2X48A

Orf 55 from sulfolobus islandicus rudivirus 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
54
structure length
54
Chain Sequence
MKKEIQVQGVRYYVESEDDLVSVAHELAKMGYTVQQIANALGVSERKVRRYLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAG38821
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rod-shaped virus 1
molecule tags Viral protein
total genus 18
structure length 54
sequence length 54
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13384 HTH_23 Homeodomain-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2x48A00
3I4NJ 2B63J 2CU7A 3TW7A 1QPIA 1JT6A 1XC5A 3E7LA 3HOUJ 4IHXA 1SANA 3GTLJ 4UUTA 3D1NI 5EGOA 1GV5A 2K9NA 4MIMA 1S7EA 2IAIA 5EEAA 2E2HJ 2JA7J 2JN6A 2X6OA 1RKTA 3FIWA 1UHSA 1RETA 1JT0A 5M3FJ 2K9QA 3Q0WA 5F27A 3BR5A 3TW6A 1AKHA 3GTGJ 1NTCA 2ECBA 2YUSA 2XGDA 3HB9A 1FEXA 4V2GA 5C4XJ 1LE8A 3BR1A 1B72B 1DU0A 4D5FA 3BTCA 2ID6A 4JP0A 1PUFA 1Z0XA 3GTKJ 4A93J 3TP3A 4A3JJ 2R5ZB 2OF7A 4M3EA 2CQQA 1ZKGA 2VKEA 1ETXA 3B6AA 3FK6A 4M3GA 4X1EA 1ETVA 4FE7A 4C3JJ 3QPLA 1HDDC 1B8IB 2RAEA 5EYRA 1MH3A 1R9TJ 2XPUA 2VI6A 4XRSA 2D5VA 4EEFG 4A3EJ 2LTPA 4A3LJ 5DTDA 1X2MA 5DS9A 1IUFA 3BG9A 1VI0A 1I50J 5F08A 2E19A 5J1RA 5FKMA 4RDUA 1JKQC 2FQ4A 2WV1A 1BA5A 3S15J 3S1NJ 1WI3A 4XK4A 1LFUP 2ME0A 1JTYA 1H8AC 3HGYA 2TRTA 4J19A 1ZR4A 4A3KJ 3Q3SA 3LSPA 5E3MA 4JX5A 4BY7J 2HOSA 1P7JA 2Y0SN 3O8HA 1A5JA 1B72A 4AUXA 1FTZA 2MSYA 2XPWA 1FIPA 1HCRA 2KDZA 4JX4A 5EGOB 4D7NA 3GTQJ 4DYCA 1P7IA 5IPAA 2HXOA 2M8GX 3CCYA 4A69C 1HF0A 3JRDA 2COBA 2NOGA 2VPRA 3BR2A 3LSGA 2MGQA 2HOTA 3LSJA 1TWFJ 3PO3J 1AU7A 2VKVA 1K61A 1BJZA 2AO9A 3SDGA 3GTPJ 3LNQA 2W48A 1Y1WJ 2E1OA 1GV2A 1ZR2A 1IJWC 4XRMA 5C3EJ 2L7ZA 2NVXJ 4M6VA 1ETQA 2LP0A 2XGEA 2NS7A 1IC8A 1E3OC 3A03A 1PUFB 1I6HJ 1W0TA 1W0UA 1D5YA 4DZPA 2HYJA 1QVTA 2Y9ZA 2HI3A 1FTTA 2PMZN 5F04A 3HOWJ 4QIWN 1LFBA 2LFBA 1XS9A 4DZJA 5FLMJ 3S17J 4XRSG 3RKQA 1OFCX 1IRZA 2Y2ZA 2KT0A 3K2AA 1WH7A 5J1YA 5M5YJ 3S14J 4JYKA 2TCTA 3BR3A 2FD5A 3BTLA 1ETYA 4A3MJ 2VUMJ 1BW6A 3M4OJ 2Y9YA 2JMWA 2G0EA 2HDDA 5JLXA 5IP9J 5M5XJ 2XPVA 4I76A 1O4XA 2EZIA 3LSRA 4BXXJ 3A01B 2XGCA 2JWTA 4DW6A 4IEJA 1JUSA 1OCPA 4FTHA 5GPCA 3O8GA 1IV6A 4C2MJ 2O7OA 1BL0A 1ZGWA 1NK2P 2DMUA 4MO7A 1JKPC 1WH5A 3HM5A 3BTJA 3ZQLA 2DMNA 5FKOA 4IHWA 3C2BA 4I6ZA 4A3CJ 4AC0A 5GPAA 3HOYJ 1SFOJ 2EZLA 3S1RJ 2DA6A 3H0GJ 5FJ8J 3QQAA 2M34A 1TWCJ 4UUSB 3ZOBA 1ETKA 4IHYA 3MVPA 4FE4A 4A3BJ 1H88C 5EF6A 3JR9A 2N8GA 2M2EA 2DA1A 4DYQA 1CQTA 1YRNA 2GM4A 3S1MJ 5JLWA 4G12A 3ZQGA 3JRCA 3QPSA 3UKGA 1POGA 1Y1VJ 3TP0A 1ITYA 4JX6A 3IV5A 3NAUA 5F0HA 1T56A 2L7MP 1A6IA 1GVDA 3GTMJ 1IDZA 3A01A 3JREA 1MBKA 1EF4A 2P81A 1JKOC 1DU6A 1OJLA 3JRHA 5IP7J 3SFIA 1Z77A 1I3QJ 3JRBA 5FKNA 2DMQA 5K7ZA 3BR6A 3W6VA 4IHVA 1WCMJ 4AYBN 4FISA 4A3DJ 2EZKA 4MLOA 3BG3A 4ABZA 4DYRA 2NS8A 3HOVJ 1RR7A 3GTOJ 5FLVA 1BW5A 2I10A 4D7MA 2XB5A 2L9RA 2FX0A 2X9DA 3FKIJ 2DN0A 2Y31A 3L1PA 1FJLA 4UUSA 2DA5A 3CDLA 3TEDA 1GT0C 1ETWA 3OIOA 1MNMC 5IYDJ 3MKLA 3ZQHA 2K9SA 1K83J 1U9OA 2LY9A 2EQRA 5FKLA 2LD5A 9ANTA 3GTJJ 3HOZJ 2NVYJ 3FK7A 1TWHJ 1ZK8A 4W1UA 1JUMA 1XG1A 5EDNA 1VFCA 2YS9A 2QCOA 5GP9A 1U8BA 1JTXA 2X48A 3M3YJ 2L0KA 3G1OA 2YU9J 4B3AA 4FCYA 2XB0X 1WGXA 4GFBA 2R93J 2GBYA 1MSFC 1JKRC 1JJ6C 5IYCJ 3PM1A 5EG0B 2DMTA 4V2FA 2K40A 3BG5A 2JJ7A 5E3LA 1ZTRA 4M3FA 2E2IJ 1UG2A 4HNVA 1YRNB 2DJNA 5HODA 1ZQ3P 1RKWA 1X2NA 2CUFA 2XSDC 4QSHA 3BQYA 3B6CA 5M5WJ 3F0CA 3DEWA 2HQ5A 1WPKA 1F43A 1HLVA 2CQXA 3OSFA 5K7FA 3IH2A 5IOYA 3ZQCA 5K7HA 1MH4A 2FJ1A 1ENHA 3RZDJ 3OSGA 1MBEA 2LR8A 4MFEA 3DCFA 2R7ZJ 1JGGA 4XIDA 3Q0UA 4X6AJ 4M3BA 2R5YA 2DA2A 3G1MA 2ZB9A 2M0CA 4C3HJ 2DA3A 1Q1VA 1RESA 2WB1N 2CJJA 2R92J 2LLKA 3BTIA 3JRGA 1IG7A 2HOAA 2IBDA 3ZQIA 1HOMA 1MBJA 3BR0A 1U78A 4CYCA 2E2JJ 5F1JA 4BBSJ 2H1KA 3NARA 2HXIA 1APLC 2ECCA 1H89C 5EG0A 2ME6A 1JJ8C 2QF7A 3JRFA 1QRYA 1VF9A 4B1RA 2JA5J 3G1LA 4Y52J 5FKKA 2OPTA 1OCTC 1TWGJ 5IOZA 1FIAA 4LOCA 4C3IJ 3HBLA 1U9NA 2L7FP 1GUUA 3FISA 2IEKA 5EZHA 1G2HA 1MSEC 2NVTJ 1NK3P 3MN2A 1MBGA 3JRAA 2DA7A 3HDDA 3VPRA 2DMPA 4BBRJ 1MBHA 2R0QC 5E3OA 1HDPA 1ETOA 3RZOJ 1QVUA 2WAQN 1AHDP 3IH4A 4L5EA 4RBOA 1GDTA 3HGGA 2MG4A 3PO2J 3WHCA 4BKXA 2LK2A 3K7AJ 3BQZA 4Y7NJ 2JK3A 3LOCA 5M3MJ 3SJMA 3HKZN 4BY1J 1MBFA 3WHBA 4A3FJ 5BNGA 1T33A 3S2DJ 4NDLA 5J3LA 5E3NA 5F0FA 2CUEA 2Y30A 2NVQJ 5IP6A 3S16J 3H3VK 1VNDA 2CRGA 4XICA 2JA6J 1RPWA 1UMQA 3IH3A 1ORKA 5C4JJ 2MW8A 2R5ZA 2R5YB 5IYBJ 2XRLA 4D5CA 3Q0VA 1TWAJ 2DA4A 4MFDA 2O9LA 1IGNA 3A02A 2AHQA 1B8IA 2ID3A 2LKXA 3OOUA 4B4CA 1AKHB 5J1UA 4W97A 4CYCB 2H8RA 4QTRA 2EBIA 3S2HJ 3ZQFA 1LE8B 3HEFA 3JRIA 2GLOA 2JA8J 3GBGA 4M3DA 2EZHA 1TC3C 2LVSA 4A3GJ 3S1QJ 2EH3A 2DTZA 1F36A 1JUPA 3CMYA 3I4MJ 2M9HA 4A3IJ 5C44J 1IDYA 2ELKA 3BT9A 3CQZJ 1X58A 4S0HB 2O8KA 3RQIA 5EZGA 3HOXJ 5F0CA
chains in the Genus database with same CATH superfamily
4G7OF 1OCCH 5DM7F 2B63J 4RB3C 1QPIA 2KIQA 1XC5A 4U7BA 2QBYA 3L2CA 3RKXA 2P5KA 2V9KA 3P9KA 1FY7A 4ZYGA 3GTLJ 4UV9A 4UUTA 1GV5A 2K9NA 3GLXA 3KLOA 3PQKA 2R7RA 1O3RA 2BY1A 4HQMA 3CJRB 4HDUA 3KP5A 1RKTA 4ZH4F 2MBFA 1RETA 4JK1X 3Q0WA 4NUBA 1HSJA 3FBIB 4F3QA 1G6NA 3GTGJ 2YUSA 5L3DA 2KFDA 4N4NB 2HQNA 1ON2A 2Y48A 1FEXA 4V2GA 2UZKA 2EV5A 2ID6A 3I53A 4JP0A 1ZGAA 3GTKJ 3KLNA 3SFZA 2XAFA 3NWTA 1O3SA 2QM3A 4OAYA 4A3JJ 4F91B 4EATA 3ZMDA 2R5ZB 3CDHA 3PSIA 3MFKA 1ZKGA 1I6XA 2VKEA 1P4WA 1QZYA 1ETXA 4F52A 4X1EA 1ETVA 2DDBA 4FE7A 4G7ZF 1HDDC 3J7AY 1MKMA 1B8IB 1SEUA 3GVAA 1YS6A 2M30A 1IXRC 2XASA 2FEZA 2CQNA 3HIFA 2ADUA 4I7HA 1R9TJ 1S5LC 2XPUA 3F22A 3ZMUA 4ZZDA 1VQKI 1UAAA 3AKZA 1X3UA 3AG3H 4MHGA 4EEFG 4A3EJ 2QUFA 3KPHA 2LG4A 5DTDA 1IUFA 3TKYA 4IOCF 1K6OA 1PJRA 4M9SA 2K9MA 2QZ8A 2QENA 3H3ZA 2FQ4A 2MFZA 4I99C 1X1AA 1LEBA 1J9IA 2MC3A 1TL8A 1LFUP 3G71I 2WAEA 1K7AA 2KDOA 1ZR4A 4A3KJ 3G2BA 2MH2A 3LSPA 4FX4A 2QKLB 2QYOA 3PUFA 1QQIA 3O8HA 1L3LA 5EEGA 1B72A 2F5VA 5L3CA 3ZMVA 2XPWA 3LL7A 5JVGF 1BOBA 2OV7A 1A36A 1TQMA 4DYCA 1P7IA 1C0WA 2M8GX 1D0ZA 3N05A 1G4DA 1HW2A 5BMZA 2WC2A 3LAPA 3R60A 1XSDA 2NOGA 2VPRA 2LBFA 4QPOA 1XN7A 3DKXA 3GFMA 3HXLA 3OR2C 2VB6A 3SYTA 1ONVA 1AU7A 1BJZA 1XX5A 3HRUA 3SDGA 1I3AA 2HZDA 2BE5F 2ZXJA 3ZRGA 4E7IA 4XL9A 4N9IA 2Y75A 2DI3A 1RIOH 2E1OA 2R7VA 1WSUA 2L7ZA 2NVXJ 3E6CC 4M6VA 1ETQA 2LP0A 3KZIC 2CQKA 1VQ9I 2P7CB 3WE2A 3DXJF 1PUFB 2MABA 3S3MA 3BG7A 4I98B 3TQNA 2HYJA 4UHTA 5LHIA 2E35A 2PMZN 3WU1B 1Z9CA 2KIMA 2DLLA 5FLMJ 4ZYHA 4YIFA 1HXDA 2O3FA 3K70C 4JBAA 4ZJZA 1WH7A 5J1YA 3ML6A 2UWMA 1WRJA 2JRTA 5HLGA 3RPQA 4AWXB 2XROA 1VQ7I 2TCTA 1KU9A 3BR3A 3DKYA 3ZMTA 2VUMJ 1YOVB 2EILH 3LSKA 3S3OA 1BIBA 3QP6A 5HS7A 3NRVA 3FM3A 2A3SA 5JLXA 2HDDA 1HKSA 5IP9J 1YJWI 1OR7C 1MNEA 4I76A 4LG3A 3RYRA 1O4XA 4UNOA 1U8RA 1TW3A 4OMYA 1P9QC 3KP4A 4D0PA 4ZDOA 1RNLA 4RM3A 5B66C 1OCPA 3AG4H 5ILSA 4LLGF 4FTHA 5GPCA 2HKOA 2W24A 4KA4A 4C2MJ 1IV6A 4CICA 2PN6A 5FO5A 4KIGA 1TNTA 2HVQA 4RS8A 1Q1HA 5LFAA 2VJ5A 2DMNA 5FKOA 1MJAA 3O2PE 1YI2I 4HSTA 1ZELA 3U21A 2XAUA 3S1RJ 5E8IA 3H0GJ 2PMZA 2O8XA 2M34A 1TWCJ 3ZOBA 3O3KA 4DGWB 3LFUA 1Y8QB 2EK5A 1WQ2A 2NOJB 2HNHA 4LG0A 3VWBA 2CO5A 5D6EA 5EF6A 1KYWA 5K5QA 3HSEA 2ISYA 2DA1A 4DYQA 1EJ9A 1CQTA 3BPXA 3ZQGA 1B1BA 1S29A 1POGA 3GZ6A 1YO5C 3TP0A 4IRIA 2RKHA 1OYYA 3NAUA 5F0HA 4L9TA 2L7MP 3GTMJ 5CYVA 4GO1A 4CHUA 5KNLA 4UB6C 3JREA 2PMHA 1EF4A 1OKRA 3ISPA 1JKOC 3M7GA 3ESWB 1OQYA 3S2WA 4YIIA 3IRRA 4RGRA 1S6LA 1P4XA 3RCOA 1I3QJ 1ERDA 2M8EA 5FFXA 5EEHA 3X2QH 2DMQA 3B02A 1XPXA 2ZFWA 5AIPA 1R22A 3VEPA 5K7ZA 4I0AA 1SFUA 3W6VA 1VQOI 1BC7C 2BY0A 4A3DJ 2R3SA 4ABZA 2KHMA 3GFIA 1HC8A 4IHTA 3GTOJ 1BW5A 1SFEA 2I10A 2P5LC 4IQ4A 2XB5A 4R1HA 2FX0A 5BPIA 3I54A 1V3FA 5F1RA 2CG4A 5IT9Z 4UUSA 2V1XA 5IYDJ 1Y39A 1YLFA 3K10A 2EQRA 3FXRA 5FKLA 3I59B 4BJ6C 3GTJJ 3PFIA 4YIRX 4NNJA 3SEZA 3ULQB 3FK7A 1ZK8A 2ETHA 2Y0MA 1JUMA 4E7JA 2GXBA 5LHHA 4FX0A 4BNCA 4LIUA 3CUOA 3OS0A 2MC4A 2ZFUA 3ABKH 1VFCA 2CFOA 1XDUA 2FBKA 3D5LA 1U8BA 1JTXA 2X48A 2L0KA 1Z6TA 2X1DA 2ZJQF 1WZ2A 3W3CA 2YU9J 3HRSA 2ISZA 5A2QK 1OPCA 4PJLA 1WGXA 4KUMA 2E60A 2IPQX 5KVRA 2RNGA 4Y15A 2FRHA 4I2OA 1D0YA 3PM1A 2HVSA 5EG0B 1EA3A 2JRMA 2BHYA 2LY2A 5FFZA 5LLQA 2JJ7A 1D1AA 5FGMA 1RUOA 2E2IJ 3L2WA 4U7DA 2F4MB 1BC8C 3GXOA 1YRNB 2L9SA 1ZQ3P 3MZYA 3V42A 3K9TA 3KEOA 4UB8C 2CUFA 4BAYA 1R4NB 1CF7B 4E7ZA 1OR7A 1TP4A 2PG4A 4UY8I 3W2VA 3T0YA 2EIJH 1IN4A 1MIJA 4PK4A 2KZVA 3L2QA 4LFUA 4FASD 4HDVA 3MD2A 4KNYA 2KJBA 3IH2A 3K1MA 1WJ5A 1XCBA 2E36A 2ZKZA 3HUGA 4IOAF 3CMAI 3V7CA 4BHPA 1XMAA 1IW7F 3RZDJ 4HX4A 3OSGA 3HHHA 4MFEA 2YX4A 1SVOA 4CYDA 4XIDA 4X6AJ 3WTZA 2R5YA 4EM1A 2ZNYA 4GXOA 3K2ZA 2VLAA 3KFWX 2EINH 3AL0C 2B7EA 2ZB9A 1Q1VA 2XSJC 1RESA 4BU2A 2K4JA 4HPQA 4EV0A 3O6BB 3J7ZI 5J40A 1V5GA 4XLNF 6PAXA 2L9NA 1L0OC 2XIGA 3L7WA 3FXMA 4BBSJ 2F4OB 1APLC 1WJDA 1TQIA 3MKYB 2ME6A 5E17F 4A2UA 1JJ8C 4HNUA 2V26A 4Y52J 1J0RA 