3K7AJ

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k7aJ00
3Q0VA 4V2GA 5EYRA 5C44J 3A01A 2YU9J 4A3LJ 1AHDP 1WGXA 2VPRA 2LKXA 3QPSA 3QPLA 1WH5A 2O7OA 3K2AA 2YS9A 2GM4A 1SANA 2HQ5A 5JLXA 2OF7A 2KDZA 5EZHA 2NS8A 2JWTA 3BG5A 4QSHA 2CJJA 2WV1A 2H8RA 1FIPA 3BTLA 5IYDJ 2DTZA 3F0CA 2HI3A 3SFIA 1MBJA 3TW6A 2ECCA 1BA5A 5J1RA 4MIMA 1I3QJ 1JGGA 2R92J 1QVTA 5FKLA 3DCFA 1QRYA 2LFBA 4LOCA 1MBEA 4D7NA 3BTJA 2PMZN 4IHWA 4I6ZA 3Q3SA 1ZTRA 4A3FJ 2NVQJ 1P7JA 1BW5A 2N8GA 1JUMA 2MG4A 5BNGA 2JN6A 4MFEA 3JRHA 4B3AA 2XRLA 3GTPJ 3MVPA 3JRGA 3OSGA 2EH3A 5GPAA 3L1PA 1X2NA 4JX4A 3HOZJ 2CQQA 1OCPA 2W48A 1AKHA 1SFOJ 1ZKGA 3QQAA 1JKPC 4BBSJ 4XK4A 1JTXA 4RDUA 2RAEA 5K7HA 2R5YB 2XB0X 1AU7A 2L7FP 5IYBJ 5F04A 3NARA 3S14J 2QF7A 3A02A 1ETOA 5GPCA 5JLWA 4UUSA 5C3EJ 4X1EA 1QPIA 3UKGA 2O8KA 4X6AJ 1JT0A 5E3NA 5FKKA 2JMWA 3SJMA 1MH3A 5F08A 2HOSA 3GTQJ 4QTRA 2L7MP 3MKLA 4V2FA 3A01B 1OCTC 3ZQGA 4A3KJ 1Z77A 4C3HJ 1HCRA 1YRNB 4NDLA 3H3VK 2DA5A 4FE7A 1NK2P 1Q1VA 5IP7J 4A3CJ 1ETWA 2LK2A 4M3GA 3LSGA 4RBOA 5FKMA 4D5CA 2EZLA 4M3FA 3I4MJ 2WAQN 2LD5A 1U8BA 1LE8A 4A3DJ 3ZQIA 3S15J 2GBYA 3LSRA 1JKQC 1MSFC 2DMTA 2Y30A 1VF9A 1RPWA 2DN0A 1NK3P 5FJ8J 2VKVA 4L5EA 1ZQ3P 2E1OA 2NVYJ 5GP9A 1LFUP 2H1KA 3RZDJ 1FEXA 1U78A 5J1UA 1D5YA 2Y9YA 3BTCA 5EGOA 3I4NJ 1H8AC 2Y31A 1FTZA 1ENHA 4Y52J 4A3GJ 2XPVA 3S2HJ 2X48A 1GUUA 5C4XJ 5DS9A 2ECBA 3MN2A 5FKOA 4A3BJ 2EQRA 2DMPA 1VFCA 4G12A 1Y1WJ 4M3EA 5DTDA 3S1NJ 3IH2A 3CQZJ 2AHQA 3IH4A 5IP6A 3JRCA 2EBIA 3BR2A 3NAUA 4B1RA 5E3LA 3W6VA 4MLOA 1HDPA 3LNQA 3S1MJ 4QIWN 3HOUJ 3GTLJ 1XS9A 1AKHB 2FD5A 4MO7A 5F0HA 2VKEA 1JUSA 5M3MJ 3ZQFA 5F27A 5M5WJ 3A03A 3B6CA 2XSDC 4DZJA 5M3FJ 1E3OC 5HODA 3IV5A 4FTHA 4XRSA 1IG7A 2K9QA 4UUSB 2NVTJ 4Y7NJ 4BXXJ 2R0QC 5IOZA 5K7FA 1GDTA 1IUFA 2DMQA 1I50J 2NS7A 1JTYA 1ZK8A 1WCMJ 1I6HJ 3GTMJ 2XPWA 1JJ8C 1H89C 1B8IA 1UMQA 2P81A 3PO2J 2YUSA 4A93J 2FQ4A 2O9LA 1DU6A 5EEAA 2D5VA 1RKWA 2NOGA 3FK6A 5FLVA 2FJ1A 4D7MA 3BT9A 3TP0A 2MSYA 1A5JA 1RKTA 2R5ZA 3JREA 1W0TA 3GTJJ 3WHCA 2XPUA 1PUFA 1T56A 2NVXJ 2K40A 4W97A 4DYQA 2QCOA 1NTCA 4D5FA 1MH4A 2M8GX 4XIDA 3BQYA 4XRSG 1ETVA 1ETKA 1RETA 4BBRJ 5EGOB 1X58A 2WB1N 2JA6J 2ME6A 1GV5A 3HOXJ 1ZR2A 3HKZN 1TWFJ 1ITYA 4XRMA 1W0UA 3OIOA 2HDDA 3G1OA 4BY7J 4UUTA 3C2BA 2IEKA 3RKQA 3JRIA 1QVUA 3JRDA 1XG1A 3TW7A 1OJLA 3Q0UA 2HXIA 1HOMA 1T33A 2ME0A 1JKOC 5F0FA 1LFBA 1JT6A 5EF6A 4I76A 4W1UA 1MBFA 4BKXA 3BR1A 2DMUA 2Y2ZA 2COBA 2IAIA 1FJLA 1MNMC 2FX0A 5IOYA 3B6AA 3CMYA 1ORKA 4DW6A 1F43A 3JR9A 1WPKA 2LR8A 5FKNA 1VI0A 2JA5J 2L9RA 5EG0A 3FKIJ 1TC3C 5IP9J 1GT0C 3HB9A 1IGNA 5IPAA 3TP3A 2Y9ZA 4M3DA 4JYKA 2HXOA 1O4XA 1RR7A 3VPRA 4GFBA 4FISA 5E3OA 1FTTA 1U9OA 1ZR4A 1B8IB 2LLKA 2TRTA 1DU0A 3WHBA 1UG2A 3JRFA 1JJ6C 2X6OA 2VUMJ 2ELKA 2M2EA 2MGQA 4M3BA 4S0HB 4HNVA 1WI3A 4IHVA 2E19A 4CYCA 2IBDA 1HLVA 1IDYA 4IEJA 3LSPA 2ID3A 2R5ZB 2I10A 1OFCX 3ZQHA 3DEWA 1UHSA 4M6VA 3S16J 1PUFB 5K7ZA 3CDLA 5C4JJ 1IRZA 3M4OJ 4AYBN 3JRBA 4J19A 5M5XJ 3FK7A 2XB5A 1EF4A 4C3JJ 5M5YJ 3GTOJ 1GVDA 2CQXA 4AC0A 1APLC 4AUXA 2K9NA 2M34A 3TEDA 5F1JA 2M9HA 5EZGA 3GTGJ 3FIWA 3BTIA 2Y0SN 1H88C 2G0EA 1B72A 5J3LA 2HOAA 1YRNA 1RESA 4A3IJ 3HM5A 3D1NI 2DA1A 1JKRC 1P7IA 2K9SA 2ID6A 4A3EJ 3FISA 4C2MJ 2R7ZJ 3HOVJ 1FIAA 3G1MA 4EEFG 5FLMJ 2KT0A 3ZQLA 2ZB9A 1ZGWA 3BR3A 2XGEA 1XC5A 2HYJA 2GLOA 3RZOJ 1LE8B 2JK3A 1TWGJ 1HDDC 2JA8J 1ETXA 2DA7A 1U9NA 5EG0B 2L0KA 3HBLA 1K61A 4MFDA 3ZQCA 2TCTA 1IC8A 1BW6A 3HEFA 2E2IJ 3HOWJ 3S1RJ 3E7LA 1S7EA 2AO9A 3HDDA 1POGA 1BJZA 1F36A 3LOCA 5J1YA 2DA3A 3IH3A 4BY1J 3M3YJ 2M0CA 1MBHA 1TWAJ 2EZHA 3S17J 2DJNA 2X9DA 1ETQA 3O8HA 4CYCB 5EDNA 3Q0WA 3BQZA 3RQIA 9ANTA 3H0GJ 3OSFA 4FCYA 2B63J 2LY9A 3GTKJ 2CRGA 1HF0A 1IDZA 4FE4A 2LP0A 3S2DJ 1CQTA 4JX5A 4A3MJ 3BR0A 2DA4A 4DZPA 4A69C 3HOYJ 1IJWC 3JRAA 3PM1A 1IV6A 2OPTA 2E2HJ 1G2HA 2JA7J 1Y1VJ 3HGGA 2CUEA 5F0CA 1B72B 3BR5A 4DYCA 3HGYA 3OOUA 5IYCJ 2E2JJ 1JUPA 2L7ZA 4DYRA 5E3MA 4IHXA 2DMNA 2CU7A 3LSJA 3GBGA 3G1LA 4ABZA 2R93J 3ZOBA 2DA6A 1ETYA 2JJ7A 2LVSA 4XICA 1MSEC 3S1QJ 2XGDA 3SDGA 3PO3J 1WH7A 2LTPA 1R9TJ 4JP0A 4JX6A 4B4CA 2XGCA 2R5YA 2CUFA 1MBGA 2EZKA 2HOTA 3BG9A 3O8GA 1X2MA 1K83J 4A3JJ 1VNDA 1GV2A 2EZIA 2VI6A 3CCYA 4C3IJ 1BL0A 2MW8A 4IHYA 3BR6A 1TWHJ 1TWCJ 3K7AJ 1MBKA 1Z0XA 1A6IA 2DA2A 3BG3A
chains in the Genus database with same CATH superfamily
2RQQA 3GLLA 4N4OB 4V2GA 3CD6I 3I0TA 4A3LJ 2F5FA 1AHDP 3HHGA 3QPLA 3J80K 4XRFA 5GTHC 1SANA 5E8GA 4B47A 2KDZA 2GIZA 2NS8A 2WV1A 1FYMA 1ZH5A 4LIUA 2GAUA 2OAZA 3SFIA 5GAGJ 3OYLA 4ENKA 4MQVA 3NQOA 2VPLA 1SD6A 4KNYA 3V8LA 3HRTA 1B59A 1JGGA 1BC7C 4OMYA 3E1SA 1USTA 2XUBA 3SZPA 2ZXIA 1QHGA 3IAM2 1F9NA 4FX0A 4IQJA 1STZA 3I5UA 2LFBA 1MBEA 4E7HA 3OMYA 4HEA2 4D7NA 3WU1B 2EIJH 4MEYF 1R7JA 3Q5FA 4IHWA 2VLAA 3BY6A 4P9UA 4J00A 2M8EA 3FWEA 5BNGA 4LG0A 2Z33A 4RGUA 4YFNF 3OSGA 3QAHA 2NNNA 3BC8A 3K4MA 2EFNA 2VBXA 3U21A 2DU9A 5F1RA 3KYDB 1OCPA 4ENMA 1G3TA 2K3FA 1WJFA 4XLEA 3GFMA 3ASNH 3VYTB 1ZGAA 3QQAA 3TOAA 1RIOH 4MNUA 2ADUA 4RDUA 4M9ZA 2RAEA 3RJPA 3S32A 5K7HA 4BXFA 3OYEA 2HKOA 2XB0X 2CV1A 1YW9A 3PNVA 1R5GA 4OAYA 3OS1A 5A2QZ 5JLWA 1NG6A 3ML6A 1HKTA 5C3EJ 2CUZA 5D6EA 1V5FA 3EDPA 4X1EA 2Z2SB 3P9CA 4X6AJ 5E3NA 3CDHA 2JUCA 1PVEA 3L9FA 5LRSA 3GTQJ 1MH3A 2Z1DA 5F08A 2VOOA 3MKLA 5ILVA 3A01B 1AA7A 2D1VA 2IGNA 1RC9A 3CP8A 4C3HJ 1HCRA 3LAJA 4NDLA 1V55H 3OS0A 3UNGC 3IWZA 1NK2P 5IP7J 3I56I 5L3CA 2LK2A 4M3GA 4NQWB 4RBOA 4D5CA 2W57A 4CDGA 3I4MJ 2WAQN 3K0LA 2LD5A 2M45A 2K85A 1SC7A 1CF7A 2A61A 2XAJA 3HHHA 4L5JA 1JKQC 2KL4A 1MSFC 2CG4A 4I7HA 1UCRA 4CICA 1RPWA 2MC4A 2IGMA 2Y75A 2E1OA 1WQ2A 5LD2C 1LFUP 4NC6A 3HRSA 3W3CA 5J1UA 3AL0B 4BHCA 2VOPA 3BTCA 1ULYA 1Z6RA 3I4NJ 2H94A 3O3KA 1FMVA 2Y31A 1W1WE 4LLNA 2QQAA 1UFMA 2YPRA 4Z2YA 3HL2A 2KISA 1U5TA 4WWCA 4Y52J 4A3GJ 2XPVA 2H6BA 3MN2A 4ESFA 3CF5F 1BM9A 4CUGA 2EQRA 1WJCA 4G12A 1Y1WJ 3FBNB 2ZJPF 2FSWA 5B3SH 2HTSA 1MIJA 2RREA 5D4SA 2AHQA 2EBIA 1YFHA 4B1RA 1HDPA 3PNYA 1L3LA 4QIWN 3GTLJ 2MH9A 2FD5A 3C2HA 1MZBA 4KT6A 2A69F 3VYUB 3EUKL 1PP7U 3ZQFA 3BZCA 2IT0A 3G6EI 4E6KG 1DPUA 3KLNA 3MMYB 1VQMI 2CW7A 4LB6B 4GCVA 3CCMI 2FE3A 4IVNA 1IN8A 1Z67A 4XLPF 1BIAA 1Y0NA 4XRSA 1S6LA 4XSXF 4UUSB 4B3XA 2NVTJ 2VN2A 1V3FA 1D0YA 4QPQA 2DJIA 5IOZA 1AOYA 3H5AA 1IUFA 3DKYA 3U1DA 1R1UA 2VC0A 3M7GA 2DMQA 2NS0A 5B1AH 2HQNA 2OJED 3M07A 4RAYA 1UZCA 1JTYA 1ZK8A 4B43A 1W5TA 2XPWA 1U5TC 3EYYA 3CCRI 1H0MA 5K1YA 2W84A 2R7RA 2RN7A 1UMQA 3PO2J 2UZKA 2LY1A 3PSFA 5CJ9A 4L0ZB 2ESHA 1RKWA 3FK6A 4UNOA 1OCOH 4D7MA 2BY1A 2J5PA 4M72A 4OINF 4ZJZA 2XRNA 4EM0B 4EJTA 4U7BA 4FHTA 3I54A 2R7DA 4A0ZA 3GTJJ 1FYLA 1PUFA 4KIBA 4HF0A 3SFZA 1G59A 2NVXJ 4W97A 1OISA 1A04A 2XDVA 4DYQA 3DBLB 1P9QC 4ZZDA 1V5GA 4D5FA 5LLQA 4XIDA 4GDFA 3L2CA 1RETA 3EPZA 2FU4A 1X58A 1Z7UA 2JA6J 2DOFA 2IA0A 1GV5A 4CXFA 2HQAA 4XLHA 1ZR2A 2DK5A 4RAGA 1Z6TA 4TV7A 5DEQA 2E60A 2VL8A 4EMSA 3TDZC 1MJBA 2XKOA 3DPTA 1D5VA 1W0UA 5ICFA 4XL9A 4ZC3A 2FOKA 4R1HA 5FFZA 2WBMA 4CZCA 2HDCA 2K27A 4AD9A 4F92B 2V1NA 4PJLA 4Y3OA 3DLLF 2CGPA 1WJ5A 2Q0OA 3I64A 2A07F 1HKSA 2A5YB 4OIRF 3SXYA 5HVQC 4XM3A 2EB7A 3FX3A 4HDUA 3CCJI 5L3FA 4IOCF 5F0FA 1LFBA 1Y56A 4G7ZF 2DMUA 2COBA 2DFFA 4G6TB 1UELB 2RQPA 1FJLA 2ZO4A 2FMYA 3KCCA 5IOYA 1YITI 1X3WB 2PJPA 1ORKA 4DW6A 4EV0A 1EH8A 4Q48A 3ZMUA 2W00A 2V79A 1W7PD 3CCQI 3N4MA 1TC3C 3HB9A 2Y9ZA 1G4DA 5LBQA 3PIOF 2E36A 2VB6A 4GO1A 4MEXF 4GFBA 3VDXA 2EJRA 2R7WA 1U9OA 4C30A 1B8IB 1IN6A 2QSFX 3HJEA 1DU0A 3WTSC 2LKPA 1R00A 4S04A 3FMSA 4DNCA 1WWXA 2EV6A 2MGQA 3HRUA 1FBQA 1OYWA 4HNVA 5JHFA 4BE1A 4CYCA 5HLIA 2DT7B 3FM3A 3ROUA 4BS9A 1QZYA 3CESA 2ID3A 1XPXA 2R5ZB 1SAXA 2DQLA 2QZ8A 1S29A 1ACIA 3HC7A 3S16J 1OMIA 4YEJA 5C4JJ 1O7LA 1X3ZB 4AYBN 5LHIA 2CQNA 4IRHA 1R36A 3E6BA 2L9NA 2DAOA 4B44A 1FP2A 4C3JJ 2OA4A 3V7CA 3I53A 1APLC 3AG4H 1D1CA 3NRVA 4II3A 2M9HA 2LOOA 4QLCU 4DGWB 1H9TA 4L9NA 2W25A 2G0EA 5GTIC 1VQ4I 1QA6A 3CJQB 2RVCA 4DBQA 4A3IJ 2AQEA 5JR3A 2DA1A 4L9JA 2DTRA 1JKRC 2A68F 2K9SA 4U0YA 2XAQA 4C2MJ 4XMYA 3I9V2 2X1DA 2R4GA 4I0BA 1JXSA 3LA3A 1ZG5A 3BZKA 1W7PA 5FLMJ 3I59B 2KT0A 4XORA 5BQTA 3IL2A 1VQ5I 2HYJA 2O8XA 2RC4A 1JHFA 1ETXA 1U9NA 2WAFA 1ZLJA 3CJNA 2QLZA 5KCMA 4A0YA 2Q2EB 4F55A 5CVVA 3ABKH 4E7IA 1LQ1A 3QYFA 2VE8A 3H5RA 2IRFG 4XONA 3HDDA 1XDSA 1POGA 3WGHA 3KP2A 5J1YA 4E70A 3M3YJ 3GFLA 3R0AA 4HNUA 3S17J 1BIBA 3BZ6A 3HZJA 2VJJA 1YJNI 1DPRA 1RZ4A 4FX4A 3NEUA 4HV5A 3ERED 2G7HA 4HAMA 3FXKA 4FCYA 3I3LA 3S3MA 2IA1A 3TO6A 2M30A 4AU7A 1RI7A 4QPOA 1K4SA 1IDZA 3A1YA 4FE4A 1A31A 1YIJI 2PMUA 3CJRB 3KP3A 2OUMA 2KDOA 3M8JA 1I27A 3J7YJ 1K4TA 2TDXA 2O3FA 5J4YA 3PIPF 2HKXA 4OIOF 1QU3A 5KK1A 2XSJC 4A69C 3JW4A 3G3ZA 1IJWC 3PM1A 1PYVA 4C9YA 2E2HJ 4RA2A 3FXOA 4HX7A 2VQGA 4BEHB 3DFGA 3F72A 2H27A 3FXJA 3HGGA 2CUJA 1A36A 2V7FA 