5D4SA

Crystal structure of arar(dbd) in complex with operator orx1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
b'EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arabinose metabolism transcriptional repressor
publication title Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transcription/dna
total genus 21
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d4sA00
5TRDA 1ZRDA 5E20A 5E17F 5AIQA 3WE2A 4WX9A 5D4RA 4HV6A 5JFRA 3M8FA 5A2QZ 5D8LB 2ZMEB 6PAXA 2NS0A 3P9IA 4DQ2A 1J7KA 2LNBA 4CHUA 2D1HA 2QQ9A 1FT9A 4U7BA 2HDCA 3T1BA 2EA4A 3M9AA 1YIOA 2A5YB 1CF7B 5F64A 3HRMA 4LFUA 3IHUA 4CXFA 4PGHA 4LMYA 4Q5SF 5DUIA 3LA3A 2KRFA 3ROUA 1XGMA 4PDKA 4XRFA 1LB2A 3JW4A 2VBZA 4UUVA 2R7DA 4S05A 4UVCA 1D8JA 5IT9K 3E6DA 3RJPA 2STTA 4ZZDA 1Z05A 3K0LA 4MQVA 5BPDA 1F4KA 2QYOA 5D8KB 4ZYDA 5HLIA 1TQMA 3BPVA 3T8TA 2Y48A 1FP2A 1FBSA 2VBWA 1ZG1A 3GW2A 1I27A 1YS6A 4P9UA 1UHWA 3BJAA 1K79A 2H27A 1S3JA 1O7LA 5E8IA 1BC7C 3CLOA 5HS7A 1XSDA 5DUKA 4XLNF 3GO5A 2XAGA 1HXDA 2IA2A 3VEPA 5LHHA 3V8KA 2XVCA 4AIHA 1AWCA 2OAZA 3K9TA 4HZFA 2DQRA 4I09A 5HOOA 5L3CA 2IW5A 3PQJA 3I59A 3ZMDA 1JE8A 2FOKA 2BV6A 1W4MA 5JI6A 5E1XA 4RB0A 1USTA 2P5KA 2JT1A 4BHPA 3E6CC 3H3UA 2PFBA 4A6DA 2EFQA 2WC2A 4OIOF 1WKMA 2RGVA 3LA2A 4G7OF 4A5MA 4U0VA 1KU7A 1J0RA 1RUNA 5HDKA 1SD7A 1STZA 2KKOA 3KE2A 4OU0A 1LVAA 1O57A 2LDUA 2D2WA 5EEGA 2A3SA 3C1DA 4EM2A 1U78A 2O6GE 2CWEA 2IA1A 3ZQ7A 4I7HA 1YYVA 2F5EA 2EV5A 1P6RA 4KICA 1S7OA 4OINF 3L9FA 1GXPA 4LG0B 5HLHA 1G3YA 2K4JA 2CQKA 1F9NA 2ZNZA 1QBJA 4P9FA 1S29A 5FGMA 3O2PE 3WU0A 5DCFA 3IWFA 4KFCA 1ZH5A 1L0OC 2VXZA 2P4WA 4ENNA 1P92A 2VBXA 2TDXA 2PBIA 3F72A 1KU9A 2G7UA 5CVJA 4CYDA 1FZPB 3GFIA 5J6XA 3F8MA 3QRFF 1B9NA 2RNJA 2ZKZA 2HEOA 2FMYA 5DD8A 4UHTA 4KMUX 1MJAA 2RN7A 4L5IA 2KIUA 2WWYA 4IRIA 1TQIA 3F22A 2XKOA 3V7CA 2A6HF 2D45A 2VT2A 1FSEA 3U2RA 4HQMA 1Z1DA 2FNAA 4O6JA 4IXAA 2FSWA 1XDSA 2EJRA 5ICFA 4OMZA 4L9NA 2ZMEA 4OOIA 1L3LA 2MD5A 3V8LA 2F5FA 1YS7A 1GVJA 4P55A 4PCQA 3FX3A 4RGUA 3TO7A 4MEXF 4QWQA 4GCVA 1CF7A 2HWVA 5L3DA 4HDUA 2AXLA 1BC8C 1IN5A 3ZMUA 1EH7A 3DP7A 5F1RA 3QAHA 4M9XA 2Y0MA 1FWZA 1IN4A 2E7XA 4E70A 3QP5A 4HF1A 2M1BA 4CO8A 1T0FA 4EJVA 3M1EA 2KJCA 5JVTA 2GA2A 5DCMB 2M87A 2OA4A 2EV6A 4M6YA 5E8GA 4MTEA 5FO5A 3K1NA 3QOPA 3DFGA 1IRGA 3P9CA 3KCCA 4EVIA 3N4MA 4A6EA 4GGGA 2O8XA 3KETA 4I98B 4KMFA 4FX0A 3KP7A 4RGRA 5LGNA 2RVCA 1UFMA 3I0TA 1I1GA 2HS5A 2ISYA 2K02A 1XCBA 1YLFA 3L00A 1QQIA 3HSFA 5EEHA 4R8HA 5D6EA 2GZWA 1TNTA 2IVMA 3H3ZA 4GXOA 1ZG3A 1SD4A 5J8FA 3DQVC 1XSVA 3K2ZA 3EDPA 2Q8KA 4QLCU 4L9VA 2L3DA 1SMTA 1ON2A 2L54A 1J75A 3ELKA 1XGSA 4RB3C 2B0LA 4BQAA 3EYYA 2YU3A 2HKOA 5BOXA 2K86A 4KA4A 1A04A 3I59B 5ILVA 4U0WA 1ONVA 1XB4A 1WWXA 1KYZA 1LEBA 1YTYA 2VOPA 1U8RA 2EWNA 3HTUA 5ILUA 3HRTA 3KLNA 1RUOA 3LQRA 3W6JB 1R1VA 3VOEA 1PP7U 4ZYGA 3I64A 2GXBA 4YFNF 3DPLC 1FBUA 5LHIA 1DUXC 3KP3A 1BIAA 2XGXA 3K1PA 3KEOA 5L3GA 3C18A 4MQ9F 2PG4A 1O7FA 2MLGA 3LAJA 4ZH4F 3G3ZA 1SFUA 2BBYA 4M6XA 4XBFA 3ERED 1T2KA 2CGPA 1ZYRF 4LLNA 3LWFA 3JSPA 4EJTA 3M8EA 4TV7A 2H6BA 5L3EA 1MGTA 3GZ5A 2LSOA 2HR3A 4HV5A 5HS8A 3VODA 3EYIA 5KK1A 1ZG5A 3DV8A 2FXAA 2E7WA 2CW0F 3COAC 3WTYC 1FY7A 3BZ6A 5HDNA 4CDGA 3L7WA 4L0YB 2OQGA 4LB6B 2AS5F 1IXSB 5LRSA 2JZYA 4Y15A 1SFXA 3ECHA 2EFWA 3ML6A 2XUBA 5D5UB 1W7PB 4R1HA 1J2XA 2V1UA 3MZYA 2HQRA 4L9TA 3I58A 2V79A 1HW1A 3CJNA 2COMA 5DEQA 3AAFA 3V7SA 4KN7X 3B02A 3FWEA 3I54A 3BROA 2XROA 2FEZA 1S7AA 3WTVC 4NB5A 2UXNA 3LQQA 5DCMA 3DPTA 3GUDA 3T5XA 4G6DA 4EV0A 1QGPA 3T8RA 2OZ6A 5IT3A 3TQNA 2VOOA 1BN5A 1OMIA 4HX8A 1X3UA 3I4PA 1UCRA 4A2UA 2K4BA 1KGSA 4L18B 4G6QA 2ESHA 2PMHA 5IT9Z 2YPRA 4RAZA 1EH6A 3GWZA 3D5LA 1GHCA 1XGNA 4G9YA 3S2WA 3CUQB 5LHGA 4EGYA 2FA5A 2QQBA 2UZKA 2KJBA 3F8BA 4O3MA 2X0LA 2HZTA 1IZ1A 2FQ3A 2NYXA 3LSTA 2RDPA 4M72A 3KEQA 3T0YA 4IPAA 1OYIA 3Q5FA 2CSOA 1B59A 3CO6C 2IP2A 1ZARA 4I02A 1HBXG 4HAMA 2DU9A 1ZLJA 3R4KA 1JXSA 4RGXA 1YO5C 2H6CA 1PUEE 2BE5F 3ZN0A 1FP1D 1OYWA 4LGWA 1IXCA 4UV9A 1P4XA 3CUOA 3FXUA 1TBXA 3NEUA 5HDGA 1IRFA 4OMYA 1J59A 3RDIA 1ZLKA 3CUQC 3QU6A 1KA8A 3WTSC 3DXJF 3ZMSA 5DD4A 3C7JA 3SZPA 3E5UA 4A0ZA 4GYGA 4R79A 3CDHA 4Y13A 3V7RA 5E1ZB 4BHCA 3WTXC 4LLGF 2DI3A 3LA7A 3PQKA 4UXNA 4LK0F 2FBHA 5E18F 2A07F 1FPQA 1SMYF 1XMAA 1P4AA 2Q2EA 3HYIA 4LJZF 2XHKA 4G7ZF 2KIMA 2A69F 2VN2A 1W5SA 5BMZA 3BWGA 1DDNA 1MKMA 1NHAA 1I1SA 1KU3A 3F21A 1REPC 3MCZA 2Z3YA 4XLPF 5DV5A 1O3SA 1BOAA 1BBYA 2XASA 4HX7A 3WTTC 4ZYEA 1SAXA 3J7AO 2C6YA 1R22A 2OBPA 4IJAA 5LGTA 2M8EA 2RKHA 2DAOA 2K7LA 3KZYA 3FZVA 2DLLA 2PJPA 3WG9A 3SFZA 1FYMA 1IN7A 2MA3A 2XRNA 2ESNA 4A5NA 3MZHA 1B6AA 4WXHA 3IWZA 3SXYA 1IAWA 3E3VA 3H92A 3U1DA 2E1CA 5LRRA 4ETSA 4ESBA 3HOSA 2XAJA 1YG2A 3TKYA 3OOPA 2FBKA 3TOBA 2PQ8A 4JK1X 1P2FA 3QU3A 4N0BA 2F5DA 1W7PA 2GQQA 3GYHX 1LEAA 2DPDA 2DO7A 2QLZA 5FLXK 3L2CA 1XCVA 2P6TA 2W84A 3FF5A 2MH2A 2EV0A 4M9SA 2DTRA 2HQNA 1BI0A 3ULQB 5BQTA 1PDNC 2RV8A 4IHTA 1F1ZA 1ZRCA 3KFWX 3RKWA 1BJAA 2F5CA 3OV8A 2L4AA 2O61A 5DYMA 4KNYA 1YW7A 2RC4A 1W7PD 1C0WA 3U9GA 4BXUA 4KIFA 2L02A 3IRQA 2OZUA 1G3WA 2PI0A 3WTUC 1V4RA 1BI2A 2O0YA 3CUQA 4KYWA 4ZYHA 3JTGA 4I0BA 4B09A 2YR2A 1T6SA 4UNOA 2ADUA 3CTAA 1FYKA 3F8FA 1TW3A 4IF4A 1YQAA 2ACJA 1XSXA 5CYVA 1ON1A 3E97A 2ELHA 3IKTA 3WTWC 3I5UA 5K5OA 1MJBA 1R1UA 2P5VA 1HKSA 3ZMTA 2ZXJA 4ENKA 2O03A 2VC1A 1WI9A 4IRHA 2EA2A 3KP2A 4NQWA 2JPBA 2FE3A 2P7CB 1IUYA 2V9VA 1EV7A 2DT5A 1Q1HA 1D8KA 3RPQA 1IN8A 4BNCA 4FT8A 3HSEA 3FXQA 2CFXA 1CGPA 4FHTA 1J5YA 3J81K 5L3BA 1O3QA 2D1VA 1DPRA 3FMRA 2ISZA 3RI4A 3MEXA 1MDMB 3F3XA 3HRSA 2JRTA 3GX4X 2NRAC 4CGZA 4JBAA 2LF7A 1IF1A 3GEZA 3EQLF 1Z91A 1Z9CA 1R5HA 1ZRFA 2MBFA 1G3SA 1YFHA 5CVUA 4ON0A 3NQOA 5D5WB 4HLYA 3BDDA 1Z6TA 3HSRA 1U2WA 4HA8A 1V3FA 1B1BA 1QZYA 4HYEA 4WK8F 3GFLA 2VBYA 4ESJA 3QPHA 4FX4A 2E1NA 2Q0OA 4NHJA 3WTZA 3QPTA 2ZNYA 4N9HA 1HSJA 1HW5A 2EFPA 3F8NA 4UVAA 2EK5A 2QBYB 2R3SA 1JHHA 4B8XA 3WGHA 4OIRF 2L01A 4EJUA 2XAFA 4M73A 3F23A 2PN6A 4I2OA 1FNNA 3D0SA 1OYYA 1QNTA 4DNCA 5H6QA 3RYPA 3RPUA 3P7NA 1G6NA 3R0AA 1T38A 5ICCA 4G8XA 5K1YA 2A6EF 1GXQA 3I53A 1Z6RA 1E17A 1EH8A 1OKRA 3MFKA 2VODA 3F8CA 2HYFA 1B9MA 4O5VA 2PMUA 2M5WA 3N97A 4YIFA 2W57A 4HBLA 4KIGA 5TJJA 1G3TA 1XDUA 3GXOA 1OR7A 2DPUA 2M30A 3WODF 2W85A 3JAMK 3J80K 4YFXF 4EGZA 4M74A 4KUMA 3V4GA 1K78B 1KYWA 2DQLA 1YW8A 4Y17A 4L9JA 4A0XA 4A12A 3B73A 2QVOA 3RKYA 1R23A 2GIVA 4KDPA 1MD0A 4LK1F 4K2EA 4S04A 4ESFA 1I5ZA 1FOKA 2KIFA 1QZZA 1ZAOA 1AOYA 5H6RA 3NRVA 3O6BB 1ZREA 4LD5A 3MAJA 3HTSB 4P5OA 4Z2YA 3ZMZA 3F6OA 2F2EA 4U7DA 1ODDA 2G7HA 3M7GA 2OD5A 4YG2F 5A2QK 2JSCA 1XN7A 4XSZF 5ERIA 1RIOH 2HOEA 3ISPA 1KQ9A 2M45A 1FX7A 2UXXA 2Z33A 3HOTA 1ULYA 2FU4A 4HDVA 3TOAA 1U5TC 1UB9A 3PFIA 4L0ZB 1ZGJA 3E5XA 3MWMA 4L5JA 3VB2A 2QENA 2ZFWA 4U88A 2PEXA 3GVAA 1O3RA 5K5QA 3EUHA 2H09A 1D5VA 2XIGA 1E2XA 5FB2A 4XSXF 1FYLA 2ZO4A 3HIFA 1MDMA 1R00A 2DFIA 2HYGD 3GFMA 3FM5A 1FLIA 5BS6A 1USSA 4LB5A 3RKXA 1HKTA 3HHGA 1LDJA 3P9KA 4BAYA 1LDKB 1HW2A 2STWA 4OIQF 2V1XA 4AVPA 5H20A 2UWMA 5ICGA 3BJ6A 4UVBA 3BOQA 3Q9VA 2IJLA 1DPUA 1TQPA 4KN4X 3TDZC 1LNWA 1XD7A 3KZZA 5LEJA 5D5VB 4ENJA 2GA1A 1FC3A 3W6KB 3ZN1A 3GF2A 1K7AA 5CVRA 5FFXA 4KT5C 2YX7A 1IN6A 3IRRA 4Q47A 1ZHFA 1WRJA 4H0EA 2VC0A 4A0YA 3LAPA 4HF2A 1XGOA 1T39A 1KU2A 2ZBKA 2QBYA 3FHZA 3BPXA 4GO1A 1RZ4A 2K27A 1OPCA 3V8JA 4ZZLA 2L4MA 2QWWA 2MH9A 4HW0A 4UV8A 1TTYA 2Z5UA 1K6OA 2FNPA 3TO6A 1JHFA 4Q48A 4EQQA 5HS9A 2QQAA 3R0JA 1HSTA 4YFKF 2XAQA 2HKXA 2FF4A 3KP6A 1MZBA 2JTVA 2HTJA 3IC7A 2PLYA 3REOA 4OIPF 4I0AA 1ZGAA 2HGCA 2Z99A 2IT0A 1SFEA 2GWRA 1BIBA 2CG4A 1K78A 4MHGA 1W5TA 3R61A 1F5TA 4IVNA 3DKWA 4MGRA 5CJ9A 4HF0A 1IW7F 3KP4A 5ICEA 2VONA 3EETA 5FLXZ 1J9IA 2G9WA 3GZ6A 3WGGA 4AIKA 2Z9OA 4G7HF 1Z7UA 2VE8A 2WV0A 4WWCA 1U5TA 4JQFA 2P5LC 2HFHA 2XAHA 4ASNA 1JGSA 4WF2A 4WCGA 4F7ZA 2VE9A 4N9IA 4GYIA 2RQPA 3RYRA 3DF8A 1VTNC 5KVRA 5D5XB 2YSRA 3FXRA 3SQNA 2R7FA 1U3EM 2J5OA 3ZPLA 2BEOA 2JPCA 2EFNA 1PP8F 1DP7P 5D4SA 5BPIA 4AD9A 5J8CA 2DK8A 4I01A 4RB1A 5JR3A 1P4WA 1S6LA 2BGCA 2P8TA 5FD6A 2NAZA 1R5GA 1H9GA 5AIPA 1WSUA 4AIJA 3WE3A 2IPQX 3E5QA 4BHBA 4HQEA 2VT3A 1O3TA 1MJ9A 1UHMA 3RTRA 5DDGA 4WXDA 1Y0UA 2FBIA 5D6FA 4YIIA 3L09A 4MTDA 4HLXA 4CZZA 3I71A 3BY6A 1R1TA 2LKPA 3JTHA 4Q4ZF 2Y75A 2DW4A 4BYYA 2ZCWA 2LF8A 2P6SA 5ILSA 1TW2A 4EMSA 3CO7C 1S8NA 5K5RA 3WGIA 5E1WA 1I6XA 3C3WA 3E6MA 5LBQA 1FBQA 1LQ1A 4EJWA 3J81Z 3FMQA 1YW9A 3RIRA 2ETHA 2CO5A 1KQ0A 4RAYA 1RI7A 4U0YA 2J5PA 2FMLA 1R7JA 3BJOA 1T98A 1R36A 3KLOA 1QPMA 4IRGA 3VFZA 1TNSA 2WTEA 2DBBA 4WXCA 3MQ0A 2YX4A 3HUGA 1HKQA 1H0MA 5L3FA 1B4AA 2P7VB 2QUFA 2OU2A 5HLGA 1HQCA 5FD5A 2O3FA 2H94A 1R58A 4HOBA 4IHSA 2DK5A 5CLSA 4RS8A 2QM3A 3G73A 2EB7A 5HVQC 2GAUA 2HTSA 1QO0D 2V1DA 4M71A 2A61A 5LLQA 3K1MA 3ABTA 3DEUA 1LDDA 2X4HA 2MLKA 2IRFG 1H9TA 5JHUA 1WQ2A 4KIBA 3TDUC 3JSOA 4G94A 4P96A 4PGGA 3O3KA 1SD6A 1TLHB 2GXGA 4LG0A 1FSHA 1BI3A 4EM1A 5CVVA 1RNLA 2FRHA 3GLXA 2EFOA 4AWXB 4RB2C 3BP8A 1BI1A 1U6GA 3IL2A 3ZP5A 4ENMA 3E6BA 3FM3A 3Q9SA 2OQRA 5LEKA 2W24A 1BM9A 1D3YA 4HX4A 4PZJA 1LJ9A 4EM0B 2ZJ2A 1ZN2A 2MC3A 3HHHA 4RGSA 4MNUA 1IXRC 2A68F 5CVIA 3K69A 3JAMZ 3J80Z 3QP6A 3GFJA 3TO9A 4EJOA 4D0PA 1SD5A 4M9ZA 3KP5A 3TGNA 3R60A 3SHFA 2BYVE 1KQ8A 2XKPA 3R6SA 3WU1B 3FMSA 2NNNA 3HRUA 5LGUA 5AONA 2W25A 3IKVA 5FFZA 4MEYF 1XMKA 1U5TB 4CICA 3ECOA 2XV4S 1G4DA 2QZ8A 4LLLA 5F6FA 3F6VA 5ED4A 3SZTA 2CYYA 2V6CA 3ZMVA 3LFKA 2IA0A 4BH9A 2NNYA 3ABUA
chains in the Genus database with same CATH superfamily