3RI4A 2P8TA 4DJAA 1WJFA 1DUXC 4C3IJ 1PP7U 2WV0A 4CGZA 3FISA 4Y3OA 3BWGA 4RLQA 3BY6A 4E7KA 1AWCA 4BQQA 2NVTJ 4BDYA 4E7HA 4D9JA 3KYCB 2KIFA 3E3VA 4F55A 2DMPA 3TGNA 3PQJA 5E3OA 3AG2H 1JE8A 4RB1A 3CCSI 1WJBA 3LWFA 4DQ2A 1VQ4I 3S3NA 1X3WB 4G9YA 3IH4A 4RBOA 1K4SA 2MG4A 4RAGA 2LK2A 2VPLA 2PFBA 3BJOA 4QWQA 3BQZA 3CJQB 3PNYA 4RLFA 5JFRA 1W7PD 2E7XA 2VQLA 3MKZA 2P5VA 3HC7A 4RGSA 4ENKA 3FMSA 2D1HA 3QYBA 5LGNA 1STZA 2IJLA 2FQ3A 5F0FA 2JPBA 2WWYA 1AA7A 1JXSA 4YELA 2Q2EB 3H3VK 4L9VA 2I8DA 1YJNI 1VNDA 4RGUA 2PQ8A 1RPWA 4WF2A 3ERMA 5C4JJ 2R5ZA 5GAEJ 4MFDA 3RIRA 1DP3A 3G73A 3F8FA 5DCMA 1U5TC 3ABTA 4HW0A 1B8IA 3OOUA 2OTJI 1R1VA 4II2A 3LSHA 2EB7A 4W97A 4MQVA 1IV8A 2H8RA 2EBIA 2XVCA 1YJ9I 3OYHA 5D4RA 1LE8B 1VQLI 4OIPF 2ACJA 2GOMA 2IGKA 4LITA 3OOPA 2GLOA 2JA8J 5AONA 3OV8A 2VJ4A 1E0EA 2EA2A 3K4JA 2NAZA 3RSNA 4GCVA 1AOYA 2H6CA 3OYDA 2Q0OA 1FBQA 3VYUB 3R6SA 2M9HA 4U0YA 3TO6A 4J00A 1IDYA 4XSZF 3A1YA 4NQWB 1HW5A 5L3EA 1S7OA 3RQIA 3K4LA 4IJAA 3HOXJ 4O5VA 5F0CA 5HLIA 3CC4I 1MMGA 3T5XA 3I4NJ 3DTIA 2CU7A 3TW7A 1JT6A 1KU7A 2XUBA 2GXGA 3D1NI 2HZTA 5LGTA 3KX2A 2A5WA 2IAIA 4ESJA 2JA7J 2JN6A 4IPAA 5J6XA 5H2FC 5DCFA 3M1CA 2X6OA 1KA8A 4AIDA 1UHSA 2HKXA 2XKOA 2WA0A 4OU0A 5GAGJ 5BQTA 3LAJA 4B8XA 2V7FA 2Z99A 2IA2A 4EVIA 2JUCA 2FOKA 5HDGA 1AKHA 2XGDA 4YG2F 4P9UA 5HDKA 3QPHA 3ZN0A 1V54H 2OZUA 2TDXA 4LMYA 3BR1A 3CCJI 5JR3A 1DU0A 4D5FA 1ZN2A 3MCZA 5GTHC 4HA8A 2WY8Q 1PUFA 2VKHA 4XLHA 4Y33A 5GADJ 2L01A 4A93J 3TP3A 3QRFF 5BPDA 1ZREA 4BYYA 4M72A 1J59A 2OF7A 1I1GA 2EFQA 2F4IA 2CGPA 1MD0A 3B6AA 4M3GA 4P55A 1XSVA 1GVJA 2M0MA 4HBLA 2L9VA 4BQAA 1V4RA 4MQ9F 1OYIA 3BP8A 5ED4A 1MH3A 1XD7A 3HOSA 2VI6A 4XRSA 3E97A 1X2MA 1Z7UA 2DOAA 1J2XA 3HTUA 2OAZA 5F08A 1GHCA 3E6DA 3OYBA 3KCCA 1JKQC 3MKWB 3P9CA 3S15J 3S1NJ 2XHKA 3TMOA 1SD6A 3H9GA 1JTYA 4CCJA 1NHAA 5E3MA 2V6CA 3K1NA 4JX5A 2HOSA 1A5JA 4AUXA 2L02A 5BOXA 1TW2A 2XF7A 1FIPA 1X1CA 4BEHA 2QSFX 5EGOB 1BI2A 3L00A 3GF2A 4D7NA 3GTQJ 2KP6A 5IPAA 2RNJA 1HF0A 5KCMA 1XMXA 2COBA 1BR1A 2XC7A 3B73A 1UJ8A 1A35A 3LSGA 1QPMA 2MGQA 2HOTA 4CSWA 1FOWA 1U5TA 2YX7A 1TWFJ 3PO3J 1K61A 3GTPJ 3T8RA 2W48A 1Y1WJ 2VXDA 2KIUA 1KYZA 4M9XA 1R71A 2DU9A 3DWLE 2LH9A 4P1WA 2XGEA 2NS7A 3ERED 1ZGJA 2BW3B 2RDPA 1WKMA 1XB4A 4MEYF 4Q47A 2KJCA 1D5YA 3KZYA 1G3YA 1QVTA 2RQQA 3A0BC 3LQQA 1FTTA 5F04A 3HOWJ 3MZHA 1BI1A 2LFBA 2VODA 1XS9A 2MLGA 2X4HA 3S17J 5FROA 2R7OA 3RKQA 1OFCX 3KEYA 4LK1F 4ESBA 1Y0UA 1UG0A 3R0AA 1I39A 2Z2SB 3JTHA 3OS1A 3WTTC 2ELHA 2YU3A 2OUMA 3BTLA 1FYLA 1ETYA 2LSOA 1BW6A 1FBSA 2BVLA 3F8BA 3FMRA 3MWMA 1SVLA 3BROA 1YW8A 5FD6A 1RUNA 2JMWA 4S04A 3V8JA 2DQRA 1R6RA 3BG6A 4PUSA 2XPVA 1U2WA 2EZIA 1K4TA 3LSRA 5CVRA 2E1MB 3A01B 2ZO4A 4DW6A 3G3ZA 3HJEA 4P9FA 2ZSHB 1LDDA 3O8GA 1S72I 1FOKA 4B44A 1YW9A 1ZGWA 4MO7A 3OL3A 5JHUA 5ILVA 1LKXA 2ZJRF 1WH5A 2A5YB 3HM5A 2A69F 2A6TA 1X4OA 2W1OA 4M74A 2IGNA 4IHWA 3C2BA 1FZPB 1T39A 4A3CJ 5FLXK 1LNWA 4AC0A 1SVMA 2W82A 1MDMA 4N9HA 2LY1A 4KMFA 2V79A 4AU7A 3QQAA 5FD5A 1D3YA 3AG1H 3U2RA 1FSHA 4HOBA 3CC7I 3ASNH 1U0JA 1XDSA 4FE4A 5D5XB 2MD5A 4A3BJ 2GZWA 2XRNA 1H88C 3ZN1A 3PNVA 1K78B 2IA0A 3KEQA 2GWRA 5CLSA 2NRAC 2OCCH 3I0TA 1JI8A 2ZMEB 4MGRA 1K79A 1YRNA 3ECHA 3KYDB 2JVHA 5JLWA 1W7PB 3JRCA 3QPSA 1OCOH 3UKGA 2GAUA 1VQNI 4JX6A 4E70A 1T56A 4BGDA 2FF4A 5LRRA 3TBIA 4EJTA 5DUIA 1WI9A 2LYCA 2XAQA 5CQEA 4Q5SF 1XGOA 3JW4A 3CCLI 2VJIA 3G6EI 2LF7A 4CZCA 4LIVA 4FQGA 2UXXA 3OIPA 1USTA 4IO9F 3PJRA 2F48A 4XR6A 4AYBN 4FISA 2C6YA 3CDIA 1RI7A 2NS8A 3HRMA 3HOVJ 3K4KA 3W2WA 3FKJA 5B1AH 2QKMB 3ZQ7A 2Q1ZB 3U1KA 2X9DA 2Y31A 3OYFA 2DFHA 2FBIA 2DTRA 2K3PA 2DA5A 4RMNA 3TEDA 3H92A 4LLNA 3MKLA 1YTYA 3SZGA 2K9SA 2PX9A 3KZZA 2CSOA 4CDGA 1FMVA 1V55H 2JTVA 5TRDA 1TWHJ 4RA2A 3E0JB 2NNNA 3V4GA 3HPGA 4ENNA 5LBQA 4EGYA 1I1SA 2VE8A 3DPLC 2OC6A 1W5SA 2JZYA 2QCOA 2VC1A 1PUEE 4IRGA 3M3YJ 2DFEA 2W7NA 1D8JA 2JSCA 1A04A 3GWZA 1ZARA 4B3AA 2LKSA 1HSTA 1M1EB 1E3PA 2R93J 2IW5A 2GBYA 3WG9A 3FMQA 1T0FC 4B48A 2LNBA 3SDBA 5IYCJ 4LD5A 4HZFA 2R7UA 2MD0A 1FX7A 2XAHA 1YW7A 3BG5A 2VQGA 5E3LA 1ZTRA 4IZZA 3CUQB 1Z6RA 2YR2A 1LDJA 5KAFC 3J80K 3D5SC 1OMIA 4AYBA 2XSDC 2X51A 5K5OA 2EFWA 2LRDA 2O03A 4Y13A 2JA2A 3F0CA 4XONA 2JQ7A 1P2FA 1BM9A 2BYVE 3P5JA 1ON1A 4C30A 5LHGA 2EFNA 2W84A 2L3DA 3ZMSA 1RRJA 2CQXA 4I02A 1F5TA 1LVAA 2DBBA 1YIJI 4RM2A 3QU3A 4A0ZA 1YE9A 1FSEA 2FJ1A 1ENHA 5ICCA 3QOPA 2ZXHA 4G6DA 1MBEA 2LR8A 5D5UB 4G8XA 5CVJA 4M3BA 3FHNA 4V19K 2VKDA 3HHGA 2PMUA 2M0CA 4UVCA 3GFLA 2G9WA 4C3HJ 2EV0A 5EJCA 4N4OB 3EQLF 2QEXI 2FUG2 1X19A 3CLQA 2H27A 1WJEA 2IBDA 3QWLA 3ASOH 3ZQIA 1MBJA 4YFNF 2E2JJ 4KT6A 3M9AA 3HL2A 2H1KA 4KFCA 4HV6A 2F5EA 2AXTC 5IY5H 1H0MA 1WJCA 2QF7A 3BC8A 3DTEA 3CCQI 1QRYA 2X6XA 2JA5J 3J80Z 1JGSA 1R1UA 2J5OA 2R7DA 5B5EC 4LOCA 5IOZA 1S8NA 2W4SA 4PFPA 1EH7A 1GUUA 1EH6A 2L7FP 4RAYA 2IEKA 4XBFA 2PLYA 1MSEC 4IX7A 2Z33A 3K4CA 2VJJA 3MN2A 1MBGA 2COMA 4J01A 4BXFA 2STTA 3IWZA 3F72A 5D6FA 1SC7A 4BBRJ 5DM6F 2R0QC 1HDPA 1G3TA 3RZOJ 1JHFA 1VTNC 1GDTA 4OINF 5D5WB 3HZJA 4XNFA 2QWWA 1PYVA 2L2OA 3DU5A 1LQ1A 4UVAA 2DJIA 4G6TB 3LOCA 3SJMA 3HKZN 2NYXA 4A3FJ 4OIQF 3BZKA 1HKTA 2HYGD 4RGXA 2R7FA 3UR3C 4EGZA 1FC3A 3KP3A 3IL2A 4DBRA 1UZCA 2HTJA 3I55I 2CRGA 2RVCA 1N77A 3IH3A 4XLAA 2CH0A 4HX7A 1SFKA 4DOZA 4EMSA 3CO7C 3S32A 4A0YA 4AIJA 3HTSB 2DT6A 2FMLA 2FE3A 1ODDA 3J81K 4XN3A 2E71A 2PJRA 2A68F 4S05A 4CCOA 2WBMA 3WTSC 4CYCB 1T0FA 3GCMA 2CUZA 2OBPA 3ZQFA 2HTSA 3DLAA 3MMYB 2DDAA 3I5UA 2OQRA 1IN6A 3K4NA 4XKVA 4M3DA 3CCMI 3ZPLA 1TC3C 1T6SA 1N78A 1FNNA 2EH3A 5HVQC 4BE1A 4L9JA 2DTZA 3L2UA 1R5ID 3E5XA 5GTIC 1F36A 2HWVA 5TISC 3JCUC 4A3IJ 5C44J 5F6FA 2VE9A 3CQZJ 1Z1DA 1BN5A 2CQ7A 4S0HB 3HKZA 4ZTJA 3I58A 1Z3XA 1BR4A 1RC9A 3CCEI 1H9GA 4DIQA 1MMAA 4B3XA 4CA0A 2Y0SA 4WCGA 4WXDA 4IHXA 1SANA 1WJAA 2L5QA 3FXJA 4KN7X 5EGOA 1S7EA 2E2HJ 3CF2A 4M6XA 1DP7P 2ELJA 2VC0A 2XAGA 4Z2YA 3FIWA 1ZAOA 2QLZA 4DNCA 3J81Z 2BXZA 2K9QA 2JT1A 5A2QZ 3WG7H 4ZTFA 1U3EM 4HSRA 3BR5A 2GOXB 3TW6A 4RB0A 2DFIA 3CP8A 1QA6A 1T38A 2M1BA 2X1CA 2Z3YA 3HB9A 4U0VA 2CS3A 2DFFA 1FLIA 3KIOA 1B72B 3RPUA 3QYEA 1ZG5A 1PP8F 3CZ6A 1FP2A 1O7LA 3BTCA 2R7XA 4UVBA 2Y69H 5DUKA 1SAUA 3DFGA 4BQOA 2NS0A 3FXLA 3FWEA 4EJUA 4WXHA 2QQAA 3ECOA 3LQRA 3OYIA 4M3EA 2HFHA 2HQAA 2OJED 2ZCWA 2LBFB 3SXYA 5D5VB 2KKOA 4CCMA 3FK6A 4M71A 5ERIA 4R8HA 4C3JJ 3QPLA 3BJ6A 3U1DA 1E17A 3GYHX 3S8PA 2RAEA 4BXUA 5EYRA 2DT5A 2G7UA 2KISA 1B59A 1TT5B 3WTUC 2KQRA 3LSIA 2W85A 4MTDA 4A3LJ 1ZHFA 5DS9A 2E7WA 2OZ6A 3NWSA 2VONA 3F6OA 1VI0A 2A6HF 1I50J 4A5NA 4AD9A 2JUGA 3Q5FA 5H20A 5J1RA 4UUVA 4RDUA 5K5RA 2A61A 1WI3A 1KU2A 2DYSH 1UFMA 2FU4A 4ANJA 3BCBA 2R7TA 1IO2A 1XTAA 2O61A 4J19A 3U9GA 3Q3SA 4BUPA 1P7JA 1R23A 2Q8KA 5L3GA 4NC7A 1FTZA 2BEOA 4IVNA 1OCZH 4XSXF 1A6QA 3WTVC 1HCRA 2KDZA 1I27A 1VQPI 2KZGA 3DEUA 4HX8A 3VSLA 3JRDA 1TBXA 2X6WA 3HRTA 4PGGA 1W4MA 3BR2A 1ZH5A 4OIOF 1OLTA 2F2EA 3LSJA 3TO9A 4G94A 1GXQA 1ZG1A 2VKVA 2AO9A 4IF4A 3LNQA 3H1CA 2CFXA 3DV8A 2VBWA 2XKPA 1ZR2A 1GV2A 4BE2A 4E4HA 1IJWC 4XRMA 3BPVA 1T95A 4XLPF 4IL6C 2ESHA 2KRCA 4CH7A 1ACIA 3A03A 1MZBA 4KMUX 4QPQA 3H9JA 4A0XA 1I6HJ 1W0UA 2CV1A 1XGNA 1WFXA 5ICFA 3DTKA 3JTGA 2HI3A 2OTLI 3UNGC 1IUYA 1LFBA 3CCVI 4DZJA 3FM5A 4XRSG 2W00A 2Y2ZA 4HG2A 2UV1A 5M5YJ 3W6JB 1QHGA 4JYKA 4CUGA 1EKEA 4OOIA 1XGMA 4HEA2 5DYMA 1HQCA 3DBRB 1SD7A 1SD4A 4LG0B 1TQPA 3E5UA 1D0XA 5KK1A 2OD5A 2ZSIB 3NQOA 4BHBA 3IRQA 2I5UA 1GLNA 5IT3A 4NB5A 2ZXWH 4A5MA 4PSWA 2VASA 5M5XJ 2LF8A 5HS9A 4IHSA 1FOYA 5LEKA 1UHWA 1T8IA 2FNPA 2RC4A 1YX3A 1D8KA 2VT3A 2LMDA 1N25A 3P9IA 2OQGA 4HRIA 3FX3A 2HU9A 2CUJA 3OYGA 1BL0A 4L18B 1NK2P 2DMUA 3H36A 2QSHX 3BTJA 3BZCA 2V6EA 3ZQLA 1X1BA 1B9NA 2OU2A 4PJ0C 3OYNA 1T2KA 2DPUA 1KQ0A 5E1WA 3OY9A 3CMMA 1QU3A 1H9TA 3TDUC 5E8GA 5D8KB 1YFHA 3R0JA 4CCKA 3TOBA 5FJ8J 4EJWA 1LEAA 3QU6A 2V4JC 1QBJA 4UUSB 2VBXA 3IAM2 4IHYA 3MVPA 3WU0A 2IS4A 1QGPA 2GA2A 1SD5A 2MLKA 3JR9A 3L2VA 3HPHA 2L4MA 2N8GA 3MQ0A 2KLOA 1ULYA 2ZNZA 3IKTA 4MEXF 5B1BH 1ZLJA 4G12A 1Y56A 4XKCA 3Q9SA 1IRXA 1Y1VJ 2F5FA 3IUOA 3IV5A 2AQFA 3GMEA 1GVDA 4KN4X 4PCQA 1FYMA 4KYWA 1QNTA 1MBKA 4EM0B 3OR1C 5CVVA 1Z91A 3ZCOA 3JRHA 3F8NA 2VIXA 3OMYA 4Y4RA 3JRBA 1Z67A 5FKNA 1D5VA 1J09A 3BR6A 3K0LA 2D2WA 5TJJA 1LUJB 4IHVA 2LREA 4OWRB 3GUDA 3ZGKA 1Z05A 2NXNB 3BG3A 4HAMA 4MLOA 3RDIA 3GZNB 2FOWA 2CW0F 2DODA 1RR7A 3FXQA 4WWCA 2DN0A 3L1PA 1YYVA 1FJLA 1WWXA 4HLXA 1P4AA 3CDLA 5KHDA 1FT9A 3DPTA 4HQEA 2DW4A 3MEXA 1U9OA 2LY9A 3OYCA 3W2AA 3HUGB 3HOZJ 1JHHA 2P6TA 3HSRA 3BDDA 3COAC 4Q48A 1RZ4A 1N75A 4W1UA 4PFOA 4G6QA 3TDZC 4RAZA 4XKWA 3FXUA 4I09A 1B4AA 3EETA 3GO5A 5D4SA 3V7RA 3G1OA 3EYIA 1B9MA 1MMNA 2HS5A 1W36D 1O57A 5DV5A 3VYTB 4FHTA 2MH9A 1JJ6C 1BBYA 3ABMH 2QQBA 1Y6IA 4V2FA 2K40A 4QLCU 5HNFA 2M7AA 2H09A 5AIQA 4M3FA 4N0BA 1RR8C 2HDWA 2WAQA 4BHCA 3I4PA 3CLOA 4HNVA 3CD6I 