2M5WA

Nmr solution structure of the la motif (n-terminal domain, ntd) of dictyostelium discoideum la protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
91
structure length
91
Chain Sequence
MSEETSTQILKQVEYYFSDSNFPRDKFLRSEAAKNVDNYISIDVIASFNRMKTISTDLQLITEALKKSTRLQVSEDGKMVRRLDPLPENID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR Solution Structure of the La motif (N-terminal Domain, NTD) of Dictyostelium discoideum La protein
rcsb
source organism Dictyostelium discoideum
molecule tags Rna binding protein
molecule keywords Lupus La protein
total genus 24
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2013-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2m5wA00
5CVVA 1U78A 2XROA 3ZMUA 1SFXA 3DXJF 3AAFA 1SD5A 2IPQX 2FU4A 3I58A 1Q1HA 3FXQA 1BIBA 3RYRA 5DD8A 2P6TA 3MZHA 1IRFA 2IP2A 4I0AA 5ERIA 1TQMA 2EFQA 1UHWA 2VC1A 2D2WA 2FE3A 2XKOA 4EJUA 2OU2A 4U7BA 3VEPA 3HTSB 3FM5A 2KIMA 2VOOA 1FBQA 5E20A 3QAHA 5IT9K 3TQNA 1HW2A 2V1UA 2HZTA 1R1VA 1JGSA 1MJ9A 4HA8A 4G7OF 4EMSA 2R3SA 4RAYA 2MD5A 1XDUA 2GXGA 2XKPA 3BZ6A 3GFMA 5D6EA 4NB5A 2VODA 5EEHA 3GF2A 1KQ9A 1I1SA 2PN6A 5J8CA 1HW5A 1S3JA 4M72A 4U7DA 3HSEA 5HDGA 2HQNA 3ZN0A 2P8TA 4KMUX 4G7HF 3RI4A 5AONA 1RI7A 4LB5A 2RKHA 1D8JA 4EJTA 2R7DA 2HWVA 2OZ6A 2V6CA 1U5TA 1ONVA 1REPC 3E6MA 2EFPA 2X0LA 5DD4A 3I59B 4BYYA 2ZMEA 3R0AA 3E6CC 4F7ZA 3I64A 3COAC 1IW7F 2UXXA 2Q8KA 1XSVA 3GLXA 2H94A 4GCVA 4OIQF 4RGUA 4OOIA 1OR7A 4LLNA 1T38A 3DPLC 1R7JA 3ZQ7A 1HBXG 3T8RA 4U0VA 1F4KA 5AIPA 1ODDA 3GYHX 3EETA 4Q47A 3U9GA 1B9NA 1BC7C 1OMIA 1U5TB 5FFZA 4EVIA 4HLYA 3WTZA 1DUXC 3HHHA 4B09A 2UZKA 4G7ZF 2MBFA 1AWCA 1T0FA 2LF7A 2E7XA 2W85A 4L9VA 2IA2A 4BNCA 3DEUA 1PDNC 1Z6RA 3F8MA 3LAPA 3V8JA 1QZZA 1DPUA 3HIFA 1WI9A 4AIHA 1R22A 5D8KB 4Y15A 2H27A 3BWGA 2COMA 1W7PB 4E70A 1P4AA 1KU2A 2ZJ2A 2VN2A 3IKTA 1D8KA 3OOPA 4HBLA 1LDKB 2JZYA 1USSA 1QNTA 4I0BA 1HSJA 4KUMA 4UVBA 2VC0A 5IT9Z 5DCMA 2OBPA 2NS0A 3B02A 1R36A 2H6BA 5CVRA 2EV6A 1K78A 4BHBA 1G3TA 1UFMA 2VBYA 5J6XA 4ENJA 2K86A 5CLSA 5D5VB 4I09A 5HS9A 2HFHA 4ENNA 2FMYA 1B59A 1G3YA 2Y48A 2QZ8A 3G3ZA 4OMYA 1FNNA 2VXZA 3CO7C 2UWMA 3RPUA 3P9CA 4OIRF 4IHTA 5KVRA 2Z33A 3E5UA 4A0XA 4P5OA 2STWA 1YLFA 4P9FA 1XCVA 1SFEA 2BEOA 3KZZA 5DUKA 4A2UA 3WTUC 4PCQA 5TJJA 3QRFF 2L4AA 1XB4A 4O3MA 3PQKA 4L18B 2F5EA 3HRMA 2M30A 4ENMA 1E17A 3LA7A 5TRDA 5JVTA 5E1XA 4M6XA 1SD4A 2JRTA 1S7OA 1J75A 4BHCA 4HF2A 2A61A 4M9SA 3N4MA 2Y0MA 2CSOA 2K4JA 3TOBA 2ACJA 2AS5F 3F21A 3RTRA 1J0RA 1YW9A 2Y75A 2WWYA 1FWZA 1H0MA 1PP7U 2EFOA 3FXUA 3NEUA 3KFWX 2XASA 4RGRA 4EJWA 3L7WA 4I7HA 5L3BA 2EV5A 3GFLA 2HS5A 4JBAA 1I6XA 2FBKA 4AWXB 1GVJA 3M7GA 4LFUA 5ICCA 1UHMA 2PBIA 2Z3YA 1ZRDA 2VE9A 2V1DA 3F72A 1QPMA 5HLHA 5LHGA 4OIOF 4HV6A 2MH2A 1FBUA 3P9IA 5JR3A 2HEOA 1TNSA 2QM3A 1XSXA 2BV6A 4WK8F 2P5KA 1O7FA 2RC4A 4FHTA 2JPCA 5FLXZ 1MD0A 2UXNA 1RIOH 4P9UA 2G9WA 1QGPA 1K78B 4M73A 3TOAA 5HOOA 4L0ZB 5D5WB 1ZG1A 2BYVE 1KQ0A 3O2PE 4KIBA 3TKYA 3GEZA 5E18F 3L2CA 3RPQA 3WU1B 1BI1A 3MWMA 3L9FA 2V79A 2DO7A 3FXRA 4OU0A 5DCFA 4HX8A 4XSZF 2JSCA 1W7PA 3KCCA 3SZTA 5BOXA 2RV8A 1OYIA 3EUHA 5DYMA 1Z1DA 4GYIA 2RGVA 1FSHA 5D5UB 3HTUA 4UVAA 3BOQA 1H9TA 1FZPB 2W84A 4YG2F 3I4PA 4CYDA 3ABTA 1U3EM 3CO6C 1BC8C 3MCZA 3V4GA 2BGCA 2ISZA 2NNYA 3QPTA 3WTYC 5JHUA 2A68F 1STZA 4Q48A 2IRFG 5LRSA 4P96A 3HSRA 5DV5A 4IF4A 3QU3A 3BP8A 3SQNA 1W4MA 4Y13A 2ESNA 2Z5UA 5BPIA 4ENKA 3J80K 2DQLA 2ZXJA 3WGIA 4A12A 4R79A 3HRUA 4RB1A 3MQ0A 2QBYA 2RQPA 1GXQA 4RAZA 1YIOA 4B8XA 2Q2EA 2IVMA 2HTSA 3NRVA 3BDDA 1MZBA 2FSWA 2D45A 1YO5C 3KP7A 3KEOA 2WV0A 3EQLF 3ZMVA 1HKTA 2DQRA 3RYPA 1BIAA 4R8HA 5LEJA 2K02A 3ELKA 4DQ2A 2QBYB 2JT1A 3HOTA 5AIQA 4LLLA 2W24A 2GXBA 2VBWA 3R0JA 2DU9A 2GA2A 4ASNA 5K5RA 3ULQB 1NHAA 4S05A 3L09A 3RJPA 4LD5A 2VOPA 3EYYA 3ZPLA 2CO5A 1JE8A 2EV0A 5L3FA 1ZHFA 1FOKA 4QLCU 2DI3A 2F5CA 3B73A 4IPAA 1B9MA 2QYOA 5BS6A 4CZZA 3KLNA 3F8FA 2XRNA 4UUVA 4XRFA 1YFHA 3K1MA 5DCMB 2XHKA 3JTGA 1HXDA 2J5PA 2W57A 3REOA 4KT5C 4YFXF 2XAHA 2QVOA 2P4WA 5E8GA 4HQMA 4ZYGA 3ZP5A 3ROUA 2VE8A 5L3EA 4D0PA 1F9NA 2EFNA 4U0WA 2IJLA 2M5WA 1L0OC 3JTHA 1ZGJA 5CVJA 3CUQB 2OAZA 2KIFA 4KA4A 3FM3A 1D3YA 2MH9A 1TNTA 2P5VA 2K4BA 2TDXA 3TGNA 1ZRCA 1YTYA 2FBIA 1QBJA 3QP6A 2A5YB 3VOEA 1MGTA 2R7FA 4JQFA 3H92A 1DDNA 3WODF 4UV9A 2HR3A 4KIGA 1XMKA 3HSFA 3CUOA 5CVIA 5FFXA 2V1XA 6PAXA 4UV8A 3E97A 2HOEA 1CF7B 5DEQA 4N9HA 3T5XA 3IWZA 5K5QA 3GFJA 5E17F 2OZUA 5BMZA 3MFKA 3KP3A 3GWZA 4GYGA 2L54A 1KGSA 1R23A 1RNLA 3K1PA 3GZ5A 3GW2A 3W6JB 1T6SA 5LGUA 4WXHA 1Z7UA 4KNYA 4HAMA 4UVCA 1O57A 2WTEA 5ICFA 3CLOA 4A0YA 3V7CA 3S2WA 3HYIA 2O03A 3KP6A 2B0LA 4RB3C 2NRAC 1TQPA 4Q5SF 2P5LC 1T39A 3H3UA 3C7JA 2MLKA 2CWEA 5FLXK 2LKPA 2JPBA 2XIGA 2FQ3A 2KJBA 4IHSA 1MKMA 1ON2A 1LDDA 3IRQA 2ZNZA 2XAFA 1DP7P 4CICA 1I5ZA 2LNBA 2XGXA 2A07F 2VT2A 2MC3A 4OIPF 4OMZA 5D5XB 3SZPA 2YU3A 4RB0A 5IT3A 4UXNA 2ZBKA 2LDUA 1G3SA 4IJAA 2V9VA 4WWCA 3F6OA 4EV0A 4GXOA 4HW0A 3E5QA 4IVNA 1WSUA 2M1BA 1R00A 4ZYDA 1IXCA 1KYWA 1K6OA 3DV8A 3ECHA 2A6HF 4FX0A 1LVAA 2L3DA 5D8LB 4PDKA 3I54A 4XLPF 2P6SA 5HDNA 5A2QK 3DPTA 4XSXF 5D6FA 1RUNA 3I59A 4KYWA 1R1UA 1O7LA 1IN6A 3LSTA 4R1HA 3WGGA 3BY6A 3CJNA 4ESBA 4AVPA 2ZNYA 3WG9A 3F8NA 3KP5A 3RKYA 3F3XA 4M9XA 2IA1A 1IF1A 4ETSA 5BQTA 1MDMB 2STTA 1FSEA 3WTSC 2PFBA 2GZWA 4HZFA 1T98A 2X4HA 1O3TA 3NQOA 1J59A 1LQ1A 1QO0D 2PJPA 4GGGA 4OINF 2DPUA 1I1GA 2EA4A 1K7AA 3CUQA 1S6LA 3R4KA 2M45A 1R58A 4MTEA 1P4XA 1ULYA 4MEXF 5LBQA 3IWFA 1Z6TA 2DLLA 3WE3A 1FX7A 1WQ2A 1Z9CA 4EJOA 2QQAA 2HKOA 5F6FA 4ON0A 5H6RA 5L3DA 1LEBA 4KDPA 1BM9A 4LGWA 4WF2A 2QLZA 1XD7A 1HQCA 2E1NA 3JW4A 2P7VB 2O3FA 2EK5A 2IA0A 4M9ZA 3K69A 3ZMZA 3G73A 3T8TA 5HVQC 4KN7X 3K2ZA 2EFWA 5D4SA 4UHTA 4N0BA 2GQQA 3KETA 3P9KA 1SMYF 1YW8A 2NNNA 1WKMA 4ESJA 4EM1A 1LB2A 3R61A 1IUYA 5CJ9A 4AD9A 1X3UA 3BPVA 1B6AA 1P92A 1HKSA 4MQ9F 2E1CA 2W25A 4YFNF 2HYGD 4IRGA 3E5XA 2JTVA 3U2RA 4EGZA 4Q4ZF 4LMYA 5LEKA 3ZMTA 3JSOA 3DP7A 2D1HA 4G94A 4IXAA 2H6CA 3PFIA 4M6YA 2Z9OA 1ZGAA 3DFGA 1FY7A 1FP2A 3FMSA 4BQAA 3TO6A 5FO5A 3C1DA 3WTTC 1LJ9A 1BI0A 3J80Z 3JSPA 5HS7A 1O3SA 1Y0UA 4YIIA 5ILVA 4HX7A 3U1DA 2VBXA 5ED4A 5JFRA 1JHFA 1J5YA 2O0YA 2RN7A 3PQJA 3C18A 4FT8A 4JK1X 3T1BA 2GA1A 1C0WA 4G9YA 4YIFA 2BE5F 1TTYA 2IW5A 2ZFWA 3KE2A 5J8FA 3M8FA 5A2QZ 2HKXA 3CUQC 3GXOA 2KJCA 3FF5A 4RGXA 3K9TA 2K27A 1ZH5A 2MA3A 5E1ZB 3VODA 2H09A 2FOKA 3SHFA 1RZ4A 3K0LA 5E1WA 1XDSA 1O3RA 4ZZLA 1IN7A 5KK1A 1LDJA 1SD7A 1UCRA 3J81Z 2ADUA 4AIJA 3IHUA 4A5MA 2HQRA 3DKWA 4NQWA 4HDUA 5K1YA 2LSOA 3ZN1A 5F64A 3F8CA 2O6GE 1XGOA 4CGZA 5H20A 1P2FA 2XAJA 1LEAA 3BJAA 4ZYHA 2K7LA 4KFCA 2CQKA 2Z99A 1Z91A 2A69F 1EH8A 1QQIA 2ISYA 1G3WA 3I0TA 1ZAOA 1ZG3A 1BN5A 3R60A 4K2EA 1BOAA 4L9TA 5D4RA 1JHHA 1ZYRF 3ML6A 1V4RA 3OV8A 3D5LA 2VT3A 2OQGA 1YW7A 3L00A 1G6NA 2QQ9A 1S8NA 3LAJA 1B1BA 4ZZDA 4HF0A 2DW4A 3MAJA 2M8EA 4L9NA 2P7CB 3WGHA 5ICGA 3GFIA 4ZH4F 4LG0B 1P6RA 3E6DA 2D1VA 3SFZA 4EGYA 3HUGA 4HOBA 5FD6A 1SD6A 4M71A 4CO8A 2QENA 1SMTA 4A0ZA 4S04A 4MNUA 2XUBA 1IN8A 3KP4A 4WCGA 4KMFA 5ILUA 2ESHA 4TV7A 4HDVA 2FF4A 2HGCA 2PMHA 3M9AA 2G7UA 3VFZA 3ISPA 2XAQA 2VONA 3GO5A 1HW1A 1ZLJA 1R1TA 3QPHA 2PMUA 2RNJA 3I71A 2HDCA 1QZYA 4DNCA 1SAXA 3HOSA 4UNOA 2LF8A 1XCBA 4NHJA 4LJZF 1EV7A 3LQQA 2CG4A 3TO7A 4EQQA 3LA3A 1XMAA 1P4WA 1TQIA 2KKOA 3LFKA 3MEXA 2PQ8A 4EM0B 3MZYA 4PZJA 2EA2A 3WTWC 5HS8A 4L0YB 4WX9A 5FB2A 3M8EA 1JXSA 3BJOA 1U2WA 4KICA 5LHIA 2FNAA 1SFUA 5ICEA 4RS8A 4XBFA 2FMLA 5EEGA 1TW2A 2MLGA 1HKQA 1R5HA 2EB7A 3R6SA 4YFKF 2O8XA 3GUDA 1IRGA 2F5DA 1IN4A 3GX4X 2DFIA 4QWQA 3IKVA 4I98B 3BJ6A 2YSRA 1BI2A 2ZMEB 2CFXA 2PLYA 2RDPA 2ETHA 1KQ8A 3GVAA 1LNWA 2YX4A 3BROA 4BHPA 1XGMA 2XV4S 5CVUA 1U5TC 4N9IA 5LGNA 1YG2A 1J7KA 3FMQA 3QP5A 3JAMZ 2OA4A 3FWEA 3W6KB 4H0EA 2EJRA 4IRIA 1A04A 1IXSB 4G8XA 1U6GA 4U0YA 3VB2A 3DQVC 1CF7A 1KA8A 1IZ1A 2GWRA 1BI3A 4ESFA 3RDIA 2O61A 1XN7A 2L4MA 2J5OA 2G7HA 4P55A 3E6BA 3N97A 1IN5A 2XAGA 2ZCWA 3EYIA 2L02A 1TBXA 2FNPA 3EDPA 2ZKZA 1WWXA 3KZYA 5HLGA 2WC2A 4U88A 2CYYA 2VBZA 5FGMA 3F22A 5DUIA 1IAWA 3Q9VA 4HYEA 3H3ZA 1EH6A 3RKXA 3V7RA 1XGNA 1K79A 3WU0A 4HV5A 4MQVA 4MEYF 1RUOA 4G6QA 4HX4A 4Y17A 4PGGA 4O6JA 3WTXC 2DTRA 1V3FA 4EM2A 1I27A 5HLIA 3TDZC 3ECOA 1ZARA 4RB2C 1YS7A 1AOYA 1E2XA 4KIFA 1XGSA 3T0YA 5L3GA 4HQEA 3SXYA 3TO9A 3ZMDA 4EJVA 5LRRA 5LHHA 3Q5FA 2NYXA 4O5VA 2FEZA 2YR2A 3D0SA 1CGPA 1TW3A 4L5IA 2KIUA 1L3LA 4A6EA 3V7SA 4A5NA 1U8RA 2AXLA 2NAZA 2DBBA 5DDGA 2CGPA 1FLIA 4I01A 1G4DA 2A6EF 4L5JA 2FXAA 1FP1D 4PGHA 5H6QA 1ZG5A 3F23A 2OD5A 4HLXA 1KU3A 3HRTA 4BH9A 5CYVA 1GXPA 1UB9A 2GAUA 4IRHA 3IC7A 1FYMA 1YYVA 3QOPA 1BBYA 4LB6B 3FMRA 4G6DA 1J9IA 3WTVC 1Z05A 4LK0F 1OYYA 2YPRA 3F8BA 3F6VA 4XLNF 3C3WA 5BPDA 4MTDA 3O3KA 3E3VA 3K1NA 4WXCA 1OKRA 4RGSA 3M1EA 1XSDA 1FPQA 3V8KA 3J7AO 2KRFA 3TDUC 1MJAA 2L01A 3FZVA 2M87A 3KLOA 3JAMK 3ERED 2RVCA 1J2XA 1T2KA 2FBHA 4HF1A 2DPDA 1H9GA 1F1ZA 2YX7A 1EH7A 2GIVA 4KN4X 3IL2A 2OQRA 3ABUA 3LQRA 3FHZA 3CDHA 2XVCA 2HTJA 1ZLKA 5E8IA 3GZ6A 1IXRC 2QUFA 2IT0A 2FA5A 3BPXA 4AIKA 1TLHB 1D5VA 1ZRFA 1ZREA 4MHGA 1O3QA 2ZO4A 2QQBA 5LLQA 3J81K 1FBSA 1FC3A 2FRHA 2DK5A 5ILSA 3Q9SA 2HYFA 2ELHA 5L3CA 2DT5A 1B4AA 5F1RA 1KU9A 1HSTA 1ZN2A 1PP8F 2A3SA 2F2EA 3KP2A 5LGTA 1F5TA 4I2OA 3RIRA 1FT9A 1MJBA 1W7PD 3O6BB 4WXDA 2F5FA 3HHGA 3DF8A 4CXFA 4Z2YA 2BBYA 1FYKA 1YS6A 4MGRA 4LK1F 4CDGA 5HDKA 2PEXA 4L9JA 2DAOA 2DK8A 4GO1A 1PUEE 1KU7A 2C6YA 2EWNA 1VTNC 3HRSA 1W5SA 4BAYA 1MDMA 2Q0OA 3LWFA 3QU6A 2E7WA 4CHUA 2QWWA 5FD5A 1DPRA 1W5TA 4LLGF 5K5OA 3I5UA 1OPCA 1YQAA 3V8LA 3FX3A 1ON1A 1KYZA 3WE2A 2PI0A 4FX4A 4M74A 4LG0A 3P7NA 3IRRA 1WRJA 1S7AA 3KEQA 5JI6A 4I02A 3ZMSA 2CW0F 4BXUA 3I53A 3RKWA 2PG4A 1R5GA 1BJAA 1USTA 1GHCA 1FYLA 3LA2A 1S29A 1OYWA 4A6DA 4ZYEA 3CTAA
chains in the Genus database with same CATH superfamily
1VFCA 5CVVA 2XB5A 1U78A 2XROA 3ZMUA 1SFXA 3DXJF 3AAFA 1SD5A 2R5ZB 3RKQA 2IPQX 3ONQA 4F3QA 1HLVA 2FU4A 3HOVJ 3I58A 4YELA 1Q1HA 1LFBA 3FXQA 1BIBA 2GM4A 3OYJA 3RYRA 5DD8A 2DMQA 2K40A 1Y39A 2P6TA 3K4MA 3MZHA 2BOLA 3H0DA 1O4XA 1IRFA 5DM7F 2IP2A 4I0AA 5ERIA 1TQMA 2EFQA 4V19K 1UHWA 2VC1A 2D2WA 2FUG2 2FE3A 2XKOA 4EJUA 1ETQA 2OU2A 4N4OB 4U7BA 2K9QA 2DYRH 3FKJA 3VEPA 2KLOA 1SVMA 3HTSB 2LREA 3FM5A 2KIMA 4C9YA 3PSIA 2VB6A 2VOOA 1FBQA 5E20A 3QAHA 4A3EJ 5IT9K 3TQNA 5F0HA 1HW2A 1QHGA 4XM3A 4BU2A 2V1UA 1WH5A 4BS9A 2HZTA 3QQAA 1R1VA 1JGSA 1I50J 2VKDA 1HOMA 1MJ9A 4HA8A 2VI6A 4G7OF 3BCAA 4EMSA 1B8IB 1HF0A 2R3SA 4RAYA 2MD5A 1XDUA 2GXGA 5HLTA 3VSKA 2XKPA 3BZ6A 3GFMA 5D6EA 4CCOA 5GPCA 4NB5A 4D9JA 2VODA 5EEHA 4E7ZA 3C2GA 4HSTA 3GF2A 1KQ9A 2LC2A 3BQZA 1I1SA 2PN6A 5J8CA 1HW5A 5KHDA 2E2IJ 1LUJB 1S3JA 2JQ7A 4M72A 3OIQA 3HSEA 4U7DA 5HDGA 2HQNA 3ZN0A 2P8TA 4KMUX 4G7HF 3W2AA 3RI4A 2F5VA 5AONA 1Y1WJ 1RI7A 4LB5A 1AHDP 2WAQN 4HEA2 2RKHA 1D8JA 1RETA 1EJ9A 4EJTA 2R7DA 2HWVA 2OZ6A 3HBLA 1V5GA 2LY2A 3CF2A 2JMWA 1Y8RB 2V6CA 1N25A 3A01A 3UKGA 5M5WJ 2Z2SB 1U5TA 3PNVA 4Z6YA 3K6GA 3RPUD 1ONVA 1REPC 3E6MA 4BBSJ 2EFPA 4XLEA 3EUKL 1EA3A 2X0LA 5DD4A 3I59B 4BYYA 1B72B 3L2WA 1MSFC 2COBA 2ZMEA 1X1PA 2QSGX 4BJ6C 3RZOJ 3PNTA 3R0AA 3AKZA 5IP7J 3E6CC 4F7ZA 2LK2A 3I64A 3IAM2 3COAC 1IW7F 2DT6A 4NC7A 2UXXA 2H1LA 1ETYA 2Q8KA 1XSVA 3GLXA 2H94A 4GCVA 4CCKA 2LP0A 4OIQF 2W7NA 4RGUA 1EF4A 4OOIA 1OR7A 1YE9A 4LLNA 1T38A 3DPLC 1R7JA 1X1CA 3OYFA 3ZQ7A 1HBXG 1BJZA 5EJCA 4IZZA 1UG2A 3T8RA 2A05A 4U0VA 1F4KA 1JUPA 3I56I 2DA6A 5AIPA 2WY7Q 1CQTA 1ORKA 1ODDA 2CFOA 3GYHX 3EETA 4Q47A 2LH9A 2W82A 2CJJA 3U9GA 1B9NA 1BC7C 2V6EA 4NQWB 1OMIA 2K9SA 4LIUA 1E3PA 1A6QA 4AUXA 1PUFA 1WJFA 2E5ZA 1U5TB 2AO9A 3LSKA 5FFZA 4EVIA 4HLYA 3WTZA 3C2HA 1P9QC 3DTKA 1MMDA 1DUXC 3HHHA 3KIOA 4B09A 2UZKA 2DJIA 4G7ZF 3HXLA 4XORA 3DBRB 3OYBA 2MBFA 2WAEA 1AWCA 1T0FA 2HXOA 4BE1A 2LF7A 2E7XA 2W85A 2DOEA 4XIDA 2VLAA 4L9VA 2IA2A 4BNCA 3DEUA 5GADJ 