2M5WA

Nmr solution structure of the la motif (n-terminal domain, ntd) of dictyostelium discoideum la protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lupus La protein
publication title NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
rcsb
source organism Dictyostelium discoideum
molecule tags Rna binding protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m5wA00
3R61A 5CLSA 4KIGA 3GWZA 4KN7X 4XSZF 4IRIA 4L0YB 5FO5A 3IHUA 2PQ8A 3LQRA 4P96A 3DV8A 3GZ6A 1IXCA 3HOSA 1UCRA 5JHUA 3PQKA 3C18A 5CVVA 5DV5A 2G7UA 4IRHA 1JHFA 3TO9A 3DPTA 1NHAA 2GXGA 2O61A 2K4JA 3DPLC 2XKPA 1HKTA 2JPCA 1BN5A 3J80K 2V1UA 1G3WA 1YYVA 2Z99A 4IHSA 3ERED 3M9AA 1E17A 2BBYA 4DNCA 3KCCA 4M6YA 5HS8A 2FMLA 3IKTA 5FLXZ 1CF7B 3WTTC 5E8GA 3F22A 1BM9A 5E18F 1ZHFA 4G6DA 3ZMZA 1XGMA 3SZTA 2HS5A 1A04A 1FWZA 3WG9A 3BJOA 3R0AA 3WGGA 3FWEA 3FXUA 2CWEA 4Q47A 1LNWA 2H6BA 3FF5A 2KJCA 1FSHA 1K79A 5TJJA 3BY6A 3I58A 1YQAA 4PGHA 1J59A 1JGSA 2XV4S 1O3RA 3J81Z 1TQIA 4LG0B 3KP7A 2XAJA 4B8XA 4WCGA 1VTNC 2F5FA 5CVIA 1W4MA 2LDUA 2MD5A 2RDPA 4HDUA 3F72A 1OYIA 3FMSA 4ESJA 2DBBA 1I6XA 1H0MA 3O3KA 4I09A 4UNOA 2QVOA 2O3FA 1OMIA 2Y48A 3CJNA 1WI9A 1MDMB 3U2RA 2P6TA 5L3CA 2CO5A 1QZYA 4YG2F 3ECHA 5LGTA 4ZZDA 2J5OA 3W6JB 4BHPA 3FX3A 3C7JA 2KIUA 3RKXA 1RZ4A 3R60A 2D1HA 3LWFA 4Y13A 2L3DA 5ED4A 3SHFA 3REOA 3P9IA 3JTHA 4PZJA 1DPUA 3WTUC 4BNCA 2RQPA 4R79A 3ELKA 4AVPA 5BQTA 2MH2A 2JPBA 2ZMEA 1RI7A 5D6FA 3R0JA 1FBQA 4EM0B 3LSTA 2FU4A 1F9NA 2FOKA 3HUGA 5BPIA 3FM3A 4ESBA 4P9UA 3E6MA 2MH9A 3CUQB 4O3MA 2KIFA 2QM3A 3GO5A 2ZJ2A 1F4KA 2FNAA 2P6SA 4UUVA 1D8KA 2K7LA 3O6BB 3VB2A 1G3TA 2K86A 5E1WA 4F7ZA 1YS6A 4HA8A 2EV5A 4RAZA 3ZN1A 4S05A 2D2WA 5HLHA 2P5KA 2VBZA 3B02A 5D5UB 2P7CB 2HTJA 4CGZA 3I0TA 2D1VA 2BEOA 3EDPA 4OU0A 2WV0A 3U9GA 1ZG5A 3FHZA 2G9WA 5KVRA 1YG2A 1Z9CA 1BOAA 2CFXA 4OIPF 4YIIA 2ISZA 1YLFA 4AD9A 3QAHA 2ZNYA 5F6FA 1S3JA 2CYYA 2HTSA 2HKOA 1WKMA 4FT8A 2MBFA 2GIVA 5FFZA 5CVJA 4AIJA 3ZMTA 3KFWX 5D4SA 3ABUA 3ABTA 1MJBA 3KP6A 4RB3C 2XHKA 3WU0A 1BI0A 4WXCA 5D8LB 2UXXA 1JHHA 2IPQX 4D0PA 5JI6A 4CO8A 2GA2A 1Q1HA 3U1DA 1G3YA 4RGRA 4UV9A 1R00A 4A6EA 4UVAA 3P9KA 4EJOA 1RUOA 2CG4A 5CVUA 3WE3A 5E8IA 1IZ1A 1KU7A 3K9TA 2R7FA 3KLNA 1WSUA 1HQCA 2CQKA 2YR2A 3J80Z 2STTA 2DPDA 2DK5A 4BHBA 2A68F 4G7ZF 2BGCA 1CGPA 2VC1A 2FA5A 4KFCA 4MTDA 3GXOA 1O7LA 3V8KA 1W5SA 2VXZA 4FX0A 2VONA 4XBFA 1J2XA 2PJPA 3IWZA 3KP4A 1YW7A 3CO6C 1TW3A 2FQ3A 2GWRA 2R3SA 2PLYA 3G73A 1K6OA 3K1NA 5D4RA 2FNPA 1PP8F 4IJAA 1XD7A 1KA8A 4L9JA 3RTRA 4HQMA 2DLLA 1STZA 3GFJA 4KYWA 1SAXA 1YW9A 3WGIA 4NHJA 5E1ZB 2V6CA 1LVAA 2ZNZA 1KQ8A 3WGHA 5D5WB 1Z6TA 4EM1A 2QQ9A 3MAJA 3DEUA 4R1HA 2ADUA 4Y15A 1F1ZA 3LFKA 2R7DA 2O8XA 1Z1DA 3CDHA 4WXHA 3SZPA 2XASA 3V4GA 1OYYA 3S2WA 1J9IA 3HIFA 4UV8A 1Z05A 1SD7A 3Q9SA 3HRMA 2VOPA 1R22A 2IVMA 3OOPA 2DI3A 3J7AO 4AIHA 4NQWA 1YW8A 2A6HF 2DQLA 2Z9OA 4TV7A 2FBKA 3EETA 1MJAA 3BOQA 5EEGA 1D5VA 3DFGA 1WRJA 4KICA 1UFMA 3LQQA 2W25A 1FP2A 1XCVA 4HYEA 1MGTA 2Y75A 2BE5F 3WTSC 3RPUA 4U0WA 2VN2A 5DD8A 4LB5A 2OZ6A 3V8JA 1MD0A 4AIKA 1G3SA 1U5TC 2HYFA 1GXQA 3HTSB 1FSEA 2IA1A 3RYRA 3HRUA 5DD4A 4RB2C 2ESNA 4KN4X 4XSXF 1XSDA 1LEAA 1J0RA 2A3SA 5LBQA 5L3DA 2NYXA 1L0OC 2VBXA 4KIBA 2PG4A 3BJAA 4HX8A 4AWXB 1D8JA 1EV7A 3LA7A 1FZPB 4ENNA 4MQ9F 2HKXA 2YX7A 4BAYA 3I53A 4ZYDA 2UWMA 5E1XA 3QP5A 1BC7C 1T2KA 2PI0A 4HLYA 3PFIA 4LMYA 4RGXA 3M8FA 2EV6A 4CICA 2XROA 5BOXA 4HF0A 2XIGA 1LDKB 2JTVA 1O57A 3AAFA 4MHGA 3DP7A 3RPQA 1IN7A 4P5OA 3L2CA 2L01A 1IUYA 3RYPA 4IHTA 4HX7A 3JAMK 2FBIA 2CW0F 2PEXA 5CJ9A 1YFHA 1F5TA 1ZRFA 4U7DA 2A5YB 4G6QA 2X0LA 1U8RA 1I27A 1ZH5A 1IAWA 1ZYRF 2QLZA 2VBYA 1GHCA 2RGVA 5FD5A 4BHCA 1REPC 3FM5A 4GCVA 1T38A 1LB2A 4JK1X 1HW1A 5J8FA 2HGCA 3M7GA 1LDJA 4HV5A 1T6SA 4M72A 3GX4X 2IA0A 3QU6A 4U0VA 3ZMUA 3F6OA 1MJ9A 3ZP5A 5JFRA 2HEOA 3ZN0A 2M8EA 4HOBA 1ZARA 2ZBKA 4I01A 5K5OA 3BZ6A 5HDGA 4OIQF 1H9TA 1FC3A 2NAZA 4O6JA 1O7FA 1T39A 4PGGA 1XDUA 1IN6A 1TNTA 3K1MA 2M87A 3HRSA 5K1YA 4U0YA 1B9MA 1TLHB 1FYMA 3TDUC 1KGSA 5DCMB 1PUEE 4HQEA 4HW0A 1I5ZA 4LLNA 1P92A 1U6GA 3W6KB 1IXSB 4HF2A 3F3XA 5LEJA 2V1XA 2GZWA 5D5VB 2OQGA 2Z3YA 2RN7A 3SXYA 4OINF 4GXOA 1ONVA 4ESFA 1XCBA 3KEQA 4A5MA 3CUOA 5D8KB 2HDCA 4OMYA 3LAPA 5IT9Z 1QO0D 4G9YA 3KZYA 4MEYF 1X3UA 4A6DA 2QWWA 5L3BA 1XSVA 3N97A 1HSTA 2QUFA 3GFLA 2PBIA 1HSJA 4P9FA 1BIAA 3QRFF 4KIFA 4QLCU 3LAJA 4M71A 4IF4A 1B9NA 4MGRA 3ULQB 2HFHA 1FPQA 2OQRA 4RS8A 1R7JA 4ZYHA 5D6EA 1SMYF 1WQ2A 4M74A 2XGXA 4EJVA 1IW7F 3L7WA 2KKOA 1UB9A 1DDNA 1GVJA 2DO7A 2E1CA 4YFKF 1TTYA 2KIMA 4OMZA 2OBPA 5CVRA 1Y0UA 4Z2YA 1U2WA 5JR3A 2M30A 4YFNF 2MA3A 2ACJA 4EM2A 1R1VA 4ZZLA 2H09A 1FX7A 1XMAA 4ON0A 3DXJF 2XAQA 2RC4A 3K69A 4I7HA 3T8RA 2OAZA 1IRFA 3NQOA 5FD6A 1SFUA 3FXRA 3F8BA 1XDSA 3HSRA 2FSWA 4U88A 2L54A 4HLXA 5K5RA 1ZG3A 2IW5A 4FHTA 5L3EA 2W57A 4LK0F 3Q9VA 3JW4A 4UVBA 1ZRCA 4P55A 2O0YA 2VOOA 4A0XA 4WXDA 1RNLA 2QZ8A 2AS5F 4EGZA 5F64A 3ZPLA 3ISPA 3GEZA 1BIBA 4M73A 1KQ9A 4L18B 2CSOA 3ECOA 3GFIA 1ZN2A 1D3YA 2V1DA 4WK8F 4UXNA 1ZGJA 2EFWA 3VOEA 3JAMZ 1OPCA 2IT0A 3G3ZA 1QGPA 2LNBA 2HQNA 3CTAA 4G7OF 3L09A 4RGUA 1ZRDA 5HLGA 2EV0A 3KZZA 4HAMA 2B0LA 3I59B 2DW4A 1P4WA 3BROA 2F5EA 3L00A 4WX9A 3C3WA 2A6EF 2HYGD 4ENJA 3F8MA 4L5IA 4B09A 3T0YA 3TO7A 3HOTA 2JT1A 1W5TA 4XRFA 3ZMDA 2G7HA 1L3LA 2IJLA 3I4PA 3E5QA 1RUNA 5LLQA 1FLIA 4EQQA 1XB4A 1DP7P 3L9FA 2QENA 4NB5A 3IRRA 2ESHA 2VE9A 2ISYA 3ZMVA 4LLGF 2OZUA 3GZ5A 3H3ZA 1ZLKA 4M6XA 2QBYB 1V4RA 4RB0A 5FFXA 1I1SA 1S8NA 2PMHA 2P4WA 4M9ZA 5IT9K 4E70A 3K0LA 2LSOA 2J5PA 2OA4A 4LLLA 2P8TA 2VE8A 5L3GA 3QP6A 5DCMA 2Q2EA 2O6GE 3NRVA 2NRAC 4KMUX 2PFBA 4K2EA 2Z5UA 1P2FA 1W7PB 1B59A 1AWCA 4FX4A 1RIOH 5DEQA 3EYYA 3CUQC 1SD6A 2L02A 4O5VA 4ZYEA 1FYLA 1SMTA 1SD4A 1XGSA 3KEOA 5DYMA 2XAGA 2L4AA 1OKRA 4KNYA 4ETSA 4L9TA 1QPMA 5LHGA 2EFPA 2NNNA 3R4KA 2XUBA 3DQVC 4N9HA 3V7SA 5ILUA 3IC7A 3VFZA 1O3SA 2H27A 3GFMA 1KYZA 5ICGA 1KQ0A 1XSXA 2DK8A 5ICEA 2COMA 4A5NA 1Z91A 4YFXF 4G7HF 3MQ0A 1GXPA 2K4BA 1KYWA 2PN6A 3H3UA 4RAYA 1O3TA 2FXAA 4EV0A 2V9VA 5J6XA 4BQAA 1AOYA 3V7RA 4QWQA 5EEHA 1IN8A 1BI3A 2DTRA 2XAHA 3VODA 5LEKA 3F8CA 4LFUA 3RKWA 4XLPF 2GA1A 3FZVA 1HW2A 2DT5A 2EFOA 2A61A 3HTUA 4ENMA 3NEUA 2JSCA 3GW2A 4A12A 4HF1A 1DUXC 1IRGA 1IF1A 4MNUA 4CXFA 1SD5A 2DQRA 1ODDA 4UHTA 1BI1A 3B73A 2IA2A 3O2PE 4YIFA 2F5CA 3H92A 3I71A 3COAC 5HVQC 3V7CA 4A0YA 1FBUA 1R58A 1U5TA 3WU1B 3WE2A 3M8EA 1P4AA 3I64A 3RI4A 2DPUA 2BV6A 5ICFA 2A69F 1ON2A 2MC3A 5HDNA 4CDGA 3HYIA 4MQVA 2E7XA 2ZFWA 3GVAA 4N9IA 3KE2A 4EGYA 3E5UA 2DAOA 3GYHX 4A0ZA 3K2ZA 3T5XA 5LHIA 2OU2A 4N0BA 3E5XA 3KLOA 1K78A 6PAXA 3RDIA 2ZO4A 3HSFA 1UHWA 5L3FA 2P5LC 2LF8A 2CGPA 1G6NA 3SQNA 5LRSA 1QBJA 2WC2A 4ZH4F 1MKMA 1FT9A 1KU3A 2HR3A 3T1BA 5A2QZ 1R23A 2XKOA 1YS7A 1PP7U 2K27A 5LRRA 1WWXA 5BMZA 1BC8C 2VT3A 3KP5A 2PMUA 2FF4A 4CZZA 3ML6A 3ZQ7A 2HQRA 1BBYA 3E3VA 3WTWC 1B4AA 1YO5C 1ZREA 1QNTA 2FEZA 1R5HA 3BDDA 1ZGAA 2P5VA 3I59A 3Q5FA 5H6RA 2HZTA 3TO6A 2LF7A 3GF2A 1QZZA 5H20A 1EH6A 2EJRA 5AIPA 3TDZC 2WTEA 1XN7A 4RGSA 4EMSA 2HWVA 3MCZA 3QOPA 3HHHA 2JRTA 3HRTA 3V8LA 1LEBA 3WTXC 3JSOA 5KK1A 4M9XA 1E2XA 2ZKZA 1YTYA 1SFEA 4RB1A 1IXRC 5AONA 2STWA 2EA2A 1XGNA 4CHUA 4IXAA 3BPVA 1J7KA 3C1DA 2UZKA 3JTGA 2GAUA 5DDGA 1S7AA 4OIOF 1TBXA 1JE8A 3M1EA 1BJAA 2F2EA 2QBYA 1HKSA 1OYWA 3LA2A 1IN4A 1Z7UA 4HX4A 5LGUA 5E17F 1FOKA 1J5YA 3T8TA 2FRHA 2VBWA 2W84A 2O03A 3IRQA 4GYIA 4I02A 3KETA 3GLXA 3P9CA 3TQNA 4LGWA 1TNSA 4G94A 2V79A 2DFIA 4MTEA 2AXLA 4UVCA 4XLNF 5H6QA 1XGOA 4WWCA 1PDNC 4L0ZB 1W7PA 2QQAA 1ZAOA 3DKWA 1ULYA 3D0SA 3FMQA 1USSA 3BWGA 2ZXJA 3R6SA 5F1RA 4R8HA 5CYVA 1B6AA 2VODA 4HZFA 2X4HA 1FNNA 1I1GA 4WF2A 4BH9A 1R1UA 3F8FA 2M5WA 1HBXG 3LA3A 2H94A 3E6CC 3KP2A 1R36A 1QQIA 2QQBA 1HW5A 2H6CA 3WTYC 3WTZA 4KA4A 4OIRF 1U5TB 5LHHA 2LKPA 4Y17A 1J75A 4KT5C 4BYYA 1UHMA 2EK5A 3SFZA 4LJZF 4EVIA 1P4XA 3RKYA 2OD5A 1ZG1A 3KP3A 1XMKA 3ROUA 5HS7A 4Q5SF 3F6VA 5HDKA 2MLKA 1K78B 2Y0MA 2L4MA 4ZYGA 5FGMA 1ON1A 1S7OA 2D45A 3I54A 1FY7A 4M9SA 2F5DA 1HXDA 3EUHA 5J8CA 4GYGA 2Q0OA 1IN5A 1V3FA 1S29A 3MEXA 4Q48A 1C0WA 4GO1A 4DQ2A 4HDVA 1R5GA 3MWMA 3OV8A 3BJ6A 5BPDA 5ICCA 1Z6RA 4JQFA 5FLXK 1LQ1A 4ENKA 4EJWA 4U7BA 2XRNA 3BP8A 4I2OA 2XVCA 3IWFA 1T0FA 4KDPA 5HLIA 3JSPA 5A2QK 1P6RA 1H9GA 3IKVA 4CYDA 2TDXA 5DCFA 3EYIA 2Z33A 1B1BA 4KMFA 2KRFA 2EB7A 2GXBA 3D5LA 1KU2A 1FYKA 1EH8A 2C6YA 4I0BA 2FBHA 4I98B 3ZMSA 4PDKA 2KJBA 2FMYA 3J81K 2XAFA 3EQLF 2E1NA 5HS9A 1LDDA 2IP2A 2ZCWA 3MZYA 1K7AA 2E7WA 4L5JA 3K1PA 4BXUA 2RKHA 4LB6B 2NS0A 3F8NA 3DF8A 3E97A 4MEXF 5D5XB 1USTA 3CO7C 5IT3A 1CF7A 1TQPA 1FBSA 4KUMA 1U78A 3QU3A 2Q8KA 3F21A 2VT2A 2RNJA 2VC0A 1R1TA 4HV6A 4JBAA 5E20A 4IVNA 2JZYA 3QPTA 4ASNA 1HKQA 3P7NA 4I0AA 2RV8A 1EH7A 2M45A 2ZMEB 3F23A 2YSRA 3FMRA 3GUDA 2MLGA 4H0EA 3HSEA 1SFXA 1KU9A 3VEPA 3FXQA 1TQMA 4PCQA 4LG0A 2UXNA 2DU9A 5BS6A 4OOIA 5DUKA 4G8XA 5K5QA 5JVTA 2W24A 3QPHA 2EFNA 2ETHA 2EFQA 2YU3A 3RIRA 2YPRA 1BI2A 1W7PD 3PQJA 1YIOA 1DPRA 3N4MA 1JXSA 4LK1F 2W85A 3E6BA 5DUIA 4S04A 2BYVE 3TGNA 2YX4A 1MDMA 3RJPA 2IRFG 3HHGA 1LJ9A 2QYOA 3MFKA 5AIQA 1OR7A 5HOOA 2FE3A 2M1BA 4LD5A 2A07F 1T98A 5ILSA 1MZBA 2ELHA 1G4DA 1FP1D 4EJUA 4IRGA 3TOBA 1TW2A 2P7VB 4A2UA 2EA4A 4Q4ZF 3IL2A 2NNYA 5FB2A 3WODF 2HOEA 4HBLA 3I5UA 5TRDA 5ILVA 4L9NA 2RVCA 2K02A 1S6LA 2GQQA 3CLOA 1O3QA 1ZLJA 5ERIA 4GGGA 4L9VA 3WTVC 1U3EM 3TKYA 3BPXA 3E6DA 2WWYA 2EWNA 3CUQA 5LGNA 4EJTA 3TOAA 3MZHA 4IPAA
chains in the Genus database with same CATH superfamily
1K6YA 3HOYJ 1MMDA 1LFPA 3R61A 4II3A 1LFUP 5CLSA 4KIGA 1OCOH 3GWZA 4KN7X 3CMMA 3JRFA 4B4CA 2CV1A 4XSZF 1W5CC 3NAUA 4IRIA 4L0YB 2GIZA 4PJJA 5FO5A 3CC4I 4DYCA 3IHUA 1R9TJ 2PQ8A 3LQRA 3MVPA 4P96A 5EYRA 3DV8A 4F52A 3GZ6A 1IXCA 4YELA 3HOSA 4A3GJ 1UCRA 5JHUA 3PUBA 3PQKA 5FKLA 3C18A 4NNJA 5CVVA 5DV5A 3JRHA 2G7UA 4IRHA 1JHFA 2LG4A 3TO9A 2XF6A 3DPTA 1NHAA 1TZLA 2CUZA 2GXGA 3S3NA 2O61A 3A0HC 1ITYA 3F9KA 2K4JA 3DPLC 2XKPA 1VQ9I 3HXLA 2JN6A 1U8BA 1HKTA 2JPCA 3FBIB 1BN5A 3S3OA 3J80K 2V1UA 1R71A 3CCUI 2DT6A 3IUOA 1MH4A 2VKHA 5KNLA 1G3WA 1OQYA 1YJNI 2H8WA 1X2NA 1YYVA 2Z99A 4OAYA 3W3CA 4J00A 4IHSA 4PJ0C 3ERED 2ECCA 3M9AA 1MIJA 1E17A 2ZFUA 1T08B 2BBYA 4DNCA 3KCCA 4CYCB 4M6YA 5HS8A 2FMLA 2MYSA 2DJNA 3IKTA 5FLXZ 3HGYA 1MBJA 1CF7B 3S16J 3WTTC 1JUPA 3NARA 5E8GA 3F22A 1BM9A 2E71A 5E18F 1ZHFA 2L7FP 4G6DA 3ZMZA 1XGMA 3CZ6A 3OIPA 3SZTA 5E3NA 2BW3A 2HS5A 1A04A 5CPRB 2LTPA 5EGOA 1FWZA 1JTYA 3WG9A 3BJOA 1GUUA 1WJBA 1YITI 3R0AA 3WGGA 3FWEA 3FKJA 3FXUA 3FXOA 5GAGJ 4IHYA 2CWEA 2MABA 2DOEA 4Q47A 1LNWA 2H6BA 4B3AA 3BCBA 3FF5A 3MMYB 4S0HB 3BG9A 4L5EA 4XLCA 4A3IJ 3I4NJ 5J47A 2KJCA 5KHDA 1FSHA 1K79A 2G0EA 4B47A 1H89C 1RC9A 5TJJA 3BY6A 2VQHA 3I58A 1YQAA 4PGHA 1J59A 4MFEA 1JGSA 2OCEA 2XV4S 1O3RA 3J81Z 1TQIA 3HKZA 1SFKA 2ZJRF 4LG0B 3KP7A 2XAJA 3BC8A 5JLWA 4B8XA 3N05A 3VYSB 1TT0A 3H9QA 3ZXSA 4WCGA 1Z67A 1I6HJ 4QPOA 1VTNC 3QOEA 2F5FA 4PSXA 2QA4I 3OYKA 1RRJA 5CVIA 1W4MA 2GOMA 2LDUA 4E7SA 2MD5A 2RDPA 4HDUA 2LVSA 1HDDC 3F72A 1OYIA 4IHXA 1IGNA 1GV5A 1LKXA 4BU2A 3FMSA 4F91B 4ESJA 3PFYA 2DBBA 5E3MA 4UUSB 1GT0C 2F4MB 1I6XA 1N75A 3FK6A 1H0MA 3O3KA 4BJTA 4I09A 1RESA 2B63J 4UNOA 2QVOA 2O3FA 1OMIA 2Y48A 3CJNA 1WI9A 3SEZA 2XF5A 3CLQA 4FE7A 3ZCOA 1MDMB 3U2RA 2R4GA 2P6TA 3AG1H 1ZR2A 2FD5A 1S9HA 3CMYA 4IKFA 1D1CA 5L3CA 2CO5A 1UHSA 2HQAA 4BE0A 1QZYA 2DA2A 4YG2F 3L1PA 3SJMA 3ECHA 5LGTA 4ZZDA 2J5OA 3W6JB 3DTEA 1J09A 4BHPA 3FX3A 1K4TA 1MNDA 1A35A 3C7JA 2LKXA 2X9DA 2VB6A 3BT9A 3O8HA 3PO3J 1M1EB 5H2FC 5IYBJ 2KIUA 3RKXA 2OCCH 3S1NJ 1RZ4A 2O9LA 3R60A 1WPKA 4RDUA 2D1HA 2CV2A 3LWFA 3JRAA 1QVTA 4Y13A 2L3DA 3H0GJ 4BJ6C 5ED4A 3PSIA 3SHFA 3REOA 3P9IA 5IOZA 4XKVA 3JTHA 4PZJA 1DPUA 3WTUC 3K4LA 4BNCA 2R93J 2NVYJ 2RQPA 5FKOA 4R79A 3OWTA 1TT5B 3ELKA 2B9SA 4AVPA 5BQTA 2MH2A 2JPBA 