3K7AJ

Crystal structure of an rna polymerase ii-tfiib complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 14
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2009-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3k7aJ00
3HBLA 2CQXA 2DMPA 4FTHA 1GV2A 4FE7A 2XPUA 5GPAA 1R9TJ 2L9RA 3HDDA 2WAQN 3A01A 1SANA 1OCTC 2HOTA 2ELKA 5C4XJ 4D5CA 5FKKA 4C3HJ 2L7FP 1OFCX 1JUPA 1QVUA 1DU0A 5FLVA 2E2JJ 1UHSA 2EZIA 3HOYJ 2XPVA 2LD5A 5EGOB 3BR1A 3S1QJ 3JRFA 1F36A 4AYBN 2DA2A 2DA7A 2XB0X 5BNGA 2JA7J 4ABZA 2DA5A 2ID3A 4BBSJ 4A3MJ 2N8GA 3S1NJ 2E1OA 1DU6A 1IG7A 2DA6A 3S14J 5EG0A 4JX5A 4A93J 1JUMA 2DA3A 3B6AA 2HXIA 3L1PA 2R92J 4EEFG 1T33A 3WHBA 4XICA 3SFIA 2FQ4A 4A69C 1HF0A 1W0UA 4BY7J 4AUXA 2P81A 1MBHA 3TW6A 3UKGA 1X58A 2AHQA 1S7EA 4W97A 2M9HA 3CMYA 3TP3A 3BG9A 1RKTA 3JRDA 2K9SA 2XGDA 5JLXA 1WPKA 5F0CA 1RKWA 3QPSA 1RETA 3HOXJ 5IOYA 2L0KA 4B4CA 1B8IB 1SFOJ 4XRSG 1AKHB 1B72A 3S2DJ 2M34A 4BXXJ 1APLC 5EF6A 4M3EA 3JRGA 1IRZA 3ZQCA 3ZQFA 1IC8A 1FEXA 1MSFC 5M5YJ 4BY1J 3JRBA 3OOUA 2ME0A 2OF7A 2IEKA 3Q0UA 1POGA 2CQQA 1OCPA 4GFBA 5EDNA 4JX6A 2ZB9A 4MLOA 4A3BJ 3GTJJ 2HDDA 1VI0A 1MSEC 2R0QC 1JTXA 1ETKA 1Z0XA 2HI3A 2DTZA 3ZQGA 1ZGWA 1AU7A 2JK3A 2Y2ZA 3IV5A 1Y1WJ 1X2MA 3Q0WA 3FK7A 1ZQ3P 1JJ8C 3B6CA 2D5VA 4A3DJ 3ZQLA 3GTLJ 2CU7A 1HLVA 2NVYJ 1GVDA 2EZLA 2OPTA 3OSFA 3LSGA 3LOCA 1ETOA 3HKZN 2VUMJ 3M4OJ 1A5JA 1UG2A 3TEDA 3GTMJ 1Y1VJ 1XC5A 2X9DA 5EEAA 1WH7A 1IGNA 5FKLA 3GBGA 1BW5A 2DMTA 4W1UA 5DS9A 2E2IJ 5F1JA 4UUSB 1JJ6C 4IHWA 5IOZA 1HDPA 1P7IA 3G1MA 1WCMJ 2MGQA 4A3JJ 3BTLA 1JTYA 1RESA 2JA5J 3G1OA 3H3VK 3QQAA 3BTCA 4IHVA 1LFBA 3F0CA 3MVPA 1BW6A 2CRGA 1PUFA 2JJ7A 3BR5A 3PO2J 2EZKA 3BR3A 4M3FA 2KDZA 1TWFJ 3ZQHA 1MBFA 3LNQA 1MBKA 2DA4A 3LSPA 1O4XA 3HGGA 5C44J 3GTKJ 3FKIJ 2ECBA 1H88C 5J1RA 2LP0A 4A3LJ 2KT0A 1P7JA 5FKNA 2VPRA 5E3NA 1EF4A 2NOGA 4D7MA 4C2MJ 4BBRJ 3FK6A 2X48A 3SJMA 3G1LA 3S1MJ 4IEJA 2VKVA 2MW8A 3O8HA 3VPRA 1E3OC 4QSHA 5IYBJ 2XGEA 1I50J 2LFBA 5C3EJ 5IPAA 2DMNA 3JR9A 4MO7A 5EGOA 4QTRA 2VKEA 2XGCA 5FJ8J 2K9QA 5FKOA 1AHDP 2EZHA 1FIAA 4A3KJ 1MNMC 1JKOC 2HYJA 4B3AA 1OJLA 4FISA 4V2FA 2B63J 3I4NJ 5M5WJ 4JX4A 2X6OA 1QVTA 2VI6A 3OSGA 4J19A 3W6VA 3BTJA 4D7NA 3GTGJ 2I10A 2Y30A 1IUFA 1FJLA 2LR8A 1IDZA 4B1RA 1YRNB 4MFDA 2R7ZJ 2MSYA 5F27A 4JP0A 2DJNA 5JLWA 5K7HA 2Y9YA 4XRSA 1HCRA 1WGXA 2IBDA 1RR7A 2XSDC 4CYCB 1XS9A 2QF7A 2LTPA 2NVQJ 4RDUA 1B8IA 1JT6A 4M6VA 1U9NA 2JMWA 4M3DA 4C3JJ 1AKHA 1FTTA 2JN6A 3A02A 2R5YB 2R5ZB 2CUFA 3RZDJ 2QCOA 2NVXJ 1IDYA 3M3YJ 4DW6A 2EBIA 3JRCA 1TWGJ 1A6IA 1ZK8A 5IP9J 3BG5A 1D5YA 5J3LA 3HEFA 2DA1A 1JT0A 1ETYA 3JREA 3JRIA 5M3MJ 2NS7A 1RPWA 3TP0A 1G2HA 4I6ZA 5IYDJ 1NTCA 3S16J 1X2NA 1LE8B 4I76A 2L7ZA 3BT9A 2K40A 3CCYA 2MG4A 2M2EA 5C4JJ 2DN0A 4A3CJ 1W0TA 1K83J 5F04A 3PM1A 2L7MP 2TRTA 3HOVJ 5K7FA 1VF9A 1TWCJ 4D5FA 4Y52J 4M3BA 1TWAJ 1U9OA 3Q3SA 3NAUA 3ZOBA 4A3GJ 3A03A 2WV1A 3RQIA 1GT0C 5IYCJ 1HOMA 2GLOA 3IH3A 4UUSA 2LLKA 5GPCA 5K7ZA 5M5XJ 2W48A 1GDTA 1U78A 2M0CA 2EQRA 3HB9A 1JGGA 1ITYA 3FISA 4X1EA 4L5EA 3SDGA 2K9NA 3GTPJ 3H0GJ 3A01B 5HODA 1BL0A 3S1RJ 3K2AA 2YS9A 3MN2A 1JUSA 1QRYA 2DMUA 5FKMA 3O8GA 2YUSA 4UUTA 2CUEA 5EZHA 2EH3A 2DMQA 4S0HB 2E19A 1WI3A 2O9LA 2Y9ZA 3BTIA 3HOZJ 4A3IJ 1FTZA 4FE4A 3QPLA 3LSJA 4JYKA 1ETQA 4A3FJ 4G12A 3JRAA 3S17J 4C3IJ 5J1YA 5EG0B 2G0EA 3FIWA 1BJZA 1BA5A 1ZKGA 3BQYA 2YU9J 5J1UA 1MH4A 1JKRC 5FLMJ 3JRHA 2FX0A 4MFEA 3IH4A 4BKXA 2HQ5A 1HDDC 4DYCA 2GM4A 3CDLA 4V2GA 5F08A 1IJWC 3BR0A 2FJ1A 2HOSA 4NDLA 3RZOJ 2TCTA 4MIMA 3BR2A 2CJJA 1U8BA 1MH3A 2RAEA 1B72B 9ANTA 4DZJA 1ZR2A 1YRNA 3PO3J 5F0FA 1H89C 4XIDA 1GUUA 2IAIA 3HOUJ 1ENHA 1ETXA 4HNVA 1Q1VA 2ME6A 5IP6A 2ID6A 3HOWJ 4LOCA 1UMQA 3S2HJ 5F0HA 2Y0SN 4QIWN 3BR6A 2COBA 4CYCA 1NK2P 4IHXA 3E7LA 3GTQJ 3NARA 4IHYA 2HOAA 3CQZJ 3ZQIA 2E2HJ 2XB5A 5IP7J 2R5YA 5DTDA 1WH5A 2R5ZA 2HXOA 2LY9A 2M8GX 2NS8A 1T56A 2JWTA 2LKXA 3HGYA 3TW7A 3LSRA 5EZGA 3C2BA 5E3OA 2XPWA 1H8AC 2XRLA 2H1KA 3D1NI 3DEWA 3DCFA 1GV5A 2O7OA 2AO9A 5GP9A 4XRMA 1TWHJ 1NK3P 2PMZN 2LK2A 2Y31A 1ZTRA 1MBJA 2WB1N 4AC0A 3BG3A 5EYRA 1I3QJ 1K61A 5E3MA 1ORKA 2O8KA 3GTOJ 3S15J 1JKQC 2LVSA 2R93J 3OIOA 4XK4A 2ECCA 4RBOA 1VFCA 3IH2A 2H8RA 3BQZA 3I4MJ 3MKLA 1CQTA 1LE8A 4X6AJ 1VNDA 4DZPA 1XG1A 2JA6J 2FD5A 3Q0VA 1I6HJ 1MBEA 4A3EJ 1Z77A 1QPIA 1ETVA 3K7AJ 5E3LA 1IV6A 4DYRA 1TC3C 3RKQA 1FIPA 4DYQA 1LFUP 1MBGA 1PUFB 1F43A 3WHCA 2GBYA 2JA8J 1ETWA 4FCYA 2NVTJ 1JKPC 3HM5A 1ZR4A 5M3FJ 4M3GA 4Y7NJ
chains in the Genus database with same CATH superfamily
5B1AH 2EIKH 2XIGA 4BUPA 2DMPA 1HA8A 2DI3A 5CVUA 5HDGA 2CSOA 1TW3A 2XPUA 2L9RA 3CP2A 2MD0A 2VQGA 2WAQN 1E3HA 3DTIA 3BZKA 1OCTC 3QRFF 2HOTA 3K4BA 3WGIA 3BZCA 3JAMK 2K5CA 4N4OB 3H35A 4C3HJ 2HDCA 3L2QA 1OFCX 3QOPA 1DU0A 5FLVA 3PNYA 2EZIA 1X1DA 2DXIA 2CW0F 1J2XA 2HVRA 2O03A 1IRFA 3D5LA 5BNGA 1Y39A 4BNCA 3AL0C 4XKWA 4ABZA 5FD5A 2GIVA 1KONA 4YRVA 2ID3A 3I9V2 3L2CA 3GFMA 4UB6C 3S32A 5LGUA 3W2AA 4JX5A 3VDXA 1Z6RA 1R6RA 2IS4A 3GFIA 2L7KA 1V5FA 4G9YA 2R92J 3CJNA 3EUKL 2AQEA 1Z7LA 3DU5A 1T33A 3TOAA 2ZXHA 3WHBA 3ZQQA 4A69C 1FNNA 5DUIA 2PG4A 3MKYB 4RAFA 1MBHA 1Z7UA 3BY6A 2WC2A 4W97A 3CMYA 1ZELA 3TP3A 4KITB 1WJDA 1T95A 5LD2C 1QZZA 2DDBA 4QWQA 1WPKA 5F0CA 3JCUC 3REOA 3QPSA 4HEA2 3H5NA 3H3ZA 3HOXJ 1WQ2A 2VPLA 3S2DJ 2F4IA 2W7NA 2JVGA 1QNTA 3H3UA 1WZ2A 3T1BA 4M3EA 1YW7A 2ADUA 3K0LA 5EF6A 3ZQFA 1IRZA 3ZCOA 2A5WA 2DFEA 1D3YA 1ZYRF 2EV0A 3MCZA 3DFGA 2R7WA 3LL7A 5BPDA 3OOUA 1ZLJA 2ZBKA 5FFXA 2OF7A 2IEKA 5HNHA 3S93A 1JHHA 2ZNZA 5EDNA 3CJTB 4GFBA 4A12A 3GTJJ 4ZYAA 3ML6A 2JQ7A 5J8FA 2W24A 1ETKA 1AU7A 1R49A 3VYSB 4RB3C 1A36A 1B59A 2B9SA 1X2MA 1JJ8C 3B6CA 3IRQA 1WFXA 4HQMA 3V8JA 2NVYJ 1FOKA 1ZG3A 2P4WA 2XV4S 1D1CA 3EQLF 4ZTFA 3GFLA 5LRRA 3LOCA 4IPAA 2MLGA 1RUOA 4X0GA 4OAZA 1G3SA 3TEDA 1LVAA 1NHAA 3HUGA 2UZKA 4RB1A 2ACJA 5TJJA 4NQWB 1KZHA 5B5EC 2K86A 1EKEA 5EEAA 1WH7A 3F6VA 5HS8A 4HW0A 3EUHA 3I5UA 4E7IA 5DS9A 1SFKA 5ERIA 2VXZA 2TDXA 4HOBA 3G1MA 1R23A 3BP8A 3BTLA 5FB2A 3DLLF 3OYDA 1Y8QB 3K4CA 4WF2A 1XGOA 5FD6A 2V26A 1E2XA 1MGTA 2HQRA 2V7FA 1XSXA 3QQAA 5IT9Z 4IHVA 4J01A 5D5WB 1LFBA 1XMKA 1MMGA 1QGPA 3BR5A 1ZARA 3TO7A 1Z21A 3BR3A 3OMYA 3BWGA 4M3FA 1LKXA 3KEOA 2ETHA 1L0OC 2DA4A 3BLYA 1O4XA 1MMSA 2Y69H 1L3LA 2O0YA 5C44J 1QZYA 4OIRF 2CH0A 1R5ID 2KMUA 4GGGA 1H88C 3DTEA 5DUKA 3BDDA 5JHFA 4A6DA 1X4PA 3OYKA 2RGVA 1EF4A 2EFPA 3V7SA 5AIPA 3W6JB 4D7MA 4BBRJ 3SJMA 4IEJA 1W7PB 3CUQA 1KU2A 2VKVA 4BJTA 2E1MC 1FMWA 2E1CA 4KUMA 4N9IA 2HNHA 4OIQF 5IYBJ 1P92A 2XGEA 2LFBA 5C3EJ 3JR9A 5BQTA 1X19A 1IN6A 2XKOA 4ZH4F 2VKEA 4QTRA 5EGOA 1FZPB 3CUOA 3FDYA 4UHTA 3C3WA 1JI8A 4IQ4A 1IXCA 3H92A 1USTA 4P5OA 1JKOC 2HYJA 1XX5A 4FISA 4V2FA 1IRXA 5A2QK 2L4MA 3WTWC 2P5LC 2EPFA 1QVTA 1XTAA 2P6SA 4YFNF 3W6VA 3BTJA 2VL8A 1OKRA 3GTGJ 4NB5A 2I10A 3WU1B 4XLEA 4PFOA 2DT6A 4XMYA 3LAJA 2ESHA 3FBNB 2HTJA 3KP5A 4BEHB 3QAHA 4LG0A 2KL4A 1D1AA 1HCRA 1NH3A 4II3A 1RR7A 2JRMA 4M71A 1XS9A 3PNTA 3DBRB 2QF7A 3F72A 2NVQJ 3CF2A 4MEXF 2YX7A 1JT6A 2COMA 3U1DA 3G4SI 1ZLKA 1AKHA 2ESNA 2F4MB 2LKPA 1FTTA 2JN6A 2KIUA 4L0ZB 3F9KA 2R5YB 3FM5A 3J7AY 2CUFA 2CV1A 2NS0A 1HW5A 1R00A 2QCOA 3OYJA 2NVXJ 3OV8A 4KYWA 2VOPA 1IDYA 4AVZA 2QM3A 5H6RA 1BI1A 4GO1A 1OR7A 3I59B 5IP9J 2M7AA 4PJ0C 2VT3A 3CO6C 2ZJQF 2CG4A 2XVCA 1JT0A 3EYIA 2EIJH 2CO5A 4JBAA 2WY7Q 2HU9A 4MTDA 1O3RA 4KIGA 3QPTA 4LLGF 4IRGA 5HOOA 2M87A 1DUXC 4HNUA 4XN3A 3KETA 4I6ZA 5IYDJ 1GLNA 4WCGA 2ZMEB 1O7FA 3M1EA 4UVBA 1LE8B 3G2BA 1MMNA 1FYKA 2L7ZA 1YJ9I 1SC7A 1KQ9A 1ONVA 2IA0A 3E5XA 2K40A 4MQ9F 2OTJI 4CZZA 3PM1A 2IW5A 1FPQA 2NVUB 1U5TB 2TRTA 3SEZA 4D5FA 1TWCJ 4Y52J 2WA0A 2EK5A 1U9OA 4CCKA 2EA4A 1HOMA 5D8KB 3EUAA 4U87A 1P9QC 4ETSA 4G7ZF 1VZ0A 5H6QA 3NEUA 3BROA 2NRAC 5DCMA 5K7ZA 5M5XJ 5CJ9A 1GDTA 2CUJA 3SQNA 4IKFA 1LPQA 1AWCA 4M9ZA 2KIMA 1D1BA 4RAZA 1JGGA 1N75A 3ESWB 3HG9A 4L5EA 1F5TA 1FBUA 1BL0A 3S1RJ 1XCVA 2RNJA 5FLXZ 3RCOA 4L0YB 1JUSA 5L3FA 3QYEA 3LA2A 3TDUC 1X1AA 2OC6A 3LWFA 3FMSA 3O8GA 2YUSA 3GUDA 3DKXA 4HPQA 3FXMA 5EZHA 4I0BA 1XSDA 1FOWA 2A6EF 5AIQA 2VC1A 1MKMA 1B9MA 1FWZA 2O9LA 3FHNA 4A5NA 3CMMA 1VTNC 3EDPA 3GCMA 2WAFA 3CCQI 2DFIA 5DD8A 5K5QA 2HVSA 1ETQA 4G12A 3EETA 4L5IA 3DKYA 3CC2I 3S17J 3CMEI 3FIWA 5DCFA 1ZKGA 1TQPA 4DBRA 4HV6A 3DLAA 1JKRC 5FLMJ 3WTTC 4Q4ZF 4LK0F 5DDGA 3KYLA 2HQ5A 5L3DA 1OQYA 4KJZA 4DYCA 2GM4A 3CDLA 2OBPA 4PZJA 2D1VA 3L7WA 3JTHA 2QA4I 4B09A 3IHUA 1RRJA 2LDUA 3H9QA 2HKXA 5GAGJ 5D6FA 3RZOJ 2H8WA 1I3AA 4KIBA 3NQOA 3IP4B 1KU7A 2TCTA 1VQKI 1MH3A 2WAEA 3VEPA 2B7EA 9ANTA 4DZJA 2Z2SB 1ZR2A 1IRGA 5F0FA 3DKWA 1GUUA 2IAIA 2QLZA 4BL0B 3HOUJ 3FXUA 3ZXSA 1VQMI 2E36A 2W25A 3K9TA 5B1BH 3S2HJ 2L5QA 5F0HA 2Y0SN 3PQJA 3BR6A 5E1WA 2LH9A 2IGKA 4BXFA 4Y13A 2Y48A 3ECOA 2X51A 3NARA 2ZCWA 1VQ4I 1R36A 4IXAA 2BVLA 2J5OA 3OL4A 