2X48A

Orf 55 from sulfolobus islandicus rudivirus 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
54
structure length
54
Chain Sequence
MKKEIQVQGVRYYVESEDDLVSVAHELAKMGYTVQQIANALGVSERKVRRYLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rod-shaped virus 1
molecule tags Viral protein
molecule keywords CAG38821
total genus 18
structure length 54
sequence length 54
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13384 HTH_23 Homeodomain-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2x48A00
2WB1N 5J1RA 2EZHA 2EZIA 4FTHA 3HDDA 1BL0A 2XGEA 5EYRA 1R9TJ 1U8BA 4C3JJ 2CJJA 1ZGWA 2LK2A 1JUSA 3Q0WA 3H3VK 2QCOA 1ZTRA 1MBFA 4A3GJ 5C44J 1BA5A 1RKTA 3RKQA 1GUUA 3WHCA 3GTQJ 3GTLJ 2XPWA 1LFUP 5GPAA 2DMQA 3A02A 1LE8A 5E3LA 1VI0A 2Y0SN 4RDUA 2L0KA 2GLOA 2NVTJ 2Y2ZA 3ZOBA 3PO3J 1UG2A 3A03A 2YUSA 3FIWA 4V2GA 4D7NA 1JT0A 1UMQA 2FX0A 5F27A 1JKQC 1U9NA 1WI3A 2LFBA 2ME6A 4X1EA 1RR7A 5JLXA 2MW8A 2ME0A 2L7ZA 3ZQLA 4BBSJ 5GPCA 4B3AA 3G1MA 5FKKA 1AKHA 5IP6A 2LY9A 3HB9A 3TW7A 3GTOJ 4A3CJ 1XS9A 2AHQA 2K9QA 4A3EJ 4G12A 1WGXA 4Y7NJ 3JRAA 1HCRA 1IUFA 3LSGA 1WH5A 2E1OA 2MG4A 1B8IA 5IOYA 5J1UA 1W0TA 1GVDA 3OIOA 4UUTA 2M0CA 4D5FA 2CUFA 5M5WJ 3O8HA 3S16J 4A3MJ 3GTGJ 3S15J 1MBEA 2HOAA 3HBLA 2GBYA 2R5ZB 1B8IB 2DMUA 1AKHB 3GTJJ 2JA7J 3UKGA 3GBGA 1ITYA 3HOZJ 2NS7A 5EG0B 4A3KJ 1HOMA 1QVUA 4BBRJ 3RZDJ 4MIMA 5F0FA 1JKOC 4XICA 3BR6A 4MO7A 3S1RJ 4FE4A 2JN6A 2Y9ZA 1JKPC 4LOCA 1ZKGA 4V2FA 1H88C 1X2NA 1S7EA 1I50J 2R7ZJ 3HOWJ 1ETYA 1TWGJ 4XIDA 1MH4A 5C3EJ 3BTIA 5F04A 1OFCX 5EG0A 1GV5A 3IH3A 4DZJA 4AC0A 5M3FJ 3GTMJ 4IHYA 2G0EA 2K9SA 5DTDA 4I6ZA 5EDNA 3HGGA 2VKVA 3DCFA 3FK7A 5FKMA 4XRSA 5F08A 3CDLA 3E7LA 4FE7A 4C3HJ 3HOYJ 2ID3A 4D7MA 2JK3A 2HQ5A 2NOGA 5E3OA 4DYQA 2IEKA 2JA8J 1NK2P 4XK4A 1ETQA 5F0CA 2ZB9A 2XRLA 1JTXA 2FJ1A 2ID6A 4QIWN 3JRGA 5FKNA 3I4MJ 1BW5A 4A69C 2L7MP 4S0HB 5FLMJ 2X9DA 3OOUA 1FEXA 4W1UA 4BXXJ 2HXOA 1F43A 3S14J 2TCTA 2ECCA 1HLVA 3BG3A 1P7JA 5BNGA 3ZQGA 1IC8A 2PMZN 3ZQIA 4IEJA 1SFOJ 4XRSG 3HOUJ 2E2JJ 9ANTA 1JUPA 2M2EA 1X58A 1A6IA 1FIAA 4HNVA 2VPRA 4M6VA 4B4CA 1MSFC 4XRMA 5EGOA 3S1QJ 1P7IA 2E2IJ 3SFIA 2EH3A 2AO9A 5IPAA 1YRNA 2HOSA 1W0UA 3S2HJ 2R93J 2XGDA 3QPSA 4UUSB 2W48A 5K7ZA 5FJ8J 2EQRA 1WPKA 3F0CA 2O7OA 3B6CA 2DN0A 1AU7A 3M4OJ 5K7HA 2DA5A 2EZKA 2HI3A 1U9OA 2OPTA 3S1NJ 5EGOB 1XC5A 1B72B 1T56A 1IRZA 1FIPA 3B6AA 2IAIA 4M3FA 4MFEA 2L9RA 4UUSA 2DA2A 1WH7A 2OF7A 1VF9A 3ZQHA 3JRFA 2FD5A 3BG9A 3C2BA 5GP9A 4A3LJ 3BR5A 1H8AC 2LKXA 3JRCA 4A3JJ 3JRDA 5E3MA 3LSJA 2M34A 1O4XA 1TWFJ 5EZHA 3TEDA 2LTPA 2X48A 3RZOJ 1IDZA 1ETOA 1QPIA 3MN2A 3HM5A 3L1PA 1FTTA 1I6HJ 3ZQCA 1HF0A 4QSHA 2HOTA 1QRYA 4Y52J 3SDGA 4A3BJ 5K7FA 3JRHA 5EEAA 3Q0VA 2M9HA 3PO2J 4C3IJ 2JWTA 1BJZA 3S2DJ 2Y9YA 4BKXA 3JRIA 1ZQ3P 1FJLA 2O9LA 4MFDA 2ELKA 3RQIA 2VI6A 3OSGA 2JA5J 2R5YA 1MBJA 4DZPA 4BY7J 2H1KA 4M3GA 2LVSA 3BQZA 1F36A 3BR1A 3ZQFA 2DMPA 5F0HA 2R5YB 3QQAA 1RESA 2DA1A 3H0GJ 2DA6A 2VKEA 3BTCA 4AUXA 5IP7J 4RBOA 2XSDC 3CMYA 1APLC 1WCMJ 1Z0XA 3D1NI 3QPLA 2HXIA 1Y1WJ 1Z77A 1E3OC 2IBDA 3Q0UA 2KDZA 2CRGA 4CYCB 3HOVJ 3Q3SA 4A3IJ 3HEFA 1VNDA 2DMNA 1HDPA 3BTLA 1GDTA 5IYDJ 5JLWA 1NTCA 1XG1A 5FKLA 1GV2A 1D5YA 1VFCA 2LR8A 4FCYA 3MVPA 5EZGA 4CYCA 4JX5A 1K61A 5J1YA 4NDLA 2D5VA 4JYKA 4FISA 1JJ6C 1MBHA 1RETA 1MBKA 5FLVA 3GTKJ 1EF4A 4BY1J 5F1JA 3LOCA 3BG5A 3FKIJ 3WHBA 2JA6J 3MKLA 4M3DA 4D5CA 1JGGA 3HKZN 1OCPA 2EZLA 4EEFG 1A5JA 1HDDC 1LE8B 2EBIA 2HYJA 4M3EA 2P81A 3FK6A 2QF7A 5IYCJ 2HDDA 4A3FJ 2GM4A 2O8KA 1JUMA 2H8RA 5IP9J 3M3YJ 5EF6A 4QTRA 4ABZA 1MH3A 1UHSA 2FQ4A 4M3BA 5HODA 3FISA 5FKOA 2R92J 2E2HJ 2X6OA 3A01A 1CQTA 5M5XJ 3CCYA 1H89C 1T33A 1OCTC 2COBA 4X6AJ 2Y30A 2K40A 2NS8A 2ECBA 2DJNA 1PUFA 3IV5A 4I76A 3S1MJ 1IV6A 1ORKA 4DYCA 2R0QC 2JMWA 3VPRA 5M3MJ 2LD5A 1IGNA 3LSRA 1POGA 2DA3A 2Y31A 2CU7A 1ZK8A 1LFBA 3K7AJ 2CUEA 1U78A 3TP0A 2DA7A 1MBGA 2XPUA 1MSEC 5M5YJ 1ETXA 3TW6A 5IOZA 2E19A 2M8GX 3G1OA 1JJ8C 2LLKA 3LSPA 4B1RA 3SJMA 2I10A 3HOXJ 1YRNB 2NVYJ 3IH4A 3OSFA 3JREA 1JTYA 5DS9A 3CQZJ 3TP3A 4J19A 1RKWA 1ETVA 1SANA 4GFBA 1NK3P 2TRTA 3I4NJ 1DU0A 1ENHA 2L7FP 2NVXJ 2R5ZA 3W6VA 3LNQA 3JRBA 4IHVA 2NVQJ 5C4JJ 3JR9A 2MSYA 3IH2A 4A3DJ 1JKRC 3DEWA 2MGQA 3G1LA 5J3LA 2YU9J 2YS9A 2CQQA 2RAEA 1TWHJ 5C4XJ 1FTZA 1K83J 5E3NA 1OJLA 1TWCJ 4C2MJ 4JX4A 2K9NA 2XGCA 2DA4A 3NARA 2B63J 1I3QJ 2VUMJ 2DTZA 4L5EA 2WAQN 1DU6A 4MLOA 1G2HA 1IDYA 3GTPJ 2LP0A 3HGYA 2JJ7A 3BTJA 5IYBJ 1JT6A 2XPVA 3NAUA 1BW6A 2N8GA 1Q1VA 1ETWA 4A93J 1ZR2A 1TC3C 2XB0X 1IJWC 3BR3A 1Y1VJ 1PUFB 1ETKA 4DW6A 1AHDP 2WV1A 1QVTA 4JX6A 1IG7A 2CQXA 1ZR4A 1X2MA 3S17J 1MNMC 4DYRA 3A01B 1TWAJ 4IHWA 1RPWA 2DMTA 4JP0A 4W97A 3PM1A 2KT0A 3BQYA 3BT9A 3BR0A 4IHXA 3BR2A 3K2AA 3O8GA 4AYBN 2XB5A 1B72A 1GT0C
chains in the Genus database with same CATH superfamily
3TOAA 4DBQA 2EZHA 1DGWY 3HDDA 1UJ8A 1YIOA 4GXOA 4XSZF 3TO9A 4ZDLA 2QA4I 2LK2A 1ZGWA 4ZTFA 1ZTRA 3G73A 4A12A 3V8LA 1T6SA 1H0MA 3N05A 3V4GA 2BY3A 1RKTA 4M9XA 1SFXA 3M9AA 3PFIA 3RKQA 1Z3YA 3SYTA 1F9NA 5ICGA 2XPWA 3PNVA 2E60A 5GPAA 2DMQA 3HPHA 1UHWA 4ZYDA 5KVRA 4RDUA 3CCLI 2L0KA 3GUDA 2KRFA 2VBWA 4GGGA 2Y2ZA 3SHFA 1ZLJA 2MLKA 5BOXA 5EJCA 4V2GA 4HNUA 1WQ2A 1UMQA 2FX0A 5ILSA 1TZLA 3MZ8A 2J5OA 3ZMSA 3PQJA 4J00A 4BBSJ 2EFNA 5GPCA 1N75A 4AVZA 3SZGA 3JW4A 3CCEI 1XS9A 1YW7A 4LB5A 2KRHA 2K9QA 5H6RA 4A3EJ 2CW8A 4G12A 2FOWA 2BBYA 3BY6A 3JRAA 1BI0A 1IUFA 3MD2A 1WH5A 4GDFA 3L09A 1L0OC 1B8IA 3FXQA 4RS8A 5J1UA 3JSOA 1R4MB 4HF0A 1IW7F 1D8KA 3CC2I 5JFRA 1SVOA 1OYIA 3RKWA 2IS1A 3PUFA 2DXIA 2A69F 4NB5A 2XKOA 3CP2A 4XL9A 3GTJJ 2JA7J 2KP6A 3UKGA 3BLYA 2XASA 3KFWX 3LFKA 4EJWA 4U0WA 1T0FA 5EG0B 2KRCA 4A3KJ 2ADUA 2ZXJA 3PNTA 2CMPA 2WB1A 1HOMA 1HA8A 2QKLB 3WTSC 2ZC2A 2RNJA 3QP6A 3GEZA 3KP4A 4IVNA 1RR8C 3ESWB 3O3KA 3S1RJ 1YJWI 4RAFA 3QU6A 5LEJA 2W84A 3W6JB 1Z7LA 3F9KA 3K10A 1H88C 1X2NA 2CQKA 1OISA 2BW3A 1MJ9A 2A6HF 2E36A 4PK4A 5DUKA 3AAFA 2R7SA 3ABUA 1EKEA 3SDBA 1I5ZA 3BTIA 2VKHA 4IF4A 3S3NA 3CJTB 4OIPF 3OS0A 1X1BA 2XIGA 4AC0A 4XLAA 3WTTC 3U1KA 2MBFA 2IGKA 3M8FA 2BE5F 2EFPA 2VKVA 3FK7A 5FKMA 3G71I 3JAMZ 2FU4A 3E7LA 4FE7A 4C3HJ 2TDXA 4D7MA 1FYMA 5FRMA 2JK3A 4FT8A 2HQ5A 4ENMA 2KKOA 2F5EA 1OYWA 2DODA 4ZZLA 1EA3A 1NK2P 3GLXA 2IS6A 4LIVA 5E18F 2CFXA 4II2A 2FJ1A 1V3FA 2FXAA 2D2WA 3F6VA 2RC4A 2GOMA 3VWBA 1BW5A 4BJ6C 5LRRA 3BJAA 4IL6C 4KNYA 3FZVA 3OOUA 3L9FA 4MTEA 4BXXJ 1ZH5A 4QLCU 2K9LA 1D3YA 4Y13A 1OMIA 1O57A 5TRDA 1I1GA 2P4WA 1YX3A 2Q2EA 3HOUJ 2MA3A 9ANTA 4BHPA 2XF7A 4UVAA 1TL8A 1O3TA 3VYTB 1FIAA 4ZJZA 1MSFC 3S1QJ 3ZGKA 2ACJA 5IPAA 1KU2A 1U5TB 2BZTA 1G3WA 1Z05A 3ECOA 3C3WA 3CMEI 5J47A 1NG7A 1PJRA 2HS5A 4G7OF 2O7OA 1AU7A 3S3OA 4I0AA 4XORA 3RJPA 1NH3A 1KA8A 4ZDOA 1LDDA 2XV4S 2FF4A 3QODA 1XC5A 5EGOB 1B72B 1FIPA 4UUSA 1I39A 1YE9A 2OF7A 1OCRH 1K78A 4LJZF 1WJEA 2BEOA 1H8AC 3HL2A 2V79A 2KQRA 3ZMDA 2EV0A 1GXPA 1HW2A 2Q1ZB 3A2KA 1O4XA 3GW2A 2Y69H 5EZHA 2LTPA 1W7PD 4MHGA 5LBQA 4AM3A 1QPIA 3MN2A 4HG2A 3KEQA 3VDXA 3J7AY 4U0VA 5DYMA 1K79A 5IT9Z 3K4BA 1QRYA 1B6AA 4PSXA 4G6DA 2AQEA 3JRHA 4UY8I 3RPQA 2LYCA 2M9HA 3N97A 2JWTA 1ZREA 2QZ8A 3L2RA 3RQIA 2VI6A 2V9VA 4XOTA 1YHQI 3U2RA 2ZMEC 3OSGA 3C2HA 3QPTA 3TMOA 1D1AA 3JTHA 1E17A 4BY7J 1OR7C 2EFQA 1YW8A 4N9HA 2JT1A 3BQZA 2YR2A 3FF5A 3FWEA 4O6JA 3ZQFA 2PMZA 2CV1A 1JI8A 1SD7A 2R5YB 2H6CA 4NC6A 1FP1D 3CC4I 3KYDB 4UXNA 1X3UA 2X6YA 2OTJI 2W7NA 4BH9A 3CO7C 4FASD 3L00A 3BJ6A 1RC9A 3VYRB 5DD4A 4OMZA 1R1UA 2IRFG 1S29A 2KZVA 1SVMA 4OMYA 2CFOA 3HKZA 3K2ZA 2PEXA 3Q0UA 2LF7A 4KT5C 3CCJI 2ZJPF 1ZARA 3DKWA 2QBYB 3CDHA 5LGUA 4NQWA 3HSRA 3IUOA 4P5OA 4FCYA 3MVPA 5EZGA 2L2OA 4JX5A 2K85A 3P9IA 4FHTA 1OCOH 5D5WB 1OQYA 1MZBA 3CDIA 1Z6TA 3GTKJ 2XRNA 4BY1J 2DFFA 5F1JA 4ESBA 1J5YA 1RIOH 4YEJA 3MKLA 2K4BA 1PUEE 2PMHA 4QPQA 3I56I 2LF8A 1XGOA 2EINH 2DAOA 1ZRCA 1ACIA 3I5UA 2ZBKA 3PFYA 3CUQC 1LE8B 4XKVA 1HDDC 1V5EA 1V4RA 4M3EA 2LG4A 2QF7A 2QLZA 2YSRA 2HFHA 4EGZA 1QZEA 4GRIA 2GM4A 1FOXA 2EPFA 4ITVA 4Y33A 3ZRGA 2VBYA 4PJMA 1FOYA 3F22A 1HXDA 5EF6A 1SMYF 2ZMEB 2ESNA 4BEHA 1SFUA 4E7SA 4WXHA 1MH3A 2QGUA 4M3BA 4F3QA 5LD2C 3N4MA 1J9IA 1D1CA 3FISA 3GZNB 2LH9A 3U1DA 3OR2C 1XMKA 3BZ6A 1T33A 4PCQA 1OCTC 2COBA 4UNOA 2M30A 5E8IA 1WWXA 1LVAA 2LREA 1XPXA 2CV2A 2NS8A 2VIXA 3PUBA 3ZR8X 3CUQA 2XF6A 3RPUA 1VQ9I 2HVSA 2R0QC 4NBQA 3EQLF 4L5JA 3VPRA 3L2UA 2LD5A 2R7OA 2EK5A 2LMDA 3FX3A 4F93B 1IGNA 4RAYA 2LDUA 1OKRA 1LFPA 1D0XA 1K6OA 2BXYA 2QSHX 2XPUA 1AOYA 3GZ6A 1MSEC 4HLXA 2HTJA 3DLLF 1JJ8C 1IXCA 2M8GX 3LSPA 1LUJB 3BPVA 4LIUA 3CMAI 1VQKI 3T8TA 3SJMA 2X4HA 4NQWB 2EA2A 5CYVA 1FWZA 1TTYA 2W00A 2NVYJ 2CQNA 2JRMA 3IH4A 2VT3A 4G9YA 4RM2A 4Q47A 2RVCA 1VZ0A 3R60A 2K5CA 1RKWA 4I7HA 2OJED 5B5EC 4GFBA 2CW0F 2IA1A 3MKWB 2L7FP 1WJ5A 4XN0A 3JRBA 3OIPA 4JK1X 3H9GA 2AXTC 3OYDA 4CCNA 5D5UB 3DBRB 4A0YA 1UHMA 1TNSA 