1RR7A

Crystal structure of the middle operon regulator protein of bacteriophage mu
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
94
structure length
94
Chain Sequence
RFPALLAELNDLLRGELSRLGVDPAHSLEIVVAICKHLGGGQVYIPRGQALDSLIRDLRIWNDFNGRNVSELTTRYGVTFNTVYKAIRRMRRLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Middle operon regulator
publication title Crystal structure of the Mor protein of bacteriophage Mu, a member of the Mor/C family of transcription activators.
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 30
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2003-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08765 Mor Mor transcription activator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rr7A02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1rr7A01
3IH4A 1ETWA 2FD5A 2JA5J 5IPAA 4BXXJ 5E3MA 5EG0A 2LFBA 3TP3A 1MBKA 3PO3J 1I3QJ 1F36A 2HXIA 3HOWJ 3D1NI 3M3YJ 2CQXA 1MBHA 3S1RJ 4X1EA 1GV5A 1ETKA 4BY7J 4ABZA 2ID3A 3LOCA 2YU9J 1X2NA 1ZK8A 5HODA 1OCTC 2DA1A 2DN0A 1P7IA 3A02A 2VI6A 3JR9A 1ZGWA 1JT0A 1JT6A 2L0KA 1U78A 5F04A 1IUFA 2O7OA 4A3FJ 1Y1WJ 4JX6A 4UUSA 3E7LA 1ETOA 4A3LJ 2EQRA 3WHBA 3O8HA 2FQ4A 1T56A 1POGA 2YUSA 2R5ZB 1E3OC 2G0EA 2M9HA 1T33A 3BT9A 1XS9A 5GPAA 1WPKA 1DU6A 5DTDA 1U9NA 2XPVA 3Q0UA 2E1OA 3A03A 3HB9A 4FCYA 4FE7A 3CQZJ 3JRFA 3GTPJ 3BQZA 3UKGA 5F27A 3HOZJ 2AO9A 2H1KA 5FKMA 2P81A 2R93J 2DTZA 4M3EA 4LOCA 3HM5A 2IEKA 2L9RA 1I6HJ 3GTJJ 2K9QA 1AKHA 3G1LA 4A69C 5IOYA 1YRNA 1JKPC 2K40A 3G1OA 3S1NJ 1WH7A 3FK6A 5JLXA 3GTOJ 4BBRJ 1RR7A 2X48A 3S17J 2M0CA 4IHWA 1XC5A 1BJZA 3FKIJ 1ETVA 1MH4A 1ENHA 2DA5A 3BQYA 5BNGA 1OJLA 1MSEC 4G12A 3M4OJ 1GVDA 4MLOA 2HDDA 1JUSA 3LSRA 2XB5A 4A3MJ 3LSGA 3HEFA 1VF9A 2CUFA 4V2GA 4DYCA 4DYRA 3ZOBA 4M3GA 5M3FJ 1ORKA 1ITYA 1ZR4A 2DA6A 3HOYJ 2Y9YA 1W0TA 4AYBN 2XGDA 1JKRC 4B4CA 5FJ8J 3Q0WA 3GTLJ 5F1JA 1FIAA 3K2AA 2XRLA 2FJ1A 3HBLA 1LE8B 2DA4A 1QRYA 9ANTA 4AUXA 3HGYA 3IH2A 3JRGA 5EZGA 2X9DA 4A3GJ 1UMQA 1FIPA 1AKHB 1WCMJ 1RKWA 4V2FA 2PMZN 2E2IJ 3BG3A 1JJ8C 3S2DJ 4JP0A 1Z0XA 2AHQA 4A3KJ 3Q3SA 2H8RA 5JLWA 2QF7A 3GTMJ 2EH3A 1BW6A 1JTYA 4BKXA 5M5XJ 3SFIA 2LY9A 2JA6J 4A3BJ 4S0HB 3MN2A 4XRSG 3BR2A 3JREA 2WV1A 1OFCX 4HNVA 1WH5A 2TCTA 5J1UA 1FJLA 2JA8J 3SDGA 5IP9J 5EZHA 2M2EA 4L5EA 1HDDC 3F0CA 4A3JJ 3QPSA 1FEXA 1MH3A 3S14J 3A01A 1EF4A 3I4MJ 1B8IA 1LFBA 1TWAJ 1NK2P 2ELKA 2ID6A 4MFDA 3JRIA 4C3IJ 4DW6A 2E2HJ 2M34A 1G2HA 2HI3A 4AC0A 1PUFA 1Y1VJ 3GBGA 1FTTA 2KDZA 1SANA 4C3HJ 4A3IJ 2R92J 2W48A 1RESA 4CYCA 3RKQA 2QCOA 4NDLA 2OPTA 2TRTA 2NVTJ 2VKEA 5K7HA 2X6OA 2MSYA 4C3JJ 2XB0X 1HF0A 4GFBA 2LLKA 3CCYA 2NOGA 3MKLA 3BR3A 1X2MA 3IH3A 5EG0B 2EZIA 1AHDP 2E19A 4D7MA 1HOMA 2HOSA 1JTXA 3C2BA 3G1MA 3WHCA 2M8GX 1A6IA 3TW6A 1Z77A 1ZR2A 3A01B 4DZPA 2NS8A 2IBDA 2XGCA 3O8GA 2Y31A 4D7NA 1CQTA 4Y7NJ 1S7EA 2VPRA 4FISA 5FLMJ 1R9TJ 3HOXJ 4D5CA 3BTIA 2IAIA 1JUPA 1O4XA 1F43A 2DMQA 1HLVA 1JJ6C 2JK3A 3QQAA 3ZQCA 2NVYJ 1QVUA 5J1RA 1QVTA 4B1RA 4UUSB 5DS9A 2LTPA 1TWGJ 2L7FP 1ZKGA 3S2HJ 4A3EJ 2K9SA 5EGOA 3BR0A 3GTQJ 1SFOJ 3CMYA 1TC3C 3TP0A 3S1QJ 4DYQA 3B6CA 4MFEA 5F0HA 4EEFG 1BA5A 3QPLA 3LSJA 1IDYA 2CUEA 2R5YA 1QPIA 4M3DA 5GPCA 5K7ZA 2MW8A 5F0CA 1XG1A 2I10A 5FKOA 2DMNA 3GTKJ 2K9NA 3BG5A 3I4NJ 3RZDJ 1YRNB 1U9OA 2LR8A 2ME0A 4XIDA 3OOUA 2LVSA 3K7AJ 2R0QC 3RZOJ 4MO7A 4XRSA 5IYCJ 1ETXA 5C4JJ 3S15J 2DA7A 1ETYA 3DEWA 2JJ7A 2O9LA 1VNDA 2GBYA 2Y9ZA 2JA7J 2O8KA 3PM1A 4IHYA 2DMUA 3BTLA 3RQIA 3HOUJ 1H89C 5FKLA 3TEDA 2R7ZJ 3FK7A 2CJJA 1HDPA 4RDUA 3BR1A 5E3LA 2R5ZA 1H88C 1IGNA 1B72A 5E3NA 3BG9A 4W97A 1UG2A 1VFCA 1OCPA 3W6VA 2CU7A 2JMWA 1NK3P 1Q1VA 2VKVA 2Y2ZA 3ZQFA 3SJMA 4B3AA 4Y52J 2JN6A 1RPWA 5FLVA 1JGGA 2ECCA 2EZLA 1K61A 1IC8A 1ETQA 2FX0A 4A93J 1I50J 5IYBJ 1GUUA 2Y30A 3TW7A 4XICA 2EZHA 3VPRA 3L1PA 4IHXA 2DJNA 5E3OA 2NVQJ 1JUMA 4JX5A 2LD5A 1X58A 2LP0A 4IEJA 3OSGA 1MBFA 2JWTA 1BW5A 1IG7A 1TWCJ 2XGEA 5IP7J 4QTRA 3HKZN 2XSDC 1P7JA 5M5WJ 2XPUA 2OF7A 2YS9A 1IRZA 5F0FA 4FTHA 2VUMJ 2DA3A 4JX4A 2HOAA 1HCRA 3NAUA 2ECBA 2DMTA 1TWFJ 3NARA 5C4XJ 3ZQLA 1B72B 5EEAA 1AU7A 1B8IB 1LFUP 3GTGJ 5K7FA 3JRDA 1GV2A 2ZB9A 2DA2A 1MBGA 5IOZA 1FTZA 4J19A 4BBSJ 4MIMA 1IV6A 2B63J 4XRMA 1PUFB 5EF6A 1RKTA 4QIWN 5EDNA 3LSPA 2LKXA 2DMPA 2RAEA 3CDLA 1TWHJ 4UUTA 4M3BA 1LE8A 1MNMC 4IHVA 3HOVJ 3ZQHA 2D5VA 1D5YA 4CYCB 3BR5A 3S16J 1NTCA 4M3FA 4M6VA 2ME6A 3FISA 2Y0SN 1DU0A 3S1MJ 1JKOC 3HDDA 1H8AC 4DZJA 3JRBA 2KT0A 3LNQA 3B6AA 1WI3A 1U8BA 1UHSA 1K83J 4A3DJ 3BTCA 2CQQA 3PO2J 3DCFA 2E2JJ 3HGGA 3ZQIA 2HXOA 2L7ZA 4I76A 5M3MJ 4QSHA 2NS7A 1MSFC 5FKKA 2EZKA 2WB1N 2WAQN 5M5YJ 1A5JA 1APLC 5IP6A 1W0UA 5IYDJ 5GP9A 2CRGA 1VI0A 2MGQA 1JKQC 5EYRA 3JRAA 4FE4A 3H3VK 1RETA 1ZTRA 3IV5A 2GM4A 4C2MJ 1BL0A 3OIOA 4I6ZA 4JYKA 5J3LA 4X6AJ 3BR6A 2N8GA 5C44J 2L7MP 4A3CJ 3H0GJ 4BY1J 1MBJA 4D5FA 5J1YA 2GLOA 2MG4A 5EGOB 2EBIA 3FIWA 4RBOA 3JRCA 5C3EJ 3BTJA 3JRHA 3MVPA 2COBA 2XPWA 2HOTA 5F08A 1MBEA 2NVXJ 5FKNA 3ZQGA 4W1UA 2R5YB 1IJWC 2HQ5A 4XK4A 1WGXA 1GT0C 2HYJA 1ZQ3P 1GDTA 2LK2A 1IDZA 3OSFA 3Q0VA
chains in the Genus database with same CATH superfamily
5E3MA 3I5UA 4RAFA 1K7AA 3LSKA 2LFBA 2UV1A 3CCQI 2O8XA 4GRIA 1L3LA 3OYJA 5IT9K 3OWTA 1F36A 3HJEA 3OL3A 5CQGA 3HOWJ 1MJBA 2GAUA 2HKOA 4B47A 4XORA 2DT5A 1H9TA 1V5GA 4PFPA 1BOBA 2KFDA 3PQJA 2HEOA 3LOCA 1V3FA 2DA1A 2DN0A 1IRFA 2P8TA 5DCFA 1JT6A 2W4SA 2D45A 1XSXA 2L0KA 1VQMI 2LG4A 2WBMA 4Q5SF 1WJBA 5F04A 1WJ5A 1LDJA 3KEOA 5HS8A 1ETOA 2EQRA 1ULYA 3DV8A 4BE1A 2FQ4A 1ZHFA 4LIVA 2JUGA 3I4PA 3L2WA 1X1DA 2KZGA 4E7KA 5E8IA 5DTDA 1U9NA 4XONA 3Q0UA 4ENNA 5CVUA 1LQ1A 3GXOA 1AOYA 4IF4A 3HYIA 3HB9A 2LYCA 2EFWA 3GTPJ 3AL0C 1FSEA 3CZ6A 3UKGA 5F27A 4UVAA 3HOZJ 2H1KA 4OIOF 1G3YA 3I71A 5FKMA 3FX3A 2R93J 2BY1A 5L3CA 3CESA 1X3UA 3MKZA 4LOCA 2IEKA 3P9CA 4XSXF 1ZREA 5CLSA 2NS0A 4M6YA 4P55A 3QWLA 2O03A 2Y48A 2F5CA 2IS6A 4A69C 2ZJ2A 2FMLA 3QRFF 2VXZA 4AU7A 1WH7A 3FK6A 3LAJA 2IGOA 1MJAA 3GTOJ 3IRRA 2FE3A 3VSLA 2MYSA 4BHBA 5IY5H 5L3GA 3HRSA 1ETVA 1ENHA 2DA5A 4L9JA 3J80K 1OJLA 2Z3YA 1MSEC 1HC8A 3M4OJ 1GVDA 4N4NB 2JSPA 4PJNA 4CO8A 4IXAA 4LLGF 3K4BA 3TOAA 3LSGA 3HEFA 3S3OA 3LA2A 2VT3A 5B1BH 4WCGA 5BMZA 4DYRA 4R1HA 1S8NA 3DLAA 2FBKA 4M3GA 5M3FJ 5KNLA 2XKOA 1ITYA 4Y13A 2OBPA 4LFUA 2ZNYA 3DKXA 1JKRC 4AYBN 1IN7A 4I0BA 1WVRA 4IRIA 4NQWA 3LMMA 3K2AA 1Z21A 1W36D 3GW2A 2ZC2A 4MQVA 3C2GA 3V7CA 5EZGA 2Q2EB 2HKXA 3FWEA 1FIPA 3VB2A 1WCMJ 5DM6F 3S3MA 1BJAA 3OV8A 4RM2A 2ACJA 3BZCA 3R61A 2F4OB 3S2DJ 2KZVA 1Z0XA 2AHQA 3WE2A 3TQNA 2QYOA 1E2XA 3F22A 1JHHA 3GTMJ 3DU6A 2JA6J 1JTYA 3SFIA 4PUSA 1H0MA 4XRSG 3JREA 3BR2A 2WV1A 1LB2A 3F8MA 1F5TA 5HLTA 1LUJB 1T98A 2NNNA 1WH5A 4RAYA 2W82A 1FJLA 2F5VA 2P5KA 3SDGA 4YG2F 1R22A 1ZG3A 3MAJA 2M2EA 3FZVA 3RI4A 1K4SA 3D5RC 3IKTA 3QPSA 2VLAA 1Y0NA 1MH3A 1OYYA 1FWZA 4KIFA 1L0OC 3S14J 1EF4A 2X0LA 4RA2A 3OS2A 2FNPA 2STTA 1RZ4A 1TWAJ 5FGMA 2ELKA 2VJ5A 2ID6A 2RREA 5LHGA 4HSTA 4PZJA 4L0YB 1PUFA 4UV8A 4P9FA 4ENMA 3DTIA 3GBGA 1Z05A 2XF7A 5HDKA 4C3HJ 3RPUD 1D1AA 4HZFA 3DBRB 5ILUA 2R92J 1VTNC 5FROA 1A31A 1Y0UA 1BIAA 2E1NA 2WB1A 2XRNA 5EEGA 3OYNA 3IWZA 2E1MC 3HUGA 1D1CA 4PSWA 2X6OA 2CSOA 5TISC 2OQRA 1R4NB 2VC0A 3M1EA 1M1EB 3CCYA 3SFZA 3MKLA 1UCRA 5ERIA 5L3BA 1Q1HA 1UZCA 3OYDA 3WG7H 3MCZA 3DBHB 4D7MA 1HOMA 2OTJI 2YR2A 2HOSA 4I98B 2JUCA 3QOPA 4BAYA 1ZR2A 4IRHA 3A01B 4P96A 2HGCA 4D7NA 1Y6IA 4KA4A 3Q5FA 4Y7NJ 3CP8A 3CC2I 3ROUA 2VPRA 2DK5A 2KRHA 2LY2A 1ODDA 2BXYA 1LFPA 3RPUA 1X4PA 2BHZA 1HLVA 1HW1A 3ABMH 3BJAA 2CWEA 1MMAA 1LDDA 2NVYJ 2RV8A 1QVTA 3HRMA 3IP4B 3KP6A 5DD4A 3ZXSA 5LGNA 5J1RA 5DS9A 1DPUA 1TWGJ 4A3EJ 3F6OA 3I64A 4CYDA 2VODA 3AG1H 1XMKA 3BR0A 3GF2A 5LHIA 3GTQJ 3OYHA 2BV6A 3PNVA 3U9GA 5CVIA 1VZ0A 1K78B 2BY0A 1DPRA 4ZZDA 4RGXA 4CXFA 1SVMA 1FP1D 2M8EA 1QPIA 1IDYA 1BI3A 1LKXA 2CUEA 2DOAA 2PJRB 3PIPF 4M3DA 1O3SA 2VBYA 3E5UA 3K2ZA 4HG2A 1WJCA 2I10A 5FKOA 4ESFA 4G8XA 4I99C 3GTKJ 5H20A 2CQ7A 2DO7A 4LMYA 4XL9A 1QQIA 1UHWA 2LR8A 3A0HC 5DM7F 1ZLKA 4R79A 3WG9A 3CCLI 1RRJA 1DP7P 5IYCJ 1EH7A 2QLZA 3CUQC 3S15J 2CV2A 2GZWA 2FBHA 4IKFA 3BY6A 1N77A 3CTAA 4LB6B 2GBYA 3K1PA 2OZ6A 2QGUA 3ZMVA 4AVZA 3DXJF 4RM3A 4NB5A 1MIJA 3BTLA 3WTXC 3MQ0A 1SFUA 1F1ZA 3EYIA 1H89C 2D1HA 3CC4I 1REPC 2AXTC 1XGSA 1XN7A 2KDOA 2ISZA 2CJJA 2EK5A 3DQVC 1B72A 2OAZA 1V5EA 1R58A 1XD7A 1FMVA 1XMXA 2CV1A 2ZKZA 1VFCA 4G7HF 2HS5A 3SZTA 1Q1VA 3ZQFA 3SJMA 3IKVA 3J7AO 1FLIA 1S6LA 2MC4A 4P1WA 4WX9A 1I39A 1MW7A 3DKYA 3GMEA 4ZYGA 1IC8A 1ETQA 4V19K 2FX0A 1WWXA 5GAHJ 5JFRA 4XLNF 3TW7A 3K4MA 2LDUA 3ABKH 1R5HA 1IF1A 3KX2A 2E7XA 2LP0A 2Z2SB 4IEJA 2IA2A 2HVSA 5FD5A 1ZN2A 4A0YA 3ZMSA 4HX4A 1O7LA 4E7IA 1S29A 4CGZA 4IX7A 1BW5A 1D0ZA 1IG7A 3I59B 5D4RA 4GYIA 3KP2A 1YIJI 1S7OA 2V4JC 4I7HA 1YE9A 4HA8A 2H8WA 1U0JA 2ZJRF 5EJCA 3HKZN 3M7GA 2XSDC 5M5WJ 1XGNA 5FFXA 2XPUA 2YS9A 5F0FA 3OIQA 