5E1XA 5IP7J 3HSEA 1FC3A 2LY9A 2QGUA 4DNCA 1IZ1A 3CJRB 2X1DA 4RS8A 2F5VA 1VQPI 3M8JA 4ZZDA 5EZGA 3EUHC 2LBFA 1BC7C 1SMTA 2XRLA 3D1NI 2PX9A 5IY5H 2O7OA 4IOAF 1HQCA 4XRMA 1K6YA 4XLFA 4C30A 3J80K 2PMZN 2LK2A 1MNEA 1BC8C 2F2EA 2XDVA 1WRJA 3GFJA 2VKHA 3HKZA 3DPTA 2WB1N 3HUGB 3HOSA 3IAS2 1ODDA 3WU2C 4MNUA 4CH7A 5EYRA 3KP4A 4ASNA 1KYWA 5E3MA 1ORKA 3GTOJ 3LSIA 1VFCA 3BQZA 2DPDA 4WXHA 5BOXA 2JVHA 1XGSA 4X6AJ 3FXLA 1YITI 1XG1A 2JA6J 4FHTA 3AFHA 3Q0VA 3FXOA 1IV8A 2MC3A 1ETVA 2JUGA 3OYNA 3CLQA 2DYSH 3QU3A 3SFZA 4BACA 5LGTA 2DLLA 3RKQA 1JXSA 1WJAA 3FXRA 3LSMA 2XAJA 1MBGA 4KT5C 4HX4A 2K7LA 3G71I 1ETWA 2Z5UA 5J8CA 3RPUA 4FCYA 2XKPA 1MD0A 3HM5A 1YQAA 4KMFA 2Q8KA 2OCCH 3R61A 1OYWA 1S7OA 2CQXA 2VBZA 1E17A 1UCRA 1GV2A 2IXSA 2EFWA 4RLFA 3DEEA 1R9TJ 4AWXB 3S3NA 4I2OA 3WU0A 4YIRX 3NWTA 2Q1ZB 1SFEA 3OOPA 5FKKA 3CUQB 1ULYA 1YTYA 5FO5A 5ICCA 4LB5A 1QU3A 4YEJA 2QQBA 1QVUA 1SVOA 5TGTA 2D45A 2OA4A 2RQQA 2IS2A 2P5VA 2QKLB 2M7BA 1UHMA 5EGOB 5L3GA 3JRFA 1WSUA 1F36A 1I5ZA 4IRHA 2DA2A 2DA7A 3U1KA 4AYBN 2VKDA 3OYFA 2FBKA 2WY8Q 4CA0A 3HL2A 2E5ZA 2XF5A 4M74A 2JA7J 1YG2A 2JPBA 4PDKA 4UXNA 4BBSJ 3BJ6A 4GCVA 4A3MJ 4FQGA 2LC2A 3T8RA 1DU6A 2VC0A 2DA6A 1TW2A 4A93J 1JUMA 1QHHD 2ELJA 2V1DA 3KP3A 2DK8A 5ILUA 4CCOA 3KIOA 1TT5B 2HFHA 3A4CA 3I64A 4XICA 2FQ4A 1WWXA 2IPQX 4HG2A 3P7NA 3AAFA 2K9LA 3RI4A 2FNAA 3FMRA 3KCCA 4BE2A 2IRFG 4LLNA 2P81A 5DEQA 3HIFA 1U8RA 3BG9A 4LG0B 3JRDA 1AOYA 1HKSA 4UNOA 4M72A 3I71A 3SEQA 4G6QA 3HXLA 3MMYB 2R7UA 2O61A 3LFKA 3BPVA 2KHMA 4XRSG 4EV0A 1AKHB 2W84A 1APLC 3G73A 4XRFA 3OY9A 3OS1A 1LQ1A 4CSWA 4XQFA 1BI0A 1IC8A 1MSFC 4LK1F 5M5YJ 2DDAA 4BY1J 5FFZA 3K6GA 2ZXJA 3QP5A 5L3BA 1U6GA 2ME0A 1T39A 5LHHA 2E7XA 1FOXA 2KISA 2CQQA 1OCPA 2F4OB 4CICA 5EJCA 3QP6A 3M8FA 4BJ5C 1EA3A 3CLOA 4R79A 1MSEC 1Z0XA 3HRSA 3ZQGA 1ZGWA 1EJ9A 2Y2ZA 3GXOA 3K4JA 5JI6A 2PLYA 4U0WA 4LMYA 3Q0WA 3K4MA 4A3DJ 4J00A 2VBYA 3J7AO 1I1GA 5CVIA 1YJNI 2Q0OA 1GVDA 2OPTA 4BQQA 4Y33A 3RSNA 5LEJA 2VUMJ 1D0XA 2FMYA 3DBHB 3WE3A 4UV9A 5EEHA 3OWTA 4XKBA 3GTMJ 2CFXA 4D0PA 2IS1A 3FX3A 2RQPA 3J81Z 1V54H 4M6YA 3GBGA 1BW5A 3HHHA 2M4GA 1VQ8I 4ESBA 4E70A 2DOEA 5KNLA 3CMAI 1G59A 1JJ6C 1IUYA 4BHPA 4IHWA 2VJJA 2MABA 1P7IA 3VSKA 5IOZA 5DCMB 2MGQA 5D4SA 4A3JJ 2NYXA 1JTYA 4LJZF 3HTSB 4BJ6C 2JA5J 2GOMA 2KRFA 3I58A 4OIPF 1X1BA 2O3FA 3LQQA 4U7DA 3KE2A 1DP7P 2WBMA 3RTRA 3MVPA 2CRGA 4AU7A 1PUFA 4ZYDA 3FXQA 4XLPF 2DJIA 2HYFA 3ZQHA 2E35A 1R1VA 3LSPA 1F4KA 2FF4A 3HGGA 2R4GA 1ON1A 2A05A 1GVJA 2ZSIB 3O6BB 4FETA 2M0MA 5CVVA 2FE3A 4KMUX 3GTKJ 2YR2A 3F8FA 4A3LJ 1W36C 2KT0A 2P8TA 1ZGAA 4Y17A 5FKNA 2VPRA 4OMYA 3KLOA 1X3ZB 2AXTC 2F48A 3FK6A 3G1LA 3S1MJ 3GLXA 4B3XA 4E4HA 1P4XA 2HDWA 1RZ4A 4NBQA 3MZ8A 2E1NA 3VPRA 1E3OC 3COAC 1SFXA 2KRHA 3ASNH 4Y15A 1MNDA 4A2UA 3KYDB 4O5VA 3RYRA 2DODA 1YFHA 5IPAA 2B0LA 3V7RA 2KP6A 5F64A 1Z3XA 2BYVE 1B9NA 5GTIC 1JGSA 2DOFA 5FKOA 4HQEA 1O57A 2EZHA 1FIAA 1U2WA 4A3KJ 4MGRA 4BU2A 4ITVA 5HVQC 1YX3A 3PQKA 3ROUA 3CCJI 1OJLA 2LG4A 3OYGA 3F23A 1ZH5A 2LY2A 5M5WJ 2X6OA 2PQ8A 3X2QH 1VQNI 3OSGA 4J19A 3HC7A 3KYCB 1UG0A 2JA2A 3HZJA 2W4SA 4EATA 2LR8A 1IDZA 3P9IA 4B1RA 3GLLA 3JSOA 2WWYA 4Q47A 5D5VB 2K4JA 2R7ZJ 4CCNA 3ABLH 2XC7A 2DJNA 2R3SA 5JLWA 3JSPA 2Y9YA 4FX0A 2GIZA 1SAXA 5LFAA 5LHIA 5D5UB 1HW1A 3S3MA 2L54A 4EQQA 2JMWA 4M3DA 2DBBA 3T5XA 3HOTA 1OCCH 3A02A 2BVMA 5E18F 1VQ7I 2RREA 1PP8F 3M3YJ 3E97A 2LBFB 1W36D 3JRCA 1REPC 4XOPA 1YS7A 3CJQB 5KAFC 4F92B 3BG5A 3WGGA 4E7HA 5L3CA 3ERED 4WXDA 1O3SA 3N05A 3LA7A 2L3DA 3JREA 1OPCA 4G8XA 3OYHA 3JRIA 4PJMA 1FMVA 5M3MJ 4LB6B 3A1YA 4BHBA 2VJ4A 4EVIA 4K2EA 2EB7A 1DQUA 1G3WA 4FASD 1NTCA 2IA2A 2UWMA 1W1WE 3S16J 1X2NA 4E6KG 3BT9A 2G7HA 2VOOA 4KN4X 2HQNA 3ZN0A 2RV8A 3HHGA 4JQFA 2DN0A 2FEZA 2OZ6A 3I56I 4CHUA 2KKOA 5ICEA 2HKOA 3TGNA 5K7FA 3CD6I 2V9VA 3VB2A 3WE2A 2V1UA 1UB9A 1R7JA 2UUZA 3Q3SA 5F1RA 5DM7F 3A03A 1GT0C 5IYCJ 3IH3A 4F3QA 4UUSA 4WK8F 2NAZA 4HF1A 3K70C 1H0MA 4RGUA 1SFUA 1MZBA 2QUFA 3GW2A 4D9JA 3HTUA 3HB9A 4B44A 2ISYA 4XLAA 4B8XA 5HLGA 1J59A 1ITYA 1E0EA 4F52A 3CF5F 4G7HF 3ASOH 5HODA 2QQAA 5J6XA 3QODA 3WTYC 1J9IA 3NRVA 3CCMI 2KIFA 3V8LA 2KDOA 2JTVA 5ILVA 1QRYA 3OYMA 2DMUA 4P9FA 3W2VA 5CKTA 3AG1H 3PIOF 2CUEA 4NHJA 2VBXA 2MH2A 2X85A 3ISPA 3CZ6A 2CYYA 1V55H 1XGNA 1WI3A 1FY7A 3OIQA 2K9MA 3BTIA 3L2UA 4UY8I 3KZZA 3HOZJ 4FE4A 2L02A 1BR4A 3LSJA 4A3FJ 1PYVA 3IUOA 4XM3A 1S29A 2FXAA 1NG7A 1X1CA 1BR1A 1TLHB 2EV5A 3KPHA 4C3IJ 1ERDA 1A31A 1D5VA 4BQAA 3BQYA 3EYYA 3CC7I 1SAUA 3F6OA 3H36A 1BOAA 3JRHA 1R1TA 3IH4A 5LRSA 1Y8RB 1HDDC 1QA6A 2LREA 4FX4A 4V2GA 5F08A 1IJWC 1MIJA 4CCLA 1T6SA 2FJ1A 3SYTA 2A5YB 1LDDA 2A3SA 3SHFA 4IQJA 3PNVA 1KYZA 2MBFA 4M73A 1Z9CA 3F22A 3K70D 4ZDOA 1YRNA 2ZSHB 1UJ8A 3H1CA 1YIOA 2K3PA 2PI0A 1ENHA 4HNVA 1F1ZA 5IP6A 2DW4A 2ID6A 3I55I 1LNWA 4LOCA 1UMQA 5KAIC 2XF7A 2ZMEC 4EM1A 1NK2P 3E7LA 1T98A 1XCBA 3S2WA 2M30A 4H0EA 2CQKA 4ZYEA 1I27A 2HVQA 1S72I 3S8PA 3KP7A 2BGCA 3I54A 5IT9K 3ZMSA 2NS8A 3HGYA 3C2BA 2KZGA 1FLIA 3IKTA 1U5TC 3LMMA 4EMSA 5E3OA 2XPWA 2QQ8A 2EFQA 3ZP5A 5J47A 3CCVI 3ZMTA 3DEWA 1LDKB 2AO9A 4G94A 4U7BA 2CQ7A 4EJTA 2HPIA 4XN0A 1I3QJ 2CFOA 1IN7A 3S15J 2OQRA 6PAXA 4XK4A 2ECCA 4RBOA 3OYEA 1JHFA 1CQTA 4ZDLA 2M45A 2DTRA 1TZLA 1ZHFA 2LNBA 3FM3A 5HS9A 4BHCA 1GXPA 1EH7A 1KA8A 4A3EJ 4BH9A 1XMXA 3E0JB 3ABUA 4A0XA 3IKVA 4DYRA 3MKWB 3FBIB 5LGNA 4HF2A 4DYQA 1XSVA 2IVMA 3DQVC 1MMAA 3LSHA 5J4VA 4D1QA 1PUFB 3DP7A 3WHCA 2JA8J 2A68F 3KZIC 3J7YJ 3W3CA 1YW8A 1JKPC 4R1HA 4M3GA 3RIRA 3PSFA 2QQ9A 5BMZA 3ZMVA 3HBLA 2H94A 2IS6A 3BCBA 3ZRGA 2CS3A 3OYCA 5KHDA 2LSOA 3CO7C 2VE8A 1SVLA 1OCRH 4NNJA 3PIPF 2LMDA 2AQFA 3A01A 1ZGJA 1SANA 1R4MB 2KPMA 4XLNF 3PUBA 3OL3A 2FOWA 1UAAA 3J80Z 5C4XJ 1K6OA 2HTSA 3KFWX 3HPHA 2BHYA 2DT7B 2W85A 2PJRA 1UHWA 5LEKA 2XHKA 1QQIA 1UHSA 5BPIA 2XPVA 5CYVA 3C2GA 2Z3YA 5ILSA 5HLTA 2Q2EA 4HV5A 1Z05A 1BR2A 2MYSA 2N8GA 3S1NJ 2PJPA 3O2PE 3ABTA 2K3FA 1T0FA 3K69A 5EG0A 2LF7A 4HA8A 3WTXC 1CF7A 1CGPA 2K27A 5E1ZB 3WTUC 2DA3A 3B6AA 5E20A 1S3JA 1KQ8A 2C6YA 2HXIA 4E7SA 4EEFG 1K78A 4R8HA 1HF0A 1W0UA 1FX7A 4Z2YA 4RMNA 1B1BA 4BY7J 4HDUA 2BOLA 3TW6A 3CC4I 2AHQA 1S7EA 1HKTA 2OTLI 2M9HA 1GXQA 3QWLA 2KFDA 2GZWA 2K9SA 4LGWA 1Y0NA 2L9VA 2V6CA 2XGDA 2ZXWH 2ZFUA 4MEYF 5JLXA 4DBQA 4IZZA 1YO5C 2L01A 2HGCA 1FBSA 1HBXG 2EFNA 3ZPLA 2L0KA 1DDNA 1EH8A 1SFOJ 1B72A 4BXXJ 1QZEA 1XDSA 3ECHA 3L2VA 3ZQCA 4F91B 2VXDA 1J09A 1PJRA 5K5RA 1D8JA 1TNTA 2OJED 2ELHA 2MC4A 3EPZA 2WTEA 4RGXA 2BZTA 1XGMA 4HBLA 4PGGA 3TL4X 2BY1A 2DPUA 2ZB9A 4MLOA 3WTZA 2MA3A 2QZ8A 4CGZA 1VI0A 2XGXA 3L2RA 1F9NA 2R0QC 2HI3A 2W82A 2DTZA 4AIKA 1TTYA 2QSFX 2JK3A 4HZFA 3IV5A 1OLTA 5FLXK 1ZQ3P 3TMOA 1J5YA 3L9FA 4IJAA 1W5CC 3GTLJ 3F3XA 4E7ZA 1B4AA 2YX4A 2EZLA 1RR8C 3RDIA 1FBQA 3OSFA 3T8TA 2NNYA 4PJLA 2JSCA 4BS9A 1ETOA 3HKZN 1H9GA 1UG2A 1LVKA 5E8IA 1LEAA 3F8NA 5DD4A 3RQ4A 5FRMA 2P7CB 2EA2A 2D1HA 2IGOA 1LDJA 2X9DA 3I3LA 3R60A 2VJIA 1D0YA 5GAHJ 1IGNA 1TQMA 2FQ3A 3KP6A 4G7OF 4XKVA 2DMTA 3BG6A 3PUFA 4W1UA 5CQEA 1MDMA 3VODA 4UUSB 1HDPA 2BY0A 3F8BA 4HLYA 1WCMJ 3CUQC 2HEOA 1KU9A 1C0WA 4WWCA 4LIUA 3C7JA 2OU2A 1BW6A 2JJ7A 5LLQA 1FSEA 1PVEA 2KDZA 1TWFJ 4P55A 3VYRB 2OD5A 1MBFA 1MBKA 2QSGX 2GXGA 3KLNA 2CW7A 4PFPA 4HRIA 3WTSC 3FKIJ 1FP2A 5J1RA 1R71A 1ZRFA 3K4LA 1P7JA 2STTA 5E3NA 2X1CA 2QEXI 3HPGA 1G4DA 2F5CA 2NOGA 4CUGA 2MLKA 4Q5SF 2ZNYA 4JOMA 3ABKH 1Y56A 3CP8A 3O8HA 2QYOA 5KK1A 3CCRI 2R7XA 3T0YA 4N4NB 2VT2A 1RUNA 3VFZA 4MQVA 4QSHA 1I50J 4OWRB 5D6EA 4MO7A 3GX4X 3FZVA 2H6BA 2I8DA 2XGCA 3GVAA 4RM3A 5FJ8J 2KQRA 2K9QA 2W57A 3HSFA 1AHDP 4LD5A 1MNMC 2LF8A 2DK5A 3I4NJ 2B63J 5ED4A 1EH6A 2FMLA 3Q5FA 1OR7C 4EM0B 4D7NA 4IO9F 3I0TA 3VYUB 3OS0A 3L2WA 1YRNB 4HF0A 4ZYHA 3CCEI 3W6KB 2QSHX 2UV1A 3V42A 1IN5A 5ICGA 2L9NA 3E6BA 4PGHA 5F27A 3JAMZ 1OYIA 4JP0A 2QWWA 5FRNA 5TISC 4XRSA 5K7HA 2L4AA 4AIJA 2IP2A 2R7VA 2IBDA 2HQAA 1FT9A 3GO5A 4S04A 4HSTA 3OR1C 2LTPA 1B8IA 3ZMUA 4RB0A 2R7OA 4M6VA 3DU6A 4E7LA 1EV7A 4C3JJ 3E6CC 2A61A 3TKYA 1FP1D 1I39A 1HXDA 3O3KA 2EINH 2RDPA 1IAWA 2KZVA 1Y6IA 1OISA 4ZTJA 4UUVA 3P9KA 1HSJA 1G6NA 4UVAA 1A6IA 1BI3A 5J4YA 1NG6A 2R7RA 2OCEA 1N78A 3CDHA 5J3LA 2DA1A 1V4RA 2FU4A 1ETYA 3K2ZA 3JTGA 1O7LA 2CV0A 1IXRC 2ICWG 1G2HA 3OS2A 1WKMA 4Y3OA 1PDNC 4I02A 4I76A 2FBHA 4XSXF 5H2FC 4YG2F 1TNSA 1IO2A 4II2A 1W0TA 4YFKF 1K83J 3E5QA 3F8MA 5F04A 4E7KA 3BC8A 3BOQA 2L7MP 4HSRA 1STZA 4HNTA 3HOVJ 1IXSB 2PN6A 2M4KA 2JUCA 1TWAJ 4RAYA 4P9UA 4PSWA 4A3GJ 3RQIA 2WV1A 2WV0A 1PUEE 2LLKA 1WJEA 5GPCA 2VJ5A 2W48A 1WHUA 2F5FA 1N77A 1I1SA 2M0CA 2EQRA 2XF6A 3ERMA 4AD9A 2HR3A 2BHZA 4M6XA 5JR3A 2VE9A 3U2RA 1YIJI 3JW4A 3GTPJ 4ENJA 3H0GJ 3A01B 2X0LA 2WAQA 5EEGA 2ZJRF 1YHQI 3K2AA 3V4GA 2YS9A 2JZYA 3FXKA 3M1CA 3KEYA 1J7KA 2A69F 2HWVA 3AG3H 1H9TA 1ZRDA 3CCSI 3K1MA 3V8KA 2PJRB 