9ANTA

Antennapedia homeodomain-dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*AP*GP*AP*AP*AP*GP*CP*CP*AP*TP*TP*AP*GP*AP*G)-3')
publication title Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex.
pubmed rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 9antA00
1IDYA 1XS9A 2XSDC 1OFCX 3JREA 3CMYA 2Y30A 3TEDA 5EG0A 2YS9A 2HOSA 1UMQA 1JJ8C 2XRLA 4A69C 4A3FJ 2NS8A 3FIWA 4CYCA 1IJWC 4W97A 2M2EA 2JA7J 4V2GA 4XRMA 3HGYA 2Y9YA 2LKXA 5EZHA 2Y0SN 3OSFA 1A6IA 1LFBA 2DMUA 1Q1VA 4JX6A 1VF9A 1X2MA 1WGXA 2DTZA 2WAQN 5EG0B 3OOUA 5E3MA 1OCTC 2COBA 4CYCB 4RBOA 1IC8A 1U9OA 3S1RJ 5FKKA 1K83J 2XGEA 5F0HA 2MGQA 3BQZA 1BA5A 2L9RA 5M5YJ 1FIAA 3BG9A 3S15J 1X2NA 3CDLA 4BXXJ 2FQ4A 5M3MJ 2E1OA 1T56A 2E19A 2R93J 1Z77A 2EBIA 3PM1A 1W0UA 2LTPA 3JRFA 2M8GX 2DA5A 3TP3A 4EEFG 1RKTA 5JLWA 4IEJA 2IEKA 1ETKA 4V2FA 1NTCA 3A02A 1JUPA 2XB5A 5FKNA 1APLC 3A03A 5F04A 2NVTJ 1K61A 3FISA 5IP6A 3WHBA 1WPKA 2MSYA 3O8HA 2EH3A 4M3FA 3WHCA 3S14J 1MBHA 5JLXA 2R0QC 2X9DA 3ZQIA 1LE8A 3CQZJ 1ZQ3P 5K7ZA 4AUXA 4UUSB 1EF4A 3LNQA 2L7MP 1GV5A 4W1UA 4I76A 4DW6A 5E3NA 3PO3J 3BR1A 1TWGJ 5C44J 5J3LA 1WI3A 3JRIA 2K40A 3S1NJ 1GDTA 4FCYA 1QRYA 2M34A 5FLVA 1LE8B 1NK2P 1JUMA 4XK4A 1ETQA 1ETXA 3LSRA 1TWAJ 1D5YA 3BR6A 2Y2ZA 2HOTA 2K9QA 2ME6A 1TWHJ 1Y1VJ 4FTHA 4IHYA 1FTZA 1JUSA 1ETVA 3S1MJ 1DU6A 3E7LA 5M5WJ 2WV1A 3HM5A 3M3YJ 4A3MJ 2AHQA 4G12A 3BQYA 4JYKA 3S1QJ 3B6CA 2GLOA 1ZR4A 1RPWA 2VKVA 2E2IJ 4C3HJ 3S2HJ 3BTIA 1SFOJ 1JTXA 1RESA 3B6AA 3JRHA 3SJMA 1GUUA 2FJ1A 1Z0XA 1MH3A 3IH3A 1JT6A 2R5ZA 3QPLA 1ETOA 5FKMA 1RETA 5BNGA 4DYRA 2R5YA 3RZOJ 5IYDJ 3ZOBA 3JR9A 5J1UA 1HF0A 2JWTA 3O8GA 4A3CJ 1QPIA 3L1PA 2E2JJ 2ELKA 3Q0WA 1ZGWA 1T33A 1GVDA 4AC0A 3JRDA 4MFEA 1B72A 4UUTA 2JJ7A 2R5ZB 2IBDA 2ID6A 3K2AA 2X48A 3BR0A 2I10A 2R5YB 2DMPA 1GT0C 4IHWA 2OF7A 2CUEA 2DMQA 2XGDA 3BT9A 1JGGA 1AHDP 1ORKA 5M5XJ 1B72B 5FKLA 2NVQJ 3H3VK 1HDDC 2P81A 5EGOB 2VKEA 5C3EJ 3BTCA 5F1JA 3UKGA 2NVXJ 2TCTA 5HODA 2D5VA 3S16J 3FK6A 4A3GJ 2LK2A 2MW8A 4X6AJ 1X58A 3ZQFA 5DS9A 3IH2A 1BW6A 1MSEC 2LFBA 2XPUA 2JA6J 1VI0A 2LLKA 3LSPA 2ME0A 3BG3A 4BY1J 1P7JA 5C4JJ 2DA3A 2B63J 2CJJA 2X6OA 5FLMJ 5GP9A 4UUSA 1HCRA 1NK3P 3G1MA 3OIOA 2JN6A 1OJLA 1OCPA 2XB0X 4MLOA 4XRSA 1AKHA 2NVYJ 4M3BA 4DZJA 1XG1A 3QPSA 2QF7A 1JKRC 1UG2A 2E2HJ 4M3EA 4DYQA 4A3IJ 2N8GA 4Y52J 4BY7J 1AKHB 1JKQC 2PMZN 2L7FP 2G0EA 2DMTA 2XPWA 5GPAA 1TWCJ 3PO2J 1HLVA 2JA8J 4QIWN 3RZDJ 2K9NA 1MBKA 2WB1N 3H0GJ 4C3IJ 5E3OA 2LR8A 1G2HA 2L7ZA 4I6ZA 2FX0A 1MSFC 3HEFA 1O4XA 5IOYA 2M0CA 2ID3A 1IV6A 2Y31A 2O7OA 4DZPA 4JX5A 1BJZA 4A3JJ 2O9LA 2HI3A 4MIMA 5IOZA 2VPRA 3ZQLA 5IYCJ 5F08A 4A3EJ 1BW5A 1SANA 4BBSJ 3Q0UA 3GTKJ 1I3QJ 1I50J 1H8AC 1FIPA 5EYRA 3FK7A 2QCOA 1DU0A 2DN0A 4A3BJ 1UHSA 5K7FA 2DMNA 2XGCA 1ZR2A 2ECBA 5EF6A 5DTDA 2CQQA 2HOAA 3MVPA 4A3LJ 2L0KA 4GFBA 4DYCA 3GTMJ 3BR3A 2EZHA 1I6HJ 4ABZA 1FJLA 5GPCA 2O8KA 3JRBA 1MBJA 3HDDA 3Q3SA 5FKOA 4MFDA 2HXOA 1R9TJ 3HOZJ 4M6VA 2Y9ZA 3DEWA 2XPVA 1JT0A 3VPRA 1E3OC 2HXIA 1W0TA 2W48A 3GTLJ 2AO9A 9ANTA 2HYJA 4IHVA 1IUFA 2DJNA 5EDNA 3GBGA 3HBLA 3HKZN 5EGOA 1WCMJ 3FKIJ 2CQXA 1S7EA 4X1EA 3A01A 2VI6A 4MO7A 3RQIA 4AYBN 1AU7A 2EZKA 2LY9A 1RKWA 3TW6A 1IDZA 1VFCA 4XICA 1RR7A 3GTGJ 1MBFA 4L5EA 4XIDA 3F0CA 2LD5A 2FD5A 4J19A 1IRZA 5IP9J 3HOVJ 2H1KA 1WH5A 4JX4A 3BR2A 3A01B 4Y7NJ 2KT0A 2LVSA 3DCFA 5E3LA 4B4CA 1YRNB 5C4XJ 3GTJJ 4HNVA 1POGA 4BKXA 2DA6A 2ZB9A 1U8BA 5F27A 1IGNA 3IH4A 1H89C 3NARA 1ZK8A 1TC3C 1FTTA 1JKPC 5IYBJ 3G1LA 3G1OA 2M9HA 4RDUA 2IAIA 1HOMA 4A93J 2CU7A 3GTOJ 2ECCA 5IPAA 2R92J 2DA2A 2YUSA 5J1YA 2MG4A 3HOYJ 3M4OJ 1JKOC 4FISA 2JMWA 1A5JA 3K7AJ 3W6VA 1P7IA 3BR5A 5IP7J 2NS7A 3LOCA 3TP0A 3SDGA 4C3JJ 1IG7A 2GBYA 2CUFA 5F0CA 1ZTRA 5J1RA 3S2DJ 1ENHA 2OPTA 2R7ZJ 3JRCA 4M3DA 2HDDA 1MH4A 3HB9A 3CCYA 2NOGA 3GTQJ 4D7NA 2JK3A 3Q0VA 4D5FA 5EEAA 2KDZA 1MBEA 1U9NA 1ZKGA 3D1NI 3GTPJ 3QQAA 3TW7A 4LOCA 5F0FA 4S0HB 1B8IA 1ETYA 3LSGA 1HDPA 2YU9J 1FEXA 3ZQCA 3BG5A 1MBGA 5EZGA 1XC5A 3HOXJ 4NDLA 2H8RA 1WH7A 1MNMC 4QTRA 1LFUP 1VNDA 1JTYA 5K7HA 2LP0A 1GV2A 5FJ8J 4A3KJ 4B3AA 3HOUJ 3I4MJ 1B8IB 2DA1A 2EZLA 1QVTA 2HQ5A 1PUFA 3OSGA 3JRAA 3BTJA 3SFIA 4JP0A 4D5CA 1ITYA 1F36A 2VUMJ 3I4NJ 1QVUA 3IV5A 3RKQA 1ETWA 2CRGA 4C2MJ 1F43A 2GM4A 3NAUA 4D7MA 2EQRA 3MN2A 3ZQGA 1PUFB 3LSJA 3MKLA 1U78A 3JRGA 1CQTA 4QSHA 4IHXA 2RAEA 3ZQHA 4XRSG 3HOWJ 3HGGA 4B1RA 3S17J 2DA7A 2EZIA 3BTLA 3C2BA 1BL0A 1TWFJ 2TRTA 2DA4A 1JJ6C 2JA5J 1YRNA 5M3FJ 4A3DJ 4M3GA 1H88C 4FE7A 4BBRJ 1Y1WJ 2K9SA 4FE4A
chains in the Genus database with same CATH superfamily
2PX9A 3E6BA 2JZYA 4G9YA 3CMYA 5L3FA 1F1ZA 2BY0A 1JGSA 3TEDA 2A68F 1J5YA 4BEHA 2HOSA 1YS7A 2LF8A 3HUGB 2NS8A 4CYCA 3IKTA 1IJWC 3PUFA 4EJWA 1Y39A 5LEKA 4XRMA 3HGYA 4Y3OA 4I7HA 3H9QA 1PP8F 2BOLA 5DYMA 2DMUA 3WGIA 2BBYA 2EFWA 4ZYDA 1X2MA 4WXHA 1R5HA 2Q2EA 1SMTA 4PSWA 2VONA 2DAOA 3C2HA 3ISPA 1ODDA 1B1BA 3L09A 4AM3A 4ZDOA 3KX2A 4PJMA 2GIVA 1SFUA 3PNVA 3S1RJ 1FC3A 5GADJ 2MGQA 4G6TB 5HNFA 2FNAA 3GCMA 2KPMA 1FOWA 2E7XA 2DYSH 2XAQA 4E7IA 2NAZA 1PDNC 3BG9A 4G7HF 2UZKA 3S15J 2E35A 1X2NA 1T0FC 4PCQA 2PI0A 2FQ4A 3ZXSA 4ZYGA 2RVCA 3ESWB 4CCKA 1G3YA 1EJ9A 4L9NA 1Z77A 4RGUA 3DU6A 2IT0A 4MNUA 1A6QA 3GFJA 2X6XA 5FROA 3B73A 3DPTA 2DPUA 2HR3A 3JRFA 2Z9OA 1X1BA 2D45A 3MZYA 4NHJA 2EJRA 1JHFA 2YSRA 1Y0NA 5HLTA 3W6JB 1U3EM 3O2PE 4P9UA 5JR3A 1I27A 1APLC 4BQQA 3A03A 3K1MA 1K61A 3WHBA 1QPMA 2MSYA 4OU0A 3S14J 1SC7A 1FLIA 1LDJA 3K4LA 3CF5F 3ZQIA 3SZPA 4A0YA 5K7ZA 1S29A 4BHPA 2L7MP 4ZZDA 3LWFA 4I76A 3PL8A 4MEXF 4M9XA 3K70D 1XMAA 1N75A 5IT9K 2QKMB 1TWGJ 2EFOA 2VJ5A 3KP2A 4ETSA 1SD5A 3MCZA 1WI3A 1IN7A 3S1NJ 3OS0A 2XKOA 3NEUA 1L3LA 5H6RA 4JK1X 2HU9A 2DO7A 5FFZA 5TISC 5HNHA 4XNFA 1D8JA 4HAMA 2HDCA 1NK2P 1ETQA 1ETXA 2OD5A 4DGWB 3OYNA 3DLLF 2X1EA 2XASA 1D5YA 5FRMA 2K9QA 2Q8KA 3QYFA 2ME6A 1W4MA 4LK1F 1XCVA 3KZYA 2R3SA 5L3BA 1J2XA 1ETVA 1FNNA 3HRSA 3OYAA 4CCMA 4JOMA 3HG9A 2F2EA 1DU6A 2P8TA 3L2VA 3HM5A 3P7NA 4G6DA 3L00A 3M3YJ 4QPQA 3T1BA 4LLLA 1WJAA 3RIRA 3TO9A 1T39A 3S1QJ 4B8XA 2UWMA 4EGYA 1OQYA 3D5SC 3KE2A 5DUKA 1F4KA 3FZVA 3ABLH 2WB1A 3OL4A 3S2HJ 3IL2A 1UG0A 3JRHA 2HKOA 3REOA 3T8TA 4BHBA 1GUUA 4CZZA 5DCFA 2CW0F 3FWEA 3G6EI 3L2WA 4LJZF 5IYDJ 1K6YA 1OYWA 2L9VA 2P5KA 3JR9A 1HF0A 2JWTA 2O03A 3O8GA 4OAZA 2EPFA 3L1PA 2ELKA 3MQ0A 2AS5F 3Q0WA 2GA2A 1IN6A 5KHDA 1ONVA 3ABUA 3S8PA 1SVMA 2MYSA 3EPZA 3HXLA 3KEYA 3BCBA 1VQ9I 5E1WA 2X6WA 2KKOA 3TKYA 2J5OA 4XLPF 1SFKA 2FEZA 3EUHA 2XGDA 3FBIB 4RAGA 4S04A 2R7UA 2ZJQF 1AHDP 3KP4A 3FXLA 2Z33A 2HFHA 2ZSHB 1VQPI 1HBXG 1I1GA 5GAHJ 2IP2A 3D5LA 5D8KB 5EGOB 3MZ8A 1FPQA 1HKQA 1X1DA 2KRCA 5C3EJ 3UKGA 1FBQA 1WJBA 1UHWA 2EIKH 3LMMA 5JHUA 4K2EA 2D5VA 1IRGA 3S16J 4AYBA 2EIJH 1IUYA 2KHMA 1NH3A 1BR4A 3S32A 2XAFA 4ZYAA 2K27A 1WJCA 3KEQA 3OYMA 3ELKA 2BVMA 2AQFA 1Y8RB 2ME0A 2PJPA 3QPHA 2DCEA 5TJJA 1SVOA 1V54H 2CG4A 3CF2A 3OY9A 1KYZA 2B63J 2CJJA 4LGWA 4LIUA 1MJ9A 4XSXF 4G8XA 5GP9A 2WV0A 1R5GA 2HYFA 2XB0X 2JPCA 3AG3H 4MLOA 3IC7A 1JHHA 4M72A 2NVYJ 1G4DA 4I99C 1JKRC 4U0WA 4BUPA 2PMHA 4AIKA 3R0JA 4BDZA 5D8LB 2KRHA 1GLNA 1G6NA 3EUAA 3H36A 4KT6A 4PJ0C 3NWTA 1CF7B 4M6YA 2XPWA 4EQQA 1HLVA 2JA8J 4XKBA 2ICWG 1SD4A 2E60A 2K9NA 4I0BA 1MBKA 2PMUA 3H35A 3ZMDA 5LGUA 2LR8A 2HWVA 1G2HA 3G71I 3H1CA 2CW8A 3J81K 5FRNA 2LKSA 5FFXA 3HRMA 3KFWX 3QOPA 1BJZA 2WTEA 4XKCA 2GWRA 5IOZA 1XSDA 2VPRA 2ZNYA 4L5IA 5F08A 1VTNC 3I71A 1UELB 3L7WA 3DLAA 3WG9A 1W7PD 3ZPLA 5D5WB 1X1AA 1XGSA 1I50J 2QCOA 5E8IA 1WWXA 2DMNA 3F8MA 1T38A 2ECBA 3V8LA 2HOAA 2EZHA 1I6HJ 2RV8A 4ABZA 1FJLA 1NG7A 3ZR8X 4DBRA 1VQKI 2JSPA 4XLHA 3TO6A 2O8KA 3I3LA 3GXOA 2HTJA 2XIGA 1YFHA 4YIIA 1BIBA 2Z1DA 2HXOA 2IA0A 2FE3A 2H09A 2CV0A 1O57A 2EV0A 3DEWA 3RYPA 5D4SA 1JT0A 1VQ7I 4RA2A 2X85A 2UXNA 3GTLJ 1JXSA 1IAWA 3GBGA 3RKYA 4X0GA 3F23A 1TW3A 4GCVA 5EGOA 1WCMJ 2W85A 1NHAA 2ZKZA 4HV5A 1QBJA 4MO7A 1YG2A 3DV8A 1KU3A 2XHKA 4A6EA 3J7AO 1Z6RA 3OYEA 4XN0A 3P9IA 1W36D 4UB8C 4L5EA 1ZG3A 2UUZA 2Z99A 1IRZA 1XMKA 2D1HA 2K7LA 2BVLA 3A2KA 3H92A 4II3A 2BEOA 2F48A 5CVIA 2IJLA 2VOOA 4B4CA 4ESJA 3TL4X 1YRNB 1IN4A 3CESA 1O7LA 4HNVA 3IAS2 3KZIC 3LA2A 2D1VA 4P55A 4TV7A 4HBLA 2V6CA 4BDYA 1IGNA 1ZELA 1YS6A 1R1UA 4EM0B 3NARA 3R6SA 5IYBJ 3G1LA 3CCJI 2M9HA 5A2QZ 2FNPA 3OS1A 3G4SI 1HOMA 2DK8A 3GTOJ 1GXQA 2R92J 1WHUA 3I59B 3LA3A 4U88A 1KYWA 2IGOA 1K78B 1T6SA 2RNJA 5J1YA 2EFPA 2DQLA 2MG4A 1HKTA 2IS2A 5HVQC 3MD2A 3HHGA 2P7CB 5ILSA 1A04A 4LFUA 2VC0A 4PDKA 2MFZA 3LOCA 3HPHA 3ZRGA 4ENJA 1UAAA 2ELJA 2KIQA 2CFOA 2GBYA 3IAM2 2CUFA 1KU7A 5F0CA 5J1RA 1IF1A 2LOOA 4M73A 5J47A 2ZO4A 2ZJ2A 3CUOA 2OJED 2R7ZJ 2JVGA 3JRCA 4M3DA 1VQ8I 1FSEA 1FBSA 3HB9A 2XF6A 4L0YB 2GOXB 2NOGA 4E4HA 3Q0VA 3QPTA 1H0MA 2V1UA 4KYWA 1YX3A 2KDZA 1ON1A 4PZJA 5K5OA 1H9TA 2OCCH 1EV7A 1FMWA 3GTPJ 1U5TB 2CQ7A 