2M5WA

Nmr solution structure of the la motif (n-terminal domain, ntd) of dictyostelium discoideum la protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lupus La protein
publication title NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
rcsb
source organism Dictyostelium discoideum
molecule tags Rna binding protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m5wA00
1YW7A 2NNYA 3J7AO 4ZYGA 4WWCA 1WKMA 1FP1D 4KDPA 4LFUA 3T8TA 3E6BA 1KYZA 1ZG3A 2ZMEA 1XGMA 2FF4A 2P7CB 1O7FA 1MKMA 1R23A 2H6BA 3RJPA 3ZMSA 3DF8A 4PDKA 2YR2A 1T6SA 1K78B 5L3DA 1ZN2A 1D3YA 1TLHB 5D5XB 2JPBA 1Y0UA 1VTNC 4AD9A 4HDVA 3NRVA 2GA1A 3P9KA 4CYDA 1MDMB 1R1UA 5BPDA 3ZN1A 1I6XA 4KT5C 4P9FA 3IL2A 4EQQA 4HLXA 3QP6A 2VBYA 4FHTA 4U7BA 4U0WA 1G6NA 1R5GA 4P55A 3HSRA 4XLNF 1JHHA 5LGNA 1PP7U 5FFZA 3ZMVA 3F21A 4HX4A 1S3JA 2BBYA 4IRIA 3P7NA 3IRQA 5ILSA 1O3SA 1K78A 3K1PA 3JSPA 3E97A 3CJNA 1HSTA 4OMZA 4IHSA 3LQRA 1QNTA 1MDMA 4KYWA 3KP7A 1BI2A 4S05A 2J5PA 1I1SA 4JQFA 4GXOA 5LGUA 4YFKF 2YX7A 3HOSA 1D5VA 5HS7A 2K7LA 2DLLA 3SHFA 4ESJA 4HBLA 1UHMA 3LFKA 5ICCA 3DEUA 2R3SA 1KQ9A 1RIOH 2ISZA 2PBIA 4HZFA 4MHGA 3V7SA 1ZRDA 2DO7A 3GFJA 2YPRA 3KP5A 3TOBA 4RB1A 4FX0A 3WU0A 1X3UA 3C3WA 4U0YA 2FOKA 5DD8A 1OYYA 3GF2A 5LHGA 4BAYA 2OD5A 3NEUA 4L9JA 2KRFA 3MZHA 4G7OF 1XCBA 3V8JA 3O3KA 5LHHA 4OMYA 1U6GA 4R8HA 3RIRA 2W84A 1GXQA 3SQNA 1DPUA 3B02A 5CVRA 1FY7A 3GFIA 2V9VA 5DUIA 4A6EA 5LBQA 2EA4A 1TTYA 4I2OA 2IVMA 4Y13A 2JRTA 5ICGA 4L0ZB 4WXHA 1RUOA 3WE3A 2L4MA 4HAMA 2A3SA 2EFWA 1FWZA 1W5TA 3F23A 1OKRA 4Q4ZF 4LK0F 2M45A 3E5QA 4G6DA 2MH9A 4HDUA 5FO5A 4I98B 5DCFA 4M9SA 1I5ZA 1OMIA 1PDNC 2H94A 2DQLA 3MZYA 3WTWC 3LSTA 1SMYF 2FA5A 5ILVA 2R7DA 3CUOA 3HHHA 1K6OA 3O2PE 4A5MA 5JVTA 4OOIA 1DP7P 1W7PB 3K1MA 1DUXC 2ACJA 2XAGA 5D4SA 1TNTA 3DP7A 3KFWX 4RS8A 4A2UA 3TDUC 4EV0A 4HF2A 5TJJA 5JFRA 3BOQA 4EJVA 4ZZDA 6PAXA 1IN4A 4D0PA 5CYVA 4K2EA 2HFHA 3ECHA 2LKPA 5CJ9A 2CGPA 1JXSA 4I7HA 2FE3A 4WXDA 3CO7C 2YX4A 3R0JA 1YFHA 3L9FA 2QQAA 1B9MA 3L7WA 3JAMK 2V1DA 1BM9A 3WTYC 2IA0A 3I0TA 4LB5A 1D8JA 3BPVA 4EM2A 2Z9OA 1W7PA 5F64A 3RKWA 2WC2A 3BJOA 4LGWA 4UVAA 2UXNA 1IN5A 1P4WA 5FD5A 2FEZA 1IRGA 1XGOA 3DFGA 4RB0A 1LDDA 2NYXA 3I5UA 2YU3A 1LDKB 4ZZLA 2XVCA 3WTZA 2XV4S 1FP2A 5HS8A 1HKSA 2DBBA 4FX4A 1F4KA 4YIIA 3MEXA 3M1EA 2IJLA 3VOEA 2Q8KA 3CUQC 3QOPA 4DNCA 4G7ZF 4RGUA 1B6AA 4KFCA 4RB2C 1J0RA 3J80K 2PEXA 5BPIA 5F6FA 1SD4A 1U2WA 2FU4A 2EA2A 3L09A 3ZP5A 2MA3A 4CO8A 5L3FA 1Z9CA 1XDSA 3C18A 1HW5A 1IAWA 3EETA 5E17F 2CO5A 3EYIA 2RVCA 3CUQB 2OBPA 2MD5A 3GO5A 3GXOA 4M74A 3W6JB 1KQ8A 3RYPA 2OA4A 2Y48A 3HTUA 2O03A 1WWXA 1P92A 3F22A 2VOOA 1P4AA 1IXSB 2W25A 4ENJA 2XROA 3K2ZA 3E5UA 4I09A 3EQLF 3R6SA 3K69A 1L0OC 1YS6A 1U5TC 3PFIA 3I54A 3HSEA 1FYLA 2FNPA 1IN6A 2ADUA 2LSOA 3BZ6A 3QAHA 2ETHA 2IPQX 2VT3A 1LEAA 2VOPA 2VBXA 3GW2A 1W5SA 1O3QA 2FBKA 4EGYA 1ZG1A 3V7RA 2QWWA 3KZYA 5DUKA 1MZBA 3HRMA 3GFMA 4EGZA 3R0AA 4JBAA 3S2WA 1G4DA 2VONA 4I0BA 1EV7A 2MBFA 2VT2A 3CUQA 1RUNA 1U5TB 2PMHA 5LHIA 3H92A 1ZHFA 2GXGA 4UNOA 3Q9VA 3RDIA 5KK1A 3E6CC 3TQNA 5ILUA 3E5XA 2V1UA 1FBQA 4RGRA 2UWMA 1P6RA 2STWA 3JW4A 4KIFA 3VFZA 2DK8A 2VBWA 2EK5A 1EH8A 3KP3A 4RB3C 5ICEA 4Y15A 2XAFA 4ESFA 5LRRA 1XSVA 3BY6A 4CGZA 2FXAA 3ISPA 3TKYA 3Q5FA 2OZ6A 3GZ6A 1S29A 2M1BA 5L3EA 3ULQB 1S7AA 1UB9A 1ULYA 3HRSA 3KLOA 2DFIA 1U5TA 2WWYA 1LVAA 4PZJA 5AIPA 5IT3A 2Q0OA 5D5VB 1XMKA 3FWEA 2D1VA 2HQRA 3HYIA 2FSWA 2BYVE 2XIGA 2FMLA 1KU9A 1MGTA 4LJZF 1R00A 4LMYA 4YG2F 3F8BA 4LG0B 1OYIA 2D1HA 1TQIA 2QUFA 3GUDA 5TRDA 2VODA 4Z2YA 5E8IA 1XSXA 3QP5A 2GWRA 4GCVA 2CYYA 1YLFA 2KIFA 3C7JA 2DPDA 4TV7A 3O6BB 5JHUA 5LEKA 5HLIA 3FF5A 2M8EA 5BOXA 1KA8A 3GWZA 1GXPA 4U7DA 2HZTA 4XSXF 2A6EF 3BWGA 2EFNA 1IXCA 4F7ZA 1FBSA 4L0YB 4AWXB 3SFZA 2JT1A 5K5QA 1FNNA 1WSUA 5K5RA 1H9TA 1O3RA 3BJAA 4G8XA 2HR3A 2CSOA 2EFOA 1SD5A 2RNJA 3ERED 1R7JA 2J5OA 3GFLA 5FFXA 3F6VA 1KU2A 1O7LA 3ZMUA 4LG0A 1S6LA 2ZCWA 3LA2A 2ZKZA 2Z33A 1SD6A 4EJUA 2P8TA 4MEXF 4XSZF 3RPQA 2JSCA 5DCMB 3HRUA 3L00A 5J6XA 3TO6A 3WG9A 3BPXA 2B0LA 2HYGD 2WV0A 2A5YB 3MFKA 2P6SA 3SZTA 3GLXA 3TO7A 3GZ5A 1E17A 3ABUA 1OYWA 5K5OA 2EJRA 1PP8F 3HHGA 1WI9A 2P5VA 1XSDA 2DQRA 2ZBKA 1IZ1A 4Q48A 5DYMA 1RNLA 2M87A 2CQKA 3WTSC 1IN8A 5E20A 3L2CA 4IPAA 2O0YA 4ZH4F 4R1HA 3FM5A 3N97A 1IW7F 2XAQA 1LJ9A 2OZUA 2HOEA 2G9WA 5ED4A 2ISYA 4PGHA 2PG4A 5DCMA 1KYWA 1R1VA 1YYVA 2D2WA 5DV5A 3JTHA 2L4AA 1ZYRF 4LK1F 2ZFWA 2E1CA 2QZ8A 4KICA 3LA3A 3BDDA 3FX3A 4GO1A 1RZ4A 1QO0D 3IKVA 4KIBA 3GX4X 5IT9Z 2F5CA 2M5WA 4OINF 3EUHA 1G3TA 1QPMA 3HSFA 1IF1A 1A04A 1ZAOA 3LQQA 3KP4A 1LEBA 1B4AA 2DW4A 1Z7UA 1J75A 1O3TA 3P9IA 4BHBA 2Z3YA 1J7KA 2H09A 4RGXA 1YW8A 3JAMZ 1W7PD 3WE2A 1BJAA 2O3FA 5D6FA 4OU0A 1LQ1A 3FMRA 4KMUX 2PI0A 2OQGA 1YG2A 2AXLA 4OIOF 4U88A 3KP2A 2IP2A 2K27A 4MEYF 4ENKA 4XLPF 2HS5A 2YSRA 2G7UA 3T8RA 2XGXA 2XAJA 1SFUA 2HGCA 2VN2A 4GYGA 3F72A 2A68F 5HLGA 4M9ZA 5FGMA 2K4JA 3VEPA 1TBXA 4BH9A 3R4KA 5CLSA 2HDCA 4MNUA 5DDGA 5D5UB 1H9GA 1BI1A 5IT9K 4P96A 3F8MA 4UVCA 1BIAA 2HKOA 2VBZA 2K86A 5BMZA 1ZARA 1PUEE 4BQAA 2E1NA 2MLGA 4YFXF 2O6GE 3K0LA 2GQQA 1FX7A 1KU3A 3J80Z 1R58A 3G73A 4ZYEA 2XKOA 3I71A 4M73A 5E18F 2W24A 2EWNA 2C6YA 4EM1A 4ZYDA 3WU1B 2F5EA 5DD4A 1UFMA 2AS5F 4P5OA 4EJWA 3F6OA 1HXDA 3KEQA 2FMYA 2E7WA 1QBJA 1ZLJA 2Y0MA 1ZRFA 2DI3A 1IXRC 3K1NA 1B1BA 3ZPLA 1FSEA 4A0ZA 1KQ0A 1QGPA 3I58A 1R1TA 3J81Z 3PQKA 2F5DA 4MTEA 4MQ9F 1YO5C 3RTRA 4MTDA 3C1DA 3WGIA 1HBXG 2CG4A 2FBHA 3MCZA 1MD0A 2EV6A 4KIGA 2RDPA 4CHUA 4B8XA 4NB5A 2HQNA 4NQWA 4G7HF 2QVOA 2BEOA 4EVIA 1XMAA 2Y75A 2IA1A 1FYMA 3T1BA 2QLZA 4KNYA 1B9NA 2VE8A 2ZNZA 2GZWA 5BS6A 4O3MA 1BI3A 4HF1A 2XAHA 4XBFA 4HQMA 2KIUA 3BROA 2KKOA 1E2XA 2MLKA 1G3YA 4ZYHA 2M30A 5EEGA 2FQ3A 4YIFA 1G3WA 1SFEA 4I0AA 1ODDA 5HOOA 2PN6A 4HV6A 3OOPA 3FXRA 3FXQA 4O5VA 5D8KB 4JK1X 3F3XA 1REPC 3J81K 4WCGA 1G3SA 4HLYA 3IRRA 4KMFA 4G94A 3DKWA 1B59A 4HA8A 5L3GA 4L18B 2QQBA 4QLCU 3IC7A 2ESHA 5A2QZ 3TGNA 5FLXK 1BN5A 4L9VA 2L02A 4CDGA 2JZYA 3EYYA 3F8CA 2L54A 5DEQA 2DTRA 3GEZA 1NHAA 2EFQA 3HRTA 2PLYA 3B73A 5D4RA 1HKQA 1OPCA 4CZZA 3W6KB 4O6JA 5AONA 2DPUA 3IKTA 2XKPA 2BGCA 4WF2A 2NS0A 1SAXA 2FNAA 3MAJA 3HUGA 5H6RA 3K9TA 4LLLA 2KJCA 1SMTA 1CF7B 1ZGJA 3CDHA 3AAFA 4LLNA 2W57A 1XCVA 1ONVA 5H6QA 2RKHA 4L9NA 2NNNA 1R36A 2COMA 5D8LB 4Y17A 2OAZA 2LF7A 1FLIA 4L5JA 4KUMA 4A12A 4IF4A 5FB2A 1YIOA 1QQIA 2EFPA 1GVJA 4M72A 3E6DA 5A2QK 2RQPA 4OIQF 4RAYA 4H0EA 1FC3A 2A6HF 4A6DA 1DPRA 1KU7A 1FYKA 4OIRF 1U3EM 4KN4X 2K4BA 2GIVA 1T2KA 3FMQA 3LA7A 5AIQA 3OV8A 1CF7A 2HEOA 3BP8A 4IJAA 3N4MA 5D5WB 1F5TA 2VC0A 3ML6A 4Q47A 5F1RA 2GA2A 1TW2A 4CICA 2XASA 2Z5UA 4UV8A 1WQ2A 1Z6RA 3ECOA 3R60A 1U8RA 2IW5A 5CVJA 2QQ9A 4ESBA 1XB4A 1BBYA 1IUYA 1ZLKA 1V4RA 3VB2A 3H3ZA 3ABTA 2ZNYA 2IA2A 1TQPA 2GAUA 5CVIA 4KA4A 2HTJA 3HTSB 3F8FA 1OR7A 4MGRA 1USTA 1JHFA 3RPUA 4ETSA 2K02A 3DPTA 4LD5A 4OIPF 1SFXA 3V8LA 5BQTA 5E1WA 5K1YA 4IHTA 5CVVA 1QZZA 4UXNA 4A0XA 1J2XA 2DT5A 4G6QA 3ZQ7A 5HDGA 1TQMA 2E7XA 1ZRCA 2O61A 3E6MA 1Z91A 3V4GA 5E1ZB 1FT9A 1XGSA 3M7GA 3WTUC 3M8FA 2CW0F 1FPQA 4HQEA 2H6CA 1S8NA 4A5NA 3DXJF 4ON0A 3I59B 2A69F 1J9IA 2RV8A 4S04A 1JGSA 3LAJA 4ENMA 2PJPA 4UV9A 3T5XA 2QENA 2DK5A 4WXCA 4L5IA 1O57A 4M71A 3WGGA 4EM0B 1AWCA 3ROUA 2P7VB 2FRHA 2LNBA 1BC7C 1EH7A 4P9UA 3SXYA 2V6CA 2ELHA 3QU3A 1FZPB 1ON2A 4HYEA 2EV5A 5KVRA 2A61A 2HKXA 1UCRA 3RI4A 2D45A 3JTGA 5HDKA 2P4WA 3FHZA 1BI0A 4EJOA 2QBYB 3I59A 1TNSA 3QU6A 5LGTA 1ZREA 5JR3A 3IWZA 1AOYA 4HX8A 2Z99A 1XDUA 3RYRA 3KLNA 2L3DA 4U0VA 1H0MA 1FBUA 1IN7A 1LDJA 2DAOA 2CFXA 3CLOA 3HOTA 4Q5SF 4YFNF 2OQRA 2GXBA 3HIFA 4M6XA 4IXAA 2A07F 1ZG5A 4IVNA 4FT8A 4R79A 4LLGF 4CXFA 4EMSA 4L9TA 1T38A 3R61A 4AIJA 5ICFA 3IWFA 1T98A 3CTAA 4XRFA 1Z6TA 5LRSA 3LAPA 1XN7A 1CGPA 3COAC 3RKXA 2HTSA 3I53A 4IRGA 1BC8C 1P4XA 2NAZA 1HQCA 2QBYA 2EB7A 2TDXA 2MH2A 1J59A 2QYOA 3Q9SA 1HW2A 5CVUA 2OU2A 4WK8F 1EH6A 2IT0A 1DDNA 2P6TA 5LLQA 4PCQA 1R5HA 4RGSA 3DQVC 2WTEA 1ZGAA 3ZMZA 5LEJA 2O8XA 5EEHA 5HS9A 3PQJA 3WGHA 5J8CA 1HKTA 4KN7X 3IHUA 3RKYA 4LB6B 3ZMDA 3TDZC 2LF8A 4ENNA 4HOBA 2ZO4A 5J8FA 4DQ2A 3V7CA 4BHPA 1W4MA 2H27A 3TO9A 4AIHA 1QZYA 3KE2A 4I02A 2G7HA 3M8EA 3NQOA 4HW0A 2VC1A 4N0BA 4HV5A 3KZZA 2F2EA 2CWEA 2VE9A 3MQ0A 4G9YA 2X0LA 3U2RA 1TW3A 3KETA 5E1XA 3QPHA 5ERIA 1GHCA 3LWFA 1Q1HA 1U78A 3KCCA 1USSA 1YW9A 2UXXA 2F5FA 2RGVA 3QPTA 2PQ8A 4GYIA 3BJ6A 4MQVA 2HWVA 4M6YA 1XGNA 3GVAA 1YQAA 3DV8A 4BXUA 4NHJA 4I01A 4M9XA 2HYFA 1IRFA 3U9GA 3E3VA 5FD6A 2XUBA 1BIBA 3FZVA 2KJBA 3VODA 5FLXZ 3KP6A 2RC4A 2XHKA 2STTA 1V3FA 4ASNA 2UZKA 4EJTA 5L3CA 2JTVA 2DU9A 3QRFF 3P9CA 4WX9A 4UUVA 3FXUA 3D5LA 2ESNA 4N9IA 5L3BA 3F8NA 3M9AA 4B09A 2ZXJA 2P5KA 1YS7A 1KGSA 4A0YA 3SZPA 1WRJA 1S7OA 1LB2A 1RI7A 2PFBA 5JI6A 5D6EA 4N9HA 2VXZA 4HF0A 1MJAA 5HVQC 2MC3A 1T0FA 1T39A 1HW1A 3WTVC 4BYYA 4HX7A 2XRNA 1XD7A 4UHTA 1YTYA 1ZH5A 1I1GA 3H3UA 2PMUA 1D8KA 2EV0A 1C0WA 3FM3A 5HLHA 3ZMTA 2BE5F 4BHCA 3U1DA 2R7FA 4AVPA 1I27A 4E70A 3V8KA 3D0SA 1ON1A 3I4PA 1K7AA 3I64A 1F9NA 3KEOA 1F1ZA 3WTTC 4BNCA 2BV6A 1FSHA 2X4HA 3REOA 5E8GA 4RAZA 2V79A 1J5YA 4QWQA 3ZN0A 2Q2EA 4GGGA 1SD7A 2RN7A 1HSJA 2W85A 4UVBA 2P5LC 2IRFG 2JPCA 1LNWA 3G3ZA 3DPLC 3ELKA 2L01A 2ZJ2A 2ZMEB 4IRHA 1UHWA 2KIMA 3MWMA 1K79A 3CO6C 1BOAA 2NRAC 5H20A 3GYHX 1MJBA 3WODF 3TOAA 5HDNA 1FOKA 2FBIA 4AIKA 3FMSA 3WTXC 2V1XA 1R22A 2QM3A 1Z1DA 3T0YA 3EDPA 4PGGA 1Z05A 1MJ9A 3JSOA 1P2FA 1STZA 1JE8A 2LDUA 1L3LA
chains in the Genus database with same CATH superfamily
1YI2I 2BVMA 1TWHJ 2V9KA 1YW7A 3IH2A 2NNYA 3J7AO 4RA2A 4S0HB 4ZYGA 5M3FJ 4WWCA 1WKMA 1ETQA 4XRSA 1FP1D 2ZXHA 1W36C 2VASA 3G2BA 4KDPA 4LFUA 3K4LA 3T8TA 2CV2A 1YRNA 1W36D 2OF7A 2LOOA 2X1DA 3E6BA 1KYZA 1ZG3A 2W48A 2ZMEA 1APLC 1XGMA 2FF4A 4HRIA 3JRIA 2P7CB 1UG0A 1O7FA 4CYCB 1MKMA 1R23A 2H6BA 1TWAJ 3RJPA 3AG2H 3DF8A 3ZMSA 2HNHA 4PDKA 1PUFA 2YR2A 2ZJPF 1T6SA 1K78B 5L3DA 1ZN2A 2CUJA 1D3YA 1TLHB 1X1CA 2JPBA 3TMOA 5D5XB 1Y0UA 3LSHA 3MKZA 1VTNC 1Y1VJ 4AD9A 1Z3YA 2LMDA 4HDVA 3A1YA 3NRVA 2GA1A 3P9KA 4CYDA 2EIKH 1MDMB 2DDBA 2ID6A 4NNJA 1R1UA 2JMWA 4BE2A 5BPDA 1JKQC 3GTQJ 3ZN1A 4XM3A 1I6XA 4KT5C 4P9FA 1W5CC 3M4OJ 2F4OB 3IL2A 4EQQA 4HLXA 3QP6A 3BTIA 4CCLA 3KIOA 2VBYA 4ZTFA 3OWTA 4FHTA 5EGOB 4U7BA 4U0WA 3S8PA 1G6NA 4IL6C 1R5GA 4P55A 4C3IJ 2MABA 3HSRA 5TGTA 4XLNF 3K4CA 1JHHA 3MZ8A 2E2JJ 3MD2A 5LGNA 2KPMA 2VKDA 3IUOA 3M8JA 1X19A 1PP7U 4MIMA 3IH3A 5FFZA 4BE1A 3ZMVA 1X3WB 1VQLI 3F21A 4HX4A 1S3JA 2BBYA 4CYCA 1X1AA 4IRIA 3P7NA 3BC8A 3IRQA 5ILSA 1O3SA 1K78A 1I3QJ 3K1PA 3JSPA 3E97A 3CJNA 2FJ1A 3H5NA 1HSTA 3RQ4A 2R7QA 4OMZA 5FJ8J 4IHSA 3HEFA 1W0TA 2DMUA 2KIQA 4MO7A 3K70D 1T08B 3LQRA 1QNTA 3M3YJ 1MDMA 2QKLB 1MMSA 2VLAA 2AHQA 1GV2A 1OJLA 4C3HJ 5H2FC 4KYWA 3KP7A 1BI2A 4S05A 2GBYA 1K83J 3BG9A 2J5PA 2EZKA 5F04A 1I1SA 4JQFA 3L1PA 1TWFJ 4HG2A 1S72I 4GXOA 5LGUA 1OCRH 2M8GX 4V19K 2KLOA 3U21A 2K9SA 4YFKF 1RC9A 5EGOA 2YX7A 2EH3A 3HOSA 1D5VA 1RR7A 2MD0A 3ZRGA 5HS7A 2K7LA 2DLLA 2DOEA 3I9V2 3SHFA 1R5ID 4PJNA 5B3SH 1PVEA 4ESJA 4W1UA 4HBLA 1UHMA 3LFKA 2K9LA 1XC5A 1MH3A 1Z0XA 4X1EA 3S1RJ 2R7ZJ 3NARA 5ICCA 3DEUA 4ZTJA 2R3SA 2GOXB 1KQ9A 3I4NJ 4J19A 2R7XA 1RIOH 2LLKA 2ISZA 2O8KA 1UAAA 1X2MA 2PBIA 3E7LA 4HZFA 4MHGA 3V7SA 1ZRDA 2DO7A 3GFJA 4W97A 3GTPJ 3IP4B 2UUZA 2YPRA 3KP5A 3TOBA 2E5NA 4RB1A 4A3CJ 1NG7A 3BR0A 4FX0A 3WU0A 1X3UA 2NOGA 2VQGA 3G71I 4UB6C 3C3WA 5FKLA 3C2BA 4U0YA 2FOKA 5DD8A 1OYYA 3GF2A 5LHGA 4BAYA 2OD5A 3NEUA 4L9JA 2KRFA 1SVMA 4BU2A 4D7NA 3MZHA 1YJNI 4G7OF 3A4CA 2LKSA 1XCBA 3V8JA 2ID3A 2GIZA 3H35A 3O3KA 3LSGA 5LHHA 1FEXA 3BCAA 1ORKA 5DM7F 4AVZA 1XS9A 4OMYA 3HPHA 1WH7A 2WB1N 3OIOA 3SEQA 3FK7A 1U6GA 4R8HA 2LP0A 3RIRA 2XSJC 2RQQA 3LMMA 2W84A 1GXQA 3SQNA 3KZIC 1DPUA 3B02A 5CVRA 1ZGWA 2JJ7A 2LG4A 3WU2C 1FY7A 4DJAA 3GFIA 2V9VA 5DUIA 2A05A 3C2HA 