1WI9A

Solution structure of the pci domain from mouse hypothetical protein aah51541
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
b'GSSGSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein C20orf116 homolog
publication title Solution structure of the PCI domain from mouse hypothetical protein AAH51541
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wi9A01
5H6RA 5HDGA 2XV4S 3FMQA 4ENKA 4OMYA 1USSA 3DKWA 3ISPA 3HSRA 2EFPA 3K1MA 4L9TA 1ZG3A 3WGIA 4OIOF 1MJAA 3C1DA 3MCZA 1K78A 1B6AA 3ZN0A 1H0MA 1FSEA 1RZ4A 2KRFA 5F1RA 1GVJA 5L3DA 1P2FA 1KA8A 2EJRA 3BPXA 4ZZDA 3E6BA 4HF0A 2XROA 1ZARA 5HS7A 1FP2A 3GFJA 1S7OA 4U7DA 4HW0A 2NNYA 2M5WA 4IF4A 1IN8A 1W4MA 2VBXA 1QZZA 4RS8A 2DI3A 3ABUA 4HAMA 1O7FA 3QAHA 2FNAA 3BROA 1OYYA 1DP7P 3JAMZ 2OQGA 1DPUA 2P8TA 1I6XA 1IXRC 2HZTA 4NQWA 1K79A 4UVCA 1G3YA 3E3VA 2Z5UA 2EFOA 3RKYA 4G7HF 2FEZA 1MZBA 4UXNA 1IW7F 3FM3A 3JW4A 1B59A 4G7ZF 2XUBA 2HR3A 4D0PA 1V3FA 4MEXF 2JPCA 3L2CA 3TO9A 1J75A 1XGOA 3D5LA 4K2EA 4Q47A 3KETA 4A6EA 1FY7A 2D45A 1YG2A 5LEKA 4XBFA 2NYXA 4M71A 2NRAC 4KYWA 5L3FA 4Q5SF 1GXPA 4LLNA 4GYIA 5HLHA 3BJ6A 3Q9SA 3E6DA 3GFIA 1BIAA 2EB7A 4CDGA 3JAMK 1R58A 3F6VA 5DYMA 1Z05A 1D3YA 3V8JA 4RAYA 2DBBA 1PP7U 2ISYA 5ILVA 1LB2A 3FXQA 4LB6B 4RGRA 3GZ6A 4UV8A 1YFHA 1KU2A 3WTSC 2L54A 4ZYGA 5EEGA 3BWGA 2HKOA 1W7PA 1RIOH 1OMIA 3V8LA 3V8KA 3VEPA 2WV0A 3QRFF 3ZMUA 2Z9OA 2KJBA 1LJ9A 2KIFA 2L4MA 2MA3A 2DU9A 5ED4A 2L01A 1LVAA 4M9ZA 2H94A 4Q4ZF 5HLGA 4LK0F 2H09A 1BM9A 2NNNA 3EQLF 1FC3A 1ZHFA 2OD5A 4HQEA 1J0RA 1X3UA 2EFWA 4N9HA 6PAXA 4A0ZA 4PCQA 2QQ9A 3K1PA 3B73A 5CJ9A 3HOSA 4OOIA 1SMTA 1XSXA 5LGNA 3VB2A 3BJAA 4LD5A 1CF7B 1KYWA 4KMFA 1Q1HA 3GO5A 3FX3A 1JGSA 2WWYA 3R0AA 3N97A 3I71A 3E6MA 3CDHA 2MH9A 4NB5A 4EGZA 4MTDA 1OR7A 4G9YA 2YX7A 3WODF 2PBIA 4RGXA 2IPQX 3GW2A 1ODDA 3JSPA 1BI1A 3T8TA 1BBYA 2VC0A 3DV8A 1BC8C 3QOPA 1HXDA 4WF2A 4BHBA 1FYMA 2EFNA 4CICA 4UUVA 1TW3A 3LA2A 5HS8A 4ETSA 3KCCA 1ZRDA 3KP6A 1Z91A 2ZKZA 2PMHA 2FU4A 3LFKA 3RIRA 2W85A 5IT3A 4LG0A 4ON0A 4S04A 2FA5A 1YW7A 1JHHA 3PQKA 5E1WA 1EH7A 2IA0A 3ZQ7A 5AIQA 4WWCA 2LNBA 3GX4X 3ZMVA 4RB2C 2HTJA 5HDKA 3BJOA 1H9TA 1I1GA 3QP5A 1KQ8A 2CGPA 5FB2A 1FBQA 2FBHA 2OBPA 5FLXZ 2KIUA 5CYVA 1B1BA 3TOAA 4OMZA 1XCVA 4GYGA 1UCRA 1S8NA 4RB0A 1STZA 3WTVC 2PI0A 3HRUA 2UWMA 5A2QZ 4ENMA 5JFRA 2X0LA 2CG4A 2GXBA 1IAWA 3WE2A 3F8FA 1QZYA 2QBYA 4WXDA 4KMUX 2GXGA 3AAFA 4B8XA 4EGYA 2DPUA 2TDXA 1FP1D 3BOQA 2JPBA 2MH2A 1J5YA 1H9GA 4O3MA 3DXJF 5CVVA 5E18F 3WU1B 2A5YB 2B0LA 1J9IA 2KKOA 1HSTA 2MLKA 2FRHA 3K1NA 5FLXK 5AONA 2H6BA 1F5TA 4EM1A 4CYDA 4A6DA 1TQIA 5A2QK 1G4DA 1REPC 4A5MA 2IW5A 2IA1A 4IRIA 2Q8KA 2DT5A 4U88A 3TDUC 3MEXA 2IRFG 2HQRA 5E1XA 5D6EA 1RNLA 5HOOA 1R22A 4DQ2A 2BV6A 5LEJA 1MD0A 4IJAA 3REOA 3S2WA 1WRJA 2GA2A 1YS6A 1C0WA 5HVQC 3I53A 1ON2A 1HKQA 1ZAOA 3TOBA 1FT9A 3RI4A 1U8RA 2PN6A 3DPTA 4O5VA 1UHWA 1J7KA 1LDDA 4FX0A 2YSRA 2PG4A 3PQJA 1SD4A 3WTTC 2K02A 5H20A 3Q9VA 1SFXA 4L5JA 4ZYEA 1U2WA 2M8EA 1JE8A 4R1HA 3GWZA 2ZCWA 1FOKA 3R60A 2Q0OA 3OOPA 1T0FA 2QUFA 2HOEA 2DAOA 5F6FA 3QP6A 3WG9A 1LEBA 4IVNA 5BMZA 2LSOA 4IHSA 1MDMB 1HSJA 5D8LB 1HBXG 5KK1A 3ZMSA 3QPTA 4KT5C 4KA4A 1HW2A 2DO7A 4P9FA 1ZN2A 2QVOA 4HDUA 1YTYA 3CUOA 4WXCA 5BPDA 5DCMB 1FBUA 1ZLKA 2YX4A 5JHUA 4U0YA 2P4WA 1S29A 4BNCA 4EMSA 3G3ZA 1WKMA 3KEOA 4LFUA 2EV6A 2FE3A 2QLZA 3ECOA 3DFGA 1ULYA 1XDUA 4HA8A 2DTRA 2QQBA 4EJOA 4E70A 1HKSA 2HYFA 1W5SA 2HFHA 3CTAA 4UV9A 4OIRF 2VBZA 1R5GA 2ELHA 3WGHA 3IHUA 3RTRA 1AWCA 5LGUA 3MWMA 4YFNF 1BI3A 4FT8A 4L9VA 3I59B 4Q48A 4I2OA 4GO1A 1GXQA 2CO5A 3VFZA 2OQRA 1P4AA 3FF5A 1I5ZA 2P5KA 4IRGA 3F8CA 3K2ZA 1FYLA 1TTYA 3L7WA 5D5XB 1SD5A 1HQCA 4HDVA 2LDUA 2ZXJA 2E7WA 2ESHA 2JRTA 3HTUA 4HOBA 3F8MA 2RN7A 5ICEA 5L3GA 5JI6A 1OKRA 1HW5A 2P5LC 1BJAA 5HDNA 1XGMA 2DFIA 3MQ0A 2GZWA 4ZYDA 1O3SA 4I02A 3W6KB 3EUHA 3I0TA 4XRFA 2IJLA 2KJCA 2XGXA 1QBJA 1FNNA 5LHHA 1A04A 1DPRA 4EQQA 1R00A 5L3CA 4MQ9F 2CFXA 5FFXA 4HV5A 3ZMTA 1OYIA 1IF1A 2VOPA 3U9GA 2K27A 1O57A 1D8JA 2NS0A 2ZBKA 3E6CC 1XB4A 3SFZA 5K1YA 2A69F 3JTHA 2V1UA 2UXXA 4AIJA 1FWZA 5DD8A 2IT0A 1FPQA 1OYWA 2ZNYA 2A68F 5JVTA 2K4JA 1R36A 5CLSA 2VE9A 1P4XA 3MZYA 3NRVA 3HSFA 3LQRA 2QM3A 4P96A 4DNCA 4I98B 1IRFA 4I7HA 4IRHA 4L9JA 3TO6A 2D1VA 1XDSA 2P6SA 4BYYA 4PDKA 3F3XA 2R3SA 3BZ6A 2VC1A 2ZNZA 4MHGA 4TV7A 4LLLA 3WTUC 1LDKB 1B4AA 2KIMA 2XAHA 3CUQA 3L9FA 1G3WA 5DUIA 3MZHA 3SZTA 3IL2A 3HIFA 2IVMA 2DLLA 3GYHX 1V4RA 1G3TA 3NQOA 2R7DA 1ZRCA 3N4MA 2E1CA 3QU3A 4G7OF 3ELKA 5AIPA 1T39A 3VOEA 5BOXA 1RUNA 2E7XA 4P55A 1FBSA 1JXSA 1L3LA 4Y17A 3SHFA 1O7LA 1KU3A 4YG2F 1O3RA 1Y0UA 3DQVC 1IN4A 1T98A 3WTXC 2JT1A 1S3JA 2STWA 2E1NA 2Z3YA 1XMKA 2O3FA 5L3EA 1F4KA 4LK1F 2CYYA 3F8NA 3M9AA 4YFKF 3O6BB 2R7FA 3KP3A 2D1HA 1JHFA 3M1EA 4EJTA 4HZFA 5BQTA 5LHIA 2DK8A 1VTNC 5J6XA 3P9KA 1CGPA 1TLHB 3D0SA 1USTA 2L02A 1MKMA 4Y13A 1KQ9A 4MEYF 4WX9A 1SMYF 3RKWA 3P9IA 5D4SA 3KEQA 2F5FA 1BOAA 2W24A 4A12A 2O61A 2W25A 2HWVA 1PP8F 4L9NA 2V6CA 2M87A 5LRSA 3T8RA 4JBAA 1I27A 5E8IA 5E20A 2MLGA 4KICA 3HTSB 4PGGA 1IN7A 3KFWX 1R1VA 2DQLA 2HS5A 1ZRFA 3KLNA 2A6HF 2C6YA 3HRSA 3QPHA 5DUKA 5DCFA 4ENNA 2V1DA 4ENJA 3DEUA 1P6RA 1ZGJA 4NHJA 4L18B 4YIFA 4IHTA 2D2WA 1IXCA 3K69A 4OU0A 4U0VA 2MBFA 4R8HA 3RPUA 2ZJ2A 1IN5A 2IA2A 1BIBA 2VODA 3WTWC 3HHHA 1G6NA 4AVPA 2VBWA 2F2EA 1T2KA 2YU3A 1XGNA 2OZ6A 4CO8A 3F21A 4RB1A 3ROUA 5FGMA 2VN2A 1ZG5A 4A5NA 1WQ2A 2BYVE 4ZYHA 1XN7A 2Z33A 4XLPF 4KIBA 5TJJA 3E97A 1BI2A 2H27A 2RV8A 3COAC 2XRNA 1RUOA 3CJNA 3G73A 2EV5A 2RGVA 1LNWA 5ILUA 1T38A 3EETA 1FLIA 4FHTA 2ZFWA 3U1DA 2OU2A 1W7PD 3EYYA 2WTEA 3CLOA 3JSOA 3MAJA 4MNUA 1WI9A 5CVRA 1UB9A 2RQPA 1MDMA 1QGPA 3C18A 3R61A 2X4HA 5H6QA 4FX4A 3GF2A 3V7SA 3HYIA 4UNOA 2CW0F 1AOYA 2AS5F 1U5TC 3W6JB 3IRQA 1R5HA 3VODA 2FOKA 2VT2A 4I0BA 4O6JA 5DCMA 2UZKA 3Q5FA 1LQ1A 2VONA 4N0BA 2IP2A 5LGTA 2JSCA 1XSVA 1IN6A 4HQMA 2FBKA 5E8GA 2K4BA 5LBQA 3M8FA 3BDDA 4S05A 5JR3A 2FSWA 1QQIA 1YO5C 3LA7A 2V79A 4BAYA 3C3WA 4N9IA 3FZVA 2Y75A 2F5DA 3KP4A 3LQQA 3DF8A 1B9NA 4PGHA 4LMYA 1ZLJA 3WU0A 1FZPB 1IZ1A 1U5TB 2L4AA 4MTEA 1ON1A 3GFMA 3HSEA 2P7VB 4HV6A 2RVCA 3DP7A 2BE5F 2RC4A 2Y0MA 2JZYA 1K6OA 5J8FA 5HLIA 4EJWA 4CHUA 1Z9CA 2W84A 2QYOA 5KVRA 1SD6A 2O6GE 1XCBA 1QPMA 3ZP5A 1XD7A 2EFQA 4LLGF 5ILSA 5D6FA 4IPAA 1MJBA 2XIGA 3TGNA 1KGSA 4BHPA 3V4GA 3E5XA 3KP7A 2P7CB 5IT9Z 3BPVA 1XGSA 4HX8A 2XAFA 2FXAA 4BH9A 4KIGA 2RDPA 3RJPA 2A61A 4CGZA 1KU9A 1FX7A 3L09A 1FYKA 2Z99A 1B9MA 4ZZLA 3R4KA 5D4RA 2F5EA 4M73A 3KP5A 3ZN1A 5CVUA 4EJVA 2O8XA 2GQQA 5HS9A 5BPIA 2DW4A 5FO5A 5BS6A 1D8KA 2RNJA 3IWFA 2ZMEB 3F6OA 1J59A 2VOOA 3FXRA 4LGWA 2J5OA 2YPRA 2QQAA 4LJZF 1TQPA 1R7JA 3IWZA 3J81K 3R6SA 1IXSB 4AIKA 5IT9K 1U3EM 2G7UA 2LF8A 4HF1A 3ZMZA 1DUXC 3FWEA 3F72A 3P9CA 1R1TA 2MC3A 3WTZA 3J80Z 3I54A 1NHAA 3MFKA 2HEOA 3H3UA 5EEHA 4XLNF 2ESNA 3H3ZA 4AWXB 3ERED 2HQNA 4I09A 2JTVA 3C7JA 4OIQF 1Z6RA 1P4WA 3FXUA 1SAXA 1YQAA 1PDNC 1K78B 5TRDA 4EM2A 2CQKA 4HX4A 5ICFA 2XASA 5LRRA 3IRRA 3BP8A 4A0XA 4A2UA 4GCVA 3I64A 5J8CA 3RDIA 3CO7C 5D8KB 3BY6A 3KZZA 1ONVA 5D5WB 4BQAA 2PMUA 2V9VA 4BHCA 1CF7A 1DDNA 2PJPA 3J80K 2FNPA 2AXLA 3HRTA 4Z2YA 4M9SA 3EDPA 2J5PA 1ZH5A 4CXFA 2EV0A 1WWXA 1O3TA 1FSHA 2HDCA 2GAUA 2DQRA 2FQ3A 1SFUA 1KU7A 1ZYRF 3RYPA 2UXNA 1OPCA 3T0YA 4ASNA 5CVJA 2K7LA 5DEQA 2XKPA 3FHZA 4PZJA 1E2XA 2XVCA 4A0YA 3RKXA 2ISZA 3I58A 4HX7A 4P9UA 3ML6A 4OIPF 3R0JA 1BN5A 3CUQC 4CZZA 4M6XA 3TO7A 1QNTA 1J2XA 2YR2A 4F7ZA 1WSUA 2XKOA 3T5XA 2WC2A 3E5UA 1EV7A 3LAJA 3FM5A 1IRGA 1BC7C 2OA4A 3GFLA 4HF2A 1R23A 5LHGA 1RI7A 5K5OA 1L0OC 3GXOA 3E5QA 3FMRA 3I4PA 2NAZA 1ZREA 3ZPLA 4M72A 3LSTA 1G3SA 2K86A 2GIVA 1S7AA 1W7PB 3DPLC 3SZPA 2P5VA 4G6QA 3LWFA 2OZUA 1ZGAA 2FBIA 4G94A 5D5VB 3HOTA 2XHKA 2QWWA 1EH8A 3GZ5A 5K5QA 2GWRA 4Y15A 3CUQB 3KZYA 1KQ0A 1W5TA 2V1XA 1TW2A 3OV8A 4GGGA 4ESJA 5E17F 3ULQB 1XSDA 1HKTA 4YFXF 1F9NA 4M9XA 3HRMA 2Y48A 3O3KA 3H92A 2QZ8A 3LA3A 2GA1A 2Q2EA 2CWEA 1K7AA 4RAZA 2G9WA 1S6LA 2BBYA 2O03A 1YW8A 5D5UB 4EJUA 2FMLA 2FMYA 2MD5A 3U2RA 5FD5A 2VE8A 3IKVA 2O0YA 1SFEA 4KN4X 5ERIA 3P7NA 3V7RA 1IUYA 2PLYA 4UVAA 1SD7A 2XAJA 4M6YA 2RKHA 5ICCA 3F22A 2BEOA 4KIFA 2PFBA 4RGSA 4YIIA 3V7CA 3PFIA 4L0ZB 4ESBA 1U6GA 5K5RA 2HKXA 4AD9A 1U78A 1KYZA 4WK8F 2LF7A 4U0WA 2EK5A 2LKPA 3HHGA 2STTA 1LDJA 5DDGA 1MJ9A 4LB5A 3GUDA 1UFMA 2PEXA 3NEUA 5CVIA 3GVAA 2EA2A 4ZH4F 4EVIA 2FF4A 1YYVA 2F5CA 5DV5A 2ACJA 4IXAA 3RYRA 2EA4A 4G6DA 4KN7X 3GLXA 2VBYA 4GXOA 4L0YB 4LG0B 1P92A 1PUEE 3WTYC 4U7BA 3GEZA 3TDZC 5ICGA 3M8EA 5DD4A 5FFZA 4ESFA 4KDPA 1TBXA 1MGTA 3EYIA 4JK1X 4AIHA 3HUGA 2QENA 5E1ZB 3JTGA 2G7HA 5LLQA 1HW1A 1YIOA 2PQ8A 4BXUA 3SXYA 3FMSA 4WCGA 1Z6TA 4QLCU 2OAZA 1R1UA 4HBLA 1UHMA 4XSZF 4EV0A 3M7GA 3TQNA 4B09A 1U5TA 1I1SA 3WGGA 3T1BA 4L5IA 2DK5A 1T6SA 4HYEA 2HTSA 4MGRA 2DPDA 2H6CA 5FD6A 4HLXA 1D5VA 2QBYB 2CSOA 5F64A 1O3QA 1TNTA 2EWNA 4M74A 4XSXF 4HLYA 4JQFA 3RPQA 2COMA 1YW9A 3KP2A 3CO6C 2ADUA 4MQVA 3LAPA 3IKTA 1ZG1A 2ETHA 3L00A 1TQMA 3B02A 3I59A 3F8BA 3KE2A 2M1BA 2P6TA 4WXHA 2VXZA 2M45A 2XAGA 3ABTA 2A3SA 3ECHA 3F23A 1YS7A 4G8XA 3IC7A 2HGCA 3ZMDA 4KNYA 4RB3C 4RGUA 4UHTA 3TKYA 2HYGD 2VT3A 2W57A 1QO0D 3SQNA 4OINF 2XAQA 1TNSA 2ZO4A 2A07F 2ZMEA 2A6EF 1F1ZA 3K9TA 3O2PE 4H0EA 2M30A 4QWQA 1Z7UA 2BGCA 2L3DA 1LEAA 3KLOA 4EM0B 1E17A 3I5UA 4KFCA 4UVBA 4I0AA 1BI0A 3WE3A 4R79A 1GHCA 1YLFA 3QU6A 3J81Z 1EH6A 4P5OA 1XMAA 4I01A 5L3BA 4KUMA 3K0LA 1Z1DA 3J7AO
chains in the Genus database with same CATH superfamily
5H6RA 1BJZA 1LVKA 1X58A 5HDGA 3OYJA 2XV4S 3FMQA 4ENKA 1VNDA 4MIMA 1LFPA 4OMYA 1USSA 2DA6A 3DKWA 2R7QA 3ISPA 1ZQ3P 1WFXA 3HSRA 2EFPA 2R7ZJ 2M4KA 3K1MA 4L9TA 1ZG3A 2DJIA 2ZJRF 3WGIA 2B63J 4OIOF 3E1SA 1MJAA 3C1DA 3MCZA 1K78A 1B6AA 4YEJA 3ZN0A 1H0MA 3BG9A 1FSEA 1RZ4A 2KRFA 2PJRB 3GTPJ 1JTXA 3CC2I 5F1RA 1GVJA 5L3DA 1BOBA 5J1YA 1N75A 1P2FA 3HZJA 1KA8A 2EJRA 3BPXA 4ZZDA 2BY1A 3E6BA 3LFUA 4HF0A 2XROA 3HL2A 4XLFA 1ZARA 2CU7A 5HS7A 3VYTB 2BHYA 1FP2A 3GFJA 3FXOA 3HOUJ 2P0WA 1S7OA 2E34A 4U7DA 4HW0A 2NNYA 1JUPA 2M5WA 4IF4A 3RPUD 1IN8A 2M0CA 1W4MA 1PVEA 2VBXA 2DA7A 4JX4A 1QZZA 4RS8A 2DI3A 2VI6A 3ABUA 1HLVA 4HAMA 1O7FA 3QAHA 2FNAA 3BROA 5M5WJ 1OYYA 1DP7P 3JAMZ 2OQGA 1DPUA 2P8TA 1I6XA 2DMPA 3J7YJ 4A3CJ 1IXRC 1RKWA 2HZTA 4NQWA 1K79A 4UVCA 1G3YA 3E3VA 4NBQA 4V2FA 2Z5UA 2XF6A 2EFOA 3RKYA 4G7HF 2FEZA 3UNGC 1MZBA 4IHWA 4UXNA 5EF6A 1IW7F 5EZGA 3FM3A 3EUHC 3JW4A 1B59A 4G7ZF 2XUBA 2IS6A 2HR3A 1P7IA 3OSGA 4D0PA 1PYVA 2DTZA 1V3FA 4E7JA 4MEXF 2JPCA 3L2CA 2CW8A 4XMYA 3TO9A 1J75A 1XGOA 3D5LA 4K2EA 4Q47A 2ZJPF 3KETA 4A6EA 3O8GA 3LSKA 1FY7A 4A3IJ 4ABZA 2D45A 1YG2A 3B6AA 4ZTFA 2GIZA 1QRYA 5LEKA 3BG5A 4XBFA 2NYXA 4XLEA 1ETOA 4M71A 2NRAC 3J7ZI 4KYWA 5L3FA 4Q5SF 1GXPA 3SEZA 4LLNA 3I55I 4GYIA 2DXIA 3G2BA 2HVRA 5FRNA 1ERDA 5HLHA 1SANA 3BJ6A 3Q9SA 4BKXA 3E6DA 3GFIA 2BVLA 3U1KA 3L2WA 2R5ZB 2MABA 1BIAA 2EB7A 4CDGA 3JAMK 1UHSA 1R58A 4D7NA 3OYIA 2IGNA 3F6VA 2HYJA 5DYMA 1Z05A 2O8KA 1F43A 1D3YA 5IYCJ 4BE2A 3ESWB 3CF2A 4BUPA 1TL8A 3V8JA 4RAYA 2DBBA 1PP7U 3I9V2 1VQMI 1QVTA 2ECBA 5HLTA 1VQOI 2ISYA 5ILVA 3PL8A 1LB2A 3LMMA 4BDZA 3FXQA 2DA3A 4LB6B 4RGRA 2HXOA 2WAQN 1VF9A 3GZ6A 4BY1J 4UV8A 1YFHA 1FMVA 1X4OA 1KU2A 3WTSC 3ASNH 4JYKA 2L54A 3BG6A 1Z1DA 3OYAA 2CRGA 4ZYGA 5EEGA 3BWGA 2HKOA 1D1BA 1W7PA 1ENHA 1RIOH 2K85A 1FIPA 1OMIA 3BG7A 1FMWA 1GVDA 1BA5A 3H36A 3V8LA 5F08A 1W0UA 3V8KA 2BY0A 3VEPA 4EATA 2WV0A 3QRFF 3ZMUA 4PFPA 1WJFA 2IGMA 3BQYA 1JUMA 2Z9OA 2KJBA 1LJ9A 2KIFA 2L4MA 2MA3A 2NVYJ 2DU9A 5ED4A 2L01A 1LVAA 4E7SA 4M9ZA 1MSFC 2H94A 1HDPA 4Q4ZF 4QSHA 3MMYB 5HLGA 4LK0F 2VL8A 1ETYA 3AG1H 2H09A 4XN0A 1BM9A 3HOVJ 3K70D 2CW7A 1DQUA 2NNNA 3EQLF 1FEXA 1FC3A 1ZHFA 3S8PA 1IRXA 2OD5A 2KL4A 4HQEA 1J0RA 1X3UA 2ELKA 4OAZA 4FISA 2EFWA 4IO9F 4N9HA 3PNVA 1N25A 6PAXA 4A0ZA 5C44J 