3K7AJ

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k7aJ00
1GV5A 5F08A 4A3LJ 3HKZN 3E7LA 2JJ7A 3JRDA 3GTGJ 3IV5A 2XSDC 1PUFA 3ZQCA 4IHYA 3LSJA 1MBJA 2GLOA 2MG4A 2CQQA 2HXOA 3H0GJ 1MH3A 2N8GA 3C2BA 2YUSA 2H1KA 2WV1A 4XIDA 1X2MA 5M5YJ 1ETXA 2CJJA 2B63J 3JRCA 3ZQHA 1FIPA 2FD5A 4UUTA 5GPCA 2L7FP 4D7NA 2R5ZB 1JTYA 4IHWA 2DMQA 3BG3A 4BY7J 2NS7A 1GDTA 4C3JJ 5J1RA 3MN2A 2IEKA 1WH7A 3JRGA 1A6IA 2EZHA 1AKHB 1QPIA 5M3FJ 1RR7A 5FLVA 5FKMA 1YRNB 4BBSJ 2CQXA 1WH5A 1ZTRA 2R92J 2VI6A 1IUFA 2VPRA 5IYBJ 5C4XJ 2K40A 1NK3P 2GM4A 3BTIA 2DA1A 3ZQLA 1TC3C 3S17J 4X6AJ 2Y31A 2JK3A 3TEDA 2AO9A 3JRFA 2FX0A 5IYCJ 2NVTJ 5IP9J 5IP6A 1ETVA 3HBLA 5F0HA 3WHBA 1MH4A 2R5YA 1HCRA 3FK6A 2K9SA 5IOZA 2CUEA 2HOTA 1WGXA 1JKPC 1JKRC 1QVUA 2TRTA 2JA6J 4HNVA 2M9HA 1HDPA 4LOCA 3HOWJ 2NOGA 3HOXJ 1LE8B 1JJ8C 1WPKA 2NVQJ 3DCFA 3PO2J 3K7AJ 4V2FA 5FJ8J 3HOVJ 3JREA 2LR8A 4M3GA 1GVDA 3CMYA 1T33A 2OPTA 4A3CJ 2LTPA 3IH3A 3FISA 4A3MJ 3NARA 2DA2A 3O8GA 5M5XJ 3LSRA 1LFUP 3BTCA 4DW6A 1XS9A 1IV6A 4M3EA 1QVTA 2E19A 3PM1A 1S7EA 2O7OA 3MVPA 1XG1A 1MBKA 4BKXA 4D5CA 5J1UA 5FKLA 1WI3A 2IAIA 3BR6A 1SANA 2DA7A 1HDDC 1JTXA 2ID3A 2OF7A 4AYBN 1BW6A 5GP9A 5F0CA 5E3OA 3BQZA 2WAQN 1FTZA 1MBFA 3HGYA 4FE4A 1G2HA 4D7MA 1F43A 2DMNA 3G1LA 5DTDA 3QPSA 2FJ1A 2M34A 3HB9A 4M3DA 5EYRA 4J19A 1BL0A 3O8HA 3A02A 4B1RA 1RESA 1JJ6C 2DMPA 4MIMA 4DZJA 5EG0B 1B8IA 4C3HJ 2LY9A 5EGOA 1I6HJ 1SFOJ 4IEJA 1PUFB 2VUMJ 5IYDJ 4QTRA 3GTJJ 2M0CA 3TP0A 1D5YA 2RAEA 2XGDA 4FCYA 2YU9J 1Q1VA 1MSEC 2R0QC 4RDUA 4A69C 1TWAJ 3CDLA 4UUSA 1R9TJ 1RKTA 4Y7NJ 2E2IJ 2ME0A 4B4CA 5E3LA 3A01A 5M5WJ 1WCMJ 1ENHA 4NDLA 4DYRA 4B3AA 4D5FA 5EF6A 1VNDA 3LOCA 1ETWA 4M3FA 1VF9A 4I6ZA 9ANTA 4G12A 3NAUA 2K9QA 1U9NA 2LP0A 5HODA 4A3JJ 3K2AA 4A3IJ 3D1NI 1TWHJ 2L7ZA 2DMUA 1ETYA 1IDYA 3SFIA 2E1OA 2JA7J 4A93J 1UG2A 1I50J 2IBDA 3QQAA 1OCTC 4XK4A 3HGGA 1P7JA 3CCYA 4DYQA 5GPAA 2QCOA 3OIOA 1JT6A 4MO7A 2X6OA 4M6VA 2JA5J 1B72A 3B6CA 4MFDA 1EF4A 4A3GJ 1VFCA 2COBA 3HOUJ 3GTKJ 3GTLJ 1QRYA 4M3BA 1U8BA 2R5YB 1FJLA 3S1QJ 3I4NJ 3OOUA 3TW7A 2WB1N 5IOYA 4AUXA 5JLWA 1APLC 1HF0A 4XRSG 1JKOC 1FEXA 1W0UA 4MFEA 3M3YJ 4CYCA 2HI3A 5E3NA 3BT9A 2ID6A 2HOAA 1MBGA 1ITYA 2EZIA 4A3FJ 2HYJA 2MGQA 4AC0A 4C3IJ 2NVYJ 1Z77A 5EDNA 2D5VA 3BG5A 1ZK8A 2PMZN 2DTZA 2G0EA 3ZOBA 1ZQ3P 5M3MJ 3VPRA 1MBHA 4W97A 2XB5A 4L5EA 5E3MA 5FKKA 1HLVA 2MW8A 1XC5A 3BR0A 4MLOA 5DS9A 3GTMJ 2K9NA 2M2EA 2O9LA 1BA5A 3BTLA 4XRSA 1JGGA 2DMTA 4ABZA 3ZQGA 2EQRA 4IHVA 3IH2A 1CQTA 2ECCA 1P7IA 2ZB9A 2W48A 4A3BJ 4FTHA 1IJWC 1TWGJ 1RPWA 1K83J 5C44J 4A3EJ 1B8IB 2VKEA 3GBGA 5EGOB 1TWCJ 5K7HA 3GTOJ 2NVXJ 2QF7A 1H88C 4FISA 3GTPJ 1IRZA 1I3QJ 1O4XA 2R7ZJ 5C3EJ 3MKLA 1ZR2A 1K61A 3Q0WA 3S2DJ 4X1EA 4Y52J 2HDDA 2R93J 5F27A 2JWTA 3BR5A 1JT0A 2ME6A 5J3LA 2NS8A 4JP0A 2LD5A 3S15J 1TWFJ 1UHSA 1MBEA 2LFBA 2DJNA 2VKVA 2X48A 4QIWN 1ZGWA 3M4OJ 3A01B 1JUMA 3SDGA 3JRIA 2TCTA 1Y1WJ 3W6VA 1NTCA 2L7MP 2DA5A 2CU7A 1H89C 1T56A 4IHXA 5F0FA 3JR9A 1IC8A 5FKOA 3Q0UA 2DA4A 1BJZA 3BR3A 1JKQC 2JN6A 1DU6A 1LFBA 1IGNA 4XICA 3BQYA 1UMQA 4V2GA 3BG9A 1GT0C 1MSFC 3A03A 3BR2A 2O8KA 4BBRJ 1X2NA 2EZKA 2AHQA 1IG7A 2Y9YA 3RKQA 1VI0A 1ORKA 2EH3A 1POGA 1H8AC 2P81A 2LVSA 4JX6A 3FIWA 1A5JA 3ZQIA 1B72B 2ELKA 1JUSA 2JMWA 3TP3A 2Y0SN 3RQIA 1IDZA 3TW6A 2R5ZA 3PO3J 3LSGA 1X58A 3S1RJ 5IPAA 3S16J 1DU0A 3CQZJ 3B6AA 5F04A 3S1NJ 3JRAA 3FK7A 2DA3A 1AKHA 2L0KA 4BXXJ 4CYCB 3RZOJ 2GBYA 2E2JJ 4DYCA 1YRNA 1JUPA 5EEAA 3S1MJ 3HOZJ 2CUFA 2DN0A 2YS9A 5F1JA 2XGEA 3G1OA 2XPUA 4I76A 4A3DJ 3LSPA 2Y30A 5FLMJ 2ECBA 2LLKA 3DEWA 1AU7A 4EEFG 5K7FA 1Z0XA 4JYKA 3S2HJ 3H3VK 1GV2A 5K7ZA 1RKWA 3Q3SA 1W0TA 3WHCA 1NK2P 1ZKGA 3HOYJ 1F36A 2FQ4A 2EZLA 2M8GX 3S14J 2XPWA 3BTJA 3QPLA 2MSYA 2CRGA 3GTQJ 2Y2ZA 1AHDP 3G1MA 2I10A 4W1UA 5FKNA 5EZGA 3LNQA 2H8RA 2E2HJ 5JLXA 2HXIA 2L9RA 1LE8A 1ETKA 1OFCX 4A3KJ 4BY1J 3F0CA 4JX5A 1RETA 1ETOA 3JRBA 4QSHA 2XGCA 3ZQFA 2JA8J 1FTTA 5IP7J 2LKXA 2Y9ZA 1FIAA 4S0HB 2XB0X 3IH4A 4C2MJ 1OJLA 3FKIJ 1BW5A 2XRLA 3SJMA 3OSFA 3JRHA 1ZR4A 1U9OA 3UKGA 2HOSA 4XRMA 3BR1A 1OCPA 5BNGA 4FE7A 3RZDJ 3HDDA 3L1PA 4DZPA 5C4JJ 4UUSB 2EBIA 3Q0VA 1ETQA 1MNMC 1GUUA 1HOMA 2KT0A 4JX4A 2X9DA 3HM5A 2KDZA 1E3OC 5J1YA 1Y1VJ 5EZHA 3I4MJ 2XPVA 2LK2A 2DA6A 2HQ5A 3HEFA 4RBOA 3OSGA 4GFBA 1U78A 5EG0A
chains in the Genus database with same CATH superfamily
1TW2A 1R71A 1GV5A 4A3LJ 4Q48A 2Y0SA 3DTIA 3JRDA 3QU3A 1T2KA 4J00A 2ZJRF 5H6RA 5FROA 3F72A 1LDJA 3GLXA 3W6JB 3GFMA 2HXOA 5LD2C 3SZGA 2WV1A 2AXLA 3F6OA 5FO5A 1FLIA 2B63J 3GZNB 3L9FA 2HPMA 2A61A 2X6YA 5LGUA 3CUQB 1FBUA 4IHWA 5GAGJ 3Q9SA 4DQ2A 1GDTA 1ZARA 5J1RA 2IEKA 3PUBA 3TO9A 5D8KB 3J80K 3S3MA 1A6IA 2EZHA 4ZYDA 5FKMA 1ZH5A 2M7AA 2A6TA 4BAYA 4GO1A 1ZTRA 3PQKA 1U8RA 2VJ5A 1VQNI 1MIJA 1AA7A 5D6FA 5IYBJ 1NK3P 3ZN1A 3K1MA 2RKHA 4YEJA 2DA1A 2HDCA 2BE5F 3MKYB 2V79A 1WQ2A 5ICGA 4IVNA 3OYGA 2OTJI 1Y8QB 4UNOA 4B43A 2K7LA 2Z16A 4YIRX 1VQ6I 2EIJH 2VT2A 4EQQA 4KYWA 4I0AA 5IYCJ 4JOMA 2DPDA 2E35A 1R00A 4I02A 3WHBA 2R7RA 2MC4A 2XAGA 3FBNB 2E36A 5HS8A 1HCRA 2DFIA 5IOZA 1WGXA 2JA6J 3OYNA 4A0ZA 3OYIA 4WXHA 3WU0A 4LOCA 3HUGA 2NOGA 3AKZA 4A0XA 5BS6A 2RNGA 4I0BA 1HW2A 2CUJA 2GZWA 3I55I 2LG4A 4WK8F 5FJ8J 3HZJA 2IP2A 3C7JA 3DP7A 3HRUA 4QWQA 5JFRA 3JREA 1IUYA 2OPTA 2P4WA 2LTPA 4A12A 3O8GA 1K78A 2O6GE 3BROA 1E3PA 4M3EA 4UXNA 1QVTA 1OR7C 4XLCA 1DGWY 2DQLA 1S7EA 2EILH 3QAHA 1XG1A 1MBKA 3OYCA 4BYYA 2MH9A 5F6FA 5FKLA 2IAIA 3F21A 1MZBA 1SANA 2DA7A 2GAUA 1ZLKA 1G3YA 5DM7F 1TP4A 2YR2A 4PGHA 2VJ4A 3DF8A 1G3TA 5H2FC 5GP9A 2E1CA 3L2UA 2HVRA 3IHUA 4DBQA 4KMFA 5LGNA 4D7MA 2Q0OA 4IO9F 2W1OA 1P2FA 1V5FA 3E6MA 1ZRDA 1NH3A 3V8LA 2M34A 3F22A 2QSGX 5EYRA 1K6OA 1BL0A 3CF2A 2HTSA 4M74A 1E17A 4B1RA 3AFHA 3CTAA 4OWRB 2DPUA 2ZC2A 2GXBA 1JJ6C 4ENJA 3LA2A 1KQ9A 4DZJA 1Y0NA 3A0BC 4HNUA 5LBQA 2K85A 1B8IA 3DXJF 5GAEJ 1FP1D 3K6GA 1L3LA 1V5EA 3DQVC 1LUJB 2A6HF 1WJ5A 1D5YA 3RPUD 4EATA 2M4GA 2YU9J 4EV0A 4HDVA 1MSEC 4A69C 1TWAJ 3CDLA 4EJUA 3TDUC 3L2QA 2RVCA 3K4CA 4HRIA 1SEUA 1RKTA 2FMYA 5JVTA 1VQ8I 2VPLA 1GLNA 1UG0A 2R7WA 2BVMA 3TKYA 2PI0A 1ENHA 4C2UA 2PBIA 4B3AA 4D5FA 2ZJ2A 5B1BH 4G7ZF 1U0JA 4M3FA 3A1YA 3JSPA 1W7PB 3BOQA 3PFIA 4D9JA 2DYSH 3HSFA 1U9NA 4ZYAA 3VWBA 5AIQA 4AWXB 1HQCA 3CJQB 1IDYA 5HS7A 3SFIA 2QZ8A 2LF8A 1QU3A 2A6EF 1W5CC 2XDVA 1FMWA 1UG2A 3FXJA 5ICFA 1I50J 1IN7A 3OYJA 1XDSA 3S3OA 3QQAA 1OCTC 4XK4A 1TQPA 3N97A 3HGGA 2V6CA 1U2WA 1G8XA 2TDXA 3CCYA 1J7KA 5GPAA 2QENA 4XSXF 4MO7A 1UHMA 2KJCA 4QPQA 2VJIA 4B09A 4M6VA 2A68F 2KZGA 2W00A 2WAEA 3B6CA 4XLHA 1BR1A 3G6EI 1B72A 3ZMUA 3WU2C 4CCKA 1UZCA 4A3GJ 1D1BA 2COBA 1LDDA 3HOUJ 2WAFA 4RM3A 3WU1B 2R5YB 4EM2A 3ZMTA 1VQOI 3I4NJ 3BPVA 4C9YA 1MMAA 2OJED 3OOUA 4XM3A 3BPXA 1APLC 4O6JA 1FEXA 4EJWA 1W5SA 3EPZA 2NRAC 4RGXA 1ONVA 1TL8A 1I3AA 2H6BA 4PGGA 2IS6A 2FSWA 1JHFA 1ITYA 3VYRB 5B3SH 1XSDA 3KCCA 2MGQA 3PJRA 3KP4A 4G8XA 1ON2A 1U5TC 2LRDA 1XSXA 4OMZA 1Z77A 2F2EA 1HA8A 2FOWA 3BG5A 1LVAA 2G0EA 1ZQ3P 5M3MJ 5IT3A 3VPRA 1KU3A 3K4LA 1Z21A 1MBHA 2XF7A 4W97A 4EJTA 2XB5A 4Z6YA 4F93B 4L5EA 5ILSA 3TO7A 2BEOA 1XD7A 2IJLA 1XC5A 4MLOA 5GTHC 5AIPA 2M2EA 3MKWB 1FYMA 2O9LA 1R58A 3BTLA 4XRSA 2R7SA 3QODA 4ESJA 4ABZA 2AQEA 3ML6A 1MJAA 3BJAA 5EEGA 3VOEA 2DDAA 2MD0A 3FZVA 1CQTA 1QGPA 4BEHA 3GEZA 5KHDA 2ZB9A 5LLQA 2ZO4A 3CZ6A 4FTHA 4KT5C 1TWGJ 2M7BA 5L3DA 1X1PA 4RB2C 2D45A 5DEQA 4JBAA 3UNGC 3GBGA 2PJRB 3F6VA 1TLHB 5EGOB 3K70C 2NVXJ 2L9VA 2QF7A 3OYFA 3HYIA 2Y75A 3LFUA 1O4XA 5FGMA 2VKHA 2FQ3A 3SHFA 2W82A 3MKLA 4ZYEA 2EFWA 2E34A 4XLAA 2JUCA 2KIFA 1A31A 3D5SC 2HDDA 2R93J 4YRVA 1JT0A 1SVLA 3WTTC 2Q1ZB 2H27A 2ME6A 3ABUA 1WJFA 2G7HA 4AU7A 2FOKA 4AVPA 1W7PD 2VKVA 2X48A 1MDMA 3CCLI 3M4OJ 5B1AH 2KRFA 1LKXA 1EH8A 2RREA 3WTYC 2K9LA 3MWMA 3G4SI 1IXSB 2DA5A 2VQLA 3E3VA 2ICWG 3MZ8A 3BCAA 5FKOA 1BJZA 3BR3A 4E7JA 4L9NA 2JN6A 4IKFA 2GXAA 1Z7LA 3M1EA 3CCMI 1IGNA 3DPUA 2ELHA 1X1DA 3BDDA 3BWGA 1USTA 4XLFA 2BY1A 2JRMA 3H1CA 3HPGA 2VE8A 3U1DA 2O8KA 1XGMA 1X2NA 2EZKA 2ETHA 4G9YA 5LRSA 1IG7A 3E6DA 3OYLA 3CCQI 4C2TA 4XRFA 4D0PA 1MMGA 3DFGA 3EUKL 5GAHJ 4IX7A 2PG4A 1Y0UA 1ZRCA 2EH3A 1POGA 5J8CA 2LVSA 1PVEA 2VC1A 2KL4A 2DI3A 3RPUA 1A5JA 5KAIC 2JMWA 3C3WA 3DBHB 3CUQA 5E8IA 2Y0SN 1OCZH 2EFPA 1OCOH 2KKOA 4BDYA 2ZNZA 3DBRB 2JQ7A 1T39A 3B6AA 3T8RA 1RNLA 1WJDA 5CYVA 3JRAA 2XAQA 5KAFC 3CC7I 2OU2A 1Z6TA 3RZOJ 3E6BA 1SVOA 1VQMI 1USSA 1E3HA 3MD2A 3VODA 2CUFA 1O3SA 5K5QA 5K1YA 1LB2A 1RI7A 5F1JA 4ZC3A 2OD5A 2DQRA 2YX4A 3LSPA 1UELB 2ECBA 5DUKA 2F5CA 4IQJA 2H09A 2LLKA 2F5FA 3RPQA 2IXSA 2HWVA 3ZMDA 3B73A 3CLOA 3O6BB 3VSLA 2M5WA 5LGTA 3B02A 2R7XA 1V54H 1HXDA 3L2VA 1S7OA 2QKMB 1F36A 1IF1A 1ZRFA 4GYIA 3BTJA 3AG2H 2MSYA 2CRGA 4EVIA 1MMSA 1IRFA 4A5NA 1Y39A 4UVBA 2CH0A 2I10A 4JK1X 1S3JA 3LNQA 1FYLA 4HSRA 3JAMK 