2M3AA 4A6EA 3JR9A 5LBQA 1QVTA 3JRDA 2EA4A 3H9QA 4CZCA 1B72B 1TTYA 4JX6A 4I2OA 1V5GA 2IVMA 4Y13A 3DLLF 2JRTA 3G4SI 2WY7Q 3RQIA 1R4MB 5ICGA 4II2A 3V42A 4JX4A 4L0ZB 4C9YA 4XQFA 2IBDA 4RAFA 1VZ0A 3OYGA 4WXHA 1RUOA 4AIDA 5DS9A 3WE3A 2HI3A 2L4MA 1YJWI 5J40A 4HAMA 3WG7H 2A3SA 4RAGA 2EFWA 4BS9A 1FWZA 1W5TA 3AG3H 2KQRA 1OKRA 3ONQA 4Q4ZF 4RM3A 3F23A 1FTTA 2VJ4A 2HDDA 3OYMA 4LK0F 2Y30A 4HPQA 2WY8Q 2M45A 3E5QA 4G6DA 2MH9A 4PJ0C 4HDUA 5FO5A 4I98B 4MFDA 3G1OA 5DCFA 4M9SA 3L2VA 1WJCA 3LOCA 3FXKA 1I5ZA 1OMIA 1PDNC 2H94A 2HVSA 2DQLA 2ZJRF 2HQ5A 3Q0UA 3MZYA 3WTWC 3LSTA 1SMYF 1UHSA 1HOMA 4HNUA 2FA5A 2BY2A 5ILVA 2R7DA 3CUOA 4LOCA 3MKWB 4M3BA 3HHHA 2BXYA 2DYRH 3O2PE 1K6OA 1B72A 2XB5A 4A5MA 1FIAA 4OOIA 5JVTA 1DP7P 2BY0A 1W7PB 4U87A 3K1MA 1DUXC 2VUMJ 2ACJA 1A5JA 2XAGA 5D4SA 1TNTA 1VNDA 3DP7A 3HKZA 3KFWX 2L7MP 2XPUA 4RS8A 4A2UA 3X2QH 3CP2A 1SFOJ 3TDUC 4EV0A 4HF2A 5TJJA 5JFRA 3BZCA 3BOQA 4EJVA 4ZZDA 6PAXA 4PSXA 3TL4X 4EEFG 3RZDJ 1IN4A 3BT9A 4A3DJ 4D0PA 5CYVA 4K2EA 3SDBA 1UJ8A 2HFHA 3ECHA 2NVXJ 2I5UA 3CLQA 4H4KC 2X51A 2KRHA 2LKPA 5CJ9A 4XOTA 2CGPA 1FMVA 1V5FA 1JXSA 1ZK8A 4I7HA 2FE3A 5J1UA 4WXDA 2DA3A 2P81A 5J4VA 3CZ6A 3CO7C 2YX4A 3FK6A 3R0JA 1YFHA 1D1BA 3L9FA 3F0CA 2QQAA 1B9MA 2QKMB 3L7WA 2KZGA 3MKLA 3JAMK 1AU7A 1MH4A 2V1DA 3A02A 5B5EC 3CCQI 1BM9A 2LY1A 2OJED 3CCMI 3WTYC 4KT6A 2IA0A 2R4GA 3I0TA 1ZR2A 2HVQA 3TEDA 4LB5A 3K4JA 1D8JA 3BPVA 1QVUA 4EM2A 2Z9OA 1SVOA 2DDAA 5CKTA 1OCTC 1W7PA 5F64A 4XKCA 4XLEA 3RKWA 2WC2A 4GFBA 3K4MA 3GTJJ 3BJOA 4LGWA 4UVAA 2UXNA 2OC6A 1IN5A 1GV5A 2QCOA 1P4WA 2VI6A 5FD5A 2FEZA 4V2FA 1A36A 1IRGA 1XGOA 1Y8QB 2MFZA 2DMTA 5EF6A 3DFGA 4RB0A 2R0QC 1LDDA 2NYXA 3I5UA 5LFAA 2YU3A 4B48A 5GTIC 1LDKB 1GUUA 4GRIA 1WZ2A 4ZZLA 4IOAF 2XVCA 3AG1H 3WTZA 2XV4S 1FP2A 4ZDOA 2CUZA 5HS8A 4XICA 1HKSA 2PMZN 3KPHA 3KYCB 2DBBA 4FX4A 4ITVA 1F4KA 4YIIA 2XAUA 3MEXA 3QYEA 3M1EA 2IJLA 5JLXA 1Y0NA 4BUPA 2HVRA 2BVLA 5HNFA 3VOEA 3OS1A 1LVKA 2M0CA 3ASOH 2Q8KA 5FLMJ 2K3PA 2MYSA 2DA5A 3DWLE 2Z2SB 3CUQC 3IH4A 3QOPA 4DNCA 5GADJ 4G7ZF 4RGUA 1R4NB 1B6AA 4KFCA 4RB2C 1J0RA 1V55H 3J80K 1U9NA 2PEXA 2LTPA 5JHFA 4DOZA 3K4BA 1QPIA 2KISA 5BPIA 5F6FA 4XKBA 1SD4A 2DA6A 2E2IJ 1WI3A 1VQ6I 2GOMA 1U2WA 3TW7A 2FU4A 2EA2A 3O8GA 4F3QA 3L09A 3ZP5A 1VQPI 5J4YA 1B8IB 4C2UA 4BJ6C 2R92J 2MA3A 4CO8A 5L3FA 1Z9CA 2IGNA 1XDSA 2Z16A 3C18A 1HW5A 1BJZA 1LFPA 2WAQN 1IAWA 3EETA 3EPZA 1PJRA 1PYVA 2QSHX 2HZDA 5E17F 2CO5A 3EYIA 2RVCA 3CUQB 3CMEI 2OBPA 3BR3A 2MD5A 2NS7A 3GO5A 3GXOA 2AO9A 3PO2J 4M74A 3W6JB 4KISA 5KAFC 2ZMEC 3RYPA 1KQ8A 2OA4A 2TRTA 2Y48A 3HTUA 3HOZJ 2O03A 4ANJA 1WWXA 1P92A 4XKVA 1X58A 2OCCH 2B63J 3F22A 4AYBA 3CCSI 1JUPA 3JRAA 4IHYA 2VOOA 1P4AA 4ABZA 1IXSB 4CCNA 4JYKA 2W25A 2ZXWH 3DEWA 4ENJA 2V4JC 2R7VA 2XROA 3K2ZA 3CCLI 1WJDA 3ERMA 4DYCA 2M4GA 3E5UA 1DQUA 4I09A 3CC4I 3EQLF 1WCMJ 3R6SA 2QQ8A 1Y6IA 5EDNA 5LD2C 3CCEI 3K69A 1LPQA 1L0OC 1YS6A 1ETOA 1U5TC 3I54A 3HSEA 3PFIA 1FYLA 4B47A 1JGGA 2FNPA 3HOUJ 1IN6A 4NUBA 5F27A 2ADUA 2LSOA 3BZ6A 3QAHA 2ETHA 2IPQX 2VT3A 1LEAA 2VOPA 2VBXA 5EZGA 4JP0A 5KCMA 5IP7J 4IHXA 2M7AA 3GW2A 2EQRA 1W5SA 2ECCA 1O3QA 2FBKA 4Z6YA 4DZJA 4EGYA 1ZG1A 3S2HJ 4XL9A 1B8IA 3V7RA 1QU3A 2QWWA 3KZYA 1IDZA 5DUKA 5TISC 2E19A 1YOVB 2YUSA 1MZBA 1RPWA 3HRMA 4B4CA 3GFMA 2VJ5A 2K40A 4EGZA 3R0AA 1SFKA 4JBAA 2LRDA 3S2WA 1MBKA 1G4DA 2VONA 4I0BA 1EV7A 1DU0A 2MBFA 4Y52J 2VT2A 3CUQA 1RUNA 3QYBA 1U5TB 2PMHA 5LHIA 2DA7A 3FKIJ 3H92A 1VQNI 1KZHA 1ZHFA 2GXGA 3GTGJ 4UNOA 3FXLA 2EZIA 2R7OA 3Q9VA 2F6CA 2CQQA 3RDIA 5KK1A 4G12A 4LIVA 1DP3A 2V1NA 3E6CC 3TQNA 5ILUA 1MBHA 3E5XA 1CQTA 2V1UA 4DYQA 1FBQA 2VJJA 1RESA 4RGRA 1P7IA 2K5CA 2UWMA 1P6RA 1H88C 2STWA 2R7UA 2ECBA 4FETA 1IDYA 2VXDA 3BR2A 2M7BA 3JW4A 4KIFA 3VFZA 3ZQGA 2DK8A 2M9HA 4PUSA 2VBWA 5FROA 4RLFA 2EK5A 2L9SA 2FX0A 4DZPA 1EH8A 4N4OB 1NK2P 2X6WA 3KP3A 2COBA 4RB3C 2OCEA 2R93J 2EZLA 2K9NA 2Y0SN 1FOWA 2IGKA 5ICEA 4Y15A 1HDPA 4PSWA 4J01A 2XAFA 4ESFA 1SC7A 5LRRA 3PNYA 1D5YA 4XNFA 1XSVA 3BY6A 4CGZA 2FXAA 3ISPA 4N4NB 1XG1A 4BACA 2QSFX 2WAEA 3TKYA 2DMNA 2DCEA 3Q5FA 2OZ6A 3GZ6A 1S29A 1UG2A 2M1BA 1IRXA 5L3EA 3ULQB 1S7AA 1UB9A 3CJRB 1ULYA 4QPQA 3HRSA 3KLOA 5BNGA 2DFIA 1U5TA 3HOVJ 2M4KA 2WWYA 4ZYAA 1LVAA 4PZJA 1RETA 1IJWC 2NOJB 5AIPA 5IT3A 2Q0OA 2BHZA 1SAUA 1JTYA 2E2HJ 2KMUA 4OAYA 1HDDC 5D5VB 3GLLA 1XMKA 3FWEA 2D1VA 2HQRA 2O7OA 3HYIA 2FSWA 3OIPA 3OR1C 2BYVE 2XIGA 2FMLA 2CUFA 4A3KJ 1LFBA 1KU9A 1MGTA 4LJZF 1R00A 4LMYA 4YG2F 2IS2A 1A6IA 3F8BA 3HC7A 4LG0B 5GPAA 2DA2A 1OYIA 2D1HA 1TQIA 2QUFA 5FKNA 3GUDA 5TRDA 2VODA 3ASNH 4Z2YA 1XSXA 3U1KA 5E8IA 2I10A 3GTMJ 1N75A 5DTDA 3QP5A 1BW6A 2QA4I 3ESWB 2GWRA 4GCVA 2CYYA 1YLFA 1HLVA 2IS6A 2KIFA 3C7JA 3S1QJ 2DPDA 5C3EJ 1ZKGA 3BR6A 4TV7A 4D5CA 1N25A 2XF7A 1Y1WJ 3O6BB 4UB8C 5JHUA 1YX5A 2VKHA 1MSEC 5LEKA 3BTLA 5HLIA 1IV8A 3FF5A 5J47A 2M8EA 1UZCA 5BOXA 1KA8A 4IEJA 3GWZA 2X9DA 4U7DA 3HG9A 1GXPA 1T56A 2HZTA 1Y39A 3FXMA 4XSXF 1A6QA 2A6EF 2QEXI 3BWGA 4A3FJ 2EFNA 1IXCA 4F7ZA 5F08A 5GAHJ 1FBSA 3LFUA 4L0YB 4AWXB 3SFZA 2JT1A 3NWSA 2HPMA 2NXNB 3DKYA 3PNTA 5K5QA 1FNNA 1WSUA 1ZQ3P 5K5RA 1H9TA 4XKWA 1O3RA 3BJAA 4G8XA 4FASD 2ELKA 2HR3A 2DOFA 4RMNA 2CSOA 4CSWA 1XPXA 1W0UA 2EFOA 1SD5A 2RNJA 3ERED 3HGGA 4E7LA 1EJ9A 1R7JA 4PFOA 4Y4RA 4LG3A 3S17J 3MKYB 2J5OA 3GFLA 5FFXA 3LSKA 2ME0A 3F6VA 1KU2A 1O7LA 5E3LA 3ZMUA 3K7AJ 5KAIC 1LUJB 4LG0A 1S6LA 2ZCWA 3LA2A 2ZKZA 1XX5A 3EUHC 2Z33A 1SD6A 4EJUA 2P8TA 4XN0A 4MEXF 1OCOH 3H36A 4XSZF 4UUSB 3BG6A 1MBFA 3RPQA 2JSCA 5DCMB 3HRUA 3L00A 3N05A 5J6XA 3OYFA 3TO6A 4BEHB 1AKHB 5CPRB 3WG9A 3BPXA 2B0LA 2HYGD 2WV0A 2A5YB 3MFKA 2P6SA 3SZTA 3VYSB 3GLXA 3TO7A 3GZ5A 2Y9ZA 1E17A 4B3XA 3ABUA 2IGMA 1OYWA 1IGNA 2Y9YA 5K5OA 2EJRA 1PP8F 2JRMA 2LKXA 2JQ7A 3HHGA 1WI9A 2P5VA 1XSDA 2KHMA 2DQRA 4M3DA 2XGCA 1QHGA 2DT6A 2ZBKA 3CQZJ 3NWTA 3W2AA 3JRHA 1IZ1A 5HODA 2DA4A 3HOWJ 4Q48A 5DYMA 4MFEA 2GXAA 1RNLA 4FCYA 4DIQA 1YJ9I 2M87A 2CQKA 1POGA 3WTSC 1ITYA 1IN8A 2LR8A 5E20A 3L2CA 1ERDA 4IPAA 2O0YA 3ZQLA 1P9QC 3RKQA 4ZH4F 4R1HA 4CCKA 1TT5B 4CCOA 1YIJI 2V9PA 3FM5A 3Q0WA 4NDLA 3HJEA 3N97A 3CF5F 1IW7F 4E7ZA 3CF2A 4A3JJ 5FLVA 3M07A 2XAQA 1Z3XA 3TP3A 4DGWB 1H89C 4UUSA 1LJ9A 2OZUA 2HOEA 2HYJA 2G9WA 2Y2ZA 2ISYA 4PGHA 5F1JA 5ED4A 3OR2C 2PG4A 3OYDA 5DCMA 1KYWA 1R1VA 1YYVA 2D2WA 5DV5A 4BEHA 2H8RA 1AKHA 3JTHA 1T95A 2L4AA 2L7ZA 1ZYRF 4LK1F 1VQOI 2IS1A 2ZFWA 2E1CA 5J1YA 3D5SC 2QZ8A 4KICA 5EZHA 3LA3A 3BDDA 3A0BC 1VQ7I 3FX3A 4GO1A 3DBHB 1RZ4A 4HEA2 3OYHA 3CCYA 1QO0D 2Y69H 3IKVA 4BXXJ 1VQ5I 2JVHA 4XN3A 4KIBA 3GX4X 5IT9Z 2F5CA 1TZLA 1OCCH 2M5WA 4OINF 3H3VK 4YIRX 1GT0C 3EUHA 1G3TA 2ZXIA 4CH7A 1D1AA 1VFCA 1QPMA 3RZOJ 5IOYA 4UY8I 1WPKA 3HSFA 4YELA 1IF1A 1A04A 1R6RA 1ZAOA 3LQQA 3KP4A 3JRGA 1LEBA 1ZR4A 1JT6A 1B4AA 3TP0A 2DW4A 1Z7UA 1J75A 1O3TA 3S2DJ 1Y56A 3P9IA 2EZHA 1RKTA 4BHBA 2Z3YA 1J7KA 3I4MJ 3QPSA 4IO9F 2H09A 4RGXA 5IPAA 2XSDC 3GTLJ 1YW8A 3JAMZ 1W7PD 3WE2A 1TT0A 1BJAA 1NK3P 2O3FA 5D6FA 4OU0A 2RREA 1LQ1A 1WJAA 3FMRA 4KMUX 2NVYJ 3FKJA 2VQHA 2PI0A 2OQGA 4E6KG 1YG2A 2AXLA 4OIOF 3BLYA 2CU7A 4NC7A 4B43A 4M3FA 4U88A 1ENHA 3KP2A 3CC2I 1IC8A 2IP2A 2K27A 2KT0A 3HZJA 4MEYF 3S1MJ 4ENKA 3ABMH 3ZOBA 4XLPF 1D0YA 2HS5A 3BQZA 2YSRA 3K10A 3MN2A 2G7UA 2RNGA 3T8RA 1NTCA 2XGXA 2ZB9A 4IQ4A 5GP9A 2XAJA 1SFUA 2HGCA 2VN2A 4GYGA 3F72A 2A68F 3HGYA 5HLGA 4M9ZA 1X1BA 5FGMA 2K4JA 3VEPA 4IOCF 2WBMA 2XRLA 1TBXA 2CV0A 4BH9A 3R4KA 5CLSA 4I6ZA 2DT7B 2HDCA 4MNUA 5DDGA 1IUFA 5D5UB 3K4KA 3SYTA 5GAEJ 1H9GA 3QYFA 3O8HA 2E5ZA 2BY1A 1BI1A 5IT9K 2M34A 4P96A 2ZSHB 1P7JA 3F8MA 4UVCA 1YHQI 1BIAA 2HKOA 3MMYB 2VBZA 2VL8A 2K86A 1JT0A 3DU5A 5BMZA 3L2QA 1ZARA 1PUEE 4BQAA 3AL0B 3CP8A 2NVUB 3FHNA 2E1NA 2MLGA 4YFXF 2O6GE 3K0LA 5J1RA 1FIPA 3VWBA 3CCVI 2GQQA 2X6XA 1FX7A 2E36A 4NQWB 4Y7NJ 3OS2A 1KU3A 4A93J 3J80Z 3S1NJ 1R58A 3G73A 5FRNA 4ZYEA 2XKOA 3OYBA 3I71A 4M73A 5E18F 4BY1J 2W24A 2EWNA 2C6YA 1S9HA 4EM1A 4ZYDA 2F4MB 4X0GA 3WU1B 3CC7I 5C4XJ 2B7EA 2F5EA 1GLNA 2CQXA 3GCMA 5DD4A 1UFMA 2AS5F 4P5OA 4EJWA 3F6OA 3BQYA 1HXDA 2E71A 3VSKA 3KEQA 2FMYA 2E7WA 4BKXA 1QBJA 1ZLJA 2Y0MA 1ZRFA 2DI3A 2V6EA 1IXRC 2F4IA 1NG6A 3K1NA 1E3OC 2LH9A 1B1BA 2L9NA 4II3A 1FSEA 3ZPLA 1QRYA 4A0ZA 1KQ0A 1QGPA 3ZQQA 3I58A 1R1TA 4NC8A 3LSMA 4IZZA 3J81Z 1ZELA 3PQKA 1LFUP 4A3EJ 3UKGA 2F5DA 2DN0A 4MTEA 3CCJI 2MC4A 4MQ9F 4QSHA 2JA7J 1YO5C 1G8XA 3PSFA 2PJRB 3RTRA 4MTDA 1VI0A 3C1DA 1WVRA 3WGIA 1HBXG 3W2VA 2CG4A 2FBHA 3MCZA 3A01B 1MD0A 2EV6A 4KIGA 2RDPA 4CHUA 3OYJA 1IG7A 4B8XA 2CMPA 4RBOA 2XGEA 4NB5A 4M6VA 2BOLA 2HPIA 3L2UA 3H0GJ 1G59A 5IOZA 3S16J 3PM1A 2HQNA 3OOUA 4NQWA 2QVOA 3TW6A 4G7HF 4OWRB 2BEOA 3S3MA 3WHCA 3ZXSA 2JUCA 1XMAA 4EVIA 2Y75A 2IA1A 1K4TA 3B6AA 1FYMA 3T1BA 4F55A 2QLZA 4KNYA 1R49A 3S93A 1B9NA 2VE8A 4F92B 2ZNZA 2R7RA 2GZWA 5BS6A 4O3MA 1BI3A 2K9QA 1M1EB 4HF1A 2XAHA 2X6OA 4XBFA 4HQMA 2KIUA 3BROA 2KKOA 5C4JJ 1E2XA 2MLKA 1G3YA 3FIWA 3LSIA 4ZYHA 2M30A 5F0FA 5EEGA 4J00A 2FQ3A 4YIFA 3D1NI 1MSFC 1G3WA 1UMQA 2DJNA 1JKRC 1SFEA 4I0AA 1ODDA 2JSPA 5IY5H 5HOOA 2PN6A 4HV6A 3HUGB 3AKZA 3OOPA 4D5FA 3A2KA 2PJRA 1TWCJ 4EATA 3BZKA 1BR4A 3FXRA 3FXQA 4O5VA 5D8KB 4ZC3A 4JK1X 3F3XA 1REPC 2DXIA 3J81K 3A01A 4DBQA 2HDWA 1G3SA 4WCGA 1LE8B 3EUKL 2OTLI 3ABKH 1SVLA 1JUMA 3PJRA 3OL4A 3KX2A 2LREA 4HLYA 3G1LA 3IRRA 4KMFA 4G94A 2FOWA 3DKWA 1B59A 4HA8A 5L3GA 4L18B 2L9RA 3PL8A 2CRGA 2QQBA 4QLCU 1SANA 2CQNA 3IC7A 2ESHA 5A2QZ 3TGNA 3S14J 5FLXK 2K85A 1BN5A 4L9VA 2L02A 4CDGA 2JZYA 2KDOA 3EYYA 2DJIA 2DTZA 3F8CA 2LY9A 4PFPA 2L54A 1I39A 5DEQA 2VB6A 2DTRA 1OCZH 3GEZA 1I6HJ 1E3HA 1NHAA 2EFQA 3HRTA 3DBRB 2PLYA 3B73A 5D4RA 1HKQA 1OPCA 3PFYA 4CZZA 3W6KB 1K61A 4O6JA 1T33A 1WHUA 5AONA 2DPUA 5IP6A 3IKTA 4XONA 2A5WA 2V7FA 4XLCA 3VDXA 3D5RC 2XKPA 2BGCA 4WF2A 2NS0A 5E3NA 4XR6A 2FNAA 1SAXA 3MAJA 2GLOA 1AHDP 3HUGA 3GBGA 5H6RA 3K9TA 4AUXA 2OTJI 4LLLA 2KJCA 2HXOA 1SMTA 4FTHA 1CF7B 5M5YJ 1ZGJA 2D5VA 2XB0X 3CDHA 4BDZA 4B3AA 1V5EA 4D9JA 1Z77A 4LITA 2WAFA 4P1WA 3AAFA 1RR8C 4FISA 2NVTJ 1ETWA 1LE8A 2WB1A 2X1CA 4LLNA 2W57A 1OR7C 2P0WA 2MG4A 1Z67A 1XCVA 1MNMC 5E3MA 1ONVA 5H6QA 2RKHA 4L9NA 2NVQJ 3JRBA 1MW7A 3OYCA 3RPUD 5M3MJ 2NNNA 1R36A 2COMA 3B6CA 4Y17A 5D8LB 2OAZA 3GZNB 2LF7A 3CDIA 1FLIA 2MSYA 3CCUI 4L5JA 1I3AA 4KUMA 4A12A 3H0DA 3PUFA 1X1PA 3HKZN 1I50J 4BJ5C 3DKXA 4IF4A 2BZTA 5IYDJ 3FISA 2GM4A 1ACIA 5FB2A 1YIOA 3KYDB 3JRFA 1QQIA 2EFPA 1ETVA 1GVJA 3H5RA 4M72A 3E6DA 3TBIA 3GMEA 4XRSG 5A2QK 1TL8A 2RQPA 4OIQF 1A35A 1FTZA 2KDZA 4RAYA 2CS3A 2KP6A 2VIXA 4H0EA 1FC3A 2HOTA 2A6HF 2Q1ZB 2AQEA 3GTKJ 4ZDLA 3OYEA 2IEKA 4A6DA 5FKKA 3L2WA 1DPRA 1D0ZA 2IAIA 2WV1A 1KU7A 3W6VA 3OSFA 1FYKA 4OIRF 3Q3SA 1U3EM 2NS8A 4KN4X 2KFDA 4ZJZA 2K4BA 2W4SA 3A0HC 2GIVA 1Z21A 1T2KA 3PO3J 2F5VA 3FMQA 3LA7A 1IV6A 5AIQA 2R5ZB 3OV8A 5IYCJ 4GDFA 1CF7A 2HEOA 3BP8A 2E60A 2DFHA 2DMPA 4IJAA 3N4MA 5D5WB 1F5TA 3OL3A 2VC0A 2JA8J 3ML6A 4Q47A 3K6GA 3I55I 2HQAA 2GA2A 5F1RA 1TW2A 2JA2A 3FBNB 2FUG2 3L2RA 2LYCA 5EYRA 4CICA 1BL0A 2XASA 1BW5A 1ETYA 4E4HA 2Z5UA 4UV8A 2WADA 4C30A 4BY7J 1WQ2A 4CA0A 1VQ9I 2VQCA 1Z6RA 2OV7A 3ECOA 1KONA 1X4PA 3QOEA 3R60A 3OYNA 2IW5A 1U8RA 5CVJA 2QQ9A 4ESBA 5FKOA 1XB4A 1BBYA 1IUYA 2XDVA 4F52A 3HDDA 1RRJA 2I8DA 1ZLKA 2N8GA 4FQGA 3W2WA 1V4RA 3VB2A 1G2HA 1ETXA 3H3ZA 3ABTA 2XPVA 2A6TA 2IA2A 2ZNYA 4A3LJ 4D7MA 3BTJA 1X2NA 1TQPA 2GAUA 5CVIA 4KA4A 2HTJA 3HTSB 3F8FA 2MGQA 3J7YJ 4F93B 1OR7A 4MGRA 3MVPA 1USTA 1JHFA 3BG7A 4CUGA 3RPUA 2AQFA 4ETSA 2B9SA 3UNGC 3DU6A 2K02A 3DPTA 4LD5A 1JI8A 1BR2A 3BG5A 4OIPF 1SFXA 3V8LA 5BQTA 5E1WA 5K1YA 3PIOF 4JX5A 2KRCA 4DBRA 4IHTA 5CVVA 1QZZA 4UXNA 2R5ZA 3DPUA 4PK4A 4A0XA 1J2XA 2DT5A 4QTRA 3K4NA 3WHBA 4G6QA 3ZQ7A 1HF0A 2CQ7A 1DGRM 2XF5A 5HDGA 1TQMA 2E7XA 2CW8A 1ZRCA 3E6MA 2O61A 1Z91A 3V4GA 5CQEA 3QQAA 3ZQHA 5E1ZB 5K7HA 1FT9A 1XGSA 3M7GA 2EBIA 4G6TB 3WTUC 3M8FA 