1WI9A

Solution structure of the pci domain from mouse hypothetical protein aah51541
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSSGSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Protein C20orf116 homolog
publication title Solution structure of the PCI domain from mouse hypothetical protein AAH51541
rcsb
source organism Mus musculus
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wi9A01
1XDSA 2GA2A 1D3YA 3GF2A 4LLLA 4LB5A 1J9IA 5BPDA 1XCBA 1TNTA 3R6SA 4KUMA 2K4BA 2J5OA 2FQ3A 3BDDA 4I01A 4OINF 3BPVA 3KFWX 2MC3A 4M9XA 4HOBA 3GZ5A 4QLCU 4G8XA 4A0ZA 2X0LA 3E6CC 2MD5A 4MNUA 3KP4A 3KP5A 4LG0A 2O8XA 1YW9A 2OBPA 2XGXA 2G7UA 5E8IA 3ZMTA 3E97A 2F2EA 3EUHA 2IA1A 1QNTA 4E70A 1FY7A 2VBYA 2IA2A 2VBZA 1J59A 4IRGA 3Q9VA 4ZYDA 2EK5A 4GYGA 2YR2A 2XVCA 2ZJ2A 3ZN0A 3JSOA 1G6NA 2LNBA 4A2UA 1ZH5A 3LQQA 1L0OC 5L3GA 1LDJA 2OZUA 1BC7C 2GA1A 1IXCA 2P5LC 5A2QK 2L4AA 3Q9SA 2YX7A 3RKWA 1HKTA 2D1VA 3RI4A 3WODF 3ISPA 3I54A 3CO7C 4LLGF 5IT3A 1SMYF 4UVAA 3B73A 1HQCA 1KA8A 3K9TA 1FBUA 3BY6A 1WI9A 4ZYHA 4FT8A 1MJ9A 1O3TA 3ZPLA 4U0VA 3RPUA 3BPXA 3P7NA 4P9FA 1Z05A 2ESHA 1SMTA 1P4WA 1S7OA 1K6OA 2FSWA 1S6LA 2XASA 3M8EA 3WGGA 3L7WA 2W84A 1HW2A 5AIQA 3F6OA 2UWMA 2P5VA 1YYVA 4TV7A 3IRQA 1DUXC 1PDNC 1DP7P 3VOEA 1NHAA 1TQIA 3F21A 2PQ8A 2E7XA 1ZREA 1D8JA 2KIUA 3FF5A 3H92A 5FFXA 3RTRA 5LGUA 2BYVE 2ZMEA 4IF4A 4RAZA 1R1TA 3KCCA 3CTAA 2O0YA 4ZYGA 4XSZF 5E18F 2DK8A 2VE8A 3C7JA 2ZMEB 4L18B 1J0RA 2GXGA 3U1DA 4L9JA 2D45A 1BI0A 1O3RA 3MFKA 4XBFA 4HAMA 3TOAA 1FP2A 1TQPA 3TO7A 4OIPF 2RN7A 4CDGA 1HSTA 5BQTA 2FMYA 4WF2A 3TOBA 1XGSA 1QBJA 4HBLA 3ZP5A 4G7ZF 5CLSA 4U7BA 1K78A 4GXOA 1RUOA 3BROA 1RI7A 1HKSA 3F6VA 4HQMA 4R8HA 4CYDA 4LJZF 2ADUA 3GFIA 3EDPA 4Z2YA 1TQMA 3GLXA 5CYVA 3FM3A 2NS0A 1UB9A 4KIGA 1H9GA 3VFZA 1EH6A 2O61A 5CVVA 2DU9A 3MCZA 1HXDA 1FYLA 3JAMZ 3E5QA 3IHUA 4OU0A 1IN8A 2WTEA 4UVBA 2ACJA 4RB0A 3GW2A 5DD4A 3KEOA 1XSDA 1K79A 1USTA 5H6RA 5TJJA 3QPTA 4CXFA 2PEXA 2QWWA 3V8LA 4A6DA 4N9IA 3F3XA 2K27A 4UV8A 1D5VA 1HBXG 3TDZC 3D5LA 4B8XA 4KFCA 2KIFA 5DCFA 4YFXF 4IRIA 4WCGA 4A12A 4M73A 4MEXF 1S7AA 5D6FA 2HQRA 2FEZA 4WWCA 5H6QA 4M74A 1F9NA 3U2RA 1PP7U 3TDUC 2RV8A 1XMKA 1RUNA 2EJRA 1W7PB 2FXAA 3PFIA 2Z33A 1BC8C 1LNWA 1LEBA 3OOPA 5DUIA 4XLPF 1R1UA 1QGPA 4PGHA 1FX7A 5LEJA 3HRMA 2CFXA 5D4RA 2EFPA 1TLHB 3DXJF 4GGGA 2PMUA 1SD6A 3O6BB 1MDMA 2VOPA 3DKWA 2EFOA 1S8NA 4WX9A 4Q4ZF 2DPDA 1Y0UA 2VN2A 3KZZA 1FP1D 2H27A 5JVTA 5LHHA 4MEYF 1T2KA 4L9VA 2MH9A 2ZNZA 5ILUA 4XSXF 2ZNYA 4L9TA 1IRGA 3FWEA 1J7KA 1PP8F 4U0YA 4RGXA 3IWZA 2V1XA 4A6EA 3WTWC 2Y75A 2V1DA 1G3WA 2P8TA 2F5EA 3IL2A 3F72A 5HLHA 4LK1F 3HTSB 3IC7A 1IW7F 2XRNA 1XMAA 2A3SA 4NB5A 1EH7A 2FU4A 3LQRA 5D5UB 2XAJA 1ZG3A 2GAUA 5K5OA 1QO0D 2OAZA 1P6RA 2V1UA 1R7JA 3MQ0A 5K1YA 4I09A 4N9HA 1U8RA 1SAXA 4WK8F 5HDNA 4OIOF 3E6MA 4H0EA 1DPRA 5CJ9A 2JPBA 5L3CA 2GZWA 3K2ZA 2Q8KA 1JE8A 1ZLKA 2E1CA 1FT9A 3BJAA 4RS8A 1T0FA 1J2XA 3CUQC 5LRRA 1VTNC 5ICFA 5DCMB 4ENMA 3I64A 5LBQA 2STWA 2XAHA 4HX7A 4AIJA 2XV4S 3QRFF 2K86A 3KE2A 1IN4A 3ELKA 2ZCWA 2Z3YA 4HQEA 3LA7A 2PI0A 3JTHA 4U0WA 1KU3A 3HRSA 4M71A 4LK0F 4PZJA 3EYIA 2QBYB 1DDNA 2Q0OA 2KJCA 3L2CA 1RZ4A 1AOYA 4IJAA 3J80Z 2W24A 2ISYA 5FD5A 5FGMA 3IKVA 3KZYA 3GWZA 1Q1HA 1BIBA 2A07F 1YO5C 2P7VB 3CJNA 3R61A 3CUOA 2ELHA 1IF1A 2WWYA 1UHWA 2ETHA 5L3EA 3MEXA 1F1ZA 1OYIA 2O03A 1RIOH 5J8CA 3PQKA 2W57A 1OYWA 3HSFA 1FLIA 3BZ6A 3ECOA 4A5MA 3V7RA 4HYEA 1U5TC 3I71A 1BJAA 5HDKA 5AONA 4FX4A 2RNJA 3CDHA 3F8MA 3RKYA 4I0AA 2IPQX 3HOTA 2YSRA 1H9TA 2MLGA 1ON1A 2BV6A 4JBAA 3IWFA 2HZTA 5ICEA 4RAYA 4BHPA 4IHTA 1XD7A 2YPRA 3MWMA 3ZMSA 3ZMVA 1USSA 4HDVA 1GVJA 3QU3A 2EV6A 5ICCA 3FHZA 1FC3A 1OR7A 2O6GE 1SFXA 5F1RA 3F8FA 3WTZA 2F5CA 1P2FA 4MTEA 4Q47A 3CUQB 2QYOA 3H3ZA 3E3VA 3WTTC 2BGCA 3E6DA 4Y15A 3QU6A 4KN7X 5FLXK 3P9KA 2IVMA 5BS6A 2EFQA 1FZPB 4IXAA 1OKRA 5D5VB 2JRTA 1IN5A 2HTJA 2LKPA 5J6XA 2MA3A 4F7ZA 2FOKA 3GYHX 5HOOA 1B9NA 4K2EA 2PJPA 1T98A 2HYGD 2UXXA 1W4MA 3HSEA 2R7FA 4EGYA 3T8RA 4AWXB 3FMRA 1T39A 2QQ9A 2QZ8A 5BMZA 5JFRA 1O57A 2HKOA 3BOQA 3R0AA 3T8TA 4G6QA 1JHHA 3SQNA 2HTSA 5E8GA 1IN7A 5A2QZ 3QP6A 2LDUA 3WGIA 2CW0F 1U5TB 4RGSA 2KIMA 2IJLA 3WTXC 4BXUA 2W25A 5HDGA 1Z6RA 4I2OA 3T5XA 1XGNA 4UV9A 4JQFA 5E20A 1ON2A 3LA3A 3I59B 4Y17A 1WKMA 4G9YA 3HUGA 4O5VA 1GXQA 3GVAA 4OOIA 5ED4A 2K4JA 4IPAA 4D0PA 2QUFA 1U6GA 2E7WA 3SZTA 2OU2A 5L3FA 3F22A 4CHUA 2A61A 3HSRA 2Z9OA 4M72A 5L3DA 3BWGA 3ZMZA 3IRRA 1SD5A 1XDUA 6PAXA 1UFMA 3N4MA 1STZA 4HLXA 3I53A 4ON0A 3LWFA 5D8LB 1MGTA 2P6TA 2CWEA 3DPTA 3K69A 2JPCA 2NYXA 3AAFA 1O3SA 5DEQA 3J81K 1YFHA 2M30A 3RIRA 4G7HF 2PN6A 2K7LA 3LFKA 4WXHA 3WTUC 4UVCA 2DO7A 4OIRF 4KIBA 3HYIA 2FF4A 1YS6A 3ROUA 4ESJA 1ZARA 2LF7A 5D4SA 4OMZA 1KGSA 2O3FA 2VT2A 2MLKA 1MJAA 2K02A 2BBYA 2EFNA 4EJWA 3C1DA 4YIIA 4M9ZA 2HQNA 1CF7A 4XRFA 1XSVA 2RKHA 2WV0A 4IHSA 2MH2A 4MQVA 5L3BA 2FBHA 4HLYA 1KU2A 1QPMA 1CF7B 2CG4A 4BHCA 1KU9A 5D5XB 1Z1DA 4BH9A 3NQOA 4Y13A 1GHCA 2FA5A 3EQLF 2VONA 3QP5A 3CLOA 4GYIA 1LDKB 1R36A 2B0LA 4L0ZB 1O7LA 2CGPA 4AVPA 2HDCA 4RB2C 4EQQA 1S3JA 3KP6A 5TRDA 1FYMA 1KYWA 3WTVC 2HKXA 3M1EA 2IP2A 5DUKA 4CO8A 3WTYC 4MQ9F 4P96A 1IAWA 3C3WA 5JI6A 1Z6TA 2BEOA 2XAGA 3ABTA 4LLNA 4MGRA 4RGUA 2VT3A 1W7PA 4FHTA 2RVCA 3F8CA 1FBQA 2ESNA 3V7CA 1C0WA 3K1PA 1B4AA 1P4XA 2V6CA 3DV8A 4UNOA 3HOSA 1YS7A 4RB1A 1I1GA 4EM0B 2E1NA 2VODA 1REPC 2PBIA 2OZ6A 1EH8A 3K1MA 5AIPA 4MHGA 3O3KA 1IUYA 4AD9A 2R7DA 4I7HA 1F5TA 3V8JA 3MZYA 3TGNA 2DT5A 4PGGA 1ZGJA 4CGZA 5LGTA 4A0YA 1FSHA 5JHUA 1ONVA 4IRHA 3L09A 3F8BA 5DYMA 2VC1A 4KN4X 4ZYEA 2RC4A 4ESFA 1LQ1A 3SFZA 2XAQA 2DLLA 3FZVA 3H3UA 2CSOA 1ZRFA 4OMYA 1A04A 1KYZA 2P4WA 3NRVA 3P9CA 2NNYA 1R22A 1IXSB 3M9AA 3DP7A 2DW4A 5CVIA 4EM1A 2L01A 4UHTA 2XROA 3S2WA 2GXBA 1K7AA 2DI3A 2RGVA 5IT9K 1JXSA 3GXOA 3HRTA 5K5RA 5DCMA 1BOAA 3HTUA 3RPQA 3J7AO 2FRHA 1S29A 2EA2A 1ZLJA 1D8KA 2XAFA 1YTYA 4KDPA 3D0SA 1J5YA 3U9GA 2VBWA 4EM2A 1ZG1A 5K5QA 1TTYA 4M9SA 3Q5FA 2PG4A 2QBYA 5F6FA 1W7PD 1HKQA 3FXQA 2YU3A 1HSJA 2XKPA 2A68F 5BOXA 1WQ2A 1BIAA 2H94A 1Z9CA 3KETA 1EV7A 1G3TA 1XGOA 2M5WA 2EWNA 5LLQA 1LB2A 3G3ZA 2RQPA 2G9WA 3V4GA 3FXUA 5BPIA 2L02A 1B9MA 5FD6A 1YG2A 2KRFA 4U88A 1IRFA 4ZZDA 1FYKA 2EB7A 2YX4A 4HA8A 2F5FA 4KICA 1O7FA 4BAYA 1OMIA 3R0JA 2WC2A 4AIKA 4M6XA 3CO6C 2AS5F 3F23A 4DNCA 3RJPA 2M87A 3JTGA 1FPQA 1W5TA 2OQRA 5LRSA 5LHGA 4WXCA 4P55A 3RYPA 2HR3A 1R23A 3WE2A 1WSUA 3CUQA 1O3QA 5ICGA 2FBIA 2C6YA 2JSCA 1XCVA 3TQNA 2LSOA 4DQ2A 3QAHA 4EGZA 3MZHA 2HFHA 2H6CA 1OYYA 2OQGA 3TO6A 4YIFA 4M6YA 4KMFA 3KP7A 4EJVA 2GWRA 3EETA 1LEAA 2DK5A 3E5UA 1U78A 1SD4A 4WXDA 2PLYA 5CVJA 2CO5A 4RB3C 5FLXZ 1HW5A 5KK1A 3KP2A 1JHFA 3NEUA 2TDXA 1BN5A 4NHJA 3O2PE 2V79A 2UZKA 2DBBA 2M8EA 2P5KA 3WU1B 4LG0B 2IT0A 1RNLA 2ZBKA 4LMYA 1KQ0A 3WG9A 3ERED 2MBFA 1YIOA 1U5TA 3E5XA 2EV0A 3F8NA 2Z99A 3DEUA 3KLOA 5HLIA 1LJ9A 2BE5F 5HS8A 1MD0A 3L9FA 1FBSA 2VOOA 2GIVA 3I59A 1G4DA 3TKYA 5LGNA 1IXRC 2P6SA 3JSPA 4EJOA 4U7DA 2EFWA 3REOA 1U2WA 4KYWA 3SHFA 2F5DA 1E2XA 5HVQC 1B1BA 2L54A 3DQVC 3SXYA 1P4AA 1T6SA 4ESBA 3TO9A 4XLNF 2IRFG 4EVIA 2Z5UA 5CVUA 3ZN1A 1ZRDA 1W5SA 5E1WA 4P5OA 4HDUA 3GFLA 4EJUA 2DPUA 1I5ZA 4AIHA 4UUVA 3KLNA 1MKMA 1HW1A 2ZFWA 4PCQA 3COAC 2CQKA 2UXNA 1ULYA 2FNPA 3ECHA 3R4KA 4NQWA 2PFBA 1P92A 1F4KA 1B59A 2ZO4A 2G7HA 5KVRA 2A5YB 1XGMA 4G94A 5DV5A 2D2WA 4S05A 1TW3A 2QM3A 3FM5A 3K0LA 3HIFA 3HHGA 2P7CB 2L4MA 3M8FA 1G3YA 3ABUA 3I58A 4ENKA 3LSTA 3QPHA 3GZ6A 1XB4A 3J81Z 1OPCA 2HYFA 3WTSC 1UHMA 4ENJA 2DQLA 4L5IA 1XSXA 1FSEA 1LDDA 1KQ8A 1YLFA 2H6BA 4YFNF 2HEOA 2PMHA 1UCRA 4YG2F 4R1HA 3DPLC 3HRUA 2RDPA 3FX3A 4A0XA 2OA4A 3B02A 3ZQ7A 2NNNA 5FO5A 4BQAA 2A69F 1ZYRF 2R3SA 1T38A 1V4RA 5FB2A 2Y48A 1IZ1A 1WRJA 3WU0A 5D8KB 5E17F 2FE3A 5J8FA 1XN7A 1K78B 3MAJA 4LD5A 2IW5A 3JAMK 1Z7UA 3VB2A 3DF8A 3M7GA 2ZXJA 3BP8A 3V8KA 5CVRA 1TW2A 3E6BA 1YQAA 4I0BA 2DQRA 3FMQA 2VBXA 1WWXA 3FXRA 1ZAOA 2HGCA 2XIGA 3QOPA 1ZRCA 3P9IA 4I98B 3GX4X 1ODDA 4I02A 2D1HA 4N0BA 4B09A 1TNSA 2EV5A 2XKOA 3N97A 1JGSA 4LGWA 2DAOA 2COMA 1GXPA 4FX0A 5E1ZB 4BHBA 3LAJA 3V7SA 1I6XA 2DFIA 2ZKZA 5DDGA 1ZG5A 2XUBA 4HZFA 4HF0A 4HV6A 5FFZA 5HLGA 4HX4A 3KP3A 4LB6B 1KQ9A 2A6EF 1SD7A 4GCVA 4P9UA 1BI1A 1BM9A 1V3FA 1BI2A 2QVOA 3VEPA 3GEZA 4OIQF 3W6KB 1IN6A 4KIFA 3WGHA 5DD8A 2LF8A 3OV8A 3DFGA 3RKXA 1I1SA 2JZYA 1TBXA 3FMSA 2H09A 2QLZA 4CZZA 4KA4A 5ILSA 4KMUX 4O3MA 1QZZA 1MZBA 1BBYA 5EEHA 2JTVA 5D6EA 2QQBA 2M1BA 2HS5A 2XHKA 4HV5A 3GUDA 4BYYA 1MDMB 4L5JA 3W6JB 5LEKA 4L0YB 4RGRA 2J5PA 3GFJA 3BJ6A 2X4HA 4HF1A 3G73A 2Q2EA 1G3SA 3T0YA 1DPUA 1U3EM 3C18A 3ML6A 3LA2A 1SFEA 3I0TA 1FWZA 4G6DA 4MTDA 3I4PA 3RDIA 3BJOA 1CGPA 4CICA 2DTRA 1FOKA 2FMLA 2FBKA 4Q5SF 4ZH4F 5EEGA 2CYYA 1R5HA 5E1XA 1BI3A 5ILVA 2NAZA 2A6HF 3JW4A 4S04A 4EV0A 3RYRA 5HS9A 3ZMUA 3L00A 5IT9Z 2KKOA 1H0MA 4HX8A 1QZYA 5D5WB 3VODA 4ENNA 3GO5A 2ISZA 1ZGAA 2VXZA 4QWQA 4EMSA 2W85A 5F64A 1R5GA 3WE3A 1MJBA 3T1BA 4R79A 1KU7A 2EA4A 5H20A 2Y0MA 3GFMA 4EJTA 3R60A 1AWCA 4KNYA 1J75A 4LFUA 2STTA 4L9NA 1E17A 4ETSA 3J80K 1Z91A 2L3DA 1R00A 2QENA 2GQQA 4A5NA 2KJBA 4YFKF 2NRAC 4JK1X 3I5UA 2V9VA 3ULQB 2FNAA 2AXLA 1R58A 3SZPA 4HF2A 3ZMDA 3HHHA 4IVNA 4KT5C 4GO1A 1LVAA 1QQIA 4UXNA 3EYYA 1PUEE 1ZN2A 4G7OF 1R1VA 1X3UA 4Q48A 5JR3A 1SFUA 5HS7A 2JT1A 2VC0A 2OD5A 1B6AA 4BNCA 3K1NA 4PDKA 4HW0A 2HOEA 1YW7A 4ZZLA 3LAPA 4O6JA 1FNNA 5ERIA 1YW8A 1L3LA 2M45A 2VE9A 2HWVA 2QQAA 3KEQA 2IA0A 5LHIA 1ZHFA 1I27A 4ASNA 3IKTA 3PQJA
chains in the Genus database with same CATH superfamily
5FLMJ 4NC7A 1XDSA 2GA2A 4XKWA 2XPWA 2LVSA 1D3YA 2ZXWH 3GF2A 4LLLA 2VQLA 1JJ8C 4LB5A 1J9IA 2PMZA 5BPDA 4RLQA 3BCBA 2KDOA 1XCBA 3BLYA 1TNTA 3R6SA 1TT0A 4KUMA 2K4BA 4IOCF 2J5OA 5EG0B 3VYSB 2LBFA 2FQ3A 3BDDA 1XPXA 3GTPJ 4I01A 4OINF 3CJRB 1K61A 3BPVA 3KFWX 2LY9A 3MKWB 2MC3A 1MW7A 4XOTA 4EEFG 4M9XA 4BUPA 1JJ6C 4HOBA 2LP0A 2V4JC 2LBFB 5JLWA 3TEDA 3GZ5A 1DGWY 5FRNA 4RBOA 2FQ4A 2R7SA 1BR2A 4QLCU 5GPCA 4A3FJ 4G8XA 3PL8A 4A0ZA 2X0LA 1Z67A 3E6CC 1A31A 2MD5A 4MNUA 3KP4A 3KP5A 4XOPA 1IC8A 2AQFA 3DBHB 5HODA 3SFIA 4LG0A 2O8XA 3SDGA 1YW9A 2OBPA 2JUCA 2XGXA 2G7UA 2BXYA 3LSJA 4OAZA 5E8IA 3L2QA 3RZOJ 3ZMTA 3E97A 2F2EA 3A02A 2IA1A 3EUHA 2CV2A 2MGQA 2NS7A 5J1YA 1S72I 1QNTA 4IL6C 4E70A 1FY7A 2VBYA 1DU6A 3AL0C 2IA2A 2VBZA 2ZMEC 1J59A 4IRGA 3Q9VA 4ZYDA 2EK5A 1VZ0A 5F08A 4GYGA 2WB1N 3BZKA 2YR2A 2XVCA 1OCPA 3E7LA 2ZJ2A 3ZN0A 3JSOA 1G6NA 2LNBA 4A2UA 3H35A 1FTZA 1ZH5A 3RZDJ 3LQQA 1L0OC 5EJCA 5L3GA 1LDJA 2OZUA 2XGEA 2Z2SB 4N4NB 3OYKA 4J00A 2GA1A 1IXCA 4B1RA 2P5LC 5A2QK 1BC7C 2L4AA 2JMWA 3Q9SA 4AM3A 1X4OA 3CMAI 2M0CA 1Z0XA 2VUMJ 3OR1C 2YX7A 1WVRA 4BU2A 3RKWA 1HKTA 2D1VA 3RI4A 3WODF 3ISPA 1E3OC 1MMDA 1WJEA 3I54A 4NC8A 1NTCA 4LLGF 5IT3A 3CO7C 1SMYF 3ZQLA 2XB5A 1PVEA 3SJMA 2QKLB 2WAQN 4UVAA 3PFYA 2ZC2A 3B73A 1HQCA 3OY9A 1TL8A 1OFCX 3MKYB 1KA8A 3K9TA 1FBUA 3BY6A 1WI9A 4ZYHA 2JK3A 4FT8A 3NWSA 1MJ9A 4FISA 2KFDA 1T8IA 4FE4A 3K2AA 3L2RA 1O3TA 3WU2C 1POGA 2VXDA 3JRGA 2B9SA 3ZPLA 4B47A 3DCFA 4U0VA 2DCEA 5F04A 3RPUA 3BPXA 4XKCA 3P7NA 4DIQA 4P9FA 5CQGA 1Z05A 1ETWA 2ESHA 2V26A 3PO3J 4B3AA 3BQZA 2ZJQF 1SMTA 2H1KA 3LSKA 1P4WA 1S7OA 1K6OA 2FSWA 1S6LA 2XASA 3LSMA 3M8EA 3WGGA 1HLVA 1ZR2A 3L7WA 1LUJB 2W84A 1R9TJ 1HW2A 5AIQA 3F6OA 1AA7A 2UWMA 2P5VA 3GTGJ 1YYVA 4TV7A 3IRQA 1DUXC 1PDNC 1JUMA 1JI8A 1DP7P 2KQRA 3U21A 3VOEA 3DKYA 1MBEA 3PQJA 2EZHA 1NHAA 1TQIA 3DU5A 1VQPI 4E7KA 2WADA 3F21A 2LKXA 1JUPA 2PQ8A 1W36C 2E7XA 2KRHA 1ZREA 3KEYA 1D8JA 2KIUA 4DZPA 3FF5A 2LREA 3H92A 4XN0A 4BGDA 1W0UA 1SANA 2MFZA 4G12A 2TCTA 5GTIC 5FFXA 4X6AJ 2KZVA 3GMEA 3RTRA 1P7JA 5LGUA 1B72A 2BYVE 2ZMEA 4IF4A 4RAZA 3QODA 4XK4A 1U9NA 4JP0A 5C4JJ 2K9NA 1R1TA 3KCCA 3CTAA 2O0YA 4ZYGA 1LFBA 3OYEA 2LK2A 1TZLA 5FLVA 3HZJA 2JJ7A 4XSZF 5E18F 2X6OA 2DK8A 2VE8A 3AL0B 4UB6C 