1WI9A

Solution structure of the pci domain from mouse hypothetical protein aah51541
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
72
structure length
72
Chain Sequence
GSSGSSGFLTEFINYIKKSKVVLLEDLAFQMGLRTQDAINRIQDLLTEGTLTGVIDDRGKFIYITPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein C20orf116 homolog
publication title Solution structure of the PCI domain from mouse hypothetical protein AAH51541
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 12
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2004-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1wi9A01
5DYMA 2PQ8A 2EV6A 4HDVA 2Q8KA 1ZRFA 3E5XA 4R8HA 3RDIA 1P4XA 5F1RA 2PEXA 2ETHA 2HFHA 2JTVA 4KYWA 2V1XA 3BP8A 3LAPA 3LFKA 5HDKA 2JRTA 3ZN0A 5ICFA 1O57A 1LDDA 1YIOA 4WWCA 1EH8A 1ZAOA 1L3LA 3JW4A 4HZFA 3K1PA 1GXPA 1YG2A 1R1TA 3FXUA 1O7LA 3E5QA 1BIAA 5DEQA 2LF8A 3EYYA 1MJ9A 3V8KA 2FBKA 3WE3A 4I0BA 3WTWC 1MDMA 2QVOA 4U7DA 2VE8A 2Z99A 5HVQC 4L9JA 1K79A 3SXYA 2H94A 2QUFA 3C7JA 2EV0A 2A68F 2HKOA 3BJOA 5CVVA 5D6FA 2VBYA 3P7NA 2P7VB 3F8FA 2P7CB 4MQ9F 3TQNA 4ZYGA 3ZMVA 1USTA 5K1YA 3MWMA 5LBQA 2EFOA 3GFMA 3TKYA 4R1HA 3Q5FA 1KA8A 4RGRA 5FFXA 3ZMUA 2UZKA 1FBSA 3ULQB 3WU0A 3M7GA 4IF4A 2VE9A 1O3RA 1J75A 4Y17A 3V7SA 2O3FA 1FSHA 1YS6A 1WWXA 2FSWA 3CUQA 4ZYHA 2HS5A 3QPTA 2NS0A 1YTYA 1RI7A 3KP7A 4I0AA 3WTZA 3W6KB 2EFWA 1QZYA 2HKXA 4KNYA 1JGSA 3LAJA 1V4RA 1F9NA 4A6EA 3E6BA 2GXGA 4M6XA 4BH9A 4RGXA 3I71A 3U9GA 2HZTA 2BBYA 3J7AO 2P8TA 5L3CA 5KK1A 4LG0A 4JBAA 3NEUA 1W5SA 5E20A 1FBQA 3KEOA 1KYZA 3F8MA 5AIPA 2XRNA 2GZWA 4A6DA 4BNCA 3FM3A 4YFNF 1YYVA 3RYPA 4BQAA 2DU9A 3FMRA 2FBIA 1OKRA 4LB6B 2OAZA 1H9GA 3CUQC 3KZZA 1S7AA 2EWNA 3M1EA 1TNTA 1PP8F 1IW7F 3N97A 1ZLJA 3KP5A 3M8FA 2KJCA 2STTA 1G3YA 1SMYF 3BJAA 2JSCA 3KLNA 3MFKA 1T6SA 2IJLA 2F5FA 3CO7C 4EM1A 3D0SA 4G94A 1W5TA 4UVCA 2NYXA 3P9CA 4EVIA 4HA8A 3C1DA 3E3VA 4AWXB 1ZN2A 2HYGD 3FM5A 1KU2A 2VT2A 3DV8A 2IW5A 1O7FA 4IJAA 5HOOA 2ISYA 4JK1X 2BGCA 5D4SA 5HDNA 4KICA 1R58A 2OU2A 2NNNA 1G3WA 3SHFA 2ADUA 3NQOA 5FLXZ 3ELKA 3HSEA 5HDGA 1D5VA 2JZYA 5A2QK 5ED4A 1LEAA 2XAFA 3VB2A 2ZO4A 2M1BA 1PDNC 3K0LA 1IN8A 4EGYA 2K86A 2FNAA 3BDDA 3HOSA 1IN5A 3FXRA 2L4AA 2IVMA 2DAOA 1OYYA 3KE2A 2L3DA 1T2KA 1P4WA 3F6OA 5EEHA 5JI6A 2QBYB 5HLGA 2MBFA 1KQ8A 4UUVA 4ESBA 4HQEA 3ZPLA 3FXQA 4ENNA 1FT9A 3Q9VA 4LK1F 3KP3A 3J80K 5D6EA 3W6JB 4WX9A 1TW3A 1TQIA 2LSOA 4ZH4F 3SZTA 3LQRA 2QQBA 2K7LA 3T5XA 2GAUA 2KRFA 5ILSA 2E1CA 5E1WA 4LFUA 4ETSA 5BMZA 3U2RA 3HRSA 1AWCA 3KP2A 3IRQA 1IN7A 2CW0F 3F72A 4RAZA 1HXDA 2GIVA 3PQKA 5F6FA 2YU3A 5CVRA 3ZQ7A 1DP7P 4PZJA 2A5YB 1R5GA 3EQLF 1BOAA 3PQJA 2MA3A 4FX4A 1F4KA 4B8XA 4XBFA 2ZXJA 1U3EM 2EJRA 4XLNF 4I01A 2OQRA 1T38A 5H20A 1HKTA 4LK0F 1XMAA 3E6DA 4ESFA 2ISZA 4UHTA 5HS9A 5BS6A 2VOPA 1RIOH 2RDPA 4PGGA 2WC2A 2COMA 3K1MA 4P96A 1HW5A 1BI1A 4CO8A 1H9TA 4UV8A 3GUDA 5DCFA 4LLNA 4N9HA 4LB5A 3ZMZA 1J2XA 3GFJA 2A61A 2YPRA 2BV6A 2X0LA 1G4DA 4G6DA 5CLSA 5DUKA 3L00A 1YW7A 1XB4A 1JXSA 3V7RA 3ERED 3WTSC 5HS7A 1B6AA 1D3YA 1XDUA 4ZZDA 2H6BA 2DK5A 5DV5A 4LLLA 2IP2A 3DFGA 3JTGA 4NB5A 1BC8C 1LQ1A 2HDCA 3IL2A 2FE3A 1RZ4A 1XDSA 3M8EA 1J59A 4BHPA 2FMYA 2OZ6A 4F7ZA 5L3BA 2RQPA 4XSXF 2P5LC 3J81K 1PP7U 4L18B 2DQLA 2CWEA 4HX8A 1R22A 4RB1A 2LF7A 3K9TA 1XN7A 5FD5A 4ESJA 2W25A 4EMSA 3DF8A 1J9IA 2VN2A 5AONA 3OOPA 3HIFA 1RNLA 3LA2A 4FHTA 2FQ3A 2F2EA 3E97A 4BYYA 1X3UA 4NQWA 2KIUA 3C18A 4CZZA 3C3WA 1QQIA 2Z9OA 4IRGA 1STZA 1J7KA 1FSEA 3TGNA 4WXDA 3IHUA 2HQRA 4RB2C 4U7BA 3F8NA 4L9TA 1EV7A 2Z3YA 5HS8A 5D5XB 4S05A 2R7FA 3T8RA 1IXSB 3FHZA 1WRJA 2BE5F 1MJAA 4A0ZA 1E2XA 2DTRA 2CSOA 3ZMDA 4MTEA 3EYIA 2NRAC 3K1NA 4L5IA 4G6QA 1KQ0A 4G7OF 1XGSA 3LA7A 3AAFA 4GCVA 3HRUA 1BIBA 1FC3A 2DI3A 2ZMEA 1LB2A 1SAXA 3F3XA 3NRVA 1XMKA 3GLXA 3LWFA 1REPC 3PFIA 2NNYA 3CJNA 1U5TC 3IKTA 1LJ9A 4R79A 4BHBA 2O03A 5CYVA 2XV4S 4HX4A 1FP2A 1ZRCA 3FWEA 4G7HF 2PI0A 2VC1A 4HF0A 4ZYDA 3DXJF 3OV8A 5TJJA 5BQTA 2J5PA 5D4RA 1WI9A 2RGVA 3QRFF 4O5VA 1DDNA 3TOAA 1MDMB 1KU7A 2ZNYA 3DKWA 2XIGA 2XKPA 1XSVA 2HR3A 3MEXA 1S8NA 3IRRA 2XAHA 2EFNA 1UCRA 1HBXG 2MH9A 1J5YA 1FPQA 4HV5A 1FLIA 3HRTA 3S2WA 2P6TA 4A5MA 2FEZA 2HOEA 2O0YA 5K5OA 2CQKA 3KEQA 4HBLA 2QENA 4EQQA 1LVAA 4I7HA 3ZN1A 1W7PA 1TTYA 3QU3A 4K2EA 5EEGA 2FMLA 4I02A 1HQCA 2OZUA 2XROA 1Z6TA 4HX7A 1SFUA 3T1BA 2CO5A 1IRGA 3CUQB 1BM9A 5LHIA 3GFIA 4U88A 1G3TA 3FMQA 3IWZA 2A6HF 3RTRA 1GVJA 2IA1A 1ZYRF 5JFRA 3L9FA 2E1NA 3CO6C 5JVTA 4A0YA 5LEKA 4AIKA 3JAMZ 4Y15A 1LDJA 2FXAA 5J8CA 3MZHA 1SFEA 3CTAA 4Q48A 3BROA 2LNBA 2CGPA 1KQ9A 1UHWA 5J8FA 4NHJA 1FP1D 1R00A 4OIOF 2KKOA 4HYEA 2ZNZA 4LG0B 5D5VB 3WTVC 4AD9A 3EDPA 4M71A 1IXCA 2R3SA 4B09A 1UB9A 1ON1A 4OU0A 1BBYA 5LRRA 3BY6A 4O3MA 5D8KB 3GVAA 2IA2A 3LA3A 1RUOA 1BI0A 3Q9SA 1K6OA 2TDXA 4M9ZA 3HYIA 4FT8A 4KIFA 1LDKB 4TV7A 2HQNA 3LQQA 5KVRA 3IWFA 1IXRC 4BHCA 1T0FA 2W85A 2VOOA 3FZVA 1XSDA 3ZMSA 4IRHA 3RKYA 2QLZA 1YQAA 2O61A 1AOYA 1G6NA 1OYIA 1LNWA 1R1UA 4Q4ZF 1KU3A 2FRHA 3E5UA 1ZLKA 2X4HA 4I2OA 2RVCA 1TQPA 1B9NA 2BEOA 4HLXA 3V4GA 1V3FA 5D5UB 1YFHA 2L54A 1Z05A 2JPCA 5E8GA 3K2ZA 3GZ5A 2PFBA 4ZYEA 2R7DA 2CFXA 4M9XA 4YIFA 5D5WB 5ILVA 2VT3A 3WODF 2XAQA 4XRFA 1B59A 1P2FA 2KIMA 3B73A 3ECHA 4HV6A 4MQVA 1IF1A 2GWRA 1FY7A 5LGNA 4KN7X 1IRFA 4YIIA 4IPAA 1MZBA 3BJ6A 1B9MA 2M5WA 2RC4A 3E6CC 2O8XA 3P9KA 1USSA 1YW9A 3SQNA 4LMYA 4L9VA 3G3ZA 4MNUA 1CGPA 2QQ9A 3GF2A 4M73A 3RJPA 1SMTA 4L5JA 1CF7A 2IRFG 3L7WA 1G3SA 2EA2A 1CF7B 1BI3A 1HKQA 3H3ZA 1P4AA 1Y0UA 5CVIA 2EK5A 5LRSA 4N9IA 2PN6A 2FA5A 3BPXA 3JAMK 4CHUA 4L0ZB 3P9IA 3WGIA 5BPIA 2FNPA 5ILUA 3DPTA 3H92A 1R5HA 2JPBA 2V1UA 4S04A 2F5EA 3I53A 3JSOA 4GXOA 1S7OA 3WU1B 3REOA 2E7XA 3R0AA 1RUNA 4PGHA 1HW2A 3HHHA 1EH6A 5HLHA 2PLYA 1E17A 2DPDA 1Z6RA 2ELHA 4LD5A 2AS5F 3L2CA 4GO1A 1F1ZA 3GWZA 2Q2EA 4OIQF 2AXLA 4GGGA 4L0YB 4M6YA 1MJBA 4YFKF 4P9FA 5FFZA 2V1DA 3F8BA 2ZCWA 1OPCA 2EV5A 5JR3A 3FF5A 4CGZA 2XAJA 5AIQA 5DUIA 4AIHA 2XUBA 4LJZF 4IHTA 1T98A 2RKHA 5DCMA 2XAGA 2C6YA 4HLYA 4YFXF 4A5NA 2DPUA 3MQ0A 3TDUC 4YG2F 4XLPF 1Q1HA 2WWYA 3R0JA 2OA4A 2ESHA 2FBHA 2QYOA 3GZ6A 3R4KA 1S3JA 4ZZLA 1I27A 1JHFA 3CLOA 5FLXK 5HLIA 4CDGA 1HW1A 1FX7A 3QPHA 2FU4A 2WV0A 3R61A 1R36A 5ICEA 1U5TA 5JHUA 1GHCA 4AIJA 4P9UA 3M9AA 2EFQA 3GX4X 5BPDA 2LKPA 4IRIA 2K27A 4WCGA 2XHKA 3F22A 5L3DA 4M9SA 1ZRDA 2DK8A 3ABTA 2Y48A 5J6XA 2G9WA 2CYYA 1C0WA 2A6EF 4WK8F 5TRDA 1Z7UA 3I59A 4HAMA 1WKMA 4EGZA 3IKVA 1FWZA 3GFLA 1IAWA 2L4MA 5CVUA 3HRMA 3E6MA 1T39A 2L02A 1TLHB 1R7JA 4QLCU 4UXNA 1FBUA 2FF4A 3JSPA 1TQMA 5L3FA 4A0XA 2DBBA 1ZG3A 3HTUA 2UXNA 1HSTA 2Y75A 1ODDA 3ECOA 2V9VA 5ICCA 2ZMEB 5IT3A 1OR7A 3WTYC 1P92A 4A2UA 2O6GE 3BPVA 4EJUA 4BAYA 4A12A 2DQRA 1F5TA 3VOEA 4HQMA 2HWVA 3HUGA 4EJVA 2F5DA 4ON0A 3I0TA 4OIRF 3VODA 3RIRA 5L3GA 2ZBKA 1QNTA 5CVJA 3I5UA 1XCVA 5F64A 2W24A 4M74A 3SZPA 1U6GA 1BJAA 4WF2A 3BWGA 3VFZA 4OIPF 2GQQA 3GXOA 4UNOA 1KYWA 4UVBA 1QZZA 1ZARA 4KA4A 4KUMA 1ONVA 2NAZA 5FD6A 4KT5C 2A3SA 1JE8A 3JTHA 3WTXC 3KP4A 1Z9CA 5IT9Z 5LLQA 4Z2YA 4PCQA 1W4MA 2HTJA 3QAHA 3IC7A 2B0LA 4IHSA 2VONA 3QU6A 1IN6A 2YX7A 3KFWX 2H6CA 5A2QZ 3I54A 1P6RA 5LGUA 3RPUA 1SD4A 5E18F 2PJPA 4U0YA 1QBJA 3I64A 3HTSB 4MTDA 4P5OA 2D1HA 4N0BA 2P4WA 1DPRA 1W7PB 2OBPA 1R23A 3HSRA 2G7UA 1XSXA 3COAC 4I09A 3WGGA 4Q5SF 1OMIA 2OD5A 3ROUA 1KGSA 1FZPB 1TW2A 3ABUA 2HYFA 1I1GA 2K02A 4Y13A 2YX4A 3J80Z 3L09A 3WTUC 1MGTA 2XGXA 4KIGA 4DQ2A 2K4JA 3HHGA 1S29A 3K69A 1HSJA 2W57A 4KDPA 4MGRA 4CICA 4HF2A 2ZKZA 1W7PD 4HF1A 4HOBA 1J0RA 5K5RA 4ENKA 2WTEA 4WXCA 4U0WA 5ICGA 1O3TA 4LLGF 2QWWA 4G8XA 2DFIA 2VODA 3ZMTA 2G7HA 2YSRA 4RB3C 3DEUA 4IVNA 4KFCA 2DT5A 3LSTA 1IN4A 2A07F 5FO5A 3DP7A 3O6BB 4KMUX 5E1XA 1U78A 2VBZA 4AVPA 3CUOA 2J5OA 2MLGA 1VTNC 2V6CA 1SFXA 3VEPA 1BN5A 2QZ8A 2XASA 1ZG1A 4L9NA 3BOQA 2MH2A 5LGTA 2YR2A 1ZG5A 2M87A 4JQFA 1QGPA 1IUYA 2XVCA 2IT0A 3WG9A 4OMZA 4KIBA 1H0MA 2Z5UA 2FOKA 2H09A 4G7ZF 4ASNA 4EJWA 4GYGA 3ZP5A 5LHGA 2VBXA 1D8JA 2GA1A 3T0YA 1K78A 4G9YA 4ENJA 2VC0A 3I58A 1ZGAA 1K78B 2CG4A 2P5VA 3BZ6A 3DQVC 2A69F 3KCCA 1SD7A 4OINF 2M8EA 2PMHA 2EB7A 4KN4X 3TDZC 5E8IA 3QOPA 2PBIA 1YW8A 3B02A 2D45A 3TO9A 3R60A 3J81Z 1UFMA 1FYLA 2MC3A 1FYMA 2GA2A 2P6SA 4PDKA 5DD8A 1ON2A 4EJTA 5IT9K 5DDGA 5E17F 3KZYA 3CDHA 1ZH5A 2IA0A 4GYIA 1B1BA 3QP5A 2BYVE 4RGSA 1I6XA 3GEZA 2LDUA 4CYDA 3V7CA 2UWMA 2DO7A 2HEOA 2QBYA 5BOXA 2VXZA 3KLOA 1DPUA 1BI2A 3F23A 1EH7A 3SFZA 2QM3A 1WSUA 1ZREA 1U8RA 3R6SA 3RYRA 2Q0OA 2F5CA 1SD5A 1MD0A 4EM2A 3EUHA 4BXUA 5DD4A 1FYKA 4MEXF 5LHHA 1XGNA 2QQAA 1YS7A 1FNNA 4I98B 3HOTA 2PMUA 3O2PE 4RS8A 3FX3A 2KIFA 4IXAA 4Q47A 2L01A 1SD6A 3ML6A 1KU9A 1UHMA 1I1SA 2RNJA 3EETA 4P55A 1DUXC 5D8LB 4EM0B 4MEYF 2RN7A 2HTSA 5ERIA 3HSFA 4LGWA 2DW4A 3MAJA 1XD7A 1Z91A 3RPQA 1L0OC 2D1VA 2EA4A 2K4BA 1HKSA 4OMYA 1ZGJA 1S6LA 3RKWA 2XKOA 3F6VA 3V8LA 1A04A 4DNCA 1FOKA 3GYHX 3GO5A 4KMFA 2MLKA 2ZJ2A 3MZYA 4OOIA 1YO5C 3GW2A 6PAXA 3ISPA 4ENMA 3G73A 4EJOA 4HDUA 3WE2A 1LEBA 2KJBA 2PG4A 1WQ2A 1MKMA 5LEJA 5DCMB 4UV9A 2STWA 1QPMA 4H0EA 3O3KA 2E7WA 3FMSA 2UXXA 3MCZA 2ZFWA 3TOBA 2D2WA 1ZHFA 1BC7C 1TNSA 3I4PA 4QWQA 4XSZF 4RAYA 5E1ZB 4D0PA 3WGHA 5FB2A 3T8TA 2M45A 1ULYA 1TBXA 1OYWA 3QP6A 1Z1DA 2OQGA 5H6RA 4E70A 4CXFA 4UVAA 3V8JA 2ACJA 2GXBA 1U5TB 5H6QA 2VBWA 2MD5A 2Z33A 3KP6A 1U2WA 3DPLC 3RI4A 4EV0A 3TO7A 3TO6A 4RGUA 3F21A 1XGMA 3U1DA 4M72A 2RV8A 2HGCA 3N4MA 1D8KA 1K7AA 4RB0A 1O3SA 4O6JA 2JT1A 4MHGA 1PUEE 2DLLA 5CJ9A 1XGOA 3I59B 2ESNA 5K5QA 1I5ZA 4FX0A 4WXHA 1R1VA 5L3EA 1YLFA 1IZ1A 2P5KA 2H27A 3RKXA 5FGMA 4HW0A 3KETA 4U0VA 2EFPA 3D5LA 1XCBA 1B4AA 3F8CA 3WTTC 1QO0D 1NHAA 1O3QA 2W84A 2Y0MA 2IPQX 1GXQA 2V79A 3H3UA 1JHHA 2M30A
chains in the Genus database with same CATH superfamily
1FEXA 2HXOA 5M3FJ 5DYMA 2PQ8A 2EV6A 2X6XA 4HDVA 2Q8KA 3VSKA 1ZRFA 5JLWA 3E5XA 3TMOA 4R8HA 3RDIA 3L2WA 2RREA 1P4XA 5F1RA 3S1RJ 3HGYA 4JP0A 3AKZA 2XC7A 1WJDA 2PEXA 1E3PA 5F27A 5FKNA 2ETHA 2HFHA 2JTVA 4UUSB 4D7NA 4KYWA 1GDTA 2V1XA 3S32A 3BP8A 3HUGB 3RQ4A 2DTZA 3LAPA 2HPIA 2O8KA 3LFKA 5HDKA 3I4MJ 2JRTA 5HODA 3ZN0A 3WG7H 5ICFA 1O57A 2ZB9A 1LDDA 1YIOA 2CW8A 5BNGA 1EH8A 1ZAOA 4WWCA 1T08B 1L3LA 1EKEA 4RMNA 3JW4A 4HZFA 3K1PA 1GXPA 3LL7A 1YG2A 1OQYA 1QZEA 1R1TA 2WV1A 2ZXHA 3FXUA 1O7LA 3E5QA 3CC2I 1BIAA 3ESWB 5DEQA 2LF8A 3EYYA 2NS8A 1MJ9A 3V8KA 2FBKA 2QKLB 3WE3A 3OS2A 4C2UA 4I0BA 3WTWC 4NNJA 1X58A 1MDMA 3OYLA 3AFHA 1ORKA 4HG2A 2QVOA 3WHBA 2WAFA 3OIQA 4U7DA 2JVHA 2OJED 2LY9A 3FK6A 1Q1VA 3JRCA 3W6VA 2LOOA 1Y1VJ 1Y56A 2DN0A 4CCNA 2VE8A 1GV2A 2FJ1A 2Z99A 5HVQC 4L9JA 2BY1A 3CMEI 2XAUA 1K79A 4GDFA 3HPGA 3SXYA 3CCEI 2H94A 4F93B 2QUFA 3C7JA 2R5ZA 2BVLA 2EV0A 3L2RA 2A68F 2HKOA 3BJOA 2JQ7A 5CVVA 4PSXA 3MVPA 5D6FA 2ZMEC 2VBYA 3P7NA 2Y0SA 2EPFA 2P7VB 3ABLH 2CQ7A 2M4GA 4NC7A 3F8FA 2IS2A 2P7CB 2FQ4A 2QSGX 1VQLI 4E7JA 4MQ9F 3TQNA 3EUKL 3ZMVA 1USTA 4ZYGA 4XMYA 5K1YA 2AQEA 3MWMA 4BE1A 3N05A 5LBQA 2Z16A 4NC8A 2EFOA 3L2UA 3GFMA 3TKYA 4FETA 1WJEA 2XPUA 2L9VA 4R1HA 4BY7J 4DIQA 3Q5FA 1KA8A 2KISA 4RGRA 1JGGA 2JK3A 5FFXA 3ZMUA 2UZKA 1WFXA 1FBSA 1PVEA 3ULQB 4XRSA 3WU0A 3S3MA 3M7GA 3NARA 3RZDJ 5EZGA 4IF4A 2VE9A 1F43A 1O3RA 1J75A 4Y17A 3V7SA 2O3FA 4IHYA 1FSHA 1EF4A 3NAUA 4B4CA 2X85A 1YS6A 1WWXA 2FSWA 3CUQA 4ZYHA 4PJ0C 1ETYA 3RPUD 4JOMA 2PMZA 4QTRA 3IUOA 3FHNA 5DS9A 2EILH 2HS5A 1IC8A 1LKXA 3H5AA 3QPTA 2NS0A 1YTYA 2DOAA 5CKTA 1RI7A 3H0DA 1AU7A 3QODA 1A6QA 3KP7A 3O8HA 4I0AA 3WTZA 3W6KB 5M5YJ 2EFWA 1QZYA 2HKXA 2HQ5A 4KNYA 2R7QA 1JGSA 4C2TA 3LAJA 1V4RA 3HB9A 1DGWY 1F9NA 2CUFA 4A6EA 2XF6A 2GXGA 3E6BA 4M6XA 5F0CA 3OS1A 2PJRA 2H8RA 4BH9A 4MFEA 2H8WA 3PO2J 4LG3A 4XLAA 4AUXA 4RGXA 1W36C 3I71A 3U9GA 4W1UA 3MKWB 1SVOA 2HZTA 3DTKA 1W0TA 2BBYA 2LBFA 3J7AO 2DT7B 2DYRH 2P8TA 3A03A 4A3KJ 3FKIJ 3NWSA 1HOMA 3K4LA 3S2DJ 5L3CA 5KK1A 4LG0A 4JBAA 3NEUA 4ZTFA 1W5SA 5E20A 1FBQA 3KEOA 1KYZA 