4IX7A 5TRDA 4HG2A 5E20A 1ZRDA 4JOMA 5E17F 2LKXA 1JUMA 5AIQA 3WE2A 4WX9A 2JA7J 5D4RA 2WV1A 4HV6A 5JFRA 2QSGX 3M8FA 2KIQA 2HXIA 5A2QZ 1BR1A 5D8LB 1B8IB 2ZMEB 1W1WE 3QYEA 3HKZN 3G71I 1R4MB 6PAXA 2R7VA 4AYBA 5DS9A 1OCCH 2NS0A 2JMWA 1LFUP 3P9IA 4DQ2A 3J7ZI 1J7KA 2LNBA 4CHUA 1XMXA 5EEAA 3IV5A 2A5WA 2D1HA 2QQ9A 2LP0A 2QSFX 2EZLA 1FT9A 3CCYA 4U7BA 2HDCA 2KFDA 3T1BA 2EA4A 1POGA 1YIOA 2A5YB 3M9AA 1YOVB 1CF7B 1EF4A 2DFEA 2ME0A 3HRMA 3FXMA 4NUBA 4LFUA 5F08A 5F64A 3IHUA 2OPTA 4CXFA 2L9RA 4PGHA 4LMYA 4XM3A 4Q5SF 4BACA 5DUIA 2H1KA 3TP3A 5J1RA 2EIJH 3LA3A 2KRFA 2KRHA 3ROUA 1XGMA 4PDKA 1Y6IA 1YE9A 2E60A 4XRFA 1LB2A 3JW4A 3ZQGA 2VBZA 4UUVA 2VL8A 2R7DA 4S05A 2OCCH 4UVCA 1D8JA 3TL4X 4BE0A 1Z77A 5IT9K 3E6DA 2MD0A 1LE8A 3RJPA 1JGGA 2STTA 4ZZDA 1Z05A 3K0LA 4MQVA 5BPDA 3DBHB 1F4KA 2QYOA 5D8KB 4LIVA 4N4NB 4ZYDA 5HLIA 3CC7I 1TQMA 2DA7A 2LFBA 5JLXA 4CYCB 1XS9A 2ZMEC 3BPVA 1WHUA 5KHDA 4MIMA 2H8WA 1ITYA 4XN0A 2BHYA 2ZB9A 3T8TA 2Y48A 1FP2A 1FBSA 2VBWA 4DBQA 3GW2A 1ZG1A 1I27A 4DYQA 1YS6A 4P9UA 1UHWA 3BJAA 1K79A 2L7ZA 2H27A 1S3JA 4XMYA 1O7LA 1X1AA 5E8IA 1BC7C 4BDZA 3CLOA 5HS7A 1XSDA 3HDDA 5DUKA 4RBOA 3W3CA 4XLNF 1I3AA 1JTXA 3GO5A 2XAGA 1HXDA 1F43A 2ZJRF 2IA2A 3VEPA 3KEYA 5LHHA 1T56A 3V8KA 2XVCA 4AIHA 5K7HA 1AWCA 5KAFC 3BTJA 2OAZA 3K9TA 4HZFA 5HNHA 2VLAA 3G4SI 4BJ5C 2DQRA 5JVGF 2DT6A 1OCRH 4I09A 4J01A 3PUFA 5HOOA 2VPRA 2XF6A 4XLCA 5L3CA 2IW5A 2DDAA 1WH5A 3PQJA 3F0CA 2DOEA 2M9HA 3I59A 2HI3A 3OL3A 3ZMDA 5CQGA 5GTIC 3PSIA 1JE8A 1GV2A 2FOKA 4BE2A 2BV6A 2HDWA 1W4MA 5JI6A 5E1XA 4RB0A 1USTA 1E3HA 2P5KA 3I56I 4IEJA 1QRYA 2IBDA 3L2QA 2JT1A 3CDLA 4BHPA 4B48A 4D1QA 2H1LA 5FKLA 3E6CC 1XC5A 3H3UA 3TP0A 2PFBA 3C2HA 4A6DA 2EFQA 4J00A 4XKWA 3ZQQA 1SFKA 3BLYA 3CP2A 3CCJI 3IH3A 3KIOA 4PK4A 3NWTA 2WC2A 3AG3H 3OYDA 1WKMA 4OIOF 1JUPA 1VQMI 1UAAA 3MKZA 4FQGA 2RGVA 1ETVA 3CZ6A 3LA2A 5H2FC 4G7OF 4A5MA 3BTLA 4U0VA 1KU7A 1J0RA 2DDBA 2ZFUA 5HDKA 1RUNA 2Y0SN 3S16J 2DA4A 2KDZA 1SD7A 1STZA 1HCRA 1UHSA 2W00A 4B47A 5IY5H 2KKOA 1WFXA 3KE2A 2DCEA 4GRIA 4OU0A 1DU0A 2BY2A 3RZDJ 1LVAA 3A03A 4JP0A 3VWBA 1O57A 2LDUA 2D2WA 2AQFA 2A3SA 5EEGA 5K7ZA 3C1DA 3K4BA 2AXTC 4BQNA 5HLTA 4EM2A 1U78A 2O6GE 1TWFJ 2CWEA 2IA1A 4XLHA 3ZQ7A 5EGOA 2IGMA 2IAIA 4I7HA 1YYVA 1WH7A 2F5EA 2HVRA 3IAS2 2EV5A 1P6RA 4KICA 1EJ9A 1S7OA 3OMYA 4FCYA 4OINF 5J1UA 1WJAA 1HDDC 3L9FA 4XRSA 1GXPA 4LG0B 4FASD 5HLHA 4PSXA 1G3YA 2K4JA 2CQKA 1F9NA 1DU6A 5M5YJ 2ZNZA 2YU9J 1QBJA 2R7UA 4P9FA 3FIWA 1TWAJ 3BQYA 1S29A 5FGMA 3O2PE 3WU0A 5DCFA 3IWFA 4M3EA 4KFCA 5TGTA 4DZJA 2IXSA 1ZH5A 1L0OC 2YS9A 2MC4A 2VXZA 2XF5A 4LIUA 2P4WA 2HNHA 4ENNA 1P92A 2HQ5A 2VBXA 2TDXA 2PBIA 4DYCA 3F72A 4A3GJ 4BQQA 3BG6A 3H1CA 2E1MC 4I76A 3DLLF 1YI2I 1TC3C 1Y8RB 1KU9A 2G7UA 4BEHB 5CVJA 4CYDA 1FZPB 2WB1A 3GFIA 5J6XA 3F8MA 5EYRA 3QRFF 1B9NA 2KP6A 2RNJA 2R7ZJ 2ZKZA 2HEOA 2FMYA 5DD8A 4UHTA 5FLVA 4KMUX 1MJAA 2EBIA 2HXOA 2RN7A 4L5IA 2KIUA 2M7BA 2BXYA 2LKSA 2WWYA 4IRIA 3IAM2 1TQIA 3F22A 2XKOA 2L7FP 2V6EA 3V7CA 4NDLA 2A6HF 1S9HA 4RAGA 2D45A 2VT2A 1FSEA 3U2RA 4HQMA 1MBGA 1Z1DA 3CC4I 2KL4A 2KDOA 2FNAA 4O6JA 4IXAA 1ZQ3P 2FSWA 1XDSA 2EJRA 3K10A 5ICFA 4E6KG 4OMZA 4L9NA 1B8IA 2ZMEA 4OOIA 1L3LA 2DA3A 5FRMA 5J3LA 2K9QA 5IYDJ 2MD5A 5B1AH 4ZJZA 2M2EA 1R5ID 3HKZA 3OOUA 4XONA 2F5FA 3V8LA 1RETA 1NG7A 1NK3P 1YS7A 3CJTB 1GVJA 4P55A 2L5QA 3FX3A 4PCQA 4RGUA 3L2VA 3TO7A 4MEXF 2LBFA 4I6ZA 4UUTA 4QWQA 4GCVA 1CF7A 3BR0A 3P5JA 1BR4A 3H9JA 4RMNA 5J4YA 5M5XJ 2HWVA 5L3DA 4HDUA 2AXLA 1BC8C 2LG4A 4Y4RA 4BDYA 1IN5A 3VSLA 3ZMUA 2GM4A 4HPQA 1EH7A 1D0ZA 3DP7A 3HB9A 5F1RA 3QAHA 4M9XA 2JA2A 4XKVA 1MW7A 3VPRA 3MVPA 2Y0MA 1FWZA 1IN4A 2E7XA 2GXAA 4E70A 3OYFA 3QP5A 2Y30A 1IV8A 4HF1A 1RPWA 4UB8C 3H35A 2M1BA 4CO8A 3HOWJ 2IGKA 2QQ8A 3JR9A 1T0FA 1TL8A 4C2TA 4EJVA 3M1EA 3CCLI 2KJCA 3S8PA 5IP9J 3S1NJ 2XF7A 5JVTA 4BE1A 5FRNA 2VB6A 2GA2A 4II3A 4HRIA 1MNEA 5DCMB 2DA2A 2M87A 2OA4A 1W0UA 2EV6A 4M6YA 2A05A 4CYCA 5E8GA 3K70D 4MTEA 2ID6A 2NOGA 4RA2A 3VYTB 4OAZA 3G6EI 5FO5A 3K1NA 2QGUA 3QOPA 4Y3OA 3DFGA 1IRGA 1WPKA 3P9CA 4BXFA 3CF5F 3KCCA 4EVIA 2R7WA 3N4MA 4ANJA 4A6EA 4GGGA 2F48A 1DP3A 2DA1A 2O8XA 5KAIC 3KETA 2A6TA 4I98B 4KMFA 4FX0A 3KP7A 1YX5A 1WZ2A 3SEQA 4RGRA 4ZDPA 5LGNA 5IP6A 3KYDB 3VSKA 2QCOA 2CQXA 2RVCA 2JA5J 3GTJJ 1UFMA 1BOBA 3I0TA 1I1GA 1LE8B 2HS5A 1BW5A 3ZQCA 2ISYA 2K02A 1XCBA 1M1EB 5J40A 4W97A 1X2MA 2KQRA 1YLFA 3JRCA 3L00A 1QQIA 3HSFA 5EEHA 3SDBA 1AA7A 4R8HA 4DJAA 4KITB 5D6EA 2RAEA 2GZWA 1HC8A 1TNTA 2IVMA 1OFCX 3CLQA 3H3ZA 2JK3A 2M8GX 3GTQJ 4GXOA 2DT7B 4LG3A 3ZQHA 1ZG3A 1SD4A 5J8FA 1JKPC 2R4GA 4B44A 3S3NA 3DQVC 1XSVA 3K2ZA 3EDPA 2Q8KA 4QLCU 4L9VA 4RLFA 2L3DA 1SMTA 4M3BA 2LY9A 3OYHA 2H8RA 2L7MP 2IS6A 4A3JJ 1ON2A 2L54A 3EUKL 4ZDLA 1J75A 3ELKA 3CP8A 2GOMA 1XGSA 4RB3C 2B0LA 2RQQA 1OCPA 5E79C 3EYYA 4BQAA 2X48A 4L5EA 4PSWA 2YU3A 1FIAA 1ETYA 4RM3A 1ACIA 1S7EA 2HKOA 5BOXA 2K86A 3PNVA 5J1YA 1YJNI 4KA4A 1A04A 3M1CA 4E7HA 3FKIJ 3Q0WA 1N77A 3I59B 5ILVA 1V54H 1X1PA 4U0WA 1VF9A 1ONVA 3OYBA 1XB4A 3H5AA 1WWXA 1KYZA 1RRJA 2DMPA 1LEBA 1YTYA 2Y0SA 2VOPA 2NS8A 3VYUB 3IH4A 2ZJPF 4HNUA 1U8RA 3BC8A 2EZIA 2EWNA 4V2GA 1P7JA 3ASNH 3HTUA 3K4NA 3TW6A 3DBLB 3NWSA 5ILUA 2R5YA 1MNMC 2F5VA 3EUHC 3SZGA 2E2HJ 3HRTA 1WJ5A 4PJLA 3D1NI 3KLNA 3O8HA 5B66C 3LQRA 3OS0A 1RUOA 3W6JB 4UY8I 1R1VA 3VOEA 1PP7U 2NVTJ 4ZYGA 2JQ7A 3KX2A 1MMSA 1VQ8I 3I64A 2GXBA 2LD5A 4YFNF 1AKHB 3DPLC 1FBUA 5LHIA 2F6CA 1DUXC 3CCEI 3KP3A 1BIAA 2XGXA 5DTDA 5HODA 1YX3A 3WU2C 3K1PA 2CS3A 3KEOA 5L3GA 3C18A 4ZTJA 3ZGKA 4MQ9F 2ZXWH 1E3PA 2PG4A 2Y31A 1Y0NA 1O7FA 2WBMA 2LLKA 2MLGA 3JREA 1Z0XA 2VASA 4D5FA 3LAJA 2JVGA 4ZH4F 4BEHA 5IP7J 4QTRA 3RSNA 3G3ZA 2LK2A 3HOYJ 1SFUA 1YJWI 4MLOA 2VPLA 4BUPA 3GCMA 2BBYA 4M6XA 4XBFA 1XPXA 3ERED 1NG6A 2XPUA 1MMDA 4W1UA 3OYAA 1T2KA 2O9LA 2CGPA 1DGWY 1ZYRF 4M3FA 3CCSI 4LLNA 3LWFA 3JSPA 4EJTA 3M8EA 2K85A 4TV7A 4FETA 2H6BA 3CJRB 1Z3YA 5L3EA 1MGTA 3FBNB 4XIDA 3C2GA 3HGGA 3GZ5A 1UJ8A 2LSOA 2HR3A 4D7NA 1SVMA 4HV5A 5HS8A 2HPMA 3H5NA 1HLVA 1MBFA 3VODA 3EYIA 5KK1A 1ZG5A 1W36C 1VQ4I 1X58A 1GDTA 2XPWA 3DV8A 2FXAA 3OL4A 1EA3A 3RQ4A 2E7WA 4XICA 2CW0F 2I10A 3ZOBA 3OIOA 3COAC 5C4JJ 1FY7A 1SVLA 3BZ6A 3K6GA 3WTYC 2V1NA 5HDNA 4CDGA 3L7WA 4L0YB 2Y9ZA 2OQGA 2Q1ZB 4LB6B 2FUG2 2AS5F 1IXSB 3S14J 5LRSA 2JZYA 3S17J 3DEEA 1VQOI 4Y15A 4Y52J 1SFXA 2M3AA 2EZHA 3ECHA 3DU5A 3SEZA 4A69C 5DM6F 2EFWA 3ML6A 1JT6A 2KZVA 4C3HJ 2QSHX 2XUBA 5D5UB 1W7PB 4KISA 4R1HA 1J2XA 2V1UA 3S1QJ 5C44J 3MZYA 2X6XA 4N4OB 2HQRA 4L9TA 3CD6I 3I58A 3LL7A 2V79A 1HW1A 3CJNA 2COMA 5DEQA 3AAFA 3V7SA 2I5UA 4KN7X 1ZK8A 3B02A 3FWEA 3I54A 3BROA 5EG0B 2XROA 1HOMA 2FEZA 1S7AA 3WTVC 2IGNA 4NB5A 3D5SC 2UXNA 1KONA 2L9SA 3LQQA 3A2KA 5DCMA 3DPTA 3GUDA 4M3DA 3T5XA 1UG0A 4G6DA 1JKOC 4EV0A 4IHYA 1QGPA 3T8RA 3PO2J 2LBFB 2BOLA 2OZ6A 5IT3A 3TQNA 2VOOA 2B7EA 1BN5A 1TWHJ 4HNTA 4J19A 4XK4A 1OMIA 4EEFG 4HX8A 4BY1J 2CJJA 2XGDA 1X3UA 4H4KC 2KMUA 3CDIA 1RR7A 2X6OA 3I4PA 3FISA 1UCRA 4A2UA 2K4BA 1KGSA 1WJCA 3BZKA 4L18B 4G6QA 4HSTA 1TWGJ 1ZGWA 2ESHA 2XPVA 2PMHA 5IT9Z 4B3XA 2YPRA 3LSRA 4RAZA 1EH6A 1MBHA 3GWZA 4I99C 3M3YJ 3A4CA 3D5LA 1GHCA 3HGYA 1XGNA 4G9YA 1P9QC 3CUQB 3S2WA 5LHGA 4EGYA 1QZEA 2FA5A 2HOAA 1SFOJ 2QQBA 2UZKA 3ABMH 2KJBA 3F8BA 2V26A 1TP4A 2AQEA 2CUEA 1FOWA 4BJ6C 4O3MA 2X0LA 1E0EA 1NTCA 2V7FA 1G2HA 2HZTA 1IZ1A 4OAYA 5C3EJ 2FQ3A 2NYXA 3LSTA 2RDPA 4HEA2 4PJNA 4M72A 1X1CA 3KEQA 1ZR4A 3T0YA 4DYRA 4IPAA 4KT6A 4PJJA 1T08B 1OYIA 1V5FA 2VKHA 3Q5FA 2CSOA 2CV0A 3I9V2 1B59A 2KLOA 1SAUA 3CO6C 2IP2A 1ZARA 3BQZA 3VYRB 4YIRX 4I02A 4BXXJ 1HBXG 4HAMA 2DU9A 3CJQB 4IHWA 1ZLJA 2NS7A 3R4KA 1JXSA 4RGXA 3E0JB 1YO5C 1IGNA 4AM3A 2H6CA 3H0DA 1JI8A 1QVTA 1PUEE 2XC7A 2BE5F 3ZN0A 1TWCJ 3KYLA 1FP1D 1OYWA 4LGWA 1Y56A 1IXCA 4UV9A 1B72B 1P4XA 3CUOA 5J4VA 1D0YA 3H5RA 3JRHA 3FXUA 1TBXA 2MW8A 3GLLA 3NEUA 4JX6A 5HDGA 1JKRC 3Q0UA 5EJCA 4NQWB 1A6QA 1IRFA 4OMYA 1J59A 2LTPA 3RDIA 1ZLKA 2X6YA 2O5RA 3AG4H 1FOYA 3CUQC 1KA8A 2KZGA 3QU6A 4BQOA 4DOZA 1FTTA 4DZPA 3WTSC 3DXJF 3ZR8X 1WVRA 3ZMSA 5DD4A 4AU7A 2HVSA 4NC8A 3C7JA 4Z6YA 3SZPA 2R93J 3B6CA 3E5UA 1ENHA 5CKTA 2K9LA 4GYGA 4A0ZA 2CMPA 4R79A 3CDHA 1ETKA 1K4SA 4Y13A 1U8BA 3V7RA 5E1ZB 4BHCA 3WTXC 4LLGF 3PUBA 1K4TA 2CQ7A 2DI3A 2WY8Q 1IO2A 3LA7A 3PQKA 2N8GA 4F55A 3CCUI 4UXNA 1AKHA 5FKOA 4LK0F 2FBHA 2CUZA 3H9QA 3PNYA 1YIJI 2NXNB 2ICWG 5E18F 3QWLA 2A07F 1FPQA 1NK2P 1SMYF 1XMAA 2E36A 1P4AA 2Q2EA 4V2FA 1VQ9I 2E1MB 2HVQA 3HYIA 2E34A 2XHKA 4LJZF 4G7ZF 2KIMA 2AHQA 3HXLA 2A69F 2VN2A 1W5SA 2VQCA 2X1DA 5BMZA 3BWGA 1PUFA 1DDNA 2D5VA 1MKMA 1WI3A 1NHAA 2VKVA 1I1SA 2X51A 1KU3A 3F21A 1REPC 3MCZA 2EIKH 2Z3YA 2LH9A 4XLPF 2JVHA 4QPQA 5DV5A 1O3SA 1BOAA 1BBYA 1VQNI 2XASA 2HZDA 4FE4A 4HX7A 5M3MJ 3WTTC 1MMGA 4ZYEA 4CCLA 2R5YB 2NVQJ 3L2WA 2TRTA 1SAXA 3J7AO 3L1PA 2C6YA 1PJRA 3I4MJ 4E4HA 4F3QA 1R22A 2OBPA 4IJAA 5LGTA 2M8EA 1ZELA 2IGOA 2JSPA 2RKHA 1HA8A 3A1YA 2DAOA 2K7LA 3KZYA 1H89C 3FZVA 2DLLA 5BNGA 2PJPA 2V9KA 3WG9A 3SFZA 3S3OA 1FYMA 4RAFA 1VNDA 1IN7A 2MA3A 3MMYB 1YITI 4YEJA 2LOOA 2ESNA 2XRNA 1W0TA 2XDVA 4A5NA 3MZHA 2EZKA 1B6AA 4YELA 2FX0A 4WXHA 3IWZA 1K83J 4F52A 3SXYA 1IAWA 3E3VA 5E3NA 3H92A 3U1DA 4Y7NJ 2KHMA 2E1CA 2EIMH 2OTLI 5LRRA 4ETSA 2KPMA 3ZRGA 4ESBA 4CZCA 1JUSA 5GAGJ 4XLAA 2DFFA 4P1WA 3HOSA 2XAJA 1YG2A 3TKYA 3OOPA 4NC7A 3JRGA 2E71A 2FBKA 3TOBA 2PQ8A 4JK1X 1P2FA 3QU3A 4N0BA 2F5DA 1W7PA 2GQQA 4HNVA 3DBRB 3GYHX 1X3WB 2W48A 1LEAA 2DPDA 2DO7A 2QLZA 4GDFA 5FLXK 3L2CA 3CCQI 4JX4A 4JX5A 1XCVA 2P6TA 3ABLH 4Y33A 3OIQA 1VQ7I 1TT5B 2W84A 3FF5A 1OJLA 2MH2A 2EV0A 4M9SA 4KJZA 2DTRA 2HQNA 5IOZA 5EG0A 3OSGA 1BI0A 3ERMA 4XLFA 5J47A 2MG4A 2WAFA 3MN2A 1D1BA 5GPCA 3ULQB 5BQTA 3OSFA 3S1RJ 2KRCA 1APLC 1PDNC 1Y39A 2RV8A 2M7AA 1F1ZA 1ZRCA 4IHTA 1A5JA 1VQ5I 3KFWX 2GBYA 3RKWA 3CF2A 1GV5A 1BJAA 2K3PA 3ZXSA 3Q3SA 2F5CA 3OV8A 2NOJB 2L4AA 2O61A 2ELJA 3BTIA 4QPOA 5DYMA 4ZTFA 1X1BA 1YW7A 4KNYA 2RC4A 5E3MA 4A3IJ 1W7PD 1C0WA 3U9GA 4BXUA 4KIFA 2VJIA 2L02A 3IRQA 5EZGA 2OZUA 1G3WA 1H8AC 2PI0A 4IHXA 3WTUC 3IP4B 3OYIA 2I8DA 1V4RA 2JA6J 1BI2A 2O0YA 2DJNA 3BR3A 3BR1A 3GTGJ 2Y9YA 5F04A 2HQAA 3GZNB 4ABZA 4BBRJ 3CUQA 3CC2I 5DM7F 4KYWA 4CA0A 4ZYHA 1VZ0A 2DMTA 3JTGA 3FKJA 4I0BA 1Q1VA 2R7QA 4B09A 1W5CC 2YR2A 1T6SA 4UNOA 2ADUA 3CTAA 3V42A 1E3OC 1FYKA 1OR7C 3F8FA 4IOAF 1TW3A 4IF4A 3GTPJ 1YQAA 2CW7A 2ACJA 2RREA 1XSXA 2K3FA 2Y2ZA 5CYVA 4IHVA 2GOXB 3LSHA 2X85A 1ON1A 3E97A 4E7ZA 2ELHA 2LC2A 5FKMA 3WTWC 3IKTA 3I5UA 5K5OA 1QPIA 2XSDC 1MJBA 3H0GJ 2XGEA 1JKQC 4IQJA 1R1UA 2LYCA 5IPAA 1B72A 2ZXIA 2ECBA 2P5VA 3CCMI 1HKSA 1DQUA 1OISA 4C3JJ 3ZMTA 2ZXJA 4ENKA 2O03A 2VC1A 4A3BJ 1WI9A 2MABA 4ZYAA 1FOXA 4IRHA 