  1UEL B;  5FKN A;  4KJZ A;  1J2X A;  4QLC U;  2R7V A;  4Y52 J;  3IAM 2;  3HOS A;  2NNN A;  4HZF A;  1UHM A;  1W5S A;  2KKO A;  4RAF A;  1HDP A;  1AKH A;  1WJC A;  3H0G J;  5L3B A;  2JPC A;  1KQ9 A;  2QA4 I;  1QZZ A;  3RYP A;  2H6C A;  4KFC A;  3ZMZ A;  1MMA A;  4HSR A;  1U8B A;  4DBQ A;  4CHU A;  2F5C A;  1VQ6 I;  5KAF C;  1DU6 A;  4EV0 A;  2O3F A;  1WJB A;  4R1H A;  2JVH A;  1JGS A;  5FB2 A;  1I1G A;  3GFJ A;  4QPO A;  1R1V A;  3ONQ A;  3D5R C;  1HSJ A;  2XGE A;  1EH8 A;  2E34 A;  3SZG A;  2X1D A;  1T38 A;  3RKY A;  5K7H A;  3OYJ A;  1GV5 A;  1I6X A;  1E3H A;  3ECO A;  2NXN B;  3PIP F;  3JRI A;  3CCQ I;  4RA2 A;  5FKM A;  4NC7 A;  2KZG A;  2DI3 A;  3CF5 F;  2PLY A;  4WF2 A;  2BGC A;  2LKS A;  1E2X A;  3DF8 A;  1Z9C A;  3LFK A;  4AVZ A;  4H0E A;  3LL7 A;  1PUF A;  1HDD C;  4BE1 A;  3R0J A;  3LST A;  1EH7 A;  4B3A A;  2DXI A;  1I3Q J;  3HUG B;  1O3Q A;  3K2A A;  1MNE A;  2CUE A;  1UCR A;  3CF2 A;  3SQN A;  2L7K A;  4QIW N;  2HR3 A;  5HLT A;  2JTV A;  3I53 A;  4G8X A;  4L9N A;  1IRG A;  1VF9 A;  4FE4 A;  1F9N A;  2J5O A;  1ZG5 A;  5E8G A;  2R0Q C;  5HDN A;  3W6K B;  2WB1 A;  4IRI A;  2L7Z A;  1TT5 B;  3NAU A;  2DMT A;  3WTY C;  3JRE A;  4HNU A;  3S1Q J;  1J59 A;  1WWX A;  2R93 J;  1QHG A;  4L9T A;  4BNC A;  1YW9 A;  1J0R A;  4UUT A;  3C2H A;  2M3A A;  5F04 A;  1K61 A;  1U9N A;  1U5T A;  3TMO A;  3FX3 A;  3CUQ B;  3K4K A;  3WU2 C;  5HLH A;  4BDY A;  1BOB A;  2LY1 A;  1Z77 A;  4HX7 A;  4XN0 A;  1XMK A;  2VB6 A;  3S15 J;  1B72 A;  2OUM A;  5F1J A;  2EFP A;  2NS7 A;  2DO7 A;  2G9W A;  5EYR A;  2ECC A;  2M45 A;  5J6X A;  1A6I A;  1ITY A;  2P7V B;  4BHB A;  4RMN A;  3IWZ A;  1U2W A;  4KIB A;  2QEN A;  4HQM A;  3BQZ A;  2O0Y A;  1YJN I;  2NVY J;  2K9L A;  1MMS A;  1GXQ A;  2KFD A;  3SFI A;  4UUS B;  4V2G A;  4L5I A;  4BHC A;  1YS7 A;  2EBI A;  2FQ3 A;  4P9U A;  4IX7 A;  2ZBK A;  1JT0 A;  2DQL A;  1MKM A;  2KP6 A;  2XB0 X;  2CQ7 A;  4A3J J;  1WH7 A;  4JP0 A;  4A3K J;  2IJL A;  3BOQ A;  2W85 A;  4IHS A;  3HG9 A;  3S32 A;  3TP0 A;  2B7E A;  2WV1 A;  3D5L A;  3S3N A;  4Z6Y A;  2A5W A;  2RNG A;  3CJR B;  1POG A;  5M5X J;  3KX2 A;  4NBQ A;  4FTH A;  2L9N A;  3T8T A;  4MFE A;  3K2Z A;  3OS0 A;  4M3F A;  1A35 A;  4U87 A;  5E79 C;  3F8N A;  5DD4 A;  2NS0 A;  3ZN1 A;  3NEU A;  5HOD A;  2ZSH B;  2HNH A;  4CYD A;  2DMQ A;  3WTU C;  4YFN F;  4XLC A;  3IV5 A;  2WB1 N;  5H6Q A;  3BG9 A;  2D1H A;  3CCE I;  2LRD A;  5DM7 F;  4E70 A;  2ME0 A;  1HQC A;  4ZTJ A;  2LKP A;  1U78 A;  2DOA A;  2L2O A;  1ZK8 A;  5IP6 A;  3QAH A;  1R71 A;  3WU0 A;  4UVC A;  2CV2 A;  4RB0 A;  3ECH A;  3TGN A;  1TTY A;  2V4J C;  2H09 A;  5K7Z A;  1G4D A;  2DN0 A;  4ZYG A;  3K6G A;  1DDN A;  3ABK H;  2M8E A;  5ICF A;  1DQU A;  2BOL A;  2ZCW A;  3KFW X;  2EFN A;  4LK1 F;  1IRF A;  1Y0N A;  1MW7 A;  2GA1 A;  5E8I A;  3HBL A;  2L5Q A;  1MMD A;  2EA2 A;  1TWC J;  3BZC A;  4F91 B;  1N77 A;  4N4O B;  4CA0 A;  5J8C A;  2ID6 A;  1LPQ A;  4BQA A;  1U9O A;  9ANT A;  2PN6 A;  2MSY A;  1OCZ H;  1SFX A;  3KP5 A;  3KP7 A;  2M87 A;  2I5U A;  1V5G A;  1S3J A;  2O61 A;  2AQF A;  4A3L J;  2M4G A;  4GRI A;  4RGS A;  4M9X A;  3PNV A;  2IAI A;  1BI2 A;  4RM2 A;  1FPQ A;  3N05 A;  4DGW B;  3K7A J;  4PZJ A;  1R6R A;  2XAG A;  1KU3 A;  1TWA J;  4NC6 A;  3E6C C;  3C3W A;  3EQL F;  2XKP A;  3RI4 A;  4MEX F;  2LFB A;  4MEY F;  2TDX A;  3SDB A;  2Q8K A;  2BW3 A;  5L3D A;  3KLN A;  2E5N A;  2LKX A;  3I4M J;  3PQK A;  4I98 B;  3W2W A;  4XIC A;  1WFX A;  3M8E A;  2FEZ A;  3QQA A;  2AO9 A;  4PFP A;  2KZV A;  2K9N A;  4E7H A;  4MO7 A;  4EM0 B;  3VYU B;  1XMX A;  2XKO A;  4L9J A;  3ZOB A;  3ZQH A;  2HOS A;  2BY2 A;  2QGU A;  2DMU A;  2OA4 A;  3M4O J;  1IXS B;  2EQR A;  2DOF A;  3WG7 H;  3O2P E;  3QPS A;  4B47 A;  2RKH A;  2VON A;  3CC7 I;  5GTH C;  1FYM A;  3HOV J;  1Z7L A;  1FMV A;  3CO6 C;  3HTS B;  4Y3O A;  4XRM A;  2WAQ N;  4G12 A;  4EJU A;  2E36 A;  3AG3 H;  4DOZ A;  1H9T A;  2Z5U A;  4AIJ A;  5DCF A;  