3M1CA 3G1LA 2HGCA 2H8WA 4RM3A 2YU9J 4HDVA 2RAEA 1TWHJ 5C4XJ 4Q5SF 1K6YA 3A1YA 5JHUA 4BDZA 2P7CB 2F48A 2VODA 5KK1A 1P4WA 1OYYA 4C2MJ 2OD5A 3BOQA 3BPXA 1YJ9I 2XGCA 1LPQA 5D8KB 1ZG5A 2B63J 2P6SA 2ZMEA 3ZMZA 2Z1DA 4L5EA 1O3SA 1DU6A 2X85A 2K3PA 4EV0A 3W2WA 1YIJI 1X1PA 1K4SA 1AWCA 4DOZA 4KIFA 2HPIA 4BHCA 2D1HA 2FMLA 4OU0A 2LOOA 4N0BA 4L9NA 1MGTA 1YI2I 3BR3A 1F4KA 4EM2A 4HW0A 2PN6A 1ETKA 2QYOA 4B8XA 1AHDP 2BOLA 2WV1A 1IG7A 1X2MA 1HBXG 1IRXA 1QQIA 3S17J 4RGRA 2XAJA 2KIQA 4BNCA 1RPWA 2E7WA 3V7RA 2KT0A 1TW2A 3NWSA 1FBSA 3BWGA 3C2GA 4CA0A 3BQYA 2XC7A 3MKYB 2IJLA 3ERED 1H9GA 5FD5A 3RYPA 1VTNC 3IHUA 2M7BA 1W0UA 2XB5A 2WV0A 2LC2A 5JR3A 1G3YA 3LA2A 2GZWA 3MAJA 2EZIA 3QAHA 5FGMA 2XGEA 1PYVA 2PX9A 4C3JJ 3HJEA 2CJJA 1JUSA 2ZXWH 3Q0WA 4RB3C 2QVOA 1BA5A 3ZQ7A 3HTSB 4CYDA 1J09A 4RB2C 2IGMA 4BXFA 2VXDA 2KLOA 1WSUA 2LY2A 2YU3A 4MGRA 4FX0A 3L2CA 2DT6A 5GAHJ 4HF2A 1UFMA 1VI0A 2Y0SN 4OIOF 2CSOA 4E7ZA 3HRUA 3CCUI 3DU5A 2GLOA 3VSKA 2GIZA 2A68F 2GXGA 4F92B 3VODA 2OCEA 5F64A 4CZCA 3A03A 5AONA 3ZN0A 1GXQA 3WE3A 1BR1A 4E7HA 2DPDA 4WK8F 2O61A 1U9NA 1WI3A 1V5GA 3WTXC 1RR7A 5JLXA 4HQMA 1T39A 4LGWA 4IHSA 3L2QA 3ZQLA 3DEUA 2V1UA 2LBFA 2O8XA 2ELHA 4Q4ZF 4Q48A 5FKKA 1X1AA 2X1EA 5H2FC 5IP6A 1Y39A 1NHAA 3TW7A 3GTOJ 4A3CJ 4YFXF 4WCGA 5KNLA 3CCQI 2AHQA 2WTEA 1WGXA 2CS3A 2M7AA 2DBBA 3B73A 3DU6A 5LHHA 4LLGF 5LHIA 1LB2A 3ZMUA 2Q0OA 3FHNA 3FXJA 2MG4A 5A2QK 4ZTJA 3OIOA 4A5MA 5ILVA 3ZPLA 1AA7A 5CVJA 3S16J 4DNCA 1E2XA 3AG4H 1MBEA 3S15J 3HBLA 2R7TA 3DEEA 5FO5A 1ZYRF 3J81Z 2R4GA 4BYYA 2DMUA 1O3RA 4CGZA 3KP3A 1ITYA 1B4AA 3HOZJ 2CUJA 2PJRB 4ANJA 2ZJ2A 4BBRJ 3RZDJ 1EV7A 3DLAA 4MIMA 5F0FA 1JKOC 1EJ9A 4XICA 1JGSA 3BR6A 1SFKA 4MO7A 3H3UA 4FE4A 3WE2A 2CO5A 3T1BA 1HC8A 3CMMA 4BHBA 3LSHA 2PJPA 2DO7A 4LLLA 2GQQA 1ETYA 1TWGJ 2VJ4A 3E97A 2HPMA 4M6YA 4CZZA 5J8CA 1IV8A 1NG6A 4KDPA 2BYVE 5HS9A 2MH2A 4IRGA 2BY0A 3GTMJ 4YIRX 3ROUA 3FXKA 3WU1B 2G0EA 3F8BA 3R61A 5DTDA 2JPBA 2I5UA 4I6ZA 5EDNA 2IW5A 1IF1A 2DTRA 4G94A 5K5OA 3HOYJ 2XDVA 1IAWA 1PDNC 3M1EA 4L9VA 4BAYA 1W5CC 4UB8C 3H1CA 1Z1DA 2NOGA 2JVHA 3NQOA 2IEKA 2DT5A 4QPOA 2JA8J 3K4LA 4CCMA 2IGOA 4XK4A 3KLOA 2UV1A 2MC3A 5F0CA 3BC8A 2DOFA 3ZN1A 2V7FA 3OYIA 2ID6A 3ZXSA 3JRGA 2DQLA 3BZCA 5FKNA 4EM1A 3J7YJ 4GCVA 4XMYA 4A69C 4N4OB 2F5FA 1XB4A 2XGXA 3WTZA 4ENNA 4KYWA 2HXOA 3MKZA 2L4MA 3K4KA 3BG3A 1P7JA 3ZQGA 1FBQA 2ZKZA 4XLHA 1W5SA 2PMZN 3CUQB 4B44A 3ZQIA 4IEJA 4XRSG 1JUPA 4EMSA 3IC7A 2O6GE 1X58A 4HZFA 4XR6A 3DTEA 4HNVA 3COAC 4M6VA 4B4CA 5EGOA 2I8DA 1P7IA 3WG9A 3SFIA 2E2IJ 2HOSA 4UUSB 4BUPA 3OIQA 4O5VA 2Z2SB 2G7UA 1WPKA 4XRFA 4HSRA 2L01A 2EB7A 4XONA 2DN0A 3GZ5A 3M4OJ 1ZGAA 5FD6A 2DA5A 2WAFA 3F6OA 1USSA 3S1NJ 4XKBA 1ODDA 4C9YA 3G4SI 4E7LA 1U8RA 1U3EM 4HRIA 1G6NA 1I27A 1ZGJA 2IGNA 3B6AA 4MEYF 2MC4A 2A61A 2K9MA 3GFIA 3IP4B 4GYGA 1HSJA 4U87A 3HHGA 4U7BA 1J59A 4D1QA 2EV5A 3HUGA 3C2BA 5GP9A 3CC7I 2K27A 3ABKH 4EJUA 2G7HA 3JRCA 4A3JJ 3RIRA 4ZYHA 5E3MA 2RNGA 2M34A 5DM6F 1TBXA 2CW7A 5AIPA 4P9FA 3BJOA 4A6DA 2P5VA 5CQEA 4BU2A 5L3GA 3LA3A 3M8JA 2R7FA 5GADJ 4ON0A 2HZTA 6PAXA 4QWQA 2DOAA 1HF0A 4LK1F 1CF7A 2HOTA 4AIHA 4A3BJ 3Q0VA 4R8HA 4CCJA 4LK0F 3JRIA 4BKXA 4N9IA 3S2DJ 3QPHA 1N77A 2FMYA 1FJLA 2VN2A 4MFDA 1P2FA 1ZQ3P 1W36D 4HAMA 1YYVA 4YFKF 2LBFB 5BMZA 2DDAA 2VXZA 4IRHA 2W4SA 1J75A 4DZPA 3H92A 3I54A 2H1KA 4B48A 4FETA 1HKTA 2LVSA 4D0PA 2V6CA 2O0YA 1EH7A 3IWFA 4MQVA 2EIMH 3REOA 1G59A 3QQAA 1MJAA 1RESA 1X3WB 1ZG1A 5FFXA 3H0GJ 4E4HA 2WY7Q 4PGHA 1VQLI 3BTCA 4RBOA 3CMYA 1APLC 1Z0XA 3QWLA 5CKTA 2Q2EB 3QPLA 3CP8A 1Y1WJ 4CICA 1BC8C 2UXNA 2KDZA 1B1BA 3RPUD 3HOVJ 4A3IJ 3HEFA 1E0EA 1VNDA 2DMNA 1OCZH 2DYRH 1GDTA 2W1OA 2CUZA 3ABMH 4AWXB 4KMFA 4RGXA 3X2QH 1FBUA 4MNUA 3EUHA 3FMQA 4CYCA 5HDKA 5JVTA 1BOBA 4BDYA 4NDLA 2D5VA 2EA4A 4FISA 1MBHA 4BE1A 1RETA 3KP5A 5FLVA 2P8TA 4R1HA 3K6GA 4PUSA 2VASA 1SC7A 2HVRA 1BI2A 3FKIJ 2Z9OA 1JGGA 5J4YA 3H36A 3ECHA 4AU7A 3HKZN 3QP5A 2A5WA 3PJRA 4DIQA 2EZLA 4CSWA 1O3QA 5D8LB 4EEFG 1A5JA 2HOEA 1MDMB 2EBIA 2F5DA 3CJRB 3W2VA 4UVCA 3S3MA 3FK6A 4KICA 2OCCH 4ESFA 4PJNA 2O8KA 4ENKA 2B0LA 4CCKA 1QO0D 2E34A 5GTIC 3ZP5A 4BE0A 4QTRA 2RQQA 4FQGA 4DJAA 1XMXA 4NNJA 3FBIB 3O2PE 4IO9F 2R92J 4HX8A 2X6OA 3EETA 1HKQA 3A01A 5M5XJ 3HRMA 5D5VB 2QSGX 1QZYA 5E1XA 3W3CA 5ERIA 3CLOA 3K1PA 1ZRDA 5CVVA 4B47A 1XDSA 2ECBA 4BXUA 3TDUC 3SFZA 1W1WE 4I76A 1STZA 4XKCA 1L3LA 3T8RA 3OWTA 1PVEA 4D9JA 1GLNA 1SD6A 3KIOA 2W85A 2R7UA 5M3MJ 1F1ZA 4OAYA 3TO6A 2JA2A 2E7XA 1S7AA 5HOOA 2ETHA 3K7AJ 5BPIA 2VQLA 3K4CA 3TP0A 2DA7A 2IP2A 4B43A 1ETXA 4IZZA 3G1OA 2L9SA 3S32A 2AQFA 3G2BA 4BQNA 1GHCA 2IA0A 3E1SA 4HOBA 4HF1A 4A0ZA 2OUMA 1YRNB 2EILH 3K70D 1YOVB 3OSFA 1UG0A 1B9MA 1CF7B 4P1WA 3D0SA 5DS9A 5KAFC 1D8JA 1Z21A 2PMUA 2WA0A 1XGMA 2GOXB 2QUFA 2IS4A 2HYGD 1NK3P 3I4NJ 2E35A 1JE8A 2NVQJ 1Z6RA 5DCFA 3LQRA 3DKYA 3BZKA 2X6WA 3LWFA 3IH2A 2HU9A 3PSIA 5HLGA 1JKRC 5L3BA 3DEWA 4B3XA 1YFHA 2MGQA 4F52A 4C2UA 1U2WA 3LFUA 5GAGJ 1FTZA 5D6EA 1HW1A 3RQ4A 2W25A 2HQRA 1JHHA 3OYHA 1W7PA 1OJLA 2HYFA 1TWCJ 4M9SA 1UCRA 2F5CA 3FXUA 4JX4A 1UB9A 1XSXA 2K9NA 1R00A 2VUMJ 2DT7B 4HLYA 4C2TA 2LSOA 2ZCWA 5ICEA 3A4CA 5JHFA 3JSPA 2VC1A 4XBFA 1R1VA 3OYAA 1G2HA 1UZCA 3GTPJ 2M0MA 5IY5H 1MMSA 5D5XB 3HGYA 3VYSB 1WKMA 3NAUA 1KQ8A 2VC0A 3FM5A 1YS6A 1KU3A 1Y1VJ 4L18B 2COMA 1I1SA 3DFGA 3K4JA 1VQ8I 2HQAA 2OC6A 3L2WA 2VT2A 4P96A 1ZLKA 4O3MA 4G6TB 4HX4A 2L4AA 3R6SA 4NC7A 1WJFA 4ZYEA 3KP2A 1MNMC 1TWAJ 2H1LA 2GA2A 1FYKA 3PM1A 3K69A 1QA6A 3VEPA 5KAIC 4IHXA 4FX4A 3IAS2 3OYGA 1B72A 3KX2A 2L5QA 3GXOA 1BI3A 1BL0A 5EYRA 3K1MA 4OAZA 2ZSIB 1U8BA 3C18A 4IOCF 3DQVC 3WTWC 1MBFA 1SMTA 5C44J 2ZFWA 3KYLA 1U5TC 3HOSA 3H5RA 4EJOA 4LG3A 1DGRM 3WHCA 5HVQC 5HLHA 1C0WA 1T98A 2JUGA 2KIUA 1PP7U 3J81K 3PL8A 1LFUP 3WU2C 1Y8RB 4MTDA 1Z3XA 3BROA 3JCUC 1DUXC 2XVCA 3HG9A 2DDBA 1QGPA 2QQ9A 2LRDA 1MMAA 1ULYA 5B1AH 1FX7A 2NVTJ 2WADA 2QEXI 3TDZC 5CQGA 3ZOBA 5B66C 3PO3J 1I6XA 3FIWA 3I4PA 4LITA 4D7NA 1JT0A 3K9TA 1S7OA 2ICWG 5F27A 2LFBA 4HQEA 2E5NA 3I64A 4X1EA 5LGTA 2V9KA 2ELJA 2MW8A 2ME0A 3GYHX 2Q8KA 2ZXIA 4B3AA 2NXNB 3NRVA 4CXFA 4YFNF 2LY9A 3HB9A 1JXSA 4HYEA 3IKTA 2WWYA 2F4OB 2BY2A 4LLNA 2PJRA 5KHDA 2R3SA 2CH0A 3OYMA 2OZ6A 4Y7NJ 4BQOA 2Y0SA 1HCRA 4AVPA 3OOPA 2E1NA 3EDPA 2H09A 2X1DA 4IX7A 1LEBA 2QSFX 2A05A 1ZG3A 3E5QA 1W0TA 3C7JA 2R7RA 4XNFA 4D5FA 1T2KA 3OL4A 2HTSA 3O8HA 2ZJRF 4BJ5C 4A3MJ 3GTGJ 1YX5A 4G8XA 2ZNYA 2H6BA 1B8IB 1AKHB 3FMRA 3GBGA 2NNNA 4KITB 4KFCA 4E6KG 3GLLA 4I98B 1X1CA 2JVGA 2XF5A 4WXCA 5E17F 2QQAA 2K3FA 2M4GA 4II3A 3TO7A 3LA7A 2JSCA 4XLNF 2VOPA 3CESA 2MLGA 2W24A 3F72A 3OS1A 2Y9ZA 1S9HA 4R79A 1X3ZB 1R49A 5E8GA 4UB6C 5FROA 5ICCA 1JKPC 3OYLA 4LOCA 3OS2A 4HV5A 1ZKGA 4E7JA 1WVRA 3KP6A 4V2FA 1VQ4I 1BR4A 2DK5A 2DLLA 3TGNA 3ONQA 1P4AA 4XIDA 5C3EJ 3MQ0A 1FY7A 3F23A 3AL0B 2R7VA 4IQ4A 2E5ZA 3LMMA 1GV5A 3IH3A 4DZJA 5M3FJ 4E7IA 1BIAA 3KYCB 4IHYA 2K9SA 3Q9VA 4LG0B 3W6KB 3HUGB 5LFAA 2KMUA 3DKXA 5TJJA 4PFOA 3LSIA 5LGNA 4C30A 5F08A 3CDLA 3VSLA 1V55H 2PLYA 1KU7A 2BV6A 1LJ9A 1USTA 4RB0A 1CGPA 4OWRB 2WC2A 3E0JB 2PG4A 1ZELA 2NS0A 2OAZA 3D5SC 2IXSA 4HX7A 4RA2A 4AIKA 2ZB9A 2E71A 2XRLA 1JTXA 5K5QA 4DGWB 1FNNA 1X4OA 1U6GA 5HS7A 1G8XA 1IN8A 5TGTA 4PSWA 2X9DA 2ZO4A 1FEXA 4W1UA 2KHMA 3J80K 5J6XA 3AG1H 2TCTA 3CF2A 2RREA 1TNTA 3CCRI 3RSNA 4RB1A 3Q5FA 4I2OA 2YPRA 4GYIA 1S5LC 3H5NA 2E2JJ 2M2EA 3WTUC 1A6IA 2VPRA 1Z91A 2XAHA 4HPQA 4XRMA 2FQ3A 5D4RA 1ZRFA 2HR3A 4I0BA 3RCOA 5D4SA 4WWCA 1ON1A 5F6FA 2XGDA 3QU3A 1FZPB 4M6XA 5K7ZA 4XLCA 4LB6B 1FC3A 3LSTA 4CO8A 1KQ9A 2RDPA 1ZN2A 2M3AA 2JTVA 3L2VA 5JVGF 1QBJA 3DPTA 4M9ZA 3H9QA 2EZKA 3QYBA 2KISA 4ZZDA 1U9OA 3P9CA 5L3FA 2R7WA 2DW4A 3U9GA 1LEAA 2YX4A 1T56A 4Y3OA 3V42A 4M3FA 1R6RA 2L9RA 4MFEA 4A6EA 2XROA 2DA2A 5EEHA 1SAUA 1W4MA 1BI1A 1VF9A 3ZQHA 3JRFA 2CWEA 3HC7A 2HNHA 4EJTA 4XQFA 3BR5A 1W36C 1P6RA 2D45A 2KDOA 3P5JA 4M72A 4N4NB 3I59B 3LSJA 3GVAA 3VYUB 3E5UA 4A0XA 3RZOJ 4ASNA 1A04A 3H9JA 2P5LC 4P55A 3L1PA 1G3SA 4ZYGA 4HNTA 1A35A 4QSHA 3ULQB 3CTAA 4Y52J 1XCBA 4YIIA 3SDGA 5EEAA 1MDMA 3SZPA 4OIRF 4C3IJ 1YJNI 3V7CA 2Y9YA 3H5AA 2V6EA 3CF5F 2ELKA 5E20A 1QHGA 3CCMI 2X6XA 4HBLA 3LAJA 2IA2A 4XLPF 2R5YA 2HDCA 1MBJA 4M73A 5FB2A 5HDGA 2EFWA 4UV8A 2FA5A 1R71A 1SFEA 2STWA 2NVUB 1WHUA 1F36A 3Q9SA 3E6CC 4IRIA 3QOEA 4XOPA 5DD8A 1WJDA 4EATA 2DA6A 3P9KA 3F8NA 1V54H 1BJAA 1YQAA 2VKEA 4AUXA 5IP7J 2JSPA 2BY1A 3DXJF 3AL0C 3OY9A 4XLEA 3JAMK 1E3OC 5K5RA 2IBDA 1XGSA 2CRGA 4OIQF 3Q3SA 5BPDA 2EV6A 2LKPA 3RKYA 4DQ2A 1HDPA 3BTLA 4K2EA 5IYDJ 1B59A 2HEOA 1XG1A 1GV2A 3VB2A 1D5YA 1VQ6I 5HS8A 2LR8A 2PQ8A 5FLXK 3R4KA 5F1RA 3BP8A 5J1YA 2QBYA 2A5YB 2L7KA 4JYKA 4Z6YA 1A36A 1XN7A 2VJIA 3H35A 1D5VA 1MBKA 3LOCA 4X0GA 3ZMTA 4ETSA 1R7JA 1LDJA 2UZKA 1BR2A 2JA6J 4D5CA 4M3DA 1YO5C 2QQ8A 5HLIA 3R0JA 3RDIA 4IKFA 4Y4RA 4XLFA 