2ZMEA 1RI7A 1X4PA 3NWTA 3R0JA 5D6FA 1FBQA 4EM0B 3LSTA 2FU4A 3CCVI 1F9NA 1YX3A 1SFOJ 2FOKA 2XB0X 5IYDJ 3HUGA 5BPIA 3FM3A 4BJ5C 4ESBA 4P9UA 4BQOA 3E6MA 3FXJA 2DFHA 2IGOA 2MH9A 3CUQB 1H88C 3L2UA 4O3MA 2KIFA 2W7NA 4G6TB 2QM3A 3GO5A 1WJFA 2E36A 2ZJ2A 1F4KA 3EUHC 3HC7A 3PNYA 2M0MA 2FNAA 3BTIA 2P6SA 4Y7NJ 4UUVA 1D8KA 2K7LA 1OCTC 3O6BB 3VB2A 1QHGA 3HEFA 3TP0A 2Y0SN 1G3TA 3QODA 2K86A 5E1WA 3RCOA 4F7ZA 3G1MA 1YS6A 4HA8A 2EV5A 2KIQA 4I99C 2XB5A 5GTIC 1T95A 4RAZA 3ZN1A 2X6XA 4S05A 2D2WA 3BR2A 5HLHA 2P5KA 2VBZA 2HYJA 3B02A 5D5UB 3VDXA 1NG7A 2P7CB 2F4IA 1E3OC 2HTJA 2R7VA 3AFHA 2PJRB 4CGZA 2HVQA 3I0TA 3A01A 2IS1A 2D1VA 5B66C 2BEOA 2LD5A 3EDPA 1B8IA 1T56A 5KAFC 4OU0A 2WV0A 9ANTA 3S15J 3RZOJ 3U9GA 3GBGA 4PSWA 2CMPA 1ZG5A 3FHZA 4PK4A 2G9WA 3AL0B 3ZRGA 5JLXA 3H1CA 3TW6A 3K4CA 3DU5A 1WJCA 5KVRA 3K6GA 1YG2A 5F08A 4M3DA 2XRLA 4NUBA 4UB6C 1BOAA 1Z9CA 2CFXA 2F4OB 1XX5A 4OIPF 4BBRJ 4NC8A 1WJEA 4A3JJ 2W82A 3S1QJ 2EZLA 3IH2A 4YIIA 3EPZA 5IY5H 4MO7A 2M0CA 2ISZA 1YLFA 3ZQFA 2LK2A 4AD9A 2ZSHB 3BR5A 3QAHA 2ZNYA 4JX4A 4RLFA 5F6FA 1S3JA 2CYYA 2X1CA 2HTSA 2X1EA 2HKOA 1WKMA 4FT8A 2MBFA 2OTLI 2GIVA 1WGXA 5FFZA 5F27A 4RM3A 5CVJA 4AIJA 3ZMTA 2BW3B 3KFWX 5D4SA 1AHDP 5BNGA 2FOWA 5EGOB 3ABUA 5B1BH 3ABTA 1MJBA 3KP6A 4RB3C 1YIJI 4YIRX 1Y6IA 2MW8A 1UMQA 2WY8Q 2XHKA 2CS3A 4XRSA 2E1MC 3WU0A 1BI0A 4WXCA 5D8LB 2UXXA 1GV2A 3C2GA 1JHHA 2IPQX 1BW5A 2LYCA 4D0PA 5JI6A 2HOSA 4CO8A 1R4NB 4QTRA 4HNTA 2GA2A 3OOUA 1Q1HA 3U1DA 1D1BA 1G3YA 4RGRA 5HODA 4UV9A 2WY7Q 2LP0A 2KISA 1R00A 4A6EA 3BG3A 4UVAA 2KHMA 3P9KA 3CQZJ 2HZDA 4EJOA 1TC3C 4GDFA 1RUOA 2CG4A 2EILH 2K9LA 5CVUA 3WE3A 4Y4RA 2OC6A 5E8IA 1IZ1A 5F1JA 1KU7A 3K9TA 2R7FA 3KLNA 1WSUA 1HQCA 2CQKA 2YR2A 3CCYA 4F93B 3L2WA 3J80Z 2STTA 2K3FA 2DPDA 2DK5A 4BHBA 2A68F 4G7ZF 1OLTA 2BGCA 2R0QC 1D0XA 2BHYA 2VXDA 2XAUA 5IPAA 1CGPA 1MBKA 2VC1A 2M4GA 2L7KA 2FA5A 2K9SA 4KFCA 4MTDA 2DMNA 3GXOA 1O7LA 3TP3A 3V8KA 1KONA 3PSFA 5GTHC 1W5SA 3AL0C 3J7YJ 3GTQJ 2ID3A 2VXZA 4FX0A 2VONA 4XBFA 1X4OA 1J2XA 2PJPA 1U9OA 1POGA 3IWZA 2DA5A 3KP4A 1YW7A 5EF6A 3CO6C 1OISA 3E1SA 5GPAA 3WU2C 4XRMA 1IV6A 3OYIA 1TW3A 2FQ3A 2DTZA 2GWRA 2QKLB 3ASNH 1VQ4I 2R3SA 2PLYA 3G73A 1K6OA 2KMUA 3K1NA 5D4RA 4FETA 1LE8B 2FNPA 1A31A 1PP8F 2R7OA 2BXZA 4IJAA 2DXIA 2WAQA 2XGDA 3KYCB 3OS1A 4ZTFA 4A3LJ 4D9JA 1XD7A 1KA8A 4L9JA 3RTRA 4HQMA 4XORA 1R49A 2DLLA 3DEWA 3OSFA 4BGDA 1STZA 3GFJA 3FBNB 4KYWA 2R7TA 2L5QA 2A5WA 4U87A 1SAXA 3OYBA 1YW9A 3WGIA 1X1DA 2IAIA 4NHJA 5E1ZB 1OR7C 2V6CA 1LVAA 2XDVA 1QU3A 2ZNZA 1KQ8A 4RAGA 3WGHA 1W1WE 5D5WB 3A0BC 4X0GA 1Z6TA 3KX2A 4EM1A 2QQ9A 3Q0VA 3MAJA 3DEUA 4R1HA 3G6EI 3H35A 4BACA 4HSRA 4ZJZA 3TEDA 4KITB 2ADUA 4Y15A 1F1ZA 3KEYA 4F55A 3K70D 2VLAA 3GMEA 1QZEA 1X1AA 3LFKA 2R7DA 2O8XA 1Z1DA 3CDHA 4WXHA 3SZPA 4FASD 2XASA 3V4GA 1WZ2A 1OYYA 3S2WA 1J9IA 3HIFA 1IUFA 1Y8RB 2X85A 2BY1A 4UV8A 1WJDA 1Z05A 4YRVA 1SD7A 3Q9SA 3HRMA 2LREA 1ZR4A 2CW8A 3W2WA 1WI3A 2X6WA 5EZHA 2VOPA 5GPCA 1R22A 3FIWA 2IVMA 1IO2A 4V2GA 1VQNI 5C3EJ 2RREA 4M3FA 3JRDA 3PNVA 1EJ9A 3C2HA 4H4KC 3OOPA 3W2AA 2DI3A 3J7AO 3BTJA 2NS8A 2E19A 4AIHA 2DDBA 4NQWA 5J3LA 4ZDLA 4CCKA 1YW8A 1V54H 1XG1A 2A6HF 2DQLA 4JX6A 2Z9OA 4TV7A 4C2UA 2FBKA 1Z77A 3EETA 2XPWA 2KQRA 2V9KA 3S2DJ 1MJAA 1BR4A 2ECBA 3BOQA 5EEGA 1D5VA 3DFGA 2D5VA 2IXSA 4ABZA 4Y52J 1WRJA 2L9NA 2ME6A 4KICA 1UFMA 2Y31A 3LQQA 1A36A 2W25A 1FP2A 4A3FJ 1XCVA 4IHVA 4HYEA 1ZGWA 1MGTA 2Y75A 2GXAA 1RETA 2L7ZA 2BE5F 3WTSC 1BL0A 2COBA 3RPUA 4U0WA 2KRHA 2VN2A 5DD8A 2JUCA 4LB5A 2XPUA 2OZ6A 3V8JA 1MD0A 2WB1N 3V42A 1G3SA 3HGGA 4AIKA 2P0WA 3DBLB 1U5TC 2HYFA 3BR1A 1GXQA 3HTSB 1FSEA 2IA1A 5E79C 3OMYA 3RYRA 2VJ5A 3KPHA 3HRUA 5GAEJ 5IP6A 1ERDA 5DD4A 3OYHA 3HPGA 4RB2C 4HRIA 2ESNA 4KN4X 4XSXF 3MD2A 2V4JC 4RBOA 4CZCA 1XSDA 1LEAA 4N4OB 2AQFA 3S8PA 1BOBA 1OJLA 4BDYA 1J0RA 1I39A 1VQ6I 2A3SA 2FQ4A 5LBQA 2HXOA 3SEQA 2W48A 4BXXJ 5L3DA 2NYXA 3OYDA 1L0OC 2VBXA 3LFUA 4MLOA 3G1LA 3K4BA 1AU7A 1X58A 4KIBA 4BKXA 2PG4A 2KT0A 3DKXA 3PIPF 1S72I 4UB8C 2N8GA 3BJAA 3ERMA 4HX8A 4AWXB 1UJ8A 1EV7A 3LA7A 1D8JA 3ZR8X 1FZPB 4DBRA 4ENNA 4MQ9F 2QSHX 1YI2I 4JOMA 2HKXA 2YX7A 1LUJB 4BAYA 4XN3A 3I53A 4BY7J 4ZYDA 2UWMA 1SVLA 5E1XA 1JKQC 3QP5A 5HNFA 2HU9A 1MBFA 4XR6A 2GOXB 4GFBA 1A6QA 4DGWB 1BC7C 1RR8C 1T2KA 3H3VK 4C30A 2WADA 4RMNA 2CU7A 1NG6A 3VSKA 1FOYA 4V2FA 2TRTA 1ETWA 2PI0A 4HLYA 3PFIA 4LMYA 4RGXA 4I76A 2LR8A 3M8FA 2EV6A 2PMZN 3M8JA 2Q1ZB 4CICA 3JCUC 2XROA 2PJRA 5BOXA 4HF0A 5IOYA 1NH3A 5EZGA 2XIGA 1LDKB 3Q0WA 3QYFA 2X1DA 3GTKJ 4DIQA 2JTVA 3LNQA 3BZKA 1O57A 3AAFA 4MHGA 2I5UA 3DP7A 1IN7A 3RPQA 5EG0A 2JVHA 4P5OA 3L2CA 1SC7A 4LIVA 2L01A 1X1PA 1IUYA 2QF7A 3B6CA 1QPIA 3RYPA 1APLC 4IHTA 4HX7A 3JAMK 2FBIA 2CW0F 2PEXA 5CJ9A 1YFHA 2O8KA 5K7FA 1F5TA 1ZRFA 3HBLA 4U7DA 2A5YB 2XGCA 4G6QA 4ANJA 3M3YJ 4A3MJ 2X0LA 1U8RA 2Z2SB 1I27A 1ZH5A 2XPVA 1IAWA 1ZYRF 2QLZA 2VBYA 1GHCA 2RGVA 2L9RA 4HSTA 5FD5A 4BHCA 1REPC 1GDTA 4MFDA 2ZB9A 3FM5A 4GCVA 4A69C 1T38A 4JK1X 1LB2A 1RR7A 1HW1A 5J8FA 1EF4A 2RAEA 2HGCA 3M7GA 1LDJA 2HPIA 4HV5A 3RQ4A 3ZOBA 1T6SA 4M72A 3UNGC 1HLVA 3GX4X 2IA0A 3H36A 3QU6A 4U0VA 3F6OA 3ZMUA 1MJ9A 5EJCA 3ZP5A 5JFRA 5F0CA 2HEOA 3K4KA 3ZN0A 4XICA 4UUTA 2M8EA 4HOBA 1ZARA 2ZBKA 3I4MJ 4I01A 5K5OA 3BZ6A 5HDGA 1Y8QB 4OIQF 4DZJA 1H9TA 2H8RA 5IP9J 2LOOA 1FC3A 2NAZA 4O6JA 1O7FA 1T39A 1FMWA 4PGGA 1XDUA 1IN6A 1TNTA 3DTIA 3K1MA 2VJJA 2M87A 3HRSA 5K1YA 2X51A 2NVTJ 4U0YA 2WAFA 1TL8A 1B9MA 1TLHB 1FYMA 1JT6A 3DTKA 3TDUC 1KGSA 5DCMB 1PUEE 2Q2EB 3FXKA 4HQEA 3CCRI 4HW0A 1I5ZA 4LLNA 1P92A 1U6GA 3W6KB 1I3AA 2ZMEC 1Y56A 3RQIA 1IXSB 4HF2A 3F3XA 5FKMA 5LEJA 2V1XA 4XLAA 2GZWA 4HPQA 4FISA 4XLEA 3OYLA 3FK7A 3D5SC 4DOZA 4NQWB 4RLQA 3L2QA 2JA8J 1BR1A 3Q0UA 2BVLA 4PFOA 2JK3A 5D5VB 2CQXA 3BQYA 1ZQ3P 4BDZA 2OQGA 2DCEA 1IDYA 2Z3YA 2RN7A 1XC5A 3SXYA 3JRBA 4BEHB 3I55I 2ZSIB 1TP4A 4OINF 4GXOA 3C2BA 1ONVA 2M2EA 1BA5A 1XCBA 3KEQA 4ESFA 1OCPA 2VQCA 2MD0A 2BVMA 3OL4A 4XN0A 4A5MA 3CUOA 5D8KB 4IL6C 2HDCA 2AO9A 3PNTA 1V5FA 3WG7H 2WV1A 1K4SA 4RA2A 1LE8A 2YS9A 3K7AJ 3PJRA 4OMYA 2VUMJ 1VI0A 1V55H 3LAPA 1RPWA 4UY8I 5IT9Z 1QO0D 4G9YA 1IRZA 3KZYA 4MEYF 4XKBA 1X3UA 4A6DA 3VYRB 4HNVA 2QWWA 2KZVA 3CJTB 5L3BA 1XSVA 3N97A 1HSTA 3D1NI 2QUFA 3GFLA 4Y33A 5GADJ 4XQFA 4DBQA 2PBIA 1HSJA 2E5NA 4P9FA 1BIAA 4IZZA 3QRFF 5FKNA 4KIFA 2HPMA 4QLCU 3RPUD 2MSYA 3OYAA 3LAJA 2DA6A 4M71A 4IF4A 2R7SA 1Y1VJ 1B9NA 2F48A 3ZQQA 5K7HA 4MGRA 3HB9A 3LSPA 2ME0A 3FISA 2KFDA 3ULQB 2V9PA 4AVZA 3E0JB 2HFHA 1FPQA 2OQRA 5GP9A 4RS8A 1R7JA 4ZYHA 5D6EA 1HA8A 3S1RJ 2KZGA 4RM2A 3UKGA 4N4NB 3SDGA 1SMYF 1WQ2A 4PUSA 1G59A 2IGKA 4M74A 1SEUA 2XGXA 4EJVA 2YU9J 1IW7F 3GTOJ 3L7WA 3KIOA 2KKOA 1UB9A 1DDNA 1GVJA 1HDPA 4XRSG 2ZJQF 4JYKA 2OJED 1Z3XA 3S14J 2DO7A 4ZTJA 2E1CA 4YFKF 1TTYA 3CP2A 4D5CA 1JJ8C 2KIMA 4OMZA 2M7BA 2A05A 2OBPA 5CVRA 1Y0UA 2M9HA 1DGWY 3IAS2 4Z2YA 1U2WA 5JR3A 2ZJPF 2M30A 4YFNF 2MA3A 2ACJA 4EM2A 1R1VA 3ZQGA 4QPQA 4IHWA 3CC7I 4ZZLA 1IRXA 2H09A 1FX7A 3H5AA 3L2RA 1S5LC 1XMAA 5FJ8J 5EG0B 1T0FC 4ON0A 3ZQHA 2R7ZJ 2Y0SA 2OPTA 3DXJF 1UG2A 1WHUA 1QVUA 2XAQA 1FIPA 2L0KA 2RC4A 2DT7B 1X3WB 3K69A 4I7HA 1N78A 3T8RA 2OAZA 1IRFA 1MH3A 3NQOA 5FD6A 1UG0A 1SFUA 3FXRA 3F8BA 1XDSA 2R5ZB 3KYLA 1JKRC 3HSRA 5FLVA 2FSWA 2R7XA 4U88A 2L54A 4HLXA 2M3AA 3ABMH 1LPQA 3HOWJ 5K5RA 1ZG3A 2KRCA 2IW5A 3MN2A 4FHTA 5L3EA 2W57A 3BR3A 4LK0F 2MFZA 1N77A 3Q9VA 2YUSA 3JW4A 3GTGJ 1X1CA 4UVBA 3OIOA 3X2QH 4IEJA 1ZRCA 1ENHA 2LRDA 3LSRA 1LFBA 1OCZH 2CFOA 4P55A 1E0EA 3BR0A 2O0YA 4M3GA 1PUFB 3W6VA 5CQEA 2VOOA 3S1MJ 2F6CA 3CCMI 4A0XA 1TWCJ 2VJIA 3DCFA 4WXDA 1RNLA 2QZ8A 2AS5F 4EGZA 5F64A 3ZPLA 3AKZA 3ISPA 3CCQI 2V26A 4DJAA 2I10A 3MKLA 3OYCA 2R7RA 1MBHA 3GEZA 1BIBA 4M73A 2HNHA 1KQ9A 4L18B 1I50J 1RKTA 2CSOA 3ECOA 3GFIA 2A6TA 3ABKH 5TGTA 2V6EA 4XMYA 3K2AA 1ZN2A 1XTAA 1D3YA 2V1DA 4WK8F 4UXNA 1ZGJA 3VYUB 2R7WA 2EFWA 3VOEA 3QQAA 4NDLA 3JAMZ 1OPCA 3TBIA 5J4YA 4Y3OA 2IT0A 1PVEA 3G3ZA 2HDDA 1QGPA 2LNBA 2HQNA 2OF7A 4XNFA 3CJQB 3CTAA 1BW6A 4G7OF 3L09A 4RGUA 5J4VA 1ZRDA 5HLGA 2EV0A 3KZZA 4CCMA 2JA6J 3W2VA 4HAMA 2B0LA 2CUEA 4II2A 4PJLA 4BQNA 3MKWB 3EUAA 3FKIJ 3I59B 1VNDA 1TWGJ 1P4WA 2DW4A 1MBEA 2F5EA 3BROA 1VQPI 3G2BA 2LY9A 3GTPJ 4LOCA 3OYJA 3L00A 4BUPA 4Z6YA 3C3WA 4WX9A 2ZXWH 4IOCF 3S2HJ 2A6EF 4RAFA 2HYGD 4ENJA 2FUG2 3F8MA 2Y9YA 4L5IA 4B09A 4M6VA 3T0YA 4PJNA 3TO7A 3HOTA 4QIWN 1P7IA 2VKDA 2JT1A 3HPHA 1SVOA 1W5TA 4XRFA 3IH4A 4JX5A 1JTXA 3ZMDA 2G7HA 1L3LA 2E35A 2IJLA 3I4PA 3E5QA 2KDZA 1VF9A 2Y30A 2QKMB 5LLQA 1RUNA 4XKCA 4EQQA 1XB4A 1ETKA 1HCRA 2JA5J 1FLIA 1R4MB 2W00A 1SVMA 3QWLA 4PJMA 1DP7P 2BY0A 3L9FA 4I6ZA 5F0FA 2RNGA 2QENA 2CW7A 4NB5A 3IRRA 2ESHA 4AU7A 2VE9A 2ISYA 1A5JA 3VYTB 4IO9F 3ZMVA 4LLGF 3M1CA 4FCYA 3HJEA 1YRNA 2OZUA 4A3EJ 3GZ5A 5GAHJ 3H3ZA 1ZLKA 4M6XA 4XONA 2QBYB 2DODA 1NTCA 1V4RA 4RB0A 5FFXA 1I1SA 1S8NA 4E7IA 4DYRA 4KJZA 2PMHA 2P4WA 4M9ZA 5IT9K 1ACIA 3LSGA 4LIUA 4E70A 3K0LA 3KZIC 2ZXIA 2HI3A 2LSOA 4XOPA 1MNEA 2J5PA 4F92B 2OA4A 1O4XA 4LLLA 4D7NA 1VQ8I 4V19K 2P8TA 2VE8A 3GLLA 3GTLJ 5L3GA 3QP6A 5DCMA 1CQTA 2CUFA 2Q2EA 5FKKA 2Y2ZA 5TISC 2O6GE 3NRVA 1OFCX 3OSGA 2NRAC 1P9QC 5DTDA 4KMUX 1VZ0A 4B1RA 2PFBA 4K2EA 2Z5UA 1P2FA 4CH7A 1W7PB 2V1NA 2Z1DA 1B59A 5FROA 4CCLA 1AWCA 4FX4A 1RIOH 5DEQA 3JRCA 2QSFX 4XLHA 3EYYA 1RKWA 3CUQC 1SD6A 1X2MA 2WA0A 2L02A 2IBDA 3K4MA 4O5VA 4ZYEA 1FOWA 1FYLA 2I8DA 2Y9ZA 1SMTA 1WH7A 3OYNA 3JR9A 1SD4A 1D1AA 1XGSA 3KEOA 5DYMA 4BEHA 4E4HA 1HC8A 4W1UA 3EUKL 1EKEA 2XAGA 3VSLA 4BS9A 3CCSI 2L4AA 1OKRA 2CQQA 1JUMA 3S93A 4KNYA 1K61A 3DBRB 4ETSA 1G8XA 4L9TA 1QPMA 5LHGA 5DS9A 3JRIA 2EFPA 2NNNA 3R4KA 1WCMJ 2E2JJ 3FDYA 2GLOA 2HXIA 4CCNA 3HOZJ 4X6AJ 2XUBA 3DQVC 4N9HA 4XM3A 3ZQCA 3V7SA 5ILUA 3IC7A 3VFZA 3U21A 1O3SA 3GFMA 2H27A 1KYZA 5ICGA 2LFBA 2KDOA 2M8GX 2X6YA 1KQ0A 1XSXA 2DK8A 2IS6A 5ICEA 3FXMA 2COMA 1NK2P 4A5NA 1UAAA 1Z91A 4YFXF 4G7HF 3MQ0A 5M5YJ 1GXPA 2K4BA 1KYWA 2PN6A 3H3UA 2LKSA 4RAYA 3HM5A 4IQ4A 1O3TA 3CESA 1JJ6C 2WB1A 2FXAA 4EV0A 1YE9A 2V9VA 5J6XA 1MMGA 4BQAA 3I3LA 1AOYA 2NS7A 3V7RA 2L9SA 1FIAA 4QWQA 5EEHA 5B5EC 4NC6A 3BLYA 4FTHA 1IN8A 1BI3A 2DTRA 3BTLA 2XAHA 2Y69H 3VODA 1K83J 1JKPC 2DOFA 1FEXA 5LEKA 2W4SA 3F8CA 4LFUA 3RKWA 2WBMA 4XLPF 2XSDC 4AYBN 2IS2A 2GA1A 3FZVA 1HW2A 4CCJA 2DT5A 2EFOA 3OR1C 1N25A 2A61A 1Q1VA 3HTUA 3IV5A 2VPRA 2LMDA 3DPUA 3LSMA 4ENMA 3NEUA 2JSCA 3GW2A 4G12A 4A12A 3KYDB 2DYRH 3LSHA 3PM1A 3LL7A 4HF1A 1Z21A 1DUXC 4B43A 3CD6I 4A3DJ 2DA7A 2VASA 1KZHA 4A3CJ 4CCOA 1IRGA 1W0UA 3BTCA 1IF1A 4MNUA 4CXFA 3MKYB 1SD5A 2DQRA 2FJ1A 1ODDA 2LY2A 3CJRB 4UHTA 1BI1A 3B73A 2IA2A 4JP0A 5K7ZA 3LSJA 3O2PE 3J7AY 5FRNA 4YIFA 2F5CA 1P7JA 2CJJA 5C44J 3GTMJ 5CQGA 4J19A 1BR2A 3H92A 3I71A 2EZKA 3RKQA 3JRGA 2X6OA 3COAC 4AIDA 1DU6A 1ETOA 1SAUA 5HVQC 2PMZA 3V7CA 2DA3A 4BL0B 4A0YA 2VPLA 3WHBA 3OL3A 1FBUA 2R5ZA 3RZDJ 3K10A 1R58A 2AXTC 3H9JA 1U5TA 2QCOA 3WU1B 3WE2A 3M8EA 3S3MA 5CKTA 1P4AA 2M4KA 3LMMA 1ETVA 2CH0A 1HOMA 3I64A 4ZDPA 3RI4A 2DPUA 2DDAA 2BV6A 5ICFA 4A3KJ 2A69F 1ON2A 1PYVA 5J40A 5DM6F 2MC3A 5HDNA 2CQ7A 4CDGA 3HYIA 1MNMC 1MW7A 4MQVA 2E7XA 2ZFWA 3GVAA 4N9IA 3KE2A 3SDBA 3E5UA 4C2MJ 4DW6A 4EGYA 2DAOA 2EBIA 3CF2A 3GYHX 3CDIA 4A0ZA 2E1MB 3K2ZA 3T5XA 5LHIA 3K4NA 3M4OJ 2CUJA 2OU2A 3VPRA 1H8AC 3G1OA 2HDWA 1PUFA 4N0BA 3E5XA 3KLOA 1K78A 1AKHA 6PAXA 3RDIA 3H9GA 1YRNB 2BY3A 1VQMI 2ZO4A 1MMSA 3HSFA 1UHWA 4OAZA 1JUSA 2ICWG 2M7AA 5L3FA 3JREA 3ZGKA 2P5LC 2LF8A 4DYQA 2CGPA 2LBFA 4XLFA 1G6NA 2BHZA 3SQNA 2VI6A 5LRSA 1QBJA 2DOAA 3ASOH 1QRYA 2MC4A 2WC2A 2DFEA 4ZH4F 1LVKA 1MKMA 3HKZN 3SYTA 1FT9A 1KU3A 2HR3A 3T1BA 5J1RA 5A2QZ 1U0JA 1R23A 2XKOA 1YS7A 5M3MJ 3K70C 4BY1J 1PP7U 2DMTA 2K27A 3CDLA 5LRRA 2AQEA 1WWXA 5BMZA 1BC8C 2VT3A 3KP5A 2PMUA 3G71I 1X19A 3BCAA 5E3LA 3TMOA 2LLKA 2ZXHA 2O7OA 2AHQA 2FF4A 4CZZA 2K85A 3ML6A 2K3PA 3ZQ7A 