2X48A

Orf 55 from sulfolobus islandicus rudivirus 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
54
structure length
54
Chain Sequence
MKKEIQVQGVRYYVESEDDLVSVAHELAKMGYTVQQIANALGVSERKVRRYLES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords CAG38821
publication title The Scottish Structural Proteomics Facility: Targets, Methods and Outputs.
pubmed doi rcsb
source organism Sulfolobus islandicus rod-shaped virus 1
total genus 18
structure length 54
sequence length 54
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13384 HTH_23 Homeodomain-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2x48A00
1Z0XA 3OIOA 4NDLA 2X6OA 4A3MJ 2CUFA 2WB1N 3H0GJ 2ZB9A 3BR5A 3TW7A 1ZR4A 2R7ZJ 2CJJA 5M5WJ 4IEJA 3GTOJ 5DTDA 2R5YB 5EGOB 3HOZJ 3MKLA 1HF0A 4ABZA 1AKHA 1IDZA 1RESA 2KDZA 1R9TJ 1S7EA 1MH4A 4IHXA 5EZGA 1RPWA 5K7FA 3JRIA 4X6AJ 3HBLA 2M2EA 3K7AJ 1GV2A 5IP9J 3S14J 4QIWN 2E2HJ 2LTPA 5FKKA 1APLC 1PUFA 1ETOA 3BQYA 1JKPC 1JKRC 1RR7A 3BR2A 2G0EA 1DU0A 1JUMA 2LP0A 3LSRA 2QF7A 3PO2J 1ETWA 2HXOA 4DZJA 1ETQA 4A3KJ 3FK6A 3BG3A 1JUSA 1HCRA 3JR9A 2HDDA 1MBJA 2DA7A 5GP9A 2NVYJ 3VPRA 5J1YA 2EZKA 5J1UA 3M3YJ 2K9QA 1MBEA 1MH3A 3S1RJ 1IV6A 2VUMJ 1GDTA 2COBA 1ZKGA 1H8AC 1LE8B 5FLMJ 4LOCA 4B3AA 3K2AA 4G12A 4GFBA 1QVUA 2H1KA 4MLOA 3BTIA 2MG4A 3QPLA 5IOZA 2RAEA 5M3MJ 4XIDA 2LKXA 4XRSG 1SANA 5C4JJ 2XPWA 5IYCJ 2R5ZB 5F0HA 4Y7NJ 1MSFC 5JLXA 3FK7A 3W6VA 4A3EJ 1WPKA 5E3LA 2JMWA 2JA7J 3A01B 5EDNA 3BR0A 2MSYA 4DW6A 4XRSA 1NK3P 3ZQGA 5HODA 5IYBJ 4BBRJ 4A3IJ 1IDYA 5FKMA 1Y1WJ 1FIPA 1WGXA 1WH7A 2GBYA 4FCYA 4CYCA 1DU6A 5EZHA 9ANTA 2XPVA 1ZK8A 1B72A 1W0TA 2XB0X 3JRFA 4JX5A 4I76A 1RKWA 1AU7A 3S1NJ 1P7IA 1GT0C 2HOTA 3Q0UA 1ZTRA 4V2GA 4XRMA 2Y31A 1X2MA 4UUSA 4FE4A 3UKGA 3GTGJ 2YUSA 3Q0WA 1JKOC 3A03A 4J19A 5E3NA 1RKTA 2X9DA 3GTLJ 3ZQHA 1MBFA 2DA1A 2LK2A 1K83J 1RETA 1ETXA 1QVTA 3LSJA 2JA6J 3JRHA 3JREA 3S17J 4QSHA 4DYCA 1BW6A 2OPTA 5J3LA 1XC5A 3TW6A 2LVSA 1IUFA 1JJ8C 5IOYA 2ME0A 1UMQA 2NOGA 2MW8A 1FIAA 4X1EA 4HNVA 1WCMJ 1G2HA 4C3JJ 1JJ6C 2IEKA 2K40A 2MGQA 4JX4A 2KT0A 5F08A 1ETKA 4JYKA 2DTZA 1JTXA 1MSEC 2DN0A 3O8HA 2HQ5A 4M3FA 2YS9A 4M3BA 1IG7A 2Y9ZA 3TP3A 2ID3A 2WAQN 3TP0A 3JRBA 1D5YA 4IHVA 4IHYA 5FKOA 4B1RA 2LFBA 1FEXA 4XK4A 1QPIA 2DJNA 3HGYA 5FKLA 2JN6A 3S1QJ 2VKEA 1NTCA 3FISA 2FD5A 2ECBA 2FX0A 4W97A 2B63J 2DMUA 2ELKA 3C2BA 5BNGA 2CQXA 3ZOBA 3G1OA 3A02A 2N8GA 2DMPA 2DA5A 2R5YA 2WV1A 5EGOA 3I4MJ 1UHSA 3LNQA 1JT6A 2TCTA 1F36A 1OFCX 3RKQA 3GTPJ 3HOUJ 5K7HA 3B6CA 1ETVA 2ECCA 5EG0B 2FQ4A 5F04A 3OOUA 3GTJJ 2LD5A 1CQTA 2JJ7A 2K9SA 5F27A 4BKXA 2CQQA 2LY9A 4FISA 1IRZA 3HOVJ 4RDUA 2JA5J 1EF4A 2VKVA 4MFEA 1LFUP 5F0CA 1OCTC 2L7MP 2LLKA 3NARA 3BR6A 5IPAA 1LFBA 5M5XJ 3BR3A 4UUTA 4JX6A 1K61A 1TC3C 4A93J 3RZOJ 3GTQJ 3ZQLA 2TRTA 3SJMA 1TWAJ 3MN2A 1W0UA 5FKNA 4A3JJ 2AO9A 1JUPA 4MFDA 1ZR2A 3GBGA 3ZQIA 3OSFA 1FTZA 4D7MA 2IAIA 1OJLA 2JK3A 1H88C 2M9HA 3S16J 2R92J 3S2DJ 1OCPA 5K7ZA 2DMTA 1LE8A 2O7OA 1X58A 5EYRA 4CYCB 3S15J 1O4XA 1HDDC 1QRYA 2IBDA 4BXXJ 5DS9A 5F0FA 3LOCA 2R5ZA 3H3VK 4A3GJ 3BTCA 1MBHA 4D5FA 5EEAA 1T56A 2EZLA 1Q1VA 4DYRA 5J1RA 1BL0A 1MNMC 5F1JA 1P7JA 3A01A 2VPRA 1H89C 3BG5A 3BG9A 3CMYA 2W48A 5IYDJ 4RBOA 1B8IB 4DYQA 1IJWC 1GV5A 3B6AA 2E1OA 2E19A 1A5JA 3HKZN 4C3IJ 2FJ1A 4D7NA 3IH3A 3WHBA 2CU7A 3BT9A 3JRDA 5M5YJ 1YRNB 2NVXJ 1HDPA 2DA6A 2HOSA 2EZIA 4A69C 2XGCA 1X2NA 4W1UA 4AC0A 5E3MA 1VI0A 2E2IJ 3F0CA 1POGA 1IGNA 1FTTA 2O8KA 3Q0VA 2Y0SN 4M3DA 3JRCA 2L9RA 2XPUA 2XB5A 2HOAA 1JGGA 3M4OJ 1AKHB 3HOYJ 2JA8J 2L7ZA 2R0QC 1XS9A 1F43A 1WI3A 2DMNA 2DA4A 3QPSA 4A3DJ 2E2JJ 3OSGA 1JKQC 2R93J 4JP0A 1TWGJ 3DEWA 4A3CJ 4L5EA 3CQZJ 3BTLA 1FJLA 4BY1J 2YU9J 4B4CA 3HEFA 1ITYA 1PUFB 2HXIA 3BR1A 2JWTA 2P81A 3I4NJ 3CCYA 3BQZA 2PMZN 3IV5A 2LR8A 3G1LA 3RZDJ 1GVDA 5JLWA 2QCOA 2DA2A 2ID6A 3ZQCA 1MBGA 1U9NA 3GTMJ 2L7FP 1ENHA 1ORKA 2XGEA 3JRGA 4M3EA 3S2HJ 1MBKA 1TWHJ 2NS8A 4XICA 1VNDA 2O9LA 1I6HJ 2M0CA 4DZPA 1VF9A 2H8RA 4IHWA 3TEDA 1U78A 3LSGA 1SFOJ 3E7LA 2HYJA 1HLVA 2GM4A 5C44J 2OF7A 1U8BA 2L0KA 4MIMA 1AHDP 1Y1VJ 3IH4A 5C3EJ 5EG0A 2AHQA 3PM1A 3HDDA 2Y2ZA 1Z77A 2VI6A 4EEFG 2D5VA 3HOWJ 5GPAA 4MO7A 2Y30A 3SFIA 3PO3J 1E3OC 3DCFA 4QTRA 1HOMA 1NK2P 3CDLA 2NS7A 1T33A 4M3GA 4FE7A 4M6VA 3D1NI 5M3FJ 3GTKJ 4V2FA 4A3FJ 2EBIA 1BJZA 3O8GA 3JRAA 2DA3A 1B72B 2EZHA 2M34A 1I50J 3SDGA 1UG2A 5FJ8J 1JT0A 4FTHA 4C2MJ 4UUSB 1U9OA 3BTJA 3G1MA 2DMQA 4Y52J 1TWCJ 4AUXA 3ZQFA 2X48A 2EH3A 3S1MJ 2CRGA 3IH2A 3QQAA 1TWFJ 2Y9YA 3HGGA 3L1PA 2I10A 5EF6A 2HI3A 5E3OA 4D5CA 1WH5A 3WHCA 5IP7J 4I6ZA 4A3BJ 2GLOA 4A3LJ 3HM5A 2ME6A 1A6IA 5FLVA 1ZQ3P 1ZGWA 3HB9A 1JTYA 1XG1A 1ETYA 2K9NA 2XSDC 2NVQJ 4AYBN 4C3HJ 2M8GX 3HOXJ 1B8IA 2XGDA 5C4XJ 2CUEA 1VFCA 4S0HB 4BY7J 1BA5A 3LSPA 2EQRA 2NVTJ 1I3QJ 3MVPA 1BW5A 1YRNA 2XRLA 1GUUA 3RQIA 5IP6A 3FKIJ 3NAUA 3FIWA 3Q3SA 5GPCA 4BBSJ 1IC8A
chains in the Genus database with same CATH superfamily
4A3MJ 2DFHA 1LNWA 3LSMA 3H0GJ 1LFPA 2HQAA 3RQ4A 4F93B 3M1EA 4RGSA 2Z3YA 3LSIA 2RREA 2X6XA 5M5WJ 2R5YB 2VJ5A 3HOZJ 4IF4A 1HF0A 5BOXA 4XR6A 5EEGA 3PSIA 2KIQA 1S7EA 2FNPA 1XSVA 4IHXA 5EZGA 3ULQB 4MEYF 3KETA 1FX7A 4OAYA 5J40A 3J7YJ 1YIJI 1S9HA 2JRTA 2M2EA 1BR2A 2FBIA 3HXLA 3GF2A 3OWTA 1UFMA 1PUFA 1ZRDA 5DD4A 2JRMA 1JKPC 2HTSA 3RPUA 3BR2A 3S32A 1JUMA 2LP0A 3LSRA 2QF7A 3Q5FA 2XUBA 4DZJA 3J80K 3K1PA 4IX7A 1JUSA 1SC7A 1O3SA 1I6XA 3WGGA 1MDMA 5D8LB 4KT6A 2F4MB 2EZKA 4L9VA 2VT2A 4EM0B 2DXIA 2Y75A 3HG9A 3BZKA 2COBA 2HU9A 3CP8A 3K4KA 4IOCF 4XSXF 2CV1A 4PJJA 1HSTA 2CQKA 1R5HA 4CSWA 4FASD 3COAC 4FHTA 5IYCJ 3D5SC 1ZELA 2X6YA 3IP4B 4OINF 5HLHA 4Y7NJ 3OYCA 1SD4A 3B73A 5JLXA 2A69F 2ACJA 2PEXA 4A3EJ 1WJ5A 1LKXA 3GEZA 3HKZA 2QSHX 2M87A 2IW5A 2JA7J 4IL6C 5EDNA 3O2PE 2K4JA 3PSFA 4DW6A 4XRSA 3LAJA 4PJLA 1XDUA 3WU0A 2I8DA 4MQ9F 4BBRJ 3NWTA 2CYYA 5LGUA 1FBSA 3EETA 4OAZA 4XLFA 4L18B 1WGXA 1WH7A 1Z6RA 2GBYA 4XLEA 3TO9A 3CESA 4IQ4A 2DW4A 2JTVA 4CYCA 3HUGB 2DU9A 2BY1A 3HSFA 4A2UA 1YIOA 1ZK8A 2F48A 3ABKH 4R8HA 3CCEI 3JRFA 3F8BA 2X51A 1XGNA 1GT0C 2GA2A 2OZ6A 1F4KA 3RPQA 3GO5A 4ZJZA 4UUSA 4FE4A 1X4PA 5CKTA 2K02A 3UKGA 4V19K 2YUSA 3Q0WA 2JVHA 3UNGC 4KITB 1VQ4I 1WJCA 3GVAA 2JA2A 2WY7Q 5D8KB 2XVCA 2DA1A 1QNTA 1ULYA 3BJAA 3TO7A 5BMZA 2A61A 1K83J 1SFKA 2ZXJA 5BPDA 4YFKF 2QQ9A 3K4JA 3OYKA 3RIRA 3WTVC 4PZJA 4B44A 1VQ6I 4I0AA 3MKYB 4FX0A 4KYWA 3W3CA 4OMZA 3ML6A 2DT6A 5J3LA 2LVSA 5IOYA 4GDFA 3P9KA 5HS9A 1FIAA 2XIGA 4BJ6C 4C3JJ 1WJBA 2MLGA 2M1BA 5F08A 1WI9A 4Q47A 3HRMA 4JYKA 1MNDA 1BBYA 1B9NA 3O8HA 4OIOF 4PSWA 3FKJA 5E20A 1RI7A 3FXUA 3I3LA 3JAMZ 3LAPA 2XF5A 1IG7A 1DDNA 4IHYA 4HX4A 1EV7A 1A36A 1QPIA 1Z7LA 2JN6A 2AXTC 3K2ZA 2VKEA 4KT5C 3DBRB 3EPZA 4RAZA 1MMNA 3TO6A 2B63J 1R36A 3GUDA 4BDYA 5DCMA 2Y48A 3WTXC 1TNTA 3I4MJ 1BI0A 3ABUA 4Y13A 1VQ7I 1WJAA 2BHYA 4BU2A 3K4BA 3PNVA 1BR4A 1JT6A 1F36A 2ETHA 1Y0NA 4NQWA 3MFKA 3GFJA 2LSOA 2AXLA 1E2XA 2R4GA 3ZXSA 2JVGA 3LMMA 2P5KA 2YX4A 1SEUA 3BZ6A 5E79C 5F04A 3GTJJ 2DLLA 1T98A 3ZCOA 4FISA 2LBFB 4HBLA 4A0XA 1IRGA 3K10A 1VQMI 2R7UA 4CO8A 1J0RA 2VKVA 3V4GA 1LFUP 4ZTFA 4A6DA 5IPAA 2LLKA 1FOXA 3BR6A 4XKVA 5FLXK 2DPUA 1GLNA 3TL4X 4XBFA 1QHGA 2VB6A 4OIPF 2E7XA 3KEQA 1K61A 4MTEA 3RZOJ 4A93J 1FBQA 3DQVC 1J59A 4PSXA 3GTQJ 3ZQLA 2W84A 3MN2A 2JSPA 3T8RA 3P9IA 5FKNA 1W5CC 1LJ9A 2DYSH 3F23A 5D6FA 3F72A 3GMEA 1HBXG 2JK3A 1H88C 2M9HA 2R92J 5JHFA 4L9NA 4CZCA 4H4KC 3HRUA 2IGOA 3V8KA 4BEHB 2X1DA 3R4KA 2ZJRF 1D5VA 3CCUI 2QM3A 5ICGA 2LDUA 1O4XA 2CFOA 1BIBA 4ZTJA 3HSEA 2R5ZA 4AIDA 4A3GJ 4AVZA 1E3PA 3BTCA 4KIGA 1T56A 2EZLA 2QEXI 5HLGA 4P55A 1BL0A 1P92A 2DCEA 2ZKZA 5B3SH 4XLHA 4A5NA 1QHHD 1ON1A 1H89C 2L4MA 2W48A 2GAUA 4I0BA 1IJWC 3HTSB 3B6AA 2E1OA 3DBLB 2NNYA 1N78A 2L4AA 2FJ1A 3RKWA 4MNUA 1K6OA 5M5YJ 2NVXJ 2VN2A 2ZBKA 2ELJA 1HDPA 3DKWA 2DA6A 4LB5A 1WWXA 2STWA 2ESHA 1F9NA 2EZIA 4A69C 2FQ3A 4HQMA 4B47A 2XGCA 1FWZA 4W1UA 2EK5A 5ED4A 1U5TA 1F1ZA 1QZYA 1LB2A 3WG7H 4EM1A 4BGDA 3GZ5A 4ZH4F 1BC7C 3PJRA 2OV7A 3ZMZA 3F0CA 3K4MA 2FE3A 2P7VB 2K3PA 5ERIA 5D5WB 4C30A 2XAHA 3LSTA 2JUCA 2OU2A 2Y0SN 4DOZA 3CCRI 2PN6A 2L9RA 2XPUA 3C3WA 3PQKA 2HOAA 1TQIA 4WF2A 3WU2C 1JGGA 3M4OJ 1AKHB 3HOYJ 4BE2A 2MC3A 1T39A 1XS9A 1WI3A 2DA4A 4FX4A 2FSWA 4GYGA 2UXNA 5LLQA 2DFEA 4L5EA 3NRVA 1FJLA 1VTNC 4IRIA 3C18A 2YU9J 3CJQB 3F8NA 2QZ8A 2GIZA 4CCOA 4IQJA 1K78A 1N77A 3M07A 4UVCA 3ZQQA 1A31A 4I98B 2OA4A 1LPQA 2JWTA 1MIJA 2XAGA 3CCYA 3BQZA 5HDKA 2FBHA 3HPGA 2GXGA 1R1VA 2NS0A 2CV0A 5DDGA 2BV6A 2DA2A 2D2WA 4XLNF 5HNHA 2IVMA 3KP5A 3GTMJ 2UWMA 1KZHA 1S7OA 3JRGA 2RC4A 4KFCA 4M3EA 3GLXA 3ZP5A 2XSJC 2NS8A 4XLCA 4XICA 1PDNC 3EYIA 4HRIA 2L01A 1SVOA 3L2RA 2Q0OA 4C2UA 1I6HJ 2M0CA 1R6RA 1YQAA 4KNYA 2H8RA 4CYDA 3J80Z 1VQ9I 3LSGA 1A04A 1FNNA 4FETA 2GM4A 3SYTA 1U8BA 1SAXA 1ZH5A 2L0KA 5DUIA 4ZYDA 1Y1VJ 5E1WA 2D1VA 3S3OA 2HYFA 2O61A 