1Z67A

Structure of homeodomain-like protein of unknown function s4005 from shigella flexneri
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
129
structure length
127
Chain Sequence
LFDEVVGAFLKGDAGKYQAILSWVEEQGGIQVLLEKLQSGGLGAILSTWLSNQQRNQSVSGEQLESALGTNAVSDLGQKLGVDTSTASSLLAEQLPKIIDALSPQGEVQANNDLLSAGMELLKGKLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein S4005
publication title Structure of YidB protein from Shigella flexneri shows a new fold with homeodomain motif.
pubmed doi rcsb
source organism Shigella flexneri 2a
total genus 47
structure length 127
sequence length 129
ec nomenclature
pdb deposition date 2005-03-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.690 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A YidB-like 1z67A00
1Z67A
chains in the Genus database with same CATH superfamily
4A2UA 5LD2C 3OYDA 2K02A 2ZKZA 3A1YA 1FWZA 3TDZC 2IJLA 2L4AA 1VQKI 2H8WA 4G7ZF 3E1SA 2O03A 1P92A 3QQAA 1J09A 4XICA 2FMYA 2TDXA 3ONQA 3M4OJ 2CW0F 3QPSA 4EV0A 4BACA 2L7FP 1XX5A 2DMTA 3H1CA 3JTHA 4CH7A 4BQNA 2NYXA 1DQUA 3FK6A 1ZELA 2O8XA 1JTXA 3FXKA 3L7WA 1EV7A 5BS6A 3OYBA 2DO7A 1W0TA 1VQOI 5FKKA 3KPHA 2B9SA 1XGNA 1RETA 3IUOA 4A6EA 1N25A 3R6SA 1G6NA 3ZQHA 1BOBA 2HS5A 3H3ZA 2A6HF 3SYTA 4CHUA 1K78B 4FASD 3KFWX 4MFDA 2K85A 1LFUP 2CV0A 5GADJ 3ZN1A 2AXLA 3CCYA 4EATA 2NNYA 3HSEA 5CKTA 4KITB 5K5QA 1BW5A 4E7SA 5BNGA 5M5WJ 3H5RA 1XSVA 2DPDA 2HXIA 3L2UA 3FXMA 4G94A 4DQ2A 4A69C 1UELB 2R7FA 4P96A 2HQAA 3TEDA 4DZPA 4PSXA 3ZCOA 4ZDPA 2JN6A 4I76A 2P7CB 4RGXA 5EG0B 4JYKA 5EEAA 2P6TA 5JLWA 2LKPA 1W7PB 1BI2A 3AFHA 1X3UA 1I6XA 4IRGA 4M3FA 2V1XA 4II3A 4ANJA 1AA7A 1XMKA 5LRRA 5ICFA 5FKOA 1MNEA 4M3EA 4KA4A 3GTGJ 1TNTA 2DMQA 1Z91A 4NC7A 3K70D 1LFPA 4XKWA 2QQ9A 2F5FA 2P4WA 3OYFA 1TP4A 1WJEA 1X1AA 4IO9F 2FEZA 4F3QA 2ISZA 1JKOC 3SZPA 1R4MB 2R3SA 3LFUA 3SHFA 1P7IA 3GMEA 2GXAA 3DV8A 1AKHB 4CCLA 2LD5A 1WSUA 1F1ZA 3BG3A 1TWHJ 1V3FA 2DXIA 5A2QK 2OTLI 3GEZA 4RA2A 1QZYA 2JUCA 3FKJA 4PJLA 2NAZA 3H5AA 3A0BC 3RCOA 5HDKA 2DQRA 4L5IA 5C4JJ 4XLCA 1T98A 4M72A 2JVHA 2CFXA 5IYBJ 5GAGJ 3TO9A 3ASOH 4HLYA 1ON1A 2YSRA 1SD5A 3LFKA 3RYRA 5EEGA 3RJPA 4BEHB 1FOYA 2P5VA 2TCTA 1BA5A 3BQYA 3CDHA 5J3LA 2RQPA 5TISC 5KAIC 3ZQLA 3WU1B 1KQ0A 3SFZA 4GCVA 5M5XJ 5KK1A 1XTAA 2XAUA 1MIJA 3TW7A 3U9GA 1X1CA 2LSOA 3LSJA 1QZZA 1Y8QB 2CYYA 3GTMJ 3KZYA 5FB2A 2A5YB 4WX9A 2NS7A 4CO8A 4LK1F 2CQNA 4IOCF 1APLC 2QQAA 3G2BA 4U88A 5ICCA 3IWZA 1VQMI 4HRIA 4OMZA 5D4RA 1VQNI 3VYRB 3LSHA 2WB1A 2PLYA 1QVUA 2CGPA 3B02A 1ZGWA 3CTAA 3KX2A 4IZZA 5C44J 3FXUA 1G3SA 4M9XA 2HDDA 2H09A 3VSKA 1OJLA 3J80Z 2HNHA 1JHFA 1W36C 3CC4I 1ZRDA 2RNGA 2Z1DA 3COAC 1ETWA 5LBQA 1VNDA 2A5WA 2CJJA 3AL0C 3F8MA 1RUOA 5J1UA 2VLAA 2KP6A 2XB5A 4AIDA 2PEXA 1HKTA 1YHQI 2BBYA 3BTLA 3FX3A 5CVVA 3CDIA 3K9TA 3L2CA 1X2MA 2ZJ2A 3GW2A 5FROA 3BR1A 3HTSB 3HOYJ 1SVMA 1FP1D 3GTKJ 5E3OA 2VN2A 1MBGA 3A01B 2F4OB 5IT3A 2A05A 2R7XA 2ZXIA 3DBLB 3HHHA 2IS6A 1SVOA 2WC2A 1JUSA 4IVNA 3C18A 4UXNA 2JMWA 2UXNA 4WXHA 5GTHC 4D1QA 3N05A 1H9TA 4DGWB 1QPIA 1I6HJ 3GBGA 2VQLA 1D5YA 1UG2A 3OS0A 1X1BA 2VONA 1ZK8A 3AG4H 5K7HA 2XUBA 1K79A 2PX9A 2OCEA 5F27A 2VT3A 3W6JB 1I1SA 3F6OA 3ZMVA 1D1AA 4E7HA 1R1TA 2XDVA 4E7ZA 3H9JA 3JAMK 4A93J 4Y4RA 1ZG1A 3I4NJ 1XSDA 5CPRB 3FKIJ 1S7EA 3E0JB 2B0LA 3E6MA 1NHAA 2V9VA 3TOBA 1I27A 3HL2A 2WV0A 1HLVA 2L9SA 4HSTA 3HRUA 3VB2A 1GXQA 4HEA2 3HPGA 3W2AA 2ELKA 4YFNF 3L2RA 1KU2A 2LP0A 1JGSA 2P5LC 4JBAA 2WWYA 3HSRA 4IHYA 1IRFA 2M3AA 1SEUA 4R1HA 1WQ2A 2ZO4A 2W1OA 3TBIA 5HNHA 2V79A 2DI3A 4L5JA 2H1LA 5ED4A 3E5UA 2L4MA 3K2ZA 2ADUA 4C2MJ 3S14J 4CCMA 3JREA 4G8XA 2R5YB 4OIPF 3GFMA 3VEPA 2GXBA 1FBUA 1YTYA 3E97A 2PN6A 2Z9OA 3P9IA 4RGRA 2JRTA 4ESFA 4XRSG 3ESWB 2V9KA 1DU6A 3KLNA 5EJCA 1FYMA 4DYCA 3GUDA 1J59A 4M73A 4N9HA 1RESA 2L5QA 4N4OB 1S6LA 2DFHA 1OCOH 2E19A 4ENJA 2V1UA 3W2WA 4I6ZA 3U1DA 3KCCA 2ESNA 1IO2A 4MTEA 4MIMA 3SZTA 4E7JA 4W97A 2MYSA 4HV5A 1Y1VJ 3ZMUA 3NRVA 3WTXC 1SFEA 3V7RA 3V8JA 3PNYA 1Z3XA 1T95A 3A03A 1Z05A 2CSOA 2FE3A 1ZG5A 2EZHA 2NS8A 3LSTA 5CVRA 2KZVA 2E1NA 3ABMH 5E8GA 4RMNA 3PUFA 4Y3OA 2WAQN 2CU7A 1XMAA 3CMEI 4BY1J 1DGRM 1G59A 4D9JA 1F43A 2IA0A 2DA7A 3NWSA 3MD2A 4ESBA 5GAHJ 4BAYA 2HEOA 3OIOA 2HGCA 1XGOA 2KFDA 4OOIA 5HOOA 3MKLA 3DWLE 3F8CA 4KN7X 2H8RA 3C3WA 3RZOJ 1I3AA 2MC3A 5F6FA 1IXCA 2D45A 2KKOA 1PUFB 5LEJA 3RYPA 4A5MA 1BOAA 4EMSA 3JRFA 2IRFG 1FY7A 2VODA 2QGUA 3A02A 1Y1WJ 2V7FA 3KEOA 5EF6A 3H0DA 2BZTA 1MMSA 3K70C 2YX4A 2F5CA 1G3TA 4A0ZA 2NVTJ 1MJ9A 5F0HA 5K5OA 3DCFA 3I59B 1BBYA 1I39A 3BR2A 2ACJA 4ZH4F 1SANA 1Z77A 4EJOA 1JJ8C 2PI0A 4UV9A 4BDZA 3P9KA 1DP7P 5EEHA 1MJAA 2FU4A 4DYQA 1UMQA 1JI8A 2OUMA 1IUFA 2R4GA 4HLXA 2DA4A 1MSEC 2GA2A 3A4CA 3LSGA 1TQPA 2DJIA 3OYHA 3JTGA 2HR3A 3G3ZA 2BW3A 2ZBKA 2IGOA 3I53A 2F4IA 2GM4A 2RNJA 2EA2A 1N75A 2R7ZJ 2W85A 3CO7C 1B8IB 1G2HA 4L18B 4CCJA 1T56A 3WGGA 3K4JA 3CF5F 1G4DA 3CUOA 3JRBA 4S0HB 2OBPA 1Z67A 2RDPA 4C3IJ 3DKWA 1VQ7I 1A6QA 4PJMA 5FLXK 2E2IJ 2MC4A 3CF2A 1FMWA 3TW6A 5M3MJ 1H8AC 2PJRB 2EQRA 1BIBA 2WADA 3BCBA 3WTTC 4EJWA 3GLLA 2IXSA 2KRFA 1VF9A 2QEXI 2LBFA 2O8KA 3C2GA 3BJOA 4OWRB 3BC8A 4G6DA 5HS7A 3G1OA 3RPUD 2UUZA 4HZFA 4UUSA 1Y0UA 4KT5C 2OF7A 1TBXA 2IGNA 2V1NA 4C9YA 3G1MA 2EFPA 4AYBN 4B4CA 5KVRA 5CYVA 2ZFUA 4P1WA 4GXOA 1O3SA 3FHZA 3AKZA 5TJJA 3TL4X 2XVCA 3RPUA 3TGNA 2HXOA 3L2QA 4LIUA 1EJ9A 5J40A 1U0JA 2F5DA 1AWCA 1A31A 2BYVE 2WAFA 2NNNA 3H92A 4LJZF 4B09A 1T0FA 2L7MP 4WK8F 1D0ZA 4BBSJ 2LG4A 1T6SA 2EIMH 2NOGA 3MZYA 2HZDA 4E70A 4LGWA 3BTIA 3HOVJ 3O2PE 3R4KA 2OQGA 2DYRH 2Y9ZA 1IN4A 2K4JA 5FRMA 1X3WB 3TOAA 1Z9CA 4V19K 5E79C 3J7YJ 4IQJA 3L2WA 4BE2A 1FLIA 1IC8A 2X1EA 2MSYA 4QWQA 2P81A 4CZZA 2XGCA 1YIOA 3OYIA 1FOKA 1R58A 2LY2A 3PJRA 3WG7H 4H4KC 3V7SA 2IEKA 2EZIA 3K4KA 5J1YA 1ZH5A 2PJPA 5J8FA 4L9TA 3LAPA 1SFUA 2YU9J 2CV2A 2DFEA 4XSXF 1R7JA 3ZMDA 2OJED 3OYCA 4LLGF 1WI9A 3JRDA 4BE0A 4H0EA 2M8GX 2LC2A 3PNVA 2HDWA 4RB0A 2HPIA 2FQ4A 2K4BA 1KYZA 1R6RA 4A3KJ 1EA3A 1E0EA 3NARA 4ON0A 2MW8A 3DF8A 4QTRA 1V55H 2YR2A 2STWA 2JA7J 4EM1A 1RR8C 2QBYB 3S2DJ 1MNDA 1U3EM 1IN7A 2ZFWA 3N97A 1K83J 2KMUA 2RREA 1F9NA 2R7UA 3ASNH 4UNOA 3IAM2 2DT5A 2FMLA 5E18F 1LPQA 1HF0A 3CMMA 