2M5WA

Nmr solution structure of the la motif (n-terminal domain, ntd) of dictyostelium discoideum la protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Lupus La protein
publication title NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
rcsb
source organism Dictyostelium discoideum
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m5wA00
2XVCA 2PFBA 2L4MA 5E20A 2RQPA 2PQ8A 3WTXC 4HYEA 4RGXA 1DP7P 2M5WA 4ESJA 2DQRA 1I6XA 5KK1A 2K4JA 1B59A 3SZPA 2WC2A 3ISPA 1OMIA 1XGMA 4MQVA 3O3KA 2XHKA 1ZREA 2VE8A 1K78A 1EH7A 3J80Z 2FNAA 3V4GA 1RIOH 4G7OF 3FXQA 4WXHA 2KIUA 1WSUA 4AVPA 3RTRA 4FX4A 5D5VB 4KMUX 3QU6A 5DCMB 1EV7A 1MJ9A 3HRUA 2CFXA 3VOEA 1PP8F 2W25A 1W5TA 2MC3A 1FY7A 1G3WA 2WV0A 1R1VA 4QWQA 4IRIA 2V9VA 3IHUA 2ETHA 3DQVC 3SFZA 3ABUA 2P5VA 4WK8F 3GWZA 2QM3A 1QZYA 3VFZA 3QPHA 2NAZA 1HSJA 3JW4A 2R7FA 1O3RA 2OD5A 1JHFA 3MQ0A 3ZP5A 5LEKA 3I59B 3DP7A 1E17A 1X3UA 2JSCA 1IXCA 2VT2A 3WE3A 3F23A 2J5OA 3KZZA 2GWRA 1SFUA 1OPCA 2KJBA 4L9VA 2Q8KA 2HYFA 5E1XA 3KETA 1JHHA 3F8FA 4EJWA 1C0WA 1U2WA 4A5MA 4HF2A 3G73A 1ZYRF 1VTNC 1DPUA 3LA7A 3L7WA 2D2WA 5LLQA 5D4RA 4I02A 2Q2EA 2K02A 3L2CA 1XSDA 5LGTA 3I4PA 4ZH4F 2L01A 5DUKA 1BBYA 4EJUA 2HQRA 1YFHA 2QBYB 2FEZA 3JTGA 3WGGA 4LK0F 1MJBA 5J8CA 2CO5A 4N0BA 5D6FA 1USTA 4AIHA 1XCVA 1S6LA 3TQNA 3JAMK 2MA3A 2P7VB 3HOSA 1KU3A 1MGTA 4KYWA 2OA4A 5BQTA 3SQNA 2ZO4A 2K4BA 4KUMA 4L5JA 1FNNA 1HW2A 4G6DA 2FSWA 3N97A 1OYIA 1TTYA 2JZYA 3EDPA 4M9ZA 4LGWA 3KEQA 4ENNA 2OBPA 3WGIA 3B02A 2DW4A 2JPCA 3K1MA 1D8KA 2ESHA 3N4MA 1F5TA 1LQ1A 5LRRA 2IPQX 1GVJA 2XUBA 3M8EA 1O7FA 1B4AA 3FM5A 5J6XA 3U9GA 3GW2A 3WU1B 4MQ9F 3EUHA 3GLXA 2A68F 1TQIA 2NS0A 3U1DA 4CDGA 3Q9VA 5ED4A 4ZYEA 1Q1HA 1BI1A 1AOYA 5AONA 2MD5A 1ZGAA 1R36A 2EJRA 4XSZF 3EETA 5IT9K 1ZRDA 2Y0MA 3MZYA 1B6AA 3V8JA 2D1HA 1FSHA 2KRFA 1DUXC 2E7WA 5TRDA 4U0WA 2M8EA 4EMSA 1KQ8A 1FBUA 3LA2A 2FBIA 4BQAA 2DO7A 3OOPA 5HDNA 5K5OA 3BJOA 3R4KA 3GO5A 3HHGA 4PDKA 1EH6A 4EGYA 2YX4A 3KLOA 2H27A 3KP2A 3QP5A 4HX7A 4HV6A 2F5EA 4B8XA 3JAMZ 4NQWA 3MWMA 5ICFA 3BOQA 2ACJA 1TQPA 4U7BA 3E5XA 2E1CA 2O0YA 4EM1A 3E3VA 3LA3A 4LMYA 1IF1A 5H6QA 2A6EF 3WTSC 1TW3A 1K78B 1DPRA 5LGNA 2CG4A 4WX9A 3L00A 4TV7A 2FOKA 4NB5A 2A3SA 4ZYDA 3DEUA 1BM9A 5E17F 2RVCA 5DDGA 1P2FA 1U6GA 2RGVA 4XSXF 3P9KA 2K86A 5HVQC 1EH8A 2M87A 3U2RA 3WTZA 1G3SA 3KP7A 2UXXA 2D45A 1RNLA 1O3TA 4M73A 3PQKA 4ENMA 3RYRA 1KU2A 2PN6A 1G3TA 3QPTA 1S7OA 1RUOA 2Q0OA 1Z6TA 4RGUA 2DBBA 2PMHA 1I1SA 5FO5A 3ERED 3FX3A 2W57A 1D5VA 3FMQA 4GYGA 3ZN0A 2MH2A 1BOAA 2Z9OA 3FF5A 3BJAA 3V7RA 2E7XA 3GVAA 3CTAA 1HW1A 1BIAA 3W6KB 5IT9Z 1BIBA 1H0MA 5K5RA 1UHWA 2XIGA 1O7LA 1AWCA 2EFPA 4KN4X 4YG2F 3H92A 1YS6A 1XMAA 2LF8A 2QENA 1GHCA 3DXJF 3L9FA 4Q5SF 5TJJA 2HGCA 3LAPA 1ZG1A 1YIOA 4HF1A 5H20A 2IW5A 1LJ9A 2HS5A 3RKWA 1IN7A 1CGPA 2IJLA 4IVNA 3MCZA 4LB5A 5D5XB 2IP2A 2DI3A 3DPLC 4UUVA 1W7PD 4WCGA 2VBXA 3EYYA 2H6CA 4M72A 3D5LA 4A0YA 1JXSA 5D8LB 4U7DA 2A07F 4UVCA 1J7KA 4WXDA 1IRGA 2HTSA 3M7GA 2EA4A 3I58A 1PDNC 3LSTA 1ON2A 4U88A 4BHCA 3RPUA 1F4KA 1LNWA 4IRGA 2R7DA 2V1DA 2XASA 4OIOF 3SXYA 3I5UA 1SD5A 3D0SA 3ROUA 1ZRCA 2KKOA 1XCBA 2GQQA 4ENKA 5DCFA 4BYYA 1OR7A 4OIQF 4I0BA 2XAJA 1BC8C 3F8CA 2ZMEA 4RAYA 2OZUA 1B9NA 5DEQA 3FM3A 2XAGA 5FD5A 3KP4A 2Z99A 4CHUA 2VE9A 5HLGA 4M6XA 2W84A 3I71A 2EFNA 1BI0A 5CYVA 4L9JA 1G3YA 3HSFA 2EV6A 4MTEA 5FFZA 1L0OC 1UCRA 4OINF 2EV0A 4OMYA 2VBWA 4OIPF 3G3ZA 1B9MA 3JTHA 2FE3A 1TBXA 2EFOA 1SD7A 1R5HA 2V6CA 5L3DA 3RKYA 2V79A 1OYWA 1O3SA 2RV8A 2DQLA 1Z1DA 4EM0B 3P9CA 1T98A 3PFIA 5L3FA 1A04A 3WU0A 1XGOA 1R1UA 3Q5FA 4M74A 4RB3C 1UHMA 3GFLA 2QWWA 4XBFA 1LEBA 3FMRA 4HQEA 4ETSA 4YFXF 3ZMVA 4P9FA 3V8LA 3DV8A 4UNOA 3QOPA 4O5VA 3F8BA 4LK1F 4OU0A 4FX0A 1LDDA 3E6BA 2M1BA 2STTA 3RIRA 2VXZA 2V1XA 3GF2A 4L9NA 1U8RA 1G4DA 1QQIA 2GA1A 3HRTA 3QU3A 3TDZC 3W6JB 4Z2YA 4BNCA 3IRQA 1IN5A 2BGCA 2HR3A 5ILVA 3GZ5A 4R1HA 2L3DA 3IKVA 2PBIA 3RKXA 4LD5A 2CYYA 1Z91A 4Q48A 1YW9A 5DD4A 3ZMTA 5HS7A 3FXRA 5JFRA 4CZZA 4KIFA 1IW7F 4U0YA 3H3UA 3WG9A 5BPDA 4S04A 3IWFA 1XDUA 1D8JA 1FOKA 4N9IA 1HBXG 2RDPA 1H9GA 1ZG3A 4RS8A 2BBYA 2HOEA 1YG2A 2H94A 2QQ9A 3ECHA 2QQAA 2FQ3A 3K0LA 1KA8A 4M9SA 2CGPA 3IKTA 2Z5UA 2ZFWA 4JQFA 2L4AA 2GIVA 4PCQA 4RAZA 3T1BA 4I09A 1MKMA 4YFKF 5JVTA 3CDHA 5D5UB 5K5QA 4G7ZF 1HQCA 5HS8A 1KYWA 3F8MA 3GUDA 1FC3A 5L3BA 1H9TA 5L3GA 2RKHA 2IA0A 2F5CA 3HHHA 2VOOA 1PP7U 1YLFA 2FNPA 4AD9A 1OKRA 2H6BA 2UWMA 5FB2A 2FMLA 4G6QA 2NNNA 1FBSA 2EB7A 4WWCA 4RB2C 5FD6A 2DK5A 1J0RA 4QLCU 3H3ZA 2A6HF 4ZZDA 4IHTA 1R22A 3F72A 4L18B 2F5FA 4Q47A 2F2EA 2ZKZA 4MTDA 4GCVA 3KLNA 3WTTC 4YIIA 4KFCA 2PEXA 4G7HF 3L09A 4I98B 4IHSA 3JSOA 1YO5C 2UXNA 1LVAA 3K1PA 2P5KA 3HUGA 2BE5F 4GYIA 3TO9A 3HSRA 4A6EA 3MAJA 1ZARA 1ODDA 2H09A 2ZMEB 1SD4A 2G7HA 4G94A 1E2XA 1R58A 5E18F 2W24A 1S3JA 1ULYA 3F22A 1ZLKA 1IN4A 3BPXA 5HLIA 4Y17A 3MFKA 1O57A 4ESFA 1FYMA 1QPMA 2PG4A 3HOTA 1K79A 3FHZA 3GFJA 3NEUA 5FGMA 5ICEA 5LGUA 3HRMA 2P5LC 1XB4A 3KP6A 4ON0A 2UZKA 2F5DA 4XRFA 1SFEA 3FWEA 4R79A 1WWXA 5EEGA 1S7AA 2PLYA 1P4WA 3KFWX 3KE2A 3KCCA 1KU9A 4IRHA 4BH9A 3LFKA 1T6SA 2M45A 2VC0A 4UVAA 3VB2A 2JPBA 2VODA 4UV9A 1L3LA 4KDPA 4Y13A 3P7NA 3LQRA 3VODA 4U0VA 4CO8A 3GYHX 3LWFA 2MLKA 1ONVA 2ESNA 4A5NA 2VN2A 2XRNA 1P4AA 2AXLA 4KIBA 3REOA 2E1NA 3O6BB 2GZWA 1IN6A 4L5IA 4M9XA 5E1ZB 2IRFG 4JK1X 2Z3YA 4HLYA 5H6RA 1J75A 3WTWC 1P4XA 1FZPB 4I2OA 2NRAC 3E5QA 2BEOA 3KP5A 5HOOA 1JE8A 3ZMUA 1FT9A 5HLHA 3ELKA 3M1EA 1IZ1A 1IRFA 3TOAA 3F21A 5AIQA 2HWVA 4N9HA 3CUQA 1IAWA 3ZMSA 4OIRF 5JR3A 2QQBA 4YIFA 2IA2A 4UVBA 3DPTA 2WTEA 2K27A 3C3WA 4LJZF 3C7JA 4P5OA 1Y0UA 2ADUA 4E70A 2O61A 4HAMA 2VBYA 3IRRA 4L0ZB 4HZFA 2XGXA 5F1RA 3RYPA 2X4HA 2COMA 4EQQA 5CVVA 4Y15A 2MH9A 2YR2A 4HX8A 1YTYA 5BS6A 4CYDA 2HYGD 2CQKA 3BDDA 3GZ6A 4KA4A 1Z05A 1TNTA 3K9TA 4OMZA 2G9WA 4EJOA 5FLXK 4EGZA 1V4RA 1FP2A 5DUIA 2OQGA 1T39A 1R23A 2HKXA 2M30A 1SMTA 1RI7A 2EV5A 5LBQA 4DNCA 3KP3A 4A2UA 4RB0A 2FA5A 2OAZA 3GFMA 4B09A 2P4WA 4L0YB 1TNSA 3GEZA 1BJAA 3E6CC 5ERIA 2YPRA 3KEOA 4OOIA 3HTSB 3TGNA 2FRHA 2K7LA 3DF8A 3HRSA 1T38A 5DYMA 5CVJA 2TDXA 5D6EA 5BMZA 1BI3A 3CUOA 2GA2A 3HYIA 3IWZA 3WTVC 2GXGA 2MLGA 1TLHB 4WXCA 5CVRA 2PI0A 2FBHA 3ECOA 1SMYF 2FBKA 1U5TA 2DPDA 1XSVA 4HV5A 3VEPA 2EK5A 2EWNA 3WODF 4IXAA 2O3FA 4P96A 5DD8A 2KIFA 2V1UA 1K6OA 2VONA 4I7HA 4LLNA 2ZCWA 2BYVE 1J5YA 1Z6RA 2A61A 2O6GE 3R0AA 1I1GA 3R61A 4BHBA 3E97A 1V3FA 1FPQA 1S29A 4RB1A 1KGSA 3GFIA 4O3MA 3RPQA 1BN5A 1T2KA 3BROA 3F3XA 3I0TA 4EV0A 1KQ0A 4WF2A 4ZYHA 2OU2A 2STWA 1ZN2A 1MD0A 3F6VA 3J81K 3BZ6A 2DT5A 4EVIA 5FLXZ 5A2QK 3T8RA 2EFWA 1UFMA 1W4MA 4Q4ZF 1DDNA 4MNUA 3QAHA 4DQ2A 1OYYA 4CGZA 2HEOA 4A12A 2D1VA 3GX4X 5JI6A 1QBJA 4GGGA 1XGSA 3WE2A 3R0JA 2YX7A 2OQRA 1MDMB 1RUNA 3C18A 1YQAA 2R3SA 3RDIA 3I53A 4PGGA 5HS9A 1J9IA 1D3YA 1MJAA 5D5WB 2HZTA 1HW5A 2XV4S 2OZ6A 1IXRC 3T8TA 2RNJA 2XKPA 4I01A 4MEXF 3BJ6A 1G6NA 1WRJA 4AIJA 4LG0A 1PUEE 1YW8A 3FXUA 3R60A 4LLGF 2JRTA 3TO6A 3LQQA 4R8HA 4GXOA 5JHUA 2ZBKA 2DFIA 5CLSA 1MZBA 1NHAA 2IVMA 4HF0A 4H0EA 4UHTA 2ZNZA 1SAXA 2J5PA 1IUYA 3E5UA 5CJ9A 3JSPA 5IT3A 1QGPA 1FYKA 2QVOA 1YS7A 1SFXA 5E8GA 4KMFA 2LSOA 3WTUC 3V8KA 3ZMZA 1WQ2A 5HDGA 2DK8A 1CF7B 2PMUA 3CUQB 2HDCA 4ASNA 1F9NA 1LEAA 4HX4A 2NNYA 5L3EA 4O6JA 5E8IA 1LDJA 5ICGA 3COAC 4HDVA 5LHGA 2HKOA 1KU7A 3MEXA 4F7ZA 2EA2A 4HOBA 1XGNA 1FP1D 3Q9SA 3J81Z 4IJAA 3IL2A 3EQLF 4S05A 1ON1A 1I27A 5FFXA 3TO7A 4EJVA 3NRVA 5A2QZ 2Z33A 5BOXA 4M6YA 1JGSA 2CSOA 4AWXB 5J8FA 5CVIA 2RC4A 4PZJA 1BC7C 3CJNA 5F6FA 1U3EM 1ZLJA 3RI4A 2XAFA 4KT5C 2HFHA 1ZHFA 2A69F 3HSEA 1HKSA 2JTVA 4A0ZA 3SZTA 4HLXA 2VBZA 5E1WA 2XAHA 1WI9A 5F64A 4MHGA 1TW2A 4EM2A 4RGRA 4D0PA 2WWYA 2YU3A 1HKTA 3J7AO 1LB2A 1IN8A 3HTUA 1YYVA 2G7UA 3LAJA 3SHFA 2ZXJA 3ML6A 4P9UA 1W7PA 2P7CB 4HW0A 2W85A 4P55A 1WKMA 2KJCA 3F8NA 4MGRA 5D4SA 2KIMA 1XN7A 3TDUC 5LHHA 1GXPA 2LDUA 2HQNA 2XROA 2YSRA 4ZZLA 1J2XA 4JBAA 2CW0F 2ISZA 2A5YB 3K1NA 3EYIA 1U5TB 4CICA 1HKQA 3CUQC 3QRFF 2VOPA 3K2ZA 2GAUA 1P92A 1R1TA 3TOBA 2DTRA 1FLIA 1R00A 5BPIA 5ICCA 1ZH5A 4I0AA 3R6SA 2ISYA 1QNTA 2ELHA 1XSXA 4LLLA 4NHJA 2AS5F 3GXOA 2P8TA 1FYLA 1GXQA 3E6DA 5DCMA 3ZQ7A 2DU9A 1KYZA 4L9TA 2FXAA 3T5XA 2FF4A 2XKOA 1XDSA 1MDMA 4KIGA 3P9IA 3T0YA 2HTJA 5K1YA 4HDUA 4FHTA 3MZHA 2P6SA 1XMKA 1B1BA 5ILSA 4BAYA 2FU4A 2DAOA 4PGHA 1ZRFA 3QP6A 1U78A 3CLOA 3I59A 1HSTA 3ABTA 3FZVA 1R7JA 1ZGJA 1USSA 5KVRA 3BWGA 2C6YA 2PJPA 2BV6A 3C1DA 1I5ZA 1STZA 1T0FA 3FMSA 5CVUA 3V7SA 4IF4A 3DFGA 1RZ4A 2P6TA 3B73A 1KQ9A 1W5SA 1CF7A 2QYOA 3AAFA 4HBLA 3ZPLA 1FX7A 4LG0B 3PQJA 3ULQB 4GO1A 3WGHA 2VC1A 4YFNF 1IXSB 2EFQA 1U5TC 2QBYA 2LNBA 4ENJA 2L54A 4KICA 2B0LA 3M9AA 1S8NA 1ZG5A 4HQMA 2L02A 3RJPA 2VT3A 4K2EA 3O2PE 5L3CA 2LF7A 5D8KB 3IC7A 2X0LA 4RGSA 3K69A 3HIFA 4MEYF 4AIKA 3CO6C 1REPC 3V7CA 1ZAOA 2CWEA 6PAXA 1QZZA 2QLZA 3OV8A 4BXUA 2Y75A 1Z9CA 3ZMDA 2ZJ2A 5LRSA 4A6DA 4KNYA 1LDKB 2QZ8A 3E6MA 1SD6A 3J80K 3I54A 2NYXA 4HA8A 3WTYC 3TKYA 3DKWA 3BY6A 1Z7UA 4G9YA 4ESBA 2GXBA 3KZYA 2QUFA 1FBQA 2O03A 3M8FA 1FWZA 2LKPA 2RN7A 4XLPF 4IPAA 3NQOA 4XLNF 2JT1A 3BPVA 3I64A 1BI2A 3F6OA 1XD7A 2IA1A 4UV8A 3BP8A 4CXFA 5LHIA 2O8XA 4A0XA 4ZYGA 1O3QA 2DPUA 5ILUA 5AIPA 2MBFA 2Y48A 1QO0D 1FSEA 4M71A 3CO7C 5DV5A 1R5GA 4LFUA 4KN7X 4EJTA 1TQMA 2ZNYA 5HDKA 3ZN1A 4FT8A 4G8XA 1W7PB 1K7AA 2XAQA 1YW7A 5EEHA 1J59A 2IT0A 5LEJA 1F1ZA 4LB6B 3S2WA 1P6RA 4BHPA 1UB9A 2DLLA 2FMYA 4UXNA 1HXDA
chains in the Genus database with same CATH superfamily
2XVCA 2PFBA 2RNGA 2L4MA 5E20A 2Z1DA 4LITA 2RQPA 2K40A 4X0GA 2PQ8A 3DBRB 2EZHA 3WTXC 2M0MA 4HYEA 5IPAA 2JA2A 5M5XJ 3RZDJ 4RGXA 1DP7P 2QKMB 5F0HA 1FOWA 4RA2A 3OYCA 2M5WA 2B9SA 3ASOH 4ESJA 3FKJA 1IGNA 4Y3OA 2DQRA 1I6XA 3HB9A 5KK1A 5EEAA 2K4JA 1RR7A 1W5CC 2CS3A 1VQMI 1B59A 3SZPA 2WC2A 1EF4A 3H3VK 1SVLA 3CJRB 3BZKA 4BQOA 3ISPA 1OMIA 2KPMA 1QA6A 1XGMA 4MQVA 3O3KA 3ZR8X 2XHKA 3CCLI 2O8KA 4JX5A 4UUSB 1BJZA 1ZREA 2VE8A 1K78A 3NARA 3I4MJ 1EH7A 1SVOA 3J80Z 2COBA 2FNAA 2XGDA 2K3FA 3B6AA 5GP9A 3V4GA 1RIOH 4G7OF 1S9HA 3FXQA 4WXHA 2KIUA 1WSUA 4AVPA 2LRDA 4AVZA 3RTRA 1QRYA 4FX4A 4XKCA 5D5VB 4KMUX 3QU6A 5DCMB 3BTLA 1EV7A 3JCUC 3DLAA 1MJ9A 3HRUA 2CFXA 2LKSA 3VOEA 1PP8F 2W25A 9ANTA 2QF7A 2HQ5A 1R6RA 1W5TA 5CKTA 1XPXA 2MC3A 2NOJB 4GRIA 1FY7A 3KYLA 3DEWA 1G3WA 1FTTA 5E79C 2WV0A 1R1VA 4QWQA 3FK6A 1ZTRA 1AU7A 4IRIA 2V9VA 3IHUA 2ETHA 3DQVC 2IGNA 3SFZA 3ABUA 4YEJA 2IGOA 4CCLA 2P5VA 3H1CA 4WK8F 3GWZA 2XAUA 3FXLA 2QM3A 4KITB 1QZYA 3VFZA 3QPHA 2NAZA 1HSJA 2FX0A 4Y52J 3JW4A 2R7FA 1O3RA 2OD5A 1JHFA 3MQ0A 5B5EC 2UV1A 3ZP5A 5LEKA 2E2IJ 3JRCA 3I59B 3DP7A 1EJ9A 2BVMA 1E17A 1X3UA 2JSCA 1IXCA 2VT2A 3WE3A 3F23A 2J5OA 3KZZA 2GWRA 1SFUA 3A03A 4D5CA 1OPCA 2KJBA 2DOFA 4L9VA 2Q8KA 2HVRA 2HYFA 4CYCA 3MKWB 1MW7A 2QA4I 2BZTA 5E1XA 3KETA 3S2HJ 1RC9A 3EUHC 1JHHA 3F8FA 3AG3H 2IS2A 1N25A 3S3OA 4EJWA 2GLOA 1C0WA 4HRIA 1U2WA 4A5MA 2EIMH 4HF2A 3G73A 1ZYRF 5KHDA 2R0QC 1VTNC 1DPUA 3H5AA 3LA7A 1DU0A 2W4SA 3L7WA 5EGOA 2D2WA 3H9GA 5LLQA 5D4RA 1OISA 4I02A 2Q2EA 2VL8A 4W1UA 2K02A 3L2CA 3K4MA 4IHYA 1XSDA 4HPQA 3K4BA 2F48A 5LGTA 2E60A 3DKXA 3I4PA 1IUFA 3F0CA 4ZH4F 2H1KA 2A5WA 2E1MB 2L01A 2W7NA 5DUKA 3K7AJ 4DJAA 1FIPA 1BBYA 2R7TA 2OF7A 4EJUA 3UR3C 1T8IA 4NC6A 2TCTA 4CCKA 2GOMA 2HQRA 4PSXA 2JA7J 1YFHA 2QBYB 2FEZA 2AQEA 3K4KA 3JTGA 4V2FA 3WGGA 4LK0F 5IOZA 1MJBA 2WB1A 2JUGA 5J8CA 2ZSIB 2CO5A 4N0BA 5D6FA 3OSFA 1JKRC 3PO3J 1QVTA 2WAFA 4NUBA 3SEQA 1USTA 1Y6IA 4AIHA 1XCVA 3CCQI 1S6LA 3CJQB 3SFIA 3TQNA 2I5UA 3JAMK 2MA3A 2P7VB 5H2FC 3HOSA 5LD2C 3HJEA 1KU3A 3G1MA 2W00A 3S1QJ 1MGTA 4KYWA 2OA4A 5BQTA 3TL4X 3SQNA 1EA3A 1RR8C 2ZO4A 2K4BA 4KUMA 4L5JA 3ZQCA 2RAEA 2LLKA 2YUSA 1FNNA 1HW2A 3SDGA 4G6DA 2CRGA 2FSWA 3N97A 1I6HJ 4AYBA 1OYIA 1TTYA 2JZYA 3EDPA 4M9ZA 4LGWA 3KEQA 4ENNA 2CUJA 2OBPA 4IOAF 1FIAA 4ANJA 