2EA2A 3KP2A 4NQWA 5FKKA 2JPBA 2FE3A 3G1OA 2P7CB 1IUYA 2V9VA 1EV7A 2DT5A 1Q1HA 3G2BA 1D8KA 2DN0A 3RPQA 1IN8A 3PL8A 1RC9A 4BNCA 4FT8A 3HSEA 4IKFA 3FXQA 3S93A 2CFXA 1CGPA 1ZKGA 3AL0C 4FHTA 1J5YA 2BVMA 5EDNA 3J81K 4RDUA 2W1OA 1Y1WJ 5L3BA 1O3QA 2D1VA 1DPRA 2F4IA 3FMRA 2VIXA 2ISZA 5M3FJ 3RI4A 3BCAA 5EF6A 4E7JA 3HPHA 3MKLA 3MEXA 1MDMB 3F3XA 4A3EJ 2E2IJ 3ESWB 3HRSA 5E3LA 2JRTA 3K4KA 4BU2A 3GX4X 3DLAA 2NRAC 4BGDA 4CGZA 4JBAA 2LF7A 1IF1A 3GEZA 1YHQI 3EQLF 1Z91A 1Z9CA 1R5HA 4C3IJ 1ZRFA 2ELKA 2MBFA 1G3SA 1MMAA 1YFHA 2NVUB 4CCMA 2Z2SB 3DWLE 3BCBA 5CVUA 4ON0A 3NQOA 2K40A 4X1EA 5D5WB 4HLYA 1Y8QB 3S2HJ 2Z1DA 3BDDA 4CSWA 1D1CA 1LUJB 3AG1H 3BR5A 1Z6TA 4XKBA 4E7LA 3M4OJ 1IDZA 2QKLB 3HSRA 1LPQA 1JTYA 3HM5A 1U2WA 4HA8A 2ZJQF 1V3FA 4PFOA 1B1BA 1QZYA 1RKWA 4S0HB 1UMQA 4HYEA 4WK8F 3GFLA 2DA5A 2VBYA 1FMWA 4ESJA 3QPHA 4FX4A 2E1NA 2Q0OA 3FHNA 2M34A 4NHJA 2CFOA 3HOUJ 2FD5A 3LSJA 2K5CA 3WTZA 3QPTA 3TEDA 2ZNYA 4N9HA 5B1BH 2DYSH 2ZSIB 1HSJA 4XRMA 2DODA 3EPZA 1R49A 1K6YA 2R0QC 1BA5A 1HW5A 3BR6A 5FROA 2OTJI 2HPIA 3RZOJ 1YRNA 2EFPA 3F8NA 4UVAA 2EK5A 2QBYB 2R5ZB 2R3SA 1JHHA 3PIOF 2DOAA 2Q2EB 2ZC2A 4XR6A 3WGHA 4OIRF 4B8XA 3CMAI 3S3MA 2L01A 4EJUA 2XAFA 4M73A 3F23A 3QPSA 2PN6A 4I2OA 1FNNA 3D0SA 1OYYA 4CCKA 1QNTA 4MFDA 5H6QA 4DNCA 3RYPA 1JT0A 3RPUA 1PUFB 2BY1A 3P7NA 2AO9A 4IL6C 4BS9A 1OCTC 2K9SA 4V19K 1D5YA 1DGRM 1G6NA 3U1KA 3R0AA 4UB6C 5ICCA 1T38A 3GTOJ 4XNFA 3HC7A 4G8XA 5K1YA 3X2QH 2A6EF 1Z3XA 5FLMJ 1GXQA 5E3OA 3I53A 3SYTA 3OS2A 1Z6RA 2JWTA 1E17A 1EH8A 1OKRA 1Z21A 3MFKA 2VODA 4E7KA 2CUFA 3F8CA 2HYFA 1X19A 2UUZA 1B9MA 1LKXA 1IUFA 2K9MA 4O5VA 3OWTA 2PMUA 2M5WA 2IS4A 3N97A 4YIFA 2CW8A 3ZQLA 2W57A 4HBLA 4KIGA 5TJJA 3DU6A 3A02A 3RKQA 1G3TA 1XDUA 3GXOA 3RPUD 5IOYA 1OR7A 2DPUA 1UZCA 2JUCA 2HDDA 5CQEA 1UG2A 2M30A 2VUMJ 1S5LC 3WODF 2W85A 3JAMK 3J80K 1FIPA 1A31A 2PJRB 4YFXF 4EGZA 3JRIA 4M74A 4A3MJ 4KUMA 1I50J 3L2RA 2P0WA 3V4GA 1K78B 1R71A 1KYWA 4A3LJ 1RKTA 2DQLA 5FKNA 3G1LA 3BG9A 2W7NA 1YW8A 3I4NJ 1V55H 2XAUA 4Y17A 4XL9A 1P7IA 2Z16A 1VQLI 2VJJA 3MKYB 3H3VK 4L9JA 5GAHJ 4G6TB 4A0XA 2GLOA 4A12A 3MZ8A 3O8GA 3B73A 2QVOA 3BTCA 3RKYA 1R23A 3FXJA 1MH4A 3LSPA 2LREA 2GIVA 4UUSA 4KDPA 3JRFA 1MD0A 4LK1F 3MD2A 4K2EA 4XN3A 4S04A 5KCMA 3VDXA 4ESFA 1I5ZA 5B3SH 3DTEA 1FOKA 1SEUA 3H36A 2KIFA 1QZZA 1T95A 1ZAOA 1AOYA 5H6RA 3NRVA 4QSHA 3O6BB 2CQNA 1ZREA 3ONQA 1MIJA 4LD5A 1VQPI 5F0FA 2G0EA 3RCOA 2MYSA 1X4OA 3MAJA 3HTSB 2WAEA 4P5OA 1WGXA 3BT9A 4Z2YA 3ZMZA 3F6OA 1I6HJ 3PO3J 2KT0A 2F2EA 4U7DA 1ODDA 2G7HA 3M7GA 1ETQA 2OD5A 4FISA 4C2UA 5IYBJ 4MFEA 3KPHA 4YG2F 5A2QK 1U0JA 3TBIA 2JSCA 3S32A 1U9OA 1XN7A 4XSZF 2QEXI 3DTIA 5ERIA 5KNLA 1K61A 1RIOH 2HOEA 2PX9A 4B3AA 2VI6A 1CQTA 2R92J 3ISPA 4EATA 1KQ9A 4IO9F 4RLQA 3FXLA 2M45A 3PIPF 1FX7A 4F91B 2M0CA 2UXXA 3LSKA 1NH3A 2DXIA 3E7LA 2Z33A 2ECCA 2DMUA 3HOTA 2IS2A 1G8XA 1ULYA 2MFZA 2FU4A 4HDVA 3TOAA 3HG9A 2M4GA 1U5TC 1UB9A 3PFIA 1ZR2A 4L0ZB 1ZGJA 3AFHA 2WAQN 5CPRB 3E5XA 3MWMA 4L5JA 2XSJC 3VB2A 5GTHC 1Z67A 2QENA 2ZFWA 2DFHA 4D7MA 4U88A 1FMVA 4RM2A 3PJRA 3TW7A 3VYSB 2PEXA 4F92B 3GVAA 4M6VA 1O3RA 5K5QA 4II2A 2R7OA 2H09A 3EUHA 1V5GA 1D5VA 1OCZH 1E2XA 2XIGA 3GBGA 4IOCF 5FB2A 4XSXF 5EZHA 1FYLA 1RESA 1V5EA 2ZO4A 4LITA 3FXKA 3HIFA 1MDMA 1R00A 2DFIA 2F4OB 2HYGD 3FM5A 3GFMA 1FLIA 5BS6A 2L2OA 2DOFA 2BW3B 1USSA 4LB5A 3RKXA 1HKTA 1QA6A 3HHGA 1D1AA 1SC7A 3D5RC 1LDJA 3P9KA 4IQ4A 4BAYA 1LDKB 2LVSA 3CCVI 1HW2A 5GPAA 5C4XJ 2STWA 4OIQF 2V1XA 3OYJA 4AVPA 3BG3A 3QYBA 2CRGA 1MSFC 3A0BC 5H20A 2UWMA 5ICGA 3BJ6A 4UVBA 3HEFA 3K70C 3BOQA 4ZDOA 3Q9VA 1QVUA 2PMZN 2IJLA 4XLEA 1VQ6I 3JRBA 2V9PA 1DPUA 4A93J 1TQPA 4KN4X 3TDZC 2WADA 3J7YJ 3LFUA 2LR8A 1LNWA 3MKWB 1TT0A 1MBEA 1RR8C 1XD7A 4XORA 3KZZA 5LEJA 5D5VB 2VQHA 4ENJA 3UKGA 3A01A 2GA1A 1IRXA 1FC3A 3W6KB 3ZN1A 3GF2A 1K7AA 1AU7A 2CQQA 2FOWA 2MGQA 2WY7Q 4DW6A 1ERDA 2NVXJ 3LSGA 5CVRA 5FFXA 3J7AY 2JRMA 2X9DA 2R7SA 4KT5C 1T0FC 1X1DA 1MBJA 1IN6A 2YX7A 3IRRA 4Q47A 5GAEJ 3HOVJ 1QU3A 1OQYA 3W6VA 1ZHFA 2VQLA 1WRJA 1D0XA 4H0EA 1VFCA 2VC0A 2EPFA 4AC0A 4A0YA 4U87A 3OR2C 3LAPA 4HF2A 3HOXJ 1XGOA 3JRAA 1T39A 3HUGB 4JYKA 1KU2A 2ZBKA 4X0GA 2QBYA 3FHZA 1PYVA 2R5ZA 1UELB 4A3DJ 2HYJA 3BPXA 4GO1A 3ZQIA 1RZ4A 1R6RA 2K27A 1OPCA 3HZJA 3OS1A 3GTKJ 1IC8A 5F1JA 3V8JA 3SFIA 4ZZLA 2OF7A 4XRSG 1U9NA 2WA0A 4BJTA 2L4MA 5IYCJ 2XB5A 3OYMA 3QYFA 2QWWA 3CMMA 4M3GA 4AIDA 4A3FJ 2MH9A 4HW0A 4UV8A 1TTYA 2Z5UA 2YUSA 1K6OA 1WJDA 2FNPA 3TO6A 4C9YA 1JHFA 4PJ0C 2O8KA 1Y1VJ 1X4PA 4Q48A 4EQQA 1W36D 5HS9A 3WHBA 4C2MJ 2QQAA 3R0JA 1F36A 1HSTA 4NBQA 4YFKF 3CMYA 3ABKH 3QPLA 5B5EC 2XAQA 2HKXA 2FF4A 2FQ4A 3KP6A 3U21A 1YRNB 2QKMB 1MZBA 1WJEA 2JTVA 2HTJA 2BY3A 4PFPA 4MO7A 3IC7A 2BXZA 2PLYA 4B4CA 3REOA 4OIPF 4I0AA 4A3CJ 1ZGAA 2HGCA 4DIQA 2Z99A 4BKXA 2IT0A 2JA8J 3BZCA 1SFEA 2GWRA 3KYCB 1BIBA 4DGWB 3F9KA 3DEWA 1J09A 2PJRA 2CG4A 2EH3A 1K78A 1KZHA 4MHGA 1W5TA 3GMEA 3R61A 1F5TA 1MSEC 4IVNA 3CMEI 2JJ7A 4OWRB 3DKWA 4MGRA 5CJ9A 4HF0A 1IW7F 1HDPA 2JUGA 3KP4A 1ORKA 4XOTA 2DA6A 3A0HC 5JLWA 2W82A 5ICEA 3RQIA 2DYRH 2VONA 3EETA 5FLXZ 1A6IA 1J9IA 2G9WA 3LMMA 4F93B 3GZ6A 2QF7A 5LFAA 1I3QJ 3K7AJ 3UNGC 1X3ZB 3WGGA 4XKCA 4AIKA 3LOCA 2Z9OA 4G7HF 3K4JA 3W2AA 1Z7UA 2VE8A 2WV0A 1MBKA 1U5TA 4JQFA 4WWCA 2P5LC 1R4NB 1N78A 2M0MA 2KISA 4CUGA 1XTAA 4NC6A 2HFHA 2XAHA 4ASNA 1JGSA 4WF2A 2RNGA 4WCGA 2HOTA 4F7ZA 2VE9A 2R7RA 4N9IA 4GYIA 5F0HA 3DKXA 2DTZA 2RQPA 2E2JJ 4GFBA 2BY0A 4CCNA 3RYRA 2R7TA 1FTZA 2BHZA 3DF8A 1ZTRA 1VTNC 5KVRA 5D5XB 2YSRA 4FTHA 2E5NA 3FXRA 3SQNA 2R7FA 1U3EM 2J5OA 3ZPLA 2BEOA 1I39A 2JPCA 2EFNA 4CCOA 1PP8F 1DP7P 5D4SA 5BPIA 2VKEA 2XB0X 4AD9A 1MH3A 4AUXA 2ID3A 5J8CA 4D5CA 2DK8A 4I01A 3HJEA 4RB1A 2CU7A 5JR3A 1P4WA 3PFYA 2ME6A 2EQRA 1S6LA 3W2WA 2BGCA 1A36A 5TISC 2VXDA 5FJ8J 2P8TA 1WJFA 5FD6A 1OCOH 4UUSB 3M8JA 3OYKA 2NAZA 1R5GA 1H9GA 2E35A 4XOPA 2XRLA 2TCTA 1A35A 3KZIC 5AIPA 3AG2H 1WSUA 4AIJA 1HF0A 3LSIA 3WE3A 2IPQX 2VQGA 2QA4I 3AL0B 3E5QA 3HL2A 4BHBA 4HQEA 2VT3A 2LY1A 2K9NA 1O3TA 1TZLA 2WAQA 3C2BA 3H9GA 1MJ9A 1UHMA 3RTRA 5DDGA 2LY2A 4WXDA 3AKZA 4A3KJ 1Y0UA 4D9JA 4AYBN 4CH7A 3PSFA 2FBIA 5D6FA 2ZXHA 3GTLJ 4YIIA 3L09A 4BBSJ 4MTDA 4HLXA 4CZZA 1IG7A 2VKDA 3FDYA 3I71A 2B63J 2BW3A 3GTMJ 3BY6A 4QIWN 1R1TA 2LKPA 3JTHA 2HOSA 1LFBA 2E1OA 1BJZA 2NVYJ 4Q4ZF 2ZSHB 2Y75A 5JHFA 2EINH 3OYCA 2DW4A 4BYYA 2ZCWA 3SDGA 2LF8A 2P6SA 3IUOA 2FJ1A 1O4XA 1GT0C 2DMNA 5ILSA 1TW2A 3IH2A 1EKEA 1WCMJ 4EMSA 5F0CA 3CO7C 1S8NA 5K5RA 3WGIA 3K4LA 4BY7J 5E1WA 5K7FA 1ETXA 1I6XA 2L9NA 3C3WA 3E6MA 2X1EA 5LBQA 1FBQA 1MNDA 1LQ1A 4EJWA 1VI0A 3J81Z 3FMQA 1YW9A 2PMZA 3RIRA 1S72I 3JCUC 1XX5A 1BL0A 4PJMA 3HBLA 1BW6A 2ETHA 2CO5A 2Y69H 1KQ0A 4RAYA 1RI7A 4U0YA 2J5PA 1SVOA 3FK7A 2FMLA 1BR2A 3LSMA 1R7JA 3BJOA 3LNQA 3K4CA 1T98A 3I3LA 4C30A 4IZZA 1R36A 3KLOA 1QPMA 3OYGA 4IRGA 1ETWA 3VFZA 1TNSA 2BVLA 3WHCA 4XQFA 3NARA 2L0KA 3OYLA 2WTEA 3DTKA 2DBBA 2W4SA 4WXCA 2DJIA 3MQ0A 1N75A 2YX4A 1YJ9I 3HUGA 1HKQA 3CQZJ 1H0MA 2LMDA 3S2DJ 5L3FA 4ITVA 1B4AA 4B1RA 2P7VB 2QUFA 2OU2A 1IJWC 5HLGA 1HQCA 3SJMA 5FD5A 3OYEA 2OV7A 2O3FA 2H94A 4DBRA 2GIZA 2UV1A 5M5WJ 1R58A 4HOBA 4IHSA 2X1CA 4X6AJ 5LD2C 4CCJA 2DK5A 5F27A 2IS1A 1MMNA 4E7IA 2V4JC 2OJED 3A01B 5CLSA 4RS8A 3CCRI 2QM3A 3L2UA 3G73A 3DPUA 5GP9A 2COBA 2CH0A 2EB7A 3ZCOA 5HVQC 1LVKA 3FXOA 2GAUA 2HTSA 1QO0D 3BR2A 2V1DA 4M71A 2O7OA 3DCFA 3ZQFA 2A61A 5LLQA 3K1MA 3ABTA 3DEUA 9ANTA 1IV6A 3M07A 1LDDA 2DMQA 2X4HA 2MLKA 2OUMA 2IRFG 1H9TA 5JHUA 3HOZJ 1IRZA 2OC6A 1WQ2A 4PUSA 4KIBA 3TDUC 3JSOA 4G94A 4P96A 4PGGA 3O3KA 2F4MB 1GVDA 3QODA 3WG7H 1SD6A 1TLHB 2GXGA 4LG0A 1VQKI 1FSHA 3PNTA 1PVEA 3NAUA 3BG7A 1BI3A 4LOCA 1QHHD 4EM1A 2X6WA 5CVVA 1RNLA 3DKYA 3Q0VA 2BZTA 2FRHA 3GLXA 2EFOA 3S1MJ 3N05A 5GADJ 3OIPA 1G59A 2EILH 4AWXB 4RB2C 3BP8A 3TMOA 1BI1A 1U6GA 3OYNA 3IL2A 3ZP5A 1LFPA 2XGCA 3E1SA 4G12A 4BL0B 3E6BA 4ENMA 2VJ5A 3BG5A 3FM3A 2E19A 4B43A 4FE7A 2L9VA 4YRVA 3Q9SA 2VJ4A 2OQRA 3K4MA 5LEKA 2MSYA 2W24A 1BM9A 1T8IA 1D3YA 4HX4A 4PZJA 1OLTA 2OCEA 1LJ9A 2ZJ2A 4EM0B 1GLNA 1SANA 1ZN2A 3OY9A 5EGOB 2MC3A 3HPGA 3HHHA 4RGSA 3I55I 4MNUA 3EUAA 1AHDP 2LRDA 1IXRC 2A68F 2CUJA 1R9TJ 4AVZA 5CVIA 3CESA 3K69A 1X2NA 3PM1A 1ETOA 2L7KA 3JAMZ 3QP6A 3J80Z 3FBIB 3QOEA 3QQAA 3GFJA 3G1MA 3TO9A 4EJOA 1Z7LA 4D0PA 1SD5A 3FK6A 4M9ZA 3KP5A 3OR1C 3TGNA 3R60A 3SHFA 2BYVE 2HU9A 3K2AA 1KQ8A 3ASOH 2XKPA 3R6SA 1JJ6C 2B9SA 1T33A 3WU1B 3W2VA 4E7SA 3FMSA 1FJLA 2P81A 2NNNA 3HRUA 2WB1N 5LGUA 1N25A 5AONA 1IDYA 2W25A 3IKVA 5FFZA 1H88C 4MEYF 3UR3C 1XMKA 2CV1A 1QHGA 1U5TB 4CICA 1XG1A 4ZC3A 3ECOA 1JJ8C 2XV4S 4HSRA 1G4DA 2QZ8A 4LLLA 3B6AA 5F6FA 3F6VA 2M4KA 5ED4A 2E5ZA 3S15J 3SZTA 2CYYA 2IEKA 2V6CA 3ZMVA 1WJBA 5HNFA 3JRDA 3LFKA 4NNJA 2CV2A 2JN6A 2R7XA 2IA0A 4BH9A 2NNYA 1FEXA 1GUUA 3ABUA
chains in the Genus database with same CATH topology