1MBJ A;  1W4M A;  4XR6 A;  4HV5 A;  3RPQ A;  3NQO A;  5JFR A;  1QPM A;  3V8J A;  1SMY F;  2LF8 A;  1X1P A;  2RQP A;  2XVC A;  2EFO A;  2H6B A;  3UR3 C;  2JA8 J;  2HQR A;  2MYS A;  3GZN B;  1BIA A;  4PSW A;  3TQN A;  3LSM A;  1VQ8 I;  3HOU J;  2GIV A;  2XRL A;  2JA7 J;  1SD4 A;  3E7L A;  4C2U A;  2Y30 A;  3BG3 A;  3GZ5 A;  3SZP A;  2V79 A;  4E7L A;  2DPD A;  1OCP A;  4GO1 A;  3OYM A;  1X2N A;  4B09 A;  3GWZ A;  2L7M P;  2IP2 A;  1YE9 A;  1BW6 A;  2KIQ A;  2EV5 A;  3WGI A;  1IZ1 A;  2IGK A;  3TW7 A;  2K3P A;  5K7F A;  3CUQ C;  1W7P D;  1B1B A;  2DA4 A;  1FBU A;  4JBA A;  2RV8 A;  3CZ6 A;  3ISP A;  2DA7 A;  5IT9 K;  4D1Q A;  3UNG C;  4ZYA A;  4KYW A;  1UHW A;  3A03 A;  2HQA A;  2QVO A;  2CFX A;  2R5Y A;  2L7F P;  5EJC A;  2M4K A;  2DDB A;  2EFQ A;  3H9J A;  5LEK A;  2STW A;  5KK1 A;  1BR1 A;  3K4M A;  3G4S I;  4LFU A;  4CYC A;  1GLN A;  2K3F A;  3G3Z A;  4HV6 A;  2O8K A;  1GDT A;  1MJ9 A;  1WJ5 A;  3KIO A;  4FHT A;  4XRF A;  3RJP A;  4AIH A;  2LVS A;  1BJA A;  1P4A A;  5HS9 A;  1FTZ A;  2Z99 A;  1S72 I;  4M3D A;  2L4A A;  2Q0O A;  3ZR8 X;  3A0B C;  1J9I A;  5C3E J;  1KGS A;  3L2R A;  2IRF G;  1S9H A;  2V1X A;  4I6Z A;  1FLI A;  1TQM A;  5FD5 A;  1KU9 A;  2H8W A;  5JHU A;  4UB6 C;  4ENK A;  1W5C C;  1IG7 A;  3OYD A;  2R7S A;  3ZQI A;  1VQ7 I;  2ZME C;  3FXK A;  1VQL I;  2VBX A;  4PGH A;  5ILU A;  3MCZ A;  2CQK A;  3J7A Y;  5LFA A;  3M1C A;  1ZG3 A;  3CJQ B;  3R6S A;  3MZH A;  3W3C A;  5M3F J;  3L00 A;  4R8H A;  3CME I;  2IT0 A;  1XGM A;  5IOZ A;  4BKX A;  3FXO A;  1HBX G;  4RAG A;  1H8A C;  1K6O A;  4M9S A;  2Y0S N;  5JR3 A;  5CVI A;  1WCM J;  2F5V A;  5CLS A;  5KVR A;  1MIJ A;  3E6D A;  4A93 J;  3ASO H;  4RLQ A;  5J4Y A;  1S7A A;  2CFO A;  2Y69 H;  1W36 C;  4LGW A;  4OIN F;  4A0Z A;  1DP3 A;  1F43 A;  1FNN A;  4P9F A;  1OCO H;  3HKZ A;  1VQM I;  2HXI A;  2ELH A;  1PUF B;  4U0Y A;  3OIO A;  3H5R A;  3OSG A;  5DS9 A;  4C3I J;  2HQ5 A;  3QOE A;  2VE9 A;  2HDW A;  2F5F A;  2Z2S B;  5LGN A;  1IAW A;  2MC3 A;  1Z0X A;  2HWV A;  4F3Q A;  2A61 A;  2QQB A;  3S2H J;  3CJT B;  3GTG J;  5FRO A;  3L09 A;  4U88 A;  1NH3 A;  1G3W A;  2BBY A;  2WA0 A;  1LFP A;  2QEX I;  4KIF A;  1OQY A;  3JTH A;  4BEH A;  1ZRD A;  2ZXW H;  3OWT A;  4F52 A;  1H88 C;  1WPK A;  3JW4 A;  2DFF A;  4ZZL A;  5JVG F;  4L9V A;  1ZN2 A;  4Q47 A;  1R5I D;  2OTJ I;  4E7S A;  3JSO A;  4L5J A;  2L02 A;  3LAJ A;  4AIK A;  2A68 F;  3ABM H;  3FM5 A;  4O6J A;  4W1U A;  3BG6 A;  2D5V A;  5K5Q A;  2Y9Y A;  4KT6 A;  3VOD A;  1MSE C;  4IL6 C;  4YFK F;  2KJC A;  2XF5 A;  2OV7 A;  2CJJ A;  4P55 A;  3ZMT A;  3OR1 C;  3KE2 A;  2ZNZ A;  3JAM Z;  1XGS A;  3LA3 A;  5L3E A;  2EV6 A;  1BI0 A;  2K02 A;  4WXH A;  1XMA A;  3T8R A;  3MD2 A;  5E3O A;  1WI9 A;  1ACI A;  3VYS B;  4MQV A;  3WOD F;  4QSH A;  4A3G J;  2XF7 A;  5J40 A;  3HPH A;  2EZI A;  3GFL A;  3ZGK A;  3OYH A;  1ZYR F;  1VQ4 I;  2P8T A;  3H9Q A;  1Y6I A;  1D8K A;  4HBL A;  3R61 A;  3RTR A;  3OOP A;  2R7T A;  1HKS A;  2X1C A;  3HDD A;  3CMY A;  2YU3 A;  3GO5 A;  2HI3 A;  1XDU A;  5CQG A;  2RGV A;  2VOO A;  1WHU A;  1GHC A;  3GTK J;  1KU2 A;  3S2D J;  3KCC A;  3GFI A;  4IZZ A;  4HLY A;  1IC8 A;  4XLP F;  5GAE J;  3GUD A;  2R3S A;  5FO5 A;  3QOP A;  4XOP A;  4C3H J;  5EEH A;  2LBF B;  4JX5 A;  1P4X A;  3IKV A;  3FMQ A;  2J5P A;  1ETY A;  3ZQF A;  2XPW A;  5LEJ A;  2PMZ A;  3KZI C;  5DYM A;  4AUX A;  1WKM A;  3CO7 C;  4XKC A;  2MLK A;  2M8G X;  3CLO A;  1TNS A;  2RQQ A;  3X2Q H;  3NAR A;  1FBS A;  2MGQ A;  3RYR A;  2D2W A;  4XBF A;  3GVA A;  2RAE A;  2LP0 A;  5FKK A;  3FIS A;  2BXY A;  5JHF A;  3DEU A;  4BJ6 C;  5L3F A;  2XHK A;  3CCM I;  3OR2 C;  4RGR A;  1MMN A;  1IO2 A;  3GYH X;  1BC8 C;  1WRJ A;  1W7P A;  1DGW Y;  2KL4 A;  1STZ A;  4XLH A;  3KYC B;  2RDP A;  2N8G A;  2OCC H;  1LEB A;  3B73 A;  3G2B A;  4WXD A;  1NG7 A;  1K78 B;  3DLL F;  3PFY A;  2A05 A;  3GFM A;  1MND A;  3BC8 A;  1AOY A;  1TWF J;  4ZJZ A;  2FNA A;  2JSP A;  3I9V 