5HODA 1RKWA 1X2NA 2EWNA 3BJAA 4QSHA 3B6CA 5M5WJ 4AIKA 3IC7A 3BZ6A 2RREA 2HYFA 3E6MA 3L09A 2V1UA 2CW8A 1WPKA 2QGUA 4Q4ZF 4XOPA 1F43A 3M8JA 5K7FA 2ZJ2A 2W25A 5IOYA 3M8EA 3ZQCA 5K7HA 1KQ9A 3I59A 3WGHA 1F9NA 1MH4A 3EYYA 1UB9A 3P7NA 2AQEA 3DCFA 2R7ZJ 3C1DA 3I3LA 3OYEA 5J4VA 2AS5F 2XDVA 3G1MA 2K3FA 4ZC3A 1FBUA 3DQVC 1BI0A 4XRFA 1X1DA 1G3WA 2LLKA 1IG7A 2R92J 1V5FA 3CC2I 3TOAA 4EM2A 1U78A 1OCRH 4CYCA 4ZDPA 3L2RA 5HLHA 1S7AA 2CYYA 5F1JA 3NARA 2HXIA 3OYAA 1J75A 2ECCA 1H89C 2VBYA 5EG0A 2M45A 1NH3A 1LB2A 3C2GA 1HW1A 4BJTA 2FA5A 4U0WA 3QAHA 3JRFA 3PIPF 2STWA 1VF9A 1R5GA 3G4SI 5FKKA 2X1EA 1F4KA 1FIAA 4L0ZB 3C7JA 1FMWA 2IT0A 2ZJPF 1CF7A 4Z6YA 1U9NA 5DCMB 4EJVA 1DDNA 2IXSA 1KQ8A 1KGSA 2K5CA 3CJNA 4BL0B 3WTWC 2VOOA 1MW7A 2OCEA 4ITVA 2RN7A 2IP2A 1V5EA 2DA7A 1B6AA 3VPRA 5DDGA 1MBHA 5J47A 3EUKL 2E1CA 1IRGA 1BR2A 4A6EA 5FLXZ 1ETOA 1O7FA 4CCLA 3HGGA 2BV6A 2PEXA 4XM3A 3WHCA 1VQ5I 5JVTA 2G7HA 3FDYA 2MA3A 1QZEA 4CZZA 4Y7NJ 3DEEA 3N4MA 5M3MJ 2DCEA 2M4KA 3QYFA 1CGPA 5DEQA 3ABLH 3AAFA 4MNUA 3OYJA 3BCAA 1T33A 5FRMA 1DPUA 2K4BA 5J3LA 2BVMA 1YHQI 3KP6A 2CUEA 1U6GA 3SZTA 3E1SA 1MNDA 3H5RA 2E5ZA 2VQHA 3I64A 4XICA 2JA6J 1SMYF 1R00A 1ORKA 1G3SA 3AL0B 2MW8A 3DPUA 1R5HA 5IYBJ 4GYGA 4D5CA 5HLTA 2YSRA 1TWAJ 4BDZA 2EV6A 2E1NA 2J5PA 5HNHA 1IF1A 3CCRI 4XLFA 4CCNA 2JSPA 3LA3A 1Z7LA 2ID3A 4B4CA 3EUAA 2FNAA 3DLLF 1AKHB 2KRHA 1BOAA 2KPMA 2EPFA 3GZ5A 1NG7A 1YX5A 3GX4X 2HEOA 5CKTA 2NVUB 3J7YJ 3HEFA 4H4KC 1DGWY 3JSPA 2V1NA 3JRIA 4PZJA 1Y0NA 2RQPA 1FP1D 2IVMA 3H3UA 3QOEA 3RJPA 4AIHA 2GIZA 3T1BA 4ZDLA 4ESFA 3JSOA 1TT0A 4AVZA 1JUPA 1X4PA 2HQRA 3I4MJ 5CVIA 3EUHC 2KRFA 2MYSA 4JOMA 4NC6A 3F3XA 3WTYC 5JI6A 2WADA 4ZYAA 2O8KA 5EZGA 1I5ZA 3TL4X 3H35A 2JPCA 3E7LA 3HOUJ 1QZZA 4BACA 1P92A 4B43A 1YS7A 2Q2EA 3MAJA 4KIBA 3IAS2 4GYIA 4KJZA 4MIMA 5EEAA 3FXKA 4E6KG 3LFKA 3HSFA 4JQFA 4IKFA 2X0LA 2LC2A 1JT0A 5M3FJ 5F27A 3V7SA 4WXCA 4ZYDA 3GFJA 3S93A 5FB2A 2EA4A 1R36A 2ZXIA 5CJ9A 2P4WA 3V8LA 1NTCA 2ECBA 1X1PA 2VL8A 2ICWG 5C4XJ 1LE8A 4O6JA 2K86A 4M73A 3GLLA 1XGSA 1VQ6I 1IZ1A 4BEHB 1Z0XA 1DGRM 1LJ9A 2IA1A 4Y17A 2CQQA 1WHUA 1U5TB 2BGCA 3VB2A 5CVUA 2F6CA 4NQWA 1E2XA 4LK0F 1S3JA 1ZRFA 5IT9K 2KL4A 4L0YB 4KISA 5GAHJ 3VYRB 3K6GA 3DF8A 4E7LA 2F5CA 1EV7A 4RAFA 2D5VA 2K9LA 5ICEA 2GQQA 1TTYA 3H9QA 2LTPA 4YFKF 4WX9A 1YQAA 3BG9A 3OS2A 4F7ZA 2BOLA 3LMMA 4PSXA 3VSKA 1TZLA 2L4AA 2E19A 2QSGX 1G59A 5FKMA 2WV1A 5ILUA 3FHZA 3EPZA 1BA5A 1QO0D 2E34A 2X6YA 2UUZA 4B09A 2E1MC 2GIVA 4XLEA 4XK4A 5HOOA 3RYPA 2ME0A 1H8AC 3HGYA 2TRTA 3VODA 2XAJA 3R4KA 4BY7J 3K70D 2Y0SN 4ENMA 2QBYB 2BXYA 1LVKA 2MSYA 1HA8A 4OAZA 2PBIA 4JX4A 3OWTA 3FZVA 2R7SA 2HXOA 4A69C 3CCYA 3L9FA 3RKWA 3MZ8A 4P5OA 2VT2A 5JHFA 2EFOA 1MJ9A 2YPRA 3H0DA 3QPTA 2L54A 3A0HC 4C9YA 3IP4B 3IKVA 3DP7A 3M07A 4HYEA 5E1XA 4GDFA 4RB2C 3QODA 5L3FA 5C3EJ 2VOPA 1UELB 4YRVA 4DBQA 2QA4I 1IC8A 1E3OC 5E20A 2ZMEC 1W0TA 4HF1A 2M87A 4HV5A 1MDMB 2AXLA 3W6KB 4M6YA 2OA4A 4XKBA 4DZPA 2EIKH 2Y9ZA 2W57A 5E79C 4QIWN 5LD2C 1YITI 1IXSB 3EUHA 5LGUA 4C2TA 4L5IA 1IRZA 4LLLA 4ON0A 2KT0A 1SMTA 3K2AA 4FETA 5CPRB 1UHMA 3S14J 3C2HA 2LDUA 3LA7A 1W5CC 1YIOA 4L9NA 2LKPA 3PFYA 3F8CA 1IXCA 3I71A 3SZPA 2FD5A 4A3MJ 4C2UA 2FSWA 4ASNA 1J5YA 2E5NA 3NEUA 3RPUD 3SHFA 4LGWA 2V9VA 2Y9YA 3GEZA 3M4OJ 5E18F 2IGOA 4XORA 2G0EA 2V1DA 2IGMA 1IN7A 1VQMI 1IN8A 4BXXJ 2XGCA 2JWTA 4M9ZA 2IRFG 4IEJA 1JUSA 2A05A 5KAIC 4BE0A 4U88A 2O7OA 1YG2A 5H6RA 2BY2A 4ENJA 1JKPC 2DXIA 3I9V2 3V8KA 3ZP5A 2H6BA 3F23A 4ZZLA 1MMSA 3PSFA 4U87A 3OIQA 2BW3A 1R7JA 2K02A 4I6ZA 1VZ0A 3T8TA 1O3TA 4OIRF 2Z16A 5GPAA 1R49A 3HOYJ 1USSA 1SFOJ 2EZLA 2RV8A 1EH8A 3C18A 4R79A 4ETSA 2DA6A 2CMPA 4EQQA 2WY7Q 3WU2C 3DBHB 1O3QA 5DD8A 4LB5A 1ETKA 2Z1DA 2R7WA 4EJOA 4BQNA 2XF6A 4PGHA 4FT8A 5HDNA 2EIMH 2WTEA 3RTRA 4F92B 2EFPA 4E7SA 2UXNA 2F5DA 3F6VA 4YEJA 1DQUA 2Z5UA 3K1PA 3RQ4A 4HNTA 1MGTA 3WODF 2BBYA 2M2EA 2B0LA 2XGXA 3CESA 3ZR8X 3CUQC 2CW7A 2R7QA 2GM4A 5B3SH 5HS8A 3K4MA 3WGGA 4XQFA 2H1LA 3S1MJ 5J4YA 4II3A 1D1CA 1X3ZB 1ITYA 3KETA 4PDKA 3ROUA 4G7HF 1A6IA 4ZYEA 4YFXF 1IDZA 3A01A 2DT7B 4PJJA 5E1ZB 4D1QA 4HLYA 3WGIA 2P81A 4LJZF 1FWZA 3OL4A 1HKQA 1DU6A 2CV0A 1LFPA 1OJLA 2M3AA 3IWFA 5J8CA 2KMUA 3SFIA 3D0SA 5IP7J 2P0WA 2K27A 1Z77A 2A07F 2V9PA 1ZLKA 3I56I 4XLCA 2XV4S 3K69A 1SAXA 5H6QA 3D5RC 2P7VB 2QVOA 3KYLA 1REPC 5BS6A 1KU3A 1WCMJ 1LPQA 1MMDA 2EZKA 2QQ9A 3Q9VA 1XMKA 3OYMA 3RKYA 4DYRA 2FXAA 1KZHA 5DD4A 3WTXC 3CO6C 5FLVA 4AM3A 4D7MA 2L9RA 3FKIJ 2NNYA 3JAMK 1SFXA 1MNMC 1GT0C 1ETWA 3F9KA 3OIOA 3ZQHA 1ZG3A 5TGTA 1K83J 2DOFA 2K7LA 2O6GE 1TNSA 2B9SA 4BS9A 2VXZA 2LD5A 9ANTA 2NVYJ 2M7BA 1K78A 3KP2A 3A4CA 1XG1A 4X0GA 5EDNA 4TV7A 2ZMEA 3KE2A 2HR3A 1R4MB 1W7PA 2YS9A 5GP9A 2PI0A 4OMZA 3PL8A 4KT5C 2HOEA 2IS6A 3KP7A 1G8XA 1IN5A 2H94A 5F64A 4FCYA 2XB0X 4CXFA 2DAOA 2XF5A 1WVRA 3ZMZA 3VYSB 3HG9A 1MSFC 4GFBA 5J8FA 2PJPA 4L5JA 1JKRC 2ESNA 4K2EA 1K6YA 2A6EF 2DMTA 3ONQA 4KIFA 3VOEA 1HBXG 1KONA 3M8FA 3BOQA 2BY3A 4NHJA 1UG2A 2WAFA 3FF5A 2BZTA 2DJNA 2Z9OA 1R1TA 3FXOA 4I0BA 5ICGA 1OYWA 1MJBA 3TO7A 2IS2A 3N97A 3BQYA 3K4BA 2JVGA 3JAMZ 3DEWA 1DPRA 2VBZA 3H5AA 2HQ5A 3LA2A 3VDXA 1HLVA 2GXAA 1FPQA 1J7KA 1ZYRF 2FMYA 3OSFA 4WK8F 4A6DA 1A31A 3SEQA 3SQNA 3LSMA 4XOTA 2LOOA 4HF0A 2ZBKA 4MTEA 1D1BA 1W1WE 1QHHD 4IXAA 3HOTA 4CO8A 1JGGA 3GW2A 3Q0UA 1P6RA 4NC8A 3ELKA 2R4GA 3CP2A 2RGVA 5LRSA 2DA2A 4LB6B 1W36C 4KDPA 2DA3A 2HVRA 4AVPA 1R58A 2WB1N 2L7KA 2CJJA 2P6SA 3BTIA 3JRGA 4P96A 4XN0A 3WE3A 2HOAA 2DO7A 4XMYA 1HOMA 3FBNB 3BR0A 2K85A 3HYIA 4IRHA 2DOEA 1VQ8I 2DQLA 3AFHA 5FRNA 3DU6A 4B47A 1ZRDA 4H0EA 4A12A 3A2KA 4BH9A 4I01A 3H5NA 1W5TA 3CMEI 4B1RA 3G1LA 3CUQA 3M1EA 2VQCA 2OPTA 1E3HA 3E6BA 2O5RA 1TWGJ 3PUBA 4UXNA 1OCTC 3HBLA 5CQGA 3OYLA 3F21A 2HPMA 3C3WA 5EZHA 1PDNC 1G2HA 2BHZA 2PJRB 1NK3P 1IRFA 2DYRH 3ZQQA 3JRAA 2DK8A 2DPDA 2FBHA 1F1ZA 3BLYA 3HDDA 1ZRCA 1OISA 1QVUA 2ZC2A 2WAQN 1AHDP 1UCRA 3E5QA 4L5EA 2D45A 3PNTA 3IHUA 3PO2J 4PJMA 3R61A 4BKXA 3K7AJ 4IQJA 1S9HA 2JK3A 2WB1A 4BY1J 2CV2A 1MBFA 3WHBA 5BNGA 2D1VA 2HGCA 2H8WA 4GRIA 3S2DJ 4NDLA 1FOXA 5K1YA 5E3NA 4F93B 2GA1A 2Y30A 3QP5A 2NVQJ 2CWEA 5IP6A 2HPIA 1NG6A 1FYKA 3S16J 5D8LB 1UMQA 1IAWA 3ZXSA 3DKWA 4O3MA 2R5YB 2XRLA 3Q0VA 4KICA 2DA4A 4KITB 2O9LA 3PIOF 1PVEA 1XSXA 1IGNA 4NBQA 3A02A 5L3BA 3CF5F 2AHQA 4GGGA 3J7AO 3CTAA 2VN2A 3VFZA 1GXPA 5LEJA 3CJTB 2LKXA 3OYKA 4PJNA 5J1UA 3ABUA 4HF2A 1T98A 2M4GA 4BJ5C 4QTRA 3S2HJ 1BIAA 2EJRA 1T08B 3GBGA 3F8MA 2EZHA 2O0YA 2X85A 2M5WA 3REOA 2LVSA 4A3GJ 4UV8A 3S1QJ 1Y8RB 3CCUI 1XCVA 2IS1A 2DK5A 3LSTA 1TLHB 1BJAA 1Z21A 3CMYA 3DBLB 3EDPA 2ELKA 3BT9A 1BI3A 1Z3YA 1X58A 2QQ8A 2HDCA 1LDKB
chains in the Genus database with same CATH topology
3I4NJ 2B63J 2CU7A 3TW7A 1QPIA 1JT6A 1XC5A 3E7LA 3HOUJ 4IHXA 1SANA 3GTLJ 4UUTA 3D1NI 5EGOA 1GV5A 2K9NA 4MIMA 1S7EA 2IAIA 5EEAA 2E2HJ 2JA7J 2JN6A 2X6OA 1RKTA 3FIWA 1UHSA 1RETA 1JT0A 5M3FJ 2K9QA 3Q0WA 5F27A 3BR5A 3TW6A 1AKHA 3GTGJ 1NTCA 2ECBA 2YUSA 2XGDA 3HB9A 1FEXA 4V2GA 5C4XJ 1LE8A 3BR1A 1B72B 1DU0A 4D5FA 3BTCA 2ID6A 4JP0A 1PUFA 1Z0XA 3GTKJ 4A93J 3TP3A 4A3JJ 2R5ZB 2OF7A 4M3EA 2CQQA 1ZKGA 2VKEA 1ETXA 3B6AA 3FK6A 4M3GA 4X1EA 1ETVA 4FE7A 4C3JJ 3QPLA 1HDDC 1B8IB 2RAEA 5EYRA 1MH3A 1R9TJ 2XPUA 2VI6A 4XRSA 2D5VA 4EEFG 4A3EJ 2LTPA 4A3LJ 5DTDA 1X2MA 5DS9A 1IUFA 3BG9A 1VI0A 1I50J 5F08A 2E19A 5J1RA 5FKMA 4RDUA 1JKQC 2FQ4A 2WV1A 1BA5A 3S15J 3S1NJ 1WI3A 4XK4A 1LFUP 2ME0A 1JTYA 1H8AC 3HGYA 2TRTA 4J19A 1ZR4A 4A3KJ 3Q3SA 3LSPA 5E3MA 4JX5A 4BY7J 2HOSA 1P7JA 2Y0SN 3O8HA 1A5JA 1B72A 4AUXA 1FTZA 2MSYA 2XPWA 1FIPA 1HCRA 2KDZA 4JX4A 5EGOB 4D7NA 3GTQJ 4DYCA 1P7IA 5IPAA 2HXOA 2M8GX 3CCYA 4A69C 1HF0A 3JRDA 2COBA 2NOGA 2VPRA 3BR2A 3LSGA 2MGQA 2HOTA 3LSJA 1TWFJ 3PO3J 1AU7A 2VKVA 1K61A 1BJZA 2AO9A 3SDGA 3GTPJ 3LNQA 2W48A 1Y1WJ 2E1OA 1GV2A 1ZR2A 1IJWC 4XRMA 5C3EJ 2L7ZA 2NVXJ 4M6VA 1ETQA 2LP0A 2XGEA 2NS7A 1IC8A 1E3OC 3A03A 1PUFB 1I6HJ 1W0TA 1W0UA 1D5YA 4DZPA 2HYJA 1QVTA 2Y9ZA 2HI3A 1FTTA 2PMZN 5F04A 3HOWJ 4QIWN 1LFBA 2LFBA 1XS9A 4DZJA 5FLMJ 3S17J 4XRSG 3RKQA 1OFCX 1IRZA 2Y2ZA 2KT0A 3K2AA 1WH7A 5J1YA 5M5YJ 3S14J 4JYKA 2TCTA 3BR3A 2FD5A 3BTLA 1ETYA 4A3MJ 2VUMJ 1BW6A 3M4OJ 2Y9YA 2JMWA 2G0EA 2HDDA 5JLXA 5IP9J 5M5XJ 2XPVA 4I76A 1O4XA 2EZIA 3LSRA 4BXXJ 3A01B 2XGCA 2JWTA 4DW6A 4IEJA 1JUSA 1OCPA 4FTHA 5GPCA 3O8GA 1IV6A 4C2MJ 2O7OA 1BL0A 1ZGWA 1NK2P 2DMUA 4MO7A 1JKPC 1WH5A 3HM5A 3BTJA 3ZQLA 2DMNA 5FKOA 4IHWA 3C2BA 4I6ZA 4A3CJ 4AC0A 5GPAA 3HOYJ 1SFOJ 2EZLA 3S1RJ 2DA6A 3H0GJ 5FJ8J 3QQAA 2M34A 1TWCJ 4UUSB 3ZOBA 1ETKA 4IHYA 3MVPA 4FE4A 4A3BJ 1H88C 5EF6A 3JR9A 2N8GA 2M2EA 2DA1A 4DYQA 1CQTA 1YRNA 2GM4A 3S1MJ 5JLWA 4G12A 3ZQGA 3JRCA 3QPSA 3UKGA 1POGA 1Y1VJ 3TP0A 1ITYA 4JX6A 3IV5A 3NAUA 5F0HA 1T56A 2L7MP 1A6IA 1GVDA 3GTMJ 1IDZA 3A01A 3JREA 1MBKA 1EF4A 2P81A 1JKOC 1DU6A 1OJLA 3JRHA 