9ANTA

Antennapedia homeodomain-dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
56
structure length
56
Chain Sequence
RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*AP*GP*AP*AP*AP*GP*CP*CP*AP*TP*TP*AP*GP*AP*G)-3')
publication title Comparison of X-ray and NMR structures for the Antennapedia homeodomain-DNA complex.
pubmed rcsb
source organism Drosophila melanogaster
total genus 20
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 9antA00
1YRNA 3GTOJ 1X2MA 1BA5A 1AU7A 3TP0A 4BXXJ 3Q0UA 2HYJA 3LSPA 4A3JJ 3BQYA 5F27A 3SDGA 2E19A 4NDLA 4BKXA 1HLVA 1IDYA 3GBGA 4C3IJ 4BBSJ 2X9DA 4I76A 4XIDA 2JWTA 2R92J 1UG2A 1BL0A 3LSGA 4C3HJ 3JRDA 3RZDJ 1IV6A 3TEDA 4Y52J 1DU6A 2VI6A 1FIPA 4G12A 3FIWA 4QSHA 1G2HA 2DN0A 3OSGA 1WH7A 3I4MJ 1SANA 1Y1WJ 1JKPC 1MBHA 3MVPA 3HGGA 2FX0A 5BNGA 4UUSB 4CYCA 1U9OA 1ETXA 2HDDA 1WPKA 1FIAA 3GTQJ 1OCPA 2M9HA 4XRSA 2CRGA 1AKHB 1I3QJ 5F04A 1ETYA 2CQXA 3HB9A 4V2FA 2R0QC 4L5EA 1RESA 2DA2A 2HXOA 2NVXJ 1LFUP 2R5YA 4AUXA 3HM5A 2H8RA 3TP3A 2ECBA 3ZQIA 4A3LJ 3QPSA 5EGOB 2COBA 1RR7A 1FJLA 1U8BA 1I50J 4Y7NJ 4RDUA 5M5WJ 3ZQLA 4D7NA 1OJLA 5IP7J 3GTMJ 3ZQFA 2L7MP 2PMZN 5FKNA 2L9RA 3GTJJ 1IG7A 1H89C 3HOYJ 3QPLA 2X6OA 3DEWA 5IYDJ 5IP6A 4A3KJ 2JA7J 2JN6A 1TWFJ 3JRHA 4W1UA 2ID6A 3GTKJ 1WI3A 4A3EJ 2DMUA 4JYKA 3IH2A 1HF0A 1IGNA 2NS8A 2GM4A 1XS9A 5IYCJ 3PM1A 1ITYA 1OFCX 4UUSA 2AO9A 2QCOA 3BTJA 3JRAA 2XB5A 3HOVJ 3FK7A 1JT0A 3JR9A 3HKZN 2NVTJ 4BY1J 5M5XJ 3FISA 1H8AC 2LVSA 1HDDC 1ETKA 4MFDA 3JRBA 2JA8J 5M3MJ 2LR8A 3S1MJ 1ZKGA 2MG4A 1AKHA 4AC0A 1WCMJ 2DA6A 3A02A 3B6CA 1K83J 2E2JJ 3WHBA 1JT6A 1BW6A 4D5FA 4A3MJ 1Z0XA 1BW5A 3G1MA 4D5CA 2ID3A 2I10A 2MW8A 2ME6A 2EZIA 1H88C 2FQ4A 2CU7A 5JLXA 1MBJA 3A01A 5JLWA 2FJ1A 3S16J 1QRYA 2O7OA 5IOZA 1ZQ3P 4BBRJ 4DZJA 3ZQCA 5IYBJ 4XK4A 5FKMA 3HGYA 3F0CA 3L1PA 4RBOA 2YU9J 2JK3A 2XGDA 4B3AA 2HI3A 2NVQJ 2LTPA 1HCRA 1TWCJ 1MH3A 2NOGA 4BY7J 2LFBA 5E3LA 3JRGA 1R9TJ 4A3FJ 5J1YA 2YUSA 3S17J 1LE8A 2CUEA 3H0GJ 3IH4A 5FLMJ 1VI0A 2HOTA 3HBLA 1FEXA 5C4XJ 2K9SA 5F0HA 1RKTA 2DA7A 2XGEA 1JUMA 1JUSA 2M34A 1K61A 1TWGJ 3OIOA 4M3BA 1UMQA 2LD5A 3FKIJ 3G1LA 4M6VA 1TWHJ 2WAQN 2O9LA 2VPRA 2ELKA 5FJ8J 3BR1A 4A93J 5F0CA 4X1EA 3BQZA 3DCFA 2DTZA 4FISA 3LSJA 3K7AJ 1GVDA 1QVUA 2FD5A 5EZHA 2W48A 5DTDA 3ZQGA 3VPRA 2NVYJ 2DA1A 1IJWC 1MBEA 1DU0A 1VF9A 1POGA 5HODA 4XRSG 2DA3A 3IH3A 2VKVA 3HOXJ 3C2BA 5K7ZA 3JREA 2OPTA 1JKQC 4M3DA 1JKRC 1I6HJ 2Y31A 1P7JA 2DA5A 1P7IA 1ETQA 4MFEA 3BTCA 2Y9YA 2WV1A 2R5ZB 4IHVA 1Y1VJ 3A01B 2LP0A 1FTZA 4FE4A 2KT0A 3GTLJ 2XRLA 4MIMA 3Q3SA 1ZR2A 3W6VA 3S1RJ 2O8KA 4DW6A 2P81A 4C2MJ 2ECCA 1NK3P 3CCYA 3NAUA 3HOWJ 4JX6A 5EF6A 1NK2P 2Y9ZA 3HEFA 4B4CA 1APLC 2EZLA 3BR2A 2NS7A 4UUTA 1VNDA 4LOCA 3ZOBA 1LE8B 5GPCA 5GP9A 1EF4A 2HXIA 1OCTC 5J1RA 3GTPJ 4FE7A 3S15J 4X6AJ 2EZKA 1Z77A 3LOCA 2X48A 1O4XA 3BTLA 5K7HA 1ETWA 2MSYA 2LLKA 5EEAA 3JRCA 3S1QJ 2Y30A 4W97A 4C3JJ 1T56A 3RZOJ 3RQIA 3M3YJ 4MLOA 1ENHA 9ANTA 4IHXA 1GDTA 1FTTA 5C44J 1MSFC 4I6ZA 1A5JA 4M3FA 4IHWA 1B72B 2AHQA 3BG9A 4IEJA 1GV2A 3M4OJ 3CDLA 2M0CA 2EZHA 1T33A 2R5ZA 3SFIA 1NTCA 1ZGWA 3S2HJ 1TWAJ 1XC5A 1B8IB 4A3IJ 2XB0X 3WHCA 3LSRA 3D1NI 1ETVA 1S7EA 3OOUA 3OSFA 3H3VK 2XGCA 1ETOA 1X58A 3O8GA 4M3EA 3K2AA 3S1NJ 4IHYA 2DMNA 4QIWN 1BJZA 1JTXA 1RPWA 4XICA 5EG0B 2JA6J 1JUPA 2JA5J 3I4NJ 5EZGA 5C4JJ 4JX4A 1JJ6C 3S2DJ 1RETA 5IOYA 5GPAA 4DYRA 4EEFG 3JRFA 2LK2A 2IEKA 2G0EA 3BR5A 3JRIA 4S0HB 1JKOC 2TCTA 4D7MA 1Q1VA 2H1KA 4A69C 3MKLA 1U78A 1CQTA 5IP9J 5EDNA 4B1RA 1GT0C 1QPIA 2Y0SN 1LFBA 2IBDA 3MN2A 1JGGA 1MH4A 1ZTRA 2DMQA 1B72A 2WB1N 4A3BJ 3S14J 2IAIA 3PO2J 5F1JA 4DYQA 1VFCA 1IRZA 1UHSA 2CJJA 3TW6A 1W0TA 2CUFA 5DS9A 1W0UA 1IC8A 2VUMJ 5FKOA 2L0KA 1B8IA 2VKEA 2XPUA 1WGXA 2K40A 4V2GA 1A6IA 1IDZA 3IV5A 1MSEC 4A3CJ 4JX5A 2MGQA 3O8HA 1PUFB 1GV5A 2EQRA 2DJNA 5FKLA 1SFOJ 2R7ZJ 1AHDP 2B63J 1WH5A 2L7FP 1MNMC 1U9NA 3BR6A 2D5VA 2XSDC 4XRMA 4A3DJ 2M8GX 5EG0A 5M3FJ 3BR0A 1HDPA 2E2IJ 5IPAA 4GFBA 2XPWA 2K9QA 1IUFA 2HQ5A 2TRTA 5F08A 2RAEA 3BT9A 3BG5A 4DYCA 2KDZA 2DMPA 5M5YJ 4DZPA 2ME0A 1D5YA 3CMYA 3SJMA 2GLOA 1ZR4A 1GUUA 4J19A 4QTRA 3HDDA 5EYRA 2JJ7A 1JJ8C 4HNVA 1X2NA 1ZK8A 2E2HJ 1HOMA 2HOAA 4MO7A 4FTHA 5FLVA 2N8GA 3PO3J 4ABZA 3TW7A 1F43A 3B6AA 1YRNB 1QVTA 3BG3A 5J1UA 3NARA 1MBFA 5E3MA 2L7ZA 2YS9A 1F36A 3FK6A 4AYBN 1XG1A 2EBIA 2LKXA 3CQZJ 3A03A 1RKWA 2GBYA 2K9NA 5K7FA 3BTIA 3ZQHA 5F0FA 2QF7A 1PUFA 1MBKA 2M2EA 3UKGA 1TC3C 4CYCB 2EH3A 2CQQA 3BR3A 2DMTA 1E3OC 2ZB9A 2R93J 2Y2ZA 5E3OA 3HOZJ 4JP0A 1ORKA 5EGOA 3G1OA 3RKQA 4A3GJ 3GTGJ 2OF7A 3E7LA 4M3GA 1MBGA 2HOSA 4FCYA 2XPVA 2R5YB 5E3NA 2LY9A 2JMWA 3HOUJ 2E1OA 5J3LA 5C3EJ 3LNQA 2DA4A 3Q0WA 3QQAA 5FKKA 1JTYA 3Q0VA
chains in the Genus database with same CATH superfamily
5GAGJ 1HQCA 1XB4A 2JT1A 4IL6C 1HBXG 3Q0UA 2LYCA 1YJ9I 3OYIA 4A3JJ 3OS1A 3OYDA 2RVCA 5KVRA 1IDYA 4EATA 2BW3A 4ZDPA 3W2WA 5H20A 4C3IJ 1J0RA 1R1TA 1W5TA 2R92J 1UG2A 3JTHA 3I0TA 3RJPA 1MZBA 3JRDA 4Y52J 2VI6A 4UVCA 4XN0A 4DQ2A 4RLFA 2Q8KA 2EILH 1QZYA 1JKPC 5BNGA 3GEZA 1JGSA 4CHUA 2J5PA 3L00A 3OYAA 2RQQA 2DAOA 1PUEE 4I01A 1WPKA 3K4JA 4A12A 3RIRA 1OMIA 1FIAA 1OCPA 2KL4A 4C30A 2CRGA 3ZQQA 1MNEA 1I3QJ 1FBUA 3HB9A 2KRFA 4HX8A 4ESBA 4BJ6C 2PMUA 3K4MA 4CCNA 3WGGA 3RSNA 1LFUP 3BCBA 4PJNA 2JRMA 4CICA 2ECBA 3IUOA 3WGHA 3ZQIA 3QPSA 2VXDA 5H2FC 4A3LJ 1U8BA 3CO7C 3K2ZA 3ZQLA 4D7NA 1OJLA 4RAGA 3ZQFA 5FLXK 4P1WA 4AIHA 1T39A 4ZH4F 4IO9F 3QPLA 2X6OA 3GFIA 5IYDJ 4OWRB 1WJDA 1X1CA 3CLOA 3WTVC 3J7YJ 3GTKJ 1WI3A 2HVSA 4IRIA 4JYKA 3RDIA 2VODA 1HF0A 1IGNA 2K3FA 5H6QA 4HLXA 3WU0A 4RA2A 1Z91A 2MBFA 1LJ9A 4II3A 4C9YA 2EIKH 2LC2A 3AG4H 2M30A 4RM2A 2KP6A 2QCOA 3BTJA 2V1NA 3QOEA 3M9AA 3JRAA 3FK7A 5KCMA 3BDDA 2Y0MA 3HKZN 5D5VB 1H8AC 1ETKA 3RPUA 3JRBA 4E7IA 4HPQA 3KEQA 2M4KA 4L0ZB 4EJVA 5M3MJ 2LR8A 4ZTFA 4XKCA 2VOOA 3B6CA 1K83J 5F6FA 2XGXA 2CO5A 2RQPA 3MZHA 1JT6A 1YW8A 4MQVA 5CLSA 4A3MJ 3HTSB 2BXZA 3G1MA 5ERIA 4L18B 1I27A 2EV5A 2ZFWA 4FQGA 4XN3A 2HKOA 2ID3A 2I10A 1R5GA 4AIDA 2BZTA 3KP5A 1MBJA 1XMKA 3GWZA 2R7XA 2GOXB 2GQQA 4G6DA 4HG2A 1ZQ3P 5LEJA 3LA3A 4BBRJ 3ZQCA 2WV0A 3HRMA 3RCOA 4R1HA 4U0VA 2W7NA 4RBOA 2OTJI 1JI8A 2YU9J 4II2A 4EMSA 2KIUA 4ZDOA 1STZA 4B3AA 3ZMDA 1R23A 2LTPA 2BY0A 1YLFA 2NOGA 2LFBA 3F8MA 3BJ6A 1BOBA 2YUSA 4DOZA 2Z33A 2FQ3A 1RNLA 1OYWA 3CUQB 3N05A 5CJ9A 2IS2A 3H0GJ 2E1MC 1MJAA 4YG2F 2HOTA 5ICEA 3DBRB 2FUG2 2K9SA 4ZYGA 1RKTA 2DA7A 1OCOH 1X4PA 3CUOA 3OYCA 4U7BA 1SD4A 1AWCA 2LD5A 2XROA 1WFXA 3G1LA 4M6VA 1TWHJ 4LG3A 3RYRA 4E6KG 4P55A 2A69F 2GWRA 4RB2C 3BQZA 1MMNA 2XAFA 3DCFA 3K7AJ 3HUGB 2CQNA 2OCEA 1QO0D 1EA3A 1QVUA 2FD5A 2QENA 4RMNA 5DTDA 2VE8A 3I58A 2K3PA 4XLCA 2NVYJ 3GLLA 3CO6C 4N4OB 3IRQA 3IH3A 3HRSA 3C2BA 5K7ZA 3G2BA 2Y69H 4S04A 3PIPF 2OPTA 2XF6A 4I99C 2Y31A 2DT7B 1P7JA 5FRNA 3P9IA 3F6OA 2WV1A 2DPDA 1T6SA 3SFZA 4OIPF 2RNGA 3CMMA 2LP0A 4LLLA 4QPOA 2BE5F 4U87A 3J81K 4EJWA 3GTLJ 1FT9A 3T8RA 1J5YA 2YPRA 4MIMA 1TLHB 3Q3SA 4OOIA 2O8KA 2OAZA 2LDUA 2P81A 5FD5A 2DU9A 1YIOA 4C2MJ 2ECCA 1HKTA 1PP7U 3FMRA 2IA2A 4XOPA 1ACIA 1NK2P 4EGYA 1G3TA 3QU3A 4A0YA 3V7RA 1ZREA 1HW1A 3NWSA 4PGHA 2NS7A 4FASD 2Z9OA 2R7TA 1R1VA 3EYYA 2VKHA 1VNDA 3O6BB 1VQLI 3GZ6A 3ZQ7A 2DDAA 4MHGA 3X2QH 1K6YA 4FE7A 1LEAA 5E17F 4L5IA 3QOPA 2G9WA 2RNJA 2XKOA 3BTLA 2ZO4A 5K7HA 1MDMA 3HPGA 5TRDA 2IGOA 3TOAA 2R4GA 2LRDA 2CGPA 1T56A 2STWA 2FU4A 4MLOA 2VKDA 2IS1A 4M9SA 1GDTA 3SEZA 1K4TA 1PDNC 4NBQA 1MSFC 3U2RA 5LHGA 3ABUA 1WRJA 3CJQB 2DOAA 4IHWA 1G3YA 2FNAA 2D2WA 1D0YA 3CDLA 2Q2EA 4E7ZA 1MJBA 1SMYF 2OZUA 1ZG5A 2CG4A 1TWAJ 1B8IB 4RGRA 1L0OC 3WHCA 3BLYA 1YITI 1BBYA 1QZZA 2RDPA 2MABA 3D1NI 3SEQA 3H3VK 2GXGA 3OSFA 2F48A 5FFXA 3KCCA 2HS5A 3BG7A 4R79A 1USTA 5DCMB 3K2AA 2DMNA 4QIWN 1N77A 4KIBA 1ZG3A 4XQFA 1JTXA 1RPWA 5BPIA 2QQBA 4XLAA 3FM5A 4XICA 1IRGA 2OBPA 3KPHA 4KT5C 1WKMA 1JUPA 2ELJA 3I4NJ 1O3RA 1E3PA 1SVOA 3DFGA 1HW5A 4ESJA 1JJ6C 1BC8C 3HTUA 4QPQA 2BHYA 5GPAA 1IXCA 1JHHA 3V4GA 5HLIA 3BR5A 2R7OA 3H5NA 4RAZA 2NNNA 3R0AA 3JRIA 2ZJ2A 3IKVA 2YU3A 3HOTA 2VJIA 3LSIA 4A69C 3MKLA 1D8KA 4HZFA 1SAXA 5IP9J 1I1SA 3DKYA 4HNUA 2CS3A 1R5HA 3KZZA 2P5LC 4BQOA 3MN2A 4BE0A 2JVGA 4AD9A 2DMQA 2WB1N 3CZ6A 4A3BJ 2IAIA 1KU7A 2F2EA 5JHUA 1BR1A 5BOXA 2L02A 3CF5F 1KYWA 2MYSA 1IC8A 1YYVA 2DCEA 3CCJI 3BPXA 4OAZA 3H3UA 4ON0A 2VT2A 3MKWB 2VKEA 3DU6A 1WGXA 2PEXA 2Z16A 3VDXA 4V2GA 3QPHA 4WCGA 2GXBA 4A3CJ 4JX5A 2ZJRF 1XDUA 3FXJA 2BOLA 2EQRA 1YX3A 4BQNA 1PUFB 2L2OA 1SFOJ 3E6MA 4KN4X 1R1UA 1PP8F 2B9SA 4HQEA 2L7FP 1LNWA 2R7SA 2F6CA 4XRMA 4L0YB 5EG0A 5M3FJ 1IXSB 3BR0A 2E2IJ 1NG6A 4GFBA 3M8JA 3CP2A 2K9QA 1IUFA 2RV8A 2TRTA 3TO6A 3L2VA 4DYCA 4U0WA 1SVLA 1TQPA 3PNVA 4PFPA 2PLYA 1J09A 1MMAA 3MZ8A 3OR2C 5GAEJ 2ETHA 2E1CA 1GUUA 4H4KC 3G6EI 4RB3C 1X2NA 4NHJA 2R7QA 3ASOH 4LK1F 4FTHA 5FLVA 1ZGAA 1RRJA 1IRXA 