1SD4A 4UUTA 2V1XA 2Z99A 2EH3A 2ZFWA 1SEUA 1FYLA 3R0AA 4MHGA 2Q2EB 4XOTA 2E60A 4KNYA 4RM2A 4U0VA 4WXCA 1YW9A 3W2WA 4A3IJ 1FTZA 2G9WA 3FWEA 2PMUA 3MZYA 3ELKA 3JRAA 2M1BA 5J1YA 5EG0B 1PP7U 2G0EA 1CF7B 1MJ9A 1BJZA 2XASA 3F8CA 4M9XA 5CLSA 3ULQB 1BA5A 1RNLA 3UR3C 3MZHA 2HZDA 1V5GA 5J1UA 1IN8A 1MH4A 1K78B 1TQIA 1ZG5A 1QO0D 4P96A 2ISZA 4BKXA 4ZZLA 3PFYA 1OYYA 3BR0A 1DGWY 1I6XA 3LAPA 2IGNA 1G3YA 2L9SA 2HOSA 3FF5A 2DFHA 4NDLA 4C2UA 2QKMB 2KLOA 2Z9OA 3BR2A 4I0AA 3DBLB 2CJJA 2KJBA 4QPQA 4HDVA 3AL0B 2RAEA 4KISA 2A6HF 2CUZA 1B72B 4RGRA 3E6DA 2CWEA 4IRIA 3C18A 3J81K 1ETXA 3NWSA 5HNFA 3H9JA 2ME6A 1BM9A 3HOWJ 2JT1A 4CO8A 5JHUA 4WX9A 1XPXA 4QIWN 4KT6A 2PBIA 3DTKA 2COBA 3RKWA 2J5PA 4KN7X 2CW8A 4TV7A 4CYCA 2GXAA 2XUBA 4IHXA 3GTQJ 5DV5A 1TL8A 4IHYA 4HX7A 1WVRA 3SZGA 2HOAA 3CQZJ 2V9PA 2E2HJ 1DP3A 2XB5A 5DTDA 2R5ZA 3OYLA 2HXOA 2M8GX 1T56A 2OUMA 3A0HC 3H0DA 1W5SA 2K85A 2G7UA 4RB2C 1HW2A 3LQRA 1H8AC 4RA2A 5A2QZ 3QOEA 1WJFA 2H1KA 1O3TA 3PSIA 1K79A 3TBIA 3DCFA 4XSZF 5E8GA 3HRTA 2R7SA 3MAJA 3DPLC 2HOEA 3R4KA 4QPOA 2Y31A 1ZTRA 3AG2H 3DPUA 4KFCA 4AC0A 2X6XA 3BG3A 3KZYA 5GTHC 1K61A 1W4MA 2LVSA 2ZO4A 3IAM2 3WG9A 5DM6F 5JVGF 4B48A 1VQ9I 2R93J 3BPXA 1R1UA 3IH2A 2H8RA 3SZPA 3I4MJ 1USSA 2NNNA 3MKLA 1MDMB 2DYRH 1N25A 1VNDA 4DZPA 4ENMA 3VOEA 3H9GA 1I6HJ 1MBEA 1A04A 1QPIA 1BN5A 2BXZA 2YU3A 4U88A 2V1NA 1HKQA 1TC3C 3U21A 3ZQ7A 2KRCA 2HZTA 2FUG2 3CDIA 1LFUP 1VQLI 1SD6A 4FT8A 2GBYA 2A6TA 2NVTJ 4GRIA 4IX7A 2V4JC 5BS6A 1ZR4A 3RKXA 1WI9A 1FYMA 4DGWB 3IC7A 4ZDPA 3PFIA 4FTHA 4FE7A 5TRDA 2QBYA 5GPAA 2PMHA 1P6RA 2XRNA 4LITA 4S05A 4ENNA 3HDDA 1IF1A 4NC8A 1MW7A 1X1PA 1R22A 2GQQA 1LB2A 2ELKA 2X6YA 3E1SA 5HLIA 4D5CA 3N4MA 3MWMA 1XN7A 1AA7A 3BCAA 2L7FP 3ZMZA 5CPRB 1JUPA 3RYPA 2X6WA 2E2JJ 3HOYJ 3H5RA 2LD5A 3BR1A 3S1QJ 3GEZA 2XB0X 4OMZA 3UNGC 3RPUD 1VQOI 3M8EA 3TO6A 1ACIA 2FBIA 4PSXA 1U0JA 2RN7A 2DA5A 4L9VA 3B02A 2RVCA 2E1OA 2OQGA 4AIDA 4YIFA 4DQ2A 3S3OA 1IG7A 3S14J 1ZRCA 2BBYA 4BGDA 1SD5A 3L1PA 4UV8A 1T08B 1Y0UA 2M5WA 3SDBA 3GYHX 2P7VB 3SFIA 2FNPA 1R4NB 4LG3A 2LOOA 1WJBA 3PL8A 4AUXA 4ESJA 3UKGA 1X58A 2VQHA 2E1MB 3VSLA 4AVPA 1W7PD 1RKTA 1YE9A 3P9CA 5HLHA 1RKWA 3WTVC 2Z16A 1JE8A 4PJJA 5JFRA 5D5XB 1RETA 1A35A 2M8EA 5IOYA 1QBJA 4B4CA 1Z67A 4ZYGA 4CCMA 1B8IB 1IN4A 2M34A 3BZ6A 3ZN1A 2Z1DA 4XLCA 4JK1X 4UB8C 3JRGA 3PJRA 2VIXA 3HRMA 5F6FA 3P5JA 1FEXA 2EJRA 3JRBA 4YFXF 2YPRA 3A0BC 4DIQA 1LUJB 3OYBA 1Z6TA 2IA1A 3Q0UA 2VONA 4ESFA 4EM2A 5HDNA 1POGA 4QLCU 2P6TA 4JX6A 4A3BJ 2HDDA 1JTXA 2E34A 1YX5A 4G6TB 1BBYA 2R7QA 2PFBA 2O6GE 2A07F 1Y1WJ 1ZAOA 3FMQA 3IL2A 2D5VA 3FK7A 2BEOA 3GF2A 3V7CA 3ZQLA 1Z91A 2BY3A 2GAUA 4Q48A 4CYDA 1BOBA 2CU7A 1HLVA 2KJCA 4LIVA 3LSGA 4BE1A 3K4NA 2EIMH 1R5HA 3KP2A 3QYFA 1R58A 4L5JA 3M4OJ 2LKSA 2VN2A 1A5JA 1U3EM 2V6EA 1RI7A 2AS5F 2EV6A 1B6AA 1Y1VJ 1P4WA 1XC5A 2H27A 3GMEA 5FKLA 1M1EB 4DJAA 2OAZA 2E2IJ 5F1JA 2BW3A 3R0JA 3D5RC 2FOKA 2UXXA 2P0WA 3LSKA 1RESA 3ZGKA 3G1OA 3H3VK 5E17F 2VBWA 3GZNB 1FSHA 3BTCA 4F55A 3L00A 2NXNB 2VLAA 3F0CA 2ZJPF 5FROA 2VB6A 4AIHA 4V19K 3PO2J 3D0SA 2E5NA 2EZKA 5D8LB 3RJPA 1SMYF 4EGYA 3LNQA 4IHSA 3U9GA 2PEXA 2ECBA 2R7FA 2ZJ2A 2GA1A 3D5SC 3MFKA 4XKCA 4F93B 3A2KA 2LP0A 3QU6A 4CDGA 3CCUI 1TP4A 2F5DA 1G8XA 2GA2A 5JVTA 1VQ6I 5HS7A 1J0RA 2R7DA 4L18B 4I98B 4C2MJ 4RGSA 2X48A 4ON0A 3C2HA 2HYGD 3IWFA 2MW8A 2K4BA 4YELA 3GWZA 5FGMA 1X3UA 3VWBA 4L9JA 4N0BA 4PJNA 2FA5A 2R7TA 2DMNA 2L2OA 2MH9A 2XAHA 1YI2I 1WJCA 1S5LC 2DU9A 2JSPA 2XSJC 3VYTB 1T8IA 4HLXA 3WODF 2GWRA 1QHGA 3H5AA 2XAFA 1RIOH 2BV6A 2ZC2A 4B3AA 4HAMA 1Z3YA 1A6QA 1UELB 4JX4A 2Y75A 4RLQA 1S6LA 2VI6A 3G3ZA 1V5EA 2VQLA 3ABMH 2XAGA 2XROA 4IHTA 3DV8A 2Y30A 3HJEA 3G6EI 1IUFA 1FJLA 2DQLA 1KU3A 2STWA 3QYBA 3DXJF 1XDUA 4MFDA 2NOJB 2MSYA 2UXNA 3ZR8X 1K4SA 2EWNA 2OV7A 3M07A 1HSTA 1WGXA 2M3AA 2XSDC 2Y0SA 4Z6YA 2QENA 4CYCB 3CESA 5GADJ 1ZN2A 3HSRA 1TBXA 4LFUA 5E79C 4RDUA 2LY1A 2VASA 4C2TA 1U9NA 5AONA 4N9HA 3R6SA 2JRTA 2R5ZB 3RZDJ 4BXUA 1YJWI 1S9HA 4CXFA 2CQNA 4DW6A 2XAQA 2F6CA 4IOCF 1LFPA 2EBIA 4BDZA 3MKZA 1TWGJ 3DEUA 1UZCA 1ZK8A 2EFOA 1ZG1A 2E7WA 3DWLE 1S7AA 1D5YA 2ZXIA 3HEFA 2Z33A 4KDPA 1P4AA 1W5TA 5KVRA 2PMZA 3BJOA 1YYVA 1T2KA 2ZKZA 2NS7A 2WB1A 4I01A 4BYYA 3OR2C 1RPWA 3TP0A 3GZ5A 3F21A 1YOVB 3B73A 4P1WA 3ONQA 2BE5F 4U0YA 3K4KA 4IVNA 1VQ5I 4OU0A 3FKJA 2D2WA 3CCYA 2MG4A 2M2EA 3HRUA 5C4JJ 2W00A 2FSWA 3L09A 3OYAA 4A3CJ 5B3SH 1DGRM 3GZ6A 2H1LA 3E5UA 3LA3A 3I4PA 4NC6A 2HPMA 1LJ9A 3QPHA 2DT5A 4NQWA 4RAGA 1MMDA 1VF9A 1R5GA 4M3BA 3MD2A 3NAUA 4LLLA 3ZOBA 5GAEJ 4AM3A 2VQCA 3TQNA 2GLOA 3TDZC 4OAYA 4A0ZA 3C1DA 2X4HA 5K5OA 1U78A 4GXOA 4I09A 4Y4RA 5IT3A 2QVOA 2H09A 4KICA 4GYIA 2QBYB 1BI2A 2DCEA 3FISA 4X1EA 1OCZH 1SVMA 2K9NA 3SDGA 1HC8A 3K1NA 4A5MA 1O3QA 3N97A 1YS6A 3J7ZI 3MN2A 4M9SA 1IW7F 2BXYA 1DPRA 2CMPA 4H4KC 1SD7A 5FKMA 2RC4A 3SZTA 2BY2A 1ON2A 4HYEA 5LBQA 2DMQA 1BJAA 5H20A 4S0HB 1BIBA 2E19A 2Y9ZA 2DAOA 4AYBA 4BQOA 2Y0MA 4I99C 4IL6C 2CV2A 4O3MA 2H6CA 1MJAA 3QPLA 3IRRA 3M9AA 4PK4A 4JYKA 2EILH 2DOAA 1W7PA 3E3VA 4KA4A 4BAYA 2IJLA 1X3WB 4BDYA 1G3TA 3K1PA 4ZJZA 4PCQA 2E71A 3K10A 4HX8A 4NUBA 2I5UA 3TO9A 3Q9VA 4XORA 1BIAA 1FOYA 2YU9J 4DOZA 1QPMA 1XD7A 5K1YA 2FX0A 4MFEA 2GXBA 2VODA 3WGHA 2LRDA 4EGZA 2LYCA 5L3EA 1Z1DA 5CQGA 2IT0A 1X4OA 1UFMA 4XR6A 4XBFA 1T38A 2V79A 3Q9SA 4EJWA 4IF4A 4F7ZA 2MD5A 4G6DA 4MIMA 4GYGA 1U8BA 2P5KA 5ICFA 4GDFA 2DQRA 4XONA 5HDKA 1E3PA 3KEQA 3PO3J 1RC9A 4KIFA 4UVCA 1H89C 4XIDA 2KIQA 4I7HA 2K02A 4A6EA 4BEHA 1Q1VA 2YSRA 4C9YA 4EJUA 2DFFA 3LSTA 4PUSA 1KGSA 1D0ZA 3FHZA 2X1EA 1K4TA 3LFUA 4A0YA 4OINF 1GHCA 1OCOH 4ANJA 1MJBA 1S8NA 4NC7A 3ZQIA 3SXYA 1P2FA 3HYIA 2V9KA 2O5RA 3CTAA 4XLHA 1WH5A 2R5YA 3MEXA 4XL9A 5CVRA 2JWTA 4CCJA 2LKXA 5LHGA 2RNGA 3TW7A 3LSRA 4XNFA 4L9NA 4BQNA 1OMIA 4OIOF 3CCLI 1V3FA 1KQ0A 1XMAA 1ZREA 3I59A 1GV5A 3IWZA 3WG7H 5D4RA 5GP9A 2CGPA 1TWHJ 1NK3P 1LEBA 5B66C 1MBJA 4EJOA 2AXLA 2RKHA 1K7AA 4CZCA 3FXJA 4OOIA 4MTEA 5KCMA 4B47A 2O8KA 3AG4H 1JKQC 4YIIA 3OIOA 3OIPA 1J75A 2MFZA 3OYIA 3RPQA 3AKZA 2ZMEA 3MQ0A 2F5EA 3KX2A 2JPCA 2GOXB 4BE0A 1LE8A 2BW3B 2W1OA 3I53A 3RKYA 3DF8A 1YLFA 2FD5A 3TOBA 3BJAA 1Z77A 4B43A 2DO7A 3K7AJ 5E3LA 2IGMA 4E7JA 5J40A 1IV6A 3M7GA 2WADA 3ZMDA 1FIPA 1D8KA 1U5TA 1XB4A 2FRHA 4L9TA 3E6MA 1TT0A 2O8XA 4EJVA 1F43A 2OZUA 3BG7A 2HS5A 1Q1HA 1WJ5A 4ENKA 4O6JA 5DYMA 5CVJA 2XAUA 5M3FJ 1DPUA 4ZC3A 4Y7NJ 1T0FC
chains in the Genus database with same CATH topology
3HBLA 2CQXA 2DMPA 4FTHA 1GV2A 4FE7A 2XPUA 5GPAA 1R9TJ 2L9RA 3HDDA 2WAQN 3A01A 1SANA 1OCTC 2HOTA 2ELKA 5C4XJ 4D5CA 5FKKA 4C3HJ 2L7FP 1OFCX 1JUPA 1QVUA 1DU0A 5FLVA 2E2JJ 1UHSA 2EZIA 3HOYJ 2XPVA 2LD5A 5EGOB 3BR1A 3S1QJ 3JRFA 1F36A 4AYBN 2DA2A 2DA7A 2XB0X 5BNGA 2JA7J 4ABZA 2DA5A 2ID3A 4BBSJ 4A3MJ 2N8GA 3S1NJ 2E1OA 1DU6A 1IG7A 2DA6A 3S14J 5EG0A 4JX5A 4A93J 1JUMA 2DA3A 3B6AA 2HXIA 3L1PA 2R92J 4EEFG 1T33A 3WHBA 4XICA 3SFIA 2FQ4A 4A69C 1HF0A 1W0UA 4BY7J 4AUXA 2P81A 1MBHA 3TW6A 3UKGA 1X58A 2AHQA 1S7EA 4W97A 2M9HA 3CMYA 3TP3A 3BG9A 1RKTA 3JRDA 2K9SA 2XGDA 5JLXA 1WPKA 5F0CA 1RKWA 3QPSA 1RETA 3HOXJ 5IOYA 2L0KA 4B4CA 1B8IB 1SFOJ 4XRSG 1AKHB 1B72A 3S2DJ 2M34A 4BXXJ 1APLC 5EF6A 4M3EA 3JRGA 1IRZA 3ZQCA 3ZQFA 1IC8A 1FEXA 1MSFC 5M5YJ 4BY1J 3JRBA 3OOUA 2ME0A 2OF7A 2IEKA 3Q0UA 1POGA 2CQQA 1OCPA 4GFBA 5EDNA 4JX6A 2ZB9A 4MLOA 4A3BJ 3GTJJ 2HDDA 1VI0A 1MSEC 2R0QC 1JTXA 1ETKA 1Z0XA 2HI3A 2DTZA 3ZQGA 1ZGWA 1AU7A 2JK3A 2Y2ZA 3IV5A 1Y1WJ 1X2MA 3Q0WA 3FK7A 1ZQ3P 1JJ8C 3B6CA 2D5VA 4A3DJ 3ZQLA 3GTLJ 2CU7A 1HLVA 2NVYJ 1GVDA 2EZLA 2OPTA 3OSFA 3LSGA 3LOCA 1ETOA 3HKZN 2VUMJ 3M4OJ 1A5JA 1UG2A 3TEDA 3GTMJ 1Y1VJ 1XC5A 2X9DA 5EEAA 1WH7A 1IGNA 5FKLA 3GBGA 1BW5A 2DMTA 4W1UA 5DS9A 2E2IJ 5F1JA 4UUSB 1JJ6C 4IHWA 5IOZA 1HDPA 1P7IA 3G1MA 1WCMJ 2MGQA 4A3JJ 3BTLA 1JTYA 1RESA 2JA5J 3G1OA 3H3VK 3QQAA 3BTCA 4IHVA 1LFBA 3F0CA 3MVPA 1BW6A 2CRGA 1PUFA 2JJ7A 3BR5A 3PO2J 2EZKA 3BR3A 4M3FA 2KDZA 1TWFJ 3ZQHA 1MBFA 3LNQA 1MBKA 2DA4A 3LSPA 1O4XA 3HGGA 5C44J 3GTKJ 3FKIJ 2ECBA 1H88C 5J1RA 2LP0A 4A3LJ 2KT0A 1P7JA 5FKNA 2VPRA 5E3NA 1EF4A 2NOGA 4D7MA 4C2MJ 4BBRJ 3FK6A 2X48A 3SJMA 3G1LA 3S1MJ 4IEJA 2VKVA 2MW8A 3O8HA 3VPRA 1E3OC 4QSHA 5IYBJ 2XGEA 1I50J 2LFBA 5C3EJ 5IPAA 2DMNA 3JR9A 4MO7A 5EGOA 4QTRA 2VKEA 2XGCA 5FJ8J 2K9QA 5FKOA 1AHDP 2EZHA 1FIAA 4A3KJ 1MNMC 1JKOC 2HYJA 4B3AA 1OJLA 4FISA 4V2FA 2B63J 3I4NJ 5M5WJ 4JX4A 2X6OA 1QVTA 2VI6A 3OSGA 4J19A 3W6VA 3BTJA 4D7NA 3GTGJ 2I10A 2Y30A 1IUFA 1FJLA 2LR8A 1IDZA 4B1RA 1YRNB 4MFDA 2R7ZJ 2MSYA 5F27A 4JP0A 2DJNA 5JLWA 5K7HA 2Y9YA 4XRSA 1HCRA 1WGXA 2IBDA 1RR7A 2XSDC 4CYCB 1XS9A 2QF7A 2LTPA 2NVQJ 4RDUA 1B8IA 1JT6A 4M6VA 1U9NA 2JMWA 4M3DA 4C3JJ 1AKHA 1FTTA 2JN6A 3A02A 2R5YB 2R5ZB 2CUFA 3RZDJ 2QCOA 2NVXJ 1IDYA 3M3YJ 4DW6A 2EBIA 3JRCA 1TWGJ 1A6IA 1ZK8A 5IP9J 