1OYIA 3CCSI 2DA3A 2VPLA 2K9MA 3DKWA 3NARA 4Y15A 3E6MA 3QPTA 1P2FA 1RI7A 2W24A 1R00A 3GTGJ 1J7KA 5IOZA 2ZB9A 2KISA 3VYUB 2PMZA 1BI0A 1H9GA 3LSTA 3FM5A 1USSA 4A5MA 4ZDOA 4K2EA 2XHKA 2JTVA 2LSOA 3CDLA 4UUTA 1T8IA 3E6BA 3KP3A 5FD6A 2D5VA 2K3PA 1FSHA 1D5YA 2BW3B 4M71A 1X1CA 2KRFA 2Q2EA 3FISA 2Y0SN 3FHNA 3PNTA 4EVIA 1DU0A 1JKOC 5E8GA 2AQEA 2A07F 3K4NA 3QP5A 4YELA 2WV0A 2XIGA 2ZJPF 3TDZC 4HV5A 1G59A 1R4MB 2LKPA 1UHSA 1U8BA 2AQFA 3KIOA 1K83J 2W00A 3UR3C 2DYRH 4PFOA 2Q8KA 4EQQA 5B1AH 2CQQA 2ZBKA 2HTSA 2E2JJ 2HXOA 5KK1A 5LRSA 4U88A 2EA4A 4I76A 5M3MJ 4UVBA 2VBWA 4QSHA 3GYHX 3JTHA 1B6AA 1SFXA 4BQAA 2HDWA 2XF6A 4CUGA 4ETSA 1APLC 3HTSB 2DDBA 2M45A 1QU3A 3S32A 1W0UA 3W3CA 1YW7A 1FYMA 1VI0A 2MGQA 2P6TA 4FE4A 1RETA 4NBQA 3CC7I 3IV5A 1MKMA 2GM4A 2YSRA 3OIOA 3RYPA 4I6ZA 3CCEI 2N8GA 4OWRB 2JA2A 3FXMA 1ON2A 4N9HA 3K69A 4LIUA 4NNJA 2EILH 1EJ9A 4IOAF 3H92A 1MBJA 5F1RA 3J81Z 3R6SA 1U5TC 3BROA 4I01A 3JRCA 3JRHA 2ZO4A 5ICGA 3MVPA 3CLQA 5F08A 2EV0A 1RIOH 2K4BA 2F48A 3GO5A 4OU0A 4XK4A 1GT0C 1O3QA 1TP4A 4MGRA 1FPQA 1HW2A 2A6EF 1IDZA 2HQNA 3Q0VA 3IH4A 1ETWA 4JK1X 3KYLA 2R7DA 5IPAA 1YHQI 4BXXJ 3ASOH 3QYEA 4B43A 3ZPLA 1FBUA 2QENA 3HOSA 4KFCA 3LA3A 2PMHA 3O2PE 3T1BA 5LLQA 1KYWA 1I3QJ 4LK1F 2VQHA 1WQ2A 3W2AA 4BNCA 2GQQA 4FX4A 3M3YJ 4LD5A 3WTUC 5FO5A 1WJDA 3S1RJ 1GV5A 3QYBA 4PJMA 4WXDA 4ABZA 1K79A 1ZK8A 5HODA 3A02A 2VI6A 3U1KA 4QPQA 3R0JA 4GXOA 1U78A 1IUFA 1Y1WJ 1YG2A 4IOCF 2EV5A 3H9JA 1OPCA 3WHBA 4OMYA 1BM9A 1VQPI 1T56A 2L9NA 4UNOA 3KYCB 4L0ZB 2M5WA 2R5ZB 1E3OC 2M9HA 1S9HA 3BT9A 3QYFA 1KQ0A 5GPAA 3SZGA 1K78A 3VYSB 1QZEA 2B7EA 2XPVA 3FF5A 2PJRA 2D1VA 1UFMA 2OC6A 3I53A 5ILVA 4FE7A 1YFHA 4RLFA 3JRFA 2W25A 2KKOA 3C1DA 5L3DA 4M3EA 1PP7U 3EYYA 2VB6A 3PSFA 3O3KA 1I6XA 1ZLJA 4G6QA 2KL4A 1I6HJ 3GTJJ 4CA0A 4X0GA 1OQYA 5HNHA 2HFHA 1JKPC 2CGPA 3BPVA 3LQRA 2RQQA 5JLXA 4BBRJ 1QA6A 4WF2A 1GLNA 1SD6A 3W2WA 3S17J 1W7PB 3OYEA 1BJZA 2PQ8A 3CCRI 1LVKA 3FKIJ 3V7SA 2EA2A 3IUOA 4CCJA 3BQYA 3COAC 5BNGA 3LSIA 4G12A 4YIRX 4MLOA 1FX7A 4JQFA 2HDDA 1JUSA 4EJUA 3LSRA 2P4WA 4LG3A 2WAFA 1J0RA 1TQPA 5DDGA 4A0ZA 2VKDA 3Q9SA 2CUFA 3C18A 4V2GA 4D0PA 5B66C 3CCJI 4XNFA 4ANJA 4M6XA 2DA6A 1YJNI 2ICWG 5K5OA 4FHTA 3HOYJ 4HLXA 2XGDA 1T2KA 4B4CA 3CLOA 3VFZA 3GTLJ 5F1JA 3AG3H 1FIAA 2NRAC 2H6CA 2FJ1A 2XAHA 3HBLA 1LE8B 2DA4A 1D3YA 3H1CA 1G3TA 4AUXA 2GIVA 1IAWA 3GFIA 4MNUA 4I02A 2FBIA 2V9PA 3I3LA 4ZDLA 2LNBA 1YW9A 1AKHB 1NG6A 1RNLA 1TQMA 1A6QA 3E5QA 3BJ6A 5A2QZ 1TL8A 3BG3A 4MQ9F 2VQLA 2XV4S 2W1OA 3H3ZA 1VQ8I 4A3KJ 3F8NA 1HW5A 4XLEA 1X3WB 1N25A 1TT0A 3DLLF 1E17A 2QF7A 2X1DA 3BJOA 3JTGA 2EH3A 5M5XJ 4BKXA 2OZUA 5DYMA 3SZPA 2VIXA 3MN2A 1R6RA 2ELJA 1T95A 3FXJA 1IRXA 1OFCX 2E35A 4D9JA 2QZ8A 2L9SA 4YFKF 5J1UA 4B48A 3HHHA 3RQ4A 1S72I 2CQNA 3LSHA 1HDDC 4ZYAA 2PG4A 4QLCU 3J81K 4A3JJ 4LB5A 3PNYA 5LFAA 2TDXA 4DOZA 4UV9A 4E7HA 1NK2P 4I2OA 3JRIA 1OR7C 2M34A 3AKZA 1FBSA 1G2HA 2M4GA 4XLFA 5HS9A 2HI3A 4OIRF 3RYRA 4AM3A 1WSUA 2PFBA 1XCVA 3OY9A 4NUBA 1DP3A 1EV7A 2O5RA 3CJTB 1CF7A 2QA4I 4RB0A 2BW3A 5IT3A 2QCOA 1TBXA 1RUOA 3KZZA 1YI2I 3ABLH 5ICCA 2TRTA 2VT2A 1NH3A 3WGHA 2Y0MA 2FUG2 5KCMA 4AD9A 4C3JJ 1P6RA 2XB0X 3HSEA 2IJLA 3E5XA 2CV0A 2OQGA 1AA7A 2LLKA 2NOGA 2ZSIB 3DEEA 3BR3A 4IVNA 5EG0B 2HYFA 3PQKA 4E7LA 2K4JA 4AWXB 5D5WB 3GLLA 2HVRA 1FY7A 5L3FA 2EB7A 2A6TA 1SD7A 2BEOA 1PDNC 1JTXA 3G1MA 4ZYEA 1MGTA 3P7NA 3DU5A 3BOQA 1K6OA 3S93A 1I5ZA 2XGCA 1ZAOA 1QHGA 1TT5B 2E7WA 2FQ3A 5FLMJ 2MABA 4IRGA 4Z2YA 4KUMA 3KP7A 2RGVA 4WWCA 2F5FA 2HNHA 3I0TA 4E7JA 2GA1A 2K86A 2ZXIA 5CVRA 3EQLF 3L7WA 3MKWB 4GCVA 2QEXI 3X2QH 1X19A 1VQOI 1WKMA 1QVUA 4UUSB 5D4SA 1Z6RA 1PYVA 3AFHA 2BE5F 5BPIA 2PEXA 3H3UA 2L54A 4HPQA 2Y69H 1TC3C 2FMYA 3TP0A 3OYBA 3GFMA 3S1QJ 2DODA 2MLKA 3N97A 4L5JA 1BA5A 3LSJA 1W1WE 2NAZA 3CDIA 4E7ZA 5DV5A 5GPCA 4EM1A 2XAGA 1R5GA 3LL7A 1R1TA 5E17F 1TNTA 4CZCA 2A6HF 3WTWC 4IZZA 2GIZA 1C0WA 3BWGA 2HDCA 1XGOA 3BG5A 1W4MA 2XF5A 2ZXWH 1SMTA 2G9WA 3WTSC 2YPRA 4OIPF 1U9OA 4XIDA 3K10A 4HF1A 2LVSA 3L9FA 3PUBA 2OUMA 2VJ4A 3MFKA 5C4JJ 4ZTJA 3JSOA 1VQKI 2MH2A 4Q47A 3CO7C 3PFIA 2L2OA 2Q1ZB 1ETYA 3DEWA 4WK8F 3U1DA 2Z9OA 3JAMZ 2Y9ZA 3REOA 4ENKA 4ZH4F 2O8KA 1T0FC 4PJ0C 3V42A 1DGRM 4XBFA 4Y4RA 1MDMA 2ZMEB 1W7PD 1KONA 3D0SA 2PN6A 1IZ1A 4O5VA 5FFZA 2HOEA 2VONA 4B09A 5FKLA 2VQCA 2Z16A 3TEDA 2R7ZJ 1G8XA 5A2QK 2O61A 1HDPA 2R5ZA 1IGNA 2HZTA 1H88C 1RUNA 2KP6A 2WY8Q 4RMNA 5B5EC 3BG9A 4PGHA 4W97A 1YS7A 2CW8A 3K4JA 1UG2A 3IC7A 5FLXK 2EFNA 2CU7A 2QBYB 2JMWA 4S05A 1NK3P 1MNEA 2QUFA 1Y8RB 1PJRA 3MZYA 1HKQA 3OYLA 3FHZA 1JGGA 1ZELA 1X3ZB 2ECCA 4JBAA 4AVPA 3AG2H 2FA5A 4A93J 3MZHA 1FOKA 4BQNA 2GWRA 3EPZA 2Y30A 3KP4A 2WTEA 4O3MA 4IHXA 5E3OA 1HSJA 2LH9A 2KJBA 4BS9A 1YJWI 2D2WA 3H35A 1MBFA 5KVRA 4XLHA 5IP7J 1W7PA 4G94A 2V1UA 1FZPB 3R0AA 1P4WA 4AYBA 4F7ZA 4HQEA 2MD0A 1UJ8A 3EUAA 1IRZA 2F4IA 1HCRA 2R7OA 1LVAA 3RIRA 2DQLA 2X6XA 3WE3A 3WU2C 1FNNA 2DJIA 2MLGA 1LFUP 3K70C 3JRDA 4HDVA 1FTZA 5HOOA 4J19A 4BBSJ 4MIMA 3DPUA 2ZXJA 1IV6A 2OTLI 2B63J 5DEQA 3IAM2 5EF6A 4QIWN 2L3DA 5E1XA 2DMPA 2RAEA 1LE8A 4XLCA 3HOVJ 4IHVA 3AG4H 1Z6TA 1UHMA 4CYCB 2IS4A 3S16J 2EIMH 3GX4X 1NTCA 3TDUC 1YOVB 2M7AA 1ERDA 4M6VA 1FOYA 2Z1DA 4HX8A 2VOPA 2LKSA 4DZJA 3JRBA 2GXAA 3H9QA 4IHTA 1WHUA 3H36A 1FT9A 3B6AA 4MEXF 3AL0B 3TOBA 2V6EA 5J40A 2F4MB 2V1DA 3WU1B 2KRCA 3BTCA 4DNCA 4EGZA 1AWCA 4DBRA 3LSMA 5E79C 2L7ZA 2QSFX 3RCOA 1XB4A 2KIFA 2XDVA 1YO5C 4DBQA 4F52A 1W5CC 1BR2A 2WAQN 2H1LA 1A5JA 4XOPA 5AIQA 2GOXB 4CHUA 5IP6A 5FB2A 2J5OA 2M7BA 1SFEA 4BE0A 1P4AA 2K7LA 3M07A 4WXCA 2IXSA 3B02A 3ULQB 1ZTRA 2BOLA 3HIFA 4C2MJ 2HWVA 5J3LA 4UY8I 1KZHA 5C44J 2PX9A 4BY1J 2CFXA 4ASNA 2P5LC 2BXZA 4IJAA 2A5YB 1WJEA 4D5FA 1USTA 4L5IA 2GLOA 1KU9A 2MG4A 4XSZF 3V8JA 5EGOB 1D1BA 5H2FC 4OINF 4XLPF 3GFJA 3K9TA 3CJNA 4UHTA 2XPWA 2CG4A 2HOTA 2ELHA 3I9V2 1HQCA 2CW7A 4HF0A 1G3SA 1VQ5I 4XKCA 3NQOA 1Z3XA 3CO6C 4E6KG 2VBXA 1ZQ3P 3OYIA 3VDXA 1P92A 2LF8A 2LK2A 3G73A 1R7JA 1GDTA 3K6GA 2FD5A 3LFKA 3FXUA 4BJ6C 5CYVA 2FEZA 5EG0A 3GEZA 3W2VA 3TP3A 4ESJA 3JAMK 1SAUA 3W6KB 1MBKA 2DDAA 3QAHA 3ZN0A 2QQ9A 2KMUA 4G6DA 3WTYC 1K4TA 1IV8A 2MFZA 2R4GA 4HV6A 5D8KB 4EATA 5HNFA 2HXIA 2HR3A 3ASNH 2OU2A 4XM3A 4XRFA 4X1EA 4M73A 1ETKA 4BY7J 2YU9J 3ZP5A 1OCTC 3LAPA 3H9GA 3EDPA 4OMZA 4HNUA 1ZGWA 1W36C 3A0BC 2KIMA 5D5XB 1S5LC 4PCQA 4F55A 3OYFA 1JT0A 3CMAI 2NNYA 1HKTA 3A2KA 5BPDA 2O7OA 3F6VA 4UUSA 5LEKA 2DLLA 2DT7B 2K85A 4M9SA 5JR3A 4A3LJ 3O8HA 2LY1A 2YUSA 4XR6A 1IN4A 3WTVC 2NOJB 1FYLA 4QPOA 4BQOA 4LK0F 4BUPA 1T33A 1FMWA 1XS9A 1WPKA 2P5VA 1YITI 1DU6A 3F21A 5K5QA 3VYTB 3WTZA 4KIGA 4Y3OA 1XDUA 3CD6I 4FCYA 3FKJA 3BQZA 1ZARA 2DQRA 2AO9A 3L2RA 2DOEA 3ZMDA 1D8KA 2E5NA 2P81A 1F9NA 2A3SA 4LG0B 2DTZA 2E1MB 4CCMA 3QP6A 3HM5A 3G4SI 2L9RA 5D5VB 4E70A 2IA0A 3BC8A 3HPGA 2ESHA 3LWFA 2K40A 2DT6A 3O6BB 4PSXA 1RR7A 2X48A 1YQAA 2M0CA 3K1MA 3KFWX 4NC8A 1MH4A 4L9TA 5HLGA 2MBFA 2JRTA 2NVUB 1YYVA 4A3MJ 3IAS2 4RB1A 1HBXG 3QU6A 4RB2C 2ZMEA 2PJPA 4XN3A 2V79A 2VQGA 4BXUA 3ZN1A 4DYCA 2ZCWA 1PUEE 1FOWA 1MMSA 4EGYA 4MHGA 1ORKA 1ZR4A 3BP8A 2Y9YA 5FJ8J 1I1SA 3Q0WA 1BI1A 3K4CA 1IN5A 4BYYA 2QM3A 4ZTFA 4HX7A 1KA8A 1J2XA 2WY7Q 3LFUA 4BDYA 2QBYA 3HRTA 2V7FA 3HGYA 2QQAA 4A6EA 1I3AA 1P4XA 3JRGA 3H0DA 4XKWA 4Y17A 4KIBA 3OIPA 3F9KA 4D1QA 2X9DA 4A3GJ 3EUHA 3JCUC 1RKWA 2E2IJ 3R60A 3HKZA 2VC1A 5LGUA 1OCRH 3OMYA 4KDPA 1ZYRF 3Q3SA 2H8RA 4HOBA 3G71I 2JVHA 4TV7A 5JLWA 1SC7A 2H27A 1BW6A 3KLOA 3C7JA 2LY9A 5LEJA 4S0HB 3HHGA 1S7AA 4CDGA 1IO2A 1LDKB 2DPDA 4CCLA 4HNVA 3NWSA 3PSIA 3WU0A 2LOOA 5J47A 4OAZA 4EMSA 5IP9J 2O6GE 1XX5A 2L01A 1TQIA 1Z67A 4F91B 2E5ZA 3F0CA 2KPMA 5L3EA 5EEHA 4FETA 3CUQB 3ESWB 5J4YA 3A01A 2F2EA 2JRMA 3I4MJ 3ZQ7A 3L09A 4JOMA 2Y0SA 1GVJA 1I1GA 3F8BA 2RVCA 4MFDA 4C3IJ 1OISA 1BOAA 4MTDA 4AC0A 1Y1VJ 2P7CB 1DUXC 3FBNB 4A6DA 1D0XA 2KDZA 2EFQA 3JW4A 4BL0B 3ABTA 2BBYA 4A3IJ 2W48A 1RESA 2X1CA 4CYCA 3RKQA 3A1YA 3HXLA 2H6BA 3KPHA 4XMYA 1XSDA 2KJCA 4NDLA 2R7RA 4MEYF 1KU3A 2VKEA 2OJED 5K7HA 2ZXHA 3ZCOA 4IQJA 2MSYA 4BQQA 4L18B 2GXGA 2LF7A 2DW4A 3M9AA 5ED4A 1X2MA 2P6SA 4EM2A 4CCNA 3TL4X 2EZIA 4OIQF 3RPQA 4ZYHA 2F6CA 4RAZA 4BGDA 3K4LA 1OKRA 2Y75A 2E19A 4M72A 1B1BA 3KCCA 2L02A 4BJ5C 1SD4A 1OLTA 3WHCA 2M8GX 1A6IA 2XAUA 3TW6A 2EIJH 3GZNB 1SD5A 3RJPA 1R23A 2NS8A 3O8GA 3OYCA 3G6EI 3AAFA 2K9LA 2EINH 3IHUA 1R9TJ 1XTAA 2BHYA 2IAIA 1JUPA 2XAFA 4L9VA 3T8RA 3CMEI 3R4KA 2DMQA 5D6EA 1DQUA 2JK3A 3ZQCA 1JJ6C 2R3SA 2K5CA 5BOXA 2IS1A 4YFXF 4U7DA 1JI8A 2VL8A 3ZRGA 2LTPA 3SXYA 2L7FP 4OOIA 3S2HJ 3DWLE 4PGGA 2K9SA 2XGXA 2BVMA 5EGOA 3HG9A 3HOTA 1SFOJ 3F8CA 4GGGA 4IPAA 5ILSA 3CMYA 5FRMA 4DYQA 3L2CA 1MD0A 3KEQA 4E4HA 5F0HA 4EEFG 2FXAA 3V8KA 2RC4A 2VOOA 2LREA 3QPLA 4U0YA 3SQNA 3U2RA 3S2WA 2WWYA 3ZGKA 3GLXA 1P9QC 3DBLB 5K7ZA 4EJWA 1LEBA 2MW8A 4Z6YA 3IRQA 1T38A 2V26A 2WADA 1F4KA 4RLQA 5AIPA 1QZZA 4BHPA 