2;  1G8X A;  3I59 A;  2M30 A;  3H3Z A;  2CMP A;  5LHG A;  1YX5 A;  5J1R A;  2EZL A;  2R7Z J;  4CXF A;  4OIQ F;  2NVU B;  2PBI A;  2WY7 Q;  5EZH A;  3MKZ A;  2EZK A;  2DOD A;  2ID3 A;  4LG3 A;  3M8J A;  3W2V A;  1FSH A;  2AHQ A;  2HXO A;  4EM1 A;  3FDY A;  5LRS A;  2IGN A;  2L54 A;  2FBK A;  5GAD J;  3E6M A;  1JKR C;  2K9M A;  3K69 A;  2BXZ A;  1IV6 A;  1O3R A;  3HKZ N;  3ABU A;  1Q1V A;  2I8D A;  3FF5 A;  3IAS 2;  2HOE A;  2JA2 A;  3W6V A;  1OLT A;  2VIX A;  2BY0 A;  2R7U A;  4II3 A;  2Y0S A;  3F3X A;  1TQP A;  4RDU A;  4OMZ A;  5HVQ C;  2W00 A;  4FQG A;  4PDK A;  1IF1 A;  2B63 J;  3GTP J;  2M5W A;  4WWC A;  1QO0 D;  1VTN C;  5C4X J;  1U5T C;  3IH3 A;  4G94 A;  5EGO A;  2ELJ A;  1QVU A;  3JSP A;  2CV0 A;  2OF7 A;  2BVL A;  1FMW A;  4A0X A;  3BR1 A;  5H6R A;  1R4N B;  2OAZ A;  3BQY A;  5CVU A;  2GQQ A;  4BHP A;  2XC7 A;  1O7L A;  1V3F A;  3PQJ A;  3ZMV A;  4ZH4 F;  5CJ9 A;  4RB3 C;  2QSG X;  2G7H A;  2K40 A;  3FXM A;  4EM2 A;  1ETK A;  3TDZ C;  3A01 A;  2EK5 A;  3A1Y A;  1JGG A;  3U1D A;  2K86 A;  2BY3 A;  5ICC A;  2O8X A;  4DQ2 A;  4R79 A;  5HDK A;  4WX9 A;  4PK4 A;  2QKM B;  1YHQ I;  1Z05 A;  1JE8 A;  3HPG A;  1XG1 A;  1YJW I;  4AID A;  2PMZ N;  3AG4 H;  5D6F A;  2X85 A;  4NHJ A;  4IHY A;  2ICW G;  1ZRE A;  5E3L A;  1ETV A;  4CO8 A;  1XC5 A;  2FOW A;  1UST A;  1XB4 A;  2Y0M A;  1WQ2 A;  1LE8 A;  4KMU X;  5J47 A;  4BY1 J;  1FTT A;  1L0O C;  1EV7 A;  4I76 A;  1IXC A;  2KIF A;  5HLG A;  1Z91 A;  1XDS A;  2B9S A;  2OPT A;  5EEA A;  4U7B A;  1YIT I;  1WZ2 A;  1I50 J;  4KDP A;  1MBG A;  1P6R A;  4D7N A;  3ERE D;  3HXL A;  2EZH A;  4AWX B;  2DPU A;  2LYC A;  3K1M A;  2P5L C;  3I3L A;  4YIF A;  3CMA I;  1Y0U A;  5IT9 Z;  2ZNY A;  4IQ4 A;  4IOA F;  2K9S A;  3G1L A;  3WTT C;  4U0W A;  4BE0 A;  1K4S A;  4MIM A;  3VSK A;  1ZLJ A;  2FOK A;  4ZYD A;  5BS6 A;  2UUZ A;  1F1Z A;  1TW3 A;  3GZ6 A;  3K4N A;  1X2M A;  3GCM A;  3BG5 A;  1JUP A;  1VQO I;  2DK8 A;  3NWT A;  3LSJ A;  2Q1Z B;  3OYB A;  2FF4 A;  3SEZ A;  1T95 A;  2XPV A;  2MH9 A;  3SXY A;  3L9F A;  4M9Z A;  4LIT A;  3ZQQ A;  3FHZ A;  2V6E A;  2P5K A;  3KZY A;  4B1R A;  2V9K A;  3S2W A;  1ZRF A;  1O57 A;  2WAE A;  3LSH A;  2ISZ A;  2P7C B;  2VXZ A;  3ASN H;  2YU9 J;  4ENN A;  1BL0 A;  3QPT A;  4JQF A;  2V1D A;  3OS1 A;  1OMI A;  4EVI A;  1G59 A;  3S3M A;  1RR8 C;  2IGM A;  2FMY A;  3BY6 A;  4Y33 A;  3K9T A;  3PFI A;  1P4W A;  5ICG A;  4IXA A;  2VLA A;  3Q5F A;  1R5G A;  5B66 C;  2WWY A;  1I3A A;  4CH7 A;  4UXN A;  2LH9 A;  1X4O A;  1OYY A;  3QPL A;  3H0D A;  3C2B A;  5LHH A;  5CVJ A;  2W48 A;  4XRS A;  4ESJ A;  1SVO A;  2L01 A;  2YPR A;  1B9M A;  3F6O A;  4B4C A;  4UVB A;  4CYC B;  4IHT A;  1XN7 A;  1VQP I;  5IP9 J;  4MFD A;  4LLN A;  5C44 J;  3A2K A;  1R5H A;  2NRA C;  5FLV A;  2ZB9 A;  2LY2 A;  2X1E A;  5DEQ A;  1RRJ A;  2R7W A;  1JKO C;  2DFI A;  2Y2Z A;  4IPA A;  4KUM A;  1G3S A;  3S1R J;  1Z3Y A;  1LDJ A;  3L7W A;  4DBR A;  3M9A A;  3DEE A;  1XGN A;  3ABL H;  1R00 A;  1BM9 A;  3PUB A;  4AD9 A;  3ZPL A;  3HM5 A;  3N4M A;  3M8F A;  2R7F A;  3CCR I;  4UVA A;  4LD5 A;  1HF0 A;  2QSH X;  1SFK A;  3H5N A;  4Y17 A;  2OQR A;  1BA5 A;  3HUG A;  1H89 C;  1WJA A;  5IT3 A;  2NVX J;  2K27 A;  2ZXI A;  1Z3X A;  2QYO A;  3LA7 A;  3VWB A;  1FZP B;  3K1N A;  3ULQ B;  4A5N A;  3OYN A;  3IL2 A;  5CQE A;  3BPX A;  3Q0W A;  3HRS A;  1SFU A;  3IH4 A;  1R1T A;  4HOB A;  3OYK A;  4A6D A;  3LSR A;  1IUF A;  1F5T A;  4IHV A;  4I02 A;  4PFO A;  2X48 A;  4CUG A;  2P4W A;  1JTX A;  1UB9 A;  2GOX B;  2K7L A;  3EET A;  1RET A;  2A6H F;  1V5F A;  4HA8 A;  4OU0 A;  2FRH A;  1T08 B;  4ZDL A;  4A12 A;  1UHS A;  2MAB A;  2R7O A;  4XLE A;  2DT7 B;  1CQT A;  1NK2 P;  3GTM J;  5DM6 F;  2QBY A;  1RUN A;  3FWE A;  3KEQ A;  1TL8 A;  1NK3 P;  3RCO A;  5JI6 A;  3O8H A;  3W2A A;  2DAO A;  2ZFU A;  3QWL A;  5D5U B;  4OWR B;  1TW2 A;  1FX7 A;  1U6G A;  1E3O C;  4YG2 F;  1W0T A;  3HGY A;  1Y39 A;  4E7K A;  2XUB A;  1HXD A;  