2M5WA

Nmr solution structure of the la motif (n-terminal domain, ntd) of dictyostelium discoideum la protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
rcsb
source organism Dictyostelium discoideum
molecule tags Rna binding protein
molecule keywords Lupus La protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m5wA00
5LHHA 3OOPA 5L3EA 1E2XA 3B73A 5CVJA 3ZPLA 5LGUA 1REPC 2H27A 2AS5F 4R1HA 3ZMUA 4A0XA 4OINF 2V79A 1O3SA 2MLKA 5HS9A 1WSUA 1CF7B 4MQ9F 2FQ3A 4O3MA 3C1DA 5FFXA 2IP2A 4ENKA 1SD7A 1J0RA 4IRGA 1KQ9A 1TQIA 2K86A 3IWFA 4WXHA 3ZMZA 1ZRFA 4HF0A 4IF4A 4UUVA 1BI2A 1TW2A 1PUEE 4I0AA 5ILVA 4Q48A 4LLNA 5IT9K 3BJAA 3HYIA 2YR2A 4M71A 2XAJA 5D5UB 1ZGJA 3FF5A 2XHKA 5L3DA 2V1DA 1JE8A 5BQTA 3V7SA 4HF2A 5H6QA 4PCQA 4HV5A 1BC8C 1T38A 2ZMEA 5F64A 3M9AA 2H09A 5FB2A 2DQRA 4ZZLA 6PAXA 4ESBA 4OIRF 3E6DA 1EH6A 3O2PE 3WU0A 3LWFA 2Y48A 1T98A 4MNUA 4HV6A 5D4SA 1YLFA 3LAJA 2B0LA 2WC2A 5DYMA 1XB4A 4L0YB 5K1YA 1YTYA 3I5UA 1FBUA 4KNYA 2A69F 4HF1A 2STWA 5DV5A 4GCVA 1YIOA 4KFCA 3E6MA 3DF8A 5JI6A 1O3QA 1J5YA 1S6LA 2L01A 2Z9OA 2M5WA 3ZMDA 1JGSA 2Z99A 1BM9A 4GO1A 3GF2A 1R5HA 4HQEA 3WE2A 2EFQA 2VC1A 1DPRA 2DK8A 2HWVA 2YX4A 1U3EM 4I2OA 2JPCA 5DCFA 2K4BA 4MQVA 2VBZA 2K02A 4WXCA 2Z3YA 5CVRA 4MHGA 1Q1HA 1ZH5A 4KDPA 3RKXA 3KP4A 4EM2A 4LJZF 3TO7A 1Z1DA 3I64A 5D5VB 5HDKA 2ZBKA 1DP7P 4KUMA 2KJCA 2VXZA 3WTZA 3F8NA 1ZAOA 5FO5A 2DLLA 1J75A 3FHZA 3WTSC 1AWCA 3FM5A 2FOKA 3KE2A 1R00A 4EV0A 4ENJA 4IHTA 2OZ6A 4FX4A 4YFKF 3WU1B 2W85A 1UFMA 2VBXA 1ZLJA 1HSTA 2F5CA 3HRSA 2NYXA 4GGGA 3NRVA 2CGPA 4EJWA 4I01A 3MAJA 3ELKA 3RJPA 1D8KA 3WTTC 2VE9A 2JPBA 2DAOA 2FRHA 2F5DA 2DT5A 3ZN0A 3TDUC 2EA4A 1STZA 3H3UA 5ICCA 5D6EA 1RUOA 1ZRDA 4HX8A 4L0ZB 4EGYA 3V4GA 1IRFA 5D5XB 1DDNA 2OBPA 2O3FA 3TO9A 1LDKB 1D5VA 4IJAA 2X0LA 5HLGA 1YW9A 3VB2A 4ZZDA 1TW3A 1W7PA 1FSEA 3CO6C 3F72A 1SFXA 5BPIA 1JHFA 2LSOA 2HYGD 3RYRA 2UZKA 1D3YA 3WTXC 3QU6A 1LEBA 1T0FA 2JTVA 3HRUA 3ROUA 2IA0A 3D5LA 3BWGA 2ZNYA 1IUYA 3P7NA 1R1TA 2TDXA 1O3TA 2ZO4A 1U6GA 3E5QA 1IZ1A 3ABUA 3AAFA 3IHUA 3I4PA 1RIOH 1YW7A 5K5OA 4CICA 3JTHA 4RGRA 1JHHA 3ZQ7A 4RB3C 3IKVA 1GXQA 3F8BA 3L09A 3LA2A 2NNNA 2W24A 3LFKA 2ADUA 2L3DA 5DD4A 4G9YA 4L18B 1V4RA 1RI7A 4S05A 2ZKZA 2A68F 3V7CA 2G7UA 3TO6A 4G7HF 2COMA 1R23A 2RGVA 1ZN2A 2PG4A 3KFWX 4ZYGA 4M74A 2VOPA 1YFHA 3PQJA 3N97A 2XUBA 3KP6A 4P9UA 3JW4A 1FOKA 1LJ9A 3RTRA 2Q2EA 1J7KA 2HTJA 2DPDA 1BBYA 5ICFA 1USTA 2DU9A 5JVTA 2D2WA 5D6FA 3ZN1A 1TTYA 4HQMA 5FGMA 4TV7A 1H9TA 3QPHA 2YSRA 2VN2A 3T8TA 1J59A 5H6RA 4YIFA 5FD6A 3WTYC 2G7HA 3LA7A 4PGGA 3BPVA 1O7LA 3F8CA 2FU4A 2E1NA 1MDMA 3SHFA 4U88A 2Z5UA 4UNOA 1FBSA 2RNJA 3Q5FA 3HIFA 3IKTA 3MWMA 1NHAA 2M30A 5HLHA 5HLIA 1O3RA 4PZJA 3LQRA 1Z7UA 1FBQA 3RIRA 2ETHA 1P92A 2G9WA 2EK5A 3E5UA 2VONA 2Q8KA 2A6HF 4AWXB 1LDDA 1VTNC 2PJPA 1IN6A 2XAHA 3ZMSA 4LGWA 2O8XA 1GXPA 2FEZA 1OKRA 5J6XA 2HFHA 2QENA 2RC4A 3J80K 3WTUC 2W84A 1CF7A 2ESHA 4Y13A 2C6YA 1IN4A 2OQGA 3J7AO 2HOEA 3V7RA 4QWQA 5KVRA 1I1GA 3BOQA 5DDGA 3RPUA 1OR7A 1K6OA 1WRJA 3KCCA 4KICA 2J5PA 5JFRA 3SZPA 5KK1A 4KMFA 4L9JA 4M9ZA 1LNWA 2KJBA 5DCMA 2ESNA 3JAMK 5BOXA 5HVQC 5FD5A 1O7FA 3JSOA 3HSRA 3F21A 5AIQA 2XV4S 1UHMA 5LEKA 4E70A 5D4RA 3B02A 4LLLA 3TOBA 4NQWA 5DD8A 3KEOA 3SQNA 1GHCA 3LSTA 1DUXC 2ELHA 4A6DA 3ULQB 2GZWA 4L9NA 3K1MA 2HKOA 3HSFA 1FP2A 1QO0D 1K79A 1R1VA 3PQKA 3ZMVA 2H6CA 2NS0A 3BP8A 4LMYA 1SFUA 4IHSA 4JQFA 3H92A 3IRQA 3L7WA 1KGSA 1SMYF 1S7AA 2QUFA 3R61A 5LLQA 1PDNC 3DEUA 4G7ZF 4IXAA 5L3CA 1B9MA 4R79A 4BXUA 1AOYA 4I02A 1YQAA 1XGNA 1IXCA 2Y75A 3TQNA 1LQ1A 4KT5C 2M8EA 1YS6A 2HGCA 1U5TB 1ZARA 1TBXA 4HDUA 5BPDA 5L3GA 1PP7U 2XIGA 2HEOA 3WTVC 3E3VA 4BHPA 2JT1A 4S04A 1XSXA 3HHHA 1IAWA 1HBXG 3IL2A 2VC0A 2QYOA 3WE3A 1WI9A 2P5LC 4P96A 4RGUA 4XBFA 5BMZA 2CWEA 2IW5A 1DPUA 3L2CA 5E8IA 1G6NA 5LHIA 2FNAA 2OQRA 1YO5C 2STTA 2R7DA 4AVPA 4MEXF 5ILUA 5HOOA 2F5EA 1P4AA 1L3LA 1F5TA 3LQQA 3LAPA 2OD5A 3BROA 3NQOA 3E97A 3GFIA 1FYKA 4DNCA 2E7XA 5CVUA 2Z33A 4WCGA 4ZYHA 1BJAA 2HDCA 1W7PD 1XD7A 5LBQA 1YYVA 2KIMA 1R7JA 4I98B 3BY6A 4OIOF 3W6JB 4LK0F 1SD4A 3HHGA 1YS7A 1U5TA 1Z91A 2A5YB 1K78A 3TGNA 4HA8A 1F4KA 2PBIA 2O61A 3JTGA 3N4MA 1ZREA 2VOOA 1OYIA 2F2EA 3BPXA 4Q4ZF 2GA1A 4JK1X 3K0LA 4YFXF 3J81Z 2XROA 2VODA 4LB5A 1QQIA 2XGXA 1KQ0A 4BHCA 1RNLA 4ESFA 2FF4A 4CGZA 1P2FA 4L9TA 1I6XA 1BN5A 1EH8A 2VBWA 2HZTA 4N9IA 4CXFA 2DBBA 5FFZA 2Q0OA 1G4DA 2IPQX 3MZHA 4RAYA 3T5XA 4LB6B 4U7DA 3H3ZA 1R22A 3SFZA 1UCRA 1R58A 4HYEA 2RDPA 1BOAA 5E18F 4BYYA 2V9VA 5LGTA 4UVBA 2RKHA 1EV7A 1QBJA 4OMZA 4FX0A 3RDIA 4A5NA 5DCMB 2OU2A 3WGGA 1OYYA 2QLZA 3SZTA 5HS7A 1T39A 1KU9A 3E5XA 3CJNA 1MZBA 1ON2A 1A04A 2J5OA 4EJUA 4XRFA 1L0OC 3M8FA 1IN7A 1YG2A 2VBYA 3I53A 4OMYA 4KA4A 4BAYA 1V3FA 1G3TA 1S3JA 4KIFA 4Y17A 3KP5A 4LFUA 2R7FA 3EUHA 3GYHX 2O6GE 3HSEA 4GYGA 3ISPA 2NAZA 4L9VA 1H0MA 3FMQA 4EJOA 5LEJA 3FZVA 4MTDA 4XSZF 2ZXJA 3S2WA 4CO8A 3K9TA 4EGZA 2K7LA 3MZYA 3I59A 1MKMA 2OA4A 4M9XA 5HDGA 3RI4A 2DW4A 4RB1A 4ETSA 2XKOA 2JSCA 2A3SA 5A2QK 3HRMA 3FXQA 2PEXA 3CUQC 5F6FA 1FSHA 3FXUA 4P5OA 4RGXA 4UV8A 5K5RA 4AIKA 2QQ9A 1OMIA 2BE5F 3RKYA 1J2XA 3QP6A 4XLPF 4O6JA 4RS8A 1XSVA 2A61A 2ACJA 1XCVA 3HOTA 4UVAA 2E7WA 4LK1F 2VT2A 3CLOA 2QM3A 3KZYA 4A5MA 5LRRA 2ZMEB 1S29A 3ECOA 3EYIA 1BIBA 4N9HA 2V6CA 4JBAA 1E17A 4HX7A 2O0YA 3M7GA 1FLIA 3R60A 1QZZA 1B1BA 1B59A 1LDJA 1FWZA 5D8LB 5FLXK 3GVAA 4UHTA 3I59B 4MEYF 3HTUA 2DPUA 3FMRA 1I27A 5LRSA 3DKWA 1BI1A 4L5JA 1FC3A 3DP7A 1LB2A 2HTSA 2MA3A 3KZZA 1P4WA 4IRHA 4IRIA 2DTRA 2FMLA 3DQVC 1UHWA 2K27A 3O6BB 2CFXA 2IA2A 2L4MA 3SXYA 4HOBA 2DQLA 2GIVA 4OIQF 4F7ZA 1SFEA 1TLHB 3RYPA 4CYDA 1W7PB 3BJOA 2KKOA 1B4AA 5A2QZ 2PLYA 1F9NA 2XAFA 2EA2A 1ON1A 2VT3A 5J8FA 3F22A 3COAC 3MEXA 2MH2A 4HLYA 1XDSA 3F8MA 4FHTA 2EV0A 2PN6A 2KIUA 3GFJA 1KYWA 3T0YA 2RN7A 5ICEA 1J9IA 3QRFF 1LEAA 4CHUA 5IT3A 4KN7X 3REOA 4KMUX 3QU3A 4BHBA 2P7VB 3VFZA 3F6VA 2DO7A 4ASNA 4RB2C 2DI3A 2CQKA 2F5FA 4MGRA 2EFPA 3R0AA 3G3ZA 4UV9A 1XGMA 3CO7C 2EJRA 4UXNA 2WWYA 2EB7A 3EYYA 2QWWA 2NRAC 2BBYA 4B09A 2FE3A 5CYVA 1TNTA 1I5ZA 2R3SA 5D8KB 5LHGA 2P7CB 3V8JA 1KQ8A 3CDHA 1WWXA 4YFNF 5D5WB 2ZJ2A 1B6AA 4G8XA 3TOAA 5EEGA 5CJ9A 1KU2A 1K78B 1EH7A 4H0EA 2GQQA 1U78A 4ZYEA 1MJ9A 1B9NA 2HYFA 3ERED 4EM0B 3WGIA 2FBKA 3DPLC 4XLNF 2PMUA 4RAZA 1QPMA 2NNYA 4I7HA 2XVCA 2ZCWA 2HQNA 1IXRC 2IT0A 1MJAA 3WGHA 5DEQA 2K4JA 5IT9Z 1TQPA 3EETA 5E1XA 3VEPA 3F6OA 3HOSA 4LG0A 2AXLA 1FZPB 4BQAA 1ZLKA 3F3XA 2XASA 1ODDA 4RB0A 3E6CC 4G7OF 1FY7A 4A0ZA 1IW7F 4ON0A 1MGTA 3I0TA 4EM1A 1ZG3A 1W5TA 5L3FA 2FBHA 3GUDA 2A07F 2L4AA 5CVIA 4OIPF 2IA1A 2YPRA 4N0BA 3QOPA 2UWMA 1D8JA 3KP3A 1HW1A 2MBFA 3T8RA 4BNCA 5F1RA 3KLNA 2LF8A 4PDKA 3CTAA 3IRRA 2UXNA 1G3SA 3IWZA 4IPAA 2LNBA 3WODF 1TQMA 3W6KB 2CYYA 1FNNA 4EMSA 2W25A 1MD0A 5E8GA 4HDVA 4LD5A 2BEOA 2O03A 1IRGA 1BC7C 4M9SA 4M72A 2MH9A 1FYLA 1HW2A 1KU7A 3U2RA 4B8XA 4NHJA 3OV8A 1C0WA 2M87A 2XRNA 3U1DA 1I1SA 4WWCA 1ULYA 2QQBA 1Y0UA 5TRDA 3L00A 1GVJA 4RGSA 3F23A 2GAUA 2MC3A 1KA8A 2EV5A 3L9FA 3GZ6A 4Z2YA 4HAMA 2V1XA 4IVNA 5J8CA 1Z6TA 4A2UA 3GFLA 3Q9VA 4WF2A 2X4HA 3DFGA 4R8HA 3ABTA 2M45A 4EQQA 1P6RA 4P55A 3BJ6A 2M1BA 1S7OA 1P4XA 4WX9A 3LA3A 2OZUA 3R0JA 4ENNA 2EFWA 3WTWC 3ZMTA 4G94A 4WK8F 2P5KA 2D1HA 3U9GA 1ZG5A 2DFIA 2YU3A 2EWNA 1XDUA 2A6EF 1H9GA 3KP2A 4ESJA 4LG0B 2QBYA 3KEQA 4KIBA 4O5VA 4AD9A 4M6XA 3BZ6A 4BH9A 3MFKA 4YG2F 1MJBA 2CO5A 4OU0A 2HS5A 4LLGF 3JSPA 3CUOA 5E1WA 3WG9A 1HXDA 5L3BA 5DUIA 1OPCA 3CUQB 1HQCA 1HW5A 1SMTA 3P9CA 2HKXA 2ISZA 3M1EA 1ZRCA 3V8LA 1R1UA 2L54A 3JAMZ 2HR3A 3K1PA 4M6YA 1MDMB 1IN8A 2EV6A 2KRFA 1W4MA 1ONVA 2XAQA 2L02A 3GWZA 4CZZA 3KLOA 4KN4X 2FSWA 2KIFA 1HSJA 1UB9A 3K1NA 3C3WA 3NEUA 1XMAA 2PQ8A 4ZYDA 4CDGA 5H20A 2QBYB 2JRTA 3DV8A 3VODA 2FXAA 3FMSA 4HW0A 3GEZA 3T1BA 1T2KA 4U0WA 1F1ZA 4I09A 4UVCA 1FYMA 4EVIA 2ZFWA 1R5GA 2BYVE 2YX7A 2CW0F 1XSDA 2RV8A 5E20A 2VE8A 2CSOA 4YIIA 4AIHA 1XMKA 5E1ZB 1XGSA 4GXOA 1ZYRF 4FT8A 2FMYA 2EFOA 2RQPA 4Q5SF 4AIJA 2D1VA 3VOEA 2IJLA 2ISYA 1X3UA 2OAZA 2XAGA 1WKMA 1U8RA 1IN5A 2P6TA 3J80Z 4Q47A 2GXBA 2D45A 3QP5A 2EFNA 4G6QA 1PP8F 2GXGA 5JR3A 1RUNA 4A6EA 2BGCA 5HDNA 4WXDA 3GZ5A 3RKWA 4KIGA 5EEHA 3PFIA 4Y15A 1SD6A 3J81K 2DK5A 1ZG1A 1RZ4A 4GYIA 4NB5A 2H94A 3ECHA 1BI0A 1XN7A 3P9KA 4P9FA 4OOIA 4A0YA 2FBIA 3HUGA 4QLCU 2QVOA 1SAXA 1JXSA 1TNSA 3FXRA 3G73A 3EQLF 2RVCA 3ZP5A 3I54A 3GX4X 2MD5A 3C18A 5LGNA 5CVVA 1XGOA 5JHUA 1QNTA 1QGPA 2LKPA 3RPQA 1R36A 5HS8A 3GXOA 2HQRA 1USSA 1XCBA 1G3YA 1W5SA 4EJVA 2MLGA 1ZGAA 3IC7A 2Y0MA 1S8NA 2P5VA 4D0PA 3D0SA 2H6BA 1BIAA 1FPQA 2PMHA 4MTEA 3DPTA 3O3KA 1HKSA 3R6SA 3K69A 5ED4A 1IXSB 1FT9A 3V8KA 1WQ2A 3EDPA 3GO5A 1ZHFA 2CG4A 2PI0A 1KYZA 4HX4A 2P4WA 5AONA 3M8EA 3BDDA 5E17F 3Q9SA 4HZFA 1OYWA 1KU3A 1U2WA 4M73A 2UXXA 4DQ2A 1Z9CA 1IF1A 1Z6RA 1YW8A 4KYWA 3GLXA 3HRTA 3DXJF 1T6SA 1HKTA 2FNPA 3C7JA 3GW2A 1K7AA 3E6BA 5BS6A 4U0VA 3MQ0A 3R4KA 4HLXA 4L5IA 3FM3A 1LVAA 1U5TC 2W57A 3K2ZA 2LF7A 4EJTA 3MCZA 2BV6A 5TJJA 5ERIA 3CUQA 2V1UA 2GA2A 1FP1D 4U7BA 3F8FA 1O57A 2P8TA 3KP7A 3P9IA 2ZNZA 5DUKA 3HTSB 2PFBA 4U0YA 4A12A 1BI3A 5K5QA 2E1CA 3FX3A 2IRFG 3QAHA 4ENMA 5ICGA 1HKQA 3QPTA 2WV0A 2LDUA 3I71A 4K2EA 5CLSA 3TKYA 1FX7A 3FWEA 1Z05A 1SD5A 4I0BA 1G3WA 1QZYA 3GFMA 2WTEA 2GWRA 5AIPA 3KETA 4PGHA 4HBLA 2FA5A 2P6SA 2QZ8A 3TDZC 2JZYA 3ML6A 2QQAA 3I58A 4XSXF 5ILSA 5FLXZ 1CGPA 2IVMA 4G6DA 2XKPA 4ZH4F
chains in the Genus database with same CATH superfamily
3U1KA 3H5RA 5LHHA 3OOPA 5L3EA 3V42A 1E2XA 3B73A 2W48A 1SANA 5CVJA 3ZPLA 5LGUA 2R5ZB 3HB9A 1REPC 4YIRX 5KAIC 2H27A 1QVTA 2AS5F 2DA2A 4R1HA 3ZMUA 4ZDLA 4A0XA 1X4OA 4OINF 4A69C 2V79A 1NK3P 5LD2C 5M5WJ 1O3SA 1ACIA 1UG0A 4UUSB 1KONA 2MLKA 5HS9A 4BDYA 1WSUA 5J3LA 1CF7B 4MQ9F 4OAZA 2QEXI 2VB6A 2FQ3A 4O3MA 3C1DA 5FFXA 2IP2A 4XICA 4XLFA 4ENKA 3HXLA 1Z77A 3S16J 1SD7A 1J0RA 2KL4A 4FISA 2MABA 4IRGA 1KQ9A 5IP6A 1TQIA 2K86A 1Y39A 1EKEA 1X1CA 2LD5A 4MIMA 2K9LA 3ZQFA 1MSEC 3IWFA 4WXHA 2R5YB 3ZMZA 3LSRA 1ZRFA 3OL3A 4HF0A 1V5FA 4IF4A 5EEAA 4UUVA 2KHMA 1OJLA 1BI2A 1TW2A 1PUEE 4I0AA 4W1UA 5J1YA 5ILVA 4Q48A 4LLNA 5IT9K 3BJAA 4L5EA 3HYIA 2YR2A 1FOWA 4M71A 2XAJA 4LIVA 2RNGA 5D5UB 1LVKA 3OYLA 1ZGJA 3FF5A 2XHKA 4B47A 1WJBA 1AU7A 5L3DA 2W82A 2V1DA 4BKXA 5JLWA 1AKHB 1JE8A 2CJJA 2E5NA 4F52A 5BQTA 3V7SA 1LFBA 4HF2A 4HRIA 1WJEA 2DA5A 5H6QA 3CCYA 4PCQA 4HV5A 1BC8C 1OCOH 2AHQA 1T38A 9ANTA 2ZMEA 5F64A 3M9AA 4BQOA 2H09A 4YEJA 2ZJQF 3H36A 5FB2A 5IP7J 5E79C 3JR9A 2DQRA 2BY1A 4ZZLA 2HPMA 6PAXA 4ESBA 4OIRF 3E6DA 2LOOA 1EH6A 3O2PE 3WU0A 4I99C 3B6CA 3LWFA 3SJMA 1FTTA 3CJQB 4MFEA 3DWLE 2Y48A 2BVLA 1NH3A 1T98A 4MNUA 4E4HA 4HV6A 5F04A 1YLFA 5D4SA 4BQQA 2L2OA 3LAJA 1JTXA 2B0LA 2WC2A 5EG0A 5DYMA 2M2EA 1XB4A 4XKWA 4L0YB 5K1YA 2DA6A 1YTYA 2R7RA 3CC7I 3I5UA 1FBUA 1GV5A 3OYKA 4KNYA 2A69F 4HNVA 4HF1A 2STWA 5DV5A 2BW3B 4NUBA 1WH7A 4GCVA 1YIOA 4KFCA 3E6MA 3DF8A 5JI6A 3SEZA 2XC7A 1O3QA 1J5YA 2MFZA 1XTAA 1S6LA 2WBMA 2X1EA 2L01A 2M8GX 4MO7A 1IV6A 2Z9OA 2M5WA 3OIOA 3ZMDA 1JGSA 4BDZA 2Z99A 3RZOJ 3QPLA 1BM9A 3K7AJ 4GO1A 2E36A 3VSKA 5B66C 4BEHA 5E3NA 1SC7A 3AG3H 3GF2A 3KYCB 4Z6YA 1U9NA 1R5HA 4HQEA 1V5EA 3WE2A 2OCEA 3SDBA 4BY7J 3K70C 2EFQA 2VC1A 1FOXA 1DPRA 2DK8A 2HWVA 2YX4A 1U3EM 4OAYA 4I2OA 2JPCA 5DCFA 3FBIB 2K4BA 4MQVA 2VBZA 3CF5F 3BT9A 2K02A 1IG7A 3OYNA 4WXCA 2Z3YA 5CVRA 4MHGA 4IEJA 1Q1HA 1ZH5A 4AVZA 4C9YA 4KDPA 3RKXA 1D1BA 1Y1VJ 3KP4A 4EM2A 3BR0A 4LJZF 3TO7A 1Z1DA 4ABZA 3IH4A 3I64A 5D5VB 1A35A 5HDKA 3AFHA 2H1KA 2K40A 2ZBKA 1DP7P 4PSWA 1FMVA 2R7UA 4KUMA 2KJCA 5FRMA 2VXZA 3WTZA 3TW6A 5GAEJ 1LFPA 1ZAOA 3F8NA 5FO5A 2DLLA 1ERDA 1J75A 3FHZA 2LR8A 2HQAA 3WTSC 2BXYA 3BZCA 1AWCA 3AG2H 3FM5A 4B4CA 2FOKA 3PUFA 1ZR2A 1FJLA 3CCEI 2CUEA 3KE2A 2LMDA 1VQNI 1BA5A 3EUHC 2VKDA 1ENHA 1R00A 4EV0A 2E1OA 1PYVA 2DN0A 4ENJA 2Z2SB 