1B72B 4DYCA 3MZYA 3HGYA 1XGSA 4BYYA 1XGNA 3OOUA 2E2JJ 2EINH 2F5CA 1JUPA 3E6DA 5LRRA 1R5HA 2Z9OA 2CFXA 1YX5A 3OYCA 4ETSA 3G1LA 2GOXB 4DIQA 2DA6A 3VSLA 4G9YA 2JJ7A 4XICA 2X4HA 1VQ6I 4FETA 1KA8A 3F23A 2VJ4A 4M71A 3VEPA 3CC4I 2CS3A 2HYFA 3FXLA 3PNTA 3U1KA 3IP4B 2JZYA 4GYIA 3S3OA 2H8WA 2M4GA 4EATA 2E7XA 1X2MA 2JRMA 2MD5A 4LGWA 1W36D 1SMTA 3TL4X 4A3JJ 2W1OA 4L0YB 1TZLA 1HW2A 3DQVC 4ZYGA 3WU0A 2VI6A 2OTJI 3OYNA 1DGWY 2CW8A 4IHYA 2E71A 2V26A 1I1GA 1HQCA 2YX4A 1MBKA 1A6IA 4WXDA 2K02A 3WODF 2KHMA 2HYGD 3K10A 3Q0VA 5C44J 3LSTA 3A01A 2YU9J 1WGXA 3KEYA 3PL8A 2LKXA 3H35A 2DOAA 2X6YA 2L9SA 3K2AA 4IHTA 3J7ZI 2YS9A 4N0BA 1XB4A 2HQ5A 4HX8A 2JWTA 2NAZA 2E7WA 1ZAOA 2H8RA 5D5WB 1VQ7I 4NQWA 4BJTA 4OIQF 5IYDJ 3DKWA 1ZG3A 2MFZA 1P4AA 3MKWB 2YU3A 1N78A 2IW5A 1BA5A 2M1BA 1UJ8A 2LMDA 4F3QA 1SD4A 3TO7A 1I3QJ 4HQMA 5LFAA 2ICWG 2ZJRF 2X85A 4YELA 4WXHA 4YIFA 3COAC 5AONA 2ZC2A 5DUKA 4HDVA 3L00A 4G6DA 3RDIA 1QQIA 3T0YA 3HTSB 1G6NA 3BTJA 2PMZN 4KN4X 1LPQA 4KDPA 4I6ZA 1ZTRA 1P7JA 2N8GA 1E17A 1U3EM 1TTYA 3R61A 3GTPJ 4IJAA 4XSZF 1LJ9A 4Y17A 3ABLH 1I1SA 3A0HC 1P2FA 3L1PA 3QOEA 1WJEA 3KP6A 4JX4A 3G2BA 3MD2A 2W48A 2GXGA 1U0JA 5DD4A 3QODA 1OLTA 3BJ6A 1Y8RB 1ZKGA 4PDKA 3E97A 1SFOJ 2XAHA 4PJ0C 3TKYA 3ZN1A 4XK4A 1JTXA 1ZHFA 3OYFA 2CQ7A 2R5YB 1HSJA 1AU7A 1LDKB 3L2RA 2CMPA 2VODA 1QZEA 1X19A 3EUAA 5F04A 3K70D 2ELHA 4OMZA 4RGSA 4WX9A 2XC7A 2QF7A 1ETOA 4UUSA 3C2GA 2HVQA 2LH9A 4KFCA 1G3YA 4EM1A 1QPIA 3UKGA 2O8KA 4XLCA 3VYRB 3HPGA 3IRQA 3F6OA 2MABA 3KEOA 1UG0A 2KIUA 2JMWA 2HOSA 4GGGA 5E1WA 2V1XA 5CVUA 4LLLA 3JTHA 3AG3H 4A3KJ 5D4RA 2Y69H 4XOPA 5GAEJ 2DA5A 4LITA 1YO5C 1Q1VA 4NC7A 4IX7A 2RNJA 2Q1ZB 1FWZA 2MLKA 3HG9A 2EZLA 3FMRA 4M3FA 2I5UA 2ZXJA 3I4PA 2X1EA 3OL3A 4RLQA 4A3DJ 3CJTB 3ZQIA 3K4NA 3LSRA 5KAIC 2FXAA 3BWGA 2DMTA 2Y30A 3WTUC 1W36C 2DPDA 2DN0A 4CCLA 4A6EA 1X3UA 4HYEA 2VKVA 4L5EA 3L7WA 2W4SA 3V8KA 1D5YA 1RRJA 2P6TA 4EM2A 2BY0A 1OYYA 1IUYA 4CH7A 4A12A 5CVRA 4IRGA 4ITVA 1GUUA 4NNJA 4E7LA 3HTUA 3H36A 2NYXA 2V9KA 5DTDA 3IH2A 3CLOA 3JRCA 3BR2A 3NAUA 5E3LA 1K78B 4MLOA 3LNQA 3F6VA 1AKHB 2QYOA 4XN3A 4MO7A 1R22A 5F0HA 3X2QH 2VKEA 2D45A 2DBBA 3WG7H 5M3MJ 2CO5A 5F27A 5M5WJ 2A5WA 3B6CA 1NHAA 3FF5A 1E3OC 3OYMA 2VONA 3E5QA 4FTHA 3AFHA 2WV0A 1SVLA 3F3XA 1QNTA 2BXYA 4E4HA 2R0QC 2HQRA 5K7FA 1DDNA 1E0EA 2JTVA 1B9MA 2CFOA 4KT5C 1I50J 2DDAA 2BVLA 3BJOA 1I6HJ 3PJRA 3OYGA 2FUG2 4IL6C 1VQNI 1R1TA 1B8IA 5HS8A 1Z1DA 2OU2A 1GHCA 4UUVA 4GRIA 2NXNB 3K1PA 2EK5A 4D9JA 4IRIA 3WG9A 1YIOA 4GYGA 4A93J 2FQ4A 2O9LA 3A0BC 1V54H 1SMYF 1FLIA 4P1WA 4JOMA 4CCNA 3BT9A 1KQ0A 2B7EA 1VQ8I 3FMQA 4P55A 2R5ZA 1A5JA 4HX4A 1VQPI 1IRGA 1W0TA 1BOBA 1O3QA 2K5CA 3K70C 1WI9A 3SEQA 4BJ5C 1IRFA 5FD5A 1Y0UA 2K40A 2JQ7A 2VKDA 2DDBA 1D3YA 3K9TA 2EILH 2M8GX 4A5NA 5FD6A 4HG2A 1ETKA 1ZGJA 4PJMA 4KITB 2WB1N 2ME6A 1HA8A 1LFPA 1KONA 1IO2A 1NG7A 2CW0F 3HKZN 3H1CA 2ZNYA 4RAFA 3TMOA 1ITYA 4UXNA 4L9TA 1SAUA 2OBPA 4IPAA 3OIOA 1KYWA 5HLGA 1MJAA 3D0SA 2LF8A 2OTLI 4Q5SF 1OR7C 3E5XA 1XG1A 4O3MA 4MTDA 1HOMA 2NOJB 2ME0A 2PMHA 2KJCA 2KRHA 3PSIA 2DI3A 5B5EC 3CO6C 4Z6YA 3K4CA 3KETA 3PUBA 1RUNA 3DWLE 5JHUA 1R23A 3CCSI 1LKXA 3I59A 4BKXA 3BR1A 1KGSA 1XMKA 2IAIA 3R4KA 1MNMC 1KZHA 4CO8A 3B6AA 3CMYA 5D5VB 2NNYA 5BPIA 4OIPF 4AWXB 2QQBA 2L9RA 3RPUD 3EQLF 3FKIJ 1D1AA 1IF1A 2HS5A 2JPBA 5IP9J 5J47A 5J40A 1UHWA 1F5TA 3TP3A 2ELJA 4I2OA 2M5WA 3SDBA 2Q2EA 5HDKA 2F4MB 2STTA 4KN7X 2IP2A 2XV4S 4Y4RA 4YRVA 1MDMB 2BW3B 1XMAA 4AIKA 1MGTA 2TRTA 3N05A 1P4WA 3K4JA 1ZN2A 4Y13A 3JRFA 3VODA 5FROA 1JJ6C 2X6OA 2VUMJ 1FOXA 1MJ9A 4M3BA 2VQLA 1XSVA 2E19A 4OOIA 2AXTC 1IDYA 1AWCA 2GWRA 3FM5A 4BQAA 3W2WA 2I10A 3ZQHA 3DEWA 2YSRA 4M6VA 2X6XA 2QM3A 1LEAA 3CDLA 1J2XA 3LFUA 2H6CA 5FRNA 3RCOA 1CGPA 2L5QA 3M4OJ 2AS5F 1FOKA 2DQRA 4ZDPA 4J19A 2ZFWA 3J81Z 2XB5A 1Z21A 2FRHA 3OV8A 5M5YJ 2M87A 5J6XA 4WK8F 2P0WA 1GVDA 4CSWA 4AC0A 2O6GE 5F1JA 5EZGA 4BEHA 4ASNA 3FIWA 3MEXA 2Y0SN 1BBYA 2JRTA 2GOMA 2LF7A 5HLTA 1B72A 2MC3A 1V5EA 2V1DA 1KU9A 1VQ9I 2Y0MA 3T8RA 1X1AA 2KRFA 3HM5A 3T1BA 4XLFA 1V4RA 5FGMA 2ID6A 1B9NA 4A3EJ 4HSRA 1FPQA 1TQIA 5CQEA 1FOYA 2R7ZJ 3ERMA 2W24A 3RPUA 4IKFA 1ZGWA 3BR3A 4YIIA 2QVOA 3A2KA 1XC5A 2P4WA 3VWBA 2BXZA 1OPCA 2GLOA 2DOEA 4PCQA 4BJ6C 4PZJA 1TNSA 2JA8J 3DLAA 2DA7A 2KIMA 3ZN0A 4ESBA 2CV0A 4AM3A 3ZQCA 2TCTA 1BI0A 2F6CA 5TRDA 1BW6A 2Y48A 3DF8A 2E2IJ 3HOWJ 4XLAA 2AO9A 2OZUA 1S7AA 2BZTA 5EEGA 3ZQQA 3SHFA 1F36A 4HA8A 3IH3A 4BY1J 1GXQA 1SD7A 2VIXA 4M74A 1MBHA 2XGXA 2KPMA 1ETQA 3BROA 2A6HF 1PJRA 3CUQB 3Q0WA 1XCBA 3RQIA 3TOBA 2R7OA 1BOAA 3OSFA 9ANTA 2IGOA 4FQGA 2MLGA 4Y15A 5CVJA 5DDGA 4G7HF 5FRMA 1A35A 2KFDA 3GTKJ 2WAQA 3CTAA 4HQEA 5IT9K 3Q9VA 1FNNA 5CPRB 3OOPA 1EJ9A 2V9VA 3IWFA 2W7NA 2UV1A 4A3MJ 2G9WA 3R0JA 5LGNA 5EEHA 2JSPA 2A3SA 4IHSA 4DZPA 1TW3A 3HOYJ 3OYKA 3JCUC 1P6RA 2HR3A 4II2A 1IXCA 1MMDA 2M3AA 1K6YA 3RYPA 4I99C 1FOWA 4BAYA 4IZZA 2DLLA 1Y1VJ 2WY8Q 2BVMA 1XMXA 2PLYA 3BR5A 2DW4A 4EJWA 5ICCA 5H6RA 4MGRA 2L7ZA 1LUJB 2QQ8A 3KYCB 3M1EA 3ZXSA 4DYRA 2R7SA 5CYVA 2RGVA 2DMNA 1G8XA 4IO9F 2CU7A 3H9QA 2R7VA 1X1CA 1ON1A 1T0FA 1IRXA 3R6SA 3ZOBA 1ONVA 3K6GA 2QKLB 4ON0A 2ZXHA 2QSHX 2E1NA 4KICA 1N25A 4BDZA 1MSEC 2XGDA 3MQ0A 2MYSA 1MNEA 2ZKZA 1R9TJ 1LB2A 3DKXA 4LK1F 2MA3A 2R5YA 1WJAA 3KLOA 2DO7A 1MBGA 3OR1C 2HVSA 1HSTA 4RGRA 4HF2A 3BG9A 2WY7Q 1IXSB 3I71A 3O8GA 1K83J 2CSOA 1VQKI 2HZDA 2EZIA 2HWVA 3BCBA 5TGTA 4CCMA 3H3UA 5J8FA 3MKYB 2NRAC 4ZTFA 3BR6A 1TWHJ 1FYKA 1TWCJ 4Q4ZF 1H9GA 2H1LA 3WE2A 2A6EF 5EYRA 4PSXA 5E79C 3QPSA 4LLGF 1WH5A 2O7OA 4ZYDA 2VE9A 3QYBA 2P6SA 5LGUA 2GM4A 5JLXA 5JFRA 4UV9A 5EZHA 5DM7F 4P9FA 3BG5A 5D5XB 1BR2A 2CJJA 1T0FC 2QWWA 1OKRA 1X1PA 1S7OA 1TT5B 4EQQA 2K4BA 3F22A 3FZVA 3LL7A 3GUDA 3F0CA 4Q47A 4P96A 1MBJA 2ECCA 4UV8A 4U88A 4MIMA 2PI0A 3DTKA 1MMGA 2Z16A 1USSA 2IPQX 3VSKA 4M6YA 1FSEA 2KQRA 2VT2A 1I39A 2KMUA 4ANJA 2YX7A 3DCFA 3BG6A 1ZRDA 3JSPA 2VXZA 4LOCA 4PJJA 1Z91A 1SVOA 3SYTA 3V4GA 4A3FJ 2KRCA 3LA2A 1JUMA 2MG4A 2JN6A 5IT9Z 3JRHA 4B3AA 2XRLA 3MVPA 4H4KC 5GPAA 3ELKA 4AIDA 2IGKA 3P7NA 1EH6A 4WCGA 1X2NA 1K78A 5LEJA 5D5UB 3HOZJ 2CQQA 2M4KA 3QU3A 1AKHA 4XR6A 4BL0B 1T6SA 4L18B 5IT3A 3GX4X 1MD0A 2R7UA 2OV7A 2L7KA 3DBRB 1TT0A 3FXMA 2KIQA 3LQQA 4IOAF 2L7FP 3BG7A 3VYSB 4C2UA 2E5ZA 2VQHA 1Z9CA 5IYBJ 3EYIA 1P92A 3I58A 3NARA 3S14J 4BQNA 5GPCA 2VBWA 3JSOA 4BUPA 1T8IA 3K2ZA 1ZYRF 3CCUI 1JT0A 1LEBA 5FKKA 4CZZA 2R7QA 3SJMA 2QUFA 5BPDA 4QTRA 2L7MP 3IHUA 4V2FA 1C0WA 3E3VA 2L02A 4A5MA 2ZSHB 4U7DA 3FXRA 4ZZLA 1W5SA 3H3VK 2EA4A 5J4VA 2GA2A 3W6KB 2JSCA 4A3CJ 3EUHA 3LSGA 2FOWA 1Z0XA 4UB8C 2A05A 3EETA 1LE8A 3S15J 2GBYA 2IA2A 1DP3A 1XDUA 1NK3P 4AYBA 3ZQ7A 3T8TA 1ZQ3P 2NVYJ 5GP9A 3MZ8A 3U9GA 3RZDJ 1D0XA 1SFKA 1QPMA 3FHZA 1PDNC 4O6JA 1S8NA 1UB9A 3C3WA 2ZXWH 5E8IA 4ZDOA 5K5QA 1H8AC 1ENHA 1BR4A 1LDDA 3GMEA 2OZ6A 2G7UA 2PFBA 1Y8QB 2FBIA 2HFHA 4N9IA 3S2HJ 2X48A 1K7AA 5J8CA 5DS9A 1J9IA 3RPQA 2P5KA 3K4LA 2DMPA 4AIJA 4E7JA 3G4SI 4M3EA 2FEZA 2DXIA 3S1NJ 2M7AA 3PFYA 3H9GA 4RM3A 1RNLA 2VT3A 5IP6A 1REPC 2K9MA 3W6VA 2ZJ2A 1WHUA 1T39A 4XNFA 3HOUJ 1XS9A 4MTEA 1YLFA 1S5LC 2KZVA 1JUSA 3EUHC 1TBXA 3PUFA 1RR8C 3OYJA 2COMA 3GFJA 3A03A 3FXQA 3IC7A 4BDYA 4CGZA 2LNBA 4HNTA 3ASOH 5M3FJ 1Z3XA 2LBFB 3IV5A 2P5VA 1T98A 4PUSA 1IG7A 3BCAA 2D2WA 3GZ5A 3R60A 1RUOA 2P7CB 4ZH4F 4V19K 4Y7NJ 2DPUA 4P5OA 1R1VA 2V6CA 3P9KA 4UVAA 4R79A 1JGSA 2NS7A 1WRJA 4BXUA 3KP7A 2PJRB 2JA2A 3SZGA 2BE5F 1QZZA 3H92A 2FNPA 4AVPA 2DODA 1OCRH 1MDMA 2BW3A 3GF2A 3LA7A 3SEZA 1U8RA 2P81A 2YUSA 3WTWC 2R7XA 2XIGA 4XLNF 1TNTA 2D5VA 2NOGA 4HPQA 5FLVA 5DCFA 2GIVA 1R4NB 5HS7A 5GADJ 2BY3A 3JREA 2Z99A 5ERIA 4I09A 1OCZH 1IW7F 2MD0A 3WHCA 2XPUA 3F8CA 1T56A 2XKPA 3MFKA 2XF7A 3DV8A 1ZARA 3OYHA 3S2WA 3ISPA 4KMUX 3DTEA 3E5UA 3ULQB 2QCOA 1BI2A 1NTCA 3ZMVA 3HIFA 4JBAA 3BQYA 3WTTC 1QBJA 2JUGA 4M6XA 5E1XA 4ZDLA 4BBRJ 5KVRA 5EGOB 2EWNA 1R5ID 4NB5A 3H3ZA 1Y39A 3HOXJ 3VOEA 1KYZA 4RMNA 4CCOA 4R8HA 3K1MA 4XKCA 2E35A 1G3SA 2EFWA 2GXAA 4DJAA 3CCEI 1YW8A 1QHHD 2OC6A 4NUBA 4PJNA 1IXRC 3G1OA 4FT8A 1R71A 3QYEA 3C2BA 2IEKA 3RKQA 1QVUA 3TW7A 2V4JC 3RSNA 1OJLA 5HOOA 4PK4A 2JVHA 1T33A 3REOA 5KNLA 2HVRA 3Q9SA 3WTVC 1JT6A 2STWA 4I76A 2L4MA 2FX0A 4UVBA 1F43A 1WPKA 2LR8A 3SZTA 4F7ZA 1VI0A 2JA5J 3QPHA 3LMMA 1N75A 1GT0C 1IGNA 4M3DA 3ZCOA 2IXSA 3OYIA 2HXOA 1O4XA 4HLXA 3CO7C 2HDWA 1RR7A 3U2RA 4FISA 1OYIA 3WTXC 1FP1D 1FX7A 4ZYAA 3HXLA 1VQOI 1UG2A 2YR2A 2M2EA 5H2FC 4IHVA 5ILSA 1SFEA 1YG2A 1HLVA 2P5LC 4IEJA 3CUQA 4EJOA 1OFCX 1UHSA 2BOLA 3JAMK 4OAZA 2FNAA 5K7ZA 5CKTA 4BQOA 3TDUC 2E34A 5ICEA 2BHYA 2HPIA 3P9IA 3FK7A 3VB2A 5ED4A 5F6FA 1EF4A 5DV5A 3WGIA 3CMEI 1B4AA 3CCVI 5B66C 4RGXA 4ENJA 3GXOA 1O3SA 2K9NA 2M34A 2WAEA 5LHHA 2IS4A 5LEKA 3FHNA 4HRIA 2PMZA 3OY9A 1XSDA 2I8DA 