5IP7J 3SFIA 1Z77A 1I3QJ 3JRBA 5FKNA 2DMQA 5K7ZA 3BR6A 3W6VA 4IHVA 1WCMJ 4AYBN 4FISA 4A3DJ 2EZKA 4MLOA 3BG3A 4ABZA 4DYRA 2NS8A 3HOVJ 1RR7A 3GTOJ 5FLVA 1BW5A 2I10A 4D7MA 2XB5A 2L9RA 2FX0A 2X9DA 3FKIJ 2DN0A 2Y31A 3L1PA 1FJLA 4UUSA 2DA5A 3CDLA 3TEDA 1GT0C 1ETWA 3OIOA 1MNMC 5IYDJ 3MKLA 3ZQHA 2K9SA 1K83J 1U9OA 2LY9A 2EQRA 5FKLA 2LD5A 9ANTA 3GTJJ 3HOZJ 2NVYJ 3FK7A 1TWHJ 1ZK8A 4W1UA 1JUMA 1XG1A 5EDNA 1VFCA 2YS9A 2QCOA 5GP9A 1U8BA 1JTXA 2X48A 3M3YJ 2L0KA 3G1OA 2YU9J 4B3AA 4FCYA 2XB0X 1WGXA 4GFBA 2R93J 2GBYA 1MSFC 1JKRC 1JJ6C 5IYCJ 3PM1A 5EG0B 2DMTA 4V2FA 2K40A 3BG5A 2JJ7A 5E3LA 1ZTRA 4M3FA 2E2IJ 1UG2A 4HNVA 1YRNB 2DJNA 5HODA 1ZQ3P 1RKWA 1X2NA 2CUFA 2XSDC 4QSHA 3BQYA 3B6CA 5M5WJ 3F0CA 3DEWA 2HQ5A 1WPKA 1F43A 1HLVA 2CQXA 3OSFA 5K7FA 3IH2A 5IOYA 3ZQCA 5K7HA 1MH4A 2FJ1A 1ENHA 3RZDJ 3OSGA 1MBEA 2LR8A 4MFEA 3DCFA 2R7ZJ 1JGGA 4XIDA 3Q0UA 4X6AJ 4M3BA 2R5YA 2DA2A 3G1MA 2ZB9A 2M0CA 4C3HJ 2DA3A 1Q1VA 1RESA 2WB1N 2CJJA 2R92J 2LLKA 3BTIA 3JRGA 1IG7A 2HOAA 2IBDA 3ZQIA 1HOMA 1MBJA 3BR0A 1U78A 4CYCA 2E2JJ 5F1JA 4BBSJ 2H1KA 3NARA 2HXIA 1APLC 2ECCA 1H89C 5EG0A 2ME6A 1JJ8C 2QF7A 3JRFA 1QRYA 1VF9A 4B1RA 2JA5J 3G1LA 4Y52J 5FKKA 2OPTA 1OCTC 1TWGJ 5IOZA 1FIAA 4LOCA 4C3IJ 3HBLA 1U9NA 2L7FP 1GUUA 3FISA 2IEKA 5EZHA 1G2HA 1MSEC 2NVTJ 1NK3P 3MN2A 1MBGA 3JRAA 2DA7A 3HDDA 3VPRA 2DMPA 4BBRJ 1MBHA 2R0QC 5E3OA 1HDPA 1ETOA 3RZOJ 1QVUA 2WAQN 1AHDP 3IH4A 4L5EA 4RBOA 1GDTA 3HGGA 2MG4A 3PO2J 3WHCA 4BKXA 2LK2A 3K7AJ 3BQZA 4Y7NJ 2JK3A 3LOCA 5M3MJ 3SJMA 3HKZN 4BY1J 1MBFA 3WHBA 4A3FJ 5BNGA 1T33A 3S2DJ 4NDLA 5J3LA 5E3NA 5F0FA 2CUEA 2Y30A 2NVQJ 5IP6A 3S16J 3H3VK 1VNDA 2CRGA 4XICA 2JA6J 1RPWA 1UMQA 3IH3A 1ORKA 5C4JJ 2MW8A 2R5ZA 2R5YB 5IYBJ 2XRLA 4D5CA 3Q0VA 1TWAJ 2DA4A 4MFDA 2O9LA 1IGNA 3A02A 2AHQA 1B8IA 2ID3A 2LKXA 3OOUA 4B4CA 1AKHB 5J1UA 4W97A 4CYCB 2H8RA 4QTRA 2EBIA 3S2HJ 3ZQFA 1LE8B 3HEFA 3JRIA 2GLOA 2JA8J 3GBGA 4M3DA 2EZHA 1TC3C 2LVSA 4A3GJ 3S1QJ 2EH3A 2DTZA 1F36A 1JUPA 3CMYA 3I4MJ 2M9HA 4A3IJ 5C44J 1IDYA 2ELKA 3BT9A 3CQZJ 1X58A 4S0HB 2O8KA 3RQIA 5EZGA 3HOXJ 5F0CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N J;  2B63 J;  2CU7 A;  3TW7 A;  1QPI A;  1JT6 A;  1XC5 A;  3E7L A;  3HOU J;  4IHX A;  1SAN A;  3GTL J;  4UUT A;  3D1N I;  5EGO A;  1GV5 A;  2K9N A;  4MIM A;  1S7E A;  2IAI A;  5EEA A;  2E2H J;  2JA7 J;  2JN6 A;  2X6O A;  1RKT A;  3FIW A;  1UHS A;  1RET A;  1JT0 A;  5M3F J;  2K9Q A;  3Q0W A;  5F27 A;  3BR5 A;  3TW6 A;  1AKH A;  3GTG J;  1NTC A;  2ECB A;  2YUS A;  2XGD A;  3HB9 A;  1FEX A;  4V2G A;  5C4X J;  1LE8 A;  3BR1 A;  1B72 B;  1DU0 A;  4D5F A;  3BTC A;  2ID6 A;  4JP0 A;  1PUF A;  1Z0X A;  3GTK J;  4A93 J;  3TP3 A;  4A3J J;  2R5Z B;  2OF7 A;  4M3E A;  2CQQ A;  1ZKG A;  2VKE A;  1ETX A;  3B6A A;  3FK6 A;  4M3G A;  4X1E A;  1ETV A;  4FE7 A;  4C3J J;  3QPL A;  1HDD C;  1B8I B;  2RAE A;  5EYR A;  1MH3 A;  1R9T J;  2XPU A;  2VI6 A;  4XRS A;  2D5V A;  4EEF G;  4A3E J;  2LTP A;  4A3L J;  5DTD A;  1X2M A;  5DS9 A;  1IUF A;  3BG9 A;  1VI0 A;  1I50 J;  5F08 A;  2E19 A;  5J1R A;  5FKM A;  4RDU A;  1JKQ C;  2FQ4 A;  2WV1 A;  1BA5 A;  3S15 J;  3S1N J;  1WI3 A;  4XK4 A;  1LFU P;  2ME0 A;  1JTY A;  1H8A C;  3HGY A;  2TRT A;  4J19 A;  1ZR4 A;  4A3K J;  3Q3S A;  3LSP A;  5E3M A;  4JX5 A;  4BY7 J;  2HOS A;  1P7J A;  2Y0S N;  3O8H A;  1A5J A;  1B72 A;  4AUX A;  1FTZ A;  2MSY A;  2XPW A;  1FIP A;  1HCR A;  2KDZ A;  4JX4 A;  5EGO B;  4D7N A;  3GTQ J;  4DYC A;  1P7I A;  5IPA A;  2HXO A;  2M8G X;  3CCY A;  4A69 C;  1HF0 A;  3JRD A;  2COB A;  2NOG A;  2VPR A;  3BR2 A;  3LSG A;  2MGQ A;  2HOT A;  3LSJ A;  1TWF J;  3PO3 J;  1AU7 A;  2VKV A;  1K61 A;  1BJZ A;  2AO9 A;  3SDG A;  3GTP J;  3LNQ A;  2W48 A;  1Y1W J;  2E1O A;  1GV2 A;  1ZR2 A;  1IJW C;  4XRM A;  5C3E J;  2L7Z A;  2NVX J;  4M6V A;  1ETQ A;  2LP0 A;  2XGE A;  2NS7 A;  1IC8 A;  1E3O C;  3A03 A;  1PUF B;  1I6H J;  1W0T A;  1W0U A;  1D5Y A;  4DZP A;  2HYJ A;  1QVT A;  2Y9Z A;  2HI3 A;  1FTT A;  2PMZ N;  5F04 A;  3HOW J;  4QIW N;  1LFB A;  2LFB A;  1XS9 A;  4DZJ A;  5FLM J;  3S17 J;  4XRS G;  3RKQ A;  1OFC X;  1IRZ A;  2Y2Z A;  2KT0 A;  3K2A A;  1WH7 A;  5J1Y A;  5M5Y J;  3S14 J;  4JYK A;  2TCT A;  3BR3 A;  2FD5 A;  3BTL A;  1ETY A;  4A3M J;  2VUM J;  1BW6 A;  3M4O J;  2Y9Y A;  2JMW A;  2G0E A;  2HDD A;  5JLX A;  5IP9 J;  5M5X J;  2XPV A;  4I76 A;  1O4X A;  2EZI A;  3LSR A;  4BXX J;  3A01 B;  2XGC A;  2JWT A;  4DW6 A;  4IEJ A;  1JUS A;  1OCP A;  4FTH A;  5GPC A;  3O8G A;  1IV6 A;  4C2M J;  2O7O A;  1BL0 A;  1ZGW A;  1NK2 P;  2DMU A;  4MO7 A;  1JKP C;  1WH5 A;  3HM5 A;  3BTJ A;  3ZQL A;  2DMN A;  5FKO A;  4IHW A;  3C2B A;  4I6Z A;  4A3C J;  4AC0 A;  5GPA A;  3HOY J;  1SFO J;  2EZL A;  3S1R J;  2DA6 A;  3H0G J;  5FJ8 J;  3QQA A;  2M34 A;  1TWC J;  4UUS B;  3ZOB A;  1ETK A;  4IHY A;  3MVP A;  4FE4 A;  4A3B J;  1H88 C;  5EF6 A;  3JR9 A;  2N8G A;  2M2E A;  2DA1 A;  4DYQ A;  1CQT A;  1YRN A;  2GM4 A;  3S1M J;  5JLW A;  4G12 A;  3ZQG A;  3JRC A;  3QPS A;  3UKG A;  1POG A;  1Y1V J;  3TP0 A;  1ITY A;  4JX6 A;  3IV5 A;  3NAU A;  5F0H A;  1T56 A;  2L7M P;  1A6I A;  1GVD A;  3GTM J;  1IDZ A;  3A01 A;  3JRE A;  1MBK A;  1EF4 A;  2P81 A;  1JKO C;  1DU6 A;  1OJL A;  3JRH A;  5IP7 J;  3SFI A;  1Z77 A;  1I3Q J;  3JRB A;  5FKN A;  2DMQ A;  5K7Z A;  3BR6 A;  3W6V A;  4IHV A;  1WCM J;  4AYB N;  4FIS A;  4A3D J;  2EZK A;  4MLO A;  3BG3 A;  4ABZ A;  4DYR A;  2NS8 A;  3HOV J;  1RR7 A;  3GTO J;  5FLV A;  1BW5 A;  2I10 A;  4D7M A;  2XB5 A;  2L9R A;  2FX0 A;  2X9D A;  3FKI J;  2DN0 A;  2Y31 A;  3L1P A;  1FJL A;  4UUS A;  2DA5 A;  3CDL A;  3TED A;  1GT0 C;  1ETW A;  3OIO A;  1MNM C;  5IYD J;  3MKL A;  3ZQH A;  2K9S A;  1K83 J;  1U9O A;  2LY9 A;  2EQR A;  5FKL A;  2LD5 A;  9ANT A;  3GTJ J;  3HOZ J;  2NVY J;  3FK7 A;  1TWH J;  1ZK8 A;  4W1U A;  1JUM A;  1XG1 A;  5EDN A;  1VFC A;  2YS9 A;  2QCO A;  5GP9 A;  1U8B A;  1JTX A;  2X48 A;  3M3Y J;  2L0K A;  3G1O A;  2YU9 J;  4B3A A;  4FCY A;  2XB0 X;  1WGX A;  4GFB A;  2R93 J;  2GBY A;  1MSF C;  1JKR C;  1JJ6 C;  5IYC J;  3PM1 A;  5EG0 B;  2DMT A;  4V2F A;  2K40 A;  3BG5 A;  2JJ7 A;  5E3L A;  1ZTR A;  4M3F A;  2E2I J;  1UG2 A;  4HNV A;  1YRN B;  2DJN A;  5HOD A;  1ZQ3 P;  1RKW A;  1X2N A;  2CUF A;  2XSD C;  4QSH A;  3BQY A;  3B6C A;  5M5W J;  3F0C A;  3DEW A;  2HQ5 A;  1WPK A;  1F43 A;  1HLV A;  2CQX A;  3OSF A;  5K7F A;  3IH2 A;  5IOY A;  3ZQC A;  5K7H A;  1MH4 A;  2FJ1 A;  1ENH A;  3RZD J;  3OSG A;  1MBE A;  2LR8 A;  4MFE A;  3DCF A;  2R7Z J;  1JGG A;  4XID A;  3Q0U A;  4X6A J;  4M3B A;  2R5Y A;  2DA2 A;  3G1M A;  2ZB9 A;  2M0C A;  4C3H J;  2DA3 A;  1Q1V A;  1RES A;  2WB1 N;  2CJJ A;  2R92 J;  2LLK A;  3BTI A;  3JRG A;  1IG7 A;  2HOA A;  2IBD A;  3ZQI A;  1HOM A;  1MBJ A;  3BR0 A;  1U78 A;  4CYC A;  2E2J J;  5F1J A;  4BBS J;  2H1K A;  3NAR A;  2HXI A;  1APL C;  2ECC A;  1H89 C;  5EG0 A;  2ME6 A;  1JJ8 C;  2QF7 A;  3JRF A;  1QRY A;  1VF9 A;  4B1R A;  2JA5 J;  3G1L A;  4Y52 J;  5FKK A;  2OPT A;  1OCT C;  1TWG J;  5IOZ A;  1FIA A;  4LOC A;  4C3I J;  3HBL A;  1U9N A;  2L7F P;  1GUU A;  3FIS A;  2IEK A;  5EZH A;  1G2H A;  1MSE C;  2NVT J;  1NK3 P;  3MN2 A;  1MBG A;  3JRA A;  2DA7 A;  3HDD A;  3VPR A;  2DMP A;  4BBR J;  1MBH A;  2R0Q C;  5E3O A;  1HDP A;  1ETO A;  3RZO J;  1QVU A;  2WAQ N;  1AHD P;  3IH4 A;  4L5E A;  4RBO A;  1GDT A;  3HGG A;  2MG4 A;  3PO2 J;  3WHC A;  4BKX A;  2LK2 A;  3K7A J;  3BQZ A;  4Y7N J;  2JK3 A;  3LOC A;  5M3M J;  3SJM A;  3HKZ N;  4BY1 J;  1MBF A;  3WHB A;  4A3F J;  5BNG A;  1T33 A;  3S2D J;  4NDL A;  5J3L A;  5E3N A;  5F0F A;  2CUE A;  2Y30 A;  2NVQ J;  5IP6 A;  3S16 J;  3H3V K;  1VND A;  2CRG A;  4XIC A;  2JA6 J;  1RPW A;  1UMQ A;  3IH3 A;  1ORK A;  5C4J J;  2MW8 A;  2R5Z A;  2R5Y B;  5IYB J;  2XRL A;  4D5C A;  3Q0V A;  1TWA J;  2DA4 A;  4MFD A;  2O9L A;  1IGN A;  3A02 A;  2AHQ A;  1B8I A;  2ID3 A;  2LKX A;  3OOU A;  4B4C A;  1AKH B;  5J1U A;  4W97 A;  4CYC B;  2H8R A;  4QTR A;  2EBI A;  3S2H J;  3ZQF A;  1LE8 B;  3HEF A;  3JRI A;  2GLO A;  2JA8 J;  3GBG A;  4M3D A;  2EZH A;  1TC3 C;  2LVS A;  4A3G J;  3S1Q J;  2EH3 A;  2DTZ A;  1F36 A;  1JUP A;  3CMY A;  3I4M J;  2M9H A;  4A3I J;  5C44 J;  1IDY A;  2ELK A;  3BT9 A;  3CQZ J;  1X58 A;  4S0H B;  2O8K A;  3RQI A;  5EZG A;  3HOX J;  5F0C A; 
#chains in the Genus database with same CATH topology