1V5FA 1OFCX 1Z6RA 1PDNC 3F8MA 3LAPA 3V8JA 2CQ7A 3HUGB 2HZDA 3IH2A 1QZZA 2R92J 4D7NA 1DPUA 3ASNH 3HIFA 2VJIA 1WI9A 3OYKA 2BY1A 2PJRB 4AIHA 1R22A 2BW3B 5D8KB 4Y15A 1JJ8C 2LTPA 1JJ6C 2H27A 1GV5A 2L7MP 3BWGA 2COMA 1HCRA 3D1NI 2ZFUA 1Z21A 4I99C 2DDBA 2JA7J 1TT5B 1W7PB 2RNGA 1SANA 4E70A 2LG4A 3M8JA 2L7KA 1P4AA 2HDDA 1OCTC 2DFEA 3IH3A 1KU2A 2ZJ2A 1APLC 2VKEA 2VN2A 3IKTA 1D8KA 4FCYA 4JYKA 3OOPA 1YHQI 4U87A 4HBLA 1LDKB 2JZYA 4XOTA 1USSA 1QNTA 4I0BA 4NC6A 4AYBN 5M5YJ 1ETKA 1HSJA 4KUMA 4UVBA 3BG5A 3H36A 2VC0A 5IT9Z 4JX5A 2OUMA 5DCMA 4XKBA 2WA0A 3PSFA 2OBPA 4BE2A 1WI3A 2NS0A 2HVSA 1GV2A 3B02A 3X2QH 9ANTA 1R36A 2H6BA 5CVRA 2EV6A 1K78A 2ID3A 2CUEA 4BHBA 1G3TA 2DODA 1UFMA 2VBYA 5J6XA 4ENJA 2K86A 2VXDA 2R5YB 5CLSA 5HNFA 3CLQA 3DLAA 5D5VB 4I09A 3WG7H 1RKWA 1T0FC 2GOXB 3FXJA 2WB1N 1QZEA 5HS9A 1R71A 3RQ4A 2HFHA 3A02A 4E6KG 3OOUA 4ENNA 2FMYA 1SFOJ 1B59A 1WJEA 4HNTA 2KQRA 1G3YA 2HU9A 2Y48A 4XRSG 2QZ8A 2V26A 3G3ZA 2L9VA 4OMYA 4JX4A 1FNNA 3PM1A 1G2HA 2M34A 2VXZA 4H4KC 5KCMA 3KYLA 5IP9J 3CO7C 4G6TB 1QA6A 2M0CA 1VQ4I 2Y30A 1YJ9I 2UWMA 2QSFX 3RPUA 3P9CA 4OIRF 4BKXA 4XL9A 4IHTA 1ZR2A 5IYBJ 5KVRA 2Z33A 2VJ5A 2WV1A 1ETOA 3E5UA 1RESA 4P5OA 4A0XA 1JKRC 2STWA 2XGDA 2XSJC 5J4VA 3OL3A 1YLFA 2VKVA 2VQHA 2Q2EB 4P9FA 1XCVA 4CUGA 4CSWA 1SFEA 4RA2A 2BEOA 2X48A 2MC4A 4Y52J 3KZZA 2H8WA 5DUKA 4A2UA 3WTUC 2Y2ZA 4PCQA 3OYMA 5TJJA 5FJ8J 3PL8A 3H9QA 2L4AA 3QRFF 1SEUA 1XB4A 2E34A 3S1NJ 1ERDA 3CJQB 4DYQA 3L1PA 4O3MA 3PQKA 3PNYA 4L18B 2R5ZA 2KDOA 1TT0A 2F5EA 3HRMA 2M30A 5J1RA 4ENMA 1E17A 2XDVA 3LA7A 3I4MJ 2OC6A 5TRDA 5JVTA 5E1XA 4M6XA 4QPOA 1E3HA 1EKEA 1SD4A 3PJRA 2TRTA 2QF7A 1YX3A 2NOJB 2UV1A 2HVRA 2JRTA 3DTEA 1S7OA 3CDLA 4UUSA 3ZQGA 2I10A 3FBIB 2QKLB 1J75A 4LG3A 4BHCA 4HF2A 2A61A 4M9SA 3N4MA 3DKYA 2Y0MA 3FK7A 2CSOA 3H35A 2K4JA 3TOBA 3LSMA 2JWTA 1W5CC 2ACJA 2AS5F 3F21A 1OCRH 4CYCB 3RTRA 2ICWG 3IH4A 1J0RA 1YW9A 3RCOA 2Y75A 2WWYA 4M6VA 3JRCA 1FWZA 4HSRA 2R7UA 1H0MA 1MBHA 3G71I 1S7EA 5F08A 2OF7A 1PP7U 4LITA 1KONA 3E7LA 2EFOA 3FXUA 3NEUA 3KFWX 2XASA 4RGRA 4EJWA 3L7WA 4A69C 4I7HA 3L2QA 5L3BA 2EV5A 3GFLA 2KFDA 1RC9A 2HS5A 4JBAA 1I6XA 2KT0A 1BL0A 2DA1A 2FBKA 3H9JA 4AWXB 1GVJA 2JRMA 3A03A 3M7GA 4LFUA 5ICCA 1UHMA 4XNFA 2Z3YA 2PBIA 1T56A 5IY5H 2R7ZJ 3ABLH 1ZRDA 2KIQA 2VE9A 2WAQA 4UB6C 3OIPA 2V1DA 3MVPA 2KZGA 5FKLA 3F72A 1QPMA 5B3SH 2JN6A 5HLHA 3CP8A 5LHGA 4OIOF 4HV6A 2MH2A 1FBUA 4JOMA 1QVTA 3I3LA 4DYRA 4BXFA 3P9IA 1XX5A 1SC7A 1Y0NA 5JR3A 3GMEA 2HEOA 1TNSA 4MFEA 2QM3A 2N8GA 1XSXA 2F4OB 2BV6A 4A3KJ 3ZQLA 4WK8F 2P5KA 4IOAF 1O7FA 3DU6A 3OR2C 4A3FJ 2CU7A 3D5RC 2RC4A 4FHTA 2JPCA 5FLXZ 1MD0A 2UXNA 1MNEA 2L0KA 4PJNA 1RIOH 2R7QA 2R5YA 4P9UA 1SFKA 2G9WA 5GTIC 2F4MB 1QGPA 2A5WA 1K78B 4XONA 4M73A 3TOAA 5HOOA 4L0ZB 1LPQA 5D5WB 1ZG1A 2BYVE 4KITB 1KQ0A 1I6HJ 4HPQA 3O2PE 4KIBA 1MBEA 3TKYA 3GEZA 3SEQA 5E18F 3L2CA 2LR8A 2R7WA 3RPQA 3WU1B 2W1OA 2M3AA 3DKXA 2IXSA 4V2GA 1BI1A 5GP9A 3MWMA 3L9FA 1YIJI 1V54H 3BG7A 2V79A 2DO7A 3FXRA 3PO3J 2R7RA 2NS7A 2K3PA 4ZDPA 4XOPA 3DCFA 4OU0A 5F04A 2DMTA 1D1BA 5DCFA 4HX8A 4RAGA 4XSZF 2R7VA 2MGQA 4BEHB 2JSCA 1W7PA 1X2NA 3KCCA 3K70D 3SZTA 3RZDJ 2RV8A 5BOXA 1OYIA 3EUHA 2JK3A 5DYMA 1Z1DA 4GYIA 2RGVA 2HNHA 1FSHA 2XF6A 5D5UB 3HTUA 4UVAA 3OMYA 1GVDA 3BOQA 4M3DA 1MBFA 3GBGA 1H9TA 1FZPB 4BY1J 3HEFA 4ZYAA 1B8IA 2W84A 4YG2F 3I4PA 4CYDA 3S3NA 3H3VK 4BQOA 4F92B 4ZC3A 3ABTA 1U3EM 4BXXJ 4QIWN 3CO6C 1BC8C 3MCZA 2ZXWH 3V4GA 2BGCA 3G1MA 2ISZA 3BTJA 2PX9A 2NNYA 3LMMA 3QPTA 2QA4I 3WTYC 2DA7A 5JHUA 2A68F 1STZA 4Q48A 2F48A 4OAZA 2IRFG 4AC0A 2IEKA 5E79C 2DA4A 2VIXA 4P96A 5LRSA 3D5SC 3HSRA 5DV5A 3W2WA 1XG1A 2R7XA 3MZ8A 4IL6C 3N05A 1JGGA 2DA2A 4IF4A 3CCJI 3QU3A 3PUFA 3P5JA 4FE7A 2ME0A 3M3YJ 3BP8A 3SQNA 1QRYA 5KNLA 1W4MA 4Y13A 5FLMJ 5IP6A 2ESNA 2Z5UA 5BPIA 4ENKA 3J80K 4UUSB 2DQLA 2ZXJA 3WGIA 1PJRA 4CZCA 4A12A 4R79A 4ZTFA 3HRUA 2ZMEC 1NG6A 2IS6A 4FASD 4RB1A 3MQ0A 2BY2A 2Q1ZB 1WJCA 5C4XJ 2YU9J 2QBYA 2RQPA 1U9NA 1GXQA 3CESA 4RAZA 1YIOA 3FXOA 4J19A 5IYCJ 2W00A 5IOYA 4B8XA 2Q2EA 1MNDA 2IVMA 2HOTA 2HTSA 4F91B 3NRVA 2E2JJ 3BDDA 1MZBA 2TCTA 3HZJA 1Y56A 2VQCA 2FSWA 2D45A 3ASOH 4OWRB 2L7ZA 1R4MB 1YO5C 3KP7A 1E3OC 3KEOA 2X6YA 2WV0A 3EQLF 2ZJRF 1VNDA 3H0GJ 1FIPA 3ZMVA 1HKTA 4KJZA 3RSNA 2VKHA 3VWBA 1Y8QB 2DQRA 3RYPA 1BIAA 3MMYB 4R8HA 5LEJA 2K02A 2KISA 3ELKA 4DQ2A 2QBYB 2JT1A 3HOTA 4GFBA 5AIQA 3H1CA 4LLLA 2W24A 1FEXA 2GXBA 4XLFA 2VBWA 3ESWB 4FETA 3R0JA 2DU9A 2VQGA 2GA2A 3JRBA 4ASNA 5K5RA 3ULQB 1NHAA 3CMAI 2EPFA 5FKOA 4S05A 3L09A 2HDWA 3RJPA 4LD5A 2VOPA 5BNGA 4A3IJ 3VPRA 3EYYA 3ZPLA 1YRNB 2CO5A 4B4CA 1JE8A 2DCEA 2EV0A 5L3FA 1ZHFA 1ENHA 4QLCU 1FOKA 2DI3A 1WPKA 3ZRGA 2F5CA 2EIJH 2L7FP 3B73A 1NG7A 4B3AA 4IPAA 1B9MA 2QYOA 1VI0A 2V7FA 5BS6A 4RAFA 4CZZA 3MKWB 3KLNA 3F8FA 2XRNA 2FJ1A 2RQQA 4UUVA 1I39A 1ETWA 3OYAA 4XRFA 1K4TA 1YFHA 3WHCA 3K1MA 5DCMB 2JVGA 2XHKA 5F27A 3JTGA 1HXDA 3FXLA 3CC7I 2J5PA 2W57A 3REOA 4ABZA 4KT5C 3G6EI 4YFXF 2XAHA 2E36A 2QVOA 3HGGA 5C3EJ 3VYTB 5FKKA 2P4WA 3JR9A 5E8GA 4BEHA 4HQMA 4Y3OA 1IG7A 4ZYGA 3ZP5A 1X2MA 1YITI 3ROUA 2O8KA 1ZR4A 2VE8A 2BY0A 5L3EA 2W4SA 4D0PA 1F9NA 2EFNA 4U0WA 2IJLA 2M5WA 1L0OC 3JTHA 3ZQCA 1ZGJA 5CVJA 3CUQB 2OAZA 3LSPA 2KIFA 1FOYA 3CC2I 4KA4A 3FM3A 1D3YA 2MH9A 1TNTA 2P5VA 2K4BA 3GTJJ 2TDXA 3IUOA 3DEEA 3TGNA 3GZNB 3OYHA 4C2TA 1ZRCA 3OYGA 1HC8A 1YTYA 1LE8A 2FBIA 3W6VA 2E1MB 2UUZA 1QBJA 2VUMJ 3QP6A 2A5YB 2KHMA 3CJRB 3CP2A 4B43A 1VQKI 2H1KA 3VOEA 1MGTA 2R7FA 4JQFA 3H92A 1MBGA 5E3OA 3CC4I 5GTHC 2I8DA 1DDNA 1BR2A 2WY8Q 4RM3A 3WODF 4UV9A 2HR3A 1V5EA 4CCJA 4KIGA 1D0YA 4IKFA 1XMKA 3SYTA 3HSFA 2CW8A 3CUOA 2CV0A 1PUFB 1U0JA 4C3JJ 3C2BA 4Y4RA 5CVIA 5FFXA 2V1XA 4E7HA 1DP3A 3QWLA 6PAXA 2X6WA 1YJNI 4UV8A 3E97A 4IQJA 4N4NB 5F0CA 2B63J 2HOEA 1WJ5A 3L2UA 1CF7B 5DEQA 4QPQA 2L9SA 2LBFB 2DFFA 4N9HA 3CCMI 3HOYJ 4A3JJ 3T5XA 3IWZA 5K5QA 2NOGA 3GFJA 3O8HA 3SEZA 5E17F 5EZGA 1N75A 2OZUA 3IAS2 2GIZA 2FX0A 4ITVA 2R0QC 5BMZA 3ZGKA 4XQFA 3MFKA 3KP3A 1R4NB 3GWZA 4GYGA 1OQYA 1VQ7I 2L54A 3AG1H 4UUTA 3BG6A 1ACIA 4F55A 1KGSA 2DN0A 1TC3C 2IGKA 1R23A 1RNLA 3K1PA 3GZ5A 1ZTRA 3GW2A 3W6JB 5F1JA 1T6SA 4M3BA 5LGUA 1IO2A 5C44J 2BZTA 4XKVA 4MLOA 1ITYA 2EBIA 4WXHA 1Z7UA 4KNYA 4CH7A 1D0ZA 3VYUB 4AIDA 2OTJI 4II3A 2E19A 2HOSA 2R7SA 2LRDA 4F52A 2Y69H 1I3QJ 4YRVA 4HAMA 4UVCA 3HOXJ 2JVHA 2M4GA 2OCEA 1O57A 2WTEA 5ICFA 3CLOA 3V7CA 4A0YA 1ETXA 3S2WA 3I4NJ 3HYIA 2O03A 4EEFG 5GAEJ 2ZSIB 4AVZA 3KP6A 2B0LA 2CQQA 2LYCA 4RB3C 2NRAC 1TQPA 1W0UA 4Q5SF 5TISC 3TW7A 2VQLA 2P5LC 1T39A 3H3UA 3C7JA 1MMGA 3JRHA 2MLKA 2CWEA 5FLXK 4HG2A 1VQNI 2R93J 2IS1A 2LLKA 2LKPA 2XGCA 4FQGA 4RMNA 1K6YA 2JPBA 3OIOA 2CV1A 2XIGA 2FQ3A 3SJMA 1TWHJ 4C2MJ 2KMUA 2KJBA 4IHSA 1MKMA 3FHNA 1ON2A 3GTQJ 3G4SI 4D5FA 2MYSA 1LDDA 3IRQA 5JLWA 2ZNZA 5DS9A 1S5LC 1TP4A 2XAFA 2DOAA 3AG3H 4PJMA 4CICA 4DYCA 1DP7P 1I5ZA 1QU3A 1UMQA 2LNBA 3CMMA 4IHWA 2XGXA 2A07F 4B48A 2VT2A 1IDYA 2MC3A 3ZR8X 4OIPF 1TZLA 4OMZA 5D5XB 3SZPA 2BHZA 3AG2H 2YU3A 3CCEI 4RB0A 5IT3A 3PIPF 4UXNA 2X9DA 3HOZJ 4JX6A 2ZBKA 2QEXI 4XRSA 4B44A 2LDUA 1VF9A 2VJ4A 1G3SA 2OCCH 4IJAA 2V9VA 1G8XA 2LY1A 3TP0A 4B3XA 3CZ6A 5K7HA 4WWCA 2XPVA 3F6OA 2LKSA 2XB0X 2QGUA 3S32A 4EV0A 4GXOA 4HW0A 3FDYA 4PJLA 5TGTA 1JT6A 3E5QA 2CH0A 1PVEA 4IVNA 3HB9A 1WSUA 2M1BA 1R00A 2NVYJ 4CYCA 4ZYDA 1IXCA 1KYWA 3O8GA 1K6OA 5J1UA 3DV8A 3ECHA 2A6HF 3QYEA 4FX0A 1LVAA 2L3DA 5D8LB 4PDKA 1JTYA 3Q0VA 3IP4B 3I54A 4E7SA 3GLLA 4XLPF 2I5UA 1YJWI 2P6SA 5IPAA 3DU5A 1AKHB 1D5YA 3CMYA 5HDNA 5A2QK 3DPTA 2K9LA 4XSXF 1ZKGA 2W48A 3S16J 4IQ4A 1A6IA 5D6FA 1RUNA 3CCRI 3I59A 4A3MJ 2XF5A 4KYWA 2BY3A 5CQGA 4S0HB 1QVUA 1P7IA 1R1UA 3HGYA 1O7LA 1IN6A 2MW8A 3LL7A 3LSTA 4R1HA 3WGGA 3BY6A 3CJNA 4ESBA 1JT0A 2ZNYA 4AVPA 3WG9A 3F8NA 3KP5A 4XICA 3BR5A 3RKYA 2NVTJ 3F3XA 2WAFA 1MH3A 4M9XA 2IA1A 2E1OA 3HOWJ 3KEYA 1MBJA 3H5NA 1IF1A 4Y33A 4D7MA 3JCUC 4ETSA 3S2HJ 2E1MC 5BQTA 2HXIA 1MDMB 1IV6A 1FSEA 1POGA 4NUBA 3WTSC 2R7OA 2STTA 2PFBA 2NXNB 4E4HA 4HNUA 3OYCA 4E7LA 2F4IA 4ZDOA 2GZWA 4HZFA 5B1BH 1T98A 3BC8A 2X4HA 1O3TA 4DZJA 3NQOA 1J59A 1BA5A 2DA5A 1LQ1A 1QO0D 2PJPA 4GGGA 2YS9A 3V42A 4OINF 1WH7A 3BR1A 2DPUA 1I1GA 2EA4A 3J7AY 1K7AA 3CUQA 3SDBA 4E7IA 1S6LA 1BOBA 5F0FA 3R4KA 2M45A 1MNMC 3DBLB 1R58A 1MW7A 4PSWA 1TWCJ 4MTEA 1P4XA 1ULYA 4MEXF 5LBQA 1IGNA 2AXTC 2JA2A 4XKCA 3WHBA 3IWFA 3SZGA 1Z6TA 2DLLA 3WE3A 1FX7A 1WQ2A 3K4CA 4D1QA 2FOWA 4NNJA 4A3CJ 1VQOI 5J47A 1Z9CA 4EJOA 2QQAA 2HKOA 5F6FA 2EZHA 1Z67A 4ON0A 4XLHA 5H6RA 5L3DA 1OCPA 1LEBA 4A3LJ 4KDPA 4RBOA 1BM9A 2IAIA 3H5RA 5CPRB 3OS1A 3S1RJ 5EGOB 1VQLI 1GDTA 4LGWA 3SDGA 2OJED 1FTZA 2Y31A 4WF2A 2QLZA 1X1BA 1XD7A 2JSPA 4BGDA 2V9KA 1HQCA 3JRFA 2E1NA 4W97A 1VQPI 3JW4A 1UAAA 4UY8I 4CCLA 3OYIA 1JUMA 2P7VB 3CCQI 2O3FA 2EK5A 2IA0A 4M9ZA 2ELJA 1V55H 2M7BA 3K69A 3ZMZA 1VQ8I 3S3MA 1WJAA 1YOVB 5CQEA 3G73A 3M07A 2JUCA 3GTKJ 2ZXIA 1BW5A 3CQZJ 3T8TA 5HVQC 1XPXA 3IV5A 3S8PA 1T95A 2LD5A 2XRLA 3J7ZI 3CCVI 2IS2A 4KN7X 3I55I 4J00A 3K2ZA 2EFWA 1JTXA 5D4SA 3S1QJ 2P0WA 4UHTA 3RQIA 3H5AA 4N0BA 4XLCA 3JRGA 2GQQA 3KETA 3DBHB 3P9KA 1SMYF 4XK4A 1YW8A 2NNNA 2EILH 1TWAJ 2X1CA 1WKMA 1SVLA 4ESJA 4EM1A 2ECBA 2Y9ZA 3R61A 2FQ4A 3QPSA 1LB2A 1X19A 4DW6A 1OISA 1IUYA 5CJ9A 4AD9A 1X3UA 3BPVA 1A36A 1B6AA 4ZTJA 1P92A 3PUBA 3ZCOA 1FOXA 4RLQA 1HKSA 4MQ9F 2HPMA 2E1CA 3W2VA 2W25A 4KT6A 4YFNF 4CA0A 2HYGD 2KP6A 4IO9F 5B1AH 4IRGA 4C2UA 3E5XA 2JTVA 3OSFA 3VDXA 3U2RA 4EGZA 4Q4ZF 2DA3A 3HC7A 1LVKA 2DJNA 3DTIA 1MSEC 3BR0A 4LMYA 5LEKA 3ZMTA 5K7FA 3JSOA 3BR2A 3DP7A 4XKWA 2D1HA 4G94A 1VQ5I 3OL4A 4IXAA 2H6CA 3PFIA 2D5VA 3M4OJ 4M6YA 5M5XJ 1ETVA 2YUSA 4C3IJ 4IX7A 1ZGAA 3DFGA 4NDLA 3K10A 2Z9OA 1FY7A 1FP2A 1X3ZB 2LBFA 4IOCF 1FMWA 3FMSA 4BQAA 2BW3A 4JP0A 2Z1DA 3H9GA 3TO6A 2M4KA 2M0MA 5FO5A 3C1DA 3WTTC 1LJ9A 1BI0A 3J80Z 1VQ6I 2IGNA 3JSPA 3OSGA 3ABMH 5HS7A 5EF6A 1O3SA 1FIAA 3FIWA 1Y0UA 2M9HA 4YIIA 1P7JA 2ZJPF 2WB1A 3MKLA 3BR3A 2IS4A 5ILVA 1X4PA 3TEDA 4HX7A 4YIRX 3U1DA 3U21A 4XRMA 2VBXA 5ED4A 3GTGJ 2JUGA 5JFRA 1T08B 1JHFA 1J5YA 2O0YA 2RN7A 3C18A 3PQJA 4FT8A 1FTTA 1OJLA 4JK1X 1Z0XA 3HPGA 1D1CA 3T1BA 2E71A 3CJTB 2GA1A 1C0WA 3LSIA 1WZ2A 5HNHA 4G9YA 2EZKA 4YIFA 2GBYA 3KX2A 3TMOA 5EEAA 2BE5F 1VQ9I 1NK3P 2K85A 2NVUB 1TTYA 3UR3C 2IW5A 2ZFWA 3J7YJ 2FD5A 4AYBA 3KE2A 5J8FA 1T8IA 3OYNA 3M8FA 1X3WB 5A2QZ 4BE0A 2HKXA 3CUQC 4NBQA 2XC7A 2NVXJ 3GXOA 2KJCA 1SVOA 3FF5A 4RGXA 3K9TA 2K27A 4BDZA 1ZH5A 2MA3A 3CCUI 5E1ZB 3VODA 2H09A 3W3CA 4BQQA 1MH4A 2FOKA 2R4GA 3FK6A 1QHHD 2DMNA 2ZB9A 4W1UA 2RREA 2ME6A 3SHFA 1FJLA 1X1DA 1RZ4A 3BG9A 3K0LA 2DFHA 3MD2A 2BXYA 2PMZN 5E1WA 1XDSA 1O3RA 4ZZLA 1IN7A 1VQMI 5KK1A 1LDJA 4CCMA 1SD7A 1DU0A 2CRGA 1B72A 1UCRA 3J81Z 2ADUA 4KISA 4AIJA 3IHUA 4A5MA 1OCCH 2HQRA 3DKWA 5FKNA 3HDDA 3LSGA 4IHVA 1Q1VA 2ZXHA 1U9OA 4NQWA 3ZXSA 4HDUA 5K1YA 2GXAA 4IEJA 2O5RA 2CQXA 3A01B 2LSOA 1BW6A 3ZN1A 5F64A 5GPAA 3CMEI 3F8CA 4OAYA 2O6GE 1XGOA 4XR6A 5H20A 2DYSH 4CGZA 1P2FA 2XAJA 1IJWC 2DDAA 1LEAA 2DT7B 1WFXA 3BJAA 4ZYHA 2K7LA 4KFCA 2NVQJ 2CQKA 1H88C 1UJ8A 1Z91A 2Z99A 2A69F 1EH8A 2CUFA 1JKOC 1YX5A 2B7EA 2JJ7A 3U1KA 1QQIA 2ISYA 1UG0A 4PUSA 1G3WA 3I0TA 2B9SA 1ZAOA 2KRHA 1ZG3A 1BN5A 3R60A 4K2EA 1BOAA 4L9TA 2K5CA 3HKZA 5D4RA 2R7TA 1DGWY 1JHHA 1ZYRF 3ML6A 2G0EA 1V4RA 1X58A 3OV8A 3CDIA 1S9HA 3D5LA 4M3GA 2VT3A 3OR1C 2OQGA 2X6OA 3ABKH 1YW7A 3K4JA 3L00A 3NWSA 4B1RA 1HDPA 1G6NA 1LE8B 2QQ9A 1IV8A 4LIVA 1S8NA 4BL0B 3LAJA 1B1BA 5LD2C 2MABA 1WJBA 4ZZDA 4HF0A 2DW4A 3MAJA 2M8EA 4L9NA 5GAGJ 4A93J 2P7CB 2HVQA 4A3DJ 1RPWA 2XF7A 2X1DA 3WGHA 5ICGA 3S15J 2QCOA 3DLLF 3GFIA 2QKMB 1H89C 3S1MJ 3ERMA 2L2OA 3SFIA 4BQNA 3AL0C 3MKZA 4ZH4F 2AQFA 4LG0B 1P6RA 3E6DA 1TWGJ 2D1VA 4L5EA 2ECCA 3SFZA 3HUGA 4EGYA 3GTPJ 4HOBA 5FD6A 2KZVA 1SD6A 1Z7LA 2JA5J 4M71A 2KDZA 4CO8A 2XSDC 2QENA 4AU7A 1SMTA 4A0ZA 3LNQA 2EIKH 4S04A 4MNUA 2XUBA 1IN8A 3FXMA 1NH3A 