5IT9Z 3KETA 4W1UA 1SD7A 4BBRJ 2IPQX 4ZYEA 2DA5A 1J9IA 4XN3A 2JA2A 5E1ZB 3WTWC 2DW4A 2P8TA 4XOPA 1ETOA 1P6RA 2E1MC 2FBKA 3F23A 2DDAA 4HDUA 4HQEA 2VL8A 3K10A 2OQRA 4HAMA 4MNUA 4D7MA 1PP7U 1STZA 2J5OA 2VBXA 4L5EA 4C3JJ 4IKFA 3GFLA 3O6BB 2KHMA 4ZTFA 1TTYA 1KZHA 1OCRH 3LQRA 2VB6A 1HDPA 1HCRA 3I54A 4DYRA 4BKXA 2QSFX 1UB9A 5E8IA 1GVDA 4AVZA 3ZGKA 1JXSA 4YEJA 4NC6A 3CCRI 2CS3A 1MMDA 2QYOA 2R7DA 3OS1A 2X6YA 4LMYA 4UVAA 3FMQA 4XKVA 3PFYA 4PUSA 2UV1A 3I64A 4E6KG 1REPC 3IL2A 4OIOF 4B3XA 3FMRA 1MMNA 3D5SC 5B1BH 3WGHA 1YW7A 5KNLA 4U7DA 4KIGA 4XRMA 2NXNB 1ZKGA 5E20A 3ROUA 2JUGA 1QBJA 1WH7A 1G3WA 3LSIA 2VPRA 4CXFA 2QZ8A 2FSWA 4HA8A 4TV7A 1YO5C 1VQ9I 3B73A 3L1PA 3I71A 2FD5A 2FNPA 1ZGJA 2IA2A 2XV4S 4M6VA 2ZXJA 4JX4A 1ZRFA 5GPCA 2LMDA 1K78A 3T5XA 1X2NA 2KISA 2IS1A 4IHWA 3W6KB 2XF7A 2MH9A 4MO7A 3S3OA 2E35A 1KGSA 2HVSA 3WGIA 1O3QA 4Y13A 4I7HA 2VC1A 2F48A 1LE8B 3J7AO 1W7PD 4U0WA 3JCUC 1WCMJ 1S3JA 2R7RA 1MMGA 2EFQA 2HVRA 2E1OA 3I9V2 1RRJA 3G71I 2IGKA 3FXLA 2HYFA 3HRMA 3W6VA 4GFBA 4N9IA 2ZSHB 4B3AA 4WWCA 4LB5A 2UZKA 5EG0A 2Q2EA 5FKNA 3X2QH 3KP3A 2HU9A 2X4HA 2FOWA 1W7PA 1WZ2A 2M4KA 2CH0A 3K4MA 4B48A 3K6GA 1MSFC 4DBRA 2Q1ZB 1QO0D 4AD9A 3S1RJ 4CA0A 1MD0A 4U7BA 3FDYA 1VQ4I 4DW6A 2O61A 4F93B 3H9GA 3BG6A 5EYRA 4RBOA 3KYDB 2XSJC 5BMZA 1VFCA 4PJNA 4A3LJ 1ZN2A 5JI6A 1JKRC 3HZJA 5L3EA 2G7UA 3K1NA 1AKHA 4KFCA 3K7AJ 3C1DA 3L00A 4BJ5C 3V8KA 1W1WE 2VE8A 4HDVA 4AIJA 3MVPA 3KP4A 1WJBA 2KIUA 1Z21A 5JR3A 2HTJA 2QQ8A 2QF7A 3TO6A 3ZPLA 4QIWN 5F1JA 1YOVB 2HZTA 4FCYA 4CYDA 1N78A 1U6GA 2XF6A 4F55A 4DIQA 4C2TA 4FQGA 3SEQA 1X19A 3MMYB 2OZUA 3LAJA 1ORKA 1A5JA 2LDUA 4MLOA 2GXGA 2ME6A 5AIPA 3I5UA 5J4YA 2YS9A 3OYGA 2MBFA 5IYCJ 2GIZA 2GBYA 2DA1A 2EIJH 4Q47A 3TQNA 2XGXA 4U0VA 4J00A 2VJ5A 1QNTA 2YU3A 4JP0A 3CLOA 4K2EA 1CGPA 1T0FC 2WAQA 2LR8A 1OCZH 4G7HF 4B1RA 1E2XA 1YS6A 2QENA 2ZCWA 2MLGA 3QOPA 3BR6A 1OR7A 1FNNA 3IWFA 1FIPA 3KIOA 3R61A 1FC3A 1YG2A 2DMPA 3K4NA 3ABLH 3OR1C 2HOEA 2FBIA 2CUFA 1T08B 3SZGA 1QPMA 1UFMA 4PFOA 1SFXA 2KRCA 2XSDC 2ME0A 3W3CA 1VI0A 2NS0A 3T0YA 5LFAA 3HM5A 2R0QC 5L3CA 2W4SA 3BPXA 4O3MA 4BU2A 2O7OA 4GO1A 1G3YA 1QA6A 4NDLA 2QSHX 1MH3A 1H0MA 2H27A 4CCKA 2EZKA 4OAZA 1XCBA 1YITI 5JLXA 2HOTA 3OOPA 1B72B 4GYGA 3G6EI 1IDZA 3LSMA 3F8NA 4C2UA 2P0WA 4OU0A 2K3FA 2DBBA 2IP2A 1VQ8I 1D0XA 3KP2A 3OYKA 3ZQQA 5HVQC 4BQQA 1JKQC 4LG3A 3HBLA 4A12A 2JTVA 1ZGAA 2J5PA 2V6CA 3F21A 4I98B 5JFRA 4E7LA 2AHQA 4L0YB 2VXDA 3CJNA 5CVUA 4LOCA 4DZJA 1L3LA 2Z16A 4HX4A 1FOWA 5J47A 2EV5A 4RM2A 3GZ5A 3OYMA 3ZQCA 3RI4A 1NK3P 4XMYA 1FZPB 4CDGA 2DJNA 2EZLA 1IGNA 2XROA 3QPHA 4CCOA 3RTRA 1U5TB 3S2WA 4DBQA 2Z5UA 1T38A 4HYEA 2FX0A 1BI0A 2L9RA 2L2OA 2LF7A 3FF5A 2BXZA 3OY9A 1J2XA 1Y8RB 3DPUA 5HS9A 3DTEA 5DS9A 3WU2C 3T8TA 4J01A 3C2HA 4CUGA 1IV8A 1WKMA 3QRFF 2WTEA 3WE2A 3I56I 1K6YA 5E3NA 1J0RA 2DTRA 2STTA 3GVAA 4Q48A 2X48A 3JRHA 1VQ6I 1OLTA 2XGDA 3FHNA 3E5XA 2VJ4A 3ZMTA 1YQAA 3FM5A 2VIXA 5LHIA 2BHZA 2KQRA 4HNVA 3DFGA 3SDGA 5FD6A 3EUAA 4V2FA 2M7AA 3C7JA 2A69F 2DTZA 4IRIA 2D1HA 3FXJA 1QGPA 2VXZA 4AYBA 2A61A 3VFZA 1NG6A 1S72I 4HQMA 1LNWA 2EIKH 4UV8A 1U8BA 2Y48A 1RKWA 4P9UA 2IS4A 1ACIA 3QP5A 2HOSA 1P4WA 2JSCA 2KJCA 1OYIA 4A3CJ 2QLZA 4C30A 2KT0A 1UCRA 4EEFG 1ZYRF 4II2A 1A6IA 2QKMB 2Z2SB 2DLLA 2R5YA 4I0BA 5ILUA 3WTSC 1T8IA 4ABZA 4A0YA 4U0YA 1R23A 3KZIC 2EPFA 2X51A 4X0GA 3PIOF 4ZZDA 4UB8C 1DPRA 1R36A 2M87A 4XOTA 4A3EJ 4JQFA 1FOXA 3NEUA 4MFEA 1Z6TA 3QAHA 1R49A 2MD0A 5D5WB 2PFBA 5EDNA 1X1DA 2KIFA 3BG7A 1WJAA 4ENMA 2WV1A 2H6BA 2RN7A 3PNTA 5M3FJ 1BR1A 1ZLJA 2JVGA 3F22A 1ZG3A 1AOYA 5FGMA 3S1QJ 4XK4A 2BY3A 3CO6C 4ZYHA 4G12A 2ZJQF 1JUMA 2Y69H 3PO3J 2F6CA 2BHYA 3K0LA 1BW6A 3CMYA 1ETYA 2IBDA 3HRTA 5ICGA 3BCAA 2HPMA 3D0SA 4XKBA 3JAMZ 1RIOH 2XAQA 5CJ9A 4D7NA 3S3MA 4M9SA 2Q0OA 1TNSA 1P4XA 3K4LA 5HNFA 4F92B 3I4MJ 2RV8A 2HI3A 1MW7A 2I10A 1PUFA 2FXAA 2XPVA 3Q9SA 4OINF 1OPCA 4RDUA 3I3LA 3B6CA 3H3UA 3REOA 2EV0A 2TRTA 1IN8A 3CJQB 2YUSA 2VOOA 1J75A 1MH4A 1RKTA 5FFZA 1PYVA 2RQQA 2X1DA 3DTKA 3KP6A 4MGRA 3TMOA 1OCTC 1SD6A 4NQWB 2MG4A 2VKEA 3F6VA 3KP7A 2EBIA 1DP3A 1R22A 3ZRGA 3KYLA 1XSXA 4KJZA 2ZB9A 4MTDA 3RQIA 5L3GA 4PCQA 1ETQA 4FT8A 2JA8J 3C2BA 4MEYF 1IUYA 4UB6C 3VYTB 4A0XA 2MD5A 3Q0VA 3H5NA 5M5YJ 5LGNA 1P4AA 5J4VA 3Q5FA 3CUQA 1SVLA 1B8IA 3PFIA 1VTNC 1ZHFA 4BJTA 2E7WA 2R7SA 1MBKA 3CD6I 3PSIA 2Y30A 4HV6A 4A6DA 1WJFA 3BY6A 5L3FA 2VBZA 2DA2A 3CCJI 4KMFA 2K3PA 4ZDLA 1OR7C 3CCVI 4MQ9F 1V5FA 3HOXJ 1IW7F 1FSEA 2LY1A 4L0ZB 2HYGD 3NQOA 3BT9A 4HW0A 3WHBA 3ZQFA 4YIFA 2BGCA 4LK0F 1TZLA 1USTA 1XMXA 3FM3A 4BHPA 3GZ6A 2Z3YA 4E7KA 1WJDA 2GA1A 2XKOA 4BHCA 3DEWA 3OOUA 3BZKA 1R00A 1W5CC 4Q5SF 4JX6A 5B3SH 4A5NA 1XGMA 4PFPA 3CCSI 1DGWY 2E71A 1Z0XA 3HGYA 3GO5A 3BR3A 1NG7A 1YRNA 2X9DA 2O0YA 4XN0A 2W7NA 1WHUA 4XL9A 2AQEA 3OIQA 5FLMJ 3MCZA 4MEXF 1MJBA 4DJAA 1KYWA 2C6YA 2DA3A 3M8EA 2L7ZA 1W0UA 1IXRC 3WTUC 2LY9A 2FA5A 2B7EA 3HUGA 1ZQ3P 1ITYA 1WPKA 2EFOA 3BZ6A 3G1LA 2XAGA 1CF7B 3GF2A 3DBHB 4I01A 4HG2A 4ESJA 3IKTA 1OYYA 2E1MB 2ESHA 4OIRF 1MDMB 2LLKA 4KDPA 1IF1A 2R7QA 1ZRCA 3FISA 1FX7A 3MEXA 3GX4X 4UHTA 2ZNYA 4BH9A 1YI2I 3GWZA 1MZBA 2DODA 2LK2A 5DUIA 3BR5A 3PM1A 3BJAA 1B6AA 3IV5A 1BN5A 4I0AA 4YIIA 5EGOA 3DU5A 4IOAF 1SD4A 3D1NI 1O3TA 3PQKA 2LKXA 2PMZN 5D5XB 2JQ7A 4FHTA 2CQ7A 2E5ZA 4CYCB 2ZJPF 5H20A 3IH3A 2MGQA 1TC3C 4M9ZA 3T1BA 1VQ5I 3W2VA 5LHGA 1KU3A 2XAFA 4N0BA 4M74A 2AXTC 4YFXF 2ZMEA 2HOAA 1BIAA 5D8KB 3LSKA 1EF4A 2ELJA 3HTUA 3HOSA 1Y56A 4L9NA 1S8NA 1G8XA 3BG9A 3QYFA 4ENKA 1K7AA 3HIFA 2JA5J 5C4XJ 1LFBA 3HJEA 4RM3A 4N4NB 4BYYA 3GFJA 1XG1A 5E17F 1O57A 2QBYA 3FZVA 3M1EA 2RAEA 1DU0A 3HOWJ 2KJBA 4IXAA 4EJUA 3JSOA 1B1BA 3S16J 1BC7C 1IG7A 4RAZA 2KIMA 1VQLI 1E17A 1HDDC 5HLGA 2F5EA 2EFWA 2JJ7A 2K9QA 4KUMA 3JRCA 1ODDA 1LKXA 2EWNA 4FISA 2JA6J 1BI1A 1SFKA 2ECBA 3IH2A 1XS9A 2BXYA 2X6WA 4BY7J 2EINH 2ZXWH 5JVGF 4XLHA 1H89C 2BY2A 1YW8A 1WVRA 1JT0A 4WF2A 3ZR8X 2N8GA 4XONA 2XB0X 2NVQJ 2WY8Q 2V9PA 2R92J 1XD7A 3HKZN 1IJWC 2W25A 3KYCB 3J81Z 4HF1A 4KIBA 1UHWA 3OYEA 3BWGA 4FX4A 1ZR4A 1EH6A 1ZTRA 4A3BJ 5DUKA 1WFXA 4HX8A 3HGGA 3HOZJ 2IT0A 1D8KA 3IP4B 3OL4A 1BR2A 2VKVA 4AC0A 2R5ZB 1JJ6C 1V54H 3T8RA 3BTJA 2K7LA 3E3VA 3HEFA 2NRAC 2ID6A 4KICA 