2R7QA 5AIPA 3DKXA 1S3JA 2JQ7A 3PO3J 3ECOA 4MO7A 3SFIA 4BJ5C 4EGYA 4XQFA 3AKZA 3DCFA 5J6XA 2HS5A 3D5LA 1TT0A 2W57A 1FP2A 2OTJI 2XASA 2EFWA 4O3MA 2DT5A 3HOSA 1X3UA 1K6YA 2H09A 3LWFA 5D5XB 4KMFA 3WGHA 1BJZA 4M74A 4AD9A 2DA3A 3OS1A 3CDIA 1KU3A 5BS6A 1W7PA 1ZAOA 2EIJH 4PFOA 3AG4H 1JT0A 1D0XA 2BVLA 2LREA 4P96A 2HGCA 1SD6A 4FTHA 1SMTA 1U9OA 2CQNA 1Y6IA 3ZQFA 2EH3A 2H6CA 5L3GA 1U6GA 1OISA 2LNBA 5DM6F 2VKHA 4HX8A 4YFNF 5EF6A 1SD5A 2HI3A 5E3OA 3WHCA 3OR2C 3BWGA 1GXQA 3VYSB 3F6OA 3FMRA 4XMYA 2OC6A 4ZYEA 3L00A 1AWCA 1H9TA 2V9KA 1FZPB 3IWZA 1A6IA 2CH0A 4RLQA 1XPXA 1QBJA 2WB1A 1TW2A 3DU5A 5FD6A 3IAS2 3R60A 4LG0A 1TZLA 3FXLA 2JT1A 2BY2A 4R79A 3OL3A 4C3HJ 3HOXJ 3KEOA 1B8IA 3FXRA 3E6CC 1VFCA 2QSGX 3MZYA 4C9YA 4CH7A 1X3WB 3CUQC 3U1KA 1GHCA 4OOIA 1EA3A 2VBZA 2FBKA 1BW5A 1FSEA 1FT9A 3REOA 2HPIA 3PNTA 2JSCA 4PDKA 3E0JB 1XMKA 2FNAA 5GPCA 3TKYA 2RKHA 1IC8A 2HZDA 2M4KA 3CJTB 1Z0XA 4ESFA 4XOTA 3S93A 3OIOA 4NDLA 2M45A 4OMYA 3VYTB 3TW7A 3BR5A 2QKMB 5ICEA 3CCQI 1Z9CA 1IRXA 3VSKA 1W5SA 2BGCA 4ZYHA 2P6TA 2CJJA 3HPHA 3I54A 4PGHA 1XSDA 4F55A 1PP8F 5DTDA 2XKOA 1R4MB 3ONQA 5EGOB 5CVRA 2CGPA 5CJ9A 4AM3A 3RKYA 4ZZDA 3BPVA 3ZR8X 4R1HA 5BQTA 1E0EA 1UG0A 2F5CA 5GTIC 5HS7A 1FMWA 1ZGJA 1MH4A 5HLIA 1SMYF 1Z7UA 2XV4S 5K7FA 2FMYA 1B4AA 1XMXA 4X6AJ 4G9YA 4NHJA 3K7AJ 5IP9J 3WE2A 4CUGA 4QIWN 5L3EA 4UV8A 3J7ZI 3ZMDA 2E2HJ 2V9VA 1BN5A 2IA1A 1W36D 3BQYA 1OYIA 2BXYA 3QAHA 2L9SA 2KJBA 3IC7A 1LQ1A 3OYDA 4E7IA 5JR3A 3Q9SA 4YIIA 4E7HA 1CF7A 1NG6A 1MJAA 2DK8A 1XCBA 4HOBA 1OYWA 1HCRA 1EH8A 3N05A 4G8XA 5CYVA 2NVYJ 3VPRA 5K5OA 3G6EI 2RNJA 2TDXA 4OWRB 2K9QA 3M8FA 3BJOA 4RB2C 2FOKA 4QPOA 3A4CA 1MMGA 5JVGF 1ZKGA 4Y15A 1VQLI 1LE8B 1VZ0A 2A05A 4LOCA 2H1KA 4MLOA 3E5QA 3LA3A 2GQQA 2MG4A 3LL7A 1G3SA 5IOZA 2LOOA 2KKOA 3I55I 1X4OA 3V7CA 2LKXA 1WQ2A 2EFNA 4XRSG 4U0WA 2BW3B 1FYKA 5C4JJ 2CG4A 2XPWA 2VPLA 3BPXA 5F0HA 3WTWC 3ZGKA 1MSFC 1OPCA 3W6VA 5E3LA 1X19A 1IN6A 2B7EA 4U7DA 4EVIA 3C1DA 2JMWA 3A01B 3DXJF 1X1CA 5D6EA 1KA8A 1UZCA 5L3FA 3O6BB 2W25A 5LRSA 4A3IJ 1FSHA 3K4LA 1FIPA 4RAYA 4DJAA 2ESNA 1DU6A 2K3FA 2ZNYA 3MD2A 5IY5H 1BOBA 2R7FA 4D9JA 2UUZA 2AQFA 3KP3A 5FFZA 3CCMI 3UR3C 5KCMA 3JW4A 1DPRA 2MABA 1B1BA 3Q0UA 2WWYA 2DQLA 2VL8A 1DUXC 1RIOH 3L2VA 2NVUB 1X2MA 3GTGJ 5FD5A 4HF0A 1PP7U 4GXOA 2Y0SA 4NUBA 2DFFA 2R7RA 1JGSA 2XC7A 4L9TA 4Y4RA 3OV8A 4ON0A 5HLTA 2X9DA 3ZQHA 2DPDA 1MD0A 2EFPA 2HVQA 2XRNA 2R7WA 1WVRA 4IHSA 3H0DA 1ETXA 5A2QK 2ZCWA 2JA6J 3H9JA 3K69A 3JREA 1T6SA 2K86A 4KMUX 5J4VA 5J47A 3E1SA 1J9IA 2VBXA 4G7OF 1IUFA 4GO1A 1JJ8C 4M71A 1D3YA 2EFQA 1BC8C 4DQ2A 1J09A 3OS2A 2ZNZA 3OIPA 4I7HA 1ZRCA 2MW8A 2RQQA 4HNVA 1WCMJ 2OTLI 4P9FA 2CW8A 1G2HA 4JX4A 2VOPA 2MD0A 2FA5A 4PGGA 1CGPA 2WTEA 4QWQA 3X2QH 2KZGA 1JTXA 5ILSA 2IT0A 3HOTA 3U1DA 1FBUA 2X1EA 1P4XA 1YW9A 4M3BA 3AAFA 2K7LA 3JRBA 2ID3A 3TP0A 1D5YA 4BHPA 3CUQB 5FKOA 4B1RA 1W1WE 2VJJA 2MA3A 1FEXA 2A68F 2M3AA 5FO5A 2DODA 2OCCH 5CPRB 1NTCA 2FD5A 1DQUA 2EV5A 2DMUA 2ELKA 3C2BA 5BNGA 2YSRA 4E7KA 3U9GA 3BC8A 2ZXWH 1IN4A 4ITVA 3WODF 2R5YA 2WV1A 3BG7A 3FX3A 1TLHB 1UHSA 3F22A 1YI2I 3CCJI 3HIFA 4ZYAA 5L3DA 4IHTA 1J75A 3HOUJ 3J81K 1IZ1A 4F3QA 3ERED 1ETVA 2M30A 1P2FA 2E1MC 4I01A 3I56I 4E7LA 3CCVI 3S8PA 3IKTA 4EM2A 2R7VA 2EV0A 2CQQA 3ABMH 3DF8A 3S3MA 2WAEA 1TTYA 3L2WA 3TOBA 2ZJQF 3HZJA 1SVLA 2VQHA 2DT7B 2L7MP 1IXSB 3QYEA 4BQAA 4F7ZA 2HDWA 1YYVA 3FBNB 3T0YA 1TC3C 3K70C 2BZTA 1G3TA 2ZMEC 4J00A 2HKOA 4EQQA 1TWAJ 2GXBA 3RYPA 4A3JJ 2AO9A 4MFDA 3FMSA 3GBGA 4IVNA 3KZYA 1Z91A 1R22A 2EILH 4U0VA 4KDPA 2L7KA 4Y33A 2PI0A 2IAIA 3PIPF 3HHHA 3LFUA 1OCPA 3S2DJ 2GA1A 3CZ6A 3G2BA 1FC3A 5EEHA 1YJWI 1X58A 5EYRA 3OYEA 2I5UA 4DNCA 4CYCB 2ZFUA 3S15J 1VQPI 2PFBA 1U8RA 1EKEA 1QRYA 1UAAA 2Z2SB 5LEKA 4BXXJ 3CO7C 3H3VK 1R1UA 2RQPA 1IUYA 5FRMA 4DYRA 5J1RA 1MNMC 3IHUA 1MJ9A 1DGWY 5F1JA 2EIMH 2NNNA 1J5YA 2VPRA 3BG5A 2OD5A 1D1CA 4ZDOA 1RNLA 2OZUA 1R58A 3DU6A 1H0MA 1R23A 3QU3A 3TDZC 4C2TA 1IO2A 2J5PA 1P4AA 4XN3A 4ENMA 3HUGA 3WHBA 1B59A 4IRGA 4NB5A 4XN0A 3BT9A 3CF2A 3LFKA 4I99C 3V8JA 1YRNB 3DV8A 3GX4X 5ICCA 6PAXA 2HOSA 3CMEI 3B02A 3QP5A 3I5UA 1X2NA 4HSRA 4YIRX 4PK4A 1X3ZB 2KMUA 3DP7A 1S5LC 4IRHA 3Q0VA 1R71A 3DWLE 3I64A 1R00A 4DBQA 1HKTA 1VQ5I 2KISA 5H6RA 4NC6A 5LEJA 4CCJA 4Z6YA 3LSKA 5HDNA 3JRCA 4RB1A 3ESWB 3K4CA 4I02A 5FB2A 3JSPA 1F43A 2EA2A 4A3DJ 4AIJA 4BQQA 2E2JJ 4A6EA 2CWEA 3DEWA 4I09A 1E17A 3EUKL 4A3CJ 4XL9A 3PL8A 5CQEA 4ZZLA 4BY1J 2YX7A 5KHDA 2ZXHA 3GFIA 5DCFA 1IN5A 1XMAA 3DLAA 2HXIA 2NXNB 3T1BA 3MMYB 4WCGA 1S72I 3V7RA 2Z33A 4PFPA 2Z5UA 2RDPA 2IS2A 5GADJ 2HQNA 3RZDJ 1S8NA 1OCZH 2H8WA 5JLWA 2QCOA 4BHBA 2ID6A 3KFWX 3ZQCA 2HKXA 4G6QA 2KIMA 4FQGA 4UNOA 2HVSA 1ENHA 3W6KB 5DEQA 5AONA 5EJCA 3CC7I 2QENA 4RAFA 2LYCA 1HW1A 1D1BA 3SZPA 3H1CA 1VF9A 3AL0C 4JBAA 4IHWA 2PG4A 3RSNA 2PJRB 4L5IA 1U78A 1SFOJ 4XNFA 1HLVA 3MQ0A 5E17F 1T2KA 1R4NB 2DOAA 3ASNH 1BI3A 4CXFA 5GAEJ 1AHDP 2E34A 4H0EA 1KQ8A 4LJZF 1YE9A 3S3NA 1JI8A 2H1LA 2KPMA 3FXJA 1OMIA 3LSHA 3VFZA 3L9FA 1SVMA 3PM1A 4LFUA 2OQRA 4CCMA 1V55H 2VC1A 5LBQA 2LBFA 1E3OC 3FXOA 1TW3A 4KN4X 2D45A 5D5UB 4QTRA 1HOMA 4HF1A 1FPQA 4O5VA 3CC2I 2R3SA 3DLLF 2Q1ZB 2HFHA 3GTKJ 2EBIA 3ZMUA 4BJTA 3O8GA 2E1CA 1B72B 3FM3A 2EZHA 1OKRA 2M34A 1PUEE 3AG3H 3KZIC 3SDGA 1UG2A 1I3AA 4RAGA 2AS5F 3CJRB 2V6EA 4AU7A 2JPBA 4LIUA 2EIKH 5LHHA 3G1MA 1TWCJ 4TV7A 4M9ZA 4AUXA 3OYJA 2ZMEB 3QQAA 3MZ8A 2L02A 3HGGA 1E3HA 2XAJA 4BEHA 3CO6C 4ZDLA 3R0JA 2W7NA 4L9JA 4E7JA 1Z3YA 2F5DA 2XROA 4D5CA 5IP7J 3EYYA 2B9SA 1IXRC 4IO9F 2QUFA 4DIQA 2KL4A 3BCBA 3M8JA 5TISC 3OIQA 3FF5A 1T0FC 2EINH 2DI3A 3HB9A 1ZLKA 4BACA 3VYRB 4GYIA 2BBYA 4AYBN 5C4XJ 1ZGAA 2XGDA 4YELA 4ZC3A 2CUEA 1HQCA 3KPHA 3SHFA 1BA5A 3LSPA 2NVTJ 1RUNA 2FOWA 4BE1A 1EJ9A 3J7AO 1RUOA 2XRLA 4HLYA 3CF5F 4BXFA 5TRDA 3FWEA 3RQIA 3WU1B 3F9KA 3NWSA 1HSJA 1BJAA 2ISZA 2X6OA 3IRRA 4HDUA 2FEZA 4K2EA 3WTUC 1MJBA 2R7ZJ 5LRRA 4B43A 1YTYA 2DJIA 3W2WA 2HZTA 3MKLA 4U88A 5LHIA 1I1GA 3DTIA 1AKHA 1IDZA 2K5CA 4E6KG 4YIFA 5GAHJ 5CQGA 2QA4I 3OL4A 2CMPA 4U7BA 1YJ9I 1YX3A 4ZYGA 5E8GA 2BXZA 2F5VA 2QSFX 3K0LA 2EV6A 3FHZA 2NRAC 2V1XA 3OY9A 1GV2A 4JOMA 3RJPA 5E18F 3S14J 1HA8A 4YEJA 5KVRA 5CVVA 3TGNA 1APLC 3P7NA 2PMUA 5B5EC 2E7WA 2O3FA 4NNJA 3CMMA 1O7LA 4A5MA 1JKRC 2P5VA 5CVJA 2G0EA 5B1AH 2VASA 1UHWA 2DQRA 1ETWA 2HXOA 1ETQA 3FZVA 4A3KJ 3L2CA 2JPCA 4HA8A 2HDDA 1MBJA 4AWXB 1DP3A 1WJDA 2DA7A 2KFDA 5J1YA 3HYIA 4WWCA 4J01A 4NC7A 3KP6A 4N4NB 1UCRA 1K79A 4F91B 3M3YJ 3SZTA 5F1RA 3K9TA 3HC7A 2DAOA 1H8AC 5FLMJ 4Q4ZF 4B3AA 4G12A 2MD5A 2E35A 3F6VA 1YJNI 2QWWA 4RA2A 4GFBA 1S7AA 3BTIA 5J8FA 2RV8A 4XIDA 4WXCA 3KP7A 4WXDA 2A5WA 4B48A 3FK7A 4CCLA 4DGWB 3FDYA 2P8TA 3VWBA 3I58A 3JTGA 2GZWA 3QP6A 3OYLA 4MQVA 1NK3P 4HDVA 3CDHA 2MBFA 5D4SA 3ZN0A 1RR8C 5IYBJ 2BE5F 3Q9VA 1IDYA 4KIBA 1Y1WJ 5CVUA 1OR7A 3K6GA 3FHNA 3FXKA 2QBYB 2XB0X 3WE3A 3VOEA 2CUJA 2XAUA 4I76A 5K5QA 1RKWA 1D1AA 4CCKA 1P7IA 2KRFA 2MH9A 4PUSA 3I0TA 4FT8A 1B9MA 2CUZA 2RVCA 3KP4A 1GXPA 4XRMA 2VE8A 1X1AA 1OQYA 3OMYA 2IXSA 4J19A 2VODA 1T95A 1RKTA 2MH2A 2YPRA 2QVOA 2CV2A 1RC9A 2CSOA 4JQFA 2O6GE 1RRJA 3V42A 3OOPA 4EJVA 4BYYA 5LGNA 2V6CA 3ELKA 1G59A 2O03A 1MMDA 2ELHA 1RETA 2ZC2A 1YFHA 3BJ6A 5H20A 4HAMA 4BAYA 1QVTA 4D1QA 2CFXA 3C2GA 3KP2A 2BYVE 4UB6C 3S17J 1Z05A 4QSHA 5AIQA 5DD8A 3ABTA 3I59B 3G3ZA 3I71A 3GZ6A 4Q48A 3NQOA 2WA0A 4LITA 1B6AA 2VBWA 2HR3A 3MAJA 4RB0A 3DTEA 2IA2A 1R5ID 3HHGA 3K70D 1UMQA 2NOGA 3M9AA 4BQOA 3F8MA 2IS1A 2K40A 2MGQA 3HTUA 1ETKA 3F8CA 1MSEC 2DN0A 4RMNA 4M6XA 2HNHA 2Y9ZA 3TP3A 2ICWG 2VQCA 4M9XA 1J7KA 1ACIA 3OYHA 4XK4A 2DJNA 2QGUA 3JAMK 5FKLA 3S1QJ 4M72A 1FLIA 3FISA 4S04A 2ECBA 1LUJB 2FX0A 1L3LA 4W97A 1XTAA 2MLKA 1ONVA 2PBIA 3ZOBA 4II3A 1TBXA 3A02A 3M1CA 2GXAA 2N8GA 1IN7A 2DMPA 1D0YA 3OS0A 2DA5A 1D0ZA 1G3YA 3FXMA 5EGOA 2VJ4A 2H94A 1V54H 1KQ0A 5KAFC 2TCTA 4HQEA 1OFCX 1ODDA 5K7HA 2QYOA 3JCUC 3LQQA 2ECCA 4CCNA 4G7HF 5EG0B 4CICA 4EMSA 3U2RA 4EJUA 2KRCA 1YOVB 4UB8C 2JJ7A 2E1NA 2K9SA 5F27A 3HOVJ 2VLAA 3H3UA 4AIHA 1MMAA 3WTTC 5FLXZ 2MC4A 4RDUA 4MFEA 1BM9A 3NARA 2Z9OA 4BHCA 2M8EA 5M5XJ 2A6HF 3AG2H 2X4HA 4UUTA 3BY6A 1HW2A 3AG1H 4UXNA 4KA4A 3TOAA 2O5RA 3GWZA 3ZMTA 2TRTA 3SJMA 2L9VA 4S05A 2P0WA 1WSUA 3OSFA 3ZQIA 4BNCA 1FTZA 2EA4A 1QZZA 2BVMA 2G7UA 3QPHA 5E1ZB 3S16J 1WJEA 3EUHA 5K7ZA 2DMTA 3FXQA 1LE8A 3F3XA 2R7OA 2LKPA 5H6QA 3KE2A 4IOAF 2Y0MA 3LQRA 1W4MA 4P9UA 1X1BA 4HV6A 2Q2EB 5L3CA 2BW3A 4RS8A 2DO7A 5F0FA 3C2HA 4AYBA 4BS9A 2B0LA 1P6RA 2CQ7A 3O3KA 4XKBA 3RTRA 5EEAA 1Q1VA 2HDCA 3L09A 3N97A 2HTJA 3FBIB 1P7JA 3A01A 2UXXA 3WTYC 3BG9A 3CMYA 3A1YA 2E19A 4HNTA 1A5JA 2ZSHB 4M6YA 5K1YA 2ZJPF 1J2XA 4D7NA 3IH3A 1FY7A 3JRDA 3LA2A 5F64A 3VYUB 1KGSA 3EQLF 4ZDPA 5KK1A 3L2UA 2FRHA 3ABLH 5E3MA 1TP4A 2O0YA 3HRSA 3H5AA 4LGWA 4U87A 1FTTA 4BXUA 2VE9A 2O8KA 3ZPLA 1XN7A 4L0ZB 4RM3A 2D1HA 