3WGIA 3B02A 2DMQA 2BY1A 1VQPI 5FRMA 5GTHC 2DW4A 3CDIA 2Y0SN 2JPCA 2EINH 3K1MA 3H35A 5EDNA 2CQNA 1D8KA 4I76A 4CCMA 1D1CA 4XONA 3WU2C 2ESHA 3N4MA 1QU3A 4PK4A 1F5TA 1LQ1A 2NVUB 5LRRA 2DTZA 2IPQX 1GVJA 4A3KJ 2XUBA 3M8EA 4P1WA 4HG2A 2V4JC 5K7ZA 1O7FA 3S1RJ 1B4AA 3J7ZI 3FM5A 4B44A 5J6XA 3C2BA 3U9GA 3GW2A 3WU1B 4MQ9F 2Y9ZA 3EUHA 3GLXA 2A68F 1TQIA 2NS0A 3U1DA 3VDXA 1AKHB 4CDGA 3Q9VA 5ED4A 4ZYEA 1Q1HA 1YX3A 3BR5A 1BI1A 2LBFA 4UB6C 3PO2J 1AOYA 5AONA 2MD5A 1TWAJ 2VQLA 4IQJA 3DEEA 5E3MA 3C2GA 2VKDA 1ZGAA 1Z3YA 1GDTA 2X48A 1B8IB 1MH3A 2EILH 1MBJA 1R36A 2EJRA 3C2HA 3LMMA 1T0FC 4XSZF 5EF6A 4YIRX 3EETA 1UHSA 1SFKA 2MYSA 2KHMA 5IT9K 3OR2C 1ZRDA 2Y0MA 4LOCA 1PUFB 3AG4H 2B7EA 1B6AA 3MZYA 3V8JA 5F1JA 2D1HA 4YELA 4E6KG 3OYKA 1JKOC 1FSHA 1WVRA 4RLQA 1U8BA 2KRFA 4RAGA 3JRFA 3S1NJ 1DUXC 3ESWB 2E7WA 3S1MJ 5TRDA 1W36D 4U0WA 2E1MC 2M8EA 1WJEA 4EMSA 1KQ8A 1JTYA 1FBUA 1X2NA 1X4OA 2FBIA 3LA2A 1HOMA 5B3SH 1RPWA 2DO7A 2L7MP 3OOPA 4BQAA 2CW8A 4I99C 5HDNA 1E0EA 5K5OA 3CCMI 3BJOA 3R4KA 4N4OB 3GO5A 1QZEA 2JQ7A 3HHGA 4PDKA 1EH6A 5J4YA 3GZNB 2NS7A 4EGYA 2YX4A 2VPLA 3KLOA 4FTHA 1DGWY 2QSFX 1WJAA 3PIOF 3Q0WA 2EZLA 2H27A 3AKZA 3I56I 3GTKJ 1D5YA 3KP2A 3QP5A 4HX7A 1ERDA 4HV6A 3WG7H 2F5EA 4B8XA 1NG7A 3JAMZ 4JP0A 4NQWA 3MWMA 5ICFA 3BOQA 3LSMA 3ZQIA 2ACJA 1TQPA 4U7BA 3LNQA 2ZFUA 3E5XA 2HDWA 3B6CA 2E1CA 2O0YA 4EM1A 4C9YA 2VXDA 3E3VA 3LA3A 4LMYA 1OCCH 1IF1A 1NG6A 5H6QA 4FE7A 3OY9A 3ABLH 1A6QA 2A6EF 2ZSHB 3WTSC 2R92J 1MBGA 5GAEJ 1TW3A 1K78B 2KZVA 5FKKA 1DPRA 1MSFC 3W3CA 4BUPA 5LGNA 2PMZA 2Y69H 3VYUB 2CG4A 3UNGC 4WX9A 3L00A 3ZXSA 4TV7A 1VQ8I 2FOKA 4NB5A 1H89C 2A3SA 2QSHX 3WHCA 4ZYDA 1ITYA 1S72I 3DEUA 3FXMA 2BY0A 3FBNB 2ZJRF 1BM9A 4XQFA 5E17F 1T95A 2RVCA 2ZC2A 5DDGA 1QHHD 3KYDB 1P2FA 1U6GA 2RGVA 4XSXF 3P9KA 5LFAA 3HKZN 2K86A 2NVXJ 4IKFA 5FLMJ 3CMMA 3MMYB 5HVQC 2E2JJ 1EH8A 2M87A 2TRTA 1FMVA 2FUG2 3U2RA 3WTZA 1YJWI 4HEA2 4DYCA 1G3SA 1ZQ3P 3KP7A 5F04A 2UXXA 5FKMA 2D45A 5EYRA 1RNLA 1Y56A 1O3TA 4M73A 3PQKA 3RYRA 4ENMA 1KU2A 2PN6A 1G3TA 5J1RA 2JMWA 4RLFA 3TBIA 2OTLI 3QPTA 1S7OA 1RUOA 2A6TA 2Q0OA 1Z6TA 4A3JJ 4RGUA 2DBBA 2PMHA 3JRBA 1Y0NA 1E3HA 5FO5A 1I1SA 2UUZA 3ERED 3FX3A 2W57A 1D5VA 3FMQA 4GYGA 3ZN0A 2X1EA 2MG4A 3GLLA 2MH2A 2LYCA 1ETOA 1BOAA 3ZQLA 2Z9OA 2HOAA 1UAAA 4FISA 3FF5A 3BJAA 5DM7F 3V7RA 2E7XA 1TL8A 1D1BA 2ID3A 1N75A 3GVAA 3CESA 4XL9A 3CTAA 1HW1A 1BIAA 1UELB 3W6KB 3GTOJ 5IT9Z 1BIBA 2AO9A 1HA8A 1H0MA 4BJTA 5K5RA 1UHWA 3EPZA 3LSHA 2XIGA 2W48A 3W2AA 2F5VA 1O7LA 2E2HJ 5EZHA 1VQOI 2ZMEC 1ZR2A 1AWCA 2CQXA 2EFPA 3I9V2 4B47A 4KN4X 1VZ0A 2L7ZA 2XB0X 3RKQA 2KRHA 5FKOA 2VQHA 3G71I 3LSIA 4YG2F 3H92A 2BHYA 1YS6A 1XMAA 2DODA 3N05A 4MO7A 5K7FA 2LF8A 2Q2EB 1LFPA 2QENA 2CV1A 4H4KC 1P7JA 3BG7A 4XIDA 1GHCA 3DXJF 3L9FA 3FDYA 2VJIA 2XRLA 4Q5SF 5TJJA 1WI3A 2HGCA 3LAPA 1UMQA 5J4VA 3ZQQA 1ZG1A 2NVQJ 4II2A 2EPFA 2GOXB 3HG9A 1YIOA 4HF1A 5H20A 3PNYA 2H1LA 2IW5A 1LJ9A 1GV2A 2HS5A 3RQIA 3RKWA 1IN7A 1CGPA 2NVTJ 2IJLA 3HXLA 2M0CA 4ZC3A 4DZJA 4BGDA 2ZJQF 2DA5A 4IVNA 4NC8A 3MCZA 4LB5A 5D5XB 2IP2A 4IHXA 2DI3A 2JN6A 3DPLC 4PJNA 4UUVA 1W7PD 4WCGA 2VBXA 2MSYA 3EYYA 2H6CA 4M72A 3FIWA 2LH9A 1ETVA 3D5LA 1X1CA 1BOBA 4QPQA 4A0YA 1JXSA 5D8LB 4U7DA 2A07F 4UVCA 1VQ5I 2DMNA 2WADA 2DFEA 1J7KA 3CP2A 3W6VA 2M9HA 2V7FA 3L2UA 4CCNA 1PYVA 4WXDA 4A3EJ 2HTSA 1IRGA 2MGQA 1JTXA 1KONA 3M7GA 1APLC 2EA4A 3I58A 1PDNC 3LSTA 1ON2A 4U88A 4BHCA 1YI2I 1A35A 3RPUA 1F4KA 4C3HJ 5FJ8J 1D1AA 3AG1H 1TWHJ 1LNWA 4XICA 4IRGA 1X3WB 2R7DA 2V1DA 2FQ4A 2XASA 3MKLA 2WBMA 4OIOF 3SXYA 1HCRA 2VKEA 2XB5A 3I5UA 3BR3A 4E7SA 1SD5A 2OJED 3DU6A 3A01A 4A3FJ 3DU5A 3D0SA 2JA8J 3ROUA 2JVHA 1ZRCA 2KKOA 1XCBA 4Y33A 2GQQA 1Q1VA 4I6ZA 4ENKA 5DCFA 3G4SI 4BYYA 3LSPA 1OR7A 4OIQF 2EBIA 4I0BA 3BG3A 1WJBA 3F9KA 2ECBA 2XAJA 4PSWA 2HPIA 4A3GJ 1BC8C 1MBHA 1IC8A 1ZELA 3F8CA 1ENHA 2ZMEA 4UY8I 3BR2A 1SVMA 3PUBA 1MNMC 4RAYA 4F91B 4A3CJ 3ERMA 2X6OA 2OZUA 1B9NA 3PM1A 1PJRA 5DEQA 2LD5A 3I55I 3FM3A 2XAGA 5FD5A 3FXJA 2Z99A 3KP4A 1X2MA 4CHUA 4Y7NJ 3DPUA 3LSRA 1K4TA 3TEDA 2VE9A 5HLGA 4E7KA 4E7HA 4F92B 3PNTA 4M6VA 4M6XA 2W84A 3H36A 1MMNA 3I71A 4AM3A 2EFNA 1BI0A 5CYVA 2L0KA 4D5FA 3HUGB 4L9JA 1G3YA 3KX2A 3HSFA 2CU7A 2EV6A 1D0YA 4Z6YA 4MTEA 5J1YA 4GDFA 5FFZA 1L0OC 1UCRA 4OINF 2EV0A 2WAQA 2XPVA 4OMYA 2VBWA 4OIPF 2BW3A 3G3ZA 2DYSH 2Y30A 4IEJA 1B9MA 2E1OA 2XGCA 3JTHA 1WHUA 2FE3A 1TBXA 4PJMA 2EFOA 3DBLB 5HNHA 5J40A 3Q0VA 1SD7A 4BY7J 2QEXI 1R5HA 3SZGA 2V6CA 5L3DA 4BBRJ 3RKYA 1XTAA 2V79A 1OYWA 1ETYA 4KJZA 4XN0A 2RV8A 1O3SA 2G0EA 2DQLA 1Z1DA 4EM0B 2KL4A 2VLAA 3P9CA 1T98A 3PFIA 1XC5A 5L3FA 1A04A 3WU0A 1XGOA 2Y31A 1R1UA 3Q5FA 3M07A 3J7AY 4M74A 1IRZA 4W97A 4RB3C 2M7AA 3K4CA 1UHMA 3GFLA 4XM3A 2F4MB 2K9MA 2Q1ZB 2QWWA 2I10A 4XBFA 2DOAA 1LEBA 4NQWB 3FMRA 4HQEA 3WHBA 2XF7A 4ETSA 4YFXF 2LY2A 2CUFA 1HC8A 3ZMVA 4P9FA 3FK7A 3V8LA 2LY1A 3CCSI 3DV8A 2L2OA 1ETQA 2LREA 2BY3A 1SFOJ 3QOPA 4UNOA 4O5VA 3F8BA 1OCPA 4QTRA 1GUUA 4LK1F 2HZDA 2KRCA 4ZDPA 2DN0A 4OU0A 4FX0A 5IYBJ 2CV0A 5C4XJ 1LDDA 3E6BA 1VFCA 2M1BA 2STTA 1B72A 3RIRA 2VXZA 3GMEA 2V1XA 3GF2A 4QPOA 4L9NA 1U8RA 1G4DA 1A31A 3DKYA 2Y2ZA 3CD6I 1QQIA 4C2TA 1E3OC 2M34A 2GA1A 3HRTA 1V55H 2DA6A 3E1SA 3K4NA 4B3XA 3QU3A 3TDZC 3W6JB 4Z2YA 3JRDA 4BNCA 3IRQA 3BR6A 1IN5A 3IP4B 3CCRI 2BGCA 2HR3A 5ILVA 1YE9A 3GZ5A 4R1HA 3HBLA 1MNDA 2L3DA 2MABA 3CQZJ 3IKVA 2PBIA 3RKXA 5HLTA 3OYMA 4LD5A 2FD5A 3GTJJ 4NNJA 2CYYA 1W1WE 2LC2A 2DA2A 1Z91A 1JJ6C 4Q48A 5C3EJ 2LFBA 3OIOA 4V2GA 5DS9A 1YW9A 2HVQA 2R7QA 4EATA 5DD4A 3ZMTA 1ZGWA 5HS7A 3FXRA 5JFRA 2DT6A 2IS6A 2CJJA 4CZZA 1WJCA 4KIFA 3FBIB 1IW7F 4U0YA 2LOOA 2L9VA 2V6EA 1WH5A 1VQ4I 2MC4A 3H3UA 4M3GA 3WG9A 1TP4A 2MFZA 5BPDA 3HL2A 3FXKA 1JGGA 4S04A 3IWFA 1XDUA 2K85A 2NVYJ 1D8JA 3GCMA 1TC3C 1FOKA 3H5NA 4N9IA 1HBXG 2RDPA 1H9GA 1ZG3A 3DBHB 4RS8A 2BBYA 1ACIA 2HOEA 1YG2A 2H94A 2QQ9A 2FJ1A 3ECHA 4DGWB 2QQAA 2DDBA 2FQ3A 3K0LA 2VKHA 3TW7A 1O4XA 1VQNI 1KA8A 3MD2A 2GM4A 4M9SA 2CGPA 3JR9A 4DZPA 3IKTA 2Z5UA 2ZFWA 4JQFA 1VQ7I 5F0CA 2L4AA 2GIVA 2GBYA 3JRHA 2K9SA 4PCQA 4RAZA 1UJ8A 4ZTJA 3T1BA 4I09A 1MKMA 2VJ5A 4RBOA 1V5EA 2L7KA 3LSJA 1Y8QB 2R5ZA 2JUCA 4UUTA 1E3PA 1N77A 5IYDJ 4PUSA 2K3PA 4YFKF 3D1NI 5JVTA 3CDHA 5D5UB 5K5QA 4G7ZF 4BQQA 1HQCA 5HS8A 4KISA 4AU7A 1KYWA 3F8MA 5HNFA 3GUDA 1FC3A 5L3BA 1H9TA 5L3GA 2RKHA 5CQEA 2IA0A 2F5CA 1T08B 1X3ZB 3HHHA 4JX6A 1HDDC 2QGUA 2VOOA 1YIJI 5E3LA 1X1DA 1PP7U 3M3YJ 3FHNA 1YLFA 5M3FJ 2FNPA 3PSFA 4AD9A 1OKRA 2H6BA 2UWMA 5FB2A 2FMLA 4G6QA 2NNNA 3AG2H 5JLWA 3HOXJ 3PNVA 2JVGA 1CQTA 3HDDA 1FBSA 2EB7A 2CQ7A 3NAUA 4WWCA 4RB2C 3LSGA 5FD6A 2DK5A 1IDYA 2V26A 2R7SA 1DU6A 3L2RA 2E34A 1J0RA 3E7LA 2JWTA 5B1BH 4BXFA 4XOPA 3QOEA 3AFHA 2V9KA 4ZDLA 4QLCU 3HEFA 2HPMA 3H3ZA 4RAFA 2A6HF 4ZZDA 3SYTA 4DYQA 1VQLI 2X6WA 4IHTA 1R22A 1HDPA 1ETKA 1LPQA 2V9PA 3F72A 4M3DA 2F5FA 4L18B 4E7JA 4Q47A 4IHVA 2F2EA 1OJLA 2ZKZA 5C44J 3A01B 4MTDA 5C4JJ 4GCVA 2KZGA 2OPTA 3KLNA 3WTTC 4YIIA 3OMYA 4KFCA 2PEXA 4G7HF 3L09A 4CUGA 4I98B 4FASD 4IHSA 1VQ6I 3JSOA 1YO5C 2UXNA 1LVAA 2E36A 3IAM2 3K1PA 2P5KA 3VPRA 3HUGA 2BE5F 1J09A 4GYIA 1A6IA 3G6EI 3TO9A 3ABKH 3HSRA 2LMDA 4A3DJ 1RKTA 4A6EA 3MAJA 5J47A 2VQCA 1ZARA 2HDDA 1ODDA 2H09A 3O8GA 2KISA 2ZMEB 3G1LA 1SD4A 2G7HA 4G94A 3QYBA 4GFBA 5F27A 2HU9A 4OAZA 1Y39A 1E2XA 3S93A 2HQAA 1R58A 3QPLA 1JT0A 5E18F 1BR1A 2W24A 2CUZA 1S7EA 3S15J 1S3JA 1ULYA 3F22A 1IJWC 1XMXA 1WPKA 1ZLKA 3OWTA 4RM2A 3H0GJ 1IN4A 3SJMA 3BPXA 4HSRA 5HLIA 4Y17A 3A4CA 3MFKA 1MSEC 4HSTA 2E19A 1O57A 4RM3A 3TW6A 4ESFA 1FYMA 1QPMA 3AL0C 2PG4A 2VI6A 3G2BA 4IX7A 3HOTA 1K79A 3BG6A 3FHZA 3GFJA 2IGMA 5GTIC 2F4OB 4Y4RA 2BW3B 3H5RA 4A93J 2VKVA 3NEUA 3JRAA 5FGMA 4IHWA 5ICEA 4CH7A 1LE8A 5LGUA 1BW6A 1RRJA 3BTIA 3HRMA 2P5LC 1XB4A 4PFPA 4FE4A 1Z0XA 3KP6A 4ON0A 4CCJA 2UZKA 2F5DA 5TISC 4C2UA 3ZQGA 4XRFA 1T33A 1SFEA 4X6AJ 3FWEA 4R79A 1WWXA 5EEGA 1S7AA 3VYRB 5IYCJ 3VSLA 2PLYA 2PJRA 1P4WA 3KFWX 1FJLA 3KE2A 1U9OA 1JUMA 3KCCA 3S14J 1KU9A 4IRHA 4DW6A 4IL6C 4BH9A 3LFKA 1T6SA 5KCMA 5B66C 2M45A 2VC0A 2M8GX 1R4NB 4UVAA 3L2VA 3VB2A 2JPBA 5KNLA 1WJDA 1UZCA 2VODA 4UV9A 1L3LA 4KDPA 3OS2A 1EKEA 4PJLA 5J1UA 3P7NA 3LQRA 4Y13A 3VODA 4U0VA 4CO8A 5IP7J 3K4LA 5IP9J 2W82A 3K4JA 4B48A 3GYHX 1AHDP 3LWFA 2MLKA 1ONVA 3CCVI 2ESNA 5GPAA 4A5NA 3CCJI 2VN2A 4JYKA 2XRNA 1P4AA 1B72B 2R5YA 2AXLA 4KIBA 3REOA 2VASA 4LG3A 2E1NA 3O6BB 2GZWA 3CCEI 2LP0A 4BE2A 1IN6A 4L5IA 4M9XA 1TT5B 5E1ZB 4JK1X 2Z3YA 2IRFG 4HLYA 5H6RA 1BR4A 3ZCOA 1X4PA 2Y0SA 1J75A 4E7IA 3WTWC 4BDZA 1U0JA 4XKBA 3LOCA 1P4XA 1FZPB 4I2OA 4E7ZA 2NRAC 2VIXA 1OR7C 3E5QA 2BEOA 3KP5A 5HOOA 1JE8A 3ZMUA 1FT9A 1LUJB 5HLHA 3CLQA 1LFUP 1D0XA 3ELKA 3HGGA 3M1EA 1IZ1A 1IRFA 3TOAA 3F21A 5AIQA 2HWVA 4XNFA 2ECCA 2DJIA 2QKLB 4N9HA 3CUQA 1IAWA 2R7ZJ 2AHQA 2CUEA 3ZMSA 2EH3A 3CP8A 1OCRH 3LFUA 4OIRF 5JR3A 2JRMA 2OCCH 1Z21A 1V54H 2QQBA 1MH4A 4YIFA 2IA2A 4UVBA 3DPTA 4BJ6C 4NC7A 4EEFG 2E35A 2GIZA 2WTEA 2K27A 3C3WA 3BG5A 3OYEA 2DDAA 4LJZF 2KLOA 3C7JA 4P5OA 1Y0UA 3CDLA 2ADUA 4E70A 3OYAA 4FETA 3BR0A 1IV6A 2DFFA 2O61A 3OIQA 4HAMA 2VBYA 3IRRA 4L0ZB 3EUKL 2XC7A 3OYDA 4HZFA 2XGXA 4XKWA 5F1RA 3RYPA 2X4HA 1U9NA 2COMA 4EQQA 3FISA 5CVVA 1VNDA 4FQGA 4Y15A 2MH9A 5KAFC 1X1AA 3OL4A 2YR2A 4HX8A 4BEHB 5EJCA 3U21A 2O9LA 1YTYA 5BS6A 4AC0A 4XRSA 2BXZA 2XPUA 3CMEI 2M7BA 4CYDA 2HYGD 1QHGA 2CQKA 3BDDA 2R7OA 1P9QC 5M5YJ 3GZ6A 1NH3A 4KA4A 1Z05A 1TNTA 2D5VA 3K9TA 4OMZA 2G9WA 4EJOA 5FLXK 4EGZA 1V4RA 2O5RA 1FP2A 5DUIA 2OQGA 1T39A 1R23A 2ZXWH 4XLHA 2IGKA 2HKXA 2M30A 1K61A 4A3LJ 1GVDA 1MBEA 1SMTA 1RI7A 2EV5A 2WY7Q 2R5ZB 4DNCA 3KP3A 4G12A 3TP0A 4A2UA 4RB0A 5LBQA 4OAYA 4MLOA 2FA5A 1GV5A 1RKWA 2OAZA 4RDUA 3OYJA 3HOVJ 3GFMA 4B09A 1YJ9I 2P4WA 2ZJPF 4L0YB 1TNSA 3GEZA 4BJ5C 1BJAA 3E6CC 3SEZA 1Z67A 5ERIA 4ZTFA 2YPRA 2LK2A 3KEOA 4OOIA 3HTSB 2NS8A 3TGNA 2QCOA 3CJTB 2FRHA 1P7IA 1IO2A 2WA0A 2K7LA 2Z2SB 3DF8A 4CZCA 3HRSA 2JK3A 1YX5A 3S3MA 1FEXA 1T38A 4F93B 3K2AA 5DYMA 2LTPA 5CVJA 2TDXA 1RETA 3OYFA 5D6EA 5BMZA 3OIPA 1Z3XA 1BI3A 4G6TB 2F6CA 1K6YA 3CUOA 2GA2A 3HYIA 3IWZA 2DA7A 5M5WJ 2WY8Q 3HOWJ 4XN3A 2GXGA 4LIUA 2MLGA 3WTVC 1TLHB 4BE0A 4PFOA 4PJ0C 2WV1A 2K9NA 2KIQA 4WXCA 4XLFA 4F3QA 5CVRA 4IOCF 2PI0A 1LVKA 2FBHA 3BCBA 2E5ZA 3ECOA 1YJNI 1SAUA 4XR6A 1SMYF 1ZK8A 2FBKA 3PJRA 1JT6A 2LR8A 1U5TA 1Z7LA 3ZOBA 2IBDA 3QODA 2DPDA 1XSVA 4HV5A 3VEPA 2WB1N 1X58A 2EK5A 3HOZJ 2EWNA 3WODF 4IXAA 4C3IJ 2O3FA 2F4IA 3HC7A 4P96A 4E4HA 4CA0A 5DD8A 4BDYA 3ZQHA 2KIFA 5B1AH 3PIPF 2V1UA 1K6OA 2H8RA 2XF6A 5FROA 2VONA 3S8PA 2BVLA 4I7HA 5EG0B 4LLNA 2ZCWA 2BYVE 2XDVA 1J5YA 1Z6RA 4AUXA 2A61A 4XOTA 1YHQI 2O6GE 3R0AA 5JLXA 3TMOA 2R7XA 3OOUA 1I1GA 3R61A 5GAHJ 1LFBA 4BHBA 3MVPA 1QVUA 3E97A 1V3FA 1FPQA 4AYBN 1OCOH 2AXTC 1S29A 2AQFA 4RB1A 1KGSA 1ORKA 2I8DA 2DA1A 1ZKGA 3GFIA 4O3MA 2HXIA 4C2MJ 4LIVA 3RPQA 1BN5A 1ZR4A 1T2KA 3S16J 3BROA 3F3XA 3I0TA 4X1EA 1HF0A 3HOUJ 3A2KA 4EV0A 5K7HA 1KQ0A 4WF2A 4ZYHA 2OU2A 4M3FA 4S0HB 2HXOA 2STWA 2M3AA 1W0UA 3PL8A 1DP3A 1ZN2A 3PFYA 1MD0A 3F6VA 4FCYA 3J81K 1K4SA 1G59A 2ELKA 3BTCA 3CC2I 2EIJH 3BZ6A 2DT5A 4EVIA 5FLXZ 5A2QK 3T8RA 1PVEA 2EFWA 3BZCA 1UFMA 1W4MA 3BQZA 2KQRA 2KDZA 2LKXA 2E71A 4Q4ZF 1DDNA 2X1DA 3QWLA 4MNUA 3QAHA 4DQ2A 1OYYA 4CGZA 2Y9YA 2VUMJ 4DBQA 2HEOA 4ZYAA 4A12A 1SEUA 4HNUA 2D1VA 1LE8B 1SANA 1Y8RB 3GX4X 5JI6A 1QBJA 1D0ZA 2DJNA 3A0BC 4B4CA 4GGGA 1XGSA 2CW7A 3WE2A 2R4GA 1MMSA 3R0JA 3GTPJ 3IH2A 2YX7A 2OQRA 5IY5H 3BG9A 1MDMB 1WZ2A 1RUNA 3C18A 2K9LA 1YQAA 2R3SA 1NK3P 5FRNA 3RDIA 3I53A 2RREA 4PGGA 2PJRB 5HS9A 1J9IA 1D3YA 4N4NB 2IAIA 1MJAA 4C3JJ 5D5WB 2PX9A 2HZTA 1HW5A 2XV4S 2OZ6A 3Q0UA 3MZ8A 4NDLA 2HOSA 2X1CA 1BW5A 3IH3A 1IXRC 3ABMH 3CF2A 3M8JA 3W2WA 3IV5A 5IOYA 3T8TA 2L9NA 1XG1A 1IV8A 2RNJA 2XKPA 4I01A 4MEXF 1TWGJ 1UG0A 3BJ6A 1G6NA 3H9QA 2ME6A 3OYHA 2L9RA 1WRJA 4AIJA 4LG0A 