3KYDB 5JVGF 1LPQA 2DFIA 2ZFWA 3M8FA 3KZYA 3I4NJ 2IA1A 1KQ8A 1YRNB 4CICA 2ME0A 4XN0A 2VKHA 5DD8A 4CCOA 3K7AJ 2R0QC 2BYVE 3DF8A 4QWQA 3RZOJ 1WRJA 1FOXA 4GO1A 5HDGA 2IPQX 3MKYB 5JVTA 3ECOA 1VQ7I 2UUZA 2DA7A 1D8JA 1B4AA 2JJ7A 1SVLA 1VNDA 3I59A 3ZMTA 2L7KA 4B44A 3PM1A 1BN5A 2K3FA 1X4OA 4I0AA 5J8CA 2FU4A 4IHYA 3BZ6A 4BH9A 3D5SC 2JZYA 1EKEA 4CZZA 2DMUA 3OYMA 2IRFG 2W7NA 3HOUJ 2VASA 1JHFA 3CP2A 1J75A 3BCAA 4RDUA 5E3LA 2C6YA 1BR1A 3QU3A 2EPFA 4HNTA 1ZG1A 1O3TA 2UWMA 4XOTA 3W6VA 1U5TB 4M9XA 2VKVA 3KEYA 4NC6A 5D6FA 4Y52J 2K02A 2VBZA 1HXDA 5FLVA 2CS3A 2L5QA 2EZLA 4XKBA 2LRDA 1DDNA 4IHSA 5DUKA 4EV0A 2M1BA 4LG0A 2UXXA 1I50J 4FASD 4XICA 3DP7A 2EZHA 4IL6C 3FMRA 1B9NA 3T5XA 1T08B 2XROA 2NVQJ 2COMA 1JUMA 2E60A 4JX5A 5KAIC 1A36A 2DCEA 3OYGA 3JSPA 3OSGA 2DPUA 3TMOA 2JVGA 2HQAA 2V1NA 3I54A 4YEJA 2CH0A 2WA0A 1IN6A 4R8HA 1TWCJ 4AIKA 2VE8A 3U21A 1FYKA 4U87A 3GVAA 1U6GA 1R1UA 1BIBA 2CUZA 2QQ8A 2WC2A 1PVEA 3H5RA 2VUMJ 3OL4A 2HOAA 4JX4A 4LJZF 3NAUA 4F3QA 1BR4A 3HPHA 4PDKA 1TWFJ 3I55I 5C4XJ 3ZQLA 2FNAA 1B72B 3A4CA 5EEAA 1B8IB 3OR1C 5ICEA 5K7FA 1GV2A 2DA2A 2L4MA 4DIQA 1OMIA 3DTEA 2QVOA 4XRMA 3E3VA 3PFYA 2H09A 3LSPA 2A05A 4J00A 4II3A 5BS6A 1MNMC 3ZQHA 3PUFA 2HVQA 5F6FA 1WFXA 5DUIA 1J09A 3M8JA 3BR5A 2XC7A 2ESNA 5E1ZB 3ZMUA 4M3FA 2ME6A 2ZJQF 2EJRA 5LD2C 3S1MJ 3HDDA 4L9NA 3CCVI 2P0WA 2IVMA 3ERED 3N05A 1R1VA 4EJOA 2MD5A 2KT0A 3LNQA 2HPIA 1WI3A 1UELB 2XSJC 1VQLI 1T6SA 3FDYA 4A3DJ 4XQFA 5CPRB 1FC3A 2XASA 3OS0A 3CUOA 3PO2J 1R5ID 2CO5A 1V54H 2IT0A 4U7BA 4RAGA 4UB6C 4FT8A 2O0YA 5FKKA 1MSFC 5GADJ 2EZKA 3CMMA 2WB1N 2QSGX 3TO7A 2R7UA 3FXLA 2HPMA 1TZLA 3CJRB 1MMDA 2DFEA 2JSCA 5J6XA 3GFLA 4BE2A 5GP9A 3CUQA 1IUYA 1FBQA 2CRGA 5EYRA 3JRAA 3H3VK 2V6CA 5DCMB 4A0XA 1BL0A 1MNDA 2NXNB 4JYKA 2QSHX 4ITVA 1G4DA 4X6AJ 2M4KA 1X1BA 3BDDA 2Q0OA 4Q4ZF 1G3WA 2L7MP 4A3CJ 2A5WA 3GZ5A 1OCZH 2PLYA 4G7ZF 3J7ZI 1LJ9A 4BDZA 2QQBA 2J5PA 3RDIA 3GZ6A 3E0JB 2EBIA 2E71A 3FIWA 3I56I 5K1YA 5CJ9A 3M8EA 1HSTA 2ZNZA 3F3XA 5CQEA 1PP8F 4UUVA 1MBEA 1ZGAA 3FXKA 5FKNA 3VWBA 2X1EA 3ZQGA 4W1UA 2R5YB 4O6JA 2XKPA 3HRUA 2HQ5A 1WGXA 1ZGJA 2M3AA 3H5AA 3IWFA 2EWNA 2Z33A 1UG0A 1SFKA 1ON1A 2L4AA 1QZYA 5JHUA 2JA5J 3L2VA 4HSRA 1S3JA 4E7SA 4UB8C 3FMSA 3PO3J 2HQRA 2MA3A 1HKSA 2DYSH 5HLHA 1ZRCA 2CQKA 3D1NI 4IQ4A 2CQXA 2EFOA 4BU2A 4Y33A 1LEAA 4FQGA 1MBHA 1EH6A 4FX0A 4HEA2 4KYWA 3K1NA 3P9IA 2ID3A 3VODA 4ESBA 1X2NA 4C2UA 3T8TA 1P7IA 1E3PA 2KIQA 1YX3A 4GYGA 3LA7A 3JR9A 4UVCA 1KGSA 1GHCA 1ZH5A 3TKYA 1J5YA 5GTHC 2FSWA 2X85A 4A3FJ 4JX6A 1ACIA 2CYYA 3DPTA 3E7LA 2BGCA 4LLLA 3ABUA 2OD5A 1K6YA 4PJJA 3KZIC 1POGA 3UNGC 3RKXA 4KITB 2IP2A 2G0EA 2M0MA 5HDNA 1RR8C 2Z99A 4HQMA 4EJVA 2E1OA 3PJRA 2RN7A 2JPCA 3MD2A 3A03A 2KHMA 2B0LA 2WAEA 5FRNA 2LBFB 2M30A 3CQZJ 1B59A 1BC7C 1NHAA 3DPLC 3BZKA 1O57A 1MZBA 2X4HA 3CDHA 2BZTA 1SMYF 3MZ8A 2QWWA 2W57A 1Z7LA 1QHHD 4RB3C 2DK8A 2K9QA 1AKHA 3ZMZA 3G1LA 1U2WA 2E1CA 5IOYA 1YRNA 2R7SA 3RSNA 3G1OA 3S1NJ 2V1XA 2LC2A 2A61A 1QNTA 1G6NA 3N4MA 3NWTA 4IHWA 2RNGA 1XC5A 3NEUA 4AIHA 2UZKA 3VEPA 3WGIA 4HW0A 2ETHA 2CW0F 1YW8A 4OAYA 2VXDA 1KU7A 4N9IA 1IXCA 2I8DA 2RQPA 1TTYA 2XB5A 2XUBA 3FBIB 4DQ2A 3RKWA 1R71A 3K0LA 4AIJA 2HYGD 1VF9A 1R49A 5LBQA 4KMUX 4C2TA 3ZOBA 2MC3A 5LGTA 5TRDA 4M9ZA 3D5LA 3G2BA 3NRVA 3FXRA 1XPXA 5D5UB 3LQQA 1W0TA 1WZ2A 2YU3A 1V5FA 2XRLA 4YIFA 1O7FA 4GDFA 1QRYA 3GUDA 2RDPA 3SEQA 3L2QA 2STWA 1U5TA 3ZQQA 9ANTA 4G7OF 1IXRC 3IH2A 2R7FA 2YX7A 3TO9A 2R7WA 1UMQA 4BXFA 1Z3YA 4V2FA 2PMZN 1KQ9A 1QGPA 1JJ8C 4JP0A 5TJJA 3F23A 2X6WA 4HLYA 4CCKA 1V55H 4J01A 3VYRB 3HL2A 1QBJA 3HTUA 3V7RA 1E3HA 4A3BJ 5HS7A 3QPHA 1CGPA 2TCTA 2OCEA 2DBBA 2XAJA 1BI2A 1ONVA 5CVJA 3SHFA 1SEUA 2JA8J 1GXQA 4PJLA 5EZHA 4A5NA 4L5EA 2DFFA 3I58A 5CVVA 3F8FA 1BBYA 1FEXA 1XCBA 4H0EA 1B8IA 1LFBA 2K27A 2GXBA 2E2HJ 4DW6A 2DOFA 4RS8A 1Z1DA 2JQ7A 2V9VA 3V8LA 4Q48A 4KN7X 1FTTA 1SANA 5HVQC 1EA3A 3RKYA 1YTYA 2HZDA 1FP2A 3ELKA 3QODA 4BACA 2W84A 4U0VA 2VJJA 2OPTA 1Y8QB 4N4OB 4BEHB 1JGSA 2NVTJ 4NHJA 1VQNI 1TNSA 2FRHA 5D8LB 2WAQA 4F93B 5LRRA 4HRIA 1R36A 3ONQA 1SVOA 1NG7A 1HF0A 3CJQB 4GFBA 4ZC3A 2G7HA 1W5SA 2B9SA 3IH3A 3PL8A 4RGSA 4H4KC 1AHDP 3PIOF 2HU9A 1ZRFA 3C2BA 3M1CA 2CFOA 1Z77A 1GXPA 2P7VB 1OCCH 4DZPA 2IBDA 2Y31A 1CQTA 1TW3A 1JXSA 4A2UA 1S7EA 1W5TA 4C9YA 4FISA 4ON0A 1OYWA 3DEUA 3L2UA 5GTIC 3Q9VA 4G6TB 4RGUA 4EJTA 2G7UA 2IW5A 3HOXJ 4D5CA 3BTIA 1QO0D 3MWMA 2W85A 5DCMA 3J7AY 1O4XA 1F43A 2ZSHB 2UXNA 3K4KA 3EUKL 3QQAA 3ML6A 3F72A 3V4GA 3HC7A 1CF7B 2M87A 4KISA 3SYTA 4B1RA 2MH9A 1ZKGA 1MMGA 3DTKA 1J9IA 4I09A 2FOKA 2GA2A 2VN2A 4HBLA 4KMFA 2RNJA 3VSKA 3B6CA 1Z9CA 4MFEA 4B8XA 4UXNA 2DXIA 2FOWA 3KE2A 1WJFA 3OYAA 4CSWA 2EV6A 5JI6A 2R5YA 4HDUA 1VQ9I 3C2HA 4ZDPA 4U0WA 2VJIA 3VOEA 1VQ6I 2CUJA 1XSVA 5F0CA 1XG1A 2BY3A 2CMPA 4HAMA 1WI9A 1OCOH 2DMNA 2K9NA 3RZDJ 2OA4A 4YIIA 4BJTA 3W6JB 3MEXA 1UB9A 2JT1A 2PMUA 3B73A 3OOUA 5JHFA 3IL2A 1IXSB 2A69F 4KJZA 5J8FA 2IGMA 2LMDA 3H5NA 4MO7A 3CF2A 4XRSA 2EIKH 1ETXA 1ZG5A 3OOPA 1X1AA 3TGNA 5TGTA 3ECHA 1X1PA 2R7QA 1TLHB 1U8RA 2KIUA 3E97A 2O9LA 1N78A 1Z7UA 4G9YA 2JA7J 1KYZA 2AS5F 2DI3A 5IT9Z 3KLNA 1E0EA 3RQIA 2OV7A 5H6RA 4ENJA 4N0BA 2R7VA 1EH8A 3FK7A 1OR7A 2V9KA 4KT6A 2O3FA 4LITA 3BR1A 3ZR8X 5BQTA 4WXHA 3E1SA 2F5EA 5E18F 1YX5A 5E3NA 3S3NA 2A68F 4P9UA 4NQWB 2NYXA 1OCPA 1Y56A 3BG6A 1XGMA 3BCBA 3P9KA 2LBFA 1STZA 1LNWA 2Y2ZA 4B3AA 4A12A 5GAGJ 2JN6A 1RPWA 3J7YJ 4BHCA 1DGWY 2ISYA 2XAQA 1K61A 2KQRA 4RGRA 4CH7A 4DJAA 5IYBJ 1GUUA 2E36A 3T0YA 3VPRA 3MMYB 1XDSA 3FXOA 3GCMA 4II2A 1A04A 1TW2A 5LHHA 1HA8A 3L1PA 2DAOA 2DJNA 5HLIA 1V4RA 3TBIA 2XVCA 5CKTA 2LD5A 1X58A 4ZZLA 2JWTA 1D5VA 2XGEA 4ZJZA 4QTRA 4NC7A 3HSFA 1MDMB 1JE8A 1P7JA 5KAFC 2OF7A 2QKMB 3RTRA 3OS1A 3FXQA 2VE9A 3QOEA 4FTHA 2DTRA 1J59A 2ECBA 3S8PA 2R7XA 3HZJA 2FF4A 1Y39A 2DMTA 3FMQA 3ISPA 4XLAA 3TO6A 1AU7A 5ICFA 1T39A 1O3RA 4LLNA 2QKLB 2RKHA 4LGWA 1VQ4I 4YRVA 5B3SH 2EFPA 2KLOA 1MBGA 4MTEA 1QPMA 2F5DA 4AIDA 2PI0A 3OYKA 1I27A 3CCMI 4ZYDA 3HSRA 1PUFB 1RKTA 5EDNA 1RC9A 1WJAA 1YS6A 3L00A 4IO9F 2LKXA 3FM3A 2IGKA 3J80Z 1TWHJ 1KU2A 3C3WA 4M3BA 4HF2A 1MJ9A 1MMNA 1A35A 3BPXA 5E1WA 2BVLA 4KNYA 1IRGA 4KT5C 2I5UA 2ZFUA 5KHDA 1H8AC 2DFHA 3CF5F 2JPBA 3HUGB 2IS2A 2YX4A 2R7TA 2AXLA 4XKVA 3DFGA 5F64A 1ZRDA 3GWZA 1YLFA 2X6YA 3WTTC 1BC8C 3OR2C 3DCFA 4HYEA 5J4VA 1YIOA 3E6DA 3HGGA 3ZQIA 3E6CC 3BG7A 1SAXA 3G3ZA 2OCCH 4P5OA 2NS7A 1D0YA 3KETA 1XMAA 2PBIA 5E20A 2HTJA 5M5YJ 3SEZA 3CCUI 2ADUA 1IW7F 4B3XA 1N75A 5IYDJ 2ZMEC 1JKQC 4C30A 1UAAA 2IGNA 1T0FA 2E34A 2Z5UA 3BR6A 3WGGA 1Z91A 2L9VA 5GAEJ 3H0GJ 2DU9A 3WODF 3P5JA 5J1YA 4KICA 4F92B 3KP5A 1IN8A 3BLYA 4RBOA 5C3EJ 3BTJA 4YFNF 2COBA 1U3EM 4EM0B 6PAXA 4KN4X 5AONA 2NVXJ 2GOMA 4BEHA 3K70D 3EUHC 4S04A 3ERMA 4PK4A 1IJWC 3EETA 5FLXZ 2HYJA 4M74A 5H6QA 5K5RA 2BY2A 3SDBA 2X51A 1B9MA 4DGWB 3OSFA 1YJ9I 2H94A
chains in the Genus database with same CATH topology
3IH4A 1ETWA 2FD5A 2JA5J 5IPAA 4BXXJ 5E3MA 5EG0A 2LFBA 3TP3A 1MBKA 3PO3J 1I3QJ 1F36A 2HXIA 3HOWJ 3D1NI 3M3YJ 2CQXA 1MBHA 3S1RJ 4X1EA 1GV5A 1ETKA 4BY7J 4ABZA 2ID3A 3LOCA 2YU9J 1X2NA 1ZK8A 5HODA 1OCTC 2DA1A 2DN0A 1P7IA 3A02A 2VI6A 3JR9A 1ZGWA 1JT0A 1JT6A 2L0KA 1U78A 5F04A 1IUFA 2O7OA 4A3FJ 1Y1WJ 4JX6A 4UUSA 3E7LA 1ETOA 4A3LJ 2EQRA 3WHBA 3O8HA 2FQ4A 1T56A 1POGA 2YUSA 2R5ZB 1E3OC 2G0EA 2M9HA 1T33A 3BT9A 1XS9A 5GPAA 1WPKA 1DU6A 5DTDA 1U9NA 2XPVA 3Q0UA 2E1OA 3A03A 3HB9A 4FCYA 4FE7A 3CQZJ 3JRFA 3GTPJ 3BQZA 3UKGA 5F27A 3HOZJ 2AO9A 2H1KA 5FKMA 2P81A 2R93J 2DTZA 4M3EA 4LOCA 3HM5A 2IEKA 2L9RA 1I6HJ 3GTJJ 2K9QA 1AKHA 3G1LA 4A69C 5IOYA 1YRNA 1JKPC 2K40A 3G1OA 3S1NJ 1WH7A 3FK6A 5JLXA 3GTOJ 4BBRJ 1RR7A 2X48A 3S17J 2M0CA 4IHWA 1XC5A 1BJZA 3FKIJ 1ETVA 1MH4A 1ENHA 2DA5A 3BQYA 5BNGA 1OJLA 1MSEC 4G12A 3M4OJ 1GVDA 4MLOA 2HDDA 1JUSA 3LSRA 2XB5A 4A3MJ 3LSGA 3HEFA 1VF9A 2CUFA 4V2GA 4DYCA 4DYRA 3ZOBA 4M3GA 5M3FJ 1ORKA 1ITYA 1ZR4A 2DA6A 3HOYJ 2Y9YA 1W0TA 4AYBN 2XGDA 1JKRC 4B4CA 5FJ8J 3Q0WA 3GTLJ 5F1JA 1FIAA 3K2AA 2XRLA 2FJ1A 3HBLA 1LE8B 2DA4A 1QRYA 9ANTA 4AUXA 3HGYA 3IH2A 3JRGA 5EZGA 2X9DA 4A3GJ 1UMQA 1FIPA 1AKHB 1WCMJ 1RKWA 4V2FA 2PMZN 2E2IJ 3BG3A 1JJ8C 3S2DJ 4JP0A 1Z0XA 2AHQA 4A3KJ 3Q3SA 2H8RA 5JLWA 2QF7A 3GTMJ 2EH3A 1BW6A 1JTYA 4BKXA 5M5XJ 3SFIA 2LY9A 2JA6J 4A3BJ 4S0HB 3MN2A 4XRSG 3BR2A 3JREA 2WV1A 1OFCX 4HNVA 1WH5A 2TCTA 5J1UA 1FJLA 2JA8J 3SDGA 5IP9J 5EZHA 2M2EA 4L5EA 1HDDC 3F0CA 4A3JJ 3QPSA 1FEXA 1MH3A 3S14J 3A01A 1EF4A 3I4MJ 1B8IA 1LFBA 1TWAJ 1NK2P 2ELKA 2ID6A 4MFDA 3JRIA 4C3IJ 4DW6A 2E2HJ 2M34A 1G2HA 2HI3A 4AC0A 1PUFA 1Y1VJ 3GBGA 1FTTA 2KDZA 1SANA 4C3HJ 4A3IJ 2R92J 2W48A 1RESA 4CYCA 3RKQA 2QCOA 4NDLA 2OPTA 2TRTA 2NVTJ 2VKEA 5K7HA 2X6OA 2MSYA 4C3JJ 2XB0X 1HF0A 4GFBA 2LLKA 3CCYA 2NOGA 3MKLA 3BR3A 1X2MA 3IH3A 5EG0B 2EZIA 1AHDP 2E19A 4D7MA 1HOMA 2HOSA 1JTXA 3C2BA 3G1MA 3WHCA 2M8GX 1A6IA 3TW6A 1Z77A 