3S16J 4Y3OA 3G1LA 2QQ9A 3K1PA 4PCQA 3B73A 2DFEA 5CJ9A 3FDYA 4FTHA 3BG3A 3CCSI 3HOSA 5B5EC 4OOIA 1SMTA 1XSXA 5LGNA 5M5XJ 3VB2A 3BJAA 4LD5A 2NVUB 1CF7B 1XMXA 2G0EA 5F27A 1KYWA 4J00A 4KMFA 3F0CA 2OV7A 2RAEA 1Q1HA 3GO5A 1R4MB 2CUFA 3FX3A 3W2WA 3E7LA 1JGSA 2WWYA 3IAM2 3BTCA 2LKSA 3R0AA 2X1EA 3L2VA 3N97A 5FKLA 2Z1DA 5FKKA 2Y69H 1ACIA 3AG2H 3I71A 1D0ZA 3E6MA 3CDHA 2MH9A 1SVOA 4NB5A 1S9HA 4DOZA 2Y0SN 4DZJA 4MTDA 4EGZA 4I6ZA 3G4SI 1OR7A 5GPCA 1S7EA 4G9YA 1R71A 1ZGWA 2YX7A 3WODF 2PBIA 4RGXA 2IPQX 3GW2A 4F91B 1LE8A 1DU6A 1ODDA 4AYBN 1MH4A 2XF7A 3JSPA 1YJWI 1BI1A 1TWGJ 4XONA 3T8TA 4XQFA 1BBYA 4BACA 2BW3A 2VC0A 3C2BA 3DV8A 5GPAA 1BC8C 3QOPA 1HXDA 4WF2A 2HU9A 4BHBA 1FYMA 1Y56A 2EFNA 3BT9A 4CICA 4UUVA 1TW3A 2FJ1A 5GAGJ 3LA2A 3TMOA 5HS8A 3PIPF 4ETSA 3PO3J 3WU2C 3KCCA 2K9NA 4F3QA 1ZRDA 3KP6A 2NVQJ 2X6YA 4M3BA 1Z91A 2ZKZA 5GTIC 4PJNA 2PMHA 1Y1VJ 2FU4A 3LFKA 4V2GA 3RIRA 2W85A 4BJ6C 5IT3A 3ZRGA 4UB8C 3CMEI 4W1UA 1IUFA 2AQEA 2HOTA 1YITI 4LG0A 4ON0A 3VSLA 1W1WE 3DCFA 4S04A 2FA5A 1Z3XA 1YW7A 4XRMA 1ZK8A 2ZXHA 1JHHA 3SDGA 1WJCA 1WH7A 3PQKA 5E1WA 2EH3A 1JJ8C 1QPIA 1EH7A 2Y0SA 5GAEJ 1U0JA 2IA0A 4JX5A 3ZQ7A 5AIQA 2VQHA 4WWCA 2LNBA 3H5NA 3GX4X 1IGNA 4AYBA 1UZCA 3ZMVA 3TW7A 2LRDA 3WHBA 4RB2C 2HTJA 2LYCA 5HDKA 2JMWA 2VJ4A 2HPIA 3BJOA 1H9TA 1I1GA 3QP5A 2H8WA 2VKDA 1KQ8A 2IS2A 1WJDA 4M3DA 1T95A 5J4YA 1RPWA 2CGPA 2YS9A 2PX9A 3OY9A 5FB2A 2DMNA 3ABLH 4CH7A 1FBQA 2LBFB 2FBHA 1W5CC 2OBPA 2KIUA 5CYVA 5FLXZ 1B1BA 2VJJA 3TOAA 1JUSA 2E1OA 4NDLA 1ITYA 4OMZA 1FOYA 1XCVA 4GYGA 1UCRA 1S8NA 4RB0A 1STZA 3WTVC 2PI0A 3HRUA 2UWMA 4BXFA 1AKHB 5A2QZ 4ENMA 3S3NA 3H9QA 3DTEA 5JFRA 5F0HA 5C4XJ 2X0LA 2CG4A 3KX2A 2XSJC 2WY8Q 3DTKA 3DWLE 2GXBA 4XLCA 2L7ZA 3A1YA 2PMZN 1IAWA 3S15J 3H3VK 1MBFA 3WE2A 2HDDA 3F8FA 1QZYA 2QBYA 1POGA 4WXDA 1GV2A 4KMUX 3QOEA 5E3OA 2GXGA 3M3YJ 3AAFA 1NTCA 4B8XA 2BVMA 4EGYA 2DPUA 3L2RA 4ITVA 4LIUA 3N05A 3U21A 2TDXA 1FP1D 1YJ9I 3BOQA 2L9VA 4C2TA 2JPBA 2LVSA 2MH2A 1OCRH 4QPQA 1J5YA 1H9GA 3HOYJ 4O3MA 1T8IA 3DXJF 5CVVA 5E18F 3FKIJ 3OIPA 3WU1B 3OYMA 2WBMA 2A5YB 2B0LA 1J9IA 2KKOA 1HSTA 1DGRM 2MLKA 3LSPA 4MFEA 1SFKA 2FRHA 4DBQA 3K1NA 5FLXK 4B47A 5AONA 1MBKA 4JP0A 2H6BA 4CZCA 9ANTA 1F5TA 2M8GX 2NOGA 4CYDA 4EM1A 3PUFA 4A6DA 2DCEA 3QYEA 1TQIA 5A2QK 1G4DA 1REPC 4A5MA 2IW5A 2IA1A 4IRIA 2LH9A 3ZQFA 2Q8KA 2IAIA 2ZSHB 4RM2A 3WHCA 1PUFB 2P81A 1PJRA 2DT5A 4U88A 1R5ID 3TDUC 3MEXA 2IRFG 2HQRA 5E1XA 4D7MA 5D6EA 2E36A 1RNLA 5HOOA 1R22A 2CUZA 2VLAA 1AU7A 2F4OB 4DQ2A 2BV6A 5LEJA 2VKEA 1MD0A 4IJAA 4I76A 3CQZJ 3REOA 2CS3A 3S2WA 1APLC 3M07A 1WRJA 2PMZA 2GA2A 1YS6A 1C0WA 5HVQC 1VQ8I 3I53A 3HGYA 3BLYA 1ON2A 1HKQA 2E60A 3AL0C 1ZAOA 3TOBA 3HJEA 4F52A 1FT9A 3GTLJ 3WG7H 4IEJA 3RI4A 1U8RA 2PN6A 3DPTA 1TWCJ 5F0CA 4O5VA 1DP3A 1UHWA 1J7KA 1LDDA 3PSIA 4FX0A 1OFCX 2EZHA 4B1RA 5IPAA 3UKGA 3FK7A 4CCJA 2YSRA 2CJJA 2CQXA 2PG4A 3PQJA 1SD4A 3WTTC 3A0BC 3LSGA 3OIOA 2QKLB 4UUSB 1FTZA 2K02A 2OCCH 5H20A 2KZGA 3Q9VA 1SFXA 3TL4X 4L5JA 4BJTA 4ZYEA 3MKWB 5CQGA 1AHDP 4RAFA 4IHVA 1U2WA 1U9NA 4ZDPA 2M8EA 2KDOA 1JE8A 4IKFA 4R1HA 5EG0B 2MGQA 4BXXJ 3GWZA 3HUGB 2ZCWA 1YIJI 1ZR4A 4RLFA 1FOKA 4XKWA 2E35A 3R60A 1EF4A 2Q0OA 4CUGA 3OOPA 1X19A 1T0FA 2VQLA 3QYBA 2QUFA 2HOEA 1RRJA 2DAOA 5F6FA 4KISA 3UR3C 2QF7A 3QP6A 2CH0A 3WG9A 3K70C 1B8IB 4XRSA 4BEHA 1LEBA 5FKMA 3FXLA 2KISA 4IVNA 5BMZA 1AA7A 2LSOA 1MDMB 1HSJA 4IHSA 5D8LB 1IC8A 4E7HA 3D5RC 3GMEA 5FJ8J 3AL0B 2LY1A 5J47A 3JRHA 1HBXG 5KK1A 3ZMSA 2WY7Q 4LG3A 2NOJB 3QPTA 4KT5C 5J4VA 1Z67A 4KA4A 1Z77A 1HW2A 4DYCA 2ELJA 2BY2A 2DO7A 3LSJA 5DM7F 4P9FA 3GTMJ 1ZN2A 4X6AJ 4YIRX 3HPHA 2QVOA 4HDUA 1YTYA 3CUOA 2V9PA 4D5FA 4WXCA 5BPDA 5DCMB 4A3LJ 1YRNB 1FBUA 1ZLKA 2EILH 1U9OA 1E3HA 2YX4A 5JHUA 3PFYA 2KQRA 5EGOB 5B3SH 3PNYA 3DKXA 4U0YA 1A6IA 1NH3A 3FXJA 2P4WA 1S29A 3C2GA 4XOTA 1OISA 1P7JA 2Y9YA 4A69C 4BNCA 3W6VA 1V54H 3HGGA 3MZ8A 3A2KA 2QCOA 4EMSA 3G3ZA 1WKMA 3KEOA 4LFUA 2EV6A 1TT5B 2FE3A 2JRMA 2QLZA 3ECOA 1Z3YA 3DFGA 4M3GA 1ULYA 3BR3A 1XDUA 4HA8A 2DTRA 1RR8C 3VWBA 3GTKJ 2QQBA 2NS7A 4EJOA 1QA6A 3ZR8X 4E70A 1HKSA 2HYFA 1W5SA 2HFHA 3CTAA 4UV9A 1SAUA 4OIRF 2QA4I 1X3ZB 4B43A 4Y7NJ 3K4JA 2VBZA 3CMYA 2JA2A 4U87A 1K61A 2ZXWH 2ZXIA 2M2EA 1R5GA 2ELHA 3WGHA 3IHUA 3RTRA 4M3FA 1AWCA 5LGUA 3MWMA 4YFNF 1BI3A 3HEFA 4FT8A 4M3EA 4L9VA 3I59B 4Q48A 4I2OA 3OYEA 1ETQA 2KHMA 4YRVA 1JKPC 1B72B 3CCVI 4GO1A 1GXQA 2CO5A 3H35A 3MD2A 4PJLA 5CPRB 3VFZA 2E5ZA 2OQRA 4RAGA 2L9NA 4DBRA 2UUZA 4V19K 1P4AA 3FF5A 1ZR2A 1I5ZA 1EA3A 2P5KA 3L2QA 4IRGA 3F8CA 4JOMA 2V1NA 3K2ZA 2R5ZA 3MN2A 2R7SA 1FYLA 1TTYA 3L7WA 5D5XB 3S1RJ 1SD5A 1HQCA 4HDVA 4B4CA 1D0XA 3G71I 2LDUA 2ZXJA 2E7WA 2DOAA 2ESHA 2JRTA 3HTUA 4HOBA 2XAUA 3ZGKA 3F8MA 4DYRA 2RN7A 3K4BA 5HNFA 4IHXA 5ICEA 5L3GA 1LPQA 3DEEA 3BR5A 1H88C 5JI6A 4ZDLA 3TW6A 1OKRA 1HW5A 2P5LC 1BR1A 5E3MA 3MVPA 1BJAA 1WHUA 3Q0UA 5HDNA 1QZEA 1WH5A 1XGMA 1MBJA 2DFIA 3FHNA 3A03A 3MQ0A 2GZWA 5DM6F 4ZYDA 1O3SA 2BXZA 4I02A 3W6KB 2VB6A 2AO9A 1CQTA 4AM3A 3H1CA 3EUHA 3C2HA 3I0TA 4XRFA 2LC2A 4PK4A 5IY5H 2W7NA 3AG3H 2IJLA 2MFZA 1TWHJ 2KJCA 2XGXA 1QBJA 1FNNA 3ZCOA 1HF0A 5LHHA 1A04A 1DPRA 4EQQA 1R00A 2R7RA 3G1MA 5KNLA 2KLOA 1MMGA 2IS1A 3A4CA 5L3CA 4MQ9F 2RREA 2WAEA 2JSPA 2CFXA 5FFXA 4HV5A 3V42A 3ZMTA 5HODA 1OYIA 3BCAA 2X1DA 1IF1A 2VOPA 3U9GA 2K27A 1O57A 3K7AJ 1D8JA 2NS0A 5J1UA 2ZBKA 3E6CC 1XB4A 5KCMA 3CC4I 4DJAA 3SFZA 1X2MA 5K1YA 2A69F 3G1OA 3JTHA 2V1UA 2M4GA 2UXXA 1WVRA 4UUTA 4NUBA 4AIJA 4NNJA 1FWZA 1UELB 4CCKA 4A3GJ 4LITA 5DD8A 1V5EA 1WCMJ 2R7OA 3S3MA 2IT0A 3DU5A 2K9QA 3S14J 1D1AA 1FPQA 1KZHA 1U8BA 2TRTA 1OYWA 2ZNYA 1YHQI 3BR6A 1WJ5A 3HDDA 1OCCH 2E19A 3LSIA 4QTRA 2R5YB 2A68F 2W4SA 5JVTA 3I56I 2K4JA 3OSFA 1XS9A 4UY8I 1R36A 2JK3A 3NWSA 1Y1WJ 3I4NJ 5CLSA 4BS9A 2VE9A 1LUJB 3K6GA 1P4XA 3MZYA 3NRVA 3HSFA 3BTIA 3AG4H 4G12A 3CCJI 3LQRA 2QM3A 4P96A 4DNCA 4XRSG 4I98B 2ZJQF 1IRFA 2M34A 4I7HA 4IRHA 4L9JA 4N4OB 3TO6A 2D1VA 1XDSA 1JGGA 2P6SA 4BYYA 4L5EA 1V55H 4PDKA 4BU2A 3F3XA 1G2HA 1OJLA 2R3SA 3BZ6A 2VC1A 2KIQA 2ZNZA 4TV7A 4MHGA 4LLLA 3OR2C 3WTUC 1LDKB 1B4AA 3K10A 1QU3A 5EJCA 2ZSIB 3KIOA 2BXYA 2KIMA 2XAHA 3CUQA 3L9FA 1G3WA 1YJNI 5DUIA 3MZHA 3ERMA 3SZTA 1ZKGA 2XB5A 3IL2A 2JN6A 1WJBA 1MBHA 1MMAA 3HIFA 2IVMA 1GV5A 2HVQA 4HEA2 4CYCB 3QODA 1VQ4I 2DLLA 1R9TJ 3GYHX 4RDUA 1V4RA 4DIQA 1G3TA 3NQOA 2JVHA 2LFBA 1WGXA 2R7DA 2GM4A 4HSTA 4A3JJ 3NARA 3N4MA 1ZRCA 2E1CA 4JX6A 3QU3A 4G7OF 1OCOH 1A31A 3ELKA 1N78A 1E0EA 2FQ4A 3JRDA 5AIPA 1T39A 2AXTC 3VOEA 1W36D 2BZTA 4XK4A 1IRZA 2L7KA 5BOXA 3FIWA 1RUNA 2E7XA 4P55A 2EPFA 2TCTA 1FBSA 1JXSA 1L3LA 2HXIA 4Z6YA 4Y17A 1NK3P 3SHFA 1O7LA 2VQCA 2WAFA 1KU3A 4PJMA 1VQLI 4AUXA 4YG2F 4EEFG 1O3RA 2XRLA 2H1KA 1Y39A 1Y0UA 3PO2J 4MFDA 3DQVC 5J1RA 1IN4A 1T98A 3WTXC 2JT1A 1S3JA 2OJED 3OYGA 2STWA 1OCTC 2LY2A 4W97A 2Z3YA 2E1NA 1XMKA 2HPMA 1WJAA 4E6KG 2O3FA 3CCEI 1LFBA 4PSXA 4C3HJ 3OWTA 5L3EA 1WZ2A 1F4KA 4LK1F 2CQNA 1RC9A 2CYYA 3Q0WA 3F8NA 3M9AA 4YFKF 2QSGX 4E4HA 3O6BB 3DBRB 1VQKI 2R7FA 1E3PA 3KP3A 3MKYB 2D1HA 3RZOJ 2M7AA 1JHFA 3M1EA 3GZNB 4EJTA 3GBGA 4HZFA 1M1EB 5BQTA 5LHIA 2DK8A 1VTNC 5J6XA 3P9KA 1O4XA 1CGPA 1OR7C 2LBFA 1TLHB 3NWTA 3D0SA 2KRCA 2FUG2 1OLTA 5JVGF 4IOAF 1USTA 1JTYA 2L02A 1MKMA 1X1BA 2L7MP 1AKHA 2FD5A 3BC8A 3OIQA 4F55A 4Y13A 2E1MC 2X1CA 1RETA 2ID6A 1KQ9A 4MEYF 4XNFA 3BR0A 3I3LA 1SMYF 2K5CA 2X51A 3Q0VA 4WX9A 3RZDJ 2VPLA 3RKWA 3P9IA 5D4SA 3BTLA 3KEQA 2FOWA 3GTOJ 2F5FA 3JRFA 1BOAA 2W24A 5FLMJ 2E5NA 4A12A 5GP9A 3DBLB 2O61A 3ZQLA 4G6TB 3VYRB 2W25A 2XGDA 1K6YA 2HWVA 1PP8F 3LSHA 1JT0A 2ZFUA 4L9NA 4E7IA 2V6CA 2O9LA 2M87A 4XORA 1WPKA 5LRSA 4E7KA 4A3MJ 3T8RA 4JBAA 1I27A 5E8IA 4J19A 1X4PA 5TISC 4RM3A 5E20A 4H4KC 2MLGA 4KICA 3HTSB 2DFFA 2DDBA 3NAUA 1I50J 4PGGA 1IN7A 3KFWX 1R1VA 2HOAA 2DQLA 5LFAA 2GXAA 2HS5A 4DGWB 1ZRFA 3KLNA 3DLLF 5J3LA 2W82A 2A6HF 2C6YA 3HRSA 3QPHA 1TZLA 2JJ7A 5DUKA 5DCFA 1XPXA 3QPLA 1MSEC 3CCQI 1RR7A 1H8AC 5C3EJ 4DYQA 4ENNA 2V1DA 4ENJA 3CCYA 3DEUA 1P6RA 3S2HJ 1ZGJA 4NHJA 5LD2C 4L18B 4X1EA 4CCNA 4YIFA 3LNQA 2VUMJ 4IHTA 2D2WA 3LOCA 1IXCA 2E1MB 3K69A 3QQAA 4OU0A 4LIVA 4U0VA 3GTGJ 2MBFA 4RBOA 5KAFC 4M6VA 2AQFA 4R8HA 3RPUA 2ZJ2A 1IN5A 2IA2A 2QKMB 2HDWA 1BIBA 2VODA 3WTWC 4BY7J 3HHHA 2HQAA 2LR8A 1G6NA 2V6EA 3P5JA 2OF7A 2Q2EB 5IYBJ 4AU7A 4AVPA 2VBWA 1VFCA 2F2EA 1T2KA 3HM5A 3SYTA 4P1WA 2DMTA 4ZDOA 1T08B 2YU3A 1NG6A 1XGNA 2OZ6A 4CO8A 5E3NA 3F21A 4RB1A 4BBRJ 3ROUA 5FGMA 2VN2A 3CZ6A 1ZG5A 4A5NA 3RCOA 3HPGA 1WQ2A 2VJIA 5TGTA 1QHHD 5K7FA 2BYVE 1D0YA 1R4NB 1TC3C 2O5RA 4ZYHA 2HI3A 4UUSA 1XN7A 2FX0A 2CV0A 3CMAI 2DFHA 2Z33A 1X3WB 4XLPF 3PNTA 4BQQA 4KIBA 5TJJA 3OS2A 4AC0A 4FASD 3BZCA 2L9RA 5EG0A 3E97A 1BI2A 2H27A 3S93A 2RV8A 3COAC 2XRNA 5E3LA 1RUOA 4I99C 4KJZA 3CJNA 3G73A 3OL4A 2IGOA 3PSFA 2EV5A 4PJ0C 2RGVA 3VDXA 3OYNA 3DKYA 1LNWA 5ILUA 1T38A 3TEDA 3EETA 1FLIA 5B1BH 4FHTA 2ZFWA 3U1DA 2YUSA 2OU2A 1W7PD 3EYYA 2WTEA 3CLOA 2QSHX 3JSOA 1B8IA 3MAJA 1BR4A 4MNUA 5K7HA 1WI9A 5CVRA 3ASOH 1UB9A 2RQPA 2DMUA 1MDMA 1YX3A 1QGPA 3C18A 3R61A 4RLQA 4QIWN 2X4HA 5H6QA 4FX4A 3GF2A 3V7SA 2GOXB 3HYIA 4UNOA 4CCMA 2CW0F 2VPRA 5K7ZA 1AOYA 3LL7A 3AKZA 2AS5F 1V5GA 1U5TC 3W6JB 3IRQA 3K4KA 1R5HA 3VODA 2FOKA 3IH2A 3OYCA 2VT2A 4I0BA 3OS0A 5JLWA 3HB9A 4LOCA 4BQOA 4E7ZA 4AIDA 4O6JA 2Y2ZA 2R7UA 5DCMA 2UZKA 5F0FA 3OYHA 3Q5FA 2DT7B 1LQ1A 1A5JA 1EKEA 5EGOA 2OCEA 2VONA 1A36A 2RNGA 2V26A 3JR9A 4N0BA 4A93J 1Y6IA 1ETXA 2IP2A 3CDLA 4HSRA 3RQ4A 5LGTA 2JSCA 1XSVA 1IN6A 3CCMI 4HQMA 1TWAJ 2IXSA 4NC6A 2DMQA 3E0JB 2FBKA 5E8GA 3ZQHA 2CUEA 2K4BA 5LBQA 3FXKA 1SEUA 3M8FA 3BDDA 1NK2P 4S05A 1IV8A 5JR3A 5B66C 4XIDA 3LSRA 2HOSA 5KHDA 2FSWA 1QQIA 1YO5C 1HCRA 4B3AA 2JWTA 4X0GA 4FETA 3LA7A 2V79A 4BAYA 3C3WA 2MW8A 4N9IA 1NG7A 4II3A 2QQ8A 3LSMA 3VYSB 3FZVA 4E7LA 2Y75A 2F5DA 3KP4A 3LQQA 3DF8A 1B9NA 4PGHA 4LMYA 1ZLJA 2XGEA 3A01B 3WU0A 1FZPB 1IZ1A 1MMSA 1U5TB 2L4AA 2PJRA 2DT6A 1B72A 4MTEA 1ON1A 3GFMA 3CLQA 2I10A 3HSEA 3QYFA 2P7VB 4HV6A 2RVCA 3DP7A 4FE7A 2BE5F 4XLAA 5F04A 1W36C 2RC4A 3OR1C 2Y0MA 2JZYA 1WI3A 1GDTA 1K6OA 1IV6A 5J8FA 5HLIA 4EJWA 4CHUA 3B6CA 4A3EJ 2W84A 1Z9CA 2JQ7A 2E71A 1GLNA 3SEQA 1BW6A 3CP2A 1SVMA 2QYOA 3EUAA 2L5QA 1SD6A 2VASA 5KVRA 2O6GE 1I3QJ 1XCBA 1QPMA 3CCRI 4B3XA 2K9MA 3DU6A 3ZP5A 2ZMEC 1FOWA 1XD7A 1X2NA 2EFQA 2MYSA 4XKBA 4ZJZA 4LLGF 5ILSA 4C3IJ 5D6FA 1QVUA 5BNGA 4IPAA 1MJBA 2XIGA 1FJLA 2ICWG 3TGNA 1KGSA 4BHPA 2ID3A 3IH4A 3V4GA 3E5XA 3KP7A 2P7CB 5IT9Z 3BPVA 1P9QC 4BGDA 5KAIC 1XGSA 3JRCA 2L9SA 5GTHC 1Z0XA 4HX8A 2E2JJ 2F5VA 2CMPA 2XAFA 2FXAA 4BH9A 1S5LC 2NVTJ 4KIGA 1G8XA 5CQEA 1BR2A 2RDPA 4MLOA 5IYDJ 2KPMA 1MH3A 3BCBA 3FXMA 3RJPA 1LKXA 2A61A 2M7BA 4CGZA 2R7XA 1JKQC 1KU9A 1FX7A 3L09A 2XSDC 1JJ6C 1FYKA 2Z99A 1VQ7I 5H2FC 3OYDA 1B9MA 4ZZLA 3R4KA 5D4RA 2F5EA 4M73A 3KP5A 3JREA 3ZN1A 5CVUA 5HNHA 2BHZA 2DYRH 4EJVA 2CUJA 2VKHA 3BR1A 4BEHB 1ETVA 2Y9ZA 4C3JJ 2O8XA 1IDZA 1TWFJ 2GQQA 2F48A 2IEKA 5M3MJ 2IGKA 5HS9A 5BPIA 2ZC2A 2MSYA 2DW4A 4RA2A 5FO5A 2H8RA 5BS6A 1D8KA 4KITB 2RNJA 3IWFA 2ZMEB 1FTTA 3F6OA 4HNTA 3JCUC 1J59A 2VJ5A 2VOOA 3PIOF 3FXRA 4LGWA 3GTQJ 2J5OA 5FKNA 1VZ0A 3L1PA 2YPRA 2QQAA 3D1NI 4LJZF 2I8DA 2LOOA 1TQPA 1R7JA 3IWZA 3J81K 2R5YA 3ZQCA 3R6SA 1IXSB 4AIKA 1FIAA 5IT9K 1MMDA 2XF5A 4XOPA 1K4SA 1FOXA 1U3EM 3PM1A 4XR6A 4BJ5C 2V7FA 2G7UA 2LF8A 4HF1A 3KPHA 3MKZA 1N77A 2LLKA 3ZMZA 1OQYA 1DUXC 3Q3SA 3FWEA 5FROA 1HC8A 3F72A 3P9CA 2CV2A 1R1TA 2MC3A 2LP0A 3WTZA 3J80Z 3I54A 1NHAA 3MFKA 4NC7A 2HEOA 3H3UA 3GTJJ 1MMNA 2F6CA 5EEHA 3VYUB 2F4IA 4XLNF 2ESNA 3H3ZA 4AWXB 2X85A 1T56A 3ERED 2V9KA 3SJMA 3RQIA 2HQNA 4I09A 4FE4A 3HC7A 2JTVA 3C7JA 4OIQF 1Z6RA 3HXLA 1D1CA 2Q1ZB 2WB1N 1P4WA 3EUKL 4A3FJ 3FXUA 4KT6A 1W0TA 2NXNB 2X48A 3D5SC 4CYCA 3HOXJ 1YQAA 1SAXA 1PDNC 3SFIA 1K78B 5TRDA 5DS9A 2KDZA 2NS8A 4EM2A 2VKVA 2CQKA 2R4GA 4HX4A 