1MBJA 1MNMC 3F8MA 5AIPA 2XRNA 2GZWA 3HOUJ 4A6DA 1I50J 4BNCA 3FM3A 4YFNF 3SFIA 1YYVA 3RSNA 3RYPA 4B48A 2K9MA 2XGEA 2DU9A 3CJQB 3FMRA 4BQAA 2FBIA 2R5YA 1OKRA 4LB6B 2OAZA 1H9GA 3CUQC 1R49A 1XTAA 3KZZA 4BXFA 2FX0A 3BG7A 1S7AA 2VKVA 2EWNA 3M1EA 1TNTA 1PP8F 2GXAA 1IW7F 5E3NA 3N97A 1MW7A 1ZLJA 4QPOA 3BLYA 4FASD 2QCOA 3KP5A 3DCFA 3GZNB 3M8FA 1YX3A 2KJCA 2L7ZA 4RBOA 1G3YA 2STTA 1SMYF 3BJAA 1ZK8A 2DMNA 2JSCA 3KLNA 1Z77A 1T6SA 2IJLA 2CUZA 2A6TA 2F5FA 3MFKA 3J7AY 1E0EA 3ABMH 2IGOA 3DTIA 3CO7C 1MMGA 3CESA 4E7ZA 4J00A 3BG6A 2HOAA 2AXTC 3BT9A 4EM1A 1ZR4A 1T95A 5FKMA 1SANA 3ASNH 2V4JC 2HQAA 3D0SA 4G6TB 4G94A 1W5TA 5HNHA 4GFBA 4ZTJA 1TP4A 2DFHA 4UVCA 4YIRX 2NYXA 3P9CA 4EVIA 4HA8A 5M5WJ 3C1DA 3E3VA 4AWXB 1ZN2A 5J47A 2BY3A 2HYGD 1P7IA 1LE8B 5KCMA 3FM5A 1KU2A 2VT2A 5B3SH 3DV8A 1K4SA 2IW5A 1O7FA 4FE7A 4IJAA 5HOOA 2ISYA 4JK1X 2WY8Q 2BGCA 5D4SA 2M9HA 5HDNA 3PSIA 4H4KC 4KICA 1R58A 2OU2A 2NNNA 1G3WA 2XGDA 2KT0A 4J19A 4JYKA 4KITB 2WB1A 3BTLA 3SHFA 2ADUA 4DYCA 3NQOA 3VYRB 5FLXZ 3HG9A 3ELKA 3HSEA 4E7SA 3FDYA 5HDGA 1D5VA 2ICWG 2JZYA 5A2QK 4PJJA 5ED4A 5H2FC 1LEAA 2XAFA 2CW7A 3VB2A 2ZO4A 4M3FA 2NVUB 3CCYA 4XRSG 2M1BA 3Q0WA 3U21A 3ZCOA 1PDNC 2KQRA 2AQFA 2DYSH 4QIWN 2FOWA 2IS4A 3K0LA 1IN8A 1NG6A 4EGYA 3BDDA 2FNAA 2K86A 3SEZA 3HOSA 1IN5A 3OS0A 1B72B 3FXRA 3IAS2 2L4AA 1OFCX 3KYDB 2LP0A 4CYCA 2X1DA 2IVMA 5F04A 2DAOA 1OYYA 3KE2A 2R7SA 4CUGA 4CYCB 2L3DA 1T2KA 1P4WA 3F6OA 5EEHA 2F4MB 5JI6A 1T0FC 1WJ5A 2QBYB 5HLGA 1SVLA 4XONA 1G2HA 1PYVA 2MBFA 1KQ8A 4UUVA 4ESBA 4HQEA 3ZPLA 2NOGA 3FXQA 4AU7A 4ZJZA 4ENNA 4A3BJ 1FT9A 3Q9VA 1JKOC 4LK1F 3KP3A 2HVRA 3J80K 2EIJH 4XNFA 5D6EA 1G8XA 1TW3A 1TQIA 3W6JB 4WX9A 1XG1A 2LSOA 2MD0A 4ZH4F 1JTYA 2F6CA 3SZTA 2Y31A 4A3GJ 3LQRA 3CCLI 2QQBA 2K7LA 1Y1WJ 4ZDOA 3T5XA 2GAUA 2KRFA 5ILSA 2E1CA 2ECBA 3G6EI 3S3OA 5IP7J 3QPSA 5E1WA 4LFUA 4XLCA 4AYBN 4ETSA 5BMZA 3U2RA 3HRSA 1AWCA 1LPQA 3KP2A 3IRQA 2E71A 3FBIB 1IN7A 2CW0F 3F72A 4RAZA 2BW3B 1HXDA 3JCUC 3ERMA 1AHDP 1FIPA 2GIVA 3PQKA 5F6FA 2YU3A 5CVRA 4BE0A 2MFZA 1HDPA 3CF2A 3ZQ7A 2DT6A 2P81A 1DP7P 2FUG2 4PZJA 1VNDA 4X0GA 2A5YB 1QA6A 1R5GA 3E0JB 3LOCA 3EQLF 1BOAA 3OR2C 5J40A 3W2VA 3AL0C 3PQJA 3LSHA 5B66C 2MA3A 4FX4A 1F4KA 4B8XA 4XBFA 2ZXJA 1U3EM 2EJRA 4RLQA 2E2JJ 1ETXA 3CP8A 2R7OA 4XLNF 4DZJA 4YELA 4I01A 5K7FA 2OQRA 1T38A 5H20A 1HKTA 4JX4A 4LK0F 1XMAA 2DA1A 4XK4A 5FKOA 5K7HA 3E6DA 2JJ7A 4ESFA 1VFCA 2ISZA 3IAM2 4UHTA 5HS9A 5BS6A 3S1QJ 2VOPA 1RIOH 1FOWA 2RDPA 4PGGA 2F4OB 2WC2A 2TCTA 2COMA 2KZVA 3K1MA 2DCEA 4P96A 1HW5A 3Q0UA 1UG2A 1BI1A 4CO8A 1TWAJ 3GLLA 5M5XJ 1H9TA 4C9YA 3JRGA 4UV8A 3OY9A 1I6HJ 3GUDA 5DCFA 4LLNA 4XIDA 2CMPA 4N9HA 4LB5A 3ZMZA 1TT5B 1J2XA 3GFJA 2A61A 3JREA 4IHVA 5FJ8J 5F0HA 2YPRA 2BV6A 3BTJA 2K3FA 2H1LA 2X0LA 1G4DA 1WH5A 3PIPF 4G6DA 4LIUA 2R93J 5CLSA 5DUKA 2M8GX 3L00A 1YW7A 1GUUA 1XB4A 1JXSA 3V7RA 3ERED 1E3HA 2BXZA 3WTSC 2VL8A 5HS7A 1B6AA 5GPCA 1D3YA 1XDUA 4ZZDA 4CCMA 3C2BA 1IV8A 2H6BA 4GRIA 2DK5A 1VQMI 5DV5A 2M34A 3OYKA 4P1WA 4LLLA 2IP2A 3DFGA 3JTGA 3CZ6A 1YOVB 2VKDA 2DXIA 4NB5A 1BC8C 1LQ1A 2HDCA 3IL2A 2OF7A 2XB5A 2FE3A 2CU7A 1RZ4A 1XDSA 3BR5A 3MD2A 3M8EA 3W2AA 3A01B 1J59A 3CQZJ 3IH4A 3HKZA 4YEJA 4BHPA 2FMYA 2EH3A 3OSFA 5FRMA 3B6AA 2OZ6A 4F7ZA 2E5ZA 5L3BA 1W0UA 2RQPA 4XSXF 2P5LC 3J81K 4PSWA 1PP7U 2DQLA 4B44A 4L18B 2CWEA 5KAIC 3RCOA 2R0QC 3EPZA 4HX8A 1R22A 4RB1A 3K10A 4NC6A 2LF7A 3K9TA 5GPAA 1XN7A 5FD5A 4ESJA 2W25A 4XOPA 4EMSA 2BHYA 2X1CA 3VWBA 4CSWA 3DF8A 4Y3OA 3U1KA 2QA4I 3OYDA 1J9IA 2VN2A 5AONA 2HXIA 3OOPA 1T8IA 3HIFA 1DP3A 3RZOJ 1ETKA 1RNLA 3LA2A 4FHTA 1MIJA 2FQ3A 3X2QH 1A35A 5FROA 2F2EA 3E97A 4BYYA 1X3UA 1K6YA 5IOZA 4NQWA 4A69C 1IG7A 2KIUA 3C18A 4CZZA 3C3WA 3H0GJ 1F36A 4EATA 1QQIA 2Z9OA 4IRGA 2VJ4A 1STZA 3TEDA 2W82A 3TL4X 1APLC 1J7KA 1WI3A 3PM1A 1FSEA 3TGNA 4WXDA 3OOUA 3IHUA 2VXDA 1V54H 2HQRA 5EGOA 4II2A 4RB2C 3FISA 2KZGA 4U7BA 3F8NA 5IYCJ 1XX5A 3KZIC 4L9TA 1WJCA 1EV7A 2Z3YA 4RM3A 5HS8A 5D5XB 4S05A 2R7FA 3T8RA 1IXSB 2ID3A 1OCZH 3G1LA 1K4TA 2K9QA 3FHZA 1Y39A 2VB6A 1WRJA 2BE5F 3CCVI 1WGXA 1MJAA 5GP9A 1X1AA 4A0ZA 1E2XA 4DOZA 2DTRA 1NTCA 2X6WA 2CSOA 3OL4A 3ZMDA 2ZXIA 1UAAA 4MTEA 3EYIA 1WJAA 2NRAC 2V6EA 3G2BA 3K1NA 3LSJA 1X2MA 4L5IA 2VASA 1VQ5I 4G6QA 3DLLF 1KQ0A 2MSYA 4G7OF 1EJ9A 5CQGA 1XGSA 2KRHA 1TWHJ 3LA7A 4HPQA 3AAFA 3GMEA 4GCVA 3HRUA 4PFOA 1IRZA 4FE4A 1BIBA 1FC3A 2DI3A 2ZMEA 4AC0A 1LB2A 1SAXA 3HOVJ 3F3XA 3G1MA 3NRVA 1XMKA 3GLXA 3LWFA 4CH7A 1Y8QB 3PFIA 1REPC 4BJ5C 1R5ID 2NNYA 1H89C 3CJNA 1U5TC 2IS1A 3IKTA 1LJ9A 3OYGA 4R79A 4BHBA 1BR4A 2O03A 1X1CA 3K4MA 5CYVA 2XV4S 1EA3A 3ZQHA 1JUSA 4HX4A 1FP2A 4DBQA 1ZRCA 3FWEA 4XKBA 3HJEA 3BG3A 4G7HF 1D1AA 3S93A 1H88C 2PI0A 1FTZA 2Z2SB 4IEJA 1O4XA 2VC1A 3CCJI 5HNFA 4HF0A 4ZYDA 1A5JA 3DXJF 3OV8A 5TJJA 5BQTA 1POGA 2J5PA 5D4RA 1WI9A 2RGVA 4PJLA 4W97A 1MH4A 4O5VA 2V9PA 5EZHA 3QRFF 1JJ8C 1RESA 1DDNA 4CA0A 3TOAA 5HLTA 2Y69H 4B1RA 1MDMB 1QHGA 2ZFUA 1K83J 1KU7A 2ZNYA 1WH7A 4DBRA 3DKWA 4BL0B 1IJWC 2XIGA 1QPIA 2XKPA 3M3YJ 1XSVA 2HR3A 3MEXA 1U9OA 4Z6YA 3NWTA 1S8NA 3JRDA 1D1CA 4BBSJ 1YJNI 3B6CA 1B8IA 3IRRA 3CMMA 2XAHA 1YJWI 2EZLA 2JUCA 2EFNA 2R5ZB 1UCRA 1HBXG 2DFEA 2MH9A 1VQ7I 1J5YA 1FPQA 4HV5A 2E1MB 3HRTA 4C3HJ 5K7ZA 3HOXJ 3S2WA 1FLIA 2CQXA 3GTMJ 2P6TA 4U87A 2VKEA 4A5MA 1UELB 1VQKI 2Y30A 2FEZA 2YS9A 4B3XA 2HOEA 2O0YA 5K5OA 2X6YA 4A93J 5E3OA 2CQKA 4I6ZA 3AG3H 5DM7F 3I3LA 2E1OA 3KEQA 2LG4A 4HBLA 3DBHB 3IP4B 2QENA 4EQQA 1LVAA 4I7HA 1W7PA 3ZN1A 1TTYA 3QU3A 4K2EA 1IGNA 4HNUA 3ZQIA 2LRDA 2ZJQF 4ZC3A 1ENHA 1WJFA 5EEGA 2FMLA 3TBIA 2VQLA 4I02A 1HQCA 3M8JA 2JA2A 2OZUA 3ABKH 2XROA 1Z6TA 1PUFA 4HX7A 3LSGA 2UV1A 1SFUA 1DGRM 3T1BA 2CO5A 1IRGA 5JVGF 3SYTA 1MMNA 1VQNI 3CUQB 1BM9A 5GAGJ 5LHIA 3GFIA 1BJZA 1G3TA 3FMQA 4U88A 2IEKA 3IWZA 1D0ZA 5TGTA 1MMSA 2A6HF 3RTRA 1MBKA 4A3IJ 1GVJA 4UY8I 2IA1A 1ZYRF 5CQEA 3OL3A 2LMDA 1Z3YA 5JFRA 3LSMA 3L9FA 2YU9J 2E1NA 3CO6C 5C3EJ 5JVTA 3HC7A 1UZCA 2DODA 4A0YA 1MBGA 5LEKA 4AIKA 5IYDJ 3JAMZ 4A3FJ 4Y15A 2PJRB 1LDJA 1T33A 2M7AA 2FXAA 5J8CA 3MZHA 3BR1A 1MBHA 2EIKH 1SFEA 3CTAA 4CZCA 4Q48A 5J1YA 2EQRA 3BROA 2LNBA 2MG4A 2DMQA 1KQ9A 4BEHA 2CGPA 1UHWA 2LBFB 5J8FA 4MO7A 1D0XA 3ZQQA 2AHQA 2EZKA 4NHJA 1FP1D 1S9HA 1R00A 4OIOF 3PNVA 2KKOA 2M2EA 3FKJA 3DBRB 5FLVA 1I39A 3L2VA 1S7EA 4HYEA 2ZNZA 4LG0B 5D5VB 3WTVC 4KISA 2L2OA 2HVSA 4AD9A 4ZYAA 3EDPA 4M71A 1IXCA 2XB0X 2R3SA 1GLNA 1N75A 1UB9A 4B09A 5LD2C 1ON1A 3OYBA 3HL2A 4OU0A 1BBYA 4XKVA 5LRRA 3BY6A 3MMYB 1XS9A 4M3DA 2YUSA 2L9NA 5IP6A 4O3MA 1ERDA 2R5YB 5D8KB 3I55I 3GTGJ 1FTTA 1Y6IA 4BDYA 3GVAA 3G1OA 1BL0A 2IA2A 4XRMA 4YRVA 3LA3A 1RUOA 1BI0A 3G4SI 2DA6A 2ZC2A 3Q9SA 1K6OA 2TDXA 4M9ZA 3HYIA 2HDWA 1VQOI 2V26A 4FT8A 2MYSA 4KIFA 2CV1A 1LDKB 3JRAA 4TV7A 2HQNA 1UMQA 2UUZA 3LQQA 1YITI 5KVRA 1UHSA 1X3WB 3IWFA 4A3LJ 5EF6A 1IXRC 4F91B 4XN3A 5IP9J 4BHCA 5J4VA 1RRJA 2DJNA 1T0FA 2M3AA 2W85A 2VOOA 4AVZA 2Y0SN 3FZVA 3ZMSA 1XSDA 4IRHA 2DMPA 2QLZA 3RKYA 1SC7A 3W2WA 1YQAA 2O61A 1AOYA 1G6NA 1IRXA 1OYIA 3JRHA 3OSGA 1LNWA 1R1UA 4Q4ZF 1KU3A 2XSDC 2FRHA 4PUSA 3TW7A 2RAEA 3ZQGA 3E5UA 1ZLKA 2X4HA 2CV2A 2K9LA 4M3BA 3Q3SA 2NVYJ 4I2OA 2RVCA 1ZKGA 1LVKA 1TQPA 1B9NA 1E3OC 2BEOA 1HC8A 5J1UA 2ECCA 4HLXA 4PFPA 1W5CC 3V4GA 5FLMJ 1V3FA 1FJLA 2WAQA 5D5UB 1ITYA 1YFHA 2L54A 3SZGA 3ZRGA 1Z05A 1KONA 2JPCA 3BTCA 4IZZA 4G12A 2Q1ZB 5E8GA 3K70D 3K2ZA 3GZ5A 3VSLA 2PFBA 2EIMH 2R7WA 4ZYEA 1WPKA 2R7DA 2CFXA 2PMZN 4M9XA 4YIFA 1YIJI 5D5WB 5ILVA 2P0WA 2VQCA 2VT3A 2X6OA 2MW8A 2V7FA 3WODF 2XAQA 2QKMB 4M3EA 1B59A 4XRFA 1P2FA 2VJ5A 3AL0B 2KIMA 3MZ8A 3SDGA 1OCPA 3B73A 3ECHA 4HV6A 1OLTA 4MQVA 2GLOA 1V5FA 1IF1A 2K3PA 2B63J 4XN0A 4F55A 1TZLA 2GWRA 1FY7A 2XF5A 5LGNA 4KN7X 2COBA 1IRFA 4YIIA 4IPAA 1MZBA 2VUMJ 3BJ6A 4XKCA 4QSHA 5B1BH 1B9MA 2OPTA 4X6AJ 2EZIA 2M5WA 2RC4A 2JVGA 2NVXJ 3PNTA 3E6CC 2F48A 2KFDA 2O8XA 2AO9A 2CRGA 4MIMA 4DW6A 3QPLA 2ZSIB 3P9KA 1USSA 4F92B 2WA0A 5E79C 4IO9F 1YW9A 1R71A 1N77A 1MNEA 1YRNA 3SQNA 1V5GA 4LMYA 3MKZA 2V9KA 4L9VA 3G3ZA 4MNUA 1CGPA 1JI8A 2QQ9A 3GF2A 2M7BA 4M73A 3RJPA 1SMTA 3DPUA 2VQGA 3FK7A 3AG4H 4L5JA 3QYBA 1CF7A 2L9SA 2M0MA 2IRFG 3L7WA 1G3SA 2EA2A 2VJIA 1CF7B 1BI3A 1HKQA 3DWLE 3H3ZA 2NS7A 3SEQA 1HF0A 3OYAA 1P4AA 2R7TA 1Y0UA 4PJMA 5EG0A 2QSHX 5CVIA 3A2KA 2EK5A 5B5EC 5LRSA 3OYMA 4HRIA 4N9IA 1VZ0A 3S8PA 4BQNA 2PN6A 2FA5A 2QF7A 3BPXA 4ANJA 2W4SA 3GTLJ 3S16J 4HEA2 3JAMK 4CHUA 4L0ZB 2W7NA 3P9IA 3WGIA 5BPIA 1RR7A 2DDAA 2FNPA 2OCCH 5ILUA 3DPTA 5IY5H 5DM6F 9ANTA 3H92A 1R5HA 2JPBA 2V1UA 4S04A 4A3JJ 2LKSA 4KT6A 2F5EA 3I53A 3FIWA 2LFBA 1YE9A 3ASOH 3K4CA 3JSOA 1R4MB 4GXOA 2KL4A 3MKYB 1S7OA 3WU1B 3REOA 1BR1A 2FD5A 3E7LA 2E7XA 3R0AA 4E6KG 1RUNA 3BR3A 4PGHA 1HW2A 1P7JA 1TC3C 3HHHA 1AA7A 1EH6A 5HLHA 2PLYA 2DOEA 1E17A 2DPDA 1OCTC 1IO2A 3KX2A 1Z6RA 2ELHA 3HEFA 2HI3A 4LD5A 1VQ8I 2AS5F 1D5YA 2E2IJ 4BQQA 3L2CA 4GO1A 3GTPJ 1F1ZA 3GWZA 2LY2A 2Q2EA 2CJJA 4XLHA 2BXYA 4OIQF 3LSKA 3ZR8X 2AXLA 1NK2P 4BE2A 4GGGA 3K4KA 4L0YB 4BBRJ 4M6YA 1MJBA 4YFKF 4P9FA 1G59A 2XRLA 5FFZA 2V1DA 2DMTA 3F8BA 4RAFA 2ZCWA 1AKHA 3ZOBA 3CC4I 4XM3A 1QHHD 1Z67A 3BG9A 1OPCA 3HOWJ 2EV5A 2GIZA 3L1PA 5JR3A 3FF5A 3JRIA 5DTDA 4CGZA 2XAJA 3HZJA 2WB1N 3H9JA 4RAGA 5AIQA 5DUIA 4AIHA 2XUBA 3PSFA 3OWTA 4LJZF 3OYHA 4IHTA 1T98A 3OIPA 2QGUA 3UNGC 4Y4RA 2RKHA 5DCMA 1QU3A 5IYBJ 1X4OA 2XAGA 2XPWA 2OUMA 2C6YA 3BQZA 3UR3C 4HLYA 3AG2H 4YFXF 4A5NA 3KEYA 2DPUA 2VQHA 4B43A 3MQ0A 3JR9A 3I56I 3TDUC 4XOTA 2KRCA 1FIAA 1OISA 4YG2F 4IQ4A 4XLPF 1LFPA 1Q1HA 2ME0A 3CDIA 2WWYA 3R0JA 2JSPA 2OA4A 2ESHA 1LUJB 1Z0XA 2L7FP 5C4XJ 2VI6A 2VPLA 2I8DA 2ZJPF 2FBHA 2QYOA 3GZ6A 3O8GA 4OAZA 3R4KA 3OIOA 1S3JA 4ZZLA 3CCQI 1I27A 3CLQA 1JHFA 2GOMA 3CLOA 5FLXK 3Q0VA 2W1OA 2N8GA 5HLIA 4CDGA 1HW1A 1FX7A 2X51A 2Y9ZA 3QPHA 3VPRA 4BJTA 4Y7NJ 2FU4A 2WV0A 3R61A 1R36A 4RA2A 5ICEA 1U5TA 2ME6A 3DEEA 2WBMA 3CCMI 5JHUA 1GHCA 4AIJA 2KLOA 1WJBA 4P9UA 2ELJA 2WY7Q 4NQWB 3PUFA 2R4GA 2LTPA 2K85A 2EFQA 3M9AA 4L5EA 3GX4X 2JA6J 5BPDA 2LKPA 4CCLA 4IRIA 2K27A 4WCGA 1J09A 1H8AC 2XHKA 3QYEA 4DGWB 2KDZA 3F22A 5L3DA 4M9SA 2IBDA 4Y33A 2DA7A 4BKXA 1OCRH 1ZRDA 2BZTA 4N4NB 2DK8A 2ELKA 2Y48A 3ABTA 5J6XA 5EGOB 5GAHJ 4PJNA 5FKLA 2G9WA 2GBYA 2CYYA 1C0WA 5FRNA 2A6EF 4WK8F 2HVQA 2R7VA 4XQFA 5TRDA 1Z7UA 3DLAA 3I59A 4HAMA 1WKMA 2OTJI 4EGZA 3IKVA 1Z21A 1ZTRA 1FWZA 3GFLA 1IAWA 2L0KA 4JX5A 2L4MA 4D1QA 2H1KA 5CVUA 1D1BA 2WADA 3HRMA 1JT0A 1OCCH 4J01A 3E6MA 1T39A 3BR0A 4IOAF 1ETQA 2L02A 2VIXA 1TLHB 1R7JA 4NUBA 4QLCU 4UXNA 2HPMA 4A3CJ 5F08A 1FBUA 2FF4A 2CFOA 4BU2A 3JSPA 3LNQA 1YJ9I 3WHCA 2LC2A 1TQMA 3SJMA 1IV6A 4RM2A 5L3FA 2EBIA 4A0XA 2DBBA 2Z1DA 2ZXWH 2W00A 1ZG3A 1RPWA 1JTXA 3HTUA 2K9SA 1Y8RB 2UXNA 1HSTA 2L7KA 4BUPA 3PFYA 2Y75A 4E4HA 1ODDA 3ECOA 2V9VA 2IS6A 3ZQFA 5ICCA 3LMMA 2ZMEB 5IT3A 3GTQJ 2EINH 3LFUA 2R7RA 1OR7A 3WTYC 1VQ4I 1P92A 4A2UA 2E19A 4D9JA 2O6GE 4OAYA 4RLFA 3BCBA 1HA8A 3BPVA 4IHWA 3CC7I 4EJUA 2X1EA 3ZXSA 4BAYA 3KPHA 4A12A 4BACA 4E7HA 3TP3A 1X1PA 2DQRA 4UUSA 1F5TA 3VOEA 4HQMA 2HWVA 2LREA 3I9V2 3HUGA 3MN2A 4EJVA 3A0HC 2CQNA 2F5DA 4AM3A 4ON0A 3I0TA 1X3ZB 4OIRF 3VODA 1WZ2A 3RIRA 4BS9A 1IDZA 2HDDA 5L3GA 5J3LA 2ZBKA 3PIOF 2CUEA 1QNTA 5CVJA 3H35A 1XCVA 3I5UA 4BDZA 5F64A 4UB8C 1NK3P 2W24A 4M74A 3SZPA 1U6GA 3GTOJ 2F5VA 1BJAA 2QQ8A 3DKYA 4F3QA 4WF2A 3CJRB 3C2GA 3BWGA 2OV7A 4IHXA 4C2MJ 2HYJA 3VFZA 4OIPF 5KHDA 2GQQA 3GXOA 3FXKA 3OYIA 4UNOA 1KYWA 4UVBA 3HKZN 1QZZA 1ZARA 4LIVA 5CPRB 4JX6A 4KA4A 1S72I 5GADJ 5LFAA 4KUMA 5GTIC 3JRBA 2NVQJ 1FMWA 1ONVA 2NAZA 5FD6A 4KT5C 1RKWA 2A3SA 1VQPI 1R4NB 1JE8A 1RKTA 3PL8A 4F52A 3OMYA 4A3MJ 4C3JJ 3JTHA 3WTXC 2O9LA 3KP4A 1Z9CA 5IT9Z 1HLVA 1B8IB 5LLQA 4Z2YA 2DOFA 4PCQA 1W4MA 3BR6A 2HTJA 3QAHA 3S1NJ 2BY0A 3IC7A 3PUBA 2B0LA 4IHSA 2VONA 3QU6A 3BCAA 1IN6A 2CV0A 3CD6I 1OR7C 3HGGA 2YX7A 3KFWX 2PX9A 2H6CA 5A2QZ 3I54A 2HOTA 1P6RA 2BY2A 1A6IA 