1ZR2A 3A01B 4DZPA 2NS8A 2IBDA 2XGCA 3O8GA 2Y31A 4D7NA 1CQTA 4Y7NJ 1S7EA 2VPRA 4FISA 5FLMJ 1R9TJ 3HOXJ 4D5CA 3BTIA 2IAIA 1JUPA 1O4XA 1F43A 2DMQA 1HLVA 1JJ6C 2JK3A 3QQAA 3ZQCA 2NVYJ 1QVUA 5J1RA 1QVTA 4B1RA 4UUSB 5DS9A 2LTPA 1TWGJ 2L7FP 1ZKGA 3S2HJ 4A3EJ 2K9SA 5EGOA 3BR0A 3GTQJ 1SFOJ 3CMYA 1TC3C 3TP0A 3S1QJ 4DYQA 3B6CA 4MFEA 5F0HA 4EEFG 1BA5A 3QPLA 3LSJA 1IDYA 2CUEA 2R5YA 1QPIA 4M3DA 5GPCA 5K7ZA 2MW8A 5F0CA 1XG1A 2I10A 5FKOA 2DMNA 3GTKJ 2K9NA 3BG5A 3I4NJ 3RZDJ 1YRNB 1U9OA 2LR8A 2ME0A 4XIDA 3OOUA 2LVSA 3K7AJ 2R0QC 3RZOJ 4MO7A 4XRSA 5IYCJ 1ETXA 5C4JJ 3S15J 2DA7A 1ETYA 3DEWA 2JJ7A 2O9LA 1VNDA 2GBYA 2Y9ZA 2JA7J 2O8KA 3PM1A 4IHYA 2DMUA 3BTLA 3RQIA 3HOUJ 1H89C 5FKLA 3TEDA 2R7ZJ 3FK7A 2CJJA 1HDPA 4RDUA 3BR1A 5E3LA 2R5ZA 1H88C 1IGNA 1B72A 5E3NA 3BG9A 4W97A 1UG2A 1VFCA 1OCPA 3W6VA 2CU7A 2JMWA 1NK3P 1Q1VA 2VKVA 2Y2ZA 3ZQFA 3SJMA 4B3AA 4Y52J 2JN6A 1RPWA 5FLVA 1JGGA 2ECCA 2EZLA 1K61A 1IC8A 1ETQA 2FX0A 4A93J 1I50J 5IYBJ 1GUUA 2Y30A 3TW7A 4XICA 2EZHA 3VPRA 3L1PA 4IHXA 2DJNA 5E3OA 2NVQJ 1JUMA 4JX5A 2LD5A 1X58A 2LP0A 4IEJA 3OSGA 1MBFA 2JWTA 1BW5A 1IG7A 1TWCJ 2XGEA 5IP7J 4QTRA 3HKZN 2XSDC 1P7JA 5M5WJ 2XPUA 2OF7A 2YS9A 1IRZA 5F0FA 4FTHA 2VUMJ 2DA3A 4JX4A 2HOAA 1HCRA 3NAUA 2ECBA 2DMTA 1TWFJ 3NARA 5C4XJ 3ZQLA 1B72B 5EEAA 1AU7A 1B8IB 1LFUP 3GTGJ 5K7FA 3JRDA 1GV2A 2ZB9A 2DA2A 1MBGA 5IOZA 1FTZA 4J19A 4BBSJ 4MIMA 1IV6A 2B63J 4XRMA 1PUFB 5EF6A 1RKTA 4QIWN 5EDNA 3LSPA 2LKXA 2DMPA 2RAEA 3CDLA 1TWHJ 4UUTA 4M3BA 1LE8A 1MNMC 4IHVA 3HOVJ 3ZQHA 2D5VA 1D5YA 4CYCB 3BR5A 3S16J 1NTCA 4M3FA 4M6VA 2ME6A 3FISA 2Y0SN 1DU0A 3S1MJ 1JKOC 3HDDA 1H8AC 4DZJA 3JRBA 2KT0A 3LNQA 3B6AA 1WI3A 1U8BA 1UHSA 1K83J 4A3DJ 3BTCA 2CQQA 3PO2J 3DCFA 2E2JJ 3HGGA 3ZQIA 2HXOA 2L7ZA 4I76A 5M3MJ 4QSHA 2NS7A 1MSFC 5FKKA 2EZKA 2WB1N 2WAQN 5M5YJ 1A5JA 1APLC 5IP6A 1W0UA 5IYDJ 5GP9A 2CRGA 1VI0A 2MGQA 1JKQC 5EYRA 3JRAA 4FE4A 3H3VK 1RETA 1ZTRA 3IV5A 2GM4A 4C2MJ 1BL0A 3OIOA 4I6ZA 4JYKA 5J3LA 4X6AJ 3BR6A 2N8GA 5C44J 2L7MP 4A3CJ 3H0GJ 4BY1J 1MBJA 4D5FA 5J1YA 2GLOA 2MG4A 5EGOB 2EBIA 3FIWA 4RBOA 3JRCA 5C3EJ 3BTJA 3JRHA 3MVPA 2COBA 2XPWA 2HOTA 5F08A 1MBEA 2NVXJ 5FKNA 3ZQGA 4W1UA 2R5YB 1IJWC 2HQ5A 4XK4A 1WGXA 1GT0C 2HYJA 1ZQ3P 1GDTA 2LK2A 1IDZA 3OSFA 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IH4 A;  1ETW A;  2FD5 A;  2JA5 J;  5IPA A;  4BXX J;  5E3M A;  5EG0 A;  2LFB A;  3TP3 A;  1MBK A;  3PO3 J;  1I3Q J;  1F36 A;  2HXI A;  3HOW J;  3D1N I;  3M3Y J;  2CQX A;  1MBH A;  3S1R J;  4X1E A;  1GV5 A;  1ETK A;  4BY7 J;  4ABZ A;  2ID3 A;  3LOC A;  2YU9 J;  1X2N A;  1ZK8 A;  5HOD A;  1OCT C;  2DA1 A;  2DN0 A;  1P7I A;  3A02 A;  2VI6 A;  3JR9 A;  1ZGW A;  1JT0 A;  1JT6 A;  2L0K A;  1U78 A;  5F04 A;  1IUF A;  2O7O A;  4A3F J;  1Y1W J;  4JX6 A;  4UUS A;  3E7L A;  1ETO A;  4A3L J;  2EQR A;  3WHB A;  3O8H A;  2FQ4 A;  1T56 A;  1POG A;  2YUS A;  2R5Z B;  1E3O C;  2G0E A;  2M9H A;  1T33 A;  3BT9 A;  1XS9 A;  5GPA A;  1WPK A;  1DU6 A;  5DTD A;  1U9N A;  2XPV A;  3Q0U A;  2E1O A;  3A03 A;  3HB9 A;  4FCY A;  4FE7 A;  3CQZ J;  3JRF A;  3GTP J;  3BQZ A;  3UKG A;  5F27 A;  3HOZ J;  2AO9 A;  2H1K A;  5FKM A;  2P81 A;  2R93 J;  2DTZ A;  4M3E A;  4LOC A;  3HM5 A;  2IEK A;  2L9R A;  1I6H J;  3GTJ J;  2K9Q A;  1AKH A;  3G1L A;  4A69 C;  5IOY A;  1YRN A;  1JKP C;  2K40 A;  3G1O A;  3S1N J;  1WH7 A;  3FK6 A;  5JLX A;  3GTO J;  4BBR J;  1RR7 A;  2X48 A;  3S17 J;  2M0C A;  4IHW A;  1XC5 A;  1BJZ A;  3FKI J;  1ETV A;  1MH4 A;  1ENH A;  2DA5 A;  3BQY A;  5BNG A;  1OJL A;  1MSE C;  4G12 A;  3M4O J;  1GVD A;  4MLO A;  2HDD A;  1JUS A;  3LSR A;  2XB5 A;  4A3M J;  3LSG A;  3HEF A;  1VF9 A;  2CUF A;  4V2G A;  4DYC A;  4DYR A;  3ZOB A;  4M3G A;  5M3F J;  1ORK A;  1ITY A;  1ZR4 A;  2DA6 A;  3HOY J;  2Y9Y A;  1W0T A;  4AYB N;  2XGD A;  1JKR C;  4B4C A;  5FJ8 J;  3Q0W A;  3GTL J;  5F1J A;  1FIA A;  3K2A A;  2XRL A;  2FJ1 A;  3HBL A;  1LE8 B;  2DA4 A;  1QRY A;  9ANT A;  4AUX A;  3HGY A;  3IH2 A;  3JRG A;  5EZG A;  2X9D A;  4A3G J;  1UMQ A;  1FIP A;  1AKH B;  1WCM J;  1RKW A;  4V2F A;  2PMZ N;  2E2I J;  3BG3 A;  1JJ8 C;  3S2D J;  4JP0 A;  1Z0X A;  2AHQ A;  4A3K J;  3Q3S A;  2H8R A;  5JLW A;  2QF7 A;  3GTM J;  2EH3 A;  1BW6 A;  1JTY A;  4BKX A;  5M5X J;  3SFI A;  2LY9 A;  2JA6 J;  4A3B J;  4S0H B;  3MN2 A;  4XRS G;  3BR2 A;  3JRE A;  2WV1 A;  1OFC X;  4HNV A;  1WH5 A;  2TCT A;  5J1U A;  1FJL A;  2JA8 J;  3SDG A;  5IP9 J;  5EZH A;  2M2E A;  4L5E A;  1HDD C;  3F0C A;  4A3J J;  3QPS A;  1FEX A;  1MH3 A;  3S14 J;  3A01 A;  1EF4 A;  3I4M J;  1B8I A;  1LFB A;  1TWA J;  1NK2 P;  2ELK A;  2ID6 A;  4MFD A;  3JRI A;  4C3I J;  4DW6 A;  2E2H J;  2M34 A;  1G2H A;  2HI3 A;  4AC0 A;  1PUF A;  1Y1V J;  3GBG A;  1FTT A;  2KDZ A;  1SAN A;  4C3H J;  4A3I J;  2R92 J;  2W48 A;  1RES A;  4CYC A;  3RKQ A;  2QCO A;  4NDL A;  2OPT A;  2TRT A;  2NVT J;  2VKE A;  5K7H A;  2X6O A;  2MSY A;  4C3J J;  2XB0 X;  1HF0 A;  4GFB A;  2LLK A;  3CCY A;  2NOG A;  3MKL A;  3BR3 A;  1X2M A;  3IH3 A;  5EG0 B;  2EZI A;  1AHD P;  2E19 A;  4D7M A;  1HOM A;  2HOS A;  1JTX A;  3C2B A;  3G1M A;  3WHC A;  2M8G X;  1A6I A;  3TW6 A;  1Z77 A;  1ZR2 A;  3A01 B;  4DZP A;  2NS8 A;  2IBD A;  2XGC A;  3O8G A;  2Y31 A;  4D7N A;  1CQT A;  4Y7N J;  1S7E A;  2VPR A;  4FIS A;  5FLM J;  1R9T J;  3HOX J;  4D5C A;  3BTI A;  2IAI A;  1JUP A;  1O4X A;  1F43 A;  2DMQ A;  1HLV A;  1JJ6 C;  2JK3 A;  3QQA A;  3ZQC A;  2NVY J;  1QVU A;  5J1R A;  1QVT A;  4B1R A;  4UUS B;  5DS9 A;  2LTP A;  1TWG J;  2L7F P;  1ZKG A;  3S2H J;  4A3E J;  2K9S A;  5EGO A;  3BR0 A;  3GTQ J;  1SFO J;  3CMY A;  1TC3 C;  3TP0 A;  3S1Q J;  4DYQ A;  3B6C A;  4MFE A;  5F0H A;  4EEF G;  1BA5 A;  3QPL A;  3LSJ A;  1IDY A;  2CUE A;  2R5Y A;  1QPI A;  4M3D A;  5GPC A;  5K7Z A;  2MW8 A;  5F0C A;  1XG1 A;  2I10 A;  5FKO A;  2DMN A;  3GTK J;  2K9N A;  3BG5 A;  3I4N J;  3RZD J;  1YRN B;  1U9O A;  2LR8 A;  2ME0 A;  4XID A;  3OOU A;  2LVS A;  3K7A J;  2R0Q C;  3RZO J;  4MO7 A;  4XRS A;  5IYC J;  1ETX A;  5C4J J;  3S15 J;  2DA7 A;  1ETY A;  3DEW A;  2JJ7 A;  2O9L A;  1VND A;  2GBY A;  2Y9Z A;  2JA7 J;  2O8K A;  3PM1 A;  4IHY A;  2DMU A;  3BTL A;  3RQI A;  3HOU J;  1H89 C;  5FKL A;  3TED A;  2R7Z J;  3FK7 A;  2CJJ A;  1HDP A;  4RDU A;  3BR1 A;  5E3L A;  2R5Z A;  1H88 C;  1IGN A;  1B72 A;  5E3N A;  3BG9 A;  4W97 A;  1UG2 A;  1VFC A;  1OCP A;  3W6V A;  2CU7 A;  2JMW A;  1NK3 P;  1Q1V A;  2VKV A;  2Y2Z A;  3ZQF A;  3SJM A;  4B3A A;  4Y52 J;  2JN6 A;  1RPW A;  5FLV A;  1JGG A;  2ECC A;  2EZL A;  1K61 A;  1IC8 A;  1ETQ A;  2FX0 A;  4A93 J;  1I50 J;  5IYB J;  1GUU A;  2Y30 A;  3TW7 A;  4XIC A;  2EZH A;  3VPR A;  3L1P A;  4IHX A;  2DJN A;  5E3O A;  2NVQ J;  1JUM A;  4JX5 A;  2LD5 A;  1X58 A;  2LP0 A;  4IEJ A;  3OSG A;  1MBF A;  2JWT A;  1BW5 A;  1IG7 A;  1TWC J;  2XGE A;  5IP7 J;  4QTR A;  3HKZ N;  2XSD C;  1P7J A;  5M5W J;  2XPU A;  2OF7 A;  2YS9 A;  1IRZ A;  5F0F A;  4FTH A;  2VUM J;  2DA3 A;  4JX4 A;  2HOA A;  1HCR A;  3NAU A;  2ECB A;  2DMT A;  1TWF J;  3NAR A;  5C4X J;  3ZQL A;  1B72 B;  5EEA A;  1AU7 A;  1B8I B;  1LFU P;  3GTG J;  5K7F A;  3JRD A;  1GV2 A;  2ZB9 A;  2DA2 A;  1MBG A;  5IOZ A;  1FTZ A;  4J19 A;  4BBS J;  4MIM A;  1IV6 A;  2B63 J;  4XRM A;  1PUF B;  5EF6 A;  1RKT A;  4QIW N;  5EDN A;  3LSP A;  2LKX A;  2DMP A;  2RAE A;  3CDL A;  1TWH J;  4UUT A;  4M3B A;  1LE8 A;  1MNM C;  4IHV A;  3HOV J;  3ZQH A;  2D5V A;  1D5Y A;  4CYC B;  3BR5 A;  3S16 J;  1NTC A;  4M3F A;  4M6V A;  2ME6 A;  3FIS A;  2Y0S N;  1DU0 A;  3S1M J;  1JKO C;  3HDD A;  1H8A C;  4DZJ A;  3JRB A;  2KT0 A;  3LNQ A;  3B6A A;  1WI3 A;  1U8B A;  1UHS A;  1K83 J;  4A3D J;  3BTC A;  2CQQ A;  3PO2 J;  3DCF A;  2E2J J;  3HGG A;  3ZQI A;  2HXO A;  2L7Z A;  4I76 A;  5M3M J;  4QSH A;  2NS7 A;  1MSF C;  5FKK A;  2EZK A;  2WB1 N;  2WAQ N;  5M5Y J;  1A5J A;  1APL C;  5IP6 A;  1W0U A;  5IYD J;  5GP9 A;  2CRG A;  1VI0 A;  2MGQ A;  1JKQ C;  5EYR A;  3JRA A;  4FE4 A;  3H3V K;  1RET A;  1ZTR A;  3IV5 A;  2GM4 A;  4C2M J;  1BL0 A;  3OIO A;  4I6Z A;  4JYK A;  5J3L A;  4X6A J;  3BR6 A;  2N8G A;  5C44 J;  2L7M P;  4A3C J;  3H0G J;  4BY1 J;  1MBJ A;  4D5F A;  5J1Y A;  2GLO A;  2MG4 A;  5EGO B;  2EBI A;  3FIW A;  4RBO A;  3JRC A;  5C3E J;  3BTJ A;  3JRH A;  3MVP A;  2COB A;  2XPW A;  2HOT A;  5F08 A;  1MBE A;  2NVX J;  5FKN A;  3ZQG A;  4W1U A;  2R5Y B;  1IJW C;  2HQ5 A;  4XK4 A;  1WGX A;  1GT0 C;  2HYJ A;  1ZQ3 P;  1GDT A;  2LK2 A;  1IDZ A;  3OSF A;  3Q0V A; 
#chains in the Genus database with same CATH topology