1MJ9A 3C18A 4O3MA 2FBKA 2HQRA 2XF6A 5IY5H 3F0CA 1MW7A 3OYBA 1SMTA 2L02A 2R7VA 4NC6A 4S04A 5LHHA 3GFIA 4NUBA 2KJBA 2W57A 1ZG5A 1FTTA 1KZHA 4I01A 3IWZA 2HS5A 2Z99A 3IH4A 4C2MJ 2VOOA 2DYRH 5E8GA 2DAOA 1FZPB 3SJMA 1FPQA 1ZELA 1RRJA 1G59A 3I3LA 3EYYA 3KP6A 3D0SA 2DTRA 1IAWA 4Y15A 5CLSA 4OOIA 2WA0A 4YIIA 5FRNA 3BJ6A 1LVKA 2F48A 4BGDA 1GUUA 3IAM2 3U2RA 4HF1A 2A5WA 2X9DA 3HM5A 1E3OC 4BH9A 1Y1VJ 2XPVA 3R6SA 2KQRA 4RS8A 1IN6A 3H9QA 2NYXA 3E5QA 3P9CA 4E7HA 5BMZA 1J59A 5DM6F 4RGUA 2BYVE 5J47A 3PFYA 1U6GA 3ZMSA 2ZFWA 2JSPA 4E6KG 3V8KA 2JJ7A 1G3SA 2HFHA 4BHCA 4BHPA 1S5LC 2WTEA 2WV0A 3ZQCA 3VDXA 5D4RA 1R6RA 1D1CA 4IHYA 2GLOA 1XMAA 4DBRA 2IS2A 3E5UA 4BQNA 1X2MA 2CGPA 1ETXA 2CFOA 1TT0A 1V4RA 2RGVA 2VBYA 4NBQA 3F8CA 2YPRA 3ZQHA 1ZN2A 1BBYA 3PIPF 3E1SA 2LREA 4XN0A 2L7FP 4IXAA 2M30A 1JTYA 5CVRA 2DMQA 2RN7A 2MABA 1WFXA 2M3AA 3LQQA 5TRDA 4P9UA 1G6NA 1W7PA 2PX9A 2NS7A 3GCMA 3I5UA 2Z9OA 3MN2A 1WH7A 5CVUA 3JRGA 1XN7A 5J4YA 4IRHA 3VB2A 2CO5A 2P0WA 2P7CB 5M3FJ 5FLVA 4HLYA 2W25A 3GZ5A 3VSKA 2GOMA 3JW4A 3MMYB 2HQNA 1IUFA 5FFZA 4PUSA 2VPRA 2GA1A 4EMSA 3PQJA 3HRSA 3I9V2 3K4KA 4YFXF 2GM4A 3BTIA 4BQQA 5ILUA 1OR7A 3EUHA 1TC3C 3S17J 4U0VA 1I39A 3GLLA 2ZMEB 5K5OA 4I7HA 3ZMVA 2JK3A 3H5NA 3ZPLA 4CXFA 3TEDA 4CHUA 3IP4B 1J09A 3JRFA 1QHHD 1PJRA 1MNDA 4PSWA 5IP9J 3WTUC 2VOPA 4N0BA 2M4KA 2DT5A 4KFCA 3BY6A 5HLTA 2R5YA 2FBHA 1B59A 1UCRA 2K9SA 2PMUA 5E20A 1Z3XA 3H3ZA 3BP8A 1JKPC 1BOAA 4HNVA 5FFXA 1RR8C 2V6EA 3FHZA 3KETA 3HOXJ 3P7NA 4CYDA 1FC3A 4KN4X 2BHZA 5FD5A 1R36A 3REOA 2MLKA 2JPCA 2ZXJA 1FSHA 1XMXA 2XAHA 2LR8A 4GXOA 4M3GA 3JTGA 3CMYA 5CVJA 2LOOA 3DPTA 3FISA 3J81Z 5LEJA 2CMPA 1XS9A 4X0GA 3OIQA 4OIOF 4XSZF 4AIHA 3PM1A 2VBWA 2HGCA 4I2OA 1QA6A 3MVPA 1BI0A 4U7DA 5LHGA 4BKXA 3BR6A 1RC9A 1XCVA 4U7BA 4BNCA 2OF7A 4AYBN 5F0CA 2X1DA 3V42A 3HGYA 1SFXA 3K4MA 3HSRA 2DMNA 3G1LA 1WKMA 3K1PA 4J01A 3HB9A 1REPC 1A04A 3O8HA 5H20A 3A02A 3DPLC 1YJ9I 4RB1A 2LC2A 4MIMA 3RIRA 4Q5SF 5EG0B 1PP8F 3TMOA 2LY9A 1P6RA 5EGOA 2JRTA 4LFUA 4B44A 3BC8A 2L54A 1UAAA 4ZDOA 1PUFB 3K1NA 1XMKA 1OYWA 2M0CA 3TP0A 4XL9A 3RKXA 1MMDA 2X6XA 5D5XB 4BS9A 2BY0A 2XKOA 3G3ZA 1R9TJ 3RI4A 3KFWX 2F4OB 1ACIA 4B4CA 1E2XA 2Z5UA 3GZ6A 1CF7B 3K4JA 4M9SA 1TTYA 2HYGD 3FXOA 2H8WA 2R4GA 4V19K 3RCOA 4N9IA 1PYVA 2EFQA 4ESBA 4A5MA 2K9QA 4UVCA 2FNAA 2L2OA 2O8XA 5HODA 1KYWA 4A3JJ 5JHFA 3K2AA 1R49A 4MTEA 1EA3A 1XCBA 3FF5A 2BY2A 2DMUA 2ZFUA 1ETYA 3M8FA 2MA3A 4LLLA 2CQ7A 1YLFA 5L3EA 4ENNA 1UB9A 3CUOA 1WJBA 2QQAA 4XLEA 2CS3A 4LJZF 1O7FA 3OYHA 4IJAA 5CJ9A 2WADA 3CCUI 3NWTA 1GVJA 2P5KA 1P7JA 4XOTA 5J40A 4DYQA 2ZXHA 4S05A 2JA5J 3FKJA 4IOCF 1A6QA 1FOWA 1EF4A 1SFEA 2PMZA 2D1VA 3ZQQA 2MYSA 2OCCH 2ZCWA 4M3BA 1U8BA 2DJIA 3RYPA 3S1QJ 2IA2A 4GCVA 3WTSC 1Y56A 3QYFA 3KLNA 2WB1N 4AUXA 4BXUA 1LPQA 4CUGA 2FA5A 3C1DA 4XRSG 1JKOC 5H6QA 3HSEA 1W0UA 3CD6I 2NAZA 1BOBA 4MFEA 3Q5FA 4E70A 1W1WE 3ABMH 3HPHA 1R5GA 5E3NA 1HSTA 2DOEA 2HOAA 3ISPA 1KQ8A 3AAFA 2HYJA 4U0WA 2KRCA 1X1CA 2LSOA 1P4WA 2Z3YA 4L9VA 2NVYJ 5EDNA 1R1TA 2PEXA 4MEYF 1K6YA 4HYEA 1ZK8A 2DDBA 2DTZA 2A05A 2DK5A 3BG6A 2O3FA 3L7WA 1X4OA 2BXYA 2HQAA 1NG7A 2V1XA 2VODA 5E3MA 2O61A 3RDIA 3H9JA 2ZNYA 2MW8A 1R1VA 2XF5A 3BR0A 3FXQA 5DS9A 2ZJPF 1HLVA 4LIVA 2CV1A 1YS7A 4DGWB 2VN2A 3I54A 2DMTA 2EFNA 3HJEA 1FP2A 4HV6A 4UB8C 3IH2A 3BLYA 2MH2A 2GA2A 3ELKA 4LG3A 4DIQA 2QSHX 3HIFA 2EA4A 4CO8A 1RPWA 1K83J 3HHGA 3GYHX 3R0AA 1IRGA 1YYVA 2EWNA 3H36A 1Z7UA 4HA8A 3GTPJ 2R7ZJ 2WY7Q 3MZHA 3CCSI 3LFKA 3S2DJ 1ZGAA 2GIZA 2Z1DA 2JWTA 1FOYA 1R4MB 2EV5A 3V7CA 1Z05A 1KGSA 2NS8A 2FF4A 3DWLE 3I0TA 4FHTA 4LLGF 2XRNA 1MBEA 2LFBA 1X19A 1ZGWA 2VL8A 2TCTA 3BG7A 3GW2A 1YITI 2X51A 3WTVC 5J6XA 2CU7A 2NVUB 2Y69H 3CCVI 3KEYA 1BIBA 2F5VA 4BE2A 3ECHA 2FE3A 3Q0UA 1Q1HA 5ICCA 1LFBA 3I64A 1XGSA 1B9NA 3BQYA 3IKTA 3R61A 2W24A 4V2GA 4AIKA 2D1HA 3HOSA 4IF4A 2DO7A 3BG9A 1MSFC 4P55A 4F92B 2XHKA 3KP7A 3CDIA 2ESHA 4ZTJA 2HZTA 3T0YA 1HC8A 4RM2A 2P8TA 1JHHA 1VI0A 3ZN0A 4XKBA 3CCRI 1U3EM 1H8AC 2P81A 3I53A 3R60A 2MC3A 2W84A 2X4HA 1KONA 4OAYA 3ZQIA 1JUSA 1PP7U 3W6KB 3KYDB 2EA2A 3PO3J 3LSGA 1X58A 4CICA 3S16J 2UV1A 3CJRB 3H35A 3FM3A 4G6DA 5F04A 2STTA 4WCGA 3IWFA 3FK7A 4CH7A 2DA3A 3FHNA 1SAUA 1KU7A 5CPRB 1T08B 4Y33A 1BM9A 4MNUA 2F4IA 1TNSA 3HOZJ 3CP2A 2DN0A 3PL8A 1MGTA 3O2PE 3D5LA 4A0YA 4I76A 2EIMH 4A3DJ 2L7KA 1X1BA 3OYDA 2STWA 4MTDA 2GQQA 2Y30A 2KLOA 4M71A 5BPIA 4ESFA 1A35A 5K7FA 1Z0XA 2ZMEA 3H3VK 5EEHA 3Q3SA 2Y0MA 2AXTC 3C2HA 1IN4A 2V4JC 1ZKGA 1SD5A 3HOYJ 4M9XA 2ESNA 2ZKZA 3NWSA 2DFFA 2FQ4A 3DKWA 1D3YA 3VFZA 2I8DA 3KX2A 3AL0C 4FASD 2M8GX 2Y2ZA 3K2ZA 1AHDP 1S6LA 1OQYA 2UUZA 5JLXA 3MFKA 3OL3A 3R0JA 3KP2A 1ETKA 1OFCX 2OBPA 2XGXA 1HW1A 5DCMB 1QNTA 2OZUA 2OCEA 1IXCA 2A5YB 1J5YA 2JA8J 3G2BA 3KP3A 5IP7J 2VQGA 4ON0A 2W7NA 3BJOA 2Y48A 4Y4RA 3HTUA 2XRLA 2V1UA 4II3A 3OSFA 3ERMA 3JRHA 1IRXA 1U9OA 1ZR4A 2QVOA 4E4HA 4KDPA 2IGOA 3IC7A 2VXDA 1Y8RB 3RZDJ 4PJ0C 3L1PA 1IV8A 2OQGA 1A36A 4M6XA 1ETQA 1DP7P 5JR3A 1HOMA 3DKYA 2DT7B 2KP6A 3GWZA 4JX4A 2KDZA 1N77A 3I4MJ 3IUOA 2XROA 3W3CA 4RBOA 1Z3YA 3OSGA 3K69A 3HXLA 1Z67A 2W4SA 3PIOF 1IW7F 1OCCH 5EG0A 1P4XA 4RGSA 2ISYA 4XMYA 1BI2A 3E7LA 3WE3A 4F55A 2A3SA 2QBYB 1EH6A 4BQAA 3KEOA 4RAFA 3GTGJ 3IV5A 2XSDC 1PUFA 1EJ9A 4ZZDA 1D0YA 2NNNA 3LSJA 1U5TB 2E7XA 4ZDLA 2CQQA 1MH3A 2N8GA 3H3UA 1XB4A 1J2XA 4MQ9F 2KHMA 4XIDA 1DPRA 1I1SA 2K3FA 4XNFA 4AIDA 2XIGA 1IXRC 3JCUC 2VQHA 3JRCA 5HDNA 3CC4I 2HEOA 4U88A 1CF7A 2BGCA 4EGYA 1SD7A 2B7EA 4WXDA 4LGWA 4CA0A 3OYMA 2FUG2 2K27A 3KP5A 2L01A 4XR6A 3DLLF 2K5CA 1IO2A 2RNJA 1QPIA 1RR7A 2J5PA 4PJMA 3KLOA 3UR3C 4LMYA 1WH5A 5HOOA 3OY9A 2R92J 3ROUA 2VI6A 4B3XA 1TNTA 2NXNB 4WXCA 2K40A 4BACA 2L9NA 1X3WB 2QGUA 4BHBA 3IKVA 1UJ8A 4RLFA 4UUVA 4X6AJ 2E1MC 2QLZA 4UVAA 4MQVA 1ULYA 4F3QA 2FX0A 2NVTJ 3BZCA 3HBLA 1XSVA 1Z91A 1MH4A 2H94A 4LITA 1JI8A 4ZH4F 2HOTA 2CUEA 4G7OF 3W2AA 3P9KA 3H0DA 1GXQA 1YJNI 1JKRC 2XSJC 1BR4A 1BC7C 2M9HA 5L3FA 4PFPA 1HDPA 4OU0A 4NQWA 1TBXA 1LE8B 2XC7A 2BVLA 3TOBA 2LYCA 2NVQJ 3PO2J 4XLPF 4IHSA 4FT8A 5DD4A 2EPFA 4Y3OA 4ZDPA 4V2FA 2CG4A 5BOXA 1GXPA 3HOVJ 4EJOA 1GVDA 1FSEA 1T33A 1NHAA 2E5ZA 5E17F 3A4CA 1WWXA 1V3FA 3IH3A 3KE2A 3CC2I 3IL2A 3FXLA 1DGRM 4CCNA 4PJJA 3NARA 2DA2A 4DJAA 5M5XJ 3LSRA 3BTCA 2KFDA 3F8MA 4DW6A 4EJVA 1P92A 3OL4A 1IV6A 1MKMA 1RUNA 1Y6IA 3QOEA 3WTXC 5TGTA 5TJJA 3H92A 2E19A 3DBLB 3U9GA 5J1UA 2ZBKA 3I4PA 3CMMA 3HKZA 1HDDC 2ID3A 4I98B 3CESA 4PDKA 3ERED 1J75A 1BW6A 1SC7A 5KVRA 2L4MA 1FTZA 1MBFA 3LSTA 3OYAA 2D2WA 4FE4A 3S93A 2KDOA 5DTDA 2NNYA 3WTWC 4LLNA 1S9HA 4M3DA 4J19A 3JSOA 2ZSHB 2Z2SB 3QYBA 3MKZA 3SXYA 1FY7A 2OAZA 1RESA 3M8EA 2M1BA 1X1AA 1HW5A 4C3HJ 3FMRA 1KU2A 5HNHA 3NQOA 3FXRA 4LIUA 4IEJA 4GYGA 1I1GA 4H4KC 3SEQA 3OWTA 2VUMJ 4QTRA 2YU3A 1B4AA 3G73A 2F4MB 2DOAA 1LEBA 2XGDA 2VLAA 4FCYA 4UHTA 1Q1VA 1BJAA 4UV8A 2R0QC 3J7AY 2VE9A 1LNWA 4KUMA 3CF5F 4UUSA 3FWEA 5B66C 1W36C 1D0XA 2E2IJ 1YFHA 1LDKB 2ME0A 3ESWB 4A6EA 4BL0B 3DV8A 2VQCA 5E3LA 2IRFG 3CCEI 1WCMJ 4NDLA 4DYRA 1YIJI 2VONA 2ZJQF 5D5UB 1VQ4I 3LOCA 2HTJA 1J9IA 2VB6A 4I6ZA 3L2RA 4CDGA 5ED4A 3J81K 2OQRA 1CGPA 2LP0A 2GWRA 4EM0B 4KA4A 1YI2I 2CV0A 3AG4H 3ZRGA 1WSUA 4MHGA 3GXOA 3D1NI 2W85A 2YX7A 3QRFF 2L7ZA 2L9SA 3OMYA 3K70D 4A2UA 4CCLA 2UWMA 2WBMA 4KT6A 2E1OA 1WHUA 1Z9CA 1DDNA 3N05A 4KISA 2DU9A 3ZGKA 5A2QK 4UY8I 1QHGA 4XKVA 2ADUA 2EJRA 2A69F 2VASA 3CP8A 1QPMA 4PJLA 3LAJA 3BZKA 4CZCA 1G4DA 1R23A 5LHIA 1JT6A 3K10A 1D1AA 2PLYA 2EK5A 3M8JA 3CCJI 5D4SA 3AG1H 2EV6A 2K3PA 3GO5A 3M7GA 4MFDA 1VQ5I 4IHTA 2IS4A 4HF2A 2IVMA 2R7UA 3L00A 3NEUA 3GTKJ 3GTLJ 1ZG1A 5JI6A 3J7AO 1B9MA 2QA4I 4H0EA 3M9AA 3SQNA 2OV7A 3TW7A 5IOYA 3CO6C 2QM3A 1HF0A 3ZCOA 4Q47A 3CMEI 4UB6C 4E7IA 2LDUA 3M3YJ 3BT9A 2ID6A 2LF7A 2JSCA 2EZIA 4IOAF 5D8LB 3GFJA 4AC0A 3GUDA 3M1CA 2WAQA 1WVRA 2K4JA 3A0HC 4C3IJ 5AONA 3ZMZA 3VEPA 3COAC 3KIOA 5HDKA 4M9ZA 3ZOBA 2DBBA 2FBIA 2ACJA 1J0RA 2P5VA 3DEUA 3ONQA 3GMEA 5FKKA 3CUQC 3ZR8X 1B1BA 5CKTA 4KICA 1AOYA 3GTMJ 2H1LA 2XV4S 3FBIB 4IPAA 3CJTB 4OIRF 4YIFA 3MQ0A 5A2QZ 2CQKA 2EQRA 3PUFA 4IHVA 3QWLA 3DTEA 1R5ID 4NHJA 2ECCA 4AVZA 3RKWA 3QOPA 3WODF 4A3BJ 5DCMA 4C30A 4HNTA 2JT1A 5C44J 3DEEA 5LRRA 1LQ1A 3QPHA 3R4KA 1DUXC 4Z2YA 3GTOJ 2E5NA 1Z1DA 3AG3H 4XQFA 4LK0F 2AS5F 3V4GA 5L3CA 1ZR2A 3LWFA 2VXZA 3Q0WA 4BE0A 4PCQA 2HVSA 4Y52J 3L2WA 2NS0A 4HQMA 3BR5A 1OMIA 3KZYA 1X4PA 1BC8C 5ICEA 3S15J 4JP0A 4NC8A 3BCBA 4BDZA 5BPDA 1UHSA 4KITB 3I56I 1T8IA 3A01B 1FBQA 1JUMA 4ENMA 1RZ4A 1VQLI 1Y1WJ 3W6VA 1NTCA 4FX0A 2L7MP 3N4MA 5DUIA 1KA8A 2QEXI 1H89C 3F8FA 1T56A 2ZSIB 5F0FA 3JR9A 1IC8A 2Q2EB 5HLHA 2DA4A 4YFNF 1DU6A 1IZ1A 1SVMA 1GHCA 1F4KA 2DFEA 3U21A 5DCFA 1UMQA 4MGRA 2WC2A 3C2GA 1LFPA 4LG0B 2MD5A 2QBYA 3K9TA 2F5EA 4E7LA 1T98A 3BR2A 2DK8A 3OOPA 