3F8NA 2QBYB 2LY2A 2HOAA 2OD5A 4I02A 1YRNA 3W6JB 4RB0A 3D1NI 3J81K 1K79A 1UHMA 1VTNC 3F8BA 1OR7A 3S8PA 4A6DA 2ETHA 2F5EA 3WGGA 3WU2C 2XVCA 3K1NA 1FIAA 3G1MA 1FT9A 5KAFC 3W2VA 3CUQC 4EEFG 1W5CC 3NWTA 2JVGA 1YJ9I 3ZQLA 2ZB9A 3MZHA 1WSUA 3KP5A 4E7SA 1XTAA 5K5OA 1Z05A 1G3WA 2HZTA 3KYLA 2ACJA 5D8LB 1LE8B 1TWGJ 5HLHA 3PQJA 5L3GA 5H20A 5EG0B 3HPHA 2L0KA 1TL8A 1K61A 1I6XA 3HRMA 4MFDA 3L09A 4K2EA 4UB6C 4HW0A 1IC8A 1EV7A 4YG2F 3S93A 1R58A 3HEFA 1JHHA 1ZLKA 3S1RJ 3E7LA 1QO0D 3WTYC 2D1HA 1DUXC 1BJZA 4RB3C 3LOCA 3RYRA 2M0CA 3ABTA 5AIPA 3JTGA 3GW2A 1PUEE 1LDJA 4ZTJA 4F52A 2L54A 2DJNA 2X9DA 2HU9A 3P5JA 4U0WA 4LK0F 3O8HA 4EJUA 4F91B 2LC2A 2E1MB 3BQZA 1D0ZA 1TLHB 3H0GJ 5CQGA 2RDPA 5FLXZ 3MCZA 2LY9A 3CP2A 4L5IA 2EIKH 4ESJA 2MBFA 4MQ9F 4KA4A 2X0LA 3C7JA 2RKHA 3TQNA 4E7KA 1R49A 2LP0A 4G94A 4XOTA 3S2DJ 3D5SC 3L2QA 1ON2A 3OWTA 4OWRB 1BR1A 5FB2A 2DA4A 4RLFA 1IV8A 4U0VA 1MKMA 1DP7P 3JRAA 1IV6A 2X51A 3OIQA 4CYDA 1G2HA 1ZRFA 2FF4A 3LSMA 1KU2A 4HV6A 1XD7A 2B0LA 3V7RA 3JAMZ 1TW2A 3WTZA 1B6AA 2HNHA 3H0DA 3CC2I 3RKWA 2LKSA 1T95A 1WJDA 1J75A 3FDYA 2R93J 2QEXI 3CDIA 1D8JA 2LVSA 1D8KA 2KLOA 1X4OA 4CHUA 4I0AA 2QENA 3B02A 2LTPA 2F2EA 1J5YA 3OIPA 2IS2A 4JX6A 4B4CA 3H5NA 3DTIA 3CC7I 1N77A 3MAJA 2Q8KA 2QQ9A 2Z5UA 3AG1H 4EVIA 3J80Z 4PGHA 3G73A 3K69A 4CCKA 3BOQA 4S05A 1KU7A 2HOTA 4NC8A 1BC8C 3F9KA 1ZELA 3MKZA 3ZMZA 1VNDA 1GV2A 5LHGA 2ZMEA 3CCYA 4C3IJ 1ERDA 4O5VA 3K7AJ 1YHQI 2VJ5A 4D1QA 3AAFA 3OYAA 2L2OA 2Z3YA 2FMLA 2VJIA 2VPRA 2P7VB 2DFIA 2DT5A 1LVAA 2R7TA 3KZZA 1IN7A 1HBXG 1A6QA 1E2XA 2O5RA 2KIFA 3PFIA 2OF7A 4QSHA 1K6OA 2QSGX 3ZGKA 1P4XA 1FIPA 3BTLA 1IN4A 5E17F 2DTZA 5L3EA 2HI3A 4LD5A 2RV8A 3TW6A 1X1BA 4WXCA 2L9VA 3HOSA 5J1RA 5BMZA 3DPUA 3HSRA 4KIGA 4L9VA 4EGYA 1L0OC 1XGMA 2R92J 1QVTA 4OU0A 2PX9A 2ZCWA 3ECOA 3SQNA 2WB1A 1VQLI 5FKLA 3QOPA 3D5RC 1WFXA 1QRYA 3LSIA 5H6QA 1M1EB 1YW7A 5FO5A 2CH0A 3HKZA 3GFIA 2HTJA 3N97A 3KX2A 2ZMEC 1X1DA 2OCCH 4XQFA 2ZNZA 2BV6A 3Q3SA 2CWEA 2IJLA 2NVQJ 4PSWA 1BW5A 4DQ2A 3DP7A 3GVAA 5E20A 4MFEA 3ZMSA 3JRGA 4LB5A 2EH3A 3RIRA 3TBIA 3J7AO 2WTEA 2V9PA 2WC2A 4GXOA 1WVRA 4KMFA 3LAPA 3ZPLA 1YYVA 1X4PA 3E0JB 1JKPC 4BBSJ 3ZMTA 3KFWX 4M9SA 2CYYA 3HOTA 5ILUA 4BQQA 1YS6A 5HDGA 6PAXA 2LBFA 1F1ZA 3IKVA 4KUMA 1IZ1A 3ABUA 1DGRM 4RAZA 3A02A 1R6RA 2FBHA 2VBYA 2VBZA 3CZ6A 3CLQA 1R4MB 2L3DA 5L3DA 4BE2A 1S72I 1YX3A 2AQFA 3AKZA 5DCMB 2PJRA 4DOZA 1FMWA 3GLXA 3CMAI 2DFEA 5TJJA 1MMSA 1OCTC 3ZQGA 1Z77A 2ESNA 1BI3A 2B9SA 1YRNB 1BJAA 3TGNA 2VXDA 1T08B 3ONQA 4B48A 4CCJA 1YQAA 4FE7A 5DD8A 2BHZA 2EIMH 1I5ZA 1ETWA 2RNGA 3F21A 3OR2C 2IVMA 2L01A 5FKMA 3DXJF 2K7LA 3GZNB 4G6QA 4QWQA 1U8BA 1GXPA 3IAS2 1MMNA 1VF9A 2EA2A 2VKHA 2KJBA 2DCEA 5FJ8J 4JK1X 3L2WA 2H1KA 5ICGA 1HKQA 1FEXA 3G71I 1U78A 2O0YA 2ISZA 2K4JA 5F64A 2Y9YA 1FC3A 5EGOA 2LRDA 1FTZA 5CLSA 1YI2I 3I55I 3KEQA 3PQKA 5C4XJ 2GA1A 2ECBA 2Y0SA 2PBIA 5FKOA 4A3BJ 5BS6A 1VFCA 3E6CC 1JE8A 2H09A 4LG0B 5TISC 5BOXA 2E1CA 3QWLA 4H0EA 3CQZJ 3IH4A 3A4CA 1O3TA 2HPMA 3KPHA 2WADA 3ZR8X 2W85A 2F4IA 4RM2A 3S1MJ 4PFOA 3FKJA 2WWYA 1MMAA 3GO5A 4BGDA 2BYVE 1ODDA 1U6GA 1S9HA 4G8XA 4XBFA 4B09A 2XSDC 2ZJQF 4DZJA 3BP8A 2PN6A 2FA5A 5HODA 2DT6A 2XASA 2MH2A 2V1UA 2BGCA 2K9QA 2O61A 1KQ8A 3K4KA 4IXAA 4BXXJ 3DEUA 1GDTA 2KP6A 3M9AA 1XX5A 4ZYHA 4E7ZA 1ZRCA 4RB1A 1WCMJ 3GTMJ 3FBIB 3L2VA 4HSTA 4BE0A 1JJ8C 1H89C 3T5XA 1O57A 4KYWA 4YFKF 2W82A 2PG4A 2CQKA 4F93B 3WE3A 3QP5A 2VC1A 4KJZA 1LVKA 4NHJA 1DU6A 5EEAA 1YJWI 1O7FA 1UAAA 2JT1A 2FJ1A 1D1BA 2KZGA 2HOEA 3E6MA 3TP0A 2MSYA 2DYRH 4N9HA 1RKTA 3C1DA 5K5RA 1CF7B 2EV0A 4U87A 2GZWA 1OCCH 1T38A 1KU3A 3LSKA 5JI6A 4AIHA 3HUGA 1T2KA 3CCLI 1E3PA 1TQPA 3DBHB 3RQ4A 1HW5A 1FZPB 3DPLC 2LSOA 1MH4A 2XAFA 2QA4I 1FSHA 4XRSG 1ETVA 5EJCA 1S3JA 4IF4A 3V8JA 1VZ0A 4I01A 4M73A 3VFZA 2C6YA 1U5TB 1YTYA 1TWFJ 3LSHA 4IQ4A 5JVGF 4XRMA 2XROA 2ZMEB 3MWMA 3FXUA 4ENNA 2HDDA 2LG4A 1TP4A 2BY2A 4LFUA 4BY7J 4UUTA 2QBYA 1J59A 3GZ6A 3JRIA 3OS2A 4XKVA 3D5LA 3JRDA 2EPFA 5HNFA 1BN5A 1WKMA 2FQ3A 3Q0UA 1GVJA 2HXIA 3F8FA 1J0RA 1JKOC 3CF2A 1SVMA 4KIFA 5EF6A 1IN5A 3KE2A 2XF6A 1DQUA 5IY5H 4BACA 4W1UA 3HYIA 1MBFA 2Y2ZA 1NH3A 2HGCA 1Z7LA 2DK8A 5E18F 1XCVA 3JR9A 1HC8A 4LMYA 5FKNA 4YIRX 2BBYA 3ABMH 3DU6A 5EG0A 1IAWA 2QKMB 1SFXA 3LWFA 5IPAA 3GCMA 1XGOA 3ECHA 4JYKA 1Z3YA 2LREA 2IS6A 2AXLA 2A6TA 3KIOA 3IKTA 2X1CA 2E5NA 3VPRA 5E3OA 1FTTA 2P8TA 1ZR4A 2LLKA 2BEOA 2PEXA 4XKWA 3WHBA 3QP6A 3K4BA 2ELKA 4S0HB 1WI3A 4UHTA 2XAGA 3M1CA 2IBDA 3V7SA 2F5VA 2K86A 2XHKA 3LSPA 1YE9A 3GYHX 4B8XA 1WZ2A 1SEUA 2GQQA 1MNDA 3BJAA 3C18A 1PUFB 2UUZA 2J5OA 4HOBA 1IRZA 3J7AY 5DUIA 2UWMA 4BHBA 3JRBA 4HBLA 5M5XJ 3O2PE 2VQCA 2L4AA 4BH9A 3GTOJ 3KP4A 5E1ZB 3HSFA 4HLYA 2CQXA 3QRFF 4AUXA 1MW7A 5HDNA 5HNHA 5LGTA 3TEDA 3GTGJ 1XSXA 3BTIA 1YS7A 1H88C 1TQMA 1XN7A 5J3LA 3OL4A 2ZFUA 1RESA 1LNWA 3ZRGA 4XKBA 2OQRA 1P7IA 2DYSH 4M9XA 1B1BA 1HXDA 2OCEA 3FISA 3HOVJ 4MHGA 3ESWB 2E1MC 3M8EA 1Q1HA 3CUOA 3CMMA 2EFOA 2XGEA 1QGPA 3QPTA 1OQYA 3RZOJ 3RI4A 4YFXF 3OYBA 5KHDA 2JK3A 1HDDC 2LYCA 4BHPA 2EFPA 4X0GA 4EGZA 2EV5A 3ZMDA 3HBLA 4C2TA 1J09A 2K9LA 3M8FA 2R3SA 2OQGA 4HF1A 1S7EA 4A0XA 1SD5A 3B73A 3AG2H 2O03A 1EA3A 2DA3A 3W2AA 3UR3C 2JPCA 3KZYA 1FBSA 1TWAJ 1SFUA 3GEZA 3BLYA 2EZHA 5CVIA 1JI8A 4CYCB 4A2UA 2PQ8A 3BPXA 4ZYEA 5L3BA 1FY7A 1KQ9A 3DEEA 5D6FA 5EDNA 4EJVA 1I3AA 4G7OF 2KKOA 3OYDA 2NVUB 4HZFA 2B63J 2UXNA 1J7KA 2CRGA 4BU2A 5GAHJ 4J01A 1HF0A 1F4KA 2VASA 3TO9A 4KISA 5HS9A 3O6BB 1CQTA 4Y33A 2V6EA 5JVTA 4N4NB 3DU5A 4JX5A 1ZG1A 4CA0A 3BR0A 3LQRA 5DYMA 4LIVA 4DBRA 4PFPA 3AL0C 2ZSIB 3HSEA 1HW1A 2OPTA 2M0MA 3NWSA 3LFKA 4UVCA 3RKXA 3RTRA 2JA7J 5FLXK 2QGUA 3H9JA 2CUEA 1GLNA 5B1BH 5FFXA 5DM6F 3S3NA 1E3HA 5F0CA 3IRRA 2ISYA 5IYCJ 3ZP5A 4WF2A 2F48A 5A2QK 5E3MA 4IHXA 2HEOA 4AVZA 4I98B 4LG3A 3KZIC 1Y6IA 3BDDA 3LSJA 5D8KB 1W4MA 5AIQA 1WJBA 2XAUA 3GBGA 3QU6A 1EH7A 1W7PB 4XN0A 4ABZA 1PP8F 3V42A 2GXBA 2EFQA 1ETYA 3IUOA 3S1QJ 3L2UA 3F8MA 4LJZF 1ZREA 3SDGA 3PO3J 1WH7A 1YOVB 2K3PA 4JP0A 3GWZA 4RS8A 2UXXA 4FASD 2XGCA 3HUGB 4JQFA 2CUFA 4D0PA 2F4OB 2F5DA 2CV2A 4PGGA 2EZKA 1U2WA 3RKYA 2IS1A 2R7FA 1FBUA 2FBKA 2WA0A 4UY8I 1EKEA 1BI1A 4BNCA 2X6WA 4NBQA 2M7BA 1BL0A 2ZBKA 2MW8A 1O3RA 2XF5A 3BPVA 4RB2C 2DFHA 5DCMA 2LDUA 2DA2A 3BG3A
chains in the Genus database with same CATH topology
3Q0VA 4V2GA 5EYRA 5C44J 3A01A 2YU9J 4A3LJ 1AHDP 1WGXA 2VPRA 2LKXA 3QPSA 3QPLA 1WH5A 2O7OA 3K2AA 2YS9A 2GM4A 1SANA 2HQ5A 5JLXA 2OF7A 2KDZA 5EZHA 2NS8A 2JWTA 3BG5A 4QSHA 2CJJA 2WV1A 2H8RA 1FIPA 3BTLA 5IYDJ 2DTZA 3F0CA 2HI3A 3SFIA 1MBJA 3TW6A 2ECCA 1BA5A 5J1RA 4MIMA 1I3QJ 1JGGA 2R92J 1QVTA 5FKLA 3DCFA 1QRYA 2LFBA 4LOCA 1MBEA 4D7NA 3BTJA 2PMZN 4IHWA 4I6ZA 3Q3SA 1ZTRA 4A3FJ 2NVQJ 1P7JA 1BW5A 2N8GA 1JUMA 2MG4A 5BNGA 2JN6A 4MFEA 3JRHA 4B3AA 2XRLA 3GTPJ 3MVPA 3JRGA 3OSGA 2EH3A 5GPAA 3L1PA 1X2NA 4JX4A 3HOZJ 2CQQA 1OCPA 2W48A 1AKHA 1SFOJ 1ZKGA 3QQAA 1JKPC 4BBSJ 4XK4A 1JTXA 4RDUA 2RAEA 5K7HA 2R5YB 2XB0X 1AU7A 2L7FP 5IYBJ 5F04A 3NARA 3S14J 2QF7A 3A02A 1ETOA 5GPCA 5JLWA 4UUSA 5C3EJ 4X1EA 1QPIA 3UKGA 2O8KA 4X6AJ 1JT0A 5E3NA 5FKKA 2JMWA 3SJMA 1MH3A 5F08A 2HOSA 3GTQJ 4QTRA 2L7MP 3MKLA 4V2FA 3A01B 1OCTC 3ZQGA 4A3KJ 1Z77A 4C3HJ 1HCRA 1YRNB 4NDLA 3H3VK 2DA5A 4FE7A 1NK2P 1Q1VA 5IP7J 4A3CJ 1ETWA 2LK2A 4M3GA 3LSGA 4RBOA 5FKMA 4D5CA 2EZLA 4M3FA 3I4MJ 2WAQN 2LD5A 1U8BA 1LE8A 4A3DJ 3ZQIA 3S15J 2GBYA 3LSRA 1JKQC 1MSFC 2DMTA 2Y30A 1VF9A 1RPWA 2DN0A 1NK3P 5FJ8J 2VKVA 4L5EA 1ZQ3P 2E1OA 2NVYJ 5GP9A 1LFUP 2H1KA 3RZDJ 1FEXA 1U78A 5J1UA 1D5YA 2Y9YA 3BTCA 5EGOA 3I4NJ 1H8AC 2Y31A 1FTZA 1ENHA 4Y52J 4A3GJ 2XPVA 3S2HJ 2X48A 1GUUA 5C4XJ 5DS9A 2ECBA 3MN2A 5FKOA 4A3BJ 2EQRA 2DMPA 1VFCA 4G12A 1Y1WJ 4M3EA 5DTDA 3S1NJ 3IH2A 3CQZJ 2AHQA 3IH4A 5IP6A 3JRCA 2EBIA 3BR2A 3NAUA 4B1RA 5E3LA 3W6VA 4MLOA 1HDPA 3LNQA 3S1MJ 4QIWN 3HOUJ 3GTLJ 1XS9A 1AKHB 2FD5A 4MO7A 5F0HA 2VKEA 1JUSA 5M3MJ 3ZQFA 5F27A 5M5WJ 3A03A 3B6CA 2XSDC 4DZJA 5M3FJ 1E3OC 5HODA 3IV5A 4FTHA 4XRSA 1IG7A 2K9QA 4UUSB 2NVTJ 4Y7NJ 4BXXJ 2R0QC 5IOZA 5K7FA 1GDTA 1IUFA 2DMQA 1I50J 2NS7A 1JTYA 1ZK8A 1WCMJ 1I6HJ 3GTMJ 2XPWA 1JJ8C 1H89C 1B8IA 1UMQA 2P81A 3PO2J 2YUSA 4A93J 2FQ4A 2O9LA 1DU6A 5EEAA 2D5VA 1RKWA 2NOGA 3FK6A 5FLVA 2FJ1A 4D7MA 3BT9A 3TP0A 2MSYA 1A5JA 1RKTA 2R5ZA 3JREA 1W0TA 3GTJJ 3WHCA 2XPUA 1PUFA 1T56A 2NVXJ 2K40A 4W97A 4DYQA 2QCOA 1NTCA 4D5FA 1MH4A 2M8GX 4XIDA 3BQYA 4XRSG 1ETVA 1ETKA 1RETA 4BBRJ 5EGOB 1X58A 2WB1N 2JA6J 2ME6A 1GV5A 3HOXJ 1ZR2A 3HKZN 1TWFJ 1ITYA 4XRMA 1W0UA 3OIOA 2HDDA 3G1OA 4BY7J 4UUTA 3C2BA 2IEKA 3RKQA 3JRIA 1QVUA 3JRDA 1XG1A 3TW7A 1OJLA 3Q0UA 2HXIA 1HOMA 1T33A 2ME0A 1JKOC 5F0FA 1LFBA 1JT6A 5EF6A 4I76A 4W1UA 1MBFA 4BKXA 3BR1A 2DMUA 2Y2ZA 2COBA 2IAIA 1FJLA 1MNMC 2FX0A 5IOYA 3B6AA 3CMYA 1ORKA 4DW6A 