5ICFA 3ZQGA 2X6WA 5FLVA 2XASA 5LRRA 3IRRA 4IHYA 3BP8A 4A0XA 4A2UA 4GCVA 5IP9J 3I64A 5J8CA 4IL6C 2R7TA 2DYSH 3RDIA 3CO7C 5D8KB 2EZIA 2GBYA 3EPZA 1K83J 3BY6A 4IQJA 2HZDA 3KZZA 1MNMC 1ZTRA 1ONVA 5M3FJ 1XX5A 4BBSJ 2VXDA 2X6XA 3ABKH 1J09A 5D5WB 2PMUA 4BQAA 2V9VA 4BHCA 1CF7A 2OPTA 1DDNA 2PJPA 3J80K 2FNPA 4GFBA 3H5RA 3H0DA 2AXLA 3HRTA 4AVZA 5EDNA 4Z2YA 3SZGA 4C2UA 1Z21A 2DODA 4M9SA 3EDPA 1TP4A 3KEYA 2J5PA 1ZH5A 4CXFA 2EV0A 1WWXA 1O3TA 2MC4A 1FSHA 4HNVA 4NQWB 2HDCA 1MBGA 2JA8J 4PSWA 2B7EA 2LKXA 2GAUA 3RSNA 2R7VA 4HG2A 2K3FA 1I6HJ 2JUCA 2DQRA 2FQ3A 1VQ9I 1SFUA 1JT6A 1KU7A 1ZYRF 2COBA 2MD0A 2LREA 3RYPA 4XL9A 2UXNA 1OPCA 3T0YA 4ASNA 2HVSA 5CVJA 2K7LA 3CJRB 2IS4A 5DEQA 2K9SA 2XKPA 1LFUP 2WB1A 3FHZA 1XG1A 4FQGA 3CF5F 4PZJA 3CDIA 1E2XA 1YI2I 2XVCA 4A0YA 5JHFA 3RKXA 4DZPA 3I58A 2N8GA 2ISZA 4HX7A 4P9UA 2XB0X 3ML6A 4OIPF 3R0JA 3S3OA 1BN5A 2KFDA 3CUQC 3KYCB 4CZZA 1V5FA 4M6XA 2F4MB 2DA2A 3TO7A 1QNTA 1J2XA 2YR2A 2DA5A 2OC6A 4CCOA 4F7ZA 4FCYA 2XPVA 1WSUA 2XKOA 3SDBA 2LK2A 3OYBA 1EJ9A 3T5XA 3TBIA 4BE1A 4ZYAA 3HG9A 2WC2A 3E5UA 1BW5A 1IO2A 3DPUA 1EV7A 3LAJA 3S1MJ 2WADA 2LMDA 3FM5A 3H9GA 1IRGA 1BC7C 2OA4A 3GFLA 3AFHA 4HF2A 1R23A 5LHGA 1RI7A 2LD5A 5K5OA 2JA6J 2EQRA 4N4NB 2HQ5A 2A05A 1L0OC 3GXOA 1UJ8A 3E5QA 3RKQA 3FMRA 4CSWA 3I4PA 2NAZA 4C30A 2D5VA 1ZREA 3ZPLA 2WAQA 2DDAA 4M72A 3CC7I 3LSTA 2EZLA 4GRIA 1G3SA 2K86A 3W2VA 2GIVA 3CMMA 1Q1VA 2E2HJ 1S7AA 3FISA 3ONQA 1W7PB 4UB6C 3DPLC 3S2DJ 4Y4RA 3SZPA 1QHGA 2P5VA 3HKZN 4G6QA 3LWFA 3X2QH 3ZOBA 2OZUA 1ZGAA 2CQQA 2XPWA 2FBIA 3M1CA 2L7FP 4G94A 5D5VB 3HOTA 2XHKA 2QWWA 1EH8A 3GZ5A 4IQ4A 4Y52J 5K5QA 2GWRA 2ZB9A 4PFOA 4Y15A 3CUQB 3KZYA 1ZELA 1KQ0A 3VSKA 1SVLA 1W5TA 2V1XA 1TW2A 3OV8A 2R92J 2DOEA 5IP7J 1GUUA 2X6OA 4GGGA 2EIMH 4ESJA 3JRAA 5E17F 1XC5A 3ULQB 3W2AA 2KP6A 1OCPA 1X1AA 3DEWA 2R0QC 1XSDA 1HKTA 4YFXF 3TP0A 1F9NA 4M9XA 1VQPI 3CD6I 3HRMA 2Y48A 3IUOA 4A3KJ 3O3KA 2O7OA 3IH3A 3H92A 2QZ8A 2JUGA 3DLAA 3LA3A 3QWLA 2LTPA 2GA1A 2Q2EA 2CWEA 3VPRA 1YX5A 4XKCA 1K7AA 5FKOA 4RAZA 1HDDC 2G9WA 1S6LA 2BBYA 2O03A 1IG7A 1GT0C 1YW8A 5D5UB 2FMLA 2FMYA 2MD5A 4EJUA 3U2RA 1R49A 2CV1A 2QEXI 5FD5A 2VE8A 3IKVA 4DW6A 3BR2A 1A6QA 2O0YA 2E2IJ 3KZIC 1SFEA 1HA8A 4KN4X 4D5CA 3W3CA 4XICA 5ERIA 3P7NA 3V7RA 1IUYA 3F9KA 2L2OA 1OCZH 1XTAA 2PLYA 2I5UA 4UVAA 4YELA 1WJEA 2A6TA 1SD7A 4ZC3A 2XAJA 4M6YA 4BL0B 1A35A 2Z2SB 2RKHA 5ICCA 3F22A 4C2MJ 2BEOA 4KIFA 2PFBA 4RGSA 2Y30A 3HKZA 5F1JA 3S32A 4YIIA 3JRIA 3V7CA 3PFIA 3ZXSA 2YU9J 4L0ZB 1ETWA 2JA7J 4ESBA 1U6GA 5K5RA 3CJTB 2HKXA 4AD9A 3S17J 1U78A 2GLOA 2XDVA 5IOZA 1KYZA 1LE8B 4WK8F 3FK6A 5B1AH 3GCMA 3BZKA 1UG2A 2LF7A 4U0WA 1X1CA 4XM3A 4A3BJ 2XGCA 1PUFA 1K4TA 2EK5A 1T33A 2LKPA 4IX7A 1RKTA 4OWRB 2BOLA 1VQNI 5EZHA 2BW3B 3HHGA 1Y0NA 2STTA 1UG0A 1LDJA 2XC7A 3KYLA 2EIKH 5DDGA 3S1QJ 4CCLA 1MJ9A 4LB5A 3GUDA 5IP6A 1UFMA 2PEXA 1S72I 3O8HA 3NEUA 2Y31A 5CVIA 3CESA 3GVAA 2W00A 2EA2A 4ZH4F 4EVIA 2FF4A 1YYVA 3HOWJ 2F5CA 5DV5A 3G6EI 2W1OA 1YE9A 2ACJA 2X9DA 4IXAA 3H9JA 4S0HB 4ZTJA 3RYRA 1MNDA 2EA4A 1YOVB 2KZVA 2L0KA 1I3AA 4G6DA 4KN7X 2KMUA 2W48A 3GLXA 2VBYA 3GLLA 2K3PA 4GXOA 1ORKA 4L0YB 4II2A 4LG0B 3ZQQA 1X1PA 4OAYA 1P92A 1PUEE 5M5YJ 3WTYC 2B9SA 3H0GJ 4U7BA 3OYKA 2VIXA 3GEZA 3FBIB 3TDZC 4BQNA 5ICGA 3M8EA 5DD4A 4B44A 2EIJH 5FFZA 2MG4A 4ESFA 1TBXA 3OS1A 4BDYA 4KDPA 1MGTA 3EYIA 4JK1X 4AIHA 3HUGA 2QENA 5E1ZB 3JTGA 2G7HA 3S1NJ 5LLQA 3FBNB 1HW1A 3IAS2 1YIOA 2PQ8A 4XKVA 4BXUA 3SXYA 1BL0A 3K4MA 2WV1A 3FMSA 4XLHA 5EEAA 3HBLA 4PJJA 4IOCF 1JKOC 4PUSA 4WCGA 1Z6TA 1Y8QB 2OAZA 1R1UA 3TP3A 4QLCU 4HBLA 1UHMA 4XSZF 1G59A 4GDFA 3H5AA 4EV0A 2OTJI 2EINH 3OMYA 3M8JA 1VQ5I 3M7GA 4D1QA 3IP4B 3A01A 3I4MJ 4RMNA 3TQNA 4B09A 1U5TA 3PJRA 2DA1A 4IZZA 4QPOA 1HOMA 1I1SA 3BQZA 5EYRA 2WA0A 4HRIA 1R6RA 3WGGA 2ME0A 1IDYA 3T1BA 2DJNA 4NC8A 4L5IA 2DK5A 3ZQIA 2M9HA 1T6SA 3OL3A 4HYEA 2QSFX 4J01A 2ME6A 2HTSA 4BE0A 3J7AY 4MGRA 4HPQA 1YRNA 1DU0A 2DPDA 2H6CA 5FD6A 2RQQA 4HLXA 3IV5A 5GAHJ 1D5VA 2QBYB 3A02A 2OUMA 1JI8A 2CSOA 5IOYA 5F64A 3K4LA 2DN0A 3PUBA 1O3QA 1VQ6I 2XPUA 3CCUI 3CJQB 2R93J 2OTLI 1TNTA 3CCLI 2EWNA 5JLXA 2JVGA 1ETKA 4M74A 4C9YA 1Z7LA 1UAAA 2JA5J 1UMQA 1RESA 1TT0A 1SC7A 3QPSA 2KRHA 2DA4A 4XSXF 1MIJA 3DTIA 4HLYA 4JQFA 2NVXJ 4Y33A 2KT0A 3RPQA 2ECCA 1D5YA 5DTDA 4B48A 3JRBA 4MO7A 2COMA 2CQ7A 1YW9A 3KP2A 3CO6C 2ADUA 3K4CA 4MQVA 3LAPA 3IKTA 1ZG1A 2V4JC 2ETHA 1MBEA 1IJWC 1E3OC 2AHQA 3L00A 1TQMA 3B02A 3I59A 3F8BA 1MNEA 3KE2A 4XN3A 2M1BA 2P6TA 3OYFA 4WXHA 3CP8A 2UV1A 2VXZA 2XAGA 2M45A 3ABTA 2A3SA 2BY3A 3ECHA 4HNUA 3F23A 1YS7A 1Y8RB 4G8XA 1DGWY 5E79C 3IC7A 2CFOA 1KONA 3HOZJ 2HGCA 2A5WA 1T0FC 3ZMDA 4KNYA 4RB3C 2H1LA 4RGUA 4UHTA 5FRMA 3TKYA 5C4JJ 2HYGD 2VT3A 2W57A 1QO0D 5CKTA 2DOFA 3JRGA 1X1DA 3SQNA 4OINF 2XAQA 3MKLA 3OYLA 5GADJ 2LY9A 1TNSA 3OOUA 2ZO4A 4F92B 3L2UA 2A07F 2K40A 2ZMEA 2A6EF 1F1ZA 3K9TA 2HNHA 3O2PE 1VI0A 1I39A 3A0HC 4H0EA 4A3DJ 2GOMA 2M0MA 2M30A 4QWQA 1Z7UA 3FKJA 2BGCA 2EBIA 2L3DA 1LEAA 2K9LA 3KLOA 4EM0B 3K4NA 3I5UA 1E17A 2VQGA 4KFCA 2M3AA 4CA0A 4UVBA 4I0AA 1F36A 2LG4A 1BI0A 4D9JA 3WE3A 3ABMH 3KYDB 4ANJA 4R79A 1GHCA 1YLFA 3QU6A 2R7WA 4F93B 3J81Z 1MW7A 2Z16A 1EH6A 1H89C 5J40A 4P5OA 3K2AA 3M4OJ 1XMAA 4I01A 1SFOJ 2QGUA 5L3BA 3DBHB 1JKRC 4KUMA 2IBDA 2EZKA 3K0LA 3BTJA 3J7AO
chains in the Genus database with same CATH topology
5H6RA 5HDGA 2XV4S 3FMQA 4ENKA 4OMYA 1USSA 3DKWA 3ISPA 3HSRA 2EFPA 3K1MA 4L9TA 1ZG3A 3WGIA 4OIOF 1MJAA 3C1DA 3MCZA 1K78A 1B6AA 3ZN0A 1H0MA 1FSEA 1RZ4A 2KRFA 5F1RA 1GVJA 5L3DA 1P2FA 1KA8A 2EJRA 3BPXA 4ZZDA 3E6BA 4HF0A 2XROA 1ZARA 5HS7A 1FP2A 3GFJA 1S7OA 4U7DA 4HW0A 2NNYA 2M5WA 4IF4A 1IN8A 1W4MA 2VBXA 1QZZA 4RS8A 2DI3A 3ABUA 4HAMA 1O7FA 3QAHA 2FNAA 3BROA 1OYYA 1DP7P 3JAMZ 2OQGA 1DPUA 2P8TA 1I6XA 1IXRC 2HZTA 4NQWA 1K79A 4UVCA 1G3YA 3E3VA 2Z5UA 2EFOA 3RKYA 4G7HF 2FEZA 1MZBA 4UXNA 1IW7F 3FM3A 3JW4A 1B59A 4G7ZF 2XUBA 2HR3A 4D0PA 1V3FA 4MEXF 2JPCA 3L2CA 3TO9A 1J75A 1XGOA 3D5LA 4K2EA 4Q47A 3KETA 4A6EA 1FY7A 2D45A 1YG2A 5LEKA 4XBFA 2NYXA 4M71A 2NRAC 4KYWA 5L3FA 4Q5SF 1GXPA 4LLNA 4GYIA 5HLHA 3BJ6A 3Q9SA 3E6DA 3GFIA 1BIAA 2EB7A 4CDGA 3JAMK 1R58A 3F6VA 5DYMA 1Z05A 1D3YA 3V8JA 4RAYA 2DBBA 1PP7U 2ISYA 5ILVA 1LB2A 3FXQA 4LB6B 4RGRA 3GZ6A 4UV8A 1YFHA 1KU2A 3WTSC 2L54A 4ZYGA 5EEGA 3BWGA 2HKOA 1W7PA 1RIOH 1OMIA 3V8LA 3V8KA 3VEPA 2WV0A 3QRFF 3ZMUA 2Z9OA 2KJBA 1LJ9A 2KIFA 2L4MA 2MA3A 2DU9A 5ED4A 2L01A 1LVAA 4M9ZA 2H94A 4Q4ZF 5HLGA 4LK0F 2H09A 1BM9A 2NNNA 3EQLF 1FC3A 1ZHFA 2OD5A 4HQEA 1J0RA 1X3UA 2EFWA 4N9HA 6PAXA 4A0ZA 4PCQA 2QQ9A 3K1PA 3B73A 5CJ9A 3HOSA 4OOIA 1SMTA 1XSXA 5LGNA 3VB2A 3BJAA 4LD5A 1CF7B 1KYWA 4KMFA 1Q1HA 3GO5A 3FX3A 1JGSA 2WWYA 3R0AA 3N97A 3I71A 3E6MA 3CDHA 2MH9A 4NB5A 4EGZA 4MTDA 1OR7A 4G9YA 2YX7A 3WODF 2PBIA 4RGXA 2IPQX 3GW2A 1ODDA 3JSPA 1BI1A 3T8TA 1BBYA 2VC0A 3DV8A 1BC8C 3QOPA 1HXDA 4WF2A 4BHBA 1FYMA 2EFNA 4CICA 4UUVA 1TW3A 3LA2A 5HS8A 4ETSA 3KCCA 1ZRDA 3KP6A 1Z91A 2ZKZA 2PMHA 2FU4A 3LFKA 3RIRA 2W85A 5IT3A 4LG0A 4ON0A 4S04A 2FA5A 1YW7A 1JHHA 3PQKA 5E1WA 1EH7A 2IA0A 3ZQ7A 5AIQA 4WWCA 2LNBA 3GX4X 3ZMVA 4RB2C 2HTJA 5HDKA 3BJOA 1H9TA 1I1GA 3QP5A 1KQ8A 2CGPA 5FB2A 1FBQA 2FBHA 2OBPA 5FLXZ 2KIUA 5CYVA 1B1BA 3TOAA 4OMZA 1XCVA 4GYGA 1UCRA 1S8NA 4RB0A 1STZA 3WTVC 2PI0A 3HRUA 2UWMA 5A2QZ 4ENMA 5JFRA 2X0LA 2CG4A 2GXBA 1IAWA 3WE2A 3F8FA 1QZYA 2QBYA 4WXDA 4KMUX 2GXGA 3AAFA 4B8XA 4EGYA 2DPUA 2TDXA 1FP1D 3BOQA 2JPBA 2MH2A 1J5YA 1H9GA 4O3MA 3DXJF 5CVVA 5E18F 3WU1B 2A5YB 2B0LA 1J9IA 2KKOA 1HSTA 2MLKA 2FRHA 3K1NA 5FLXK 5AONA 2H6BA 1F5TA 4EM1A 4CYDA 4A6DA 1TQIA 5A2QK 1G4DA 1REPC 4A5MA 2IW5A 2IA1A 4IRIA 2Q8KA 2DT5A 4U88A 3TDUC 3MEXA 2IRFG 2HQRA 5E1XA 5D6EA 1RNLA 5HOOA 1R22A 4DQ2A 2BV6A 5LEJA 1MD0A 4IJAA 3REOA 3S2WA 1WRJA 2GA2A 1YS6A 1C0WA 5HVQC 3I53A 1ON2A 1HKQA 1ZAOA 3TOBA 1FT9A 3RI4A 1U8RA 2PN6A 3DPTA 4O5VA 1UHWA 1J7KA 1LDDA 4FX0A 2YSRA 2PG4A 3PQJA 1SD4A 3WTTC 2K02A 5H20A 3Q9VA 1SFXA 4L5JA 4ZYEA 1U2WA 2M8EA 1JE8A 4R1HA 3GWZA 2ZCWA 1FOKA 3R60A 2Q0OA 3OOPA 1T0FA 2QUFA 2HOEA 2DAOA 5F6FA 3QP6A 3WG9A 1LEBA 4IVNA 5BMZA 2LSOA 4IHSA 1MDMB 1HSJA 5D8LB 1HBXG 5KK1A 3ZMSA 3QPTA 4KT5C 4KA4A 1HW2A 2DO7A 4P9FA 1ZN2A 2QVOA 4HDUA 1YTYA 3CUOA 4WXCA 5BPDA 5DCMB 1FBUA 1ZLKA 2YX4A 5JHUA 4U0YA 2P4WA 1S29A 4BNCA 4EMSA 3G3ZA 1WKMA 3KEOA 4LFUA 2EV6A 2FE3A 2QLZA 3ECOA 3DFGA 1ULYA 1XDUA 4HA8A 2DTRA 2QQBA 4EJOA 4E70A 1HKSA 2HYFA 1W5SA 2HFHA 3CTAA 4UV9A 4OIRF 2VBZA 1R5GA 2ELHA 3WGHA 3IHUA 3RTRA 1AWCA 5LGUA 3MWMA 4YFNF 1BI3A 4FT8A 4L9VA 3I59B 4Q48A 4I2OA 4GO1A 1GXQA 2CO5A 3VFZA 2OQRA 1P4AA 3FF5A 1I5ZA 2P5KA 4IRGA 3F8CA 3K2ZA 1FYLA 1TTYA 3L7WA 5D5XB 1SD5A 1HQCA 4HDVA 2LDUA 2ZXJA 2E7WA 2ESHA 2JRTA 3HTUA 4HOBA 3F8MA 2RN7A 5ICEA 5L3GA 5JI6A 1OKRA 1HW5A 2P5LC 1BJAA 5HDNA 1XGMA 2DFIA 3MQ0A 2GZWA 4ZYDA 1O3SA 4I02A 3W6KB 3EUHA 3I0TA 4XRFA 2IJLA 2KJCA 2XGXA 1QBJA 1FNNA 5LHHA 1A04A 1DPRA 4EQQA 1R00A 5L3CA 4MQ9F 2CFXA 5FFXA 4HV5A 3ZMTA 1OYIA 1IF1A 2VOPA 3U9GA 2K27A 1O57A 1D8JA 2NS0A 2ZBKA 3E6CC 1XB4A 3SFZA 5K1YA 2A69F 3JTHA 2V1UA 2UXXA 4AIJA 1FWZA 5DD8A 2IT0A 1FPQA 1OYWA 2ZNYA 2A68F 5JVTA 2K4JA 1R36A 5CLSA 2VE9A 1P4XA 3MZYA 3NRVA 3HSFA 3LQRA 2QM3A 4P96A 4DNCA 4I98B 1IRFA 4I7HA 4IRHA 4L9JA 3TO6A 2D1VA 1XDSA 2P6SA 4BYYA 4PDKA 3F3XA 2R3SA 3BZ6A 2VC1A 2ZNZA 4MHGA 4TV7A 4LLLA 3WTUC 1LDKB 1B4AA 2KIMA 2XAHA 3CUQA 3L9FA 1G3WA 5DUIA 3MZHA 3SZTA 3IL2A 3HIFA 2IVMA 2DLLA 3GYHX 1V4RA 1G3TA 3NQOA 2R7DA 1ZRCA 3N4MA 2E1CA 3QU3A 4G7OF 3ELKA 5AIPA 1T39A 3VOEA 5BOXA 1RUNA 2E7XA 4P55A 1FBSA 1JXSA 1L3LA 4Y17A 3SHFA 1O7LA 1KU3A 4YG2F 1O3RA 1Y0UA 3DQVC 1IN4A 1T98A 3WTXC 2JT1A 1S3JA 2STWA 2E1NA 2Z3YA 1XMKA 2O3FA 5L3EA 1F4KA 4LK1F 2CYYA 3F8NA 3M9AA 4YFKF 3O6BB 2R7FA 3KP3A 2D1HA 1JHFA 3M1EA 4EJTA 4HZFA 5BQTA 5LHIA 2DK8A 1VTNC 5J6XA 3P9KA 1CGPA 1TLHB 3D0SA 1USTA 2L02A 1MKMA 4Y13A 1KQ9A 4MEYF 4WX9A 1SMYF 3RKWA 3P9IA 5D4SA 3KEQA 2F5FA 1BOAA 2W24A 4A12A 2O61A 2W25A 2HWVA 1PP8F 4L9NA 2V6CA 2M87A 5LRSA 3T8RA 4JBAA 1I27A 5E8IA 5E20A 2MLGA 4KICA 3HTSB 4PGGA 1IN7A 3KFWX 1R1VA 2DQLA 2HS5A 1ZRFA 3KLNA 2A6HF 2C6YA 3HRSA 3QPHA 5DUKA 5DCFA 4ENNA 2V1DA 4ENJA 3DEUA 1P6RA 1ZGJA 4NHJA 4L18B 4YIFA 4IHTA 2D2WA 1IXCA 3K69A 4OU0A 4U0VA 2MBFA 4R8HA 3RPUA 2ZJ2A 1IN5A 2IA2A 1BIBA 2VODA 3WTWC 3HHHA 1G6NA 4AVPA 2VBWA 2F2EA 1T2KA 2YU3A 1XGNA 2OZ6A 4CO8A 3F21A 4RB1A 3ROUA 5FGMA 2VN2A 1ZG5A 4A5NA 1WQ2A 2BYVE 4ZYHA 1XN7A 2Z33A 4XLPF 4KIBA 5TJJA 3E97A 1BI2A 2H27A 2RV8A 3COAC 2XRNA 1RUOA 3CJNA 3G73A 2EV5A 2RGVA 1LNWA 5ILUA 1T38A 3EETA 1FLIA 4FHTA 2ZFWA 3U1DA 2OU2A 1W7PD 3EYYA 2WTEA 3CLOA 3JSOA 3MAJA 4MNUA 1WI9A 5CVRA 1UB9A 2RQPA 1MDMA 1QGPA 3C18A 3R61A 2X4HA 5H6QA 4FX4A 3GF2A 3V7SA 3HYIA 4UNOA 2CW0F 1AOYA 2AS5F 1U5TC 3W6JB 3IRQA 1R5HA 3VODA 2FOKA 2VT2A 4I0BA 4O6JA 5DCMA 2UZKA 3Q5FA 1LQ1A 2VONA 4N0BA 2IP2A 5LGTA 2JSCA 1XSVA 1IN6A 4HQMA 2FBKA 5E8GA 2K4BA 5LBQA 3M8FA 3BDDA 4S05A 5JR3A 2FSWA 1QQIA 1YO5C 3LA7A 2V79A 4BAYA 3C3WA 4N9IA 3FZVA 2Y75A 2F5DA 3KP4A 3LQQA 3DF8A 1B9NA 4PGHA 4LMYA 1ZLJA 3WU0A 1FZPB 1IZ1A 1U5TB 2L4AA 4MTEA 1ON1A 3GFMA 3HSEA 2P7VB 4HV6A 2RVCA 3DP7A 2BE5F 2RC4A 2Y0MA 2JZYA 1K6OA 5J8FA 5HLIA 4EJWA 4CHUA 1Z9CA 2W84A 2QYOA 5KVRA 1SD6A 2O6GE 1XCBA 1QPMA 3ZP5A 1XD7A 2EFQA 4LLGF 5ILSA 5D6FA 4IPAA 1MJBA 2XIGA 3TGNA 1KGSA 4BHPA 3V4GA 3E5XA 3KP7A 2P7CB 5IT9Z 3BPVA 1XGSA 4HX8A 2XAFA 2FXAA 4BH9A 4KIGA 2RDPA 3RJPA 2A61A 4CGZA 1KU9A 1FX7A 3L09A 1FYKA 2Z99A 1B9MA 4ZZLA 3R4KA 5D4RA 2F5EA 4M73A 3KP5A 3ZN1A 5CVUA 4EJVA 2O8XA 2GQQA 5HS9A 5BPIA 2DW4A 5FO5A 5BS6A 1D8KA 2RNJA 3IWFA 2ZMEB 3F6OA 1J59A 2VOOA 3FXRA 4LGWA 2J5OA 2YPRA 2QQAA 4LJZF 1TQPA 1R7JA 3IWZA 3J81K 3R6SA 1IXSB 4AIKA 5IT9K 1U3EM 2G7UA 2LF8A 4HF1A 3ZMZA 1DUXC 3FWEA 3F72A 3P9CA 1R1TA 2MC3A 3WTZA 3J80Z 3I54A 1NHAA 3MFKA 2HEOA 3H3UA 5EEHA 4XLNF 