2CW0F 3G1MA 3K70C 1FPQA 3OYLA 2H6CA 1S8NA 4A5NA 3PSIA 3DXJF 4BXFA 4HQEA 1Q1VA 4ON0A 1K4SA 1FJLA 3I59B 1VQ8I 2A69F 1J9IA 2ZSIB 3OYAA 2RV8A 4S04A 3DBLB 1JGSA 3LAJA 3IAM2 2ELJA 4ENMA 4E7SA 3VSLA 3CCRI 4UV9A 3T5XA 2PJPA 2QENA 5M5WJ 3ABLH 2DK5A 5C44J 2MW8A 4WXCA 4L5IA 3OYIA 4BBSJ 1O57A 4M71A 3WGGA 4EM0B 4BDYA 4XK4A 1AWCA 3ROUA 2P7VB 2FRHA 3ZQFA 1IRZA 4YRVA 1X3ZB 3BCBA 4D1QA 4PJLA 2LNBA 3S3OA 1XTAA 2KL4A 3VPRA 2HXIA 4A69C 1X4OA 2L7FP 1BC7C 2O9LA 1EH7A 4XOPA 4P9UA 4I99C 2DYSH 4AYBN 1OISA 3SXYA 4BQOA 2V6CA 2VKVA 2ELHA 1SEUA 2R7SA 1DU6A 3CJQB 2PMZA 3QU3A 1JKPC 1FZPB 4XMYA 1ON2A 1VQ4I 3VYUB 4HYEA 3IV5A 2FQ4A 2EV5A 1R9TJ 2IXSA 1YX3A 5KVRA 2A61A 1DGWY 2G0EA 2HKXA 1UCRA 3RI4A 2D45A 3JTGA 5HDKA 1TP4A 2P4WA 3DTIA 3FHZA 1WGXA 1K6YA 1W1WE 2AXTC 1BI0A 4EJOA 2QBYB 4E7JA 3I59A 4RM2A 1TNSA 3QU6A 4QPOA 5LGTA 2LFBA 1ZREA 5JR3A 3IWZA 1AOYA 3BG3A 3FXOA 3OIQA 1LKXA 1MMAA 4HX8A 2EINH 2EILH 2Z1DA 1V54H 2EPFA 2Z99A 1QA6A 1XDUA 2H1LA 3RYRA 3KLNA 2L3DA 5K7FA 4U0VA 1H0MA 4BQNA 1FBUA 4KITB 3QPLA 1IN7A 3GTOJ 5KNLA 1WJEA 5IYBJ 2E35A 1LDJA 2DAOA 5EG0B 2CFXA 3ZQCA 3CLOA 3HOTA 4A3MJ 4Q5SF 4YFNF 4HNVA 1JUSA 2JUGA 3JREA 2OQRA 2YS9A 2GXBA 1NH3A 3HIFA 4M6XA 4IXAA 4XLFA 5E3OA 3M1CA 2WAQA 3BTCA 2A07F 2WA0A 1ZG5A 4IVNA 4FT8A 4R79A 1TWGJ 4LLGF 1S5LC 3QODA 5B66C 4CXFA 4EMSA 2BHYA 4A3IJ 1AA7A 1MBEA 1E3PA 4L9TA 1T38A 1WH5A 3R61A 4AIJA 1O4XA 5ICFA 3IWFA 1MBGA 1T98A 3CTAA 4XRFA 1R71A 1TC3C 3LSPA 2VJIA 2LBFB 4IQJA 5JVGF 1Z6TA 5LRSA 3LAPA 1XN7A 3E1SA 1CGPA 3VYTB 3COAC 1EKEA 3RKXA 2HTSA 3ZR8X 3I56I 3I53A 4AC0A 5GTHC 4IRGA 1MNDA 2JN6A 1BC8C 2LK2A 2X85A 1P4XA 2NAZA 2X48A 4JOMA 2LC2A 2OUMA 1HQCA 1BA5A 5GPCA 2QBYA 2EB7A 3H1CA 2TDXA 4Y33A 5B1BH 4OAZA 2MH2A 2OPTA 1J09A 3J7ZI 1J59A 1A31A 3J7AY 4RDUA 3ZQIA 2QYOA 3Q9SA 1HW2A 1RKWA 4A3GJ 5CVUA 2OU2A 4WK8F 2L0KA 1EH6A 2ZFUA 2JA5J 2IT0A 1DDNA 2P6TA 5LLQA 4PCQA 1R5HA 4RGSA 2ICWG 3DQVC 2WTEA 1ZGAA 3ZMZA 3LNQA 5LEJA 1N77A 2O8XA 1YE9A 5EEHA 5EG0A 5HS9A 3PQJA 3BR5A 9ANTA 3CJTB 2JK3A 3WGHA 5J8CA 1HKTA 1FOYA 2E1OA 3OMYA 1T8IA 5F0CA 4KN7X 1OFCX 3AL0C 2R5YB 2L9VA 3IHUA 3CMAI 4E7KA 3RKYA 4LB6B 2YU9J 3ZMDA 5GAGJ 1QZEA 3H9JA 4NBQA 3RSNA 2LD5A 3TDZC 1JJ8C 1D0XA 1UELB 1JJ6C 1N78A 3OS0A 2LF8A 4HSTA 4ENNA 2R7WA 3E0JB 2QF7A 4HOBA 2LBFA 5F0HA 4C3JJ 1U8BA 4L5EA 1EA3A 2ZO4A 2XPWA 4XORA 5J8FA 4DQ2A 3V7CA 3CMMA 2ZC2A 4BHPA 1W4MA 2H27A 3TO9A 2M2EA 3HM5A 3S3NA 3DEEA 3ZGKA 2EIMH 1QZYA 4AIHA 4IHWA 5B1AH 3DLAA 2XGDA 3KE2A 2G7HA 4I02A 4RLQA 5HLTA 3A03A 3Q0VA 2X1EA 3M8EA 4E7IA 3NQOA 4HW0A 3FXJA 1ZTRA 4DYRA 4AM3A 3CMYA 2VC1A 4N0BA 5K7ZA 2CJJA 1JKOC 4HV5A 3KZZA 1EF4A 1MBJA 2XC7A 1MNEA 2Y0SA 2F2EA 4E7HA 4XIDA 2CWEA 2EIJH 2VE9A 3MQ0A 4G9YA 1T0FC 2W00A 2X0LA 2VQLA 3FDYA 3U2RA 1TW3A 2E1MC 3KETA 4I76A 5E1XA 3QPHA 5ERIA 2DODA 2BXZA 1WJFA 3SDGA 3DCFA 2V26A 1GHCA 3LWFA 3PIPF 4B1RA 1Q1HA 1U78A 3KCCA 2K9MA 1USSA 2R5YA 1YW9A 2L7KA 3H9GA 2UXXA 2F5FA 1VF9A 2TCTA 2RGVA 3QPTA 4ZDPA 2DMQA 2PQ8A 4GYIA 2UV1A 3HBLA 3BJ6A 3AFHA 4MQVA 5M5XJ 3HOXJ 2HWVA 1IO2A 4M6YA 1XGNA 3H5AA 3GVAA 2DOAA 1U9OA 3CD6I 2PX9A 1YQAA 3DV8A 2LVSA 1WJBA 1QHHD 4BXUA 4HNTA 4NHJA 4I01A 4FE4A 3SEZA 1U0JA 1FMWA 3FBIB 2E1MB 4M9XA 2HYFA 4XRMA 2DFEA 4M3EA 1IRFA 3ZCOA 3U9GA 4PJMA 3E3VA 4LIUA 5FD6A 2XUBA 2FD5A 1BIBA 4BGDA 3FZVA 2H8WA 2KJBA 3CESA 3VYRB 3VODA 3HXLA 3KP6A 5FLXZ 2RC4A 2W7NA 2K3FA 4M3GA 4CCJA 2E34A 2XHKA 3PNVA 1GDTA 1H8AC 5EJCA 1V3FA 2HU9A 4ASNA 4MLOA 2STTA 4BJTA 2UZKA 2QGUA 4IKFA 3KEYA 4FE7A 2Y31A 1OLTA 5L3CA 4EJTA 2W82A 1OQYA 2JTVA 3BR1A 2DU9A 3QRFF 1HA8A 3P9CA 4WX9A 4UUVA 3RCOA 4F91B 4C2MJ 3NAUA 3FXUA 3D5LA 1MIJA 1S7EA 2ESNA 3S15J 2HOAA 4N9IA 1E0EA 5L3BA 1X1DA 3F8NA 3M9AA 4CCMA 5FRMA 2IS4A 4B09A 3IAS2 2ZXJA 2ME6A 1HC8A 2P5KA 1VQMI 5FKMA 1YS7A 2Q2EB 1KGSA 4A0YA 3SZPA 4KJZA 1ETKA 1WRJA 1S7OA 1LB2A 3PUBA 1RI7A 2PFBA 5JI6A 3HL2A 5D6EA 2VKEA 1Z7LA 4N9HA 3DTKA 3K2AA 2BW3B 2VPRA 2VXZA 4HF0A 1MJAA 1WJ5A 1MMGA 5HVQC 2MC3A 1T0FA 1T39A 1HW1A 3DTEA 2KZVA 2M0MA 3WTVC 2DA1A 4BYYA 3SJMA 4HX7A 2XRNA 3UR3C 4UUTA 1FOXA 2W1OA 1XD7A 3KYLA 4UHTA 5JLWA 1YTYA 2R7TA 1ZH5A 4IX7A 1I1GA 1WFXA 4IHVA 3H3UA 2PMUA 1MMDA 2JWTA 1D8KA 2EV0A 3G6EI 1C0WA 3SFIA 3OY9A 4Y3OA 3FM3A 2QSGX 3CDLA 3C2GA 5HLHA 3ZMTA 2BE5F 1VQKI 4BHCA 2XF6A 3U1DA 4X6AJ 1BOBA 2R7FA 4AVPA 1I27A 1JTXA 3V8KA 4E70A 3D0SA 2VPLA 1Y8RB 3S32A 2CFOA 2CUEA 1ON1A 1GVDA 3I4PA 1K7AA 5IP9J 2O5RA 1F43A 4V2GA 2ZJQF 3I64A 1F9NA 4QIWN 1XMXA 1HCRA 3KEOA 1F1ZA 3WTTC 3W3CA 4BNCA 2BV6A 4BQQA 1FSHA 4HSRA 2X4HA 3REOA 5KHDA 2H1KA 5E8GA 4XLAA 3OYKA 4RAZA 2V79A 1J5YA 3HOYJ 4YEJA 4QWQA 3ZN0A 2Q2EA 4GGGA 3HPGA 2LY2A 4DW6A 3F9KA 1SD7A 2RN7A 4B44A 2IGOA 1HSJA 2W85A 5J3LA 2RAEA 4UVBA 1OCPA 5HNHA 2P5LC 2IRFG 2JPCA 1LNWA 2BW3A 3SZGA 4C2TA 3G3ZA 3DPLC 3ELKA 1YRNB 2JA6J 2L01A 2ZJ2A 3QWLA 2ZMEB 2JVGA 3LSJA 5CQGA 4IRHA 3JRCA 1UHWA 3LSRA 2BY3A 2L5QA 2KIMA 3EUAA 3MWMA 1K79A 3CO6C 1BOAA 2NRAC 5H20A 3GYHX 1MMNA 2CW7A 1F36A 5EEAA 3JCUC 1PUFB 2L2OA 1MJBA 4AU7A 3WODF 5DM6F 4NC6A 4A3BJ 3TOAA 5HDNA 1FOKA 2FBIA 4XLHA 4AIKA 4BE0A 3FMSA 4BBRJ 3OSGA 3AG4H 2CH0A 2X6YA 3WTXC 2V1XA 1R22A 2QM3A 1Z1DA 3T0YA 4BL0B 3I3LA 3HB9A 2F48A 3P5JA 3EDPA 2DFFA 4PJJA 4PGGA 2CV1A 1Z05A 1MJ9A 3JSOA 1P2FA 2HOSA 1STZA 3LL7A 1BR1A 1JE8A 1D1CA 5E79C 2LDUA 1L3LA 1YITI
chains in the Genus database with same CATH topology
1YW7A 2NNYA 3J7AO 4ZYGA 4WWCA 1WKMA 1FP1D 4KDPA 4LFUA 3T8TA 3E6BA 1KYZA 1ZG3A 2ZMEA 1XGMA 2FF4A 2P7CB 1O7FA 1MKMA 1R23A 2H6BA 3RJPA 3ZMSA 3DF8A 4PDKA 2YR2A 1T6SA 1K78B 5L3DA 1ZN2A 1D3YA 1TLHB 5D5XB 2JPBA 1Y0UA 1VTNC 4AD9A 4HDVA 3NRVA 2GA1A 3P9KA 4CYDA 1MDMB 1R1UA 5BPDA 3ZN1A 1I6XA 4KT5C 4P9FA 3IL2A 4EQQA 4HLXA 3QP6A 2VBYA 4FHTA 4U7BA 4U0WA 1G6NA 1R5GA 4P55A 3HSRA 4XLNF 1JHHA 5LGNA 1PP7U 5FFZA 3ZMVA 3F21A 4HX4A 1S3JA 2BBYA 4IRIA 3P7NA 3IRQA 5ILSA 1O3SA 1K78A 3K1PA 3JSPA 3E97A 3CJNA 1HSTA 4OMZA 4IHSA 3LQRA 1QNTA 1MDMA 4KYWA 3KP7A 1BI2A 4S05A 2J5PA 1I1SA 4JQFA 4GXOA 5LGUA 4YFKF 2YX7A 3HOSA 1D5VA 5HS7A 2K7LA 2DLLA 3SHFA 4ESJA 4HBLA 1UHMA 3LFKA 5ICCA 3DEUA 2R3SA 1KQ9A 1RIOH 2ISZA 2PBIA 4HZFA 4MHGA 3V7SA 1ZRDA 2DO7A 3GFJA 2YPRA 3KP5A 3TOBA 4RB1A 4FX0A 3WU0A 1X3UA 3C3WA 4U0YA 2FOKA 5DD8A 1OYYA 3GF2A 5LHGA 4BAYA 2OD5A 3NEUA 4L9JA 2KRFA 3MZHA 4G7OF 1XCBA 3V8JA 3O3KA 5LHHA 4OMYA 1U6GA 4R8HA 3RIRA 2W84A 1GXQA 3SQNA 1DPUA 3B02A 5CVRA 1FY7A 3GFIA 2V9VA 5DUIA 4A6EA 5LBQA 2EA4A 1TTYA 4I2OA 2IVMA 4Y13A 2JRTA 5ICGA 4L0ZB 4WXHA 1RUOA 3WE3A 2L4MA 4HAMA 2A3SA 2EFWA 1FWZA 1W5TA 3F23A 1OKRA 4Q4ZF 4LK0F 2M45A 3E5QA 4G6DA 2MH9A 4HDUA 5FO5A 4I98B 5DCFA 4M9SA 1I5ZA 1OMIA 1PDNC 2H94A 2DQLA 3MZYA 3WTWC 3LSTA 1SMYF 2FA5A 5ILVA 2R7DA 3CUOA 3HHHA 1K6OA 3O2PE 4A5MA 5JVTA 4OOIA 1DP7P 1W7PB 3K1MA 1DUXC 2ACJA 2XAGA 5D4SA 1TNTA 3DP7A 3KFWX 4RS8A 4A2UA 3TDUC 4EV0A 4HF2A 5TJJA 5JFRA 3BOQA 4EJVA 4ZZDA 6PAXA 1IN4A 4D0PA 5CYVA 4K2EA 2HFHA 3ECHA 2LKPA 5CJ9A 2CGPA 1JXSA 4I7HA 2FE3A 4WXDA 3CO7C 2YX4A 3R0JA 1YFHA 3L9FA 2QQAA 1B9MA 3L7WA 3JAMK 2V1DA 1BM9A 3WTYC 2IA0A 3I0TA 4LB5A 1D8JA 3BPVA 4EM2A 2Z9OA 1W7PA 5F64A 3RKWA 2WC2A 3BJOA 4LGWA 4UVAA 2UXNA 1IN5A 1P4WA 5FD5A 2FEZA 1IRGA 1XGOA 3DFGA 4RB0A 1LDDA 2NYXA 3I5UA 2YU3A 1LDKB 4ZZLA 2XVCA 3WTZA 2XV4S 1FP2A 5HS8A 1HKSA 2DBBA 4FX4A 1F4KA 4YIIA 3MEXA 3M1EA 2IJLA 3VOEA 2Q8KA 3CUQC 3QOPA 4DNCA 4G7ZF 4RGUA 1B6AA 4KFCA 4RB2C 1J0RA 3J80K 2PEXA 5BPIA 5F6FA 1SD4A 1U2WA 2FU4A 2EA2A 3L09A 3ZP5A 2MA3A 4CO8A 5L3FA 1Z9CA 1XDSA 3C18A 1HW5A 1IAWA 3EETA 5E17F 2CO5A 3EYIA 2RVCA 3CUQB 2OBPA 2MD5A 3GO5A 3GXOA 4M74A 3W6JB 1KQ8A 3RYPA 2OA4A 2Y48A 3HTUA 2O03A 1WWXA 1P92A 3F22A 2VOOA 1P4AA 1IXSB 2W25A 4ENJA 2XROA 3K2ZA 3E5UA 4I09A 3EQLF 3R6SA 3K69A 1L0OC 1YS6A 1U5TC 3PFIA 3I54A 3HSEA 1FYLA 2FNPA 1IN6A 2ADUA 2LSOA 3BZ6A 3QAHA 2ETHA 2IPQX 2VT3A 1LEAA 2VOPA 2VBXA 3GW2A 1W5SA 1O3QA 2FBKA 4EGYA 1ZG1A 3V7RA 2QWWA 3KZYA 5DUKA 1MZBA 3HRMA 3GFMA 4EGZA 3R0AA 4JBAA 3S2WA 1G4DA 2VONA 4I0BA 1EV7A 2MBFA 2VT2A 3CUQA 1RUNA 1U5TB 2PMHA 5LHIA 3H92A 1ZHFA 2GXGA 4UNOA 3Q9VA 3RDIA 5KK1A 3E6CC 3TQNA 5ILUA 3E5XA 2V1UA 1FBQA 4RGRA 2UWMA 1P6RA 2STWA 3JW4A 4KIFA 3VFZA 2DK8A 2VBWA 2EK5A 1EH8A 3KP3A 4RB3C 5ICEA 4Y15A 2XAFA 4ESFA 5LRRA 1XSVA 3BY6A 4CGZA 2FXAA 3ISPA 3TKYA 3Q5FA 2OZ6A 3GZ6A 1S29A 2M1BA 5L3EA 3ULQB 1S7AA 1UB9A 1ULYA 3HRSA 3KLOA 2DFIA 1U5TA 2WWYA 1LVAA 4PZJA 5AIPA 5IT3A 2Q0OA 5D5VB 1XMKA 3FWEA 2D1VA 2HQRA 3HYIA 2FSWA 2BYVE 2XIGA 2FMLA 1KU9A 1MGTA 4LJZF 1R00A 4LMYA 4YG2F 3F8BA 4LG0B 1OYIA 2D1HA 1TQIA 2QUFA 3GUDA 5TRDA 2VODA 4Z2YA 5E8IA 1XSXA 3QP5A 2GWRA 4GCVA 2CYYA 1YLFA 2KIFA 3C7JA 2DPDA 4TV7A 3O6BB 5JHUA 5LEKA 5HLIA 3FF5A 2M8EA 5BOXA 1KA8A 3GWZA 1GXPA 4U7DA 2HZTA 4XSXF 2A6EF 3BWGA 2EFNA 1IXCA 4F7ZA 1FBSA 4L0YB 4AWXB 3SFZA 2JT1A 5K5QA 1FNNA 1WSUA 5K5RA 1H9TA 1O3RA 3BJAA 4G8XA 2HR3A 2CSOA 2EFOA 1SD5A 2RNJA 3ERED 1R7JA 2J5OA 3GFLA 5FFXA 3F6VA 1KU2A 1O7LA 3ZMUA 4LG0A 1S6LA 2ZCWA 3LA2A 2ZKZA 2Z33A 1SD6A 4EJUA 2P8TA 4MEXF 4XSZF 3RPQA 2JSCA 5DCMB 3HRUA 3L00A 5J6XA 3TO6A 3WG9A 3BPXA 2B0LA 2HYGD 2WV0A 2A5YB 3MFKA 2P6SA 3SZTA 3GLXA 3TO7A 3GZ5A 1E17A 3ABUA 1OYWA 5K5OA 2EJRA 1PP8F 3HHGA 1WI9A 2P5VA 1XSDA 2DQRA 2ZBKA 1IZ1A 4Q48A 5DYMA 1RNLA 2M87A 2CQKA 3WTSC 1IN8A 5E20A 3L2CA 4IPAA 2O0YA 4ZH4F 4R1HA 3FM5A 3N97A 1IW7F 2XAQA 1LJ9A 2OZUA 2HOEA 2G9WA 5ED4A 2ISYA 4PGHA 2PG4A 5DCMA 1KYWA 1R1VA 1YYVA 2D2WA 5DV5A 3JTHA 2L4AA 1ZYRF 4LK1F 2ZFWA 2E1CA 2QZ8A 4KICA 3LA3A 3BDDA 3FX3A 4GO1A 1RZ4A 1QO0D 3IKVA 4KIBA 3GX4X 5IT9Z 2F5CA 2M5WA 4OINF 3EUHA 1G3TA 1QPMA 3HSFA 1IF1A 1A04A 1ZAOA 3LQQA 3KP4A 1LEBA 1B4AA 2DW4A 1Z7UA 1J75A 1O3TA 3P9IA 4BHBA 2Z3YA 1J7KA 2H09A 4RGXA 1YW8A 3JAMZ 1W7PD 3WE2A 1BJAA 2O3FA 5D6FA 4OU0A 1LQ1A 3FMRA 4KMUX 2PI0A 2OQGA 1YG2A 2AXLA 4OIOF 4U88A 3KP2A 2IP2A 2K27A 4MEYF 4ENKA 4XLPF 2HS5A 2YSRA 2G7UA 3T8RA 2XGXA 2XAJA 1SFUA 2HGCA 2VN2A 4GYGA 3F72A 2A68F 5HLGA 4M9ZA 5FGMA 2K4JA 3VEPA 1TBXA 4BH9A 3R4KA 5CLSA 2HDCA 4MNUA 5DDGA 5D5UB 1H9GA 1BI1A 5IT9K 4P96A 3F8MA 4UVCA 1BIAA 2HKOA 2VBZA 2K86A 5BMZA 1ZARA 1PUEE 4BQAA 2E1NA 2MLGA 4YFXF 2O6GE 3K0LA 2GQQA 1FX7A 1KU3A 3J80Z 1R58A 3G73A 4ZYEA 2XKOA 3I71A 4M73A 5E18F 2W24A 2EWNA 2C6YA 4EM1A 4ZYDA 3WU1B 2F5EA 5DD4A 1UFMA 2AS5F 4P5OA 4EJWA 3F6OA 1HXDA 3KEQA 2FMYA 2E7WA 1QBJA 1ZLJA 2Y0MA 1ZRFA 2DI3A 1IXRC 3K1NA 1B1BA 3ZPLA 1FSEA 4A0ZA 1KQ0A 1QGPA 3I58A 1R1TA 3J81Z 3PQKA 2F5DA 4MTEA 4MQ9F 1YO5C 3RTRA 4MTDA 3C1DA 3WGIA 1HBXG 2CG4A 2FBHA 3MCZA 1MD0A 2EV6A 4KIGA 2RDPA 4CHUA 4B8XA 4NB5A 2HQNA 4NQWA 4G7HF 2QVOA 2BEOA 4EVIA 1XMAA 2Y75A 2IA1A 1FYMA 3T1BA 2QLZA 4KNYA 1B9NA 2VE8A 2ZNZA 2GZWA 5BS6A 4O3MA 1BI3A 4HF1A 2XAHA 4XBFA 4HQMA 2KIUA 3BROA 2KKOA 1E2XA 2MLKA 1G3YA 4ZYHA 2M30A 5EEGA 2FQ3A 4YIFA 1G3WA 1SFEA 4I0AA 1ODDA 5HOOA 2PN6A 4HV6A 3OOPA 3FXRA 3FXQA 4O5VA 5D8KB 4JK1X 3F3XA 1REPC 3J81K 4WCGA 1G3SA 4HLYA 3IRRA 4KMFA 4G94A 3DKWA 1B59A 4HA8A 5L3GA 4L18B 2QQBA 4QLCU 3IC7A 2ESHA 5A2QZ 3TGNA 5FLXK 1BN5A 4L9VA 2L02A 4CDGA 2JZYA 3EYYA 3F8CA 2L54A 5DEQA 2DTRA 3GEZA 1NHAA 2EFQA 3HRTA 2PLYA 3B73A 5D4RA 1HKQA 1OPCA 4CZZA 3W6KB 4O6JA 5AONA 2DPUA 3IKTA 2XKPA 2BGCA 4WF2A 2NS0A 1SAXA 2FNAA 3MAJA 3HUGA 5H6RA 3K9TA 4LLLA 2KJCA 1SMTA 1CF7B 1ZGJA 3CDHA 3AAFA 4LLNA 2W57A 1XCVA 1ONVA 5H6QA 2RKHA 4L9NA 2NNNA 1R36A 2COMA 5D8LB 4Y17A 2OAZA 2LF7A 1FLIA 4L5JA 4KUMA 4A12A 4IF4A 5FB2A 1YIOA 1QQIA 2EFPA 1GVJA 4M72A 3E6DA 5A2QK 2RQPA 4OIQF 4RAYA 4H0EA 1FC3A 2A6HF 4A6DA 1DPRA 1KU7A 1FYKA 4OIRF 1U3EM 4KN4X 2K4BA 2GIVA 1T2KA 3FMQA 3LA7A 5AIQA 3OV8A 1CF7A 2HEOA 3BP8A 4IJAA 3N4MA 5D5WB 1F5TA 2VC0A 3ML6A 4Q47A 5F1RA 2GA2A 1TW2A 4CICA 2XASA 2Z5UA 4UV8A 1WQ2A 1Z6RA 3ECOA 3R60A 1U8RA 2IW5A 5CVJA 2QQ9A 4ESBA 1XB4A 1BBYA 1IUYA 1ZLKA 1V4RA 3VB2A 3H3ZA 3ABTA 2ZNYA 2IA2A 1TQPA 2GAUA 5CVIA 4KA4A 2HTJA 3HTSB 3F8FA 1OR7A 4MGRA 