4IHTA 2OZ6A 4FX4A 3OR1C 4YFKF 3WU1B 2W85A 1UFMA 2VBXA 1YIJI 1ZLJA 1HSTA 2F5CA 3HRSA 1V55H 2NYXA 4GGGA 2L9SA 2OPTA 3NRVA 1WCMJ 1VQMI 3H9JA 2E2HJ 2Y69H 2CGPA 1VQ6I 4EJWA 5KHDA 2JVGA 2LY1A 3FIWA 4I01A 3MAJA 4NQWB 4AM3A 2Z16A 2WADA 3KEYA 3ELKA 2XF7A 3RJPA 3RZDJ 1D8KA 1MNDA 3PJRA 4LOCA 3WTTC 2VE9A 1JJ8C 2JPBA 2DAOA 2FRHA 1NK2P 2F5DA 3CMAI 2DT5A 3ZN0A 3TDUC 2EA4A 1STZA 3FXOA 3H3UA 1BR4A 5ICCA 5D6EA 5IYDJ 3UKGA 1RUOA 1ZRDA 4HX8A 2DMQA 5CQEA 4L0ZB 4DYRA 3G1LA 4EGYA 4PJJA 3V4GA 1IRFA 5D5XB 1DDNA 2YU9J 2OBPA 4ZYAA 3FKIJ 5M3MJ 2O3FA 2EZHA 4D5FA 3TO9A 1LDKB 1D5VA 4JOMA 1VQ7I 4IJAA 2X0LA 5HNHA 5HLGA 1A6IA 1YW9A 4RAGA 3VB2A 5BNGA 5J40A 4ZZDA 1TW3A 4GDFA 1W7PA 2CW7A 1FSEA 2YUSA 3F72A 3CO6C 1SFXA 3ZOBA 3BTCA 1JHFA 5BPIA 1JUSA 2LSOA 2HYGD 4F55A 3RYRA 2UZKA 1D3YA 3ZCOA 3WTXC 3QU6A 4M6VA 1LEBA 2X85A 3L2QA 2IGMA 1T0FA 1WH5A 3H5NA 4D5CA 3OYEA 3JREA 3AL0C 2JTVA 3HRUA 4KJZA 3ROUA 3JRAA 2M34A 3I56I 2IA0A 4XLHA 3D5LA 3BWGA 2ZNYA 4N4OB 4Y33A 3OYGA 2VXDA 1OCPA 1IUYA 5IYBJ 1AHDP 2P0WA 3P7NA 5IOZA 1R1TA 2TCTA 2TDXA 3OS1A 1O3TA 3HM5A 1U6GA 2ZO4A 2XGCA 3E5QA 2PJRB 2CRGA 1IZ1A 3ABUA 1RC9A 5B5EC 3AAFA 3IHUA 2ICWG 2L7ZA 2WAQN 3I4PA 1RIOH 1YW7A 5K5OA 4CICA 4CYCA 3LSGA 1WJDA 3JTHA 4RGRA 1JHHA 3ZQ7A 2JK3A 4RB3C 3IKVA 1GXQA 3F8BA 3L09A 3LA2A 2NNNA 2W24A 3CCVI 3LFKA 2ADUA 3G1MA 2L3DA 4CCOA 3LSJA 5DD4A 4G9YA 3K4CA 3S3MA 4L18B 2K9SA 1T56A 2L9RA 2KISA 1V4RA 1X1DA 1RI7A 4S05A 1W0UA 2ZKZA 2A68F 1MIJA 3ERMA 1TWCJ 3V7CA 2G7UA 3TO6A 1LFUP 3CP2A 3CESA 2V9KA 4G7HF 2COMA 1R23A 2ME6A 4CCMA 1SEUA 1YJWI 2RGVA 3HDDA 3OYHA 1ZN2A 1SVMA 1VQPI 2EPFA 2PG4A 2ZXIA 3KFWX 4ZYGA 4M74A 2VOPA 3GTGJ 1JJ6C 1IDYA 3ONQA 4A93J 2W00A 3BR5A 1TZLA 1YFHA 2LP0A 1ZK8A 3PQJA 3HOUJ 3GTOJ 3N97A 2BHYA 2XUBA 2EBIA 3KP6A 5IYCJ 4P9UA 3JW4A 3S3NA 1FOKA 3ASOH 2M0CA 1LJ9A 3MKZA 3RTRA 2Q2EA 1J7KA 1RRJA 2EZKA 4XN3A 3M8JA 5JVGF 2K5CA 2HTJA 2R7WA 4ZTFA 2DPDA 1BBYA 5ICFA 1USTA 4NC6A 1VQLI 5KNLA 2DU9A 5JVTA 2K85A 2D2WA 5D6FA 3ZN1A 1TTYA 3HPGA 4EEFG 4HQMA 4E6KG 4A3JJ 5FGMA 2L9VA 3BG3A 5IY5H 1YI2I 2R7SA 3FXJA 1EA3A 1X3ZB 1K61A 2CQ7A 1TWHJ 4TV7A 1VQKI 1H9TA 4UB6C 3W2AA 2HVQA 1FMWA 1X1BA 2CUZA 5GPCA 3QPHA 1D1AA 2VN2A 2YSRA 3T8TA 3BG5A 4IL6C 3S2DJ 1J59A 3IH2A 5H6RA 3HG9A 1QHGA 3F9KA 3TW7A 4YIFA 4NDLA 5FD6A 3WTYC 2G7HA 3LA7A 2Q1ZB 4PGGA 4CCJA 3BPVA 1O7LA 3F8CA 4E7ZA 2FU4A 2E1NA 1MDMA 5TGTA 1YJ9I 2IBDA 3KX2A 1NG6A 4ITVA 2KLOA 4XLEA 3SHFA 4U88A 1HA8A 2Z5UA 4UNOA 2FQ4A 3CCMI 1GVDA 2ELJA 5F08A 1FBSA 2R7QA 2RNJA 4Y3OA 3Q5FA 4NC8A 3HIFA 1K6YA 3IKTA 3MWMA 2R7VA 3CJTB 3CF2A 2G0EA 1NHAA 2M30A 5HLHA 2VKHA 5HLIA 1O3RA 2X1DA 2IS6A 1HLVA 4ZDOA 3LSPA 1EJ9A 2F6CA 3M4OJ 2Y9YA 4PUSA 1WJAA 4PZJA 4XOTA 3LQRA 1TL8A 2A6TA 2LVSA 2B7EA 1Z7UA 1FBQA 2DODA 2KDZA 3RIRA 2KFDA 2ETHA 3DPUA 3BZKA 3IP4B 1P92A 2G9WA 1MBKA 3QQAA 2EK5A 3E5UA 3TL4X 2VONA 1YOVB 2Q8KA 2HOTA 2A6HF 4AWXB 1LDDA 2R5YA 2ECBA 3BCAA 3BR1A 1VTNC 3LSKA 5B1BH 2PJPA 1IN6A 2XAHA 3HBLA 3ZMSA 4RLFA 4LGWA 4XIDA 3K10A 4IZZA 2I8DA 2O8XA 1GXPA 2FEZA 3PSIA 1OKRA 4HG2A 1ZTRA 2HFHA 5J6XA 2QENA 2RC4A 3K4BA 3J80K 1F43A 1MMGA 3S3OA 3WTUC 2W84A 1LKXA 1RR8C 1CF7A 2ESHA 4Y13A 2C6YA 3BG7A 5J4YA 4I76A 2CUFA 3AG4H 4CSWA 4IOAF 1IN4A 2OQGA 4FASD 1PJRA 3J7AO 2HOEA 3H9GA 3V7RA 4QWQA 2HYJA 1YRNB 5KVRA 1I1GA 3BOQA 3K4LA 4C2UA 1DGWY 1E3OC 4C3IJ 5DDGA 3RPUA 1OR7A 1K6OA 4RM2A 1WRJA 1POGA 3D5RC 2ZB9A 2CQNA 3KCCA 4KICA 5KCMA 1NTCA 2J5PA 2VQCA 5JFRA 3A2KA 2DJNA 3SZPA 4J01A 1RESA 3I4MJ 4JX6A 3SZGA 1OCZH 4U87A 2M7BA 2LTPA 4P1WA 3GTMJ 1ETWA 1WFXA 5KK1A 4KMFA 4L9JA 4N4NB 3QODA 2ID6A 4M9ZA 1LNWA 1B72A 4D7NA 2KJBA 2M9HA 4YELA 2F5VA 5DCMA 3TBIA 2ESNA 3JAMK 5BOXA 1YRNA 5HVQC 3H9QA 3HZJA 1WJ5A 5FD5A 1O7FA 5EGOA 2DMNA 1VZ0A 3HSRA 3JSOA 3G6EI 1ETQA 3F21A 4B48A 5AIQA 2XV4S 2CV0A 1UHMA 5LEKA 4E70A 5D4RA 3B02A 1MMDA 4LLLA 5DM6F 3TOBA 3E0JB 4NQWA 5EYRA 2I10A 3DBLB 5DD8A 5FKNA 4BJ6C 3HOWJ 3KEOA 3SQNA 1GHCA 3LSTA 1DUXC 4XKCA 2ELHA 4A6DA 3ULQB 2GZWA 4L9NA 3K1MA 2HKOA 3HSFA 3W6VA 1FP2A 2BXZA 3OMYA 1QO0D 1K79A 1R1VA 3EPZA 3BR6A 3PQKA 4F93B 3ZMVA 1D0ZA 2H6CA 2NS0A 3QYBA 2XSDC 3BP8A 4LMYA 1D1CA 3S8PA 1SFUA 1YJNI 1G2HA 4KT6A 2VQLA 4IHSA 2Y30A 1MMNA 4JQFA 3H92A 3IRQA 3L7WA 2XPUA 1KGSA 1JT0A 3NWSA 1SMYF 1S7AA 3A02A 2QUFA 3R61A 3AG1H 2HVSA 5LLQA 1PDNC 3DEUA 4G7ZF 4IXAA 5L3CA 2A5WA 5F1JA 1W36D 1B9MA 2NVQJ 2GIZA 4DYCA 4R79A 2ZJPF 3D1NI 4BXUA 1AOYA 1FIPA 2HQ5A 2PMZN 3DBHB 2KQRA 4I02A 2KP6A 2GXAA 1YQAA 1XGNA 2E5ZA 1IXCA 2Y75A 2VJ5A 4B43A 3TQNA 1JUMA 1LQ1A 1G59A 3NAUA 4KT5C 3PO3J 3S14J 3GTQJ 2M8EA 1YS6A 3CCRI 3DEEA 4J19A 2HGCA 4GFBA 2IS2A 1U5TB 1ZARA 5GTIC 3KYLA 4BU2A 1TBXA 3MKWB 1DGRM 4HDUA 5BPDA 5L3GA 1PP7U 3QYEA 2XIGA 1HCRA 1VNDA 3DU6A 2HEOA 3GBGA 5K7HA 3WTVC 2X48A 3CP8A 4F92B 3E3VA 2KIQA 4BHPA 2JT1A 4S04A 1XSXA 3HHHA 3HOXJ 4IKFA 2VIXA 1IAWA 1HBXG 3IL2A 2VC0A 2QYOA 3WE3A 2VJIA 1WI9A 2P5LC 2WB1A 3OYDA 2XGDA 2X6WA 1MSFC 4P96A 3OR2C 4RGUA 4XBFA 3BTIA 1Z67A 5BMZA 3IV5A 1H88C 2CW8A 4RMNA 2CWEA 1GT0C 4HNTA 2IW5A 1RETA 1DPUA 3RCOA 3H0DA 4C2MJ 2HOAA 3L2CA 2UUZA 5E8IA 1G6NA 5LHIA 1W36C 4V2GA 2B9SA 2FNAA 2OQRA 4RA2A 5FLVA 1YO5C 2STTA 3OIQA 2QKMB 1LE8B 2BW3A 1MNMC 4E7IA 2R7DA 2LRDA 4AVPA 4BS9A 2IGNA 3FHNA 3L2RA 2BHZA 4MEXF 3UNGC 2VL8A 4C3JJ 5ILUA 5HOOA 5EZHA 1QU3A 1UJ8A 2F5EA 1P4AA 1L3LA 1F5TA 2DDAA 3LQQA 2Y31A 3LAPA 1X2MA 2OD5A 3BROA 3NQOA 3E97A 3GFIA 1ETOA 1FYKA 4YRVA 4AIDA 3H1CA 4DNCA 2E7XA 5CVUA 2Z33A 4A3CJ 3ABKH 4WCGA 2L5QA 4ZYHA 4X0GA 1BJAA 2HDCA 1W7PD 4DBRA 4FCYA 2XRLA 1XD7A 5LBQA 1YYVA 2KIMA 1R7JA 3PIOF 4RM3A 2RQQA 4I98B 3BY6A 3LSIA 2DA3A 4OIOF 1I39A 2R4GA 3W6JB 4PJMA 4FE7A 4LK0F 4C30A 1SD4A 2ZXHA 3D5SC 3HHGA 2F4MB 3QOEA 1YS7A 3BLYA 4E7JA 1U5TA 1Z91A 2A5YB 3CC4I 3H3VK 5JLXA 4UUTA 1K78A 3M3YJ 1JT6A 2CMPA 2EINH 3TGNA 4HA8A 3RPUD 4ZJZA 1A5JA 1F4KA 2GLOA 2P81A 2PBIA 1QRYA 3JTGA 2O61A 1XX5A 3L1PA 3N4MA 1U8BA 1ZREA 4M3EA 2VOOA 2OJED 1OYIA 1IC8A 2F2EA 1MMAA 3LSHA 2R7TA 1QPIA 3BPXA 1XS9A 2NXNB 4Q4ZF 1YITI 3OWTA 2GA1A 3MZ8A 4IX7A 2WY8Q 4JK1X 3K0LA 4YFXF 3ZXSA 3J81Z 2IGKA 2XROA 2VODA 3OYFA 2OC6A 3IAM2 4LB5A 1QQIA 2XGXA 1KQ0A 2Y2ZA 2EZLA 2EQRA 4IQJA 4BHCA 4MLOA 1RNLA 4ESFA 2FF4A 3SDGA 2NVTJ 2DA4A 4CGZA 2LYCA 1P2FA 4L9TA 5GP9A 2E35A 4UUSA 1MNEA 1I6XA 1BN5A 1EH8A 1N25A 2DOEA 1BOBA 2VBWA 2HZTA 3OYIA 2HPIA 3DKXA 4N9IA 4CXFA 2DBBA 5FFZA 2E2JJ 3DU5A 5M5YJ 1R6RA 3JRDA 3F0CA 2X6YA 1VF9A 2Q0OA 1G4DA 3RSNA 2IPQX 2JA2A 1XG1A 3A0BC 1ZQ3P 3RQ4A 3MZHA 2EH3A 4RAYA 3T5XA 4XOPA 4LB6B 4U7DA 3H3ZA 1R22A 3SFZA 5CPRB 4ZC3A 2DXIA 1UCRA 2DFEA 1R58A 4HYEA 5C4JJ 1KZHA 5IPAA 2RDPA 5KAFC 1BOAA 5E18F 4Y4RA 4BYYA 2XAUA 4II2A 2V9VA 1MBGA 3N05A 2XF6A 4UVBA 1ZELA 2RKHA 5LGTA 1EV7A 4J00A 3GZNB 4B3XA 3P5JA 1QBJA 2HZDA 4OMZA 4FX0A 1P7JA 3RDIA 4BQNA 2F48A 4A5NA 5DCMB 2W4SA 2OU2A 3WGGA 1B72B 3FK6A 1OYYA 3M07A 4HSTA 3Q0UA 1A36A 1JUPA 2QLZA 3SZTA 3Q3SA 5HS7A 1T39A 1KU9A 3E5XA 3CJNA 1UMQA 1MZBA 1ON2A 2JMWA 1A04A 2WAQA 2J5OA 2KZVA 4EJUA 4XRFA 2MGQA 1L0OC 3CLQA 3GMEA 3M8FA 1IN7A 1YG2A 2VBYA 3I53A 4OMYA 4KA4A 1M1EB 1BJZA 3BTLA 4BAYA 2H8WA 5GAGJ 2QSHX 5FLMJ 1V3FA 1U9OA 2LBFA 2B63J 5H2FC 1G3TA 4XRSG 1S3JA 2V4JC 4PFPA 1FTZA 4KIFA 1MH3A 3A1YA 4HSRA 4Y17A 3CDIA 3KP5A 4LFUA 2R7FA 4XN0A 5DM7F 3EUHA 3O8HA 3GYHX 2O6GE 3HSEA 1MBEA 4GYGA 3BR2A 3ISPA 1X1AA 1BW5A 1Y0NA 2NAZA 4L9VA 4XM3A 4AUXA 1PUFA 1V5GA 3FMQA 4EJOA 1K4SA 1H0MA 1HDDC 5LEJA 3FDYA 3FZVA 4MTDA 4XQFA 2JQ7A 2E71A 3CD6I 4XSZF 2ZXJA 3PNTA 4NBQA 3S2WA 2CQXA 3K9TA 4CO8A 4EGZA 2CQQA 2K7LA 3MZYA 3I59A 2O9LA 1MKMA 3ZQLA 3FKJA 2CV1A 2LKXA 1OLTA 2OA4A 3H5AA 2O5RA 5HODA 3PSFA 4M9XA 2MG4A 5HDGA 3RI4A 3A01B 2DW4A 2K3FA 2V9PA 4RB1A 4ETSA 4A3KJ 2XKOA 3MKYB 4E7KA 1HC8A 5E3LA 2JSCA 3TEDA 2A3SA 1SVLA 3M1CA 4JP0A 1S5LC 1ZR4A 4BEHB 3H35A 2OCCH 5A2QK 3HRMA 2OF7A 4XORA 4A3DJ 3HGGA 4EATA 3ABLH 3FXQA 2PEXA 3I9V2 4QIWN 2QSFX 2DA7A 1G8XA 3CUQC 2V1NA 5F6FA 2ZXWH 2NVXJ 1FSHA 2XGEA 1RPWA 3FXUA 2LY9A 1JI8A 4P5OA 2HI3A 4RGXA 4UV8A 5K5RA 1LE8A 4XL9A 4AIKA 2QQ9A 3IH3A 1OMIA 1R5ID 1WI3A 2BE5F 2DMUA 3NARA 2X1CA 1S72I 1XC5A 3OS0A 3RKYA 3CC2I 1J2XA 3QP6A 2JUCA 4XLPF 4O6JA 1SVOA 4RS8A 2OV7A 1OCTC 5FKLA 1E0EA 2GOMA 1XSVA 2A61A 4B44A 1R4NB 3E1SA 2NS8A 2ACJA 1XCVA 4XNFA 4HNUA 3HOTA 4UVAA 2E7WA 4LK1F 2VT2A 3EUKL 4DOZA 3CLOA 2QM3A 3KZYA 2KRHA 4V2FA 4A5MA 3ZQQA 5LRRA 2ZMEB 1S29A 3ECOA 4XKVA 4QSHA 3EYIA 3QWLA 1BIBA 4GRIA 4XLCA 1PVEA 4N9HA 2HDDA 2V6CA 4JBAA 1E17A 4HX7A 2A05A 2O0YA 3M7GA 3K6GA 1FLIA 2F4OB 1W0TA 4CCKA 3G4SI 1P9QC 2LC2A 1P7IA 3R60A 3VYUB 1QZZA 1B1BA 3W2WA 4KISA 1B59A 1FWZA 1LDJA 4ZDPA 3C2HA 5D8LB 5FLXK 5FROA 1D0XA 2DT7B 3GVAA 3DBRB 4UHTA 3S93A 1Z3XA 3I59B 4MEYF 3HTUA 2XPVA 2DPUA 3G1OA 3FMRA 3DKYA 1I27A 4CZCA 2EIKH 5LRSA 1Z0XA 3DKWA 1BI1A 4L5JA 1FC3A 2L7FP 3DP7A 2R7XA 1I3AA 2X6XA 1LB2A 2HTSA 3CCQI 2MA3A 3IUOA 2VPRA 3KZZA 1P4WA 2ZFUA 5DTDA 4IRHA 3S17J 3LNQA 2VQHA 1Y56A 1TC3C 2EIJH 4IRIA 2DTRA 2FMLA 1J09A 3A4CA 3DQVC 1UHWA 2K27A 3O6BB 3HOVJ 2XF5A 2CFXA 2IA2A 2OTJI 2L4MA 4BBRJ 1EF4A 3SXYA 4HOBA 2QKLB 2DQLA 2LBFB 2GIVA 4NC7A 3MMYB 4OIQF 2L7MP 2LREA 2MSYA 4BACA 4FE4A 1SFEA 1TWAJ 1TLHB 4F7ZA 3RYPA 2KMUA 4CYDA 3S15J 4XRMA 1Y8QB 1W7PB 2VKEA 2KT0A 1GDTA 3CMEI 1BR1A 3BJOA 1NG7A 2NS7A 3PUBA 2VASA 1APLC 2KKOA 2PJRA 1B4AA 2JA5J 5A2QZ 4F3QA 3GTJJ 2PLYA 1F9NA 2XAFA 2EA2A 1ON1A 2VT3A 1CQTA 5J8FA 3F22A 3COAC 3MEXA 2MH2A 4HLYA 1XDSA 3F8MA 1SFOJ 4FHTA 2EV0A 2PN6A 1XMXA 5HNFA 4C3HJ 1B8IB 2RREA 2KIUA 1JGGA 2IXSA 3GFJA 3HOZJ 3VWBA 4IHYA 1ETXA 1KYWA 3T0YA 2RN7A 5ICEA 1J9IA 1O4XA 3QRFF 1LEAA 4CHUA 5IT3A 1IRXA 4KN7X 2IAIA 4BE1A 3G2BA 3REOA 1X4PA 4KMUX 4QPOA 4F91B 2OUMA 3QU3A 4BHBA 2CFOA 5J1RA 4PJNA 2DDBA 2DFFA 2P7VB 2VJJA 3F6VA 5FKMA 3VFZA 1FIAA 1IGNA 2DO7A 2DOFA 4ASNA 4HPQA 2DA1A 2M0MA 4RB2C 4W97A 2DI3A 3ABMH 4X6AJ 3OS2A 2CQKA 2QF7A 2F5FA 4MGRA 4BBSJ 2EFPA 2M4GA 3R0AA 2VJ4A 3G3ZA 3LMMA 4UV9A 4AYBA 1XGMA 3CO7C 2EJRA 5J4VA 4UXNA 3OYMA 1DU0A 2WWYA 2EB7A 3EYYA 1K4TA 2QWWA 2NRAC 3O8GA 2BBYA 3HKZN 4B09A 2FE3A 5CYVA 1TNTA 1I5ZA 2R3SA 2VPLA 4UB8C 2X51A 4G6TB 1RR7A 1YE9A 1UAAA 5D8KB 5LHGA 1ZGWA 3SFIA 2P7CB 4UY8I 3V8JA 1KQ8A 3CDHA 1WWXA 3QYFA 4YFNF 3X2QH 5D5WB 1ITYA 2K3PA 3WU2C 2ZJ2A 1TT0A 1B6AA 5J1UA 3GLLA 2JA8J 3ZQCA 4G8XA 3JRBA 3OSGA 1R4MB 5TISC 3TOAA 5EEGA 2WAEA 5CJ9A 1KU2A 1WJFA 3KZIC 4XONA 1K78B 4IO9F 2F4IA 3HKZA 4OWRB 1S9HA 1DP3A 1EH7A 4DZJA 4H0EA 2LY2A 2GQQA 1U78A 2FD5A 1TWGJ 1WVRA 4ZYEA 1MJ9A 1B9NA 2HYFA 2VI6A 3ERED 2CUJA 4EM0B 1OCRH 3WGIA 2E60A 3L2VA 2FBKA 3DPLC 1X58A 4RDUA 4XLNF 2PMUA 4RAZA 1QPMA 1ETYA 4JYKA 1MMSA 2NNYA 4I7HA 2XVCA 2AQFA 2ZCWA 1QVUA 2HQNA 1DU6A 3MD2A 1IXRC 2IT0A 1MJAA 3WGHA 1R49A 5DEQA 2K4JA 3G71I 5IT9Z 1TQPA 2HU9A 3EETA 5E1XA 1OQYA 3VEPA 3F6OA 3HOSA 4LG0A 2AXLA 1FZPB 2NOGA 4BQAA 1ZLKA 3ZQGA 2PMZA 3F3XA 3DEWA 2XASA 2QGUA 4XR6A 3CCJI 1ODDA 2I5UA 3MKLA 1D5YA 4RB0A 3E6CC 3GTLJ 4G7OF 1FY7A 4A0ZA 3QPSA 1IW7F 4ON0A 5B3SH 3HPHA 4XKBA 3EUAA 3OYBA 1MGTA 3I0TA 3HJEA 3KYDB 5EF6A 1BR2A 4EM1A 2BY2A 3A0HC 1VI0A 1JKPC 4A3IJ 3LOCA 1ZG3A 1W5TA 4BL0B 5L3FA 2FBHA 4Y7NJ 2LG4A 3GUDA 4A3EJ 2A07F 5K7FA 4FETA 2L4AA 2QCOA 1SAUA 4FTHA 5CVIA 1I3QJ 4OIPF 2IA1A 2EILH 2YPRA 2M7AA 3BC8A 5EG0B 2GBYA 2V6EA 4N0BA 2WY7Q 2WAFA 3QOPA 2IGOA 2UWMA 4IHXA 2ZMEC 3BTJA 1D8JA 1XPXA 1MW7A 3GTKJ 3RQIA 1IV8A 1HW1A 2DYRH 1QZEA 2MBFA 3KP3A 3T8RA 3L2WA 2QSGX 4BNCA 4IQ4A 3K4NA 5FKKA 1Z21A 5GAHJ 5F1RA 4V19K 1X19A 4M3FA 3W2VA 2FJ1A 3J7YJ 4QPQA 2DTZA 4NNJA 3KLNA 3JRHA 3DTKA 4B1RA 5HLTA 2LF8A 1VQ4I 1H8AC 2Y0SN 2N8GA 1Y8RB 4PDKA 5F27A 3CTAA 2O8KA 3BR3A 4BGDA 1B8IA 3IRRA 2R7ZJ 2PX9A 4AYBN 2UXNA 1G3SA 3TP3A 3IWZA 2E1MC 1IRZA 4IPAA 5FJ8J 2LNBA 3WODF 3S1NJ 2RAEA 1TQMA 1T0FC 1UG2A 4XK4A 3W6KB 2CYYA 2AQEA 4D1QA 1FNNA 2O7OA 4PJ0C 4LIUA 3BQYA 4EMSA 2HNHA 2W25A 4E7LA 1I50J 1MD0A 3FXLA 