3EUHC 4MFDA 3BTCA 3KP4A 4WCGA 4KMFA 5ILUA 2ESHA 4TV7A 4DBQA 3GTOJ 2DMUA 4HDVA 2FF4A 2HGCA 2PMHA 3M9AA 1LFUP 4B47A 1A5JA 2G7UA 3VFZA 3ISPA 2XAQA 2VONA 3GO5A 1HW1A 1ZLJA 1ZQ3P 1R1TA 2ZC2A 3QPHA 2PMUA 2RNJA 4GDFA 2K3FA 1A35A 3I71A 1XMXA 2HDCA 3A4CA 4PFPA 1QZYA 4PSXA 4DNCA 1E0EA 4BJTA 5DTDA 3ZQQA 4Y7NJ 3HOSA 1SAXA 1R6RA 2GLOA 3S14J 4UNOA 2AQEA 2LF8A 1XCBA 4NHJA 4LJZF 1EV7A 3LQQA 4QSHA 2CG4A 2M2EA 3TO7A 4EQQA 2BHYA 3JRDA 3MN2A 3LA3A 5FKMA 1XMAA 1P4WA 1TQIA 2KKOA 3LFKA 4XMYA 5FLVA 5FRNA 3MEXA 2PQ8A 4EM0B 3HM5A 1IDZA 3MZYA 4PZJA 2EA2A 3WTWC 2ZJQF 5HS8A 4DOZA 1MBKA 4L0YB 4WX9A 4C30A 5FB2A 3M8EA 3KZIC 1JXSA 3BJOA 4BACA 2O7OA 4QTRA 2E2HJ 3KYCB 5EDNA 1U2WA 2Y9YA 4KICA 4C3HJ 5LHIA 3GCMA 2FNAA 1SFUA 3BLYA 5ICEA 5EG0A 4RS8A 2EZLA 2CUZA 4XBFA 2FMLA 5EEGA 1TW2A 2MLGA 1HKQA 1R49A 1R5HA 4ZDLA 2EB7A 3R6SA 4YFKF 2PMZA 2O8XA 3BCBA 3GUDA 1IRGA 2F5DA 1NTCA 1LFPA 1IN4A 3A2KA 3GX4X 3Q3SA 4M3FA 4X0GA 2K9MA 2DFIA 4QWQA 3IKVA 4HNVA 4I98B 1Z77A 1H8AC 2VPRA 3BJ6A 2YSRA 1BI2A 2CUJA 2ZMEB 2CFXA 1XTAA 2PLYA 2RDPA 2ETHA 1KQ8A 3GVAA 2JA6J 1LNWA 2YX4A 4MO7A 3BROA 4BHPA 1XGMA 2HQ5A 2Y0SA 2ZSHB 2XV4S 5CVUA 4IHXA 1U5TC 4N9IA 5LGNA 3CF5F 1YG2A 2LY9A 1J7KA 1K83J 5M3FJ 3FMQA 3QP5A 3JAMZ 2OA4A 4CCNA 3FWEA 4PJ0C 3BG3A 3W6KB 4MIMA 4H0EA 2HQAA 3OYDA 2EJRA 3DEWA 4IRIA 1A04A 4I76A 1IXSB 1AU7A 5EZHA 1WHUA 2L9RA 4G8XA 1U6GA 1OR7C 4U0YA 3S93A 3VB2A 2QQ8A 1MMAA 1WCMJ 2E35A 3DQVC 1CF7A 3BR6A 3FXKA 2EQRA 1KA8A 4BDYA 1IZ1A 1WGXA 2HYJA 3LSJA 2GWRA 1BI3A 3NARA 4ESFA 3RDIA 2O61A 1XN7A 2L4MA 2J5OA 4BJ5C 2G7HA 4P55A 4LOCA 4ZYEA 1UELB 3E6BA 1RR8C 2ELKA 3N97A 1IN5A 1J09A 2XAGA 2ZCWA 3HJEA 3EYIA 2L02A 3QPLA 1TBXA 2WBMA 3CCYA 2AHQA 1W36C 3K4LA 3I9V2 2FNPA 3EDPA 4V2FA 2ZKZA 3BTLA 1WWXA 3KZYA 4YEJA 3CCLI 2PJRA 1ZELA 5HLGA 4DBRA 2WC2A 5J1YA 4U88A 2CYYA 2VBZA 5FGMA 3ZQHA 3F22A 5DUIA 1IAWA 3Q9VA 3AG4H 4HYEA 4ANJA 3H3ZA 1EH6A 2EH3A 3G1OA 3RKXA 3V7RA 3JRIA 4DJAA 3QODA 5KAFC 1KZHA 1K61A 4PFOA 1XGNA 2OTLI 3K4KA 1K79A 3WU0A 5E3LA 1T33A 4HV5A 4MQVA 4DGWB 1YI2I 4MEYF 4FE4A 3HOUJ 2BVLA 2DMPA 1RUOA 2RAEA 1MIJA 2F6CA 4G6QA 4HX4A 3E1SA 1JKPC 4Y17A 4FTHA 4PGGA 3A0HC 4NC8A 1IUFA 4O6JA 3WTXC 2DTRA 1YRNA 1V3FA 4EM2A 4J01A 4FISA 1I27A 3NWTA 5B66C 5HLIA 3OYLA 1G59A 2CV2A 1XS9A 3LFUA 3B6CA 3TDZC 3ECOA 1ZARA 4RB2C 2E5NA 1YS7A 1AOYA 1E2XA 4KIFA 1XGSA 3PO2J 3JRAA 2OV7A 3T0YA 5L3GA 4HQEA 3SXYA 3HG9A 3TO9A 3ZMDA 5E3NA 3LSRA 4EJVA 5LRRA 2DTZA 5LHHA 3Q5FA 2NYXA 1UZCA 2V9PA 4O5VA 5EYRA 1IRXA 5EGOA 3OYEA 2FEZA 2YR2A 1QPIA 1FOWA 2X1EA 2NS8A 3D0SA 1CGPA 2QSHX 1A31A 3WU2C 1TW3A 4E7KA 4L5IA 4X6AJ 2KIUA 1OCZH 1XC5A 4A6EA 3V7SA 4A5NA 1U8RA 2M7AA 3PFYA 1IC8A 5CKTA 3ZQIA 2AXLA 2NAZA 2LFBA 1WJDA 2X85A 1IRZA 2DBBA 5C4JJ 3AL0B 5DDGA 2IGOA 5B5EC 2H8RA 3HKZN 1RKTA 2CGPA 1FLIA 4I01A 1G4DA 2A6EF 2L9NA 4BBRJ 2KRCA 5M3MJ 4L5JA 1I3AA 1FP1D 2FXAA 4PGHA 2KPMA 5H6QA 1ZG5A 3F23A 3JREA 2OD5A 4UB8C 4HLXA 1KU3A 2VPLA 2BXZA 3TL4X 2Z16A 3HRTA 4DIQA 4RDUA 4BH9A 5CYVA 2KL4A 1RRJA 1UB9A 1GXPA 2GAUA 3VYRB 1N77A 1PYVA 2L5QA 4IRHA 1D1AA 3G2BA 3IC7A 4D5CA 1FYMA 2VL8A 1YYVA 2VASA 3LSHA 3QOPA 1GT0C 1BBYA 2IGMA 4LB6B 3Q0WA 3K4BA 3QYBA 2MD0A 3FMRA 4G6DA 1J9IA 3MKYB 4X1EA 2JA8J 3WTVC 4XLAA 2LVSA 1Z05A 4LK0F 3CD6I 1OYYA 2YPRA 3L2RA 5JLXA 3AFHA 3F8BA 1JKQC 3F9KA 2XGEA 2A6TA 3F6VA 1UHSA 4XLNF 1FMVA 3C3WA 3DWLE 5BPDA 4DZPA 4MTDA 3TBIA 1SAUA 3KYDB 3O3KA 1M1EB 3E3VA 1K4SA 3K1NA 1GLNA 2CW7A 4WXCA 1OKRA 4RGSA 3M1EA 1XSDA 1FPQA 1Y6IA 3V8KA 3J7AO 2KRFA 2MSYA 3G1LA 1HDDC 3TDUC 1MJAA 4P1WA 2L01A 3DPUA 2M87A 3FZVA 5FRMA 3KLOA 3JAMK 3ERED 2RVCA 1HA8A 3BT9A 1J2XA 2XPUA 2MG4A 4BUPA 1T2KA 4IHYA 2FBHA 4HF1A 2DPDA 1H9GA 1F1ZA 2K9NA 2HPIA 2YX7A 1WVRA 5DM6F 3CCSI 1EH7A 2GIVA 4KN4X 2M8GX 3BZKA 3IL2A 2OQRA 3ABUA 3BZCA 1W36D 1MMSA 3LQRA 3FHZA 3Q0UA 3CDHA 4ZJZA 2XVCA 2WADA 2XPWA 4A3GJ 2HTJA 1ZLKA 5E8IA 3GZ6A 3E0JB 1IXRC 1OLTA 2QUFA 4BY7J 2IT0A 2ID6A 2X6XA 2VJJA 2FA5A 1BR1A 3BPXA 4AIKA 1TLHB 1D5VA 3K4NA 3EUAA 1ZRFA 1ZREA 4MHGA 4RLFA 1O3QA 2ZO4A 2Y0SN 2MFZA 3GTLJ 3TP3A 2QQBA 4EATA 5LLQA 1L3LA 2HOAA 3TW6A 3J81K 1FBSA 1FC3A 1TL8A 2FRHA 2DK5A 2EINH 3LOCA 1X4OA 5ILSA 3Q9SA 2HYFA 2ELHA 3NAUA 5IOZA 1Y1VJ 5L3CA 2DT5A 1B4AA 5F1RA 1KU9A 3FKIJ 1HSTA 1X1AA 1ZN2A 2OPTA 2X51A 2CS3A 1DQUA 1PP8F 2A3SA 2F2EA 3ZQFA 3KP2A 2V4JC 3ZOBA 5H2FC 2LMDA 5LGTA 2HI3A 1DGRM 1DU6A 1W1WE 1F43A 1F5TA 1S72I 2GOMA 1Z3YA 3EPZA 4I2OA 3FISA 3RIRA 1FT9A 5KAIC 1MJBA 1W7PD 3O6BB 4WXDA 4E7JA 2F5FA 1Z3XA 3A0BC 3VSLA 1RR7A 3HHGA 3S3OA 2O9LA 4AM3A 3M1CA 5K7ZA 3DF8A 4II2A 4CXFA 1N78A 1W0TA 4Z2YA 2BBYA 2EZIA 4XN0A 3UNGC 3QYFA 1FYKA 1YS6A 4MGRA 4LK1F 4F93B 2DOFA 2LOOA 5E3MA 1JUSA 5GAHJ 4CDGA 5HDKA 3K2AA 2PEXA 4L9JA 2DAOA 1F36A 2CMPA 1OCOH 2DK8A 3B6AA 4GO1A 2EIMH 5JHFA 1PUEE 1KU7A 1MMNA 3K70C 2C6YA 5J40A 2EWNA 1VTNC 4RM2A 3HPHA 3HRSA 1W5SA 3GTMJ 4BAYA 1ZGWA 2P81A 1MDMA 4GRIA 2Q0OA 3LWFA 1NK2P 4HRIA 5IYDJ 3QU6A 3OS0A 2E7WA 4CHUA 1BR4A 1ZK8A 2QWWA 1GUUA 5FD5A 3PIOF 1DPRA 1W5TA 3OWTA 4LLGF 3K7AJ 2V1NA 1LKXA 5K5OA 4M3EA 5JVGF 5J3LA 3QOEA 3I5UA 5J4YA 1OPCA 1YQAA 3V8LA 3HL2A 3FX3A 1R9TJ 3OY9A 1U8BA 1ON1A 1KYZA 3F0CA 4G12A 3WE2A 5LFAA 2XAUA 2PI0A 1VZ0A 2LKXA 4FX4A 2DXIA 4M74A 4LG0A 4I6ZA 3P7NA 1TWFJ 2CQNA 3IRRA 4PK4A 1WRJA 5HODA 1S7AA 3KPHA 2E60A 3KEQA 5JI6A 3BTIA 1AKHA 5FROA 2BVMA 4I02A 2CW0F 3ZMSA 4BXUA 3OS2A 1JI8A 3I53A 3FBNB 3A1YA 3RKWA 2PG4A 1R5GA 4PJJA 3S17J 4XN3A 1BJAA 1USTA 3VYSB 4A3BJ 1GHCA 1FYLA 3LA2A 1R5ID 1OYWA 1S29A 2IBDA 1AA7A 1D0XA 3S2DJ 5EG0B 4A6DA 3BQYA 3CTAA 3L2VA
chains in the Genus database with same CATH topology
5CVVA 1U78A 2XROA 3ZMUA 1SFXA 3DXJF 3AAFA 1SD5A 2IPQX 2FU4A 3I58A 1Q1HA 3FXQA 1BIBA 3RYRA 5DD8A 2P6TA 3MZHA 1IRFA 2IP2A 4I0AA 5ERIA 1TQMA 2EFQA 1UHWA 2VC1A 2D2WA 2FE3A 2XKOA 4EJUA 2OU2A 4U7BA 3VEPA 3HTSB 3FM5A 2KIMA 2VOOA 1FBQA 5E20A 3QAHA 5IT9K 3TQNA 1HW2A 2V1UA 2HZTA 1R1VA 1JGSA 1MJ9A 4HA8A 4G7OF 4EMSA 2R3SA 4RAYA 2MD5A 1XDUA 2GXGA 2XKPA 3BZ6A 3GFMA 5D6EA 4NB5A 2VODA 5EEHA 3GF2A 1KQ9A 1I1SA 2PN6A 5J8CA 1HW5A 1S3JA 4M72A 4U7DA 3HSEA 5HDGA 2HQNA 3ZN0A 2P8TA 4KMUX 4G7HF 3RI4A 5AONA 1RI7A 4LB5A 2RKHA 1D8JA 4EJTA 2R7DA 2HWVA 2OZ6A 2V6CA 1U5TA 1ONVA 1REPC 3E6MA 2EFPA 2X0LA 5DD4A 3I59B 4BYYA 2ZMEA 3R0AA 3E6CC 4F7ZA 3I64A 3COAC 1IW7F 2UXXA 2Q8KA 1XSVA 3GLXA 2H94A 4GCVA 4OIQF 4RGUA 4OOIA 1OR7A 4LLNA 1T38A 3DPLC 1R7JA 3ZQ7A 1HBXG 3T8RA 4U0VA 1F4KA 5AIPA 1ODDA 3GYHX 3EETA 4Q47A 3U9GA 1B9NA 1BC7C 1OMIA 1U5TB 5FFZA 4EVIA 4HLYA 3WTZA 1DUXC 3HHHA 4B09A 2UZKA 4G7ZF 2MBFA 1AWCA 1T0FA 2LF7A 2E7XA 2W85A 4L9VA 2IA2A 4BNCA 3DEUA 1PDNC 1Z6RA 3F8MA 3LAPA 3V8JA 1QZZA 1DPUA 3HIFA 1WI9A 4AIHA 1R22A 5D8KB 4Y15A 2H27A 3BWGA 2COMA 1W7PB 4E70A 1P4AA 1KU2A 2ZJ2A 2VN2A 3IKTA 1D8KA 3OOPA 4HBLA 1LDKB 2JZYA 1USSA 1QNTA 4I0BA 1HSJA 4KUMA 4UVBA 2VC0A 5IT9Z 5DCMA 2OBPA 2NS0A 3B02A 1R36A 2H6BA 5CVRA 2EV6A 1K78A 4BHBA 1G3TA 1UFMA 2VBYA 5J6XA 4ENJA 2K86A 5CLSA 5D5VB 4I09A 5HS9A 2HFHA 4ENNA 2FMYA 1B59A 1G3YA 2Y48A 2QZ8A 3G3ZA 4OMYA 1FNNA 2VXZA 3CO7C 2UWMA 3RPUA 3P9CA 4OIRF 4IHTA 5KVRA 2Z33A 3E5UA 4A0XA 4P5OA 2STWA 1YLFA 4P9FA 1XCVA 1SFEA 2BEOA 3KZZA 5DUKA 4A2UA 3WTUC 4PCQA 5TJJA 3QRFF 2L4AA 1XB4A 4O3MA 3PQKA 4L18B 2F5EA 3HRMA 2M30A 4ENMA 1E17A 3LA7A 5TRDA 5JVTA 5E1XA 4M6XA 1SD4A 2JRTA 1S7OA 1J75A 4BHCA 4HF2A 2A61A 4M9SA 3N4MA 2Y0MA 2CSOA 2K4JA 3TOBA 2ACJA 2AS5F 3F21A 3RTRA 1J0RA 1YW9A 2Y75A 2WWYA 1FWZA 1H0MA 1PP7U 2EFOA 3FXUA 3NEUA 3KFWX 2XASA 4RGRA 4EJWA 3L7WA 4I7HA 5L3BA 2EV5A 3GFLA 2HS5A 4JBAA 1I6XA 2FBKA 4AWXB 1GVJA 3M7GA 4LFUA 5ICCA 1UHMA 2PBIA 2Z3YA 1ZRDA 2VE9A 2V1DA 3F72A 1QPMA 5HLHA 5LHGA 4OIOF 4HV6A 2MH2A 1FBUA 3P9IA 5JR3A 2HEOA 1TNSA 2QM3A 1XSXA 2BV6A 4WK8F 2P5KA 1O7FA 2RC4A 4FHTA 2JPCA 5FLXZ 1MD0A 2UXNA 1RIOH 4P9UA 2G9WA 1QGPA 1K78B 4M73A 3TOAA 5HOOA 4L0ZB 5D5WB 1ZG1A 2BYVE 1KQ0A 3O2PE 4KIBA 3TKYA 3GEZA 5E18F 3L2CA 3RPQA 3WU1B 1BI1A 3MWMA 3L9FA 2V79A 2DO7A 3FXRA 4OU0A 5DCFA 4HX8A 4XSZF 2JSCA 1W7PA 3KCCA 3SZTA 5BOXA 2RV8A 1OYIA 3EUHA 5DYMA 1Z1DA 4GYIA 2RGVA 1FSHA 5D5UB 3HTUA 4UVAA 3BOQA 1H9TA 1FZPB 2W84A 4YG2F 3I4PA 4CYDA 3ABTA 1U3EM 3CO6C 1BC8C 3MCZA 3V4GA 2BGCA 2ISZA 2NNYA 3QPTA 3WTYC 5JHUA 2A68F 1STZA 4Q48A 2IRFG 5LRSA 4P96A 3HSRA 5DV5A 4IF4A 3QU3A 3BP8A 3SQNA 1W4MA 4Y13A 2ESNA 2Z5UA 5BPIA 4ENKA 3J80K 2DQLA 2ZXJA 3WGIA 4A12A 4R79A 3HRUA 4RB1A 3MQ0A 2QBYA 2RQPA 1GXQA 4RAZA 1YIOA 4B8XA 2Q2EA 2IVMA 2HTSA 3NRVA 3BDDA 1MZBA 2FSWA 2D45A 1YO5C 3KP7A 3KEOA 2WV0A 3EQLF 3ZMVA 1HKTA 2DQRA 3RYPA 1BIAA 4R8HA 5LEJA 2K02A 3ELKA 4DQ2A 2QBYB 2JT1A 3HOTA 5AIQA 4LLLA 2W24A 2GXBA 2VBWA 3R0JA 2DU9A 2GA2A 4ASNA 5K5RA 3ULQB 1NHAA 4S05A 3L09A 3RJPA 4LD5A 2VOPA 3EYYA 3ZPLA 2CO5A 1JE8A 2EV0A 5L3FA 1ZHFA 1FOKA 4QLCU 2DI3A 2F5CA 3B73A 4IPAA 1B9MA 2QYOA 5BS6A 4CZZA 3KLNA 3F8FA 2XRNA 4UUVA 4XRFA 1YFHA 3K1MA 5DCMB 2XHKA 3JTGA 1HXDA 2J5PA 2W57A 3REOA 4KT5C 4YFXF 2XAHA 2QVOA 2P4WA 5E8GA 4HQMA 4ZYGA 3ZP5A 3ROUA 2VE8A 5L3EA 4D0PA 1F9NA 2EFNA 4U0WA 2IJLA 2M5WA 1L0OC 3JTHA 1ZGJA 5CVJA 3CUQB 2OAZA 2KIFA 4KA4A 3FM3A 1D3YA 2MH9A 1TNTA 2P5VA 2K4BA 2TDXA 3TGNA 1ZRCA 1YTYA 2FBIA 1QBJA 3QP6A 2A5YB 3VOEA 1MGTA 2R7FA 4JQFA 3H92A 1DDNA 3WODF 4UV9A 2HR3A 4KIGA 1XMKA 3HSFA 3CUOA 5CVIA 5FFXA 2V1XA 6PAXA 4UV8A 3E97A 2HOEA 1CF7B 5DEQA 4N9HA 3T5XA 3IWZA 5K5QA 3GFJA 5E17F 2OZUA 5BMZA 3MFKA 3KP3A 3GWZA 4GYGA 2L54A 1KGSA 1R23A 1RNLA 3K1PA 3GZ5A 3GW2A 3W6JB 1T6SA 5LGUA 4WXHA 1Z7UA 4KNYA 4HAMA 4UVCA 1O57A 2WTEA 5ICFA 3CLOA 4A0YA 3V7CA 3S2WA 3HYIA 2O03A 3KP6A 2B0LA 4RB3C 2NRAC 1TQPA 4Q5SF 2P5LC 1T39A 3H3UA 3C7JA 2MLKA 2CWEA 5FLXK 2LKPA 2JPBA 2XIGA 2FQ3A 2KJBA 4IHSA 1MKMA 1ON2A 1LDDA 3IRQA 2ZNZA 2XAFA 1DP7P 4CICA 1I5ZA 2LNBA 2XGXA 2A07F 2VT2A 2MC3A 4OIPF 4OMZA 5D5XB 3SZPA 2YU3A 4RB0A 5IT3A 4UXNA 2ZBKA 2LDUA 1G3SA 4IJAA 2V9VA 4WWCA 3F6OA 4EV0A 4GXOA 4HW0A 3E5QA 4IVNA 1WSUA 2M1BA 1R00A 4ZYDA 1IXCA 1KYWA 1K6OA 3DV8A 3ECHA 2A6HF 4FX0A 1LVAA 2L3DA 5D8LB 4PDKA 3I54A 4XLPF 2P6SA 5HDNA 5A2QK 3DPTA 4XSXF 5D6FA 1RUNA 3I59A 4KYWA 1R1UA 1O7LA 1IN6A 3LSTA 4R1HA 3WGGA 3BY6A 3CJNA 4ESBA 4AVPA 2ZNYA 3WG9A 3F8NA 3KP5A 3RKYA 3F3XA 4M9XA 2IA1A 1IF1A 4ETSA 5BQTA 1MDMB 2STTA 1FSEA 3WTSC 2PFBA 2GZWA 4HZFA 1T98A 2X4HA 1O3TA 3NQOA 1J59A 1LQ1A 1QO0D 2PJPA 4GGGA 4OINF 2DPUA 1I1GA 2EA4A 1K7AA 3CUQA 1S6LA 3R4KA 2M45A 1R58A 4MTEA 1P4XA 1ULYA 4MEXF 5LBQA 3IWFA 1Z6TA 2DLLA 3WE3A 1FX7A 1WQ2A 1Z9CA 4EJOA 2QQAA 2HKOA 5F6FA 4ON0A 5H6RA 5L3DA 1LEBA 4KDPA 1BM9A 4LGWA 4WF2A 2QLZA 1XD7A 1HQCA 2E1NA 3JW4A 2P7VB 2O3FA 2EK5A 2IA0A 4M9ZA 3K69A 3ZMZA 3G73A 3T8TA 5HVQC 4KN7X 3K2ZA 2EFWA 5D4SA 4UHTA 4N0BA 2GQQA 3KETA 3P9KA 1SMYF 1YW8A 2NNNA 1WKMA 4ESJA 4EM1A 1LB2A 3R61A 1IUYA 5CJ9A 4AD9A 1X3UA 3BPVA 1B6AA 1P92A 1HKSA 4MQ9F 2E1CA 2W25A 4YFNF 2HYGD 4IRGA 3E5XA 2JTVA 3U2RA 4EGZA 4Q4ZF 4LMYA 5LEKA 3ZMTA 3JSOA 3DP7A 2D1HA 4G94A 4IXAA 2H6CA 3PFIA 4M6YA 2Z9OA 1ZGAA 3DFGA 1FY7A 1FP2A 3FMSA 4BQAA 3TO6A 5FO5A 3C1DA 3WTTC 1LJ9A 1BI0A 3J80Z 3JSPA 5HS7A 1O3SA 1Y0UA 4YIIA 5ILVA 4HX7A 3U1DA 2VBXA 5ED4A 5JFRA 1JHFA 1J5YA 2O0YA 2RN7A 3PQJA 3C18A 4FT8A 4JK1X 3T1BA 2GA1A 1C0WA 4G9YA 4YIFA 2BE5F 1TTYA 2IW5A 2ZFWA 3KE2A 5J8FA 3M8FA 5A2QZ 2HKXA 3CUQC 3GXOA 2KJCA 3FF5A 4RGXA 3K9TA 2K27A 1ZH5A 2MA3A 5E1ZB 3VODA 2H09A 2FOKA 3SHFA 1RZ4A 3K0LA 5E1WA 1XDSA 1O3RA 4ZZLA 1IN7A 5KK1A 1LDJA 1SD7A 1UCRA 3J81Z 2ADUA 4AIJA 3IHUA 4A5MA 2HQRA 3DKWA 4NQWA 4HDUA 5K1YA 2LSOA 3ZN1A 5F64A 3F8CA 2O6GE 1XGOA 4CGZA 5H20A 1P2FA 2XAJA 1LEAA 3BJAA 4ZYHA 2K7LA 4KFCA 2CQKA 2Z99A 1Z91A 2A69F 1EH8A 1QQIA 2ISYA 1G3WA 3I0TA 1ZAOA 1ZG3A 1BN5A 3R60A 4K2EA 1BOAA 4L9TA 5D4RA 1JHHA 1ZYRF 3ML6A 1V4RA 3OV8A 3D5LA 2VT3A 2OQGA 1YW7A 3L00A 1G6NA 2QQ9A 1S8NA 3LAJA 1B1BA 4ZZDA 4HF0A 2DW4A 3MAJA 2M8EA 4L9NA 2P7CB 3WGHA 5ICGA 3GFIA 4ZH4F 4LG0B 1P6RA 3E6DA 2D1VA 3SFZA 4EGYA 3HUGA 4HOBA 