3WG7H 3C7JA 2ZMEB 4L18B 4I99C 1J0RA 2GXGA 2XPVA 3U1DA 2L7MP 3AFHA 3G4SI 4L9JA 2CW8A 2D45A 3ERMA 1BI0A 1O3RA 3MFKA 2QF7A 4XBFA 4HAMA 3TOAA 3CESA 4BJTA 1X3ZB 1FP2A 1ETOA 1TQPA 2WBMA 5JLXA 3TO7A 4OIPF 2RN7A 2K9LA 4CDGA 1HSTA 5BQTA 1I3AA 2FMYA 3D1NI 2F4IA 1JGGA 4WF2A 4YRVA 3OMYA 3TOBA 1SVOA 5JHFA 1XGSA 1QBJA 4HBLA 1K4SA 4FETA 3ZP5A 4G7ZF 3H0DA 2XF5A 3HC7A 2F4OB 5CLSA 4U7BA 1K78A 4GXOA 1RUOA 3BROA 1RI7A 5K7HA 1HKSA 4M3DA 3F6VA 4HQMA 4OAYA 3PUFA 4R8HA 1SEUA 4CYDA 4LJZF 1UAAA 5DM6F 2ADUA 3GFIA 3EDPA 5LFAA 1CQTA 3HJEA 4A3EJ 4Z2YA 1TQMA 3GLXA 5CYVA 3FM3A 3OS1A 4PJMA 2Y9ZA 2NS0A 3FXKA 1UB9A 4HNUA 4CCOA 4KIGA 2R7VA 1H9GA 1B8IA 3VFZA 1EJ9A 2IAIA 1EH6A 4DYRA 2O61A 5CVVA 2DU9A 1N78A 3MCZA 1HXDA 2JA5J 1FYLA 1V5FA 4CCLA 3JAMZ 3E5QA 2IXSA 3IHUA 4OU0A 1IN8A 1YRNA 4V2FA 5IYBJ 5C3EJ 2R5YA 2WTEA 4UVBA 4AC0A 2ACJA 1B8IB 3OYFA 4RB0A 3HKZA 2JA7J 1MBFA 4RMNA 3GW2A 5DD4A 3KEOA 5EYRA 1XSDA 1K79A 1USTA 3OL3A 5H6RA 1JKPC 5TJJA 3RPUD 3G1LA 1IJWC 3ZQCA 3PSFA 4DW6A 4IHVA 3QPTA 5J3LA 2DOFA 2HQ5A 4CXFA 2PEXA 2X6XA 2QWWA 3V8LA 3PO2J 3GZNB 4A6DA 3S2HJ 4N9IA 3F3XA 5DS9A 2K27A 1JKOC 4UV8A 1QU3A 2DTZA 1D5VA 1HBXG 2E5ZA 3TDZC 1WGXA 2CJJA 5IYDJ 2P0WA 4RM3A 2VQCA 3RKQA 3W2VA 3D5LA 4B8XA 3FK7A 2ZXIA 2LR8A 3EUAA 4KFCA 3H5RA 2KIFA 5DCFA 2ID6A 4YFXF 4IRIA 4WCGA 1Y39A 4HSTA 3IP4B 2D5VA 4A12A 4M73A 1MBJA 5K7FA 1S7AA 3LFUA 4MEXF 2EZIA 1YJNI 3SDBA 3MN2A 5D6FA 1SVMA 5E3MA 3JREA 3CZ6A 2HQRA 2FEZA 1IV6A 2DODA 1VQLI 2COBA 4WWCA 5H6QA 4M74A 1F9NA 3U2RA 1NK2P 2NVTJ 1PP7U 2Q1ZB 3H0GJ 2X85A 2RV8A 3TDUC 3ZQFA 5GADJ 1XMKA 1RUNA 3U1KA 2E1MC 2EJRA 2OTJI 1W7PB 2FXAA 4UUSA 3DKXA 3PFIA 5F1JA 2Z33A 1BC8C 1LNWA 1MBHA 1LEBA 3E0JB 3OOPA 3CLQA 5DUIA 4XN3A 4XLPF 1R1UA 4GDFA 1V54H 1R4MB 3G6EI 2R7WA 2JA6J 1VQ5I 2CMPA 1QGPA 4A3BJ 4PGHA 1FX7A 5LEJA 3HRMA 1MNMC 3ONQA 2CFXA 4UUSB 1T0FC 5D4RA 3S1QJ 2EFPA 1TLHB 3DXJF 4GGGA 2PMUA 1MSEC 4AYBN 3K70D 1SD6A 3O6BB 3ZOBA 1MDMA 2VOPA 3DKWA 2EFOA 1S8NA 2EIJH 4WX9A 4Q4ZF 2DPDA 4B48A 1Y0UA 1JKQC 2KLOA 2VN2A 3MKZA 2VIXA 4XLEA 5IOZA 1K4TA 3NAUA 3KZZA 4A93J 1FP1D 2H27A 5JVTA 4B4CA 5LHHA 4MEYF 1T2KA 4L9VA 1Y1VJ 2MH9A 4HSRA 1RKTA 4M3GA 3CCJI 2ZNZA 1MH3A 4XLHA 5J4VA 4GRIA 4D5FA 3BG5A 2DFFA 1X1BA 2LY1A 3RQ4A 5ILUA 4XSXF 2ZNYA 4L9TA 5B66C 1IRGA 3FWEA 1J7KA 1PP8F 3QWLA 4IOAF 4U0YA 2LOOA 4RGXA 3IWZA 2V1XA 3HOZJ 3AG1H 3AG3H 4A6EA 3WTWC 2Y75A 2Y0SN 2GBYA 3OYIA 2V1DA 2FJ1A 1G3WA 2P8TA 2VKEA 2F5EA 3IL2A 2OTLI 3F72A 5HLHA 2XGDA 4LK1F 1G8XA 3JRCA 3K7AJ 3HTSB 3IC7A 1IW7F 2XRNA 4CA0A 1IDYA 1XMAA 2A3SA 3C2BA 4NB5A 1EH7A 2FU4A 3LQRA 5D5UB 2XAJA 3CD6I 1ZG3A 4XLAA 2VJJA 2GAUA 4DOZA 5K5OA 1W36D 1QO0D 2OAZA 1LE8A 1P6RA 3H1CA 2V1UA 1R7JA 3MQ0A 4HPQA 5K1YA 3CCUI 3I4NJ 4I09A 4N9HA 2KHMA 1U8RA 1SAXA 4WK8F 5HDNA 4OIOF 3E6MA 4H0EA 1DPRA 4NC6A 4BBSJ 1RETA 2A05A 3BTCA 4X0GA 5CJ9A 2JPBA 5EZGA 5L3CA 2GZWA 4BKXA 2DYSH 3K2ZA 2Q8KA 1A35A 3TMOA 1JE8A 1ZLKA 2CRGA 2E5NA 3W2WA 2E1CA 2Y2ZA 1FT9A 4NUBA 1VNDA 4E7JA 1QVTA 3BJAA 4Y52J 2E1MB 2XF6A 2BY1A 3DLAA 2L7FP 3OYBA 2W82A 4RS8A 1T0FA 2FD5A 1J2XA 2OC6A 3CUQC 5LRRA 1VQ4I 3K4BA 1VTNC 5ICFA 5DCMB 4ENMA 3I64A 3UNGC 4X1EA 5J47A 2BY2A 5LBQA 3ZCOA 1OR7C 4BE1A 4XL9A 4BQOA 2STWA 2XAHA 2PX9A 4HX7A 1BW6A 4AIJA 2XV4S 1D1AA 3FXOA 3QRFF 3S3NA 2K86A 3KE2A 5GTHC 3HXLA 5GAHJ 1PUFB 1IN4A 3ELKA 2ZCWA 1GVDA 2Z3YA 4XICA 2M3AA 4HQEA 3L2UA 4MIMA 3LA7A 2PI0A 2V9KA 3JTHA 4U0WA 1KU3A 3HRSA 2GM4A 4M71A 4LK0F 4PZJA 3EYIA 2QBYB 4PJJA 3K6GA 1DDNA 2Q0OA 1MNEA 2KJCA 3HGYA 3L2CA 1RZ4A 1W1WE 1AOYA 4IJAA 4RM2A 3J80Z 3KIOA 1DU0A 2ZFUA 2W24A 2ISYA 3H9GA 5FD5A 3CJQB 5FGMA 3I9V2 3OYJA 3IKVA 3KZYA 3GWZA 1Q1HA 1TWHJ 1BIBA 2A07F 2AXTC 2YS9A 3S1NJ 1YO5C 2E19A 3CJNA 2P7VB 2F6CA 3FK6A 1UG2A 2ELHA 3BG9A 3CUOA 3IH4A 2WWYA 1IF1A 2ETHA 1V5GA 1SC7A 3PNYA 1VQ8I 5L3EA 1TC3C 3TL4X 3MEXA 4AU7A 1F1ZA 1OYIA 4MFEA 4QTRA 3GTOJ 3VYUB 2EIKH 2O03A 5CPRB 2X9DA 1RIOH 5J8CA 3PQKA 4ZDLA 2W57A 1OYWA 2R4GA 3HSFA 1HCRA 1VQKI 1FLIA 2O7OA 3OYDA 1MMNA 3BZ6A 3ECOA 4A5MA 1P9QC 1BOBA 2EIMH 3V7RA 4C9YA 4HYEA 1U5TC 3I71A 1BJAA 2L7ZA 3DU6A 5HDKA 2V1NA 2XB0X 2DMNA 5AONA 3M4OJ 2NOJB 4FX4A 2RNJA 3CDHA 3F8MA 2RREA 3RKYA 3H9JA 2IPQX 2K9SA 4I0AA 5DTDA 1GDTA 1EKEA 3HOTA 2DFHA 2YSRA 1H9TA 4BL0B 2MLGA 5EG0A 1ON1A 2ZJRF 2BV6A 4JBAA 3IWFA 2HZTA 5C44J 4KJZA 3CMMA 5ICEA 3D5SC 3A01B 4RAYA 5EZHA 1IUFA 4BHPA 4IHTA 1XD7A 2E71A 2YPRA 1GUUA 3H5AA 3MWMA 3ZMSA 4W97A 2DMUA 3ZMVA 1USSA 4HDVA 2WV1A 1GVJA 3QU3A 4KT6A 1YHQI 2EV6A 1D0XA 5ICCA 3FHZA 3QYEA 1JTYA 4RDUA 1WH7A 3MKLA 4E7LA 1FC3A 3S14J 3OYGA 1OR7A 4LITA 2O6GE 3CC7I 1SFXA 1X3WB 5F1RA 3F8FA 3WTZA 2F5CA 3CC2I 3J7YJ 2VQGA 5FKKA 3JRHA 1P2FA 4MTEA 4Q47A 3CUQB 2QYOA 4XQFA 3MVPA 3LSRA 3H3ZA 3E3VA 4ANJA 3WTTC 2Z16A 2JSPA 2Y31A 2BGCA 3E6DA 3BR5A 4Y15A 3QU6A 2JUGA 4KN7X 3VYTB 3IV5A 3IUOA 2QSGX 3JRFA 5FLXK 3P9KA 2IVMA 3H36A 2B7EA 5BS6A 3M8JA 2EFQA 3DTEA 1FZPB 1WJBA 2K3PA 3H5NA 1EA3A 1OKRA 4IXAA 5EGOB 2HOAA 2CUJA 5D5VB 3FXLA 2JRTA 1IN5A 1GLNA 4UY8I 2HTJA 2LKPA 1OCRH 5J6XA 3LNQA 2MA3A 2QQ8A 4F7ZA 2FOKA 4UUTA 5CKTA 5HOOA 1B9NA 4K2EA 3GYHX 1T98A 2PJPA 2HYGD 2UXXA 4PFPA 1EF4A 1W4MA 2W4SA 3CP8A 4FTHA 4Y4RA 3HSEA 2V6EA 3L2VA 3BR1A 2FOWA 2R7FA 1N75A 4EGYA 1WJ5A 1MBGA 3T8RA 2HXIA 4AVZA 4AWXB 9ANTA 2GLOA 5B1BH 3LSPA 3FMRA 1T39A 2QQ9A 2QZ8A 2R7OA 5BMZA 2E2JJ 3ASNH 2DMQA 5M5YJ 2VJIA 5JFRA 3DBLB 2L2OA 3AG2H 3PIOF 1O57A 2HKOA 2CQ7A 3BOQA 3R0AA 3T8TA 2DA5A 4G6QA 3SEQA 2Z1DA 1WHUA 1JHHA 3SQNA 4BS9A 2MABA 1FJLA 2HTSA 4E4HA 5E8GA 1IN7A 5A2QZ 3QP6A 2LDUA 2ME0A 3OYCA 2NVXJ 2N8GA 3WGIA 4E7SA 4AIDA 2CW0F 1U5TB 2H8WA 4RGSA 3R61A 2LMDA 2M8GX 2KIMA 2HVQA 5EDNA 2IJLA 1QHHD 3WTXC 2R7ZJ 1UMQA 4XLFA 4BXUA 2W25A 1A36A 5JVGF 2XAUA 5HDGA 1Z6RA 2CQQA 4I2OA 3E1SA 3T5XA 1XGNA 4UV9A 2DJIA 1KZHA 4JQFA 5E20A 4IHYA 1ON2A 3LA3A 2HDDA 3I59B 2M4KA 3I3LA 4Y17A 1WKMA 1X1PA 4G9YA 5IP7J 2EBIA 3HUGA 1BA5A 4O5VA 1QPIA 4Z6YA 1DGRM 1GXQA 3GVAA 4BQNA 4OOIA 5ED4A 5LD2C 2L9SA 2JRMA 4I6ZA 2VL8A 4Y7NJ 3MZ8A 2K4JA 4G6TB 4XLCA 4IPAA 5KNLA 3D5RC 2QEXI 3HUGB 3OIOA 4D0PA 2QUFA 1U6GA 3S3OA 1S7EA 1ETVA 3CF2A 2E7WA 3SZTA 4MFDA 2OU2A 4FQGA 3DEWA 5L3FA 3F22A 4QPOA 1TP4A 1R4NB 4CHUA 2VJ5A 1PYVA 2A61A 3HSRA 3KX2A 1MSFC 2HVRA 2Z9OA 3Q0UA 4IO9F 4M72A 5L3DA 1V5EA 3BWGA 3ZMZA 3IRRA 2MW8A 1SD5A 1XDUA 2EQRA 3L1PA 6PAXA 2PMZN 1I50J 1UFMA 4S0HB 1X58A 3N4MA 1STZA 2YU9J 1BL0A 2L9NA 2XF7A 1S9HA 4D7NA 4HLXA 3HL2A 3S17J 3I53A 3S8PA 2E2IJ 4C3HJ 4ON0A 3LWFA 1YX3A 2VASA 2QSFX 5D8LB 1MGTA 2P6TA 1Y56A 2CWEA 1MMSA 3DPTA 2M9HA 3K69A 2JPCA 2ZSIB 2NYXA 3AAFA 1O3SA 5DEQA 3FBIB 3J81K 4M6VA 3RQIA 3I56I 3C2GA 1WCMJ 1ETYA 2X1EA 3KYLA 2HXOA 4XRSG 1YFHA 3CCRI 2M30A 1AU7A 1MNDA 2AHQA 3RIRA 4G7HF 2PN6A 5J4YA 2K7LA 2L7KA 1A6QA 1VI0A 3LFKA 4WXHA 3WTUC 1AHDP 1Y6IA 4UVCA 2DO7A 4DYQA 4A3CJ 2K9MA 4OIRF 4KIBA 2K5CA 3VPRA 4U87A 3HYIA 3MD2A 2E2HJ 1FMVA 1OCZH 3HBLA 2FF4A 1JT6A 1ETXA 1YS6A 3BZCA 3ROUA 4ESJA 1ZARA 2LF7A 3BTLA 4C2TA 5D4SA 1UJ8A 4OMZA 3CMYA 4XMYA 2W7NA 4BXXJ 3ESWB 4QPQA 2EZLA 2BOLA 1KGSA 2O3FA 1K6YA 4YIRX 2VT2A 4BJ6C 2MLKA 1MJAA 2K02A 3WHBA 2M4GA 2BBYA 2EFNA 3B6CA 4PJ0C 5M3MJ 4EJWA 2Y9YA 3C1DA 4YIIA 1Z77A 4M9ZA 4MO7A 4ZDPA 1I39A 5EEAA 4BDYA 2H8RA 2BZTA 4PUSA 2HQNA 3HEFA 2CUFA 4PJNA 1CF7A 4XRFA 1XSVA 1IV8A 2RKHA 2WV0A 3S32A 3A0BC 4XRSA 2MH2A 4MQVA 4IHSA 5L3BA 2FBHA 4HLYA 1KU2A 3M1CA 2HOTA 1QPMA 5TGTA 1Z21A 5BNGA 1CF7B 1OCOH 2CG4A 4BHCA 3S3MA 1KU9A 4ABZA 5D5XB 1Z1DA 5F27A 3I4MJ 4BH9A 2LRDA 3NQOA 4Y13A 1GHCA 3LSIA 2FA5A 3EQLF 2VPRA 2VONA 3QP5A 3CLOA 4GYIA 1LDKB 1R36A 2B0LA 4BACA 4L0ZB 1WFXA 1O7LA 1BJZA 2CGPA 4AVPA 2HDCA 4RB2C 4EQQA 4QIWN 1S3JA 3KP6A 4XKBA 3HB9A 5TRDA 2BY0A 1FIAA 1FYMA 1KYWA 3WTVC 2CV0A 3OIQA 4ZTFA 2CH0A 2HKXA 3M1EA 1VQ9I 2IP2A 5DUKA 1HDDC 4CO8A 3JR9A 3TP3A 1MMGA 1E0EA 2BVMA 1ETQA 3WTYC 1I6HJ 4MQ9F 5B3SH 4JX4A 3GBGA 4P96A 3TW6A 1IAWA 3C3WA 2IBDA 5JI6A 1GT0C 1Z6TA 2DA7A 3TBIA 1FTTA 2OCCH 2BEOA 2XAGA 4N4OB 1F43A 3ABTA 4LLNA 3ZQIA 4MGRA 1M1EB 4RGUA 2VT3A 3M3YJ 1W7PA 4FHTA 2RVCA 2DFEA 1R71A 3F8CA 3FDYA 4DBQA 2IS6A 1FBQA 2BY3A 2ESNA 3BC8A 1G59A 3V7CA 1H88C 1C0WA 2L0KA 1ZGWA 4HRIA 3K1PA 1B4AA 2KPMA 1P4XA 1WJDA 2V6CA 3LMMA 2XC7A 3DV8A 2Y69H 4UNOA 3HOSA 1YS7A 2R5ZA 4Y3OA 1TT5B 4RB1A 1I1GA 2I10A 4ZYAA 3PNTA 3ZGKA 4EM0B 2E1NA 3HOXJ 2VODA 1REPC 2BW3B 2PBIA 2R5ZB 4V2GA 2OZ6A 1EH8A 2M7BA 1FOWA 3IAS2 3K1MA 5AIPA 4MHGA 4F93B 3O3KA 4CZCA 1IUYA 4AD9A 2R7DA 3G1OA 4I7HA 1LKXA 3PSIA 4BY1J 2OPTA 4CCNA 1F5TA 2E35A 3V8JA 3MZYA 3TGNA 3KZIC 2DT5A 4PGGA 1ZGJA 2ICWG 4CGZA 2R7XA 2WY7Q 4F52A 5LGTA 4A0YA 4IZZA 2BHYA 1OJLA 2R7UA 1ZKGA 1FSHA 3FHNA 3CF5F 2DT7B 5JHUA 5C4XJ 1ONVA 4IRHA 3ZQGA 3L09A 3HOYJ 3CDIA 3F8BA 5DYMA 1BR4A 1AKHB 5IOYA 2VC1A 4KN4X 1YIJI 2GXAA 1NG7A 3RCOA 4ZYEA 2P81A 2RC4A 4ESFA 2DYRH 3SFZA 2XAQA 1LQ1A 5HNHA 2HPIA 4PSWA 2DLLA 1TWFJ 4A3LJ 5KAIC 5KHDA 3CCVI 4IHXA 3FZVA 2X6WA 2OCEA 3H3UA 2CSOA 1ZRFA 4OMYA 4LIVA 4F91B 1A04A 1KYZA 2P4WA 3NRVA 3P9CA 4M3EA 2NNYA 1ORKA 1Z3YA 1WJAA 1R22A 1IXSB 3M9AA 3CC4I 3DP7A 3OS0A 2DW4A 5CVIA 2WY8Q 1W5CC 1APLC 2R0QC 3B6AA 3PJRA 4DJAA 4EM1A 1XX5A 2L01A 3BG3A 5TISC 4UHTA 3HPHA 2XROA 3CCYA 2ID3A 3S2WA 3CJTB 5F0CA 4XR6A 2GXBA 1TWCJ 3PNVA 4ZTJA 1K7AA 2DI3A 3HKZN 1XG1A 2RGVA 4NDLA 5IT9K 1JXSA 3GXOA 3HRTA 5K5RA 5DCMA 1BOAA 3HTUA 3MMYB 3OOUA 3RPQA 3V42A 3J7AO 4J01A 4RA2A 4BEHA 2OV7A 2FRHA 1S29A 2EA2A 5E3LA 3TW7A 1ZLJA 4L5EA 2F48A 4MLOA 3O8GA 3K4KA 3ZRGA 1D8KA 2DMPA 3ASOH 2XAFA 1PUFA 4BY7J 1YTYA 3K4CA 2KISA 3J7AY 4KDPA 3D0SA 2WB1A 4BEHB 1RKWA 2MSYA 1J5YA 3U9GA 2VBWA 4EM2A 1ZG1A 5K5QA 2E60A 1TTYA 2DA6A 4B44A 2HOSA 1X1AA 4M9SA 3SZGA 3Q5FA 2PG4A 1VQ7I 2QBYA 2M0MA 2ZXHA 1YI2I 5F6FA 1NH3A 2I8DA 1W7PD 1RC9A 2IS1A 1HKQA 1YE9A 2DMTA 3FXQA 3K4MA 2YU3A 4PJLA 5GAGJ 1HSJA 2XKPA 3ABLH 4E7HA 2F4MB 2A68F 2LTPA 5BOXA 1WQ2A 1BIAA 2EINH 2H94A 1Z9CA 2WAQA 3KETA 1EV7A 3A03A 5FKOA 3GTJJ 1G3TA 3FISA 1XGOA 4QSHA 3Q0WA 2M5WA 2EWNA 4PFOA 3J7ZI 3BR3A 5LLQA 2KMUA 1ZK8A 1T33A 1OLTA 1LB2A 2LC2A 3G3ZA 4JOMA 4XONA 2VKVA 1W0TA 2RQPA 2G9WA 3V4GA 3FXUA 5BPIA 2PJRB 1UELB 4JX5A 3HOUJ 5HNFA 1J09A 1VQNI 1X19A 2L02A 1B9MA 4DBRA 5FD6A 1RPWA 3O8HA 4FE7A 1YG2A 1UZCA 2KRFA 2TRTA 4I76A 4U88A 2IS4A 1IRFA 4ZC3A 3A1YA 4ZZDA 2LG4A 2V9PA 1FYKA 4B43A 4E7ZA 2EB7A 4D1QA 3RSNA 4CCMA 2YX4A 1FOXA 4HA8A 1IO2A 2F5FA 3KYCB 1WJCA 3HOVJ 2QA4I 4UB8C 4KICA 1O7FA 3A01A 4BAYA 1BR1A 1MH4A 1OMIA 3BG6A 3R0JA 3OWTA 2WC2A 5M3FJ 5H2FC 1H89C 4AIKA 2XPUA 4M6XA 3CO6C 1K83J 1ITYA 2AS5F 3F23A 4DNCA 4A3GJ 3A0HC 3RJPA 2M87A 1T95A 3JTGA 2HU9A 3BTIA 4HNVA 1FPQA 1W5TA 2OQRA 3W6VA 5LRSA 4WXCA 2EILH 4P55A 4BJ5C 5GP9A 3RYPA 5LHGA 2HR3A 1R23A 2IGOA 3WE2A 1WSUA 3CUQA 1O3QA 3L2WA 5ICGA 2FBIA 2DDBA 1PJRA 2C6YA 2JSCA 3DBRB 2L9VA 4B3XA 2FUG2 1XCVA 3TQNA 4A69C 1IGNA 2LSOA 1ETKA 3S1MJ 1ACIA 4D7MA 4DQ2A 3QAHA 1IDZA 2E36A 4ITVA 4EGZA 3ABMH 5FJ8J 3MZHA 5FRMA 2HFHA 1ZQ3P 2H6CA 1OYYA 1IRZA 2OQGA 3CCMI 1Y1WJ 3TO6A 2W00A 5CQEA 4YIFA 5EGOA 2KZGA 4M6YA 4KMFA 3H3VK 5B5EC 3KP7A 2XSJC 2L5QA 4EJVA 2GWRA 2MYSA 3SYTA 5IPAA 5IYCJ 3HPGA 4BDZA 2OJED 3EETA 4YELA 1LEAA 2V7FA 2DK5A 3E5UA 1JT0A 3OS2A 1U78A 1SFOJ 1HA8A 1SD4A 4WXDA 1X2NA 3ZXSA 2CU7A 2PLYA 5CVJA 2CO5A 4RB3C 5FLXZ 1HW5A 5KK1A 3VSKA 3KP2A 1JHFA 3NEUA 3GTMJ 2TDXA 1BN5A 1WI3A 4NHJA 2RAEA 4J19A 1X1DA 3O2PE 3OSFA 2V79A 2KRCA 2ME6A 4F3QA 2UZKA 2DBBA 4A3DJ 1DP3A 2P5KA 1E3PA 2M8EA 3WU1B 1QZEA 4LG0B 2IT0A 3H9QA 1RNLA 1E3HA 2DOAA 2ZBKA 4LMYA 2BVLA 1KQ0A 4D5CA 3Q0VA 3QYFA 3G71I 4IEJA 3WG9A 4BXFA 2BXZA 3HDDA 2ZB9A 3ERED 2MBFA 1YIOA 3N05A 1U5TA 3FXJA 3ABKH 5IY5H 3E5XA 2EV0A 3LSHA 3F8NA 2Z99A 5GAEJ 2KP6A 5J40A 3DEUA 3CP2A 3KLOA 5HLIA 1LJ9A 2BE5F 2R7TA 4NNJA 1MD0A 3VSLA 5HS8A 3L9FA 4CCKA 2VKDA 3HG9A 3K70C 1FBSA 2G0EA 2VOOA 2XRLA 2GIVA 5DM7F 3I59A 1G4DA 1OQYA 3TKYA 5LGNA 3CQZJ 2NVQJ 1U0JA 1IXRC 