2ESNA 3H3ZA 4AWXB 3ERED 2HQNA 4I09A 2JTVA 3C7JA 4OIQF 1Z6RA 1P4WA 3FXUA 1SAXA 1YQAA 1PDNC 1K78B 5TRDA 4EM2A 2CQKA 4HX4A 5ICFA 2XASA 5LRRA 3IRRA 3BP8A 4A0XA 4A2UA 4GCVA 3I64A 5J8CA 3RDIA 3CO7C 5D8KB 3BY6A 3KZZA 1ONVA 5D5WB 4BQAA 2PMUA 2V9VA 4BHCA 1CF7A 1DDNA 2PJPA 3J80K 2FNPA 2AXLA 3HRTA 4Z2YA 4M9SA 3EDPA 2J5PA 1ZH5A 4CXFA 2EV0A 1WWXA 1O3TA 1FSHA 2HDCA 2GAUA 2DQRA 2FQ3A 1SFUA 1KU7A 1ZYRF 3RYPA 2UXNA 1OPCA 3T0YA 4ASNA 5CVJA 2K7LA 5DEQA 2XKPA 3FHZA 4PZJA 1E2XA 2XVCA 4A0YA 3RKXA 2ISZA 3I58A 4HX7A 4P9UA 3ML6A 4OIPF 3R0JA 1BN5A 3CUQC 4CZZA 4M6XA 3TO7A 1QNTA 1J2XA 2YR2A 4F7ZA 1WSUA 2XKOA 3T5XA 2WC2A 3E5UA 1EV7A 3LAJA 3FM5A 1IRGA 1BC7C 2OA4A 3GFLA 4HF2A 1R23A 5LHGA 1RI7A 5K5OA 1L0OC 3GXOA 3E5QA 3FMRA 3I4PA 2NAZA 1ZREA 3ZPLA 4M72A 3LSTA 1G3SA 2K86A 2GIVA 1S7AA 1W7PB 3DPLC 3SZPA 2P5VA 4G6QA 3LWFA 2OZUA 1ZGAA 2FBIA 4G94A 5D5VB 3HOTA 2XHKA 2QWWA 1EH8A 3GZ5A 5K5QA 2GWRA 4Y15A 3CUQB 3KZYA 1KQ0A 1W5TA 2V1XA 1TW2A 3OV8A 4GGGA 4ESJA 5E17F 3ULQB 1XSDA 1HKTA 4YFXF 1F9NA 4M9XA 3HRMA 2Y48A 3O3KA 3H92A 2QZ8A 3LA3A 2GA1A 2Q2EA 2CWEA 1K7AA 4RAZA 2G9WA 1S6LA 2BBYA 2O03A 1YW8A 5D5UB 4EJUA 2FMLA 2FMYA 2MD5A 3U2RA 5FD5A 2VE8A 3IKVA 2O0YA 1SFEA 4KN4X 5ERIA 3P7NA 3V7RA 1IUYA 2PLYA 4UVAA 1SD7A 2XAJA 4M6YA 2RKHA 5ICCA 3F22A 2BEOA 4KIFA 2PFBA 4RGSA 4YIIA 3V7CA 3PFIA 4L0ZB 4ESBA 1U6GA 5K5RA 2HKXA 4AD9A 1U78A 1KYZA 4WK8F 2LF7A 4U0WA 2EK5A 2LKPA 3HHGA 2STTA 1LDJA 5DDGA 1MJ9A 4LB5A 3GUDA 1UFMA 2PEXA 3NEUA 5CVIA 3GVAA 2EA2A 4ZH4F 4EVIA 2FF4A 1YYVA 2F5CA 5DV5A 2ACJA 4IXAA 3RYRA 2EA4A 4G6DA 4KN7X 3GLXA 2VBYA 4GXOA 4L0YB 4LG0B 1P92A 1PUEE 3WTYC 4U7BA 3GEZA 3TDZC 5ICGA 3M8EA 5DD4A 5FFZA 4ESFA 4KDPA 1TBXA 1MGTA 3EYIA 4JK1X 4AIHA 3HUGA 2QENA 5E1ZB 3JTGA 2G7HA 5LLQA 1HW1A 1YIOA 2PQ8A 4BXUA 3SXYA 3FMSA 4WCGA 1Z6TA 4QLCU 2OAZA 1R1UA 4HBLA 1UHMA 4XSZF 4EV0A 3M7GA 3TQNA 4B09A 1U5TA 1I1SA 3WGGA 3T1BA 4L5IA 2DK5A 1T6SA 4HYEA 2HTSA 4MGRA 2DPDA 2H6CA 5FD6A 4HLXA 1D5VA 2QBYB 2CSOA 5F64A 1O3QA 1TNTA 2EWNA 4M74A 4XSXF 4HLYA 4JQFA 3RPQA 2COMA 1YW9A 3KP2A 3CO6C 2ADUA 4MQVA 3LAPA 3IKTA 1ZG1A 2ETHA 3L00A 1TQMA 3B02A 3I59A 3F8BA 3KE2A 2M1BA 2P6TA 4WXHA 2VXZA 2M45A 2XAGA 3ABTA 2A3SA 3ECHA 3F23A 1YS7A 4G8XA 3IC7A 2HGCA 3ZMDA 4KNYA 4RB3C 4RGUA 4UHTA 3TKYA 2HYGD 2VT3A 2W57A 1QO0D 3SQNA 4OINF 2XAQA 1TNSA 2ZO4A 2A07F 2ZMEA 2A6EF 1F1ZA 3K9TA 3O2PE 4H0EA 2M30A 4QWQA 1Z7UA 2BGCA 2L3DA 1LEAA 3KLOA 4EM0B 1E17A 3I5UA 4KFCA 4UVBA 4I0AA 1BI0A 3WE3A 4R79A 1GHCA 1YLFA 3QU6A 3J81Z 1EH6A 4P5OA 1XMAA 4I01A 5L3BA 4KUMA 3K0LA 1Z1DA 3J7AO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H6R A;  5HDG A;  2XV4 S;  3FMQ A;  4ENK A;  4OMY A;  1USS A;  3DKW A;  3ISP A;  3HSR A;  2EFP A;  3K1M A;  4L9T A;  1ZG3 A;  3WGI A;  4OIO F;  1MJA A;  3C1D A;  3MCZ A;  1K78 A;  1B6A A;  3ZN0 A;  1H0M A;  1FSE A;  1RZ4 A;  2KRF A;  5F1R A;  1GVJ A;  5L3D A;  1P2F A;  1KA8 A;  2EJR A;  3BPX A;  4ZZD A;  3E6B A;  4HF0 A;  2XRO A;  1ZAR A;  5HS7 A;  1FP2 A;  3GFJ A;  1S7O A;  4U7D A;  4HW0 A;  2NNY A;  2M5W A;  4IF4 A;  1IN8 A;  1W4M A;  2VBX A;  1QZZ A;  4RS8 A;  2DI3 A;  3ABU A;  4HAM A;  1O7F A;  3QAH A;  2FNA A;  3BRO A;  1OYY A;  1DP7 P;  3JAM Z;  2OQG A;  1DPU A;  2P8T A;  1I6X A;  1IXR C;  2HZT A;  4NQW A;  1K79 A;  4UVC A;  1G3Y A;  3E3V A;  2Z5U A;  2EFO A;  3RKY A;  4G7H F;  2FEZ A;  1MZB A;  4UXN A;  1IW7 F;  3FM3 A;  3JW4 A;  1B59 A;  4G7Z F;  2XUB A;  2HR3 A;  4D0P A;  1V3F A;  4MEX F;  2JPC A;  3L2C A;  3TO9 A;  1J75 A;  1XGO A;  3D5L A;  4K2E A;  4Q47 A;  3KET A;  4A6E A;  1FY7 A;  2D45 A;  1YG2 A;  5LEK A;  4XBF A;  2NYX A;  4M71 A;  2NRA C;  4KYW A;  5L3F A;  4Q5S F;  1GXP A;  4LLN A;  4GYI A;  5HLH A;  3BJ6 A;  3Q9S A;  3E6D A;  3GFI A;  1BIA A;  2EB7 A;  4CDG A;  3JAM K;  1R58 A;  3F6V A;  5DYM A;  1Z05 A;  1D3Y A;  3V8J A;  4RAY A;  2DBB A;  1PP7 U;  2ISY A;  5ILV A;  1LB2 A;  3FXQ A;  4LB6 B;  4RGR A;  3GZ6 A;  4UV8 A;  1YFH A;  1KU2 A;  3WTS C;  2L54 A;  4ZYG A;  5EEG A;  3BWG A;  2HKO A;  1W7P A;  1RIO H;  1OMI A;  3V8L A;  3V8K A;  3VEP A;  2WV0 A;  3QRF F;  3ZMU A;  2Z9O A;  2KJB A;  1LJ9 A;  2KIF A;  2L4M A;  2MA3 A;  2DU9 A;  5ED4 A;  2L01 A;  1LVA A;  4M9Z A;  2H94 A;  4Q4Z F;  5HLG A;  4LK0 F;  2H09 A;  1BM9 A;  2NNN A;  3EQL F;  1FC3 A;  1ZHF A;  2OD5 A;  4HQE A;  1J0R A;  1X3U A;  2EFW A;  4N9H A;  6PAX A;  4A0Z A;  4PCQ A;  2QQ9 A;  3K1P A;  3B73 A;  5CJ9 A;  3HOS A;  4OOI A;  1SMT A;  1XSX A;  5LGN A;  3VB2 A;  3BJA A;  4LD5 A;  1CF7 B;  1KYW A;  4KMF A;  1Q1H A;  3GO5 A;  3FX3 A;  1JGS A;  2WWY A;  3R0A A;  3N97 A;  3I71 A;  3E6M A;  3CDH A;  2MH9 A;  4NB5 A;  4EGZ A;  4MTD A;  1OR7 A;  4G9Y A;  2YX7 A;  3WOD F;  2PBI A;  4RGX A;  2IPQ X;  3GW2 A;  1ODD A;  3JSP A;  1BI1 A;  3T8T A;  1BBY A;  2VC0 A;  3DV8 A;  1BC8 C;  3QOP A;  1HXD A;  4WF2 A;  4BHB A;  1FYM A;  2EFN A;  4CIC A;  4UUV A;  1TW3 A;  3LA2 A;  5HS8 A;  4ETS A;  3KCC A;  1ZRD A;  3KP6 A;  1Z91 A;  2ZKZ A;  2PMH A;  2FU4 A;  3LFK A;  3RIR A;  2W85 A;  5IT3 A;  4LG0 A;  4ON0 A;  4S04 A;  2FA5 A;  1YW7 A;  1JHH A;  3PQK A;  5E1W A;  1EH7 A;  2IA0 A;  3ZQ7 A;  5AIQ A;  4WWC A;  2LNB A;  3GX4 X;  3ZMV A;  4RB2 C;  2HTJ A;  5HDK A;  3BJO A;  1H9T A;  1I1G A;  3QP5 A;  1KQ8 A;  2CGP A;  5FB2 A;  1FBQ A;  2FBH A;  2OBP A;  5FLX Z;  2KIU A;  5CYV A;  1B1B A;  3TOA A;  4OMZ A;  1XCV A;  4GYG A;  1UCR A;  1S8N A;  4RB0 A;  1STZ A;  3WTV C;  2PI0 A;  3HRU A;  2UWM A;  5A2Q Z;  4ENM A;  5JFR A;  2X0L A;  2CG4 A;  2GXB A;  1IAW A;  3WE2 A;  3F8F A;  1QZY A;  2QBY A;  4WXD A;  4KMU X;  2GXG A;  3AAF A;  4B8X A;  4EGY A;  2DPU A;  2TDX A;  1FP1 D;  3BOQ A;  2JPB A;  2MH2 A;  1J5Y A;  1H9G A;  4O3M A;  3DXJ F;  5CVV A;  5E18 F;  3WU1 B;  2A5Y B;  2B0L A;  1J9I A;  2KKO A;  1HST A;  2MLK A;  2FRH A;  3K1N A;  5FLX K;  5AON A;  2H6B A;  1F5T A;  4EM1 A;  4CYD A;  4A6D A;  1TQI A;  5A2Q K;  1G4D A;  1REP C;  4A5M A;  2IW5 A;  2IA1 A;  4IRI A;  2Q8K A;  2DT5 A;  4U88 A;  3TDU C;  3MEX A;  2IRF G;  2HQR A;  5E1X A;  5D6E A;  1RNL A;  5HOO A;  1R22 A;  4DQ2 A;  2BV6 A;  5LEJ A;  1MD0 A;  4IJA A;  3REO A;  3S2W A;  1WRJ A;  2GA2 A;  1YS6 A;  1C0W A;  5HVQ C;  3I53 A;  1ON2 A;  1HKQ A;  1ZAO A;  3TOB A;  1FT9 A;  3RI4 A;  1U8R A;  2PN6 A;  3DPT A;  4O5V A;  1UHW A;  1J7K A;  1LDD A;  4FX0 A;  2YSR A;  2PG4 A;  3PQJ A;  1SD4 A;  3WTT C;  2K02 A;  5H20 A;  3Q9V A;  1SFX A;  4L5J A;  4ZYE A;  1U2W A;  2M8E A;  1JE8 A;  4R1H A;  3GWZ A;  2ZCW A;  1FOK A;  3R60 A;  2Q0O A;  3OOP A;  1T0F A;  2QUF A;  2HOE A;  2DAO A;  5F6F A;  3QP6 A;  3WG9 A;  1LEB A;  4IVN A;  5BMZ A;  2LSO A;  4IHS A;  1MDM B;  1HSJ A;  5D8L B;  1HBX G;  5KK1 A;  3ZMS A;  3QPT A;  4KT5 C;  4KA4 A;  1HW2 A;  2DO7 A;  4P9F A;  1ZN2 A;  2QVO A;  4HDU A;  1YTY A;  3CUO A;  4WXC A;  5BPD A;  5DCM B;  1FBU A;  1ZLK A;  2YX4 A;  5JHU A;  4U0Y A;  2P4W A;  1S29 A;  4BNC A;  4EMS A;  3G3Z A;  1WKM A;  3KEO A;  4LFU A;  2EV6 A;  2FE3 A;  2QLZ A;  3ECO A;  3DFG A;  1ULY A;  1XDU A;  4HA8 A;  2DTR A;  2QQB A;  4EJO A;  4E70 A;  1HKS A;  2HYF A;  1W5S A;  2HFH A;  3CTA A;  4UV9 A;  4OIR F;  2VBZ A;  1R5G A;  2ELH A;  3WGH A;  3IHU A;  3RTR A;  1AWC A;  5LGU A;  3MWM A;  4YFN F;  1BI3 A;  4FT8 A;  4L9V A;  3I59 B;  4Q48 A;  4I2O A;  4GO1 A;  1GXQ A;  2CO5 A;  3VFZ A;  2OQR A;  1P4A A;  3FF5 A;  1I5Z A;  2P5K A;  4IRG A;  3F8C A;  3K2Z A;  1FYL A;  1TTY A;  3L7W A;  5D5X B;  1SD5 A;  1HQC A;  4HDV A;  2LDU A;  2ZXJ A;  2E7W A;  2ESH A;  2JRT A;  3HTU A;  4HOB A;  3F8M A;  2RN7 A;  5ICE A;  5L3G A;  5JI6 A;  1OKR A;  1HW5 A;  2P5L C;  1BJA A;  5HDN A;  1XGM A;  2DFI A;  3MQ0 A;  2GZW A;  4ZYD A;  1O3S A;  4I02 A;  3W6K B;  3EUH A;  3I0T A;  4XRF A;  2IJL A;  2KJC A;  2XGX A;  1QBJ A;  1FNN A;  5LHH A;  1A04 A;  1DPR A;  4EQQ A;  1R00 A;  5L3C A;  4MQ9 F;  2CFX A;  5FFX A;  4HV5 A;  3ZMT A;  1OYI A;  1IF1 A;  2VOP A;  3U9G A;  2K27 A;  1O57 A;  1D8J A;  2NS0 A;  2ZBK A;  3E6C C;  1XB4 A;  3SFZ A;  5K1Y A;  2A69 F;  3JTH A;  2V1U A;  2UXX A;  4AIJ A;  1FWZ A;  5DD8 A;  2IT0 A;  1FPQ A;  1OYW A;  2ZNY A;  2A68 F;  5JVT A;  2K4J A;  1R36 A;  5CLS A;  2VE9 A;  1P4X A;  3MZY A;  3NRV A;  3HSF A;  3LQR A;  2QM3 A;  4P96 A;  4DNC A;  4I98 B;  1IRF A;  4I7H A;  4IRH A;  4L9J A;  3TO6 A;  2D1V A;  1XDS A;  2P6S A;  4BYY A;  4PDK A;  3F3X A;  2R3S A;  3BZ6 A;  2VC1 A;  2ZNZ A;  4MHG A;  4TV7 A;  4LLL A;  3WTU C;  1LDK B;  1B4A A;  2KIM A;  2XAH A;  3CUQ A;  3L9F A;  1G3W A;  5DUI A;  3MZH A;  3SZT A;  3IL2 A;  3HIF A;  2IVM A;  2DLL A;  3GYH X;  1V4R A;  1G3T A;  3NQO A;  2R7D A;  1ZRC A;  3N4M A;  2E1C A;  3QU3 A;  4G7O F;  3ELK A;  5AIP A;  1T39 A;  3VOE A;  5BOX A;  1RUN A;  2E7X A;  4P55 A;  1FBS A;  1JXS A;  1L3L A;  4Y17 A;  3SHF A;  1O7L A;  1KU3 A;  4YG2 F;  1O3R A;  1Y0U A;  3DQV C;  1IN4 A;  1T98 A;  3WTX C;  2JT1 A;  1S3J A;  2STW A;  2E1N A;  2Z3Y A;  1XMK A;  2O3F A;  5L3E A;  1F4K A;  4LK1 F;  2CYY A;  3F8N A;  3M9A A;  4YFK F;  3O6B B;  2R7F A;  3KP3 A;  2D1H A;  1JHF A;  3M1E A;  4EJT A;  4HZF A;  5BQT A;  5LHI A;  2DK8 A;  1VTN C;  5J6X A;  3P9K A;  1CGP A;  1TLH B;  3D0S A;  1UST A;  2L02 A;  1MKM A;  4Y13 A;  1KQ9 A;  4MEY F;  4WX9 A;  1SMY F;  3RKW A;  3P9I A;  5D4S A;  3KEQ A;  2F5F A;  1BOA A;  2W24 A;  4A12 A;  2O61 A;  2W25 A;  2HWV A;  1PP8 F;  4L9N A;  2V6C A;  2M87 A;  5LRS A;  3T8R A;  4JBA A;  1I27 A;  5E8I A;  5E20 A;  2MLG A;  4KIC A;  3HTS B;  4PGG A;  1IN7 A;  3KFW X;  1R1V A;  2DQL A;  2HS5 A;  1ZRF A;  3KLN A;  2A6H F;  2C6Y A;  3HRS A;  3QPH A;  5DUK A;  5DCF A;  4ENN A;  2V1D A;  4ENJ A;  3DEU A;  1P6R A;  1ZGJ A;  4NHJ A;  4L18 B;  4YIF A;  4IHT A;  2D2W A;  1IXC A;  3K69 A;  4OU0 A;  4U0V A;  2MBF A;  4R8H A;  3RPU A;  2ZJ2 A;  1IN5 A;  2IA2 A;  1BIB A;  2VOD A;  3WTW C;  3HHH A;  1G6N A;  4AVP A;  2VBW A;  2F2E A;  1T2K A;  2YU3 A;  1XGN A;  2OZ6 A;  4CO8 A;  3F21 A;  4RB1 A;  3ROU A;  5FGM A;  2VN2 A;  1ZG5 A;  4A5N A;  1WQ2 A;  2BYV E;  4ZYH A;  1XN7 A;  2Z33 A;  4XLP F;  4KIB A;  5TJJ A;  3E97 A;  1BI2 A;  2H27 A;  2RV8 A;  3COA C;  2XRN A;  1RUO A;  3CJN A;  3G73 A;  2EV5 A;  2RGV A;  1LNW A;  5ILU A;  1T38 A;  3EET A;  1FLI A;  4FHT A;  2ZFW A;  3U1D A;  2OU2 A;  1W7P D;  3EYY A;  2WTE A;  3CLO A;  3JSO A;  3MAJ A;  4MNU A;  1WI9 A;  5CVR A;  1UB9 A;  2RQP A;  1MDM A;  1QGP A;  3C18 A;  3R61 A;  2X4H A;  5H6Q A;  4FX4 A;  3GF2 A;  3V7S A;  3HYI A;  4UNO A;  2CW0 F;  1AOY A;  2AS5 F;  1U5T C;  3W6J B;  3IRQ A;  1R5H A;  3VOD A;  2FOK A;  2VT2 A;  4I0B A;  4O6J A;  5DCM A;  2UZK A;  3Q5F A;  1LQ1 A;  2VON A;  4N0B A;  2IP2 A;  5LGT A;  2JSC A;  1XSV A;  1IN6 A;  4HQM A;  2FBK A;  5E8G A;  2K4B A;  5LBQ A;  3M8F A;  3BDD A;  4S05 A;  5JR3 A;  2FSW A;  1QQI A;  1YO5 C;  3LA7 A;  2V79 A;  4BAY A;  3C3W A;  4N9I A;  3FZV A;  2Y75 A;  2F5D A;  3KP4 A;  3LQQ A;  3DF8 A;  1B9N A;  4PGH A;  4LMY A;  1ZLJ A;  3WU0 A;  1FZP B;  1IZ1 A;  1U5T B;  2L4A A;  4MTE A;  1ON1 A;  3GFM A;  3HSE A;  2P7V B;  4HV6 A;  2RVC A;  3DP7 A;  2BE5 F;  2RC4 A;  2Y0M A;  2JZY A;  1K6O A;  5J8F A;  5HLI A;  4EJW A;  4CHU A;  1Z9C A;  2W84 A;  2QYO A;  5KVR A;  1SD6 A;  2O6G E;  1XCB A;  1QPM A;  3ZP5 A;  1XD7 A;  2EFQ A;  4LLG F;  5ILS A;  5D6F A;  4IPA A;  1MJB A;  2XIG A;  3TGN A;  1KGS A;  4BHP A;  3V4G A;  3E5X A;  3KP7 A;  2P7C B;  5IT9 Z;  3BPV A;  1XGS A;  4HX8 A;  2XAF A;  2FXA A;  4BH9 A;  4KIG A;  2RDP A;  3RJP A;  2A61 A;  4CGZ A;  1KU9 A;  1FX7 A;  3L09 A;  1FYK A;  2Z99 A;  1B9M A;  4ZZL A;  3R4K A;  5D4R A;  2F5E A;  4M73 A;  