2L4MA 2ZNZA 2N8GA 3CTAA 3TW7A 5B3SH 2EFQA 2P0WA 1QVTA 2QUFA 4HBLA 5J1UA 3PQJA 1QA6A 3ZR8X 4I2OA 2A07F 4CXFA 4G8XA 3E5XA 2YS9A 5E3MA 2XAHA 3MMYB 1FYKA 2PN6A 1UFMA 1U5TB 3V7CA 4AYBN 3ABLH 1REPC 1WJBA 3IWFA 1BC7C 2EBIA 3GZ5A 2LKXA 1ODDA 3CQZJ 3E6BA 2MD5A 2GBYA 5L3EA 2HOEA 2HVQA 3ZMVA 3BTIA 1XCBA 3ZQHA 4BJ5C 1XGNA 1MBKA 3JCUC 3ONQA 5AONA 1X1PA 2X51A 3SQNA 3TMOA 2DFHA 2VC1A 1P4WA 3U1DA 3MEXA 4I09A 1B9NA 3ISPA 4NUBA 3F21A 2R93J 4LJZF 3GO5A 2P7VB 2DOEA 2JPCA 2HEOA 4IRGA 1HSTA 3DTIA 4HF2A 2QQ9A 1ZELA 1OPCA 3V8JA 2OF7A 1ZRFA 5LEKA 2IPQX 3L09A 3TO7A 5E8IA 3W2AA 4AM3A 3E3VA 4EJOA 3M07A 3IAM2 2DDBA 3HOUJ 5L3FA 1G59A 5C3EJ 3ZMUA 3Q5FA 2DA4A 4WX9A 3PNTA 5LHIA 3QQAA 5FKKA 2JRTA 2KHMA 4RGSA 1FC3A 1AU7A 3TP0A 4BXXJ 3QYFA 3KYLA 3EUHA 4I02A 3LSPA 5F27A 4YFXF 2E19A 3FXLA 4QTRA 4NDLA 1W4MA 4BKXA 2CWEA 4XSXF 3W3CA 2QBYB 2NS0A 5CVVA 2JUCA 4A0ZA 1DGRM 3GBGA 4BBSJ 1BIBA 4I76A 4XIDA 3CCSI 3T0YA 3D0SA 5A2QZ 1P2FA 3LSGA 3GFMA 3TEDA 2NOJB 4G12A 4QSHA 1Y6IA 3N4MA 2VXZA 1EH6A 3OSGA 1WH7A 3QPTA 4DIQA 2HR3A 3MVPA 4GO1A 4UUSB 2MD0A 2HPIA 1R4NB 2R7RA 4EJTA 3C2HA 5DM6F 4P9UA 2ZFUA 2PJRB 2FEZA 5B1BH 4AIJA 3REOA 4GXOA 2KQRA 2V26A 3CDHA 1XMXA 1QBJA 3A4CA 1DUXC 1KYZA 4Q48A 3HIFA 3ZN1A 5F04A 2WBMA 4ZC3A 1AKHB 1XSDA 2CQXA 4V2FA 2EFPA 5JHFA 2ZMEB 1RESA 4EVIA 4WK8F 2P7CB 3DBLB 1ONVA 3OYEA 1WHUA 2R5YA 4AUXA 3HM5A 4M71A 3TP3A 4A6DA 4JK1X 2M7BA 1IRFA 4KJZA 1DQUA 1FJLA 1VQ5I 3C3WA 3F6VA 1I50J 5CKTA 5M5WJ 1UJ8A 5D4RA 4WXCA 3BZKA 5IP7J 2V1XA 3HSRA 4X0GA 3WTUC 3LAJA 3O3KA 1SVMA 2HU9A 1E0EA 3CCLI 3CC7I 2MA3A 3DEWA 1F9NA 4HYEA 1K4SA 1S7OA 2JN6A 5EJCA 1TWFJ 3C7JA 4W1UA 2DK8A 2ID6A 1C0WA 1SD5A 2DMUA 5KNLA 1P4XA 3DTEA 1W7PB 2E5ZA 3L2CA 3FHNA 2QLZA 2GM4A 1KQ9A 1G8XA 3LMMA 3HHHA 2A5YB 2JSCA 4B8XA 2HDCA 2LH9A 1OFCX 2OQGA 1SFKA 1CF7A 2AO9A 1S5LC 1H9TA 1JT0A 1DPRA 2NXNB 2M3AA 1W5CC 3E97A 5M5XJ 1HDDC 3ZCOA 4YIFA 4MFDA 3H5AA 3KLOA 2HZDA 2W4SA 3GLXA 3E5QA 5FRMA 3S1MJ 2MG4A 2JVHA 1TT0A 3W6KB 3BPVA 1VQKI 3A02A 3MKZA 4BNCA 2UUZA 1ZGJA 3DP7A 5ICGA 1VQ7I 1MMSA 3WHBA 4IHTA 1BW6A 4D5FA 1XX5A 1Y39A 2QKMB 1D5VA 1V5FA 4PDKA 4D5CA 2MW8A 3TQNA 4N0BA 2FBKA 2CU7A 2F4MB 4GYGA 1FNNA 3L2RA 5JLWA 3PUBA 1QRYA 5IOZA 4RB1A 4DZJA 5IYBJ 2WWYA 1Y0UA 2A61A 2F5DA 3L1PA 4FX4A 1Z05A 3UR3C 2EIMH 2DT5A 3HRTA 2XGDA 4IOAF 4R8HA 3VSKA 2NVQJ 2MH9A 1TWCJ 5LHHA 3K70C 1MH3A 2L9NA 4BY7J 3WTYC 3P7NA 2CUZA 1S8NA 4A3FJ 3BG6A 5J1YA 1FOXA 1SAUA 5CPRB 2CUEA 1MJ9A 4HOBA 1VQ6I 4OIOF 3IH4A 2KDOA 1YW7A 3HBLA 1FMWA 2UZKA 5C4XJ 4XM3A 4RAFA 3ZN0A 4IPAA 1JUMA 4IOCF 1JUSA 2CQKA 2X85A 3OIOA 3H0DA 1KONA 1K61A 2RC4A 1X3WB 1UMQA 3MQ0A 3GCMA 4B3XA 2XAQA 3WG7H 3RYPA 3BR1A 4B44A 1WWXA 4X1EA 2VJ5A 1UHWA 2DTZA 4FISA 2RKHA 3LSJA 1GVDA 2OUMA 3L9FA 1XN7A 2EA2A 2ESHA 2CW8A 2W48A 2JSPA 3QWLA 4ENNA 3VPRA 1SFXA 2V9PA 2F4IA 4NB5A 4UB8C 4KFCA 2DA1A 1DU0A 2A68F 3ABMH 4ASNA 1POGA 5HODA 3BC8A 2DA3A 3FXRA 2L9SA 5DYMA 2EWNA 5E1ZB 3W2VA 2WAEA 3K4LA 3LSHA 1YI2I 3M1EA 2D45A 1JKQC 1JKRC 3W6JB 5HDKA 2MC4A 1P7IA 2JA2A 3BTCA 2KFDA 2R5ZB 1H0MA 1Y1VJ 4IHVA 4YIRX 2ZXWH 3MAJA 2DW4A 2JZYA 4BHBA 2Z99A 3EUHC 4XSZF 2KT0A 3CP8A 3ZGKA 1G3SA 1ZR2A 3L2WA 3NRVA 4HX7A 3S1RJ 3K4NA 3D5RC 2EB7A 1Y0NA 3DPTA 3T5XA 3HOWJ 3OV8A 1NH3A 2D1VA 2VBZA 1Q1HA 3HEFA 1ZRDA 4UUTA 2RN7A 1QQIA 2LKSA 5FO5A 1TL8A 3A2KA 4LOCA 1LE8B 5GPCA 3CCQI 3F22A 1EF4A 4EGZA 2VT3A 3AAFA 4M6YA 4FHTA 2VQCA 2EZKA 3DV8A 2EINH 2IW5A 2IVMA 2ICWG 1V4RA 4ZYAA 3IP4B 2XC7A 3HSFA 5EEAA 2LREA 1UCRA 1UZCA 4F7ZA 4F3QA 1TP4A 3M3YJ 1G3WA 2OV7A 2LF7A 1YG2A 1FP1D 3T1BA 2HQNA 5D6FA 4AVZA 1A5JA 2BVMA 3HPHA 3HYIA 3H35A 1I3AA 2AHQA 1EH8A 3IKTA 4M73A 1JHFA 2H6CA 4AU7A 4U7DA 3J80K 1NTCA 2ISYA 1F5TA 2DXIA 3D5LA 3S2HJ 6PAXA 3OYNA 3PQKA 4A3IJ 2XB0X 5LRRA 2CYYA 2LBFA 3I64A 4BACA 3I9V2 3P5JA 3OOUA 3J7ZI 4I7HA 1ETOA 4XL9A 2ZSIB 2LKPA 3O8GA 4M3EA 4NNJA 4G7ZF 3DU5A 3PJRA 1O7LA 4LITA 4QWQA 2A3SA 3S1NJ 4IHYA 2W1OA 3B02A 3E6CC 3JSPA 1DPUA 1J7KA 2CQ7A 3JAMZ 1ON2A 4E7HA 2CFXA 4ETSA 2NNYA 2M45A 3HXLA 3KZYA 2KIMA 1UELB 2O61A 4JX4A 2AS5F 4IX7A 5IT9Z 1FX7A 4DYRA 4EEFG 1EV7A 2LNBA 2M0MA 3EYIA 3ZMTA 2LY2A 3ERMA 3CC4I 3MKYB 3KX2A 5J40A 4D7MA 5JR3A 3GFJA 5JFRA 1Q1VA 2MC3A 5DD8A 5DCFA 2UV1A 4UXNA 5J6XA 2ZBKA 4LIVA 5HS9A 2ESNA 3DWLE 1OLTA 3BP8A 1GT0C 4HX4A 2Y0SN 1R58A 4P5OA 1XGOA 3CCVI 1FBSA 1YS6A 2MFZA 2KJCA 1B72A 4OIQF 3KP6A 3VODA 1VQ9I 3S14J 1J9IA 2IA1A 3ELKA 5B5EC 5F1JA 1T08B 4E7JA 1IRZA 2CJJA 2BY3A 3DEEA 1W0TA 3G73A 5DS9A 1J2XA 2EFWA 2EA4A 1XGSA 1WI9A 4CGZA 2BY1A 2W57A 2KKOA 4UB6C 2E1MB 2GA2A 2QSGX 3GFLA 2ZXIA 5K5RA 2CSOA 3ECOA 5FKLA 3VWBA 2BYVE 4V19K 3KFWX 4MEYF 2B63J 3RPQA 2D5VA 3CCEI 3BR6A 2IS4A 2GIVA 2IGNA 2XSDC 4HSTA 1VQNI 2M8GX 3S3NA 4XLFA 4N9IA 2PJPA 4XLPF 1DGWY 2HQ5A 2X6YA 4BEHA 1L3LA 2VPLA 2F4OB 3ROUA 2QYOA 4IHSA 2CW0F 5B66C 2KDZA 2DMPA 3BZCA 4DZPA 1D5YA 3SDBA 1IN8A 2GOMA 2JTVA 4I0AA 3I59A 2JUGA 2FRHA 3FXQA 4KYWA 3K70D 1U2WA 1U0JA 1JJ8C 3FXOA 2DQRA 1HOMA 2K85A 1QHHD 4MEXF 2H6BA 1T38A 5DDGA 4LG0A 4UV8A 1IN4A 3KIOA 3PO3J 5CYVA 1TQIA 4B43A 5HNFA 3DPUA 2WY8Q 2XRNA 1RR8C 1FPQA 3M8EA 3ZPLA 3E5UA 2YR2A 1MBFA 5HNHA 3H36A 1BI0A 1QZEA 2M87A 2BW3B 2WADA 4BQAA 2H8WA 1YIJI 4UVAA 2DPUA 4OAYA 3CJRB 1XG1A 3WE3A 1HSJA 5D8KB 3I5UA 2PJRA 1YFHA 3S3MA 1BM9A 4L9VA 4M74A 3WG9A 3F23A 2DFFA 2DTRA 2NAZA 1TC3C 1SD6A 1IW7F 4UVBA 3HHGA 2EH3A 2CQQA 1FYLA 1SFEA 1E3OC 3A0BC 2V6CA 2Y2ZA 4PZJA 3H9JA 4CO8A 5E3OA 3CD6I 1ORKA 2M5WA 3R6SA 3EUKL 5FLXZ 2E35A 5FFZA 1YE9A 3OYKA 3E7LA 3RI4A 3GTGJ 4OINF 4M3GA 1MBGA 3PFYA 2HOSA 3NWTA 4E7LA 4P9FA 4FCYA 5E1WA 5E3NA 2VJ4A 2F5VA 2E1OA 1SEUA 3MFKA 5J3LA 4KUMA 2EFNA 4TV7A 1V54H 2QGUA 4G7HF 5KAFC 5CVUA 1IV6A 1VF9A 5LLQA 4CCOA 3S1QJ 1HKQA 2FX0A 1G4DA 4C2TA 2O3FA 4NC7A 3PSFA 2R7FA 4G94A 4BHPA 1YRNA 3GTOJ 1X2MA 2HYJA 2FBHA 2E1NA 3BQYA 1YS7A 4E7KA 3ML6A 1HLVA 2DLLA 4M9XA 2PMZA 1RUOA 4XLNF 3ZMZA 2JWTA 1I39A 1XD7A 3I56I 1BL0A 1I1GA 3FMQA 3RZDJ 1FIPA 1ZN2A 3FIWA 3LA7A 1Z67A 3J7AO 3LSMA 4GYIA 2A05A 1XDSA 3FMSA 2HWVA 5DD4A 4NQWA 1KQ0A 4LK0F 1K6OA 1MBHA 3QYBA 5D4SA 5EEGA 4CYCA 3LFKA 1T8IA 2R7DA 1X1BA 1ETXA 1XSVA 3C1DA 3E1SA 3KYCB 1ZH5A 1WJAA 4A2UA 1GHCA 2V4JC 2HTSA 2HDDA 2LF8A 2ZJQF 2XUBA 4L9TA 2LG4A 2EV0A 1WZ2A 1N25A 1EH7A 2FSWA 3N97A 2X6XA 1YW9A 4WXHA 1N78A 2OCCH 1R22A 1LVAA 2E34A 4BE2A 5L3CA 2K4JA 3I4PA 1BJAA 2DA2A 5ICFA 3OYHA 2B0LA 2UXNA 3HC7A 1LDKB 2HXOA 3PFIA 4B48A 1HKSA 5GAHJ 2NVXJ 3M1CA 2V1UA 4HF0A 3VYUB 4HF1A 4HNTA 1OKRA 5EGOB 3PUFA 3WTSC 3MCZA 5BMZA 3WTTC 3GTMJ 5FKNA 4PK4A 5J47A 1MMDA 3DKWA 3R61A 3FKJA 3L2UA 3FHZA 2J5OA 3OR1C 1H89C 3HOYJ 2ZSHB 1T98A 2IT0A 4XRFA 2IA0A 3QODA 3JRHA 4KNYA 3WU1B 4CA0A 4A3EJ 5HDNA 3K1NA 2L4AA 3OWTA 3IH2A 2HPMA 3OYMA 3TOBA 4PFOA 5B1AH 4KN7X 1RZ4A 1XS9A 1O3TA 2H27A 3PM1A 2XASA 1Z7LA 2M1BA 2KIFA 4UV9A 2XB5A 3HOVJ 1XPXA 4IF4A 3JR9A 4BXFA 2PMHA 2NVTJ 3QU6A 3D5SC 4ZZDA 4XR6A 1FY7A 2OU2A 1OCCH 2JA8J 4KIGA 3EPZA 1ZKGA 1ZG1A 1D0XA 4AC0A 3SHFA 4DBQA 2BVLA 1BOAA 3QP6A 4CZZA 3J7AY 4LB6B 1BW5A 4ANJA 1YJWI 2WAQA 1KU3A 4CH7A 5ILVA 4GCVA 3CMAI 4WWCA 3R4KA 2ME6A 2EZIA 1H88C 3J81Z 2PG4A 1Z3XA 2K4BA 3RKWA 1BR4A 2FMYA 2DT6A 1TW3A 1LKXA 3OMYA 4ITVA 4E4HA 3O2PE 3G4SI 2A6TA 2WB1A 5ILSA 4ZDLA 3DTKA 3CCRI 5IY5H 3HGYA 3F0CA 3GUDA 2XSJC 1BN5A 4J01A 4IZZA 1QU3A 4LIUA 3V7SA 2OTLI 2W24A 1RUNA 2JK3A 4QLCU 3FXKA 2UWMA 4N9HA 2ZCWA 1XGMA 2HI3A 1TW2A 1FZPB 1W36C 1FLIA 1HCRA 1TQMA 3AG3H 1P4AA 1SD7A 3H1CA 5E3LA 1R49A 4F55A 4PSXA 1R9TJ 1GXPA 1J75A 4ENMA 1FWZA 1LE8A 3L7WA 1YQAA 5FLMJ 2OC6A 1VI0A 3CJTB 5E79C 4BDZA 1FOKA 2VONA 3GYHX 5F0HA 4JBAA 4XLEA 2FMLA 3AL0B 2V9KA 2M34A 1TWGJ 1LEBA 4HSRA 4IVNA 4ZJZA 1YJNI 2FF4A 4HAMA 4HV6A 2O9LA 2ELKA 5FJ8J 4LD5A 4HRIA 4A93J 4UNOA 3V42A 2XKPA 1MDMB 2A5WA 4AIKA 1BI3A 4G6TB 1LDJA 1KZHA 2XAUA 4OU0A 1SC7A 5FB2A 2L5QA 2R7VA 2X6WA 5EZHA 3ZQGA 1BR2A 5E20A 2LOOA 2H94A 4GGGA 2HFHA 2BV6A 1MBEA 2VN2A 3SZTA 2KISA 4XRSG 4BUPA 1MW7A 5GTHC 3AG2H 1PVEA 1I6HJ 4KT6A 3F3XA 4F92B 4L9JA 4CCKA 2Q2EB 2Y9YA 3IRRA 4ZYDA 3A01B 3K1PA 3RKYA 4AYBA 2ZKZA 5AIPA 1FTZA 2HZTA 4FE4A 3IWZA 2XRLA 5J8CA 1PYVA 4DW6A 3ULQB 3CUQA 3OL3A 4BQQA 3IL2A 3NAUA 4JX6A 4XORA 1S6LA 5EF6A 1K7AA 4FETA 2AQEA 4B4CA 2TDXA 2EZLA 2R3SA 2M4GA 3BR2A 1M1EB 1Y56A 2C6YA 2A6EF 4M9ZA 1ULYA 1ZHFA 2NVUB 2BGCA 3A1YA 4PSWA 3U21A 3ZOBA 4U88A 1IZ1A 2HXIA 5J1RA 2I5UA 3GTPJ 2PX9A 3K9TA 5IT9K 3LOCA 2E7XA 4KISA 3EETA 3GF2A 3KETA 3HUGA 1ETWA 4PGGA 2MSYA 2HTJA 2Y75A 2RREA 4LFUA 4PJMA 2Y30A 1D0ZA 4C3JJ 3RZOJ 3RQIA 2MLKA 2IGMA 2FNPA 2VQHA 1FTTA 2RGVA 3FZVA 5JVTA 3BCAA 3KP7A 3BG9A 4IEJA 1GV2A 2ZC2A 5D6EA 1IO2A 2M0CA 3OYJA 2K27A 5L3GA 1LQ1A 3SFIA 1WJFA 1ZGWA 1Y8QB 1MNDA 2PBIA 3RQ4A 2O03A 2O0YA 4FT8A 1MD0A 5HLGA 3LSRA 3CLQA 1USSA 3DLAA 2QVOA 1ETVA 1S7EA 1D1AA 2XGCA 1X58A 2K9LA 3V8LA 1V55H 4F52A 5FGMA 3ZXSA 3DLLF 