5FD6A 1SD6A 4M71A 4CO8A 2QENA 1SMTA 4A0ZA 4S04A 4MNUA 2XUBA 1IN8A 3KP4A 4WCGA 4KMFA 5ILUA 2ESHA 4TV7A 4HDVA 2FF4A 2HGCA 2PMHA 3M9AA 2G7UA 3VFZA 3ISPA 2XAQA 2VONA 3GO5A 1HW1A 1ZLJA 1R1TA 3QPHA 2PMUA 2RNJA 3I71A 2HDCA 1QZYA 4DNCA 1SAXA 3HOSA 4UNOA 2LF8A 1XCBA 4NHJA 4LJZF 1EV7A 3LQQA 2CG4A 3TO7A 4EQQA 3LA3A 1XMAA 1P4WA 1TQIA 2KKOA 3LFKA 3MEXA 2PQ8A 4EM0B 3MZYA 4PZJA 2EA2A 3WTWC 5HS8A 4L0YB 4WX9A 5FB2A 3M8EA 1JXSA 3BJOA 1U2WA 4KICA 5LHIA 2FNAA 1SFUA 5ICEA 4RS8A 4XBFA 2FMLA 5EEGA 1TW2A 2MLGA 1HKQA 1R5HA 2EB7A 3R6SA 4YFKF 2O8XA 3GUDA 1IRGA 2F5DA 1IN4A 3GX4X 2DFIA 4QWQA 3IKVA 4I98B 3BJ6A 2YSRA 1BI2A 2ZMEB 2CFXA 2PLYA 2RDPA 2ETHA 1KQ8A 3GVAA 1LNWA 2YX4A 3BROA 4BHPA 1XGMA 2XV4S 5CVUA 1U5TC 4N9IA 5LGNA 1YG2A 1J7KA 3FMQA 3QP5A 3JAMZ 2OA4A 3FWEA 3W6KB 4H0EA 2EJRA 4IRIA 1A04A 1IXSB 4G8XA 1U6GA 4U0YA 3VB2A 3DQVC 1CF7A 1KA8A 1IZ1A 2GWRA 1BI3A 4ESFA 3RDIA 2O61A 1XN7A 2L4MA 2J5OA 2G7HA 4P55A 3E6BA 3N97A 1IN5A 2XAGA 2ZCWA 3EYIA 2L02A 1TBXA 2FNPA 3EDPA 2ZKZA 1WWXA 3KZYA 5HLGA 2WC2A 4U88A 2CYYA 2VBZA 5FGMA 3F22A 5DUIA 1IAWA 3Q9VA 4HYEA 3H3ZA 1EH6A 3RKXA 3V7RA 1XGNA 1K79A 3WU0A 4HV5A 4MQVA 4MEYF 1RUOA 4G6QA 4HX4A 4Y17A 4PGGA 4O6JA 3WTXC 2DTRA 1V3FA 4EM2A 1I27A 5HLIA 3TDZC 3ECOA 1ZARA 4RB2C 1YS7A 1AOYA 1E2XA 4KIFA 1XGSA 3T0YA 5L3GA 4HQEA 3SXYA 3TO9A 3ZMDA 4EJVA 5LRRA 5LHHA 3Q5FA 2NYXA 4O5VA 2FEZA 2YR2A 3D0SA 1CGPA 1TW3A 4L5IA 2KIUA 1L3LA 4A6EA 3V7SA 4A5NA 1U8RA 2AXLA 2NAZA 2DBBA 5DDGA 2CGPA 1FLIA 4I01A 1G4DA 2A6EF 4L5JA 2FXAA 1FP1D 4PGHA 5H6QA 1ZG5A 3F23A 2OD5A 4HLXA 1KU3A 3HRTA 4BH9A 5CYVA 1GXPA 1UB9A 2GAUA 4IRHA 3IC7A 1FYMA 1YYVA 3QOPA 1BBYA 4LB6B 3FMRA 4G6DA 1J9IA 3WTVC 1Z05A 4LK0F 1OYYA 2YPRA 3F8BA 3F6VA 4XLNF 3C3WA 5BPDA 4MTDA 3O3KA 3E3VA 3K1NA 4WXCA 1OKRA 4RGSA 3M1EA 1XSDA 1FPQA 3V8KA 3J7AO 2KRFA 3TDUC 1MJAA 2L01A 3FZVA 2M87A 3KLOA 3JAMK 3ERED 2RVCA 1J2XA 1T2KA 2FBHA 4HF1A 2DPDA 1H9GA 1F1ZA 2YX7A 1EH7A 2GIVA 4KN4X 3IL2A 2OQRA 3ABUA 3LQRA 3FHZA 3CDHA 2XVCA 2HTJA 1ZLKA 5E8IA 3GZ6A 1IXRC 2QUFA 2IT0A 2FA5A 3BPXA 4AIKA 1TLHB 1D5VA 1ZRFA 1ZREA 4MHGA 1O3QA 2ZO4A 2QQBA 5LLQA 3J81K 1FBSA 1FC3A 2FRHA 2DK5A 5ILSA 3Q9SA 2HYFA 2ELHA 5L3CA 2DT5A 1B4AA 5F1RA 1KU9A 1HSTA 1ZN2A 1PP8F 2A3SA 2F2EA 3KP2A 5LGTA 1F5TA 4I2OA 3RIRA 1FT9A 1MJBA 1W7PD 3O6BB 4WXDA 2F5FA 3HHGA 3DF8A 4CXFA 4Z2YA 2BBYA 1FYKA 1YS6A 4MGRA 4LK1F 4CDGA 5HDKA 2PEXA 4L9JA 2DAOA 2DK8A 4GO1A 1PUEE 1KU7A 2C6YA 2EWNA 1VTNC 3HRSA 1W5SA 4BAYA 1MDMA 2Q0OA 3LWFA 3QU6A 2E7WA 4CHUA 2QWWA 5FD5A 1DPRA 1W5TA 4LLGF 5K5OA 3I5UA 1OPCA 1YQAA 3V8LA 3FX3A 1ON1A 1KYZA 3WE2A 2PI0A 4FX4A 4M74A 4LG0A 3P7NA 3IRRA 1WRJA 1S7AA 3KEQA 5JI6A 4I02A 3ZMSA 2CW0F 4BXUA 3I53A 3RKWA 2PG4A 1R5GA 1BJAA 1USTA 1GHCA 1FYLA 3LA2A 1S29A 1OYWA 4A6DA 4ZYEA 3CTAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVV A;  1U78 A;  2XRO A;  3ZMU A;  1SFX A;  3DXJ F;  3AAF A;  1SD5 A;  2IPQ X;  2FU4 A;  3I58 A;  1Q1H A;  3FXQ A;  1BIB A;  3RYR A;  5DD8 A;  2P6T A;  3MZH A;  1IRF A;  2IP2 A;  4I0A A;  5ERI A;  1TQM A;  2EFQ A;  1UHW A;  2VC1 A;  2D2W A;  2FE3 A;  2XKO A;  4EJU A;  2OU2 A;  4U7B A;  3VEP A;  3HTS B;  3FM5 A;  2KIM A;  2VOO A;  1FBQ A;  5E20 A;  3QAH A;  5IT9 K;  3TQN A;  1HW2 A;  2V1U A;  2HZT A;  1R1V A;  1JGS A;  1MJ9 A;  4HA8 A;  4G7O F;  4EMS A;  2R3S A;  4RAY A;  2MD5 A;  1XDU A;  2GXG A;  2XKP A;  3BZ6 A;  3GFM A;  5D6E A;  4NB5 A;  2VOD A;  5EEH A;  3GF2 A;  1KQ9 A;  1I1S A;  2PN6 A;  5J8C A;  1HW5 A;  1S3J A;  4M72 A;  4U7D A;  3HSE A;  5HDG A;  2HQN A;  3ZN0 A;  2P8T A;  4KMU X;  4G7H F;  3RI4 A;  5AON A;  1RI7 A;  4LB5 A;  2RKH A;  1D8J A;  4EJT A;  2R7D A;  2HWV A;  2OZ6 A;  2V6C A;  1U5T A;  1ONV A;  1REP C;  3E6M A;  2EFP A;  2X0L A;  5DD4 A;  3I59 B;  4BYY A;  2ZME A;  3R0A A;  3E6C C;  4F7Z A;  3I64 A;  3COA C;  1IW7 F;  2UXX A;  2Q8K A;  1XSV A;  3GLX A;  2H94 A;  4GCV A;  4OIQ F;  4RGU A;  4OOI A;  1OR7 A;  4LLN A;  1T38 A;  3DPL C;  1R7J A;  3ZQ7 A;  1HBX G;  3T8R A;  4U0V A;  1F4K A;  5AIP A;  1ODD A;  3GYH X;  3EET A;  4Q47 A;  3U9G A;  1B9N A;  1BC7 C;  1OMI A;  1U5T B;  5FFZ A;  4EVI A;  4HLY A;  3WTZ A;  1DUX C;  3HHH A;  4B09 A;  2UZK A;  4G7Z F;  2MBF A;  1AWC A;  1T0F A;  2LF7 A;  2E7X A;  2W85 A;  4L9V A;  2IA2 A;  4BNC A;  3DEU A;  1PDN C;  1Z6R A;  3F8M A;  3LAP A;  3V8J A;  1QZZ A;  1DPU A;  3HIF A;  1WI9 A;  4AIH A;  1R22 A;  5D8K B;  4Y15 A;  2H27 A;  3BWG A;  2COM A;  1W7P B;  4E70 A;  1P4A A;  1KU2 A;  2ZJ2 A;  2VN2 A;  3IKT A;  1D8K A;  3OOP A;  4HBL A;  1LDK B;  2JZY A;  1USS A;  1QNT A;  4I0B A;  1HSJ A;  4KUM A;  4UVB A;  2VC0 A;  5IT9 Z;  5DCM A;  2OBP A;  2NS0 A;  3B02 A;  1R36 A;  2H6B A;  5CVR A;  2EV6 A;  1K78 A;  4BHB A;  1G3T A;  1UFM A;  2VBY A;  5J6X A;  4ENJ A;  2K86 A;  5CLS A;  5D5V B;  4I09 A;  5HS9 A;  2HFH A;  4ENN A;  2FMY A;  1B59 A;  1G3Y A;  2Y48 A;  2QZ8 A;  3G3Z A;  4OMY A;  1FNN A;  2VXZ A;  3CO7 C;  2UWM A;  3RPU A;  3P9C A;  4OIR F;  4IHT A;  5KVR A;  2Z33 A;  3E5U A;  4A0X A;  4P5O A;  2STW A;  1YLF A;  4P9F A;  1XCV A;  1SFE A;  2BEO A;  3KZZ A;  5DUK A;  4A2U A;  3WTU C;  4PCQ A;  5TJJ A;  3QRF F;  2L4A A;  1XB4 A;  4O3M A;  3PQK A;  4L18 B;  2F5E A;  3HRM A;  2M30 A;  4ENM A;  1E17 A;  3LA7 A;  5TRD A;  5JVT A;  5E1X A;  4M6X A;  1SD4 A;  2JRT A;  1S7O A;  1J75 A;  4BHC A;  4HF2 A;  2A61 A;  4M9S A;  3N4M A;  2Y0M A;  2CSO A;  2K4J A;  3TOB A;  2ACJ A;  2AS5 F;  3F21 A;  3RTR A;  1J0R A;  1YW9 A;  2Y75 A;  2WWY A;  1FWZ A;  1H0M A;  1PP7 U;  2EFO A;  3FXU A;  3NEU A;  3KFW X;  2XAS A;  4RGR A;  4EJW A;  3L7W A;  4I7H A;  5L3B A;  2EV5 A;  3GFL A;  2HS5 A;  4JBA A;  1I6X A;  2FBK A;  4AWX B;  1GVJ A;  3M7G A;  4LFU A;  5ICC A;  1UHM A;  2PBI A;  2Z3Y A;  1ZRD A;  2VE9 A;  2V1D A;  3F72 A;  1QPM A;  5HLH A;  5LHG A;  4OIO F;  4HV6 A;  2MH2 A;  1FBU A;  3P9I A;  5JR3 A;  2HEO A;  1TNS A;  2QM3 A;  1XSX A;  2BV6 A;  4WK8 F;  2P5K A;  1O7F A;  2RC4 A;  4FHT A;  2JPC A;  5FLX Z;  1MD0 A;  2UXN A;  1RIO H;  4P9U A;  2G9W A;  1QGP A;  1K78 B;  4M73 A;  3TOA A;  5HOO A;  4L0Z B;  5D5W B;  1ZG1 A;  2BYV E;  1KQ0 A;  3O2P E;  4KIB A;  3TKY A;  3GEZ A;  5E18 F;  3L2C A;  3RPQ A;  3WU1 B;  1BI1 A;  3MWM A;  3L9F A;  2V79 A;  2DO7 A;  3FXR A;  4OU0 A;  5DCF A;  4HX8 A;  4XSZ F;  2JSC A;  1W7P A;  3KCC A;  3SZT A;  5BOX A;  2RV8 A;  1OYI A;  3EUH A;  5DYM A;  1Z1D A;  4GYI A;  2RGV A;  1FSH A;  5D5U B;  3HTU A;  4UVA A;  3BOQ A;  1H9T A;  1FZP B;  2W84 A;  4YG2 F;  3I4P A;  4CYD A;  3ABT A;  1U3E M;  3CO6 C;  1BC8 C;  3MCZ A;  3V4G A;  2BGC A;  2ISZ A;  2NNY A;  3QPT A;  3WTY C;  5JHU A;  2A68 F;  1STZ A;  4Q48 A;  2IRF G;  5LRS A;  4P96 A;  3HSR A;  5DV5 A;  4IF4 A;  3QU3 A;  3BP8 A;  3SQN A;  1W4M A;  4Y13 A;  2ESN A;  2Z5U A;  5BPI A;  4ENK A;  3J80 K;  2DQL A;  2ZXJ A;  3WGI A;  4A12 A;  4R79 A;  3HRU A;  4RB1 A;  3MQ0 A;  2QBY A;  2RQP A;  1GXQ A;  4RAZ A;  1YIO A;  4B8X A;  2Q2E A;  2IVM A;  2HTS A;  3NRV A;  3BDD A;  1MZB A;  2FSW A;  2D45 A;  1YO5 C;  3KP7 A;  3KEO A;  2WV0 A;  3EQL F;  3ZMV A;  1HKT A;  2DQR A;  3RYP A;  1BIA A;  4R8H A;  5LEJ A;  2K02 A;  3ELK A;  4DQ2 A;  2QBY B;  2JT1 A;  3HOT A;  5AIQ A;  4LLL A;  2W24 A;  2GXB A;  2VBW A;  3R0J A;  2DU9 A;  2GA2 A;  4ASN A;  5K5R A;  3ULQ B;  1NHA A;  4S05 A;  3L09 A;  3RJP A;  4LD5 A;  2VOP A;  3EYY A;  3ZPL A;  2CO5 A;  1JE8 A;  2EV0 A;  5L3F A;  1ZHF A;  1FOK A;  4QLC U;  2DI3 A;  2F5C A;  3B73 A;  4IPA A;  1B9M A;  2QYO A;  5BS6 A;  4CZZ A;  3KLN A;  3F8F A;  2XRN A;  4UUV A;  4XRF A;  1YFH A;  3K1M A;  5DCM B;  2XHK A;  3JTG A;  1HXD A;  2J5P A;  2W57 A;  3REO A;  4KT5 C;  4YFX F;  2XAH A;  2QVO A;  2P4W A;  5E8G A;  4HQM A;  4ZYG A;  3ZP5 A;  3ROU A;  2VE8 A;  5L3E A;  4D0P A;  1F9N A;  2EFN A;  4U0W A;  2IJL A;  2M5W A;  1L0O C;  3JTH A;  1ZGJ A;  5CVJ A;  3CUQ B;  2OAZ A;  2KIF A;  4KA4 A;  3FM3 A;  1D3Y A;  2MH9 A;  1TNT A;  2P5V A;  2K4B A;  2TDX A;  3TGN A;  1ZRC A;  1YTY A;  2FBI A;  1QBJ A;  3QP6 A;  2A5Y B;  3VOE A;  1MGT A;  2R7F A;  4JQF A;  3H92 A;  1DDN A;  3WOD F;  4UV9 A;  2HR3 A;  4KIG A;  1XMK A;  3HSF A;  3CUO A;  5CVI A;  5FFX A;  2V1X A;  6PAX A;  4UV8 A;  3E97 A;  2HOE A;  1CF7 B;  5DEQ A;  4N9H A;  3T5X A;  3IWZ A;  5K5Q A;  3GFJ A;  5E17 F;  2OZU A;  5BMZ A;  3MFK A;  3KP3 A;  3GWZ A;  4GYG A;  2L54 A;  1KGS A;  1R23 A;  1RNL A;  3K1P A;  3GZ5 A;  3GW2 A;  3W6J B;  1T6S A;  5LGU A;  4WXH A;  1Z7U A;  4KNY A;  4HAM A;  4UVC A;  1O57 A;  2WTE A;  5ICF A;  3CLO A;  4A0Y A;  3V7C A;  3S2W A;  3HYI A;  2O03 A;  3KP6 A;  2B0L A;  4RB3 C;  2NRA C;  1TQP A;  4Q5S F;  2P5L C;  1T39 A;  3H3U A;  3C7J A;  2MLK A;  2CWE A;  5FLX K;  2LKP A;  2JPB A;  2XIG A;  2FQ3 A;  2KJB A;  4IHS A;  1MKM A;  1ON2 A;  1LDD A;  3IRQ A;  2ZNZ A;  2XAF A;  1DP7 P;  4CIC A;  1I5Z A;  2LNB A;  2XGX A;  2A07 F;  2VT2 A;  2MC3 A;  4OIP F;  4OMZ A;  5D5X B;  3SZP A;  2YU3 A;  4RB0 A;  5IT3 A;  4UXN A;  2ZBK A;  2LDU A;  1G3S A;  4IJA A;  2V9V A;  4WWC A;  3F6O A;  4EV0 A;  4GXO A;  4HW0 A;  3E5Q A;  4IVN A;  1WSU A;  2M1B A;  1R00 A;  4ZYD A;  1IXC A;  1KYW A;  1K6O A;  3DV8 A;  3ECH A;  2A6H F;  4FX0 A;  1LVA A;  2L3D A;  5D8L B;  4PDK A;  3I54 A;  4XLP F;  2P6S A;  5HDN A;  5A2Q K;  3DPT A;  4XSX F;  5D6F A;  1RUN A;  3I59 A;  4KYW A;  1R1U A;  1O7L A;  1IN6 A;  3LST A;  4R1H A;  3WGG A;  3BY6 A;  3CJN A;  4ESB A;  4AVP A;  2ZNY A;  3WG9 A;  3F8N A;  3KP5 A;  3RKY A;  3F3X A;  4M9X A;  2IA1 A;  1IF1 A;  4ETS A;  5BQT A;  1MDM B;  2STT A;  1FSE A;  3WTS C;  2PFB A;  2GZW A;  4HZF A;  1T98 A;  2X4H A;  1O3T A;  3NQO A;  1J59 A;  1LQ1 A;  1QO0 D;  2PJP A;  4GGG A;  4OIN F;  2DPU A;  1I1G A;  2EA4 A;  1K7A A;  3CUQ A;  1S6L A;  3R4K A;  2M45 A;  1R58 A;  4MTE A;  1P4X A;  1ULY A;  4MEX F;  5LBQ A;  3IWF A;  1Z6T A;  2DLL A;  3WE3 A;  1FX7 A;  1WQ2 A;  1Z9C A;  4EJO A;  2QQA A;  2HKO A;  5F6F A;  4ON0 A;  5H6R A;  5L3D A;  1LEB A;  4KDP A;  1BM9 A;  4LGW A;  4WF2 A;  2QLZ A;  1XD7 A;  1HQC A;  2E1N A;  3JW4 A;  2P7V B;  2O3F A;  2EK5 A;  2IA0 A;  4M9Z A;  3K69 A;  3ZMZ A;  3G73 A;  3T8T A;  5HVQ C;  4KN7 X;  3K2Z A;  2EFW A;  5D4S A;  4UHT A;  4N0B A;  2GQQ A;  3KET A;  3P9K A;  1SMY F;  1YW8 A;  2NNN A;  1WKM A;  4ESJ A;  4EM1 A;  1LB2 A;  3R61 A;  1IUY A;  5CJ9 A;  4AD9 A;  1X3U A;  3BPV A;  1B6A A;  1P92 A;  1HKS A;  4MQ9 F;  2E1C A;  2W25 A;  4YFN F;  2HYG D;  4IRG A;  3E5X A;  2JTV A;  3U2R A;  4EGZ A;  4Q4Z F;  4LMY A;  5LEK A;  3ZMT A;  3JSO A;  3DP7 A;  2D1H A;  4G94 A;  4IXA A;  2H6C A;  3PFI A;  4M6Y A;  2Z9O A;  1ZGA A;  3DFG A;  1FY7 A;  1FP2 A;  3FMS A;  4BQA A;  3TO6 A;  5FO5 A;  3C1D A;  3WTT C;  1LJ9 A;  1BI0 A;  3J80 Z;  3JSP A;  5HS7 A;  1O3S A;  1Y0U A;  4YII A;  5ILV A;  4HX7 A;  3U1D A;  2VBX A;  5ED4 A;  5JFR A;  1JHF A;  1J5Y A;  2O0Y A;  2RN7 A;  3PQJ A;  3C18 A;  4FT8 A;  4JK1 X;  3T1B A;  2GA1 A;  1C0W A;  4G9Y A;  4YIF A;  2BE5 F;  1TTY A;  2IW5 A;  2ZFW A;  3KE2 A;  5J8F A;  3M8F A;  5A2Q Z;  2HKX A;  3CUQ C;  3GXO A;  2KJC A;  3FF5 A;  4RGX A;  3K9T A;  2K27 A;  1ZH5 A;  2MA3 A;  5E1Z B;  3VOD A;  2H09 A;  2FOK A;  3SHF A;  1RZ4 A;  3K0L A;  5E1W A;  1XDS A;  1O3R A;  4ZZL A;  1IN7 A;  5KK1 A;  1LDJ A;  1SD7 A;  1UCR A;  3J81 Z;  2ADU A;  4AIJ A;  3IHU A;  4A5M A;  2HQR A;  3DKW A;  4NQW A;  4HDU A;  5K1Y A;  2LSO A;  3ZN1 A;  5F64 A;  3F8C A;  2O6G E;  1XGO A;  4CGZ A;  5H20 A;  1P2F A;  2XAJ A;  1LEA A;  3BJA A;  4ZYH A;  2K7L A;  4KFC A;  2CQK A;  2Z99 A;  1Z91 A;  2A69 F;  1EH8 A;  1QQI A;  2ISY A;  1G3W A;  3I0T A;  1ZAO A;  1ZG3 A;  1BN5 A;  3R60 A;  4K2E A;  1BOA