2FNPA 1BN5A 3SDBA 1U5TA 2AHQA 3CDHA 3HC7A 4GGGA 4M73A 3S2WA 4HAMA 3TO6A 2FXAA 3HHHA 3J7ZI 4BJ6C 2K86A 3FIWA 3EQLF 3J7YJ 3M07A 2O03A 3FXKA 2ELKA 3QP5A 2ELJA 5D5VB 4JQFA 1VQ9I 1S29A 4Q4ZF 4E7SA 5FRMA 3S1RJ 2LY2A 3Q9VA 3S32A 5IT9K 1ON1A 3CQZJ 1DU0A 4B47A 1E0EA 2XAFA 4E7KA 1WJCA 2XUBA 2CW0F 4F91B 1W4MA 4LB6B 4DOZA 2V26A 1JXSA 4XONA 2L0KA 3WGHA 5FD6A 1YIOA 4CYCB 4BXXJ 3S3NA 2E2JJ 2JA2A 5DD8A 2DOFA 3CO7C 2VC0A 3S1MJ 2AQFA 1FX7A 1S72I 4NQWB 3IRRA 4N4NB 3G1OA 2OA4A 2O0YA 1W36D 4I99C 3VYTB 2HVQA 3DEWA 2QQ8A 4R79A 4G7HF 1FOXA 4FETA 4EEFG 4NC7A 2Z33A 2RV8A 3V8JA 3OS1A 1T38A 4AM3A 4M6YA 5K7ZA 1W0TA 2QYOA 3WHCA 2L5QA 1NK2P 2HU9A 4O5VA 3KZZA 2EZLA 1T0FC 4U87A 3A2KA 2XPWA 1TQIA 1XGOA 3QPLA 2KRHA 4KMUX 4CZZA 1VQPI 1HKTA 4NB5A 5FKNA 5EZGA 1M1EB 2E2HJ 3KEQA 4HQEA 2IGNA 1SFUA 2HXIA 2L9RA 1LE8A 4LB5A 2XKPA 4A3KJ 5KNLA 2B0LA 5KCMA 1WRJA 1ETOA 3BZ6A 1ZYRF 1I6XA 5E79C 1MJBA 3DLAA 1OLTA 3ZQFA 2GXGA 4K2EA 3SZTA 2LKXA 2VT3A 2QWWA 1FIAA 2KMUA 3ECOA 3EUHC 3LSHA 2DLLA 1OJLA 3MZYA 1YTYA 3FKIJ 5IT9Z 3J80Z 2GOXB 5LFAA 3DU6A 1R4NB 4WX9A 3UKGA 2BZTA 2HOSA 4XRMA 2BW3B 3PNTA 3X2QH 2RQQA 4OMYA 1OCPA 3HDDA 4DZPA 5C4JJ 5L3BA 4UUSB 3L09A 3RKYA 1JE8A 4FQGA 4F7ZA 2IS1A 2R3SA 1XDUA 2JTVA 3W2VA 2KT0A 2OTLI 1O7LA 2DA6A 2HQ5A 3FMSA 3HEFA 2LKPA 1IN5A 2E60A 4U0YA 1XPXA 3OS0A 1YE9A 1FYKA 5E1WA 1U78A 4GFBA 5F08A 3HKZN 5FLXK 2KISA 3PNYA 4XKWA 2IA0A 2RC4A 4XLNF 2Q8KA 3MCZA 2IT0A 2PQ8A 1YQAA 1V55H 2HR3A 2UXXA 1MBJA 1R1UA 1VTNC 2MG4A 5EJCA 3H0GJ 4GDFA 1S7AA 3C2BA 2IW5A 2YUSA 1X3UA 2H1KA 3PSIA 3LAPA 2LH9A 5M5YJ 1XTAA 2CJJA 2J5OA 4B8XA 1FIPA 2OUMA 1YW9A 2FD5A 3QP6A 3SZPA 4UUTA 5GPCA 2R7FA 4D7NA 2R5ZB 4DNCA 3O3KA 3KYLA 3BG3A 5F64A 4BY7J 1TT5B 4C3JJ 3RTRA 4P96A 1AKHB 1YW8A 4PZJA 5L3GA 2JZYA 2EFOA 3OR2C 4HLXA 5JVGF 2LY1A 1YRNB 4BBSJ 2CQXA 4YELA 1MNEA 3I59B 5C4XJ 2LMDA 4TV7A 2GIVA 3ZQLA 4KNYA 1YS6A 2HKXA 4CCOA 3E6CC 2BY3A 4A6DA 2X6WA 2CSOA 1D0ZA 2Y31A 3LSKA 3F23A 1LJ9A 1D5VA 4HSTA 2AO9A 5E18F 2JVGA 2L4AA 2V9PA 4IL6C 5IP6A 1ETVA 2CV2A 5F0HA 3P5JA 1TW3A 4R8HA 5FLXZ 3EYIA 2FRHA 4Y13A 3FK6A 1KQ0A 4RLQA 2JUGA 3LSMA 5BQTA 1QVUA 2TRTA 3FM5A 1I5ZA 1V5GA 4HDUA 3ULQB 1YX3A 3HOWJ 4AYBA 1JJ8C 1WPKA 4CGZA 3DCFA 1QBJA 2HKOA 4RA2A 2EB7A 4R1HA 3K7AJ 3V7SA 4XN3A 3LA3A 3K4NA 2EV0A 3QYEA 4KN7X 3F8NA 5CVIA 3VYSB 3LMMA 3PSFA 4A3CJ 3KPHA 4L5IA 2LNBA 4IRIA 4A3MJ 1LFUP 2PFBA 4RAGA 4P9FA 4CSWA 4WWCA 2WY8Q 2E7WA 4ZYHA 1HKSA 4RB0A 3VYUB 2O7OA 3RJPA 2UZKA 4D5CA 2A07F 1NG6A 1WI3A 4HOBA 4PFOA 1JTXA 4P1WA 3GX4X 3ABKH 2VBZA 4P5OA 5E3OA 2DFHA 3IRQA 3BQZA 2WAQN 5E1XA 5J4VA 3ASNH 2K4BA 1G2HA 5HLIA 1F43A 1W5TA 1QZEA 1UFMA 2H6CA 3QPSA 4LD5A 4I09A 2FJ1A 2EIKH 1WI9A 5D6EA 2CUZA 4D1QA 4QPOA 4RAZA 2DMPA 4KJZA 4B48A 1ZGJA 3W2WA 2BBYA 2QSFX 2C6YA 3KYCB 3WTZA 2E1NA 1I6HJ 2DT6A 1JGSA 1SFOJ 4CCJA 2R7DA 5IYDJ 4L18B 1YG2A 1OYYA 3GTJJ 1HKQA 5GADJ 2RAEA 5DDGA 4PSXA 3DKXA 2V7FA 4XOPA 4RDUA 1SFKA 5LEKA 2QUFA 2ZXWH 4Y7NJ 4HX8A 2CWEA 1ZREA 3OV8A 5JHUA 1R5HA 2VBXA 1OISA 4ETSA 3A01A 4N4OB 5M5WJ 4OAZA 1H9TA 2HPIA 5EF6A 1SAXA 3TL4X 1VNDA 1KU9A 3ABTA 1OPCA 3WGIA 1ETWA 1VF9A 2LBFA 2MBFA 3ASOH 4G12A 1O3QA 3AL0B 2L3DA 1AWCA 9ANTA 4L9JA 5ILVA 3NAUA 2V1NA 1QZYA 2Q2EA 3LQRA 1HSJA 2HNHA 3KZIC 3MAJA 4HV5A 4RAYA 3WGGA 4OIPF 3T5XA 4YFKF 4A3IJ 1YOVB 2R7QA 1SD4A 1TWHJ 2ISZA 4BJ5C 2VIXA 2V9KA 1T6SA 6PAXA 1N25A 1F1ZA 4LG0A 2OZ6A 2WB1A 1RUOA 3CJNA 2JA7J 3OYEA 4A93J 4G94A 1IN8A 1DP3A 2VJJA 3T1BA 2BV6A 2IBDA 3TQNA 3ZP5A 3RQ4A 5CVVA 4BXFA 1KYZA 1R7JA 2OC6A 2QCOA 2X1CA 3OIOA 4KIFA 3PNVA 2X6OA 2RQPA 1YHQI 4BE1A 1YO5C 2R7OA 3I71A 3DTKA 3K4BA 4LK1F 3HRMA 3HOTA 2PJPA 2DODA 2UXNA 4Y17A 3H9GA 1VFCA 4E7ZA 4FX4A 1QRYA 1T95A 4HX4A 1FJLA 4IZZA 3FX3A 5JLWA 1R22A 4QLCU 4G6QA 3HUGB 2WWYA 1STZA 2G7UA 4CYCA 2I5UA 2HI3A 2MFZA 3RSNA 2HZDA 1MBGA 1S8NA 4A3FJ 4BU2A 1K79A 2P7VB 3FXUA 3WG9A 5HS9A 2COMA 3RYRA 3I58A 5K5RA 3TDZC 2PN6A 4ZZLA 1HBXG 5CQEA 4IRGA 5HLGA 2V1DA 2D5VA 3IAS2 1K78B 2PMZN 1VQ7I 2X85A 2FU4A 4II2A 3LL7A 3HRTA 4N9HA 3G71I 1BIAA 2K9NA 1BA5A 4UV9A 4ZYGA 1JGGA 1K7AA 3ZQGA 1P7IA 4M72A 2P5LC 2W48A 2BXZA 2IPQX 3F3XA 4ITVA 1IJWC 2DXIA 2P6TA 2NOJB 1WJAA 4A3EJ 1B8IB 2KPMA 2RDPA 2VKEA 3DU5A 1P9QC 3H5AA 3NRVA 1TWCJ 2HOEA 2M45A 5K7HA 1H88C 4FISA 1IRZA 1I3QJ 1YW7A 3CMAI 1B6AA 5C3EJ 1D8KA 2ZMEC 1Z6RA 2PMHA 4L5JA 1K61A 2HDWA 3SYTA 4BQOA 4X1EA 4L0YB 1F5TA 1FWZA 5F27A 2BW3A 3TOAA 3ABLH 1BR2A 3OYKA 5J3LA 2LD5A 2E1MB 2K9MA 1TWFJ 1UHWA 3LSIA 5F1RA 2DJNA 4QIWN 3SDGA 3JRIA 3H5RA 4XBFA 4EGZA 2F6CA 1BI3A 4EM1A 3SFZA 1PUEE 3OR1C 1VZ0A 3HG9A 4IHXA 2YSRA 3FXMA 2ZXIA 4GRIA 2XAUA 1JKQC 1SD6A 5HDGA 1EKEA 4XORA 3EDPA 4F52A 4XICA 2KIMA 1ZG3A 1ZHFA 4BJTA 3ZQ7A 4OIQF 1FNNA 4HBLA 4BUPA 1OKRA 3E0JB 3FDYA 2EINH 5CQGA 3T8TA 1GT0C 2M87A 3A03A 1OYIA 4HX7A 4BBRJ 1RIOH 1EH7A 3MEXA 1QO0D 3JAMZ 5GTIC 1O3TA 2Y9YA 2BHYA 3RKQA 1WJEA 1C0WA 5DV5A 3L2CA 2CW8A 4RGRA 1ORKA 2MLGA 1I27A 4YG2F 4JX6A 2QKLB 1H0MA 3QU6A 1B72B 1FT9A 3U1KA 2CQNA 3TP3A 1T0FA 2VKDA 1WZ2A 3RQIA 5FB2A 2KIQA 2F5DA 1IDZA 3TW6A 4HW0A 4PK4A 5D5WB 1TQMA 1DQUA 2R5ZA 4NNJA 2P6SA 5IPAA 2B9SA 4ENKA 2M0MA 4L9TA 2HYFA 1SMYF 2JPBA 3S1NJ 1P4AA 4HG2A 3HL2A 1K4SA 1AKHA 3E97A 2X0LA 3JTHA 4ASNA 2GBYA 1DPUA 1QQIA 4DYCA 1YRNA 1JUPA 1ODDA 4IQ4A 1VQKI 1FMVA 5EEAA 5TISC 2DCEA 4HF0A 3I59A 3EETA 4G6TB 2YS9A 1K4TA 1XX5A 2X1EA 2XGEA 3F9KA 4RMNA 2QQBA 2XPUA 2JVHA 4AD9A 4HEA2 2O5RA 2LKSA 5FLMJ 4AIJA 4ZTFA 3TGNA 1AU7A 1BI1A 2IGMA 2K02A 4JYKA 2CW7A 3S2HJ 3S8PA 4ANJA 1GV2A 3FMQA 2R7TA 1RKWA 5HNFA 1QZZA 1EV7A 2G9WA 5HVQC 4KIGA 3S14J 3HTSB 3GTQJ 3D5RC 1N75A 2IGKA 3F8BA 2QQ9A 1FOKA 3G1MA 3WG7H 3V7RA 2KZVA 4W1UA 1FBSA 2E71A 2H8RA 5E1ZB 1H9GA 1F9NA 3EUAA 5J8FA 4BEHB 4BY1J 4JX5A 1RETA 1OCRH 2DW4A 3JRBA 4QSHA 2BOLA 2XGCA 2CYYA 1ZLJA 3OIPA 3LA7A 2Y9ZA 3OS2A 1ZAOA 2CFXA 1G3WA 4S0HB 2XB0X 3P9IA 4RB3C 1BW5A 4MEXF 1YJWI 1L0OC 3K0LA 2M8EA 1O57A 1X3ZB 1O3RA 4PJNA 3WE2A 1TZLA 3BR1A 3CLQA 5BNGA 4FE7A 4WF2A 4HPQA 1MMNA 4KIBA 3SEZA 1MDMB 5ERIA 1D8JA 2EBIA 2V9VA 3Q0VA 5KK1A 4ZJZA 1MNMC 1ERDA 1LEAA 5DYMA 4OINF 2FEZA 2XASA 2KIUA 5J1YA 5EZHA 1MD0A 1XGNA 2FMLA 2LK2A 3GFLA 3QPTA 3E5XA 4XKCA 3ZXSA 4CCMA 4HZFA 1PDNC 3GF2A 1YX5A 3GVAA 3TBIA 2PJRA 2XAJA 2XVCA 4L0ZB 2LBFB 1N78A 2IA1A 5B5EC
chains in the Genus database with same CATH topology
1GV5A 5F08A 4A3LJ 3HKZN 3E7LA 2JJ7A 3JRDA 3GTGJ 3IV5A 2XSDC 1PUFA 3ZQCA 4IHYA 3LSJA 1MBJA 2GLOA 2MG4A 2CQQA 2HXOA 3H0GJ 1MH3A 2N8GA 3C2BA 2YUSA 2H1KA 2WV1A 4XIDA 1X2MA 5M5YJ 1ETXA 2CJJA 2B63J 3JRCA 3ZQHA 1FIPA 2FD5A 4UUTA 5GPCA 2L7FP 4D7NA 2R5ZB 1JTYA 4IHWA 2DMQA 3BG3A 4BY7J 2NS7A 1GDTA 4C3JJ 5J1RA 3MN2A 2IEKA 1WH7A 3JRGA 1A6IA 2EZHA 1AKHB 1QPIA 5M3FJ 1RR7A 5FLVA 5FKMA 1YRNB 4BBSJ 2CQXA 1WH5A 1ZTRA 2R92J 2VI6A 1IUFA 2VPRA 5IYBJ 5C4XJ 2K40A 1NK3P 2GM4A 3BTIA 2DA1A 3ZQLA 1TC3C 3S17J 4X6AJ 2Y31A 2JK3A 3TEDA 2AO9A 3JRFA 2FX0A 5IYCJ 2NVTJ 5IP9J 5IP6A 1ETVA 3HBLA 5F0HA 3WHBA 1MH4A 2R5YA 1HCRA 3FK6A 2K9SA 5IOZA 2CUEA 2HOTA 1WGXA 1JKPC 1JKRC 1QVUA 2TRTA 2JA6J 4HNVA 2M9HA 1HDPA 4LOCA 3HOWJ 2NOGA 3HOXJ 1LE8B 1JJ8C 1WPKA 2NVQJ 3DCFA 3PO2J 3K7AJ 4V2FA 5FJ8J 3HOVJ 3JREA 2LR8A 4M3GA 1GVDA 3CMYA 1T33A 2OPTA 4A3CJ 2LTPA 3IH3A 3FISA 4A3MJ 3NARA 2DA2A 3O8GA 5M5XJ 3LSRA 1LFUP 3BTCA 4DW6A 1XS9A 1IV6A 4M3EA 1QVTA 2E19A 3PM1A 1S7EA 2O7OA 3MVPA 1XG1A 1MBKA 4BKXA 4D5CA 5J1UA 5FKLA 1WI3A 2IAIA 3BR6A 1SANA 2DA7A 1HDDC 1JTXA 2ID3A 2OF7A 4AYBN 1BW6A 5GP9A 5F0CA 5E3OA 3BQZA 2WAQN 1FTZA 1MBFA 3HGYA 4FE4A 1G2HA 4D7MA 1F43A 2DMNA 3G1LA 5DTDA 3QPSA 2FJ1A 2M34A 3HB9A 4M3DA 5EYRA 4J19A 1BL0A 3O8HA 3A02A 4B1RA 1RESA 1JJ6C 2DMPA 4MIMA 4DZJA 5EG0B 1B8IA 4C3HJ 2LY9A 5EGOA 1I6HJ 1SFOJ 4IEJA 1PUFB 2VUMJ 5IYDJ 4QTRA 3GTJJ 2M0CA 3TP0A 1D5YA 2RAEA 2XGDA 4FCYA 2YU9J 1Q1VA 1MSEC 2R0QC 4RDUA 4A69C 1TWAJ 3CDLA 4UUSA 1R9TJ 1RKTA 4Y7NJ 2E2IJ 2ME0A 4B4CA 5E3LA 3A01A 5M5WJ 1WCMJ 1ENHA 4NDLA 4DYRA 4B3AA 4D5FA 5EF6A 1VNDA 3LOCA 1ETWA 4M3FA 1VF9A 4I6ZA 9ANTA 4G12A 3NAUA 2K9QA 1U9NA 2LP0A 5HODA 4A3JJ 3K2AA 4A3IJ 3D1NI 1TWHJ 2L7ZA 2DMUA 1ETYA 1IDYA 3SFIA 2E1OA 2JA7J 4A93J 1UG2A 1I50J 2IBDA 3QQAA 1OCTC 4XK4A 3HGGA 1P7JA 3CCYA 4DYQA 5GPAA 2QCOA 3OIOA 1JT6A 4MO7A 2X6OA 4M6VA 2JA5J 1B72A 3B6CA 4MFDA 1EF4A 4A3GJ 1VFCA 2COBA 3HOUJ 3GTKJ 3GTLJ 1QRYA 4M3BA 1U8BA 2R5YB 1FJLA 3S1QJ 3I4NJ 3OOUA 3TW7A 2WB1N 5IOYA 4AUXA 5JLWA 1APLC 1HF0A 4XRSG 1JKOC 1FEXA 1W0UA 4MFEA 3M3YJ 4CYCA 2HI3A 5E3NA 3BT9A 2ID6A 2HOAA 1MBGA 1ITYA 2EZIA 4A3FJ 2HYJA 2MGQA 4AC0A 4C3IJ 2NVYJ 1Z77A 5EDNA 2D5VA 3BG5A 1ZK8A 2PMZN 2DTZA 2G0EA 3ZOBA 1ZQ3P 5M3MJ 3VPRA 1MBHA 4W97A 2XB5A 4L5EA 5E3MA 5FKKA 1HLVA 2MW8A 1XC5A 3BR0A 4MLOA 5DS9A 3GTMJ 2K9NA 2M2EA 2O9LA 1BA5A 3BTLA 4XRSA 1JGGA 2DMTA 4ABZA 3ZQGA 2EQRA 4IHVA 3IH2A 1CQTA 2ECCA 