3K4NA 1BOBA 1TZLA 4LOCA 4XLFA 3SXYA 4OIQF 3KLNA 1YHQI 1DGWY 2YU9J 1XMXA 1OR7A 4Q47A 5LRSA 2QBYB 3OR2C 3ZQCA 3HOXJ 4P5OA 3BZCA 4RAZA 1MNMC 2PG4A 1OPCA 4BU2A 2F4IA 2A61A 5K7HA 2LP0A 1IN5A 1GV2A 1OMIA 5FJ8J 1FOKA 3COAC 5E1XA 2VIXA 4XBFA 2EZLA 4I09A 2HQ5A 4YEJA 4Z2YA 4DIQA 5HDNA 3ZMUA 1ITYA 2GAUA 1VQOI 3IV5A 3FM5A 3RKQA 1ETWA 2CRGA 3K10A 4KT5C 1PJRA 5J6XA 4HQEA 1TLHB 3V7CA 3NAUA 4D7MA 3WGGA 2W57A 3HYIA 1IZ1A 2PQ8A 2VJJA 3ZQGA 1PUFB 3LA7A 3MKLA 1U78A 1CQTA 3OS2A 4LK0F 4ANJA 2RAEA 3BJAA 1BOAA 2BGCA 4QLCU 3HGGA 2ZXIA 2WWYA 4FQGA 2DI3A 1YJ9I 3R0AA 2VOPA 1BL0A 5D5VB 1TWFJ 3K0LA 3HJEA 2ZJPF 1YRNA 4FETA 2KIMA 2PBIA 3F8FA 4FE7A 1TP4A 2HQRA 1R1TA 4HDUA 2JMWA 4FE4A 1OYYA 4RM2A 4A2UA 4AVZA 1BJAA 2F5EA 4KFCA 1YIOA 2M30A 2XDVA 3JREA 1OCZH 3M8FA 2KJBA 1WKMA 2VT2A 4Q48A 2YS9A 1P4AA 1UMQA 3C2GA 1SAUA 2CQNA 3I59A 3WU0A 4OIPF 1E17A 3W2WA 2M2EA 1K78A 4V19K 2JA7J 4V2GA 1SAXA 2HYGD 4GXOA 5EZHA 2Y0SN 3GYHX 3V7SA 3NQOA 2EILH 1VF9A 4C2UA 1S9HA 2ZXHA 4CCOA 3OR1C 4Y13A 1MMNA 2WAQN 2R7RA 1HW5A 4PSXA 1D3YA 5ICCA 4BEHB 1G3WA 3OOUA 2COBA 2E71A 4CYCB 3K6GA 3CCUI 4EJTA 2A69F 4RM3A 3SEQA 1K7AA 2VT3A 1U9OA 5FKKA 2XV4S 3DQVC 1K83J 2XGEA 3U21A 5ILVA 1ZRDA 3HHHA 3LFKA 4NUBA 3CO7C 2G7UA 4KDPA 2Q2EB 4EM1A 4MQVA 5M5YJ 3C3WA 1EKEA 2E1OA 2X4HA 1DGRM 3L2CA 2XKPA 2R93J 1YQAA 2STTA 2VODA 2V6EA 1ZGJA 3K2ZA 3RDIA 1W0UA 4HF1A 2LTPA 2MD0A 3RI4A 2M8GX 1D1CA 3TP3A 3FX3A 1RKTA 4EEFG 1KQ8A 5JLWA 2Z2SB 5IT3A 2DFHA 3A02A 3DFGA 2JUCA 5F04A 2NVTJ 2LREA 4LMYA 3SZTA 3T0YA 5BPDA 5DCMA 2HQNA 2EH3A 4M3FA 5GAGJ 3AL0C 5E8GA 3VODA 2KP6A 4IO9F 1LE8A 2MBFA 3CJTB 2R7TA 3V4GA 3LNQA 1GV5A 1V5GA 2DFFA 3BG7A 2CS3A 2W82A 4DW6A 2NNNA 2V1DA 1V55H 3CUQA 2KDOA 2M3AA 2F6CA 5H2FC 1SD6A 5JI6A 1P92A 2V4JC 1UCRA 1GDTA 4FCYA 2CUJA 3ERED 1DP3A 2M34A 3KP3A 4ZTJA 3CCVI 5JVTA 3FM3A 3AAFA 3DF8A 3LSRA 1TWAJ 3WTVC 1H9GA 5DUIA 2QA4I 1TWHJ 4H4KC 4FTHA 1FMVA 3KZZA 2L2OA 1OYIA 1Z3XA 2QWWA 5F6FA 3CO6C 5M5WJ 3HSFA 1QZYA 3VYRB 3AG1H 3MWMA 4FASD 4A3MJ 2AHQA 2STWA 2HOEA 2F4MB 3BQYA 4YFXF 2GLOA 1ZR4A 2QM3A 1ZARA 1USTA 1SFOJ 1XSVA 2ZXJA 3ZMTA 3S3OA 4KISA 1LEAA 1MH3A 4M9ZA 1HKSA 3KP6A 2R5ZA 4BE1A 2CV2A 1YTYA 1D0ZA 1ETOA 3CC7I 4XKWA 4FT8A 2R5YA 5LGTA 3IWFA 3BZKA 4RB3C 5J1UA 5AIPA 2RNGA 3E5QA 3RPQA 3IRQA 2DFEA 2QQ9A 2E2JJ 3H0DA 4OMYA 4A0ZA 1ZGWA 2VKHA 2V7FA 2K02A 4MFEA 1B72A 2JJ7A 1RRJA 2ID6A 2V9VA 1R7JA 2X51A 3K2AA 4OIRF 3DEEA 2DMPA 3IHUA 2CH0A 2HPIA 3RTRA 2OF7A 4IRGA 4B3XA 1ORKA 4XL9A 5M5XJ 1TT5B 3LL7A 5CVVA 5FKLA 4WCGA 2NVQJ 4OWRB 2ZMEA 3KETA 2VKEA 1BI2A 2W1OA 1WZ2A 2NVXJ 2OTJI 2E5NA 1F9NA 4BS9A 5GAEJ 3HKZA 3PUBA 2TCTA 1WJEA 2PEXA 3SDBA 4EJVA 1OKRA 4UNOA 5FO5A 4G7ZF 1VQ4I 3I58A 4F92B 4X6AJ 3ASOH 1AOYA 2NYXA 3ZQFA 1XN7A 3CCMI 5DS9A 5GTIC 1MSEC 3W6KB 1B59A 1Z6TA 2NNYA 3CDIA 3E5XA 3LSPA 3CJNA 4HV6A 2DPDA 3OYDA 3FF5A 1S8NA 5IT9Z 4GYIA 3ZMSA 1K4TA 4ZDPA 1QU3A 1HCRA 3OYJA 3TQNA 2W24A 4G6QA 1BM9A 1SEUA 2JN6A 4IKFA 2O0YA 1OJLA 4XRSA 1FP1D 1FT9A 1AKHA 2H27A 4Y4RA 4ITVA 4M3BA 1XG1A 1VQLI 3VSLA 4WX9A 1UG2A 4IX7A 2E2HJ 3EDPA 2V1NA 2RKHA 2DFIA 3BY6A 1W7PB 4AIHA 2MC4A 4HSRA 4Y52J 3ABKH 5JVGF 2L02A 4ESBA 1ERDA 4HG2A 4XLCA 2L7FP 2G0EA 2VE8A 3FMSA 2L5QA 2IGMA 1J0RA 4QIWN 1VQ5I 4PUSA 2VE9A 2WB1N 4MTDA 3PSIA 3GF2A 3VDXA 4CXFA 4IOCF 4I6ZA 2OV7A 1MSFC 1UJ8A 2M0CA 1IV6A 2IGNA 1O3RA 2Y31A 3IKVA 4HNTA 2ETHA 1X1CA 4ZDLA 2HPMA 4A3JJ 3I53A 3DEUA 2HI3A 4MIMA 1J75A 3ZQLA 5IYCJ 1FOYA 4UB6C 1BW5A 3P9KA 2QQAA 3GTKJ 3TBIA 1X1PA 2YPRA 1S7AA 1FIPA 2DDAA 1DPUA 2DN0A 4HA8A 1LB2A 4A3BJ 2XGCA 3OYLA 1ZR2A 1MNDA 5D6FA 1LEBA 4UVAA 2IW5A 3O6BB 4B43A 3MVPA 3HOSA 1FY7A 5GPCA 2CGPA 2MH9A 3JRBA 1IXRC 2OBPA 1R9TJ 4IRIA 2W4SA 4JQFA 2L3DA 2XPVA 3WTYC 4IZZA 1MGTA 1E3OC 1W0TA 2V9PA 4CYDA 2P4WA 2OU2A 1WI9A 3CMEI 4IHVA 2V9KA 5EDNA 2XROA 2RQPA 3BJ6A 2CQXA 3M9AA 1QA6A 3N4MA 1QNTA 3A01A 2VI6A 3RQIA 3T8RA 4AYBN 1DUXC 1E0EA 1AU7A 1YITI 2EZKA 2LY9A 2DODA 4IPAA 1IDZA 1RZ4A 5L3DA 3E0JB 3WTTC 3U1KA 3K9TA 3BJOA 4XIDA 2LDUA 2FD5A 3VEPA 4HF2A 1XTAA 2E36A 3M8EA 2FOWA 4JX4A 5TRDA 2KL4A 2KT0A 2LVSA 2M4GA 2IXSA 5E3LA 3OYCA 5LHHA 5C4XJ 2ZBKA 1POGA 4HX4A 4UV9A 3TMOA 5FD5A 3T5XA 3IH4A 2IA2A 1V5FA 2R7VA 1FTTA 2ISYA 1UB9A 4M71A 4MEYF 1JKPC 2HKXA 5HLGA 2G9WA 2IRFG 4OAYA 2ECCA 1TNTA 2B0LA 3FMQA 5K5RA 2DA2A 3K69A 5HS8A 3A0HC 3M4OJ 1XDSA 5D6EA 2DU9A 4FISA 4HOBA 4EMSA 3Q9SA 1W7PA 3UR3C 2VXDA 2JRTA 2VB6A 3H5AA 3MKWB 2ESHA 1BR2A 3JTHA 3MAJA 3BLYA 4GO1A 3OYIA 1ZTRA 1N78A 3S2DJ 1SMYF 1VZ0A 3J81Z 4L9VA 2XSJC 3JSPA 2XVCA 3A0BC 3LAJA 1P9QC 4CH7A 2A05A 1MDMA 4A6DA 1T0FA 5HDGA 2VC1A 3V7RA 3CCYA 5L3CA 1Y6IA 1S3JA 3MFKA 2JK3A 1KU9A 2ELHA 4M6XA 2A6HF 1B9NA 3VSKA 3H5RA 3Q5FA 2C6YA 1MBEA 1HA8A 3OIPA 1ZKGA 3GLXA 1RR8C 3TW7A 1LDKB 3QU3A 5FD6A 1G3TA 1B8IA 3V8JA 1ETYA 1T08B 1HDPA 2B9SA 3SYTA 2FUG2 3OYKA 4N9IA 2AXLA 2F5DA 5DDGA 4CSWA 3CCQI 1HW2A 1P6RA 3BG5A 5EZGA 3CCRI 4DOZA 4UHTA 2P5LC 4QTRA 3F3XA 2CO5A 4WK8F 1JTYA 5BS6A 3HOTA 3I56I 1KU2A 2BXZA 5B3SH 4A3KJ 4B3AA 1VQMI 2CV1A 3I4MJ 4LLNA 2V26A 2CSOA 2DJIA 3OSGA 2R7SA 3BTJA 1Z7LA 2GA1A 3A1YA 4JP0A 2BE5F 1LQ1A 3M1EA 2VUMJ 1TNSA 6PAXA 4F91B 3F6VA 4E7ZA 3KIOA 3E1SA 4RLQA 2LNBA 2ADUA 3PQKA 2WADA 4Y15A 4EATA 3CP2A 2W25A 4F55A 1E3PA 4KIFA 4C30A 4B1RA 4XQFA 3S17J 3JCUC 2DA7A 3DPLC 3OYGA 3C2BA 2VQHA 1T8IA 4XLEA 2DA4A 2WC2A 3I4PA 3VYSB 1JJ6C 2OC6A 2JA5J 2XC7A 3R4KA 2XAJA 1H88C 4C2TA 4XSZF 1RI7A 3DKWA 4I01A 2K9LA 5BNGA 1IDYA 1MNEA 1XS9A 2FSWA 3HIFA 4JBAA 1TQPA 3LSTA 1ULYA 1OFCX 3RPUA 2VN2A 4KN7X 1G59A 4RS8A 5KAFC 1PUEE 5EG0A 3GVAA 3M8JA 2XRLA 4A69C 1W5CC 4KA4A 2F5VA 3K4KA 1D8KA 3KP5A 4IQ4A 3FBNB 1EA3A 2Y9YA 2LKXA 1OCCH 3MKZA 3CJQB 3Q9VA 3ZQ7A 4E7LA 1LFPA 1Q1HA 4JX6A 1WGXA 2K3FA 1N77A 2COMA 4LG0A 3HTUA 2KISA 4UV8A 1OCTC 3E6CC 1M1EB 2HTSA 3EUKL 3P5JA 2VLAA 4ENMA 3PJRA 1MZBA 1E3HA 1Z9CA 2GOMA 3J80K 4N4OB 3BQZA 1BA5A 2EWNA 2L9RA 2QSGX 4YELA 5CPRB 2E1MB 1FIAA 1SFXA 1EH7A 4HLYA 1U5TC 1W1WE 4BXXJ 2LY2A 2ESNA 1T56A 2BZTA 3ABMH 2KIFA 3U1DA 2E19A 4BH9A 2DTRA 3QYBA 1S72I 2PLYA 2PJRA 5L3GA 2WAEA 2DW4A 2RREA 3DU5A 2JRMA 1KA8A 2CQKA 3ZMVA 3RPUD 3PNYA 2EFQA 2W00A 3F22A 1V3FA 3N05A 4IEJA 2IEKA 1RUNA 1JUPA 1SFEA 2XB5A 4KIGA 5FKNA 1YYVA 1TL8A 2VPLA 5IP6A 3L9FA 1WPKA 2DXIA 3WTXC 4R79A 3CDHA 3E5UA 2W7NA 2R0QC 3NWSA 2X9DA 3G2BA 3CQZJ 3MEXA 4BJ6C 3DTKA 4AUXA 4HSTA 1R4NB 2IA1A 2MLKA 3S2WA 1XDUA 3CCEI 3J7AY 2NS0A 4Y33A 3PO3J 5KCMA 4N9HA 5D4RA 1FOXA 1REPC 5C44J 2BHYA 4BE0A 5J3LA 5DCMB 2JT1A 1D1BA 3RQ4A 5LLQA 3JRIA 2CMPA 2L7KA 1IRFA 1QRYA 3SFZA 3BOQA 5DD8A 4IHSA 1LE8B 2AQEA 1DPRA 1JUMA 4XK4A 2J5PA 1KQ9A 1L0OC 4NBQA 3CUQB 1WJFA 1Y1VJ 1MIJA 2QYOA 2F5FA 4WF2A 3KCCA 2RQQA 4XORA 1JUSA 1T95A 3H9JA 3S1MJ 1YW8A 2PMZA 2FBKA 3ZQQA 1OCRH 2WV1A 3CMMA 2KZVA 4IRHA 4G12A 4JYKA 3M07A 2OQRA 4ZJZA 4GDFA 1S6LA 5LHIA 5LD2C 2KJCA 4CICA 2E2IJ 4C3HJ 1X4PA 3ASNH 3BTIA 2FMYA 3FXMA 3I9V2 1RESA 4XLAA 3RKXA 5LGNA 2IPQX 1OCOH 1Z0XA 3BROA 4HEA2 3FXQA 4NC8A 4XLNF 3E6DA 3VYUB 4O5VA 5FKMA 1RETA 3ULQB 1YJNI 4DYRA 3RZOJ 4LB5A 1D1AA 2L4AA 1LDDA 1UHMA 3ZOBA 3P9CA 1G8XA 3LQRA 2OA4A 2V79A 2H1LA 4A3CJ 2KQRA 2O5RA 3S3NA 1QPIA 2JUGA 2BY1A 1T33A 1GVDA 3CCLI 4AC0A 3FKJA 2NVUB 4UUTA 2R5ZB 3GFLA 2IBDA 5HS7A 4PFOA 3DBRB 2X48A 5E79C 2GIZA 1Y0UA 1I3AA 3BR0A 4I0AA 4YFKF 2I10A 2R5YB 2HS5A 2DQRA 3BZ6A 4RMNA 1GT0C 4BGDA 2DMQA 3BT9A 3K70C 3OWTA 4RAYA 2HVRA 1WJDA 4BJTA 3HRUA 1B72B 1E2XA 2XRNA 3H3VK 1HDDC 1B9MA 2BW3B 4IVNA 2XAUA 3F8BA 4BXFA 1BIAA 2GQQA 4IJAA 2H6CA 4XMYA 5BQTA 2O8XA 5HODA 2JQ7A 3U9GA 2Z5UA 2JTVA 3FK6A 4CDGA 5J4YA 4ASNA 3HZJA 2FQ3A 2LK2A 5DV5A 5FLXK 1X58A 3DXJF 1UFMA 2ZMEB 4IXAA 5LBQA 2L9SA 2MLGA 4L9TA 1XGMA 2QQBA 4YRVA 3IH2A 5CQGA 5ILUA 4HLXA 3PQJA 2LLKA 3M7GA 3BG3A 4BY1J 1R49A 1X19A 4QPOA 1NG6A 1SVLA 1BC8C 4D1QA 5FLMJ 4RB2C 1QQIA 2PFBA 3OIOA 5BOXA 2E1CA 1OCPA 2VBYA 2NRAC 3PIOF 5J8FA 2B7EA 2WAFA 3G3ZA 2LMDA 2Y48A 3HSEA 3QPSA 2H6BA 3WTSC 1ZYRF 4M3EA 4KNYA 4ZC3A 4DYQA 2YX4A 3CZ6A 4YIRX 4A3IJ 3X2QH 4KUMA 3M1CA 3JAMK 4FX4A 1ACIA 2ZNZA 3H3ZA 3QU6A 1AKHB 4O3MA 2DMTA 4BHCA 2L01A 1Z1DA 5GPAA 5CVUA 1N25A 1TWCJ 3PO2J 4YFNF 1YI2I 3BPXA 1GHCA 1LJ9A 4C3IJ 3ZCOA 1LPQA 5E3OA 3I64A 2LF7A 4P1WA 4XKVA 2ACJA 2FX0A 2DT6A 2ID3A 4U87A 3GMEA 4NC7A 4GYGA 4DZPA 1FP2A 4I02A 3ZP5A 3LSKA 2MD5A 4AU7A 3KP7A 3ECOA 1S5LC 2O9LA 2QLZA 5CVRA 4CUGA 2R7WA 3AG2H 4A3EJ 1SANA 4BBSJ 2BY3A 2VQGA 4XRFA 1H8AC 5BPIA 5EYRA 3FK7A 2M5WA 2KFDA 4NC6A 5K7FA 3TDUC 5ICFA 4LD5A 1ZRCA 5EF6A 5JFRA 4HX7A 5DTDA 4WWCA 2CQQA 3WU1B 4HPQA 1C0WA 4GFBA 3GTMJ 3BR3A 2XGXA 1YOVB 4NQWA 2R7FA 1TQIA 3PNTA 2HZDA 1MBJA 4I2OA 5FKOA 1YX5A 3HOZJ 1AA7A 2VKDA 2Y9ZA 3VWBA 1ZGAA 2HGCA 3CC2I 2OQGA 4DBQA 3VPRA 1MW7A 1MMGA 2HXIA 2K86A 4IL6C 3EUHC 4DNCA 2BHZA 1IUFA 2DJNA 3HSRA 1UZCA 3LSMA 4PJJA 1R71A 1K6OA 3WG7H 3E6MA 