1USTA 1JHFA 3RPUA 4ETSA 2K02A 3DPTA 4LD5A 4OIPF 1SFXA 3V8LA 5BQTA 5E1WA 5K1YA 4IHTA 5CVVA 1QZZA 4UXNA 4A0XA 1J2XA 2DT5A 4G6QA 3ZQ7A 5HDGA 1TQMA 2E7XA 1ZRCA 2O61A 3E6MA 1Z91A 3V4GA 5E1ZB 1FT9A 1XGSA 3M7GA 3WTUC 3M8FA 2CW0F 1FPQA 4HQEA 2H6CA 1S8NA 4A5NA 3DXJF 4ON0A 3I59B 2A69F 1J9IA 2RV8A 4S04A 1JGSA 3LAJA 4ENMA 2PJPA 4UV9A 3T5XA 2QENA 2DK5A 4WXCA 4L5IA 1O57A 4M71A 3WGGA 4EM0B 1AWCA 3ROUA 2P7VB 2FRHA 2LNBA 1BC7C 1EH7A 4P9UA 3SXYA 2V6CA 2ELHA 3QU3A 1FZPB 1ON2A 4HYEA 2EV5A 5KVRA 2A61A 2HKXA 1UCRA 3RI4A 2D45A 3JTGA 5HDKA 2P4WA 3FHZA 1BI0A 4EJOA 2QBYB 3I59A 1TNSA 3QU6A 5LGTA 1ZREA 5JR3A 3IWZA 1AOYA 4HX8A 2Z99A 1XDUA 3RYRA 3KLNA 2L3DA 4U0VA 1H0MA 1FBUA 1IN7A 1LDJA 2DAOA 2CFXA 3CLOA 3HOTA 4Q5SF 4YFNF 2OQRA 2GXBA 3HIFA 4M6XA 4IXAA 2A07F 1ZG5A 4IVNA 4FT8A 4R79A 4LLGF 4CXFA 4EMSA 4L9TA 1T38A 3R61A 4AIJA 5ICFA 3IWFA 1T98A 3CTAA 4XRFA 1Z6TA 5LRSA 3LAPA 1XN7A 1CGPA 3COAC 3RKXA 2HTSA 3I53A 4IRGA 1BC8C 1P4XA 2NAZA 1HQCA 2QBYA 2EB7A 2TDXA 2MH2A 1J59A 2QYOA 3Q9SA 1HW2A 5CVUA 2OU2A 4WK8F 1EH6A 2IT0A 1DDNA 2P6TA 5LLQA 4PCQA 1R5HA 4RGSA 3DQVC 2WTEA 1ZGAA 3ZMZA 5LEJA 2O8XA 5EEHA 5HS9A 3PQJA 3WGHA 5J8CA 1HKTA 4KN7X 3IHUA 3RKYA 4LB6B 3ZMDA 3TDZC 2LF8A 4ENNA 4HOBA 2ZO4A 5J8FA 4DQ2A 3V7CA 4BHPA 1W4MA 2H27A 3TO9A 4AIHA 1QZYA 3KE2A 4I02A 2G7HA 3M8EA 3NQOA 4HW0A 2VC1A 4N0BA 4HV5A 3KZZA 2F2EA 2CWEA 2VE9A 3MQ0A 4G9YA 2X0LA 3U2RA 1TW3A 3KETA 5E1XA 3QPHA 5ERIA 1GHCA 3LWFA 1Q1HA 1U78A 3KCCA 1USSA 1YW9A 2UXXA 2F5FA 2RGVA 3QPTA 2PQ8A 4GYIA 3BJ6A 4MQVA 2HWVA 4M6YA 1XGNA 3GVAA 1YQAA 3DV8A 4BXUA 4NHJA 4I01A 4M9XA 2HYFA 1IRFA 3U9GA 3E3VA 5FD6A 2XUBA 1BIBA 3FZVA 2KJBA 3VODA 5FLXZ 3KP6A 2RC4A 2XHKA 2STTA 1V3FA 4ASNA 2UZKA 4EJTA 5L3CA 2JTVA 2DU9A 3QRFF 3P9CA 4WX9A 4UUVA 3FXUA 3D5LA 2ESNA 4N9IA 5L3BA 3F8NA 3M9AA 4B09A 2ZXJA 2P5KA 1YS7A 1KGSA 4A0YA 3SZPA 1WRJA 1S7OA 1LB2A 1RI7A 2PFBA 5JI6A 5D6EA 4N9HA 2VXZA 4HF0A 1MJAA 5HVQC 2MC3A 1T0FA 1T39A 1HW1A 3WTVC 4BYYA 4HX7A 2XRNA 1XD7A 4UHTA 1YTYA 1ZH5A 1I1GA 3H3UA 2PMUA 1D8KA 2EV0A 1C0WA 3FM3A 5HLHA 3ZMTA 2BE5F 4BHCA 3U1DA 2R7FA 4AVPA 1I27A 4E70A 3V8KA 3D0SA 1ON1A 3I4PA 1K7AA 3I64A 1F9NA 3KEOA 1F1ZA 3WTTC 4BNCA 2BV6A 1FSHA 2X4HA 3REOA 5E8GA 4RAZA 2V79A 1J5YA 4QWQA 3ZN0A 2Q2EA 4GGGA 1SD7A 2RN7A 1HSJA 2W85A 4UVBA 2P5LC 2IRFG 2JPCA 1LNWA 3G3ZA 3DPLC 3ELKA 2L01A 2ZJ2A 2ZMEB 4IRHA 1UHWA 2KIMA 3MWMA 1K79A 3CO6C 1BOAA 2NRAC 5H20A 3GYHX 1MJBA 3WODF 3TOAA 5HDNA 1FOKA 2FBIA 4AIKA 3FMSA 3WTXC 2V1XA 1R22A 2QM3A 1Z1DA 3T0YA 3EDPA 4PGGA 1Z05A 1MJ9A 3JSOA 1P2FA 1STZA 1JE8A 2LDUA 1L3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  2NNY A;  3J7A O;  4ZYG A;  4WWC A;  1WKM A;  1FP1 D;  4KDP A;  4LFU A;  3T8T A;  3E6B A;  1KYZ A;  1ZG3 A;  2ZME A;  1XGM A;  2FF4 A;  2P7C B;  1O7F A;  1MKM A;  1R23 A;  2H6B A;  3RJP A;  3ZMS A;  3DF8 A;  4PDK A;  2YR2 A;  1T6S A;  1K78 B;  5L3D A;  1ZN2 A;  1D3Y A;  1TLH B;  5D5X B;  2JPB A;  1Y0U A;  1VTN C;  4AD9 A;  4HDV A;  3NRV A;  2GA1 A;  3P9K A;  4CYD A;  1MDM B;  1R1U A;  5BPD A;  3ZN1 A;  1I6X A;  4KT5 C;  4P9F A;  3IL2 A;  4EQQ A;  4HLX A;  3QP6 A;  2VBY A;  4FHT A;  4U7B A;  4U0W A;  1G6N A;  1R5G A;  4P55 A;  3HSR A;  4XLN F;  1JHH A;  5LGN A;  1PP7 U;  5FFZ A;  3ZMV A;  3F21 A;  4HX4 A;  1S3J A;  2BBY A;  4IRI A;  3P7N A;  3IRQ A;  5ILS A;  1O3S A;  1K78 A;  3K1P A;  3JSP A;  3E97 A;  3CJN A;  1HST A;  4OMZ A;  4IHS A;  3LQR A;  1QNT A;  1MDM A;  4KYW A;  3KP7 A;  1BI2 A;  4S05 A;  2J5P A;  1I1S A;  4JQF A;  4GXO A;  5LGU A;  4YFK F;  2YX7 A;  3HOS A;  1D5V A;  5HS7 A;  2K7L A;  2DLL A;  3SHF A;  4ESJ A;  4HBL A;  1UHM A;  3LFK A;  5ICC A;  3DEU A;  2R3S A;  1KQ9 A;  1RIO H;  2ISZ A;  2PBI A;  4HZF A;  4MHG A;  3V7S A;  1ZRD A;  2DO7 A;  3GFJ A;  2YPR A;  3KP5 A;  3TOB A;  4RB1 A;  4FX0 A;  3WU0 A;  1X3U A;  3C3W A;  4U0Y A;  2FOK A;  5DD8 A;  1OYY A;  3GF2 A;  5LHG A;  4BAY A;  2OD5 A;  3NEU A;  4L9J A;  2KRF A;  3MZH A;  4G7O F;  1XCB A;  3V8J A;  3O3K A;  5LHH A;  4OMY A;  1U6G A;  4R8H A;  3RIR A;  2W84 A;  1GXQ A;  3SQN A;  1DPU A;  3B02 A;  5CVR A;  1FY7 A;  3GFI A;  2V9V A;  5DUI A;  4A6E A;  5LBQ A;  2EA4 A;  1TTY A;  4I2O A;  2IVM A;  4Y13 A;  2JRT A;  5ICG A;  4L0Z B;  4WXH A;  1RUO A;  3WE3 A;  2L4M A;  4HAM A;  2A3S A;  2EFW A;  1FWZ A;  1W5T A;  3F23 A;  1OKR A;  4Q4Z F;  4LK0 F;  2M45 A;  3E5Q A;  4G6D A;  2MH9 A;  4HDU A;  5FO5 A;  4I98 B;  5DCF A;  4M9S A;  1I5Z A;  1OMI A;  1PDN C;  2H94 A;  2DQL A;  3MZY A;  3WTW C;  3LST A;  1SMY F;  2FA5 A;  5ILV A;  2R7D A;  3CUO A;  3HHH A;  1K6O A;  3O2P E;  4A5M A;  5JVT A;  4OOI A;  1DP7 P;  1W7P B;  3K1M A;  1DUX C;  2ACJ A;  2XAG A;  5D4S A;  1TNT A;  3DP7 A;  3KFW X;  4RS8 A;  4A2U A;  3TDU C;  4EV0 A;  4HF2 A;  5TJJ A;  5JFR A;  3BOQ A;  4EJV A;  4ZZD A;  6PAX A;  1IN4 A;  4D0P A;  5CYV A;  4K2E A;  2HFH A;  3ECH A;  2LKP A;  5CJ9 A;  2CGP A;  1JXS A;  4I7H A;  2FE3 A;  4WXD A;  3CO7 C;  2YX4 A;  3R0J A;  1YFH A;  3L9F A;  2QQA A;  1B9M A;  3L7W A;  3JAM K;  2V1D A;  1BM9 A;  3WTY C;  2IA0 A;  3I0T A;  4LB5 A;  1D8J A;  3BPV A;  4EM2 A;  2Z9O A;  1W7P A;  5F64 A;  3RKW A;  2WC2 A;  3BJO A;  4LGW A;  4UVA A;  2UXN A;  1IN5 A;  1P4W A;  5FD5 A;  2FEZ A;  1IRG A;  1XGO A;  3DFG A;  4RB0 A;  1LDD A;  2NYX A;  3I5U A;  2YU3 A;  1LDK B;  4ZZL A;  2XVC A;  3WTZ A;  2XV4 S;  1FP2 A;  5HS8 A;  1HKS A;  2DBB A;  4FX4 A;  1F4K A;  4YII A;  3MEX A;  3M1E A;  2IJL A;  3VOE A;  2Q8K A;  3CUQ C;  3QOP A;  4DNC A;  4G7Z F;  4RGU A;  1B6A A;  4KFC A;  4RB2 C;  1J0R A;  3J80 K;  2PEX A;  5BPI A;  5F6F A;  1SD4 A;  1U2W A;  2FU4 A;  2EA2 A;  3L09 A;  3ZP5 A;  2MA3 A;  4CO8 A;  5L3F A;  1Z9C A;  1XDS A;  3C18 A;  1HW5 A;  1IAW A;  3EET A;  5E17 F;  2CO5 A;  3EYI A;  2RVC A;  3CUQ B;  2OBP A;  2MD5 A;  3GO5 A;  3GXO A;  4M74 A;  3W6J B;  1KQ8 A;  3RYP A;  2OA4 A;  2Y48 A;  3HTU A;  2O03 A;  1WWX A;  1P92 A;  3F22 A;  2VOO A;  1P4A A;  1IXS B;  2W25 A;  4ENJ A;  2XRO A;  3K2Z A;  3E5U A;  4I09 A;  3EQL F;  3R6S A;  3K69 A;  1L0O C;  1YS6 A;  1U5T C;  3PFI A;  3I54 A;  3HSE A;  1FYL A;  2FNP A;  1IN6 A;  2ADU A;  2LSO A;  3BZ6 A;  3QAH A;  2ETH A;  2IPQ X;  2VT3 A;  1LEA A;  2VOP A;  2VBX A;  3GW2 A;  1W5S A;  1O3Q A;  2FBK A;  4EGY A;  1ZG1 A;  3V7R A;  2QWW A;  3KZY A;  5DUK A;  1MZB A;  3HRM A;  3GFM A;  4EGZ A;  3R0A A;  4JBA A;  3S2W A;  1G4D A;  2VON A;  4I0B A;  1EV7 A;  2MBF A;  2VT2 A;  3CUQ A;  1RUN A;  1U5T B;  2PMH A;  5LHI A;  3H92 A;  1ZHF A;  2GXG A;  4UNO A;  3Q9V A;  3RDI A;  5KK1 A;  3E6C C;  3TQN A;  5ILU A;  3E5X A;  2V1U A;  1FBQ A;  4RGR A;  2UWM A;  1P6R A;  2STW A;  3JW4 A;  4KIF A;  3VFZ A;  2DK8 A;  2VBW A;  2EK5 A;  1EH8 A;  3KP3 A;  4RB3 C;  5ICE A;  4Y15 A;  2XAF A;  4ESF A;  5LRR A;  1XSV A;  3BY6 A;  4CGZ A;  2FXA A;  3ISP A;  3TKY A;  3Q5F A;  2OZ6 A;  3GZ6 A;  1S29 A;  2M1B A;  5L3E A;  3ULQ B;  1S7A A;  1UB9 A;  1ULY A;  3HRS A;  3KLO A;  2DFI A;  1U5T A;  2WWY A;  1LVA A;  4PZJ A;  5AIP A;  5IT3 A;  2Q0O A;  5D5V B;  1XMK A;  3FWE A;  2D1V A;  2HQR A;  3HYI A;  2FSW A;  2BYV E;  2XIG A;  2FML A;  1KU9 A;  1MGT A;  4LJZ F;  1R00 A;  4LMY A;  4YG2 F;  3F8B A;  4LG0 B;  1OYI A;  2D1H A;  1TQI A;  2QUF A;  3GUD A;  5TRD A;  2VOD A;  4Z2Y A;  5E8I A;  1XSX A;  3QP5 A;  2GWR A;  4GCV A;  2CYY A;  1YLF A;  2KIF A;  3C7J A;  2DPD A;  4TV7 A;  3O6B B;  5JHU A;  5LEK A;  5HLI A;  3FF5 A;  2M8E A;  5BOX A;  1KA8 A;  3GWZ A;  1GXP A;  4U7D A;  2HZT A;  4XSX F;  2A6E F;  3BWG A;  2EFN A;  1IXC A;  4F7Z A;  1FBS A;  4L0Y B;  4AWX B;  3SFZ A;  2JT1 A;  5K5Q A;  1FNN A;  1WSU A;  5K5R A;  1H9T A;  1O3R A;  3BJA A;  4G8X A;  2HR3 A;  2CSO A;  2EFO A;  1SD5 A;  2RNJ A;  3ERE D;  1R7J A;  2J5O A;  3GFL A;  5FFX A;  3F6V A;  1KU2 A;  1O7L A;  3ZMU A;  4LG0 A;  1S6L A;  2ZCW A;  3LA2 A;  2ZKZ A;  2Z33 A;  1SD6 A;  4EJU A;  2P8T A;  4MEX F;  4XSZ F;  3RPQ A;  2JSC A;  5DCM B;  3HRU A;  3L00 A;  5J6X A;  3TO6 A;  3WG9 A;  3BPX A;  2B0L A;  2HYG D;  2WV0 A;  2A5Y B;  3MFK A;  2P6S A;  3SZT A;  3GLX A;  3TO7 A;  3GZ5 A;  1E17 A;  3ABU A;  1OYW A;  5K5O A;  2EJR A;  1PP8 F;  3HHG A;  1WI9 A;  2P5V A;  1XSD A;  2DQR A;  2ZBK A;  1IZ1 A;  4Q48 A;  5DYM A;  1RNL A;  2M87 A;  2CQK A;  3WTS C;  1IN8 A;  5E20 A;  3L2C A;  4IPA A;  2O0Y A;  4ZH4 F;  4R1H A;  3FM5 A;  3N97 A;  1IW7 F;  2XAQ A;  1LJ9 A;  2OZU A;  2HOE A;  2G9W A;  5ED4 A;  2ISY A;  4PGH A;  2PG4 A;  5DCM A;  1KYW A;  1R1V A;  1YYV A;  2D2W A;  5DV5 A;  3JTH A;  2L4A A;  1ZYR F;  4LK1 F;  2ZFW A;  2E1C A;  2QZ8 A;  4KIC A;  3LA3 A;  3BDD A;  3FX3 A;  4GO1 A;  1RZ4 A;  1QO0 D;  3IKV A;  4KIB A;  3GX4 X;  5IT9 Z;  2F5C A;  2M5W A;  4OIN F;  3EUH A;  1G3T A;  1QPM A;  3HSF A;  1IF1 A;  1A04 A;  1ZAO A;  3LQQ A;  3KP4 A;  1LEB A;  1B4A A;  2DW4 A;  1Z7U A;  1J75 A;  1O3T A;  3P9I A;  4BHB A;  2Z3Y A;  1J7K A;  2H09 A;  4RGX A;  1YW8 A;  3JAM Z;  1W7P D;  3WE2 A;  1BJA A;  2O3F A;  5D6F A;  4OU0 A;  1LQ1 A;  3FMR A;  4KMU X;  2PI0 A;  2OQG A;  1YG2 A;  2AXL A;  4OIO F;  4U88 A;  3KP2 A;  2IP2 A;  2K27 A;  4MEY F;  4ENK A;  4XLP F;  2HS5 A;  2YSR A;  2G7U A;  3T8R A;  2XGX A;  2XAJ A;  1SFU A;  2HGC A;  2VN2 A;  4GYG A;  3F72 A;  2A68 F;  5HLG A;  4M9Z A;  5FGM A;  2K4J A;  3VEP A;  1TBX A;  4BH9 A;  3R4K A;  5CLS A;  2HDC A;  4MNU A;  5DDG A;  5D5U B;  1H9G A;  1BI1 A;  5IT9 K;  4P96 A;  3F8M A;  4UVC A;  1BIA A;  2HKO A;  2VBZ A;  2K86 A;  5BMZ A;  1ZAR A;  1PUE E;  4BQA A;  2E1N A;  2MLG A;  4YFX F;  2O6G E;  3K0L A;  2GQQ A;  1FX7 A;  1KU3 A;  3J80 Z;  1R58 A;  3G73 A;  4ZYE A;  2XKO A;  3I71 A;  4M73 A;  5E18 F;  2W24 A;  2EWN A;  2C6Y A;  4EM1 A;  4ZYD A;  3WU1 B;  2F5E A;  5DD4 A;  1UFM A;  2AS5 F;  4P5O A;  4EJW A;  3F6O A;  1HXD A;  3KEQ A;  2FMY A;  2E7W A;  1QBJ A;  1ZLJ A;  2Y0M A;  1ZRF A;  2DI3 A;  1IXR C;  3K1N A;  1B1B A;  3ZPL A;  1FSE A;  4A0Z A;  1KQ0 A;  1QGP A;  3I58 A;  1R1T A;  3J81 Z;  3PQK A;  2F5D A;  4MTE A;  4MQ9 F;  1YO5 C;  3RTR A;  4MTD A;  3C1D A;  3WGI A;  1HBX G;  2CG4 A;  2FBH A;  3MCZ A;  1MD0 A;  2EV6 A;  4KIG A;  2RDP A;  4CHU A;  4B8X A;  4NB5 A;  2HQN A;  4NQW A;  4G7H F;  2QVO A;  2BEO A;  4EVI A;  1XMA A;  2Y75 A;  2IA1 A;  1FYM A;  3T1B A;  2QLZ A;  4KNY A;  1B9N A;  2VE8 A;  2ZNZ A;  2GZW A;  5BS6 A;  4O3M A;  1BI3 A;  4HF1 A;  2XAH A;  4XBF A;  4HQM A;  2KIU A;  3BRO A;  2KKO A;  1E2X A;  2MLK A;  1G3Y A;  4ZYH A;  2M30 A;  5EEG A;  2FQ3 A;  4YIF A;  1G3W A;  1SFE A;  4I0A A;  1ODD A;  5HOO A;  2PN6 A;  4HV6 A;  3OOP A;  3FXR A;  3FXQ A;  4O5V A;  5D8K B;  4JK1 X;  3F3X A;  1REP C;  3J81 K;  4WCG A;  1G3S A;  4HLY A;  3IRR A;  4KMF A;  4G94 A;  3DKW A;  1B59 A;  4HA8 A;  5L3G A;  4L18 B;  2QQB A;  4QLC U;  3IC7 A;  2ESH A;  5A2Q Z;  3TGN A;  5FLX K;  1BN5 A;  4L9V A;  2L02 A;  4CDG A;  2JZY A;  3EYY A;  3F8C A;  2L54 A;  5DEQ A;  2DTR A;  3GEZ A;  1NHA A;  2EFQ A;  3HRT A;  2PLY A;  3B73 A;  5D4R A;  1HKQ A;  1OPC A;  4CZZ A;  3W6K B;  4O6J A;  5AON A;  2DPU A;  3IKT A;  2XKP A;  2BGC A;  4WF2 A;  2NS0 A;  1SAX A;  2FNA A;  3MAJ A;  3HUG A;  5H6R A;  3K9T A;  4LLL A;  2KJC A;  1SMT A;  1CF7 B;  1ZGJ A;  3CDH A;  3AAF A;  4LLN A;  2W57 A;  1XCV A;  1ONV A;  5H6Q A;  2RKH A;  4L9N A;  2NNN A;  1R36 A;  2COM A;  5D8L B;  4Y17 A;  2OAZ A;  2LF7 A;  1FLI A;  4L5J A;  4KUM A;  4A12 A;  4IF4 A;  5FB2 A;  1YIO A;  1QQI A;  2EFP A;  1GVJ A;  4M72 A;  3E6D A;  5A2Q K;  2RQP A;  4OIQ F;  4RAY A;  4H0E A;  1FC3 A;  2A6H F;  4A6D A;  1DPR A;  1KU7 A;  1FYK A;  4OIR F;  1U3E M;  4KN4 X;  2K4B A;  2GIV A;  