5TRDA 1ZRDA 5E20A 5E17F 5AIQA 3WE2A 4WX9A 5D4RA 4HV6A 5JFRA 3M8FA 5A2QZ 5D8LB 2ZMEB 6PAXA 2NS0A 3P9IA 4DQ2A 1J7KA 2LNBA 4CHUA 2D1HA 2QQ9A 1FT9A 4U7BA 2HDCA 3T1BA 2EA4A 3M9AA 1YIOA 2A5YB 1CF7B 5F64A 3HRMA 4LFUA 3IHUA 4CXFA 4PGHA 4LMYA 4Q5SF 5DUIA 3LA3A 2KRFA 3ROUA 1XGMA 4PDKA 4XRFA 1LB2A 3JW4A 2VBZA 4UUVA 2R7DA 4S05A 4UVCA 1D8JA 5IT9K 3E6DA 3RJPA 2STTA 4ZZDA 1Z05A 3K0LA 4MQVA 5BPDA 1F4KA 2QYOA 5D8KB 4ZYDA 5HLIA 1TQMA 3BPVA 3T8TA 2Y48A 1FP2A 1FBSA 2VBWA 1ZG1A 3GW2A 1I27A 1YS6A 4P9UA 1UHWA 3BJAA 1K79A 2H27A 1S3JA 1O7LA 5E8IA 1BC7C 3CLOA 5HS7A 1XSDA 5DUKA 4XLNF 3GO5A 2XAGA 1HXDA 2IA2A 3VEPA 5LHHA 3V8KA 2XVCA 4AIHA 1AWCA 2OAZA 3K9TA 4HZFA 2DQRA 4I09A 5HOOA 5L3CA 2IW5A 3PQJA 3I59A 3ZMDA 1JE8A 2FOKA 2BV6A 1W4MA 5JI6A 5E1XA 4RB0A 1USTA 2P5KA 2JT1A 4BHPA 3E6CC 3H3UA 2PFBA 4A6DA 2EFQA 2WC2A 4OIOF 1WKMA 2RGVA 3LA2A 4G7OF 4A5MA 4U0VA 1KU7A 1J0RA 1RUNA 5HDKA 1SD7A 1STZA 2KKOA 3KE2A 4OU0A 1LVAA 1O57A 2LDUA 2D2WA 5EEGA 2A3SA 3C1DA 4EM2A 1U78A 2O6GE 2CWEA 2IA1A 3ZQ7A 4I7HA 1YYVA 2F5EA 2EV5A 1P6RA 4KICA 1S7OA 4OINF 3L9FA 1GXPA 4LG0B 5HLHA 1G3YA 2K4JA 2CQKA 1F9NA 2ZNZA 1QBJA 4P9FA 1S29A 5FGMA 3O2PE 3WU0A 5DCFA 3IWFA 4KFCA 1ZH5A 1L0OC 2VXZA 2P4WA 4ENNA 1P92A 2VBXA 2TDXA 2PBIA 3F72A 1KU9A 2G7UA 5CVJA 4CYDA 1FZPB 3GFIA 5J6XA 3F8MA 3QRFF 1B9NA 2RNJA 2ZKZA 2HEOA 2FMYA 5DD8A 4UHTA 4KMUX 1MJAA 2RN7A 4L5IA 2KIUA 2WWYA 4IRIA 1TQIA 3F22A 2XKOA 3V7CA 2A6HF 2D45A 2VT2A 1FSEA 3U2RA 4HQMA 1Z1DA 2FNAA 4O6JA 4IXAA 2FSWA 1XDSA 2EJRA 5ICFA 4OMZA 4L9NA 2ZMEA 4OOIA 1L3LA 2MD5A 3V8LA 2F5FA 1YS7A 1GVJA 4P55A 4PCQA 3FX3A 4RGUA 3TO7A 4MEXF 4QWQA 4GCVA 1CF7A 2HWVA 5L3DA 4HDUA 2AXLA 1BC8C 1IN5A 3ZMUA 1EH7A 3DP7A 5F1RA 3QAHA 4M9XA 2Y0MA 1FWZA 1IN4A 2E7XA 4E70A 3QP5A 4HF1A 2M1BA 4CO8A 1T0FA 4EJVA 3M1EA 2KJCA 5JVTA 2GA2A 5DCMB 2M87A 2OA4A 2EV6A 4M6YA 5E8GA 4MTEA 5FO5A 3K1NA 3QOPA 3DFGA 1IRGA 3P9CA 3KCCA 4EVIA 3N4MA 4A6EA 4GGGA 2O8XA 3KETA 4I98B 4KMFA 4FX0A 3KP7A 4RGRA 5LGNA 2RVCA 1UFMA 3I0TA 1I1GA 2HS5A 2ISYA 2K02A 1XCBA 1YLFA 3L00A 1QQIA 3HSFA 5EEHA 4R8HA 5D6EA 2GZWA 1TNTA 2IVMA 3H3ZA 4GXOA 1ZG3A 1SD4A 5J8FA 3DQVC 1XSVA 3K2ZA 3EDPA 2Q8KA 4QLCU 4L9VA 2L3DA 1SMTA 1ON2A 2L54A 1J75A 3ELKA 1XGSA 4RB3C 2B0LA 4BQAA 3EYYA 2YU3A 2HKOA 5BOXA 2K86A 4KA4A 1A04A 3I59B 5ILVA 4U0WA 1ONVA 1XB4A 1WWXA 1KYZA 1LEBA 1YTYA 2VOPA 1U8RA 2EWNA 3HTUA 5ILUA 3HRTA 3KLNA 1RUOA 3LQRA 3W6JB 1R1VA 3VOEA 1PP7U 4ZYGA 3I64A 2GXBA 4YFNF 3DPLC 1FBUA 5LHIA 1DUXC 3KP3A 1BIAA 2XGXA 3K1PA 3KEOA 5L3GA 3C18A 4MQ9F 2PG4A 1O7FA 2MLGA 3LAJA 4ZH4F 3G3ZA 1SFUA 2BBYA 4M6XA 4XBFA 3ERED 1T2KA 2CGPA 1ZYRF 4LLNA 3LWFA 3JSPA 4EJTA 3M8EA 4TV7A 2H6BA 5L3EA 1MGTA 3GZ5A 2LSOA 2HR3A 4HV5A 5HS8A 3VODA 3EYIA 5KK1A 1ZG5A 3DV8A 2FXAA 2E7WA 2CW0F 3COAC 3WTYC 1FY7A 3BZ6A 5HDNA 4CDGA 3L7WA 4L0YB 2OQGA 4LB6B 2AS5F 1IXSB 5LRSA 2JZYA 4Y15A 1SFXA 3ECHA 2EFWA 3ML6A 2XUBA 5D5UB 1W7PB 4R1HA 1J2XA 2V1UA 3MZYA 2HQRA 4L9TA 3I58A 2V79A 1HW1A 3CJNA 2COMA 5DEQA 3AAFA 3V7SA 4KN7X 3B02A 3FWEA 3I54A 3BROA 2XROA 2FEZA 1S7AA 3WTVC 4NB5A 2UXNA 3LQQA 5DCMA 3DPTA 3GUDA 3T5XA 4G6DA 4EV0A 1QGPA 3T8RA 2OZ6A 5IT3A 3TQNA 2VOOA 1BN5A 1OMIA 4HX8A 1X3UA 3I4PA 1UCRA 4A2UA 2K4BA 1KGSA 4L18B 4G6QA 2ESHA 2PMHA 5IT9Z 2YPRA 4RAZA 1EH6A 3GWZA 3D5LA 1GHCA 1XGNA 4G9YA 3S2WA 3CUQB 5LHGA 4EGYA 2FA5A 2QQBA 2UZKA 2KJBA 3F8BA 4O3MA 2X0LA 2HZTA 1IZ1A 2FQ3A 2NYXA 3LSTA 2RDPA 4M72A 3KEQA 3T0YA 4IPAA 1OYIA 3Q5FA 2CSOA 1B59A 3CO6C 2IP2A 1ZARA 4I02A 1HBXG 4HAMA 2DU9A 1ZLJA 3R4KA 1JXSA 4RGXA 1YO5C 2H6CA 1PUEE 2BE5F 3ZN0A 1FP1D 1OYWA 4LGWA 1IXCA 4UV9A 1P4XA 3CUOA 3FXUA 1TBXA 3NEUA 5HDGA 1IRFA 4OMYA 1J59A 3RDIA 1ZLKA 3CUQC 3QU6A 1KA8A 3WTSC 3DXJF 3ZMSA 5DD4A 3C7JA 3SZPA 3E5UA 4A0ZA 4GYGA 4R79A 3CDHA 4Y13A 3V7RA 5E1ZB 4BHCA 3WTXC 4LLGF 2DI3A 3LA7A 3PQKA 4UXNA 4LK0F 2FBHA 5E18F 2A07F 1FPQA 1SMYF 1XMAA 1P4AA 2Q2EA 3HYIA 4LJZF 2XHKA 4G7ZF 2KIMA 2A69F 2VN2A 1W5SA 5BMZA 3BWGA 1DDNA 1MKMA 1NHAA 1I1SA 1KU3A 3F21A 1REPC 3MCZA 2Z3YA 4XLPF 5DV5A 1O3SA 1BOAA 1BBYA 2XASA 4HX7A 3WTTC 4ZYEA 1SAXA 3J7AO 2C6YA 1R22A 2OBPA 4IJAA 5LGTA 2M8EA 2RKHA 2DAOA 2K7LA 3KZYA 3FZVA 2DLLA 2PJPA 3WG9A 3SFZA 1FYMA 1IN7A 2MA3A 2XRNA 2ESNA 4A5NA 3MZHA 1B6AA 4WXHA 3IWZA 3SXYA 1IAWA 3E3VA 3H92A 3U1DA 2E1CA 5LRRA 4ETSA 4ESBA 3HOSA 2XAJA 1YG2A 3TKYA 3OOPA 2FBKA 3TOBA 2PQ8A 4JK1X 1P2FA 3QU3A 4N0BA 2F5DA 1W7PA 2GQQA 3GYHX 1LEAA 2DPDA 2DO7A 2QLZA 5FLXK 3L2CA 1XCVA 2P6TA 2W84A 3FF5A 2MH2A 2EV0A 4M9SA 2DTRA 2HQNA 1BI0A 3ULQB 5BQTA 1PDNC 2RV8A 4IHTA 1F1ZA 1ZRCA 3KFWX 3RKWA 1BJAA 2F5CA 3OV8A 2L4AA 2O61A 5DYMA 4KNYA 1YW7A 2RC4A 1W7PD 1C0WA 3U9GA 4BXUA 4KIFA 2L02A 3IRQA 2OZUA 1G3WA 2PI0A 3WTUC 1V4RA 1BI2A 2O0YA 3CUQA 4KYWA 4ZYHA 3JTGA 4I0BA 4B09A 2YR2A 1T6SA 4UNOA 2ADUA 3CTAA 1FYKA 3F8FA 1TW3A 4IF4A 1YQAA 2ACJA 1XSXA 5CYVA 1ON1A 3E97A 2ELHA 3IKTA 3WTWC 3I5UA 5K5OA 1MJBA 1R1UA 2P5VA 1HKSA 3ZMTA 2ZXJA 4ENKA 2O03A 2VC1A 1WI9A 4IRHA 2EA2A 3KP2A 4NQWA 2JPBA 2FE3A 2P7CB 1IUYA 2V9VA 1EV7A 2DT5A 1Q1HA 1D8KA 3RPQA 1IN8A 4BNCA 4FT8A 3HSEA 3FXQA 2CFXA 1CGPA 4FHTA 1J5YA 3J81K 5L3BA 1O3QA 2D1VA 1DPRA 3FMRA 2ISZA 3RI4A 3MEXA 1MDMB 3F3XA 3HRSA 2JRTA 3GX4X 2NRAC 4CGZA 4JBAA 2LF7A 1IF1A 3GEZA 3EQLF 1Z91A 1Z9CA 1R5HA 1ZRFA 2MBFA 1G3SA 1YFHA 5CVUA 4ON0A 3NQOA 5D5WB 4HLYA 3BDDA 1Z6TA 3HSRA 1U2WA 4HA8A 1V3FA 1B1BA 1QZYA 4HYEA 4WK8F 3GFLA 2VBYA 4ESJA 3QPHA 4FX4A 2E1NA 2Q0OA 4NHJA 3WTZA 3QPTA 2ZNYA 4N9HA 1HSJA 1HW5A 2EFPA 3F8NA 4UVAA 2EK5A 2QBYB 2R3SA 1JHHA 4B8XA 3WGHA 4OIRF 2L01A 4EJUA 2XAFA 4M73A 3F23A 2PN6A 4I2OA 1FNNA 3D0SA 1OYYA 1QNTA 4DNCA 5H6QA 3RYPA 3RPUA 3P7NA 1G6NA 3R0AA 1T38A 5ICCA 4G8XA 5K1YA 2A6EF 1GXQA 3I53A 1Z6RA 1E17A 1EH8A 1OKRA 3MFKA 2VODA 3F8CA 2HYFA 1B9MA 4O5VA 2PMUA 2M5WA 3N97A 4YIFA 2W57A 4HBLA 4KIGA 5TJJA 1G3TA 1XDUA 3GXOA 1OR7A 2DPUA 2M30A 3WODF 2W85A 3JAMK 3J80K 4YFXF 4EGZA 4M74A 4KUMA 3V4GA 1K78B 1KYWA 2DQLA 1YW8A 4Y17A 4L9JA 4A0XA 4A12A 3B73A 2QVOA 3RKYA 1R23A 2GIVA 4KDPA 1MD0A 4LK1F 4K2EA 4S04A 4ESFA 1I5ZA 1FOKA 2KIFA 1QZZA 1ZAOA 1AOYA 5H6RA 3NRVA 3O6BB 1ZREA 4LD5A 3MAJA 3HTSB 4P5OA 4Z2YA 3ZMZA 3F6OA 2F2EA 4U7DA 1ODDA 2G7HA 3M7GA 2OD5A 4YG2F 5A2QK 2JSCA 1XN7A 4XSZF 5ERIA 1RIOH 2HOEA 3ISPA 1KQ9A 2M45A 1FX7A 2UXXA 2Z33A 3HOTA 1ULYA 2FU4A 4HDVA 3TOAA 1U5TC 1UB9A 3PFIA 4L0ZB 1ZGJA 3E5XA 3MWMA 4L5JA 3VB2A 2QENA 2ZFWA 4U88A 2PEXA 3GVAA 1O3RA 5K5QA 3EUHA 2H09A 1D5VA 2XIGA 1E2XA 5FB2A 4XSXF 1FYLA 2ZO4A 3HIFA 1MDMA 1R00A 2DFIA 2HYGD 3GFMA 3FM5A 1FLIA 5BS6A 1USSA 4LB5A 3RKXA 1HKTA 3HHGA 1LDJA 3P9KA 4BAYA 1LDKB 1HW2A 2STWA 4OIQF 2V1XA 4AVPA 5H20A 2UWMA 5ICGA 3BJ6A 4UVBA 3BOQA 3Q9VA 2IJLA 1DPUA 1TQPA 4KN4X 3TDZC 1LNWA 1XD7A 3KZZA 5LEJA 5D5VB 4ENJA 2GA1A 1FC3A 3W6KB 3ZN1A 3GF2A 1K7AA 5CVRA 5FFXA 4KT5C 2YX7A 1IN6A 3IRRA 4Q47A 1ZHFA 1WRJA 4H0EA 2VC0A 4A0YA 3LAPA 4HF2A 1XGOA 1T39A 1KU2A 2ZBKA 2QBYA 3FHZA 3BPXA 4GO1A 1RZ4A 2K27A 1OPCA 3V8JA 4ZZLA 2L4MA 2QWWA 2MH9A 4HW0A 4UV8A 1TTYA 2Z5UA 1K6OA 2FNPA 3TO6A 1JHFA 4Q48A 4EQQA 5HS9A 2QQAA 3R0JA 1HSTA 4YFKF 2XAQA 2HKXA 2FF4A 3KP6A 1MZBA 2JTVA 2HTJA 3IC7A 2PLYA 3REOA 4OIPF 4I0AA 1ZGAA 2HGCA 2Z99A 2IT0A 1SFEA 2GWRA 1BIBA 2CG4A 1K78A 4MHGA 1W5TA 3R61A 1F5TA 4IVNA 3DKWA 4MGRA 5CJ9A 4HF0A 1IW7F 3KP4A 5ICEA 2VONA 3EETA 5FLXZ 1J9IA 2G9WA 3GZ6A 3WGGA 4AIKA 2Z9OA 4G7HF 1Z7UA 2VE8A 2WV0A 4WWCA 1U5TA 4JQFA 2P5LC 2HFHA 2XAHA 4ASNA 1JGSA 4WF2A 4WCGA 4F7ZA 2VE9A 4N9IA 4GYIA 2RQPA 3RYRA 3DF8A 1VTNC 5KVRA 5D5XB 2YSRA 3FXRA 3SQNA 2R7FA 1U3EM 2J5OA 3ZPLA 2BEOA 2JPCA 2EFNA 1PP8F 1DP7P 5D4SA 5BPIA 4AD9A 5J8CA 2DK8A 4I01A 4RB1A 5JR3A 1P4WA 1S6LA 2BGCA 2P8TA 5FD6A 2NAZA 1R5GA 1H9GA 5AIPA 1WSUA 4AIJA 3WE3A 2IPQX 3E5QA 4BHBA 4HQEA 2VT3A 1O3TA 1MJ9A 1UHMA 3RTRA 5DDGA 4WXDA 1Y0UA 2FBIA 5D6FA 4YIIA 3L09A 4MTDA 4HLXA 4CZZA 3I71A 3BY6A 1R1TA 2LKPA 3JTHA 4Q4ZF 2Y75A 2DW4A 4BYYA 2ZCWA 2LF8A 2P6SA 5ILSA 1TW2A 4EMSA 3CO7C 1S8NA 5K5RA 3WGIA 5E1WA 1I6XA 3C3WA 3E6MA 5LBQA 1FBQA 1LQ1A 4EJWA 3J81Z 3FMQA 1YW9A 3RIRA 2ETHA 2CO5A 1KQ0A 4RAYA 1RI7A 4U0YA 2J5PA 2FMLA 1R7JA 3BJOA 1T98A 1R36A 3KLOA 1QPMA 4IRGA 3VFZA 1TNSA 2WTEA 2DBBA 4WXCA 3MQ0A 2YX4A 3HUGA 1HKQA 1H0MA 5L3FA 1B4AA 2P7VB 2QUFA 2OU2A 5HLGA 1HQCA 5FD5A 2O3FA 2H94A 1R58A 4HOBA 4IHSA 2DK5A 5CLSA 4RS8A 2QM3A 3G73A 2EB7A 5HVQC 2GAUA 2HTSA 1QO0D 2V1DA 4M71A 2A61A 5LLQA 3K1MA 3ABTA 3DEUA 1LDDA 2X4HA 2MLKA 2IRFG 1H9TA 5JHUA 1WQ2A 4KIBA 3TDUC 3JSOA 4G94A 4P96A 4PGGA 3O3KA 1SD6A 1TLHB 2GXGA 4LG0A 1FSHA 1BI3A 4EM1A 5CVVA 1RNLA 2FRHA 3GLXA 2EFOA 4AWXB 4RB2C 3BP8A 1BI1A 1U6GA 3IL2A 3ZP5A 4ENMA 3E6BA 3FM3A 3Q9SA 2OQRA 5LEKA 2W24A 1BM9A 1D3YA 4HX4A 4PZJA 1LJ9A 4EM0B 2ZJ2A 1ZN2A 2MC3A 3HHHA 4RGSA 4MNUA 1IXRC 2A68F 5CVIA 3K69A 3JAMZ 3J80Z 3QP6A 3GFJA 3TO9A 4EJOA 4D0PA 1SD5A 4M9ZA 3KP5A 3TGNA 3R60A 3SHFA 2BYVE 1KQ8A 2XKPA 3R6SA 3WU1B 3FMSA 2NNNA 3HRUA 5LGUA 5AONA 2W25A 3IKVA 5FFZA 4MEYF 1XMKA 1U5TB 4CICA 3ECOA 2XV4S 1G4DA 2QZ8A 4LLLA 5F6FA 3F6VA 5ED4A 3SZTA 2CYYA 2V6CA 3ZMVA 3LFKA 2IA0A 4BH9A 2NNYA 3ABUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TRD A;  1ZRD A;  5E20 A;  5E17 F;  5AIQ A;  3WE2 A;  4WX9 A;  5D4R A;  4HV6 A;  5JFR A;  3M8F A;  5A2Q Z;  5D8L B;  2ZME B;  6PAX A;  2NS0 A;  3P9I A;  4DQ2 A;  1J7K A;  2LNB A;  4CHU A;  2D1H A;  2QQ9 A;  1FT9 A;  4U7B A;  2HDC A;  3T1B A;  2EA4 A;  3M9A A;  1YIO A;  2A5Y B;  1CF7 B;  5F64 A;  3HRM A;  4LFU A;  3IHU A;  4CXF A;  4PGH A;  4LMY A;  4Q5S F;  5DUI A;  3LA3 A;  2KRF A;  3ROU A;  1XGM A;  4PDK A;  4XRF A;  1LB2 A;  3JW4 A;  2VBZ A;  4UUV A;  2R7D A;  4S05 A;  4UVC A;  1D8J A;  5IT9 K;  3E6D A;  3RJP A;  2STT A;  4ZZD A;  1Z05 A;  3K0L A;  4MQV A;  5BPD A;  1F4K A;  2QYO A;  5D8K B;  4ZYD A;  5HLI A;  1TQM A;  3BPV A;  3T8T A;  2Y48 A;  1FP2 A;  1FBS A;  2VBW A;  1ZG1 A;  3GW2 A;  1I27 A;  1YS6 A;  4P9U A;  1UHW A;  3BJA A;  1K79 A;  2H27 A;  1S3J A;  1O7L A;  5E8I A;  1BC7 C;  3CLO A;  5HS7 A;  1XSD A;  5DUK A;  4XLN F;  3GO5 A;  2XAG A;  1HXD A;  2IA2 A;  3VEP A;  5LHH A;  3V8K A;  2XVC A;  4AIH A;  1AWC A;  2OAZ A;  3K9T A;  4HZF A;  2DQR A;  4I09 A;  5HOO A;  5L3C A;  2IW5 A;  3PQJ A;  3I59 A;  3ZMD A;  1JE8 A;  2FOK A;  2BV6 A;  1W4M A;  5JI6 A;  5E1X A;  4RB0 A;  1UST A;  2P5K A;  2JT1 A;  4BHP A;  3E6C C;  3H3U A;  2PFB A;  4A6D A;  2EFQ A;  2WC2 A;  4OIO F;  1WKM A;  2RGV A;  3LA2 A;  4G7O F;  4A5M A;  4U0V A;  1KU7 A;  1J0R A;  1RUN A;  5HDK A;  1SD7 A;  1STZ A;  2KKO A;  3KE2 A;  4OU0 A;  1LVA A;  1O57 A;  2LDU A;  2D2W A;  5EEG A;  2A3S A;  3C1D A;  4EM2 A;  1U78 A;  2O6G E;  2CWE A;  2IA1 A;  3ZQ7 A;  4I7H A;  1YYV A;  2F5E A;  2EV5 A;  1P6R A;  4KIC A;  1S7O A;  4OIN F;  3L9F A;  1GXP A;  4LG0 B;  5HLH A;  1G3Y A;  2K4J A;  2CQK A;  1F9N A;  2ZNZ A;  1QBJ A;  4P9F A;  1S29 A;  5FGM A;  3O2P E;  3WU0 A;  5DCF A;  3IWF A;  4KFC A;  1ZH5 A;  1L0O C;  2VXZ A;  2P4W A;  4ENN A;  1P92 A;  2VBX A;  2TDX A;  2PBI A;  3F72 A;  1KU9 A;  2G7U A;  5CVJ A;  4CYD A;  1FZP B;  3GFI A;  5J6X A;  3F8M A;  3QRF F;  1B9N A;  2RNJ A;  2ZKZ A;  2HEO A;  2FMY A;  5DD8 A;  4UHT A;  4KMU X;  1MJA A;  2RN7 A;  4L5I A;  2KIU A;  2WWY A;  4IRI A;  1TQI A;  3F22 A;  2XKO A;  3V7C A;  2A6H F;  2D45 A;  2VT2 A;  1FSE A;  3U2R A;  4HQM A;  1Z1D A;  