 5E3M A;  3I5U A;  4RAF A;  1K7A A;  3LSK A;  2LFB A;  2UV1 A;  3CCQ I;  2O8X A;  4GRI A;  1L3L A;  3OYJ A;  5IT9 K;  3OWT A;  1F36 A;  3HJE A;  3OL3 A;  5CQG A;  3HOW J;  1MJB A;  2GAU A;  2HKO A;  4B47 A;  4XOR A;  2DT5 A;  1H9T A;  1V5G A;  4PFP A;  1BOB A;  2KFD A;  3PQJ A;  2HEO A;  3LOC A;  1V3F A;  2DA1 A;  2DN0 A;  1IRF A;  2P8T A;  5DCF A;  1JT6 A;  2W4S A;  2D45 A;  1XSX A;  2L0K A;  1VQM I;  2LG4 A;  2WBM A;  4Q5S F;  1WJB A;  5F04 A;  1WJ5 A;  1LDJ A;  3KEO A;  5HS8 A;  1ETO A;  2EQR A;  1ULY A;  3DV8 A;  4BE1 A;  2FQ4 A;  1ZHF A;  4LIV A;  2JUG A;  3I4P A;  3L2W A;  1X1D A;  2KZG A;  4E7K A;  5E8I A;  5DTD A;  1U9N A;  4XON A;  3Q0U A;  4ENN A;  5CVU A;  1LQ1 A;  3GXO A;  1AOY A;  4IF4 A;  3HYI A;  3HB9 A;  2LYC A;  2EFW A;  3GTP J;  3AL0 C;  1FSE A;  3CZ6 A;  3UKG A;  5F27 A;  4UVA A;  3HOZ J;  2H1K A;  4OIO F;  1G3Y A;  3I71 A;  5FKM A;  3FX3 A;  2R93 J;  2BY1 A;  5L3C A;  3CES A;  1X3U A;  3MKZ A;  4LOC A;  2IEK A;  3P9C A;  4XSX F;  1ZRE A;  5CLS A;  2NS0 A;  4M6Y A;  4P55 A;  3QWL A;  2O03 A;  2Y48 A;  2F5C A;  2IS6 A;  4A69 C;  2ZJ2 A;  2FML A;  3QRF F;  2VXZ A;  4AU7 A;  1WH7 A;  3FK6 A;  3LAJ A;  2IGO A;  1MJA A;  3GTO J;  3IRR A;  2FE3 A;  3VSL A;  2MYS A;  4BHB A;  5IY5 H;  5L3G A;  3HRS A;  1ETV A;  1ENH A;  2DA5 A;  4L9J A;  3J80 K;  1OJL A;  2Z3Y A;  1MSE C;  1HC8 A;  3M4O J;  1GVD A;  4N4N B;  2JSP A;  4PJN A;  4CO8 A;  4IXA A;  4LLG F;  3K4B A;  3TOA A;  3LSG A;  3HEF A;  3S3O A;  3LA2 A;  2VT3 A;  5B1B H;  4WCG A;  5BMZ A;  4DYR A;  4R1H A;  1S8N A;  3DLA A;  2FBK A;  4M3G A;  5M3F J;  5KNL A;  2XKO A;  1ITY A;  4Y13 A;  2OBP A;  4LFU A;  2ZNY A;  3DKX A;  1JKR C;  4AYB N;  1IN7 A;  4I0B A;  1WVR A;  4IRI A;  4NQW A;  3LMM A;  3K2A A;  1Z21 A;  1W36 D;  3GW2 A;  2ZC2 A;  4MQV A;  3C2G A;  3V7C A;  5EZG A;  2Q2E B;  2HKX A;  3FWE A;  1FIP A;  3VB2 A;  1WCM J;  5DM6 F;  3S3M A;  1BJA A;  3OV8 A;  4RM2 A;  2ACJ A;  3BZC A;  3R61 A;  2F4O B;  3S2D J;  2KZV A;  1Z0X A;  2AHQ A;  3WE2 A;  3TQN A;  2QYO A;  1E2X A;  3F22 A;  1JHH A;  3GTM J;  3DU6 A;  2JA6 J;  1JTY A;  3SFI A;  4PUS A;  1H0M A;  4XRS G;  3JRE A;  3BR2 A;  2WV1 A;  1LB2 A;  3F8M A;  1F5T A;  5HLT A;  1LUJ B;  1T98 A;  2NNN A;  1WH5 A;  4RAY A;  2W82 A;  1FJL A;  2F5V A;  2P5K A;  3SDG A;  4YG2 F;  1R22 A;  1ZG3 A;  3MAJ A;  2M2E A;  3FZV A;  3RI4 A;  1K4S A;  3D5R C;  3IKT A;  3QPS A;  2VLA A;  1Y0N A;  1MH3 A;  1OYY A;  1FWZ A;  4KIF A;  1L0O C;  3S14 J;  1EF4 A;  2X0L A;  4RA2 A;  3OS2 A;  2FNP A;  2STT A;  1RZ4 A;  1TWA J;  5FGM A;  2ELK A;  2VJ5 A;  2ID6 A;  2RRE A;  5LHG A;  4HST A;  4PZJ A;  4L0Y B;  1PUF A;  4UV8 A;  4P9F A;  4ENM A;  3DTI A;  3GBG A;  1Z05 A;  2XF7 A;  5HDK A;  4C3H J;  3RPU D;  1D1A A;  4HZF A;  3DBR B;  5ILU A;  2R92 J;  1VTN C;  5FRO A;  1A31 A;  1Y0U A;  1BIA A;  2E1N A;  2WB1 A;  2XRN A;  5EEG A;  3OYN A;  3IWZ A;  2E1M C;  3HUG A;  1D1C A;  4PSW A;  2X6O A;  2CSO A;  5TIS C;  2OQR A;  1R4N B;  2VC0 A;  3M1E A;  1M1E B;  3CCY A;  3SFZ A;  3MKL A;  1UCR A;  5ERI A;  5L3B A;  1Q1H A;  1UZC A;  3OYD A;  3WG7 H;  3MCZ A;  3DBH B;  4D7M A;  1HOM A;  2OTJ I;  2YR2 A;  2HOS A;  4I98 B;  2JUC A;  3QOP A;  4BAY A;  1ZR2 A;  4IRH A;  3A01 B;  4P96 A;  2HGC A;  4D7N A;  1Y6I A;  4KA4 A;  3Q5F A;  4Y7N J;  3CP8 A;  3CC2 I;  3ROU A;  2VPR A;  2DK5 A;  2KRH A;  2LY2 A;  1ODD A;  2BXY A;  1LFP A;  3RPU A;  1X4P A;  2BHZ A;  1HLV A;  1HW1 A;  3ABM H;  3BJA A;  2CWE A;  1MMA A;  1LDD A;  2NVY J;  2RV8 A;  1QVT A;  3HRM A;  3IP4 B;  3KP6 A;  5DD4 A;  3ZXS A;  5LGN A;  5J1R A;  5DS9 A;  1DPU A;  1TWG J;  4A3E J;  3F6O A;  3I64 A;  4CYD A;  2VOD A;  3AG1 H;  1XMK A;  3BR0 A;  3GF2 A;  5LHI A;  3GTQ J;  3OYH A;  2BV6 A;  3PNV A;  3U9G A;  5CVI A;  1VZ0 A;  1K78 B;  2BY0 A;  1DPR A;  4ZZD A;  4RGX A;  4CXF A;  1SVM A;  1FP1 D;  2M8E A;  1QPI A;  1IDY A;  1BI3 A;  1LKX A;  2CUE A;  2DOA A;  2PJR B;  3PIP F;  4M3D A;  1O3S A;  2VBY A;  3E5U A;  3K2Z A;  4HG2 A;  1WJC A;  2I10 A;  5FKO A;  4ESF A;  4G8X A;  4I99 C;  3GTK J;  5H20 A;  2CQ7 A;  2DO7 A;  4LMY A;  4XL9 A;  1QQI A;  1UHW A;  2LR8 A;  3A0H C;  5DM7 F;  1ZLK A;  4R79 A;  3WG9 A;  3CCL I;  1RRJ A;  1DP7 P;  5IYC J;  1EH7 A;  2QLZ A;  3CUQ C;  3S15 J;  2CV2 A;  2GZW A;  2FBH A;  4IKF A;  3BY6 A;  1N77 A;  3CTA A;  4LB6 B;  2GBY A;  3K1P A;  2OZ6 A;  2QGU A;  3ZMV A;  4AVZ A;  3DXJ F;  4RM3 A;  4NB5 A;  1MIJ A;  3BTL A;  3WTX C;  3MQ0 A;  1SFU A;  1F1Z A;  3EYI A;  1H89 C;  2D1H A;  3CC4 I;  1REP C;  2AXT C;  1XGS A;  1XN7 A;  2KDO A;  2ISZ A;  2CJJ A;  2EK5 A;  3DQV C;  1B72 A;  2OAZ A;  1V5E A;  1R58 A;  1XD7 A;  1FMV A;  1XMX A;  2CV1 A;  2ZKZ A;  1VFC A;  4G7H F;  2HS5 A;  3SZT A;  1Q1V A;  3ZQF A;  3SJM A;  3IKV A;  3J7A O;  1FLI A;  1S6L A;  2MC4 A;  4P1W A;  4WX9 A;  1I39 A;  1MW7 A;  3DKY A;  3GME A;  4ZYG A;  1IC8 A;  1ETQ A;  4V19 K;  2FX0 A;  1WWX A;  5GAH J;  5JFR A;  4XLN F;  3TW7 A;  3K4M A;  2LDU A;  3ABK H;  1R5H A;  1IF1 A;  3KX2 A;  2E7X A;  2LP0 A;  2Z2S B;  4IEJ A;  2IA2 A;  2HVS A;  5FD5 A;  1ZN2 A;  4A0Y A;  3ZMS A;  4HX4 A;  1O7L A;  4E7I A;  1S29 A;  4CGZ A;  4IX7 A;  1BW5 A;  1D0Z A;  1IG7 A;  3I59 B;  5D4R A;  4GYI A;  3KP2 A;  1YIJ I;  1S7O A;  2V4J C;  4I7H A;  1YE9 A;  4HA8 A;  2H8W A;  1U0J A;  2ZJR F;  5EJC A;  3HKZ N;  3M7G A;  2XSD C;  5M5W J;  1XGN A;  5FFX A;  2XPU A;  2YS9 A;  5F0F A;  3OIQ A;  1OYI A;  3CCS I;  2DA3 A;  2VPL A;  2K9M A;  3DKW A;  3NAR A;  4Y15 A;  3E6M A;  3QPT A;  1P2F A;  1RI7 A;  2W24 A;  1R00 A;  3GTG J;  1J7K A;  5IOZ A;  2ZB9 A;  2KIS A;  3VYU B;  2PMZ A;  1BI0 A;  1H9G A;  3LST A;  3FM5 A;  1USS A;  4A5M A;  4ZDO A;  4K2E A;  2XHK A;  2JTV A;  2LSO A;  3CDL A;  4UUT A;  1T8I A;  3E6B A;  3KP3 A;  5FD6 A;  2D5V A;  2K3P A;  1FSH A;  1D5Y A;  2BW3 B;  4M71 A;  1X1C A;  2KRF A;  2Q2E A;  3FIS A;  2Y0S N;  3FHN A;  3PNT A;  4EVI A;  1DU0 A;  1JKO C;  5E8G A;  2AQE A;  2A07 F;  3K4N A;  3QP5 A;  4YEL A;  2WV0 A;  2XIG A;  2ZJP F;  3TDZ C;  4HV5 A;  1G59 A;  1R4M B;  2LKP A;  1UHS A;  1U8B A;  2AQF A;  3KIO A;  1K83 J;  2W00 A;  3UR3 C;  2DYR H;  4PFO A;  2Q8K A;  4EQQ A;  5B1A H;  2CQQ A;  2ZBK A;  2HTS A;  2E2J J;  2HXO A;  5KK1 A;  5LRS A;  4U88 A;  2EA4 A;  4I76 A;  5M3M J;  4UVB A;  2VBW A;  4QSH A;  3GYH X;  3JTH A;  1B6A A;  1SFX A;  4BQA A;  2HDW A;  2XF6 A;  4CUG A;  4ETS A;  1APL C;  3HTS B;  2DDB A;  2M45 A;  1QU3 A;  3S32 A;  1W0U A;  3W3C A;  1YW7 A;  1FYM A;  1VI0 A;  2MGQ A;  2P6T A;  4FE4 A;  1RET A;  4NBQ A;  3CC7 I;  3IV5 A;  1MKM A;  2GM4 A;  2YSR A;  3OIO A;  3RYP A;  4I6Z A;  3CCE I;  2N8G A;  4OWR B;  2JA2 A;  3FXM A;  1ON2 A;  4N9H A;  3K69 A;  4LIU A;  4NNJ A;  2EIL H;  1EJ9 A;  4IOA F;  3H92 A;  1MBJ A;  5F1R A;  3J81 Z;  3R6S A;  1U5T C;  3BRO A;  4I01 A;  3JRC A;  3JRH A;  2ZO4 A;  5ICG A;  3MVP A;  3CLQ A;  5F08 A;  2EV0 A;  1RIO H;  2K4B A;  2F48 A;  3GO5 A;  4OU0 A;  4XK4 A;  1GT0 C;  1O3Q A;  1TP4 A;  4MGR A;  1FPQ A;  1HW2 A;  2A6E F;  1IDZ A;  2HQN A;  3Q0V A;  3IH4 A;  1ETW A;  4JK1 X;  3KYL A;  2R7D A;  5IPA A;  1YHQ I;  4BXX J;  3ASO H;  3QYE A;  4B43 A;  3ZPL A;  1FBU A;  2QEN A;  3HOS A;  4KFC A;  3LA3 A;  2PMH A;  3O2P E;  3T1B A;  5LLQ A;  1KYW A;  1I3Q J;  4LK1 F;  2VQH A;  1WQ2 A;  3W2A A;  4BNC A;  2GQQ A;  4FX4 A;  3M3Y J;  4LD5 A;  3WTU C;  5FO5 A;  1WJD A;  3S1R J;  1GV5 A;  3QYB A;  4PJM A;  4WXD A;  4ABZ A;  1K79 A;  1ZK8 A;  5HOD A;  3A02 A;  2VI6 A;  3U1K A;  4QPQ A;  3R0J A;  4GXO A;  1U78 A;  1IUF A;  1Y1W J;  1YG2 A;  4IOC F;  2EV5 A;  3H9J A;  1OPC A;  3WHB A;  4OMY A;  1BM9 A;  1VQP I;  1T56 A;  2L9N A;  4UNO A;  3KYC B;  4L0Z B;  2M5W A;  2R5Z B;  1E3O C;  2M9H A;  1S9H A;  3BT9 A;  3QYF A;  1KQ0 A;  5GPA A;  3SZG A;  1K78 A;  3VYS B;  1QZE A;  2B7E A;  2XPV A;  3FF5 A;  2PJR A;  2D1V A;  1UFM A;  2OC6 A;  3I53 A;  5ILV A;  4FE7 A;  1YFH A;  4RLF A;  3JRF A;  2W25 A;  2KKO A;  3C1D A;  5L3D A;  4M3E A;  1PP7 U;  3EYY A;  2VB6 A;  3PSF A;  3O3K A;  1I6X A;  1ZLJ A;  4G6Q A;  2KL4 A;  1I6H J;  3GTJ J;  4CA0 A;  4X0G A;  1OQY A;  5HNH A;  2HFH A;  1JKP C;  2CGP A;  3BPV A;  3LQR A;  2RQQ A;  5JLX A;  4BBR J;  1QA6 A;  4WF2 A;  1GLN A;  1SD6 A;  3W2W A;  3S17 J;  1W7P B;  3OYE A;  1BJZ A;  2PQ8 A;  3CCR I;  1LVK A;  3FKI J;  3V7S A;  2EA2 A;  3IUO A;  4CCJ A;  3BQY A;  3COA C;  5BNG A;  3LSI A;  4G12 A;  4YIR X;  4MLO A;  1FX7 A;  4JQF A;  2HDD A;  1JUS A;  4EJU A;  3LSR A;  2P4W A;  4LG3 A;  2WAF A;  1J0R A;  1TQP A;  5DDG A;  4A0Z A;  2VKD A;  3Q9S A;  2CUF A;  3C18 A;  4V2G A;  4D0P A;  5B66 C;  3CCJ I;  4XNF A;  4ANJ A;  4M6X A;  2DA6 A;  1YJN I;  2ICW G;  5K5O A;  4FHT A;  3HOY J;  4HLX A;  2XGD A;  1T2K A;  4B4C A;  3CLO A;  3VFZ A;  3GTL J;  5F1J