1P7IA 2ZB9A 2W48A 4A3BJ 4FTHA 1IJWC 1TWGJ 1RPWA 1K83J 5C44J 4A3EJ 1B8IB 2VKEA 3GBGA 5EGOB 1TWCJ 5K7HA 3GTOJ 2NVXJ 2QF7A 1H88C 4FISA 3GTPJ 1IRZA 1I3QJ 1O4XA 2R7ZJ 5C3EJ 3MKLA 1ZR2A 1K61A 3Q0WA 3S2DJ 4X1EA 4Y52J 2HDDA 2R93J 5F27A 2JWTA 3BR5A 1JT0A 2ME6A 5J3LA 2NS8A 4JP0A 2LD5A 3S15J 1TWFJ 1UHSA 1MBEA 2LFBA 2DJNA 2VKVA 2X48A 4QIWN 1ZGWA 3M4OJ 3A01B 1JUMA 3SDGA 3JRIA 2TCTA 1Y1WJ 3W6VA 1NTCA 2L7MP 2DA5A 2CU7A 1H89C 1T56A 4IHXA 5F0FA 3JR9A 1IC8A 5FKOA 3Q0UA 2DA4A 1BJZA 3BR3A 1JKQC 2JN6A 1DU6A 1LFBA 1IGNA 4XICA 3BQYA 1UMQA 4V2GA 3BG9A 1GT0C 1MSFC 3A03A 3BR2A 2O8KA 4BBRJ 1X2NA 2EZKA 2AHQA 1IG7A 2Y9YA 3RKQA 1VI0A 1ORKA 2EH3A 1POGA 1H8AC 2P81A 2LVSA 4JX6A 3FIWA 1A5JA 3ZQIA 1B72B 2ELKA 1JUSA 2JMWA 3TP3A 2Y0SN 3RQIA 1IDZA 3TW6A 2R5ZA 3PO3J 3LSGA 1X58A 3S1RJ 5IPAA 3S16J 1DU0A 3CQZJ 3B6AA 5F04A 3S1NJ 3JRAA 3FK7A 2DA3A 1AKHA 2L0KA 4BXXJ 4CYCB 3RZOJ 2GBYA 2E2JJ 4DYCA 1YRNA 1JUPA 5EEAA 3S1MJ 3HOZJ 2CUFA 2DN0A 2YS9A 5F1JA 2XGEA 3G1OA 2XPUA 4I76A 4A3DJ 3LSPA 2Y30A 5FLMJ 2ECBA 2LLKA 3DEWA 1AU7A 4EEFG 5K7FA 1Z0XA 4JYKA 3S2HJ 3H3VK 1GV2A 5K7ZA 1RKWA 3Q3SA 1W0TA 3WHCA 1NK2P 1ZKGA 3HOYJ 1F36A 2FQ4A 2EZLA 2M8GX 3S14J 2XPWA 3BTJA 3QPLA 2MSYA 2CRGA 3GTQJ 2Y2ZA 1AHDP 3G1MA 2I10A 4W1UA 5FKNA 5EZGA 3LNQA 2H8RA 2E2HJ 5JLXA 2HXIA 2L9RA 1LE8A 1ETKA 1OFCX 4A3KJ 4BY1J 3F0CA 4JX5A 1RETA 1ETOA 3JRBA 4QSHA 2XGCA 3ZQFA 2JA8J 1FTTA 5IP7J 2LKXA 2Y9ZA 1FIAA 4S0HB 2XB0X 3IH4A 4C2MJ 1OJLA 3FKIJ 1BW5A 2XRLA 3SJMA 3OSFA 3JRHA 1ZR4A 1U9OA 3UKGA 2HOSA 4XRMA 3BR1A 1OCPA 5BNGA 4FE7A 3RZDJ 3HDDA 3L1PA 4DZPA 5C4JJ 4UUSB 2EBIA 3Q0VA 1ETQA 1MNMC 1GUUA 1HOMA 2KT0A 4JX4A 2X9DA 3HM5A 2KDZA 1E3OC 5J1YA 1Y1VJ 5EZHA 3I4MJ 2XPVA 2LK2A 2DA6A 2HQ5A 3HEFA 4RBOA 3OSGA 4GFBA 1U78A 5EG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV5 A;  5F08 A;  4A3L J;  3HKZ N;  3E7L A;  2JJ7 A;  3JRD A;  3GTG J;  3IV5 A;  2XSD C;  1PUF A;  3ZQC A;  4IHY A;  3LSJ A;  1MBJ A;  2GLO A;  2MG4 A;  2CQQ A;  2HXO A;  3H0G J;  1MH3 A;  2N8G A;  3C2B A;  2YUS A;  2H1K A;  2WV1 A;  4XID A;  1X2M A;  5M5Y J;  1ETX A;  2CJJ A;  2B63 J;  3JRC A;  3ZQH A;  1FIP A;  2FD5 A;  4UUT A;  5GPC A;  2L7F P;  4D7N A;  2R5Z B;  1JTY A;  4IHW A;  2DMQ A;  3BG3 A;  4BY7 J;  2NS7 A;  1GDT A;  4C3J J;  5J1R A;  3MN2 A;  2IEK A;  1WH7 A;  3JRG A;  1A6I A;  2EZH A;  1AKH B;  1QPI A;  5M3F J;  1RR7 A;  5FLV A;  5FKM A;  1YRN B;  4BBS J;  2CQX A;  1WH5 A;  1ZTR A;  2R92 J;  2VI6 A;  1IUF A;  2VPR A;  5IYB J;  5C4X J;  2K40 A;  1NK3 P;  2GM4 A;  3BTI A;  2DA1 A;  3ZQL A;  1TC3 C;  3S17 J;  4X6A J;  2Y31 A;  2JK3 A;  3TED A;  2AO9 A;  3JRF A;  2FX0 A;  5IYC J;  2NVT J;  5IP9 J;  5IP6 A;  1ETV A;  3HBL A;  5F0H A;  3WHB A;  1MH4 A;  2R5Y A;  1HCR A;  3FK6 A;  2K9S A;  5IOZ A;  2CUE A;  2HOT A;  1WGX A;  1JKP C;  1JKR C;  1QVU A;  2TRT A;  2JA6 J;  4HNV A;  2M9H A;  1HDP A;  4LOC A;  3HOW J;  2NOG A;  3HOX J;  1LE8 B;  1JJ8 C;  1WPK A;  2NVQ J;  3DCF A;  3PO2 J;  3K7A J;  4V2F A;  5FJ8 J;  3HOV J;  3JRE A;  2LR8 A;  4M3G A;  1GVD A;  3CMY A;  1T33 A;  2OPT A;  4A3C J;  2LTP A;  3IH3 A;  3FIS A;  4A3M J;  3NAR A;  2DA2 A;  3O8G A;  5M5X J;  3LSR A;  1LFU P;  3BTC A;  4DW6 A;  1XS9 A;  1IV6 A;  4M3E A;  1QVT A;  2E19 A;  3PM1 A;  1S7E A;  2O7O A;  3MVP A;  1XG1 A;  1MBK A;  4BKX A;  4D5C A;  5J1U A;  5FKL A;  1WI3 A;  2IAI A;  3BR6 A;  1SAN A;  2DA7 A;  1HDD C;  1JTX A;  2ID3 A;  2OF7 A;  4AYB N;  1BW6 A;  5GP9 A;  5F0C A;  5E3O A;  3BQZ A;  2WAQ N;  1FTZ A;  1MBF A;  3HGY A;  4FE4 A;  1G2H A;  4D7M A;  1F43 A;  2DMN A;  3G1L A;  5DTD A;  3QPS A;  2FJ1 A;  2M34 A;  3HB9 A;  4M3D A;  5EYR A;  4J19 A;  1BL0 A;  3O8H A;  3A02 A;  4B1R A;  1RES A;  1JJ6 C;  2DMP A;  4MIM A;  4DZJ A;  5EG0 B;  1B8I A;  4C3H J;  2LY9 A;  5EGO A;  1I6H J;  1SFO J;  4IEJ A;  1PUF B;  2VUM J;  5IYD J;  4QTR A;  3GTJ J;  2M0C A;  3TP0 A;  1D5Y A;  2RAE A;  2XGD A;  4FCY A;  2YU9 J;  1Q1V A;  1MSE C;  2R0Q C;  4RDU A;  4A69 C;  1TWA J;  3CDL A;  4UUS A;  1R9T J;  1RKT A;  4Y7N J;  2E2I J;  2ME0 A;  4B4C A;  5E3L A;  3A01 A;  5M5W J;  1WCM J;  1ENH A;  4NDL A;  4DYR A;  4B3A A;  4D5F A;  5EF6 A;  1VND A;  3LOC A;  1ETW A;  4M3F A;  1VF9 A;  4I6Z A;  9ANT A;  4G12 A;  3NAU A;  2K9Q A;  1U9N A;  2LP0 A;  5HOD A;  4A3J J;  3K2A A;  4A3I J;  3D1N I;  1TWH J;  2L7Z A;  2DMU A;  1ETY A;  1IDY A;  3SFI A;  2E1O A;  2JA7 J;  4A93 J;  1UG2 A;  1I50 J;  2IBD A;  3QQA A;  1OCT C;  4XK4 A;  3HGG A;  1P7J A;  3CCY A;  4DYQ A;  5GPA A;  2QCO A;  3OIO A;  1JT6 A;  4MO7 A;  2X6O A;  4M6V A;  2JA5 J;  1B72 A;  3B6C A;  4MFD A;  1EF4 A;  4A3G J;  1VFC A;  2COB A;  3HOU J;  3GTK J;  3GTL J;  1QRY A;  4M3B A;  1U8B A;  2R5Y B;  1FJL A;  3S1Q J;  3I4N J;  3OOU A;  3TW7 A;  2WB1 N;  5IOY A;  4AUX A;  5JLW A;  1APL C;  1HF0 A;  4XRS G;  1JKO C;  1FEX A;  1W0U A;  4MFE A;  3M3Y J;  4CYC A;  2HI3 A;  5E3N A;  3BT9 A;  2ID6 A;  2HOA A;  1MBG A;  1ITY A;  2EZI A;  4A3F J;  2HYJ A;  2MGQ A;  4AC0 A;  4C3I J;  2NVY J;  1Z77 A;  5EDN A;  2D5V A;  3BG5 A;  1ZK8 A;  2PMZ N;  2DTZ A;  2G0E A;  3ZOB A;  1ZQ3 P;  5M3M J;  3VPR A;  1MBH A;  4W97 A;  2XB5 A;  4L5E A;  5E3M A;  5FKK A;  1HLV A;  2MW8 A;  1XC5 A;  3BR0 A;  4MLO A;  5DS9 A;  3GTM J;  2K9N A;  2M2E A;  2O9L A;  1BA5 A;  3BTL A;  4XRS A;  1JGG A;  2DMT A;  4ABZ A;  3ZQG A;  2EQR A;  4IHV A;  3IH2 A;  1CQT A;  2ECC A;  1P7I A;  2ZB9 A;  2W48 A;  4A3B J;  4FTH A;  1IJW C;  1TWG J;  1RPW A;  1K83 J;  5C44 J;  4A3E J;  1B8I B;  2VKE A;  3GBG A;  5EGO B;  1TWC J;  5K7H A;  3GTO J;  2NVX J;  2QF7 A;  1H88 C;  4FIS A;  3GTP J;  1IRZ A;  1I3Q J;  1O4X A;  2R7Z J;  5C3E J;  3MKL A;  1ZR2 A;  1K61 A;  3Q0W A;  3S2D J;  4X1E A;  4Y52 J;  2HDD A;  2R93 J;  5F27 A;  2JWT A;  3BR5 A;  1JT0 A;  2ME6 A;  5J3L A;  2NS8 A;  4JP0 A;  2LD5 A;  3S15 J;  1TWF J;  1UHS A;  1MBE A;  2LFB A;  2DJN A;  2VKV A;  2X48 A;  4QIW N;  1ZGW A;  3M4O J;  3A01 B;  1JUM A;  3SDG A;  3JRI A;  2TCT A;  1Y1W J;  3W6V A;  1NTC A;  2L7M P;  2DA5 A;  2CU7 A;  1H89 C;  1T56 A;  4IHX A;  5F0F A;  3JR9 A;  1IC8 A;  5FKO A;  3Q0U A;  2DA4 A;  1BJZ A;  3BR3 A;  1JKQ C;  2JN6 A;  1DU6 A;  1LFB A;  1IGN A;  4XIC A;  3BQY A;  1UMQ A;  4V2G A;  3BG9 A;  1GT0 C;  1MSF C;  3A03 A;  3BR2 A;  2O8K A;  4BBR J;  1X2N A;  2EZK A;  2AHQ A;  1IG7 A;  2Y9Y A;  3RKQ A;  1VI0 A;  1ORK A;  2EH3 A;  1POG A;  1H8A C;  2P81 A;  2LVS A;  4JX6 A;  3FIW A;  1A5J A;  3ZQI A;  1B72 B;  2ELK A;  1JUS A;  2JMW A;  3TP3 A;  2Y0S N;  3RQI A;  1IDZ A;  3TW6 A;  2R5Z A;  3PO3 J;  3LSG A;  1X58 A;  3S1R J;  5IPA A;  3S16 J;  1DU0 A;  3CQZ J;  3B6A A;  5F04 A;  3S1N J;  3JRA A;  3FK7 A;  2DA3 A;  1AKH A;  2L0K A;  4BXX J;  4CYC B;  3RZO J;  2GBY A;  2E2J J;  4DYC A;  1YRN A;  1JUP A;  5EEA A;  3S1M J;  3HOZ J;  2CUF A;  2DN0 A;  2YS9 A;  5F1J A;  2XGE A;  3G1O A;  2XPU A;  4I76 A;  4A3D J;  3LSP A;  2Y30 A;  5FLM J;  2ECB A;  2LLK A;  3DEW A;  1AU7 A;  4EEF G;  5K7F A;  1Z0X A;  4JYK A;  3S2H J;  3H3V K;  1GV2 A;  5K7Z A;  1RKW A;  3Q3S A;  1W0T A;  3WHC A;  1NK2 P;  1ZKG A;  3HOY J;  1F36 A;  2FQ4 A;  2EZL A;  2M8G X;  3S14 J;  2XPW A;  3BTJ A;  3QPL A;  2MSY A;  2CRG A;  3GTQ J;  2Y2Z A;  1AHD P;  3G1M A;  2I10 A;  4W1U A;  5FKN A;  5EZG A;  3LNQ A;  2H8R A;  2E2H J;  5JLX A;  2HXI A;  2L9R A;  1LE8 A;  1ETK A;  1OFC X;  4A3K J;  4BY1 J;  3F0C A;  4JX5 A;  1RET A;  1ETO A;  3JRB A;  4QSH A;  2XGC A;  3ZQF A;  2JA8 J;  1FTT A;  5IP7 J;  2LKX A;  2Y9Z A;  1FIA A;  4S0H B;  2XB0 X;  3IH4 A;  4C2M J;  1OJL A;  3FKI J;  1BW5 A;  2XRL A;  3SJM A;  3OSF A;  3JRH A;  1ZR4 A;  1U9O A;  3UKG A;  2HOS A;  4XRM A;  3BR1 A;  1OCP A;  5BNG A;  4FE7 A;  3RZD J;  3HDD A;  3L1P A;  4DZP A;  5C4J J;  4UUS B;  2EBI A;  3Q0V A;  1ETQ A;  1MNM C;  1GUU A;  1HOM A;  2KT0 A;  4JX4 A;  2X9D A;  3HM5 A;  2KDZ A;  1E3O C;  5J1Y A;  1Y1V J;  5EZH A;  3I4M J;  2XPV A;  2LK2 A;  2DA6 A;  2HQ5 A;  3HEF A;  4RBO A;  3OSG A;  4GFB A;  1U78 A;  5EG0 A; 
#chains in the Genus database with same CATH topology