2FNA A;  4O6J A;  4IXA A;  2FSW A;  1XDS A;  2EJR A;  5ICF A;  4OMZ A;  4L9N A;  2ZME A;  4OOI A;  1L3L A;  2MD5 A;  3V8L A;  2F5F A;  1YS7 A;  1GVJ A;  4P55 A;  4PCQ A;  3FX3 A;  4RGU A;  3TO7 A;  4MEX F;  4QWQ A;  4GCV A;  1CF7 A;  2HWV A;  5L3D A;  4HDU A;  2AXL A;  1BC8 C;  1IN5 A;  3ZMU A;  1EH7 A;  3DP7 A;  5F1R A;  3QAH A;  4M9X A;  2Y0M A;  1FWZ A;  1IN4 A;  2E7X A;  4E70 A;  3QP5 A;  4HF1 A;  2M1B A;  4CO8 A;  1T0F A;  4EJV A;  3M1E A;  2KJC A;  5JVT A;  2GA2 A;  5DCM B;  2M87 A;  2OA4 A;  2EV6 A;  4M6Y A;  5E8G A;  4MTE A;  5FO5 A;  3K1N A;  3QOP A;  3DFG A;  1IRG A;  3P9C A;  3KCC A;  4EVI A;  3N4M A;  4A6E A;  4GGG A;  2O8X A;  3KET A;  4I98 B;  4KMF A;  4FX0 A;  3KP7 A;  4RGR A;  5LGN A;  2RVC A;  1UFM A;  3I0T A;  1I1G A;  2HS5 A;  2ISY A;  2K02 A;  1XCB A;  1YLF A;  3L00 A;  1QQI A;  3HSF A;  5EEH A;  4R8H A;  5D6E A;  2GZW A;  1TNT A;  2IVM A;  3H3Z A;  4GXO A;  1ZG3 A;  1SD4 A;  5J8F A;  3DQV C;  1XSV A;  3K2Z A;  3EDP A;  2Q8K A;  4QLC U;  4L9V A;  2L3D A;  1SMT A;  1ON2 A;  2L54 A;  1J75 A;  3ELK A;  1XGS A;  4RB3 C;  2B0L A;  4BQA A;  3EYY A;  2YU3 A;  2HKO A;  5BOX A;  2K86 A;  4KA4 A;  1A04 A;  3I59 B;  5ILV A;  4U0W A;  1ONV A;  1XB4 A;  1WWX A;  1KYZ A;  1LEB A;  1YTY A;  2VOP A;  1U8R A;  2EWN A;  3HTU A;  5ILU A;  3HRT A;  3KLN A;  1RUO A;  3LQR A;  3W6J B;  1R1V A;  3VOE A;  1PP7 U;  4ZYG A;  3I64 A;  2GXB A;  4YFN F;  3DPL C;  1FBU A;  5LHI A;  1DUX C;  3KP3 A;  1BIA A;  2XGX A;  3K1P A;  3KEO A;  5L3G A;  3C18 A;  4MQ9 F;  2PG4 A;  1O7F A;  2MLG A;  3LAJ A;  4ZH4 F;  3G3Z A;  1SFU A;  2BBY A;  4M6X A;  4XBF A;  3ERE D;  1T2K A;  2CGP A;  1ZYR F;  4LLN A;  3LWF A;  3JSP A;  4EJT A;  3M8E A;  4TV7 A;  2H6B A;  5L3E A;  1MGT A;  3GZ5 A;  2LSO A;  2HR3 A;  4HV5 A;  5HS8 A;  3VOD A;  3EYI A;  5KK1 A;  1ZG5 A;  3DV8 A;  2FXA A;  2E7W A;  2CW0 F;  3COA C;  3WTY C;  1FY7 A;  3BZ6 A;  5HDN A;  4CDG A;  3L7W A;  4L0Y B;  2OQG A;  4LB6 B;  2AS5 F;  1IXS B;  5LRS A;  2JZY A;  4Y15 A;  1SFX A;  3ECH A;  2EFW A;  3ML6 A;  2XUB A;  5D5U B;  1W7P B;  4R1H A;  1J2X A;  2V1U A;  3MZY A;  2HQR A;  4L9T A;  3I58 A;  2V79 A;  1HW1 A;  3CJN A;  2COM A;  5DEQ A;  3AAF A;  3V7S A;  4KN7 X;  3B02 A;  3FWE A;  3I54 A;  3BRO A;  2XRO A;  2FEZ A;  1S7A A;  3WTV C;  4NB5 A;  2UXN A;  3LQQ A;  5DCM A;  3DPT A;  3GUD A;  3T5X A;  4G6D A;  4EV0 A;  1QGP A;  3T8R A;  2OZ6 A;  5IT3 A;  3TQN A;  2VOO A;  1BN5 A;  1OMI A;  4HX8 A;  1X3U A;  3I4P A;  1UCR A;  4A2U A;  2K4B A;  1KGS A;  4L18 B;  4G6Q A;  2ESH A;  2PMH A;  5IT9 Z;  2YPR A;  4RAZ A;  1EH6 A;  3GWZ A;  3D5L A;  1GHC A;  1XGN A;  4G9Y A;  3S2W A;  3CUQ B;  5LHG A;  4EGY A;  2FA5 A;  2QQB A;  2UZK A;  2KJB A;  3F8B A;  4O3M A;  2X0L A;  2HZT A;  1IZ1 A;  2FQ3 A;  2NYX A;  3LST A;  2RDP A;  4M72 A;  3KEQ A;  3T0Y A;  4IPA A;  1OYI A;  3Q5F A;  2CSO A;  1B59 A;  3CO6 C;  2IP2 A;  1ZAR A;  4I02 A;  1HBX G;  4HAM A;  2DU9 A;  1ZLJ A;  3R4K A;  1JXS A;  4RGX A;  1YO5 C;  2H6C A;  1PUE E;  2BE5 F;  3ZN0 A;  1FP1 D;  1OYW A;  4LGW A;  1IXC A;  4UV9 A;  1P4X A;  3CUO A;  3FXU A;  1TBX A;  3NEU A;  5HDG A;  1IRF A;  4OMY A;  1J59 A;  3RDI A;  1ZLK A;  3CUQ C;  3QU6 A;  1KA8 A;  3WTS C;  3DXJ F;  3ZMS A;  5DD4 A;  3C7J A;  3SZP A;  3E5U A;  4A0Z A;  4GYG A;  4R79 A;  3CDH A;  4Y13 A;  3V7R A;  5E1Z B;  4BHC A;  3WTX C;  4LLG F;  2DI3 A;  3LA7 A;  3PQK A;  4UXN A;  4LK0 F;  2FBH A;  5E18 F;  2A07 F;  1FPQ A;  1SMY F;  1XMA A;  1P4A A;  2Q2E A;  3HYI A;  4LJZ F;  2XHK A;  4G7Z F;  2KIM A;  2A69 F;  2VN2 A;  1W5S A;  5BMZ A;  3BWG A;  1DDN A;  1MKM A;  1NHA A;  1I1S A;  1KU3 A;  3F21 A;  1REP C;  3MCZ A;  2Z3Y A;  4XLP F;  5DV5 A;  1O3S A;  1BOA A;  1BBY A;  2XAS A;  4HX7 A;  3WTT C;  4ZYE A;  1SAX A;  3J7A O;  2C6Y A;  1R22 A;  2OBP A;  4IJA A;  5LGT A;  2M8E A;  2RKH A;  2DAO A;  2K7L A;  3KZY A;  3FZV A;  2DLL A;  2PJP A;  3WG9 A;  3SFZ A;  1FYM A;  1IN7 A;  2MA3 A;  2XRN A;  2ESN A;  4A5N A;  3MZH A;  1B6A A;  4WXH A;  3IWZ A;  3SXY A;  1IAW A;  3E3V A;  3H92 A;  3U1D A;  2E1C A;  5LRR A;  4ETS A;  4ESB A;  3HOS A;  2XAJ A;  1YG2 A;  3TKY A;  3OOP A;  2FBK A;  3TOB A;  2PQ8 A;  4JK1 X;  1P2F A;  3QU3 A;  4N0B A;  2F5D A;  1W7P A;  2GQQ A;  3GYH X;  1LEA A;  2DPD A;  2DO7 A;  2QLZ A;  5FLX K;  3L2C A;  1XCV A;  2P6T A;  2W84 A;  3FF5 A;  2MH2 A;  2EV0 A;  4M9S A;  2DTR A;  2HQN A;  1BI0 A;  3ULQ B;  5BQT A;  1PDN C;  2RV8 A;  4IHT A;  1F1Z A;  1ZRC A;  3KFW X;  3RKW A;  1BJA A;  2F5C A;  3OV8 A;  2L4A A;  2O61 A;  5DYM A;  4KNY A;  1YW7 A;  2RC4 A;  1W7P D;  1C0W A;  3U9G A;  4BXU A;  4KIF A;  2L02 A;  3IRQ A;  2OZU A;  1G3W A;  2PI0 A;  3WTU C;  1V4R A;  1BI2 A;  2O0Y A;  3CUQ A;  4KYW A;  4ZYH A;  3JTG A;  4I0B A;  4B09 A;  2YR2 A;  1T6S A;  4UNO A;  2ADU A;  3CTA A;  1FYK A;  3F8F A;  1TW3 A;  4IF4 A;  1YQA A;  2ACJ A;  1XSX A;  5CYV A;  1ON1 A;  3E97 A;  2ELH A;  3IKT A;  3WTW C;  3I5U A;  5K5O A;  1MJB A;  1R1U A;  2P5V A;  1HKS A;  3ZMT A;  2ZXJ A;  4ENK A;  2O03 A;  2VC1 A;  1WI9 A;  4IRH A;  2EA2 A;  3KP2 A;  4NQW A;  2JPB A;  2FE3 A;  2P7C B;  1IUY A;  2V9V A;  1EV7 A;  2DT5 A;  1Q1H A;  1D8K A;  3RPQ A;  1IN8 A;  4BNC A;  4FT8 A;  3HSE A;  3FXQ A;  2CFX A;  1CGP A;  4FHT A;  1J5Y A;  3J81 K;  5L3B A;  1O3Q A;  2D1V A;  1DPR A;  3FMR A;  2ISZ A;  3RI4 A;  3MEX A;  1MDM B;  3F3X A;  3HRS A;  2JRT A;  3GX4 X;  2NRA C;  4CGZ A;  4JBA A;  2LF7 A;  1IF1 A;  3GEZ A;  3EQL F;  1Z91 A;  1Z9C A;  1R5H A;  1ZRF A;  2MBF A;  1G3S A;  1YFH A;  5CVU A;  4ON0 A;  3NQO A;  5D5W B;  4HLY A;  3BDD A;  1Z6T A;  3HSR A;  1U2W A;  4HA8 A;  1V3F A;  1B1B A;  1QZY A;  4HYE A;  4WK8 F;  3GFL A;  2VBY A;  4ESJ A;  3QPH A;  4FX4 A;  2E1N A;  2Q0O A;  4NHJ A;  3WTZ A;  3QPT A;  2ZNY A;  4N9H A;  1HSJ A;  1HW5 A;  2EFP A;  3F8N A;  4UVA A;  2EK5 A;  2QBY B;  2R3S A;  1JHH A;  4B8X A;  3WGH A;  4OIR F;  2L01 A;  4EJU A;  2XAF A;  4M73 A;  3F23 A;  2PN6 A;  4I2O A;  1FNN A;  3D0S A;  1OYY A;  1QNT A;  4DNC A;  5H6Q A;  3RYP A;  3RPU A;  3P7N A;  1G6N A;  3R0A A;  1T38 A;  5ICC A;  4G8X A;  5K1Y A;  2A6E F;  1GXQ A;  3I53 A;  1Z6R A;  1E17 A;  1EH8 A;  1OKR A;  3MFK A;  2VOD A;  3F8C A;  2HYF A;  1B9M A;  4O5V A;  2PMU A;  2M5W A;  3N97 A;  4YIF A;  2W57 A;  4HBL A;  4KIG A;  5TJJ A;  1G3T A;  1XDU A;  3GXO A;  1OR7 A;  2DPU A;  2M30 A;  3WOD F;  2W85 A;  3JAM K;  3J80 K;  4YFX F;  4EGZ A;  4M74 A;  4KUM A;  3V4G A;  1K78 B;  1KYW A;  2DQL A;  1YW8 A;  4Y17 A;  4L9J A;  4A0X A;  4A12 A;  3B73 A;  2QVO A;  3RKY A;  1R23 A;  2GIV A;  4KDP A;  1MD0 A;  4LK1 F;  4K2E A;  4S04 A;  4ESF A;  1I5Z A;  1FOK A;  2KIF A;  1QZZ A;  1ZAO A;  1AOY A;  5H6R A;  3NRV A;  3O6B B;  1ZRE A;  4LD5 A;  3MAJ A;  3HTS B;  4P5O A;  4Z2Y A;  3ZMZ A;  3F6O A;  2F2E A;  4U7D A;  1ODD A;  2G7H A;  3M7G A;  2OD5 A;  4YG2 F;  5A2Q K;  2JSC A;  1XN7 A;  4XSZ F;  5ERI A;  1RIO H;  2HOE A;  3ISP A;  1KQ9 A;  2M45 A;  1FX7 A;  2UXX A;  2Z33 A;  3HOT A;  1ULY A;  2FU4 A;  4HDV A;  3TOA A;  1U5T C;  1UB9 A;  3PFI A;  4L0Z B;  1ZGJ A;  3E5X A;  3MWM A;  4L5J A;  3VB2 A;  2QEN A;  2ZFW A;  4U88 A;  2PEX A;  3GVA A;  1O3R A;  5K5Q A;  3EUH A;  2H09 A;  1D5V A;  2XIG A;  1E2X A;  5FB2 A;  4XSX F;  1FYL A;  2ZO4 A;  3HIF A;  1MDM A;  1R00 A;  2DFI A;  2HYG D;  3GFM A;  3FM5 A;  1FLI A;  5BS6 A;  1USS A;  4LB5 A;  3RKX A;  1HKT A;  3HHG A;  1LDJ A;  3P9K A;  4BAY A;  1LDK B;  1HW2 A;  2STW A;  4OIQ F;  2V1X A;  4AVP A;  5H20 A;  2UWM A;  5ICG A;  3BJ6 A;  4UVB A;  3BOQ A;  3Q9V A;  2IJL A;  1DPU A;  1TQP A;  4KN4 X;  3TDZ C;  1LNW A;  1XD7 A;  3KZZ A;  5LEJ A;  5D5V B;  4ENJ A;  2GA1 A;  1FC3 A;  3W6K B;  3ZN1 A;  3GF2 A;  1K7A A;  5CVR A;  5FFX A;  4KT5 C;  2YX7 A;  1IN6 A;  3IRR A;  4Q47 A;  1ZHF A;  1WRJ A;  4H0E A;  2VC0 A;  4A0Y A;  3LAP A;  4HF2 A;  1XGO A;  1T39 A;  1KU2 A;  2ZBK A;  2QBY A;  3FHZ A;  3BPX A;  4GO1 A;  1RZ4 A;  2K27 A;  1OPC A;  3V8J A;  4ZZL A;  2L4M A;  2QWW A;  2MH9 A;  4HW0 A;  4UV8 A;  1TTY A;  2Z5U A;  1K6O A;  2FNP A;  3TO6 A;  1JHF A;  4Q48 A;  4EQQ A;  5HS9 A;  2QQA A;  3R0J A;  1HST A;  4YFK F;  2XAQ A;  2HKX A;  2FF4 A;  3KP6 A;  1MZB A;  2JTV A;  2HTJ A;  3IC7 A;  2PLY A;  3REO A;  4OIP F;  4I0A A;  1ZGA A;  2HGC A;  2Z99 A;  2IT0 A;  1SFE A;  2GWR A;  1BIB A;  2CG4 A;  1K78 A;  4MHG A;  1W5T A;  3R61 A;  1F5T A;  4IVN A;  3DKW A;  4MGR A;  5CJ9 A;  4HF0 A;  1IW7 F;  3KP4 A;  5ICE A;  2VON A;  3EET A;  5FLX Z;  1J9I A;  2G9W A;  3GZ6 A;  3WGG A;  4AIK A;  2Z9O A;  4G7H F;  1Z7U A;  2VE8 A;  2WV0 A;  4WWC A;  1U5T A;  4JQF A;  2P5L C;  2HFH A;  2XAH A;  4ASN A;  1JGS A;  4WF2 A;  4WCG A;  4F7Z A;  2VE9 A;  4N9I A;  4GYI A;  2RQP A;  3RYR A;  3DF8 A;  1VTN C;  5KVR A;  5D5X B;  2YSR A;  3FXR A;  3SQN A;  2R7F A;  1U3E M;  2J5O A;  3ZPL A;  2BEO A;  2JPC A;  2EFN A;  1PP8 F;  1DP7 P;  5D4S A;  5BPI A;  4AD9 A;  5J8C A;  2DK8 A;  4I01 A;  4RB1 A;  5JR3 A;  1P4W A;  1S6L A;  2BGC A;  2P8T A;  5FD6 A;  2NAZ A;  1R5G A;  1H9G A;  5AIP A;  1WSU A;  4AIJ A;  3WE3 A;  2IPQ X;  3E5Q A;  4BHB A;  4HQE A;  2VT3 A;  1O3T A;  1MJ9 A;  1UHM A;  3RTR A;  5DDG A;  4WXD A;  1Y0U A;  2FBI A;  5D6F A;  4YII A;  3L09 A;  4MTD A;  4HLX A;  4CZZ A;  3I71 A;  3BY6 A;  1R1T A;  2LKP A;  3JTH A;  4Q4Z F;  2Y75 A;  2DW4 A;  4BYY A;  2ZCW A;  2LF8 A;  2P6S A;  5ILS A;  1TW2 A;  4EMS A;  3CO7 C;  1S8N A;  5K5R A;  3WGI A;  5E1W A;  1I6X A;  3C3W A;  3E6M A;  5LBQ A;  1FBQ A;  1LQ1 A;  4EJW A;  3J81 Z;  3FMQ A;  1YW9 A;  3RIR A;  2ETH A;  2CO5 A;  1KQ0 A;  4RAY A;  1RI7 A;  4U0Y A;  2J5P A;  2FML A;  1R7J A;  3BJO A;  1T98 A;  1R36 A;  3KLO A;  1QPM A;  4IRG A;  3VFZ A;  1TNS A;  2WTE A;  2DBB A;  4WXC A;  3MQ0 A;  2YX4 A;  3HUG A;  1HKQ A;  1H0M A;  5L3F A;  1B4A A;  2P7V B;  2QUF A;  2OU2 A;  5HLG A;  1HQC A;  5FD5 A;  2O3F A;  2H94 A;  1R58 A;  4HOB A;  4IHS A;  2DK5 A;  5CLS A;  4RS8 A;  2QM3 A;  3G73 A;  2EB7 A;  5HVQ C;  2GAU A;  2HTS A;  1QO0 D;  2V1D A;  4M71 A;  2A61 A;  5LLQ A;  3K1M A;  3ABT A;  3DEU A;  1LDD A;  2X4H A;  2MLK A;  2IRF G;  1H9T A;  5JHU A;  1WQ2 A;  4KIB A;  3TDU C;  3JSO A;  4G94 A;  4P96 A;  4PGG A;  3O3K A;  1SD6 A;  1TLH B;  2GXG A;  4LG0 A;  1FSH A;  1BI3 A;  4EM1 A;  5CVV A;  1RNL A;  2FRH A;  3GLX A;  2EFO A;  4AWX B;  4RB2 C;  3BP8 A;  1BI1 A;  1U6G A;  3IL2 A;  3ZP5 A;  4ENM A;  3E6B A;  3FM3 A;  3Q9S A;  2OQR A;  5LEK A;  2W24 A;  1BM9 A;  1D3Y A;  4HX4 A;  4PZJ A;  1LJ9 A;  4EM0 B;  2ZJ2 A;  1ZN2 A;  2MC3 A;  3HHH A;  4RGS A;  4MNU A;  1IXR C;  2A68 F;  5CVI A;  3K69 A;  3JAM Z;  3J80 Z;  3QP6 A;  3GFJ A;  3TO9 A;  4EJO A;  4D0P A;  1SD5 A;  4M9Z A;  3KP5 A;  3TGN A;  3R60 A;  3SHF A;  2BYV E;  1KQ8 A;  2XKP A;  3R6S A;  3WU1 B;  3FMS A;  2NNN A;  3HRU A;  5LGU A;  5AON A;  2W25 A;  3IKV A;  5FFZ A;  4MEY F;  1XMK A;  1U5T B;  4CIC A;  3ECO A;  2XV4 S;  1G4D A;  2QZ8 A;  4LLL A;  5F6F A;  3F6V A;  5ED4 A;  3SZT A;  2CYY A;  2V6C A;  3ZMV A;  3LFK A;  2IA0 A;  4BH9 A;  2NNY A;  3ABU A; 