5E8GA 4HDVA 1T8IA 3I4NJ 4LD5A 2BEOA 3ZQHA 2O03A 1IRGA 1FOYA 3PL8A 2H1LA 2ZSIB 3PNVA 2M3AA 1BC7C 1Y6IA 1ETVA 4M9SA 1JKQC 1GV2A 4M72A 3SYTA 1E3HA 3WG7H 2BY0A 2MH9A 3OY9A 1FYLA 3JRFA 2XB5A 1A6QA 1HW2A 2ZC2A 1KU7A 4A3GJ 3U2RA 4B8XA 1VQOI 1AA7A 4NHJA 5GPAA 3OV8A 1C0WA 5E3OA 2M87A 2XRNA 3LFUA 5FKOA 3U1DA 1I1SA 1T08B 1HDPA 1ULYA 4ANJA 4WWCA 3DLLF 2XSJC 2QQBA 4BUPA 4M3GA 1Y0UA 5TRDA 3L00A 2JA7J 1GVJA 4RGSA 3F23A 3FXKA 4BJTA 2R5ZA 2GAUA 2MC3A 1KA8A 1V54H 2EV5A 2ZSHB 1FEXA 3L9FA 1U0JA 3GZ6A 4Z2YA 4DIQA 1OFCX 4BXFA 4HAMA 2V1XA 4IVNA 3HEFA 5J8CA 5M5XJ 1Z6TA 4A2UA 2LK2A 1D0YA 3GFLA 3J7AY 1WGXA 3Q9VA 4WF2A 2X4HA 3DFGA 4AC0A 3PFYA 4R8HA 3ABTA 2M45A 5B1AH 3OSFA 4EQQA 4JX4A 1IUFA 1P6RA 2M4KA 4P55A 4A3FJ 2CU7A 3BJ6A 2M1BA 1S7OA 2YS9A 2E2IJ 1P4XA 1TT5B 4WX9A 3LA3A 2OTLI 2LKSA 2OZUA 3LSMA 3R0JA 4ENNA 4PK4A 2EFWA 3WTWC 3CDLA 3ZMTA 4G94A 4WK8F 2P5KA 4E7SA 2D1HA 5IP9J 1YHQI 1RKTA 3NWTA 3U9GA 4AU7A 1ZG5A 2DFIA 2YU3A 5LFAA 3S1RJ 2EWNA 3K4JA 2UV1A 1XDUA 2A6EF 1H9GA 3KP2A 3CMYA 4ESJA 4LG0B 1YX5A 2QBYA 3KEQA 4KIBA 1GLNA 4O5VA 4AD9A 4M6XA 3BZ6A 3OOUA 4BH9A 5F0FA 3MFKA 5DS9A 4YG2F 1MJBA 1X3WB 2CO5A 4OU0A 2HS5A 4LLGF 3JSPA 3E7LA 3W3CA 2QA4I 2BOLA 2JWTA 3CUOA 5E1WA 4RLQA 4BY1J 3PNYA 3WG9A 3JCUC 1HXDA 3K4KA 5L3BA 2NVUB 1OPCA 5DUIA 5FRNA 3CUQB 2JN6A 1HQCA 1HW5A 2VUMJ 1SMTA 3P9CA 3A01A 1UELB 2HKXA 2ISZA 3M1EA 1ZRCA 3V8LA 1R1UA 1OCCH 2L54A 3JAMZ 1VQ9I 2HR3A 3BCBA 3L2UA 4IHWA 3K1PA 4XRSA 4M6YA 1MDMB 4G12A 1IN8A 2EV6A 2KRFA 4KITB 2COBA 1ETKA 1W4MA 1ONVA 2XAQA 2L02A 3GWZA 4CZZA 3CCUI 3KLOA 4KN4X 2FSWA 2KIFA 1HSJA 2WB1N 1UB9A 2CS3A 3K1NA 1BW6A 1H89C 2K9QA 3C3WA 3NEUA 3OL4A 4I6ZA 1XMAA 2DFHA 1W1WE 2PQ8A 1T33A 4CUGA 4ZYDA 3K2AA 2E1MB 3FISA 4CDGA 1N77A 5H20A 2QBYB 2JRTA 3DV8A 1MH4A 3VODA 4CCLA 3WHCA 4C2TA 1MBHA 2FXAA 3FMSA 4HW0A 1K83J 3GEZA 2XB0X 3T1BA 2VQGA 1N78A 4IHVA 1T2KA 4U0WA 2XPWA 3LL7A 1F1ZA 2X9DA 3KIOA 2JUGA 4I09A 4UVCA 1FYMA 4EVIA 3RKQA 1X1PA 3TP0A 2Q2EB 3AL0B 2ZFWA 1R5GA 2BYVE 2KDOA 2YX7A 2CW0F 4XMYA 1XSDA 2RV8A 2L7KA 5E20A 1QHHD 4BJ5C 2VE8A 2JSPA 2CSOA 5F0CA 1W5CC 4YIIA 3VSLA 4AIHA 4X1EA 3HL2A 1XMKA 2DOAA 5E1ZB 1XGSA 1VQ8I 2BZTA 1ZYRF 4GXOA 2LH9A 4FT8A 2FMYA 2EFOA 2RQPA 4Q5SF 1WHUA 3HC7A 3FBNB 4AIJA 3TMOA 2D1VA 3VOEA 2IJLA 2ISYA 1TP4A 1F36A 1X3UA 2OAZA 2XAGA 2E19A 1WKMA 2DT6A 2W1OA 4II3A 3U21A 3ZRGA 1U8RA 4LG3A 1IN5A 2MD0A 2P6TA 3J80Z 4E7HA 2KZGA 1QA6A 4Q47A 3Q0VA 2GXBA 3I55I 2D45A 3QP5A 1UHSA 2NVYJ 4IOCF 4DYQA 4QTRA 3PO2J 1E3PA 2EFNA 2V7FA 4G6QA 1PP8F 2GXGA 4CYCB 4CH7A 2FUG2 3DTEA 5JR3A 5J47A 2GOXB 3AKZA 1RUNA 4A6EA 3OYJA 2V26A 2R0QC 5C44J 2Z1DA 3B6AA 5EJCA 3JRCA 2MC4A 2BGCA 5HDNA 4WXDA 5C3EJ 3GZ5A 3RKWA 1VQ5I 3GTPJ 3HUGB 4KIGA 1ORKA 5EEHA 3CMMA 3VYRB 5JHFA 1A31A 3PFIA 4Y15A 3IAS2 4Y52J 1SD6A 1OR7C 3CZ6A 3UR3C 3J81K 2DK5A 3WHBA 2K9MA 2BY3A 1Z3YA 3S1MJ 2EZIA 1ZG1A 2DMTA 3C2BA 1RZ4A 4GYIA 4NB5A 2H94A 2K9NA 5IOYA 3S1QJ 3ECHA 1WZ2A 1BI0A 2E34A 1XN7A 3P9KA 4P9FA 4OOIA 3DCFA 1Z7LA 1ZKGA 2FBIA 4A0YA 3HUGA 2QQ8A 4QLCU 2QVOA 1SAXA 1JXSA 2HVRA 2LFBA 4CA0A 3OIPA 1TNSA 5M3FJ 3FXRA 3G73A 3EQLF 3C2GA 2RVCA 4B3AA 2ID3A 1Y1WJ 3VPRA 3ZP5A 1IJWC 4S0HB 3I54A 2BVMA 3K70D 3PM1A 3GX4X 2MD5A 3KPHA 3C18A 3GCMA 5LGNA 2DMPA 5CVVA 1XGOA 1GUUA 5JHUA 1QNTA 2Y9ZA 1QGPA 2LKPA 3RPQA 1R36A 1HOMA 1SFKA 5HS8A 2HOSA 5F0HA 3GXOA 5K7ZA 2HQRA 1USSA 1XCBA 2D5VA 2DCEA 3JRIA 1JKOC 1G3YA 3OYAA 3HGYA 3ZQIA 1W5SA 4EJVA 2MLGA 1ZGAA 4RAFA 4BE0A 3IC7A 3VDXA 4PJLA 2Y0MA 1IO2A 1S8NA 2P5VA 3S32A 1I6HJ 2R92J 4D0PA 3D0SA 2H6BA 2WV1A 2L0KA 1Q1VA 2CV2A 1BIAA 4DJAA 3PIPF 1FPQA 4A3BJ 2PMHA 4MTEA 3ESWB 3DPTA 3O3KA 1HKSA 2H8RA 2KRCA 3R6SA 2W7NA 3K69A 5ED4A 4CCNA 1R9TJ 5E3MA 1IXSB 1FT9A 1LUJB 1TWFJ 2R7OA 2AO9A 3V8KA 1WQ2A 4M3DA 3HOYJ 4BE2A 4PSXA 3EDPA 1X2NA 1ZHFA 2CG4A 3GO5A 2PI0A 1KYZA 4LITA 4HX4A 2P4WA 5AONA 3M8EA 4RBOA 3BG9A 2R93J 2JJ7A 3BDDA 5E17F 3Q9SA 4HZFA 5CQGA 1IDZA 1OYWA 1T95A 2MW8A 1KU3A 1UZCA 4HEA2 2JRMA 1U2WA 4M73A 3ZGKA 3OYCA 2FX0A 3K4MA 3FK7A 4A3LJ 2UXXA 4DQ2A 1VFCA 1HF0A 3DTIA 1Z9CA 4DBQA 1IF1A 2XDVA 1Z6RA 1YW8A 2HDWA 4KYWA 3HRTA 3GLXA 1JKRC 3DXJF 3JRGA 3H0GJ 1T6SA 4DZPA 1HKTA 2WA0A 5EZGA 5EDNA 2EIMH 2FNPA 3C7JA 1N75A 3GW2A 4A3MJ 3E6BA 1K7AA 2GM4A 2IS1A 3J7ZI 2ZJRF 5BS6A 4PFOA 1MBFA 2Y0SA 4U0VA 3MQ0A 3R4KA 4HLXA 4L5IA 2VLAA 3FM3A 1RKWA 1LVAA 1U5TC 1BL0A 3ZR8X 2W57A 3ASNH 2LF7A 3K2ZA 4EJTA 3MCZA 4H4KC 1YX3A 2IEKA 4DW6A 2BV6A 5GTHC 5TJJA 5ERIA 3CUQA 1R71A 2V1UA 2MYSA 2KPMA 2GA2A 4DGWB 1FP1D 2X6OA 4U7BA 2L9NA 1PUFB 2AXTC 3F8FA 2FOWA 2HXOA 3S2HJ 2VKVA 5CKTA 1O57A 4MFDA 1JTYA 2P8TA 3KP7A 3P9IA 3CCLI 3Q0WA 2ZNZA 3BQZA 5DUKA 5C4XJ 4M3BA 2DJIA 3HTSB 2PFBA 3MVPA 4U0YA 4A12A 1BI3A 5K5QA 1LPQA 2JA6J 2TRTA 2LLKA 3SEQA 3BG6A 3CJRB 5GADJ 2DYSH 2E1CA 4D7MA 3FX3A 2IRFG 3QAHA 4ENMA 5ICGA 1HKQA 3QPTA 2HXIA 2WV0A 3VYSB 2LDUA 1WJCA 3I71A 4K2EA 3VYTB 1DQUA 5CLSA 3TKYA 1WPKA 1FX7A 3FWEA 3CCSI 1Z05A 1SD5A 4I0BA 1G3WA 4BXXJ 1QZYA 3DLAA 3GFMA 1OISA 1S7EA 2WTEA 3I3LA 4D9JA 4ZTJA 2GWRA 5AIPA 2JVHA 4PGHA 3KETA 4HBLA 4JX5A 2FA5A 2P6SA 2QZ8A 5EGOB 3CQZJ 2ME0A 3TDZC 2JZYA 2IS4A 2NOJB 2ECCA 3FXMA 3ML6A 4FQGA 3MN2A 4XLAA 2QQAA 2ELKA 3A03A 3I58A 4XSXF 5ILSA 2IVMA 4G6DA 5FLXZ 1AKHA 1CGPA 2XKPA 4ZH4F 1MBJA 2CH0A
chains in the Genus database with same CATH topology
5LHHA 3OOPA 5L3EA 1E2XA 3B73A 5CVJA 3ZPLA 5LGUA 1REPC 2H27A 2AS5F 4R1HA 3ZMUA 4A0XA 4OINF 2V79A 1O3SA 2MLKA 5HS9A 1WSUA 1CF7B 4MQ9F 2FQ3A 4O3MA 3C1DA 5FFXA 2IP2A 4ENKA 1SD7A 1J0RA 4IRGA 1KQ9A 1TQIA 2K86A 3IWFA 4WXHA 3ZMZA 1ZRFA 4HF0A 4IF4A 4UUVA 1BI2A 1TW2A 1PUEE 4I0AA 5ILVA 4Q48A 4LLNA 5IT9K 3BJAA 3HYIA 2YR2A 4M71A 2XAJA 5D5UB 1ZGJA 3FF5A 2XHKA 5L3DA 2V1DA 1JE8A 5BQTA 3V7SA 4HF2A 5H6QA 4PCQA 4HV5A 1BC8C 1T38A 2ZMEA 5F64A 3M9AA 2H09A 5FB2A 2DQRA 4ZZLA 6PAXA 4ESBA 4OIRF 3E6DA 1EH6A 3O2PE 3WU0A 3LWFA 2Y48A 1T98A 4MNUA 4HV6A 5D4SA 1YLFA 3LAJA 2B0LA 2WC2A 5DYMA 1XB4A 4L0YB 5K1YA 1YTYA 3I5UA 1FBUA 4KNYA 2A69F 4HF1A 2STWA 5DV5A 4GCVA 1YIOA 4KFCA 3E6MA 3DF8A 5JI6A 1O3QA 1J5YA 1S6LA 2L01A 2Z9OA 2M5WA 3ZMDA 1JGSA 2Z99A 1BM9A 4GO1A 3GF2A 1R5HA 4HQEA 3WE2A 2EFQA 2VC1A 1DPRA 2DK8A 2HWVA 2YX4A 1U3EM 4I2OA 2JPCA 5DCFA 2K4BA 4MQVA 2VBZA 2K02A 4WXCA 2Z3YA 5CVRA 4MHGA 1Q1HA 1ZH5A 4KDPA 3RKXA 3KP4A 4EM2A 4LJZF 3TO7A 1Z1DA 3I64A 5D5VB 5HDKA 2ZBKA 1DP7P 4KUMA 2KJCA 2VXZA 3WTZA 3F8NA 1ZAOA 5FO5A 2DLLA 1J75A 3FHZA 3WTSC 1AWCA 3FM5A 2FOKA 3KE2A 1R00A 4EV0A 4ENJA 4IHTA 2OZ6A 4FX4A 4YFKF 3WU1B 2W85A 1UFMA 2VBXA 1ZLJA 1HSTA 2F5CA 3HRSA 2NYXA 4GGGA 3NRVA 2CGPA 4EJWA 4I01A 3MAJA 3ELKA 3RJPA 1D8KA 3WTTC 2VE9A 2JPBA 2DAOA 2FRHA 2F5DA 2DT5A 3ZN0A 3TDUC 2EA4A 1STZA 3H3UA 5ICCA 5D6EA 1RUOA 1ZRDA 4HX8A 4L0ZB 4EGYA 3V4GA 1IRFA 5D5XB 1DDNA 2OBPA 2O3FA 3TO9A 1LDKB 1D5VA 4IJAA 2X0LA 5HLGA 1YW9A 3VB2A 4ZZDA 1TW3A 1W7PA 1FSEA 3CO6C 3F72A 1SFXA 5BPIA 1JHFA 2LSOA 2HYGD 3RYRA 2UZKA 1D3YA 3WTXC 3QU6A 1LEBA 1T0FA 2JTVA 3HRUA 3ROUA 2IA0A 3D5LA 3BWGA 2ZNYA 1IUYA 3P7NA 1R1TA 2TDXA 1O3TA 2ZO4A 1U6GA 3E5QA 1IZ1A 3ABUA 3AAFA 3IHUA 3I4PA 1RIOH 1YW7A 5K5OA 4CICA 3JTHA 4RGRA 1JHHA 3ZQ7A 4RB3C 3IKVA 1GXQA 3F8BA 3L09A 3LA2A 2NNNA 2W24A 3LFKA 2ADUA 2L3DA 5DD4A 4G9YA 4L18B 1V4RA 1RI7A 4S05A 2ZKZA 2A68F 3V7CA 2G7UA 3TO6A 4G7HF 2COMA 1R23A 2RGVA 1ZN2A 2PG4A 3KFWX 4ZYGA 4M74A 2VOPA 1YFHA 3PQJA 3N97A 2XUBA 3KP6A 4P9UA 3JW4A 1FOKA 1LJ9A 3RTRA 2Q2EA 1J7KA 2HTJA 2DPDA 1BBYA 5ICFA 1USTA 2DU9A 5JVTA 2D2WA 5D6FA 3ZN1A 1TTYA 4HQMA 5FGMA 4TV7A 1H9TA 3QPHA 2YSRA 2VN2A 3T8TA 1J59A 5H6RA 4YIFA 5FD6A 3WTYC 2G7HA 3LA7A 4PGGA 3BPVA 1O7LA 3F8CA 2FU4A 2E1NA 1MDMA 3SHFA 4U88A 2Z5UA 4UNOA 1FBSA 2RNJA 3Q5FA 3HIFA 3IKTA 3MWMA 1NHAA 2M30A 5HLHA 5HLIA 1O3RA 4PZJA 3LQRA 1Z7UA 1FBQA 3RIRA 2ETHA 1P92A 2G9WA 2EK5A 3E5UA 2VONA 2Q8KA 2A6HF 4AWXB 1LDDA 1VTNC 2PJPA 1IN6A 2XAHA 3ZMSA 4LGWA 2O8XA 1GXPA 2FEZA 1OKRA 5J6XA 2HFHA 2QENA 2RC4A 3J80K 3WTUC 2W84A 1CF7A 2ESHA 4Y13A 2C6YA 1IN4A 2OQGA 3J7AO 2HOEA 3V7RA 4QWQA 5KVRA 1I1GA 3BOQA 5DDGA 3RPUA 1OR7A 1K6OA 1WRJA 3KCCA 4KICA 2J5PA 5JFRA 3SZPA 5KK1A 4KMFA 4L9JA 4M9ZA 1LNWA 2KJBA 5DCMA 2ESNA 3JAMK 5BOXA 5HVQC 5FD5A 1O7FA 3JSOA 3HSRA 3F21A 5AIQA 2XV4S 1UHMA 5LEKA 4E70A 5D4RA 3B02A 4LLLA 3TOBA 4NQWA 5DD8A 3KEOA 3SQNA 1GHCA 3LSTA 1DUXC 2ELHA 4A6DA 3ULQB 2GZWA 4L9NA 3K1MA 2HKOA 3HSFA 1FP2A 1QO0D 1K79A 1R1VA 3PQKA 3ZMVA 2H6CA 2NS0A 3BP8A 4LMYA 1SFUA 4IHSA 4JQFA 3H92A 3IRQA 3L7WA 1KGSA 1SMYF 1S7AA 2QUFA 3R61A 5LLQA 1PDNC 3DEUA 4G7ZF 4IXAA 5L3CA 1B9MA 4R79A 4BXUA 1AOYA 4I02A 1YQAA 1XGNA 1IXCA 2Y75A 3TQNA 1LQ1A 4KT5C 2M8EA 1YS6A 2HGCA 1U5TB 1ZARA 1TBXA 4HDUA 5BPDA 5L3GA 1PP7U 2XIGA 2HEOA 3WTVC 3E3VA 4BHPA 2JT1A 4S04A 1XSXA 3HHHA 1IAWA 1HBXG 3IL2A 2VC0A 2QYOA 3WE3A 1WI9A 2P5LC 4P96A 4RGUA 4XBFA 5BMZA 2CWEA 2IW5A 1DPUA 3L2CA 5E8IA 1G6NA 5LHIA 2FNAA 2OQRA 1YO5C 2STTA 2R7DA 4AVPA 4MEXF 5ILUA 5HOOA 2F5EA 1P4AA 1L3LA 1F5TA 3LQQA 3LAPA 2OD5A 3BROA 3NQOA 3E97A 3GFIA 1FYKA 4DNCA 2E7XA 5CVUA 2Z33A 4WCGA 4ZYHA 1BJAA 2HDCA 1W7PD 1XD7A 5LBQA 1YYVA 2KIMA 1R7JA 4I98B 3BY6A 4OIOF 3W6JB 4LK0F 1SD4A 3HHGA 1YS7A 1U5TA 1Z91A 2A5YB 1K78A 3TGNA 4HA8A 1F4KA 2PBIA 2O61A 3JTGA 3N4MA 1ZREA 2VOOA 1OYIA 2F2EA 3BPXA 4Q4ZF 2GA1A 4JK1X 3K0LA 4YFXF 3J81Z 2XROA 2VODA 4LB5A 1QQIA 2XGXA 1KQ0A 4BHCA 1RNLA 4ESFA 2FF4A 4CGZA 1P2FA 4L9TA 1I6XA 1BN5A 1EH8A 2VBWA 2HZTA 4N9IA 4CXFA 2DBBA 5FFZA 2Q0OA 1G4DA 2IPQX 3MZHA 4RAYA 3T5XA 4LB6B 4U7DA 3H3ZA 1R22A 3SFZA 1UCRA 1R58A 4HYEA 2RDPA 1BOAA 5E18F 4BYYA 2V9VA 5LGTA 4UVBA 2RKHA 1EV7A 1QBJA 4OMZA 4FX0A 3RDIA 4A5NA 5DCMB 2OU2A 3WGGA 1OYYA 2QLZA 3SZTA 5HS7A 1T39A 1KU9A 3E5XA 3CJNA 1MZBA 1ON2A 1A04A 2J5OA 4EJUA 4XRFA 1L0OC 3M8FA 1IN7A 1YG2A 2VBYA 3I53A 4OMYA 4KA4A 4BAYA 1V3FA 1G3TA 1S3JA 4KIFA 4Y17A 3KP5A 4LFUA 2R7FA 3EUHA 3GYHX 2O6GE 3HSEA 4GYGA 3ISPA 2NAZA 4L9VA 1H0MA 3FMQA 4EJOA 5LEJA 3FZVA 4MTDA 4XSZF 2ZXJA 3S2WA 4CO8A 3K9TA 4EGZA 2K7LA 3MZYA 3I59A 1MKMA 2OA4A 4M9XA 5HDGA 3RI4A 2DW4A 4RB1A 4ETSA 2XKOA 2JSCA 2A3SA 5A2QK 3HRMA 3FXQA 2PEXA 3CUQC 5F6FA 1FSHA 3FXUA 4P5OA 4RGXA 4UV8A 5K5RA 4AIKA 2QQ9A 1OMIA 2BE5F 3RKYA 1J2XA 3QP6A 4XLPF 4O6JA 4RS8A 1XSVA 2A61A 2ACJA 1XCVA 3HOTA 4UVAA 2E7WA 4LK1F 2VT2A 3CLOA 2QM3A 3KZYA 4A5MA 5LRRA 2ZMEB 1S29A 3ECOA 3EYIA 1BIBA 4N9HA 2V6CA 4JBAA 1E17A 4HX7A 2O0YA 3M7GA 1FLIA 3R60A 1QZZA 1B1BA 1B59A 1LDJA 1FWZA 5D8LB 5FLXK 3GVAA 4UHTA 3I59B 4MEYF 3HTUA 2DPUA 3FMRA 1I27A 5LRSA 3DKWA 1BI1A 4L5JA 1FC3A 3DP7A 1LB2A 2HTSA 2MA3A 3KZZA 1P4WA 4IRHA 4IRIA 2DTRA 2FMLA 3DQVC 1UHWA 2K27A 3O6BB 2CFXA 2IA2A 2L4MA 3SXYA 4HOBA 2DQLA 2GIVA 4OIQF 4F7ZA 1SFEA 1TLHB 3RYPA 4CYDA 1W7PB 3BJOA 2KKOA 1B4AA 5A2QZ 2PLYA 1F9NA 2XAFA 2EA2A 1ON1A 2VT3A 5J8FA 3F22A 3COAC 3MEXA 2MH2A 4HLYA 1XDSA 3F8MA 4FHTA 2EV0A 2PN6A 2KIUA 3GFJA 1KYWA 3T0YA 2RN7A 5ICEA 1J9IA 3QRFF 1LEAA 4CHUA 5IT3A 4KN7X 3REOA 4KMUX 3QU3A 4BHBA 2P7VB 3VFZA 3F6VA 2DO7A 4ASNA 4RB2C 2DI3A 2CQKA 2F5FA 4MGRA 2EFPA 3R0AA 3G3ZA 4UV9A 1XGMA 3CO7C 2EJRA 4UXNA 2WWYA 2EB7A 3EYYA 2QWWA 2NRAC 2BBYA 4B09A 2FE3A 5CYVA 1TNTA 1I5ZA 2R3SA 5D8KB 5LHGA 2P7CB 3V8JA 1KQ8A 3CDHA 1WWXA 4YFNF 5D5WB 2ZJ2A 1B6AA 4G8XA 3TOAA 5EEGA 5CJ9A 1KU2A 1K78B 1EH7A 4H0EA 2GQQA 1U78A 4ZYEA 1MJ9A 1B9NA 2HYFA 3ERED 4EM0B 3WGIA 2FBKA 3DPLC 4XLNF 2PMUA 4RAZA 1QPMA 2NNYA 4I7HA 2XVCA 2ZCWA 2HQNA 1IXRC 2IT0A 1MJAA 3WGHA 5DEQA 2K4JA 5IT9Z 1TQPA 3EETA 5E1XA 3VEPA 3F6OA 3HOSA 4LG0A 2AXLA 1FZPB 4BQAA 1ZLKA 3F3XA 2XASA 1ODDA 4RB0A 3E6CC 4G7OF 1FY7A 4A0ZA 1IW7F 4ON0A 1MGTA 3I0TA 4EM1A 1ZG3A 1W5TA 5L3FA 2FBHA 3GUDA 2A07F 2L4AA 5CVIA 4OIPF 2IA1A 2YPRA 4N0BA 3QOPA 2UWMA 1D8JA 3KP3A 1HW1A 2MBFA 3T8RA 4BNCA 5F1RA 3KLNA 2LF8A 4PDKA 3CTAA 3IRRA 2UXNA 1G3SA 3IWZA 4IPAA 2LNBA 3WODF 1TQMA 3W6KB 2CYYA 1FNNA 4EMSA 2W25A 1MD0A 5E8GA 4HDVA 4LD5A 2BEOA 2O03A 1IRGA 