1RR7A

Crystal structure of the middle operon regulator protein of bacteriophage mu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
RFPALLAELNDLLRGELSRLGVDPAHSLEIVVAICKHLGGGQVYIPRGQALDSLIRDLRIWNDFNGRNVSELTTRYGVTFNTVYKAIRRMRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Middle operon regulator
publication title Crystal structure of the Mor protein of bacteriophage Mu, a member of the Mor/C family of transcription activators.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Transcription
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08765 Mor Mor transcription activator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rr7A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rr7A01
1FEXA 5E3NA 3S14J 1AU7A 2NVXJ 2DMPA 3JRFA 2LVSA 4EEFG 5M3MJ 1GUUA 1JUSA 1VNDA 4QIWN 3BG9A 3BT9A 2M0CA 3JREA 3HKZN 3LSRA 3IV5A 1OCTC 1G2HA 2X6OA 3JRDA 2JA5J 4V2GA 4RDUA 5FKNA 2Y2ZA 1RKWA 1S7EA 1GV5A 2CU7A 2XGDA 4IHWA 5F08A 1ETVA 3ZQIA 4W1UA 1MBHA 2RAEA 1ETWA 2MW8A 3S17J 3JRHA 3K2AA 3GTOJ 2N8GA 1OCPA 5JLWA 2I10A 1BW6A 1JUMA 3HGGA 1RKTA 1W0TA 4XICA 2GLOA 2KT0A 1B8IA 3IH4A 2O7OA 2JK3A 1ENHA 5EGOA 5M5WJ 2HDDA 5EZHA 1LE8A 4ABZA 4M6VA 4D5FA 1IDYA 5J1UA 4C3IJ 2DA3A 1VI0A 3HDDA 2XB5A 1B72A 2JA8J 2EQRA 3ZQHA 2CUEA 2M8GX 4JYKA 3Q0UA 5J1RA 4BY1J 1X2NA 2IAIA 3HBLA 4LOCA 2M34A 3LSGA 5IYBJ 1UG2A 1HCRA 2CQQA 3Q0WA 1JGGA 2IEKA 2ME0A 1F36A 1SANA 1NTCA 2ID6A 3GTKJ 4DYCA 1UMQA 4CYCA 3SJMA 3S1MJ 2FX0A 2K9NA 1MBJA 2Y30A 4M3FA 1SFOJ 1QVUA 3SDGA 2HOSA 4JX5A 1ZQ3P 1GDTA 3IH2A 1MSEC 4A3CJ 4UUTA 2AHQA 2WAQN 5FKKA 4Y7NJ 1H88C 3HGYA 2DA5A 3G1OA 1RETA 1APLC 3RZDJ 5K7FA 3TP3A 1R9TJ 4DZJA 2DA6A 1RESA 1GT0C 5DTDA 3NARA 3DEWA 4A3IJ 3M3YJ 1XC5A 1VF9A 3JRCA 1HDPA 2QCOA 1IUFA 2HOAA 2ME6A 4D7MA 1MH3A 1IV6A 5IOZA 3LSPA 2R5YB 4X1EA 4XRSG 1DU0A 5M5YJ 2DMUA 3OSFA 4Y52J 1K61A 1U9NA 1MBEA 2VUMJ 3CQZJ 2DA7A 2E2IJ 3K7AJ 3BR1A 2QF7A 4BY7J 3O8GA 3BQZA 5GP9A 1MBKA 3H0GJ 4GFBA 3WHBA 1JJ6C 2JWTA 2NVQJ 1BW5A 2EH3A 2NS8A 1JUPA 3GTQJ 2DJNA 1BL0A 4AUXA 1WPKA 2LTPA 4W97A 4C3HJ 3HEFA 2HXOA 2MG4A 3L1PA 1AKHA 4BXXJ 3PO2J 1DU6A 1P7JA 1JT6A 1Z0XA 4DW6A 3BQYA 5GPCA 3FISA 3I4MJ 2CJJA 2HQ5A 5F0FA 3JRAA 3C2BA 2ECBA 1ETYA 2HI3A 2K40A 3HOWJ 2P81A 3GTLJ 5GPAA 1B8IB 3OSGA 2E19A 1P7IA 2LLKA 5FJ8J 5EGOB 1RR7A 1FIAA 2K9QA 4A3JJ 3ZQLA 1LE8B 1MBGA 5F1JA 4M3BA 3I4NJ 2B63J 1HOMA 2YS9A 1I3QJ 2XSDC 3HOYJ 3RKQA 1B72B 3G1MA 2L0KA 2XRLA 2YU9J 2LKXA 2ZB9A 2E2JJ 3QPLA 1NK3P 4IHXA 5EZGA 2R0QC 2GM4A 2L7FP 3B6CA 4A3DJ 1TWFJ 1TWGJ 4A3FJ 4A69C 1HDDC 4CYCB 2R92J 1VFCA 1TWHJ 4C2MJ 4DZPA 1QPIA 1D5YA 2EZIA 1ETQA 2TCTA 2M9HA 1U78A 4MIMA 1JKOC 4G12A 1IGNA 1FJLA 3PO3J 1Y1VJ 1ZTRA 2FQ4A 1T56A 2WV1A 4FE7A 3DCFA 3BTIA 3HOUJ 2L7ZA 2MGQA 3M4OJ 2GBYA 5IP6A 4JX6A 1LFBA 4A3MJ 1JJ8C 5IYDJ 3S1RJ 3JRBA 3FIWA 2JA6J 5HODA 2IBDA 2EZLA 4IHVA 3W6VA 3H3VK 1X58A 1MBFA 2CQXA 5C44J 5IPAA 1JT0A 1HF0A 1W0UA 1EF4A 3HOZJ 4C3JJ 1JKQC 3A02A 2EBIA 3JR9A 2JMWA 1K83J 1T33A 2YUSA 3D1NI 4A3LJ 3GTGJ 1ZKGA 5J1YA 2XPVA 2XPWA 4FCYA 3CDLA 4UUSA 4DYQA 1PUFA 4I76A 2HYJA 4IHYA 1Q1VA 1LFUP 1YRNA 1MH4A 5JLXA 3S15J 2MSYA 3BR5A 1WH5A 3QPSA 5F0CA 4IEJA 5EDNA 3A01A 3S2HJ 4FTHA 3RQIA 2OPTA 3BG5A 4XRMA 3TP0A 1JTYA 2VPRA 1U9OA 1U8BA 4MFDA 3BR6A 3CCYA 3WHCA 1ZR4A 2WB1N 1JKPC 1AKHB 5E3LA 2XGCA 3TW6A 2W48A 3OIOA 4D5CA 2COBA 5C4JJ 2NOGA 4FISA 1BA5A 2DMNA 5IP9J 2ELKA 2FJ1A 4BKXA 2CUFA 2VI6A 3GTPJ 3IH3A 5FLVA 1Z77A 3HOVJ 3S1NJ 4NDLA 1H89C 2H8RA 3MKLA 1MNMC 3FK7A 1QRYA 4J19A 4MO7A 4L5EA 3TW7A 2FD5A 3HM5A 1ZGWA 3BTJA 1BJZA 3GTJJ 1POGA 2JN6A 2VKEA 5M5XJ 1FTTA 2ID3A 2OF7A 3BR2A 3Q3SA 3UKGA 3S1QJ 2VKVA 2TRTA 4M3GA 2R5ZA 4JP0A 5F0HA 2HOTA 5K7HA 2X9DA 2LD5A 1ZR2A 2XPUA 5EG0A 5IYCJ 3HB9A 4D7NA 4XK4A 1IDZA 2LR8A 2JA7J 1MSFC 1ITYA 1TWAJ 1UHSA 1WGXA 1H8AC 4A93J 4A3GJ 4RBOA 2HXIA 1X2MA 1Y1WJ 2NVYJ 3Q0VA 1ORKA 1OJLA 1ETOA 4A3EJ 1IC8A 2L9RA 3FKIJ 1WCMJ 3NAUA 3O8HA 1CQTA 3BR3A 3ZQFA 2Y0SN 5E3MA 3BTLA 4JX4A 5E3OA 4MLOA 2D5VA 5IOYA 1WI3A 2DMQA 2DTZA 5C4XJ 2ECCA 3BTCA 3JRGA 2CRGA 4HNVA 1WH7A 4XRSA 3GBGA 4A3BJ 1E3OC 5FLMJ 4BBRJ 4V2FA 2DA4A 2XB0X 2LFBA 5K7ZA 3ZOBA 4B4CA 4BBSJ 1O4XA 1F43A 5F27A 5BNGA 2EZKA 3MN2A 3B6AA 3FK6A 3ZQCA 3LSJA 4I6ZA 3ZQGA 4M3EA 4UUSB 2Y9ZA 4QTRA 4X6AJ 1PUFB 2JJ7A 5J3LA 3F0CA 2LY9A 2O9LA 3RZOJ 5EYRA 1A5JA 1YRNB 2DMTA 5M3FJ 1HLVA 2DA1A 3TEDA 1FIPA 3LOCA 1JKRC 2R93J 3S16J 3E7LA 4MFEA 3A01B 2KDZA 1ETXA 3BR0A 3CMYA 4S0HB 2H1KA 1I50J 4QSHA 1ZK8A 2E1OA 2DN0A 1XS9A 4B1RA 2PMZN 2M2EA 1XG1A 2Y31A 3JRIA 2LP0A 5C3EJ 1IRZA 1TWCJ 2XGEA 1RPWA 3A03A 2LK2A 4M3DA 4DYRA 3S2DJ 4AC0A 3VPRA 4B3AA 2EZHA 5EF6A 3HOXJ 1NK2P 3BG3A 2G0EA 1OFCX 3MVPA 3GTMJ 2E2HJ 2K9SA 3SFIA 5EEAA 1FTZA 1A6IA 1IG7A 1TC3C 2X48A 4XIDA 1I6HJ 5FKMA 4A3KJ 1AHDP 1JTXA 3G1LA 2NS7A 4FE4A 3LNQA 5F04A 1QVTA 3PM1A 2O8KA 1GV2A 9ANTA 1GVDA 2R5ZB 4AYBN 2DA2A 5FKLA 3QQAA 5IP7J 5EG0B 3OOUA 2AO9A 5FKOA 2NVTJ 1IJWC 1ETKA 2R7ZJ 2Y9YA 2R5YA 2L7MP 5DS9A
chains in the Genus database with same CATH superfamily
3K4CA 1FEXA 3S14J 4RA2A 2GOMA 2RNGA 1U6GA 1HC8A 2L3DA 3IWFA 5CKTA 4EEFG 5E18F 2QZ8A 1VNDA 3FHNA 4ZJZA 4F91B 3MZYA 1O3QA 3SEZA 5HVQC 2XV4S 2ZBKA 3TDUC 3HKZN 5DM7F 1IRGA 4CSWA 1J2XA 2JA5J 4KT5C 1MMSA 5FKNA 2EFWA 1RKWA 3K1PA 2XGDA 3H92A 2DK8A 2KRHA 1OISA 1O7LA 3OYHA 2STTA 2QKMB 4W1UA 4B3XA 3MKYB 1ETWA 2DU9A 1QZEA 3A4CA 2ZMEC 3CJRB 3PUBA 2R7SA 3M8FA 2FNAA 2N8GA 1RIOH 3WTWC 1FP1D 4LJZF 1HBXG 1KONA 1JUMA 3HGGA 3LQQA 2JVGA 3RPUD 1RC9A 4MNUA 2VBWA 3K4MA 1N77A 2FEZA 5EZHA 1IDYA 2DO7A 3ZP5A 2QSFX 2ZXIA 5CJ9A 3ABUA 5HS9A 3MWMA 1V54H 3HOSA 2OCEA 4Z6YA 3GF2A 3P9KA 3J7AY 1BI3A 3SDBA 1F1ZA 2Z2SB 3ZQHA 2CUEA 2KIFA 2B0LA 2JRTA 5J1RA 1BOBA 3Q0UA 1X2NA 2IAIA 2KISA 3HBLA 3RKYA 3B02A 1ZRCA 1LVKA 3N4MA 5D5VB 1MDMB 1G59A 5JR3A 4YFKF 2CW8A 3DXJF 2D2WA 3K2ZA 1SANA 5B1BH 4ZDLA 1Z1DA 1MJAA 4HEA2 2M3AA 3SJMA 3GVAA 2ZJPF 2HZDA 1EA3A 1J5YA 3CTAA 3S2WA 4Y13A 2EV6A 1SAUA 3AFHA 1VQPI 2IS4A 3J81K 1XD7A 1SFOJ 3OYCA 4LK0F 3LSMA 4Y33A 3M8JA 4XLCA 1MSEC 2ZXWH 1VQ8I 3OYIA 4AM3A 2AHQA 2GQQA 4XBFA 3W2VA 3ZCOA 5FKKA 4BEHB 5IT9Z 3IAM2 3LA7A 1YOVB 1H88C 5LBQA 3CUOA 4IRGA 1RETA 3OYFA 5FB2A 1APLC 3RPUA 3RZDJ 4YEJA 1IUYA 4HNUA 3OIPA 4BNCA 2BV6A 1W1WE 2LKSA 4Q5SF 4DQ2A 3M3YJ 4TV7A 1XC5A 4M73A 4G9YA 3F8MA 1F5TA 2IS1A 2QCOA 1PYVA 5K5QA 4PJNA 2HOAA 3HJEA 2L2OA 2ME6A 2J5OA 2QBYA 2XAGA 3H36A 4L9NA 2OU2A 2X0LA 2HDWA 4XRSG 2RNJA 3DLAA 2F48A 1R5GA 2DMUA 2EA4A 3OSFA 2FU4A 4Y52J 4CZCA 1MBEA 1RNLA 3CQZJ 3DPLC 3K4JA 3BR1A 3I59A 4A5MA 3HKZA 3PJRA 2YR2A 2Z3YA 3O8GA 2R7OA 3PSFA 4ENMA 4RGXA 3BQZA 5GP9A 3HYIA 2VL8A 4PJ0C 4K2EA 1XDUA 1L3LA 1PP7U 1IXCA 1BIBA 3GTQJ 3FBIB 3H35A 4HG2A 5CLSA 1BL0A 3DKXA 1GLNA 2LTPA 3GLXA 4W97A 2HXOA 2Z16A 2QGUA 1P7JA 2R7FA 3GZ5A 2VODA 4HX4A 2UXNA 3FISA 2OAZA 3ABMH 3VYTB 3SFZA 1KYWA 1YIOA 2CJJA 3G4SI 1VTNC 4ZYEA 2ECBA 3HOWJ 2P81A 5GPAA 1B8IB 2RV8A 3BC8A 4PCQA 5EGOB 4XSZF 4EJUA 1Y0NA 2VB6A 4E7SA 3GEZA 4M3BA 5F1JA 2W7NA 3I4NJ 4EJWA 3KYLA 2B63J 3LWFA 5J4YA 3EYIA 3LA3A 1E3PA 1HOMA 2YS9A 1G8XA 3G1MA 1OLTA 4AVZA 2OV7A 4C2TA 2LKXA 4EGZA 3D5RC 4P9UA 3QPLA 2L9VA 4IRHA 1NK3P 3KCCA 2LF8A 2VQCA 5KK1A 4M71A 4HZFA 4L9VA 2ZC2A 4QLCU 4ZC3A 5BQTA 3HRSA 3FBNB 1FOKA 1R36A 3I64A 4Y3OA 2E1MB 1D5YA 2EZIA 1FMWA 2TCTA 3MQ0A 3IKTA 3ECOA 1Y6IA 2K27A 2D1VA 2XGXA 4KNYA 3WTYC 1FJLA 2HFHA 4CCLA 5JVTA 4S04A 4OIOF 3DCFA 3BTIA 2L7ZA 2BHZA 2GIZA 3BP8A 1SVLA 2PMHA 5H6RA 4RB2C 1DDNA 2JQ7A 4XM3A 4JBAA 4PJJA 1W5TA 4H4KC 4HNTA 2Q0OA 4HV6A 2F4IA 3JRBA 1ERDA 1E2XA 2R7TA 5HODA 2EIJH 2PG4A 2L5QA 5CYVA 4GO1A 2QA4I 2CQXA 4LG3A 1YI2I 5C44J 4O6JA 1OCZH 1MZBA 3TO7A 2JTVA 1W4MA 2OZUA 3BROA 4N0BA 1TTYA 2BE5F 5J40A 3VYSB 3OYKA 5DUKA 5CVVA 1TBXA 3CCJI 2A61A 1UJ8A 3ZGKA 1K4SA 3D1NI 4PFPA 2FMYA 3T0YA 5J1YA 4M9ZA 3T1BA 3ULQB 2KJCA 1IV8A 2XPWA 3N05A 1AWCA 2AQFA 4KISA 2VN2A 2LYCA 3ASOH 3K70C 1LDKB 4I76A 3REOA 3BLYA 4IHYA 3IWZA 1FX7A 1SVMA 5HS8A 5JLXA 1YRNA 2BGCA 1WH5A 4HX8A 3SZTA 3QPSA 2Q2EB 1QA6A 1TZLA 3A01A 1D1AA 4LB6B 2VQHA 1LNWA 1YFHA 3VWBA 1U8RA 1RUOA 2WB1N 1FT9A 4YFNF 3ZMTA 3TW6A 2DI3A 1WJAA 2YPRA 3OIOA 4M72A 2COBA 4E7HA 5C4JJ 1FWZA 1D3YA 4FISA 1BA5A 4Q48A 1P92A 1UAAA 3I5UA 5IP9J 2FJ1A 2VOOA 1RRJA 2M8EA 5E17F 1Q1HA 5FLVA 2LREA 3O2PE 1H9TA 4B43A 1WRJA 4RLQA 5ICCA 2GXGA 4ETSA 2MABA 2FRHA 2FUG2 4HV5A 2VXZA 2DBBA 2CS3A 1BJZA 2WBMA 4E7LA 2QSHX 4XLFA 2VKEA 2V6CA 4UUVA 2ID3A 3Q3SA 3UKGA 3C18A 5H20A 3CCVI 2WAEA 3OV8A 4KITB 1TT0A 3CUQA 1GXQA 2WTEA 2WA0A 4XLEA 3QYBA 2EA2A 3I4PA 2LD5A 1YQAA 3V7SA 5IYCJ 4D7NA 5J47A 1BN5A 3LQRA 4II2A 3J7ZI 3CLOA 2V4JC 2HVSA 1EKEA 1TWAJ 4A3GJ 3ML6A 4L0YB 2HXIA 4BDYA 1FOXA 1X2MA 2R5YA 1Y1WJ 1RR8C 4MTEA 1O3SA 3Q0VA 1ETOA 1XGOA 4XRFA 3R61A 2L9RA 2P0WA 3FKIJ 1XSDA 2Q1ZB 4F55A 4KDPA 3F3XA 2FBHA 2EFPA 3S8PA 1E0EA 2L9NA 4EJVA 3CDHA 1XPXA 3BG7A 