#chains in the Genus database with same CATH topology
 4IX7 A;  5TRD A;  4HG2 A;  5E20 A;  1ZRD A;  4JOM A;  5E17 F;  2LKX A;  1JUM A;  5AIQ A;  3WE2 A;  4WX9 A;  2JA7 J;  5D4R A;  2WV1 A;  4HV6 A;  5JFR A;  2QSG X;  3M8F A;  2KIQ A;  2HXI A;  5A2Q Z;  1BR1 A;  5D8L B;  1B8I B;  2ZME B;  1W1W E;  3QYE A;  3HKZ N;  3G71 I;  1R4M B;  6PAX A;  2R7V A;  4AYB A;  5DS9 A;  1OCC H;  2NS0 A;  2JMW A;  1LFU P;  3P9I A;  4DQ2 A;  3J7Z I;  1J7K A;  2LNB A;  4CHU A;  1XMX A;  5EEA A;  3IV5 A;  2A5W A;  2D1H A;  2QQ9 A;  2LP0 A;  2QSF X;  2EZL A;  1FT9 A;  3CCY A;  4U7B A;  2HDC A;  2KFD A;  3T1B A;  2EA4 A;  1POG A;  1YIO A;  2A5Y B;  3M9A A;  1YOV B;  1CF7 B;  1EF4 A;  2DFE A;  2ME0 A;  3HRM A;  3FXM A;  4NUB A;  4LFU A;  5F08 A;  5F64 A;  3IHU A;  2OPT A;  4CXF A;  2L9R A;  4PGH A;  4LMY A;  4XM3 A;  4Q5S F;  4BAC A;  5DUI A;  2H1K A;  3TP3 A;  5J1R A;  2EIJ H;  3LA3 A;  2KRF A;  2KRH A;  3ROU A;  1XGM A;  4PDK A;  1Y6I A;  1YE9 A;  2E60 A;  4XRF A;  1LB2 A;  3JW4 A;  3ZQG A;  2VBZ A;  4UUV A;  2VL8 A;  2R7D A;  4S05 A;  2OCC H;  4UVC A;  1D8J A;  3TL4 X;  4BE0 A;  1Z77 A;  5IT9 K;  3E6D A;  2MD0 A;  1LE8 A;  3RJP A;  1JGG A;  2STT A;  4ZZD A;  1Z05 A;  3K0L A;  4MQV A;  5BPD A;  3DBH B;  1F4K A;  2QYO A;  5D8K B;  4LIV A;  4N4N B;  4ZYD A;  5HLI A;  3CC7 I;  1TQM A;  2DA7 A;  2LFB A;  5JLX A;  4CYC B;  1XS9 A;  2ZME C;  3BPV A;  1WHU A;  5KHD A;  4MIM A;  2H8W A;  1ITY A;  4XN0 A;  2BHY A;  2ZB9 A;  3T8T A;  2Y48 A;  1FP2 A;  1FBS A;  2VBW A;  4DBQ A;  3GW2 A;  1ZG1 A;  1I27 A;  4DYQ A;  1YS6 A;  4P9U A;  1UHW A;  3BJA A;  1K79 A;  2L7Z A;  2H27 A;  1S3J A;  4XMY A;  1O7L A;  1X1A A;  5E8I A;  1BC7 C;  4BDZ A;  3CLO A;  5HS7 A;  1XSD A;  3HDD A;  5DUK A;  4RBO A;  3W3C A;  4XLN F;  1I3A A;  1JTX A;  3GO5 A;  2XAG A;  1HXD A;  1F43 A;  2ZJR F;  2IA2 A;  3VEP A;  3KEY A;  5LHH A;  1T56 A;  3V8K A;  2XVC A;  4AIH A;  5K7H A;  1AWC A;  5KAF C;  3BTJ A;  2OAZ A;  3K9T A;  4HZF A;  5HNH A;  2VLA A;  3G4S I;  4BJ5 C;  2DQR A;  5JVG F;  2DT6 A;  1OCR H;  4I09 A;  4J01 A;  3PUF A;  5HOO A;  2VPR A;  2XF6 A;  4XLC A;  5L3C A;  2IW5 A;  2DDA A;  1WH5 A;  3PQJ A;  3F0C A;  2DOE A;  2M9H A;  3I59 A;  2HI3 A;  3OL3 A;  3ZMD A;  5CQG A;  5GTI C;  3PSI A;  1JE8 A;  1GV2 A;  2FOK A;  4BE2 A;  2BV6 A;  2HDW A;  1W4M A;  5JI6 A;  5E1X A;  4RB0 A;  1UST A;  1E3H A;  2P5K A;  3I56 I;  4IEJ A;  1QRY A;  2IBD A;  3L2Q A;  2JT1 A;  3CDL A;  4BHP A;  4B48 A;  4D1Q A;  2H1L A;  5FKL A;  3E6C C;  1XC5 A;  3H3U A;  3TP0 A;  2PFB A;  3C2H A;  4A6D A;  2EFQ A;  4J00 A;  4XKW A;  3ZQQ A;  1SFK A;  3BLY A;  3CP2 A;  3CCJ I;  3IH3 A;  3KIO A;  4PK4 A;  3NWT A;  2WC2 A;  3AG3 H;  3OYD A;  1WKM A;  4OIO F;  1JUP A;  1VQM I;  1UAA A;  3MKZ A;  4FQG A;  2RGV A;  1ETV A;  3CZ6 A;  3LA2 A;  5H2F C;  4G7O F;  4A5M A;  3BTL A;  4U0V A;  1KU7 A;  1J0R A;  2DDB A;  2ZFU A;  5HDK A;  1RUN A;  2Y0S N;  3S16 J;  2DA4 A;  2KDZ A;  1SD7 A;  1STZ A;  1HCR A;  1UHS A;  2W00 A;  4B47 A;  5IY5 H;  2KKO A;  1WFX A;  3KE2 A;  2DCE A;  4GRI A;  4OU0 A;  1DU0 A;  2BY2 A;  3RZD J;  1LVA A;  3A03 A;  4JP0 A;  3VWB A;  1O57 A;  2LDU A;  2D2W A;  2AQF A;  2A3S A;  5EEG A;  5K7Z A;  3C1D A;  3K4B A;  2AXT C;  4BQN A;  5HLT A;  4EM2 A;  1U78 A;  2O6G E;  1TWF J;  2CWE A;  2IA1 A;  4XLH A;  3ZQ7 A;  5EGO A;  2IGM A;  2IAI A;  4I7H A;  1YYV A;  1WH7 A;  2F5E A;  2HVR A;  3IAS 2;  2EV5 A;  1P6R A;  4KIC A;  1EJ9 A;  1S7O A;  3OMY A;  4FCY A;  4OIN F;  5J1U A;  1WJA A;  1HDD C;  3L9F A;  4XRS A;  1GXP A;  4LG0 B;  4FAS D;  5HLH A;  4PSX A;  1G3Y A;  2K4J A;  2CQK A;  1F9N A;  1DU6 A;  5M5Y J;  2ZNZ A;  2YU9 J;  1QBJ A;  2R7U A;  4P9F A;  3FIW A;  1TWA J;  3BQY A;  1S29 A;  5FGM A;  3O2P E;  3WU0 A;  5DCF A;  3IWF A;  4M3E A;  4KFC A;  5TGT A;  4DZJ A;  2IXS A;  1ZH5 A;  1L0O C;  2YS9 A;  2MC4 A;  2VXZ A;  2XF5 A;  4LIU A;  2P4W A;  2HNH A;  4ENN A;  1P92 A;  2HQ5 A;  2VBX A;  2TDX A;  2PBI A;  4DYC A;  3F72 A;  4A3G J;  4BQQ A;  3BG6 A;  3H1C A;  2E1M C;  4I76 A;  3DLL F;  1YI2 I;  1TC3 C;  1Y8R B;  1KU9 A;  2G7U A;  4BEH B;  5CVJ A;  4CYD A;  1FZP B;  2WB1 A;  3GFI A;  5J6X A;  3F8M A;  5EYR A;  3QRF F;  1B9N A;  2KP6 A;  2RNJ A;  2R7Z J;  2ZKZ A;  2HEO A;  2FMY A;  5DD8 A;  4UHT A;  5FLV A;  4KMU X;  1MJA A;  2EBI A;  2HXO A;  2RN7 A;  4L5I A;  2KIU A;  2M7B A;  2BXY A;  2LKS A;  2WWY A;  4IRI A;  3IAM 2;  1TQI A;  3F22 A;  2XKO A;  2L7F P;  2V6E A;  3V7C A;  4NDL A;  2A6H F;  1S9H A;  4RAG A;  2D45 A;  2VT2 A;  1FSE A;  3U2R A;  4HQM A;  1MBG A;  1Z1D A;  3CC4 I;  2KL4 A;  2KDO A;  2FNA A;  4O6J A;  4IXA A;  1ZQ3 P;  2FSW A;  1XDS A;  2EJR A;  3K10 A;  5ICF A;  4E6K G;  4OMZ A;  4L9N A;  1B8I A;  2ZME A;  4OOI A;  1L3L A;  2DA3 A;  5FRM A;  5J3L A;  2K9Q A;  5IYD J;  2MD5 A;  5B1A H;  4ZJZ A;  2M2E A;  1R5I D;  3HKZ A;  3OOU A;  4XON A;  2F5F A;  3V8L A;  1RET A;  1NG7 A;  1NK3 P;  1YS7 A;  3CJT B;  1GVJ A;  4P55 A;  2L5Q A;  3FX3 A;  4PCQ A;  4RGU A;  3L2V A;  3TO7 A;  4MEX F;  2LBF A;  4I6Z A;  4UUT A;  4QWQ A;  4GCV A;  1CF7 A;  3BR0 A;  3P5J A;  1BR4 A;  3H9J A;  4RMN A;  5J4Y A;  5M5X J;  2HWV A;  5L3D A;  4HDU A;  2AXL A;  1BC8 C;  2LG4 A;  4Y4R A;  4BDY A;  1IN5 A;  3VSL A;  3ZMU A;  2GM4 A;  4HPQ A;  1EH7 A;  1D0Z A;  3DP7 A;  3HB9 A;  5F1R A;  3QAH A;  4M9X A;  2JA2 A;  4XKV A;  1MW7 A;  3VPR A;  3MVP A;  2Y0M A;  1FWZ A;  1IN4 A;  2E7X A;  2GXA A;  4E70 A;  3OYF A;  3QP5 A;  2Y30 A;  1IV8 A;  4HF1 A;  1RPW A;  4UB8 C;  3H35 A;  2M1B A;  4CO8 A;  3HOW J;  2IGK A;  2QQ8 A;  3JR9 A;  1T0F A;  1TL8 A;  4C2T A;  4EJV A;  3M1E A;  3CCL I;  2KJC A;  3S8P A;  5IP9 J;  3S1N J;  2XF7 A;  5JVT A;  4BE1 A;  5FRN A;  2VB6 A;  2GA2 A;  4II3 A;  4HRI A;  1MNE A;  5DCM B;  2DA2 A;  2M87 A;  2OA4 A;  1W0U A;  2EV6 A;  4M6Y A;  2A05 A;  4CYC A;  5E8G A;  3K70 D;  4MTE A;  2ID6 A;  2NOG A;  4RA2 A;  3VYT B;  4OAZ A;  3G6E I;  5FO5 A;  3K1N A;  2QGU A;  3QOP A;  4Y3O A;  3DFG A;  1IRG A;  1WPK A;  3P9C A;  4BXF A;  3CF5 F;  3KCC A;  4EVI A;  2R7W A;  3N4M A;  4ANJ A;  4A6E A;  4GGG A;  2F48 A;  1DP3 A;  2DA1 A;  2O8X A;  5KAI C;  3KET A;  2A6T A;  4I98 B;  4KMF A;  4FX0 A;  3KP7 A;  1YX5 A;  1WZ2 A;  3SEQ A;  4RGR A;  4ZDP A;  5LGN A;  5IP6 A;  3KYD B;  3VSK A;  2QCO A;  2CQX A;  2RVC A;  2JA5 J;  3GTJ J;  1UFM A;  1BOB A;  3I0T A;  1I1G A;  1LE8 B;  2HS5 A;  1BW5 A;  3ZQC A;  2ISY A;  2K02 A;  1XCB A;  1M1E B;  5J40 A;  4W97 A;  1X2M A;  2KQR A;  1YLF A;  3JRC A;  3L00 A;  1QQI A;  3HSF A;  5EEH A;  3SDB A;  1AA7 A;  4R8H A;  4DJA A;  4KIT B;  5D6E A;  2RAE A;  2GZW A;  1HC8 A;  1TNT A;  2IVM A;  1OFC X;  3CLQ A;  3H3Z A;  2JK3 A;  2M8G X;  3GTQ J;  4GXO A;  2DT7 B;  4LG3 A;  3ZQH A;  1ZG3 A;  1SD4 A;  5J8F A;  1JKP C;  2R4G A;  4B44 A;  3S3N A;  3DQV C;  1XSV A;  3K2Z A;  3EDP A;  2Q8K A;  4QLC U;  4L9V A;  4RLF A;  2L3D A;  1SMT A;  4M3B A;  2LY9 A;  3OYH A;  2H8R A;  2L7M P;  2IS6 A;  4A3J J;  1ON2 A;  2L54 A;  3EUK L;  4ZDL A;  1J75 A;  3ELK A;  3CP8 A;  2GOM A;  1XGS A;  4RB3 C;  2B0L A;  2RQQ A;  1OCP A;  5E79 C;  3EYY A;  4BQA A;  2X48 A;  4L5E A;  4PSW A;  2YU3 A;  1FIA A;  1ETY A;  4RM3 A;  1ACI A;  1S7E A;  2HKO A;  5BOX A;  2K86 A;  3PNV A;  5J1Y A;  1YJN I;  4KA4 A;  1A04 A;  3M1C A;  4E7H A;  3FKI J;  3Q0W A;  1N77 A;  3I59 B;  5ILV A;  1V54 H;  1X1P A;  4U0W A;  1VF9 A;  1ONV A;  3OYB A;  1XB4 A;  3H5A A;  1WWX A;  1KYZ A;  1RRJ A;  2DMP A;  1LEB A;  1YTY A;  2Y0S A;  2VOP A;  2NS8 A;  3VYU B;  3IH4 A;  2ZJP F;  4HNU A;  1U8R A;  3BC8 A;  2EZI A;  2EWN A;  4V2G A;  1P7J A;  3ASN H;  3HTU A;  3K4N A;  3TW6 A;  3DBL B;  3NWS A;  5ILU A;  2R5Y A;  1MNM C;  2F5V A;  3EUH C;  3SZG A;  2E2H J;  3HRT A;  1WJ5 A;  4PJL A;  3D1N I;  3KLN A;  3O8H A;  5B66 C;  3LQR A;  3OS0 A;  1RUO A;  3W6J B;  4UY8 I;  1R1V A;  3VOE A;  1PP7 U;  2NVT J;  4ZYG A;  2JQ7 A;  3KX2 A;  1MMS A;  1VQ8 I;  3I64 A;  2GXB A;  2LD5 A;  4YFN F;  1AKH B;  3DPL C;  1FBU A;  5LHI A;  2F6C A;  1DUX C;  3CCE I;  3KP3 A;  1BIA A;  2XGX A;  5DTD A;  5HOD A;  1YX3 A;  3WU2 C;  3K1P A;  2CS3 A;  3KEO A;  5L3G A;  3C18 A;  4ZTJ A;  3ZGK A;  4MQ9 F;  2ZXW H;  1E3P A;  2PG4 A;  2Y31 A;  1Y0N A;  1O7F A;  2WBM A;  2LLK A;  2MLG A;  3JRE A;  1Z0X A;  2VAS A;  4D5F A;  3LAJ A;  2JVG A;  4ZH4 F;  4BEH A;  5IP7 J;  4QTR A;  3RSN A;  3G3Z A;  2LK2 A;  3HOY J;  1SFU A;  1YJW I;  4MLO A;  2VPL A;  4BUP A;  3GCM A;  2BBY A;  4M6X A;  4XBF A;  1XPX A;  3ERE D;  1NG6 A;  2XPU A;  1MMD A;  4W1U A;  3OYA A;  1T2K A;  2O9L A;  2CGP A;  1DGW Y;  1ZYR F;  4M3F A;  3CCS I;  4LLN A;  3LWF A;  3JSP A;  