3BG5A 1D5YA 5J3LA 3HEFA 2DA1A 1JT0A 1ETYA 3JREA 3JRIA 5M3MJ 2NS7A 1RPWA 3TP0A 1G2HA 4I6ZA 5IYDJ 1NTCA 3S16J 1X2NA 1LE8B 4I76A 2L7ZA 3BT9A 2K40A 3CCYA 2MG4A 2M2EA 5C4JJ 2DN0A 4A3CJ 1W0TA 1K83J 5F04A 3PM1A 2L7MP 2TRTA 3HOVJ 5K7FA 1VF9A 1TWCJ 4D5FA 4Y52J 4M3BA 1TWAJ 1U9OA 3Q3SA 3NAUA 3ZOBA 4A3GJ 3A03A 2WV1A 3RQIA 1GT0C 5IYCJ 1HOMA 2GLOA 3IH3A 4UUSA 2LLKA 5GPCA 5K7ZA 5M5XJ 2W48A 1GDTA 1U78A 2M0CA 2EQRA 3HB9A 1JGGA 1ITYA 3FISA 4X1EA 4L5EA 3SDGA 2K9NA 3GTPJ 3H0GJ 3A01B 5HODA 1BL0A 3S1RJ 3K2AA 2YS9A 3MN2A 1JUSA 1QRYA 2DMUA 5FKMA 3O8GA 2YUSA 4UUTA 2CUEA 5EZHA 2EH3A 2DMQA 4S0HB 2E19A 1WI3A 2O9LA 2Y9ZA 3BTIA 3HOZJ 4A3IJ 1FTZA 4FE4A 3QPLA 3LSJA 4JYKA 1ETQA 4A3FJ 4G12A 3JRAA 3S17J 4C3IJ 5J1YA 5EG0B 2G0EA 3FIWA 1BJZA 1BA5A 1ZKGA 3BQYA 2YU9J 5J1UA 1MH4A 1JKRC 5FLMJ 3JRHA 2FX0A 4MFEA 3IH4A 4BKXA 2HQ5A 1HDDC 4DYCA 2GM4A 3CDLA 4V2GA 5F08A 1IJWC 3BR0A 2FJ1A 2HOSA 4NDLA 3RZOJ 2TCTA 4MIMA 3BR2A 2CJJA 1U8BA 1MH3A 2RAEA 1B72B 9ANTA 4DZJA 1ZR2A 1YRNA 3PO3J 5F0FA 1H89C 4XIDA 1GUUA 2IAIA 3HOUJ 1ENHA 1ETXA 4HNVA 1Q1VA 2ME6A 5IP6A 2ID6A 3HOWJ 4LOCA 1UMQA 3S2HJ 5F0HA 2Y0SN 4QIWN 3BR6A 2COBA 4CYCA 1NK2P 4IHXA 3E7LA 3GTQJ 3NARA 4IHYA 2HOAA 3CQZJ 3ZQIA 2E2HJ 2XB5A 5IP7J 2R5YA 5DTDA 1WH5A 2R5ZA 2HXOA 2LY9A 2M8GX 2NS8A 1T56A 2JWTA 2LKXA 3HGYA 3TW7A 3LSRA 5EZGA 3C2BA 5E3OA 2XPWA 1H8AC 2XRLA 2H1KA 3D1NI 3DEWA 3DCFA 1GV5A 2O7OA 2AO9A 5GP9A 4XRMA 1TWHJ 1NK3P 2PMZN 2LK2A 2Y31A 1ZTRA 1MBJA 2WB1N 4AC0A 3BG3A 5EYRA 1I3QJ 1K61A 5E3MA 1ORKA 2O8KA 3GTOJ 3S15J 1JKQC 2LVSA 2R93J 3OIOA 4XK4A 2ECCA 4RBOA 1VFCA 3IH2A 2H8RA 3BQZA 3I4MJ 3MKLA 1CQTA 1LE8A 4X6AJ 1VNDA 4DZPA 1XG1A 2JA6J 2FD5A 3Q0VA 1I6HJ 1MBEA 4A3EJ 1Z77A 1QPIA 1ETVA 3K7AJ 5E3LA 1IV6A 4DYRA 1TC3C 3RKQA 1FIPA 4DYQA 1LFUP 1MBGA 1PUFB 1F43A 3WHCA 2GBYA 2JA8J 1ETWA 4FCYA 2NVTJ 1JKPC 3HM5A 1ZR4A 5M3FJ 4M3GA 4Y7NJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HBL A;  2CQX A;  2DMP A;  4FTH A;  1GV2 A;  4FE7 A;  2XPU A;  5GPA A;  1R9T J;  2L9R A;  3HDD A;  2WAQ N;  3A01 A;  1SAN A;  1OCT C;  2HOT A;  2ELK A;  5C4X J;  4D5C A;  5FKK A;  4C3H J;  2L7F P;  1OFC X;  1JUP A;  1QVU A;  1DU0 A;  5FLV A;  2E2J J;  1UHS A;  2EZI A;  3HOY J;  2XPV A;  2LD5 A;  5EGO B;  3BR1 A;  3S1Q J;  3JRF A;  1F36 A;  4AYB N;  2DA2 A;  2DA7 A;  2XB0 X;  5BNG A;  2JA7 J;  4ABZ A;  2DA5 A;  2ID3 A;  4BBS J;  4A3M J;  2N8G A;  3S1N J;  2E1O A;  1DU6 A;  1IG7 A;  2DA6 A;  3S14 J;  5EG0 A;  4JX5 A;  4A93 J;  1JUM A;  2DA3 A;  3B6A A;  2HXI A;  3L1P A;  2R92 J;  4EEF G;  1T33 A;  3WHB A;  4XIC A;  3SFI A;  2FQ4 A;  4A69 C;  1HF0 A;  1W0U A;  4BY7 J;  4AUX A;  2P81 A;  1MBH A;  3TW6 A;  3UKG A;  1X58 A;  2AHQ A;  1S7E A;  4W97 A;  2M9H A;  3CMY A;  3TP3 A;  3BG9 A;  1RKT A;  3JRD A;  2K9S A;  2XGD A;  5JLX A;  1WPK A;  5F0C A;  1RKW A;  3QPS A;  1RET A;  3HOX J;  5IOY A;  2L0K A;  4B4C A;  1B8I B;  1SFO J;  4XRS G;  1AKH B;  1B72 A;  3S2D J;  2M34 A;  4BXX J;  1APL C;  5EF6 A;  4M3E A;  3JRG A;  1IRZ A;  3ZQC A;  3ZQF A;  1IC8 A;  1FEX A;  1MSF C;  5M5Y J;  4BY1 J;  3JRB A;  3OOU A;  2ME0 A;  2OF7 A;  2IEK A;  3Q0U A;  1POG A;  2CQQ A;  1OCP A;  4GFB A;  5EDN A;  4JX6 A;  2ZB9 A;  4MLO A;  4A3B J;  3GTJ J;  2HDD A;  1VI0 A;  1MSE C;  2R0Q C;  1JTX A;  1ETK A;  1Z0X A;  2HI3 A;  2DTZ A;  3ZQG A;  1ZGW A;  1AU7 A;  2JK3 A;  2Y2Z A;  3IV5 A;  1Y1W J;  1X2M A;  3Q0W A;  3FK7 A;  1ZQ3 P;  1JJ8 C;  3B6C A;  2D5V A;  4A3D J;  3ZQL A;  3GTL J;  2CU7 A;  1HLV A;  2NVY J;  1GVD A;  2EZL A;  2OPT A;  3OSF A;  3LSG A;  3LOC A;  1ETO A;  3HKZ N;  2VUM J;  3M4O J;  1A5J A;  1UG2 A;  3TED A;  3GTM J;  1Y1V J;  1XC5 A;  2X9D A;  5EEA A;  1WH7 A;  1IGN A;  5FKL A;  3GBG A;  1BW5 A;  2DMT A;  4W1U A;  5DS9 A;  2E2I J;  5F1J A;  4UUS B;  1JJ6 C;  4IHW A;  5IOZ A;  1HDP A;  1P7I A;  3G1M A;  1WCM J;  2MGQ A;  4A3J J;  3BTL A;  1JTY A;  1RES A;  2JA5 J;  3G1O A;  3H3V K;  3QQA A;  3BTC A;  4IHV A;  1LFB A;  3F0C A;  3MVP A;  1BW6 A;  2CRG A;  1PUF A;  2JJ7 A;  3BR5 A;  3PO2 J;  2EZK A;  3BR3 A;  4M3F A;  2KDZ A;  1TWF J;  3ZQH A;  1MBF A;  3LNQ A;  1MBK A;  2DA4 A;  3LSP A;  1O4X A;  3HGG A;  5C44 J;  3GTK J;  3FKI J;  2ECB A;  1H88 C;  5J1R A;  2LP0 A;  4A3L J;  2KT0 A;  1P7J A;  5FKN A;  2VPR A;  5E3N A;  1EF4 A;  2NOG A;  4D7M A;  4C2M J;  4BBR J;  3FK6 A;  2X48 A;  3SJM A;  3G1L A;  3S1M J;  4IEJ A;  2VKV A;  2MW8 A;  3O8H A;  3VPR A;  1E3O C;  4QSH A;  5IYB J;  2XGE A;  1I50 J;  2LFB A;  5C3E J;  5IPA A;  2DMN A;  3JR9 A;  4MO7 A;  5EGO A;  4QTR A;  2VKE A;  2XGC A;  5FJ8 J;  2K9Q A;  5FKO A;  1AHD P;  2EZH A;  1FIA A;  4A3K J;  1MNM C;  1JKO C;  2HYJ A;  4B3A A;  1OJL A;  4FIS A;  4V2F A;  2B63 J;  3I4N J;  5M5W J;  4JX4 A;  2X6O A;  1QVT A;  2VI6 A;  3OSG A;  4J19 A;  3W6V A;  3BTJ A;  4D7N A;  3GTG J;  2I10 A;  2Y30 A;  1IUF A;  1FJL A;  2LR8 A;  1IDZ A;  4B1R A;  1YRN B;  4MFD A;  2R7Z J;  2MSY A;  5F27 A;  4JP0 A;  2DJN A;  5JLW A;  5K7H A;  2Y9Y A;  4XRS A;  1HCR A;  1WGX A;  2IBD A;  1RR7 A;  2XSD C;  4CYC B;  1XS9 A;  2QF7 A;  2LTP A;  2NVQ J;  4RDU A;  1B8I A;  1JT6 A;  4M6V A;  1U9N A;  2JMW A;  4M3D A;  4C3J J;  1AKH A;  1FTT A;  2JN6 A;  3A02 A;  2R5Y B;  2R5Z B;  2CUF A;  3RZD J;  2QCO A;  2NVX J;  1IDY A;  3M3Y J;  4DW6 A;  2EBI A;  3JRC A;  1TWG J;  1A6I A;  1ZK8 A;  5IP9 J;  3BG5 A;  1D5Y A;  5J3L A;  3HEF A;  2DA1 A;  1JT0 A;  1ETY A;  3JRE A;  3JRI A;  5M3M J;  2NS7 A;  1RPW A;  3TP0 A;  1G2H A;  4I6Z A;  5IYD J;  1NTC A;  3S16 J;  1X2N A;  1LE8 B;  4I76 A;  2L7Z A;  3BT9 A;  2K40 A;  3CCY A;  2MG4 A;  2M2E A;  5C4J J;  2DN0 A;  4A3C J;  1W0T A;  1K83 J;  5F04 A;  3PM1 A;  2L7M P;  2TRT A;  3HOV J;  5K7F A;  1VF9 A;  1TWC J;  4D5F A;  4Y52 J;  4M3B A;  1TWA J;  1U9O A;  3Q3S A;  3NAU A;  3ZOB A;  4A3G J;  3A03 A;  2WV1 A;  3RQI A;  1GT0 C;  5IYC J;  1HOM A;  2GLO A;  3IH3 A;  4UUS A;  2LLK A;  5GPC A;  5K7Z A;  5M5X J;  2W48 A;  1GDT A;  1U78 A;  2M0C A;  2EQR A;  3HB9 A;  1JGG A;  1ITY A;  3FIS A;  4X1E A;  4L5E A;  3SDG A;  2K9N A;  3GTP J;  3H0G J;  3A01 B;  5HOD A;  1BL0 A;  3S1R J;  3K2A A;  2YS9 A;  3MN2 A;  1JUS A;  1QRY A;  2DMU A;  5FKM A;  3O8G A;  2YUS A;  4UUT A;  2CUE A;  5EZH A;  2EH3 A;  2DMQ A;  4S0H B;  2E19 A;  1WI3 A;  2O9L A;  2Y9Z A;  3BTI A;  3HOZ J;  4A3I J;  1FTZ A;  4FE4 A;  3QPL A;  3LSJ A;  4JYK A;  1ETQ A;  4A3F J;  4G12 A;  3JRA A;  3S17 J;  4C3I J;  5J1Y A;  5EG0 B;  2G0E A;  3FIW A;  1BJZ A;  1BA5 A;  1ZKG A;  3BQY A;  2YU9 J;  5J1U A;  1MH4 A;  1JKR C;  5FLM J;  3JRH A;  2FX0 A;  4MFE A;  3IH4 A;  4BKX A;  2HQ5 A;  1HDD C;  4DYC A;  2GM4 A;  3CDL A;  4V2G A;  5F08 A;  1IJW C;  3BR0 A;  2FJ1 A;  2HOS A;  4NDL A;  3RZO J;  2TCT A;  4MIM A;  3BR2 A;  2CJJ A;  1U8B A;  1MH3 A;  2RAE A;  1B72 B;  9ANT A;  4DZJ A;  1ZR2 A;  1YRN A;  3PO3 J;  5F0F A;  1H89 C;  4XID A;  1GUU A;  2IAI A;  3HOU J;  1ENH A;  1ETX A;  4HNV A;  1Q1V A;  2ME6 A;  5IP6 A;  2ID6 A;  3HOW J;  4LOC A;  1UMQ A;  3S2H J;  5F0H A;  2Y0S N;  4QIW N;  3BR6 A;  2COB A;  4CYC A;  1NK2 P;  4IHX A;  3E7L A;  3GTQ J;  3NAR A;  4IHY A;  2HOA A;  3CQZ J;  3ZQI A;  2E2H J;  2XB5 A;  5IP7 J;  2R5Y A;  5DTD A;  1WH5 A;  2R5Z A;  2HXO A;  2LY9 A;  2M8G X;  2NS8 A;  1T56 A;  2JWT A;  2LKX A;  3HGY A;  3TW7 A;  3LSR A;  5EZG A;  3C2B A;  5E3O A;  2XPW A;  1H8A C;  2XRL A;  2H1K A;  3D1N I;  3DEW A;  3DCF A;  1GV5 A;  2O7O A;  2AO9 A;  5GP9 A;  4XRM A;  1TWH J;  1NK3 P;  2PMZ N;  2LK2 A;  2Y31 A;  1ZTR A;  1MBJ A;  2WB1 N;  4AC0 A;  3BG3 A;  5EYR A;  1I3Q J;  1K61 A;  5E3M A;  1ORK A;  2O8K A;  3GTO J;  3S15 J;  1JKQ C;  2LVS A;  2R93 J;  3OIO A;  4XK4 A;  2ECC A;  4RBO A;  1VFC A;  3IH2 A;  2H8R A;  3BQZ A;  3I4M J;  3MKL A;  1CQT A;  1LE8 A;  4X6A J;  1VND A;  4DZP A;  1XG1 A;  2JA6 J;  2FD5 A;  3Q0V A;  1I6H J;  1MBE A;  4A3E J;  1Z77 A;  1QPI A;  1ETV A;  3K7A J;  5E3L A;  1IV6 A;  4DYR A;  1TC3 C;  3RKQ A;  1FIP A;  4DYQ A;  1LFU P;  1MBG A;  1PUF B;  1F43 A;  3WHC A;  2GBY A;  2JA8 J;  1ETW A;  4FCY A;  2NVT J;  1JKP C;  3HM5 A;  1ZR4 A;  5M3F J;  4M3G A;  4Y7N J; 
#chains in the Genus database with same CATH topology