4I01A 4RLQA 2L3DA 3OYNA 1R5ID 3CUOA 1K78B 1E3HA 3KZIC 2Z16A 5HNHA 1MD0A 1Q1HA 5BS6A 1ZHFA 1DP7P 5GAEJ 3DV8A 3DTKA 5IYCJ 1SAXA 2FNAA 2EFOA 4AIJA 4A3FJ 1YITI 1RI7A 3QYEA 4IOAF 2NYXA 1JUMA 2STTA 2H8RA 5IP9J 2ISYA 3G3ZA 3M3YJ 3I53A 4ABZA 2HKXA 3GF2A 1TP4A 2Z99A 3GO5A 2NAZA 3GWZA 3V7SA 1UHSA 2FQ4A 5HODA 5E1WA 1JHFA 1P9QC 5FKOA 2E2HJ 2F6CA 2H94A 3ELKA 3CCYA 1H89C 3T5XA 5LLQA 2FEZA 1X19A 1R5GA 2XAGA 3UR3C 4X6AJ 4IXAA 2JZYA 3BCBA 4DYCA 4YG2F 4EVIA 2JMWA 3I58A 1D1BA 1POGA 3MWMA 1WJCA 2DA3A 2VPLA 1N78A 3FBNB 4CHUA 2CUEA 3DPUA 1U78A 2K4JA 1MBGA 5M5YJ 3ISPA 3TW6A 3B02A 2E19A 3F8CA 3DF8A 2E1MC 1LQ1A 5IT9K 2FBHA 2EIJH 4JBAA 3M8EA 3PQKA 3DP7A 4PFPA 1GVJA 1TQPA 1Y6IA 3GFMA 2XAQA 5L3DA 1RUOA 4UV9A 4KA4A 2A3SA 2HQNA 4J19A 4PZJA 3T0YA 1SANA 1DU0A 3E6BA 1W7PB 1ENHA 2KZGA 4IHVA 2R5ZA 3LNQA 3E5XA 5C4JJ 3JR9A 3AFHA 4HA8A 1IN4A 4LMYA 3QRFF 2GIVA 4CUGA 3ASOH 2HKOA 4IHTA 2NRAC 2CQQA 1DDNA 2AXLA 3SQNA 3K4MA 1K83J 5JI6A 1WZ2A 1MMGA 1XSVA 2DYSH 1T95A 5ICFA 1KYWA 2ZJQF 2LKSA 2YX7A 3NARA 3MCZA 1QHHD 4RGSA 2OA4A 2WAQN 3IRQA 4MLOA 4NUBA 2QENA 3I55I 2V1NA 2XAFA 2VQGA 3LQQA 3BG7A 3IL2A 2XPVA 3RTRA 3EUKL 2FBIA 1Q1VA 4A93J 3TOBA 1ZR2A 2GXBA 2GA1A 2P7VB 1IJWC 3F3XA 4E7KA 2OU2A 2VB6A 3F8MA 4Z2YA 4Y17A 3WTYC 4L0ZB 1I3AA 2FRHA 4J01A 1MW7A 3SEZA 3RI4A 1IUYA 5DDGA 1QVTA 3IWZA 4JX6A 1E3PA 1ZR4A 3ZQQA 2K02A 1M1EB 2IVMA 3K4NA 4EGYA 1VQOI 4DYRA 2V1DA 4F55A 2DMTA 5CVUA 4JP0A 4GO1A 4W97A 4NHJA 4JOMA 4CCOA 1KYZA 2K86A 4RMNA 5FFZA 3VOEA 3BT9A 3E6DA 3IKVA 5DUIA 3BR2A 3MZYA 2V4JC 3HPGA 4L9JA 3FKJA 2B9SA 1OPCA 3O8GA 1GT0C 2WB1N 5J1RA 4FTHA 1YG2A 3W2AA 1BOAA 2FUG2 2DJIA 5DM7F 1R9TJ 1UELB 4U88A 4E70A 4Y15A 4IJAA 3H3VK 2QCOA 2LY1A 4A3GJ 4BGDA 1D0YA 4L0YB 3FXRA 2CV0A 3KE2A 1U5TA 4ZYAA 3AKZA 1GUUA 2A6TA 3KCCA 3FXLA 4KN7X 4UUVA 3CO6C 2OQRA 1Z9CA 3GTQJ 3GTLJ 1LDKB 4MQ9F 1HSTA 4WX9A 1S6LA 1O7LA 3HYIA 2PFBA 3OYEA 2D1VA 3A02A 1LE8A 1FT9A 3HRSA 5E3LA 1S8NA 1T38A 3GFLA 2AS5F 1KGSA 2F4IA 3OYFA 3ZCOA 3LSMA 1UG2A 4AYBA 3I9V2 1H9TA 3KEYA 2L9VA 2YUSA 1T08B 3KEOA 5ED4A 4P9UA 1IZ1A 1XCVA 1JKQC 2M87A 2ME6A 1Z7UA 4AIDA 1WI9A 2HDWA 2M5WA 3J80Z 2KFDA 5HLTA 2L7ZA 3MZHA 1EH6A 2JPCA 2BHZA 2VJ5A 3G1MA 3QOPA 2VE9A 1AKHA 2WBMA 5DCMB 3CCSI 2VKDA 4G6QA 4DBRA 1Y56A 1R58A 3BDDA 3FMSA 3CJQB 2RGVA 3CLQA 3HHHA 3ABLH 2GXAA 3ASNH 3DPLC 4L5IA 2EIKH 3LSGA 2E1OA 3BG6A 3O6BB 1XSDA 1A6QA 4AD9A 1YTYA 5IOYA 4KJZA 1RNLA 1GVDA 4UUTA 2CGPA 5J4VA 2M0CA 2CYYA 2CUFA 4LD5A 5M5WJ 2DOEA 3I3LA 2DK8A 2P6TA 3RYRA 1VQNI 1BN5A 2HOAA 4IPAA 2GBYA 2R5ZB 1DP3A 2MD0A 5J40A 3EYIA 1SEUA 1IRGA 4V19K 1QU3A 2MD5A 2NS7A 3OMYA 3U21A 2FE3A 1QVUA 2VONA 1YLFA 2ZXHA 4ZC3A 1IO2A 4H0EA 3V8KA 4RLFA 2DFEA 4XN3A 2DFIA 4EM0B 4ZH4F 2JN6A 1YW9A 1MMDA 2GAUA 3FDYA 1FPQA 3AG3H 3M7GA 2O5RA 4LG0A 1S7EA 2KJCA 4I09A 1I50J 1X4PA 4RGUA 4KIBA 4LFUA 5IT3A 1FOWA 2R7ZJ 3HOWJ 2VQCA 2Z3YA 2KL4A 3IRRA 1MH4A 1R36A 2ESHA 4KIGA 1VQMI 5F04A 1SVLA 1OFCX 5EG0A 2GWRA 2OV7A 1ONVA 4CDGA 2XUBA 1X1DA 3HSEA 3E6MA 1R4NB 5H6QA 4PJLA 1PP8F 3WU0A 4YRVA 4A2UA 1MJBA 3DCFA 3HGGA 2RKHA 4OINF 4XRSA 3KETA 3QYFA 3WGHA 2ID3A 3GX4X 3GCMA 1VQPI 2C6YA 5EEGA 3ML6A 3SZTA 2XKPA 5E1ZB 5E3OA 4DYQA 2MFZA 4XSXF 4M71A 1IN5A 1ETQA 1LNWA 1MNDA 2IPQX 4QIWN 2UUZA 2DPUA 5LRSA 4BE2A 3I4MJ 2X51A 2L7MP 4S0HB 1S72I 3FM3A 5FLMJ 4EJVA 1OCCH 3EPZA 2V9PA 3C1DA 1F43A 1WRJA 3S14J 3I0TA 2ECCA 1KQ0A 3M07A 1HLVA 5BNGA 1IC8A 2IS2A 3ERMA 3NEUA 2JRTA 5D6FA 4PDKA 4HV6A 2L54A 4HEA2 2XSJC 4UVBA 1SFOJ 4RAZA 2BW3B 3PSFA 4MEXF 1B9NA 1J0RA 2E1CA 3JTGA 3FHZA 2W57A 2EH3A 2AO9A 2XAUA 3DWLE 1YRNA 3G6EI 3S2HJ 2OQGA 4KN4X 2R93J 3QPSA 2W48A 5FJ8J 2EQRA 3MFKA 2A6EF 4CH7A 3F0CA 3B6CA 1RZ4A 1TLHB 5K7HA 1WJAA 4TV7A 5GTHC 2HI3A 5H20A 2OPTA 3CD6I 3KPHA 1TT0A 4WF2A 1MNEA 4BJTA 5K1YA 4KISA 2MABA 1IRZA 2IAIA 1FOKA 2IT0A 1G3TA 2DQRA 2DU9A 2VJJA 3EUHC 1WH7A 2P0WA 4BQQA 5FRNA 5B1BH 1K4TA 2V26A 4PGGA 2F5VA 4F7ZA 1VQ7I 1XTAA 2FD5A 2R7DA 3BG9A 4A3LJ 2LNBA 3FXOA 2Y48A 2LKXA 1KONA 1QNTA 3EYYA 2NNYA 2JQ7A 2HZDA 4HDUA 3JRDA 3F8FA 3OV8A 2MH9A 1TWFJ 3TEDA 2X48A 5KCMA 1XD7A 1IDZA 1ETOA 2HVQA 3K1NA 3SXYA 3KZYA 3HM5A 5CLSA 5FLXZ 1VQ5I 4KUMA 1FTTA 1I6HJ 5TISC 3ZQCA 1QZZA 1A31A 1XMAA 2M45A 5K7FA 5CJ9A 3PO2J 1Z67A 2ZNZA 5CPRB 1BJZA 3S2WA 1TQIA 5E79C 1FMWA 2FOKA 2O9LA 2M8EA 2QM3A 1IXSB 1MKMA 2O3FA 2JA5J 2ZSHB 2QKMB 1BIBA 2J5PA 2BVLA 3HTUA 4M3GA 2FBKA 5AIQA 2OTLI 3GMEA 3BR1A 3MEXA 2FSWA 2EWNA 2DMPA 1DPUA 3D5RC 1FSEA 3HRTA 5F0HA 1F5TA 1WFXA 2RQPA 2DA1A 4ZDPA 2A07F 1O7FA 3TKYA 2VLAA 3PIOF 2XSDC 3GFJA 1XGNA 1J2XA 1WCMJ 4RAGA 1REPC 3D1NI 2HXIA 2F4MB 4A3DJ 1Z77A 3KLNA 5BQTA 3NWTA 4F91B 2RV8A 3KP7A 4WXDA 4CYCB 3CJNA 2WAQA 4PJJA 1Y0NA 2WY8Q 3SEQA 5JLWA 1NTCA 1V5FA 2PI0A 5FKLA 1MMNA 3L7WA 1VFCA 1XDUA 2E1MB 2KIFA 2VL8A 2K7LA 2FNPA 1K61A 4B09A 4ESJA 4U7DA 2DFHA 2QQBA 4S05A 1JJ6C 3WTVC 1KZHA 3LSKA 2CG4A 1OLTA 3KZZA 2BHYA 5L3CA 1EF4A 4G7ZF 2MYSA 3CZ6A 3BG5A 3J7AO 3ABTA 1Y8QB 3H0DA 2XHKA 2KPMA 3F21A 3WHBA 1KU9A 3TQNA 3PNYA 3E3VA 5HDNA 3J7ZI 1FSHA 2NOJB 1YS7A 1LKXA 2UXXA 2X1CA 2Y0MA 1OCPA 4M74A 3MMYB 1W5TA 4XM3A 1D0ZA 1TQMA 2HYJA 2P81A 4G7HF 3R0AA 5DV5A 1RRJA 4PJ0C 3K0LA 2HDDA 2W82A 2X0LA 1DQUA 5DEQA 1FMVA 1IRFA 5LEKA 1SD4A 3WGGA 1T0FC 5ILUA 2VOOA 4U0YA 2P5KA 3OL3A 3HSFA 5A2QZ 1HQCA 4BQAA 3P7NA 4UHTA 2EJRA 3DTIA 4EQQA 1BM9A 1CQTA 1RUNA 4HSTA 1SD5A 1P92A 3I71A 1OR7A 2M4KA 3HZJA 2R7XA 3K70C 3A0BC 3HOTA 4A5NA 3LL7A 2Y30A 3UNGC 3TL4X 2K40A 2DJNA 4IQJA 1PUFA 3IV5A 3S1MJ 1WJBA 1ORKA 1IV6A 1S3JA 2G9WA 3ZMVA 4ENJA 5CVRA 1QPMA 3DBLB 1IN6A 4BL0B 3LSRA 5CVIA 2Y31A 2ZFUA 2CU7A 1ZK8A 1LFBA 3AG2H 1K7AA 4XKWA 3LAPA 2R7QA 5IOZA 2LLKA 2RN7A 4B1RA 1R1TA 2I10A 3HOXJ 3HXLA 1U0JA 3OYKA 1ZAOA 2O03A 4I99C 3RKXA 3JREA 2L9NA 4JQFA 2WAEA 4S04A 3FXMA 2CQ7A 1JTYA 3V8JA 1N25A 3H3ZA 2H27A 1R22A 2OZUA 3CQZJ 3TP3A 3DBHB 2QWWA 2Z5UA 1ETVA 3WODF 1LVKA 2TRTA 1P4XA 1ON2A 1Y0UA 4KT6A 2NVXJ 3W6VA 1G4DA 2DCEA 1TW3A 2MSYA 4CCLA 2Y75A 3OYJA 1FP2A 3OYCA 4OOIA 4H4KC 5J3LA 3S8PA 2YS9A 1ERDA 2Z33A 1UAAA 2V1XA 1XX5A 1EH8A 3WGIA 4L9TA 5E3NA 4BS9A 4YELA 2B7EA 3WG7H 4BEHB 2BVMA 2JUCA 3BCAA 3OR1C 2DA4A 2VQHA 1I3QJ 2BXZA 2DTZA 2L02A 1BBYA 1DPRA 4YIFA 4NC8A 1IDYA 2BGCA 2LP0A 2VBZA 5J8FA 3A0HC 2JJ7A 3BTJA 3VFZA 2KJBA 1JT6A 5IYBJ 2HWVA 1BW6A 2N8GA 2VE8A 1ETWA 1R5HA 2KIMA 1TC3C 1BC7C 2XB0X 5LHGA 3HIFA 4BACA 3OYBA 2DI3A 1PUFB 1TT5B 1FLIA 2VBXA 4DW6A 3IAM2 2M1BA 3D5LA 1J7KA 3I59A 4I02A 4KMUX 2CQXA 2ISZA 1IXRC 3TBIA 3A01B 4IHWA 1HW5A 1MIJA 3CCVI 5L3EA 2OBPA 2F2EA 3PIPF 3BR0A 3EUAA 5B3SH 1R23A 1HKSA 1IN7A 3S93A 3K2AA 5DCMA 5HNFA 1T8IA 2PBIA 4AYBN 1FYLA 2UWMA
chains in the Genus database with same CATH topology
2WB1N 5J1RA 2EZHA 2EZIA 4FTHA 3HDDA 1BL0A 2XGEA 5EYRA 1R9TJ 1U8BA 4C3JJ 2CJJA 1ZGWA 2LK2A 1JUSA 3Q0WA 3H3VK 2QCOA 1ZTRA 1MBFA 4A3GJ 5C44J 1BA5A 1RKTA 3RKQA 1GUUA 3WHCA 3GTQJ 3GTLJ 2XPWA 1LFUP 5GPAA 2DMQA 3A02A 1LE8A 5E3LA 1VI0A 2Y0SN 4RDUA 2L0KA 2GLOA 2NVTJ 2Y2ZA 3ZOBA 3PO3J 1UG2A 3A03A 2YUSA 3FIWA 4V2GA 4D7NA 1JT0A 1UMQA 2FX0A 5F27A 1JKQC 1U9NA 1WI3A 2LFBA 2ME6A 4X1EA 1RR7A 5JLXA 2MW8A 2ME0A 2L7ZA 3ZQLA 4BBSJ 5GPCA 4B3AA 3G1MA 5FKKA 1AKHA 5IP6A 2LY9A 3HB9A 3TW7A 3GTOJ 4A3CJ 1XS9A 2AHQA 2K9QA 4A3EJ 4G12A 1WGXA 4Y7NJ 3JRAA 1HCRA 1IUFA 3LSGA 1WH5A 2E1OA 2MG4A 1B8IA 5IOYA 5J1UA 1W0TA 1GVDA 3OIOA 4UUTA 2M0CA 4D5FA 2CUFA 5M5WJ 3O8HA 3S16J 4A3MJ 3GTGJ 3S15J 1MBEA 2HOAA 3HBLA 2GBYA 2R5ZB 1B8IB 2DMUA 1AKHB 3GTJJ 2JA7J 3UKGA 3GBGA 1ITYA 3HOZJ 2NS7A 5EG0B 4A3KJ 1HOMA 1QVUA 4BBRJ 3RZDJ 4MIMA 5F0FA 1JKOC 4XICA 3BR6A 4MO7A 3S1RJ 4FE4A 2JN6A 2Y9ZA 1JKPC 4LOCA 1ZKGA 4V2FA 1H88C 1X2NA 1S7EA 1I50J 2R7ZJ 3HOWJ 1ETYA 1TWGJ 4XIDA 1MH4A 5C3EJ 3BTIA 5F04A 1OFCX 5EG0A 1GV5A 3IH3A 4DZJA 4AC0A 5M3FJ 3GTMJ 4IHYA 2G0EA 2K9SA 5DTDA 4I6ZA 5EDNA 3HGGA 2VKVA 3DCFA 3FK7A 5FKMA 4XRSA 5F08A 3CDLA 3E7LA 4FE7A 4C3HJ 3HOYJ 2ID3A 4D7MA 2JK3A 2HQ5A 2NOGA 5E3OA 4DYQA 2IEKA 2JA8J 1NK2P 4XK4A 1ETQA 5F0CA 2ZB9A 2XRLA 1JTXA 2FJ1A 2ID6A 4QIWN 3JRGA 5FKNA 3I4MJ 1BW5A 4A69C 2L7MP 4S0HB 5FLMJ 2X9DA 3OOUA 1FEXA 4W1UA 4BXXJ 2HXOA 1F43A 3S14J 2TCTA 2ECCA 1HLVA 3BG3A 1P7JA 5BNGA 3ZQGA 1IC8A 2PMZN 3ZQIA 4IEJA 1SFOJ 4XRSG 3HOUJ 2E2JJ 9ANTA 1JUPA 2M2EA 1X58A 1A6IA 1FIAA 4HNVA 2VPRA 4M6VA 4B4CA 1MSFC 4XRMA 5EGOA 3S1QJ 1P7IA 2E2IJ 3SFIA 2EH3A 2AO9A 5IPAA 1YRNA 2HOSA 1W0UA 3S2HJ 2R93J 2XGDA 3QPSA 4UUSB 2W48A 5K7ZA 5FJ8J 2EQRA 1WPKA 3F0CA 2O7OA 3B6CA 2DN0A 1AU7A 3M4OJ 5K7HA 2DA5A 2EZKA 2HI3A 1U9OA 2OPTA 3S1NJ 5EGOB 1XC5A 1B72B 1T56A 1IRZA 1FIPA 3B6AA 2IAIA 4M3FA 4MFEA 2L9RA 4UUSA 2DA2A 1WH7A 2OF7A 1VF9A 3ZQHA 3JRFA 2FD5A 3BG9A 3C2BA 5GP9A 4A3LJ 3BR5A 1H8AC 2LKXA 3JRCA 4A3JJ 3JRDA 5E3MA 3LSJA 2M34A 1O4XA 1TWFJ 5EZHA 3TEDA 2LTPA 2X48A 3RZOJ 1IDZA 1ETOA 1QPIA 3MN2A 3HM5A 3L1PA 1FTTA 1I6HJ 3ZQCA 1HF0A 4QSHA 2HOTA 