4EJT A;  3M8E A;  2K85 A;  4TV7 A;  4FET A;  2H6B A;  3CJR B;  1Z3Y A;  5L3E A;  1MGT A;  3FBN B;  4XID A;  3C2G A;  3HGG A;  3GZ5 A;  1UJ8 A;  2LSO A;  2HR3 A;  4D7N A;  1SVM A;  4HV5 A;  5HS8 A;  2HPM A;  3H5N A;  1HLV A;  1MBF A;  3VOD A;  3EYI A;  5KK1 A;  1ZG5 A;  1W36 C;  1VQ4 I;  1X58 A;  1GDT A;  2XPW A;  3DV8 A;  2FXA A;  3OL4 A;  1EA3 A;  3RQ4 A;  2E7W A;  4XIC A;  2CW0 F;  2I10 A;  3ZOB A;  3OIO A;  3COA C;  5C4J J;  1FY7 A;  1SVL A;  3BZ6 A;  3K6G A;  3WTY C;  2V1N A;  5HDN A;  4CDG A;  3L7W A;  4L0Y B;  2Y9Z A;  2OQG A;  2Q1Z B;  4LB6 B;  2FUG 2;  2AS5 F;  1IXS B;  3S14 J;  5LRS A;  2JZY A;  3S17 J;  3DEE A;  1VQO I;  4Y15 A;  4Y52 J;  1SFX A;  2M3A A;  2EZH A;  3ECH A;  3DU5 A;  3SEZ A;  4A69 C;  5DM6 F;  2EFW A;  3ML6 A;  1JT6 A;  2KZV A;  4C3H J;  2QSH X;  2XUB A;  5D5U B;  1W7P B;  4KIS A;  4R1H A;  1J2X A;  2V1U A;  3S1Q J;  5C44 J;  3MZY A;  2X6X A;  4N4O B;  2HQR A;  4L9T A;  3CD6 I;  3I58 A;  3LL7 A;  2V79 A;  1HW1 A;  3CJN A;  2COM A;  5DEQ A;  3AAF A;  3V7S A;  2I5U A;  4KN7 X;  1ZK8 A;  3B02 A;  3FWE A;  3I54 A;  3BRO A;  5EG0 B;  2XRO A;  1HOM A;  2FEZ A;  1S7A A;  3WTV C;  2IGN A;  4NB5 A;  3D5S C;  2UXN A;  1KON A;  2L9S A;  3LQQ A;  3A2K A;  5DCM A;  3DPT A;  3GUD A;  4M3D A;  3T5X A;  1UG0 A;  4G6D A;  1JKO C;  4EV0 A;  4IHY A;  1QGP A;  3T8R A;  3PO2 J;  2LBF B;  2BOL A;  2OZ6 A;  5IT3 A;  3TQN A;  2VOO A;  2B7E A;  1BN5 A;  1TWH J;  4HNT A;  4J19 A;  4XK4 A;  1OMI A;  4EEF G;  4HX8 A;  4BY1 J;  2CJJ A;  2XGD A;  1X3U A;  4H4K C;  2KMU A;  3CDI A;  1RR7 A;  2X6O A;  3I4P A;  3FIS A;  1UCR A;  4A2U A;  2K4B A;  1KGS A;  1WJC A;  3BZK A;  4L18 B;  4G6Q A;  4HST A;  1TWG J;  1ZGW A;  2ESH A;  2XPV A;  2PMH A;  5IT9 Z;  4B3X A;  2YPR A;  3LSR A;  4RAZ A;  1EH6 A;  1MBH A;  3GWZ A;  4I99 C;  3M3Y J;  3A4C A;  3D5L A;  1GHC A;  3HGY A;  1XGN A;  4G9Y A;  1P9Q C;  3CUQ B;  3S2W A;  5LHG A;  4EGY A;  1QZE A;  2FA5 A;  2HOA A;  1SFO J;  2QQB A;  2UZK A;  3ABM H;  2KJB A;  3F8B A;  2V26 A;  1TP4 A;  2AQE A;  2CUE A;  1FOW A;  4BJ6 C;  4O3M A;  2X0L A;  1E0E A;  1NTC A;  2V7F A;  1G2H A;  2HZT A;  1IZ1 A;  4OAY A;  5C3E J;  2FQ3 A;  2NYX A;  3LST A;  2RDP A;  4HEA 2;  4PJN A;  4M72 A;  1X1C A;  3KEQ A;  1ZR4 A;  3T0Y A;  4DYR A;  4IPA A;  4KT6 A;  4PJJ A;  1T08 B;  1OYI A;  1V5F A;  2VKH A;  3Q5F A;  2CSO A;  2CV0 A;  3I9V 2;  1B59 A;  2KLO A;  1SAU A;  3CO6 C;  2IP2 A;  1ZAR A;  3BQZ A;  3VYR B;  4YIR X;  4I02 A;  4BXX J;  1HBX G;  4HAM A;  2DU9 A;  3CJQ B;  4IHW A;  1ZLJ A;  2NS7 A;  3R4K A;  1JXS A;  4RGX A;  3E0J B;  1YO5 C;  1IGN A;  4AM3 A;  2H6C A;  3H0D A;  1JI8 A;  1QVT A;  1PUE E;  2XC7 A;  2BE5 F;  3ZN0 A;  1TWC J;  3KYL A;  1FP1 D;  1OYW A;  4LGW A;  1Y56 A;  1IXC A;  4UV9 A;  1B72 B;  1P4X A;  3CUO A;  5J4V A;  1D0Y A;  3H5R A;  3JRH A;  3FXU A;  1TBX A;  2MW8 A;  3GLL A;  3NEU A;  4JX6 A;  5HDG A;  1JKR C;  3Q0U A;  5EJC A;  4NQW B;  1A6Q A;  1IRF A;  4OMY A;  1J59 A;  2LTP A;  3RDI A;  1ZLK A;  2X6Y A;  2O5R A;  3AG4 H;  1FOY A;  3CUQ C;  1KA8 A;  2KZG A;  3QU6 A;  4BQO A;  4DOZ A;  1FTT A;  4DZP A;  3WTS C;  3DXJ F;  3ZR8 X;  1WVR A;  3ZMS A;  5DD4 A;  4AU7 A;  2HVS A;  4NC8 A;  3C7J A;  4Z6Y A;  3SZP A;  2R93 J;  3B6C A;  3E5U A;  1ENH A;  5CKT A;  2K9L A;  4GYG A;  4A0Z A;  2CMP A;  4R79 A;  3CDH A;  1ETK A;  1K4S A;  4Y13 A;  1U8B A;  3V7R A;  5E1Z B;  4BHC A;  3WTX C;  4LLG F;  3PUB A;  1K4T A;  2CQ7 A;  2DI3 A;  2WY8 Q;  1IO2 A;  3LA7 A;  3PQK A;  2N8G A;  4F55 A;  3CCU I;  4UXN A;  1AKH A;  5FKO A;  4LK0 F;  2FBH A;  2CUZ A;  3H9Q A;  3PNY A;  1YIJ I;  2NXN B;  2ICW G;  5E18 F;  3QWL A;  2A07 F;  1FPQ A;  1NK2 P;  1SMY F;  1XMA A;  2E36 A;  1P4A A;  2Q2E A;  4V2F A;  1VQ9 I;  2E1M B;  2HVQ A;  3HYI A;  2E34 A;  2XHK A;  4LJZ F;  4G7Z F;  2KIM A;  2AHQ A;  3HXL A;  2A69 F;  2VN2 A;  1W5S A;  2VQC A;  2X1D A;  5BMZ A;  3BWG A;  1PUF A;  1DDN A;  2D5V A;  1MKM A;  1WI3 A;  1NHA A;  2VKV A;  1I1S A;  2X51 A;  1KU3 A;  3F21 A;  1REP C;  3MCZ A;  2EIK H;  2Z3Y A;  2LH9 A;  4XLP F;  2JVH A;  4QPQ A;  5DV5 A;  1O3S A;  1BOA A;  1BBY A;  1VQN I;  2XAS A;  2HZD A;  4FE4 A;  4HX7 A;  5M3M J;  3WTT C;  1MMG A;  4ZYE A;  4CCL A;  2R5Y B;  2NVQ J;  3L2W A;  2TRT A;  1SAX A;  3J7A O;  3L1P A;  2C6Y A;  1PJR A;  3I4M J;  4E4H A;  4F3Q A;  1R22 A;  2OBP A;  4IJA A;  5LGT A;  2M8E A;  1ZEL A;  2IGO A;  2JSP A;  2RKH A;  1HA8 A;  3A1Y A;  2DAO A;  2K7L A;  3KZY A;  1H89 C;  3FZV A;  2DLL A;  5BNG A;  2PJP A;  2V9K A;  3WG9 A;  3SFZ A;  3S3O A;  1FYM A;  4RAF A;  1VND A;  1IN7 A;  2MA3 A;  3MMY B;  1YIT I;  4YEJ A;  2LOO A;  2ESN A;  2XRN A;  1W0T A;  2XDV A;  4A5N A;  3MZH A;  2EZK A;  1B6A A;  4YEL A;  2FX0 A;  4WXH A;  3IWZ A;  1K83 J;  4F52 A;  3SXY A;  1IAW A;  3E3V A;  5E3N A;  3H92 A;  3U1D A;  4Y7N J;  2KHM A;  2E1C A;  2EIM H;  2OTL I;  5LRR A;  4ETS A;  2KPM A;  3ZRG A;  4ESB A;  4CZC A;  1JUS A;  5GAG J;  4XLA A;  2DFF A;  4P1W A;  3HOS A;  2XAJ A;  1YG2 A;  3TKY A;  3OOP A;  4NC7 A;  3JRG A;  2E71 A;  2FBK A;  3TOB A;  2PQ8 A;  4JK1 X;  1P2F A;  3QU3 A;  4N0B A;  2F5D A;  1W7P A;  2GQQ A;  4HNV A;  3DBR B;  3GYH X;  1X3W B;  2W48 A;  1LEA A;  2DPD A;  2DO7 A;  2QLZ A;  4GDF A;  5FLX K;  3L2C A;  3CCQ I;  4JX4 A;  4JX5 A;  1XCV A;  2P6T A;  3ABL H;  4Y33 A;  3OIQ A;  1VQ7 I;  1TT5 B;  2W84 A;  3FF5 A;  1OJL A;  2MH2 A;  2EV0 A;  4M9S A;  4KJZ A;  2DTR A;  2HQN A;  5IOZ A;  5EG0 A;  3OSG A;  1BI0 A;  3ERM A;  4XLF A;  5J47 A;  2MG4 A;  2WAF A;  3MN2 A;  1D1B A;  5GPC A;  3ULQ B;  5BQT A;  3OSF A;  3S1R J;  2KRC A;  1APL C;  1PDN C;  1Y39 A;  2RV8 A;  2M7A A;  1F1Z A;  1ZRC A;  4IHT A;  1A5J A;  1VQ5 I;  3KFW X;  2GBY A;  3RKW A;  3CF2 A;  1GV5 A;  1BJA A;  2K3P A;  3ZXS A;  3Q3S A;  2F5C A;  3OV8 A;  2NOJ B;  2L4A A;  2O61 A;  2ELJ A;  3BTI A;  4QPO A;  5DYM A;  4ZTF A;  1X1B A;  1YW7 A;  4KNY A;  2RC4 A;  5E3M A;  4A3I J;  1W7P D;  1C0W A;  3U9G A;  4BXU A;  4KIF A;  2VJI A;  2L02 A;  3IRQ A;  5EZG A;  2OZU A;  1G3W A;  1H8A C;  2PI0 A;  4IHX A;  3WTU C;  3IP4 B;  3OYI A;  2I8D A;  1V4R A;  2JA6 J;  1BI2 A;  2O0Y A;  2DJN A;  3BR3 A;  3BR1 A;  3GTG J;  2Y9Y A;  5F04 A;  2HQA A;  3GZN B;  4ABZ A;  4BBR J;  3CUQ A;  3CC2 I;  5DM7 F;  4KYW A;  4CA0 A;  4ZYH A;  1VZ0 A;  2DMT A;  3JTG A;  3FKJ A;  4I0B A;  1Q1V A;  2R7Q A;  4B09 A;  1W5C C;  2YR2 A;  1T6S A;  4UNO A;  2ADU A;  3CTA A;  3V42 A;  1E3O C;  1FYK A;  1OR7 C;  3F8F A;  4IOA F;  1TW3 A;  4IF4 A;  3GTP J;  1YQA A;  2CW7 A;  2ACJ A;  2RRE A;  1XSX A;  2K3F A;  2Y2Z A;  5CYV A;  4IHV A;  2GOX B;  3LSH A;  2X85 A;  1ON1 A;  3E97 A;  4E7Z A;  2ELH A;  2LC2 A;  5FKM A;  3WTW C;  3IKT A;  3I5U A;  5K5O A;  1QPI A;  2XSD C;  1MJB A;  3H0G J;  2XGE A;  1JKQ C;  4IQJ A;  1R1U A;  2LYC A;  5IPA A;  1B72 A;  2ZXI A;  2ECB A;  2P5V A;  3CCM I;  1HKS A;  1DQU A;  1OIS A;  4C3J J;  3ZMT A;  2ZXJ A;  4ENK A;  2O03 A;  2VC1 A;  4A3B J;  1WI9 A;  2MAB A;  4ZYA A;  1FOX A;  4IRH A;  2EA2 A;  3KP2 A;  4NQW A;  5FKK A;  2JPB A;  2FE3 A;  3G1O A;  2P7C B;  1IUY A;  2V9V A;  1EV7 A;  2DT5 A;  1Q1H A;  3G2B A;  1D8K A;  2DN0 A;  3RPQ A;  1IN8 A;  3PL8 A;  1RC9 A;  4BNC A;  4FT8 A;  3HSE A;  4IKF A;  3FXQ A;  3S93 A;  2CFX A;  1CGP A;  1ZKG A;  3AL0 C;  4FHT A;  1J5Y A;  2BVM A;  5EDN A;  3J81 K;  4RDU A;  2W1O A;  1Y1W J;  5L3B A;  1O3Q A;  2D1V A;  1DPR A;  2F4I A;  3FMR A;  2VIX A;  2ISZ A;  5M3F J;  3RI4 A;  3BCA A;  5EF6 A;  4E7J A;  3HPH A;  3MKL A;  3MEX A;  1MDM B;  3F3X A;  4A3E J;  2E2I J;  3ESW B;  3HRS A;  5E3L A;  2JRT A;  3K4K A;  4BU2 A;  3GX4 X;  3DLA A;  2NRA C;  4BGD A;  4CGZ A;  4JBA A;  2LF7 A;  1IF1 A;  3GEZ A;  1YHQ I;  3EQL F;  1Z91 A;  1Z9C A;  1R5H A;  4C3I J;  1ZRF A;  2ELK A;  2MBF A;  1G3S A;  1MMA A;  1YFH A;  2NVU B;  4CCM A;  2Z2S B;  3DWL E;  3BCB A;  5CVU A;  4ON0 A;  3NQO A;  2K40 A;  4X1E A;  5D5W B;  4HLY A;  1Y8Q B;  3S2H J;  2Z1D A;  3BDD A;  4CSW A;  1D1C A;  1LUJ B;  3AG1 H;  3BR5 A;  1Z6T A;  4XKB A;  4E7L A;  3M4O J;  1IDZ A;  2QKL B;  3HSR A;  1LPQ A;  1JTY A;  3HM5 A;  1U2W A;  4HA8 A;  2ZJQ F;  1V3F A;  4PFO A;  1B1B A;  1QZY A;  1RKW A;  4S0H B;  1UMQ A;  4HYE A;  4WK8 F;  3GFL A;  2DA5 A;  2VBY A;  1FMW A;  4ESJ A;  3QPH A;  4FX4 A;  2E1N A;  2Q0O A;  3FHN A;  2M34 A;  4NHJ A;  2CFO A;  3HOU J;  2FD5 A;  3LSJ A;  2K5C A;  3WTZ A;  3QPT A;  3TED A;  2ZNY A;  4N9H A;  5B1B H;  2DYS H;  2ZSI B;  1HSJ A;  4XRM A;  2DOD A;  3EPZ A;  1R49 A;  1K6Y A;  2R0Q C;  1BA5 A;  1HW5 A;  3BR6 A;  5FRO A;  2OTJ I;  2HPI A;  3RZO J;  1YRN A;  2EFP A;  3F8N A;  4UVA A;  2EK5 A;  2QBY B;  2R5Z B;  2R3S A;  1JHH A;  3PIO F;  2DOA A;  2Q2E B;  2ZC2 A;  4XR6 A;  3WGH A;  4OIR F;  4B8X A;  3CMA I;  3S3M A;  2L01 A;  4EJU A;  2XAF A;  4M73 A;  3F23 A;  3QPS A;  2PN6 A;  4I2O A;  1FNN A;  3D0S A;  1OYY A;  4CCK A;  1QNT A;  4MFD A;  5H6Q A;  4DNC A;  3RYP A;  1JT0 A;  3RPU A;  1PUF B;  2BY1 A;  3P7N A;  2AO9 A;  4IL6 C;  4BS9 A;  1OCT C;  2K9S A;  4V19 K;  1D5Y A;  1DGR M;  1G6N A;  3U1K A;  3R0A A;  4UB6 C;  5ICC A;  1T38 A;  3GTO J;  4XNF A;  3HC7 A;  4G8X A;  5K1Y A;  3X2Q H;  2A6E F;  1Z3X A;  5FLM J;  1GXQ A;  5E3O A;  3I53 A;  3SYT A;  3OS2 A;  1Z6R A;  2JWT A;  1E17 A;  1EH8 A;  1OKR A;  1Z21 A;  3MFK A;  2VOD A;  4E7K A;  2CUF A;  3F8C A;  2HYF A;  1X19 A;  2UUZ A;  1B9M A;  1LKX A;  1IUF A;  2K9M A;  4O5V A;  3OWT A;  2PMU A;  2M5W A;  2IS4 A;  3N97 A;  4YIF A;  2CW8 A;  3ZQL A;  2W57 A;  4HBL A;  4KIG A;  5TJJ A;  3DU6 A;  3A02 A;  3RKQ A;  1G3T A;  1XDU A;  3GXO A;  3RPU D;  5IOY A;  1OR7 A;  2DPU A;  1UZC A;  2JUC A;  2HDD A;  5CQE A;  1UG2 A;  2M30 A;  2VUM J;  1S5L C;  3WOD F;  2W85 A;  3JAM K;  3J80 K;  1FIP A;  1A31 A;  2PJR B;  4YFX F;  4EGZ A;  3JRI A;  4M74 A;  4A3M J;  4KUM A;  1I50 