1M1E B;  1BR2 A;  4YII A;  5M5Y J;  2MG4 A;  1BOA A;  4G6Q A;  3RIR A;  2A07 F;  1VQ5 I;  4M6Y A;  3PJR A;  1JJ6 C;  3M07 A;  5J1Y A;  3ESW B;  3TL4 X;  4EQQ A;  3JRA A;  4RS8 A;  1SD5 A;  1YI2 I;  3C18 A;  3OYA A;  2EH3 A;  3BP8 A;  2GM4 A;  2Q2E A;  1R22 A;  3I5U A;  4WCG A;  1OCC H;  3V4G A;  2IS1 A;  3DTK A;  3J7Z I;  2LBF A;  3HRT A;  2UXX A;  1YFH A;  4N0B A;  4QPQ A;  2DYS H;  2WAF A;  1V54 H;  3R4K A;  1MDM A;  3VOE A;  2LG4 A;  5BMZ A;  5F0F A;  4Y13 A;  2M2E A;  1T2K A;  2BZT A;  1SC7 A;  1DP7 P;  2ACJ A;  1REP C;  2HOT A;  4I2O A;  5F6F A;  1IN6 A;  2XB5 A;  2W7N A;  1T98 A;  2DA2 A;  1ON2 A;  2AXL A;  1UZC A;  3ML6 A;  4D0P A;  4RBO A;  3TOA A;  2DYR H;  3MWM A;  4AM3 A;  3S8P A;  2ZME B;  2E1N A;  1B4A A;  4GCV A;  1B6A A;  1LJ9 A;  1Y56 A;  3F23 A;  2ISY A;  3FHN A;  4PGG A;  3JRF A;  2ZJQ F;  3WTX C;  1X4P A;  2LDU A;  2IA2 A;  1EF4 A;  4ON0 A;  1FP2 A;  3WG9 A;  5L3G A;  1Y8R B;  2K5C A;  2OU2 A;  4X1E A;  4IEJ A;  2ZXH A;  4BXF A;  1ZGW A;  2HPM A;  2OCE A;  3E5X A;  3BWG A;  3S3O A;  1K78 A;  4A3D J;  1K7A A;  1OYI A;  2CRG A;  2JMW A;  2HPI A;  3BCA A;  1MZB A;  4B43 A;  2F48 A;  1MBF A;  3P9I A;  3P7N A;  2W84 A;  3AL0 C;  4UHT A;  3S1N J;  2FXA A;  3I56 I;  4HF1 A;  2VOP A;  2L9V A;  2AS5 F;  3L1P A;  2R5Z A;  1TP4 A;  3GTO J;  1IN4 A;  3JRD A;  2OJE D;  4IKF A;  5F27 A;  3OYF A;  3LMM A;  2BHZ A;  3CDH A;  1IDY A;  3V42 A;  5C4J J;  4E7I A;  1IV8 A;  4PUS A;  2GBY A;  3MFK A;  1X3W B;  3QP6 A;  3CC2 I;  3BR6 A;  2W1O A;  3Q9S A;  2L9S A;  2CU7 A;  3HIF A;  1Y1W J;  4LLG F;  4ETS A;  1PP7 U;  2E1O A;  6PAX A;  5D8L B;  2FSW A;  4XL9 A;  1LVA A;  1UJ8 A;  2MW8 A;  5TGT A;  3HSR A;  4J00 A;  1L3L A;  4DYR A;  1APL C;  5FRN A;  3CP8 A;  5J1U A;  3DKW A;  2E2J J;  5FFZ A;  3DTI A;  4ENM A;  3H36 A;  2CW0 F;  3K70 C;  2JT1 A;  2DJN A;  2E1M B;  4NUB A;  5B1B H;  1SEU A;  4FET A;  4Y4R A;  2EJR A;  1FY7 A;  3O8G A;  2Y9Z A;  3LQQ A;  2TRT A;  1MH4 A;  2QF7 A;  3K1P A;  2GXA A;  3VPR A;  4CDG A;  3MN2 A;  1MMG A;  2OTL I;  3BJ6 A;  2M1B A;  4IO9 F;  3MZ8 A;  1QVT A;  1WGX A;  4W97 A;  3V8L A;  2VPR A;  3N97 A;  3RKX A;  1MJB A;  3W6J B;  2F5D A;  1B8I A;  4KIS A;  2HGC A;  1RUO A;  3REO A;  3H92 A;  2GLO A;  4U0V A;  3IWF A;  1VZ0 A;  5D8K B;  5D5V B;  1WJF A;  3F0C A;  1IJW C;  5E18 F;  5D5X B;  2W82 A;  3RKQ A;  3A01 B;  1IRX A;  4B3X A;  1LEA A;  1J7K A;  2QM3 A;  1LDK B;  2CW7 A;  3IC7 A;  2VJJ A;  1LNW A;  1X1B A;  3QU3 A;  5BOX A;  1PP8 F;  4MLO A;  1YW7 A;  4HF2 A;  3IRR A;  4MTE A;  1SAX A;  2HZT A;  2OBP A;  1XSD A;  1RKW A;  1MD0 A;  1Z21 A;  1YS6 A;  4XKW A;  2CUZ A;  2LNB A;  1SFE A;  1XD7 A;  2JUG A;  3HJE A;  4C30 A;  3J80 Z;  3I54 A;  1K79 A;  1NTC A;  3ELK A;  3BG7 A;  5H20 A;  4MGR A;  4DZJ A;  1LVK A;  2VE8 A;  3PO3 J;  3HYI A;  2X6O A;  2XSJ C;  3GTJ J;  3K70 D;  4EAT A;  2CYY A;  4NNJ A;  1QPI A;  4ESB A;  4MTD A;  3R60 A;  2K4J A;  2GAU A;  2DFE A;  1O3T A;  1KU7 A;  1H9G A;  3HOT A;  3GTQ J;  1SAN A;  4XM3 A;  2KRC A;  5DUI A;  5KNL A;  2NVT J;  4FE7 A;  4LIV A;  3DWL E;  2DQR A;  2JZY A;  2F6C A;  2ETH A;  1O7F A;  4ZYH A;  5J8F A;  2QSF X;  2FQ4 A;  4OIO F;  1Z1D A;  2KJB A;  1HKQ A;  4GXO A;  5FKL A;  4GDF A;  2IGO A;  4UY8 I;  1FOW A;  2CQN A;  1LDD A;  3ZMU A;  3ZQL A;  5M3M J;  5DCM B;  1X1A A;  3T0Y A;  2VQC A;  4V2F A;  2RNJ A;  3O6B B;  3LSK A;  1YOV B;  3E5Q A;  2QQ8 A;  4D5F A;  1VND A;  3DQV C;  1F4K A;  5F1R A;  2CUJ A;  2R5Y B;  4YFX F;  1J09 A;  1D0Y A;  2GXG A;  3ZMD A;  1D3Y A;  2O6G E;  1LUJ B;  3U21 A;  1QA6 A;  2VXD A;  3OYI A;  3HSF A;  4D9J A;  1R7J A;  1Q1H A;  4M3E A;  3BTJ A;  2JUC A;  5K5R A;  4BQO A;  3S14 J;  1YW8 A;  5ERI A;  5A2Q K;  4L5E A;  1V4R A;  2R7Q A;  4RM3 A;  4M3B A;  4KIG A;  1TQI A;  1ZGJ A;  1FOX A;  4XSZ F;  1NG6 A;  3A02 A;  1TNT A;  1ZAO A;  2WBM A;  3DP7 A;  1D1C A;  3RQI A;  3SFZ A;  2IS4 A;  5BPI A;  1LQ1 A;  2VBY A;  2DT5 A;  2IW5 A;  