5LGUA 3RPUA 2K9NA 1SD4A 5E18F 2PJPA 4U0YA 4FCYA 4DZPA 3H1CA 3GTKJ 1QBJA 1KZHA 3I64A 1MBEA 1BOBA 3S14J 2IGKA 3RKQA 3HTSB 4V2FA 4MTDA 4P5OA 2D1HA 4N0BA 1A31A 2P4WA 1DPRA 2I5UA 2W48A 5E3LA 2LVSA 1W7PB 2JN6A 2OBPA 1R23A 3HSRA 2G7UA 2MGQA 2ZSHB 2HU9A 3HBLA 2OCEA 1JUMA 3DBLB 3K4NA 1XSXA 3COAC 4I09A 3WGGA 4Q5SF 1OMIA 2OD5A 3ROUA 4IQJA 2DJIA 4FTHA 1KGSA 3BQYA 1FZPB 2Y2ZA 1PUFB 1TW2A 3ABUA 2HYFA 2E35A 1W36D 1I1GA 2K02A 4I99C 1QVUA 4QPQA 4Y13A 2YX4A 3J80Z 3L09A 3WTUC 1MGTA 2XGXA 2NVTJ 4KIGA 4DQ2A 4BXXJ 2K4JA 3HHGA 3PNYA 1S29A 4LOCA 4CCKA 2M4KA 1NH3A 1BR2A 3J7ZI 3K69A 2B9SA 2E36A 1HSJA 2W57A 3BZCA 4BQOA 1WHUA 4KDPA 4V2GA 4MGRA 3LSIA 4CICA 1BA5A 5F1JA 3TW6A 4HF2A 2ZKZA 1W7PD 4HF1A 4HOBA 1J0RA 4UUTA 4B47A 5K5RA 5KAFC 2G0EA 4ENKA 2WTEA 4WXCA 4U0WA 1WVRA 5ICGA 4LLGF 2QWWA 1O3TA 4B3AA 4G8XA 4XLFA 3OR1C 4XICA 2DFIA 2VODA 3ZMTA 2G7HA 2YSRA 2E1MC 4RB3C 2R7ZJ 3DEUA 4IVNA 4CCOA 2Y9YA 2IAIA 4BEHB 1P9QC 4KFCA 3A02A 2DT5A 2DA3A 1IN4A 3LSTA 2A07F 5FO5A 1N25A 3DP7A 3O6BB 1Z7LA 1HCRA 2DDBA 4KMUX 3S3NA 1FOXA 5E1XA 1X4PA 3H5NA 1U78A 2VBZA 4AVPA 3K7AJ 4I76A 1X2NA 3CUOA 4IKFA 1TWFJ 2J5OA 2MLGA 3QQAA 3H9GA 4XORA 1VTNC 2V6CA 1SFXA 1MSEC 3VEPA 1BN5A 2QZ8A 2XASA 3K4BA 1ZG1A 1SVMA 1WCMJ 3CDLA 1ACIA 1OCOH 4L9NA 3BOQA 4MLOA 2MH2A 4AYBA 3BG5A 5LGTA 2YR2A 1ZG5A 2M87A 3VDXA 4JQFA 1QGPA 1IUYA 2XVCA 2IT0A 3WG9A 4OMZA 4KIBA 4UB6C 1H0MA 2Z5UA 1N78A 3HOYJ 4X1EA 4KJZA 1YHQI 2FOKA 2H09A 4DYQA 2IXSA 4C3IJ 3QWLA 4G7ZF 3GBGA 1K61A 1GVDA 4ASNA 4EJWA 4GYGA 3ZP5A 5C4JJ 5LHGA 2VBXA 3VYSB 1D8JA 2GA1A 4AIDA 3T0YA 1K78A 5EYRA 4G9YA 4ENJA 4XR6A 2VC0A 4NDLA 3HDDA 5E3MA 3I58A 1ZGAA 1K78B 2CG4A 3S2HJ 2P5VA 2R92J 3BZ6A 2JA7J 3OYNA 2JA8J 3ZQLA 2XF7A 2MABA 3DQVC 4EEFG 1TL8A 2A69F 2LLKA 5EJCA 3G71I 2CUJA 1DQUA 2KIQA 3KCCA 1SD7A 1TWGJ 3KYCB 2RNGA 4IX7A 2A05A 5EDNA 4OINF 2M8EA 2PMHA 2D5VA 3CP2A 2EB7A 3FBNB 4ITVA 4KN4X 1LE8A 3F0CA 3CJTB 3TDZC 5E8IA 3QOPA 2XSJC 2XPVA 5KNLA 3KIOA 2PBIA 1YW8A 3B02A 1T56A 2D45A 3TO9A 1X1BA 5C44J 3QYFA 3R60A 3J81Z 1UFMA 1FYLA 1X19A 2MC3A 3FXLA 1SFOJ 1FYMA 1GT0C 2GA2A 5TISC 1QVTA 5B1AH 1RC9A 2P6SA 4PDKA 5DD8A 1ON2A 4EJTA 1V55H 1CQTA 5IT9K 3W3CA 5DDGA 3ZQCA 5E17F 5F0FA 3KZYA 3H3VK 3CDHA 1ZH5A 2B7EA 2IA0A 1S5LC 2ID6A 1FOYA 2DMUA 3V42A 4HNVA 4GYIA 1B1BA 3QP5A 3FXMA 5M3MJ 2X9DA 4Y52J 1MH3A 4RDUA 1GV5A 3ONQA 2KP6A 3EUAA 1B72A 2BYVE 4RGSA 1LFBA 2HOSA 1I6XA 1ZQ3P 3GEZA 1XMXA 2LDUA 3GCMA 4IL6C 4CYDA 3CCSI 3QOEA 3DKXA 3C2HA 3DU5A 4C30A 4IOCF 3V7CA 3K70C 1MNDA 2UWMA 2DO7A 3KYLA 2HEOA 3S1MJ 3PJRA 2QBYA 5BOXA 2VXZA 2VPRA 3KLOA 1DPUA 4E7IA 1YRNB 3HOZJ 1BI2A 3HM5A 4CCJA 3F23A 4DJAA 1EH7A 2CS3A 3IH2A 3SFZA 2VLAA 2QM3A 1WSUA 4D5FA 1ZREA 1SAUA 2X48A 1U8RA 3R6SA 3RYRA 2DA5A 2Q0OA 2JA5J 2HNHA 5GTHC 2F5CA 1SD5A 1MD0A 4EM2A 3LSRA 3EUHA 4ABZA 4BXUA 3K4JA 1MMDA 3HPHA 1W1WE 1ZELA 5EG0B 5DD4A 1FYKA 4MEXF 2JMWA 2ZJRF 4XKWA 2L9RA 5LHHA 1XGNA 2QQAA 3K2AA 1R9TJ 2IGMA 3M07A 2R7XA 1YS7A 5GAEJ 2DA4A 1FNNA 2BW3A 4I98B 3HOTA 1SEUA 2PMUA 1ETOA 3DEWA 3O2PE 4RS8A 3FX3A 4V19K 2K5CA 2KIFA 4IXAA 4Q47A 3S17J 2MC4A 2L01A 3H9QA 1SD6A 3FXJA 2KMUA 3ML6A 1KU9A 2WAEA 1UHMA 1RETA 4S0HB 1I1SA 2RNJA 3EETA 1XPXA 4P55A 3BTIA 1DUXC 1XC5A 5JLXA 1V5EA 5D8LB 4EM0B 3D5RC 4MEYF 2RN7A 2LY1A 2HTSA 2KDOA 3E1SA 4OWRB 3HSFA 4LGWA 2XGCA 4M6VA 2DW4A 5ERIA 3TP0A 5IOYA 3H5RA 3MAJA 1XD7A 1D0YA 1Z91A 3RPQA 1L0OC 2D1VA 2EA4A 2OC6A 2K4BA 1HKSA 1IDYA 4II3A 4OMYA 1ETVA 3M1CA 2R7UA 1ZGJA 1S6LA 3RKWA 1BW5A 1JUPA 2XKOA 2JUGA 3F6VA 3V8LA 4FISA 1A04A 4DNCA 1JJ6C 3H36A 3VYUB 2Q2EB 3GYHX 1FOKA 3PO3J 3GO5A 4KMFA 1QRYA 2MLKA 2TRTA 1YI2I 2DFFA 2ZJ2A 3MZYA 1DU0A 4OOIA 2BHZA 1YO5C 1VQ6I 3GW2A 3EUHC 3CF5F 1I3AA 1AKHB 3JRFA 1MMAA 3DTEA 3IV5A 3ISPA 6PAXA 2WAQN 2O5RA 1DU6A 3FXOA 2K40A 4PK4A 1PJRA 1IUFA 4ENMA 3G73A 5EEAA 4EJOA 4HSTA 2IGNA 1A36A 1Z3XA 4HNTA 3CMYA 4HDUA 4ZDLA 2HZDA 3RQIA 3WE2A 3ZGKA 1TT0A 3S15J 1LEBA 1RR8C 4M3GA 2DA2A 2KJBA 4NBQA 4BY1J 2PG4A 3J7YJ 2GM4A 1WQ2A 1MKMA 3GTJJ 5LEJA 5DCMB 4A3EJ 2E5NA 2GOXB 1QPMA 3DU6A 4UV9A 2STWA 4H0EA 1MBFA 1UG0A 4FQGA 1TWCJ 3O3KA 2L5QA 2BOLA 2E7WA 2LD5A 1JKPC 2F4IA 2JWTA 3FMSA 2UXXA 3MCZA 2ZFWA 1JKRC 4E7LA 3BZKA 2VJJA 3A4CA 3TOBA 1JKQC 3F9KA 1MSFC 2D2WA 1ZHFA 2E60A 1BC7C 1TNSA 2LK2A 1BW6A 3I4PA 4QWQA 1JT6A 1R6RA 2LYCA 2RQQA 4MFDA 2V1NA 4RAYA 4XSZF 5E1ZB 4D0PA 3WGHA 3A01A 3BC8A 4XLEA 5FB2A 3T8TA 2M45A 5FKKA 1ZR2A 1ULYA 1TBXA 1OYWA 3QP6A 3M4OJ 1Z1DA 4D5CA 1Y0NA 3A1YA 2OQGA 5H6RA 4E70A 2LR8A 5J4YA 2LKXA 3OYFA 1ZGWA 4CXFA 2I10A 4UVAA 2QEXI 2O7OA 5IPAA 3D1NI 2E2HJ 3WU2C 3V8JA 2ACJA 2GXBA 1U5TB 5JHFA 3OYEA 5H6QA 1VI0A 2VBWA 2MD5A 4DYRA 2BVMA 3OYJA 1U9NA 3KP6A 2Z33A 4E7KA 1VQ9I 3CMAI 2JRMA 1U2WA 4BGDA 3OYCA 3I4NJ 1M1EB 2NXNB 3DPLC 4XL9A 4EV0A 3RI4A 4N4OB 3TO7A 1X1DA 3SDBA 3TO6A 4A3DJ 2OTLI 4RGUA 3AG1H 3F21A 1U8BA 2EZHA 3MKLA 1XGMA 3U1DA 4M72A 2RV8A 2M0CA 2HGCA 2E34A 4BJ6C 3N4MA 1LFUP 1D8KA 1SFKA 3P5JA 1K7AA 2CQQA 4RB0A 1O3SA 1NG7A 2JT1A 1FMVA 4O6JA 4MHGA 1PUEE 2DLLA 5CJ9A 1XGOA 2XDVA 3HXLA 3I59B 2ESNA 5K5QA 4LITA 1I5ZA 3D5SC 4FX0A 4WXHA 3CCUI 4ZDPA 1R1VA 3VYTB 3BR2A 5L3EA 1YLFA 1IZ1A 2P5KA 2H27A 3LSPA 1HDDC 1YX5A 3RKXA 2NOJB 2VKHA 1OJLA 2KPMA 3K6GA 5FGMA 5J1RA 3L2QA 2LH9A 4D7MA 4HW0A 4U0VA 2KHMA 3D5LA 2EFPA 1XCBA 3IH3A 1B4AA 3KETA 3F8CA 3WTTC 3A0BC 1QO0D 1NHAA 1U0JA 3UKGA 1O3QA 1I3QJ 1VF9A 1ETWA 2L7MP 3CCRI 2W84A 2Y0MA 2IPQX 1GXQA 4HSRA 2A5WA 1UJ8A 2CH0A 2V79A 3H3UA 1JHHA 2M30A 2QSFX
chains in the Genus database with same CATH topology
5DYMA 2PQ8A 2EV6A 4HDVA 2Q8KA 1ZRFA 3E5XA 4R8HA 3RDIA 1P4XA 5F1RA 2PEXA 2ETHA 2HFHA 2JTVA 4KYWA 2V1XA 3BP8A 3LAPA 3LFKA 5HDKA 2JRTA 3ZN0A 5ICFA 1O57A 1LDDA 1YIOA 4WWCA 1EH8A 1ZAOA 1L3LA 3JW4A 4HZFA 3K1PA 1GXPA 1YG2A 1R1TA 3FXUA 1O7LA 3E5QA 1BIAA 5DEQA 2LF8A 3EYYA 1MJ9A 3V8KA 2FBKA 3WE3A 4I0BA 3WTWC 1MDMA 2QVOA 4U7DA 2VE8A 2Z99A 5HVQC 4L9JA 1K79A 3SXYA 2H94A 2QUFA 3C7JA 2EV0A 2A68F 2HKOA 3BJOA 5CVVA 5D6FA 2VBYA 3P7NA 2P7VB 3F8FA 2P7CB 4MQ9F 3TQNA 4ZYGA 3ZMVA 1USTA 5K1YA 3MWMA 5LBQA 2EFOA 3GFMA 3TKYA 4R1HA 3Q5FA 1KA8A 4RGRA 5FFXA 3ZMUA 2UZKA 1FBSA 3ULQB 3WU0A 3M7GA 4IF4A 2VE9A 1O3RA 1J75A 4Y17A 3V7SA 2O3FA 1FSHA 1YS6A 1WWXA 2FSWA 3CUQA 4ZYHA 2HS5A 3QPTA 2NS0A 1YTYA 1RI7A 3KP7A 4I0AA 3WTZA 3W6KB 2EFWA 1QZYA 2HKXA 4KNYA 1JGSA 3LAJA 1V4RA 1F9NA 4A6EA 3E6BA 2GXGA 4M6XA 4BH9A 4RGXA 3I71A 3U9GA 2HZTA 2BBYA 3J7AO 2P8TA 5L3CA 5KK1A 4LG0A 4JBAA 3NEUA 1W5SA 5E20A 1FBQA 3KEOA 1KYZA 3F8MA 5AIPA 2XRNA 2GZWA 4A6DA 4BNCA 3FM3A 4YFNF 1YYVA 3RYPA 4BQAA 2DU9A 3FMRA 2FBIA 1OKRA 4LB6B 2OAZA 1H9GA 3CUQC 3KZZA 1S7AA 2EWNA 3M1EA 1TNTA 1PP8F 1IW7F 3N97A 1ZLJA 3KP5A 3M8FA 2KJCA 2STTA 1G3YA 1SMYF 3BJAA 2JSCA 3KLNA 3MFKA 1T6SA 2IJLA 2F5FA 3CO7C 4EM1A 3D0SA 4G94A 1W5TA 4UVCA 2NYXA 3P9CA 4EVIA 4HA8A 3C1DA 3E3VA 4AWXB 1ZN2A 2HYGD 3FM5A 1KU2A 2VT2A 3DV8A 2IW5A 1O7FA 4IJAA 5HOOA 2ISYA 4JK1X 2BGCA 5D4SA 5HDNA 4KICA 1R58A 2OU2A 2NNNA 1G3WA 3SHFA 2ADUA 3NQOA 5FLXZ 3ELKA 3HSEA 5HDGA 1D5VA 2JZYA 5A2QK 5ED4A 1LEAA 2XAFA 3VB2A 2ZO4A 2M1BA 1PDNC 3K0LA 1IN8A 4EGYA 2K86A 2FNAA 3BDDA 3HOSA 1IN5A 3FXRA 2L4AA 2IVMA 2DAOA 1OYYA 3KE2A 2L3DA 1T2KA 1P4WA 3F6OA 5EEHA 5JI6A 2QBYB 5HLGA 2MBFA 1KQ8A 4UUVA 4ESBA 4HQEA 3ZPLA 3FXQA 4ENNA 1FT9A 3Q9VA 4LK1F 3KP3A 3J80K 5D6EA 3W6JB 4WX9A 1TW3A 1TQIA 2LSOA 4ZH4F 3SZTA 3LQRA 2QQBA 2K7LA 3T5XA 2GAUA 2KRFA 5ILSA 2E1CA 5E1WA 4LFUA 4ETSA 5BMZA 3U2RA 3HRSA 1AWCA 3KP2A 3IRQA 1IN7A 2CW0F 3F72A 4RAZA 1HXDA 2GIVA 3PQKA 5F6FA 2YU3A 5CVRA 3ZQ7A 1DP7P 4PZJA 2A5YB 1R5GA 3EQLF 1BOAA 3PQJA 2MA3A 4FX4A 1F4KA 4B8XA 4XBFA 2ZXJA 1U3EM 2EJRA 4XLNF 4I01A 2OQRA 1T38A 5H20A 1HKTA 4LK0F 1XMAA 3E6DA 4ESFA 2ISZA 4UHTA 5HS9A 5BS6A 2VOPA 1RIOH 2RDPA 4PGGA 2WC2A 2COMA 3K1MA 4P96A 1HW5A 1BI1A 4CO8A 1H9TA 4UV8A 3GUDA 5DCFA 4LLNA 4N9HA 4LB5A 3ZMZA 1J2XA 3GFJA 2A61A 2YPRA 2BV6A 2X0LA 1G4DA 4G6DA 5CLSA 5DUKA 3L00A 1YW7A 1XB4A 1JXSA 3V7RA 3ERED 3WTSC 5HS7A 1B6AA 1D3YA 1XDUA 4ZZDA 2H6BA 2DK5A 5DV5A 4LLLA 2IP2A 3DFGA 3JTGA 4NB5A 1BC8C 1LQ1A 2HDCA 3IL2A 2FE3A 1RZ4A 1XDSA 3M8EA 1J59A 4BHPA 2FMYA 2OZ6A 4F7ZA 5L3BA 2RQPA 4XSXF 2P5LC 3J81K 1PP7U 4L18B 2DQLA 2CWEA 4HX8A 1R22A 4RB1A 2LF7A 3K9TA 1XN7A 5FD5A 4ESJA 2W25A 4EMSA 3DF8A 1J9IA 2VN2A 5AONA 3OOPA 3HIFA 1RNLA 3LA2A 4FHTA 2FQ3A 2F2EA 3E97A 4BYYA 1X3UA 4NQWA 2KIUA 3C18A 4CZZA 3C3WA 1QQIA 2Z9OA 4IRGA 1STZA 1J7KA 1FSEA 3TGNA 4WXDA 3IHUA 2HQRA 4RB2C 4U7BA 3F8NA 4L9TA 1EV7A 2Z3YA 5HS8A 5D5XB 4S05A 2R7FA 3T8RA 1IXSB 3FHZA 1WRJA 2BE5F 1MJAA 4A0ZA 1E2XA 2DTRA 2CSOA 3ZMDA 4MTEA 3EYIA 2NRAC 3K1NA 4L5IA 4G6QA 1KQ0A 4G7OF 1XGSA 3LA7A 3AAFA 4GCVA 3HRUA 1BIBA 1FC3A 2DI3A 2ZMEA 1LB2A 1SAXA 3F3XA 3NRVA 1XMKA 3GLXA 3LWFA 1REPC 3PFIA 2NNYA 3CJNA 1U5TC 3IKTA 1LJ9A 4R79A 4BHBA 2O03A 5CYVA 2XV4S 4HX4A 1FP2A 1ZRCA 3FWEA 4G7HF 2PI0A 2VC1A 4HF0A 4ZYDA 3DXJF 3OV8A 5TJJA 5BQTA 2J5PA 5D4RA 1WI9A 2RGVA 3QRFF 4O5VA 1DDNA 3TOAA 1MDMB 1KU7A 2ZNYA 3DKWA 2XIGA 2XKPA 1XSVA 2HR3A 3MEXA 1S8NA 3IRRA 2XAHA 2EFNA 1UCRA 1HBXG 2MH9A 1J5YA 1FPQA 4HV5A 1FLIA 3HRTA 3S2WA 2P6TA 4A5MA 2FEZA 2HOEA 2O0YA 5K5OA 2CQKA 3KEQA 4HBLA 2QENA 4EQQA 1LVAA 4I7HA 3ZN1A 1W7PA 1TTYA 3QU3A 4K2EA 5EEGA 2FMLA 4I02A 1HQCA 2OZUA 2XROA 1Z6TA 4HX7A 1SFUA 3T1BA 2CO5A 1IRGA 3CUQB 1BM9A 5LHIA 3GFIA 4U88A 1G3TA 3FMQA 3IWZA 2A6HF 3RTRA 1GVJA 2IA1A 1ZYRF 5JFRA 3L9FA 2E1NA 3CO6C 5JVTA 4A0YA 5LEKA 4AIKA 3JAMZ 4Y15A 1LDJA 2FXAA 5J8CA 3MZHA 1SFEA 3CTAA 4Q48A 3BROA 2LNBA 2CGPA 1KQ9A 1UHWA 5J8FA 4NHJA 1FP1D 1R00A 4OIOF 2KKOA 4HYEA 2ZNZA 4LG0B 5D5VB 3WTVC 4AD9A 3EDPA 4M71A 1IXCA 2R3SA 4B09A 1UB9A 1ON1A 4OU0A 1BBYA 5LRRA 3BY6A 4O3MA 5D8KB 3GVAA 2IA2A 3LA3A 1RUOA 1BI0A 3Q9SA 1K6OA 2TDXA 4M9ZA 3HYIA 4FT8A 4KIFA 1LDKB 4TV7A 2HQNA 3LQQA 5KVRA 3IWFA 1IXRC 4BHCA 1T0FA 2W85A 2VOOA 3FZVA 1XSDA 3ZMSA 4IRHA 3RKYA 2QLZA 1YQAA 2O61A 1AOYA 1G6NA 1OYIA 1LNWA 1R1UA 4Q4ZF 1KU3A 2FRHA 3E5UA 1ZLKA 2X4HA 4I2OA 2RVCA 1TQPA 1B9NA 2BEOA 4HLXA 3V4GA 1V3FA 5D5UB 1YFHA 2L54A 1Z05A 2JPCA 5E8GA 3K2ZA 3GZ5A 2PFBA 4ZYEA 2R7DA 2CFXA 4M9XA 4YIFA 5D5WB 5ILVA 2VT3A 3WODF 2XAQA 4XRFA 1B59A 1P2FA 2KIMA 3B73A 3ECHA 4HV6A 4MQVA 1IF1A 2GWRA 1FY7A 5LGNA 4KN7X 1IRFA 4YIIA 4IPAA 1MZBA 3BJ6A 1B9MA 2M5WA 2RC4A 3E6CC 2O8XA 3P9KA 1USSA 1YW9A 3SQNA 4LMYA 4L9VA 3G3ZA 4MNUA 1CGPA 2QQ9A 3GF2A 4M73A 3RJPA 1SMTA 4L5JA 1CF7A 2IRFG 3L7WA 1G3SA 2EA2A 1CF7B 1BI3A 1HKQA 3H3ZA 1P4AA 1Y0UA 5CVIA 2EK5A 5LRSA 4N9IA 2PN6A 2FA5A 3BPXA 3JAMK 4CHUA 4L0ZB 3P9IA 3WGIA 5BPIA 2FNPA 5ILUA 3DPTA 3H92A 1R5HA 2JPBA 2V1UA 4S04A 2F5EA 3I53A 3JSOA 4GXOA 1S7OA 3WU1B 3REOA 2E7XA 3R0AA 1RUNA 4PGHA 1HW2A 3HHHA 1EH6A 5HLHA 2PLYA 1E17A 2DPDA 1Z6RA 2ELHA 4LD5A 2AS5F 3L2CA 4GO1A 1F1ZA 3GWZA 2Q2EA 4OIQF 2AXLA 4GGGA 4L0YB 4M6YA 1MJBA 4YFKF 4P9FA 5FFZA 2V1DA 3F8BA 2ZCWA 1OPCA 2EV5A 5JR3A 3FF5A 4CGZA 2XAJA 5AIQA 5DUIA 4AIHA 2XUBA 4LJZF 4IHTA 1T98A 2RKHA 5DCMA 2XAGA 2C6YA 4HLYA 4YFXF 4A5NA 2DPUA 3MQ0A 3TDUC 4YG2F 4XLPF 1Q1HA 2WWYA 3R0JA 2OA4A 2ESHA 2FBHA 2QYOA 3GZ6A 3R4KA 1S3JA 4ZZLA 1I27A 1JHFA 3CLOA 5FLXK 5HLIA 4CDGA 1HW1A 1FX7A 3QPHA 2FU4A 2WV0A 3R61A 1R36A 5ICEA 1U5TA 5JHUA 1GHCA 4AIJA 4P9UA 3M9AA 2EFQA 3GX4X 5BPDA 2LKPA 4IRIA 2K27A 4WCGA 2XHKA 3F22A 5L3DA 4M9SA 1ZRDA 2DK8A 3ABTA 2Y48A 5J6XA 2G9WA 2CYYA 1C0WA 2A6EF 4WK8F 5TRDA 1Z7UA 3I59A 4HAMA 1WKMA 4EGZA 3IKVA 1FWZA 3GFLA 1IAWA 2L4MA 5CVUA 3HRMA 3E6MA 1T39A 2L02A 1TLHB 1R7JA 4QLCU 4UXNA 1FBUA 2FF4A 3JSPA 1TQMA 5L3FA 4A0XA 2DBBA 1ZG3A 3HTUA 2UXNA 1HSTA 2Y75A 1ODDA 3ECOA 2V9VA 5ICCA 2ZMEB 5IT3A 1OR7A 3WTYC 1P92A 4A2UA 2O6GE 3BPVA 4EJUA 4BAYA 4A12A 2DQRA 1F5TA 3VOEA 4HQMA 2HWVA 3HUGA 4EJVA 2F5DA 4ON0A 3I0TA 4OIRF 3VODA 3RIRA 5L3GA 2ZBKA 1QNTA 5CVJA 3I5UA 1XCVA 5F64A 2W24A 4M74A 3SZPA 1U6GA 1BJAA 4WF2A 3BWGA 3VFZA 4OIPF 2GQQA 3GXOA 4UNOA 1KYWA 4UVBA 1QZZA 1ZARA 