3HKZN 2BW3A 2IS6A 3R60A 4AVPA 1PP7U 4X1EA 1IXCA 2AXTC 2LYCA 5K1YA 1RKWA 2D2WA 2Q0OA 4B09A 2Y0MA 4XICA 3GTGJ 1MBFA 1QGPA 5DM7F 3GWZA 2DT5A 1IXSB 3F0CA 4P96A 4J19A 2QENA 4J01A 2DT7B 2W84A 2O61A 1T98A 2P7VB 3HOVJ 3HC7A 1WH5A 1X3UA 3BR2A 1XX5A 2KLOA 3CTAA 3A01B 3AG4H 3DCFA 4E7SA 5KNLA 3DKXA 3GTJJ 1FYLA 2F5CA 3VFZA 4BKXA 1YJWI 1U8BA 5F27A 3RCOA 2KRFA 4R8HA 3DBHB 5DM6F 4XR6A 1TC3C 4P9FA 1W5SA 3PSFA 4RDUA 3AKZA 2IAIA 4A93J 1DQUA 2JPBA 5K5QA 2IS1A 4N0BA 3GEZA 4PGHA 1XPXA 4LITA 1R22A 2YUSA 3S3MA 4PK4A 5GTHC 4ZTFA 1JI8A 3QP5A 2I8DA 3HOYJ 3LAPA 1JKOC 2VJ4A 3WTUC 1ZLKA 2F4OB 3K7AJ 3BCAA 3C18A 1A5JA 4RGXA 5HS9A 2QSHX 1P7IA 3BR5A 4A0XA 4U0YA 4MTEA 3PIPF 1IV8A 3SDGA 4C3JJ 3W2VA 3KYCB 4HZFA 3IP4B 1LUJB 5ICEA 2LY1A 2EIMH 2OPTA 4RAFA 5LHGA 1HC8A 2HDDA 2EA2A 5H20A 4ZYHA 5AONA 4BJ5C 2YU3A 3GTQJ 2NOJB 5IY5H 1FZPB 4UY8I 2IS4A 3GZ5A 4II2A 4D5FA 2FA5A 1USSA 4KN4X 3BWGA 5F64A 1W36C 1MDMB 2VL8A 4ESFA 3D1NI 1ON2A 3QQAA 2P5VA 5KK1A 2HZTA 3RSNA 1KGSA 1FEXA 2HQAA 4PJNA 3K1PA 4ENKA 4LIVA 2P6TA 4DQ2A 3WTWC 1EH8A 1WH7A 2H8RA 2VQCA 5ICGA 2Y75A 1LFUP 1YO5C 1VNDA 3GLLA 2X0LA 2YX7A 1Z21A 4XOPA 2XF7A 2R7XA 4E70A 4U7DA 2R4GA 1ZG5A 3HOUJ 3TGNA 3GW2A 1B8IB 2DA1A 1ZREA 2MC3A 1MJBA 5FGMA 1KQ0A 2OTLI 4WXDA 4E7KA 3JRAA 3SFIA 4CO8A 1TTYA 1FYKA 5HOOA 3EYIA 1F36A 3ECHA 3I4NJ 1D0YA 2QGUA 5CQEA 1ZG1A 1ZLJA 4FX0A 4C2MJ 1F43A 3H9GA 2GXAA 4N4NB 4KMFA 3KYLA 3HTSB 2Z16A 3S93A 2EQRA 2QQ8A 3AFHA 3MN2A 4HX8A 1STZA 2QSFX 2ZJRF 1S7OA 3WU2C 1DP7P 3CC4I 1YLFA 3LSJA 3KEOA 3TDZC 3JRGA 3W2AA 1MMAA 3OL3A 4IHXA 2LBFB 3QP6A 1MKMA 4XRSG 3ZQHA 4EGZA 1Z3YA 4CGZA 2WY8Q 4O6JA 3WTZA 2XAHA 3BTLA 5E17F 4IHTA 2TRTA 2M7BA 3CP8A 1PVEA 5TGTA 5M3FJ 2E5ZA 4A3DJ 3GZ6A 3HUGA 4M3GA 4UVCA 4BBRJ 5J40A 1FBUA 1I6XA 2K9SA 3L2QA 4NNJA 2BV6A 4EJUA 2BYVE 2BY2A 4LB6B 5EEGA 2XSDC 2YR2A 3WE3A 4G94A 3J7YJ 1A36A 2Y30A 3ABTA 2RGVA 3KPHA 1JJ8C 2MABA 4A3FJ 3FIWA 3EYYA 2DDBA 4HF0A 4W97A 2LG4A 4BACA 4XOTA 2R7OA 3OSFA 4D9JA 3MMYB 3I54A 1A6IA 1LFBA 1XGNA 2JSCA 3K4MA 4HYEA 1Q1VA 5D5XB 3KYDB 1Z7UA 2WBMA 3CMAI 1XSXA 1B4AA 3J7ZI 2DTZA 4H0EA 1Z67A 4M9SA 5EG0B 1PYVA 1HQCA 5J8CA 5E3MA 1FWZA 5EEHA 4CCJA 2LC2A 2H8WA 4LG3A 2K9MA 4RBOA 3EQLF 1IC8A 3ZMZA 2E7WA 2OUMA 4EM2A 5F0HA 2ISZA 3RYRA 2HDWA 3DTIA 4LG0B 4A5MA 3CDLA 5M3MJ 1HW1A 2EB7A 3HPGA 3ERMA 5CJ9A 4HNUA 1P4XA 5KAIC 1P4WA 2EBIA 3PM1A 3FHNA 1Z05A 4S05A 3N97A 1YW7A 1MMSA 2DA5A 1U0JA 4OOIA 1ETKA 2A6EF 1NTCA 4V2FA 2OCEA 1OR7C 2BXYA 3FXOA 4KJZA 3L2RA 3FISA 5ERIA 1W5TA 3O8HA 1K79A 2PJRB 3WHCA 5JHFA 1MBHA 1G3SA 5JLXA 4B44A 4F93B 3MKYB 4PJLA 1ZQ3P 4LLGF 4UUSB 3QRFF 1EF4A 5DEQA 1Y56A 4W1UA 3SQNA 4RGRA 2M1BA 3TOAA 2A07F 5E3NA 1GVJA 1U2WA 2ZC2A 3BR1A 3WE2A 1YE9A 2I5UA 4EJOA 2K40A 2M4KA 2L4MA 1IRXA 1MMDA 5FLVA 4B48A 2VQLA 1R6RA 2A5WA 4XN3A 5CLSA 2OZUA 3ONQA 2M0MA 3ML6A 5E1ZB 1RNLA 3BR6A 2Y2ZA 2HOTA 2HVSA 3CJRB 4L18B 4IHYA 2LBFA 1FTZA 3FDYA 4R1HA 3E7LA 2QZ8A 4BXUA 5FB2A 1FX7A 1KZHA 1TQMA 1WVRA 2FBIA 3O3KA 3B6CA 1RPWA 2VKVA 2E1NA 2Z3YA 1JTXA 3B6AA 3I55I 3SJMA 1R1VA 3RKWA 3D0SA 2FJ1A 2HVQA 3IH3A 3VB2A 3ZN0A 5HLIA 1JT6A 3I5UA 3QPLA 4B47A 3HRTA 1FYMA 3G73A 2ZCWA 3K4BA 2HNHA 4E6KG 1YW9A 1RIOH 1FSHA 3SEZA 3FHZA 1U6GA 5H6QA 1R23A 3DP7A 3PFYA 1O3QA 2GXBA 3JRDA 3ZGKA 3F72A 1LNWA 3J80Z 1QZZA 4IHWA 3KLOA 2E1MC 1VQNI 2CUEA 1D0XA 2VASA 1JGGA 4KIBA 4BYYA 2IVMA 3OYFA 3DBLB 2FMLA 4FHTA 4RB0A 5D5UB 1R36A 4MQ9F 5KVRA 3TO7A 3OYHA 2P81A 4A12A 3PFIA 3BTCA 4A5NA 5F1JA 1V5EA 2CW7A 2CUZA 3GX4X 3K1NA 4E7JA 2ZFWA 3BDDA 2L9NA 4HDVA 3BP8A 5AIQA 4ON0A 2LKPA 4A3GJ 2MW8A 1T2KA 4UUVA 4XM3A 2KZGA 3LSHA 1O7FA 1J7KA 3DWLE 1BW6A 3ZN1A 2LFBA 4CCLA 2O3FA 2XPUA 2ZFUA 2JA6J 1VI0A 1QHHD 1P7JA 2XF5A 3SHFA 5C4JJ 2DA3A 2A5YB 4IQJA 2X6OA 1ZH5A 1RC9A 4UUSA 1NK3P 3G1MA 1I39A 3IUOA 4WXCA 1IO2A 2JVHA 4CZCA 4KICA 1BI3A 2DOFA 2DOAA 2WY7Q 4CCNA 4DZJA 1GXPA 3CUQC 1CF7A 4HRIA 5A2QK 2UV1A 2UXXA 2QF7A 2K5CA 3A4CA 1IN8A 3H3UA 1WSUA 3VYTB 4UXNA 2VJIA 3F6OA 2R7QA 3JTGA 3BPVA 2N8GA 4I98B 4BE2A 4BY7J 2VBZA 5J4VA 3I0TA 1JKQC 2X1CA 2PMZN 1V4RA 2ZSIB 3CLQA 1XB4A 2OZ6A 2KIUA 3RZDJ 4Y17A 4BQNA 3DKYA 3D5RC 3K4CA 4L9JA 3U2RA 2DBBA 3H0GJ 4GGGA 4BNCA 5B1BH 2L7ZA 3BC8A 3FXJA 1J59A 3IWZA 4ZZLA 1XCBA 1CGPA 2RDPA 3HEFA 1O4XA 5IOYA 1J9IA 4CA0A 2M87A 2O7OA 2A6TA 1QO0D 2DOEA 4AWXB 4JX5A 2KMUA 1TT0A 3QAHA 4U7BA 3LFUA 3JW4A 1MJAA 4MHGA 2E34A 3Q0UA 1I3QJ 2VBWA 2IGKA 1OISA 2EA4A 3LQQA 1DU0A 2FOKA 3IRRA 1UHSA 4ENNA 4AIDA 1TBXA 1DDNA 4A3LJ 1WQ2A 2L0KA 4DYCA 1A35A 5L3EA 3QOEA 4M74A 4QWQA 3SZGA 1WFXA 3C1DA 2QEXI 3JSOA 2EK5A 3HDDA 3Q3SA 4MFDA 4M6VA 2G7HA 5B1AH 1BI1A 1ZN2A 2EINH 3K4JA 2K85A 2W48A 1BR1A 3VOEA 2AO9A 9ANTA 2HYJA 4KITB 3HBLA 4NQWB 2RC4A 1X3ZB 1X4OA 5LFAA 3FKIJ 1S7EA 4AD9A 4MGRA 2V1XA 2H94A 2ZMEC 5E18F 4ZYEA 1K4SA 2DYRH 5FLXZ 3V42A 3L2UA 5ED4A 2X1DA 3TOBA 3TW6A 4C9YA 4XONA 1VFCA 1RR7A 4L0ZB 5EJCA 1R4MB 2CYYA 3DPUA 3OOPA 3F8NA 4EV0A 2LD5A 1R00A 3NRVA 3OYBA 5IP9J 2H1KA 2VXZA 4Y7NJ 5LEJA 1U8RA 3EETA 3ROUA 4ZH4F 3FXUA 2M7AA 1ZHFA 3CCSI 4J00A 2XUBA 2DA6A 2ZB9A 4F7ZA 3E3VA 2A3SA 1KONA 1Y8QB 1H89C 1ZK8A 4KMUX 3W3CA 3G1OA 1YIJI 2MA3A 2CFXA 1MD0A 2CU7A 3FMRA 2LRDA 2MH2A 2M45A 3UNGC 5IPAA 4IF4A 3QYEA 4U0VA 4UVBA 3JAMZ 1HXDA 2NXNB 1RUOA 1F5TA 2GZWA 3E97A 2EV6A 2EFNA 2K4BA 4OMZA 5CVJA 5CYVA 1EH6A 1D5VA 4BQOA 2QVOA 1AWCA 1J09A 3W6VA 3F9KA 2Y0SA 2LH9A 2DK5A 5IP7J 3WODF 2NS7A 2OAZA 1BC7C 2XAGA 3TP0A 1HSTA 4IOAF 5LRRA 3RJPA 1IG7A 2P0WA 2WAQA 1P2FA 3F21A 5F1RA 1IW7F 1ENHA 5BMZA 4RB1A 2P6SA 4RLFA 1U5TA 2TDXA 4PGGA 2FXAA 4RGSA 1MH4A 4D0PA 3GZNB 1I1SA 4CHUA 4D7NA 2QBYA 1QHGA 2O6GE 2Q1ZB 2R7DA 1R58A 2ZXWH 4BAYA 4Q5SF 5EEAA 4YIFA 2QUFA 1U9NA 1WJ5A 5F0FA 3GFIA 4S0HB 3CLOA 1LKXA 1XGOA 2PN6A 1I5ZA 3LSGA 1OLTA 3QWLA 4Z6YA 1LVAA 1MBGA 3GUDA 5E20A 1XC5A 3FXKA 2X6YA 4YG2F 4OIOF 1HSJA 3R61A 2FF4A 4NDLA 3H5NA 3BG6A 4HW0A 3HL2A 3DTEA 2Y69H 1A31A 3FXRA 1BBYA 1JE8A 2M8EA 3B02A 1XD7A 4L5JA 2K4JA 1QVTA 4BQAA 2FU4A 1PUFA 4D5CA 2GXGA 3AL0B 5HDKA 5B5EC 4GRIA 1QVUA 2LSOA 4AIJA 1ZAOA 1QZEA 2RN7A 3QODA 2GM4A 2JA2A 4G7OF 4BL0B 2VBXA 4PFPA 3V8KA 4HQMA 3GFMA 1LVKA 4E7HA 4F52A 2WA0A 1BN5A 2EV5A 3OV8A 4NB5A 1X3WB 3OMYA 5B66C 1Z91A 1TW2A 2K3PA 1WRJA 4QSHA 1SD7A 4Q4ZF 3MZHA 3HOWJ 3F8CA 3OIQA 2FRHA 4OINF 3CD6I 1R5ID 4F3QA 1O3SA 2L54A 2EZIA 2CWEA 1BI0A 2FBHA 2DLLA 4DJAA 3GO5A 3C7JA 3LSIA 4EVIA 5HLHA 1ZRFA 2HEOA 5DD4A 3WGHA 1Y1WJ 1VQ6I 5CKTA 2QKLB 1B6AA 1O3TA
chains in the Genus database with same CATH topology
1IDYA 1XS9A 2XSDC 1OFCX 3JREA 3CMYA 2Y30A 3TEDA 5EG0A 2YS9A 2HOSA 1UMQA 1JJ8C 2XRLA 4A69C 4A3FJ 2NS8A 3FIWA 4CYCA 1IJWC 4W97A 2M2EA 2JA7J 4V2GA 4XRMA 3HGYA 2Y9YA 2LKXA 5EZHA 2Y0SN 3OSFA 1A6IA 1LFBA 2DMUA 1Q1VA 4JX6A 1VF9A 1X2MA 1WGXA 2DTZA 2WAQN 5EG0B 3OOUA 5E3MA 1OCTC 2COBA 4CYCB 4RBOA 1IC8A 1U9OA 3S1RJ 5FKKA 1K83J 2XGEA 5F0HA 2MGQA 3BQZA 1BA5A 2L9RA 5M5YJ 1FIAA 3BG9A 3S15J 1X2NA 3CDLA 4BXXJ 2FQ4A 5M3MJ 2E1OA 1T56A 2E19A 2R93J 1Z77A 2EBIA 3PM1A 1W0UA 2LTPA 3JRFA 2M8GX 2DA5A 3TP3A 4EEFG 1RKTA 5JLWA 4IEJA 2IEKA 1ETKA 4V2FA 1NTCA 3A02A 1JUPA 2XB5A 5FKNA 1APLC 3A03A 5F04A 2NVTJ 1K61A 3FISA 5IP6A 3WHBA 1WPKA 2MSYA 3O8HA 2EH3A 4M3FA 3WHCA 3S14J 1MBHA 5JLXA 2R0QC 2X9DA 3ZQIA 1LE8A 3CQZJ 1ZQ3P 5K7ZA 4AUXA 4UUSB 1EF4A 3LNQA 2L7MP 1GV5A 4W1UA 4I76A 4DW6A 5E3NA 3PO3J 3BR1A 1TWGJ 5C44J 5J3LA 1WI3A 3JRIA 2K40A 3S1NJ 1GDTA 4FCYA 1QRYA 2M34A 5FLVA 1LE8B 1NK2P 1JUMA 4XK4A 1ETQA 1ETXA 3LSRA 1TWAJ 1D5YA 3BR6A 2Y2ZA 2HOTA 2K9QA 2ME6A 1TWHJ 1Y1VJ 4FTHA 4IHYA 1FTZA 1JUSA 1ETVA 3S1MJ 1DU6A 3E7LA 5M5WJ 2WV1A 3HM5A 3M3YJ 4A3MJ 2AHQA 4G12A 3BQYA 4JYKA 3S1QJ 3B6CA 2GLOA 1ZR4A 1RPWA 2VKVA 2E2IJ 4C3HJ 3S2HJ 3BTIA 1SFOJ 1JTXA 1RESA 3B6AA 3JRHA 3SJMA 1GUUA 2FJ1A 1Z0XA 1MH3A 3IH3A 1JT6A 2R5ZA 3QPLA 1ETOA 5FKMA 1RETA 5BNGA 4DYRA 2R5YA 3RZOJ 5IYDJ 3ZOBA 3JR9A 5J1UA 1HF0A 2JWTA 3O8GA 4A3CJ 1QPIA 3L1PA 2E2JJ 2ELKA 3Q0WA 1ZGWA 1T33A 1GVDA 4AC0A 3JRDA 4MFEA 1B72A 4UUTA 2JJ7A 2R5ZB 2IBDA 2ID6A 3K2AA 2X48A 3BR0A 2I10A 2R5YB 2DMPA 1GT0C 4IHWA 2OF7A 2CUEA 2DMQA 2XGDA 3BT9A 1JGGA 1AHDP 1ORKA 5M5XJ 1B72B 5FKLA 2NVQJ 3H3VK 1HDDC 2P81A 5EGOB 2VKEA 5C3EJ 3BTCA 5F1JA 3UKGA 2NVXJ 2TCTA 5HODA 2D5VA 3S16J 3FK6A 4A3GJ 2LK2A 2MW8A 4X6AJ 1X58A 3ZQFA 5DS9A 3IH2A 1BW6A 1MSEC 2LFBA 2XPUA 2JA6J 1VI0A 2LLKA 3LSPA 2ME0A 3BG3A 4BY1J 1P7JA 5C4JJ 2DA3A 2B63J 2CJJA 2X6OA 5FLMJ 5GP9A 4UUSA 1HCRA 1NK3P 3G1MA 3OIOA 2JN6A 1OJLA 1OCPA 2XB0X 4MLOA 4XRSA 1AKHA 2NVYJ 4M3BA 4DZJA 1XG1A 3QPSA 2QF7A 1JKRC 1UG2A 2E2HJ 4M3EA 4DYQA 4A3IJ 2N8GA 4Y52J 4BY7J 1AKHB 1JKQC 2PMZN 2L7FP 2G0EA 2DMTA 2XPWA 5GPAA 1TWCJ 3PO2J 1HLVA 2JA8J 4QIWN 3RZDJ 2K9NA 1MBKA 2WB1N 3H0GJ 4C3IJ 5E3OA 2LR8A 1G2HA 2L7ZA 4I6ZA 2FX0A 1MSFC 3HEFA 1O4XA 5IOYA 2M0CA 2ID3A 1IV6A 2Y31A 2O7OA 4DZPA 4JX5A 1BJZA 