2P6SA 1XC5A 3K4JA 3JSPA 2X51A 3OYNA 3IH3A 4EJOA 2DOEA 2LH9A 4NBQA 1VQ6I 4U7DA 2RNGA 3BR0A 3OYMA 3QPLA 2EFWA 3REOA 1U2WA 3PIPF 3GCMA 3SHFA 3JRBA 2F5DA 1A6IA 4KYWA 1E2XA 3GTQJ 4HG2A 1LVKA 1WZ2A 4DZJA 3F9KA 1D1CA 1YOVB 5HVQC 4DYCA 2KIQA 2LFBA 1B1BA 2L54A 3DQVC 2ELJA 3SXYA 3CDLA 1RESA 2KDZA 1HDPA 3S16J 4YEJA 1P4AA 1T6SA 4ESBA 2AQEA 2F5VA 3TO9A 4BBRJ 2JA8J 5J1UA 4XLNF 2DXIA 3GLLA 2IRFG 4EVIA 2Z5UA 1YITI 2DA4A 4LIUA 2ELKA 5CVUA 2NVYJ 4XIDA 3ZN1A 1ZRDA 1W5SA 5E1WA 4P5OA 4HDUA 3GFLA 4EJUA 2DPUA 1I5ZA 2NS8A 4AIHA 3CCQI 2NVUB 4UUVA 5F0HA 4LOCA 3OSGA 2O5RA 4E6KG 2CQNA 1SFKA 2AO9A 1MKMA 2X1CA 3KLNA 1HW1A 4II3A 2ZFWA 4PCQA 4C3JJ 3COAC 3ZQHA 3BCAA 2CQKA 2CUEA 2UXNA 3DEEA 3LOCA 1U8BA 1ULYA 2FNPA 3ECHA 3R4KA 2JN6A 4NQWA 2PFBA 1P92A 1F4KA 1IG7A 1B59A 5EF6A 4D9JA 2ZO4A 3VDXA 2G7HA 3K10A 5KVRA 2A5YB 3QPSA 1XGMA 2B63J 1LFPA 4G94A 5FKMA 1UHSA 2O8KA 2HDWA 5DV5A 2D2WA 4NQWB 4S05A 1TW3A 2ZSHB 4BE0A 4IHWA 3OYHA 2QM3A 3FM5A 3K0LA 1B72B 5E79C 1ENHA 1ZR4A 3HIFA 4XRMA 3HHGA 2P7CB 2L4MA 4AYBA 3DPUA 3M8FA 2K40A 1G3YA 3ABUA 3I58A 1ZELA 4ENKA 3BR2A 3LSTA 3QPHA 3GZ6A 1XB4A 3J81Z 1OPCA 3FKJA 2CV1A 2HYFA 4CH7A 3WTSC 3UKGA 1UHMA 4ENJA 1QA6A 2DQLA 2DDAA 4L5IA 3AKZA 1LFUP 1XSXA 1FSEA 4GFBA 1LDDA 1T08B 2OUMA 1KQ8A 1YLFA 2H6BA 4YFNF 2HEOA 4XM3A 2PMHA 4M3FA 1TWAJ 2XDVA 1Y8QB 1UCRA 3S2DJ 2A6TA 4KITB 4YG2F 4R1HA 2VB6A 1H8AC 2VJ4A 1D5YA 3DPLC 1YX5A 2QGUA 3HRUA 1NG6A 2GIZA 2RDPA 2E1OA 3FX3A 4JYKA 4A0XA 2OA4A 3B02A 1X1CA 3ZQ7A 2NNNA 1Y8RB 2WAEA 3DTIA 4IQJA 1D0YA 4KISA 5FO5A 4BQAA 3W3CA 5HLTA 2A69F 1ZYRF 2R3SA 3JRDA 1JUSA 1T38A 4XORA 1V4RA 3KPHA 5IP6A 5FB2A 2LD5A 2Y48A 1IZ1A 2M34A 2Y0SA 4BE2A 4F55A 3FXMA 1WRJA 3WU0A 5D8KB 5E17F 2FE3A 1X4PA 3OIPA 1MIJA 5J8FA 1XN7A 2Y30A 2XSDC 1YJ9I 1K78B 3MAJA 1TWGJ 4LD5A 4C3IJ 2IW5A 4CUGA 1VF9A 3JAMK 2XGCA 3DTKA 3G1MA 4A3KJ 3LL7A 1Z7UA 1SAUA 1WH5A 3VB2A 4EATA 2W1OA 3DF8A 3M7GA 2ZXJA 3BP8A 2EH3A 1XS9A 3V8KA 5CVRA 1TW2A 3E6BA 1YQAA 1D0ZA 4I0BA 2DQRA 3FMQA 2VBXA 1WWXA 3FXRA 3M07A 5FROA 1ZAOA 2HGCA 2XIGA 3QOPA 1ZRCA 3FKIJ 3CCEI 4A3IJ 1R49A 2HNHA 3FIWA 1NK3P 4RAFA 3P9IA 4I98B 3GX4X 1GV5A 1ODDA 1MBKA 2UV1A 4I02A 2D1HA 1Q1VA 2L9RA 4N0BA 3S1RJ 4B09A 1TNSA 2EV5A 1YRNB 3W2AA 2XKOA 1N77A 3N97A 1KONA 1JGSA 2R5YB 4LGWA 2CS3A 1ZTRA 2DAOA 2COMA 4FASD 2VKHA 1GXPA 4FX0A 2HYJA 5E1ZB 3UR3C 3C2HA 4BHBA 3LAJA 3HOWJ 3V7SA 3S15J 3QOEA 4IQ4A 1I6XA 2DFIA 2ZKZA 5DDGA 1ZG5A 3Q3SA 2XUBA 4HZFA 4HF0A 4HV6A 5FFZA 3S93A 5HLGA 4HX4A 2R92J 1P7IA 3CCLI 3KP3A 4LB6B 1JTXA 2NOGA 5KAFC 2ECCA 1KQ9A 4XKVA 4JX6A 2A6EF 1OCTC 5F0FA 1MMAA 1SD7A 2BW3A 4FCYA 1V55H 4C2MJ 4GCVA 4P9UA 1BI1A 1U9OA 1BM9A 1V3FA 2R93J 2LLKA 4CCJA 3ZR8X 1BI2A 2QVOA 3VEPA 1SVLA 4HNTA 3GEZA 4OIQF 2VLAA 3W6KB 2H1LA 1IN6A 4A3JJ 2BHZA 3A2KA 1HF0A 4KIFA 3WGHA 5DD8A 3IAM2 1YJWI 2LF8A 3OV8A 3DFGA 1Z3XA 1S5LC 3OYLA 1RR8C 3RKXA 1I1SA 3EUKL 2VI6A 1T56A 2JA2A 2K85A 1RR7A 2JZYA 4AUXA 1TBXA 3FMSA 1HC8A 1UG0A 2DN0A 2UUZA 4DGWB 2KT0A 3HM5A 2H09A 2QLZA 1AKHA 4CZZA 4KA4A 5ILSA 2K3FA 5K7ZA 4KMUX 2X48A 2MG4A 2LYCA 2OF7A 5E3NA 4O3MA 1QZZA 1MZBA 1BBYA 2QCOA 5EEHA 2JTVA 4V19K 5D6EA 2QQBA 2DA3A 5E3OA 3BQYA 3QQAA 2M1BA 2JVHA 2HS5A 2XHKA 4HV5A 1JKRC 3GUDA 1DQUA 4BQQA 2HVSA 2WA0A 4BYYA 1MDMB 2E34A 4L5JA 2FX0A 3W6JB 2IGNA 5LEKA 5KCMA 2DA2A 4L0YB 3OYAA 4RGRA 2J5PA 2W48A 3GFJA 3BJ6A 2X4HA 3ZQQA 4CYCA 3CMEI 4HF1A 2EPFA 2HQAA 1FOYA 2IEKA 3G73A 1HOMA 2Q2EA 3OL4A 4P1WA 1G3SA 3T0YA 1O4XA 1DPUA 1GV2A 1U3EM 2NXNB 3C18A 1RRJA 4CYCB 2QKMB 3ML6A 1LPQA 5M5WJ 3LA2A 1SFEA 5B1AH 3VWBA 2YUSA 3I0TA 1FWZA 2Q2EB 2VPLA 4G6DA 4C30A 4MTDA 3I4PA 3RDIA 1FMWA 4XNFA 4H4KC 2RQQA 2VQHA 3VYRB 2WAFA 3BJOA 1CGPA 4CICA 2DTRA 3KYDB 4II2A 1FOKA 3HGGA 2ECBA 2FMLA 3BT9A 3NARA 2FBKA 2GOXB 2M2EA 1G2HA 1ERDA 3AG4H 4Q5SF 4ZH4F 4LG3A 5EEGA 2CYYA 2HPMA 3LSGA 1R5HA 5E1XA 1BI3A 5ILVA 3PM1A 2NAZA 2A6HF 4M3BA 4OWRB 1VQOI 1A5JA 3JW4A 4E7IA 4S04A 2IGKA 2R7QA 4EV0A 3BR6A 2JVGA 1N25A 1QVUA 2K9QA 3EPZA 4ZJZA 3RYRA 2DT6A 3PUBA 2LKSA 5HS9A 1VFCA 3ZMUA 1LE8B 3L00A 5IT9Z 2KKOA 1H0MA 1XTAA 2HZDA 5M5XJ 3IH2A 4HX8A 1QZYA 5D5WB 3VODA 4ENNA 3GO5A 2ISZA 1X2MA 4PK4A 1ZGAA 2VXZA 4QWQA 2GOMA 2JWTA 4F92B 4EMSA 1VQMI 2O9LA 2W85A 2X6YA 3QYBA 2LY2A 1XMXA 5FKLA 5F64A 3WHCA 1R5GA 2HI3A 3WE3A 1MJBA 4IKFA 1Z7LA 3A4CA 1F36A 3T1BA 4R79A 1KU7A 2EA4A 5H20A 2X1DA 3GTLJ 2Y0MA 3X2QH 2DA1A 1FIPA 3GFMA 5IP9J 2MD0A 4EJTA 1QHGA 3R60A 3F0CA 1AWCA 1WPKA 4KNYA 1QRYA 2CUZA 2A5WA 2M7AA 1FEXA 4HEA2 1J75A 4LFUA 2STTA 2PJRA 4L9NA 1E17A 3OR2C 4ETSA 3J80K 1D1BA 1Z91A 3TP0A 1WJFA 2L3DA 1R00A 2QENA 3I55I 1IRXA 2GQQA 1R6RA 4A5NA 2KJBA 4YFKF 2NRAC 4JK1X 3I5UA 2V9VA 3ULQB 2FNAA 2R7RA 2IS2A 2AXLA 4CSWA 3JRIA 3SEZA 1R58A 3SZPA 4HF2A 3BG7A 3GTKJ 3EUHC 3DWLE 3ZMDA 3HHHA 4IVNA 4KT5C 3FBNB 4GO1A 2I5UA 1LVAA 4A3MJ 1QQIA 2JQ7A 4UXNA 1I3QJ 3EYYA 3JRAA 1PUEE 1ZN2A 4G7OF 2EZKA 4Y33A 1R1VA 1X3UA 4Q48A 4RAGA 3BTJA 3K4LA 5FKNA 5JR3A 2ZJPF 1SFUA 5HS7A 1OISA 4ZDOA 2CW7A 2JT1A 3P5JA 2VC0A 2OD5A 1B6AA 4BNCA 3K1NA 3G2BA 4PDKA 5J1RA 2QSHX 1OCCH 4HW0A 2HOEA 1YW7A 2CFOA 4PSXA 5GPAA 2DJNA 2CQXA 4ZZLA 3LAPA 2MC4A 4O6JA 1FNNA 5ERIA 4C2UA 1YW8A 3K4NA 3NWTA 4IX7A 3DLLF 2IGMA 1L3LA 2M45A 1R5ID 2VE9A 2HWVA 2QQAA 4W1UA 3JCUC 4RLFA 1BW5A 2KL4A 1Y0NA 3KEQA 2IA0A 5LHIA 3CCSI 1ZHFA 1I27A 4ASNA 3IKTA 1UHWA
chains in the Genus database with same CATH topology
1XDSA 2GA2A 1D3YA 3GF2A 4LLLA 4LB5A 1J9IA 5BPDA 1XCBA 1TNTA 3R6SA 4KUMA 2K4BA 2J5OA 2FQ3A 3BDDA 4I01A 4OINF 3BPVA 3KFWX 2MC3A 4M9XA 4HOBA 3GZ5A 4QLCU 4G8XA 4A0ZA 2X0LA 3E6CC 2MD5A 4MNUA 3KP4A 3KP5A 4LG0A 2O8XA 1YW9A 2OBPA 2XGXA 2G7UA 5E8IA 3ZMTA 3E97A 2F2EA 3EUHA 2IA1A 1QNTA 4E70A 1FY7A 2VBYA 2IA2A 2VBZA 1J59A 4IRGA 3Q9VA 4ZYDA 2EK5A 4GYGA 2YR2A 2XVCA 2ZJ2A 3ZN0A 3JSOA 1G6NA 2LNBA 4A2UA 1ZH5A 3LQQA 1L0OC 5L3GA 1LDJA 2OZUA 1BC7C 2GA1A 1IXCA 2P5LC 5A2QK 2L4AA 3Q9SA 2YX7A 3RKWA 1HKTA 2D1VA 3RI4A 3WODF 3ISPA 3I54A 3CO7C 4LLGF 5IT3A 1SMYF 4UVAA 3B73A 1HQCA 1KA8A 3K9TA 1FBUA 3BY6A 1WI9A 4ZYHA 4FT8A 1MJ9A 1O3TA 3ZPLA 4U0VA 3RPUA 3BPXA 3P7NA 4P9FA 1Z05A 2ESHA 1SMTA 1P4WA 1S7OA 1K6OA 2FSWA 1S6LA 2XASA 3M8EA 3WGGA 3L7WA 2W84A 1HW2A 5AIQA 3F6OA 2UWMA 2P5VA 1YYVA 4TV7A 3IRQA 1DUXC 1PDNC 1DP7P 3VOEA 1NHAA 1TQIA 3F21A 2PQ8A 2E7XA 1ZREA 1D8JA 2KIUA 3FF5A 3H92A 5FFXA 3RTRA 5LGUA 2BYVE 2ZMEA 4IF4A 4RAZA 1R1TA 3KCCA 3CTAA 2O0YA 4ZYGA 4XSZF 5E18F 2DK8A 2VE8A 3C7JA 2ZMEB 4L18B 1J0RA 2GXGA 3U1DA 4L9JA 2D45A 1BI0A 1O3RA 3MFKA 4XBFA 4HAMA 3TOAA 1FP2A 1TQPA 3TO7A 4OIPF 2RN7A 4CDGA 1HSTA 5BQTA 2FMYA 4WF2A 3TOBA 1XGSA 1QBJA 4HBLA 3ZP5A 4G7ZF 5CLSA 4U7BA 1K78A 4GXOA 1RUOA 3BROA 1RI7A 1HKSA 3F6VA 4HQMA 4R8HA 4CYDA 4LJZF 2ADUA 3GFIA 3EDPA 4Z2YA 1TQMA 3GLXA 5CYVA 3FM3A 2NS0A 1UB9A 4KIGA 1H9GA 3VFZA 1EH6A 2O61A 5CVVA 2DU9A 3MCZA 1HXDA 1FYLA 3JAMZ 3E5QA 3IHUA 4OU0A 1IN8A 2WTEA 4UVBA 2ACJA 4RB0A 3GW2A 5DD4A 3KEOA 1XSDA 1K79A 1USTA 5H6RA 5TJJA 3QPTA 4CXFA 2PEXA 2QWWA 3V8LA 4A6DA 4N9IA 3F3XA 2K27A 4UV8A 1D5VA 1HBXG 3TDZC 3D5LA 4B8XA 4KFCA 2KIFA 5DCFA 4YFXF 4IRIA 4WCGA 4A12A 4M73A 4MEXF 1S7AA 5D6FA 2HQRA 2FEZA 4WWCA 5H6QA 4M74A 1F9NA 3U2RA 1PP7U 3TDUC 2RV8A 1XMKA 1RUNA 2EJRA 1W7PB 2FXAA 3PFIA 2Z33A 1BC8C 1LNWA 1LEBA 3OOPA 5DUIA 4XLPF 1R1UA 1QGPA 4PGHA 1FX7A 5LEJA 3HRMA 2CFXA 5D4RA 2EFPA 1TLHB 3DXJF 4GGGA 2PMUA 1SD6A 3O6BB 1MDMA 2VOPA 3DKWA 2EFOA 1S8NA 4WX9A 4Q4ZF 2DPDA 1Y0UA 2VN2A 3KZZA 1FP1D 2H27A 5JVTA 5LHHA 4MEYF 1T2KA 4L9VA 2MH9A 2ZNZA 5ILUA 4XSXF 2ZNYA 4L9TA 1IRGA 3FWEA 1J7KA 1PP8F 4U0YA 4RGXA 3IWZA 2V1XA 4A6EA 3WTWC 2Y75A 2V1DA 1G3WA 2P8TA 2F5EA 3IL2A 3F72A 5HLHA 4LK1F 3HTSB 3IC7A 1IW7F 2XRNA 1XMAA 2A3SA 4NB5A 1EH7A 2FU4A 3LQRA 5D5UB 2XAJA 1ZG3A 2GAUA 5K5OA 1QO0D 2OAZA 1P6RA 2V1UA 1R7JA 3MQ0A 5K1YA 4I09A 4N9HA 1U8RA 1SAXA 4WK8F 5HDNA 4OIOF 3E6MA 4H0EA 1DPRA 5CJ9A 2JPBA 5L3CA 2GZWA 3K2ZA 2Q8KA 1JE8A 1ZLKA 2E1CA 1FT9A 3BJAA 4RS8A 1T0FA 1J2XA 3CUQC 5LRRA 1VTNC 5ICFA 5DCMB 4ENMA 3I64A 5LBQA 2STWA 2XAHA 4HX7A 4AIJA 2XV4S 3QRFF 2K86A 3KE2A 1IN4A 3ELKA 2ZCWA 2Z3YA 4HQEA 3LA7A 2PI0A 3JTHA 4U0WA 1KU3A 3HRSA 4M71A 4LK0F 4PZJA 3EYIA 2QBYB 1DDNA 2Q0OA 2KJCA 3L2CA 1RZ4A 1AOYA 4IJAA 3J80Z 2W24A 2ISYA 5FD5A 5FGMA 3IKVA 3KZYA 3GWZA 1Q1HA 1BIBA 2A07F 1YO5C 2P7VB 3CJNA 3R61A 3CUOA 2ELHA 1IF1A 2WWYA 1UHWA 2ETHA 5L3EA 3MEXA 1F1ZA 1OYIA 2O03A 1RIOH 5J8CA 3PQKA 2W57A 1OYWA 3HSFA 1FLIA 3BZ6A 3ECOA 4A5MA 3V7RA 4HYEA 1U5TC 3I71A 1BJAA 5HDKA 5AONA 4FX4A 2RNJA 3CDHA 3F8MA 3RKYA 4I0AA 2IPQX 3HOTA 2YSRA 1H9TA 2MLGA 1ON1A 2BV6A 4JBAA 3IWFA 2HZTA 5ICEA 4RAYA 4BHPA 4IHTA 1XD7A 2YPRA 3MWMA 3ZMSA 3ZMVA 1USSA 4HDVA 1GVJA 3QU3A 2EV6A 5ICCA 3FHZA 1FC3A 1OR7A 2O6GE 1SFXA 5F1RA 3F8FA 3WTZA 2F5CA 1P2FA 4MTEA 4Q47A 3CUQB 2QYOA 3H3ZA 3E3VA 3WTTC 2BGCA 3E6DA 4Y15A 3QU6A 4KN7X 5FLXK 3P9KA 2IVMA 5BS6A 2EFQA 1FZPB 4IXAA 1OKRA 5D5VB 2JRTA 1IN5A 2HTJA 2LKPA 5J6XA 2MA3A 4F7ZA 2FOKA 3GYHX 5HOOA 1B9NA 4K2EA 2PJPA 1T98A 2HYGD 2UXXA 1W4MA 3HSEA 2R7FA 4EGYA 3T8RA 4AWXB 3FMRA 1T39A 2QQ9A 2QZ8A 5BMZA 5JFRA 1O57A 2HKOA 3BOQA 3R0AA 3T8TA 4G6QA 1JHHA 3SQNA 2HTSA 5E8GA 1IN7A 5A2QZ 3QP6A 2LDUA 3WGIA 2CW0F 1U5TB 4RGSA 2KIMA 2IJLA 3WTXC 4BXUA 2W25A 5HDGA 1Z6RA 4I2OA 3T5XA 1XGNA 4UV9A 4JQFA 5E20A 1ON2A 3LA3A 3I59B 4Y17A 1WKMA 4G9YA 3HUGA 4O5VA 1GXQA 3GVAA 4OOIA 5ED4A 2K4JA 4IPAA 4D0PA 2QUFA 1U6GA 2E7WA 3SZTA 2OU2A 5L3FA 3F22A 4CHUA 2A61A 3HSRA 2Z9OA 4M72A 5L3DA 3BWGA 3ZMZA 3IRRA 1SD5A 1XDUA 6PAXA 1UFMA 3N4MA 1STZA 4HLXA 3I53A 4ON0A 3LWFA 5D8LB 1MGTA 2P6TA 2CWEA 3DPTA 3K69A 2JPCA 2NYXA 3AAFA 1O3SA 5DEQA 3J81K 1YFHA 2M30A 3RIRA 4G7HF 2PN6A 2K7LA 3LFKA 4WXHA 3WTUC 4UVCA 2DO7A 4OIRF 4KIBA 3HYIA 2FF4A 1YS6A 3ROUA 4ESJA 1ZARA 2LF7A 5D4SA 4OMZA 1KGSA 2O3FA 2VT2A 2MLKA 1MJAA 2K02A 2BBYA 2EFNA 4EJWA 3C1DA 4YIIA 4M9ZA 2HQNA 1CF7A 4XRFA 1XSVA 2RKHA 2WV0A 4IHSA 2MH2A 4MQVA 5L3BA 2FBHA 4HLYA 1KU2A 1QPMA 1CF7B 2CG4A 4BHCA 1KU9A 5D5XB 1Z1DA 4BH9A 3NQOA 4Y13A 1GHCA 2FA5A 3EQLF 2VONA 3QP5A 3CLOA 4GYIA 1LDKB 1R36A 2B0LA 4L0ZB 1O7LA 2CGPA 4AVPA 2HDCA 4RB2C 4EQQA 1S3JA 3KP6A 5TRDA 1FYMA 1KYWA 3WTVC 2HKXA 3M1EA 2IP2A 5DUKA 4CO8A 3WTYC 4MQ9F 4P96A 1IAWA 3C3WA 5JI6A 1Z6TA 2BEOA 2XAGA 3ABTA 4LLNA 4MGRA 4RGUA 2VT3A 1W7PA 4FHTA 2RVCA 3F8CA 1FBQA 2ESNA 3V7CA 1C0WA 3K1PA 1B4AA 1P4XA 2V6CA 3DV8A 4UNOA 3HOSA 1YS7A 4RB1A 1I1GA 4EM0B 2E1NA 2VODA 1REPC 2PBIA 2OZ6A 1EH8A 3K1MA 5AIPA 4MHGA 3O3KA 1IUYA 4AD9A 2R7DA 4I7HA 1F5TA 3V8JA 3MZYA 3TGNA 2DT5A 4PGGA 1ZGJA 4CGZA 5LGTA 4A0YA 1FSHA 5JHUA 1ONVA 4IRHA 3L09A 3F8BA 5DYMA 2VC1A 4KN4X 4ZYEA 2RC4A 4ESFA 1LQ1A 3SFZA 2XAQA 2DLLA 3FZVA 3H3UA 2CSOA 1ZRFA 4OMYA 1A04A 1KYZA 2P4WA 3NRVA 3P9CA 2NNYA 1R22A 1IXSB 3M9AA 3DP7A 2DW4A 5CVIA 4EM1A 2L01A 4UHTA 2XROA 3S2WA 2GXBA 1K7AA 2DI3A 2RGVA 5IT9K 1JXSA 3GXOA 3HRTA 5K5RA 5DCMA 1BOAA 3HTUA 3RPQA 3J7AO 2FRHA 1S29A 2EA2A 1ZLJA 1D8KA 2XAFA 1YTYA 4KDPA 3D0SA 1J5YA 3U9GA 2VBWA 4EM2A 1ZG1A 5K5QA 1TTYA 4M9SA 3Q5FA 2PG4A 2QBYA 5F6FA 1W7PD 1HKQA 3FXQA 2YU3A 1HSJA 2XKPA 2A68F 5BOXA 1WQ2A 1BIAA 2H94A 1Z9CA 3KETA 1EV7A 1G3TA 1XGOA 2M5WA 2EWNA 5LLQA 1LB2A 3G3ZA 2RQPA 2G9WA 3V4GA 3FXUA 5BPIA 2L02A 1B9MA 5FD6A 1YG2A 2KRFA 4U88A 1IRFA 4ZZDA 1FYKA 2EB7A 2YX4A 4HA8A 2F5FA 4KICA 1O7FA 4BAYA 1OMIA 3R0JA 2WC2A 4AIKA 4M6XA 3CO6C 2AS5F 3F23A 4DNCA 3RJPA 2M87A 3JTGA 1FPQA 1W5TA 2OQRA 5LRSA 5LHGA 4WXCA 4P55A 3RYPA 2HR3A 1R23A 3WE2A 1WSUA 3CUQA 1O3QA 5ICGA 2FBIA 2C6YA 2JSCA 1XCVA 3TQNA 2LSOA 4DQ2A 3QAHA 4EGZA 3MZHA 2HFHA 2H6CA 1OYYA 2OQGA 3TO6A 4YIFA 4M6YA 4KMFA 3KP7A 4EJVA 2GWRA 3EETA 1LEAA 2DK5A 3E5UA 1U78A 1SD4A 4WXDA 2PLYA 5CVJA 2CO5A 4RB3C 5FLXZ 1HW5A 5KK1A 3KP2A 1JHFA 3NEUA 2TDXA 1BN5A 4NHJA 3O2PE 2V79A 2UZKA 2DBBA 2M8EA 2P5KA 3WU1B 4LG0B 2IT0A 1RNLA 2ZBKA 4LMYA 1KQ0A 3WG9A 3ERED 2MBFA 1YIOA 1U5TA 3E5XA 2EV0A 3F8NA 2Z99A 