5GTIC 1KA8A 4ENJA 3Q9SA 1LUJB 5K1YA 2KZVA 3VYTB 5EG0B 2JA6J 5H6RA 3EDPA 4D1QA 1WJEA 2D1HA 1U6GA 1ZLKA 5IOYA 2FOWA 5D8LB 4YELA 2IEKA 2LMDA 5KHDA 1OCZH 2G0EA 3I71A 2KLOA 3ECHA 4OMZA 4S0HB 2R7UA 1JKOC 2TCTA 2Q1ZB 2P6TA 4HQMA 2H1KA 2P5VA 4O3MA 4BU2A 2ISZA 4KIFA 3ASNH 2QQAA 5HOOA 5EDNA 3NEUA 4B1RA 4MTEA 1QPIA 2IBDA 1JGGA 1MH4A 4B47A 1ZTRA 1IUYA 3OS0A 3K1MA 1X19A 2XF5A 2L3DA 4IXAA 3PO2J 4UY8I 2E71A 1A31A 4CDGA 3DBHB 4MNUA 1E2XA 1VFCA 3TW6A 2VBYA 2CUFA 1W0UA 2VUMJ 5FKOA 2L0KA 5LRSA 4RS8A 1I5ZA 1XTAA 3HOSA 1B8IA 2X1DA 4EJUA 1F1ZA 2XPUA 3F8NA 1R71A 2K40A 3T8TA 1IDZA 1A6IA 4IJAA 5HLHA 3IV5A 4XONA 1MSEC 1BI1A 1GV5A 3I54A 1LPQA 5DCMA 2CW7A 3C2GA 2R7ZJ 1AHDP 3GZNB 1WH5A 2Z3YA 3BJAA 2F5CA 1LB2A 4K2EA 4F91B 1MNMC 5TISC 2O8XA 4A3DJ 2O6GE 4CZCA 1HDPA 3WTXC 3LWFA 5IPAA 2KRCA 3BZ6A 3DKXA 5F08A 2RAEA 3OY9A 1IN7A 1OYIA 1WVRA 5M5YJ 2XDVA 2ME0A 2IXSA 1VTNC 4O5VA 3SJMA 3QRFF 4HEA2 3OYFA 4N4NB 2GLOA 1X1AA 1KQ8A 5HS7A 3TDZC 3OOPA 1ZR4A 3KP4A 4LLNA 1AA7A 4J19A 1W36D 1TBXA 3HDDA 3PSIA 5CQEA 1DP7P 2AXLA 2PFBA 1ZK8A 2HOAA 4MO7A 5ICCA 1OQYA 4IRHA 1S29A 1R4MB 1RC9A 2HYGD 1OR7A 4D9JA 4ZTJA 4KICA 3RTRA 1TTYA 1SFUA 1F43A 2EJRA 3HG9A 2HDWA 1R7JA 3NARA 2Q0OA 4H0EA 3SYTA 2L7ZA 2ACJA 2CV1A 4O6JA 1F36A 5DUKA 3R60A 3QYEA 3BJOA 2DQLA 4KDPA 3WODF 2DOFA 3TGNA 5CVRA 4RB0A 3A03A 3VYRB 1RKWA 5CVIA 4EQQA 2K9NA 2L54A 4EM1A 5J4YA 2P5KA 2DODA 4L5JA 5CVJA 1ERDA 5F0FA 2QF7A 1X1DA 1PUFA 3WE2A 2M2EA 4IQJA 3H5RA 3UKGA 3I55I 3KP2A 1O3QA 4BH9A 2JPBA 2ELHA 4UUVA 3CUQC 3B73A 2F5EA 2ZB9A 2XVCA 4EM2A 4PUSA 2DI3A 3LFUA 2IP2A 1EKEA 2WTEA 3L2QA 5EGOA 3RKQA 1W7PD 4XOTA 2IGKA 4E7SA 2YSRA 3VEPA 2XPVA 2I8DA 4Y15A 2R5YB 3M7GA 3PIOF 4WXDA 2DBBA 2LY9A 5IT3A 1D3YA 4ZYEA 3LNQA 2CMPA 2QA4I 3ABKH 3U1KA 1XMAA 4BGDA 1ZLJA 1YHQI 1JTYA 1Z21A 1BA5A 1UG0A 1I6XA 2AQFA 2W85A 3FDYA 1V5GA 4CCJA 3SDGA 1V5EA 2P8TA 2HYFA 2VBXA 5TJJA 3KYDB 1NG7A 1R6RA 1U5TA 3IHUA 2X9DA 2CV0A 1B6AA 4XMYA 4C3HJ 4Q4ZF 1G2HA 1DU6A 3F9KA 2STTA 3R0JA 3JW4A 4E70A 4Y33A 4WF2A 1S7AA 3OS2A 2DN0A 3I4MJ 1FOYA 1SANA 1Y1WJ 3HGGA 1CF7B 2VJJA 1U9OA 3ZRGA 3PL8A 3VOEA 3FWEA 2VL8A 3GXOA 1TNTA 1VQMI 1WSUA 2QKLB 4RAYA 3LSTA 1BIAA 2VB6A 1MMGA 3GTQJ 5HLTA 2M9HA 3DEUA 1Z6RA 4XRSA 1ETYA 3HKZA 1QGPA 2HQRA 2K9MA 4XNFA 4CCMA 1Z3YA 2YX7A 3RKXA 1B9MA 2XHKA 5J4VA 2R0QC 4L5EA 3LQRA 1K78B 1VQ4I 1S72I 1IV8A 1KU9A 4CYDA 2MLGA 2H8RA 1FMVA 4Z2YA 1LDDA 3UNGC 2OA4A 2COBA 1RR7A 2QM3A 3F8FA 2YX4A 1R00A 2FE3A 3FXMA 4Y7NJ 4RDUA 1ZRCA 2CFOA 1IN5A 4GDFA 2W84A 2L7MP 2PMZN 2L9RA 1P9QC 3CMEI 3GTJJ 1IG7A 2K7LA 2QZ8A 3KP3A 1P6RA 4ENKA 2HVRA 2A6HF 4RGXA 5IP6A 4A3KJ 2GXAA 2JA7J 1AOYA 2EPFA 3K6GA 3OIPA 2QBYA 2Z1DA 4Y17A 1YOVB 2CV2A 2XIGA 3HL2A 5LBQA 2OQRA 2E36A 2E5NA 3E0JB 2NS8A 1B59A 4BJTA 2R7WA 4YFNF 5JI6A 4OMYA 1HA8A 5IYCJ 1D1BA 1F4KA 4F93B 1Z9CA 1ITYA 1QPMA 3S8PA 5D5UB 1T0FA 3H9GA 4UUSA 2VE9A 4BS9A 2CUJA 5DEQA 3GVAA 2MH2A 2PQ8A 3P9KA 3G3ZA 4BY1J 2Z5UA 5LGNA 2IRFG 3FISA 2LVSA 5A2QK 2WC2A 3GMEA 5LD2C 1IAWA 3QP5A 3MD2A 2DK5A 3FBIB 2JQ7A 1YTYA 1AKHA 1O3SA 1WCMJ 2DA6A 5E8GA 3IC7A 2W00A 4DGWB 2V7FA 4BAYA 2ZMEA 2E2JJ 4AVPA 2W25A 5FROA 3ABTA 5K5QA 3HRUA 4S05A 1Z0XA 1VZ0A 1Y8RB 2QSHX 5D5WB 4Y4RA 1IF1A 3HSEA 1A35A 2FQ4A 2M8EA 1K79A 2X1CA 5JLXA 3TDUC 4HDVA 3A01A 2HKXA 2FJ1A 2Y0SA 3S16J 1H9GA 2O7OA 2VQGA 5HVQC 5BPDA 2QWWA 1OR7C 4XK4A 1V3FA 5FKMA 2K02A 5E18F 1GXQA 1KU2A 3CESA 4LLGF 1VQPI 1XCVA 1FSEA 1MGTA 3Q9VA 4DNCA 2HGCA 1YX5A 1KGSA 1W7PA 1FBQA 1G6NA 2PI0A 5CQGA 2WY7Q 2DYSH 4I0BA 4ZYHA 3WGIA 2BHZA 3JSOA 2DYRH 3JRGA 3LAPA 1VQ8I 3DQVC 4KITB 3S17J 1S3JA 1T2KA 1WJCA 5F1RA 1D1CA 3FF5A 2E60A 4A6EA 1FEXA 1QNTA 4A5MA 3I3LA 5K5OA 2XGEA 3EUAA 1O57A 1Z6TA 2DO7A 4HLYA 4M3BA 1E3HA 2G7UA 3FKIJ 3TBIA 2WAQN 5JVGF 2X1EA 4D0PA 2FOKA 1WQ2A 2OZ6A 2VPRA 5F0CA 4HV5A 2P4WA 2M7AA 1QHGA 3LA2A 3G71I 4XKBA 4RGUA 3J80Z 3LQQA 3WTWC 2QEXI 1U8RA 3VFZA 1MKMA 2GA1A 1IJWC 5DV5A 2GIZA 2BEOA 2F5FA 2VKVA 3HOXJ 3TKYA 3JREA 4XBFA 2KPMA 1GVJA 4M3DA 2KZGA 4Q5SF 2DA5A 4HDUA 1ETQA 2B7EA 4MFEA 3BWGA 3OYLA 1IN6A 1TT5B 5EEHA 2LSOA 2VOPA 5KK1A 5LGUA 2LBFB 1WJ5A 1U5TC 1ZARA 3W6VA 3FXUA 1OISA 4Y13A 3FM3A 3MZYA 2VBWA 2L9VA 5BQTA 1NK3P 3CCYA 4NC8A 5BS6A 1PJRA 2FXAA 1W5SA 2E7WA 2Y9ZA 4NC6A 3FBNB 3JTGA 1APLC 5ILUA 4PJLA 4BDYA 2HQAA 3S3OA 2ZXJA 3H3ZA 2ZXHA 1TNSA 3VSLA 5GP9A 4BE1A 1OCTC 3S15J 2WAFA 4X6AJ 3S93A 1Z77A 3BY6A 2X48A 3DPLC 4AWXB 1O4XA 1B4AA 1RIOH 1UAAA 2LLKA 4CSWA 3JRCA 4A5NA 1B1BA 4W97A 4IQ4A 4BL0B 1E17A 3V8KA 1ZAOA 3WTZA 1XSXA 2GAUA 1ENHA 9ANTA 4IHXA 1S9HA 2LY1A 1A6QA 2H09A 4KMUX 4G9YA 5C44J 4BXUA 4I6ZA 3TO9A 2V6EA 1IXRC 4M3FA 1B72B 4XLHA 4G6QA 4A0XA 3M4OJ 2EZHA 1T33A 1X3UA 2R5ZA 4U0YA 1XC5A 1BI2A 4BYYA 5AIQA 3HZJA 4RLQA 4XKVA 3SZGA 1MIJA 3K0LA 2NRAC 2XAGA 4HA8A 1HC8A 1T95A 1VQOI 5GADJ 2ZNYA 3K4BA 1OYYA 2V9VA 4YIIA 2EV6A 3F8CA 1BJZA 3AL0C 3KZIC 5L3DA 2JA5J 1T0FC 2EK5A 4LGWA 1HW2A 2EIJH 4J00A 5EZGA 4BEHB 3KEOA 1LVKA 2X0LA 3A0HC 4PJ0C 5C4JJ 3S2DJ 1RETA 1Z1DA 3S32A 3ERED 3K4CA 2FA5A 4G7OF 3JRFA 1P92A 3K69A 3E6DA 2LK2A 2ZJPF 4KMFA 4OIRF 1FYMA 3I59B 4LMYA 2IS6A 1FSHA 4HW0A 5E1XA 2DFIA 5DM7F 4Z6YA 4BHCA 4GRIA 1U78A 1CQTA 2ZMEC 3QAHA 3GX4X 4EV0A 2IJLA 4LG0B 4Y3OA 5L3BA 4PJJA 1A04A 3CCMI 2EFOA 3GW2A 1LFBA 1ZYRF 3CCUI 3PNYA 2VLAA 5TGTA 2VIXA 1D8JA 4P96A 1CGPA 4DYQA 3BOQA 3K4KA 1UHSA 4I98B 1HXDA 2COMA 2OJED 3FX3A 1UHMA 2WA0A 3EQLF 3WU2C 2KIQA 1J59A 2QSFX 2UXXA 2K86A 3CF2A 3TL4X 4ZZLA 3SXYA 4FX0A 3SZPA 2G7HA 2O5RA 2MGQA 3O8HA 2W82A 3NQOA 2DJNA 3OYBA 1U3EM 5F64A 4IKFA 3K10A 1TZLA 1U9NA 4DJAA 2DJIA 1UB9A 1NHAA 3BROA 4XKWA 4ESFA 3ZP5A 2K5CA 1SMTA 2XPWA 3F72A 3OYGA 1A36A 1LFPA 1N75A 2L01A 4CUGA 3BT9A 1ON1A 5DUIA 4YRVA 3BG5A 1FOWA 1DDNA 4MQ9F 3CMYA 4M6XA 4RM3A 2OD5A 2X4HA 2QQ8A 5ED4A 1Z7UA 3M8FA 3JAMK 5HS8A 2XF7A 3DXJF 3H9QA 1GLNA 1O7FA 1R5ID 3CDIA 2JJ7A 3AG1H 5EYRA 4HNVA 2E2HJ 5FD6A 3P9CA 1X3ZB 2V79A 4B09A 3AKZA 1JXSA 3MWMA 4DBRA 2XV4S 4MTDA 2P6SA 4ABZA 5D5XB 3RPUD 2FBIA 3KLNA 3B6AA 4JOMA 1YRNB 3BG3A 1W1WE 2BBYA 4YEJA 4CCLA 2AXTC 1R36A 3AFHA 2ADUA 3S2WA 4UHTA 3LSKA 5LGTA 4EM0B 3FK6A 1YO5C 2H1LA 4YFKF 4PCQA 4M72A 4LB5A 2HNHA 5LFAA 2KMUA 1FP2A 2BXYA 5K7FA 3OL4A 1EJ9A 3C18A 3DF8A 3CJNA 3VYSB 5J8FA 4NQWB 1OCRH 4CYCB 2XAJA 3ESWB 2KJBA 3CC2I 3ZMSA 2BY2A 2VQLA 1RI7A 2DMTA 3BR3A 3KEYA 4L9NA 1K78A 5KAIC 3HJEA 3HOZJ 2GZWA 2KRHA 2NYXA 3IAS2 4MGRA 4JP0A 3G1OA 2Z2SB 4A3GJ 2V1DA 4KA4A 1DP3A 3U9GA 3OIQA 1X4OA 3COAC 2VASA 1JE8A 2L7KA 2Y48A 3KE2A 2VC0A 4JQFA 4C2UA 3H92A 3VB2A 3LL7A 3I53A 2CH0A 4Q47A 2JMWA 2DFEA 3Q0WA 5HDGA 3F8BA 3Q0VA
chains in the Genus database with same CATH topology
1YRNA 3GTOJ 1X2MA 1BA5A 1AU7A 3TP0A 4BXXJ 3Q0UA 2HYJA 3LSPA 4A3JJ 3BQYA 5F27A 3SDGA 2E19A 4NDLA 4BKXA 1HLVA 1IDYA 3GBGA 4C3IJ 4BBSJ 2X9DA 4I76A 4XIDA 2JWTA 2R92J 1UG2A 1BL0A 3LSGA 4C3HJ 3JRDA 3RZDJ 1IV6A 3TEDA 4Y52J 1DU6A 2VI6A 1FIPA 4G12A 3FIWA 4QSHA 1G2HA 2DN0A 3OSGA 1WH7A 3I4MJ 1SANA 1Y1WJ 1JKPC 1MBHA 3MVPA 3HGGA 2FX0A 5BNGA 4UUSB 4CYCA 1U9OA 1ETXA 2HDDA 1WPKA 1FIAA 3GTQJ 1OCPA 2M9HA 4XRSA 2CRGA 1AKHB 1I3QJ 5F04A 1ETYA 2CQXA 3HB9A 4V2FA 2R0QC 4L5EA 1RESA 2DA2A 2HXOA 2NVXJ 1LFUP 2R5YA 4AUXA 3HM5A 2H8RA 3TP3A 2ECBA 3ZQIA 4A3LJ 3QPSA 5EGOB 2COBA 1RR7A 1FJLA 1U8BA 1I50J 4Y7NJ 4RDUA 5M5WJ 3ZQLA 4D7NA 1OJLA 5IP7J 3GTMJ 3ZQFA 2L7MP 2PMZN 5FKNA 2L9RA 3GTJJ 1IG7A 1H89C 3HOYJ 3QPLA 2X6OA 3DEWA 5IYDJ 5IP6A 4A3KJ 2JA7J 2JN6A 1TWFJ 3JRHA 4W1UA 2ID6A 3GTKJ 1WI3A 4A3EJ 2DMUA 4JYKA 3IH2A 1HF0A 1IGNA 2NS8A 2GM4A 1XS9A 5IYCJ 3PM1A 1ITYA 1OFCX 4UUSA 2AO9A 2QCOA 3BTJA 3JRAA 2XB5A 3HOVJ 3FK7A 1JT0A 3JR9A 3HKZN 2NVTJ 4BY1J 5M5XJ 3FISA 1H8AC 2LVSA 1HDDC 1ETKA 4MFDA 3JRBA 2JA8J 5M3MJ 2LR8A 3S1MJ 1ZKGA 2MG4A 1AKHA 4AC0A 1WCMJ 2DA6A 3A02A 3B6CA 1K83J 2E2JJ 3WHBA 1JT6A 1BW6A 4D5FA 4A3MJ 1Z0XA 1BW5A 3G1MA 4D5CA 2ID3A 2I10A 2MW8A 2ME6A 2EZIA 1H88C 2FQ4A 2CU7A 5JLXA 1MBJA 3A01A 5JLWA 2FJ1A 3S16J 1QRYA 2O7OA 5IOZA 1ZQ3P 4BBRJ 4DZJA 3ZQCA 5IYBJ 4XK4A 5FKMA 3HGYA 3F0CA 3L1PA 4RBOA 2YU9J 2JK3A 2XGDA 4B3AA 2HI3A 2NVQJ 2LTPA 1HCRA 1TWCJ 1MH3A 2NOGA 4BY7J 2LFBA 5E3LA 3JRGA 1R9TJ 4A3FJ 5J1YA 2YUSA 3S17J 1LE8A 2CUEA 3H0GJ 3IH4A 5FLMJ 1VI0A 2HOTA 3HBLA 1FEXA 5C4XJ 2K9SA 5F0HA 1RKTA 2DA7A 2XGEA 1JUMA 1JUSA 2M34A 1K61A 1TWGJ 3OIOA 4M3BA 1UMQA 2LD5A 3FKIJ 3G1LA 4M6VA 1TWHJ 2WAQN 2O9LA 2VPRA 2ELKA 5FJ8J 3BR1A 4A93J 5F0CA 4X1EA 3BQZA 3DCFA 2DTZA 4FISA 3LSJA 3K7AJ 1GVDA 1QVUA 2FD5A 5EZHA 2W48A 5DTDA 3ZQGA 3VPRA 2NVYJ 2DA1A 1IJWC 1MBEA 1DU0A 1VF9A 1POGA 5HODA 4XRSG 2DA3A 3IH3A 2VKVA 3HOXJ 3C2BA 5K7ZA 3JREA 2OPTA 1JKQC 4M3DA 1JKRC 1I6HJ 2Y31A 1P7JA 2DA5A 1P7IA 1ETQA 4MFEA 3BTCA 2Y9YA 2WV1A 2R5ZB 4IHVA 1Y1VJ 3A01B 2LP0A 1FTZA 4FE4A 2KT0A 3GTLJ 2XRLA 4MIMA 3Q3SA 1ZR2A 3W6VA 3S1RJ 2O8KA 4DW6A 2P81A 4C2MJ 2ECCA 1NK3P 3CCYA 3NAUA 3HOWJ 