4HV5A 4BH9A 4P5OA 3R61A 1SD7A 2E36A 2XB5A 2VQLA 3F8FA 2JA8J 1AOYA 2VBYA 2L7ZA 2OBPA 2A3SA 1LDDA 2XDVA 3OYNA 2R93J 3PFIA 1TWGJ 2XGXA 5FRNA 4N0BA 4HLXA 3K4NA 4G94A 2Y69H 3BTLA 4NC8A 5FFXA 3HEFA 1JHHA 1BIAA 4G7ZF 3H9QA 3PUFA 1PUFB 3GCMA 3T8TA 2P81A 3CCSI 1G3WA 3K1NA 3I4NJ 2JZYA 4U0YA 2LKSA 2PMZN 4D0PA 3G1LA 3SXYA 3E6MA 1GVDA 2HEOA 3ERMA 1Z67A 2QKLB 3NEUA 4ESJA 3CUQA 1U9NA 1MDMB 2WBMA 2HOEA 1ORKA 2XGEA 1O3QA 3S2HJ 2LH9A 2WC2A 4A0ZA 4WXHA 2CS3A 2NAZA 2DTRA 3IKVA 1KU9A 4DZPA 1KONA 3SEQA 4ETSA 4OU0A 3CMAI 1KU2A 3P9CA 1XGMA 2ZXIA 2KZVA 2W00A 2HYJA 3WGIA 5C44J 2CW7A 5IT9K 5HNFA 3HL2A 3M8EA 3H3ZA 1OCRH 4PCQA 1XGSA 2AHQA 2OJED 2R7TA 3R0AA 3HDDA 1XCVA 2PQ8A 1FOYA 2Y2ZA 1R1TA 4EEFG 2D5VA 4YRVA 2Y30A 1DGRM 5KNLA 1YO5C 1Y56A 3IWFA 4DBRA 3CDLA 2NS7A 4FE7A 2KP6A 4M6VA 1YITI 1U5TC 4EGZA 2XF7A 3JRAA 4KISA 2G9WA 2IA0A 3QODA 4F52A 2LC2A 2W85A 1ZG1A 4L5JA 3RCOA 2KIFA 5FJ8J 4Y3OA 2XF6A 2K4BA 1JXSA 1WRJA 4UUSB 3BTJA 2DOEA 2DMQA 3BP8A 2DYRH 4YG2F 4Y52J 3QYBA 1EH7A 2X48A 4XRFA 3VEPA 1V3FA 3IH2A 5BPIA 1PVEA 1ZREA 4HEA2 2Y9YA 2XKPA 2IGKA 3L1PA 2I10A 3DEUA 3KYLA 3H9GA 1WH5A 1XX5A 3QOPA 3A0BC 4I6ZA 3MEXA 3IUOA 2GLOA 1U2WA 3BOQA 1W36C 4N4OB 2HVRA 3P5JA 1ZQ3P 1ZGWA 5JHUA 2IGNA 3KIOA 2E60A 2WV0A 1IRFA 4AIKA 3RI4A 1IW7F 2XSDC 2K9NA 1SAUA 2M8GX 3FMQA 3I4PA 1RZ4A 3DTKA 4BY7J 4IKFA 2M7BA 3BROA 2EQRA 3RKXA 2H27A 2WY8Q 3E3VA 3MVPA 2XAFA 1SFEA 2L54A 2A07F 4LMYA 2H6BA 2E71A 2MYSA 1YRNA 4Y17A 2DFIA 5H2FC 5IP6A 3ROUA 3D5RC 3GZNB 3FKIJ 3NAUA 3Q3SA 4B3XA 1Z21A 2VC0A 5IT3A 5L3BA 1YW8A 2VQGA 2K9LA 3M7GA 3DPTA 3A0HC 3W2VA 3IAM2 2CUFA 2WB1N 2XHKA 2ZB9A 1VQKI 4LLLA 1ZR4A 5DCMB 3V7SA 4IEJA 3GTOJ 2QQ8A 3MZHA 3W2AA 1HW5A 2C6YA 2HPMA 4ABZA 1RESA 2KDZA 1R9TJ 3RDIA 3E5XA 4I2OA 4NQWB 4LIVA 2L3DA 1RPWA 1O3TA 3JRIA 2VT3A 1XDSA 1ZG5A 2OQGA 3HBLA 5LHGA 5CLSA 1Z3XA 3PIOF 1T08B 1T38A 2LTPA 4M9SA 5FKKA 1KQ9A 1ETOA 2CO5A 1RR7A 1DU0A 2DDAA 2FU4A 2W1OA 3DPUA 5CVIA 3OYIA 3PO2J 4CHUA 1ERDA 3GW2A 1IF1A 4RLFA 3FK6A 1H9GA 3BG3A 5TGTA 3JR9A 2IP2A 3WTZA 5GP9A 3SFZA 1F5TA 1OR7C 3GXOA 5J1UA 1EH6A 1LDJA 4IJAA 2BY0A 5ILVA 4OIRF 4IXAA 3DKYA 3E5UA 1MBEA 1MH3A 4RGUA 3S1RJ 1IV6A 2VUMJ 1YLFA 2G7HA 4N9HA 1GDTA 4UY8I 2DDBA 2LY1A 4PJMA 2GWRA 5J8CA 3K2AA 2IS6A 4MHGA 1QVUA 2E1MB 5LD2C 2X1CA 3QPLA 2PJRA 4ANJA 5GTHC 2RAEA 2HYGD 3SZGA 3RPUD 5M3MJ 5HVQC 1REPC 2K27A 3SEZA 1SANA 5B66C 4MTDA 1IN8A 2ADUA 3R6SA 2R5ZB 3KYDB 4XSZF 3G73A 3W6JB 2VXDA 2W24A 4XONA 1WPKA 2KQRA 4UHTA 2LF7A 2L5QA 1V4RA 3BR0A 3E6BA 2MSYA 5JI6A 1I1SA 4ESBA 3ZQGA 5HODA 5JFRA 5DM7F 2L9NA 3C7JA 5FKMA 3QYFA 3ZN1A 5D4RA 1U3EM 4L0YB 4X0GA 4FCYA 1KYWA 3VODA 1QA6A 4M73A 2X6WA 5EZHA 9ANTA 2M7AA 2XPVA 1JE8A 3HJEA 1K4SA 1W0TA 1B72A 1Y39A 4GGGA 1BI2A 4JX5A 1P4WA 1AU7A 3S1NJ 2A5YB 1VQOI 2AQEA 1LVAA 3CJNA 3OYAA 1ZTRA 2HOTA 2LY2A 4YFXF 3HRTA 1U5TB 2Y31A 4V2GA 2V1UA 3EUAA 4XORA 2ZMEA 1JKOC 3A03A 1FMVA 4KIFA 1WZ2A 5E3NA 4UV9A 1WKMA 3BDDA 2OUMA 3OYBA 3CTAA 1X1PA 2IGMA 3E6DA 3GTLJ 1MBFA 2KHMA 1MGTA 2DK5A 4B09A 5A2QZ 4MGRA 4GCVA 3CC4I 2LK2A 5DV5A 3H92A 4IZZA 3LSJA 2STTA 3JRHA 2RN7A 2V7FA 5KAIC 1ON2A 3TMOA 4DYCA 1TNSA 4CGZA 2X85A 4KUMA 1BW6A 1K4TA 2OPTA 1XC5A 2YU3A 3TW6A 5HS8A 4G6TB 5LFAA 2GIVA 4CA0A 2ME0A 1MZBA 2PMZA 2V1DA 4BE0A 3MWMA 5JVTA 1MNEA 1NH3A 1K78B 4X1EA 1ZN2A 1JJ6C 2IEKA 1TL8A 2KT0A 3EDPA 3DBHB 1WFXA 2DTZA 3LA7A 3CD6I 5DYMA 2HQ5A 2V1NA 4M3FA 2YS9A 2MFZA 3L7WA 1SFUA 2VXZA 2KIUA 5J4YA 1OCOH 2WAQN 4IHVA 2LFBA 2LRDA 3PQJA 3GYHX 1MW7A 3HGYA 3QPTA 4HX7A 4HNUA 4LLNA 3DPLC 5GAGJ 3SDBA 1QU3A 4E4HA 4CZZA 1R49A 2K85A 2CQXA 2OCEA 3G1OA 1R7JA 2Z16A 3PNYA 3U21A 2P4WA 4RB3C 3CCLI 1BOAA 3KLOA 4Q5SF 4RGRA 3OR1C 4ASNA 1Y8RB 3J81Z 1YHQI 3LNQA 1I39A 4GRIA 2BHZA 1ZG3A 1YG2A 4HSTA 4HPQA 3RKQA 3GTPJ 3EUHC 1MMSA 3PUBA 3GLLA 3QWLA 1Q1HA 3B6CA 2KRHA 3OYGA 3RYRA 2FQ4A 2GOMA 1XGOA 3ZQ7A 3OOUA 2LD5A 1CQTA 4BKXA 1Y8QB 2LY9A 1IRZA 1K7AA 1LVKA 1KU7A 1TQPA 2JA5J 1TT5B 4LK0F 4O6JA 1EF4A 1QQIA 3DFGA 4XOPA 5F0CA 1OCTC 1LFBA 1A6QA 1HXDA 4EJTA 3BR3A 2CW0F 4P1WA 3OYFA 5IT9Z 1L0OC 1HKQA 4JX6A 4E7SA 2F5EA 2V4JC 3SQNA 3T5XA 1W0UA 4EJOA 1W7PB 2O8XA 2W82A 4UVAA 1VQ8I 2HWVA 1JUPA 1ZR2A 3AL0B 5K5RA 2XAQA 3ASOH 2V79A 2Z99A 3F21A 2VIXA 1O7FA 1WHUA 4D7MA 1FP1D 5FGMA 4ENKA 1OJLA 2ZO4A 3K1MA 2EWNA 1ZHFA 4HYEA 2F4OB 2M5WA 5E8IA 3KLNA 2PJPA 2O7OA 4KJZA 2J5OA 4OIQF 2KLOA 4LB6B 3WG9A 1N75A 3IRQA 1KYZA 1W5TA 2EPFA 4WX9A 1HDDC 2IBDA 4UUVA 2NOJB 2KDOA 4KN7X 5DS9A 4HW0A 3LOCA 2ISYA 3VSLA 5HOOA 2UZKA 2KJCA 1MBHA 4D5FA 2BEOA 2R7DA 1LDKB 3IL2A 4LG0B 3J7AY 4HZFA 1G6NA 3I9V2 5DUKA 1DPUA 1QZEA 4PJ0C 3V8LA 5IYDJ 4RBOA 1B8IB 4B8XA 1R5GA 2OAZA 2FXAA 3TBIA 1GV5A 2M0MA 3TDUC 4DYQA 2WAFA 2Z1DA 2COMA 1IV8A 2BY3A 2IPQX 2A6TA 3HKZN 4XLAA 4C3IJ 2FUG2 1V5EA 2CU7A 2QBYA 1ZRFA 2ZFWA 3AFHA 3DEEA 3S2WA 3VB2A 3HSRA 5ILUA 3KCCA 4QPQA 4ENJA 1Z6TA 1D8JA 2Q8KA 1I27A 2X0LA 3CLOA 1OYYA 1OLTA 4AC0A 3E97A 1BI1A 4RM2A 3JSOA 3QU6A 1VI0A 1QGPA 4EATA 2FMLA 2E2IJ 1POGA 2QQAA 1HC8A 3MCZA 5LGTA 4XM3A 3TQNA 3BG6A 1IGNA 4BL0B 3FM5A 1S29A 4EV0A 4ENNA 5F6FA 2JUGA 1LEBA 1UJ8A 4M3DA 1LEAA 4UVBA 2YR2A 1XB4A 2QQBA 2R0QC 3OYMA 1PJRA 2DMNA 2IJLA 3QPSA 2IS4A 4XKCA 3OSGA 1JKQC 3H5NA 3I59A 4JP0A 4LG3A 4N9IA 1VQNI 2R7SA 1V5FA 2P6SA 3CQZJ 2FF4A 4B4CA 5HDGA 1T8IA 1X1DA 2VKDA 2W4SA 1ITYA 4RGXA 2F2EA 5TJJA 2E5NA 1FYMA 1A35A 2E5ZA 3BR1A 4G6DA 1T0FA 3L2QA 4BUPA 2R7XA 3ECHA 2IRFG 2EJRA 3H36A 3IV5A 3ISPA 1IXCA 1M1EB 2LR8A 1AA7A 4JK1X 1CF7B 4KICA 1I5ZA 1NHAA 3H35A 1JHFA 4HF2A 1MBGA 1XSXA 1TQMA 2L7FP 3BLYA 4BDZA 1MBKA 1TWHJ 3G4SI 1D8KA 1QPMA 1SFXA 1VNDA 2O9LA 5D5VB 3WTSC 1PYVA 2WADA 2RNGA 3TEDA 3KYCB 2ZSIB 3E7LA 1P9QC 2V26A 2DBBA 2PLYA 1DP7P 2F6CA 3ZMVA 2OF7A 3JTHA 4MIMA 4CDGA 1ZARA 3IH4A 3KZZA 5ICFA 1U0JA 3QOEA 5C3EJ 5EG0A 1O57A 4HG2A 1S6LA 1YW7A 1Y0UA 4XLPF 3H5RA 4WK8F 3MKZA 3G71I 1O3RA 1BR1A 4XKWA 1Z77A 2VI6A 2P7CB 3HOWJ 5GPAA 2VJIA 3KEYA 5FROA 2RGVA 4EJWA 3KX2A 1NK2P 1FYLA 1T33A 2DOFA 4II2A 4M3GA 4NBQA 3VDXA 3D1NI 2GOXB 5M3FJ 4V2FA 4A3FJ 2VOOA 1UHMA 4LLGF 1YS7A 1UELB 3MKWB 3CUOA 1XD7A 1STZA 1NG7A 4AVPA 1IAWA 1I50J 2P5LC 2UV1A 1UB9A 1C0WA 1Z1DA 2BOLA 2ZJ2A 4C2MJ 3ZMSA 1USSA 4E70A 1MKMA 1G8XA 1V5GA 3S1MJ 1YX5A 4IPAA 3N4MA 2CRGA 1ZLJA 2EB7A 1TWFJ 2EFOA 3CLQA 3BZCA 4QLCU 1WJFA 1OCCH 4A12A 2HQRA 1QO0D 1G4DA 3A2KA 2Q2EA 4A3BJ 2M4GA 4A3LJ 4LD5A 1USTA 3HM5A 2ME6A 1HKSA 3QRFF 5FLVA 1W7PD 2VONA 4LK1F 3I53A 1JTYA 4A0YA 2PMHA 1XG1A 1ETYA 2NVQJ 3BCAA 1YS6A 4MEXF 4S0HB 2NYXA 2QLZA 3GFLA 5E1XA 3GFMA 4E7ZA 1I3QJ 4F92B 2K9MA 2WAQA 4PJNA 1ZYRF 2F4IA 3D0SA 2V9PA 1GUUA 1N25A 2LMDA 3ZRGA 2LF8A 5B1BH 3PFYA 2F5FA 1FOWA 1GVJA 2L2OA 3FIWA 4Z2YA 2LG4A 4BQNA 1FOKA 4BBSJ 3CP2A 2PX9A 2A6EF
chains in the Genus database with same CATH topology
1Z0XA 3OIOA 4NDLA 2X6OA 4A3MJ 2CUFA 2WB1N 3H0GJ 2ZB9A 3BR5A 3TW7A 1ZR4A 2R7ZJ 2CJJA 5M5WJ 4IEJA 3GTOJ 5DTDA 2R5YB 5EGOB 3HOZJ 3MKLA 1HF0A 4ABZA 1AKHA 1IDZA 1RESA 2KDZA 1R9TJ 1S7EA 1MH4A 4IHXA 5EZGA 1RPWA 5K7FA 3JRIA 4X6AJ 3HBLA 2M2EA 3K7AJ 1GV2A 5IP9J 3S14J 4QIWN 2E2HJ 2LTPA 5FKKA 1APLC 1PUFA 1ETOA 3BQYA 1JKPC 1JKRC 1RR7A 3BR2A 2G0EA 1DU0A 1JUMA 2LP0A 3LSRA 2QF7A 3PO2J 1ETWA 2HXOA 4DZJA 1ETQA 4A3KJ 3FK6A 3BG3A 1JUSA 1HCRA 3JR9A 2HDDA 1MBJA 2DA7A 5GP9A 2NVYJ 3VPRA 5J1YA 2EZKA 5J1UA 3M3YJ 2K9QA 1MBEA 1MH3A 3S1RJ 1IV6A 2VUMJ 1GDTA 2COBA 1ZKGA 1H8AC 1LE8B 5FLMJ 4LOCA 4B3AA 3K2AA 4G12A 4GFBA 1QVUA 2H1KA 4MLOA 3BTIA 2MG4A 3QPLA 5IOZA 2RAEA 5M3MJ 4XIDA 2LKXA 4XRSG 1SANA 5C4JJ 2XPWA 5IYCJ 2R5ZB 5F0HA 4Y7NJ 1MSFC 5JLXA 3FK7A 3W6VA 4A3EJ 1WPKA 5E3LA 2JMWA 2JA7J 3A01B 5EDNA 3BR0A 2MSYA 4DW6A 4XRSA 1NK3P 3ZQGA 5HODA 5IYBJ 4BBRJ 4A3IJ 1IDYA 5FKMA 1Y1WJ 1FIPA 1WGXA 1WH7A 2GBYA 4FCYA 4CYCA 1DU6A 5EZHA 9ANTA 2XPVA 1ZK8A 1B72A 1W0TA 2XB0X 3JRFA 4JX5A 4I76A 1RKWA 1AU7A 3S1NJ 1P7IA 1GT0C 2HOTA 3Q0UA 1ZTRA 4V2GA 4XRMA 2Y31A 1X2MA 4UUSA 4FE4A 3UKGA 3GTGJ 2YUSA 3Q0WA 1JKOC 3A03A 4J19A 5E3NA 1RKTA 2X9DA 3GTLJ 3ZQHA 1MBFA 2DA1A 2LK2A 1K83J 1RETA 1ETXA 1QVTA 3LSJA 2JA6J 3JRHA 3JREA 3S17J 4QSHA 4DYCA 1BW6A 2OPTA 5J3LA 1XC5A 3TW6A 2LVSA 1IUFA 1JJ8C 5IOYA 2ME0A 1UMQA 2NOGA 2MW8A 1FIAA 4X1EA 4HNVA 1WCMJ 1G2HA 4C3JJ 1JJ6C 2IEKA 2K40A 2MGQA 4JX4A 2KT0A 5F08A 1ETKA 4JYKA 2DTZA 1JTXA 1MSEC 2DN0A 3O8HA 2HQ5A 4M3FA 2YS9A 4M3BA 1IG7A 2Y9ZA 3TP3A 2ID3A 2WAQN 3TP0A 3JRBA 1D5YA 4IHVA 4IHYA 5FKOA 4B1RA 2LFBA 1FEXA 4XK4A 1QPIA 2DJNA 3HGYA 5FKLA 2JN6A 3S1QJ 2VKEA 1NTCA 3FISA 2FD5A 2ECBA 2FX0A 4W97A 2B63J 2DMUA 2ELKA 3C2BA 5BNGA 2CQXA 3ZOBA 3G1OA 3A02A 2N8GA 2DMPA 2DA5A 2R5YA 2WV1A 5EGOA 3I4MJ 1UHSA 3LNQA 1JT6A 2TCTA 1F36A 1OFCX 3RKQA 3GTPJ 3HOUJ 5K7HA 3B6CA 1ETVA 2ECCA 5EG0B 2FQ4A 5F04A 3OOUA 3GTJJ 2LD5A 1CQTA 2JJ7A 2K9SA 5F27A 4BKXA 2CQQA 2LY9A 4FISA 1IRZA 3HOVJ 4RDUA 2JA5J 1EF4A 2VKVA 4MFEA 1LFUP 5F0CA 1OCTC 2L7MP 2LLKA 3NARA 