2PQ8A 2L4AA 3E5UA 1WI3A 4HQMA 3VYRB 1QO0D 1Y39A 2ECCA 3BTCA 4HF2A 5C4XJ 2ZXHA 2CRGA 1WH7A 1S7AA 2ZJQF 3RKWA 3HC7A 6PAXA 1I6XA 2V6EA 1BBYA 1E3OC 4L0ZB 4BBRJ 2EPFA 3DFGA 3PQJA 2K3FA 2RGVA 4V2FA 3ZMUA 1WJFA 3HZJA 1Z91A 2Y69H 2JA2A 3LMMA 1N25A 1REPC 3CZ6A 3FMQA 2LFBA 3T8RA 2BOLA 5HNHA 4B4CA 2DPUA 1F43A 5BNGA 4YFXF 1ZH5A 1YHQI 2VJ5A 1GXPA 3W2AA 2CGPA 1U5TC 3MN2A 1KQ0A 2A5WA 3LSJA 4I6ZA 3ZQGA 2L01A 5JHFA 4UUSB 4ZZDA 1DGRM 5DDGA 2JJ7A 2PMUA 1W7PB 1ACIA 1OYWA 3GO5A 3JAMZ 5LHIA 1YS6A 2B7EA 4UXNA 1O3TA 1I1GA 3BR0A 3EUKL 3CMYA 3H9JA 1MDMA 3FXUA 3PFIA 2X51A 5L3FA 2IP2A 4QSHA 4MHGA 3U1DA 1XGNA 2PBIA 4WXDA 2MD5A 2H94A 3OOPA 2ZJ2A 1P4AA 5D8LB 3I9V2 4OAYA 3RCOA 1XG1A 2E7XA 2FF4A 2DCEA 3H3ZA 1YW9A 2LP0A 2VKDA 4OMYA 2XGEA 3M9AA 3L2VA 3IRRA 5L3EA 2LK2A 4M3DA 5A2QZ 5BOXA 3KLNA 1VQ6I 2HU9A 1D0XA 5FD6A 4G6TB 2BHYA 2EZHA 2X6YA 4WX9A 3HOXJ 5HLGA 4BJTA 1NK2P 4BEHA 2BEOA 1J9IA 2VT2A 3BPVA 3LL7A 2E2HJ 1D8KA 2HWVA 3ECHA 3ZXSA 2MH2A 3LSKA 2M30A 4A12A 1I6HJ 1USTA 4ANJA 2NS7A 4FE4A 3N97A 1VZ0A 3WODF 2BBYA 1RUNA 4RMNA 3JTHA 3EDPA 4AU7A 3MFKA 5L3GA 5FRMA 2WV0A 1GVDA 4XLPF 5D6FA 3V7CA 3RSNA 3CCRI 4IF4A 1OCCH 2AQEA 4IL6C 5IP7J 3VODA 1R1UA 3OOUA 4EM1A 3QRFF 3S93A 4NB5A 5BPIA 4RGRA 5FO5A 5HNFA 2NVXJ 4OIRF 5LGNA 2UWMA 4A6DA 2P6TA 1LUJB 5FLXZ 1OMIA 3ONQA 2LVSA 3CP2A 3NWSA 1JUSA 3AAFA 4QIWN 5D5XB 1UHWA 3FXKA 3IV5A 1TQIA 1OCTC 3K69A 4ON0A 1G2HA 3HTSB 3LSTA 1GHCA 3E3VA 4M6YA 1UB9A 2GA2A 3CJQB 2M45A 4C9YA 5ILSA 1ETVA 1MBHA 3Q9SA 3OYAA 2F5DA 2MW8A 3S17J 2V7FA 1BR1A 4CYDA 2R7WA 1OCPA 2FA5A 1B4AA 1BW6A 2ISYA 4MQ9F 4PGGA 5LFAA 1RKTA 2GLOA 3V42A 4GRIA 1XX5A 1B8IA 3FDYA 2O7OA 3BY6A 1YS7A 5EGOA 2HDDA 1FOWA 1LVAA 1IN4A 4YIRX 4ABZA 4M6VA 2LY2A 2R7VA 3MKZA 1X3ZB 2DA3A 1MJBA 3K4NA 3KLOA 2OC6A 3ZMSA 2JA8J 4WK8F 4JYKA 2OQRA 3F6VA 1DQUA 2E7WA 4LOCA 2X4HA 2M34A 2XF6A 1WVRA 1HCRA 2EV5A 3HRTA 4UY8I 2IEKA 2W57A 3ZMDA 3FF5A 3GTKJ 3ZN0A 2STWA 3NQOA 3BZ6A 4CO8A 3NWTA 3QP5A 1VQOI 2IGOA 5J6XA 3QOEA 3D0SA 2K9NA 1FY7A 1OR7A 5CQGA 1MBJA 2Y30A 3DF8A 4M3FA 1BOAA 1NG7A 1HXDA 1PJRA 5KAFC 3TBIA 1GDTA 5J4VA 1P4XA 4A0YA 3VOEA 4Y7NJ 3HGYA 1ZAOA 2DA5A 3FXMA 4HSTA 4E7KA 2OD5A 3CP8A 4I02A 4FT8A 2K3PA 3VSLA 3TP3A 1R9TJ 1MMNA 2CW7A 2DDAA 1GT0C 5DTDA 3NARA 3W6JB 4CCOA 2A3SA 3DEWA 4A3IJ 2GXBA 1FLIA 1HDPA 4KA4A 1W36D 4EJTA 1IUFA 2RN7A 1QZYA 5LRRA 4RGUA 2DQLA 5HDNA 2HQNA 1IV6A 4FASD 1HW2A 1I3AA 1Y8QB 2PFBA 4DNCA 3LSPA 3TO9A 4QWQA 5M5YJ 3HSFA 2HKOA 4IOCF 2H09A 3IL2A 2VUMJ 1R49A 1K6OA 3H9GA 3RIRA 4ENJA 3K7AJ 1R1VA 3FM5A 5J8FA 3ZQ7A 1O57A 4R1HA 3WHBA 4IRIA 3LAJA 3CC4I 3F8CA 3CDIA 4HDVA 2NRAC 3ELKA 3K1NA 3OYBA 4F93B 5DYMA 1TQPA 4AUXA 4C3HJ 1ZGAA 3H5RA 2MG4A 5TJJA 1VQKI 1DU6A 3H3UA 2QUFA 1WSUA 3JSOA 4DW6A 4F3QA 3BQYA 3SZGA 1SFKA 3OYMA 2CFOA 5F0FA 1Y0UA 3FZVA 3ASNH 3D5LA 1ETYA 3VEPA 2K40A 2R7DA 3DLLF 1TW3A 4ESFA 2E19A 1P7IA 2LLKA 3IRQA 1RR7A 4HLXA 3ZQLA 4DBRA 1LE8B 2FNPA 3WG9A 2GZWA 1Z7LA 4E7ZA 1I3QJ 2XSDC 1DGWY 3PNYA 3RKQA 1WI9A 2VJ4A 3PL8A 4XQFA 2E2JJ 5IY5H 2ELHA 3K1MA 1NHAA 4ITVA 2KPMA 2DLLA 1KGSA 4G7OF 5EZGA 2L7FP 1W7PD 1W5CC 3EPZA 1HSTA 2ZXJA 5E1WA 4QPQA 4EVIA 2EFNA 2M4KA 2UXXA 1YG2A 4FQGA 4A69C 4A3FJ 2ACJA 1VFCA 2R92J 3GW2A 3JSPA 3KYDB 1TWHJ 3ZN1A 4DZPA 1WHUA 3QPTA 1U78A 1JKOC 3OR1C 1ZREA 3F8FA 1Y1VJ 1R6RA 2DFFA 4CHUA 2GWRA 1MGTA 1M1EB 4FETA 2V9VA 1T56A 1WWXA 2WV1A 2HKXA 3OYDA 4ZYGA 2JVHA 4XOTA 3AG1H 3A0HC 2VBYA 3M8EA 2BXYA 4A3MJ 1BM9A 1OQYA 1JJ8C 3S1RJ 3SHFA 1PVEA 2JA6J 4NQWB 4S05A 2DTRA 1JT0A 4UV8A 3I3LA 3E5QA 1W0UA 1Z67A 4UVAA 3E1SA 4UB8C 1Y8RB 1VQ7I 2EBIA 3WGGA 5FROA 5ED4A 2JMWA 3JR9A 1DPUA 3K10A 3ABLH 1G3TA 4EGYA 1ON1A 4A3LJ 4DBQA 5F1RA 2XPVA 4XMYA 2ZFUA 4OWRB 2ZCWA 4XL9A 3UNGC 5HOOA 4UUSA 2LNBA 2C6YA 4DYQA 3FMSA 2PJRB 3M1EA 2M7BA 1W7PA 2VONA 1YLFA 4BQQA 1MH4A 3S15J 2MSYA 4CCJA 5BMZA 1H9GA 1GVJA 5F0CA 5EDNA 4FTHA 3RQIA 2OPTA 1HW1A 3BG5A 2Z33A 1LEAA 4CGZA 2CV1A 1A04A 1FBUA 3MAJA 4MFDA 3BR6A 1B6AA 5HLTA 1ZR4A 3D5SC 5E3LA 2O5RA 2DJIA 4F52A 3OL4A 2K4JA 4D5CA 4CXFA 4ENKA 3QYFA 1WJEA 4D9JA 1LEBA 3DBLB 3JW4A 2DK5A 2DMNA 3L2QA 4XLAA 3C1DA 1BIAA 1R22A 2W24A 1IRXA 2CUFA 2VI6A 2W25A 2XRNA 4MGRA 1SFUA 1JHFA 4XKVA 1V55H 1YJNI 3S1NJ 2O03A 4NC7A 5DCFA 2HPIA 1MMGA 5LHHA 4R79A 1XN7A 4J19A 1G3SA 5JI6A 3OYJA 2V9PA 3HM5A 2ISZA 2BY2A 1EH8A 3E5XA 1KA8A 1KU9A 5TISC 4BJ5C 3KE2A 2X1DA 2CFXA 5M5XJ 1ZG1A 3CC7I 4KN4X 3L2RA 3S1QJ 3ABTA 1N78A 2GA1A 2DFHA 1ZHFA 2M87A 2VKVA 1FOYA 2ETHA 3M1CA 2I8DA 3GWZA 5D4RA 4JP0A 2K9LA 2HOTA 2X9DA 5J8CA 3HB9A 4XK4A 2LF7A 1R00A 2E60A 5DM6F 2P5LC 2LR8A 3KEYA 1IDZA 2LY1A 4AWXB 2L9SA 1TNTA 2O6GE 2LKPA 4C2UA 1S3JA 1WGXA 1QGPA 5A2QK 2VIXA 1SC7A 4N9IA 3KZIC 4HF1A 3CUQC 1ORKA 2XHKA 4A3EJ 1IC8A 4BE0A 2E1CA 1WCMJ 4Q4ZF 4M74A 3O8HA 2GOXB 4B8XA 3BR3A 3ZQFA 2Y0SN 4BHPA 5E3MA 4JX4A 2K02A 1X1AA 4AVPA 4GDFA 2QSGX 3OS0A 3AL0B 4ZZLA 3C3WA 3PIPF 4HDUA 1R7JA 2DMQA 2UUZA 3BJ6A 4FX4A 3JRGA 1MMDA 2GAUA 4CDGA 3GBGA 5LD2C 1YTYA 1G4DA 3LSIA 1ZARA 1WKMA 1A35A 5HLHA 1T8IA 4N9HA 3CC2I 1PP8F 3BG6A 4XSXF 2HYGD 2EINH 5HS7A 3LAPA 2XB0X 5K7ZA 3LFKA 4BBSJ 4ESBA 2KRCA 5ICFA 3GFIA 1FYKA 4AIKA 1S7OA 3HHHA 1KU3A 2IGKA 4OOIA 3ZQCA 4M3EA 1A31A 3CCMI 3GUDA 4ZYDA 2Y9ZA 2IS6A 4RAFA 3F0CA 3R0JA 2JUGA 3RZOJ 5EYRA 4EM2A 4GCVA 1TQMA 5GAHJ 2V26A 2R93J 4KJZA 2ICWG 3S16J 3E7LA 4MFEA 5FFXA 3ZPLA 1WJBA 2IS2A 1ETXA 4M9SA 3HOTA 2I5UA 2EK5A 2H1KA 4BQNA 4NC6A 5E20A 1U2WA 4RAGA 5CVRA 5JVGF 3ZMZA 3I54A 5FFZA 4A0ZA 1EH7A 1O3RA 4NC8A 2F4OB 2A07F 2KDOA 2A05A 2F2EA 3U21A 5C3EJ 4XOPA 4A5NA 2VPLA 3A03A 4DYRA 4AC0A 4D1QA 1X19A 2RREA 1RI7A 2A6HF 1ZN2A 3DPUA 3BG3A 1FNNA 4P9FA 2G0EA 4B48A 2OA4A 1TC3C 2A68F 4G6DA 1MNEA 4WXCA 4BACA 2X48A 3QU3A 5FKMA 1A6QA 2FQ3A 4A3KJ 1BI1A 4CZZA 1JTXA 3VDXA 4LFUA 3HRUA 5LGUA 2P6SA 1BI0A 4BYYA 3P5JA 9ANTA 3COAC 2FBIA 4AYBN 3K4LA 4BJ6C 4JQFA 4ZYHA 4XORA 3CESA 3L9FA 3R60A 5AONA 5EG0B 3A2KA 4AD9A 4XN0A 1VQ4I 5FRNA 3O3KA 1IJWC 2Y9YA 4KUMA 2M5WA 2L7MP 5DS9A 2QVOA 2OTLI 3RYRA 4ASNA 5L3CA 2HPMA 3ERMA 1USSA 2DMPA 1G3WA 3RDIA 1OYIA 2CQKA 4LMYA 2TDXA 4MEXF 4CCNA 4KFCA 4IO9F 5ICEA 5M3MJ 1AA7A 2Y0SA 4RB3C 5H6QA 3WE2A 2WY8Q 3BT9A 1J0RA 4NHJA 3JREA 3IUOA 1KU7A 4Q47A 2X85A 4V2GA 4I01A 2Z99A 4PGHA 4N4NB 1GV5A 1SMTA 1MD0A 2HVQA 3R6SA 4IHWA 5DD4A 5F08A 2FSWA 4OMZA 3ZQIA 3BOQA 2KIMA 3ISPA 1UG0A 4KMUX 2L7KA 2EFOA 3ZRGA 3ZMVA 3J80K 4A0XA 3K2AA 4KMFA 3GTOJ 3DP7A 1XMAA 3DKWA 1W0TA 4XICA 2IGMA 3S3MA 4P96A 3B73A 3MMYB 3H9QA 3IH4A 3ERED 1XSXA 3E6MA 3I58A 1ZYRF 1XTAA 3K6GA 3E6CC 4BS9A 1ENHA 5M5WJ 2KFDA 1XGSA 3KETA 3GYHX 1LE8A 2EB7A 2L02A 1BI2A 1FPQA 2DAOA 2CMPA 2H1LA 3I71A 1Z6RA 2VJIA 3HDDA 1QQIA 3RJPA 4L5JA 2DW4A 2OBPA 4PJLA 3BJAA 4GXOA 1FBQA 2EQRA 1K6YA 3WTZA 2EFQA 3H5NA 3NRVA 2XAJA 2XKOA 3A0BC 3JCUC 3HRMA 1UG2A 5B3SH 5HLIA 5JFRA 2V79A 3Q0WA 5GTIC 2IW5A 4O5VA 1XCVA 2V1NA 3LSHA 3GFLA 1X1BA 2ID6A 4DYCA 2VXDA 1D1CA 1BC8C 2VLAA 3S1MJ 2OZ6A 2CH0A 2RVCA 2E34A 3CLQA 3IC7A 1FP2A 4WXHA 2FX0A 5L3BA 2NAZA 2CW0F 3EYYA 1QVUA 2IA2A 2WB1A 2HOSA 4L18B 1DP3A 1IN6A 4I0AA 1MMAA 3IH2A 4A3CJ 5ERIA 1LPQA 3JTGA 5D5UB 2HTSA 2Y48A 3RYPA 2WAQN 1LDJA 2VASA 4DJAA 1S8NA 3X2QH 4P55A 2CYYA 2DFIA 2E1MC 5B5EC 3CCSI 3F23A 4HPQA 1LFPA 1OR7C 1SD7A 3QODA 2VJJA 1HKQA 3EETA 5K7FA 4XNFA 1OKRA 4NQWA 4DZJA 1RESA 4BE1A 4U0WA 4AYBA 1UZCA 2XF5A 1S72I 2XKPA 2ELJA 3JRCA 3U1KA 3VB2A 2RKHA 4MQVA 2Z9OA 1OPCA 1E17A 4LLNA 2HVRA 4D7MA 1R58A 1P9QC 1MH3A 5IOZA 4X1EA 3HIFA 3J7AO 2MBFA 2KIUA 3G2BA 2KMUA 1R4MB 1LB2A 1KZHA 1JI8A 2E2IJ 2PJRA 2QF7A 2ZMEB 3QYEA 2MC3A 5B1AH 1MBKA 1TW2A 1R23A 1V5EA 4U87A 1VQ5I 2ZSHB 3IHUA 3O6BB 2JWTA 2YX7A 3CF5F 1JGSA 2R7RA 3RKXA 3T5XA 2NS8A 1JUPA 2DJNA 4I2OA 4CH7A 2IVMA 1WPKA 2OTJI 2XAQA 3HEFA 5IT9K 4KT6A 3L1PA 2ADUA 1J09A 1Z05A 2XDVA 4P5OA 4BXXJ 3F72A 1JT6A 1VQNI 4MEYF 2DFEA 5GPCA 5HDGA 3CCUI 1HKTA 3I4MJ 1FBSA 2HQ5A 3JRAA 4CCMA 4BH9A 2H8WA 2CWEA 3W6KB 2PJPA 2HI3A 2JRMA 3GTLJ 1L0OC 1QZZA 4V19K 5FJ8J 1SFEA 2K9QA 2E71A 4HYEA 1SEUA 3DPTA 2W85A 4LITA 1ZGJA 4HOBA 2Z1DA 2J5PA 3HOYJ 2ESHA 1SD4A 1B72B 4JOMA 1IO2A 1B1BA 1D0YA 1YJWI 1KQ9A 3G6EI 3WTSC 2OQGA 2EWNA 4LK1F 3OS1A 2MC4A 1ZLKA 4IHXA 1Z9CA 5LRSA 2DT5A 4HQEA 5K5OA 2K86A 2R0QC 1ZLJA 5BPDA 1G6NA 1W36C 3RI4A 1MW7A 2ZKZA 3TO6A 4L9TA 4IZZA 4A3DJ 2BY1A 1TWGJ 2K7LA 1F9NA 1SD5A 1HDDC 4CYCB 2ZO4A 1J59A 2VBXA 2DT6A 4RB1A 5AIPA 5H2FC 3GLLA 2M9HA 4WWCA 4MIMA 2V9KA 2Z5UA 4PZJA 1WJDA 5DEQA 2DYSH 4RLFA 2WY7Q 2KQRA 2MFZA 3TDZC 1X3WB 2DOFA 1QPMA 3QOPA 1G3YA 2X6WA 4IJAA 4UVCA 2KHMA 3WGIA 5IP6A 2CQNA 1LJ9A 3K9TA 4JX6A 1JE8A 1B9NA 2AS5F 2G7HA 2O3FA 2KRFA 3FIWA 3G3ZA 3FXRA 5B66C 2IBDA 2EZLA 4Y4RA 3W6VA 3H3VK 1X58A 3K0LA 4BGDA 1HF0A 2LDUA 4G94A 3HOZJ 3K4BA 1JKQC 4RM3A 4BQOA 3A02A 3TQNA 2O61A 1XB4A 4IHTA 1IRFA 1ZRFA 1C0WA 4UB6C 1TLHB 1LDDA 2CO5A 1Z6TA 2W84A 2W1OA 3WG7H 2V1UA 1ZKGA 4E70A 2JSPA 4WF2A 3AG2H 