4KA4A 4KUMA 1ONVA 2NAZA 5FD6A 4KT5C 2A3SA 1JE8A 3JTHA 3WTXC 3KP4A 1Z9CA 5IT9Z 5LLQA 4Z2YA 4PCQA 1W4MA 2HTJA 3QAHA 3IC7A 2B0LA 4IHSA 2VONA 3QU6A 1IN6A 2YX7A 3KFWX 2H6CA 5A2QZ 3I54A 1P6RA 5LGUA 3RPUA 1SD4A 5E18F 2PJPA 4U0YA 1QBJA 3I64A 3HTSB 4MTDA 4P5OA 2D1HA 4N0BA 2P4WA 1DPRA 1W7PB 2OBPA 1R23A 3HSRA 2G7UA 1XSXA 3COAC 4I09A 3WGGA 4Q5SF 1OMIA 2OD5A 3ROUA 1KGSA 1FZPB 1TW2A 3ABUA 2HYFA 1I1GA 2K02A 4Y13A 2YX4A 3J80Z 3L09A 3WTUC 1MGTA 2XGXA 4KIGA 4DQ2A 2K4JA 3HHGA 1S29A 3K69A 1HSJA 2W57A 4KDPA 4MGRA 4CICA 4HF2A 2ZKZA 1W7PD 4HF1A 4HOBA 1J0RA 5K5RA 4ENKA 2WTEA 4WXCA 4U0WA 5ICGA 1O3TA 4LLGF 2QWWA 4G8XA 2DFIA 2VODA 3ZMTA 2G7HA 2YSRA 4RB3C 3DEUA 4IVNA 4KFCA 2DT5A 3LSTA 1IN4A 2A07F 5FO5A 3DP7A 3O6BB 4KMUX 5E1XA 1U78A 2VBZA 4AVPA 3CUOA 2J5OA 2MLGA 1VTNC 2V6CA 1SFXA 3VEPA 1BN5A 2QZ8A 2XASA 1ZG1A 4L9NA 3BOQA 2MH2A 5LGTA 2YR2A 1ZG5A 2M87A 4JQFA 1QGPA 1IUYA 2XVCA 2IT0A 3WG9A 4OMZA 4KIBA 1H0MA 2Z5UA 2FOKA 2H09A 4G7ZF 4ASNA 4EJWA 4GYGA 3ZP5A 5LHGA 2VBXA 1D8JA 2GA1A 3T0YA 1K78A 4G9YA 4ENJA 2VC0A 3I58A 1ZGAA 1K78B 2CG4A 2P5VA 3BZ6A 3DQVC 2A69F 3KCCA 1SD7A 4OINF 2M8EA 2PMHA 2EB7A 4KN4X 3TDZC 5E8IA 3QOPA 2PBIA 1YW8A 3B02A 2D45A 3TO9A 3R60A 3J81Z 1UFMA 1FYLA 2MC3A 1FYMA 2GA2A 2P6SA 4PDKA 5DD8A 1ON2A 4EJTA 5IT9K 5DDGA 5E17F 3KZYA 3CDHA 1ZH5A 2IA0A 4GYIA 1B1BA 3QP5A 2BYVE 4RGSA 1I6XA 3GEZA 2LDUA 4CYDA 3V7CA 2UWMA 2DO7A 2HEOA 2QBYA 5BOXA 2VXZA 3KLOA 1DPUA 1BI2A 3F23A 1EH7A 3SFZA 2QM3A 1WSUA 1ZREA 1U8RA 3R6SA 3RYRA 2Q0OA 2F5CA 1SD5A 1MD0A 4EM2A 3EUHA 4BXUA 5DD4A 1FYKA 4MEXF 5LHHA 1XGNA 2QQAA 1YS7A 1FNNA 4I98B 3HOTA 2PMUA 3O2PE 4RS8A 3FX3A 2KIFA 4IXAA 4Q47A 2L01A 1SD6A 3ML6A 1KU9A 1UHMA 1I1SA 2RNJA 3EETA 4P55A 1DUXC 5D8LB 4EM0B 4MEYF 2RN7A 2HTSA 5ERIA 3HSFA 4LGWA 2DW4A 3MAJA 1XD7A 1Z91A 3RPQA 1L0OC 2D1VA 2EA4A 2K4BA 1HKSA 4OMYA 1ZGJA 1S6LA 3RKWA 2XKOA 3F6VA 3V8LA 1A04A 4DNCA 1FOKA 3GYHX 3GO5A 4KMFA 2MLKA 2ZJ2A 3MZYA 4OOIA 1YO5C 3GW2A 6PAXA 3ISPA 4ENMA 3G73A 4EJOA 4HDUA 3WE2A 1LEBA 2KJBA 2PG4A 1WQ2A 1MKMA 5LEJA 5DCMB 4UV9A 2STWA 1QPMA 4H0EA 3O3KA 2E7WA 3FMSA 2UXXA 3MCZA 2ZFWA 3TOBA 2D2WA 1ZHFA 1BC7C 1TNSA 3I4PA 4QWQA 4XSZF 4RAYA 5E1ZB 4D0PA 3WGHA 5FB2A 3T8TA 2M45A 1ULYA 1TBXA 1OYWA 3QP6A 1Z1DA 2OQGA 5H6RA 4E70A 4CXFA 4UVAA 3V8JA 2ACJA 2GXBA 1U5TB 5H6QA 2VBWA 2MD5A 2Z33A 3KP6A 1U2WA 3DPLC 3RI4A 4EV0A 3TO7A 3TO6A 4RGUA 3F21A 1XGMA 3U1DA 4M72A 2RV8A 2HGCA 3N4MA 1D8KA 1K7AA 4RB0A 1O3SA 4O6JA 2JT1A 4MHGA 1PUEE 2DLLA 5CJ9A 1XGOA 3I59B 2ESNA 5K5QA 1I5ZA 4FX0A 4WXHA 1R1VA 5L3EA 1YLFA 1IZ1A 2P5KA 2H27A 3RKXA 5FGMA 4HW0A 3KETA 4U0VA 2EFPA 3D5LA 1XCBA 1B4AA 3F8CA 3WTTC 1QO0D 1NHAA 1O3QA 2W84A 2Y0MA 2IPQX 1GXQA 2V79A 3H3UA 1JHHA 2M30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DYM A;  2PQ8 A;  2EV6 A;  4HDV A;  2Q8K A;  1ZRF A;  3E5X A;  4R8H A;  3RDI A;  1P4X A;  5F1R A;  2PEX A;  2ETH A;  2HFH A;  2JTV A;  4KYW A;  2V1X A;  3BP8 A;  3LAP A;  3LFK A;  5HDK A;  2JRT A;  3ZN0 A;  5ICF A;  1O57 A;  1LDD A;  1YIO A;  4WWC A;  1EH8 A;  1ZAO A;  1L3L A;  3JW4 A;  4HZF A;  3K1P A;  1GXP A;  1YG2 A;  1R1T A;  3FXU A;  1O7L A;  3E5Q A;  1BIA A;  5DEQ A;  2LF8 A;  3EYY A;  1MJ9 A;  3V8K A;  2FBK A;  3WE3 A;  4I0B A;  3WTW C;  1MDM A;  2QVO A;  4U7D A;  2VE8 A;  2Z99 A;  5HVQ C;  4L9J A;  1K79 A;  3SXY A;  2H94 A;  2QUF A;  3C7J A;  2EV0 A;  2A68 F;  2HKO A;  3BJO A;  5CVV A;  5D6F A;  2VBY A;  3P7N A;  2P7V B;  3F8F A;  2P7C B;  4MQ9 F;  3TQN A;  4ZYG A;  3ZMV A;  1UST A;  5K1Y A;  3MWM A;  5LBQ A;  2EFO A;  3GFM A;  3TKY A;  4R1H A;  3Q5F A;  1KA8 A;  4RGR A;  5FFX A;  3ZMU A;  2UZK A;  1FBS A;  3ULQ B;  3WU0 A;  3M7G A;  4IF4 A;  2VE9 A;  1O3R A;  1J75 A;  4Y17 A;  3V7S A;  2O3F A;  1FSH A;  1YS6 A;  1WWX A;  2FSW A;  3CUQ A;  4ZYH A;  2HS5 A;  3QPT A;  2NS0 A;  1YTY A;  1RI7 A;  3KP7 A;  4I0A A;  3WTZ A;  3W6K B;  2EFW A;  1QZY A;  2HKX A;  4KNY A;  1JGS A;  3LAJ A;  1V4R A;  1F9N A;  4A6E A;  3E6B A;  2GXG A;  4M6X A;  4BH9 A;  4RGX A;  3I71 A;  3U9G A;  2HZT A;  2BBY A;  3J7A O;  2P8T A;  5L3C A;  5KK1 A;  4LG0 A;  4JBA A;  3NEU A;  1W5S A;  5E20 A;  1FBQ A;  3KEO A;  1KYZ A;  3F8M A;  5AIP A;  2XRN A;  2GZW A;  4A6D A;  4BNC A;  3FM3 A;  4YFN F;  1YYV A;  3RYP A;  4BQA A;  2DU9 A;  3FMR A;  2FBI A;  1OKR A;  4LB6 B;  2OAZ A;  1H9G A;  3CUQ C;  3KZZ A;  1S7A A;  2EWN A;  3M1E A;  1TNT A;  1PP8 F;  1IW7 F;  3N97 A;  1ZLJ A;  3KP5 A;  3M8F A;  2KJC A;  2STT A;  1G3Y A;  1SMY F;  3BJA A;  2JSC A;  3KLN A;  3MFK A;  1T6S A;  2IJL A;  2F5F A;  3CO7 C;  4EM1 A;  3D0S A;  4G94 A;  1W5T A;  4UVC A;  2NYX A;  3P9C A;  4EVI A;  4HA8 A;  3C1D A;  3E3V A;  4AWX B;  1ZN2 A;  2HYG D;  3FM5 A;  1KU2 A;  2VT2 A;  3DV8 A;  2IW5 A;  1O7F A;  4IJA A;  5HOO A;  2ISY A;  4JK1 X;  2BGC A;  5D4S A;  5HDN A;  4KIC A;  1R58 A;  2OU2 A;  2NNN A;  1G3W A;  3SHF A;  2ADU A;  3NQO A;  5FLX Z;  3ELK A;  3HSE A;  5HDG A;  1D5V A;  2JZY A;  5A2Q K;  5ED4 A;  1LEA A;  2XAF A;  3VB2 A;  2ZO4 A;  2M1B A;  1PDN C;  3K0L A;  1IN8 A;  4EGY A;  2K86 A;  2FNA A;  3BDD A;  3HOS A;  1IN5 A;  3FXR A;  2L4A A;  2IVM A;  2DAO A;  1OYY A;  3KE2 A;  2L3D A;  1T2K A;  1P4W A;  3F6O A;  5EEH A;  5JI6 A;  2QBY B;  5HLG A;  2MBF A;  1KQ8 A;  4UUV A;  4ESB A;  4HQE A;  3ZPL A;  3FXQ A;  4ENN A;  1FT9 A;  3Q9V A;  4LK1 F;  3KP3 A;  3J80 K;  5D6E A;  3W6J B;  4WX9 A;  1TW3 A;  1TQI A;  2LSO A;  4ZH4 F;  3SZT A;  3LQR A;  2QQB A;  2K7L A;  3T5X A;  2GAU A;  2KRF A;  5ILS A;  2E1C A;  5E1W A;  4LFU A;  4ETS A;  5BMZ A;  3U2R A;  3HRS A;  1AWC A;  3KP2 A;  3IRQ A;  1IN7 A;  2CW0 F;  3F72 A;  4RAZ A;  1HXD A;  2GIV A;  3PQK A;  5F6F A;  2YU3 A;  5CVR A;  3ZQ7 A;  1DP7 P;  4PZJ A;  2A5Y B;  1R5G A;  3EQL F;  1BOA A;  3PQJ A;  2MA3 A;  4FX4 A;  1F4K A;  4B8X A;  4XBF A;  2ZXJ A;  1U3E M;  2EJR A;  4XLN F;  4I01 A;  2OQR A;  1T38 A;  5H20 A;  1HKT A;  4LK0 F;  1XMA A;  3E6D A;  4ESF A;  2ISZ A;  4UHT A;  5HS9 A;  5BS6 A;  2VOP A;  1RIO H;  2RDP A;  4PGG A;  2WC2 A;  2COM A;  3K1M A;  4P96 A;  1HW5 A;  1BI1 A;  4CO8 A;  1H9T A;  4UV8 A;  3GUD A;  5DCF A;  4LLN A;  4N9H A;  4LB5 A;  3ZMZ A;  1J2X A;  3GFJ A;  2A61 A;  2YPR A;  2BV6 A;  2X0L A;  1G4D A;  4G6D A;  5CLS A;  5DUK A;  3L00 A;  1YW7 A;  1XB4 A;  1JXS A;  3V7R A;  3ERE D;  3WTS C;  5HS7 A;  1B6A A;  1D3Y A;  1XDU A;  4ZZD A;  2H6B A;  2DK5 A;  5DV5 A;  4LLL A;  2IP2 A;  3DFG A;  3JTG A;  4NB5 A;  1BC8 C;  1LQ1 A;  2HDC A;  3IL2 A;  2FE3 A;  1RZ4 A;  1XDS A;  3M8E A;  1J59 A;  4BHP A;  2FMY A;  2OZ6 A;  4F7Z A;  5L3B A;  2RQP A;  4XSX F;  2P5L C;  3J81 K;  1PP7 U;  4L18 B;  2DQL A;  2CWE A;  4HX8 A;  1R22 A;  4RB1 A;  2LF7 A;  3K9T A;  1XN7 A;  5FD5 A;  4ESJ A;  2W25 A;  4EMS A;  3DF8 A;  1J9I A;  2VN2 A;  5AON A;  3OOP A;  3HIF A;  1RNL A;  3LA2 A;  4FHT A;  2FQ3 A;  2F2E A;  3E97 A;  4BYY A;  1X3U A;  4NQW A;  2KIU A;  3C18 A;  4CZZ A;  3C3W A;  1QQI A;  2Z9O A;  4IRG A;  1STZ A;  1J7K A;  1FSE A;  3TGN A;  4WXD A;  3IHU A;  2HQR A;  4RB2 C;  4U7B A;  3F8N A;  4L9T A;  1EV7 A;  2Z3Y A;  5HS8 A;  5D5X B;  4S05 A;  2R7F A;  3T8R A;  1IXS B;  3FHZ A;  1WRJ A;  2BE5 F;  1MJA A;  4A0Z A;  1E2X A;  2DTR A;  2CSO A;  3ZMD A;  4MTE A;  3EYI A;  2NRA C;  3K1N A;  4L5I A;  4G6Q A;  1KQ0 A;  4G7O F;  1XGS A;  3LA7 A;  3AAF A;  4GCV A;  3HRU A;  1BIB A;  1FC3 A;  2DI3 A;  2ZME A;  1LB2 A;  1SAX A;  3F3X A;  3NRV A;  1XMK A;  3GLX A;  3LWF A;  1REP C;  3PFI A;  2NNY A;  3CJN A;  1U5T C;  3IKT A;  1LJ9 A;  4R79 A;  4BHB A;  2O03 A;  5CYV A;  2XV4 S;  4HX4 A;  1FP2 A;  1ZRC A;  3FWE A;  4G7H F;  2PI0 A;  2VC1 A;  4HF0 A;  4ZYD A;  3DXJ F;  3OV8 A;  5TJJ A;  5BQT A;  2J5P A;  5D4R A;  1WI9 A;  2RGV A;  3QRF F;  4O5V A;  1DDN A;  3TOA A;  1MDM B;  1KU7 A;  2ZNY A;  3DKW A;  2XIG A;  2XKP A;  1XSV A;  2HR3 A;  3MEX A;  1S8N A;  3IRR A;  2XAH A;  2EFN A;  1UCR A;  1HBX G;  2MH9 A;  1J5Y A;  1FPQ A;  4HV5 A;  1FLI A;  3HRT A;  3S2W A;  2P6T A;  4A5M A;  2FEZ A;  2HOE A;  2O0Y A;  5K5O A;  2CQK A;  3KEQ A;  4HBL A;  2QEN A;  4EQQ A;  1LVA A;  4I7H A;  3ZN1 A;  1W7P A;  1TTY A;  3QU3 A;  4K2E A;  5EEG A;  2FML A;  4I02 A;  1HQC A;  2OZU A;  2XRO A;  1Z6T A;  4HX7 A;  1SFU A;  3T1B A;  2CO5 A;  1IRG A;  3CUQ B;  1BM9 A;  5LHI A;  3GFI A;  4U88 A;  1G3T A;  3FMQ A;  3IWZ A;  2A6H F;  3RTR A;  1GVJ A;  2IA1 A;  1ZYR F;  5JFR A;  3L9F A;  2E1N A;  3CO6 C;  5JVT A;  4A0Y A;  5LEK A;  4AIK A;  3JAM Z;  4Y15 A;  1LDJ A;  2FXA A;  5J8C A;  3MZH A;  1SFE A;  3CTA A;  4Q48 A;  3BRO A;  2LNB A;  2CGP A;  1KQ9 A;  1UHW A;  5J8F A;  4NHJ A;  1FP1 D;  1R00 A;  4OIO F;  2KKO A;  4HYE A;  2ZNZ A;  4LG0 B;  5D5V B;  3WTV C;  4AD9 A;  3EDP A;  4M71 A;  1IXC A;  2R3S A;  4B09 A;  1UB9 A;  1ON1 A;  4OU0 A;  1BBY A;  5LRR A;  3BY6 A;  4O3M A;  5D8K B;  3GVA A;  2IA2 A;  3LA3 A;  1RUO A;  1BI0 A;  3Q9S A;  1K6O A;  2TDX A;  4M9Z A;  3HYI A;  4FT8 A;  4KIF A;  1LDK B;  4TV7 A;  2HQN A;  3LQQ A;  5KVR A;  3IWF A;  1IXR C;  4BHC A;  1T0F A;  2W85 A;  2VOO A;  3FZV A;  1XSD A;  3ZMS A;  4IRH A;  3RKY A;  2QLZ A;  1YQA A;  2O61 A;  1AOY A;  1G6N A;  1OYI A;  1LNW A;  1R1U A;  4Q4Z F;  1KU3 A;  2FRH A;  3E5U A;  1ZLK A;  2X4H A;  4I2O A;  2RVC A;  1TQP A;  1B9N A;  2BEO A;  4HLX A;  3V4G A;  1V3F A;  5D5U B;  1YFH A;  2L54 A;  1Z05 A;  2JPC A;  5E8G A;  3K2Z A;  3GZ5 A;  2PFB A;  4ZYE A;  2R7D A;  2CFX A;  4M9X A;  4YIF A;  5D5W B;  5ILV A;  2VT3 A;  3WOD F;  2XAQ A;  4XRF A;  1B59 A;  1P2F A;  2KIM A;  3B73 A;  3ECH A;  4HV6 A;  4MQV A;  1IF1 A;  2GWR A;  1FY7 A;  5LGN A;  4KN7 X;  1IRF A;  4YII A;  4IPA A;  1MZB A;  3BJ6 A;  1B9M A;  2M5W A;  2RC4 A;  3E6C C;  2O8X A;  3P9K A;  1USS A;  1YW9 A;  3SQN A;  4LMY A;  4L9V A;  3G3Z A;  4MNU A;  1CGP A;  2QQ9 A;  3GF2 A;  4M73 A;  3RJP A;  1SMT A;  4L5J A;  1CF7 A;  2IRF G;  3L7W A;  1G3S A;  2EA2 A;  1CF7 B;  1BI3 A;  1HKQ A;  3H3Z A;  1P4A A;  1Y0U A;  5CVI A;  2EK5 A;  5LRS A;  4N9I A;  2PN6 A;  2FA5 A;  3BPX A;  3JAM K;  4CHU A;  4L0Z B;  3P9I A;  3WGI A;  5BPI A;  2FNP A;  5ILU A;  3DPT A;  3H92 A;  1R5H A;  2JPB A;  2V1U A;  4S04 A;  2F5E A;  3I53 A;  3JSO A;  4GXO A;  1S7O A;  3WU1 B;  3REO A;  2E7X A;  3R0A A;  1RUN A;  4PGH A;  1HW2 A;  3HHH A;  1EH6 A;  5HLH A;  2PLY A;  1E17 A;  2DPD A;  1Z6R A;  2ELH A;  4LD5 A;  2AS5 F;  3L2C A;  4GO1 A;  1F1Z A;  3GWZ A;  2Q2E A;  4OIQ F;  2AXL A;  4GGG A;  4L0Y B;  4M6Y A;  1MJB A;  4YFK F;  4P9F A;  5FFZ A;  2V1D A;  3F8B A;  2ZCW A;  1OPC A;  2EV5 A;  5JR3 A;  3FF5 A;  4CGZ A;  2XAJ A;  5AIQ A;  5DUI A;  4AIH A;  2XUB A;  4LJZ F;  4IHT A;  1T98 A;  2RKH A;  5DCM A;  2XAG A;  2C6Y A;  4HLY A;  4YFX F;  4A5N A;  2DPU A;  3MQ0 A;  3TDU C;  4YG2 F;  4XLP F;  1Q1H A;  2WWY A;  3R0J A;  2OA4 A;  2ESH A;  2FBH A;  2QYO A;  3GZ6 A;  3R4K A;  1S3J A;  4ZZL A;  1I27 A;  1JHF A;  3CLO A;  5FLX K;  5HLI A;  4CDG A;  1HW1 A;  1FX7 A;  3QPH A;  2FU4 A;  2WV0 A;  3R61 A;  1R36 A;  5ICE A;  1U5T A;  5JHU A;  1GHC A;  4AIJ A;  4P9U A;  3M9A A;  2EFQ A;  3GX4 X;  5BPD A;  2LKP A;  4IRI A;  2K27 A;  4WCG A;  2XHK A;  3F22 A;  5L3D A;  4M9S A;  1ZRD A;  2DK8 A;  3ABT A;  2Y48 A;  5J6X A;  2G9W A;  2CYY A;  1C0W A;  2A6E F;  4WK8 F;  5TRD A;  1Z7U A;  3I59 A;  4HAM A;  1WKM A;  4EGZ A;  3IKV A;  1FWZ A;  3GFL A;  1IAW A;  2L4M A;  5CVU A;  3HRM A;  3E6M A;  1T39 A;  2L02 A;  1TLH B;  1R7J A;  4QLC U;  4UXN A;  1FBU A;  2FF4 A;  3JSP A;  1TQM A;  5L3F A;  4A0X A;  2DBB A;  1ZG3 A;  3HTU A;  2UXN A;  1HST A;  2Y75 A;  1ODD A;  3ECO A;  2V9V A;  5ICC A;  2ZME B;  5IT3 A;  1OR7 A;  3WTY C;  1P92 A;  4A2U A;  