3BR6A 5IPAA 1LFBA 5M5XJ 3BR3A 4UUTA 4JX6A 1K61A 1TC3C 4A93J 3RZOJ 3GTQJ 3ZQLA 2TRTA 3SJMA 1TWAJ 3MN2A 1W0UA 5FKNA 4A3JJ 2AO9A 1JUPA 4MFDA 1ZR2A 3GBGA 3ZQIA 3OSFA 1FTZA 4D7MA 2IAIA 1OJLA 2JK3A 1H88C 2M9HA 3S16J 2R92J 3S2DJ 1OCPA 5K7ZA 2DMTA 1LE8A 2O7OA 1X58A 5EYRA 4CYCB 3S15J 1O4XA 1HDDC 1QRYA 2IBDA 4BXXJ 5DS9A 5F0FA 3LOCA 2R5ZA 3H3VK 4A3GJ 3BTCA 1MBHA 4D5FA 5EEAA 1T56A 2EZLA 1Q1VA 4DYRA 5J1RA 1BL0A 1MNMC 5F1JA 1P7JA 3A01A 2VPRA 1H89C 3BG5A 3BG9A 3CMYA 2W48A 5IYDJ 4RBOA 1B8IB 4DYQA 1IJWC 1GV5A 3B6AA 2E1OA 2E19A 1A5JA 3HKZN 4C3IJ 2FJ1A 4D7NA 3IH3A 3WHBA 2CU7A 3BT9A 3JRDA 5M5YJ 1YRNB 2NVXJ 1HDPA 2DA6A 2HOSA 2EZIA 4A69C 2XGCA 1X2NA 4W1UA 4AC0A 5E3MA 1VI0A 2E2IJ 3F0CA 1POGA 1IGNA 1FTTA 2O8KA 3Q0VA 2Y0SN 4M3DA 3JRCA 2L9RA 2XPUA 2XB5A 2HOAA 1JGGA 3M4OJ 1AKHB 3HOYJ 2JA8J 2L7ZA 2R0QC 1XS9A 1F43A 1WI3A 2DMNA 2DA4A 3QPSA 4A3DJ 2E2JJ 3OSGA 1JKQC 2R93J 4JP0A 1TWGJ 3DEWA 4A3CJ 4L5EA 3CQZJ 3BTLA 1FJLA 4BY1J 2YU9J 4B4CA 3HEFA 1ITYA 1PUFB 2HXIA 3BR1A 2JWTA 2P81A 3I4NJ 3CCYA 3BQZA 2PMZN 3IV5A 2LR8A 3G1LA 3RZDJ 1GVDA 5JLWA 2QCOA 2DA2A 2ID6A 3ZQCA 1MBGA 1U9NA 3GTMJ 2L7FP 1ENHA 1ORKA 2XGEA 3JRGA 4M3EA 3S2HJ 1MBKA 1TWHJ 2NS8A 4XICA 1VNDA 2O9LA 1I6HJ 2M0CA 4DZPA 1VF9A 2H8RA 4IHWA 3TEDA 1U78A 3LSGA 1SFOJ 3E7LA 2HYJA 1HLVA 2GM4A 5C44J 2OF7A 1U8BA 2L0KA 4MIMA 1AHDP 1Y1VJ 3IH4A 5C3EJ 5EG0A 2AHQA 3PM1A 3HDDA 2Y2ZA 1Z77A 2VI6A 4EEFG 2D5VA 3HOWJ 5GPAA 4MO7A 2Y30A 3SFIA 3PO3J 1E3OC 3DCFA 4QTRA 1HOMA 1NK2P 3CDLA 2NS7A 1T33A 4M3GA 4FE7A 4M6VA 3D1NI 5M3FJ 3GTKJ 4V2FA 4A3FJ 2EBIA 1BJZA 3O8GA 3JRAA 2DA3A 1B72B 2EZHA 2M34A 1I50J 3SDGA 1UG2A 5FJ8J 1JT0A 4FTHA 4C2MJ 4UUSB 1U9OA 3BTJA 3G1MA 2DMQA 4Y52J 1TWCJ 4AUXA 3ZQFA 2X48A 2EH3A 3S1MJ 2CRGA 3IH2A 3QQAA 1TWFJ 2Y9YA 3HGGA 3L1PA 2I10A 5EF6A 2HI3A 5E3OA 4D5CA 1WH5A 3WHCA 5IP7J 4I6ZA 4A3BJ 2GLOA 4A3LJ 3HM5A 2ME6A 1A6IA 5FLVA 1ZQ3P 1ZGWA 3HB9A 1JTYA 1XG1A 1ETYA 2K9NA 2XSDC 2NVQJ 4AYBN 4C3HJ 2M8GX 3HOXJ 1B8IA 2XGDA 5C4XJ 2CUEA 1VFCA 4S0HB 4BY7J 1BA5A 3LSPA 2EQRA 2NVTJ 1I3QJ 3MVPA 1BW5A 1YRNA 2XRLA 1GUUA 3RQIA 5IP6A 3FKIJ 3NAUA 3FIWA 3Q3SA 5GPCA 4BBSJ 1IC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0X A;  3OIO A;  4NDL A;  2X6O A;  4A3M J;  2CUF A;  2WB1 N;  3H0G J;  2ZB9 A;  3BR5 A;  3TW7 A;  1ZR4 A;  2R7Z J;  2CJJ A;  5M5W J;  4IEJ A;  3GTO J;  5DTD A;  2R5Y B;  5EGO B;  3HOZ J;  3MKL A;  1HF0 A;  4ABZ A;  1AKH A;  1IDZ A;  1RES A;  2KDZ A;  1R9T J;  1S7E A;  1MH4 A;  4IHX A;  5EZG A;  1RPW A;  5K7F A;  3JRI A;  4X6A J;  3HBL A;  2M2E A;  3K7A J;  1GV2 A;  5IP9 J;  3S14 J;  4QIW N;  2E2H J;  2LTP A;  5FKK A;  1APL C;  1PUF A;  1ETO A;  3BQY A;  1JKP C;  1JKR C;  1RR7 A;  3BR2 A;  2G0E A;  1DU0 A;  1JUM A;  2LP0 A;  3LSR A;  2QF7 A;  3PO2 J;  1ETW A;  2HXO A;  4DZJ A;  1ETQ A;  4A3K J;  3FK6 A;  3BG3 A;  1JUS A;  1HCR A;  3JR9 A;  2HDD A;  1MBJ A;  2DA7 A;  5GP9 A;  2NVY J;  3VPR A;  5J1Y A;  2EZK A;  5J1U A;  3M3Y J;  2K9Q A;  1MBE A;  1MH3 A;  3S1R J;  1IV6 A;  2VUM J;  1GDT A;  2COB A;  1ZKG A;  1H8A C;  1LE8 B;  5FLM J;  4LOC A;  4B3A A;  3K2A A;  4G12 A;  4GFB A;  1QVU A;  2H1K A;  4MLO A;  3BTI A;  2MG4 A;  3QPL A;  5IOZ A;  2RAE A;  5M3M J;  4XID A;  2LKX A;  4XRS G;  1SAN A;  5C4J J;  2XPW A;  5IYC J;  2R5Z B;  5F0H A;  4Y7N J;  1MSF C;  5JLX A;  3FK7 A;  3W6V A;  4A3E J;  1WPK A;  5E3L A;  2JMW A;  2JA7 J;  3A01 B;  5EDN A;  3BR0 A;  2MSY A;  4DW6 A;  4XRS A;  1NK3 P;  3ZQG A;  5HOD A;  5IYB J;  4BBR J;  4A3I J;  1IDY A;  5FKM A;  1Y1W J;  1FIP A;  1WGX A;  1WH7 A;  2GBY A;  4FCY A;  4CYC A;  1DU6 A;  5EZH A;  9ANT A;  2XPV A;  1ZK8 A;  1B72 A;  1W0T A;  2XB0 X;  3JRF A;  4JX5 A;  4I76 A;  1RKW A;  1AU7 A;  3S1N J;  1P7I A;  1GT0 C;  2HOT A;  3Q0U A;  1ZTR A;  4V2G A;  4XRM A;  2Y31 A;  1X2M A;  4UUS A;  4FE4 A;  3UKG A;  3GTG J;  2YUS A;  3Q0W A;  1JKO C;  3A03 A;  4J19 A;  5E3N A;  1RKT A;  2X9D A;  3GTL J;  3ZQH A;  1MBF A;  2DA1 A;  2LK2 A;  1K83 J;  1RET A;  1ETX A;  1QVT A;  3LSJ A;  2JA6 J;  3JRH A;  3JRE A;  3S17 J;  4QSH A;  4DYC A;  1BW6 A;  2OPT A;  5J3L A;  1XC5 A;  3TW6 A;  2LVS A;  1IUF A;  1JJ8 C;  5IOY A;  2ME0 A;  1UMQ A;  2NOG A;  2MW8 A;  1FIA A;  4X1E A;  4HNV A;  1WCM J;  1G2H A;  4C3J J;  1JJ6 C;  2IEK A;  2K40 A;  2MGQ A;  4JX4 A;  2KT0 A;  5F08 A;  1ETK A;  4JYK A;  2DTZ A;  1JTX A;  1MSE C;  2DN0 A;  3O8H A;  2HQ5 A;  4M3F A;  2YS9 A;  4M3B A;  1IG7 A;  2Y9Z A;  3TP3 A;  2ID3 A;  2WAQ N;  3TP0 A;  3JRB A;  1D5Y A;  4IHV A;  4IHY A;  5FKO A;  4B1R A;  2LFB A;  1FEX A;  4XK4 A;  1QPI A;  2DJN A;  3HGY A;  5FKL A;  2JN6 A;  3S1Q J;  2VKE A;  1NTC A;  3FIS A;  2FD5 A;  2ECB A;  2FX0 A;  4W97 A;  2B63 J;  2DMU A;  2ELK A;  3C2B A;  5BNG A;  2CQX A;  3ZOB A;  3G1O A;  3A02 A;  2N8G A;  2DMP A;  2DA5 A;  2R5Y A;  2WV1 A;  5EGO A;  3I4M J;  1UHS A;  3LNQ A;  1JT6 A;  2TCT A;  1F36 A;  1OFC X;  3RKQ A;  3GTP J;  3HOU J;  5K7H A;  3B6C A;  1ETV A;  2ECC A;  5EG0 B;  2FQ4 A;  5F04 A;  3OOU A;  3GTJ J;  2LD5 A;  1CQT A;  2JJ7 A;  2K9S A;  5F27 A;  4BKX A;  2CQQ A;  2LY9 A;  4FIS A;  1IRZ A;  3HOV J;  4RDU A;  2JA5 J;  1EF4 A;  2VKV A;  4MFE A;  1LFU P;  5F0C A;  1OCT C;  2L7M P;  2LLK A;  3NAR A;  3BR6 A;  5IPA A;  1LFB A;  5M5X J;  3BR3 A;  4UUT A;  4JX6 A;  1K61 A;  1TC3 C;  4A93 J;  3RZO J;  3GTQ J;  3ZQL A;  2TRT A;  3SJM A;  1TWA J;  3MN2 A;  1W0U A;  5FKN A;  4A3J J;  2AO9 A;  1JUP A;  4MFD A;  1ZR2 A;  3GBG A;  3ZQI A;  3OSF A;  1FTZ A;  4D7M A;  2IAI A;  1OJL A;  2JK3 A;  1H88 C;  2M9H A;  3S16 J;  2R92 J;  3S2D J;  1OCP A;  5K7Z A;  2DMT A;  1LE8 A;  2O7O A;  1X58 A;  5EYR A;  4CYC B;  3S15 J;  1O4X A;  1HDD C;  1QRY A;  2IBD A;  4BXX J;  5DS9 A;  5F0F A;  3LOC A;  2R5Z A;  3H3V K;  4A3G J;  3BTC A;  1MBH A;  4D5F A;  5EEA A;  1T56 A;  2EZL A;  1Q1V A;  4DYR A;  5J1R A;  1BL0 A;  1MNM C;  5F1J A;  1P7J A;  3A01 A;  2VPR A;  1H89 C;  3BG5 A;  3BG9 A;  3CMY A;  2W48 A;  5IYD J;  4RBO A;  1B8I B;  4DYQ A;  1IJW C;  1GV5 A;  3B6A A;  2E1O A;  2E19 A;  1A5J A;  3HKZ N;  4C3I J;  2FJ1 A;  4D7N A;  3IH3 A;  3WHB A;  2CU7 A;  3BT9 A;  3JRD A;  5M5Y J;  1YRN B;  2NVX J;  1HDP A;  2DA6 A;  2HOS A;  2EZI A;  4A69 C;  2XGC A;  1X2N A;  4W1U A;  4AC0 A;  5E3M A;  1VI0 A;  2E2I J;  3F0C A;  1POG A;  1IGN A;  1FTT A;  2O8K A;  3Q0V A;  2Y0S N;  4M3D A;  3JRC A;  2L9R A;  2XPU A;  2XB5 A;  2HOA A;  1JGG A;  3M4O J;  1AKH B;  3HOY J;  2JA8 J;  2L7Z A;  2R0Q C;  1XS9 A;  1F43 A;  1WI3 A;  2DMN A;  2DA4 A;  3QPS A;  4A3D J;  2E2J J;  3OSG A;  1JKQ C;  2R93 J;  4JP0 A;  1TWG J;  3DEW A;  4A3C J;  4L5E A;  3CQZ J;  3BTL A;  1FJL A;  4BY1 J;  2YU9 J;  4B4C A;  3HEF A;  1ITY A;  1PUF B;  2HXI A;  3BR1 A;  2JWT A;  2P81 A;  3I4N J;  3CCY A;  3BQZ A;  2PMZ N;  3IV5 A;  2LR8 A;  3G1L A;  3RZD J;  1GVD A;  5JLW A;  2QCO A;  2DA2 A;  2ID6 A;  3ZQC A;  1MBG A;  1U9N A;  3GTM J;  2L7F P;  1ENH A;  1ORK A;  2XGE A;  3JRG A;  4M3E A;  3S2H J;  1MBK A;  1TWH J;  2NS8 A;  4XIC A;  1VND A;  2O9L A;  1I6H J;  2M0C A;  4DZP A;  1VF9 A;  2H8R A;  4IHW A;  3TED A;  1U78 A;  3LSG A;  1SFO J;  3E7L A;  2HYJ A;  1HLV A;  2GM4 A;  5C44 J;  2OF7 A;  1U8B A;  2L0K A;  4MIM A;  1AHD P;  1Y1V J;  3IH4 A;  5C3E J;  5EG0 A;  2AHQ A;  3PM1 A;  3HDD A;  2Y2Z A;  1Z77 A;  2VI6 A;  4EEF G;  2D5V A;  3HOW J;  5GPA A;  4MO7 A;  2Y30 A;  3SFI A;  3PO3 J;  1E3O C;  3DCF A;  4QTR A;  1HOM A;  1NK2 P;  3CDL A;  2NS7 A;  1T33 A;  4M3G A;  4FE7 A;  4M6V A;  3D1N I;  5M3F J;  3GTK J;  4V2F A;  4A3F J;  2EBI A;  1BJZ A;  3O8G A;  3JRA A;  2DA3 A;  1B72 B;  2EZH A;  2M34 A;  1I50 J;  3SDG A;  1UG2 A;  5FJ8 J;  1JT0 A;  4FTH A;  4C2M J;  4UUS B;  1U9O A;  3BTJ A;  3G1M A;  2DMQ A;  4Y52 J;  1TWC J;  4AUX A;  3ZQF A;  2X48 A;  2EH3 A;  3S1M J;  2CRG A;  3IH2 A;  3QQA A;  1TWF J;  2Y9Y A;  3HGG A;  3L1P A;  2I10 A;  5EF6 A;  2HI3 A;  5E3O A;  4D5C A;  1WH5 A;  3WHC A;  5IP7 J;  4I6Z A;  4A3B J;  2GLO A;  4A3L J;  3HM5 A;  2ME6 A;  1A6I A;  5FLV A;  1ZQ3 P;  1ZGW A;  3HB9 A;  1JTY A;  1XG1 A;  1ETY A;  2K9N A;  2XSD C;  2NVQ J;  4AYB N;  4C3H J;  2M8G X;  3HOX J;  1B8I A;  2XGD A;  5C4X J;  2CUE A;  1VFC A;  4S0H B;  4BY7 J;  1BA5 A;  3LSP A;  2EQR A;  2NVT J;  1I3Q J;  3MVP A;  1BW5 A;  1YRN A;  2XRL A;  1GUU A;  3RQI A;  5IP6 A;  3FKI J;  3NAU A;  3FIW A;  3Q3S A;  5GPC A;  4BBS J;  1IC8 A; 
#chains in the Genus database with same CATH topology