1QRYA 4Y52J 3SDGA 4A3BJ 5K7FA 3JRHA 5EEAA 3Q0VA 2M9HA 3PO2J 4C3IJ 2JWTA 1BJZA 3S2DJ 2Y9YA 4BKXA 3JRIA 1ZQ3P 1FJLA 2O9LA 4MFDA 2ELKA 3RQIA 2VI6A 3OSGA 2JA5J 2R5YA 1MBJA 4DZPA 4BY7J 2H1KA 4M3GA 2LVSA 3BQZA 1F36A 3BR1A 3ZQFA 2DMPA 5F0HA 2R5YB 3QQAA 1RESA 2DA1A 3H0GJ 2DA6A 2VKEA 3BTCA 4AUXA 5IP7J 4RBOA 2XSDC 3CMYA 1APLC 1WCMJ 1Z0XA 3D1NI 3QPLA 2HXIA 1Y1WJ 1Z77A 1E3OC 2IBDA 3Q0UA 2KDZA 2CRGA 4CYCB 3HOVJ 3Q3SA 4A3IJ 3HEFA 1VNDA 2DMNA 1HDPA 3BTLA 1GDTA 5IYDJ 5JLWA 1NTCA 1XG1A 5FKLA 1GV2A 1D5YA 1VFCA 2LR8A 4FCYA 3MVPA 5EZGA 4CYCA 4JX5A 1K61A 5J1YA 4NDLA 2D5VA 4JYKA 4FISA 1JJ6C 1MBHA 1RETA 1MBKA 5FLVA 3GTKJ 1EF4A 4BY1J 5F1JA 3LOCA 3BG5A 3FKIJ 3WHBA 2JA6J 3MKLA 4M3DA 4D5CA 1JGGA 3HKZN 1OCPA 2EZLA 4EEFG 1A5JA 1HDDC 1LE8B 2EBIA 2HYJA 4M3EA 2P81A 3FK6A 2QF7A 5IYCJ 2HDDA 4A3FJ 2GM4A 2O8KA 1JUMA 2H8RA 5IP9J 3M3YJ 5EF6A 4QTRA 4ABZA 1MH3A 1UHSA 2FQ4A 4M3BA 5HODA 3FISA 5FKOA 2R92J 2E2HJ 2X6OA 3A01A 1CQTA 5M5XJ 3CCYA 1H89C 1T33A 1OCTC 2COBA 4X6AJ 2Y30A 2K40A 2NS8A 2ECBA 2DJNA 1PUFA 3IV5A 4I76A 3S1MJ 1IV6A 1ORKA 4DYCA 2R0QC 2JMWA 3VPRA 5M3MJ 2LD5A 1IGNA 3LSRA 1POGA 2DA3A 2Y31A 2CU7A 1ZK8A 1LFBA 3K7AJ 2CUEA 1U78A 3TP0A 2DA7A 1MBGA 2XPUA 1MSEC 5M5YJ 1ETXA 3TW6A 5IOZA 2E19A 2M8GX 3G1OA 1JJ8C 2LLKA 3LSPA 4B1RA 3SJMA 2I10A 3HOXJ 1YRNB 2NVYJ 3IH4A 3OSFA 3JREA 1JTYA 5DS9A 3CQZJ 3TP3A 4J19A 1RKWA 1ETVA 1SANA 4GFBA 1NK3P 2TRTA 3I4NJ 1DU0A 1ENHA 2L7FP 2NVXJ 2R5ZA 3W6VA 3LNQA 3JRBA 4IHVA 2NVQJ 5C4JJ 3JR9A 2MSYA 3IH2A 4A3DJ 1JKRC 3DEWA 2MGQA 3G1LA 5J3LA 2YU9J 2YS9A 2CQQA 2RAEA 1TWHJ 5C4XJ 1FTZA 1K83J 5E3NA 1OJLA 1TWCJ 4C2MJ 4JX4A 2K9NA 2XGCA 2DA4A 3NARA 2B63J 1I3QJ 2VUMJ 2DTZA 4L5EA 2WAQN 1DU6A 4MLOA 1G2HA 1IDYA 3GTPJ 2LP0A 3HGYA 2JJ7A 3BTJA 5IYBJ 1JT6A 2XPVA 3NAUA 1BW6A 2N8GA 1Q1VA 1ETWA 4A93J 1ZR2A 1TC3C 2XB0X 1IJWC 3BR3A 1Y1VJ 1PUFB 1ETKA 4DW6A 1AHDP 2WV1A 1QVTA 4JX6A 1IG7A 2CQXA 1ZR4A 1X2MA 3S17J 1MNMC 4DYRA 3A01B 1TWAJ 4IHWA 1RPWA 2DMTA 4JP0A 4W97A 3PM1A 2KT0A 3BQYA 3BT9A 3BR0A 4IHXA 3BR2A 3K2AA 3O8GA 4AYBN 2XB5A 1B72A 1GT0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 N;  5J1R A;  2EZH A;  2EZI A;  4FTH A;  3HDD A;  1BL0 A;  2XGE A;  5EYR A;  1R9T J;  1U8B A;  4C3J J;  2CJJ A;  1ZGW A;  2LK2 A;  1JUS A;  3Q0W A;  3H3V K;  2QCO A;  1ZTR A;  1MBF A;  4A3G J;  5C44 J;  1BA5 A;  1RKT A;  3RKQ A;  1GUU A;  3WHC A;  3GTQ J;  3GTL J;  2XPW A;  1LFU P;  5GPA A;  2DMQ A;  3A02 A;  1LE8 A;  5E3L A;  1VI0 A;  2Y0S N;  4RDU A;  2L0K A;  2GLO A;  2NVT J;  2Y2Z A;  3ZOB A;  3PO3 J;  1UG2 A;  3A03 A;  2YUS A;  3FIW A;  4V2G A;  4D7N A;  1JT0 A;  1UMQ A;  2FX0 A;  5F27 A;  1JKQ C;  1U9N A;  1WI3 A;  2LFB A;  2ME6 A;  4X1E A;  1RR7 A;  5JLX A;  2MW8 A;  2ME0 A;  2L7Z A;  3ZQL A;  4BBS J;  5GPC A;  4B3A A;  3G1M A;  5FKK A;  1AKH A;  5IP6 A;  2LY9 A;  3HB9 A;  3TW7 A;  3GTO J;  4A3C J;  1XS9 A;  2AHQ A;  2K9Q A;  4A3E J;  4G12 A;  1WGX A;  4Y7N J;  3JRA A;  1HCR A;  1IUF A;  3LSG A;  1WH5 A;  2E1O A;  2MG4 A;  1B8I A;  5IOY A;  5J1U A;  1W0T A;  1GVD A;  3OIO A;  4UUT A;  2M0C A;  4D5F A;  2CUF A;  5M5W J;  3O8H A;  3S16 J;  4A3M J;  3GTG J;  3S15 J;  1MBE A;  2HOA A;  3HBL A;  2GBY A;  2R5Z B;  1B8I B;  2DMU A;  1AKH B;  3GTJ J;  2JA7 J;  3UKG A;  3GBG A;  1ITY A;  3HOZ J;  2NS7 A;  5EG0 B;  4A3K J;  1HOM A;  1QVU A;  4BBR J;  3RZD J;  4MIM A;  5F0F A;  1JKO C;  4XIC A;  3BR6 A;  4MO7 A;  3S1R J;  4FE4 A;  2JN6 A;  2Y9Z A;  1JKP C;  4LOC A;  1ZKG A;  4V2F A;  1H88 C;  1X2N A;  1S7E A;  1I50 J;  2R7Z J;  3HOW J;  1ETY A;  1TWG J;  4XID A;  1MH4 A;  5C3E J;  3BTI A;  5F04 A;  1OFC X;  5EG0 A;  1GV5 A;  3IH3 A;  4DZJ A;  4AC0 A;  5M3F J;  3GTM J;  4IHY A;  2G0E A;  2K9S A;  5DTD A;  4I6Z A;  5EDN A;  3HGG A;  2VKV A;  3DCF A;  3FK7 A;  5FKM A;  4XRS A;  5F08 A;  3CDL A;  3E7L A;  4FE7 A;  4C3H J;  3HOY J;  2ID3 A;  4D7M A;  2JK3 A;  2HQ5 A;  2NOG A;  5E3O A;  4DYQ A;  2IEK A;  2JA8 J;  1NK2 P;  4XK4 A;  1ETQ A;  5F0C A;  2ZB9 A;  2XRL A;  1JTX A;  2FJ1 A;  2ID6 A;  4QIW N;  3JRG A;  5FKN A;  3I4M J;  1BW5 A;  4A69 C;  2L7M P;  4S0H B;  5FLM J;  2X9D A;  3OOU A;  1FEX A;  4W1U A;  4BXX J;  2HXO A;  1F43 A;  3S14 J;  2TCT A;  2ECC A;  1HLV A;  3BG3 A;  1P7J A;  5BNG A;  3ZQG A;  1IC8 A;  2PMZ N;  3ZQI A;  4IEJ A;  1SFO J;  4XRS G;  3HOU J;  2E2J J;  9ANT A;  1JUP A;  2M2E A;  1X58 A;  1A6I A;  1FIA A;  4HNV A;  2VPR A;  4M6V A;  4B4C A;  1MSF C;  4XRM A;  5EGO A;  3S1Q J;  1P7I A;  2E2I J;  3SFI A;  2EH3 A;  2AO9 A;  5IPA A;  1YRN A;  2HOS A;  1W0U A;  3S2H J;  2R93 J;  2XGD A;  3QPS A;  4UUS B;  2W48 A;  5K7Z A;  5FJ8 J;  2EQR A;  1WPK A;  3F0C A;  2O7O A;  3B6C A;  2DN0 A;  1AU7 A;  3M4O J;  5K7H A;  2DA5 A;  2EZK A;  2HI3 A;  1U9O A;  2OPT A;  3S1N J;  5EGO B;  1XC5 A;  1B72 B;  1T56 A;  1IRZ A;  1FIP A;  3B6A A;  2IAI A;  4M3F A;  4MFE A;  2L9R A;  4UUS A;  2DA2 A;  1WH7 A;  2OF7 A;  1VF9 A;  3ZQH A;  3JRF A;  2FD5 A;  3BG9 A;  3C2B A;  5GP9 A;  4A3L J;  3BR5 A;  1H8A C;  2LKX A;  3JRC A;  4A3J J;  3JRD A;  5E3M A;  3LSJ A;  2M34 A;  1O4X A;  1TWF J;  5EZH A;  3TED A;  2LTP A;  2X48 A;  3RZO J;  1IDZ A;  1ETO A;  1QPI A;  3MN2 A;  3HM5 A;  3L1P A;  1FTT A;  1I6H J;  3ZQC A;  1HF0 A;  4QSH A;  2HOT A;  1QRY A;  4Y52 J;  3SDG A;  4A3B J;  5K7F A;  3JRH A;  5EEA A;  3Q0V A;  2M9H A;  3PO2 J;  4C3I J;  2JWT A;  1BJZ A;  3S2D J;  2Y9Y A;  4BKX A;  3JRI A;  1ZQ3 P;  1FJL A;  2O9L A;  4MFD A;  2ELK A;  3RQI A;  2VI6 A;  3OSG A;  2JA5 J;  2R5Y A;  1MBJ A;  4DZP A;  4BY7 J;  2H1K A;  4M3G A;  2LVS A;  3BQZ A;  1F36 A;  3BR1 A;  3ZQF A;  2DMP A;  5F0H A;  2R5Y B;  3QQA A;  1RES A;  2DA1 A;  3H0G J;  2DA6 A;  2VKE A;  3BTC A;  4AUX A;  5IP7 J;  4RBO A;  2XSD C;  3CMY A;  1APL C;  1WCM J;  1Z0X A;  3D1N I;  3QPL A;  2HXI A;  1Y1W J;  1Z77 A;  1E3O C;  2IBD A;  3Q0U A;  2KDZ A;  2CRG A;  4CYC B;  3HOV J;  3Q3S A;  4A3I J;  3HEF A;  1VND A;  2DMN A;  1HDP A;  3BTL A;  1GDT A;  5IYD J;  5JLW A;  1NTC A;  1XG1 A;  5FKL A;  1GV2 A;  1D5Y A;  1VFC A;  2LR8 A;  4FCY A;  3MVP A;  5EZG A;  4CYC A;  4JX5 A;  1K61 A;  5J1Y A;  4NDL A;  2D5V A;  4JYK A;  4FIS A;  1JJ6 C;  1MBH A;  1RET A;  1MBK A;  5FLV A;  3GTK J;  1EF4 A;  4BY1 J;  5F1J A;  3LOC A;  3BG5 A;  3FKI J;  3WHB A;  2JA6 J;  3MKL A;  4M3D A;  4D5C A;  1JGG A;  3HKZ N;  1OCP A;  2EZL A;  4EEF G;  1A5J A;  1HDD C;  1LE8 B;  2EBI A;  2HYJ A;  4M3E A;  2P81 A;  3FK6 A;  2QF7 A;  5IYC J;  2HDD A;  4A3F J;  2GM4 A;  2O8K A;  1JUM A;  2H8R A;  5IP9 J;  3M3Y J;  5EF6 A;  4QTR A;  4ABZ A;  1MH3 A;  1UHS A;  2FQ4 A;  4M3B A;  5HOD A;  3FIS A;  5FKO A;  2R92 J;  2E2H J;  2X6O A;  3A01 A;  1CQT A;  5M5X J;  3CCY A;  1H89 C;  1T33 A;  1OCT C;  2COB A;  4X6A J;  2Y30 A;  2K40 A;  2NS8 A;  2ECB A;  2DJN A;  1PUF A;  3IV5 A;  4I76 A;  3S1M J;  1IV6 A;  1ORK A;  4DYC A;  2R0Q C;  2JMW A;  3VPR A;  5M3M J;  2LD5 A;  1IGN A;  3LSR A;  1POG A;  2DA3 A;  2Y31 A;  2CU7 A;  1ZK8 A;  1LFB A;  3K7A J;  2CUE A;  1U78 A;  3TP0 A;  2DA7 A;  1MBG A;  2XPU A;  1MSE C;  5M5Y J;  1ETX A;  3TW6 A;  5IOZ A;  2E19 A;  2M8G X;  3G1O A;  1JJ8 C;  2LLK A;  3LSP A;  4B1R A;  3SJM A;  2I10 A;  3HOX J;  1YRN B;  2NVY J;  3IH4 A;  3OSF A;  3JRE A;  1JTY A;  5DS9 A;  3CQZ J;  3TP3 A;  4J19 A;  1RKW A;  1ETV A;  1SAN A;  4GFB A;  1NK3 P;  2TRT A;  3I4N J;  1DU0 A;  1ENH A;  2L7F P;  2NVX J;  2R5Z A;  3W6V A;  3LNQ A;  3JRB A;  4IHV A;  2NVQ J;  5C4J J;  3JR9 A;  2MSY A;  3IH2 A;  4A3D J;  1JKR C;  3DEW A;  2MGQ A;  3G1L A;  5J3L A;  2YU9 J;  2YS9 A;  2CQQ A;  2RAE A;  1TWH J;  5C4X J;  1FTZ A;  1K83 J;  5E3N A;  1OJL A;  1TWC J;  4C2M J;  4JX4 A;  2K9N A;  2XGC A;  2DA4 A;  3NAR A;  2B63 J;  1I3Q J;  2VUM J;  2DTZ A;  4L5E A;  2WAQ N;  1DU6 A;  4MLO A;  1G2H A;  1IDY A;  3GTP J;  2LP0 A;  3HGY A;  2JJ7 A;  3BTJ A;  5IYB J;  1JT6 A;  2XPV A;  3NAU A;  1BW6 A;  2N8G A;  1Q1V A;  1ETW A;  4A93 J;  1ZR2 A;  1TC3 C;  2XB0 X;  1IJW C;  3BR3 A;  1Y1V J;  1PUF B;  1ETK A;  4DW6 A;  1AHD P;  2WV1 A;  1QVT A;  4JX6 A;  1IG7 A;  2CQX A;  1ZR4 A;  1X2M A;  3S17 J;  1MNM C;  4DYR A;  3A01 B;  1TWA J;  4IHW A;  1RPW A;  2DMT A;  4JP0 A;  4W97 A;  3PM1 A;  2KT0 A;  3BQY A;  3BT9 A;  3BR0 A;  4IHX A;  3BR2 A;  3K2A A;  3O8G A;  4AYB N;  2XB5 A;  1B72 A;  1GT0 C; 
#chains in the Genus database with same CATH topology