1PUEE 1YW8A 1X1PA 3FXUA 4U87A 2QSGX 3R60A 4LLGF 2JRTA 3TO6A 3E0JB 3LQQA 1R5ID 3KYCB 4R8HA 1RESA 2HI3A 4GXOA 2KP6A 2ZBKA 5JHUA 2DFIA 5M3MJ 5E3NA 5CLSA 1MZBA 2R5YB 1NHAA 3IH4A 2IVMA 2ID6A 4HF0A 1V5GA 4H0EA 4UHTA 2ZNZA 4M3BA 2H8WA 3DCFA 3A0HC 1DGRM 1YRNB 1SAXA 2J5PA 2XPWA 1IUYA 4BS9A 3E5UA 4XORA 4DOZA 2VJJA 4UB8C 5CJ9A 3JSPA 1JKPC 5IT3A 1QGPA 1T56A 1FYKA 2QVOA 2GXAA 1YS7A 1SFXA 4D7NA 2JA5J 1XX5A 5E8GA 2XSDC 1TWCJ 4A3IJ 4KMFA 2LSOA 4ABZA 3WTUC 1Z77A 3V8KA 3ZMZA 1WQ2A 1R9TJ 4BEHA 2V1NA 5HDGA 2DK8A 3ZRGA 1CF7B 3GTGJ 2PMUA 4CCOA 3D5SC 3M1CA 4IO9F 3CUQB 2HDCA 3OYLA 4ASNA 2P81A 3OL3A 1F9NA 3OYNA 1LEAA 2BHZA 3RPUD 4HX4A 4AIDA 3CMAI 2NNYA 5L3EA 2ICWG 3AL0B 2MW8A 2X6XA 3L2WA 4O6JA 4ZDOA 2PMZN 5E8IA 1VQKI 1LDJA 2JSPA 5ICGA 1VF9A 3CZ6A 3COAC 2N8GA 4HDVA 5LHGA 2HKOA 1KU7A 3MEXA 4F7ZA 2EA2A 2YS9A 4HOBA 2Z16A 1XGNA 1FP1D 3Q9SA 3J81Z 4D9JA 1Y1WJ 5IP6A 4IJAA 3HM5A 5CPRB 4BU2A 3IL2A 3BCAA 3EQLF 4S05A 1WFXA 4J19A 1ON1A 3BT9A 1I27A 5FFXA 2X51A 2ME0A 3TO7A 4EJVA 3NRVA 5A2QZ 2Z33A 2DXIA 5BOXA 4M6YA 2R7UA 1JGSA 2CSOA 2CH0A 4AWXB 5J8FA 5CVIA 1MMAA 2RC4A 4PZJA 4XLCA 1BC7C 3CJNA 5CQGA 2X6YA 5F6FA 1U3EM 3SDBA 1ZLJA 3CCYA 3MKZA 3D5RC 3A1YA 1A5JA 5DTDA 2VB6A 3L1PA 3RI4A 3ONQA 3VSKA 2XAFA 1ETWA 4KT5C 5FKLA 1IG7A 3ZQFA 2HFHA 1ZHFA 2A69F 2R7WA 3HSEA 5F0FA 3H0DA 1HKSA 4B3AA 2R7RA 2KDOA 3DWLE 2JTVA 4A0ZA 3SZTA 3EUAA 2VBZA 4HLXA 4L5EA 5E1WA 2XAHA 1WI9A 5F64A 4MHGA 3GTMJ 2OTJI 3CMYA 1TW2A 4EM2A 4RGRA 4J00A 2M2EA 4BKXA 4D0PA 1IRXA 2WWYA 2YU3A 1FMWA 3J7AO 1LB2A 1HKTA 1IN8A 3HTUA 3OYBA 3L2QA 1YYVA 2G7UA 3LAJA 3SHFA 1GLNA 2ZXJA 3ML6A 4P9UA 5JVGF 1W7PA 3BR1A 1JKQC 2P7CB 3HPHA 4A69C 2ZXIA 4HW0A 4KT6A 2W85A 2DMTA 4P55A 1I50J 3A02A 3QPSA 3KZIC 1WKMA 1GT0C 1R4MB 2L7FP 4NBQA 1NTCA 5BNGA 5EG0A 2KJCA 3F8NA 2VJ4A 4MGRA 5D4SA 3PSIA 3CCUI 2KIMA 1XN7A 3TDUC 1FTZA 4ZJZA 5LHHA 1GXPA 3RQ4A 2DCEA 2LDUA 3V42A 1V5FA 4F55A 3K70D 2HQNA 3ZGKA 3QYEA 2M4KA 3S2DJ 3CF5F 2XROA 2BXYA 2YSRA 2DFHA 4ZZLA 4IZZA 1J2XA 1FOYA 1I39A 4BACA 4JBAA 2CW0F 1OCTC 5JHFA 1WJFA 3LSKA 2A5YB 4XKVA 3K10A 3JRIA 2ISZA 3VWBA 2EZIA 3RCOA 3OSGA 3BTJA 3K1NA 3EYIA 1U5TB 4CICA 1HKQA 3CUQC 3DTIA 2LVSA 3QRFF 2L5QA 3K2ZA 2VOPA 2GAUA 1P92A 2LG4A 1R1TA 2M4GA 3TOBA 2DTRA 2ZXHA 2HVSA 1R00A 5BPIA 1FLIA 5ICCA 4UUSA 1ZH5A 4I0AA 5DM6F 5J3LA 3S3NA 3R6SA 4MFEA 2ISYA 1QNTA 2CV2A 2ELHA 1N78A 5FLVA 1XSXA 4LLLA 4NHJA 2AS5F 3GXOA 5EZGA 3NWSA 2P8TA 1FYLA 2HOTA 1AA7A 1UG2A 1OQYA 1GXQA 3G1OA 3E6DA 3GTLJ 5DCMA 1OFCX 3ZQ7A 2DU9A 2LY9A 1XS9A 4BQNA 1F43A 2HYJA 1KYZA 5GAGJ 4L9TA 1BA5A 1H88C 4QIWN 2YU9J 3FXOA 4DIQA 3DTEA 2FXAA 1WH7A 3T5XA 4B43A 2FF4A 2XKOA 1XDSA 1MBFA 3BQYA 1MDMA 1FOXA 4RMNA 2IXSA 2DYRH 2HNHA 4KIGA 5GPCA 1S5LC 3P9IA 3T0YA 3OS1A 2FOWA 3QQAA 2EIKH 1JI8A 2HTJA 5K1YA 4HDUA 1TWFJ 4FHTA 4XK4A 3TP3A 3MZHA 3OYIA 4QSHA 3W2VA 2P0WA 2P6SA 5KAIC 1JJ8C 1XMKA 1B1BA 3U1KA 4XRMA 4JOMA 5ILSA 4DYRA 4BAYA 2FU4A 2DAOA 4PGHA 4MIMA 3UKGA 3H9JA 3I3LA 1ZRFA 3QP6A 1U78A 3CLOA 3I59A 2XGEA 1A36A 2JA6J 2XSJC 2ELJA 1HSTA 2K9QA 3ABTA 3NWTA 4F52A 3BC8A 3FZVA 2X85A 5FKNA 1R7JA 1MMDA 3S17J 1ZGJA 1USSA 2KFDA 5KVRA 2OV7A 3BWGA 2C6YA 2PJPA 1K83J 2WAEA 2BV6A 1VQ9I 1YRNA 3C1DA 1I5ZA 1STZA 1X19A 2R7VA 1T0FA 3KEYA 2A05A 3GBGA 3FMSA 1YOVB 5CVUA 3V7SA 3HZJA 4IF4A 1SC7A 2BY2A 3DFGA 2IEKA 4V19K 2WAQN 4YRVA 4M3EA 1RZ4A 2EZKA 2P6TA 4HNVA 3B73A 1JUPA 2NXNB 1KQ9A 1W5SA 1CF7A 3RSNA 2NOGA 2QYOA 4J01A 3AAFA 4HBLA 3ZPLA 4C30A 1DQUA 3Q3SA 1FX7A 3OR1C 4LG0B 4D7MA 3CC4I 1JUSA 2JJ7A 3PQJA 2DOEA 3ULQB 2IS4A 4GO1A 3WGHA 2VC1A 4YFNF 1IXSB 2EFQA 3QYFA 3MN2A 1U5TC 2QBYA 4BXXJ 1WJ5A 2LNBA 4CYCB 4ENJA 3M4OJ 2L54A 3P5JA 3DLLF 4KICA 2B0LA 3M9AA 4OWRB 4HNTA 4XMYA 1S8NA 1ZG5A 4IQ4A 1NK2P 4HQMA 2CQQA 2L02A 2E5NA 3RJPA 4D1QA 2VT3A 4K2EA 3O2PE 3VYTB 5L3CA 2LF7A 2CFOA 4E7LA 1TZLA 5D8KB 3IC7A 2X0LA 4A3MJ 5EGOB 4RGSA 3K69A 3HIFA 1R71A 2RQQA 4MEYF 4CSWA 4AIKA 3RZOJ 1Y1VJ 3CO6C 1W0TA 3IUOA 3ASNH 3VYSB 1REPC 3V7CA 1ZAOA 2CWEA 2DT7B 4BBSJ 6PAXA 1QZZA 2QLZA 3OV8A 4BXUA 2Y75A 1Z9CA 3X2QH 2OUMA 3ZMDA 4BE1A 1QPIA 1M1EB 3JREA 2QQ8A 2ZJ2A 5LRSA 4A6DA 3HPGA 3PUFA 4KNYA 1LDKB 2QZ8A 3E6MA 1SD6A 3J80K 3S32A 3I4NJ 3I54A 4PJJA 2KT0A 2ZB9A 2NYXA 4HA8A 2DA3A 3K6GA 3WTYC 3TKYA 3BLYA 3DKWA 3BY6A 1Z7UA 4G9YA 4ESBA 4BY1J 2GXBA 3K70C 3KZYA 2VQGA 4JX4A 3JRGA 1IDZA 5TGTA 3HGYA 2QUFA 1FBQA 4BL0B 2DMUA 2O03A 3M8FA 1ETXA 1FWZA 1MIJA 3O8HA 3DTKA 2LKPA 2CMPA 2RN7A 4XLPF 3GTQJ 2EQRA 3HOYJ 5GADJ 5E3OA 4IPAA 1MNEA 2DA4A 2MD0A 3NQOA 1BL0A 5HODA 1G2HA 4MFDA 1BR2A 1HLVA 4XLNF 2JT1A 1X1BA 2BOLA 3BPVA 1W36C 3FKIJ 5F08A 4XRSG 1TT0A 4XLAA 1AKHA 1MBKA 3I64A 1BI2A 2VPRA 2W1OA 1R49A 1POGA 3F6OA 1XD7A 2IA1A 4UV8A 1VI0A 1I3QJ 3BP8A 5LHIA 4CXFA 1OLTA 2O8XA 4A0XA 1LKXA 1B8IA 4ZYGA 4A3BJ 1O3QA 1KZHA 1WGXA 2DPUA 5ILUA 1G8XA 2KMUA 5AIPA 2MBFA 1I3AA 3KIOA 2Y48A 2B63J 1QO0D 3KPHA 1FSEA 2R93J 3OYGA 4M71A 2X9DA 4DBRA 3CO7C 3J7YJ 5DV5A 1R5GA 4LFUA 4KN7X 4EJTA 2L9SA 2IS1A 2O7OA 2DMPA 3IAS2 1TQMA 1PUFA 2ZNYA 5HDKA 3ZN1A 2OC6A 4FT8A 1F36A 1OCZH 3HKZA 4G8XA 4XLEA 2K5CA 1W7PB 1K7AA 4ITVA 2XAQA 2OCEA 1YW7A 4II3A 5EEHA 1J59A 2IT0A 5LEJA 1F1ZA 1MMGA 4LB6B 3MKYB 2LBFB 1YITI 3S2WA 3CC7I 1P6RA 3LL7A 1H8AC 2XF5A 1WCMJ 4B1RA 4BHPA 1UB9A 2DLLA 2FMYA 4UXNA 3OS0A 1HXDA
chains in the Genus database with same CATH topology
2XVCA 2PFBA 2L4MA 5E20A 2RQPA 2PQ8A 3WTXC 4HYEA 4RGXA 1DP7P 2M5WA 4ESJA 2DQRA 1I6XA 5KK1A 2K4JA 1B59A 3SZPA 2WC2A 3ISPA 1OMIA 1XGMA 4MQVA 3O3KA 2XHKA 1ZREA 2VE8A 1K78A 1EH7A 3J80Z 2FNAA 3V4GA 1RIOH 4G7OF 3FXQA 4WXHA 2KIUA 1WSUA 4AVPA 3RTRA 4FX4A 5D5VB 4KMUX 3QU6A 5DCMB 1EV7A 1MJ9A 3HRUA 2CFXA 3VOEA 1PP8F 2W25A 1W5TA 2MC3A 1FY7A 1G3WA 2WV0A 1R1VA 4QWQA 4IRIA 2V9VA 3IHUA 2ETHA 3DQVC 3SFZA 3ABUA 2P5VA 4WK8F 3GWZA 2QM3A 1QZYA 3VFZA 3QPHA 2NAZA 1HSJA 3JW4A 2R7FA 1O3RA 2OD5A 1JHFA 3MQ0A 3ZP5A 5LEKA 3I59B 3DP7A 1E17A 1X3UA 2JSCA 1IXCA 2VT2A 3WE3A 3F23A 2J5OA 3KZZA 2GWRA 1SFUA 1OPCA 2KJBA 4L9VA 2Q8KA 2HYFA 5E1XA 3KETA 1JHHA 3F8FA 4EJWA 1C0WA 1U2WA 4A5MA 4HF2A 3G73A 1ZYRF 1VTNC 1DPUA 3LA7A 3L7WA 2D2WA 5LLQA 5D4RA 4I02A 2Q2EA 2K02A 3L2CA 1XSDA 5LGTA 3I4PA 4ZH4F 2L01A 5DUKA 1BBYA 4EJUA 2HQRA 1YFHA 2QBYB 2FEZA 3JTGA 3WGGA 4LK0F 1MJBA 5J8CA 2CO5A 4N0BA 5D6FA 1USTA 4AIHA 1XCVA 1S6LA 3TQNA 3JAMK 2MA3A 2P7VB 3HOSA 1KU3A 1MGTA 4KYWA 2OA4A 5BQTA 3SQNA 2ZO4A 2K4BA 4KUMA 4L5JA 1FNNA 1HW2A 4G6DA 2FSWA 3N97A 1OYIA 1TTYA 2JZYA 3EDPA 4M9ZA 4LGWA 3KEQA 4ENNA 2OBPA 3WGIA 3B02A 2DW4A 2JPCA 3K1MA 1D8KA 2ESHA 3N4MA 1F5TA 1LQ1A 5LRRA 2IPQX 1GVJA 2XUBA 3M8EA 1O7FA 1B4AA 3FM5A 5J6XA 3U9GA 3GW2A 3WU1B 4MQ9F 3EUHA 3GLXA 2A68F 1TQIA 2NS0A 3U1DA 4CDGA 3Q9VA 5ED4A 4ZYEA 1Q1HA 1BI1A 1AOYA 5AONA 2MD5A 1ZGAA 1R36A 2EJRA 4XSZF 3EETA 5IT9K 1ZRDA 2Y0MA 3MZYA 1B6AA 3V8JA 2D1HA 1FSHA 2KRFA 1DUXC 2E7WA 5TRDA 4U0WA 2M8EA 4EMSA 1KQ8A 1FBUA 3LA2A 2FBIA 4BQAA 2DO7A 3OOPA 5HDNA 5K5OA 3BJOA 3R4KA 3GO5A 3HHGA 4PDKA 1EH6A 4EGYA 2YX4A 3KLOA 2H27A 3KP2A 3QP5A 4HX7A 4HV6A 2F5EA 4B8XA 3JAMZ 4NQWA 3MWMA 5ICFA 3BOQA 2ACJA 1TQPA 4U7BA 3E5XA 2E1CA 2O0YA 4EM1A 3E3VA 3LA3A 4LMYA 1IF1A 5H6QA 2A6EF 3WTSC 1TW3A 1K78B 1DPRA 5LGNA 2CG4A 4WX9A 3L00A 4TV7A 2FOKA 4NB5A 2A3SA 4ZYDA 3DEUA 1BM9A 5E17F 2RVCA 5DDGA 1P2FA 1U6GA 2RGVA 4XSXF 3P9KA 2K86A 5HVQC 1EH8A 2M87A 3U2RA 3WTZA 1G3SA 3KP7A 2UXXA 2D45A 1RNLA 1O3TA 4M73A 3PQKA 4ENMA 3RYRA 1KU2A 2PN6A 1G3TA 3QPTA 1S7OA 1RUOA 2Q0OA 1Z6TA 4RGUA 2DBBA 2PMHA 1I1SA 5FO5A 3ERED 3FX3A 2W57A 1D5VA 3FMQA 4GYGA 3ZN0A 2MH2A 1BOAA 2Z9OA 3FF5A 3BJAA 3V7RA 2E7XA 3GVAA 3CTAA 1HW1A 1BIAA 3W6KB 5IT9Z 1BIBA 1H0MA 5K5RA 1UHWA 2XIGA 1O7LA 1AWCA 2EFPA 4KN4X 4YG2F 3H92A 1YS6A 1XMAA 2LF8A 2QENA 1GHCA 3DXJF 3L9FA 4Q5SF 5TJJA 2HGCA 3LAPA 1ZG1A 1YIOA 4HF1A 5H20A 2IW5A 1LJ9A 2HS5A 3RKWA 1IN7A 1CGPA 2IJLA 4IVNA 3MCZA 4LB5A 5D5XB 2IP2A 2DI3A 3DPLC 4UUVA 1W7PD 4WCGA 2VBXA 3EYYA 2H6CA 4M72A 3D5LA 4A0YA 1JXSA 5D8LB 4U7DA 2A07F 4UVCA 1J7KA 4WXDA 1IRGA 2HTSA 3M7GA 2EA4A 3I58A 1PDNC 3LSTA 1ON2A 4U88A 4BHCA 3RPUA 1F4KA 1LNWA 4IRGA 2R7DA 2V1DA 2XASA 4OIOF 3SXYA 3I5UA 1SD5A 3D0SA 3ROUA 1ZRCA 2KKOA 1XCBA 2GQQA 4ENKA 5DCFA 4BYYA 1OR7A 4OIQF 4I0BA 2XAJA 1BC8C 3F8CA 2ZMEA 4RAYA 2OZUA 1B9NA 5DEQA 3FM3A 2XAGA 5FD5A 3KP4A 2Z99A 4CHUA 2VE9A 5HLGA 4M6XA 2W84A 3I71A 2EFNA 1BI0A 5CYVA 4L9JA 1G3YA 3HSFA 2EV6A 4MTEA 5FFZA 1L0OC 1UCRA 4OINF 2EV0A 4OMYA 2VBWA 4OIPF 3G3ZA 1B9MA 3JTHA 2FE3A 1TBXA 2EFOA 1SD7A 1R5HA 2V6CA 5L3DA 3RKYA 2V79A 1OYWA 1O3SA 2RV8A 2DQLA 1Z1DA 4EM0B 3P9CA 1T98A 3PFIA 5L3FA 1A04A 3WU0A 1XGOA 1R1UA 3Q5FA 4M74A 4RB3C 1UHMA 3GFLA 2QWWA 4XBFA 1LEBA 3FMRA 4HQEA 4ETSA 4YFXF 3ZMVA 4P9FA 3V8LA 3DV8A 4UNOA 3QOPA 4O5VA 3F8BA 4LK1F 4OU0A 4FX0A 1LDDA 3E6BA 2M1BA 2STTA 3RIRA 2VXZA 2V1XA 3GF2A 4L9NA 1U8RA 1G4DA 1QQIA 2GA1A 3HRTA 3QU3A 3TDZC 3W6JB 4Z2YA 4BNCA 3IRQA 1IN5A 2BGCA 2HR3A 5ILVA 3GZ5A 4R1HA 2L3DA 3IKVA 2PBIA 3RKXA 4LD5A 2CYYA 1Z91A 4Q48A 1YW9A 5DD4A 3ZMTA 5HS7A 3FXRA 5JFRA 4CZZA 4KIFA 1IW7F 4U0YA 3H3UA 3WG9A 5BPDA 4S04A 3IWFA 1XDUA 1D8JA 1FOKA 4N9IA 1HBXG 2RDPA 1H9GA 1ZG3A 4RS8A 2BBYA 2HOEA 1YG2A 2H94A 2QQ9A 3ECHA 2QQAA 2FQ3A 3K0LA 1KA8A 4M9SA 2CGPA 3IKTA 2Z5UA 2ZFWA 4JQFA 2L4AA 2GIVA 4PCQA 4RAZA 3T1BA 4I09A 1MKMA 4YFKF 5JVTA 3CDHA 5D5UB 5K5QA 4G7ZF 1HQCA 5HS8A 1KYWA 3F8MA 3GUDA 1FC3A 5L3BA 1H9TA 5L3GA 2RKHA 2IA0A 2F5CA 3HHHA 2VOOA 1PP7U 1YLFA 2FNPA 4AD9A 1OKRA 2H6BA 2UWMA 5FB2A 2FMLA 4G6QA 2NNNA 1FBSA 2EB7A 4WWCA 4RB2C 5FD6A 2DK5A 1J0RA 4QLCU 3H3ZA 2A6HF 4ZZDA 4IHTA 1R22A 3F72A 4L18B 2F5FA 4Q47A 2F2EA 2ZKZA 4MTDA 4GCVA 3KLNA 3WTTC 4YIIA 4KFCA 2PEXA 4G7HF 3L09A 4I98B 4IHSA 3JSOA 1YO5C 2UXNA 1LVAA 3K1PA 2P5KA 3HUGA 2BE5F 4GYIA 3TO9A 3HSRA 4A6EA 3MAJA 1ZARA 1ODDA 2H09A 2ZMEB 1SD4A 2G7HA 4G94A 1E2XA 1R58A 5E18F 2W24A 1S3JA 1ULYA 3F22A 1ZLKA 1IN4A 3BPXA 5HLIA 4Y17A 3MFKA 1O57A 4ESFA 1FYMA 1QPMA 2PG4A 3HOTA 1K79A 3FHZA 3GFJA 3NEUA 5FGMA 5ICEA 5LGUA 3HRMA 2P5LC 1XB4A 3KP6A 4ON0A 2UZKA 2F5DA 4XRFA 1SFEA 3FWEA 4R79A 1WWXA 5EEGA 1S7AA 2PLYA 1P4WA 3KFWX 3KE2A 3KCCA 1KU9A 4IRHA 4BH9A 3LFKA 1T6SA 2M45A 2VC0A 4UVAA 3VB2A 2JPBA 2VODA 4UV9A 1L3LA 4KDPA 4Y13A 3P7NA 3LQRA 3VODA 4U0VA 4CO8A 3GYHX 3LWFA 2MLKA 1ONVA 2ESNA 4A5NA 2VN2A 2XRNA 1P4AA 2AXLA 4KIBA 3REOA 2E1NA 3O6BB 2GZWA 1IN6A 4L5IA 4M9XA 5E1ZB 2IRFG 4JK1X 2Z3YA 4HLYA 5H6RA 1J75A 3WTWC 1P4XA 1FZPB 4I2OA 2NRAC 3E5QA 2BEOA 3KP5A 5HOOA 1JE8A 3ZMUA 1FT9A 5HLHA 3ELKA 3M1EA 1IZ1A 1IRFA 3TOAA 3F21A 5AIQA 2HWVA 4N9HA 3CUQA 1IAWA 3ZMSA 4OIRF 5JR3A 2QQBA 4YIFA 2IA2A 4UVBA 3DPTA 2WTEA 2K27A 3C3WA 4LJZF 3C7JA 4P5OA 1Y0UA 2ADUA 4E70A 2O61A 4HAMA 2VBYA 3IRRA 4L0ZB 4HZFA 2XGXA 5F1RA 3RYPA 2X4HA 2COMA 4EQQA 5CVVA 4Y15A 2MH9A 2YR2A 4HX8A 1YTYA 5BS6A 4CYDA 2HYGD 2CQKA 3BDDA 3GZ6A 4KA4A 1Z05A 1TNTA 3K9TA 4OMZA 2G9WA 4EJOA 5FLXK 4EGZA 1V4RA 1FP2A 5DUIA 2OQGA 1T39A 1R23A 2HKXA 2M30A 1SMTA 1RI7A 2EV5A 5LBQA 4DNCA 3KP3A 4A2UA 4RB0A 2FA5A 2OAZA 3GFMA 4B09A 2P4WA 4L0YB 1TNSA 3GEZA 1BJAA 3E6CC 5ERIA 2YPRA 3KEOA 4OOIA 3HTSB 3TGNA 2FRHA 2K7LA 3DF8A 3HRSA 1T38A 5DYMA 5CVJA 2TDXA 5D6EA 5BMZA 1BI3A 3CUOA 2GA2A 3HYIA 3IWZA 3WTVC 2GXGA 2MLGA 1TLHB 4WXCA 5CVRA 2PI0A 2FBHA 3ECOA 1SMYF 2FBKA 1U5TA 2DPDA 1XSVA 4HV5A 3VEPA 2EK5A 2EWNA 3WODF 4IXAA 2O3FA 4P96A 5DD8A 2KIFA 2V1UA 1K6OA 2VONA 4I7HA 4LLNA 2ZCWA 2BYVE 1J5YA 1Z6RA 2A61A 2O6GE 3R0AA 1I1GA 3R61A 4BHBA 3E97A 1V3FA 1FPQA 1S29A 4RB1A 1KGSA 3GFIA 4O3MA 3RPQA 1BN5A 1T2KA 3BROA 3F3XA 3I0TA 4EV0A 1KQ0A 4WF2A 4ZYHA 2OU2A 2STWA 1ZN2A 1MD0A 3F6VA 3J81K 3BZ6A 2DT5A 4EVIA 5FLXZ 5A2QK 3T8RA 2EFWA 1UFMA 1W4MA 4Q4ZF 1DDNA 4MNUA 3QAHA 4DQ2A 1OYYA 4CGZA 2HEOA 4A12A 2D1VA 3GX4X 5JI6A 1QBJA 4GGGA 1XGSA 3WE2A 3R0JA 2YX7A 2OQRA 1MDMB 1RUNA 3C18A 1YQAA 2R3SA 3RDIA 3I53A 4PGGA 5HS9A 1J9IA 1D3YA 1MJAA 5D5WB 2HZTA 1HW5A 