1BC7C 4M9SA 4M72A 2MH9A 1FYLA 1HW2A 1KU7A 3U2RA 4B8XA 4NHJA 3OV8A 1C0WA 2M87A 2XRNA 3U1DA 1I1SA 4WWCA 1ULYA 2QQBA 1Y0UA 5TRDA 3L00A 1GVJA 4RGSA 3F23A 2GAUA 2MC3A 1KA8A 2EV5A 3L9FA 3GZ6A 4Z2YA 4HAMA 2V1XA 4IVNA 5J8CA 1Z6TA 4A2UA 3GFLA 3Q9VA 4WF2A 2X4HA 3DFGA 4R8HA 3ABTA 2M45A 4EQQA 1P6RA 4P55A 3BJ6A 2M1BA 1S7OA 1P4XA 4WX9A 3LA3A 2OZUA 3R0JA 4ENNA 2EFWA 3WTWC 3ZMTA 4G94A 4WK8F 2P5KA 2D1HA 3U9GA 1ZG5A 2DFIA 2YU3A 2EWNA 1XDUA 2A6EF 1H9GA 3KP2A 4ESJA 4LG0B 2QBYA 3KEQA 4KIBA 4O5VA 4AD9A 4M6XA 3BZ6A 4BH9A 3MFKA 4YG2F 1MJBA 2CO5A 4OU0A 2HS5A 4LLGF 3JSPA 3CUOA 5E1WA 3WG9A 1HXDA 5L3BA 5DUIA 1OPCA 3CUQB 1HQCA 1HW5A 1SMTA 3P9CA 2HKXA 2ISZA 3M1EA 1ZRCA 3V8LA 1R1UA 2L54A 3JAMZ 2HR3A 3K1PA 4M6YA 1MDMB 1IN8A 2EV6A 2KRFA 1W4MA 1ONVA 2XAQA 2L02A 3GWZA 4CZZA 3KLOA 4KN4X 2FSWA 2KIFA 1HSJA 1UB9A 3K1NA 3C3WA 3NEUA 1XMAA 2PQ8A 4ZYDA 4CDGA 5H20A 2QBYB 2JRTA 3DV8A 3VODA 2FXAA 3FMSA 4HW0A 3GEZA 3T1BA 1T2KA 4U0WA 1F1ZA 4I09A 4UVCA 1FYMA 4EVIA 2ZFWA 1R5GA 2BYVE 2YX7A 2CW0F 1XSDA 2RV8A 5E20A 2VE8A 2CSOA 4YIIA 4AIHA 1XMKA 5E1ZB 1XGSA 4GXOA 1ZYRF 4FT8A 2FMYA 2EFOA 2RQPA 4Q5SF 4AIJA 2D1VA 3VOEA 2IJLA 2ISYA 1X3UA 2OAZA 2XAGA 1WKMA 1U8RA 1IN5A 2P6TA 3J80Z 4Q47A 2GXBA 2D45A 3QP5A 2EFNA 4G6QA 1PP8F 2GXGA 5JR3A 1RUNA 4A6EA 2BGCA 5HDNA 4WXDA 3GZ5A 3RKWA 4KIGA 5EEHA 3PFIA 4Y15A 1SD6A 3J81K 2DK5A 1ZG1A 1RZ4A 4GYIA 4NB5A 2H94A 3ECHA 1BI0A 1XN7A 3P9KA 4P9FA 4OOIA 4A0YA 2FBIA 3HUGA 4QLCU 2QVOA 1SAXA 1JXSA 1TNSA 3FXRA 3G73A 3EQLF 2RVCA 3ZP5A 3I54A 3GX4X 2MD5A 3C18A 5LGNA 5CVVA 1XGOA 5JHUA 1QNTA 1QGPA 2LKPA 3RPQA 1R36A 5HS8A 3GXOA 2HQRA 1USSA 1XCBA 1G3YA 1W5SA 4EJVA 2MLGA 1ZGAA 3IC7A 2Y0MA 1S8NA 2P5VA 4D0PA 3D0SA 2H6BA 1BIAA 1FPQA 2PMHA 4MTEA 3DPTA 3O3KA 1HKSA 3R6SA 3K69A 5ED4A 1IXSB 1FT9A 3V8KA 1WQ2A 3EDPA 3GO5A 1ZHFA 2CG4A 2PI0A 1KYZA 4HX4A 2P4WA 5AONA 3M8EA 3BDDA 5E17F 3Q9SA 4HZFA 1OYWA 1KU3A 1U2WA 4M73A 2UXXA 4DQ2A 1Z9CA 1IF1A 1Z6RA 1YW8A 4KYWA 3GLXA 3HRTA 3DXJF 1T6SA 1HKTA 2FNPA 3C7JA 3GW2A 1K7AA 3E6BA 5BS6A 4U0VA 3MQ0A 3R4KA 4HLXA 4L5IA 3FM3A 1LVAA 1U5TC 2W57A 3K2ZA 2LF7A 4EJTA 3MCZA 2BV6A 5TJJA 5ERIA 3CUQA 2V1UA 2GA2A 1FP1D 4U7BA 3F8FA 1O57A 2P8TA 3KP7A 3P9IA 2ZNZA 5DUKA 3HTSB 2PFBA 4U0YA 4A12A 1BI3A 5K5QA 2E1CA 3FX3A 2IRFG 3QAHA 4ENMA 5ICGA 1HKQA 3QPTA 2WV0A 2LDUA 3I71A 4K2EA 5CLSA 3TKYA 1FX7A 3FWEA 1Z05A 1SD5A 4I0BA 1G3WA 1QZYA 3GFMA 2WTEA 2GWRA 5AIPA 3KETA 4PGHA 4HBLA 2FA5A 2P6SA 2QZ8A 3TDZC 2JZYA 3ML6A 2QQAA 3I58A 4XSXF 5ILSA 5FLXZ 1CGPA 2IVMA 4G6DA 2XKPA 4ZH4F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LHH A;  3OOP A;  5L3E A;  1E2X A;  3B73 A;  5CVJ A;  3ZPL A;  5LGU A;  1REP C;  2H27 A;  2AS5 F;  4R1H A;  3ZMU A;  4A0X A;  4OIN F;  2V79 A;  1O3S A;  2MLK A;  5HS9 A;  1WSU A;  1CF7 B;  4MQ9 F;  2FQ3 A;  4O3M A;  3C1D A;  5FFX A;  2IP2 A;  4ENK A;  1SD7 A;  1J0R A;  4IRG A;  1KQ9 A;  1TQI A;  2K86 A;  3IWF A;  4WXH A;  3ZMZ A;  1ZRF A;  4HF0 A;  4IF4 A;  4UUV A;  1BI2 A;  1TW2 A;  1PUE E;  4I0A A;  5ILV A;  4Q48 A;  4LLN A;  5IT9 K;  3BJA A;  3HYI A;  2YR2 A;  4M71 A;  2XAJ A;  5D5U B;  1ZGJ A;  3FF5 A;  2XHK A;  5L3D A;  2V1D A;  1JE8 A;  5BQT A;  3V7S A;  4HF2 A;  5H6Q A;  4PCQ A;  4HV5 A;  1BC8 C;  1T38 A;  2ZME A;  5F64 A;  3M9A A;  2H09 A;  5FB2 A;  2DQR A;  4ZZL A;  6PAX A;  4ESB A;  4OIR F;  3E6D A;  1EH6 A;  3O2P E;  3WU0 A;  3LWF A;  2Y48 A;  1T98 A;  4MNU A;  4HV6 A;  5D4S A;  1YLF A;  3LAJ A;  2B0L A;  2WC2 A;  5DYM A;  1XB4 A;  4L0Y B;  5K1Y A;  1YTY A;  3I5U A;  1FBU A;  4KNY A;  2A69 F;  4HF1 A;  2STW A;  5DV5 A;  4GCV A;  1YIO A;  4KFC A;  3E6M A;  3DF8 A;  5JI6 A;  1O3Q A;  1J5Y A;  1S6L A;  2L01 A;  2Z9O A;  2M5W A;  3ZMD A;  1JGS A;  2Z99 A;  1BM9 A;  4GO1 A;  3GF2 A;  1R5H A;  4HQE A;  3WE2 A;  2EFQ A;  2VC1 A;  1DPR A;  2DK8 A;  2HWV A;  2YX4 A;  1U3E M;  4I2O A;  2JPC A;  5DCF A;  2K4B A;  4MQV A;  2VBZ A;  2K02 A;  4WXC A;  2Z3Y A;  5CVR A;  4MHG A;  1Q1H A;  1ZH5 A;  4KDP A;  3RKX A;  3KP4 A;  4EM2 A;  4LJZ F;  3TO7 A;  1Z1D A;  3I64 A;  5D5V B;  5HDK A;  2ZBK A;  1DP7 P;  4KUM A;  2KJC A;  2VXZ A;  3WTZ A;  3F8N A;  1ZAO A;  5FO5 A;  2DLL A;  1J75 A;  3FHZ A;  3WTS C;  1AWC A;  3FM5 A;  2FOK A;  3KE2 A;  1R00 A;  4EV0 A;  4ENJ A;  4IHT A;  2OZ6 A;  4FX4 A;  4YFK F;  3WU1 B;  2W85 A;  1UFM A;  2VBX A;  1ZLJ A;  1HST A;  2F5C A;  3HRS A;  2NYX A;  4GGG A;  3NRV A;  2CGP A;  4EJW A;  4I01 A;  3MAJ A;  3ELK A;  3RJP A;  1D8K A;  3WTT C;  2VE9 A;  2JPB A;  2DAO A;  2FRH A;  2F5D A;  2DT5 A;  3ZN0 A;  3TDU C;  2EA4 A;  1STZ A;  3H3U A;  5ICC A;  5D6E A;  1RUO A;  1ZRD A;  4HX8 A;  4L0Z B;  4EGY A;  3V4G A;  1IRF A;  5D5X B;  1DDN A;  2OBP A;  2O3F A;  3TO9 A;  1LDK B;  1D5V A;  4IJA A;  2X0L A;  5HLG A;  1YW9 A;  3VB2 A;  4ZZD A;  1TW3 A;  1W7P A;  1FSE A;  3CO6 C;  3F72 A;  1SFX A;  5BPI A;  1JHF A;  2LSO A;  2HYG D;  3RYR A;  2UZK A;  1D3Y A;  3WTX C;  3QU6 A;  1LEB A;  1T0F A;  2JTV A;  3HRU A;  3ROU A;  2IA0 A;  3D5L A;  3BWG A;  2ZNY A;  1IUY A;  3P7N A;  1R1T A;  2TDX A;  1O3T A;  2ZO4 A;  1U6G A;  3E5Q A;  1IZ1 A;  3ABU A;  3AAF A;  3IHU A;  3I4P A;  1RIO H;  1YW7 A;  5K5O A;  4CIC A;  3JTH A;  4RGR A;  1JHH A;  3ZQ7 A;  4RB3 C;  3IKV A;  1GXQ A;  3F8B A;  3L09 A;  3LA2 A;  2NNN A;  2W24 A;  3LFK A;  2ADU A;  2L3D A;  5DD4 A;  4G9Y A;  4L18 B;  1V4R A;  1RI7 A;  4S05 A;  2ZKZ A;  2A68 F;  3V7C A;  2G7U A;  3TO6 A;  4G7H F;  2COM A;  1R23 A;  2RGV A;  1ZN2 A;  2PG4 A;  3KFW X;  4ZYG A;  4M74 A;  2VOP A;  1YFH A;  3PQJ A;  3N97 A;  2XUB A;  3KP6 A;  4P9U A;  3JW4 A;  1FOK A;  1LJ9 A;  3RTR A;  2Q2E A;  1J7K A;  2HTJ A;  2DPD A;  1BBY A;  5ICF A;  1UST A;  2DU9 A;  5JVT A;  2D2W A;  5D6F A;  3ZN1 A;  1TTY A;  4HQM A;  5FGM A;  4TV7 A;  1H9T A;  3QPH A;  2YSR A;  2VN2 A;  3T8T A;  1J59 A;  5H6R A;  4YIF A;  5FD6 A;  3WTY C;  2G7H A;  3LA7 A;  4PGG A;  3BPV A;  1O7L A;  3F8C A;  2FU4 A;  2E1N A;  1MDM A;  3SHF A;  4U88 A;  2Z5U A;  4UNO A;  1FBS A;  2RNJ A;  3Q5F A;  3HIF A;  3IKT A;  3MWM A;  1NHA A;  2M30 A;  5HLH A;  5HLI A;  1O3R A;  4PZJ A;  3LQR A;  1Z7U A;  1FBQ A;  3RIR A;  2ETH A;  1P92 A;  2G9W A;  2EK5 A;  3E5U A;  2VON A;  2Q8K A;  2A6H F;  4AWX B;  1LDD A;  1VTN C;  2PJP A;  1IN6 A;  2XAH A;  3ZMS A;  4LGW A;  2O8X A;  1GXP A;  2FEZ A;  1OKR A;  5J6X A;  2HFH A;  2QEN A;  2RC4 A;  3J80 K;  3WTU C;  2W84 A;  1CF7 A;  2ESH A;  4Y13 A;  2C6Y A;  1IN4 A;  2OQG A;  3J7A O;  2HOE A;  3V7R A;  4QWQ A;  5KVR A;  1I1G A;  3BOQ A;  5DDG A;  3RPU A;  1OR7 A;  1K6O A;  1WRJ A;  3KCC A;  4KIC A;  2J5P A;  5JFR A;  3SZP A;  5KK1 A;  4KMF A;  4L9J A;  4M9Z A;  1LNW A;  2KJB A;  5DCM A;  2ESN A;  3JAM K;  5BOX A;  5HVQ C;  5FD5 A;  1O7F A;  3JSO A;  3HSR A;  3F21 A;  5AIQ A;  2XV4 S;  1UHM A;  5LEK A;  4E70 A;  5D4R A;  3B02 A;  4LLL A;  3TOB A;  4NQW A;  5DD8 A;  3KEO A;  3SQN A;  1GHC A;  3LST A;  1DUX C;  2ELH A;  4A6D A;  3ULQ B;  2GZW A;  4L9N A;  3K1M A;  2HKO A;  3HSF A;  1FP2 A;  1QO0 D;  1K79 A;  1R1V A;  3PQK A;  3ZMV A;  2H6C A;  2NS0 A;  3BP8 A;  4LMY A;  1SFU A;  4IHS A;  4JQF A;  3H92 A;  3IRQ A;  3L7W A;  1KGS A;  1SMY F;  1S7A A;  2QUF A;  3R61 A;  5LLQ A;  1PDN C;  3DEU A;  4G7Z F;  4IXA A;  5L3C A;  1B9M A;  4R79 A;  4BXU A;  1AOY A;  4I02 A;  1YQA A;  1XGN A;  1IXC A;  2Y75 A;  3TQN A;  1LQ1 A;  4KT5 C;  2M8E A;  1YS6 A;  2HGC A;  1U5T B;  1ZAR A;  1TBX A;  4HDU A;  5BPD A;  5L3G A;  1PP7 U;  2XIG A;  2HEO A;  3WTV C;  3E3V A;  4BHP A;  2JT1 A;  4S04 A;  1XSX A;  3HHH A;  1IAW A;  1HBX G;  3IL2 A;  2VC0 A;  2QYO A;  3WE3 A;  1WI9 A;  2P5L C;  4P96 A;  4RGU A;  4XBF A;  5BMZ A;  2CWE A;  2IW5 A;  1DPU A;  3L2C A;  5E8I A;  1G6N A;  5LHI A;  2FNA A;  2OQR A;  1YO5 C;  2STT A;  2R7D A;  4AVP A;  4MEX F;  5ILU A;  5HOO A;  2F5E A;  1P4A A;  1L3L A;  1F5T A;  3LQQ A;  3LAP A;  2OD5 A;  3BRO A;  3NQO A;  3E97 A;  3GFI A;  1FYK A;  4DNC A;  2E7X A;  5CVU A;  2Z33 A;  4WCG A;  4ZYH A;  1BJA A;  2HDC A;  1W7P D;  1XD7 A;  5LBQ A;  1YYV A;  2KIM A;  1R7J A;  4I98 B;  3BY6 A;  4OIO F;  3W6J B;  4LK0 F;  1SD4 A;  3HHG A;  1YS7 A;  1U5T A;  1Z91 A;  2A5Y B;  1K78 A;  3TGN A;  4HA8 A;  1F4K A;  2PBI A;  2O61 A;  3JTG A;  3N4M A;  1ZRE A;  2VOO A;  1OYI A;  2F2E A;  3BPX A;  4Q4Z F;  2GA1 A;  4JK1 X;  3K0L A;  4YFX F;  3J81 Z;  2XRO A;  2VOD A;  4LB5 A;  1QQI A;  2XGX A;  1KQ0 A;  4BHC A;  1RNL A;  4ESF A;  2FF4 A;  4CGZ A;  1P2F A;  4L9T A;  1I6X A;  1BN5 A;  1EH8 A;  2VBW A;  2HZT A;  4N9I A;  4CXF A;  2DBB A;  5FFZ A;  2Q0O A;  1G4D A;  2IPQ X;  3MZH A;  4RAY A;  3T5X A;  4LB6 B;  4U7D A;  3H3Z A;  1R22 A;  3SFZ A;  1UCR A;  1R58 A;  4HYE A;  2RDP A;  1BOA A;  5E18 F;  4BYY A;  2V9V A;  5LGT A;  4UVB A;  2RKH A;  1EV7 A;  1QBJ A;  4OMZ A;  4FX0 A;  3RDI A;  4A5N A;  5DCM B;  2OU2 A;  3WGG A;  1OYY A;  2QLZ A;  3SZT A;  5HS7 A;  1T39 A;  1KU9 A;  3E5X A;  3CJN A;  1MZB A;  1ON2 A;  1A04 A;  2J5O A;  4EJU A;  4XRF A;  1L0O C;  3M8F A;  1IN7 A;  1YG2 A;  2VBY A;  3I53 A;  4OMY A;  4KA4 A;  4BAY A;  1V3F A;  1G3T A;  1S3J A;  4KIF A;  4Y17 A;  3KP5 A;  4LFU A;  2R7F A;  3EUH A;  3GYH X;  2O6G E;  3HSE A;  4GYG A;  3ISP A;  2NAZ A;  4L9V A;  1H0M A;  3FMQ A;  4EJO A;  5LEJ A;  3FZV A;  4MTD A;  4XSZ F;  2ZXJ A;  3S2W A;  4CO8 A;  3K9T A;  4EGZ A;  2K7L A;  3MZY A;  3I59 A;  1MKM A;  2OA4 A;  4M9X A;  5HDG A;  3RI4 A;  2DW4 A;  4RB1 A;  4ETS A;  2XKO A;  2JSC A;  2A3S A;  5A2Q K;  3HRM A;  3FXQ A;  2PEX A;  3CUQ C;  5F6F A;  1FSH A;  3FXU A;  4P5O A;  4RGX A;  4UV8 A;  5K5R A;  4AIK A;  2QQ9 A;  1OMI A;  2BE5 F;  3RKY A;  1J2X A;  3QP6 A;  4XLP F;  4O6J A;  4RS8 A;  1XSV A;  2A61 A;  2ACJ A;  1XCV A;  3HOT A;  4UVA A;  2E7W A;  4LK1 F;  2VT2 A;  3CLO A;  2QM3 A;  3KZY A;  4A5M A;  5LRR A;  2ZME B;  1S29 A;  3ECO A;  3EYI A;  1BIB A;  4N9H A;  2V6C A;  4JBA A;  1E17 A;  4HX7 A;  2O0Y A;  3M7G A;  1FLI A;  3R60 A;  1QZZ A;  1B1B A;  1B59 A;  1LDJ A;  1FWZ A;  5D8L B;  5FLX K;  3GVA A;  4UHT A;  3I59 B;  4MEY F;  3HTU A;  2DPU A;  3FMR A;  1I27 A;  5LRS A;  3DKW A;  1BI1 A;  4L5J A;  1FC3 A;  3DP7 A;  1LB2 A;  2HTS A;  2MA3 A;  3KZZ A;  1P4W A;  4IRH A;  4IRI A;  2DTR A;  2FML A;  3DQV C;  1UHW A;  2K27 A;  3O6B B;  2CFX A;  2IA2 A;  2L4M A;  3SXY A;  4HOB A;  2DQL A;  2GIV A;  4OIQ F;  4F7Z A;  1SFE A;  1TLH B;  3RYP A;  4CYD A;  1W7P B;  3BJO A;  2KKO A;  1B4A A;  5A2Q Z;  2PLY A;  1F9N A;  2XAF A;  2EA2 A;  1ON1 A;  2VT3 A;  5J8F A;  3F22 A;  3COA C;  3MEX A;  2MH2 A;  4HLY A;  1XDS A;  3F8M A;  4FHT A;  2EV0 A;  2PN6 A;  2KIU A;  3GFJ A;  1KYW A;  3T0Y A;  2RN7 A;  5ICE A;  1J9I A;  3QRF F;  1LEA A;  4CHU A;  5IT3 A;  4KN7 X;  3REO A;  4KMU X;  3QU3 A;  4BHB A;  2P7V B;  3VFZ A;  3F6V A;  2DO7 A;  4ASN A;  4RB2 C;  2DI3 A;  2CQK A;  2F5F A;  4MGR A;  2EFP A;  3R0A A;  3G3Z A;  4UV9 A;  1XGM A;  3CO7 C;  2EJR A;  4UXN A;  2WWY A;  2EB7 A;  3EYY A;  2QWW A;  2NRA C;  2BBY A;  4B09 A;  2FE3 A;  5CYV A;  1TNT A;  1I5Z A;  2R3S A;  5D8K B;  5LHG A;  2P7C B;  3V8J A;  1KQ8 A;  3CDH A;  1WWX A;  4YFN F;  5D5W B;  2ZJ2 A;  1B6A A;  4G8X A;  3TOA A;  5EEG A;  5CJ9 A;  1KU2 A;  1K78 B;  1EH7 A;  4H0E A;  2GQQ A;  1U78 A;  4ZYE A;  1MJ9 A;  1B9N A;  2HYF A;  3ERE D;  4EM0 B;  3WGI A;  2FBK A;  3DPL C;  4XLN F;  2PMU A;  4RAZ A;  1QPM A;  2NNY A;  4I7H A;  2XVC A;  2ZCW A;  2HQN A;  1IXR C;  2IT0 A;  1MJA A;  3WGH A;  5DEQ A;  2K4J A;  5IT9 Z;  1TQP A;  3EET A;  5E1X A;  3VEP A;  3F6O A;  3HOS A;  4LG0 A;  2AXL A;  1FZP B;  4BQA A;  1ZLK A;  3F3X A;  2XAS A;  1ODD A;  4RB0 