1FJL A;  2A5Y B;  1XCV A;  4F7Z A;  3C2G A;  3G1M A;  2L3D A;  3RZD J;  3DBH B;  4HX4 A;  1T33 A;  1ZQ3 P;  2DOE A;  1MBE A;  3SJM A;  4AU7 A;  5LLQ A;  2NYX A;  4I99 C;  2FUG 2;  3LA2 A;  4A69 C;  4B44 A;  5EG0 A;  2P6T A;  3EUH C;  4OAZ A;  3DPT A;  4AYB N;  2YX4 A;  2HOA A;  5IP7 J;  4N4N B;  3VB2 A;  2GWR A;  3J80 K;  3HL2 A;  3VFZ A;  3CP2 A;  1A36 A;  2ESN A;  1TLH B;  2PMH A;  4EMS A;  1O4X A;  1OFC X;  4PSX A;  5F0C A;  1R49 A;  2FML A;  1X1C A;  2VKE A;  3HB9 A;  2AQE A;  4LG0 B;  2HU9 A;  3DTE A;  4EGZ A;  2JRM A;  1D8J A;  4DJA A;  2M0C A;  2NOJ B;  4MNU A;  2W4S A;  1A6Q A;  2LC2 A;  1SVL A;  5BPD A;  4XKB A;  4LLL A;  3JCU C;  1U8R A;  3CCV I;  3P9K A;  3CCY A;  5HNH A;  3LSI A;  3SEQ A;  4BE2 A;  1D1B A;  2GA2 A;  2M7B A;  3AG1 H;  4XOT A;  4XID A;  1ETW A;  2Y31 A;  3ERM A;  3HOW J;  4O5V A;  1RC9 A;  2VBZ A;  1RPW A;  3FKJ A;  5BNG A;  1LE8 B;  4A6E A;  2HDD A;  3FK6 A;  1A5J A;  1FT9 A;  1MSF C;  4ASN A;  2D1V A;  2LD5 A;  2NOG A;  1MBH A;  3CCU I;  1LFB A;  4UNO A;  2IEK A;  3CCS I;  4XLA A;  1JHF A;  2F4M B;  2MA3 A;  2KRF A;  1ZHF A;  2R92 J;  1ZEL A;  3EUH A;  4S04 A;  4PJL A;  4XKV A;  2COB A;  3KLO A;  1ORK A;  3A0H C;  3BCB A;  1QQI A;  1TC3 C;  1YRN B;  2IPQ X;  3GF2 A;  3I4N J;  1XTA A;  4CGZ A;  3E3V A;  3AAF A;  5HLI A;  3CDI A;  3BDD A;  5E1X A;  3HOZ J;  3MVP A;  3K4J A;  4WK8 F;  3DKY A;  4OIP F;  4HRI A;  4PJ0 C;  3IH2 A;  4BBR J;  3K10 A;  1ERD A;  4ZC3 A;  5AIQ A;  3IRQ A;  2LMD A;  2ZJP F;  1XPX A;  1S8N A;  2R7D A;  3PIO F;  4JYK A;  5M5W J;  2H94 A;  3NRV A;  2DTZ A;  3T1B A;  3F9K A;  1KQ0 A;  1RIO H;  2LRE A;  4PJN A;  3H9G A;  5E17 F;  2VKV A;  2DTR A;  1YX3 A;  2IVM A;  5KHD A;  1OPC A;  5GPC A;  3OYE A;  4IF4 A;  3TP3 A;  5K5O A;  1YIJ I;  2CH0 A;  2MC4 A;  1BC7 C;  3RKW A;  4HDU A;  2Z16 A;  3FXQ A;  3L2U A;  1MDM B;  3FXR A;  2GXB A;  3OMY A;  3DU6 A;  4ENJ A;  4P1W A;  3HOX J;  1MBK A;  4J19 A;  1OJL A;  4G7H F;  3ZQ7 A;  2EB7 A;  1WH5 A;  5F64 A;  4J01 A;  4E7Z A;  2XSD C;  2HVQ A;  1Y1V J;  4I01 A;  3WE3 A;  4CIC A;  4ZTF A;  3QRF F;  2VI6 A;  2ADU A;  2VT3 A;  1PVE A;  3ZN0 A;  1IDZ A;  1HW5 A;  2JRT A;  3GXO A;  4NC8 A;  3OYL A;  2KDZ A;  1HKT A;  2DMP A;  1UG2 A;  4CCL A;  4O3M A;  3F72 A;  5HNF A;  3MMY B;  2BEO A;  1FYL A;  4BGD A;  3JTG A;  3VDX A;  4ZYE A;  2VKD A;  3ROU A;  5FLM J;  1OYW A;  4XMY A;  1TBX A;  3WTS C;  3PM1 A;  2EWN A;  3LOC A;  4KN4 X;  5FKO A;  1O3S A;  2FNP A;  1TT0 A;  3V7R A;  4FIS A;  5B3S H;  4I7H A;  2CGP A;  3G6E I;  5GTI C;  4JK1 X;  1PJR A;  3QYB A; 
#chains in the Genus database with same CATH homology
 4M72 A;  4A0Y A;  2OZU A;  3COA C;  3F22 A;  5HOO A;  3CUO A;  3F8M A;  3M1E A;  5D6E A;  3I64 A;  4KN7 X;  2RN7 A;  2DW4 A;  2DBB A;  3KP4 A;  3DV8 A;  5E1Z B;  5EEG A;  1SD7 A;  2ZME A;  4MQ9 F;  5TRD A;  1QBJ A;  4MHG A;  1ZAR A;  2PI0 A;  4EJO A;  3FMS A;  1UFM A;  2HTJ A;  2E1C A;  1QZY A;  1QNT A;  3C1D A;  4RGX A;  4M74 A;  1X3U A;  1KQ8 A;  1FYK A;  4BH9 A;  4IRG A;  4P96 A;  3J81 Z;  2XAQ A;  2XAS A;  3HRU A;  3J7A O;  3GLX A;  1YLF A;  3LAP A;  3EDP A;  3U2R A;  2PMU A;  4N9I A;  1DPU A;  4M6X A;  2HYF A;  3KEO A;  5ILS A;  2VT2 A;  2Y75 A;  2QQ9 A;  1R58 A;  1T6S A;  2ZJ2 A;  3MAJ A;  3HHG A;  2DLL A;  2HTS A;  1DPR A;  2ZO4 A;  1ONV A;  5CVV A;  4WXC A;  3WGG A;  1Z7U A;  4L18 B;  3KP2 A;  2V1U A;  2EA4 A;  4A5M A;  4XLN F;  1G6N A;  1T39 A;  4N9H A;  4S05 A;  1P2F A;  2KIM A;  3CJN A;  2P5V A;  1JHH A;  1A04 A;  5DD8 A;  1CGP A;  2VC0 A;  4IJA A;  2HKO A;  4LK0 F;  1RNL A;  1IN8 A;  1IN7 A;  5DCM A;  3SZT A;  3QPH A;  4TV7 A;  4QWQ A;  3KP6 A;  2QZ8 A;  2BV6 A;  1QGP A;  2XRO A;  2H27 A;  3GW2 A;  3H3U A;  3SHF A;  3F6V A;  4ZZD A;  3ZMS A;  1G3Y A;  2RC4 A;  4M71 A;  3BRO A;  4KNY A;  4A2U A;  1MGT A;  2E7W A;  5L3C A;  2STT A;  2COM A;  3E6B A;  2CWE A;  4M73 A;  2W24 A;  2E7X A;  3RPU A;  3EYI A;  2A6E F;  2X4H A;  2HQN A;  2VC1 