 1TW2 A;  1R71 A;  1GV5 A;  4A3L J;  4Q48 A;  2Y0S A;  3DTI A;  3JRD A;  3QU3 A;  1T2K A;  4J00 A;  2ZJR F;  5H6R A;  5FRO A;  3F72 A;  1LDJ A;  3GLX A;  3W6J B;  3GFM A;  2HXO A;  5LD2 C;  3SZG A;  2WV1 A;  2AXL A;  3F6O A;  5FO5 A;  1FLI A;  2B63 J;  3GZN B;  3L9F A;  2HPM A;  2A61 A;  2X6Y A;  5LGU A;  3CUQ B;  1FBU A;  4IHW A;  5GAG J;  3Q9S A;  4DQ2 A;  1GDT A;  1ZAR A;  5J1R A;  2IEK A;  3PUB A;  3TO9 A;  5D8K B;  3J80 K;  3S3M A;  1A6I A;  2EZH A;  4ZYD A;  5FKM A;  1ZH5 A;  2M7A A;  2A6T A;  4BAY A;  4GO1 A;  1ZTR A;  3PQK A;  1U8R A;  2VJ5 A;  1VQN I;  1MIJ A;  1AA7 A;  5D6F A;  5IYB J;  1NK3 P;  3ZN1 A;  3K1M A;  2RKH A;  4YEJ A;  2DA1 A;  2HDC A;  2BE5 F;  3MKY B;  2V79 A;  1WQ2 A;  5ICG A;  4IVN A;  3OYG A;  2OTJ I;  1Y8Q B;  4UNO A;  4B43 A;  2K7L A;  2Z16 A;  4YIR X;  1VQ6 I;  2EIJ H;  2VT2 A;  4EQQ A;  4KYW A;  4I0A A;  5IYC J;  4JOM A;  2DPD A;  2E35 A;  1R00 A;  4I02 A;  3WHB A;  2R7R A;  2MC4 A;  2XAG A;  3FBN B;  2E36 A;  5HS8 A;  1HCR A;  2DFI A;  5IOZ A;  1WGX A;  2JA6 J;  3OYN A;  4A0Z A;  3OYI A;  4WXH A;  3WU0 A;  4LOC A;  3HUG A;  2NOG A;  3AKZ A;  4A0X A;  5BS6 A;  2RNG A;  4I0B A;  1HW2 A;  2CUJ A;  2GZW A;  3I55 I;  2LG4 A;  4WK8 F;  5FJ8 J;  3HZJ A;  2IP2 A;  3C7J A;  3DP7 A;  3HRU A;  4QWQ A;  5JFR A;  3JRE A;  1IUY A;  2OPT A;  2P4W A;  2LTP A;  4A12 A;  3O8G A;  1K78 A;  2O6G E;  3BRO A;  1E3P A;  4M3E A;  4UXN A;  1QVT A;  1OR7 C;  4XLC A;  1DGW Y;  2DQL A;  1S7E A;  2EIL H;  3QAH A;  1XG1 A;  1MBK A;  3OYC A;  4BYY A;  2MH9 A;  5F6F A;  5FKL A;  2IAI A;  3F21 A;  1MZB A;  1SAN A;  2DA7 A;  2GAU A;  1ZLK A;  1G3Y A;  5DM7 F;  1TP4 A;  2YR2 A;  4PGH A;  2VJ4 A;  3DF8 A;  1G3T A;  5H2F C;  5GP9 A;  2E1C A;  3L2U A;  2HVR A;  3IHU A;  4DBQ A;  4KMF A;  5LGN A;  4D7M A;  2Q0O A;  4IO9 F;  2W1O A;  1P2F A;  1V5F A;  3E6M A;  1ZRD A;  1NH3 A;  3V8L A;  2M34 A;  3F22 A;  2QSG X;  5EYR A;  1K6O A;  1BL0 A;  3CF2 A;  2HTS A;  4M74 A;  1E17 A;  4B1R A;  3AFH A;  3CTA A;  4OWR B;  2DPU A;  2ZC2 A;  2GXB A;  1JJ6 C;  4ENJ A;  3LA2 A;  1KQ9 A;  4DZJ A;  1Y0N A;  3A0B C;  4HNU A;  5LBQ A;  2K85 A;  1B8I A;  3DXJ F;  5GAE J;  1FP1 D;  3K6G A;  1L3L A;  1V5E A;  3DQV C;  1LUJ B;  2A6H F;  1WJ5 A;  1D5Y A;  3RPU D;  4EAT A;  2M4G A;  2YU9 J;  4EV0 A;  4HDV A;  1MSE C;  4A69 C;  1TWA J;  3CDL A;  4EJU A;  3TDU C;  3L2Q A;  2RVC A;  3K4C A;  4HRI A;  1SEU A;  1RKT A;  2FMY A;  5JVT A;  1VQ8 I;  2VPL A;  1GLN A;  1UG0 A;  2R7W A;  2BVM A;  3TKY A;  2PI0 A;  1ENH A;  4C2U A;  2PBI A;  4B3A A;  4D5F A;  2ZJ2 A;  5B1B H;  4G7Z F;  1U0J A;  4M3F A;  3A1Y A;  3JSP A;  1W7P B;  3BOQ A;  3PFI A;  4D9J A;  2DYS H;  3HSF A;  1U9N A;  4ZYA A;  3VWB A;  5AIQ A;  4AWX B;  1HQC A;  3CJQ B;  1IDY A;  5HS7 A;  3SFI A;  2QZ8 A;  2LF8 A;  1QU3 A;  2A6E F;  1W5C C;  2XDV A;  1FMW A;  1UG2 A;  3FXJ A;  5ICF A;  1I50 J;  1IN7 A;  3OYJ A;  1XDS A;  3S3O A;  3QQA A;  1OCT C;  4XK4 A;  1TQP A;  3N97 A;  3HGG A;  2V6C A;  1U2W A;  1G8X A;  2TDX A;  3CCY A;  1J7K A;  5GPA A;  2QEN A;  4XSX F;  4MO7 A;  1UHM A;  2KJC A;  4QPQ A;  2VJI A;  4B09 A;  4M6V A;  2A68 F;  2KZG A;  2W00 A;  2WAE A;  3B6C A;  4XLH A;  1BR1 A;  3G6E I;  1B72 A;  3ZMU A;  3WU2 C;  4CCK A;  1UZC A;  4A3G J;  1D1B A;  2COB A;  1LDD A;  3HOU J;  2WAF A;  4RM3 A;  3WU1 B;  2R5Y B;  4EM2 A;  3ZMT A;  1VQO I;  3I4N J;  3BPV A;  4C9Y A;  1MMA A;  2OJE D;  3OOU A;  4XM3 A;  3BPX A;  1APL C;  4O6J A;  1FEX A;  4EJW A;  1W5S A;  3EPZ A;  2NRA C;  4RGX A;  1ONV A;  1TL8 A;  1I3A A;  2H6B A;  4PGG A;  2IS6 A;  2FSW A;  1JHF A;  1ITY A;  3VYR B;  5B3S H;  1XSD A;  3KCC A;  2MGQ A;  3PJR A;  3KP4 A;  4G8X A;  1ON2 A;  1U5T C;  2LRD A;  1XSX A;  4OMZ A;  1Z77 A;  2F2E A;  1HA8 A;  2FOW A;  3BG5 A;  1LVA A;  2G0E A;  1ZQ3 P;  5M3M J;  5IT3 A;  3VPR A;  1KU3 A;  3K4L A;  1Z21 A;  1MBH A;  2XF7 A;  4W97 A;  4EJT A;  2XB5 A;  4Z6Y A;  4F93 B;  4L5E A;  5ILS A;  3TO7 A;  2BEO A;  1XD7 A;  2IJL A;  1XC5 A;  4MLO A;  5GTH C;  5AIP A;  2M2E A;  3MKW B;  1FYM A;  2O9L A;  1R58 A;  3BTL A;  4XRS A;  2R7S A;  3QOD A;  4ESJ A;  4ABZ A;  2AQE A;  3ML6 A;  1MJA A;  3BJA A;  5EEG A;  3VOE A;  2DDA A;  2MD0 A;  3FZV A;  1CQT A;  1QGP A;  4BEH A;  3GEZ A;  5KHD A;  2ZB9 A;  5LLQ A;  2ZO4 A;  3CZ6 A;  4FTH A;  4KT5 C;  1TWG J;  2M7B A;  5L3D A;  1X1P A;  4RB2 C;  2D45 A;  5DEQ A;  4JBA A;  3UNG C;  3GBG A;  2PJR B;  3F6V A;  1TLH B;  5EGO B;  3K70 C;  2NVX J;  2L9V A;  2QF7 A;  3OYF A;  3HYI A;  2Y75 A;  3LFU A;  1O4X A;  5FGM A;  2VKH A;  2FQ3 A;  3SHF A;  2W82 A;  3MKL A;  4ZYE A;  2EFW A;  2E34 A;  4XLA A;  2JUC A;  2KIF A;  1A31 A;  3D5S C;  2HDD A;  2R93 J;  4YRV A;  1JT0 A;  1SVL A;  3WTT C;  2Q1Z B;  2H27 A;  2ME6 A;  3ABU A;  1WJF A;  2G7H A;  4AU7 A;  2FOK A;  4AVP A;  1W7P D;  2VKV A;  2X48 A;  1MDM A;  3CCL I;  3M4O J;  5B1A H;  2KRF A;  1LKX A;  1EH8 A;  2RRE A;  3WTY C;  2K9L A;  3MWM A;  3G4S I;  1IXS B;  2DA5 A;  2VQL A;  3E3V A;  2ICW G;  3MZ8 A;  3BCA A;  5FKO A;  1BJZ A;  3BR3 A;  4E7J A;  4L9N A;  2JN6 A;  4IKF A;  2GXA A;  1Z7L A;  3M1E A;  3CCM I;  1IGN A;  3DPU A;  2ELH A;  1X1D A;  3BDD A;  3BWG A;  1UST A;  4XLF A;  2BY1 A;  2JRM A;  3H1C A;  3HPG A;  2VE8 A;  3U1D A;  2O8K A;  1XGM A;  1X2N A;  2EZK A;  2ETH A;  4G9Y A;  5LRS A;  1IG7 A;  3E6D A;  3OYL A;  3CCQ I;  4C2T A;  4XRF A;  4D0P A;  1MMG A;  3DFG A;  3EUK L;  5GAH J;  4IX7 A;  2PG4 A;  1Y0U A;  1ZRC A;  2EH3 A;  1POG A;  5J8C A;  2LVS A;  1PVE A;  2VC1 A;  2KL4 A;  2DI3 A;  3RPU A;  1A5J A;  5KAI C;  2JMW A;  3C3W A;  3DBH B;  3CUQ A;  5E8I A;  2Y0S N;  1OCZ H;  2EFP A;  1OCO H;  2KKO A;  4BDY A;  2ZNZ A;  3DBR B;  2JQ7 A;  1T39 A;  3B6A A;  3T8R A;  1RNL A;  1WJD A;  5CYV A;  3JRA A;  2XAQ A;  5KAF C;  3CC7 I;  2OU2 A;  1Z6T A;  3RZO J;  3E6B A;  1SVO A;  1VQM I;  1USS A;  1E3H A;  3MD2 A;  3VOD A;  2CUF A;  1O3S A;  5K5Q A;  5K1Y A;  1LB2 A;  1RI7 A;  5F1J A;  4ZC3 A;  2OD5 A;  2DQR A;  2YX4 A;  3LSP A;  1UEL B;  2ECB A;  5DUK A;  2F5C A;  4IQJ A;  2H09 A;  2LLK A;  2F5F A;  3RPQ A;  2IXS A;  2HWV A;  3ZMD A;  3B73 A;  3CLO A;  3O6B B;  3VSL A;  2M5W A;  5LGT A;  3B02 A;  2R7X A;  1V54 H;  1HXD A;  3L2V A;  1S7O A;  2QKM B;  1F36 A;  1IF1 A;  1ZRF A;  4GYI A;  3BTJ A;  3AG2 H;  2MSY A;  2CRG A;  4EVI A;  1MMS A;  1IRF A;  4A5N A;  1Y39 A;  4UVB A;  2CH0 A;  2I10 A;  4JK1 X;  1S3J A;  3LNQ A;  1FYL A;  4HSR A;  3JAM K;  1MJ9 A;  3C18 A;  4O3M A;  2FBK A;  2HQR A;  2XF6 A;  5IY5 H;  3F0C A;  1MW7 A;  3OYB A;  1SMT A;  2L02 A;  2R7V A;  4NC6 A;  4S04 A;  5LHH A;  3GFI A;  4NUB A;  2KJB A;  2W57 A;  1ZG5 A;  1FTT A;  1KZH A;  4I01 A;  3IWZ A;  2HS5 A;  2Z99 A;  3IH4 A;  4C2M J;  2VOO A;  2DYR H;  5E8G A;  2DAO A;  1FZP B;  3SJM A;  1FPQ A;  1ZEL A;  1RRJ A;  1G59 A;  3I3L A;  3EYY A;  3KP6 A;  3D0S A;  2DTR A;  1IAW A;  4Y15 A;  5CLS A;  4OOI A;  2WA0 A;  4YII A;  5FRN A;  3BJ6 A;  1LVK A;  2F48 A;  4BGD A;  1GUU A;  3IAM 2;  3U2R A;  4HF1 A;  2A5W A;  2X9D A;  3HM5 A;  1E3O C;  4BH9 A;  1Y1V J;  2XPV A;  3R6S A;  2KQR A;  4RS8 A;  1IN6 A;  3H9Q A;  2NYX A;  3E5Q A;  3P9C A;  4E7H A;  5BMZ A;  1J59 A;  5DM6 F;  4RGU A;  2BYV E;  5J47 A;  3PFY A;  1U6G A;  3ZMS A;  2ZFW A;  2JSP A;  4E6K G;  3V8K A;  2JJ7 A;  1G3S A;  2HFH A;  4BHC A;  4BHP A;  1S5L C;  2WTE A;  2WV0 A;  3ZQC A;  3VDX A;  5D4R A;  1R6R A;  1D1C A;  4IHY A;  2GLO A;  1XMA A;  4DBR A;  2IS2 A;  3E5U A;  4BQN A;  1X2M A;  2CGP A;  1ETX A;  2CFO A;  1TT0 A;  1V4R A;  2RGV A;  2VBY A;  4NBQ A;  3F8C A;  2YPR A;  3ZQH A;  1ZN2 A;  1BBY A;  3PIP F;  3E1S A;  2LRE A;  4XN0 A;  2L7F P;  4IXA A;  2M30 A;  1JTY A;  5CVR A;  2DMQ A;  2RN7 A;  2MAB A;  1WFX A;  2M3A A;  3LQQ A;  5TRD A;  4P9U A;  1G6N A;  1W7P A;  2PX9 A;  2NS7 A;  3GCM A;  3I5U A;  2Z9O A;  3MN2 A;  1WH7 A;  5CVU A;  3JRG A;  1XN7 A;  5J4Y A;  4IRH A;  3VB2 A;  2CO5 A;  2P0W A;  2P7C B;  5M3F J;  5FLV A;  4HLY A;  2W25 A;  3GZ5 A;  3VSK A;  2GOM A;  3JW4 A;  3MMY B;  2HQN A;  1IUF A;  5FFZ A;  4PUS A;  2VPR A;  2GA1 A;  4EMS A;  3PQJ A;  3HRS A;  3I9V 2;  3K4K A;  4YFX F;  2GM4 A;  3BTI A;  4BQQ A;  5ILU A;  1OR7 A;  3EUH A;  1TC3 C;  3S17 J;  4U0V A;  1I39 A;  3GLL A;  2ZME B;  5K5O A;  4I7H A;  3ZMV A;  2JK3 A;  3H5N A;  3ZPL A;  4CXF A;  3TED A;  4CHU A;  3IP4 B;  1J09 A;  3JRF A;  1QHH D;  1PJR A;  1MND A;  4PSW A;  5IP9 J;  3WTU C;  2VOP A;  4N0B A;  2M4K A;  2DT5 A;  4KFC A;  3BY6 A;  5HLT A;  2R5Y A;  2FBH A;  1B59 A;  1UCR A;  2K9S A;  2PMU A;  5E20 A;  1Z3X A;  3H3Z A;  3BP8 A;  1JKP C;  1BOA A;  4HNV A;  5FFX A;  1RR8 C;  2V6E A;  3FHZ A;  3KET A;  3HOX J;  3P7N A;  4CYD A;  1FC3 A;  4KN4 X;  2BHZ A;  5FD5 A;  1R36 A;  3REO A;  2MLK A;  2JPC A;  2ZXJ A;  1FSH A;  1XMX A;  2XAH A;  2LR8 A;  4GXO A;  4M3G A;  3JTG A;  3CMY A;  5CVJ A;  2LOO A;  3DPT A;  3FIS A;  3J81 Z;  5LEJ A;  2CMP A;  1XS9 A;  4X0G A;  3OIQ A;  4OIO F;  4XSZ F;  4AIH A;  3PM1 A;  2VBW A;  2HGC A;  4I2O A;  1QA6 A;  3MVP A;  1BI0 A;  4U7D A;  5LHG A;  4BKX A;  3BR6 A;  1RC9 A;  