4JX6A 5EF6A 1NK2P 2Y9ZA 3HEFA 4B4CA 1APLC 2EZLA 3BR2A 2NS7A 4UUTA 1VNDA 4LOCA 3ZOBA 1LE8B 5GPCA 5GP9A 1EF4A 2HXIA 1OCTC 5J1RA 3GTPJ 4FE7A 3S15J 4X6AJ 2EZKA 1Z77A 3LOCA 2X48A 1O4XA 3BTLA 5K7HA 1ETWA 2MSYA 2LLKA 5EEAA 3JRCA 3S1QJ 2Y30A 4W97A 4C3JJ 1T56A 3RZOJ 3RQIA 3M3YJ 4MLOA 1ENHA 9ANTA 4IHXA 1GDTA 1FTTA 5C44J 1MSFC 4I6ZA 1A5JA 4M3FA 4IHWA 1B72B 2AHQA 3BG9A 4IEJA 1GV2A 3M4OJ 3CDLA 2M0CA 2EZHA 1T33A 2R5ZA 3SFIA 1NTCA 1ZGWA 3S2HJ 1TWAJ 1XC5A 1B8IB 4A3IJ 2XB0X 3WHCA 3LSRA 3D1NI 1ETVA 1S7EA 3OOUA 3OSFA 3H3VK 2XGCA 1ETOA 1X58A 3O8GA 4M3EA 3K2AA 3S1NJ 4IHYA 2DMNA 4QIWN 1BJZA 1JTXA 1RPWA 4XICA 5EG0B 2JA6J 1JUPA 2JA5J 3I4NJ 5EZGA 5C4JJ 4JX4A 1JJ6C 3S2DJ 1RETA 5IOYA 5GPAA 4DYRA 4EEFG 3JRFA 2LK2A 2IEKA 2G0EA 3BR5A 3JRIA 4S0HB 1JKOC 2TCTA 4D7MA 1Q1VA 2H1KA 4A69C 3MKLA 1U78A 1CQTA 5IP9J 5EDNA 4B1RA 1GT0C 1QPIA 2Y0SN 1LFBA 2IBDA 3MN2A 1JGGA 1MH4A 1ZTRA 2DMQA 1B72A 2WB1N 4A3BJ 3S14J 2IAIA 3PO2J 5F1JA 4DYQA 1VFCA 1IRZA 1UHSA 2CJJA 3TW6A 1W0TA 2CUFA 5DS9A 1W0UA 1IC8A 2VUMJ 5FKOA 2L0KA 1B8IA 2VKEA 2XPUA 1WGXA 2K40A 4V2GA 1A6IA 1IDZA 3IV5A 1MSEC 4A3CJ 4JX5A 2MGQA 3O8HA 1PUFB 1GV5A 2EQRA 2DJNA 5FKLA 1SFOJ 2R7ZJ 1AHDP 2B63J 1WH5A 2L7FP 1MNMC 1U9NA 3BR6A 2D5VA 2XSDC 4XRMA 4A3DJ 2M8GX 5EG0A 5M3FJ 3BR0A 1HDPA 2E2IJ 5IPAA 4GFBA 2XPWA 2K9QA 1IUFA 2HQ5A 2TRTA 5F08A 2RAEA 3BT9A 3BG5A 4DYCA 2KDZA 2DMPA 5M5YJ 4DZPA 2ME0A 1D5YA 3CMYA 3SJMA 2GLOA 1ZR4A 1GUUA 4J19A 4QTRA 3HDDA 5EYRA 2JJ7A 1JJ8C 4HNVA 1X2NA 1ZK8A 2E2HJ 1HOMA 2HOAA 4MO7A 4FTHA 5FLVA 2N8GA 3PO3J 4ABZA 3TW7A 1F43A 3B6AA 1YRNB 1QVTA 3BG3A 5J1UA 3NARA 1MBFA 5E3MA 2L7ZA 2YS9A 1F36A 3FK6A 4AYBN 1XG1A 2EBIA 2LKXA 3CQZJ 3A03A 1RKWA 2GBYA 2K9NA 5K7FA 3BTIA 3ZQHA 5F0FA 2QF7A 1PUFA 1MBKA 2M2EA 3UKGA 1TC3C 4CYCB 2EH3A 2CQQA 3BR3A 2DMTA 1E3OC 2ZB9A 2R93J 2Y2ZA 5E3OA 3HOZJ 4JP0A 1ORKA 5EGOA 3G1OA 3RKQA 4A3GJ 3GTGJ 2OF7A 3E7LA 4M3GA 1MBGA 2HOSA 4FCYA 2XPVA 2R5YB 5E3NA 2LY9A 2JMWA 3HOUJ 2E1OA 5J3LA 5C3EJ 3LNQA 2DA4A 3Q0WA 3QQAA 5FKKA 1JTYA 3Q0VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YRN A;  3GTO J;  1X2M A;  1BA5 A;  1AU7 A;  3TP0 A;  4BXX J;  3Q0U A;  2HYJ A;  3LSP A;  4A3J J;  3BQY A;  5F27 A;  3SDG A;  2E19 A;  4NDL A;  4BKX A;  1HLV A;  1IDY A;  3GBG A;  4C3I J;  4BBS J;  2X9D A;  4I76 A;  4XID A;  2JWT A;  2R92 J;  1UG2 A;  1BL0 A;  3LSG A;  4C3H J;  3JRD A;  3RZD J;  1IV6 A;  3TED A;  4Y52 J;  1DU6 A;  2VI6 A;  1FIP A;  4G12 A;  3FIW A;  4QSH A;  1G2H A;  2DN0 A;  3OSG A;  1WH7 A;  3I4M J;  1SAN A;  1Y1W J;  1JKP C;  1MBH A;  3MVP A;  3HGG A;  2FX0 A;  5BNG A;  4UUS B;  4CYC A;  1U9O A;  1ETX A;  2HDD A;  1WPK A;  1FIA A;  3GTQ J;  1OCP A;  2M9H A;  4XRS A;  2CRG A;  1AKH B;  1I3Q J;  5F04 A;  1ETY A;  2CQX A;  3HB9 A;  4V2F A;  2R0Q C;  4L5E A;  1RES A;  2DA2 A;  2HXO A;  2NVX J;  1LFU P;  2R5Y A;  4AUX A;  3HM5 A;  2H8R A;  3TP3 A;  2ECB A;  3ZQI A;  4A3L J;  3QPS A;  5EGO B;  2COB A;  1RR7 A;  1FJL A;  1U8B A;  1I50 J;  4Y7N J;  4RDU A;  5M5W J;  3ZQL A;  4D7N A;  1OJL A;  5IP7 J;  3GTM J;  3ZQF A;  2L7M P;  2PMZ N;  5FKN A;  2L9R A;  3GTJ J;  1IG7 A;  1H89 C;  3HOY J;  3QPL A;  2X6O A;  3DEW A;  5IYD J;  5IP6 A;  4A3K J;  2JA7 J;  2JN6 A;  1TWF J;  3JRH A;  4W1U A;  2ID6 A;  3GTK J;  1WI3 A;  4A3E J;  2DMU A;  4JYK A;  3IH2 A;  1HF0 A;  1IGN A;  2NS8 A;  2GM4 A;  1XS9 A;  5IYC J;  3PM1 A;  1ITY A;  1OFC X;  4UUS A;  2AO9 A;  2QCO A;  3BTJ A;  3JRA A;  2XB5 A;  3HOV J;  3FK7 A;  1JT0 A;  3JR9 A;  3HKZ N;  2NVT J;  4BY1 J;  5M5X J;  3FIS A;  1H8A C;  2LVS A;  1HDD C;  1ETK A;  4MFD A;  3JRB A;  2JA8 J;  5M3M J;  2LR8 A;  3S1M J;  1ZKG A;  2MG4 A;  1AKH A;  4AC0 A;  1WCM J;  2DA6 A;  3A02 A;  3B6C A;  1K83 J;  2E2J J;  3WHB A;  1JT6 A;  1BW6 A;  4D5F A;  4A3M J;  1Z0X A;  1BW5 A;  3G1M A;  4D5C A;  2ID3 A;  2I10 A;  2MW8 A;  2ME6 A;  2EZI A;  1H88 C;  2FQ4 A;  2CU7 A;  5JLX A;  1MBJ A;  3A01 A;  5JLW A;  2FJ1 A;  3S16 J;  1QRY A;  2O7O A;  5IOZ A;  1ZQ3 P;  4BBR J;  4DZJ A;  3ZQC A;  5IYB J;  4XK4 A;  5FKM A;  3HGY A;  3F0C A;  3L1P A;  4RBO A;  2YU9 J;  2JK3 A;  2XGD A;  4B3A A;  2HI3 A;  2NVQ J;  2LTP A;  1HCR A;  1TWC J;  1MH3 A;  2NOG A;  4BY7 J;  2LFB A;  5E3L A;  3JRG A;  1R9T J;  4A3F J;  5J1Y A;  2YUS A;  3S17 J;  1LE8 A;  2CUE A;  3H0G J;  3IH4 A;  5FLM J;  1VI0 A;  2HOT A;  3HBL A;  1FEX A;  5C4X J;  2K9S A;  5F0H A;  1RKT A;  2DA7 A;  2XGE A;  1JUM A;  1JUS A;  2M34 A;  1K61 A;  1TWG J;  3OIO A;  4M3B A;  1UMQ A;  2LD5 A;  3FKI J;  3G1L A;  4M6V A;  1TWH J;  2WAQ N;  2O9L A;  2VPR A;  2ELK A;  5FJ8 J;  3BR1 A;  4A93 J;  5F0C A;  4X1E A;  3BQZ A;  3DCF A;  2DTZ A;  4FIS A;  3LSJ A;  3K7A J;  1GVD A;  1QVU A;  2FD5 A;  5EZH A;  2W48 A;  5DTD A;  3ZQG A;  3VPR A;  2NVY J;  2DA1 A;  1IJW C;  1MBE A;  1DU0 A;  1VF9 A;  1POG A;  5HOD A;  4XRS G;  2DA3 A;  3IH3 A;  2VKV A;  3HOX J;  3C2B A;  5K7Z A;  3JRE A;  2OPT A;  1JKQ C;  4M3D A;  1JKR C;  1I6H J;  2Y31 A;  1P7J A;  2DA5 A;  1P7I A;  1ETQ A;  4MFE A;  3BTC A;  2Y9Y A;  2WV1 A;  2R5Z B;  4IHV A;  1Y1V J;  3A01 B;  2LP0 A;  1FTZ A;  4FE4 A;  2KT0 A;  3GTL J;  2XRL A;  4MIM A;  3Q3S A;  1ZR2 A;  3W6V A;  3S1R J;  2O8K A;  4DW6 A;  2P81 A;  4C2M J;  2ECC A;  1NK3 P;  3CCY A;  3NAU A;  3HOW J;  4JX6 A;  5EF6 A;  1NK2 P;  2Y9Z A;  3HEF A;  4B4C A;  1APL C;  2EZL A;  3BR2 A;  2NS7 A;  4UUT A;  1VND A;  4LOC A;  3ZOB A;  1LE8 B;  5GPC A;  5GP9 A;  1EF4 A;  2HXI A;  1OCT C;  5J1R A;  3GTP J;  4FE7 A;  3S15 J;  4X6A J;  2EZK A;  1Z77 A;  3LOC A;  2X48 A;  1O4X A;  3BTL A;  5K7H A;  1ETW A;  2MSY A;  2LLK A;  5EEA A;  3JRC A;  3S1Q J;  2Y30 A;  4W97 A;  4C3J J;  1T56 A;  3RZO J;  3RQI A;  3M3Y J;  4MLO A;  1ENH A;  9ANT A;  4IHX A;  1GDT A;  1FTT A;  5C44 J;  1MSF C;  4I6Z A;  1A5J A;  4M3F A;  4IHW A;  1B72 B;  2AHQ A;  3BG9 A;  4IEJ A;  1GV2 A;  3M4O J;  3CDL A;  2M0C A;  2EZH A;  1T33 A;  2R5Z A;  3SFI A;  1NTC A;  1ZGW A;  3S2H J;  1TWA J;  1XC5 A;  1B8I B;  4A3I J;  2XB0 X;  3WHC A;  3LSR A;  3D1N I;  1ETV A;  1S7E A;  3OOU A;  3OSF A;  3H3V K;  2XGC A;  1ETO A;  1X58 A;  3O8G A;  4M3E A;  3K2A A;  3S1N J;  4IHY A;  2DMN A;  4QIW N;  1BJZ A;  1JTX A;  1RPW A;  4XIC A;  5EG0 B;  2JA6 J;  1JUP A;  2JA5 J;  3I4N J;  5EZG A;  5C4J J;  4JX4 A;  1JJ6 C;  3S2D J;  1RET A;  5IOY A;  5GPA A;  4DYR A;  4EEF G;  3JRF A;  2LK2 A;  2IEK A;  2G0E A;  3BR5 A;  3JRI A;  4S0H B;  1JKO C;  2TCT A;  4D7M A;  1Q1V A;  2H1K A;  4A69 C;  3MKL A;  1U78 A;  1CQT A;  5IP9 J;  5EDN A;  4B1R A;  1GT0 C;  1QPI A;  2Y0S N;  1LFB A;  2IBD A;  3MN2 A;  1JGG A;  1MH4 A;  1ZTR A;  2DMQ A;  1B72 A;  2WB1 N;  4A3B J;  3S14 J;  2IAI A;  3PO2 J;  5F1J A;  4DYQ A;  1VFC A;  1IRZ A;  1UHS A;  2CJJ A;  3TW6 A;  1W0T A;  2CUF A;  5DS9 A;  1W0U A;  1IC8 A;  2VUM J;  5FKO A;  2L0K A;  1B8I A;  2VKE A;  2XPU A;  1WGX A;  2K40 A;  4V2G A;  1A6I A;  1IDZ A;  3IV5 A;  1MSE C;  4A3C J;  4JX5 A;  2MGQ A;  3O8H A;  1PUF B;  1GV5 A;  2EQR A;  2DJN A;  5FKL A;  1SFO J;  2R7Z J;  1AHD P;  2B63 J;  1WH5 A;  2L7F P;  1MNM C;  1U9N A;  3BR6 A;  2D5V A;  2XSD C;  4XRM A;  4A3D J;  2M8G X;  5EG0 A;  5M3F J;  3BR0 A;  1HDP A;  2E2I J;  5IPA A;  4GFB A;  2XPW A;  2K9Q A;  1IUF A;  2HQ5 A;  2TRT A;  5F08 A;  2RAE A;  3BT9 A;  3BG5 A;  4DYC A;  2KDZ A;  2DMP A;  5M5Y J;  4DZP A;  2ME0 A;  1D5Y A;  3CMY A;  3SJM A;  2GLO A;  1ZR4 A;  1GUU A;  4J19 A;  4QTR A;  3HDD A;  5EYR A;  2JJ7 A;  1JJ8 C;  4HNV A;  1X2N A;  1ZK8 A;  2E2H J;  1HOM A;  2HOA A;  4MO7 A;  4FTH A;  5FLV A;  2N8G A;  3PO3 J;  4ABZ A;  3TW7 A;  1F43 A;  3B6A A;  1YRN B;  1QVT A;  3BG3 A;  5J1U A;  3NAR A;  1MBF A;  5E3M A;  2L7Z A;  2YS9 A;  1F36 A;  3FK6 A;  4AYB N;  1XG1 A;  2EBI A;  2LKX A;  3CQZ J;  3A03 A;  1RKW A;  2GBY A;  2K9N A;  5K7F A;  3BTI A;  3ZQH A;  5F0F A;  2QF7 A;  1PUF A;  1MBK A;  2M2E A;  3UKG A;  1TC3 C;  4CYC B;  2EH3 A;  2CQQ A;  3BR3 A;  2DMT A;  1E3O C;  2ZB9 A;  2R93 J;  2Y2Z A;  5E3O A;  3HOZ J;  4JP0 A;  1ORK A;  5EGO A;  3G1O A;  3RKQ A;  4A3G J;  3GTG J;  2OF7 A;  3E7L A;  4M3G A;  1MBG A;  2HOS A;  4FCY A;  2XPV A;  2R5Y B;  5E3N A;  2LY9 A;  2JMW A;  3HOU J;  2E1O A;  5J3L A;  5C3E J;  3LNQ A;  2DA4 A;  3Q0W A;  3QQA A;  5FKK A;  1JTY A;  3Q0V A; 
#chains in the Genus database with same CATH topology