2JVGA 3A1YA 1FMVA 2HQRA 1BBYA 1IDZA 3E3VA 3A02A 1WFXA 3WTWC 2F5VA 1B4AA 4HNUA 3A2KA 2ID6A 2DA1A 4FQGA 1X1BA 1YO5C 1ZK8A 2NVUB 1ZREA 1BJZA 1ZKGA 1QNTA 3BG6A 2FEZA 1R5HA 2KPMA 1ZGAA 3BDDA 3GTJJ 2P5VA 2EZIA 2HOAA 4NC7A 3I59A 4E7HA 3Q5FA 2QQ8A 3QYBA 4J01A 2CRGA 5H6RA 2DJIA 2HZTA 3TO6A 3ZQLA 3I9V2 2LF7A 3GF2A 1QZZA 3DLAA 5H20A 1EH6A 2EJRA 3OIQA 2WAEA 2R5YB 5M5WJ 1UZCA 2LC2A 5AIPA 1VQ5I 3TDZC 2WTEA 3DKYA 4XIDA 3A03A 1E3PA 3ONQA 4GRIA 1XN7A 1Z3YA 3ESWB 4RGSA 3M07A 4EMSA 2HWVA 2KP6A 3MCZA 3QOPA 5IP7J 3HHHA 2JRTA 3HRTA 3V8LA 1LEBA 3QPSA 3WTXC 3JSOA 4IOAF 4E7KA 5KK1A 5HLTA 3PIOF 2HOTA 3DWLE 3HDDA 4M9XA 3PUFA 1E2XA 5KCMA 2ZKZA 1YTYA 1SFEA 3P5JA 4RB1A 5JVGF 1IXRC 5AONA 2STWA 1MMAA 1B72A 2EA2A 1YX5A 1XGNA 4CHUA 1JT0A 4IXAA 3BPVA 3OR2C 1J7KA 3C1DA 2UZKA 1MBGA 3JTGA 2NOJB 2GAUA 5DDGA 3S17J 1S7AA 4OIOF 1XMXA 1W0TA 1TBXA 3LSIA 1JE8A 1W36D 3M1EA 1BJAA 3IAM2 2F2EA 1WH5A 2QBYA 1F36A 1HKSA 1OYWA 3LA2A 1IN4A 2VQGA 4LG3A 1XS9A 1QA6A 1Z7UA 4HX4A 5LGUA 5E17F 2VIXA 1WJAA 5JHFA 1J5YA 1FOKA 1F43A 3T8TA 2FRHA 2VBWA 1T8IA 2W84A 2O03A 4AC0A 3IRQA 2VKVA 1GVDA 4GYIA 2MG4A 4KISA 4I02A 2E1OA 1UELB 3KETA 3GLXA 3P9CA 3TQNA 4LGWA 2DMQA 1TNSA 3CCEI 3Q3SA 4G94A 2V79A 2DFIA 2UUZA 4EEFG 2ELJA 3H5RA 1S7EA 4YEJA 4MTEA 2AXLA 4UVCA 2VL8A 4XLNF 3LSKA 5H6QA 1XGOA 4WWCA 2E5ZA 5M5XJ 1PDNC 4L0ZB 1W7PA 2QQAA 4E7ZA 1ZAOA 3DKWA 1ULYA 3D0SA 3FMQA 1USSA 3BWGA 2ZXJA 3R6SA 4E6KG 5F1RA 5EEAA 4R8HA 5CYVA 1B6AA 2CV0A 2VODA 2EIKH 1R5ID 4HZFA 4C3IJ 2IS4A 5LD2C 2X4HA 1ETQA 1FNNA 2ELKA 4PFPA 3BG5A 3DBHB 1ZELA 1I1GA 2Z16A 1E3HA 4WF2A 4BH9A 5C4XJ 3ZQIA 1R1UA 2BZTA 3A4CA 3F8FA 3GCMA 2M5WA 1HBXG 3LA3A 3OYEA 4XK4A 2H94A 2E60A 2KL4A 1GLNA 3E6CC 2JA7J 3KP2A 1R36A 1QQIA 2QQBA 1HW5A 3AG2H 2H6CA 3WTYC 2EINH 2CQNA 3SFIA 2K9NA 3WTZA 1JKOC 4KA4A 4OIRF 1U5TB 2ZC2A 5LHHA 2LKPA 4Y17A 1J75A 4KT5C 4BYYA 1R6RA 1UHMA 1FJLA 2EK5A 3SFZA 4LJZF 4EVIA 3OYMA 1P4XA 4C2TA 3NWSA 3RKYA 2OD5A 4C3JJ 2JWTA 3H0DA 3FXLA 1ZG1A 2E2IJ 2QSGX 2K40A 3KP3A 1XMKA 1WVRA 3ROUA 5HS7A 2HVSA 4Q5SF 3F6VA 3OS0A 5HDKA 2MLKA 2PX9A 1DU0A 2EH3A 2Y0MA 1K78B 1AKHB 1OCCH 2L4MA 2FX0A 3OYGA 2DA4A 4ZYGA 4ZC3A 4BE1A 5FGMA 4BQQA 3QYEA 1ON1A 2LBFB 1S7OA 2D45A 3I54A 1FY7A 4M9SA 2F5DA 4LITA 1YHQI 1HXDA 3EUHA 5J8CA 2MGQA 4GYGA 4A93J 5EDNA 2Q0OA 2JUGA 3LOCA 1YJWI 1IN5A 1V3FA 1S29A 1Y1WJ 2KLOA 3MEXA 4AUXA 3I56I 4Q48A 3RSNA 1C0WA 2P81A 4GO1A 4DQ2A 4HDVA 1R5GA 2R7UA 3MWMA 2OV7A 3OV8A 3BJ6A 3G4SI 1YJ9I 5B1AH 1TWHJ 5ICCA 5BPDA 3OS2A 2NOGA 1Z6RA 4JQFA 5FLXK 5KAIC 1LQ1A 1Y0NA 2HVRA 1A6IA 1AA7A 4ENKA 4EJWA 1VQKI 3UR3C 4U7BA 2XRNA 1VFCA 1IG7A 1MSFC 3BP8A 2K5CA 1ORKA 2H1LA 3FHNA 4BXFA 4BE2A 4I2OA 2JRMA 2XVCA 4NBQA 3IH3A 3IWFA 3S32A 3BG7A 1T0FA 4KDPA 1YOVB 5HLIA 4C3HJ 2TCTA 5A2QK 3JSPA 1VQOI 1P6RA 1IJWC 3CCLI 1H9GA 4E7LA 3IKVA 3WHCA 2OTJI 4CYDA 1DP3A 1PJRA 2TDXA 5DCFA 3EYIA 5DM7F 4X1EA 3H5NA 2Z33A 1B1BA 1ETXA 1D5YA 2RQQA 4KMFA 2KRFA 2EB7A 1T33A 4HG2A 2DN0A 2GXBA 1V5GA 3D5LA 1KU2A 2L7MP 3CMEI 1EH8A 1FYKA 4EATA 2C6YA 3F0CA 4I0BA 1JGGA 2FBHA 4I98B 3ZMSA 4PDKA 2KJBA 2FMYA 3J81K 1Z0XA 3HL2A 1EA3A 1FTZA 2XAFA 3EQLF 2E1NA 2WAQN 3ABLH 5HS9A 2OUMA 2E2HJ 5M3FJ 1LDDA 2IP2A 4CUGA 3CMAI 3BZCA 2ZCWA 1SANA 3MZYA 1K7AA 2E7WA 3CCJI 2XGEA 5FLMJ 4L5JA 2UV1A 4B3XA 3K1PA 4BXUA 2RKHA 4LB6B 2NS0A 3F8NA 2GBYA 3J7ZI 4FE4A 1X3ZB 1B72B 3DF8A 4XOTA 2DYSH 3E97A 4XKWA 1DQUA 5J1YA 4BBSJ 3DLLF 4MEXF 2V7FA 3TW7A 4AM3A 4C9YA 5D5XB 4CYCA 1USTA 1Y39A 3CO7C 5IT3A 4IQJA 4XL9A 2R92J 3CP8A 1CF7A 1TQPA 2W1OA 1FBSA 5LFAA 4KUMA 4ZDOA 1WJ5A 1W36C 1U78A 3BR6A 3QU3A 2X48A 5C4JJ 2Q8KA 3F21A 2VT2A 2RNJA 2VC0A 1R1TA 4MIMA 4HV6A 4JBAA 5E20A 4IVNA 2JZYA 2O5RA 3QPTA 4ASNA 1HKQA 3P7NA 4ZYAA 4I0AA 2RV8A 2DMUA 5F04A 1EH7A 2M45A 3OYFA 2ZMEB 3F23A 2YSRA 1U9NA 3FMRA 3GUDA 3CC2I 2MLGA 2XC7A 2BXYA 4H0EA 1MMNA 3HSEA 1SFXA 1ETYA 1KU9A 3DU6A 2NXNB 2L9VA 1TWAJ 3B6AA 3D5RC 3HUGB 2VJ4A 3VEPA 1IV8A 1HF0A 2XSJC 3IP4B 2JQ7A 3FXQA 1TQMA 1ZTRA 2M34A 3HZJA 4PCQA 4LG0A 2UXNA 2DU9A 5BS6A 3HG9A 4OOIA 5DUKA 2E34A 5B3SH 4G8XA 1VQLI 5K5QA 5JVTA 3DEEA 4OWRB 5F0HA 5IYCJ 2W24A 3TL4X 3O8GA 4IX7A 3QPHA 1MSEC 2EFNA 4HEA2 2H1KA 3QPLA 3BQZA 2ETHA 1D0YA 2EFQA 2JJ7A 4CA0A 2R5YA 2YU3A 3RIRA 2YPRA 1V5EA 2BOLA 1BI2A 4CSWA 2QGUA 3AG3H 1W7PD 3PQJA 4E7JA 1YIOA 1DPRA 3N4MA 2K9MA 2IGMA 2LY1A 1JXSA 2DFFA 4LK1F 4UUSA 3VWBA 2W85A 3E6BA 5DUIA 3A01B 4KT6A 2EZHA 5FRMA 1VQ7I 1B8IB 4DZPA 4S04A 1FOXA 4D7MA 3K4JA 2BYVE 3TGNA 2YX4A 4B48A 1MDMA 3RJPA 1I3QJ 2IRFG 3HHGA 1LJ9A 2NVXJ 2QYOA 1G2HA 3MFKA 3HOUJ 4M3EA 5AIQA 2JSPA 5HNHA 1OR7A 3L2VA 5HOOA 2FE3A 2M1BA 2IGNA 4LD5A 3U1KA 2R7QA 2A07F 1T98A 2L2OA 4QSHA 3HOVJ 4B44A 5ILSA 1MZBA 1JI8A 4P1WA 2ELHA 3PO2J 1G4DA 1FP1D 4EJUA 4IRGA 1IC8A 3E7LA 2EPFA 1D0ZA 3TOBA 2IEKA 1TW2A 2P7VB 3GZNB 4A2UA 2EA4A 4Q4ZF 2JA2A 1OCRH 3IL2A 2B7EA 5FB2A 2NNYA 3MZ8A 3WODF 2K9QA 2HOEA 2XF7A 1FTTA 4D1QA 4HBLA 3I5UA 5TRDA 2JMWA 4W97A 5ILVA 3PL8A 4L9NA 1NK3P 5E3OA 2RVCA 2K02A 1TWFJ 2DMPA 2HQ5A 2NVQJ 1S6LA 1DGRM 2GQQA 4M3BA 1Z7LA 3CLOA 4F3QA 2LH9A 3SZGA 1O3QA 1ZLJA 1QHHD 4GGGA 5ERIA 4L9VA 3AG4H 2EQRA 4ITVA 3WTVC 2VQLA 2BY2A 3TKYA 3CF5F 1U3EM 4A3BJ 1XPXA 3MKZA 3BPXA 3E6DA 3OY9A 2WWYA 3HOXJ 5J1UA 2EWNA 3CUQA 2VKEA 5LGNA 4D5FA 4EJTA 2GM4A 3TOAA 3MZHA 4IPAA 2EIJH 2QEXI 4AYBA 2EIMH
chains in the Genus database with same CATH topology
3R61A 5CLSA 4KIGA 3GWZA 4KN7X 4XSZF 4IRIA 4L0YB 5FO5A 3IHUA 2PQ8A 3LQRA 4P96A 3DV8A 3GZ6A 1IXCA 3HOSA 1UCRA 5JHUA 3PQKA 3C18A 5CVVA 5DV5A 2G7UA 4IRHA 1JHFA 3TO9A 3DPTA 1NHAA 2GXGA 2O61A 2K4JA 3DPLC 2XKPA 1HKTA 2JPCA 1BN5A 3J80K 2V1UA 1G3WA 1YYVA 2Z99A 4IHSA 3ERED 3M9AA 1E17A 2BBYA 4DNCA 3KCCA 4M6YA 5HS8A 2FMLA 3IKTA 5FLXZ 1CF7B 3WTTC 5E8GA 3F22A 1BM9A 5E18F 1ZHFA 4G6DA 3ZMZA 1XGMA 3SZTA 2HS5A 1A04A 1FWZA 3WG9A 3BJOA 3R0AA 3WGGA 3FWEA 3FXUA 2CWEA 4Q47A 1LNWA 2H6BA 3FF5A 2KJCA 1FSHA 1K79A 5TJJA 3BY6A 3I58A 1YQAA 4PGHA 1J59A 1JGSA 2XV4S 1O3RA 3J81Z 1TQIA 4LG0B 3KP7A 2XAJA 4B8XA 4WCGA 1VTNC 2F5FA 5CVIA 1W4MA 2LDUA 2MD5A 2RDPA 4HDUA 3F72A 1OYIA 3FMSA 4ESJA 2DBBA 1I6XA 1H0MA 3O3KA 4I09A 4UNOA 2QVOA 2O3FA 1OMIA 2Y48A 3CJNA 1WI9A 1MDMB 3U2RA 2P6TA 5L3CA 2CO5A 1QZYA 4YG2F 3ECHA 5LGTA 4ZZDA 2J5OA 3W6JB 4BHPA 3FX3A 3C7JA 2KIUA 3RKXA 1RZ4A 3R60A 2D1HA 3LWFA 4Y13A 2L3DA 5ED4A 3SHFA 3REOA 3P9IA 3JTHA 4PZJA 1DPUA 3WTUC 4BNCA 2RQPA 4R79A 3ELKA 4AVPA 5BQTA 2MH2A 2JPBA 2ZMEA 1RI7A 5D6FA 3R0JA 1FBQA 4EM0B 3LSTA 2FU4A 1F9NA 2FOKA 3HUGA 5BPIA 3FM3A 4ESBA 4P9UA 3E6MA 2MH9A 3CUQB 4O3MA 2KIFA 2QM3A 3GO5A 2ZJ2A 1F4KA 2FNAA 2P6SA 4UUVA 1D8KA 2K7LA 3O6BB 3VB2A 1G3TA 2K86A 5E1WA 4F7ZA 1YS6A 4HA8A 2EV5A 4RAZA 3ZN1A 4S05A 2D2WA 5HLHA 2P5KA 2VBZA 3B02A 5D5UB 2P7CB 2HTJA 4CGZA 3I0TA 2D1VA 2BEOA 3EDPA 4OU0A 2WV0A 3U9GA 1ZG5A 3FHZA 2G9WA 5KVRA 1YG2A 1Z9CA 1BOAA 2CFXA 4OIPF 4YIIA 2ISZA 1YLFA 4AD9A 3QAHA 2ZNYA 5F6FA 1S3JA 2CYYA 2HTSA 2HKOA 1WKMA 4FT8A 2MBFA 2GIVA 5FFZA 5CVJA 4AIJA 3ZMTA 3KFWX 5D4SA 3ABUA 3ABTA 1MJBA 3KP6A 4RB3C 2XHKA 3WU0A 1BI0A 4WXCA 5D8LB 2UXXA 1JHHA 2IPQX 4D0PA 5JI6A 4CO8A 2GA2A 1Q1HA 3U1DA 1G3YA 4RGRA 4UV9A 1R00A 4A6EA 4UVAA 3P9KA 4EJOA 1RUOA 2CG4A 5CVUA 3WE3A 5E8IA 1IZ1A 1KU7A 3K9TA 2R7FA 3KLNA 1WSUA 1HQCA 2CQKA 2YR2A 3J80Z 2STTA 2DPDA 2DK5A 4BHBA 2A68F 4G7ZF 2BGCA 1CGPA 2VC1A 2FA5A 4KFCA 4MTDA 3GXOA 1O7LA 3V8KA 1W5SA 2VXZA 4FX0A 2VONA 4XBFA 1J2XA 2PJPA 3IWZA 3KP4A 1YW7A 3CO6C 1TW3A 2FQ3A 2GWRA 2R3SA 2PLYA 3G73A 1K6OA 3K1NA 5D4RA 2FNPA 1PP8F 4IJAA 1XD7A 1KA8A 4L9JA 3RTRA 4HQMA 2DLLA 1STZA 3GFJA 4KYWA 1SAXA 1YW9A 3WGIA 4NHJA 5E1ZB 2V6CA 1LVAA 2ZNZA 1KQ8A 3WGHA 5D5WB 1Z6TA 4EM1A 2QQ9A 3MAJA 3DEUA 4R1HA 2ADUA 4Y15A 1F1ZA 3LFKA 2R7DA 2O8XA 1Z1DA 3CDHA 4WXHA 3SZPA 2XASA 3V4GA 1OYYA 3S2WA 1J9IA 3HIFA 4UV8A 1Z05A 1SD7A 3Q9SA 3HRMA 2VOPA 1R22A 2IVMA 3OOPA 2DI3A 3J7AO 4AIHA 4NQWA 1YW8A 2A6HF 2DQLA 2Z9OA 4TV7A 2FBKA 3EETA 1MJAA 3BOQA 5EEGA 1D5VA 3DFGA 1WRJA 4KICA 1UFMA 3LQQA 2W25A 1FP2A 1XCVA 4HYEA 1MGTA 2Y75A 2BE5F 3WTSC 3RPUA 4U0WA 2VN2A 5DD8A 4LB5A 2OZ6A 3V8JA 1MD0A 4AIKA 1G3SA 1U5TC 2HYFA 1GXQA 3HTSB 1FSEA 2IA1A 3RYRA 3HRUA 5DD4A 4RB2C 2ESNA 4KN4X 4XSXF 1XSDA 1LEAA 1J0RA 2A3SA 5LBQA 5L3DA 2NYXA 1L0OC 2VBXA 4KIBA 2PG4A 3BJAA 4HX8A 4AWXB 1D8JA 1EV7A 3LA7A 1FZPB 4ENNA 4MQ9F 2HKXA 2YX7A 4BAYA 3I53A 4ZYDA 2UWMA 5E1XA 3QP5A 1BC7C 1T2KA 2PI0A 4HLYA 3PFIA 4LMYA 4RGXA 3M8FA 2EV6A 4CICA 2XROA 5BOXA 4HF0A 2XIGA 1LDKB 2JTVA 1O57A 3AAFA 4MHGA 3DP7A 3RPQA 1IN7A 4P5OA 3L2CA 2L01A 1IUYA 3RYPA 4IHTA 4HX7A 3JAMK 2FBIA 2CW0F 2PEXA 5CJ9A 1YFHA 1F5TA 1ZRFA 4U7DA 2A5YB 4G6QA 2X0LA 1U8RA 1I27A 1ZH5A 1IAWA 1ZYRF 2QLZA 2VBYA 1GHCA 2RGVA 5FD5A 4BHCA 1REPC 3FM5A 4GCVA 1T38A 1LB2A 4JK1X 1HW1A 5J8FA 2HGCA 3M7GA 1LDJA 4HV5A 1T6SA 4M72A 3GX4X 2IA0A 3QU6A 4U0VA 3ZMUA 3F6OA 1MJ9A 3ZP5A 5JFRA 2HEOA 3ZN0A 2M8EA 4HOBA 1ZARA 2ZBKA 4I01A 5K5OA 3BZ6A 5HDGA 4OIQF 1H9TA 1FC3A 2NAZA 4O6JA 1O7FA 1T39A 4PGGA 1XDUA 1IN6A 1TNTA 3K1MA 2M87A 3HRSA 5K1YA 4U0YA 1B9MA 1TLHB 1FYMA 3TDUC 1KGSA 5DCMB 1PUEE 4HQEA 4HW0A 1I5ZA 4LLNA 1P92A 1U6GA 3W6KB 1IXSB 4HF2A 3F3XA 5LEJA 2V1XA 2GZWA 5D5VB 2OQGA 2Z3YA 2RN7A 3SXYA 4OINF 4GXOA 1ONVA 4ESFA 1XCBA 3KEQA 4A5MA 3CUOA 5D8KB 2HDCA 4OMYA 3LAPA 5IT9Z 1QO0D 4G9YA 3KZYA 4MEYF 1X3UA 4A6DA 2QWWA 5L3BA 1XSVA 3N97A 1HSTA 2QUFA 3GFLA 2PBIA 1HSJA 4P9FA 1BIAA 3QRFF 4KIFA 4QLCU 3LAJA 4M71A 4IF4A 1B9NA 4MGRA 3ULQB 2HFHA 1FPQA 2OQRA 4RS8A 1R7JA 4ZYHA 5D6EA 1SMYF 1WQ2A 4M74A 2XGXA 4EJVA 1IW7F 3L7WA 2KKOA 1UB9A 1DDNA 1GVJA 2DO7A 2E1CA 4YFKF 1TTYA 2KIMA 4OMZA 2OBPA 5CVRA 1Y0UA 4Z2YA 1U2WA 5JR3A 2M30A 4YFNF 2MA3A 2ACJA 4EM2A 1R1VA 4ZZLA 2H09A 1FX7A 1XMAA 4ON0A 3DXJF 2XAQA 2RC4A 3K69A 4I7HA 3T8RA 2OAZA 1IRFA 3NQOA 5FD6A 1SFUA 3FXRA 3F8BA 1XDSA 3HSRA 2FSWA 4U88A 2L54A 4HLXA 5K5RA 1ZG3A 2IW5A 4FHTA 5L3EA 2W57A 4LK0F 3Q9VA 3JW4A 4UVBA 1ZRCA 4P55A 2O0YA 2VOOA 4A0XA 4WXDA 1RNLA 2QZ8A 2AS5F 4EGZA 5F64A 3ZPLA 3ISPA 3GEZA 1BIBA 4M73A 1KQ9A 4L18B 2CSOA 3ECOA 3GFIA 1ZN2A 1D3YA 2V1DA 4WK8F 4UXNA 1ZGJA 2EFWA 3VOEA 3JAMZ 1OPCA 2IT0A 3G3ZA 1QGPA 2LNBA 2HQNA 3CTAA 4G7OF 3L09A 4RGUA 1ZRDA 5HLGA 2EV0A 3KZZA 4HAMA 2B0LA 3I59B 2DW4A 1P4WA 3BROA 2F5EA 3L00A 4WX9A 3C3WA 2A6EF 2HYGD 4ENJA 3F8MA 4L5IA 4B09A 3T0YA 3TO7A 3HOTA 2JT1A 1W5TA 4XRFA 3ZMDA 2G7HA 1L3LA 2IJLA 3I4PA 3E5QA 1RUNA 5LLQA 1FLIA 4EQQA 1XB4A 1DP7P 3L9FA 2QENA 4NB5A 3IRRA 2ESHA 2VE9A 2ISYA 3ZMVA 4LLGF 2OZUA 3GZ5A 3H3ZA 1ZLKA 4M6XA 2QBYB 1V4RA 4RB0A 5FFXA 1I1SA 1S8NA 2PMHA 2P4WA 4M9ZA 5IT9K 4E70A 3K0LA 2LSOA 2J5PA 2OA4A 4LLLA 2P8TA 2VE8A 5L3GA 3QP6A 5DCMA 2Q2EA 2O6GE 3NRVA 2NRAC 4KMUX 2PFBA 4K2EA 2Z5UA 1P2FA 1W7PB 1B59A 1AWCA 4FX4A 1RIOH 5DEQA 3EYYA 3CUQC 1SD6A 2L02A 4O5VA 4ZYEA 1FYLA 1SMTA 1SD4A 1XGSA 3KEOA 5DYMA 2XAGA 2L4AA 1OKRA 4KNYA 4ETSA 4L9TA 1QPMA 5LHGA 2EFPA 2NNNA 3R4KA 2XUBA 3DQVC 4N9HA 3V7SA 5ILUA 3IC7A 3VFZA 1O3SA 2H27A 3GFMA 1KYZA 5ICGA 1KQ0A 1XSXA 2DK8A 5ICEA 2COMA 4A5NA 1Z91A 4YFXF 4G7HF 3MQ0A 1GXPA 2K4BA 1KYWA 2PN6A 3H3UA 4RAYA 1O3TA 2FXAA 4EV0A 2V9VA 5J6XA 4BQAA 1AOYA 3V7RA 4QWQA 5EEHA 1IN8A 1BI3A 2DTRA 2XAHA 3VODA 5LEKA 3F8CA 4LFUA 3RKWA 4XLPF 2GA1A 3FZVA 1HW2A 2DT5A 2EFOA 2A61A 3HTUA 4ENMA 3NEUA 2JSCA 3GW2A 4A12A 4HF1A 1DUXC 1IRGA 1IF1A 4MNUA 4CXFA 1SD5A 2DQRA 1ODDA 4UHTA 1BI1A 3B73A 2IA2A 3O2PE 4YIFA 2F5CA 3H92A 3I71A 3COAC 5HVQC 3V7CA 4A0YA 1FBUA 1R58A 1U5TA 3WU1B 3WE2A 3M8EA 1P4AA 3I64A 3RI4A 2DPUA 2BV6A 5ICFA 2A69F 1ON2A 2MC3A 5HDNA 4CDGA 3HYIA 4MQVA 2E7XA 2ZFWA 3GVAA 4N9IA 3KE2A 4EGYA 3E5UA 2DAOA 3GYHX 4A0ZA 3K2ZA 3T5XA 5LHIA 2OU2A 4N0BA 3E5XA 3KLOA 1K78A 6PAXA 3RDIA 2ZO4A 3HSFA 1UHWA 5L3FA 2P5LC 2LF8A 2CGPA 1G6NA 3SQNA 5LRSA 1QBJA 2WC2A 4ZH4F 1MKMA 1FT9A 1KU3A 2HR3A 3T1BA 5A2QZ 1R23A 2XKOA 1YS7A 1PP7U 2K27A 5LRRA 1WWXA 5BMZA 1BC8C 2VT3A 3KP5A 2PMUA 2FF4A 4CZZA 