 3TOA A;  4DBQ A;  2EZH A;  1DGW Y;  3HDD A;  1UJ8 A;  1YIO A;  4GXO A;  4XSZ F;  3TO9 A;  4ZDL A;  2QA4 I;  2LK2 A;  1ZGW A;  4ZTF A;  1ZTR A;  3G73 A;  4A12 A;  3V8L A;  1T6S A;  1H0M A;  3N05 A;  3V4G A;  2BY3 A;  1RKT A;  4M9X A;  1SFX A;  3M9A A;  3PFI A;  3RKQ A;  1Z3Y A;  3SYT A;  1F9N A;  5ICG A;  2XPW A;  3PNV A;  2E60 A;  5GPA A;  2DMQ A;  3HPH A;  1UHW A;  4ZYD A;  5KVR A;  4RDU A;  3CCL I;  2L0K A;  3GUD A;  2KRF A;  2VBW A;  4GGG A;  2Y2Z A;  3SHF A;  1ZLJ A;  2MLK A;  5BOX A;  5EJC A;  4V2G A;  4HNU A;  1WQ2 A;  1UMQ A;  2FX0 A;  5ILS A;  1TZL A;  3MZ8 A;  2J5O A;  3ZMS A;  3PQJ A;  4J00 A;  4BBS J;  2EFN A;  5GPC A;  1N75 A;  4AVZ A;  3SZG A;  3JW4 A;  3CCE I;  1XS9 A;  1YW7 A;  4LB5 A;  2KRH A;  2K9Q A;  5H6R A;  4A3E J;  2CW8 A;  4G12 A;  2FOW A;  2BBY A;  3BY6 A;  3JRA A;  1BI0 A;  1IUF A;  3MD2 A;  1WH5 A;  4GDF A;  3L09 A;  1L0O C;  1B8I A;  3FXQ A;  4RS8 A;  5J1U A;  3JSO A;  1R4M B;  4HF0 A;  1IW7 F;  1D8K A;  3CC2 I;  5JFR A;  1SVO A;  1OYI A;  3RKW A;  2IS1 A;  3PUF A;  2DXI A;  2A69 F;  4NB5 A;  2XKO A;  3CP2 A;  4XL9 A;  3GTJ J;  2JA7 J;  2KP6 A;  3UKG A;  3BLY A;  2XAS A;  3KFW X;  3LFK A;  4EJW A;  4U0W A;  1T0F A;  5EG0 B;  2KRC A;  4A3K J;  2ADU A;  2ZXJ A;  3PNT A;  2CMP A;  2WB1 A;  1HOM A;  1HA8 A;  2QKL B;  3WTS C;  2ZC2 A;  2RNJ A;  3QP6 A;  3GEZ A;  3KP4 A;  4IVN A;  1RR8 C;  3ESW B;  3O3K A;  3S1R J;  1YJW I;  4RAF A;  3QU6 A;  5LEJ A;  2W84 A;  3W6J B;  1Z7L A;  3F9K A;  3K10 A;  1H88 C;  1X2N A;  2CQK A;  1OIS A;  2BW3 A;  1MJ9 A;  2A6H F;  2E36 A;  4PK4 A;  5DUK A;  3AAF A;  2R7S A;  3ABU A;  1EKE A;  3SDB A;  1I5Z A;  3BTI A;  2VKH A;  4IF4 A;  3S3N A;  3CJT B;  4OIP F;  3OS0 A;  1X1B A;  2XIG A;  4AC0 A;  4XLA A;  3WTT C;  3U1K A;  2MBF A;  2IGK A;  3M8F A;  2BE5 F;  2EFP A;  2VKV A;  3FK7 A;  5FKM A;  3G71 I;  3JAM Z;  2FU4 A;  3E7L A;  4FE7 A;  4C3H J;  2TDX A;  4D7M A;  1FYM A;  5FRM A;  2JK3 A;  4FT8 A;  2HQ5 A;  4ENM A;  2KKO A;  2F5E A;  1OYW A;  2DOD A;  4ZZL A;  1EA3 A;  1NK2 P;  3GLX A;  2IS6 A;  4LIV A;  5E18 F;  2CFX A;  4II2 A;  2FJ1 A;  1V3F A;  2FXA A;  2D2W A;  3F6V A;  2RC4 A;  2GOM A;  3VWB A;  1BW5 A;  4BJ6 C;  5LRR A;  3BJA A;  4IL6 C;  4KNY A;  3FZV A;  3OOU A;  3L9F A;  4MTE A;  4BXX J;  1ZH5 A;  4QLC U;  2K9L A;  1D3Y A;  4Y13 A;  1OMI A;  1O57 A;  5TRD A;  1I1G A;  2P4W A;  1YX3 A;  2Q2E A;  3HOU J;  2MA3 A;  9ANT A;  4BHP A;  2XF7 A;  4UVA A;  1TL8 A;  1O3T A;  3VYT B;  1FIA A;  4ZJZ A;  1MSF C;  3S1Q J;  3ZGK A;  2ACJ A;  5IPA A;  1KU2 A;  1U5T B;  2BZT A;  1G3W A;  1Z05 A;  3ECO A;  3C3W A;  3CME I;  5J47 A;  1NG7 A;  1PJR A;  2HS5 A;  4G7O F;  2O7O A;  1AU7 A;  3S3O A;  4I0A A;  4XOR A;  3RJP A;  1NH3 A;  1KA8 A;  4ZDO A;  1LDD A;  2XV4 S;  2FF4 A;  3QOD A;  1XC5 A;  5EGO B;  1B72 B;  1FIP A;  4UUS A;  1I39 A;  1YE9 A;  2OF7 A;  1OCR H;  1K78 A;  4LJZ F;  1WJE A;  2BEO A;  1H8A C;  3HL2 A;  2V79 A;  2KQR A;  3ZMD A;  2EV0 A;  1GXP A;  1HW2 A;  2Q1Z B;  3A2K A;  1O4X A;  3GW2 A;  2Y69 H;  5EZH A;  2LTP A;  1W7P D;  4MHG A;  5LBQ A;  4AM3 A;  1QPI A;  3MN2 A;  4HG2 A;  3KEQ A;  3VDX A;  3J7A Y;  4U0V A;  5DYM A;  1K79 A;  5IT9 Z;  3K4B A;  1QRY A;  1B6A A;  4PSX A;  4G6D A;  2AQE A;  3JRH A;  4UY8 I;  3RPQ A;  2LYC A;  2M9H A;  3N97 A;  2JWT A;  1ZRE A;  2QZ8 A;  3L2R A;  3RQI A;  2VI6 A;  2V9V A;  4XOT A;  1YHQ I;  3U2R A;  2ZME C;  3OSG A;  3C2H A;  3QPT A;  3TMO A;  1D1A A;  3JTH A;  1E17 A;  4BY7 J;  1OR7 C;  2EFQ A;  1YW8 A;  4N9H A;  2JT1 A;  3BQZ A;  2YR2 A;  3FF5 A;  3FWE A;  4O6J A;  3ZQF A;  2PMZ A;  2CV1 A;  1JI8 A;  1SD7 A;  2R5Y B;  2H6C A;  4NC6 A;  1FP1 D;  3CC4 I;  3KYD B;  4UXN A;  1X3U A;  2X6Y A;  2OTJ I;  2W7N A;  4BH9 A;  3CO7 C;  4FAS D;  3L00 A;  3BJ6 A;  1RC9 A;  3VYR B;  5DD4 A;  4OMZ A;  1R1U A;  2IRF G;  1S29 A;  2KZV A;  1SVM A;  4OMY A;  2CFO A;  3HKZ A;  3K2Z A;  2PEX A;  3Q0U A;  2LF7 A;  4KT5 C;  3CCJ I;  2ZJP F;  1ZAR A;  3DKW A;  2QBY B;  3CDH A;  5LGU A;  4NQW A;  3HSR A;  3IUO A;  4P5O A;  4FCY A;  3MVP A;  5EZG A;  2L2O A;  4JX5 A;  2K85 A;  3P9I A;  4FHT A;  1OCO H;  5D5W B;  1OQY A;  1MZB A;  3CDI A;  1Z6T A;  3GTK J;  2XRN A;  4BY1 J;  2DFF A;  5F1J A;  4ESB A;  1J5Y A;  1RIO H;  4YEJ A;  3MKL A;  2K4B A;  1PUE E;  2PMH A;  4QPQ A;  3I56 I;  2LF8 A;  1XGO A;  2EIN H;  2DAO A;  1ZRC A;  1ACI A;  3I5U A;  2ZBK A;  3PFY A;  3CUQ C;  1LE8 B;  4XKV A;  1HDD C;  1V5E A;  1V4R A;  4M3E A;  2LG4 A;  2QF7 A;  2QLZ A;  2YSR A;  2HFH A;  4EGZ A;  1QZE A;  4GRI A;  2GM4 A;  1FOX A;  2EPF A;  4ITV A;  4Y33 A;  3ZRG A;  2VBY A;  4PJM A;  1FOY A;  3F22 A;  1HXD A;  5EF6 A;  1SMY F;  2ZME B;  2ESN A;  4BEH A;  1SFU A;  4E7S A;  4WXH A;  1MH3 A;  2QGU A;  4M3B A;  4F3Q A;  5LD2 C;  3N4M A;  1J9I A;  1D1C A;  3FIS A;  3GZN B;  2LH9 A;  3U1D A;  3OR2 C;  1XMK A;  3BZ6 A;  1T33 A;  4PCQ A;  1OCT C;  2COB A;  4UNO A;  2M30 A;  5E8I A;  1WWX A;  1LVA A;  2LRE A;  1XPX A;  2CV2 A;  2NS8 A;  2VIX A;  3PUB A;  3ZR8 X;  3CUQ A;  2XF6 A;  3RPU A;  1VQ9 I;  2HVS A;  2R0Q C;  4NBQ A;  3EQL F;  4L5J A;  3VPR A;  3L2U A;  2LD5 A;  2R7O A;  2EK5 A;  2LMD A;  3FX3 A;  4F93 B;  1IGN A;  4RAY A;  2LDU A;  1OKR A;  1LFP A;  1D0X A;  1K6O A;  2BXY A;  2QSH X;  2XPU A;  1AOY A;  3GZ6 A;  1MSE C;  4HLX A;  2HTJ A;  3DLL F;  1JJ8 C;  1IXC A;  2M8G X;  3LSP A;  1LUJ B;  3BPV A;  4LIU A;  3CMA I;  1VQK I;  3T8T A;  3SJM A;  2X4H A;  4NQW B;  2EA2 A;  5CYV A;  1FWZ A;  1TTY A;  2W00 A;  2NVY J;  2CQN A;  2JRM A;  3IH4 A;  2VT3 A;  4G9Y A;  4RM2 A;  4Q47 A;  2RVC A;  1VZ0 A;  3R60 A;  2K5C A;  1RKW A;  4I7H A;  2OJE D;  5B5E C;  4GFB A;  2CW0 F;  2IA1 A;  3MKW B;  2L7F P;  1WJ5 A;  4XN0 A;  3JRB A;  3OIP A;  4JK1 X;  3H9G A;  2AXT C;  3OYD A;  4CCN A;  5D5U B;  3DBR B;  4A0Y A;  1UHM A;  1TNS A;  3M1C A;  3G1L A;  2HGC A;  2H8W A;  4RM3 A;  2YU9 J;  4HDV A;  2RAE A;  1TWH J;  5C4X J;  4Q5S F;  1K6Y A;  3A1Y A;  5JHU A;  4BDZ A;  2P7C B;  2F48 A;  2VOD A;  5KK1 A;  1P4W A;  1OYY A;  4C2M J;  2OD5 A;  3BOQ A;  3BPX A;  1YJ9 I;  2XGC A;  1LPQ A;  5D8K B;  1ZG5 A;  2B63 J;  2P6S A;  2ZME A;  3ZMZ A;  2Z1D A;  4L5E A;  1O3S A;  1DU6 A;  2X85 A;  2K3P A;  4EV0 A;  3W2W A;  1YIJ I;  1X1P A;  1K4S A;  1AWC A;  4DOZ A;  4KIF A;  2HPI A;  4BHC A;  2D1H A;  2FML A;  4OU0 A;  2LOO A;  4N0B A;  4L9N A;  1MGT A;  1YI2 I;  3BR3 A;  1F4K A;  4EM2 A;  4HW0 A;  2PN6 A;  1ETK A;  2QYO A;  4B8X A;  1AHD P;  2BOL A;  2WV1 A;  1IG7 A;  1X2M A;  1HBX G;  1IRX A;  1QQI A;  3S17 J;  4RGR A;  2XAJ A;  2KIQ A;  4BNC A;  1RPW A;  2E7W A;  3V7R A;  2KT0 A;  1TW2 A;  3NWS A;  1FBS A;  3BWG A;  3C2G A;  4CA0 A;  3BQY A;  2XC7 A;  3MKY B;  2IJL A;  3ERE D;  1H9G A;  5FD5 A;  3RYP A;  1VTN C;  3IHU A;  2M7B A;  1W0U A;  2XB5 A;  2WV0 A;  2LC2 A;  5JR3 A;  1G3Y A;  3LA2 A;  2GZW A;  3MAJ A;  2EZI A;  3QAH A;  5FGM A;  2XGE A;  1PYV A;  2PX9 A;  4C3J J;  3HJE A;  2CJJ A;  1JUS A;  2ZXW H;  3Q0W A;  4RB3 C;  2QVO A;  1BA5 A;  3ZQ7 A;  3HTS B;  4CYD A;  1J09 A;  4RB2 C;  2IGM A;  4BXF A;  2VXD A;  2KLO A;  1WSU A;  2LY2 A;  2YU3 A;  4MGR A;  4FX0 A;  3L2C A;  2DT6 A;  5GAH J;  4HF2 A;  1UFM A;  1VI0 A;  2Y0S N;  4OIO F;  2CSO A;  4E7Z A;  3HRU A;  3CCU I;  3DU5 A;  2GLO A;  3VSK A;  2GIZ A;  2A68 F;  2GXG A;  4F92 B;  3VOD A;  2OCE A;  5F64 A;  4CZC A;  3A03 A;  5AON A;  3ZN0 A;  1GXQ A;  3WE3 A;  1BR1 A;  4E7H A;  2DPD A;  4WK8 F;  2O61 A;  1U9N A;  1WI3 A;  1V5G A;  3WTX C;  1RR7 A;  5JLX A;  4HQM A;  1T39 A;  4LGW A;  4IHS A;  3L2Q A;  3ZQL A;  3DEU A;  2V1U A;  2LBF A;  2O8X A;  2ELH A;  4Q4Z F;  4Q48 A;  5FKK A;  1X1A A;  2X1E A;  5H2F C;  5IP6 A;  1Y39 A;  1NHA A;  3TW7 A;  3GTO J;  4A3C J;  4YFX F;  4WCG A;  5KNL A;  3CCQ I;  2AHQ A;  2WTE A;  1WGX A;  2CS3 A;  2M7A A;  2DBB A;  3B73 A;  3DU6 A;  5LHH A;  4LLG F;  5LHI A;  1LB2 A;  3ZMU A;  2Q0O A;  3FHN A;  3FXJ A;  2MG4 A;  5A2Q K;  4ZTJ A;  3OIO A;  4A5M A;  5ILV A;  3ZPL A;  1AA7 A;  5CVJ A;  3S16 J;  4DNC A;  1E2X A;  3AG4 H;  1MBE A;  3S15 J;  3HBL A;  2R7T A;  3DEE A;  5FO5 A;  1ZYR F;  3J81 Z;  2R4G A;  4BYY A;  2DMU A;  1O3R A;  4CGZ A;  3KP3 A;  1ITY A;  1B4A A;  3HOZ J;  2CUJ A;  2PJR B;  4ANJ A;  2ZJ2 A;  4BBR J;  3RZD J;  1EV7 A;  3DLA A;  4MIM A;  5F0F A;  1JKO C;  1EJ9 A;  4XIC A;  1JGS A;  3BR6 A;  1SFK A;  4MO7 A;  3H3U A;  4FE4 A;  3WE2 A;  2CO5 A;  3T1B A;  1HC8 A;  3CMM A;  4BHB A;  3LSH A;  2PJP A;  2DO7 A;  4LLL A;  2GQQ A;  1ETY A;  1TWG J;  2VJ4 A;  3E97 A;  2HPM A;  4M6Y A;  4CZZ A;  5J8C A;  1IV8 A;  1NG6 A;  4KDP A;  2BYV E;  5HS9 A;  2MH2 A;  4IRG A;  2BY0 A;  3GTM J;  4YIR X;  3ROU A;  3FXK A;  3WU1 B;  2G0E A;  3F8B A;  3R61 A;  5DTD A;  2JPB A;  2I5U A;  4I6Z A;  5EDN A;  2IW5 A;  1IF1 A;  2DTR A;  4G94 A;  5K5O A;  3HOY J;  2XDV A;  1IAW A;  1PDN C;  3M1E A;  4L9V A;  4BAY A;  1W5C C;  4UB8 C;  3H1C A;  