3DEUA 3KLOA 5HLIA 1LJ9A 2BE5F 5HS8A 1MD0A 3L9FA 1FBSA 2VOOA 2GIVA 3I59A 1G4DA 3TKYA 5LGNA 1IXRC 2P6SA 3JSPA 4EJOA 4U7DA 2EFWA 3REOA 1U2WA 4KYWA 3SHFA 2F5DA 1E2XA 5HVQC 1B1BA 2L54A 3DQVC 3SXYA 1P4AA 1T6SA 4ESBA 3TO9A 4XLNF 2IRFG 4EVIA 2Z5UA 5CVUA 3ZN1A 1ZRDA 1W5SA 5E1WA 4P5OA 4HDUA 3GFLA 4EJUA 2DPUA 1I5ZA 4AIHA 4UUVA 3KLNA 1MKMA 1HW1A 2ZFWA 4PCQA 3COAC 2CQKA 2UXNA 1ULYA 2FNPA 3ECHA 3R4KA 4NQWA 2PFBA 1P92A 1F4KA 1B59A 2ZO4A 2G7HA 5KVRA 2A5YB 1XGMA 4G94A 5DV5A 2D2WA 4S05A 1TW3A 2QM3A 3FM5A 3K0LA 3HIFA 3HHGA 2P7CB 2L4MA 3M8FA 1G3YA 3ABUA 3I58A 4ENKA 3LSTA 3QPHA 3GZ6A 1XB4A 3J81Z 1OPCA 2HYFA 3WTSC 1UHMA 4ENJA 2DQLA 4L5IA 1XSXA 1FSEA 1LDDA 1KQ8A 1YLFA 2H6BA 4YFNF 2HEOA 2PMHA 1UCRA 4YG2F 4R1HA 3DPLC 3HRUA 2RDPA 3FX3A 4A0XA 2OA4A 3B02A 3ZQ7A 2NNNA 5FO5A 4BQAA 2A69F 1ZYRF 2R3SA 1T38A 1V4RA 5FB2A 2Y48A 1IZ1A 1WRJA 3WU0A 5D8KB 5E17F 2FE3A 5J8FA 1XN7A 1K78B 3MAJA 4LD5A 2IW5A 3JAMK 1Z7UA 3VB2A 3DF8A 3M7GA 2ZXJA 3BP8A 3V8KA 5CVRA 1TW2A 3E6BA 1YQAA 4I0BA 2DQRA 3FMQA 2VBXA 1WWXA 3FXRA 1ZAOA 2HGCA 2XIGA 3QOPA 1ZRCA 3P9IA 4I98B 3GX4X 1ODDA 4I02A 2D1HA 4N0BA 4B09A 1TNSA 2EV5A 2XKOA 3N97A 1JGSA 4LGWA 2DAOA 2COMA 1GXPA 4FX0A 5E1ZB 4BHBA 3LAJA 3V7SA 1I6XA 2DFIA 2ZKZA 5DDGA 1ZG5A 2XUBA 4HZFA 4HF0A 4HV6A 5FFZA 5HLGA 4HX4A 3KP3A 4LB6B 1KQ9A 2A6EF 1SD7A 4GCVA 4P9UA 1BI1A 1BM9A 1V3FA 1BI2A 2QVOA 3VEPA 3GEZA 4OIQF 3W6KB 1IN6A 4KIFA 3WGHA 5DD8A 2LF8A 3OV8A 3DFGA 3RKXA 1I1SA 2JZYA 1TBXA 3FMSA 2H09A 2QLZA 4CZZA 4KA4A 5ILSA 4KMUX 4O3MA 1QZZA 1MZBA 1BBYA 5EEHA 2JTVA 5D6EA 2QQBA 2M1BA 2HS5A 2XHKA 4HV5A 3GUDA 4BYYA 1MDMB 4L5JA 3W6JB 5LEKA 4L0YB 4RGRA 2J5PA 3GFJA 3BJ6A 2X4HA 4HF1A 3G73A 2Q2EA 1G3SA 3T0YA 1DPUA 1U3EM 3C18A 3ML6A 3LA2A 1SFEA 3I0TA 1FWZA 4G6DA 4MTDA 3I4PA 3RDIA 3BJOA 1CGPA 4CICA 2DTRA 1FOKA 2FMLA 2FBKA 4Q5SF 4ZH4F 5EEGA 2CYYA 1R5HA 5E1XA 1BI3A 5ILVA 2NAZA 2A6HF 3JW4A 4S04A 4EV0A 3RYRA 5HS9A 3ZMUA 3L00A 5IT9Z 2KKOA 1H0MA 4HX8A 1QZYA 5D5WB 3VODA 4ENNA 3GO5A 2ISZA 1ZGAA 2VXZA 4QWQA 4EMSA 2W85A 5F64A 1R5GA 3WE3A 1MJBA 3T1BA 4R79A 1KU7A 2EA4A 5H20A 2Y0MA 3GFMA 4EJTA 3R60A 1AWCA 4KNYA 1J75A 4LFUA 2STTA 4L9NA 1E17A 4ETSA 3J80K 1Z91A 2L3DA 1R00A 2QENA 2GQQA 4A5NA 2KJBA 4YFKF 2NRAC 4JK1X 3I5UA 2V9VA 3ULQB 2FNAA 2AXLA 1R58A 3SZPA 4HF2A 3ZMDA 3HHHA 4IVNA 4KT5C 4GO1A 1LVAA 1QQIA 4UXNA 3EYYA 1PUEE 1ZN2A 4G7OF 1R1VA 1X3UA 4Q48A 5JR3A 1SFUA 5HS7A 2JT1A 2VC0A 2OD5A 1B6AA 4BNCA 3K1NA 4PDKA 4HW0A 2HOEA 1YW7A 4ZZLA 3LAPA 4O6JA 1FNNA 5ERIA 1YW8A 1L3LA 2M45A 2VE9A 2HWVA 2QQAA 3KEQA 2IA0A 5LHIA 1ZHFA 1I27A 4ASNA 3IKTA 3PQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XDS A;  2GA2 A;  1D3Y A;  3GF2 A;  4LLL A;  4LB5 A;  1J9I A;  5BPD A;  1XCB A;  1TNT A;  3R6S A;  4KUM A;  2K4B A;  2J5O A;  2FQ3 A;  3BDD A;  4I01 A;  4OIN F;  3BPV A;  3KFW X;  2MC3 A;  4M9X A;  4HOB A;  3GZ5 A;  4QLC U;  4G8X A;  4A0Z A;  2X0L A;  3E6C C;  2MD5 A;  4MNU A;  3KP4 A;  3KP5 A;  4LG0 A;  2O8X A;  1YW9 A;  2OBP A;  2XGX A;  2G7U A;  5E8I A;  3ZMT A;  3E97 A;  2F2E A;  3EUH A;  2IA1 A;  1QNT A;  4E70 A;  1FY7 A;  2VBY A;  2IA2 A;  2VBZ A;  1J59 A;  4IRG A;  3Q9V A;  4ZYD A;  2EK5 A;  4GYG A;  2YR2 A;  2XVC A;  2ZJ2 A;  3ZN0 A;  3JSO A;  1G6N A;  2LNB A;  4A2U A;  1ZH5 A;  3LQQ A;  1L0O C;  5L3G A;  1LDJ A;  2OZU A;  1BC7 C;  2GA1 A;  1IXC A;  2P5L C;  5A2Q K;  2L4A A;  3Q9S A;  2YX7 A;  3RKW A;  1HKT A;  2D1V A;  3RI4 A;  3WOD F;  3ISP A;  3I54 A;  3CO7 C;  4LLG F;  5IT3 A;  1SMY F;  4UVA A;  3B73 A;  1HQC A;  1KA8 A;  3K9T A;  1FBU A;  3BY6 A;  1WI9 A;  4ZYH A;  4FT8 A;  1MJ9 A;  1O3T A;  3ZPL A;  4U0V A;  3RPU A;  3BPX A;  3P7N A;  4P9F A;  1Z05 A;  2ESH A;  1SMT A;  1P4W A;  1S7O A;  1K6O A;  2FSW A;  1S6L A;  2XAS A;  3M8E A;  3WGG A;  3L7W A;  2W84 A;  1HW2 A;  5AIQ A;  3F6O A;  2UWM A;  2P5V A;  1YYV A;  4TV7 A;  3IRQ A;  1DUX C;  1PDN C;  1DP7 P;  3VOE A;  1NHA A;  1TQI A;  3F21 A;  2PQ8 A;  2E7X A;  1ZRE A;  1D8J A;  2KIU A;  3FF5 A;  3H92 A;  5FFX A;  3RTR A;  5LGU A;  2BYV E;  2ZME A;  4IF4 A;  4RAZ A;  1R1T A;  3KCC A;  3CTA A;  2O0Y A;  4ZYG A;  4XSZ F;  5E18 F;  2DK8 A;  2VE8 A;  3C7J A;  2ZME B;  4L18 B;  1J0R A;  2GXG A;  3U1D A;  4L9J A;  2D45 A;  1BI0 A;  1O3R A;  3MFK A;  4XBF A;  4HAM A;  3TOA A;  1FP2 A;  1TQP A;  3TO7 A;  4OIP F;  2RN7 A;  4CDG A;  1HST A;  5BQT A;  2FMY A;  4WF2 A;  3TOB A;  1XGS A;  1QBJ A;  4HBL A;  3ZP5 A;  4G7Z F;  5CLS A;  4U7B A;  1K78 A;  4GXO A;  1RUO A;  3BRO A;  1RI7 A;  1HKS A;  3F6V A;  4HQM A;  4R8H A;  4CYD A;  4LJZ F;  2ADU A;  3GFI A;  3EDP A;  4Z2Y A;  1TQM A;  3GLX A;  5CYV A;  3FM3 A;  2NS0 A;  1UB9 A;  4KIG A;  1H9G A;  3VFZ A;  1EH6 A;  2O61 A;  5CVV A;  2DU9 A;  3MCZ A;  1HXD A;  1FYL A;  3JAM Z;  3E5Q A;  3IHU A;  4OU0 A;  1IN8 A;  2WTE A;  4UVB A;  2ACJ A;  4RB0 A;  3GW2 A;  5DD4 A;  3KEO A;  1XSD A;  1K79 A;  1UST A;  5H6R A;  5TJJ A;  3QPT A;  4CXF A;  2PEX A;  2QWW A;  3V8L A;  4A6D A;  4N9I A;  3F3X A;  2K27 A;  4UV8 A;  1D5V A;  1HBX G;  3TDZ C;  3D5L A;  4B8X A;  4KFC A;  2KIF A;  5DCF A;  4YFX F;  4IRI A;  4WCG A;  4A12 A;  4M73 A;  4MEX F;  1S7A A;  5D6F A;  2HQR A;  2FEZ A;  4WWC A;  5H6Q A;  4M74 A;  1F9N A;  3U2R A;  1PP7 U;  3TDU C;  2RV8 A;  1XMK A;  1RUN A;  2EJR A;  1W7P B;  2FXA A;  3PFI A;  2Z33 A;  1BC8 C;  1LNW A;  1LEB A;  3OOP A;  5DUI A;  4XLP F;  1R1U A;  1QGP A;  4PGH A;  1FX7 A;  5LEJ A;  3HRM A;  2CFX A;  5D4R A;  2EFP A;  1TLH B;  3DXJ F;  4GGG A;  2PMU A;  1SD6 A;  3O6B B;  1MDM A;  2VOP A;  3DKW A;  2EFO A;  1S8N A;  4WX9 A;  4Q4Z F;  2DPD A;  1Y0U A;  2VN2 A;  3KZZ A;  1FP1 D;  2H27 A;  5JVT A;  5LHH A;  4MEY F;  1T2K A;  4L9V A;  2MH9 A;  2ZNZ A;  5ILU A;  4XSX F;  2ZNY A;  4L9T A;  1IRG A;  3FWE A;  1J7K A;  1PP8 F;  4U0Y A;  4RGX A;  3IWZ A;  2V1X A;  4A6E A;  3WTW C;  2Y75 A;  2V1D A;  1G3W A;  2P8T A;  2F5E A;  3IL2 A;  3F72 A;  5HLH A;  4LK1 F;  3HTS B;  3IC7 A;  1IW7 F;  2XRN A;  1XMA A;  2A3S A;  4NB5 A;  1EH7 A;  2FU4 A;  3LQR A;  5D5U B;  2XAJ A;  1ZG3 A;  2GAU A;  5K5O A;  1QO0 D;  2OAZ A;  1P6R A;  2V1U A;  1R7J A;  3MQ0 A;  5K1Y A;  4I09 A;  4N9H A;  1U8R A;  1SAX A;  4WK8 F;  5HDN A;  4OIO F;  3E6M A;  4H0E A;  1DPR A;  5CJ9 A;  2JPB A;  5L3C A;  2GZW A;  3K2Z A;  2Q8K A;  1JE8 A;  1ZLK A;  2E1C A;  1FT9 A;  3BJA A;  4RS8 A;  1T0F A;  1J2X A;  3CUQ C;  5LRR A;  1VTN C;  5ICF A;  5DCM B;  4ENM A;  3I64 A;  5LBQ A;  2STW A;  2XAH A;  4HX7 A;  4AIJ A;  2XV4 S;  3QRF F;  2K86 A;  3KE2 A;  1IN4 A;  3ELK A;  2ZCW A;  2Z3Y A;  4HQE A;  3LA7 A;  2PI0 A;  3JTH A;  4U0W A;  1KU3 A;  3HRS A;  4M71 A;  4LK0 F;  4PZJ A;  3EYI A;  2QBY B;  1DDN A;  2Q0O A;  2KJC A;  3L2C A;  1RZ4 A;  1AOY A;  4IJA A;  3J80 Z;  2W24 A;  2ISY A;  5FD5 A;  5FGM A;  3IKV A;  3KZY A;  3GWZ A;  1Q1H A;  1BIB A;  2A07 F;  1YO5 C;  2P7V B;  3CJN A;  3R61 A;  3CUO A;  2ELH A;  1IF1 A;  2WWY A;  1UHW A;  2ETH A;  5L3E A;  3MEX A;  1F1Z A;  1OYI A;  2O03 A;  1RIO H;  5J8C A;  3PQK A;  2W57 A;  1OYW A;  3HSF A;  1FLI A;  3BZ6 A;  3ECO A;  4A5M A;  3V7R A;  4HYE A;  1U5T C;  3I71 A;  1BJA A;  5HDK A;  5AON A;  4FX4 A;  2RNJ A;  3CDH A;  3F8M A;  3RKY A;  4I0A A;  2IPQ X;  3HOT A;  2YSR A;  1H9T A;  2MLG A;  1ON1 A;  2BV6 A;  4JBA A;  3IWF A;  2HZT A;  5ICE A;  4RAY A;  4BHP A;  4IHT A;  1XD7 A;  2YPR A;  3MWM A;  3ZMS A;  3ZMV A;  1USS A;  4HDV A;  1GVJ A;  3QU3 A;  2EV6 A;  5ICC A;  3FHZ A;  1FC3 A;  1OR7 A;  2O6G E;  1SFX A;  5F1R A;  3F8F A;  3WTZ A;  2F5C A;  1P2F A;  4MTE A;  4Q47 A;  3CUQ B;  2QYO A;  3H3Z A;  3E3V A;  3WTT C;  2BGC A;  3E6D A;  4Y15 A;  3QU6 A;  4KN7 X;  5FLX K;  3P9K A;  2IVM A;  5BS6 A;  2EFQ A;  1FZP B;  4IXA A;  1OKR A;  5D5V B;  2JRT A;  1IN5 A;  2HTJ A;  2LKP A;  5J6X A;  2MA3 A;  4F7Z A;  2FOK A;  3GYH X;  5HOO A;  1B9N A;  4K2E A;  2PJP A;  1T98 A;  2HYG D;  2UXX A;  1W4M A;  3HSE A;  2R7F A;  4EGY A;  3T8R A;  4AWX B;  3FMR A;  1T39 A;  2QQ9 A;  2QZ8 A;  5BMZ A;  5JFR A;  1O57 A;  2HKO A;  3BOQ A;  3R0A A;  3T8T A;  4G6Q A;  1JHH A;  3SQN A;  2HTS A;  5E8G A;  1IN7 A;  5A2Q Z;  3QP6 A;  2LDU A;  3WGI A;  2CW0 F;  1U5T B;  4RGS A;  2KIM A;  2IJL A;  3WTX C;  4BXU A;  2W25 A;  5HDG A;  1Z6R A;  4I2O A;  3T5X A;  1XGN A;  4UV9 A;  4JQF A;  5E20 A;  1ON2 A;  3LA3 A;  3I59 B;  4Y17 A;  1WKM A;  4G9Y A;  3HUG A;  4O5V A;  1GXQ A;  3GVA A;  4OOI A;  5ED4 A;  2K4J A;  4IPA A;  4D0P A;  2QUF A;  1U6G A;  2E7W A;  3SZT A;  2OU2 A;  5L3F A;  3F22 A;  4CHU A;  2A61 A;  3HSR A;  2Z9O A;  4M72 A;  5L3D A;  3BWG A;  3ZMZ A;  3IRR A;  1SD5 A;  1XDU A;  6PAX A;  1UFM A;  3N4M A;  1STZ A;  4HLX A;  3I53 A;  4ON0 A;  3LWF A;  5D8L B;  1MGT A;  2P6T A;  2CWE A;  3DPT A;  3K69 A;  2JPC A;  2NYX A;  3AAF A;  1O3S A;  5DEQ A;  3J81 K;  1YFH A;  2M30 A;  3RIR A;  4G7H F;  2PN6 A;  2K7L A;  3LFK A;  4WXH A;  3WTU C;  4UVC A;  2DO7 A;  4OIR F;  4KIB A;  3HYI A;  2FF4 A;  1YS6 A;  3ROU A;  4ESJ A;  1ZAR A;  2LF7 A;  5D4S A;  4OMZ A;  1KGS A;  2O3F A;  2VT2 A;  2MLK A;  1MJA A;  2K02 A;  2BBY A;  2EFN A;  4EJW A;  3C1D A;  4YII A;  4M9Z A;  2HQN A;  1CF7 A;  4XRF A;  1XSV A;  2RKH A;  2WV0 A;  4IHS A;  2MH2 A;  4MQV A;  5L3B A;  2FBH A;  4HLY A;  1KU2 A;  1QPM A;  1CF7 B;  2CG4 A;  4BHC A;  1KU9 A;  5D5X B;  1Z1D A;  4BH9 A;  3NQO A;  4Y13 A;  1GHC A;  2FA5 A;  3EQL F;  2VON A;  3QP5 A;  3CLO A;  4GYI A;  1LDK B;  1R36 A;  2B0L A;  4L0Z B;  1O7L A;  2CGP A;  4AVP A;  2HDC A;  4RB2 C;  4EQQ A;  1S3J A;  3KP6 A;  5TRD A;  1FYM A;  1KYW A;  3WTV C;  2HKX A;  3M1E A;  2IP2 A;  5DUK A;  4CO8 A;  3WTY C;  4MQ9 F;  4P96 A;  1IAW A;  3C3W A;  5JI6 A;  1Z6T A;  2BEO A;  2XAG A;  3ABT A;  4LLN A;  4MGR A;  4RGU A;  2VT3 A;  1W7P A;  4FHT A;  2RVC A;  3F8C A;  1FBQ A;  2ESN A;  3V7C A;  1C0W A;  3K1P A;  1B4A A;  1P4X A;  2V6C A;  3DV8 A;  4UNO A;  3HOS A;  1YS7 A;  4RB1 A;  1I1G A;  4EM0 B;  2E1N A;  2VOD A;  1REP C;  2PBI A;  2OZ6 A;  1EH8 A;  3K1M A;  5AIP A;  4MHG A;  3O3K A;  1IUY A;  4AD9 A;  2R7D A;  4I7H A;  1F5T A;  3V8J A;  3MZY A;  3TGN A;  2DT5 A;  4PGG A;  1ZGJ A;  4CGZ A;  5LGT A;  4A0Y A;  1FSH A;  5JHU A;  1ONV A;  4IRH A;  3L09 A;  3F8B A;  5DYM A;  2VC1 A;  4KN4 X;  4ZYE A;  2RC4 A;  4ESF A;  1LQ1 A;  3SFZ A;  2XAQ A;  2DLL A;  3FZV A;  3H3U A;  2CSO A;  1ZRF A;  4OMY A;  1A04 A;  1KYZ A;  2P4W A;  3NRV A;  3P9C A;  2NNY A;  1R22 A;  1IXS B;  3M9A A;  3DP7 A;  2DW4 A;  5CVI A;  4EM1 A;  2L01 A;  4UHT A;  2XRO A;  3S2W A;  2GXB A;  1K7A A;  2DI3 A;  2RGV A;  5IT9 K;  1JXS A;  3GXO A;  3HRT A;  5K5R A;  5DCM A;  1BOA A;  3HTU A;  3RPQ A;  3J7A O;  2FRH A;  1S29 A;  2EA2 A;  1ZLJ A;  1D8K A;  2XAF A;  1YTY A;  4KDP A;  3D0S A;  1J5Y A;  3U9G A;  2VBW A;  4EM2 A;  1ZG1 A;  5K5Q A;  1TTY A;  4M9S A;  3Q5F A;  2PG4 A;  2QBY A;  5F6F A;  1W7P D;  1HKQ A;  3FXQ A;  2YU3 A;  1HSJ A;  2XKP A;  2A68 F;  5BOX A;  1WQ2 A;  1BIA A;  2H94 A;  1Z9C A;  3KET A;  1EV7 A;  1G3T A;  1XGO A;  2M5W A;  2EWN A;  5LLQ A;  1LB2 A;  3G3Z A;  2RQP A;  2G9W A;  3V4G A;  3FXU A;  5BPI A;  2L02 A;  1B9M A;  5FD6 A;  1YG2 A;  2KRF A;  4U88 A;  1IRF A;  4ZZD A;  1FYK A;  2EB7 A;  2YX4 A;  4HA8 A;  2F5F A;  4KIC A;  1O7F A;  4BAY A;  1OMI A;  3R0J A;  2WC2 A;  4AIK A;  4M6X A;  3CO6 C;  2AS5 F;  3F23 A;  4DNC A;  3RJP A;  2M87 A;  3JTG A;  1FPQ A;  1W5T A;  2OQR A;  5LRS A;  5LHG A;  4WXC A;  4P55 A;  3RYP A;  2HR3 A;  1R23 A;  3WE2 A;  1WSU A;  3CUQ A;  1O3Q A;  5ICG A;  2FBI A;  2C6Y A;  2JSC A;  1XCV A;  3TQN A;  2LSO A;  4DQ2 A;  3QAH A;  4EGZ A;  3MZH A;  2HFH A;  2H6C A;  1OYY A;  