4A3JJ 2O9LA 2HI3A 4MIMA 5IOZA 2VPRA 3ZQLA 5IYCJ 5F08A 4A3EJ 1BW5A 1SANA 4BBSJ 3Q0UA 3GTKJ 1I3QJ 1I50J 1H8AC 1FIPA 5EYRA 3FK7A 2QCOA 1DU0A 2DN0A 4A3BJ 1UHSA 5K7FA 2DMNA 2XGCA 1ZR2A 2ECBA 5EF6A 5DTDA 2CQQA 2HOAA 3MVPA 4A3LJ 2L0KA 4GFBA 4DYCA 3GTMJ 3BR3A 2EZHA 1I6HJ 4ABZA 1FJLA 5GPCA 2O8KA 3JRBA 1MBJA 3HDDA 3Q3SA 5FKOA 4MFDA 2HXOA 1R9TJ 3HOZJ 4M6VA 2Y9ZA 3DEWA 2XPVA 1JT0A 3VPRA 1E3OC 2HXIA 1W0TA 2W48A 3GTLJ 2AO9A 9ANTA 2HYJA 4IHVA 1IUFA 2DJNA 5EDNA 3GBGA 3HBLA 3HKZN 5EGOA 1WCMJ 3FKIJ 2CQXA 1S7EA 4X1EA 3A01A 2VI6A 4MO7A 3RQIA 4AYBN 1AU7A 2EZKA 2LY9A 1RKWA 3TW6A 1IDZA 1VFCA 4XICA 1RR7A 3GTGJ 1MBFA 4L5EA 4XIDA 3F0CA 2LD5A 2FD5A 4J19A 1IRZA 5IP9J 3HOVJ 2H1KA 1WH5A 4JX4A 3BR2A 3A01B 4Y7NJ 2KT0A 2LVSA 3DCFA 5E3LA 4B4CA 1YRNB 5C4XJ 3GTJJ 4HNVA 1POGA 4BKXA 2DA6A 2ZB9A 1U8BA 5F27A 1IGNA 3IH4A 1H89C 3NARA 1ZK8A 1TC3C 1FTTA 1JKPC 5IYBJ 3G1LA 3G1OA 2M9HA 4RDUA 2IAIA 1HOMA 4A93J 2CU7A 3GTOJ 2ECCA 5IPAA 2R92J 2DA2A 2YUSA 5J1YA 2MG4A 3HOYJ 3M4OJ 1JKOC 4FISA 2JMWA 1A5JA 3K7AJ 3W6VA 1P7IA 3BR5A 5IP7J 2NS7A 3LOCA 3TP0A 3SDGA 4C3JJ 1IG7A 2GBYA 2CUFA 5F0CA 1ZTRA 5J1RA 3S2DJ 1ENHA 2OPTA 2R7ZJ 3JRCA 4M3DA 2HDDA 1MH4A 3HB9A 3CCYA 2NOGA 3GTQJ 4D7NA 2JK3A 3Q0VA 4D5FA 5EEAA 2KDZA 1MBEA 1U9NA 1ZKGA 3D1NI 3GTPJ 3QQAA 3TW7A 4LOCA 5F0FA 4S0HB 1B8IA 1ETYA 3LSGA 1HDPA 2YU9J 1FEXA 3ZQCA 3BG5A 1MBGA 5EZGA 1XC5A 3HOXJ 4NDLA 2H8RA 1WH7A 1MNMC 4QTRA 1LFUP 1VNDA 1JTYA 5K7HA 2LP0A 1GV2A 5FJ8J 4A3KJ 4B3AA 3HOUJ 3I4MJ 1B8IB 2DA1A 2EZLA 1QVTA 2HQ5A 1PUFA 3OSGA 3JRAA 3BTJA 3SFIA 4JP0A 4D5CA 1ITYA 1F36A 2VUMJ 3I4NJ 1QVUA 3IV5A 3RKQA 1ETWA 2CRGA 4C2MJ 1F43A 2GM4A 3NAUA 4D7MA 2EQRA 3MN2A 3ZQGA 1PUFB 3LSJA 3MKLA 1U78A 3JRGA 1CQTA 4QSHA 4IHXA 2RAEA 3ZQHA 4XRSG 3HOWJ 3HGGA 4B1RA 3S17J 2DA7A 2EZIA 3BTLA 3C2BA 1BL0A 1TWFJ 2TRTA 2DA4A 1JJ6C 2JA5J 1YRNA 5M3FJ 4A3DJ 4M3GA 1H88C 4FE7A 4BBRJ 1Y1WJ 2K9SA 4FE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IDY A;  1XS9 A;  2XSD C;  1OFC X;  3JRE A;  3CMY A;  2Y30 A;  3TED A;  5EG0 A;  2YS9 A;  2HOS A;  1UMQ A;  1JJ8 C;  2XRL A;  4A69 C;  4A3F J;  2NS8 A;  3FIW A;  4CYC A;  1IJW C;  4W97 A;  2M2E A;  2JA7 J;  4V2G A;  4XRM A;  3HGY A;  2Y9Y A;  2LKX A;  5EZH A;  2Y0S N;  3OSF A;  1A6I A;  1LFB A;  2DMU A;  1Q1V A;  4JX6 A;  1VF9 A;  1X2M A;  1WGX A;  2DTZ A;  2WAQ N;  5EG0 B;  3OOU A;  5E3M A;  1OCT C;  2COB A;  4CYC B;  4RBO A;  1IC8 A;  1U9O A;  3S1R J;  5FKK A;  1K83 J;  2XGE A;  5F0H A;  2MGQ A;  3BQZ A;  1BA5 A;  2L9R A;  5M5Y J;  1FIA A;  3BG9 A;  3S15 J;  1X2N A;  3CDL A;  4BXX J;  2FQ4 A;  5M3M J;  2E1O A;  1T56 A;  2E19 A;  2R93 J;  1Z77 A;  2EBI A;  3PM1 A;  1W0U A;  2LTP A;  3JRF A;  2M8G X;  2DA5 A;  3TP3 A;  4EEF G;  1RKT A;  5JLW A;  4IEJ A;  2IEK A;  1ETK A;  4V2F A;  1NTC A;  3A02 A;  1JUP A;  2XB5 A;  5FKN A;  1APL C;  3A03 A;  5F04 A;  2NVT J;  1K61 A;  3FIS A;  5IP6 A;  3WHB A;  1WPK A;  2MSY A;  3O8H A;  2EH3 A;  4M3F A;  3WHC A;  3S14 J;  1MBH A;  5JLX A;  2R0Q C;  2X9D A;  3ZQI A;  1LE8 A;  3CQZ J;  1ZQ3 P;  5K7Z A;  4AUX A;  4UUS B;  1EF4 A;  3LNQ A;  2L7M P;  1GV5 A;  4W1U A;  4I76 A;  4DW6 A;  5E3N A;  3PO3 J;  3BR1 A;  1TWG J;  5C44 J;  5J3L A;  1WI3 A;  3JRI A;  2K40 A;  3S1N J;  1GDT A;  4FCY A;  1QRY A;  2M34 A;  5FLV A;  1LE8 B;  1NK2 P;  1JUM A;  4XK4 A;  1ETQ A;  1ETX A;  3LSR A;  1TWA J;  1D5Y A;  3BR6 A;  2Y2Z A;  2HOT A;  2K9Q A;  2ME6 A;  1TWH J;  1Y1V J;  4FTH A;  4IHY A;  1FTZ A;  1JUS A;  1ETV A;  3S1M J;  1DU6 A;  3E7L A;  5M5W J;  2WV1 A;  3HM5 A;  3M3Y J;  4A3M J;  2AHQ A;  4G12 A;  3BQY A;  4JYK A;  3S1Q J;  3B6C A;  2GLO A;  1ZR4 A;  1RPW A;  2VKV A;  2E2I J;  4C3H J;  3S2H J;  3BTI A;  1SFO J;  1JTX A;  1RES A;  3B6A A;  3JRH A;  3SJM A;  1GUU A;  2FJ1 A;  1Z0X A;  1MH3 A;  3IH3 A;  1JT6 A;  2R5Z A;  3QPL A;  1ETO A;  5FKM A;  1RET A;  5BNG A;  4DYR A;  2R5Y A;  3RZO J;  5IYD J;  3ZOB A;  3JR9 A;  5J1U A;  1HF0 A;  2JWT A;  3O8G A;  4A3C J;  1QPI A;  3L1P A;  2E2J J;  2ELK A;  3Q0W A;  1ZGW A;  1T33 A;  1GVD A;  4AC0 A;  3JRD A;  4MFE A;  1B72 A;  4UUT A;  2JJ7 A;  2R5Z B;  2IBD A;  2ID6 A;  3K2A A;  2X48 A;  3BR0 A;  2I10 A;  2R5Y B;  2DMP A;  1GT0 C;  4IHW A;  2OF7 A;  2CUE A;  2DMQ A;  2XGD A;  3BT9 A;  1JGG A;  1AHD P;  1ORK A;  5M5X J;  1B72 B;  5FKL A;  2NVQ J;  3H3V K;  1HDD C;  2P81 A;  5EGO B;  2VKE A;  5C3E J;  3BTC A;  5F1J A;  3UKG A;  2NVX J;  2TCT A;  5HOD A;  2D5V A;  3S16 J;  3FK6 A;  4A3G J;  2LK2 A;  2MW8 A;  4X6A J;  1X58 A;  3ZQF A;  5DS9 A;  3IH2 A;  1BW6 A;  1MSE C;  2LFB A;  2XPU A;  2JA6 J;  1VI0 A;  2LLK A;  3LSP A;  2ME0 A;  3BG3 A;  4BY1 J;  1P7J A;  5C4J J;  2DA3 A;  2B63 J;  2CJJ A;  2X6O A;  5FLM J;  5GP9 A;  4UUS A;  1HCR A;  1NK3 P;  3G1M A;  3OIO A;  2JN6 A;  1OJL A;  1OCP A;  2XB0 X;  4MLO A;  4XRS A;  1AKH A;  2NVY J;  4M3B A;  4DZJ A;  1XG1 A;  3QPS A;  2QF7 A;  1JKR C;  1UG2 A;  2E2H J;  4M3E A;  4DYQ A;  4A3I J;  2N8G A;  4Y52 J;  4BY7 J;  1AKH B;  1JKQ C;  2PMZ N;  2L7F P;  2G0E A;  2DMT A;  2XPW A;  5GPA A;  1TWC J;  3PO2 J;  1HLV A;  2JA8 J;  4QIW N;  3RZD J;  2K9N A;  1MBK A;  2WB1 N;  3H0G J;  4C3I J;  5E3O A;  2LR8 A;  1G2H A;  2L7Z A;  4I6Z A;  2FX0 A;  1MSF C;  3HEF A;  1O4X A;  5IOY A;  2M0C A;  2ID3 A;  1IV6 A;  2Y31 A;  2O7O A;  4DZP A;  4JX5 A;  1BJZ A;  4A3J J;  2O9L A;  2HI3 A;  4MIM A;  5IOZ A;  2VPR A;  3ZQL A;  5IYC J;  5F08 A;  4A3E J;  1BW5 A;  1SAN A;  4BBS J;  3Q0U A;  3GTK J;  1I3Q J;  1I50 J;  1H8A C;  1FIP A;  5EYR A;  3FK7 A;  2QCO A;  1DU0 A;  2DN0 A;  4A3B J;  1UHS A;  5K7F A;  2DMN A;  2XGC A;  1ZR2 A;  2ECB A;  5EF6 A;  5DTD A;  2CQQ A;  2HOA A;  3MVP A;  4A3L J;  2L0K A;  4GFB A;  4DYC A;  3GTM J;  3BR3 A;  2EZH A;  1I6H J;  4ABZ A;  1FJL A;  5GPC A;  2O8K A;  3JRB A;  1MBJ A;  3HDD A;  3Q3S A;  5FKO A;  4MFD A;  2HXO A;  1R9T J;  3HOZ J;  4M6V A;  2Y9Z A;  3DEW A;  2XPV A;  1JT0 A;  3VPR A;  1E3O C;  2HXI A;  1W0T A;  2W48 A;  3GTL J;  2AO9 A;  9ANT A;  2HYJ A;  4IHV A;  1IUF A;  2DJN A;  5EDN A;  3GBG A;  3HBL A;  3HKZ N;  5EGO A;  1WCM J;  3FKI J;  2CQX A;  1S7E A;  4X1E A;  3A01 A;  2VI6 A;  4MO7 A;  3RQI A;  4AYB N;  1AU7 A;  2EZK A;  2LY9 A;  1RKW A;  3TW6 A;  1IDZ A;  1VFC A;  4XIC A;  1RR7 A;  3GTG J;  1MBF A;  4L5E A;  4XID A;  3F0C A;  2LD5 A;  2FD5 A;  4J19 A;  1IRZ A;  5IP9 J;  3HOV J;  2H1K A;  1WH5 A;  4JX4 A;  3BR2 A;  3A01 B;  4Y7N J;  2KT0 A;  2LVS A;  3DCF A;  5E3L A;  4B4C A;  1YRN B;  5C4X J;  3GTJ J;  4HNV A;  1POG A;  4BKX A;  2DA6 A;  2ZB9 A;  1U8B A;  5F27 A;  1IGN A;  3IH4 A;  1H89 C;  3NAR A;  1ZK8 A;  1TC3 C;  1FTT A;  1JKP C;  5IYB J;  3G1L A;  3G1O A;  2M9H A;  4RDU A;  2IAI A;  1HOM A;  4A93 J;  2CU7 A;  3GTO J;  2ECC A;  5IPA A;  2R92 J;  2DA2 A;  2YUS A;  5J1Y A;  2MG4 A;  3HOY J;  3M4O J;  1JKO C;  4FIS A;  2JMW A;  1A5J A;  3K7A J;  3W6V A;  1P7I A;  3BR5 A;  5IP7 J;  2NS7 A;  3LOC A;  3TP0 A;  3SDG A;  4C3J J;  1IG7 A;  2GBY A;  2CUF A;  5F0C A;  1ZTR A;  5J1R A;  3S2D J;  1ENH A;  2OPT A;  2R7Z J;  3JRC A;  4M3D A;  2HDD A;  1MH4 A;  3HB9 A;  3CCY A;  2NOG A;  3GTQ J;  4D7N A;  2JK3 A;  3Q0V A;  4D5F A;  5EEA A;  2KDZ A;  1MBE A;  1U9N A;  1ZKG A;  3D1N I;  3GTP J;  3QQA A;  3TW7 A;  4LOC A;  5F0F A;  4S0H B;  1B8I A;  1ETY A;  3LSG A;  1HDP A;  2YU9 J;  1FEX A;  3ZQC A;  3BG5 A;  1MBG A;  5EZG A;  1XC5 A;  3HOX J;  4NDL A;  2H8R A;  1WH7 A;  1MNM C;  4QTR A;  1LFU P;  1VND A;  1JTY A;  5K7H A;  2LP0 A;  1GV2 A;  5FJ8 J;  4A3K J;  4B3A A;  3HOU J;  3I4M J;  1B8I B;  2DA1 A;  2EZL A;  1QVT A;  2HQ5 A;  1PUF A;  3OSG A;  3JRA A;  3BTJ A;  3SFI A;  4JP0 A;  4D5C A;  1ITY A;  1F36 A;  2VUM J;  3I4N J;  1QVU A;  3IV5 A;  3RKQ A;  1ETW A;  2CRG A;  4C2M J;  1F43 A;  2GM4 A;  3NAU A;  4D7M A;  2EQR A;  3MN2 A;  3ZQG A;  1PUF B;  3LSJ A;  3MKL A;  1U78 A;  3JRG A;  1CQT A;  4QSH A;  4IHX A;  2RAE A;  3ZQH A;  4XRS G;  3HOW J;  3HGG A;  4B1R A;  3S17 J;  2DA7 A;  2EZI A;  3BTL A;  3C2B A;  1BL0 A;  1TWF J;  2TRT A;  2DA4 A;  1JJ6 C;  2JA5 J;  1YRN A;  5M3F J;  4A3D J;  4M3G A;  1H88 C;  4FE7 A;  4BBR J;  1Y1W J;  2K9S A;  4FE4 A; 
#chains in the Genus database with same CATH topology