3VPRA 4FE7A 3ZXSA 1U9NA 4YRVA 2OZ6A 3JRGA 3CP2A 5E1XA 2DDBA 4LG0B 3KEQA 3RIRA 2RKHA 5DCMB 5D5VB 2ZNZA 1A35A 2CW7A 5FO5A 2X1CA 3WHCA 4UUSB 3FMSA 3M07A 3KE2A 2XGEA 2I8DA 2QM3A 2M7BA 3BOQA 1TLHB 5DDGA 3PIPF 3HDDA 2MH2A 4G6TB 3S32A 2XPUA 1GT0C 2W24A 3HB9A 1SAUA 1HA8A 5HLIA 4LLLA 5FJ8J 1EH7A 1ENHA 2JWTA 4ZTJA 1LE8A 2HVQA 4AM3A 3EETA 5HODA 1OYWA 4NC8A 5IT9K 4AWXB 4KIFA 3RKWA 4XQFA 4ZC3A 1BJAA 2HKXA 1WJ5A 4S04A 2G9WA 4IL6C 2R7WA 3WU0A 3CCQI 3I55I 1V4RA 4XSZF 1DDNA 2E34A 2XRNA 3M1CA 1O7LA 4CGZA 5B5EC 3KEYA 4XNFA 3H35A 3DU6A 3FXRA 2LYCA 3ISPA 4IHXA 4BNCA 1LDKB 3QOEA 2IS2A 2P5KA 1IZ1A 5DD4A 3CCUI 3RDIA 4BGDA 2E5NA 4BE1A 1LVKA 1IRGA 4V2GA 3PUBA 1AHDP 4IQ4A 3CUQC 3DTIA 5F08A 1X1PA 2M2EA 5HLHA 4EGZA 1FYKA 2Y2ZA 2LFBA 3DXJF 2CV1A 1Q1VA 5KHDA 4Y52J 2VJIA 2LH9A 3FXOA 1J5YA 3EUHA 1YS7A 1PP8F 2F2EA 4ENNA 2V4JC 1LDJA 4P9FA 3EYIA 4AUXA 3ECOA 1WI3A 2M34A 3ZMSA 4Z6YA 2KLOA 5DD8A 5F1RA 4HF2A 1XN7A 3ERMA 1LQ1A 2CQQA 2HTSA 5IPAA 3HOTA 4L9JA 4YFKF 3PL8A 1TT5B 2O6GE 2M45A 2IAIA 1FJLA 5CQGA 1KU9A 1T33A 5C3EJ 1D1BA 4ASNA 3GTPJ 2KRHA 4GYIA 4FE4A 1AU7A 5J8CA 1ERDA 3ELKA 1LEAA 4PGHA 2OC6A 2X0LA 2CWEA 4CCNA 2Y9YA 2L0KA 1X4OA 5K5RA 3MN2A 5IY5H 2Y31A 3E5QA 4EQQA 4M3GA 2QKLB 5F0FA 3L9FA 5DM7F 1FBSA 1LDDA 4D5CA 3S15J 2R7TA 1B9MA 1H9GA 1ETKA 3FBNB 5H6RA 1JGGA 2VT2A 4Y7NJ 2VBYA 4RB1A 4YIRX 1UHSA 3CDLA 1WRJA 2A68F 3O8HA 1MBHA 1QVTA 1RR7A 1F36A 2K9MA 2QQBA 2VQGA 4LD5A 3KZZA 2R93J 1PDNC 3OV8A 2Y0MA 2L9NA 4XLAA 1MBEA 3QYEA 4LITA 4PJJA 1XDUA 1R4NB 1RC9A 4KYWA 1YW9A 3AL0B 2MA3A 1T39A 5ERIA 4HNUA 1B72A 4IJAA 2QWWA 1SFOJ 4M3BA 4WCGA 1OMIA 2KPMA 1PVEA 3OWTA 4PGGA 3CMAI 3WG9A 2KIQA 2D5VA 3H9QA 3I4PA 4QSHA 5LRSA 3KLOA 2OU2A 5K7FA 3QODA 2QSGX 2ZMEC 5IP9J 3U21A 4BXXJ 4BHBA 4BEHA 2GWRA 1LB2A 2GOMA 1ETVA 2EH3A 3IAS2 1GVJA 2DMNA 1YLFA 6PAXA 5BPDA 3D5LA 1V5EA 4IHTA 3DPLC 5EZGA 1U5TA 3EYYA 4XLNF 4NUBA 1TWCJ 5TRDA 1W5TA 2QVOA 3WTZA 4XLEA 2CQKA 4WXCA 2KDOA 3G73A 4G6QA 5IOYA 1MBFA 1X58A 3IC7A 3M3YJ 2K5CA 3ULQB 4J19A 2EFNA 2BVLA 3F0CA 3NWTA 3OSFA 1EH8A 3GCMA 2JZYA 2NVUB 1IRXA 2DFIA 1NH3A 3RKQA 3P7NA 3OR2C 2ECCA 3D5RC 5D6FA 2VI6A 1KQ8A 3CQZJ 3GFIA 4GRIA 4UUVA 2Q2EB 1IAWA 2W84A 4XKCA 4IEJA 4HX7A 1ZARA 1D3YA 1MMAA 1PJRA 2DFFA 2JK3A 4PJ0C 4BS9A 3BROA 5LGUA 3BPVA 4EJTA 4F52A 2ELHA 3TP0A 2RVCA 2FBHA 5FRNA 5FKLA 1R5ID 3A0HC 1TW3A 2AS5F 4IHSA 5KAFC 2CFOA 3O8GA 5A2QZ 3GTJJ 2HQ5A 1TW2A 1D0YA 2OV7A 2LNBA 1QHGA 2M0MA 2FUG2 5FFXA 3CZ6A 5DYMA 4RLQA 2WY7Q 4LFUA 3VSLA 5H2FC 1O4XA 3V7CA 3DP7A 1OQYA 1Z1DA 3A01A 5D8LB 3ECHA 3IKVA 4Y33A 1USSA 3ERED 1QZEA 1RI7A 4LG0A 4B43A 1OISA 3ZP5A 5JVTA 3F3XA 2FF4A 1D5VA 1E3PA 2EV6A 2DMUA 4HPQA 3BLYA 4IF4A 1JHHA 3DLAA 4A3FJ 3H0GJ 2VC0A 3GXOA 1R1UA 1S29A 2BEOA 1UG0A 5D5UB 1H88C 2VJJA 5HDNA 1YJ9I 1V5GA 2BOLA 2PMZA 2DYSH 5J1RA 5K1YA 1K4TA 5E1WA 2ZSIB 3QU3A 1D1CA 2HQRA 2Z99A 2NOJB 3GTOJ 1TWAJ 2A6EF 1DUXC 1FYLA 1TT0A 5ILVA 2DK8A 3TO7A 1TQIA 2M5WA 3LWFA 4C3HJ 4IRHA 2OCCH 3OIPA 4B47A 3AG2H 2L9VA 2LREA 4IPAA 1GV2A 3R0AA 5IOZA 2L7KA 3SQNA 1YIJI 2Z33A 1R9TJ 1F4KA 4I09A 3H3VK 2BY0A 2LTPA 2XHKA 4MHGA 2P6SA 4MQVA 3J80K 1XC5A 2FRHA 2IW5A 4X6AJ 1R5GA 3HXLA 3OYNA 2COBA 1HQCA 3LL7A 4ITVA 4QLCU 4RAGA 3QP6A 4QPOA 3PQJA 4JK1X 4LB6B 2QUFA 4HNTA 1TWFJ 4BXUA 3QU6A 3QWLA 4M6YA 2Y0SN 1N77A 2UXXA 3BZCA 2GAUA 2LKSA 2DK5A 3EUHC 2BE5F 2EB7A 2F4MB 2GOXB 2HKOA 4HF0A 2H6CA 2XIGA 1RUNA 2K9LA 2WA0A 3F9KA 4JOMA 1XDSA 4EJVA 1WGXA 2K86A 2PMUA 3DKXA 4S05A 4DOZA 1ETXA 4I99C 3N4MA 2CRGA 3QPTA 4ZZLA 1KONA 4NQWA 4BUPA 1IXSB 1T2KA 1ZREA 2NVXJ 5LHHA 3K1MA 2COMA 4ZDOA 2W82A 1BI3A 3S93A 5GP9A 2V26A 3R60A 4A3IJ 4AU7A 3BQZA 2JT1A 1Y6IA 3HOUJ 4A3GJ 4EGYA 1Y39A 1S7OA 3HKZA 4IHVA 1HC8A 1QU3A 4OAYA 3SEZA 3DBRB 2A07F 2D1VA 2OTJI 4M3DA 4D5FA 3MKZA 3MFKA 2PQ8A 4HOBA 1HBXG 2E2HJ 4GDFA 2R7OA 3TKYA 4P5OA 1GDTA 2HWVA 3OL3A 3QPLA 4YG2F 4G7OF 1R71A 4EVIA 4CICA 1YYVA 2GQQA 3ZQ7A 3V4GA 3SJMA 1IN6A 2VKDA 3K69A 3WE3A 2NVYJ 4R8HA 1FT9A 4XR6A 1MBJA 2PBIA 5L3BA 2RC4A 1ZAOA 5DM6F 4F7ZA 3DEUA 2M1BA 3UNGC 2VOPA 1DPUA 1BM9A 2DPUA 2M0CA 1HSJA 5BPIA 1S9HA 2EA4A 1W5SA 2M4GA 4AVPA 1YX3A 4ETSA 1HW5A 3ABUA 2JPCA 1BJZA 2DN0A 3I59A 2YX7A 2GZWA 2QCOA 5FKMA 2YPRA 1WJCA 1OCCH 1UJ8A 3S1MJ 3S2HJ 4JX5A 4FX0A 3CESA 1SC7A 4NB5A 2QA4I 1FIAA 2K9SA 4QPQA 3K2AA 2ETHA 2H1KA 4FETA 2CUJA 3TDUC 3E6DA 1PUEE 1P2FA 2K40A 3M9AA 5F04A 1OFCX 3LA3A 4KN4X 1XPXA 1EKEA 4PK4A 4AIHA 1CF7A 3AG1H 3DPTA 2DOAA 3JRIA 2VQCA 2EJRA 3Q3SA 3J7ZI 1O7FA 2X6OA 1Z7LA 2LRDA 3PSFA 5B66C 1CQTA 3Q0WA 1MDMA 5IYDJ 1U2WA 5DEQA 2VQHA 1U5TC 2O5RA 3HPHA 2BV6A 3Q9VA 4P55A 5F64A 3E6CC 1X3ZB 3CLQA 1I3QJ 1LJ9A 2V6EA 1IRZA 2OAZA 4XM3A 1X4PA 3HHGA 3JRAA 4WXDA 3QYBA 3CCEI 5DTDA 2DU9A 2PJRA 3ZN0A 2CO5A 2JRMA 5DV5A 2XKPA 2M9HA 4LLNA 1XGSA 4CYCA 3FXQA 2ZJRF 2W48A 4E4HA 1YE9A 1K4SA 3O3KA 4KISA 2VPLA 3HC7A 1B4AA 2OPTA 3JW4A 2E2JJ 1A04A 4CSWA 5J6XA 3V8LA 2UWMA 2PG4A 2M30A 4A3MJ 1HOMA 1TL8A 2EK5A 4UY8I 3S1NJ 4AIKA 3VWBA 3HYIA 3ZMZA 1WH5A 2OA4A 3GZNB 5GPAA 3ZQGA 3RPQA 5GAEJ 1NK2P 2EILH 4BQAA 4HSRA 2L02A 4UUTA 4ZYAA 1GLNA 1GUUA 3MAJA 3MZ8A 5L3DA 2FNAA 4ZJZA 3IRRA 1HW1A 2AQFA 5JHUA 2DOEA 3JSPA 1QQIA 4I02A 1YJWI 3DLLF 1LEBA 2DCEA 4A3DJ 2R7VA 3ML6A 1ONVA 5D6EA 4RB3C 4LIVA 3ABTA 1SAXA 1BC8C 4A3JJ 3BR0A 5F0CA 1HXDA 2MABA 1F5TA 5LLQA 1ZLKA 3E7LA 5E3LA 3BDDA 1BL0A 2LOOA 4BDYA 2E36A 2W00A 5CLSA 4Y17A 4YELA 2CUEA 3VDXA 2LVSA 3MWMA 2XASA 3WODF 3P9CA 5EZHA 4UVBA 3WTVC 3K4CA 3CUQB 3FWEA 3CCLI 4PZJA 5FLXZ 3BTCA 3VODA 1C0WA 1FPQA 3P5JA 2M8EA 1Z3YA 4DNCA 1ULYA 1Q1HA 5B1AH 3PO2J 3BJ6A 2R5ZA 2IA1A 3U1KA 3VYSB 4D0PA 3L09A 2X6XA 1FEXA 2DOFA 4EM0B 3F8BA 3HSFA 4BJ6C 4RGSA 1KQ9A 2IGMA 1XB4A 3IRQA 5FLVA 5KCMA 1FP2A 4L9VA 5HS8A 2WB1N 2Y75A 1GXPA 4RAYA 4HBLA 1I5ZA 3HG9A 3I0TA 5DCMA 2H94A 4NNJA 2GLOA 4XIDA 1BR4A 4XBFA 1K6OA 2B63J 1Y0NA 1ON2A 5TGTA 3B6AA 2F5VA 3V42A 4ZYGA 2VKHA 5HLTA 4GGGA 1NTCA 3VYUB 1RPWA 3OYJA 5AIQA 2L01A 5AONA 3LMMA 3RKYA 3I58A 3LQQA 3JR9A 2E1CA 1HKSA 1KU7A 1YRNB 2VE9A 5IP7J 3NAUA 1J7KA 4CZCA 2A3SA 1WWXA 2HDCA 1HKQA 2CMPA 2X85A 4M71A 2FOKA 9ANTA 1YX5A 3LA2A 3WTYC 3M8FA 2BVMA 2AO9A 3GLXA 3HUGB 1TWGJ 4RAFA 3EPZA 4X1EA 1UHMA 2FJ1A 5JHFA 4F91B 4XLPF 3LSRA 4XRFA 4B44A 