 5GAG J;  1HQC A;  1XB4 A;  2JT1 A;  4IL6 C;  1HBX G;  3Q0U A;  2LYC A;  1YJ9 I;  3OYI A;  4A3J J;  3OS1 A;  3OYD A;  2RVC A;  5KVR A;  1IDY A;  4EAT A;  2BW3 A;  4ZDP A;  3W2W A;  5H20 A;  4C3I J;  1J0R A;  1R1T A;  1W5T A;  2R92 J;  1UG2 A;  3JTH A;  3I0T A;  3RJP A;  1MZB A;  3JRD A;  4Y52 J;  2VI6 A;  4UVC A;  4XN0 A;  4DQ2 A;  4RLF A;  2Q8K A;  2EIL H;  1QZY A;  1JKP C;  5BNG A;  3GEZ A;  1JGS A;  4CHU A;  2J5P A;  3L00 A;  3OYA A;  2RQQ A;  2DAO A;  1PUE E;  4I01 A;  1WPK A;  3K4J A;  4A12 A;  3RIR A;  1OMI A;  1FIA A;  1OCP A;  2KL4 A;  4C30 A;  2CRG A;  3ZQQ A;  1MNE A;  1I3Q J;  1FBU A;  3HB9 A;  2KRF A;  4HX8 A;  4ESB A;  4BJ6 C;  2PMU A;  3K4M A;  4CCN A;  3WGG A;  3RSN A;  1LFU P;  3BCB A;  4PJN A;  2JRM A;  4CIC A;  2ECB A;  3IUO A;  3WGH A;  3ZQI A;  3QPS A;  2VXD A;  5H2F C;  4A3L J;  1U8B A;  3CO7 C;  3K2Z A;  3ZQL A;  4D7N A;  1OJL A;  4RAG A;  3ZQF A;  5FLX K;  4P1W A;  4AIH A;  1T39 A;  4ZH4 F;  4IO9 F;  3QPL A;  2X6O A;  3GFI A;  5IYD J;  4OWR B;  1WJD A;  1X1C A;  3CLO A;  3WTV C;  3J7Y J;  3GTK J;  1WI3 A;  2HVS A;  4IRI A;  4JYK A;  3RDI A;  2VOD A;  1HF0 A;  1IGN A;  2K3F A;  5H6Q A;  4HLX A;  3WU0 A;  4RA2 A;  1Z91 A;  2MBF A;  1LJ9 A;  4II3 A;  4C9Y A;  2EIK H;  2LC2 A;  3AG4 H;  2M30 A;  4RM2 A;  2KP6 A;  2QCO A;  3BTJ A;  2V1N A;  3QOE A;  3M9A A;  3JRA A;  3FK7 A;  5KCM A;  3BDD A;  2Y0M A;  3HKZ N;  5D5V B;  1H8A C;  1ETK A;  3RPU A;  3JRB A;  4E7I A;  4HPQ A;  3KEQ A;  2M4K A;  4L0Z B;  4EJV A;  5M3M J;  2LR8 A;  4ZTF A;  4XKC A;  2VOO A;  3B6C A;  1K83 J;  5F6F A;  2XGX A;  2CO5 A;  2RQP A;  3MZH A;  1JT6 A;  1YW8 A;  4MQV A;  5CLS A;  4A3M J;  3HTS B;  2BXZ A;  3G1M A;  5ERI A;  4L18 B;  1I27 A;  2EV5 A;  2ZFW A;  4FQG A;  4XN3 A;  2HKO A;  2ID3 A;  2I10 A;  1R5G A;  4AID A;  2BZT A;  3KP5 A;  1MBJ A;  1XMK A;  3GWZ A;  2R7X A;  2GOX B;  2GQQ A;  4G6D A;  4HG2 A;  1ZQ3 P;  5LEJ A;  3LA3 A;  4BBR J;  3ZQC A;  2WV0 A;  3HRM A;  3RCO A;  4R1H A;  4U0V A;  2W7N A;  4RBO A;  2OTJ I;  1JI8 A;  2YU9 J;  4II2 A;  4EMS A;  2KIU A;  4ZDO A;  1STZ A;  4B3A A;  3ZMD A;  1R23 A;  2LTP A;  2BY0 A;  1YLF A;  2NOG A;  2LFB A;  3F8M A;  3BJ6 A;  1BOB A;  2YUS A;  4DOZ A;  2Z33 A;  2FQ3 A;  1RNL A;  1OYW A;  3CUQ B;  3N05 A;  5CJ9 A;  2IS2 A;  3H0G J;  2E1M C;  1MJA A;  4YG2 F;  2HOT A;  5ICE A;  3DBR B;  2FUG 2;  2K9S A;  4ZYG A;  1RKT A;  2DA7 A;  1OCO H;  1X4P A;  3CUO A;  3OYC A;  4U7B A;  1SD4 A;  1AWC A;  2LD5 A;  2XRO A;  1WFX A;  3G1L A;  4M6V A;  1TWH J;  4LG3 A;  3RYR A;  4E6K G;  4P55 A;  2A69 F;  2GWR A;  4RB2 C;  3BQZ A;  1MMN A;  2XAF A;  3DCF A;  3K7A J;  3HUG B;  2CQN A;  2OCE A;  1QO0 D;  1EA3 A;  1QVU A;  2FD5 A;  2QEN A;  4RMN A;  5DTD A;  2VE8 A;  3I58 A;  2K3P A;  4XLC A;  2NVY J;  3GLL A;  3CO6 C;  4N4O B;  3IRQ A;  3IH3 A;  3HRS A;  3C2B A;  5K7Z A;  3G2B A;  2Y69 H;  4S04 A;  3PIP F;  2OPT A;  2XF6 A;  4I99 C;  2Y31 A;  2DT7 B;  1P7J A;  5FRN A;  3P9I A;  3F6O A;  2WV1 A;  2DPD A;  1T6S A;  3SFZ A;  4OIP F;  2RNG A;  3CMM A;  2LP0 A;  4LLL A;  4QPO A;  2BE5 F;  4U87 A;  3J81 K;  4EJW A;  3GTL J;  1FT9 A;  3T8R A;  1J5Y A;  2YPR A;  4MIM A;  1TLH B;  3Q3S A;  4OOI A;  2O8K A;  2OAZ A;  2LDU A;  2P81 A;  5FD5 A;  2DU9 A;  1YIO A;  4C2M J;  2ECC A;  1HKT A;  1PP7 U;  3FMR A;  2IA2 A;  4XOP A;  1ACI A;  1NK2 P;  4EGY A;  1G3T A;  3QU3 A;  4A0Y A;  3V7R A;  1ZRE A;  1HW1 A;  3NWS A;  4PGH A;  2NS7 A;  4FAS D;  2Z9O A;  2R7T A;  1R1V A;  3EYY A;  2VKH A;  1VND A;  3O6B B;  1VQL I;  3GZ6 A;  3ZQ7 A;  2DDA A;  4MHG A;  3X2Q H;  1K6Y A;  4FE7 A;  1LEA A;  5E17 F;  4L5I A;  3QOP A;  2G9W A;  2RNJ A;  2XKO A;  3BTL A;  2ZO4 A;  5K7H A;  1MDM A;  3HPG A;  5TRD A;  2IGO A;  3TOA A;  2R4G A;  2LRD A;  2CGP A;  1T56 A;  2STW A;  2FU4 A;  4MLO A;  2VKD A;  2IS1 A;  4M9S A;  1GDT A;  3SEZ A;  1K4T A;  1PDN C;  4NBQ A;  1MSF C;  3U2R A;  5LHG A;  3ABU A;  1WRJ A;  3CJQ B;  2DOA A;  4IHW A;  1G3Y A;  2FNA A;  2D2W A;  1D0Y A;  3CDL A;  2Q2E A;  4E7Z A;  1MJB A;  1SMY F;  2OZU A;  1ZG5 A;  2CG4 A;  1TWA J;  1B8I B;  4RGR A;  1L0O C;  3WHC A;  3BLY A;  1YIT I;  1BBY A;  1QZZ A;  2RDP A;  2MAB A;  3D1N I;  3SEQ A;  3H3V K;  2GXG A;  3OSF A;  2F48 A;  5FFX A;  3KCC A;  2HS5 A;  3BG7 A;  4R79 A;  1UST A;  5DCM B;  3K2A A;  2DMN A;  4QIW N;  1N77 A;  4KIB A;  1ZG3 A;  4XQF A;  1JTX A;  1RPW A;  5BPI A;  2QQB A;  4XLA A;  3FM5 A;  4XIC A;  1IRG A;  2OBP A;  3KPH A;  4KT5 C;  1WKM A;  1JUP A;  2ELJ A;  3I4N J;  1O3R A;  1E3P A;  1SVO A;  3DFG A;  1HW5 A;  4ESJ A;  1JJ6 C;  1BC8 C;  3HTU A;  4QPQ A;  2BHY A;  5GPA A;  1IXC A;  1JHH A;  3V4G A;  5HLI A;  3BR5 A;  2R7O A;  3H5N A;  4RAZ A;  2NNN A;  3R0A A;  3JRI A;  2ZJ2 A;  3IKV A;  2YU3 A;  3HOT A;  2VJI A;  3LSI A;  4A69 C;  3MKL A;  1D8K A;  4HZF A;  1SAX A;  5IP9 J;  1I1S A;  3DKY A;  4HNU A;  2CS3 A;  1R5H A;  3KZZ A;  2P5L C;  4BQO A;  3MN2 A;  4BE0 A;  2JVG A;  4AD9 A;  2DMQ A;  2WB1 N;  3CZ6 A;  4A3B J;  2IAI A;  1KU7 A;  2F2E A;  5JHU A;  1BR1 A;  5BOX A;  2L02 A;  3CF5 F;  1KYW A;  2MYS A;  1IC8 A;  1YYV A;  2DCE A;  3CCJ I;  3BPX A;  4OAZ A;  3H3U A;  4ON0 A;  2VT2 A;  3MKW B;  2VKE A;  3DU6 A;  1WGX A;  2PEX A;  2Z16 A;  3VDX A;  4V2G A;  3QPH A;  4WCG A;  2GXB A;  4A3C J;  4JX5 A;  2ZJR F;  1XDU A;  3FXJ A;  2BOL A;  2EQR A;  1YX3 A;  4BQN A;  1PUF B;  2L2O A;  1SFO J;  3E6M A;  4KN4 X;  1R1U A;  1PP8 F;  2B9S A;  4HQE A;  2L7F P;  1LNW A;  2R7S A;  2F6C A;  4XRM A;  4L0Y B;  5EG0 A;  5M3F J;  1IXS B;  3BR0 A;  2E2I J;  1NG6 A;  4GFB A;  3M8J A;  3CP2 A;  2K9Q A;  1IUF A;  2RV8 A;  2TRT A;  3TO6 A;  3L2V A;  4DYC A;  4U0W A;  1SVL A;  1TQP A;  3PNV A;  4PFP A;  2PLY A;  1J09 A;  1MMA A;  3MZ8 A;  3OR2 C;  5GAE J;  2ETH A;  2E1C A;  1GUU A;  4H4K C;  3G6E I;  4RB3 C;  1X2N A;  4NHJ A;  2R7Q A;  3ASO H;  4LK1 F;  4FTH A;  5FLV A;  1ZGA A;  1RRJ A;  1IRX A;  2L4M A;  2ZNZ A;  2N8G A;  3CTA A;  3TW7 A;  5B3S H;  2EFQ A;  2P0W A;  1QVT A;  2QUF A;  4HBL A;  5J1U A;  3PQJ A;  1QA6 A;  3ZR8 X;  4I2O A;  2A07 F;  4CXF A;  4G8X A;  3E5X A;  2YS9 A;  5E3M A;  2XAH A;  3MMY B;  1FYK A;  2PN6 A;  1UFM A;  1U5T B;  3V7C A;  4AYB N;  3ABL H;  1REP C;  1WJB A;  3IWF A;  1BC7 C;  2EBI A;  3GZ5 A;  2LKX A;  1ODD A;  3CQZ J;  3E6B A;  2MD5 A;  2GBY A;  5L3E A;  2HOE A;  2HVQ A;  3ZMV A;  3BTI A;  1XCB A;  3ZQH A;  4BJ5 C;  1XGN A;  1MBK A;  3JCU C;  3ONQ A;  5AON A;  1X1P A;  2X51 A;  3SQN A;  3TMO A;  2DFH A;  2VC1 A;  1P4W A;  3U1D A;  3MEX A;  4I09 A;  1B9N A;  3ISP A;  4NUB A;  3F21 A;  2R93 J;  4LJZ F;  3GO5 A;  2P7V B;  2DOE A;  2JPC A;  2HEO A;  4IRG A;  1HST A;  3DTI A;  4HF2 A;  2QQ9 A;  1ZEL A;  1OPC A;  3V8J A;  2OF7 A;  1ZRF A;  5LEK A;  2IPQ X;  3L09 A;  3TO7 A;  5E8I A;  3W2A A;  4AM3 A;  3E3V A;  4EJO A;  3M07 A;  3IAM 2;  2DDB A;  3HOU J;  5L3F A;  1G59 A;  5C3E J;  3ZMU A;  3Q5F A;  2DA4 A;  4WX9 A;  3PNT A;  5LHI A;  3QQA A;  5FKK A;  2JRT A;  2KHM A;  4RGS A;  1FC3 A;  1AU7 A;  3TP0 A;  4BXX J;  3QYF A;  3KYL A;  3EUH A;  4I02 A;  3LSP A;  5F27 A;  4YFX F;  2E19 A;  3FXL A;  4QTR A;  4NDL A;  1W4M A;  4BKX A;  2CWE A;  4XSX F;  3W3C A;  2QBY B;  2NS0 A;  5CVV A;  2JUC A;  4A0Z A;  1DGR M;  3GBG A;  4BBS J;  1BIB A;  4I76 A;  4XID A;  3CCS I;  3T0Y A;  3D0S A;  5A2Q Z;  1P2F A;  3LSG A;  3GFM A;  3TED A;  2NOJ B;  4G12 A;  4QSH A;  1Y6I A;  3N4M A;  2VXZ A;  1EH6 A;  3OSG A;  1WH7 A;  3QPT A;  4DIQ A;  2HR3 A;  3MVP A;  4GO1 A;  4UUS B;  2MD0 A;  2HPI A;  1R4N B;  2R7R A;  4EJT A;  3C2H A;  5DM6 F;  4P9U A;  2ZFU A;  2PJR B;  2FEZ A;  5B1B H;  4AIJ A;  3REO A;  4GXO A;  2KQR A;  2V26 A;  3CDH A;  1XMX A;  1QBJ A;  3A4C A;  1DUX C;  1KYZ A;  4Q48 A;  3HIF A;  3ZN1 A;  5F04 A;  2WBM A;  4ZC3 A;  1AKH B;  1XSD A;  2CQX A;  4V2F A;  2EFP A;  5JHF A;  2ZME B;  1RES A;  4EVI A;  4WK8 F;  2P7C B;  3DBL B;  1ONV A;  3OYE A;  1WHU A;  2R5Y A;  4AUX A;  3HM5 A;  4M71 A;  3TP3 A;  4A6D A;  4JK1 X;  2M7B A;  1IRF A;  4KJZ A;  1DQU A;  1FJL A;  1VQ5 I;  3C3W A;  3F6V A;  1I50 J;  5CKT A;  5M5W J;  1UJ8 A;  5D4R A;  4WXC A;  3BZK A;  5IP7 J;  2V1X A;  3HSR A;  4X0G A;  3WTU C;  3LAJ A;  3O3K A;  1SVM A;  2HU9 A;  1E0E A;  3CCL I;  3CC7 I;  2MA3 A;  3DEW A;  1F9N A;  4HYE A;  1K4S A;  1S7O A;  2JN6 A;  5EJC A;  1TWF J;  3C7J A;  4W1U A;  2DK8 A;  2ID6 A;  1C0W A;  1SD5 A;  2DMU A;  5KNL A;  1P4X A;  3DTE A;  1W7P B;  2E5Z A;  3L2C A;  3FHN A;  2QLZ A;  2GM4 A;  1KQ9 A;  1G8X A;  3LMM A;  3HHH A;  2A5Y B;  2JSC A;  4B8X A;  2HDC A;  2LH9 A;  1OFC X;  2OQG A;  1SFK A;  1CF7 A;  2AO9 A;  1S5L C;  1H9T A;  1JT0 A;  1DPR A;  2NXN B;  2M3A A;  1W5C C;  3E97 A;  5M5X J;  1HDD C;  3ZCO A;  4YIF A;  4MFD A;  3H5A A;  3KLO A;  2HZD A;  2W4S A;  3GLX A;  3E5Q A;  5FRM A;  3S1M J;  2MG4 A;  2JVH A;  1TT0 A;  3W6K B;  3BPV A;  1VQK I;  3A02 A;  3MKZ A;  4BNC A;  2UUZ A;  1ZGJ A;  3DP7 A;  5ICG