A;  1ZGA A;  1W5T A;  4HAM A;  3V8K A;  4HF0 A;  2FA5 A;  2QUF A;  2VBW A;  2XRN A;  1I5Z A;  1G3T A;  1YYV A;  3V7C A;  1P92 A;  2PEX A;  2A3S A;  2MD5 A;  3ABT A;  4GYI A;  4LG0 A;  3MQ0 A;  4RB2 C;  5LHI A;  2LSO A;  1IW7 F;  2JSC A;  2Z9O A;  3HRM A;  1SD6 A;  1HST A;  4LJZ F;  2D45 A;  5K1Y A;  4HDV A;  1WSU A;  1USS A;  1IN5 A;  2OQG A;  1FWZ A;  2BE5 F;  3BJO A;  4Q5S F;  2NNY A;  1KA8 A;  1B9N A;  1J75 A;  4G7O F;  3F8C A;  2LF7 A;  1Z6T A;  1T0F A;  2WC2 A;  2X0L A;  2IA1 A;  1YTY A;  2O03 A;  3WTZ A;  5FLX K;  4B8X A;  2WV0 A;  4L0Z B;  4BYY A;  1GVJ A;  1BIB A;  1ZRC A;  1BI3 A;  5HS8 A;  4NQW A;  3IKT A;  3BPV A;  2Z33 A;  3EYY A;  3OV8 A;  4OOI A;  3TO6 A;  2QBY B;  4HX8 A;  3FZV A;  2XAF A;  1BI1 A;  4XSX F;  2K4B A;  2QQA A;  5TJJ A;  5D5W B;  3I58 A;  3WE2 A;  2P6S A;  1BBY A;  4FT8 A;  1BN5 A;  3K0L A;  3DPL C;  3B02 A;  1YO5 C;  3M7G A;  2VN2 A;  3CTA A;  3BZ6 A;  1FP1 D;  4UV9 A;  1ULY A;  4UUV A;  3Q9V A;  4ESF A;  5ED4 A;  3E5U A;  2FE3 A;  2RVC A;  2MLG A;  4FX0 A;  3TKY A;  2WTE A;  4I0A A;  3WGH A;  2W25 A;  4GGG A;  1CF7 A;  1RI7 A;  2OD5 A;  3LWF A;  3R0A A;  1YQA A;  3I4P A;  1S7O A;  5LBQ A;  5FLX Z;  1PDN C;  5CYV A;  4RAY A;  5FGM A;  1ZG1 A;  2PJP A;  2XIG A;  5JVT A;  1C0W A;  4Q4Z F;  1R36 A;  3DFG A;  1SMT A;  2ZKZ A;  3F8F A;  3MEX A;  5FFX A;  5A2Q Z;  5ILV A;  4RB1 A;  4KIC A;  1IXR C;  1IUY A;  2UZK A;  1MJA A;  3O3K A;  2GZW A;  2Y48 A;  3WTV C;  1EH6 A;  1OKR A;  3CUQ A;  4FX4 A;  4EGY A;  4L0Y B;  2G7U A;  3G73 A;  4HQE A;  4U7D A;  1XSV A;  5E20 A;  2A69 F;  3F21 A;  5LRR A;  1XCB A;  1Z6R A;  4LB6 B;  3KP3 A;  5LGT A;  2PG4 A;  1ODD A;  3FM3 A;  5D4S A;  4Y15 A;  1DUX C;  3VEP A;  1S29 A;  3WTW C;  2ZXJ A;  1HW2 A;  1H0M A;  2XV4 S;  3MZY A;  4DNC A;  2HEO A;  2F5E A;  1I1S A;  1U5T B;  4I0B A;  2BYV E;  4G7Z F;  4K2E A;  5LGU A;  1GXP A;  4AVP A;  1ZH5 A;  4KMF A;  1R1U A;  3TOB A;  2B0L A;  2Z3Y A;  1RZ4 A;  4EJW A;  3QP5 A;  5DUK A;  1FSE A;  4PCQ A;  3J81 K;  2HDC A;  4G6D A;  3GEZ A;  1YIO A;  3L2C A;  2JPB A;  3LQR A;  3JAM K;  4Z2Y A;  2W57 A;  2CG4 A;  3KET A;  3P9C A;  2NAZ A;  1S6L A;  3C7J A;  2DU9 A;  4BAY A;  2XAH A;  4GYG A;  3QU6 A;  1W7P B;  2MBF A;  3U9G A;  2VOD A;  3V7S A;  1E17 A;  1PUE E;  3IHU A;  4EJV A;  5HS7 A;  3I59 B;  2YX7 A;  1JXS A;  2ESH A;  5DV5 A;  3GX4 X;  4Q48 A;  5E1W A;  2OZ6 A;  2CSO A;  5FD6 A;  5AON A;  5CVR A;  3FMR A;  3TO7 A;  3KZZ A;  2HYG D;  1YG2 A;  3E97 A;  2QLZ A;  2L4M A;  4KT5 C;  2YR2 A;  3RDI A;  4KA4 A;  4RAZ A;  4HW0 A;  1KYW A;  4HYE A;  1OR7 A;  1ZLK A;  1AWC A;  4UV8 A;  1D5V A;  3TDU C;  5D4R A;  2V9V A;  2DK5 A;  5DDG A;  1XSX A;  2FBH A;  2PFB A;  4G9Y A;  5ICE A;  3I0T A;  2IA0 A;  3TO9 A;  2C6Y A;  2F2E A;  2HFH A;  3BJA A;  4EJT A;  2XGX A;  1I27 A;  2PQ8 A;  1ON1 A;  5HDG A;  4OIR F;  4I09 A;  4P5O A;  2HKX A;  3F8B A;  1FBQ A;  4RGU A;  2FU4 A;  4CZZ A;  1LB2 A;  2EFW A;  2ZFW A;  1J5Y A;  1XGO A;  2YSR A;  2XAJ A;  2UWM A;  4IRH A;  5BQT A;  2KIU A;  2FBI A;  3WU1 B;  4LB5 A;  2MH2 A;  3HHH A;  1NHA A;  1KYZ A;  4OMY A;  3HSE A;  1B59 A;  1FOK A;  3I71 A;  4LMY A;  1R23 A;  3ZP5 A;  2CO5 A;  3DXJ F;  5AIP A;  2QWW A;  1HW1 A;  3FXU A;  2UXN A;  1U3E M;  4HLX A;  4IVN A;  2HS5 A;  3T5X A;  4NB5 A;  4BXU A;  1FC3 A;  3D0S A;  1CF7 B;  2V6C A;  3HTU A;  2EV0 A;  1J2X A;  4QLC U;  3HOS A;  2NNN A;  4HZF A;  1UHM A;  1W5S A;  2KKO A;  5L3B A;  2JPC A;  1KQ9 A;  1QZZ A;  3RYP A;  2H6C A;  4KFC A;  3ZMZ A;  4CHU A;  2F5C A;  4EV0 A;  2O3F A;  4R1H A;  1JGS A;  5FB2 A;  1I1G A;  3GFJ A;  1R1V A;  1HSJ A;  1EH8 A;  1T38 A;  3RKY A;  1I6X A;  3ECO A;  2DI3 A;  2PLY A;  4WF2 A;  2BGC A;  1Z9C A;  1E2X A;  3DF8 A;  3LFK A;  4H0E A;  3R0J A;  3LST A;  1EH7 A;  1O3Q A;  1UCR A;  3SQN A;  2HR3 A;  2JTV A;  3I53 A;  4G8X A;  4L9N A;  1IRG A;  1F9N A;  2J5O A;  1ZG5 A;  5E8G A;  5HDN A;  3W6K B;  4IRI A;  3WTY C;  1J59 A;  1WWX A;  