2XV4S 2OZ6A 1IXRC 3T8TA 2RNJA 2XKPA 4I01A 4MEXF 3BJ6A 1G6NA 1WRJA 4AIJA 4LG0A 1PUEE 1YW8A 3FXUA 3R60A 4LLGF 2JRTA 3TO6A 3LQQA 4R8HA 4GXOA 5JHUA 2ZBKA 2DFIA 5CLSA 1MZBA 1NHAA 2IVMA 4HF0A 4H0EA 4UHTA 2ZNZA 1SAXA 2J5PA 1IUYA 3E5UA 5CJ9A 3JSPA 5IT3A 1QGPA 1FYKA 2QVOA 1YS7A 1SFXA 5E8GA 4KMFA 2LSOA 3WTUC 3V8KA 3ZMZA 1WQ2A 5HDGA 2DK8A 1CF7B 2PMUA 3CUQB 2HDCA 4ASNA 1F9NA 1LEAA 4HX4A 2NNYA 5L3EA 4O6JA 5E8IA 1LDJA 5ICGA 3COAC 4HDVA 5LHGA 2HKOA 1KU7A 3MEXA 4F7ZA 2EA2A 4HOBA 1XGNA 1FP1D 3Q9SA 3J81Z 4IJAA 3IL2A 3EQLF 4S05A 1ON1A 1I27A 5FFXA 3TO7A 4EJVA 3NRVA 5A2QZ 2Z33A 5BOXA 4M6YA 1JGSA 2CSOA 4AWXB 5J8FA 5CVIA 2RC4A 4PZJA 1BC7C 3CJNA 5F6FA 1U3EM 1ZLJA 3RI4A 2XAFA 4KT5C 2HFHA 1ZHFA 2A69F 3HSEA 1HKSA 2JTVA 4A0ZA 3SZTA 4HLXA 2VBZA 5E1WA 2XAHA 1WI9A 5F64A 4MHGA 1TW2A 4EM2A 4RGRA 4D0PA 2WWYA 2YU3A 1HKTA 3J7AO 1LB2A 1IN8A 3HTUA 1YYVA 2G7UA 3LAJA 3SHFA 2ZXJA 3ML6A 4P9UA 1W7PA 2P7CB 4HW0A 2W85A 4P55A 1WKMA 2KJCA 3F8NA 4MGRA 5D4SA 2KIMA 1XN7A 3TDUC 5LHHA 1GXPA 2LDUA 2HQNA 2XROA 2YSRA 4ZZLA 1J2XA 4JBAA 2CW0F 2ISZA 2A5YB 3K1NA 3EYIA 1U5TB 4CICA 1HKQA 3CUQC 3QRFF 2VOPA 3K2ZA 2GAUA 1P92A 1R1TA 3TOBA 2DTRA 1FLIA 1R00A 5BPIA 5ICCA 1ZH5A 4I0AA 3R6SA 2ISYA 1QNTA 2ELHA 1XSXA 4LLLA 4NHJA 2AS5F 3GXOA 2P8TA 1FYLA 1GXQA 3E6DA 5DCMA 3ZQ7A 2DU9A 1KYZA 4L9TA 2FXAA 3T5XA 2FF4A 2XKOA 1XDSA 1MDMA 4KIGA 3P9IA 3T0YA 2HTJA 5K1YA 4HDUA 4FHTA 3MZHA 2P6SA 1XMKA 1B1BA 5ILSA 4BAYA 2FU4A 2DAOA 4PGHA 1ZRFA 3QP6A 1U78A 3CLOA 3I59A 1HSTA 3ABTA 3FZVA 1R7JA 1ZGJA 1USSA 5KVRA 3BWGA 2C6YA 2PJPA 2BV6A 3C1DA 1I5ZA 1STZA 1T0FA 3FMSA 5CVUA 3V7SA 4IF4A 3DFGA 1RZ4A 2P6TA 3B73A 1KQ9A 1W5SA 1CF7A 2QYOA 3AAFA 4HBLA 3ZPLA 1FX7A 4LG0B 3PQJA 3ULQB 4GO1A 3WGHA 2VC1A 4YFNF 1IXSB 2EFQA 1U5TC 2QBYA 2LNBA 4ENJA 2L54A 4KICA 2B0LA 3M9AA 1S8NA 1ZG5A 4HQMA 2L02A 3RJPA 2VT3A 4K2EA 3O2PE 5L3CA 2LF7A 5D8KB 3IC7A 2X0LA 4RGSA 3K69A 3HIFA 4MEYF 4AIKA 3CO6C 1REPC 3V7CA 1ZAOA 2CWEA 6PAXA 1QZZA 2QLZA 3OV8A 4BXUA 2Y75A 1Z9CA 3ZMDA 2ZJ2A 5LRSA 4A6DA 4KNYA 1LDKB 2QZ8A 3E6MA 1SD6A 3J80K 3I54A 2NYXA 4HA8A 3WTYC 3TKYA 3DKWA 3BY6A 1Z7UA 4G9YA 4ESBA 2GXBA 3KZYA 2QUFA 1FBQA 2O03A 3M8FA 1FWZA 2LKPA 2RN7A 4XLPF 4IPAA 3NQOA 4XLNF 2JT1A 3BPVA 3I64A 1BI2A 3F6OA 1XD7A 2IA1A 4UV8A 3BP8A 4CXFA 5LHIA 2O8XA 4A0XA 4ZYGA 1O3QA 2DPUA 5ILUA 5AIPA 2MBFA 2Y48A 1QO0D 1FSEA 4M71A 3CO7C 5DV5A 1R5GA 4LFUA 4KN7X 4EJTA 1TQMA 2ZNYA 5HDKA 3ZN1A 4FT8A 4G8XA 1W7PB 1K7AA 2XAQA 1YW7A 5EEHA 1J59A 2IT0A 5LEJA 1F1ZA 4LB6B 3S2WA 1P6RA 4BHPA 1UB9A 2DLLA 2FMYA 4UXNA 1HXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XVC A;  2PFB A;  2L4M A;  5E20 A;  2RQP A;  2PQ8 A;  3WTX C;  4HYE A;  4RGX A;  1DP7 P;  2M5W A;  4ESJ A;  2DQR A;  1I6X A;  5KK1 A;  2K4J A;  1B59 A;  3SZP A;  2WC2 A;  3ISP A;  1OMI A;  1XGM A;  4MQV A;  3O3K A;  2XHK A;  1ZRE A;  2VE8 A;  1K78 A;  1EH7 A;  3J80 Z;  2FNA A;  3V4G A;  1RIO H;  4G7O F;  3FXQ A;  4WXH A;  2KIU A;  1WSU A;  4AVP A;  3RTR A;  4FX4 A;  5D5V B;  4KMU X;  3QU6 A;  5DCM B;  1EV7 A;  1MJ9 A;  3HRU A;  2CFX A;  3VOE A;  1PP8 F;  2W25 A;  1W5T A;  2MC3 A;  1FY7 A;  1G3W A;  2WV0 A;  1R1V A;  4QWQ A;  4IRI A;  2V9V A;  3IHU A;  2ETH A;  3DQV C;  3SFZ A;  3ABU A;  2P5V A;  4WK8 F;  3GWZ A;  2QM3 A;  1QZY A;  3VFZ A;  3QPH A;  2NAZ A;  1HSJ A;  3JW4 A;  2R7F A;  1O3R A;  2OD5 A;  1JHF A;  3MQ0 A;  3ZP5 A;  5LEK A;  3I59 B;  3DP7 A;  1E17 A;  1X3U A;  2JSC A;  1IXC A;  2VT2 A;  3WE3 A;  3F23 A;  2J5O A;  3KZZ A;  2GWR A;  1SFU A;  1OPC A;  2KJB A;  4L9V A;  2Q8K A;  2HYF A;  5E1X A;  3KET A;  1JHH A;  3F8F A;  4EJW A;  1C0W A;  1U2W A;  4A5M A;  4HF2 A;  3G73 A;  1ZYR F;  1VTN C;  1DPU A;  3LA7 A;  3L7W A;  2D2W A;  5LLQ A;  5D4R A;  4I02 A;  2Q2E A;  2K02 A;  3L2C A;  1XSD A;  5LGT A;  3I4P A;  4ZH4 F;  2L01 A;  5DUK A;  1BBY A;  4EJU A;  2HQR A;  1YFH A;  2QBY B;  2FEZ A;  3JTG A;  3WGG A;  4LK0 F;  1MJB A;  5J8C A;  2CO5 A;  4N0B A;  5D6F A;  1UST A;  4AIH A;  1XCV A;  1S6L A;  3TQN A;  3JAM K;  2MA3 A;  2P7V B;  3HOS A;  1KU3 A;  1MGT A;  4KYW A;  2OA4 A;  5BQT A;  3SQN A;  2ZO4 A;  2K4B A;  4KUM A;  4L5J A;  1FNN A;  1HW2 A;  4G6D A;  2FSW A;  3N97 A;  1OYI A;  1TTY A;  2JZY A;  3EDP A;  4M9Z A;  4LGW A;  3KEQ A;  4ENN A;  2OBP A;  3WGI A;  3B02 A;  2DW4 A;  2JPC A;  3K1M A;  1D8K A;  2ESH A;  3N4M A;  1F5T A;  1LQ1 A;  5LRR A;  2IPQ X;  1GVJ A;  2XUB A;  3M8E A;  1O7F A;  1B4A A;  3FM5 A;  5J6X A;  3U9G A;  3GW2 A;  3WU1 B;  4MQ9 F;  3EUH A;  3GLX A;  2A68 F;  1TQI A;  2NS0 A;  3U1D A;  4CDG A;  3Q9V A;  5ED4 A;  4ZYE A;  1Q1H A;  1BI1 A;  1AOY A;  5AON A;  2MD5 A;  1ZGA A;  1R36 A;  2EJR A;  4XSZ F;  3EET A;  5IT9 K;  1ZRD A;  2Y0M A;  3MZY A;  1B6A A;  3V8J A;  2D1H A;  1FSH A;  2KRF A;  1DUX C;  2E7W A;  5TRD A;  4U0W A;  2M8E A;  4EMS A;  1KQ8 A;  1FBU A;  3LA2 A;  2FBI A;  4BQA A;  2DO7 A;  3OOP A;  5HDN A;  5K5O A;  3BJO A;  3R4K A;  3GO5 A;  3HHG A;  4PDK A;  1EH6 A;  4EGY A;  2YX4 A;  3KLO A;  2H27 A;  3KP2 A;  3QP5 A;  4HX7 A;  4HV6 A;  2F5E A;  4B8X A;  3JAM Z;  4NQW A;  3MWM A;  5ICF A;  3BOQ A;  2ACJ A;  1TQP A;  4U7B A;  3E5X A;  2E1C A;  2O0Y A;  4EM1 A;  3E3V A;  3LA3 A;  4LMY A;  1IF1 A;  5H6Q A;  2A6E F;  3WTS C;  1TW3 A;  1K78 B;  1DPR A;  5LGN A;  2CG4 A;  4WX9 A;  3L00 A;  4TV7 A;  2FOK A;  4NB5 A;  2A3S A;  4ZYD A;  3DEU A;  1BM9 A;  5E17 F;  2RVC A;  5DDG A;  1P2F A;  1U6G A;  2RGV A;  4XSX F;  3P9K A;  2K86 A;  5HVQ C;  1EH8 A;  2M87 A;  3U2R A;  3WTZ A;  1G3S A;  3KP7 A;  2UXX A;  2D45 A;  1RNL A;  1O3T A;  4M73 A;  3PQK A;  4ENM A;  3RYR A;  1KU2 A;  2PN6 A;  1G3T A;  3QPT A;  1S7O A;  1RUO A;  2Q0O A;  1Z6T A;  4RGU A;  2DBB A;  2PMH A;  1I1S A;  5FO5 A;  3ERE D;  3FX3 A;  2W57 A;  1D5V A;  3FMQ A;  4GYG A;  3ZN0 A;  2MH2 A;  1BOA A;  2Z9O A;  3FF5 A;  3BJA A;  3V7R A;  2E7X A;  3GVA A;  3CTA A;  1HW1 A;  1BIA A;  3W6K B;  5IT9 Z;  1BIB A;  1H0M A;  5K5R A;  1UHW A;  2XIG A;  1O7L A;  1AWC A;  2EFP A;  4KN4 X;  4YG2 F;  3H92 A;  1YS6 A;  1XMA A;  2LF8 A;  2QEN A;  1GHC A;  3DXJ F;  3L9F A;  4Q5S F;  5TJJ A;  2HGC A;  3LAP A;  1ZG1 A;  1YIO A;  4HF1 A;  5H20 A;  2IW5 A;  1LJ9 A;  2HS5 A;  3RKW A;  1IN7 A;  1CGP A;  2IJL A;  4IVN A;  3MCZ A;  4LB5 A;  5D5X B;  2IP2 A;  2DI3 A;  3DPL C;  4UUV A;  1W7P D;  4WCG A;  2VBX A;  3EYY A;  2H6C A;  4M72 A;  3D5L A;  4A0Y A;  1JXS A;  5D8L B;  4U7D A;  2A07 F;  4UVC A;  1J7K A;  4WXD A;  1IRG A;  2HTS A;  3M7G A;  2EA4 A;  3I58 A;  1PDN C;  3LST A;  1ON2 A;  4U88 A;  4BHC A;  3RPU A;  1F4K A;  1LNW A;  4IRG A;  2R7D A;  2V1D A;  2XAS A;  4OIO F;  3SXY A;  3I5U A;  1SD5 A;  3D0S A;  3ROU A;  1ZRC A;  2KKO A;  1XCB A;  2GQQ A;  4ENK A;  5DCF A;  4BYY A;  1OR7 A;  4OIQ F;  4I0B A;  2XAJ A;  1BC8 C;  3F8C A;  2ZME A;  4RAY A;  2OZU A;  1B9N A;  5DEQ A;  3FM3 A;  2XAG A;  5FD5 A;  3KP4 A;  2Z99 A;  4CHU A;  2VE9 A;  5HLG A;  4M6X A;  2W84 A;  3I71 A;  2EFN A;  1BI0 A;  5CYV A;  4L9J A;  1G3Y A;  3HSF A;  2EV6 A;  4MTE A;  5FFZ A;  1L0O C;  1UCR A;  4OIN F;  2EV0 A;  4OMY A;  2VBW A;  4OIP F;  3G3Z A;  1B9M A;  3JTH A;  2FE3 A;  1TBX A;  2EFO A;  1SD7 A;  1R5H A;  2V6C A;  5L3D A;  3RKY A;  2V79 A;  1OYW A;  1O3S A;  2RV8 A;  2DQL A;  1Z1D A;  4EM0 B;  3P9C A;  1T98 A;  3PFI A;  5L3F A;  1A04 A;  3WU0 A;  1XGO A;  1R1U A;  3Q5F A;  4M74 A;  4RB3 C;  1UHM A;  3GFL A;  2QWW A;  4XBF A;  1LEB A;  3FMR A;  4HQE A;  4ETS A;  4YFX F;  3ZMV A;  4P9F A;  3V8L A;  3DV8 A;  4UNO A;  3QOP A;  4O5V A;  3F8B A;  4LK1 F;  4OU0 A;  4FX0 A;  1LDD A;  3E6B A;  2M1B A;  2STT A;  3RIR A;  2VXZ A;  2V1X A;  3GF2 A;  4L9N A;  1U8R A;  1G4D A;  1QQI A;  2GA1 A;  3HRT A;  3QU3 A;  3TDZ C;  3W6J B;  4Z2Y A;  4BNC A;  3IRQ A;  1IN5 A;  2BGC A;  2HR3 A;  5ILV A;  3GZ5 A;  4R1H A;  2L3D A;  3IKV A;  2PBI A;  3RKX A;  4LD5 A;  2CYY A;  1Z91 A;  4Q48 A;  1YW9 A;  5DD4 A;  3ZMT A;  5HS7 A;  3FXR A;  5JFR A;  4CZZ A;  4KIF A;  1IW7 F;  4U0Y A;  3H3U A;  3WG9 A;  5BPD A;  4S04 A;  3IWF A;  1XDU A;  1D8J A;  1FOK A;  4N9I A;  1HBX G;  2RDP A;  1H9G A;  1ZG3 A;  4RS8 A;  2BBY A;  2HOE A;  1YG2 A;  2H94 A;  2QQ9 A;  3ECH A;  2QQA A;  2FQ3 A;  3K0L A;  1KA8 A;  4M9S A;  2CGP A;  3IKT A;  2Z5U A;  2ZFW A;  4JQF A;  2L4A A;  2GIV A;  4PCQ A;  4RAZ A;  3T1B A;  4I09 A;  1MKM A;  4YFK F;  5JVT A;  3CDH A;  5D5U B;  5K5Q A;  4G7Z F;  1HQC A;  5HS8 A;  1KYW A;  3F8M A;  3GUD A;  1FC3 A;  5L3B A;  1H9T A;  5L3G A;  2RKH A;  2IA0 A;  2F5C A;  3HHH A;  2VOO A;  1PP7 U;  1YLF A;  2FNP A;  4AD9 A;  1OKR A;  2H6B A;  2UWM A;  5FB2 A;  2FML A;  4G6Q A;  2NNN A;  1FBS A;  2EB7 A;  4WWC A;  4RB2 C;  5FD6 A;  2DK5 A;  1J0R A;  4QLC U;  3H3Z A;  2A6H F;  4ZZD A;  4IHT A;  1R22 A;  3F72 A;  4L18 B;  2F5F A;  4Q47 A;  2F2E A;  2ZKZ A;  4MTD A;  4GCV A;  3KLN A;  3WTT C;  4YII A;  4KFC A;  2PEX A;  4G7H F;  3L09 A;  4I98 B;  4IHS A;  3JSO A;  1YO5 C;  2UXN A;  1LVA A;  3K1P A;  2P5K A;  3HUG A;  2BE5 F;  4GYI A;  3TO9 A;  3HSR A;  4A6E A;  3MAJ A;  1ZAR A;  1ODD A;  2H09 A;  2ZME B;  1SD4 A;  2G7H A;  4G94 A;  1E2X A;  1R58 A;  5E18 F;  2W24 A;  1S3J A;  1ULY A;  3F22 A;  1ZLK A;  1IN4 A;  3BPX A;  5HLI A;  4Y17 A;  3MFK A;  1O57 A;  4ESF A;  1FYM A;  1QPM A;  2PG4 A;  3HOT A;  1K79 A;  3FHZ A;  3GFJ A;  3NEU A;  5FGM A;  5ICE A;  5LGU A;  3HRM A;  2P5L C;  1XB4 A;  3KP6 A;  4ON0 A;  2UZK A;  2F5D A;  4XRF A;  1SFE A;  3FWE A;  4R79 A;  1WWX A;  5EEG A;  1S7A A;  2PLY A;  1P4W A;  3KFW X;  3KE2 A;  3KCC A;  1KU9 A;  4IRH A;  4BH9 A;  3LFK A;  1T6S A;  2M45 A;  2VC0 A;  4UVA A;  3VB2 A;  2JPB A;  2VOD A;  4UV9 A;  1L3L A;  4KDP A;  4Y13 A;  3P7N A;  3LQR A;  3VOD A;  4U0V A;  4CO8 A;  3GYH X;  3LWF A;  2MLK A;  1ONV A;  2ESN A;  4A5N A;  2VN2 A;  2XRN A;  1P4A A;  2AXL A;  4KIB A;  3REO A;  2E1N A;  3O6B B;  2GZW A;  1IN6 A;  4L5I A;  4M9X A;  5E1Z B;  2IRF G;  4JK1 X;  2Z3Y A;  4HLY A;  5H6R A;  1J75 A;  3WTW C;  1P4X A;  1FZP B;  4I2O A;  2NRA C;  3E5Q A;  2BEO A;  3KP5 A;  5HOO A;  1JE8 A;  3ZMU A;  1FT9 A;  5HLH A;  3ELK A;  3M1E A;  1IZ1 A;  1IRF A;  3TOA A;  3F21 A;  5AIQ A;  2HWV A;  4N9H A;  3CUQ A;  1IAW A;  3ZMS A;  4OIR F;  5JR3 A;  2QQB A;  4YIF A;  2IA2 A;  4UVB A;  3DPT A;  2WTE A;  2K27 A;  3C3W A;  4LJZ F;  3C7J A;  4P5O A;  1Y0U A;  2ADU A;  4E70 A;  2O61 A;  4HAM A;  2VBY A;  3IRR A;  4L0Z B;  4HZF A;  2XGX A;  5F1R A;  3RYP A;  2X4H A;  2COM A;  4EQQ A;  5CVV A;  4Y15 A;  2MH9 A;  2YR2 A;  4HX8 A;  1YTY A;  5BS6 A;  4CYD A;  2HYG D;  2CQK A;  3BDD A;  3GZ6 A;  4KA4 A;  1Z05 A;  1TNT A;  3K9T A;  4OMZ A;  2G9W A;  4EJO A;  5FLX K;  4EGZ A;  1V4R A;  1FP2 A;  5DUI A;  2OQG A;  1T39 A;  1R23 A;  2HKX A;  2M30 A;  1SMT A;  1RI7 A;  2EV5 A;  5LBQ A;  4DNC A;  3KP3 A;  4A2U A;  4RB0 A;  2FA5 A;  2OAZ A;  3GFM A;  4B09 A;  2P4W A;  4L0Y B;  1TNS A;  3GEZ A;  1BJA A;  3E6C C;  5ERI A;  2YPR A;  3KEO A;  4OOI A;  3HTS B;  3TGN A;  2FRH A;  2K7L A;  3DF8 A;  3HRS A;  1T38 A;  5DYM A;  5CVJ A;  2TDX A;  5D6E A;  5BMZ A;  1BI3 A;  3CUO A;  2GA2 A;  3HYI A;  3IWZ A;  3WTV C;  2GXG A;  2MLG A;  1TLH B;  4WXC A;  5CVR A;  2PI0 A;  2FBH A;  3ECO A;  1SMY F;  2FBK A;  1U5T A;  2DPD A;  1XSV A;  4HV5 A;  3VEP A;  2EK5 A;  2EWN A;  3WOD F;  4IXA A;  2O3F A;  4P96 A;  5DD8 A;  2KIF A;  2V1U A;  1K6O A;  2VON A;  4I7H A;  4LLN A;  2ZCW A;  2BYV E;  1J5Y A;  1Z6R A;  2A61 A;  2O6G E;  3R0A A;  1I1G A;  3R61 A;  4BHB A;  3E97 A;  1V3F A;  1FPQ A;  1S29 A;  4RB1 A;  1KGS A;  3GFI A;  4O3M A;  3RPQ A;  1BN5 A;  1T2K A;  3BRO A;  3F3X A;  3I0T A;  