A;  3E6C C;  4G7O F;  1FY7 A;  4A0Z A;  1IW7 F;  4ON0 A;  1MGT A;  3I0T A;  4EM1 A;  1ZG3 A;  1W5T A;  5L3F A;  2FBH A;  3GUD A;  2A07 F;  2L4A A;  5CVI A;  4OIP F;  2IA1 A;  2YPR A;  4N0B A;  3QOP A;  2UWM A;  1D8J A;  3KP3 A;  1HW1 A;  2MBF A;  3T8R A;  4BNC A;  5F1R A;  3KLN A;  2LF8 A;  4PDK A;  3CTA A;  3IRR A;  2UXN A;  1G3S A;  3IWZ A;  4IPA A;  2LNB A;  3WOD F;  1TQM A;  3W6K B;  2CYY A;  1FNN A;  4EMS A;  2W25 A;  1MD0 A;  5E8G A;  4HDV A;  4LD5 A;  2BEO A;  2O03 A;  1IRG A;  1BC7 C;  4M9S A;  4M72 A;  2MH9 A;  1FYL A;  1HW2 A;  1KU7 A;  3U2R A;  4B8X A;  4NHJ A;  3OV8 A;  1C0W A;  2M87 A;  2XRN A;  3U1D A;  1I1S A;  4WWC A;  1ULY A;  2QQB A;  1Y0U A;  5TRD A;  3L00 A;  1GVJ A;  4RGS A;  3F23 A;  2GAU A;  2MC3 A;  1KA8 A;  2EV5 A;  3L9F A;  3GZ6 A;  4Z2Y A;  4HAM A;  2V1X A;  4IVN A;  5J8C A;  1Z6T A;  4A2U A;  3GFL A;  3Q9V A;  4WF2 A;  2X4H A;  3DFG A;  4R8H A;  3ABT A;  2M45 A;  4EQQ A;  1P6R A;  4P55 A;  3BJ6 A;  2M1B A;  1S7O A;  1P4X A;  4WX9 A;  3LA3 A;  2OZU A;  3R0J A;  4ENN A;  2EFW A;  3WTW C;  3ZMT A;  4G94 A;  4WK8 F;  2P5K A;  2D1H A;  3U9G A;  1ZG5 A;  2DFI A;  2YU3 A;  2EWN A;  1XDU A;  2A6E F;  1H9G A;  3KP2 A;  4ESJ A;  4LG0 B;  2QBY A;  3KEQ A;  4KIB A;  4O5V A;  4AD9 A;  4M6X A;  3BZ6 A;  4BH9 A;  3MFK A;  4YG2 F;  1MJB A;  2CO5 A;  4OU0 A;  2HS5 A;  4LLG F;  3JSP A;  3CUO A;  5E1W A;  3WG9 A;  1HXD A;  5L3B A;  5DUI A;  1OPC A;  3CUQ B;  1HQC A;  1HW5 A;  1SMT A;  3P9C A;  2HKX A;  2ISZ A;  3M1E A;  1ZRC A;  3V8L A;  1R1U A;  2L54 A;  3JAM Z;  2HR3 A;  3K1P A;  4M6Y A;  1MDM B;  1IN8 A;  2EV6 A;  2KRF A;  1W4M A;  1ONV A;  2XAQ A;  2L02 A;  3GWZ A;  4CZZ A;  3KLO A;  4KN4 X;  2FSW A;  2KIF A;  1HSJ A;  1UB9 A;  3K1N A;  3C3W A;  3NEU A;  1XMA A;  2PQ8 A;  4ZYD A;  4CDG A;  5H20 A;  2QBY B;  2JRT A;  3DV8 A;  3VOD A;  2FXA A;  3FMS A;  4HW0 A;  3GEZ A;  3T1B A;  1T2K A;  4U0W A;  1F1Z A;  4I09 A;  4UVC A;  1FYM A;  4EVI A;  2ZFW A;  1R5G A;  2BYV E;  2YX7 A;  2CW0 F;  1XSD A;  2RV8 A;  5E20 A;  2VE8 A;  2CSO A;  4YII A;  4AIH A;  1XMK A;  5E1Z B;  1XGS A;  4GXO A;  1ZYR F;  4FT8 A;  2FMY A;  2EFO A;  2RQP A;  4Q5S F;  4AIJ A;  2D1V A;  3VOE A;  2IJL A;  2ISY A;  1X3U A;  2OAZ A;  2XAG A;  1WKM A;  1U8R A;  1IN5 A;  2P6T A;  3J80 Z;  4Q47 A;  2GXB A;  2D45 A;  3QP5 A;  2EFN A;  4G6Q A;  1PP8 F;  2GXG A;  5JR3 A;  1RUN A;  4A6E A;  2BGC A;  5HDN A;  4WXD A;  3GZ5 A;  3RKW A;  4KIG A;  5EEH A;  3PFI A;  4Y15 A;  1SD6 A;  3J81 K;  2DK5 A;  1ZG1 A;  1RZ4 A;  4GYI A;  4NB5 A;  2H94 A;  3ECH A;  1BI0 A;  1XN7 A;  3P9K A;  4P9F A;  4OOI A;  4A0Y A;  2FBI A;  3HUG A;  4QLC U;  2QVO A;  1SAX A;  1JXS A;  1TNS A;  3FXR A;  3G73 A;  3EQL F;  2RVC A;  3ZP5 A;  3I54 A;  3GX4 X;  2MD5 A;  3C18 A;  5LGN A;  5CVV A;  1XGO A;  5JHU A;  1QNT A;  1QGP A;  2LKP A;  3RPQ A;  1R36 A;  5HS8 A;  3GXO A;  2HQR A;  1USS A;  1XCB A;  1G3Y A;  1W5S A;  4EJV A;  2MLG A;  1ZGA A;  3IC7 A;  2Y0M A;  1S8N A;  2P5V A;  4D0P A;  3D0S A;  2H6B A;  1BIA A;  1FPQ A;  2PMH A;  4MTE A;  3DPT A;  3O3K A;  1HKS A;  3R6S A;  3K69 A;  5ED4 A;  1IXS B;  1FT9 A;  3V8K A;  1WQ2 A;  3EDP A;  3GO5 A;  1ZHF A;  2CG4 A;  2PI0 A;  1KYZ A;  4HX4 A;  2P4W A;  5AON A;  3M8E A;  3BDD A;  5E17 F;  3Q9S A;  4HZF A;  1OYW A;  1KU3 A;  1U2W A;  4M73 A;  2UXX A;  4DQ2 A;  1Z9C A;  1IF1 A;  1Z6R A;  1YW8 A;  4KYW A;  3GLX A;  3HRT A;  3DXJ F;  1T6S A;  1HKT A;  2FNP A;  3C7J A;  3GW2 A;  1K7A A;  3E6B A;  5BS6 A;  4U0V A;  3MQ0 A;  3R4K A;  4HLX A;  4L5I A;  3FM3 A;  1LVA A;  1U5T C;  2W57 A;  3K2Z A;  2LF7 A;  4EJT A;  3MCZ A;  2BV6 A;  5TJJ A;  5ERI A;  3CUQ A;  2V1U A;  2GA2 A;  1FP1 D;  4U7B A;  3F8F A;  1O57 A;  2P8T A;  3KP7 A;  3P9I A;  2ZNZ A;  5DUK A;  3HTS B;  2PFB A;  4U0Y A;  4A12 A;  1BI3 A;  5K5Q A;  2E1C A;  3FX3 A;  2IRF G;  3QAH A;  4ENM A;  5ICG A;  1HKQ A;  3QPT A;  2WV0 A;  2LDU A;  3I71 A;  4K2E A;  5CLS A;  3TKY A;  1FX7 A;  3FWE A;  1Z05 A;  1SD5 A;  4I0B A;  1G3W A;  1QZY A;  3GFM A;  2WTE A;  2GWR A;  5AIP A;  3KET A;  4PGH A;  4HBL A;  2FA5 A;  2P6S A;  2QZ8 A;  3TDZ C;  2JZY A;  3ML6 A;  2QQA A;  3I58 A;  4XSX F;  5ILS A;  5FLX Z;  1CGP A;  2IVM A;  4G6D A;  2XKP A;  4ZH4 F; 
#chains in the Genus database with same CATH topology
 3U1K A;  3H5R A;  5LHH A;  3OOP A;  5L3E A;  3V42 A;  1E2X A;  3B73 A;  2W48 A;  1SAN A;  5CVJ A;  3ZPL A;  5LGU A;  2R5Z B;  3HB9 A;  1REP C;  4YIR X;  5KAI C;  2H27 A;  1QVT A;  2AS5 F;  2DA2 A;  4R1H A;  3ZMU A;  4ZDL A;  4A0X A;  1X4O A;  4OIN F;  4A69 C;  2V79 A;  1NK3 P;  5LD2 C;  5M5W J;  1O3S A;  1ACI A;  1UG0 A;  4UUS B;  1KON A;  2MLK A;  5HS9 A;  4BDY A;  1WSU A;  5J3L A;  1CF7 B;  4MQ9 F;  4OAZ A;  2QEX I;  2VB6 A;  2FQ3 A;  4O3M A;  3C1D A;  5FFX A;  2IP2 A;  4XIC A;  4XLF A;  4ENK A;  3HXL A;  1Z77 A;  3S16 J;  1SD7 A;  1J0R A;  2KL4 A;  4FIS A;  2MAB A;  4IRG A;  1KQ9 A;  5IP6 A;  1TQI A;  2K86 A;  1Y39 A;  1EKE A;  1X1C A;  2LD5 A;  4MIM A;  2K9L A;  3ZQF A;  1MSE C;  3IWF A;  4WXH A;  2R5Y B;  3ZMZ A;  3LSR A;  1ZRF A;  3OL3 A;  4HF0 A;  1V5F A;  4IF4 A;  5EEA A;  4UUV A;  2KHM A;  1OJL A;  1BI2 A;  1TW2 A;  1PUE E;  4I0A A;  4W1U A;  5J1Y A;  5ILV A;  4Q48 A;  4LLN A;  5IT9 K;  3BJA A;  4L5E A;  3HYI A;  2YR2 A;  1FOW A;  4M71 A;  2XAJ A;  4LIV A;  2RNG A;  5D5U B;  1LVK A;  3OYL A;  1ZGJ A;  3FF5 A;  2XHK A;  4B47 A;  1WJB A;  1AU7 A;  5L3D A;  2W82 A;  2V1D A;  4BKX A;  5JLW A;  1AKH B;  1JE8 A;  2CJJ A;  2E5N A;  4F52 A;  5BQT A;  3V7S A;  1LFB A;  4HF2 A;  4HRI A;  1WJE A;  2DA5 A;  5H6Q A;  3CCY A;  4PCQ A;  4HV5 A;  1BC8 C;  1OCO H;  2AHQ A;  1T38 A;  9ANT A;  2ZME A;  5F64 A;  3M9A A;  4BQO A;  2H09 A;  4YEJ A;  2ZJQ F;  3H36 A;  5FB2 A;  5IP7 J;  5E79 C;  3JR9 A;  2DQR A;  2BY1 A;  4ZZL A;  2HPM A;  6PAX A;  4ESB A;  4OIR F;  3E6D A;  2LOO A;  1EH6 A;  3O2P E;  3WU0 A;  4I99 C;  3B6C A;  3LWF A;  3SJM A;  1FTT A;  3CJQ B;  4MFE A;  3DWL E;  2Y48 A;  2BVL A;  1NH3 A;  1T98 A;  4MNU A;  4E4H A;  4HV6 A;  5F04 A;  1YLF A;  5D4S A;  4BQQ A;  2L2O A;  3LAJ A;  1JTX A;  2B0L A;  2WC2 A;  5EG0 A;  5DYM A;  2M2E A;  1XB4 A;  4XKW A;  4L0Y B;  5K1Y A;  2DA6 A;  1YTY A;  2R7R A;  3CC7 I;  3I5U A;  1FBU A;  1GV5 A;  3OYK A;  4KNY A;  2A69 F;  4HNV A;  4HF1 A;  2STW A;  5DV5 A;  2BW3 B;  4NUB A;  1WH7 A;  4GCV A;  1YIO A;  4KFC A;  3E6M A;  3DF8 A;  5JI6 A;  3SEZ A;  2XC7 A;  1O3Q A;  1J5Y A;  2MFZ A;  1XTA A;  1S6L A;  2WBM A;  2X1E A;  2L01 A;  2M8G X;  4MO7 A;  1IV6 A;  2Z9O A;  2M5W A;  3OIO A;  3ZMD A;  1JGS A;  4BDZ A;  2Z99 A;  3RZO J;  3QPL A;  1BM9 A;  3K7A J;  4GO1 A;  2E36 A;  3VSK A;  5B66 C;  4BEH A;  5E3N A;  1SC7 A;  3AG3 H;  3GF2 A;  3KYC B;  4Z6Y A;  1U9N A;  1R5H A;  4HQE A;  1V5E A;  3WE2 A;  2OCE A;  3SDB A;  4BY7 J;  3K70 C;  2EFQ A;  2VC1 A;  1FOX A;  1DPR A;  2DK8 A;  2HWV A;  2YX4 A;  1U3E M;  4OAY A;  4I2O A;  2JPC A;  5DCF A;  3FBI B;  2K4B A;  4MQV A;  2VBZ A;  3CF5 F;  3BT9 A;  2K02 A;  1IG7 A;  3OYN A;  4WXC A;  2Z3Y A;  5CVR A;  4MHG A;  4IEJ A;  1Q1H A;  1ZH5 A;  4AVZ A;  4C9Y A;  4KDP A;  3RKX A;  1D1B A;  1Y1V J;  3KP4 A;  4EM2 A;  3BR0 A;  4LJZ F;  3TO7 A;  1Z1D A;  4ABZ A;  3IH4 A;  3I64 A;  5D5V B;  1A35 A;  5HDK A;  3AFH A;  2H1K A;  2K40 A;  2ZBK A;  1DP7 P;  4PSW A;  1FMV A;  2R7U A;  4KUM A;  2KJC A;  5FRM A;  2VXZ A;  3WTZ A;  3TW6 A;  5GAE J;  1LFP A;  1ZAO A;  3F8N A;  5FO5 A;  2DLL A;  1ERD A;  1J75 A;  3FHZ A;  2LR8 A;  2HQA A;  3WTS C;  2BXY A;  3BZC A;  1AWC A;  3AG2 H;  3FM5 A;  4B4C A;  2FOK A;  3PUF A;  1ZR2 A;  1FJL A;  3CCE I;  2CUE A;  3KE2 A;  2LMD A;  1VQN I;  1BA5 A;  3EUH C;  2VKD A;  1ENH A;  1R00 A;  4EV0 A;  2E1O A;  1PYV A;  2DN0 A;  4ENJ A;  2Z2S B;  4IHT A;  2OZ6 A;  4FX4 A;  3OR1 C;  4YFK F;  3WU1 B;  2W85 A;  1UFM A;  2VBX A;  1YIJ I;  1ZLJ A;  1HST A;  2F5C A;  3HRS A;  1V55 H;  2NYX A;  4GGG A;  2L9S A;  2OPT A;  3NRV A;  1WCM J;  1VQM I;  3H9J A;  2E2H J;  2Y69 H;  2CGP A;  1VQ6 I;  4EJW A;  5KHD A;  2JVG A;  2LY1 A;  3FIW A;  4I01 A;  3MAJ A;  4NQW B;  4AM3 A;  2Z16 A;  2WAD A;  3KEY A;  3ELK A;  2XF7 A;  3RJP A;  3RZD J;  1D8K A;  1MND A;  3PJR A;  4LOC A;  3WTT C;  2VE9 A;  1JJ8 C;  2JPB A;  2DAO A;  2FRH A;  1NK2 P;  2F5D A;  3CMA I;  2DT5 A;  3ZN0 A;  3TDU C;  2EA4 A;  1STZ A;  3FXO A;  3H3U A;  1BR4 A;  5ICC A;  5D6E A;  5IYD J;  3UKG A;  1RUO A;  1ZRD A;  4HX8 A;  2DMQ A;  5CQE A;  4L0Z B;  4DYR A;  3G1L A;  4EGY A;  4PJJ A;  3V4G A;  1IRF A;  5D5X B;  1DDN A;  2YU9 J;  2OBP A;  4ZYA A;  3FKI J;  5M3M J;  2O3F A;  2EZH A;  4D5F A;  3TO9 A;  1LDK B;  1D5V A;  4JOM A;  1VQ7 I;  4IJA A;  2X0L A;  5HNH A;  5HLG A;  1A6I A;  1YW9 A;  4RAG A;  3VB2 A;  5BNG A;  5J40 A;  4ZZD A;  1TW3 A;  4GDF A;  1W7P A;  2CW7 A;  1FSE A;  2YUS A;  3F72 A;  3CO6 C;  1SFX A;  3ZOB A;  3BTC A;  1JHF A;  5BPI A;  1JUS A;  2LSO A;  2HYG D;  4F55 A;  3RYR A;  2UZK A;  1D3Y A;  3ZCO A;  3WTX C;  3QU6 A;  4M6V A;  1LEB A;  2X85 A;  3L2Q A;  2IGM A;  1T0F A;  1WH5 A;  3H5N A;  4D5C A;  3OYE A;  3JRE A;  3AL0 C;  2JTV A;  3HRU A;  4KJZ A;  3ROU A;  3JRA A;  2M34 A;  3I56 I;  2IA0 A;  4XLH A;  3D5L A;  3BWG A;  2ZNY A;  4N4O B;  4Y33 A;  3OYG A;  2VXD A;  1OCP A;  1IUY A;  5IYB J;  1AHD P;  2P0W A;  3P7N A;  5IOZ A;  1R1T A;  2TCT A;  2TDX A;  3OS1 A;  1O3T A;  3HM5 A;  1U6G A;  2ZO4 A;  2XGC A;  3E5Q A;  2PJR B;  2CRG A;  1IZ1 A;  3ABU A;  1RC9 A;  5B5E C;  3AAF A;  3IHU A;  2ICW G;  2L7Z A;  2WAQ N;  3I4P A;  1RIO H;  1YW7 A;  5K5O A;  4CIC A;  4CYC A;  3LSG A;  1WJD A;  3JTH A;  4RGR A;  1JHH A;  3ZQ7 A;  2JK3 A;  4RB3 C;  3IKV A;  1GXQ A;  3F8B A;  3L09 A;  3LA2 A;  2NNN A;  2W24 A;  3CCV I;  3LFK A;  2ADU A;  3G1M A;  2L3D A;  4CCO A;  3LSJ A;  5DD4 A;  4G9Y A;  3K4C A;  3S3M A;  4L18 B;  2K9S A;  1T56 A;  2L9R A;  2KIS A;  1V4R A;  1X1D A;  1RI7 A;  4S05 A;  1W0U A;  2ZKZ A;  2A68 F;  1MIJ A;  3ERM A;  1TWC J;  3V7C A;  2G7U A;  3TO6 A;  1LFU P;  3CP2 A;  3CES A;  2V9K A;  4G7H F;  2COM A;  1R23 A;  2ME6 A;  4CCM A;  1SEU A;  1YJW I;  2RGV A;  3HDD A;  3OYH A;  1ZN2 A;  1SVM A;  1VQP I;  2EPF A;  2PG4 A;  2ZXI A;  3KFW X;  4ZYG A;  4M74 A;  2VOP A;  3GTG J;  1JJ6 C;  1IDY A;  3ONQ A;  4A93 J;  2W00 A;  3BR5 A;  1TZL A;  1YFH A;  2LP0 A;  1ZK8 A;  3PQJ A;  3HOU J;  3GTO J;  3N97 A;  2BHY A;  2XUB A;  2EBI A;  3KP6 A;  5IYC J;  4P9U A;  3JW4 A;  3S3N A;  1FOK A;  3ASO H;  2M0C A;  1LJ9 A;  3MKZ A;  3RTR A;  2Q2E A;  1J7K A;  1RRJ A;  2EZK A;  4XN3 A;  3M8J A;  5JVG F;  2K5C A;  2HTJ A;  2R7W A;  4ZTF A;  2DPD A;  1BBY A;  5ICF A;  1UST A;  4NC6 A;  1VQL I;  5KNL A;  2DU9 A;  5JVT A;  2K85 A;  2D2W A;  5D6F A;  3ZN1 A;  1TTY A;  3HPG A;  4EEF G;  4HQM A;  4E6K G;  4A3J J;  5FGM A;  2L9V A;  3BG3 A;  5IY5 H;  1YI2 I;  2R7S A;  3FXJ A;  1EA3 A;  1X3Z B;  1K61 A;  2CQ7 A;  1TWH J;  4TV7 A;  1VQK I;  1H9T A;  4UB6 C;  3W2A A;  2HVQ A;  1FMW A;  1X1B A;  2CUZ A;  5GPC A;  3QPH A;  1D1A A;  2VN2 A;  2YSR A;  3T8T A;  3BG5 A;  4IL6 C;  3S2D J;  1J59 A;  3IH2 A;  5H6R A;  3HG9 A;  1QHG A;  3F9K A;  3TW7 A;  4YIF A;  4NDL A;  5FD6 A;  3WTY C;  2G7H A;  3LA7 A;  2Q1Z B;  4PGG A;  4CCJ A;  3BPV A;  1O7L A;  3F8C A;  4E7Z A;  2FU4 A;  2E1N A;  1MDM A;  5TGT A;  1YJ9 I;  2IBD A;  3KX2 A;  1NG6 A;  4ITV A;  2KLO A;  4XLE A;  3SHF A;  4U88 A;  1HA8 A;  2Z5U A;  4UNO A;  2FQ4 A;  3CCM I;  1GVD A;  2ELJ A;  5F08 A;  1FBS A;  2R7Q A;  2RNJ A;  4Y3O A;  3Q5F A;  4NC8 A;  3HIF A;  1K6Y A;  3IKT A;  3MWM