A;  3AG3 H;  1FIA A;  2NRA C;  2H6C A;  2FJ1 A;  2XAH A;  3HBL A;  1LE8 B;  2DA4 A;  1D3Y A;  3H1C A;  1G3T A;  4AUX A;  2GIV A;  1IAW A;  3GFI A;  4MNU A;  4I02 A;  2FBI A;  2V9P A;  3I3L A;  4ZDL A;  2LNB A;  1YW9 A;  1AKH B;  1NG6 A;  1RNL A;  1TQM A;  1A6Q A;  3E5Q A;  3BJ6 A;  5A2Q Z;  1TL8 A;  3BG3 A;  4MQ9 F;  2VQL A;  2XV4 S;  2W1O A;  3H3Z A;  1VQ8 I;  4A3K J;  3F8N A;  1HW5 A;  4XLE A;  1X3W B;  1N25 A;  1TT0 A;  3DLL F;  1E17 A;  2QF7 A;  2X1D A;  3BJO A;  3JTG A;  2EH3 A;  5M5X J;  4BKX A;  2OZU A;  5DYM A;  3SZP A;  2VIX A;  3MN2 A;  1R6R A;  2ELJ A;  1T95 A;  3FXJ A;  1IRX A;  1OFC X;  2E35 A;  4D9J A;  2QZ8 A;  2L9S A;  4YFK F;  5J1U A;  4B48 A;  3HHH A;  3RQ4 A;  1S72 I;  2CQN A;  3LSH A;  1HDD C;  4ZYA A;  2PG4 A;  4QLC U;  3J81 K;  4A3J J;  4LB5 A;  3PNY A;  5LFA A;  2TDX A;  4DOZ A;  4UV9 A;  4E7H A;  1NK2 P;  4I2O A;  3JRI A;  1OR7 C;  2M34 A;  3AKZ A;  1FBS A;  1G2H A;  2M4G A;  4XLF A;  5HS9 A;  2HI3 A;  4OIR F;  3RYR A;  4AM3 A;  1WSU A;  2PFB A;  1XCV A;  3OY9 A;  4NUB A;  1DP3 A;  1EV7 A;  2O5R A;  3CJT B;  1CF7 A;  2QA4 I;  4RB0 A;  2BW3 A;  5IT3 A;  2QCO A;  1TBX A;  1RUO A;  3KZZ A;  1YI2 I;  3ABL H;  5ICC A;  2TRT A;  2VT2 A;  1NH3 A;  3WGH A;  2Y0M A;  2FUG 2;  5KCM A;  4AD9 A;  4C3J J;  1P6R A;  2XB0 X;  3HSE A;  2IJL A;  3E5X A;  2CV0 A;  2OQG A;  1AA7 A;  2LLK A;  2NOG A;  2ZSI B;  3DEE A;  3BR3 A;  4IVN A;  5EG0 B;  2HYF A;  3PQK A;  4E7L A;  2K4J A;  4AWX B;  5D5W B;  3GLL A;  2HVR A;  1FY7 A;  5L3F A;  2EB7 A;  2A6T A;  1SD7 A;  2BEO A;  1PDN C;  1JTX A;  3G1M A;  4ZYE A;  1MGT A;  3P7N A;  3DU5 A;  3BOQ A;  1K6O A;  3S93 A;  1I5Z A;  2XGC A;  1ZAO A;  1QHG A;  1TT5 B;  2E7W A;  2FQ3 A;  5FLM J;  2MAB A;  4IRG A;  4Z2Y A;  4KUM A;  3KP7 A;  2RGV A;  4WWC A;  2F5F A;  2HNH A;  3I0T A;  4E7J A;  2GA1 A;  2K86 A;  2ZXI A;  5CVR A;  3EQL F;  3L7W A;  3MKW B;  4GCV A;  2QEX I;  3X2Q H;  1X19 A;  1VQO I;  1WKM A;  1QVU A;  4UUS B;  5D4S A;  1Z6R A;  1PYV A;  3AFH A;  2BE5 F;  5BPI A;  2PEX A;  3H3U A;  2L54 A;  4HPQ A;  2Y69 H;  1TC3 C;  2FMY A;  3TP0 A;  3OYB A;  3GFM A;  3S1Q J;  2DOD A;  2MLK A;  3N97 A;  4L5J A;  1BA5 A;  3LSJ A;  1W1W E;  2NAZ A;  3CDI A;  4E7Z A;  5DV5 A;  5GPC A;  4EM1 A;  2XAG A;  1R5G A;  3LL7 A;  1R1T A;  5E17 F;  1TNT A;  4CZC A;  2A6H F;  3WTW C;  4IZZ A;  2GIZ A;  1C0W A;  3BWG A;  2HDC A;  1XGO A;  3BG5 A;  1W4M A;  2XF5 A;  2ZXW H;  1SMT A;  2G9W A;  3WTS C;  2YPR A;  4OIP F;  1U9O A;  4XID A;  3K10 A;  4HF1 A;  2LVS A;  3L9F A;  3PUB A;  2OUM A;  2VJ4 A;  3MFK A;  5C4J J;  4ZTJ A;  3JSO A;  1VQK I;  2MH2 A;  4Q47 A;  3CO7 C;  3PFI A;  2L2O A;  2Q1Z B;  1ETY A;  3DEW A;  4WK8 F;  3U1D A;  2Z9O A;  3JAM Z;  2Y9Z A;  3REO A;  4ENK A;  4ZH4 F;  2O8K A;  1T0F C;  4PJ0 C;  3V42 A;  1DGR M;  4XBF A;  4Y4R A;  1MDM A;  2ZME B;  1W7P D;  1KON A;  3D0S A;  2PN6 A;  1IZ1 A;  4O5V A;  5FFZ A;  2HOE A;  2VON A;  4B09 A;  5FKL A;  2VQC A;  2Z16 A;  3TED A;  2R7Z J;  1G8X A;  5A2Q K;  2O61 A;  1HDP A;  2R5Z A;  1IGN A;  2HZT A;  1H88 C;  1RUN A;  2KP6 A;  2WY8 Q;  4RMN A;  5B5E C;  3BG9 A;  4PGH A;  4W97 A;  1YS7 A;  2CW8 A;  3K4J A;  1UG2 A;  3IC7 A;  5FLX K;  2EFN A;  2CU7 A;  2QBY B;  2JMW A;  4S05 A;  1NK3 P;  1MNE A;  2QUF A;  1Y8R B;  1PJR A;  3MZY A;  1HKQ A;  3OYL A;  3FHZ A;  1JGG A;  1ZEL A;  1X3Z B;  2ECC A;  4JBA A;  4AVP A;  3AG2 H;  2FA5 A;  4A93 J;  3MZH A;  1FOK A;  4BQN A;  2GWR A;  3EPZ A;  2Y30 A;  3KP4 A;  2WTE A;  4O3M A;  4IHX A;  5E3O A;  1HSJ A;  2LH9 A;  2KJB A;  4BS9 A;  1YJW I;  2D2W A;  3H35 A;  1MBF A;  5KVR A;  4XLH A;  5IP7 J;  1W7P A;  4G94 A;  2V1U A;  1FZP B;  3R0A A;  1P4W A;  4AYB A;  4F7Z A;  4HQE A;  2MD0 A;  1UJ8 A;  3EUA A;  1IRZ A;  2F4I A;  1HCR A;  2R7O A;  1LVA A;  3RIR A;  2DQL A;  2X6X A;  3WE3 A;  3WU2 C;  1FNN A;  2DJI A;  2MLG A;  1LFU P;  3K70 C;  3JRD A;  4HDV A;  1FTZ A;  5HOO A;  4J19 A;  4BBS J;  4MIM A;  3DPU A;  2ZXJ A;  1IV6 A;  2OTL I;  2B63 J;  5DEQ A;  3IAM 2;  5EF6 A;  4QIW N;  2L3D A;  5E1X A;  2DMP A;  2RAE A;  1LE8 A;  4XLC A;  3HOV J;  4IHV A;  3AG4 H;  1Z6T A;  1UHM A;  4CYC B;  2IS4 A;  3S16 J;  2EIM H;  3GX4 X;  1NTC A;  3TDU C;  1YOV B;  2M7A A;  1ERD A;  4M6V A;  1FOY A;  2Z1D A;  4HX8 A;  2VOP A;  2LKS A;  4DZJ A;  3JRB A;  2GXA A;  3H9Q A;  4IHT A;  1WHU A;  3H36 A;  1FT9 A;  3B6A A;  4MEX F;  3AL0 B;  3TOB A;  2V6E A;  5J40 A;  2F4M B;  2V1D A;  3WU1 B;  2KRC A;  3BTC A;  4DNC A;  4EGZ A;  1AWC A;  4DBR A;  3LSM A;  5E79 C;  2L7Z A;  2QSF X;  3RCO A;  1XB4 A;  2KIF A;  2XDV A;  1YO5 C;  4DBQ A;  4F52 A;  1W5C C;  1BR2 A;  2WAQ N;  2H1L A;  1A5J A;  4XOP A;  5AIQ A;  2GOX B;  4CHU A;  5IP6 A;  5FB2 A;  2J5O A;  2M7B A;  1SFE A;  4BE0 A;  1P4A A;  2K7L A;  3M07 A;  4WXC A;  2IXS A;  3B02 A;  3ULQ B;  1ZTR A;  2BOL A;  3HIF A;  4C2M J;  2HWV A;  5J3L A;  4UY8 I;  1KZH A;  5C44 J;  2PX9 A;  4BY1 J;  2CFX A;  4ASN A;  2P5L C;  2BXZ A;  4IJA A;  2A5Y B;  1WJE A;  4D5F A;  1UST A;  4L5I A;  2GLO A;  1KU9 A;  2MG4 A;  4XSZ F;  3V8J A;  5EGO B;  1D1B A;  5H2F C;  4OIN F;  4XLP F;  3GFJ A;  3K9T A;  3CJN A;  4UHT A;  2XPW A;  2CG4 A;  2HOT A;  2ELH A;  3I9V 2;  1HQC A;  2CW7 A;  4HF0 A;  1G3S A;  1VQ5 I;  4XKC A;  3NQO A;  1Z3X A;  3CO6 C;  4E6K G;  2VBX A;  1ZQ3 P;  3OYI A;  3VDX A;  1P92 A;  2LF8 A;  2LK2 A;  3G73 A;  1R7J A;  1GDT A;  3K6G A;  2FD5 A;  3LFK A;  3FXU A;  4BJ6 C;  5CYV A;  2FEZ A;  5EG0 A;  3GEZ A;  3W2V A;  3TP3 A;  4ESJ A;  3JAM K;  1SAU A;  3W6K B;  1MBK A;  2DDA A;  3QAH A;  3ZN0 A;  2QQ9 A;  2KMU A;  4G6D A;  3WTY C;  1K4T A;  1IV8 A;  2MFZ A;  2R4G A;  4HV6 A;  5D8K B;  4EAT A;  5HNF A;  2HXI A;  2HR3 A;  3ASN H;  2OU2 A;  4XM3 A;  4XRF A;  4X1E A;  4M73 A;  1ETK A;  4BY7 J;  2YU9 J;  3ZP5 A;  1OCT C;  3LAP A;  3H9G A;  3EDP A;  4OMZ A;  4HNU A;  1ZGW A;  1W36 C;  3A0B C;  2KIM A;  5D5X B;  1S5L C;  4PCQ A;  4F55 A;  3OYF A;  1JT0 A;  3CMA I;  2NNY A;  1HKT A;  3A2K A;  5BPD A;  2O7O A;  3F6V A;  4UUS A;  5LEK A;  2DLL A;  2DT7 B;  2K85 A;  4M9S A;  5JR3 A;  4A3L J;  3O8H A;  2LY1 A;  2YUS A;  4XR6 A;  1IN4 A;  3WTV C;  2NOJ B;  1FYL A;  4QPO A;  4BQO A;  4LK0 F;  4BUP A;  1T33 A;  1FMW A;  1XS9 A;  1WPK A;  2P5V A;  1YIT I;  1DU6 A;  3F21 A;  5K5Q A;  3VYT B;  3WTZ A;  4KIG A;  4Y3O A;  1XDU A;  3CD6 I;  4FCY A;  3FKJ A;  3BQZ A;  1ZAR A;  2DQR A;  2AO9 A;  3L2R A;  2DOE A;  3ZMD A;  1D8K A;  2E5N A;  2P81 A;  1F9N A;  2A3S A;  4LG0 B;  2DTZ A;  2E1M B;  4CCM A;  3QP6 A;  3HM5 A;  3G4S I;  2L9R A;  5D5V B;  4E70 A;  2IA0 A;  3BC8 A;  3HPG A;  2ESH A;  3LWF A;  2K40 A;  2DT6 A;  3O6B B;  4PSX A;  1RR7 A;  2X48 A;  1YQA A;  2M0C A;  3K1M A;  3KFW X;  4NC8 A;  1MH4 A;  4L9T A;  5HLG A;  2MBF A;  2JRT A;  2NVU B;  1YYV A;  4A3M J;  3IAS 2;  4RB1 A;  1HBX G;  3QU6 A;  4RB2 C;  2ZME A;  2PJP A;  4XN3 A;  2V79 A;  2VQG A;  4BXU A;  3ZN1 A;  4DYC A;  2ZCW A;  1PUE E;  1FOW A;  1MMS A;  4EGY A;  4MHG A;  1ORK A;  1ZR4 A;  3BP8 A;  2Y9Y A;  5FJ8 J;  1I1S A;  3Q0W A;  1BI1 A;  3K4C A;  1IN5 A;  4BYY A;  2QM3 A;  4ZTF A;  4HX7 A;  1KA8 A;  1J2X A;  2WY7 Q;  3LFU A;  4BDY A;  2QBY A;  3HRT A;  2V7F A;  3HGY A;  2QQA A;  4A6E A;  1I3A A;  1P4X A;  3JRG A;  3H0D A;  4XKW A;  4Y17 A;  4KIB A;  3OIP A;  3F9K A;  4D1Q A;  2X9D A;  4A3G J;  3EUH A;  3JCU C;  1RKW A;  2E2I J;  3R60 A;  3HKZ A;  2VC1 A;  5LGU A;  1OCR H;  3OMY A;  4KDP A;  1ZYR F;  3Q3S A;  2H8R A;  4HOB A;  3G71 I;  2JVH A;  4TV7 A;  5JLW A;  1SC7 A;  2H27 A;  1BW6 A;  3KLO A;  3C7J A;  2LY9 A;  5LEJ A;  4S0H B;  3HHG A;  1S7A A;  4CDG A;  1IO2 A;  1LDK B;  2DPD A;  4CCL A;  4HNV A;  3NWS A;  3PSI A;  3WU0 A;  2LOO A;  5J47 A;  4OAZ A;  4EMS A;  5IP9 J;  2O6G E;  1XX5 A;  2L01 A;  1TQI A;  1Z67 A;  4F91 B;  2E5Z A;  3F0C A;  2KPM A;  5L3E A;  5EEH A;  4FET A;  3CUQ B;  3ESW B;  5J4Y A;  3A01 A;  2F2E A;  2JRM A;  3I4M J;  3ZQ7 A;  3L09 A;  4JOM A;  2Y0S A;  1GVJ A;  1I1G A;  3F8B A;  2RVC A;  4MFD A;  4C3I J;  1OIS A;  1BOA A;  4MTD A;  4AC0 A;  1Y1V J;  2P7C B;  1DUX C;  3FBN B;  4A6D A;  1D0X A;  2KDZ A;  2EFQ A;  3JW4 A;  4BL0 B;  3ABT A;  2BBY A;  4A3I J;  2W48 A;  1RES A;  2X1C A;  4CYC A;  3RKQ A;  3A1Y A;  3HXL A;  2H6B A;  3KPH A;  4XMY A;  1XSD A;  2KJC A;  4NDL A;  2R7R A;  4MEY F;  1KU3 A;  2VKE A;  2OJE D;  5K7H A;  2ZXH A;  3ZCO A;  4IQJ A;  2MSY A;  4BQQ A;  4L18 B;  2GXG A;  2LF7 A;  2DW4 A;  3M9A A;  5ED4 A;  1X2M A;  2P6S A;  4EM2 A;  4CCN A;  3TL4 X;  2EZI A;  4OIQ F;  3RPQ A;  4ZYH A;  2F6C A;  4RAZ A;  4BGD A;  3K4L A;  1OKR A;  2Y75 A;  2E19 A;  4M72 A;  1B1B A;  3KCC A;  