2O6G E;  3BPV A;  4EJU A;  4BAY A;  4A12 A;  2DQR A;  1F5T A;  3VOE A;  4HQM A;  2HWV A;  3HUG A;  4EJV A;  2F5D A;  4ON0 A;  3I0T A;  4OIR F;  3VOD A;  3RIR A;  5L3G A;  2ZBK A;  1QNT A;  5CVJ A;  3I5U A;  1XCV A;  5F64 A;  2W24 A;  4M74 A;  3SZP A;  1U6G A;  1BJA A;  4WF2 A;  3BWG A;  3VFZ A;  4OIP F;  2GQQ A;  3GXO A;  4UNO A;  1KYW A;  4UVB A;  1QZZ A;  1ZAR A;  4KA4 A;  4KUM A;  1ONV A;  2NAZ A;  5FD6 A;  4KT5 C;  2A3S A;  1JE8 A;  3JTH A;  3WTX C;  3KP4 A;  1Z9C A;  5IT9 Z;  5LLQ A;  4Z2Y A;  4PCQ A;  1W4M A;  2HTJ A;  3QAH A;  3IC7 A;  2B0L A;  4IHS A;  2VON A;  3QU6 A;  1IN6 A;  2YX7 A;  3KFW X;  2H6C A;  5A2Q Z;  3I54 A;  1P6R A;  5LGU A;  3RPU A;  1SD4 A;  5E18 F;  2PJP A;  4U0Y A;  1QBJ A;  3I64 A;  3HTS B;  4MTD A;  4P5O A;  2D1H A;  4N0B A;  2P4W A;  1DPR A;  1W7P B;  2OBP A;  1R23 A;  3HSR A;  2G7U A;  1XSX A;  3COA C;  4I09 A;  3WGG A;  4Q5S F;  1OMI A;  2OD5 A;  3ROU A;  1KGS A;  1FZP B;  1TW2 A;  3ABU A;  2HYF A;  1I1G A;  2K02 A;  4Y13 A;  2YX4 A;  3J80 Z;  3L09 A;  3WTU C;  1MGT A;  2XGX A;  4KIG A;  4DQ2 A;  2K4J A;  3HHG A;  1S29 A;  3K69 A;  1HSJ A;  2W57 A;  4KDP A;  4MGR A;  4CIC A;  4HF2 A;  2ZKZ A;  1W7P D;  4HF1 A;  4HOB A;  1J0R A;  5K5R A;  4ENK A;  2WTE A;  4WXC A;  4U0W A;  5ICG A;  1O3T A;  4LLG F;  2QWW A;  4G8X A;  2DFI A;  2VOD A;  3ZMT A;  2G7H A;  2YSR A;  4RB3 C;  3DEU A;  4IVN A;  4KFC A;  2DT5 A;  3LST A;  1IN4 A;  2A07 F;  5FO5 A;  3DP7 A;  3O6B B;  4KMU X;  5E1X A;  1U78 A;  2VBZ A;  4AVP A;  3CUO A;  2J5O A;  2MLG A;  1VTN C;  2V6C A;  1SFX A;  3VEP A;  1BN5 A;  2QZ8 A;  2XAS A;  1ZG1 A;  4L9N A;  3BOQ A;  2MH2 A;  5LGT A;  2YR2 A;  1ZG5 A;  2M87 A;  4JQF A;  1QGP A;  1IUY A;  2XVC A;  2IT0 A;  3WG9 A;  4OMZ A;  4KIB A;  1H0M A;  2Z5U A;  2FOK A;  2H09 A;  4G7Z F;  4ASN A;  4EJW A;  4GYG A;  3ZP5 A;  5LHG A;  2VBX A;  1D8J A;  2GA1 A;  3T0Y A;  1K78 A;  4G9Y A;  4ENJ A;  2VC0 A;  3I58 A;  1ZGA A;  1K78 B;  2CG4 A;  2P5V A;  3BZ6 A;  3DQV C;  2A69 F;  3KCC A;  1SD7 A;  4OIN F;  2M8E A;  2PMH A;  2EB7 A;  4KN4 X;  3TDZ C;  5E8I A;  3QOP A;  2PBI A;  1YW8 A;  3B02 A;  2D45 A;  3TO9 A;  3R60 A;  3J81 Z;  1UFM A;  1FYL A;  2MC3 A;  1FYM A;  2GA2 A;  2P6S A;  4PDK A;  5DD8 A;  1ON2 A;  4EJT A;  5IT9 K;  5DDG A;  5E17 F;  3KZY A;  3CDH A;  1ZH5 A;  2IA0 A;  4GYI A;  1B1B A;  3QP5 A;  2BYV E;  4RGS A;  1I6X A;  3GEZ A;  2LDU A;  4CYD A;  3V7C A;  2UWM A;  2DO7 A;  2HEO A;  2QBY A;  5BOX A;  2VXZ A;  3KLO A;  1DPU A;  1BI2 A;  3F23 A;  1EH7 A;  3SFZ A;  2QM3 A;  1WSU A;  1ZRE A;  1U8R A;  3R6S A;  3RYR A;  2Q0O A;  2F5C A;  1SD5 A;  1MD0 A;  4EM2 A;  3EUH A;  4BXU A;  5DD4 A;  1FYK A;  4MEX F;  5LHH A;  1XGN A;  2QQA A;  1YS7 A;  1FNN A;  4I98 B;  3HOT A;  2PMU A;  3O2P E;  4RS8 A;  3FX3 A;  2KIF A;  4IXA A;  4Q47 A;  2L01 A;  1SD6 A;  3ML6 A;  1KU9 A;  1UHM A;  1I1S A;  2RNJ A;  3EET A;  4P55 A;  1DUX C;  5D8L B;  4EM0 B;  4MEY F;  2RN7 A;  2HTS A;  5ERI A;  3HSF A;  4LGW A;  2DW4 A;  3MAJ A;  1XD7 A;  1Z91 A;  3RPQ A;  1L0O C;  2D1V A;  2EA4 A;  2K4B A;  1HKS A;  4OMY A;  1ZGJ A;  1S6L A;  3RKW A;  2XKO A;  3F6V A;  3V8L A;  1A04 A;  4DNC A;  1FOK A;  3GYH X;  3GO5 A;  4KMF A;  2MLK A;  2ZJ2 A;  3MZY A;  4OOI A;  1YO5 C;  3GW2 A;  6PAX A;  3ISP A;  4ENM A;  3G73 A;  4EJO A;  4HDU A;  3WE2 A;  1LEB A;  2KJB A;  2PG4 A;  1WQ2 A;  1MKM A;  5LEJ A;  5DCM B;  4UV9 A;  2STW A;  1QPM A;  4H0E A;  3O3K A;  2E7W A;  3FMS A;  2UXX A;  3MCZ A;  2ZFW A;  3TOB A;  2D2W A;  1ZHF A;  1BC7 C;  1TNS A;  3I4P A;  4QWQ A;  4XSZ F;  4RAY A;  5E1Z B;  4D0P A;  3WGH A;  5FB2 A;  3T8T A;  2M45 A;  1ULY A;  1TBX A;  1OYW A;  3QP6 A;  1Z1D A;  2OQG A;  5H6R A;  4E70 A;  4CXF A;  4UVA A;  3V8J A;  2ACJ A;  2GXB A;  1U5T B;  5H6Q A;  2VBW A;  2MD5 A;  2Z33 A;  3KP6 A;  1U2W A;  3DPL C;  3RI4 A;  4EV0 A;  3TO7 A;  3TO6 A;  4RGU A;  3F21 A;  1XGM A;  3U1D A;  4M72 A;  2RV8 A;  2HGC A;  3N4M A;  1D8K A;  1K7A A;  4RB0 A;  1O3S A;  4O6J A;  2JT1 A;  4MHG A;  1PUE E;  2DLL A;  5CJ9 A;  1XGO A;  3I59 B;  2ESN A;  5K5Q A;  1I5Z A;  4FX0 A;  4WXH A;  1R1V A;  5L3E A;  1YLF A;  1IZ1 A;  2P5K A;  2H27 A;  3RKX A;  5FGM A;  4HW0 A;  3KET A;  4U0V A;  2EFP A;  3D5L A;  1XCB A;  1B4A A;  3F8C A;  3WTT C;  1QO0 D;  1NHA A;  1O3Q A;  2W84 A;  2Y0M A;  2IPQ X;  1GXQ A;  2V79 A;  3H3U A;  1JHH A;  2M30 A; 
#chains in the Genus database with same CATH topology
 1FEX A;  2HXO A;  5M3F J;  5DYM A;  2PQ8 A;  2EV6 A;  2X6X A;  4HDV A;  2Q8K A;  3VSK A;  1ZRF A;  5JLW A;  3E5X A;  3TMO A;  4R8H A;  3RDI A;  3L2W A;  2RRE A;  1P4X A;  5F1R A;  3S1R J;  3HGY A;  4JP0 A;  3AKZ A;  2XC7 A;  1WJD A;  2PEX A;  1E3P A;  5F27 A;  5FKN A;  2ETH A;  2HFH A;  2JTV A;  4UUS B;  4D7N A;  4KYW A;  1GDT A;  2V1X A;  3S32 A;  3BP8 A;  3HUG B;  3RQ4 A;  2DTZ A;  3LAP A;  2HPI A;  2O8K A;  3LFK A;  5HDK A;  3I4M J;  2JRT A;  5HOD A;  3ZN0 A;  3WG7 H;  5ICF A;  1O57 A;  2ZB9 A;  1LDD A;  1YIO A;  2CW8 A;  5BNG A;  1EH8 A;  1ZAO A;  4WWC A;  1T08 B;  1L3L A;  1EKE A;  4RMN A;  3JW4 A;  4HZF A;  3K1P A;  1GXP A;  3LL7 A;  1YG2 A;  1OQY A;  1QZE A;  1R1T A;  2WV1 A;  2ZXH A;  3FXU A;  1O7L A;  3E5Q A;  3CC2 I;  1BIA A;  3ESW B;  5DEQ A;  2LF8 A;  3EYY A;  2NS8 A;  1MJ9 A;  3V8K A;  2FBK A;  2QKL B;  3WE3 A;  3OS2 A;  4C2U A;  4I0B A;  3WTW C;  4NNJ A;  1X58 A;  1MDM A;  3OYL A;  3AFH A;  1ORK A;  4HG2 A;  2QVO A;  3WHB A;  2WAF A;  3OIQ A;  4U7D A;  2JVH A;  2OJE D;  2LY9 A;  3FK6 A;  1Q1V A;  3JRC A;  3W6V A;  2LOO A;  1Y1V J;  1Y56 A;  2DN0 A;  4CCN A;  2VE8 A;  1GV2 A;  2FJ1 A;  2Z99 A;  5HVQ C;  4L9J A;  2BY1 A;  3CME I;  2XAU A;  1K79 A;  4GDF A;  3HPG A;  3SXY A;  3CCE I;  2H94 A;  4F93 B;  2QUF A;  3C7J A;  2R5Z A;  2BVL A;  2EV0 A;  3L2R A;  2A68 F;  2HKO A;  3BJO A;  2JQ7 A;  5CVV A;  4PSX A;  3MVP A;  5D6F A;  2ZME C;  2VBY A;  3P7N A;  2Y0S A;  2EPF A;  2P7V B;  3ABL H;  2CQ7 A;  2M4G A;  4NC7 A;  3F8F A;  2IS2 A;  2P7C B;  2FQ4 A;  2QSG X;  1VQL I;  4E7J A;  4MQ9 F;  3TQN A;  3EUK L;  3ZMV A;  1UST A;  4ZYG A;  4XMY A;  5K1Y A;  2AQE A;  3MWM A;  4BE1 A;  3N05 A;  5LBQ A;  2Z16 A;  4NC8 A;  2EFO A;  3L2U A;  3GFM A;  3TKY A;  4FET A;  1WJE A;  2XPU A;  2L9V A;  4R1H A;  4BY7 J;  4DIQ A;  3Q5F A;  1KA8 A;  2KIS A;  4RGR A;  1JGG A;  2JK3 A;  5FFX A;  3ZMU A;  2UZK A;  1WFX A;  1FBS A;  1PVE A;  3ULQ B;  4XRS A;  3WU0 A;  3S3M A;  3M7G A;  3NAR A;  3RZD J;  5EZG A;  4IF4 A;  2VE9 A;  1F43 A;  1O3R A;  1J75 A;  4Y17 A;  3V7S A;  2O3F A;  4IHY A;  1FSH A;  1EF4 A;  3NAU A;  4B4C A;  2X85 A;  1YS6 A;  1WWX A;  2FSW A;  3CUQ A;  4ZYH A;  4PJ0 C;  1ETY A;  3RPU D;  4JOM A;  2PMZ A;  4QTR A;  3IUO A;  3FHN A;  5DS9 A;  2EIL H;  2HS5 A;  1IC8 A;  1LKX A;  3H5A A;  3QPT A;  2NS0 A;  1YTY A;  2DOA A;  5CKT A;  1RI7 A;  3H0D A;  1AU7 A;  3QOD A;  1A6Q A;  3KP7 A;  3O8H A;  4I0A A;  3WTZ A;  3W6K B;  5M5Y J;  2EFW A;  1QZY A;  2HKX A;  2HQ5 A;  4KNY A;  2R7Q A;  1JGS A;  4C2T A;  3LAJ A;  1V4R A;  3HB9 A;  1DGW Y;  1F9N A;  2CUF A;  4A6E A;  2XF6 A;  2GXG A;  3E6B A;  4M6X A;  5F0C A;  3OS1 A;  2PJR A;  2H8R A;  4BH9 A;  4MFE A;  2H8W A;  3PO2 J;  4LG3 A;  4XLA A;  4AUX A;  4RGX A;  1W36 C;  3I71 A;  3U9G A;  4W1U A;  3MKW B;  1SVO A;  2HZT A;  3DTK A;  1W0T A;  2BBY A;  2LBF A;  3J7A O;  2DT7 B;  2DYR H;  2P8T A;  3A03 A;  4A3K J;  3FKI J;  3NWS A;  1HOM A;  3K4L A;  3S2D J;  5L3C A;  5KK1 A;  4LG0 A;  4JBA A;  3NEU A;  4ZTF A;  1W5S A;  5E20 A;  1FBQ A;  3KEO A;  1KYZ A;  1MBJ A;  1MNM C;  3F8M A;  5AIP A;  2XRN A;  2GZW A;  3HOU J;  4A6D A;  1I50 J;  4BNC A;  3FM3 A;  4YFN F;  3SFI A;  1YYV A;  3RSN A;  3RYP A;  4B48 A;  2K9M A;  2XGE A;  2DU9 A;  3CJQ B;  3FMR A;  4BQA A;  2FBI A;  2R5Y A;  1OKR A;  4LB6 B;  2OAZ A;  1H9G A;  3CUQ C;  1R49 A;  1XTA A;  3KZZ A;  4BXF A;  2FX0 A;  3BG7 A;  1S7A A;  2VKV A;  2EWN A;  3M1E A;  1TNT A;  1PP8 F;  2GXA A;  1IW7 F;  5E3N A;  3N97 A;  1MW7 A;  1ZLJ A;  4QPO A;  3BLY A;  4FAS D;  2QCO A;  3KP5 A;  3DCF A;  3GZN B;  3M8F A;  1YX3 A;  2KJC A;  2L7Z A;  4RBO A;  1G3Y A;  2STT A;  1SMY F;  3BJA A;  1ZK8 A;  2DMN A;  2JSC A;  3KLN A;  1Z77 A;  1T6S A;  2IJL A;  2CUZ A;  2A6T A;  2F5F A;  3MFK A;  3J7A Y;  1E0E A;  3ABM H;  2IGO A;  3DTI A;  3CO7 C;  1MMG A;  3CES A;  4E7Z A;  4J00 A;  3BG6 A;  2HOA A;  2AXT C;  3BT9 A;  4EM1 A;  1ZR4 A;  1T95 A;  5FKM A;  1SAN A;  3ASN H;  2V4J C;  2HQA A;  3D0S A;  4G6T B;  4G94 A;  1W5T A;  5HNH A;  4GFB A;  4ZTJ A;  1TP4 A;  2DFH A;  4UVC A;  4YIR X;  2NYX A;  3P9C A;  4EVI A;  4HA8 A;  5M5W J;  3C1D A;  3E3V A;  4AWX B;  1ZN2 A;  5J47 A;  2BY3 A;  2HYG D;  1P7I A;  1LE8 B;  5KCM A;  3FM5 A;  1KU2 A;  2VT2 A;  5B3S H;  3DV8 A;  1K4S A;  2IW5 A;  1O7F A;  4FE7 A;  4IJA A;  5HOO A;  2ISY A;  4JK1 X;  2WY8 Q;  2BGC A;  5D4S A;  2M9H A;  5HDN A;  3PSI A;  4H4K C;  4KIC A;  1R58 A;  2OU2 A;  2NNN A;  1G3W A;  2XGD A;  2KT0 A;  4J19 A;  4JYK A;  4KIT B;  2WB1 A;  3BTL A;  3SHF A;  2ADU A;  4DYC A;  3NQO A;  3VYR B;  5FLX Z;  3HG9 A;  3ELK A;  3HSE A;  4E7S A;  3FDY A;  5HDG A;  1D5V A;  2ICW G;  2JZY A;  5A2Q K;  4PJJ A;  5ED4 A;  5H2F C;  1LEA A;  2XAF A;  2CW7 A;  3VB2 A;  2ZO4 A;  4M3F A;  2NVU B;  3CCY A;  4XRS G;  2M1B A;  3Q0W A;  3U21 A;  3ZCO A;  1PDN C;  2KQR A;  2AQF A;  2DYS H;  4QIW N;  2FOW A;  2IS4 A;  3K0L A;  1IN8 A;  1NG6 A;  4EGY A;  3BDD A;  2FNA A;  2K86 A;  3SEZ A;  3HOS A;  1IN5 A;  3OS0 A;  1B72 B;  3FXR A;  3IAS 2;  2L4A A;  1OFC X;  3KYD B;  2LP0 A;  4CYC A;  2X1D A;  2IVM A;  5F04 A;  2DAO A;  1OYY A;  3KE2 A;  2R7S A;  4CUG A;  4CYC B;  2L3D A;  1T2K A;  1P4W A;  3F6O A;  5EEH A;  2F4M B;  5JI6 A;  1T0F C;  1WJ5 A;  2QBY B;  5HLG A;  1SVL A;  4XON A;  1G2H A;  1PYV A;  2MBF A;  1KQ8 A;  4UUV A;  4ESB A;  4HQE A;  3ZPL A;  2NOG A;  3FXQ A;  4AU7 A;  4ZJZ A;  4ENN A;  4A3B J;  1FT9 A;  3Q9V A;  1JKO C;  4LK1 F;  3KP3 A;  2HVR A;  3J80 K;  2EIJ H;  4XNF A;  5D6E A;  1G8X A;  1TW3 A;  1TQI A;  3W6J B;  4WX9 A;  1XG1 A;  2LSO A;  2MD0 A;  4ZH4 F;  1JTY A;  2F6C A;  3SZT A;  2Y31 A;  4A3G J;  3LQR A;  3CCL I;  2QQB A;  2K7L A;  1Y1W J;  4ZDO A;  3T5X A;  2GAU A;  2KRF A;  5ILS A;  2E1C A;  2ECB A;  3G6E I;  3S3O A;  5IP7 J;  3QPS A;  5E1W A;  4LFU A;  4XLC A;  4AYB N;  4ETS A;  5BMZ A;  3U2R A;  3HRS A;  1AWC A;  1LPQ A;  3KP2 A;  3IRQ A;  2E71 A;  3FBI B;  1IN7 A;  2CW0 F;  3F72 A;  4RAZ A;  2BW3 B;  1HXD A;  3JCU C;  3ERM A;  1AHD P;  1FIP A;  2GIV A;  3PQK A;  5F6F A;  2YU3 A;  5CVR A;  4BE0 A;  2MFZ A;  1HDP A;  3CF2 A;  3ZQ7 A;  2DT6 A;  2P81 A;  1DP7 P;  2FUG 2;  4PZJ A;  1VND A;  4X0G A;  2A5Y B;  1QA6 A;  1R5G A;  3E0J B;  3LOC A;  3EQL F;  1BOA A;  3OR2 C;  5J40 A;  3W2V A;  3AL0 C;  3PQJ A;  3LSH A;  5B66 C;  2MA3 A;  4FX4 A;  1F4K A;  4B8X A;  4XBF A;  2ZXJ A;  1U3E M;  2EJR A;  4RLQ A;  2E2J J;  1ETX A;  3CP8 A;  2R7O A;  4XLN F;  4DZJ A;  4YEL A;  4I01 A;  5K7F A;  2OQR A;  1T38 A;  5H20 A;  1HKT A;  4JX4 A;  4LK0 F;  1XMA A;  2DA1 A;  4XK4 A;  5FKO A;  5K7H A;  3E6D A;  2JJ7 A;  4ESF A;  1VFC A;  2ISZ A;  3IAM 2;  4UHT A;  5HS9 A;  5BS6 A;  3S1Q J;  2VOP A;  1RIO H;  1FOW A;  2RDP A;  4PGG A;  2F4O B;  2WC2 A;  2TCT A;  2COM A;  2KZV A;  3K1M A;  2DCE A;  4P96 A;  1HW5 A;  3Q0U A;  1UG2 A;  1BI1 A;  4CO8 A;  1TWA J;  3GLL A;  5M5X J;  1H9T A;  4C9Y A;  3JRG A;  4UV8 A;  3OY9 A;  1I6H J;  3GUD A;  5DCF A;  4LLN A;  4XID A;  2CMP A;  4N9H A;  4LB5 A;  3ZMZ A;  1TT5 B;  1J2X A;  3GFJ A;  2A61 A;  3JRE A;  4IHV A;  5FJ8 J;  5F0H