 5B1A H;  2EIK H;  2XIG A;  4BUP A;  2DMP A;  1HA8 A;  2DI3 A;  5CVU A;  5HDG A;  2CSO A;  1TW3 A;  2XPU A;  2L9R A;  3CP2 A;  2MD0 A;  2VQG A;  2WAQ N;  1E3H A;  3DTI A;  3BZK A;  1OCT C;  3QRF F;  2HOT A;  3K4B A;  3WGI A;  3BZC A;  3JAM K;  2K5C A;  4N4O B;  3H35 A;  4C3H J;  2HDC A;  3L2Q A;  1OFC X;  3QOP A;  1DU0 A;  5FLV A;  3PNY A;  2EZI A;  1X1D A;  2DXI A;  2CW0 F;  1J2X A;  2HVR A;  2O03 A;  1IRF A;  3D5L A;  5BNG A;  1Y39 A;  4BNC A;  3AL0 C;  4XKW A;  4ABZ A;  5FD5 A;  2GIV A;  1KON A;  4YRV A;  2ID3 A;  3I9V 2;  3L2C A;  3GFM A;  4UB6 C;  3S32 A;  5LGU A;  3W2A A;  4JX5 A;  3VDX A;  1Z6R A;  1R6R A;  2IS4 A;  3GFI A;  2L7K A;  1V5F A;  4G9Y A;  2R92 J;  3CJN A;  3EUK L;  2AQE A;  1Z7L A;  3DU5 A;  1T33 A;  3TOA A;  2ZXH A;  3WHB A;  3ZQQ A;  4A69 C;  1FNN A;  5DUI A;  2PG4 A;  3MKY B;  4RAF A;  1MBH A;  1Z7U A;  3BY6 A;  2WC2 A;  4W97 A;  3CMY A;  1ZEL A;  3TP3 A;  4KIT B;  1WJD A;  1T95 A;  5LD2 C;  1QZZ A;  2DDB A;  4QWQ A;  1WPK A;  5F0C A;  3JCU C;  3REO A;  3QPS A;  4HEA 2;  3H5N A;  3H3Z A;  3HOX J;  1WQ2 A;  2VPL A;  3S2D J;  2F4I A;  2W7N A;  2JVG A;  1QNT A;  3H3U A;  1WZ2 A;  3T1B A;  4M3E A;  1YW7 A;  2ADU A;  3K0L A;  5EF6 A;  3ZQF A;  1IRZ A;  3ZCO A;  2A5W A;  2DFE A;  1D3Y A;  1ZYR F;  2EV0 A;  3MCZ A;  3DFG A;  2R7W A;  3LL7 A;  5BPD A;  3OOU A;  1ZLJ A;  2ZBK A;  5FFX A;  2OF7 A;  2IEK A;  5HNH A;  3S93 A;  1JHH A;  2ZNZ A;  5EDN A;  3CJT B;  4GFB A;  4A12 A;  3GTJ J;  4ZYA A;  3ML6 A;  2JQ7 A;  5J8F A;  2W24 A;  1ETK A;  1AU7 A;  1R49 A;  3VYS B;  4RB3 C;  1A36 A;  1B59 A;  2B9S A;  1X2M A;  1JJ8 C;  3B6C A;  3IRQ A;  1WFX A;  4HQM A;  3V8J A;  2NVY J;  1FOK A;  1ZG3 A;  2P4W A;  2XV4 S;  1D1C A;  3EQL F;  4ZTF A;  3GFL A;  5LRR A;  3LOC A;  4IPA A;  2MLG A;  1RUO A;  4X0G A;  4OAZ A;  1G3S A;  3TED A;  1LVA A;  1NHA A;  3HUG A;  2UZK A;  4RB1 A;  2ACJ A;  5TJJ A;  4NQW B;  1KZH A;  5B5E C;  2K86 A;  1EKE A;  5EEA A;  1WH7 A;  3F6V A;  5HS8 A;  4HW0 A;  3EUH A;  3I5U A;  4E7I A;  5DS9 A;  1SFK A;  5ERI A;  2VXZ A;  2TDX A;  4HOB A;  3G1M A;  1R23 A;  3BP8 A;  3BTL A;  5FB2 A;  3DLL F;  3OYD A;  1Y8Q B;  3K4C A;  4WF2 A;  1XGO A;  5FD6 A;  2V26 A;  1E2X A;  1MGT A;  2HQR A;  2V7F A;  1XSX A;  3QQA A;  5IT9 Z;  4IHV A;  4J01 A;  5D5W B;  1LFB A;  1XMK A;  1MMG A;  1QGP A;  3BR5 A;  1ZAR A;  3TO7 A;  1Z21 A;  3BR3 A;  3OMY A;  3BWG A;  4M3F A;  1LKX A;  3KEO A;  2ETH A;  1L0O C;  2DA4 A;  3BLY A;  1O4X A;  1MMS A;  2Y69 H;  1L3L A;  2O0Y A;  5C44 J;  1QZY A;  4OIR F;  2CH0 A;  1R5I D;  2KMU A;  4GGG A;  1H88 C;  3DTE A;  5DUK A;  3BDD A;  5JHF A;  4A6D A;  1X4P A;  3OYK A;  2RGV A;  1EF4 A;  2EFP A;  3V7S A;  5AIP A;  3W6J B;  4D7M A;  4BBR J;  3SJM A;  4IEJ A;  1W7P B;  3CUQ A;  1KU2 A;  2VKV A;  4BJT A;  2E1M C;  1FMW A;  2E1C A;  4KUM A;  4N9I A;  2HNH A;  4OIQ F;  5IYB J;  1P92 A;  2XGE A;  2LFB A;  5C3E J;  3JR9 A;  5BQT A;  1X19 A;  1IN6 A;  2XKO A;  4ZH4 F;  2VKE A;  4QTR A;  5EGO A;  1FZP B;  3CUO A;  3FDY A;  4UHT A;  3C3W A;  1JI8 A;  4IQ4 A;  1IXC A;  3H92 A;  1UST A;  4P5O A;  1JKO C;  2HYJ A;  1XX5 A;  4FIS A;  4V2F A;  1IRX A;  5A2Q K;  2L4M A;  3WTW C;  2P5L C;  2EPF A;  1QVT A;  1XTA A;  2P6S A;  4YFN F;  3W6V A;  3BTJ A;  2VL8 A;  1OKR A;  3GTG J;  4NB5 A;  2I10 A;  3WU1 B;  4XLE A;  4PFO A;  2DT6 A;  4XMY A;  3LAJ A;  2ESH A;  3FBN B;  2HTJ A;  3KP5 A;  4BEH B;  3QAH A;  4LG0 A;  2KL4 A;  1D1A A;  1HCR A;  1NH3 A;  4II3 A;  1RR7 A;  2JRM A;  4M71 A;  1XS9 A;  3PNT A;  3DBR B;  2QF7 A;  3F72 A;  2NVQ J;  3CF2 A;  4MEX F;  2YX7 A;  1JT6 A;  2COM A;  3U1D A;  3G4S I;  1ZLK A;  1AKH A;  2ESN A;  2F4M B;  2LKP A;  1FTT A;  2JN6 A;  2KIU A;  4L0Z B;  3F9K A;  2R5Y B;  3FM5 A;  3J7A Y;  2CUF A;  2CV1 A;  2NS0 A;  1HW5 A;  1R00 A;  2QCO A;  3OYJ A;  2NVX J;  3OV8 A;  4KYW A;  2VOP A;  1IDY A;  4AVZ A;  2QM3 A;  5H6R A;  1BI1 A;  4GO1 A;  1OR7 A;  3I59 B;  5IP9 J;  2M7A A;  4PJ0 C;  2VT3 A;  3CO6 C;  2ZJQ F;  2CG4 A;  2XVC A;  1JT0 A;  3EYI A;  2EIJ H;  2CO5 A;  4JBA A;  2WY7 Q;  2HU9 A;  4MTD A;  1O3R A;  4KIG A;  3QPT A;  4LLG F;  4IRG A;  5HOO A;  2M87 A;  1DUX C;  4HNU A;  4XN3 A;  3KET A;  4I6Z A;  5IYD J;  1GLN A;  4WCG A;  2ZME B;  1O7F A;  3M1E A;  4UVB A;  1LE8 B;  3G2B A;  1MMN A;  1FYK A;  2L7Z A;  1YJ9 I;  1SC7 A;  1KQ9 A;  1ONV A;  2IA0 A;  3E5X A;  2K40 A;  4MQ9 F;  2OTJ I;  4CZZ A;  3PM1 A;  2IW5 A;  1FPQ A;  2NVU B;  1U5T B;  2TRT A;  3SEZ A;  4D5F A;  1TWC J;  4Y52 J;  2WA0 A;  2EK5 A;  1U9O A;  4CCK A;  2EA4 A;  1HOM A;  5D8K B;  3EUA A;  4U87 A;  1P9Q C;  4ETS A;  4G7Z F;  1VZ0 A;  5H6Q A;  3NEU A;  3BRO A;  2NRA C;  5DCM A;  5K7Z A;  5M5X J;  5CJ9 A;  1GDT A;  2CUJ A;  3SQN A;  4IKF A;  1LPQ A;  1AWC A;  4M9Z A;  2KIM A;  1D1B A;  4RAZ A;  1JGG A;  1N75 A;  3ESW B;  3HG9 A;  4L5E A;  1F5T A;  1FBU A;  1BL0 A;  3S1R J;  1XCV A;  2RNJ A;  5FLX Z;  3RCO A;  4L0Y B;  1JUS A;  5L3F A;  3QYE A;  3LA2 A;  3TDU C;  1X1A A;  2OC6 A;  3LWF A;  3FMS A;  3O8G A;  2YUS A;  3GUD A;  3DKX A;  4HPQ A;  3FXM A;  5EZH A;  4I0B A;  1XSD A;  1FOW A;  2A6E F;  5AIQ A;  2VC1 A;  1MKM A;  1B9M A;  1FWZ A;  2O9L A;  3FHN A;  4A5N A;  3CMM A;  1VTN C;  3EDP A;  3GCM A;  2WAF A;  3CCQ I;  2DFI A;  5DD8 A;  5K5Q A;  2HVS A;  1ETQ A;  4G12 A;  3EET A;  4L5I A;  3DKY A;  3CC2 I;  3S17 J;  3CME I;  3FIW A;  5DCF A;  1ZKG A;  1TQP A;  4DBR A;  4HV6 A;  3DLA A;  1JKR C;  5FLM J;  3WTT C;  4Q4Z F;  4LK0 F;  5DDG A;  3KYL A;  2HQ5 A;  5L3D A;  1OQY A;  4KJZ A;  4DYC A;  2GM4 A;  3CDL A;  2OBP A;  4PZJ A;  2D1V A;  3L7W A;  3JTH A;  2QA4 I;  4B09 A;  3IHU A;  1RRJ A;  2LDU A;  3H9Q A;  2HKX A;  5GAG J;  5D6F A;  3RZO J;  2H8W A;  1I3A A;  4KIB A;  3NQO A;  3IP4 B;  1KU7 A;  2TCT A;  1VQK I;  1MH3 A;  2WAE A;  3VEP A;  2B7E A;  9ANT A;  4DZJ A;  2Z2S B;  1ZR2 A;  1IRG A;  5F0F A;  3DKW A;  1GUU A;  2IAI A;  2QLZ A;  4BL0 B;  3HOU J;  3FXU A;  3ZXS A;  1VQM I;  2E36 A;  2W25 A;  3K9T A;  5B1B H;  3S2H J;  2L5Q A;  5F0H A;  2Y0S N;  3PQJ A;  3BR6 A;  5E1W A;  2LH9 A;  2IGK A;  4BXF A;  4Y13 A;  2Y48 A;  3ECO A;  2X51 A;  3NAR A;  2ZCW A;  1VQ4 I;  1R36 A;  4IXA A;  2BVL A;  2J5O A;  3OL4 A;  5E1X A;  5IP7 J;  3HSE A;  1FC3 A;  2LY9 A;  2QGU A;  4DNC A;  1IZ1 A;  3CJR B;  2X1D A;  4RS8 A;  2F5V A;  1VQP I;  3M8J A;  4ZZD A;  5EZG A;  3EUH C;  2LBF A;  1BC7 C;  1SMT A;  2XRL A;  3D1N I;  2PX9 A;  5IY5 H;  2O7O A;  4IOA F;  1HQC A;  4XRM A;  1K6Y A;  4XLF A;  4C30 A;  3J80 K;  2PMZ N;  2LK2 A;  1MNE A;  1BC8 C;  2F2E A;  2XDV A;  1WRJ A;  3GFJ A;  2VKH A;  3HKZ A;  3DPT A;  2WB1 N;  3HUG B;  3HOS A;  3IAS 2;  1ODD A;  3WU2 C;  4MNU A;  4CH7 A;  5EYR A;  3KP4 A;  4ASN A;  1KYW A;  5E3M A;  1ORK A;  3GTO J;  3LSI A;  1VFC A;  3BQZ A;  2DPD A;  4WXH A;  5BOX A;  2JVH A;  1XGS A;  4X6A J;  3FXL A;  1YIT I;  1XG1 A;  2JA6 J;  4FHT A;  3AFH A;  3Q0V A;  3FXO A;  1IV8 A;  2MC3 A;  1ETV A;  2JUG A;  3OYN A;  3CLQ A;  2DYS H;  3QU3 A;  3SFZ A;  4BAC A;  5LGT A;  2DLL A;  3RKQ A;  1JXS A;  1WJA A;  3FXR A;  3LSM A;  2XAJ A;  1MBG A;  4KT5 C;  4HX4 A;  2K7L A;  3G71 I;  1ETW A;  2Z5U A;  5J8C A;  3RPU A;  4FCY A;  2XKP A;  1MD0 A;  3HM5 A;  1YQA A;  4KMF A;  2Q8K A;  2OCC H;  3R61 A;  1OYW A;  1S7O A;  2CQX A;  2VBZ A;  1E17 A;  1UCR A;  1GV2 A;  2IXS A;  2EFW A;  4RLF A;  3DEE A;  1R9T J;  4AWX B;  3S3N A;  4I2O A;  3WU0 A;  4YIR X;  3NWT A;  2Q1Z B;  1SFE A;  3OOP A;  5FKK A;  3CUQ B;  1ULY A;  1YTY A;  5FO5 A;  5ICC A;  4LB5 A;  1QU3 A;  4YEJ A;  2QQB A;  1QVU A;  1SVO A;  5TGT A;  2D45 A;  2OA4 A;  2RQQ A;  2IS2 A;  2P5V A;  2QKL B;  2M7B A;  1UHM A;  5EGO B;  5L3G A;  3JRF A;  1WSU A;  1F36 A;  1I5Z A;  4IRH A;  2DA2 A;  2DA7 A;  3U1K A;  4AYB N;  2VKD A;  3OYF A;  2FBK A;  2WY8 Q;  4CA0 A;  3HL2 A;  2E5Z A;  2XF5 A;  4M74 A;  2JA7 J;  1YG2 A;  2JPB A;  4PDK A;  4UXN A;  4BBS J;  3BJ6 A;  4GCV A;  4A3M J;  4FQG A;  2LC2 A;  3T8R A;  1DU6 A;  2VC0 A;  2DA6 A;  1TW2 A;  4A93 J;  1JUM A;  1QHH D;  2ELJ A;  2V1D A;  3KP3 A;  2DK8 A;  5ILU A;  4CCO A;  3KIO A;  1TT5 B;  2HFH A;  3A4C A;  3I64 A;  4XIC A;  2FQ4 A;  1WWX A;  2IPQ X;  4HG2 A;  3P7N A;  3AAF A;  2K9L A;  3RI4 A;  2FNA A;  3FMR A;  3KCC A;  4BE2 A;  2IRF G;  4LLN A;  2P81 A;  5DEQ A;  3HIF A;  1U8R A;  3BG9 A;  4LG0 B;  3JRD A;  1AOY A;  1HKS A;  4UNO A;  4M72 A;  3I71 A;  3SEQ A;  4G6Q A;  3HXL A;  3MMY B;  2R7U A;  2O61 A;  3LFK A;  3BPV A;  2KHM A;  4XRS G;  4EV0 A;  1AKH B;  2W84 A;  1APL C;  3G73 A;  4XRF A;  3OY9 A;  3OS1 A;  1LQ1 A;  4CSW A;  4XQF A;  1BI0 A;  1IC8 A;  1MSF C;  4LK1 F;  5M5Y J;  2DDA A;  4BY1 J;  5FFZ A;  3K6G A;  2ZXJ A;  3QP5 A;  5L3B A;  1U6G A;  2ME0 A;  1T39 A;  5LHH A;  2E7X A;  1FOX A;  2KIS A;  2CQQ A;  1OCP A;  2F4O B;  4CIC A;  5EJC A;  3QP6 A;  3M8F A;  4BJ5 C;  1EA3 A;  3CLO A;  4R79 A;  1MSE C;  1Z0X A;  3HRS A;  3ZQG A;  1ZGW A;  1EJ9 A;  2Y2Z A;  3GXO A;  3K4J A;  5JI6 A;  2PLY A;  4U0W A;  4LMY A;  3Q0W A;  3K4M A;  