1QHHD 2BW3B 5ICEA 3H36A 3IH4A 4M6XA 1Z6RA 2MLKA 3M7GA 2V1DA 3BP8A 1MKMA 3OYAA 2JSPA 1POGA 1B9NA 3MKYB 3J81K 5IP6A 2FQ3A 1R1VA 4U87A 2CQXA 1M1EB 1IN5A 2L54A 4RB2C 4EM2A 4PDKA 3RZDJ 2DAOA 5EGOB 1O3RA 3CC2I 4BXFA 3EUKL 1A36A 2ISYA 2KDZA 1U8RA 3IHUA 2LBFB 1JKPC 5BOXA 3EQLF 1Z7UA 2PMHA 2WBMA 3Q0UA 3OYLA 4KMUX 2G0EA 1IV6A 3MQ0A 1K61A 3RQ4A 1P7JA 2KL4A 3J7AY 4B8XA 1JUPA 3LSPA 2ZMEB 3ZQIA 3S17J 2WAEA 3ABKH 2ZXHA 2XRLA 1JT6A 2W57A 1UZCA 4RS8A 3LNQA 5LEKA 1LVAA 2LF8A 1S5LC 2O9LA 4Z2YA 4KNYA 5FD5A 1L0OC 3K1PA 2K27A 4G9YA 1GV5A 1JE8A 1MNMC 4NHJA 2HFHA 1U9OA 2GIVA 2ZC2A 3DKYA 3LOCA 3UR3C 2G7HA 4RGUA 3HRSA 3CP8A 1D8JA 3SFIA 1W4MA 5E3MA 2XC7A 3FK7A 3GTLJ 4OIQF 4XORA 1RZ4A 3F8FA 2DT6A 3VOEA 4XRSA 3UKGA 2VUMJ 1FMVA 1SMYF 2XAHA 5BQTA 2E60A 1UAAA 5HDGA 3FIWA 5ILSA 1W36D 4RLFA 1FTZA 3TP3A 4O5VA 1E3OC 3U2RA 3A2KA 1YJNI 3BG5A 4I2OA 3RKXA 2P7VB 1RNLA 3CJRB 1GHCA 3MZHA 2XPWA 1TQMA 2I5UA 3CJTB 4PSWA 1KA8A 3DQVC 3FBIB 3LA7A 1B59A 2ID3A 3GTQJ 3S8PA 2DA6A 4UVCA 2IVMA 2VASA 3SDBA 4IX7A 2XAJA 4BQOA 3EDPA 2Y0SA 2D2WA 3E6BA 1OKRA 4O6JA 5H6QA 3GYHX 1HW2A 2RGVA 2HQNA 3OMYA 1S7AA 2XF5A 4Q4ZF 5GTIC 1U78A 5CQEA 1E3HA 2CG4A 3OS2A 3OSGA 3K4BA 3G4SI 2HYJA 1YFHA 2ICWG 2L3DA 1FBQA 1I1GA 4BL0B 1SMTA 1JTYA 3F72A 4ZYDA 4E7IA 1XCVA 4FTHA 2K9NA 2VBWA 1VQPI 1IDYA 1HSTA 2OD5A 3R0JA 3M8JA 4R79A 5D4SA 2CUZA 2E7XA 2BY1A 2DT7B 3SXYA 1OCPA 2JPBA 2DQLA 1R5HA 2KZGA 3AAFA 3KP5A 4Y15A 1FSHA 1QRYA 5K7ZA 3MKWB 5CVIA 2CW8A 3ZOBA 2O3FA 4KT6A 3S3NA 3DEEA 1FTTA 1I50J 4XLFA 4NBQA 3CC7I 4OMYA 2Q8KA 5LGTA 5CVJA 5DCFA 3CCMI 2A6TA 3RSNA 1MGTA 1LUJB 1P9QC 2MFZA 1ZR2A 1VZ0A 3AG3H 3L2VA
chains in the Genus database with same CATH topology
1Z67A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z67 A; 
#chains in the Genus database with same CATH topology
 4A2U A;  5LD2 C;  3OYD A;  2K02 A;  2ZKZ A;  3A1Y A;  1FWZ A;  3TDZ C;  2IJL A;  2L4A A;  1VQK I;  2H8W A;  4G7Z F;  3E1S A;  2O03 A;  1P92 A;  3QQA A;  1J09 A;  4XIC A;  2FMY A;  2TDX A;  3ONQ A;  3M4O J;  2CW0 F;  3QPS A;  4EV0 A;  4BAC A;  2L7F P;  1XX5 A;  2DMT A;  3H1C A;  3JTH A;  4CH7 A;  4BQN A;  2NYX A;  1DQU A;  3FK6 A;  1ZEL A;  2O8X A;  1JTX A;  3FXK A;  3L7W A;  1EV7 A;  5BS6 A;  3OYB A;  2DO7 A;  1W0T A;  1VQO I;  5FKK A;  3KPH A;  2B9S A;  1XGN A;  1RET A;  3IUO A;  4A6E A;  1N25 A;  3R6S A;  1G6N A;  3ZQH A;  1BOB A;  2HS5 A;  3H3Z A;  2A6H F;  3SYT A;  4CHU A;  1K78 B;  4FAS D;  3KFW X;  4MFD A;  2K85 A;  1LFU P;  2CV0 A;  5GAD J;  3ZN1 A;  2AXL A;  3CCY A;  4EAT A;  2NNY A;  3HSE A;  5CKT A;  4KIT B;  5K5Q A;  1BW5 A;  4E7S A;  5BNG A;  5M5W J;  3H5R A;  1XSV A;  2DPD A;  2HXI A;  3L2U A;  3FXM A;  4G94 A;  4DQ2 A;  4A69 C;  1UEL B;  2R7F A;  4P96 A;  2HQA A;  3TED A;  4DZP A;  4PSX A;  3ZCO A;  4ZDP A;  2JN6 A;  4I76 A;  2P7C B;  4RGX A;  5EG0 B;  4JYK A;  5EEA A;  2P6T A;  5JLW A;  2LKP A;  1W7P B;  1BI2 A;  3AFH A;  1X3U A;  1I6X A;  4IRG A;  4M3F A;  2V1X A;  4II3 A;  4ANJ A;  1AA7 A;  1XMK A;  5LRR A;  5ICF A;  5FKO A;  1MNE A;  4M3E A;  4KA4 A;  3GTG J;  1TNT A;  2DMQ A;  1Z91 A;  4NC7 A;  3K70 D;  1LFP A;  4XKW A;  2QQ9 A;  2F5F A;  2P4W A;  3OYF A;  1TP4 A;  1WJE A;  1X1A A;  4IO9 F;  2FEZ A;  4F3Q A;  2ISZ A;  1JKO C;  3SZP A;  1R4M B;  2R3S A;  3LFU A;  3SHF A;  1P7I A;  3GME A;  2GXA A;  3DV8 A;  1AKH B;  4CCL A;  2LD5 A;  1WSU A;  1F1Z A;  3BG3 A;  1TWH J;  1V3F A;  2DXI A;  5A2Q K;  2OTL I;  3GEZ A;  4RA2 A;  1QZY A;  2JUC A;  3FKJ A;  4PJL A;  2NAZ A;  3H5A A;  3A0B C;  3RCO A;  5HDK A;  2DQR A;  4L5I A;  5C4J J;  4XLC A;  1T98 A;  4M72 A;  2JVH A;  2CFX A;  5IYB J;  5GAG J;  3TO9 A;  3ASO H;  4HLY A;  1ON1 A;  2YSR A;  1SD5 A;  3LFK A;  3RYR A;  5EEG A;  3RJP A;  4BEH B;  1FOY A;  2P5V A;  2TCT A;  1BA5 A;  3BQY A;  3CDH A;  5J3L A;  2RQP A;  5TIS C;  5KAI C;  3ZQL A;  3WU1 B;  1KQ0 A;  3SFZ A;  4GCV A;  5M5X J;  5KK1 A;  1XTA A;  2XAU A;  1MIJ A;  3TW7 A;  3U9G A;  1X1C A;  2LSO A;  3LSJ A;  1QZZ A;  1Y8Q B;  2CYY A;  3GTM J;  3KZY A;  5FB2 A;  2A5Y B;  4WX9 A;  2NS7 A;  4CO8 A;  4LK1 F;  2CQN A;  4IOC F;  1APL C;  2QQA A;  3G2B A;  4U88 A;  5ICC A;  3IWZ A;  1VQM I;  4HRI A;  4OMZ A;  5D4R A;  1VQN I;  3VYR B;  3LSH A;  2WB1 A;  2PLY A;  1QVU A;  2CGP A;  3B02 A;  1ZGW A;  3CTA A;  3KX2 A;  4IZZ A;  5C44 J;  3FXU A;  1G3S A;  4M9X A;  2HDD A;  2H09 A;  3VSK A;  1OJL A;  3J80 Z;  2HNH A;  1JHF A;  1W36 C;  3CC4 I;  1ZRD A;  2RNG A;  2Z1D A;  3COA C;  1ETW A;  5LBQ A;  1VND A;  2A5W A;  2CJJ A;  3AL0 C;  3F8M A;  1RUO A;  5J1U A;  2VLA A;  2KP6 A;  2XB5 A;  4AID A;  2PEX A;  1HKT A;  1YHQ I;  2BBY A;  3BTL A;  3FX3 A;  5CVV A;  3CDI A;  3K9T A;  3L2C A;  1X2M A;  2ZJ2 A;  3GW2 A;  5FRO A;  3BR1 A;  3HTS B;  3HOY J;  1SVM A;  1FP1 D;  3GTK J;  5E3O A;  2VN2 A;  1MBG A;  3A01 B;  2F4O B;  5IT3 A;  2A05 A;  2R7X A;  2ZXI A;  3DBL B;  3HHH A;  2IS6 A;  1SVO A;  2WC2 A;  1JUS A;  4IVN A;  3C18 A;  4UXN A;  2JMW A;  2UXN A;  4WXH A;  5GTH C;  4D1Q A;  3N05 A;  1H9T A;  4DGW B;  1QPI A;  1I6H J;  3GBG A;  2VQL A;  1D5Y A;  1UG2 A;  3OS0 A;  1X1B A;  2VON A;  1ZK8 A;  3AG4 H;  5K7H A;  2XUB A;  1K79 A;  2PX9 A;  2OCE A;  5F27 A;  2VT3 A;  3W6J B;  1I1S A;  3F6O A;  3ZMV A;  1D1A A;  4E7H A;  1R1T A;  2XDV A;  4E7Z A;  3H9J A;  3JAM K;  4A93 J;  4Y4R A;  1ZG1 A;  3I4N J;  1XSD A;  5CPR B;  3FKI J;  1S7E A;  3E0J B;  2B0L A;  3E6M A;  1NHA A;  2V9V A;  3TOB A;  1I27 A;  3HL2 A;  2WV0 A;  1HLV A;  2L9S A;  4HST A;  3HRU A;  3VB2 A;  1GXQ A;  4HEA 2;  3HPG A;  3W2A A;  2ELK A;  4YFN F;  3L2R A;  1KU2 A;  2LP0 A;  1JGS A;  2P5L C;  4JBA A;  2WWY A;  3HSR A;  4IHY A;  1IRF A;  2M3A A;  1SEU A;  4R1H A;  1WQ2 A;  2ZO4 A;  2W1O A;  3TBI A;  5HNH A;  2V79 A;  2DI3 A;  4L5J A;  2H1L A;  5ED4 A;  3E5U A;  2L4M A;  3K2Z A;  2ADU A;  4C2M J;  3S14 J;  4CCM A;  3JRE A;  4G8X A;  2R5Y B;  4OIP F;  3GFM A;  3VEP A;  2GXB A;  1FBU A;  1YTY A;  3E97 A;  2PN6 A;  2Z9O A;  3P9I A;  4RGR A;  2JRT A;  4ESF A;  4XRS G;  3ESW B;  2V9K A;  1DU6 A;  3KLN A;  5EJC A;  1FYM A;  4DYC A;  3GUD A;  