4L9T A;  4BNC A;  1YW9 A;  1J0R A;  1U5T A;  3FX3 A;  3CUQ B;  5HLH A;  4HX7 A;  1XMK A;  2EFP A;  2DO7 A;  2G9W A;  2M45 A;  5J6X A;  2P7V B;  4BHB A;  3IWZ A;  1U2W A;  4KIB A;  2QEN A;  4HQM A;  2O0Y A;  1GXQ A;  4L5I A;  4BHC A;  1YS7 A;  2FQ3 A;  4P9U A;  2ZBK A;  2DQL A;  1MKM A;  2IJL A;  3BOQ A;  2W85 A;  4IHS A;  3D5L A;  3T8T A;  3K2Z A;  3F8N A;  5DD4 A;  2NS0 A;  3ZN1 A;  3NEU A;  4CYD A;  3WTU C;  4YFN F;  5H6Q A;  2D1H A;  4E70 A;  1HQC A;  1U78 A;  2LKP A;  3QAH A;  3WU0 A;  4UVC A;  4RB0 A;  3ECH A;  3TGN A;  1TTY A;  2H09 A;  1G4D A;  4ZYG A;  1DDN A;  2M8E A;  5ICF A;  2ZCW A;  4LK1 F;  3KFW X;  2EFN A;  1IRF A;  2GA1 A;  5E8I A;  2EA2 A;  5J8C A;  4BQA A;  2PN6 A;  1SFX A;  3KP5 A;  3KP7 A;  2M87 A;  1S3J A;  2O61 A;  4RGS A;  4M9X A;  1BI2 A;  1FPQ A;  4PZJ A;  2XAG A;  1KU3 A;  3E6C C;  3C3W A;  3EQL F;  2XKP A;  3RI4 A;  4MEX F;  4MEY F;  2TDX A;  2Q8K A;  5L3D A;  3KLN A;  3PQK A;  4I98 B;  3M8E A;  2FEZ A;  4EM0 B;  2XKO A;  4L9J A;  2OA4 A;  1IXS B;  3O2P E;  2RKH A;  2VON A;  1FYM A;  3CO6 C;  3HTS B;  4EJU A;  1H9T A;  2Z5U A;  4AIJ A;  5DCF A;  1W4M A;  4HV5 A;  3RPQ A;  3NQO A;  5JFR A;  1QPM A;  3V8J A;  1SMY F;  2LF8 A;  2XVC A;  2RQP A;  2EFO A;  2H6B A;  2HQR A;  1BIA A;  3TQN A;  2GIV A;  1SD4 A;  3GZ5 A;  3SZP A;  2DPD A;  2V79 A;  4GO1 A;  4B09 A;  3GWZ A;  2IP2 A;  2EV5 A;  3WGI A;  1IZ1 A;  3CUQ C;  1W7P D;  1B1B A;  1FBU A;  4JBA A;  2RV8 A;  3ISP A;  5IT9 K;  4KYW A;  1UHW A;  2QVO A;  2CFX A;  2EFQ A;  5LEK A;  2STW A;  5KK1 A;  4LFU A;  3G3Z A;  4HV6 A;  4AIH A;  1MJ9 A;  4FHT A;  4XRF A;  3RJP A;  5HS9 A;  1BJA A;  1P4A A;  2Z99 A;  2L4A A;  2Q0O A;  1J9I A;  1KGS A;  2IRF G;  2V1X A;  1FLI A;  1TQM A;  5FD5 A;  1KU9 A;  5JHU A;  4ENK A;  2VBX A;  4PGH A;  5ILU A;  3MCZ A;  2CQK A;  3R6S A;  1ZG3 A;  3MZH A;  3L00 A;  4R8H A;  2IT0 A;  1XGM A;  1HBX G;  1K6O A;  4M9S A;  5JR3 A;  5CVI A;  5CLS A;  5KVR A;  3E6D A;  1S7A A;  4LGW A;  4OIN F;  4A0Z A;  1FNN A;  4P9F A;  2ELH A;  4U0Y A;  2VE9 A;  1IAW A;  2F5F A;  5LGN A;  2MC3 A;  2HWV A;  2A61 A;  2QQB A;  3L09 A;  4U88 A;  1G3W A;  2BBY A;  4KIF A;  3JTH A;  1ZRD A;  3JW4 A;  4ZZL A;  4L9V A;  1ZN2 A;  4Q47 A;  3JSO A;  4L5J A;  2L02 A;  3LAJ A;  4AIK A;  2A68 F;  3FM5 A;  4O6J A;  5K5Q A;  3VOD A;  4YFK F;  2KJC A;  4P55 A;  3ZMT A;  3KE2 A;  2ZNZ A;  3JAM Z;  1XGS A;  3LA3 A;  5L3E A;  2EV6 A;  1BI0 A;  2K02 A;  4WXH A;  1XMA A;  3T8R A;  1WI9 A;  3WOD F;  4MQV A;  3GFL A;  1ZYR F;  2P8T A;  1D8K A;  4HBL A;  3R61 A;  3RTR A;  3OOP A;  1HKS A;  2YU3 A;  3GO5 A;  1XDU A;  2RGV A;  2VOO A;  1GHC A;  1KU2 A;  3KCC A;  3GFI A;  4HLY A;  4XLP F;  3GUD A;  2R3S A;  5FO5 A;  3QOP A;  5EEH A;  1P4X A;  3IKV A;  3FMQ A;  2J5P A;  5LEJ A;  5DYM A;  1WKM A;  3CO7 C;  2MLK A;  3CLO A;  1TNS A;  1FBS A;  3RYR A;  2D2W A;  4XBF A;  3GVA A;  5L3F A;  3DEU A;  2XHK A;  4RGR A;  3GYH X;  1BC8 C;  1WRJ A;  1W7P A;  1STZ A;  2RDP A;  1LEB A;  3B73 A;  4WXD A;  1K78 B;  3GFM A;  1AOY A;  2FNA A;  3I59 A;  2M30 A;  3H3Z A;  5LHG A;  4CXF A;  4OIQ F;  2PBI A;  1FSH A;  4EM1 A;  5LRS A;  2L54 A;  2FBK A;  3E6M A;  3K69 A;  1O3R A;  3ABU A;  3FF5 A;  2HOE A;  3F3X A;  1TQP A;  4OMZ A;  5HVQ C;  4PDK A;  1IF1 A;  2M5W A;  4WWC A;  1QO0 D;  1VTN C;  1U5T C;  4G94 A;  3JSP A;  4A0X A;  5H6R A;  2OAZ A;  4BHP A;  2GQQ A;  5CVU A;  1O7L A;  1V3F A;  3PQJ A;  3ZMV A;  4ZH4 F;  5CJ9 A;  4RB3 C;  2G7H A;  4EM2 A;  3TDZ C;  2EK5 A;  3U1D A;  2K86 A;  5ICC A;  2O8X A;  4DQ2 A;  4R79 A;  5HDK A;  4WX9 A;  1Z05 A;  1JE8 A;  5D6F A;  4NHJ A;  1ZRE A;  4CO8 A;  1UST A;  1XB4 A;  2Y0M A;  1WQ2 A;  4KMU X;  1L0O C;  1EV7 A;  1IXC A;  2KIF A;  5HLG A;  1Z91 A;  1XDS A;  4U7B A;  4KDP A;  1P6R A;  3ERE D;  4AWX B;  2DPU A;  3K1M A;  2P5L C;  4YIF A;  1Y0U A;  5IT9 Z;  2ZNY A;  3WTT C;  4U0W A;  1ZLJ A;  2FOK A;  4ZYD A;  5BS6 A;  3GZ6 A;  1F1Z A;  1TW3 A;  2DK8 A;  