2OQG A;  3TO6 A;  4YIF A;  4M6Y A;  4KMF A;  3KP7 A;  4EJV A;  2GWR A;  3EET A;  1LEA A;  2DK5 A;  3E5U A;  1U78 A;  1SD4 A;  4WXD A;  2PLY A;  5CVJ A;  2CO5 A;  4RB3 C;  5FLX Z;  1HW5 A;  5KK1 A;  3KP2 A;  1JHF A;  3NEU A;  2TDX A;  1BN5 A;  4NHJ A;  3O2P E;  2V79 A;  2UZK A;  2DBB A;  2M8E A;  2P5K A;  3WU1 B;  4LG0 B;  2IT0 A;  1RNL A;  2ZBK A;  4LMY A;  1KQ0 A;  3WG9 A;  3ERE D;  2MBF A;  1YIO A;  1U5T A;  3E5X A;  2EV0 A;  3F8N A;  2Z99 A;  3DEU A;  3KLO A;  5HLI A;  1LJ9 A;  2BE5 F;  5HS8 A;  1MD0 A;  3L9F A;  1FBS A;  2VOO A;  2GIV A;  3I59 A;  1G4D A;  3TKY A;  5LGN A;  1IXR C;  2P6S A;  3JSP A;  4EJO A;  4U7D A;  2EFW A;  3REO A;  1U2W A;  4KYW A;  3SHF A;  2F5D A;  1E2X A;  5HVQ C;  1B1B A;  2L54 A;  3DQV C;  3SXY A;  1P4A A;  1T6S A;  4ESB A;  3TO9 A;  4XLN F;  2IRF G;  4EVI A;  2Z5U A;  5CVU A;  3ZN1 A;  1ZRD A;  1W5S A;  5E1W A;  4P5O A;  4HDU A;  3GFL A;  4EJU A;  2DPU A;  1I5Z A;  4AIH A;  4UUV A;  3KLN A;  1MKM A;  1HW1 A;  2ZFW A;  4PCQ A;  3COA C;  2CQK A;  2UXN A;  1ULY A;  2FNP A;  3ECH A;  3R4K A;  4NQW A;  2PFB A;  1P92 A;  1F4K A;  1B59 A;  2ZO4 A;  2G7H A;  5KVR A;  2A5Y B;  1XGM A;  4G94 A;  5DV5 A;  2D2W A;  4S05 A;  1TW3 A;  2QM3 A;  3FM5 A;  3K0L A;  3HIF A;  3HHG A;  2P7C B;  2L4M A;  3M8F A;  1G3Y A;  3ABU A;  3I58 A;  4ENK A;  3LST A;  3QPH A;  3GZ6 A;  1XB4 A;  3J81 Z;  1OPC A;  2HYF A;  3WTS C;  1UHM A;  4ENJ A;  2DQL A;  4L5I A;  1XSX A;  1FSE A;  1LDD A;  1KQ8 A;  1YLF A;  2H6B A;  4YFN F;  2HEO A;  2PMH A;  1UCR A;  4YG2 F;  4R1H A;  3DPL C;  3HRU A;  2RDP A;  3FX3 A;  4A0X A;  2OA4 A;  3B02 A;  3ZQ7 A;  2NNN A;  5FO5 A;  4BQA A;  2A69 F;  1ZYR F;  2R3S A;  1T38 A;  1V4R A;  5FB2 A;  2Y48 A;  1IZ1 A;  1WRJ A;  3WU0 A;  5D8K B;  5E17 F;  2FE3 A;  5J8F A;  1XN7 A;  1K78 B;  3MAJ A;  4LD5 A;  2IW5 A;  3JAM K;  1Z7U A;  3VB2 A;  3DF8 A;  3M7G A;  2ZXJ A;  3BP8 A;  3V8K A;  5CVR A;  1TW2 A;  3E6B A;  1YQA A;  4I0B A;  2DQR A;  3FMQ A;  2VBX A;  1WWX A;  3FXR A;  1ZAO A;  2HGC A;  2XIG A;  3QOP A;  1ZRC A;  3P9I A;  4I98 B;  3GX4 X;  1ODD A;  4I02 A;  2D1H A;  4N0B A;  4B09 A;  1TNS A;  2EV5 A;  2XKO A;  3N97 A;  1JGS A;  4LGW A;  2DAO A;  2COM A;  1GXP A;  4FX0 A;  5E1Z B;  4BHB A;  3LAJ A;  3V7S A;  1I6X A;  2DFI A;  2ZKZ A;  5DDG A;  1ZG5 A;  2XUB A;  4HZF A;  4HF0 A;  4HV6 A;  5FFZ A;  5HLG A;  4HX4 A;  3KP3 A;  4LB6 B;  1KQ9 A;  2A6E F;  1SD7 A;  4GCV A;  4P9U A;  1BI1 A;  1BM9 A;  1V3F A;  1BI2 A;  2QVO A;  3VEP A;  3GEZ A;  4OIQ F;  3W6K B;  1IN6 A;  4KIF A;  3WGH A;  5DD8 A;  2LF8 A;  3OV8 A;  3DFG A;  3RKX A;  1I1S A;  2JZY A;  1TBX A;  3FMS A;  2H09 A;  2QLZ A;  4CZZ A;  4KA4 A;  5ILS A;  4KMU X;  4O3M A;  1QZZ A;  1MZB A;  1BBY A;  5EEH A;  2JTV A;  5D6E A;  2QQB A;  2M1B A;  2HS5 A;  2XHK A;  4HV5 A;  3GUD A;  4BYY A;  1MDM B;  4L5J A;  3W6J B;  5LEK A;  4L0Y B;  4RGR A;  2J5P A;  3GFJ A;  3BJ6 A;  2X4H A;  4HF1 A;  3G73 A;  2Q2E A;  1G3S A;  3T0Y A;  1DPU A;  1U3E M;  3C18 A;  3ML6 A;  3LA2 A;  1SFE A;  3I0T A;  1FWZ A;  4G6D A;  4MTD A;  3I4P A;  3RDI A;  3BJO A;  1CGP A;  4CIC A;  2DTR A;  1FOK A;  2FML A;  2FBK A;  4Q5S F;  4ZH4 F;  5EEG A;  2CYY A;  1R5H A;  5E1X A;  1BI3 A;  5ILV A;  2NAZ A;  2A6H F;  3JW4 A;  4S04 A;  4EV0 A;  3RYR A;  5HS9 A;  3ZMU A;  3L00 A;  5IT9 Z;  2KKO A;  1H0M A;  4HX8 A;  1QZY A;  5D5W B;  3VOD A;  4ENN A;  3GO5 A;  2ISZ A;  1ZGA A;  2VXZ A;  4QWQ A;  4EMS A;  2W85 A;  5F64 A;  1R5G A;  3WE3 A;  1MJB A;  3T1B A;  4R79 A;  1KU7 A;  2EA4 A;  5H20 A;  2Y0M A;  3GFM A;  4EJT A;  3R60 A;  1AWC A;  4KNY A;  1J75 A;  4LFU A;  2STT A;  4L9N A;  1E17 A;  4ETS A;  3J80 K;  1Z91 A;  2L3D A;  1R00 A;  2QEN A;  2GQQ A;  4A5N A;  2KJB A;  4YFK F;  2NRA C;  4JK1 X;  3I5U A;  2V9V A;  3ULQ B;  2FNA A;  2AXL A;  1R58 A;  3SZP A;  4HF2 A;  3ZMD A;  3HHH A;  4IVN A;  4KT5 C;  4GO1 A;  1LVA A;  1QQI A;  4UXN A;  3EYY A;  1PUE E;  1ZN2 A;  4G7O F;  1R1V A;  1X3U A;  4Q48 A;  5JR3 A;  1SFU A;  5HS7 A;  2JT1 A;  2VC0 A;  2OD5 A;  1B6A A;  4BNC A;  3K1N A;  4PDK A;  4HW0 A;  2HOE A;  1YW7 A;  4ZZL A;  3LAP A;  4O6J A;  1FNN A;  5ERI A;  1YW8 A;  1L3L A;  2M45 A;  2VE9 A;  2HWV A;  2QQA A;  3KEQ A;  2IA0 A;  5LHI A;  1ZHF A;  1I27 A;  4ASN A;  3IKT A;  3PQJ A; 
#chains in the Genus database with same CATH topology
 5FLM J;  4NC7 A;  1XDS A;  2GA2 A;  4XKW A;  2XPW A;  2LVS A;  1D3Y A;  2ZXW H;  3GF2 A;  4LLL A;  2VQL A;  1JJ8 C;  4LB5 A;  1J9I A;  2PMZ A;  5BPD A;  4RLQ A;  3BCB A;  2KDO A;  1XCB A;  3BLY A;  1TNT A;  3R6S A;  1TT0 A;  4KUM A;  2K4B A;  4IOC F;  2J5O A;  5EG0 B;  3VYS B;  2LBF A;  2FQ3 A;  3BDD A;  1XPX A;  3GTP J;  4I01 A;  4OIN F;  3CJR B;  1K61 A;  3BPV A;  3KFW X;  2LY9 A;  3MKW B;  2MC3 A;  1MW7 A;  4XOT A;  4EEF G;  4M9X A;  4BUP A;  1JJ6 C;  4HOB A;  2LP0 A;  2V4J C;  2LBF B;  5JLW A;  3TED A;  3GZ5 A;  1DGW Y;  5FRN A;  4RBO A;  2FQ4 A;  2R7S A;  1BR2 A;  4QLC U;  5GPC A;  4A3F J;  4G8X A;  3PL8 A;  4A0Z A;  2X0L A;  1Z67 A;  3E6C C;  1A31 A;  2MD5 A;  4MNU A;  3KP4 A;  3KP5 A;  4XOP A;  1IC8 A;  2AQF A;  3DBH B;  5HOD A;  3SFI A;  4LG0 A;  2O8X A;  3SDG A;  1YW9 A;  2OBP A;  2JUC A;  2XGX A;  2G7U A;  2BXY A;  3LSJ A;  4OAZ A;  5E8I A;  3L2Q A;  3RZO J;  3ZMT A;  3E97 A;  2F2E A;  3A02 A;  2IA1 A;  3EUH A;  2CV2 A;  2MGQ A;  2NS7 A;  5J1Y A;  1S72 I;  1QNT A;  4IL6 C;  4E70 A;  1FY7 A;  2VBY A;  1DU6 A;  3AL0 C;  2IA2 A;  2VBZ A;  2ZME C;  1J59 A;  4IRG A;  3Q9V A;  4ZYD A;  2EK5 A;  1VZ0 A;  5F08 A;  4GYG A;  2WB1 N;  3BZK A;  2YR2 A;  2XVC A;  1OCP A;  3E7L A;  2ZJ2 A;  3ZN0 A;  3JSO A;  1G6N A;  2LNB A;  4A2U A;  3H35 A;  1FTZ A;  1ZH5 A;  3RZD J;  3LQQ A;  1L0O C;  5EJC A;  5L3G A;  1LDJ A;  2OZU A;  2XGE A;  2Z2S B;  4N4N B;  3OYK A;  4J00 A;  2GA1 A;  1IXC A;  4B1R A;  2P5L C;  5A2Q K;  1BC7 C;  2L4A A;  2JMW A;  3Q9S A;  4AM3 A;  1X4O A;  3CMA I;  2M0C A;  1Z0X A;  2VUM J;  3OR1 C;  2YX7 A;  1WVR A;  4BU2 A;  3RKW A;  1HKT A;  2D1V A;  3RI4 A;  3WOD F;  3ISP A;  1E3O C;  1MMD A;  1WJE A;  3I54 A;  4NC8 A;  1NTC A;  4LLG F;  5IT3 A;  3CO7 C;  1SMY F;  3ZQL A;  2XB5 A;  1PVE A;  3SJM A;  2QKL B;  2WAQ N;  4UVA A;  3PFY A;  2ZC2 A;  3B73 A;  1HQC A;  3OY9 A;  1TL8 A;  1OFC X;  3MKY B;  1KA8 A;  3K9T A;  1FBU A;  3BY6 A;  1WI9 A;  4ZYH A;  2JK3 A;  4FT8 A;  3NWS A;  1MJ9 A;  4FIS A;  2KFD A;  1T8I A;  4FE4 A;  3K2A A;  3L2R A;  1O3T A;  3WU2 C;  1POG A;  2VXD A;  3JRG A;  2B9S A;  3ZPL A;  4B47 A;  3DCF A;  4U0V A;  2DCE A;  5F04 A;  3RPU A;  3BPX A;  4XKC A;  3P7N A;  4DIQ A;  4P9F A;  5CQG A;  1Z05 A;  1ETW A;  2ESH A;  2V26 A;  3PO3 J;  4B3A A;  3BQZ A;  2ZJQ F;  1SMT A;  2H1K A;  3LSK A;  1P4W A;  1S7O A;  1K6O A;  2FSW A;  1S6L A;  2XAS A;  3LSM A;  3M8E A;  3WGG A;  1HLV A;  1ZR2 A;  3L7W A;  1LUJ B;  2W84 A;  1R9T J;  1HW2 A;  5AIQ A;  3F6O A;  1AA7 A;  2UWM A;  2P5V A;  3GTG J;  1YYV A;  4TV7 A;  3IRQ A;  1DUX C;  1PDN C;  1JUM A;  1JI8 A;  1DP7 P;  2KQR A;  3U21 A;  3VOE A;  3DKY A;  1MBE A;  3PQJ A;  2EZH A;  1NHA A;  1TQI A;  3DU5 A;  1VQP I;  4E7K A;  2WAD A;  3F21 A;  2LKX A;  1JUP A;  2PQ8 A;  1W36 C;  2E7X A;  2KRH A;  1ZRE A;  3KEY A;  1D8J A;  2KIU A;  4DZP A;  3FF5 A;  2LRE A;  3H92 A;  4XN0 A;  4BGD A;  1W0U A;  1SAN A;  2MFZ A;  4G12 A;  2TCT A;  5GTI C;  5FFX A;  4X6A J;  2KZV A;  3GME A;  3RTR A;  1P7J A;  5LGU A;  1B72 A;  2BYV E;  2ZME A;  4IF4 A;  4RAZ A;  3QOD A;  4XK4 A;  1U9N A;  4JP0 A;  5C4J J;  2K9N A;  1R1T A;  3KCC A;  3CTA A;  2O0Y A;  4ZYG A;  1LFB A;  3OYE A;  2LK2 A;  1TZL A;  5FLV A;  3HZJ A;  2JJ7 A;  4XSZ F;  5E18 F;  2X6O A;  2DK8 A;  2VE8 A;  3AL0 B;  4UB6 C;  3WG7 H;  3C7J A;  2ZME B;  4L18 B;  4I99 C;  1J0R A;  2GXG A;  2XPV A;  3U1D A;  2L7M P;  3AFH A;  3G4S I;  4L9J A;  2CW8 A;  2D45 A;  3ERM A;  1BI0 A;  1O3R A;  3MFK A;  2QF7 A;  4XBF A;  4HAM A;  3TOA A;  3CES A;  4BJT A;  1X3Z B;  1FP2 A;  1ETO A;  1TQP A;  2WBM A;  5JLX A;  3TO7 A;  4OIP F;  2RN7 A;  2K9L A;  4CDG A;  1HST A;  5BQT A;  1I3A A;  2FMY A;  3D1N I;  2F4I A;  1JGG A;  4WF2 A;  4YRV A;  3OMY A;  3TOB A;  1SVO A;  5JHF A;  1XGS A;  1QBJ A;  4HBL A;  1K4S A;  4FET A;  3ZP5 A;  4G7Z F;  3H0D A;  2XF5 A;  3HC7 A;  2F4O B;  5CLS A;  4U7B A;  1K78 A;  4GXO A;  1RUO A;  3BRO A;  1RI7 A;  5K7H A;  1HKS A;  4M3D A;  3F6V A;  4HQM A;  4OAY A;  3PUF A;  4R8H A;  1SEU A;  4CYD A;  4LJZ F;  1UAA A;  5DM6 F;  2ADU A;  3GFI A;  3EDP A;  5LFA A;  1CQT A;  3HJE A;  4A3E J;  4Z2Y A;  1TQM A;  3GLX A;  5CYV A;  3FM3 A;  3OS1 A;  4PJM A;  2Y9Z A;  2NS0 A;  3FXK A;  1UB9 A;  4HNU A;  4CCO A;  4KIG A;  2R7V A;  1H9G A;  1B8I A;  3VFZ A;  1EJ9 A;  2IAI A;  1EH6 A;  4DYR A;  2O61 A;  5CVV A;  2DU9 A;  1N78 A;  3MCZ A;  1HXD A;  2JA5 J;  1FYL A;  1V5F A;  4CCL A;  3JAM Z;  3E5Q A;  2IXS A;  3IHU A;  4OU0 A;  1IN8 A;  1YRN A;  4V2F A;  5IYB J;  5C3E J;  2R5Y A;  2WTE A;  4UVB A;  4AC0 A;  2ACJ A;  1B8I B;  3OYF A;  4RB0 A;  3HKZ A;  2JA7 J;  1MBF A;  4RMN A;  3GW2 A;  5DD4 A;  3KEO A;  5EYR A;  1XSD A;  1K79 A;  1UST A;  3OL3 A;  5H6R A;  1JKP C;  5TJJ A;  3RPU D;  3G1L A;  1IJW C;  3ZQC A;  3PSF A;  4DW6 A;  4IHV A;  3QPT A;  5J3L A;  2DOF A;  2HQ5 A;  4CXF A;  2PEX A;  2X6X A;  2QWW A;  3V8L A;  3PO2 J;  3GZN B;  4A6D A;  3S2H J;  4N9I A;  3F3X A;  5DS9 A;  2K27 A;  1JKO C;  4UV8 A;  1QU3 A;  2DTZ A;  1D5V A;  1HBX G;  2E5Z A;  3TDZ C;  1WGX A;  2CJJ A;  5IYD J;  2P0W A;  4RM3 A;  2VQC A;  3RKQ A;  3W2V A;  3D5L A;  4B8X A;  3FK7 A;  2ZXI A;  2LR8 A;  3EUA A;  4KFC A;  3H5R A;  2KIF A;  5DCF A;  2ID6 A;  4YFX F;  4IRI A;  4WCG A;  1Y39 A;  4HST A;  3IP4 B;  2D5V A;  4A12 A;  4M73 A;  1MBJ A;  5K7F A;  1S7A A;  3LFU A;  4MEX F;  2EZI A;  1YJN I;  3SDB A;  3MN2 A;  5D6F A;  1SVM A;  5E3M A;  3JRE A;  3CZ6 A;  2HQR A;  2FEZ A;  1IV6 A;  2DOD A;  1VQL I;  2COB A;  4WWC A;  5H6Q A;  4M74 A;  1F9N A;  3U2R A;  1NK2 P;  2NVT J;  1PP7 U;  2Q1Z B;  3H0G J;  2X85 A;  2RV8 A;  3TDU C;  3ZQF A;  5GAD J;  1XMK A;  1RUN A;  3U1K A;  2E1M C;  2EJR A;  2OTJ I;  1W7P B;  2FXA A;  4UUS A;  3DKX A;  3PFI A;  5F1J A;  2Z33 A;  1BC8 C;  1LNW A;  1MBH A;  1LEB A;  3E0J B;  3OOP A;  3CLQ A;  5DUI A;  4XN3 A;  4XLP F;  1R1U A;  4GDF A;  1V54 H;  1R4M B;  3G6E I;  2R7W A;  2JA6 J;  1VQ5 I;  2CMP A;  1QGP A;  4A3B J;  4PGH A;  1FX7 A;  5LEJ A;  3HRM A;  1MNM C;  3ONQ A;  2CFX A;  4UUS B;  1T0F C;  5D4R A;  3S1Q J;  2EFP A;  1TLH B;  3DXJ F;  4GGG A;  2PMU A;  1MSE C;  4AYB N;  3K70 D;  1SD6 A;  3O6B B;  3ZOB A;  1MDM A;  2VOP A;  3DKW A;  2EFO A;  1S8N A;  2EIJ H;  4WX9 A;  4Q4Z F;  2DPD A;  4B48 A;  1Y0U A;  1JKQ C;  2KLO A;  2VN2 A;  3MKZ A;  2VIX A;  4XLE A;  5IOZ A;  1K4T A;  3NAU A;  3KZZ A;  4A93 J;  1FP1 D;  2H27 A;  5JVT A;  4B4C A;  5LHH A;  4MEY F;  1T2K A;  4L9V A;  1Y1V J;  2MH9 A;  4HSR A;  1RKT A;  4M3G A;  3CCJ I;  2ZNZ A;  1MH3 A;  4XLH A;  5J4V A;  4GRI A;  4D5F A;  3BG5 A;  2DFF A;  1X1B A;  2LY1 A;  3RQ4 A;  5ILU A;  4XSX F;  2ZNY A;  4L9T A;  5B66 C;  1IRG A;  3FWE A;  1J7K A;  1PP8 F;  3QWL A;  4IOA F;  4U0Y A;  2LOO A;  4RGX A;  3IWZ A;  2V1X A;  3HOZ J;  3AG1 H;  3AG3 H;  4A6E A;  3WTW C;  2Y75 A;  2Y0S N;  2GBY A;  3OYI A;  2V1D A;  2FJ1 A;  1G3W A;  2P8T A;  2VKE A;  2F5E A;  3IL2 A;  2OTL I;  3F72 A;  5HLH A;  2XGD A;  4LK1 F;  1G8X A;  3JRC A;  3K7A J;  3HTS B;  3IC7 A;  1IW7 F;  2XRN A;  4CA0 A;  1IDY A;  1XMA A;  2A3S A;  3C2B A;  4NB5 A;  1EH7 A;  2FU4 A;  3LQR A;  5D5U B;  2XAJ A;  3CD6 I;  1ZG3 A;  