 4G7O F;  1OCC H;  5DM7 F;  2B63 J;  4RB3 C;  1QPI A;  2KIQ A;  1XC5 A;  4U7B A;  2QBY A;  3L2C A;  3RKX A;  2P5K A;  2V9K A;  3P9K A;  1FY7 A;  4ZYG A;  3GTL J;  4UV9 A;  4UUT A;  1GV5 A;  2K9N A;  3GLX A;  3KLO A;  3PQK A;  2R7R A;  1O3R A;  2BY1 A;  4HQM A;  3CJR B;  4HDU A;  3KP5 A;  1RKT A;  4ZH4 F;  2MBF A;  1RET A;  4JK1 X;  3Q0W A;  4NUB A;  1HSJ A;  3FBI B;  4F3Q A;  1G6N A;  3GTG J;  2YUS A;  5L3D A;  2KFD A;  4N4N B;  2HQN A;  1ON2 A;  2Y48 A;  1FEX A;  4V2G A;  2UZK A;  2EV5 A;  2ID6 A;  3I53 A;  4JP0 A;  1ZGA A;  3GTK J;  3KLN A;  3SFZ A;  2XAF A;  3NWT A;  1O3S A;  2QM3 A;  4OAY A;  4A3J J;  4F91 B;  4EAT A;  3ZMD A;  2R5Z B;  3CDH A;  3PSI A;  3MFK A;  1ZKG A;  1I6X A;  2VKE A;  1P4W A;  1QZY A;  1ETX A;  4F52 A;  4X1E A;  1ETV A;  2DDB A;  4FE7 A;  4G7Z F;  1HDD C;  3J7A Y;  1MKM A;  1B8I B;  1SEU A;  3GVA A;  1YS6 A;  2M30 A;  1IXR C;  2XAS A;  2FEZ A;  2CQN A;  3HIF A;  2ADU A;  4I7H A;  1R9T J;  1S5L C;  2XPU A;  3F22 A;  3ZMU A;  4ZZD A;  1VQK I;  1UAA A;  3AKZ A;  1X3U A;  3AG3 H;  4MHG A;  4EEF G;  4A3E J;  2QUF A;  3KPH A;  2LG4 A;  5DTD A;  1IUF A;  3TKY A;  4IOC F;  1K6O A;  1PJR A;  4M9S A;  2K9M A;  2QZ8 A;  2QEN A;  3H3Z A;  2FQ4 A;  2MFZ A;  4I99 C;  1X1A A;  1LEB A;  1J9I A;  2MC3 A;  1TL8 A;  1LFU P;  3G71 I;  2WAE A;  1K7A A;  2KDO A;  1ZR4 A;  4A3K J;  3G2B A;  2MH2 A;  3LSP A;  4FX4 A;  2QKL B;  2QYO A;  3PUF A;  1QQI A;  3O8H A;  1L3L A;  5EEG A;  1B72 A;  2F5V A;  5L3C A;  3ZMV A;  2XPW A;  3LL7 A;  5JVG F;  1BOB A;  2OV7 A;  1A36 A;  1TQM A;  4DYC A;  1P7I A;  1C0W A;  2M8G X;  1D0Z A;  3N05 A;  1G4D A;  1HW2 A;  5BMZ A;  2WC2 A;  3LAP A;  3R60 A;  1XSD A;  2NOG A;  2VPR A;  2LBF A;  4QPO A;  1XN7 A;  3DKX A;  3GFM A;  3HXL A;  3OR2 C;  2VB6 A;  3SYT A;  1ONV A;  1AU7 A;  1BJZ A;  1XX5 A;  3HRU A;  3SDG A;  1I3A A;  2HZD A;  2BE5 F;  2ZXJ A;  3ZRG A;  4E7I A;  4XL9 A;  4N9I A;  2Y75 A;  2DI3 A;  1RIO H;  2E1O A;  2R7V A;  1WSU A;  2L7Z A;  2NVX J;  3E6C C;  4M6V A;  1ETQ A;  2LP0 A;  3KZI C;  2CQK A;  1VQ9 I;  2P7C B;  3WE2 A;  3DXJ F;  1PUF B;  2MAB A;  3S3M A;  3BG7 A;  4I98 B;  3TQN A;  2HYJ A;  4UHT A;  5LHI A;  2E35 A;  2PMZ N;  3WU1 B;  1Z9C A;  2KIM A;  2DLL A;  5FLM J;  4ZYH A;  4YIF A;  1HXD A;  2O3F A;  3K70 C;  4JBA A;  4ZJZ A;  1WH7 A;  5J1Y A;  3ML6 A;  2UWM A;  1WRJ A;  2JRT A;  5HLG A;  3RPQ A;  4AWX B;  2XRO A;  1VQ7 I;  2TCT A;  1KU9 A;  3BR3 A;  3DKY A;  3ZMT A;  2VUM J;  1YOV B;  2EIL H;  3LSK A;  3S3O A;  1BIB A;  3QP6 A;  5HS7 A;  3NRV A;  3FM3 A;  2A3S A;  5JLX A;  2HDD A;  1HKS A;  5IP9 J;  1YJW I;  1OR7 C;  1MNE A;  4I76 A;  4LG3 A;  3RYR A;  1O4X A;  4UNO A;  1U8R A;  1TW3 A;  4OMY A;  1P9Q C;  3KP4 A;  4D0P A;  4ZDO A;  1RNL A;  4RM3 A;  5B66 C;  1OCP A;  3AG4 H;  5ILS A;  4LLG F;  4FTH A;  5GPC A;  2HKO A;  2W24 A;  4KA4 A;  4C2M J;  1IV6 A;  4CIC A;  2PN6 A;  5FO5 A;  4KIG A;  1TNT A;  2HVQ A;  4RS8 A;  1Q1H A;  5LFA A;  2VJ5 A;  2DMN A;  5FKO A;  1MJA A;  3O2P E;  1YI2 I;  4HST A;  1ZEL A;  3U21 A;  2XAU A;  3S1R J;  5E8I A;  3H0G J;  2PMZ A;  2O8X A;  2M34 A;  1TWC J;  3ZOB A;  3O3K A;  4DGW B;  3LFU A;  1Y8Q B;  2EK5 A;  1WQ2 A;  2NOJ B;  2HNH A;  4LG0 A;  3VWB A;  2CO5 A;  5D6E A;  5EF6 A;  1KYW A;  5K5Q A;  3HSE A;  2ISY A;  2DA1 A;  4DYQ A;  1EJ9 A;  1CQT A;  3BPX A;  3ZQG A;  1B1B A;  1S29 A;  1POG A;  3GZ6 A;  1YO5 C;  3TP0 A;  4IRI A;  2RKH A;  1OYY A;  3NAU A;  5F0H A;  4L9T A;  2L7M P;  3GTM J;  5CYV A;  4GO1 A;  4CHU A;  5KNL A;  4UB6 C;  3JRE A;  2PMH A;  1EF4 A;  1OKR A;  3ISP A;  1JKO C;  3M7G A;  3ESW B;  1OQY A;  3S2W A;  4YII A;  3IRR A;  4RGR A;  1S6L A;  1P4X A;  3RCO A;  1I3Q J;  1ERD A;  2M8E A;  5FFX A;  5EEH A;  3X2Q H;  2DMQ A;  3B02 A;  1XPX A;  2ZFW A;  5AIP A;  1R22 A;  3VEP A;  5K7Z A;  4I0A A;  1SFU A;  3W6V A;  1VQO I;  1BC7 C;  2BY0 A;  4A3D J;  2R3S A;  4ABZ A;  2KHM A;  3GFI A;  1HC8 A;  4IHT A;  3GTO J;  1BW5 A;  1SFE A;  2I10 A;  2P5L C;  4IQ4 A;  2XB5 A;  4R1H A;  2FX0 A;  5BPI A;  3I54 A;  1V3F A;  5F1R A;  2CG4 A;  5IT9 Z;  4UUS A;  2V1X A;  5IYD J;  1Y39 A;  1YLF A;  3K10 A;  2EQR A;  3FXR A;  5FKL A;  3I59 B;  4BJ6 C;  3GTJ J;  3PFI A;  4YIR X;  4NNJ A;  3SEZ A;  3ULQ B;  3FK7 A;  1ZK8 A;  2ETH A;  2Y0M A;  1JUM A;  4E7J A;  2GXB A;  5LHH A;  4FX0 A;  4BNC A;  4LIU A;  3CUO A;  3OS0 A;  2MC4 A;  2ZFU A;  3ABK H;  1VFC A;  2CFO A;  1XDU A;  2FBK A;  3D5L A;  1U8B A;  1JTX A;  2X48 A;  2L0K A;  1Z6T A;  2X1D A;  2ZJQ F;  1WZ2 A;  3W3C A;  2YU9 J;  3HRS A;  2ISZ A;  5A2Q K;  1OPC A;  4PJL A;  1WGX A;  4KUM A;  2E60 A;  2IPQ X;  5KVR A;  2RNG A;  4Y15 A;  2FRH A;  4I2O A;  1D0Y A;  3PM1 A;  2HVS A;  5EG0 B;  1EA3 A;  2JRM A;  2BHY A;  2LY2 A;  5FFZ A;  5LLQ A;  2JJ7 A;  1D1A A;  5FGM A;  1RUO A;  2E2I J;  3L2W A;  4U7D A;  2F4M B;  1BC8 C;  3GXO A;  1YRN B;  2L9S A;  1ZQ3 P;  3MZY A;  3V42 A;  3K9T A;  3KEO A;  4UB8 C;  2CUF A;  4BAY A;  1R4N B;  1CF7 B;  4E7Z A;  1OR7 A;  1TP4 A;  2PG4 A;  4UY8 I;  3W2V A;  3T0Y A;  2EIJ H;  1IN4 A;  1MIJ A;  4PK4 A;  2KZV A;  3L2Q A;  4LFU A;  4FAS D;  4HDV A;  3MD2 A;  4KNY A;  2KJB A;  3IH2 A;  3K1M A;  1WJ5 A;  1XCB A;  2E36 A;  2ZKZ A;  3HUG A;  4IOA F;  3CMA I;  3V7C A;  4BHP A;  1XMA A;  1IW7 F;  3RZD J;  4HX4 A;  3OSG A;  3HHH A;  4MFE A;  2YX4 A;  1SVO A;  4CYD A;  4XID A;  4X6A J;  3WTZ A;  2R5Y A;  4EM1 A;  2ZNY A;  4GXO A;  3K2Z A;  2VLA A;  3KFW X;  2EIN H;  3AL0 C;  2B7E A;  2ZB9 A;  1Q1V A;  2XSJ C;  1RES A;  4BU2 A;  2K4J A;  4HPQ A;  4EV0 A;  3O6B B;  3J7Z I;  5J40 A;  1V5G A;  4XLN F;  6PAX A;  2L9N A;  1L0O C;  2XIG A;  3L7W A;  3FXM A;  4BBS J;  2F4O B;  1APL C;  1WJD A;  1TQI A;  3MKY B;  2ME6 A;  5E17 F;  4A2U A;  1JJ8 C;  4HNU A;  2V26 A;  4Y52 J;  1J0R A;  3RI4 A;  2P8T A;  4DJA A;  1WJF A;  1DUX C;  4C3I J;  1PP7 U;  2WV0 A;  4CGZ A;  3FIS A;  4Y3O A;  3BWG A;  4RLQ A;  3BY6 A;  4E7K A;  1AWC A;  4BQQ A;  2NVT J;  4BDY A;  4E7H A;  4D9J A;  3KYC B;  2KIF A;  3E3V A;  4F55 A;  2DMP A;  3TGN A;  3PQJ A;  5E3O A;  3AG2 H;  1JE8 A;  4RB1 A;  3CCS I;  1WJB A;  3LWF A;  4DQ2 A;  1VQ4 I;  3S3N A;  1X3W B;  4G9Y A;  3IH4 A;  4RBO A;  1K4S A;  2MG4 A;  4RAG A;  2LK2 A;  2VPL A;  2PFB A;  3BJO A;  4QWQ A;  3BQZ A;  3CJQ B;  3PNY A;  4RLF A;  5JFR A;  1W7P D;  2E7X A;  2VQL A;  3MKZ A;  2P5V A;  3HC7 A;  4RGS A;  4ENK A;  3FMS A;  2D1H A;  3QYB A;  5LGN A;  1STZ A;  2IJL A;  2FQ3 A;  5F0F A;  2JPB A;  2WWY A;  1AA7 A;  1JXS A;  4YEL A;  2Q2E B;  3H3V K;  4L9V A;  2I8D A;  1YJN I;  1VND A;  4RGU A;  2PQ8 A;  1RPW A;  4WF2 A;  3ERM A;  5C4J J;  2R5Z A;  5GAE J;  4MFD A;  3RIR A;  1DP3 A;  3G73 A;  3F8F A;  5DCM A;  1U5T C;  3ABT A;  4HW0 A;  1B8I A;  3OOU A;  2OTJ I;  1R1V A;  4II2 A;  3LSH A;  2EB7 A;  4W97 A;  4MQV A;  1IV8 A;  2H8R A;  2EBI A;  2XVC A;  1YJ9 I;  3OYH A;  5D4R A;  1LE8 B;  1VQL I;  4OIP F;  2ACJ A;  2GOM A;  2IGK A;  4LIT A;  3OOP A;  2GLO A;  2JA8 J;  5AON A;  3OV8 A;  2VJ4 A;  1E0E A;  2EA2 A;  3K4J A;  2NAZ A;  3RSN A;  4GCV A;  1AOY A;  2H6C A;  3OYD A;  2Q0O A;  1FBQ A;  3VYU B;  3R6S A;  2M9H A;  4U0Y A;  3TO6 A;  4J00 A;  1IDY A;  4XSZ F;  3A1Y A;  4NQW B;  1HW5 A;  5L3E A;  1S7O A;  3RQI A;  3K4L A;  4IJA A;  3HOX J;  4O5V A;  5F0C A;  5HLI A;  3CC4 I;  1MMG A;  3T5X A;  3I4N J;  3DTI A;  2CU7 A;  3TW7 A;  1JT6 A;  1KU7 A;  2XUB A;  2GXG A;  3D1N I;  2HZT A;  5LGT A;  3KX2 A;  2A5W A;  2IAI A;  4ESJ A;  2JA7 J;  2JN6 A;  4IPA A;  5J6X A;  5H2F C;  5DCF A;  3M1C A;  2X6O A;  1KA8 A;  4AID A;  1UHS A;  2HKX A;  2XKO A;  2WA0 A;  4OU0 A;  5GAG J;  5BQT A;  3LAJ A;  4B8X A;  2V7F A;  2Z99 A;  2IA2 A;  4EVI A;  2JUC A;  2FOK A;  5HDG A;  1AKH A;  2XGD A;  4YG2 F;  4P9U A;  5HDK A;  3QPH A;  3ZN0 A;  1V54 H;  2OZU A;  2TDX A;  4LMY A;  3BR1 A;  3CCJ I;  5JR3 A;  1DU0 A;  4D5F A;  1ZN2 A;  3MCZ A;  5GTH C;  4HA8 A;  2WY8 Q;  1PUF A;  2VKH A;  4XLH A;  4Y33 A;  5GAD J;  2L01 A;  4A93 J;  3TP3 A;  3QRF F;  5BPD A;  1ZRE A;  4BYY A;  4M72 A;  1J59 A;  2OF7 A;  1I1G A;  2EFQ A;  2F4I A;  2CGP A;  1MD0 A;  3B6A A;  4M3G A;  4P55 A;  1XSV A;  1GVJ A;  2M0M A;  4HBL A;  2L9V A;  4BQA A;  1V4R A;  4MQ9 F;  1OYI A;  3BP8 A;  5ED4 A;  1MH3 A;  1XD7 A;  3HOS A;  2VI6 A;  4XRS A;  3E97 A;  1X2M A;  1Z7U A;  2DOA A;  1J2X A;  3HTU A;  2OAZ A;  5F08 A;  1GHC A;  3E6D A;  3OYB A;  3KCC A;  1JKQ C;  3MKW B;  3P9C A;  3S15 J;  3S1N J;  2XHK A;  3TMO A;  1SD6 A;  3H9G A;  1JTY A;  4CCJ A;  1NHA A;  5E3M A;  2V6C A;  3K1N A;  4JX5 A;  2HOS A;  1A5J A;  4AUX A;  2L02 A;  5BOX A;  1TW2 A;  2XF7 A;  1FIP A;  1X1C A;  4BEH A;  2QSF X;  5EGO B;  1BI2 A;  3L00 A;  3GF2 A;  4D7N A;  3GTQ J;  2KP6 A;  5IPA A;  2RNJ A;  1HF0 A;  5KCM A;  1XMX A;  2COB A;  1BR1 A;  2XC7 A;  3B73 A;  1UJ8 A;  1A35 A;  3LSG A;  1QPM A;  2MGQ A;  2HOT A;  4CSW A;  1FOW A;  1U5T A;  2YX7 