4A3D J;  4J00 A;  2VBY A;  3J7A O;  1I1G A;  5CVI A;  1YJN I;  2Q0O A;  1GVD A;  2OPT A;  4BQQ A;  4Y33 A;  3RSN A;  5LEJ A;  2VUM J;  1D0X A;  2FMY A;  3DBH B;  3WE3 A;  4UV9 A;  5EEH A;  3OWT A;  4XKB A;  3GTM J;  2CFX A;  4D0P A;  2IS1 A;  3FX3 A;  2RQP A;  3J81 Z;  1V54 H;  4M6Y A;  3GBG A;  1BW5 A;  3HHH A;  2M4G A;  1VQ8 I;  4ESB A;  4E70 A;  2DOE A;  5KNL A;  3CMA I;  1G59 A;  1JJ6 C;  1IUY A;  4BHP A;  4IHW A;  2VJJ A;  2MAB A;  1P7I A;  3VSK A;  5IOZ A;  5DCM B;  2MGQ A;  5D4S A;  4A3J J;  2NYX A;  1JTY A;  4LJZ F;  3HTS B;  4BJ6 C;  2JA5 J;  2GOM A;  2KRF A;  3I58 A;  4OIP F;  1X1B A;  2O3F A;  3LQQ A;  4U7D A;  3KE2 A;  1DP7 P;  2WBM A;  3RTR A;  3MVP A;  2CRG A;  4AU7 A;  1PUF A;  4ZYD A;  3FXQ A;  4XLP F;  2DJI A;  2HYF A;  3ZQH A;  2E35 A;  1R1V A;  3LSP A;  1F4K A;  2FF4 A;  3HGG A;  2R4G A;  1ON1 A;  2A05 A;  1GVJ A;  2ZSI B;  3O6B B;  4FET A;  2M0M A;  5CVV A;  2FE3 A;  4KMU X;  3GTK J;  2YR2 A;  3F8F A;  4A3L J;  1W36 C;  2KT0 A;  2P8T A;  1ZGA A;  4Y17 A;  5FKN A;  2VPR A;  4OMY A;  3KLO A;  1X3Z B;  2AXT C;  2F48 A;  3FK6 A;  3G1L A;  3S1M J;  3GLX A;  4B3X A;  4E4H A;  1P4X A;  2HDW A;  1RZ4 A;  4NBQ A;  3MZ8 A;  2E1N A;  3VPR A;  1E3O C;  3COA C;  1SFX A;  2KRH A;  3ASN H;  4Y15 A;  1MND A;  4A2U A;  3KYD B;  4O5V A;  3RYR A;  2DOD A;  1YFH A;  5IPA A;  2B0L A;  3V7R A;  2KP6 A;  5F64 A;  1Z3X A;  2BYV E;  1B9N A;  5GTI C;  1JGS A;  2DOF A;  5FKO A;  4HQE A;  1O57 A;  2EZH A;  1FIA A;  1U2W A;  4A3K J;  4MGR A;  4BU2 A;  4ITV A;  5HVQ C;  1YX3 A;  3PQK A;  3ROU A;  3CCJ I;  1OJL A;  2LG4 A;  3OYG A;  3F23 A;  1ZH5 A;  2LY2 A;  5M5W J;  2X6O A;  2PQ8 A;  3X2Q H;  1VQN I;  3OSG A;  4J19 A;  3HC7 A;  3KYC B;  1UG0 A;  2JA2 A;  3HZJ A;  2W4S A;  4EAT A;  2LR8 A;  1IDZ A;  3P9I A;  4B1R A;  3GLL A;  3JSO A;  2WWY A;  4Q47 A;  5D5V B;  2K4J A;  2R7Z J;  4CCN A;  3ABL H;  2XC7 A;  2DJN A;  2R3S A;  5JLW A;  3JSP A;  2Y9Y A;  4FX0 A;  2GIZ A;  1SAX A;  5LFA A;  5LHI A;  5D5U B;  1HW1 A;  3S3M A;  2L54 A;  4EQQ A;  2JMW A;  4M3D A;  2DBB A;  3T5X A;  3HOT A;  1OCC H;  3A02 A;  2BVM A;  5E18 F;  1VQ7 I;  2RRE A;  1PP8 F;  3M3Y J;  3E97 A;  2LBF B;  1W36 D;  3JRC A;  1REP C;  4XOP A;  1YS7 A;  3CJQ B;  5KAF C;  4F92 B;  3BG5 A;  3WGG A;  4E7H A;  5L3C A;  3ERE D;  4WXD A;  1O3S A;  3N05 A;  3LA7 A;  2L3D A;  3JRE A;  1OPC A;  4G8X A;  3OYH A;  3JRI A;  4PJM A;  1FMV A;  5M3M J;  4LB6 B;  3A1Y A;  4BHB A;  2VJ4 A;  4EVI A;  4K2E A;  2EB7 A;  1DQU A;  1G3W A;  4FAS D;  1NTC A;  2IA2 A;  2UWM A;  1W1W E;  3S16 J;  1X2N A;  4E6K G;  3BT9 A;  2G7H A;  2VOO A;  4KN4 X;  2HQN A;  3ZN0 A;  2RV8 A;  3HHG A;  4JQF A;  2DN0 A;  2FEZ A;  2OZ6 A;  3I56 I;  4CHU A;  2KKO A;  5ICE A;  2HKO A;  3TGN A;  5K7F A;  3CD6 I;  2V9V A;  3VB2 A;  3WE2 A;  2V1U A;  1UB9 A;  1R7J A;  2UUZ A;  3Q3S A;  5F1R A;  5DM7 F;  3A03 A;  1GT0 C;  5IYC J;  3IH3 A;  4F3Q A;  4UUS A;  4WK8 F;  2NAZ A;  4HF1 A;  3K70 C;  1H0M A;  4RGU A;  1SFU A;  1MZB A;  2QUF A;  3GW2 A;  4D9J A;  3HTU A;  3HB9 A;  4B44 A;  2ISY A;  4XLA A;  4B8X A;  5HLG A;  1J59 A;  1ITY A;  1E0E A;  4F52 A;  3CF5 F;  4G7H F;  3ASO H;  5HOD A;  2QQA A;  5J6X A;  3QOD A;  3WTY C;  1J9I A;  3NRV A;  3CCM I;  2KIF A;  3V8L A;  2KDO A;  2JTV A;  5ILV A;  1QRY A;  3OYM A;  2DMU A;  4P9F A;  3W2V A;  5CKT A;  3AG1 H;  3PIO F;  2CUE A;  4NHJ A;  2VBX A;  2MH2 A;  2X85 A;  3ISP A;  3CZ6 A;  2CYY A;  1V55 H;  1XGN A;  1WI3 A;  1FY7 A;  3OIQ A;  2K9M A;  3BTI A;  3L2U A;  4UY8 I;  3KZZ A;  3HOZ J;  4FE4 A;  2L02 A;  1BR4 A;  3LSJ A;  4A3F J;  1PYV A;  3IUO A;  4XM3 A;  1S29 A;  2FXA A;  1NG7 A;  1X1C A;  1BR1 A;  1TLH B;  2EV5 A;  3KPH A;  4C3I J;  1ERD A;  1A31 A;  1D5V A;  4BQA A;  3BQY A;  3EYY A;  3CC7 I;  1SAU A;  3F6O A;  3H36 A;  1BOA A;  3JRH A;  1R1T A;  3IH4 A;  5LRS A;  1Y8R B;  1HDD C;  1QA6 A;  2LRE A;  4FX4 A;  4V2G A;  5F08 A;  1IJW C;  1MIJ A;  4CCL A;  1T6S A;  2FJ1 A;  3SYT A;  2A5Y B;  1LDD A;  2A3S A;  3SHF A;  4IQJ A;  3PNV A;  1KYZ A;  2MBF A;  4M73 A;  1Z9C A;  3F22 A;  3K70 D;  4ZDO A;  1YRN A;  2ZSH B;  1UJ8 A;  3H1C A;  1YIO A;  2K3P A;  2PI0 A;  1ENH A;  4HNV A;  1F1Z A;  5IP6 A;  2DW4 A;  2ID6 A;  3I55 I;  1LNW A;  4LOC A;  1UMQ A;  5KAI C;  2XF7 A;  2ZME C;  4EM1 A;  1NK2 P;  3E7L A;  1T98 A;  1XCB A;  3S2W A;  2M30 A;  4H0E A;  2CQK A;  4ZYE A;  1I27 A;  2HVQ A;  1S72 I;  3S8P A;  3KP7 A;  2BGC A;  3I54 A;  5IT9 K;  3ZMS A;  2NS8 A;  3HGY A;  3C2B A;  2KZG A;  1FLI A;  3IKT A;  1U5T C;  3LMM A;  4EMS A;  5E3O A;  2XPW A;  2QQ8 A;  2EFQ A;  3ZP5 A;  5J47 A;  3CCV I;  3ZMT A;  3DEW A;  1LDK B;  2AO9 A;  4G94 A;  4U7B A;  2CQ7 A;  4EJT A;  2HPI A;  4XN0 A;  1I3Q J;  2CFO A;  1IN7 A;  3S15 J;  2OQR A;  6PAX A;  4XK4 A;  2ECC A;  4RBO A;  3OYE A;  1JHF A;  1CQT A;  4ZDL A;  2M45 A;  2DTR A;  1TZL A;  1ZHF A;  2LNB A;  3FM3 A;  5HS9 A;  4BHC A;  1GXP A;  1EH7 A;  1KA8 A;  4A3E J;  4BH9 A;  1XMX A;  3E0J B;  3ABU A;  4A0X A;  3IKV A;  4DYR A;  3MKW B;  3FBI B;  5LGN A;  4HF2 A;  4DYQ A;  1XSV A;  2IVM A;  3DQV C;  1MMA A;  3LSH A;  5J4V A;  4D1Q A;  1PUF B;  3DP7 A;  3WHC A;  2JA8 J;  2A68 F;  3KZI C;  3J7Y J;  3W3C A;  1YW8 A;  1JKP C;  4R1H A;  4M3G A;  3RIR A;  3PSF A;  2QQ9 A;  5BMZ A;  3ZMV A;  3HBL A;  2H94 A;  2IS6 A;  3BCB A;  3ZRG A;  2CS3 A;  3OYC A;  5KHD A;  2LSO A;  3CO7 C;  2VE8 A;  1SVL A;  1OCR H;  4NNJ A;  3PIP F;  2LMD A;  2AQF A;  3A01 A;  1ZGJ A;  1SAN A;  1R4M B;  2KPM A;  4XLN F;  3PUB A;  3OL3 A;  2FOW A;  1UAA A;  3J80 Z;  5C4X J;  1K6O A;  2HTS A;  3KFW X;  3HPH A;  2BHY A;  2DT7 B;  2W85 A;  2PJR A;  1UHW A;  5LEK A;  2XHK A;  1QQI A;  1UHS A;  5BPI A;  2XPV A;  5CYV A;  3C2G A;  2Z3Y A;  5ILS A;  5HLT A;  2Q2E A;  4HV5 A;  1Z05 A;  1BR2 A;  2MYS A;  2N8G A;  3S1N J;  2PJP A;  3O2P E;  3ABT A;  2K3F A;  1T0F A;  3K69 A;  5EG0 A;  2LF7 A;  4HA8 A;  3WTX C;  1CF7 A;  1CGP A;  2K27 A;  5E1Z B;  3WTU C;  2DA3 A;  3B6A A;  5E20 A;  1S3J A;  1KQ8 A;  2C6Y A;  2HXI A;  4E7S A;  4EEF G;  1K78 A;  4R8H A;  1HF0 A;  1W0U A;  1FX7 A;  4Z2Y A;  4RMN A;  1B1B A;  4BY7 J;  4HDU A;  2BOL A;  3TW6 A;  3CC4 I;  2AHQ A;  1S7E A;  1HKT A;  2OTL I;  2M9H A;  1GXQ A;  3QWL A;  2KFD A;  2GZW A;  2K9S A;  4LGW A;  1Y0N A;  2L9V A;  2V6C A;  2XGD A;  2ZXW H;  2ZFU A;  4MEY F;  5JLX A;  4DBQ A;  4IZZ A;  1YO5 C;  2L01 A;  2HGC A;  1FBS A;  1HBX G;  2EFN A;  3ZPL A;  2L0K A;  1DDN A;  1EH8 A;  1SFO J;  1B72 A;  4BXX J;  1QZE A;  1XDS A;  3ECH A;  3L2V A;  3ZQC A;  4F91 B;  2VXD A;  1J09 A;  1PJR A;  5K5R A;  1D8J A;  1TNT A;  2OJE D;  2ELH A;  2MC4 A;  3EPZ A;  2WTE A;  4RGX A;  2BZT A;  1XGM A;  4HBL A;  4PGG A;  3TL4 X;  2BY1 A;  2DPU A;  2ZB9 A;  4MLO A;  3WTZ A;  2MA3 A;  2QZ8 A;  4CGZ A;  1VI0 A;  2XGX A;  3L2R A;  1F9N A;  2R0Q C;  2HI3 A;  2W82 A;  2DTZ A;  4AIK A;  1TTY A;  2QSF X;  2JK3 A;  4HZF A;  3IV5 A;  1OLT A;  5FLX K;  1ZQ3 P;  3TMO A;  1J5Y A;  3L9F A;  4IJA A;  1W5C C;  3GTL J;  3F3X A;  4E7Z A;  1B4A A;  2YX4 A;  2EZL A;  1RR8 C;  3RDI A;  1FBQ A;  3OSF A;  3T8T A;  2NNY A;  4PJL A;  2JSC A;  4BS9 A;  1ETO A;  3HKZ N;  1H9G A;  1UG2 A;  1LVK A;  5E8I A;  1LEA A;  3F8N A;  5DD4 A;  3RQ4 A;  5FRM A;  2P7C B;  2EA2 A;  2D1H A;  2IGO A;  1LDJ A;  2X9D A;  3I3L A;  3R60 A;  2VJI A;  1D0Y A;  5GAH J;  1IGN A;  1TQM A;  2FQ3 A;  3KP6 A;  4G7O F;  4XKV A;  2DMT A;  3BG6 A;  3PUF A;  4W1U A;  5CQE A;  1MDM A;  3VOD A;  4UUS B;  1HDP A;  2BY0 A;  3F8B A;  4HLY A;  1WCM J;  3CUQ C;  2HEO A;  1KU9 A;  1C0W A;  4WWC A;  4LIU A;  3C7J A;  2OU2 A;  1BW6 A;  2JJ7 A;  5LLQ A;  1FSE A;  1PVE A;  2KDZ A;  1TWF J;  4P55 A;  3VYR B;  2OD5 A;  1MBF A;  1MBK A;  2QSG X;  2GXG A;  3KLN A;  2CW7 A;  4PFP A;  4HRI A;  3WTS C;  3FKI J;  1FP2 A;  5J1R A;  1R71 A;  1ZRF A;  3K4L A;  1P7J A;  2STT A;  5E3N A;  2X1C A;  2QEX I;  3HPG A;  1G4D A;  2F5C A;  2NOG A;  4CUG A;  2MLK A;  4Q5S F;  2ZNY A;  4JOM A;  3ABK H;  1Y56 A;  3CP8 A;  3O8H A;  2QYO A;  5KK1 A;  3CCR I;  2R7X A;  3T0Y A;  4N4N B;  2VT2 A;  1RUN A;  3VFZ A;  4MQV A;  4QSH A;  1I50 J;  4OWR B;  5D6E A;  4MO7 A;  3GX4 X;  3FZV A;  2H6B A;  2I8D A;  2XGC A;  3GVA A;  4RM3 A;  5FJ8 J;  2KQR A;  2K9Q A;  2W57 A;  3HSF A;  1AHD P;  4LD5 A;  1MNM C;  2LF8 A;  2DK5 A;  3I4N J;  2B63 J;  5ED4 A;  1EH6 A;  2FML A;  3Q5F A;  1OR7 C;  4EM0 B;  4D7N A;  4IO9 F;  3I0T A;  3VYU B;  3OS0 A;  3L2W A;  1YRN B;  4HF0 A;  4ZYH A;  3CCE I;  3W6K B;  2QSH X;  2UV1 A;  3V42 A;  1IN5 A;  5ICG A;  2L9N A;  3E6B A;  4PGH