A;  2R7V A;  3CJT B;  3CF2 A;  2G0E A;  1NHA A;  2M30 A;  5HLH A;  2VKH A;  5HLI A;  1O3R A;  2X1D A;  2IS6 A;  1HLV A;  4ZDO A;  3LSP A;  1EJ9 A;  2F6C A;  3M4O J;  2Y9Y A;  4PUS A;  1WJA A;  4PZJ A;  4XOT A;  3LQR A;  1TL8 A;  2A6T A;  2LVS A;  2B7E A;  1Z7U A;  1FBQ A;  2DOD A;  2KDZ A;  3RIR A;  2KFD A;  2ETH A;  3DPU A;  3BZK A;  3IP4 B;  1P92 A;  2G9W A;  1MBK A;  3QQA A;  2EK5 A;  3E5U A;  3TL4 X;  2VON A;  1YOV B;  2Q8K A;  2HOT A;  2A6H F;  4AWX B;  1LDD A;  2R5Y A;  2ECB A;  3BCA A;  3BR1 A;  1VTN C;  3LSK A;  5B1B H;  2PJP A;  1IN6 A;  2XAH A;  3HBL A;  3ZMS A;  4RLF A;  4LGW A;  4XID A;  3K10 A;  4IZZ A;  2I8D A;  2O8X A;  1GXP A;  2FEZ A;  3PSI A;  1OKR A;  4HG2 A;  1ZTR A;  2HFH A;  5J6X A;  2QEN A;  2RC4 A;  3K4B A;  3J80 K;  1F43 A;  1MMG A;  3S3O A;  3WTU C;  2W84 A;  1LKX A;  1RR8 C;  1CF7 A;  2ESH A;  4Y13 A;  2C6Y A;  3BG7 A;  5J4Y A;  4I76 A;  2CUF A;  3AG4 H;  4CSW A;  4IOA F;  1IN4 A;  2OQG A;  4FAS D;  1PJR A;  3J7A O;  2HOE A;  3H9G A;  3V7R A;  4QWQ A;  2HYJ A;  1YRN B;  5KVR A;  1I1G A;  3BOQ A;  3K4L A;  4C2U A;  1DGW Y;  1E3O C;  4C3I J;  5DDG A;  3RPU A;  1OR7 A;  1K6O A;  4RM2 A;  1WRJ A;  1POG A;  3D5R C;  2ZB9 A;  2CQN A;  3KCC A;  4KIC A;  5KCM A;  1NTC A;  2J5P A;  2VQC A;  5JFR A;  3A2K A;  2DJN A;  3SZP A;  4J01 A;  1RES A;  3I4M J;  4JX6 A;  3SZG A;  1OCZ H;  4U87 A;  2M7B A;  2LTP A;  4P1W A;  3GTM J;  1ETW A;  1WFX A;  5KK1 A;  4KMF A;  4L9J A;  4N4N B;  3QOD A;  2ID6 A;  4M9Z A;  1LNW A;  1B72 A;  4D7N A;  2KJB A;  2M9H A;  4YEL A;  2F5V A;  5DCM A;  3TBI A;  2ESN A;  3JAM K;  5BOX A;  1YRN A;  5HVQ C;  3H9Q A;  3HZJ A;  1WJ5 A;  5FD5 A;  1O7F A;  5EGO A;  2DMN A;  1VZ0 A;  3HSR A;  3JSO A;  3G6E I;  1ETQ A;  3F21 A;  4B48 A;  5AIQ A;  2XV4 S;  2CV0 A;  1UHM A;  5LEK A;  4E70 A;  5D4R A;  3B02 A;  1MMD A;  4LLL A;  5DM6 F;  3TOB A;  3E0J B;  4NQW A;  5EYR A;  2I10 A;  3DBL B;  5DD8 A;  5FKN A;  4BJ6 C;  3HOW J;  3KEO A;  3SQN A;  1GHC A;  3LST A;  1DUX C;  4XKC A;  2ELH A;  4A6D A;  3ULQ B;  2GZW A;  4L9N A;  3K1M A;  2HKO A;  3HSF A;  3W6V A;  1FP2 A;  2BXZ A;  3OMY A;  1QO0 D;  1K79 A;  1R1V A;  3EPZ A;  3BR6 A;  3PQK A;  4F93 B;  3ZMV A;  1D0Z A;  2H6C A;  2NS0 A;  3QYB A;  2XSD C;  3BP8 A;  4LMY A;  1D1C A;  3S8P A;  1SFU A;  1YJN I;  1G2H A;  4KT6 A;  2VQL A;  4IHS A;  2Y30 A;  1MMN A;  4JQF A;  3H92 A;  3IRQ A;  3L7W A;  2XPU A;  1KGS A;  1JT0 A;  3NWS A;  1SMY F;  1S7A A;  3A02 A;  2QUF A;  3R61 A;  3AG1 H;  2HVS A;  5LLQ A;  1PDN C;  3DEU A;  4G7Z F;  4IXA A;  5L3C A;  2A5W A;  5F1J A;  1W36 D;  1B9M A;  2NVQ J;  2GIZ A;  4DYC A;  4R79 A;  2ZJP F;  3D1N I;  4BXU A;  1AOY A;  1FIP A;  2HQ5 A;  2PMZ N;  3DBH B;  2KQR A;  4I02 A;  2KP6 A;  2GXA A;  1YQA A;  1XGN A;  2E5Z A;  1IXC A;  2Y75 A;  2VJ5 A;  4B43 A;  3TQN A;  1JUM A;  1LQ1 A;  1G59 A;  3NAU A;  4KT5 C;  3PO3 J;  3S14 J;  3GTQ J;  2M8E A;  1YS6 A;  3CCR I;  3DEE A;  4J19 A;  2HGC A;  4GFB A;  2IS2 A;  1U5T B;  1ZAR A;  5GTI C;  3KYL A;  4BU2 A;  1TBX A;  3MKW B;  1DGR M;  4HDU A;  5BPD A;  5L3G A;  1PP7 U;  3QYE A;  2XIG A;  1HCR A;  1VND A;  3DU6 A;  2HEO A;  3GBG A;  5K7H A;  3WTV C;  2X48 A;  3CP8 A;  4F92 B;  3E3V A;  2KIQ A;  4BHP A;  2JT1 A;  4S04 A;  1XSX A;  3HHH A;  3HOX J;  4IKF A;  2VIX A;  1IAW A;  1HBX G;  3IL2 A;  2VC0 A;  2QYO A;  3WE3 A;  2VJI A;  1WI9 A;  2P5L C;  2WB1 A;  3OYD A;  2XGD A;  2X6W A;  1MSF C;  4P96 A;  3OR2 C;  4RGU A;  4XBF A;  3BTI A;  1Z67 A;  5BMZ A;  3IV5 A;  1H88 C;  2CW8 A;  4RMN A;  2CWE A;  1GT0 C;  4HNT A;  2IW5 A;  1RET A;  1DPU A;  3RCO A;  3H0D A;  4C2M J;  2HOA A;  3L2C A;  2UUZ A;  5E8I A;  1G6N A;  5LHI A;  1W36 C;  4V2G A;  2B9S A;  2FNA A;  2OQR A;  4RA2 A;  5FLV A;  1YO5 C;  2STT A;  3OIQ A;  2QKM B;  1LE8 B;  2BW3 A;  1MNM C;  4E7I A;  2R7D A;  2LRD A;  4AVP A;  4BS9 A;  2IGN A;  3FHN A;  3L2R A;  2BHZ A;  4MEX F;  3UNG C;  2VL8 A;  4C3J J;  5ILU A;  5HOO A;  5EZH A;  1QU3 A;  1UJ8 A;  2F5E A;  1P4A A;  1L3L A;  1F5T A;  2DDA A;  3LQQ A;  2Y31 A;  3LAP A;  1X2M A;  2OD5 A;  3BRO A;  3NQO A;  3E97 A;  3GFI A;  1ETO A;  1FYK A;  4YRV A;  4AID A;  3H1C A;  4DNC A;  2E7X A;  5CVU A;  2Z33 A;  4A3C J;  3ABK H;  4WCG A;  2L5Q A;  4ZYH A;  4X0G A;  1BJA A;  2HDC A;  1W7P D;  4DBR A;  4FCY A;  2XRL A;  1XD7 A;  5LBQ A;  1YYV A;  2KIM A;  1R7J A;  3PIO F;  4RM3 A;  2RQQ A;  4I98 B;  3BY6 A;  3LSI A;  2DA3 A;  4OIO F;  1I39 A;  2R4G A;  3W6J B;  4PJM A;  4FE7 A;  4LK0 F;  4C30 A;  1SD4 A;  2ZXH A;  3D5S C;  3HHG A;  2F4M B;  3QOE A;  1YS7 A;  3BLY A;  4E7J A;  1U5T A;  1Z91 A;  2A5Y B;  3CC4 I;  3H3V K;  5JLX A;  4UUT A;  1K78 A;  3M3Y J;  1JT6 A;  2CMP A;  2EIN H;  3TGN A;  4HA8 A;  3RPU D;  4ZJZ A;  1A5J A;  1F4K A;  2GLO A;  2P81 A;  2PBI A;  1QRY A;  3JTG A;  2O61 A;  1XX5 A;  3L1P A;  3N4M A;  1U8B A;  1ZRE A;  4M3E A;  2VOO A;  2OJE D;  1OYI A;  1IC8 A;  2F2E A;  1MMA A;  3LSH A;  2R7T A;  1QPI A;  3BPX A;  1XS9 A;  2NXN B;  4Q4Z F;  1YIT I;  3OWT A;  2GA1 A;  3MZ8 A;  4IX7 A;  2WY8 Q;  4JK1 X;  3K0L A;  4YFX F;  3ZXS A;  3J81 Z;  2IGK A;  2XRO A;  2VOD A;  3OYF A;  2OC6 A;  3IAM 2;  4LB5 A;  1QQI A;  2XGX A;  1KQ0 A;  2Y2Z A;  2EZL A;  2EQR A;  4IQJ A;  4BHC A;  4MLO A;  1RNL A;  4ESF A;  2FF4 A;  3SDG A;  2NVT J;  2DA4 A;  4CGZ A;  2LYC A;  1P2F A;  4L9T A;  5GP9 A;  2E35 A;  4UUS A;  1MNE A;  1I6X A;  1BN5 A;  1EH8 A;  1N25 A;  2DOE A;  1BOB A;  2VBW A;  2HZT A;  3OYI A;  2HPI A;  3DKX A;  4N9I A;  4CXF A;  2DBB A;  5FFZ A;  2E2J J;  3DU5 A;  5M5Y J;  1R6R A;  3JRD A;  3F0C A;  2X6Y A;  1VF9 A;  2Q0O A;  1G4D A;  3RSN A;  2IPQ X;  2JA2 A;  1XG1 A;  3A0B C;  1ZQ3 P;  3RQ4 A;  3MZH A;  2EH3 A;  4RAY A;  3T5X A;  4XOP A;  4LB6 B;  4U7D A;  3H3Z A;  1R22 A;  3SFZ A;  5CPR B;  4ZC3 A;  2DXI A;  1UCR A;  2DFE A;  1R58 A;  4HYE A;  5C4J J;  1KZH A;  5IPA A;  2RDP A;  5KAF C;  1BOA A;  5E18 F;  4Y4R A;  4BYY A;  2XAU A;  4II2 A;  2V9V A;  1MBG A;  3N05 A;  2XF6 A;  4UVB A;  1ZEL A;  2RKH A;  5LGT A;  1EV7 A;  4J00 A;  3GZN B;  4B3X A;  3P5J A;  1QBJ A;  2HZD A;  4OMZ A;  4FX0 A;  1P7J A;  3RDI A;  4BQN A;  2F48 A;  4A5N A;  5DCM B;  2W4S A;  2OU2 A;  3WGG A;  1B72 B;  3FK6 A;  1OYY A;  3M07 A;  4HST A;  3Q0U A;  1A36 A;  1JUP A;  2QLZ A;  3SZT A;  3Q3S A;  5HS7 A;  1T39 A;  1KU9 A;  3E5X A;  3CJN A;  1UMQ A;  1MZB A;  1ON2 A;  2JMW A;  1A04 A;  2WAQ A;  2J5O A;  2KZV A;  4EJU A;  4XRF A;  2MGQ A;  1L0O C;  3CLQ A;  3GME A;  3M8F A;  1IN7 A;  1YG2 A;  2VBY A;  3I53 A;  4OMY A;  4KA4 A;  1M1E B;  1BJZ A;  3BTL A;  4BAY A;  2H8W A;  5GAG J;  2QSH X;  5FLM J;  1V3F A;  1U9O A;  2LBF A;  2B63 J;  5H2F C;  1G3T A;  4XRS G;  1S3J A;  2V4J C;  4PFP A;  1FTZ A;  4KIF A;  1MH3 A;  3A1Y A;  4HSR A;  4Y17 A;  3CDI A;  3KP5 A;  4LFU A;  2R7F A;  4XN0 A;  5DM7 F;  3EUH A;  3O8H A;  3GYH X;  2O6G E;  3HSE A;  1MBE A;  4GYG A;  3BR2 A;  3ISP A;  1X1A A;  1BW5 A;  1Y0N A;  2NAZ A;  4L9V A;  4XM3 A;  4AUX A;  1PUF A;  1V5G A;  3FMQ A;  4EJO A;  1K4S A;  1H0M A;  1HDD C;  5LEJ A;  3FDY A;  3FZV A;  4MTD A;  4XQF A;  2JQ7 A;  2E71 A;  3CD6 I;  4XSZ F;  2ZXJ A;  3PNT A;  4NBQ A;  3S2W A;  2CQX A;  3K9T A;  4CO8 A;  4EGZ A;  2CQQ A;  2K7L A;  3MZY A;  3I59 A;  2O9L A;  1MKM A;  3ZQL A;  3FKJ A;  2CV1 A;  2LKX A;  1OLT A;  2OA4 A;  3H5A A;  2O5R A;  5HOD A;  3PSF A;  4M9X A;  2MG4 A;  5HDG A;  3RI4 A;  3A01 B;  2DW4 A;  2K3F A;  2V9P A;  4RB1 A;  4ETS A;  4A3K J;  2XKO A;  3MKY B;  4E7K A;  1HC8 A;  5E3L A;  2JSC A;  3TED A;  2A3S A;  1SVL A;  3M1C A;  4JP0 A;  1S5L C;  1ZR4 A;  4BEH B;  3H35 A;  2OCC H;  5A2Q K;  3HRM A;  2OF7 A;  4XOR A;  4A3D J;  3HGG A;  4EAT A;  3ABL H;  3FXQ A;  2PEX A;  3I9V 2;  4QIW N;  2QSF X;  2DA7 A;  1G8X A;  3CUQ C;  2V1N A;  5F6F A;  2ZXW H;  2NVX J;  1FSH A;  2XGE A;  1RPW A;  3FXU A;  2LY9 A;  1JI8 A;  4P5O A;  2HI3 A;  4RGX A;  4UV8 A;  5K5R A;  1LE8 A;  4XL9 A;  4AIK A;  2QQ9 A;  3IH3 A;  1OMI A;  1R5I D;  1WI3 A;  2BE5 F;  2DMU A;  3NAR A;  2X1C A;  1S72 I;  1XC5 A;  3OS0 A;  3RKY A;  3CC2 I;  1J2X A;  3QP6 A;  2JUC A;  4XLP F;  4O6J A;  1SVO A;  4RS8 A;  2OV7 A;  1OCT C;  5FKL A;  1E0E A;  2GOM A;  1XSV A;  2A61 A;  4B44 A;  1R4N B;  3E1S A;  2NS8 A;  2ACJ A;  1XCV A;  4XNF A;  4HNU A;  3HOT A;  4UVA A;  2E7W A;  4LK1 F;  2VT2 A;  3EUK L;  4DOZ A;  3CLO A;  2QM3 A;  3KZY A;  2KRH A;  4V2F A;  4A5M A;  3ZQQ A;  5LRR A;  2ZME B;  1S29 A;  3ECO A;  4XKV A;  4QSH A;  3EYI A;  3QWL A;  1BIB A;  4GRI A;  4XLC A;  1PVE A;  4N9H A;  2HDD A;  2V6C A;  4JBA A;  1E17 A;  4HX7 A;  2A05 A;  2O0Y A;  3M7G A;  3K6G A;  1FLI A;  2F4O B;  1W0T A;  4CCK A;  3G4S I;  1P9Q C;  2LC2 A;  1P7I A;  3R60 A;  3VYU B;  1QZZ A;  1B1B A;  3W2W A;  4KIS A;  1B59 A;  1FWZ A;  1LDJ A;  4ZDP A;  3C2H A;  5D8L B;  5FLX K;  5FRO A;  1D0X A;  2DT7 B;  3GVA A;  3DBR B;  4UHT A;  3S93 A;  1Z3X A;  3I59 B;  4MEY F;  3HTU A;  2XPV A;  2DPU A;  3G1O A;  3FMR A;  3DKY A;  1I27 A;  4CZC A;  2EIK H;  5LRS A;  1Z0X A;  3DKW A;  1BI1 A;  4L5J A;  1FC3 A;  2L7F P;  3DP7 A;  2R7X A;  1I3A A;  2X6X A;  1LB2 A;  2HTS A;  3CCQ I;  2MA3 A;  3IUO A;  2VPR A;  3KZZ A;  1P4W A;  2ZFU A;  5DTD A;  4IRH A;  3S17 J;  3LNQ A;  2VQH A;  1Y56 A;  1TC3 C;  2EIJ H;  4IRI A;  2DTR A;  2FML A;  1J09 A;  3A4C A;  3DQV C;  1UHW A;  2K27 A;  3O6B B;  3HOV J;  2XF5 A;  2CFX A;  2IA2 A;  2OTJ I;  2L4M A;  4BBR J;  1EF4 A;  3SXY A;  4HOB A;  2QKL B;  2DQL A;  2LBF B;  2GIV A;  4NC7 A;  3MMY B;  4OIQ F;  2L7M P;  2LRE A;  2MSY A;  4BAC A;  4FE4 A;  1SFE A;  1TWA J;  1TLH B;  4F7Z A;  3RYP A;  2KMU A;  4CYD A;  3S15 J;  4XRM A;  1Y8Q B;  1W7P B;  2VKE A;  2KT0 A;  1GDT A;  3CME I;  1BR1 A;  3BJO A;  1NG7 A;  2NS7 A;  3PUB A;  2VAS A;  1APL C;  2KKO A;  2PJR A;  1B4A A;  2JA5 J;  5A2Q Z;  4F3Q A;  3GTJ J;  2PLY A;  1F9N A;  2XAF A;  2EA2 A;  1ON1 A;  2VT3 A;  1CQT A;  5J8F A;  3F22 A;  3COA C;  3MEX A;  2MH2 A;  4HLY A;  1XDS A;  3F8M A;  1SFO J;  4FHT A;  2EV0 A;  2PN6 A;  1XMX A;  5HNF A;  4C3H J;  1B8I B;  2RRE A;  2KIU A;  1JGG A;  2IXS A;  3GFJ A;  3HOZ J;  3VWB A;  4IHY A;  1ETX A;  1KYW A;  3T0Y A;  2RN7 A;  5ICE A;  1J9I A;  1O4X A;  3QRF F;  1LEA A;  4CHU A;  5IT3 A;  1IRX A;  4KN7 X;  2IAI A;  4BE1 A;  3G2B A;  3REO A;  1X4P A;  4KMU X;  4QPO A;  4F91 B;  2OUM A;  3QU3 A;  4BHB A;  2CFO A;  5J1R A;  4PJN A;  2DDB A;  2DFF A;  2P7V B;  2VJJ A;  3F6V A;  5FKM A;  3VFZ A;  1FIA A;  1IGN A;  2DO7 A;  2DOF A;  4ASN A;  4HPQ A;  2DA1 A;  2M0M A;  4RB2 C;  4W97 A;  2DI3 A;  3ABM H;  4X6A J;  3OS2 A;  2CQK A;  2QF7 A;  2F5F A;  4MGR A;  4BBS J;  2EFP A;  2M4G A;  3R0A A;  2VJ4 A;  3G3Z A;  3LMM A;  4UV9 A;  4AYB A;  1XGM A;  3CO7 C;  2EJR A;  5J4V A;  4UXN A;  3OYM A;  1DU0 A;  2WWY A;  2EB7 A;  3EYY A;  1K4T A;  2QWW A;  2NRA C;  3O8G A;  2BBY A;  3HKZ N;  4B09 A;  2FE3 A;  5CYV A;  1TNT A;  1I5Z A;  2R3S A;  2VPL A;  4UB8 C;  2X51 A;  4G6T B;  1RR7 A;  1YE9 A;  1UAA A;  5D8K B;  5LHG A;  1ZGW A;  3SFI A;  2P7C B;  4UY8 I;  3V8J A;  1KQ8 A;  3CDH A;  1WWX A;  3QYF A;  4YFN F;  3X2Q H;  5D5W B;  1ITY A;  2K3P A;  3WU2 C;  2ZJ2 A;  1TT0 A;  1B6A A;  5J1U A;  3GLL A;  2JA8 J;  3ZQC A;  4G8X A;  3JRB A;  3OSG A;  1R4M B;  5TIS C;  3TOA A;  5EEG A;  2WAE A;  5CJ9 A;  1KU2 A;  1WJF A;  3KZI C;  4XON A;  1K78 B;  4IO9 F;  2F4I A;  3HKZ A;  4OWR B;  1S9H A;  1DP3 A;  1EH7 A;  4DZJ A;  4H0E A;  2LY2 A;  2GQQ A;  1U78 A;  2FD5 A;  1TWG J;  1WVR A;  4ZYE A;  1MJ9 A;  1B9N A;  