A;  4L9T A;  5D4R A;  1JHH A;  1ZYR F;  3ML6 A;  1V4R A;  3OV8 A;  3D5L A;  2VT3 A;  2OQG A;  1YW7 A;  3L00 A;  1G6N A;  2QQ9 A;  1S8N A;  3LAJ A;  1B1B A;  4ZZD A;  4HF0 A;  2DW4 A;  3MAJ A;  2M8E A;  4L9N A;  2P7C B;  3WGH A;  5ICG A;  3GFI A;  4ZH4 F;  4LG0 B;  1P6R A;  3E6D A;  2D1V A;  3SFZ A;  4EGY A;  3HUG A;  4HOB A;  5FD6 A;  1SD6 A;  4M71 A;  4CO8 A;  2QEN A;  1SMT A;  4A0Z A;  4S04 A;  4MNU A;  2XUB A;  1IN8 A;  3KP4 A;  4WCG A;  4KMF A;  5ILU A;  2ESH A;  4TV7 A;  4HDV A;  2FF4 A;  2HGC A;  2PMH A;  3M9A A;  2G7U A;  3VFZ A;  3ISP A;  2XAQ A;  2VON A;  3GO5 A;  1HW1 A;  1ZLJ A;  1R1T A;  3QPH A;  2PMU A;  2RNJ A;  3I71 A;  2HDC A;  1QZY A;  4DNC A;  1SAX A;  3HOS A;  4UNO A;  2LF8 A;  1XCB A;  4NHJ A;  4LJZ F;  1EV7 A;  3LQQ A;  2CG4 A;  3TO7 A;  4EQQ A;  3LA3 A;  1XMA A;  1P4W A;  1TQI A;  2KKO A;  3LFK A;  3MEX A;  2PQ8 A;  4EM0 B;  3MZY A;  4PZJ A;  2EA2 A;  3WTW C;  5HS8 A;  4L0Y B;  4WX9 A;  5FB2 A;  3M8E A;  1JXS A;  3BJO A;  1U2W A;  4KIC A;  5LHI A;  2FNA A;  1SFU A;  5ICE A;  4RS8 A;  4XBF A;  2FML A;  5EEG A;  1TW2 A;  2MLG A;  1HKQ A;  1R5H A;  2EB7 A;  3R6S A;  4YFK F;  2O8X A;  3GUD A;  1IRG A;  2F5D A;  1IN4 A;  3GX4 X;  2DFI A;  4QWQ A;  3IKV A;  4I98 B;  3BJ6 A;  2YSR A;  1BI2 A;  2ZME B;  2CFX A;  2PLY A;  2RDP A;  2ETH A;  1KQ8 A;  3GVA A;  1LNW A;  2YX4 A;  3BRO A;  4BHP A;  1XGM A;  2XV4 S;  5CVU A;  1U5T C;  4N9I A;  5LGN A;  1YG2 A;  1J7K A;  3FMQ A;  3QP5 A;  3JAM Z;  2OA4 A;  3FWE A;  3W6K B;  4H0E A;  2EJR A;  4IRI A;  1A04 A;  1IXS B;  4G8X A;  1U6G A;  4U0Y A;  3VB2 A;  3DQV C;  1CF7 A;  1KA8 A;  1IZ1 A;  2GWR A;  1BI3 A;  4ESF A;  3RDI A;  2O61 A;  1XN7 A;  2L4M A;  2J5O A;  2G7H A;  4P55 A;  3E6B A;  3N97 A;  1IN5 A;  2XAG A;  2ZCW A;  3EYI A;  2L02 A;  1TBX A;  2FNP A;  3EDP A;  2ZKZ A;  1WWX A;  3KZY A;  5HLG A;  2WC2 A;  4U88 A;  2CYY A;  2VBZ A;  5FGM A;  3F22 A;  5DUI A;  1IAW A;  3Q9V A;  4HYE A;  3H3Z A;  1EH6 A;  3RKX A;  3V7R A;  1XGN A;  1K79 A;  3WU0 A;  4HV5 A;  4MQV A;  4MEY F;  1RUO A;  4G6Q A;  4HX4 A;  4Y17 A;  4PGG A;  4O6J A;  3WTX C;  2DTR A;  1V3F A;  4EM2 A;  1I27 A;  5HLI A;  3TDZ C;  3ECO A;  1ZAR A;  4RB2 C;  1YS7 A;  1AOY A;  1E2X A;  4KIF A;  1XGS A;  3T0Y A;  5L3G A;  4HQE A;  3SXY A;  3TO9 A;  3ZMD A;  4EJV A;  5LRR A;  5LHH A;  3Q5F A;  2NYX A;  4O5V A;  2FEZ A;  2YR2 A;  3D0S A;  1CGP A;  1TW3 A;  4L5I A;  2KIU A;  1L3L A;  4A6E A;  3V7S A;  4A5N A;  1U8R A;  2AXL A;  2NAZ A;  2DBB A;  5DDG A;  2CGP A;  1FLI A;  4I01 A;  1G4D A;  2A6E F;  4L5J A;  2FXA A;  1FP1 D;  4PGH A;  5H6Q A;  1ZG5 A;  3F23 A;  2OD5 A;  4HLX A;  1KU3 A;  3HRT A;  4BH9 A;  5CYV A;  1GXP A;  1UB9 A;  2GAU A;  4IRH A;  3IC7 A;  1FYM A;  1YYV A;  3QOP A;  1BBY A;  4LB6 B;  3FMR A;  4G6D A;  1J9I A;  3WTV C;  1Z05 A;  4LK0 F;  1OYY A;  2YPR A;  3F8B A;  3F6V A;  4XLN F;  3C3W A;  5BPD A;  4MTD A;  3O3K A;  3E3V A;  3K1N A;  4WXC A;  1OKR A;  4RGS A;  3M1E A;  1XSD A;  1FPQ A;  3V8K A;  3J7A O;  2KRF A;  3TDU C;  1MJA A;  2L01 A;  3FZV A;  2M87 A;  3KLO A;  3JAM K;  3ERE D;  2RVC A;  1J2X A;  1T2K A;  2FBH A;  4HF1 A;  2DPD A;  1H9G A;  1F1Z A;  2YX7 A;  1EH7 A;  2GIV A;  4KN4 X;  3IL2 A;  2OQR A;  3ABU A;  3LQR A;  3FHZ A;  3CDH A;  2XVC A;  2HTJ A;  1ZLK A;  5E8I A;  3GZ6 A;  1IXR C;  2QUF A;  2IT0 A;  2FA5 A;  3BPX A;  4AIK A;  1TLH B;  1D5V A;  1ZRF A;  1ZRE A;  4MHG A;  1O3Q A;  2ZO4 A;  2QQB A;  5LLQ A;  3J81 K;  1FBS A;  1FC3 A;  2FRH A;  2DK5 A;  5ILS A;  3Q9S A;  2HYF A;  2ELH A;  5L3C A;  2DT5 A;  1B4A A;  5F1R A;  1KU9 A;  1HST A;  1ZN2 A;  1PP8 F;  2A3S A;  2F2E A;  3KP2 A;  5LGT A;  1F5T A;  4I2O A;  3RIR A;  1FT9 A;  1MJB A;  1W7P D;  3O6B B;  4WXD A;  2F5F A;  3HHG A;  3DF8 A;  4CXF A;  4Z2Y A;  2BBY A;  1FYK A;  1YS6 A;  4MGR A;  4LK1 F;  4CDG A;  5HDK A;  2PEX A;  4L9J A;  2DAO A;  2DK8 A;  4GO1 A;  1PUE E;  1KU7 A;  2C6Y A;  2EWN A;  1VTN C;  3HRS A;  1W5S A;  4BAY A;  1MDM A;  2Q0O A;  3LWF A;  3QU6 A;  2E7W A;  4CHU A;  2QWW A;  5FD5 A;  1DPR A;  1W5T A;  4LLG F;  5K5O A;  3I5U A;  1OPC A;  1YQA A;  3V8L A;  3FX3 A;  1ON1 A;  1KYZ A;  3WE2 A;  2PI0 A;  4FX4 A;  4M74 A;  4LG0 A;  3P7N A;  3IRR A;  1WRJ A;  1S7A A;  3KEQ A;  5JI6 A;  4I02 A;  3ZMS A;  2CW0 F;  4BXU A;  3I53 A;  3RKW A;  2PG4 A;  1R5G A;  1BJA A;  1UST A;  1GHC A;  1FYL A;  3LA2 A;  1S29 A;  1OYW A;  4A6D A;  4ZYE A;  3CTA A; 
#chains in the Genus database with same CATH topology
 1VFC A;  5CVV A;  2XB5 A;  1U78 A;  2XRO A;  3ZMU A;  1SFX A;  3DXJ F;  3AAF A;  1SD5 A;  2R5Z B;  3RKQ A;  2IPQ X;  3ONQ A;  4F3Q A;  1HLV A;  2FU4 A;  3HOV J;  3I58 A;  4YEL A;  1Q1H A;  1LFB A;  3FXQ A;  1BIB A;  2GM4 A;  3OYJ A;  3RYR A;  5DD8 A;  2DMQ A;  2K40 A;  1Y39 A;  2P6T A;  3K4M A;  3MZH A;  2BOL A;  3H0D A;  1O4X A;  1IRF A;  5DM7 F;  2IP2 A;  4I0A A;  5ERI A;  1TQM A;  2EFQ A;  4V19 K;  1UHW A;  2VC1 A;  2D2W A;  2FUG 2;  2FE3 A;  2XKO A;  4EJU A;  1ETQ A;  2OU2 A;  4N4O B;  4U7B A;  2K9Q A;  2DYR H;  3FKJ A;  3VEP A;  2KLO A;  1SVM A;  3HTS B;  2LRE A;  3FM5 A;  2KIM A;  4C9Y A;  3PSI A;  2VB6 A;  2VOO A;  1FBQ A;  5E20 A;  3QAH A;  4A3E J;  5IT9 K;  3TQN A;  5F0H A;  1HW2 A;  1QHG A;  4XM3 A;  4BU2 A;  2V1U A;  1WH5 A;  4BS9 A;  2HZT A;  3QQA A;  1R1V A;  1JGS A;  1I50 J;  2VKD A;  1HOM A;  1MJ9 A;  4HA8 A;  2VI6 A;  4G7O F;  3BCA A;  4EMS A;  1B8I B;  1HF0 A;  2R3S A;  4RAY A;  2MD5 A;  1XDU A;  2GXG A;  5HLT A;  3VSK A;  2XKP A;  3BZ6 A;  3GFM A;  5D6E A;  4CCO A;  5GPC A;  4NB5 A;  4D9J A;  2VOD A;  5EEH A;  4E7Z A;  3C2G A;  4HST A;  3GF2 A;  1KQ9 A;  2LC2 A;  3BQZ A;  1I1S A;  2PN6 A;  5J8C A;  1HW5 A;  5KHD A;  2E2I J;  1LUJ B;  1S3J A;  2JQ7 A;  4M72 A;  3OIQ A;  3HSE A;  4U7D A;  5HDG A;  2HQN A;  3ZN0 A;  2P8T A;  4KMU X;  4G7H F;  3W2A A;  3RI4 A;  2F5V A;  5AON A;  1Y1W J;  1RI7 A;  4LB5 A;  1AHD P;  2WAQ N;  4HEA 2;  2RKH A;  1D8J A;  1RET A;  1EJ9 A;  4EJT A;  2R7D A;  2HWV A;  2OZ6 A;  3HBL A;  1V5G A;  2LY2 A;  3CF2 A;  2JMW A;  1Y8R B;  2V6C A;  1N25 A;  3A01 A;  3UKG A;  5M5W J;  2Z2S B;  1U5T A;  3PNV A;  4Z6Y A;  3K6G A;  3RPU D;  1ONV A;  1REP C;  3E6M A;  4BBS J;  2EFP A;  4XLE A;  3EUK L;  1EA3 A;  2X0L A;  5DD4 A;  3I59 B;  4BYY A;  1B72 B;  3L2W A;  1MSF C;  2COB A;  2ZME A;  1X1P A;  2QSG X;  4BJ6 C;  3RZO J;  3PNT A;  3R0A A;  3AKZ A;  5IP7 J;  3E6C C;  4F7Z A;  2LK2 A;  3I64 A;  3IAM 2;  3COA C;  1IW7 F;  2DT6 A;  4NC7 A;  2UXX A;  2H1L A;  1ETY A;  2Q8K A;  1XSV A;  3GLX A;  2H94 A;  4GCV A;  4CCK A;  2LP0 A;  4OIQ F;  2W7N A;  4RGU A;  1EF4 A;  4OOI A;  1OR7 A;  1YE9 A;  4LLN A;  1T38 A;  3DPL C;  1R7J A;  1X1C A;  3OYF A;  3ZQ7 A;  1HBX G;  1BJZ A;  5EJC A;  4IZZ A;  1UG2 A;  3T8R A;  2A05 A;  4U0V A;  1F4K A;  1JUP A;  3I56 I;  2DA6 A;  5AIP A;  2WY7 Q;  1CQT A;  1ORK A;  1ODD A;  2CFO A;  3GYH X;  3EET A;  4Q47 A;  2LH9 A;  2W82 A;  2CJJ A;  3U9G A;  1B9N A;  1BC7 C;  2V6E A;  4NQW B;  1OMI A;  2K9S A;  4LIU A;  1E3P A;  1A6Q A;  4AUX A;  1PUF A;  1WJF A;  2E5Z A;  1U5T B;  2AO9 A;  3LSK A;  5FFZ A;  4EVI A;  4HLY A;  3WTZ A;  3C2H A;  1P9Q C;  3DTK A;  1MMD A;  1DUX C;  3HHH A;  3KIO A;  4B09 A;  2UZK A;  2DJI A;  4G7Z F;  3HXL A;  4XOR A;  3DBR B;  3OYB A;  2MBF A;  2WAE A;  1AWC A;  1T0F A;  2HXO A;  4BE1 A;  2LF7 A;  2E7X A;  2W85 A;  2DOE A;  4XID A;  2VLA A;  4L9V A;  2IA2 A;  4BNC A;  3DEU A;  5GAD J;  1V5F A;  1OFC X;  1Z6R A;  1PDN C;  3F8M A;  3LAP A;  3V8J A;  2CQ7 A;  3HUG B;  2HZD A;  3IH2 A;  1QZZ A;  2R92 J;  4D7N A;  1DPU A;  3ASN H;  3HIF A;  2VJI A;  1WI9 A;  3OYK A;  2BY1 A;  2PJR B;  4AIH A;  1R22 A;  2BW3 B;  5D8K B;  4Y15 A;  1JJ8 C;  2LTP A;  1JJ6 C;  2H27 A;  1GV5 A;  2L7M P;  3BWG A;  2COM A;  1HCR A;  3D1N I;  2ZFU A;  1Z21 A;  4I99 C;  2DDB A;  2JA7 J;  1TT5 B;  1W7P B;  2RNG A;  1SAN A;  4E70 A;  2LG4 A;  3M8J A;  2L7K A;  1P4A A;  2HDD A;  1OCT C;  2DFE A;  3IH3 A;  1KU2 A;  2ZJ2 A;  1APL C;  2VKE A;  2VN2 A;  3IKT A;  1D8K A;  4FCY A;  4JYK A;  3OOP A;  1YHQ I;  4U87 A;  4HBL A;  1LDK B;  2JZY A;  4XOT A;  1USS A;  1QNT A;  4I0B A;  4NC6 A;  4AYB N;  5M5Y J;  1ETK A;  1HSJ A;  4KUM A;  4UVB A;  3BG5 A;  3H36 A;  2VC0 A;  5IT9 Z;  4JX5 A;  2OUM A;  5DCM A;  4XKB A;  2WA0 A;  3PSF A;  2OBP A;  4BE2 A;  1WI3 A;  2NS0 A;  2HVS A;  1GV2 A;  3B02 A;  3X2Q H;  9ANT A;  1R36 A;  2H6B A;  5CVR A;  2EV6 A;  1K78 A;  2ID3 A;  2CUE A;  4BHB A;  1G3T A;  2DOD A;  1UFM A;  2VBY A;  5J6X A;  4ENJ A;  2K86 A;  2VXD A;  2R5Y B;  5CLS A;  5HNF A;  3CLQ A;  3DLA A;  5D5V B;  4I09 A;  3WG7 H;  1RKW A;  1T0F C;  2GOX B;  3FXJ A;  2WB1 N;  1QZE A;  5HS9 A;  1R71 A;  3RQ4 A;  2HFH A;  3A02 A;  4E6K G;  3OOU A;  4ENN A;  2FMY A;  1SFO J;  1B59 A;  1WJE A;  4HNT A;  2KQR A;  1G3Y A;  2HU9 A;  2Y48 A;  4XRS G;  2QZ8 A;  2V26 A;  3G3Z A;  2L9V A;  4OMY A;  4JX4 A;  1FNN A;  3PM1 A;  1G2H A;  2M34 A;  2VXZ A;  4H4K C;  5KCM A;  3KYL A;  5IP9 J;  3CO7 C;  4G6T B;  1QA6 A;  2M0C A;  1VQ4 I;  2Y30 A;  1YJ9 I;  2UWM A;  2QSF X;  3RPU A;  3P9C A;  4OIR F;  4BKX A;  4XL9 A;  4IHT A;  1ZR2 A;  5IYB J;  5KVR A;  2Z33 A;  2VJ5 A;  2WV1 A;  1ETO A;  3E5U A;  1RES A;  4P5O A;  4A0X A;  1JKR C;  2STW A;  2XGD A;  2XSJ C;  5J4V A;  3OL3 A;  1YLF A;  2VKV A;  2VQH A;  2Q2E B;  4P9F A;  1XCV A;  4CUG A;  4CSW A;  1SFE A;  4RA2 A;  2BEO A;  2X48 A;  2MC4 A;  4Y52 J;  3KZZ A;  2H8W A;  5DUK A;  4A2U A;  3WTU C;  2Y2Z A;  4PCQ A;  3OYM A;  5TJJ A;  5FJ8 J;  3PL8 A;  3H9Q A;  2L4A A;  3QRF F;  1SEU A;  1XB4 A;  2E34 A;  3S1N J;  1ERD A;  3CJQ B;  4DYQ A;  3L1P A;  4O3M A;  3PQK A;  3PNY A;  4L18 B;  2R5Z A;  2KDO A;  1TT0 A;  2F5E A;  3HRM A;  2M30 A;  5J1R A;  4ENM A;  1E17 A;  2XDV A;  3LA7 A;  3I4M J;  2OC6 A;  5TRD A;  5JVT A;  5E1X A;  4M6X A;  4QPO A;  1E3H A;  1EKE A;  1SD4 A;  3PJR A;  2TRT A;  2QF7 A;  1YX3 A;  2NOJ B;  2UV1 A;  2HVR A;  2JRT A;  3DTE A;  1S7O A;  3CDL A;  4UUS A;  3ZQG A;  2I10 A;  3FBI B;  2QKL B;  1J75 A;  4LG3 A;  4BHC A;  4HF2 A;  2A61 A;  4M9S A;  3N4M A;  3DKY A;  2Y0M A;  3FK7 A;  2CSO A;  3H35 A;  2K4J A;  3TOB A;  3LSM A;  2JWT A;  1W5C C;  2ACJ A;  2AS5 F;  3F21 A;  1OCR H;  4CYC B;  3RTR A;  2ICW G;  3IH4 A;  1J0R A;  1YW9 A;  3RCO A;  2Y75 A;  2WWY A;  4M6V A;  3JRC A;  1FWZ A;  4HSR A;  2R7U A;  1H0M A;  1MBH A;  3G71 I;  1S7E A;  5F08 A;  2OF7 A;  1PP7 U;  4LIT A;  1KON A;  3E7L A;  2EFO A;  3FXU A;  3NEU A;  3KFW X;  2XAS A;  4RGR A;  4EJW A;  3L7W A;  4A69 C;  4I7H A;  3L2Q A;  5L3B A;  2EV5 A;  3GFL A;  2KFD A;  1RC9 A;  2HS5 A;  4JBA A;  1I6X A;  2KT0 A;  1BL0 A;  2DA1 A;  2FBK A;  3H9J A;  4AWX B;  1GVJ A;  2JRM A;  3A03 A;  3M7G A;  4LFU A;  5ICC A;  1UHM A;  4XNF A;  2Z3Y A;  2PBI A;  1T56 A;  5IY5 H;  2R7Z J;  3ABL H;  1ZRD A;  2KIQ A;  2VE9 A;  2WAQ A;  4UB6 C;  3OIP A;  2V1D A;  3MVP A;  2KZG A;  5FKL A;  3F72 A;  1QPM A;  5B3S H;  2JN6 A;  5HLH A;  3CP8 A;  5LHG A;  4OIO F;  4HV6 A;  2MH2 A;  1FBU A;  4JOM A;  1QVT A;  3I3L A;  4DYR A;  4BXF A;  3P9I A;  1XX5 A;  1SC7 A;  1Y0N A;  5JR3 A;  3GME A;  2HEO A;  1TNS A;  4MFE A;  2QM3 A;  2N8G A;  1XSX A;  2F4O B;  2BV6 A;  4A3K J;  3ZQL A;  4WK8 F;  2P5K A;  4IOA F;  1O7F A;  3DU6 A;  3OR2 C;  4A3F J;  2CU7 A;  3D5R C;  2RC4 A;  4FHT A;  2JPC A;  5FLX Z;  1MD0 A;  2UXN A;  1MNE A;  2L0K A;  4PJN A;  1RIO H;  2R7Q A;  2R5Y A;  4P9U A;  1SFK A;  2G9W A;  5GTI C;  2F4M B;  1QGP A;  2A5W A;  1K78 B;  4XON A;  4M73 A;  3TOA A;  5HOO A;  4L0Z B;  1LPQ A;  5D5W B;  1ZG1 A;  2BYV E;  