 2PX9 A;  3E6B A;  2JZY A;  4G9Y A;  3CMY A;  5L3F A;  1F1Z A;  2BY0 A;  1JGS A;  3TED A;  2A68 F;  1J5Y A;  4BEH A;  2HOS A;  1YS7 A;  2LF8 A;  3HUG B;  2NS8 A;  4CYC A;  3IKT A;  1IJW C;  3PUF A;  4EJW A;  1Y39 A;  5LEK A;  4XRM A;  3HGY A;  4Y3O A;  4I7H A;  3H9Q A;  1PP8 F;  2BOL A;  5DYM A;  2DMU A;  3WGI A;  2BBY A;  2EFW A;  4ZYD A;  1X2M A;  4WXH A;  1R5H A;  2Q2E A;  1SMT A;  4PSW A;  2VON A;  2DAO A;  3C2H A;  3ISP A;  1ODD A;  1B1B A;  3L09 A;  4AM3 A;  4ZDO A;  3KX2 A;  4PJM A;  2GIV A;  1SFU A;  3PNV A;  3S1R J;  1FC3 A;  5GAD J;  2MGQ A;  4G6T B;  5HNF A;  2FNA A;  3GCM A;  2KPM A;  1FOW A;  2E7X A;  2DYS H;  2XAQ A;  4E7I A;  2NAZ A;  1PDN C;  3BG9 A;  4G7H F;  2UZK A;  3S15 J;  2E35 A;  1X2N A;  1T0F C;  4PCQ A;  2PI0 A;  2FQ4 A;  3ZXS A;  4ZYG A;  2RVC A;  3ESW B;  4CCK A;  1G3Y A;  1EJ9 A;  4L9N A;  1Z77 A;  4RGU A;  3DU6 A;  2IT0 A;  4MNU A;  1A6Q A;  3GFJ A;  2X6X A;  5FRO A;  3B73 A;  3DPT A;  2DPU A;  2HR3 A;  3JRF A;  2Z9O A;  1X1B A;  2D45 A;  3MZY A;  4NHJ A;  2EJR A;  1JHF A;  2YSR A;  1Y0N A;  5HLT A;  3W6J B;  1U3E M;  3O2P E;  4P9U A;  5JR3 A;  1I27 A;  1APL C;  4BQQ A;  3A03 A;  3K1M A;  1K61 A;  3WHB A;  1QPM A;  2MSY A;  4OU0 A;  3S14 J;  1SC7 A;  1FLI A;  1LDJ A;  3K4L A;  3CF5 F;  3ZQI A;  3SZP A;  4A0Y A;  5K7Z A;  1S29 A;  4BHP A;  2L7M P;  4ZZD A;  3LWF A;  4I76 A;  3PL8 A;  4MEX F;  4M9X A;  3K70 D;  1XMA A;  1N75 A;  5IT9 K;  2QKM B;  1TWG J;  2EFO A;  2VJ5 A;  3KP2 A;  4ETS A;  1SD5 A;  3MCZ A;  1WI3 A;  1IN7 A;  3S1N J;  3OS0 A;  2XKO A;  3NEU A;  1L3L A;  5H6R A;  4JK1 X;  2HU9 A;  2DO7 A;  5FFZ A;  5TIS C;  5HNH A;  4XNF A;  1D8J A;  4HAM A;  2HDC A;  1NK2 P;  1ETQ A;  1ETX A;  2OD5 A;  4DGW B;  3OYN A;  3DLL F;  2X1E A;  2XAS A;  1D5Y A;  5FRM A;  2K9Q A;  2Q8K A;  3QYF A;  2ME6 A;  1W4M A;  4LK1 F;  1XCV A;  3KZY A;  2R3S A;  5L3B A;  1J2X A;  1ETV A;  1FNN A;  3HRS A;  3OYA A;  4CCM A;  4JOM A;  3HG9 A;  2F2E A;  1DU6 A;  2P8T A;  3L2V A;  3HM5 A;  3P7N A;  4G6D A;  3L00 A;  3M3Y J;  4QPQ A;  3T1B A;  4LLL A;  1WJA A;  3RIR A;  3TO9 A;  1T39 A;  3S1Q J;  4B8X A;  2UWM A;  4EGY A;  1OQY A;  3D5S C;  3KE2 A;  5DUK A;  1F4K A;  3FZV A;  3ABL H;  2WB1 A;  3OL4 A;  3S2H J;  3IL2 A;  1UG0 A;  3JRH A;  2HKO A;  3REO A;  3T8T A;  4BHB A;  1GUU A;  4CZZ A;  5DCF A;  2CW0 F;  3FWE A;  3G6E I;  3L2W A;  4LJZ F;  5IYD J;  1K6Y A;  1OYW A;  2L9V A;  2P5K A;  3JR9 A;  1HF0 A;  2JWT A;  2O03 A;  3O8G A;  4OAZ A;  2EPF A;  3L1P A;  2ELK A;  3MQ0 A;  2AS5 F;  3Q0W A;  2GA2 A;  1IN6 A;  5KHD A;  1ONV A;  3ABU A;  3S8P A;  1SVM A;  2MYS A;  3EPZ A;  3HXL A;  3KEY A;  3BCB A;  1VQ9 I;  5E1W A;  2X6W A;  2KKO A;  3TKY A;  2J5O A;  4XLP F;  1SFK A;  2FEZ A;  3EUH A;  2XGD A;  3FBI B;  4RAG A;  4S04 A;  2R7U A;  2ZJQ F;  1AHD P;  3KP4 A;  3FXL A;  2Z33 A;  2HFH A;  2ZSH B;  1VQP I;  1HBX G;  1I1G A;  5GAH J;  2IP2 A;  3D5L A;  5D8K B;  5EGO B;  3MZ8 A;  1FPQ A;  1HKQ A;  1X1D A;  2KRC A;  5C3E J;  3UKG A;  1FBQ A;  1WJB A;  1UHW A;  2EIK H;  3LMM A;  5JHU A;  4K2E A;  2D5V A;  1IRG A;  3S16 J;  4AYB A;  2EIJ H;  1IUY A;  2KHM A;  1NH3 A;  1BR4 A;  3S32 A;  2XAF A;  4ZYA A;  2K27 A;  1WJC A;  3KEQ A;  3OYM A;  3ELK A;  2BVM A;  2AQF A;  1Y8R B;  2ME0 A;  2PJP A;  3QPH A;  2DCE A;  5TJJ A;  1SVO A;  1V54 H;  2CG4 A;  3CF2 A;  3OY9 A;  1KYZ A;  2B63 J;  2CJJ A;  4LGW A;  4LIU A;  1MJ9 A;  4XSX F;  4G8X A;  5GP9 A;  2WV0 A;  1R5G A;  2HYF A;  2XB0 X;  2JPC A;  3AG3 H;  4MLO A;  3IC7 A;  1JHH A;  4M72 A;  2NVY J;  1G4D A;  4I99 C;  1JKR C;  4U0W A;  4BUP A;  2PMH A;  4AIK A;  3R0J A;  4BDZ A;  5D8L B;  2KRH A;  1GLN A;  1G6N A;  3EUA A;  3H36 A;  4KT6 A;  4PJ0 C;  3NWT A;  1CF7 B;  4M6Y A;  2XPW A;  4EQQ A;  1HLV A;  2JA8 J;  4XKB A;  2ICW G;  1SD4 A;  2E60 A;  2K9N A;  4I0B A;  1MBK A;  2PMU A;  3H35 A;  3ZMD A;  5LGU A;  2LR8 A;  2HWV A;  1G2H A;  3G71 I;  3H1C A;  2CW8 A;  3J81 K;  5FRN A;  2LKS A;  5FFX A;  3HRM A;  3KFW X;  3QOP A;  1BJZ A;  2WTE A;  4XKC A;  2GWR A;  5IOZ A;  1XSD A;  2VPR A;  2ZNY A;  4L5I A;  5F08 A;  1VTN C;  3I71 A;  1UEL B;  3L7W A;  3DLA A;  3WG9 A;  1W7P D;  3ZPL A;  5D5W B;  1X1A A;  1XGS A;  1I50 J;  2QCO A;  5E8I A;  1WWX A;  2DMN A;  3F8M A;  1T38 A;  2ECB A;  3V8L A;  2HOA A;  2EZH A;  1I6H J;  2RV8 A;  4ABZ A;  1FJL A;  1NG7 A;  3ZR8 X;  4DBR A;  1VQK I;  2JSP A;  4XLH A;  3TO6 A;  2O8K A;  3I3L A;  3GXO A;  2HTJ A;  2XIG A;  1YFH A;  4YII A;  1BIB A;  2Z1D A;  2HXO A;  2IA0 A;  2FE3 A;  2H09 A;  2CV0 A;  1O57 A;  2EV0 A;  3DEW A;  3RYP A;  5D4S A;  1JT0 A;  1VQ7 I;  4RA2 A;  2X85 A;  2UXN A;  3GTL J;  1JXS A;  1IAW A;  3GBG A;  3RKY A;  4X0G A;  3F23 A;  1TW3 A;  4GCV A;  5EGO A;  1WCM J;  2W85 A;  1NHA A;  2ZKZ A;  4HV5 A;  1QBJ A;  4MO7 A;  1YG2 A;  3DV8 A;  1KU3 A;  2XHK A;  4A6E A;  3J7A O;  1Z6R A;  3OYE A;  4XN0 A;  3P9I A;  1W36 D;  4UB8 C;  4L5E A;  1ZG3 A;  2UUZ A;  2Z99 A;  1IRZ A;  1XMK A;  2D1H A;  2K7L A;  2BVL A;  3A2K A;  3H92 A;  4II3 A;  2BEO A;  2F48 A;  5CVI A;  2IJL A;  2VOO A;  4B4C A;  4ESJ A;  3TL4 X;  1YRN B;  1IN4 A;  3CES A;  1O7L A;  4HNV A;  3IAS 2;  3KZI C;  3LA2 A;  2D1V A;  4P55 A;  4TV7 A;  4HBL A;  2V6C A;  4BDY A;  1IGN A;  1ZEL A;  1YS6 A;  1R1U A;  4EM0 B;  3NAR A;  3R6S A;  5IYB J;  3G1L A;  3CCJ I;  2M9H A;  5A2Q Z;  2FNP A;  3OS1 A;  3G4S I;  1HOM A;  2DK8 A;  3GTO J;  1GXQ A;  2R92 J;  1WHU A;  3I59 B;  3LA3 A;  4U88 A;  1KYW A;  2IGO A;  1K78 B;  1T6S A;  2RNJ A;  5J1Y A;  2EFP A;  2DQL A;  2MG4 A;  1HKT A;  2IS2 A;  5HVQ C;  3MD2 A;  3HHG A;  2P7C B;  5ILS A;  1A04 A;  4LFU A;  2VC0 A;  4PDK A;  2MFZ A;  3LOC A;  3HPH A;  3ZRG A;  4ENJ A;  1UAA A;  2ELJ A;  2KIQ A;  2CFO A;  2GBY A;  3IAM 2;  2CUF A;  1KU7 A;  5F0C A;  5J1R A;  1IF1 A;  2LOO A;  4M73 A;  5J47 A;  2ZO4 A;  2ZJ2 A;  3CUO A;  2OJE D;  2R7Z J;  2JVG A;  3JRC A;  4M3D A;  1VQ8 I;  1FSE A;  1FBS A;  3HB9 A;  2XF6 A;  4L0Y B;  2GOX B;  2NOG A;  4E4H A;  3Q0V A;  3QPT A;  1H0M A;  2V1U A;  4KYW A;  1YX3 A;  2KDZ A;  1ON1 A;  4PZJ A;  5K5O A;  1H9T A;  2OCC H;  1EV7 A;  1FMW A;  3GTP J;  1U5T B;  2CQ7 A;  3K4N A;  1BOB A;  1TZL A;  4LOC A;  4XLF A;  3SXY A;  4OIQ F;  3KLN A;  1YHQ I;  1DGW Y;  2YU9 J;  1XMX A;  1OR7 A;  4Q47 A;  5LRS A;  2QBY B;  3OR2 C;  3ZQC A;  3HOX J;  4P5O A;  3BZC A;  4RAZ A;  1MNM C;  2PG4 A;  1OPC A;  4BU2 A;  2F4I A;  2A61 A;  5K7H A;  2LP0 A;  1IN5 A;  1GV2 A;  1OMI A;  5FJ8 J;  1FOK A;  3COA C;  5E1X A;  2VIX A;  4XBF A;  2EZL A;  4I09 A;  2HQ5 A;  4YEJ A;  4Z2Y A;  4DIQ A;  5HDN A;  3ZMU A;  1ITY A;  2GAU A;  1VQO I;  3IV5 A;  3FM5 A;  3RKQ A;  1ETW A;  2CRG A;  3K10 A;  4KT5 C;  1PJR A;  5J6X A;  4HQE A;  1TLH B;  3V7C A;  3NAU A;  4D7M A;  3WGG A;  2W57 A;  3HYI A;  1IZ1 A;  2PQ8 A;  2VJJ A;  3ZQG A;  1PUF B;  3LA7 A;  3MKL A;  1U78 A;  1CQT A;  3OS2 A;  4LK0 F;  4ANJ A;  2RAE A;  3BJA A;  1BOA A;  2BGC A;  4QLC U;  3HGG A;  2ZXI A;  2WWY A;  4FQG A;  2DI3 A;  1YJ9 I;  3R0A A;  2VOP A;  1BL0 A;  5D5V B;  1TWF J;  3K0L A;  3HJE A;  2ZJP F;  1YRN A;  4FET A;  2KIM A;  2PBI A;  3F8F A;  4FE7 A;  1TP4 A;  2HQR A;  1R1T A;  4HDU A;  2JMW A;  4FE4 A;  1OYY A;  4RM2 A;  4A2U A;  4AVZ A;  1BJA A;  2F5E A;  4KFC A;  1YIO A;  2M30 A;  2XDV A;  3JRE A;  1OCZ H;  3M8F A;  2KJB A;  1WKM A;  2VT2 A;  4Q48 A;  2YS9 A;  1P4A A;  1UMQ A;  3C2G A;  1SAU A;  2CQN A;  3I59 A;  3WU0 A;  4OIP F;  1E17 A;  3W2W A;  2M2E A;  1K78 A;  4V19 K;  2JA7 J;  4V2G A;  1SAX A;  2HYG D;  4GXO A;  5EZH A;  2Y0S N;  3GYH X;  3V7S A;  3NQO A;  2EIL H;  1VF9 A;  4C2U A;  1S9H A;  2ZXH A;  4CCO A;  3OR1 C;  4Y13 A;  1MMN A;  2WAQ N;  2R7R A;  1HW5 A;  4PSX A;  1D3Y A;  5ICC A;  4BEH B;  1G3W A;  3OOU A;  2COB A;  2E71 A;  4CYC B;  3K6G A;  3CCU I;  4EJT A;  2A69 F;  4RM3 A;  3SEQ A;  1K7A A;  2VT3 A;  1U9O A;  5FKK A;  2XV4 S;  3DQV C;  1K83 J;  2XGE A;  3U21 A;  5ILV A;  1ZRD A;  3HHH A;  3LFK A;  4NUB A;  3CO7 C;  2G7U A;  4KDP A;  2Q2E B;  4EM1 A;  4MQV A;  5M5Y J;  3C3W A;  1EKE A;  2E1O A;  2X4H A;  1DGR M;  3L2C A;  2XKP A;  2R93 J;  1YQA A;  2STT A;  2VOD A;  2V6E A;  1ZGJ A;  3K2Z A;  3RDI A;  1W0U A;  4HF1 A;  2LTP A;  2MD0 A;  3RI4 A;  2M8G X;  1D1C A;  3TP3 A;  3FX3 A;  1RKT A;  4EEF G;  1KQ8 A;  5JLW A;  2Z2S B;  5IT3 A;  2DFH A;  3A02 A;  3DFG A;  2JUC A;  5F04 A;  2NVT J;  2LRE A;  4LMY A;  3SZT A;  3T0Y A;  5BPD A;  5DCM A;  2HQN A;  2EH3 A;  4M3F A;  5GAG J;  3AL0 C;  5E8G A;  3VOD A;  2KP6 A;  4IO9 F;  1LE8 A;  2MBF A;  3CJT B;  2R7T A;  3V4G A;  3LNQ A;  1GV5 A;  1V5G A;  2DFF A;  3BG7 A;  2CS3 A;  2W82 A;  4DW6 A;  2NNN A;  2V1D A;  1V55 H;  3CUQ A;  2KDO A;  2M3A A;  2F6C A;  5H2F C;  1SD6 A;  5JI6 A;  1P92 A;  2V4J C;  1UCR A;  1GDT A;  4FCY A;  2CUJ A;  3ERE D;  1DP3 A;  2M34 A;  3KP3 A;  4ZTJ A;  3CCV I;  5JVT A;  3FM3 A;  3AAF A;  3DF8 A;  3LSR A;  1TWA J;  3WTV C;  1H9G A;  5DUI A;  2QA4 I;  1TWH J;  4H4K C;  4FTH A;  1FMV A;  3KZZ A;  