2FF4 A;  2MH9 A;  3SXY A;  3L9F A;  4M9Z A;  3FHZ A;  2P5K A;  3KZY A;  3S2W A;  1ZRF A;  1O57 A;  2ISZ A;  2P7C B;  2VXZ A;  4ENN A;  3QPT A;  4JQF A;  2V1D A;  1OMI A;  4EVI A;  2FMY A;  3BY6 A;  3K9T A;  3PFI A;  1P4W A;  5ICG A;  4IXA A;  3Q5F A;  1R5G A;  2WWY A;  4UXN A;  1OYY A;  5LHH A;  5CVJ A;  4ESJ A;  2YPR A;  2L01 A;  1B9M A;  3F6O A;  4UVB A;  4IHT A;  1XN7 A;  4LLN A;  1R5H A;  2NRA C;  5DEQ A;  2DFI A;  4KUM A;  4IPA A;  1G3S A;  1LDJ A;  3L7W A;  3M9A A;  1R00 A;  1XGN A;  1BM9 A;  4AD9 A;  3ZPL A;  3N4M A;  3M8F A;  2R7F A;  4UVA A;  4LD5 A;  4Y17 A;  2OQR A;  3HUG A;  5IT3 A;  2K27 A;  2QYO A;  3LA7 A;  1FZP B;  3K1N A;  3ULQ B;  3IL2 A;  4A5N A;  3BPX A;  3HRS A;  1SFU A;  1R1T A;  4HOB A;  4A6D A;  1F5T A;  4I02 A;  2P4W A;  1UB9 A;  3EET A;  2K7L A;  4OU0 A;  2A6H F;  4HA8 A;  2FRH A;  4A12 A;  2QBY A;  1RUN A;  3FWE A;  3KEQ A;  5JI6 A;  2DAO A;  5D5U B;  1TW2 A;  1FX7 A;  1U6G A;  4YG2 F;  2XUB A;  1HXD A;  4YII A;  1BOA A;  4G6Q A;  3RIR A;  2A07 F;  4M6Y A;  4EQQ A;  4RS8 A;  1SD5 A;  3C18 A;  3BP8 A;  2Q2E A;  1R22 A;  3I5U A;  4WCG A;  3V4G A;  3HRT A;  2UXX A;  1YFH A;  4N0B A;  3R4K A;  1MDM A;  3VOE A;  5BMZ A;  4Y13 A;  1T2K A;  1DP7 P;  2ACJ A;  1REP C;  4I2O A;  5F6F A;  1IN6 A;  1T98 A;  1ON2 A;  2AXL A;  3ML6 A;  4D0P A;  3TOA A;  3MWM A;  2ZME B;  2E1N A;  1B4A A;  4GCV A;  1B6A A;  1LJ9 A;  3F23 A;  2ISY A;  4PGG A;  3WTX C;  2LDU A;  2IA2 A;  4ON0 A;  1FP2 A;  5L3G A;  2OU2 A;  3E5X A;  3BWG A;  1K78 A;  1K7A A;  1OYI A;  1MZB A;  3P9I A;  3P7N A;  2W84 A;  4UHT A;  2FXA A;  4HF1 A;  2VOP A;  2AS5 F;  1IN4 A;  3CDH A;  3MFK A;  3QP6 A;  3Q9S A;  3HIF A;  4LLG F;  4ETS A;  1PP7 U;  6PAX A;  5D8L B;  2FSW A;  1LVA A;  3HSR A;  1L3L A;  3DKW A;  5FFZ A;  4ENM A;  2CW0 F;  2JT1 A;  2EJR A;  1FY7 A;  3LQQ A;  3K1P A;  4CDG A;  3BJ6 A;  2M1B A;  3V8L A;  3N97 A;  3RKX A;  1MJB A;  3W6J B;  2F5D A;  2HGC A;  1RUO A;  3REO A;  3H92 A;  4U0V A;  3IWF A;  5D8K B;  5D5V B;  5E18 F;  5D5X B;  1LEA A;  1J7K A;  2QM3 A;  1LDK B;  3IC7 A;  1PP8 F;  1LNW A;  3QU3 A;  5BOX A;  1YW7 A;  4HF2 A;  3IRR A;  4MTE A;  1SAX A;  2HZT A;  2OBP A;  1XSD A;  1MD0 A;  1YS6 A;  2LNB A;  1SFE A;  1XD7 A;  3J80 Z;  1K79 A;  3I54 A;  3ELK A;  5H20 A;  4MGR A;  2VE8 A;  3HYI A;  2CYY A;  4ESB A;  4MTD A;  3R60 A;  2K4J A;  2GAU A;  1KU7 A;  1O3T A;  1H9G A;  3HOT A;  5DUI A;  2DQR A;  2JZY A;  4ZYH A;  2ETH A;  1O7F A;  5J8F A;  4OIO F;  1Z1D A;  2KJB A;  1HKQ A;  4GXO A;  3ZMU A;  1LDD A;  5DCM B;  3T0Y A;  2RNJ A;  3O6B B;  3E5Q A;  1F4K A;  3DQV C;  5F1R A;  4YFX F;  2GXG A;  3ZMD A;  1D3Y A;  2O6G E;  3HSF A;  1R7J A;  1Q1H A;  5K5R A;  1YW8 A;  5ERI A;  5A2Q K;  1V4R A;  4KIG A;  1TQI A;  1ZGJ A;  4XSZ F;  1TNT A;  1ZAO A;  3DP7 A;  3SFZ A;  5BPI A;  1LQ1 A;  2VBY A;  2DT5 A;  2IW5 A;  2A5Y B;  1XCV A;  4F7Z A;  2L3D A;  4HX4 A;  5LLQ A;  2NYX A;  3LA2 A;  2P6T A;  3DPT A;  2YX4 A;  3VB2 A;  3J80 K;  2GWR A;  3VFZ A;  2ESN A;  1TLH B;  2PMH A;  4EMS A;  2FML A;  4LG0 B;  4EGZ A;  1D8J A;  4MNU A;  5BPD A;  4LLL A;  1U8R A;  3P9K A;  2GA2 A;  4O5V A;  2VBZ A;  4A6E A;  1FT9 A;  4ASN A;  2D1V A;  4UNO A;  1JHF A;  2MA3 A;  2KRF A;  1ZHF A;  3EUH A;  4S04 A;  3KLO A;  1QQI A;  2IPQ X;  3GF2 A;  4CGZ A;  3E3V A;  3AAF A;  5HLI A;  3BDD A;  5E1X A;  4WK8 F;  4OIP F;  5AIQ A;  3IRQ A;  1S8N A;  2R7D A;  2H94 A;  3NRV A;  3T1B A;  1KQ0 A;  1RIO H;  5E17 F;  2DTR A;  2IVM A;  1OPC A;  4IF4 A;  5K5O A;  1BC7 C;  3RKW A;  4HDU A;  3FXQ A;  1MDM B;  3FXR A;  2GXB A;  4ENJ A;  4G7H F;  3ZQ7 A;  2EB7 A;  5F64 A;  4I01 A;  3WE3 A;  4CIC A;  3QRF F;  2ADU A;  2VT3 A;  3ZN0 A;  1HW5 A;  2JRT A;  3GXO A;  1HKT A;  4O3M A;  3F72 A;  2BEO A;  1FYL A;  3JTG A;  4ZYE A;  3ROU A;  1OYW A;  1TBX A;  3WTS C;  2EWN A;  4KN4 X;  1O3S A;  2FNP A;  3V7R A;  4I7H A;  2CGP A;  4JK1 X;  3WG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...