4FCYA 2HNHA 3DBHB 4PJMA 2UV1A 3WU0A 3MZ8A 4OU0A 2HYJA 1S9HA 2PN6A 3CCEI 1LFUP 2E36A 4GGGA 2ZFWA 1J7KA 3V8JA 4HSRA 3WTXC 3TL4X 4G6QA 4IEJA 3DU6A 4LGWA 2M4GA 1U8BA 1TP4A 2Y0MA 4U7DA 3WHCA 4LLLA 1IN7A 4BHBA 1AKHB 5EJCA 4BAYA 3OIQA 2A5YB 2W48A 3MD2A 3DTEA 2Q2EA 2CV0A 2KP6A 4M9XA 3AKZA 2ELKA 1Z3XA 4YRVA 1EH6A 4AIHA 2ESNA 4XR6A 3J7YJ 3KIOA 2XAUA 3C7JA 4BKXA 3PIOF 5LEKA 3GTPJ 3IH3A 3F21A 3IAS2 1Z77A 2HYFA 4CCKA 3HOVJ 2RQPA 4UNOA 2HR3A 3MKLA 1MNMC 1R4NB 3U2RA 3TW7A 2FD5A 1ZGWA 4UHTA 2FOKA 1POGA 2DOAA 2NNNA 2JN6A 1FTTA 3BR2A 5CQEA 1STZA 2ZNYA 4GYGA 4XN3A 5E1ZB 1EV7A 2IGNA 1H0MA 2TRTA 2ZSIB 1KYZA 4M3GA 3DTIA 2NVUB 1YIJI 1W5SA 5F0HA 5K7HA 1TL8A 1ZR2A 2XPUA 5EG0A 3MKWB 1XDSA 2CUZA 1XSVA 5KVRA 3SYTA 1UCRA 2JA7J 1ITYA 1UHSA 3L00A 4M6XA 1H8AC 3WU2C 2JPBA 3HPGA 2XVCA 3BCAA 2NVYJ 3BDDA 2NS0A 1KQ8A 4GYIA 2KLOA 1FSHA 3QU6A 3GZ6A 1U0JA 2WWYA 2XAFA 2HTJA 3BTLA 5E3OA 3AG3H 3L09A 2XASA 3ZQQA 4HAMA 3WU1B 5IOYA 2KJBA 2DTZA 5DUIA 3P9CA 1V5FA 4XRSA 4LG0B 3IKVA 4EV0A 5FLMJ 3W2WA 3FHZA 3KP5A 3F8BA 3S3NA 2QQ9A 3DWLE 3QWLA 3FXJA 4U88A 2F5VA 3VFZA 2BY3A 3W3CA 1DP7P 2BW3B 3EUHA 2HS5A 4XLHA 4IHSA 1WJCA 1XMXA 2E5ZA 4CICA 2IT0A 1ODDA 1MJ9A 3U9GA 1R5ID 2VBZA 5CPRB 3H0DA 2KZVA 2P7VB 4QTRA 1YJ9I 1PUFB 5J3LA 1I27A 1T0FA 1VQMI 1T95A 1A5JA 5F64A 5M3FJ 4D0PA 1HLVA 1EJ9A 1FIPA 1JKRC 1YITI 2O0YA 5EEHA 1XMKA 1HA8A 3FM3A 1SVOA 4FX0A 1D0ZA 1T08B 3F9KA 5LHGA 3SXYA 4BDZA 1I50J 5DD8A 1DUXC 1ZK8A 1MKMA 4EMSA 1ZELA 3DTKA 3KP6A 1N75A 2CV2A 2DN0A 2DT7B 3I0TA 2PLYA 1XS9A 1I1SA 2PMZN 4IQ4A 2HZTA 3WTUC 4J01A 1JHHA 3JRIA 2V1DA 1WZ2A 1TWCJ 2FE3A 2YX4A 1RPWA 4RAZA 1K7AA 3F8NA 3WGHA 2JUCA 2QWWA 3VPRA 3HUGB 4B3AA 1S29A 1IN8A 4HX7A 5EF6A 5CVJA 4Y17A 2HOEA 4CUGA 4EM0B 1OFCX 3MVPA 3DEEA 3GTMJ 2KIQA 4I98B 2W4SA 1T39A 3TGNA 2HEOA 2K9SA 3QAHA 3SFIA 1A36A 1IG7A 2VOPA 4XONA 4IQJA 2YU3A 1SMYF 4ENNA 1BR2A 3G1LA 2QLZA 2X1EA 3CJNA 2JZYA 4B47A 3LNQA 1QVTA 3ROUA 2JSCA 3MZHA 1GV2A 2K9MA 4E4HA 3BJOA 2R5ZB 3JAMK 5FKLA 4RB0A 3QQAA 2YSRA 1HSJA 2WAFA 2X1CA 4EATA 3CMEI 2WADA 1ETKA 3CCQI 2XAHA 1V4RA 5KAIC 5E3NA 1AU7A 4I09A 4BQAA 5EEGA 2XROA 5GAEJ 3JRFA 1MIJA 2EIKH 4EQQA 4KICA 4IVNA 4OAZA 3UR3C 3F22A 2G9WA 5HDKA 2ZMEA 1GUUA 4WCGA 4ZTJA 3GZNB 4PK4A 3BG9A 4YIFA 2M0CA 2FBKA 5E8GA 4LIUA 3OYLA 3LSRA 3V8LA 2NYXA 1OCRH 4LLGF 2XSJC 3KX2A 2BVMA 2H6BA 2X6OA 3JRDA 3L7WA 4RDUA 5ILVA 1X4OA 2Y2ZA 1S7EA 2RQQA 2CU7A 5DV5A 2KZGA 1U5TB 3AG4H 5K1YA 2RAEA 3JRHA 5JLWA 2I10A 1QNTA 3M7GA 3GXOA 2KT0A 3MEXA 2MLKA 1V3FA 1X1DA 3CF2A 3DKYA 4HBLA 2P8TA 3CJTB 4NBQA 2JK3A 4D5FA 5J1UA 4O3MA 4C3IJ 1O7FA 2H27A 5KCMA 4B09A 1VI0A 2EILH 1ONVA 3I55I 2RDPA 2XB5A 5D8KB 1B72A 4IPAA 4ESJA 5TGTA 5DCMB 2K85A 2RC4A 2M8GX 5E1XA 2QQAA 3ESWB 4PFOA 3SZPA 4BY1J 2KKOA 5FLXK 3LSGA 5IYBJ 4IOAF 1TT5B 5IT3A 2CQQA 1FYLA 1JGGA 2PMZA 2ME0A 1F36A 1P2FA 4KIFA 1FSEA 1NTCA 2X6XA 2HQAA 1UMQA 3PNTA 2DQRA 3PUFA 4CYCA 1QBJA 2WC2A 2BZTA 2R7QA 3OYGA 2F4MB 4AIDA 2ZNZA 1YX5A 3KZZA 3T8TA 1CF7B 3SDGA 2A6EF 4JX5A 2A69F 1ZQ3P 4BXUA 2DODA 1K78B 1X4PA 1IXSB 1P4WA 4UUTA 3HPHA 2LBFB 4A2UA 1ZG5A 2LSOA 3RTRA 1IZ1A 2P5KA 1BJAA 3G1OA 3P7NA 5CVUA 2EJRA 4XKBA 1V5GA 1D8JA 3P9IA 2EIMH 3OR2C 3R4KA 3DQVC 2MH9A 3F6OA 3RPQA 2DA6A 2IJLA 4RM2A 4CA0A 1VF9A 3WE3A 4DGWB 4ZTFA 5ILUA 5LGTA 3DEUA 3GFMA 2E35A 4X0GA 4R8HA 3TKYA 2R5YB 4BXFA 1YW8A 1U3EM 3C2GA 3FXOA 1DU0A 2G7UA 3KP3A 1K61A 1U9NA 1YX3A 4J00A 4I0BA 2DA7A 2K4BA 2F6CA 1D1BA 4BY7J 3V4GA 3KEQA 3EUAA 2JPCA 3QPHA 1FMVA 3H0GJ 3L2CA 4GFBA 3R0AA 3GFJA 4IX7A 1JJ6C 2NVQJ 1HW5A 1IXRC 3OL3A 1LQ1A 1BW5A 4N4OB 1YE9A 2EH3A 4E7IA 2LH9A 4HA8A 1JXSA 1IAWA 2AXLA 1AKHA 2F5EA 3PO2J 1IF1A 1UFMA 4BHCA 1Z0XA 3PQKA 4KYWA 4G8XA 3C2BA 3DU5A 4G7HF 2HQRA 2AXTC 3OSGA 4OIQF 3J81Z 3KZYA 3DBRB 4A3JJ 1FIAA 3BPXA 3HG9A 3OWTA 1MBGA 5CVIA 3K70D 3GMEA 3G71I 2DOEA 1XGMA 3BZKA 1UELB 2L0KA 2XRLA 4E6KG 2YU9J 4ZH4F 1T98A 1Z3YA 2ZB9A 1QHHD 2PEXA 3H5AA 3KYCB 4EJOA 5KNLA 2GM4A 2F5FA 4QPOA 3DV8A 2VQLA 3B6CA 1ULYA 2DXIA 1TWFJ 2L54A 2PI0A 4IXAA 4C2MJ 1QPIA 1ETQA 5K5RA 1Y56A 4A6EA 4G12A 1PUEE 1IGNA 3PO3J 2XIGA 3CMMA 1OCOH 3E0JB 3HL2A 4HF0A 1ZTRA 3KFWX 2FQ4A 5F6FA 2VE8A 2HDCA 4FE7A 4P1WA 2CSOA 3C2HA 2IXSA 2K5CA 1CGPA 3FMRA 2MGQA 2DDBA 2MYSA 2P5VA 2GBYA 3HOUJ 3KPHA 3OS2A 3M4OJ 5E8IA 2COMA 3VYUB 1LFBA 2FOWA 5IYDJ 3ABKH 1I39A 3PSIA 1K4TA 1WQ2A 3OMYA 4LG0A 3IP4B 4IHVA 2IA1A 1MBFA 2GXAA 4BU2A 5IPAA 4L5IA 1R5HA 2ZJRF 1B9MA 1EF4A 3E6DA 3EQLF 4C3JJ 4PSWA 3TOBA 1IW7F 2XC7A 3AL0C 1WJ5A 2BW3A 1K83J 1T33A 2YUSA 4BUPA 2MLGA 2QBYB 3LA2A 4LIVA 5FGMA 4HRIA 4HLYA 3GTGJ 4RS8A 3CDLA 2VT3A 1ON2A 2R7XA 3FWEA 2NOJB 3OY9A 1PUFA 3I59B 4B44A 2VQGA 1Q1VA 4U0YA 2LOOA 2D45A 2VKHA 5TRDA 3BR5A 1S5LC 3HXLA 4PSXA 4YIIA 4NUBA 4UV9A 2CUJA 1I5ZA 1X1PA 3ZR8X 1BC7C 2VE9A 2PX9A 3S2HJ 3GCMA 1VQ9I 3KEOA 4OIPF 2M1BA 1E3HA 3TP0A 1JTYA 3FXQA 2BVLA 2VPRA 1U9OA 3KP2A 3PFYA 4XRMA 3H1CA 3I53A 3CCYA 1FZPB 3FKJA 5AIQA 1JKPC 2XGCA 1NH3A 5D5WB 1TNSA 2NXNB 2QYOA 2NOGA 3G73A 2FMLA 3KP7A 4LD5A 3KP4A 2IA0A 4FHTA 4KIBA 1PDNC 1Z7UA 3K4KA 5GAGJ 1J75A 1DPRA 3HTUA 3CMAI 3HUGA 4Z2YA 2D1HA 4AIJA 4E7JA 3QP6A 4JK1X 4NDLA 1H89C 4DOZA 2OCCH 3SQNA 2VC1A 2LMDA 3HSRA 4PDKA 2H8RA 3FK7A 4BE2A 1QRYA 5E79C 4PUSA 4IKFA 1BR4A 4MO7A 5JHUA 1T2KA 4L5EA 3CO6C 3BTJA 3GTJJ 1ZRDA 3LFUA 3FXLA 1LKXA 3PNVA 2OF7A 2P4WA 2QQBA 1HQCA 4L9JA 1AOYA 1D5VA 3CCLI 3MCZA 2QM3A 2R5ZA 5GADJ 1ZG3A 2QKLB 2QENA 1K79A 2LG4A 3A1YA 3V8KA 1WFXA 1MSFC 4U0VA 4A93J 1QHGA 4RBOA 2E5NA 3V7RA 1SD6A 4H0EA 2XF7A 3NEUA 1YYVA 2XUBA 2IPQX 3TMOA 1OJLA 1YW7A 1MNDA 4Y15A 1R1TA 2E1NA 3NAUA 4XLNF 3CD6I 4I99C 4NNJA 1CQTA 3WTVC 3SEQA 2H6CA 4MLOA 4II3A 3L2WA 2D5VA 2EV0A 4XKWA 5GTHC 2DPDA 2BXZA 4HNVA 1U5TA 2UZKA 1KU2A 2GIVA 2WAQA 3TOAA 5D4SA 4A3BJ 5KHDA 2L4MA 2QEXI 4YELA 2DA4A 2R4GA 4UVBA 3ZOBA 2M7AA 1O4XA 3VSKA 2V1XA 5F27A 1T38A 5ICGA 2EZKA 4U7BA 2O8XA 1OYYA 2HGCA 3B6AA 1X3UA 3FK6A 3HHGA 1YO5C 4G7ZF 4LB5A 4X6AJ 2BYVE 3Q9VA 2W82A 1IN5A 3CO7C 1RZ4A 2LY9A 4F92B 2MD0A 2IRFG 2O9LA 3BWGA 3L2UA 1YRNB 2DMTA 5DCMA 4KIGA 5LLQA 2DA1A 3TEDA 3LOCA 3EUHC 4DIQA 2CG4A 2A6TA 4BL0B 3A01B 3BCBA 2KDZA 2OJED 4I7HA 4S0HB 3OYNA 1HKSA 5L3DA 2W00A 4HW0A 2E1OA 4KN7X 2LRDA 2F5CA 2Q8KA 3WTTC 4B1RA 3FX3A 1T0FC 3OYEA 2M2EA 2JT1A 2BY0A 1QU3A 1S6LA 1FYMA 2Y31A 2NNYA 1IRZA 4ZYAA 2M0MA 3HSEA 1T6SA 2R3SA 1CF7A 3Q5FA 5D6EA 1FC3A 3S2DJ 3M07A 1K78A 2QQ8A 1UHMA 1VQLI 3BZCA 2LBFA 2OUMA 5BS6A 4OINF 1NG6A 3GX4X 3RQ4A 1X1CA 5EEAA 3J80Z 3I56I 1FTZA 1A6IA 5FD5A 3S32A 2MA3A 1Z21A 4YG2F 4XIDA 1R71A 2DYRH 1B59A 5LEJA 2KL4A 1AHDP 1SFXA 2LC2A 2B9SA 4ZDOA 2Y75A 3CUQB 5F04A 3PM1A 1SAXA 2O8KA 1P6RA 3E97A 2P7CB 3S3OA 2DA2A 4RGSA 2FXAA 1F4KA 1XCBA 4ZDPA 4RAYA 2AO9A 4MTDA 4F7ZA 5FKOA 2VC0A 2NVTJ 2R7ZJ 4XKCA 2R7UA 2CQ7A 4C30A 3E6BA
chains in the Genus database with same CATH topology
1FEXA 5E3NA 3S14J 1AU7A 2NVXJ 2DMPA 3JRFA 2LVSA 4EEFG 5M3MJ 1GUUA 1JUSA 1VNDA 4QIWN 3BG9A 3BT9A 2M0CA 3JREA 3HKZN 3LSRA 3IV5A 1OCTC 1G2HA 2X6OA 3JRDA 2JA5J 4V2GA 4RDUA 5FKNA 2Y2ZA 1RKWA 1S7EA 1GV5A 2CU7A 2XGDA 4IHWA 5F08A 1ETVA 3ZQIA 4W1UA 1MBHA 2RAEA 1ETWA 2MW8A 3S17J 3JRHA 3K2AA 3GTOJ 2N8GA 1OCPA 5JLWA 2I10A 1BW6A 1JUMA 3HGGA 1RKTA 1W0TA 4XICA 2GLOA 2KT0A 1B8IA 3IH4A 2O7OA 2JK3A 1ENHA 5EGOA 5M5WJ 2HDDA 5EZHA 1LE8A 4ABZA 4M6VA 4D5FA 1IDYA 5J1UA 4C3IJ 2DA3A 1VI0A 3HDDA 2XB5A 1B72A 2JA8J 2EQRA 3ZQHA 2CUEA 2M8GX 4JYKA 3Q0UA 5J1RA 4BY1J 1X2NA 2IAIA 3HBLA 4LOCA 2M34A 3LSGA 5IYBJ 1UG2A 1HCRA 2CQQA 3Q0WA 1JGGA 2IEKA 2ME0A 1F36A 1SANA 1NTCA 2ID6A 3GTKJ 4DYCA 1UMQA 4CYCA 3SJMA 3S1MJ 2FX0A 2K9NA 1MBJA 2Y30A 4M3FA 1SFOJ 1QVUA 3SDGA 2HOSA 4JX5A 1ZQ3P 1GDTA 3IH2A 1MSEC 4A3CJ 4UUTA 2AHQA 2WAQN 5FKKA 4Y7NJ 1H88C 3HGYA 2DA5A 3G1OA 1RETA 1APLC 3RZDJ 5K7FA 3TP3A 1R9TJ 4DZJA 2DA6A 1RESA 1GT0C 5DTDA 3NARA 3DEWA 4A3IJ 3M3YJ 1XC5A 1VF9A 3JRCA 1HDPA 2QCOA 1IUFA 2HOAA 2ME6A 4D7MA 1MH3A 1IV6A 5IOZA 3LSPA 2R5YB 4X1EA 4XRSG 1DU0A 5M5YJ 2DMUA 3OSFA 4Y52J 1K61A 1U9NA 1MBEA 2VUMJ 3CQZJ 2DA7A 2E2IJ 3K7AJ 3BR1A 2QF7A 4BY7J 3O8GA 3BQZA 5GP9A 1MBKA 3H0GJ 4GFBA 3WHBA 1JJ6C 2JWTA 2NVQJ 1BW5A 2EH3A 2NS8A 1JUPA 3GTQJ 2DJNA 1BL0A 4AUXA 1WPKA 2LTPA 4W97A 4C3HJ 3HEFA 2HXOA 2MG4A 3L1PA 1AKHA 4BXXJ 3PO2J 1DU6A 1P7JA 1JT6A 1Z0XA 4DW6A 3BQYA 5GPCA 3FISA 3I4MJ 2CJJA 2HQ5A 5F0FA 3JRAA 3C2BA 2ECBA 1ETYA 2HI3A 2K40A 3HOWJ 2P81A 3GTLJ 5GPAA 1B8IB 3OSGA 2E19A 1P7IA 2LLKA 5FJ8J 5EGOB 1RR7A 1FIAA 2K9QA 4A3JJ 3ZQLA 1LE8B 1MBGA 5F1JA 4M3BA 3I4NJ 2B63J 1HOMA 2YS9A 1I3QJ 2XSDC 3HOYJ 3RKQA 1B72B 3G1MA 2L0KA 2XRLA 2YU9J 2LKXA 2ZB9A 2E2JJ 3QPLA 1NK3P 4IHXA 5EZGA 2R0QC 2GM4A 2L7FP 3B6CA 4A3DJ 1TWFJ 1TWGJ 4A3FJ 4A69C 1HDDC 4CYCB 2R92J 1VFCA 1TWHJ 4C2MJ 4DZPA 1QPIA 1D5YA 2EZIA 1ETQA 2TCTA 2M9HA 1U78A 4MIMA 1JKOC 4G12A 1IGNA 1FJLA 3PO3J 1Y1VJ 1ZTRA 2FQ4A 1T56A 2WV1A 4FE7A 3DCFA 3BTIA 3HOUJ 2L7ZA 