A;  1VQ7 I;  1MMS A;  3WHB A;  4IHT A;  1BW6 A;  4D5F A;  1XX5 A;  1Y39 A;  2QKM B;  1D5V A;  1V5F A;  4PDK A;  4D5C A;  2MW8 A;  3TQN A;  4N0B A;  2FBK A;  2CU7 A;  2F4M B;  4GYG A;  1FNN A;  3L2R A;  5JLW A;  3PUB A;  1QRY A;  5IOZ A;  4RB1 A;  4DZJ A;  5IYB J;  2WWY A;  1Y0U A;  2A61 A;  2F5D A;  3L1P A;  4FX4 A;  1Z05 A;  3UR3 C;  2EIM H;  2DT5 A;  3HRT A;  2XGD A;  4IOA F;  4R8H A;  3VSK A;  2NVQ J;  2MH9 A;  1TWC J;  5LHH A;  3K70 C;  1MH3 A;  2L9N A;  4BY7 J;  3WTY C;  3P7N A;  2CUZ A;  1S8N A;  4A3F J;  3BG6 A;  5J1Y A;  1FOX A;  1SAU A;  5CPR B;  2CUE A;  1MJ9 A;  4HOB A;  1VQ6 I;  4OIO F;  3IH4 A;  2KDO A;  1YW7 A;  3HBL A;  1FMW A;  2UZK A;  5C4X J;  4XM3 A;  4RAF A;  3ZN0 A;  4IPA A;  1JUM A;  4IOC F;  1JUS A;  2CQK A;  2X85 A;  3OIO A;  3H0D A;  1KON A;  1K61 A;  2RC4 A;  1X3W B;  1UMQ A;  3MQ0 A;  3GCM A;  4B3X A;  2XAQ A;  3WG7 H;  3RYP A;  3BR1 A;  4B44 A;  1WWX A;  4X1E A;  2VJ5 A;  1UHW A;  2DTZ A;  4FIS A;  2RKH A;  3LSJ A;  1GVD A;  2OUM A;  3L9F A;  1XN7 A;  2EA2 A;  2ESH A;  2CW8 A;  2W48 A;  2JSP A;  3QWL A;  4ENN A;  3VPR A;  1SFX A;  2V9P A;  2F4I A;  4NB5 A;  4UB8 C;  4KFC A;  2DA1 A;  1DU0 A;  2A68 F;  3ABM H;  4ASN A;  1POG A;  5HOD A;  3BC8 A;  2DA3 A;  3FXR A;  2L9S A;  5DYM A;  2EWN A;  5E1Z B;  3W2V A;  2WAE A;  3K4L A;  3LSH A;  1YI2 I;  3M1E A;  2D45 A;  1JKQ C;  1JKR C;  3W6J B;  5HDK A;  2MC4 A;  1P7I A;  2JA2 A;  3BTC A;  2KFD A;  2R5Z B;  1H0M A;  1Y1V J;  4IHV A;  4YIR X;  2ZXW H;  3MAJ A;  2DW4 A;  2JZY A;  4BHB A;  2Z99 A;  3EUH C;  4XSZ F;  2KT0 A;  3CP8 A;  3ZGK A;  1G3S A;  1ZR2 A;  3L2W A;  3NRV A;  4HX7 A;  3S1R J;  3K4N A;  3D5R C;  2EB7 A;  1Y0N A;  3DPT A;  3T5X A;  3HOW J;  3OV8 A;  1NH3 A;  2D1V A;  2VBZ A;  1Q1H A;  3HEF A;  1ZRD A;  4UUT A;  2RN7 A;  1QQI A;  2LKS A;  5FO5 A;  1TL8 A;  3A2K A;  4LOC A;  1LE8 B;  5GPC A;  3CCQ I;  3F22 A;  1EF4 A;  4EGZ A;  2VT3 A;  3AAF A;  4M6Y A;  4FHT A;  2VQC A;  2EZK A;  3DV8 A;  2EIN H;  2IW5 A;  2IVM A;  2ICW G;  1V4R A;  4ZYA A;  3IP4 B;  2XC7 A;  3HSF A;  5EEA A;  2LRE A;  1UCR A;  1UZC A;  4F7Z A;  4F3Q A;  1TP4 A;  3M3Y J;  1G3W A;  2OV7 A;  2LF7 A;  1YG2 A;  1FP1 D;  3T1B A;  2HQN A;  5D6F A;  4AVZ A;  1A5J A;  2BVM A;  3HPH A;  3HYI A;  3H35 A;  1I3A A;  2AHQ A;  1EH8 A;  3IKT A;  4M73 A;  1JHF A;  2H6C A;  4AU7 A;  4U7D A;  3J80 K;  1NTC A;  2ISY A;  1F5T A;  2DXI A;  3D5L A;  3S2H J;  6PAX A;  3OYN A;  3PQK A;  4A3I J;  2XB0 X;  5LRR A;  2CYY A;  2LBF A;  3I64 A;  4BAC A;  3I9V 2;  3P5J A;  3OOU A;  3J7Z I;  4I7H A;  1ETO A;  4XL9 A;  2ZSI B;  2LKP A;  3O8G A;  4M3E A;  4NNJ A;  4G7Z F;  3DU5 A;  3PJR A;  1O7L A;  4LIT A;  4QWQ A;  2A3S A;  3S1N J;  4IHY A;  2W1O A;  3B02 A;  3E6C C;  3JSP A;  1DPU A;  1J7K A;  2CQ7 A;  3JAM Z;  1ON2 A;  4E7H A;  2CFX A;  4ETS A;  2NNY A;  2M45 A;  3HXL A;  3KZY A;  2KIM A;  1UEL B;  2O61 A;  4JX4 A;  2AS5 F;  4IX7 A;  5IT9 Z;  1FX7 A;  4DYR A;  4EEF G;  1EV7 A;  2LNB A;  2M0M A;  3EYI A;  3ZMT A;  2LY2 A;  3ERM A;  3CC4 I;  3MKY B;  3KX2 A;  5J40 A;  4D7M A;  5JR3 A;  3GFJ A;  5JFR A;  1Q1V A;  2MC3 A;  5DD8 A;  5DCF A;  2UV1 A;  4UXN A;  5J6X A;  2ZBK A;  4LIV A;  5HS9 A;  2ESN A;  3DWL E;  1OLT A;  3BP8 A;  1GT0 C;  4HX4 A;  2Y0S N;  1R58 A;  4P5O A;  1XGO A;  3CCV I;  1FBS A;  1YS6 A;  2MFZ A;  2KJC A;  1B72 A;  4OIQ F;  3KP6 A;  3VOD A;  1VQ9 I;  3S14 J;  1J9I A;  2IA1 A;  3ELK A;  5B5E C;  5F1J A;  1T08 B;  4E7J A;  1IRZ A;  2CJJ A;  2BY3 A;  3DEE A;  1W0T A;  3G73 A;  5DS9 A;  1J2X A;  2EFW A;  2EA4 A;  1XGS A;  1WI9 A;  4CGZ A;  2BY1 A;  2W57 A;  2KKO A;  4UB6 C;  2E1M B;  2GA2 A;  2QSG X;  3GFL A;  2ZXI A;  5K5R A;  2CSO A;  3ECO A;  5FKL A;  3VWB A;  2BYV E;  4V19 K;  3KFW X;  4MEY F;  2B63 J;  3RPQ A;  2D5V A;  3CCE I;  3BR6 A;  2IS4 A;  2GIV A;  2IGN A;  2XSD C;  4HST A;  1VQN I;  2M8G X;  3S3N A;  4XLF A;  4N9I A;  2PJP A;  4XLP F;  1DGW Y;  2HQ5 A;  2X6Y A;  4BEH A;  1L3L A;  2VPL A;  2F4O B;  3ROU A;  2QYO A;  4IHS A;  2CW0 F;  5B66 C;  2KDZ A;  2DMP A;  3BZC A;  4DZP A;  1D5Y A;  3SDB A;  1IN8 A;  2GOM A;  2JTV A;  4I0A A;  3I59 A;  2JUG A;  2FRH A;  3FXQ A;  4KYW A;  3K70 D;  1U2W A;  1U0J A;  1JJ8 C;  3FXO A;  2DQR A;  1HOM A;  2K85 A;  1QHH D;  4MEX F;  2H6B A;  1T38 A;  5DDG A;  4LG0 A;  4UV8 A;  1IN4 A;  3KIO A;  3PO3 J;  5CYV A;  1TQI A;  4B43 A;  5HNF A;  3DPU A;  2WY8 Q;  2XRN A;  1RR8 C;  1FPQ A;  3M8E A;  3ZPL A;  3E5U A;  2YR2 A;  1MBF A;  5HNH A;  3H36 A;  1BI0 A;  1QZE A;  2M87 A;  2BW3 B;  2WAD A;  4BQA A;  2H8W A;  1YIJ I;  4UVA A;  2DPU A;  4OAY A;  3CJR B;  1XG1 A;  3WE3 A;  1HSJ A;  5D8K B;  3I5U A;  2PJR A;  1YFH A;  3S3M A;  1BM9 A;  4L9V A;  4M74 A;  3WG9 A;  3F23 A;  2DFF A;  2DTR A;  2NAZ A;  1TC3 C;  1SD6 A;  1IW7 F;  4UVB A;  3HHG A;  2EH3 A;  2CQQ A;  1FYL A;  1SFE A;  1E3O C;  3A0B C;  2V6C A;  2Y2Z A;  4PZJ A;  3H9J A;  4CO8 A;  5E3O A;  3CD6 I;  1ORK A;  2M5W A;  3R6S A;  3EUK L;  5FLX Z;  2E35 A;  5FFZ A;  1YE9 A;  3OYK A;  3E7L A;  3RI4 A;  3GTG J;  4OIN F;  4M3G A;  1MBG A;  3PFY A;  2HOS A;  3NWT A;  4E7L A;  4P9F A;  4FCY A;  5E1W A;  5E3N A;  2VJ4 A;  2F5V A;  2E1O A;  1SEU A;  3MFK A;  5J3L A;  4KUM A;  2EFN A;  4TV7 A;  1V54 H;  2QGU A;  4G7H F;  5KAF C;  5CVU A;  1IV6 A;  1VF9 A;  5LLQ A;  4CCO A;  3S1Q J;  1HKQ A;  2FX0 A;  1G4D A;  4C2T A;  2O3F A;  4NC7 A;  3PSF A;  2R7F A;  4G94 A;  4BHP A;  1YRN A;  3GTO J;  1X2M A;  2HYJ A;  2FBH A;  2E1N A;  3BQY A;  1YS7 A;  4E7K A;  3ML6 A;  1HLV A;  2DLL A;  4M9X A;  2PMZ A;  1RUO A;  4XLN F;  3ZMZ A;  2JWT A;  1I39 A;  1XD7 A;  3I56 I;  1BL0 A;  1I1G A;  3FMQ A;  3RZD J;  1FIP A;  1ZN2 A;  3FIW A;  3LA7 A;  1Z67 A;  3J7A O;  3LSM A;  4GYI A;  2A05 A;  1XDS A;  3FMS A;  2HWV A;  5DD4 A;  4NQW A;  1KQ0 A;  4LK0 F;  1K6O A;  1MBH A;  3QYB A;  5D4S A;  5EEG A;  4CYC A;  3LFK A;  1T8I A;  2R7D A;  1X1B A;  1ETX A;  1XSV A;  3C1D A;  3E1S A;  3KYC B;  1ZH5 A;  1WJA A;  4A2U A;  1GHC A;  2V4J C;  2HTS A;  2HDD A;  2LF8 A;  2ZJQ F;  2XUB A;  4L9T A;  2LG4 A;  2EV0 A;  1WZ2 A;  1N25 A;  1EH7 A;  2FSW A;  3N97 A;  2X6X A;  1YW9 A;  4WXH A;  1N78 A;  2OCC H;  1R22 A;  1LVA A;  2E34 A;  4BE2 A;  5L3C A;  2K4J A;  3I4P A;  1BJA A;  2DA2 A;  5ICF A;  3OYH A;  2B0L A;  2UXN A;  3HC7 A;  1LDK B;  2HXO A;  3PFI A;  4B48 A;  1HKS A;  5GAH J;  2NVX J;  3M1C A;  2V1U A;  4HF0 A;  3VYU B;  4HF1 A;  4HNT A;  1OKR A;  5EGO B;  3PUF A;  3WTS C;  3MCZ A;  5BMZ A;  3WTT C;  3GTM J;  5FKN A;  4PK4 A;  5J47 A;  1MMD A;  3DKW A;  3R61 A;  3FKJ A;  3L2U A;  3FHZ A;  2J5O A;  3OR1 C;  1H89 C;  3HOY J;  2ZSH B;  1T98 A;  2IT0 A;  4XRF A;  2IA0 A;  3QOD A;  3JRH A;  4KNY A;  3WU1 B;  4CA0 A;  4A3E J;  5HDN A;  3K1N A;  2L4A A;  3OWT A;  3IH2 A;  2HPM A;  3OYM A;  3TOB A;  4PFO A;  5B1A H;  4KN7 X;  1RZ4 A;  1XS9 A;  1O3T A;  2H27 A;  3PM1 A;  2XAS A;  1Z7L A;  2M1B A;  2KIF A;  4UV9 A;  2XB5 A;  3HOV J;  1XPX A;  4IF4 A;  3JR9 A;  4BXF A;  2PMH A;  2NVT J;  3QU6 A;  3D5S C;  4ZZD A;  4XR6 A;  1FY7 A;  2OU2 A;  1OCC H;  2JA8 J;  4KIG A;  3EPZ A;  1ZKG A;  1ZG1 A;  1D0X A;  4AC0 A;  3SHF A;  4DBQ A;  2BVL A;  1BOA A;  3QP6 A;  4CZZ A;  3J7A Y;  4LB6 B;  1BW5 A;  4ANJ A;  1YJW I;  2WAQ A;  1KU3 A;  4CH7 A;  5ILV A;  4GCV A;  3CMA I;  4WWC A;  3R4K A;  2ME6 A;  2EZI A;  1H88 C;  3J81 Z;  2PG4 A;  1Z3X A;  2K4B A;  3RKW A;  1BR4 A;  2FMY A;  2DT6 A;  1TW3 A;  1LKX A;  3OMY A;  4ITV A;  4E4H A;  3O2P E;  3G4S I;  2A6T A;  2WB1 A;  5ILS A;  4ZDL A;  3DTK A;  3CCR I;  5IY5 H;  3HGY A;  3F0C A;  3GUD A;  2XSJ C;  1BN5 A;  4J01 A;  4IZZ A;  1QU3 A;  4LIU A;  3V7S A;  2OTL I;  2W24 A;  1RUN A;  2JK3 A;  4QLC U;  3FXK A;  2UWM A;  4N9H A;  2ZCW A;  1XGM A;  2HI3 A;  1TW2 A;  1FZP B;  1W36 C;  1FLI A;  1HCR A;  1TQM A;  3AG3 H;  1P4A A;  1SD7 A;  3H1C A;  5E3L A;  1R49 A;  4F55 A;  4PSX A;  1R9T J;  1GXP A;  1J75 A;  4ENM A;  1FWZ A;  1LE8 A;  3L7W A;  1YQA A;  5FLM J;  2OC6 A;  1VI0 A;  3CJT B;  5E79 C;  4BDZ A;  1FOK A;  2VON A;  3GYH X;  5F0H A;  4JBA A;  4XLE A;  2FML A;  3AL0 B;  2V9K A;  2M34 A;  1TWG J;  1LEB A;  4HSR A;  4IVN A;  4ZJZ A;  1YJN I;  2FF4 A;  4HAM A;  4HV6 A;  2O9L A;  2ELK A;  5FJ8 J;  4LD5 A;  4HRI A;  4A93 J;  4UNO A;  3V42 A;  2XKP A;  1MDM B;  2A5W A;  4AIK A;  1BI3 A;  4G6T B;  1LDJ A;  1KZH A;  2XAU A;  4OU0 A;  1SC7 A;  5FB2 A;  2L5Q A;  2R7V A;  2X6W A;  5EZH A;  3ZQG A;  1BR2 A;  5E20 A;  2LOO A;  2H94 A;  4GGG A;  2HFH A;  2BV6 A;  1MBE A;  2VN2 A;  3SZT A;  2KIS A;  4XRS G;  4BUP A;  1MW7 A;  5GTH C;  3AG2 H;  