2L2O A;  1OYI A;  1Z3X A;  2QWW A;  5F6F A;  3CO6 C;  5M5W J;  3HSF A;  1QZY A;  3VYR B;  3AG1 H;  3MWM A;  4FAS D;  4A3M J;  2AHQ A;  2STW A;  2HOE A;  2F4M B;  3BQY A;  4YFX F;  2GLO A;  1ZR4 A;  2QM3 A;  1ZAR A;  1UST A;  1SFO J;  1XSV A;  2ZXJ A;  3ZMT A;  3S3O A;  4KIS A;  1LEA A;  1MH3 A;  4M9Z A;  1HKS A;  3KP6 A;  2R5Z A;  4BE1 A;  2CV2 A;  1YTY A;  1D0Z A;  1ETO A;  3CC7 I;  4XKW A;  4FT8 A;  2R5Y A;  5LGT A;  3IWF A;  3BZK A;  4RB3 C;  5J1U A;  5AIP A;  2RNG A;  3E5Q A;  3RPQ A;  3IRQ A;  2DFE A;  2QQ9 A;  2E2J J;  3H0D A;  4OMY A;  4A0Z A;  1ZGW A;  2VKH A;  2V7F A;  2K02 A;  4MFE A;  1B72 A;  2JJ7 A;  1RRJ A;  2ID6 A;  2V9V A;  1R7J A;  2X51 A;  3K2A A;  4OIR F;  3DEE A;  2DMP A;  3IHU A;  2CH0 A;  2HPI A;  3RTR A;  2OF7 A;  4IRG A;  4B3X A;  1ORK A;  4XL9 A;  5M5X J;  1TT5 B;  3LL7 A;  5CVV A;  5FKL A;  4WCG A;  2NVQ J;  4OWR B;  2ZME A;  3KET A;  2VKE A;  1BI2 A;  2W1O A;  1WZ2 A;  2NVX J;  2OTJ I;  2E5N A;  1F9N A;  4BS9 A;  5GAE J;  3HKZ A;  3PUB A;  2TCT A;  1WJE A;  2PEX A;  3SDB A;  4EJV A;  1OKR A;  4UNO A;  5FO5 A;  4G7Z F;  1VQ4 I;  3I58 A;  4F92 B;  4X6A J;  3ASO H;  1AOY A;  2NYX A;  3ZQF A;  1XN7 A;  3CCM I;  5DS9 A;  5GTI C;  1MSE C;  3W6K B;  1B59 A;  1Z6T A;  2NNY A;  3CDI A;  3E5X A;  3LSP A;  3CJN A;  4HV6 A;  2DPD A;  3OYD A;  3FF5 A;  1S8N A;  5IT9 Z;  4GYI A;  3ZMS A;  1K4T A;  4ZDP A;  1QU3 A;  1HCR A;  3OYJ A;  3TQN A;  2W24 A;  4G6Q A;  1BM9 A;  1SEU A;  2JN6 A;  4IKF A;  2O0Y A;  1OJL A;  4XRS A;  1FP1 D;  1FT9 A;  1AKH A;  2H27 A;  4Y4R A;  4ITV A;  4M3B A;  1XG1 A;  1VQL I;  3VSL A;  4WX9 A;  1UG2 A;  4IX7 A;  2E2H J;  3EDP A;  2V1N A;  2RKH A;  2DFI A;  3BY6 A;  1W7P B;  4AIH A;  2MC4 A;  4HSR A;  4Y52 J;  3ABK H;  5JVG F;  2L02 A;  4ESB A;  1ERD A;  4HG2 A;  4XLC A;  2L7F P;  2G0E A;  2VE8 A;  3FMS A;  2L5Q A;  2IGM A;  1J0R A;  4QIW N;  1VQ5 I;  4PUS A;  2VE9 A;  2WB1 N;  4MTD A;  3PSI A;  3GF2 A;  3VDX A;  4CXF A;  4IOC F;  4I6Z A;  2OV7 A;  1MSF C;  1UJ8 A;  2M0C A;  1IV6 A;  2IGN A;  1O3R A;  2Y31 A;  3IKV A;  4HNT A;  2ETH A;  1X1C A;  4ZDL A;  2HPM A;  4A3J J;  3I53 A;  3DEU A;  2HI3 A;  4MIM A;  1J75 A;  3ZQL A;  5IYC J;  1FOY A;  4UB6 C;  1BW5 A;  3P9K A;  2QQA A;  3GTK J;  3TBI A;  1X1P A;  2YPR A;  1S7A A;  1FIP A;  2DDA A;  1DPU A;  2DN0 A;  4HA8 A;  1LB2 A;  4A3B J;  2XGC A;  3OYL A;  1ZR2 A;  1MND A;  5D6F A;  1LEB A;  4UVA A;  2IW5 A;  3O6B B;  4B43 A;  3MVP A;  3HOS A;  1FY7 A;  5GPC A;  2CGP A;  2MH9 A;  3JRB A;  1IXR C;  2OBP A;  1R9T J;  4IRI A;  2W4S A;  4JQF A;  2L3D A;  2XPV A;  3WTY C;  4IZZ A;  1MGT A;  1E3O C;  1W0T A;  2V9P A;  4CYD A;  2P4W A;  2OU2 A;  1WI9 A;  3CME I;  4IHV A;  2V9K A;  5EDN A;  2XRO A;  2RQP A;  3BJ6 A;  2CQX A;  3M9A A;  1QA6 A;  3N4M A;  1QNT A;  3A01 A;  2VI6 A;  3RQI A;  3T8R A;  4AYB N;  1DUX C;  1E0E A;  1AU7 A;  1YIT I;  2EZK A;  2LY9 A;  2DOD A;  4IPA A;  1IDZ A;  1RZ4 A;  5L3D A;  3E0J B;  3WTT C;  3U1K A;  3K9T A;  3BJO A;  4XID A;  2LDU A;  2FD5 A;  3VEP A;  4HF2 A;  1XTA A;  2E36 A;  3M8E A;  2FOW A;  4JX4 A;  5TRD A;  2KL4 A;  2KT0 A;  2LVS A;  2M4G A;  2IXS A;  5E3L A;  3OYC A;  5LHH A;  5C4X J;  2ZBK A;  1POG A;  4HX4 A;  4UV9 A;  3TMO A;  5FD5 A;  3T5X A;  3IH4 A;  2IA2 A;  1V5F A;  2R7V A;  1FTT A;  2ISY A;  1UB9 A;  4M71 A;  4MEY F;  1JKP C;  2HKX A;  5HLG A;  2G9W A;  2IRF G;  4OAY A;  2ECC A;  1TNT A;  2B0L A;  3FMQ A;  5K5R A;  2DA2 A;  3K69 A;  5HS8 A;  3A0H C;  3M4O J;  1XDS A;  5D6E A;  2DU9 A;  4FIS A;  4HOB A;  4EMS A;  3Q9S A;  1W7P A;  3UR3 C;  2VXD A;  2JRT A;  2VB6 A;  3H5A A;  3MKW B;  2ESH A;  1BR2 A;  3JTH A;  3MAJ A;  3BLY A;  4GO1 A;  3OYI A;  1ZTR A;  1N78 A;  3S2D J;  1SMY F;  1VZ0 A;  3J81 Z;  4L9V A;  2XSJ C;  3JSP A;  2XVC A;  3A0B C;  3LAJ A;  1P9Q C;  4CH7 A;  2A05 A;  1MDM A;  4A6D A;  1T0F A;  5HDG A;  2VC1 A;  3V7R A;  3CCY A;  5L3C A;  1Y6I A;  1S3J A;  3MFK A;  2JK3 A;  1KU9 A;  2ELH A;  4M6X A;  2A6H F;  1B9N A;  3VSK A;  3H5R A;  3Q5F A;  2C6Y A;  1MBE A;  1HA8 A;  3OIP A;  1ZKG A;  3GLX A;  1RR8 C;  3TW7 A;  1LDK B;  3QU3 A;  5FD6 A;  1G3T A;  1B8I A;  3V8J A;  1ETY A;  1T08 B;  1HDP A;  2B9S A;  3SYT A;  2FUG 2;  3OYK A;  4N9I A;  2AXL A;  2F5D A;  5DDG A;  4CSW A;  3CCQ I;  1HW2 A;  1P6R A;  3BG5 A;  5EZG A;  3CCR I;  4DOZ A;  4UHT A;  2P5L C;  4QTR A;  3F3X A;  2CO5 A;  4WK8 F;  1JTY A;  5BS6 A;  3HOT A;  3I56 I;  1KU2 A;  2BXZ A;  5B3S H;  4A3K J;  4B3A A;  1VQM I;  2CV1 A;  3I4M J;  4LLN A;  2V26 A;  2CSO A;  2DJI A;  3OSG A;  2R7S A;  3BTJ A;  1Z7L A;  2GA1 A;  3A1Y A;  4JP0 A;  2BE5 F;  1LQ1 A;  3M1E A;  2VUM J;  1TNS A;  6PAX A;  4F91 B;  3F6V A;  4E7Z A;  3KIO A;  3E1S A;  4RLQ A;  2LNB A;  2ADU A;  3PQK A;  2WAD A;  4Y15 A;  4EAT A;  3CP2 A;  2W25 A;  4F55 A;  1E3P A;  4KIF A;  4C30 A;  4B1R A;  4XQF A;  3S17 J;  3JCU C;  2DA7 A;  3DPL C;  3OYG A;  3C2B A;  2VQH A;  1T8I A;  4XLE A;  2DA4 A;  2WC2 A;  3I4P A;  3VYS B;  1JJ6 C;  2OC6 A;  2JA5 J;  2XC7 A;  3R4K A;  2XAJ A;  1H88 C;  4C2T A;  4XSZ F;  1RI7 A;  3DKW A;  4I01 A;  2K9L A;  5BNG A;  1IDY A;  1MNE A;  1XS9 A;  2FSW A;  3HIF A;  4JBA A;  1TQP A;  3LST A;  1ULY A;  1OFC X;  3RPU A;  2VN2 A;  4KN7 X;  1G59 A;  4RS8 A;  5KAF C;  1PUE E;  5EG0 A;  3GVA A;  3M8J A;  2XRL A;  4A69 C;  1W5C C;  4KA4 A;  2F5V A;  3K4K A;  1D8K A;  3KP5 A;  4IQ4 A;  3FBN B;  1EA3 A;  2Y9Y A;  2LKX A;  1OCC H;  3MKZ A;  3CJQ B;  3Q9V A;  3ZQ7 A;  4E7L A;  1LFP A;  1Q1H A;  4JX6 A;  1WGX A;  2K3F A;  1N77 A;  2COM A;  4LG0 A;  3HTU A;  2KIS A;  4UV8 A;  1OCT C;  3E6C C;  1M1E B;  2HTS A;  3EUK L;  3P5J A;  2VLA A;  4ENM A;  3PJR A;  1MZB A;  1E3H A;  1Z9C A;  2GOM A;  3J80 K;  4N4O B;  3BQZ A;  1BA5 A;  2EWN A;  2L9R A;  2QSG X;  4YEL A;  5CPR B;  2E1M B;  1FIA A;  1SFX A;  1EH7 A;  4HLY A;  1U5T C;  1W1W E;  4BXX J;  2LY2 A;  2ESN A;  1T56 A;  2BZT A;  3ABM H;  2KIF A;  3U1D A;  2E19 A;  4BH9 A;  2DTR A;  3QYB A;  1S72 I;  2PLY A;  2PJR A;  5L3G A;  2WAE A;  2DW4 A;  2RRE A;  3DU5 A;  2JRM A;  1KA8 A;  2CQK A;  3ZMV A;  3RPU D;  3PNY A;  2EFQ A;  2W00 A;  3F22 A;  1V3F A;  3N05 A;  4IEJ A;  2IEK A;  1RUN A;  1JUP A;  1SFE A;  2XB5 A;  4KIG A;  5FKN A;  1YYV A;  1TL8 A;  2VPL A;  5IP6 A;  3L9F A;  1WPK A;  2DXI A;  3WTX C;  4R79 A;  3CDH A;  3E5U A;  2W7N A;  2R0Q C;  3NWS A;  2X9D A;  3G2B A;  3CQZ J;  3MEX A;  4BJ6 C;  3DTK A;  4AUX A;  4HST A;  1R4N B;  2IA1 A;  2MLK A;  3S2W A;  1XDU A;  3CCE I;  3J7A Y;  2NS0 A;  4Y33 A;  3PO3 J;  5KCM A;  4N9H A;  5D4R A;  1FOX A;  1REP C;  5C44 J;  2BHY A;  4BE0 A;  5J3L A;  5DCM B;  2JT1 A;  1D1B A;  3RQ4 A;  5LLQ A;  3JRI A;  2CMP A;  2L7K A;  1IRF A;  1QRY A;  3SFZ A;  3BOQ A;  5DD8 A;  4IHS A;  1LE8 B;  2AQE A;  1DPR A;  1JUM A;  4XK4 A;  2J5P A;  1KQ9 A;  1L0O C;  4NBQ A;  3CUQ B;  1WJF A;  1Y1V J;  1MIJ A;  2QYO A;  2F5F A;  4WF2 A;  3KCC A;  2RQQ A;  4XOR A;  1JUS A;  1T95 A;  3H9J A;  3S1M J;  1YW8 A;  2PMZ A;  2FBK A;  3ZQQ A;  1OCR H;  2WV1 A;  3CMM A;  2KZV A;  4IRH A;  4G12 A;  4JYK A;  3M07 A;  2OQR A;  4ZJZ A;  4GDF A;  1S6L A;  5LHI A;  5LD2 C;  2KJC A;  4CIC A;  2E2I J;  4C3H J;  1X4P A;  3ASN H;  3BTI A;  2FMY A;  3FXM A;  3I9V 2;  1RES A;  4XLA A;  3RKX A;  5LGN A;  2IPQ X;  1OCO H;  1Z0X A;  3BRO A;  4HEA 2;  3FXQ A;  4NC8 A;  4XLN F;  3E6D A;  3VYU B;  4O5V A;  5FKM A;  1RET A;  3ULQ B;  1YJN I;  4DYR A;  3RZO J;  4LB5 A;  1D1A A;  2L4A A;  1LDD A;  1UHM A;  3ZOB A;  3P9C A;  1G8X A;  3LQR A;  2OA4 A;  2V79 A;  2H1L A;  4A3C J;  2KQR A;  2O5R A;  3S3N A;  1QPI A;  2JUG A;  2BY1 A;  1T33 A;  1GVD A;  3CCL I;  4AC0 A;  3FKJ A;  2NVU B;  4UUT A;  2R5Z B;  3GFL A;  2IBD A;  5HS7 A;  4PFO A;  3DBR B;  2X48 A;  5E79 C;  2GIZ A;  1Y0U A;  1I3A A;  3BR0 A;  4I0A A;  4YFK F;  2I10 A;  2R5Y B;  2HS5 A;  2DQR A;  3BZ6 A;  4RMN A;  1GT0 C;  4BGD A;  2DMQ A;  3BT9 A;  3K70 C;  3OWT A;  4RAY A;  2HVR A;  1WJD A;  4BJT A;  3HRU A;  1B72 B;  1E2X A;  2XRN A;  3H3V K;  1HDD C;  1B9M A;  2BW3 B;  4IVN A;  2XAU A;  3F8B A;  4BXF A;  1BIA A;  2GQQ A;  4IJA A;  2H6C A;  4XMY A;  5BQT A;  2O8X A;  5HOD A;  2JQ7 A;  3U9G A;  2Z5U A;  2JTV A;  3FK6 A;  4CDG A;  5J4Y A;  4ASN A;  3HZJ A;  2FQ3 A;  2LK2 A;  5DV5 A;  5FLX K;  1X58 A;  3DXJ F;  1UFM A;  2ZME B;  4IXA A;  5LBQ A;  2L9S A;  2MLG A;  4L9T A;  1XGM A;  2QQB A;  4YRV A;  3IH2 A;  5CQG A;  5ILU A;  4HLX A;  3PQJ A;  2LLK A;  3M7G A;  3BG3 A;  4BY1 J;  1R49 A;  1X19 A;  4QPO A;  1NG6 A;  1SVL A;  1BC8 C;  4D1Q A;  5FLM J;  4RB2 C;  1QQI A;  