1T2K A;  3FMQ A;  3LA7 A;  5AIQ A;  3OV8 A;  1CF7 A;  2HEO A;  3BP8 A;  4IJA A;  3N4M A;  5D5W B;  1F5T A;  2VC0 A;  3ML6 A;  4Q47 A;  5F1R A;  2GA2 A;  1TW2 A;  4CIC A;  2XAS A;  2Z5U A;  4UV8 A;  1WQ2 A;  1Z6R A;  3ECO A;  3R60 A;  1U8R A;  2IW5 A;  5CVJ A;  2QQ9 A;  4ESB A;  1XB4 A;  1BBY A;  1IUY A;  1ZLK A;  1V4R A;  3VB2 A;  3H3Z A;  3ABT A;  2ZNY A;  2IA2 A;  1TQP A;  2GAU A;  5CVI A;  4KA4 A;  2HTJ A;  3HTS B;  3F8F A;  1OR7 A;  4MGR A;  1UST A;  1JHF A;  3RPU A;  4ETS A;  2K02 A;  3DPT A;  4LD5 A;  4OIP F;  1SFX A;  3V8L A;  5BQT A;  5E1W A;  5K1Y A;  4IHT A;  5CVV A;  1QZZ A;  4UXN A;  4A0X A;  1J2X A;  2DT5 A;  4G6Q A;  3ZQ7 A;  5HDG A;  1TQM A;  2E7X A;  1ZRC A;  2O61 A;  3E6M A;  1Z91 A;  3V4G A;  5E1Z B;  1FT9 A;  1XGS A;  3M7G A;  3WTU C;  3M8F A;  2CW0 F;  1FPQ A;  4HQE A;  2H6C A;  1S8N A;  4A5N A;  3DXJ F;  4ON0 A;  3I59 B;  2A69 F;  1J9I A;  2RV8 A;  4S04 A;  1JGS A;  3LAJ A;  4ENM A;  2PJP A;  4UV9 A;  3T5X A;  2QEN A;  2DK5 A;  4WXC A;  4L5I A;  1O57 A;  4M71 A;  3WGG A;  4EM0 B;  1AWC A;  3ROU A;  2P7V B;  2FRH A;  2LNB A;  1BC7 C;  1EH7 A;  4P9U A;  3SXY A;  2V6C A;  2ELH A;  3QU3 A;  1FZP B;  1ON2 A;  4HYE A;  2EV5 A;  5KVR A;  2A61 A;  2HKX A;  1UCR A;  3RI4 A;  2D45 A;  3JTG A;  5HDK A;  2P4W A;  3FHZ A;  1BI0 A;  4EJO A;  2QBY B;  3I59 A;  1TNS A;  3QU6 A;  5LGT A;  1ZRE A;  5JR3 A;  3IWZ A;  1AOY A;  4HX8 A;  2Z99 A;  1XDU A;  3RYR A;  3KLN A;  2L3D A;  4U0V A;  1H0M A;  1FBU A;  1IN7 A;  1LDJ A;  2DAO A;  2CFX A;  3CLO A;  3HOT A;  4Q5S F;  4YFN F;  2OQR A;  2GXB A;  3HIF A;  4M6X A;  4IXA A;  2A07 F;  1ZG5 A;  4IVN A;  4FT8 A;  4R79 A;  4LLG F;  4CXF A;  4EMS A;  4L9T A;  1T38 A;  3R61 A;  4AIJ A;  5ICF A;  3IWF A;  1T98 A;  3CTA A;  4XRF A;  1Z6T A;  5LRS A;  3LAP A;  1XN7 A;  1CGP A;  3COA C;  3RKX A;  2HTS A;  3I53 A;  4IRG A;  1BC8 C;  1P4X A;  2NAZ A;  1HQC A;  2QBY A;  2EB7 A;  2TDX A;  2MH2 A;  1J59 A;  2QYO A;  3Q9S A;  1HW2 A;  5CVU A;  2OU2 A;  4WK8 F;  1EH6 A;  2IT0 A;  1DDN A;  2P6T A;  5LLQ A;  4PCQ A;  1R5H A;  4RGS A;  3DQV C;  2WTE A;  1ZGA A;  3ZMZ A;  5LEJ A;  2O8X A;  5EEH A;  5HS9 A;  3PQJ A;  3WGH A;  5J8C A;  1HKT A;  4KN7 X;  3IHU A;  3RKY A;  4LB6 B;  3ZMD A;  3TDZ C;  2LF8 A;  4ENN A;  4HOB A;  2ZO4 A;  5J8F A;  4DQ2 A;  3V7C A;  4BHP A;  1W4M A;  2H27 A;  3TO9 A;  4AIH A;  1QZY A;  3KE2 A;  4I02 A;  2G7H A;  3M8E A;  3NQO A;  4HW0 A;  2VC1 A;  4N0B A;  4HV5 A;  3KZZ A;  2F2E A;  2CWE A;  2VE9 A;  3MQ0 A;  4G9Y A;  2X0L A;  3U2R A;  1TW3 A;  3KET A;  5E1X A;  3QPH A;  5ERI A;  1GHC A;  3LWF A;  1Q1H A;  1U78 A;  3KCC A;  1USS A;  1YW9 A;  2UXX A;  2F5F A;  2RGV A;  3QPT A;  2PQ8 A;  4GYI A;  3BJ6 A;  4MQV A;  2HWV A;  4M6Y A;  1XGN A;  3GVA A;  1YQA A;  3DV8 A;  4BXU A;  4NHJ A;  4I01 A;  4M9X A;  2HYF A;  1IRF A;  3U9G A;  3E3V A;  5FD6 A;  2XUB A;  1BIB A;  3FZV A;  2KJB A;  3VOD A;  5FLX Z;  3KP6 A;  2RC4 A;  2XHK A;  2STT A;  1V3F A;  4ASN A;  2UZK A;  4EJT A;  5L3C A;  2JTV A;  2DU9 A;  3QRF F;  3P9C A;  4WX9 A;  4UUV A;  3FXU A;  3D5L A;  2ESN A;  4N9I A;  5L3B A;  3F8N A;  3M9A A;  4B09 A;  2ZXJ A;  2P5K A;  1YS7 A;  1KGS A;  4A0Y A;  3SZP A;  1WRJ A;  1S7O A;  1LB2 A;  1RI7 A;  2PFB A;  5JI6 A;  5D6E A;  4N9H A;  2VXZ A;  4HF0 A;  1MJA A;  5HVQ C;  2MC3 A;  1T0F A;  1T39 A;  1HW1 A;  3WTV C;  4BYY A;  4HX7 A;  2XRN A;  1XD7 A;  4UHT A;  1YTY A;  1ZH5 A;  1I1G A;  3H3U A;  2PMU A;  1D8K A;  2EV0 A;  1C0W A;  3FM3 A;  5HLH A;  3ZMT A;  2BE5 F;  4BHC A;  3U1D A;  2R7F A;  4AVP A;  1I27 A;  4E70 A;  3V8K A;  3D0S A;  1ON1 A;  3I4P A;  1K7A A;  3I64 A;  1F9N A;  3KEO A;  1F1Z A;  3WTT C;  4BNC A;  2BV6 A;  1FSH A;  2X4H A;  3REO A;  5E8G A;  4RAZ A;  2V79 A;  1J5Y A;  4QWQ A;  3ZN0 A;  2Q2E A;  4GGG A;  1SD7 A;  2RN7 A;  1HSJ A;  2W85 A;  4UVB A;  2P5L C;  2IRF G;  2JPC A;  1LNW A;  3G3Z A;  3DPL C;  3ELK A;  2L01 A;  2ZJ2 A;  2ZME B;  4IRH A;  1UHW A;  2KIM A;  3MWM A;  1K79 A;  3CO6 C;  1BOA A;  2NRA C;  5H20 A;  3GYH X;  1MJB A;  3WOD F;  3TOA A;  5HDN A;  1FOK A;  2FBI A;  4AIK A;  3FMS A;  3WTX C;  2V1X A;  1R22 A;  2QM3 A;  1Z1D A;  3T0Y A;  3EDP A;  4PGG A;  1Z05 A;  1MJ9 A;  3JSO A;  1P2F A;  1STZ A;  1JE8 A;  2LDU A;  1L3L A; 
#chains in the Genus database with same CATH topology
 1YI2 I;  2BVM A;  1TWH J;  2V9K A;  1YW7 A;  3IH2 A;  2NNY A;  3J7A O;  4RA2 A;  4S0H B;  4ZYG A;  5M3F J;  4WWC A;  1WKM A;  1ETQ A;  4XRS A;  1FP1 D;  2ZXH A;  1W36 C;  2VAS A;  3G2B A;  4KDP A;  4LFU A;  3K4L A;  3T8T A;  2CV2 A;  1YRN A;  1W36 D;  2OF7 A;  2LOO A;  2X1D A;  3E6B A;  1KYZ A;  1ZG3 A;  2W48 A;  2ZME A;  1APL C;  1XGM A;  2FF4 A;  4HRI A;  3JRI A;  2P7C B;  1UG0 A;  1O7F A;  4CYC B;  1MKM A;  1R23 A;  2H6B A;  1TWA J;  3RJP A;  3AG2 H;  3DF8 A;  3ZMS A;  2HNH A;  4PDK A;  1PUF A;  2YR2 A;  2ZJP F;  1T6S A;  1K78 B;  5L3D A;  1ZN2 A;  2CUJ A;  1D3Y A;  1TLH B;  1X1C A;  2JPB A;  3TMO A;  5D5X B;  1Y0U A;  3LSH A;  3MKZ A;  1VTN C;  1Y1V J;  4AD9 A;  1Z3Y A;  2LMD A;  4HDV A;  3A1Y A;  3NRV A;  2GA1 A;  3P9K A;  4CYD A;  2EIK H;  1MDM B;  2DDB A;  2ID6 A;  4NNJ A;  1R1U A;  2JMW A;  4BE2 A;  5BPD A;  1JKQ C;  3GTQ J;  3ZN1 A;  4XM3 A;  1I6X A;  4KT5 C;  4P9F A;  1W5C C;  3M4O J;  2F4O B;  3IL2 A;  4EQQ A;  4HLX A;  3QP6 A;  3BTI A;  4CCL A;  3KIO A;  2VBY A;  4ZTF A;  3OWT A;  4FHT A;  5EGO B;  4U7B A;  4U0W A;  3S8P A;  1G6N A;  4IL6 C;  1R5G A;  4P55 A;  4C3I J;  2MAB A;  3HSR A;  5TGT A;  4XLN F;  3K4C A;  1JHH A;  3MZ8 A;  2E2J J;  3MD2 A;  5LGN A;  2KPM A;  2VKD A;  3IUO A;  3M8J A;  1X19 A;  1PP7 U;  4MIM A;  3IH3 A;  5FFZ A;  4BE1 A;  3ZMV A;  1X3W B;  1VQL I;  3F21 A;  4HX4 A;  1S3J A;  2BBY A;  4CYC A;  1X1A A;  4IRI A;  3P7N A;  3BC8 A;  3IRQ A;  5ILS A;  1O3S A;  1K78 A;  1I3Q J;  3K1P A;  3JSP A;  3E97 A;  3CJN A;  2FJ1 A;  3H5N A;  1HST A;  3RQ4 A;  2R7Q A;  4OMZ A;  5FJ8 J;  4IHS A;  3HEF A;  1W0T A;  2DMU A;  2KIQ A;  4MO7 A;  3K70 D;  1T08 B;  3LQR A;  1QNT A;  3M3Y J;  1MDM A;  2QKL B;  1MMS A;  2VLA A;  2AHQ A;  1GV2 A;  1OJL A;  4C3H J;  5H2F C;  4KYW A;  3KP7 A;  1BI2 A;  4S05 A;  2GBY A;  1K83 J;  3BG9 A;  2J5P A;  2EZK A;  5F04 A;  1I1S A;  4JQF A;  3L1P A;  1TWF J;  4HG2 A;  1S72 I;  4GXO A;  5LGU A;  1OCR H;  2M8G X;  4V19 K;  2KLO A;  3U21 A;  2K9S A;  4YFK F;  1RC9 A;  5EGO A;  2YX7 A;  2EH3 A;  3HOS A;  1D5V A;  1RR7 A;  2MD0 A;  3ZRG A;  5HS7 A;  2K7L A;  2DLL A;  2DOE A;  3I9V 2;  3SHF A;  1R5I D;  4PJN A;  5B3S H;  1PVE A;  4ESJ A;  4W1U A;  4HBL A;  1UHM A;  3LFK A;  2K9L A;  1XC5 A;  1MH3 A;  1Z0X A;  4X1E A;  3S1R J;  2R7Z J;  3NAR A;  5ICC A;  3DEU A;  4ZTJ A;  2R3S A;  2GOX B;  1KQ9 A;  3I4N J;  4J19 A;  2R7X A;  1RIO H;  2LLK A;  2ISZ A;  2O8K A;  1UAA A;  1X2M A;  2PBI A;  3E7L A;  4HZF A;  4MHG A;  3V7S A;  1ZRD A;  2DO7 A;  3GFJ A;  4W97 A;  3GTP J;  3IP4 B;  2UUZ A;  2YPR A;  3KP5 A;  3TOB A;  2E5N A;  4RB1 A;  4A3C J;  1NG7 A;  3BR0 A;  4FX0 A;  3WU0 A;  1X3U A;  2NOG A;  2VQG A;  3G71 I;  4UB6 C;  3C3W A;  5FKL A;  3C2B A;  4U0Y A;  2FOK A;  5DD8 A;  1OYY A;  3GF2 A;  5LHG A;  4BAY A;  2OD5 A;  3NEU A;  4L9J A;  2KRF A;  1SVM A;  4BU2 A;  4D7N A;  3MZH A;  1YJN I;  4G7O F;  3A4C A;  2LKS A;  1XCB A;  3V8J A;  2ID3 A;  2GIZ A;  3H35 A;  3O3K A;  3LSG A;  5LHH A;  1FEX A;  3BCA A;  1ORK A;  5DM7 F;  4AVZ A;  1XS9 A;  4OMY A;  3HPH A;  1WH7 A;  2WB1 N;  3OIO A;  3SEQ A;  3FK7 A;  1U6G A;  4R8H A;  2LP0 A;  3RIR A;  2XSJ C;  2RQQ A;  3LMM A;  2W84 A;  1GXQ A;  3SQN A;  3KZI C;  1DPU A;  3B02 A;  5CVR A;  1ZGW A;  2JJ7 A;  2LG4 A;  3WU2 C;  1FY7 A;  4DJA A;  3GFI A;  2V9V A;  5DUI A;  2A05 A;  3C2H A;  2M3A A;  4A6E A;  3JR9 A;  5LBQ A;  1QVT A;  3JRD A;  2EA4 A;  3H9Q A;  4CZC A;  1B72 B;  1TTY A;  4JX6 A;  4I2O A;  1V5G A;  2IVM A;  4Y13 A;  3DLL F;  2JRT A;  3G4S I;  2WY7 Q;  3RQI A;  1R4M B;  5ICG A;  4II2 A;  3V42 A;  4JX4 A;  4L0Z B;  4C9Y A;  4XQF A;  2IBD A;  4RAF A;  1VZ0 A;  3OYG A;  4WXH A;  1RUO A;  4AID A;  5DS9 A;  3WE3 A;  2HI3 A;  2L4M A;  1YJW I;  5J40 A;  4HAM A;  3WG7 H;  2A3S A;  4RAG A;  2EFW A;  4BS9 A;  1FWZ A;  1W5T A;  3AG3 H;  2KQR A;  1OKR A;  3ONQ A;  4Q4Z F;  4RM3 A;  3F23 A;  1FTT A;  2VJ4 A;  2HDD A;  3OYM A;  4LK0 F;  2Y30 A;  4HPQ A;  2WY8 Q;  2M45 A;  3E5Q A;  4G6D A;  2MH9 A;  4PJ0 C;  4HDU A;  5FO5 A;  4I98 B;  4MFD A;  3G1O A;  5DCF A;  4M9S A;  3L2V A;  1WJC A;  3LOC A;  3FXK A;  1I5Z A;  1OMI A;  1PDN C;  2H94 A;  2HVS A;  2DQL A;  2ZJR F;  2HQ5 A;  3Q0U A;  3MZY A;  3WTW C;  3LST A;  1SMY F;  1UHS A;  1HOM A;  4HNU A;  2FA5 A;  2BY2 A;  5ILV A;  2R7D A;  3CUO A;  4LOC A;  3MKW B;  4M3B A;  3HHH A;  2BXY A;  2DYR H;  3O2P E;  1K6O A;  1B72 A;  2XB5 A;  4A5M A;  1FIA A;  4OOI A;  5JVT A;  1DP7 P;  2BY0 A;  1W7P B;  4U87 A;  3K1M A;  1DUX C;  2VUM J;  2ACJ A;  1A5J A;  2XAG A;  5D4S A;  1TNT A;  1VND A;  3DP7 A;  3HKZ A;  3KFW X;  2L7M P;  2XPU A;  4RS8 A;  4A2U A;  3X2Q H;  3CP2 A;  1SFO J;  3TDU C;  4EV0 A;  4HF2 A;  5TJJ A;  5JFR A;  3BZC A;  3BOQ A;  4EJV A;  4ZZD A;  6PAX A;  4PSX A;  3TL4 X;  4EEF G;  3RZD J;  1IN4 A;  3BT9 A;  4A3D J;  4D0P A;  5CYV A;  4K2E A;  3SDB A;  1UJ8 A;  2HFH A;  3ECH A;  2NVX J;  2I5U A;  3CLQ A;  4H4K C;  2X51 A;  2KRH A;  2LKP A;  5CJ9 A;  4XOT A;  2CGP A;  1FMV A;  1V5F A;  1JXS A;  1ZK8 A;  4I7H A;  2FE3 A;  5J1U A;  4WXD A;  2DA3 A;  2P81 A;  5J4V A;  3CZ6 A;  3CO7 C;  2YX4 A;  3FK6 A;  3R0J A;  1YFH A;  1D1B A;  3L9F A;  3F0C A;  2QQA A;  1B9M A;  2QKM B;  3L7W A;  2KZG A;  3MKL A;  3JAM K;  1AU7 A;  1MH4 A;  2V1D A;  3A02 A;  5B5E C;  3CCQ I;  1BM9 A;  2LY1 A;  2OJE D;  3CCM I;  3WTY C;  4KT6 A;  2IA0 A;  2R4G A;  3I0T A;  1ZR2 A;  2HVQ A;  3TED A;  4LB5 A;  3K4J A;  1D8J A;  3BPV A;  1QVU A;  4EM2 A;  2Z9O A;  1SVO A;  2DDA A;  5CKT A;  1OCT C;  1W7P A;  5F64 A;  4XKC A;  4XLE A;  3RKW A;  2WC2 A;  4GFB A;  3K4M A;  3GTJ J;  3BJO A;  4LGW A;  4UVA A;  2UXN A;  2OC6 A;  1IN5 A;  1GV5 A;  2QCO A;  1P4W A;  2VI6 A;  5FD5 A;  2FEZ A;  4V2F A;  1A36 A;  1IRG A;  1XGO A;  1Y8Q B;  2MFZ A;  2DMT A;  5EF6 A;  3DFG A;  4RB0 A;  2R0Q C;  1LDD A;  2NYX A;  3I5U A;  5LFA A;  2YU3 A;  4B48 A;  5GTI C;  1LDK B;  1GUU A;  4GRI A;  1WZ2 A;  4ZZL A;  4IOA F;  2XVC A;  3AG1 H;  3WTZ A;  2XV4 S;  1FP2 A;  4ZDO A;  2CUZ A;  5HS8 A;  4XIC A;  1HKS A;  2PMZ N;  3KPH A;  3KYC B;  2DBB A;  4FX4 A;  4ITV A;  1F4K A;  4YII A;  2XAU A;  3MEX A;  3QYE A;  3M1E A;  2IJL A;  5JLX A;  1Y0N A;  4BUP A;  2HVR A;  2BVL A;  5HNF A;  3VOE A;  3OS1 A;  1LVK A;  2M0C A;  3ASO H;  2Q8K A;  5FLM J;  2K3P A;  2MYS A;  2DA5 A;  3DWL E;  2Z2S B;  3CUQ C;  3IH4 A;  3QOP A;  4DNC A;  5GAD J;  4G7Z F;  4RGU A;  1R4N B;  1B6A A;  4KFC A;  4RB2 C;  1J0R A;  1V55 H;  3J80 K;  1U9N A;  2PEX A;  2LTP A;  5JHF A;  4DOZ A;  3K4B A;  1QPI A;  2KIS A;  5BPI A;  5F6F A;  4XKB A;  1SD4 A;  2DA6 A;  2E2I J;  1WI3 A;  1VQ6 I;  2GOM A;  1U2W A;  3TW7 A;  2FU4 A;  2EA2 A;  3O8G A;  4F3Q A;  3L09 A;  3ZP5 A;  1VQP I;  5J4Y A;  1B8I B;  4C2U A;  4BJ6 C;  2R92 J;  2MA3 A;  4CO8 A;  5L3F A;  1Z9C A;  2IGN A;  1XDS A;  2Z16 A;  3C18 A;  1HW5 A;  1BJZ A;  1LFP A;  2WAQ N;  1IAW A;  3EET A;  3EPZ A;  1PJR A;  1PYV A;  2QSH X;  2HZD A;  5E17 F;  2CO5 A;  3EYI A;  2RVC A;  3CUQ B;  3CME I;  2OBP A;  3BR3 A;  2MD5 A;  2NS7 A;  3GO5 A;  3GXO A;  2AO9 A;  3PO2 J;  4M74 A;  3W6J B;  4KIS A;  5KAF C;  2ZME C;  3RYP A;  1KQ8 A;  2OA4 A;  2TRT A;  2Y48 A;  3HTU A;  