4EV0 A;  1KQ0 A;  4WF2 A;  4ZYH A;  2OU2 A;  2STW A;  1ZN2 A;  1MD0 A;  3F6V A;  3J81 K;  3BZ6 A;  2DT5 A;  4EVI A;  5FLX Z;  5A2Q K;  3T8R A;  2EFW A;  1UFM A;  1W4M A;  4Q4Z F;  1DDN A;  4MNU A;  3QAH A;  4DQ2 A;  1OYY A;  4CGZ A;  2HEO A;  4A12 A;  2D1V A;  3GX4 X;  5JI6 A;  1QBJ A;  4GGG A;  1XGS A;  3WE2 A;  3R0J A;  2YX7 A;  2OQR A;  1MDM B;  1RUN A;  3C18 A;  1YQA A;  2R3S A;  3RDI A;  3I53 A;  4PGG A;  5HS9 A;  1J9I A;  1D3Y A;  1MJA A;  5D5W B;  2HZT A;  1HW5 A;  2XV4 S;  2OZ6 A;  1IXR C;  3T8T A;  2RNJ A;  2XKP A;  4I01 A;  4MEX F;  3BJ6 A;  1G6N A;  1WRJ A;  4AIJ A;  4LG0 A;  1PUE E;  1YW8 A;  3FXU A;  3R60 A;  4LLG F;  2JRT A;  3TO6 A;  3LQQ A;  4R8H A;  4GXO A;  5JHU A;  2ZBK A;  2DFI A;  5CLS A;  1MZB A;  1NHA A;  2IVM A;  4HF0 A;  4H0E A;  4UHT A;  2ZNZ A;  1SAX A;  2J5P A;  1IUY A;  3E5U A;  5CJ9 A;  3JSP A;  5IT3 A;  1QGP A;  1FYK A;  2QVO A;  1YS7 A;  1SFX A;  5E8G A;  4KMF A;  2LSO A;  3WTU C;  3V8K A;  3ZMZ A;  1WQ2 A;  5HDG A;  2DK8 A;  1CF7 B;  2PMU A;  3CUQ B;  2HDC A;  4ASN A;  1F9N A;  1LEA A;  4HX4 A;  2NNY A;  5L3E A;  4O6J A;  5E8I A;  1LDJ A;  5ICG A;  3COA C;  4HDV A;  5LHG A;  2HKO A;  1KU7 A;  3MEX A;  4F7Z A;  2EA2 A;  4HOB A;  1XGN A;  1FP1 D;  3Q9S A;  3J81 Z;  4IJA A;  3IL2 A;  3EQL F;  4S05 A;  1ON1 A;  1I27 A;  5FFX A;  3TO7 A;  4EJV A;  3NRV A;  5A2Q Z;  2Z33 A;  5BOX A;  4M6Y A;  1JGS A;  2CSO A;  4AWX B;  5J8F A;  5CVI A;  2RC4 A;  4PZJ A;  1BC7 C;  3CJN A;  5F6F A;  1U3E M;  1ZLJ A;  3RI4 A;  2XAF A;  4KT5 C;  2HFH A;  1ZHF A;  2A69 F;  3HSE A;  1HKS A;  2JTV A;  4A0Z A;  3SZT A;  4HLX A;  2VBZ A;  5E1W A;  2XAH A;  1WI9 A;  5F64 A;  4MHG A;  1TW2 A;  4EM2 A;  4RGR A;  4D0P A;  2WWY A;  2YU3 A;  1HKT A;  3J7A O;  1LB2 A;  1IN8 A;  3HTU A;  1YYV A;  2G7U A;  3LAJ A;  3SHF A;  2ZXJ A;  3ML6 A;  4P9U A;  1W7P A;  2P7C B;  4HW0 A;  2W85 A;  4P55 A;  1WKM A;  2KJC A;  3F8N A;  4MGR A;  5D4S A;  2KIM A;  1XN7 A;  3TDU C;  5LHH A;  1GXP A;  2LDU A;  2HQN A;  2XRO A;  2YSR A;  4ZZL A;  1J2X A;  4JBA A;  2CW0 F;  2ISZ A;  2A5Y B;  3K1N A;  3EYI A;  1U5T B;  4CIC A;  1HKQ A;  3CUQ C;  3QRF F;  2VOP A;  3K2Z A;  2GAU A;  1P92 A;  1R1T A;  3TOB A;  2DTR A;  1FLI A;  1R00 A;  5BPI A;  5ICC A;  1ZH5 A;  4I0A A;  3R6S A;  2ISY A;  1QNT A;  2ELH A;  1XSX A;  4LLL A;  4NHJ A;  2AS5 F;  3GXO A;  2P8T A;  1FYL A;  1GXQ A;  3E6D A;  5DCM A;  3ZQ7 A;  2DU9 A;  1KYZ A;  4L9T A;  2FXA A;  3T5X A;  2FF4 A;  2XKO A;  1XDS A;  1MDM A;  4KIG A;  3P9I A;  3T0Y A;  2HTJ A;  5K1Y A;  4HDU A;  4FHT A;  3MZH A;  2P6S A;  1XMK A;  1B1B A;  5ILS A;  4BAY A;  2FU4 A;  2DAO A;  4PGH A;  1ZRF A;  3QP6 A;  1U78 A;  3CLO A;  3I59 A;  1HST A;  3ABT A;  3FZV A;  1R7J A;  1ZGJ A;  1USS A;  5KVR A;  3BWG A;  2C6Y A;  2PJP A;  2BV6 A;  3C1D A;  1I5Z A;  1STZ A;  1T0F A;  3FMS A;  5CVU A;  3V7S A;  4IF4 A;  3DFG A;  1RZ4 A;  2P6T A;  3B73 A;  1KQ9 A;  1W5S A;  1CF7 A;  2QYO A;  3AAF A;  4HBL A;  3ZPL A;  1FX7 A;  4LG0 B;  3PQJ A;  3ULQ B;  4GO1 A;  3WGH A;  2VC1 A;  4YFN F;  1IXS B;  2EFQ A;  1U5T C;  2QBY A;  2LNB A;  4ENJ A;  2L54 A;  4KIC A;  2B0L A;  3M9A A;  1S8N A;  1ZG5 A;  4HQM A;  2L02 A;  3RJP A;  2VT3 A;  4K2E A;  3O2P E;  5L3C A;  2LF7 A;  5D8K B;  3IC7 A;  2X0L A;  4RGS A;  3K69 A;  3HIF A;  4MEY F;  4AIK A;  3CO6 C;  1REP C;  3V7C A;  1ZAO A;  2CWE A;  6PAX A;  1QZZ A;  2QLZ A;  3OV8 A;  4BXU A;  2Y75 A;  1Z9C A;  3ZMD A;  2ZJ2 A;  5LRS A;  4A6D A;  4KNY A;  1LDK B;  2QZ8 A;  3E6M A;  1SD6 A;  3J80 K;  3I54 A;  2NYX A;  4HA8 A;  3WTY C;  3TKY A;  3DKW A;  3BY6 A;  1Z7U A;  4G9Y A;  4ESB A;  2GXB A;  3KZY A;  2QUF A;  1FBQ A;  2O03 A;  3M8F A;  1FWZ A;  2LKP A;  2RN7 A;  4XLP F;  4IPA A;  3NQO A;  4XLN F;  2JT1 A;  3BPV A;  3I64 A;  1BI2 A;  3F6O A;  1XD7 A;  2IA1 A;  4UV8 A;  3BP8 A;  4CXF A;  5LHI A;  2O8X A;  4A0X A;  4ZYG A;  1O3Q A;  2DPU A;  5ILU A;  5AIP A;  2MBF A;  2Y48 A;  1QO0 D;  1FSE A;  4M71 A;  3CO7 C;  5DV5 A;  1R5G A;  4LFU A;  4KN7 X;  4EJT A;  1TQM A;  2ZNY A;  5HDK A;  3ZN1 A;  4FT8 A;  4G8X A;  1W7P B;  1K7A A;  2XAQ A;  1YW7 A;  5EEH A;  1J59 A;  2IT0 A;  5LEJ A;  1F1Z A;  4LB6 B;  3S2W A;  1P6R A;  4BHP A;  1UB9 A;  2DLL A;  2FMY A;  4UXN A;  1HXD A; 
#chains in the Genus database with same CATH topology
 2XVC A;  2PFB A;  2RNG A;  2L4M A;  5E20 A;  2Z1D A;  4LIT A;  2RQP A;  2K40 A;  4X0G A;  2PQ8 A;  3DBR B;  2EZH A;  3WTX C;  2M0M A;  4HYE A;  5IPA A;  2JA2 A;  5M5X J;  3RZD J;  4RGX A;  1DP7 P;  2QKM B;  5F0H A;  1FOW A;  4RA2 A;  3OYC A;  2M5W A;  2B9S A;  3ASO H;  4ESJ A;  3FKJ A;  1IGN A;  4Y3O A;  2DQR A;  1I6X A;  3HB9 A;  5KK1 A;  5EEA A;  2K4J A;  1RR7 A;  1W5C C;  2CS3 A;  1VQM I;  1B59 A;  3SZP A;  2WC2 A;  1EF4 A;  3H3V K;  1SVL A;  3CJR B;  3BZK A;  4BQO A;  3ISP A;  1OMI A;  2KPM A;  1QA6 A;  1XGM A;  4MQV A;  3O3K A;  3ZR8 X;  2XHK A;  3CCL I;  2O8K A;  4JX5 A;  4UUS B;  1BJZ A;  1ZRE A;  2VE8 A;  1K78 A;  3NAR A;  3I4M J;  1EH7 A;  1SVO A;  3J80 Z;  2COB A;  2FNA A;  2XGD A;  2K3F A;  3B6A A;  5GP9 A;  3V4G A;  1RIO H;  4G7O F;  1S9H A;  3FXQ A;  4WXH A;  2KIU A;  1WSU A;  4AVP A;  2LRD A;  4AVZ A;  3RTR A;  1QRY A;  4FX4 A;  4XKC A;  5D5V B;  4KMU X;  3QU6 A;  5DCM B;  3BTL A;  1EV7 A;  3JCU C;  3DLA A;  1MJ9 A;  3HRU A;  2CFX A;  2LKS A;  3VOE A;  1PP8 F;  2W25 A;  9ANT A;  2QF7 A;  2HQ5 A;  1R6R A;  1W5T A;  5CKT A;  1XPX A;  2MC3 A;  2NOJ B;  4GRI A;  1FY7 A;  3KYL A;  3DEW A;  1G3W A;  1FTT A;  5E79 C;  2WV0 A;  1R1V A;  4QWQ A;  3FK6 A;  1ZTR A;  1AU7 A;  4IRI A;  2V9V A;  3IHU A;  2ETH A;  3DQV C;  2IGN A;  3SFZ A;  3ABU A;  4YEJ A;  2IGO A;  4CCL A;  2P5V A;  3H1C A;  4WK8 F;  3GWZ A;  2XAU A;  3FXL A;  2QM3 A;  4KIT B;  1QZY A;  3VFZ A;  3QPH A;  2NAZ A;  1HSJ A;  2FX0 A;  4Y52 J;  3JW4 A;  2R7F A;  1O3R A;  2OD5 A;  1JHF A;  3MQ0 A;  5B5E C;  2UV1 A;  3ZP5 A;  5LEK A;  2E2I J;  3JRC A;  3I59 B;  3DP7 A;  1EJ9 A;  2BVM A;  1E17 A;  1X3U A;  2JSC A;  1IXC A;  2VT2 A;  3WE3 A;  3F23 A;  2J5O A;  3KZZ A;  2GWR A;  1SFU A;  3A03 A;  4D5C A;  1OPC A;  2KJB A;  2DOF A;  4L9V A;  2Q8K A;  2HVR A;  2HYF A;  4CYC A;  3MKW B;  1MW7 A;  2QA4 I;  2BZT A;  5E1X A;  3KET A;  3S2H J;  1RC9 A;  3EUH C;  1JHH A;  3F8F A;  3AG3 H;  2IS2 A;  1N25 A;  3S3O A;  4EJW A;  2GLO A;  1C0W A;  4HRI A;  1U2W A;  4A5M A;  2EIM H;  4HF2 A;  3G73 A;  1ZYR F;  5KHD A;  2R0Q C;  1VTN C;  1DPU A;  3H5A A;  3LA7 A;  1DU0 A;  2W4S A;  3L7W A;  5EGO A;  2D2W A;  3H9G A;  5LLQ A;  5D4R A;  1OIS A;  4I02 A;  2Q2E A;  2VL8 A;  4W1U A;  2K02 A;  3L2C A;  3K4M A;  4IHY A;  1XSD A;  4HPQ A;  3K4B A;  2F48 A;  5LGT A;  2E60 A;  3DKX A;  3I4P A;  1IUF A;  3F0C A;  4ZH4 F;  2H1K A;  2A5W A;  2E1M B;  2L01 A;  2W7N A;  5DUK A;  3K7A J;  4DJA A;  1FIP A;  1BBY A;  2R7T A;  2OF7 A;  4EJU A;  3UR3 C;  1T8I A;  4NC6 A;  2TCT A;  4CCK A;  2GOM A;  2HQR A;  4PSX A;  2JA7 J;  1YFH A;  2QBY B;  2FEZ A;  2AQE A;  3K4K A;  3JTG A;  4V2F A;  3WGG A;  4LK0 F;  5IOZ A;  1MJB A;  2WB1 A;  2JUG A;  5J8C A;  2ZSI B;  2CO5 A;  4N0B A;  5D6F A;  3OSF A;  1JKR C;  3PO3 J;  1QVT A;  2WAF A;  4NUB A;  3SEQ A;  1UST A;  1Y6I A;  4AIH A;  1XCV A;  3CCQ I;  1S6L A;  3CJQ B;  3SFI A;  3TQN A;  2I5U A;  3JAM K;  2MA3 A;  2P7V B;  5H2F C;  3HOS A;  5LD2 C;  3HJE A;  1KU3 A;  3G1M A;  2W00 A;  3S1Q J;  1MGT A;  4KYW A;  2OA4 A;  5BQT A;  3TL4 X;  3SQN A;  1EA3 A;  1RR8 C;  2ZO4 A;  2K4B A;  4KUM A;  4L5J A;  3ZQC A;  2RAE A;  2LLK A;  2YUS A;  1FNN A;  1HW2 A;  3SDG A;  4G6D A;  2CRG A;  2FSW A;  3N97 A;  1I6H J;  4AYB A;  1OYI A;  1TTY A;  2JZY A;  3EDP A;  4M9Z A;  4LGW A;  3KEQ A;  4ENN A;  2CUJ A;  2OBP A;  4IOA F;  1FIA A;  4ANJ A;  3WGI A;  3B02 A;  2DMQ A;  2BY1 A;  1VQP I;  5FRM A;  5GTH C;  2DW4 A;  3CDI A;  2Y0S N;  2JPC A;  2EIN H;  3K1M A;  3H35 A;  5EDN A;  2CQN A;  1D8K A;  4I76 A;  4CCM A;  1D1C A;  4XON A;  3WU2 C;  2ESH A;  3N4M A;  1QU3 A;  4PK4 A;  1F5T A;  1LQ1 A;  2NVU B;  5LRR A;  2DTZ A;  2IPQ X;  1GVJ A;  4A3K J;  2XUB A;  3M8E A;  4P1W A;  4HG2 A;  2V4J C;  5K7Z A;  1O7F A;  3S1R J;  1B4A A;  3J7Z I;  3FM5 A;  4B44 A;  5J6X A;  3C2B A;  3U9G A;  3GW2 A;  3WU1 B;  4MQ9 F;  2Y9Z A;  3EUH A;  3GLX A;  2A68 F;  1TQI A;  2NS0 A;  3U1D A;  3VDX A;  1AKH B;  4CDG A;  3Q9V A;  5ED4 A;  4ZYE A;  1Q1H A;  1YX3 A;  3BR5 A;  1BI1 A;  2LBF A;  4UB6 C;  3PO2 J;  1AOY A;  5AON A;  2MD5 A;  1TWA J;  2VQL A;  4IQJ A;  3DEE A;  5E3M A;  3C2G A;  2VKD A;  1ZGA A;  1Z3Y A;  1GDT A;  2X48 A;  1B8I B;  1MH3 A;  2EIL H;  1MBJ A;  1R36 A;  2EJR A;  3C2H A;  3LMM A;  1T0F C;  4XSZ F;  5EF6 A;  4YIR X;  3EET A;  1UHS A;  1SFK A;  2MYS A;  2KHM A;  5IT9 K;  3OR2 C;  1ZRD A;  2Y0M A;  4LOC A;  1PUF B;  3AG4 H;  2B7E A;  1B6A A;  3MZY A;  3V8J A;  5F1J A;  2D1H A;  4YEL A;  4E6K G;  3OYK A;  1JKO C;  1FSH A;  1WVR A;  4RLQ A;  1U8B A;  2KRF A;  4RAG A;  3JRF A;  3S1N J;  1DUX C;  3ESW B;  2E7W A;  3S1M J;  5TRD A;  1W36 D;  4U0W A;  2E1M C;  2M8E A;  1WJE A;  4EMS A;  1KQ8 A;  1JTY A;  1FBU A;  1X2N A;  1X4O A;  2FBI A;  3LA2 A;  1HOM A;  5B3S H;  1RPW A;  2DO7 A;  2L7M P;  3OOP A;  4BQA A;  2CW8 A;  4I99 C;  5HDN A;  1E0E A;  5K5O A;  3CCM I;  3BJO A;  3R4K A;  4N4O B;  3GO5 A;  1QZE A;  2JQ7 A;  3HHG A;  4PDK A;  1EH6 A;  5J4Y A;  3GZN B;  2NS7 A;  4EGY A;  2YX4 A;  2VPL A;  3KLO A;  4FTH A;  1DGW Y;  2QSF X;  1WJA A;  3PIO F;  3Q0W A;  2EZL A;  2H27 A;  3AKZ A;  3I56 I;  3GTK J;  1D5Y A;  3KP2 A;  3QP5 A;  4HX7 A;  1ERD A;  4HV6 A;  3WG7 H;  2F5E A;  4B8X A;  1NG7 A;  3JAM Z;  4JP0 A;  4NQW A;  3MWM A;  5ICF A;  3BOQ A;  3LSM A;  3ZQI A;  2ACJ A;  1TQP A;  4U7B A;  3LNQ A;  2ZFU A;  3E5X A;  2HDW A;  3B6C A;  2E1C A;  2O0Y A;  4EM1 A;  4C9Y A;  2VXD A;  3E3V A;  3LA3 A;  4LMY A;  1OCC H;  1IF1 A;  1NG6 A;  5H6Q A;  4FE7 A;  3OY9 A;  3ABL H;  1A6Q A;  2A6E F;  2ZSH B;  3WTS C;  2R92 J;  1MBG A;  5GAE J;  1TW3 A;  1K78 B;  2KZV A;  5FKK A;  1DPR A;  1MSF C;  3W3C A;  4BUP A;  5LGN A;  2PMZ A;  2Y69 H;  3VYU B;  2CG4 A;  3UNG C;  4WX9 A;  3L00 A;  3ZXS A;  4TV7 A;  1VQ8 I;  2FOK A;  4NB5 A;  1H89 C;  2A3S A;  2QSH X;  3WHC A;  4ZYD A;  1ITY A;  1S72 I;  3DEU A;  3FXM A;  2BY0 A;  3FBN B;  2ZJR F;  1BM9 A;  4XQF A;  5E17 F;  1T95 A;  2RVC A;  2ZC2 A;  5DDG A;  1QHH D;  3KYD B;  1P2F A;  1U6G A;  2RGV A;  4XSX F;  3P9K A;  5LFA A;  3HKZ N;  2K86 A;  2NVX J;  4IKF A;  5FLM J;  3CMM A;  3MMY B;  5HVQ C;  2E2J J;  1EH8 A;  2M87 A;  2TRT A;  1FMV A;  2FUG 2;  3U2R A;  3WTZ A;  1YJW I;  4HEA 2;  4DYC A;  1G3S A;  1ZQ3 P;  3KP7 A;  5F04 A;  2UXX A;  5FKM A;  2D45 A;  5EYR A;  1RNL A;  1Y56 A;  1O3T A;  4M73 A;  3PQK A;  3RYR A;  4ENM A;  1KU2 A;  2PN6 A;  1G3T A;  5J1R A;  2JMW A;  4RLF A;  3TBI A;  2OTL I;  3QPT A;  1S7O A;  1RUO A;  2A6T A;  2Q0O A;  1Z6T A;  4A3J J;  4RGU A;  2DBB A;  2PMH A;  3JRB A;  1Y0N A;  1E3H A;  5FO5 A;  1I1S A;  2UUZ A;  3ERE D;  3FX3 A;  2W57 A;  1D5V A;  3FMQ A;  4GYG A;  3ZN0 A;  2X1E A;  2MG4 A;  3GLL A;  2MH2 A;  2LYC A;  1ETO A;  1BOA A;  3ZQL A;  2Z9O A;  2HOA A;  1UAA A;  4FIS A;  3FF5 A;  3BJA A;  5DM7 F;  3V7R A;  2E7X A;  1TL8 A;  1D1B A;  2ID3 A;  1N75 A;  3GVA A;  3CES A;  4XL9 A;  3CTA A;  1HW1 A;  1BIA A;  1UEL B;  3W6K B;  3GTO J;  5IT9 Z;  1BIB A;  2AO9 A;  1HA8 A;  1H0M A;  4BJT A;  5K5R A;  1UHW A;  3EPZ A;  3LSH A;  2XIG A;  2W48 A;  3W2A A;  2F5V A;  1O7L A;  2E2H J;  5EZH A;  1VQO I;  2ZME C;  1ZR2 A;  1AWC A;  2CQX A;  2EFP A;  3I9V 2;  