2HYF A;  2VI6 A;  3ERE D;  2CUJ A;  4EM0 B;  1OCR H;  3WGI A;  2E60 A;  3L2V A;  2FBK A;  3DPL C;  1X58 A;  4RDU A;  4XLN F;  2PMU A;  4RAZ A;  1QPM A;  1ETY A;  4JYK A;  1MMS A;  2NNY A;  4I7H A;  2XVC A;  2AQF A;  2ZCW A;  1QVU A;  2HQN A;  1DU6 A;  3MD2 A;  1IXR C;  2IT0 A;  1MJA A;  3WGH A;  1R49 A;  5DEQ A;  2K4J A;  3G71 I;  5IT9 Z;  1TQP A;  2HU9 A;  3EET A;  5E1X A;  1OQY A;  3VEP A;  3F6O A;  3HOS A;  4LG0 A;  2AXL A;  1FZP B;  2NOG A;  4BQA A;  1ZLK A;  3ZQG A;  2PMZ A;  3F3X A;  3DEW A;  2XAS A;  2QGU A;  4XR6 A;  3CCJ I;  1ODD A;  2I5U A;  3MKL A;  1D5Y A;  4RB0 A;  3E6C C;  3GTL J;  4G7O F;  1FY7 A;  4A0Z A;  3QPS A;  1IW7 F;  4ON0 A;  5B3S H;  3HPH A;  4XKB A;  3EUA A;  3OYB A;  1MGT A;  3I0T A;  3HJE A;  3KYD B;  5EF6 A;  1BR2 A;  4EM1 A;  2BY2 A;  3A0H C;  1VI0 A;  1JKP C;  4A3I J;  3LOC A;  1ZG3 A;  1W5T A;  4BL0 B;  5L3F A;  2FBH A;  4Y7N J;  2LG4 A;  3GUD A;  4A3E J;  2A07 F;  5K7F A;  4FET A;  2L4A A;  2QCO A;  1SAU A;  4FTH A;  5CVI A;  1I3Q J;  4OIP F;  2IA1 A;  2EIL H;  2YPR A;  2M7A A;  3BC8 A;  5EG0 B;  2GBY A;  2V6E A;  4N0B A;  2WY7 Q;  2WAF A;  3QOP A;  2IGO A;  2UWM A;  4IHX A;  2ZME C;  3BTJ A;  1D8J A;  1XPX A;  1MW7 A;  3GTK J;  3RQI A;  1IV8 A;  1HW1 A;  2DYR H;  1QZE A;  2MBF A;  3KP3 A;  3T8R A;  3L2W A;  2QSG X;  4BNC A;  4IQ4 A;  3K4N A;  5FKK A;  1Z21 A;  5GAH J;  5F1R A;  4V19 K;  1X19 A;  4M3F A;  3W2V A;  2FJ1 A;  3J7Y J;  4QPQ A;  2DTZ A;  4NNJ A;  3KLN A;  3JRH A;  3DTK A;  4B1R A;  5HLT A;  2LF8 A;  1VQ4 I;  1H8A C;  2Y0S N;  2N8G A;  1Y8R B;  4PDK A;  5F27 A;  3CTA A;  2O8K A;  3BR3 A;  4BGD A;  1B8I A;  3IRR A;  2R7Z J;  2PX9 A;  4AYB N;  2UXN A;  1G3S A;  3TP3 A;  3IWZ A;  2E1M C;  1IRZ A;  4IPA A;  5FJ8 J;  2LNB A;  3WOD F;  3S1N J;  2RAE A;  1TQM A;  1T0F C;  1UG2 A;  4XK4 A;  3W6K B;  2CYY A;  2AQE A;  4D1Q A;  1FNN A;  2O7O A;  4PJ0 C;  4LIU A;  3BQY A;  4EMS A;  2HNH A;  2W25 A;  4E7L A;  1I50 J;  1MD0 A;  3FXL A;  5E8G A;  4HDV A;  1T8I A;  3I4N J;  4LD5 A;  2BEO A;  3ZQH A;  2O03 A;  1IRG A;  1FOY A;  3PL8 A;  2H1L A;  2ZSI B;  3PNV A;  2M3A A;  1BC7 C;  1Y6I A;  1ETV A;  4M9S A;  1JKQ C;  1GV2 A;  4M72 A;  3SYT A;  1E3H A;  3WG7 H;  2BY0 A;  2MH9 A;  3OY9 A;  1FYL A;  3JRF A;  2XB5 A;  1A6Q A;  1HW2 A;  2ZC2 A;  1KU7 A;  4A3G J;  3U2R A;  4B8X A;  1VQO I;  1AA7 A;  4NHJ A;  5GPA A;  3OV8 A;  1C0W A;  5E3O A;  2M87 A;  2XRN A;  3LFU A;  5FKO A;  3U1D A;  1I1S A;  1T08 B;  1HDP A;  1ULY A;  4ANJ A;  4WWC A;  3DLL F;  2XSJ C;  2QQB A;  4BUP A;  4M3G A;  1Y0U A;  5TRD A;  3L00 A;  2JA7 J;  1GVJ A;  4RGS A;  3F23 A;  3FXK A;  4BJT A;  2R5Z A;  2GAU A;  2MC3 A;  1KA8 A;  1V54 H;  2EV5 A;  2ZSH B;  1FEX A;  3L9F A;  1U0J A;  3GZ6 A;  4Z2Y A;  4DIQ A;  1OFC X;  4BXF A;  4HAM A;  2V1X A;  4IVN A;  3HEF A;  5J8C A;  5M5X J;  1Z6T A;  4A2U A;  2LK2 A;  1D0Y A;  3GFL A;  3J7A Y;  1WGX A;  3Q9V A;  4WF2 A;  2X4H A;  3DFG A;  4AC0 A;  3PFY A;  4R8H A;  3ABT A;  2M45 A;  5B1A H;  3OSF A;  4EQQ A;  4JX4 A;  1IUF A;  1P6R A;  2M4K A;  4P55 A;  4A3F J;  2CU7 A;  3BJ6 A;  2M1B A;  1S7O A;  2YS9 A;  2E2I J;  1P4X A;  1TT5 B;  4WX9 A;  3LA3 A;  2OTL I;  2LKS A;  2OZU A;  3LSM A;  3R0J A;  4ENN A;  4PK4 A;  2EFW A;  3WTW C;  3CDL A;  3ZMT A;  4G94 A;  4WK8 F;  2P5K A;  4E7S A;  2D1H A;  5IP9 J;  1YHQ I;  1RKT A;  3NWT A;  3U9G A;  4AU7 A;  1ZG5 A;  2DFI A;  2YU3 A;  5LFA A;  3S1R J;  2EWN A;  3K4J A;  2UV1 A;  1XDU A;  2A6E F;  1H9G A;  3KP2 A;  3CMY A;  4ESJ A;  4LG0 B;  1YX5 A;  2QBY A;  3KEQ A;  4KIB A;  1GLN A;  4O5V A;  4AD9 A;  4M6X A;  3BZ6 A;  3OOU A;  4BH9 A;  5F0F A;  3MFK A;  5DS9 A;  4YG2 F;  1MJB A;  1X3W B;  2CO5 A;  4OU0 A;  2HS5 A;  4LLG F;  3JSP A;  3E7L A;  3W3C A;  2QA4 I;  2BOL A;  2JWT A;  3CUO A;  5E1W A;  4RLQ A;  4BY1 J;  3PNY A;  3WG9 A;  3JCU C;  1HXD A;  3K4K A;  5L3B A;  2NVU B;  1OPC A;  5DUI A;  5FRN A;  3CUQ B;  2JN6 A;  1HQC A;  1HW5 A;  2VUM J;  1SMT A;  3P9C A;  3A01 A;  1UEL B;  2HKX A;  2ISZ A;  3M1E A;  1ZRC A;  3V8L A;  1R1U A;  1OCC H;  2L54 A;  3JAM Z;  1VQ9 I;  2HR3 A;  3BCB A;  3L2U A;  4IHW A;  3K1P A;  4XRS A;  4M6Y A;  1MDM B;  4G12 A;  1IN8 A;  2EV6 A;  2KRF A;  4KIT B;  2COB A;  1ETK A;  1W4M A;  1ONV A;  2XAQ A;  2L02 A;  3GWZ A;  4CZZ A;  3CCU I;  3KLO A;  4KN4 X;  2FSW A;  2KIF A;  1HSJ A;  2WB1 N;  1UB9 A;  2CS3 A;  3K1N A;  1BW6 A;  1H89 C;  2K9Q A;  3C3W A;  3NEU A;  3OL4 A;  4I6Z A;  1XMA A;  2DFH A;  1W1W E;  2PQ8 A;  1T33 A;  4CUG A;  4ZYD A;  3K2A A;  2E1M B;  3FIS A;  4CDG A;  1N77 A;  5H20 A;  2QBY B;  2JRT A;  3DV8 A;  1MH4 A;  3VOD A;  4CCL A;  3WHC A;  4C2T A;  1MBH A;  2FXA A;  3FMS A;  4HW0 A;  1K83 J;  3GEZ A;  2XB0 X;  3T1B A;  2VQG A;  1N78 A;  4IHV A;  1T2K A;  4U0W A;  2XPW A;  3LL7 A;  1F1Z A;  2X9D A;  3KIO A;  2JUG A;  4I09 A;  4UVC A;  1FYM A;  4EVI A;  3RKQ A;  1X1P A;  3TP0 A;  2Q2E B;  3AL0 B;  2ZFW A;  1R5G A;  2BYV E;  2KDO A;  2YX7 A;  2CW0 F;  4XMY A;  1XSD A;  2RV8 A;  2L7K A;  5E20 A;  1QHH D;  4BJ5 C;  2VE8 A;  2JSP A;  2CSO A;  5F0C A;  1W5C C;  4YII A;  3VSL A;  4AIH A;  4X1E A;  3HL2 A;  1XMK A;  2DOA A;  5E1Z B;  1XGS A;  1VQ8 I;  2BZT A;  1ZYR F;  4GXO A;  2LH9 A;  4FT8 A;  2FMY A;  2EFO A;  2RQP A;  4Q5S F;  1WHU A;  3HC7 A;  3FBN B;  4AIJ A;  3TMO A;  2D1V A;  3VOE A;  2IJL A;  2ISY A;  1TP4 A;  1F36 A;  1X3U A;  2OAZ A;  2XAG A;  2E19 A;  1WKM A;  2DT6 A;  2W1O A;  4II3 A;  3U21 A;  3ZRG A;  1U8R A;  4LG3 A;  1IN5 A;  2MD0 A;  2P6T A;  3J80 Z;  4E7H A;  2KZG A;  1QA6 A;  4Q47 A;  3Q0V A;  2GXB A;  3I55 I;  2D45 A;  3QP5 A;  1UHS A;  2NVY J;  4IOC F;  4DYQ A;  4QTR A;  3PO2 J;  1E3P A;  2EFN A;  2V7F A;  4G6Q A;  1PP8 F;  2GXG A;  4CYC B;  4CH7 A;  2FUG 2;  3DTE A;  5JR3 A;  5J47 A;  2GOX B;  3AKZ A;  1RUN A;  4A6E A;  3OYJ A;  2V26 A;  2R0Q C;  5C44 J;  2Z1D A;  3B6A A;  5EJC A;  3JRC A;  2MC4 A;  2BGC A;  5HDN A;  4WXD A;  5C3E J;  3GZ5 A;  3RKW A;  1VQ5 I;  3GTP J;  3HUG B;  4KIG A;  1ORK A;  5EEH A;  3CMM A;  3VYR B;  5JHF A;  1A31 A;  3PFI A;  4Y15 A;  3IAS 2;  4Y52 J;  1SD6 A;  1OR7 C;  3CZ6 A;  3UR3 C;  3J81 K;  2DK5 A;  3WHB A;  2K9M A;  2BY3 A;  1Z3Y A;  3S1M J;  2EZI A;  1ZG1 A;  2DMT A;  3C2B A;  1RZ4 A;  4GYI A;  4NB5 A;  2H94 A;  2K9N A;  5IOY A;  3S1Q J;  3ECH A;  1WZ2 A;  1BI0 A;  2E34 A;  1XN7 A;  3P9K A;  4P9F A;  4OOI A;  3DCF A;  1Z7L A;  1ZKG A;  2FBI A;  4A0Y A;  3HUG A;  2QQ8 A;  4QLC U;  2QVO A;  1SAX A;  1JXS A;  2HVR A;  2LFB A;  4CA0 A;  3OIP A;  1TNS A;  5M3F J;  3FXR A;  3G73 A;  3EQL F;  3C2G A;  2RVC A;  4B3A A;  2ID3 A;  1Y1W J;  3VPR A;  3ZP5 A;  1IJW C;  4S0H B;  3I54 A;  2BVM A;  3K70 D;  3PM1 A;  3GX4 X;  2MD5 A;  3KPH A;  3C18 A;  3GCM A;  5LGN A;  2DMP A;  5CVV A;  1XGO A;  1GUU A;  5JHU A;  1QNT A;  2Y9Z A;  1QGP A;  2LKP A;  3RPQ A;  1R36 A;  1HOM A;  1SFK A;  5HS8 A;  2HOS A;  5F0H A;  3GXO A;  5K7Z A;  2HQR A;  1USS A;  1XCB A;  2D5V A;  2DCE A;  3JRI A;  1JKO C;  1G3Y A;  3OYA A;  3HGY A;  3ZQI A;  1W5S A;  4EJV A;  2MLG A;  1ZGA A;  4RAF A;  4BE0 A;  3IC7 A;  3VDX A;  4PJL A;  2Y0M A;  1IO2 A;  1S8N A;  2P5V A;  3S32 A;  1I6H J;  2R92 J;  4D0P A;  3D0S A;  2H6B A;  2WV1 A;  2L0K A;  1Q1V A;  2CV2 A;  1BIA A;  4DJA A;  3PIP F;  1FPQ A;  4A3B J;  2PMH A;  4MTE A;  3ESW B;  3DPT A;  3O3K A;  1HKS A;  2H8R A;  2KRC A;  3R6S A;  2W7N A;  3K69 A;  5ED4 A;  4CCN A;  1R9T J;  5E3M A;  1IXS B;  1FT9 A;  1LUJ B;  1TWF J;  2R7O A;  2AO9 A;  3V8K A;  1WQ2 A;  4M3D A;  3HOY J;  4BE2 A;  4PSX A;  3EDP A;  1X2N A;  1ZHF A;  2CG4 A;  3GO5 A;  2PI0 A;  1KYZ A;  4LIT A;  4HX4 A;  2P4W A;  5AON A;  3M8E A;  4RBO A;  3BG9 A;  2R93 J;  2JJ7 A;  3BDD A;  5E17 F;  3Q9S A;  4HZF A;  5CQG A;  1IDZ A;  1OYW A;  1T95 A;  2MW8 A;  1KU3 A;  1UZC A;  4HEA 2;  2JRM A;  1U2W A;  4M73 A;  3ZGK A;  3OYC A;  2FX0 A;  3K4M A;  3FK7 A;  4A3L J;  2UXX A;  4DQ2 A;  1VFC A;  1HF0 A;  3DTI A;  1Z9C A;  4DBQ A;  1IF1 A;  2XDV A;  1Z6R A;  1YW8 A;  2HDW A;  4KYW A;  3HRT A;  3GLX A;  1JKR C;  3DXJ F;  3JRG A;  3H0G J;  1T6S A;  4DZP A;  1HKT A;  2WA0 A;  5EZG A;  5EDN A;  2EIM H;  2FNP A;  3C7J A;  1N75 A;  3GW2 A;  4A3M J;  3E6B A;  1K7A A;  2GM4 A;  2IS1 A;  3J7Z I;  2ZJR F;  5BS6 A;  4PFO A;  1MBF A;  2Y0S A;  4U0V A;  3MQ0 A;  3R4K A;  4HLX A;  4L5I A;  2VLA A;  3FM3 A;  1RKW A;  1LVA A;  1U5T C;  1BL0 A;  3ZR8 X;  2W57 A;  3ASN H;  2LF7 A;  3K2Z A;  4EJT A;  3MCZ A;  4H4K C;  1YX3 A;  2IEK A;  4DW6 A;  2BV6 A;  5GTH C;  5TJJ A;  5ERI A;  3CUQ A;  1R71 A;  2V1U A;  2MYS A;  2KPM A;  2GA2 A;  4DGW B;  1FP1 D;  2X6O A;  4U7B A;  2L9N A;  1PUF B;  2AXT C;  3F8F A;  2FOW A;  2HXO A;  3S2H J;  2VKV A;  5CKT A;  1O57 A;  4MFD A;  1JTY A;  2P8T A;  3KP7 A;  3P9I A;  3CCL I;  3Q0W A;  2ZNZ A;  3BQZ A;  5DUK A;  5C4X J;  4M3B A;  2DJI A;  3HTS B;  2PFB A;  3MVP A;  4U0Y A;  4A12 A;  1BI3 A;  5K5Q A;  1LPQ A;  2JA6 J;  2TRT A;  2LLK A;  3SEQ A;  3BG6 A;  3CJR B;  5GAD J;  2DYS H;  2E1C A;  4D7M A;  3FX3 A;  2IRF G;  3QAH A;  4ENM A;  5ICG A;  1HKQ A;  3QPT A;  2HXI A;  2WV0 A;  3VYS B;  2LDU A;  1WJC A;  3I71 A;  4K2E A;  3VYT B;  1DQU A;  5CLS A;  3TKY A;  1WPK A;  1FX7 A;  3FWE A;  3CCS I;  1Z05 A;  1SD5 A;  4I0B A;  1G3W A;  4BXX J;  1QZY A;  3DLA A;  3GFM A;  1OIS A;  1S7E A;  2WTE A;  3I3L A;  4D9J A;  4ZTJ A;  2GWR A;  5AIP A;  2JVH A;  4PGH A;  3KET A;  4HBL A;  4JX5 A;  2FA5 A;  2P6S A;  2QZ8 A;  5EGO B;  3CQZ J;  2ME0 A;  3TDZ C;  2JZY A;  2IS4 A;  2NOJ B;  2ECC A;  3FXM A;  3ML6 A;  4FQG A;  3MN2 A;  4XLA A;  2QQA A;  2ELK A;  3A03 A;  3I58 A;  4XSX F;  5ILS A;  2IVM A;  4G6D A;  5FLX Z;  1AKH A;  1CGP A;  2XKP A;  4ZH4 F;  1MBJ A;  2CH0 A; 
#chains in the Genus database with same CATH homology
 5LHH A;  3OOP A;  5L3E A;  1E2X A;  3B73 A;  5CVJ A;  3ZPL A;  5LGU A;  1REP C;  2H27 A;  2AS5 F;  4R1H A;  3ZMU A;  4A0X A;  4OIN F;  2V79 A;  1O3S A;  2MLK A;  5HS9 A;  1WSU A;  1CF7 B;  4MQ9 F;  2FQ3 A;  4O3M A;  3C1D A;  5FFX A;  2IP2 A;  4ENK A;  1SD7 A;  1J0R A;  4IRG A;  1KQ9 A;  1TQI A;  2K86 A;  3IWF A;  4WXH A;  3ZMZ A;  1ZRF A;  4HF0 A;  4IF4 A;  4UUV A;  1BI2 A;  1TW2 A;  1PUE E;  4I0A A;  5ILV A;  4Q48 A;  4LLN A;  5IT9 K;  3BJA A;  3HYI A;  2YR2 A;  4M71 A;  2XAJ A;  5D5U B;  1ZGJ A;  3FF5 A;  2XHK A;  5L3D A;  2V1D A;  1JE8 A;  5BQT A;  3V7S A;  4HF2 A;  5H6Q A;  4PCQ A;  4HV5 A;  1BC8 C;  1T38 A;  2ZME A;  5F64 A;  3M9A A;  2H09 A;  5FB2 A;  2DQR A;  4ZZL A;  6PAX A;  4ESB A;  4OIR F;  3E6D A;  1EH6 A;  3O2P E;  3WU0 A;  3LWF A;  2Y48 A;  1T98 A;  4MNU A;  4HV6 A;  5D4S A;  1YLF A;  3LAJ A;  2B0L A;  2WC2 A;  5DYM A;  1XB4 A;  4L0Y B;  5K1Y A;  1YTY A;  3I5U A;  1FBU A;  4KNY A;  2A69 F;  4HF1 A;  2STW A;  5DV5 A;  4GCV A;  1YIO A;  4KFC A;  3E6M A;  3DF8 A;  5JI6 A;  1O3Q A;  1J5Y A;  1S6L A;  2L01 A;  2Z9O A;  2M5W A;  3ZMD A;  1JGS A;  2Z99 A;  1BM9 A;  4GO1 A;  3GF2 A;  1R5H A;  4HQE A;  3WE2 A;  2EFQ A;  2VC1 A;  1DPR A;  2DK8 A;  2HWV A;  2YX4 A;  1U3E M;  4I2O A;  2JPC A;  5DCF A;  2K4B A;  4MQV A;  2VBZ A;  2K02 A;  4WXC A;  2Z3Y A;  5CVR A;  4MHG A;  1Q1H A;  1ZH5 A;  4KDP A;  3RKX A;  3KP4 A;  4EM2 A;  4LJZ F;  3TO7 A;  1Z1D A;  3I64 A;  5D5V B;  5HDK A;  2ZBK A;  1DP7 P;  4KUM A;  2KJC A;  2VXZ A;  3WTZ A;  3F8N A;  1ZAO A;  5FO5 A;  2DLL A;  1J75 A;  3FHZ A;  3WTS C;  1AWC A;  3FM5 A;  2FOK A;  3KE2 A;  1R00 A;  4EV0 A;  4ENJ A;  4IHT A;  2OZ6 A;  4FX4 A;  4YFK F;  3WU1 B;  2W85 A;  1UFM A;  2VBX A;  1ZLJ A;  1HST A;  