 4A3M J;  2DFH A;  1LNW A;  3LSM A;  3H0G J;  1LFP A;  2HQA A;  3RQ4 A;  4F93 B;  3M1E A;  4RGS A;  2Z3Y A;  3LSI A;  2RRE A;  2X6X A;  5M5W J;  2R5Y B;  2VJ5 A;  3HOZ J;  4IF4 A;  1HF0 A;  5BOX A;  4XR6 A;  5EEG A;  3PSI A;  2KIQ A;  1S7E A;  2FNP A;  1XSV A;  4IHX A;  5EZG A;  3ULQ B;  4MEY F;  3KET A;  1FX7 A;  4OAY A;  5J40 A;  3J7Y J;  1YIJ I;  1S9H A;  2JRT A;  2M2E A;  1BR2 A;  2FBI A;  3HXL A;  3GF2 A;  3OWT A;  1UFM A;  1PUF A;  1ZRD A;  5DD4 A;  2JRM A;  1JKP C;  2HTS A;  3RPU A;  3BR2 A;  3S32 A;  1JUM A;  2LP0 A;  3LSR A;  2QF7 A;  3Q5F A;  2XUB A;  4DZJ A;  3J80 K;  3K1P A;  4IX7 A;  1JUS A;  1SC7 A;  1O3S A;  1I6X A;  3WGG A;  1MDM A;  5D8L B;  4KT6 A;  2F4M B;  2EZK A;  4L9V A;  2VT2 A;  4EM0 B;  2DXI A;  2Y75 A;  3HG9 A;  3BZK A;  2COB A;  2HU9 A;  3CP8 A;  3K4K A;  4IOC F;  4XSX F;  2CV1 A;  4PJJ A;  1HST A;  2CQK A;  1R5H A;  4CSW A;  4FAS D;  3COA C;  4FHT A;  5IYC J;  3D5S C;  1ZEL A;  2X6Y A;  3IP4 B;  4OIN F;  5HLH A;  4Y7N J;  3OYC A;  1SD4 A;  3B73 A;  5JLX A;  2A69 F;  2ACJ A;  2PEX A;  4A3E J;  1WJ5 A;  1LKX A;  3GEZ A;  3HKZ A;  2QSH X;  2M87 A;  2IW5 A;  2JA7 J;  4IL6 C;  5EDN A;  3O2P E;  2K4J A;  3PSF A;  4DW6 A;  4XRS A;  3LAJ A;  4PJL A;  1XDU A;  3WU0 A;  2I8D A;  4MQ9 F;  4BBR J;  3NWT A;  2CYY A;  5LGU A;  1FBS A;  3EET A;  4OAZ A;  4XLF A;  4L18 B;  1WGX A;  1WH7 A;  1Z6R A;  2GBY A;  4XLE A;  3TO9 A;  3CES A;  4IQ4 A;  2DW4 A;  2JTV A;  4CYC A;  3HUG B;  2DU9 A;  2BY1 A;  3HSF A;  4A2U A;  1YIO A;  1ZK8 A;  2F48 A;  3ABK H;  4R8H A;  3CCE I;  3JRF A;  3F8B A;  2X51 A;  1XGN A;  1GT0 C;  2GA2 A;  2OZ6 A;  1F4K A;  3RPQ A;  3GO5 A;  4ZJZ A;  4UUS A;  4FE4 A;  1X4P A;  5CKT A;  2K02 A;  3UKG A;  4V19 K;  2YUS A;  3Q0W A;  2JVH A;  3UNG C;  4KIT B;  1VQ4 I;  1WJC A;  3GVA A;  2JA2 A;  2WY7 Q;  5D8K B;  2XVC A;  2DA1 A;  1QNT A;  1ULY A;  3BJA A;  3TO7 A;  5BMZ A;  2A61 A;  1K83 J;  1SFK A;  2ZXJ A;  5BPD A;  4YFK F;  2QQ9 A;  3K4J A;  3OYK A;  3RIR A;  3WTV C;  4PZJ A;  4B44 A;  1VQ6 I;  4I0A A;  3MKY B;  4FX0 A;  4KYW A;  3W3C A;  4OMZ A;  3ML6 A;  2DT6 A;  5J3L A;  2LVS A;  5IOY A;  4GDF A;  3P9K A;  5HS9 A;  1FIA A;  2XIG A;  4BJ6 C;  4C3J J;  1WJB A;  2MLG A;  2M1B A;  5F08 A;  1WI9 A;  4Q47 A;  3HRM A;  4JYK A;  1MND A;  1BBY A;  1B9N A;  3O8H A;  4OIO F;  4PSW A;  3FKJ A;  5E20 A;  1RI7 A;  3FXU A;  3I3L A;  3JAM Z;  3LAP A;  2XF5 A;  1IG7 A;  1DDN A;  4IHY A;  4HX4 A;  1EV7 A;  1A36 A;  1QPI A;  1Z7L A;  2JN6 A;  2AXT C;  3K2Z A;  2VKE A;  4KT5 C;  3DBR B;  3EPZ A;  4RAZ A;  1MMN A;  3TO6 A;  2B63 J;  1R36 A;  3GUD A;  4BDY A;  5DCM A;  2Y48 A;  3WTX C;  1TNT A;  3I4M J;  1BI0 A;  3ABU A;  4Y13 A;  1VQ7 I;  1WJA A;  2BHY A;  4BU2 A;  3K4B A;  3PNV A;  1BR4 A;  1JT6 A;  1F36 A;  2ETH A;  1Y0N A;  4NQW A;  3MFK A;  3GFJ A;  2LSO A;  2AXL A;  1E2X A;  2R4G A;  3ZXS A;  2JVG A;  3LMM A;  2P5K A;  2YX4 A;  1SEU A;  3BZ6 A;  5E79 C;  5F04 A;  3GTJ J;  2DLL A;  1T98 A;  3ZCO A;  4FIS A;  2LBF B;  4HBL A;  4A0X A;  1IRG A;  3K10 A;  1VQM I;  2R7U A;  4CO8 A;  1J0R A;  2VKV A;  3V4G A;  1LFU P;  4ZTF A;  4A6D A;  5IPA A;  2LLK A;  1FOX A;  3BR6 A;  4XKV A;  5FLX K;  2DPU A;  1GLN A;  3TL4 X;  4XBF A;  1QHG A;  2VB6 A;  4OIP F;  2E7X A;  3KEQ A;  1K61 A;  4MTE A;  3RZO J;  4A93 J;  1FBQ A;  3DQV C;  1J59 A;  4PSX A;  3GTQ J;  3ZQL A;  2W84 A;  3MN2 A;  2JSP A;  3T8R A;  3P9I A;  5FKN A;  1W5C C;  1LJ9 A;  2DYS H;  3F23 A;  5D6F A;  3F72 A;  3GME A;  1HBX G;  2JK3 A;  1H88 C;  2M9H A;  2R92 J;  5JHF A;  4L9N A;  4CZC A;  4H4K C;  3HRU A;  2IGO A;  3V8K A;  4BEH B;  2X1D A;  3R4K A;  2ZJR F;  1D5V A;  3CCU I;  2QM3 A;  5ICG A;  2LDU A;  1O4X A;  2CFO A;  1BIB A;  4ZTJ A;  3HSE A;  2R5Z A;  4AID A;  4A3G J;  4AVZ A;  1E3P A;  3BTC A;  4KIG A;  1T56 A;  2EZL A;  2QEX I;  5HLG A;  4P55 A;  1BL0 A;  1P92 A;  2DCE A;  2ZKZ A;  5B3S H;  4XLH A;  4A5N A;  1QHH D;  1ON1 A;  1H89 C;  2L4M A;  2W48 A;  2GAU A;  4I0B A;  1IJW C;  3HTS B;  3B6A A;  2E1O A;  3DBL B;  2NNY A;  1N78 A;  2L4A A;  2FJ1 A;  3RKW A;  4MNU A;  1K6O A;  5M5Y J;  2NVX J;  2VN2 A;  2ZBK A;  2ELJ A;  1HDP A;  3DKW A;  2DA6 A;  4LB5 A;  1WWX A;  2STW A;  2ESH A;  1F9N A;  2EZI A;  4A69 C;  2FQ3 A;  4HQM A;  4B47 A;  2XGC A;  1FWZ A;  4W1U A;  2EK5 A;  5ED4 A;  1U5T A;  1F1Z A;  1QZY A;  1LB2 A;  3WG7 H;  4EM1 A;  4BGD A;  3GZ5 A;  4ZH4 F;  1BC7 C;  3PJR A;  2OV7 A;  3ZMZ A;  3F0C A;  3K4M A;  2FE3 A;  2P7V B;  2K3P A;  5ERI A;  5D5W B;  4C30 A;  2XAH A;  3LST A;  2JUC A;  2OU2 A;  2Y0S N;  4DOZ A;  3CCR I;  2PN6 A;  2L9R A;  2XPU A;  3C3W A;  3PQK A;  2HOA A;  1TQI A;  4WF2 A;  3WU2 C;  1JGG A;  3M4O J;  1AKH B;  3HOY J;  4BE2 A;  2MC3 A;  1T39 A;  1XS9 A;  1WI3 A;  2DA4 A;  4FX4 A;  2FSW A;  4GYG A;  2UXN A;  5LLQ A;  2DFE A;  4L5E A;  3NRV A;  1FJL A;  1VTN C;  4IRI A;  3C18 A;  2YU9 J;  3CJQ B;  3F8N A;  2QZ8 A;  2GIZ A;  4CCO A;  4IQJ A;  1K78 A;  1N77 A;  3M07 A;  4UVC A;  3ZQQ A;  1A31 A;  4I98 B;  2OA4 A;  1LPQ A;  2JWT A;  1MIJ A;  2XAG A;  3CCY A;  3BQZ A;  5HDK A;  2FBH A;  3HPG A;  2GXG A;  1R1V A;  2NS0 A;  2CV0 A;  5DDG A;  2BV6 A;  2DA2 A;  2D2W A;  4XLN F;  5HNH A;  2IVM A;  3KP5 A;  3GTM J;  2UWM A;  1KZH A;  1S7O A;  3JRG A;  2RC4 A;  4KFC A;  4M3E A;  3GLX A;  3ZP5 A;  2XSJ C;  2NS8 A;  4XLC A;  4XIC A;  1PDN C;  3EYI A;  4HRI A;  2L01 A;  1SVO A;  3L2R A;  2Q0O A;  4C2U A;  1I6H J;  2M0C A;  1R6R A;  1YQA A;  4KNY A;  2H8R A;  4CYD A;  3J80 Z;  1VQ9 I;  3LSG A;  1A04 A;  1FNN A;  4FET A;  2GM4 A;  3SYT A;  1U8B A;  1SAX A;  1ZH5 A;  2L0K A;  5DUI A;  4ZYD A;  1Y1V J;  5E1W A;  2D1V A;  3S3O A;  2HYF A;  2O61 A;  2R7Q A;  5AIP A;  3DKX A;  1S3J A;  2JQ7 A;  3PO3 J;  3ECO A;  4MO7 A;  3SFI A;  4BJ5 C;  4EGY A;  4XQF A;  3AKZ A;  3DCF A;  5J6X A;  2HS5 A;  3D5L A;  1TT0 A;  2W57 A;  1FP2 A;  2OTJ I;  2XAS A;  2EFW A;  4O3M A;  2DT5 A;  3HOS A;  1X3U A;  1K6Y A;  2H09 A;  3LWF A;  5D5X B;  4KMF A;  3WGH A;  1BJZ A;  4M74 A;  4AD9 A;  2DA3 A;  3OS1 A;  3CDI A;  1KU3 A;  5BS6 A;  1W7P A;  1ZAO A;  2EIJ H;  4PFO A;  3AG4 H;  1JT0 A;  1D0X A;  2BVL A;  2LRE A;  4P96 A;  2HGC A;  1SD6 A;  4FTH A;  1SMT A;  1U9O A;  2CQN A;  1Y6I A;  3ZQF A;  2EH3 A;  2H6C A;  5L3G A;  1U6G A;  1OIS A;  2LNB A;  5DM6 F;  2VKH A;  4HX8 A;  4YFN F;  5EF6 A;  1SD5 A;  2HI3 A;  5E3O A;  3WHC A;  3OR2 C;  3BWG A;  1GXQ A;  3VYS B;  3F6O A;  3FMR A;  4XMY A;  2OC6 A;  4ZYE A;  3L00 A;  1AWC A;  1H9T A;  2V9K A;  1FZP B;  3IWZ A;  1A6I A;  2CH0 A;  4RLQ A;  1XPX A;  1QBJ A;  2WB1 A;  1TW2 A;  3DU5 A;  5FD6 A;  3IAS 2;  3R60 A;  4LG0 A;  1TZL A;  3FXL A;  2JT1 A;  2BY2 A;  4R79 A;  3OL3 A;  4C3H J;  3HOX J;  3KEO A;  1B8I A;  3FXR A;  3E6C C;  1VFC A;  2QSG X;  3MZY A;  4C9Y A;  4CH7 A;  1X3W B;  3CUQ C;  3U1K A;  1GHC A;  4OOI A;  1EA3 A;  2VBZ A;  2FBK A;  1BW5 A;  1FSE A;  1FT9 A;  3REO A;  2HPI A;  3PNT A;  2JSC A;  4PDK A;  3E0J B;  1XMK A;  2FNA A;  5GPC A;  3TKY A;  2RKH A;  1IC8 A;  2HZD A;  2M4K A;  3CJT B;  1Z0X A;  4ESF A;  4XOT A;  3S93 A;  3OIO A;  4NDL A;  2M45 A;  4OMY A;  3VYT B;  3TW7 A;  3BR5 A;  2QKM B;  5ICE A;  3CCQ I;  1Z9C A;  1IRX A;  3VSK A;  1W5S A;  2BGC A;  4ZYH A;  2P6T A;  2CJJ A;  3HPH A;  3I54 A;  4PGH A;  1XSD A;  4F55 A;  1PP8 F;  5DTD A;  2XKO A;  1R4M B;  3ONQ A;  5EGO B;  5CVR A;  2CGP A;  5CJ9 A;  4AM3 A;  3RKY A;  4ZZD A;  3BPV A;  3ZR8 X;  4R1H A;  5BQT A;  1E0E A;  1UG0 A;  2F5C A;  5GTI C;  5HS7 A;  1FMW A;  1ZGJ A;  1MH4 A;  5HLI A;  1SMY F;  1Z7U A;  2XV4 S;  5K7F A;  2FMY A;  1B4A A;  1XMX A;  4X6A J;  4G9Y A;  4NHJ A;  3K7A J;  5IP9 J;  3WE2 A;  4CUG A;  4QIW N;  5L3E A;  4UV8 A;  3J7Z I;  3ZMD A;  2E2H J;  2V9V A;  1BN5 A;  2IA1 A;  1W36 D;  3BQY A;  1OYI A;  2BXY A;  3QAH A;  2L9S A;  2KJB A;  3IC7 A;  1LQ1 A;  3OYD A;  4E7I A;  5JR3 A;  3Q9S A;  4YII A;  4E7H A;  1CF7 A;  1NG6 A;  1MJA A;  2DK8 A;  1XCB A;  4HOB A;  1OYW A;  1HCR A;  1EH8 A;  3N05 A;  4G8X A;  5CYV A;  2NVY J;  3VPR A;  5K5O A;  3G6E I;  2RNJ A;  2TDX A;  4OWR B;  2K9Q A;  3M8F A;  3BJO A;  4RB2 C;  2FOK A;  4QPO A;  3A4C A;  1MMG A;  5JVG F;  1ZKG A;  4Y15 A;  1VQL I;  1LE8 B;  1VZ0 A;  2A05 A;  4LOC A;  2H1K A;  4MLO A;  3E5Q A;  3LA3 A;  2GQQ A;  2MG4 A;  3LL7 A;  1G3S A;  5IOZ A;  2LOO A;  2KKO A;  3I55 I;  1X4O A;  3V7C A;  2LKX A;  1WQ2 A;  2EFN A;  4XRS G;  4U0W A;  2BW3 B;  1FYK A;  5C4J J;  2CG4 A;  2XPW A;  2VPL A;  3BPX A;  5F0H A;  3WTW C;  3ZGK A;  1MSF C;  1OPC A;  3W6V A;  5E3L A;  1X19 A;  1IN6 A;  2B7E A;  4U7D A;  4EVI A;  3C1D A;  2JMW A;  3A01 B;  3DXJ F;  1X1C A;  5D6E A;  1KA8 A;  1UZC A;  5L3F A;  3O6B B;  2W25 A;  5LRS A;  4A3I J;  1FSH A;  3K4L A;  1FIP A;  4RAY A;  4DJA A;  2ESN A;  1DU6 A;  2K3F A;  2ZNY A;  3MD2 A;  5IY5 H;  1BOB A;  2R7F A;  4D9J A;  2UUZ A;  2AQF