1J59 A;  4M73 A;  4N9H A;  1RES A;  2L5Q A;  4N4O B;  1S6L A;  2DFH A;  1OCO H;  2E19 A;  4ENJ A;  2V1U A;  3W2W A;  4I6Z A;  3U1D A;  3KCC A;  2ESN A;  1IO2 A;  4MTE A;  4MIM A;  3SZT A;  4E7J A;  4W97 A;  2MYS A;  4HV5 A;  1Y1V J;  3ZMU A;  3NRV A;  3WTX C;  1SFE A;  3V7R A;  3V8J A;  3PNY A;  1Z3X A;  1T95 A;  3A03 A;  1Z05 A;  2CSO A;  2FE3 A;  1ZG5 A;  2EZH A;  2NS8 A;  3LST A;  5CVR A;  2KZV A;  2E1N A;  3ABM H;  5E8G A;  4RMN A;  3PUF A;  4Y3O A;  2WAQ N;  2CU7 A;  1XMA A;  3CME I;  4BY1 J;  1DGR M;  1G59 A;  4D9J A;  1F43 A;  2IA0 A;  2DA7 A;  3NWS A;  3MD2 A;  4ESB A;  5GAH J;  4BAY A;  2HEO A;  3OIO A;  2HGC A;  1XGO A;  2KFD A;  4OOI A;  5HOO A;  3MKL A;  3DWL E;  3F8C A;  4KN7 X;  2H8R A;  3C3W A;  3RZO J;  1I3A A;  2MC3 A;  5F6F A;  1IXC A;  2D45 A;  2KKO A;  1PUF B;  5LEJ A;  3RYP A;  4A5M A;  1BOA A;  4EMS A;  3JRF A;  2IRF G;  1FY7 A;  2VOD A;  2QGU A;  3A02 A;  1Y1W J;  2V7F A;  3KEO A;  5EF6 A;  3H0D A;  2BZT A;  1MMS A;  3K70 C;  2YX4 A;  2F5C A;  1G3T A;  4A0Z A;  2NVT J;  1MJ9 A;  5F0H A;  5K5O A;  3DCF A;  3I59 B;  1BBY A;  1I39 A;  3BR2 A;  2ACJ A;  4ZH4 F;  1SAN A;  1Z77 A;  4EJO A;  1JJ8 C;  2PI0 A;  4UV9 A;  4BDZ A;  3P9K A;  1DP7 P;  5EEH A;  1MJA A;  2FU4 A;  4DYQ A;  1UMQ A;  1JI8 A;  2OUM A;  1IUF A;  2R4G A;  4HLX A;  2DA4 A;  1MSE C;  2GA2 A;  3A4C A;  3LSG A;  1TQP A;  2DJI A;  3OYH A;  3JTG A;  2HR3 A;  3G3Z A;  2BW3 A;  2ZBK A;  2IGO A;  3I53 A;  2F4I A;  2GM4 A;  2RNJ A;  2EA2 A;  1N75 A;  2R7Z J;  2W85 A;  3CO7 C;  1B8I B;  1G2H A;  4L18 B;  4CCJ A;  1T56 A;  3WGG A;  3K4J A;  3CF5 F;  1G4D A;  3CUO A;  3JRB A;  4S0H B;  2OBP A;  1Z67 A;  2RDP A;  4C3I J;  3DKW A;  1VQ7 I;  1A6Q A;  4PJM A;  5FLX K;  2E2I J;  2MC4 A;  3CF2 A;  1FMW A;  3TW6 A;  5M3M J;  1H8A C;  2PJR B;  2EQR A;  1BIB A;  2WAD A;  3BCB A;  3WTT C;  4EJW A;  3GLL A;  2IXS A;  2KRF A;  1VF9 A;  2QEX I;  2LBF A;  2O8K A;  3C2G A;  3BJO A;  4OWR B;  3BC8 A;  4G6D A;  5HS7 A;  3G1O A;  3RPU D;  2UUZ A;  4HZF A;  4UUS A;  1Y0U A;  4KT5 C;  2OF7 A;  1TBX A;  2IGN A;  2V1N A;  4C9Y A;  3G1M A;  2EFP A;  4AYB N;  4B4C A;  5KVR A;  5CYV A;  2ZFU A;  4P1W A;  4GXO A;  1O3S A;  3FHZ A;  3AKZ A;  5TJJ A;  3TL4 X;  2XVC A;  3RPU A;  3TGN A;  2HXO A;  3L2Q A;  4LIU A;  1EJ9 A;  5J40 A;  1U0J A;  2F5D A;  1AWC A;  1A31 A;  2BYV E;  2WAF A;  2NNN A;  3H92 A;  4LJZ F;  4B09 A;  1T0F A;  2L7M P;  4WK8 F;  1D0Z A;  4BBS J;  2LG4 A;  1T6S A;  2EIM H;  2NOG A;  3MZY A;  2HZD A;  4E70 A;  4LGW A;  3BTI A;  3HOV J;  3O2P E;  3R4K A;  2OQG A;  2DYR H;  2Y9Z A;  1IN4 A;  2K4J A;  5FRM A;  1X3W B;  3TOA A;  1Z9C A;  4V19 K;  5E79 C;  3J7Y J;  4IQJ A;  3L2W A;  4BE2 A;  1FLI A;  1IC8 A;  2X1E A;  2MSY A;  4QWQ A;  2P81 A;  4CZZ A;  2XGC A;  1YIO A;  3OYI A;  1FOK A;  1R58 A;  2LY2 A;  3PJR A;  3WG7 H;  4H4K C;  3V7S A;  2IEK A;  2EZI A;  3K4K A;  5J1Y A;  1ZH5 A;  2PJP A;  5J8F A;  4L9T A;  3LAP A;  1SFU A;  2YU9 J;  2CV2 A;  2DFE A;  4XSX F;  1R7J A;  3ZMD A;  2OJE D;  3OYC A;  4LLG F;  1WI9 A;  3JRD A;  4BE0 A;  4H0E A;  2M8G X;  2LC2 A;  3PNV A;  2HDW A;  4RB0 A;  2HPI A;  2FQ4 A;  2K4B A;  1KYZ A;  1R6R A;  4A3K J;  1EA3 A;  1E0E A;  3NAR A;  4ON0 A;  2MW8 A;  3DF8 A;  4QTR A;  1V55 H;  2YR2 A;  2STW A;  2JA7 J;  4EM1 A;  1RR8 C;  2QBY B;  3S2D J;  1MND A;  1U3E M;  1IN7 A;  2ZFW A;  3N97 A;  1K83 J;  2KMU A;  2RRE A;  1F9N A;  2R7U A;  3ASN H;  4UNO A;  3IAM 2;  2DT5 A;  2FML A;  5E18 F;  1LPQ A;  1HF0 A;  3CMM A;  5IT9 Z;  3KET A;  4W1U A;  1SD7 A;  4BBR J;  2IPQ X;  4ZYE A;  2DA5 A;  1J9I A;  4XN3 A;  2JA2 A;  5E1Z B;  3WTW C;  2DW4 A;  2P8T A;  4XOP A;  1ETO A;  1P6R A;  2E1M C;  2FBK A;  3F23 A;  2DDA A;  4HDU A;  4HQE A;  2VL8 A;  3K10 A;  2OQR A;  4HAM A;  4MNU A;  4D7M A;  1PP7 U;  1STZ A;  2J5O A;  2VBX A;  4L5E A;  4C3J J;  4IKF A;  3GFL A;  3O6B B;  2KHM A;  4ZTF A;  1TTY A;  1KZH A;  1OCR H;  3LQR A;  2VB6 A;  1HDP A;  1HCR A;  3I54 A;  4DYR A;  4BKX A;  2QSF X;  1UB9 A;  5E8I A;  1GVD A;  4AVZ A;  3ZGK A;  1JXS A;  4YEJ A;  4NC6 A;  3CCR I;  2CS3 A;  1MMD A;  2QYO A;  2R7D A;  3OS1 A;  2X6Y A;  4LMY A;  4UVA A;  3FMQ A;  4XKV A;  3PFY A;  4PUS A;  2UV1 A;  3I64 A;  4E6K G;  1REP C;  3IL2 A;  4OIO F;  4B3X A;  3FMR A;  1MMN A;  3D5S C;  5B1B H;  3WGH A;  1YW7 A;  5KNL A;  4U7D A;  4KIG A;  4XRM A;  2NXN B;  1ZKG A;  5E20 A;  3ROU A;  2JUG A;  1QBJ A;  1WH7 A;  1G3W A;  3LSI A;  2VPR A;  4CXF A;  2QZ8 A;  2FSW A;  4HA8 A;  4TV7 A;  1YO5 C;  1VQ9 I;  3B73 A;  3L1P A;  3I71 A;  2FD5 A;  2FNP A;  1ZGJ A;  2IA2 A;  2XV4 S;  4M6V A;  2ZXJ A;  4JX4 A;  1ZRF A;  5GPC A;  2LMD A;  1K78 A;  3T5X A;  1X2N A;  2KIS A;  2IS1 A;  4IHW A;  3W6K B;  2XF7 A;  2MH9 A;  4MO7 A;  3S3O A;  2E35 A;  1KGS A;  2HVS A;  3WGI A;  1O3Q A;  4Y13 A;  4I7H A;  2VC1 A;  2F48 A;  1LE8 B;  3J7A O;  1W7P D;  4U0W A;  3JCU C;  1WCM J;  1S3J A;  2R7R A;  1MMG A;  2EFQ A;  2HVR A;  2E1O A;  3I9V 2;  1RRJ A;  3G71 I;  2IGK A;  3FXL A;  2HYF A;  3HRM A;  3W6V A;  4GFB A;  4N9I A;  2ZSH B;  4B3A A;  4WWC A;  4LB5 A;  2UZK A;  5EG0 A;  2Q2E A;  5FKN A;  3X2Q H;  3KP3 A;  2HU9 A;  2X4H A;  2FOW A;  1W7P A;  1WZ2 A;  2M4K A;  2CH0 A;  3K4M A;  4B48 A;  3K6G A;  1MSF C;  4DBR A;  2Q1Z B;  1QO0 D;  4AD9 A;  3S1R J;  4CA0 A;  1MD0 A;  4U7B A;  3FDY A;  1VQ4 I;  4DW6 A;  2O61 A;  4F93 B;  3H9G A;  3BG6 A;  5EYR A;  4RBO A;  3KYD B;  2XSJ C;  5BMZ A;  1VFC A;  4PJN A;  4A3L J;  1ZN2 A;  5JI6 A;  1JKR C;  3HZJ A;  5L3E A;  2G7U A;  3K1N A;  1AKH A;  4KFC A;  3K7A J;  3C1D A;  3L00 A;  4BJ5 C;  3V8K A;  1W1W E;  2VE8 A;  4HDV A;  4AIJ A;  3MVP A;  3KP4 A;  1WJB A;  2KIU A;  1Z21 A;  5JR3 A;  2HTJ A;  2QQ8 A;  2QF7 A;  3TO6 A;  3ZPL A;  4QIW N;  5F1J A;  1YOV B;  2HZT A;  4FCY A;  4CYD A;  1N78 A;  1U6G A;  2XF6 A;  4F55 A;  4DIQ A;  4C2T A;  4FQG A;  3SEQ A;  1X19 A;  3MMY B;  2OZU A;  3LAJ A;  1ORK A;  1A5J A;  2LDU A;  4MLO A;  2GXG A;  2ME6 A;  5AIP A;  3I5U A;  5J4Y A;  2YS9 A;  3OYG A;  2MBF A;  5IYC J;  2GIZ A;  2GBY A;  2DA1 