1XCV A;  4U7B A;  4BNC A;  2OF7 A;  4AYB N;  5F0C A;  2X1D A;  3V42 A;  3HGY A;  1SFX A;  3K4M A;  3HSR A;  2DMN A;  3G1L A;  1WKM A;  3K1P A;  4J01 A;  3HB9 A;  1REP C;  1A04 A;  3O8H A;  5H20 A;  3A02 A;  3DPL C;  1YJ9 I;  4RB1 A;  2LC2 A;  4MIM A;  3RIR A;  4Q5S F;  5EG0 B;  1PP8 F;  3TMO A;  2LY9 A;  1P6R A;  5EGO A;  2JRT A;  4LFU A;  4B44 A;  3BC8 A;  2L54 A;  1UAA A;  4ZDO A;  1PUF B;  3K1N A;  1XMK A;  1OYW A;  2M0C A;  3TP0 A;  4XL9 A;  3RKX A;  1MMD A;  2X6X A;  5D5X B;  4BS9 A;  2BY0 A;  2XKO A;  3G3Z A;  1R9T J;  3RI4 A;  3KFW X;  2F4O B;  1ACI A;  4B4C A;  1E2X A;  2Z5U A;  3GZ6 A;  1CF7 B;  3K4J A;  4M9S A;  1TTY A;  2HYG D;  3FXO A;  2H8W A;  2R4G A;  4V19 K;  3RCO A;  4N9I A;  1PYV A;  2EFQ A;  4ESB A;  4A5M A;  2K9Q A;  4UVC A;  2FNA A;  2L2O A;  2O8X A;  5HOD A;  1KYW A;  4A3J J;  5JHF A;  3K2A A;  1R49 A;  4MTE A;  1EA3 A;  1XCB A;  3FF5 A;  2BY2 A;  2DMU A;  2ZFU A;  1ETY A;  3M8F A;  2MA3 A;  4LLL A;  2CQ7 A;  1YLF A;  5L3E A;  4ENN A;  1UB9 A;  3CUO A;  1WJB A;  2QQA A;  4XLE A;  2CS3 A;  4LJZ F;  1O7F A;  3OYH A;  4IJA A;  5CJ9 A;  2WAD A;  3CCU I;  3NWT A;  1GVJ A;  2P5K A;  1P7J A;  4XOT A;  5J40 A;  4DYQ A;  2ZXH A;  4S05 A;  2JA5 J;  3FKJ A;  4IOC F;  1A6Q A;  1FOW A;  1EF4 A;  1SFE A;  2PMZ A;  2D1V A;  3ZQQ A;  2MYS A;  2OCC H;  2ZCW A;  4M3B A;  1U8B A;  2DJI A;  3RYP A;  3S1Q J;  2IA2 A;  4GCV A;  3WTS C;  1Y56 A;  3QYF A;  3KLN A;  2WB1 N;  4AUX A;  4BXU A;  1LPQ A;  4CUG A;  2FA5 A;  3C1D A;  4XRS G;  1JKO C;  5H6Q A;  3HSE A;  1W0U A;  3CD6 I;  2NAZ A;  1BOB A;  4MFE A;  3Q5F A;  4E70 A;  1W1W E;  3ABM H;  3HPH A;  1R5G A;  5E3N A;  1HST A;  2DOE A;  2HOA A;  3ISP A;  1KQ8 A;  3AAF A;  2HYJ A;  4U0W A;  2KRC A;  1X1C A;  2LSO A;  1P4W A;  2Z3Y A;  4L9V A;  2NVY J;  5EDN A;  1R1T A;  2PEX A;  4MEY F;  1K6Y A;  4HYE A;  1ZK8 A;  2DDB A;  2DTZ A;  2A05 A;  2DK5 A;  3BG6 A;  2O3F A;  3L7W A;  1X4O A;  2BXY A;  2HQA A;  1NG7 A;  2V1X A;  2VOD A;  5E3M A;  2O61 A;  3RDI A;  3H9J A;  2ZNY A;  2MW8 A;  1R1V A;  2XF5 A;  3BR0 A;  3FXQ A;  5DS9 A;  2ZJP F;  1HLV A;  4LIV A;  2CV1 A;  1YS7 A;  4DGW B;  2VN2 A;  3I54 A;  2DMT A;  2EFN A;  3HJE A;  1FP2 A;  4HV6 A;  4UB8 C;  3IH2 A;  3BLY A;  2MH2 A;  2GA2 A;  3ELK A;  4LG3 A;  4DIQ A;  2QSH X;  3HIF A;  2EA4 A;  4CO8 A;  1RPW A;  1K83 J;  3HHG A;  3GYH X;  3R0A A;  1IRG A;  1YYV A;  2EWN A;  3H36 A;  1Z7U A;  4HA8 A;  3GTP J;  2R7Z J;  2WY7 Q;  3MZH A;  3CCS I;  3LFK A;  3S2D J;  1ZGA A;  2GIZ A;  2Z1D A;  2JWT A;  1FOY A;  1R4M B;  2EV5 A;  3V7C A;  1Z05 A;  1KGS A;  2NS8 A;  2FF4 A;  3DWL E;  3I0T A;  4FHT A;  4LLG F;  2XRN A;  1MBE A;  2LFB A;  1X19 A;  1ZGW A;  2VL8 A;  2TCT A;  3BG7 A;  3GW2 A;  1YIT I;  2X51 A;  3WTV C;  5J6X A;  2CU7 A;  2NVU B;  2Y69 H;  3CCV I;  3KEY A;  1BIB A;  2F5V A;  4BE2 A;  3ECH A;  2FE3 A;  3Q0U A;  1Q1H A;  5ICC A;  1LFB A;  3I64 A;  1XGS A;  1B9N A;  3BQY A;  3IKT A;  3R61 A;  2W24 A;  4V2G A;  4AIK A;  2D1H A;  3HOS A;  4IF4 A;  2DO7 A;  3BG9 A;  1MSF C;  4P55 A;  4F92 B;  2XHK A;  3KP7 A;  3CDI A;  2ESH A;  4ZTJ A;  2HZT A;  3T0Y A;  1HC8 A;  4RM2 A;  2P8T A;  1JHH A;  1VI0 A;  3ZN0 A;  4XKB A;  3CCR I;  1U3E M;  1H8A C;  2P81 A;  3I53 A;  3R60 A;  2MC3 A;  2W84 A;  2X4H A;  1KON A;  4OAY A;  3ZQI A;  1JUS A;  1PP7 U;  3W6K B;  3KYD B;  2EA2 A;  3PO3 J;  3LSG A;  1X58 A;  4CIC A;  3S16 J;  2UV1 A;  3CJR B;  3H35 A;  3FM3 A;  4G6D A;  5F04 A;  2STT A;  4WCG A;  3IWF A;  3FK7 A;  4CH7 A;  2DA3 A;  3FHN A;  1SAU A;  1KU7 A;  5CPR B;  1T08 B;  4Y33 A;  1BM9 A;  4MNU A;  2F4I A;  1TNS A;  3HOZ J;  3CP2 A;  2DN0 A;  3PL8 A;  1MGT A;  3O2P E;  3D5L A;  4A0Y A;  4I76 A;  2EIM H;  4A3D J;  2L7K A;  1X1B A;  3OYD A;  2STW A;  4MTD A;  2GQQ A;  2Y30 A;  2KLO A;  4M71 A;  5BPI A;  4ESF A;  1A35 A;  5K7F A;  1Z0X A;  2ZME A;  3H3V K;  5EEH A;  3Q3S A;  2Y0M A;  2AXT C;  3C2H A;  1IN4 A;  2V4J C;  1ZKG A;  1SD5 A;  3HOY J;  4M9X A;  2ESN A;  2ZKZ A;  3NWS A;  2DFF A;  2FQ4 A;  3DKW A;  1D3Y A;  3VFZ A;  2I8D A;  3KX2 A;  3AL0 C;  4FAS D;  2M8G X;  2Y2Z A;  3K2Z A;  1AHD P;  1S6L A;  1OQY A;  2UUZ A;  5JLX A;  3MFK A;  3OL3 A;  3R0J A;  3KP2 A;  1ETK A;  1OFC X;  2OBP A;  2XGX A;  1HW1 A;  5DCM B;  1QNT A;  2OZU A;  2OCE A;  1IXC A;  2A5Y B;  1J5Y A;  2JA8 J;  3G2B A;  3KP3 A;  5IP7 J;  2VQG A;  4ON0 A;  2W7N A;  3BJO A;  2Y48 A;  4Y4R A;  3HTU A;  2XRL A;  2V1U A;  4II3 A;  3OSF A;  3ERM A;  3JRH A;  1IRX A;  1U9O A;  1ZR4 A;  2QVO A;  4E4H A;  4KDP A;  2IGO A;  3IC7 A;  2VXD A;  1Y8R B;  3RZD J;  4PJ0 C;  3L1P A;  1IV8 A;  2OQG A;  1A36 A;  4M6X A;  1ETQ A;  1DP7 P;  5JR3 A;  1HOM A;  3DKY A;  2DT7 B;  2KP6 A;  3GWZ A;  4JX4 A;  2KDZ A;  1N77 A;  3I4M J;  3IUO A;  2XRO A;  3W3C A;  4RBO A;  1Z3Y A;  3OSG A;  3K69 A;  3HXL A;  1Z67 A;  2W4S A;  3PIO F;  1IW7 F;  1OCC H;  5EG0 A;  1P4X A;  4RGS A;  2ISY A;  4XMY A;  1BI2 A;  3E7L A;  3WE3 A;  4F55 A;  2A3S A;  2QBY B;  1EH6 A;  4BQA A;  3KEO A;  4RAF A;  3GTG J;  3IV5 A;  2XSD C;  1PUF A;  1EJ9 A;  4ZZD A;  1D0Y A;  2NNN A;  3LSJ A;  1U5T B;  2E7X A;  4ZDL A;  2CQQ A;  1MH3 A;  2N8G A;  3H3U A;  1XB4 A;  1J2X A;  4MQ9 F;  2KHM A;  4XID A;  1DPR A;  1I1S A;  2K3F A;  4XNF A;  4AID A;  2XIG A;  1IXR C;  3JCU C;  2VQH A;  3JRC A;  5HDN A;  3CC4 I;  2HEO A;  4U88 A;  1CF7 A;  2BGC A;  4EGY A;  1SD7 A;  2B7E A;  4WXD A;  4LGW A;  4CA0 A;  3OYM A;  2FUG 2;  2K27 A;  3KP5 A;  2L01 A;  4XR6 A;  3DLL F;  2K5C A;  1IO2 A;  2RNJ A;  1QPI A;  1RR7 A;  2J5P A;  4PJM A;  3KLO A;  3UR3 C;  4LMY A;  1WH5 A;  5HOO A;  3OY9 A;  2R92 J;  3ROU A;  2VI6 A;  4B3X A;  1TNT A;  2NXN B;  4WXC A;  2K40 A;  4BAC A;  2L9N A;  1X3W B;  2QGU A;  4BHB A;  3IKV A;  1UJ8 A;  4RLF A;  4UUV A;  4X6A J;  2E1M C;  2QLZ A;  4UVA A;  4MQV A;  1ULY A;  4F3Q A;  2FX0 A;  2NVT J;  3BZC A;  3HBL A;  1XSV A;  1Z91 A;  1MH4 A;  2H94 A;  4LIT A;  1JI8 A;  4ZH4 F;  2HOT A;  2CUE A;  4G7O F;  3W2A A;  3P9K A;  3H0D A;  1GXQ A;  1YJN I;  1JKR C;  2XSJ C;  1BR4 A;  1BC7 C;  2M9H A;  5L3F A;  4PFP A;  1HDP A;  4OU0 A;  4NQW A;  1TBX A;  1LE8 B;  2XC7 A;  2BVL A;  3TOB A;  2LYC A;  2NVQ J;  3PO2 J;  4XLP F;  4IHS A;  4FT8 A;  5DD4 A;  2EPF A;  4Y3O A;  4ZDP A;  4V2F A;  2CG4 A;  5BOX A;  1GXP A;  3HOV J;  4EJO A;  1GVD A;  1FSE A;  1T33 A;  1NHA A;  2E5Z A;  5E17 F;  3A4C A;  1WWX A;  1V3F A;  3IH3 A;  3KE2 A;  3CC2 I;  3IL2 A;  3FXL A;  1DGR M;  4CCN A;  4PJJ A;  3NAR A;  2DA2 A;  4DJA A;  5M5X J;  3LSR A;  3BTC A;  2KFD A;  3F8M A;  4DW6 A;  4EJV A;  1P92 A;  3OL4 A;  1IV6 A;  1MKM A;  1RUN A;  1Y6I A;  3QOE A;  3WTX C;  5TGT A;  5TJJ A;  3H92 A;  2E19 A;  3DBL B;  3U9G A;  5J1U A;  2ZBK A;  3I4P A;  3CMM A;  3HKZ A;  1HDD C;  2ID3 A;  4I98 B;  3CES A;  4PDK A;  3ERE D;  1J75 A;  1BW6 A;  1SC7 A;  5KVR A;  2L4M A;  1FTZ A;  1MBF A;  3LST A;  3OYA A;  2D2W A;  4FE4 A;  3S93 A;  2KDO A;  5DTD A;  2NNY A;  3WTW C;  4LLN A;  1S9H A;  4M3D A;  4J19 A;  3JSO A;  2ZSH B;  2Z2S B;  3QYB A;  3MKZ A;  3SXY A;  1FY7 A;  2OAZ A;  1RES A;  3M8E A;  2M1B A;  1X1A A;  1HW5 A;  4C3H J;  3FMR A;  1KU2 A;  5HNH A;  3NQO A;  3FXR A;  4LIU A;  4IEJ A;  4GYG A;  1I1G A;  4H4K C;  3SEQ A;  3OWT A;  2VUM J;  4QTR A;  2YU3 A;  1B4A A;  3G73 A;  2F4M B;  2DOA A;  1LEB A;  2XGD A;  2VLA A;  4FCY A;  4UHT A;  1Q1V A;  1BJA A;  4UV8 A;  2R0Q C;  3J7A Y;  2VE9 A;  1LNW A;  4KUM A;  3CF5 F;  4UUS A;  3FWE A;  5B66 C;  1W36 C;  1D0X A;  2E2I J;  1YFH A;  1LDK B;  2ME0 A;  3ESW B;  4A6E A;  4BL0 B;  3DV8 A;  2VQC A;  5E3L A;  2IRF G;  3CCE I;  1WCM J;  4NDL A;  4DYR A;  1YIJ I;  2VON A;  2ZJQ F;  5D5U B;  1VQ4 I;  3LOC A;  2HTJ A;  1J9I A;  2VB6 A;  4I6Z A;  3L2R A;  4CDG A;  5ED4 A;  3J81 K;  2OQR A;  1CGP A;  2LP0 A;  2GWR A;  4EM0 B;  4KA4 A;  1YI2 I;  2CV0 A;  3AG4 H;  3ZRG A;  1WSU A;  4MHG A;  3GXO A;  3D1N I;  2W85 A;  2YX7 A;  3QRF F;  2L7Z A;  2L9S A;  3OMY A;  3K70 D;  4A2U A;  4CCL A;  2UWM A;  2WBM A;  4KT6 A;  2E1O A;  1WHU A;  1Z9C A;  1DDN A;  3N05 A;  4KIS A;  2DU9 A;  3ZGK A;  5A2Q K;  4UY8 I;  1QHG A;  4XKV A;  2ADU A;  2EJR A;  2A69 F;  2VAS A;  3CP8 A;  1QPM A;  4PJL A;  3LAJ A;  3BZK A;  4CZC A;  1G4D A;  1R23 A;  5LHI A;  1JT6 A;  3K10 A;  1D1A A;  2PLY A;  2EK5 A;  3M8J A;  3CCJ I;  5D4S A;  3AG1 H;  2EV6 A;  2K3P A;  3GO5 A;  3M7G A;  4MFD A;  1VQ5 I;  4IHT A;  2IS4 A;  4HF2 A;  2IVM A;  2R7U A;  3L00 A;  3NEU A;  3GTK J;  3GTL J;  1ZG1 A;  5JI6 A;  3J7A O;  1B9M A;  2QA4 I;  4H0E A;  3M9A A;  