3KP5 A;  3ZN1 A;  5CVU A;  4EJV A;  2O8X A;  2GQQ A;  5HS9 A;  5BPI A;  2DW4 A;  5FO5 A;  5BS6 A;  1D8K A;  2RNJ A;  3IWF A;  2ZME B;  3F6O A;  1J59 A;  2VOO A;  3FXR A;  4LGW A;  2J5O A;  2YPR A;  2QQA A;  4LJZ F;  1TQP A;  1R7J A;  3IWZ A;  3J81 K;  3R6S A;  1IXS B;  4AIK A;  5IT9 K;  1U3E M;  2G7U A;  2LF8 A;  4HF1 A;  3ZMZ A;  1DUX C;  3FWE A;  3F72 A;  3P9C A;  1R1T A;  2MC3 A;  3WTZ A;  3J80 Z;  3I54 A;  1NHA A;  3MFK A;  2HEO A;  3H3U A;  5EEH A;  4XLN F;  2ESN A;  3H3Z A;  4AWX B;  3ERE D;  2HQN A;  4I09 A;  2JTV A;  3C7J A;  4OIQ F;  1Z6R A;  1P4W A;  3FXU A;  1SAX A;  1YQA A;  1PDN C;  1K78 B;  5TRD A;  4EM2 A;  2CQK A;  4HX4 A;  5ICF A;  2XAS A;  5LRR A;  3IRR A;  3BP8 A;  4A0X A;  4A2U A;  4GCV A;  3I64 A;  5J8C A;  3RDI A;  3CO7 C;  5D8K B;  3BY6 A;  3KZZ A;  1ONV A;  5D5W B;  4BQA A;  2PMU A;  2V9V A;  4BHC A;  1CF7 A;  1DDN A;  2PJP A;  3J80 K;  2FNP A;  2AXL A;  3HRT A;  4Z2Y A;  4M9S A;  3EDP A;  2J5P A;  1ZH5 A;  4CXF A;  2EV0 A;  1WWX A;  1O3T A;  1FSH A;  2HDC A;  2GAU A;  2DQR A;  2FQ3 A;  1SFU A;  1KU7 A;  1ZYR F;  3RYP A;  2UXN A;  1OPC A;  3T0Y A;  4ASN A;  5CVJ A;  2K7L A;  5DEQ A;  2XKP A;  3FHZ A;  4PZJ A;  1E2X A;  2XVC A;  4A0Y A;  3RKX A;  2ISZ A;  3I58 A;  4HX7 A;  4P9U A;  3ML6 A;  4OIP F;  3R0J A;  1BN5 A;  3CUQ C;  4CZZ A;  4M6X A;  3TO7 A;  1QNT A;  1J2X A;  2YR2 A;  4F7Z A;  1WSU A;  2XKO A;  3T5X A;  2WC2 A;  3E5U A;  1EV7 A;  3LAJ A;  3FM5 A;  1IRG A;  1BC7 C;  2OA4 A;  3GFL A;  4HF2 A;  1R23 A;  5LHG A;  1RI7 A;  5K5O A;  1L0O C;  3GXO A;  3E5Q A;  3FMR A;  3I4P A;  2NAZ A;  1ZRE A;  3ZPL A;  4M72 A;  3LST A;  1G3S A;  2K86 A;  2GIV A;  1S7A A;  1W7P B;  3DPL C;  3SZP A;  2P5V A;  4G6Q A;  3LWF A;  2OZU A;  1ZGA A;  2FBI A;  4G94 A;  5D5V B;  3HOT A;  2XHK A;  2QWW A;  1EH8 A;  3GZ5 A;  5K5Q A;  2GWR A;  4Y15 A;  3CUQ B;  3KZY A;  1KQ0 A;  1W5T A;  2V1X A;  1TW2 A;  3OV8 A;  4GGG A;  4ESJ A;  5E17 F;  3ULQ B;  1XSD A;  1HKT A;  4YFX F;  1F9N A;  4M9X A;  3HRM A;  2Y48 A;  3O3K A;  3H92 A;  2QZ8 A;  3LA3 A;  2GA1 A;  2Q2E A;  2CWE A;  1K7A A;  4RAZ A;  2G9W A;  1S6L A;  2BBY A;  2O03 A;  1YW8 A;  5D5U B;  4EJU A;  2FML A;  2FMY A;  2MD5 A;  3U2R A;  5FD5 A;  2VE8 A;  3IKV A;  2O0Y A;  1SFE A;  4KN4 X;  5ERI A;  3P7N A;  3V7R A;  1IUY A;  2PLY A;  4UVA A;  1SD7 A;  2XAJ A;  4M6Y A;  2RKH A;  5ICC A;  3F22 A;  2BEO A;  4KIF A;  2PFB A;  4RGS A;  4YII A;  3V7C A;  3PFI A;  4L0Z B;  4ESB A;  1U6G A;  5K5R A;  2HKX A;  4AD9 A;  1U78 A;  1KYZ A;  4WK8 F;  2LF7 A;  4U0W A;  2EK5 A;  2LKP A;  3HHG A;  2STT A;  1LDJ A;  5DDG A;  1MJ9 A;  4LB5 A;  3GUD A;  1UFM A;  2PEX A;  3NEU A;  5CVI A;  3GVA A;  2EA2 A;  4ZH4 F;  4EVI A;  2FF4 A;  1YYV A;  2F5C A;  5DV5 A;  2ACJ A;  4IXA A;  3RYR A;  2EA4 A;  4G6D A;  4KN7 X;  3GLX A;  2VBY A;  4GXO A;  4L0Y B;  4LG0 B;  1P92 A;  1PUE E;  3WTY C;  4U7B A;  3GEZ A;  3TDZ C;  5ICG A;  3M8E A;  5DD4 A;  5FFZ A;  4ESF A;  4KDP A;  1TBX A;  1MGT A;  3EYI A;  4JK1 X;  4AIH A;  3HUG A;  2QEN A;  5E1Z B;  3JTG A;  2G7H A;  5LLQ A;  1HW1 A;  1YIO A;  2PQ8 A;  4BXU A;  3SXY A;  3FMS A;  4WCG A;  1Z6T A;  4QLC U;  2OAZ A;  1R1U A;  4HBL A;  1UHM A;  4XSZ F;  4EV0 A;  3M7G A;  3TQN A;  4B09 A;  1U5T A;  1I1S A;  3WGG A;  3T1B A;  4L5I A;  2DK5 A;  1T6S A;  4HYE A;  2HTS A;  4MGR A;  2DPD A;  2H6C A;  5FD6 A;  4HLX A;  1D5V A;  2QBY B;  2CSO A;  5F64 A;  1O3Q A;  1TNT A;  2EWN A;  4M74 A;  4XSX F;  4HLY A;  4JQF A;  3RPQ A;  2COM A;  1YW9 A;  3KP2 A;  3CO6 C;  2ADU A;  4MQV A;  3LAP A;  3IKT A;  1ZG1 A;  2ETH A;  3L00 A;  1TQM A;  3B02 A;  3I59 A;  3F8B A;  3KE2 A;  2M1B A;  2P6T A;  4WXH A;  2VXZ A;  2M45 A;  2XAG A;  3ABT A;  2A3S A;  3ECH A;  3F23 A;  1YS7 A;  4G8X A;  3IC7 A;  2HGC A;  3ZMD A;  4KNY A;  4RB3 C;  4RGU A;  4UHT A;  3TKY A;  2HYG D;  2VT3 A;  2W57 A;  1QO0 D;  3SQN A;  4OIN F;  2XAQ A;  1TNS A;  2ZO4 A;  2A07 F;  2ZME A;  2A6E F;  1F1Z A;  3K9T A;  3O2P E;  4H0E A;  2M30 A;  4QWQ A;  1Z7U A;  2BGC A;  2L3D A;  1LEA A;  3KLO A;  4EM0 B;  1E17 A;  3I5U A;  4KFC A;  4UVB A;  4I0A A;  1BI0 A;  3WE3 A;  4R79 A;  1GHC A;  1YLF A;  3QU6 A;  3J81 Z;  1EH6 A;  4P5O A;  1XMA A;  4I01 A;  5L3B A;  4KUM A;  3K0L A;  1Z1D A;  3J7A O; 
#chains in the Genus database with same CATH topology
 5H6R A;  1BJZ A;  1LVK A;  1X58 A;  5HDG A;  3OYJ A;  2XV4 S;  3FMQ A;  4ENK A;  1VND A;  4MIM A;  1LFP A;  4OMY A;  1USS A;  2DA6 A;  3DKW A;  2R7Q A;  3ISP A;  1ZQ3 P;  1WFX A;  3HSR A;  2EFP A;  2R7Z J;  2M4K A;  3K1M A;  4L9T A;  1ZG3 A;  2DJI A;  2ZJR F;  3WGI A;  2B63 J;  4OIO F;  3E1S A;  1MJA A;  3C1D A;  3MCZ A;  1K78 A;  1B6A A;  4YEJ A;  3ZN0 A;  1H0M A;  3BG9 A;  1FSE A;  1RZ4 A;  2KRF A;  2PJR B;  3GTP J;  1JTX A;  3CC2 I;  5F1R A;  1GVJ A;  5L3D A;  1BOB A;  5J1Y A;  1N75 A;  1P2F A;  3HZJ A;  1KA8 A;  2EJR A;  3BPX A;  4ZZD A;  2BY1 A;  3E6B A;  3LFU A;  4HF0 A;  2XRO A;  3HL2 A;  4XLF A;  1ZAR A;  2CU7 A;  5HS7 A;  3VYT B;  2BHY A;  1FP2 A;  3GFJ A;  3FXO A;  3HOU J;  2P0W A;  1S7O A;  2E34 A;  4U7D A;  4HW0 A;  2NNY A;  1JUP A;  2M5W A;  4IF4 A;  3RPU D;  1IN8 A;  2M0C A;  1W4M A;  1PVE A;  2VBX A;  2DA7 A;  4JX4 A;  1QZZ A;  4RS8 A;  2DI3 A;  2VI6 A;  3ABU A;  1HLV A;  4HAM A;  1O7F A;  3QAH A;  2FNA A;  3BRO A;  5M5W J;  1OYY A;  1DP7 P;  3JAM Z;  2OQG A;  1DPU A;  2P8T A;  1I6X A;  2DMP A;  3J7Y J;  4A3C J;  1IXR C;  1RKW A;  2HZT A;  4NQW A;  1K79 A;  4UVC A;  1G3Y A;  3E3V A;  4NBQ A;  4V2F A;  2Z5U A;  2XF6 A;  2EFO A;  3RKY A;  4G7H F;  2FEZ A;  3UNG C;  1MZB A;  4IHW A;  4UXN A;  5EF6 A;  1IW7 F;  5EZG A;  3FM3 A;  3EUH C;  3JW4 A;  1B59 A;  4G7Z F;  2XUB A;  2IS6 A;  2HR3 A;  1P7I A;  3OSG A;  4D0P A;  1PYV A;  2DTZ A;  1V3F A;  4E7J A;  4MEX F;  2JPC A;  3L2C A;  2CW8 A;  4XMY A;  3TO9 A;  1J75 A;  1XGO A;  3D5L A;  4K2E A;  4Q47 A;  2ZJP F;  3KET A;  4A6E A;  3O8G A;  3LSK A;  1FY7 A;  4A3I J;  4ABZ A;  2D45 A;  1YG2 A;  3B6A A;  4ZTF A;  2GIZ A;  1QRY A;  5LEK A;  3BG5 A;  4XBF A;  2NYX A;  4XLE A;  1ETO A;  4M71 A;  2NRA C;  3J7Z I;  4KYW A;  5L3F A;  4Q5S F;  1GXP A;  3SEZ A;  4LLN A;  3I55 I;  4GYI A;  2DXI A;  3G2B A;  2HVR A;  5FRN A;  1ERD A;  5HLH A;  1SAN A;  3BJ6 A;  3Q9S A;  4BKX A;  3E6D A;  3GFI A;  2BVL A;  3U1K A;  3L2W A;  2R5Z B;  2MAB A;  1BIA A;  2EB7 A;  4CDG A;  3JAM K;  1UHS A;  1R58 A;  4D7N A;  3OYI A;  2IGN A;  3F6V A;  2HYJ A;  5DYM A;  1Z05 A;  2O8K A;  1F43 A;  1D3Y A;  5IYC J;  4BE2 A;  3ESW B;  3CF2 A;  4BUP A;  1TL8 A;  3V8J A;  4RAY A;  2DBB A;  1PP7 U;  3I9V 2;  1VQM I;  1QVT A;  2ECB A;  5HLT A;  1VQO I;  2ISY A;  5ILV A;  3PL8 A;  1LB2 A;  3LMM A;  4BDZ A;  3FXQ A;  2DA3 A;  4LB6 B;  4RGR A;  2HXO A;  2WAQ N;  1VF9 A;  3GZ6 A;  4BY1 J;  4UV8 A;  1YFH A;  1FMV A;  1X4O A;  1KU2 A;  3WTS C;  3ASN H;  4JYK A;  2L54 A;  3BG6 A;  1Z1D A;  3OYA A;  2CRG A;  4ZYG A;  5EEG A;  3BWG A;  2HKO A;  1D1B A;  1W7P A;  1ENH A;  1RIO H;  2K85 A;  1FIP A;  1OMI A;  3BG7 A;  1FMW A;  1GVD A;  1BA5 A;  3H36 A;  3V8L A;  5F08 A;  1W0U A;  3V8K A;  2BY0 A;  3VEP A;  4EAT A;  2WV0 A;  3QRF F;  3ZMU A;  4PFP A;  1WJF A;  2IGM A;  3BQY A;  1JUM A;  2Z9O A;  2KJB A;  1LJ9 A;  2KIF A;  2L4M A;  2MA3 A;  2NVY J;  2DU9 A;  5ED4 A;  2L01 A;  1LVA A;  4E7S A;  4M9Z A;  1MSF C;  2H94 A;  1HDP A;  4Q4Z F;  4QSH A;  3MMY B;  5HLG A;  4LK0 F;  2VL8 A;  1ETY A;  3AG1 H;  2H09 A;  4XN0 A;  1BM9 A;  3HOV J;  3K70 D;  2CW7 A;  1DQU A;  2NNN A;  3EQL F;  1FEX A;  1FC3 A;  1ZHF A;  3S8P A;  1IRX A;  2OD5 A;  2KL4 A;  4HQE A;  1J0R A;  1X3U A;  2ELK A;  4OAZ A;  4FIS A;  2EFW A;  4IO9 F;  4N9H A;  3PNV A;  1N25 A;  6PAX A;  4A0Z A;  5C44 J;  3S16 J;  4Y3O A;  3G1L A;  2QQ9 A;  3K1P A;  4PCQ A;  3B73 A;  2DFE A;  5CJ9 A;  3FDY A;  4FTH A;  3BG3 A;  3CCS I;  3HOS A;  5B5E C;  4OOI A;  1SMT A;  1XSX A;  5LGN A;  5M5X J;  3VB2 A;  3BJA A;  4LD5 A;  2NVU B;  1CF7 B;  1XMX A;  2G0E A;  5F27 A;  1KYW A;  4J00 A;  4KMF A;  3F0C A;  2OV7 A;  2RAE A;  1Q1H A;  3GO5 A;  1R4M B;  2CUF A;  3FX3 A;  3W2W A;  3E7L A;  1JGS A;  2WWY A;  3IAM 2;  3BTC A;  2LKS A;  3R0A A;  2X1E A;  3L2V A;  3N97 A;  5FKL A;  2Z1D A;  5FKK A;  2Y69 H;  1ACI A;  3AG2 H;  3I71 A;  1D0Z A;  3E6M A;  3CDH A;  2MH9 A;  1SVO A;  4NB5 A;  1S9H A;  4DOZ A;  2Y0S N;  4DZJ A;  4MTD A;  4EGZ A;  4I6Z A;  3G4S I;  1OR7 A;  5GPC A;  1S7E A;  4G9Y A;  1R71 A;  1ZGW A;  2YX7 A;  3WOD F;  2PBI A;  4RGX A;  2IPQ X;  3GW2 A;  4F91 B;  1LE8 A;  1DU6 A;  1ODD A;  4AYB N;  1MH4 A;  2XF7 A;  3JSP A;  1YJW I;  1BI1 A;  1TWG J;  4XON A;  3T8T A;  4XQF A;  1BBY A;  4BAC A;  2BW3 A;  2VC0 A;  3C2B A;  3DV8 A;  5GPA A;  1BC8 C;  3QOP A;  1HXD A;  4WF2 A;  2HU9 A;  4BHB A;  1FYM A;  1Y56 A;  2EFN A;  3BT9 A;  4CIC A;  4UUV A;  1TW3 A;  2FJ1 A;  5GAG J;  3LA2 A;  3TMO A;  5HS8 A;  3PIP F;  4ETS A;  3PO3 J;  3WU2 C;  3KCC A;  2K9N A;  4F3Q A;  1ZRD A;  3KP6 A;  2NVQ J;  2X6Y A;  4M3B A;  1Z91 A;  2ZKZ A;  5GTI C;  4PJN A;  2PMH A;  1Y1V J;  2FU4 A;  3LFK A;  4V2G A;  3RIR A;  2W85 A;  4BJ6 C;  5IT3 A;  3ZRG A;  4UB8 C;  3CME I;  4W1U A;  1IUF A;  2AQE A;  2HOT A;  1YIT I;  4LG0 A;  4ON0 A;  3VSL A;  1W1W E;  3DCF A;  4S04 A;  2FA5 A;  1Z3X A;  1YW7 A;  4XRM A;  1ZK8 A;  2ZXH A;  1JHH A;  3SDG A;  1WJC A;  1WH7 A;  3PQK A;  5E1W A;  2EH3 A;  1JJ8 C;  1QPI A;  1EH7 A;  2Y0S A;  5GAE J;  1U0J A;  2IA0 A;  4JX5 A;  3ZQ7 A;  5AIQ A;  2VQH A;  4WWC A;  2LNB A;  3H5N A;  3GX4 X;  1IGN A;  4AYB A;  1UZC A;  3ZMV A;  3TW7 A;  2LRD A;  3WHB A;  4RB2 C;  2HTJ A;  2LYC A;  5HDK A;  2JMW A;  2VJ4 A;  2HPI A;  3BJO A;  1H9T A;  1I1G A;  3QP5 A;  2H8W A;  2VKD A;  1KQ8 A;  2IS2 A;  1WJD A;  4M3D A;  1T95 A;  5J4Y A;  1RPW A;  2CGP A;  2YS9 A;  2PX9 A;  3OY9 A;  5FB2 A;  2DMN A;  3ABL H;  4CH7 A;  1FBQ A;  2LBF B;  2FBH A;  1W5C C;  2OBP A;  2KIU A;  5CYV A;  5FLX Z;  1B1B A;  2VJJ A;  3TOA A;  1JUS A;  2E1O A;  4NDL A;  1ITY A;  4OMZ A;  1FOY A;  1XCV A;  4GYG A;  1UCR A;  1S8N A;  4RB0 A;  1STZ A;  3WTV C;  2PI0 A;  3HRU A;  2UWM A;  4BXF A;  1AKH B;  5A2Q Z;  4ENM A;  3S3N A;  3H9Q A;  3DTE A;  5JFR A;  5F0H A;  5C4X J;  2X0L A;  2CG4 A;  3KX2 A;  2XSJ C;  2WY8 Q;  3DTK A;  3DWL E;  2GXB A;  4XLC A;  2L7Z A;  3A1Y A;  2PMZ N;  1IAW A;  3S15 J;  3H3V K;  1MBF A;  3WE2 A;  2HDD A;  3F8F A;  1QZY A;  2QBY A;  1POG A;  4WXD A;  1GV2 A;  4KMU X;  3QOE A;  5E3O A;  2GXG A;  3M3Y J;  3AAF A;  1NTC A;  4B8X A;  2BVM A;  4EGY A;  2DPU A;  3L2R A;  4ITV A;  4LIU A;  3N05 A;  3U21 A;  2TDX A;  1FP1 D;  1YJ9 I;  3BOQ A;  2L9V A;  4C2T A;  2JPB A;  2LVS A;  2MH2 A;  1OCR H;  4QPQ A;  1J5Y A;  1H9G A;  3HOY J;  4O3M A;  1T8I A;  3DXJ F;  5CVV A;  5E18 F;  3FKI J;  3OIP A;  3WU1 B;  3OYM A;  2WBM A;  2A5Y B;  2B0L A;  1J9I A;  2KKO A;  1HST A;  1DGR M;  2MLK A;  3LSP A;  4MFE A;  1SFK A;  2FRH A;  4DBQ A;  3K1N A;  5FLX K;  4B47 A;  5AON A;  1MBK A;  4JP0 A;  2H6B A;  4CZC A;  9ANT A;  1F5T A;  2M8G X;  2NOG A;  4CYD A;  4EM1 A;  3PUF A;  4A6D A;  2DCE A;  3QYE A;  1TQI A;  5A2Q K;  1G4D A;  1REP C;  4A5M A;  2IW5 A;  2IA1 A;  4IRI A;  2LH9 A;  3ZQF A;  2Q8K A;  2IAI A;  2ZSH B;  4RM2 A;  3WHC A;  1PUF B;  2P81 A;  1PJR A;  2DT5 A;  4U88 A;  1R5I D;  3TDU C;  3MEX A;  2IRF G;  2HQR A;  5E1X A;  4D7M A;  5D6E A;  2E36 A;  1RNL A;  5HOO A;  1R22 A;  2CUZ A;  2VLA A;  1AU7 A;  2F4O B;  4DQ2 A;  2BV6 A;  5LEJ A;  2VKE A;  1MD0 A;  4IJA A;  4I76 A;  3CQZ J;  3REO A;  2CS3 A;  3S2W A;  1APL C;  3M07 