A;  2EIJ H;  4Q47 A;  3TQN A;  2XGX A;  4U0V A;  4J00 A;  2VJ5 A;  1QNT A;  2YU3 A;  4JP0 A;  3CLO A;  4K2E A;  1CGP A;  1T0F C;  2WAQ A;  2LR8 A;  1OCZ H;  4G7H F;  4B1R A;  1E2X A;  1YS6 A;  2QEN A;  2ZCW A;  2MLG A;  3QOP A;  3BR6 A;  1OR7 A;  1FNN A;  3IWF A;  1FIP A;  3KIO A;  3R61 A;  1FC3 A;  1YG2 A;  2DMP A;  3K4N A;  3ABL H;  3OR1 C;  2HOE A;  2FBI A;  2CUF A;  1T08 B;  3SZG A;  1QPM A;  1UFM A;  4PFO A;  1SFX A;  2KRC A;  2XSD C;  2ME0 A;  3W3C A;  1VI0 A;  2NS0 A;  3T0Y A;  5LFA A;  3HM5 A;  2R0Q C;  5L3C A;  2W4S A;  3BPX A;  4O3M A;  4BU2 A;  2O7O A;  4GO1 A;  1G3Y A;  1QA6 A;  4NDL A;  2QSH X;  1MH3 A;  1H0M A;  2H27 A;  4CCK A;  2EZK A;  4OAZ A;  1XCB A;  1YIT I;  5JLX A;  2HOT A;  3OOP A;  1B72 B;  4GYG A;  3G6E I;  1IDZ A;  3LSM A;  3F8N A;  4C2U A;  2P0W A;  4OU0 A;  2K3F A;  2DBB A;  2IP2 A;  1VQ8 I;  1D0X A;  3KP2 A;  3OYK A;  3ZQQ A;  5HVQ C;  4BQQ A;  1JKQ C;  4LG3 A;  3HBL A;  4A12 A;  2JTV A;  1ZGA A;  2J5P A;  2V6C A;  3F21 A;  4I98 B;  5JFR A;  4E7L A;  2AHQ A;  4L0Y B;  2VXD A;  3CJN A;  5CVU A;  4LOC A;  4DZJ A;  1L3L A;  2Z16 A;  4HX4 A;  1FOW A;  5J47 A;  2EV5 A;  4RM2 A;  3GZ5 A;  3OYM A;  3ZQC A;  3RI4 A;  1NK3 P;  4XMY A;  1FZP B;  4CDG A;  2DJN A;  2EZL A;  1IGN A;  2XRO A;  3QPH A;  4CCO A;  3RTR A;  1U5T B;  3S2W A;  4DBQ A;  2Z5U A;  1T38 A;  4HYE A;  2FX0 A;  1BI0 A;  2L9R A;  2L2O A;  2LF7 A;  3FF5 A;  2BXZ A;  3OY9 A;  1J2X A;  1Y8R B;  3DPU A;  5HS9 A;  3DTE A;  5DS9 A;  3WU2 C;  3T8T A;  4J01 A;  3C2H A;  4CUG A;  1IV8 A;  1WKM A;  3QRF F;  2WTE A;  3WE2 A;  3I56 I;  1K6Y A;  5E3N A;  1J0R A;  2DTR A;  2STT A;  3GVA A;  4Q48 A;  2X48 A;  3JRH A;  1VQ6 I;  1OLT A;  2XGD A;  3FHN A;  3E5X A;  2VJ4 A;  3ZMT A;  1YQA A;  3FM5 A;  2VIX A;  5LHI A;  2BHZ A;  2KQR A;  4HNV A;  3DFG A;  3SDG A;  5FD6 A;  3EUA A;  4V2F A;  2M7A A;  3C7J A;  2A69 F;  2DTZ A;  4IRI A;  2D1H A;  3FXJ A;  1QGP A;  2VXZ A;  4AYB A;  2A61 A;  3VFZ A;  1NG6 A;  1S72 I;  4HQM A;  1LNW A;  2EIK H;  4UV8 A;  1U8B A;  2Y48 A;  1RKW A;  4P9U A;  2IS4 A;  1ACI A;  3QP5 A;  2HOS A;  1P4W A;  2JSC A;  2KJC A;  1OYI A;  4A3C J;  2QLZ A;  4C30 A;  2KT0 A;  1UCR A;  4EEF G;  1ZYR F;  4II2 A;  1A6I A;  2QKM B;  2Z2S B;  2DLL A;  2R5Y A;  4I0B A;  5ILU A;  3WTS C;  1T8I A;  4ABZ A;  4A0Y A;  4U0Y A;  1R23 A;  3KZI C;  2EPF A;  2X51 A;  4X0G A;  3PIO F;  4ZZD A;  4UB8 C;  1DPR A;  1R36 A;  2M87 A;  4XOT A;  4A3E J;  4JQF A;  1FOX A;  3NEU A;  4MFE A;  1Z6T A;  3QAH A;  1R49 A;  2MD0 A;  5D5W B;  2PFB A;  5EDN A;  1X1D A;  2KIF A;  3BG7 A;  1WJA A;  4ENM A;  2WV1 A;  2H6B A;  2RN7 A;  3PNT A;  5M3F J;  1BR1 A;  1ZLJ A;  2JVG A;  3F22 A;  1ZG3 A;  1AOY A;  5FGM A;  3S1Q J;  4XK4 A;  2BY3 A;  3CO6 C;  4ZYH A;  4G12 A;  2ZJQ F;  1JUM A;  2Y69 H;  3PO3 J;  2F6C A;  2BHY A;  3K0L A;  1BW6 A;  3CMY A;  1ETY A;  2IBD A;  3HRT A;  5ICG A;  3BCA A;  2HPM A;  3D0S A;  4XKB A;  3JAM Z;  1RIO H;  2XAQ A;  5CJ9 A;  4D7N A;  3S3M A;  4M9S A;  2Q0O A;  1TNS A;  1P4X A;  3K4L A;  5HNF A;  4F92 B;  3I4M J;  2RV8 A;  2HI3 A;  1MW7 A;  2I10 A;  1PUF A;  2FXA A;  2XPV A;  3Q9S A;  4OIN F;  1OPC A;  4RDU A;  3I3L A;  3B6C A;  3H3U A;  3REO A;  2EV0 A;  2TRT A;  1IN8 A;  3CJQ B;  2YUS A;  2VOO A;  1J75 A;  1MH4 A;  1RKT A;  5FFZ A;  1PYV A;  2RQQ A;  2X1D A;  3DTK A;  3KP6 A;  4MGR A;  3TMO A;  1OCT C;  1SD6 A;  4NQW B;  2MG4 A;  2VKE A;  3F6V A;  3KP7 A;  2EBI A;  1DP3 A;  1R22 A;  3ZRG A;  3KYL A;  1XSX A;  4KJZ A;  2ZB9 A;  4MTD A;  3RQI A;  5L3G A;  4PCQ A;  1ETQ A;  4FT8 A;  2JA8 J;  3C2B A;  4MEY F;  1IUY A;  4UB6 C;  3VYT B;  4A0X A;  2MD5 A;  3Q0V A;  3H5N A;  5M5Y J;  5LGN A;  1P4A A;  5J4V A;  3Q5F A;  3CUQ A;  1SVL A;  1B8I A;  3PFI A;  1VTN C;  1ZHF A;  4BJT A;  2E7W A;  2R7S A;  1MBK A;  3CD6 I;  3PSI A;  2Y30 A;  4HV6 A;  4A6D A;  1WJF A;  3BY6 A;  5L3F A;  2VBZ A;  2DA2 A;  3CCJ I;  4KMF A;  2K3P A;  4ZDL A;  1OR7 C;  3CCV I;  4MQ9 F;  1V5F A;  3HOX J;  1IW7 F;  1FSE A;  2LY1 A;  4L0Z B;  2HYG D;  3NQO A;  3BT9 A;  4HW0 A;  3WHB A;  3ZQF A;  4YIF A;  2BGC A;  4LK0 F;  1TZL A;  1UST A;  1XMX A;  3FM3 A;  4BHP A;  3GZ6 A;  2Z3Y A;  4E7K A;  1WJD A;  2GA1 A;  2XKO A;  4BHC A;  3DEW A;  3OOU A;  3BZK A;  1R00 A;  1W5C C;  4Q5S F;  4JX6 A;  5B3S H;  4A5N A;  1XGM A;  4PFP A;  3CCS I;  1DGW Y;  2E71 A;  1Z0X A;  3HGY A;  3GO5 A;  3BR3 A;  1NG7 A;  1YRN A;  2X9D A;  2O0Y A;  4XN0 A;  2W7N A;  1WHU A;  4XL9 A;  2AQE A;  3OIQ A;  5FLM J;  3MCZ A;  4MEX F;  1MJB A;  4DJA A;  1KYW A;  2C6Y A;  2DA3 A;  3M8E A;  2L7Z A;  1W0U A;  1IXR C;  3WTU C;  2LY9 A;  2FA5 A;  2B7E A;  3HUG A;  1ZQ3 P;  1ITY A;  1WPK A;  2EFO A;  3BZ6 A;  3G1L A;  2XAG A;  1CF7 B;  3GF2 A;  3DBH B;  4I01 A;  4HG2 A;  4ESJ A;  3IKT A;  1OYY A;  2E1M B;  2ESH A;  4OIR F;  1MDM B;  2LLK A;  4KDP A;  1IF1 A;  2R7Q A;  1ZRC A;  3FIS A;  1FX7 A;  3MEX A;  3GX4 X;  4UHT A;  2ZNY A;  4BH9 A;  1YI2 I;  3GWZ A;  1MZB A;  2DOD A;  2LK2 A;  5DUI A;  3BR5 A;  3PM1 A;  3BJA A;  1B6A A;  3IV5 A;  1BN5 A;  4I0A A;  4YII A;  5EGO A;  3DU5 A;  4IOA F;  1SD4 A;  3D1N I;  1O3T A;  3PQK A;  2LKX A;  2PMZ N;  5D5X B;  2JQ7 A;  4FHT A;  2CQ7 A;  2E5Z A;  4CYC B;  2ZJP F;  5H20 A;  3IH3 A;  2MGQ A;  1TC3 C;  4M9Z A;  3T1B A;  1VQ5 I;  3W2V A;  5LHG A;  1KU3 A;  2XAF A;  4N0B A;  4M74 A;  2AXT C;  4YFX F;  2ZME A;  2HOA A;  1BIA A;  5D8K B;  3LSK A;  1EF4 A;  2ELJ A;  3HTU A;  3HOS A;  1Y56 A;  4L9N A;  1S8N A;  1G8X A;  3BG9 A;  3QYF A;  4ENK A;  1K7A A;  3HIF A;  2JA5 J;  5C4X J;  1LFB A;  3HJE A;  4RM3 A;  4N4N B;  4BYY A;  3GFJ A;  1XG1 A;  5E17 F;  1O57 A;  2QBY A;  3FZV A;  3M1E A;  2RAE A;  1DU0 A;  3HOW J;  2KJB A;  4IXA A;  4EJU A;  3JSO A;  1B1B A;  3S16 J;  1BC7 C;  1IG7 A;  4RAZ A;  2KIM A;  1VQL I;  1E17 A;  1HDD C;  5HLG A;  2F5E A;  2EFW A;  2JJ7 A;  2K9Q A;  4KUM A;  3JRC A;  1ODD A;  1LKX A;  2EWN A;  4FIS A;  2JA6 J;  1BI1 A;  1SFK A;  2ECB A;  3IH2 A;  1XS9 A;  2BXY A;  2X6W A;  4BY7 J;  2EIN H;  2ZXW H;  5JVG F;  4XLH A;  1H89 C;  