1F43A 3JR9A 1WPKA 2LR8A 5FKNA 1VI0A 2JA5J 2L9RA 5EG0A 3FKIJ 1TC3C 5IP9J 1GT0C 3HB9A 1IGNA 5IPAA 3TP3A 2Y9ZA 4M3DA 4JYKA 2HXOA 1O4XA 1RR7A 3VPRA 4GFBA 4FISA 5E3OA 1FTTA 1U9OA 1ZR4A 1B8IB 2LLKA 2TRTA 1DU0A 3WHBA 1UG2A 3JRFA 1JJ6C 2X6OA 2VUMJ 2ELKA 2M2EA 2MGQA 4M3BA 4S0HB 4HNVA 1WI3A 4IHVA 2E19A 4CYCA 2IBDA 1HLVA 1IDYA 4IEJA 3LSPA 2ID3A 2R5ZB 2I10A 1OFCX 3ZQHA 3DEWA 1UHSA 4M6VA 3S16J 1PUFB 5K7ZA 3CDLA 5C4JJ 1IRZA 3M4OJ 4AYBN 3JRBA 4J19A 5M5XJ 3FK7A 2XB5A 1EF4A 4C3JJ 5M5YJ 3GTOJ 1GVDA 2CQXA 4AC0A 1APLC 4AUXA 2K9NA 2M34A 3TEDA 5F1JA 2M9HA 5EZGA 3GTGJ 3FIWA 3BTIA 2Y0SN 1H88C 2G0EA 1B72A 5J3LA 2HOAA 1YRNA 1RESA 4A3IJ 3HM5A 3D1NI 2DA1A 1JKRC 1P7IA 2K9SA 2ID6A 4A3EJ 3FISA 4C2MJ 2R7ZJ 3HOVJ 1FIAA 3G1MA 4EEFG 5FLMJ 2KT0A 3ZQLA 2ZB9A 1ZGWA 3BR3A 2XGEA 1XC5A 2HYJA 2GLOA 3RZOJ 1LE8B 2JK3A 1TWGJ 1HDDC 2JA8J 1ETXA 2DA7A 1U9NA 5EG0B 2L0KA 3HBLA 1K61A 4MFDA 3ZQCA 2TCTA 1IC8A 1BW6A 3HEFA 2E2IJ 3HOWJ 3S1RJ 3E7LA 1S7EA 2AO9A 3HDDA 1POGA 1BJZA 1F36A 3LOCA 5J1YA 2DA3A 3IH3A 4BY1J 3M3YJ 2M0CA 1MBHA 1TWAJ 2EZHA 3S17J 2DJNA 2X9DA 1ETQA 3O8HA 4CYCB 5EDNA 3Q0WA 3BQZA 3RQIA 9ANTA 3H0GJ 3OSFA 4FCYA 2B63J 2LY9A 3GTKJ 2CRGA 1HF0A 1IDZA 4FE4A 2LP0A 3S2DJ 1CQTA 4JX5A 4A3MJ 3BR0A 2DA4A 4DZPA 4A69C 3HOYJ 1IJWC 3JRAA 3PM1A 1IV6A 2OPTA 2E2HJ 1G2HA 2JA7J 1Y1VJ 3HGGA 2CUEA 5F0CA 1B72B 3BR5A 4DYCA 3HGYA 3OOUA 5IYCJ 2E2JJ 1JUPA 2L7ZA 4DYRA 5E3MA 4IHXA 2DMNA 2CU7A 3LSJA 3GBGA 3G1LA 4ABZA 2R93J 3ZOBA 2DA6A 1ETYA 2JJ7A 2LVSA 4XICA 1MSEC 3S1QJ 2XGDA 3SDGA 3PO3J 1WH7A 2LTPA 1R9TJ 4JP0A 4JX6A 4B4CA 2XGCA 2R5YA 2CUFA 1MBGA 2EZKA 2HOTA 3BG9A 3O8GA 1X2MA 1K83J 4A3JJ 1VNDA 1GV2A 2EZIA 2VI6A 3CCYA 4C3IJ 1BL0A 2MW8A 4IHYA 3BR6A 1TWHJ 1TWCJ 3K7AJ 1MBKA 1Z0XA 1A6IA 2DA2A 3BG3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0V A;  4V2G A;  5EYR A;  5C44 J;  3A01 A;  2YU9 J;  4A3L J;  1AHD P;  1WGX A;  2VPR A;  2LKX A;  3QPS A;  3QPL A;  1WH5 A;  2O7O A;  3K2A A;  2YS9 A;  2GM4 A;  1SAN A;  2HQ5 A;  5JLX A;  2OF7 A;  2KDZ A;  5EZH A;  2NS8 A;  2JWT A;  3BG5 A;  4QSH A;  2CJJ A;  2WV1 A;  2H8R A;  1FIP A;  3BTL A;  5IYD J;  2DTZ A;  3F0C A;  2HI3 A;  3SFI A;  1MBJ A;  3TW6 A;  2ECC A;  1BA5 A;  5J1R A;  4MIM A;  1I3Q J;  1JGG A;  2R92 J;  1QVT A;  5FKL A;  3DCF A;  1QRY A;  2LFB A;  4LOC A;  1MBE A;  4D7N A;  3BTJ A;  2PMZ N;  4IHW A;  4I6Z A;  3Q3S A;  1ZTR A;  4A3F J;  2NVQ J;  1P7J A;  1BW5 A;  2N8G A;  1JUM A;  2MG4 A;  5BNG A;  2JN6 A;  4MFE A;  3JRH A;  4B3A A;  2XRL A;  3GTP J;  3MVP A;  3JRG A;  3OSG A;  2EH3 A;  5GPA A;  3L1P A;  1X2N A;  4JX4 A;  3HOZ J;  2CQQ A;  1OCP A;  2W48 A;  1AKH A;  1SFO J;  1ZKG A;  3QQA A;  1JKP C;  4BBS J;  4XK4 A;  1JTX A;  4RDU A;  2RAE A;  5K7H A;  2R5Y B;  2XB0 X;  1AU7 A;  2L7F P;  5IYB J;  5F04 A;  3NAR A;  3S14 J;  2QF7 A;  3A02 A;  1ETO A;  5GPC A;  5JLW A;  4UUS A;  5C3E J;  4X1E A;  1QPI A;  3UKG A;  2O8K A;  4X6A J;  1JT0 A;  5E3N A;  5FKK A;  2JMW A;  3SJM A;  1MH3 A;  5F08 A;  2HOS A;  3GTQ J;  4QTR A;  2L7M P;  3MKL A;  4V2F A;  3A01 B;  1OCT C;  3ZQG A;  4A3K J;  1Z77 A;  4C3H J;  1HCR A;  1YRN B;  4NDL A;  3H3V K;  2DA5 A;  4FE7 A;  1NK2 P;  1Q1V A;  5IP7 J;  4A3C J;  1ETW A;  2LK2 A;  4M3G A;  3LSG A;  4RBO A;  5FKM A;  4D5C A;  2EZL A;  4M3F A;  3I4M J;  2WAQ N;  2LD5 A;  1U8B A;  1LE8 A;  4A3D J;  3ZQI A;  3S15 J;  2GBY A;  3LSR A;  1JKQ C;  1MSF C;  2DMT A;  2Y30 A;  1VF9 A;  1RPW A;  2DN0 A;  1NK3 P;  5FJ8 J;  2VKV A;  4L5E A;  1ZQ3 P;  2E1O A;  2NVY J;  5GP9 A;  1LFU P;  2H1K A;  3RZD J;  1FEX A;  1U78 A;  5J1U A;  1D5Y A;  2Y9Y A;  3BTC A;  5EGO A;  3I4N J;  1H8A C;  2Y31 A;  1FTZ A;  1ENH A;  4Y52 J;  4A3G J;  2XPV A;  3S2H J;  2X48 A;  1GUU A;  5C4X J;  5DS9 A;  2ECB A;  3MN2 A;  5FKO A;  4A3B J;  2EQR A;  2DMP A;  1VFC A;  4G12 A;  1Y1W J;  4M3E A;  5DTD A;  3S1N J;  3IH2 A;  3CQZ J;  2AHQ A;  3IH4 A;  5IP6 A;  3JRC A;  2EBI A;  3BR2 A;  3NAU A;  4B1R A;  5E3L A;  3W6V A;  4MLO A;  1HDP A;  3LNQ A;  3S1M J;  4QIW N;  3HOU J;  3GTL J;  1XS9 A;  1AKH B;  2FD5 A;  4MO7 A;  5F0H A;  2VKE A;  1JUS A;  5M3M J;  3ZQF A;  5F27 A;  5M5W J;  3A03 A;  3B6C A;  2XSD C;  4DZJ A;  5M3F J;  1E3O C;  5HOD A;  3IV5 A;  4FTH A;  4XRS A;  1IG7 A;  2K9Q A;  4UUS B;  2NVT J;  4Y7N J;  4BXX J;  2R0Q C;  5IOZ A;  5K7F A;  1GDT A;  1IUF A;  2DMQ A;  1I50 J;  2NS7 A;  1JTY A;  1ZK8 A;  1WCM J;  1I6H J;  3GTM J;  2XPW A;  1JJ8 C;  1H89 C;  1B8I A;  1UMQ A;  2P81 A;  3PO2 J;  2YUS A;  4A93 J;  2FQ4 A;  2O9L A;  1DU6 A;  5EEA A;  2D5V A;  1RKW A;  2NOG A;  3FK6 A;  5FLV A;  2FJ1 A;  4D7M A;  3BT9 A;  3TP0 A;  2MSY A;  1A5J A;  1RKT A;  2R5Z A;  3JRE A;  1W0T A;  3GTJ J;  3WHC A;  2XPU A;  1PUF A;  1T56 A;  2NVX J;  2K40 A;  4W97 A;  4DYQ A;  2QCO A;  1NTC A;  4D5F A;  1MH4 A;  2M8G X;  4XID A;  3BQY A;  4XRS G;  1ETV A;  1ETK A;  1RET A;  4BBR J;  5EGO B;  1X58 A;  2WB1 N;  2JA6 J;  2ME6 A;  1GV5 A;  3HOX J;  1ZR2 A;  3HKZ N;  1TWF J;  1ITY A;  4XRM A;  1W0U A;  3OIO A;  2HDD A;  3G1O A;  4BY7 J;  4UUT A;  3C2B A;  2IEK A;  3RKQ A;  3JRI A;  1QVU A;  3JRD A;  1XG1 A;  3TW7 A;  1OJL A;  3Q0U A;  2HXI A;  1HOM A;  1T33 A;  2ME0 A;  1JKO C;  5F0F A;  1LFB A;  1JT6 A;  5EF6 A;  4I76 A;  4W1U A;  1MBF A;  4BKX A;  3BR1 A;  2DMU A;  2Y2Z A;  2COB A;  2IAI A;  1FJL A;  1MNM C;  2FX0 A;  5IOY A;  3B6A A;  3CMY A;  1ORK A;  4DW6 A;  1F43 A;  3JR9 A;  1WPK A;  2LR8 A;  5FKN A;  1VI0 A;  2JA5 J;  2L9R A;  5EG0 A;  3FKI J;  1TC3 C;  5IP9 J;  1GT0 C;  3HB9 A;  1IGN A;  5IPA A;  3TP3 A;  2Y9Z A;  4M3D A;  4JYK A;  2HXO A;  1O4X A;  1RR7 A;  3VPR A;  4GFB A;  4FIS A;  5E3O A;  1FTT A;  1U9O A;  1ZR4 A;  1B8I B;  2LLK A;  2TRT A;  1DU0 A;  3WHB A;  1UG2 A;  3JRF A;  1JJ6 C;  2X6O A;  2VUM J;  2ELK A;  2M2E A;  2MGQ A;  4M3B A;  4S0H B;  4HNV A;  1WI3 A;  4IHV A;  2E19 A;  4CYC A;  2IBD A;  1HLV A;  1IDY A;  4IEJ A;  3LSP A;  2ID3 A;  2R5Z B;  2I10 A;  1OFC X;  3ZQH A;  3DEW A;  1UHS A;  4M6V A;  3S16 J;  1PUF B;  5K7Z A;  3CDL A;  5C4J J;  1IRZ A;  3M4O J;  4AYB N;  3JRB A;  4J19 A;  5M5X J;  3FK7 A;  2XB5 A;  1EF4 A;  4C3J J;  5M5Y J;  3GTO J;  1GVD A;  2CQX A;  4AC0 A;  1APL C;  4AUX A;  2K9N A;  2M34 A;  3TED A;  5F1J A;  2M9H A;  5EZG A;  3GTG J;  3FIW A;  3BTI A;  2Y0S N;  1H88 C;  2G0E A;  1B72 A;  5J3L A;  2HOA A;  1YRN A;  1RES A;  4A3I J;  3HM5 A;  3D1N I;  2DA1 A;  1JKR C;  1P7I A;  2K9S A;  2ID6 A;  4A3E J;  3FIS A;  4C2M J;  2R7Z J;  3HOV J;  1FIA A;  3G1M A;  4EEF G;  5FLM J;  2KT0 A;  3ZQL A;  2ZB9 A;  1ZGW A;  3BR3 A;  2XGE A;  1XC5 A;  2HYJ A;  2GLO A;  3RZO J;  1LE8 B;  2JK3 A;  1TWG J;  1HDD C;  2JA8 J;  1ETX A;  2DA7 A;  1U9N A;  5EG0 B;  2L0K A;  3HBL A;  1K61 A;  4MFD A;  3ZQC A;  2TCT A;  1IC8 A;  1BW6 A;  3HEF A;  2E2I J;  3HOW J;  3S1R J;  3E7L A;  1S7E A;  2AO9 A;  3HDD A;  1POG A;  1BJZ A;  1F36 A;  3LOC A;  5J1Y A;  2DA3 A;  3IH3 A;  4BY1 J;  3M3Y J;  2M0C A;  1MBH A;  1TWA J;  2EZH A;  3S17 J;  2DJN A;  2X9D A;  1ETQ A;  3O8H A;  4CYC B;  5EDN A;  3Q0W A;  3BQZ A;  3RQI A;  9ANT A;  3H0G J;  3OSF A;  4FCY A;  2B63 J;  2LY9 A;  3GTK J;  2CRG A;  1HF0 A;  1IDZ A;  4FE4 A;  2LP0 A;  3S2D J;  1CQT A;  4JX5 A;  4A3M J;  3BR0 A;  2DA4 A;  4DZP A;  4A69 C;  3HOY J;  1IJW C;  3JRA A;  3PM1 A;  1IV6 A;  2OPT A;  2E2H J;  1G2H A;  2JA7 J;  1Y1V J;  3HGG A;  2CUE A;  5F0C A;  1B72 B;  3BR5 A;  4DYC A;  3HGY A;  3OOU A;  5IYC J;  2E2J J;  1JUP A;  2L7Z A;  4DYR A;  5E3M A;  4IHX A;  2DMN A;  2CU7 A;  3LSJ A;  3GBG A;  3G1L A;  4ABZ A;  2R93 J;  3ZOB A;  2DA6 A;  1ETY A;  2JJ7 A;  2LVS A;  4XIC A;  1MSE C;  3S1Q J;  2XGD A;  3SDG A;  3PO3 J;  1WH7 A;  2LTP A;  1R9T J;  4JP0 A;  4JX6 A;  4B4C A;  2XGC A;  2R5Y A;  2CUF A;  1MBG A;  2EZK A;  2HOT A;  3BG9 A;  3O8G A;  1X2M A;  1K83 J;  4A3J J;  1VND A;  1GV2 A;  2EZI A;  2VI6 A;  3CCY A;  4C3I J;  1BL0 A;  2MW8 A;  4IHY A;  3BR6 A;  1TWH J;  1TWC J;  3K7A J;  1MBK A;  1Z0X A;  1A6I A;  2DA2 A;  3BG3 A; 
#chains in the Genus database with same CATH topology