4XLA A;  2VJJ A;  2GAU A;  4DOZ A;  5K5O A;  1W36 D;  1QO0 D;  2OAZ A;  1LE8 A;  1P6R A;  3H1C A;  2V1U A;  1R7J A;  3MQ0 A;  4HPQ A;  5K1Y A;  3CCU I;  3I4N J;  4I09 A;  4N9H A;  2KHM A;  1U8R A;  1SAX A;  4WK8 F;  5HDN A;  4OIO F;  3E6M A;  4H0E A;  1DPR A;  4NC6 A;  4BBS J;  1RET A;  2A05 A;  3BTC A;  4X0G A;  5CJ9 A;  2JPB A;  5EZG A;  5L3C A;  2GZW A;  4BKX A;  2DYS H;  3K2Z A;  2Q8K A;  1A35 A;  3TMO A;  1JE8 A;  1ZLK A;  2CRG A;  2E5N A;  3W2W A;  2E1C A;  2Y2Z A;  1FT9 A;  4NUB A;  1VND A;  4E7J A;  1QVT A;  3BJA A;  4Y52 J;  2E1M B;  2XF6 A;  2BY1 A;  3DLA A;  2L7F P;  3OYB A;  2W82 A;  4RS8 A;  1T0F A;  2FD5 A;  1J2X A;  2OC6 A;  3CUQ C;  5LRR A;  1VQ4 I;  3K4B A;  1VTN C;  5ICF A;  5DCM B;  4ENM A;  3I64 A;  3UNG C;  4X1E A;  5J47 A;  2BY2 A;  5LBQ A;  3ZCO A;  1OR7 C;  4BE1 A;  4XL9 A;  4BQO A;  2STW A;  2XAH A;  2PX9 A;  4HX7 A;  1BW6 A;  4AIJ A;  2XV4 S;  1D1A A;  3FXO A;  3QRF F;  3S3N A;  2K86 A;  3KE2 A;  5GTH C;  3HXL A;  5GAH J;  1PUF B;  1IN4 A;  3ELK A;  2ZCW A;  1GVD A;  2Z3Y A;  4XIC A;  2M3A A;  4HQE A;  3L2U A;  4MIM A;  3LA7 A;  2PI0 A;  2V9K A;  3JTH A;  4U0W A;  1KU3 A;  3HRS A;  2GM4 A;  4M71 A;  4LK0 F;  4PZJ A;  3EYI A;  2QBY B;  4PJJ A;  3K6G A;  1DDN A;  2Q0O A;  1MNE A;  2KJC A;  3HGY A;  3L2C A;  1RZ4 A;  1W1W E;  1AOY A;  4IJA A;  4RM2 A;  3J80 Z;  3KIO A;  1DU0 A;  2ZFU A;  2W24 A;  2ISY A;  3H9G A;  5FD5 A;  3CJQ B;  5FGM A;  3I9V 2;  3OYJ A;  3IKV A;  3KZY A;  3GWZ A;  1Q1H A;  1TWH J;  1BIB A;  2A07 F;  2AXT C;  2YS9 A;  3S1N J;  1YO5 C;  2E19 A;  3CJN A;  2P7V B;  2F6C A;  3FK6 A;  1UG2 A;  2ELH A;  3BG9 A;  3CUO A;  3IH4 A;  2WWY A;  1IF1 A;  2ETH A;  1V5G A;  1SC7 A;  3PNY A;  1VQ8 I;  5L3E A;  1TC3 C;  3TL4 X;  3MEX A;  4AU7 A;  1F1Z A;  1OYI A;  4MFE A;  4QTR A;  3GTO J;  3VYU B;  2EIK H;  2O03 A;  5CPR B;  2X9D A;  1RIO H;  5J8C A;  3PQK A;  4ZDL A;  2W57 A;  1OYW A;  2R4G A;  3HSF A;  1HCR A;  1VQK I;  1FLI A;  2O7O A;  3OYD A;  1MMN A;  3BZ6 A;  3ECO A;  4A5M A;  1P9Q C;  1BOB A;  2EIM H;  3V7R A;  4C9Y A;  4HYE A;  1U5T C;  3I71 A;  1BJA A;  2L7Z A;  3DU6 A;  5HDK A;  2V1N A;  2XB0 X;  2DMN A;  5AON A;  3M4O J;  2NOJ B;  4FX4 A;  2RNJ A;  3CDH A;  3F8M A;  2RRE A;  3RKY A;  3H9J A;  2IPQ X;  2K9S A;  4I0A A;  5DTD A;  1GDT A;  1EKE A;  3HOT A;  2DFH A;  2YSR A;  1H9T A;  4BL0 B;  2MLG A;  5EG0 A;  1ON1 A;  2ZJR F;  2BV6 A;  4JBA A;  3IWF A;  2HZT A;  5C44 J;  4KJZ A;  3CMM A;  5ICE A;  3D5S C;  3A01 B;  4RAY A;  5EZH A;  1IUF A;  4BHP A;  4IHT A;  1XD7 A;  2E71 A;  2YPR A;  1GUU A;  3H5A A;  3MWM A;  3ZMS A;  4W97 A;  2DMU A;  3ZMV A;  1USS A;  4HDV A;  2WV1 A;  1GVJ A;  3QU3 A;  4KT6 A;  1YHQ I;  2EV6 A;  1D0X A;  5ICC A;  3FHZ A;  3QYE A;  1JTY A;  4RDU A;  1WH7 A;  3MKL A;  4E7L A;  1FC3 A;  3S14 J;  3OYG A;  1OR7 A;  4LIT A;  2O6G E;  3CC7 I;  1SFX A;  1X3W B;  5F1R A;  3F8F A;  3WTZ A;  2F5C A;  3CC2 I;  3J7Y J;  2VQG A;  5FKK A;  3JRH A;  1P2F A;  4MTE A;  4Q47 A;  3CUQ B;  2QYO A;  4XQF A;  3MVP A;  3LSR A;  3H3Z A;  3E3V A;  4ANJ A;  3WTT C;  2Z16 A;  2JSP A;  2Y31 A;  2BGC A;  3E6D A;  3BR5 A;  4Y15 A;  3QU6 A;  2JUG A;  4KN7 X;  3VYT B;  3IV5 A;  3IUO A;  2QSG X;  3JRF A;  5FLX K;  3P9K A;  2IVM A;  3H36 A;  2B7E A;  5BS6 A;  3M8J A;  2EFQ A;  3DTE A;  1FZP B;  1WJB A;  2K3P A;  3H5N A;  1EA3 A;  1OKR A;  4IXA A;  5EGO B;  2HOA A;  2CUJ A;  5D5V B;  3FXL A;  2JRT A;  1IN5 A;  1GLN A;  4UY8 I;  2HTJ A;  2LKP A;  1OCR H;  5J6X A;  3LNQ A;  2MA3 A;  2QQ8 A;  4F7Z A;  2FOK A;  4UUT A;  5CKT A;  5HOO A;  1B9N A;  4K2E A;  3GYH X;  1T98 A;  2PJP A;  2HYG D;  2UXX A;  4PFP A;  1EF4 A;  1W4M A;  2W4S A;  3CP8 A;  4FTH A;  4Y4R A;  3HSE A;  2V6E A;  3L2V A;  3BR1 A;  2FOW A;  2R7F A;  1N75 A;  4EGY A;  1WJ5 A;  1MBG A;  3T8R A;  2HXI A;  4AVZ A;  4AWX B;  9ANT A;  2GLO A;  5B1B H;  3LSP A;  3FMR A;  1T39 A;  2QQ9 A;  2QZ8 A;  2R7O A;  5BMZ A;  2E2J J;  3ASN H;  2DMQ A;  5M5Y J;  2VJI A;  5JFR A;  3DBL B;  2L2O A;  3AG2 H;  3PIO F;  1O57 A;  2HKO A;  2CQ7 A;  3BOQ A;  3R0A A;  3T8T A;  2DA5 A;  4G6Q A;  3SEQ A;  2Z1D A;  1WHU A;  1JHH A;  3SQN A;  4BS9 A;  2MAB A;  1FJL A;  2HTS A;  4E4H A;  5E8G A;  1IN7 A;  5A2Q Z;  3QP6 A;  2LDU A;  2ME0 A;  3OYC A;  2NVX J;  2N8G A;  3WGI A;  4E7S A;  4AID A;  2CW0 F;  1U5T B;  2H8W A;  4RGS A;  3R61 A;  2LMD A;  2M8G X;  2KIM A;  2HVQ A;  5EDN A;  2IJL A;  1QHH D;  3WTX C;  2R7Z J;  1UMQ A;  4XLF A;  4BXU A;  2W25 A;  1A36 A;  5JVG F;  2XAU A;  5HDG A;  1Z6R A;  2CQQ A;  4I2O A;  3E1S A;  3T5X A;  1XGN A;  4UV9 A;  2DJI A;  1KZH A;  4JQF A;  5E20 A;  4IHY A;  1ON2 A;  3LA3 A;  2HDD A;  3I59 B;  2M4K A;  3I3L A;  4Y17 A;  1WKM A;  1X1P A;  4G9Y A;  5IP7 J;  2EBI A;  3HUG A;  1BA5 A;  4O5V A;  1QPI A;  4Z6Y A;  1DGR M;  1GXQ A;  3GVA A;  4BQN A;  4OOI A;  5ED4 A;  5LD2 C;  2L9S A;  2JRM A;  4I6Z A;  2VL8 A;  4Y7N J;  3MZ8 A;  2K4J A;  4G6T B;  4XLC A;  4IPA A;  5KNL A;  3D5R C;  2QEX I;  3HUG B;  3OIO A;  4D0P A;  2QUF A;  1U6G A;  3S3O A;  1S7E A;  1ETV A;  3CF2 A;  2E7W A;  3SZT A;  4MFD A;  2OU2 A;  4FQG A;  3DEW A;  5L3F A;  3F22 A;  4QPO A;  1TP4 A;  1R4N B;  4CHU A;  2VJ5 A;  1PYV A;  2A61 A;  3HSR A;  3KX2 A;  1MSF C;  2HVR A;  2Z9O A;  3Q0U A;  4IO9 F;  4M72 A;  5L3D A;  1V5E A;  3BWG A;  3ZMZ A;  3IRR A;  2MW8 A;  1SD5 A;  1XDU A;  2EQR A;  3L1P A;  6PAX A;  2PMZ N;  1I50 J;  1UFM A;  4S0H B;  1X58 A;  3N4M A;  1STZ A;  2YU9 J;  1BL0 A;  2L9N A;  2XF7 A;  1S9H A;  4D7N A;  4HLX A;  3HL2 A;  3S17 J;  3I53 A;  3S8P A;  2E2I J;  4C3H J;  4ON0 A;  3LWF A;  1YX3 A;  2VAS A;  2QSF X;  5D8L B;  1MGT A;  2P6T A;  1Y56 A;  2CWE A;  1MMS A;  3DPT A;  2M9H A;  3K69 A;  2JPC A;  2ZSI B;  2NYX A;  3AAF A;  1O3S A;  5DEQ A;  3FBI B;  3J81 K;  4M6V A;  3RQI A;  3I56 I;  3C2G A;  1WCM J;  1ETY A;  2X1E A;  3KYL A;  2HXO A;  4XRS G;  1YFH A;  3CCR I;  2M30 A;  1AU7 A;  1MND A;  2AHQ A;  3RIR A;  4G7H F;  2PN6 A;  5J4Y A;  2K7L A;  2L7K A;  1A6Q A;  1VI0 A;  3LFK A;  4WXH A;  3WTU C;  1AHD P;  1Y6I A;  4UVC A;  2DO7 A;  4DYQ A;  4A3C J;  2K9M A;  4OIR F;  4KIB A;  2K5C A;  3VPR A;  4U87 A;  3HYI A;  3MD2 A;  2E2H J;  1FMV A;  1OCZ H;  3HBL A;  2FF4 A;  1JT6 A;  1ETX A;  1YS6 A;  3BZC A;  3ROU A;  4ESJ A;  1ZAR A;  2LF7 A;  3BTL A;  4C2T A;  5D4S A;  1UJ8 A;  4OMZ A;  3CMY A;  4XMY A;  2W7N A;  4BXX J;  3ESW B;  4QPQ A;  2EZL A;  2BOL A;  1KGS A;  2O3F A;  1K6Y A;  4YIR X;  2VT2 A;  4BJ6 C;  2MLK A;  1MJA A;  2K02 A;  3WHB A;  2M4G A;  2BBY A;  2EFN A;  3B6C A;  4PJ0 C;  5M3M J;  4EJW A;  2Y9Y A;  3C1D A;  4YII A;  1Z77 A;  4M9Z A;  4MO7 A;  4ZDP A;  1I39 A;  5EEA A;  4BDY A;  2H8R A;  2BZT A;  4PUS A;  2HQN A;  3HEF A;  2CUF A;  4PJN A;  1CF7 A;  4XRF A;  1XSV A;  1IV8 A;  2RKH A;  2WV0 A;  3S32 A;  3A0B C;  4XRS A;  2MH2 A;  4MQV A;  4IHS A;  5L3B A;  2FBH A;  4HLY A;  1KU2 A;  3M1C A;  2HOT A;  1QPM A;  5TGT A;  1Z21 A;  5BNG A;  1CF7 B;  1OCO H;  2CG4 A;  4BHC A;  3S3M A;  1KU9 A;  4ABZ A;  5D5X B;  1Z1D A;  5F27 A;  3I4M J;  4BH9 A;  2LRD A;  3NQO A;  4Y13 A;  1GHC A;  3LSI A;  2FA5 A;  3EQL F;  2VPR A;  2VON A;  3QP5 A;  3CLO A;  4GYI A;  1LDK B;  1R36 A;  2B0L A;  4BAC A;  4L0Z B;  1WFX A;  1O7L A;  1BJZ A;  2CGP A;  4AVP A;  2HDC A;  4RB2 C;  4EQQ A;  4QIW N;  1S3J A;  3KP6 A;  4XKB A;  3HB9 A;  5TRD A;  2BY0 A;  1FIA A;  1FYM A;  1KYW A;  3WTV C;  2CV0 A;  3OIQ A;  4ZTF A;  2CH0 A;  2HKX A;  3M1E A;  1VQ9 I;  2IP2 A;  5DUK A;  1HDD C;  4CO8 A;  3JR9 A;  3TP3 A;  1MMG A;  1E0E A;  2BVM A;  1ETQ A;  3WTY C;  1I6H J;  4MQ9 F;  5B3S H;  4JX4 A;  3GBG A;  4P96 A;  3TW6 A;  1IAW A;  3C3W A;  2IBD A;  5JI6 A;  1GT0 C;  1Z6T A;  2DA7 A;  3TBI A;  1FTT A;  2OCC H;  2BEO A;  2XAG A;  4N4O B;  1F43 A;  3ABT A;  4LLN A;  3ZQI A;  4MGR A;  1M1E B;  4RGU A;  2VT3 A;  3M3Y J;  1W7P A;  4FHT A;  2RVC A;  2DFE A;  1R71 A;  3F8C A;  3FDY A;  4DBQ A;  2IS6 A;  1FBQ A;  2BY3 A;  2ESN A;  3BC8 A;  1G59 A;  3V7C A;  1H88 C;  1C0W A;  2L0K A;  1ZGW A;  4HRI A;  3K1P A;  1B4A A;  2KPM A;  1P4X A;  1WJD A;  2V6C A;  3LMM A;  2XC7 A;  3DV8 A;  2Y69 H;  4UNO A;  3HOS A;  1YS7 A;  2R5Z A;  4Y3O A;  1TT5 B;  4RB1 A;  1I1G A;  2I10 A;  4ZYA A;  3PNT A;  3ZGK A;  4EM0 B;  2E1N A;  3HOX J;  2VOD A;  1REP C;  2BW3 B;  2PBI A;  2R5Z B;  4V2G A;  2OZ6 A;  1EH8 A;  2M7B A;  1FOW A;  3IAS 2;  3K1M A;  5AIP A;  4MHG A;  4F93 B;  3O3K A;  4CZC A;  1IUY A;  4AD9 A;  2R7D A;  3G1O A;  4I7H A;  1LKX A;  3PSI A;  4BY1 J;  2OPT A;  4CCN A;  1F5T A;  2E35 A;  3V8J A;  3MZY A;  3TGN A;  3KZI C;  2DT5 A;  4PGG A;  1ZGJ A;  2ICW G;  4CGZ A;  2R7X A;  2WY7 Q;  4F52 A;  5LGT A;  4A0Y A;  4IZZ A;  2BHY A;  1OJL A;  2R7U A;  1ZKG A;  1FSH A;  3FHN A;  3CF5 F;  2DT7 B;  5JHU A;  5C4X J;  1ONV A;  4IRH A;  3ZQG A;  3L09 A;  3HOY J;  3CDI A;  3F8B A;  5DYM A;  1BR4 A;  1AKH B;  5IOY A;  2VC1 A;  4KN4 X;  1YIJ I;  2GXA A;  1NG7 A;  3RCO A;  4ZYE A;  2P81 A;  2RC4 A;  4ESF A;  2DYR H;  3SFZ A;  2XAQ A;  1LQ1 A;  5HNH A;  2HPI A;  4PSW A;  2DLL A;  1TWF J;  4A3L J;  5KAI C;  5KHD A;  3CCV I;  4IHX A;  3FZV A;  2X6W A;  2OCE A;  3H3U A;  2CSO A;  1ZRF A;  4OMY A;  4LIV A;  4F91 B;  1A04 A;  1KYZ A;  2P4W A;  3NRV A;  3P9C A;  4M3E A;  2NNY A;  1ORK A;  1Z3Y A;  1WJA A;  1R22 A;  1IXS B;  3M9A A;  3CC4 I;  3DP7 A;  3OS0 A;  2DW4 A;  5CVI A;  2WY8 Q;  1W5C C;  1APL C;  2R0Q C;  3B6A A;  3PJR A;  4DJA A;  4EM1 A;  1XX5 A;  2L01 A;  3BG3 A;  5TIS C;  4UHT A;  3HPH A;  2XRO A;  3CCY A;  2ID3 A;  3S2W A;  3CJT B;  5F0C A;  4XR6 A;  2GXB A;  1TWC J;  3PNV A;  4ZTJ A;  1K7A A;  2DI3 A;  3HKZ N;  1XG1 A;  2RGV A;  4NDL A;  5IT9 K;  1JXS A;  3GXO A;  3HRT A;  5K5R A;  5DCM A;  1BOA A;  3HTU A;  3MMY B;  3OOU A;  3RPQ A;  3V42 A;  3J7A O;  4J01 A;  4RA2 A;  4BEH A;  2OV7 A;  2FRH A;  1S29 A;  2EA2 A;  5E3L A;  3TW7 A;  1ZLJ A;  4L5E A;  2F48 A;  4MLO A;  3O8G A;  3K4K A;  3ZRG A;  1D8K A;  2DMP A;  3ASO H;  2XAF A;  1PUF A;  4BY7 J;  1YTY A;  3K4C A;  2KIS A;  3J7A Y;  4KDP A;  3D0S A;  2WB1 A;  4BEH B;  1RKW A;  2MSY A;  1J5Y A;  3U9G A;  2VBW A;  4EM2 A;  1ZG1 A;  5K5Q A;  2E60 A;  1TTY A;  2DA6 A;  4B44 A;  2HOS A;  1X1A A;  4M9S A;  3SZG A;  3Q5F A;  2PG4 A;  1VQ7 I;  2QBY A;  2M0M A;  2ZXH A;  1YI2 I;  5F6F A;  1NH3 A;  2I8D A;  1W7P D;  1RC9 A;  2IS1 A;  1HKQ A;  1YE9 A;  2DMT A;  3FXQ A;  3K4M A;  2YU3 A;  4PJL A;  5GAG J;  1HSJ A;  2XKP A;  3ABL H;  4E7H A;  2F4M B;  2A68 F;  2LTP A;  5BOX A;  1WQ2 A;  1BIA A;  2EIN H;  2H94 A;  1Z9C A;  2WAQ A;  3KET A;  1EV7 A;  3A03 A;  5FKO A;  3GTJ J;  1G3T A;  3FIS A;  1XGO A;  4QSH A;  3Q0W A;  2M5W A;  2EWN A;  4PFO A;  3J7Z I;  3BR3 A;  5LLQ A;  2KMU A;  1ZK8 A;  1T33 A;  1OLT A;  1LB2 A;  2LC2 A;  3G3Z A;  4JOM A;  4XON A;  2VKV A;  1W0T A;  2RQP A;  2G9W A;  3V4G A;  3FXU A;  5BPI A;  2PJR B;  1UEL B;  4JX5 A;  3HOU J;  5HNF A;  1J09 A;  1VQN I;  1X19 A;  2L02 A;  1B9M A;  4DBR A;  5FD6 A;  1RPW A;  3O8H A;  4FE7 A;  1YG2 A;  1UZC A;  2KRF A;  2TRT A;  4I76 A;  4U88 A;  2IS4 A;  1IRF A;  4ZC3 A;  3A1Y A;  4ZZD A;  2LG4 A;  2V9P A;  1FYK A;  4B43 A;  4E7Z A;  2EB7 A;  4D1Q A;  3RSN A;  4CCM A;  2YX4 A;  1FOX A;  4HA8 A;  1IO2 A;  2F5F A;  3KYC B;  1WJC A;  3HOV J;  2QA4 I;  4UB8 C;  4KIC A;  1O7F A;  3A01 A;  4BAY A;  1BR1 A;  1MH4 A;  1OMI A;  3BG6 A;  3R0J A;  3OWT A;  2WC2 A;  5M3F J;  5H2F C;  1H89 C;  4AIK A;  2XPU A;  4M6X A;  3CO6 C;  1K83 J;  1ITY A;  2AS5 F;  3F23 A;  4DNC A;  4A3G J;  3A0H C;  