3SQN A;  2OV7 A;  3TW7 A;  5IOY A;  3CO6 C;  2QM3 A;  1HF0 A;  3ZCO A;  4Q47 A;  3CME I;  4UB6 C;  4E7I A;  2LDU A;  3M3Y J;  3BT9 A;  2ID6 A;  2LF7 A;  2JSC A;  2EZI A;  4IOA F;  5D8L B;  3GFJ A;  4AC0 A;  3GUD A;  3M1C A;  2WAQ A;  1WVR A;  2K4J A;  3A0H C;  4C3I J;  5AON A;  3ZMZ A;  3VEP A;  3COA C;  3KIO A;  5HDK A;  4M9Z A;  3ZOB A;  2DBB A;  2FBI A;  2ACJ A;  1J0R A;  2P5V A;  3DEU A;  3ONQ A;  3GME A;  5FKK A;  3CUQ C;  3ZR8 X;  1B1B A;  5CKT A;  4KIC A;  1AOY A;  3GTM J;  2H1L A;  2XV4 S;  3FBI B;  4IPA A;  3CJT B;  4OIR F;  4YIF A;  3MQ0 A;  5A2Q Z;  2CQK A;  2EQR A;  3PUF A;  4IHV A;  3QWL A;  3DTE A;  1R5I D;  4NHJ A;  2ECC A;  4AVZ A;  3RKW A;  3QOP A;  3WOD F;  4A3B J;  5DCM A;  4C30 A;  4HNT A;  2JT1 A;  5C44 J;  3DEE A;  5LRR A;  1LQ1 A;  3QPH A;  3R4K A;  1DUX C;  4Z2Y A;  3GTO J;  2E5N A;  1Z1D A;  3AG3 H;  4XQF A;  4LK0 F;  2AS5 F;  3V4G A;  5L3C A;  1ZR2 A;  3LWF A;  2VXZ A;  3Q0W A;  4BE0 A;  4PCQ A;  2HVS A;  4Y52 J;  3L2W A;  2NS0 A;  4HQM A;  3BR5 A;  1OMI A;  3KZY A;  1X4P A;  1BC8 C;  5ICE A;  3S15 J;  4JP0 A;  4NC8 A;  3BCB A;  4BDZ A;  5BPD A;  1UHS A;  4KIT B;  3I56 I;  1T8I A;  3A01 B;  1FBQ A;  1JUM A;  4ENM A;  1RZ4 A;  1VQL I;  1Y1W J;  3W6V A;  1NTC A;  4FX0 A;  2L7M P;  3N4M A;  5DUI A;  1KA8 A;  2QEX I;  1H89 C;  3F8F A;  1T56 A;  2ZSI B;  5F0F A;  3JR9 A;  1IC8 A;  2Q2E B;  5HLH A;  2DA4 A;  4YFN F;  1DU6 A;  1IZ1 A;  1SVM A;  1GHC A;  1F4K A;  2DFE A;  3U21 A;  5DCF A;  1UMQ A;  4MGR A;  2WC2 A;  3C2G A;  1LFP A;  4LG0 B;  2MD5 A;  2QBY A;  3K9T A;  2F5E A;  4E7L A;  1T98 A;  3BR2 A;  2DK8 A;  3OOP A;  2FNP A;  1BN5 A;  3SDB A;  1U5T A;  2AHQ A;  3CDH A;  3HC7 A;  4GGG A;  4M73 A;  3S2W A;  4HAM A;  3TO6 A;  2FXA A;  3HHH A;  3J7Z I;  4BJ6 C;  2K86 A;  3FIW A;  3EQL F;  3J7Y J;  3M07 A;  2O03 A;  3FXK A;  2ELK A;  3QP5 A;  2ELJ A;  5D5V B;  4JQF A;  1VQ9 I;  1S29 A;  4Q4Z F;  4E7S A;  5FRM A;  3S1R J;  2LY2 A;  3Q9V A;  3S32 A;  5IT9 K;  1ON1 A;  3CQZ J;  1DU0 A;  4B47 A;  1E0E A;  2XAF A;  4E7K A;  1WJC A;  2XUB A;  2CW0 F;  4F91 B;  1W4M A;  4LB6 B;  4DOZ A;  2V26 A;  1JXS A;  4XON A;  2L0K A;  3WGH A;  5FD6 A;  1YIO A;  4CYC B;  4BXX J;  3S3N A;  2E2J J;  2JA2 A;  5DD8 A;  2DOF A;  3CO7 C;  2VC0 A;  3S1M J;  2AQF A;  1FX7 A;  1S72 I;  4NQW B;  3IRR A;  4N4N B;  3G1O A;  2OA4 A;  2O0Y A;  1W36 D;  4I99 C;  3VYT B;  2HVQ A;  3DEW A;  2QQ8 A;  4R79 A;  4G7H F;  1FOX A;  4FET A;  4EEF G;  4NC7 A;  2Z33 A;  2RV8 A;  3V8J A;  3OS1 A;  1T38 A;  4AM3 A;  4M6Y A;  5K7Z A;  1W0T A;  2QYO A;  3WHC A;  2L5Q A;  1NK2 P;  2HU9 A;  4O5V A;  3KZZ A;  2EZL A;  1T0F C;  4U87 A;  3A2K A;  2XPW A;  1TQI A;  1XGO A;  3QPL A;  2KRH A;  4KMU X;  4CZZ A;  1VQP I;  1HKT A;  4NB5 A;  5FKN A;  5EZG A;  1M1E B;  2E2H J;  3KEQ A;  4HQE A;  2IGN A;  1SFU A;  2HXI A;  2L9R A;  1LE8 A;  4LB5 A;  2XKP A;  4A3K J;  5KNL A;  2B0L A;  5KCM A;  1WRJ A;  1ETO A;  3BZ6 A;  1ZYR F;  1I6X A;  5E79 C;  1MJB A;  3DLA A;  1OLT A;  3ZQF A;  2GXG A;  4K2E A;  3SZT A;  2LKX A;  2VT3 A;  2QWW A;  1FIA A;  2KMU A;  3ECO A;  3EUH C;  3LSH A;  2DLL A;  1OJL A;  3MZY A;  1YTY A;  3FKI J;  5IT9 Z;  3J80 Z;  2GOX B;  5LFA A;  3DU6 A;  1R4N B;  4WX9 A;  3UKG A;  2BZT A;  2HOS A;  4XRM A;  2BW3 B;  3PNT A;  3X2Q H;  2RQQ A;  4OMY A;  1OCP A;  3HDD A;  4DZP A;  5C4J J;  5L3B A;  4UUS B;  3L09 A;  3RKY A;  1JE8 A;  4FQG A;  4F7Z A;  2IS1 A;  2R3S A;  1XDU A;  2JTV A;  3W2V A;  2KT0 A;  2OTL I;  1O7L A;  2DA6 A;  2HQ5 A;  3FMS A;  3HEF A;  2LKP A;  1IN5 A;  2E60 A;  4U0Y A;  1XPX A;  3OS0 A;  1YE9 A;  1FYK A;  5E1W A;  1U78 A;  4GFB A;  5F08 A;  3HKZ N;  5FLX K;  2KIS A;  3PNY A;  4XKW A;  2IA0 A;  2RC4 A;  4XLN F;  2Q8K A;  3MCZ A;  2IT0 A;  2PQ8 A;  1YQA A;  1V55 H;  2HR3 A;  2UXX A;  1MBJ A;  1R1U A;  1VTN C;  2MG4 A;  5EJC A;  3H0G J;  4GDF A;  1S7A A;  3C2B A;  2IW5 A;  2YUS A;  1X3U A;  2H1K A;  3PSI A;  3LAP A;  2LH9 A;  5M5Y J;  1XTA A;  2CJJ A;  2J5O A;  4B8X A;  1FIP A;  2OUM A;  1YW9 A;  2FD5 A;  3QP6 A;  3SZP A;  4UUT A;  5GPC A;  2R7F A;  4D7N A;  2R5Z B;  4DNC A;  3O3K A;  3KYL A;  3BG3 A;  5F64 A;  4BY7 J;  1TT5 B;  4C3J J;  3RTR A;  4P96 A;  1AKH B;  1YW8 A;  4PZJ A;  5L3G A;  2JZY A;  2EFO A;  3OR2 C;  4HLX A;  5JVG F;  2LY1 A;  1YRN B;  4BBS J;  2CQX A;  4YEL A;  1MNE A;  3I59 B;  5C4X J;  2LMD A;  4TV7 A;  2GIV A;  3ZQL A;  4KNY A;  1YS6 A;  2HKX A;  4CCO A;  3E6C C;  2BY3 A;  4A6D A;  2X6W A;  2CSO A;  1D0Z A;  2Y31 A;  3LSK A;  3F23 A;  1LJ9 A;  1D5V A;  4HST A;  2AO9 A;  5E18 F;  2JVG A;  2L4A A;  2V9P A;  4IL6 C;  5IP6 A;  1ETV A;  2CV2 A;  5F0H A;  3P5J A;  1TW3 A;  4R8H A;  5FLX Z;  3EYI A;  2FRH A;  4Y13 A;  3FK6 A;  1KQ0 A;  4RLQ A;  2JUG A;  3LSM A;  5BQT A;  1QVU A;  2TRT A;  3FM5 A;  1I5Z A;  1V5G A;  4HDU A;  3ULQ B;  1YX3 A;  3HOW J;  4AYB A;  1JJ8 C;  1WPK A;  4CGZ A;  3DCF A;  1QBJ A;  2HKO A;  4RA2 A;  2EB7 A;  4R1H A;  3K7A J;  3V7S A;  4XN3 A;  3LA3 A;  3K4N A;  2EV0 A;  3QYE A;  4KN7 X;  3F8N A;  5CVI A;  3VYS B;  3LMM A;  3PSF A;  4A3C J;  3KPH A;  4L5I A;  2LNB A;  4IRI A;  4A3M J;  1LFU P;  2PFB A;  4RAG A;  4P9F A;  4CSW A;  4WWC A;  2WY8 Q;  2E7W A;  4ZYH A;  1HKS A;  4RB0 A;  3VYU B;  2O7O A;  3RJP A;  2UZK A;  4D5C A;  2A07 F;  1NG6 A;  1WI3 A;  4HOB A;  4PFO A;  1JTX A;  4P1W A;  3GX4 X;  3ABK H;  2VBZ A;  4P5O A;  5E3O A;  2DFH A;  3IRQ A;  3BQZ A;  2WAQ N;  5E1X A;  5J4V A;  3ASN H;  2K4B A;  1G2H A;  5HLI A;  1F43 A;  1W5T A;  1QZE A;  1UFM A;  2H6C A;  3QPS A;  4LD5 A;  4I09 A;  2FJ1 A;  2EIK H;  1WI9 A;  5D6E A;  2CUZ A;  4D1Q A;  4QPO A;  4RAZ A;  2DMP A;  4KJZ A;  4B48 A;  1ZGJ A;  3W2W A;  2BBY A;  2QSF X;  2C6Y A;  3KYC B;  3WTZ A;  2E1N A;  1I6H J;  2DT6 A;  1JGS A;  1SFO J;  4CCJ A;  2R7D A;  5IYD J;  4L18 B;  1YG2 A;  1OYY A;  3GTJ J;  1HKQ A;  5GAD J;  2RAE A;  5DDG A;  4PSX A;  3DKX A;  2V7F A;  4XOP A;  4RDU A;  1SFK A;  5LEK A;  2QUF A;  2ZXW H;  4Y7N J;  4HX8 A;  2CWE A;  1ZRE A;  3OV8 A;  5JHU A;  1R5H A;  2VBX A;  1OIS A;  4ETS A;  3A01 A;  4N4O B;  5M5W J;  4OAZ A;  1H9T A;  2HPI A;  5EF6 A;  1SAX A;  3TL4 X;  1VND A;  1KU9 A;  3ABT A;  1OPC A;  3WGI A;  1ETW A;  1VF9 A;  2LBF A;  2MBF A;  3ASO H;  4G12 A;  1O3Q A;  3AL0 B;  2L3D A;  1AWC A;  9ANT A;  4L9J A;  5ILV A;  3NAU A;  2V1N A;  1QZY A;  2Q2E A;  3LQR A;  1HSJ A;  2HNH A;  3KZI C;  3MAJ A;  4HV5 A;  4RAY A;  3WGG A;  4OIP F;  3T5X A;  4YFK F;  4A3I J;  1YOV B;  2R7Q A;  1SD4 A;  1TWH J;  2ISZ A;  4BJ5 C;  2VIX A;  2V9K A;  1T6S A;  6PAX A;  1N25 A;  1F1Z A;  4LG0 A;  2OZ6 A;  2WB1 A;  1RUO A;  3CJN A;  2JA7 J;  3OYE A;  4A93 J;  4G94 A;  1IN8 A;  1DP3 A;  2VJJ A;  3T1B A;  2BV6 A;  2IBD A;  3TQN A;  3ZP5 A;  3RQ4 A;  5CVV A;  4BXF A;  1KYZ A;  1R7J A;  2OC6 A;  2QCO A;  2X1C A;  3OIO A;  4KIF A;  3PNV A;  2X6O A;  2RQP A;  1YHQ I;  4BE1 A;  1YO5 C;  2R7O A;  3I71 A;  3DTK A;  3K4B A;  4LK1 F;  3HRM A;  3HOT A;  2PJP A;  2DOD A;  2UXN A;  4Y17 A;  3H9G A;  1VFC A;  4E7Z A;  4FX4 A;  1QRY A;  1T95 A;  4HX4 A;  1FJL A;  4IZZ A;  3FX3 A;  5JLW A;  1R22 A;  4QLC U;  4G6Q A;  3HUG B;  2WWY A;  1STZ A;  2G7U A;  4CYC A;  2I5U A;  2HI3 A;  2MFZ A;  3RSN A;  2HZD A;  1MBG A;  1S8N A;  4A3F J;  4BU2 A;  1K79 A;  2P7V B;  3FXU A;  3WG9 A;  5HS9 A;  2COM A;  3RYR A;  3I58 A;  5K5R A;  3TDZ C;  2PN6 A;  4ZZL A;  1HBX G;  5CQE A;  4IRG A;  5HLG A;  2V1D A;  2D5V A;  3IAS 2;  1K78 B;  2PMZ N;  1VQ7 I;  2X85 A;  2FU4 A;  4II2 A;  3LL7 A;  3HRT A;  4N9H A;  3G71 I;  1BIA A;  2K9N A;  1BA5 A;  4UV9 A;  4ZYG A;  1JGG A;  1K7A A;  3ZQG A;  1P7I A;  4M72 A;  2P5L C;  2W48 A;  2BXZ A;  2IPQ X;  3F3X A;  4ITV A;  1IJW C;  2DXI A;  2P6T A;  2NOJ B;  1WJA A;  4A3E J;  1B8I B;  2KPM A;  2RDP A;  2VKE A;  3DU5 A;  1P9Q C;  3H5A A;  3NRV A;  1TWC J;  2HOE A;  2M45 A;  5K7H A;  1H88 C;  4FIS A;  1IRZ A;  1I3Q J;  1YW7 A;  3CMA I;  1B6A A;  5C3E J;  1D8K A;  2ZME C;  1Z6R A;  2PMH A;  4L5J A;  1K61 A;  2HDW A;  3SYT A;  4BQO A;  4X1E A;  4L0Y B;  1F5T A;  1FWZ A;  5F27 A;  2BW3 A;  3TOA A;  3ABL H;  1BR2 A;  3OYK A;  5J3L A;  2LD5 A;  2E1M B;  2K9M A;  1TWF J;  1UHW A;  3LSI A;  5F1R A;  2DJN A;  4QIW N;  3SDG A;  3JRI A;  3H5R A;  4XBF A;  4EGZ A;  2F6C A;  1BI3 A;  4EM1 A;  3SFZ A;  1PUE E;  3OR1 C;  1VZ0 A;  3HG9 A;  4IHX A;  2YSR A;  3FXM A;  2ZXI A;  4GRI A;  2XAU A;  1JKQ C;  1SD6 A;  5HDG A;  1EKE A;  4XOR A;  3EDP A;  4F52 A;  4XIC A;  2KIM A;  1ZG3 A;  1ZHF A;  4BJT A;  3ZQ7 A;  4OIQ F;  1FNN A;  4HBL