2MGQA 3M4OJ 2GBYA 5IP6A 4JX6A 1LFBA 4A3MJ 1JJ8C 5IYDJ 3S1RJ 3JRBA 3FIWA 2JA6J 5HODA 2IBDA 2EZLA 4IHVA 3W6VA 3H3VK 1X58A 1MBFA 2CQXA 5C44J 5IPAA 1JT0A 1HF0A 1W0UA 1EF4A 3HOZJ 4C3JJ 1JKQC 3A02A 2EBIA 3JR9A 2JMWA 1K83J 1T33A 2YUSA 3D1NI 4A3LJ 3GTGJ 1ZKGA 5J1YA 2XPVA 2XPWA 4FCYA 3CDLA 4UUSA 4DYQA 1PUFA 4I76A 2HYJA 4IHYA 1Q1VA 1LFUP 1YRNA 1MH4A 5JLXA 3S15J 2MSYA 3BR5A 1WH5A 3QPSA 5F0CA 4IEJA 5EDNA 3A01A 3S2HJ 4FTHA 3RQIA 2OPTA 3BG5A 4XRMA 3TP0A 1JTYA 2VPRA 1U9OA 1U8BA 4MFDA 3BR6A 3CCYA 3WHCA 1ZR4A 2WB1N 1JKPC 1AKHB 5E3LA 2XGCA 3TW6A 2W48A 3OIOA 4D5CA 2COBA 5C4JJ 2NOGA 4FISA 1BA5A 2DMNA 5IP9J 2ELKA 2FJ1A 4BKXA 2CUFA 2VI6A 3GTPJ 3IH3A 5FLVA 1Z77A 3HOVJ 3S1NJ 4NDLA 1H89C 2H8RA 3MKLA 1MNMC 3FK7A 1QRYA 4J19A 4MO7A 4L5EA 3TW7A 2FD5A 3HM5A 1ZGWA 3BTJA 1BJZA 3GTJJ 1POGA 2JN6A 2VKEA 5M5XJ 1FTTA 2ID3A 2OF7A 3BR2A 3Q3SA 3UKGA 3S1QJ 2VKVA 2TRTA 4M3GA 2R5ZA 4JP0A 5F0HA 2HOTA 5K7HA 2X9DA 2LD5A 1ZR2A 2XPUA 5EG0A 5IYCJ 3HB9A 4D7NA 4XK4A 1IDZA 2LR8A 2JA7J 1MSFC 1ITYA 1TWAJ 1UHSA 1WGXA 1H8AC 4A93J 4A3GJ 4RBOA 2HXIA 1X2MA 1Y1WJ 2NVYJ 3Q0VA 1ORKA 1OJLA 1ETOA 4A3EJ 1IC8A 2L9RA 3FKIJ 1WCMJ 3NAUA 3O8HA 1CQTA 3BR3A 3ZQFA 2Y0SN 5E3MA 3BTLA 4JX4A 5E3OA 4MLOA 2D5VA 5IOYA 1WI3A 2DMQA 2DTZA 5C4XJ 2ECCA 3BTCA 3JRGA 2CRGA 4HNVA 1WH7A 4XRSA 3GBGA 4A3BJ 1E3OC 5FLMJ 4BBRJ 4V2FA 2DA4A 2XB0X 2LFBA 5K7ZA 3ZOBA 4B4CA 4BBSJ 1O4XA 1F43A 5F27A 5BNGA 2EZKA 3MN2A 3B6AA 3FK6A 3ZQCA 3LSJA 4I6ZA 3ZQGA 4M3EA 4UUSB 2Y9ZA 4QTRA 4X6AJ 1PUFB 2JJ7A 5J3LA 3F0CA 2LY9A 2O9LA 3RZOJ 5EYRA 1A5JA 1YRNB 2DMTA 5M3FJ 1HLVA 2DA1A 3TEDA 1FIPA 3LOCA 1JKRC 2R93J 3S16J 3E7LA 4MFEA 3A01B 2KDZA 1ETXA 3BR0A 3CMYA 4S0HB 2H1KA 1I50J 4QSHA 1ZK8A 2E1OA 2DN0A 1XS9A 4B1RA 2PMZN 2M2EA 1XG1A 2Y31A 3JRIA 2LP0A 5C3EJ 1IRZA 1TWCJ 2XGEA 1RPWA 3A03A 2LK2A 4M3DA 4DYRA 3S2DJ 4AC0A 3VPRA 4B3AA 2EZHA 5EF6A 3HOXJ 1NK2P 3BG3A 2G0EA 1OFCX 3MVPA 3GTMJ 2E2HJ 2K9SA 3SFIA 5EEAA 1FTZA 1A6IA 1IG7A 1TC3C 2X48A 4XIDA 1I6HJ 5FKMA 4A3KJ 1AHDP 1JTXA 3G1LA 2NS7A 4FE4A 3LNQA 5F04A 1QVTA 3PM1A 2O8KA 1GV2A 9ANTA 1GVDA 2R5ZB 4AYBN 2DA2A 5FKLA 3QQAA 5IP7J 5EG0B 3OOUA 2AO9A 5FKOA 2NVTJ 1IJWC 1ETKA 2R7ZJ 2Y9YA 2R5YA 2L7MP 5DS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEX A;  5E3N A;  3S14 J;  1AU7 A;  2NVX J;  2DMP A;  3JRF A;  2LVS A;  4EEF G;  5M3M J;  1GUU A;  1JUS A;  1VND A;  4QIW N;  3BG9 A;  3BT9 A;  2M0C A;  3JRE A;  3HKZ N;  3LSR A;  3IV5 A;  1OCT C;  1G2H A;  2X6O A;  3JRD A;  2JA5 J;  4V2G A;  4RDU A;  5FKN A;  2Y2Z A;  1RKW A;  1S7E A;  1GV5 A;  2CU7 A;  2XGD A;  4IHW A;  5F08 A;  1ETV A;  3ZQI A;  4W1U A;  1MBH A;  2RAE A;  1ETW A;  2MW8 A;  3S17 J;  3JRH A;  3K2A A;  3GTO J;  2N8G A;  1OCP A;  5JLW A;  2I10 A;  1BW6 A;  1JUM A;  3HGG A;  1RKT A;  1W0T A;  4XIC A;  2GLO A;  2KT0 A;  1B8I A;  3IH4 A;  2O7O A;  2JK3 A;  1ENH A;  5EGO A;  5M5W J;  2HDD A;  5EZH A;  1LE8 A;  4ABZ A;  4M6V A;  4D5F A;  1IDY A;  5J1U A;  4C3I J;  2DA3 A;  1VI0 A;  3HDD A;  2XB5 A;  1B72 A;  2JA8 J;  2EQR A;  3ZQH A;  2CUE A;  2M8G X;  4JYK A;  3Q0U A;  5J1R A;  4BY1 J;  1X2N A;  2IAI A;  3HBL A;  4LOC A;  2M34 A;  3LSG A;  5IYB J;  1UG2 A;  1HCR A;  2CQQ A;  3Q0W A;  1JGG A;  2IEK A;  2ME0 A;  1F36 A;  1SAN A;  1NTC A;  2ID6 A;  3GTK J;  4DYC A;  1UMQ A;  4CYC A;  3SJM A;  3S1M J;  2FX0 A;  2K9N A;  1MBJ A;  2Y30 A;  4M3F A;  1SFO J;  1QVU A;  3SDG A;  2HOS A;  4JX5 A;  1ZQ3 P;  1GDT A;  3IH2 A;  1MSE C;  4A3C J;  4UUT A;  2AHQ A;  2WAQ N;  5FKK A;  4Y7N J;  1H88 C;  3HGY A;  2DA5 A;  3G1O A;  1RET A;  1APL C;  3RZD J;  5K7F A;  3TP3 A;  1R9T J;  4DZJ A;  2DA6 A;  1RES A;  1GT0 C;  5DTD A;  3NAR A;  3DEW A;  4A3I J;  3M3Y J;  1XC5 A;  1VF9 A;  3JRC A;  1HDP A;  2QCO A;  1IUF A;  2HOA A;  2ME6 A;  4D7M A;  1MH3 A;  1IV6 A;  5IOZ A;  3LSP A;  2R5Y B;  4X1E A;  4XRS G;  1DU0 A;  5M5Y J;  2DMU A;  3OSF A;  4Y52 J;  1K61 A;  1U9N A;  1MBE A;  2VUM J;  3CQZ J;  2DA7 A;  2E2I J;  3K7A J;  3BR1 A;  2QF7 A;  4BY7 J;  3O8G A;  3BQZ A;  5GP9 A;  1MBK A;  3H0G J;  4GFB A;  3WHB A;  1JJ6 C;  2JWT A;  2NVQ J;  1BW5 A;  2EH3 A;  2NS8 A;  1JUP A;  3GTQ J;  2DJN A;  1BL0 A;  4AUX A;  1WPK A;  2LTP A;  4W97 A;  4C3H J;  3HEF A;  2HXO A;  2MG4 A;  3L1P A;  1AKH A;  4BXX J;  3PO2 J;  1DU6 A;  1P7J A;  1JT6 A;  1Z0X A;  4DW6 A;  3BQY A;  5GPC A;  3FIS A;  3I4M J;  2CJJ A;  2HQ5 A;  5F0F A;  3JRA A;  3C2B A;  2ECB A;  1ETY A;  2HI3 A;  2K40 A;  3HOW J;  2P81 A;  3GTL J;  5GPA A;  1B8I B;  3OSG A;  2E19 A;  1P7I A;  2LLK A;  5FJ8 J;  5EGO B;  1RR7 A;  1FIA A;  2K9Q A;  4A3J J;  3ZQL A;  1LE8 B;  1MBG A;  5F1J A;  4M3B A;  3I4N J;  2B63 J;  1HOM A;  2YS9 A;  1I3Q J;  2XSD C;  3HOY J;  3RKQ A;  1B72 B;  3G1M A;  2L0K A;  2XRL A;  2YU9 J;  2LKX A;  2ZB9 A;  2E2J J;  3QPL A;  1NK3 P;  4IHX A;  5EZG A;  2R0Q C;  2GM4 A;  2L7F P;  3B6C A;  4A3D J;  1TWF J;  1TWG J;  4A3F J;  4A69 C;  1HDD C;  4CYC B;  2R92 J;  1VFC A;  1TWH J;  4C2M J;  4DZP A;  1QPI A;  1D5Y A;  2EZI A;  1ETQ A;  2TCT A;  2M9H A;  1U78 A;  4MIM A;  1JKO C;  4G12 A;  1IGN A;  1FJL A;  3PO3 J;  1Y1V J;  1ZTR A;  2FQ4 A;  1T56 A;  2WV1 A;  4FE7 A;  3DCF A;  3BTI A;  3HOU J;  2L7Z A;  2MGQ A;  3M4O J;  2GBY A;  5IP6 A;  4JX6 A;  1LFB A;  4A3M J;  1JJ8 C;  5IYD J;  3S1R J;  3JRB A;  3FIW A;  2JA6 J;  5HOD A;  2IBD A;  2EZL A;  4IHV A;  3W6V A;  3H3V K;  1X58 A;  1MBF A;  2CQX A;  5C44 J;  5IPA A;  1JT0 A;  1HF0 A;  1W0U A;  1EF4 A;  3HOZ J;  4C3J J;  1JKQ C;  3A02 A;  2EBI A;  3JR9 A;  2JMW A;  1K83 J;  1T33 A;  2YUS A;  3D1N I;  4A3L J;  3GTG J;  1ZKG A;  5J1Y A;  2XPV A;  2XPW A;  4FCY A;  3CDL A;  4UUS A;  4DYQ A;  1PUF A;  4I76 A;  2HYJ A;  4IHY A;  1Q1V A;  1LFU P;  1YRN A;  1MH4 A;  5JLX A;  3S15 J;  2MSY A;  3BR5 A;  1WH5 A;  3QPS A;  5F0C A;  4IEJ A;  5EDN A;  3A01 A;  3S2H J;  4FTH A;  3RQI A;  2OPT A;  3BG5 A;  4XRM A;  3TP0 A;  1JTY A;  2VPR A;  1U9O A;  1U8B A;  4MFD A;  3BR6 A;  3CCY A;  3WHC A;  1ZR4 A;  2WB1 N;  1JKP C;  1AKH B;  5E3L A;  2XGC A;  3TW6 A;  2W48 A;  3OIO A;  4D5C A;  2COB A;  5C4J J;  2NOG A;  4FIS A;  1BA5 A;  2DMN A;  5IP9 J;  2ELK A;  2FJ1 A;  4BKX A;  2CUF A;  2VI6 A;  3GTP J;  3IH3 A;  5FLV A;  1Z77 A;  3HOV J;  3S1N J;  4NDL A;  1H89 C;  2H8R A;  3MKL A;  1MNM C;  3FK7 A;  1QRY A;  4J19 A;  4MO7 A;  4L5E A;  3TW7 A;  2FD5 A;  3HM5 A;  1ZGW A;  3BTJ A;  1BJZ A;  3GTJ J;  1POG A;  2JN6 A;  2VKE A;  5M5X J;  1FTT A;  2ID3 A;  2OF7 A;  3BR2 A;  3Q3S A;  3UKG A;  3S1Q J;  2VKV A;  2TRT A;  4M3G A;  2R5Z A;  4JP0 A;  5F0H A;  2HOT A;  5K7H A;  2X9D A;  2LD5 A;  1ZR2 A;  2XPU A;  5EG0 A;  5IYC J;  3HB9 A;  4D7N A;  4XK4 A;  1IDZ A;  2LR8 A;  2JA7 J;  1MSF C;  1ITY A;  1TWA J;  1UHS A;  1WGX A;  1H8A C;  4A93 J;  4A3G J;  4RBO A;  2HXI A;  1X2M A;  1Y1W J;  2NVY J;  3Q0V A;  1ORK A;  1OJL A;  1ETO A;  4A3E J;  1IC8 A;  2L9R A;  3FKI J;  1WCM J;  3NAU A;  3O8H A;  1CQT A;  3BR3 A;  3ZQF A;  2Y0S N;  5E3M A;  3BTL A;  4JX4 A;  5E3O A;  4MLO A;  2D5V A;  5IOY A;  1WI3 A;  2DMQ A;  2DTZ A;  5C4X J;  2ECC A;  3BTC A;  3JRG A;  2CRG A;  4HNV A;  1WH7 A;  4XRS A;  3GBG A;  4A3B J;  1E3O C;  5FLM J;  4BBR J;  4V2F A;  2DA4 A;  2XB0 X;  2LFB A;  5K7Z A;  3ZOB A;  4B4C A;  4BBS J;  1O4X A;  1F43 A;  5F27 A;  5BNG A;  2EZK A;  3MN2 A;  3B6A A;  3FK6 A;  3ZQC A;  3LSJ A;  4I6Z A;  3ZQG A;  4M3E A;  4UUS B;  2Y9Z A;  4QTR A;  4X6A J;  1PUF B;  2JJ7 A;  5J3L A;  3F0C A;  2LY9 A;  2O9L A;  3RZO J;  5EYR A;  1A5J A;  1YRN B;  2DMT A;  5M3F J;  1HLV A;  2DA1 A;  3TED A;  1FIP A;  3LOC A;  1JKR C;  2R93 J;  3S16 J;  3E7L A;  4MFE A;  3A01 B;  2KDZ A;  1ETX A;  3BR0 A;  3CMY A;  4S0H B;  2H1K A;  1I50 J;  4QSH A;  1ZK8 A;  2E1O A;  2DN0 A;  1XS9 A;  4B1R A;  2PMZ N;  2M2E A;  1XG1 A;  2Y31 A;  3JRI A;  2LP0 A;  5C3E J;  1IRZ A;  1TWC J;  2XGE A;  1RPW A;  3A03 A;  2LK2 A;  4M3D A;  4DYR A;  3S2D J;  4AC0 A;  3VPR A;  4B3A A;  2EZH A;  5EF6 A;  3HOX J;  1NK2 P;  3BG3 A;  2G0E A;  1OFC X;  3MVP A;  3GTM J;  2E2H J;  2K9S A;  3SFI A;  5EEA A;  1FTZ A;  1A6I A;  1IG7 A;  1TC3 C;  2X48 A;  4XID A;  1I6H J;  5FKM A;  4A3K J;  1AHD P;  1JTX A;  3G1L A;  2NS7 A;  4FE4 A;  3LNQ A;  5F04 A;  1QVT A;  3PM1 A;  2O8K A;  1GV2 A;  9ANT A;  1GVD A;  2R5Z B;  4AYB N;  2DA2 A;  5FKL A;  3QQA A;  5IP7 J;  5EG0 B;  3OOU A;  2AO9 A;  5FKO A;  2NVT J;  1IJW C;  1ETK A;  2R7Z J;  2Y9Y A;  2R5Y A;  2L7M P;  5DS9 A; 
#chains in the Genus database with same CATH topology