3RJP A;  2M87 A;  1T95 A;  3JTG A;  2HU9 A;  3BTI A;  4HNV A;  1FPQ A;  1W5T A;  2OQR A;  3W6V A;  5LRS A;  4WXC A;  2EIL H;  4P55 A;  4BJ5 C;  5GP9 A;  3RYP A;  5LHG A;  2HR3 A;  1R23 A;  2IGO A;  3WE2 A;  1WSU A;  3CUQ A;  1O3Q A;  3L2W A;  5ICG A;  2FBI A;  2DDB A;  1PJR A;  2C6Y A;  2JSC A;  3DBR B;  2L9V A;  4B3X A;  2FUG 2;  1XCV A;  3TQN A;  4A69 C;  1IGN A;  2LSO A;  1ETK A;  3S1M J;  1ACI A;  4D7M A;  4DQ2 A;  3QAH A;  1IDZ A;  2E36 A;  4ITV A;  4EGZ A;  3ABM H;  5FJ8 J;  3MZH A;  5FRM A;  2HFH A;  1ZQ3 P;  2H6C A;  1OYY A;  1IRZ A;  2OQG A;  3CCM I;  1Y1W J;  3TO6 A;  2W00 A;  5CQE A;  4YIF A;  5EGO A;  2KZG A;  4M6Y A;  4KMF A;  3H3V K;  5B5E C;  3KP7 A;  2XSJ C;  2L5Q A;  4EJV A;  2GWR A;  2MYS A;  3SYT A;  5IPA A;  5IYC J;  3HPG A;  4BDZ A;  2OJE D;  3EET A;  4YEL A;  1LEA A;  2V7F A;  2DK5 A;  3E5U A;  1JT0 A;  3OS2 A;  1U78 A;  1SFO J;  1HA8 A;  1SD4 A;  4WXD A;  1X2N A;  3ZXS A;  2CU7 A;  2PLY A;  5CVJ A;  2CO5 A;  4RB3 C;  5FLX Z;  1HW5 A;  5KK1 A;  3VSK A;  3KP2 A;  1JHF A;  3NEU A;  3GTM J;  2TDX A;  1BN5 A;  1WI3 A;  4NHJ A;  2RAE A;  4J19 A;  1X1D A;  3O2P E;  3OSF A;  2V79 A;  2KRC A;  2ME6 A;  4F3Q A;  2UZK A;  2DBB A;  4A3D J;  1DP3 A;  2P5K A;  1E3P A;  2M8E A;  3WU1 B;  1QZE A;  4LG0 B;  2IT0 A;  3H9Q A;  1RNL A;  1E3H A;  2DOA A;  2ZBK A;  4LMY A;  2BVL A;  1KQ0 A;  4D5C A;  3Q0V A;  3QYF A;  3G71 I;  4IEJ A;  3WG9 A;  4BXF A;  2BXZ A;  3HDD A;  2ZB9 A;  3ERE D;  2MBF A;  1YIO A;  3N05 A;  1U5T A;  3FXJ A;  3ABK H;  5IY5 H;  3E5X A;  2EV0 A;  3LSH A;  3F8N A;  2Z99 A;  5GAE J;  2KP6 A;  5J40 A;  3DEU A;  3CP2 A;  3KLO A;  5HLI A;  1LJ9 A;  2BE5 F;  2R7T A;  4NNJ A;  1MD0 A;  3VSL A;  5HS8 A;  3L9F A;  4CCK A;  2VKD A;  3HG9 A;  3K70 C;  1FBS A;  2G0E A;  2VOO A;  2XRL A;  2GIV A;  5DM7 F;  3I59 A;  1G4D A;  1OQY A;  3TKY A;  5LGN A;  3CQZ J;  2NVQ J;  1U0J A;  1IXR C;  2P6S A;  1XC5 A;  3K4J A;  3JSP A;  2X51 A;  3OYN A;  3IH3 A;  4EJO A;  2DOE A;  2LH9 A;  4NBQ A;  1VQ6 I;  4U7D A;  2RNG A;  3BR0 A;  3OYM A;  3QPL A;  2EFW A;  3REO A;  1U2W A;  3PIP F;  3GCM A;  3SHF A;  3JRB A;  2F5D A;  1A6I A;  4KYW A;  1E2X A;  3GTQ J;  4HG2 A;  1LVK A;  1WZ2 A;  4DZJ A;  3F9K A;  1D1C A;  1YOV B;  5HVQ C;  4DYC A;  2KIQ A;  2LFB A;  1B1B A;  2L54 A;  3DQV C;  2ELJ A;  3SXY A;  3CDL A;  1RES A;  2KDZ A;  1HDP A;  3S16 J;  4YEJ A;  1P4A A;  1T6S A;  4ESB A;  2AQE A;  2F5V A;  3TO9 A;  4BBR J;  2JA8 J;  5J1U A;  4XLN F;  2DXI A;  3GLL A;  2IRF G;  4EVI A;  2Z5U A;  1YIT I;  2DA4 A;  4LIU A;  2ELK A;  5CVU A;  2NVY J;  4XID A;  3ZN1 A;  1ZRD A;  1W5S A;  5E1W A;  4P5O A;  4HDU A;  3GFL A;  4EJU A;  2DPU A;  1I5Z A;  2NS8 A;  4AIH A;  3CCQ I;  2NVU B;  4UUV A;  5F0H A;  4LOC A;  3OSG A;  2O5R A;  4E6K G;  2CQN A;  1SFK A;  2AO9 A;  1MKM A;  2X1C A;  3KLN A;  1HW1 A;  4II3 A;  2ZFW A;  4PCQ A;  4C3J J;  3COA C;  3ZQH A;  3BCA A;  2CQK A;  2CUE A;  2UXN A;  3DEE A;  3LOC A;  1U8B A;  1ULY A;  2FNP A;  3ECH A;  3R4K A;  2JN6 A;  4NQW A;  2PFB A;  1P92 A;  1F4K A;  1IG7 A;  1B59 A;  5EF6 A;  4D9J A;  2ZO4 A;  3VDX A;  2G7H A;  3K10 A;  5KVR A;  2A5Y B;  3QPS A;  1XGM A;  2B63 J;  1LFP A;  4G94 A;  5FKM A;  1UHS A;  2O8K A;  2HDW A;  5DV5 A;  2D2W A;  4NQW B;  4S05 A;  1TW3 A;  2ZSH B;  4BE0 A;  4IHW A;  3OYH A;  2QM3 A;  3FM5 A;  3K0L A;  1B72 B;  5E79 C;  1ENH A;  1ZR4 A;  3HIF A;  4XRM A;  3HHG A;  2P7C B;  2L4M A;  4AYB A;  3DPU A;  3M8F A;  2K40 A;  1G3Y A;  3ABU A;  3I58 A;  1ZEL A;  4ENK A;  3BR2 A;  3LST A;  3QPH A;  3GZ6 A;  1XB4 A;  3J81 Z;  1OPC A;  3FKJ A;  2CV1 A;  2HYF A;  4CH7 A;  3WTS C;  3UKG A;  1UHM A;  4ENJ A;  1QA6 A;  2DQL A;  2DDA A;  4L5I A;  3AKZ A;  1LFU P;  1XSX A;  1FSE A;  4GFB A;  1LDD A;  1T08 B;  2OUM A;  1KQ8 A;  1YLF A;  2H6B A;  4YFN F;  2HEO A;  4XM3 A;  2PMH A;  4M3F A;  1TWA J;  2XDV A;  1Y8Q B;  1UCR A;  3S2D J;  2A6T A;  4KIT B;  4YG2 F;  4R1H A;  2VB6 A;  1H8A C;  2VJ4 A;  1D5Y A;  3DPL C;  1YX5 A;  2QGU A;  3HRU A;  1NG6 A;  2GIZ A;  2RDP A;  2E1O A;  3FX3 A;  4JYK A;  4A0X A;  2OA4 A;  3B02 A;  1X1C A;  3ZQ7 A;  2NNN A;  1Y8R B;  2WAE A;  3DTI A;  4IQJ A;  1D0Y A;  4KIS A;  5FO5 A;  4BQA A;  3W3C A;  5HLT A;  2A69 F;  1ZYR F;  2R3S A;  3JRD A;  1JUS A;  1T38 A;  4XOR A;  1V4R A;  3KPH A;  5IP6 A;  5FB2 A;  2LD5 A;  2Y48 A;  1IZ1 A;  2M34 A;  2Y0S A;  4BE2 A;  4F55 A;  3FXM A;  1WRJ A;  3WU0 A;  5D8K B;  5E17 F;  2FE3 A;  1X4P A;  3OIP A;  1MIJ A;  5J8F A;  1XN7 A;  2Y30 A;  2XSD C;  1YJ9 I;  1K78 B;  3MAJ A;  1TWG J;  4LD5 A;  4C3I J;  2IW5 A;  4CUG A;  1VF9 A;  3JAM K;  2XGC A;  3DTK A;  3G1M A;  4A3K J;  3LL7 A;  1Z7U A;  1SAU A;  1WH5 A;  3VB2 A;  4EAT A;  2W1O A;  3DF8 A;  3M7G A;  2ZXJ A;  3BP8 A;  2EH3 A;  1XS9 A;  3V8K A;  5CVR A;  1TW2 A;  3E6B A;  1YQA A;  1D0Z A;  4I0B A;  2DQR A;  3FMQ A;  2VBX A;  1WWX A;  3FXR A;  3M07 A;  5FRO A;  1ZAO A;  2HGC A;  2XIG A;  3QOP A;  1ZRC A;  3FKI J;  3CCE I;  4A3I J;  1R49 A;  2HNH A;  3FIW A;  1NK3 P;  4RAF A;  3P9I A;  4I98 B;  3GX4 X;  1GV5 A;  1ODD A;  1MBK A;  2UV1 A;  4I02 A;  2D1H A;  1Q1V A;  2L9R A;  4N0B A;  3S1R J;  4B09 A;  1TNS A;  2EV5 A;  1YRN B;  3W2A A;  2XKO A;  1N77 A;  3N97 A;  1KON A;  1JGS A;  2R5Y B;  4LGW A;  2CS3 A;  1ZTR A;  2DAO A;  2COM A;  4FAS D;  2VKH A;  1GXP A;  4FX0 A;  2HYJ A;  5E1Z B;  3UR3 C;  3C2H A;  4BHB A;  3LAJ A;  3HOW J;  3V7S A;  3S15 J;  3QOE A;  4IQ4 A;  1I6X A;  2DFI A;  2ZKZ A;  5DDG A;  1ZG5 A;  3Q3S A;  2XUB A;  4HZF A;  4HF0 A;  4HV6 A;  5FFZ A;  3S93 A;  5HLG A;  4HX4 A;  2R92 J;  1P7I A;  3CCL I;  3KP3 A;  4LB6 B;  1JTX A;  2NOG A;  5KAF C;  2ECC A;  1KQ9 A;  4XKV A;  4JX6 A;  2A6E F;  1OCT C;  5F0F A;  1MMA A;  1SD7 A;  2BW3 A;  4FCY A;  1V55 H;  4C2M J;  4GCV A;  4P9U A;  1BI1 A;  1U9O A;  1BM9 A;  1V3F A;  2R93 J;  2LLK A;  4CCJ A;  3ZR8 X;  1BI2 A;  2QVO A;  3VEP A;  1SVL A;  4HNT A;  3GEZ A;  4OIQ F;  2VLA A;  3W6K B;  2H1L A;  1IN6 A;  4A3J J;  2BHZ A;  3A2K A;  1HF0 A;  4KIF A;  3WGH A;  5DD8 A;  3IAM 2;  1YJW I;  2LF8 A;  3OV8 A;  3DFG A;  1Z3X A;  1S5L C;  3OYL A;  1RR8 C;  3RKX A;  1I1S A;  3EUK L;  2VI6 A;  1T56 A;  2JA2 A;  2K85 A;  1RR7 A;  2JZY A;  4AUX A;  1TBX A;  3FMS A;  1HC8 A;  1UG0 A;  2DN0 A;  2UUZ A;  4DGW B;  2KT0 A;  3HM5 A;  2H09 A;  2QLZ A;  1AKH A;  4CZZ A;  4KA4 A;  5ILS A;  2K3F A;  5K7Z A;  4KMU X;  2X48 A;  2MG4 A;  2LYC A;  2OF7 A;  5E3N A;  4O3M A;  1QZZ A;  1MZB A;  1BBY A;  2QCO A;  5EEH A;  2JTV A;  4V19 K;  5D6E A;  2QQB A;  2DA3 A;  5E3O A;  3BQY A;  3QQA A;  2M1B A;  2JVH A;  2HS5 A;  2XHK A;  4HV5 A;  1JKR C;  3GUD A;  1DQU A;  4BQQ A;  2HVS A;  2WA0 A;  4BYY A;  1MDM B;  2E34 A;  4L5J A;  2FX0 A;  3W6J B;  2IGN A;  5LEK A;  5KCM A;  2DA2 A;  4L0Y B;  3OYA A;  4RGR A;  2J5P A;  2W48 A;  3GFJ A;  3BJ6 A;  2X4H A;  3ZQQ A;  4CYC A;  3CME I;  4HF1 A;  2EPF A;  2HQA A;  1FOY A;  2IEK A;  3G73 A;  1HOM A;  2Q2E A;  3OL4 A;  4P1W A;  1G3S A;  3T0Y A;  1O4X A;  1DPU A;  1GV2 A;  1U3E M;  2NXN B;  3C18 A;  1RRJ A;  4CYC B;  2QKM B;  3ML6 A;  1LPQ A;  5M5W J;  3LA2 A;  1SFE A;  5B1A H;  3VWB A;  2YUS A;  3I0T A;  1FWZ A;  2Q2E B;  2VPL A;  4G6D A;  4C30 A;  4MTD A;  3I4P A;  3RDI A;  1FMW A;  4XNF A;  4H4K C;  2RQQ A;  2VQH A;  3VYR B;  2WAF A;  3BJO A;  1CGP A;  4CIC A;  2DTR A;  3KYD B;  4II2 A;  1FOK A;  3HGG A;  2ECB A;  2FML A;  3BT9 A;  3NAR A;  2FBK A;  2GOX B;  2M2E A;  1G2H A;  1ERD A;  3AG4 H;  4Q5S F;  4ZH4 F;  4LG3 A;  5EEG A;  2CYY A;  2HPM A;  3LSG A;  1R5H A;  5E1X A;  1BI3 A;  5ILV A;  3PM1 A;  2NAZ A;  2A6H F;  4M3B A;  4OWR B;  1VQO I;  1A5J A;  3JW4 A;  4E7I A;  4S04 A;  2IGK A;  2R7Q A;  4EV0 A;  3BR6 A;  2JVG A;  1N25 A;  1QVU A;  2K9Q A;  3EPZ A;  4ZJZ A;  3RYR A;  2DT6 A;  3PUB A;  2LKS A;  5HS9 A;  1VFC A;  3ZMU A;  1LE8 B;  3L00 A;  5IT9 Z;  2KKO A;  1H0M A;  1XTA A;  2HZD A;  5M5X J;  3IH2 A;  4HX8 A;  1QZY A;  5D5W B;  3VOD A;  4ENN A;  3GO5 A;  2ISZ A;  1X2M A;  4PK4 A;  1ZGA A;  2VXZ A;  4QWQ A;  2GOM A;  2JWT A;  4F92 B;  4EMS A;  1VQM I;  2O9L A;  2W85 A;  2X6Y A;  3QYB A;  2LY2 A;  1XMX A;  5FKL A;  5F64 A;  3WHC A;  1R5G A;  2HI3 A;  3WE3 A;  1MJB A;  4IKF A;  1Z7L A;  3A4C A;  1F36 A;  3T1B A;  4R79 A;  1KU7 A;  2EA4 A;  5H20 A;  2X1D A;  3GTL J;  2Y0M A;  3X2Q H;  2DA1 A;  1FIP A;  3GFM A;  5IP9 J;  2MD0 A;  4EJT A;  1QHG A;  3R60 A;  3F0C A;  1AWC A;  1WPK A;  4KNY A;  1QRY A;  2CUZ A;  2A5W A;  2M7A A;  1FEX A;  4HEA 2;  1J75 A;  4LFU A;  2STT A;  2PJR A;  4L9N A;  1E17 A;  3OR2 C;  4ETS A;  3J80 K;  1D1B A;  1Z91 A;  3TP0 A;  1WJF A;  2L3D A;  1R00 A;  2QEN A;  3I55 I;  1IRX A;  2GQQ A;  1R6R A;  4A5N A;  2KJB A;  4YFK F;  2NRA C;  4JK1 X;  3I5U A;  2V9V A;  3ULQ B;  2FNA A;  2R7R A;  2IS2 A;  2AXL A;  4CSW A;  3JRI A;  3SEZ A;  1R58 A;  3SZP A;  4HF2 A;  3BG7 A;  3GTK J;  3EUH C;  3DWL E;  3ZMD A;  3HHH A;  4IVN A;  4KT5 C;  3FBN B;  4GO1 A;  2I5U A;  1LVA A;  4A3M J;  1QQI A;  2JQ7 A;  4UXN A;  1I3Q J;  3EYY A;  3JRA A;  1PUE E;  1ZN2 A;  4G7O F;  2EZK A;  4Y33 A;  1R1V A;  1X3U A;  4Q48 A;  4RAG A;  3BTJ A;  3K4L A;  5FKN A;  5JR3 A;  2ZJP F;  1SFU A;  5HS7 A;  1OIS A;  4ZDO A;  2CW7 A;  2JT1 A;  3P5J A;  2VC0 A;  2OD5 A;  1B6A A;  4BNC A;  3K1N A;  3G2B A;  4PDK A;  5J1R A;  2QSH X;  1OCC H;  4HW0 A;  2HOE A;  1YW7 A;  2CFO A;  4PSX A;  5GPA A;  2DJN A;  2CQX A;  4ZZL A;  3LAP A;  2MC4 A;  4O6J A;  1FNN A;  5ERI A;  4C2U A;  1YW8 A;  3K4N A;  3NWT A;  4IX7 A;  3DLL F;  2IGM A;  1L3L A;  2M45 A;  1R5I D;  2VE9 A;  2HWV A;  2QQA A;  4W1U A;  3JCU C;  4RLF A;  1BW5 A;  2KL4 A;  1Y0N A;  3KEQ A;  2IA0 A;  5LHI A;  3CCS I;  1ZHF A;  1I27 A;  4ASN A;  3IKT A;  1UHW A; 
#chains in the Genus database with same CATH homology
 1XDS A;  2GA2 A;  1D3Y A;  3GF2 A;  4LLL A;  4LB5 A;  1J9I A;  5BPD A;  1XCB A;  1TNT A;  3R6S A;  4KUM A;  2K4B A;  2J5O A;  2FQ3 A;  3BDD A;  4I01 A;  4OIN F;  3BPV A;  3KFW X;  2MC3 A;  4M9X A;  4HOB A;  3GZ5 A;  4QLC U;  4G8X A;  4A0Z A;  2X0L A;  3E6C C;  2MD5 A;  4MNU A;  3KP4 A;  3KP5 A;  4LG0 A;  2O8X A;  1YW9 A;  2OBP A;  2XGX A;  2G7U A;  5E8I A;  3ZMT A;  3E97 A;  2F2E A;  3EUH A;  2IA1 A;  1QNT A;  4E70 A;  1FY7 A;  2VBY A;  2IA2 A;  2VBZ A;  1J59 A;  4IRG A;  3Q9V A;  4ZYD A;  2EK5 A;  4GYG A;  2YR2 A;  2XVC A;  2ZJ2 A;  3ZN0 A;  3JSO A;  1G6N A;  2LNB A;  4A2U A;  1ZH5 A;  3LQQ A;  1L0O C;  5L3G A;  1LDJ A;  2OZU A;  1BC7 C;  2GA1 A;  1IXC A;  2P5L C;  5A2Q K;  2L4A A;  3Q9S A;  2YX7 A;  3RKW A;  1HKT A;  2D1V A;  3RI4 A;  3WOD F;  3ISP A;  3I54 A;  3CO7 C;  4LLG F;  5IT3 A;  1SMY F;  4UVA A;  3B73 A;  1HQC A;  1KA8 A;  3K9T A;  1FBU A;  3BY6 A;  1WI9 A;  4ZYH A;  4FT8 A;  1MJ9 A;  1O3T A;  3ZPL A;  4U0V A;  3RPU A;  3BPX A;  3P7N A;  4P9F A;  1Z05 A;  2ESH A;  1SMT A;  1P4W A;  1S7O A;  1K6O A;  2FSW A;  1S6L A;  2XAS A;  3M8E A;  3WGG A;  3L7W A;  2W84 A;  1HW2 A;  5AIQ A;  3F6O A;  2UWM A;  2P5V A;  1YYV A;  4TV7 A;  3IRQ A;  1DUX C;  1PDN C;  1DP7 P;  3VOE A;  1NHA A;  1TQI A;  3F21 A;  2PQ8 A;  2E7X A;  1ZRE A;  1D8J A;  2KIU A;  3FF5 A;  3H92 A;  5FFX A;  3RTR A;  5LGU A;  2BYV E;  2ZME A;  4IF4 A;  4RAZ A;  1R1T A;  3KCC A;  3CTA A;  2O0Y A;  4ZYG A;  4XSZ F;  5E18 F;  2DK8 A;  2VE8 A;  3C7J A;  2ZME B;  4L18 B;  1J0R A;  2GXG A;  3U1D A;  4L9J A;  2D45 A;  1BI0 A;  1O3R A;  3MFK A;  4XBF A;  4HAM A;  3TOA A;  1FP2 A;  1TQP A;  3TO7 A;  4OIP F;  2RN7 A;  4CDG A;  1HST A;  5BQT A;  2FMY A;  4WF2 A;  3TOB A;  1XGS