A;  1WRJ A;  2PMZ A;  2GA2 A;  1YS6 A;  1C0W A;  5HVQ C;  1VQ8 I;  3I53 A;  3HGY A;  3BLY A;  1ON2 A;  1HKQ A;  2E60 A;  3AL0 C;  1ZAO A;  3TOB A;  3HJE A;  4F52 A;  1FT9 A;  3GTL J;  3WG7 H;  4IEJ A;  3RI4 A;  1U8R A;  2PN6 A;  3DPT A;  1TWC J;  5F0C A;  4O5V A;  1DP3 A;  1UHW A;  1J7K A;  1LDD A;  3PSI A;  4FX0 A;  1OFC X;  2EZH A;  4B1R A;  5IPA A;  3UKG A;  3FK7 A;  4CCJ A;  2YSR A;  2CJJ A;  2CQX A;  2PG4 A;  3PQJ A;  1SD4 A;  3WTT C;  3A0B C;  3LSG A;  3OIO A;  2QKL B;  4UUS B;  1FTZ A;  2K02 A;  2OCC H;  5H20 A;  2KZG A;  3Q9V A;  1SFX A;  3TL4 X;  4L5J A;  4BJT A;  4ZYE A;  3MKW B;  5CQG A;  1AHD P;  4RAF A;  4IHV A;  1U2W A;  1U9N A;  4ZDP A;  2M8E A;  2KDO A;  1JE8 A;  4IKF A;  4R1H A;  5EG0 B;  2MGQ A;  4BXX J;  3GWZ A;  3HUG B;  2ZCW A;  1YIJ I;  1ZR4 A;  4RLF A;  1FOK A;  4XKW A;  2E35 A;  3R60 A;  1EF4 A;  2Q0O A;  4CUG A;  3OOP A;  1X19 A;  1T0F A;  2VQL A;  3QYB A;  2QUF A;  2HOE A;  1RRJ A;  2DAO A;  5F6F A;  4KIS A;  3UR3 C;  2QF7 A;  3QP6 A;  2CH0 A;  3WG9 A;  3K70 C;  1B8I B;  4XRS A;  4BEH A;  1LEB A;  5FKM A;  3FXL A;  2KIS A;  4IVN A;  5BMZ A;  1AA7 A;  2LSO A;  1MDM B;  1HSJ A;  4IHS A;  5D8L B;  1IC8 A;  4E7H A;  3D5R C;  3GME A;  5FJ8 J;  3AL0 B;  2LY1 A;  5J47 A;  3JRH A;  1HBX G;  5KK1 A;  3ZMS A;  2WY7 Q;  4LG3 A;  2NOJ B;  3QPT A;  4KT5 C;  5J4V A;  1Z67 A;  4KA4 A;  1Z77 A;  1HW2 A;  4DYC A;  2ELJ A;  2BY2 A;  2DO7 A;  3LSJ A;  5DM7 F;  4P9F A;  3GTM J;  1ZN2 A;  4X6A J;  4YIR X;  3HPH A;  2QVO A;  4HDU A;  1YTY A;  3CUO A;  2V9P A;  4D5F A;  4WXC A;  5BPD A;  5DCM B;  4A3L J;  1YRN B;  1FBU A;  1ZLK A;  2EIL H;  1U9O A;  1E3H A;  2YX4 A;  5JHU A;  3PFY A;  2KQR A;  5EGO B;  5B3S H;  3PNY A;  3DKX A;  4U0Y A;  1A6I A;  1NH3 A;  3FXJ A;  2P4W A;  1S29 A;  3C2G A;  4XOT A;  1OIS A;  1P7J A;  2Y9Y A;  4A69 C;  4BNC A;  3W6V A;  1V54 H;  3HGG A;  3MZ8 A;  3A2K A;  2QCO A;  4EMS A;  3G3Z A;  1WKM A;  3KEO A;  4LFU A;  2EV6 A;  1TT5 B;  2FE3 A;  2JRM A;  2QLZ A;  3ECO A;  1Z3Y A;  3DFG A;  4M3G A;  1ULY A;  3BR3 A;  1XDU A;  4HA8 A;  2DTR A;  1RR8 C;  3VWB A;  3GTK J;  2QQB A;  2NS7 A;  4EJO A;  1QA6 A;  3ZR8 X;  4E70 A;  1HKS A;  2HYF A;  1W5S A;  2HFH A;  3CTA A;  4UV9 A;  1SAU A;  4OIR F;  2QA4 I;  1X3Z B;  4B43 A;  4Y7N J;  3K4J A;  2VBZ A;  3CMY A;  2JA2 A;  4U87 A;  1K61 A;  2ZXW H;  2ZXI A;  2M2E A;  1R5G A;  2ELH A;  3WGH A;  3IHU A;  3RTR A;  4M3F A;  1AWC A;  5LGU A;  3MWM A;  4YFN F;  1BI3 A;  3HEF A;  4FT8 A;  4M3E A;  4L9V A;  3I59 B;  4Q48 A;  4I2O A;  3OYE A;  1ETQ A;  2KHM A;  4YRV A;  1JKP C;  1B72 B;  3CCV I;  4GO1 A;  1GXQ A;  2CO5 A;  3H35 A;  3MD2 A;  4PJL A;  5CPR B;  3VFZ A;  2E5Z A;  2OQR A;  4RAG A;  2L9N A;  4DBR A;  2UUZ A;  4V19 K;  1P4A A;  3FF5 A;  1ZR2 A;  1I5Z A;  1EA3 A;  2P5K A;  3L2Q A;  4IRG A;  3F8C A;  4JOM A;  2V1N A;  3K2Z A;  2R5Z A;  3MN2 A;  2R7S A;  1FYL A;  1TTY A;  3L7W A;  5D5X B;  3S1R J;  1SD5 A;  1HQC A;  4HDV A;  4B4C A;  1D0X A;  3G71 I;  2LDU A;  2ZXJ A;  2E7W A;  2DOA A;  2ESH A;  2JRT A;  3HTU A;  4HOB A;  2XAU A;  3ZGK A;  3F8M A;  4DYR A;  2RN7 A;  3K4B A;  5HNF A;  4IHX A;  5ICE A;  5L3G A;  1LPQ A;  3DEE A;  3BR5 A;  1H88 C;  5JI6 A;  4ZDL A;  3TW6 A;  1OKR A;  1HW5 A;  2P5L C;  1BR1 A;  5E3M A;  3MVP A;  1BJA A;  1WHU A;  3Q0U A;  5HDN A;  1QZE A;  1WH5 A;  1XGM A;  1MBJ A;  2DFI A;  3FHN A;  3A03 A;  3MQ0 A;  2GZW A;  5DM6 F;  4ZYD A;  1O3S A;  2BXZ A;  4I02 A;  3W6K B;  2VB6 A;  2AO9 A;  1CQT A;  4AM3 A;  3H1C A;  3EUH A;  3C2H A;  3I0T A;  4XRF A;  2LC2 A;  4PK4 A;  5IY5 H;  2W7N A;  3AG3 H;  2IJL A;  2MFZ A;  1TWH J;  2KJC A;  2XGX A;  1QBJ A;  1FNN A;  3ZCO A;  1HF0 A;  5LHH A;  1A04 A;  1DPR A;  4EQQ A;  1R00 A;  2R7R A;  3G1M A;  5KNL A;  2KLO A;  1MMG A;  2IS1 A;  3A4C A;  5L3C A;  4MQ9 F;  2RRE A;  2WAE A;  2JSP A;  2CFX A;  5FFX A;  4HV5 A;  3V42 A;  3ZMT A;  5HOD A;  1OYI A;  3BCA A;  2X1D A;  1IF1 A;  2VOP A;  3U9G A;  2K27 A;  1O57 A;  3K7A J;  1D8J A;  2NS0 A;  5J1U A;  2ZBK A;  3E6C C;  1XB4 A;  5KCM A;  3CC4 I;  4DJA A;  3SFZ A;  1X2M A;  5K1Y A;  2A69 F;  3G1O A;  3JTH A;  2V1U A;  2M4G A;  2UXX A;  1WVR A;  4UUT A;  4NUB A;  4AIJ A;  4NNJ A;  1FWZ A;  1UEL B;  4CCK A;  4A3G J;  4LIT A;  5DD8 A;  1V5E A;  1WCM J;  2R7O A;  3S3M A;  2IT0 A;  3DU5 A;  2K9Q A;  3S14 J;  1D1A A;  1FPQ A;  1KZH A;  1U8B A;  2TRT A;  1OYW A;  2ZNY A;  1YHQ I;  3BR6 A;  1WJ5 A;  3HDD A;  1OCC H;  2E19 A;  3LSI A;  4QTR A;  2R5Y B;  2A68 F;  2W4S A;  5JVT A;  3I56 I;  2K4J A;  3OSF A;  1XS9 A;  4UY8 I;  1R36 A;  2JK3 A;  3NWS A;  1Y1W J;  3I4N J;  5CLS A;  4BS9 A;  2VE9 A;  1LUJ B;  3K6G A;  1P4X A;  3MZY A;  3NRV A;  3HSF A;  3BTI A;  3AG4 H;  4G12 A;  3CCJ I;  3LQR A;  2QM3 A;  4P96 A;  4DNC A;  4XRS G;  4I98 B;  2ZJQ F;  1IRF A;  2M34 A;  4I7H A;  4IRH A;  4L9J A;  4N4O B;  3TO6 A;  2D1V A;  1XDS A;  1JGG A;  2P6S A;  4BYY A;  4L5E A;  1V55 H;  4PDK A;  4BU2 A;  3F3X A;  1G2H A;  1OJL A;  2R3S A;  3BZ6 A;  2VC1 A;  2KIQ A;  2ZNZ A;  4TV7 A;  4MHG A;  4LLL A;  3OR2 C;  3WTU C;  1LDK B;  1B4A A;  3K10 A;  1QU3 A;  5EJC A;  2ZSI B;  3KIO A;  2BXY A;  2KIM A;  2XAH A;  3CUQ A;  3L9F A;  1G3W A;  1YJN I;  5DUI A;  3MZH A;  3ERM A;  3SZT A;  1ZKG A;  2XB5 A;  3IL2 A;  2JN6 A;  1WJB A;  1MBH A;  1MMA A;  3HIF A;  2IVM A;  1GV5 A;  2HVQ A;  4HEA 2;  4CYC B;  3QOD A;  1VQ4 I;  2DLL A;  1R9T J;  3GYH X;  4RDU A;  1V4R A;  4DIQ A;  1G3T A;  3NQO A;  2JVH A;  2LFB A;  1WGX A;  2R7D A;  2GM4 A;  4HST A;  4A3J J;  3NAR A;  3N4M A;  1ZRC A;  2E1C A;  4JX6 A;  3QU3 A;  4G7O F;  1OCO H;  1A31 A;  3ELK A;  1N78 A;  1E0E A;  2FQ4 A;  3JRD A;  5AIP A;  1T39 A;  2AXT C;  3VOE A;  1W36 D;  2BZT A;  4XK4 A;  1IRZ A;  2L7K A;  5BOX A;  3FIW A;  1RUN A;  2E7X A;  4P55 A;  2EPF A;  2TCT A;  1FBS A;  1JXS A;  1L3L A;  2HXI A;  4Z6Y A;  4Y17 A;  1NK3 P;  3SHF A;  1O7L A;  2VQC A;  2WAF A;  1KU3 A;  4PJM A;  1VQL I;  4AUX A;  4YG2 F;  4EEF G;  1O3R A;  2XRL A;  2H1K A;  1Y39 A;  1Y0U A;  3PO2 J;  4MFD A;  3DQV C;  5J1R A;  1IN4 A;  1T98 A;  3WTX C;  2JT1 A;  1S3J A;  2OJE D;  3OYG A;  2STW A;  1OCT C;  2LY2 A;  4W97 A;  2Z3Y A;  2E1N A;  1XMK A;  2HPM A;  1WJA A;  4E6K G;  2O3F A;  3CCE I;  1LFB A;  4PSX A;  4C3H J;  3OWT A;  5L3E A;  1WZ2 A;  1F4K A;  4LK1 F;  2CQN A;  1RC9 A;  2CYY A;  3Q0W A;  3F8N A;  3M9A A;  4YFK F;  2QSG X;  4E4H A;  3O6B B;  3DBR B;  1VQK I;  2R7F A;  1E3P A;  3KP3 A;  3MKY B;  2D1H A;  3RZO J;  2M7A A;  1JHF A;  3M1E A;  3GZN B;  4EJT A;  3GBG A;  4HZF A;  1M1E B;  5BQT A;  5LHI A;  2DK8 A;  1VTN C;  5J6X A;  3P9K A;  1O4X A;  1CGP A;  1OR7 C;  2LBF A;  1TLH B;  3NWT A;  3D0S A;  2KRC A;  2FUG 2;  1OLT A;  5JVG F;  4IOA F;  1UST A;  1JTY A;  2L02 A;  1MKM A;  1X1B A;  2L7M P;  1AKH A;  2FD5 A;  3BC8 A;  3OIQ A;  4F55 A;  4Y13 A;  2E1M C;  2X1C A;  1RET A;  2ID6 A;  1KQ9 A;  4MEY F;  4XNF A;  3BR0 A;  3I3L A;  1SMY F;  2K5C A;  2X51 A;  3Q0V A;  4WX9 A;  3RZD J;  2VPL A;  3RKW A;  3P9I A;  5D4S A;  3BTL A;  3KEQ A;  2FOW A;  3GTO J;  2F5F A;  3JRF A;  1BOA A;  2W24 A;  5FLM J;  2E5N A;  4A12 A;  5GP9 A;  3DBL B;  2O61 A;  3ZQL A;  4G6T B;  3VYR B;  2W25 A;  2XGD A;  1K6Y A;  2HWV A;  1PP8 F;  3LSH A;  1JT0 A;  2ZFU A;  4L9N A;  4E7I A;  2V6C A;  2O9L A;  2M87 A;  4XOR A;  1WPK A;  5LRS A;  4E7K A;  4A3M J;  3T8R A;  4JBA A;  1I27 A;  5E8I A;  4J19 A;  1X4P A;  5TIS C;  4RM3 A;  5E20 A;  4H4K C;  2MLG A;  4KIC A;  3HTS B;  2DFF A;  2DDB A;  3NAU A;  1I50 J;  4PGG A;  1IN7 A;  3KFW X;  1R1V A;  2HOA A;  2DQL A;  5LFA A;  2GXA A;  2HS5 A;  4DGW B;  1ZRF A;  3KLN A;  3DLL F;  5J3L A;  2W82 A;  2A6H F;  2C6Y A;  3HRS A;  3QPH A;  1TZL A;  2JJ7 A;  5DUK A;  5DCF A;  1XPX A;  3QPL A;  1MSE C;  3CCQ I;  1RR7 A;  1H8A C;  5C3E J;  4DYQ A;  4ENN A;  2V1D A;  4ENJ A;  3CCY A;  3DEU A;  1P6R A;  3S2H J;  1ZGJ A;  4NHJ A;  5LD2 C;  4L18 B;  4X1E A;  4CCN A;  4YIF A;  3LNQ A;  2VUM J;  4IHT A;  2D2W A;  3LOC A;  1IXC A;  2E1M B;  3K69 A;  3QQA A;  4OU0 A;  4LIV A;  4U0V A;  3GTG J;  2MBF A;  4RBO A;  5KAF C;  4M6V A;  2AQF A;  4R8H A;  3RPU A;  2ZJ2 A;  1IN5 A;  2IA2 A;  2QKM B;  2HDW A;  1BIB A;  2VOD A;  3WTW C;  4BY7 J;  3HHH A;  2HQA A;  2LR8 A;  1G6N A;  2V6E A;  3P5J A;  2OF7 A;  2Q2E B;  5IYB J;  4AU7 A;  4AVP A;  2VBW A;  1VFC A;  2F2E A;  1T2K A;  3HM5 A;  3SYT A;  4P1W A;  2DMT A;  4ZDO A;  1T08 B;  2YU3 A;  1NG6 A;  1XGN A;  2OZ6 A;  4CO8 A;  5E3N A;  3F21 A;  4RB1 A;  4BBR J;  3ROU A;  5FGM A;  2VN2 A;  3CZ6 A;  1ZG5 A;  4A5N A;  3RCO A;  3HPG A;  1WQ2 A;  2VJI A;  5TGT A;  1QHH D;  5K7F A;  2BYV E;  1D0Y A;  1R4N B;  1TC3 C;  2O5R A;  4ZYH A;  2HI3 A;  4UUS A;  1XN7 A;  2FX0 A;  2CV0 A;  3CMA I;  2DFH A;  2Z33 A;  1X3W B;  4XLP F;  3PNT A;  4BQQ A;  4KIB A;  5TJJ A;  3OS2 A;  4AC0 A;  4FAS D;  3BZC A;  2L9R A;  5EG0 A;  3E97 A;  1BI2 A;  2H27 A;  3S93 A;  2RV8 A;  3COA C;  2XRN A;  5E3L A;  1RUO A;  4I99 C;  4KJZ A;  3CJN A;  3G73 A;  3OL4 A;  2IGO A;  3PSF A;  2EV5 A;  4PJ0 C;  2RGV A;  3VDX A;  3OYN A;  3DKY A;  1LNW A;  5ILU A;  1T38 A;  3TED A;  3EET A;  1FLI A;  5B1B H;  4FHT A;  2ZFW A;  3U1D A;  2YUS A;  2OU2 A;  1W7P D;  3EYY A;  2WTE A;  3CLO A;  2QSH X;  3JSO A;  1B8I A;  3MAJ A;  1BR4 A;  4MNU A;  5K7H A;  1WI9 A;  5CVR A;  3ASO H;  1UB9 A;  2RQP A;  2DMU A;  1MDM A;  1YX3 A;  1QGP A;  3C18 A;  3R61 A;  4RLQ A;  4QIW N;  2X4H A;  5H6Q A;  4FX4 A;  3GF2 A;  3V7S A;  2GOX B;  3HYI A;  4UNO A;  4CCM A;  2CW0 F;  2VPR A;  5K7Z A;  1AOY A;  3LL7 A;  3AKZ A;  2AS5 F;  1V5G A;  1U5T C;  3W6J B;  3IRQ A;  3K4K A;  1R5H A;  3VOD A;  2FOK A;  3IH2 A;  3OYC A;  2VT2 A;  4I0B A;  3OS0 A;  5JLW A;  3HB9 A;  4LOC A;  4BQO A;  4E7Z A;  4AID A;  4O6J A;  2Y2Z A;  2R7U A;  5DCM A;  2UZK A;  5F0F A;  3OYH A;  3Q5F A;  2DT7 B;  1LQ1 A;  1A5J A;  1EKE A;  5EGO A;  2OCE A;  2VON A;  1A36 A;  2RNG A;  2V26 A;  3JR9 A;  4N0B A;  4A93 J;  1Y6I A;  1ETX A;  2IP2 A;  3CDL A;  4HSR A;  3RQ4 A;  5LGT A;  2JSC A;  1XSV A;  1IN6 A;  3CCM I;  4HQM A;  1TWA J;  2IXS A;  4NC6 A;  2DMQ A;  3E0J B;  2FBK A;  5E8G A;  3ZQH A;  2CUE A;  2K4B A;  5LBQ A;  3FXK A;  1SEU A;  3M8F A;  3BDD A;  1NK2 P;  4S05 A;  1IV8 A;  5JR3 A;  5B66 C;  4XID A;  3LSR A;  2HOS A;  5KHD A;  2FSW A;  1QQI A;  1YO5 C;  1HCR A;  4B3A A;  2JWT A;  4X0G A;  4FET A;  3LA7 A;  2V79 A;  4BAY A;  3C3W A;  2MW8 A;  4N9I A;  1NG7 A;  4II3 A;  2QQ8 A;  3LSM A;  3VYS B;  3FZV A;  4E7L A;  2Y75 A;  2F5D A;  3KP4 A;  3LQQ A;  3DF8 A;  1B9N A;  4PGH A;  4LMY A;  1ZLJ A;  2XGE A;  3A01 B;  3WU0 A;  1FZP B;  1IZ1 A;  1MMS A;  1U5T B;  2L4A A;  2PJR A;  2DT6 A;  1B72 A;  4MTE A;  1ON1 A;  3GFM A;  3CLQ A;  2I10 A;  3HSE A;  3QYF A;  2P7V B;  4HV6 A;  2RVC A;  3DP7 A;  4FE7 A;  2BE5 F;  4XLA A;  5F04 A;  1W36 C;  2RC4 A;  3OR1 C;  2Y0M A;  2JZY A;  1WI3 A;  1GDT A;  1K6O A;  1IV6 A;  5J8F A;  5HLI A;  4EJW A;  4CHU A;  3B6C A;  4A3E J;  2W84 A;  1Z9C A;  2JQ7 A;  2E71 A;  1GLN A;  3SEQ A;  1BW6 A;  3CP2 A;  1SVM A;  2QYO A;  3EUA A;  2L5Q A;  1SD6 A;  2VAS A;  5KVR A;  2O6G E;  1I3Q J;  1XCB A;  1QPM A;  3CCR I;  4B3X A;  2K9M A;  3DU6 A;  3ZP5 A;  2ZME C;  1FOW A;  1XD7 A;  1X2N A;  2EFQ A;  2MYS A;  4XKB A;  4ZJZ A;  4LLG F;  5ILS A;  4C3I J;  5D6F A;  1QVU A;  5BNG A;  4IPA A;  1MJB A;  2XIG A;  1FJL A;  2ICW G;  3TGN A;  1KGS A;  4BHP A;  2ID3 A;  3IH4 A;  3V4G A;  3E5X A;  3KP7 A;  2P7C B;  5IT9 Z;  3BPV A;  1P9Q C;  4BGD A;  5KAI C;  1XGS A;  3JRC A;  