 3K4C A;  1FEX A;  3S14 J;  4RA2 A;  2GOM A;  2RNG A;  1U6G A;  1HC8 A;  2L3D A;  3IWF A;  5CKT A;  4EEF G;  5E18 F;  2QZ8 A;  1VND A;  3FHN A;  4ZJZ A;  4F91 B;  3MZY A;  1O3Q A;  3SEZ A;  5HVQ C;  2XV4 S;  2ZBK A;  3TDU C;  3HKZ N;  5DM7 F;  1IRG A;  4CSW A;  1J2X A;  2JA5 J;  4KT5 C;  1MMS A;  5FKN A;  2EFW A;  1RKW A;  3K1P A;  2XGD A;  3H92 A;  2DK8 A;  2KRH A;  1OIS A;  1O7L A;  3OYH A;  2STT A;  2QKM B;  4W1U A;  4B3X A;  3MKY B;  1ETW A;  2DU9 A;  1QZE A;  3A4C A;  2ZME C;  3CJR B;  3PUB A;  2R7S A;  3M8F A;  2FNA A;  2N8G A;  1RIO H;  3WTW C;  1FP1 D;  4LJZ F;  1HBX G;  1KON A;  1JUM A;  3HGG A;  3LQQ A;  2JVG A;  3RPU D;  1RC9 A;  4MNU A;  2VBW A;  3K4M A;  1N77 A;  2FEZ A;  5EZH A;  1IDY A;  2DO7 A;  3ZP5 A;  2QSF X;  2ZXI A;  5CJ9 A;  3ABU A;  5HS9 A;  3MWM A;  1V54 H;  3HOS A;  2OCE A;  4Z6Y A;  3GF2 A;  3P9K A;  3J7A Y;  1BI3 A;  3SDB A;  1F1Z A;  2Z2S B;  3ZQH A;  2CUE A;  2KIF A;  2B0L A;  2JRT A;  5J1R A;  1BOB A;  3Q0U A;  1X2N A;  2IAI A;  2KIS A;  3HBL A;  3RKY A;  3B02 A;  1ZRC A;  1LVK A;  3N4M A;  5D5V B;  1MDM B;  1G59 A;  5JR3 A;  4YFK F;  2CW8 A;  3DXJ F;  2D2W A;  3K2Z A;  1SAN A;  5B1B H;  4ZDL A;  1Z1D A;  1MJA A;  4HEA 2;  2M3A A;  3SJM A;  3GVA A;  2ZJP F;  2HZD A;  1EA3 A;  1J5Y A;  3CTA A;  3S2W A;  4Y13 A;  2EV6 A;  1SAU A;  3AFH A;  1VQP I;  2IS4 A;  3J81 K;  1XD7 A;  1SFO J;  3OYC A;  4LK0 F;  3LSM A;  4Y33 A;  3M8J A;  4XLC A;  1MSE C;  2ZXW H;  1VQ8 I;  3OYI A;  4AM3 A;  2AHQ A;  2GQQ A;  4XBF A;  3W2V A;  3ZCO A;  5FKK A;  4BEH B;  5IT9 Z;  3IAM 2;  3LA7 A;  1YOV B;  1H88 C;  5LBQ A;  3CUO A;  4IRG A;  1RET A;  3OYF A;  5FB2 A;  1APL C;  3RPU A;  3RZD J;  4YEJ A;  1IUY A;  4HNU A;  3OIP A;  4BNC A;  2BV6 A;  1W1W E;  2LKS A;  4Q5S F;  4DQ2 A;  3M3Y J;  4TV7 A;  1XC5 A;  4M73 A;  4G9Y A;  3F8M A;  1F5T A;  2IS1 A;  2QCO A;  1PYV A;  5K5Q A;  4PJN A;  2HOA A;  3HJE A;  2L2O A;  2ME6 A;  2J5O A;  2QBY A;  2XAG A;  3H36 A;  4L9N A;  2OU2 A;  2X0L A;  2HDW A;  4XRS G;  2RNJ A;  3DLA A;  2F48 A;  1R5G A;  2DMU A;  2EA4 A;  3OSF A;  2FU4 A;  4Y52 J;  4CZC A;  1MBE A;  1RNL A;  3CQZ J;  3DPL C;  3K4J A;  3BR1 A;  3I59 A;  4A5M A;  3HKZ A;  3PJR A;  2YR2 A;  2Z3Y A;  3O8G A;  2R7O A;  3PSF A;  4ENM A;  4RGX A;  3BQZ A;  5GP9 A;  3HYI A;  2VL8 A;  4PJ0 C;  4K2E A;  1XDU A;  1L3L A;  1PP7 U;  1IXC A;  1BIB A;  3GTQ J;  3FBI B;  3H35 A;  4HG2 A;  5CLS A;  1BL0 A;  3DKX A;  1GLN A;  2LTP A;  3GLX A;  4W97 A;  2HXO A;  2Z16 A;  2QGU A;  1P7J A;  2R7F A;  3GZ5 A;  2VOD A;  4HX4 A;  2UXN A;  3FIS A;  2OAZ A;  3ABM H;  3VYT B;  3SFZ A;  1KYW A;  1YIO A;  2CJJ A;  3G4S I;  1VTN C;  4ZYE A;  2ECB A;  3HOW J;  2P81 A;  5GPA A;  1B8I B;  2RV8 A;  3BC8 A;  4PCQ A;  5EGO B;  4XSZ F;  4EJU A;  1Y0N A;  2VB6 A;  4E7S A;  3GEZ A;  4M3B A;  5F1J A;  2W7N A;  3I4N J;  4EJW A;  3KYL A;  2B63 J;  3LWF A;  5J4Y A;  3EYI A;  3LA3 A;  1E3P A;  1HOM A;  2YS9 A;  1G8X A;  3G1M A;  1OLT A;  4AVZ A;  2OV7 A;  4C2T A;  2LKX A;  4EGZ A;  3D5R C;  4P9U A;  3QPL A;  2L9V A;  4IRH A;  1NK3 P;  3KCC A;  2LF8 A;  2VQC A;  5KK1 A;  4M71 A;  4HZF A;  4L9V A;  2ZC2 A;  4QLC U;  4ZC3 A;  5BQT A;  3HRS A;  3FBN B;  1FOK A;  1R36 A;  3I64 A;  4Y3O A;  2E1M B;  1D5Y A;  2EZI A;  1FMW A;  2TCT A;  3MQ0 A;  3IKT A;  3ECO A;  1Y6I A;  2K27 A;  2D1V A;  2XGX A;  4KNY A;  3WTY C;  1FJL A;  2HFH A;  4CCL A;  5JVT A;  4S04 A;  4OIO F;  3DCF A;  3BTI A;  2L7Z A;  2BHZ A;  2GIZ A;  3BP8 A;  1SVL A;  2PMH A;  5H6R A;  4RB2 C;  1DDN A;  2JQ7 A;  4XM3 A;  4JBA A;  4PJJ A;  1W5T A;  4H4K C;  4HNT A;  2Q0O A;  4HV6 A;  2F4I A;  3JRB A;  1ERD A;  1E2X A;  2R7T A;  5HOD A;  2EIJ H;  2PG4 A;  2L5Q A;  5CYV A;  4GO1 A;  2QA4 I;  2CQX A;  4LG3 A;  1YI2 I;  5C44 J;  4O6J A;  1OCZ H;  1MZB A;  3TO7 A;  2JTV A;  1W4M A;  2OZU A;  3BRO A;  4N0B A;  1TTY A;  2BE5 F;  5J40 A;  3VYS B;  3OYK A;  5DUK A;  5CVV A;  1TBX A;  3CCJ I;  2A61 A;  1UJ8 A;  3ZGK A;  1K4S A;  3D1N I;  4PFP A;  2FMY A;  3T0Y A;  5J1Y A;  4M9Z A;  3T1B A;  3ULQ B;  2KJC A;  1IV8 A;  2XPW A;  3N05 A;  1AWC A;  2AQF A;  4KIS A;  2VN2 A;  2LYC A;  3ASO H;  3K70 C;  1LDK B;  4I76 A;  3REO A;  3BLY A;  4IHY A;  3IWZ A;  1FX7 A;  1SVM A;  5HS8 A;  5JLX A;  1YRN A;  2BGC A;  1WH5 A;  4HX8 A;  3SZT A;  3QPS A;  2Q2E B;  1QA6 A;  1TZL A;  3A01 A;  1D1A A;  4LB6 B;  2VQH A;  1LNW A;  1YFH A;  3VWB A;  1U8R A;  1RUO A;  2WB1 N;  1FT9 A;  4YFN F;  3ZMT A;  3TW6 A;  2DI3 A;  1WJA A;  2YPR A;  3OIO A;  4M72 A;  2COB A;  4E7H A;  5C4J J;  1FWZ A;  1D3Y A;  4FIS A;  1BA5 A;  4Q48 A;  1P92 A;  1UAA A;  3I5U A;  5IP9 J;  2FJ1 A;  2VOO A;  1RRJ A;  2M8E A;  5E17 F;  1Q1H A;  5FLV A;  2LRE A;  3O2P E;  1H9T A;  4B43 A;  1WRJ A;  4RLQ A;  5ICC A;  2GXG A;  4ETS A;  2MAB A;  2FRH A;  2FUG 2;  4HV5 A;  2VXZ A;  2DBB A;  2CS3 A;  1BJZ A;  2WBM A;  4E7L A;  2QSH X;  4XLF A;  2VKE A;  2V6C A;  4UUV A;  2ID3 A;  3Q3S A;  3UKG A;  3C18 A;  5H20 A;  3CCV I;  2WAE A;  3OV8 A;  4KIT B;  1TT0 A;  3CUQ A;  1GXQ A;  2WTE A;  2WA0 A;  4XLE A;  3QYB A;  2EA2 A;  3I4P A;  2LD5 A;  1YQA A;  3V7S A;  5IYC J;  4D7N A;  5J47 A;  1BN5 A;  3LQR A;  4II2 A;  3J7Z I;  3CLO A;  2V4J C;  2HVS A;  1EKE A;  1TWA J;  4A3G J;  3ML6 A;  4L0Y B;  2HXI A;  4BDY A;  1FOX A;  1X2M A;  2R5Y A;  1Y1W J;  1RR8 C;  4MTE A;  1O3S A;  3Q0V A;  1ETO A;  1XGO A;  4XRF A;  3R61 A;  2L9R A;  2P0W A;  3FKI J;  1XSD A;  2Q1Z B;  4F55 A;  4KDP A;  3F3X A;  2FBH A;  2EFP A;  3S8P A;  1E0E A;  2L9N A;  4EJV A;  3CDH A;  1XPX A;  3BG7 A;  2PQ8 A;  2L4A A;  3E5U A;  1WI3 A;  4HQM A;  3VYR B;  1QO0 D;  1Y39 A;  2ECC A;  3BTC A;  4HF2 A;  5C4X J;  2ZXH A;  2CRG A;  1WH7 A;  1S7A A;  2ZJQ F;  3RKW A;  3HC7 A;  6PAX A;  1I6X A;  2V6E A;  1BBY A;  1E3O C;  4L0Z B;  4BBR J;  2EPF A;  3DFG A;  3PQJ A;  2K3F A;  2RGV A;  4V2F A;  3ZMU A;  1WJF A;  3HZJ A;  1Z91 A;  2Y69 H;  2JA2 A;  3LMM A;  1N25 A;  1REP C;  3CZ6 A;  3FMQ A;  2LFB A;  3T8R A;  2BOL A;  5HNH A;  4B4C A;  2DPU A;  1F43 A;  5BNG A;  4YFX F;  1ZH5 A;  1YHQ I;  2VJ5 A;  1GXP A;  3W2A A;  2CGP A;  1U5T C;  3MN2 A;  1KQ0 A;  2A5W A;  3LSJ A;  4I6Z A;  3ZQG A;  2L01 A;  5JHF A;  4UUS B;  4ZZD A;  1DGR M;  5DDG A;  2JJ7 A;  2PMU A;  1W7P B;  1ACI A;  1OYW A;  3GO5 A;  3JAM Z;  5LHI A;  1YS6 A;  2B7E A;  4UXN A;  1O3T A;  1I1G A;  3BR0 A;  3EUK L;  3CMY A;  3H9J A;  1MDM A;  3FXU A;  3PFI A;  2X51 A;  5L3F A;  2IP2 A;  4QSH A;  4MHG A;  3U1D A;  1XGN A;  2PBI A;  4WXD A;  2MD5 A;  2H94 A;  3OOP A;  2ZJ2 A;  1P4A A;  5D8L B;  3I9V 2;  4OAY A;  3RCO A;  1XG1 A;  2E7X A;  2FF4 A;  2DCE A;  3H3Z A;  1YW9 A;  2LP0 A;  2VKD A;  4OMY A;  2XGE A;  3M9A A;  3L2V A;  3IRR A;  5L3E A;  2LK2 A;  4M3D A;  5A2Q Z;  5BOX A;  3KLN A;  1VQ6 I;  2HU9 A;  1D0X A;  5FD6 A;  4G6T B;  2BHY A;  2EZH A;  2X6Y A;  4WX9 A;  3HOX J;  5HLG A;  4BJT A;  1NK2 P;  4BEH A;  2BEO A;  1J9I A;  2VT2 A;  3BPV A;  3LL7 A;  2E2H J;  1D8K A;  2HWV A;  3ECH A;  3ZXS A;  2MH2 A;  3LSK A;  2M30 A;  4A12 A;  1I6H J;  1UST A;  4ANJ A;  2NS7 A;  4FE4 A;  3N97 A;  1VZ0 A;  3WOD F;  2BBY A;  1RUN A;  4RMN A;  3JTH A;  3EDP A;  4AU7 A;  3MFK A;  5L3G A;  5FRM A;  2WV0 A;  1GVD A;  4XLP F;  5D6F A;  3V7C A;  3RSN A;  3CCR I;  4IF4 A;  1OCC H;  2AQE A;  4IL6 C;  5IP7 J;  3VOD A;  1R1U A;  3OOU A;  4EM1 A;  3QRF F;  3S93 A;  4NB5 A;  5BPI A;  4RGR A;  5FO5 A;  5HNF A;  2NVX J;  4OIR F;  5LGN A;  2UWM A;  4A6D A;  2P6T A;  1LUJ B;  5FLX Z;  1OMI A;  3ONQ A;  2LVS A;  3CP2 A;  3NWS A;  1JUS A;  3AAF A;  4QIW N;  5D5X B;  1UHW A;  3FXK A;  3IV5 A;  1TQI A;  1OCT C;  3K69 A;  4ON0 A;  1G2H A;  3HTS B;  3LST A;  1GHC A;  3E3V A;  4M6Y A;  1UB9 A;  2GA2 A;  3CJQ B;  2M45 A;  4C9Y A;  5ILS A;  1ETV A;  1MBH A;  3Q9S A;  3OYA A;  2F5D A;  2MW8 A;  3S17 J;  2V7F A;  1BR1 A;  4CYD A;  2R7W A;  1OCP A;  2FA5 A;  1B4A A;  1BW6 A;  2ISY A;  4MQ9 F;  4PGG A;  5LFA A;  1RKT A;  2GLO A;  3V42 A;  4GRI A;  1XX5 A;  1B8I A;  3FDY A;  2O7O A;  3BY6 A;  1YS7 A;  5EGO A;  2HDD A;  1FOW A;  1LVA A;  1IN4 A;  4YIR X;  4ABZ A;  4M6V A;  2LY2 A;  2R7V A;  3MKZ A;  1X3Z B;  2DA3 A;  1MJB A;  3K4N A;  3KLO A;  2OC6 A;  3ZMS A;  2JA8 J;  4WK8 F;  4JYK A;  2OQR A;  3F6V A;  1DQU A;  2E7W A;  4LOC A;  2X4H A;  2M34 A;  2XF6 A;  1WVR A;  1HCR A;  2EV5 A;  3HRT A;  4UY8 I;  2IEK A;  2W57 A;  3ZMD A;  3FF5 A;  3GTK J;  3ZN0 A;  2STW A;  3NQO A;  3BZ6 A;  4CO8 A;  3NWT A;  3QP5 A;  1VQO I;  2IGO A;  5J6X A;  3QOE A;  3D0S A;  2K9N A;  1FY7 A;  1OR7 A;  5CQG A;  1MBJ A;  2Y30 A;  3DF8 A;  4M3F A;  1BOA A;  1NG7 A;  1HXD A;  1PJR A;  5KAF C;  3TBI A;  1GDT A;  5J4V A;  1P4X A;  4A0Y A;  3VOE A;  4Y7N J;  3HGY A;  1ZAO A;  2DA5 A;  3FXM A;  4HST A;  4E7K A;  2OD5 A;  3CP8 A;  4I02 A;  4FT8 A;  2K3P A;  3VSL A;  3TP3 A;  