4KIT B;  1KQ0 A;  1I6H J;  4HPQ A;  3O2P E;  4KIB A;  1MBE A;  3TKY A;  3GEZ A;  3SEQ A;  5E18 F;  3L2C A;  2LR8 A;  2R7W A;  3RPQ A;  3WU1 B;  2W1O A;  2M3A A;  3DKX A;  2IXS A;  4V2G A;  1BI1 A;  5GP9 A;  3MWM A;  3L9F A;  1YIJ I;  1V54 H;  3BG7 A;  2V79 A;  2DO7 A;  3FXR A;  3PO3 J;  2R7R A;  2NS7 A;  2K3P A;  4ZDP A;  4XOP A;  3DCF A;  4OU0 A;  5F04 A;  2DMT A;  1D1B A;  5DCF A;  4HX8 A;  4RAG A;  4XSZ F;  2R7V A;  2MGQ A;  4BEH B;  2JSC A;  1W7P A;  1X2N A;  3KCC A;  3K70 D;  3SZT A;  3RZD J;  2RV8 A;  5BOX A;  1OYI A;  3EUH A;  2JK3 A;  5DYM A;  1Z1D A;  4GYI A;  2RGV A;  2HNH A;  1FSH A;  2XF6 A;  5D5U B;  3HTU A;  4UVA A;  3OMY A;  1GVD A;  3BOQ A;  4M3D A;  1MBF A;  3GBG A;  1H9T A;  1FZP B;  4BY1 J;  3HEF A;  4ZYA A;  1B8I A;  2W84 A;  4YG2 F;  3I4P A;  4CYD A;  3S3N A;  3H3V K;  4BQO A;  4F92 B;  4ZC3 A;  3ABT A;  1U3E M;  4BXX J;  4QIW N;  3CO6 C;  1BC8 C;  3MCZ A;  2ZXW H;  3V4G A;  2BGC A;  3G1M A;  2ISZ A;  3BTJ A;  2PX9 A;  2NNY A;  3LMM A;  3QPT A;  2QA4 I;  3WTY C;  2DA7 A;  5JHU A;  2A68 F;  1STZ A;  4Q48 A;  2F48 A;  4OAZ A;  2IRF G;  4AC0 A;  2IEK A;  5E79 C;  2DA4 A;  2VIX A;  4P96 A;  5LRS A;  3D5S C;  3HSR A;  5DV5 A;  3W2W A;  1XG1 A;  2R7X A;  3MZ8 A;  4IL6 C;  3N05 A;  1JGG A;  2DA2 A;  4IF4 A;  3CCJ I;  3QU3 A;  3PUF A;  3P5J A;  4FE7 A;  2ME0 A;  3M3Y J;  3BP8 A;  3SQN A;  1QRY A;  5KNL A;  1W4M A;  4Y13 A;  5FLM J;  5IP6 A;  2ESN A;  2Z5U A;  5BPI A;  4ENK A;  3J80 K;  4UUS B;  2DQL A;  2ZXJ A;  3WGI A;  1PJR A;  4CZC A;  4A12 A;  4R79 A;  4ZTF A;  3HRU A;  2ZME C;  1NG6 A;  2IS6 A;  4FAS D;  4RB1 A;  3MQ0 A;  2BY2 A;  2Q1Z B;  1WJC A;  5C4X J;  2YU9 J;  2QBY A;  2RQP A;  1U9N A;  1GXQ A;  3CES A;  4RAZ A;  1YIO A;  3FXO A;  4J19 A;  5IYC J;  2W00 A;  5IOY A;  4B8X A;  2Q2E A;  1MND A;  2IVM A;  2HOT A;  2HTS A;  4F91 B;  3NRV A;  2E2J J;  3BDD A;  1MZB A;  2TCT A;  3HZJ A;  1Y56 A;  2VQC A;  2FSW A;  2D45 A;  3ASO H;  4OWR B;  2L7Z A;  1R4M B;  1YO5 C;  3KP7 A;  1E3O C;  3KEO A;  2X6Y A;  2WV0 A;  3EQL F;  2ZJR F;  1VND A;  3H0G J;  1FIP A;  3ZMV A;  1HKT A;  4KJZ A;  3RSN A;  2VKH A;  3VWB A;  1Y8Q B;  2DQR A;  3RYP A;  1BIA A;  3MMY B;  4R8H A;  5LEJ A;  2K02 A;  2KIS A;  3ELK A;  4DQ2 A;  2QBY B;  2JT1 A;  3HOT A;  4GFB A;  5AIQ A;  3H1C A;  4LLL A;  2W24 A;  1FEX A;  2GXB A;  4XLF A;  2VBW A;  3ESW B;  4FET A;  3R0J A;  2DU9 A;  2VQG A;  2GA2 A;  3JRB A;  4ASN A;  5K5R A;  3ULQ B;  1NHA A;  3CMA I;  2EPF A;  5FKO A;  4S05 A;  3L09 A;  2HDW A;  3RJP A;  4LD5 A;  2VOP A;  5BNG A;  4A3I J;  3VPR A;  3EYY A;  3ZPL A;  1YRN B;  2CO5 A;  4B4C A;  1JE8 A;  2DCE A;  2EV0 A;  5L3F A;  1ZHF A;  1ENH A;  4QLC U;  1FOK A;  2DI3 A;  1WPK A;  3ZRG A;  2F5C A;  2EIJ H;  2L7F P;  3B73 A;  1NG7 A;  4B3A A;  4IPA A;  1B9M A;  2QYO A;  1VI0 A;  2V7F A;  5BS6 A;  4RAF A;  4CZZ A;  3MKW B;  3KLN A;  3F8F A;  2XRN A;  2FJ1 A;  2RQQ A;  4UUV A;  1I39 A;  1ETW A;  3OYA A;  4XRF A;  1K4T A;  1YFH A;  3WHC A;  3K1M A;  5DCM B;  2JVG A;  2XHK A;  5F27 A;  3JTG A;  1HXD A;  3FXL A;  3CC7 I;  2J5P A;  2W57 A;  3REO A;  4ABZ A;  4KT5 C;  3G6E I;  4YFX F;  2XAH A;  2E36 A;  2QVO A;  3HGG A;  5C3E J;  3VYT B;  5FKK A;  2P4W A;  3JR9 A;  5E8G A;  4BEH A;  4HQM A;  4Y3O A;  1IG7 A;  4ZYG A;  3ZP5 A;  1X2M A;  1YIT I;  3ROU A;  2O8K A;  1ZR4 A;  2VE8 A;  2BY0 A;  5L3E A;  2W4S A;  4D0P A;  1F9N A;  2EFN A;  4U0W A;  2IJL A;  2M5W A;  1L0O C;  3JTH A;  3ZQC A;  1ZGJ A;  5CVJ A;  3CUQ B;  2OAZ A;  3LSP A;  2KIF A;  1FOY A;  3CC2 I;  4KA4 A;  3FM3 A;  1D3Y A;  2MH9 A;  1TNT A;  2P5V A;  2K4B A;  3GTJ J;  2TDX A;  3IUO A;  3DEE A;  3TGN A;  3GZN B;  3OYH A;  4C2T A;  1ZRC A;  3OYG A;  1HC8 A;  1YTY A;  1LE8 A;  2FBI A;  3W6V A;  2E1M B;  2UUZ A;  1QBJ A;  2VUM J;  3QP6 A;  2A5Y B;  2KHM A;  3CJR B;  3CP2 A;  4B43 A;  1VQK I;  2H1K A;  3VOE A;  1MGT A;  2R7F A;  4JQF A;  3H92 A;  1MBG A;  5E3O A;  3CC4 I;  5GTH C;  2I8D A;  1DDN A;  1BR2 A;  2WY8 Q;  4RM3 A;  3WOD F;  4UV9 A;  2HR3 A;  1V5E A;  4CCJ A;  4KIG A;  1D0Y A;  4IKF A;  1XMK A;  3SYT A;  3HSF A;  2CW8 A;  3CUO A;  2CV0 A;  1PUF B;  1U0J A;  4C3J J;  3C2B A;  4Y4R A;  5CVI A;  5FFX A;  2V1X A;  4E7H A;  1DP3 A;  3QWL A;  6PAX A;  2X6W A;  1YJN I;  4UV8 A;  3E97 A;  4IQJ A;  4N4N B;  5F0C A;  2B63 J;  2HOE A;  1WJ5 A;  3L2U A;  1CF7 B;  5DEQ A;  4QPQ A;  2L9S A;  2LBF B;  2DFF A;  4N9H A;  3CCM I;  3HOY J;  4A3J J;  3T5X A;  3IWZ A;  5K5Q A;  2NOG A;  3GFJ A;  3O8H A;  3SEZ A;  5E17 F;  5EZG A;  1N75 A;  2OZU A;  3IAS 2;  2GIZ A;  2FX0 A;  4ITV A;  2R0Q C;  5BMZ A;  3ZGK A;  4XQF A;  3MFK A;  3KP3 A;  1R4N B;  3GWZ A;  4GYG A;  1OQY A;  1VQ7 I;  2L54 A;  3AG1 H;  4UUT A;  3BG6 A;  1ACI A;  4F55 A;  1KGS A;  2DN0 A;  1TC3 C;  2IGK A;  1R23 A;  1RNL A;  3K1P A;  3GZ5 A;  1ZTR A;  3GW2 A;  3W6J B;  5F1J A;  1T6S A;  4M3B A;  5LGU A;  1IO2 A;  5C44 J;  2BZT A;  4XKV A;  4MLO A;  1ITY A;  2EBI A;  4WXH A;  1Z7U A;  4KNY A;  4CH7 A;  1D0Z A;  3VYU B;  4AID A;  2OTJ I;  4II3 A;  2E19 A;  2HOS A;  2R7S A;  2LRD A;  4F52 A;  2Y69 H;  1I3Q J;  4YRV A;  4HAM A;  4UVC A;  3HOX J;  2JVH A;  2M4G A;  2OCE A;  1O57 A;  2WTE A;  5ICF A;  3CLO A;  3V7C A;  4A0Y A;  1ETX A;  3S2W A;  3I4N J;  3HYI A;  2O03 A;  4EEF G;  5GAE J;  2ZSI B;  4AVZ A;  3KP6 A;  2B0L A;  2CQQ A;  2LYC A;  4RB3 C;  2NRA C;  1TQP A;  1W0U A;  4Q5S F;  5TIS C;  3TW7 A;  2VQL A;  2P5L C;  1T39 A;  3H3U A;  3C7J A;  1MMG A;  3JRH A;  2MLK A;  2CWE A;  5FLX K;  4HG2 A;  1VQN I;  2R93 J;  2IS1 A;  2LLK A;  2LKP A;  2XGC A;  4FQG A;  4RMN A;  1K6Y A;  2JPB A;  3OIO A;  2CV1 A;  2XIG A;  2FQ3 A;  3SJM A;  1TWH J;  4C2M J;  2KMU A;  2KJB A;  4IHS A;  1MKM A;  3FHN A;  1ON2 A;  3GTQ J;  3G4S I;  4D5F A;  2MYS A;  1LDD A;  3IRQ A;  5JLW A;  2ZNZ A;  5DS9 A;  1S5L C;  1TP4 A;  2XAF A;  2DOA A;  3AG3 H;  4PJM A;  4CIC A;  4DYC A;  1DP7 P;  1I5Z A;  1QU3 A;  1UMQ A;  2LNB A;  3CMM A;  4IHW A;  2XGX A;  2A07 F;  4B48 A;  2VT2 A;  1IDY A;  2MC3 A;  3ZR8 X;  4OIP F;  1TZL A;  4OMZ A;  5D5X B;  3SZP A;  2BHZ A;  3AG2 H;  2YU3 A;  3CCE I;  4RB0 A;  5IT3 A;  3PIP F;  4UXN A;  2X9D A;  3HOZ J;  4JX6 A;  2ZBK A;  2QEX I;  4XRS A;  4B44 A;  2LDU A;  1VF9 A;  2VJ4 A;  1G3S A;  2OCC H;  4IJA A;  2V9V A;  1G8X A;  2LY1 A;  3TP0 A;  4B3X A;  3CZ6 A;  5K7H A;  4WWC A;  2XPV A;  3F6O A;  2LKS A;  2XB0 X;  2QGU A;  3S32 A;  4EV0 A;  4GXO A;  4HW0 A;  3FDY A;  4PJL A;  5TGT A;  1JT6 A;  3E5Q A;  2CH0 A;  1PVE A;  4IVN A;  3HB9 A;  1WSU A;  2M1B A;  1R00 A;  2NVY J;  4CYC A;  4ZYD A;  1IXC A;  1KYW A;  3O8G A;  1K6O A;  5J1U A;  3DV8 A;  3ECH A;  2A6H F;  3QYE A;  4FX0 A;  1LVA A;  2L3D A;  5D8L B;  4PDK A;  1JTY A;  3Q0V A;  3IP4 B;  3I54 A;  4E7S A;  3GLL A;  4XLP F;  2I5U A;  1YJW I;  2P6S A;  5IPA A;  3DU5 A;  1AKH B;  1D5Y A;  3CMY A;  5HDN A;  5A2Q K;  3DPT A;  2K9L A;  4XSX F;  1ZKG A;  2W48 A;  3S16 J;  4IQ4 A;  1A6I A;  5D6F A;  1RUN A;  3CCR I;  3I59 A;  4A3M J;  2XF5 A;  4KYW A;  2BY3 A;  5CQG A;  4S0H B;  1QVU A;  1P7I A;  1R1U A;  3HGY A;  1O7L A;  1IN6 A;  2MW8 A;  3LL7 A;  3LST A;  4R1H A;  3WGG A;  3BY6 A;  3CJN A;  4ESB A;  1JT0 A;  2ZNY A;  4AVP A;  3WG9 A;  3F8N A;  3KP5 A;  4XIC A;  3BR5 A;  3RKY A;  2NVT J;  3F3X A;  2WAF A;  1MH3 A;  4M9X A;  2IA1 A;  2E1O A;  3HOW J;  3KEY A;  1MBJ A;  3H5N A;  1IF1 A;  4Y33 A;  4D7M A;  3JCU C;  4ETS A;  3S2H J;  2E1M C;  5BQT A;  2HXI A;  1MDM B;  1IV6 A;  1FSE A;  1POG A;  4NUB A;  3WTS C;  2R7O A;  2STT A;  2PFB A;  2NXN B;  4E4H A;  4HNU A;  3OYC A;  4E7L A;  2F4I A;  4ZDO A;  2GZW A;  4HZF A;  5B1B H;  1T98 A;  3BC8 A;  2X4H A;  1O3T A;  4DZJ A;  3NQO A;  1J59 A;  1BA5 A;  2DA5 A;  1LQ1 A;  1QO0 D;  2PJP A;  4GGG A;  2YS9 A;  3V42 A;  4OIN F;  1WH7 A;  3BR1 A;  2DPU A;  1I1G A;  2EA4 A;  3J7A Y;  1K7A A;  3CUQ A;  3SDB A;  4E7I A;  1S6L A;  1BOB A;  5F0F A;  3R4K A;  2M45 A;  1MNM C;  3DBL B;  1R58 A;  1MW7 A;  4PSW A;  1TWC J;  4MTE A;  1P4X A;  1ULY A;  4MEX F;  5LBQ A;  1IGN A;  2AXT C;  2JA2 A;  4XKC A;  3WHB A;  3IWF A;  3SZG A;  1Z6T A;  2DLL A;  3WE3 A;  1FX7 A;  1WQ2 A;  3K4C A;  4D1Q A;  2FOW A;  4NNJ A;  4A3C J;  1VQO I;  5J47 A;  1Z9C A;  4EJO A;  2QQA A;  2HKO A;  5F6F A;  2EZH A;  1Z67 A;  4ON0 A;  4XLH A;  5H6R A;  5L3D A;  1OCP A;  1LEB A;  4A3L J;  4KDP A;  4RBO A;  1BM9 A;  2IAI A;  3H5R A;  5CPR B;  3OS1 A;  3S1R J;  5EGO B;  1VQL I;  1GDT A;  4LGW A;  3SDG A;  2OJE D;  1FTZ A;  2Y31 A;  4WF2 A;  2QLZ A;  1X1B A;  1XD7 A;  2JSP A;  4BGD A;  2V9K A;  1HQC A;  3JRF A;  2E1N A;  4W97 A;  1VQP I;  3JW4 A;  1UAA A;  4UY8 I;  4CCL A;  3OYI A;  1JUM A;  2P7V B;  3CCQ I;  2O3F A;  2EK5 A;  2IA0 A;  4M9Z A;  2ELJ A;  1V55 H;  2M7B A;  3K69 A;  3ZMZ A;  1VQ8 I;  3S3M A;  1WJA A;  1YOV B;  5CQE A;  3G73 A;  3M07 A;  2JUC A;  3GTK J;  2ZXI A;  1BW5 A;  3CQZ J;  3T8T A;  5HVQ C;  1XPX A;  3IV5 A;  3S8P A;  1T95 A;  2LD5 A;  2XRL A;  3J7Z I;  3CCV I;  2IS2 A;  4KN7 X;  3I55 I;  4J00 A;  3K2Z A;  2EFW A;  1JTX A;  5D4S A;  3S1Q J;  2P0W A;  4UHT A;  3RQI A;  3H5A A;  4N0B A;  4XLC A;  3JRG A;  2GQQ A;  3KET A;  3DBH B;  3P9K A;  1SMY F;  4XK4 A;  1YW8 A;  2NNN A;  2EIL H;  1TWA J;  2X1C A;  1WKM A;  1SVL A;  4ESJ A;  4EM1 A;  2ECB A;  2Y9Z A;  3R61 A;  2FQ4 A;  3QPS A;  1LB2 A;  1X19 A;  4DW6 A;  1OIS A;  1IUY A;  5CJ9 A;  4AD9 A;  1X3U A;  3BPV A;  1A36 A;  1B6A A;  4ZTJ A;  1P92 A;  3PUB A;  3ZCO A;  1FOX A;  4RLQ A;  1HKS A;  4MQ9 F;  2HPM A;  2E1C A;  3W2V A;  2W25 A;  4KT6 A;  4YFN F;  4CA0 A;  2HYG D;  2KP6 A;  4IO9 F;  5B1A H;  4IRG A;  4C2U A;  3E5X A;  2JTV A;  3OSF A;  3VDX A;  3U2R A;  4EGZ A;  4Q4Z F;  2DA3 A;  3HC7 A;  1LVK A;  2DJN A;  3DTI A;  1MSE C;  3BR0 A;  4LMY A;  5LEK A;  3ZMT A;  5K7F A;  3JSO A;  3BR2 A;  3DP7 A;  4XKW A;  2D1H A;  4G94 A;  1VQ5 I;  3OL4 A;  4IXA A;  2H6C A;  3PFI A;  2D5V A;  3M4O J;  4M6Y A;  5M5X J;  1ETV A;  2YUS A;  4C3I J;  4IX7 A;  1ZGA A;  3DFG A;  4NDL A;  3K10 A;  2Z9O A;  1FY7 A;  1FP2 A;  1X3Z B;  2LBF A;  4IOC F;  1FMW A;  3FMS A;  4BQA A;  2BW3 A;  4JP0 A;  2Z1D A;  3H9G A;  3TO6 A;  2M4K A;  2M0M A;  5FO5 A;  3C1D A;  3WTT C;  1LJ9 A;  1BI0 A;  3J80 Z;  1VQ6 I;  2IGN A;  3JSP A;  3OSG A;  3ABM H;  5HS7 A;  5EF6 A;  1O3S A;  1FIA A;  3FIW A;  1Y0U A;  2M9H A;  4YII A;  1P7J A;  2ZJP F;  2WB1 A;  3MKL A;  3BR3 A;  2IS4 A;  5ILV A;  1X4P A;  3TED A;  4HX7 A;  4YIR X;  3U1D A;  3U21 A;  4XRM A;  2VBX A;  5ED4 A;  3GTG J;  2JUG A;  5JFR A;  1T08 B;  1JHF A;  1J5Y A;  2O0Y A;  2RN7 A;  3C18 A;  3PQJ A;  4FT8 A;  1FTT A;  1OJL A;  4JK1 X;  1Z0X A;  3HPG A;  1D1C A;  3T1B A;  2E71 A;  3CJT B;  2GA1 A;  1C0W A;  3LSI A;  1WZ2 A;  5HNH A;  4G9Y A;  2EZK A;  4YIF A;  2GBY A;  3KX2 A;  3TMO A;  5EEA A;  2BE5 F;  1VQ9 I;  1NK3 P;  2K85 A;  2NVU B;  1TTY A;  3UR3 C;  2IW5 A;  2ZFW A;  3J7Y J;  2FD5 A;  4AYB A;  3KE2 A;  5J8F A;  1T8I A;  3OYN A;  3M8F A;  1X3W B;  5A2Q Z;  4BE0 A;  2HKX A;  3CUQ C;  4NBQ A;  2XC7 A;  2NVX J;  3GXO A;  2KJC A;  1SVO A;  3FF5 A;  4RGX A;  3K9T A;  2K27 A;  4BDZ A;  1ZH5 A;  2MA3 A;  3CCU I;  5E1Z B;  3VOD A;  2H09 A;  3W3C A;  4BQQ A;  1MH4 A;  2FOK A;  2R4G A;  3FK6 A;  1QHH D;  2DMN A;  2ZB9 A;  4W1U A;  2RRE A;  2ME6 A;  3SHF A;  1FJL A;  1X1D A;  1RZ4 A;  3BG9 A;  3K0L A;  2DFH A;  3MD2 A;  2BXY A;  2PMZ N;  5E1W A;  1XDS A;  1O3R A;  4ZZL A;  1IN7 A;  1VQM I;  5KK1 A;  1LDJ A;  4CCM A;  1SD7 A;  1DU0 A;  2CRG A;  1B72 A;  1UCR A;  3J81 Z;  2ADU A;  4KIS A;  4AIJ A;  3IHU A;  4A5M A;  