 2RQQ A;  3GLL A;  4N4O B;  4V2G A;  3CD6 I;  3I0T A;  4A3L J;  2F5F A;  1AHD P;  3HHG A;  3QPL A;  3J80 K;  4XRF A;  5GTH C;  1SAN A;  5E8G A;  4B47 A;  2KDZ A;  2GIZ A;  2NS8 A;  2WV1 A;  1FYM A;  1ZH5 A;  4LIU A;  2GAU A;  2OAZ A;  3SFI A;  5GAG J;  3OYL A;  4ENK A;  4MQV A;  3NQO A;  2VPL A;  1SD6 A;  4KNY A;  3V8L A;  3HRT A;  1B59 A;  1JGG A;  1BC7 C;  4OMY A;  3E1S A;  1UST A;  2XUB A;  3SZP A;  2ZXI A;  1QHG A;  3IAM 2;  1F9N A;  4FX0 A;  4IQJ A;  1STZ A;  3I5U A;  2LFB A;  1MBE A;  4E7H A;  3OMY A;  4HEA 2;  4D7N A;  3WU1 B;  2EIJ H;  4MEY F;  1R7J A;  3Q5F A;  4IHW A;  2VLA A;  3BY6 A;  4P9U A;  4J00 A;  2M8E A;  3FWE A;  5BNG A;  4LG0 A;  2Z33 A;  4RGU A;  4YFN F;  3OSG A;  3QAH A;  2NNN A;  3BC8 A;  3K4M A;  2EFN A;  2VBX A;  3U21 A;  2DU9 A;  5F1R A;  3KYD B;  1OCP A;  4ENM A;  1G3T A;  2K3F A;  1WJF A;  4XLE A;  3GFM A;  3ASN H;  3VYT B;  1ZGA A;  3QQA A;  3TOA A;  1RIO H;  4MNU A;  2ADU A;  4RDU A;  4M9Z A;  2RAE A;  3RJP A;  3S32 A;  5K7H A;  4BXF A;  3OYE A;  2HKO A;  2XB0 X;  2CV1 A;  1YW9 A;  3PNV A;  1R5G A;  4OAY A;  3OS1 A;  5A2Q Z;  5JLW A;  1NG6 A;  3ML6 A;  1HKT A;  5C3E J;  2CUZ A;  5D6E A;  1V5F A;  3EDP A;  4X1E A;  2Z2S B;  3P9C A;  4X6A J;  5E3N A;  3CDH A;  2JUC A;  1PVE A;  3L9F A;  5LRS A;  3GTQ J;  1MH3 A;  2Z1D A;  5F08 A;  2VOO A;  3MKL A;  5ILV A;  3A01 B;  1AA7 A;  2D1V A;  2IGN A;  1RC9 A;  3CP8 A;  4C3H J;  1HCR A;  3LAJ A;  4NDL A;  1V55 H;  3OS0 A;  3UNG C;  3IWZ A;  1NK2 P;  5IP7 J;  3I56 I;  5L3C A;  2LK2 A;  4M3G A;  4NQW B;  4RBO A;  4D5C A;  2W57 A;  4CDG A;  3I4M J;  2WAQ N;  3K0L A;  2LD5 A;  2M45 A;  2K85 A;  1SC7 A;  1CF7 A;  2A61 A;  2XAJ A;  3HHH A;  4L5J A;  1JKQ C;  2KL4 A;  1MSF C;  2CG4 A;  4I7H A;  1UCR A;  4CIC A;  1RPW A;  2MC4 A;  2IGM A;  2Y75 A;  2E1O A;  1WQ2 A;  5LD2 C;  1LFU P;  4NC6 A;  3HRS A;  3W3C A;  5J1U A;  3AL0 B;  4BHC A;  2VOP A;  3BTC A;  1ULY A;  1Z6R A;  3I4N J;  2H94 A;  3O3K A;  1FMV A;  2Y31 A;  1W1W E;  4LLN A;  2QQA A;  1UFM A;  2YPR A;  4Z2Y A;  3HL2 A;  2KIS A;  1U5T A;  4WWC A;  4Y52 J;  4A3G J;  2XPV A;  2H6B A;  3MN2 A;  4ESF A;  3CF5 F;  1BM9 A;  4CUG A;  2EQR A;  1WJC A;  4G12 A;  1Y1W J;  3FBN B;  2ZJP F;  2FSW A;  5B3S H;  2HTS A;  1MIJ A;  2RRE A;  5D4S A;  2AHQ A;  2EBI A;  1YFH A;  4B1R A;  1HDP A;  3PNY A;  1L3L A;  4QIW N;  3GTL J;  2MH9 A;  2FD5 A;  3C2H A;  1MZB A;  4KT6 A;  2A69 F;  3VYU B;  3EUK L;  1PP7 U;  3ZQF A;  3BZC A;  2IT0 A;  3G6E I;  4E6K G;  1DPU A;  3KLN A;  3MMY B;  1VQM I;  2CW7 A;  4LB6 B;  4GCV A;  3CCM I;  2FE3 A;  4IVN A;  1IN8 A;  1Z67 A;  4XLP F;  1BIA A;  1Y0N A;  4XRS A;  1S6L A;  4XSX F;  4UUS B;  4B3X A;  2NVT J;  2VN2 A;  1V3F A;  1D0Y A;  4QPQ A;  2DJI A;  5IOZ A;  1AOY A;  3H5A A;  1IUF A;  3DKY A;  3U1D A;  1R1U A;  2VC0 A;  3M7G A;  2DMQ A;  2NS0 A;  5B1A H;  2HQN A;  2OJE D;  3M07 A;  4RAY A;  1UZC A;  1JTY A;  1ZK8 A;  4B43 A;  1W5T A;  2XPW A;  1U5T C;  3EYY A;  3CCR I;  1H0M A;  5K1Y A;  2W84 A;  2R7R A;  2RN7 A;  1UMQ A;  3PO2 J;  2UZK A;  2LY1 A;  3PSF A;  5CJ9 A;  4L0Z B;  2ESH A;  1RKW A;  3FK6 A;  4UNO A;  1OCO H;  4D7M A;  2BY1 A;  2J5P A;  4M72 A;  4OIN F;  4ZJZ A;  2XRN A;  4EM0 B;  4EJT A;  4U7B A;  4FHT A;  3I54 A;  2R7D A;  4A0Z A;  3GTJ J;  1FYL A;  1PUF A;  4KIB A;  4HF0 A;  3SFZ A;  1G59 A;  2NVX J;  4W97 A;  1OIS A;  1A04 A;  2XDV A;  4DYQ A;  3DBL B;  1P9Q C;  4ZZD A;  1V5G A;  4D5F A;  5LLQ A;  4XID A;  4GDF A;  3L2C A;  1RET A;  3EPZ A;  2FU4 A;  1X58 A;  1Z7U A;  2JA6 J;  2DOF A;  2IA0 A;  1GV5 A;  4CXF A;  2HQA A;  4XLH A;  1ZR2 A;  2DK5 A;  4RAG A;  1Z6T A;  4TV7 A;  5DEQ A;  2E60 A;  2VL8 A;  4EMS A;  3TDZ C;  1MJB A;  2XKO A;  3DPT A;  1D5V A;  1W0U A;  5ICF A;  4XL9 A;  4ZC3 A;  2FOK A;  4R1H A;  5FFZ A;  2WBM A;  4CZC A;  2HDC A;  2K27 A;  4AD9 A;  4F92 B;  2V1N A;  4PJL A;  4Y3O A;  3DLL F;  2CGP A;  1WJ5 A;  2Q0O A;  3I64 A;  2A07 F;  1HKS A;  2A5Y B;  4OIR F;  3SXY A;  5HVQ C;  4XM3 A;  2EB7 A;  3FX3 A;  4HDU A;  3CCJ I;  5L3F A;  4IOC F;  5F0F A;  1LFB A;  1Y56 A;  4G7Z F;  2DMU A;  2COB A;  2DFF A;  4G6T B;  1UEL B;  2RQP A;  1FJL A;  2ZO4 A;  2FMY A;  3KCC A;  5IOY A;  1YIT I;  1X3W B;  2PJP A;  1ORK A;  4DW6 A;  4EV0 A;  1EH8 A;  4Q48 A;  3ZMU A;  2W00 A;  2V79 A;  1W7P D;  3CCQ I;  3N4M A;  1TC3 C;  3HB9 A;  2Y9Z A;  1G4D A;  5LBQ A;  3PIO F;  2E36 A;  2VB6 A;  4GO1 A;  4MEX F;  4GFB A;  3VDX A;  2EJR A;  2R7W A;  1U9O A;  4C30 A;  1B8I B;  1IN6 A;  2QSF X;  3HJE A;  1DU0 A;  3WTS C;  2LKP A;  1R00 A;  4S04 A;  3FMS A;  4DNC A;  1WWX A;  2EV6 A;  2MGQ A;  3HRU A;  1FBQ A;  1OYW A;  4HNV A;  5JHF A;  4BE1 A;  4CYC A;  5HLI A;  2DT7 B;  3FM3 A;  3ROU A;  4BS9 A;  1QZY A;  3CES A;  2ID3 A;  1XPX A;  2R5Z B;  1SAX A;  2DQL A;  2QZ8 A;  1S29 A;  1ACI A;  3HC7 A;  3S16 J;  1OMI A;  4YEJ A;  5C4J J;  1O7L A;  1X3Z B;  4AYB N;  5LHI A;  2CQN A;  4IRH A;  1R36 A;  3E6B A;  2L9N A;  2DAO A;  4B44 A;  1FP2 A;  4C3J J;  2OA4 A;  3V7C A;  3I53 A;  1APL C;  3AG4 H;  1D1C A;  3NRV A;  4II3 A;  2M9H A;  2LOO A;  4QLC U;  4DGW B;  1H9T A;  4L9N A;  2W25 A;  2G0E A;  5GTI C;  1VQ4 I;  1QA6 A;  3CJQ B;  2RVC A;  4DBQ A;  4A3I J;  2AQE A;  5JR3 A;  2DA1 A;  4L9J A;  2DTR A;  1JKR C;  2A68 F;  2K9S A;  4U0Y A;  2XAQ A;  4C2M J;  4XMY A;  3I9V 2;  2X1D A;  2R4G A;  4I0B A;  1JXS A;  3LA3 A;  1ZG5 A;  3BZK A;  1W7P A;  5FLM J;  3I59 B;  2KT0 A;  4XOR A;  5BQT A;  3IL2 A;  1VQ5 I;  2HYJ A;  2O8X A;  2RC4 A;  1JHF A;  1ETX A;  1U9N A;  2WAF A;  1ZLJ A;  3CJN A;  2QLZ A;  5KCM A;  4A0Y A;  2Q2E B;  4F55 A;  5CVV A;  3ABK H;  4E7I A;  1LQ1 A;  3QYF A;  2VE8 A;  3H5R A;  2IRF G;  4XON A;  3HDD A;  1XDS A;  1POG A;  3WGH A;  3KP2 A;  5J1Y A;  4E70 A;  3M3Y J;  3GFL A;  3R0A A;  4HNU A;  3S17 J;  1BIB A;  3BZ6 A;  3HZJ A;  2VJJ A;  1YJN I;  1DPR A;  1RZ4 A;  4FX4 A;  3NEU A;  4HV5 A;  3ERE D;  2G7H A;  4HAM A;  3FXK A;  4FCY A;  3I3L A;  3S3M A;  2IA1 A;  3TO6 A;  2M30 A;  4AU7 A;  1RI7 A;  4QPO A;  1K4S A;  1IDZ A;  3A1Y A;  4FE4 A;  1A31 A;  1YIJ I;  2PMU A;  3CJR B;  3KP3 A;  2OUM A;  2KDO A;  3M8J A;  1I27 A;  3J7Y J;  1K4T A;  2TDX A;  2O3F A;  5J4Y A;  3PIP F;  2HKX A;  4OIO F;  1QU3 A;  5KK1 A;  2XSJ C;  4A69 C;  3JW4 A;  3G3Z A;  1IJW C;  3PM1 A;  1PYV A;  4C9Y A;  2E2H J;  4RA2 A;  3FXO A;  4HX7 A;  2VQG A;  4BEH B;  3DFG A;  3F72 A;  2H27 A;  3FXJ A;  3HGG A;  2CUJ A;  1A36 A;  2V7F A;  1B72 B;  4DYC A;  3MZY A;  3HGY A;  1XGS A;  4BYY A;  1XGN A;  3OOU A;  2E2J J;  2EIN H;  2F5C A;  1JUP A;  3E6D A;  5LRR A;  1R5H A;  2Z9O A;  2CFX A;  1YX5 A;  3OYC A;  4ETS A;  3G1L A;  2GOX B;  4DIQ A;  2DA6 A;  3VSL A;  4G9Y A;  2JJ7 A;  4XIC A;  2X4H A;  1VQ6 I;  4FET A;  1KA8 A;  3F23 A;  2VJ4 A;  4M71 A;  3VEP A;  3CC4 I;  2CS3 A;  2HYF A;  3FXL A;  3PNT A;  3U1K A;  3IP4 B;  2JZY A;  4GYI A;  3S3O A;  2H8W A;  2M4G A;  4EAT A;  2E7X A;  1X2M A;  2JRM A;  2MD5 A;  4LGW A;  1W36 D;  1SMT A;  3TL4 X;  4A3J J;  2W1O A;  4L0Y B;  1TZL A;  1HW2 A;  3DQV C;  4ZYG A;  3WU0 A;  2VI6 A;  2OTJ I;  3OYN A;  1DGW Y;  2CW8 A;  4IHY A;  2E71 A;  2V26 A;  1I1G A;  1HQC A;  2YX4 A;  1MBK A;  1A6I A;  4WXD A;  2K02 A;  3WOD F;  2KHM A;  2HYG D;  3K10 A;  3Q0V A;  5C44 J;  3LST A;  3A01 A;  2YU9 J;  1WGX A;  3KEY A;  3PL8 A;  2LKX A;  3H35 A;  2DOA A;  2X6Y A;  2L9S A;  3K2A A;  4IHT A;  3J7Z I;  2YS9 A;  4N0B A;  1XB4 A;  2HQ5 A;  4HX8 A;  2JWT A;  2NAZ A;  2E7W A;  1ZAO A;  2H8R A;  5D5W B;  1VQ7 I;  4NQW A;  4BJT A;  4OIQ F;  5IYD J;  3DKW A;  1ZG3 A;  2MFZ A;  1P4A A;  3MKW B;  2YU3 A;  1N78 A;  2IW5 A;  1BA5 A;  2M1B A;  1UJ8 A;  2LMD A;  4F3Q A;  1SD4 A;  3TO7 A;  1I3Q J;  4HQM A;  5LFA A;  2ICW G;  2ZJR F;  2X85 A;  4YEL A;  4WXH A;  4YIF A;  3COA C;  5AON A;  2ZC2 A;  5DUK A;  4HDV A;  3L00 A;  4G6D A;  3RDI A;  1QQI A;  3T0Y A;  3HTS B;  1G6N A;  3BTJ A;  2PMZ N;  4KN4 X;  1LPQ A;  4KDP A;  4I6Z A;  1ZTR A;  1P7J A;  2N8G A;  1E17 A;  1U3E M;  1TTY A;  3R61 A;  3GTP J;  4IJA A;  4XSZ F;  1LJ9 A;  4Y17 A;  3ABL H;  1I1S A;  3A0H C;  1P2F A;  3L1P A;  3QOE A;  1WJE A;  3KP6 A;  4JX4 A;  3G2B A;  3MD2 A;  2W48 A;  2GXG A;  1U0J A;  5DD4 A;  3QOD A;  1OLT A;  3BJ6 A;  1Y8R B;  1ZKG A;  4PDK A;  3E97 A;  1SFO J;  2XAH A;  4PJ0 C;  3TKY A;  3ZN1 A;  4XK4 A;  1JTX A;  1ZHF A;  3OYF A;  2CQ7 A;  2R5Y B;  1HSJ A;  1AU7 A;  1LDK B;  3L2R A;  2CMP A;  2VOD A;  1QZE A;  1X19 A;  3EUA A;  5F04 A;  3K70 D;  2ELH A;  4OMZ A;  4RGS A;  4WX9 A;  2XC7 A;  2QF7 A;  1ETO A;  4UUS A;  3C2G A;  2HVQ A;  2LH9 A;  4KFC A;  1G3Y A;  4EM1 A;  1QPI A;  3UKG A;  2O8K A;  4XLC A;  3VYR B;  3HPG A;  3IRQ A;  3F6O A;  2MAB A;  3KEO A;  1UG0 A;  2KIU A;  2JMW A;  2HOS A;  4GGG A;  5E1W A;  2V1X A;  5CVU A;  4LLL A;  3JTH A;  3AG3 H;  4A3K J;  5D4R A;  2Y69 H;  4XOP A;  5GAE J;  2DA5 A;  4LIT A;  1YO5 C;  1Q1V A;  4NC7 A;  4IX7 A;  2RNJ A;  2Q1Z B;  1FWZ A;  2MLK A;  3HG9 A;  2EZL A;  3FMR A;  4M3F A;  2I5U A;  2ZXJ A;  3I4P A;  2X1E A;  3OL3 A;  4RLQ A;  4A3D J;  3CJT B;  3ZQI A;  3K4N A;  