4B47 A;  4KN4 X;  1VZ0 A;  2L7Z A;  2XB0 X;  3RKQ A;  2KRH A;  5FKO A;  2VQH A;  3G71 I;  3LSI A;  4YG2 F;  3H92 A;  2BHY A;  1YS6 A;  1XMA A;  2DOD A;  3N05 A;  4MO7 A;  5K7F A;  2LF8 A;  2Q2E B;  1LFP A;  2QEN A;  2CV1 A;  4H4K C;  1P7J A;  3BG7 A;  4XID A;  1GHC A;  3DXJ F;  3L9F A;  3FDY A;  2VJI A;  2XRL A;  4Q5S F;  5TJJ A;  1WI3 A;  2HGC A;  3LAP A;  1UMQ A;  5J4V A;  3ZQQ A;  1ZG1 A;  2NVQ J;  4II2 A;  2EPF A;  2GOX B;  3HG9 A;  1YIO A;  4HF1 A;  5H20 A;  3PNY A;  2H1L A;  2IW5 A;  1LJ9 A;  1GV2 A;  2HS5 A;  3RQI A;  3RKW A;  1IN7 A;  1CGP A;  2NVT J;  2IJL A;  3HXL A;  2M0C A;  4ZC3 A;  4DZJ A;  4BGD A;  2ZJQ F;  2DA5 A;  4IVN A;  4NC8 A;  3MCZ A;  4LB5 A;  5D5X B;  2IP2 A;  4IHX A;  2DI3 A;  2JN6 A;  3DPL C;  4PJN A;  4UUV A;  1W7P D;  4WCG A;  2VBX A;  2MSY A;  3EYY A;  2H6C A;  4M72 A;  3FIW A;  2LH9 A;  1ETV A;  3D5L A;  1X1C A;  1BOB A;  4QPQ A;  4A0Y A;  1JXS A;  5D8L B;  4U7D A;  2A07 F;  4UVC A;  1VQ5 I;  2DMN A;  2WAD A;  2DFE A;  1J7K A;  3CP2 A;  3W6V A;  2M9H A;  2V7F A;  3L2U A;  4CCN A;  1PYV A;  4WXD A;  4A3E J;  2HTS A;  1IRG A;  2MGQ A;  1JTX A;  1KON A;  3M7G A;  1APL C;  2EA4 A;  3I58 A;  1PDN C;  3LST A;  1ON2 A;  4U88 A;  4BHC A;  1YI2 I;  1A35 A;  3RPU A;  1F4K A;  4C3H J;  5FJ8 J;  1D1A A;  3AG1 H;  1TWH J;  1LNW A;  4XIC A;  4IRG A;  1X3W B;  2R7D A;  2V1D A;  2FQ4 A;  2XAS A;  3MKL A;  2WBM A;  4OIO F;  3SXY A;  1HCR A;  2VKE A;  2XB5 A;  3I5U A;  3BR3 A;  4E7S A;  1SD5 A;  2OJE D;  3DU6 A;  3A01 A;  4A3F J;  3DU5 A;  3D0S A;  2JA8 J;  3ROU A;  2JVH A;  1ZRC A;  2KKO A;  1XCB A;  4Y33 A;  2GQQ A;  1Q1V A;  4I6Z A;  4ENK A;  5DCF A;  3G4S I;  4BYY A;  3LSP A;  1OR7 A;  4OIQ F;  2EBI A;  4I0B A;  3BG3 A;  1WJB A;  3F9K A;  2ECB A;  2XAJ A;  4PSW A;  2HPI A;  4A3G J;  1BC8 C;  1MBH A;  1IC8 A;  1ZEL A;  3F8C A;  1ENH A;  2ZME A;  4UY8 I;  3BR2 A;  1SVM A;  3PUB A;  1MNM C;  4RAY A;  4F91 B;  4A3C J;  3ERM A;  2X6O A;  2OZU A;  1B9N A;  3PM1 A;  1PJR A;  5DEQ A;  2LD5 A;  3I55 I;  3FM3 A;  2XAG A;  5FD5 A;  3FXJ A;  2Z99 A;  3KP4 A;  1X2M A;  4CHU A;  4Y7N J;  3DPU A;  3LSR A;  1K4T A;  3TED A;  2VE9 A;  5HLG A;  4E7K A;  4E7H A;  4F92 B;  3PNT A;  4M6V A;  4M6X A;  2W84 A;  3H36 A;  1MMN A;  3I71 A;  4AM3 A;  2EFN A;  1BI0 A;  5CYV A;  2L0K A;  4D5F A;  3HUG B;  4L9J A;  1G3Y A;  3KX2 A;  3HSF A;  2CU7 A;  2EV6 A;  1D0Y A;  4Z6Y A;  4MTE A;  5J1Y A;  4GDF A;  5FFZ A;  1L0O C;  1UCR A;  4OIN F;  2EV0 A;  2WAQ A;  2XPV A;  4OMY A;  2VBW A;  4OIP F;  2BW3 A;  3G3Z A;  2DYS H;  2Y30 A;  4IEJ A;  1B9M A;  2E1O A;  2XGC A;  3JTH A;  1WHU A;  2FE3 A;  1TBX A;  4PJM A;  2EFO A;  3DBL B;  5HNH A;  5J40 A;  3Q0V A;  1SD7 A;  4BY7 J;  2QEX I;  1R5H A;  3SZG A;  2V6C A;  5L3D A;  4BBR J;  3RKY A;  1XTA A;  2V79 A;  1OYW A;  1ETY A;  4KJZ A;  4XN0 A;  2RV8 A;  1O3S A;  2G0E A;  2DQL A;  1Z1D A;  4EM0 B;  2KL4 A;  2VLA A;  3P9C A;  1T98 A;  3PFI A;  1XC5 A;  5L3F A;  1A04 A;  3WU0 A;  1XGO A;  2Y31 A;  1R1U A;  3Q5F A;  3M07 A;  3J7A Y;  4M74 A;  1IRZ A;  4W97 A;  4RB3 C;  2M7A A;  3K4C A;  1UHM A;  3GFL A;  4XM3 A;  2F4M B;  2K9M A;  2Q1Z B;  2QWW A;  2I10 A;  4XBF A;  2DOA A;  1LEB A;  4NQW B;  3FMR A;  4HQE A;  3WHB A;  2XF7 A;  4ETS A;  4YFX F;  2LY2 A;  2CUF A;  1HC8 A;  3ZMV A;  4P9F A;  3FK7 A;  3V8L A;  2LY1 A;  3CCS I;  3DV8 A;  2L2O A;  1ETQ A;  2LRE A;  2BY3 A;  1SFO J;  3QOP A;  4UNO A;  4O5V A;  3F8B A;  1OCP A;  4QTR A;  1GUU A;  4LK1 F;  2HZD A;  2KRC A;  4ZDP A;  2DN0 A;  4OU0 A;  4FX0 A;  5IYB J;  2CV0 A;  5C4X J;  1LDD A;  3E6B A;  1VFC A;  2M1B A;  2STT A;  1B72 A;  3RIR A;  2VXZ A;  3GME A;  2V1X A;  3GF2 A;  4QPO A;  4L9N A;  1U8R A;  1G4D A;  1A31 A;  3DKY A;  2Y2Z A;  3CD6 I;  1QQI A;  4C2T A;  1E3O C;  2M34 A;  2GA1 A;  3HRT A;  1V55 H;  2DA6 A;  3E1S A;  3K4N A;  4B3X A;  3QU3 A;  3TDZ C;  3W6J B;  4Z2Y A;  3JRD A;  4BNC A;  3IRQ A;  3BR6 A;  1IN5 A;  3IP4 B;  3CCR I;  2BGC A;  2HR3 A;  5ILV A;  1YE9 A;  3GZ5 A;  4R1H A;  3HBL A;  1MND A;  2L3D A;  2MAB A;  3CQZ J;  3IKV A;  2PBI A;  3RKX A;  5HLT A;  3OYM A;  4LD5 A;  2FD5 A;  3GTJ J;  4NNJ A;  2CYY A;  1W1W E;  2LC2 A;  2DA2 A;  1Z91 A;  1JJ6 C;  4Q48 A;  5C3E J;  2LFB A;  3OIO A;  4V2G A;  5DS9 A;  1YW9 A;  2HVQ A;  2R7Q A;  4EAT A;  5DD4 A;  3ZMT A;  1ZGW A;  5HS7 A;  3FXR A;  5JFR A;  2DT6 A;  2IS6 A;  2CJJ A;  4CZZ A;  1WJC A;  4KIF A;  3FBI B;  1IW7 F;  4U0Y A;  2LOO A;  2L9V A;  2V6E A;  1WH5 A;  1VQ4 I;  2MC4 A;  3H3U A;  4M3G A;  3WG9 A;  1TP4 A;  2MFZ A;  5BPD A;  3HL2 A;  3FXK A;  1JGG A;  4S04 A;  3IWF A;  1XDU A;  2K85 A;  2NVY J;  1D8J A;  3GCM A;  1TC3 C;  1FOK A;  3H5N A;  4N9I A;  1HBX G;  2RDP A;  1H9G A;  1ZG3 A;  3DBH B;  4RS8 A;  2BBY A;  1ACI A;  2HOE A;  1YG2 A;  2H94 A;  2QQ9 A;  2FJ1 A;  3ECH A;  4DGW B;  2QQA A;  2DDB A;  2FQ3 A;  3K0L A;  2VKH A;  3TW7 A;  1O4X A;  1VQN I;  1KA8 A;  3MD2 A;  2GM4 A;  4M9S A;  2CGP A;  3JR9 A;  4DZP A;  3IKT A;  2Z5U A;  2ZFW A;  4JQF A;  1VQ7 I;  5F0C A;  2L4A A;  2GIV A;  2GBY A;  3JRH A;  2K9S A;  4PCQ A;  4RAZ A;  1UJ8 A;  4ZTJ A;  3T1B A;  4I09 A;  1MKM A;  2VJ5 A;  4RBO A;  1V5E A;  2L7K A;  3LSJ A;  1Y8Q B;  2R5Z A;  2JUC A;  4UUT A;  1E3P A;  1N77 A;  5IYD J;  4PUS A;  2K3P A;  4YFK F;  3D1N I;  5JVT A;  3CDH A;  5D5U B;  5K5Q A;  4G7Z F;  4BQQ A;  1HQC A;  5HS8 A;  4KIS A;  4AU7 A;  1KYW A;  3F8M A;  5HNF A;  3GUD A;  1FC3 A;  5L3B A;  1H9T A;  5L3G A;  2RKH A;  5CQE A;  2IA0 A;  2F5C A;  1T08 B;  1X3Z B;  3HHH A;  4JX6 A;  1HDD C;  2QGU A;  2VOO A;  1YIJ I;  5E3L A;  1X1D A;  1PP7 U;  3M3Y J;  3FHN A;  1YLF A;  5M3F J;  2FNP A;  3PSF A;  4AD9 A;  1OKR A;  2H6B A;  2UWM A;  5FB2 A;  2FML A;  4G6Q A;  2NNN A;  3AG2 H;  5JLW A;  3HOX J;  3PNV A;  2JVG A;  1CQT A;  3HDD A;  1FBS A;  2EB7 A;  2CQ7 A;  3NAU A;  4WWC A;  4RB2 C;  3LSG A;  5FD6 A;  2DK5 A;  1IDY A;  2V26 A;  2R7S A;  1DU6 A;  3L2R A;  2E34 A;  1J0R A;  3E7L A;  2JWT A;  5B1B H;  4BXF A;  4XOP A;  3QOE A;  3AFH A;  2V9K A;  4ZDL A;  4QLC U;  3HEF A;  2HPM A;  3H3Z A;  4RAF A;  2A6H F;  4ZZD A;  3SYT A;  4DYQ A;  1VQL I;  2X6W A;  4IHT A;  1R22 A;  1HDP A;  1ETK A;  1LPQ A;  2V9P A;  3F72 A;  4M3D A;  2F5F A;  4L18 B;  4E7J A;  4Q47 A;  4IHV A;  2F2E A;  1OJL A;  2ZKZ A;  5C44 J;  3A01 B;  4MTD A;  5C4J J;  4GCV A;  2KZG A;  2OPT A;  3KLN A;  3WTT C;  4YII A;  3OMY A;  4KFC A;  2PEX A;  4G7H F;  3L09 A;  4CUG A;  4I98 B;  4FAS D;  4IHS A;  1VQ6 I;  3JSO A;  1YO5 C;  2UXN A;  1LVA A;  2E36 A;  3IAM 2;  3K1P A;  2P5K A;  3VPR A;  3HUG A;  2BE5 F;  1J09 A;  4GYI A;  1A6I A;  3G6E I;  3TO9 A;  3ABK H;  3HSR A;  2LMD A;  4A3D J;  1RKT A;  4A6E A;  3MAJ A;  5J47 A;  2VQC A;  1ZAR A;  2HDD A;  1ODD A;  2H09 A;  3O8G A;  2KIS A;  2ZME B;  3G1L A;  1SD4 A;  2G7H A;  4G94 A;  3QYB A;  4GFB A;  5F27 A;  2HU9 A;  4OAZ A;  1Y39 A;  1E2X A;  3S93 A;  2HQA A;  1R58 A;  3QPL A;  1JT0 A;  5E18 F;  1BR1 A;  2W24 A;  2CUZ A;  1S7E A;  3S15 J;  1S3J A;  1ULY A;  3F22 A;  1IJW C;  1XMX A;  1WPK A;  1ZLK A;  3OWT A;  4RM2 A;  3H0G J;  1IN4 A;  3SJM A;  3BPX A;  4HSR A;  5HLI A;  4Y17 A;  3A4C A;  3MFK A;  1MSE C;  4HST A;  2E19 A;  1O57 A;  4RM3 A;  3TW6 A;  4ESF A;  1FYM A;  1QPM A;  3AL0 C;  2PG4 A;  2VI6 A;  3G2B A;  4IX7 A;  3HOT A;  1K79 A;  3BG6 A;  3FHZ A;  3GFJ A;  2IGM A;  5GTI C;  2F4O B;  4Y4R A;  2BW3 B;  3H5R A;  4A93 J;  2VKV A;  3NEU A;  3JRA A;  5FGM A;  4IHW A;  5ICE A;  4CH7 A;  1LE8 A;  5LGU A;  1BW6 A;  1RRJ A;  3BTI A;  3HRM A;  2P5L C;  1XB4 A;  4PFP A;  4FE4 A;  1Z0X A;  3KP6 A;  4ON0 A;  4CCJ A;  2UZK A;  2F5D A;  5TIS C;  4C2U A;  3ZQG A;  4XRF A;  1T33 A;  1SFE A;  4X6A J;  3FWE A;  4R79 A;  1WWX A;  5EEG A;  1S7A A;  3VYR B;  5IYC J;  3VSL A;  2PLY A;  2PJR A;  1P4W A;  3KFW X;  1FJL A;  3KE2 A;  1U9O A;  1JUM A;  3KCC A;  3S14 J;  1KU9 A;  4IRH A;  4DW6 A;  4IL6 C;  4BH9 A;  3LFK A;  1T6S A;  5KCM A;  5B66 C;  2M45 A;  2VC0 A;  2M8G X;  1R4N B;  4UVA A;  3L2V A;  3VB2 A;  2JPB A;  5KNL A;  1WJD A;  1UZC A;  2VOD A;  4UV9 A;  1L3L A;  4KDP A;  3OS2 A;  1EKE A;  4PJL A;  5J1U A;  3P7N A;  3LQR A;  4Y13 A;  3VOD A;  4U0V A;  4CO8 A;  5IP7 J;  3K4L A;  5IP9 J;  2W82 A;  3K4J A;  4B48 A;  3GYH X;  1AHD P;  3LWF A;  2MLK A;  1ONV A;  3CCV I;  2ESN A;  5GPA A;  4A5N A;  3CCJ I;  2VN2 A;  4JYK A;  2XRN A;  1P4A A;  1B72 B;  2R5Y A;  2AXL A;  4KIB A;  3REO A;  2VAS A;  4LG3 A;  2E1N A;  3O6B B;  2GZW A;  3CCE I;  2LP0 A;  4BE2 A;  1IN6 A;  4L5I A;  4M9X A;  1TT5 B;  5E1Z B;  4JK1 X;  2Z3Y A;  2IRF G;  4HLY A;  5H6R A;  1BR4 A;  3ZCO A;  1X4P A;  2Y0S A;  1J75 A;  4E7I A;  3WTW C;  4BDZ A;  1U0J A;  4XKB A;  3LOC A;  1P4X A;  1FZP B;  4I2O A;  4E7Z A;  2NRA C;  2VIX A;  1OR7 C;  3E5Q A;  2BEO A;  3KP5 A;  5HOO A;  1JE8 A;  3ZMU A;  1FT9 A;  1LUJ B;  5HLH A;  3CLQ A;  1LFU P;  1D0X A;  3ELK A;  3HGG A;  3M1E A;  1IZ1 A;  1IRF A;  3TOA A;  3F21 A;  5AIQ A;  2HWV A;  4XNF A;  2ECC A;  2DJI A;  2QKL B;  4N9H A;  3CUQ A;  1IAW A;  2R7Z J;  2AHQ A;  2CUE A;  3ZMS A;  2EH3 A;  3CP8 A;  1OCR H;  3LFU A;  4OIR F;  5JR3 A;  2JRM A;  2OCC H;  1Z21 A;  1V54 H;  2QQB A;  1MH4 A;  4YIF A;  2IA2 A;  4UVB A;  3DPT A;  4BJ6 C;  4NC7 A;  4EEF G;  2E35 A;  2GIZ A;  2WTE A;  2K27 A;  3C3W A;  3BG5 A;  3OYE A;  2DDA A;  4LJZ F;  2KLO A;  3C7J A;  4P5O A;  1Y0U A;  3CDL A;  2ADU A;  4E70 A;  3OYA A;  4FET A;  3BR0 A;  1IV6 A;  2DFF A;  2O61 A;  3OIQ A;  4HAM A;  2VBY A;  3IRR A;  4L0Z B;  3EUK L;  2XC7 A;  3OYD A;  4HZF A;  2XGX A;  4XKW A;  5F1R A;  3RYP A;  2X4H A;  1U9N A;  2COM A;  4EQQ A;  3FIS A;  5CVV A;  1VND A;  4FQG A;  4Y15 A;  2MH9 A;  5KAF C;  1X1A A;  3OL4 A;  2YR2 A;  4HX8 A;  4BEH B;  5EJC A;  3U21 A;  2O9L A;  1YTY A;  5BS6 A;  4AC0 A;  4XRS A;  2BXZ A;  2XPU A;  3CME I;  2M7B A;  4CYD A;  2HYG D;  1QHG A;  2CQK A;  3BDD A;  2R7O A;  1P9Q C;  5M5Y J;  3GZ6 A;  1NH3 A;  4KA4 A;  1Z05 A;  1TNT A;  2D5V A;  3K9T A;  4OMZ A;  2G9W A;  4EJO A;  5FLX K;  4EGZ A;  1V4R A;  2O5R A;  1FP2 A;  5DUI A;  2OQG A;  1T39 A;  1R23 A;  2ZXW H;  4XLH A;  2IGK A;  2HKX A;  2M30 A;  1K61 A;  4A3L J;  1GVD A;  1MBE A;  1SMT A;  1RI7 A;  2EV5 A;  2WY7 Q;  2R5Z B;  4DNC A;  3KP3 A;  4G12 A;  3TP0 A;  4A2U A;  4RB0 A;  5LBQ A;  4OAY A;  4MLO A;  2FA5 A;  1GV5 A;  1RKW A;  2OAZ A;  4RDU A;  3OYJ A;  3HOV J;  3GFM A;  4B09 A;  1YJ9 I;  2P4W A;  2ZJP F;  4L0Y B;  1TNS A;  3GEZ A;  4BJ5 C;  1BJA A;  3E6C C;  3SEZ A;  1Z67 A;  5ERI A;  4ZTF A;  2YPR A;  2LK2 A;  3KEO A;  4OOI A;  3HTS B;  2NS8 A;  3TGN A;  2QCO A;  3CJT B;  2FRH A;  1P7I A;  1IO2 A;  2WA0 A;  2K7L A;  2Z2S B;  3DF8 A;  4CZC A;  3HRS A;  2JK3 A;  1YX5 A;  3S3M A;  1FEX A;  1T38 A;  4F93 B;  3K2A A;  5DYM A;  2LTP A;  5CVJ A;  2TDX A;  1RET A;  3OYF A;  5D6E A;  5BMZ A;  3OIP A;  1Z3X A;  1BI3 A;  4G6T B;  2F6C A;  1K6Y A;  3CUO A;  2GA2 A;  3HYI A;  3IWZ A;  2DA7 A;  5M5W J;  2WY8 Q;  3HOW J;  4XN3 A;  2GXG A;  4LIU A;  2MLG A;  3WTV C;  1TLH B;  4BE0 A;  4PFO A;  4PJ0 C;  2WV1 A;  2K9N A;  2KIQ A;  4WXC A;  4XLF A;  4F3Q A;  5CVR A;  4IOC F;  2PI0 A;  1LVK A;  2FBH A;  3BCB A;  2E5Z A;  3ECO A;  1YJN I;  1SAU A;  4XR6 A;  1SMY F;  1ZK8 A;  2FBK A;  3PJR A;  1JT6 A;  2LR8 A;  1U5T A;  1Z7L A;  3ZOB A;  2IBD A;  3QOD A;  2DPD A;  1XSV A;  4HV5 A;  3VEP A;  2WB1 N;  1X58 A;  2EK5 A;  3HOZ J;  2EWN A;  3WOD F;  4IXA A;  4C3I J;  2O3F A;  2F4I A;  3HC7 A;  4P96 A;  4E4H A;  4CA0 A;  5DD8 A;  4BDY A;  3ZQH A;  2KIF A;  5B1A