A;  3KP3 A;  5FFZ A;  3CCM I;  3UR3 C;  5KCM A;  3JW4 A;  1DPR A;  2MAB A;  1B1B A;  3Q0U A;  2WWY A;  2DQL A;  2VL8 A;  1DUX C;  1RIO H;  3L2V A;  2NVU B;  1X2M A;  3GTG J;  5FD5 A;  4HF0 A;  1PP7 U;  4GXO A;  2Y0S A;  4NUB A;  2DFF A;  2R7R A;  1JGS A;  2XC7 A;  4L9T A;  4Y4R A;  3OV8 A;  4ON0 A;  5HLT A;  2X9D A;  3ZQH A;  2DPD A;  1MD0 A;  2EFP A;  2HVQ A;  2XRN A;  2R7W A;  1WVR A;  4IHS A;  3H0D A;  1ETX A;  5A2Q K;  2ZCW A;  2JA6 J;  3H9J A;  3K69 A;  3JRE A;  1T6S A;  2K86 A;  4KMU X;  5J4V A;  5J47 A;  3E1S A;  1J9I A;  2VBX A;  4G7O F;  1IUF A;  4GO1 A;  1JJ8 C;  4M71 A;  1D3Y A;  2EFQ A;  1BC8 C;  4DQ2 A;  1J09 A;  3OS2 A;  2ZNZ A;  3OIP A;  4I7H A;  1ZRC A;  2MW8 A;  2RQQ A;  4HNV A;  1WCM J;  2OTL I;  4P9F A;  2CW8 A;  1G2H A;  4JX4 A;  2VOP A;  2MD0 A;  2FA5 A;  4PGG A;  1CGP A;  2WTE A;  4QWQ A;  3X2Q H;  2KZG A;  1JTX A;  5ILS A;  2IT0 A;  3HOT A;  3U1D A;  1FBU A;  2X1E A;  1P4X A;  1YW9 A;  4M3B A;  3AAF A;  2K7L A;  3JRB A;  2ID3 A;  3TP0 A;  1D5Y A;  4BHP A;  3CUQ B;  5FKO A;  4B1R A;  1W1W E;  2VJJ A;  2MA3 A;  1FEX A;  2A68 F;  2M3A A;  5FO5 A;  2DOD A;  2OCC H;  5CPR B;  1NTC A;  2FD5 A;  1DQU A;  2EV5 A;  2DMU A;  2ELK A;  3C2B A;  5BNG A;  2YSR A;  4E7K A;  3U9G A;  3BC8 A;  2ZXW H;  1IN4 A;  4ITV A;  3WOD F;  2R5Y A;  2WV1 A;  3BG7 A;  3FX3 A;  1TLH B;  1UHS A;  3F22 A;  1YI2 I;  3CCJ I;  3HIF A;  4ZYA A;  5L3D A;  4IHT A;  1J75 A;  3HOU J;  3J81 K;  1IZ1 A;  4F3Q A;  3ERE D;  1ETV A;  2M30 A;  1P2F A;  2E1M C;  4I01 A;  3I56 I;  4E7L A;  3CCV I;  3S8P A;  3IKT A;  4EM2 A;  2R7V A;  2EV0 A;  2CQQ A;  3ABM H;  3DF8 A;  3S3M A;  2WAE A;  1TTY A;  3L2W A;  3TOB A;  2ZJQ F;  3HZJ A;  1SVL A;  2VQH A;  2DT7 B;  2L7M P;  1IXS B;  3QYE A;  4BQA A;  4F7Z A;  2HDW A;  1YYV A;  3FBN B;  3T0Y A;  1TC3 C;  3K70 C;  2BZT A;  1G3T A;  2ZME C;  4J00 A;  2HKO A;  4EQQ A;  1TWA J;  2GXB A;  3RYP A;  4A3J J;  2AO9 A;  4MFD A;  3FMS A;  3GBG A;  4IVN A;  3KZY A;  1Z91 A;  1R22 A;  2EIL H;  4U0V A;  4KDP A;  2L7K A;  4Y33 A;  2PI0 A;  2IAI A;  3PIP F;  3HHH A;  3LFU A;  1OCP A;  3S2D J;  2GA1 A;  3CZ6 A;  3G2B A;  1FC3 A;  5EEH A;  1YJW I;  1X58 A;  5EYR A;  3OYE A;  2I5U A;  4DNC A;  4CYC B;  2ZFU A;  3S15 J;  1VQP I;  2PFB A;  1U8R A;  1EKE A;  1QRY A;  1UAA A;  2Z2S B;  5LEK A;  4BXX J;  3CO7 C;  3H3V K;  1R1U A;  2RQP A;  1IUY A;  5FRM A;  4DYR A;  5J1R A;  1MNM C;  3IHU A;  1MJ9 A;  1DGW Y;  5F1J A;  2EIM H;  2NNN A;  1J5Y A;  2VPR A;  3BG5 A;  2OD5 A;  1D1C A;  4ZDO A;  1RNL A;  2OZU A;  1R58 A;  3DU6 A;  1H0M A;  1R23 A;  3QU3 A;  3TDZ C;  4C2T A;  1IO2 A;  2J5P A;  1P4A A;  4XN3 A;  4ENM A;  3HUG A;  3WHB A;  1B59 A;  4IRG A;  4NB5 A;  4XN0 A;  3BT9 A;  3CF2 A;  3LFK A;  4I99 C;  3V8J A;  1YRN B;  3DV8 A;  3GX4 X;  5ICC A;  6PAX A;  2HOS A;  3CME I;  3B02 A;  3QP5 A;  3I5U A;  1X2N A;  4HSR A;  4YIR X;  4PK4 A;  1X3Z B;  2KMU A;  3DP7 A;  1S5L C;  4IRH A;  3Q0V A;  1R71 A;  3DWL E;  3I64 A;  1R00 A;  4DBQ A;  1HKT A;  1VQ5 I;  2KIS A;  5H6R A;  4NC6 A;  5LEJ A;  4CCJ A;  4Z6Y A;  3LSK A;  5HDN A;  3JRC A;  4RB1 A;  3ESW B;  3K4C A;  4I02 A;  5FB2 A;  3JSP A;  1F43 A;  2EA2 A;  4A3D J;  4AIJ A;  4BQQ A;  2E2J J;  4A6E A;  2CWE A;  3DEW A;  4I09 A;  1E17 A;  3EUK L;  4A3C J;  4XL9 A;  3PL8 A;  5CQE A;  4ZZL A;  4BY1 J;  2YX7 A;  5KHD A;  2ZXH A;  3GFI A;  5DCF A;  1IN5 A;  1XMA A;  3DLA A;  2HXI A;  2NXN B;  3T1B A;  3MMY B;  4WCG A;  1S72 I;  3V7R A;  2Z33 A;  4PFP A;  2Z5U A;  2RDP A;  2IS2 A;  5GAD J;  2HQN A;  3RZD J;  1S8N A;  1OCZ H;  2H8W A;  5JLW A;  2QCO A;  4BHB A;  2ID6 A;  3KFW X;  3ZQC A;  2HKX A;  4G6Q A;  2KIM A;  4FQG A;  4UNO A;  2HVS A;  1ENH A;  3W6K B;  5DEQ A;  5AON A;  5EJC A;  3CC7 I;  2QEN A;  4RAF A;  2LYC A;  1HW1 A;  1D1B A;  3SZP A;  3H1C A;  1VF9 A;  3AL0 C;  4JBA A;  4IHW A;  2PG4 A;  3RSN A;  2PJR B;  4L5I A;  1U78 A;  1SFO J;  4XNF A;  1HLV A;  3MQ0 A;  5E17 F;  1T2K A;  1R4N B;  2DOA A;  3ASN H;  1BI3 A;  4CXF A;  5GAE J;  1AHD P;  2E34 A;  4H0E A;  1KQ8 A;  4LJZ F;  1YE9 A;  3S3N A;  1JI8 A;  2H1L A;  2KPM A;  3FXJ A;  1OMI A;  3LSH A;  3VFZ A;  3L9F A;  1SVM A;  3PM1 A;  4LFU A;  2OQR A;  4CCM A;  1V55 H;  2VC1 A;  5LBQ A;  2LBF A;  1E3O C;  3FXO A;  1TW3 A;  4KN4 X;  2D45 A;  5D5U B;  4QTR A;  1HOM A;  4HF1 A;  1FPQ A;  4O5V A;  3CC2 I;  2R3S A;  3DLL F;  2Q1Z B;  2HFH A;  3GTK J;  2EBI A;  3ZMU A;  4BJT A;  3O8G A;  2E1C A;  1B72 B;  3FM3 A;  2EZH A;  1OKR A;  2M34 A;  1PUE E;  3AG3 H;  3KZI C;  3SDG A;  1UG2 A;  1I3A A;  4RAG A;  2AS5 F;  3CJR B;  2V6E A;  4AU7 A;  2JPB A;  4LIU A;  2EIK H;  5LHH A;  3G1M A;  1TWC J;  4TV7 A;  4M9Z A;  4AUX A;  3OYJ A;  2ZME B;  3QQA A;  3MZ8 A;  2L02 A;  3HGG A;  1E3H A;  2XAJ A;  4BEH A;  3CO6 C;  4ZDL A;  3R0J A;  2W7N A;  4L9J A;  4E7J A;  1Z3Y A;  2F5D A;  2XRO A;  4D5C A;  5IP7 J;  3EYY A;  2B9S A;  1IXR C;  4IO9 F;  2QUF A;  4DIQ A;  2KL4 A;  3BCB A;  3M8J A;  5TIS C;  3OIQ A;  3FF5 A;  1T0F C;  2EIN H;  2DI3 A;  3HB9 A;  1ZLK A;  4BAC A;  3VYR B;  4GYI A;  2BBY A;  4AYB N;  5C4X J;  1ZGA A;  2XGD A;  4YEL A;  4ZC3 A;  2CUE A;  1HQC A;  3KPH A;  3SHF A;  1BA5 A;  3LSP A;  2NVT J;  1RUN A;  2FOW A;  4BE1 A;  1EJ9 A;  3J7A O;  1RUO A;  2XRL A;  4HLY A;  3CF5 F;  4BXF A;  5TRD A;  3FWE A;  3RQI A;  3WU1 B;  3F9K A;  3NWS A;  1HSJ A;  1BJA A;  2ISZ A;  2X6O A;  3IRR A;  4HDU A;  2FEZ A;  4K2E A;  3WTU C;  1MJB A;  2R7Z J;  5LRR A;  4B43 A;  1YTY A;  2DJI A;  3W2W A;  2HZT A;  3MKL A;  4U88 A;  5LHI A;  1I1G A;  3DTI A;  1AKH A;  1IDZ A;  2K5C A;  4E6K G;  4YIF A;  5GAH J;  5CQG A;  2QA4 I;  3OL4 A;  2CMP A;  4U7B A;  1YJ9 I;  1YX3 A;  4ZYG A;  5E8G A;  2BXZ A;  2F5V A;  2QSF X;  3K0L A;  2EV6 A;  3FHZ A;  2NRA C;  2V1X A;  3OY9 A;  1GV2 A;  4JOM A;  3RJP A;  5E18 F;  3S14 J;  1HA8 A;  4YEJ A;  5KVR A;  5CVV A;  3TGN A;  1APL C;  3P7N A;  2PMU A;  5B5E C;  2E7W A;  2O3F A;  4NNJ A;  3CMM A;  1O7L A;  4A5M A;  1JKR C;  2P5V A;  5CVJ A;  2G0E A;  5B1A H;  2VAS A;  1UHW A;  2DQR A;  1ETW A;  2HXO A;  1ETQ A;  3FZV A;  4A3K J;  3L2C A;  2JPC A;  4HA8 A;  2HDD A;  1MBJ A;  4AWX B;  1DP3 A;  1WJD A;  2DA7 A;  2KFD A;  5J1Y A;  3HYI A;  4WWC A;  4J01 A;  4NC7 A;  3KP6 A;  4N4N B;  1UCR A;  1K79 A;  4F91 B;  3M3Y J;  3SZT A;  5F1R A;  3K9T A;  3HC7 A;  2DAO A;  1H8A C;  5FLM J;  4Q4Z F;  4B3A A;  4G12 A;  2MD5 A;  2E35 A;  3F6V A;  1YJN I;  2QWW A;  4RA2 A;  4GFB A;  1S7A A;  3BTI A;  5J8F A;  2RV8 A;  4XID A;  4WXC A;  3KP7 A;  4WXD A;  2A5W A;  4B48 A;  3FK7 A;  4CCL A;  4DGW B;  3FDY A;  2P8T A;  3VWB A;  3I58 A;  3JTG A;  2GZW A;  3QP6 A;  3OYL A;  4MQV A;  1NK3 P;  4HDV A;  3CDH A;  2MBF A;  5D4S A;  3ZN0 A;  1RR8 C;  5IYB J;  2BE5 F;  3Q9V A;  1IDY A;  4KIB A;  1Y1W J;  5CVU A;  1OR7 A;  3K6G A;  3FHN A;  3FXK A;  2QBY B;  2XB0 X;  3WE3 A;  3VOE A;  2CUJ A;  2XAU A;  4I76 A;  5K5Q A;  1RKW A;  1D1A A;  4CCK A;  1P7I A;  2KRF A;  2MH9 A;  4PUS A;  3I0T A;  4FT8 A;  1B9M A;  2CUZ A;  2RVC A;  3KP4 A;  1GXP A;  4XRM A;  2VE8 A;  1X1A A;  1OQY A;  3OMY A;  2IXS A;  4J19 A;  2VOD A;  1T95 A;  1RKT A;  2MH2 A;  2YPR A;  2QVO A;  2CV2 A;  1RC9 A;  2CSO A;  4JQF A;  2O6G E;  1RRJ A;  3V42 A;  3OOP A;  4EJV A;  4BYY A;  5LGN A;  2V6C A;  3ELK A;  1G59 A;  2O03 A;  1MMD A;  2ELH A;  1RET A;  2ZC2 A;  1YFH A;  3BJ6 A;  5H20 A;  4HAM A;  4BAY A;  1QVT A;  4D1Q A;  2CFX A;  3C2G A;  3KP2 A;  2BYV E;  4UB6 C;  3S17 J;  1Z05 A;  4QSH A;  5AIQ A;  5DD8 A;  3ABT A;  3I59 B;  3G3Z A;  3I71 A;  3GZ6 A;  4Q48 A;  3NQO A;  2WA0 A;  4LIT A;  1B6A A;  2VBW A;  2HR3 A;  3MAJ A;  4RB0 A;  3DTE A;  2IA2 A;  1R5I D;  3HHG A;  3K70 D;  1UMQ A;  2NOG A;  3M9A A;  4BQO A;  3F8M A;  2IS1 A;  2K40 A;  2MGQ A;  3HTU A;  1ETK A;  3F8C A;  1MSE C;  2DN0 A;  4RMN A;  4M6X A;  2HNH A;  2Y9Z A;  3TP3 A;  2ICW G;  2VQC A;  4M9X A;  1J7K A;  1ACI A;  3OYH A;  4XK4 A;  2DJN A;  2QGU A;  3JAM K;  5FKL A;  3S1Q J;  4M72 A;  1FLI A;  3FIS A;  4S04 A;  2ECB A;  1LUJ B;  2FX0 A;  1L3L A;  4W97 A;  1XTA A;  2MLK A;  1ONV A;  2PBI A;  3ZOB A;  4II3 A;  1TBX A;  3A02 A;  3M1C A;  2GXA A;  2N8G A;  1IN7 A;  2DMP A;  1D0Y A;  3OS0 A;  2DA5 A;  1D0Z A;  1G3Y A;  3FXM A;  5EGO A;  2VJ4 A;  2H94 A;  1V54 H;  1KQ0 A;  5KAF C;  2TCT A;  4HQE A;  1OFC X;  1ODD A;  5K7H A;  2QYO A;  3JCU C;  3LQQ A;  2ECC A;  4CCN A;  4G7H F;  5EG0 B;  4CIC A;  4EMS A;  3U2R A;  4EJU A;  2KRC A;  1YOV B;  4UB8 C;  2JJ7 A;  2E1N A;  2K9S A;  5F27 A;  3HOV J;  2VLA A;  3H3U A;  4AIH A;  1MMA A;  3WTT C;  5FLX Z;  2MC4 A;  4RDU A;  4MFE A;  1BM9 