1PVE A;  1I6H J;  4KT6 A;  3F3X A;  4F92 B;  4L9J A;  4CCK A;  2Q2E B;  2Y9Y A;  3IRR A;  4ZYD A;  3A01 B;  3K1P A;  3RKY A;  4AYB A;  2ZKZ A;  5AIP A;  1FTZ A;  2HZT A;  4FE4 A;  3IWZ A;  2XRL A;  5J8C A;  1PYV A;  4DW6 A;  3ULQ B;  3CUQ A;  3OL3 A;  4BQQ A;  3IL2 A;  3NAU A;  4JX6 A;  4XOR A;  1S6L A;  5EF6 A;  1K7A A;  4FET A;  2AQE A;  4B4C A;  2TDX A;  2EZL A;  2R3S A;  2M4G A;  3BR2 A;  1M1E B;  1Y56 A;  2C6Y A;  2A6E F;  4M9Z A;  1ULY A;  1ZHF A;  2NVU B;  2BGC A;  3A1Y A;  4PSW A;  3U21 A;  3ZOB A;  4U88 A;  1IZ1 A;  2HXI A;  5J1R A;  2I5U A;  3GTP J;  2PX9 A;  3K9T A;  5IT9 K;  3LOC A;  2E7X A;  4KIS A;  3EET A;  3GF2 A;  3KET A;  3HUG A;  1ETW A;  4PGG A;  2MSY A;  2HTJ A;  2Y75 A;  2RRE A;  4LFU A;  4PJM A;  2Y30 A;  1D0Z A;  4C3J J;  3RZO J;  3RQI A;  2MLK A;  2IGM A;  2FNP A;  2VQH A;  1FTT A;  2RGV A;  3FZV A;  5JVT A;  3BCA A;  3KP7 A;  3BG9 A;  4IEJ A;  1GV2 A;  2ZC2 A;  5D6E A;  1IO2 A;  2M0C A;  3OYJ A;  2K27 A;  5L3G A;  1LQ1 A;  3SFI A;  1WJF A;  1ZGW A;  1Y8Q B;  1MND A;  2PBI A;  3RQ4 A;  2O03 A;  2O0Y A;  4FT8 A;  1MD0 A;  5HLG A;  3LSR A;  3CLQ A;  1USS A;  3DLA A;  2QVO A;  1ETV A;  1S7E A;  1D1A A;  2XGC A;  1X58 A;  2K9L A;  3V8L A;  1V55 H;  4F52 A;  5FGM A;  3ZXS A;  3DLL F;  5GTI C;  1KA8 A;  4ENJ A;  3Q9S A;  1LUJ B;  5K1Y A;  2KZV A;  3VYT B;  5EG0 B;  2JA6 J;  5H6R A;  3EDP A;  4D1Q A;  1WJE A;  2D1H A;  1U6G A;  1ZLK A;  5IOY A;  2FOW A;  5D8L B;  4YEL A;  2IEK A;  2LMD A;  5KHD A;  1OCZ H;  2G0E A;  3I71 A;  2KLO A;  3ECH A;  4OMZ A;  4S0H B;  2R7U A;  1JKO C;  2TCT A;  2Q1Z B;  2P6T A;  4HQM A;  2H1K A;  2P5V A;  4O3M A;  4BU2 A;  2ISZ A;  4KIF A;  3ASN H;  2QQA A;  5HOO A;  5EDN A;  3NEU A;  4B1R A;  4MTE A;  1QPI A;  2IBD A;  1JGG A;  1MH4 A;  4B47 A;  1ZTR A;  1IUY A;  3OS0 A;  3K1M A;  1X19 A;  2XF5 A;  2L3D A;  4IXA A;  3PO2 J;  4UY8 I;  2E71 A;  1A31 A;  4CDG A;  3DBH B;  4MNU A;  1E2X A;  1VFC A;  3TW6 A;  2VBY A;  2CUF A;  1W0U A;  2VUM J;  5FKO A;  2L0K A;  5LRS A;  4RS8 A;  1I5Z A;  1XTA A;  3HOS A;  1B8I A;  2X1D A;  4EJU A;  1F1Z A;  2XPU A;  3F8N A;  1R71 A;  2K40 A;  3T8T A;  1IDZ A;  1A6I A;  4IJA A;  5HLH A;  3IV5 A;  4XON A;  1MSE C;  1BI1 A;  1GV5 A;  3I54 A;  1LPQ A;  5DCM A;  2CW7 A;  3C2G A;  2R7Z J;  1AHD P;  3GZN B;  1WH5 A;  2Z3Y A;  3BJA A;  2F5C A;  1LB2 A;  4K2E A;  4F91 B;  1MNM C;  5TIS C;  2O8X A;  4A3D J;  2O6G E;  4CZC A;  1HDP A;  3WTX C;  3LWF A;  5IPA A;  2KRC A;  3BZ6 A;  3DKX A;  5F08 A;  2RAE A;  3OY9 A;  1IN7 A;  1OYI A;  1WVR A;  5M5Y J;  2XDV A;  2ME0 A;  2IXS A;  1VTN C;  4O5V A;  3SJM A;  3QRF F;  4HEA 2;  3OYF A;  4N4N B;  2GLO A;  1X1A A;  1KQ8 A;  5HS7 A;  3TDZ C;  3OOP A;  1ZR4 A;  3KP4 A;  4LLN A;  1AA7 A;  4J19 A;  1W36 D;  1TBX A;  3HDD A;  3PSI A;  5CQE A;  1DP7 P;  2AXL A;  2PFB A;  1ZK8 A;  2HOA A;  4MO7 A;  5ICC A;  1OQY A;  4IRH A;  1S29 A;  1R4M B;  1RC9 A;  2HYG D;  1OR7 A;  4D9J A;  4ZTJ A;  4KIC A;  3RTR A;  1TTY A;  1SFU A;  1F43 A;  2EJR A;  3HG9 A;  2HDW A;  1R7J A;  3NAR A;  2Q0O A;  4H0E A;  3SYT A;  2L7Z A;  2ACJ A;  2CV1 A;  4O6J A;  1F36 A;  5DUK A;  3R60 A;  3QYE A;  3BJO A;  2DQL A;  4KDP A;  3WOD F;  2DOF A;  3TGN A;  5CVR A;  4RB0 A;  3A03 A;  3VYR B;  1RKW A;  5CVI A;  4EQQ A;  2K9N A;  2L54 A;  4EM1 A;  5J4Y A;  2P5K A;  2DOD A;  4L5J A;  5CVJ A;  1ERD A;  5F0F A;  2QF7 A;  1X1D A;  1PUF A;  3WE2 A;  2M2E A;  4IQJ A;  3H5R A;  3UKG A;  3I55 I;  3KP2 A;  1O3Q A;  4BH9 A;  2JPB A;  2ELH A;  4UUV A;  3CUQ C;  3B73 A;  2F5E A;  2ZB9 A;  2XVC A;  4EM2 A;  4PUS A;  2DI3 A;  3LFU A;  2IP2 A;  1EKE A;  2WTE A;  3L2Q A;  5EGO A;  3RKQ A;  1W7P D;  4XOT A;  2IGK A;  4E7S A;  2YSR A;  3VEP A;  2XPV A;  2I8D A;  4Y15 A;  2R5Y B;  3M7G A;  3PIO F;  4WXD A;  2DBB A;  2LY9 A;  5IT3 A;  1D3Y A;  4ZYE A;  3LNQ A;  2CMP A;  2QA4 I;  3ABK H;  3U1K A;  1XMA A;  4BGD A;  1ZLJ A;  1YHQ I;  1JTY A;  1Z21 A;  1BA5 A;  1UG0 A;  1I6X A;  2AQF A;  2W85 A;  3FDY A;  1V5G A;  4CCJ A;  3SDG A;  1V5E A;  2P8T A;  2HYF A;  2VBX A;  5TJJ A;  3KYD B;  1NG7 A;  1R6R A;  1U5T A;  3IHU A;  2X9D A;  2CV0 A;  1B6A A;  4XMY A;  4C3H J;  4Q4Z F;  1G2H A;  1DU6 A;  3F9K A;  2STT A;  3R0J A;  3JW4 A;  4E70 A;  4Y33 A;  4WF2 A;  1S7A A;  3OS2 A;  2DN0 A;  3I4M J;  1FOY A;  1SAN A;  1Y1W J;  3HGG A;  1CF7 B;  2VJJ A;  1U9O A;  3ZRG A;  3PL8 A;  3VOE A;  3FWE A;  2VL8 A;  3GXO A;  1TNT A;  1VQM I;  1WSU A;  2QKL B;  4RAY A;  3LST A;  1BIA A;  2VB6 A;  1MMG A;  3GTQ J;  5HLT A;  2M9H A;  3DEU A;  1Z6R A;  4XRS A;  1ETY A;  3HKZ A;  1QGP A;  2HQR A;  2K9M A;  4XNF A;  4CCM A;  1Z3Y A;  2YX7 A;  3RKX A;  1B9M A;  2XHK A;  5J4V A;  2R0Q C;  4L5E A;  3LQR A;  1K78 B;  1VQ4 I;  1S72 I;  1IV8 A;  1KU9 A;  4CYD A;  2MLG A;  2H8R A;  1FMV A;  4Z2Y A;  1LDD A;  3UNG C;  2OA4 A;  2COB A;  1RR7 A;  2QM3 A;  3F8F A;  2YX4 A;  1R00 A;  2FE3 A;  3FXM A;  4Y7N J;  4RDU A;  1ZRC A;  2CFO A;  1IN5 A;  4GDF A;  2W84 A;  2L7M P;  2PMZ N;  2L9R A;  1P9Q C;  3CME I;  3GTJ J;  1IG7 A;  2K7L A;  2QZ8 A;  3KP3 A;  1P6R A;  4ENK A;  2HVR A;  2A6H F;  4RGX A;  5IP6 A;  4A3K J;  2GXA A;  2JA7 J;  1AOY A;  2EPF A;  3K6G A;  3OIP A;  2QBY A;  2Z1D A;  4Y17 A;  1YOV B;  2CV2 A;  2XIG A;  3HL2 A;  5LBQ A;  2OQR A;  2E36 A;  2E5N A;  3E0J B;  2NS8 A;  1B59 A;  4BJT A;  2R7W A;  4YFN F;  5JI6 A;  4OMY A;  1HA8 A;  5IYC J;  1D1B A;  1F4K A;  4F93 B;  1Z9C A;  1ITY A;  1QPM A;  3S8P A;  5D5U B;  1T0F A;  3H9G A;  4UUS A;  2VE9 A;  4BS9 A;  2CUJ A;  5DEQ A;  3GVA A;  2MH2 A;  2PQ8 A;  3P9K A;  3G3Z A;  4BY1 J;  2Z5U A;  5LGN A;  2IRF G;  3FIS A;  2LVS A;  5A2Q K;  2WC2 A;  3GME A;  5LD2 C;  1IAW A;  3QP5 A;  3MD2 A;  2DK5 A;  3FBI B;  2JQ7 A;  1YTY A;  1AKH A;  1O3S A;  1WCM J;  2DA6 A;  5E8G A;  3IC7 A;  2W00 A;  4DGW B;  2V7F A;  4BAY A;  2ZME A;  2E2J J;  4AVP A;  2W25 A;  5FRO A;  3ABT A;  5K5Q A;  3HRU A;  4S05 A;  1Z0X A;  1VZ0 A;  1Y8R B;  2QSH X;  5D5W B;  4Y4R A;  1IF1 A;  3HSE A;  1A35 A;  2FQ4 A;  2M8E A;  1K79 A;  2X1C A;  5JLX A;  3TDU C;  4HDV A;  3A01 A;  2HKX A;  2FJ1 A;  2Y0S A;  3S16 J;  1H9G A;  2O7O A;  2VQG A;  5HVQ C;  5BPD A;  2QWW A;  1OR7 C;  4XK4 A;  1V3F A;  5FKM A;  2K02 A;  5E18 F;  1GXQ A;  1KU2 A;  3CES A;  4LLG F;  1VQP I;  1XCV A;  1FSE A;  1MGT A;  3Q9V A;  4DNC A;  2HGC A;  1YX5 A;  1KGS A;  1W7P A;  1FBQ A;  1G6N A;  2PI0 A;  5CQG A;  2WY7 Q;  2DYS H;  4I0B A;  4ZYH A;  3WGI A;  2BHZ A;  3JSO A;  2DYR H;  3JRG A;  3LAP A;  1VQ8 I;  3DQV C;  4KIT B;  3S17 J;  1S3J A;  1T2K A;  1WJC A;  5F1R A;  1D1C A;  3FF5 A;  2E60 A;  4A6E A;  1FEX A;  1QNT A;  4A5M A;  3I3L A;  5K5O A;  2XGE A;  3EUA A;  1O57 A;  1Z6T A;  2DO7 A;  4HLY A;  4M3B A;  1E3H A;  2G7U A;  3FKI J;  3TBI A;  2WAQ N;  5JVG F;  2X1E A;  4D0P A;  2FOK A;  1WQ2 A;  2OZ6 A;  2VPR A;  5F0C A;  4HV5 A;  2P4W A;  2M7A A;  1QHG A;  3LA2 A;  3G71 I;  4XKB A;  4RGU A;  3J80 Z;  3LQQ A;  3WTW C;  2QEX I;  1U8R A;  3VFZ A;  1MKM A;  2GA1 A;  1IJW C;  5DV5 A;  2GIZ A;  2BEO A;  2F5F A;  2VKV A;  3HOX J;  3TKY A;  3JRE A;  4XBF A;  2KPM A;  1GVJ A;  4M3D A;  2KZG A;  4Q5S F;  2DA5 A;  4HDU A;  1ETQ A;  2B7E A;  4MFE A;  3BWG A;  3OYL A;  1IN6 A;  1TT5 B;  5EEH A;  2LSO A;  2VOP A;  5KK1 A;  5LGU A;  2LBF B;  1WJ5 A;  1U5T C;  1ZAR A;  3W6V A;  3FXU A;  1OIS A;  4Y13 A;  3FM3 A;  3MZY A;  2VBW A;  2L9V A;  5BQT A;  1NK3 P;  3CCY A;  4NC8 A;  5BS6 A;  1PJR A;  2FXA A;  1W5S A;  2E7W A;  2Y9Z A;  4NC6 A;  3FBN B;  3JTG A;  1APL C;  5ILU A;  4PJL A;  4BDY A;  2HQA A;  3S3O A;  2ZXJ A;  3H3Z A;  2ZXH A;  1TNS A;  3VSL A;  5GP9 A;  4BE1 A;  1OCT C;  3S15 J;  2WAF A;  4X6A J;  3S93 A;  1Z77 A;  3BY6 A;  2X48 A;  3DPL C;  4AWX B;  1O4X A;  1B4A A;  1RIO H;  1UAA A;  2LLK A;  4CSW A;  3JRC A;  4A5N A;  1B1B A;  4W97 A;  4IQ4 A;  4BL0 B;  1E17 A;  3V8K A;  1ZAO A;  3WTZ A;  1XSX A;  2GAU A;  1ENH A;  9ANT A;  4IHX A;  1S9H A;  2LY1 A;  1A6Q A;  2H09 A;  4KMU X;  4G9Y A;  5C44 J;  4BXU A;  4I6Z A;  3TO9 A;  2V6E A;  1IXR C;  4M3F A;  1B72 B;  4XLH A;  4G6Q A;  4A0X A;  3M4O J;  2EZH A;  1T33 A;  1X3U A;  2R5Z A;  4U0Y A;  1XC5 A;  1BI2 A;  4BYY A;  5AIQ A;  3HZJ A;  4RLQ A;  4XKV A;  3SZG A;  1MIJ A;  3K0L A;  2NRA C;  2XAG A;  4HA8 A;  1HC8 A;  1T95 A;  1VQO I;  5GAD J;  2ZNY A;  3K4B A;  1OYY A;  2V9V A;  4YII A;  2EV6 A;  3F8C A;  1BJZ A;  3AL0 C;  3KZI C;  5L3D A;  2JA5 J;  1T0F C;  2EK5 A;  4LGW A;  1HW2 A;  2EIJ H;  4J00 A;  5EZG A;  4BEH B;  3KEO A;  1LVK A;  2X0L A;  3A0H C;  4PJ0 C;  5C4J J;  3S2D J;  1RET A;  1Z1D A;  3S32 A;  