1OCC H;  2HQR A;  3DKW A;  5FKN A;  3HDD A;  3LSG A;  4IHV A;  1Q1V A;  2ZXH A;  1U9O A;  4NQW A;  3ZXS A;  4HDU A;  5K1Y A;  2GXA A;  4IEJ A;  2O5R A;  2CQX A;  3A01 B;  2LSO A;  1BW6 A;  3ZN1 A;  5F64 A;  5GPA A;  3CME I;  3F8C A;  4OAY A;  2O6G E;  1XGO A;  4XR6 A;  5H20 A;  2DYS H;  4CGZ A;  1P2F A;  2XAJ A;  1IJW C;  2DDA A;  1LEA A;  2DT7 B;  1WFX A;  3BJA A;  4ZYH A;  2K7L A;  4KFC A;  2NVQ J;  2CQK A;  1H88 C;  1UJ8 A;  1Z91 A;  2Z99 A;  2A69 F;  1EH8 A;  2CUF A;  1JKO C;  1YX5 A;  2B7E A;  2JJ7 A;  3U1K A;  1QQI A;  2ISY A;  1UG0 A;  4PUS A;  1G3W A;  3I0T A;  2B9S A;  1ZAO A;  2KRH A;  1ZG3 A;  1BN5 A;  3R60 A;  4K2E A;  1BOA A;  4L9T A;  2K5C A;  3HKZ A;  5D4R A;  2R7T A;  1DGW Y;  1JHH A;  1ZYR F;  3ML6 A;  2G0E A;  1V4R A;  1X58 A;  3OV8 A;  3CDI A;  1S9H A;  3D5L A;  4M3G A;  2VT3 A;  3OR1 C;  2OQG A;  2X6O A;  3ABK H;  1YW7 A;  3K4J A;  3L00 A;  3NWS A;  4B1R A;  1HDP A;  1G6N A;  1LE8 B;  2QQ9 A;  1IV8 A;  4LIV A;  1S8N A;  4BL0 B;  3LAJ A;  1B1B A;  5LD2 C;  2MAB A;  1WJB A;  4ZZD A;  4HF0 A;  2DW4 A;  3MAJ A;  2M8E A;  4L9N A;  5GAG J;  4A93 J;  2P7C B;  2HVQ A;  4A3D J;  1RPW A;  2XF7 A;  2X1D A;  3WGH A;  5ICG A;  3S15 J;  2QCO A;  3DLL F;  3GFI A;  2QKM B;  1H89 C;  3S1M J;  3ERM A;  2L2O A;  3SFI A;  4BQN A;  3AL0 C;  3MKZ A;  4ZH4 F;  2AQF A;  4LG0 B;  1P6R A;  3E6D A;  1TWG J;  2D1V A;  4L5E A;  2ECC A;  3SFZ A;  3HUG A;  4EGY A;  3GTP J;  4HOB A;  5FD6 A;  2KZV A;  1SD6 A;  1Z7L A;  2JA5 J;  4M71 A;  2KDZ A;  4CO8 A;  2XSD C;  2QEN A;  4AU7 A;  1SMT A;  4A0Z A;  3LNQ A;  2EIK H;  4S04 A;  4MNU A;  2XUB A;  1IN8 A;  3FXM A;  1NH3 A;  3EUH C;  4MFD A;  3BTC A;  3KP4 A;  4WCG A;  4KMF A;  5ILU A;  2ESH A;  4TV7 A;  4DBQ A;  3GTO J;  2DMU A;  4HDV A;  2FF4 A;  2HGC A;  2PMH A;  3M9A A;  1LFU P;  4B47 A;  1A5J A;  2G7U A;  3VFZ A;  3ISP A;  2XAQ A;  2VON A;  3GO5 A;  1HW1 A;  1ZLJ A;  1ZQ3 P;  1R1T A;  2ZC2 A;  3QPH A;  2PMU A;  2RNJ A;  4GDF A;  2K3F A;  1A35 A;  3I71 A;  1XMX A;  2HDC A;  3A4C A;  4PFP A;  1QZY A;  4PSX A;  4DNC A;  1E0E A;  4BJT A;  5DTD A;  3ZQQ A;  4Y7N J;  3HOS A;  1SAX A;  1R6R A;  2GLO A;  3S14 J;  4UNO A;  2AQE A;  2LF8 A;  1XCB A;  4NHJ A;  4LJZ F;  1EV7 A;  3LQQ A;  4QSH A;  2CG4 A;  2M2E A;  3TO7 A;  4EQQ A;  2BHY A;  3JRD A;  3MN2 A;  3LA3 A;  5FKM A;  1XMA A;  1P4W A;  1TQI A;  2KKO A;  3LFK A;  4XMY A;  5FLV A;  5FRN A;  3MEX A;  2PQ8 A;  4EM0 B;  3HM5 A;  1IDZ A;  3MZY A;  4PZJ A;  2EA2 A;  3WTW C;  2ZJQ F;  5HS8 A;  4DOZ A;  1MBK A;  4L0Y B;  4WX9 A;  4C30 A;  5FB2 A;  3M8E A;  3KZI C;  1JXS A;  3BJO A;  4BAC A;  2O7O A;  4QTR A;  2E2H J;  3KYC B;  5EDN A;  1U2W A;  2Y9Y A;  4KIC A;  4C3H J;  5LHI A;  3GCM A;  2FNA A;  1SFU A;  3BLY A;  5ICE A;  5EG0 A;  4RS8 A;  2EZL A;  2CUZ A;  4XBF A;  2FML A;  5EEG A;  1TW2 A;  2MLG A;  1HKQ A;  1R49 A;  1R5H A;  4ZDL A;  2EB7 A;  3R6S A;  4YFK F;  2PMZ A;  2O8X A;  3BCB A;  3GUD A;  1IRG A;  2F5D A;  1NTC A;  1LFP A;  1IN4 A;  3A2K A;  3GX4 X;  3Q3S A;  4M3F A;  4X0G A;  2K9M A;  2DFI A;  4QWQ A;  3IKV A;  4HNV A;  4I98 B;  1Z77 A;  1H8A C;  2VPR A;  3BJ6 A;  2YSR A;  1BI2 A;  2CUJ A;  2ZME B;  2CFX A;  1XTA A;  2PLY A;  2RDP A;  2ETH A;  1KQ8 A;  3GVA A;  2JA6 J;  1LNW A;  2YX4 A;  4MO7 A;  3BRO A;  4BHP A;  1XGM A;  2HQ5 A;  2Y0S A;  2ZSH B;  2XV4 S;  5CVU A;  4IHX A;  1U5T C;  4N9I A;  5LGN A;  3CF5 F;  1YG2 A;  2LY9 A;  1J7K A;  1K83 J;  5M3F J;  3FMQ A;  3QP5 A;  3JAM Z;  2OA4 A;  4CCN A;  3FWE A;  4PJ0 C;  3BG3 A;  3W6K B;  4MIM A;  4H0E A;  2HQA A;  3OYD A;  2EJR A;  3DEW A;  4IRI A;  1A04 A;  4I76 A;  1IXS B;  1AU7 A;  5EZH A;  1WHU A;  2L9R A;  4G8X A;  1U6G A;  1OR7 C;  4U0Y A;  3S93 A;  3VB2 A;  2QQ8 A;  1MMA A;  1WCM J;  2E35 A;  3DQV C;  1CF7 A;  3BR6 A;  3FXK A;  2EQR A;  1KA8 A;  4BDY A;  1IZ1 A;  1WGX A;  2HYJ A;  3LSJ A;  2GWR A;  1BI3 A;  3NAR A;  4ESF A;  3RDI A;  2O61 A;  1XN7 A;  2L4M A;  2J5O A;  4BJ5 C;  2G7H A;  4P55 A;  4LOC A;  4ZYE A;  1UEL B;  3E6B A;  1RR8 C;  2ELK A;  3N97 A;  1IN5 A;  1J09 A;  2XAG A;  2ZCW A;  3HJE A;  3EYI A;  2L02 A;  3QPL A;  1TBX A;  2WBM A;  3CCY A;  2AHQ A;  1W36 C;  3K4L A;  3I9V 2;  2FNP A;  3EDP A;  4V2F A;  2ZKZ A;  3BTL A;  1WWX A;  3KZY A;  4YEJ A;  3CCL I;  2PJR A;  1ZEL A;  5HLG A;  4DBR A;  2WC2 A;  5J1Y A;  4U88 A;  2CYY A;  2VBZ A;  5FGM A;  3ZQH A;  3F22 A;  5DUI A;  1IAW A;  3Q9V A;  3AG4 H;  4HYE A;  4ANJ A;  3H3Z A;  1EH6 A;  2EH3 A;  3G1O A;  3RKX A;  3V7R A;  3JRI A;  4DJA A;  3QOD A;  5KAF C;  1KZH A;  1K61 A;  4PFO A;  1XGN A;  2OTL I;  3K4K A;  1K79 A;  3WU0 A;  5E3L A;  1T33 A;  4HV5 A;  4MQV A;  4DGW B;  1YI2 I;  4MEY F;  4FE4 A;  3HOU J;  2BVL A;  2DMP A;  1RUO A;  2RAE A;  1MIJ A;  2F6C A;  4G6Q A;  4HX4 A;  3E1S A;  1JKP C;  4Y17 A;  4FTH A;  4PGG A;  3A0H C;  4NC8 A;  1IUF A;  4O6J A;  3WTX C;  2DTR A;  1YRN A;  1V3F A;  4EM2 A;  4J01 A;  4FIS A;  1I27 A;  3NWT A;  5B66 C;  5HLI A;  3OYL A;  1G59 A;  2CV2 A;  1XS9 A;  3LFU A;  3B6C A;  3TDZ C;  3ECO A;  1ZAR A;  4RB2 C;  2E5N A;  1YS7 A;  1AOY A;  1E2X A;  4KIF A;  1XGS A;  3PO2 J;  3JRA A;  2OV7 A;  3T0Y A;  5L3G A;  4HQE A;  3SXY A;  3HG9 A;  3TO9 A;  3ZMD A;  5E3N A;  3LSR A;  4EJV A;  5LRR A;  2DTZ A;  5LHH A;  3Q5F A;  2NYX A;  1UZC A;  2V9P A;  4O5V A;  5EYR A;  1IRX A;  5EGO A;  3OYE A;  2FEZ A;  2YR2 A;  1QPI A;  1FOW A;  2X1E A;  2NS8 A;  3D0S A;  1CGP A;  2QSH X;  1A31 A;  3WU2 C;  1TW3 A;  4E7K A;  4L5I A;  4X6A J;  2KIU A;  1OCZ H;  1XC5 A;  4A6E A;  3V7S A;  4A5N A;  1U8R A;  2M7A A;  3PFY A;  1IC8 A;  5CKT A;  3ZQI A;  2AXL A;  2NAZ A;  2LFB A;  1WJD A;  2X85 A;  1IRZ A;  2DBB A;  5C4J J;  3AL0 B;  5DDG A;  2IGO A;  5B5E C;  2H8R A;  3HKZ N;  1RKT A;  2CGP A;  1FLI A;  4I01 A;  1G4D A;  2A6E F;  2L9N A;  4BBR J;  2KRC A;  5M3M J;  4L5J A;  1I3A A;  1FP1 D;  2FXA A;  4PGH A;  2KPM A;  5H6Q A;  1ZG5 A;  3F23 A;  3JRE A;  2OD5 A;  4UB8 C;  4HLX A;  1KU3 A;  2VPL A;  2BXZ A;  3TL4 X;  2Z16 A;  3HRT A;  4DIQ A;  4RDU A;  4BH9 A;  5CYV A;  2KL4 A;  1RRJ A;  1UB9 A;  1GXP A;  2GAU A;  3VYR B;  1N77 A;  1PYV A;  2L5Q A;  4IRH A;  1D1A A;  3G2B A;  3IC7 A;  4D5C A;  1FYM A;  2VL8 A;  1YYV A;  2VAS A;  3LSH A;  3QOP A;  1GT0 C;  1BBY A;  2IGM A;  4LB6 B;  3Q0W A;  3K4B A;  3QYB A;  2MD0 A;  3FMR A;  4G6D A;  1J9I A;  3MKY B;  4X1E A;  2JA8 J;  3WTV C;  4XLA A;  2LVS A;  1Z05 A;  4LK0 F;  3CD6 I;  1OYY A;  2YPR A;  3L2R A;  5JLX A;  3AFH A;  3F8B A;  1JKQ C;  3F9K A;  2XGE A;  2A6T A;  3F6V A;  1UHS A;  4XLN F;  1FMV A;  3C3W A;  3DWL E;  5BPD A;  4DZP A;  4MTD A;  3TBI A;  1SAU A;  3KYD B;  3O3K A;  1M1E B;  3E3V A;  1K4S A;  3K1N A;  1GLN A;  2CW7 A;  4WXC A;  1OKR A;  4RGS A;  3M1E A;  1XSD A;  1FPQ A;  1Y6I A;  3V8K A;  3J7A O;  2KRF A;  2MSY A;  3G1L A;  1HDD C;  3TDU C;  1MJA A;  4P1W A;  2L01 A;  3DPU A;  2M87 A;  3FZV A;  5FRM A;  3KLO A;  3JAM K;  3ERE D;  2RVC A;  1HA8 A;  3BT9 A;  1J2X A;  2XPU A;  2MG4 A;  4BUP A;  1T2K A;  4IHY A;  2FBH A;  4HF1 A;  2DPD A;  1H9G A;  1F1Z A;  2K9N A;  2HPI A;  2YX7 A;  1WVR A;  5DM6 F;  3CCS I;  1EH7 A;  2GIV A;  4KN4 X;  2M8G X;  3BZK A;  3IL2 A;  2OQR A;  3ABU A;  3BZC A;  1W36 D;  1MMS A;  3LQR A;  3FHZ A;  3Q0U A;  3CDH A;  4ZJZ A;  2XVC A;  2WAD A;  2XPW A;  4A3G J;  2HTJ A;  1ZLK A;  5E8I A;  3GZ6 A;  3E0J B;  1IXR C;  1OLT A;  2QUF A;  4BY7 J;  2IT0 A;  2ID6 A;  2X6X A;  2VJJ A;  2FA5 A;  1BR1 A;  3BPX A;  4AIK A;  1TLH B;  1D5V A;  3K4N A;  3EUA A;  1ZRF A;  1ZRE A;  4MHG A;  4RLF A;  1O3Q A;  2ZO4 A;  2Y0S N;  2MFZ A;  3GTL J;  3TP3 A;  2QQB A;  4EAT A;  5LLQ A;  1L3L A;  2HOA A;  3TW6 A;  3J81 K;  1FBS A;  1FC3 A;  1TL8 A;  2FRH A;  2DK5 A;  2EIN H;  3LOC A;  1X4O A;  5ILS A;  3Q9S A;  2HYF A;  2ELH A;  3NAU A;  5IOZ A;  1Y1V J;  5L3C A;  2DT5 A;  1B4A A;  5F1R A;  1KU9 A;  3FKI J;  1HST A;  1X1A A;  1ZN2 A;  2OPT A;  2X51 A;  2CS3 A;  1DQU A;  1PP8 F;  2A3S A;  2F2E A;  3ZQF A;  3KP2 A;  2V4J C;  3ZOB A;  5H2F C;  2LMD A;  5LGT A;  2HI3 A;  1DGR M;  1DU6 A;  1W1W E;  1F43 A;  1F5T A;  1S72 I;  2GOM A;  1Z3Y A;  3EPZ A;  4I2O A;  3FIS A;  3RIR A;  1FT9 A;  5KAI C;  1MJB A;  1W7P D;  3O6B B;  4WXD A;  4E7J A;  2F5F A;  1Z3X A;  3A0B C;  3VSL A;  1RR7 A;  3HHG A;  3S3O A;  2O9L A;  4AM3 A;  3M1C A;  5K7Z A;  3DF8 A;  4II2 A;  4CXF A;  1N78 A;  1W0T A;  4Z2Y A;  2BBY A;  2EZI A;  4XN0 A;  3UNG C;  3QYF A;  1FYK A;  1YS6 A;  4MGR A;  4LK1 F;  4F93 B;  2DOF A;  2LOO A;  5E3M A;  1JUS A;  5GAH J;  4CDG A;  5HDK A;  3K2A A;  2PEX A;  4L9J A;  2DAO A;  1F36 A;  2CMP A;  1OCO H;  2DK8 A;  3B6A A;  4GO1 A;  2EIM H;  5JHF A;  1PUE E;  1KU7 A;  1MMN A;  3K70 C;  2C6Y A;  5J40 A;  2EWN A;  1VTN C;  4RM2 A;  3HPH A;  3HRS A;  1W5S A;  3GTM J;  4BAY A;  1ZGW A;  2P81 A;  1MDM A;  4GRI A;  2Q0O A;  3LWF A;  1NK2 P;  4HRI A;  5IYD J;  3QU6 A;  3OS0 A;  2E7W A;  4CHU A;  1BR4 A;  1ZK8 A;  2QWW A;  1GUU A;  5FD5 A;  3PIO F;  1DPR A;  1W5T A;  3OWT A;  4LLG F;  3K7A J;  2V1N A;  1LKX A;  5K5O A;  4M3E A;  5JVG F;  5J3L A;  3QOE A;  3I5U A;  5J4Y A;  1OPC A;  1YQA A;  3V8L A;  3HL2 A;  3FX3 A;  1R9T J;  3OY9 A;  1U8B A;  1ON1 A;  1KYZ A;  3F0C A;  4G12 A;  3WE2 A;  5LFA A;  2XAU A;  2PI0 A;  1VZ0 A;  2LKX A;  4FX4 A;  2DXI A;  4M74 A;  4LG0 A;  4I6Z A;  3P7N A;  1TWF J;  2CQN A;  3IRR A;  4PK4 A;  1WRJ A;  5HOD A;  1S7A A;  3KPH A;  2E60 A;  3KEQ A;  5JI6 A;  3BTI A;  1AKH A;  5FRO A;  2BVM A;  4I02 A;  2CW0 F;  3ZMS A;  4BXU A;  3OS2 A;  1JI8 A;  3I53 A;  3FBN B;  3A1Y A;  3RKW A;  2PG4 A;  1R5G A;  4PJJ A;  3S17 J;  4XN3 A;  1BJA A;  1UST A;  3VYS B;  4A3B J;  1GHC A;  1FYL A;  3LA2 A;  1R5I D;  1OYW A;  1S29 A;  2IBD A;  1AA7 A;  1D0X A;  3S2D J;  5EG0 B;  4A6D A;  3BQY A;  3CTA A;  3L2V A; 
#chains in the Genus database with same CATH homology