3ML6A 3ZQ7A 2HQRA 1BBYA 3E3VA 3WTWC 1B4AA 1YO5C 1ZREA 1QNTA 2FEZA 1R5HA 3BDDA 1ZGAA 2P5VA 3I59A 3Q5FA 5H6RA 2HZTA 3TO6A 2LF7A 3GF2A 1QZZA 5H20A 1EH6A 2EJRA 5AIPA 3TDZC 2WTEA 1XN7A 4RGSA 4EMSA 2HWVA 3MCZA 3QOPA 3HHHA 2JRTA 3HRTA 3V8LA 1LEBA 3WTXC 3JSOA 5KK1A 4M9XA 1E2XA 2ZKZA 1YTYA 1SFEA 4RB1A 1IXRC 5AONA 2STWA 2EA2A 1XGNA 4CHUA 4IXAA 3BPVA 1J7KA 3C1DA 2UZKA 3JTGA 2GAUA 5DDGA 1S7AA 4OIOF 1TBXA 1JE8A 3M1EA 1BJAA 2F2EA 2QBYA 1HKSA 1OYWA 3LA2A 1IN4A 1Z7UA 4HX4A 5LGUA 5E17F 1FOKA 1J5YA 3T8TA 2FRHA 2VBWA 2W84A 2O03A 3IRQA 4GYIA 4I02A 3KETA 3GLXA 3P9CA 3TQNA 4LGWA 1TNSA 4G94A 2V79A 2DFIA 4MTEA 2AXLA 4UVCA 4XLNF 5H6QA 1XGOA 4WWCA 1PDNC 4L0ZB 1W7PA 2QQAA 1ZAOA 3DKWA 1ULYA 3D0SA 3FMQA 1USSA 3BWGA 2ZXJA 3R6SA 5F1RA 4R8HA 5CYVA 1B6AA 2VODA 4HZFA 2X4HA 1FNNA 1I1GA 4WF2A 4BH9A 1R1UA 3F8FA 2M5WA 1HBXG 3LA3A 2H94A 3E6CC 3KP2A 1R36A 1QQIA 2QQBA 1HW5A 2H6CA 3WTYC 3WTZA 4KA4A 4OIRF 1U5TB 5LHHA 2LKPA 4Y17A 1J75A 4KT5C 4BYYA 1UHMA 2EK5A 3SFZA 4LJZF 4EVIA 1P4XA 3RKYA 2OD5A 1ZG1A 3KP3A 1XMKA 3ROUA 5HS7A 4Q5SF 3F6VA 5HDKA 2MLKA 1K78B 2Y0MA 2L4MA 4ZYGA 5FGMA 1ON1A 1S7OA 2D45A 3I54A 1FY7A 4M9SA 2F5DA 1HXDA 3EUHA 5J8CA 4GYGA 2Q0OA 1IN5A 1V3FA 1S29A 3MEXA 4Q48A 1C0WA 4GO1A 4DQ2A 4HDVA 1R5GA 3MWMA 3OV8A 3BJ6A 5BPDA 5ICCA 1Z6RA 4JQFA 5FLXK 1LQ1A 4ENKA 4EJWA 4U7BA 2XRNA 3BP8A 4I2OA 2XVCA 3IWFA 1T0FA 4KDPA 5HLIA 3JSPA 5A2QK 1P6RA 1H9GA 3IKVA 4CYDA 2TDXA 5DCFA 3EYIA 2Z33A 1B1BA 4KMFA 2KRFA 2EB7A 2GXBA 3D5LA 1KU2A 1FYKA 1EH8A 2C6YA 4I0BA 2FBHA 4I98B 3ZMSA 4PDKA 2KJBA 2FMYA 3J81K 2XAFA 3EQLF 2E1NA 5HS9A 1LDDA 2IP2A 2ZCWA 3MZYA 1K7AA 2E7WA 4L5JA 3K1PA 4BXUA 2RKHA 4LB6B 2NS0A 3F8NA 3DF8A 3E97A 4MEXF 5D5XB 1USTA 3CO7C 5IT3A 1CF7A 1TQPA 1FBSA 4KUMA 1U78A 3QU3A 2Q8KA 3F21A 2VT2A 2RNJA 2VC0A 1R1TA 4HV6A 4JBAA 5E20A 4IVNA 2JZYA 3QPTA 4ASNA 1HKQA 3P7NA 4I0AA 2RV8A 1EH7A 2M45A 2ZMEB 3F23A 2YSRA 3FMRA 3GUDA 2MLGA 4H0EA 3HSEA 1SFXA 1KU9A 3VEPA 3FXQA 1TQMA 4PCQA 4LG0A 2UXNA 2DU9A 5BS6A 4OOIA 5DUKA 4G8XA 5K5QA 5JVTA 2W24A 3QPHA 2EFNA 2ETHA 2EFQA 2YU3A 3RIRA 2YPRA 1BI2A 1W7PD 3PQJA 1YIOA 1DPRA 3N4MA 1JXSA 4LK1F 2W85A 3E6BA 5DUIA 4S04A 2BYVE 3TGNA 2YX4A 1MDMA 3RJPA 2IRFG 3HHGA 1LJ9A 2QYOA 3MFKA 5AIQA 1OR7A 5HOOA 2FE3A 2M1BA 4LD5A 2A07F 1T98A 5ILSA 1MZBA 2ELHA 1G4DA 1FP1D 4EJUA 4IRGA 3TOBA 1TW2A 2P7VB 4A2UA 2EA4A 4Q4ZF 3IL2A 2NNYA 5FB2A 3WODF 2HOEA 4HBLA 3I5UA 5TRDA 5ILVA 4L9NA 2RVCA 2K02A 1S6LA 2GQQA 3CLOA 1O3QA 1ZLJA 5ERIA 4GGGA 4L9VA 3WTVC 1U3EM 3TKYA 3BPXA 3E6DA 2WWYA 2EWNA 3CUQA 5LGNA 4EJTA 3TOAA 3MZHA 4IPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R61 A;  5CLS A;  4KIG A;  3GWZ A;  4KN7 X;  4XSZ F;  4IRI A;  4L0Y B;  5FO5 A;  3IHU A;  2PQ8 A;  3LQR A;  4P96 A;  3DV8 A;  3GZ6 A;  1IXC A;  3HOS A;  1UCR A;  5JHU A;  3PQK A;  3C18 A;  5CVV A;  5DV5 A;  2G7U A;  4IRH A;  1JHF A;  3TO9 A;  3DPT A;  1NHA A;  2GXG A;  2O61 A;  2K4J A;  3DPL C;  2XKP A;  1HKT A;  2JPC A;  1BN5 A;  3J80 K;  2V1U A;  1G3W A;  1YYV A;  2Z99 A;  4IHS A;  3ERE D;  3M9A A;  1E17 A;  2BBY A;  4DNC A;  3KCC A;  4M6Y A;  5HS8 A;  2FML A;  3IKT A;  5FLX Z;  1CF7 B;  3WTT C;  5E8G A;  3F22 A;  1BM9 A;  5E18 F;  1ZHF A;  4G6D A;  3ZMZ A;  1XGM A;  3SZT A;  2HS5 A;  1A04 A;  1FWZ A;  3WG9 A;  3BJO A;  3R0A A;  3WGG A;  3FWE A;  3FXU A;  2CWE A;  4Q47 A;  1LNW A;  2H6B A;  3FF5 A;  2KJC A;  1FSH A;  1K79 A;  5TJJ A;  3BY6 A;  3I58 A;  1YQA A;  4PGH A;  1J59 A;  1JGS A;  2XV4 S;  1O3R A;  3J81 Z;  1TQI A;  4LG0 B;  3KP7 A;  2XAJ A;  4B8X A;  4WCG A;  1VTN C;  2F5F A;  5CVI A;  1W4M A;  2LDU A;  2MD5 A;  2RDP A;  4HDU A;  3F72 A;  1OYI A;  3FMS A;  4ESJ A;  2DBB A;  1I6X A;  1H0M A;  3O3K A;  4I09 A;  4UNO A;  2QVO A;  2O3F A;  1OMI A;  2Y48 A;  3CJN A;  1WI9 A;  1MDM B;  3U2R A;  2P6T A;  5L3C A;  2CO5 A;  1QZY A;  4YG2 F;  3ECH A;  5LGT A;  4ZZD A;  2J5O A;  3W6J B;  4BHP A;  3FX3 A;  3C7J A;  2KIU A;  3RKX A;  1RZ4 A;  3R60 A;  2D1H A;  3LWF A;  4Y13 A;  2L3D A;  5ED4 A;  3SHF A;  3REO A;  3P9I A;  3JTH A;  4PZJ A;  1DPU A;  3WTU C;  4BNC A;  2RQP A;  4R79 A;  3ELK A;  4AVP A;  5BQT A;  2MH2 A;  2JPB A;  2ZME A;  1RI7 A;  5D6F A;  3R0J A;  1FBQ A;  4EM0 B;  3LST A;  2FU4 A;  1F9N A;  2FOK A;  3HUG A;  5BPI A;  3FM3 A;  4ESB A;  4P9U A;  3E6M A;  2MH9 A;  3CUQ B;  4O3M A;  2KIF A;  2QM3 A;  3GO5 A;  2ZJ2 A;  1F4K A;  2FNA A;  2P6S A;  4UUV A;  1D8K A;  2K7L A;  3O6B B;  3VB2 A;  1G3T A;  2K86 A;  5E1W A;  4F7Z A;  1YS6 A;  4HA8 A;  2EV5 A;  4RAZ A;  3ZN1 A;  4S05 A;  2D2W A;  5HLH A;  2P5K A;  2VBZ A;  3B02 A;  5D5U B;  2P7C B;  2HTJ A;  4CGZ A;  3I0T A;  2D1V A;  2BEO A;  3EDP A;  4OU0 A;  2WV0 A;  3U9G A;  1ZG5 A;  3FHZ A;  2G9W A;  5KVR A;  1YG2 A;  1Z9C A;  1BOA A;  2CFX A;  4OIP F;  4YII A;  2ISZ A;  1YLF A;  4AD9 A;  3QAH A;  2ZNY A;  5F6F A;  1S3J A;  2CYY A;  2HTS A;  2HKO A;  1WKM A;  4FT8 A;  2MBF A;  2GIV A;  5FFZ A;  5CVJ A;  4AIJ A;  3ZMT A;  3KFW X;  5D4S A;  3ABU A;  3ABT A;  1MJB A;  3KP6 A;  4RB3 C;  2XHK A;  3WU0 A;  1BI0 A;  4WXC A;  5D8L B;  2UXX A;  1JHH A;  2IPQ X;  4D0P A;  5JI6 A;  4CO8 A;  2GA2 A;  1Q1H A;  3U1D A;  1G3Y A;  4RGR A;  4UV9 A;  1R00 A;  4A6E A;  4UVA A;  3P9K A;  4EJO A;  1RUO A;  2CG4 A;  5CVU A;  3WE3 A;  5E8I A;  1IZ1 A;  1KU7 A;  3K9T A;  2R7F A;  3KLN A;  1WSU A;  1HQC A;  2CQK A;  2YR2 A;  3J80 Z;  2STT A;  2DPD A;  2DK5 A;  4BHB A;  2A68 F;  4G7Z F;  2BGC A;  1CGP A;  2VC1 A;  2FA5 A;  4KFC A;  4MTD A;  3GXO A;  1O7L A;  3V8K A;  1W5S A;  2VXZ A;  4FX0 A;  2VON A;  4XBF A;  1J2X A;  2PJP A;  3IWZ A;  3KP4 A;  1YW7 A;  3CO6 C;  1TW3 A;  2FQ3 A;  2GWR A;  2R3S A;  2PLY A;  3G73 A;  1K6O A;  3K1N A;  5D4R A;  2FNP A;  1PP8 F;  4IJA A;  1XD7 A;  1KA8 A;  4L9J A;  3RTR A;  4HQM A;  2DLL A;  1STZ A;  3GFJ A;  4KYW A;  1SAX A;  1YW9 A;  3WGI A;  4NHJ A;  5E1Z B;  2V6C A;  1LVA A;  2ZNZ A;  1KQ8 A;  3WGH A;  5D5W B;  1Z6T A;  4EM1 A;  2QQ9 A;  3MAJ A;  3DEU A;  4R1H A;  2ADU A;  4Y15 A;  1F1Z A;  3LFK A;  2R7D A;  2O8X A;  1Z1D A;  3CDH A;  4WXH A;  3SZP A;  2XAS A;  3V4G A;  1OYY A;  3S2W A;  1J9I A;  3HIF A;  4UV8 A;  1Z05 A;  1SD7 A;  3Q9S A;  3HRM A;  2VOP A;  1R22 A;  2IVM A;  3OOP A;  2DI3 A;  3J7A O;  4AIH A;  4NQW A;  1YW8 A;  2A6H F;  2DQL A;  2Z9O A;  4TV7 A;  2FBK A;  3EET A;  1MJA A;  3BOQ A;  5EEG A;  1D5V A;  3DFG A;  1WRJ A;  4KIC A;  1UFM A;  3LQQ A;  2W25 A;  1FP2 A;  1XCV A;  4HYE A;  1MGT A;  2Y75 A;  2BE5 F;  3WTS C;  3RPU A;  4U0W A;  2VN2 A;  5DD8 A;  4LB5 A;  2OZ6 A;  3V8J A;  1MD0 A;  4AIK A;  1G3S A;  1U5T C;  2HYF A;  1GXQ A;  3HTS B;  1FSE A;  2IA1 A;  3RYR A;  3HRU A;  5DD4 A;  4RB2 C;  2ESN A;  4KN4 X;  4XSX F;  1XSD A;  1LEA A;  1J0R A;  2A3S A;  5LBQ A;  5L3D A;  2NYX A;  1L0O C;  2VBX A;  4KIB A;  2PG4 A;  3BJA A;  4HX8 A;  4AWX B;  1D8J A;  1EV7 A;  3LA7 A;  1FZP B;  4ENN A;  4MQ9 F;  2HKX A;  2YX7 A;  4BAY A;  3I53 A;  4ZYD A;  2UWM A;  5E1X A;  3QP5 A;  1BC7 C;  1T2K A;  2PI0 A;  4HLY A;  3PFI A;  4LMY A;  4RGX A;  3M8F A;  2EV6 A;  4CIC A;  2XRO A;  5BOX A;  4HF0 A;  2XIG A;  1LDK B;  2JTV A;  1O57 A;  3AAF A;  4MHG A;  3DP7 A;  3RPQ A;  1IN7 A;  4P5O A;  3L2C A;  2L01 A;  1IUY A;  3RYP A;  4IHT A;  4HX7 A;  3JAM K;  2FBI A;  2CW0 F;  2PEX A;  5CJ9 A;  1YFH A;  1F5T A;  1ZRF A;  4U7D A;  2A5Y B;  4G6Q A;  2X0L A;  1U8R A;  1I27 A;  1ZH5 A;  1IAW A;  1ZYR F;  2QLZ A;  2VBY A;  1GHC A;  2RGV A;  5FD5 A;  4BHC A;  1REP C;  3FM5 A;  4GCV A;  1T38 A;  1LB2 A;  4JK1 X;  1HW1 A;  5J8F A;  2HGC A;  3M7G A;  1LDJ A;  4HV5 A;  1T6S A;  4M72 A;  3GX4 X;  2IA0 A;  3QU6 A;  4U0V A;  3ZMU A;  3F6O A;  1MJ9 A;  3ZP5 A;  5JFR A;  2HEO A;  3ZN0 A;  2M8E A;  4HOB A;  1ZAR A;  2ZBK A;  4I01 A;  5K5O A;  3BZ6 A;  5HDG A;  4OIQ F;  1H9T A;  1FC3 A;  2NAZ A;  4O6J A;  1O7F A;  1T39 A;  4PGG A;  1XDU A;  1IN6 A;  1TNT A;  3K1M A;  2M87 A;  3HRS A;  5K1Y A;  4U0Y A;  1B9M A;  1TLH B;  1FYM A;  3TDU C;  1KGS A;  5DCM B;  1PUE E;  4HQE A;  4HW0 A;  1I5Z A;  4LLN A;  1P92 A;  1U6G A;  3W6K B;  1IXS B;  4HF2 A;  3F3X A;  5LEJ A;  2V1X A;  2GZW A;  5D5V B;  2OQG A;  2Z3Y A;  2RN7 A;  3SXY A;  4OIN F;  4GXO A;  1ONV A;  4ESF A;  1XCB A;  3KEQ A;  4A5M A;  3CUO A;  5D8K B;  2HDC A;  4OMY A;  3LAP A;  5IT9 Z;  1QO0 D;  4G9Y A;  3KZY A;  4MEY F;  1X3U A;  4A6D A;  2QWW A;  5L3B A;  1XSV A;  3N97 A;  1HST A;  2QUF A;  3GFL A;  2PBI A;  1HSJ A;  4P9F A;  1BIA A;  3QRF F;  4KIF A;  4QLC U;  3LAJ A;  4M71 A;  4IF4 A;  1B9N A;  4MGR A;  3ULQ B;  2HFH A;  1FPQ A;  2OQR A;  4RS8 A;  1R7J A;  4ZYH A;  5D6E A;  1SMY F;  1WQ2 A;  4M74 A;  2XGX A;  4EJV A;  1IW7 F;  3L7W A;  2KKO A;  1UB9 A;  1DDN A;  1GVJ A;  2DO7 A;  2E1C A;  4YFK F;  1TTY A;  2KIM A;  4OMZ A;  2OBP A;  5CVR A;  1Y0U A;  4Z2Y A;  1U2W A;  5JR3 A;  2M30 A;  4YFN F;  2MA3 A;  2ACJ A;  4EM2 A;  1R1V A;  4ZZL A;  2H09 A;  1FX7 A;  1XMA A;  4ON0 A;  3DXJ F;  2XAQ A;  2RC4 A;  3K69 A;  4I7H A;  3T8R A;  2OAZ A;  1IRF A;  3NQO A;  5FD6 A;  1SFU A;  3FXR A;  3F8B A;  1XDS A;  3HSR A;  2FSW A;  4U88 A;  2L54 A;  4HLX A;  5K5R A;  1ZG3 A;  2IW5 A;  4FHT A;  5L3E A;  2W57 A;  4LK0 F;  3Q9V A;  3JW4 A;  4UVB A;  1ZRC A;  4P55 A;  2O0Y A;  2VOO A;  4A0X A;  4WXD A;  1RNL A;  2QZ8 A;  2AS5 F;  4EGZ A;  5F64 A;  3ZPL A;  3ISP A;  3GEZ A;  1BIB A;  4M73 A;  1KQ9 A;  4L18 B;  2CSO A;  3ECO A;  3GFI A;  1ZN2 A;  1D3Y A;  2V1D A;  4WK8 F;  4UXN A;  1ZGJ A;  2EFW A;  3VOE A;  3JAM Z;  1OPC A;  2IT0 A;  3G3Z A;  1QGP A;  2LNB A;  2HQN A;  3CTA A;  4G7O F;  3L09 A;  4RGU A;  1ZRD A;  5HLG A;  2EV0 A;  3KZZ A;  4HAM A;  2B0L A;  3I59 B;  2DW4 A;  1P4W A;  3BRO A;  2F5E A;  3L00 A;  4WX9 A;  3C3W A;  2A6E F;  2HYG D;  4ENJ A;  3F8M A;  4L5I A;  4B09 A;  3T0Y A;  3TO7 A;  3HOT A;  2JT1 A;  1W5T A;  4XRF A;  3ZMD A;  2G7H A;  1L3L A;  2IJL A;  3I4P A;  3E5Q A;  1RUN A;  5LLQ A;  1FLI A;  4EQQ A;  1XB4 A;  1DP7 P;  3L9F A;  2QEN A;  4NB5 A;  3IRR A;  2ESH A;  2VE9 A;  2ISY A;  3ZMV A;  4LLG F;  2OZU A;  3GZ5 A;  3H3Z A;  1ZLK A;  4M6X A;  2QBY B;  1V4R A;  4RB0 A;  5FFX A;  1I1S A;  1S8N A;  2PMH A;  2P4W A;  4M9Z A;  5IT9 K;  4E70 A;  3K0L A;  2LSO A;  2J5P A;  2OA4 A;  4LLL A;  2P8T A;  2VE8 A;  5L3G A;  3QP6 A;  5DCM A;  2Q2E A;  2O6G E;  3NRV A;  2NRA C;  4KMU X;  2PFB A;  4K2E A;  2Z5U A;  1P2F A;  1W7P B;  1B59 A;  1AWC A;  4FX4 A;  1RIO H;  5DEQ A;  3EYY A;  3CUQ C;  1SD6 A;  2L02 A;  4O5V A;  4ZYE A;  1FYL A;  1SMT A;  1SD4 A;  1XGS A;  3KEO A;  5DYM A;  2XAG A;  2L4A A;  1OKR A;  4KNY A;  4ETS A;  4L9T A;  1QPM A;  5LHG A;  2EFP A;  2NNN A;  3R4K A;  2XUB A;  3DQV C;  4N9H A;  3V7S A;  5ILU A;  3IC7 A;  3VFZ A;  1O3S A;  2H27 A;  3GFM A;  1KYZ A;  5ICG A;  1KQ0 A;  1XSX A;  2DK8 A;  5ICE A;  2COM A;  4A5N A;  1Z91 A;  4YFX F;  4G7H F;  3MQ0 A;  1GXP A;  2K4B A;  1KYW A;  2PN6 A;  3H3U A;  4RAY A;  1O3T A;  2FXA A;  4EV0 A;  2V9V A;  5J6X A;  4BQA A;  1AOY A;  3V7R A;  4QWQ A;  5EEH A;  1IN8 A;  1BI3 A;  2DTR A;  2XAH A;  3VOD A;  5LEK A;  3F8C A;  4LFU A;  3RKW A;  4XLP F;  2GA1 A;  3FZV A;  1HW2 A;  2DT5 A;  2EFO A;  2A61 A;  3HTU A;  4ENM A;  3NEU A;  2JSC A;  3GW2 A;  4A12 A;  4HF1 A;  1DUX C;  1IRG A;  1IF1 A;  4MNU A;  4CXF A;  1SD5 A;  2DQR A;  1ODD A;  4UHT A;  1BI1 A;  3B73 A;  2IA2 A;  3O2P E;  4YIF A;  2F5C A;  3H92 A;  3I71 A;  3COA C;  5HVQ C;  3V7C A;  4A0Y A;  1FBU A;  1R58 A;  1U5T A;  3WU1 B;  3WE2 A;  3M8E A;  1P4A A;  3I64 A;  3RI4 A;  2DPU A;  2BV6 A;  5ICF A;  2A69 F;  1ON2 A;  2MC3 A;  5HDN A;  4CDG A;  3HYI A;  4MQV A;  2E7X A;  2ZFW