A;  2YPR A;  2BV6 A;  3BTJ A;  2K3F A;  2H1L A;  2X0L A;  1G4D A;  1WH5 A;  3PIP F;  4G6D A;  4LIU A;  2R93 J;  5CLS A;  5DUK A;  2M8G X;  3L00 A;  1YW7 A;  1GUU A;  1XB4 A;  1JXS A;  3V7R A;  3ERE D;  1E3H A;  2BXZ A;  3WTS C;  2VL8 A;  5HS7 A;  1B6A A;  5GPC A;  1D3Y A;  1XDU A;  4ZZD A;  4CCM A;  3C2B A;  1IV8 A;  2H6B A;  4GRI A;  2DK5 A;  1VQM I;  5DV5 A;  2M34 A;  3OYK A;  4P1W A;  4LLL A;  2IP2 A;  3DFG A;  3JTG A;  3CZ6 A;  1YOV B;  2VKD A;  2DXI A;  4NB5 A;  1BC8 C;  1LQ1 A;  2HDC A;  3IL2 A;  2OF7 A;  2XB5 A;  2FE3 A;  2CU7 A;  1RZ4 A;  1XDS A;  3BR5 A;  3MD2 A;  3M8E A;  3W2A A;  3A01 B;  1J59 A;  3CQZ J;  3IH4 A;  3HKZ A;  4YEJ A;  4BHP A;  2FMY A;  2EH3 A;  3OSF A;  5FRM A;  3B6A A;  2OZ6 A;  4F7Z A;  2E5Z A;  5L3B A;  1W0U A;  2RQP A;  4XSX F;  2P5L C;  3J81 K;  4PSW A;  1PP7 U;  2DQL A;  4B44 A;  4L18 B;  2CWE A;  5KAI C;  3RCO A;  2R0Q C;  3EPZ A;  4HX8 A;  1R22 A;  4RB1 A;  3K10 A;  4NC6 A;  2LF7 A;  3K9T A;  5GPA A;  1XN7 A;  5FD5 A;  4ESJ A;  2W25 A;  4XOP A;  4EMS A;  2BHY A;  2X1C A;  3VWB A;  4CSW A;  3DF8 A;  4Y3O A;  3U1K A;  2QA4 I;  3OYD A;  1J9I A;  2VN2 A;  5AON A;  2HXI A;  3OOP A;  1T8I A;  3HIF A;  1DP3 A;  3RZO J;  1ETK A;  1RNL A;  3LA2 A;  4FHT A;  1MIJ A;  2FQ3 A;  3X2Q H;  1A35 A;  5FRO A;  2F2E A;  3E97 A;  4BYY A;  1X3U A;  1K6Y A;  5IOZ A;  4NQW A;  4A69 C;  1IG7 A;  2KIU A;  3C18 A;  4CZZ A;  3C3W A;  3H0G J;  1F36 A;  4EAT A;  1QQI A;  2Z9O A;  4IRG A;  2VJ4 A;  1STZ A;  3TED A;  2W82 A;  3TL4 X;  1APL C;  1J7K A;  1WI3 A;  3PM1 A;  1FSE A;  3TGN A;  4WXD A;  3OOU A;  3IHU A;  2VXD A;  1V54 H;  2HQR A;  5EGO A;  4II2 A;  4RB2 C;  3FIS A;  2KZG A;  4U7B A;  3F8N A;  5IYC J;  1XX5 A;  3KZI C;  4L9T A;  1WJC A;  1EV7 A;  2Z3Y A;  4RM3 A;  5HS8 A;  5D5X B;  4S05 A;  2R7F A;  3T8R A;  1IXS B;  2ID3 A;  1OCZ H;  3G1L A;  1K4T A;  2K9Q A;  3FHZ A;  1Y39 A;  2VB6 A;  1WRJ A;  2BE5 F;  3CCV I;  1WGX A;  1MJA A;  5GP9 A;  1X1A A;  4A0Z A;  1E2X A;  4DOZ A;  2DTR A;  1NTC A;  2X6W A;  2CSO A;  3OL4 A;  3ZMD A;  2ZXI A;  1UAA A;  4MTE A;  3EYI A;  1WJA A;  2NRA C;  2V6E A;  3G2B A;  3K1N A;  3LSJ A;  1X2M A;  4L5I A;  2VAS A;  1VQ5 I;  4G6Q A;  3DLL F;  1KQ0 A;  2MSY A;  4G7O F;  1EJ9 A;  5CQG A;  1XGS A;  2KRH A;  1TWH J;  3LA7 A;  4HPQ A;  3AAF A;  3GME A;  4GCV A;  3HRU A;  4PFO A;  1IRZ A;  4FE4 A;  1BIB A;  1FC3 A;  2DI3 A;  2ZME A;  4AC0 A;  1LB2 A;  1SAX A;  3HOV J;  3F3X A;  3G1M A;  3NRV A;  1XMK A;  3GLX A;  3LWF A;  4CH7 A;  1Y8Q B;  3PFI A;  1REP C;  4BJ5 C;  1R5I D;  2NNY A;  1H89 C;  3CJN A;  1U5T C;  2IS1 A;  3IKT A;  1LJ9 A;  3OYG A;  4R79 A;  4BHB A;  1BR4 A;  2O03 A;  1X1C A;  3K4M A;  5CYV A;  2XV4 S;  1EA3 A;  3ZQH A;  1JUS A;  4HX4 A;  1FP2 A;  4DBQ A;  1ZRC A;  3FWE A;  4XKB A;  3HJE A;  3BG3 A;  4G7H F;  1D1A A;  3S93 A;  1H88 C;  2PI0 A;  1FTZ A;  2Z2S B;  4IEJ A;  1O4X A;  2VC1 A;  3CCJ I;  5HNF A;  4HF0 A;  4ZYD A;  1A5J A;  3DXJ F;  3OV8 A;  5TJJ A;  5BQT A;  1POG A;  2J5P A;  5D4R A;  1WI9 A;  2RGV A;  4PJL A;  4W97 A;  1MH4 A;  4O5V A;  2V9P A;  5EZH A;  3QRF F;  1JJ8 C;  1RES A;  1DDN A;  4CA0 A;  3TOA A;  5HLT A;  2Y69 H;  4B1R A;  1MDM B;  1QHG A;  2ZFU A;  1K83 J;  1KU7 A;  2ZNY A;  1WH7 A;  4DBR A;  3DKW A;  4BL0 B;  1IJW C;  2XIG A;  1QPI A;  2XKP A;  3M3Y J;  1XSV A;  2HR3 A;  3MEX A;  1U9O A;  4Z6Y A;  3NWT A;  1S8N A;  3JRD A;  1D1C A;  4BBS J;  1YJN I;  3B6C A;  1B8I A;  3IRR A;  3CMM A;  2XAH A;  1YJW I;  2EZL A;  2JUC A;  2EFN A;  2R5Z B;  1UCR A;  1HBX G;  2DFE A;  2MH9 A;  1VQ7 I;  1J5Y A;  1FPQ A;  4HV5 A;  2E1M B;  3HRT A;  4C3H J;  5K7Z A;  3HOX J;  3S2W A;  1FLI A;  2CQX A;  3GTM J;  2P6T A;  4U87 A;  2VKE A;  4A5M A;  1UEL B;  1VQK I;  2Y30 A;  2FEZ A;  2YS9 A;  4B3X A;  2HOE A;  2O0Y A;  5K5O A;  2X6Y A;  4A93 J;  5E3O A;  2CQK A;  4I6Z A;  3AG3 H;  5DM7 F;  3I3L A;  2E1O A;  3KEQ A;  2LG4 A;  4HBL A;  3DBH B;  3IP4 B;  2QEN A;  4EQQ A;  1LVA A;  4I7H A;  1W7P A;  3ZN1 A;  1TTY A;  3QU3 A;  4K2E A;  1IGN A;  4HNU A;  3ZQI A;  2LRD A;  2ZJQ F;  4ZC3 A;  1ENH A;  1WJF A;  5EEG A;  2FML A;  3TBI A;  2VQL A;  4I02 A;  1HQC A;  3M8J A;  2JA2 A;  2OZU A;  3ABK H;  2XRO A;  1Z6T A;  1PUF A;  4HX7 A;  3LSG A;  2UV1 A;  1SFU A;  1DGR M;  3T1B A;  2CO5 A;  1IRG A;  5JVG F;  3SYT A;  1MMN A;  1VQN I;  3CUQ B;  1BM9 A;  5GAG J;  5LHI A;  3GFI A;  1BJZ A;  1G3T A;  3FMQ A;  4U88 A;  2IEK A;  3IWZ A;  1D0Z A;  5TGT A;  1MMS A;  2A6H F;  3RTR A;  1MBK A;  4A3I J;  1GVJ A;  4UY8 I;  2IA1 A;  1ZYR F;  5CQE A;  3OL3 A;  2LMD A;  1Z3Y A;  5JFR A;  3LSM A;  3L9F A;  2YU9 J;  2E1N A;  3CO6 C;  5C3E J;  5JVT A;  3HC7 A;  1UZC A;  2DOD A;  4A0Y A;  1MBG A;  5LEK A;  4AIK A;  5IYD J;  3JAM Z;  4A3F J;  4Y15 A;  2PJR B;  1LDJ A;  1T33 A;  2M7A A;  2FXA A;  5J8C A;  3MZH A;  3BR1 A;  1MBH A;  2EIK H;  1SFE A;  3CTA A;  4CZC A;  4Q48 A;  5J1Y A;  2EQR A;  3BRO A;  2LNB A;  2MG4 A;  2DMQ A;  1KQ9 A;  4BEH A;  2CGP A;  1UHW A;  2LBF B;  5J8F A;  4MO7 A;  1D0X A;  3ZQQ A;  2AHQ A;  2EZK A;  4NHJ A;  1FP1 D;  1S9H A;  1R00 A;  4OIO F;  3PNV A;  2KKO A;  2M2E A;  3FKJ A;  3DBR B;  5FLV A;  1I39 A;  3L2V A;  1S7E A;  4HYE A;  2ZNZ A;  4LG0 B;  5D5V B;  3WTV C;  4KIS A;  2L2O A;  2HVS A;  4AD9 A;  4ZYA A;  3EDP A;  4M71 A;  1IXC A;  2XB0 X;  2R3S A;  1GLN A;  1N75 A;  1UB9 A;  4B09 A;  5LD2 C;  1ON1 A;  3OYB A;  3HL2 A;  4OU0 A;  1BBY A;  4XKV A;  5LRR A;  3BY6 A;  3MMY B;  1XS9 A;  4M3D A;  2YUS A;  2L9N A;  5IP6 A;  4O3M A;  1ERD A;  2R5Y B;  5D8K B;  3I55 I;  3GTG J;  1FTT A;  1Y6I A;  4BDY A;  3GVA A;  3G1O A;  1BL0 A;  2IA2 A;  4XRM A;  4YRV A;  3LA3 A;  1RUO A;  1BI0 A;  3G4S I;  2DA6 A;  2ZC2 A;  3Q9S A;  1K6O A;  2TDX A;  4M9Z A;  3HYI A;  2HDW A;  1VQO I;  2V26 A;  4FT8 A;  2MYS A;  4KIF A;  2CV1 A;  1LDK B;  3JRA A;  4TV7 A;  2HQN A;  1UMQ A;  2UUZ A;  3LQQ A;  1YIT I;  5KVR A;  1UHS A;  1X3W B;  3IWF A;  4A3L J;  5EF6 A;  1IXR C;  4F91 B;  4XN3 A;  5IP9 J;  4BHC A;  5J4V A;  1RRJ A;  2DJN A;  1T0F A;  2M3A A;  2W85 A;  2VOO A;  4AVZ A;  2Y0S N;  3FZV A;  3ZMS A;  1XSD A;  4IRH A;  2DMP A;  2QLZ A;  3RKY A;  1SC7 A;  3W2W A;  1YQA A;  2O61 A;  1AOY A;  1G6N A;  1IRX A;  1OYI A;  3JRH A;  3OSG A;  1LNW A;  1R1U A;  4Q4Z F;  1KU3 A;  2XSD C;  2FRH A;  4PUS A;  3TW7 A;  2RAE A;  3ZQG A;  3E5U A;  1ZLK A;  2X4H A;  2CV2 A;  2K9L A;  4M3B A;  3Q3S A;  2NVY J;  4I2O A;  2RVC A;  1ZKG A;  1LVK A;  1TQP A;  1B9N A;  1E3O C;  2BEO A;  1HC8 A;  5J1U A;  2ECC A;  4HLX A;  4PFP A;  1W5C C;  3V4G A;  5FLM J;  1V3F A;  1FJL A;  2WAQ A;  5D5U B;  1ITY A;  1YFH A;  2L54 A;  3SZG A;  3ZRG A;  1Z05 A;  1KON A;  2JPC A;  3BTC A;  4IZZ A;  4G12 A;  2Q1Z B;  5E8G A;  3K70 D;  3K2Z A;  3GZ5 A;  3VSL A;  2PFB A;  2EIM H;  2R7W A;  4ZYE A;  1WPK A;  2R7D A;  2CFX A;  2PMZ N;  4M9X A;  4YIF A;  1YIJ I;  5D5W B;  5ILV A;  2P0W A;  2VQC A;  2VT3 A;  2X6O A;  2MW8 A;  2V7F A;  3WOD F;  2XAQ A;  2QKM B;  4M3E A;  1B59 A;  4XRF A;  1P2F A;  2VJ5 A;  3AL0 B;  2KIM A;  3MZ8 A;  3SDG A;  1OCP A;  3B73 A;  3ECH A;  4HV6 A;  1OLT A;  4MQV A;  2GLO A;  1V5F A;  1IF1 A;  2K3P A;  2B63 J;  4XN0 A;  4F55 A;  1TZL A;  2GWR A;  1FY7 A;  2XF5 A;  5LGN A;  4KN7 X;  2COB A;  1IRF A;  4YII A;  4IPA A;  1MZB A;  2VUM J;  3BJ6 A;  4XKC A;  4QSH A;  5B1B H;  1B9M A;  2OPT A;  4X6A J;  2EZI A;  2M5W A;  2RC4 A;  2JVG A;  2NVX J;  3PNT A;  3E6C C;  2F48 A;  2KFD A;  2O8X A;  2AO9 A;  2CRG A;  4MIM A;  4DW6 A;  3QPL A;  2ZSI B;  3P9K A;  1USS A;  4F92 B;  2WA0 A;  5E79 C;  4IO9 F;  1YW9 A;  1R71 A;  1N77 A;  1MNE A;  1YRN A;  3SQN A;  1V5G A;  4LMY A;  3MKZ A;  2V9K A;  4L9V A;  3G3Z A;  4MNU A;  1CGP A;  1JI8 A;  2QQ9 A;  3GF2 A;  2M7B A;  4M73 A;  3RJP A;  1SMT A;  3DPU A;  2VQG A;  3FK7 A;  3AG4 H;  4L5J A;  3QYB A;  1CF7 A;  2L9S A;  2M0M A;  2IRF G;  3L7W A;  1G3S A;  2EA2 A;  2VJI A;  1CF7 B;  1BI3 A;  1HKQ A;  3DWL E;  3H3Z A;  2NS7 A;  3SEQ A;  1HF0 A;  3OYA A;  1P4A A;  2R7T A;  1Y0U A;  4PJM A;  5EG0 A;  2QSH X;  5CVI A;  3A2K A;  2EK5 A;  5B5E C;  5LRS A;  3OYM A;  4HRI A;  4N9I A;  1VZ0 A;  3S8P A;  4BQN A;  2PN6 A;  2FA5 A;  2QF7 A;  3BPX A;  4ANJ A;  2W4S A;  3GTL J;  3S16 J;  4HEA 2;  3JAM K;  4CHU A;  4L0Z B;  2W7N A;  3P9I A;  3WGI A;  5BPI A;  1RR7 A;  2DDA A;  2FNP A;  2OCC H;  5ILU A;  3DPT A;  5IY5 H;  5DM6 F;  9ANT A;  3H92 A;  1R5H A;  2JPB A;  2V1U A;  4S04 A;  4A3J J;  2LKS A;  4KT6 A;  2F5E A;  3I53 A;  3FIW A;  2LFB A;  1YE9 A;  3ASO H;  3K4C A;  3JSO A;  1R4M B;  4GXO A;  2KL4 A;  3MKY B;  1S7O A;  3WU1 B;  3REO A;  1BR1 A;  2FD5 A;  3E7L A;  2E7X A;  3R0A A;  4E6K G;  1RUN A;  3BR3 A;  4PGH A;  1HW2 A;  1P7J A;  1TC3 C;  3HHH A;  1AA7 A;  1EH6 A;  5HLH A;  2PLY A;  2DOE A;  1E17 A;  2DPD A;  1OCT C;  1IO2 A;  3KX2 A;  1Z6R A;  2ELH A;  3HEF A;  2HI3 A;  4LD5 A;  1VQ8 I;  2AS5 F;  1D5Y A;  2E2I J;  4BQQ A;  3L2C A;  4GO1 A;  3GTP J;  1F1Z A;  3GWZ A;  2LY2 A;  2Q2E A;  2CJJ A;  4XLH A;  2BXY A;  4OIQ F;  3LSK A;  3ZR8 X;  2AXL A;  1NK2 P;  4BE2 A;  4GGG A;  3K4K A;  4L0Y B;  4BBR J;  4M6Y A;  1MJB A;  4YFK F;  4P9F A;  1G59 A;  2XRL A;  5FFZ A;  2V1D A;  2DMT A;  3F8B A;  4RAF A;  2ZCW A;  1AKH A;  3ZOB A;  3CC4 I;  4XM3 A;  1QHH D;  1Z67 A;  3BG9 A;  1OPC A;  3HOW J;  2EV5 A;  2GIZ A;  3L1P A;  5JR3 A;  3FF5 A;  3JRI A;  5DTD A;  4CGZ A;  2XAJ A;  3HZJ A;  2WB1 N;  3H9J A;  4RAG A;  5AIQ A;  5DUI A;  4AIH A;  2XUB A;  3PSF A;  3OWT A;  4LJZ F;  3OYH A;  4IHT A;  1T98 A;  3OIP A;  2QGU A;  3UNG C;  4Y4R A;  2RKH A;  5DCM A;  1QU3 A;  5IYB J;  1X4O A;  2XAG A;  2XPW A;  2OUM A;  2C6Y A;  3BQZ A;  3UR3 C;  4HLY A;  3AG2 H;  4YFX F;  4A5N A;  3KEY A;  2DPU A;  2VQH A;  4B43 A;  3MQ0 A;  3JR9 A;  3I56 I;  3TDU C;  4XOT A;  2KRC A;  1FIA A;  1OIS A;  4YG2 F;  4IQ4 A;  4XLP F;  1LFP A;  1Q1H A;  2ME0 A;  3CDI A;  2WWY A;  3R0J A;  2JSP A;  2OA4 A;  2ESH A;  1LUJ B;  1Z0X A;  2L7F P;  5C4X J;  2VI6 A;  2VPL A;  2I8D A;  2ZJP F;  2FBH A;  2QYO A;  3GZ6 A;  3O8G A;  4OAZ A;  3R4K A;  3OIO A;  1S3J A;  4ZZL A;  3CCQ I;  1I27 A;  3CLQ A;  1JHF A;  2GOM A;  3CLO A;  5FLX K;  3Q0V A;  2W1O A;  2N8G A;  5HLI A;  4CDG A;  1HW1 A;  1FX7 A;  2X51 A;  2Y9Z A;  3QPH A;  3VPR A;  4BJT A;  4Y7N J;  2FU4 A;  2WV0 A;  3R61 A;  1R36 A;  4RA2 A;  5ICE A;  1U5T A;  2ME6 A;  3DEE A;  2WBM A;  3CCM I;  5JHU A;  1GHC A;  4AIJ A;  2KLO A;  1WJB A;  4P9U A;  2ELJ A;  2WY7 Q;  4NQW B;  3PUF A;  2R4G A;  2LTP A;  2K85 A;  2EFQ A;  3M9A A;  4L5E A;  3GX4 X;  2JA6 J;  5BPD A;  2LKP A;  4CCL A;  4IRI A;  2K27 A;  4WCG A;  1J09 A;  1H8A C;  2XHK A;  3QYE A;  4DGW B;  2KDZ A;  3F22 A;  5L3D A;  4M9S A;  2IBD A;  4Y33 A;  2DA7 A;  4BKX A;  1OCR H;  1ZRD A;  2BZT A;  4N4N B;  2DK8 A;  2ELK A;  2Y48 A;  3ABT A;  5J6X A;  5EGO B;  5GAH J;  4PJN A;  5FKL A;  2G9W A;  2GBY A;  2CYY A;  1C0W A;  5FRN A;  2A6E F;  4WK8 F;  2HVQ A;  2R7V A;  4XQF A;  5TRD A;  1Z7U A;  3DLA A;  3I59 A;  4HAM A;  1WKM A;  2OTJ I;  4EGZ A;  3IKV A;  1Z21 A;  1ZTR A;  1FWZ A;  3GFL A;  1IAW A;  2L0K A;  4JX5 A;  2L4M A;  4D1Q A;  2H1K A;  5CVU A;  1D1B A;  2WAD A;  3HRM A;  1JT0 A;  1OCC H;  4J01 A;  3E6M A;  1T39 A;  3BR0 A;  4IOA F;  1ETQ A;  2L02 A;  2VIX A;  1TLH B;  1R7J A;  4NUB A;  4QLC U;  4UXN A;  2HPM A;  4A3C J;  5F08 A;  1FBU A;  2FF4 A;  2CFO A;  4BU2 A;  3JSP A;  3LNQ A;  1YJ9 I;  3WHC A;  2LC2 A;  1TQM A;  3SJM A;  1IV6 A;  4RM2 A;  5L3F A;  2EBI A;  4A0X A;  2DBB A;  2Z1D A;  2ZXW H;  2W00 A;  1ZG3 A;  1RPW A;  