3LSR A;  5KAI C;  2FXA A;  3BWG A;  2DMT A;  2Y30 A;  3WTU C;  1W36 C;  2DPD A;  2DN0 A;  4CCL A;  4A6E A;  1X3U A;  4HYE A;  2VKV A;  4L5E A;  3L7W A;  2W4S A;  3V8K A;  1D5Y A;  1RRJ A;  2P6T A;  4EM2 A;  2BY0 A;  1OYY A;  1IUY A;  4CH7 A;  4A12 A;  5CVR A;  4IRG A;  4ITV A;  1GUU A;  4NNJ A;  4E7L A;  3HTU A;  3H36 A;  2NYX A;  2V9K A;  5DTD A;  3IH2 A;  3CLO A;  3JRC A;  3BR2 A;  3NAU A;  5E3L A;  1K78 B;  4MLO A;  3LNQ A;  3F6V A;  1AKH B;  2QYO A;  4XN3 A;  4MO7 A;  1R22 A;  5F0H A;  3X2Q H;  2VKE A;  2D45 A;  2DBB A;  3WG7 H;  5M3M J;  2CO5 A;  5F27 A;  5M5W J;  2A5W A;  3B6C A;  1NHA A;  3FF5 A;  1E3O C;  3OYM A;  2VON A;  3E5Q A;  4FTH A;  3AFH A;  2WV0 A;  1SVL A;  3F3X A;  1QNT A;  2BXY A;  4E4H A;  2R0Q C;  2HQR A;  5K7F A;  1DDN A;  1E0E A;  2JTV A;  1B9M A;  2CFO A;  4KT5 C;  1I50 J;  2DDA A;  2BVL A;  3BJO A;  1I6H J;  3PJR A;  3OYG A;  2FUG 2;  4IL6 C;  1VQN I;  1R1T A;  1B8I A;  5HS8 A;  1Z1D A;  2OU2 A;  1GHC A;  4UUV A;  4GRI A;  2NXN B;  3K1P A;  2EK5 A;  4D9J A;  4IRI A;  3WG9 A;  1YIO A;  4GYG A;  4A93 J;  2FQ4 A;  2O9L A;  3A0B C;  1V54 H;  1SMY F;  1FLI A;  4P1W A;  4JOM A;  4CCN A;  3BT9 A;  1KQ0 A;  2B7E A;  1VQ8 I;  3FMQ A;  4P55 A;  2R5Z A;  1A5J A;  4HX4 A;  1VQP I;  1IRG A;  1W0T A;  1BOB A;  1O3Q A;  2K5C A;  3K70 C;  1WI9 A;  3SEQ A;  4BJ5 C;  1IRF A;  5FD5 A;  1Y0U A;  2K40 A;  2JQ7 A;  2VKD A;  2DDB A;  1D3Y A;  3K9T A;  2EIL H;  2M8G X;  4A5N A;  5FD6 A;  4HG2 A;  1ETK A;  1ZGJ A;  4PJM A;  4KIT B;  2WB1 N;  2ME6 A;  1HA8 A;  1LFP A;  1KON A;  1IO2 A;  1NG7 A;  2CW0 F;  3HKZ N;  3H1C A;  2ZNY A;  4RAF A;  3TMO A;  1ITY A;  4UXN A;  4L9T A;  1SAU A;  2OBP A;  4IPA A;  3OIO A;  1KYW A;  5HLG A;  1MJA A;  3D0S A;  2LF8 A;  2OTL I;  4Q5S F;  1OR7 C;  3E5X A;  1XG1 A;  4O3M A;  4MTD A;  1HOM A;  2NOJ B;  2ME0 A;  2PMH A;  2KJC A;  2KRH A;  3PSI A;  2DI3 A;  5B5E C;  3CO6 C;  4Z6Y A;  3K4C A;  3KET A;  3PUB A;  1RUN A;  3DWL E;  5JHU A;  1R23 A;  3CCS I;  1LKX A;  3I59 A;  4BKX A;  3BR1 A;  1KGS A;  1XMK A;  2IAI A;  3R4K A;  1MNM C;  1KZH A;  4CO8 A;  3B6A A;  3CMY A;  5D5V B;  2NNY A;  5BPI A;  4OIP F;  4AWX B;  2QQB A;  2L9R A;  3RPU D;  3EQL F;  3FKI J;  1D1A A;  1IF1 A;  2HS5 A;  2JPB A;  5IP9 J;  5J47 A;  5J40 A;  1UHW A;  1F5T A;  3TP3 A;  2ELJ A;  4I2O A;  2M5W A;  3SDB A;  2Q2E A;  5HDK A;  2F4M B;  2STT A;  4KN7 X;  2IP2 A;  2XV4 S;  4Y4R A;  4YRV A;  1MDM B;  2BW3 B;  1XMA A;  4AIK A;  1MGT A;  2TRT A;  3N05 A;  1P4W A;  3K4J A;  1ZN2 A;  4Y13 A;  3JRF A;  3VOD A;  5FRO A;  1JJ6 C;  2X6O A;  2VUM J;  1FOX A;  1MJ9 A;  4M3B A;  2VQL A;  1XSV A;  2E19 A;  4OOI A;  2AXT C;  1IDY A;  1AWC A;  2GWR A;  3FM5 A;  4BQA A;  3W2W A;  2I10 A;  3ZQH A;  3DEW A;  2YSR A;  4M6V A;  2X6X A;  2QM3 A;  1LEA A;  3CDL A;  1J2X A;  3LFU A;  2H6C A;  5FRN A;  3RCO A;  1CGP A;  2L5Q A;  3M4O J;  2AS5 F;  1FOK A;  2DQR A;  4ZDP A;  4J19 A;  2ZFW A;  3J81 Z;  2XB5 A;  1Z21 A;  2FRH A;  3OV8 A;  5M5Y J;  2M87 A;  5J6X A;  4WK8 F;  2P0W A;  1GVD A;  4CSW A;  4AC0 A;  2O6G E;  5F1J A;  5EZG A;  4BEH A;  4ASN A;  3FIW A;  3MEX A;  2Y0S N;  1BBY A;  2JRT A;  2GOM A;  2LF7 A;  5HLT A;  1B72 A;  2MC3 A;  1V5E A;  2V1D A;  1KU9 A;  1VQ9 I;  2Y0M A;  3T8R A;  1X1A A;  2KRF A;  3HM5 A;  3T1B A;  4XLF A;  1V4R A;  5FGM A;  2ID6 A;  1B9N A;  4A3E J;  4HSR A;  1FPQ A;  1TQI A;  5CQE A;  1FOY A;  2R7Z J;  3ERM A;  2W24 A;  3RPU A;  4IKF A;  1ZGW A;  3BR3 A;  4YII A;  2QVO A;  3A2K A;  1XC5 A;  2P4W A;  3VWB A;  2BXZ A;  1OPC A;  2GLO A;  2DOE A;  4PCQ A;  4BJ6 C;  4PZJ A;  1TNS A;  2JA8 J;  3DLA A;  2DA7 A;  2KIM A;  3ZN0 A;  4ESB A;  2CV0 A;  4AM3 A;  3ZQC A;  2TCT A;  1BI0 A;  2F6C A;  5TRD A;  1BW6 A;  2Y48 A;  3DF8 A;  2E2I J;  3HOW J;  4XLA A;  2AO9 A;  2OZU A;  1S7A A;  2BZT A;  5EEG A;  3ZQQ A;  3SHF A;  1F36 A;  4HA8 A;  3IH3 A;  4BY1 J;  1GXQ A;  1SD7 A;  2VIX A;  4M74 A;  1MBH A;  2XGX A;  2KPM A;  1ETQ A;  3BRO A;  2A6H F;  1PJR A;  3CUQ B;  3Q0W A;  1XCB A;  3RQI A;  3TOB A;  2R7O A;  1BOA A;  3OSF A;  9ANT A;  2IGO A;  4FQG A;  2MLG A;  4Y15 A;  5CVJ A;  5DDG A;  4G7H F;  5FRM A;  1A35 A;  2KFD A;  3GTK J;  2WAQ A;  3CTA A;  4HQE A;  5IT9 K;  3Q9V A;  1FNN A;  5CPR B;  3OOP A;  1EJ9 A;  2V9V A;  3IWF A;  2W7N A;  2UV1 A;  4A3M J;  2G9W A;  3R0J A;  5LGN A;  5EEH A;  2JSP A;  2A3S A;  4IHS A;  4DZP A;  1TW3 A;  3HOY J;  3OYK A;  3JCU C;  1P6R A;  2HR3 A;  4II2 A;  1IXC A;  1MMD A;  2M3A A;  1K6Y A;  3RYP A;  4I99 C;  1FOW A;  4BAY A;  4IZZ A;  2DLL A;  1Y1V J;  2WY8 Q;  2BVM A;  1XMX A;  2PLY A;  3BR5 A;  2DW4 A;  4EJW A;  5ICC A;  5H6R A;  4MGR A;  2L7Z A;  1LUJ B;  2QQ8 A;  3KYC B;  3M1E A;  3ZXS A;  4DYR A;  2R7S A;  5CYV A;  2RGV A;  2DMN A;  1G8X A;  4IO9 F;  2CU7 A;  3H9Q A;  2R7V A;  1X1C A;  1ON1 A;  1T0F A;  1IRX A;  3R6S A;  3ZOB A;  1ONV A;  3K6G A;  2QKL B;  4ON0 A;  2ZXH A;  2QSH X;  2E1N A;  4KIC A;  1N25 A;  4BDZ A;  1MSE C;  2XGD A;  3MQ0 A;  2MYS A;  1MNE A;  2ZKZ A;  1R9T J;  1LB2 A;  3DKX A;  4LK1 F;  2MA3 A;  2R5Y A;  1WJA A;  3KLO A;  2DO7 A;  1MBG A;  3OR1 C;  2HVS A;  1HST A;  4RGR A;  4HF2 A;  3BG9 A;  2WY7 Q;  1IXS B;  3I71 A;  3O8G A;  1K83 J;  2CSO A;  1VQK I;  2HZD A;  2EZI A;  2HWV A;  3BCB A;  5TGT A;  4CCM A;  3H3U A;  5J8F A;  3MKY B;  2NRA C;  4ZTF A;  3BR6 A;  1TWH J;  1FYK A;  1TWC J;  4Q4Z F;  1H9G A;  2H1L A;  3WE2 A;  2A6E F;  5EYR A;  4PSX A;  5E79 C;  3QPS A;  4LLG F;  1WH5 A;  2O7O A;  4ZYD A;  2VE9 A;  3QYB A;  2P6S A;  5LGU A;  2GM4 A;  5JLX A;  5JFR A;  4UV9 A;  5EZH A;  5DM7 F;  4P9F A;  3BG5 A;  5D5X B;  1BR2 A;  2CJJ A;  1T0F C;  2QWW A;  1OKR A;  1X1P A;  1S7O A;  1TT5 B;  4EQQ A;  2K4B A;  3F22 A;  3FZV A;  3LL7 A;  3GUD A;  3F0C A;  4Q47 A;  4P96 A;  1MBJ A;  2ECC A;  4UV8 A;  4U88 A;  4MIM A;  2PI0 A;  3DTK A;  1MMG A;  2Z16 A;  1USS A;  2IPQ X;  3VSK A;  4M6Y A;  1FSE A;  2KQR A;  2VT2 A;  1I39 A;  2KMU A;  4ANJ A;  2YX7 A;  3DCF A;  3BG6 A;  1ZRD A;  3JSP A;  2VXZ A;  4LOC A;  4PJJ A;  1Z91 A;  1SVO A;  3SYT A;  3V4G A;  4A3F J;  2KRC A;  3LA2 A;  1JUM A;  2MG4 A;  2JN6 A;  5IT9 Z;  3JRH A;  4B3A A;  2XRL A;  3MVP A;  4H4K C;  5GPA A;  3ELK A;  4AID A;  2IGK A;  3P7N A;  1EH6 A;  4WCG A;  1X2N A;  1K78 A;  5LEJ A;  5D5U B;  3HOZ J;  2CQQ A;  2M4K A;  3QU3 A;  1AKH A;  4XR6 A;  4BL0 B;  1T6S A;  4L18 B;  5IT3 A;  3GX4 X;  1MD0 A;  2R7U A;  2OV7 A;  2L7K A;  3DBR B;  1TT0 A;  3FXM A;  2KIQ A;  3LQQ A;  4IOA F;  2L7F P;  3BG7 A;  3VYS B;  4C2U A;  2E5Z A;  2VQH A;  1Z9C A;  5IYB J;  3EYI A;  1P92 A;  3I58 A;  3NAR A;  3S14 J;  4BQN A;  5GPC A;  2VBW A;  3JSO A;  4BUP A;  1T8I A;  3K2Z A;  1ZYR F;  3CCU I;  1JT0 A;  1LEB A;  5FKK A;  4CZZ A;  2R7Q A;  3SJM A;  2QUF A;  5BPD A;  4QTR A;  2L7M P;  3IHU A;  4V2F A;  1C0W A;  3E3V A;  2L02 A;  4A5M A;  2ZSH B;  4U7D A;  3FXR A;  4ZZL A;  1W5S A;  3H3V K;  2EA4 A;  5J4V A;  2GA2 A;  3W6K B;  2JSC A;  4A3C J;  3EUH A;  3LSG A;  2FOW A;  1Z0X A;  4UB8 C;  2A05 A;  3EET A;  1LE8 A;  3S15 J;  2GBY A;  2IA2 A;  1DP3 A;  1XDU A;  1NK3 P;  4AYB A;  3ZQ7 A;  3T8T A;  1ZQ3 P;  2NVY J;  5GP9 A;  3MZ8 A;  3U9G A;  3RZD J;  1D0X A;  1SFK A;  1QPM A;  3FHZ A;  1PDN C;  4O6J A;  1S8N A;  1UB9 A;  3C3W A;  2ZXW H;  5E8I A;  4ZDO A;  5K5Q A;  1H8A C;  1ENH A;  1BR4 A;  1LDD A;  3GME A;  2OZ6 A;  2G7U A;  2PFB A;  1Y8Q B;  2FBI A;  2HFH A;  4N9I A;  3S2H J;  2X48 A;  1K7A A;  5J8C A;  5DS9 A;  1J9I A;  3RPQ A;  2P5K A;  3K4L A;  2DMP A;  4AIJ A;  4E7J A;  3G4S I;  4M3E A;  2FEZ A;  2DXI A;  3S1N J;  2M7A A;  3PFY A;  3H9G A;  4RM3 A;  1RNL A;  2VT3 A;  5IP6 A;  1REP C;  2K9M A;  3W6V A;  2ZJ2 A;  1WHU A;  1T39 A;  4XNF A;  3HOU J;  1XS9 A;  4MTE A;  1YLF A;  1S5L C;  2KZV A;  1JUS A;  3EUH C;  1TBX A;  3PUF A;  1RR8 C;  3OYJ A;  2COM A;  3GFJ A;  3A03 A;  3FXQ A;  3IC7 A;  4BDY A;  4CGZ A;  2LNB A;  4HNT A;  3ASO H;  5M3F J;  1Z3X A;  2LBF B;  3IV5 A;  2P5V A;  1T98 A;  4PUS A;  1IG7 A;  3BCA A;  2D2W A;  3GZ5 A;  3R60 A;  1RUO A;  2P7C B;  4ZH4 F;  4V19 K;  4Y7N J;  2DPU A;  4P5O A;  1R1V A;  2V6C A;  3P9K A;  4UVA A;  4R79 A;  1JGS A;  2NS7 A;  1WRJ A;  4BXU A;  3KP7 A;  2PJR B;  2JA2 A;  3SZG A;  2BE5 F;  1QZZ A;  3H92 A;  2FNP A;  4AVP A;  2DOD A;  1OCR H;  1MDM A;  2BW3 A;  3GF2 A;  3LA7 A;  3SEZ A;  1U8R A;  2P81 A;  2YUS A;  3WTW C;  2R7X A;  2XIG A;  4XLN F;  1TNT A;  2D5V A;  2NOG A;  4HPQ A;  5FLV A;  5DCF A;  2GIV A;  1R4N B;  5HS7 A;  5GAD J;  2BY3 A;  3JRE A;  2Z99 A;  5ERI A;  