3HOZ J;  2O03 A;  4ANJ A;  1WWX A;  1P92 A;  4XKV A;  1X58 A;  2OCC H;  2B63 J;  3F22 A;  4AYB A;  3CCS I;  1JUP A;  3JRA A;  4IHY A;  2VOO A;  1P4A A;  4ABZ A;  1IXS B;  4CCN A;  4JYK A;  2W25 A;  2ZXW H;  3DEW A;  4ENJ A;  2V4J C;  2R7V A;  2XRO A;  3K2Z A;  3CCL I;  1WJD A;  3ERM A;  4DYC A;  2M4G A;  3E5U A;  1DQU A;  4I09 A;  3CC4 I;  3EQL F;  1WCM J;  3R6S A;  2QQ8 A;  1Y6I A;  5EDN A;  5LD2 C;  3CCE I;  3K69 A;  1LPQ A;  1L0O C;  1YS6 A;  1ETO A;  1U5T C;  3I54 A;  3HSE A;  3PFI A;  1FYL A;  4B47 A;  1JGG A;  2FNP A;  3HOU J;  1IN6 A;  4NUB A;  5F27 A;  2ADU A;  2LSO A;  3BZ6 A;  3QAH A;  2ETH A;  2IPQ X;  2VT3 A;  1LEA A;  2VOP A;  2VBX A;  5EZG A;  4JP0 A;  5KCM A;  5IP7 J;  4IHX A;  2M7A A;  3GW2 A;  2EQR A;  1W5S A;  2ECC A;  1O3Q A;  2FBK A;  4Z6Y A;  4DZJ A;  4EGY A;  1ZG1 A;  3S2H J;  4XL9 A;  1B8I A;  3V7R A;  1QU3 A;  2QWW A;  3KZY A;  1IDZ A;  5DUK A;  5TIS C;  2E19 A;  1YOV B;  2YUS A;  1MZB A;  1RPW A;  3HRM A;  4B4C A;  3GFM A;  2VJ5 A;  2K40 A;  4EGZ A;  3R0A A;  1SFK A;  4JBA A;  2LRD A;  3S2W A;  1MBK A;  1G4D A;  2VON A;  4I0B A;  1EV7 A;  1DU0 A;  2MBF A;  4Y52 J;  2VT2 A;  3CUQ A;  1RUN A;  3QYB A;  1U5T B;  2PMH A;  5LHI A;  2DA7 A;  3FKI J;  3H92 A;  1VQN I;  1KZH A;  1ZHF A;  2GXG A;  3GTG J;  4UNO A;  3FXL A;  2EZI A;  2R7O A;  3Q9V A;  2F6C A;  2CQQ A;  3RDI A;  5KK1 A;  4G12 A;  4LIV A;  1DP3 A;  2V1N A;  3E6C C;  3TQN A;  5ILU A;  1MBH A;  3E5X A;  1CQT A;  2V1U A;  4DYQ A;  1FBQ A;  2VJJ A;  1RES A;  4RGR A;  1P7I A;  2K5C A;  2UWM A;  1P6R A;  1H88 C;  2STW A;  2R7U A;  2ECB A;  4FET A;  1IDY A;  2VXD A;  3BR2 A;  2M7B A;  3JW4 A;  4KIF A;  3VFZ A;  3ZQG A;  2DK8 A;  2M9H A;  4PUS A;  2VBW A;  5FRO A;  4RLF A;  2EK5 A;  2L9S A;  2FX0 A;  4DZP A;  1EH8 A;  4N4O B;  1NK2 P;  2X6W A;  3KP3 A;  2COB A;  4RB3 C;  2OCE A;  2R93 J;  2EZL A;  2K9N A;  2Y0S N;  1FOW A;  2IGK A;  5ICE A;  4Y15 A;  1HDP A;  4PSW A;  4J01 A;  2XAF A;  4ESF A;  1SC7 A;  5LRR A;  3PNY A;  1D5Y A;  4XNF A;  1XSV A;  3BY6 A;  4CGZ A;  2FXA A;  3ISP A;  4N4N B;  1XG1 A;  4BAC A;  2QSF X;  2WAE A;  3TKY A;  2DMN A;  2DCE A;  3Q5F A;  2OZ6 A;  3GZ6 A;  1S29 A;  1UG2 A;  2M1B A;  1IRX A;  5L3E A;  3ULQ B;  1S7A A;  1UB9 A;  3CJR B;  1ULY A;  4QPQ A;  3HRS A;  3KLO A;  5BNG A;  2DFI A;  1U5T A;  3HOV J;  2M4K A;  2WWY A;  4ZYA A;  1LVA A;  4PZJ A;  1RET A;  1IJW C;  2NOJ B;  5AIP A;  5IT3 A;  2Q0O A;  2BHZ A;  1SAU A;  1JTY A;  2E2H J;  2KMU A;  4OAY A;  1HDD C;  5D5V B;  3GLL A;  1XMK A;  3FWE A;  2D1V A;  2HQR A;  2O7O A;  3HYI A;  2FSW A;  3OIP A;  3OR1 C;  2BYV E;  2XIG A;  2FML A;  2CUF A;  4A3K J;  1LFB A;  1KU9 A;  1MGT A;  4LJZ F;  1R00 A;  4LMY A;  4YG2 F;  2IS2 A;  1A6I A;  3F8B A;  3HC7 A;  4LG0 B;  5GPA A;  2DA2 A;  1OYI A;  2D1H A;  1TQI A;  2QUF A;  5FKN A;  3GUD A;  5TRD A;  2VOD A;  3ASN H;  4Z2Y A;  1XSX A;  3U1K A;  5E8I A;  2I10 A;  3GTM J;  1N75 A;  5DTD A;  3QP5 A;  1BW6 A;  2QA4 I;  3ESW B;  2GWR A;  4GCV A;  2CYY A;  1YLF A;  1HLV A;  2IS6 A;  2KIF A;  3C7J A;  3S1Q J;  2DPD A;  5C3E J;  1ZKG A;  3BR6 A;  4TV7 A;  4D5C A;  1N25 A;  2XF7 A;  1Y1W J;  3O6B B;  4UB8 C;  5JHU A;  1YX5 A;  2VKH A;  1MSE C;  5LEK A;  3BTL A;  5HLI A;  1IV8 A;  3FF5 A;  5J47 A;  2M8E A;  1UZC A;  5BOX A;  1KA8 A;  4IEJ A;  3GWZ A;  2X9D A;  4U7D A;  3HG9 A;  1GXP A;  1T56 A;  2HZT A;  1Y39 A;  3FXM A;  4XSX F;  1A6Q A;  2A6E F;  2QEX I;  3BWG A;  4A3F J;  2EFN A;  1IXC A;  4F7Z A;  5F08 A;  5GAH J;  1FBS A;  3LFU A;  4L0Y B;  4AWX B;  3SFZ A;  2JT1 A;  3NWS A;  2HPM A;  2NXN B;  3DKY A;  3PNT A;  5K5Q A;  1FNN A;  1WSU A;  1ZQ3 P;  5K5R A;  1H9T A;  4XKW A;  1O3R A;  3BJA A;  4G8X A;  4FAS D;  2ELK A;  2HR3 A;  2DOF A;  4RMN A;  2CSO A;  4CSW A;  1XPX A;  1W0U A;  2EFO A;  1SD5 A;  2RNJ A;  3ERE D;  3HGG A;  4E7L A;  1EJ9 A;  1R7J A;  4PFO A;  4Y4R A;  4LG3 A;  3S17 J;  3MKY B;  2J5O A;  3GFL A;  5FFX A;  3LSK A;  2ME0 A;  3F6V A;  1KU2 A;  1O7L A;  5E3L A;  3ZMU A;  3K7A J;  5KAI C;  1LUJ B;  4LG0 A;  1S6L A;  2ZCW A;  3LA2 A;  2ZKZ A;  1XX5 A;  3EUH C;  2Z33 A;  1SD6 A;  4EJU A;  2P8T A;  4XN0 A;  4MEX F;  1OCO H;  3H36 A;  4XSZ F;  4UUS B;  3BG6 A;  1MBF A;  3RPQ A;  2JSC A;  5DCM B;  3HRU A;  3L00 A;  3N05 A;  5J6X A;  3OYF A;  3TO6 A;  4BEH B;  1AKH B;  5CPR B;  3WG9 A;  3BPX A;  2B0L A;  2HYG D;  2WV0 A;  2A5Y B;  3MFK A;  2P6S A;  3SZT A;  3VYS B;  3GLX A;  3TO7 A;  3GZ5 A;  2Y9Z A;  1E17 A;  4B3X A;  3ABU A;  2IGM A;  1OYW A;  1IGN A;  2Y9Y A;  5K5O A;  2EJR A;  1PP8 F;  2JRM A;  2LKX A;  2JQ7 A;  3HHG A;  1WI9 A;  2P5V A;  1XSD A;  2KHM A;  2DQR A;  4M3D A;  2XGC A;  1QHG A;  2DT6 A;  2ZBK A;  3CQZ J;  3NWT A;  3W2A A;  3JRH A;  1IZ1 A;  5HOD A;  2DA4 A;  3HOW J;  4Q48 A;  5DYM A;  4MFE A;  2GXA A;  1RNL A;  4FCY A;  4DIQ A;  1YJ9 I;  2M87 A;  2CQK A;  1POG A;  3WTS C;  1ITY A;  1IN8 A;  2LR8 A;  5E20 A;  3L2C A;  1ERD A;  4IPA A;  2O0Y A;  3ZQL A;  1P9Q C;  3RKQ A;  4ZH4 F;  4R1H A;  4CCK A;  1TT5 B;  4CCO A;  1YIJ I;  2V9P A;  3FM5 A;  3Q0W A;  4NDL A;  3HJE A;  3N97 A;  3CF5 F;  1IW7 F;  4E7Z A;  3CF2 A;  4A3J J;  5FLV A;  3M07 A;  2XAQ A;  1Z3X A;  3TP3 A;  4DGW B;  1H89 C;  4UUS A;  1LJ9 A;  2OZU A;  2HOE A;  2HYJ A;  2G9W A;  2Y2Z A;  2ISY A;  4PGH A;  5F1J A;  5ED4 A;  3OR2 C;  2PG4 A;  3OYD A;  5DCM A;  1KYW A;  1R1V A;  1YYV A;  2D2W A;  5DV5 A;  4BEH A;  2H8R A;  1AKH A;  3JTH A;  1T95 A;  2L4A A;  2L7Z A;  1ZYR F;  4LK1 F;  1VQO I;  2IS1 A;  2ZFW A;  2E1C A;  5J1Y A;  3D5S C;  2QZ8 A;  4KIC A;  5EZH A;  3LA3 A;  3BDD A;  3A0B C;  1VQ7 I;  3FX3 A;  4GO1 A;  3DBH B;  1RZ4 A;  4HEA 2;  3OYH A;  3CCY A;  1QO0 D;  2Y69 H;  3IKV A;  4BXX J;  1VQ5 I;  2JVH A;  4XN3 A;  4KIB A;  3GX4 X;  5IT9 Z;  2F5C A;  1TZL A;  1OCC H;  2M5W A;  4OIN F;  3H3V K;  4YIR X;  1GT0 C;  3EUH A;  1G3T A;  2ZXI A;  4CH7 A;  1D1A A;  1VFC A;  1QPM A;  3RZO J;  5IOY A;  4UY8 I;  1WPK A;  3HSF A;  4YEL A;  1IF1 A;  1A04 A;  1R6R A;  1ZAO A;  3LQQ A;  3KP4 A;  3JRG A;  1LEB A;  1ZR4 A;  1JT6 A;  1B4A A;  3TP0 A;  2DW4 A;  1Z7U A;  1J75 A;  1O3T A;  3S2D J;  1Y56 A;  3P9I A;  2EZH A;  1RKT A;  4BHB A;  2Z3Y A;  1J7K A;  3I4M J;  3QPS A;  4IO9 F;  2H09 A;  4RGX A;  5IPA A;  2XSD C;  3GTL J;  1YW8 A;  3JAM Z;  1W7P D;  3WE2 A;  1TT0 A;  1BJA A;  1NK3 P;  2O3F A;  5D6F A;  4OU0 A;  2RRE A;  1LQ1 A;  1WJA A;  3FMR A;  4KMU X;  2NVY J;  3FKJ A;  2VQH A;  2PI0 A;  2OQG A;  4E6K G;  1YG2 A;  2AXL A;  4OIO F;  3BLY A;  2CU7 A;  4NC7 A;  4B43 A;  4M3F A;  4U88 A;  1ENH A;  3KP2 A;  3CC2 I;  1IC8 A;  2IP2 A;  2K27 A;  2KT0 A;  3HZJ A;  4MEY F;  3S1M J;  4ENK A;  3ABM H;  3ZOB A;  4XLP F;  1D0Y A;  2HS5 A;  3BQZ A;  2YSR A;  3K10 A;  3MN2 A;  2G7U A;  2RNG A;  3T8R A;  1NTC A;  2XGX A;  2ZB9 A;  4IQ4 A;  5GP9 A;  2XAJ A;  1SFU A;  2HGC A;  2VN2 A;  4GYG A;  3F72 A;  2A68 F;  3HGY A;  5HLG A;  4M9Z A;  1X1B A;  5FGM A;  2K4J A;  3VEP A;  4IOC F;  2WBM A;  2XRL A;  1TBX A;  2CV0 A;  4BH9 A;  3R4K A;  5CLS A;  4I6Z A;  2DT7 B;  2HDC A;  4MNU A;  5DDG A;  1IUF A;  5D5U B;  3K4K A;  3SYT A;  5GAE J;  1H9G A;  3QYF A;  3O8H A;  2E5Z A;  2BY1 A;  1BI1 A;  5IT9 K;  2M34 A;  4P96 A;  2ZSH B;  1P7J A;  3F8M A;  4UVC A;  1YHQ I;  1BIA A;  2HKO A;  3MMY B;  2VBZ A;  2VL8 A;  2K86 A;  1JT0 A;  3DU5 A;  5BMZ A;  3L2Q A;  1ZAR A;  1PUE E;  4BQA A;  3AL0 B;  3CP8 A;  2NVU B;  3FHN A;  2E1N A;  2MLG A;  4YFX F;  2O6G E;  3K0L A;  5J1R A;  1FIP A;  3VWB A;  3CCV I;  2GQQ A;  2X6X A;  1FX7 A;  2E36 A;  4NQW B;  4Y7N J;  3OS2 A;  1KU3 A;  4A93 J;  3J80 Z;  3S1N J;  1R58 A;  3G73 A;  5FRN A;  4ZYE A;  2XKO A;  3OYB A;  3I71 A;  4M73 A;  5E18 F;  4BY1 J;  2W24 A;  2EWN A;  2C6Y A;  1S9H A;  4EM1 A;  4ZYD A;  2F4M B;  4X0G A;  3WU1 B;  3CC7 I;  5C4X J;  2B7E A;  2F5E A;  1GLN A;  2CQX A;  3GCM A;  5DD4 A;  1UFM A;  2AS5 F;  4P5O A;  4EJW A;  3F6O A;  3BQY A;  1HXD A;  2E71 A;  3VSK A;  3KEQ A;  2FMY A;  2E7W A;  4BKX A;  1QBJ A;  1ZLJ A;  2Y0M A;  1ZRF A;  2DI3 A;  2V6E A;  1IXR C;  2F4I A;  1NG6 A;  3K1N A;  1E3O C;  2LH9 A;  1B1B A;  2L9N A;  4II3 A;  1FSE A;  3ZPL A;  1QRY A;  4A0Z A;  1KQ0 A;  1QGP A;  3ZQQ A;  3I58 A;  1R1T A;  4NC8 A;  3LSM A;  4IZZ A;  3J81 Z;  1ZEL A;  3PQK A;  1LFU P;  4A3E J;  3UKG A;  2F5D A;  2DN0 A;  4MTE A;  3CCJ I;  2MC4 A;  4MQ9 F;  4QSH A;  2JA7 J;  1YO5 C;  1G8X A;  3PSF A;  2PJR B;  3RTR A;  4MTD A;  1VI0 A;  3C1D A;  1WVR A;  3WGI A;  1HBX G;  3W2V A;  2CG4 A;  2FBH A;  3MCZ A;  3A01 B;  1MD0 A;  2EV6 A;  4KIG A;  2RDP A;  4CHU A;  3OYJ A;  1IG7 A;  4B8X A;  2CMP A;  4RBO A;  2XGE A;  4NB5 A;  4M6V A;  2BOL A;  2HPI A;  3L2U A;  3H0G J;  1G59 A;  5IOZ A;  3S16 J;  3PM1 A;  2HQN A;  3OOU A;  4NQW A;  2QVO A;  3TW6 A;  4G7H F;  4OWR B;  2BEO A;  3S3M A;  3WHC A;  3ZXS A;  2JUC A;  1XMA A;  4EVI A;  2Y75 A;  2IA1 A;  1K4T A;  3B6A A;  1FYM A;  3T1B A;  4F55 A;  2QLZ A;  4KNY A;  1R49 A;  3S93 A;  1B9N A;  2VE8 A;  4F92 B;  2ZNZ A;  2R7R A;  2GZW A;  5BS6 A;  4O3M A;  1BI3 A;  2K9Q A;  1M1E B;  4HF1 A;  2XAH A;  2X6O A;  4XBF A;  4HQM A;  2KIU A;  3BRO A;  2KKO A;  5C4J J;  1E2X A;  2MLK A;  1G3Y A;  3FIW A;  3LSI A;  4ZYH A;  2M30 A;  5F0F A;  5EEG A;  4J00 A;  2FQ3 A;  4YIF A;  3D1N I;  1MSF C;  1G3W A;  1UMQ A;  2DJN A;  1JKR C;  1SFE A;  4I0A A;  1ODD A;  2JSP A;  5IY5 H;  5HOO A;  2PN6 A;  4HV6 A;  3HUG B;  3AKZ A;  3OOP A;  4D5F A;  3A2K A;  2PJR A;  1TWC J;  4EAT A;  3BZK A;  1BR4 A;  3FXR A;  3FXQ A;  4O5V A;  5D8K B;  4ZC3 A;  4JK1 X;  3F3X A;  1REP C;  2DXI A;  3J81 K;  3A01 A;  4DBQ A;  2HDW A;  1G3S A;  4WCG A;  1LE8 B;  3EUK L;  2OTL I;  3ABK H;  1SVL A;  1JUM A;  3PJR A;  3OL4 A;  3KX2 A;  2LRE A;  4HLY A;  3G1L A;  3IRR A;  4KMF A;  4G94 A;  2FOW A;  3DKW A;  1B59 A;  4HA8 A;  5L3G A;  4L18 B;  2L9R A;  3PL8 A;  2CRG A;  2QQB A;  4QLC U;  1SAN A;  2CQN A;  3IC7 A;  2ESH A;  5A2Q Z;  3TGN A;  3S14 J;  5FLX K;  2K85 A;  1BN5 A;  4L9V A;  2L02 A;  4CDG A;  2JZY A;  2KDO A;  3EYY A;  2DJI A;  2DTZ A;  3F8C A;  2LY9 A;  4PFP A;  2L54 A;  1I39 A;  5DEQ A;  2VB6 A;  2DTR A;  1OCZ H;  3GEZ A;  1I6H J;  1E3H A;  1NHA A;  2EFQ A;  3HRT A;  3DBR B;  2PLY A;  3B73 A;  5D4R A;  1HKQ A;  1OPC A;  3PFY A;  4CZZ A;  3W6K B;  1K61 A;  4O6J A;  1T33 A;  1WHU A;  5AON A;  2DPU A;  5IP6 A;  3IKT A;  4XON A;  2A5W A;  2V7F A;  4XLC A;  3VDX A;  3D5R C;  2XKP A;  2BGC A;  4WF2 A;  2NS0 A;  5E3N A;  4XR6 A;  2FNA A;  1SAX A;  3MAJ A;  2GLO A;  1AHD P;  3HUG A;  3GBG A;  5H6R A;  3K9T A;  4AUX A;  2OTJ I;  4LLL A;  2KJC A;  2HXO A;  1SMT A;  4FTH A;  1CF7 B;  5M5Y J;  1ZGJ A;  2D5V A;  2XB0 X;  3CDH A;  4BDZ A;  4B3A A;  1V5E A;  4D9J A;  1Z77 A;  4LIT A;  2WAF A;  4P1W A;  3AAF A;  1RR8 C;  4FIS A;  2NVT J;  1ETW A;  1LE8 A;  2WB1 A;  2X1C A;  4LLN A;  2W57 A;  1OR7 C;  2P0W A;  2MG4 A;  1Z67 A;  1XCV A;  1MNM C;  5E3M A;  1ONV A;  5H6Q A;  2RKH A;  4L9N A;  2NVQ J;  3JRB A;  1MW7 A;  3OYC A;  3RPU D;  5M3M J;  2NNN A;  1R36 A;  2COM A;  3B6C A;  4Y17 A;  5D8L B;  2OAZ A;  3GZN B;  2LF7 A;  3CDI A;  1FLI A;  2MSY A;  3CCU I;  4L5J A;  1I3A A;  4KUM A;  4A12 A;  3H0D A;  3PUF A;  1X1P A;  3HKZ N;  1I50 J;  4BJ5 C;  3DKX A;  4IF4 A;  2BZT A;  5IYD J;  3FIS A;  2GM4 A;  1ACI A;  5FB2 A;  1YIO A;  3KYD B;  3JRF A;  1QQI A;  2EFP A;  1ETV A;  1GVJ A;  3H5R A;  4M72 A;  3E6D A;  3TBI A;  3GME A;  4XRS G;  5A2Q K;  1TL8 A;  2RQP A;  4OIQ F;  1A35 A;  1FTZ A;  2KDZ A;  4RAY A;  2CS3 A;  2KP6 A;  2VIX