2PFB A;  3OIO A;  5BOX A;  2E1C A;  1OCP A;  2VBY A;  2NRA C;  3PIO F;  5J8F A;  2B7E A;  2WAF A;  3G3Z A;  2LMD A;  2Y48 A;  3HSE A;  3QPS A;  2H6B A;  3WTS C;  1ZYR F;  4M3E A;  4KNY A;  4ZC3 A;  4DYQ A;  2YX4 A;  3CZ6 A;  4YIR X;  4A3I J;  3X2Q H;  4KUM A;  3M1C A;  3JAM K;  4FX4 A;  1ACI A;  2ZNZ A;  3H3Z A;  3QU6 A;  1AKH B;  4O3M A;  2DMT A;  4BHC A;  2L01 A;  1Z1D A;  5GPA A;  5CVU A;  1N25 A;  1TWC J;  3PO2 J;  4YFN F;  1YI2 I;  3BPX A;  1GHC A;  1LJ9 A;  4C3I J;  3ZCO A;  1LPQ A;  5E3O A;  3I64 A;  2LF7 A;  4P1W A;  4XKV A;  2ACJ A;  2FX0 A;  2DT6 A;  2ID3 A;  4U87 A;  3GME A;  4NC7 A;  4GYG A;  4DZP A;  1FP2 A;  4I02 A;  3ZP5 A;  3LSK A;  2MD5 A;  4AU7 A;  3KP7 A;  3ECO A;  1S5L C;  2O9L A;  2QLZ A;  5CVR A;  4CUG A;  2R7W A;  3AG2 H;  4A3E J;  1SAN A;  4BBS J;  2BY3 A;  2VQG A;  4XRF A;  1H8A C;  5BPI A;  5EYR A;  3FK7 A;  2M5W A;  2KFD A;  4NC6 A;  5K7F A;  3TDU C;  5ICF A;  4LD5 A;  1ZRC A;  5EF6 A;  5JFR A;  4HX7 A;  5DTD A;  4WWC A;  2CQQ A;  3WU1 B;  4HPQ A;  1C0W A;  4GFB A;  3GTM J;  3BR3 A;  2XGX A;  1YOV B;  4NQW A;  2R7F A;  1TQI A;  3PNT A;  2HZD A;  1MBJ A;  4I2O A;  5FKO A;  1YX5 A;  3HOZ J;  1AA7 A;  2VKD A;  2Y9Z A;  3VWB A;  1ZGA A;  2HGC A;  3CC2 I;  2OQG A;  4DBQ A;  3VPR A;  1MW7 A;  1MMG A;  2HXI A;  2K86 A;  4IL6 C;  3EUH C;  4DNC A;  2BHZ A;  1IUF A;  2DJN A;  3HSR A;  1UZC A;  3LSM A;  4PJJ A;  1R71 A;  1K6O A;  3WG7 H;  3E6M A;  3HKZ N;  2BW3 A;  2IS6 A;  3R60 A;  4AVP A;  1PP7 U;  4X1E A;  1IXC A;  2AXT C;  2LYC A;  5K1Y A;  1RKW A;  2D2W A;  2Q0O A;  4B09 A;  2Y0M A;  4XIC A;  3GTG J;  1MBF A;  1QGP A;  5DM7 F;  3GWZ A;  2DT5 A;  1IXS B;  3F0C A;  4P96 A;  4J19 A;  2QEN A;  4J01 A;  2DT7 B;  2W84 A;  2O61 A;  1T98 A;  2P7V B;  3HOV J;  3HC7 A;  1WH5 A;  1X3U A;  3BR2 A;  1XX5 A;  2KLO A;  3CTA A;  3A01 B;  3AG4 H;  3DCF A;  4E7S A;  5KNL A;  3DKX A;  3GTJ J;  1FYL A;  2F5C A;  3VFZ A;  4BKX A;  1YJW I;  1U8B A;  5F27 A;  3RCO A;  2KRF A;  4R8H A;  3DBH B;  5DM6 F;  4XR6 A;  1TC3 C;  4P9F A;  1W5S A;  3PSF A;  4RDU A;  3AKZ A;  2IAI A;  4A93 J;  1DQU A;  2JPB A;  5K5Q A;  2IS1 A;  4N0B A;  3GEZ A;  4PGH A;  1XPX A;  4LIT A;  1R22 A;  2YUS A;  3S3M A;  4PK4 A;  5GTH C;  4ZTF A;  1JI8 A;  3QP5 A;  2I8D A;  3HOY J;  3LAP A;  1JKO C;  2VJ4 A;  3WTU C;  1ZLK A;  2F4O B;  3K7A J;  3BCA A;  3C18 A;  1A5J A;  4RGX A;  5HS9 A;  2QSH X;  1P7I A;  3BR5 A;  4A0X A;  4U0Y A;  4MTE A;  3PIP F;  1IV8 A;  3SDG A;  4C3J J;  3W2V A;  3KYC B;  4HZF A;  3IP4 B;  1LUJ B;  5ICE A;  2LY1 A;  2EIM H;  2OPT A;  4RAF A;  5LHG A;  1HC8 A;  2HDD A;  2EA2 A;  5H20 A;  4ZYH A;  5AON A;  4BJ5 C;  2YU3 A;  3GTQ J;  2NOJ B;  5IY5 H;  1FZP B;  4UY8 I;  2IS4 A;  3GZ5 A;  4II2 A;  4D5F A;  2FA5 A;  1USS A;  4KN4 X;  3BWG A;  5F64 A;  1W36 C;  1MDM B;  2VL8 A;  4ESF A;  3D1N I;  1ON2 A;  3QQA A;  2P5V A;  5KK1 A;  2HZT A;  3RSN A;  1KGS A;  1FEX A;  2HQA A;  4PJN A;  3K1P A;  4ENK A;  4LIV A;  2P6T A;  4DQ2 A;  3WTW C;  1EH8 A;  1WH7 A;  2H8R A;  2VQC A;  5ICG A;  2Y75 A;  1LFU P;  1YO5 C;  1VND A;  3GLL A;  2X0L A;  2YX7 A;  1Z21 A;  4XOP A;  2XF7 A;  2R7X A;  4E70 A;  4U7D A;  2R4G A;  1ZG5 A;  3HOU J;  3TGN A;  3GW2 A;  1B8I B;  2DA1 A;  1ZRE A;  2MC3 A;  1MJB A;  5FGM A;  1KQ0 A;  2OTL I;  4WXD A;  4E7K A;  3JRA A;  3SFI A;  4CO8 A;  1TTY A;  1FYK A;  5HOO A;  3EYI A;  1F36 A;  3ECH A;  3I4N J;  1D0Y A;  2QGU A;  5CQE A;  1ZG1 A;  1ZLJ A;  4FX0 A;  4C2M J;  1F43 A;  3H9G A;  2GXA A;  4N4N B;  4KMF A;  3KYL A;  3HTS B;  2Z16 A;  3S93 A;  2EQR A;  2QQ8 A;  3AFH A;  3MN2 A;  4HX8 A;  1STZ A;  2QSF X;  2ZJR F;  1S7O A;  3WU2 C;  1DP7 P;  3CC4 I;  1YLF A;  3LSJ A;  3KEO A;  3TDZ C;  3JRG A;  3W2A A;  1MMA A;  3OL3 A;  4IHX A;  2LBF B;  3QP6 A;  1MKM A;  4XRS G;  3ZQH A;  4EGZ A;  1Z3Y A;  4CGZ A;  2WY8 Q;  4O6J A;  3WTZ A;  2XAH A;  3BTL A;  5E17 F;  4IHT A;  2TRT A;  2M7B A;  3CP8 A;  1PVE A;  5TGT A;  5M3F J;  2E5Z A;  4A3D J;  3GZ6 A;  3HUG A;  4M3G A;  4UVC A;  4BBR J;  5J40 A;  1FBU A;  1I6X A;  2K9S A;  3L2Q A;  4NNJ A;  2BV6 A;  4EJU A;  2BYV E;  2BY2 A;  4LB6 B;  5EEG A;  2XSD C;  2YR2 A;  3WE3 A;  4G94 A;  3J7Y J;  1A36 A;  2Y30 A;  3ABT A;  2RGV A;  3KPH A;  1JJ8 C;  2MAB A;  4A3F J;  3FIW A;  3EYY A;  2DDB A;  4HF0 A;  4W97 A;  2LG4 A;  4BAC A;  4XOT A;  2R7O A;  3OSF A;  4D9J A;  3MMY B;  3I54 A;  1A6I A;  1LFB A;  1XGN A;  2JSC A;  3K4M A;  4HYE A;  1Q1V A;  5D5X B;  3KYD B;  1Z7U A;  2WBM A;  3CMA I;  1XSX A;  1B4A A;  3J7Z I;  2DTZ A;  4H0E A;  1Z67 A;  4M9S A;  5EG0 B;  1PYV A;  1HQC A;  5J8C A;  5E3M A;  1FWZ A;  5EEH A;  4CCJ A;  2LC2 A;  2H8W A;  4LG3 A;  2K9M A;  4RBO A;  3EQL F;  1IC8 A;  3ZMZ A;  2E7W A;  2OUM A;  4EM2 A;  5F0H A;  2ISZ A;  3RYR A;  2HDW A;  3DTI A;  4LG0 B;  4A5M A;  3CDL A;  5M3M J;  1HW1 A;  2EB7 A;  3HPG A;  3ERM A;  5CJ9 A;  4HNU A;  1P4X A;  5KAI C;  1P4W A;  2EBI A;  3PM1 A;  3FHN A;  1Z05 A;  4S05 A;  3N97 A;  1YW7 A;  1MMS A;  2DA5 A;  1U0J A;  4OOI A;  1ETK A;  2A6E F;  1NTC A;  4V2F A;  2OCE A;  1OR7 C;  2BXY A;  3FXO A;  4KJZ A;  3L2R A;  3FIS A;  5ERI A;  1W5T A;  3O8H A;  1K79 A;  2PJR B;  3WHC A;  5JHF A;  1MBH A;  1G3S A;  5JLX A;  4B44 A;  4F93 B;  3MKY B;  4PJL A;  1ZQ3 P;  4LLG F;  4UUS B;  3QRF F;  1EF4 A;  5DEQ A;  1Y56 A;  4W1U A;  3SQN A;  4RGR A;  2M1B A;  3TOA A;  2A07 F;  5E3N A;  1GVJ A;  1U2W A;  2ZC2 A;  3BR1 A;  3WE2 A;  1YE9 A;  2I5U A;  4EJO A;  2K40 A;  2M4K A;  2L4M A;  1IRX A;  1MMD A;  5FLV A;  4B48 A;  2VQL A;  1R6R A;  2A5W A;  4XN3 A;  5CLS A;  2OZU A;  3ONQ A;  2M0M A;  3ML6 A;  5E1Z B;  1RNL A;  3BR6 A;  2Y2Z A;  2HOT A;  2HVS A;  3CJR B;  4L18 B;  4IHY A;  2LBF A;  1FTZ A;  3FDY A;  4R1H A;  3E7L A;  2QZ8 A;  4BXU A;  5FB2 A;  1FX7 A;  1KZH A;  1TQM A;  1WVR A;  2FBI A;  3O3K A;  3B6C A;  1RPW A;  2VKV A;  2E1N A;  2Z3Y A;  1JTX A;  3B6A A;  3I55 I;  3SJM A;  1R1V A;  3RKW A;  3D0S A;  2FJ1 A;  2HVQ A;  3IH3 A;  3VB2 A;  3ZN0 A;  5HLI A;  1JT6 A;  3I5U A;  3QPL A;  4B47 A;  3HRT A;  1FYM A;  3G73 A;  2ZCW A;  3K4B A;  2HNH A;  4E6K G;  1YW9 A;  1RIO H;  1FSH A;  3SEZ A;  3FHZ A;  1U6G A;  5H6Q A;  1R23 A;  3DP7 A;  3PFY A;  1O3Q A;  2GXB A;  3JRD A;  3ZGK A;  3F72 A;  1LNW A;  3J80 Z;  1QZZ A;  4IHW A;  3KLO A;  2E1M C;  1VQN I;  2CUE A;  1D0X A;  2VAS A;  1JGG A;  4KIB A;  4BYY A;  2IVM A;  3OYF A;  3DBL B;  2FML A;  4FHT A;  4RB0 A;  5D5U B;  1R36 A;  4MQ9 F;  5KVR A;  3TO7 A;  3OYH A;  2P81 A;  4A12 A;  3PFI A;  3BTC A;  4A5N A;  5F1J A;  1V5E A;  2CW7 A;  2CUZ A;  3GX4 X;  3K1N A;  4E7J A;  2ZFW A;  3BDD A;  2L9N A;  4HDV A;  3BP8 A;  5AIQ A;  4ON0 A;  2LKP A;  4A3G J;  2MW8 A;  1T2K A;  4UUV A;  4XM3 A;  2KZG A;  3LSH A;  1O7F A;  1J7K A;  3DWL E;  1BW6 A;  3ZN1 A;  2LFB A;  4CCL A;  2O3F A;  2XPU A;  2ZFU A;  2JA6 J;  1VI0 A;  1QHH D;  1P7J A;  2XF5 A;  3SHF A;  5C4J J;  2DA3 A;  2A5Y B;  4IQJ A;  2X6O A;  1ZH5 A;  1RC9 A;  4UUS A;  1NK3 P;  3G1M A;  1I39 A;  3IUO A;  4WXC A;  1IO2 A;  2JVH A;  4CZC A;  4KIC A;  1BI3 A;  2DOF A;  2DOA A;  2WY7 Q;  4CCN A;  4DZJ A;  1GXP A;  3CUQ C;  1CF7 A;  4HRI A;  5A2Q K;  2UV1 A;  2UXX A;  2QF7 A;  2K5C A;  3A4C A;  1IN8 A;  3H3U A;  1WSU A;  3VYT B;  4UXN A;  2VJI A;  3F6O A;  2R7Q A;  3JTG A;  3BPV A;  2N8G A;  4I98 B;  4BE2 A;  4BY7 J;  2VBZ A;  5J4V A;  3I0T A;  1JKQ C;  2X1C A;  2PMZ N;  1V4R A;  2ZSI B;  3CLQ A;  1XB4 A;  2OZ6 A;  2KIU A;  3RZD J;  4Y17 A;  4BQN A;  3DKY A;  3D5R C;  3K4C A;  4L9J A;  3U2R A;  2DBB A;  3H0G J;  4GGG A;  4BNC A;  5B1B H;  2L7Z A;  3BC8 A;  3FXJ A;  1J59 A;  3IWZ A;  4ZZL A;  1XCB A;  1CGP A;  2RDP A;  3HEF A;  1O4X A;  5IOY A;  1J9I A;  4CA0 A;  2M87 A;  2O7O A;  2A6T A;  1QO0 D;  2DOE A;  4AWX B;  4JX5 A;  2KMU A;  1TT0 A;  3QAH A;  4U7B A;  3LFU A;  3JW4 A;  1MJA A;  4MHG A;  2E34 A;  3Q0U A;  1I3Q J;  2VBW A;  2IGK A;  1OIS A;  2EA4 A;  3LQQ A;  1DU0 A;  2FOK A;  3IRR A;  1UHS A;  4ENN A;  4AID A;  1TBX A;  1DDN A;  4A3L J;  1WQ2 A;  2L0K A;  4DYC A;  1A35 A;  5L3E A;  3QOE A;  4M74 A;  4QWQ A;  3SZG A;  1WFX A;  3C1D A;  2QEX I;  3JSO A;  2EK5 A;  3HDD A;  3Q3S A;  4MFD A;  4M6V A;  2G7H A;  5B1A H;  1BI1 A;  1ZN2 A;  2EIN H;  3K4J A;  2K85 A;  2W48 A;  1BR1 A;  3VOE A;  2AO9 A;  9ANT A;  2HYJ A;  4KIT B;  3HBL A;  4NQW B;  2RC4 A;  1X3Z B;  1X4O A;  5LFA A;  3FKI J;  1S7E A;  4AD9 A;  4MGR A;  2V1X A;  2H94 A;  2ZME C;  5E18 F;  4ZYE A;  1K4S A;  2DYR H;  5FLX Z;  3V42 A;  3L2U A;  5ED4 A;  2X1D A;  3TOB A;  3TW6 A;  4C9Y A;  4XON A;  1VFC A;  1RR7 