A;  1TWF J;  3PO3 J;  1K61 A;  3GTP J;  3T8R A;  2W48 A;  1Y1W J;  2VXD A;  2KIU A;  1KYZ A;  4M9X A;  1R71 A;  2DU9 A;  3DWL E;  2LH9 A;  4P1W A;  2XGE A;  2NS7 A;  3ERE D;  1ZGJ A;  2BW3 B;  2RDP A;  1WKM A;  1XB4 A;  4MEY F;  4Q47 A;  2KJC A;  1D5Y A;  3KZY A;  1G3Y A;  1QVT A;  2RQQ A;  3A0B C;  3LQQ A;  1FTT A;  5F04 A;  3HOW J;  3MZH A;  1BI1 A;  2LFB A;  2VOD A;  1XS9 A;  2MLG A;  2X4H A;  3S17 J;  5FRO A;  2R7O A;  3RKQ A;  1OFC X;  3KEY A;  4LK1 F;  4ESB A;  1Y0U A;  1UG0 A;  3R0A A;  1I39 A;  2Z2S B;  3JTH A;  3OS1 A;  3WTT C;  2ELH A;  2YU3 A;  2OUM A;  3BTL A;  1FYL A;  1ETY A;  2LSO A;  1BW6 A;  1FBS A;  2BVL A;  3F8B A;  3FMR A;  3MWM A;  1SVL A;  3BRO A;  1YW8 A;  5FD6 A;  1RUN A;  2JMW A;  4S04 A;  3V8J A;  2DQR A;  1R6R A;  3BG6 A;  4PUS A;  2XPV A;  1U2W A;  2EZI A;  1K4T A;  3LSR A;  5CVR A;  2E1M B;  3A01 B;  2ZO4 A;  4DW6 A;  3G3Z A;  3HJE A;  4P9F A;  2ZSH B;  1LDD A;  3O8G A;  1S72 I;  1FOK A;  4B44 A;  1YW9 A;  1ZGW A;  4MO7 A;  3OL3 A;  5JHU A;  5ILV A;  1LKX A;  2ZJR F;  1WH5 A;  2A5Y B;  3HM5 A;  2A69 F;  2A6T A;  1X4O A;  2W1O A;  4M74 A;  2IGN A;  4IHW A;  3C2B A;  1FZP B;  1T39 A;  4A3C J;  5FLX K;  1LNW A;  4AC0 A;  1SVM A;  2W82 A;  1MDM A;  4N9H A;  2LY1 A;  4KMF A;  2V79 A;  4AU7 A;  3QQA A;  5FD5 A;  1D3Y A;  3AG1 H;  3U2R A;  1FSH A;  4HOB A;  3CC7 I;  3ASN H;  1U0J A;  1XDS A;  4FE4 A;  5D5X B;  2MD5 A;  4A3B J;  2GZW A;  2XRN A;  1H88 C;  3ZN1 A;  3PNV A;  1K78 B;  2IA0 A;  3KEQ A;  2GWR A;  5CLS A;  2NRA C;  2OCC H;  3I0T A;  1JI8 A;  2ZME B;  4MGR A;  1K79 A;  1YRN A;  3ECH A;  3KYD B;  2JVH A;  5JLW A;  1W7P B;  3JRC A;  3QPS A;  1OCO H;  3UKG A;  2GAU A;  1VQN I;  4JX6 A;  4E70 A;  1T56 A;  4BGD A;  2FF4 A;  5LRR A;  3TBI A;  4EJT A;  5DUI A;  1WI9 A;  2LYC A;  2XAQ A;  5CQE A;  4Q5S F;  1XGO A;  3JW4 A;  3CCL I;  2VJI A;  3G6E I;  2LF7 A;  4CZC A;  4LIV A;  4FQG A;  2UXX A;  3OIP A;  1UST A;  4IO9 F;  3PJR A;  2F48 A;  4XR6 A;  4AYB N;  4FIS A;  2C6Y A;  3CDI A;  1RI7 A;  2NS8 A;  3HRM A;  3HOV J;  3K4K A;  3W2W A;  3FKJ A;  5B1A H;  2QKM B;  3ZQ7 A;  2Q1Z B;  3U1K A;  2X9D A;  2Y31 A;  3OYF A;  2DFH A;  2FBI A;  2DTR A;  2K3P A;  2DA5 A;  4RMN A;  3TED A;  3H92 A;  4LLN A;  3MKL A;  1YTY A;  3SZG A;  2K9S A;  2PX9 A;  3KZZ A;  2CSO A;  4CDG A;  1FMV A;  1V55 H;  2JTV A;  5TRD A;  1TWH J;  4RA2 A;  3E0J B;  2NNN A;  3V4G A;  3HPG A;  4ENN A;  5LBQ A;  4EGY A;  1I1S A;  2VE8 A;  3DPL C;  2OC6 A;  1W5S A;  2JZY A;  2QCO A;  2VC1 A;  1PUE E;  4IRG A;  3M3Y J;  2DFE A;  2W7N A;  1D8J A;  2JSC A;  1A04 A;  3GWZ A;  1ZAR A;  4B3A A;  2LKS A;  1HST A;  1M1E B;  1E3P A;  2R93 J;  2IW5 A;  2GBY A;  3WG9 A;  3FMQ A;  1T0F C;  4B48 A;  2LNB A;  3SDB A;  5IYC J;  4LD5 A;  4HZF A;  2R7U A;  2MD0 A;  1FX7 A;  2XAH A;  1YW7 A;  3BG5 A;  2VQG A;  5E3L A;  1ZTR A;  4IZZ A;  3CUQ B;  1Z6R A;  2YR2 A;  1LDJ A;  5KAF C;  3J80 K;  3D5S C;  1OMI A;  4AYB A;  2XSD C;  2X51 A;  5K5O A;  2EFW A;  2LRD A;  2O03 A;  4Y13 A;  2JA2 A;  3F0C A;  4XON A;  2JQ7 A;  1P2F A;  1BM9 A;  2BYV E;  3P5J A;  1ON1 A;  4C30 A;  5LHG A;  2EFN A;  2W84 A;  2L3D A;  3ZMS A;  1RRJ A;  2CQX A;  4I02 A;  1F5T A;  1LVA A;  2DBB A;  1YIJ I;  4RM2 A;  3QU3 A;  4A0Z A;  1YE9 A;  1FSE A;  2FJ1 A;  1ENH A;  5ICC A;  3QOP A;  2ZXH A;  4G6D A;  1MBE A;  2LR8 A;  5D5U B;  4G8X A;  5CVJ A;  4M3B A;  3FHN A;  4V19 K;  2VKD A;  3HHG A;  2PMU A;  2M0C A;  4UVC A;  3GFL A;  2G9W A;  4C3H J;  2EV0 A;  5EJC A;  4N4O B;  3EQL F;  2QEX I;  2FUG 2;  1X19 A;  3CLQ A;  2H27 A;  1WJE A;  2IBD A;  3QWL A;  3ASO H;  3ZQI A;  1MBJ A;  4YFN F;  2E2J J;  4KT6 A;  3M9A A;  3HL2 A;  2H1K A;  4KFC A;  4HV6 A;  2F5E A;  2AXT C;  5IY5 H;  1H0M A;  1WJC A;  2QF7 A;  3BC8 A;  3DTE A;  3CCQ I;  1QRY A;  2X6X A;  2JA5 J;  3J80 Z;  1JGS A;  1R1U A;  2J5O A;  2R7D A;  5B5E C;  4LOC A;  5IOZ A;  1S8N A;  2W4S A;  4PFP A;  1EH7 A;  1GUU A;  1EH6 A;  2L7F P;  4RAY A;  2IEK A;  4XBF A;  2PLY A;  1MSE C;  4IX7 A;  2Z33 A;  3K4C A;  2VJJ A;  3MN2 A;  1MBG A;  2COM A;  4J01 A;  4BXF A;  2STT A;  3IWZ A;  3F72 A;  5D6F A;  1SC7 A;  4BBR J;  5DM6 F;  2R0Q C;  1HDP A;  1G3T A;  3RZO J;  1JHF A;  1VTN C;  1GDT A;  4OIN F;  5D5W B;  3HZJ A;  4XNF A;  2QWW A;  1PYV A;  2L2O A;  3DU5 A;  1LQ1 A;  4UVA A;  2DJI A;  4G6T B;  3LOC A;  3SJM A;  3HKZ N;  2NYX A;  4A3F J;  4OIQ F;  3BZK A;  1HKT A;  2HYG D;  4RGX A;  2R7F A;  3UR3 C;  4EGZ A;  1FC3 A;  3KP3 A;  3IL2 A;  4DBR A;  1UZC A;  2HTJ A;  3I55 I;  2CRG A;  2RVC A;  1N77 A;  3IH3 A;  4XLA A;  2CH0 A;  4HX7 A;  1SFK A;  4DOZ A;  4EMS A;  3CO7 C;  3S32 A;  4A0Y A;  4AIJ A;  3HTS B;  2DT6 A;  2FML A;  2FE3 A;  1ODD A;  3J81 K;  4XN3 A;  2E71 A;  2PJR A;  2A68 F;  4S05 A;  4CCO A;  2WBM A;  3WTS C;  4CYC B;  1T0F A;  3GCM A;  2CUZ A;  2OBP A;  3ZQF A;  2HTS A;  3DLA A;  3MMY B;  2DDA A;  3I5U A;  2OQR A;  1IN6 A;  3K4N A;  4XKV A;  4M3D A;  3CCM I;  3ZPL A;  1TC3 C;  1T6S A;  1N78 A;  1FNN A;  2EH3 A;  5HVQ C;  4BE1 A;  4L9J A;  2DTZ A;  3L2U A;  1R5I D;  3E5X A;  5GTI C;  1F36 A;  2HWV A;  5TIS C;  3JCU C;  4A3I J;  5C44 J;  5F6F A;  2VE9 A;  3CQZ J;  1Z1D A;  1BN5 A;  2CQ7 A;  4S0H B;  3HKZ A;  4ZTJ A;  3I58 A;  1Z3X A;  1BR4 A;  1RC9 A;  3CCE I;  1H9G A;  4DIQ A;  1MMA A;  4B3X A;  4CA0 A;  2Y0S A;  4WCG A;  4WXD A;  4IHX A;  1SAN A;  1WJA A;  2L5Q A;  3FXJ A;  4KN7 X;  5EGO A;  1S7E A;  2E2H J;  3CF2 A;  4M6X A;  1DP7 P;  2ELJ A;  2VC0 A;  2XAG A;  4Z2Y A;  3FIW A;  1ZAO A;  2QLZ A;  4DNC A;  3J81 Z;  2BXZ A;  2K9Q A;  2JT1 A;  5A2Q Z;  3WG7 H;  4ZTF A;  1U3E M;  4HSR A;  3BR5 A;  2GOX B;  3TW6 A;  4RB0 A;  2DFI A;  3CP8 A;  1QA6 A;  1T38 A;  2M1B A;  2X1C A;  2Z3Y A;  3HB9 A;  4U0V A;  2CS3 A;  2DFF A;  1FLI A;  3KIO A;  1B72 B;  3RPU A;  3QYE A;  1ZG5 A;  1PP8 F;  3CZ6 A;  1FP2 A;  1O7L A;  3BTC A;  2R7X A;  4UVB A;  2Y69 H;  5DUK A;  1SAU A;  3DFG A;  4BQO A;  2NS0 A;  3FXL A;  3FWE A;  4EJU A;  4WXH A;  2QQA A;  3ECO A;  3LQR A;  3OYI A;  4M3E A;  2HFH A;  2HQA A;  2OJE D;  2ZCW A;  2LBF B;  3SXY A;  5D5V B;  2KKO A;  4CCM A;  3FK6 A;  4M71 A;  5ERI A;  4R8H A;  4C3J J;  3QPL A;  3BJ6 A;  3U1D A;  1E17 A;  3GYH X;  3S8P A;  2RAE A;  4BXU A;  5EYR A;  2DT5 A;  2G7U A;  2KIS A;  1B59 A;  1TT5 B;  3WTU C;  2KQR A;  3LSI A;  2W85 A;  4MTD A;  4A3L J;  1ZHF A;  5DS9 A;  2E7W A;  2OZ6 A;  3NWS A;  2VON A;  3F6O A;  1VI0 A;  2A6H F;  1I50 J;  4A5N A;  4AD9 A;  2JUG A;  3Q5F A;  5H20 A;  5J1R A;  4UUV A;  4RDU A;  5K5R A;  2A61 A;  1WI3 A;  1KU2 A;  2DYS H;  1UFM A;  2FU4 A;  4ANJ A;  3BCB A;  2R7T A;  1IO2 A;  1XTA A;  2O61 A;  4J19 A;  3U9G A;  3Q3S A;  4BUP A;  1P7J A;  1R23 A;  2Q8K A;  5L3G A;  4NC7 A;  1FTZ A;  2BEO A;  4IVN A;  1OCZ H;  4XSX F;  1A6Q A;  3WTV C;  1HCR A;  2KDZ A;  1I27 A;  1VQP I;  2KZG A;  3DEU A;  4HX8 A;  3VSL A;  3JRD A;  1TBX A;  2X6W A;  3HRT A;  4PGG A;  1W4M A;  3BR2 A;  1ZH5 A;  4OIO F;  1OLT A;  2F2E A;  3LSJ A;  3TO9 A;  4G94 A;  1GXQ A;  1ZG1 A;  2VKV A;  2AO9 A;  4IF4 A;  3LNQ A;  3H1C A;  2CFX A;  3DV8 A;  2VBW A;  2XKP A;  1ZR2 A;  1GV2 A;  4BE2 A;  4E4H A;  1IJW C;  4XRM A;  3BPV A;  1T95 A;  4XLP F;  4IL6 C;  2ESH A;  2KRC A;  4CH7 A;  1ACI A;  3A03 A;  1MZB A;  4KMU X;  4QPQ A;  3H9J A;  4A0X A;  1I6H J;  1W0U A;  2CV1 A;  1XGN A;  1WFX A;  5ICF A;  3DTK A;  3JTG A;  2HI3 A;  2OTL I;  3UNG C;  1IUY A;  1LFB A;  3CCV I;  4DZJ A;  3FM5 A;  4XRS G;  2W00 A;  2Y2Z A;  4HG2 A;  2UV1 A;  5M5Y J;  3W6J B;  1QHG A;  4JYK A;  4CUG A;  1EKE A;  4OOI A;  1XGM A;  4HEA 2;  5DYM A;  1HQC A;  3DBR B;  1SD7 A;  1SD4 A;  4LG0 B;  1TQP A;  3E5U A;  1D0X A;  5KK1 A;  2OD5 A;  2ZSI B;  3NQO A;  4BHB A;  3IRQ A;  2I5U A;  1GLN A;  5IT3 A;  4NB5 A;  2ZXW H;  4A5M A;  4PSW A;  2VAS A;  5M5X J;  2LF8 A;  5HS9 A;  4IHS A;  1FOY A;  5LEK A;  1UHW A;  1T8I A;  2FNP A;  2RC4 A;  1YX3 A;  1D8K A;  2VT3 A;  2LMD A;  1N25 A;  3P9I A;  2OQG A;  4HRI A;  3FX3 A;  2HU9 A;  2CUJ A;  3OYG A;  1BL0 A;  4L18 B;  1NK2 P;  2DMU A;  3H36 A;  2QSH X;  3BTJ A;  3BZC A;  2V6E A;  3ZQL A;  1X1B A;  1B9N A;  2OU2 A;  4PJ0 C;  3OYN A;  1T2K A;  2DPU A;  1KQ0 A;  5E1W A;  3OY9 A;  3CMM A;  1QU3 A;  1H9T A;  3TDU C;  5E8G A;  5D8K B;  1YFH A;  3R0J A;  4CCK A;  3TOB A;  5FJ8 J;  4EJW A;  1LEA A;  3QU6 A;  2V4J C;  1QBJ A;  4UUS B;  2VBX A;  3IAM 2;  4IHY A;  3MVP A;  3WU0 A;  2IS4 A;  1QGP A;  2GA2 A;  1SD5 A;  2MLK A;  3JR9 A;  3L2V A;  3HPH A;  2L4M A;  2N8G A;  3MQ0 A;  2KLO A;  1ULY A;  2ZNZ A;  3IKT A;  4MEX F;  5B1B H;  1ZLJ A;  4G12 A;  1Y56 A;  4XKC