 5CVV A;  1U78 A;  2XRO A;  3ZMU A;  1SFX A;  3DXJ F;  3AAF A;  1SD5 A;  2IPQ X;  2FU4 A;  3I58 A;  1Q1H A;  3FXQ A;  1BIB A;  3RYR A;  5DD8 A;  2P6T A;  3MZH A;  1IRF A;  2IP2 A;  4I0A A;  5ERI A;  1TQM A;  2EFQ A;  1UHW A;  2VC1 A;  2D2W A;  2FE3 A;  2XKO A;  4EJU A;  2OU2 A;  4U7B A;  3VEP A;  3HTS B;  3FM5 A;  2KIM A;  2VOO A;  1FBQ A;  5E20 A;  3QAH A;  5IT9 K;  3TQN A;  1HW2 A;  2V1U A;  2HZT A;  1R1V A;  1JGS A;  1MJ9 A;  4HA8 A;  4G7O F;  4EMS A;  2R3S A;  4RAY A;  2MD5 A;  1XDU A;  2GXG A;  2XKP A;  3BZ6 A;  3GFM A;  5D6E A;  4NB5 A;  2VOD A;  5EEH A;  3GF2 A;  1KQ9 A;  1I1S A;  2PN6 A;  5J8C A;  1HW5 A;  1S3J A;  4M72 A;  4U7D A;  3HSE A;  5HDG A;  2HQN A;  3ZN0 A;  2P8T A;  4KMU X;  4G7H F;  3RI4 A;  5AON A;  1RI7 A;  4LB5 A;  2RKH A;  1D8J A;  4EJT A;  2R7D A;  2HWV A;  2OZ6 A;  2V6C A;  1U5T A;  1ONV A;  1REP C;  3E6M A;  2EFP A;  2X0L A;  5DD4 A;  3I59 B;  4BYY A;  2ZME A;  3R0A A;  3E6C C;  4F7Z A;  3I64 A;  3COA C;  1IW7 F;  2UXX A;  2Q8K A;  1XSV A;  3GLX A;  2H94 A;  4GCV A;  4OIQ F;  4RGU A;  4OOI A;  1OR7 A;  4LLN A;  1T38 A;  3DPL C;  1R7J A;  3ZQ7 A;  1HBX G;  3T8R A;  4U0V A;  1F4K A;  5AIP A;  1ODD A;  3GYH X;  3EET A;  4Q47 A;  3U9G A;  1B9N A;  1BC7 C;  1OMI A;  1U5T B;  5FFZ A;  4EVI A;  4HLY A;  3WTZ A;  1DUX C;  3HHH A;  4B09 A;  2UZK A;  4G7Z F;  2MBF A;  1AWC A;  1T0F A;  2LF7 A;  2E7X A;  2W85 A;  4L9V A;  2IA2 A;  4BNC A;  3DEU A;  1PDN C;  1Z6R A;  3F8M A;  3LAP A;  3V8J A;  1QZZ A;  1DPU A;  3HIF A;  1WI9 A;  4AIH A;  1R22 A;  5D8K B;  4Y15 A;  2H27 A;  3BWG A;  2COM A;  1W7P B;  4E70 A;  1P4A A;  1KU2 A;  2ZJ2 A;  2VN2 A;  3IKT A;  1D8K A;  3OOP A;  4HBL A;  1LDK B;  2JZY A;  1USS A;  1QNT A;  4I0B A;  1HSJ A;  4KUM A;  4UVB A;  2VC0 A;  5IT9 Z;  5DCM A;  2OBP A;  2NS0 A;  3B02 A;  1R36 A;  2H6B A;  5CVR A;  2EV6 A;  1K78 A;  4BHB A;  1G3T A;  1UFM A;  2VBY A;  5J6X A;  4ENJ A;  2K86 A;  5CLS A;  5D5V B;  4I09 A;  5HS9 A;  2HFH A;  4ENN A;  2FMY A;  1B59 A;  1G3Y A;  2Y48 A;  2QZ8 A;  3G3Z A;  4OMY A;  1FNN A;  2VXZ A;  3CO7 C;  2UWM A;  3RPU A;  3P9C A;  4OIR F;  4IHT A;  5KVR A;  2Z33 A;  3E5U A;  4A0X A;  4P5O A;  2STW A;  1YLF A;  4P9F A;  1XCV A;  1SFE A;  2BEO A;  3KZZ A;  5DUK A;  4A2U A;  3WTU C;  4PCQ A;  5TJJ A;  3QRF F;  2L4A A;  1XB4 A;  4O3M A;  3PQK A;  4L18 B;  2F5E A;  3HRM A;  2M30 A;  4ENM A;  1E17 A;  3LA7 A;  5TRD A;  5JVT A;  5E1X A;  4M6X A;  1SD4 A;  2JRT A;  1S7O A;  1J75 A;  4BHC A;  4HF2 A;  2A61 A;  4M9S A;  3N4M A;  2Y0M A;  2CSO A;  2K4J A;  3TOB A;  2ACJ A;  2AS5 F;  3F21 A;  3RTR A;  1J0R A;  1YW9 A;  2Y75 A;  2WWY A;  1FWZ A;  1H0M A;  1PP7 U;  2EFO A;  3FXU A;  3NEU A;  3KFW X;  2XAS A;  4RGR A;  4EJW A;  3L7W A;  4I7H A;  5L3B A;  2EV5 A;  3GFL A;  2HS5 A;  4JBA A;  1I6X A;  2FBK A;  4AWX B;  1GVJ A;  3M7G A;  4LFU A;  5ICC A;  1UHM A;  2PBI A;  2Z3Y A;  1ZRD A;  2VE9 A;  2V1D A;  3F72 A;  1QPM A;  5HLH A;  5LHG A;  4OIO F;  4HV6 A;  2MH2 A;  1FBU A;  3P9I A;  5JR3 A;  2HEO A;  1TNS A;  2QM3 A;  1XSX A;  2BV6 A;  4WK8 F;  2P5K A;  1O7F A;  2RC4 A;  4FHT A;  2JPC A;  5FLX Z;  1MD0 A;  2UXN A;  1RIO H;  4P9U A;  2G9W A;  1QGP A;  1K78 B;  4M73 A;  3TOA A;  5HOO A;  4L0Z B;  5D5W B;  1ZG1 A;  2BYV E;  1KQ0 A;  3O2P E;  4KIB A;  3TKY A;  3GEZ A;  5E18 F;  3L2C A;  3RPQ A;  3WU1 B;  1BI1 A;  3MWM A;  3L9F A;  2V79 A;  2DO7 A;  3FXR A;  4OU0 A;  5DCF A;  4HX8 A;  4XSZ F;  2JSC A;  1W7P A;  3KCC A;  3SZT A;  5BOX A;  2RV8 A;  1OYI A;  3EUH A;  5DYM A;  1Z1D A;  4GYI A;  2RGV A;  1FSH A;  5D5U B;  3HTU A;  4UVA A;  3BOQ A;  1H9T A;  1FZP B;  2W84 A;  4YG2 F;  3I4P A;  4CYD A;  3ABT A;  1U3E M;  3CO6 C;  1BC8 C;  3MCZ A;  3V4G A;  2BGC A;  2ISZ A;  2NNY A;  3QPT A;  3WTY C;  5JHU A;  2A68 F;  1STZ A;  4Q48 A;  2IRF G;  5LRS A;  4P96 A;  3HSR A;  5DV5 A;  4IF4 A;  3QU3 A;  3BP8 A;  3SQN A;  1W4M A;  4Y13 A;  2ESN A;  2Z5U A;  5BPI A;  4ENK A;  3J80 K;  2DQL A;  2ZXJ A;  3WGI A;  4A12 A;  4R79 A;  3HRU A;  4RB1 A;  3MQ0 A;  2QBY A;  2RQP A;  1GXQ A;  4RAZ A;  1YIO A;  4B8X A;  2Q2E A;  2IVM A;  2HTS A;  3NRV A;  3BDD A;  1MZB A;  2FSW A;  2D45 A;  1YO5 C;  3KP7 A;  3KEO A;  2WV0 A;  3EQL F;  3ZMV A;  1HKT A;  2DQR A;  3RYP A;  1BIA A;  4R8H A;  5LEJ A;  2K02 A;  3ELK A;  4DQ2 A;  2QBY B;  2JT1 A;  3HOT A;  5AIQ A;  4LLL A;  2W24 A;  2GXB A;  2VBW A;  3R0J A;  2DU9 A;  2GA2 A;  4ASN A;  5K5R A;  3ULQ B;  1NHA A;  4S05 A;  3L09 A;  3RJP A;  4LD5 A;  2VOP A;  3EYY A;  3ZPL A;  2CO5 A;  1JE8 A;  2EV0 A;  5L3F A;  1ZHF A;  1FOK A;  4QLC U;  2DI3 A;  2F5C A;  3B73 A;  4IPA A;  1B9M A;  2QYO A;  5BS6 A;  4CZZ A;  3KLN A;  3F8F A;  2XRN A;  4UUV A;  4XRF A;  1YFH A;  3K1M A;  5DCM B;  2XHK A;  3JTG A;  1HXD A;  2J5P A;  2W57 A;  3REO A;  4KT5 C;  4YFX F;  2XAH A;  2QVO A;  2P4W A;  5E8G A;  4HQM A;  4ZYG A;  3ZP5 A;  3ROU A;  2VE8 A;  5L3E A;  4D0P A;  1F9N A;  2EFN A;  4U0W A;  2IJL A;  2M5W A;  1L0O C;  3JTH A;  1ZGJ A;  5CVJ A;  3CUQ B;  2OAZ A;  2KIF A;  4KA4 A;  3FM3 A;  1D3Y A;  2MH9 A;  1TNT A;  2P5V A;  2K4B A;  2TDX A;  3TGN A;  1ZRC A;  1YTY A;  2FBI A;  1QBJ A;  3QP6 A;  2A5Y B;  3VOE A;  1MGT A;  2R7F A;  4JQF A;  3H92 A;  1DDN A;  3WOD F;  4UV9 A;  2HR3 A;  4KIG A;  1XMK A;  3HSF A;  3CUO A;  5CVI A;  5FFX A;  2V1X A;  6PAX A;  4UV8 A;  3E97 A;  2HOE A;  1CF7 B;  5DEQ A;  4N9H A;  3T5X A;  3IWZ A;  5K5Q A;  3GFJ A;  5E17 F;  2OZU A;  5BMZ A;  3MFK A;  3KP3 A;  3GWZ A;  4GYG A;  2L54 A;  1KGS A;  1R23 A;  1RNL A;  3K1P A;  3GZ5 A;  3GW2 A;  3W6J B;  1T6S A;  5LGU A;  4WXH A;  1Z7U A;  4KNY A;  4HAM A;  4UVC A;  1O57 A;  2WTE A;  5ICF A;  3CLO A;  4A0Y A;  3V7C A;  3S2W A;  3HYI A;  2O03 A;  3KP6 A;  2B0L A;  4RB3 C;  2NRA C;  1TQP A;  4Q5S F;  2P5L C;  1T39 A;  3H3U A;  3C7J A;  2MLK A;  2CWE A;  5FLX K;  2LKP A;  2JPB A;  2XIG A;  2FQ3 A;  2KJB A;  4IHS A;  1MKM A;  1ON2 A;  1LDD A;  3IRQ A;  2ZNZ A;  2XAF A;  1DP7 P;  4CIC A;  1I5Z A;  2LNB A;  2XGX A;  2A07 F;  2VT2 A;  2MC3 A;  4OIP F;  4OMZ A;  5D5X B;  3SZP A;  2YU3 A;  4RB0 A;  5IT3 A;  4UXN A;  2ZBK A;  2LDU A;  1G3S A;  4IJA A;  2V9V A;  4WWC A;  3F6O A;  4EV0 A;  4GXO A;  4HW0 A;  3E5Q A;  4IVN A;  1WSU A;  2M1B A;  1R00 A;  4ZYD A;  1IXC A;  1KYW A;  1K6O A;  3DV8 A;  3ECH A;  2A6H F;  4FX0 A;  1LVA A;  2L3D A;  5D8L B;  4PDK A;  3I54 A;  4XLP F;  2P6S A;  5HDN A;  5A2Q K;  3DPT A;  4XSX F;  5D6F A;  1RUN A;  3I59 A;  4KYW A;  1R1U A;  1O7L A;  1IN6 A;  3LST A;  4R1H A;  3WGG A;  3BY6 A;  3CJN A;  4ESB A;  4AVP A;  2ZNY A;  3WG9 A;  3F8N A;  3KP5 A;  3RKY A;  3F3X A;  4M9X A;  2IA1 A;  1IF1 A;  4ETS A;  5BQT A;  1MDM B;  2STT A;  1FSE A;  3WTS C;  2PFB A;  2GZW A;  4HZF A;  1T98 A;  2X4H A;  1O3T A;  3NQO A;  1J59 A;  1LQ1 A;  1QO0 D;  2PJP A;  4GGG A;  4OIN F;  2DPU A;  1I1G A;  2EA4 A;  1K7A A;  3CUQ A;  1S6L A;  3R4K A;  2M45 A;  1R58 A;  4MTE A;  1P4X A;  1ULY A;  4MEX F;  5LBQ A;  3IWF A;  1Z6T A;  2DLL A;  3WE3 A;  1FX7 A;  1WQ2 A;  1Z9C A;  4EJO A;  2QQA A;  2HKO A;  5F6F A;  4ON0 A;  5H6R A;  5L3D A;  1LEB A;  4KDP A;  1BM9 A;  4LGW A;  4WF2 A;  2QLZ A;  1XD7 A;  1HQC A;  2E1N A;  3JW4 A;  2P7V B;  2O3F A;  2EK5 A;  2IA0 A;  4M9Z A;  3K69 A;  3ZMZ A;  3G73 A;  3T8T A;  5HVQ C;  4KN7 X;  3K2Z A;  2EFW A;  5D4S A;  4UHT A;  4N0B A;  2GQQ A;  3KET A;  3P9K A;  1SMY F;  1YW8 A;  2NNN A;  1WKM A;  4ESJ A;  4EM1 A;  1LB2 A;  3R61 A;  1IUY A;  5CJ9 A;  4AD9 A;  1X3U A;  3BPV A;  1B6A A;  1P92 A;  1HKS A;  4MQ9 F;  2E1C A;  2W25 A;  4YFN F;  2HYG D;  4IRG A;  3E5X A;  2JTV A;  3U2R A;  4EGZ A;  4Q4Z F;  4LMY A;  5LEK A;  3ZMT A;  3JSO A;  3DP7 A;  2D1H A;  4G94 A;  4IXA A;  2H6C A;  3PFI A;  4M6Y A;  2Z9O A;  1ZGA A;  3DFG A;  1FY7 A;  1FP2 A;  3FMS A;  4BQA A;  3TO6 A;  5FO5 A;  3C1D A;  3WTT C;  1LJ9 A;  1BI0 A;  3J80 Z;  3JSP A;  5HS7 A;  1O3S A;  1Y0U A;  4YII A;  5ILV A;  4HX7 A;  3U1D A;  2VBX A;  5ED4 A;  5JFR A;  1JHF A;  1J5Y A;  2O0Y A;  2RN7 A;  3PQJ A;  3C18 A;  4FT8 A;  4JK1 X;  3T1B A;  2GA1 A;  1C0W A;  4G9Y A;  4YIF A;  2BE5 F;  1TTY A;  2IW5 A;  2ZFW A;  3KE2 A;  5J8F A;  3M8F A;  5A2Q Z;  2HKX A;  3CUQ C;  3GXO A;  2KJC A;  3FF5 A;  4RGX A;  3K9T A;  2K27 A;  1ZH5 A;  2MA3 A;  5E1Z B;  3VOD A;  2H09 A;  2FOK A;  3SHF A;  1RZ4 A;  3K0L A;  5E1W A;  1XDS A;  1O3R A;  4ZZL A;  1IN7 A;  5KK1 A;  1LDJ A;  1SD7 A;  1UCR A;  3J81 Z;  2ADU A;  4AIJ A;  3IHU A;  4A5M A;  2HQR A;  3DKW A;  4NQW A;  4HDU A;  5K1Y A;  2LSO A;  3ZN1 A;  5F64 A;  3F8C A;  2O6G E;  1XGO A;  4CGZ A;  5H20 A;  1P2F A;  2XAJ A;  1LEA A;  3BJA A;  4ZYH A;  2K7L A;  4KFC A;  2CQK A;  2Z99 A;  1Z91 A;  2A69 F;  1EH8 A;  1QQI A;  2ISY A;  1G3W A;  3I0T A;  1ZAO A;  1ZG3 A;  1BN5 A;  3R60 A;  4K2E A;  1BOA A;  4L9T A;  5D4R A;  1JHH A;  1ZYR F;  3ML6 A;  1V4R A;  3OV8 A;  3D5L A;  2VT3 A;  2OQG A;  1YW7 A;  3L00 A;  1G6N A;  2QQ9 A;  1S8N A;  3LAJ A;  1B1B A;  4ZZD A;  4HF0 A;  2DW4 A;  3MAJ A;  2M8E A;  4L9N A;  2P7C B;  3WGH A;  5ICG A;  3GFI A;  4ZH4 F;  4LG0 B;  1P6R A;  3E6D A;  2D1V A;  3SFZ A;  4EGY A;  3HUG A;  4HOB A;  5FD6 A;  1SD6 A;  4M71 A;  4CO8 A;  2QEN A;  1SMT A;  4A0Z A;  4S04 A;  4MNU A;  2XUB A;  1IN8 A;  3KP4 A;  4WCG A;  4KMF A;  5ILU A;  2ESH A;  4TV7 A;  4HDV A;  2FF4 A;  2HGC A;  2PMH A;  3M9A A;  2G7U A;  3VFZ A;  3ISP A;  2XAQ A;  2VON A;  3GO5 A;  1HW1 A;  1ZLJ A;  1R1T A;  3QPH A;  2PMU A;  2RNJ A;  3I71 A;  2HDC A;  1QZY A;  4DNC A;  1SAX A;  3HOS A;  4UNO A;  2LF8 A;  1XCB A;  4NHJ A;  4LJZ F;  1EV7 A;  3LQQ A;  2CG4 A;  3TO7 A;  4EQQ A;  3LA3 A;  1XMA A;  1P4W A;  1TQI A;  2KKO A;  3LFK A;  3MEX A;  2PQ8 A;  4EM0 B;  3MZY A;  4PZJ A;  2EA2 A;  3WTW C;  5HS8 A;  4L0Y B;  4WX9 A;  5FB2 A;  3M8E A;  1JXS A;  3BJO A;  1U2W A;  4KIC A;  5LHI A;  2FNA A;  1SFU A;  5ICE A;  4RS8 A;  4XBF A;  2FML A;  5EEG A;  1TW2 A;  2MLG A;  1HKQ A;  1R5H A;  2EB7 A;  3R6S A;  4YFK F;  2O8X A;  3GUD A;  1IRG A;  2F5D A;  1IN4 A;  3GX4 X;  2DFI A;  4QWQ A;  3IKV A;  4I98 B;  3BJ6 A;  2YSR A;  1BI2 A;  2ZME B;  2CFX A;  2PLY A;  2RDP A;  2ETH A;  1KQ8 A;  3GVA A;  1LNW A;  2YX4 A;  3BRO A;  4BHP A;  1XGM A;  2XV4 S;  5CVU A;  1U5T C;  4N9I A;  5LGN A;  1YG2 A;  1J7K A;  3FMQ A;  3QP5 A;  3JAM Z;  2OA4 A;  3FWE A;  3W6K B;  4H0E A;  2EJR A;  4IRI A;  1A04 A;  1IXS B;  4G8X A;  1U6G A;  4U0Y A;  3VB2 A;  3DQV C;  1CF7 A;  1KA8 A;  1IZ1 A;  2GWR A;  1BI3 A;  4ESF A;  3RDI A;  2O61 A;  1XN7 A;  2L4M A;  2J5O A;  2G7H A;  4P55 A;  3E6B A;  3N97 A;  1IN5 A;  2XAG A;  2ZCW A;  3EYI A;  2L02 A;  1TBX A;  2FNP A;  3EDP A;  2ZKZ A;  1WWX A;  3KZY A;  5HLG A;  2WC2 A;  4U88 A;  2CYY A;  2VBZ A;  5FGM A;  3F22 A;  5DUI A;  1IAW A;  3Q9V A;  4HYE A;  3H3Z A;  1EH6 A;  3RKX A;  3V7R A;  1XGN A;  1K79 A;  3WU0 A;  4HV5 A;  4MQV A;  4MEY F;  1RUO A;  4G6Q A;  4HX4 A;  4Y17 A;  4PGG A;  4O6J A;  3WTX C;  2DTR A;  1V3F A;  4EM2 A;  1I27 A;  5HLI A;  3TDZ C;  3ECO A;  1ZAR A;  4RB2 C;  1YS7 A;  1AOY A;  1E2X A;  4KIF A;  1XGS A;  3T0Y A;  5L3G A;  4HQE A;  3SXY A;  3TO9 A;  3ZMD A;  4EJV A;  5LRR A;  5LHH A;  3Q5F A;  2NYX A;  4O5V A;  2FEZ A;  2YR2 A;  3D0S A;  1CGP A;  1TW3 A;  4L5I A;  2KIU A;  1L3L A;  4A6E A;  3V7S A;  4A5N A;  1U8R A;  2AXL A;  2NAZ A;  2DBB A;  5DDG A;  2CGP A;  1FLI A;  4I01 A;  1G4D A;  2A6E F;  4L5J A;  2FXA A;  1FP1 D;  4PGH A;  5H6Q A;  1ZG5 A;  3F23 A;  2OD5 A;  4HLX A;  1KU3 A;  3HRT A;  4BH9 A;  5CYV A;  1GXP A;  1UB9 A;  2GAU A;  4IRH A;  3IC7 A;  1FYM A;  1YYV A;  3QOP A;  1BBY A;  4LB6 B;  3FMR A;  4G6D A;  1J9I A;  3WTV C;  1Z05 A;  4LK0 F;  1OYY A;  2YPR A;  3F8B A;  3F6V A;  4XLN F;  3C3W A;  5BPD A;  4MTD A;  3O3K A;  3E3V A;  3K1N A;  4WXC A;  1OKR A;  4RGS A;  3M1E A;  1XSD A;  1FPQ A;  3V8K A;  3J7A O;  2KRF A;  3TDU C;  1MJA A;  2L01 A;  3FZV A;  2M87 A;  3KLO A;  3JAM K;  3ERE D;  2RVC A;  1J2X A;  1T2K A;  2FBH A;  4HF1 A;  2DPD A;  1H9G A;  1F1Z A;  2YX7 A;  1EH7 A;  2GIV A;  4KN4 X;  3IL2 A;  2OQR A;  3ABU A;  3LQR A;  3FHZ A;  3CDH A;  2XVC A;  2HTJ A;  1ZLK A;  5E8I A;  3GZ6 A;  1IXR C;  2QUF A;  2IT0 A;  2FA5 A;  3BPX A;  4AIK A;  1TLH B;  1D5V A;  1ZRF A;  1ZRE A;  4MHG A;  1O3Q A;  2ZO4 A;  2QQB A;  5LLQ A;  3J81 K;  1FBS A;  1FC3 A;  2FRH A;  2DK5 A;  5ILS A;  3Q9S A;  2HYF A;  2ELH A;  5L3C A;  2DT5 A;  1B4A A;  5F1R A;  1KU9 A;  1HST A;  1ZN2 A;  1PP8 F;  2A3S A;  2F2E A;  3KP2 A;  5LGT A;  1F5T A;  4I2O A;  3RIR A;  1FT9 A;  1MJB A;  1W7P D;  3O6B B;  4WXD A;  2F5F A;  3HHG A;  3DF8 A;  4CXF A;  4Z2Y A;  2BBY A;  1FYK A;  1YS6 A;  4MGR A;  4LK1 F;  4CDG A;  5HDK A;  2PEX A;  4L9J A;  2DAO A;  2DK8 A;  4GO1 A;  1PUE E;  1KU7 A;  2C6Y A;  2EWN A;  1VTN C;  3HRS A;  1W5S A;  4BAY A;  1MDM A;  2Q0O A;  3LWF A;  3QU6 A;  2E7W A;  4CHU A;  2QWW A;  5FD5 A;  1DPR A;  1W5T A;  4LLG F;  5K5O A;  3I5U A;  1OPC A;  1YQA A;  3V8L A;  3FX3 A;  1ON1 A;  1KYZ A;  3WE2 A;  2PI0 A;  4FX4 A;  4M74 A;  4LG0 A;  3P7N A;  3IRR A;  1WRJ A;  1S7A A;  3KEQ A;  5JI6 A;  4I02 A;  3ZMS A;  2CW0 F;  4BXU A;  3I53 A;  3RKW A;  2PG4 A;  1R5G A;  1BJA A;  1UST A;  1GHC A;  1FYL A;  3LA2 A;  1S29 A;  1OYW A;  4A6D A;  4ZYE A;  3CTA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...