A;  3GVA A;  4N9I A;  3KE2 A;  4EGY A;  3E5U A;  2DAO A;  3GYH X;  4A0Z A;  3K2Z A;  3T5X A;  5LHI A;  2OU2 A;  4N0B A;  3E5X A;  3KLO A;  1K78 A;  6PAX A;  3RDI A;  2ZO4 A;  3HSF A;  1UHW A;  5L3F A;  2P5L C;  2LF8 A;  2CGP A;  1G6N A;  3SQN A;  5LRS A;  1QBJ A;  2WC2 A;  4ZH4 F;  1MKM A;  1FT9 A;  1KU3 A;  2HR3 A;  3T1B A;  5A2Q Z;  1R23 A;  2XKO A;  1YS7 A;  1PP7 U;  2K27 A;  5LRR A;  1WWX A;  5BMZ A;  1BC8 C;  2VT3 A;  3KP5 A;  2PMU A;  2FF4 A;  4CZZ A;  3ML6 A;  3ZQ7 A;  2HQR A;  1BBY A;  3E3V A;  3WTW C;  1B4A A;  1YO5 C;  1ZRE A;  1QNT A;  2FEZ A;  1R5H A;  3BDD A;  1ZGA A;  2P5V A;  3I59 A;  3Q5F A;  5H6R A;  2HZT A;  3TO6 A;  2LF7 A;  3GF2 A;  1QZZ A;  5H20 A;  1EH6 A;  2EJR A;  5AIP A;  3TDZ C;  2WTE A;  1XN7 A;  4RGS A;  4EMS A;  2HWV A;  3MCZ A;  3QOP A;  3HHH A;  2JRT A;  3HRT A;  3V8L A;  1LEB A;  3WTX C;  3JSO A;  5KK1 A;  4M9X A;  1E2X A;  2ZKZ A;  1YTY A;  1SFE A;  4RB1 A;  1IXR C;  5AON A;  2STW A;  2EA2 A;  1XGN A;  4CHU A;  4IXA A;  3BPV A;  1J7K A;  3C1D A;  2UZK A;  3JTG A;  2GAU A;  5DDG A;  1S7A A;  4OIO F;  1TBX A;  1JE8 A;  3M1E A;  1BJA A;  2F2E A;  2QBY A;  1HKS A;  1OYW A;  3LA2 A;  1IN4 A;  1Z7U A;  4HX4 A;  5LGU A;  5E17 F;  1FOK A;  1J5Y A;  3T8T A;  2FRH A;  2VBW A;  2W84 A;  2O03 A;  3IRQ A;  4GYI A;  4I02 A;  3KET A;  3GLX A;  3P9C A;  3TQN A;  4LGW A;  1TNS A;  4G94 A;  2V79 A;  2DFI A;  4MTE A;  2AXL A;  4UVC A;  4XLN F;  5H6Q A;  1XGO A;  4WWC A;  1PDN C;  4L0Z B;  1W7P A;  2QQA A;  1ZAO A;  3DKW A;  1ULY A;  3D0S A;  3FMQ A;  1USS A;  3BWG A;  2ZXJ A;  3R6S A;  5F1R A;  4R8H A;  5CYV A;  1B6A A;  2VOD A;  4HZF A;  2X4H A;  1FNN A;  1I1G A;  4WF2 A;  4BH9 A;  1R1U A;  3F8F A;  2M5W A;  1HBX G;  3LA3 A;  2H94 A;  3E6C C;  3KP2 A;  1R36 A;  1QQI A;  2QQB A;  1HW5 A;  2H6C A;  3WTY C;  3WTZ A;  4KA4 A;  4OIR F;  1U5T B;  5LHH A;  2LKP A;  4Y17 A;  1J75 A;  4KT5 C;  4BYY A;  1UHM A;  2EK5 A;  3SFZ A;  4LJZ F;  4EVI A;  1P4X A;  3RKY A;  2OD5 A;  1ZG1 A;  3KP3 A;  1XMK A;  3ROU A;  5HS7 A;  4Q5S F;  3F6V A;  5HDK A;  2MLK A;  1K78 B;  2Y0M A;  2L4M A;  4ZYG A;  5FGM A;  1ON1 A;  1S7O A;  2D45 A;  3I54 A;  1FY7 A;  4M9S A;  2F5D A;  1HXD A;  3EUH A;  5J8C A;  4GYG A;  2Q0O A;  1IN5 A;  1V3F A;  1S29 A;  3MEX A;  4Q48 A;  1C0W A;  4GO1 A;  4DQ2 A;  4HDV A;  1R5G A;  3MWM A;  3OV8 A;  3BJ6 A;  5BPD A;  5ICC A;  1Z6R A;  4JQF A;  5FLX K;  1LQ1 A;  4ENK A;  4EJW A;  4U7B A;  2XRN A;  3BP8 A;  4I2O A;  2XVC A;  3IWF A;  1T0F A;  4KDP A;  5HLI A;  3JSP A;  5A2Q K;  1P6R A;  1H9G A;  3IKV A;  4CYD A;  2TDX A;  5DCF A;  3EYI A;  2Z33 A;  1B1B A;  4KMF A;  2KRF A;  2EB7 A;  2GXB A;  3D5L A;  1KU2 A;  1FYK A;  1EH8 A;  2C6Y A;  4I0B A;  2FBH A;  4I98 B;  3ZMS A;  4PDK A;  2KJB A;  2FMY A;  3J81 K;  2XAF A;  3EQL F;  2E1N A;  5HS9 A;  1LDD A;  2IP2 A;  2ZCW A;  3MZY A;  1K7A A;  2E7W A;  4L5J A;  3K1P A;  4BXU A;  2RKH A;  4LB6 B;  2NS0 A;  3F8N A;  3DF8 A;  3E97 A;  4MEX F;  5D5X B;  1UST A;  3CO7 C;  5IT3 A;  1CF7 A;  1TQP A;  1FBS A;  4KUM A;  1U78 A;  3QU3 A;  2Q8K A;  3F21 A;  2VT2 A;  2RNJ A;  2VC0 A;  1R1T A;  4HV6 A;  4JBA A;  5E20 A;  4IVN A;  2JZY A;  3QPT A;  4ASN A;  1HKQ A;  3P7N A;  4I0A A;  2RV8 A;  1EH7 A;  2M45 A;  2ZME B;  3F23 A;  2YSR A;  3FMR A;  3GUD A;  2MLG A;  4H0E A;  3HSE A;  1SFX A;  1KU9 A;  3VEP A;  3FXQ A;  1TQM A;  4PCQ A;  4LG0 A;  2UXN A;  2DU9 A;  5BS6 A;  4OOI A;  5DUK A;  4G8X A;  5K5Q A;  5JVT A;  2W24 A;  3QPH A;  2EFN A;  2ETH A;  2EFQ A;  2YU3 A;  3RIR A;  2YPR A;  1BI2 A;  1W7P D;  3PQJ A;  1YIO A;  1DPR A;  3N4M A;  1JXS A;  4LK1 F;  2W85 A;  3E6B A;  5DUI A;  4S04 A;  2BYV E;  3TGN A;  2YX4 A;  1MDM A;  3RJP A;  2IRF G;  3HHG A;  1LJ9 A;  2QYO A;  3MFK A;  5AIQ A;  1OR7 A;  5HOO A;  2FE3 A;  2M1B A;  4LD5 A;  2A07 F;  1T98 A;  5ILS A;  1MZB A;  2ELH A;  1G4D A;  1FP1 D;  4EJU A;  4IRG A;  3TOB A;  1TW2 A;  2P7V B;  4A2U A;  2EA4 A;  4Q4Z F;  3IL2 A;  2NNY A;  5FB2 A;  3WOD F;  2HOE A;  4HBL A;  3I5U A;  5TRD A;  5ILV A;  4L9N A;  2RVC A;  2K02 A;  1S6L A;  2GQQ A;  3CLO A;  1O3Q A;  1ZLJ A;  5ERI A;  4GGG A;  4L9V A;  3WTV C;  1U3E M;  3TKY A;  3BPX A;  3E6D A;  2WWY A;  2EWN A;  3CUQ A;  5LGN A;  4EJT A;  3TOA A;  3MZH A;  4IPA A; 
#chains in the Genus database with same CATH topology
 1K6Y A;  3HOY J;  1MMD A;  1LFP A;  3R61 A;  4II3 A;  1LFU P;  5CLS A;  4KIG A;  1OCO H;  3GWZ A;  4KN7 X;  3CMM A;  3JRF A;  4B4C A;  2CV1 A;  4XSZ F;  1W5C C;  3NAU A;  4IRI A;  4L0Y B;  2GIZ A;  4PJJ A;  5FO5 A;  3CC4 I;  4DYC A;  3IHU A;  1R9T J;  2PQ8 A;  3LQR A;  3MVP A;  4P96 A;  5EYR A;  3DV8 A;  4F52 A;  3GZ6 A;  1IXC A;  4YEL A;  3HOS A;  4A3G J;  1UCR A;  5JHU A;  3PUB A;  3PQK A;  5FKL A;  3C18 A;  4NNJ A;  5CVV A;  5DV5 A;  3JRH A;  2G7U A;  4IRH A;  1JHF A;  2LG4 A;  3TO9 A;  2XF6 A;  3DPT A;  1NHA A;  1TZL A;  2CUZ A;  2GXG A;  3S3N A;  2O61 A;  3A0H C;  1ITY A;  3F9K A;  2K4J A;  3DPL C;  2XKP A;  1VQ9 I;  3HXL A;  2JN6 A;  1U8B A;  1HKT A;  2JPC A;  3FBI B;  1BN5 A;  3S3O A;  3J80 K;  2V1U A;  1R71 A;  3CCU I;  2DT6 A;  3IUO A;  1MH4 A;  2VKH A;  5KNL A;  1G3W A;  1OQY A;  1YJN I;  2H8W A;  1X2N A;  1YYV A;  2Z99 A;  4OAY A;  3W3C A;  4J00 A;  4IHS A;  4PJ0 C;  3ERE D;  2ECC A;  3M9A A;  1MIJ A;  1E17 A;  2ZFU A;  1T08 B;  2BBY A;  4DNC A;  3KCC A;  4CYC B;  4M6Y A;  5HS8 A;  2FML A;  2MYS A;  2DJN A;  3IKT A;  5FLX Z;  3HGY A;  1MBJ A;  1CF7 B;  3S16 J;  3WTT C;  1JUP A;  3NAR A;  5E8G A;  3F22 A;  1BM9 A;  2E71 A;  5E18 F;  1ZHF A;  2L7F P;  4G6D A;  3ZMZ A;  1XGM A;  3CZ6 A;  3OIP A;  3SZT A;  5E3N A;  2BW3 A;  2HS5 A;  1A04 A;  5CPR B;  2LTP A;  5EGO A;  1FWZ A;  1JTY A;  3WG9 A;  3BJO A;  1GUU A;  1WJB A;  1YIT I;  3R0A A;  3WGG A;  3FWE A;  3FKJ A;  3FXU A;  3FXO A;  5GAG J;  4IHY A;  2CWE A;  2MAB A;  2DOE A;  4Q47 A;  1LNW A;  2H6B A;  4B3A A;  3BCB A;  3FF5 A;  3MMY B;  4S0H B;  3BG9 A;  4L5E A;  4XLC A;  4A3I J;  3I4N J;  5J47 A;  2KJC A;  5KHD A;  1FSH A;  1K79 A;  2G0E A;  4B47 A;  1H89 C;  1RC9 A;  5TJJ A;  3BY6 A;  2VQH A;  3I58 A;  1YQA A;  4PGH A;  1J59 A;  4MFE A;  1JGS A;  2OCE A;  2XV4 S;  1O3R A;  3J81 Z;  1TQI A;  3HKZ A;  1SFK A;  2ZJR F;  4LG0 B;  3KP7 A;  2XAJ A;  3BC8 A;  5JLW A;  4B8X A;  3N05 A;  3VYS B;  1TT0 A;  3H9Q A;  3ZXS A;  4WCG A;  1Z67 A;  1I6H J;  4QPO A;  1VTN C;  3QOE A;  2F5F A;  4PSX A;  2QA4 I;  3OYK A;  1RRJ A;  5CVI A;  1W4M A;  2GOM A;  2LDU A;  4E7S A;  2MD5 A;  2RDP A;  4HDU A;  2LVS A;  1HDD C;  3F72 A;  1OYI A;  4IHX A;  1IGN A;  1GV5 A;  1LKX A;  4BU2 A;  3FMS A;  4F91 B;  4ESJ A;  3PFY A;  2DBB A;  5E3M A;  4UUS B;  1GT0 C;  2F4M B;  1I6X A;  1N75 A;  3FK6 A;  1H0M A;  3O3K A;  4BJT A;  4I09 A;  1RES A;  2B63 J;  4UNO A;  2QVO A;  2O3F A;  1OMI A;  2Y48 A;  3CJN A;  1WI9 A;  3SEZ A;  2XF5 A;  3CLQ A;  4FE7 A;  3ZCO A;  1MDM B;  3U2R A;  2R4G A;  2P6T A;  3AG1 H;  1ZR2 A;  2FD5 A;  1S9H A;  3CMY A;  4IKF A;  1D1C A;  5L3C A;  2CO5 A;  1UHS A;  2HQA A;  4BE0 A;  1QZY A;  2DA2 A;  4YG2 F;  3L1P A;  3SJM A;  3ECH A;  5LGT A;  4ZZD A;  2J5O A;  3W6J B;  3DTE A;  1J09 A;  4BHP A;  3FX3 A;  1K4T A;  1MND A;  1A35 A;  3C7J A;  2LKX A;  2X9D A;  2VB6 A;  3BT9 A;  3O8H A;  3PO3 J;  1M1E B;  5H2F C;  5IYB J;  2KIU A;  3RKX A;  2OCC H;  3S1N J;  1RZ4 A;  2O9L A;  3R60 A;  1WPK A;  4RDU A;  2D1H A;  2CV2 A;  3LWF A;  3JRA A;  1QVT A;  4Y13 A;  2L3D A;  3H0G J;  4BJ6 C;  5ED4 A;  3PSI A;  3SHF A;  3REO A;  3P9I A;  5IOZ A;  4XKV A;  3JTH A;  4PZJ A;  1DPU A;  3WTU C;  3K4L A;  4BNC A;  2R93 J;  2NVY J;  2RQP A;  5FKO A;  4R79 A;  3OWT A;  1TT5 B;  3ELK A;  2B9S A;  4AVP A;  5BQT A;  2MH2 A;  2JPB A;  2ZME A;  1RI7 A;  1X4P A;  3NWT A;  3R0J A;  5D6F A;  1FBQ A;  4EM0 B;  3LST A;  2FU4 A;  3CCV I;  1F9N A;  1YX3 A;  1SFO J;  2FOK A;  2XB0 X;  5IYD J;  3HUG A;  5BPI A;  3FM3 A;  4BJ5 C;  4ESB A;  4P9U A;  4BQO A;  3E6M A;  3FXJ A;  2DFH A;  2IGO A;  2MH9 A;  3CUQ B;  1H88 C;  3L2U A;  4O3M A;  2KIF A;  2W7N A;  4G6T B;  2QM3 A;  3GO5 A;  1WJF A;  2E36 A;  2ZJ2 A;  1F4K A;  3EUH C;  3HC7 A;  3PNY A;  2M0M A;  2FNA A;  3BTI A;  2P6S A;  4Y7N J;  4UUV A;  1D8K A;  2K7L A;  1OCT C;  3O6B B;  3VB2 A;  1QHG A;  3HEF A;  3TP0 A;  2Y0S N;  1G3T A;  3QOD A;  2K86 A;  5E1W A;  3RCO A;  4F7Z A;  3G1M A;  1YS6 A;  4HA8 A;  2EV5 A;  2KIQ A;  4I99 C;  2XB5 A;  5GTI C;  1T95 A;  4RAZ A;  3ZN1 A;  2X6X A;  4S05 A;  2D2W A;  3BR2 A;  5HLH A;  2P5K A;  2VBZ A;  2HYJ A;  3B02 A;  5D5U B;  3VDX A;  1NG7 A;  2P7C B;  2F4I A;  1E3O C;  2HTJ A;  2R7V A;  3AFH A;  2PJR B;  4CGZ A;  2HVQ A;  3I0T A;  3A01 A;  2IS1 A;  2D1V A;  5B66 C;  2BEO A;  2LD5 A;  3EDP A;  1B8I A;  1T56 A;  5KAF C;  4OU0 A;  2WV0 A;  9ANT A;  3S15 J;  3RZO J;  3U9G A;  3GBG A;  4PSW A;  2CMP A;  1ZG5 A;  3FHZ A;  4PK4 A;  2G9W A;  3AL0 B;  3ZRG A;  5JLX A;  3H1C A;  3TW6 A;  3K4C A;  3DU5 A;  1WJC A;  5KVR A;  3K6G A;  1YG2 A;  5F08 A;  4M3D A;  2XRL A;  4NUB A;  4UB6 C;  1BOA A;  1Z9C A;  2CFX A;  2F4O B;  1XX5 A;  4OIP F;  4BBR J;  4NC8 A;  1WJE A;  4A3J J;  2W82 A;  3S1Q J;  2EZL A;  3IH2 A;  4YII A;  3EPZ A;  5IY5 H;  4MO7 A;  2M0C A;  2ISZ A;  1YLF A;  3ZQF A;  2LK2 A;  4AD9 A;  2ZSH B;  3BR5 A;  3QAH A;  2ZNY A;  4JX4 A;  4RLF A;  5F6F A;  1S3J A;  2CYY A;  2X1C A;  2HTS A;  2X1E A;  2HKO A;  1WKM A;  4FT8 A;  2MBF A;  2OTL I;  2GIV A;  1WGX A;  5FFZ A;  5F27 A;  4RM3 A;  5CVJ A;  4AIJ A;  3ZMT A;  2BW3 B;  3KFW X;  5D4S A;  1AHD P;  5BNG A;  2FOW A;  5EGO B;  3ABU A;  5B1B H;  3ABT A;  1MJB A;  3KP6 A;  4RB3 C;  1YIJ I;  4YIR X;  1Y6I A;  2MW8 A;  1UMQ A;  2WY8 Q;  2XHK A;  2CS3 A;  4XRS A;  2E1M C;  3WU0 A;  1BI0 A;  4WXC A;  5D8L B;  2UXX A;  1GV2 A;  3C2G A;  1JHH A;  2IPQ X;  1BW5 A;  2LYC A;  4D0P A;  5JI6 A;  2HOS A;  4CO8 A;  1R4N B;  4QTR A;  4HNT A;  2GA2 A;  3OOU A;  1Q1H A;  3U1D A;  1D1B A;  1G3Y A;  4RGR A;  5HOD A;  4UV9 A;  2WY7 Q;  2LP0 A;  2KIS A;  1R00 A;  4A6E A;  3BG3 A;  4UVA A;  2KHM A;  3P9K A;  3CQZ J;  2HZD A;  4EJO A;  1TC3 C;  4GDF A;  1RUO A;  2CG4 A;  2EIL H;  2K9L A;  5CVU A;  3WE3 A;  4Y4R A;  2OC6 A;  5E8I A;  1IZ1 A;  5F1J A;  1KU7 A;  3K9T A;  2R7F A;  3KLN A;  1WSU A;  1HQC A;  2CQK A;  2YR2 A;  3CCY A;  4F93 B;  3L2W A;  3J80 Z;  2STT A;  2K3F A;  2DPD A;  2DK5 A;  4BHB A;  2A68 F;  4G7Z F;  1OLT A;  2BGC A;  2R0Q C;  1D0X A;  2BHY A;  2VXD A;  2XAU A;  5IPA A;  1CGP A;  1MBK A;  2VC1 A;  2M4G A;  2L7K A;  2FA5 A;  2K9S A;  4KFC A;  4MTD A;  2DMN A;  3GXO A;  1O7L A;  3TP3 A;  3V8K A;  1KON A;  3PSF A;  5GTH C;  1W5S A;  3AL0 C;  3J7Y J;  3GTQ J;  2ID3 A;  2VXZ A;  4FX0 A;  2VON A;  4XBF A;  1X4O A;  1J2X A;  2PJP A;  1U9O A;  1POG A;  3IWZ A;  2DA5 A;  3KP4 A;  1YW7 A;  5EF6 A;  3CO6 C;  1OIS A;  3E1S A;  5GPA A;  3WU2 C;  4XRM A;  1IV6 A;  3OYI A;  1TW3 A;  2FQ3 A;  2DTZ A;  2GWR A;  2QKL B;  3ASN H;  1VQ4 I;  2R3S A;  2PLY A;  3G73 A;  1K6O A;  2KMU A;  3K1N A;  5D4R A;  4FET A;  1LE8 B;  2FNP A;  1A31 A;  1PP8 F;  2R7O A;  2BXZ A;  4IJA A;  2DXI A;  2WAQ A;  2XGD A;  3KYC B;  3OS1 A;  4ZTF A;  4A3L J;  4D9J A;  1XD7 A;  1KA8 A;  4L9J A;  3RTR A;  4HQM A;  4XOR A;  1R49 A;  2DLL A;  3DEW A;  3OSF A;  4BGD A;  1STZ A;  3GFJ A;  3FBN B;  4KYW A;  2R7T A;  2L5Q A;  2A5W A;  4U87 A;  1SAX A;  3OYB A;  1YW9 A;  3WGI A;  1X1D A;  2IAI A;  4NHJ A;  5E1Z B;  1OR7 C;  2V6C A;  1LVA A;  2XDV A;  1QU3 A;  2ZNZ A;  1KQ8 A;  4RAG A;  3WGH A;  1W1W E;  5D5W B;  3A0B C;  4X0G A;  1Z6T A;  