A;  4H0E A;  1FC3 A;  2HOT A;  2A6H F;  2Q1Z B;  2AQE A;  3GTK J;  4ZDL A;  3OYE A;  2IEK A;  4A6D A;  5FKK A;  3L2W A;  1DPR A;  1D0Z A;  2IAI A;  2WV1 A;  1KU7 A;  3W6V A;  3OSF A;  1FYK A;  4OIR F;  3Q3S A;  1U3E M;  2NS8 A;  4KN4 X;  2KFD A;  4ZJZ A;  2K4B A;  2W4S A;  3A0H C;  2GIV A;  1Z21 A;  1T2K A;  3PO3 J;  2F5V A;  3FMQ A;  3LA7 A;  1IV6 A;  5AIQ A;  2R5Z B;  3OV8 A;  5IYC J;  4GDF A;  1CF7 A;  2HEO A;  3BP8 A;  2E60 A;  2DFH A;  2DMP A;  4IJA A;  3N4M A;  5D5W B;  1F5T A;  3OL3 A;  2VC0 A;  2JA8 J;  3ML6 A;  4Q47 A;  3K6G A;  3I55 I;  2HQA A;  2GA2 A;  5F1R A;  1TW2 A;  2JA2 A;  3FBN B;  2FUG 2;  3L2R A;  2LYC A;  5EYR A;  4CIC A;  1BL0 A;  2XAS A;  1BW5 A;  1ETY A;  4E4H A;  2Z5U A;  4UV8 A;  2WAD A;  4C30 A;  4BY7 J;  1WQ2 A;  4CA0 A;  1VQ9 I;  2VQC A;  1Z6R A;  2OV7 A;  3ECO A;  1KON A;  1X4P A;  3QOE A;  3R60 A;  3OYN A;  2IW5 A;  1U8R A;  5CVJ A;  2QQ9 A;  4ESB A;  5FKO A;  1XB4 A;  1BBY A;  1IUY A;  2XDV A;  4F52 A;  3HDD A;  1RRJ A;  2I8D A;  1ZLK A;  2N8G A;  4FQG A;  3W2W A;  1V4R A;  3VB2 A;  1G2H A;  1ETX A;  3H3Z A;  3ABT A;  2XPV A;  2A6T A;  2IA2 A;  2ZNY A;  4A3L J;  4D7M A;  3BTJ A;  1X2N A;  1TQP A;  2GAU A;  5CVI A;  4KA4 A;  2HTJ A;  3HTS B;  3F8F A;  2MGQ A;  3J7Y J;  4F93 B;  1OR7 A;  4MGR A;  3MVP A;  1UST A;  1JHF A;  3BG7 A;  4CUG A;  3RPU A;  2AQF A;  4ETS A;  2B9S A;  3UNG C;  3DU6 A;  2K02 A;  3DPT A;  4LD5 A;  1JI8 A;  1BR2 A;  3BG5 A;  4OIP F;  1SFX A;  3V8L A;  5BQT A;  5E1W A;  5K1Y A;  3PIO F;  4JX5 A;  2KRC A;  4DBR A;  4IHT A;  5CVV A;  1QZZ A;  4UXN A;  2R5Z A;  3DPU A;  4PK4 A;  4A0X A;  1J2X A;  2DT5 A;  4QTR A;  3K4N A;  3WHB A;  4G6Q A;  3ZQ7 A;  1HF0 A;  2CQ7 A;  1DGR M;  2XF5 A;  5HDG A;  1TQM A;  2E7X A;  2CW8 A;  1ZRC A;  3E6M A;  2O61 A;  1Z91 A;  3V4G A;  5CQE A;  3QQA A;  3ZQH A;  5E1Z B;  5K7H A;  1FT9 A;  1XGS A;  3M7G A;  2EBI A;  4G6T B;  3WTU C;  3M8F A;  2CW0 F;  3G1M A;  3K70 C;  1FPQ A;  3OYL A;  2H6C A;  1S8N A;  4A5N A;  3PSI A;  3DXJ F;  4BXF A;  4HQE A;  1Q1V A;  4ON0 A;  1K4S A;  1FJL A;  3I59 B;  1VQ8 I;  2A69 F;  1J9I A;  2ZSI B;  3OYA A;  2RV8 A;  4S04 A;  3DBL B;  1JGS A;  3LAJ A;  3IAM 2;  2ELJ A;  4ENM A;  4E7S A;  3VSL A;  3CCR I;  4UV9 A;  3T5X A;  2PJP A;  2QEN A;  5M5W J;  3ABL H;  2DK5 A;  5C44 J;  2MW8 A;  4WXC A;  4L5I A;  3OYI A;  4BBS J;  1O57 A;  4M71 A;  3WGG A;  4EM0 B;  4BDY A;  4XK4 A;  1AWC A;  3ROU A;  2P7V B;  2FRH A;  3ZQF A;  1IRZ A;  4YRV A;  1X3Z B;  3BCB A;  4D1Q A;  4PJL A;  2LNB A;  3S3O A;  1XTA A;  2KL4 A;  3VPR A;  2HXI A;  4A69 C;  1X4O A;  2L7F P;  1BC7 C;  2O9L A;  1EH7 A;  4XOP A;  4P9U A;  4I99 C;  2DYS H;  4AYB N;  1OIS A;  3SXY A;  4BQO A;  2V6C A;  2VKV A;  2ELH A;  1SEU A;  2R7S A;  1DU6 A;  3CJQ B;  2PMZ A;  3QU3 A;  1JKP C;  1FZP B;  4XMY A;  1ON2 A;  1VQ4 I;  3VYU B;  4HYE A;  3IV5 A;  2FQ4 A;  2EV5 A;  1R9T J;  2IXS A;  1YX3 A;  5KVR A;  2A61 A;  1DGW Y;  2G0E A;  2HKX A;  1UCR A;  3RI4 A;  2D45 A;  3JTG A;  5HDK A;  1TP4 A;  2P4W A;  3DTI A;  3FHZ A;  1WGX A;  1K6Y A;  1W1W E;  2AXT C;  1BI0 A;  4EJO A;  2QBY B;  4E7J A;  3I59 A;  4RM2 A;  1TNS A;  3QU6 A;  4QPO A;  5LGT A;  2LFB A;  1ZRE A;  5JR3 A;  3IWZ A;  1AOY A;  3BG3 A;  3FXO A;  3OIQ A;  1LKX A;  1MMA A;  4HX8 A;  2EIN H;  2EIL H;  2Z1D A;  1V54 H;  2EPF A;  2Z99 A;  1QA6 A;  1XDU A;  2H1L A;  3RYR A;  3KLN A;  2L3D A;  5K7F A;  4U0V A;  1H0M A;  4BQN A;  1FBU A;  4KIT B;  3QPL A;  1IN7 A;  3GTO J;  5KNL A;  1WJE A;  5IYB J;  2E35 A;  1LDJ A;  2DAO A;  5EG0 B;  2CFX A;  3ZQC A;  3CLO A;  3HOT A;  4A3M J;  4Q5S F;  4YFN F;  4HNV A;  1JUS A;  2JUG A;  3JRE A;  2OQR A;  2YS9 A;  2GXB A;  1NH3 A;  3HIF A;  4M6X A;  4IXA A;  4XLF A;  5E3O A;  3M1C A;  2WAQ A;  3BTC A;  2A07 F;  2WA0 A;  1ZG5 A;  4IVN A;  4FT8 A;  4R79 A;  1TWG J;  4LLG F;  1S5L C;  3QOD A;  5B66 C;  4CXF A;  4EMS A;  2BHY A;  4A3I J;  1AA7 A;  1MBE A;  1E3P A;  4L9T A;  1T38 A;  1WH5 A;  3R61 A;  4AIJ A;  1O4X A;  5ICF A;  3IWF A;  1MBG A;  1T98 A;  3CTA A;  4XRF A;  1R71 A;  1TC3 C;  3LSP A;  2VJI A;  2LBF B;  4IQJ A;  5JVG F;  1Z6T A;  5LRS A;  3LAP A;  1XN7 A;  3E1S A;  1CGP A;  3VYT B;  3COA C;  1EKE A;  3RKX A;  2HTS A;  3ZR8 X;  3I56 I;  3I53 A;  4AC0 A;  5GTH C;  4IRG A;  1MND A;  2JN6 A;  1BC8 C;  2LK2 A;  2X85 A;  1P4X A;  2NAZ A;  2X48 A;  4JOM A;  2LC2 A;  2OUM A;  1HQC A;  1BA5 A;  5GPC A;  2QBY A;  2EB7 A;  3H1C A;  2TDX A;  4Y33 A;  5B1B H;  4OAZ A;  2MH2 A;  2OPT A;  1J09 A;  3J7Z I;  1J59 A;  1A31 A;  3J7A Y;  4RDU A;  3ZQI A;  2QYO A;  3Q9S A;  1HW2 A;  1RKW A;  4A3G J;  5CVU A;  2OU2 A;  4WK8 F;  2L0K A;  1EH6 A;  2ZFU A;  2JA5 J;  2IT0 A;  1DDN A;  2P6T A;  5LLQ A;  4PCQ A;  1R5H A;  4RGS A;  2ICW G;  3DQV C;  2WTE A;  1ZGA A;  3ZMZ A;  3LNQ A;  5LEJ A;  1N77 A;  2O8X A;  1YE9 A;  5EEH A;  5EG0 A;  5HS9 A;  3PQJ A;  3BR5 A;  9ANT A;  3CJT B;  2JK3 A;  3WGH A;  5J8C A;  1HKT A;  1FOY A;  2E1O A;  3OMY A;  1T8I A;  5F0C A;  4KN7 X;  1OFC X;  3AL0 C;  2R5Y B;  2L9V A;  3IHU A;  3CMA I;  4E7K A;  3RKY A;  4LB6 B;  2YU9 J;  3ZMD A;  5GAG J;  1QZE A;  3H9J A;  4NBQ A;  3RSN A;  2LD5 A;  3TDZ C;  1JJ8 C;  1D0X A;  1UEL B;  1JJ6 C;  1N78 A;  3OS0 A;  2LF8 A;  4HST A;  4ENN A;  2R7W A;  3E0J B;  2QF7 A;  4HOB A;  2LBF A;  5F0H A;  4C3J J;  1U8B A;  4L5E A;  1EA3 A;  2ZO4 A;  2XPW A;  4XOR A;  5J8F A;  4DQ2 A;  3V7C A;  3CMM A;  2ZC2 A;  4BHP A;  1W4M A;  2H27 A;  3TO9 A;  2M2E A;  3HM5 A;  3S3N A;  3DEE A;  3ZGK A;  2EIM H;  1QZY A;  4AIH A;  4IHW A;  5B1A H;  3DLA A;  2XGD A;  3KE2 A;  2G7H A;  4I02 A;  4RLQ A;  5HLT A;  3A03 A;  3Q0V A;  2X1E A;  3M8E A;  4E7I A;  3NQO A;  4HW0 A;  3FXJ A;  1ZTR A;  4DYR A;  4AM3 A;  3CMY A;  2VC1 A;  4N0B A;  5K7Z A;  2CJJ A;  1JKO C;  4HV5 A;  3KZZ A;  1EF4 A;  1MBJ A;  2XC7 A;  1MNE A;  2Y0S A;  2F2E A;  4E7H A;  4XID A;  2CWE A;  2EIJ H;  2VE9 A;  3MQ0 A;  4G9Y A;  1T0F C;  2W00 A;  2X0L A;  2VQL A;  3FDY A;  3U2R A;  1TW3 A;  2E1M C;  3KET A;  4I76 A;  5E1X A;  3QPH A;  5ERI A;  2DOD A;  2BXZ A;  1WJF A;  3SDG A;  3DCF A;  2V26 A;  1GHC A;  3LWF A;  3PIP F;  4B1R A;  1Q1H A;  1U78 A;  3KCC A;  2K9M A;  1USS A;  2R5Y A;  1YW9 A;  2L7K A;  3H9G A;  2UXX A;  2F5F A;  1VF9 A;  2TCT A;  2RGV A;  3QPT A;  4ZDP A;  2DMQ A;  2PQ8 A;  4GYI A;  2UV1 A;  3HBL A;  3BJ6 A;  3AFH A;  4MQV A;  5M5X J;  3HOX J;  2HWV A;  1IO2 A;  4M6Y A;  1XGN A;  3H5A A;  3GVA A;  2DOA A;  1U9O A;  3CD6 I;  2PX9 A;  1YQA A;  3DV8 A;  2LVS A;  1WJB A;  1QHH D;  4BXU A;  4HNT A;  4NHJ A;  4I01 A;  4FE4 A;  3SEZ A;  1U0J A;  1FMW A;  3FBI B;  2E1M B;  4M9X A;  2HYF A;  4XRM A;  2DFE A;  4M3E A;  1IRF A;  3ZCO A;  3U9G A;  4PJM A;  3E3V A;  4LIU A;  5FD6 A;  2XUB A;  2FD5 A;  1BIB A;  4BGD A;  3FZV A;  2H8W A;  2KJB A;  3CES A;  3VYR B;  3VOD A;  3HXL A;  3KP6 A;  5FLX Z;  2RC4 A;  2W7N A;  2K3F A;  4M3G A;  4CCJ A;  2E34 A;  2XHK A;  3PNV A;  1GDT A;  1H8A C;  5EJC A;  1V3F A;  2HU9 A;  4ASN A;  4MLO A;  2STT A;  4BJT A;  2UZK A;  2QGU A;  4IKF A;  3KEY A;  4FE7 A;  2Y31 A;  1OLT A;  5L3C A;  4EJT A;  2W82 A;  1OQY A;  2JTV A;  3BR1 A;  2DU9 A;  3QRF F;  1HA8 A;  3P9C A;  4WX9 A;  4UUV A;  3RCO A;  4F91 B;  4C2M J;  3NAU A;  3FXU A;  3D5L A;  1MIJ A;  1S7E A;  2ESN A;  3S15 J;  2HOA A;  4N9I A;  1E0E A;  5L3B A;  1X1D A;  3F8N A;  3M9A A;  4CCM A;  5FRM A;  2IS4 A;  4B09 A;  3IAS 2;  2ZXJ A;  2ME6 A;  1HC8 A;  2P5K A;  1VQM I;  5FKM A;  1YS7 A;  2Q2E B;  1KGS A;  4A0Y A;  3SZP A;  4KJZ A;  1ETK A;  1WRJ A;  1S7O A;  1LB2 A;  3PUB A;  1RI7 A;  2PFB A;  5JI6 A;  3HL2 A;  5D6E A;  2VKE A;  1Z7L A;  4N9H A;  3DTK A;  3K2A A;  2BW3 B;  2VPR A;  2VXZ A;  4HF0 A;  1MJA A;  1WJ5 A;  1MMG A;  5HVQ C;  2MC3 A;  1T0F A;  1T39 A;  1HW1 A;  3DTE A;  2KZV A;  2M0M A;  3WTV C;  2DA1 A;  4BYY A;  3SJM A;  4HX7 A;  2XRN A;  3UR3 C;  4UUT A;  1FOX A;  2W1O A;  1XD7 A;  3KYL A;  4UHT A;  5JLW A;  1YTY A;  2R7T A;  1ZH5 A;  4IX7 A;  1I1G A;  1WFX A;  4IHV A;  3H3U A;  2PMU A;  1MMD A;  2JWT A;  1D8K A;  2EV0 A;  3G6E I;  1C0W A;  3SFI A;  3OY9 A;  4Y3O A;  3FM3 A;  2QSG X;  3CDL A;  3C2G A;  5HLH A;  3ZMT A;  2BE5 F;  1VQK I;  4BHC A;  2XF6 A;  3U1D A;  4X6A J;  1BOB A;  2R7F A;  4AVP A;  1I27 A;  1JTX A;  3V8K A;  4E70 A;  3D0S A;  2VPL A;  1Y8R B;  3S32 A;  2CFO A;  2CUE A;  1ON1 A;  1GVD A;  3I4P A;  1K7A A;  5IP9 J;  2O5R A;  1F43 A;  4V2G A;  2ZJQ F;  3I64 A;  1F9N A;  4QIW N;  1XMX A;  1HCR A;  3KEO A;  1F1Z A;  3WTT C;  3W3C A;  4BNC A;  2BV6 A;  4BQQ A;  1FSH A;  4HSR A;  2X4H A;  3REO A;  5KHD A;  2H1K A;  5E8G A;  4XLA A;  3OYK A;  4RAZ A;  2V79 A;  1J5Y A;  3HOY J;  4YEJ A;  4QWQ A;  3ZN0 A;  2Q2E A;  4GGG A;  3HPG A;  2LY2 A;  4DW6 A;  3F9K A;  1SD7 A;  2RN7 A;  4B44 A;  2IGO A;  1HSJ A;  2W85 A;  5J3L A;  2RAE A;  4UVB A;  1OCP A;  5HNH A;  2P5L C;  2IRF G;  2JPC A;  1LNW A;  2BW3 A;  3SZG A;  4C2T A;  3G3Z A;  3DPL C;  3ELK A;  1YRN B;  2JA6 J;  2L01 A;  2ZJ2 A;  3QWL A;  2ZME B;  2JVG A;  3LSJ A;  5CQG A;  4IRH A;  3JRC A;  1UHW A;  3LSR A;  2BY3 A;  2L5Q A;  2KIM A;  3EUA A;  3MWM A;  1K79 A;  3CO6 C;  1BOA A;  2NRA C;  5H20 A;  3GYH X;  1MMN A;  2CW7 A;  1F36 A;  5EEA A;  3JCU C;  1PUF B;  2L2O A;  1MJB A;  4AU7 A;  3WOD F;  5DM6 F;  4NC6 A;  4A3B J;  3TOA A;  5HDN A;  1FOK A;  2FBI A;  4XLH A;  4AIK A;  4BE0 A;  3FMS A;  4BBR J;  3OSG A;  3AG4 H;  2CH0 A;  2X6Y A;  3WTX C;  2V1X A;  1R22 A;  2QM3 A;  1Z1D A;  3T0Y A;  4BL0 B;  3I3L A;  3HB9 A;  2F48 A;  3P5J A;  3EDP A;  2DFF A;  4PJJ A;  4PGG A;  2CV1 A;  1Z05 A;  1MJ9 A;  3JSO A;  1P2F A;  2HOS A;  1STZ A;  3LL7 A;  1BR1 A;  1JE8 A;  1D1C A;  5E79 C;  2LDU A;  1L3L A;  1YIT I; 
#chains in the Genus database with same CATH homology
 1YW7 A;  2NNY A;  3J7A O;  4ZYG A;  4WWC A;  1WKM A;  1FP1 D;  4KDP A;  4LFU A;  3T8T A;  3E6B A;  1KYZ A;  1ZG3 A;  2ZME A;  1XGM A;  2FF4 A;  2P7C B;  1O7F A;  1MKM A;  1R23 A;  2H6B A;  3RJP A;  3ZMS A;  3DF8 A;  4PDK A;  2YR2 A;  1T6S A;  1K78 B;  5L3D A;  1ZN2 A;  1D3Y A;  1TLH B;  5D5X B;  2JPB A;  1Y0U A;  1VTN C;  4AD9 A;  4HDV A;  3NRV A;  2GA1 A;  3P9K A;  4CYD A;  1MDM B;  1R1U A;  5BPD A;  3ZN1 A;  1I6X A;  4KT5 C;  4P9F A;  3IL2 A;  4EQQ A;  4HLX A;  3QP6 A;  2VBY A;  4FHT A;  4U7B A;  4U0W A;  1G6N A;  1R5G A;  4P55 A;  3HSR A;  4XLN F;  1JHH A;  5LGN A;  1PP7 U;  5FFZ A;  3ZMV A;  3F21 A;  4HX4 A;  1S3J A;  2BBY A;  4IRI A;  3P7N A;  3IRQ A;  5ILS A;  1O3S A;  1K78 A;  3K1P A;  3JSP A;  3E97 A;  3CJN A;  1HST A;  4OMZ A;  4IHS A;  3LQR A;  1QNT A;  1MDM A;  4KYW A;  3KP7 A;  1BI2 A;  4S05 A;  2J5P A;  1I1S A;  4JQF A;  4GXO A;  5LGU A;  4YFK F;  2YX7 A;  3HOS A;  1D5V A;  5HS7 A;  2K7L A;  2DLL A;  3SHF A;  4ESJ A;  4HBL A;  1UHM A;  3LFK A;  5ICC A;  3DEU A;  2R3S A;  1KQ9 A;  1RIO H;  2ISZ A;  2PBI A;  4HZF A;  4MHG A;  3V7S A;  1ZRD A;  2DO7 A;  3GFJ A;  2YPR A;  3KP5 A;  3TOB A;  4RB1 A;  4FX0 A;  3WU0 A;  1X3U A;  3C3W A;  4U0Y A;  2FOK A;  5DD8 A;  1OYY A;  3GF2 A;  5LHG A;  4BAY A;  2OD5 A;  3NEU A;  4L9J A;  2KRF A;  3MZH A;  4G7O F;  1XCB A;  3V8J A;  3O3K A;  5LHH A;  4OMY A;  1U6G A;  4R8H A;  3RIR A;  2W84 A;  1GXQ A;  3SQN A;  1DPU A;  3B02 A;  5CVR A;  1FY7 A;  3GFI A;  2V9V A;  5DUI A;  4A6E A;  5LBQ A;  2EA4 A;  1TTY A;  4I2O A;  2IVM A;  4Y13 A;  2JRT A;  5ICG A;  4L0Z B;  4WXH A;  1RUO A;  3WE3 A;  2L4M A;  4HAM A;  2A3S A;  2EFW A;  1FWZ A;  1W5T A;  3F23 A;  1OKR A;  4Q4Z F;  4LK0 F;  2M45 A;  3E5Q A;  