A;  5F27 A;  3JAM Z;  1OYI A;  4JP0 A;  2QWW A;  5FRN A;  5TIS C;  4XRS A;  5K7H A;  2L4A A;  4AIJ A;  2IP2 A;  2R7V A;  2IBD A;  2HQA A;  1FT9 A;  3GO5 A;  4S04 A;  4HST A;  3OR1 C;  2LTP A;  1B8I A;  3ZMU A;  4RB0 A;  2R7O A;  4M6V A;  3DU6 A;  4E7L A;  1EV7 A;  4C3J J;  3E6C C;  2A61 A;  3TKY A;  1FP1 D;  1I39 A;  1HXD A;  3O3K A;  2EIN H;  2RDP A;  1IAW A;  2KZV A;  1Y6I A;  1OIS A;  4ZTJ A;  4UUV A;  3P9K A;  1HSJ A;  1G6N A;  4UVA A;  1A6I A;  1BI3 A;  5J4Y A;  1NG6 A;  2R7R A;  2OCE A;  1N78 A;  3CDH A;  5J3L A;  2DA1 A;  1V4R A;  2FU4 A;  1ETY A;  3K2Z A;  3JTG A;  1O7L A;  2CV0 A;  1IXR C;  2ICW G;  1G2H A;  3OS2 A;  1WKM A;  4Y3O A;  1PDN C;  4I02 A;  4I76 A;  2FBH A;  4XSX F;  5H2F C;  4YG2 F;  1TNS A;  1IO2 A;  4II2 A;  1W0T A;  4YFK F;  1K83 J;  3E5Q A;  3F8M A;  5F04 A;  4E7K A;  3BC8 A;  3BOQ A;  2L7M P;  4HSR A;  1STZ A;  4HNT A;  3HOV J;  1IXS B;  2PN6 A;  2M4K A;  2JUC A;  1TWA J;  4RAY A;  4P9U A;  4PSW A;  4A3G J;  3RQI A;  2WV1 A;  2WV0 A;  1PUE E;  2LLK A;  1WJE A;  5GPC A;  2VJ5 A;  2W48 A;  1WHU A;  2F5F A;  1N77 A;  1I1S A;  2M0C A;  2EQR A;  2XF6 A;  3ERM A;  4AD9 A;  2HR3 A;  2BHZ A;  4M6X A;  5JR3 A;  2VE9 A;  3U2R A;  1YIJ I;  3JW4 A;  3GTP J;  4ENJ A;  3H0G J;  3A01 B;  2X0L A;  2WAQ A;  5EEG A;  2ZJR F;  1YHQ I;  3K2A A;  3V4G A;  2YS9 A;  2JZY A;  3FXK A;  3M1C A;  3KEY A;  1J7K A;  2A69 F;  2HWV A;  3AG3 H;  1H9T A;  1ZRD A;  3CCS I;  3K1M A;  3V8K A;  2PJR B;  1SD4 A;  4UUT A;  2V1X A;  2Z99 A;  2EH3 A;  2ZFW A;  1SEU A;  1FYL A;  3R0A A;  4MHG A;  2Q2E B;  4XOT A;  2E60 A;  4KNY A;  4RM2 A;  4U0V A;  4WXC A;  1YW9 A;  3W2W A;  4A3I J;  1FTZ A;  2G9W A;  3FWE A;  2PMU A;  3MZY A;  3ELK A;  3JRA A;  2M1B A;  5J1Y A;  5EG0 B;  1PP7 U;  2G0E A;  1CF7 B;  1MJ9 A;  1BJZ A;  2XAS A;  3F8C A;  4M9X A;  5CLS A;  3ULQ B;  1BA5 A;  1RNL A;  3UR3 C;  3MZH A;  2HZD A;  1V5G A;  5J1U A;  1IN8 A;  1MH4 A;  1K78 B;  1TQI A;  1ZG5 A;  1QO0 D;  4P96 A;  2ISZ A;  4BKX A;  4ZZL A;  3PFY A;  1OYY A;  3BR0 A;  1DGW Y;  1I6X A;  3LAP A;  2IGN A;  1G3Y A;  2L9S A;  2HOS A;  3FF5 A;  2DFH A;  4NDL A;  4C2U A;  2QKM B;  2KLO A;  2Z9O A;  3BR2 A;  4I0A A;  3DBL B;  2CJJ A;  2KJB A;  4QPQ A;  4HDV A;  3AL0 B;  2RAE A;  4KIS A;  2A6H F;  2CUZ A;  1B72 B;  4RGR A;  3E6D A;  2CWE A;  4IRI A;  3C18 A;  3J81 K;  1ETX A;  3NWS A;  5HNF A;  3H9J A;  2ME6 A;  1BM9 A;  3HOW J;  2JT1 A;  4CO8 A;  5JHU A;  4WX9 A;  1XPX A;  4QIW N;  4KT6 A;  2PBI A;  3DTK A;  2COB A;  3RKW A;  2J5P A;  4KN7 X;  2CW8 A;  4TV7 A;  4CYC A;  2GXA A;  2XUB A;  4IHX A;  3GTQ J;  5DV5 A;  1TL8 A;  4IHY A;  4HX7 A;  1WVR A;  3SZG A;  2HOA A;  3CQZ J;  2V9P A;  2E2H J;  1DP3 A;  2XB5 A;  5DTD A;  2R5Z A;  3OYL A;  2HXO A;  2M8G X;  1T56 A;  2OUM A;  3A0H C;  3H0D A;  1W5S A;  2K85 A;  2G7U A;  4RB2 C;  1HW2 A;  3LQR A;  1H8A C;  4RA2 A;  5A2Q Z;  3QOE A;  1WJF A;  2H1K A;  1O3T A;  3PSI A;  1K79 A;  3TBI A;  3DCF A;  4XSZ F;  5E8G A;  3HRT A;  2R7S A;  3MAJ A;  3DPL C;  2HOE A;  3R4K A;  4QPO A;  2Y31 A;  1ZTR A;  3AG2 H;  3DPU A;  4KFC A;  4AC0 A;  2X6X A;  3BG3 A;  3KZY A;  5GTH C;  1K61 A;  1W4M A;  2LVS A;  2ZO4 A;  3IAM 2;  3WG9 A;  5DM6 F;  5JVG F;  4B48 A;  1VQ9 I;  2R93 J;  3BPX A;  1R1U A;  3IH2 A;  2H8R A;  3SZP A;  3I4M J;  1USS A;  2NNN A;  3MKL A;  1MDM B;  2DYR H;  1N25 A;  1VND A;  4DZP A;  4ENM A;  3VOE A;  3H9G A;  1I6H J;  1MBE A;  1A04 A;  1QPI A;  1BN5 A;  2BXZ A;  2YU3 A;  4U88 A;  2V1N A;  1HKQ A;  1TC3 C;  3U21 A;  3ZQ7 A;  2KRC A;  2HZT A;  2FUG 2;  3CDI A;  1LFU P;  1VQL I;  1SD6 A;  4FT8 A;  2GBY A;  2A6T A;  2NVT J;  4GRI A;  4IX7 A;  2V4J C;  5BS6 A;  1ZR4 A;  3RKX A;  1WI9 A;  1FYM A;  4DGW B;  3IC7 A;  4ZDP A;  3PFI A;  4FTH A;  4FE7 A;  5TRD A;  2QBY A;  5GPA A;  2PMH A;  1P6R A;  2XRN A;  4LIT A;  4S05 A;  4ENN A;  3HDD A;  1IF1 A;  4NC8 A;  1MW7 A;  1X1P A;  1R22 A;  2GQQ A;  1LB2 A;  2ELK A;  2X6Y A;  3E1S A;  5HLI A;  4D5C A;  3N4M A;  3MWM A;  1XN7 A;  1AA7 A;  3BCA A;  2L7F P;  3ZMZ A;  5CPR B;  1JUP A;  3RYP A;  2X6W A;  2E2J J;  3HOY J;  3H5R A;  2LD5 A;  3BR1 A;  3S1Q J;  3GEZ A;  2XB0 X;  4OMZ A;  3UNG C;  3RPU D;  1VQO I;  3M8E A;  3TO6 A;  1ACI A;  2FBI A;  4PSX A;  1U0J A;  2RN7 A;  2DA5 A;  4L9V A;  3B02 A;  2RVC A;  2E1O A;  2OQG A;  4AID A;  4YIF A;  4DQ2 A;  3S3O A;  1IG7 A;  3S14 J;  1ZRC A;  2BBY A;  4BGD A;  1SD5 A;  3L1P A;  4UV8 A;  1T08 B;  1Y0U A;  2M5W A;  3SDB A;  3GYH X;  2P7V B;  3SFI A;  2FNP A;  1R4N B;  4LG3 A;  2LOO A;  1WJB A;  3PL8 A;  4AUX A;  4ESJ A;  3UKG A;  1X58 A;  2VQH A;  2E1M B;  3VSL A;  4AVP A;  1W7P D;  1RKT A;  1YE9 A;  3P9C A;  5HLH A;  1RKW A;  3WTV C;  2Z16 A;  1JE8 A;  4PJJ A;  5JFR A;  5D5X B;  1RET A;  1A35 A;  2M8E A;  5IOY A;  1QBJ A;  4B4C A;  1Z67 A;  4ZYG A;  4CCM A;  1B8I B;  1IN4 A;  2M34 A;  3BZ6 A;  3ZN1 A;  2Z1D A;  4XLC A;  4JK1 X;  4UB8 C;  3JRG A;  3PJR A;  2VIX A;  3HRM A;  5F6F A;  3P5J A;  1FEX A;  2EJR A;  3JRB A;  4YFX F;  2YPR A;  3A0B C;  4DIQ A;  1LUJ B;  3OYB A;  1Z6T A;  2IA1 A;  3Q0U A;  2VON A;  4ESF A;  4EM2 A;  5HDN A;  1POG A;  4QLC U;  2P6T A;  4JX6 A;  4A3B J;  2HDD A;  1JTX A;  2E34 A;  1YX5 A;  4G6T B;  1BBY A;  2R7Q A;  2PFB A;  2O6G E;  2A07 F;  1Y1W J;  1ZAO A;  3FMQ A;  3IL2 A;  2D5V A;  3FK7 A;  2BEO A;  3GF2 A;  3V7C A;  3ZQL A;  1Z91 A;  2BY3 A;  2GAU A;  4Q48 A;  4CYD A;  1BOB A;  2CU7 A;  1HLV A;  2KJC A;  4LIV A;  3LSG A;  4BE1 A;  3K4N A;  2EIM H;  1R5H A;  3KP2 A;  3QYF A;  1R58 A;  4L5J A;  3M4O J;  2LKS A;  2VN2 A;  1A5J A;  1U3E M;  2V6E A;  1RI7 A;  2AS5 F;  2EV6 A;  1B6A A;  1Y1V J;  1P4W A;  1XC5 A;  2H27 A;  3GME A;  5FKL A;  1M1E B;  4DJA A;  2OAZ A;  2E2I J;  5F1J A;  2BW3 A;  3R0J A;  3D5R C;  2FOK A;  2UXX A;  2P0W A;  3LSK A;  1RES A;  3ZGK A;  3G1O A;  3H3V K;  5E17 F;  2VBW A;  3GZN B;  1FSH A;  3BTC A;  4F55 A;  3L00 A;  2NXN B;  2VLA A;  3F0C A;  2ZJP F;  5FRO A;  2VB6 A;  4AIH A;  4V19 K;  3PO2 J;  3D0S A;  2E5N A;  2EZK A;  5D8L B;  3RJP A;  1SMY F;  4EGY A;  3LNQ A;  4IHS A;  3U9G A;  2PEX A;  2ECB A;  2R7F A;  2ZJ2 A;  2GA1 A;  3D5S C;  3MFK A;  4XKC A;  4F93 B;  3A2K A;  2LP0 A;  3QU6 A;  4CDG A;  3CCU I;  1TP4 A;  2F5D A;  1G8X A;  2GA2 A;  5JVT A;  1VQ6 I;  5HS7 A;  1J0R A;  2R7D A;  4L18 B;  4I98 B;  4C2M J;  4RGS A;  2X48 A;  4ON0 A;  3C2H A;  2HYG D;  3IWF A;  2MW8 A;  2K4B A;  4YEL A;  3GWZ A;  5FGM A;  1X3U A;  3VWB A;  4L9J A;  4N0B A;  4PJN A;  2FA5 A;  2R7T A;  2DMN A;  2L2O A;  2MH9 A;  2XAH A;  1YI2 I;  1WJC A;  1S5L C;  2DU9 A;  2JSP A;  2XSJ C;  3VYT B;  1T8I A;  4HLX A;  3WOD F;  2GWR A;  1QHG A;  3H5A A;  2XAF A;  1RIO H;  2BV6 A;  2ZC2 A;  4B3A A;  4HAM A;  1Z3Y A;  1A6Q A;  1UEL B;  4JX4 A;  2Y75 A;  4RLQ A;  1S6L A;  2VI6 A;  3G3Z A;  1V5E A;  2VQL A;  3ABM H;  2XAG A;  2XRO A;  4IHT A;  3DV8 A;  2Y30 A;  3HJE A;  3G6E I;  1IUF A;  1FJL A;  2DQL A;  1KU3 A;  2STW A;  3QYB A;  3DXJ F;  1XDU A;  4MFD A;  2NOJ B;  2MSY A;  2UXN A;  3ZR8 X;  1K4S A;  2EWN A;  2OV7 A;  3M07 A;  1HST A;  1WGX A;  2M3A A;  2XSD C;  2Y0S A;  4Z6Y A;  2QEN A;  4CYC B;  3CES A;  5GAD J;  1ZN2 A;  3HSR A;  1TBX A;  4LFU A;  5E79 C;  4RDU A;  2LY1 A;  2VAS A;  4C2T A;  1U9N A;  5AON A;  4N9H A;  3R6S A;  2JRT A;  2R5Z B;  3RZD J;  4BXU A;  1YJW I;  1S9H A;  4CXF A;  2CQN A;  4DW6 A;  2XAQ A;  2F6C A;  4IOC F;  1LFP A;  2EBI A;  4BDZ A;  3MKZ A;  1TWG J;  3DEU A;  1UZC A;  1ZK8 A;  2EFO A;  1ZG1 A;  2E7W A;  3DWL E;  1S7A A;  1D5Y A;  2ZXI A;  3HEF A;  2Z33 A;  4KDP A;  1P4A A;  1W5T A;  5KVR A;  2PMZ A;  3BJO A;  1YYV A;  1T2K A;  2ZKZ A;  2NS7 A;  2WB1 A;  4I01 A;  4BYY A;  3OR2 C;  1RPW A;  3TP0 A;  3GZ5 A;  3F21 A;  1YOV B;  3B73 A;  4P1W A;  3ONQ A;  2BE5 F;  4U0Y A;  3K4K A;  4IVN A;  1VQ5 I;  4OU0 A;  3FKJ A;  2D2W A;  3CCY A;  2MG4 A;  2M2E A;  3HRU A;  5C4J J;  2W00 A;  2FSW A;  3L09 A;  3OYA A;  4A3C J;  5B3S H;  1DGR M;  3GZ6 A;  2H1L A;  3E5U A;  3LA3 A;  3I4P A;  4NC6 A;  2HPM A;  1LJ9 A;  3QPH A;  2DT5 A;  4NQW A;  4RAG A;  1MMD A;  1VF9 A;  1R5G A;  4M3B A;  3MD2 A;  3NAU A;  4LLL A;  3ZOB A;  5GAE J;  4AM3 A;  2VQC A;  3TQN A;  2GLO A;  3TDZ C;  4OAY A;  4A0Z A;  3C1D A;  2X4H A;  5K5O A;  1U78 A;  4GXO A;  4I09 A;  4Y4R A;  5IT3 A;  2QVO A;  2H09 A;  4KIC A;  4GYI A;  2QBY B;  1BI2 A;  2DCE A;  3FIS A;  4X1E A;  1OCZ H;  1SVM A;  2K9N A;  3SDG A;  1HC8 A;  3K1N A;  4A5M A;  1O3Q A;  3N97 A;  1YS6 A;  3J7Z I;  3MN2 A;  4M9S A;  1IW7 F;  2BXY A;  1DPR A;  2CMP A;  4H4K C;  1SD7 A;  