1Z1D A;  2NOG A;  2JVH A;  3NQO A;  2IEK A;  2DT5 A;  4QPO A;  2JA8 J;  3K4L A;  4CCM A;  2IGO A;  4XK4 A;  3KLO A;  2UV1 A;  2MC3 A;  5F0C A;  3BC8 A;  2DOF A;  3ZN1 A;  2V7F A;  3OYI A;  2ID6 A;  3ZXS A;  3JRG A;  2DQL A;  3BZC A;  5FKN A;  4EM1 A;  3J7Y J;  4GCV A;  4XMY A;  4A69 C;  4N4O B;  2F5F A;  1XB4 A;  2XGX A;  3WTZ A;  4ENN A;  4KYW A;  2HXO A;  3MKZ A;  2L4M A;  3K4K A;  3BG3 A;  1P7J A;  3ZQG A;  1FBQ A;  2ZKZ A;  4XLH A;  1W5S A;  2PMZ N;  3CUQ B;  4B44 A;  3ZQI A;  4IEJ A;  4XRS G;  1JUP A;  4EMS A;  3IC7 A;  2O6G E;  1X58 A;  4HZF A;  4XR6 A;  3DTE A;  4HNV A;  3COA C;  4M6V A;  4B4C A;  5EGO A;  2I8D A;  1P7I A;  3WG9 A;  3SFI A;  2E2I J;  2HOS A;  4UUS B;  4BUP A;  3OIQ A;  4O5V A;  2Z2S B;  2G7U A;  1WPK A;  4XRF A;  4HSR A;  2L01 A;  2EB7 A;  4XON A;  2DN0 A;  3GZ5 A;  3M4O J;  1ZGA A;  5FD6 A;  2DA5 A;  2WAF A;  3F6O A;  1USS A;  3S1N J;  4XKB A;  1ODD A;  4C9Y A;  3G4S I;  4E7L A;  1U8R A;  1U3E M;  4HRI A;  1G6N A;  1I27 A;  1ZGJ A;  2IGN A;  3B6A A;  4MEY F;  2MC4 A;  2A61 A;  2K9M A;  3GFI A;  3IP4 B;  4GYG A;  1HSJ A;  4U87 A;  3HHG A;  4U7B A;  1J59 A;  4D1Q A;  2EV5 A;  3HUG A;  3C2B A;  5GP9 A;  3CC7 I;  2K27 A;  3ABK H;  4EJU A;  2G7H A;  3JRC A;  4A3J J;  3RIR A;  4ZYH A;  5E3M A;  2RNG A;  2M34 A;  5DM6 F;  1TBX A;  2CW7 A;  5AIP A;  4P9F A;  3BJO A;  4A6D A;  2P5V A;  5CQE A;  4BU2 A;  5L3G A;  3LA3 A;  3M8J A;  2R7F A;  5GAD J;  4ON0 A;  2HZT A;  6PAX A;  4QWQ A;  2DOA A;  1HF0 A;  4LK1 F;  1CF7 A;  2HOT A;  4AIH A;  4A3B J;  3Q0V A;  4R8H A;  4CCJ A;  4LK0 F;  3JRI A;  4BKX A;  4N9I A;  3S2D J;  3QPH A;  1N77 A;  2FMY A;  1FJL A;  2VN2 A;  4MFD A;  1P2F A;  1ZQ3 P;  1W36 D;  4HAM A;  1YYV A;  4YFK F;  2LBF B;  5BMZ A;  2DDA A;  2VXZ A;  4IRH A;  2W4S A;  1J75 A;  4DZP A;  3H92 A;  3I54 A;  2H1K A;  4B48 A;  4FET A;  1HKT A;  2LVS A;  4D0P A;  2V6C A;  2O0Y A;  1EH7 A;  3IWF A;  4MQV A;  2EIM H;  3REO A;  1G59 A;  3QQA A;  1MJA A;  1RES A;  1X3W B;  1ZG1 A;  5FFX A;  3H0G J;  4E4H A;  2WY7 Q;  4PGH A;  1VQL I;  3BTC A;  4RBO A;  3CMY A;  1APL C;  1Z0X A;  3QWL A;  5CKT A;  2Q2E B;  3QPL A;  3CP8 A;  1Y1W J;  4CIC A;  1BC8 C;  2UXN A;  2KDZ A;  1B1B A;  3RPU D;  3HOV J;  4A3I J;  3HEF A;  1E0E A;  1VND A;  2DMN A;  1OCZ H;  2DYR H;  1GDT A;  2W1O A;  2CUZ A;  3ABM H;  4AWX B;  4KMF A;  4RGX A;  3X2Q H;  1FBU A;  4MNU A;  3EUH A;  3FMQ A;  4CYC A;  5HDK A;  5JVT A;  1BOB A;  4BDY A;  4NDL A;  2D5V A;  2EA4 A;  4FIS A;  1MBH A;  4BE1 A;  1RET A;  3KP5 A;  5FLV A;  2P8T A;  4R1H A;  3K6G A;  4PUS A;  2VAS A;  1SC7 A;  2HVR A;  1BI2 A;  3FKI J;  2Z9O A;  1JGG A;  5J4Y A;  3H36 A;  3ECH A;  4AU7 A;  3HKZ N;  3QP5 A;  2A5W A;  3PJR A;  4DIQ A;  2EZL A;  4CSW A;  1O3Q A;  5D8L B;  4EEF G;  1A5J A;  2HOE A;  1MDM B;  2EBI A;  2F5D A;  3CJR B;  3W2V A;  4UVC A;  3S3M A;  3FK6 A;  4KIC A;  2OCC H;  4ESF A;  4PJN A;  2O8K A;  4ENK A;  2B0L A;  4CCK A;  1QO0 D;  2E34 A;  5GTI C;  3ZP5 A;  4BE0 A;  4QTR A;  2RQQ A;  4FQG A;  4DJA A;  1XMX A;  4NNJ A;  3FBI B;  3O2P E;  4IO9 F;  2R92 J;  4HX8 A;  2X6O A;  3EET A;  1HKQ A;  3A01 A;  5M5X J;  3HRM A;  5D5V B;  2QSG X;  1QZY A;  5E1X A;  3W3C A;  5ERI A;  3CLO A;  3K1P A;  1ZRD A;  5CVV A;  4B47 A;  1XDS A;  2ECB A;  4BXU A;  3TDU C;  3SFZ A;  1W1W E;  4I76 A;  1STZ A;  4XKC A;  1L3L A;  3T8R A;  3OWT A;  1PVE A;  4D9J A;  1GLN A;  1SD6 A;  3KIO A;  2W85 A;  2R7U A;  5M3M J;  1F1Z A;  4OAY A;  3TO6 A;  2JA2 A;  2E7X A;  1S7A A;  5HOO A;  2ETH A;  3K7A J;  5BPI A;  2VQL A;  3K4C A;  3TP0 A;  2DA7 A;  2IP2 A;  4B43 A;  1ETX A;  4IZZ A;  3G1O A;  2L9S A;  3S32 A;  2AQF A;  3G2B A;  4BQN A;  1GHC A;  2IA0 A;  3E1S A;  4HOB A;  4HF1 A;  4A0Z A;  2OUM A;  1YRN B;  2EIL H;  3K70 D;  1YOV B;  3OSF A;  1UG0 A;  1B9M A;  1CF7 B;  4P1W A;  3D0S A;  5DS9 A;  5KAF C;  1D8J A;  1Z21 A;  2PMU A;  2WA0 A;  1XGM A;  2GOX B;  2QUF A;  2IS4 A;  2HYG D;  1NK3 P;  3I4N J;  2E35 A;  1JE8 A;  2NVQ J;  1Z6R A;  5DCF A;  3LQR A;  3DKY A;  3BZK A;  2X6W A;  3LWF A;  3IH2 A;  2HU9 A;  3PSI A;  5HLG A;  1JKR C;  5L3B A;  3DEW A;  4B3X A;  1YFH A;  2MGQ A;  4F52 A;  4C2U A;  1U2W A;  3LFU A;  5GAG J;  1FTZ A;  5D6E A;  1HW1 A;  3RQ4 A;  2W25 A;  2HQR A;  1JHH A;  3OYH A;  1W7P A;  1OJL A;  2HYF A;  1TWC J;  4M9S A;  1UCR A;  2F5C A;  3FXU A;  4JX4 A;  1UB9 A;  1XSX A;  2K9N A;  1R00 A;  2VUM J;  2DT7 B;  4HLY A;  4C2T A;  2LSO A;  2ZCW A;  5ICE A;  3A4C A;  5JHF A;  3JSP A;  2VC1 A;  4XBF A;  1R1V A;  3OYA A;  1G2H A;  1UZC A;  3GTP J;  2M0M A;  5IY5 H;  1MMS A;  5D5X B;  3HGY A;  3VYS B;  1WKM A;  3NAU A;  1KQ8 A;  2VC0 A;  3FM5 A;  1YS6 A;  1KU3 A;  1Y1V J;  4L18 B;  2COM A;  1I1S A;  3DFG A;  3K4J A;  1VQ8 I;  2HQA A;  2OC6 A;  3L2W A;  2VT2 A;  4P96 A;  1ZLK A;  4O3M A;  4G6T B;  4HX4 A;  2L4A A;  3R6S A;  4NC7 A;  1WJF A;  4ZYE A;  3KP2 A;  1MNM C;  1TWA J;  2H1L A;  2GA2 A;  1FYK A;  3PM1 A;  3K69 A;  1QA6 A;  3VEP A;  5KAI C;  4IHX A;  4FX4 A;  3IAS 2;  3OYG A;  1B72 A;  3KX2 A;  2L5Q A;  3GXO A;  1BI3 A;  1BL0 A;  5EYR A;  3K1M A;  4OAZ A;  2ZSI B;  1U8B A;  3C18 A;  4IOC F;  3DQV C;  3WTW C;  1MBF A;  1SMT A;  5C44 J;  2ZFW A;  3KYL A;  1U5T C;  3HOS A;  3H5R A;  4EJO A;  4LG3 A;  1DGR M;  3WHC A;  5HVQ C;  5HLH A;  1C0W A;  1T98 A;  2JUG A;  2KIU A;  1PP7 U;  3J81 K;  3PL8 A;  1LFU P;  3WU2 C;  1Y8R B;  4MTD A;  1Z3X A;  3BRO A;  3JCU C;  1DUX C;  2XVC A;  3HG9 A;  2DDB A;  1QGP A;  2QQ9 A;  2LRD A;  1MMA A;  1ULY A;  5B1A H;  1FX7 A;  2NVT J;  2WAD A;  2QEX I;  3TDZ C;  5CQG A;  3ZOB A;  5B66 C;  3PO3 J;  1I6X A;  3FIW A;  3I4P A;  4LIT A;  4D7N A;  1JT0 A;  3K9T A;  1S7O A;  2ICW G;  5F27 A;  2LFB A;  4HQE A;  2E5N A;  3I64 A;  4X1E A;  5LGT A;  2V9K A;  2ELJ A;  2MW8 A;  2ME0 A;  3GYH X;  2Q8K A;  2ZXI A;  4B3A A;  2NXN B;  3NRV A;  4CXF A;  4YFN F;  2LY9 A;  3HB9 A;  1JXS A;  4HYE A;  3IKT A;  2WWY A;  2F4O B;  2BY2 A;  4LLN A;  2PJR A;  5KHD A;  2R3S A;  2CH0 A;  3OYM A;  2OZ6 A;  4Y7N J;  4BQO A;  2Y0S A;  1HCR A;  4AVP A;  3OOP A;  2E1N A;  3EDP A;  2H09 A;  2X1D A;  4IX7 A;  1LEB A;  2QSF X;  2A05 A;  1ZG3 A;  3E5Q A;  1W0T A;  3C7J A;  2R7R A;  4XNF A;  4D5F A;  1T2K A;  3OL4 A;  2HTS A;  3O8H A;  2ZJR F;  4BJ5 C;  4A3M J;  3GTG J;  1YX5 A;  4G8X A;  2ZNY A;  2H6B A;  1B8I B;  1AKH B;  3FMR A;  3GBG A;  2NNN A;  4KIT B;  4KFC A;  4E6K G;  3GLL A;  4I98 B;  1X1C A;  2JVG A;  2XF5 A;  4WXC A;  5E17 F;  2QQA A;  2K3F A;  2M4G A;  4II3 A;  3TO7 A;  3LA7 A;  2JSC A;  4XLN F;  2VOP A;  3CES A;  2MLG A;  2W24 A;  3F72 A;  3OS1 A;  2Y9Z A;  1S9H A;  4R79 A;  1X3Z B;  1R49 A;  5E8G A;  4UB6 C;  5FRO A;  5ICC A;  1JKP C;  3OYL A;  4LOC A;  3OS2 A;  4HV5 A;  1ZKG A;  4E7J A;  1WVR A;  3KP6 A;  4V2F A;  1VQ4 I;  1BR4 A;  2DK5 A;  2DLL A;  3TGN A;  3ONQ A;  1P4A A;  4XID A;  5C3E J;  3MQ0 A;  1FY7 A;  3F23 A;  3AL0 B;  2R7V A;  4IQ4 A;  2E5Z A;  3LMM A;  1GV5 A;  3IH3 A;  4DZJ A;  5M3F J;  4E7I A;  1BIA A;  3KYC B;  4IHY A;  2K9S A;  3Q9V A;  4LG0 B;  3W6K B;  3HUG B;  5LFA A;  2KMU A;  3DKX A;  5TJJ A;  4PFO A;  3LSI A;  5LGN A;  4C30 A;  5F08 A;  3CDL A;  3VSL A;  1V55 H;  2PLY A;  1KU7 A;  2BV6 A;  1LJ9 A;  1UST A;  4RB0 A;  1CGP A;  4OWR B;  2WC2 A;  3E0J B;  2PG4 A;  1ZEL A;  2NS0 A;  2OAZ A;  3D5S C;  2IXS A;  4HX7 A;  4RA2 A;  4AIK A;  2ZB9 A;  2E71 A;  2XRL A;  1JTX A;  5K5Q A;  4DGW B;  1FNN A;  1X4O A;  1U6G A;  5HS7 A;  1G8X A;  1IN8 A;  5TGT A;  4PSW A;  2X9D A;  2ZO4 A;  1FEX A;  4W1U A;  2KHM A;  3J80 K;  5J6X A;  3AG1 H;  2TCT A;  3CF2 A;  2RRE A;  1TNT A;  3CCR I;  3RSN A;  4RB1 A;  3Q5F A;  4I2O A;  2YPR A;  4GYI A;  1S5L C;  3H5N A;  2E2J J;  2M2E A;  3WTU C;  1A6I A;  2VPR A;  1Z91 A;  2XAH A;  4HPQ A;  4XRM A;  2FQ3 A;  5D4R A;  1ZRF A;  2HR3 A;  4I0B A;  3RCO A;  5D4S A;  4WWC A;  1ON1 A;  5F6F A;  2XGD A;  3QU3 A;  1FZP B;  4M6X A;  5K7Z A;  4XLC A;  4LB6 B;  1FC3 A;  3LST A;  4CO8 A;  1KQ9 A;  2RDP A;  1ZN2 A;  2M3A A;  2JTV A;  3L2V A;  5JVG F;  1QBJ A;  3DPT A;  4M9Z A;  3H9Q A;  2EZK A;  3QYB A;  2KIS A;  4ZZD A;  1U9O A;  3P9C A;  5L3F A;  2R7W A;  2DW4 A;  3U9G A;  1LEA A;  2YX4 A;  1T56 A;  4Y3O A;  3V42 A;  4M3F A;  1R6R A;  2L9R A;  4MFE A;  4A6E A;  2XRO A;  2DA2 A;  5EEH A;  1SAU A;  1W4M A;  1BI1 A;  1VF9 A;  3ZQH A;  3JRF A;  2CWE A;  3HC7 A;  2HNH A;  4EJT A;  4XQF A;  3BR5 A;  1W36 C;  1P6R A;  2D45 A;  2KDO A;  3P5J A;  4M72 A;  4N4N B;  3I59 B;  3LSJ A;  3GVA A;  3VYU B;  3E5U A;  4A0X A;  3RZO J;  4ASN A;  1A04 A;  3H9J A;  2P5L C;  4P55 A;  3L1P A;  1G3S