2BY2 A;  1YW8 A;  1WVR A;  1JT0 A;  4WF2 A;  3ZR8 X;  2N8G A;  4XON A;  2XB0 X;  2NVQ J;  2WY8 Q;  2V9P A;  2R92 J;  1XD7 A;  3HKZ N;  1IJW C;  2W25 A;  3KYC B;  3J81 Z;  4HF1 A;  4KIB A;  1UHW A;  3OYE A;  3BWG A;  4FX4 A;  1ZR4 A;  1EH6 A;  1ZTR A;  4A3B J;  5DUK A;  1WFX A;  4HX8 A;  3HGG A;  3HOZ J;  2IT0 A;  1D8K A;  3IP4 B;  3OL4 A;  1BR2 A;  2VKV A;  4AC0 A;  2R5Z B;  1JJ6 C;  1V54 H;  3T8R A;  3BTJ A;  2K7L A;  3E3V A;  3HEF A;  2NRA C;  2ID6 A;  4KIC A;  3VPR A;  4FE7 A;  3ZXS A;  1U9N A;  4YRV A;  2OZ6 A;  3JRG A;  3CP2 A;  5E1X A;  2DDB A;  4LG0 B;  3KEQ A;  3RIR A;  2RKH A;  5DCM B;  5D5V B;  2ZNZ A;  1A35 A;  2CW7 A;  5FO5 A;  2X1C A;  3WHC A;  4UUS B;  3FMS A;  3M07 A;  3KE2 A;  2XGE A;  2I8D A;  2QM3 A;  2M7B A;  3BOQ A;  1TLH B;  5DDG A;  3PIP F;  3HDD A;  2MH2 A;  4G6T B;  3S32 A;  2XPU A;  1GT0 C;  2W24 A;  3HB9 A;  1SAU A;  1HA8 A;  5HLI A;  4LLL A;  5FJ8 J;  1EH7 A;  1ENH A;  2JWT A;  4ZTJ A;  1LE8 A;  2HVQ A;  4AM3 A;  3EET A;  5HOD A;  1OYW A;  4NC8 A;  5IT9 K;  4AWX B;  4KIF A;  3RKW A;  4XQF A;  4ZC3 A;  1BJA A;  2HKX A;  1WJ5 A;  4S04 A;  2G9W A;  4IL6 C;  2R7W A;  3WU0 A;  3CCQ I;  3I55 I;  1V4R A;  4XSZ F;  1DDN A;  2E34 A;  2XRN A;  3M1C A;  1O7L A;  4CGZ A;  5B5E C;  3KEY A;  4XNF A;  3H35 A;  3DU6 A;  3FXR A;  2LYC A;  3ISP A;  4IHX A;  4BNC A;  1LDK B;  3QOE A;  2IS2 A;  2P5K A;  1IZ1 A;  5DD4 A;  3CCU I;  3RDI A;  4BGD A;  2E5N A;  4BE1 A;  1LVK A;  1IRG A;  4V2G A;  3PUB A;  1AHD P;  4IQ4 A;  3CUQ C;  3DTI A;  5F08 A;  1X1P A;  2M2E A;  5HLH A;  4EGZ A;  1FYK A;  2Y2Z A;  2LFB A;  3DXJ F;  2CV1 A;  1Q1V A;  5KHD A;  4Y52 J;  2VJI A;  2LH9 A;  3FXO A;  1J5Y A;  3EUH A;  1YS7 A;  1PP8 F;  2F2E A;  4ENN A;  2V4J C;  1LDJ A;  4P9F A;  3EYI A;  4AUX A;  3ECO A;  1WI3 A;  2M34 A;  3ZMS A;  4Z6Y A;  2KLO A;  5DD8 A;  5F1R A;  4HF2 A;  1XN7 A;  3ERM A;  1LQ1 A;  2CQQ A;  2HTS A;  5IPA A;  3HOT A;  4L9J A;  4YFK F;  3PL8 A;  1TT5 B;  2O6G E;  2M45 A;  2IAI A;  1FJL A;  5CQG A;  1KU9 A;  1T33 A;  5C3E J;  1D1B A;  4ASN A;  3GTP J;  2KRH A;  4GYI A;  4FE4 A;  1AU7 A;  5J8C A;  1ERD A;  3ELK A;  1LEA A;  4PGH A;  2OC6 A;  2X0L A;  2CWE A;  4CCN A;  2Y9Y A;  2L0K A;  1X4O A;  5K5R A;  3MN2 A;  5IY5 H;  2Y31 A;  3E5Q A;  4EQQ A;  4M3G A;  2QKL B;  5F0F A;  3L9F A;  5DM7 F;  1FBS A;  1LDD A;  4D5C A;  3S15 J;  2R7T A;  1B9M A;  1H9G A;  1ETK A;  3FBN B;  5H6R A;  1JGG A;  2VT2 A;  4Y7N J;  2VBY A;  4RB1 A;  4YIR X;  1UHS A;  3CDL A;  1WRJ A;  2A68 F;  3O8H A;  1MBH A;  1QVT A;  1RR7 A;  1F36 A;  2K9M A;  2QQB A;  2VQG A;  4LD5 A;  3KZZ A;  2R93 J;  1PDN C;  3OV8 A;  2Y0M A;  2L9N A;  4XLA A;  1MBE A;  3QYE A;  4LIT A;  4PJJ A;  1XDU A;  1R4N B;  1RC9 A;  4KYW A;  1YW9 A;  3AL0 B;  2MA3 A;  1T39 A;  5ERI A;  4HNU A;  1B72 A;  4IJA A;  2QWW A;  1SFO J;  4M3B A;  4WCG A;  1OMI A;  2KPM A;  1PVE A;  3OWT A;  4PGG A;  3CMA I;  3WG9 A;  2KIQ A;  2D5V A;  3H9Q A;  3I4P A;  4QSH A;  5LRS A;  3KLO A;  2OU2 A;  5K7F A;  3QOD A;  2QSG X;  2ZME C;  5IP9 J;  3U21 A;  4BXX J;  4BHB A;  4BEH A;  2GWR A;  1LB2 A;  2GOM A;  1ETV A;  2EH3 A;  3IAS 2;  1GVJ A;  2DMN A;  1YLF A;  6PAX A;  5BPD A;  3D5L A;  1V5E A;  4IHT A;  3DPL C;  5EZG A;  1U5T A;  3EYY A;  4XLN F;  4NUB A;  1TWC J;  5TRD A;  1W5T A;  2QVO A;  3WTZ A;  4XLE A;  2CQK A;  4WXC A;  2KDO A;  3G73 A;  4G6Q A;  5IOY A;  1MBF A;  1X58 A;  3IC7 A;  3M3Y J;  2K5C A;  3ULQ B;  4J19 A;  2EFN A;  2BVL A;  3F0C A;  3NWT A;  3OSF A;  1EH8 A;  3GCM A;  2JZY A;  2NVU B;  1IRX A;  2DFI A;  1NH3 A;  3RKQ A;  3P7N A;  3OR2 C;  2ECC A;  3D5R C;  5D6F A;  2VI6 A;  1KQ8 A;  3CQZ J;  3GFI A;  4GRI A;  4UUV A;  2Q2E B;  1IAW A;  2W84 A;  4XKC A;  4IEJ A;  4HX7 A;  1ZAR A;  1D3Y A;  1MMA A;  1PJR A;  2DFF A;  2JK3 A;  4PJ0 C;  4BS9 A;  3BRO A;  5LGU A;  3BPV A;  4EJT A;  4F52 A;  2ELH A;  3TP0 A;  2RVC A;  2FBH A;  5FRN A;  5FKL A;  1R5I D;  3A0H C;  1TW3 A;  2AS5 F;  4IHS A;  5KAF C;  2CFO A;  3O8G A;  5A2Q Z;  3GTJ J;  2HQ5 A;  1TW2 A;  1D0Y A;  2OV7 A;  2LNB A;  1QHG A;  2M0M A;  2FUG 2;  5FFX A;  3CZ6 A;  5DYM A;  4RLQ A;  2WY7 Q;  4LFU A;  3VSL A;  5H2F C;  1O4X A;  3V7C A;  3DP7 A;  1OQY A;  1Z1D A;  3A01 A;  5D8L B;  3ECH A;  3IKV A;  4Y33 A;  1USS A;  3ERE D;  1QZE A;  1RI7 A;  4LG0 A;  4B43 A;  1OIS A;  3ZP5 A;  5JVT A;  3F3X A;  2FF4 A;  1D5V A;  1E3P A;  2EV6 A;  2DMU A;  4HPQ A;  3BLY A;  4IF4 A;  1JHH A;  3DLA A;  4A3F J;  3H0G J;  2VC0 A;  3GXO A;  1R1U A;  1S29 A;  2BEO A;  1UG0 A;  5D5U B;  1H88 C;  2VJJ A;  5HDN A;  1YJ9 I;  1V5G A;  2BOL A;  2PMZ A;  2DYS H;  5J1R A;  5K1Y A;  1K4T A;  5E1W A;  2ZSI B;  3QU3 A;  1D1C A;  2HQR A;  2Z99 A;  2NOJ B;  3GTO J;  1TWA J;  2A6E F;  1DUX C;  1FYL A;  1TT0 A;  5ILV A;  2DK8 A;  3TO7 A;  1TQI A;  2M5W A;  3LWF A;  4C3H J;  4IRH A;  2OCC H;  3OIP A;  4B47 A;  3AG2 H;  2L9V A;  2LRE A;  4IPA A;  1GV2 A;  3R0A A;  5IOZ A;  2L7K A;  3SQN A;  1YIJ I;  2Z33 A;  1R9T J;  1F4K A;  4I09 A;  3H3V K;  2BY0 A;  2LTP A;  2XHK A;  4MHG A;  2P6S A;  4MQV A;  3J80 K;  1XC5 A;  2FRH A;  2IW5 A;  4X6A J;  1R5G A;  3HXL A;  3OYN A;  2COB A;  1HQC A;  3LL7 A;  4ITV A;  4QLC U;  4RAG A;  3QP6 A;  4QPO A;  3PQJ A;  4JK1 X;  4LB6 B;  2QUF A;  4HNT A;  1TWF J;  4BXU A;  3QU6 A;  3QWL A;  4M6Y A;  2Y0S N;  1N77 A;  2UXX A;  3BZC A;  2GAU A;  2LKS A;  2DK5 A;  3EUH C;  2BE5 F;  2EB7 A;  2F4M B;  2GOX B;  2HKO A;  4HF0 A;  2H6C A;  2XIG A;  1RUN A;  2K9L A;  2WA0 A;  3F9K A;  4JOM A;  1XDS A;  4EJV A;  1WGX A;  2K86 A;  2PMU A;  3DKX A;  4S05 A;  4DOZ A;  1ETX A;  4I99 C;  3N4M A;  2CRG A;  3QPT A;  4ZZL A;  1KON A;  4NQW A;  4BUP A;  1IXS B;  1T2K A;  1ZRE A;  2NVX J;  5LHH A;  3K1M A;  2COM A;  4ZDO A;  2W82 A;  1BI3 A;  3S93 A;  5GP9 A;  2V26 A;  3R60 A;  4A3I J;  4AU7 A;  3BQZ A;  2JT1 A;  1Y6I A;  3HOU J;  4A3G J;  4EGY A;  1Y39 A;  1S7O A;  3HKZ A;  4IHV A;  1HC8 A;  1QU3 A;  4OAY A;  3SEZ A;  3DBR B;  2A07 F;  2D1V A;  2OTJ I;  4M3D A;  4D5F A;  3MKZ A;  3MFK A;  2PQ8 A;  4HOB A;  1HBX G;  2E2H