5FKM A;  2RC4 A;  3SZT A;  2BY2 A;  1ON2 A;  4HYE A;  5LBQ A;  2DMQ A;  1BJA A;  5H20 A;  4S0H B;  1BIB A;  2E19 A;  2Y9Z A;  2DAO A;  4AYB A;  4BQO A;  2Y0M A;  4I99 C;  4IL6 C;  2CV2 A;  4O3M A;  2H6C A;  1MJA A;  3QPL A;  3IRR A;  3M9A A;  4PK4 A;  4JYK A;  2EIL H;  2DOA A;  1W7P A;  3E3V A;  4KA4 A;  4BAY A;  2IJL A;  1X3W B;  4BDY A;  1G3T A;  3K1P A;  4ZJZ A;  4PCQ A;  2E71 A;  3K10 A;  4HX8 A;  4NUB A;  2I5U A;  3TO9 A;  3Q9V A;  4XOR A;  1BIA A;  1FOY A;  2YU9 J;  4DOZ A;  1QPM A;  1XD7 A;  5K1Y A;  2FX0 A;  4MFE A;  2GXB A;  2VOD A;  3WGH A;  2LRD A;  4EGZ A;  2LYC A;  5L3E A;  1Z1D A;  5CQG A;  2IT0 A;  1X4O A;  1UFM A;  4XR6 A;  4XBF A;  1T38 A;  2V79 A;  3Q9S A;  4EJW A;  4IF4 A;  4F7Z A;  2MD5 A;  4G6D A;  4MIM A;  4GYG A;  1U8B A;  2P5K A;  5ICF A;  4GDF A;  2DQR A;  4XON A;  5HDK A;  1E3P A;  3KEQ A;  3PO3 J;  1RC9 A;  4KIF A;  4UVC A;  1H89 C;  4XID A;  2KIQ A;  4I7H A;  2K02 A;  4A6E A;  4BEH A;  1Q1V A;  2YSR A;  4C9Y A;  4EJU A;  2DFF A;  3LST A;  4PUS A;  1KGS A;  1D0Z A;  3FHZ A;  2X1E A;  1K4T A;  3LFU A;  4A0Y A;  4OIN F;  1GHC A;  1OCO H;  4ANJ A;  1MJB A;  1S8N A;  4NC7 A;  3ZQI A;  3SXY A;  1P2F A;  3HYI A;  2V9K A;  2O5R A;  3CTA A;  4XLH A;  1WH5 A;  2R5Y A;  3MEX A;  4XL9 A;  5CVR A;  2JWT A;  4CCJ A;  2LKX A;  5LHG A;  2RNG A;  3TW7 A;  3LSR A;  4XNF A;  4L9N A;  4BQN A;  1OMI A;  4OIO F;  3CCL I;  1V3F A;  1KQ0 A;  1XMA A;  1ZRE A;  3I59 A;  1GV5 A;  3IWZ A;  3WG7 H;  5D4R A;  5GP9 A;  2CGP A;  1TWH J;  1NK3 P;  1LEB A;  5B66 C;  1MBJ A;  4EJO A;  2AXL A;  2RKH A;  1K7A A;  4CZC A;  3FXJ A;  4OOI A;  4MTE A;  5KCM A;  4B47 A;  2O8K A;  3AG4 H;  1JKQ C;  4YII A;  3OIO A;  3OIP A;  1J75 A;  2MFZ A;  3OYI A;  3RPQ A;  3AKZ A;  2ZME A;  3MQ0 A;  2F5E A;  3KX2 A;  2JPC A;  2GOX B;  4BE0 A;  1LE8 A;  2BW3 B;  2W1O A;  3I53 A;  3RKY A;  3DF8 A;  1YLF A;  2FD5 A;  3TOB A;  3BJA A;  1Z77 A;  4B43 A;  2DO7 A;  3K7A J;  5E3L A;  2IGM A;  4E7J A;  5J40 A;  1IV6 A;  3M7G A;  2WAD A;  3ZMD A;  1FIP A;  1D8K A;  1U5T A;  1XB4 A;  2FRH A;  4L9T A;  3E6M A;  1TT0 A;  2O8X A;  4EJV A;  1F43 A;  2OZU A;  3BG7 A;  2HS5 A;  1Q1H A;  1WJ5 A;  4ENK A;  4O6J A;  5DYM A;  5CVJ A;  2XAU A;  5M3F J;  1DPU A;  4ZC3 A;  4Y7N J;  1T0F C; 
#chains in the Genus database with same CATH homology
 3HBL A;  2CQX A;  2DMP A;  4FTH A;  1GV2 A;  4FE7 A;  2XPU A;  5GPA A;  1R9T J;  2L9R A;  3HDD A;  2WAQ N;  3A01 A;  1SAN A;  1OCT C;  2HOT A;  2ELK A;  5C4X J;  4D5C A;  5FKK A;  4C3H J;  2L7F P;  1OFC X;  1JUP A;  1QVU A;  1DU0 A;  5FLV A;  2E2J J;  1UHS A;  2EZI A;  3HOY J;  2XPV A;  2LD5 A;  5EGO B;  3BR1 A;  3S1Q J;  3JRF A;  1F36 A;  4AYB N;  2DA2 A;  2DA7 A;  2XB0 X;  5BNG A;  2JA7 J;  4ABZ A;  2DA5 A;  2ID3 A;  4BBS J;  4A3M J;  2N8G A;  3S1N J;  2E1O A;  1DU6 A;  1IG7 A;  2DA6 A;  3S14 J;  5EG0 A;  4JX5 A;  4A93 J;  1JUM A;  2DA3 A;  3B6A A;  2HXI A;  3L1P A;  2R92 J;  4EEF G;  1T33 A;  3WHB A;  4XIC A;  3SFI A;  2FQ4 A;  4A69 C;  1HF0 A;  1W0U A;  4BY7 J;  4AUX A;  2P81 A;  1MBH A;  3TW6 A;  3UKG A;  1X58 A;  2AHQ A;  1S7E A;  4W97 A;  2M9H A;  3CMY A;  3TP3 A;  3BG9 A;  1RKT A;  3JRD A;  2K9S A;  2XGD A;  5JLX A;  1WPK A;  5F0C A;  1RKW A;  3QPS A;  1RET A;  3HOX J;  5IOY A;  2L0K A;  4B4C A;  1B8I B;  1SFO J;  4XRS G;  1AKH B;  1B72 A;  3S2D J;  2M34 A;  4BXX J;  1APL C;  5EF6 A;  4M3E A;  3JRG A;  1IRZ A;  3ZQC A;  3ZQF A;  1IC8 A;  1FEX A;  1MSF C;  5M5Y J;  4BY1 J;  3JRB A;  3OOU A;  2ME0 A;  2OF7 A;  2IEK A;  3Q0U A;  1POG A;  2CQQ A;  1OCP A;  4GFB A;  5EDN A;  4JX6 A;  2ZB9 A;  4MLO A;  4A3B J;  3GTJ J;  2HDD A;  1VI0 A;  1MSE C;  2R0Q C;  1JTX A;  1ETK A;  1Z0X A;  2HI3 A;  2DTZ A;  3ZQG A;  1ZGW A;  1AU7 A;  2JK3 A;  2Y2Z A;  3IV5 A;  1Y1W J;  1X2M A;  3Q0W A;  3FK7 A;  1ZQ3 P;  1JJ8 C;  3B6C A;  2D5V A;  4A3D J;  3ZQL A;  3GTL J;  2CU7 A;  1HLV A;  2NVY J;  1GVD A;  2EZL A;  2OPT A;  3OSF A;  3LSG A;  3LOC A;  1ETO A;  3HKZ N;  2VUM J;  3M4O J;  1A5J A;  1UG2 A;  3TED A;  3GTM J;  1Y1V J;  1XC5 A;  2X9D A;  5EEA A;  1WH7 A;  1IGN A;  5FKL A;  3GBG A;  1BW5 A;  2DMT A;  4W1U A;  5DS9 A;  2E2I J;  5F1J A;  4UUS B;  1JJ6 C;  4IHW A;  5IOZ A;  1HDP A;  1P7I A;  3G1M A;  1WCM J;  2MGQ A;  4A3J J;  3BTL A;  1JTY A;  1RES A;  2JA5 J;  3G1O A;  3H3V K;  3QQA A;  3BTC A;  4IHV A;  1LFB A;  3F0C A;  3MVP A;  1BW6 A;  2CRG A;  1PUF A;  2JJ7 A;  3BR5 A;  3PO2 J;  2EZK A;  3BR3 A;  4M3F A;  2KDZ A;  1TWF J;  3ZQH A;  1MBF A;  3LNQ A;  1MBK A;  2DA4 A;  3LSP A;  1O4X A;  3HGG A;  5C44 J;  3GTK J;  3FKI J;  2ECB A;  1H88 C;  5J1R A;  2LP0 A;  4A3L J;  2KT0 A;  1P7J A;  5FKN A;  2VPR A;  5E3N A;  1EF4 A;  2NOG A;  4D7M A;  4C2M J;  4BBR J;  3FK6 A;  2X48 A;  3SJM A;  3G1L A;  3S1M J;  4IEJ A;  2VKV A;  2MW8 A;  3O8H A;  3VPR A;  1E3O C;  4QSH A;  5IYB J;  2XGE A;  1I50 J;  2LFB A;  5C3E J;  5IPA A;  2DMN A;  3JR9 A;  4MO7 A;  5EGO A;  4QTR A;  2VKE A;  2XGC A;  5FJ8 J;  2K9Q A;  5FKO A;  1AHD P;  2EZH A;  1FIA A;  4A3K J;  1MNM C;  1JKO C;  2HYJ A;  4B3A A;  1OJL A;  4FIS A;  4V2F A;  2B63 J;  3I4N J;  5M5W J;  4JX4 A;  2X6O A;  1QVT A;  2VI6 A;  3OSG A;  4J19 A;  3W6V A;  3BTJ A;  4D7N A;  3GTG J;  2I10 A;  2Y30 A;  1IUF A;  1FJL A;  2LR8 A;  1IDZ A;  4B1R A;  1YRN B;  4MFD A;  2R7Z J;  2MSY A;  5F27 A;  4JP0 A;  2DJN A;  5JLW A;  5K7H A;  2Y9Y A;  4XRS A;  1HCR A;  1WGX A;  2IBD A;  1RR7 A;  2XSD C;  4CYC B;  1XS9 A;  2QF7 A;  2LTP A;  2NVQ J;  4RDU A;  1B8I A;  1JT6 A;  4M6V A;  1U9N A;  2JMW A;  4M3D A;  4C3J J;  1AKH A;  1FTT A;  2JN6 A;  3A02 A;  2R5Y B;  2R5Z B;  2CUF A;  3RZD J;  2QCO A;  2NVX J;  1IDY A;  3M3Y J;  4DW6 A;  2EBI A;  3JRC A;  1TWG J;  1A6I A;  1ZK8 A;  5IP9 J;  3BG5 A;  1D5Y A;  5J3L A;  3HEF A;  2DA1 A;  1JT0 A;  1ETY A;  3JRE A;  3JRI A;  5M3M J;  2NS7 A;  1RPW A;  3TP0 A;  1G2H A;  4I6Z A;  5IYD J;  1NTC A;  3S16 J;  1X2N A;  1LE8 B;  4I76 A;  2L7Z A;  3BT9 A;  2K40 A;  3CCY A;  2MG4 A;  2M2E A;  5C4J J;  2DN0 A;  4A3C J;  1W0T A;  1K83 J;  5F04 A;  3PM1 A;  2L7M P;  2TRT A;  3HOV J;  5K7F A;  1VF9 A;  1TWC J;  4D5F A;  4Y52 J;  4M3B A;  1TWA J;  1U9O A;  3Q3S A;  3NAU A;  3ZOB A;  4A3G J;  3A03 A;  2WV1 A;  3RQI A;  1GT0 C;  5IYC J;  1HOM A;  2GLO A;  3IH3 A;  4UUS A;  2LLK A;  5GPC A;  5K7Z A;  5M5X J;  2W48 A;  1GDT A;  1U78 A;  2M0C A;  2EQR A;  3HB9 A;  1JGG A;  1ITY A;  3FIS A;  4X1E A;  4L5E A;  3SDG A;  2K9N A;  3GTP J;  3H0G J;  3A01 B;  5HOD A;  1BL0 A;  3S1R J;  3K2A A;  2YS9 A;  3MN2 A;  1JUS A;  1QRY A;  2DMU A;  5FKM A;  3O8G A;  2YUS A;  4UUT A;  2CUE A;  5EZH A;  2EH3 A;  2DMQ A;  4S0H B;  2E19 A;  1WI3 A;  2O9L A;  2Y9Z A;  3BTI A;  3HOZ J;  4A3I J;  1FTZ A;  4FE4 A;  3QPL A;  3LSJ A;  4JYK A;  1ETQ A;  4A3F J;  4G12 A;  3JRA A;  3S17 J;  4C3I J;  5J1Y A;  5EG0 B;  2G0E A;  3FIW A;  1BJZ A;  1BA5 A;  1ZKG A;  3BQY A;  2YU9 J;  5J1U A;  1MH4 A;  1JKR C;  5FLM J;  3JRH A;  2FX0 A;  4MFE A;  3IH4 A;  4BKX A;  2HQ5 A;  1HDD C;  4DYC A;  2GM4 A;  3CDL A;  4V2G A;  5F08 A;  1IJW C;  3BR0 A;  2FJ1 A;  2HOS A;  4NDL A;  3RZO J;  2TCT A;  4MIM A;  3BR2 A;  2CJJ A;  1U8B A;  1MH3 A;  2RAE A;  1B72 B;  9ANT A;  4DZJ A;  1ZR2 A;  1YRN A;  3PO3 J;  5F0F A;  1H89 C;  4XID A;  1GUU A;  2IAI A;  3HOU J;  1ENH A;  1ETX A;  4HNV A;  1Q1V A;  2ME6 A;  5IP6 A;  2ID6 A;  3HOW J;  4LOC A;  1UMQ A;  3S2H J;  5F0H A;  2Y0S N;  4QIW N;  3BR6 A;  2COB A;  4CYC A;  1NK2 P;  4IHX A;  3E7L A;  3GTQ J;  3NAR A;  4IHY A;  2HOA A;  3CQZ J;  3ZQI A;  2E2H J;  2XB5 A;  5IP7 J;  2R5Y A;  5DTD A;  1WH5 A;  2R5Z A;  2HXO A;  2LY9 A;  2M8G X;  2NS8 A;  1T56 A;  2JWT A;  2LKX A;  3HGY A;  3TW7 A;  3LSR A;  5EZG A;  3C2B A;  5E3O A;  2XPW A;  1H8A C;  2XRL A;  2H1K A;  3D1N I;  3DEW A;  3DCF A;  1GV5 A;  2O7O A;  2AO9 A;  5GP9 A;  4XRM A;  1TWH J;  1NK3 P;  2PMZ N;  2LK2 A;  2Y31 A;  1ZTR A;  1MBJ A;  2WB1 N;  4AC0 A;  3BG3 A;  5EYR A;  1I3Q J;  1K61 A;  5E3M A;  1ORK A;  2O8K A;  3GTO J;  3S15 J;  1JKQ C;  2LVS A;  2R93 J;  3OIO A;  4XK4 A;  2ECC A;  4RBO A;  1VFC A;  3IH2 A;  2H8R A;  3BQZ A;  3I4M J;  3MKL A;  1CQT A;  1LE8 A;  4X6A J;  1VND A;  4DZP A;  1XG1 A;  2JA6 J;  2FD5 A;  3Q0V A;  1I6H J;  1MBE A;  4A3E J;  1Z77 A;  1QPI A;  1ETV A;  3K7A J;  5E3L A;  1IV6 A;  4DYR A;  1TC3 C;  3RKQ A;  1FIP A;  4DYQ A;  1LFU P;  1MBG A;  1PUF B;  1F43 A;  3WHC A;  2GBY A;  2JA8 J;  1ETW A;  4FCY A;  2NVT J;  1JKP C;  3HM5 A;  1ZR4 A;  5M3F J;  4M3G A;  4Y7N J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...