A;  4ZYG A;  4HNT A;  1A35 A;  4QSH A;  3ULQ B;  3CTA A;  4Y52 J;  1XCB A;  4YII A;  3SDG A;  5EEA A;  1MDM A;  3SZP A;  4OIR F;  4C3I J;  1YJN I;  3V7C A;  2Y9Y A;  3H5A A;  2V6E A;  3CF5 F;  2ELK A;  5E20 A;  1QHG A;  3CCM I;  2X6X A;  4HBL A;  3LAJ A;  2IA2 A;  4XLP F;  2R5Y A;  2HDC A;  1MBJ A;  4M73 A;  5FB2 A;  5HDG A;  2EFW A;  4UV8 A;  2FA5 A;  1R71 A;  1SFE A;  2STW A;  2NVU B;  1WHU A;  1F36 A;  3Q9S A;  3E6C C;  4IRI A;  3QOE A;  4XOP A;  5DD8 A;  1WJD A;  4EAT A;  2DA6 A;  3P9K A;  3F8N A;  1V54 H;  1BJA A;  1YQA A;  2VKE A;  4AUX A;  5IP7 J;  2JSP A;  2BY1 A;  3DXJ F;  3AL0 C;  3OY9 A;  4XLE A;  3JAM K;  1E3O C;  5K5R A;  2IBD A;  1XGS A;  2CRG A;  4OIQ F;  3Q3S A;  5BPD A;  2EV6 A;  2LKP A;  3RKY A;  4DQ2 A;  1HDP A;  3BTL A;  4K2E A;  5IYD J;  1B59 A;  2HEO A;  1XG1 A;  1GV2 A;  3VB2 A;  1D5Y A;  1VQ6 I;  5HS8 A;  2LR8 A;  2PQ8 A;  5FLX K;  3R4K A;  5F1R A;  3BP8 A;  5J1Y A;  2QBY A;  2A5Y B;  2L7K A;  4JYK A;  4Z6Y A;  1A36 A;  1XN7 A;  2VJI A;  3H35 A;  1D5V A;  1MBK A;  3LOC A;  4X0G A;  3ZMT A;  4ETS A;  1R7J A;  1LDJ A;  2UZK A;  1BR2 A;  2JA6 J;  4D5C A;  4M3D A;  1YO5 C;  2QQ8 A;  5HLI A;  3R0J A;  3RDI A;  4IKF A;  4Y4R A;  4XLF A;  4I01 A;  4RLQ A;  2L3D A;  3OYN A;  1R5I D;  3CUO A;  1K78 B;  1E3H A;  3KZI C;  2Z16 A;  5HNH A;  1MD0 A;  1Q1H A;  5BS6 A;  1ZHF A;  1DP7 P;  5GAE J;  3DV8 A;  3DTK A;  5IYC J;  1SAX A;  2FNA A;  2EFO A;  4AIJ A;  4A3F J;  1YIT I;  1RI7 A;  3QYE A;  4IOA F;  2NYX A;  1JUM A;  2STT A;  2H8R A;  5IP9 J;  2ISY A;  3G3Z A;  3M3Y J;  3I53 A;  4ABZ A;  2HKX A;  3GF2 A;  1TP4 A;  2Z99 A;  3GO5 A;  2NAZ A;  3GWZ A;  3V7S A;  1UHS A;  2FQ4 A;  5HOD A;  5E1W A;  1JHF A;  1P9Q C;  5FKO A;  2E2H J;  2F6C A;  2H94 A;  3ELK A;  3CCY A;  1H89 C;  3T5X A;  5LLQ A;  2FEZ A;  1X19 A;  1R5G A;  2XAG A;  3UR3 C;  4X6A J;  4IXA A;  2JZY A;  3BCB A;  4DYC A;  4YG2 F;  4EVI A;  2JMW A;  3I58 A;  1D1B A;  1POG A;  3MWM A;  1WJC A;  2DA3 A;  2VPL A;  1N78 A;  3FBN B;  4CHU A;  2CUE A;  3DPU A;  1U78 A;  2K4J A;  1MBG A;  5M5Y J;  3ISP A;  3TW6 A;  3B02 A;  2E19 A;  3F8C A;  3DF8 A;  2E1M C;  1LQ1 A;  5IT9 K;  2FBH A;  2EIJ H;  4JBA A;  3M8E A;  3PQK A;  3DP7 A;  4PFP A;  1GVJ A;  1TQP A;  1Y6I A;  3GFM A;  2XAQ A;  5L3D A;  1RUO A;  4UV9 A;  4KA4 A;  2A3S A;  2HQN A;  4J19 A;  4PZJ A;  3T0Y A;  1SAN A;  1DU0 A;  3E6B A;  1W7P B;  1ENH A;  2KZG A;  4IHV A;  2R5Z A;  3LNQ A;  3E5X A;  5C4J J;  3JR9 A;  3AFH A;  4HA8 A;  1IN4 A;  4LMY A;  3QRF F;  2GIV A;  4CUG A;  3ASO H;  2HKO A;  4IHT A;  2NRA C;  2CQQ A;  1DDN A;  2AXL A;  3SQN A;  3K4M A;  1K83 J;  5JI6 A;  1WZ2 A;  1MMG A;  1XSV A;  2DYS H;  1T95 A;  5ICF A;  1KYW A;  2ZJQ F;  2LKS A;  2YX7 A;  3NAR A;  3MCZ A;  1QHH D;  4RGS A;  2OA4 A;  2WAQ N;  3IRQ A;  4MLO A;  4NUB A;  2QEN A;  3I55 I;  2V1N A;  2XAF A;  2VQG A;  3LQQ A;  3BG7 A;  3IL2 A;  2XPV A;  3RTR A;  3EUK L;  2FBI A;  1Q1V A;  4A93 J;  3TOB A;  1ZR2 A;  2GXB A;  2GA1 A;  2P7V B;  1IJW C;  3F3X A;  4E7K A;  2OU2 A;  2VB6 A;  3F8M A;  4Z2Y A;  4Y17 A;  3WTY C;  4L0Z B;  1I3A A;  2FRH A;  4J01 A;  1MW7 A;  3SEZ A;  3RI4 A;  1IUY A;  5DDG A;  1QVT A;  3IWZ A;  4JX6 A;  1E3P A;  1ZR4 A;  3ZQQ A;  2K02 A;  1M1E B;  2IVM A;  3K4N A;  4EGY A;  1VQO I;  4DYR A;  2V1D A;  4F55 A;  2DMT A;  5CVU A;  4JP0 A;  4GO1 A;  4W97 A;  4NHJ A;  4JOM A;  4CCO A;  1KYZ A;  2K86 A;  4RMN A;  5FFZ A;  3VOE A;  3BT9 A;  3E6D A;  3IKV A;  5DUI A;  3BR2 A;  3MZY A;  2V4J C;  3HPG A;  4L9J A;  3FKJ A;  2B9S A;  1OPC A;  3O8G A;  1GT0 C;  2WB1 N;  5J1R A;  4FTH A;  1YG2 A;  3W2A A;  1BOA A;  2FUG 2;  2DJI A;  5DM7 F;  1R9T J;  1UEL B;  4U88 A;  4E70 A;  4Y15 A;  4IJA A;  3H3V K;  2QCO A;  2LY1 A;  4A3G J;  4BGD A;  1D0Y A;  4L0Y B;  3FXR A;  2CV0 A;  3KE2 A;  1U5T A;  4ZYA A;  3AKZ A;  1GUU A;  2A6T A;  3KCC A;  3FXL A;  4KN7 X;  4UUV A;  3CO6 C;  2OQR A;  1Z9C A;  3GTQ J;  3GTL J;  1LDK B;  4MQ9 F;  1HST A;  4WX9 A;  1S6L A;  1O7L A;  3HYI A;  2PFB A;  3OYE A;  2D1V A;  3A02 A;  1LE8 A;  1FT9 A;  3HRS A;  5E3L A;  1S8N A;  1T38 A;  3GFL A;  2AS5 F;  1KGS A;  2F4I A;  3OYF A;  3ZCO A;  3LSM A;  1UG2 A;  4AYB A;  3I9V 2;  1H9T A;  3KEY A;  2L9V A;  2YUS A;  1T08 B;  3KEO A;  5ED4 A;  4P9U A;  1IZ1 A;  1XCV A;  1JKQ C;  2M87 A;  2ME6 A;  1Z7U A;  4AID A;  1WI9 A;  2HDW A;  2M5W A;  3J80 Z;  2KFD A;  5HLT A;  2L7Z A;  3MZH A;  1EH6 A;  2JPC A;  2BHZ A;  2VJ5 A;  3G1M A;  3QOP A;  2VE9 A;  1AKH A;  2WBM A;  5DCM B;  3CCS I;  2VKD A;  4G6Q A;  4DBR A;  1Y56 A;  1R58 A;  3BDD A;  3FMS A;  3CJQ B;  2RGV A;  3CLQ A;  3HHH A;  3ABL H;  2GXA A;  3ASN H;  3DPL C;  4L5I A;  2EIK H;  3LSG A;  2E1O A;  3BG6 A;  3O6B B;  1XSD A;  1A6Q A;  4AD9 A;  1YTY A;  5IOY A;  4KJZ A;  1RNL A;  1GVD A;  4UUT A;  2CGP A;  5J4V A;  2M0C A;  2CYY A;  2CUF A;  4LD5 A;  5M5W J;  2DOE A;  3I3L A;  2DK8 A;  2P6T A;  3RYR A;  1VQN I;  1BN5 A;  2HOA A;  4IPA A;  2GBY A;  2R5Z B;  1DP3 A;  2MD0 A;  5J40 A;  3EYI A;  1SEU A;  1IRG A;  4V19 K;  1QU3 A;  2MD5 A;  2NS7 A;  3OMY A;  3U21 A;  2FE3 A;  1QVU A;  2VON A;  1YLF A;  2ZXH A;  4ZC3 A;  1IO2 A;  4H0E A;  3V8K A;  4RLF A;  2DFE A;  4XN3 A;  2DFI A;  4EM0 B;  4ZH4 F;  2JN6 A;  1YW9 A;  1MMD A;  2GAU A;  3FDY A;  1FPQ A;  3AG3 H;  3M7G A;  2O5R A;  4LG0 A;  1S7E A;  2KJC A;  4I09 A;  1I50 J;  1X4P A;  4RGU A;  4KIB A;  4LFU A;  5IT3 A;  1FOW A;  2R7Z J;  3HOW J;  2VQC A;  2Z3Y A;  2KL4 A;  3IRR A;  1MH4 A;  1R36 A;  2ESH A;  4KIG A;  1VQM I;  5F04 A;  1SVL A;  1OFC X;  5EG0 A;  2GWR A;  2OV7 A;  1ONV A;  4CDG A;  2XUB A;  1X1D A;  3HSE A;  3E6M A;  1R4N B;  5H6Q A;  4PJL A;  1PP8 F;  3WU0 A;  4YRV A;  4A2U A;  1MJB A;  3DCF A;  3HGG A;  2RKH A;  4OIN F;  4XRS A;  3KET A;  3QYF A;  3WGH A;  2ID3 A;  3GX4 X;  3GCM A;  1VQP I;  2C6Y A;  5EEG A;  3ML6 A;  3SZT A;  2XKP A;  5E1Z B;  5E3O A;  4DYQ A;  2MFZ A;  4XSX F;  4M71 A;  1IN5 A;  1ETQ A;  1LNW A;  1MND A;  2IPQ X;  4QIW N;  2UUZ A;  2DPU A;  5LRS A;  4BE2 A;  3I4M J;  2X51 A;  2L7M P;  4S0H B;  1S72 I;  3FM3 A;  5FLM J;  4EJV A;  1OCC H;  3EPZ A;  2V9P A;  3C1D A;  1F43 A;  1WRJ A;  3S14 J;  3I0T A;  2ECC A;  1KQ0 A;  3M07 A;  1HLV A;  5BNG A;  1IC8 A;  2IS2 A;  3ERM A;  3NEU A;  2JRT A;  5D6F A;  4PDK A;  4HV6 A;  2L54 A;  4HEA 2;  2XSJ C;  4UVB A;  1SFO J;  4RAZ A;  2BW3 B;  3PSF A;  4MEX F;  1B9N A;  1J0R A;  2E1C A;  3JTG A;  3FHZ A;  2W57 A;  2EH3 A;  2AO9 A;  2XAU A;  3DWL E;  1YRN A;  3G6E I;  3S2H J;  2OQG A;  4KN4 X;  2R93 J;  3QPS A;  2W48 A;  5FJ8 J;  2EQR A;  3MFK A;  2A6E F;  4CH7 A;  3F0C A;  3B6C A;  1RZ4 A;  1TLH B;  5K7H A;  1WJA A;  4TV7 A;  5GTH C;  2HI3 A;  5H20 A;  2OPT A;  3CD6 I;  3KPH A;  1TT0 A;  4WF2 A;  1MNE A;  4BJT A;  5K1Y A;  4KIS A;  2MAB A;  1IRZ A;  2IAI A;  1FOK A;  2IT0 A;  1G3T A;  2DQR A;  2DU9 A;  2VJJ A;  3EUH C;  1WH7 A;  2P0W A;  4BQQ A;  5FRN A;  5B1B H;  1K4T A;  2V26 A;  4PGG A;  2F5V A;  4F7Z A;  1VQ7 I;  1XTA A;  2FD5 A;  2R7D A;  3BG9 A;  4A3L J;  2LNB A;  3FXO A;  2Y48 A;  2LKX A;  1KON A;  1QNT A;  3EYY A;  2NNY A;  2JQ7 A;  2HZD A;  4HDU A;  3JRD A;  3F8F A;  3OV8 A;  2MH9 A;  1TWF J;  3TED A;  2X48 A;  5KCM A;  1XD7 A;  1IDZ A;  1ETO A;  2HVQ A;  3K1N A;  3SXY A;  3KZY A;  3HM5 A;  5CLS A;  5FLX Z;  1VQ5 I;  4KUM A;  1FTT A;  1I6H J;  5TIS C;  3ZQC A;  1QZZ A;  1A31 A;  1XMA A;  2M45 A;  5K7F A;  5CJ9 A;  3PO2 J;  1Z67 A;  2ZNZ A;  5CPR B;  1BJZ A;  3S2W A;  1TQI A;  5E79 C;  1FMW A;  2FOK A;  2O9L A;  2M8E A;  2QM3 A;  1IXS B;  1MKM A;  2O3F A;  2JA5 J;  2ZSH B;  2QKM B;  1BIB A;  2J5P A;  2BVL A;  3HTU A;  4M3G A;  2FBK A;  5AIQ A;  2OTL I;  3GME A;  3BR1 A;  3MEX A;  2FSW A;  2EWN A;  2DMP A;  1DPU A;  3D5R C;  1FSE A;  3HRT A;  5F0H A;  1F5T A;  1WFX A;  2RQP A;  2DA1 A;  4ZDP A;  2A07 F;  1O7F A;  3TKY A;  2VLA A;  3PIO F;  2XSD C;  3GFJ A;  1XGN A;  1J2X A;  1WCM J;  4RAG A;  1REP C;  3D1N I;  2HXI A;  2F4M B;  4A3D J;  1Z77 A;  3KLN A;  5BQT A;  3NWT A;  4F91 B;  2RV8 A;  3KP7 A;  4WXD A;  4CYC B;  3CJN A;  2WAQ A;  4PJJ A;  1Y0N A;  2WY8 Q;  3SEQ A;  5JLW A;  1NTC A;  1V5F A;  2PI0 A;  5FKL A;  1MMN A;  3L7W A;  1VFC A;  1XDU A;  2E1M B;  2KIF A;  2VL8 A;  2K7L A;  2FNP A;  1K61 A;  4B09 A;  4ESJ A;  4U7D A;  2DFH A;  2QQB A;  4S05 A;  1JJ6 C;  3WTV C;  1KZH A;  3LSK A;  2CG4 A;  1OLT A;  3KZZ A;  2BHY A;  5L3C A;  1EF4 A;  4G7Z F;  2MYS A;  3CZ6 A;  3BG5 A;  3J7A O;  3ABT A;  1Y8Q B;  3H0D A;  2XHK A;  2KPM A;  3F21 A;  3WHB A;  1KU9 A;  3TQN A;  3PNY A;  3E3V A;  5HDN A;  3J7Z I;  1FSH A;  2NOJ B;  