1R9T J;  1MMN A;  2CW7 A;  2DDA A;  1GT0 C;  5DTD A;  3NAR A;  3W6J B;  4CCO A;  2A3S A;  3DEW A;  4A3I J;  2GXB A;  1FLI A;  1HDP A;  4KA4 A;  1W36 D;  4EJT A;  1IUF A;  2RN7 A;  1QZY A;  5LRR A;  4RGU A;  2DQL A;  5HDN A;  2HQN A;  1IV6 A;  4FAS D;  1HW2 A;  1I3A A;  1Y8Q B;  2PFB A;  4DNC A;  3LSP A;  3TO9 A;  4QWQ A;  5M5Y J;  3HSF A;  2HKO A;  4IOC F;  2H09 A;  3IL2 A;  2VUM J;  1R49 A;  1K6O A;  3H9G A;  3RIR A;  4ENJ A;  3K7A J;  1R1V A;  3FM5 A;  5J8F A;  3ZQ7 A;  1O57 A;  4R1H A;  3WHB A;  4IRI A;  3LAJ A;  3CC4 I;  3F8C A;  3CDI A;  4HDV A;  2NRA C;  3ELK A;  3K1N A;  3OYB A;  4F93 B;  5DYM A;  1TQP A;  4AUX A;  4C3H J;  1ZGA A;  3H5R A;  2MG4 A;  5TJJ A;  1VQK I;  1DU6 A;  3H3U A;  2QUF A;  1WSU A;  3JSO A;  4DW6 A;  4F3Q A;  3BQY A;  3SZG A;  1SFK A;  3OYM A;  2CFO A;  5F0F A;  1Y0U A;  3FZV A;  3ASN H;  3D5L A;  1ETY A;  3VEP A;  2K40 A;  2R7D A;  3DLL F;  1TW3 A;  4ESF A;  2E19 A;  1P7I A;  2LLK A;  3IRQ A;  1RR7 A;  4HLX A;  3ZQL A;  4DBR A;  1LE8 B;  2FNP A;  3WG9 A;  2GZW A;  1Z7L A;  4E7Z A;  1I3Q J;  2XSD C;  1DGW Y;  3PNY A;  3RKQ A;  1WI9 A;  2VJ4 A;  3PL8 A;  4XQF A;  2E2J J;  5IY5 H;  2ELH A;  3K1M A;  1NHA A;  4ITV A;  2KPM A;  2DLL A;  1KGS A;  4G7O F;  5EZG A;  2L7F P;  1W7P D;  1W5C C;  3EPZ A;  1HST A;  2ZXJ A;  5E1W A;  4QPQ A;  4EVI A;  2EFN A;  2M4K A;  2UXX A;  1YG2 A;  4FQG A;  4A69 C;  4A3F J;  2ACJ A;  1VFC A;  2R92 J;  3GW2 A;  3JSP A;  3KYD B;  1TWH J;  3ZN1 A;  4DZP A;  1WHU A;  3QPT A;  1U78 A;  1JKO C;  3OR1 C;  1ZRE A;  3F8F A;  1Y1V J;  1R6R A;  2DFF A;  4CHU A;  2GWR A;  1MGT A;  1M1E B;  4FET A;  2V9V A;  1T56 A;  1WWX A;  2WV1 A;  2HKX A;  3OYD A;  4ZYG A;  2JVH A;  4XOT A;  3AG1 H;  3A0H C;  2VBY A;  3M8E A;  2BXY A;  4A3M J;  1BM9 A;  1OQY A;  1JJ8 C;  3S1R J;  3SHF A;  1PVE A;  2JA6 J;  4NQW B;  4S05 A;  2DTR A;  1JT0 A;  4UV8 A;  3I3L A;  3E5Q A;  1W0U A;  1Z67 A;  4UVA A;  3E1S A;  4UB8 C;  1Y8R B;  1VQ7 I;  2EBI A;  3WGG A;  5FRO A;  5ED4 A;  2JMW A;  3JR9 A;  1DPU A;  3K10 A;  3ABL H;  1G3T A;  4EGY A;  1ON1 A;  4A3L J;  4DBQ A;  5F1R A;  2XPV A;  4XMY A;  2ZFU A;  4OWR B;  2ZCW A;  4XL9 A;  3UNG C;  5HOO A;  4UUS A;  2LNB A;  2C6Y A;  4DYQ A;  3FMS A;  2PJR B;  3M1E A;  2M7B A;  1W7P A;  2VON A;  1YLF A;  4BQQ A;  1MH4 A;  3S15 J;  2MSY A;  4CCJ A;  5BMZ A;  1H9G A;  1GVJ A;  5F0C A;  5EDN A;  4FTH A;  3RQI A;  2OPT A;  1HW1 A;  3BG5 A;  2Z33 A;  1LEA A;  4CGZ A;  2CV1 A;  1A04 A;  1FBU A;  3MAJ A;  4MFD A;  3BR6 A;  1B6A A;  5HLT A;  1ZR4 A;  3D5S C;  5E3L A;  2O5R A;  2DJI A;  4F52 A;  3OL4 A;  2K4J A;  4D5C A;  4CXF A;  4ENK A;  3QYF A;  1WJE A;  4D9J A;  1LEB A;  3DBL B;  3JW4 A;  2DK5 A;  2DMN A;  3L2Q A;  4XLA A;  3C1D A;  1BIA A;  1R22 A;  2W24 A;  1IRX A;  2CUF A;  2VI6 A;  2W25 A;  2XRN A;  4MGR A;  1SFU A;  1JHF A;  4XKV A;  1V55 H;  1YJN I;  3S1N J;  2O03 A;  4NC7 A;  5DCF A;  2HPI A;  1MMG A;  5LHH A;  4R79 A;  1XN7 A;  4J19 A;  1G3S A;  5JI6 A;  3OYJ A;  2V9P A;  3HM5 A;  2ISZ A;  2BY2 A;  1EH8 A;  3E5X A;  1KA8 A;  1KU9 A;  5TIS C;  4BJ5 C;  3KE2 A;  2X1D A;  2CFX A;  5M5X J;  1ZG1 A;  3CC7 I;  4KN4 X;  3L2R A;  3S1Q J;  3ABT A;  1N78 A;  2GA1 A;  2DFH A;  1ZHF A;  2M87 A;  2VKV A;  1FOY A;  2ETH A;  3M1C A;  2I8D A;  3GWZ A;  5D4R A;  4JP0 A;  2K9L A;  2HOT A;  2X9D A;  5J8C A;  3HB9 A;  4XK4 A;  2LF7 A;  1R00 A;  2E60 A;  5DM6 F;  2P5L C;  2LR8 A;  3KEY A;  1IDZ A;  2LY1 A;  4AWX B;  2L9S A;  1TNT A;  2O6G E;  2LKP A;  4C2U A;  1S3J A;  1WGX A;  1QGP A;  5A2Q K;  2VIX A;  1SC7 A;  4N9I A;  3KZI C;  4HF1 A;  3CUQ C;  1ORK A;  2XHK A;  4A3E J;  1IC8 A;  4BE0 A;  2E1C A;  1WCM J;  4Q4Z F;  4M74 A;  3O8H A;  2GOX B;  4B8X A;  3BR3 A;  3ZQF A;  2Y0S N;  4BHP A;  5E3M A;  4JX4 A;  2K02 A;  1X1A A;  4AVP A;  4GDF A;  2QSG X;  3OS0 A;  3AL0 B;  4ZZL A;  3C3W A;  3PIP F;  4HDU A;  1R7J A;  2DMQ A;  2UUZ A;  3BJ6 A;  4FX4 A;  3JRG A;  1MMD A;  2GAU A;  4CDG A;  3GBG A;  5LD2 C;  1YTY A;  1G4D A;  3LSI A;  1ZAR A;  1WKM A;  1A35 A;  5HLH A;  1T8I A;  4N9H A;  3CC2 I;  1PP8 F;  3BG6 A;  4XSX F;  2HYG D;  2EIN H;  5HS7 A;  3LAP A;  2XB0 X;  5K7Z A;  3LFK A;  4BBS J;  4ESB A;  2KRC A;  5ICF A;  3GFI A;  1FYK A;  4AIK A;  1S7O A;  3HHH A;  1KU3 A;  2IGK A;  4OOI A;  3ZQC A;  4M3E A;  1A31 A;  3CCM I;  3GUD A;  4ZYD A;  2Y9Z A;  2IS6 A;  4RAF A;  3F0C A;  3R0J A;  2JUG A;  3RZO J;  5EYR A;  4EM2 A;  4GCV A;  1TQM A;  5GAH J;  2V26 A;  2R93 J;  4KJZ A;  2ICW G;  3S16 J;  3E7L A;  4MFE A;  5FFX A;  3ZPL A;  1WJB A;  2IS2 A;  1ETX A;  4M9S A;  3HOT A;  2I5U A;  2EK5 A;  2H1K A;  4BQN A;  4NC6 A;  5E20 A;  1U2W A;  4RAG A;  5CVR A;  5JVG F;  3ZMZ A;  3I54 A;  5FFZ A;  4A0Z A;  1EH7 A;  1O3R A;  4NC8 A;  2F4O B;  2A07 F;  2KDO A;  2A05 A;  2F2E A;  3U21 A;  5C3E J;  4XOP A;  4A5N A;  2VPL A;  3A03 A;  4DYR A;  4AC0 A;  4D1Q A;  1X19 A;  2RRE A;  1RI7 A;  2A6H F;  1ZN2 A;  3DPU A;  3BG3 A;  1FNN A;  4P9F A;  2G0E A;  4B48 A;  2OA4 A;  1TC3 C;  2A68 F;  4G6D A;  1MNE A;  4WXC A;  4BAC A;  2X48 A;  3QU3 A;  5FKM A;  1A6Q A;  2FQ3 A;  4A3K J;  1BI1 A;  4CZZ A;  1JTX A;  3VDX A;  4LFU A;  3HRU A;  5LGU A;  2P6S A;  1BI0 A;  4BYY A;  3P5J A;  9ANT A;  3COA C;  2FBI A;  4AYB N;  3K4L A;  4BJ6 C;  4JQF A;  4ZYH A;  4XOR A;  3CES A;  3L9F A;  3R60 A;  5AON A;  5EG0 B;  3A2K A;  4AD9 A;  4XN0 A;  1VQ4 I;  5FRN A;  3O3K A;  1IJW C;  2Y9Y A;  4KUM A;  2M5W A;  2L7M P;  5DS9 A;  2QVO A;  2OTL I;  3RYR A;  4ASN A;  5L3C A;  2HPM A;  3ERM A;  1USS A;  2DMP A;  1G3W A;  3RDI A;  1OYI A;  2CQK A;  4LMY A;  2TDX A;  4MEX F;  4CCN A;  4KFC A;  4IO9 F;  5ICE A;  5M3M J;  1AA7 A;  2Y0S A;  4RB3 C;  5H6Q A;  3WE2 A;  2WY8 Q;  3BT9 A;  1J0R A;  4NHJ A;  3JRE A;  3IUO A;  1KU7 A;  4Q47 A;  2X85 A;  4V2G A;  4I01 A;  2Z99 A;  4PGH A;  4N4N B;  1GV5 A;  1SMT A;  1MD0 A;  2HVQ A;  3R6S A;  4IHW A;  5DD4 A;  5F08 A;  2FSW A;  4OMZ A;  3ZQI A;  3BOQ A;  2KIM A;  3ISP A;  1UG0 A;  4KMU X;  2L7K A;  2EFO A;  3ZRG A;  3ZMV A;  3J80 K;  4A0X A;  3K2A A;  4KMF A;  3GTO J;  3DP7 A;  1XMA A;  3DKW A;  1W0T A;  4XIC A;  2IGM A;  3S3M A;  4P96 A;  3B73 A;  3MMY B;  3H9Q A;  3IH4 A;  3ERE D;  1XSX A;  3E6M A;  3I58 A;  1ZYR F;  1XTA A;  3K6G A;  3E6C C;  4BS9 A;  1ENH A;  5M5W J;  2KFD A;  1XGS A;  3KET A;  3GYH X;  1LE8 A;  2EB7 A;  2L02 A;  1BI2 A;  1FPQ A;  2DAO A;  2CMP A;  2H1L A;  3I71 A;  1Z6R A;  2VJI A;  3HDD A;  1QQI A;  3RJP A;  4L5J A;  2DW4 A;  2OBP A;  4PJL A;  3BJA A;  4GXO A;  1FBQ A;  2EQR A;  1K6Y A;  3WTZ A;  2EFQ A;  3H5N A;  3NRV A;  2XAJ A;  2XKO A;  3A0B C;  3JCU C;  3HRM A;  1UG2 A;  5B3S H;  5HLI A;  5JFR A;  2V79 A;  3Q0W A;  5GTI C;  2IW5 A;  4O5V A;  1XCV A;  2V1N A;  3LSH A;  3GFL A;  1X1B A;  2ID6 A;  4DYC A;  2VXD A;  1D1C A;  1BC8 C;  2VLA A;  3S1M J;  2OZ6 A;  2CH0 A;  2RVC A;  2E34 A;  3CLQ A;  3IC7 A;  1FP2 A;  4WXH A;  2FX0 A;  5L3B A;  2NAZ A;  2CW0 F;  3EYY A;  1QVU A;  2IA2 A;  2WB1 A;  2HOS A;  4L18 B;  1DP3 A;  1IN6 A;  4I0A A;  1MMA A;  3IH2 A;  4A3C J;  5ERI A;  1LPQ A;  3JTG A;  5D5U B;  2HTS A;  2Y48 A;  3RYP A;  2WAQ N;  1LDJ A;  2VAS A;  4DJA A;  1S8N A;  3X2Q H;  4P55 A;  2CYY A;  2DFI A;  2E1M C;  5B5E C;  3CCS I;  3F23 A;  4HPQ A;  1LFP A;  1OR7 C;  1SD7 A;  3QOD A;  2VJJ A;  1HKQ A;  3EET A;  5K7F A;  4XNF A;  1OKR A;  4NQW A;  4DZJ A;  1RES A;  4BE1 A;  4U0W A;  4AYB A;  1UZC A;  2XF5 A;  1S72 I;  2XKP A;  2ELJ A;  3JRC A;  3U1K A;  3VB2 A;  2RKH A;  4MQV A;  2Z9O A;  1OPC A;  1E17 A;  4LLN A;  2HVR A;  4D7M A;  1R58 A;  1P9Q C;  1MH3 A;  5IOZ A;  4X1E A;  3HIF A;  3J7A O;  2MBF A;  2KIU A;  3G2B A;  2KMU A;  1R4M B;  1LB2 A;  1KZH A;  1JI8 A;  2E2I J;  2PJR A;  2QF7 A;  2ZME B;  3QYE A;  2MC3 A;  5B1A H;  1MBK A;  1TW2 A;  1R23 A;  1V5E A;  4U87 A;  1VQ5 I;  2ZSH B;  3IHU A;  3O6B B;  2JWT A;  2YX7 A;  3CF5 F;  1JGS A;  2R7R A;  3RKX A;  3T5X A;  2NS8 A;  1JUP A;  2DJN A;  4I2O A;  4CH7 A;  2IVM A;  1WPK A;  2OTJ I;  2XAQ A;  3HEF A;  5IT9 K;  4KT6 A;  3L1P A;  2ADU A;  1J09 A;  1Z05 A;  2XDV A;  4P5O A;  4BXX J;  3F72 A;  1JT6 A;  1VQN I;  4MEY F;  2DFE A;  5GPC A;  5HDG A;  3CCU I;  1HKT A;  3I4M J;  1FBS A;  2HQ5 A;  3JRA A;  4CCM A;  4BH9 A;  2H8W A;  2CWE A;  3W6K B;  2PJP A;  2HI3 A;  2JRM A;  3GTL J;  1L0O C;  1QZZ A;  4V19 K;  5FJ8 J;  1SFE A;  2K9Q A;  2E71 A;  4HYE A;  1SEU A;  3DPT A;  2W85 A;  4LIT A;  1ZGJ A;  4HOB A;  2Z1D A;  2J5P A;  3HOY J;  2ESH A;  1SD4 A;  1B72 B;  4JOM A;  1IO2 A;  1B1B A;  1D0Y A;  1YJW I;  1KQ9 A;  3G6E I;  3WTS C;  2OQG A;  2EWN A;  4LK1 F;  3OS1 A;  2MC4 A;  