3KX2 A;  4EM1 A;  2QQ9 A;  3Q0V A;  3MAJ A;  3DEU A;  4R1H A;  3G6E I;  3H35 A;  4BAC A;  4HSR A;  4ZJZ A;  3TED A;  4KIT B;  2ADU A;  4Y15 A;  1F1Z A;  3KEY A;  4F55 A;  3K70 D;  2VLA A;  3GME A;  1QZE A;  1X1A A;  3LFK A;  2R7D A;  2O8X A;  1Z1D A;  3CDH A;  4WXH A;  3SZP A;  4FAS D;  2XAS A;  3V4G A;  1WZ2 A;  1OYY A;  3S2W A;  1J9I A;  3HIF A;  1IUF A;  1Y8R B;  2X85 A;  2BY1 A;  4UV8 A;  1WJD A;  1Z05 A;  4YRV A;  1SD7 A;  3Q9S A;  3HRM A;  2LRE A;  1ZR4 A;  2CW8 A;  3W2W A;  1WI3 A;  2X6W A;  5EZH A;  2VOP A;  5GPC A;  1R22 A;  3FIW A;  2IVM A;  1IO2 A;  4V2G A;  1VQN I;  5C3E J;  2RRE A;  4M3F A;  3JRD A;  3PNV A;  1EJ9 A;  3C2H A;  4H4K C;  3OOP A;  3W2A A;  2DI3 A;  3J7A O;  3BTJ A;  2NS8 A;  2E19 A;  4AIH A;  2DDB A;  4NQW A;  5J3L A;  4ZDL A;  4CCK A;  1YW8 A;  1V54 H;  1XG1 A;  2A6H F;  2DQL A;  4JX6 A;  2Z9O A;  4TV7 A;  4C2U A;  2FBK A;  1Z77 A;  3EET A;  2XPW A;  2KQR A;  2V9K A;  3S2D J;  1MJA A;  1BR4 A;  2ECB A;  3BOQ A;  5EEG A;  1D5V A;  3DFG A;  2D5V A;  2IXS A;  4ABZ A;  4Y52 J;  1WRJ A;  2L9N A;  2ME6 A;  4KIC A;  1UFM A;  2Y31 A;  3LQQ A;  1A36 A;  2W25 A;  1FP2 A;  4A3F J;  1XCV A;  4IHV A;  4HYE A;  1ZGW A;  1MGT A;  2Y75 A;  2GXA A;  1RET A;  2L7Z A;  2BE5 F;  3WTS C;  1BL0 A;  2COB A;  3RPU A;  4U0W A;  2KRH A;  2VN2 A;  5DD8 A;  2JUC A;  4LB5 A;  2XPU A;  2OZ6 A;  3V8J A;  1MD0 A;  2WB1 N;  3V42 A;  1G3S A;  3HGG A;  4AIK A;  2P0W A;  3DBL B;  1U5T C;  2HYF A;  3BR1 A;  1GXQ A;  3HTS B;  1FSE A;  2IA1 A;  5E79 C;  3OMY A;  3RYR A;  2VJ5 A;  3KPH A;  3HRU A;  5GAE J;  5IP6 A;  1ERD A;  5DD4 A;  3OYH A;  3HPG A;  4RB2 C;  4HRI A;  2ESN A;  4KN4 X;  4XSX F;  3MD2 A;  2V4J C;  4RBO A;  4CZC A;  1XSD A;  1LEA A;  4N4O B;  2AQF A;  3S8P A;  1BOB A;  1OJL A;  4BDY A;  1J0R A;  1I39 A;  1VQ6 I;  2A3S A;  2FQ4 A;  5LBQ A;  2HXO A;  3SEQ A;  2W48 A;  4BXX J;  5L3D A;  2NYX A;  3OYD A;  1L0O C;  2VBX A;  3LFU A;  4MLO A;  3G1L A;  3K4B A;  1AU7 A;  1X58 A;  4KIB A;  4BKX A;  2PG4 A;  2KT0 A;  3DKX A;  3PIP F;  1S72 I;  4UB8 C;  2N8G A;  3BJA A;  3ERM A;  4HX8 A;  4AWX B;  1UJ8 A;  1EV7 A;  3LA7 A;  1D8J A;  3ZR8 X;  1FZP B;  4DBR A;  4ENN A;  4MQ9 F;  2QSH X;  1YI2 I;  4JOM A;  2HKX A;  2YX7 A;  1LUJ B;  4BAY A;  4XN3 A;  3I53 A;  4BY7 J;  4ZYD A;  2UWM A;  1SVL A;  5E1X A;  1JKQ C;  3QP5 A;  5HNF A;  2HU9 A;  1MBF A;  4XR6 A;  2GOX B;  4GFB A;  1A6Q A;  4DGW B;  1BC7 C;  1RR8 C;  1T2K A;  3H3V K;  4C30 A;  2WAD A;  4RMN A;  2CU7 A;  1NG6 A;  3VSK A;  1FOY A;  4V2F A;  2TRT A;  1ETW A;  2PI0 A;  4HLY A;  3PFI A;  4LMY A;  4RGX A;  4I76 A;  2LR8 A;  3M8F A;  2EV6 A;  2PMZ N;  3M8J A;  2Q1Z B;  4CIC A;  3JCU C;  2XRO A;  2PJR A;  5BOX A;  4HF0 A;  5IOY A;  1NH3 A;  5EZG A;  2XIG A;  1LDK B;  3Q0W A;  3QYF A;  2X1D A;  3GTK J;  4DIQ A;  2JTV A;  3LNQ A;  3BZK A;  1O57 A;  3AAF A;  4MHG A;  2I5U A;  3DP7 A;  1IN7 A;  3RPQ A;  5EG0 A;  2JVH A;  4P5O A;  3L2C A;  1SC7 A;  4LIV A;  2L01 A;  1X1P A;  1IUY A;  2QF7 A;  3B6C A;  1QPI A;  3RYP A;  1APL C;  4IHT A;  4HX7 A;  3JAM K;  2FBI A;  2CW0 F;  2PEX A;  5CJ9 A;  1YFH A;  2O8K A;  5K7F A;  1F5T A;  1ZRF A;  3HBL A;  4U7D A;  2A5Y B;  2XGC A;  4G6Q A;  4ANJ A;  3M3Y J;  4A3M J;  2X0L A;  1U8R A;  2Z2S B;  1I27 A;  1ZH5 A;  2XPV A;  1IAW A;  1ZYR F;  2QLZ A;  2VBY A;  1GHC A;  2RGV A;  2L9R A;  4HST A;  5FD5 A;  4BHC A;  1REP C;  1GDT A;  4MFD A;  2ZB9 A;  3FM5 A;  4GCV A;  4A69 C;  1T38 A;  4JK1 X;  1LB2 A;  1RR7 A;  1HW1 A;  5J8F A;  1EF4 A;  2RAE A;  2HGC A;  3M7G A;  1LDJ A;  2HPI A;  4HV5 A;  3RQ4 A;  3ZOB A;  1T6S A;  4M72 A;  3UNG C;  1HLV A;  3GX4 X;  2IA0 A;  3H36 A;  3QU6 A;  4U0V A;  3F6O A;  3ZMU A;  1MJ9 A;  5EJC A;  3ZP5 A;  5JFR A;  5F0C A;  2HEO A;  3K4K A;  3ZN0 A;  4XIC A;  4UUT A;  2M8E A;  4HOB A;  1ZAR A;  2ZBK A;  3I4M J;  4I01 A;  5K5O A;  3BZ6 A;  5HDG A;  1Y8Q B;  4OIQ F;  4DZJ A;  1H9T A;  2H8R A;  5IP9 J;  2LOO A;  1FC3 A;  2NAZ A;  4O6J A;  1O7F A;  1T39 A;  1FMW A;  4PGG A;  1XDU A;  1IN6 A;  1TNT A;  3DTI A;  3K1M A;  2VJJ A;  2M87 A;  3HRS A;  5K1Y A;  2X51 A;  2NVT J;  4U0Y A;  2WAF A;  1TL8 A;  1B9M A;  1TLH B;  1FYM A;  1JT6 A;  3DTK A;  3TDU C;  1KGS A;  5DCM B;  1PUE E;  2Q2E B;  3FXK A;  4HQE A;  3CCR I;  4HW0 A;  1I5Z A;  4LLN A;  1P92 A;  1U6G A;  3W6K B;  1I3A A;  2ZME C;  1Y56 A;  3RQI A;  1IXS B;  4HF2 A;  3F3X A;  5FKM A;  5LEJ A;  2V1X A;  4XLA A;  2GZW A;  4HPQ A;  4FIS A;  4XLE A;  3OYL A;  3FK7 A;  3D5S C;  4DOZ A;  4NQW B;  4RLQ A;  3L2Q A;  2JA8 J;  1BR1 A;  3Q0U A;  2BVL A;  4PFO A;  2JK3 A;  5D5V B;  2CQX A;  3BQY A;  1ZQ3 P;  4BDZ A;  2OQG A;  2DCE A;  1IDY A;  2Z3Y A;  2RN7 A;  1XC5 A;  3SXY A;  3JRB A;  4BEH B;  3I55 I;  2ZSI B;  1TP4 A;  4OIN F;  4GXO A;  3C2B A;  1ONV A;  2M2E A;  1BA5 A;  1XCB A;  3KEQ A;  4ESF A;  1OCP A;  2VQC A;  2MD0 A;  2BVM A;  3OL4 A;  4XN0 A;  4A5M A;  3CUO A;  5D8K B;  4IL6 C;  2HDC A;  2AO9 A;  3PNT A;  1V5F A;  3WG7 H;  2WV1 A;  1K4S A;  4RA2 A;  1LE8 A;  2YS9 A;  3K7A J;  3PJR A;  4OMY A;  2VUM J;  1VI0 A;  1V55 H;  3LAP A;  1RPW A;  4UY8 I;  5IT9 Z;  1QO0 D;  4G9Y A;  1IRZ A;  3KZY A;  4MEY F;  4XKB A;  1X3U A;  4A6D A;  3VYR B;  4HNV A;  2QWW A;  2KZV A;  3CJT B;  5L3B A;  1XSV A;  3N97 A;  1HST A;  3D1N I;  2QUF A;  3GFL A;  4Y33 A;  5GAD J;  4XQF A;  4DBQ A;  2PBI A;  1HSJ A;  2E5N A;  4P9F A;  1BIA A;  4IZZ A;  3QRF F;  5FKN A;  4KIF A;  2HPM A;  4QLC U;  3RPU D;  2MSY A;  3OYA A;  3LAJ A;  2DA6 A;  4M71 A;  4IF4 A;  2R7S A;  1Y1V J;  1B9N A;  2F48 A;  3ZQQ A;  5K7H A;  4MGR A;  3HB9 A;  3LSP A;  2ME0 A;  3FIS A;  2KFD A;  3ULQ B;  2V9P A;  4AVZ A;  3E0J B;  2HFH A;  1FPQ A;  2OQR A;  5GP9 A;  4RS8 A;  1R7J A;  4ZYH A;  5D6E A;  1HA8 A;  3S1R J;  2KZG A;  4RM2 A;  3UKG A;  4N4N B;  3SDG A;  1SMY F;  1WQ2 A;  4PUS A;  1G59 A;  2IGK A;  4M74 A;  1SEU A;  2XGX A;  4EJV A;  2YU9 J;  1IW7 F;  3GTO J;  3L7W A;  3KIO A;  2KKO A;  1UB9 A;  1DDN A;  1GVJ A;  1HDP A;  4XRS G;  2ZJQ F;  4JYK A;  2OJE D;  1Z3X A;  3S14 J;  2DO7 A;  4ZTJ A;  2E1C A;  4YFK F;  1TTY A;  3CP2 A;  4D5C A;  1JJ8 C;  2KIM A;  4OMZ A;  2M7B A;  2A05 A;  2OBP A;  5CVR A;  1Y0U A;  2M9H A;  1DGW Y;  3IAS 2;  4Z2Y A;  1U2W A;  5JR3 A;  2ZJP F;  2M30 A;  4YFN F;  2MA3 A;  2ACJ A;  4EM2 A;  1R1V A;  3ZQG A;  4QPQ A;  4IHW A;  3CC7 I;  4ZZL A;  1IRX A;  2H09 A;  1FX7 A;  3H5A A;  3L2R A;  1S5L C;  1XMA A;  5FJ8 J;  5EG0 B;  1T0F C;  4ON0 A;  3ZQH A;  2R7Z J;  2Y0S A;  2OPT A;  3DXJ F;  1UG2 A;  1WHU A;  1QVU A;  2XAQ A;  1FIP A;  2L0K A;  2RC4 A;  2DT7 B;  1X3W B;  3K69 A;  4I7H A;  1N78 A;  3T8R A;  2OAZ A;  1IRF A;  1MH3 A;  3NQO A;  5FD6 A;  1UG0 A;  1SFU A;  3FXR A;  3F8B A;  1XDS A;  2R5Z B;  3KYL A;  1JKR C;  3HSR A;  5FLV A;  2FSW A;  2R7X A;  4U88 A;  2L54 A;  4HLX A;  2M3A A;  3ABM H;  1LPQ A;  3HOW J;  5K5R A;  1ZG3 A;  2KRC A;  2IW5 A;  3MN2 A;  4FHT A;  5L3E A;  2W57 A;  3BR3 A;  4LK0 F;  2MFZ A;  1N77 A;  3Q9V A;  2YUS A;  3JW4 A;  3GTG J;  1X1C A;  4UVB A;  3OIO A;  3X2Q H;  4IEJ A;  1ZRC A;  1ENH A;  2LRD A;  3LSR A;  1LFB A;  1OCZ H;  2CFO A;  4P55 A;  1E0E A;  3BR0 A;  2O0Y A;  4M3G A;  1PUF B;  3W6V A;  5CQE A;  2VOO A;  3S1M J;  2F6C A;  3CCM I;  4A0X A;  1TWC J;  2VJI A;  3DCF A;  4WXD A;  1RNL A;  2QZ8 A;  2AS5 F;  4EGZ A;  5F64 A;  3ZPL A;  3AKZ A;  3ISP A;  3CCQ I;  2V26 A;  4DJA A;  2I10 A;  3MKL A;  3OYC A;  2R7R A;  1MBH A;  3GEZ A;  1BIB A;  4M73 A;  2HNH A;  1KQ9 A;  4L18 B;  1I50 J;  1RKT A;  2CSO A;  3ECO A;  3GFI A;  2A6T A;  3ABK H;  5TGT A;  2V6E A;  4XMY A;  3K2A A;  1ZN2 A;  1XTA A;  1D3Y A;  2V1D A;  4WK8 F;  4UXN A;  1ZGJ A;  3VYU B;  2R7W A;  2EFW A;  3VOE A;  3QQA A;  4NDL A;  3JAM Z;  1OPC A;  3TBI A;  5J4Y A;  4Y3O A;  2IT0 A;  1PVE A;  3G3Z A;  2HDD A;  1QGP A;  2LNB A;  2HQN A;  2OF7 A;  4XNF A;  3CJQ B;  3CTA A;  1BW6 A;  4G7O F;  3L09 A;  4RGU A;  5J4V A;  1ZRD A;  5HLG A;  2EV0 A;  3KZZ A;  4CCM A;  2JA6 J;  3W2V A;  4HAM A;  2B0L A;  2CUE A;  4II2 A;  4PJL A;  4BQN A;  3MKW B;  3EUA A;  3FKI J;  3I59 B;  1VND A;  1TWG J;  1P4W A;  2DW4 A;  1MBE A;  2F5E A;  3BRO A;  1VQP I;  3G2B A;  2LY9 A;  3GTP J;  4LOC A;  3OYJ A;  3L00 A;  4BUP A;  4Z6Y A;  3C3W A;  4WX9 A;  2ZXW H;  4IOC F;  3S2H J;  2A6E F;  4RAF A;  2HYG D;  4ENJ A;  2FUG 2;  3F8M A;  2Y9Y A;  4L5I A;  4B09 A;  4M6V A;  3T0Y A;  4PJN A;  3TO7 A;  3HOT A;  4QIW N;  1P7I A;  2VKD A;  2JT1 A;  3HPH A;  1SVO A;  1W5T A;  4XRF A;  3IH4 A;  4JX5 A;  1JTX A;  3ZMD A;  2G7H A;  1L3L A;  2E35 A;  2IJL A;  3I4P A;  3E5Q A;  2KDZ A;  1VF9 A;  2Y30 A;  2QKM B;  5LLQ A;  1RUN A;  4XKC A;  4EQQ A;  1XB4 A;  1ETK A;  1HCR A;  2JA5 J;  1FLI A;  1R4M B;  2W00 A;  1SVM A;  3QWL A;  4PJM A;  1DP7 P;  2BY0 A;  3L9F A;  4I6Z A;  5F0F A;  2RNG A;  2QEN A;  2CW7 A;  4NB5 A;  3IRR A;  2ESH A;  4AU7 A;  2VE9 A;  2ISY A;  1A5J A;  3VYT B;  4IO9 F;  3ZMV A;  4LLG F;  3M1C A;  4FCY A;  3HJE A;  1YRN A;  2OZU A;  4A3E J;  3GZ5 A;  5GAH J;  3H3Z A;  1ZLK A;  4M6X A;  4XON A;  2QBY B;  2DOD A;  1NTC A;  1V4R A;  4RB0 A;  5FFX A;  1I1S A;  1S8N A;  4E7I A;  4DYR A;  4KJZ A;  2PMH A;  2P4W A;  4M9Z A;  5IT9 K;  1ACI A;  3LSG A;  4LIU A;  4E70 A;  3K0L A;  3KZI C;  2ZXI A;  2HI3 A;  2LSO A;  4XOP A;  1MNE A;  2J5P A;  4F92 B;  2OA4 A;  1O4X A;  4LLL A;  4D7N A;  1VQ8 I;  4V19 K;  2P8T A;  2VE8 A;  3GLL A;  3GTL J;  5L3G A;  3QP6 A;  5DCM A;  1CQT A;  2CUF A;  2Q2E A;  5FKK A;  2Y2Z A;  5TIS C;  2O6G E;  3NRV A;  1OFC X;  3OSG A;  2NRA C;  1P9Q C;  5DTD A;  4KMU X;  1VZ0 A;  4B1R A;  2PFB A;  4K2E A;  2Z5U A;  1P2F A;  4CH7 A;  1W7P B;  2V1N A;  2Z1D A;  1B59 A;  5FRO A;  4CCL A;  1AWC A;  4FX4 A;  1RIO H;  5DEQ A;  3JRC A;  2QSF X;  4XLH A;  3EYY A;  1RKW A;  3CUQ C;  1SD6 A;  1X2M A;  2WA0 A;  2L02 A;  2IBD A;  3K4M A;  4O5V A;  4ZYE A;  1FOW A;  1FYL A;  2I8D A;  2Y9Z A;  1SMT A;  1WH7 A;  3OYN A;  3JR9 A;  1SD4 A;  1D1A A;  1XGS A;  3KEO A;  5DYM A;  4BEH A;  4E4H A;  1HC8 A;  4W1U A;  3EUK L;  1EKE A;  2XAG A;  3VSL A;  4BS9 A;  3CCS I;  2L4A A;  1OKR A;  2CQQ A;  1JUM A;  3S93 A;  4KNY A;  1K61 A;  3DBR B;  4ETS A;  1G8X A;  4L9T A;  1QPM A;  5LHG A;  5DS9 A;  3JRI A;  2EFP A;  2NNN A;  3R4K A;  1WCM J;  2E2J J;  3FDY A;  2GLO A;  2HXI A;  4CCN A;  3HOZ J;  4X6A J;  2XUB A;  3DQV C;  4N9H A;  4XM3 A;  3ZQC A;  3V7S A;  5ILU A;  3IC7 A;  3VFZ A;  3U21 A;  1O3S A;  3GFM A;  2H27 A;  1KYZ A;  5ICG A;  2LFB A;  2KDO A;  2M8G X;  2X6Y A;  1KQ0 A;  1XSX A;  2DK8 A;  2IS6 A;  5ICE A;  3FXM A;  2COM A;  1NK2 P;  4A5N A;  1UAA A;  1Z91 A;  4YFX F;  4G7H F;  3MQ0 A;  5M5Y J;  1GXP A;  2K4B A;  1KYW A;  2PN6 A;  3H3U A;  2LKS A;  4RAY A;  3HM5 A;  4IQ4 A;  1O3T A;  3CES A;  1JJ6 C;  2WB1 A;  2FXA A;  4EV0 A;  1YE9 A;  2V9V A;  5J6X A;  1MMG A;  4BQA A;  3I3L A;  1AOY A;  2NS7 A;  3V7R A;  2L9S A;  1FIA A;  4QWQ A;  5EEH A;  5B5E C;  4NC6 A;  3BLY A;  4FTH A;  1IN8 A;  1BI3 A;  2DTR A;  3BTL A;  2XAH A;  2Y69 H;  3VOD A;  1K83 J;  1JKP C;  2DOF A;  1FEX A;  5LEK A;  2W4S A;  3F8C A;  4LFU A;  3RKW A;  2WBM A;  4XLP F;  2XSD C;  4AYB N;  2IS2 A;  2GA1 A;  3FZV A;  1HW2 A;  4CCJ A;  2DT5 A;  2EFO A;  3OR1 C;  1N25 A;  2A61 A;  1Q1V A;  3HTU A;  3IV5 A;  2VPR A;  2LMD A;  3DPU A;  3LSM A;  4ENM A;  3NEU A;  2JSC A;  3GW2 A;  4G12 A;  4A12 A;  3KYD B;  2DYR H;  3LSH A;  3PM1 A;  3LL7 A;  4HF1 A;  1Z21 A;  1DUX C;  4B43 A;  3CD6 I;  4A3D J;  2DA7 A;  2VAS A;  1KZH A;  4A3C J;  4CCO A;  1IRG A;  1W0U