A;  3NAR A;  2Z9O A;  4BHC A;  2M8E A;  5M5X J;  2A6H F;  3AG2 H;  2X4H A;  4UUT A;  3BY6 A;  1HW2 A;  3AG1 H;  4UXN A;  4KA4 A;  3TOA A;  2O5R A;  3GWZ A;  3ZMT A;  2TRT A;  3SJM A;  2L9V A;  4S05 A;  2P0W A;  1WSU A;  3OSF A;  3ZQI A;  4BNC A;  1FTZ A;  2EA4 A;  1QZZ A;  2BVM A;  2G7U A;  3QPH A;  5E1Z B;  3S16 J;  1WJE A;  3EUH A;  5K7Z A;  2DMT A;  3FXQ A;  1LE8 A;  3F3X A;  2R7O A;  2LKP A;  5H6Q A;  3KE2 A;  4IOA F;  2Y0M A;  3LQR A;  1W4M A;  4P9U A;  1X1B A;  4HV6 A;  2Q2E B;  5L3C A;  2BW3 A;  4RS8 A;  2DO7 A;  5F0F A;  3C2H A;  4AYB A;  4BS9 A;  2B0L A;  1P6R A;  2CQ7 A;  3O3K A;  4XKB A;  3RTR A;  5EEA A;  1Q1V A;  2HDC A;  3L09 A;  3N97 A;  2HTJ A;  3FBI B;  1P7J A;  3A01 A;  2UXX A;  3WTY C;  3BG9 A;  3CMY A;  3A1Y A;  2E19 A;  4HNT A;  1A5J A;  2ZSH B;  4M6Y A;  5K1Y A;  2ZJP F;  1J2X A;  4D7N A;  3IH3 A;  1FY7 A;  3JRD A;  3LA2 A;  5F64 A;  3VYU B;  1KGS A;  3EQL F;  4ZDP A;  5KK1 A;  3L2U A;  2FRH A;  3ABL H;  5E3M A;  1TP4 A;  2O0Y A;  3HRS A;  3H5A A;  4LGW A;  4U87 A;  1FTT A;  4BXU A;  2VE9 A;  2O8K A;  3ZPL A;  1XN7 A;  4L0Z B;  4RM3 A;  2D1H A;  4HV5 A;  4BH9 A;  4P5O A;  3R61 A;  1SD7 A;  2E36 A;  2XB5 A;  2VQL A;  3F8F A;  2JA8 J;  1AOY A;  2VBY A;  2L7Z A;  2OBP A;  2A3S A;  1LDD A;  2XDV A;  3OYN A;  2R93 J;  3PFI A;  1TWG J;  2XGX A;  5FRN A;  4N0B A;  4HLX A;  3K4N A;  4G94 A;  2Y69 H;  3BTL A;  4NC8 A;  5FFX A;  3HEF A;  1JHH A;  1BIA A;  4G7Z F;  3H9Q A;  3PUF A;  1PUF B;  3GCM A;  3T8T A;  2P81 A;  3CCS I;  1G3W A;  3K1N A;  3I4N J;  2JZY A;  4U0Y A;  2LKS A;  2PMZ N;  4D0P A;  3G1L A;  3SXY A;  3E6M A;  1GVD A;  2HEO A;  3ERM A;  1Z67 A;  2QKL B;  3NEU A;  4ESJ A;  3CUQ A;  1U9N A;  1MDM B;  2WBM A;  2HOE A;  1ORK A;  2XGE A;  1O3Q A;  3S2H J;  2LH9 A;  2WC2 A;  4A0Z A;  4WXH A;  2CS3 A;  2NAZ A;  2DTR A;  3IKV A;  1KU9 A;  4DZP A;  1KON A;  3SEQ A;  4ETS A;  4OU0 A;  3CMA I;  1KU2 A;  3P9C A;  1XGM A;  2ZXI A;  2KZV A;  2W00 A;  2HYJ A;  3WGI A;  5C44 J;  2CW7 A;  5IT9 K;  5HNF A;  3HL2 A;  3M8E A;  3H3Z A;  1OCR H;  4PCQ A;  1XGS A;  2AHQ A;  2OJE D;  2R7T A;  3R0A A;  3HDD A;  1XCV A;  2PQ8 A;  1FOY A;  2Y2Z A;  1R1T A;  4EEF G;  2D5V A;  4YRV A;  2Y30 A;  1DGR M;  5KNL A;  1YO5 C;  1Y56 A;  3IWF A;  4DBR A;  3CDL A;  2NS7 A;  4FE7 A;  2KP6 A;  4M6V A;  1YIT I;  1U5T C;  4EGZ A;  2XF7 A;  3JRA A;  4KIS A;  2G9W A;  2IA0 A;  3QOD A;  4F52 A;  2LC2 A;  2W85 A;  1ZG1 A;  4L5J A;  3RCO A;  2KIF A;  5FJ8 J;  4Y3O A;  2XF6 A;  2K4B A;  1JXS A;  1WRJ A;  4UUS B;  3BTJ A;  2DOE A;  2DMQ A;  3BP8 A;  2DYR H;  4YG2 F;  4Y52 J;  3QYB A;  1EH7 A;  2X48 A;  4XRF A;  3VEP A;  1V3F A;  3IH2 A;  5BPI A;  1PVE A;  1ZRE A;  4HEA 2;  2Y9Y A;  2XKP A;  2IGK A;  3L1P A;  2I10 A;  3DEU A;  3KYL A;  3H9G A;  1WH5 A;  1XX5 A;  3QOP A;  3A0B C;  4I6Z A;  3MEX A;  3IUO A;  2GLO A;  1U2W A;  3BOQ A;  1W36 C;  4N4O B;  2HVR A;  3P5J A;  1ZQ3 P;  1ZGW A;  5JHU A;  2IGN A;  3KIO A;  2E60 A;  2WV0 A;  1IRF A;  4AIK A;  3RI4 A;  1IW7 F;  2XSD C;  2K9N A;  1SAU A;  2M8G X;  3FMQ A;  3I4P A;  1RZ4 A;  3DTK A;  4BY7 J;  4IKF A;  2M7B A;  3BRO A;  2EQR A;  3RKX A;  2H27 A;  2WY8 Q;  3E3V A;  3MVP A;  2XAF A;  1SFE A;  2L54 A;  2A07 F;  4LMY A;  2H6B A;  2E71 A;  2MYS A;  1YRN A;  4Y17 A;  2DFI A;  5H2F C;  5IP6 A;  3ROU A;  3D5R C;  3GZN B;  3FKI J;  3NAU A;  3Q3S A;  4B3X A;  1Z21 A;  2VC0 A;  5IT3 A;  5L3B A;  1YW8 A;  2VQG A;  2K9L A;  3M7G A;  3DPT A;  3A0H C;  3W2V A;  3IAM 2;  2CUF A;  2WB1 N;  2XHK A;  2ZB9 A;  1VQK I;  4LLL A;  1ZR4 A;  5DCM B;  3V7S A;  4IEJ A;  3GTO J;  2QQ8 A;  3MZH A;  3W2A A;  1HW5 A;  2C6Y A;  2HPM A;  4ABZ A;  1RES A;  2KDZ A;  1R9T J;  3RDI A;  3E5X A;  4I2O A;  4NQW B;  4LIV A;  2L3D A;  1RPW A;  1O3T A;  3JRI A;  2VT3 A;  1XDS A;  1ZG5 A;  2OQG A;  3HBL A;  5LHG A;  5CLS A;  1Z3X A;  3PIO F;  1T08 B;  1T38 A;  2LTP A;  4M9S A;  5FKK A;  1KQ9 A;  1ETO A;  2CO5 A;  1RR7 A;  1DU0 A;  2DDA A;  2FU4 A;  2W1O A;  3DPU A;  5CVI A;  3OYI A;  3PO2 J;  4CHU A;  1ERD A;  3GW2 A;  1IF1 A;  4RLF A;  3FK6 A;  1H9G A;  3BG3 A;  5TGT A;  3JR9 A;  2IP2 A;  3WTZ A;  5GP9 A;  3SFZ A;  1F5T A;  1OR7 C;  3GXO A;  5J1U A;  1EH6 A;  1LDJ A;  4IJA A;  2BY0 A;  5ILV A;  4OIR F;  4IXA A;  3DKY A;  3E5U A;  1MBE A;  1MH3 A;  4RGU A;  3S1R J;  1IV6 A;  2VUM J;  1YLF A;  2G7H A;  4N9H A;  1GDT A;  4UY8 I;  2DDB A;  2LY1 A;  4PJM A;  2GWR A;  5J8C A;  3K2A A;  2IS6 A;  4MHG A;  1QVU A;  2E1M B;  5LD2 C;  2X1C A;  3QPL A;  2PJR A;  4ANJ A;  5GTH C;  2RAE A;  2HYG D;  3SZG A;  3RPU D;  5M3M J;  5HVQ C;  1REP C;  2K27 A;  3SEZ A;  1SAN A;  5B66 C;  4MTD A;  1IN8 A;  2ADU A;  3R6S A;  2R5Z B;  3KYD B;  4XSZ F;  3G73 A;  3W6J B;  2VXD A;  2W24 A;  4XON A;  1WPK A;  2KQR A;  4UHT A;  2LF7 A;  2L5Q A;  1V4R A;  3BR0 A;  3E6B A;  2MSY A;  5JI6 A;  1I1S A;  4ESB A;  3ZQG A;  5HOD A;  5JFR A;  5DM7 F;  2L9N A;  3C7J A;  5FKM A;  3QYF A;  3ZN1 A;  5D4R A;  1U3E M;  4L0Y B;  4X0G A;  4FCY A;  1KYW A;  3VOD A;  1QA6 A;  4M73 A;  2X6W A;  5EZH A;  9ANT A;  2M7A A;  2XPV A;  1JE8 A;  3HJE A;  1K4S A;  1W0T A;  1B72 A;  1Y39 A;  4GGG A;  1BI2 A;  4JX5 A;  1P4W A;  1AU7 A;  3S1N J;  2A5Y B;  1VQO I;  2AQE A;  1LVA A;  3CJN A;  3OYA A;  1ZTR A;  2HOT A;  2LY2 A;  4YFX F;  3HRT A;  1U5T B;  2Y31 A;  4V2G A;  2V1U A;  3EUA A;  4XOR A;  2ZME A;  1JKO C;  3A03 A;  1FMV A;  4KIF A;  1WZ2 A;  5E3N A;  4UV9 A;  1WKM A;  3BDD A;  2OUM A;  3OYB A;  3CTA A;  1X1P A;  2IGM A;  3E6D A;  3GTL J;  1MBF A;  2KHM A;  1MGT A;  2DK5 A;  4B09 A;  5A2Q Z;  4MGR A;  4GCV A;  3CC4 I;  2LK2 A;  5DV5 A;  3H92 A;  4IZZ A;  3LSJ A;  2STT A;  3JRH A;  2RN7 A;  2V7F A;  5KAI C;  1ON2 A;  3TMO A;  4DYC A;  1TNS A;  4CGZ A;  2X85 A;  4KUM A;  1BW6 A;  1K4T A;  2OPT A;  1XC5 A;  2YU3 A;  3TW6 A;  5HS8 A;  4G6T B;  5LFA A;  2GIV A;  4CA0 A;  2ME0 A;  1MZB A;  2PMZ A;  2V1D A;  4BE0 A;  3MWM A;  5JVT A;  1MNE A;  1NH3 A;  1K78 B;  4X1E A;  1ZN2 A;  1JJ6 C;  2IEK A;  1TL8 A;  2KT0 A;  3EDP A;  3DBH B;  1WFX A;  2DTZ A;  3LA7 A;  3CD6 I;  5DYM A;  2HQ5 A;  2V1N A;  4M3F A;  2YS9 A;  2MFZ A;  3L7W A;  1SFU A;  2VXZ A;  2KIU A;  5J4Y A;  1OCO H;  2WAQ N;  4IHV A;  2LFB A;  2LRD A;  3PQJ A;  3GYH X;  1MW7 A;  3HGY A;  3QPT A;  4HX7 A;  4HNU A;  4LLN A;  3DPL C;  5GAG J;  3SDB A;  1QU3 A;  4E4H A;  4CZZ A;  1R49 A;  2K85 A;  2CQX A;  2OCE A;  3G1O A;  1R7J A;  2Z16 A;  3PNY A;  3U21 A;  2P4W A;  4RB3 C;  3CCL I;  1BOA A;  3KLO A;  4Q5S F;  4RGR A;  3OR1 C;  4ASN A;  1Y8R B;  3J81 Z;  1YHQ I;  3LNQ A;  1I39 A;  4GRI A;  2BHZ A;  1ZG3 A;  1YG2 A;  4HST A;  4HPQ A;  3RKQ A;  3GTP J;  3EUH C;  1MMS A;  3PUB A;  3GLL A;  3QWL A;  1Q1H A;  3B6C A;  2KRH A;  3OYG A;  3RYR A;  2FQ4 A;  2GOM A;  1XGO A;  3ZQ7 A;  3OOU A;  2LD5 A;  1CQT A;  4BKX A;  1Y8Q B;  2LY9 A;  1IRZ A;  1K7A A;  1LVK A;  1KU7 A;  1TQP A;  2JA5 J;  1TT5 B;  4LK0 F;  4O6J A;  1EF4 A;  1QQI A;  3DFG A;  4XOP A;  5F0C A;  1OCT C;  1LFB A;  1A6Q A;  1HXD A;  4EJT A;  3BR3 A;  2CW0 F;  4P1W A;  3OYF A;  5IT9 Z;  1L0O C;  1HKQ A;  4JX6 A;  4E7S A;  2F5E A;  2V4J C;  3SQN A;  3T5X A;  1W0U A;  4EJO A;  1W7P B;  2O8X A;  2W82 A;  4UVA A;  1VQ8 I;  2HWV A;  1JUP A;  1ZR2 A;  3AL0 B;  5K5R A;  2XAQ A;  3ASO H;  2V79 A;  2Z99 A;  3F21 A;  2VIX A;  1O7F A;  1WHU A;  4D7M A;  1FP1 D;  5FGM A;  4ENK A;  1OJL A;  2ZO4 A;  3K1M A;  2EWN A;  1ZHF A;  4HYE A;  2F4O B;  2M5W A;  5E8I A;  3KLN A;  2PJP A;  2O7O A;  4KJZ A;  2J5O A;  4OIQ F;  2KLO A;  4LB6 B;  3WG9 A;  1N75 A;  3IRQ A;  1KYZ A;  1W5T A;  2EPF A;  4WX9 A;  1HDD C;  2IBD A;  4UUV A;  2NOJ B;  2KDO A;  4KN7 X;  5DS9 A;  4HW0 A;  3LOC A;  2ISY A;  3VSL A;  5HOO A;  2UZK A;  2KJC A;  1MBH A;  4D5F A;  2BEO A;  2R7D A;  1LDK B;  3IL2 A;  4LG0 B;  3J7A Y;  4HZF A;  1G6N A;  3I9V 2;  5DUK A;  1DPU A;  1QZE A;  4PJ0 C;  3V8L A;  5IYD J;  4RBO A;  1B8I B;  4B8X A;  1R5G A;  2OAZ A;  2FXA A;  3TBI A;  1GV5 A;  2M0M A;  3TDU C;  4DYQ A;  2WAF A;  2Z1D A;  2COM A;  1IV8 A;  2BY3 A;  2IPQ X;  2A6T A;  3HKZ N;  4XLA A;  4C3I J;  2FUG 2;  1V5E A;  2CU7 A;  2QBY A;  1ZRF A;  2ZFW A;  3AFH A;  3DEE A;  3S2W A;  3VB2 A;  3HSR A;  5ILU A;  3KCC A;  4QPQ A;  4ENJ A;  1Z6T A;  1D8J A;  2Q8K A;  1I27 A;  2X0L A;  3CLO A;  1OYY A;  1OLT A;  4AC0 A;  3E97 A;  1BI1 A;  4RM2 A;  3JSO A;  3QU6 A;  1VI0 A;  1QGP A;  4EAT A;  2FML A;  2E2I J;  1POG A;  2QQA A;  1HC8 A;  3MCZ A;  5LGT A;  4XM3 A;  3TQN A;  3BG6 A;  1IGN A;  4BL0 B;  3FM5 A;  1S29 A;  4EV0 A;  4ENN A;  5F6F A;  2JUG A;  1LEB A;  1UJ8 A;  4M3D A;  1LEA A;  4UVB