1ZLK A;  4IHX A;  1Z9C A;  5LRS A;  2DT5 A;  4HQE A;  5K5O A;  2K86 A;  2R0Q C;  1ZLJ A;  5BPD A;  1G6N A;  1W36 C;  3RI4 A;  1MW7 A;  2ZKZ A;  3TO6 A;  4L9T A;  4IZZ A;  4A3D J;  2BY1 A;  1TWG J;  2K7L A;  1F9N A;  1SD5 A;  1HDD C;  4CYC B;  2ZO4 A;  1J59 A;  2VBX A;  2DT6 A;  4RB1 A;  5AIP A;  5H2F C;  3GLL A;  2M9H A;  4WWC A;  4MIM A;  2V9K A;  2Z5U A;  4PZJ A;  1WJD A;  5DEQ A;  2DYS H;  4RLF A;  2WY7 Q;  2KQR A;  2MFZ A;  3TDZ C;  1X3W B;  2DOF A;  1QPM A;  3QOP A;  1G3Y A;  2X6W A;  4IJA A;  4UVC A;  2KHM A;  3WGI A;  5IP6 A;  2CQN A;  1LJ9 A;  3K9T A;  4JX6 A;  1JE8 A;  1B9N A;  2AS5 F;  2G7H A;  2O3F A;  2KRF A;  3FIW A;  3G3Z A;  3FXR A;  5B66 C;  2IBD A;  2EZL A;  4Y4R A;  3W6V A;  3H3V K;  1X58 A;  3K0L A;  4BGD A;  1HF0 A;  2LDU A;  4G94 A;  3HOZ J;  3K4B A;  1JKQ C;  4RM3 A;  4BQO A;  3A02 A;  3TQN A;  2O61 A;  1XB4 A;  4IHT A;  1IRF A;  1ZRF A;  1C0W A;  4UB6 C;  1TLH B;  1LDD A;  2CO5 A;  1Z6T A;  2W84 A;  2W1O A;  3WG7 H;  2V1U A;  1ZKG A;  4E70 A;  2JSP A;  4WF2 A;  3AG2 H;  4FCY A;  2HNH A;  3DBH B;  4PJM A;  2UV1 A;  3WU0 A;  3MZ8 A;  4OU0 A;  2HYJ A;  1S9H A;  2PN6 A;  3CCE I;  1LFU P;  2E36 A;  4GGG A;  2ZFW A;  1J7K A;  3V8J A;  4HSR A;  3WTX C;  3TL4 X;  4G6Q A;  4IEJ A;  3DU6 A;  4LGW A;  2M4G A;  1U8B A;  1TP4 A;  2Y0M A;  4U7D A;  3WHC A;  4LLL A;  1IN7 A;  4BHB A;  1AKH B;  5EJC A;  4BAY A;  3OIQ A;  2A5Y B;  2W48 A;  3MD2 A;  3DTE A;  2Q2E A;  2CV0 A;  2KP6 A;  4M9X A;  3AKZ A;  2ELK A;  1Z3X A;  4YRV A;  1EH6 A;  4AIH A;  2ESN A;  4XR6 A;  3J7Y J;  3KIO A;  2XAU A;  3C7J A;  4BKX A;  3PIO F;  5LEK A;  3GTP J;  3IH3 A;  3F21 A;  3IAS 2;  1Z77 A;  2HYF A;  4CCK A;  3HOV J;  2RQP A;  4UNO A;  2HR3 A;  3MKL A;  1MNM C;  1R4N B;  3U2R A;  3TW7 A;  2FD5 A;  1ZGW A;  4UHT A;  2FOK A;  1POG A;  2DOA A;  2NNN A;  2JN6 A;  1FTT A;  3BR2 A;  5CQE A;  1STZ A;  2ZNY A;  4GYG A;  4XN3 A;  5E1Z B;  1EV7 A;  2IGN A;  1H0M A;  2TRT A;  2ZSI B;  1KYZ A;  4M3G A;  3DTI A;  2NVU B;  1YIJ I;  1W5S A;  5F0H A;  5K7H A;  1TL8 A;  1ZR2 A;  2XPU A;  5EG0 A;  3MKW B;  1XDS A;  2CUZ A;  1XSV A;  5KVR A;  3SYT A;  1UCR A;  2JA7 J;  1ITY A;  1UHS A;  3L00 A;  4M6X A;  1H8A C;  3WU2 C;  2JPB A;  3HPG A;  2XVC A;  3BCA A;  2NVY J;  3BDD A;  2NS0 A;  1KQ8 A;  4GYI A;  2KLO A;  1FSH A;  3QU6 A;  3GZ6 A;  1U0J A;  2WWY A;  2XAF A;  2HTJ A;  3BTL A;  5E3O A;  3AG3 H;  3L09 A;  2XAS A;  3ZQQ A;  4HAM A;  3WU1 B;  5IOY A;  2KJB A;  2DTZ A;  5DUI A;  3P9C A;  1V5F A;  4XRS A;  4LG0 B;  3IKV A;  4EV0 A;  5FLM J;  3W2W A;  3FHZ A;  3KP5 A;  3F8B A;  3S3N A;  2QQ9 A;  3DWL E;  3QWL A;  3FXJ A;  4U88 A;  2F5V A;  3VFZ A;  2BY3 A;  3W3C A;  1DP7 P;  2BW3 B;  3EUH A;  2HS5 A;  4XLH A;  4IHS A;  1WJC A;  1XMX A;  2E5Z A;  4CIC A;  2IT0 A;  1ODD A;  1MJ9 A;  3U9G A;  1R5I D;  2VBZ A;  5CPR B;  3H0D A;  2KZV A;  2P7V B;  4QTR A;  1YJ9 I;  1PUF B;  5J3L A;  1I27 A;  1T0F A;  1VQM I;  1T95 A;  1A5J A;  5F64 A;  5M3F J;  4D0P A;  1HLV A;  1EJ9 A;  1FIP A;  1JKR C;  1YIT I;  2O0Y A;  5EEH A;  1XMK A;  1HA8 A;  3FM3 A;  1SVO A;  4FX0 A;  1D0Z A;  1T08 B;  3F9K A;  5LHG A;  3SXY A;  4BDZ A;  1I50 J;  5DD8 A;  1DUX C;  1ZK8 A;  1MKM A;  4EMS A;  1ZEL A;  3DTK A;  3KP6 A;  1N75 A;  2CV2 A;  2DN0 A;  2DT7 B;  3I0T A;  2PLY A;  1XS9 A;  1I1S A;  2PMZ N;  4IQ4 A;  2HZT A;  3WTU C;  4J01 A;  1JHH A;  3JRI A;  2V1D A;  1WZ2 A;  1TWC J;  2FE3 A;  2YX4 A;  1RPW A;  4RAZ A;  1K7A A;  3F8N A;  3WGH A;  2JUC A;  2QWW A;  3VPR A;  3HUG B;  4B3A A;  1S29 A;  1IN8 A;  4HX7 A;  5EF6 A;  5CVJ A;  4Y17 A;  2HOE A;  4CUG A;  4EM0 B;  1OFC X;  3MVP A;  3DEE A;  3GTM J;  2KIQ A;  4I98 B;  2W4S A;  1T39 A;  3TGN A;  2HEO A;  2K9S A;  3QAH A;  3SFI A;  1A36 A;  1IG7 A;  2VOP A;  4XON A;  4IQJ A;  2YU3 A;  1SMY F;  4ENN A;  1BR2 A;  3G1L A;  2QLZ A;  2X1E A;  3CJN A;  2JZY A;  4B47 A;  3LNQ A;  1QVT A;  3ROU A;  2JSC A;  3MZH A;  1GV2 A;  2K9M A;  4E4H A;  3BJO A;  2R5Z B;  3JAM K;  5FKL A;  4RB0 A;  3QQA A;  2YSR A;  1HSJ A;  2WAF A;  2X1C A;  4EAT A;  3CME I;  2WAD A;  1ETK A;  3CCQ I;  2XAH A;  1V4R A;  5KAI C;  5E3N A;  1AU7 A;  4I09 A;  4BQA A;  5EEG A;  2XRO A;  5GAE J;  3JRF A;  1MIJ A;  2EIK H;  4EQQ A;  4KIC A;  4IVN A;  4OAZ A;  3UR3 C;  3F22 A;  2G9W A;  5HDK A;  2ZME A;  1GUU A;  4WCG A;  4ZTJ A;  3GZN B;  4PK4 A;  3BG9 A;  4YIF A;  2M0C A;  2FBK A;  5E8G A;  4LIU A;  3OYL A;  3LSR A;  3V8L A;  2NYX A;  1OCR H;  4LLG F;  2XSJ C;  3KX2 A;  2BVM A;  2H6B A;  2X6O A;  3JRD A;  3L7W A;  4RDU A;  5ILV A;  1X4O A;  2Y2Z A;  1S7E A;  2RQQ A;  2CU7 A;  5DV5 A;  2KZG A;  1U5T B;  3AG4 H;  5K1Y A;  2RAE A;  3JRH A;  5JLW A;  2I10 A;  1QNT A;  3M7G A;  3GXO A;  2KT0 A;  3MEX A;  2MLK A;  1V3F A;  1X1D A;  3CF2 A;  3DKY A;  4HBL A;  2P8T A;  3CJT B;  4NBQ A;  2JK3 A;  4D5F A;  5J1U A;  4O3M A;  4C3I J;  1O7F A;  2H27 A;  5KCM A;  4B09 A;  1VI0 A;  2EIL H;  1ONV A;  3I55 I;  2RDP A;  2XB5 A;  5D8K B;  1B72 A;  4IPA A;  4ESJ A;  5TGT A;  5DCM B;  2K85 A;  2RC4 A;  2M8G X;  5E1X A;  2QQA A;  3ESW B;  4PFO A;  3SZP A;  4BY1 J;  2KKO A;  5FLX K;  3LSG A;  5IYB J;  4IOA F;  1TT5 B;  5IT3 A;  2CQQ A;  1FYL A;  1JGG A;  2PMZ A;  2ME0 A;  1F36 A;  1P2F A;  4KIF A;  1FSE A;  1NTC A;  2X6X A;  2HQA A;  1UMQ A;  3PNT A;  2DQR A;  3PUF A;  4CYC A;  1QBJ A;  2WC2 A;  2BZT A;  2R7Q A;  3OYG A;  2F4M B;  4AID A;  2ZNZ A;  1YX5 A;  3KZZ A;  3T8T A;  1CF7 B;  3SDG A;  2A6E F;  4JX5 A;  2A69 F;  1ZQ3 P;  4BXU A;  2DOD A;  1K78 B;  1X4P A;  1IXS B;  1P4W A;  4UUT A;  3HPH A;  2LBF B;  4A2U A;  1ZG5 A;  2LSO A;  3RTR A;  1IZ1 A;  2P5K A;  1BJA A;  3G1O A;  3P7N A;  5CVU A;  2EJR A;  4XKB A;  1V5G A;  1D8J A;  3P9I A;  2EIM H;  3OR2 C;  3R4K A;  3DQV C;  2MH9 A;  3F6O A;  3RPQ A;  2DA6 A;  2IJL A;  4RM2 A;  4CA0 A;  1VF9 A;  3WE3 A;  4DGW B;  4ZTF A;  5ILU A;  5LGT A;  3DEU A;  3GFM A;  2E35 A;  4X0G A;  4R8H A;  3TKY A;  2R5Y B;  4BXF A;  1YW8 A;  1U3E M;  3C2G A;  3FXO A;  1DU0 A;  2G7U A;  3KP3 A;  1K61 A;  1U9N A;  1YX3 A;  4J00 A;  4I0B A;  2DA7 A;  2K4B A;  2F6C A;  1D1B A;  4BY7 J;  3V4G A;  3KEQ A;  3EUA A;  2JPC A;  3QPH A;  1FMV A;  3H0G J;  3L2C A;  4GFB A;  3R0A A;  3GFJ A;  4IX7 A;  1JJ6 C;  2NVQ J;  1HW5 A;  1IXR C;  3OL3 A;  1LQ1 A;  1BW5 A;  4N4O B;  1YE9 A;  2EH3 A;  4E7I A;  2LH9 A;  4HA8 A;  1JXS A;  1IAW A;  2AXL A;  1AKH A;  2F5E A;  3PO2 J;  1IF1 A;  1UFM A;  4BHC A;  1Z0X A;  3PQK A;  4KYW A;  4G8X A;  3C2B A;  3DU5 A;  4G7H F;  2HQR A;  2AXT C;  3OSG A;  4OIQ F;  3J81 Z;  3KZY A;  3DBR B;  4A3J J;  1FIA A;  3BPX A;  3HG9 A;  3OWT A;  1MBG A;  5CVI A;  3K70 D;  3GME A;  3G71 I;  2DOE A;  1XGM A;  3BZK A;  1UEL B;  2L0K A;  2XRL A;  4E6K G;  2YU9 J;  4ZH4 F;  1T98 A;  1Z3Y A;  2ZB9 A;  1QHH D;  2PEX A;  3H5A A;  3KYC B;  4EJO A;  5KNL A;  2GM4 A;  2F5F A;  4QPO A;  3DV8 A;  2VQL A;  3B6C A;  1ULY A;  2DXI A;  1TWF J;  2L54 A;  2PI0 A;  4IXA A;  4C2M J;  1QPI A;  1ETQ A;  5K5R A;  1Y56 A;  4A6E A;  4G12 A;  1PUE E;  1IGN A;  3PO3 J;  2XIG A;  3CMM A;  1OCO H;  3E0J B;  3HL2 A;  4HF0 A;  1ZTR A;  3KFW X;  2FQ4 A;  5F6F A;  2VE8 A;  2HDC A;  4FE7 A;  4P1W A;  2CSO A;  3C2H A;  2IXS A;  2K5C A;  1CGP A;  3FMR A;  2MGQ A;  2DDB A;  2MYS A;  2P5V A;  2GBY A;  3HOU J;  3KPH A;  3OS2 A;  3M4O J;  5E8I A;  2COM A;  3VYU B;  1LFB A;  2FOW A;  5IYD J;  3ABK H;  1I39 A;  3PSI A;  1K4T A;  1WQ2 A;  3OMY A;  4LG0 A;  3IP4 B;  4IHV A;  2IA1 A;  1MBF A;  2GXA A;  4BU2 A;  5IPA A;  4L5I A;  1R5H A;  2ZJR F;  1B9M A;  1EF4 A;  3E6D A;  3EQL F;  4C3J J;  4PSW A;  3TOB A;  1IW7 F;  2XC7 A;  3AL0 C;  1WJ5 A;  2BW3 A;  1K83 J;  1T33 A;  2YUS A;  4BUP A;  2MLG A;  2QBY B;  3LA2 A;  4LIV A;  5FGM A;  4HRI A;  4HLY A;  3GTG J;  4RS8 A;  3CDL A;  2VT3 A;  1ON2 A;  2R7X A;  3FWE A;  2NOJ B;  3OY9 A;  1PUF A;  3I59 B;  4B44 A;  2VQG A;  1Q1V A;  4U0Y A;  2LOO A;  2D45 A;  2VKH A;  5TRD A;  3BR5 A;  1S5L C;  3HXL A;  4PSX A;  4YII A;  4NUB A;  4UV9 A;  2CUJ A;  1I5Z A;  1X1P A;  3ZR8 X;  1BC7 C;  2VE9 A;  2PX9 A;  3S2H J;  3GCM A;  1VQ9 I;  3KEO A;  4OIP F;  2M1B A;  1E3H A;  3TP0 A;  1JTY A;  3FXQ A;  2BVL A;  2VPR A;  1U9O A;  3KP2 A;  3PFY A;  4XRM A;  3H1C A;  3I53 A;  3CCY A;  1FZP B;  3FKJ A;  5AIQ A;  1JKP C;  2XGC A;  1NH3 A;  5D5W B;  1TNS A;  2NXN B;  2QYO A;  2NOG A;  3G73 A;  2FML A;  3KP7 A;  4LD5 A;  3KP4 A;  2IA0 A;  4FHT A;  4KIB A;  1PDN C;  1Z7U A;  3K4K A;  5GAG J;  1J75 A;  1DPR A;  3HTU A;  3CMA I;  3HUG A;  4Z2Y A;  2D1H A;  4AIJ A;  4E7J A;  3QP6 A;  4JK1 X;  4NDL A;  1H89 C;  4DOZ A;  2OCC H;  3SQN A;  2VC1 A;  2LMD