J;  4GDF A;  2R7O A;  3TKY A;  4P5O A;  1GDT A;  2HWV A;  3OL3 A;  3QPL A;  4YG2 F;  4G7O F;  1R71 A;  4EVI A;  4CIC A;  1YYV A;  2GQQ A;  3ZQ7 A;  3V4G A;  3SJM A;  1IN6 A;  2VKD A;  3K69 A;  3WE3 A;  2NVY J;  4R8H A;  1FT9 A;  4XR6 A;  1MBJ A;  2PBI A;  5L3B A;  2RC4 A;  1ZAO A;  5DM6 F;  4F7Z A;  3DEU A;  2M1B A;  3UNG C;  2VOP A;  1DPU A;  1BM9 A;  2DPU A;  2M0C A;  1HSJ A;  5BPI A;  1S9H A;  2EA4 A;  1W5S A;  2M4G A;  4AVP A;  1YX3 A;  4ETS A;  1HW5 A;  3ABU A;  2JPC A;  1BJZ A;  2DN0 A;  3I59 A;  2YX7 A;  2GZW A;  2QCO A;  5FKM A;  2YPR A;  1WJC A;  1OCC H;  1UJ8 A;  3S1M J;  3S2H J;  4JX5 A;  4FX0 A;  3CES A;  1SC7 A;  4NB5 A;  2QA4 I;  1FIA A;  2K9S A;  4QPQ A;  3K2A A;  2ETH A;  2H1K A;  4FET A;  2CUJ A;  3TDU C;  3E6D A;  1PUE E;  1P2F A;  2K40 A;  3M9A A;  5F04 A;  1OFC X;  3LA3 A;  4KN4 X;  1XPX A;  1EKE A;  4PK4 A;  4AIH A;  1CF7 A;  3AG1 H;  3DPT A;  2DOA A;  3JRI A;  2VQC A;  2EJR A;  3Q3S A;  3J7Z I;  1O7F A;  2X6O A;  1Z7L A;  2LRD A;  3PSF A;  5B66 C;  1CQT A;  3Q0W A;  1MDM A;  5IYD J;  1U2W A;  5DEQ A;  2VQH A;  1U5T C;  2O5R A;  3HPH A;  2BV6 A;  3Q9V A;  4P55 A;  5F64 A;  3E6C C;  1X3Z B;  3CLQ A;  1I3Q J;  1LJ9 A;  2V6E A;  1IRZ A;  2OAZ A;  4XM3 A;  1X4P A;  3HHG A;  3JRA A;  4WXD A;  3QYB A;  3CCE I;  5DTD A;  2DU9 A;  2PJR A;  3ZN0 A;  2CO5 A;  2JRM A;  5DV5 A;  2XKP A;  2M9H A;  4LLN A;  1XGS A;  4CYC A;  3FXQ A;  2ZJR F;  2W48 A;  4E4H A;  1YE9 A;  1K4S A;  3O3K A;  4KIS A;  2VPL A;  3HC7 A;  1B4A A;  2OPT A;  3JW4 A;  2E2J J;  1A04 A;  4CSW A;  5J6X A;  3V8L A;  2UWM A;  2PG4 A;  2M30 A;  4A3M J;  1HOM A;  1TL8 A;  2EK5 A;  4UY8 I;  3S1N J;  4AIK A;  3VWB A;  3HYI A;  3ZMZ A;  1WH5 A;  2OA4 A;  3GZN B;  5GPA A;  3ZQG A;  3RPQ A;  5GAE J;  1NK2 P;  2EIL H;  4BQA A;  4HSR A;  2L02 A;  4UUT A;  4ZYA A;  1GLN A;  1GUU A;  3MAJ A;  3MZ8 A;  5L3D A;  2FNA A;  4ZJZ A;  3IRR A;  1HW1 A;  2AQF A;  5JHU A;  2DOE A;  3JSP A;  1QQI A;  4I02 A;  1YJW I;  3DLL F;  1LEB A;  2DCE A;  4A3D J;  2R7V A;  3ML6 A;  1ONV A;  5D6E A;  4RB3 C;  4LIV A;  3ABT A;  1SAX A;  1BC8 C;  4A3J J;  3BR0 A;  5F0C A;  1HXD A;  2MAB A;  1F5T A;  5LLQ A;  1ZLK A;  3E7L A;  5E3L A;  3BDD A;  1BL0 A;  2LOO A;  4BDY A;  2E36 A;  2W00 A;  5CLS A;  4Y17 A;  4YEL A;  2CUE A;  3VDX A;  2LVS A;  3MWM A;  2XAS A;  3WOD F;  3P9C A;  5EZH A;  4UVB A;  3WTV C;  3K4C A;  3CUQ B;  3FWE A;  3CCL I;  4PZJ A;  5FLX Z;  3BTC A;  3VOD A;  1C0W A;  1FPQ A;  3P5J A;  2M8E A;  1Z3Y A;  4DNC A;  1ULY A;  1Q1H A;  5B1A H;  3PO2 J;  3BJ6 A;  2R5Z A;  2IA1 A;  3U1K A;  3VYS B;  4D0P A;  3L09 A;  2X6X A;  1FEX A;  2DOF A;  4EM0 B;  3F8B A;  3HSF A;  4BJ6 C;  4RGS A;  1KQ9 A;  2IGM A;  1XB4 A;  3IRQ A;  5FLV A;  5KCM A;  1FP2 A;  4L9V A;  5HS8 A;  2WB1 N;  2Y75 A;  1GXP A;  4RAY A;  4HBL A;  1I5Z A;  3HG9 A;  3I0T A;  5DCM A;  2H94 A;  4NNJ A;  2GLO A;  4XID A;  1BR4 A;  4XBF A;  1K6O A;  2B63 J;  1Y0N A;  1ON2 A;  5TGT A;  3B6A A;  2F5V A;  3V42 A;  4ZYG A;  2VKH A;  5HLT A;  4GGG A;  1NTC A;  3VYU B;  1RPW A;  3OYJ A;  5AIQ A;  2L01 A;  5AON A;  3LMM A;  3RKY A;  3I58 A;  3LQQ A;  3JR9 A;  2E1C A;  1HKS A;  1KU7 A;  1YRN B;  2VE9 A;  5IP7 J;  3NAU A;  1J7K A;  4CZC A;  2A3S A;  1WWX A;  2HDC A;  1HKQ A;  2CMP A;  2X85 A;  4M71 A;  2FOK A;  9ANT A;  1YX5 A;  3LA2 A;  3WTY C;  3M8F A;  2BVM A;  2AO9 A;  3GLX A;  3HUG B;  1TWG J;  4RAF A;  3EPZ A;  4X1E A;  1UHM A;  2FJ1 A;  5JHF A;  4F91 B;  4XLP F;  3LSR A;  4XRF A;  4B44 A;  1QHH D;  2BW3 B;  5ICE A;  3H36 A;  3IH4 A;  4M6X A;  1Z6R A;  2MLK A;  3M7G A;  2V1D A;  3BP8 A;  1MKM A;  3OYA A;  2JSP A;  1POG A;  1B9N A;  3MKY B;  3J81 K;  5IP6 A;  2FQ3 A;  1R1V A;  4U87 A;  2CQX A;  1M1E B;  1IN5 A;  2L54 A;  4RB2 C;  4EM2 A;  4PDK A;  3RZD J;  2DAO A;  5EGO B;  1O3R A;  3CC2 I;  4BXF A;  3EUK L;  1A36 A;  2ISY A;  2KDZ A;  1U8R A;  3IHU A;  2LBF B;  1JKP C;  5BOX A;  3EQL F;  1Z7U A;  2PMH A;  2WBM A;  3Q0U A;  3OYL A;  4KMU X;  2G0E A;  1IV6 A;  3MQ0 A;  1K61 A;  3RQ4 A;  1P7J A;  2KL4 A;  3J7A Y;  4B8X A;  1JUP A;  3LSP A;  2ZME B;  3ZQI A;  3S17 J;  2WAE A;  3ABK H;  2ZXH A;  2XRL A;  1JT6 A;  2W57 A;  1UZC A;  4RS8 A;  3LNQ A;  5LEK A;  1LVA A;  2LF8 A;  1S5L C;  2O9L A;  4Z2Y A;  4KNY A;  5FD5 A;  1L0O C;  3K1P A;  2K27 A;  4G9Y A;  1GV5 A;  1JE8 A;  1MNM C;  4NHJ A;  2HFH A;  1U9O A;  2GIV A;  2ZC2 A;  3DKY A;  3LOC A;  3UR3 C;  2G7H A;  4RGU A;  3HRS A;  3CP8 A;  1D8J A;  3SFI A;  1W4M A;  5E3M A;  2XC7 A;  3FK7 A;  3GTL J;  4OIQ F;  4XOR A;  1RZ4 A;  3F8F A;  2DT6 A;  3VOE A;  4XRS A;  3UKG A;  2VUM J;  1FMV A;  1SMY F;  2XAH A;  5BQT A;  2E60 A;  1UAA A;  5HDG A;  3FIW A;  5ILS A;  1W36 D;  4RLF A;  1FTZ A;  3TP3 A;  4O5V A;  1E3O C;  3U2R A;  3A2K A;  1YJN I;  3BG5 A;  4I2O A;  3RKX A;  2P7V B;  1RNL A;  3CJR B;  1GHC A;  3MZH A;  2XPW A;  1TQM A;  2I5U A;  3CJT B;  4PSW A;  1KA8 A;  3DQV C;  3FBI B;  3LA7 A;  1B59 A;  2ID3 A;  3GTQ J;  3S8P A;  2DA6 A;  4UVC A;  2IVM A;  2VAS A;  3SDB A;  4IX7 A;  2XAJ A;  4BQO A;  3EDP A;  2Y0S A;  2D2W A;  3E6B A;  1OKR A;  4O6J A;  5H6Q A;  3GYH X;  1HW2 A;  2RGV A;  2HQN A;  3OMY A;  1S7A A;  2XF5 A;  4Q4Z F;  5GTI C;  1U78 A;  5CQE A;  1E3H A;  2CG4 A;  3OS2 A;  3OSG A;  3K4B A;  3G4S I;  2HYJ A;  1YFH A;  2ICW G;  2L3D A;  1FBQ A;  1I1G A;  4BL0 B;  1SMT A;  1JTY A;  3F72 A;  4ZYD A;  4E7I A;  1XCV A;  4FTH A;  2K9N A;  2VBW A;  1VQP I;  1IDY A;  1HST A;  2OD5 A;  3R0J A;  3M8J A;  4R79 A;  5D4S A;  2CUZ A;  2E7X A;  2BY1 A;  2DT7 B;  3SXY A;  1OCP A;  2JPB A;  2DQL A;  1R5H A;  2KZG A;  3AAF A;  3KP5 A;  4Y15 A;  1FSH A;  1QRY A;  5K7Z A;  3MKW B;  5CVI A;  2CW8 A;  3ZOB A;  2O3F A;  4KT6 A;  3S3N A;  3DEE A;  1FTT A;  1I50 J;  4XLF A;  4NBQ A;  3CC7 I;  4OMY A;  2Q8K A;  5LGT A;  5CVJ A;  5DCF A;  3CCM I;  2A6T A;  3RSN A;  1MGT A;  1LUJ B;  1P9Q C;  2MFZ A;  1ZR2 A;  1VZ0 A;  3AG3 H;  3L2V A; 
#chains in the Genus database with same CATH homology
 1Z67 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...