2L02 A;  4BJ5 C;  1SD4 A;  1OLT A;  3WHC A;  2M8G X;  1A6I A;  2XAU A;  3TW6 A;  2EIJ H;  3GZN B;  1SD5 A;  3RJP A;  1R23 A;  2NS8 A;  3O8G A;  3OYC A;  3G6E I;  3AAF A;  2K9L A;  2EIN H;  3IHU A;  1R9T J;  1XTA A;  2BHY A;  2IAI A;  1JUP A;  2XAF A;  4L9V A;  3T8R A;  3CME I;  3R4K A;  2DMQ A;  5D6E A;  1DQU A;  2JK3 A;  3ZQC A;  1JJ6 C;  2R3S A;  2K5C A;  5BOX A;  2IS1 A;  4YFX F;  4U7D A;  1JI8 A;  2VL8 A;  3ZRG A;  2LTP A;  3SXY A;  2L7F P;  4OOI A;  3S2H J;  3DWL E;  4PGG A;  2K9S A;  2XGX A;  2BVM A;  5EGO A;  3HG9 A;  3HOT A;  1SFO J;  3F8C A;  4GGG A;  4IPA A;  5ILS A;  3CMY A;  5FRM A;  4DYQ A;  3L2C A;  1MD0 A;  3KEQ A;  4E4H A;  5F0H A;  4EEF G;  2FXA A;  3V8K A;  2RC4 A;  2VOO A;  2LRE A;  3QPL A;  4U0Y A;  3SQN A;  3U2R A;  3S2W A;  2WWY A;  3ZGK A;  3GLX A;  1P9Q C;  3DBL B;  5K7Z A;  4EJW A;  1LEB A;  2MW8 A;  4Z6Y A;  3IRQ A;  1T38 A;  2V26 A;  2WAD A;  1F4K A;  4RLQ A;  5AIP A;  1QZZ A;  4BHP A;  3KYD B;  5JVG F;  1LPQ A;  2DFI A;  2ZFW A;  3M8F A;  3KZY A;  3I4N J;  2IA1 A;  1KQ8 A;  1YRN B;  4CIC A;  2ME0 A;  4XN0 A;  2VKH A;  5DD8 A;  4CCO A;  3K7A J;  2R0Q C;  2BYV E;  3DF8 A;  4QWQ A;  3RZO J;  1WRJ A;  1FOX A;  4GO1 A;  5HDG A;  2IPQ X;  3MKY B;  5JVT A;  3ECO A;  1VQ7 I;  2UUZ A;  2DA7 A;  1D8J A;  1B4A A;  2JJ7 A;  1SVL A;  1VND A;  3I59 A;  3ZMT A;  2L7K A;  4B44 A;  3PM1 A;  1BN5 A;  2K3F A;  1X4O A;  4I0A A;  5J8C A;  2FU4 A;  4IHY A;  3BZ6 A;  4BH9 A;  3D5S C;  2JZY A;  1EKE A;  4CZZ A;  2DMU A;  3OYM A;  2IRF G;  2W7N A;  3HOU J;  2VAS A;  1JHF A;  3CP2 A;  1J75 A;  3BCA A;  4RDU A;  5E3L A;  2C6Y A;  1BR1 A;  3QU3 A;  2EPF A;  4HNT A;  1ZG1 A;  1O3T A;  2UWM A;  4XOT A;  3W6V A;  1U5T B;  4M9X A;  2VKV A;  3KEY A;  4NC6 A;  5D6F A;  4Y52 J;  2K02 A;  2VBZ A;  1HXD A;  5FLV A;  2CS3 A;  2L5Q A;  2EZL A;  4XKB A;  2LRD A;  1DDN A;  4IHS A;  5DUK A;  4EV0 A;  2M1B A;  4LG0 A;  2UXX A;  1I50 J;  4FAS D;  4XIC A;  3DP7 A;  2EZH A;  4IL6 C;  3FMR A;  1B9N A;  3T5X A;  1T08 B;  2XRO A;  2NVQ J;  2COM A;  1JUM A;  2E60 A;  4JX5 A;  5KAI C;  1A36 A;  2DCE A;  3OYG A;  3JSP A;  3OSG A;  2DPU A;  3TMO A;  2JVG A;  2HQA A;  2V1N A;  3I54 A;  4YEJ A;  2CH0 A;  2WA0 A;  1IN6 A;  4R8H A;  1TWC J;  4AIK A;  2VE8 A;  3U21 A;  1FYK A;  4U87 A;  3GVA A;  1U6G A;  1R1U A;  1BIB A;  2CUZ A;  2QQ8 A;  2WC2 A;  1PVE A;  3H5R A;  2VUM J;  3OL4 A;  2HOA A;  4JX4 A;  4LJZ F;  3NAU A;  4F3Q A;  1BR4 A;  3HPH A;  4PDK A;  1TWF J;  3I55 I;  5C4X J;  3ZQL A;  2FNA A;  1B72 B;  3A4C A;  5EEA A;  1B8I B;  3OR1 C;  5ICE A;  5K7F A;  1GV2 A;  2DA2 A;  2L4M A;  4DIQ A;  1OMI A;  3DTE A;  2QVO A;  4XRM A;  3E3V A;  3PFY A;  2H09 A;  3LSP A;  2A05 A;  4J00 A;  4II3 A;  5BS6 A;  1MNM C;  3ZQH A;  3PUF A;  2HVQ A;  5F6F A;  1WFX A;  5DUI A;  1J09 A;  3M8J A;  3BR5 A;  2XC7 A;  2ESN A;  5E1Z B;  3ZMU A;  4M3F A;  2ME6 A;  2ZJQ F;  2EJR A;  5LD2 C;  3S1M J;  3HDD A;  4L9N A;  3CCV I;  2P0W A;  2IVM A;  3ERE D;  3N05 A;  1R1V A;  4EJO A;  2MD5 A;  2KT0 A;  3LNQ A;  2HPI A;  1WI3 A;  1UEL B;  2XSJ C;  1VQL I;  1T6S A;  3FDY A;  4A3D J;  4XQF A;  5CPR B;  1FC3 A;  2XAS A;  3OS0 A;  3CUO A;  3PO2 J;  1R5I D;  2CO5 A;  1V54 H;  2IT0 A;  4U7B A;  4RAG A;  4UB6 C;  4FT8 A;  2O0Y A;  5FKK A;  1MSF C;  5GAD J;  2EZK A;  3CMM A;  2WB1 N;  2QSG X;  3TO7 A;  2R7U A;  3FXL A;  2HPM A;  1TZL A;  3CJR B;  1MMD A;  2DFE A;  2JSC A;  5J6X A;  3GFL A;  4BE2 A;  5GP9 A;  3CUQ A;  1IUY A;  1FBQ A;  2CRG A;  5EYR A;  3JRA A;  3H3V K;  2V6C A;  5DCM B;  4A0X A;  1BL0 A;  1MND A;  2NXN B;  4JYK A;  2QSH X;  4ITV A;  1G4D A;  4X6A J;  2M4K A;  1X1B A;  3BDD A;  2Q0O A;  4Q4Z F;  1G3W A;  2L7M P;  4A3C J;  2A5W A;  3GZ5 A;  1OCZ H;  2PLY A;  4G7Z F;  3J7Z I;  1LJ9 A;  4BDZ A;  2QQB A;  2J5P A;  3RDI A;  3GZ6 A;  3E0J B;  2EBI A;  2E71 A;  3FIW A;  3I56 I;  5K1Y A;  5CJ9 A;  3M8E A;  1HST A;  2ZNZ A;  3F3X A;  5CQE A;  1PP8 F;  4UUV A;  1MBE A;  1ZGA A;  3FXK A;  5FKN A;  3VWB A;  2X1E A;  3ZQG A;  4W1U A;  2R5Y B;  4O6J A;  2XKP A;  3HRU A;  2HQ5 A;  1WGX A;  1ZGJ A;  2M3A A;  3H5A A;  3IWF A;  2EWN A;  2Z33 A;  1UG0 A;  1SFK A;  1ON1 A;  2L4A A;  1QZY A;  5JHU A;  2JA5 J;  3L2V A;  4HSR A;  1S3J A;  4E7S A;  4UB8 C;  3FMS A;  3PO3 J;  2HQR A;  2MA3 A;  1HKS A;  2DYS H;  5HLH A;  1ZRC A;  2CQK A;  3D1N I;  4IQ4 A;  2CQX A;  2EFO A;  4BU2 A;  4Y33 A;  1LEA A;  4FQG A;  1MBH A;  1EH6 A;  4FX0 A;  4HEA 2;  4KYW A;  3K1N A;  3P9I A;  2ID3 A;  3VOD A;  4ESB A;  1X2N A;  4C2U A;  3T8T A;  1P7I A;  1E3P A;  2KIQ A;  1YX3 A;  4GYG A;  3LA7 A;  3JR9 A;  4UVC A;  1KGS A;  1GHC A;  1ZH5 A;  3TKY A;  1J5Y A;  5GTH C;  2FSW A;  2X85 A;  4A3F J;  4JX6 A;  1ACI A;  2CYY A;  3DPT A;  3E7L A;  2BGC A;  4LLL A;  3ABU A;  2OD5 A;  1K6Y A;  4PJJ A;  3KZI C;  1POG A;  3UNG C;  3RKX A;  4KIT B;  2IP2 A;  2G0E A;  2M0M A;  5HDN A;  1RR8 C;  2Z99 A;  4HQM A;  4EJV A;  2E1O A;  3PJR A;  2RN7 A;  2JPC A;  3MD2 A;  3A03 A;  2KHM A;  2B0L A;  2WAE A;  5FRN A;  2LBF B;  2M30 A;  3CQZ J;  1B59 A;  1BC7 C;  1NHA A;  3DPL C;  3BZK A;  1O57 A;  1MZB A;  2X4H A;  3CDH A;  2BZT A;  1SMY F;  3MZ8 A;  2QWW A;  2W57 A;  1Z7L A;  1QHH D;  4RB3 C;  2DK8 A;  2K9Q A;  1AKH A;  3ZMZ A;  3G1L A;  1U2W A;  2E1C A;  5IOY A;  1YRN A;  2R7S A;  3RSN A;  3G1O A;  3S1N J;  2V1X A;  2LC2 A;  2A61 A;  1QNT A;  1G6N A;  3N4M A;  3NWT A;  4IHW A;  2RNG A;  1XC5 A;  3NEU A;  4AIH A;  2UZK A;  3VEP A;  3WGI A;  4HW0 A;  2ETH A;  2CW0 F;  1YW8 A;  4OAY A;  2VXD A;  1KU7 A;  4N9I A;  1IXC A;  2I8D A;  2RQP A;  1TTY A;  2XB5 A;  2XUB A;  3FBI B;  4DQ2 A;  3RKW A;  1R71 A;  3K0L A;  4AIJ A;  2HYG D;  1VF9 A;  1R49 A;  5LBQ A;  4KMU X;  4C2T A;  3ZOB A;  2MC3 A;  5LGT A;  5TRD A;  4M9Z A;  3D5L A;  3G2B A;  3NRV A;  3FXR A;  1XPX A;  5D5U B;  3LQQ A;  1W0T A;  1WZ2 A;  2YU3 A;  1V5F A;  2XRL A;  4YIF A;  1O7F A;  4GDF A;  1QRY A;  3GUD A;  2RDP A;  3SEQ A;  3L2Q A;  2STW A;  1U5T A;  3ZQQ A;  9ANT A;  4G7O F;  1IXR C;  3IH2 A;  2R7F A;  2YX7 A;  3TO9 A;  2R7W A;  1UMQ A;  4BXF A;  1Z3Y A;  4V2F A;  2PMZ N;  1KQ9 A;  1QGP A;  1JJ8 C;  4JP0 A;  5TJJ A;  3F23 A;  2X6W A;  4HLY A;  4CCK A;  1V55 H;  4J01 A;  3VYR B;  3HL2 A;  1QBJ A;  3HTU A;  3V7R A;  1E3H A;  4A3B J;  5HS7 A;  3QPH A;  1CGP A;  2TCT A;  2OCE A;  2DBB A;  2XAJ A;  1BI2 A;  1ONV A;  5CVJ A;  3SHF A;  1SEU A;  2JA8 J;  1GXQ A;  4PJL A;  5EZH A;  4A5N A;  4L5E A;  2DFF A;  3I58 A;  5CVV A;  3F8F A;  1BBY A;  1FEX A;  1XCB A;  4H0E A;  1B8I A;  1LFB A;  2K27 A;  2GXB A;  2E2H J;  4DW6 A;  2DOF A;  4RS8 A;  1Z1D A;  2JQ7 A;  2V9V A;  3V8L A;  4Q48 A;  4KN7 X;  1FTT A;  1SAN A;  5HVQ C;  1EA3 A;  3RKY A;  1YTY A;  2HZD A;  1FP2 A;  3ELK A;  3QOD A;  4BAC A;  2W84 A;  4U0V A;  2VJJ A;  2OPT A;  1Y8Q B;  4N4O B;  4BEH B;  1JGS A;  2NVT J;  4NHJ A;  1VQN I;  1TNS A;  2FRH A;  5D8L B;  2WAQ A;  4F93 B;  5LRR A;  4HRI A;  1R36 A;  3ONQ A;  1SVO A;  1NG7 A;  1HF0 A;  3CJQ B;  4GFB A;  4ZC3 A;  2G7H A;  1W5S A;  2B9S A;  3IH3 A;  3PL8 A;  4RGS A;  4H4K C;  1AHD P;  3PIO F;  2HU9 A;  1ZRF A;  3C2B A;  3M1C A;  2CFO A;  1Z77 A;  1GXP A;  2P7V B;  1OCC H;  4DZP A;  2IBD A;  2Y31 A;  1CQT A;  1TW3 A;  1JXS A;  4A2U A;  1S7E A;  1W5T A;  4C9Y A;  4FIS A;  4ON0 A;  1OYW A;  3DEU A;  3L2U A;  5GTI C;  3Q9V A;  4G6T B;  4RGU A;  4EJT A;  2G7U A;  2IW5 A;  3HOX J;  4D5C A;  3BTI A;  1QO0 D;  3MWM A;  2W85 A;  5DCM A;  3J7A Y;  1O4X A;  1F43 A;  2ZSH B;  2UXN A;  3K4K A;  3EUK L;  3QQA A;  3ML6 A;  3F72 A;  3V4G A;  3HC7 A;  1CF7 B;  2M87 A;  4KIS A;  3SYT A;  4B1R A;  2MH9 A;  1ZKG A;  1MMG A;  3DTK A;  1J9I A;  4I09 A;  2FOK A;  2GA2 A;  2VN2 A;  4HBL A;  4KMF A;  2RNJ A;  3VSK A;  3B6C A;  1Z9C A;  4MFE A;  4B8X A;  4UXN A;  2DXI A;  2FOW A;  3KE2 A;  1WJF A;  3OYA A;  4CSW A;  2EV6 A;  5JI6 A;  2R5Y A;  4HDU A;  1VQ9 I;  3C2H A;  4ZDP A;  4U0W A;  2VJI A;  3VOE A;  1VQ6 I;  2CUJ A;  1XSV A;  5F0C A;  1XG1 A;  2BY3 A;  2CMP A;  4HAM A;  1WI9 A;  1OCO H;  2DMN A;  2K9N A;  3RZD J;  2OA4 A;  4YII A;  4BJT A;  3W6J B;  3MEX A;  1UB9 A;  2JT1 A;  2PMU A;  3B73 A;  3OOU A;  5JHF A;  3IL2 A;  1IXS B;  2A69 F;  4KJZ A;  5J8F A;  2IGM A;  2LMD A;  3H5N A;  4MO7 A;  3CF2 A;  4XRS A;  2EIK H;  1ETX A;  1ZG5 A;  3OOP A;  1X1A A;  3TGN A;  5TGT A;  3ECH A;  1X1P A;  2R7Q A;  1TLH B;  1U8R A;  2KIU A;  3E97 A;  2O9L A;  1N78 A;  1Z7U A;  4G9Y A;  2JA7 J;  1KYZ A;  2AS5 F;  2DI3 A;  5IT9 Z;  3KLN A;  1E0E A;  3RQI A;  2OV7 A;  5H6R A;  4ENJ A;  4N0B A;  2R7V A;  1EH8 A;  3FK7 A;  1OR7 A;  2V9K A;  4KT6 A;  2O3F A;  4LIT A;  3BR1 A;  3ZR8 