4G6D A;  2MH9 A;  4HDU A;  5FO5 A;  4I98 B;  5DCF A;  4M9S A;  1I5Z A;  1OMI A;  1PDN C;  2H94 A;  2DQL A;  3MZY A;  3WTW C;  3LST A;  1SMY F;  2FA5 A;  5ILV A;  2R7D A;  3CUO A;  3HHH A;  1K6O A;  3O2P E;  4A5M A;  5JVT A;  4OOI A;  1DP7 P;  1W7P B;  3K1M A;  1DUX C;  2ACJ A;  2XAG A;  5D4S A;  1TNT A;  3DP7 A;  3KFW X;  4RS8 A;  4A2U A;  3TDU C;  4EV0 A;  4HF2 A;  5TJJ A;  5JFR A;  3BOQ A;  4EJV A;  4ZZD A;  6PAX A;  1IN4 A;  4D0P A;  5CYV A;  4K2E A;  2HFH A;  3ECH A;  2LKP A;  5CJ9 A;  2CGP A;  1JXS A;  4I7H A;  2FE3 A;  4WXD A;  3CO7 C;  2YX4 A;  3R0J A;  1YFH A;  3L9F A;  2QQA A;  1B9M A;  3L7W A;  3JAM K;  2V1D A;  1BM9 A;  3WTY C;  2IA0 A;  3I0T A;  4LB5 A;  1D8J A;  3BPV A;  4EM2 A;  2Z9O A;  1W7P A;  5F64 A;  3RKW A;  2WC2 A;  3BJO A;  4LGW A;  4UVA A;  2UXN A;  1IN5 A;  1P4W A;  5FD5 A;  2FEZ A;  1IRG A;  1XGO A;  3DFG A;  4RB0 A;  1LDD A;  2NYX A;  3I5U A;  2YU3 A;  1LDK B;  4ZZL A;  2XVC A;  3WTZ A;  2XV4 S;  1FP2 A;  5HS8 A;  1HKS A;  2DBB A;  4FX4 A;  1F4K A;  4YII A;  3MEX A;  3M1E A;  2IJL A;  3VOE A;  2Q8K A;  3CUQ C;  3QOP A;  4DNC A;  4G7Z F;  4RGU A;  1B6A A;  4KFC A;  4RB2 C;  1J0R A;  3J80 K;  2PEX A;  5BPI A;  5F6F A;  1SD4 A;  1U2W A;  2FU4 A;  2EA2 A;  3L09 A;  3ZP5 A;  2MA3 A;  4CO8 A;  5L3F A;  1Z9C A;  1XDS A;  3C18 A;  1HW5 A;  1IAW A;  3EET A;  5E17 F;  2CO5 A;  3EYI A;  2RVC A;  3CUQ B;  2OBP A;  2MD5 A;  3GO5 A;  3GXO A;  4M74 A;  3W6J B;  1KQ8 A;  3RYP A;  2OA4 A;  2Y48 A;  3HTU A;  2O03 A;  1WWX A;  1P92 A;  3F22 A;  2VOO A;  1P4A A;  1IXS B;  2W25 A;  4ENJ A;  2XRO A;  3K2Z A;  3E5U A;  4I09 A;  3EQL F;  3R6S A;  3K69 A;  1L0O C;  1YS6 A;  1U5T C;  3PFI A;  3I54 A;  3HSE A;  1FYL A;  2FNP A;  1IN6 A;  2ADU A;  2LSO A;  3BZ6 A;  3QAH A;  2ETH A;  2IPQ X;  2VT3 A;  1LEA A;  2VOP A;  2VBX A;  3GW2 A;  1W5S A;  1O3Q A;  2FBK A;  4EGY A;  1ZG1 A;  3V7R A;  2QWW A;  3KZY A;  5DUK A;  1MZB A;  3HRM A;  3GFM A;  4EGZ A;  3R0A A;  4JBA A;  3S2W A;  1G4D A;  2VON A;  4I0B A;  1EV7 A;  2MBF A;  2VT2 A;  3CUQ A;  1RUN A;  1U5T B;  2PMH A;  5LHI A;  3H92 A;  1ZHF A;  2GXG A;  4UNO A;  3Q9V A;  3RDI A;  5KK1 A;  3E6C C;  3TQN A;  5ILU A;  3E5X A;  2V1U A;  1FBQ A;  4RGR A;  2UWM A;  1P6R A;  2STW A;  3JW4 A;  4KIF A;  3VFZ A;  2DK8 A;  2VBW A;  2EK5 A;  1EH8 A;  3KP3 A;  4RB3 C;  5ICE A;  4Y15 A;  2XAF A;  4ESF A;  5LRR A;  1XSV A;  3BY6 A;  4CGZ A;  2FXA A;  3ISP A;  3TKY A;  3Q5F A;  2OZ6 A;  3GZ6 A;  1S29 A;  2M1B A;  5L3E A;  3ULQ B;  1S7A A;  1UB9 A;  1ULY A;  3HRS A;  3KLO A;  2DFI A;  1U5T A;  2WWY A;  1LVA A;  4PZJ A;  5AIP A;  5IT3 A;  2Q0O A;  5D5V B;  1XMK A;  3FWE A;  2D1V A;  2HQR A;  3HYI A;  2FSW A;  2BYV E;  2XIG A;  2FML A;  1KU9 A;  1MGT A;  4LJZ F;  1R00 A;  4LMY A;  4YG2 F;  3F8B A;  4LG0 B;  1OYI A;  2D1H A;  1TQI A;  2QUF A;  3GUD A;  5TRD A;  2VOD A;  4Z2Y A;  5E8I A;  1XSX A;  3QP5 A;  2GWR A;  4GCV A;  2CYY A;  1YLF A;  2KIF A;  3C7J A;  2DPD A;  4TV7 A;  3O6B B;  5JHU A;  5LEK A;  5HLI A;  3FF5 A;  2M8E A;  5BOX A;  1KA8 A;  3GWZ A;  1GXP A;  4U7D A;  2HZT A;  4XSX F;  2A6E F;  3BWG A;  2EFN A;  1IXC A;  4F7Z A;  1FBS A;  4L0Y B;  4AWX B;  3SFZ A;  2JT1 A;  5K5Q A;  1FNN A;  1WSU A;  5K5R A;  1H9T A;  1O3R A;  3BJA A;  4G8X A;  2HR3 A;  2CSO A;  2EFO A;  1SD5 A;  2RNJ A;  3ERE D;  1R7J A;  2J5O A;  3GFL A;  5FFX A;  3F6V A;  1KU2 A;  1O7L A;  3ZMU A;  4LG0 A;  1S6L A;  2ZCW A;  3LA2 A;  2ZKZ A;  2Z33 A;  1SD6 A;  4EJU A;  2P8T A;  4MEX F;  4XSZ F;  3RPQ A;  2JSC A;  5DCM B;  3HRU A;  3L00 A;  5J6X A;  3TO6 A;  3WG9 A;  3BPX A;  2B0L A;  2HYG D;  2WV0 A;  2A5Y B;  3MFK A;  2P6S A;  3SZT A;  3GLX A;  3TO7 A;  3GZ5 A;  1E17 A;  3ABU A;  1OYW A;  5K5O A;  2EJR A;  1PP8 F;  3HHG A;  1WI9 A;  2P5V A;  1XSD A;  2DQR A;  2ZBK A;  1IZ1 A;  4Q48 A;  5DYM A;  1RNL A;  2M87 A;  2CQK A;  3WTS C;  1IN8 A;  5E20 A;  3L2C A;  4IPA A;  2O0Y A;  4ZH4 F;  4R1H A;  3FM5 A;  3N97 A;  1IW7 F;  2XAQ A;  1LJ9 A;  2OZU A;  2HOE A;  2G9W A;  5ED4 A;  2ISY A;  4PGH A;  2PG4 A;  5DCM A;  1KYW A;  1R1V A;  1YYV A;  2D2W A;  5DV5 A;  3JTH A;  2L4A A;  1ZYR F;  4LK1 F;  2ZFW A;  2E1C A;  2QZ8 A;  4KIC A;  3LA3 A;  3BDD A;  3FX3 A;  4GO1 A;  1RZ4 A;  1QO0 D;  3IKV A;  4KIB A;  3GX4 X;  5IT9 Z;  2F5C A;  2M5W A;  4OIN F;  3EUH A;  1G3T A;  1QPM A;  3HSF A;  1IF1 A;  1A04 A;  1ZAO A;  3LQQ A;  3KP4 A;  1LEB A;  1B4A A;  2DW4 A;  1Z7U A;  1J75 A;  1O3T A;  3P9I A;  4BHB A;  2Z3Y A;  1J7K A;  2H09 A;  4RGX A;  1YW8 A;  3JAM Z;  1W7P D;  3WE2 A;  1BJA A;  2O3F A;  5D6F A;  4OU0 A;  1LQ1 A;  3FMR A;  4KMU X;  2PI0 A;  2OQG A;  1YG2 A;  2AXL A;  4OIO F;  4U88 A;  3KP2 A;  2IP2 A;  2K27 A;  4MEY F;  4ENK A;  4XLP F;  2HS5 A;  2YSR A;  2G7U A;  3T8R A;  2XGX A;  2XAJ A;  1SFU A;  2HGC A;  2VN2 A;  4GYG A;  3F72 A;  2A68 F;  5HLG A;  4M9Z A;  5FGM A;  2K4J A;  3VEP A;  1TBX A;  4BH9 A;  3R4K A;  5CLS A;  2HDC A;  4MNU A;  5DDG A;  5D5U B;  1H9G A;  1BI1 A;  5IT9 K;  4P96 A;  3F8M A;  4UVC A;  1BIA A;  2HKO A;  2VBZ A;  2K86 A;  5BMZ A;  1ZAR A;  1PUE E;  4BQA A;  2E1N A;  2MLG A;  4YFX F;  2O6G E;  3K0L A;  2GQQ A;  1FX7 A;  1KU3 A;  3J80 Z;  1R58 A;  3G73 A;  4ZYE A;  2XKO A;  3I71 A;  4M73 A;  5E18 F;  2W24 A;  2EWN A;  2C6Y A;  4EM1 A;  4ZYD A;  3WU1 B;  2F5E A;  5DD4 A;  1UFM A;  2AS5 F;  4P5O A;  4EJW A;  3F6O A;  1HXD A;  3KEQ A;  2FMY A;  2E7W A;  1QBJ A;  1ZLJ A;  2Y0M A;  1ZRF A;  2DI3 A;  1IXR C;  3K1N A;  1B1B A;  3ZPL A;  1FSE A;  4A0Z A;  1KQ0 A;  1QGP A;  3I58 A;  1R1T A;  3J81 Z;  3PQK A;  2F5D A;  4MTE A;  4MQ9 F;  1YO5 C;  3RTR A;  4MTD A;  3C1D A;  3WGI A;  1HBX G;  2CG4 A;  2FBH A;  3MCZ A;  1MD0 A;  2EV6 A;  4KIG A;  2RDP A;  4CHU A;  4B8X A;  4NB5 A;  2HQN A;  4NQW A;  4G7H F;  2QVO A;  2BEO A;  4EVI A;  1XMA A;  2Y75 A;  2IA1 A;  1FYM A;  3T1B A;  2QLZ A;  4KNY A;  1B9N A;  2VE8 A;  2ZNZ A;  2GZW A;  5BS6 A;  4O3M A;  1BI3 A;  4HF1 A;  2XAH A;  4XBF A;  4HQM A;  2KIU A;  3BRO A;  2KKO A;  1E2X A;  2MLK A;  1G3Y A;  4ZYH A;  2M30 A;  5EEG A;  2FQ3 A;  4YIF A;  1G3W A;  1SFE A;  4I0A A;  1ODD A;  5HOO A;  2PN6 A;  4HV6 A;  3OOP A;  3FXR A;  3FXQ A;  4O5V A;  5D8K B;  4JK1 X;  3F3X A;  1REP C;  3J81 K;  4WCG A;  1G3S A;  4HLY A;  3IRR A;  4KMF A;  4G94 A;  3DKW A;  1B59 A;  4HA8 A;  5L3G A;  4L18 B;  2QQB A;  4QLC U;  3IC7 A;  2ESH A;  5A2Q Z;  3TGN A;  5FLX K;  1BN5 A;  4L9V A;  2L02 A;  4CDG A;  2JZY A;  3EYY A;  3F8C A;  2L54 A;  5DEQ A;  2DTR A;  3GEZ A;  1NHA A;  2EFQ A;  3HRT A;  2PLY A;  3B73 A;  5D4R A;  1HKQ A;  1OPC A;  4CZZ A;  3W6K B;  4O6J A;  5AON A;  2DPU A;  3IKT A;  2XKP A;  2BGC A;  4WF2 A;  2NS0 A;  1SAX A;  2FNA A;  3MAJ A;  3HUG A;  5H6R A;  3K9T A;  4LLL A;  2KJC A;  1SMT A;  1CF7 B;  1ZGJ A;  3CDH A;  3AAF A;  4LLN A;  2W57 A;  1XCV A;  1ONV A;  5H6Q A;  2RKH A;  4L9N A;  2NNN A;  1R36 A;  2COM A;  5D8L B;  4Y17 A;  2OAZ A;  2LF7 A;  1FLI A;  4L5J A;  4KUM A;  4A12 A;  4IF4 A;  5FB2 A;  1YIO A;  1QQI A;  2EFP A;  1GVJ A;  4M72 A;  3E6D A;  5A2Q K;  2RQP A;  4OIQ F;  4RAY A;  4H0E A;  1FC3 A;  2A6H F;  4A6D A;  1DPR A;  1KU7 A;  1FYK A;  4OIR F;  1U3E M;  4KN4 X;  2K4B A;  2GIV A;  1T2K A;  3FMQ A;  3LA7 A;  5AIQ A;  3OV8 A;  1CF7 A;  2HEO A;  3BP8 A;  4IJA A;  3N4M A;  5D5W B;  1F5T A;  2VC0 A;  3ML6 A;  4Q47 A;  5F1R A;  2GA2 A;  1TW2 A;  4CIC A;  2XAS A;  2Z5U A;  4UV8 A;  1WQ2 A;  1Z6R A;  3ECO A;  3R60 A;  1U8R A;  2IW5 A;  5CVJ A;  2QQ9 A;  4ESB A;  1XB4 A;  1BBY A;  1IUY A;  1ZLK A;  1V4R A;  3VB2 A;  3H3Z A;  3ABT A;  2ZNY A;  2IA2 A;  1TQP A;  2GAU A;  5CVI A;  4KA4 A;  2HTJ A;  3HTS B;  3F8F A;  1OR7 A;  4MGR A;  1UST A;  1JHF A;  3RPU A;  4ETS A;  2K02 A;  3DPT A;  4LD5 A;  4OIP F;  1SFX A;  3V8L A;  5BQT A;  5E1W A;  5K1Y A;  4IHT A;  5CVV A;  1QZZ A;  4UXN A;  4A0X A;  1J2X A;  2DT5 A;  4G6Q A;  3ZQ7 A;  5HDG A;  1TQM A;  2E7X A;  1ZRC A;  2O61 A;  3E6M A;  1Z91 A;  3V4G A;  5E1Z B;  1FT9 A;  1XGS A;  3M7G A;  3WTU C;  3M8F A;  2CW0 F;  1FPQ A;  4HQE A;  2H6C A;  1S8N A;  4A5N A;  3DXJ F;  4ON0 A;  3I59 B;  2A69 F;  1J9I A;  2RV8 A;  4S04 A;  1JGS A;  3LAJ A;  4ENM A;  2PJP A;  4UV9 A;  3T5X A;  2QEN A;  2DK5 A;  4WXC A;  4L5I A;  1O57 A;  4M71 A;  3WGG A;  4EM0 B;  1AWC A;  3ROU A;  2P7V B;  2FRH A;  2LNB A;  1BC7 C;  1EH7 A;  4P9U A;  3SXY A;  2V6C A;  2ELH A;  3QU3 A;  1FZP B;  1ON2 A;  4HYE A;  2EV5 A;  5KVR A;  2A61 A;  2HKX A;  1UCR A;  3RI4 A;  2D45 A;  3JTG A;  5HDK A;  2P4W A;  3FHZ A;  1BI0 A;  4EJO A;  2QBY B;  3I59 A;  1TNS A;  3QU6 A;  5LGT A;  1ZRE A;  5JR3 A;  3IWZ A;  1AOY A;  4HX8 A;  2Z99 A;  1XDU A;  3RYR A;  3KLN A;  2L3D A;  4U0V A;  1H0M A;  1FBU A;  1IN7 A;  1LDJ A;  2DAO A;  2CFX A;  3CLO A;  3HOT A;  4Q5S F;  4YFN F;  2OQR A;  2GXB A;  3HIF A;  4M6X A;  4IXA A;  2A07 F;  1ZG5 A;  4IVN A;  4FT8 A;  4R79 A;  4LLG F;  4CXF A;  4EMS A;  4L9T A;  1T38 A;  3R61 A;  4AIJ A;  5ICF A;  3IWF A;  1T98 A;  3CTA A;  4XRF A;  1Z6T A;  5LRS A;  3LAP A;  1XN7 A;  1CGP A;  3COA C;  3RKX A;  2HTS A;  3I53 A;  4IRG A;  1BC8 C;  1P4X A;  2NAZ A;  1HQC A;  2QBY A;  2EB7 A;  2TDX A;  2MH2 A;  1J59 A;  2QYO A;  3Q9S A;  1HW2 A;  5CVU A;  2OU2 A;  4WK8 F;  1EH6 A;  2IT0 A;  1DDN A;  2P6T A;  5LLQ A;  4PCQ A;  1R5H A;  4RGS A;  3DQV C;  2WTE A;  1ZGA A;  3ZMZ A;  5LEJ A;  2O8X A;  5EEH A;  5HS9 A;  3PQJ A;  3WGH A;  5J8C A;  1HKT A;  4KN7 X;  3IHU A;  3RKY A;  4LB6 B;  3ZMD A;  3TDZ C;  2LF8 A;  4ENN A;  4HOB A;  2ZO4 A;  5J8F A;  4DQ2 A;  3V7C A;  4BHP A;  1W4M A;  2H27 A;  3TO9 A;  4AIH A;  1QZY A;  3KE2 A;  4I02 A;  2G7H A;  3M8E A;  3NQO A;  4HW0 A;  2VC1 A;  4N0B A;  4HV5 A;  3KZZ A;  2F2E A;  2CWE A;  2VE9 A;  3MQ0 A;  4G9Y A;  2X0L A;  3U2R A;  1TW3 A;  3KET A;  5E1X A;  3QPH A;  5ERI A;  1GHC A;  3LWF A;  1Q1H A;  1U78 A;  3KCC A;  1USS A;  1YW9 A;  2UXX A;  2F5F A;  2RGV A;  3QPT A;  2PQ8 A;  4GYI A;  3BJ6 A;  4MQV A;  2HWV A;  4M6Y A;  1XGN A;  3GVA A;  1YQA A;  3DV8 A;  4BXU A;  4NHJ A;  4I01 A;  4M9X A;  2HYF A;  1IRF A;  3U9G A;  3E3V A;  5FD6 A;  2XUB A;  1BIB A;  3FZV A;  2KJB A;  3VOD A;  5FLX Z;  3KP6 A;  2RC4 A;  2XHK A;  2STT A;  1V3F A;  4ASN A;  2UZK A;  4EJT A;  5L3C A;  2JTV A;  2DU9 A;  3QRF F;  3P9C A;  4WX9 A;  4UUV A;  3FXU A;  3D5L A;  2ESN A;  4N9I A;  5L3B A;  3F8N A;  3M9A A;  4B09 A;  2ZXJ A;  2P5K A;  1YS7 A;  1KGS A;  4A0Y A;  3SZP A;  1WRJ A;  1S7O A;  1LB2 A;  1RI7 A;  2PFB A;  5JI6 A;  5D6E A;  4N9H A;  2VXZ A;  4HF0 A;  1MJA A;  5HVQ C;  2MC3 A;  1T0F A;  1T39 A;  1HW1 A;  3WTV C;  4BYY A;  4HX7 A;  2XRN A;  1XD7 A;  4UHT A;  1YTY A;  1ZH5 A;  1I1G A;  3H3U A;  2PMU A;  1D8K A;  2EV0 A;  1C0W A;  3FM3 A;  5HLH A;  3ZMT A;  2BE5 F;  4BHC A;  3U1D A;  2R7F A;  4AVP A;  1I27 A;  4E70 A;  3V8K A;  3D0S A;  1ON1 A;  3I4P A;  1K7A A;  3I64 A;  1F9N A;  3KEO A;  1F1Z A;  3WTT C;  4BNC A;  2BV6 A;  1FSH A;  2X4H A;  3REO A;  5E8G A;  4RAZ A;  2V79 A;  1J5Y A;  4QWQ A;  3ZN0 A;  2Q2E A;  4GGG A;  1SD7 A;  2RN7 A;  1HSJ A;  2W85 A;  4UVB A;  2P5L C;  2IRF G;  2JPC A;  1LNW A;  3G3Z A;  3DPL C;  3ELK A;  2L01 A;  2ZJ2 A;  2ZME B;  4IRH A;  1UHW A;  2KIM A;  3MWM A;  1K79 A;  3CO6 C;  1BOA A;  2NRA C;  5H20 A;  3GYH X;  1MJB A;  3WOD F;  3TOA A;  5HDN A;  1FOK A;  2FBI A;  4AIK A;  3FMS A;  3WTX C;  2V1X A;  1R22 A;  2QM3 A;  1Z1D A;  3T0Y A;  3EDP A;  4PGG A;  1Z05 A;  1MJ9 A;  3JSO A;  1P2F A;  1STZ A;  1JE8 A;  2LDU A;  1L3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...