1JTX A;  3HTU A;  2K9S A;  1Y8R B;  2UXN A;  1HST A;  2L7K A;  4BUP A;  3PFY A;  2Y75 A;  4E4H A;  1ODD A;  3ECO A;  2V9V A;  2IS6 A;  3ZQF A;  5ICC A;  3LMM A;  2ZME B;  5IT3 A;  3GTQ J;  2EIN H;  3LFU A;  2R7R A;  1OR7 A;  3WTY C;  1VQ4 I;  1P92 A;  4A2U A;  2E19 A;  4D9J A;  2O6G E;  4OAY A;  4RLF A;  3BCB A;  1HA8 A;  3BPV A;  4IHW A;  3CC7 I;  4EJU A;  2X1E A;  3ZXS A;  4BAY A;  3KPH A;  4A12 A;  4BAC A;  4E7H A;  3TP3 A;  1X1P A;  2DQR A;  4UUS A;  1F5T A;  3VOE A;  4HQM A;  2HWV A;  2LRE A;  3I9V 2;  3HUG A;  3MN2 A;  4EJV A;  3A0H C;  2CQN A;  2F5D A;  4AM3 A;  4ON0 A;  3I0T A;  1X3Z B;  4OIR F;  3VOD A;  1WZ2 A;  3RIR A;  4BS9 A;  1IDZ A;  2HDD A;  5L3G A;  5J3L A;  2ZBK A;  3PIO F;  2CUE A;  1QNT A;  5CVJ A;  3H35 A;  1XCV A;  3I5U A;  4BDZ A;  5F64 A;  4UB8 C;  1NK3 P;  2W24 A;  4M74 A;  3SZP A;  1U6G A;  3GTO J;  2F5V A;  1BJA A;  2QQ8 A;  3DKY A;  4F3Q A;  4WF2 A;  3CJR B;  3C2G A;  3BWG A;  2OV7 A;  4IHX A;  4C2M J;  2HYJ A;  3VFZ A;  4OIP F;  5KHD A;  2GQQ A;  3GXO A;  3FXK A;  3OYI A;  4UNO A;  1KYW A;  4UVB A;  3HKZ N;  1QZZ A;  1ZAR A;  4LIV A;  5CPR B;  4JX6 A;  4KA4 A;  1S72 I;  5GAD J;  5LFA A;  4KUM A;  5GTI C;  3JRB A;  2NVQ J;  1FMW A;  1ONV A;  2NAZ A;  5FD6 A;  4KT5 C;  1RKW A;  2A3S A;  1VQP I;  1R4N B;  1JE8 A;  1RKT A;  3PL8 A;  4F52 A;  3OMY A;  4A3M J;  4C3J J;  3JTH A;  3WTX C;  2O9L A;  3KP4 A;  1Z9C A;  5IT9 Z;  1HLV A;  1B8I B;  5LLQ A;  4Z2Y A;  2DOF A;  4PCQ A;  1W4M A;  3BR6 A;  2HTJ A;  3QAH A;  3S1N J;  2BY0 A;  3IC7 A;  3PUB A;  2B0L A;  4IHS A;  2VON A;  3QU6 A;  3BCA A;  1IN6 A;  2CV0 A;  3CD6 I;  1OR7 C;  3HGG A;  2YX7 A;  3KFW X;  2PX9 A;  2H6C A;  5A2Q Z;  3I54 A;  2HOT A;  1P6R A;  2BY2 A;  1A6I A;  5LGU A;  3RPU A;  2K9N A;  1SD4 A;  5E18 F;  2PJP A;  4U0Y A;  4FCY A;  4DZP A;  3H1C A;  3GTK J;  1QBJ A;  1KZH A;  3I64 A;  1MBE A;  1BOB A;  3S14 J;  2IGK A;  3RKQ A;  3HTS B;  4V2F A;  4MTD A;  4P5O A;  2D1H A;  4N0B A;  1A31 A;  2P4W A;  1DPR A;  2I5U A;  2W48 A;  5E3L A;  2LVS A;  1W7P B;  2JN6 A;  2OBP A;  1R23 A;  3HSR A;  2G7U A;  2MGQ A;  2ZSH B;  2HU9 A;  3HBL A;  2OCE A;  1JUM A;  3DBL B;  3K4N A;  1XSX A;  3COA C;  4I09 A;  3WGG A;  4Q5S F;  1OMI A;  2OD5 A;  3ROU A;  4IQJ A;  2DJI A;  4FTH A;  1KGS A;  3BQY A;  1FZP B;  2Y2Z A;  1PUF B;  1TW2 A;  3ABU A;  2HYF A;  2E35 A;  1W36 D;  1I1G A;  2K02 A;  4I99 C;  1QVU A;  4QPQ A;  4Y13 A;  2YX4 A;  3J80 Z;  3L09 A;  3WTU C;  1MGT A;  2XGX A;  2NVT J;  4KIG A;  4DQ2 A;  4BXX J;  2K4J A;  3HHG A;  3PNY A;  1S29 A;  4LOC A;  4CCK A;  2M4K A;  1NH3 A;  1BR2 A;  3J7Z I;  3K69 A;  2B9S A;  2E36 A;  1HSJ A;  2W57 A;  3BZC A;  4BQO A;  1WHU A;  4KDP A;  4V2G A;  4MGR A;  3LSI A;  4CIC A;  1BA5 A;  5F1J A;  3TW6 A;  4HF2 A;  2ZKZ A;  1W7P D;  4HF1 A;  4HOB A;  1J0R A;  4UUT A;  4B47 A;  5K5R A;  5KAF C;  2G0E A;  4ENK A;  2WTE A;  4WXC A;  4U0W A;  1WVR A;  5ICG A;  4LLG F;  2QWW A;  1O3T A;  4B3A A;  4G8X A;  4XLF A;  3OR1 C;  4XIC A;  2DFI A;  2VOD A;  3ZMT A;  2G7H A;  2YSR A;  2E1M C;  4RB3 C;  2R7Z J;  3DEU A;  4IVN A;  4CCO A;  2Y9Y A;  2IAI A;  4BEH B;  1P9Q C;  4KFC A;  3A02 A;  2DT5 A;  2DA3 A;  1IN4 A;  3LST A;  2A07 F;  5FO5 A;  1N25 A;  3DP7 A;  3O6B B;  1Z7L A;  1HCR A;  2DDB A;  4KMU X;  3S3N A;  1FOX A;  5E1X A;  1X4P A;  3H5N A;  1U78 A;  2VBZ A;  4AVP A;  3K7A J;  4I76 A;  1X2N A;  3CUO A;  4IKF A;  1TWF J;  2J5O A;  2MLG A;  3QQA A;  3H9G A;  4XOR A;  1VTN C;  2V6C A;  1SFX A;  1MSE C;  3VEP A;  1BN5 A;  2QZ8 A;  2XAS A;  3K4B A;  1ZG1 A;  1SVM A;  1WCM J;  3CDL A;  1ACI A;  1OCO H;  4L9N A;  3BOQ A;  4MLO A;  2MH2 A;  4AYB A;  3BG5 A;  5LGT A;  2YR2 A;  1ZG5 A;  2M87 A;  3VDX A;  4JQF A;  1QGP A;  1IUY A;  2XVC A;  2IT0 A;  3WG9 A;  4OMZ A;  4KIB A;  4UB6 C;  1H0M A;  2Z5U A;  1N78 A;  3HOY J;  4X1E A;  4KJZ A;  1YHQ I;  2FOK A;  2H09 A;  4DYQ A;  2IXS A;  4C3I J;  3QWL A;  4G7Z F;  3GBG A;  1K61 A;  1GVD A;  4ASN A;  4EJW A;  4GYG A;  3ZP5 A;  5C4J J;  5LHG A;  2VBX A;  3VYS B;  1D8J A;  2GA1 A;  4AID A;  3T0Y A;  1K78 A;  5EYR A;  4G9Y A;  4ENJ A;  4XR6 A;  2VC0 A;  4NDL A;  3HDD A;  5E3M A;  3I58 A;  1ZGA A;  1K78 B;  2CG4 A;  3S2H J;  2P5V A;  2R92 J;  3BZ6 A;  2JA7 J;  3OYN A;  2JA8 J;  3ZQL A;  2XF7 A;  2MAB A;  3DQV C;  4EEF G;  1TL8 A;  2A69 F;  2LLK A;  5EJC A;  3G71 I;  2CUJ A;  1DQU A;  2KIQ A;  3KCC A;  1SD7 A;  1TWG J;  3KYC B;  2RNG A;  4IX7 A;  2A05 A;  5EDN A;  4OIN F;  2M8E A;  2PMH A;  2D5V A;  3CP2 A;  2EB7 A;  3FBN B;  4ITV A;  4KN4 X;  1LE8 A;  3F0C A;  3CJT B;  3TDZ C;  5E8I A;  3QOP A;  2XSJ C;  2XPV A;  5KNL A;  3KIO A;  2PBI A;  1YW8 A;  3B02 A;  1T56 A;  2D45 A;  3TO9 A;  1X1B A;  5C44 J;  3QYF A;  3R60 A;  3J81 Z;  1UFM A;  1FYL A;  1X19 A;  2MC3 A;  3FXL A;  1SFO J;  1FYM A;  1GT0 C;  2GA2 A;  5TIS C;  1QVT A;  5B1A H;  1RC9 A;  2P6S A;  4PDK A;  5DD8 A;  1ON2 A;  4EJT A;  1V55 H;  1CQT A;  5IT9 K;  3W3C A;  5DDG A;  3ZQC A;  5E17 F;  5F0F A;  3KZY A;  3H3V K;  3CDH A;  1ZH5 A;  2B7E A;  2IA0 A;  1S5L C;  2ID6 A;  1FOY A;  2DMU A;  3V42 A;  4HNV A;  4GYI A;  1B1B A;  3QP5 A;  3FXM A;  5M3M J;  2X9D A;  4Y52 J;  1MH3 A;  4RDU A;  1GV5 A;  3ONQ A;  2KP6 A;  3EUA A;  1B72 A;  2BYV E;  4RGS A;  1LFB A;  2HOS A;  1I6X A;  1ZQ3 P;  3GEZ A;  1XMX A;  2LDU A;  3GCM A;  4IL6 C;  4CYD A;  3CCS I;  3QOE A;  3DKX A;  3C2H A;  3DU5 A;  4C30 A;  4IOC F;  3V7C A;  3K70 C;  1MND A;  2UWM A;  2DO7 A;  3KYL A;  2HEO A;  3S1M J;  3PJR A;  2QBY A;  5BOX A;  2VXZ A;  2VPR A;  3KLO A;  1DPU A;  4E7I A;  1YRN B;  3HOZ J;  1BI2 A;  3HM5 A;  4CCJ A;  3F23 A;  4DJA A;  1EH7 A;  2CS3 A;  3IH2 A;  3SFZ A;  2VLA A;  2QM3 A;  1WSU A;  4D5F A;  1ZRE A;  1SAU A;  2X48 A;  1U8R A;  3R6S A;  3RYR A;  2DA5 A;  2Q0O A;  2JA5 J;  2HNH A;  5GTH C;  2F5C A;  1SD5 A;  1MD0 A;  4EM2 A;  3LSR A;  3EUH A;  4ABZ A;  4BXU A;  3K4J A;  1MMD A;  3HPH A;  1W1W E;  1ZEL A;  5EG0 B;  5DD4 A;  1FYK A;  4MEX F;  2JMW A;  2ZJR F;  4XKW A;  2L9R A;  5LHH A;  1XGN A;  2QQA A;  3K2A A;  1R9T J;  2IGM A;  3M07 A;  2R7X A;  1YS7 A;  5GAE J;  2DA4 A;  1FNN A;  2BW3 A;  4I98 B;  3HOT A;  1SEU A;  2PMU A;  1ETO A;  3DEW A;  3O2P E;  4RS8 A;  3FX3 A;  4V19 K;  2K5C A;  2KIF A;  4IXA A;  4Q47 A;  3S17 J;  2MC4 A;  2L01 A;  3H9Q A;  1SD6 A;  3FXJ A;  2KMU A;  3ML6 A;  1KU9 A;  2WAE A;  1UHM A;  1RET A;  4S0H B;  1I1S A;  2RNJ A;  3EET A;  1XPX A;  4P55 A;  3BTI A;  1DUX C;  1XC5 A;  5JLX A;  1V5E A;  5D8L B;  4EM0 B;  3D5R C;  4MEY F;  2RN7 A;  2LY1 A;  2HTS A;  2KDO A;  3E1S A;  4OWR B;  3HSF A;  4LGW A;  2XGC A;  4M6V A;  2DW4 A;  5ERI A;  3TP0 A;  5IOY A;  3H5R A;  3MAJ A;  1XD7 A;  1D0Y A;  1Z91 A;  3RPQ A;  1L0O C;  2D1V A;  2EA4 A;  2OC6 A;  2K4B A;  1HKS A;  1IDY A;  4II3 A;  4OMY A;  1ETV A;  3M1C A;  2R7U A;  1ZGJ A;  1S6L A;  3RKW A;  1BW5 A;  1JUP A;  2XKO A;  2JUG A;  3F6V A;  3V8L A;  4FIS A;  1A04 A;  4DNC A;  1JJ6 C;  3H36 A;  3VYU B;  2Q2E B;  3GYH X;  1FOK A;  3PO3 J;  3GO5 A;  4KMF A;  1QRY A;  2MLK A;  2TRT A;  1YI2 I;  2DFF A;  2ZJ2 A;  3MZY A;  1DU0 A;  4OOI A;  2BHZ A;  1YO5 C;  1VQ6 I;  3GW2 A;  3EUH C;  3CF5 F;  1I3A A;  1AKH B;  3JRF A;  1MMA A;  3DTE A;  3IV5 A;  3ISP A;  6PAX A;  2WAQ N;  2O5R A;  1DU6 A;  3FXO A;  2K40 A;  4PK4 A;  1PJR A;  1IUF A;  4ENM A;  3G73 A;  5EEA A;  4EJO A;  4HST A;  2IGN A;  1A36 A;  1Z3X A;  4HNT A;  3CMY A;  4HDU A;  4ZDL A;  2HZD A;  3RQI A;  3WE2 A;  3ZGK A;  1TT0 A;  3S15 J;  1LEB A;  1RR8 C;  4M3G A;  2DA2 A;  2KJB A;  4NBQ A;  4BY1 J;  2PG4 A;  3J7Y J;  2GM4 A;  1WQ2 A;  1MKM A;  3GTJ J;  5LEJ A;  5DCM B;  4A3E J;  2E5N A;  2GOX B;  1QPM A;  3DU6 A;  4UV9 A;  2STW A;  4H0E A;  1MBF A;  1UG0 A;  4FQG A;  1TWC J;  3O3K A;  2L5Q A;  2BOL A;  2E7W A;  2LD5 A;  1JKP C;  2F4I A;  2JWT A;  3FMS A;  2UXX A;  3MCZ A;  2ZFW A;  1JKR C;  4E7L A;  3BZK A;  2VJJ A;  3A4C A;  3TOB A;  1JKQ C;  3F9K A;  1MSF C;  2D2W A;  1ZHF A;  2E60 A;  1BC7 C;  1TNS A;  2LK2 A;  1BW6 A;  3I4P A;  4QWQ A;  1JT6 A;  1R6R A;  2LYC A;  2RQQ A;  4MFD A;  2V1N A;  4RAY A;  4XSZ F;  5E1Z B;  4D0P A;  3WGH A;  3A01 A;  3BC8 A;  4XLE A;  5FB2 A;  3T8T A;  2M45 A;  5FKK A;  1ZR2 A;  1ULY A;  1TBX A;  1OYW A;  3QP6 A;  3M4O J;  1Z1D A;  4D5C A;  1Y0N A;  3A1Y A;  2OQG A;  5H6R A;  4E70 A;  2LR8 A;  5J4Y A;  2LKX A;  3OYF A;  1ZGW A;  4CXF A;  2I10 A;  4UVA A;  2QEX I;  2O7O A;  5IPA A;  3D1N I;  2E2H J;  3WU2 C;  3V8J A;  2ACJ A;  2GXB A;  1U5T B;  5JHF A;  3OYE A;  5H6Q A;  1VI0 A;  2VBW A;  2MD5 A;  4DYR A;  2BVM A;  3OYJ A;  1U9N A;  3KP6 A;  2Z33 A;  4E7K A;  1VQ9 I;  3CMA I;  2JRM A;  1U2W A;  4BGD A;  3OYC A;  3I4N J;  1M1E B;  2NXN B;  3DPL C;  4XL9 A;  4EV0 A;  3RI4 A;  4N4O B;  3TO7 A;  1X1D A;  3SDB A;  3TO6 A;  4A3D J;  2OTL I;  4RGU A;  3AG1 H;  3F21 A;  1U8B A;  2EZH A;  3MKL A;  1XGM A;  3U1D A;  4M72 A;  2RV8 A;  2M0C A;  2HGC A;  2E34 A;  4BJ6 C;  3N4M A;  1LFU P;  1D8K A;  1SFK A;  3P5J A;  1K7A A;  2CQQ A;  4RB0 A;  1O3S A;  1NG7 A;  2JT1 A;  1FMV A;  4O6J A;  4MHG A;  1PUE E;  2DLL A;  5CJ9 A;  1XGO A;  2XDV A;  3HXL A;  3I59 B;  2ESN A;  5K5Q A;  4LIT A;  1I5Z A;  3D5S C;  4FX0 A;  4WXH A;  3CCU I;  4ZDP A;  1R1V A;  3VYT B;  3BR2 A;  5L3E A;  1YLF A;  1IZ1 A;  2P5K A;  2H27 A;  3LSP A;  1HDD C;  1YX5 A;  3RKX A;  2NOJ B;  2VKH A;  1OJL A;  2KPM A;  3K6G A;  5FGM A;  5J1R A;  3L2Q A;  2LH9 A;  4D7M A;  4HW0 A;  4U0V A;  2KHM A;  3D5L A;  2EFP A;  1XCB A;  3IH3 A;  1B4A A;  3KET A;  3F8C A;  3WTT C;  3A0B C;  1QO0 D;  1NHA A;  1U0J A;  3UKG A;  1O3Q A;  1I3Q J;  1VF9 A;  1ETW A;  2L7M P;  3CCR I;  2W84 A;  2Y0M A;  2IPQ X;  1GXQ A;  4HSR A;  2A5W A;  1UJ8 A;  2CH0 A;  2V79 A;  3H3U A;  1JHH A;  2M30 A;  2QSF X; 
#chains in the Genus database with same CATH homology