A;  3BTC A;  1IF1 A;  4MNU A;  4CXF A;  3MKY B;  1SD5 A;  2DQR A;  2FJ1 A;  1ODD A;  2LY2 A;  3CJR B;  4UHT A;  1BI1 A;  3B73 A;  2IA2 A;  4JP0 A;  5K7Z A;  3LSJ A;  3O2P E;  3J7A Y;  5FRN A;  4YIF A;  2F5C A;  1P7J A;  2CJJ A;  5C44 J;  3GTM J;  5CQG A;  4J19 A;  1BR2 A;  3H92 A;  3I71 A;  2EZK A;  3RKQ A;  3JRG A;  2X6O A;  3COA C;  4AID A;  1DU6 A;  1ETO A;  1SAU A;  5HVQ C;  2PMZ A;  3V7C A;  2DA3 A;  4BL0 B;  4A0Y A;  2VPL A;  3WHB A;  3OL3 A;  1FBU A;  2R5Z A;  3RZD J;  3K10 A;  1R58 A;  2AXT C;  3H9J A;  1U5T A;  2QCO A;  3WU1 B;  3WE2 A;  3M8E A;  3S3M A;  5CKT A;  1P4A A;  2M4K A;  3LMM A;  1ETV A;  2CH0 A;  1HOM A;  3I64 A;  4ZDP A;  3RI4 A;  2DPU A;  2DDA A;  2BV6 A;  5ICF A;  4A3K J;  2A69 F;  1ON2 A;  1PYV A;  5J40 A;  5DM6 F;  2MC3 A;  5HDN A;  2CQ7 A;  4CDG A;  3HYI A;  1MNM C;  1MW7 A;  4MQV A;  2E7X A;  2ZFW A;  3GVA A;  4N9I A;  3KE2 A;  3SDB A;  3E5U A;  4C2M J;  4DW6 A;  4EGY A;  2DAO A;  2EBI A;  3CF2 A;  3GYH X;  3CDI A;  4A0Z A;  2E1M B;  3K2Z A;  3T5X A;  5LHI A;  3K4N A;  3M4O J;  2CUJ A;  2OU2 A;  3VPR A;  1H8A C;  3G1O A;  2HDW A;  1PUF A;  4N0B A;  3E5X A;  3KLO A;  1K78 A;  1AKH A;  6PAX A;  3RDI A;  3H9G A;  1YRN B;  2BY3 A;  1VQM I;  2ZO4 A;  1MMS A;  3HSF A;  1UHW A;  4OAZ A;  1JUS A;  2ICW G;  2M7A A;  5L3F A;  3JRE A;  3ZGK A;  2P5L C;  2LF8 A;  4DYQ A;  2CGP A;  2LBF A;  4XLF A;  1G6N A;  2BHZ A;  3SQN A;  2VI6 A;  5LRS A;  1QBJ A;  2DOA A;  3ASO H;  1QRY A;  2MC4 A;  2WC2 A;  2DFE A;  4ZH4 F;  1LVK A;  1MKM A;  3HKZ N;  3SYT A;  1FT9 A;  1KU3 A;  2HR3 A;  3T1B A;  5J1R A;  5A2Q Z;  1U0J A;  1R23 A;  2XKO A;  1YS7 A;  5M3M J;  3K70 C;  4BY1 J;  1PP7 U;  2DMT A;  2K27 A;  3CDL A;  5LRR A;  2AQE A;  1WWX A;  5BMZ A;  1BC8 C;  2VT3 A;  3KP5 A;  2PMU A;  3G71 I;  1X19 A;  3BCA A;  5E3L A;  3TMO A;  2LLK A;  2ZXH A;  2O7O A;  2AHQ A;  2FF4 A;  4CZZ A;  2K85 A;  3ML6 A;  2K3P A;  3ZQ7 A;  2JVG A;  3A1Y A;  1FMV A;  2HQR A;  1BBY A;  1IDZ A;  3E3V A;  3A02 A;  1WFX A;  3WTW C;  2F5V A;  1B4A A;  4HNU A;  3A2K A;  2ID6 A;  2DA1 A;  4FQG A;  1X1B A;  1YO5 C;  1ZK8 A;  2NVU B;  1ZRE A;  1BJZ A;  1ZKG A;  1QNT A;  3BG6 A;  2FEZ A;  1R5H A;  2KPM A;  1ZGA A;  3BDD A;  3GTJ J;  2P5V A;  2EZI A;  2HOA A;  4NC7 A;  3I59 A;  4E7H A;  3Q5F A;  2QQ8 A;  3QYB A;  4J01 A;  2CRG A;  5H6R A;  2DJI A;  2HZT A;  3TO6 A;  3ZQL A;  3I9V 2;  2LF7 A;  3GF2 A;  1QZZ A;  3DLA A;  5H20 A;  1EH6 A;  2EJR A;  3OIQ A;  2WAE A;  2R5Y B;  5M5W J;  1UZC A;  2LC2 A;  5AIP A;  1VQ5 I;  3TDZ C;  2WTE A;  3DKY A;  4XID A;  3A03 A;  1E3P A;  3ONQ A;  4GRI A;  1XN7 A;  1Z3Y A;  3ESW B;  4RGS A;  3M07 A;  4EMS A;  2HWV A;  2KP6 A;  3MCZ A;  3QOP A;  5IP7 J;  3HHH A;  2JRT A;  3HRT A;  3V8L A;  1LEB A;  3QPS A;  3WTX C;  3JSO A;  4IOA F;  4E7K A;  5KK1 A;  5HLT A;  3PIO F;  2HOT A;  3DWL E;  3HDD A;  4M9X A;  3PUF A;  1E2X A;  5KCM A;  2ZKZ A;  1YTY A;  1SFE A;  3P5J A;  4RB1 A;  5JVG F;  1IXR C;  5AON A;  2STW A;  1MMA A;  1B72 A;  2EA2 A;  1YX5 A;  1XGN A;  4CHU A;  1JT0 A;  4IXA A;  3BPV A;  3OR2 C;  1J7K A;  3C1D A;  2UZK A;  1MBG A;  3JTG A;  2NOJ B;  2GAU A;  5DDG A;  3S17 J;  1S7A A;  4OIO F;  1XMX A;  1W0T A;  1TBX A;  3LSI A;  1JE8 A;  1W36 D;  3M1E A;  1BJA A;  3IAM 2;  2F2E A;  1WH5 A;  2QBY A;  1F36 A;  1HKS A;  1OYW A;  3LA2 A;  1IN4 A;  2VQG A;  4LG3 A;  1XS9 A;  1QA6 A;  1Z7U A;  4HX4 A;  5LGU A;  5E17 F;  2VIX A;  1WJA A;  5JHF A;  1J5Y A;  1FOK A;  1F43 A;  3T8T A;  2FRH A;  2VBW A;  1T8I A;  2W84 A;  2O03 A;  4AC0 A;  3IRQ A;  2VKV A;  1GVD A;  4GYI A;  2MG4 A;  4KIS A;  4I02 A;  2E1O A;  1UEL B;  3KET A;  3GLX A;  3P9C A;  3TQN A;  4LGW A;  2DMQ A;  1TNS A;  3CCE I;  3Q3S A;  4G94 A;  2V79 A;  2DFI A;  2UUZ A;  4EEF G;  2ELJ A;  3H5R A;  1S7E A;  4YEJ A;  4MTE A;  2AXL A;  4UVC A;  2VL8 A;  4XLN F;  3LSK A;  5H6Q A;  1XGO A;  4WWC A;  2E5Z A;  5M5X J;  1PDN C;  4L0Z B;  1W7P A;  2QQA A;  4E7Z A;  1ZAO A;  3DKW A;  1ULY A;  3D0S A;  3FMQ A;  1USS A;  3BWG A;  2ZXJ A;  3R6S A;  4E6K G;  5F1R A;  5EEA A;  4R8H A;  5CYV A;  1B6A A;  2CV0 A;  2VOD A;  2EIK H;  1R5I D;  4HZF A;  4C3I J;  2IS4 A;  5LD2 C;  2X4H A;  1ETQ A;  1FNN A;  2ELK A;  4PFP A;  3BG5 A;  3DBH B;  1ZEL A;  1I1G A;  2Z16 A;  1E3H A;  4WF2 A;  4BH9 A;  5C4X J;  3ZQI A;  1R1U A;  2BZT A;  3A4C A;  3F8F A;  3GCM A;  2M5W A;  1HBX G;  3LA3 A;  3OYE A;  4XK4 A;  2H94 A;  2E60 A;  2KL4 A;  1GLN A;  3E6C C;  2JA7 J;  3KP2 A;  1R36 A;  1QQI A;  2QQB A;  1HW5 A;  3AG2 H;  2H6C A;  3WTY C;  2EIN H;  2CQN A;  3SFI A;  2K9N A;  3WTZ A;  1JKO C;  4KA4 A;  4OIR F;  1U5T B;  2ZC2 A;  5LHH A;  2LKP A;  4Y17 A;  1J75 A;  4KT5 C;  4BYY A;  1R6R A;  1UHM A;  1FJL A;  2EK5 A;  3SFZ A;  4LJZ F;  4EVI A;  3OYM A;  1P4X A;  4C2T A;  3NWS A;  3RKY A;  2OD5 A;  4C3J J;  2JWT A;  3H0D A;  3FXL A;  1ZG1 A;  2E2I J;  2QSG X;  2K40 A;  3KP3 A;  1XMK A;  1WVR A;  3ROU A;  5HS7 A;  2HVS A;  4Q5S F;  3F6V A;  3OS0 A;  5HDK A;  2MLK A;  2PX9 A;  1DU0 A;  2EH3 A;  2Y0M A;  1K78 B;  1AKH B;  1OCC H;  2L4M A;  2FX0 A;  3OYG A;  2DA4 A;  4ZYG A;  4ZC3 A;  4BE1 A;  5FGM A;  4BQQ A;  3QYE A;  1ON1 A;  2LBF B;  1S7O A;  2D45 A;  3I54 A;  1FY7 A;  4M9S A;  2F5D A;  4LIT A;  1YHQ I;  1HXD A;  3EUH A;  5J8C A;  2MGQ A;  4GYG A;  4A93 J;  5EDN A;  2Q0O A;  2JUG A;  3LOC A;  1YJW I;  1IN5 A;  1V3F A;  1S29 A;  1Y1W J;  2KLO A;  3MEX A;  4AUX A;  3I56 I;  4Q48 A;  3RSN A;  1C0W A;  2P81 A;  4GO1 A;  4DQ2 A;  4HDV A;  1R5G A;  2R7U A;  3MWM A;  2OV7 A;  3OV8 A;  3BJ6 A;  3G4S I;  1YJ9 I;  5B1A H;  1TWH J;  5ICC A;  5BPD A;  3OS2 A;  2NOG A;  1Z6R A;  4JQF A;  5FLX K;  5KAI C;  1LQ1 A;  1Y0N A;  2HVR A;  1A6I A;  1AA7 A;  4ENK A;  4EJW A;  1VQK I;  3UR3 C;  4U7B A;  2XRN A;  1VFC A;  1IG7 A;  1MSF C;  3BP8 A;  2K5C A;  1ORK A;  2H1L A;  3FHN A;  4BXF A;  4BE2 A;  4I2O A;  2JRM A;  2XVC A;  4NBQ A;  3IH3 A;  3IWF A;  3S32 A;  3BG7 A;  1T0F A;  4KDP A;  1YOV B;  5HLI A;  4C3H J;  2TCT A;  5A2Q K;  3JSP A;  1VQO I;  1P6R A;  1IJW C;  3CCL I;  1H9G A;  4E7L A;  3IKV A;  3WHC A;  2OTJ I;  4CYD A;  1DP3 A;  1PJR A;  2TDX A;  5DCF A;  3EYI A;  5DM7 F;  4X1E A;  3H5N A;  2Z33 A;  1B1B A;  1ETX A;  1D5Y A;  2RQQ A;  4KMF A;  2KRF A;  2EB7 A;  1T33 A;  4HG2 A;  2DN0 A;  2GXB A;  1V5G A;  3D5L A;  1KU2 A;  2L7M P;  3CME I;  1EH8 A;  1FYK A;  4EAT A;  2C6Y A;  3F0C A;  4I0B A;  1JGG A;  2FBH A;  4I98 B;  3ZMS A;  4PDK A;  2KJB A;  2FMY A;  3J81 K;  1Z0X A;  3HL2 A;  1EA3 A;  1FTZ A;  2XAF A;  3EQL F;  2E1N A;  2WAQ N;  3ABL H;  5HS9 A;  2OUM A;  2E2H J;  5M3F J;  1LDD A;  2IP2 A;  4CUG A;  3CMA I;  3BZC A;  2ZCW A;  1SAN A;  3MZY A;  1K7A A;  2E7W A;  3CCJ I;  2XGE A;  5FLM J;  4L5J A;  2UV1 A;  4B3X A;  3K1P A;  4BXU A;  2RKH A;  4LB6 B;  2NS0 A;  3F8N A;  2GBY A;  3J7Z I;  4FE4 A;  1X3Z B;  1B72 B;  3DF8 A;  4XOT A;  2DYS H;  3E97 A;  4XKW A;  1DQU A;  5J1Y A;  4BBS J;  3DLL F;  4MEX F;  2V7F A;  3TW7 A;  4AM3 A;  4C9Y A;  5D5X B;  4CYC A;  1UST A;  1Y39 A;  3CO7 C;  5IT3 A;  4IQJ A;  4XL9 A;  2R92 J;  3CP8 A;  1CF7 A;  1TQP A;  2W1O A;  1FBS A;  5LFA A;  4KUM A;  4ZDO A;  1WJ5 A;  1W36 C;  1U78 A;  3BR6 A;  3QU3 A;  2X48 A;  5C4J J;  2Q8K A;  3F21 A;  2VT2 A;  2RNJ A;  2VC0 A;  1R1T A;  4MIM A;  4HV6 A;  4JBA A;  5E20 A;  4IVN A;  2JZY A;  2O5R A;  3QPT A;  4ASN A;  1HKQ A;  3P7N A;  4ZYA A;  4I0A A;  2RV8 A;  2DMU A;  5F04 A;  1EH7 A;  2M45 A;  3OYF A;  2ZME B;  3F23 A;  2YSR A;  1U9N A;  3FMR A;  3GUD A;  3CC2 I;  2MLG A;  2XC7 A;  2BXY A;  4H0E A;  1MMN A;  3HSE A;  1SFX A;  1ETY A;  1KU9 A;  3DU6 A;  2NXN B;  2L9V A;  1TWA J;  3B6A A;  3D5R C;  3HUG B;  2VJ4 A;  3VEP A;  1IV8 A;  1HF0 A;  2XSJ C;  3IP4 B;  2JQ7 A;  3FXQ A;  1TQM A;  1ZTR A;  2M34 A;  3HZJ A;  4PCQ A;  4LG0 A;  2UXN A;  2DU9 A;  5BS6 A;  3HG9 A;  4OOI A;  5DUK A;  2E34 A;  5B3S H;  4G8X A;  1VQL I;  5K5Q A;  5JVT A;  3DEE A;  4OWR B;  5F0H A;  5IYC J;  2W24 A;  3TL4 X;  3O8G A;  4IX7 A;  3QPH A;  1MSE C;  2EFN A;  4HEA 2;  2H1K A;  3QPL A;  3BQZ A;  2ETH A;  1D0Y A;  2EFQ A;  2JJ7 A;  4CA0 A;  2R5Y A;  2YU3 A;  3RIR A;  2YPR A;  1V5E A;  2BOL A;  1BI2 A;  4CSW A;  2QGU A;  3AG3 H;  1W7P D;  3PQJ A;  4E7J A;  1YIO A;  1DPR A;  3N4M A;  2K9M A;  2IGM A;  2LY1 A;  1JXS A;  2DFF A;  4LK1 F;  4UUS A;  3VWB A;  2W85 A;  3E6B A;  5DUI A;  3A01 B;  4KT6 A;  2EZH A;  5FRM A;  1VQ7 I;  1B8I B;  4DZP A;  4S04 A;  1FOX A;  4D7M A;  3K4J A;  2BYV E;  3TGN A;  2YX4 A;  4B48 A;  1MDM A;  3RJP A;  1I3Q J;  2IRF G;  3HHG A;  1LJ9 A;  2NVX J;  2QYO A;  1G2H A;  3MFK A;  3HOU J;  4M3E A;  5AIQ A;  2JSP A;  5HNH A;  1OR7 A;  3L2V A;  5HOO A;  2FE3 A;  2M1B A;  2IGN A;  4LD5 A;  3U1K A;  2R7Q A;  2A07 F;  1T98 A;  2L2O A;  4QSH A;  3HOV J;  4B44 A;  5ILS A;  1MZB A;  1JI8 A;  4P1W A;  2ELH A;  3PO2 J;  1G4D A;  1FP1 D;  4EJU A;  4IRG A;  1IC8 A;  3E7L A;  2EPF A;  1D0Z A;  3TOB A;  2IEK A;  1TW2 A;  2P7V B;  3GZN B;  4A2U A;  2EA4 A;  4Q4Z F;  2JA2 A;  1OCR H;  3IL2 A;  2B7E A;  5FB2 A;  2NNY A;  3MZ8 A;  3WOD F;  2K9Q A;  2HOE A;  2XF7 A;  1FTT A;  4D1Q A;  4HBL A;  3I5U A;  5TRD A;  2JMW A;  4W97 A;  5ILV A;  3PL8 A;  4L9N A;  1NK3 P;  5E3O A;  2RVC A;  2K02 A;  1TWF J;  2DMP A;  2HQ5 A;  2NVQ J;  1S6L A;  1DGR M;  2GQQ A;  4M3B A;  1Z7L A;  3CLO A;  4F3Q A;  2LH9 A;  3SZG A;  1O3Q A;  1ZLJ A;  1QHH D;  4GGG A;  5ERI A;  4L9V A;  3AG4 H;  2EQR A;  4ITV A;  3WTV C;  2VQL A;  2BY2 A;  3TKY A;  3CF5 F;  1U3E M;  4A3B J;  1XPX A;  3MKZ A;  3BPX A;  3E6D A;  3OY9 A;  2WWY A;  3HOX J;  5J1U A;  2EWN A;  3CUQ A;  2VKE A;  5LGN A;  4D5F A;  4EJT A;  2GM4 A;  3TOA A;  3MZH A;  4IPA A;  2EIJ H;  2QEX I;  4AYB A;  2EIM H; 
#chains in the Genus database with same CATH homology
 3R61 A;  5CLS A;  4KIG A;  3GWZ A;  4KN7 X;  4XSZ F;  4IRI A;  4L0Y B;  5FO5 A;  3IHU A;  2PQ8 A;  3LQR A;  4P96 A;  3DV8 A;  3GZ6 A;  1IXC A;  3HOS A;  1UCR A;  5JHU A;  3PQK A;  3C18 A;  5CVV A;  5DV5 A;  2G7U A;  4IRH A;  1JHF A;  3TO9 A;  3DPT A;  1NHA A;  2GXG A;  2O61 A;  2K4J A;  3DPL C;  2XKP A;  1HKT A;  2JPC A;  1BN5 A;  3J80 K;  2V1U A;  1G3W A;  1YYV A;  2Z99 A;  4IHS A;  3ERE D;  3M9A A;  1E17 A;  2BBY A;  4DNC A;  3KCC A;  4M6Y A;  5HS8 A;  2FML A;  3IKT A;  5FLX Z;  1CF7 B;  3WTT C;  5E8G A;  3F22 A;  1BM9 A;  5E18 F;  1ZHF A;  4G6D A;  3ZMZ A;  1XGM A;  3SZT A;  2HS5 A;  1A04 A;  1FWZ A;  3WG9 A;  3BJO A;  3R0A A;  3WGG A;  3FWE A;  3FXU A;  2CWE A;  4Q47 A;  1LNW A;  2H6B A;  3FF5 A;  2KJC A;  1FSH A;  1K79 A;  5TJJ A;  3BY6 A;  3I58 A;  1YQA A;  4PGH A;  1J59 A;  1JGS A;  2XV4 S;  1O3R A;  3J81 Z;  1TQI A;  4LG0 B;  3KP7 A;  2XAJ A;  4B8X A;  4WCG A;  1VTN C;  2F5F A;  5CVI A;  1W4M A;  2LDU A;  2MD5 A;  2RDP A;  4HDU A;  3F72 A;  1OYI A;  3FMS A;  4ESJ A;  2DBB A;  1I6X A;  1H0M A;  3O3K A;  4I09 A;  4UNO A;  2QVO A;  2O3F A;  1OMI A;  2Y48 A;  3CJN A;  1WI9 A;  1MDM B;  3U2R A;  2P6T A;  5L3C A;  2CO5 A;  1QZY A;  4YG2 F;  3ECH A;  5LGT A;  4ZZD A;  2J5O A;  3W6J B;  4BHP A;  3FX3 A;  3C7J A;  2KIU A;  3RKX A;  1RZ4 A;  3R60 A;  2D1H A;  3LWF A;  4Y13 A;  2L3D A;  5ED4 A;  3SHF A;  3REO A;  3P9I A;  3JTH A;  4PZJ A;  1DPU A;  3WTU C;  4BNC A;  2RQP A;  4R79 A;  3ELK A;  4AVP A;  5BQT A;  2MH2 A;  2JPB A;  2ZME A;  1RI7 A;  5D6F A;  3R0J A;  1FBQ A;  4EM0 B;  3LST A;  2FU4 A;  1F9N A;  2FOK A;  3HUG A;  5BPI A;  3FM3 A;  4ESB A;  4P9U A;  3E6M A;  2MH9 A;  3CUQ B;  4O3M A;  2KIF A;  2QM3 A;  3GO5 A;  2ZJ2 A;  1F4K A;  