A;  1QBJ A;  4HBL A;  3ZP5 A;  4G7Z F;  5CLS A;  4U7B A;  1K78 A;  4GXO A;  1RUO A;  3BRO A;  1RI7 A;  1HKS A;  3F6V A;  4HQM A;  4R8H A;  4CYD A;  4LJZ F;  2ADU A;  3GFI A;  3EDP A;  4Z2Y A;  1TQM A;  3GLX A;  5CYV A;  3FM3 A;  2NS0 A;  1UB9 A;  4KIG A;  1H9G A;  3VFZ A;  1EH6 A;  2O61 A;  5CVV A;  2DU9 A;  3MCZ A;  1HXD A;  1FYL A;  3JAM Z;  3E5Q A;  3IHU A;  4OU0 A;  1IN8 A;  2WTE A;  4UVB A;  2ACJ A;  4RB0 A;  3GW2 A;  5DD4 A;  3KEO A;  1XSD A;  1K79 A;  1UST A;  5H6R A;  5TJJ A;  3QPT A;  4CXF A;  2PEX A;  2QWW A;  3V8L A;  4A6D A;  4N9I A;  3F3X A;  2K27 A;  4UV8 A;  1D5V A;  1HBX G;  3TDZ C;  3D5L A;  4B8X A;  4KFC A;  2KIF A;  5DCF A;  4YFX F;  4IRI A;  4WCG A;  4A12 A;  4M73 A;  4MEX F;  1S7A A;  5D6F A;  2HQR A;  2FEZ A;  4WWC A;  5H6Q A;  4M74 A;  1F9N A;  3U2R A;  1PP7 U;  3TDU C;  2RV8 A;  1XMK A;  1RUN A;  2EJR A;  1W7P B;  2FXA A;  3PFI A;  2Z33 A;  1BC8 C;  1LNW A;  1LEB A;  3OOP A;  5DUI A;  4XLP F;  1R1U A;  1QGP A;  4PGH A;  1FX7 A;  5LEJ A;  3HRM A;  2CFX A;  5D4R A;  2EFP A;  1TLH B;  3DXJ F;  4GGG A;  2PMU A;  1SD6 A;  3O6B B;  1MDM A;  2VOP A;  3DKW A;  2EFO A;  1S8N A;  4WX9 A;  4Q4Z F;  2DPD A;  1Y0U A;  2VN2 A;  3KZZ A;  1FP1 D;  2H27 A;  5JVT A;  5LHH A;  4MEY F;  1T2K A;  4L9V A;  2MH9 A;  2ZNZ A;  5ILU A;  4XSX F;  2ZNY A;  4L9T A;  1IRG A;  3FWE A;  1J7K A;  1PP8 F;  4U0Y A;  4RGX A;  3IWZ A;  2V1X A;  4A6E A;  3WTW C;  2Y75 A;  2V1D A;  1G3W A;  2P8T A;  2F5E A;  3IL2 A;  3F72 A;  5HLH A;  4LK1 F;  3HTS B;  3IC7 A;  1IW7 F;  2XRN A;  1XMA A;  2A3S A;  4NB5 A;  1EH7 A;  2FU4 A;  3LQR A;  5D5U B;  2XAJ A;  1ZG3 A;  2GAU A;  5K5O A;  1QO0 D;  2OAZ A;  1P6R A;  2V1U A;  1R7J A;  3MQ0 A;  5K1Y A;  4I09 A;  4N9H A;  1U8R A;  1SAX A;  4WK8 F;  5HDN A;  4OIO F;  3E6M A;  4H0E A;  1DPR A;  5CJ9 A;  2JPB A;  5L3C A;  2GZW A;  3K2Z A;  2Q8K A;  1JE8 A;  1ZLK A;  2E1C A;  1FT9 A;  3BJA A;  4RS8 A;  1T0F A;  1J2X A;  3CUQ C;  5LRR A;  1VTN C;  5ICF A;  5DCM B;  4ENM A;  3I64 A;  5LBQ A;  2STW A;  2XAH A;  4HX7 A;  4AIJ A;  2XV4 S;  3QRF F;  2K86 A;  3KE2 A;  1IN4 A;  3ELK A;  2ZCW A;  2Z3Y A;  4HQE A;  3LA7 A;  2PI0 A;  3JTH A;  4U0W A;  1KU3 A;  3HRS A;  4M71 A;  4LK0 F;  4PZJ A;  3EYI A;  2QBY B;  1DDN A;  2Q0O A;  2KJC A;  3L2C A;  1RZ4 A;  1AOY A;  4IJA A;  3J80 Z;  2W24 A;  2ISY A;  5FD5 A;  5FGM A;  3IKV A;  3KZY A;  3GWZ A;  1Q1H A;  1BIB A;  2A07 F;  1YO5 C;  2P7V B;  3CJN A;  3R61 A;  3CUO A;  2ELH A;  1IF1 A;  2WWY A;  1UHW A;  2ETH A;  5L3E A;  3MEX A;  1F1Z A;  1OYI A;  2O03 A;  1RIO H;  5J8C A;  3PQK A;  2W57 A;  1OYW A;  3HSF A;  1FLI A;  3BZ6 A;  3ECO A;  4A5M A;  3V7R A;  4HYE A;  1U5T C;  3I71 A;  1BJA A;  5HDK A;  5AON A;  4FX4 A;  2RNJ A;  3CDH A;  3F8M A;  3RKY A;  4I0A A;  2IPQ X;  3HOT A;  2YSR A;  1H9T A;  2MLG A;  1ON1 A;  2BV6 A;  4JBA A;  3IWF A;  2HZT A;  5ICE A;  4RAY A;  4BHP A;  4IHT A;  1XD7 A;  2YPR A;  3MWM A;  3ZMS A;  3ZMV A;  1USS A;  4HDV A;  1GVJ A;  3QU3 A;  2EV6 A;  5ICC A;  3FHZ A;  1FC3 A;  1OR7 A;  2O6G E;  1SFX A;  5F1R A;  3F8F A;  3WTZ A;  2F5C A;  1P2F A;  4MTE A;  4Q47 A;  3CUQ B;  2QYO A;  3H3Z A;  3E3V A;  3WTT C;  2BGC A;  3E6D A;  4Y15 A;  3QU6 A;  4KN7 X;  5FLX K;  3P9K A;  2IVM A;  5BS6 A;  2EFQ A;  1FZP B;  4IXA A;  1OKR A;  5D5V B;  2JRT A;  1IN5 A;  2HTJ A;  2LKP A;  5J6X A;  2MA3 A;  4F7Z A;  2FOK A;  3GYH X;  5HOO A;  1B9N A;  4K2E A;  2PJP A;  1T98 A;  2HYG D;  2UXX A;  1W4M A;  3HSE A;  2R7F A;  4EGY A;  3T8R A;  4AWX B;  3FMR A;  1T39 A;  2QQ9 A;  2QZ8 A;  5BMZ A;  5JFR A;  1O57 A;  2HKO A;  3BOQ A;  3R0A A;  3T8T A;  4G6Q A;  1JHH A;  3SQN A;  2HTS A;  5E8G A;  1IN7 A;  5A2Q Z;  3QP6 A;  2LDU A;  3WGI A;  2CW0 F;  1U5T B;  4RGS A;  2KIM A;  2IJL A;  3WTX C;  4BXU A;  2W25 A;  5HDG A;  1Z6R A;  4I2O A;  3T5X A;  1XGN A;  4UV9 A;  4JQF A;  5E20 A;  1ON2 A;  3LA3 A;  3I59 B;  4Y17 A;  1WKM A;  4G9Y A;  3HUG A;  4O5V A;  1GXQ A;  3GVA A;  4OOI A;  5ED4 A;  2K4J A;  4IPA A;  4D0P A;  2QUF A;  1U6G A;  2E7W A;  3SZT A;  2OU2 A;  5L3F A;  3F22 A;  4CHU A;  2A61 A;  3HSR A;  2Z9O A;  4M72 A;  5L3D A;  3BWG A;  3ZMZ A;  3IRR A;  1SD5 A;  1XDU A;  6PAX A;  1UFM A;  3N4M A;  1STZ A;  4HLX A;  3I53 A;  4ON0 A;  3LWF A;  5D8L B;  1MGT A;  2P6T A;  2CWE A;  3DPT A;  3K69 A;  2JPC A;  2NYX A;  3AAF A;  1O3S A;  5DEQ A;  3J81 K;  1YFH A;  2M30 A;  3RIR A;  4G7H F;  2PN6 A;  2K7L A;  3LFK A;  4WXH A;  3WTU C;  4UVC A;  2DO7 A;  4OIR F;  4KIB A;  3HYI A;  2FF4 A;  1YS6 A;  3ROU A;  4ESJ A;  1ZAR A;  2LF7 A;  5D4S A;  4OMZ A;  1KGS A;  2O3F A;  2VT2 A;  2MLK A;  1MJA A;  2K02 A;  2BBY A;  2EFN A;  4EJW A;  3C1D A;  4YII A;  4M9Z A;  2HQN A;  1CF7 A;  4XRF A;  1XSV A;  2RKH A;  2WV0 A;  4IHS A;  2MH2 A;  4MQV A;  5L3B A;  2FBH A;  4HLY A;  1KU2 A;  1QPM A;  1CF7 B;  2CG4 A;  4BHC A;  1KU9 A;  5D5X B;  1Z1D A;  4BH9 A;  3NQO A;  4Y13 A;  1GHC A;  2FA5 A;  3EQL F;  2VON A;  3QP5 A;  3CLO A;  4GYI A;  1LDK B;  1R36 A;  2B0L A;  4L0Z B;  1O7L A;  2CGP A;  4AVP A;  2HDC A;  4RB2 C;  4EQQ A;  1S3J A;  3KP6 A;  5TRD A;  1FYM A;  1KYW A;  3WTV C;  2HKX A;  3M1E A;  2IP2 A;  5DUK A;  4CO8 A;  3WTY C;  4MQ9 F;  4P96 A;  1IAW A;  3C3W A;  5JI6 A;  1Z6T A;  2BEO A;  2XAG A;  3ABT A;  4LLN A;  4MGR A;  4RGU A;  2VT3 A;  1W7P A;  4FHT A;  2RVC A;  3F8C A;  1FBQ A;  2ESN A;  3V7C A;  1C0W A;  3K1P A;  1B4A A;  1P4X A;  2V6C A;  3DV8 A;  4UNO A;  3HOS A;  1YS7 A;  4RB1 A;  1I1G A;  4EM0 B;  2E1N A;  2VOD A;  1REP C;  2PBI A;  2OZ6 A;  1EH8 A;  3K1M A;  5AIP A;  4MHG A;  3O3K A;  1IUY A;  4AD9 A;  2R7D A;  4I7H A;  1F5T A;  3V8J A;  3MZY A;  3TGN A;  2DT5 A;  4PGG A;  1ZGJ A;  4CGZ A;  5LGT A;  4A0Y A;  1FSH A;  5JHU A;  1ONV A;  4IRH A;  3L09 A;  3F8B A;  5DYM A;  2VC1 A;  4KN4 X;  4ZYE A;  2RC4 A;  4ESF A;  1LQ1 A;  3SFZ A;  2XAQ A;  2DLL A;  3FZV A;  3H3U A;  2CSO A;  1ZRF A;  4OMY A;  1A04 A;  1KYZ A;  2P4W A;  3NRV A;  3P9C A;  2NNY A;  1R22 A;  1IXS B;  3M9A A;  3DP7 A;  2DW4 A;  5CVI A;  4EM1 A;  2L01 A;  4UHT A;  2XRO A;  3S2W A;  2GXB A;  1K7A A;  2DI3 A;  2RGV A;  5IT9 K;  1JXS A;  3GXO A;  3HRT A;  5K5R A;  5DCM A;  1BOA A;  3HTU A;  3RPQ A;  3J7A O;  2FRH A;  1S29 A;  2EA2 A;  1ZLJ A;  1D8K A;  2XAF A;  1YTY A;  4KDP A;  3D0S A;  1J5Y A;  3U9G A;  2VBW A;  4EM2 A;  1ZG1 A;  5K5Q A;  1TTY A;  4M9S A;  3Q5F A;  2PG4 A;  2QBY A;  5F6F A;  1W7P D;  1HKQ A;  3FXQ A;  2YU3 A;  1HSJ A;  2XKP A;  2A68 F;  5BOX A;  1WQ2 A;  1BIA A;  2H94 A;  1Z9C A;  3KET A;  1EV7 A;  1G3T A;  1XGO A;  2M5W A;  2EWN A;  5LLQ A;  1LB2 A;  3G3Z A;  2RQP A;  2G9W A;  3V4G A;  3FXU A;  5BPI A;  2L02 A;  1B9M A;  5FD6 A;  1YG2 A;  2KRF A;  4U88 A;  1IRF A;  4ZZD A;  1FYK A;  2EB7 A;  2YX4 A;  4HA8 A;  2F5F A;  4KIC A;  1O7F A;  4BAY A;  1OMI A;  3R0J A;  2WC2 A;  4AIK A;  4M6X A;  3CO6 C;  2AS5 F;  3F23 A;  4DNC A;  3RJP A;  2M87 A;  3JTG A;  1FPQ A;  1W5T A;  2OQR A;  5LRS A;  5LHG A;  4WXC A;  4P55 A;  3RYP A;  2HR3 A;  1R23 A;  3WE2 A;  1WSU A;  3CUQ A;  1O3Q A;  5ICG A;  2FBI A;  2C6Y A;  2JSC A;  1XCV A;  3TQN A;  2LSO A;  4DQ2 A;  3QAH A;  4EGZ A;  3MZH A;  2HFH A;  2H6C A;  1OYY A;  2OQG A;  3TO6 A;  4YIF A;  4M6Y A;  4KMF A;  3KP7 A;  4EJV A;  2GWR A;  3EET A;  1LEA A;  2DK5 A;  3E5U A;  1U78 A;  1SD4 A;  4WXD A;  2PLY A;  5CVJ A;  2CO5 A;  4RB3 C;  5FLX Z;  1HW5 A;  5KK1 A;  3KP2 A;  1JHF A;  3NEU A;  2TDX A;  1BN5 A;  4NHJ A;  3O2P E;  2V79 A;  2UZK A;  2DBB A;  2M8E A;  2P5K A;  3WU1 B;  4LG0 B;  2IT0 A;  1RNL A;  2ZBK A;  4LMY A;  1KQ0 A;  3WG9 A;  3ERE D;  2MBF A;  1YIO A;  1U5T A;  3E5X A;  2EV0 A;  3F8N A;  2Z99 A;  3DEU A;  3KLO A;  5HLI A;  1LJ9 A;  2BE5 F;  5HS8 A;  1MD0 A;  3L9F A;  1FBS A;  2VOO A;  2GIV A;  3I59 A;  1G4D A;  3TKY A;  5LGN A;  1IXR C;  2P6S A;  3JSP A;  4EJO A;  4U7D A;  2EFW A;  3REO A;  1U2W A;  4KYW A;  3SHF A;  2F5D A;  1E2X A;  5HVQ C;  1B1B A;  2L54 A;  3DQV C;  3SXY A;  1P4A A;  1T6S A;  4ESB A;  3TO9 A;  4XLN F;  2IRF G;  4EVI A;  2Z5U A;  5CVU A;  3ZN1 A;  1ZRD A;  1W5S A;  5E1W A;  4P5O A;  4HDU A;  3GFL A;  4EJU A;  2DPU A;  1I5Z A;  4AIH A;  4UUV A;  3KLN A;  1MKM A;  1HW1 A;  2ZFW A;  4PCQ A;  3COA C;  2CQK A;  2UXN A;  1ULY A;  2FNP A;  3ECH A;  3R4K A;  4NQW A;  2PFB A;  1P92 A;  1F4K A;  1B59 A;  2ZO4 A;  2G7H A;  5KVR A;  2A5Y B;  1XGM A;  4G94 A;  5DV5 A;  2D2W A;  4S05 A;  1TW3 A;  2QM3 A;  3FM5 A;  3K0L A;  3HIF A;  3HHG A;  2P7C B;  2L4M A;  3M8F A;  1G3Y A;  3ABU A;  3I58 A;  4ENK A;  3LST A;  3QPH A;  3GZ6 A;  1XB4 A;  3J81 Z;  1OPC A;  2HYF A;  3WTS C;  1UHM A;  4ENJ A;  2DQL A;  4L5I A;  1XSX A;  1FSE A;  1LDD A;  1KQ8 A;  1YLF A;  2H6B A;  4YFN F;  2HEO A;  2PMH A;  1UCR A;  4YG2 F;  4R1H A;  3DPL C;  3HRU A;  2RDP A;  3FX3 A;  4A0X A;  2OA4 A;  3B02 A;  3ZQ7 A;  2NNN A;  5FO5 A;  4BQA A;  2A69 F;  1ZYR F;  2R3S A;  1T38 A;  1V4R A;  5FB2 A;  2Y48 A;  1IZ1 A;  1WRJ A;  3WU0 A;  5D8K B;  5E17 F;  2FE3 A;  5J8F A;  1XN7 A;  1K78 B;  3MAJ A;  4LD5 A;  2IW5 A;  3JAM K;  1Z7U A;  3VB2 A;  3DF8 A;  3M7G A;  2ZXJ A;  3BP8 A;  3V8K A;  5CVR A;  1TW2 A;  3E6B A;  1YQA A;  4I0B A;  2DQR A;  3FMQ A;  2VBX A;  1WWX A;  3FXR A;  1ZAO A;  2HGC A;  2XIG A;  3QOP A;  1ZRC A;  3P9I A;  4I98 B;  3GX4 X;  1ODD A;  4I02 A;  2D1H A;  4N0B A;  4B09 A;  1TNS A;  2EV5 A;  2XKO A;  3N97 A;  1JGS A;  4LGW A;  2DAO A;  2COM A;  1GXP A;  4FX0 A;  5E1Z B;  4BHB A;  3LAJ A;  3V7S A;  1I6X A;  2DFI A;  2ZKZ A;  5DDG A;  1ZG5 A;  2XUB A;  4HZF A;  4HF0 A;  4HV6 A;  5FFZ A;  5HLG A;  4HX4 A;  3KP3 A;  4LB6 B;  1KQ9 A;  2A6E F;  1SD7 A;  4GCV A;  4P9U A;  1BI1 A;  1BM9 A;  1V3F A;  1BI2 A;  2QVO A;  3VEP A;  3GEZ A;  4OIQ F;  3W6K B;  1IN6 A;  4KIF A;  3WGH A;  5DD8 A;  2LF8 A;  3OV8 A;  3DFG A;  3RKX A;  1I1S A;  2JZY A;  1TBX A;  3FMS A;  2H09 A;  2QLZ A;  4CZZ A;  4KA4 A;  5ILS A;  4KMU X;  4O3M A;  1QZZ A;  1MZB A;  1BBY A;  5EEH A;  2JTV A;  5D6E A;  2QQB A;  2M1B A;  2HS5 A;  2XHK A;  4HV5 A;  3GUD A;  4BYY A;  1MDM B;  4L5J A;  3W6J B;  5LEK A;  4L0Y B;  4RGR A;  2J5P A;  3GFJ A;  3BJ6 A;  2X4H A;  4HF1 A;  3G73 A;  2Q2E A;  1G3S A;  3T0Y A;  1DPU A;  1U3E M;  3C18 A;  3ML6 A;  3LA2 A;  1SFE A;  3I0T A;  1FWZ A;  4G6D A;  4MTD A;  3I4P A;  3RDI A;  3BJO A;  1CGP A;  4CIC A;  2DTR A;  1FOK A;  2FML A;  2FBK A;  4Q5S F;  4ZH4 F;  5EEG A;  2CYY A;  1R5H A;  5E1X A;  1BI3 A;  5ILV A;  2NAZ A;  2A6H F;  3JW4 A;  4S04 A;  4EV0 A;  3RYR A;  5HS9 A;  3ZMU A;  3L00 A;  5IT9 Z;  2KKO A;  1H0M A;  4HX8 A;  1QZY A;  5D5W B;  3VOD A;  4ENN A;  3GO5 A;  2ISZ A;  1ZGA A;  2VXZ A;  4QWQ A;  4EMS A;  2W85 A;  5F64 A;  1R5G A;  3WE3 A;  1MJB A;  3T1B A;  4R79 A;  1KU7 A;  2EA4 A;  5H20 A;  2Y0M A;  3GFM A;  4EJT A;  3R60 A;  1AWC A;  4KNY A;  1J75 A;  4LFU A;  2STT A;  4L9N A;  1E17 A;  4ETS A;  3J80 K;  1Z91 A;  2L3D A;  1R00 A;  2QEN A;  2GQQ A;  4A5N A;  2KJB A;  4YFK F;  2NRA C;  4JK1 X;  3I5U A;  2V9V A;  3ULQ B;  2FNA A;  2AXL A;  1R58 A;  3SZP A;  4HF2 A;  3ZMD A;  3HHH A;  4IVN A;  4KT5 C;  4GO1 A;  1LVA A;  1QQI A;  4UXN A;  3EYY A;  1PUE E;  1ZN2 A;  4G7O F;  1R1V A;  1X3U A;  4Q48 A;  5JR3 A;  1SFU A;  5HS7 A;  2JT1 A;  2VC0 A;  2OD5 A;  1B6A A;  4BNC A;  3K1N A;  4PDK A;  4HW0 A;  2HOE A;  1YW7 A;  4ZZL A;  3LAP A;  4O6J A;  1FNN A;  5ERI A;  1YW8 A;  1L3L A;  2M45 A;  2VE9 A;  2HWV A;  2QQA A;  3KEQ A;  2IA0 A;  5LHI A;  1ZHF A;  1I27 A;  4ASN A;  3IKT A;  3PQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...