4I09 A;  1OCZ H;  1IW7 F;  2MD0 A;  3WHC A;  2XPU A;  3F8C A;  1T56 A;  2XKP A;  3MFK A;  2XF7 A;  3DV8 A;  1ZAR A;  3OYH A;  3S2W A;  3ISP A;  4KMU X;  3DTE A;  3E5U A;  3ULQ B;  2QCO A;  1BI2 A;  1NTC A;  3ZMV A;  3HIF A;  4JBA A;  3BQY A;  3WTT C;  1QBJ A;  2JUG A;  4M6X A;  5E1X A;  4ZDL A;  4BBR J;  5KVR A;  5EGO B;  2EWN A;  1R5I D;  4NB5 A;  3H3Z A;  1Y39 A;  3HOX J;  3VOE A;  1KYZ A;  4RMN A;  4CCO A;  4R8H A;  3K1M A;  4XKC A;  2E35 A;  1G3S A;  2EFW A;  2GXA A;  4DJA A;  3CCE I;  1YW8 A;  1QHH D;  2OC6 A;  4NUB A;  4PJN A;  1IXR C;  3G1O A;  4FT8 A;  1R71 A;  3QYE A;  3C2B A;  2IEK A;  3RKQ A;  1QVU A;  3TW7 A;  2V4J C;  3RSN A;  1OJL A;  5HOO A;  4PK4 A;  2JVH A;  1T33 A;  3REO A;  5KNL A;  2HVR A;  3Q9S A;  3WTV C;  1JT6 A;  2STW A;  4I76 A;  2L4M A;  2FX0 A;  4UVB A;  1F43 A;  1WPK A;  2LR8 A;  3SZT A;  4F7Z A;  1VI0 A;  2JA5 J;  3QPH A;  3LMM A;  1N75 A;  1GT0 C;  1IGN A;  4M3D A;  3ZCO A;  2IXS A;  3OYI A;  2HXO A;  1O4X A;  4HLX A;  3CO7 C;  2HDW A;  1RR7 A;  3U2R A;  4FIS A;  1OYI A;  3WTX C;  1FP1 D;  1FX7 A;  4ZYA A;  3HXL A;  1VQO I;  1UG2 A;  2YR2 A;  2M2E A;  5H2F C;  4IHV A;  5ILS A;  1SFE A;  1YG2 A;  1HLV A;  2P5L C;  4IEJ A;  3CUQ A;  4EJO A;  1OFC X;  1UHS A;  2BOL A;  3JAM K;  4OAZ A;  2FNA A;  5K7Z A;  5CKT A;  4BQO A;  3TDU C;  2E34 A;  5ICE A;  2BHY A;  2HPI A;  3P9I A;  3FK7 A;  3VB2 A;  5ED4 A;  5F6F A;  1EF4 A;  5DV5 A;  3WGI A;  3CME I;  1B4A A;  3CCV I;  5B66 C;  4RGX A;  4ENJ A;  3GXO A;  1O3S A;  2K9N A;  2M34 A;  2WAE A;  5LHH A;  2IS4 A;  5LEK A;  3FHN A;  4HRI A;  2PMZ A;  3OY9 A;  1XSD A;  2I8D A;  3F8N A;  2QBY B;  2LY2 A;  2HOA A;  2OD5 A;  4I02 A;  1YRN A;  3W6J B;  4RB0 A;  3D1N I;  3J81 K;  1K79 A;  1UHM A;  1VTN C;  3F8B A;  1OR7 A;  3S8P A;  4A6D A;  2ETH A;  2F5E A;  3WGG A;  3WU2 C;  2XVC A;  3K1N A;  1FIA A;  3G1M A;  1FT9 A;  5KAF C;  3W2V A;  3CUQ C;  4EEF G;  1W5C C;  3NWT A;  2JVG A;  1YJ9 I;  3ZQL A;  2ZB9 A;  3MZH A;  1WSU A;  3KP5 A;  4E7S A;  1XTA A;  5K5O A;  1Z05 A;  1G3W A;  2HZT A;  3KYL A;  2ACJ A;  5D8L B;  1LE8 B;  1TWG J;  5HLH A;  3PQJ A;  5L3G A;  5H20 A;  5EG0 B;  3HPH A;  2L0K A;  1TL8 A;  1K61 A;  1I6X A;  3HRM A;  4MFD A;  3L09 A;  4K2E A;  4UB6 C;  4HW0 A;  1IC8 A;  1EV7 A;  4YG2 F;  3S93 A;  1R58 A;  3HEF A;  1JHH A;  1ZLK A;  3S1R J;  3E7L A;  1QO0 D;  3WTY C;  2D1H A;  1DUX C;  1BJZ A;  4RB3 C;  3LOC A;  3RYR A;  2M0C A;  3ABT A;  5AIP A;  3JTG A;  3GW2 A;  1PUE E;  1LDJ A;  4ZTJ A;  4F52 A;  2L54 A;  2DJN A;  2X9D A;  2HU9 A;  3P5J A;  4U0W A;  4LK0 F;  3O8H A;  4EJU A;  4F91 B;  2LC2 A;  2E1M B;  3BQZ A;  1D0Z A;  1TLH B;  3H0G J;  5CQG A;  2RDP A;  5FLX Z;  3MCZ A;  2LY9 A;  3CP2 A;  4L5I A;  2EIK H;  4ESJ A;  2MBF A;  4MQ9 F;  4KA4 A;  2X0L A;  3C7J A;  2RKH A;  3TQN A;  4E7K A;  1R49 A;  2LP0 A;  4G94 A;  4XOT A;  3S2D J;  3D5S C;  3L2Q A;  1ON2 A;  3OWT A;  4OWR B;  1BR1 A;  5FB2 A;  2DA4 A;  4RLF A;  1IV8 A;  4U0V A;  1MKM A;  1DP7 P;  3JRA A;  1IV6 A;  2X51 A;  3OIQ A;  4CYD A;  1G2H A;  1ZRF A;  2FF4 A;  3LSM A;  1KU2 A;  4HV6 A;  1XD7 A;  2B0L A;  3V7R A;  3JAM Z;  1TW2 A;  3WTZ A;  1B6A A;  2HNH A;  3H0D A;  3CC2 I;  3RKW A;  2LKS A;  1T95 A;  1WJD A;  1J75 A;  3FDY A;  2R93 J;  2QEX I;  3CDI A;  1D8J A;  2LVS A;  1D8K A;  2KLO A;  1X4O A;  4CHU A;  4I0A A;  2QEN A;  3B02 A;  2LTP A;  2F2E A;  1J5Y A;  3OIP A;  2IS2 A;  4JX6 A;  4B4C A;  3H5N A;  3DTI A;  3CC7 I;  1N77 A;  3MAJ A;  2Q8K A;  2QQ9 A;  2Z5U A;  3AG1 H;  4EVI A;  3J80 Z;  4PGH A;  3G73 A;  3K69 A;  4CCK A;  3BOQ A;  4S05 A;  1KU7 A;  2HOT A;  4NC8 A;  1BC8 C;  3F9K A;  1ZEL A;  3MKZ A;  3ZMZ A;  1VND A;  1GV2 A;  5LHG A;  2ZME A;  3CCY A;  4C3I J;  1ERD A;  4O5V A;  3K7A J;  1YHQ I;  2VJ5 A;  4D1Q A;  3AAF A;  3OYA A;  2L2O A;  2Z3Y A;  2FML A;  2VJI A;  2VPR A;  2P7V B;  2DFI A;  2DT5 A;  1LVA A;  2R7T A;  3KZZ A;  1IN7 A;  1HBX G;  1A6Q A;  1E2X A;  2O5R A;  2KIF A;  3PFI A;  2OF7 A;  4QSH A;  1K6O A;  2QSG X;  3ZGK A;  1P4X A;  1FIP A;  3BTL A;  1IN4 A;  5E17 F;  2DTZ A;  5L3E A;  2HI3 A;  4LD5 A;  2RV8 A;  3TW6 A;  1X1B A;  4WXC A;  2L9V A;  3HOS A;  5J1R A;  5BMZ A;  3DPU A;  3HSR A;  4KIG A;  4L9V A;  4EGY A;  1L0O C;  1XGM A;  2R92 J;  1QVT A;  4OU0 A;  2PX9 A;  2ZCW A;  3ECO A;  3SQN A;  2WB1 A;  1VQL I;  5FKL A;  3QOP A;  3D5R C;  1WFX A;  1QRY A;  3LSI A;  5H6Q A;  1M1E B;  1YW7 A;  5FO5 A;  2CH0 A;  3HKZ A;  3GFI A;  2HTJ A;  3N97 A;  3KX2 A;  2ZME C;  1X1D A;  2OCC H;  4XQF A;  2ZNZ A;  2BV6 A;  3Q3S A;  2CWE A;  2IJL A;  2NVQ J;  4PSW A;  1BW5 A;  4DQ2 A;  3DP7 A;  3GVA A;  5E20 A;  4MFE A;  3ZMS A;  3JRG A;  4LB5 A;  2EH3 A;  3RIR A;  3TBI A;  3J7A O;  2WTE A;  2V9P A;  2WC2 A;  4GXO A;  1WVR A;  4KMF A;  3LAP A;  3ZPL A;  1YYV A;  1X4P A;  3E0J B;  1JKP C;  4BBS J;  3ZMT A;  3KFW X;  4M9S A;  2CYY A;  3HOT A;  5ILU A;  4BQQ A;  1YS6 A;  5HDG A;  6PAX A;  2LBF A;  1F1Z A;  3IKV A;  4KUM A;  1IZ1 A;  3ABU A;  1DGR M;  4RAZ A;  3A02 A;  1R6R A;  2FBH A;  2VBY A;  2VBZ A;  3CZ6 A;  3CLQ A;  1R4M B;  2L3D A;  5L3D A;  4BE2 A;  1S72 I;  1YX3 A;  2AQF A;  3AKZ A;  5DCM B;  2PJR A;  4DOZ A;  1FMW A;  3GLX A;  3CMA I;  2DFE A;  5TJJ A;  1MMS A;  1OCT C;  3ZQG A;  1Z77 A;  2ESN A;  1BI3 A;  2B9S A;  1YRN B;  1BJA A;  3TGN A;  2VXD A;  1T08 B;  3ONQ A;  4B48 A;  4CCJ A;  1YQA A;  4FE7 A;  5DD8 A;  2BHZ A;  2EIM H;  1I5Z A;  1ETW A;  2RNG A;  3F21 A;  3OR2 C;  2IVM A;  2L01 A;  5FKM A;  3DXJ F;  2K7L A;  3GZN B;  4G6Q A;  4QWQ A;  1U8B A;  1GXP A;  3IAS 2;  1MMN A;  1VF9 A;  2EA2 A;  2VKH A;  2KJB A;  2DCE A;  5FJ8 J;  4JK1 X;  3L2W A;  2H1K A;  5ICG A;  1HKQ A;  1FEX A;  3G71 I;  1U78 A;  2O0Y A;  2ISZ A;  2K4J A;  5F64 A;  2Y9Y A;  1FC3 A;  5EGO A;  2LRD A;  1FTZ A;  5CLS A;  1YI2 I;  3I55 I;  3KEQ A;  3PQK A;  5C4X J;  2GA1 A;  2ECB A;  2Y0S A;  2PBI A;  5FKO A;  4A3B J;  5BS6 A;  1VFC A;  3E6C C;  1JE8 A;  2H09 A;  4LG0 B;  5TIS C;  5BOX A;  2E1C A;  3QWL A;  4H0E A;  3CQZ J;  3IH4 A;  3A4C A;  1O3T A;  2HPM A;  3KPH A;  2WAD A;  3ZR8 X;  2W85 A;  2F4I A;  4RM2 A;  3S1M J;  4PFO A;  3FKJ A;  2WWY A;  1MMA A;  3GO5 A;  4BGD A;  2BYV E;  1ODD A;  1U6G A;  1S9H A;  4G8X A;  4XBF A;  4B09 A;  2XSD C;  2ZJQ F;  4DZJ A;  3BP8 A;  2PN6 A;  2FA5 A;  5HOD A;  2DT6 A;  2XAS A;  2MH2 A;  2V1U A;  2BGC A;  2K9Q A;  2O61 A;  1KQ8 A;  3K4K A;  4IXA A;  4BXX J;  3DEU A;  1GDT A;  2KP6 A;  3M9A A;  1XX5 A;  4ZYH A;  4E7Z A;  1ZRC A;  4RB1 A;  1WCM J;  3GTM J;  3FBI B;  3L2V A;  4HST A;  4BE0 A;  1JJ8 C;  1H89 C;  3T5X A;  1O57 A;  4KYW A;  4YFK F;  2W82 A;  2PG4 A;  2CQK A;  4F93 B;  3WE3 A;  3QP5 A;  2VC1 A;  4KJZ A;  1LVK A;  4NHJ A;  1DU6 A;  5EEA A;  1YJW I;  1O7F A;  1UAA A;  2JT1 A;  2FJ1 A;  1D1B A;  2KZG A;  2HOE A;  3E6M A;  3TP0 A;  2MSY A;  2DYR H;  4N9H A;  1RKT A;  3C1D A;  5K5R A;  1CF7 B;  2EV0 A;  4U87 A;  2GZW A;  1OCC H;  1T38 A;  1KU3 A;  3LSK A;  5JI6 A;  4AIH A;  3HUG A;  1T2K A;  3CCL I;  1E3P A;  1TQP A;  3DBH B;  3RQ4 A;  1HW5 A;  1FZP B;  3DPL C;  2LSO A;  1MH4 A;  2XAF A;  2QA4 I;  1FSH A;  4XRS G;  1ETV A;  5EJC A;  1S3J A;  4IF4 A;  3V8J A;  1VZ0 A;  4I01 A;  4M73 A;  3VFZ A;  2C6Y A;  1U5T B;  1YTY A;  1TWF J;  3LSH A;  4IQ4 A;  5JVG F;  4XRM A;  2XRO A;  2ZME B;  3MWM A;  3FXU A;  4ENN A;  2HDD A;  2LG4 A;  1TP4 A;  2BY2 A;  4LFU A;  4BY7 J;  4UUT A;  2QBY A;  1J59 A;  3GZ6 A;  3JRI A;  3OS2 A;  4XKV A;  3D5L A;  3JRD A;  2EPF A;  5HNF A;  1BN5 A;  1WKM A;  2FQ3 A;  3Q0U A;  1GVJ A;  2HXI A;  3F8F A;  1J0R A;  1JKO C;  3CF2 A;  1SVM A;  4KIF A;  5EF6 A;  1IN5 A;  3KE2 A;  2XF6 A;  1DQU A;  5IY5 H;  4BAC A;  4W1U A;  3HYI A;  1MBF A;  2Y2Z A;  1NH3 A;  2HGC A;  1Z7L A;  2DK8 A;  5E18 F;  1XCV A;  3JR9 A;  1HC8 A;  4LMY A;  5FKN A;  4YIR X;  2BBY A;  3ABM H;  3DU6 A;  5EG0 A;  1IAW A;  2QKM B;  1SFX A;  3LWF A;  5IPA A;  3GCM A;  1XGO A;  3ECH A;  4JYK A;  1Z3Y A;  2LRE A;  2IS6 A;  2AXL A;  2A6T A;  3KIO A;  3IKT A;  2X1C A;  2E5N A;  3VPR A;  5E3O A;  1FTT A;  2P8T A;  1ZR4 A;  2LLK A;  2BEO A;  2PEX A;  4XKW A;  3WHB A;  3QP6 A;  3K4B A;  2ELK A;  4S0H B;  1WI3 A;  4UHT A;  2XAG A;  3M1C A;  2IBD A;  3V7S A;  2F5V A;  2K86 A;  2XHK A;  3LSP A;  1YE9 A;  3GYH X;  4B8X A;  1WZ2 A;  1SEU A;  2GQQ A;  1MND A;  3BJA A;  3C18 A;  1PUF B;  2UUZ A;  2J5O A;  4HOB A;  1IRZ A;  3J7A Y;  5DUI A;  2UWM A;  4BHB A;  3JRB A;  4HBL A;  5M5X J;  3O2P E;  2VQC A;  2L4A A;  4BH9 A;  3GTO J;  3KP4 A;  5E1Z B;  3HSF A;  4HLY A;  2CQX