 5DYM A;  2PQ8 A;  2EV6 A;  4HDV A;  2Q8K A;  1ZRF A;  3E5X A;  4R8H A;  3RDI A;  1P4X A;  5F1R A;  2PEX A;  2ETH A;  2HFH A;  2JTV A;  4KYW A;  2V1X A;  3BP8 A;  3LAP A;  3LFK A;  5HDK A;  2JRT A;  3ZN0 A;  5ICF A;  1O57 A;  1LDD A;  1YIO A;  4WWC A;  1EH8 A;  1ZAO A;  1L3L A;  3JW4 A;  4HZF A;  3K1P A;  1GXP A;  1YG2 A;  1R1T A;  3FXU A;  1O7L A;  3E5Q A;  1BIA A;  5DEQ A;  2LF8 A;  3EYY A;  1MJ9 A;  3V8K A;  2FBK A;  3WE3 A;  4I0B A;  3WTW C;  1MDM A;  2QVO A;  4U7D A;  2VE8 A;  2Z99 A;  5HVQ C;  4L9J A;  1K79 A;  3SXY A;  2H94 A;  2QUF A;  3C7J A;  2EV0 A;  2A68 F;  2HKO A;  3BJO A;  5CVV A;  5D6F A;  2VBY A;  3P7N A;  2P7V B;  3F8F A;  2P7C B;  4MQ9 F;  3TQN A;  4ZYG A;  3ZMV A;  1UST A;  5K1Y A;  3MWM A;  5LBQ A;  2EFO A;  3GFM A;  3TKY A;  4R1H A;  3Q5F A;  1KA8 A;  4RGR A;  5FFX A;  3ZMU A;  2UZK A;  1FBS A;  3ULQ B;  3WU0 A;  3M7G A;  4IF4 A;  2VE9 A;  1O3R A;  1J75 A;  4Y17 A;  3V7S A;  2O3F A;  1FSH A;  1YS6 A;  1WWX A;  2FSW A;  3CUQ A;  4ZYH A;  2HS5 A;  3QPT A;  2NS0 A;  1YTY A;  1RI7 A;  3KP7 A;  4I0A A;  3WTZ A;  3W6K B;  2EFW A;  1QZY A;  2HKX A;  4KNY A;  1JGS A;  3LAJ A;  1V4R A;  1F9N A;  4A6E A;  3E6B A;  2GXG A;  4M6X A;  4BH9 A;  4RGX A;  3I71 A;  3U9G A;  2HZT A;  2BBY A;  3J7A O;  2P8T A;  5L3C A;  5KK1 A;  4LG0 A;  4JBA A;  3NEU A;  1W5S A;  5E20 A;  1FBQ A;  3KEO A;  1KYZ A;  3F8M A;  5AIP A;  2XRN A;  2GZW A;  4A6D A;  4BNC A;  3FM3 A;  4YFN F;  1YYV A;  3RYP A;  4BQA A;  2DU9 A;  3FMR A;  2FBI A;  1OKR A;  4LB6 B;  2OAZ A;  1H9G A;  3CUQ C;  3KZZ A;  1S7A A;  2EWN A;  3M1E A;  1TNT A;  1PP8 F;  1IW7 F;  3N97 A;  1ZLJ A;  3KP5 A;  3M8F A;  2KJC A;  2STT A;  1G3Y A;  1SMY F;  3BJA A;  2JSC A;  3KLN A;  3MFK A;  1T6S A;  2IJL A;  2F5F A;  3CO7 C;  4EM1 A;  3D0S A;  4G94 A;  1W5T A;  4UVC A;  2NYX A;  3P9C A;  4EVI A;  4HA8 A;  3C1D A;  3E3V A;  4AWX B;  1ZN2 A;  2HYG D;  3FM5 A;  1KU2 A;  2VT2 A;  3DV8 A;  2IW5 A;  1O7F A;  4IJA A;  5HOO A;  2ISY A;  4JK1 X;  2BGC A;  5D4S A;  5HDN A;  4KIC A;  1R58 A;  2OU2 A;  2NNN A;  1G3W A;  3SHF A;  2ADU A;  3NQO A;  5FLX Z;  3ELK A;  3HSE A;  5HDG A;  1D5V A;  2JZY A;  5A2Q K;  5ED4 A;  1LEA A;  2XAF A;  3VB2 A;  2ZO4 A;  2M1B A;  1PDN C;  3K0L A;  1IN8 A;  4EGY A;  2K86 A;  2FNA A;  3BDD A;  3HOS A;  1IN5 A;  3FXR A;  2L4A A;  2IVM A;  2DAO A;  1OYY A;  3KE2 A;  2L3D A;  1T2K A;  1P4W A;  3F6O A;  5EEH A;  5JI6 A;  2QBY B;  5HLG A;  2MBF A;  1KQ8 A;  4UUV A;  4ESB A;  4HQE A;  3ZPL A;  3FXQ A;  4ENN A;  1FT9 A;  3Q9V A;  4LK1 F;  3KP3 A;  3J80 K;  5D6E A;  3W6J B;  4WX9 A;  1TW3 A;  1TQI A;  2LSO A;  4ZH4 F;  3SZT A;  3LQR A;  2QQB A;  2K7L A;  3T5X A;  2GAU A;  2KRF A;  5ILS A;  2E1C A;  5E1W A;  4LFU A;  4ETS A;  5BMZ A;  3U2R A;  3HRS A;  1AWC A;  3KP2 A;  3IRQ A;  1IN7 A;  2CW0 F;  3F72 A;  4RAZ A;  1HXD A;  2GIV A;  3PQK A;  5F6F A;  2YU3 A;  5CVR A;  3ZQ7 A;  1DP7 P;  4PZJ A;  2A5Y B;  1R5G A;  3EQL F;  1BOA A;  3PQJ A;  2MA3 A;  4FX4 A;  1F4K A;  4B8X A;  4XBF A;  2ZXJ A;  1U3E M;  2EJR A;  4XLN F;  4I01 A;  2OQR A;  1T38 A;  5H20 A;  1HKT A;  4LK0 F;  1XMA A;  3E6D A;  4ESF A;  2ISZ A;  4UHT A;  5HS9 A;  5BS6 A;  2VOP A;  1RIO H;  2RDP A;  4PGG A;  2WC2 A;  2COM A;  3K1M A;  4P96 A;  1HW5 A;  1BI1 A;  4CO8 A;  1H9T A;  4UV8 A;  3GUD A;  5DCF A;  4LLN A;  4N9H A;  4LB5 A;  3ZMZ A;  1J2X A;  3GFJ A;  2A61 A;  2YPR A;  2BV6 A;  2X0L A;  1G4D A;  4G6D A;  5CLS A;  5DUK A;  3L00 A;  1YW7 A;  1XB4 A;  1JXS A;  3V7R A;  3ERE D;  3WTS C;  5HS7 A;  1B6A A;  1D3Y A;  1XDU A;  4ZZD A;  2H6B A;  2DK5 A;  5DV5 A;  4LLL A;  2IP2 A;  3DFG A;  3JTG A;  4NB5 A;  1BC8 C;  1LQ1 A;  2HDC A;  3IL2 A;  2FE3 A;  1RZ4 A;  1XDS A;  3M8E A;  1J59 A;  4BHP A;  2FMY A;  2OZ6 A;  4F7Z A;  5L3B A;  2RQP A;  4XSX F;  2P5L C;  3J81 K;  1PP7 U;  4L18 B;  2DQL A;  2CWE A;  4HX8 A;  1R22 A;  4RB1 A;  2LF7 A;  3K9T A;  1XN7 A;  5FD5 A;  4ESJ A;  2W25 A;  4EMS A;  3DF8 A;  1J9I A;  2VN2 A;  5AON A;  3OOP A;  3HIF A;  1RNL A;  3LA2 A;  4FHT A;  2FQ3 A;  2F2E A;  3E97 A;  4BYY A;  1X3U A;  4NQW A;  2KIU A;  3C18 A;  4CZZ A;  3C3W A;  1QQI A;  2Z9O A;  4IRG A;  1STZ A;  1J7K A;  1FSE A;  3TGN A;  4WXD A;  3IHU A;  2HQR A;  4RB2 C;  4U7B A;  3F8N A;  4L9T A;  1EV7 A;  2Z3Y A;  5HS8 A;  5D5X B;  4S05 A;  2R7F A;  3T8R A;  1IXS B;  3FHZ A;  1WRJ A;  2BE5 F;  1MJA A;  4A0Z A;  1E2X A;  2DTR A;  2CSO A;  3ZMD A;  4MTE A;  3EYI A;  2NRA C;  3K1N A;  4L5I A;  4G6Q A;  1KQ0 A;  4G7O F;  1XGS A;  3LA7 A;  3AAF A;  4GCV A;  3HRU A;  1BIB A;  1FC3 A;  2DI3 A;  2ZME A;  1LB2 A;  1SAX A;  3F3X A;  3NRV A;  1XMK A;  3GLX A;  3LWF A;  1REP C;  3PFI A;  2NNY A;  3CJN A;  1U5T C;  3IKT A;  1LJ9 A;  4R79 A;  4BHB A;  2O03 A;  5CYV A;  2XV4 S;  4HX4 A;  1FP2 A;  1ZRC A;  3FWE A;  4G7H F;  2PI0 A;  2VC1 A;  4HF0 A;  4ZYD A;  3DXJ F;  3OV8 A;  5TJJ A;  5BQT A;  2J5P A;  5D4R A;  1WI9 A;  2RGV A;  3QRF F;  4O5V A;  1DDN A;  3TOA A;  1MDM B;  1KU7 A;  2ZNY A;  3DKW A;  2XIG A;  2XKP A;  1XSV A;  2HR3 A;  3MEX A;  1S8N A;  3IRR A;  2XAH A;  2EFN A;  1UCR A;  1HBX G;  2MH9 A;  1J5Y A;  1FPQ A;  4HV5 A;  1FLI A;  3HRT A;  3S2W A;  2P6T A;  4A5M A;  2FEZ A;  2HOE A;  2O0Y A;  5K5O A;  2CQK A;  3KEQ A;  4HBL A;  2QEN A;  4EQQ A;  1LVA A;  4I7H A;  3ZN1 A;  1W7P A;  1TTY A;  3QU3 A;  4K2E A;  5EEG A;  2FML A;  4I02 A;  1HQC A;  2OZU A;  2XRO A;  1Z6T A;  4HX7 A;  1SFU A;  3T1B A;  2CO5 A;  1IRG A;  3CUQ B;  1BM9 A;  5LHI A;  3GFI A;  4U88 A;  1G3T A;  3FMQ A;  3IWZ A;  2A6H F;  3RTR A;  1GVJ A;  2IA1 A;  1ZYR F;  5JFR A;  3L9F A;  2E1N A;  3CO6 C;  5JVT A;  4A0Y A;  5LEK A;  4AIK A;  3JAM Z;  4Y15 A;  1LDJ A;  2FXA A;  5J8C A;  3MZH A;  1SFE A;  3CTA A;  4Q48 A;  3BRO A;  2LNB A;  2CGP A;  1KQ9 A;  1UHW A;  5J8F A;  4NHJ A;  1FP1 D;  1R00 A;  4OIO F;  2KKO A;  4HYE A;  2ZNZ A;  4LG0 B;  5D5V B;  3WTV C;  4AD9 A;  3EDP A;  4M71 A;  1IXC A;  2R3S A;  4B09 A;  1UB9 A;  1ON1 A;  4OU0 A;  1BBY A;  5LRR A;  3BY6 A;  4O3M A;  5D8K B;  3GVA A;  2IA2 A;  3LA3 A;  1RUO A;  1BI0 A;  3Q9S A;  1K6O A;  2TDX A;  4M9Z A;  3HYI A;  4FT8 A;  4KIF A;  1LDK B;  4TV7 A;  2HQN A;  3LQQ A;  5KVR A;  3IWF A;  1IXR C;  4BHC A;  1T0F A;  2W85 A;  2VOO A;  3FZV A;  1XSD A;  3ZMS A;  4IRH A;  3RKY A;  2QLZ A;  1YQA A;  2O61 A;  1AOY A;  1G6N A;  1OYI A;  1LNW A;  1R1U A;  4Q4Z F;  1KU3 A;  2FRH A;  3E5U A;  1ZLK A;  2X4H A;  4I2O A;  2RVC A;  1TQP A;  1B9N A;  2BEO A;  4HLX A;  3V4G A;  1V3F A;  5D5U B;  1YFH A;  2L54 A;  1Z05 A;  2JPC A;  5E8G A;  3K2Z A;  3GZ5 A;  2PFB A;  4ZYE A;  2R7D A;  2CFX A;  4M9X A;  4YIF A;  5D5W B;  5ILV A;  2VT3 A;  3WOD F;  2XAQ A;  4XRF A;  1B59 A;  1P2F A;  2KIM A;  3B73 A;  3ECH A;  4HV6 A;  4MQV A;  1IF1 A;  2GWR A;  1FY7 A;  5LGN A;  4KN7 X;  1IRF A;  4YII A;  4IPA A;  1MZB A;  3BJ6 A;  1B9M A;  2M5W A;  2RC4 A;  3E6C C;  2O8X A;  3P9K A;  1USS A;  1YW9 A;  3SQN A;  4LMY A;  4L9V A;  3G3Z A;  4MNU A;  1CGP A;  2QQ9 A;  3GF2 A;  4M73 A;  3RJP A;  1SMT A;  4L5J A;  1CF7 A;  2IRF G;  3L7W A;  1G3S A;  2EA2 A;  1CF7 B;  1BI3 A;  1HKQ A;  3H3Z A;  1P4A A;  1Y0U A;  5CVI A;  2EK5 A;  5LRS A;  4N9I A;  2PN6 A;  2FA5 A;  3BPX A;  3JAM K;  4CHU A;  4L0Z B;  3P9I A;  3WGI A;  5BPI A;  2FNP A;  5ILU A;  3DPT A;  3H92 A;  1R5H A;  2JPB A;  2V1U A;  4S04 A;  2F5E A;  3I53 A;  3JSO A;  4GXO A;  1S7O A;  3WU1 B;  3REO A;  2E7X A;  3R0A A;  1RUN A;  4PGH A;  1HW2 A;  3HHH A;  1EH6 A;  5HLH A;  2PLY A;  1E17 A;  2DPD A;  1Z6R A;  2ELH A;  4LD5 A;  2AS5 F;  3L2C A;  4GO1 A;  1F1Z A;  3GWZ A;  2Q2E A;  4OIQ F;  2AXL A;  4GGG A;  4L0Y B;  4M6Y A;  1MJB A;  4YFK F;  4P9F A;  5FFZ A;  2V1D A;  3F8B A;  2ZCW A;  1OPC A;  2EV5 A;  5JR3 A;  3FF5 A;  4CGZ A;  2XAJ A;  5AIQ A;  5DUI A;  4AIH A;  2XUB A;  4LJZ F;  4IHT A;  1T98 A;  2RKH A;  5DCM A;  2XAG A;  2C6Y A;  4HLY A;  4YFX F;  4A5N A;  2DPU A;  3MQ0 A;  3TDU C;  4YG2 F;  4XLP F;  1Q1H A;  2WWY A;  3R0J A;  2OA4 A;  2ESH A;  2FBH A;  2QYO A;  3GZ6 A;  3R4K A;  1S3J A;  4ZZL A;  1I27 A;  1JHF A;  3CLO A;  5FLX K;  5HLI A;  4CDG A;  1HW1 A;  1FX7 A;  3QPH A;  2FU4 A;  2WV0 A;  3R61 A;  1R36 A;  5ICE A;  1U5T A;  5JHU A;  1GHC A;  4AIJ A;  4P9U A;  3M9A A;  2EFQ A;  3GX4 X;  5BPD A;  2LKP A;  4IRI A;  2K27 A;  4WCG A;  2XHK A;  3F22 A;  5L3D A;  4M9S A;  1ZRD A;  2DK8 A;  3ABT A;  2Y48 A;  5J6X A;  2G9W A;  2CYY A;  1C0W A;  2A6E F;  4WK8 F;  5TRD A;  1Z7U A;  3I59 A;  4HAM A;  1WKM A;  4EGZ A;  3IKV A;  1FWZ A;  3GFL A;  1IAW A;  2L4M A;  5CVU A;  3HRM A;  3E6M A;  1T39 A;  2L02 A;  1TLH B;  1R7J A;  4QLC U;  4UXN A;  1FBU A;  2FF4 A;  3JSP A;  1TQM A;  5L3F A;  4A0X A;  2DBB A;  1ZG3 A;  3HTU A;  2UXN A;  1HST A;  2Y75 A;  1ODD A;  3ECO A;  2V9V A;  5ICC A;  2ZME B;  5IT3 A;  1OR7 A;  3WTY C;  1P92 A;  4A2U A;  2O6G E;  3BPV A;  4EJU A;  4BAY A;  4A12 A;  2DQR A;  1F5T A;  3VOE A;  4HQM A;  2HWV A;  3HUG A;  4EJV A;  2F5D A;  4ON0 A;  3I0T A;  4OIR F;  3VOD A;  3RIR A;  5L3G A;  2ZBK A;  1QNT A;  5CVJ A;  3I5U A;  1XCV A;  5F64 A;  2W24 A;  4M74 A;  3SZP A;  1U6G A;  1BJA A;  4WF2 A;  3BWG A;  3VFZ A;  4OIP F;  2GQQ A;  3GXO A;  4UNO A;  1KYW A;  4UVB A;  1QZZ A;  1ZAR A;  4KA4 A;  4KUM A;  1ONV A;  2NAZ A;  5FD6 A;  4KT5 C;  2A3S A;  1JE8 A;  3JTH A;  3WTX C;  3KP4 A;  1Z9C A;  5IT9 Z;  5LLQ A;  4Z2Y A;  4PCQ A;  1W4M A;  2HTJ A;  3QAH A;  3IC7 A;  2B0L A;  4IHS A;  2VON A;  3QU6 A;  1IN6 A;  2YX7 A;  3KFW X;  2H6C A;  5A2Q Z;  3I54 A;  1P6R A;  5LGU A;  3RPU A;  1SD4 A;  5E18 F;  2PJP A;  4U0Y A;  1QBJ A;  3I64 A;  3HTS B;  4MTD A;  4P5O A;  2D1H A;  4N0B A;  2P4W A;  1DPR A;  1W7P B;  2OBP A;  1R23 A;  3HSR A;  2G7U A;  1XSX A;  3COA C;  4I09 A;  3WGG A;  4Q5S F;  1OMI A;  2OD5 A;  3ROU A;  1KGS A;  1FZP B;  1TW2 A;  3ABU A;  2HYF A;  1I1G A;  2K02 A;  4Y13 A;  2YX4 A;  3J80 Z;  3L09 A;  3WTU C;  1MGT A;  2XGX A;  4KIG A;  4DQ2 A;  2K4J A;  3HHG A;  1S29 A;  3K69 A;  1HSJ A;  2W57 A;  4KDP A;  4MGR A;  4CIC A;  4HF2 A;  2ZKZ A;  1W7P D;  4HF1 A;  4HOB A;  1J0R A;  5K5R A;  4ENK A;  2WTE A;  4WXC A;  4U0W A;  5ICG A;  1O3T A;  4LLG F;  2QWW A;  4G8X A;  2DFI A;  2VOD A;  3ZMT A;  2G7H A;  2YSR A;  4RB3 C;  3DEU A;  4IVN A;  4KFC A;  2DT5 A;  3LST A;  1IN4 A;  2A07 F;  5FO5 A;  3DP7 A;  3O6B B;  4KMU X;  5E1X A;  1U78 A;  2VBZ A;  4AVP A;  3CUO A;  2J5O A;  2MLG A;  1VTN C;  2V6C A;  1SFX A;  3VEP A;  1BN5 A;  2QZ8 A;  2XAS A;  1ZG1 A;  4L9N A;  3BOQ A;  2MH2 A;  5LGT A;  2YR2 A;  1ZG5 A;  2M87 A;  4JQF A;  1QGP A;  1IUY A;  2XVC A;  2IT0 A;  3WG9 A;  4OMZ A;  4KIB A;  1H0M A;  2Z5U A;  2FOK A;  2H09 A;  4G7Z F;  4ASN A;  4EJW A;  4GYG A;  3ZP5 A;  5LHG A;  2VBX A;  1D8J A;  2GA1 A;  3T0Y A;  1K78 A;  4G9Y A;  4ENJ A;  2VC0 A;  3I58 A;  1ZGA A;  1K78 B;  2CG4 A;  2P5V A;  3BZ6 A;  3DQV C;  2A69 F;  3KCC A;  1SD7 A;  4OIN F;  2M8E A;  2PMH A;  2EB7 A;  4KN4 X;  3TDZ C;  5E8I A;  3QOP A;  2PBI A;  1YW8 A;  3B02 A;  2D45 A;  3TO9 A;  3R60 A;  3J81 Z;  1UFM A;  1FYL A;  2MC3 A;  1FYM A;  2GA2 A;  2P6S A;  4PDK A;  5DD8 A;  1ON2 A;  4EJT A;  5IT9 K;  5DDG A;  5E17 F;  3KZY A;  3CDH A;  1ZH5 A;  2IA0 A;  4GYI A;  1B1B A;  3QP5 A;  2BYV E;  4RGS A;  1I6X A;  3GEZ A;  2LDU A;  4CYD A;  3V7C A;  2UWM A;  2DO7 A;  2HEO A;  2QBY A;  5BOX A;  2VXZ A;  3KLO A;  1DPU A;  1BI2 A;  3F23 A;  1EH7 A;  3SFZ A;  2QM3 A;  1WSU A;  1ZRE A;  1U8R A;  3R6S A;  3RYR A;  2Q0O A;  2F5C A;  1SD5 A;  1MD0 A;  4EM2 A;  3EUH A;  4BXU A;  5DD4 A;  1FYK A;  4MEX F;  5LHH A;  1XGN A;  2QQA A;  1YS7 A;  1FNN A;  4I98 B;  3HOT A;  2PMU A;  3O2P E;  4RS8 A;  3FX3 A;  2KIF A;  4IXA A;  4Q47 A;  2L01 A;  1SD6 A;  3ML6 A;  1KU9 A;  1UHM A;  1I1S A;  2RNJ A;  3EET A;  4P55 A;  1DUX C;  5D8L B;  4EM0 B;  4MEY F;  2RN7 A;  2HTS A;  5ERI A;  3HSF A;  4LGW A;  2DW4 A;  3MAJ A;  1XD7 A;  1Z91 A;  3RPQ A;  1L0O C;  2D1V A;  2EA4 A;  2K4B A;  1HKS A;  4OMY A;  1ZGJ A;  1S6L A;  3RKW A;  2XKO A;  3F6V A;  3V8L A;  1A04 A;  4DNC A;  1FOK A;  3GYH X;  3GO5 A;  4KMF A;  2MLK A;  2ZJ2 A;  3MZY A;  4OOI A;  1YO5 C;  3GW2 A;  6PAX A;  3ISP A;  4ENM A;  3G73 A;  4EJO A;  4HDU A;  3WE2 A;  1LEB A;  2KJB A;  2PG4 A;  1WQ2 A;  1MKM A;  5LEJ A;  5DCM B;  4UV9 A;  2STW A;  1QPM A;  4H0E A;  3O3K A;  2E7W A;  3FMS A;  2UXX A;  3MCZ A;  2ZFW A;  3TOB A;  2D2W A;  1ZHF A;  1BC7 C;  1TNS A;  3I4P A;  4QWQ A;  4XSZ F;  4RAY A;  5E1Z B;  4D0P A;  3WGH A;  5FB2 A;  3T8T A;  2M45 A;  1ULY A;  1TBX A;  1OYW A;  3QP6 A;  1Z1D A;  2OQG A;  5H6R A;  4E70 A;  4CXF A;  4UVA A;  3V8J A;  2ACJ A;  2GXB A;  1U5T B;  5H6Q A;  2VBW A;  2MD5 A;  2Z33 A;  3KP6 A;  1U2W A;  3DPL C;  3RI4 A;  4EV0 A;  3TO7 A;  3TO6 A;  4RGU A;  3F21 A;  1XGM A;  3U1D A;  4M72 A;  2RV8 A;  2HGC A;  3N4M A;  1D8K A;  1K7A A;  4RB0 A;  1O3S A;  4O6J A;  2JT1 A;  4MHG A;  1PUE E;  2DLL A;  5CJ9 A;  1XGO A;  3I59 B;  2ESN A;  5K5Q A;  1I5Z A;  4FX0 A;  4WXH A;  1R1V A;  5L3E A;  1YLF A;  1IZ1 A;  2P5K A;  2H27 A;  3RKX A;  5FGM A;  4HW0 A;  3KET A;  4U0V A;  2EFP A;  3D5L A;  1XCB A;  1B4A A;  3F8C A;  3WTT C;  1QO0 D;  1NHA A;  1O3Q A;  2W84 A;  2Y0M A;  2IPQ X;  1GXQ A;  2V79 A;  3H3U A;  1JHH A;  2M30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...