2L9S A;  5GTH C;  1Z0X A;  4HX8 A;  2E2J J;  2F5V A;  2CMP A;  2XAF A;  2FXA A;  4BH9 A;  1S5L C;  2NVT J;  4KIG A;  1G8X A;  5CQE A;  1BR2 A;  2RDP A;  4MLO A;  5IYD J;  2KPM A;  1MH3 A;  3BCB A;  3FXM A;  3RJP A;  1LKX A;  2A61 A;  2M7B A;  4CGZ A;  2R7X A;  1JKQ C;  1KU9 A;  1FX7 A;  3L09 A;  2XSD C;  1JJ6 C;  1FYK A;  2Z99 A;  1VQ7 I;  5H2F C;  3OYD A;  1B9M A;  4ZZL A;  3R4K A;  5D4R A;  2F5E A;  4M73 A;  3KP5 A;  3JRE A;  3ZN1 A;  5CVU A;  5HNH A;  2BHZ A;  2DYR H;  4EJV A;  2CUJ A;  2VKH A;  3BR1 A;  4BEH B;  1ETV A;  2Y9Z A;  4C3J J;  2O8X A;  1IDZ A;  1TWF J;  2GQQ A;  2F48 A;  2IEK A;  5M3M J;  2IGK A;  5HS9 A;  5BPI A;  2ZC2 A;  2MSY A;  2DW4 A;  4RA2 A;  5FO5 A;  2H8R A;  5BS6 A;  1D8K A;  4KIT B;  2RNJ A;  3IWF A;  2ZME B;  1FTT A;  3F6O A;  4HNT A;  3JCU C;  1J59 A;  2VJ5 A;  2VOO A;  3PIO F;  3FXR A;  4LGW A;  3GTQ J;  2J5O A;  5FKN A;  1VZ0 A;  3L1P A;  2YPR A;  2QQA A;  3D1N I;  4LJZ F;  2I8D A;  2LOO A;  1TQP A;  1R7J A;  3IWZ A;  3J81 K;  2R5Y A;  3ZQC A;  3R6S A;  1IXS B;  4AIK A;  1FIA A;  5IT9 K;  1MMD A;  2XF5 A;  4XOP A;  1K4S A;  1FOX A;  1U3E M;  3PM1 A;  4XR6 A;  4BJ5 C;  2V7F A;  2G7U A;  2LF8 A;  4HF1 A;  3KPH A;  3MKZ A;  1N77 A;  2LLK A;  3ZMZ A;  1OQY A;  1DUX C;  3Q3S A;  3FWE A;  5FRO A;  1HC8 A;  3F72 A;  3P9C A;  2CV2 A;  1R1T A;  2MC3 A;  2LP0 A;  3WTZ A;  3J80 Z;  3I54 A;  1NHA A;  3MFK A;  4NC7 A;  2HEO A;  3H3U A;  3GTJ J;  1MMN A;  2F6C A;  5EEH A;  3VYU B;  2F4I A;  4XLN F;  2ESN A;  3H3Z A;  4AWX B;  2X85 A;  1T56 A;  3ERE D;  2V9K A;  3SJM A;  3RQI A;  2HQN A;  4I09 A;  4FE4 A;  3HC7 A;  2JTV A;  3C7J A;  4OIQ F;  1Z6R A;  3HXL A;  1D1C A;  2Q1Z B;  2WB1 N;  1P4W A;  3EUK L;  4A3F J;  3FXU A;  4KT6 A;  1W0T A;  2NXN B;  2X48 A;  3D5S C;  4CYC A;  3HOX J;  1YQA A;  1SAX A;  1PDN C;  3SFI A;  1K78 B;  5TRD A;  5DS9 A;  2KDZ A;  2NS8 A;  4EM2 A;  2VKV A;  2CQK A;  2R4G A;  4HX4 A;  5ICF A;  3ZQG A;  2X6W A;  5FLV A;  2XAS A;  5LRR A;  3IRR A;  4IHY A;  3BP8 A;  4A0X A;  4A2U A;  4GCV A;  5IP9 J;  3I64 A;  5J8C A;  4IL6 C;  2R7T A;  2DYS H;  3RDI A;  3CO7 C;  5D8K B;  2EZI A;  2GBY A;  3EPZ A;  1K83 J;  3BY6 A;  4IQJ A;  2HZD A;  3KZZ A;  1MNM C;  1ZTR A;  1ONV A;  5M3F J;  1XX5 A;  4BBS J;  2VXD A;  2X6X A;  3ABK H;  1J09 A;  5D5W B;  2PMU A;  4BQA A;  2V9V A;  4BHC A;  1CF7 A;  2OPT A;  1DDN A;  2PJP A;  3J80 K;  2FNP A;  4GFB A;  3H5R A;  3H0D A;  2AXL A;  3HRT A;  4AVZ A;  5EDN A;  4Z2Y A;  3SZG A;  4C2U A;  1Z21 A;  2DOD A;  4M9S A;  3EDP A;  1TP4 A;  3KEY A;  2J5P A;  1ZH5 A;  4CXF A;  2EV0 A;  1WWX A;  1O3T A;  2MC4 A;  1FSH A;  4HNV A;  4NQW B;  2HDC A;  1MBG A;  2JA8 J;  4PSW A;  2B7E A;  2LKX A;  2GAU A;  3RSN A;  2R7V A;  4HG2 A;  2K3F A;  1I6H J;  2JUC A;  2DQR A;  2FQ3 A;  1VQ9 I;  1SFU A;  1JT6 A;  1KU7 A;  1ZYR F;  2COB A;  2MD0 A;  2LRE A;  3RYP A;  4XL9 A;  2UXN A;  1OPC A;  3T0Y A;  4ASN A;  2HVS A;  5CVJ A;  2K7L A;  3CJR B;  2IS4 A;  5DEQ A;  2K9S A;  2XKP A;  1LFU P;  2WB1 A;  3FHZ A;  1XG1 A;  4FQG A;  3CF5 F;  4PZJ A;  3CDI A;  1E2X A;  1YI2 I;  2XVC A;  4A0Y A;  5JHF A;  3RKX A;  4DZP A;  3I58 A;  2N8G A;  2ISZ A;  4HX7 A;  4P9U A;  2XB0 X;  3ML6 A;  4OIP F;  3R0J A;  3S3O A;  1BN5 A;  2KFD A;  3CUQ C;  3KYC B;  4CZZ A;  1V5F A;  4M6X A;  2F4M B;  2DA2 A;  3TO7 A;  1QNT A;  1J2X A;  2YR2 A;  2DA5 A;  2OC6 A;  4CCO A;  4F7Z A;  4FCY A;  2XPV A;  1WSU A;  2XKO A;  3SDB A;  2LK2 A;  3OYB A;  1EJ9 A;  3T5X A;  3TBI A;  4BE1 A;  4ZYA A;  3HG9 A;  2WC2 A;  3E5U A;  1BW5 A;  1IO2 A;  3DPU A;  1EV7 A;  3LAJ A;  3S1M J;  2WAD A;  2LMD A;  3FM5 A;  3H9G A;  1IRG A;  1BC7 C;  2OA4 A;  3GFL A;  3AFH A;  4HF2 A;  1R23 A;  5LHG A;  1RI7 A;  2LD5 A;  5K5O A;  2JA6 J;  2EQR A;  4N4N B;  2HQ5 A;  2A05 A;  1L0O C;  3GXO A;  1UJ8 A;  3E5Q A;  3RKQ A;  3FMR A;  4CSW A;  3I4P A;  2NAZ A;  4C30 A;  2D5V A;  1ZRE A;  3ZPL A;  2WAQ A;  2DDA A;  4M72 A;  3CC7 I;  3LST A;  2EZL A;  4GRI A;  1G3S A;  2K86 A;  3W2V A;  2GIV A;  3CMM A;  1Q1V A;  2E2H J;  1S7A A;  3FIS A;  3ONQ A;  1W7P B;  4UB6 C;  3DPL C;  3S2D J;  4Y4R A;  3SZP A;  1QHG A;  2P5V A;  3HKZ N;  4G6Q A;  3LWF A;  3X2Q H;  3ZOB A;  2OZU A;  1ZGA A;  2CQQ A;  2XPW A;  2FBI A;  3M1C A;  2L7F P;  4G94 A;  5D5V B;  3HOT A;  2XHK A;  2QWW A;  1EH8 A;  3GZ5 A;  4IQ4 A;  4Y52 J;  5K5Q A;  2GWR A;  2ZB9 A;  4PFO A;  4Y15 A;  3CUQ B;  3KZY A;  1ZEL A;  1KQ0 A;  3VSK A;  1SVL A;  1W5T A;  2V1X A;  1TW2 A;  3OV8 A;  2R92 J;  2DOE A;  5IP7 J;  1GUU A;  2X6O A;  4GGG A;  2EIM H;  4ESJ A;  3JRA A;  5E17 F;  1XC5 A;  3ULQ B;  3W2A A;  2KP6 A;  1OCP A;  1X1A A;  3DEW A;  2R0Q C;  1XSD A;  1HKT A;  4YFX F;  3TP0 A;  1F9N A;  4M9X A;  1VQP I;  3CD6 I;  3HRM A;  2Y48 A;  3IUO A;  4A3K J;  3O3K A;  2O7O A;  3IH3 A;  3H92 A;  2QZ8 A;  2JUG A;  3DLA A;  3LA3 A;  3QWL A;  2LTP A;  2GA1 A;  2Q2E A;  2CWE A;  3VPR A;  1YX5 A;  4XKC A;  1K7A A;  5FKO A;  4RAZ A;  1HDD C;  2G9W A;  1S6L A;  2BBY A;  2O03 A;  1IG7 A;  1GT0 C;  1YW8 A;  5D5U B;  2FML A;  2FMY A;  2MD5 A;  4EJU A;  3U2R A;  1R49 A;  2CV1 A;  2QEX I;  5FD5 A;  2VE8 A;  3IKV A;  4DW6 A;  3BR2 A;  1A6Q A;  2O0Y A;  2E2I J;  3KZI C;  1SFE A;  1HA8 A;  4KN4 X;  4D5C A;  3W3C A;  4XIC A;  5ERI A;  3P7N A;  3V7R A;  1IUY A;  3F9K A;  2L2O A;  1OCZ H;  1XTA A;  2PLY A;  2I5U A;  4UVA A;  4YEL A;  1WJE A;  2A6T A;  1SD7 A;  4ZC3 A;  2XAJ A;  4M6Y A;  4BL0 B;  1A35 A;  2Z2S B;  2RKH A;  5ICC A;  3F22 A;  4C2M J;  2BEO A;  4KIF A;  2PFB A;  4RGS A;  2Y30 A;  3HKZ A;  5F1J A;  3S32 A;  4YII A;  3JRI A;  3V7C A;  3PFI A;  3ZXS A;  2YU9 J;  4L0Z B;  1ETW A;  2JA7 J;  4ESB A;  1U6G A;  5K5R A;  3CJT B;  2HKX A;  4AD9 A;  3S17 J;  1U78 A;  2GLO A;  2XDV A;  5IOZ A;  1KYZ A;  1LE8 B;  4WK8 F;  3FK6 A;  5B1A H;  3GCM A;  3BZK A;  1UG2 A;  2LF7 A;  4U0W A;  1X1C A;  4XM3 A;  4A3B J;  2XGC A;  1PUF A;  1K4T A;  2EK5 A;  1T33 A;  2LKP A;  4IX7 A;  1RKT A;  4OWR B;  2BOL A;  1VQN I;  5EZH A;  2BW3 B;  3HHG A;  1Y0N A;  2STT A;  1UG0 A;  1LDJ A;  2XC7 A;  3KYL A;  2EIK H;  5DDG A;  3S1Q J;  4CCL A;  1MJ9 A;  4LB5 A;  3GUD A;  5IP6 A;  1UFM A;  2PEX A;  1S72 I;  3O8H A;  3NEU A;  2Y31 A;  5CVI A;  3CES A;  3GVA A;  2W00 A;  2EA2 A;  4ZH4 F;  4EVI A;  2FF4 A;  1YYV A;  3HOW J;  2F5C A;  5DV5 A;  3G6E I;  2W1O A;  1YE9 A;  2ACJ A;  2X9D A;  4IXA A;  3H9J A;  4S0H B;  4ZTJ A;  3RYR A;  1MND A;  2EA4 A;  1YOV B;  2KZV A;  2L0K A;  1I3A A;  4G6D A;  4KN7 X;  2KMU A;  2W48 A;  3GLX A;  2VBY A;  3GLL A;  2K3P A;  4GXO A;  1ORK A;  4L0Y B;  4II2 A;  4LG0 B;  3ZQQ A;  1X1P A;  4OAY A;  1P92 A;  1PUE E;  5M5Y J;  3WTY C;  2B9S A;  3H0G J;  4U7B A;  3OYK A;  2VIX A;  3GEZ A;  3FBI B;  3TDZ C;  4BQN A;  5ICG A;  3M8E A;  5DD4 A;  4B44 A;  2EIJ H;  5FFZ A;  2MG4 A;  4ESF A;  1TBX A;  3OS1 A;  4BDY A;  4KDP A;  1MGT A;  3EYI A;  4JK1 X;  4AIH A;  3HUG A;  2QEN A;  5E1Z B;  3JTG A;  2G7H A;  3S1N J;  5LLQ A;  3FBN B;  1HW1 A;  3IAS 2;  1YIO A;  2PQ8 A;  4XKV A;  4BXU A;  3SXY A;  1BL0 A;  3K4M A;  2WV1 A;  3FMS A;  4XLH A;  5EEA A;  3HBL A;  4PJJ A;  4IOC F;  1JKO C;  4PUS A;  4WCG A;  1Z6T A;  1Y8Q B;  2OAZ A;  1R1U A;  3TP3 A;  4QLC U;  4HBL A;  1UHM A;  4XSZ F;  1G59 A;  4GDF A;  3H5A A;  4EV0 A;  2OTJ I;  2EIN H;  3OMY A;  3M8J A;  1VQ5 I;  3M7G A;  4D1Q A;  3IP4 B;  3A01 A;  3I4M J;  4RMN A;  3TQN A;  4B09 A;  1U5T A;  3PJR A;  2DA1 A;  4IZZ A;  4QPO A;  1HOM A;  1I1S A;  3BQZ A;  5EYR A;  2WA0 A;  4HRI A;  1R6R A;  3WGG A;  2ME0 A;  1IDY A;  3T1B A;  2DJN A;  4NC8 A;  4L5I A;  2DK5 A;  3ZQI A;  2M9H A;  1T6S A;  3OL3 A;  4HYE A;  2QSF X;  4J01 A;  2ME6 A;  2HTS A;  4BE0 A;  3J7A Y;  4MGR A;  4HPQ A;  1YRN A;  1DU0 A;  2DPD A;  2H6C A;  5FD6 A;  2RQQ A;  4HLX A;  3IV5 A;  5GAH J;  1D5V A;  2QBY B;  3A02 A;  2OUM A;  1JI8 A;  2CSO A;  5IOY A;  5F64 A;  3K4L A;  2DN0 A;  3PUB A;  1O3Q A;  1VQ6 I;  2XPU A;  3CCU I;  3CJQ B;  2R93 J;  2OTL I;  1TNT A;  3CCL I;  2EWN A;  5JLX A;  2JVG A;  1ETK A;  4M74 A;  4C9Y A;  1Z7L A;  1UAA A;  2JA5 J;  1UMQ A;  1RES A;  1TT0 A;  1SC7 A;  3QPS A;  2KRH A;  2DA4 A;  4XSX F;  1MIJ A;  3DTI A;  4HLY A;  4JQF A;  2NVX J;  4Y33 A;  2KT0 A;  3RPQ A;  2ECC A;  1D5Y A;  5DTD A;  4B48 A;  3JRB A;  4MO7 A;  2COM A;  2CQ7 A;  1YW9 A;  3KP2 A;  3CO6 C;  2ADU A;  3K4C A;  4MQV A;  3LAP A;  3IKT A;  1ZG1 A;  2V4J C;  2ETH A;  1MBE A;  1IJW C;  1E3O C;  2AHQ A;  3L00 A;  1TQM A;  3B02 A;  3I59 A;  3F8B A;  1MNE A;  3KE2 A;  4XN3 A;  2M1B A;  2P6T A;  3OYF A;  4WXH A;  3CP8 A;  2UV1 A;  2VXZ A;  2XAG A;  2M45 A;  3ABT A;  2A3S A;  2BY3 A;  3ECH A;  4HNU A;  3F23 A;  1YS7 A;  1Y8R B;  4G8X A;  1DGW Y;  5E79 C;  3IC7 A;  2CFO A;  1KON A;  3HOZ J;  2HGC A;  2A5W A;  1T0F C;  3ZMD A;  4KNY A;  4RB3 C;  2H1L A;  4RGU A;  4UHT A;  5FRM A;  3TKY A;  5C4J J;  2HYG D;  2VT3 A;  2W57 A;  1QO0 D;  5CKT A;  2DOF A;  3JRG A;  1X1D A;  3SQN A;  4OIN F;  2XAQ A;  3MKL A;  3OYL A;  5GAD J;  2LY9 A;  1TNS A;  3OOU A;  2ZO4 A;  4F92 B;  3L2U A;  2A07 F;  2K40 A;  2ZME A;  2A6E F;  1F1Z A;  3K9T A;  2HNH A;  3O2P E;  1VI0 A;  1I39 A;  3A0H C;  4H0E A;  4A3D J;  2GOM A;  2M0M A;  2M30 A;  4QWQ A;  1Z7U A;  3FKJ A;  2BGC A;  2EBI A;  2L3D A;  1LEA A;  2K9L A;  3KLO A;  4EM0 B;  3K4N A;  3I5U A;  1E17 A;  2VQG A;  4KFC A;  2M3A A;  4CA0 A;  4UVB A;  4I0A A;  1F36 A;  2LG4 A;  1BI0 A;  4D9J A;  3WE3 A;  3ABM H;  3KYD B;  4ANJ A;  4R79 A;  1GHC A;  1YLF A;  3QU6 A;  2R7W A;  4F93 B;  3J81 Z;  1MW7 A;  2Z16 A;  1EH6 A;  1H89 C;  5J40 A;  4P5O A;  3K2A A;  3M4O J;  1XMA A;  4I01 A;  1SFO J;  2QGU A;  5L3B A;  3DBH B;  1JKR C;  4KUM A;  2IBD A;  2EZK A;  3K0L A;  3BTJ A;  3J7A O; 
#chains in the Genus database with same CATH homology
 5H6R A;  5HDG A;  2XV4 S;  3FMQ A;  4ENK A;  4OMY A;  1USS A;  3DKW A;  3ISP A;  3HSR A;  2EFP A;  3K1M A;  4L9T A;  1ZG3 A;  3WGI A;  4OIO F;  1MJA A;  3C1D A;  3MCZ A;  1K78 A;  1B6A A;  3ZN0 A;  1H0M A;  1FSE A;  1RZ4 A;  2KRF A;  5F1R A;  1GVJ A;  5L3D A;  1P2F A;  1KA8 A;  2EJR A;  3BPX A;  4ZZD A;  3E6B A;  4HF0 A;  2XRO A;  1ZAR A;  5HS7 A;  1FP2 A;  3GFJ A;  1S7O A;  4U7D A;  4HW0 A;  2NNY A;  2M5W A;  4IF4 A;  1IN8 A;  1W4M A;  2VBX A;  1QZZ A;  4RS8 A;  2DI3 A;  3ABU A;  4HAM A;  1O7F A;  3QAH A;  2FNA A;  3BRO A;  1OYY A;  1DP7 P;  3JAM Z;  2OQG A;  1DPU A;  2P8T A;  1I6X A;  1IXR C;  2HZT A;  4NQW A;  1K79 A;  4UVC A;  1G3Y A;  3E3V A;  2Z5U A;  2EFO A;  3RKY A;  4G7H F;  2FEZ A;  1MZB A;  4UXN A;  1IW7 F;  3FM3 A;  3JW4 A;  1B59 A;  4G7Z F;  2XUB A;  2HR3 A;  4D0P A;  1V3F A;  4MEX F;  2JPC A;  3L2C A;  3TO9 A;  1J75 A;  1XGO A;  3D5L A;  4K2E A;  4Q47 A;  3KET A;  4A6E A;  1FY7 A;  2D45 A;  1YG2 A;  5LEK A;  4XBF A;  2NYX A;  4M71 A;  2NRA C;  4KYW A;  5L3F A;  4Q5S F;  1GXP A;  4LLN A;  4GYI A;  5HLH A;  3BJ6 A;  3Q9S A;  3E6D A;  3GFI A;  1BIA A;  2EB7 A;  4CDG A;  3JAM K;  1R58 A;  3F6V A;  5DYM A;  1Z05 A;  1D3Y A;  3V8J A;  4RAY A;  2DBB A;  1PP7 U;  2ISY A;  5ILV A;  1LB2 A;  3FXQ A;  4LB6 B;  4RGR A;  3GZ6 A;  4UV8 A;  1YFH A;  1KU2 A;  3WTS C;  2L54 A;  4ZYG A;  5EEG A;  3BWG A;  2HKO A;  1W7P A;  1RIO H;  1OMI A;  3V8L A;  3V8K A;  3VEP A;  2WV0 A;  3QRF F;  3ZMU A;  2Z9O A;  2KJB A;  1LJ9 A;  2KIF A;  2L4M A;  2MA3 A;  2DU9 A;  5ED4 A;  2L01 A;  1LVA A;  4M9Z A;  2H94 A;  4Q4Z F;  5HLG A;  4LK0 F;  2H09 A;  1BM9 A;  2NNN A;  3EQL F;  1FC3 A;  1ZHF A;  2OD5 A;  4HQE A;  1J0R A;  1X3U A;  2EFW A;  4N9H A;  6PAX A;  4A0Z