A;  3QRF F;  4AUX A;  1MW7 A;  5HDN A;  5HNH A;  5LGT A;  3TED A;  3GTG J;  1XSX A;  3BTI A;  1YS7 A;  1H88 C;  1TQM A;  1XN7 A;  5J3L A;  3OL4 A;  2ZFU A;  1RES A;  1LNW A;  3ZRG A;  4XKB A;  2OQR A;  1P7I A;  2DYS H;  4M9X A;  1B1B A;  1HXD A;  2OCE A;  3FIS A;  3HOV J;  4MHG A;  3ESW B;  2E1M C;  3M8E A;  1Q1H A;  3CUO A;  3CMM A;  2EFO A;  2XGE A;  1QGP A;  3QPT A;  1OQY A;  3RZO J;  3RI4 A;  4YFX F;  3OYB A;  5KHD A;  2JK3 A;  1HDD C;  2LYC A;  4BHP A;  2EFP A;  4X0G A;  4EGZ A;  2EV5 A;  3ZMD A;  3HBL A;  4C2T A;  1J09 A;  2K9L A;  3M8F A;  2R3S A;  2OQG A;  4HF1 A;  1S7E A;  4A0X A;  1SD5 A;  3B73 A;  3AG2 H;  2O03 A;  1EA3 A;  2DA3 A;  3W2A A;  3UR3 C;  2JPC A;  3KZY A;  1FBS A;  1TWA J;  1SFU A;  3GEZ A;  3BLY A;  2EZH A;  5CVI A;  1JI8 A;  4CYC B;  4A2U A;  2PQ8 A;  3BPX A;  4ZYE A;  5L3B A;  1FY7 A;  1KQ9 A;  3DEE A;  5D6F A;  5EDN A;  4EJV A;  1I3A A;  4G7O F;  2KKO A;  3OYD A;  2NVU B;  4HZF A;  2B63 J;  2UXN A;  1J7K A;  2CRG A;  4BU2 A;  5GAH J;  4J01 A;  1HF0 A;  1F4K A;  2VAS A;  3TO9 A;  4KIS A;  5HS9 A;  3O6B B;  1CQT A;  4Y33 A;  2V6E A;  5JVT A;  4N4N B;  3DU5 A;  4JX5 A;  1ZG1 A;  4CA0 A;  3BR0 A;  3LQR A;  5DYM A;  4LIV A;  4DBR A;  4PFP A;  3AL0 C;  2ZSI B;  3HSE A;  1HW1 A;  2OPT A;  2M0M A;  3NWS A;  3LFK A;  4UVC A;  3RKX A;  3RTR A;  2JA7 J;  5FLX K;  2QGU A;  3H9J A;  2CUE A;  1GLN A;  5B1B H;  5FFX A;  5DM6 F;  3S3N A;  1E3H A;  5F0C A;  3IRR A;  2ISY A;  5IYC J;  3ZP5 A;  4WF2 A;  2F48 A;  5A2Q K;  5E3M A;  4IHX A;  2HEO A;  4AVZ A;  4I98 B;  4LG3 A;  3KZI C;  1Y6I A;  3BDD A;  3LSJ A;  5D8K B;  1W4M A;  5AIQ A;  1WJB A;  2XAU A;  3GBG A;  3QU6 A;  1EH7 A;  1W7P B;  4XN0 A;  4ABZ A;  1PP8 F;  3V42 A;  2GXB A;  2EFQ A;  1ETY A;  3IUO A;  3S1Q J;  3L2U A;  3F8M A;  4LJZ F;  1ZRE A;  3SDG A;  3PO3 J;  1WH7 A;  1YOV B;  2K3P A;  4JP0 A;  3GWZ A;  4RS8 A;  2UXX A;  4FAS D;  2XGC A;  3HUG B;  4JQF A;  2CUF A;  4D0P A;  2F4O B;  2F5D A;  2CV2 A;  4PGG A;  2EZK A;  1U2W A;  3RKY A;  2IS1 A;  2R7F A;  1FBU A;  2FBK A;  2WA0 A;  4UY8 I;  1EKE A;  1BI1 A;  4BNC A;  2X6W A;  4NBQ A;  2M7B A;  1BL0 A;  2ZBK A;  2MW8 A;  1O3R A;  2XF5 A;  3BPV A;  4RB2 C;  2DFH A;  5DCM A;  2LDU A;  2DA2 A;  3BG3 A; 
#chains in the Genus database with same CATH homology
 3Q0V A;  4V2G A;  5EYR A;  5C44 J;  3A01 A;  2YU9 J;  4A3L J;  1AHD P;  1WGX A;  2VPR A;  2LKX A;  3QPS A;  3QPL A;  1WH5 A;  2O7O A;  3K2A A;  2YS9 A;  2GM4 A;  1SAN A;  2HQ5 A;  5JLX A;  2OF7 A;  2KDZ A;  5EZH A;  2NS8 A;  2JWT A;  3BG5 A;  4QSH A;  2CJJ A;  2WV1 A;  2H8R A;  1FIP A;  3BTL A;  5IYD J;  2DTZ A;  3F0C A;  2HI3 A;  3SFI A;  1MBJ A;  3TW6 A;  2ECC A;  1BA5 A;  5J1R A;  4MIM A;  1I3Q J;  1JGG A;  2R92 J;  1QVT A;  5FKL A;  3DCF A;  1QRY A;  2LFB A;  4LOC A;  1MBE A;  4D7N A;  3BTJ A;  2PMZ N;  4IHW A;  4I6Z A;  3Q3S A;  1ZTR A;  4A3F J;  2NVQ J;  1P7J A;  1BW5 A;  2N8G A;  1JUM A;  2MG4 A;  5BNG A;  2JN6 A;  4MFE A;  3JRH A;  4B3A A;  2XRL A;  3GTP J;  3MVP A;  3JRG A;  3OSG A;  2EH3 A;  5GPA A;  3L1P A;  1X2N A;  4JX4 A;  3HOZ J;  2CQQ A;  1OCP A;  2W48 A;  1AKH A;  1SFO J;  1ZKG A;  3QQA A;  1JKP C;  4BBS J;  4XK4 A;  1JTX A;  4RDU A;  2RAE A;  5K7H A;  2R5Y B;  2XB0 X;  1AU7 A;  2L7F P;  5IYB J;  5F04 A;  3NAR A;  3S14 J;  2QF7 A;  3A02 A;  1ETO A;  5GPC A;  5JLW A;  4UUS A;  5C3E J;  4X1E A;  1QPI A;  3UKG A;  2O8K A;  4X6A J;  1JT0 A;  5E3N A;  5FKK A;  2JMW A;  3SJM A;  1MH3 A;  5F08 A;  2HOS A;  3GTQ J;  4QTR A;  2L7M P;  3MKL A;  4V2F A;  3A01 B;  1OCT C;  3ZQG A;  4A3K J;  1Z77 A;  4C3H J;  1HCR A;  1YRN B;  4NDL A;  3H3V K;  2DA5 A;  4FE7 A;  1NK2 P;  1Q1V A;  5IP7 J;  4A3C J;  1ETW A;  2LK2 A;  4M3G A;  3LSG A;  4RBO A;  5FKM A;  4D5C A;  2EZL A;  4M3F A;  3I4M J;  2WAQ N;  2LD5 A;  1U8B A;  1LE8 A;  4A3D J;  3ZQI A;  3S15 J;  2GBY A;  3LSR A;  1JKQ C;  1MSF C;  2DMT A;  2Y30 A;  1VF9 A;  1RPW A;  2DN0 A;  1NK3 P;  5FJ8 J;  2VKV A;  4L5E A;  1ZQ3 P;  2E1O A;  2NVY J;  5GP9 A;  1LFU P;  2H1K A;  3RZD J;  1FEX A;  1U78 A;  5J1U A;  1D5Y A;  2Y9Y A;  3BTC A;  5EGO A;  3I4N J;  1H8A C;  2Y31 A;  1FTZ A;  1ENH A;  4Y52 J;  4A3G J;  2XPV A;  3S2H J;  2X48 A;  1GUU A;  5C4X J;  5DS9 A;  2ECB A;  3MN2 A;  5FKO A;  4A3B J;  2EQR A;  2DMP A;  1VFC A;  4G12 A;  1Y1W J;  4M3E A;  5DTD A;  3S1N J;  3IH2 A;  3CQZ J;  2AHQ A;  3IH4 A;  5IP6 A;  3JRC A;  2EBI A;  3BR2 A;  3NAU A;  4B1R A;  5E3L A;  3W6V A;  4MLO A;  1HDP A;  3LNQ A;  3S1M J;  4QIW N;  3HOU J;  3GTL J;  1XS9 A;  1AKH B;  2FD5 A;  4MO7 A;  5F0H A;  2VKE A;  1JUS A;  5M3M J;  3ZQF A;  5F27 A;  5M5W J;  3A03 A;  3B6C A;  2XSD C;  4DZJ A;  5M3F J;  1E3O C;  5HOD A;  3IV5 A;  4FTH A;  4XRS A;  1IG7 A;  2K9Q A;  4UUS B;  2NVT J;  4Y7N J;  4BXX J;  2R0Q C;  5IOZ A;  5K7F A;  1GDT A;  1IUF A;  2DMQ A;  1I50 J;  2NS7 A;  1JTY A;  1ZK8 A;  1WCM J;  1I6H J;  3GTM J;  2XPW A;  1JJ8 C;  1H89 C;  1B8I A;  1UMQ A;  2P81 A;  3PO2 J;  2YUS A;  4A93 J;  2FQ4 A;  2O9L A;  1DU6 A;  5EEA A;  2D5V A;  1RKW A;  2NOG A;  3FK6 A;  5FLV A;  2FJ1 A;  4D7M A;  3BT9 A;  3TP0 A;  2MSY A;  1A5J A;  1RKT A;  2R5Z A;  3JRE A;  1W0T A;  3GTJ J;  3WHC A;  2XPU A;  1PUF A;  1T56 A;  2NVX J;  2K40 A;  4W97 A;  4DYQ A;  2QCO A;  1NTC A;  4D5F A;  1MH4 A;  2M8G X;  4XID A;  3BQY A;  4XRS G;  1ETV A;  1ETK A;  1RET A;  4BBR J;  5EGO B;  1X58 A;  2WB1 N;  2JA6 J;  2ME6 A;  1GV5 A;  3HOX J;  1ZR2 A;  3HKZ N;  1TWF J;  1ITY A;  4XRM A;  1W0U A;  3OIO A;  2HDD A;  3G1O A;  4BY7 J;  4UUT A;  3C2B A;  2IEK A;  3RKQ A;  3JRI A;  1QVU A;  3JRD A;  1XG1 A;  3TW7 A;  1OJL A;  3Q0U A;  2HXI A;  1HOM A;  1T33 A;  2ME0 A;  1JKO C;  5F0F A;  1LFB A;  1JT6 A;  5EF6 A;  4I76 A;  4W1U A;  1MBF A;  4BKX A;  3BR1 A;  2DMU A;  2Y2Z A;  2COB A;  2IAI A;  1FJL A;  1MNM C;  2FX0 A;  5IOY A;  3B6A A;  3CMY A;  1ORK A;  4DW6 A;  1F43 A;  3JR9 A;  1WPK A;  2LR8 A;  5FKN A;  1VI0 A;  2JA5 J;  2L9R A;  5EG0 A;  3FKI J;  1TC3 C;  5IP9 J;  1GT0 C;  3HB9 A;  1IGN A;  5IPA A;  3TP3 A;  2Y9Z A;  4M3D A;  4JYK A;  2HXO A;  1O4X A;  1RR7 A;  3VPR A;  4GFB A;  4FIS A;  5E3O A;  1FTT A;  1U9O A;  1ZR4 A;  1B8I B;  2LLK A;  2TRT A;  1DU0 A;  3WHB A;  1UG2 A;  3JRF A;  1JJ6 C;  2X6O A;  2VUM J;  2ELK A;  2M2E A;  2MGQ A;  4M3B A;  4S0H B;  4HNV A;  1WI3 A;  4IHV A;  2E19 A;  4CYC A;  2IBD A;  1HLV A;  1IDY A;  4IEJ A;  3LSP A;  2ID3 A;  2R5Z B;  2I10 A;  1OFC X;  3ZQH A;  3DEW A;  1UHS A;  4M6V A;  3S16 J;  1PUF B;  5K7Z A;  3CDL A;  5C4J J;  1IRZ A;  3M4O J;  4AYB N;  3JRB A;  4J19 A;  5M5X J;  3FK7 A;  2XB5 A;  1EF4 A;  4C3J J;  5M5Y J;  3GTO J;  1GVD A;  2CQX A;  4AC0 A;  1APL C;  4AUX A;  2K9N A;  2M34 A;  3TED A;  5F1J A;  2M9H A;  5EZG A;  3GTG J;  3FIW A;  3BTI A;  2Y0S N;  1H88 C;  2G0E A;  1B72 A;  5J3L A;  2HOA A;  1YRN A;  1RES A;  4A3I J;  3HM5 A;  3D1N I;  2DA1 A;  1JKR C;  1P7I A;  2K9S A;  2ID6 A;  4A3E J;  3FIS A;  4C2M J;  2R7Z J;  3HOV J;  1FIA A;  3G1M A;  4EEF G;  5FLM J;  2KT0 A;  3ZQL A;  2ZB9 A;  1ZGW A;  3BR3 A;  2XGE A;  1XC5 A;  2HYJ A;  2GLO A;  3RZO J;  1LE8 B;  2JK3 A;  1TWG J;  1HDD C;  2JA8 J;  1ETX A;  2DA7 A;  1U9N A;  5EG0 B;  2L0K A;  3HBL A;  1K61 A;  4MFD A;  3ZQC A;  2TCT A;  1IC8 A;  1BW6 A;  3HEF A;  2E2I J;  3HOW J;  3S1R J;  3E7L A;  1S7E A;  2AO9 A;  3HDD A;  1POG A;  1BJZ A;  1F36 A;  3LOC A;  5J1Y A;  2DA3 A;  3IH3 A;  4BY1 J;  3M3Y J;  2M0C A;  1MBH A;  1TWA J;  2EZH A;  3S17 J;  2DJN A;  2X9D A;  1ETQ A;  3O8H A;  4CYC B;  5EDN A;  3Q0W A;  3BQZ A;  3RQI A;  9ANT A;  3H0G J;  3OSF A;  4FCY A;  2B63 J;  2LY9 A;  3GTK J;  2CRG A;  1HF0 A;  1IDZ A;  4FE4 A;  2LP0 A;  3S2D J;  1CQT A;  4JX5 A;  4A3M J;  3BR0 A;  2DA4 A;  4DZP A;  4A69 C;  3HOY J;  1IJW C;  3JRA A;  3PM1 A;  1IV6 A;  2OPT A;  2E2H J;  1G2H A;  2JA7 J;  1Y1V J;  3HGG A;  2CUE A;  5F0C A;  1B72 B;  3BR5 A;  4DYC A;  3HGY A;  3OOU A;  5IYC J;  2E2J J;  1JUP A;  2L7Z A;  4DYR A;  5E3M A;  4IHX A;  2DMN A;  2CU7 A;  3LSJ A;  3GBG A;  3G1L A;  4ABZ A;  2R93 J;  3ZOB A;  2DA6 A;  1ETY A;  2JJ7 A;  2LVS A;  4XIC A;  1MSE C;  3S1Q J;  2XGD A;  3SDG A;  3PO3 J;  1WH7 A;  2LTP A;  1R9T J;  4JP0 A;  4JX6 A;  4B4C A;  2XGC A;  2R5Y A;  2CUF A;  1MBG A;  2EZK A;  2HOT A;  3BG9 A;  3O8G A;  1X2M A;  1K83 J;  4A3J J;  1VND A;  1GV2 A;  2EZI A;  2VI6 A;  3CCY A;  4C3I J;  1BL0 A;  2MW8 A;  4IHY A;  3BR6 A;  1TWH J;  1TWC J;  3K7A J;  1MBK A;  1Z0X A;  1A6I A;  2DA2 A;  3BG3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...