A;  3HSR A;  4PDK A;  2H8R A;  3FK7 A;  4BE2 A;  1QRY A;  5E79 C;  4PUS A;  4IKF A;  1BR4 A;  4MO7 A;  5JHU A;  1T2K A;  4L5E A;  3CO6 C;  3BTJ A;  3GTJ J;  1ZRD A;  3LFU A;  3FXL A;  1LKX A;  3PNV A;  2OF7 A;  2P4W A;  2QQB A;  1HQC A;  4L9J A;  1AOY A;  1D5V A;  3CCL I;  3MCZ A;  2QM3 A;  2R5Z A;  5GAD J;  1ZG3 A;  2QKL B;  2QEN A;  1K79 A;  2LG4 A;  3A1Y A;  3V8K A;  1WFX A;  1MSF C;  4U0V A;  4A93 J;  1QHG A;  4RBO A;  2E5N A;  3V7R A;  1SD6 A;  4H0E A;  2XF7 A;  3NEU A;  1YYV A;  2XUB A;  2IPQ X;  3TMO A;  1OJL A;  1YW7 A;  1MND A;  4Y15 A;  1R1T A;  2E1N A;  3NAU A;  4XLN F;  3CD6 I;  4I99 C;  4NNJ A;  1CQT A;  3WTV C;  3SEQ A;  2H6C A;  4MLO A;  4II3 A;  3L2W A;  2D5V A;  2EV0 A;  4XKW A;  5GTH C;  2DPD A;  2BXZ A;  4HNV A;  1U5T A;  2UZK A;  1KU2 A;  2GIV A;  2WAQ A;  3TOA A;  5D4S A;  4A3B J;  5KHD A;  2L4M A;  2QEX I;  4YEL A;  2DA4 A;  2R4G A;  4UVB A;  3ZOB A;  2M7A A;  1O4X A;  3VSK A;  2V1X A;  5F27 A;  1T38 A;  5ICG A;  2EZK A;  4U7B A;  2O8X A;  1OYY A;  2HGC A;  3B6A A;  1X3U A;  3FK6 A;  3HHG A;  1YO5 C;  4G7Z F;  4LB5 A;  4X6A J;  2BYV E;  3Q9V A;  2W82 A;  1IN5 A;  3CO7 C;  1RZ4 A;  2LY9 A;  4F92 B;  2MD0 A;  2IRF G;  2O9L A;  3BWG A;  3L2U A;  1YRN B;  2DMT A;  5DCM A;  4KIG A;  5LLQ A;  2DA1 A;  3TED A;  3LOC A;  3EUH C;  4DIQ A;  2CG4 A;  2A6T A;  4BL0 B;  3A01 B;  3BCB A;  2KDZ A;  2OJE D;  4I7H A;  4S0H B;  3OYN A;  1HKS A;  5L3D A;  2W00 A;  4HW0 A;  2E1O A;  4KN7 X;  2LRD A;  2F5C A;  2Q8K A;  3WTT C;  4B1R A;  3FX3 A;  1T0F C;  3OYE A;  2M2E A;  2JT1 A;  2BY0 A;  1QU3 A;  1S6L A;  1FYM A;  2Y31 A;  2NNY A;  1IRZ A;  4ZYA A;  2M0M A;  3HSE A;  1T6S A;  2R3S A;  1CF7 A;  3Q5F A;  5D6E A;  1FC3 A;  3S2D J;  3M07 A;  1K78 A;  2QQ8 A;  1UHM A;  1VQL I;  3BZC A;  2LBF A;  2OUM A;  5BS6 A;  4OIN F;  1NG6 A;  3GX4 X;  3RQ4 A;  1X1C A;  5EEA A;  3J80 Z;  3I56 I;  1FTZ A;  1A6I A;  5FD5 A;  3S32 A;  2MA3 A;  1Z21 A;  4YG2 F;  4XID A;  1R71 A;  2DYR H;  1B59 A;  5LEJ A;  2KL4 A;  1AHD P;  1SFX A;  2LC2 A;  2B9S A;  4ZDO A;  2Y75 A;  3CUQ B;  5F04 A;  3PM1 A;  1SAX A;  2O8K A;  1P6R A;  3E97 A;  2P7C B;  3S3O A;  2DA2 A;  4RGS A;  2FXA A;  1F4K A;  1XCB A;  4ZDP A;  4RAY A;  2AO9 A;  4MTD A;  4F7Z A;  5FKO A;  2VC0 A;  2NVT J;  2R7Z J;  4XKC A;  2R7U A;  2CQ7 A;  4C30 A;  3E6B A; 
#chains in the Genus database with same CATH homology
 1FEX A;  5E3N A;  3S14 J;  1AU7 A;  2NVX J;  2DMP A;  3JRF A;  2LVS A;  4EEF G;  5M3M J;  1GUU A;  1JUS A;  1VND A;  4QIW N;  3BG9 A;  3BT9 A;  2M0C A;  3JRE A;  3HKZ N;  3LSR A;  3IV5 A;  1OCT C;  1G2H A;  2X6O A;  3JRD A;  2JA5 J;  4V2G A;  4RDU A;  5FKN A;  2Y2Z A;  1RKW A;  1S7E A;  1GV5 A;  2CU7 A;  2XGD A;  4IHW A;  5F08 A;  1ETV A;  3ZQI A;  4W1U A;  1MBH A;  2RAE A;  1ETW A;  2MW8 A;  3S17 J;  3JRH A;  3K2A A;  3GTO J;  2N8G A;  1OCP A;  5JLW A;  2I10 A;  1BW6 A;  1JUM A;  3HGG A;  1RKT A;  1W0T A;  4XIC A;  2GLO A;  2KT0 A;  1B8I A;  3IH4 A;  2O7O A;  2JK3 A;  1ENH A;  5EGO A;  5M5W J;  2HDD A;  5EZH A;  1LE8 A;  4ABZ A;  4M6V A;  4D5F A;  1IDY A;  5J1U A;  4C3I J;  2DA3 A;  1VI0 A;  3HDD A;  2XB5 A;  1B72 A;  2JA8 J;  2EQR A;  3ZQH A;  2CUE A;  2M8G X;  4JYK A;  3Q0U A;  5J1R A;  4BY1 J;  1X2N A;  2IAI A;  3HBL A;  4LOC A;  2M34 A;  3LSG A;  5IYB J;  1UG2 A;  1HCR A;  2CQQ A;  3Q0W A;  1JGG A;  2IEK A;  2ME0 A;  1F36 A;  1SAN A;  1NTC A;  2ID6 A;  3GTK J;  4DYC A;  1UMQ A;  4CYC A;  3SJM A;  3S1M J;  2FX0 A;  2K9N A;  1MBJ A;  2Y30 A;  4M3F A;  1SFO J;  1QVU A;  3SDG A;  2HOS A;  4JX5 A;  1ZQ3 P;  1GDT A;  3IH2 A;  1MSE C;  4A3C J;  4UUT A;  2AHQ A;  2WAQ N;  5FKK A;  4Y7N J;  1H88 C;  3HGY A;  2DA5 A;  3G1O A;  1RET A;  1APL C;  3RZD J;  5K7F A;  3TP3 A;  1R9T J;  4DZJ A;  2DA6 A;  1RES A;  1GT0 C;  5DTD A;  3NAR A;  3DEW A;  4A3I J;  3M3Y J;  1XC5 A;  1VF9 A;  3JRC A;  1HDP A;  2QCO A;  1IUF A;  2HOA A;  2ME6 A;  4D7M A;  1MH3 A;  1IV6 A;  5IOZ A;  3LSP A;  2R5Y B;  4X1E A;  4XRS G;  1DU0 A;  5M5Y J;  2DMU A;  3OSF A;  4Y52 J;  1K61 A;  1U9N A;  1MBE A;  2VUM J;  3CQZ J;  2DA7 A;  2E2I J;  3K7A J;  3BR1 A;  2QF7 A;  4BY7 J;  3O8G A;  3BQZ A;  5GP9 A;  1MBK A;  3H0G J;  4GFB A;  3WHB A;  1JJ6 C;  2JWT A;  2NVQ J;  1BW5 A;  2EH3 A;  2NS8 A;  1JUP A;  3GTQ J;  2DJN A;  1BL0 A;  4AUX A;  1WPK A;  2LTP A;  4W97 A;  4C3H J;  3HEF A;  2HXO A;  2MG4 A;  3L1P A;  1AKH A;  4BXX J;  3PO2 J;  1DU6 A;  1P7J A;  1JT6 A;  1Z0X A;  4DW6 A;  3BQY A;  5GPC A;  3FIS A;  3I4M J;  2CJJ A;  2HQ5 A;  5F0F A;  3JRA A;  3C2B A;  2ECB A;  1ETY A;  2HI3 A;  2K40 A;  3HOW J;  2P81 A;  3GTL J;  5GPA A;  1B8I B;  3OSG A;  2E19 A;  1P7I A;  2LLK A;  5FJ8 J;  5EGO B;  1RR7 A;  1FIA A;  2K9Q A;  4A3J J;  3ZQL A;  1LE8 B;  1MBG A;  5F1J A;  4M3B A;  3I4N J;  2B63 J;  1HOM A;  2YS9 A;  1I3Q J;  2XSD C;  3HOY J;  3RKQ A;  1B72 B;  3G1M A;  2L0K A;  2XRL A;  2YU9 J;  2LKX A;  2ZB9 A;  2E2J J;  3QPL A;  1NK3 P;  4IHX A;  5EZG A;  2R0Q C;  2GM4 A;  2L7F P;  3B6C A;  4A3D J;  1TWF J;  1TWG J;  4A3F J;  4A69 C;  1HDD C;  4CYC B;  2R92 J;  1VFC A;  1TWH J;  4C2M J;  4DZP A;  1QPI A;  1D5Y A;  2EZI A;  1ETQ A;  2TCT A;  2M9H A;  1U78 A;  4MIM A;  1JKO C;  4G12 A;  1IGN A;  1FJL A;  3PO3 J;  1Y1V J;  1ZTR A;  2FQ4 A;  1T56 A;  2WV1 A;  4FE7 A;  3DCF A;  3BTI A;  3HOU J;  2L7Z A;  2MGQ A;  3M4O J;  2GBY A;  5IP6 A;  4JX6 A;  1LFB A;  4A3M J;  1JJ8 C;  5IYD J;  3S1R J;  3JRB A;  3FIW A;  2JA6 J;  5HOD A;  2IBD A;  2EZL A;  4IHV A;  3W6V A;  3H3V K;  1X58 A;  1MBF A;  2CQX A;  5C44 J;  5IPA A;  1JT0 A;  1HF0 A;  1W0U A;  1EF4 A;  3HOZ J;  4C3J J;  1JKQ C;  3A02 A;  2EBI A;  3JR9 A;  2JMW A;  1K83 J;  1T33 A;  2YUS A;  3D1N I;  4A3L J;  3GTG J;  1ZKG A;  5J1Y A;  2XPV A;  2XPW A;  4FCY A;  3CDL A;  4UUS A;  4DYQ A;  1PUF A;  4I76 A;  2HYJ A;  4IHY A;  1Q1V A;  1LFU P;  1YRN A;  1MH4 A;  5JLX A;  3S15 J;  2MSY A;  3BR5 A;  1WH5 A;  3QPS A;  5F0C A;  4IEJ A;  5EDN A;  3A01 A;  3S2H J;  4FTH A;  3RQI A;  2OPT A;  3BG5 A;  4XRM A;  3TP0 A;  1JTY A;  2VPR A;  1U9O A;  1U8B A;  4MFD A;  3BR6 A;  3CCY A;  3WHC A;  1ZR4 A;  2WB1 N;  1JKP C;  1AKH B;  5E3L A;  2XGC A;  3TW6 A;  2W48 A;  3OIO A;  4D5C A;  2COB A;  5C4J J;  2NOG A;  4FIS A;  1BA5 A;  2DMN A;  5IP9 J;  2ELK A;  2FJ1 A;  4BKX A;  2CUF A;  2VI6 A;  3GTP J;  3IH3 A;  5FLV A;  1Z77 A;  3HOV J;  3S1N J;  4NDL A;  1H89 C;  2H8R A;  3MKL A;  1MNM C;  3FK7 A;  1QRY A;  4J19 A;  4MO7 A;  4L5E A;  3TW7 A;  2FD5 A;  3HM5 A;  1ZGW A;  3BTJ A;  1BJZ A;  3GTJ J;  1POG A;  2JN6 A;  2VKE A;  5M5X J;  1FTT A;  2ID3 A;  2OF7 A;  3BR2 A;  3Q3S A;  3UKG A;  3S1Q J;  2VKV A;  2TRT A;  4M3G A;  2R5Z A;  4JP0 A;  5F0H A;  2HOT A;  5K7H A;  2X9D A;  2LD5 A;  1ZR2 A;  2XPU A;  5EG0 A;  5IYC J;  3HB9 A;  4D7N A;  4XK4 A;  1IDZ A;  2LR8 A;  2JA7 J;  1MSF C;  1ITY A;  1TWA J;  1UHS A;  1WGX A;  1H8A C;  4A93 J;  4A3G J;  4RBO A;  2HXI A;  1X2M A;  1Y1W J;  2NVY J;  3Q0V A;  1ORK A;  1OJL A;  1ETO A;  4A3E J;  1IC8 A;  2L9R A;  3FKI J;  1WCM J;  3NAU A;  3O8H A;  1CQT A;  3BR3 A;  3ZQF A;  2Y0S N;  5E3M A;  3BTL A;  4JX4 A;  5E3O A;  4MLO A;  2D5V A;  5IOY A;  1WI3 A;  2DMQ A;  2DTZ A;  5C4X J;  2ECC A;  3BTC A;  3JRG A;  2CRG A;  4HNV A;  1WH7 A;  4XRS A;  3GBG A;  4A3B J;  1E3O C;  5FLM J;  4BBR J;  4V2F A;  2DA4 A;  2XB0 X;  2LFB A;  5K7Z A;  3ZOB A;  4B4C A;  4BBS J;  1O4X A;  1F43 A;  5F27 A;  5BNG A;  2EZK A;  3MN2 A;  3B6A A;  3FK6 A;  3ZQC A;  3LSJ A;  4I6Z A;  3ZQG A;  4M3E A;  4UUS B;  2Y9Z A;  4QTR A;  4X6A J;  1PUF B;  2JJ7 A;  5J3L A;  3F0C A;  2LY9 A;  2O9L A;  3RZO J;  5EYR A;  1A5J A;  1YRN B;  2DMT A;  5M3F J;  1HLV A;  2DA1 A;  3TED A;  1FIP A;  3LOC A;  1JKR C;  2R93 J;  3S16 J;  3E7L A;  4MFE A;  3A01 B;  2KDZ A;  1ETX A;  3BR0 A;  3CMY A;  4S0H B;  2H1K A;  1I50 J;  4QSH A;  1ZK8 A;  2E1O A;  2DN0 A;  1XS9 A;  4B1R A;  2PMZ N;  2M2E A;  1XG1 A;  2Y31 A;  3JRI A;  2LP0 A;  5C3E J;  1IRZ A;  1TWC J;  2XGE A;  1RPW A;  3A03 A;  2LK2 A;  4M3D A;  4DYR A;  3S2D J;  4AC0 A;  3VPR A;  4B3A A;  2EZH A;  5EF6 A;  3HOX J;  1NK2 P;  3BG3 A;  2G0E A;  1OFC X;  3MVP A;  3GTM J;  2E2H J;  2K9S A;  3SFI A;  5EEA A;  1FTZ A;  1A6I A;  1IG7 A;  1TC3 C;  2X48 A;  4XID A;  1I6H J;  5FKM A;  4A3K J;  1AHD P;  1JTX A;  3G1L A;  2NS7 A;  4FE4 A;  3LNQ A;  5F04 A;  1QVT A;  3PM1 A;  2O8K A;  1GV2 A;  9ANT A;  1GVD A;  2R5Z B;  4AYB N;  2DA2 A;  5FKL A;  3QQA A;  5IP7 J;  5EG0 B;  3OOU A;  2AO9 A;  5FKO A;  2NVT J;  1IJW C;  1ETK A;  2R7Z J;  2Y9Y A;  2R5Y A;  2L7M P;  5DS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...