A;  2YR2 A;  1XB4 A;  2QQB A;  2R0Q C;  3OYM A;  1PJR A;  2DMN A;  2IJL A;  3QPS A;  2IS4 A;  4XKC A;  3OSG A;  1JKQ C;  3H5N A;  3I59 A;  4JP0 A;  4LG3 A;  4N9I A;  1VQN I;  2R7S A;  1V5F A;  2P6S A;  3CQZ J;  2FF4 A;  4B4C A;  5HDG A;  1T8I A;  1X1D A;  2VKD A;  2W4S A;  1ITY A;  4RGX A;  2F2E A;  5TJJ A;  2E5N A;  1FYM A;  1A35 A;  2E5Z A;  3BR1 A;  4G6D A;  1T0F A;  3L2Q A;  4BUP A;  2R7X A;  3ECH A;  2IRF G;  2EJR A;  3H36 A;  3IV5 A;  3ISP A;  1IXC A;  1M1E B;  2LR8 A;  1AA7 A;  4JK1 X;  1CF7 B;  4KIC A;  1I5Z A;  1NHA A;  3H35 A;  1JHF A;  4HF2 A;  1MBG A;  1XSX A;  1TQM A;  2L7F P;  3BLY A;  4BDZ A;  1MBK A;  1TWH J;  3G4S I;  1D8K A;  1QPM A;  1SFX A;  1VND A;  2O9L A;  5D5V B;  3WTS C;  1PYV A;  2WAD A;  2RNG A;  3TED A;  3KYC B;  2ZSI B;  3E7L A;  1P9Q C;  2V26 A;  2DBB A;  2PLY A;  1DP7 P;  2F6C A;  3ZMV A;  2OF7 A;  3JTH A;  4MIM A;  4CDG A;  1ZAR A;  3IH4 A;  3KZZ A;  5ICF A;  1U0J A;  3QOE A;  5C3E J;  5EG0 A;  1O57 A;  4HG2 A;  1S6L A;  1YW7 A;  1Y0U A;  4XLP F;  3H5R A;  4WK8 F;  3MKZ A;  3G71 I;  1O3R A;  1BR1 A;  4XKW A;  1Z77 A;  2VI6 A;  2P7C B;  3HOW J;  5GPA A;  2VJI A;  3KEY A;  5FRO A;  2RGV A;  4EJW A;  3KX2 A;  1NK2 P;  1FYL A;  1T33 A;  2DOF A;  4II2 A;  4M3G A;  4NBQ A;  3VDX A;  3D1N I;  2GOX B;  5M3F J;  4V2F A;  4A3F J;  2VOO A;  1UHM A;  4LLG F;  1YS7 A;  1UEL B;  3MKW B;  3CUO A;  1XD7 A;  1STZ A;  1NG7 A;  4AVP A;  1IAW A;  1I50 J;  2P5L C;  2UV1 A;  1UB9 A;  1C0W A;  1Z1D A;  2BOL A;  2ZJ2 A;  4C2M J;  3ZMS A;  1USS A;  4E70 A;  1MKM A;  1G8X A;  1V5G A;  3S1M J;  1YX5 A;  4IPA A;  3N4M A;  2CRG A;  1ZLJ A;  2EB7 A;  1TWF J;  2EFO A;  3CLQ A;  3BZC A;  4QLC U;  1WJF A;  1OCC H;  4A12 A;  2HQR A;  1QO0 D;  1G4D A;  3A2K A;  2Q2E A;  4A3B J;  2M4G A;  4A3L J;  4LD5 A;  1UST A;  3HM5 A;  2ME6 A;  1HKS A;  3QRF F;  5FLV A;  1W7P D;  2VON A;  4LK1 F;  3I53 A;  1JTY A;  4A0Y A;  2PMH A;  1XG1 A;  1ETY A;  2NVQ J;  3BCA A;  1YS6 A;  4MEX F;  4S0H B;  2NYX A;  2QLZ A;  3GFL A;  5E1X A;  3GFM A;  4E7Z A;  1I3Q J;  4F92 B;  2K9M A;  2WAQ A;  4PJN A;  1ZYR F;  2F4I A;  3D0S A;  2V9P A;  1GUU A;  1N25 A;  2LMD A;  3ZRG A;  2LF8 A;  5B1B H;  3PFY A;  2F5F A;  1FOW A;  1GVJ A;  2L2O A;  3FIW A;  4Z2Y A;  2LG4 A;  4BQN A;  1FOK A;  4BBS J;  3CP2 A;  2PX9 A;  2A6E F; 
#chains in the Genus database with same CATH homology
 1Z0X A;  3OIO A;  4NDL A;  2X6O A;  4A3M J;  2CUF A;  2WB1 N;  3H0G J;  2ZB9 A;  3BR5 A;  3TW7 A;  1ZR4 A;  2R7Z J;  2CJJ A;  5M5W J;  4IEJ A;  3GTO J;  5DTD A;  2R5Y B;  5EGO B;  3HOZ J;  3MKL A;  1HF0 A;  4ABZ A;  1AKH A;  1IDZ A;  1RES A;  2KDZ A;  1R9T J;  1S7E A;  1MH4 A;  4IHX A;  5EZG A;  1RPW A;  5K7F A;  3JRI A;  4X6A J;  3HBL A;  2M2E A;  3K7A J;  1GV2 A;  5IP9 J;  3S14 J;  4QIW N;  2E2H J;  2LTP A;  5FKK A;  1APL C;  1PUF A;  1ETO A;  3BQY A;  1JKP C;  1JKR C;  1RR7 A;  3BR2 A;  2G0E A;  1DU0 A;  1JUM A;  2LP0 A;  3LSR A;  2QF7 A;  3PO2 J;  1ETW A;  2HXO A;  4DZJ A;  1ETQ A;  4A3K J;  3FK6 A;  3BG3 A;  1JUS A;  1HCR A;  3JR9 A;  2HDD A;  1MBJ A;  2DA7 A;  5GP9 A;  2NVY J;  3VPR A;  5J1Y A;  2EZK A;  5J1U A;  3M3Y J;  2K9Q A;  1MBE A;  1MH3 A;  3S1R J;  1IV6 A;  2VUM J;  1GDT A;  2COB A;  1ZKG A;  1H8A C;  1LE8 B;  5FLM J;  4LOC A;  4B3A A;  3K2A A;  4G12 A;  4GFB A;  1QVU A;  2H1K A;  4MLO A;  3BTI A;  2MG4 A;  3QPL A;  5IOZ A;  2RAE A;  5M3M J;  4XID A;  2LKX A;  4XRS G;  1SAN A;  5C4J J;  2XPW A;  5IYC J;  2R5Z B;  5F0H A;  4Y7N J;  1MSF C;  5JLX A;  3FK7 A;  3W6V A;  4A3E J;  1WPK A;  5E3L A;  2JMW A;  2JA7 J;  3A01 B;  5EDN A;  3BR0 A;  2MSY A;  4DW6 A;  4XRS A;  1NK3 P;  3ZQG A;  5HOD A;  5IYB J;  4BBR J;  4A3I J;  1IDY A;  5FKM A;  1Y1W J;  1FIP A;  1WGX A;  1WH7 A;  2GBY A;  4FCY A;  4CYC A;  1DU6 A;  5EZH A;  9ANT A;  2XPV A;  1ZK8 A;  1B72 A;  1W0T A;  2XB0 X;  3JRF A;  4JX5 A;  4I76 A;  1RKW A;  1AU7 A;  3S1N J;  1P7I A;  1GT0 C;  2HOT A;  3Q0U A;  1ZTR A;  4V2G A;  4XRM A;  2Y31 A;  1X2M A;  4UUS A;  4FE4 A;  3UKG A;  3GTG J;  2YUS A;  3Q0W A;  1JKO C;  3A03 A;  4J19 A;  5E3N A;  1RKT A;  2X9D A;  3GTL J;  3ZQH A;  1MBF A;  2DA1 A;  2LK2 A;  1K83 J;  1RET A;  1ETX A;  1QVT A;  3LSJ A;  2JA6 J;  3JRH A;  3JRE A;  3S17 J;  4QSH A;  4DYC A;  1BW6 A;  2OPT A;  5J3L A;  1XC5 A;  3TW6 A;  2LVS A;  1IUF A;  1JJ8 C;  5IOY A;  2ME0 A;  1UMQ A;  2NOG A;  2MW8 A;  1FIA A;  4X1E A;  4HNV A;  1WCM J;  1G2H A;  4C3J J;  1JJ6 C;  2IEK A;  2K40 A;  2MGQ A;  4JX4 A;  2KT0 A;  5F08 A;  1ETK A;  4JYK A;  2DTZ A;  1JTX A;  1MSE C;  2DN0 A;  3O8H A;  2HQ5 A;  4M3F A;  2YS9 A;  4M3B A;  1IG7 A;  2Y9Z A;  3TP3 A;  2ID3 A;  2WAQ N;  3TP0 A;  3JRB A;  1D5Y A;  4IHV A;  4IHY A;  5FKO A;  4B1R A;  2LFB A;  1FEX A;  4XK4 A;  1QPI A;  2DJN A;  3HGY A;  5FKL A;  2JN6 A;  3S1Q J;  2VKE A;  1NTC A;  3FIS A;  2FD5 A;  2ECB A;  2FX0 A;  4W97 A;  2B63 J;  2DMU A;  2ELK A;  3C2B A;  5BNG A;  2CQX A;  3ZOB A;  3G1O A;  3A02 A;  2N8G A;  2DMP A;  2DA5 A;  2R5Y A;  2WV1 A;  5EGO A;  3I4M J;  1UHS A;  3LNQ A;  1JT6 A;  2TCT A;  1F36 A;  1OFC X;  3RKQ A;  3GTP J;  3HOU J;  5K7H A;  3B6C A;  1ETV A;  2ECC A;  5EG0 B;  2FQ4 A;  5F04 A;  3OOU A;  3GTJ J;  2LD5 A;  1CQT A;  2JJ7 A;  2K9S A;  5F27 A;  4BKX A;  2CQQ A;  2LY9 A;  4FIS A;  1IRZ A;  3HOV J;  4RDU A;  2JA5 J;  1EF4 A;  2VKV A;  4MFE A;  1LFU P;  5F0C A;  1OCT C;  2L7M P;  2LLK A;  3NAR A;  3BR6 A;  5IPA A;  1LFB A;  5M5X J;  3BR3 A;  4UUT A;  4JX6 A;  1K61 A;  1TC3 C;  4A93 J;  3RZO J;  3GTQ J;  3ZQL A;  2TRT A;  3SJM A;  1TWA J;  3MN2 A;  1W0U A;  5FKN A;  4A3J J;  2AO9 A;  1JUP A;  4MFD A;  1ZR2 A;  3GBG A;  3ZQI A;  3OSF A;  1FTZ A;  4D7M A;  2IAI A;  1OJL A;  2JK3 A;  1H88 C;  2M9H A;  3S16 J;  2R92 J;  3S2D J;  1OCP A;  5K7Z A;  2DMT A;  1LE8 A;  2O7O A;  1X58 A;  5EYR A;  4CYC B;  3S15 J;  1O4X A;  1HDD C;  1QRY A;  2IBD A;  4BXX J;  5DS9 A;  5F0F A;  3LOC A;  2R5Z A;  3H3V K;  4A3G J;  3BTC A;  1MBH A;  4D5F A;  5EEA A;  1T56 A;  2EZL A;  1Q1V A;  4DYR A;  5J1R A;  1BL0 A;  1MNM C;  5F1J A;  1P7J A;  3A01 A;  2VPR A;  1H89 C;  3BG5 A;  3BG9 A;  3CMY A;  2W48 A;  5IYD J;  4RBO A;  1B8I B;  4DYQ A;  1IJW C;  1GV5 A;  3B6A A;  2E1O A;  2E19 A;  1A5J A;  3HKZ N;  4C3I J;  2FJ1 A;  4D7N A;  3IH3 A;  3WHB A;  2CU7 A;  3BT9 A;  3JRD A;  5M5Y J;  1YRN B;  2NVX J;  1HDP A;  2DA6 A;  2HOS A;  2EZI A;  4A69 C;  2XGC A;  1X2N A;  4W1U A;  4AC0 A;  5E3M A;  1VI0 A;  2E2I J;  3F0C A;  1POG A;  1IGN A;  1FTT A;  2O8K A;  3Q0V A;  2Y0S N;  4M3D A;  3JRC A;  2L9R A;  2XPU A;  2XB5 A;  2HOA A;  1JGG A;  3M4O J;  1AKH B;  3HOY J;  2JA8 J;  2L7Z A;  2R0Q C;  1XS9 A;  1F43 A;  1WI3 A;  2DMN A;  2DA4 A;  3QPS A;  4A3D J;  2E2J J;  3OSG A;  1JKQ C;  2R93 J;  4JP0 A;  1TWG J;  3DEW A;  4A3C J;  4L5E A;  3CQZ J;  3BTL A;  1FJL A;  4BY1 J;  2YU9 J;  4B4C A;  3HEF A;  1ITY A;  1PUF B;  2HXI A;  3BR1 A;  2JWT A;  2P81 A;  3I4N J;  3CCY A;  3BQZ A;  2PMZ N;  3IV5 A;  2LR8 A;  3G1L A;  3RZD J;  1GVD A;  5JLW A;  2QCO A;  2DA2 A;  2ID6 A;  3ZQC A;  1MBG A;  1U9N A;  3GTM J;  2L7F P;  1ENH A;  1ORK A;  2XGE A;  3JRG A;  4M3E A;  3S2H J;  1MBK A;  1TWH J;  2NS8 A;  4XIC A;  1VND A;  2O9L A;  1I6H J;  2M0C A;  4DZP A;  1VF9 A;  2H8R A;  4IHW A;  3TED A;  1U78 A;  3LSG A;  1SFO J;  3E7L A;  2HYJ A;  1HLV A;  2GM4 A;  5C44 J;  2OF7 A;  1U8B A;  2L0K A;  4MIM A;  1AHD P;  1Y1V J;  3IH4 A;  5C3E J;  5EG0 A;  2AHQ A;  3PM1 A;  3HDD A;  2Y2Z A;  1Z77 A;  2VI6 A;  4EEF G;  2D5V A;  3HOW J;  5GPA A;  4MO7 A;  2Y30 A;  3SFI A;  3PO3 J;  1E3O C;  3DCF A;  4QTR A;  1HOM A;  1NK2 P;  3CDL A;  2NS7 A;  1T33 A;  4M3G A;  4FE7 A;  4M6V A;  3D1N I;  5M3F J;  3GTK J;  4V2F A;  4A3F J;  2EBI A;  1BJZ A;  3O8G A;  3JRA A;  2DA3 A;  1B72 B;  2EZH A;  2M34 A;  1I50 J;  3SDG A;  1UG2 A;  5FJ8 J;  1JT0 A;  4FTH A;  4C2M J;  4UUS B;  1U9O A;  3BTJ A;  3G1M A;  2DMQ A;  4Y52 J;  1TWC J;  4AUX A;  3ZQF A;  2X48 A;  2EH3 A;  3S1M J;  2CRG A;  3IH2 A;  3QQA A;  1TWF J;  2Y9Y A;  3HGG A;  3L1P A;  2I10 A;  5EF6 A;  2HI3 A;  5E3O A;  4D5C A;  1WH5 A;  3WHC A;  5IP7 J;  4I6Z A;  4A3B J;  2GLO A;  4A3L J;  3HM5 A;  2ME6 A;  1A6I A;  5FLV A;  1ZQ3 P;  1ZGW A;  3HB9 A;  1JTY A;  1XG1 A;  1ETY A;  2K9N A;  2XSD C;  2NVQ J;  4AYB N;  4C3H J;  2M8G X;  3HOX J;  1B8I A;  2XGD A;  5C4X J;  2CUE A;  1VFC A;  4S0H B;  4BY7 J;  1BA5 A;  3LSP A;  2EQR A;  2NVT J;  1I3Q J;  3MVP A;  1BW5 A;  1YRN A;  2XRL A;  1GUU A;  3RQI A;  5IP6 A;  3FKI J;  3NAU A;  3FIW A;  3Q3S A;  5GPC A;  4BBS J;  1IC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...