A;  3Q9S A;  1IRX A;  1Y1V J;  2F5F A;  3IUO A;  3IV5 A;  2AQF A;  3GME A;  1GVD A;  4KN4 X;  4PCQ A;  1FYM A;  4KYW A;  1QNT A;  1MBK A;  4EM0 B;  3OR1 C;  5CVV A;  1Z91 A;  3ZCO A;  3JRH A;  3F8N A;  2VIX A;  3OMY A;  4Y4R A;  3JRB A;  1Z67 A;  5FKN A;  1D5V A;  1J09 A;  3BR6 A;  3K0L A;  2D2W A;  5TJJ A;  1LUJ B;  4IHV A;  2LRE A;  4OWR B;  3GUD A;  3ZGK A;  1Z05 A;  2NXN B;  3BG3 A;  4HAM A;  4MLO A;  3RDI A;  3GZN B;  2FOW A;  2CW0 F;  2DOD A;  1RR7 A;  3FXQ A;  4WWC A;  2DN0 A;  3L1P A;  1YYV A;  1FJL A;  1WWX A;  4HLX A;  1P4A A;  3CDL A;  5KHD A;  1FT9 A;  3DPT A;  4HQE A;  2DW4 A;  3MEX A;  1U9O A;  2LY9 A;  3OYC A;  3W2A A;  3HUG B;  3HOZ J;  1JHH A;  2P6T A;  3HSR A;  3BDD A;  3COA C;  4Q48 A;  1RZ4 A;  1N75 A;  4W1U A;  4PFO A;  4G6Q A;  3TDZ C;  4RAZ A;  4XKW A;  3FXU A;  4I09 A;  1B4A A;  3EET A;  3GO5 A;  5D4S A;  3V7R A;  3G1O A;  3EYI A;  1B9M A;  1MMN A;  2HS5 A;  1W36 D;  1O57 A;  5DV5 A;  3VYT B;  4FHT A;  2MH9 A;  1JJ6 C;  1BBY A;  3ABM H;  2QQB A;  1Y6I A;  4V2F A;  2K40 A;  4QLC U;  5HNF A;  2M7A A;  2H09 A;  5AIQ A;  4M3F A;  4N0B A;  1RR8 C;  2HDW A;  2WAQ A;  4BHC A;  3I4P A;  3CLO A;  4HNV A;  3CD6 I;  5HOD A;  1RKW A;  1X2N A;  2EWN A;  3BJA A;  4QSH A;  3B6C A;  5M5W J;  4AIK A;  3IC7 A;  3BZ6 A;  2RRE A;  2HYF A;  3E6M A;  3L09 A;  2V1U A;  2CW8 A;  1WPK A;  2QGU A;  4Q4Z F;  4XOP A;  1F43 A;  3M8J A;  5K7F A;  2ZJ2 A;  2W25 A;  5IOY A;  3M8E A;  3ZQC A;  5K7H A;  1KQ9 A;  3I59 A;  3WGH A;  1F9N A;  1MH4 A;  3EYY A;  1UB9 A;  3P7N A;  2AQE A;  3DCF A;  2R7Z J;  3C1D A;  3I3L A;  3OYE A;  5J4V A;  2AS5 F;  2XDV A;  3G1M A;  2K3F A;  4ZC3 A;  1FBU A;  3DQV C;  1BI0 A;  4XRF A;  1X1D A;  1G3W A;  2LLK A;  1IG7 A;  2R92 J;  1V5F A;  3CC2 I;  3TOA A;  4EM2 A;  1U78 A;  1OCR H;  4CYC A;  4ZDP A;  3L2R A;  5HLH A;  1S7A A;  2CYY A;  5F1J A;  3NAR A;  2HXI A;  3OYA A;  1J75 A;  2ECC A;  1H89 C;  2VBY A;  5EG0 A;  2M45 A;  1NH3 A;  1LB2 A;  3C2G A;  1HW1 A;  4BJT A;  2FA5 A;  4U0W A;  3QAH A;  3JRF A;  3PIP F;  2STW A;  1VF9 A;  1R5G A;  3G4S I;  5FKK A;  2X1E A;  1F4K A;  1FIA A;  4L0Z B;  3C7J A;  1FMW A;  2IT0 A;  2ZJP F;  1CF7 A;  4Z6Y A;  1U9N A;  5DCM B;  4EJV A;  1DDN A;  2IXS A;  1KQ8 A;  1KGS A;  2K5C A;  3CJN A;  4BL0 B;  3WTW C;  2VOO A;  1MW7 A;  2OCE A;  4ITV A;  2RN7 A;  2IP2 A;  1V5E A;  2DA7 A;  1B6A A;  3VPR A;  5DDG A;  1MBH A;  5J47 A;  3EUK L;  2E1C A;  1IRG A;  1BR2 A;  4A6E A;  5FLX Z;  1ETO A;  1O7F A;  4CCL A;  3HGG A;  2BV6 A;  2PEX A;  4XM3 A;  3WHC A;  1VQ5 I;  5JVT A;  2G7H A;  3FDY A;  2MA3 A;  1QZE A;  4CZZ A;  4Y7N J;  3DEE A;  3N4M A;  5M3M J;  2DCE A;  2M4K A;  3QYF A;  1CGP A;  5DEQ A;  3ABL H;  3AAF A;  4MNU A;  3OYJ A;  3BCA A;  1T33 A;  5FRM A;  1DPU A;  2K4B A;  5J3L A;  2BVM A;  1YHQ I;  3KP6 A;  2CUE A;  1U6G A;  3SZT A;  3E1S A;  1MND A;  3H5R A;  2E5Z A;  2VQH A;  3I64 A;  4XIC A;  2JA6 J;  1SMY F;  1R00 A;  1ORK A;  1G3S A;  3AL0 B;  2MW8 A;  3DPU A;  1R5H A;  5IYB J;  4GYG A;  4D5C A;  5HLT A;  2YSR A;  1TWA J;  4BDZ A;  2EV6 A;  2E1N A;  2J5P A;  5HNH A;  1IF1 A;  3CCR I;  4XLF A;  4CCN A;  2JSP A;  3LA3 A;  1Z7L A;  2ID3 A;  4B4C A;  3EUA A;  2FNA A;  3DLL F;  1AKH B;  2KRH A;  1BOA A;  2KPM A;  2EPF A;  3GZ5 A;  1NG7 A;  1YX5 A;  3GX4 X;  2HEO A;  5CKT A;  2NVU B;  3J7Y J;  3HEF A;  4H4K C;  1DGW Y;  3JSP A;  2V1N A;  3JRI A;  4PZJ A;  1Y0N A;  2RQP A;  1FP1 D;  2IVM A;  3H3U A;  3QOE A;  3RJP A;  4AIH A;  2GIZ A;  3T1B A;  4ZDL A;  4ESF A;  3JSO A;  1TT0 A;  4AVZ A;  1JUP A;  1X4P A;  2HQR A;  3I4M J;  5CVI A;  3EUH C;  2KRF A;  2MYS A;  4JOM A;  4NC6 A;  3F3X A;  3WTY C;  5JI6 A;  2WAD A;  4ZYA A;  2O8K A;  5EZG A;  1I5Z A;  3TL4 X;  3H35 A;  2JPC A;  3E7L A;  3HOU J;  1QZZ A;  4BAC A;  1P92 A;  4B43 A;  1YS7 A;  2Q2E A;  3MAJ A;  4KIB A;  3IAS 2;  4GYI A;  4KJZ A;  4MIM A;  5EEA A;  3FXK A;  4E6K G;  3LFK A;  3HSF A;  4JQF A;  4IKF A;  2X0L A;  2LC2 A;  1JT0 A;  5M3F J;  5F27 A;  3V7S A;  4WXC A;  4ZYD A;  3GFJ A;  3S93 A;  5FB2 A;  2EA4 A;  1R36 A;  2ZXI A;  5CJ9 A;  2P4W A;  3V8L A;  1NTC A;  2ECB A;  1X1P A;  2VL8 A;  2ICW G;  5C4X J;  1LE8 A;  4O6J A;  2K86 A;  4M73 A;  3GLL A;  1XGS A;  1VQ6 I;  1IZ1 A;  4BEH B;  1Z0X A;  1DGR M;  1LJ9 A;  2IA1 A;  4Y17 A;  2CQQ A;  1WHU A;  1U5T B;  2BGC A;  3VB2 A;  5CVU A;  2F6C A;  4NQW A;  1E2X A;  4LK0 F;  1S3J A;  1ZRF A;  5IT9 K;  2KL4 A;  4L0Y B;  4KIS A;  5GAH J;  3VYR B;  3K6G A;  3DF8 A;  4E7L A;  2F5C A;  1EV7 A;  4RAF A;  2D5V A;  2K9L A;  5ICE A;  2GQQ A;  1TTY A;  3H9Q A;  2LTP A;  4YFK F;  4WX9 A;  1YQA A;  3BG9 A;  3OS2 A;  4F7Z A;  2BOL A;  3LMM A;  4PSX A;  3VSK A;  1TZL A;  2L4A A;  2E19 A;  2QSG X;  1G59 A;  5FKM A;  2WV1 A;  5ILU A;  3FHZ A;  3EPZ A;  1BA5 A;  1QO0 D;  2E34 A;  2X6Y A;  2UUZ A;  4B09 A;  2E1M C;  2GIV A;  4XLE A;  4XK4 A;  5HOO A;  3RYP A;  2ME0 A;  1H8A C;  3HGY A;  2TRT A;  3VOD A;  2XAJ A;  3R4K A;  4BY7 J;  3K70 D;  2Y0S N;  4ENM A;  2QBY B;  2BXY A;  1LVK A;  2MSY A;  1HA8 A;  4OAZ A;  2PBI A;  4JX4 A;  3OWT A;  3FZV A;  2R7S A;  2HXO A;  4A69 C;  3CCY A;  3L9F A;  3RKW A;  3MZ8 A;  4P5O A;  2VT2 A;  5JHF A;  2EFO A;  1MJ9 A;  2YPR A;  3H0D A;  3QPT A;  2L54 A;  3A0H C;  4C9Y A;  3IP4 B;  3IKV A;  3DP7 A;  3M07 A;  4HYE A;  5E1X A;  4GDF A;  4RB2 C;  3QOD A;  5L3F A;  5C3E J;  2VOP A;  1UEL B;  4YRV A;  4DBQ A;  2QA4 I;  1IC8 A;  1E3O C;  5E20 A;  2ZME C;  1W0T A;  4HF1 A;  2M87 A;  4HV5 A;  1MDM B;  2AXL A;  3W6K B;  4M6Y A;  2OA4 A;  4XKB A;  4DZP A;  2EIK H;  2Y9Z A;  2W57 A;  5E79 C;  4QIW N;  5LD2 C;  1YIT I;  1IXS B;  3EUH A;  5LGU A;  4C2T A;  4L5I A;  1IRZ A;  4LLL A;  4ON0 A;  2KT0 A;  1SMT A;  3K2A A;  4FET A;  5CPR B;  1UHM A;  3S14 J;  3C2H A;  2LDU A;  3LA7 A;  1W5C C;  1YIO A;  4L9N A;  2LKP A;  3PFY A;  3F8C A;  1IXC A;  3I71 A;  3SZP A;  2FD5 A;  4A3M J;  4C2U A;  2FSW A;  4ASN A;  1J5Y A;  2E5N A;  3NEU A;  3RPU D;  3SHF A;  4LGW A;  2V9V A;  2Y9Y A;  3GEZ A;  3M4O J;  5E18 F;  2IGO A;  4XOR A;  2G0E A;  2V1D A;  2IGM A;  1IN7 A;  1VQM I;  1IN8 A;  4BXX J;  2XGC A;  2JWT A;  4M9Z A;  2IRF G;  4IEJ A;  1JUS A;  2A05 A;  5KAI C;  4BE0 A;  4U88 A;  2O7O A;  1YG2 A;  5H6R A;  2BY2 A;  4ENJ A;  1JKP C;  2DXI A;  3I9V 2;  3V8K A;  3ZP5 A;  2H6B A;  3F23 A;  4ZZL A;  1MMS A;  3PSF A;  4U87 A;  3OIQ A;  2BW3 A;  1R7J A;  2K02 A;  4I6Z A;  1VZ0 A;  3T8T A;  1O3T A;  4OIR F;  2Z16 A;  5GPA A;  1R49 A;  3HOY J;  1USS A;  1SFO J;  2EZL A;  2RV8 A;  1EH8 A;  3C18 A;  4R79 A;  4ETS A;  2DA6 A;  2CMP A;  4EQQ A;  2WY7 Q;  3WU2 C;  3DBH B;  1O3Q A;  5DD8 A;  4LB5 A;  1ETK A;  2Z1D A;  2R7W A;  4EJO A;  4BQN A;  2XF6 A;  4PGH A;  4FT8 A;  5HDN A;  2EIM H;  2WTE A;  3RTR A;  4F92 B;  2EFP A;  4E7S A;  2UXN A;  2F5D A;  3F6V A;  4YEJ A;  1DQU A;  2Z5U A;  3K1P A;  3RQ4 A;  4HNT A;  1MGT A;  3WOD F;  2BBY A;  2M2E A;  2B0L A;  2XGX A;  3CES A;  3ZR8 X;  3CUQ C;  2CW7 A;  2R7Q A;  2GM4 A;  5B3S H;  5HS8 A;  3K4M A;  3WGG A;  4XQF A;  2H1L A;  3S1M J;  5J4Y A;  4II3 A;  1D1C A;  1X3Z B;  1ITY A;  3KET A;  4PDK A;  3ROU A;  4G7H F;  1A6I A;  4ZYE A;  4YFX F;  1IDZ A;  3A01 A;  2DT7 B;  4PJJ A;  5E1Z B;  4D1Q A;  4HLY A;  3WGI A;  2P81 A;  4LJZ F;  1FWZ A;  3OL4 A;  1HKQ A;  1DU6 A;  2CV0 A;  1LFP A;  1OJL A;  2M3A A;  3IWF A;  5J8C A;  2KMU A;  3SFI A;  3D0S A;  5IP7 J;  2P0W A;  2K27 A;  1Z77 A;  2A07 F;  2V9P A;  1ZLK A;  3I56 I;  4XLC A;  2XV4 S;  3K69 A;  1SAX A;  5H6Q A;  3D5R C;  2P7V B;  2QVO A;  3KYL A;  1REP C;  5BS6 A;  1KU3 A;  1WCM J;  1LPQ A;  1MMD A;  2EZK A;  2QQ9 A;  3Q9V A;  1XMK A;  3OYM A;  3RKY A;  4DYR A;  2FXA A;  1KZH A;  5DD4 A;  3WTX C;  3CO6 C;  5FLV A;  4AM3 A;  4D7M A;  2L9R A;  3FKI J;  2NNY A;  3JAM K;  1SFX A;  1MNM C;  1GT0 C;  1ETW A;  3F9K A;  3OIO A;  3ZQH A;  1ZG3 A;  5TGT A;  1K83 J;  2DOF A;  2K7L A;  2O6G E;  1TNS A;  2B9S A;  4BS9 A;  2VXZ A;  2LD5 A;  9ANT A;  2NVY J;  2M7B A;  1K78 A;  3KP2 A;  3A4C A;  1XG1 A;  4X0G A;  5EDN A;  4TV7 A;  2ZME A;  3KE2 A;  2HR3 A;  1R4M B;  1W7P A;  2YS9 A;  5GP9 A;  2PI0 A;  4OMZ A;  3PL8 A;  4KT5 C;  2HOE A;  2IS6 A;  3KP7 A;  1G8X A;  1IN5 A;  2H94 A;  5F64 A;  4FCY A;  2XB0 X;  4CXF A;  2DAO A;  2XF5 A;  1WVR A;  3ZMZ A;  3VYS B;  3HG9 A;  1MSF C;  4GFB A;  5J8F A;  2PJP A;  4L5J A;  1JKR C;  2ESN A;  4K2E A;  1K6Y A;  2A6E F;  2DMT A;  3ONQ A;  4KIF A;  3VOE A;  1HBX G;  1KON A;  3M8F A;  3BOQ A;  2BY3 A;  4NHJ A;  1UG2 A;  2WAF A;  3FF5 A;  2BZT A;  2DJN A;  2Z9O A;  1R1T A;  3FXO A;  4I0B A;  5ICG A;  1OYW A;  1MJB