3ERE D;  3K4C A;  2FA5 A;  4G7O F;  3JRF A;  1P92 A;  3K69 A;  3E6D A;  2LK2 A;  2ZJP F;  4KMF A;  4OIR F;  1FYM A;  3I59 B;  4LMY A;  2IS6 A;  1FSH A;  4HW0 A;  5E1X A;  2DFI A;  5DM7 F;  4Z6Y A;  4BHC A;  4GRI A;  1U78 A;  1CQT A;  2ZME C;  3QAH A;  3GX4 X;  4EV0 A;  2IJL A;  4LG0 B;  4Y3O A;  5L3B A;  4PJJ A;  1A04 A;  3CCM I;  2EFO A;  3GW2 A;  1LFB A;  1ZYR F;  3CCU I;  3PNY A;  2VLA A;  5TGT A;  2VIX A;  1D8J A;  4P96 A;  1CGP A;  4DYQ A;  3BOQ A;  3K4K A;  1UHS A;  4I98 B;  1HXD A;  2COM A;  2OJE D;  3FX3 A;  1UHM A;  2WA0 A;  3EQL F;  3WU2 C;  2KIQ A;  1J59 A;  2QSF X;  2UXX A;  2K86 A;  3CF2 A;  3TL4 X;  4ZZL A;  3SXY A;  4FX0 A;  3SZP A;  2G7H A;  2O5R A;  2MGQ A;  3O8H A;  2W82 A;  3NQO A;  2DJN A;  3OYB A;  1U3E M;  5F64 A;  4IKF A;  3K10 A;  1TZL A;  1U9N A;  4DJA A;  2DJI A;  1UB9 A;  1NHA A;  3BRO A;  4XKW A;  4ESF A;  3ZP5 A;  2K5C A;  1SMT A;  2XPW A;  3F72 A;  3OYG A;  1A36 A;  1LFP A;  1N75 A;  2L01 A;  4CUG A;  3BT9 A;  1ON1 A;  5DUI A;  4YRV A;  3BG5 A;  1FOW A;  1DDN A;  4MQ9 F;  3CMY A;  4M6X A;  4RM3 A;  2OD5 A;  2X4H A;  2QQ8 A;  5ED4 A;  1Z7U A;  3M8F A;  3JAM K;  5HS8 A;  2XF7 A;  3DXJ F;  3H9Q A;  1GLN A;  1O7F A;  1R5I D;  3CDI A;  2JJ7 A;  3AG1 H;  5EYR A;  4HNV A;  2E2H J;  5FD6 A;  3P9C A;  1X3Z B;  2V79 A;  4B09 A;  3AKZ A;  1JXS A;  3MWM A;  4DBR A;  2XV4 S;  4MTD A;  2P6S A;  4ABZ A;  5D5X B;  3RPU D;  2FBI A;  3KLN A;  3B6A A;  4JOM A;  1YRN B;  3BG3 A;  1W1W E;  2BBY A;  4YEJ A;  4CCL A;  2AXT C;  1R36 A;  3AFH A;  2ADU A;  3S2W A;  4UHT A;  3LSK A;  5LGT A;  4EM0 B;  3FK6 A;  1YO5 C;  2H1L A;  4YFK F;  4PCQ A;  4M72 A;  4LB5 A;  2HNH A;  5LFA A;  2KMU A;  1FP2 A;  2BXY A;  5K7F A;  3OL4 A;  1EJ9 A;  3C18 A;  3DF8 A;  3CJN A;  3VYS B;  5J8F A;  4NQW B;  1OCR H;  4CYC B;  2XAJ A;  3ESW B;  2KJB A;  3CC2 I;  3ZMS A;  2BY2 A;  2VQL A;  1RI7 A;  2DMT A;  3BR3 A;  3KEY A;  4L9N A;  1K78 A;  5KAI C;  3HJE A;  3HOZ J;  2GZW A;  2KRH A;  2NYX A;  3IAS 2;  4MGR A;  4JP0 A;  3G1O A;  2Z2S B;  4A3G J;  2V1D A;  4KA4 A;  1DP3 A;  3U9G A;  3OIQ A;  1X4O A;  3COA C;  2VAS A;  1JE8 A;  2L7K A;  2Y48 A;  3KE2 A;  2VC0 A;  4JQF A;  4C2U A;  3H92 A;  3VB2 A;  3LL7 A;  3I53 A;  2CH0 A;  4Q47 A;  2JMW A;  2DFE A;  3Q0W A;  5HDG A;  3F8B A;  3Q0V A; 
#chains in the Genus database with same CATH homology
 1YRN A;  3GTO J;  1X2M A;  1BA5 A;  1AU7 A;  3TP0 A;  4BXX J;  3Q0U A;  2HYJ A;  3LSP A;  4A3J J;  3BQY A;  5F27 A;  3SDG A;  2E19 A;  4NDL A;  4BKX A;  1HLV A;  1IDY A;  3GBG A;  4C3I J;  4BBS J;  2X9D A;  4I76 A;  4XID A;  2JWT A;  2R92 J;  1UG2 A;  1BL0 A;  3LSG A;  4C3H J;  3JRD A;  3RZD J;  1IV6 A;  3TED A;  4Y52 J;  1DU6 A;  2VI6 A;  1FIP A;  4G12 A;  3FIW A;  4QSH A;  1G2H A;  2DN0 A;  3OSG A;  1WH7 A;  3I4M J;  1SAN A;  1Y1W J;  1JKP C;  1MBH A;  3MVP A;  3HGG A;  2FX0 A;  5BNG A;  4UUS B;  4CYC A;  1U9O A;  1ETX A;  2HDD A;  1WPK A;  1FIA A;  3GTQ J;  1OCP A;  2M9H A;  4XRS A;  2CRG A;  1AKH B;  1I3Q J;  5F04 A;  1ETY A;  2CQX A;  3HB9 A;  4V2F A;  2R0Q C;  4L5E A;  1RES A;  2DA2 A;  2HXO A;  2NVX J;  1LFU P;  2R5Y A;  4AUX A;  3HM5 A;  2H8R A;  3TP3 A;  2ECB A;  3ZQI A;  4A3L J;  3QPS A;  5EGO B;  2COB A;  1RR7 A;  1FJL A;  1U8B A;  1I50 J;  4Y7N J;  4RDU A;  5M5W J;  3ZQL A;  4D7N A;  1OJL A;  5IP7 J;  3GTM J;  3ZQF A;  2L7M P;  2PMZ N;  5FKN A;  2L9R A;  3GTJ J;  1IG7 A;  1H89 C;  3HOY J;  3QPL A;  2X6O A;  3DEW A;  5IYD J;  5IP6 A;  4A3K J;  2JA7 J;  2JN6 A;  1TWF J;  3JRH A;  4W1U A;  2ID6 A;  3GTK J;  1WI3 A;  4A3E J;  2DMU A;  4JYK A;  3IH2 A;  1HF0 A;  1IGN A;  2NS8 A;  2GM4 A;  1XS9 A;  5IYC J;  3PM1 A;  1ITY A;  1OFC X;  4UUS A;  2AO9 A;  2QCO A;  3BTJ A;  3JRA A;  2XB5 A;  3HOV J;  3FK7 A;  1JT0 A;  3JR9 A;  3HKZ N;  2NVT J;  4BY1 J;  5M5X J;  3FIS A;  1H8A C;  2LVS A;  1HDD C;  1ETK A;  4MFD A;  3JRB A;  2JA8 J;  5M3M J;  2LR8 A;  3S1M J;  1ZKG A;  2MG4 A;  1AKH A;  4AC0 A;  1WCM J;  2DA6 A;  3A02 A;  3B6C A;  1K83 J;  2E2J J;  3WHB A;  1JT6 A;  1BW6 A;  4D5F A;  4A3M J;  1Z0X A;  1BW5 A;  3G1M A;  4D5C A;  2ID3 A;  2I10 A;  2MW8 A;  2ME6 A;  2EZI A;  1H88 C;  2FQ4 A;  2CU7 A;  5JLX A;  1MBJ A;  3A01 A;  5JLW A;  2FJ1 A;  3S16 J;  1QRY A;  2O7O A;  5IOZ A;  1ZQ3 P;  4BBR J;  4DZJ A;  3ZQC A;  5IYB J;  4XK4 A;  5FKM A;  3HGY A;  3F0C A;  3L1P A;  4RBO A;  2YU9 J;  2JK3 A;  2XGD A;  4B3A A;  2HI3 A;  2NVQ J;  2LTP A;  1HCR A;  1TWC J;  1MH3 A;  2NOG A;  4BY7 J;  2LFB A;  5E3L A;  3JRG A;  1R9T J;  4A3F J;  5J1Y A;  2YUS A;  3S17 J;  1LE8 A;  2CUE A;  3H0G J;  3IH4 A;  5FLM J;  1VI0 A;  2HOT A;  3HBL A;  1FEX A;  5C4X J;  2K9S A;  5F0H A;  1RKT A;  2DA7 A;  2XGE A;  1JUM A;  1JUS A;  2M34 A;  1K61 A;  1TWG J;  3OIO A;  4M3B A;  1UMQ A;  2LD5 A;  3FKI J;  3G1L A;  4M6V A;  1TWH J;  2WAQ N;  2O9L A;  2VPR A;  2ELK A;  5FJ8 J;  3BR1 A;  4A93 J;  5F0C A;  4X1E A;  3BQZ A;  3DCF A;  2DTZ A;  4FIS A;  3LSJ A;  3K7A J;  1GVD A;  1QVU A;  2FD5 A;  5EZH A;  2W48 A;  5DTD A;  3ZQG A;  3VPR A;  2NVY J;  2DA1 A;  1IJW C;  1MBE A;  1DU0 A;  1VF9 A;  1POG A;  5HOD A;  4XRS G;  2DA3 A;  3IH3 A;  2VKV A;  3HOX J;  3C2B A;  5K7Z A;  3JRE A;  2OPT A;  1JKQ C;  4M3D A;  1JKR C;  1I6H J;  2Y31 A;  1P7J A;  2DA5 A;  1P7I A;  1ETQ A;  4MFE A;  3BTC A;  2Y9Y A;  2WV1 A;  2R5Z B;  4IHV A;  1Y1V J;  3A01 B;  2LP0 A;  1FTZ A;  4FE4 A;  2KT0 A;  3GTL J;  2XRL A;  4MIM A;  3Q3S A;  1ZR2 A;  3W6V A;  3S1R J;  2O8K A;  4DW6 A;  2P81 A;  4C2M J;  2ECC A;  1NK3 P;  3CCY A;  3NAU A;  3HOW J;  4JX6 A;  5EF6 A;  1NK2 P;  2Y9Z A;  3HEF A;  4B4C A;  1APL C;  2EZL A;  3BR2 A;  2NS7 A;  4UUT A;  1VND A;  4LOC A;  3ZOB A;  1LE8 B;  5GPC A;  5GP9 A;  1EF4 A;  2HXI A;  1OCT C;  5J1R A;  3GTP J;  4FE7 A;  3S15 J;  4X6A J;  2EZK A;  1Z77 A;  3LOC A;  2X48 A;  1O4X A;  3BTL A;  5K7H A;  1ETW A;  2MSY A;  2LLK A;  5EEA A;  3JRC A;  3S1Q J;  2Y30 A;  4W97 A;  4C3J J;  1T56 A;  3RZO J;  3RQI A;  3M3Y J;  4MLO A;  1ENH A;  9ANT A;  4IHX A;  1GDT A;  1FTT A;  5C44 J;  1MSF C;  4I6Z A;  1A5J A;  4M3F A;  4IHW A;  1B72 B;  2AHQ A;  3BG9 A;  4IEJ A;  1GV2 A;  3M4O J;  3CDL A;  2M0C A;  2EZH A;  1T33 A;  2R5Z A;  3SFI A;  1NTC A;  1ZGW A;  3S2H J;  1TWA J;  1XC5 A;  1B8I B;  4A3I J;  2XB0 X;  3WHC A;  3LSR A;  3D1N I;  1ETV A;  1S7E A;  3OOU A;  3OSF A;  3H3V K;  2XGC A;  1ETO A;  1X58 A;  3O8G A;  4M3E A;  3K2A A;  3S1N J;  4IHY A;  2DMN A;  4QIW N;  1BJZ A;  1JTX A;  1RPW A;  4XIC A;  5EG0 B;  2JA6 J;  1JUP A;  2JA5 J;  3I4N J;  5EZG A;  5C4J J;  4JX4 A;  1JJ6 C;  3S2D J;  1RET A;  5IOY A;  5GPA A;  4DYR A;  4EEF G;  3JRF A;  2LK2 A;  2IEK A;  2G0E A;  3BR5 A;  3JRI A;  4S0H B;  1JKO C;  2TCT A;  4D7M A;  1Q1V A;  2H1K A;  4A69 C;  3MKL A;  1U78 A;  1CQT A;  5IP9 J;  5EDN A;  4B1R A;  1GT0 C;  1QPI A;  2Y0S N;  1LFB A;  2IBD A;  3MN2 A;  1JGG A;  1MH4 A;  1ZTR A;  2DMQ A;  1B72 A;  2WB1 N;  4A3B J;  3S14 J;  2IAI A;  3PO2 J;  5F1J A;  4DYQ A;  1VFC A;  1IRZ A;  1UHS A;  2CJJ A;  3TW6 A;  1W0T A;  2CUF A;  5DS9 A;  1W0U A;  1IC8 A;  2VUM J;  5FKO A;  2L0K A;  1B8I A;  2VKE A;  2XPU A;  1WGX A;  2K40 A;  4V2G A;  1A6I A;  1IDZ A;  3IV5 A;  1MSE C;  4A3C J;  4JX5 A;  2MGQ A;  3O8H A;  1PUF B;  1GV5 A;  2EQR A;  2DJN A;  5FKL A;  1SFO J;  2R7Z J;  1AHD P;  2B63 J;  1WH5 A;  2L7F P;  1MNM C;  1U9N A;  3BR6 A;  2D5V A;  2XSD C;  4XRM A;  4A3D J;  2M8G X;  5EG0 A;  5M3F J;  3BR0 A;  1HDP A;  2E2I J;  5IPA A;  4GFB A;  2XPW A;  2K9Q A;  1IUF A;  2HQ5 A;  2TRT A;  5F08 A;  2RAE A;  3BT9 A;  3BG5 A;  4DYC A;  2KDZ A;  2DMP A;  5M5Y J;  4DZP A;  2ME0 A;  1D5Y A;  3CMY A;  3SJM A;  2GLO A;  1ZR4 A;  1GUU A;  4J19 A;  4QTR A;  3HDD A;  5EYR A;  2JJ7 A;  1JJ8 C;  4HNV A;  1X2N A;  1ZK8 A;  2E2H J;  1HOM A;  2HOA A;  4MO7 A;  4FTH A;  5FLV A;  2N8G A;  3PO3 J;  4ABZ A;  3TW7 A;  1F43 A;  3B6A A;  1YRN B;  1QVT A;  3BG3 A;  5J1U A;  3NAR A;  1MBF A;  5E3M A;  2L7Z A;  2YS9 A;  1F36 A;  3FK6 A;  4AYB N;  1XG1 A;  2EBI A;  2LKX A;  3CQZ J;  3A03 A;  1RKW A;  2GBY A;  2K9N A;  5K7F A;  3BTI A;  3ZQH A;  5F0F A;  2QF7 A;  1PUF A;  1MBK A;  2M2E A;  3UKG A;  1TC3 C;  4CYC B;  2EH3 A;  2CQQ A;  3BR3 A;  2DMT A;  1E3O C;  2ZB9 A;  2R93 J;  2Y2Z A;  5E3O A;  3HOZ J;  4JP0 A;  1ORK A;  5EGO A;  3G1O A;  3RKQ A;  4A3G J;  3GTG J;  2OF7 A;  3E7L A;  4M3G A;  1MBG A;  2HOS A;  4FCY A;  2XPV A;  2R5Y B;  5E3N A;  2LY9 A;  2JMW A;  3HOU J;  2E1O A;  5J3L A;  5C3E J;  3LNQ A;  2DA4 A;  3Q0W A;  3QQA A;  5FKK A;  1JTY A;  3Q0V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...