2F5C A;  3HRS A;  2NYX A;  4GGG A;  3NRV A;  2CGP A;  4EJW A;  4I01 A;  3MAJ A;  3ELK A;  3RJP A;  1D8K A;  3WTT C;  2VE9 A;  2JPB A;  2DAO A;  2FRH A;  2F5D A;  2DT5 A;  3ZN0 A;  3TDU C;  2EA4 A;  1STZ A;  3H3U A;  5ICC A;  5D6E A;  1RUO A;  1ZRD A;  4HX8 A;  4L0Z B;  4EGY A;  3V4G A;  1IRF A;  5D5X B;  1DDN A;  2OBP A;  2O3F A;  3TO9 A;  1LDK B;  1D5V A;  4IJA A;  2X0L A;  5HLG A;  1YW9 A;  3VB2 A;  4ZZD A;  1TW3 A;  1W7P A;  1FSE A;  3CO6 C;  3F72 A;  1SFX A;  5BPI A;  1JHF A;  2LSO A;  2HYG D;  3RYR A;  2UZK A;  1D3Y A;  3WTX C;  3QU6 A;  1LEB A;  1T0F A;  2JTV A;  3HRU A;  3ROU A;  2IA0 A;  3D5L A;  3BWG A;  2ZNY A;  1IUY A;  3P7N A;  1R1T A;  2TDX A;  1O3T A;  2ZO4 A;  1U6G A;  3E5Q A;  1IZ1 A;  3ABU A;  3AAF A;  3IHU A;  3I4P A;  1RIO H;  1YW7 A;  5K5O A;  4CIC A;  3JTH A;  4RGR A;  1JHH A;  3ZQ7 A;  4RB3 C;  3IKV A;  1GXQ A;  3F8B A;  3L09 A;  3LA2 A;  2NNN A;  2W24 A;  3LFK A;  2ADU A;  2L3D A;  5DD4 A;  4G9Y A;  4L18 B;  1V4R A;  1RI7 A;  4S05 A;  2ZKZ A;  2A68 F;  3V7C A;  2G7U A;  3TO6 A;  4G7H F;  2COM A;  1R23 A;  2RGV A;  1ZN2 A;  2PG4 A;  3KFW X;  4ZYG A;  4M74 A;  2VOP A;  1YFH A;  3PQJ A;  3N97 A;  2XUB A;  3KP6 A;  4P9U A;  3JW4 A;  1FOK A;  1LJ9 A;  3RTR A;  2Q2E A;  1J7K A;  2HTJ A;  2DPD A;  1BBY A;  5ICF A;  1UST A;  2DU9 A;  5JVT A;  2D2W A;  5D6F A;  3ZN1 A;  1TTY A;  4HQM A;  5FGM A;  4TV7 A;  1H9T A;  3QPH A;  2YSR A;  2VN2 A;  3T8T A;  1J59 A;  5H6R A;  4YIF A;  5FD6 A;  3WTY C;  2G7H A;  3LA7 A;  4PGG A;  3BPV A;  1O7L A;  3F8C A;  2FU4 A;  2E1N A;  1MDM A;  3SHF A;  4U88 A;  2Z5U A;  4UNO A;  1FBS A;  2RNJ A;  3Q5F A;  3HIF A;  3IKT A;  3MWM A;  1NHA A;  2M30 A;  5HLH A;  5HLI A;  1O3R A;  4PZJ A;  3LQR A;  1Z7U A;  1FBQ A;  3RIR A;  2ETH A;  1P92 A;  2G9W A;  2EK5 A;  3E5U A;  2VON A;  2Q8K A;  2A6H F;  4AWX B;  1LDD A;  1VTN C;  2PJP A;  1IN6 A;  2XAH A;  3ZMS A;  4LGW A;  2O8X A;  1GXP A;  2FEZ A;  1OKR A;  5J6X A;  2HFH A;  2QEN A;  2RC4 A;  3J80 K;  3WTU C;  2W84 A;  1CF7 A;  2ESH A;  4Y13 A;  2C6Y A;  1IN4 A;  2OQG A;  3J7A O;  2HOE A;  3V7R A;  4QWQ A;  5KVR A;  1I1G A;  3BOQ A;  5DDG A;  3RPU A;  1OR7 A;  1K6O A;  1WRJ A;  3KCC A;  4KIC A;  2J5P A;  5JFR A;  3SZP A;  5KK1 A;  4KMF A;  4L9J A;  4M9Z A;  1LNW A;  2KJB A;  5DCM A;  2ESN A;  3JAM K;  5BOX A;  5HVQ C;  5FD5 A;  1O7F A;  3JSO A;  3HSR A;  3F21 A;  5AIQ A;  2XV4 S;  1UHM A;  5LEK A;  4E70 A;  5D4R A;  3B02 A;  4LLL A;  3TOB A;  4NQW A;  5DD8 A;  3KEO A;  3SQN A;  1GHC A;  3LST A;  1DUX C;  2ELH A;  4A6D A;  3ULQ B;  2GZW A;  4L9N A;  3K1M A;  2HKO A;  3HSF A;  1FP2 A;  1QO0 D;  1K79 A;  1R1V A;  3PQK A;  3ZMV A;  2H6C A;  2NS0 A;  3BP8 A;  4LMY A;  1SFU A;  4IHS A;  4JQF A;  3H92 A;  3IRQ A;  3L7W A;  1KGS A;  1SMY F;  1S7A A;  2QUF A;  3R61 A;  5LLQ A;  1PDN C;  3DEU A;  4G7Z F;  4IXA A;  5L3C A;  1B9M A;  4R79 A;  4BXU A;  1AOY A;  4I02 A;  1YQA A;  1XGN A;  1IXC A;  2Y75 A;  3TQN A;  1LQ1 A;  4KT5 C;  2M8E A;  1YS6 A;  2HGC A;  1U5T B;  1ZAR A;  1TBX A;  4HDU A;  5BPD A;  5L3G A;  1PP7 U;  2XIG A;  2HEO A;  3WTV C;  3E3V A;  4BHP A;  2JT1 A;  4S04 A;  1XSX A;  3HHH A;  1IAW A;  1HBX G;  3IL2 A;  2VC0 A;  2QYO A;  3WE3 A;  1WI9 A;  2P5L C;  4P96 A;  4RGU A;  4XBF A;  5BMZ A;  2CWE A;  2IW5 A;  1DPU A;  3L2C A;  5E8I A;  1G6N A;  5LHI A;  2FNA A;  2OQR A;  1YO5 C;  2STT A;  2R7D A;  4AVP A;  4MEX F;  5ILU A;  5HOO A;  2F5E A;  1P4A A;  1L3L A;  1F5T A;  3LQQ A;  3LAP A;  2OD5 A;  3BRO A;  3NQO A;  3E97 A;  3GFI A;  1FYK A;  4DNC A;  2E7X A;  5CVU A;  2Z33 A;  4WCG A;  4ZYH A;  1BJA A;  2HDC A;  1W7P D;  1XD7 A;  5LBQ A;  1YYV A;  2KIM A;  1R7J A;  4I98 B;  3BY6 A;  4OIO F;  3W6J B;  4LK0 F;  1SD4 A;  3HHG A;  1YS7 A;  1U5T A;  1Z91 A;  2A5Y B;  1K78 A;  3TGN A;  4HA8 A;  1F4K A;  2PBI A;  2O61 A;  3JTG A;  3N4M A;  1ZRE A;  2VOO A;  1OYI A;  2F2E A;  3BPX A;  4Q4Z F;  2GA1 A;  4JK1 X;  3K0L A;  4YFX F;  3J81 Z;  2XRO A;  2VOD A;  4LB5 A;  1QQI A;  2XGX A;  1KQ0 A;  4BHC A;  1RNL A;  4ESF A;  2FF4 A;  4CGZ A;  1P2F A;  4L9T A;  1I6X A;  1BN5 A;  1EH8 A;  2VBW A;  2HZT A;  4N9I A;  4CXF A;  2DBB A;  5FFZ A;  2Q0O A;  1G4D A;  2IPQ X;  3MZH A;  4RAY A;  3T5X A;  4LB6 B;  4U7D A;  3H3Z A;  1R22 A;  3SFZ A;  1UCR A;  1R58 A;  4HYE A;  2RDP A;  1BOA A;  5E18 F;  4BYY A;  2V9V A;  5LGT A;  4UVB A;  2RKH A;  1EV7 A;  1QBJ A;  4OMZ A;  4FX0 A;  3RDI A;  4A5N A;  5DCM B;  2OU2 A;  3WGG A;  1OYY A;  2QLZ A;  3SZT A;  5HS7 A;  1T39 A;  1KU9 A;  3E5X A;  3CJN A;  1MZB A;  1ON2 A;  1A04 A;  2J5O A;  4EJU A;  4XRF A;  1L0O C;  3M8F A;  1IN7 A;  1YG2 A;  2VBY A;  3I53 A;  4OMY A;  4KA4 A;  4BAY A;  1V3F A;  1G3T A;  1S3J A;  4KIF A;  4Y17 A;  3KP5 A;  4LFU A;  2R7F A;  3EUH A;  3GYH X;  2O6G E;  3HSE A;  4GYG A;  3ISP A;  2NAZ A;  4L9V A;  1H0M A;  3FMQ A;  4EJO A;  5LEJ A;  3FZV A;  4MTD A;  4XSZ F;  2ZXJ A;  3S2W A;  4CO8 A;  3K9T A;  4EGZ A;  2K7L A;  3MZY A;  3I59 A;  1MKM A;  2OA4 A;  4M9X A;  5HDG A;  3RI4 A;  2DW4 A;  4RB1 A;  4ETS A;  2XKO A;  2JSC A;  2A3S A;  5A2Q K;  3HRM A;  3FXQ A;  2PEX A;  3CUQ C;  5F6F A;  1FSH A;  3FXU A;  4P5O A;  4RGX A;  4UV8 A;  5K5R A;  4AIK A;  2QQ9 A;  1OMI A;  2BE5 F;  3RKY A;  1J2X A;  3QP6 A;  4XLP F;  4O6J A;  4RS8 A;  1XSV A;  2A61 A;  2ACJ A;  1XCV A;  3HOT A;  4UVA A;  2E7W A;  4LK1 F;  2VT2 A;  3CLO A;  2QM3 A;  3KZY A;  4A5M A;  5LRR A;  2ZME B;  1S29 A;  3ECO A;  3EYI A;  1BIB A;  4N9H A;  2V6C A;  4JBA A;  1E17 A;  4HX7 A;  2O0Y A;  3M7G A;  1FLI A;  3R60 A;  1QZZ A;  1B1B A;  1B59 A;  1LDJ A;  1FWZ A;  5D8L B;  5FLX K;  3GVA A;  4UHT A;  3I59 B;  4MEY F;  3HTU A;  2DPU A;  3FMR A;  1I27 A;  5LRS A;  3DKW A;  1BI1 A;  4L5J A;  1FC3 A;  3DP7 A;  1LB2 A;  2HTS A;  2MA3 A;  3KZZ A;  1P4W A;  4IRH A;  4IRI A;  2DTR A;  2FML A;  3DQV C;  1UHW A;  2K27 A;  3O6B B;  2CFX A;  2IA2 A;  2L4M A;  3SXY A;  4HOB A;  2DQL A;  2GIV A;  4OIQ F;  4F7Z A;  1SFE A;  1TLH B;  3RYP A;  4CYD A;  1W7P B;  3BJO A;  2KKO A;  1B4A A;  5A2Q Z;  2PLY A;  1F9N A;  2XAF A;  2EA2 A;  1ON1 A;  2VT3 A;  5J8F A;  3F22 A;  3COA C;  3MEX A;  2MH2 A;  4HLY A;  1XDS A;  3F8M A;  4FHT A;  2EV0 A;  2PN6 A;  2KIU A;  3GFJ A;  1KYW A;  3T0Y A;  2RN7 A;  5ICE A;  1J9I A;  3QRF F;  1LEA A;  4CHU A;  5IT3 A;  4KN7 X;  3REO A;  4KMU X;  3QU3 A;  4BHB A;  2P7V B;  3VFZ A;  3F6V A;  2DO7 A;  4ASN A;  4RB2 C;  2DI3 A;  2CQK A;  2F5F A;  4MGR A;  2EFP A;  3R0A A;  3G3Z A;  4UV9 A;  1XGM A;  3CO7 C;  2EJR A;  4UXN A;  2WWY A;  2EB7 A;  3EYY A;  2QWW A;  2NRA C;  2BBY A;  4B09 A;  2FE3 A;  5CYV A;  1TNT A;  1I5Z A;  2R3S A;  5D8K B;  5LHG A;  2P7C B;  3V8J A;  1KQ8 A;  3CDH A;  1WWX A;  4YFN F;  5D5W B;  2ZJ2 A;  1B6A A;  4G8X A;  3TOA A;  5EEG A;  5CJ9 A;  1KU2 A;  1K78 B;  1EH7 A;  4H0E A;  2GQQ A;  1U78 A;  4ZYE A;  1MJ9 A;  1B9N A;  2HYF A;  3ERE D;  4EM0 B;  3WGI A;  2FBK A;  3DPL C;  4XLN F;  2PMU A;  4RAZ A;  1QPM A;  2NNY A;  4I7H A;  2XVC A;  2ZCW A;  2HQN A;  1IXR C;  2IT0 A;  1MJA A;  3WGH A;  5DEQ A;  2K4J A;  5IT9 Z;  1TQP A;  3EET A;  5E1X A;  3VEP A;  3F6O A;  3HOS A;  4LG0 A;  2AXL A;  1FZP B;  4BQA A;  1ZLK A;  3F3X A;  2XAS A;  1ODD A;  4RB0 A;  3E6C C;  4G7O F;  1FY7 A;  4A0Z A;  1IW7 F;  4ON0 A;  1MGT A;  3I0T A;  4EM1 A;  1ZG3 A;  1W5T A;  5L3F A;  2FBH A;  3GUD A;  2A07 F;  2L4A A;  5CVI A;  4OIP F;  2IA1 A;  2YPR A;  4N0B A;  3QOP A;  2UWM A;  1D8J A;  3KP3 A;  1HW1 A;  2MBF A;  3T8R A;  4BNC A;  5F1R A;  3KLN A;  2LF8 A;  4PDK A;  3CTA A;  3IRR A;  2UXN A;  1G3S A;  3IWZ A;  4IPA A;  2LNB A;  3WOD F;  1TQM A;  3W6K B;  2CYY A;  1FNN A;  4EMS A;  2W25 A;  1MD0 A;  5E8G A;  4HDV A;  4LD5 A;  2BEO A;  2O03 A;  1IRG A;  1BC7 C;  4M9S A;  4M72 A;  2MH9 A;  1FYL A;  1HW2 A;  1KU7 A;  3U2R A;  4B8X A;  4NHJ A;  3OV8 A;  1C0W A;  2M87 A;  2XRN A;  3U1D A;  1I1S A;  4WWC A;  1ULY A;  2QQB A;  1Y0U A;  5TRD A;  3L00 A;  1GVJ A;  4RGS A;  3F23 A;  2GAU A;  2MC3 A;  1KA8 A;  2EV5 A;  3L9F A;  3GZ6 A;  4Z2Y A;  4HAM A;  2V1X A;  4IVN A;  5J8C A;  1Z6T A;  4A2U A;  3GFL A;  3Q9V A;  4WF2 A;  2X4H A;  3DFG A;  4R8H A;  3ABT A;  2M45 A;  4EQQ A;  1P6R A;  4P55 A;  3BJ6 A;  2M1B A;  1S7O A;  1P4X A;  4WX9 A;  3LA3 A;  2OZU A;  3R0J A;  4ENN A;  2EFW A;  3WTW C;  3ZMT A;  4G94 A;  4WK8 F;  2P5K A;  2D1H A;  3U9G A;  1ZG5 A;  2DFI A;  2YU3 A;  2EWN A;  1XDU A;  2A6E F;  1H9G A;  3KP2 A;  4ESJ A;  4LG0 B;  2QBY A;  3KEQ A;  4KIB A;  4O5V A;  4AD9 A;  4M6X A;  3BZ6 A;  4BH9 A;  3MFK A;  4YG2 F;  1MJB A;  2CO5 A;  4OU0 A;  2HS5 A;  4LLG F;  3JSP A;  3CUO A;  5E1W A;  3WG9 A;  1HXD A;  5L3B A;  5DUI A;  1OPC A;  3CUQ B;  1HQC A;  1HW5 A;  1SMT A;  3P9C A;  2HKX A;  2ISZ A;  3M1E A;  1ZRC A;  3V8L A;  1R1U A;  2L54 A;  3JAM Z;  2HR3 A;  3K1P A;  4M6Y A;  1MDM B;  1IN8 A;  2EV6 A;  2KRF A;  1W4M A;  1ONV A;  2XAQ A;  2L02 A;  3GWZ A;  4CZZ A;  3KLO A;  4KN4 X;  2FSW A;  2KIF A;  1HSJ A;  1UB9 A;  3K1N A;  3C3W A;  3NEU A;  1XMA A;  2PQ8 A;  4ZYD A;  4CDG A;  5H20 A;  2QBY B;  2JRT A;  3DV8 A;  3VOD A;  2FXA A;  3FMS A;  4HW0 A;  3GEZ A;  3T1B A;  1T2K A;  4U0W A;  1F1Z A;  4I09 A;  4UVC A;  1FYM A;  4EVI A;  2ZFW A;  1R5G A;  2BYV E;  2YX7 A;  2CW0 F;  1XSD A;  2RV8 A;  5E20 A;  2VE8 A;  2CSO A;  4YII A;  4AIH A;  1XMK A;  5E1Z B;  1XGS A;  4GXO A;  1ZYR F;  4FT8 A;  2FMY A;  2EFO A;  2RQP A;  4Q5S F;  4AIJ A;  2D1V A;  3VOE A;  2IJL A;  2ISY A;  1X3U A;  2OAZ A;  2XAG A;  1WKM A;  1U8R A;  1IN5 A;  2P6T A;  3J80 Z;  4Q47 A;  2GXB A;  2D45 A;  3QP5 A;  2EFN A;  4G6Q A;  1PP8 F;  2GXG A;  5JR3 A;  1RUN A;  4A6E A;  2BGC A;  5HDN A;  4WXD A;  3GZ5 A;  3RKW A;  4KIG A;  5EEH A;  3PFI A;  4Y15 A;  1SD6 A;  3J81 K;  2DK5 A;  1ZG1 A;  1RZ4 A;  4GYI A;  4NB5 A;  2H94 A;  3ECH A;  1BI0 A;  1XN7 A;  3P9K A;  4P9F A;  4OOI A;  4A0Y A;  2FBI A;  3HUG A;  4QLC U;  2QVO A;  1SAX A;  1JXS A;  1TNS A;  3FXR A;  3G73 A;  3EQL F;  2RVC A;  3ZP5 A;  3I54 A;  3GX4 X;  2MD5 A;  3C18 A;  5LGN A;  5CVV A;  1XGO A;  5JHU A;  1QNT A;  1QGP A;  2LKP A;  3RPQ A;  1R36 A;  5HS8 A;  3GXO A;  2HQR A;  1USS A;  1XCB A;  1G3Y A;  1W5S A;  4EJV A;  2MLG A;  1ZGA A;  3IC7 A;  2Y0M A;  1S8N A;  2P5V A;  4D0P A;  3D0S A;  2H6B A;  1BIA A;  1FPQ A;  2PMH A;  4MTE A;  3DPT A;  3O3K A;  1HKS A;  3R6S A;  3K69 A;  5ED4 A;  1IXS B;  1FT9 A;  3V8K A;  1WQ2 A;  3EDP A;  3GO5 A;  1ZHF A;  2CG4 A;  2PI0 A;  1KYZ A;  4HX4 A;  2P4W A;  5AON A;  3M8E A;  3BDD A;  5E17 F;  3Q9S A;  4HZF A;  1OYW A;  1KU3 A;  1U2W A;  4M73 A;  2UXX A;  4DQ2 A;  1Z9C A;  1IF1 A;  1Z6R A;  1YW8 A;  4KYW A;  3GLX A;  3HRT A;  3DXJ F;  1T6S A;  1HKT A;  2FNP A;  3C7J A;  3GW2 A;  1K7A A;  3E6B A;  5BS6 A;  4U0V A;  3MQ0 A;  3R4K A;  4HLX A;  4L5I A;  3FM3 A;  1LVA A;  1U5T C;  2W57 A;  3K2Z A;  2LF7 A;  4EJT A;  3MCZ A;  2BV6 A;  5TJJ A;  5ERI A;  3CUQ A;  2V1U A;  2GA2 A;  1FP1 D;  4U7B A;  3F8F A;  1O57 A;  2P8T A;  3KP7 A;  3P9I A;  2ZNZ A;  5DUK A;  3HTS B;  2PFB A;  4U0Y A;  4A12 A;  1BI3 A;  5K5Q A;  2E1C A;  3FX3 A;  2IRF G;  3QAH A;  4ENM A;  5ICG A;  1HKQ A;  3QPT A;  2WV0 A;  2LDU A;  3I71 A;  4K2E A;  5CLS A;  3TKY A;  1FX7 A;  3FWE A;  1Z05 A;  1SD5 A;  4I0B A;  1G3W A;  1QZY A;  3GFM A;  2WTE A;  2GWR A;  5AIP A;  3KET A;  4PGH A;  4HBL A;  2FA5 A;  2P6S A;  2QZ8 A;  3TDZ C;  2JZY A;  3ML6 A;  2QQA A;  3I58 A;  4XSX F;  5ILS A;  5FLX Z;  1CGP A;  2IVM A;  4G6D A;  2XKP A;  4ZH4 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...