A;  4PCQ A;  2QQ9 A;  3K1P A;  3B73 A;  5CJ9 A;  3HOS A;  4OOI A;  1SMT A;  1XSX A;  5LGN A;  3VB2 A;  3BJA A;  4LD5 A;  1CF7 B;  1KYW A;  4KMF A;  1Q1H A;  3GO5 A;  3FX3 A;  1JGS A;  2WWY A;  3R0A A;  3N97 A;  3I71 A;  3E6M A;  3CDH A;  2MH9 A;  4NB5 A;  4EGZ A;  4MTD A;  1OR7 A;  4G9Y A;  2YX7 A;  3WOD F;  2PBI A;  4RGX A;  2IPQ X;  3GW2 A;  1ODD A;  3JSP A;  1BI1 A;  3T8T A;  1BBY A;  2VC0 A;  3DV8 A;  1BC8 C;  3QOP A;  1HXD A;  4WF2 A;  4BHB A;  1FYM A;  2EFN A;  4CIC A;  4UUV A;  1TW3 A;  3LA2 A;  5HS8 A;  4ETS A;  3KCC A;  1ZRD A;  3KP6 A;  1Z91 A;  2ZKZ A;  2PMH A;  2FU4 A;  3LFK A;  3RIR A;  2W85 A;  5IT3 A;  4LG0 A;  4ON0 A;  4S04 A;  2FA5 A;  1YW7 A;  1JHH A;  3PQK A;  5E1W A;  1EH7 A;  2IA0 A;  3ZQ7 A;  5AIQ A;  4WWC A;  2LNB A;  3GX4 X;  3ZMV A;  4RB2 C;  2HTJ A;  5HDK A;  3BJO A;  1H9T A;  1I1G A;  3QP5 A;  1KQ8 A;  2CGP A;  5FB2 A;  1FBQ A;  2FBH A;  2OBP A;  5FLX Z;  2KIU A;  5CYV A;  1B1B A;  3TOA A;  4OMZ A;  1XCV A;  4GYG A;  1UCR A;  1S8N A;  4RB0 A;  1STZ A;  3WTV C;  2PI0 A;  3HRU A;  2UWM A;  5A2Q Z;  4ENM A;  5JFR A;  2X0L A;  2CG4 A;  2GXB A;  1IAW A;  3WE2 A;  3F8F A;  1QZY A;  2QBY A;  4WXD A;  4KMU X;  2GXG A;  3AAF A;  4B8X A;  4EGY A;  2DPU A;  2TDX A;  1FP1 D;  3BOQ A;  2JPB A;  2MH2 A;  1J5Y A;  1H9G A;  4O3M A;  3DXJ F;  5CVV A;  5E18 F;  3WU1 B;  2A5Y B;  2B0L A;  1J9I A;  2KKO A;  1HST A;  2MLK A;  2FRH A;  3K1N A;  5FLX K;  5AON A;  2H6B A;  1F5T A;  4EM1 A;  4CYD A;  4A6D A;  1TQI A;  5A2Q K;  1G4D A;  1REP C;  4A5M A;  2IW5 A;  2IA1 A;  4IRI A;  2Q8K A;  2DT5 A;  4U88 A;  3TDU C;  3MEX A;  2IRF G;  2HQR A;  5E1X A;  5D6E A;  1RNL A;  5HOO A;  1R22 A;  4DQ2 A;  2BV6 A;  5LEJ A;  1MD0 A;  4IJA A;  3REO A;  3S2W A;  1WRJ A;  2GA2 A;  1YS6 A;  1C0W A;  5HVQ C;  3I53 A;  1ON2 A;  1HKQ A;  1ZAO A;  3TOB A;  1FT9 A;  3RI4 A;  1U8R A;  2PN6 A;  3DPT A;  4O5V A;  1UHW A;  1J7K A;  1LDD A;  4FX0 A;  2YSR A;  2PG4 A;  3PQJ A;  1SD4 A;  3WTT C;  2K02 A;  5H20 A;  3Q9V A;  1SFX A;  4L5J A;  4ZYE A;  1U2W A;  2M8E A;  1JE8 A;  4R1H A;  3GWZ A;  2ZCW A;  1FOK A;  3R60 A;  2Q0O A;  3OOP A;  1T0F A;  2QUF A;  2HOE A;  2DAO A;  5F6F A;  3QP6 A;  3WG9 A;  1LEB A;  4IVN A;  5BMZ A;  2LSO A;  4IHS A;  1MDM B;  1HSJ A;  5D8L B;  1HBX G;  5KK1 A;  3ZMS A;  3QPT A;  4KT5 C;  4KA4 A;  1HW2 A;  2DO7 A;  4P9F A;  1ZN2 A;  2QVO A;  4HDU A;  1YTY A;  3CUO A;  4WXC A;  5BPD A;  5DCM B;  1FBU A;  1ZLK A;  2YX4 A;  5JHU A;  4U0Y A;  2P4W A;  1S29 A;  4BNC A;  4EMS A;  3G3Z A;  1WKM A;  3KEO A;  4LFU A;  2EV6 A;  2FE3 A;  2QLZ A;  3ECO A;  3DFG A;  1ULY A;  1XDU A;  4HA8 A;  2DTR A;  2QQB A;  4EJO A;  4E70 A;  1HKS A;  2HYF A;  1W5S A;  2HFH A;  3CTA A;  4UV9 A;  4OIR F;  2VBZ A;  1R5G A;  2ELH A;  3WGH A;  3IHU A;  3RTR A;  1AWC A;  5LGU A;  3MWM A;  4YFN F;  1BI3 A;  4FT8 A;  4L9V A;  3I59 B;  4Q48 A;  4I2O A;  4GO1 A;  1GXQ A;  2CO5 A;  3VFZ A;  2OQR A;  1P4A A;  3FF5 A;  1I5Z A;  2P5K A;  4IRG A;  3F8C A;  3K2Z A;  1FYL A;  1TTY A;  3L7W A;  5D5X B;  1SD5 A;  1HQC A;  4HDV A;  2LDU A;  2ZXJ A;  2E7W A;  2ESH A;  2JRT A;  3HTU A;  4HOB A;  3F8M A;  2RN7 A;  5ICE A;  5L3G A;  5JI6 A;  1OKR A;  1HW5 A;  2P5L C;  1BJA A;  5HDN A;  1XGM A;  2DFI A;  3MQ0 A;  2GZW A;  4ZYD A;  1O3S A;  4I02 A;  3W6K B;  3EUH A;  3I0T A;  4XRF A;  2IJL A;  2KJC A;  2XGX A;  1QBJ A;  1FNN A;  5LHH A;  1A04 A;  1DPR A;  4EQQ A;  1R00 A;  5L3C A;  4MQ9 F;  2CFX A;  5FFX A;  4HV5 A;  3ZMT A;  1OYI A;  1IF1 A;  2VOP A;  3U9G A;  2K27 A;  1O57 A;  1D8J A;  2NS0 A;  2ZBK A;  3E6C C;  1XB4 A;  3SFZ A;  5K1Y A;  2A69 F;  3JTH A;  2V1U A;  2UXX A;  4AIJ A;  1FWZ A;  5DD8 A;  2IT0 A;  1FPQ A;  1OYW A;  2ZNY A;  2A68 F;  5JVT A;  2K4J A;  1R36 A;  5CLS A;  2VE9 A;  1P4X A;  3MZY A;  3NRV A;  3HSF A;  3LQR A;  2QM3 A;  4P96 A;  4DNC A;  4I98 B;  1IRF A;  4I7H A;  4IRH A;  4L9J A;  3TO6 A;  2D1V A;  1XDS A;  2P6S A;  4BYY A;  4PDK A;  3F3X A;  2R3S A;  3BZ6 A;  2VC1 A;  2ZNZ A;  4MHG A;  4TV7 A;  4LLL A;  3WTU C;  1LDK B;  1B4A A;  2KIM A;  2XAH A;  3CUQ A;  3L9F A;  1G3W A;  5DUI A;  3MZH A;  3SZT A;  3IL2 A;  3HIF A;  2IVM A;  2DLL A;  3GYH X;  1V4R A;  1G3T A;  3NQO A;  2R7D A;  1ZRC A;  3N4M A;  2E1C A;  3QU3 A;  4G7O F;  3ELK A;  5AIP A;  1T39 A;  3VOE A;  5BOX A;  1RUN A;  2E7X A;  4P55 A;  1FBS A;  1JXS A;  1L3L A;  4Y17 A;  3SHF A;  1O7L A;  1KU3 A;  4YG2 F;  1O3R A;  1Y0U A;  3DQV C;  1IN4 A;  1T98 A;  3WTX C;  2JT1 A;  1S3J A;  2STW A;  2E1N A;  2Z3Y A;  1XMK A;  2O3F A;  5L3E A;  1F4K A;  4LK1 F;  2CYY A;  3F8N A;  3M9A A;  4YFK F;  3O6B B;  2R7F A;  3KP3 A;  2D1H A;  1JHF A;  3M1E A;  4EJT A;  4HZF A;  5BQT A;  5LHI A;  2DK8 A;  1VTN C;  5J6X A;  3P9K A;  1CGP A;  1TLH B;  3D0S A;  1UST A;  2L02 A;  1MKM A;  4Y13 A;  1KQ9 A;  4MEY F;  4WX9 A;  1SMY F;  3RKW A;  3P9I A;  5D4S A;  3KEQ A;  2F5F A;  1BOA A;  2W24 A;  4A12 A;  2O61 A;  2W25 A;  2HWV A;  1PP8 F;  4L9N A;  2V6C A;  2M87 A;  5LRS A;  3T8R A;  4JBA A;  1I27 A;  5E8I A;  5E20 A;  2MLG A;  4KIC A;  3HTS B;  4PGG A;  1IN7 A;  3KFW X;  1R1V A;  2DQL A;  2HS5 A;  1ZRF A;  3KLN A;  2A6H F;  2C6Y A;  3HRS A;  3QPH A;  5DUK A;  5DCF A;  4ENN A;  2V1D A;  4ENJ A;  3DEU A;  1P6R A;  1ZGJ A;  4NHJ A;  4L18 B;  4YIF A;  4IHT A;  2D2W A;  1IXC A;  3K69 A;  4OU0 A;  4U0V A;  2MBF A;  4R8H A;  3RPU A;  2ZJ2 A;  1IN5 A;  2IA2 A;  1BIB A;  2VOD A;  3WTW C;  3HHH A;  1G6N A;  4AVP A;  2VBW A;  2F2E A;  1T2K A;  2YU3 A;  1XGN A;  2OZ6 A;  4CO8 A;  3F21 A;  4RB1 A;  3ROU A;  5FGM A;  2VN2 A;  1ZG5 A;  4A5N A;  1WQ2 A;  2BYV E;  4ZYH A;  1XN7 A;  2Z33 A;  4XLP F;  4KIB A;  5TJJ A;  3E97 A;  1BI2 A;  2H27 A;  2RV8 A;  3COA C;  2XRN A;  1RUO A;  3CJN A;  3G73 A;  2EV5 A;  2RGV A;  1LNW A;  5ILU A;  1T38 A;  3EET A;  1FLI A;  4FHT A;  2ZFW A;  3U1D A;  2OU2 A;  1W7P D;  3EYY A;  2WTE A;  3CLO A;  3JSO A;  3MAJ A;  4MNU A;  1WI9 A;  5CVR A;  1UB9 A;  2RQP A;  1MDM A;  1QGP A;  3C18 A;  3R61 A;  2X4H A;  5H6Q A;  4FX4 A;  3GF2 A;  3V7S A;  3HYI A;  4UNO A;  2CW0 F;  1AOY A;  2AS5 F;  1U5T C;  3W6J B;  3IRQ A;  1R5H A;  3VOD A;  2FOK A;  2VT2 A;  4I0B A;  4O6J A;  5DCM A;  2UZK A;  3Q5F A;  1LQ1 A;  2VON A;  4N0B A;  2IP2 A;  5LGT A;  2JSC A;  1XSV A;  1IN6 A;  4HQM A;  2FBK A;  5E8G A;  2K4B A;  5LBQ A;  3M8F A;  3BDD A;  4S05 A;  5JR3 A;  2FSW A;  1QQI A;  1YO5 C;  3LA7 A;  2V79 A;  4BAY A;  3C3W A;  4N9I A;  3FZV A;  2Y75 A;  2F5D A;  3KP4 A;  3LQQ A;  3DF8 A;  1B9N A;  4PGH A;  4LMY A;  1ZLJ A;  3WU0 A;  1FZP B;  1IZ1 A;  1U5T B;  2L4A A;  4MTE A;  1ON1 A;  3GFM A;  3HSE A;  2P7V B;  4HV6 A;  2RVC A;  3DP7 A;  2BE5 F;  2RC4 A;  2Y0M A;  2JZY A;  1K6O A;  5J8F A;  5HLI A;  4EJW A;  4CHU A;  1Z9C A;  2W84 A;  2QYO A;  5KVR A;  1SD6 A;  2O6G E;  1XCB A;  1QPM A;  3ZP5 A;  1XD7 A;  2EFQ A;  4LLG F;  5ILS A;  5D6F A;  4IPA A;  1MJB A;  2XIG A;  3TGN A;  1KGS A;  4BHP A;  3V4G A;  3E5X A;  3KP7 A;  2P7C B;  5IT9 Z;  3BPV A;  1XGS A;  4HX8 A;  2XAF A;  2FXA A;  4BH9 A;  4KIG A;  2RDP A;  3RJP A;  2A61 A;  4CGZ A;  1KU9 A;  1FX7 A;  3L09 A;  1FYK A;  2Z99 A;  1B9M A;  4ZZL A;  3R4K A;  5D4R A;  2F5E A;  4M73 A;  3KP5 A;  3ZN1 A;  5CVU A;  4EJV A;  2O8X A;  2GQQ A;  5HS9 A;  5BPI A;  2DW4 A;  5FO5 A;  5BS6 A;  1D8K A;  2RNJ A;  3IWF A;  2ZME B;  3F6O A;  1J59 A;  2VOO A;  3FXR A;  4LGW A;  2J5O A;  2YPR A;  2QQA A;  4LJZ F;  1TQP A;  1R7J A;  3IWZ A;  3J81 K;  3R6S A;  1IXS B;  4AIK A;  5IT9 K;  1U3E M;  2G7U A;  2LF8 A;  4HF1 A;  3ZMZ A;  1DUX C;  3FWE A;  3F72 A;  3P9C A;  1R1T A;  2MC3 A;  3WTZ A;  3J80 Z;  3I54 A;  1NHA A;  3MFK A;  2HEO A;  3H3U A;  5EEH A;  4XLN F;  2ESN A;  3H3Z A;  4AWX B;  3ERE D;  2HQN A;  4I09 A;  2JTV A;  3C7J A;  4OIQ F;  1Z6R A;  1P4W A;  3FXU A;  1SAX A;  1YQA A;  1PDN C;  1K78 B;  5TRD A;  4EM2 A;  2CQK A;  4HX4 A;  5ICF A;  2XAS A;  5LRR A;  3IRR A;  3BP8 A;  4A0X A;  4A2U A;  4GCV A;  3I64 A;  5J8C A;  3RDI A;  3CO7 C;  5D8K B;  3BY6 A;  3KZZ A;  1ONV A;  5D5W B;  4BQA A;  2PMU A;  2V9V A;  4BHC A;  1CF7 A;  1DDN A;  2PJP A;  3J80 K;  2FNP A;  2AXL A;  3HRT A;  4Z2Y A;  4M9S A;  3EDP A;  2J5P A;  1ZH5 A;  4CXF A;  2EV0 A;  1WWX A;  1O3T A;  1FSH A;  2HDC A;  2GAU A;  2DQR A;  2FQ3 A;  1SFU A;  1KU7 A;  1ZYR F;  3RYP A;  2UXN A;  1OPC A;  3T0Y A;  4ASN A;  5CVJ A;  2K7L A;  5DEQ A;  2XKP A;  3FHZ A;  4PZJ A;  1E2X A;  2XVC A;  4A0Y A;  3RKX A;  2ISZ A;  3I58 A;  4HX7 A;  4P9U A;  3ML6 A;  4OIP F;  3R0J A;  1BN5 A;  3CUQ C;  4CZZ A;  4M6X A;  3TO7 A;  1QNT A;  1J2X A;  2YR2 A;  4F7Z A;  1WSU A;  2XKO A;  3T5X A;  2WC2 A;  3E5U A;  1EV7 A;  3LAJ A;  3FM5 A;  1IRG A;  1BC7 C;  2OA4 A;  3GFL A;  4HF2 A;  1R23 A;  5LHG A;  1RI7 A;  5K5O A;  1L0O C;  3GXO A;  3E5Q A;  3FMR A;  3I4P A;  2NAZ A;  1ZRE A;  3ZPL A;  4M72 A;  3LST A;  1G3S A;  2K86 A;  2GIV A;  1S7A A;  1W7P B;  3DPL C;  3SZP A;  2P5V A;  4G6Q A;  3LWF A;  2OZU A;  1ZGA A;  2FBI A;  4G94 A;  5D5V B;  3HOT A;  2XHK A;  2QWW A;  1EH8 A;  3GZ5 A;  5K5Q A;  2GWR A;  4Y15 A;  3CUQ B;  3KZY A;  1KQ0 A;  1W5T A;  2V1X A;  1TW2 A;  3OV8 A;  4GGG A;  4ESJ A;  5E17 F;  3ULQ B;  1XSD A;  1HKT A;  4YFX F;  1F9N A;  4M9X A;  3HRM A;  2Y48 A;  3O3K A;  3H92 A;  2QZ8 A;  3LA3 A;  2GA1 A;  2Q2E A;  2CWE A;  1K7A A;  4RAZ A;  2G9W A;  1S6L A;  2BBY A;  2O03 A;  1YW8 A;  5D5U B;  4EJU A;  2FML A;  2FMY A;  2MD5 A;  3U2R A;  5FD5 A;  2VE8 A;  3IKV A;  2O0Y A;  1SFE A;  4KN4 X;  5ERI A;  3P7N A;  3V7R A;  1IUY A;  2PLY A;  4UVA A;  1SD7 A;  2XAJ A;  4M6Y A;  2RKH A;  5ICC A;  3F22 A;  2BEO A;  4KIF A;  2PFB A;  4RGS A;  4YII A;  3V7C A;  3PFI A;  4L0Z B;  4ESB A;  1U6G A;  5K5R A;  2HKX A;  4AD9 A;  1U78 A;  1KYZ A;  4WK8 F;  2LF7 A;  4U0W A;  2EK5 A;  2LKP A;  3HHG A;  2STT A;  1LDJ A;  5DDG A;  1MJ9 A;  4LB5 A;  3GUD A;  1UFM A;  2PEX A;  3NEU A;  5CVI A;  3GVA A;  2EA2 A;  4ZH4 F;  4EVI A;  2FF4 A;  1YYV A;  2F5C A;  5DV5 A;  2ACJ A;  4IXA A;  3RYR A;  2EA4 A;  4G6D A;  4KN7 X;  3GLX A;  2VBY A;  4GXO A;  4L0Y B;  4LG0 B;  1P92 A;  1PUE E;  3WTY C;  4U7B A;  3GEZ A;  3TDZ C;  5ICG A;  3M8E A;  5DD4 A;  5FFZ A;  4ESF A;  4KDP A;  1TBX A;  1MGT A;  3EYI A;  4JK1 X;  4AIH A;  3HUG A;  2QEN A;  5E1Z B;  3JTG A;  2G7H A;  5LLQ A;  1HW1 A;  1YIO A;  2PQ8 A;  4BXU A;  3SXY A;  3FMS A;  4WCG A;  1Z6T A;  4QLC U;  2OAZ A;  1R1U A;  4HBL A;  1UHM A;  4XSZ F;  4EV0 A;  3M7G A;  3TQN A;  4B09 A;  1U5T A;  1I1S A;  3WGG A;  3T1B A;  4L5I A;  2DK5 A;  1T6S A;  4HYE A;  2HTS A;  4MGR A;  2DPD A;  2H6C A;  5FD6 A;  4HLX A;  1D5V A;  2QBY B;  2CSO A;  5F64 A;  1O3Q A;  1TNT A;  2EWN A;  4M74 A;  4XSX F;  4HLY A;  4JQF A;  3RPQ A;  2COM A;  1YW9 A;  3KP2 A;  3CO6 C;  2ADU A;  4MQV A;  3LAP A;  3IKT A;  1ZG1 A;  2ETH A;  3L00 A;  1TQM A;  3B02 A;  3I59 A;  3F8B A;  3KE2 A;  2M1B A;  2P6T A;  4WXH A;  2VXZ A;  2M45 A;  2XAG A;  3ABT A;  2A3S A;  3ECH A;  3F23 A;  1YS7 A;  4G8X A;  3IC7 A;  2HGC A;  3ZMD A;  4KNY A;  4RB3 C;  4RGU A;  4UHT A;  3TKY A;  2HYG D;  2VT3 A;  2W57 A;  1QO0 D;  3SQN A;  4OIN F;  2XAQ A;  1TNS A;  2ZO4 A;  2A07 F;  2ZME A;  2A6E F;  1F1Z A;  3K9T A;  3O2P E;  4H0E A;  2M30 A;  4QWQ A;  1Z7U A;  2BGC A;  2L3D A;  1LEA A;  3KLO A;  4EM0 B;  1E17 A;  3I5U A;  4KFC A;  4UVB A;  4I0A A;  1BI0 A;  3WE3 A;  4R79 A;  1GHC A;  1YLF A;  3QU6 A;  3J81 Z;  1EH6 A;  4P5O A;  1XMA A;  4I01 A;  5L3B A;  4KUM A;  3K0L A;  1Z1D A;  3J7A O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...