A;  3TO7 A;  2IS2 A;  3N97 A;  3BQY A;  3K4B A;  2JVG A;  3JAM Z;  3DEW A;  1DPR A;  2VBZ A;  3H5A A;  2HQ5 A;  3LA2 A;  3VDX A;  1HLV A;  2GXA A;  1FPQ A;  1J7K A;  1ZYR F;  2FMY A;  3OSF A;  4WK8 F;  4A6D A;  1A31 A;  3SEQ A;  3SQN A;  3LSM A;  4XOT A;  2LOO A;  4HF0 A;  2ZBK A;  4MTE A;  1D1B A;  1W1W E;  1QHH D;  4IXA A;  3HOT A;  4CO8 A;  1JGG A;  3GW2 A;  3Q0U A;  1P6R A;  4NC8 A;  3ELK A;  2R4G A;  3CP2 A;  2RGV A;  5LRS A;  2DA2 A;  4LB6 B;  1W36 C;  4KDP A;  2DA3 A;  2HVR A;  4AVP A;  1R58 A;  2WB1 N;  2L7K A;  2CJJ A;  2P6S A;  3BTI A;  3JRG A;  4P96 A;  4XN0 A;  3WE3 A;  2HOA A;  2DO7 A;  4XMY A;  1HOM A;  3FBN B;  3BR0 A;  2K85 A;  3HYI A;  4IRH A;  2DOE A;  1VQ8 I;  2DQL A;  3AFH A;  5FRN A;  3DU6 A;  4B47 A;  1ZRD A;  4H0E A;  4A12 A;  3A2K A;  4BH9 A;  4I01 A;  3H5N A;  1W5T A;  3CME I;  4B1R A;  3G1L A;  3CUQ A;  3M1E A;  2VQC A;  2OPT A;  1E3H A;  3E6B A;  2O5R A;  1TWG J;  3PUB A;  4UXN A;  1OCT C;  3HBL A;  5CQG A;  3OYL A;  3F21 A;  2HPM A;  3C3W A;  5EZH A;  1PDN C;  1G2H A;  2BHZ A;  2PJR B;  1NK3 P;  1IRF A;  2DYR H;  3ZQQ A;  3JRA A;  2DK8 A;  2DPD A;  2FBH A;  1F1Z A;  3BLY A;  3HDD A;  1ZRC A;  1OIS A;  1QVU A;  2ZC2 A;  2WAQ N;  1AHD P;  1UCR A;  3E5Q A;  4L5E A;  2D45 A;  3PNT A;  3IHU A;  3PO2 J;  4PJM A;  3R61 A;  4BKX A;  3K7A J;  4IQJ A;  1S9H A;  2JK3 A;  2WB1 A;  4BY1 J;  2CV2 A;  1MBF A;  3WHB A;  5BNG A;  2D1V A;  2HGC A;  2H8W A;  4GRI A;  3S2D J;  4NDL A;  1FOX A;  5K1Y A;  5E3N A;  4F93 B;  2GA1 A;  2Y30 A;  3QP5 A;  2NVQ J;  2CWE A;  5IP6 A;  2HPI A;  1NG6 A;  1FYK A;  3S16 J;  5D8L B;  1UMQ A;  1IAW A;  3ZXS A;  3DKW A;  4O3M A;  2R5Y B;  2XRL A;  3Q0V A;  4KIC A;  2DA4 A;  4KIT B;  2O9L A;  3PIO F;  1PVE A;  1XSX A;  1IGN A;  4NBQ A;  3A02 A;  5L3B A;  3CF5 F;  2AHQ A;  4GGG A;  3J7A O;  3CTA A;  2VN2 A;  3VFZ A;  1GXP A;  5LEJ A;  3CJT B;  2LKX A;  3OYK A;  4PJN A;  5J1U A;  3ABU A;  4HF2 A;  1T98 A;  2M4G A;  4BJ5 C;  4QTR A;  3S2H J;  1BIA A;  2EJR A;  1T08 B;  3GBG A;  3F8M A;  2EZH A;  2O0Y A;  2X85 A;  2M5W A;  3REO A;  2LVS A;  4A3G J;  4UV8 A;  3S1Q J;  1Y8R B;  3CCU I;  1XCV A;  2IS1 A;  2DK5 A;  3LST A;  1TLH B;  1BJA A;  1Z21 A;  3CMY A;  3DBL B;  3EDP A;  2ELK A;  3BT9 A;  1BI3 A;  1Z3Y A;  1X58 A;  2QQ8 A;  2HDC A;  1LDK B; 
#chains in the Genus database with same CATH homology
 3I4N J;  2B63 J;  2CU7 A;  3TW7 A;  1QPI A;  1JT6 A;  1XC5 A;  3E7L A;  3HOU J;  4IHX A;  1SAN A;  3GTL J;  4UUT A;  3D1N I;  5EGO A;  1GV5 A;  2K9N A;  4MIM A;  1S7E A;  2IAI A;  5EEA A;  2E2H J;  2JA7 J;  2JN6 A;  2X6O A;  1RKT A;  3FIW A;  1UHS A;  1RET A;  1JT0 A;  5M3F J;  2K9Q A;  3Q0W A;  5F27 A;  3BR5 A;  3TW6 A;  1AKH A;  3GTG J;  1NTC A;  2ECB A;  2YUS A;  2XGD A;  3HB9 A;  1FEX A;  4V2G A;  5C4X J;  1LE8 A;  3BR1 A;  1B72 B;  1DU0 A;  4D5F A;  3BTC A;  2ID6 A;  4JP0 A;  1PUF A;  1Z0X A;  3GTK J;  4A93 J;  3TP3 A;  4A3J J;  2R5Z B;  2OF7 A;  4M3E A;  2CQQ A;  1ZKG A;  2VKE A;  1ETX A;  3B6A A;  3FK6 A;  4M3G A;  4X1E A;  1ETV A;  4FE7 A;  4C3J J;  3QPL A;  1HDD C;  1B8I B;  2RAE A;  5EYR A;  1MH3 A;  1R9T J;  2XPU A;  2VI6 A;  4XRS A;  2D5V A;  4EEF G;  4A3E J;  2LTP A;  4A3L J;  5DTD A;  1X2M A;  5DS9 A;  1IUF A;  3BG9 A;  1VI0 A;  1I50 J;  5F08 A;  2E19 A;  5J1R A;  5FKM A;  4RDU A;  1JKQ C;  2FQ4 A;  2WV1 A;  1BA5 A;  3S15 J;  3S1N J;  1WI3 A;  4XK4 A;  1LFU P;  2ME0 A;  1JTY A;  1H8A C;  3HGY A;  2TRT A;  4J19 A;  1ZR4 A;  4A3K J;  3Q3S A;  3LSP A;  5E3M A;  4JX5 A;  4BY7 J;  2HOS A;  1P7J A;  2Y0S N;  3O8H A;  1A5J A;  1B72 A;  4AUX A;  1FTZ A;  2MSY A;  2XPW A;  1FIP A;  1HCR A;  2KDZ A;  4JX4 A;  5EGO B;  4D7N A;  3GTQ J;  4DYC A;  1P7I A;  5IPA A;  2HXO A;  2M8G X;  3CCY A;  4A69 C;  1HF0 A;  3JRD A;  2COB A;  2NOG A;  2VPR A;  3BR2 A;  3LSG A;  2MGQ A;  2HOT A;  3LSJ A;  1TWF J;  3PO3 J;  1AU7 A;  2VKV A;  1K61 A;  1BJZ A;  2AO9 A;  3SDG A;  3GTP J;  3LNQ A;  2W48 A;  1Y1W J;  2E1O A;  1GV2 A;  1ZR2 A;  1IJW C;  4XRM A;  5C3E J;  2L7Z A;  2NVX J;  4M6V A;  1ETQ A;  2LP0 A;  2XGE A;  2NS7 A;  1IC8 A;  1E3O C;  3A03 A;  1PUF B;  1I6H J;  1W0T A;  1W0U A;  1D5Y A;  4DZP A;  2HYJ A;  1QVT A;  2Y9Z A;  2HI3 A;  1FTT A;  2PMZ N;  5F04 A;  3HOW J;  4QIW N;  1LFB A;  2LFB A;  1XS9 A;  4DZJ A;  5FLM J;  3S17 J;  4XRS G;  3RKQ A;  1OFC X;  1IRZ A;  2Y2Z A;  2KT0 A;  3K2A A;  1WH7 A;  5J1Y A;  5M5Y J;  3S14 J;  4JYK A;  2TCT A;  3BR3 A;  2FD5 A;  3BTL A;  1ETY A;  4A3M J;  2VUM J;  1BW6 A;  3M4O J;  2Y9Y A;  2JMW A;  2G0E A;  2HDD A;  5JLX A;  5IP9 J;  5M5X J;  2XPV A;  4I76 A;  1O4X A;  2EZI A;  3LSR A;  4BXX J;  3A01 B;  2XGC A;  2JWT A;  4DW6 A;  4IEJ A;  1JUS A;  1OCP A;  4FTH A;  5GPC A;  3O8G A;  1IV6 A;  4C2M J;  2O7O A;  1BL0 A;  1ZGW A;  1NK2 P;  2DMU A;  4MO7 A;  1JKP C;  1WH5 A;  3HM5 A;  3BTJ A;  3ZQL A;  2DMN A;  5FKO A;  4IHW A;  3C2B A;  4I6Z A;  4A3C J;  4AC0 A;  5GPA A;  3HOY J;  1SFO J;  2EZL A;  3S1R J;  2DA6 A;  3H0G J;  5FJ8 J;  3QQA A;  2M34 A;  1TWC J;  4UUS B;  3ZOB A;  1ETK A;  4IHY A;  3MVP A;  4FE4 A;  4A3B J;  1H88 C;  5EF6 A;  3JR9 A;  2N8G A;  2M2E A;  2DA1 A;  4DYQ A;  1CQT A;  1YRN A;  2GM4 A;  3S1M J;  5JLW A;  4G12 A;  3ZQG A;  3JRC A;  3QPS A;  3UKG A;  1POG A;  1Y1V J;  3TP0 A;  1ITY A;  4JX6 A;  3IV5 A;  3NAU A;  5F0H A;  1T56 A;  2L7M P;  1A6I A;  1GVD A;  3GTM J;  1IDZ A;  3A01 A;  3JRE A;  1MBK A;  1EF4 A;  2P81 A;  1JKO C;  1DU6 A;  1OJL A;  3JRH A;  5IP7 J;  3SFI A;  1Z77 A;  1I3Q J;  3JRB A;  5FKN A;  2DMQ A;  5K7Z A;  3BR6 A;  3W6V A;  4IHV A;  1WCM J;  4AYB N;  4FIS A;  4A3D J;  2EZK A;  4MLO A;  3BG3 A;  4ABZ A;  4DYR A;  2NS8 A;  3HOV J;  1RR7 A;  3GTO J;  5FLV A;  1BW5 A;  2I10 A;  4D7M A;  2XB5 A;  2L9R A;  2FX0 A;  2X9D A;  3FKI J;  2DN0 A;  2Y31 A;  3L1P A;  1FJL A;  4UUS A;  2DA5 A;  3CDL A;  3TED A;  1GT0 C;  1ETW A;  3OIO A;  1MNM C;  5IYD J;  3MKL A;  3ZQH A;  2K9S A;  1K83 J;  1U9O A;  2LY9 A;  2EQR A;  5FKL A;  2LD5 A;  9ANT A;  3GTJ J;  3HOZ J;  2NVY J;  3FK7 A;  1TWH J;  1ZK8 A;  4W1U A;  1JUM A;  1XG1 A;  5EDN A;  1VFC A;  2YS9 A;  2QCO A;  5GP9 A;  1U8B A;  1JTX A;  2X48 A;  3M3Y J;  2L0K A;  3G1O A;  2YU9 J;  4B3A A;  4FCY A;  2XB0 X;  1WGX A;  4GFB A;  2R93 J;  2GBY A;  1MSF C;  1JKR C;  1JJ6 C;  5IYC J;  3PM1 A;  5EG0 B;  2DMT A;  4V2F A;  2K40 A;  3BG5 A;  2JJ7 A;  5E3L A;  1ZTR A;  4M3F A;  2E2I J;  1UG2 A;  4HNV A;  1YRN B;  2DJN A;  5HOD A;  1ZQ3 P;  1RKW A;  1X2N A;  2CUF A;  2XSD C;  4QSH A;  3BQY A;  3B6C A;  5M5W J;  3F0C A;  3DEW A;  2HQ5 A;  1WPK A;  1F43 A;  1HLV A;  2CQX A;  3OSF A;  5K7F A;  3IH2 A;  5IOY A;  3ZQC A;  5K7H A;  1MH4 A;  2FJ1 A;  1ENH A;  3RZD J;  3OSG A;  1MBE A;  2LR8 A;  4MFE A;  3DCF A;  2R7Z J;  1JGG A;  4XID A;  3Q0U A;  4X6A J;  4M3B A;  2R5Y A;  2DA2 A;  3G1M A;  2ZB9 A;  2M0C A;  4C3H J;  2DA3 A;  1Q1V A;  1RES A;  2WB1 N;  2CJJ A;  2R92 J;  2LLK A;  3BTI A;  3JRG A;  1IG7 A;  2HOA A;  2IBD A;  3ZQI A;  1HOM A;  1MBJ A;  3BR0 A;  1U78 A;  4CYC A;  2E2J J;  5F1J A;  4BBS J;  2H1K A;  3NAR A;  2HXI A;  1APL C;  2ECC A;  1H89 C;  5EG0 A;  2ME6 A;  1JJ8 C;  2QF7 A;  3JRF A;  1QRY A;  1VF9 A;  4B1R A;  2JA5 J;  3G1L A;  4Y52 J;  5FKK A;  2OPT A;  1OCT C;  1TWG J;  5IOZ A;  1FIA A;  4LOC A;  4C3I J;  3HBL A;  1U9N A;  2L7F P;  1GUU A;  3FIS A;  2IEK A;  5EZH A;  1G2H A;  1MSE C;  2NVT J;  1NK3 P;  3MN2 A;  1MBG A;  3JRA A;  2DA7 A;  3HDD A;  3VPR A;  2DMP A;  4BBR J;  1MBH A;  2R0Q C;  5E3O A;  1HDP A;  1ETO A;  3RZO J;  1QVU A;  2WAQ N;  1AHD P;  3IH4 A;  4L5E A;  4RBO A;  1GDT A;  3HGG A;  2MG4 A;  3PO2 J;  3WHC A;  4BKX A;  2LK2 A;  3K7A J;  3BQZ A;  4Y7N J;  2JK3 A;  3LOC A;  5M3M J;  3SJM A;  3HKZ N;  4BY1 J;  1MBF A;  3WHB A;  4A3F J;  5BNG A;  1T33 A;  3S2D J;  4NDL A;  5J3L A;  5E3N A;  5F0F A;  2CUE A;  2Y30 A;  2NVQ J;  5IP6 A;  3S16 J;  3H3V K;  1VND A;  2CRG A;  4XIC A;  2JA6 J;  1RPW A;  1UMQ A;  3IH3 A;  1ORK A;  5C4J J;  2MW8 A;  2R5Z A;  2R5Y B;  5IYB J;  2XRL A;  4D5C A;  3Q0V A;  1TWA J;  2DA4 A;  4MFD A;  2O9L A;  1IGN A;  3A02 A;  2AHQ A;  1B8I A;  2ID3 A;  2LKX A;  3OOU A;  4B4C A;  1AKH B;  5J1U A;  4W97 A;  4CYC B;  2H8R A;  4QTR A;  2EBI A;  3S2H J;  3ZQF A;  1LE8 B;  3HEF A;  3JRI A;  2GLO A;  2JA8 J;  3GBG A;  4M3D A;  2EZH A;  1TC3 C;  2LVS A;  4A3G J;  3S1Q J;  2EH3 A;  2DTZ A;  1F36 A;  1JUP A;  3CMY A;  3I4M J;  2M9H A;  4A3I J;  5C44 J;  1IDY A;  2ELK A;  3BT9 A;  3CQZ J;  1X58 A;  4S0H B;  2O8K A;  3RQI A;  5EZG A;  3HOX J;  5F0C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...