H;  3PIP F;  2V1U A;  1K6O A;  2H8R A;  2XF6 A;  5FRO A;  2VON A;  3S8P A;  2BVL A;  4I7H A;  5EG0 B;  4LLN A;  2ZCW A;  2BYV E;  2XDV A;  1J5Y A;  1Z6R A;  4AUX A;  2A61 A;  4XOT A;  1YHQ I;  2O6G E;  3R0A A;  5JLX A;  3TMO A;  2R7X A;  3OOU A;  1I1G A;  3R61 A;  5GAH J;  1LFB A;  4BHB A;  3MVP A;  1QVU A;  3E97 A;  1V3F A;  1FPQ A;  4AYB N;  1OCO H;  2AXT C;  1S29 A;  2AQF A;  4RB1 A;  1KGS A;  1ORK A;  2I8D A;  2DA1 A;  1ZKG A;  3GFI A;  4O3M A;  2HXI A;  4C2M J;  4LIV A;  3RPQ A;  1BN5 A;  1ZR4 A;  1T2K A;  3S16 J;  3BRO A;  3F3X A;  3I0T A;  4X1E A;  1HF0 A;  3HOU J;  3A2K A;  4EV0 A;  5K7H A;  1KQ0 A;  4WF2 A;  4ZYH A;  2OU2 A;  4M3F A;  4S0H B;  2HXO A;  2STW A;  2M3A A;  1W0U A;  3PL8 A;  1DP3 A;  1ZN2 A;  3PFY A;  1MD0 A;  3F6V A;  4FCY A;  3J81 K;  1K4S A;  1G59 A;  2ELK A;  3BTC A;  3CC2 I;  2EIJ H;  3BZ6 A;  2DT5 A;  4EVI A;  5FLX Z;  5A2Q K;  3T8R A;  1PVE A;  2EFW A;  3BZC A;  1UFM A;  1W4M A;  3BQZ A;  2KQR A;  2KDZ A;  2LKX A;  2E71 A;  4Q4Z F;  1DDN A;  2X1D A;  3QWL A;  4MNU A;  3QAH A;  4DQ2 A;  1OYY A;  4CGZ A;  2Y9Y A;  2VUM J;  4DBQ A;  2HEO A;  4ZYA A;  4A12 A;  1SEU A;  4HNU A;  2D1V A;  1LE8 B;  1SAN A;  1Y8R B;  3GX4 X;  5JI6 A;  1QBJ A;  1D0Z A;  2DJN A;  3A0B C;  4B4C A;  4GGG A;  1XGS A;  2CW7 A;  3WE2 A;  2R4G A;  1MMS A;  3R0J A;  3GTP J;  3IH2 A;  2YX7 A;  2OQR A;  5IY5 H;  3BG9 A;  1MDM B;  1WZ2 A;  1RUN A;  3C18 A;  2K9L A;  1YQA A;  2R3S A;  1NK3 P;  5FRN A;  3RDI A;  3I53 A;  2RRE A;  4PGG A;  2PJR B;  5HS9 A;  1J9I A;  1D3Y A;  4N4N B;  2IAI A;  1MJA A;  4C3J J;  5D5W B;  2PX9 A;  2HZT A;  1HW5 A;  2XV4 S;  2OZ6 A;  3Q0U A;  3MZ8 A;  4NDL A;  2HOS A;  2X1C A;  1BW5 A;  3IH3 A;  1IXR C;  3ABM H;  3CF2 A;  3M8J A;  3W2W A;  3IV5 A;  5IOY A;  3T8T A;  2L9N A;  1XG1 A;  1IV8 A;  2RNJ A;  2XKP A;  4I01 A;  4MEX F;  1TWG J;  1UG0 A;  3BJ6 A;  1G6N A;  3H9Q A;  2ME6 A;  3OYH A;  2L9R A;  1WRJ A;  4AIJ A;  4LG0 A;  1PUE E;  1YW8 A;  1X1P A;  3FXU A;  4U87 A;  2QSG X;  3R60 A;  4LLG F;  2JRT A;  3TO6 A;  3E0J B;  3LQQ A;  1R5I D;  3KYC B;  4R8H A;  1RES A;  2HI3 A;  4GXO A;  2KP6 A;  2ZBK A;  5JHU A;  2DFI A;  5M3M J;  5E3N A;  5CLS A;  1MZB A;  2R5Y B;  1NHA A;  3IH4 A;  2IVM A;  2ID6 A;  4HF0 A;  1V5G A;  4H0E A;  4UHT A;  2ZNZ A;  4M3B A;  2H8W A;  3DCF A;  3A0H C;  1DGR M;  1YRN B;  1SAX A;  2J5P A;  2XPW A;  1IUY A;  4BS9 A;  3E5U A;  4XOR A;  4DOZ A;  2VJJ A;  4UB8 C;  5CJ9 A;  3JSP A;  1JKP C;  5IT3 A;  1QGP A;  1T56 A;  1FYK A;  2QVO A;  2GXA A;  1YS7 A;  1SFX A;  4D7N A;  2JA5 J;  1XX5 A;  5E8G A;  2XSD C;  1TWC J;  4A3I J;  4KMF A;  2LSO A;  4ABZ A;  3WTU C;  1Z77 A;  3V8K A;  3ZMZ A;  1WQ2 A;  1R9T J;  4BEH A;  2V1N A;  5HDG A;  2DK8 A;  3ZRG A;  1CF7 B;  3GTG J;  2PMU A;  4CCO A;  3D5S C;  3M1C A;  4IO9 F;  3CUQ B;  2HDC A;  3OYL A;  4ASN A;  2P81 A;  3OL3 A;  1F9N A;  3OYN A;  1LEA A;  2BHZ A;  3RPU D;  4HX4 A;  4AID A;  3CMA I;  2NNY A;  5L3E A;  2ICW G;  3AL0 B;  2MW8 A;  2X6X A;  3L2W A;  4O6J A;  4ZDO A;  2PMZ N;  5E8I A;  1VQK I;  1LDJ A;  2JSP A;  5ICG A;  1VF9 A;  3CZ6 A;  3COA C;  2N8G A;  4HDV A;  5LHG A;  2HKO A;  1KU7 A;  3MEX A;  4F7Z A;  2EA2 A;  2YS9 A;  4HOB A;  2Z16 A;  1XGN A;  1FP1 D;  3Q9S A;  3J81 Z;  4D9J A;  1Y1W J;  5IP6 A;  4IJA A;  3HM5 A;  5CPR B;  4BU2 A;  3IL2 A;  3BCA A;  3EQL F;  4S05 A;  1WFX A;  4J19 A;  1ON1 A;  3BT9 A;  1I27 A;  5FFX A;  2X51 A;  2ME0 A;  3TO7 A;  4EJV A;  3NRV A;  5A2Q Z;  2Z33 A;  2DXI A;  5BOX A;  4M6Y A;  2R7U A;  1JGS A;  2CSO A;  2CH0 A;  4AWX B;  5J8F A;  5CVI A;  1MMA A;  2RC4 A;  4PZJ A;  4XLC A;  1BC7 C;  3CJN A;  5CQG A;  2X6Y A;  5F6F A;  1U3E M;  3SDB A;  1ZLJ A;  3CCY A;  3MKZ A;  3D5R C;  3A1Y A;  1A5J A;  5DTD A;  2VB6 A;  3L1P A;  3RI4 A;  3ONQ A;  3VSK A;  2XAF A;  1ETW A;  4KT5 C;  5FKL A;  1IG7 A;  3ZQF A;  2HFH A;  1ZHF A;  2A69 F;  2R7W A;  3HSE A;  5F0F A;  3H0D A;  1HKS A;  4B3A A;  2R7R A;  2KDO A;  3DWL E;  2JTV A;  4A0Z A;  3SZT A;  3EUA A;  2VBZ A;  4HLX A;  4L5E A;  5E1W A;  2XAH A;  1WI9 A;  5F64 A;  4MHG A;  3GTM J;  2OTJ I;  3CMY A;  1TW2 A;  4EM2 A;  4RGR A;  4J00 A;  2M2E A;  4BKX A;  4D0P A;  1IRX A;  2WWY A;  2YU3 A;  1FMW A;  3J7A O;  1LB2 A;  1HKT A;  1IN8 A;  3HTU A;  3OYB A;  3L2Q A;  1YYV A;  2G7U A;  3LAJ A;  3SHF A;  1GLN A;  2ZXJ A;  3ML6 A;  4P9U A;  5JVG F;  1W7P A;  3BR1 A;  1JKQ C;  2P7C B;  3HPH A;  4A69 C;  2ZXI A;  4HW0 A;  4KT6 A;  2W85 A;  2DMT A;  4P55 A;  1I50 J;  3A02 A;  3QPS A;  3KZI C;  1WKM A;  1GT0 C;  1R4M B;  2L7F P;  4NBQ A;  1NTC A;  5BNG A;  5EG0 A;  2KJC A;  3F8N A;  2VJ4 A;  4MGR A;  5D4S A;  3PSI A;  3CCU I;  2KIM A;  1XN7 A;  3TDU C;  1FTZ A;  4ZJZ A;  5LHH A;  1GXP A;  3RQ4 A;  2DCE A;  2LDU A;  3V42 A;  1V5F A;  4F55 A;  3K70 D;  2HQN A;  3ZGK A;  3QYE A;  2M4K A;  3S2D J;  3CF5 F;  2XRO A;  2BXY A;  2YSR A;  2DFH A;  4ZZL A;  4IZZ A;  1J2X A;  1FOY A;  1I39 A;  4BAC A;  4JBA A;  2CW0 F;  1OCT C;  5JHF A;  1WJF A;  3LSK A;  2A5Y B;  4XKV A;  3K10 A;  3JRI A;  2ISZ A;  3VWB A;  2EZI A;  3RCO A;  3OSG A;  3BTJ A;  3K1N A;  3EYI A;  1U5T B;  4CIC A;  1HKQ A;  3CUQ C;  3DTI A;  2LVS A;  3QRF F;  2L5Q A;  3K2Z A;  2VOP A;  2GAU A;  1P92 A;  2LG4 A;  1R1T A;  2M4G A;  3TOB A;  2DTR A;  2ZXH A;  2HVS A;  1R00 A;  5BPI A;  1FLI A;  5ICC A;  4UUS A;  1ZH5 A;  4I0A A;  5DM6 F;  5J3L A;  3S3N A;  3R6S A;  4MFE A;  2ISY A;  1QNT A;  2CV2 A;  2ELH A;  1N78 A;  5FLV A;  1XSX A;  4LLL A;  4NHJ A;  2AS5 F;  3GXO A;  5EZG A;  3NWS A;  2P8T A;  1FYL A;  2HOT A;  1AA7 A;  1UG2 A;  1OQY A;  1GXQ A;  3G1O A;  3E6D A;  3GTL J;  5DCM A;  1OFC X;  3ZQ7 A;  2DU9 A;  2LY9 A;  1XS9 A;  4BQN A;  1F43 A;  2HYJ A;  1KYZ A;  5GAG J;  4L9T A;  1BA5 A;  1H88 C;  4QIW N;  2YU9 J;  3FXO A;  4DIQ A;  3DTE A;  2FXA A;  1WH7 A;  3T5X A;  4B43 A;  2FF4 A;  2XKO A;  1XDS A;  1MBF A;  3BQY A;  1MDM A;  1FOX A;  4RMN A;  2IXS A;  2DYR H;  2HNH A;  4KIG A;  5GPC A;  1S5L C;  3P9I A;  3T0Y A;  3OS1 A;  2FOW A;  3QQA A;  2EIK H;  1JI8 A;  2HTJ A;  5K1Y A;  4HDU A;  1TWF J;  4FHT A;  4XK4 A;  3TP3 A;  3MZH A;  3OYI A;  4QSH A;  3W2V A;  2P0W A;  2P6S A;  5KAI C;  1JJ8 C;  1XMK A;  1B1B A;  3U1K A;  4XRM A;  4JOM A;  5ILS A;  4DYR A;  4BAY A;  2FU4 A;  2DAO A;  4PGH A;  4MIM A;  3UKG A;  3H9J A;  3I3L A;  1ZRF A;  3QP6 A;  1U78 A;  3CLO A;  3I59 A;  2XGE A;  1A36 A;  2JA6 J;  2XSJ C;  2ELJ A;  1HST A;  2K9Q A;  3ABT A;  3NWT A;  4F52 A;  3BC8 A;  3FZV A;  2X85 A;  5FKN A;  1R7J A;  1MMD A;  3S17 J;  1ZGJ A;  1USS A;  2KFD A;  5KVR A;  2OV7 A;  3BWG A;  2C6Y A;  2PJP A;  1K83 J;  2WAE A;  2BV6 A;  1VQ9 I;  1YRN A;  3C1D A;  1I5Z A;  1STZ A;  1X19 A;  2R7V A;  1T0F A;  3KEY A;  2A05 A;  3GBG A;  3FMS A;  1YOV B;  5CVU A;  3V7S A;  3HZJ A;  4IF4 A;  1SC7 A;  2BY2 A;  3DFG A;  2IEK A;  4V19 K;  2WAQ N;  4YRV A;  4M3E A;  1RZ4 A;  2EZK A;  2P6T A;  4HNV A;  3B73 A;  1JUP A;  2NXN B;  1KQ9 A;  1W5S A;  1CF7 A;  3RSN A;  2NOG A;  2QYO A;  4J01 A;  3AAF A;  4HBL A;  3ZPL A;  4C30 A;  1DQU A;  3Q3S A;  1FX7 A;  3OR1 C;  4LG0 B;  4D7M A;  3CC4 I;  1JUS A;  2JJ7 A;  3PQJ A;  2DOE A;  3ULQ B;  2IS4 A;  4GO1 A;  3WGH A;  2VC1 A;  4YFN F;  1IXS B;  2EFQ A;  3QYF A;  3MN2 A;  1U5T C;  2QBY A;  4BXX J;  1WJ5 A;  2LNB A;  4CYC B;  4ENJ A;  3M4O J;  2L54 A;  3P5J A;  3DLL F;  4KIC A;  2B0L A;  3M9A A;  4OWR B;  4HNT A;  4XMY A;  1S8N A;  1ZG5 A;  4IQ4 A;  1NK2 P;  4HQM A;  2CQQ A;  2L02 A;  2E5N A;  3RJP A;  4D1Q A;  2VT3 A;  4K2E A;  3O2P E;  3VYT B;  5L3C A;  2LF7 A;  2CFO A;  4E7L A;  1TZL A;  5D8K B;  3IC7 A;  2X0L A;  4A3M J;  5EGO B;  4RGS A;  3K69 A;  3HIF A;  1R71 A;  2RQQ A;  4MEY F;  4CSW A;  4AIK A;  3RZO J;  1Y1V J;  3CO6 C;  1W0T A;  3IUO A;  3ASN H;  3VYS B;  1REP C;  3V7C A;  1ZAO A;  2CWE A;  2DT7 B;  4BBS J;  6PAX A;  1QZZ A;  2QLZ A;  3OV8 A;  4BXU A;  2Y75 A;  1Z9C A;  3X2Q H;  2OUM A;  3ZMD A;  4BE1 A;  1QPI A;  1M1E B;  3JRE A;  2QQ8 A;  2ZJ2 A;  5LRS A;  4A6D A;  3HPG A;  3PUF A;  4KNY A;  1LDK B;  2QZ8 A;  3E6M A;  1SD6 A;  3J80 K;  3S32 A;  3I4N J;  3I54 A;  4PJJ A;  2KT0 A;  2ZB9 A;  2NYX A;  4HA8 A;  2DA3 A;  3K6G A;  3WTY C;  3TKY A;  3BLY A;  3DKW A;  3BY6 A;  1Z7U A;  4G9Y A;  4ESB A;  4BY1 J;  2GXB A;  3K70 C;  3KZY A;  2VQG A;  4JX4 A;  3JRG A;  1IDZ A;  5TGT A;  3HGY A;  2QUF A;  1FBQ A;  4BL0 B;  2DMU A;  2O03 A;  3M8F A;  1ETX A;  1FWZ A;  1MIJ A;  3O8H A;  3DTK A;  2LKP A;  2CMP A;  2RN7 A;  4XLP F;  3GTQ J;  2EQR A;  3HOY J;  5GAD J;  5E3O A;  4IPA A;  1MNE A;  2DA4 A;  2MD0 A;  3NQO A;  1BL0 A;  5HOD A;  1G2H A;  4MFD A;  1BR2 A;  1HLV A;  4XLN F;  2JT1 A;  1X1B A;  2BOL A;  3BPV A;  1W36 C;  3FKI J;  5F08 A;  4XRS G;  1TT0 A;  4XLA A;  1AKH A;  1MBK A;  3I64 A;  1BI2 A;  2VPR A;  2W1O A;  1R49 A;  1POG A;  3F6O A;  1XD7 A;  2IA1 A;  4UV8 A;  1VI0 A;  1I3Q J;  3BP8 A;  5LHI A;  4CXF A;  1OLT A;  2O8X A;  4A0X A;  1LKX A;  1B8I A;  4ZYG A;  4A3B J;  1O3Q A;  1KZH A;  1WGX A;  2DPU A;  5ILU A;  1G8X A;  2KMU A;  5AIP A;  2MBF A;  1I3A A;  3KIO A;  2Y48 A;  2B63 J;  1QO0 D;  3KPH A;  1FSE A;  2R93 J;  3OYG A;  4M71 A;  2X9D A;  4DBR A;  3CO7 C;  3J7Y J;  5DV5 A;  1R5G A;  4LFU A;  4KN7 X;  4EJT A;  2L9S A;  2IS1 A;  2O7O A;  2DMP A;  3IAS 2;  1TQM A;  1PUF A;  2ZNY A;  5HDK A;  3ZN1 A;  2OC6 A;  4FT8 A;  1F36 A;  1OCZ H;  3HKZ A;  4G8X A;  4XLE A;  2K5C A;  1W7P B;  1K7A A;  4ITV A;  2XAQ A;  2OCE A;  1YW7 A;  4II3 A;  5EEH A;  1J59 A;  2IT0 A;  5LEJ A;  1F1Z A;  1MMG A;  4LB6 B;  3MKY B;  2LBF B;  1YIT I;  3S2W A;  3CC7 I;  1P6R A;  3LL7 A;  1H8A C;  2XF5 A;  1WCM J;  4B1R A;  4BHP A;  1UB9 A;  2DLL A;  2FMY A;  4UXN A;  3OS0 A;  1HXD A; 
#chains in the Genus database with same CATH homology
 2XVC A;  2PFB A;  2L4M A;  5E20 A;  2RQP A;  2PQ8 A;  3WTX C;  4HYE A;  4RGX A;  1DP7 P;  2M5W A;  4ESJ A;  2DQR A;  1I6X A;  5KK1 A;  2K4J A;  1B59 A;  3SZP A;  2WC2 A;  3ISP A;  1OMI A;  1XGM A;  4MQV A;  3O3K A;  2XHK A;  1ZRE A;  2VE8 A;  1K78 A;  1EH7 A;  3J80 Z;  2FNA A;  3V4G A;  1RIO H;  4G7O F;  3FXQ A;  4WXH A;  2KIU A;  1WSU A;  4AVP A;  3RTR A;  4FX4 A;  5D5V B;  4KMU X;  3QU6 A;  5DCM B;  1EV7 A;  1MJ9 A;  3HRU A;  2CFX A;  3VOE A;  1PP8 F;  2W25 A;  1W5T A;  2MC3 A;  1FY7 A;  1G3W A;  2WV0 A;  1R1V A;  4QWQ A;  4IRI A;  2V9V A;  3IHU A;  2ETH A;  3DQV C;  3SFZ A;  3ABU A;  2P5V A;  4WK8 F;  3GWZ A;  2QM3 A;  1QZY A;  3VFZ A;  3QPH A;  2NAZ A;  1HSJ A;  3JW4 A;  2R7F A;  1O3R A;  2OD5 A;  1JHF A;  3MQ0 A;  3ZP5 A;  5LEK A;  3I59 B;  3DP7 A;  1E17 A;  1X3U A;  2JSC A;  1IXC A;  2VT2 A;  3WE3 A;  3F23 A;  2J5O A;  3KZZ A;  2GWR A;  1SFU A;  1OPC A;  2KJB A;  4L9V A;  2Q8K A;  2HYF A;  5E1X A;  3KET A;  1JHH A;  3F8F A;  4EJW A;  1C0W A;  1U2W A;  4A5M A;  4HF2 A;  3G73 A;  1ZYR F;  1VTN C;  1DPU A;  3LA7 A;  3L7W A;  2D2W A;  5LLQ A;  5D4R A;  4I02 A;  2Q2E A;  2K02 A;  3L2C A;  1XSD A;  5LGT A;  3I4P A;  4ZH4 F;  2L01 A;  5DUK A;  1BBY A;  4EJU A;  2HQR A;  1YFH A;  2QBY B;  2FEZ A;  3JTG A;  3WGG A;  4LK0 F;  1MJB A;  5J8C A;  2CO5 A;  4N0B A;  5D6F A;  1UST A;  4AIH A;  1XCV A;  1S6L A;  3TQN A;  3JAM K;  2MA3 A;  2P7V B;  3HOS A;  1KU3 A;  1MGT A;  4KYW A;  2OA4 A;  5BQT A;  3SQN A;  2ZO4 A;  2K4B A;  4KUM A;  4L5J A;  1FNN A;  1HW2 A;  4G6D A;  2FSW A;  3N97 A;  1OYI A;  1TTY A;  2JZY A;  3EDP A;  4M9Z A;  4LGW A;  3KEQ A;  4ENN A;  2OBP A;  3WGI A;  3B02 A;  2DW4 A;  2JPC A;  3K1M A;  1D8K A;  2ESH A;  3N4M A;  1F5T A;  1LQ1 