1YS7 A;  1LKX A;  2UXX A;  2X1C A;  2Y0M A;  1OCP A;  4M74 A;  3MMY B;  1W5T A;  4XM3 A;  1D0Z A;  1TQM A;  2HYJ A;  2P81 A;  4G7H F;  3R0A A;  5DV5 A;  1RRJ A;  4PJ0 C;  3K0L A;  2HDD A;  2W82 A;  2X0L A;  1DQU A;  5DEQ A;  1FMV A;  1IRF A;  5LEK A;  1SD4 A;  3WGG A;  1T0F C;  5ILU A;  2VOO A;  4U0Y A;  2P5K A;  3OL3 A;  3HSF A;  5A2Q Z;  1HQC A;  4BQA A;  3P7N A;  4UHT A;  2EJR A;  3DTI A;  4EQQ A;  1BM9 A;  1CQT A;  1RUN A;  4HST A;  1SD5 A;  1P92 A;  3I71 A;  1OR7 A;  2M4K A;  3HZJ A;  2R7X A;  3K70 C;  3A0B C;  3HOT A;  4A5N A;  3LL7 A;  2Y30 A;  3UNG C;  3TL4 X;  2K40 A;  2DJN A;  4IQJ A;  1PUF A;  3IV5 A;  3S1M J;  1WJB A;  1ORK A;  1IV6 A;  1S3J A;  2G9W A;  3ZMV A;  4ENJ A;  5CVR A;  1QPM A;  3DBL B;  1IN6 A;  4BL0 B;  3LSR A;  5CVI A;  2Y31 A;  2ZFU A;  2CU7 A;  1ZK8 A;  1LFB A;  3AG2 H;  1K7A A;  4XKW A;  3LAP A;  2R7Q A;  5IOZ A;  2LLK A;  2RN7 A;  4B1R A;  1R1T A;  2I10 A;  3HOX J;  3HXL A;  1U0J A;  3OYK A;  1ZAO A;  2O03 A;  4I99 C;  3RKX A;  3JRE A;  2L9N A;  4JQF A;  2WAE A;  4S04 A;  3FXM A;  2CQ7 A;  1JTY A;  3V8J A;  1N25 A;  3H3Z A;  2H27 A;  1R22 A;  2OZU A;  3CQZ J;  3TP3 A;  3DBH B;  2QWW A;  2Z5U A;  1ETV A;  3WOD F;  1LVK A;  2TRT A;  1P4X A;  1ON2 A;  1Y0U A;  4KT6 A;  2NVX J;  3W6V A;  1G4D A;  2DCE A;  1TW3 A;  2MSY A;  4CCL A;  2Y75 A;  3OYJ A;  1FP2 A;  3OYC A;  4OOI A;  4H4K C;  5J3L A;  3S8P A;  2YS9 A;  1ERD A;  2Z33 A;  1UAA A;  2V1X A;  1XX5 A;  1EH8 A;  3WGI A;  4L9T A;  5E3N A;  4BS9 A;  4YEL A;  2B7E A;  3WG7 H;  4BEH B;  2BVM A;  2JUC A;  3BCA A;  3OR1 C;  2DA4 A;  2VQH A;  1I3Q J;  2BXZ A;  2DTZ A;  2L02 A;  1BBY A;  1DPR A;  4YIF A;  4NC8 A;  1IDY A;  2BGC A;  2LP0 A;  2VBZ A;  5J8F A;  3A0H C;  2JJ7 A;  3BTJ A;  3VFZ A;  2KJB A;  1JT6 A;  5IYB J;  2HWV A;  1BW6 A;  2N8G A;  2VE8 A;  1ETW A;  1R5H A;  2KIM A;  1TC3 C;  1BC7 C;  2XB0 X;  5LHG A;  3HIF A;  4BAC A;  3OYB A;  2DI3 A;  1PUF B;  1TT5 B;  1FLI A;  2VBX A;  4DW6 A;  3IAM 2;  2M1B A;  3D5L A;  1J7K A;  3I59 A;  4I02 A;  4KMU X;  2CQX A;  2ISZ A;  1IXR C;  3TBI A;  3A01 B;  4IHW A;  1HW5 A;  1MIJ A;  3CCV I;  5L3E A;  2OBP A;  2F2E A;  3PIP F;  3BR0 A;  3EUA A;  5B3S H;  1R23 A;  1HKS A;  1IN7 A;  3S93 A;  3K2A A;  5DCM A;  5HNF A;  1T8I A;  2PBI A;  4AYB N;  1FYL A;  2UWM A; 
#chains in the Genus database with same CATH homology
 2WB1 N;  5J1R A;  2EZH A;  2EZI A;  4FTH A;  3HDD A;  1BL0 A;  2XGE A;  5EYR A;  1R9T J;  1U8B A;  4C3J J;  2CJJ A;  1ZGW A;  2LK2 A;  1JUS A;  3Q0W A;  3H3V K;  2QCO A;  1ZTR A;  1MBF A;  4A3G J;  5C44 J;  1BA5 A;  1RKT A;  3RKQ A;  1GUU A;  3WHC A;  3GTQ J;  3GTL J;  2XPW A;  1LFU P;  5GPA A;  2DMQ A;  3A02 A;  1LE8 A;  5E3L A;  1VI0 A;  2Y0S N;  4RDU A;  2L0K A;  2GLO A;  2NVT J;  2Y2Z A;  3ZOB A;  3PO3 J;  1UG2 A;  3A03 A;  2YUS A;  3FIW A;  4V2G A;  4D7N A;  1JT0 A;  1UMQ A;  2FX0 A;  5F27 A;  1JKQ C;  1U9N A;  1WI3 A;  2LFB A;  2ME6 A;  4X1E A;  1RR7 A;  5JLX A;  2MW8 A;  2ME0 A;  2L7Z A;  3ZQL A;  4BBS J;  5GPC A;  4B3A A;  3G1M A;  5FKK A;  1AKH A;  5IP6 A;  2LY9 A;  3HB9 A;  3TW7 A;  3GTO J;  4A3C J;  1XS9 A;  2AHQ A;  2K9Q A;  4A3E J;  4G12 A;  1WGX A;  4Y7N J;  3JRA A;  1HCR A;  1IUF A;  3LSG A;  1WH5 A;  2E1O A;  2MG4 A;  1B8I A;  5IOY A;  5J1U A;  1W0T A;  1GVD A;  3OIO A;  4UUT A;  2M0C A;  4D5F A;  2CUF A;  5M5W J;  3O8H A;  3S16 J;  4A3M J;  3GTG J;  3S15 J;  1MBE A;  2HOA A;  3HBL A;  2GBY A;  2R5Z B;  1B8I B;  2DMU A;  1AKH B;  3GTJ J;  2JA7 J;  3UKG A;  3GBG A;  1ITY A;  3HOZ J;  2NS7 A;  5EG0 B;  4A3K J;  1HOM A;  1QVU A;  4BBR J;  3RZD J;  4MIM A;  5F0F A;  1JKO C;  4XIC A;  3BR6 A;  4MO7 A;  3S1R J;  4FE4 A;  2JN6 A;  2Y9Z A;  1JKP C;  4LOC A;  1ZKG A;  4V2F A;  1H88 C;  1X2N A;  1S7E A;  1I50 J;  2R7Z J;  3HOW J;  1ETY A;  1TWG J;  4XID A;  1MH4 A;  5C3E J;  3BTI A;  5F04 A;  1OFC X;  5EG0 A;  1GV5 A;  3IH3 A;  4DZJ A;  4AC0 A;  5M3F J;  3GTM J;  4IHY A;  2G0E A;  2K9S A;  5DTD A;  4I6Z A;  5EDN A;  3HGG A;  2VKV A;  3DCF A;  3FK7 A;  5FKM A;  4XRS A;  5F08 A;  3CDL A;  3E7L A;  4FE7 A;  4C3H J;  3HOY J;  2ID3 A;  4D7M A;  2JK3 A;  2HQ5 A;  2NOG A;  5E3O A;  4DYQ A;  2IEK A;  2JA8 J;  1NK2 P;  4XK4 A;  1ETQ A;  5F0C A;  2ZB9 A;  2XRL A;  1JTX A;  2FJ1 A;  2ID6 A;  4QIW N;  3JRG A;  5FKN A;  3I4M J;  1BW5 A;  4A69 C;  2L7M P;  4S0H B;  5FLM J;  2X9D A;  3OOU A;  1FEX A;  4W1U A;  4BXX J;  2HXO A;  1F43 A;  3S14 J;  2TCT A;  2ECC A;  1HLV A;  3BG3 A;  1P7J A;  5BNG A;  3ZQG A;  1IC8 A;  2PMZ N;  3ZQI A;  4IEJ A;  1SFO J;  4XRS G;  3HOU J;  2E2J J;  9ANT A;  1JUP A;  2M2E A;  1X58 A;  1A6I A;  1FIA A;  4HNV A;  2VPR A;  4M6V A;  4B4C A;  1MSF C;  4XRM A;  5EGO A;  3S1Q J;  1P7I A;  2E2I J;  3SFI A;  2EH3 A;  2AO9 A;  5IPA A;  1YRN A;  2HOS A;  1W0U A;  3S2H J;  2R93 J;  2XGD A;  3QPS A;  4UUS B;  2W48 A;  5K7Z A;  5FJ8 J;  2EQR A;  1WPK A;  3F0C A;  2O7O A;  3B6C A;  2DN0 A;  1AU7 A;  3M4O J;  5K7H A;  2DA5 A;  2EZK A;  2HI3 A;  1U9O A;  2OPT A;  3S1N J;  5EGO B;  1XC5 A;  1B72 B;  1T56 A;  1IRZ A;  1FIP A;  3B6A A;  2IAI A;  4M3F A;  4MFE A;  2L9R A;  4UUS A;  2DA2 A;  1WH7 A;  2OF7 A;  1VF9 A;  3ZQH A;  3JRF A;  2FD5 A;  3BG9 A;  3C2B A;  5GP9 A;  4A3L J;  3BR5 A;  1H8A C;  2LKX A;  3JRC A;  4A3J J;  3JRD A;  5E3M A;  3LSJ A;  2M34 A;  1O4X A;  1TWF J;  5EZH A;  3TED A;  2LTP A;  2X48 A;  3RZO J;  1IDZ A;  1ETO A;  1QPI A;  3MN2 A;  3HM5 A;  3L1P A;  1FTT A;  1I6H J;  3ZQC A;  1HF0 A;  4QSH A;  2HOT A;  1QRY A;  4Y52 J;  3SDG A;  4A3B J;  5K7F A;  3JRH A;  5EEA A;  3Q0V A;  2M9H A;  3PO2 J;  4C3I J;  2JWT A;  1BJZ A;  3S2D J;  2Y9Y A;  4BKX A;  3JRI A;  1ZQ3 P;  1FJL A;  2O9L A;  4MFD A;  2ELK A;  3RQI A;  2VI6 A;  3OSG A;  2JA5 J;  2R5Y A;  1MBJ A;  4DZP A;  4BY7 J;  2H1K A;  4M3G A;  2LVS A;  3BQZ A;  1F36 A;  3BR1 A;  3ZQF A;  2DMP A;  5F0H A;  2R5Y B;  3QQA A;  1RES A;  2DA1 A;  3H0G J;  2DA6 A;  2VKE A;  3BTC A;  4AUX A;  5IP7 J;  4RBO A;  2XSD C;  3CMY A;  1APL C;  1WCM J;  1Z0X A;  3D1N I;  3QPL A;  2HXI A;  1Y1W J;  1Z77 A;  1E3O C;  2IBD A;  3Q0U A;  2KDZ A;  2CRG A;  4CYC B;  3HOV J;  3Q3S A;  4A3I J;  3HEF A;  1VND A;  2DMN A;  1HDP A;  3BTL A;  1GDT A;  5IYD J;  5JLW A;  1NTC A;  1XG1 A;  5FKL A;  1GV2 A;  1D5Y A;  1VFC A;  2LR8 A;  4FCY A;  3MVP A;  5EZG A;  4CYC A;  4JX5 A;  1K61 A;  5J1Y A;  4NDL A;  2D5V A;  4JYK A;  4FIS A;  1JJ6 C;  1MBH A;  1RET A;  1MBK A;  5FLV A;  3GTK J;  1EF4 A;  4BY1 J;  5F1J A;  3LOC A;  3BG5 A;  3FKI J;  3WHB A;  2JA6 J;  3MKL A;  4M3D A;  4D5C A;  1JGG A;  3HKZ N;  1OCP A;  2EZL A;  4EEF G;  1A5J A;  1HDD C;  1LE8 B;  2EBI A;  2HYJ A;  4M3E A;  2P81 A;  3FK6 A;  2QF7 A;  5IYC J;  2HDD A;  4A3F J;  2GM4 A;  2O8K A;  1JUM A;  2H8R A;  5IP9 J;  3M3Y J;  5EF6 A;  4QTR A;  4ABZ A;  1MH3 A;  1UHS A;  2FQ4 A;  4M3B A;  5HOD A;  3FIS A;  5FKO A;  2R92 J;  2E2H J;  2X6O A;  3A01 A;  1CQT A;  5M5X J;  3CCY A;  1H89 C;  1T33 A;  1OCT C;  2COB A;  4X6A J;  2Y30 A;  2K40 A;  2NS8 A;  2ECB A;  2DJN A;  1PUF A;  3IV5 A;  4I76 A;  3S1M J;  1IV6 A;  1ORK A;  4DYC A;  2R0Q C;  2JMW A;  3VPR A;  5M3M J;  2LD5 A;  1IGN A;  3LSR A;  1POG A;  2DA3 A;  2Y31 A;  2CU7 A;  1ZK8 A;  1LFB A;  3K7A J;  2CUE A;  1U78 A;  3TP0 A;  2DA7 A;  1MBG A;  2XPU A;  1MSE C;  5M5Y J;  1ETX A;  3TW6 A;  5IOZ A;  2E19 A;  2M8G X;  3G1O A;  1JJ8 C;  2LLK A;  3LSP A;  4B1R A;  3SJM A;  2I10 A;  3HOX J;  1YRN B;  2NVY J;  3IH4 A;  3OSF A;  3JRE A;  1JTY A;  5DS9 A;  3CQZ J;  3TP3 A;  4J19 A;  1RKW A;  1ETV A;  1SAN A;  4GFB A;  1NK3 P;  2TRT A;  3I4N J;  1DU0 A;  1ENH A;  2L7F P;  2NVX J;  2R5Z A;  3W6V A;  3LNQ A;  3JRB A;  4IHV A;  2NVQ J;  5C4J J;  3JR9 A;  2MSY A;  3IH2 A;  4A3D J;  1JKR C;  3DEW A;  2MGQ A;  3G1L A;  5J3L A;  2YU9 J;  2YS9 A;  2CQQ A;  2RAE A;  1TWH J;  5C4X J;  1FTZ A;  1K83 J;  5E3N A;  1OJL A;  1TWC J;  4C2M J;  4JX4 A;  2K9N A;  2XGC A;  2DA4 A;  3NAR A;  2B63 J;  1I3Q J;  2VUM J;  2DTZ A;  4L5E A;  2WAQ N;  1DU6 A;  4MLO A;  1G2H A;  1IDY A;  3GTP J;  2LP0 A;  3HGY A;  2JJ7 A;  3BTJ A;  5IYB J;  1JT6 A;  2XPV A;  3NAU A;  1BW6 A;  2N8G A;  1Q1V A;  1ETW A;  4A93 J;  1ZR2 A;  1TC3 C;  2XB0 X;  1IJW C;  3BR3 A;  1Y1V J;  1PUF B;  1ETK A;  4DW6 A;  1AHD P;  2WV1 A;  1QVT A;  4JX6 A;  1IG7 A;  2CQX A;  1ZR4 A;  1X2M A;  3S17 J;  1MNM C;  4DYR A;  3A01 B;  1TWA J;  4IHW A;  1RPW A;  2DMT A;  4JP0 A;  4W97 A;  3PM1 A;  2KT0 A;  3BQY A;  3BT9 A;  3BR0 A;  4IHX A;  3BR2 A;  3K2A A;  3O8G A;  4AYB N;  2XB5 A;  1B72 A;  1GT0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...