A;  4L0Z B;  5EJC A;  1R4M B;  2CYY A;  3DPU A;  3OOP A;  3F8N A;  4EV0 A;  2LD5 A;  1R00 A;  3NRV A;  3OYB A;  5IP9 J;  2H1K A;  2VXZ A;  4Y7N J;  5LEJ A;  1U8R A;  3EET A;  3ROU A;  4ZH4 F;  3FXU A;  2M7A A;  1ZHF A;  3CCS I;  4J00 A;  2XUB A;  2DA6 A;  2ZB9 A;  4F7Z A;  3E3V A;  2A3S A;  1KON A;  1Y8Q B;  1H89 C;  1ZK8 A;  4KMU X;  3W3C A;  3G1O A;  1YIJ I;  2MA3 A;  2CFX A;  1MD0 A;  2CU7 A;  3FMR A;  2LRD A;  2MH2 A;  2M45 A;  3UNG C;  5IPA A;  4IF4 A;  3QYE A;  4U0V A;  4UVB A;  3JAM Z;  1HXD A;  2NXN B;  1RUO A;  1F5T A;  2GZW A;  3E97 A;  2EV6 A;  2EFN A;  2K4B A;  4OMZ A;  5CVJ A;  5CYV A;  1EH6 A;  1D5V A;  4BQO A;  2QVO A;  1AWC A;  1J09 A;  3W6V A;  3F9K A;  2Y0S A;  2LH9 A;  2DK5 A;  5IP7 J;  3WOD F;  2NS7 A;  2OAZ A;  1BC7 C;  2XAG A;  3TP0 A;  1HST A;  4IOA F;  5LRR A;  3RJP A;  1IG7 A;  2P0W A;  2WAQ A;  1P2F A;  3F21 A;  5F1R A;  1IW7 F;  1ENH A;  5BMZ A;  4RB1 A;  2P6S A;  4RLF A;  1U5T A;  2TDX A;  4PGG A;  2FXA A;  4RGS A;  1MH4 A;  4D0P A;  3GZN B;  1I1S A;  4CHU A;  4D7N A;  2QBY A;  1QHG A;  2O6G E;  2Q1Z B;  2R7D A;  1R58 A;  2ZXW H;  4BAY A;  4Q5S F;  5EEA A;  4YIF A;  2QUF A;  1U9N A;  1WJ5 A;  5F0F A;  3GFI A;  4S0H B;  3CLO A;  1LKX A;  1XGO A;  2PN6 A;  1I5Z A;  3LSG A;  1OLT A;  3QWL A;  4Z6Y A;  1LVA A;  1MBG A;  3GUD A;  5E20 A;  1XC5 A;  3FXK A;  2X6Y A;  4YG2 F;  4OIO F;  1HSJ A;  3R61 A;  2FF4 A;  4NDL A;  3H5N A;  3BG6 A;  4HW0 A;  3HL2 A;  3DTE A;  2Y69 H;  1A31 A;  3FXR A;  1BBY A;  1JE8 A;  2M8E A;  3B02 A;  1XD7 A;  4L5J A;  2K4J A;  1QVT A;  4BQA A;  2FU4 A;  1PUF A;  4D5C A;  2GXG A;  3AL0 B;  5HDK A;  5B5E C;  4GRI A;  1QVU A;  2LSO A;  4AIJ A;  1ZAO A;  1QZE A;  2RN7 A;  3QOD A;  2GM4 A;  2JA2 A;  4G7O F;  4BL0 B;  2VBX A;  4PFP A;  3V8K A;  4HQM A;  3GFM A;  1LVK A;  4E7H A;  4F52 A;  2WA0 A;  1BN5 A;  2EV5 A;  3OV8 A;  4NB5 A;  1X3W B;  3OMY A;  5B66 C;  1Z91 A;  1TW2 A;  2K3P A;  1WRJ A;  4QSH A;  1SD7 A;  4Q4Z F;  3MZH A;  3HOW J;  3F8C A;  3OIQ A;  2FRH A;  4OIN F;  3CD6 I;  1R5I D;  4F3Q A;  1O3S A;  2L54 A;  2EZI A;  2CWE A;  1BI0 A;  2FBH A;  2DLL A;  4DJA A;  3GO5 A;  3C7J A;  3LSI A;  4EVI A;  5HLH A;  1ZRF A;  2HEO A;  5DD4 A;  3WGH A;  1Y1W J;  1VQ6 I;  5CKT A;  2QKL B;  1B6A A;  1O3T A; 
#chains in the Genus database with same CATH homology
 1IDY A;  1XS9 A;  2XSD C;  1OFC X;  3JRE A;  3CMY A;  2Y30 A;  3TED A;  5EG0 A;  2YS9 A;  2HOS A;  1UMQ A;  1JJ8 C;  2XRL A;  4A69 C;  4A3F J;  2NS8 A;  3FIW A;  4CYC A;  1IJW C;  4W97 A;  2M2E A;  2JA7 J;  4V2G A;  4XRM A;  3HGY A;  2Y9Y A;  2LKX A;  5EZH A;  2Y0S N;  3OSF A;  1A6I A;  1LFB A;  2DMU A;  1Q1V A;  4JX6 A;  1VF9 A;  1X2M A;  1WGX A;  2DTZ A;  2WAQ N;  5EG0 B;  3OOU A;  5E3M A;  1OCT C;  2COB A;  4CYC B;  4RBO A;  1IC8 A;  1U9O A;  3S1R J;  5FKK A;  1K83 J;  2XGE A;  5F0H A;  2MGQ A;  3BQZ A;  1BA5 A;  2L9R A;  5M5Y J;  1FIA A;  3BG9 A;  3S15 J;  1X2N A;  3CDL A;  4BXX J;  2FQ4 A;  5M3M J;  2E1O A;  1T56 A;  2E19 A;  2R93 J;  1Z77 A;  2EBI A;  3PM1 A;  1W0U A;  2LTP A;  3JRF A;  2M8G X;  2DA5 A;  3TP3 A;  4EEF G;  1RKT A;  5JLW A;  4IEJ A;  2IEK A;  1ETK A;  4V2F A;  1NTC A;  3A02 A;  1JUP A;  2XB5 A;  5FKN A;  1APL C;  3A03 A;  5F04 A;  2NVT J;  1K61 A;  3FIS A;  5IP6 A;  3WHB A;  1WPK A;  2MSY A;  3O8H A;  2EH3 A;  4M3F A;  3WHC A;  3S14 J;  1MBH A;  5JLX A;  2R0Q C;  2X9D A;  3ZQI A;  1LE8 A;  3CQZ J;  1ZQ3 P;  5K7Z A;  4AUX A;  4UUS B;  1EF4 A;  3LNQ A;  2L7M P;  1GV5 A;  4W1U A;  4I76 A;  4DW6 A;  5E3N A;  3PO3 J;  3BR1 A;  1TWG J;  5C44 J;  5J3L A;  1WI3 A;  3JRI A;  2K40 A;  3S1N J;  1GDT A;  4FCY A;  1QRY A;  2M34 A;  5FLV A;  1LE8 B;  1NK2 P;  1JUM A;  4XK4 A;  1ETQ A;  1ETX A;  3LSR A;  1TWA J;  1D5Y A;  3BR6 A;  2Y2Z A;  2HOT A;  2K9Q A;  2ME6 A;  1TWH J;  1Y1V J;  4FTH A;  4IHY A;  1FTZ A;  1JUS A;  1ETV A;  3S1M J;  1DU6 A;  3E7L A;  5M5W J;  2WV1 A;  3HM5 A;  3M3Y J;  4A3M J;  2AHQ A;  4G12 A;  3BQY A;  4JYK A;  3S1Q J;  3B6C A;  2GLO A;  1ZR4 A;  1RPW A;  2VKV A;  2E2I J;  4C3H J;  3S2H J;  3BTI A;  1SFO J;  1JTX A;  1RES A;  3B6A A;  3JRH A;  3SJM A;  1GUU A;  2FJ1 A;  1Z0X A;  1MH3 A;  3IH3 A;  1JT6 A;  2R5Z A;  3QPL A;  1ETO A;  5FKM A;  1RET A;  5BNG A;  4DYR A;  2R5Y A;  3RZO J;  5IYD J;  3ZOB A;  3JR9 A;  5J1U A;  1HF0 A;  2JWT A;  3O8G A;  4A3C J;  1QPI A;  3L1P A;  2E2J J;  2ELK A;  3Q0W A;  1ZGW A;  1T33 A;  1GVD A;  4AC0 A;  3JRD A;  4MFE A;  1B72 A;  4UUT A;  2JJ7 A;  2R5Z B;  2IBD A;  2ID6 A;  3K2A A;  2X48 A;  3BR0 A;  2I10 A;  2R5Y B;  2DMP A;  1GT0 C;  4IHW A;  2OF7 A;  2CUE A;  2DMQ A;  2XGD A;  3BT9 A;  1JGG A;  1AHD P;  1ORK A;  5M5X J;  1B72 B;  5FKL A;  2NVQ J;  3H3V K;  1HDD C;  2P81 A;  5EGO B;  2VKE A;  5C3E J;  3BTC A;  5F1J A;  3UKG A;  2NVX J;  2TCT A;  5HOD A;  2D5V A;  3S16 J;  3FK6 A;  4A3G J;  2LK2 A;  2MW8 A;  4X6A J;  1X58 A;  3ZQF A;  5DS9 A;  3IH2 A;  1BW6 A;  1MSE C;  2LFB A;  2XPU A;  2JA6 J;  1VI0 A;  2LLK A;  3LSP A;  2ME0 A;  3BG3 A;  4BY1 J;  1P7J A;  5C4J J;  2DA3 A;  2B63 J;  2CJJ A;  2X6O A;  5FLM J;  5GP9 A;  4UUS A;  1HCR A;  1NK3 P;  3G1M A;  3OIO A;  2JN6 A;  1OJL A;  1OCP A;  2XB0 X;  4MLO A;  4XRS A;  1AKH A;  2NVY J;  4M3B A;  4DZJ A;  1XG1 A;  3QPS A;  2QF7 A;  1JKR C;  1UG2 A;  2E2H J;  4M3E A;  4DYQ A;  4A3I J;  2N8G A;  4Y52 J;  4BY7 J;  1AKH B;  1JKQ C;  2PMZ N;  2L7F P;  2G0E A;  2DMT A;  2XPW A;  5GPA A;  1TWC J;  3PO2 J;  1HLV A;  2JA8 J;  4QIW N;  3RZD J;  2K9N A;  1MBK A;  2WB1 N;  3H0G J;  4C3I J;  5E3O A;  2LR8 A;  1G2H A;  2L7Z A;  4I6Z A;  2FX0 A;  1MSF C;  3HEF A;  1O4X A;  5IOY A;  2M0C A;  2ID3 A;  1IV6 A;  2Y31 A;  2O7O A;  4DZP A;  4JX5 A;  1BJZ A;  4A3J J;  2O9L A;  2HI3 A;  4MIM A;  5IOZ A;  2VPR A;  3ZQL A;  5IYC J;  5F08 A;  4A3E J;  1BW5 A;  1SAN A;  4BBS J;  3Q0U A;  3GTK J;  1I3Q J;  1I50 J;  1H8A C;  1FIP A;  5EYR A;  3FK7 A;  2QCO A;  1DU0 A;  2DN0 A;  4A3B J;  1UHS A;  5K7F A;  2DMN A;  2XGC A;  1ZR2 A;  2ECB A;  5EF6 A;  5DTD A;  2CQQ A;  2HOA A;  3MVP A;  4A3L J;  2L0K A;  4GFB A;  4DYC A;  3GTM J;  3BR3 A;  2EZH A;  1I6H J;  4ABZ A;  1FJL A;  5GPC A;  2O8K A;  3JRB A;  1MBJ A;  3HDD A;  3Q3S A;  5FKO A;  4MFD A;  2HXO A;  1R9T J;  3HOZ J;  4M6V A;  2Y9Z A;  3DEW A;  2XPV A;  1JT0 A;  3VPR A;  1E3O C;  2HXI A;  1W0T A;  2W48 A;  3GTL J;  2AO9 A;  9ANT A;  2HYJ A;  4IHV A;  1IUF A;  2DJN A;  5EDN A;  3GBG A;  3HBL A;  3HKZ N;  5EGO A;  1WCM J;  3FKI J;  2CQX A;  1S7E A;  4X1E A;  3A01 A;  2VI6 A;  4MO7 A;  3RQI A;  4AYB N;  1AU7 A;  2EZK A;  2LY9 A;  1RKW A;  3TW6 A;  1IDZ A;  1VFC A;  4XIC A;  1RR7 A;  3GTG J;  1MBF A;  4L5E A;  4XID A;  3F0C A;  2LD5 A;  2FD5 A;  4J19 A;  1IRZ A;  5IP9 J;  3HOV J;  2H1K A;  1WH5 A;  4JX4 A;  3BR2 A;  3A01 B;  4Y7N J;  2KT0 A;  2LVS A;  3DCF A;  5E3L A;  4B4C A;  1YRN B;  5C4X J;  3GTJ J;  4HNV A;  1POG A;  4BKX A;  2DA6 A;  2ZB9 A;  1U8B A;  5F27 A;  1IGN A;  3IH4 A;  1H89 C;  3NAR A;  1ZK8 A;  1TC3 C;  1FTT A;  1JKP C;  5IYB J;  3G1L A;  3G1O A;  2M9H A;  4RDU A;  2IAI A;  1HOM A;  4A93 J;  2CU7 A;  3GTO J;  2ECC A;  5IPA A;  2R92 J;  2DA2 A;  2YUS A;  5J1Y A;  2MG4 A;  3HOY J;  3M4O J;  1JKO C;  4FIS A;  2JMW A;  1A5J A;  3K7A J;  3W6V A;  1P7I A;  3BR5 A;  5IP7 J;  2NS7 A;  3LOC A;  3TP0 A;  3SDG A;  4C3J J;  1IG7 A;  2GBY A;  2CUF A;  5F0C A;  1ZTR A;  5J1R A;  3S2D J;  1ENH A;  2OPT A;  2R7Z J;  3JRC A;  4M3D A;  2HDD A;  1MH4 A;  3HB9 A;  3CCY A;  2NOG A;  3GTQ J;  4D7N A;  2JK3 A;  3Q0V A;  4D5F A;  5EEA A;  2KDZ A;  1MBE A;  1U9N A;  1ZKG A;  3D1N I;  3GTP J;  3QQA A;  3TW7 A;  4LOC A;  5F0F A;  4S0H B;  1B8I A;  1ETY A;  3LSG A;  1HDP A;  2YU9 J;  1FEX A;  3ZQC A;  3BG5 A;  1MBG A;  5EZG A;  1XC5 A;  3HOX J;  4NDL A;  2H8R A;  1WH7 A;  1MNM C;  4QTR A;  1LFU P;  1VND A;  1JTY A;  5K7H A;  2LP0 A;  1GV2 A;  5FJ8 J;  4A3K J;  4B3A A;  3HOU J;  3I4M J;  1B8I B;  2DA1 A;  2EZL A;  1QVT A;  2HQ5 A;  1PUF A;  3OSG A;  3JRA A;  3BTJ A;  3SFI A;  4JP0 A;  4D5C A;  1ITY A;  1F36 A;  2VUM J;  3I4N J;  1QVU A;  3IV5 A;  3RKQ A;  1ETW A;  2CRG A;  4C2M J;  1F43 A;  2GM4 A;  3NAU A;  4D7M A;  2EQR A;  3MN2 A;  3ZQG A;  1PUF B;  3LSJ A;  3MKL A;  1U78 A;  3JRG A;  1CQT A;  4QSH A;  4IHX A;  2RAE A;  3ZQH A;  4XRS G;  3HOW J;  3HGG A;  4B1R A;  3S17 J;  2DA7 A;  2EZI A;  3BTL A;  3C2B A;  1BL0 A;  1TWF J;  2TRT A;  2DA4 A;  1JJ6 C;  2JA5 J;  1YRN A;  5M3F J;  4A3D J;  4M3G A;  1H88 C;  4FE7 A;  4BBR J;  1Y1W J;  2K9S A;  4FE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...