A;  5LRR A;  2IPQ X;  1GVJ A;  2XUB A;  3M8E A;  1O7F A;  1B4A A;  3FM5 A;  5J6X A;  3U9G A;  3GW2 A;  3WU1 B;  4MQ9 F;  3EUH A;  3GLX A;  2A68 F;  1TQI A;  2NS0 A;  3U1D A;  4CDG A;  3Q9V A;  5ED4 A;  4ZYE A;  1Q1H A;  1BI1 A;  1AOY A;  5AON A;  2MD5 A;  1ZGA A;  1R36 A;  2EJR A;  4XSZ F;  3EET A;  5IT9 K;  1ZRD A;  2Y0M A;  3MZY A;  1B6A A;  3V8J A;  2D1H A;  1FSH A;  2KRF A;  1DUX C;  2E7W A;  5TRD A;  4U0W A;  2M8E A;  4EMS A;  1KQ8 A;  1FBU A;  3LA2 A;  2FBI A;  4BQA A;  2DO7 A;  3OOP A;  5HDN A;  5K5O A;  3BJO A;  3R4K A;  3GO5 A;  3HHG A;  4PDK A;  1EH6 A;  4EGY A;  2YX4 A;  3KLO A;  2H27 A;  3KP2 A;  3QP5 A;  4HX7 A;  4HV6 A;  2F5E A;  4B8X A;  3JAM Z;  4NQW A;  3MWM A;  5ICF A;  3BOQ A;  2ACJ A;  1TQP A;  4U7B A;  3E5X A;  2E1C A;  2O0Y A;  4EM1 A;  3E3V A;  3LA3 A;  4LMY A;  1IF1 A;  5H6Q A;  2A6E F;  3WTS C;  1TW3 A;  1K78 B;  1DPR A;  5LGN A;  2CG4 A;  4WX9 A;  3L00 A;  4TV7 A;  2FOK A;  4NB5 A;  2A3S A;  4ZYD A;  3DEU A;  1BM9 A;  5E17 F;  2RVC A;  5DDG A;  1P2F A;  1U6G A;  2RGV A;  4XSX F;  3P9K A;  2K86 A;  5HVQ C;  1EH8 A;  2M87 A;  3U2R A;  3WTZ A;  1G3S A;  3KP7 A;  2UXX A;  2D45 A;  1RNL A;  1O3T A;  4M73 A;  3PQK A;  4ENM A;  3RYR A;  1KU2 A;  2PN6 A;  1G3T A;  3QPT A;  1S7O A;  1RUO A;  2Q0O A;  1Z6T A;  4RGU A;  2DBB A;  2PMH A;  1I1S A;  5FO5 A;  3ERE D;  3FX3 A;  2W57 A;  1D5V A;  3FMQ A;  4GYG A;  3ZN0 A;  2MH2 A;  1BOA A;  2Z9O A;  3FF5 A;  3BJA A;  3V7R A;  2E7X A;  3GVA A;  3CTA A;  1HW1 A;  1BIA A;  3W6K B;  5IT9 Z;  1BIB A;  1H0M A;  5K5R A;  1UHW A;  2XIG A;  1O7L A;  1AWC A;  2EFP A;  4KN4 X;  4YG2 F;  3H92 A;  1YS6 A;  1XMA A;  2LF8 A;  2QEN A;  1GHC A;  3DXJ F;  3L9F A;  4Q5S F;  5TJJ A;  2HGC A;  3LAP A;  1ZG1 A;  1YIO A;  4HF1 A;  5H20 A;  2IW5 A;  1LJ9 A;  2HS5 A;  3RKW A;  1IN7 A;  1CGP A;  2IJL A;  4IVN A;  3MCZ A;  4LB5 A;  5D5X B;  2IP2 A;  2DI3 A;  3DPL C;  4UUV A;  1W7P D;  4WCG A;  2VBX A;  3EYY A;  2H6C A;  4M72 A;  3D5L A;  4A0Y A;  1JXS A;  5D8L B;  4U7D A;  2A07 F;  4UVC A;  1J7K A;  4WXD A;  1IRG A;  2HTS A;  3M7G A;  2EA4 A;  3I58 A;  1PDN C;  3LST A;  1ON2 A;  4U88 A;  4BHC A;  3RPU A;  1F4K A;  1LNW A;  4IRG A;  2R7D A;  2V1D A;  2XAS A;  4OIO F;  3SXY A;  3I5U A;  1SD5 A;  3D0S A;  3ROU A;  1ZRC A;  2KKO A;  1XCB A;  2GQQ A;  4ENK A;  5DCF A;  4BYY A;  1OR7 A;  4OIQ F;  4I0B A;  2XAJ A;  1BC8 C;  3F8C A;  2ZME A;  4RAY A;  2OZU A;  1B9N A;  5DEQ A;  3FM3 A;  2XAG A;  5FD5 A;  3KP4 A;  2Z99 A;  4CHU A;  2VE9 A;  5HLG A;  4M6X A;  2W84 A;  3I71 A;  2EFN A;  1BI0 A;  5CYV A;  4L9J A;  1G3Y A;  3HSF A;  2EV6 A;  4MTE A;  5FFZ A;  1L0O C;  1UCR A;  4OIN F;  2EV0 A;  4OMY A;  2VBW A;  4OIP F;  3G3Z A;  1B9M A;  3JTH A;  2FE3 A;  1TBX A;  2EFO A;  1SD7 A;  1R5H A;  2V6C A;  5L3D A;  3RKY A;  2V79 A;  1OYW A;  1O3S A;  2RV8 A;  2DQL A;  1Z1D A;  4EM0 B;  3P9C A;  1T98 A;  3PFI A;  5L3F A;  1A04 A;  3WU0 A;  1XGO A;  1R1U A;  3Q5F A;  4M74 A;  4RB3 C;  1UHM A;  3GFL A;  2QWW A;  4XBF A;  1LEB A;  3FMR A;  4HQE A;  4ETS A;  4YFX F;  3ZMV A;  4P9F A;  3V8L A;  3DV8 A;  4UNO A;  3QOP A;  4O5V A;  3F8B A;  4LK1 F;  4OU0 A;  4FX0 A;  1LDD A;  3E6B A;  2M1B A;  2STT A;  3RIR A;  2VXZ A;  2V1X A;  3GF2 A;  4L9N A;  1U8R A;  1G4D A;  1QQI A;  2GA1 A;  3HRT A;  3QU3 A;  3TDZ C;  3W6J B;  4Z2Y A;  4BNC A;  3IRQ A;  1IN5 A;  2BGC A;  2HR3 A;  5ILV A;  3GZ5 A;  4R1H A;  2L3D A;  3IKV A;  2PBI A;  3RKX A;  4LD5 A;  2CYY A;  1Z91 A;  4Q48 A;  1YW9 A;  5DD4 A;  3ZMT A;  5HS7 A;  3FXR A;  5JFR A;  4CZZ A;  4KIF A;  1IW7 F;  4U0Y A;  3H3U A;  3WG9 A;  5BPD A;  4S04 A;  3IWF A;  1XDU A;  1D8J A;  1FOK A;  4N9I A;  1HBX G;  2RDP A;  1H9G A;  1ZG3 A;  4RS8 A;  2BBY A;  2HOE A;  1YG2 A;  2H94 A;  2QQ9 A;  3ECH A;  2QQA A;  2FQ3 A;  3K0L A;  1KA8 A;  4M9S A;  2CGP A;  3IKT A;  2Z5U A;  2ZFW A;  4JQF A;  2L4A A;  2GIV A;  4PCQ A;  4RAZ A;  3T1B A;  4I09 A;  1MKM A;  4YFK F;  5JVT A;  3CDH A;  5D5U B;  5K5Q A;  4G7Z F;  1HQC A;  5HS8 A;  1KYW A;  3F8M A;  3GUD A;  1FC3 A;  5L3B A;  1H9T A;  5L3G A;  2RKH A;  2IA0 A;  2F5C A;  3HHH A;  2VOO A;  1PP7 U;  1YLF A;  2FNP A;  4AD9 A;  1OKR A;  2H6B A;  2UWM A;  5FB2 A;  2FML A;  4G6Q A;  2NNN A;  1FBS A;  2EB7 A;  4WWC A;  4RB2 C;  5FD6 A;  2DK5 A;  1J0R A;  4QLC U;  3H3Z A;  2A6H F;  4ZZD A;  4IHT A;  1R22 A;  3F72 A;  4L18 B;  2F5F A;  4Q47 A;  2F2E A;  2ZKZ A;  4MTD A;  4GCV A;  3KLN A;  3WTT C;  4YII A;  4KFC A;  2PEX A;  4G7H F;  3L09 A;  4I98 B;  4IHS A;  3JSO A;  1YO5 C;  2UXN A;  1LVA A;  3K1P A;  2P5K A;  3HUG A;  2BE5 F;  4GYI A;  3TO9 A;  3HSR A;  4A6E A;  3MAJ A;  1ZAR A;  1ODD A;  2H09 A;  2ZME B;  1SD4 A;  2G7H A;  4G94 A;  1E2X A;  1R58 A;  5E18 F;  2W24 A;  1S3J A;  1ULY A;  3F22 A;  1ZLK A;  1IN4 A;  3BPX A;  5HLI A;  4Y17 A;  3MFK A;  1O57 A;  4ESF A;  1FYM A;  1QPM A;  2PG4 A;  3HOT A;  1K79 A;  3FHZ A;  3GFJ A;  3NEU A;  5FGM A;  5ICE A;  5LGU A;  3HRM A;  2P5L C;  1XB4 A;  3KP6 A;  4ON0 A;  2UZK A;  2F5D A;  4XRF A;  1SFE A;  3FWE A;  4R79 A;  1WWX A;  5EEG A;  1S7A A;  2PLY A;  1P4W A;  3KFW X;  3KE2 A;  3KCC A;  1KU9 A;  4IRH A;  4BH9 A;  3LFK A;  1T6S A;  2M45 A;  2VC0 A;  4UVA A;  3VB2 A;  2JPB A;  2VOD A;  4UV9 A;  1L3L A;  4KDP A;  4Y13 A;  3P7N A;  3LQR A;  3VOD A;  4U0V A;  4CO8 A;  3GYH X;  3LWF A;  2MLK A;  1ONV A;  2ESN A;  4A5N A;  2VN2 A;  2XRN A;  1P4A A;  2AXL A;  4KIB A;  3REO A;  2E1N A;  3O6B B;  2GZW A;  1IN6 A;  4L5I A;  4M9X A;  5E1Z B;  2IRF G;  4JK1 X;  2Z3Y A;  4HLY A;  5H6R A;  1J75 A;  3WTW C;  1P4X A;  1FZP B;  4I2O A;  2NRA C;  3E5Q A;  2BEO A;  3KP5 A;  5HOO A;  1JE8 A;  3ZMU A;  1FT9 A;  5HLH A;  3ELK A;  3M1E A;  1IZ1 A;  1IRF A;  3TOA A;  3F21 A;  5AIQ A;  2HWV A;  4N9H A;  3CUQ A;  1IAW A;  3ZMS A;  4OIR F;  5JR3 A;  2QQB A;  4YIF A;  2IA2 A;  4UVB A;  3DPT A;  2WTE A;  2K27 A;  3C3W A;  4LJZ F;  3C7J A;  4P5O A;  1Y0U A;  2ADU A;  4E70 A;  2O61 A;  4HAM A;  2VBY A;  3IRR A;  4L0Z B;  4HZF A;  2XGX A;  5F1R A;  3RYP A;  2X4H A;  2COM A;  4EQQ A;  5CVV A;  4Y15 A;  2MH9 A;  2YR2 A;  4HX8 A;  1YTY A;  5BS6 A;  4CYD A;  2HYG D;  2CQK A;  3BDD A;  3GZ6 A;  4KA4 A;  1Z05 A;  1TNT A;  3K9T A;  4OMZ A;  2G9W A;  4EJO A;  5FLX K;  4EGZ A;  1V4R A;  1FP2 A;  5DUI A;  2OQG A;  1T39 A;  1R23 A;  2HKX A;  2M30 A;  1SMT A;  1RI7 A;  2EV5 A;  5LBQ A;  4DNC A;  3KP3 A;  4A2U A;  4RB0 A;  2FA5 A;  2OAZ A;  3GFM A;  4B09 A;  2P4W A;  4L0Y B;  1TNS A;  3GEZ A;  1BJA A;  3E6C C;  5ERI A;  2YPR A;  3KEO A;  4OOI A;  3HTS B;  3TGN A;  2FRH A;  2K7L A;  3DF8 A;  3HRS A;  1T38 A;  5DYM A;  5CVJ A;  2TDX A;  5D6E A;  5BMZ A;  1BI3 A;  3CUO A;  2GA2 A;  3HYI A;  3IWZ A;  3WTV C;  2GXG A;  2MLG A;  1TLH B;  4WXC A;  5CVR A;  2PI0 A;  2FBH A;  3ECO A;  1SMY F;  2FBK A;  1U5T A;  2DPD A;  1XSV A;  4HV5 A;  3VEP A;  2EK5 A;  2EWN A;  3WOD F;  4IXA A;  2O3F A;  4P96 A;  5DD8 A;  2KIF A;  2V1U A;  1K6O A;  2VON A;  4I7H A;  4LLN A;  2ZCW A;  2BYV E;  1J5Y A;  1Z6R A;  2A61 A;  2O6G E;  3R0A A;  1I1G A;  3R61 A;  4BHB A;  3E97 A;  1V3F A;  1FPQ A;  1S29 A;  4RB1 A;  1KGS A;  3GFI A;  4O3M A;  3RPQ A;  1BN5 A;  1T2K A;  3BRO A;  3F3X A;  3I0T A;  4EV0 A;  1KQ0 A;  4WF2 A;  4ZYH A;  2OU2 A;  2STW A;  1ZN2 A;  1MD0 A;  3F6V A;  3J81 K;  3BZ6 A;  2DT5 A;  4EVI A;  5FLX Z;  5A2Q K;  3T8R A;  2EFW A;  1UFM A;  1W4M A;  4Q4Z F;  1DDN A;  4MNU A;  3QAH A;  4DQ2 A;  1OYY A;  4CGZ A;  2HEO A;  4A12 A;  2D1V A;  3GX4 X;  5JI6 A;  1QBJ A;  4GGG A;  1XGS A;  3WE2 A;  3R0J A;  2YX7 A;  2OQR A;  1MDM B;  1RUN A;  3C18 A;  1YQA A;  2R3S A;  3RDI A;  3I53 A;  4PGG A;  5HS9 A;  1J9I A;  1D3Y A;  1MJA A;  5D5W B;  2HZT A;  1HW5 A;  2XV4 S;  2OZ6 A;  1IXR C;  3T8T A;  2RNJ A;  2XKP A;  4I01 A;  4MEX F;  3BJ6 A;  1G6N A;  1WRJ A;  4AIJ A;  4LG0 A;  1PUE E;  1YW8 A;  3FXU A;  3R60 A;  4LLG F;  2JRT A;  3TO6 A;  3LQQ A;  4R8H A;  4GXO A;  5JHU A;  2ZBK A;  2DFI A;  5CLS A;  1MZB A;  1NHA A;  2IVM A;  4HF0 A;  4H0E A;  4UHT A;  2ZNZ A;  1SAX A;  2J5P A;  1IUY A;  3E5U A;  5CJ9 A;  3JSP A;  5IT3 A;  1QGP A;  1FYK A;  2QVO A;  1YS7 A;  1SFX A;  5E8G A;  4KMF A;  2LSO A;  3WTU C;  3V8K A;  3ZMZ A;  1WQ2 A;  5HDG A;  2DK8 A;  1CF7 B;  2PMU A;  3CUQ B;  2HDC A;  4ASN A;  1F9N A;  1LEA A;  4HX4 A;  2NNY A;  5L3E A;  4O6J A;  5E8I A;  1LDJ A;  5ICG A;  3COA C;  4HDV A;  5LHG A;  2HKO A;  1KU7 A;  3MEX A;  4F7Z A;  2EA2 A;  4HOB A;  1XGN A;  1FP1 D;  3Q9S A;  3J81 Z;  4IJA A;  3IL2 A;  3EQL F;  4S05 A;  1ON1 A;  1I27 A;  5FFX A;  3TO7 A;  4EJV A;  3NRV A;  5A2Q Z;  2Z33 A;  5BOX A;  4M6Y A;  1JGS A;  2CSO A;  4AWX B;  5J8F A;  5CVI A;  2RC4 A;  4PZJ A;  1BC7 C;  3CJN A;  5F6F A;  1U3E M;  1ZLJ A;  3RI4 A;  2XAF A;  4KT5 C;  2HFH A;  1ZHF A;  2A69 F;  3HSE A;  1HKS A;  2JTV A;  4A0Z A;  3SZT A;  4HLX A;  2VBZ A;  5E1W A;  2XAH A;  1WI9 A;  5F64 A;  4MHG A;  1TW2 A;  4EM2 A;  4RGR A;  4D0P A;  2WWY A;  2YU3 A;  1HKT A;  3J7A O;  1LB2 A;  1IN8 A;  3HTU A;  1YYV A;  2G7U A;  3LAJ A;  3SHF A;  2ZXJ A;  3ML6 A;  4P9U A;  1W7P A;  2P7C B;  4HW0 A;  2W85 A;  4P55 A;  1WKM A;  2KJC A;  3F8N A;  4MGR A;  5D4S A;  2KIM A;  1XN7 A;  3TDU C;  5LHH A;  1GXP A;  2LDU A;  2HQN A;  2XRO A;  2YSR A;  4ZZL A;  1J2X A;  4JBA A;  2CW0 F;  2ISZ A;  2A5Y B;  3K1N A;  3EYI A;  1U5T B;  4CIC A;  1HKQ A;  3CUQ C;  3QRF F;  2VOP A;  3K2Z A;  2GAU A;  1P92 A;  1R1T A;  3TOB A;  2DTR A;  1FLI A;  1R00 A;  5BPI A;  5ICC A;  1ZH5 A;  4I0A A;  3R6S A;  2ISY A;  1QNT A;  2ELH A;  1XSX A;  4LLL A;  4NHJ A;  2AS5 F;  3GXO A;  2P8T A;  1FYL A;  1GXQ A;  3E6D A;  5DCM A;  3ZQ7 A;  2DU9 A;  1KYZ A;  4L9T A;  2FXA A;  3T5X A;  2FF4 A;  2XKO A;  1XDS A;  1MDM A;  4KIG A;  3P9I A;  3T0Y A;  2HTJ A;  5K1Y A;  4HDU A;  4FHT A;  3MZH A;  2P6S A;  1XMK A;  1B1B A;  5ILS A;  4BAY A;  2FU4 A;  2DAO A;  4PGH A;  1ZRF A;  3QP6 A;  1U78 A;  3CLO A;  3I59 A;  1HST A;  3ABT A;  3FZV A;  1R7J A;  1ZGJ A;  1USS A;  5KVR A;  3BWG A;  2C6Y A;  2PJP A;  2BV6 A;  3C1D A;  1I5Z A;  1STZ A;  1T0F A;  3FMS A;  5CVU A;  3V7S A;  4IF4 A;  3DFG A;  1RZ4 A;  2P6T A;  3B73 A;  1KQ9 A;  1W5S A;  1CF7 A;  2QYO A;  3AAF A;  4HBL A;  3ZPL A;  1FX7 A;  4LG0 B;  3PQJ A;  3ULQ B;  4GO1 A;  3WGH A;  2VC1 A;  4YFN F;  1IXS B;  2EFQ A;  1U5T C;  2QBY A;  2LNB A;  4ENJ A;  2L54 A;  4KIC A;  2B0L A;  3M9A A;  1S8N A;  1ZG5 A;  4HQM A;  2L02 A;  3RJP A;  2VT3 A;  4K2E A;  3O2P E;  5L3C A;  2LF7 A;  5D8K B;  3IC7 A;  2X0L A;  4RGS A;  3K69 A;  3HIF A;  4MEY F;  4AIK A;  3CO6 C;  1REP C;  3V7C A;  1ZAO A;  2CWE A;  6PAX A;  1QZZ A;  2QLZ A;  3OV8 A;  4BXU A;  2Y75 A;  1Z9C A;  3ZMD A;  2ZJ2 A;  5LRS A;  4A6D A;  4KNY A;  1LDK B;  2QZ8 A;  3E6M A;  1SD6 A;  3J80 K;  3I54 A;  2NYX A;  4HA8 A;  3WTY C;  3TKY A;  3DKW A;  3BY6 A;  1Z7U A;  4G9Y A;  4ESB A;  2GXB A;  3KZY A;  2QUF A;  1FBQ A;  2O03 A;  3M8F A;  1FWZ A;  2LKP A;  2RN7 A;  4XLP F;  4IPA A;  3NQO A;  4XLN F;  2JT1 A;  3BPV A;  3I64 A;  1BI2 A;  3F6O A;  1XD7 A;  2IA1 A;  4UV8 A;  3BP8 A;  4CXF A;  5LHI A;  2O8X A;  4A0X A;  4ZYG A;  1O3Q A;  2DPU A;  5ILU A;  5AIP A;  2MBF A;  2Y48 A;  1QO0 D;  1FSE A;  4M71 A;  3CO7 C;  5DV5 A;  1R5G A;  4LFU A;  4KN7 X;  4EJT A;  1TQM A;  2ZNY A;  5HDK A;  3ZN1 A;  4FT8 A;  4G8X A;  1W7P B;  1K7A A;  2XAQ A;  1YW7 A;  5EEH A;  1J59 A;  2IT0 A;  5LEJ A;  1F1Z A;  4LB6 B;  3S2W A;  1P6R A;  4BHP A;  1UB9 A;  2DLL A;  2FMY A;  4UXN A;  1HXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...