X;  5BQT A;  4WXH A;  3E1S A;  2F5E A;  5E18 F;  1YX5 A;  5E3N A;  3S3N A;  2A68 F;  4P9U A;  4NQW B;  2NYX A;  1OCP A;  1Y56 A;  3BG6 A;  1XGM A;  3BCB A;  3P9K A;  2LBF A;  1STZ A;  1LNW A;  2Y2Z A;  4B3A A;  4A12 A;  5GAG J;  2JN6 A;  1RPW A;  3J7Y J;  4BHC A;  1DGW Y;  2ISY A;  2XAQ A;  1K61 A;  2KQR A;  4RGR A;  4CH7 A;  4DJA A;  5IYB J;  1GUU A;  2E36 A;  3T0Y A;  3VPR A;  3MMY B;  1XDS A;  3FXO A;  3GCM A;  4II2 A;  1A04 A;  1TW2 A;  5LHH A;  1HA8 A;  3L1P A;  2DAO A;  2DJN A;  5HLI A;  1V4R A;  3TBI A;  2XVC A;  5CKT A;  2LD5 A;  1X58 A;  4ZZL A;  2JWT A;  1D5V A;  2XGE A;  4ZJZ A;  4QTR A;  4NC7 A;  3HSF A;  1MDM B;  1JE8 A;  1P7J A;  5KAF C;  2OF7 A;  2QKM B;  3RTR A;  3OS1 A;  3FXQ A;  2VE9 A;  3QOE A;  4FTH A;  2DTR A;  1J59 A;  2ECB A;  3S8P A;  2R7X A;  3HZJ A;  2FF4 A;  1Y39 A;  2DMT A;  3FMQ A;  3ISP A;  4XLA A;  3TO6 A;  1AU7 A;  5ICF A;  1T39 A;  1O3R A;  4LLN A;  2QKL B;  2RKH A;  4LGW A;  1VQ4 I;  4YRV A;  5B3S H;  2EFP A;  2KLO A;  1MBG A;  4MTE A;  1QPM A;  2F5D A;  4AID A;  2PI0 A;  3OYK A;  1I27 A;  3CCM I;  4ZYD A;  3HSR A;  1PUF B;  1RKT A;  5EDN A;  1RC9 A;  1WJA A;  1YS6 A;  3L00 A;  4IO9 F;  2LKX A;  3FM3 A;  2IGK A;  3J80 Z;  1TWH J;  1KU2 A;  3C3W A;  4M3B A;  4HF2 A;  1MJ9 A;  1MMN A;  1A35 A;  3BPX A;  5E1W A;  2BVL A;  4KNY A;  1IRG A;  4KT5 C;  2I5U A;  2ZFU A;  5KHD A;  1H8A C;  2DFH A;  3CF5 F;  2JPB A;  3HUG B;  2IS2 A;  2YX4 A;  2R7T A;  2AXL A;  4XKV A;  3DFG A;  5F64 A;  1ZRD A;  3GWZ A;  1YLF A;  2X6Y A;  3WTT C;  1BC8 C;  3OR2 C;  3DCF A;  4HYE A;  5J4V A;  1YIO A;  3E6D A;  3HGG A;  3ZQI A;  3E6C C;  3BG7 A;  1SAX A;  3G3Z A;  2OCC H;  4P5O A;  2NS7 A;  1D0Y A;  3KET A;  1XMA A;  2PBI A;  5E20 A;  2HTJ A;  5M5Y J;  3SEZ A;  3CCU I;  2ADU A;  1IW7 F;  4B3X A;  1N75 A;  5IYD J;  2ZME C;  1JKQ C;  4C30 A;  1UAA A;  2IGN A;  1T0F A;  2E34 A;  2Z5U A;  3BR6 A;  3WGG A;  1Z91 A;  2L9V A;  5GAE J;  3H0G J;  2DU9 A;  3WOD F;  3P5J A;  5J1Y A;  4KIC A;  4F92 B;  3KP5 A;  1IN8 A;  3BLY A;  4RBO A;  5C3E J;  3BTJ A;  4YFN F;  2COB A;  1U3E M;  4EM0 B;  6PAX A;  4KN4 X;  5AON A;  2NVX J;  2GOM A;  4BEH A;  3K70 D;  3EUH C;  4S04 A;  3ERM A;  4PK4 A;  1IJW C;  3EET A;  5FLX Z;  2HYJ A;  4M74 A;  5H6Q A;  5K5R A;  2BY2 A;  3SDB A;  2X51 A;  1B9M A;  4DGW B;  3OSF A;  1YJ9 I;  2H94 A; 
#chains in the Genus database with same CATH homology
 3IH4 A;  1ETW A;  2FD5 A;  2JA5 J;  5IPA A;  4BXX J;  5E3M A;  5EG0 A;  2LFB A;  3TP3 A;  1MBK A;  3PO3 J;  1I3Q J;  1F36 A;  2HXI A;  3HOW J;  3D1N I;  3M3Y J;  2CQX A;  1MBH A;  3S1R J;  4X1E A;  1GV5 A;  1ETK A;  4BY7 J;  4ABZ A;  2ID3 A;  3LOC A;  2YU9 J;  1X2N A;  1ZK8 A;  5HOD A;  1OCT C;  2DA1 A;  2DN0 A;  1P7I A;  3A02 A;  2VI6 A;  3JR9 A;  1ZGW A;  1JT0 A;  1JT6 A;  2L0K A;  1U78 A;  5F04 A;  1IUF A;  2O7O A;  4A3F J;  1Y1W J;  4JX6 A;  4UUS A;  3E7L A;  1ETO A;  4A3L J;  2EQR A;  3WHB A;  3O8H A;  2FQ4 A;  1T56 A;  1POG A;  2YUS A;  2R5Z B;  1E3O C;  2G0E A;  2M9H A;  1T33 A;  3BT9 A;  1XS9 A;  5GPA A;  1WPK A;  1DU6 A;  5DTD A;  1U9N A;  2XPV A;  3Q0U A;  2E1O A;  3A03 A;  3HB9 A;  4FCY A;  4FE7 A;  3CQZ J;  3JRF A;  3GTP J;  3BQZ A;  3UKG A;  5F27 A;  3HOZ J;  2AO9 A;  2H1K A;  5FKM A;  2P81 A;  2R93 J;  2DTZ A;  4M3E A;  4LOC A;  3HM5 A;  2IEK A;  2L9R A;  1I6H J;  3GTJ J;  2K9Q A;  1AKH A;  3G1L A;  4A69 C;  5IOY A;  1YRN A;  1JKP C;  2K40 A;  3G1O A;  3S1N J;  1WH7 A;  3FK6 A;  5JLX A;  3GTO J;  4BBR J;  1RR7 A;  2X48 A;  3S17 J;  2M0C A;  4IHW A;  1XC5 A;  1BJZ A;  3FKI J;  1ETV A;  1MH4 A;  1ENH A;  2DA5 A;  3BQY A;  5BNG A;  1OJL A;  1MSE C;  4G12 A;  3M4O J;  1GVD A;  4MLO A;  2HDD A;  1JUS A;  3LSR A;  2XB5 A;  4A3M J;  3LSG A;  3HEF A;  1VF9 A;  2CUF A;  4V2G A;  4DYC A;  4DYR A;  3ZOB A;  4M3G A;  5M3F J;  1ORK A;  1ITY A;  1ZR4 A;  2DA6 A;  3HOY J;  2Y9Y A;  1W0T A;  4AYB N;  2XGD A;  1JKR C;  4B4C A;  5FJ8 J;  3Q0W A;  3GTL J;  5F1J A;  1FIA A;  3K2A A;  2XRL A;  2FJ1 A;  3HBL A;  1LE8 B;  2DA4 A;  1QRY A;  9ANT A;  4AUX A;  3HGY A;  3IH2 A;  3JRG A;  5EZG A;  2X9D A;  4A3G J;  1UMQ A;  1FIP A;  1AKH B;  1WCM J;  1RKW A;  4V2F A;  2PMZ N;  2E2I J;  3BG3 A;  1JJ8 C;  3S2D J;  4JP0 A;  1Z0X A;  2AHQ A;  4A3K J;  3Q3S A;  2H8R A;  5JLW A;  2QF7 A;  3GTM J;  2EH3 A;  1BW6 A;  1JTY A;  4BKX A;  5M5X J;  3SFI A;  2LY9 A;  2JA6 J;  4A3B J;  4S0H B;  3MN2 A;  4XRS G;  3BR2 A;  3JRE A;  2WV1 A;  1OFC X;  4HNV A;  1WH5 A;  2TCT A;  5J1U A;  1FJL A;  2JA8 J;  3SDG A;  5IP9 J;  5EZH A;  2M2E A;  4L5E A;  1HDD C;  3F0C A;  4A3J J;  3QPS A;  1FEX A;  1MH3 A;  3S14 J;  3A01 A;  1EF4 A;  3I4M J;  1B8I A;  1LFB A;  1TWA J;  1NK2 P;  2ELK A;  2ID6 A;  4MFD A;  3JRI A;  4C3I J;  4DW6 A;  2E2H J;  2M34 A;  1G2H A;  2HI3 A;  4AC0 A;  1PUF A;  1Y1V J;  3GBG A;  1FTT A;  2KDZ A;  1SAN A;  4C3H J;  4A3I J;  2R92 J;  2W48 A;  1RES A;  4CYC A;  3RKQ A;  2QCO A;  4NDL A;  2OPT A;  2TRT A;  2NVT J;  2VKE A;  5K7H A;  2X6O A;  2MSY A;  4C3J J;  2XB0 X;  1HF0 A;  4GFB A;  2LLK A;  3CCY A;  2NOG A;  3MKL A;  3BR3 A;  1X2M A;  3IH3 A;  5EG0 B;  2EZI A;  1AHD P;  2E19 A;  4D7M A;  1HOM A;  2HOS A;  1JTX A;  3C2B A;  3G1M A;  3WHC A;  2M8G X;  1A6I A;  3TW6 A;  1Z77 A;  1ZR2 A;  3A01 B;  4DZP A;  2NS8 A;  2IBD A;  2XGC A;  3O8G A;  2Y31 A;  4D7N A;  1CQT A;  4Y7N J;  1S7E A;  2VPR A;  4FIS A;  5FLM J;  1R9T J;  3HOX J;  4D5C A;  3BTI A;  2IAI A;  1JUP A;  1O4X A;  1F43 A;  2DMQ A;  1HLV A;  1JJ6 C;  2JK3 A;  3QQA A;  3ZQC A;  2NVY J;  1QVU A;  5J1R A;  1QVT A;  4B1R A;  4UUS B;  5DS9 A;  2LTP A;  1TWG J;  2L7F P;  1ZKG A;  3S2H J;  4A3E J;  2K9S A;  5EGO A;  3BR0 A;  3GTQ J;  1SFO J;  3CMY A;  1TC3 C;  3TP0 A;  3S1Q J;  4DYQ A;  3B6C A;  4MFE A;  5F0H A;  4EEF G;  1BA5 A;  3QPL A;  3LSJ A;  1IDY A;  2CUE A;  2R5Y A;  1QPI A;  4M3D A;  5GPC A;  5K7Z A;  2MW8 A;  5F0C A;  1XG1 A;  2I10 A;  5FKO A;  2DMN A;  3GTK J;  2K9N A;  3BG5 A;  3I4N J;  3RZD J;  1YRN B;  1U9O A;  2LR8 A;  2ME0 A;  4XID A;  3OOU A;  2LVS A;  3K7A J;  2R0Q C;  3RZO J;  4MO7 A;  4XRS A;  5IYC J;  1ETX A;  5C4J J;  3S15 J;  2DA7 A;  1ETY A;  3DEW A;  2JJ7 A;  2O9L A;  1VND A;  2GBY A;  2Y9Z A;  2JA7 J;  2O8K A;  3PM1 A;  4IHY A;  2DMU A;  3BTL A;  3RQI A;  3HOU J;  1H89 C;  5FKL A;  3TED A;  2R7Z J;  3FK7 A;  2CJJ A;  1HDP A;  4RDU A;  3BR1 A;  5E3L A;  2R5Z A;  1H88 C;  1IGN A;  1B72 A;  5E3N A;  3BG9 A;  4W97 A;  1UG2 A;  1VFC A;  1OCP A;  3W6V A;  2CU7 A;  2JMW A;  1NK3 P;  1Q1V A;  2VKV A;  2Y2Z A;  3ZQF A;  3SJM A;  4B3A A;  4Y52 J;  2JN6 A;  1RPW A;  5FLV A;  1JGG A;  2ECC A;  2EZL A;  1K61 A;  1IC8 A;  1ETQ A;  2FX0 A;  4A93 J;  1I50 J;  5IYB J;  1GUU A;  2Y30 A;  3TW7 A;  4XIC A;  2EZH A;  3VPR A;  3L1P A;  4IHX A;  2DJN A;  5E3O A;  2NVQ J;  1JUM A;  4JX5 A;  2LD5 A;  1X58 A;  2LP0 A;  4IEJ A;  3OSG A;  1MBF A;  2JWT A;  1BW5 A;  1IG7 A;  1TWC J;  2XGE A;  5IP7 J;  4QTR A;  3HKZ N;  2XSD C;  1P7J A;  5M5W J;  2XPU A;  2OF7 A;  2YS9 A;  1IRZ A;  5F0F A;  4FTH A;  2VUM J;  2DA3 A;  4JX4 A;  2HOA A;  1HCR A;  3NAU A;  2ECB A;  2DMT A;  1TWF J;  3NAR A;  5C4X J;  3ZQL A;  1B72 B;  5EEA A;  1AU7 A;  1B8I B;  1LFU P;  3GTG J;  5K7F A;  3JRD A;  1GV2 A;  2ZB9 A;  2DA2 A;  1MBG A;  5IOZ A;  1FTZ A;  4J19 A;  4BBS J;  4MIM A;  1IV6 A;  2B63 J;  4XRM A;  1PUF B;  5EF6 A;  1RKT A;  4QIW N;  5EDN A;  3LSP A;  2LKX A;  2DMP A;  2RAE A;  3CDL A;  1TWH J;  4UUT A;  4M3B A;  1LE8 A;  1MNM C;  4IHV A;  3HOV J;  3ZQH A;  2D5V A;  1D5Y A;  4CYC B;  3BR5 A;  3S16 J;  1NTC A;  4M3F A;  4M6V A;  2ME6 A;  3FIS A;  2Y0S N;  1DU0 A;  3S1M J;  1JKO C;  3HDD A;  1H8A C;  4DZJ A;  3JRB A;  2KT0 A;  3LNQ A;  3B6A A;  1WI3 A;  1U8B A;  1UHS A;  1K83 J;  4A3D J;  3BTC A;  2CQQ A;  3PO2 J;  3DCF A;  2E2J J;  3HGG A;  3ZQI A;  2HXO A;  2L7Z A;  4I76 A;  5M3M J;  4QSH A;  2NS7 A;  1MSF C;  5FKK A;  2EZK A;  2WB1 N;  2WAQ N;  5M5Y J;  1A5J A;  1APL C;  5IP6 A;  1W0U A;  5IYD J;  5GP9 A;  2CRG A;  1VI0 A;  2MGQ A;  1JKQ C;  5EYR A;  3JRA A;  4FE4 A;  3H3V K;  1RET A;  1ZTR A;  3IV5 A;  2GM4 A;  4C2M J;  1BL0 A;  3OIO A;  4I6Z A;  4JYK A;  5J3L A;  4X6A J;  3BR6 A;  2N8G A;  5C44 J;  2L7M P;  4A3C J;  3H0G J;  4BY1 J;  1MBJ A;  4D5F A;  5J1Y A;  2GLO A;  2MG4 A;  5EGO B;  2EBI A;  3FIW A;  4RBO A;  3JRC A;  5C3E J;  3BTJ A;  3JRH A;  3MVP A;  2COB A;  2XPW A;  2HOT A;  5F08 A;  1MBE A;  2NVX J;  5FKN A;  3ZQG A;  4W1U A;  2R5Y B;  1IJW C;  2HQ5 A;  4XK4 A;  1WGX A;  1GT0 C;  2HYJ A;  1ZQ3 P;  1GDT A;  2LK2 A;  1IDZ A;  3OSF A;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...