A;  4BUP A;  1OKR A;  3E0J B;  3FDY A;  2EIN H;  5CQG A;  3T8T A;  1GT0 C;  2M87 A;  3A03 A;  1OYI A;  4HX7 A;  4BBR J;  1RIO H;  1EH7 A;  3MEX A;  1QO0 D;  3JAM Z;  5GTI C;  1O3T A;  2Y9Y A;  2BHY A;  3RKQ A;  1WJE A;  1C0W A;  5DV5 A;  3L2C A;  2CW8 A;  4RGR A;  1ORK A;  2MLG A;  1I27 A;  4YG2 F;  4JX6 A;  2QKL B;  1H0M A;  3QU6 A;  1B72 B;  1FT9 A;  3U1K A;  2CQN A;  3TP3 A;  1T0F A;  2VKD A;  1WZ2 A;  3RQI A;  5FB2 A;  2KIQ A;  2F5D A;  1IDZ A;  3TW6 A;  4HW0 A;  4PK4 A;  5D5W B;  1TQM A;  1DQU A;  2R5Z A;  4NNJ A;  2P6S A;  5IPA A;  2B9S A;  4ENK A;  2M0M A;  4L9T A;  2HYF A;  1SMY F;  2JPB A;  3S1N J;  1P4A A;  4HG2 A;  3HL2 A;  1K4S A;  1AKH A;  3E97 A;  2X0L A;  3JTH A;  4ASN A;  2GBY A;  1DPU A;  1QQI A;  4DYC A;  1YRN A;  1JUP A;  1ODD A;  4IQ4 A;  1VQK I;  1FMV A;  5EEA A;  5TIS C;  2DCE A;  4HF0 A;  3I59 A;  3EET A;  4G6T B;  2YS9 A;  1K4T A;  1XX5 A;  2X1E A;  2XGE A;  3F9K A;  4RMN A;  2QQB A;  2XPU A;  2JVH A;  4AD9 A;  4HEA 2;  2O5R A;  2LKS A;  5FLM J;  4AIJ A;  4ZTF A;  3TGN A;  1AU7 A;  1BI1 A;  2IGM A;  2K02 A;  4JYK A;  2CW7 A;  3S2H J;  3S8P A;  4ANJ A;  1GV2 A;  3FMQ A;  2R7T A;  1RKW A;  5HNF A;  1QZZ A;  1EV7 A;  2G9W A;  5HVQ C;  4KIG A;  3S14 J;  3HTS B;  3GTQ J;  3D5R C;  1N75 A;  2IGK A;  3F8B A;  2QQ9 A;  1FOK A;  3G1M A;  3WG7 H;  3V7R A;  2KZV A;  4W1U A;  1FBS A;  2E71 A;  2H8R A;  5E1Z B;  1H9G A;  1F9N A;  3EUA A;  5J8F A;  4BEH B;  4BY1 J;  4JX5 A;  1RET A;  1OCR H;  2DW4 A;  3JRB A;  4QSH A;  2BOL A;  2XGC A;  2CYY A;  1ZLJ A;  3OIP A;  3LA7 A;  2Y9Z A;  3OS2 A;  1ZAO A;  2CFX A;  1G3W A;  4S0H B;  2XB0 X;  3P9I A;  4RB3 C;  1BW5 A;  4MEX F;  1YJW I;  1L0O C;  3K0L A;  2M8E A;  1O57 A;  1X3Z B;  1O3R A;  4PJN A;  3WE2 A;  1TZL A;  3BR1 A;  3CLQ A;  5BNG A;  4FE7 A;  4WF2 A;  4HPQ A;  1MMN A;  4KIB A;  3SEZ A;  1MDM B;  5ERI A;  1D8J A;  2EBI A;  2V9V A;  3Q0V A;  5KK1 A;  4ZJZ A;  1MNM C;  1ERD A;  1LEA A;  5DYM A;  4OIN F;  2FEZ A;  2XAS A;  2KIU A;  5J1Y A;  5EZH A;  1MD0 A;  1XGN A;  2FML A;  2LK2 A;  3GFL A;  3QPT A;  3E5X A;  4XKC A;  3ZXS A;  4CCM A;  4HZF A;  1PDN C;  3GF2 A;  1YX5 A;  3GVA A;  3TBI A;  2PJR A;  2XAJ A;  2XVC A;  4L0Z B;  2LBF B;  1N78 A;  2IA1 A;  5B5E C; 
#chains in the Genus database with same CATH homology
 1GV5 A;  5F08 A;  4A3L J;  3HKZ N;  3E7L A;  2JJ7 A;  3JRD A;  3GTG J;  3IV5 A;  2XSD C;  1PUF A;  3ZQC A;  4IHY A;  3LSJ A;  1MBJ A;  2GLO A;  2MG4 A;  2CQQ A;  2HXO A;  3H0G J;  1MH3 A;  2N8G A;  3C2B A;  2YUS A;  2H1K A;  2WV1 A;  4XID A;  1X2M A;  5M5Y J;  1ETX A;  2CJJ A;  2B63 J;  3JRC A;  3ZQH A;  1FIP A;  2FD5 A;  4UUT A;  5GPC A;  2L7F P;  4D7N A;  2R5Z B;  1JTY A;  4IHW A;  2DMQ A;  3BG3 A;  4BY7 J;  2NS7 A;  1GDT A;  4C3J J;  5J1R A;  3MN2 A;  2IEK A;  1WH7 A;  3JRG A;  1A6I A;  2EZH A;  1AKH B;  1QPI A;  5M3F J;  1RR7 A;  5FLV A;  5FKM A;  1YRN B;  4BBS J;  2CQX A;  1WH5 A;  1ZTR A;  2R92 J;  2VI6 A;  1IUF A;  2VPR A;  5IYB J;  5C4X J;  2K40 A;  1NK3 P;  2GM4 A;  3BTI A;  2DA1 A;  3ZQL A;  1TC3 C;  3S17 J;  4X6A J;  2Y31 A;  2JK3 A;  3TED A;  2AO9 A;  3JRF A;  2FX0 A;  5IYC J;  2NVT J;  5IP9 J;  5IP6 A;  1ETV A;  3HBL A;  5F0H A;  3WHB A;  1MH4 A;  2R5Y A;  1HCR A;  3FK6 A;  2K9S A;  5IOZ A;  2CUE A;  2HOT A;  1WGX A;  1JKP C;  1JKR C;  1QVU A;  2TRT A;  2JA6 J;  4HNV A;  2M9H A;  1HDP A;  4LOC A;  3HOW J;  2NOG A;  3HOX J;  1LE8 B;  1JJ8 C;  1WPK A;  2NVQ J;  3DCF A;  3PO2 J;  3K7A J;  4V2F A;  5FJ8 J;  3HOV J;  3JRE A;  2LR8 A;  4M3G A;  1GVD A;  3CMY A;  1T33 A;  2OPT A;  4A3C J;  2LTP A;  3IH3 A;  3FIS A;  4A3M J;  3NAR A;  2DA2 A;  3O8G A;  5M5X J;  3LSR A;  1LFU P;  3BTC A;  4DW6 A;  1XS9 A;  1IV6 A;  4M3E A;  1QVT A;  2E19 A;  3PM1 A;  1S7E A;  2O7O A;  3MVP A;  1XG1 A;  1MBK A;  4BKX A;  4D5C A;  5J1U A;  5FKL A;  1WI3 A;  2IAI A;  3BR6 A;  1SAN A;  2DA7 A;  1HDD C;  1JTX A;  2ID3 A;  2OF7 A;  4AYB N;  1BW6 A;  5GP9 A;  5F0C A;  5E3O A;  3BQZ A;  2WAQ N;  1FTZ A;  1MBF A;  3HGY A;  4FE4 A;  1G2H A;  4D7M A;  1F43 A;  2DMN A;  3G1L A;  5DTD A;  3QPS A;  2FJ1 A;  2M34 A;  3HB9 A;  4M3D A;  5EYR A;  4J19 A;  1BL0 A;  3O8H A;  3A02 A;  4B1R A;  1RES A;  1JJ6 C;  2DMP A;  4MIM A;  4DZJ A;  5EG0 B;  1B8I A;  4C3H J;  2LY9 A;  5EGO A;  1I6H J;  1SFO J;  4IEJ A;  1PUF B;  2VUM J;  5IYD J;  4QTR A;  3GTJ J;  2M0C A;  3TP0 A;  1D5Y A;  2RAE A;  2XGD A;  4FCY A;  2YU9 J;  1Q1V A;  1MSE C;  2R0Q C;  4RDU A;  4A69 C;  1TWA J;  3CDL A;  4UUS A;  1R9T J;  1RKT A;  4Y7N J;  2E2I J;  2ME0 A;  4B4C A;  5E3L A;  3A01 A;  5M5W J;  1WCM J;  1ENH A;  4NDL A;  4DYR A;  4B3A A;  4D5F A;  5EF6 A;  1VND A;  3LOC A;  1ETW A;  4M3F A;  1VF9 A;  4I6Z A;  9ANT A;  4G12 A;  3NAU A;  2K9Q A;  1U9N A;  2LP0 A;  5HOD A;  4A3J J;  3K2A A;  4A3I J;  3D1N I;  1TWH J;  2L7Z A;  2DMU A;  1ETY A;  1IDY A;  3SFI A;  2E1O A;  2JA7 J;  4A93 J;  1UG2 A;  1I50 J;  2IBD A;  3QQA A;  1OCT C;  4XK4 A;  3HGG A;  1P7J A;  3CCY A;  4DYQ A;  5GPA A;  2QCO A;  3OIO A;  1JT6 A;  4MO7 A;  2X6O A;  4M6V A;  2JA5 J;  1B72 A;  3B6C A;  4MFD A;  1EF4 A;  4A3G J;  1VFC A;  2COB A;  3HOU J;  3GTK J;  3GTL J;  1QRY A;  4M3B A;  1U8B A;  2R5Y B;  1FJL A;  3S1Q J;  3I4N J;  3OOU A;  3TW7 A;  2WB1 N;  5IOY A;  4AUX A;  5JLW A;  1APL C;  1HF0 A;  4XRS G;  1JKO C;  1FEX A;  1W0U A;  4MFE A;  3M3Y J;  4CYC A;  2HI3 A;  5E3N A;  3BT9 A;  2ID6 A;  2HOA A;  1MBG A;  1ITY A;  2EZI A;  4A3F J;  2HYJ A;  2MGQ A;  4AC0 A;  4C3I J;  2NVY J;  1Z77 A;  5EDN A;  2D5V A;  3BG5 A;  1ZK8 A;  2PMZ N;  2DTZ A;  2G0E A;  3ZOB A;  1ZQ3 P;  5M3M J;  3VPR A;  1MBH A;  4W97 A;  2XB5 A;  4L5E A;  5E3M A;  5FKK A;  1HLV A;  2MW8 A;  1XC5 A;  3BR0 A;  4MLO A;  5DS9 A;  3GTM J;  2K9N A;  2M2E A;  2O9L A;  1BA5 A;  3BTL A;  4XRS A;  1JGG A;  2DMT A;  4ABZ A;  3ZQG A;  2EQR A;  4IHV A;  3IH2 A;  1CQT A;  2ECC A;  1P7I A;  2ZB9 A;  2W48 A;  4A3B J;  4FTH A;  1IJW C;  1TWG J;  1RPW A;  1K83 J;  5C44 J;  4A3E J;  1B8I B;  2VKE A;  3GBG A;  5EGO B;  1TWC J;  5K7H A;  3GTO J;  2NVX J;  2QF7 A;  1H88 C;  4FIS A;  3GTP J;  1IRZ A;  1I3Q J;  1O4X A;  2R7Z J;  5C3E J;  3MKL A;  1ZR2 A;  1K61 A;  3Q0W A;  3S2D J;  4X1E A;  4Y52 J;  2HDD A;  2R93 J;  5F27 A;  2JWT A;  3BR5 A;  1JT0 A;  2ME6 A;  5J3L A;  2NS8 A;  4JP0 A;  2LD5 A;  3S15 J;  1TWF J;  1UHS A;  1MBE A;  2LFB A;  2DJN A;  2VKV A;  2X48 A;  4QIW N;  1ZGW A;  3M4O J;  3A01 B;  1JUM A;  3SDG A;  3JRI A;  2TCT A;  1Y1W J;  3W6V A;  1NTC A;  2L7M P;  2DA5 A;  2CU7 A;  1H89 C;  1T56 A;  4IHX A;  5F0F A;  3JR9 A;  1IC8 A;  5FKO A;  3Q0U A;  2DA4 A;  1BJZ A;  3BR3 A;  1JKQ C;  2JN6 A;  1DU6 A;  1LFB A;  1IGN A;  4XIC A;  3BQY A;  1UMQ A;  4V2G A;  3BG9 A;  1GT0 C;  1MSF C;  3A03 A;  3BR2 A;  2O8K A;  4BBR J;  1X2N A;  2EZK A;  2AHQ A;  1IG7 A;  2Y9Y A;  3RKQ A;  1VI0 A;  1ORK A;  2EH3 A;  1POG A;  1H8A C;  2P81 A;  2LVS A;  4JX6 A;  3FIW A;  1A5J A;  3ZQI A;  1B72 B;  2ELK A;  1JUS A;  2JMW A;  3TP3 A;  2Y0S N;  3RQI A;  1IDZ A;  3TW6 A;  2R5Z A;  3PO3 J;  3LSG A;  1X58 A;  3S1R J;  5IPA A;  3S16 J;  1DU0 A;  3CQZ J;  3B6A A;  5F04 A;  3S1N J;  3JRA A;  3FK7 A;  2DA3 A;  1AKH A;  2L0K A;  4BXX J;  4CYC B;  3RZO J;  2GBY A;  2E2J J;  4DYC A;  1YRN A;  1JUP A;  5EEA A;  3S1M J;  3HOZ J;  2CUF A;  2DN0 A;  2YS9 A;  5F1J A;  2XGE A;  3G1O A;  2XPU A;  4I76 A;  4A3D J;  3LSP A;  2Y30 A;  5FLM J;  2ECB A;  2LLK A;  3DEW A;  1AU7 A;  4EEF G;  5K7F A;  1Z0X A;  4JYK A;  3S2H J;  3H3V K;  1GV2 A;  5K7Z A;  1RKW A;  3Q3S A;  1W0T A;  3WHC A;  1NK2 P;  1ZKG A;  3HOY J;  1F36 A;  2FQ4 A;  2EZL A;  2M8G X;  3S14 J;  2XPW A;  3BTJ A;  3QPL A;  2MSY A;  2CRG A;  3GTQ J;  2Y2Z A;  1AHD P;  3G1M A;  2I10 A;  4W1U A;  5FKN A;  5EZG A;  3LNQ A;  2H8R A;  2E2H J;  5JLX A;  2HXI A;  2L9R A;  1LE8 A;  1ETK A;  1OFC X;  4A3K J;  4BY1 J;  3F0C A;  4JX5 A;  1RET A;  1ETO A;  3JRB A;  4QSH A;  2XGC A;  3ZQF A;  2JA8 J;  1FTT A;  5IP7 J;  2LKX A;  2Y9Z A;  1FIA A;  4S0H B;  2XB0 X;  3IH4 A;  4C2M J;  1OJL A;  3FKI J;  1BW5 A;  2XRL A;  3SJM A;  3OSF A;  3JRH A;  1ZR4 A;  1U9O A;  3UKG A;  2HOS A;  4XRM A;  3BR1 A;  1OCP A;  5BNG A;  4FE7 A;  3RZD J;  3HDD A;  3L1P A;  4DZP A;  5C4J J;  4UUS B;  2EBI A;  3Q0V A;  1ETQ A;  1MNM C;  1GUU A;  1HOM A;  2KT0 A;  4JX4 A;  2X9D A;  3HM5 A;  2KDZ A;  1E3O C;  5J1Y A;  1Y1V J;  5EZH A;  3I4M J;  2XPV A;  2LK2 A;  2DA6 A;  2HQ5 A;  3HEF A;  4RBO A;  3OSG A;  4GFB A;  1U78 A;  5EG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...