2FNA A;  2P6S A;  4UUV A;  1D8K A;  2K7L A;  3O6B B;  3VB2 A;  1G3T A;  2K86 A;  5E1W A;  4F7Z A;  1YS6 A;  4HA8 A;  2EV5 A;  4RAZ A;  3ZN1 A;  4S05 A;  2D2W A;  5HLH A;  2P5K A;  2VBZ A;  3B02 A;  5D5U B;  2P7C B;  2HTJ A;  4CGZ A;  3I0T A;  2D1V A;  2BEO A;  3EDP A;  4OU0 A;  2WV0 A;  3U9G A;  1ZG5 A;  3FHZ A;  2G9W A;  5KVR A;  1YG2 A;  1Z9C A;  1BOA A;  2CFX A;  4OIP F;  4YII A;  2ISZ A;  1YLF A;  4AD9 A;  3QAH A;  2ZNY A;  5F6F A;  1S3J A;  2CYY A;  2HTS A;  2HKO A;  1WKM A;  4FT8 A;  2MBF A;  2GIV A;  5FFZ A;  5CVJ A;  4AIJ A;  3ZMT A;  3KFW X;  5D4S A;  3ABU A;  3ABT A;  1MJB A;  3KP6 A;  4RB3 C;  2XHK A;  3WU0 A;  1BI0 A;  4WXC A;  5D8L B;  2UXX A;  1JHH A;  2IPQ X;  4D0P A;  5JI6 A;  4CO8 A;  2GA2 A;  1Q1H A;  3U1D A;  1G3Y A;  4RGR A;  4UV9 A;  1R00 A;  4A6E A;  4UVA A;  3P9K A;  4EJO A;  1RUO A;  2CG4 A;  5CVU A;  3WE3 A;  5E8I A;  1IZ1 A;  1KU7 A;  3K9T A;  2R7F A;  3KLN A;  1WSU A;  1HQC A;  2CQK A;  2YR2 A;  3J80 Z;  2STT A;  2DPD A;  2DK5 A;  4BHB A;  2A68 F;  4G7Z F;  2BGC A;  1CGP A;  2VC1 A;  2FA5 A;  4KFC A;  4MTD A;  3GXO A;  1O7L A;  3V8K A;  1W5S A;  2VXZ A;  4FX0 A;  2VON A;  4XBF A;  1J2X A;  2PJP A;  3IWZ A;  3KP4 A;  1YW7 A;  3CO6 C;  1TW3 A;  2FQ3 A;  2GWR A;  2R3S A;  2PLY A;  3G73 A;  1K6O A;  3K1N A;  5D4R A;  2FNP A;  1PP8 F;  4IJA A;  1XD7 A;  1KA8 A;  4L9J A;  3RTR A;  4HQM A;  2DLL A;  1STZ A;  3GFJ A;  4KYW A;  1SAX A;  1YW9 A;  3WGI A;  4NHJ A;  5E1Z B;  2V6C A;  1LVA A;  2ZNZ A;  1KQ8 A;  3WGH A;  5D5W B;  1Z6T A;  4EM1 A;  2QQ9 A;  3MAJ A;  3DEU A;  4R1H A;  2ADU A;  4Y15 A;  1F1Z A;  3LFK A;  2R7D A;  2O8X A;  1Z1D A;  3CDH A;  4WXH A;  3SZP A;  2XAS A;  3V4G A;  1OYY A;  3S2W A;  1J9I A;  3HIF A;  4UV8 A;  1Z05 A;  1SD7 A;  3Q9S A;  3HRM A;  2VOP A;  1R22 A;  2IVM A;  3OOP A;  2DI3 A;  3J7A O;  4AIH A;  4NQW A;  1YW8 A;  2A6H F;  2DQL A;  2Z9O A;  4TV7 A;  2FBK A;  3EET A;  1MJA A;  3BOQ A;  5EEG A;  1D5V A;  3DFG A;  1WRJ A;  4KIC A;  1UFM A;  3LQQ A;  2W25 A;  1FP2 A;  1XCV A;  4HYE A;  1MGT A;  2Y75 A;  2BE5 F;  3WTS C;  3RPU A;  4U0W A;  2VN2 A;  5DD8 A;  4LB5 A;  2OZ6 A;  3V8J A;  1MD0 A;  4AIK A;  1G3S A;  1U5T C;  2HYF A;  1GXQ A;  3HTS B;  1FSE A;  2IA1 A;  3RYR A;  3HRU A;  5DD4 A;  4RB2 C;  2ESN A;  4KN4 X;  4XSX F;  1XSD A;  1LEA A;  1J0R A;  2A3S A;  5LBQ A;  5L3D A;  2NYX A;  1L0O C;  2VBX A;  4KIB A;  2PG4 A;  3BJA A;  4HX8 A;  4AWX B;  1D8J A;  1EV7 A;  3LA7 A;  1FZP B;  4ENN A;  4MQ9 F;  2HKX A;  2YX7 A;  4BAY A;  3I53 A;  4ZYD A;  2UWM A;  5E1X A;  3QP5 A;  1BC7 C;  1T2K A;  2PI0 A;  4HLY A;  3PFI A;  4LMY A;  4RGX A;  3M8F A;  2EV6 A;  4CIC A;  2XRO A;  5BOX A;  4HF0 A;  2XIG A;  1LDK B;  2JTV A;  1O57 A;  3AAF A;  4MHG A;  3DP7 A;  3RPQ A;  1IN7 A;  4P5O A;  3L2C A;  2L01 A;  1IUY A;  3RYP A;  4IHT A;  4HX7 A;  3JAM K;  2FBI A;  2CW0 F;  2PEX A;  5CJ9 A;  1YFH A;  1F5T A;  1ZRF A;  4U7D A;  2A5Y B;  4G6Q A;  2X0L A;  1U8R A;  1I27 A;  1ZH5 A;  1IAW A;  1ZYR F;  2QLZ A;  2VBY A;  1GHC A;  2RGV A;  5FD5 A;  4BHC A;  1REP C;  3FM5 A;  4GCV A;  1T38 A;  1LB2 A;  4JK1 X;  1HW1 A;  5J8F A;  2HGC A;  3M7G A;  1LDJ A;  4HV5 A;  1T6S A;  4M72 A;  3GX4 X;  2IA0 A;  3QU6 A;  4U0V A;  3ZMU A;  3F6O A;  1MJ9 A;  3ZP5 A;  5JFR A;  2HEO A;  3ZN0 A;  2M8E A;  4HOB A;  1ZAR A;  2ZBK A;  4I01 A;  5K5O A;  3BZ6 A;  5HDG A;  4OIQ F;  1H9T A;  1FC3 A;  2NAZ A;  4O6J A;  1O7F A;  1T39 A;  4PGG A;  1XDU A;  1IN6 A;  1TNT A;  3K1M A;  2M87 A;  3HRS A;  5K1Y A;  4U0Y A;  1B9M A;  1TLH B;  1FYM A;  3TDU C;  1KGS A;  5DCM B;  1PUE E;  4HQE A;  4HW0 A;  1I5Z A;  4LLN A;  1P92 A;  1U6G A;  3W6K B;  1IXS B;  4HF2 A;  3F3X A;  5LEJ A;  2V1X A;  2GZW A;  5D5V B;  2OQG A;  2Z3Y A;  2RN7 A;  3SXY A;  4OIN F;  4GXO A;  1ONV A;  4ESF A;  1XCB A;  3KEQ A;  4A5M A;  3CUO A;  5D8K B;  2HDC A;  4OMY A;  3LAP A;  5IT9 Z;  1QO0 D;  4G9Y A;  3KZY A;  4MEY F;  1X3U A;  4A6D A;  2QWW A;  5L3B A;  1XSV A;  3N97 A;  1HST A;  2QUF A;  3GFL A;  2PBI A;  1HSJ A;  4P9F A;  1BIA A;  3QRF F;  4KIF A;  4QLC U;  3LAJ A;  4M71 A;  4IF4 A;  1B9N A;  4MGR A;  3ULQ B;  2HFH A;  1FPQ A;  2OQR A;  4RS8 A;  1R7J A;  4ZYH A;  5D6E A;  1SMY F;  1WQ2 A;  4M74 A;  2XGX A;  4EJV A;  1IW7 F;  3L7W A;  2KKO A;  1UB9 A;  1DDN A;  1GVJ A;  2DO7 A;  2E1C A;  4YFK F;  1TTY A;  2KIM A;  4OMZ A;  2OBP A;  5CVR A;  1Y0U A;  4Z2Y A;  1U2W A;  5JR3 A;  2M30 A;  4YFN F;  2MA3 A;  2ACJ A;  4EM2 A;  1R1V A;  4ZZL A;  2H09 A;  1FX7 A;  1XMA A;  4ON0 A;  3DXJ F;  2XAQ A;  2RC4 A;  3K69 A;  4I7H A;  3T8R A;  2OAZ A;  1IRF A;  3NQO A;  5FD6 A;  1SFU A;  3FXR A;  3F8B A;  1XDS A;  3HSR A;  2FSW A;  4U88 A;  2L54 A;  4HLX A;  5K5R A;  1ZG3 A;  2IW5 A;  4FHT A;  5L3E A;  2W57 A;  4LK0 F;  3Q9V A;  3JW4 A;  4UVB A;  1ZRC A;  4P55 A;  2O0Y A;  2VOO A;  4A0X A;  4WXD A;  1RNL A;  2QZ8 A;  2AS5 F;  4EGZ A;  5F64 A;  3ZPL A;  3ISP A;  3GEZ A;  1BIB A;  4M73 A;  1KQ9 A;  4L18 B;  2CSO A;  3ECO A;  3GFI A;  1ZN2 A;  1D3Y A;  2V1D A;  4WK8 F;  4UXN A;  1ZGJ A;  2EFW A;  3VOE A;  3JAM Z;  1OPC A;  2IT0 A;  3G3Z A;  1QGP A;  2LNB A;  2HQN A;  3CTA A;  4G7O F;  3L09 A;  4RGU A;  1ZRD A;  5HLG A;  2EV0 A;  3KZZ A;  4HAM A;  2B0L A;  3I59 B;  2DW4 A;  1P4W A;  3BRO A;  2F5E A;  3L00 A;  4WX9 A;  3C3W A;  2A6E F;  2HYG D;  4ENJ A;  3F8M A;  4L5I A;  4B09 A;  3T0Y A;  3TO7 A;  3HOT A;  2JT1 A;  1W5T A;  4XRF A;  3ZMD A;  2G7H A;  1L3L A;  2IJL A;  3I4P A;  3E5Q A;  1RUN A;  5LLQ A;  1FLI A;  4EQQ A;  1XB4 A;  1DP7 P;  3L9F A;  2QEN A;  4NB5 A;  3IRR A;  2ESH A;  2VE9 A;  2ISY A;  3ZMV A;  4LLG F;  2OZU A;  3GZ5 A;  3H3Z A;  1ZLK A;  4M6X A;  2QBY B;  1V4R A;  4RB0 A;  5FFX A;  1I1S A;  1S8N A;  2PMH A;  2P4W A;  4M9Z A;  5IT9 K;  4E70 A;  3K0L A;  2LSO A;  2J5P A;  2OA4 A;  4LLL A;  2P8T A;  2VE8 A;  5L3G A;  3QP6 A;  5DCM A;  2Q2E A;  2O6G E;  3NRV A;  2NRA C;  4KMU X;  2PFB A;  4K2E A;  2Z5U A;  1P2F A;  1W7P B;  1B59 A;  1AWC A;  4FX4 A;  1RIO H;  5DEQ A;  3EYY A;  3CUQ C;  1SD6 A;  2L02 A;  4O5V A;  4ZYE A;  1FYL A;  1SMT A;  1SD4 A;  1XGS A;  3KEO A;  5DYM A;  2XAG A;  2L4A A;  1OKR A;  4KNY A;  4ETS A;  4L9T A;  1QPM A;  5LHG A;  2EFP A;  2NNN A;  3R4K A;  2XUB A;  3DQV C;  4N9H A;  3V7S A;  5ILU A;  3IC7 A;  3VFZ A;  1O3S A;  2H27 A;  3GFM A;  1KYZ A;  5ICG A;  1KQ0 A;  1XSX A;  2DK8 A;  5ICE A;  2COM A;  4A5N A;  1Z91 A;  4YFX F;  4G7H F;  3MQ0 A;  1GXP A;  2K4B A;  1KYW A;  2PN6 A;  3H3U A;  4RAY A;  1O3T A;  2FXA A;  4EV0 A;  2V9V A;  5J6X A;  4BQA A;  1AOY A;  3V7R A;  4QWQ A;  5EEH A;  1IN8 A;  1BI3 A;  2DTR A;  2XAH A;  3VOD A;  5LEK A;  3F8C A;  4LFU A;  3RKW A;  4XLP F;  2GA1 A;  3FZV A;  1HW2 A;  2DT5 A;  2EFO A;  2A61 A;  3HTU A;  4ENM A;  3NEU A;  2JSC A;  3GW2 A;  4A12 A;  4HF1 A;  1DUX C;  1IRG A;  1IF1 A;  4MNU A;  4CXF A;  1SD5 A;  2DQR A;  1ODD A;  4UHT A;  1BI1 A;  3B73 A;  2IA2 A;  3O2P E;  4YIF A;  2F5C A;  3H92 A;  3I71 A;  3COA C;  5HVQ C;  3V7C A;  4A0Y A;  1FBU A;  1R58 A;  1U5T A;  3WU1 B;  3WE2 A;  3M8E A;  1P4A A;  3I64 A;  3RI4 A;  2DPU A;  2BV6 A;  5ICF A;  2A69 F;  1ON2 A;  2MC3 A;  5HDN A;  4CDG A;  3HYI A;  4MQV A;  2E7X A;  2ZFW A;  3GVA A;  4N9I A;  3KE2 A;  4EGY A;  3E5U A;  2DAO A;  3GYH X;  4A0Z A;  3K2Z A;  3T5X A;  5LHI A;  2OU2 A;  4N0B A;  3E5X A;  3KLO A;  1K78 A;  6PAX A;  3RDI A;  2ZO4 A;  3HSF A;  1UHW A;  5L3F A;  2P5L C;  2LF8 A;  2CGP A;  1G6N A;  3SQN A;  5LRS A;  1QBJ A;  2WC2 A;  4ZH4 F;  1MKM A;  1FT9 A;  1KU3 A;  2HR3 A;  3T1B A;  5A2Q Z;  1R23 A;  2XKO A;  1YS7 A;  1PP7 U;  2K27 A;  5LRR A;  1WWX A;  5BMZ A;  1BC8 C;  2VT3 A;  3KP5 A;  2PMU A;  2FF4 A;  4CZZ A;  3ML6 A;  3ZQ7 A;  2HQR A;  1BBY A;  3E3V A;  3WTW C;  1B4A A;  1YO5 C;  1ZRE A;  1QNT A;  2FEZ A;  1R5H A;  3BDD A;  1ZGA A;  2P5V A;  3I59 A;  3Q5F A;  5H6R A;  2HZT A;  3TO6 A;  2LF7 A;  3GF2 A;  1QZZ A;  5H20 A;  1EH6 A;  2EJR A;  5AIP A;  3TDZ C;  2WTE A;  1XN7 A;  4RGS A;  4EMS A;  2HWV A;  3MCZ A;  3QOP A;  3HHH A;  2JRT A;  3HRT A;  3V8L A;  1LEB A;  3WTX C;  3JSO A;  5KK1 A;  4M9X A;  1E2X A;  2ZKZ A;  1YTY A;  1SFE A;  4RB1 A;  1IXR C;  5AON A;  2STW A;  2EA2 A;  1XGN A;  4CHU A;  4IXA A;  3BPV A;  1J7K A;  3C1D A;  2UZK A;  3JTG A;  2GAU A;  5DDG A;  1S7A A;  4OIO F;  1TBX A;  1JE8 A;  3M1E A;  1BJA A;  2F2E A;  2QBY A;  1HKS A;  1OYW A;  3LA2 A;  1IN4 A;  1Z7U A;  4HX4 A;  5LGU A;  5E17 F;  1FOK A;  1J5Y A;  3T8T A;  2FRH A;  2VBW A;  2W84 A;  2O03 A;  3IRQ A;  4GYI A;  4I02 A;  3KET A;  3GLX A;  3P9C A;  3TQN A;  4LGW A;  1TNS A;  4G94 A;  2V79 A;  2DFI A;  4MTE A;  2AXL A;  4UVC A;  4XLN F;  5H6Q A;  1XGO A;  4WWC A;  1PDN C;  4L0Z B;  1W7P A;  2QQA A;  1ZAO A;  3DKW A;  1ULY A;  3D0S A;  3FMQ A;  1USS A;  3BWG A;  2ZXJ A;  3R6S A;  5F1R A;  4R8H A;  5CYV A;  1B6A A;  2VOD A;  4HZF A;  2X4H A;  1FNN A;  1I1G A;  4WF2 A;  4BH9 A;  1R1U A;  3F8F A;  2M5W A;  1HBX G;  3LA3 A;  2H94 A;  3E6C C;  3KP2 A;  1R36 A;  1QQI A;  2QQB A;  1HW5 A;  2H6C A;  3WTY C;  3WTZ A;  4KA4 A;  4OIR F;  1U5T B;  5LHH A;  2LKP A;  4Y17 A;  1J75 A;  4KT5 C;  4BYY A;  1UHM A;  2EK5 A;  3SFZ A;  4LJZ F;  4EVI A;  1P4X A;  3RKY A;  2OD5 A;  1ZG1 A;  3KP3 A;  1XMK A;  3ROU A;  5HS7 A;  4Q5S F;  3F6V A;  5HDK A;  2MLK A;  1K78 B;  2Y0M A;  2L4M A;  4ZYG A;  5FGM A;  1ON1 A;  1S7O A;  2D45 A;  3I54 A;  1FY7 A;  4M9S A;  2F5D A;  1HXD A;  3EUH A;  5J8C A;  4GYG A;  2Q0O A;  1IN5 A;  1V3F A;  1S29 A;  3MEX A;  4Q48 A;  1C0W A;  4GO1 A;  4DQ2 A;  4HDV A;  1R5G A;  3MWM A;  3OV8 A;  3BJ6 A;  5BPD A;  5ICC A;  1Z6R A;  4JQF A;  5FLX K;  1LQ1 A;  4ENK A;  4EJW A;  4U7B A;  2XRN A;  3BP8 A;  4I2O A;  2XVC A;  3IWF A;  1T0F A;  4KDP A;  5HLI A;  3JSP A;  5A2Q K;  1P6R A;  1H9G A;  3IKV A;  4CYD A;  2TDX A;  5DCF A;  3EYI A;  2Z33 A;  1B1B A;  4KMF A;  2KRF A;  2EB7 A;  2GXB A;  3D5L A;  1KU2 A;  1FYK A;  1EH8 A;  2C6Y A;  4I0B A;  2FBH A;  4I98 B;  3ZMS A;  4PDK A;  2KJB A;  2FMY A;  3J81 K;  2XAF A;  3EQL F;  2E1N A;  5HS9 A;  1LDD A;  2IP2 A;  2ZCW A;  3MZY A;  1K7A A;  2E7W A;  4L5J A;  3K1P A;  4BXU A;  2RKH A;  4LB6 B;  2NS0 A;  3F8N A;  3DF8 A;  3E97 A;  4MEX F;  5D5X B;  1UST A;  3CO7 C;  5IT3 A;  1CF7 A;  1TQP A;  1FBS A;  4KUM A;  1U78 A;  3QU3 A;  2Q8K A;  3F21 A;  2VT2 A;  2RNJ A;  2VC0 A;  1R1T A;  4HV6 A;  4JBA A;  5E20 A;  4IVN A;  2JZY A;  3QPT A;  4ASN A;  1HKQ A;  3P7N A;  4I0A A;  2RV8 A;  1EH7 A;  2M45 A;  2ZME B;  3F23 A;  2YSR A;  3FMR A;  3GUD A;  2MLG A;  4H0E A;  3HSE A;  1SFX A;  1KU9 A;  3VEP A;  3FXQ A;  1TQM A;  4PCQ A;  4LG0 A;  2UXN A;  2DU9 A;  5BS6 A;  4OOI A;  5DUK A;  4G8X A;  5K5Q A;  5JVT A;  2W24 A;  3QPH A;  2EFN A;  2ETH A;  2EFQ A;  2YU3 A;  3RIR A;  2YPR A;  1BI2 A;  1W7P D;  3PQJ A;  1YIO A;  1DPR A;  3N4M A;  1JXS A;  4LK1 F;  2W85 A;  3E6B A;  5DUI A;  4S04 A;  2BYV E;  3TGN A;  2YX4 A;  1MDM A;  3RJP A;  2IRF G;  3HHG A;  1LJ9 A;  2QYO A;  3MFK A;  5AIQ A;  1OR7 A;  5HOO A;  2FE3 A;  2M1B A;  4LD5 A;  2A07 F;  1T98 A;  5ILS A;  1MZB A;  2ELH A;  1G4D A;  1FP1 D;  4EJU A;  4IRG A;  3TOB A;  1TW2 A;  2P7V B;  4A2U A;  2EA4 A;  4Q4Z F;  3IL2 A;  2NNY A;  5FB2 A;  3WOD F;  2HOE A;  4HBL A;  3I5U A;  5TRD A;  5ILV A;  4L9N A;  2RVC A;  2K02 A;  1S6L A;  2GQQ A;  3CLO A;  1O3Q A;  1ZLJ A;  5ERI A;  4GGG A;  4L9V A;  3WTV C;  1U3E M;  3TKY A;  3BPX A;  3E6D A;  2WWY A;  2EWN A;  3CUQ A;  5LGN A;  4EJT A;  3TOA A;  3MZH A;  4IPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...