J;  3L2R A;  2P0W A;  3V4G A;  1K78 B;  1R71 A;  1KYW A;  4A3L J;  1RKT A;  2DQL A;  5FKN A;  3G1L A;  3BG9 A;  2W7N A;  1YW8 A;  3I4N J;  1V55 H;  2XAU A;  4Y17 A;  4XL9 A;  1P7I A;  2Z16 A;  1VQL I;  2VJJ A;  3MKY B;  3H3V K;  4L9J A;  5GAH J;  4G6T B;  4A0X A;  2GLO A;  4A12 A;  3MZ8 A;  3O8G A;  3B73 A;  2QVO A;  3BTC A;  3RKY A;  1R23 A;  3FXJ A;  1MH4 A;  3LSP A;  2LRE A;  2GIV A;  4UUS A;  4KDP A;  3JRF A;  1MD0 A;  4LK1 F;  3MD2 A;  4K2E A;  4XN3 A;  4S04 A;  5KCM A;  3VDX A;  4ESF A;  1I5Z A;  5B3S H;  3DTE A;  1FOK A;  1SEU A;  3H36 A;  2KIF A;  1QZZ A;  1T95 A;  1ZAO A;  1AOY A;  5H6R A;  3NRV A;  4QSH A;  3O6B B;  2CQN A;  1ZRE A;  3ONQ A;  1MIJ A;  4LD5 A;  1VQP I;  5F0F A;  2G0E A;  3RCO A;  2MYS A;  1X4O A;  3MAJ A;  3HTS B;  2WAE A;  4P5O A;  1WGX A;  3BT9 A;  4Z2Y A;  3ZMZ A;  3F6O A;  1I6H J;  3PO3 J;  2KT0 A;  2F2E A;  4U7D A;  1ODD A;  2G7H A;  3M7G A;  1ETQ A;  2OD5 A;  4FIS A;  4C2U A;  5IYB J;  4MFE A;  3KPH A;  4YG2 F;  5A2Q K;  1U0J A;  3TBI A;  2JSC A;  3S32 A;  1U9O A;  1XN7 A;  4XSZ F;  2QEX I;  3DTI A;  5ERI A;  5KNL A;  1K61 A;  1RIO H;  2HOE A;  2PX9 A;  4B3A A;  2VI6 A;  1CQT A;  2R92 J;  3ISP A;  4EAT A;  1KQ9 A;  4IO9 F;  4RLQ A;  3FXL A;  2M45 A;  3PIP F;  1FX7 A;  4F91 B;  2M0C A;  2UXX A;  3LSK A;  1NH3 A;  2DXI A;  3E7L A;  2Z33 A;  2ECC A;  2DMU A;  3HOT A;  2IS2 A;  1G8X A;  1ULY A;  2MFZ A;  2FU4 A;  4HDV A;  3TOA A;  3HG9 A;  2M4G A;  1U5T C;  1UB9 A;  3PFI A;  1ZR2 A;  4L0Z B;  1ZGJ A;  3AFH A;  2WAQ N;  5CPR B;  3E5X A;  3MWM A;  4L5J A;  2XSJ C;  3VB2 A;  5GTH C;  1Z67 A;  2QEN A;  2ZFW A;  2DFH A;  4D7M A;  4U88 A;  1FMV A;  4RM2 A;  3PJR A;  3TW7 A;  3VYS B;  2PEX A;  4F92 B;  3GVA A;  4M6V A;  1O3R A;  5K5Q A;  4II2 A;  2R7O A;  2H09 A;  3EUH A;  1V5G A;  1D5V A;  1OCZ H;  1E2X A;  2XIG A;  3GBG A;  4IOC F;  5FB2 A;  4XSX F;  5EZH A;  1FYL A;  1RES A;  1V5E A;  2ZO4 A;  4LIT A;  3FXK A;  3HIF A;  1MDM A;  1R00 A;  2DFI A;  2F4O B;  2HYG D;  3FM5 A;  3GFM A;  1FLI A;  5BS6 A;  2L2O A;  2DOF A;  2BW3 B;  1USS A;  4LB5 A;  3RKX A;  1HKT A;  1QA6 A;  3HHG A;  1D1A A;  1SC7 A;  3D5R C;  1LDJ A;  3P9K A;  4IQ4 A;  4BAY A;  1LDK B;  2LVS A;  3CCV I;  1HW2 A;  5GPA A;  5C4X J;  2STW A;  4OIQ F;  2V1X A;  3OYJ A;  4AVP A;  3BG3 A;  3QYB A;  2CRG A;  1MSF C;  3A0B C;  5H20 A;  2UWM A;  5ICG A;  3BJ6 A;  4UVB A;  3HEF A;  3K70 C;  3BOQ A;  4ZDO A;  3Q9V A;  1QVU A;  2PMZ N;  2IJL A;  4XLE A;  1VQ6 I;  3JRB A;  2V9P A;  1DPU A;  4A93 J;  1TQP A;  4KN4 X;  3TDZ C;  2WAD A;  3J7Y J;  3LFU A;  2LR8 A;  1LNW A;  3MKW B;  1TT0 A;  1MBE A;  1RR8 C;  1XD7 A;  4XOR A;  3KZZ A;  5LEJ A;  5D5V B;  2VQH A;  4ENJ A;  3UKG A;  3A01 A;  2GA1 A;  1IRX A;  1FC3 A;  3W6K B;  3ZN1 A;  3GF2 A;  1K7A A;  1AU7 A;  2CQQ A;  2FOW A;  2MGQ A;  2WY7 Q;  4DW6 A;  1ERD A;  2NVX J;  3LSG A;  5CVR A;  5FFX A;  3J7A Y;  2JRM A;  2X9D A;  2R7S A;  4KT5 C;  1T0F C;  1X1D A;  1MBJ A;  1IN6 A;  2YX7 A;  3IRR A;  4Q47 A;  5GAE J;  3HOV J;  1QU3 A;  1OQY A;  3W6V A;  1ZHF A;  2VQL A;  1WRJ A;  1D0X A;  4H0E A;  1VFC A;  2VC0 A;  2EPF A;  4AC0 A;  4A0Y A;  4U87 A;  3OR2 C;  3LAP A;  4HF2 A;  3HOX J;  1XGO A;  3JRA A;  1T39 A;  3HUG B;  4JYK A;  1KU2 A;  2ZBK A;  4X0G A;  2QBY A;  3FHZ A;  1PYV A;  2R5Z A;  1UEL B;  4A3D J;  2HYJ A;  3BPX A;  4GO1 A;  3ZQI A;  1RZ4 A;  1R6R A;  2K27 A;  1OPC A;  3HZJ A;  3OS1 A;  3GTK J;  1IC8 A;  5F1J A;  3V8J A;  3SFI A;  4ZZL A;  2OF7 A;  4XRS G;  1U9N A;  2WA0 A;  4BJT A;  2L4M A;  5IYC J;  2XB5 A;  3OYM A;  3QYF A;  2QWW A;  3CMM A;  4M3G A;  4AID A;  4A3F J;  2MH9 A;  4HW0 A;  4UV8 A;  1TTY A;  2Z5U A;  2YUS A;  1K6O A;  1WJD A;  2FNP A;  3TO6 A;  4C9Y A;  1JHF A;  4PJ0 C;  2O8K A;  1Y1V J;  1X4P A;  4Q48 A;  4EQQ A;  1W36 D;  5HS9 A;  3WHB A;  4C2M J;  2QQA A;  3R0J A;  1F36 A;  1HST A;  4NBQ A;  4YFK F;  3CMY A;  3ABK H;  3QPL A;  5B5E C;  2XAQ A;  2HKX A;  2FF4 A;  2FQ4 A;  3KP6 A;  3U21 A;  1YRN B;  2QKM B;  1MZB A;  1WJE A;  2JTV A;  2HTJ A;  2BY3 A;  4PFP A;  4MO7 A;  3IC7 A;  2BXZ A;  2PLY A;  4B4C A;  3REO A;  4OIP F;  4I0A A;  4A3C J;  1ZGA A;  2HGC A;  4DIQ A;  2Z99 A;  4BKX A;  2IT0 A;  2JA8 J;  3BZC A;  1SFE A;  2GWR A;  3KYC B;  1BIB A;  4DGW B;  3F9K A;  3DEW A;  1J09 A;  2PJR A;  2CG4 A;  2EH3 A;  1K78 A;  1KZH A;  4MHG A;  1W5T A;  3GME A;  3R61 A;  1F5T A;  1MSE C;  4IVN A;  3CME I;  2JJ7 A;  4OWR B;  3DKW A;  4MGR A;  5CJ9 A;  4HF0 A;  1IW7 F;  1HDP A;  2JUG A;  3KP4 A;  1ORK A;  4XOT A;  2DA6 A;  3A0H C;  5JLW A;  2W82 A;  5ICE A;  3RQI A;  2DYR H;  2VON A;  3EET A;  5FLX Z;  1A6I A;  1J9I A;  2G9W A;  3LMM A;  4F93 B;  3GZ6 A;  2QF7 A;  5LFA A;  1I3Q J;  3K7A J;  3UNG C;  1X3Z B;  3WGG A;  4XKC A;  4AIK A;  3LOC A;  2Z9O A;  4G7H F;  3K4J A;  3W2A A;  1Z7U A;  2VE8 A;  2WV0 A;  1MBK A;  1U5T A;  4JQF A;  4WWC A;  2P5L C;  1R4N B;  1N78 A;  2M0M A;  2KIS A;  4CUG A;  1XTA A;  4NC6 A;  2HFH A;  2XAH A;  4ASN A;  1JGS A;  4WF2 A;  2RNG A;  4WCG A;  2HOT A;  4F7Z A;  2VE9 A;  2R7R A;  4N9I A;  4GYI A;  5F0H A;  3DKX A;  2DTZ A;  2RQP A;  2E2J J;  4GFB A;  2BY0 A;  4CCN A;  3RYR A;  2R7T A;  1FTZ A;  2BHZ A;  3DF8 A;  1ZTR A;  1VTN C;  5KVR A;  5D5X B;  2YSR A;  4FTH A;  2E5N A;  3FXR A;  3SQN A;  2R7F A;  1U3E M;  2J5O A;  3ZPL A;  2BEO A;  1I39 A;  2JPC A;  2EFN A;  4CCO A;  1PP8 F;  1DP7 P;  5D4S A;  5BPI A;  2VKE A;  2XB0 X;  4AD9 A;  1MH3 A;  4AUX A;  2ID3 A;  5J8C A;  4D5C A;  2DK8 A;  4I01 A;  3HJE A;  4RB1 A;  2CU7 A;  5JR3 A;  1P4W A;  3PFY A;  2ME6 A;  2EQR A;  1S6L A;  3W2W A;  2BGC A;  1A36 A;  5TIS C;  2VXD A;  5FJ8 J;  2P8T A;  1WJF A;  5FD6 A;  1OCO H;  4UUS B;  3M8J A;  3OYK A;  2NAZ A;  1R5G A;  1H9G A;  2E35 A;  4XOP A;  2XRL A;  2TCT A;  1A35 A;  3KZI C;  5AIP A;  3AG2 H;  1WSU A;  4AIJ A;  1HF0 A;  3LSI A;  3WE3 A;  2IPQ X;  2VQG A;  2QA4 I;  3AL0 B;  3E5Q A;  3HL2 A;  4BHB A;  4HQE A;  2VT3 A;  2LY1 A;  2K9N A;  1O3T A;  1TZL A;  2WAQ A;  3C2B A;  3H9G A;  1MJ9 A;  1UHM A;  3RTR A;  5DDG A;  2LY2 A;  4WXD A;  3AKZ A;  4A3K J;  1Y0U A;  4D9J A;  4AYB N;  4CH7 A;  3PSF A;  2FBI A;  5D6F A;  2ZXH A;  3GTL J;  4YII A;  3L09 A;  4BBS J;  4MTD A;  4HLX A;  4CZZ A;  1IG7 A;  2VKD A;  3FDY A;  3I71 A;  2B63 J;  2BW3 A;  3GTM J;  3BY6 A;  4QIW N;  1R1T A;  2LKP A;  3JTH A;  2HOS A;  1LFB A;  2E1O A;  1BJZ A;  2NVY J;  4Q4Z F;  2ZSH B;  2Y75 A;  5JHF A;  2EIN H;  3OYC A;  2DW4 A;  4BYY A;  2ZCW A;  3SDG A;  2LF8 A;  2P6S A;  3IUO A;  2FJ1 A;  1O4X A;  1GT0 C;  2DMN A;  5ILS A;  1TW2 A;  3IH2 A;  1EKE A;  1WCM J;  4EMS A;  5F0C A;  3CO7 C;  1S8N A;  5K5R A;  3WGI A;  3K4L A;  4BY7 J;  5E1W A;  5K7F A;  1ETX A;  1I6X A;  2L9N A;  3C3W A;  3E6M A;  2X1E A;  5LBQ A;  1FBQ A;  1MND A;  1LQ1 A;  4EJW A;  1VI0 A;  3J81 Z;  3FMQ A;  1YW9 A;  2PMZ A;  3RIR A;  1S72 I;  3JCU C;  1XX5 A;  1BL0 A;  4PJM A;  3HBL A;  1BW6 A;  2ETH A;  2CO5 A;  2Y69 H;  1KQ0 A;  4RAY A;  1RI7 A;  4U0Y A;  2J5P A;  1SVO A;  3FK7 A;  2FML A;  1BR2 A;  3LSM A;  1R7J A;  3BJO A;  3LNQ A;  3K4C A;  1T98 A;  3I3L A;  4C30 A;  4IZZ A;  1R36 A;  3KLO A;  1QPM A;  3OYG A;  4IRG A;  1ETW A;  3VFZ A;  1TNS A;  2BVL A;  3WHC A;  4XQF A;  3NAR A;  2L0K A;  3OYL A;  2WTE A;  3DTK A;  2DBB A;  2W4S A;  4WXC A;  2DJI A;  3MQ0 A;  1N75 A;  2YX4 A;  1YJ9 I;  3HUG A;  1HKQ A;  3CQZ J;  1H0M A;  2LMD A;  3S2D J;  5L3F A;  4ITV A;  1B4A A;  4B1R A;  2P7V B;  2QUF A;  2OU2 A;  1IJW C;  5HLG A;  1HQC A;  3SJM A;  5FD5 A;  3OYE A;  2OV7 A;  2O3F A;  2H94 A;  4DBR A;  2GIZ A;  2UV1 A;  5M5W J;  1R58 A;  4HOB A;  4IHS A;  2X1C A;  4X6A J;  5LD2 C;  4CCJ A;  2DK5 A;  5F27 A;  2IS1 A;  1MMN A;  4E7I A;  2V4J C;  2OJE D;  3A01 B;  5CLS A;  4RS8 A;  3CCR I;  2QM3 A;  3L2U A;  3G73 A;  3DPU A;  5GP9 A;  2COB A;  2CH0 A;  2EB7 A;  3ZCO A;  5HVQ C;  1LVK A;  3FXO A;  2GAU A;  2HTS A;  1QO0 D;  3BR2 A;  2V1D A;  4M71 A;  2O7O A;  3DCF A;  3ZQF A;  2A61 A;  5LLQ A;  3K1M A;  3ABT A;  3DEU A;  9ANT A;  1IV6 A;  3M07 A;  1LDD A;  2DMQ A;  2X4H A;  2MLK A;  2OUM A;  2IRF G;  1H9T A;  5JHU A;  3HOZ J;  1IRZ A;  2OC6 A;  1WQ2 A;  4PUS A;  4KIB A;  3TDU C;  3JSO A;  4G94 A;  4P96 A;  4PGG A;  3O3K A;  2F4M B;  1GVD A;  3QOD A;  3WG7 H;  1SD6 A;  1TLH B;  2GXG A;  4LG0 A;  1VQK I;  1FSH A;  3PNT A;  1PVE A;  3NAU A;  3BG7 A;  1BI3 A;  4LOC A;  1QHH D;  4EM1 A;  2X6W A;  5CVV A;  1RNL A;  3DKY A;  3Q0V A;  2BZT A;  2FRH A;  3GLX A;  2EFO A;  3S1M J;  3N05 A;  5GAD J;  3OIP A;  1G59 A;  2EIL H;  4AWX B;  4RB2 C;  3BP8 A;  3TMO A;  1BI1 A;  1U6G A;  3OYN A;  3IL2 A;  3ZP5 A;  1LFP A;  2XGC A;  3E1S A;  4G12 A;  4BL0 B;  3E6B A;  4ENM A;  2VJ5 A;  3BG5 A;  3FM3 A;  2E19 A;  4B43 A;  4FE7 A;  2L9V A;  4YRV A;  3Q9S A;  2VJ4 A;  2OQR A;  3K4M A;  5LEK A;  2MSY A;  2W24 A;  1BM9 A;  1T8I A;  1D3Y A;  4HX4 A;  4PZJ A;  1OLT A;  2OCE A;  1LJ9 A;  2ZJ2 A;  4EM0 B;  1GLN A;  1SAN A;  1ZN2 A;  3OY9 A;  5EGO B;  2MC3 A;  3HPG A;  3HHH A;  4RGS A;  3I55 I;  4MNU A;  3EUA A;  1AHD P;  2LRD A;  1IXR C;  2A68 F;  2CUJ A;  1R9T J;  4AVZ A;  5CVI A;  3CES A;  3K69 A;  1X2N A;  3PM1 A;  1ETO A;  2L7K A;  3JAM Z;  3QP6 A;  3J80 Z;  3FBI B;  3QOE A;  3QQA A;  3GFJ A;  3G1M A;  3TO9 A;  4EJO A;  1Z7L A;  4D0P A;  1SD5 A;  3FK6 A;  4M9Z A;  3KP5 A;  3OR1 C;  3TGN A;  3R60 A;  3SHF A;  2BYV E;  2HU9 A;  3K2A A;  1KQ8 A;  3ASO H;  2XKP A;  3R6S A;  1JJ6 C;  2B9S A;  1T33 A;  3WU1 B;  3W2V A;  4E7S A;  3FMS A;  1FJL A;  2P81 A;  2NNN A;  3HRU A;  2WB1 N;  5LGU A;  1N25 A;  5AON A;  1IDY A;  2W25 A;  3IKV A;  5FFZ A;  1H88 C;  4MEY F;  3UR3 C;  1XMK A;  2CV1 A;  1QHG A;  1U5T B;  4CIC A;  1XG1 A;  4ZC3 A;  3ECO A;  1JJ8 C;  2XV4 S;  4HSR A;  1G4D A;  2QZ8 A;  4LLL A;  3B6A A;  5F6F A;  3F6V A;  2M4K A;  5ED4 A;  2E5Z A;  3S15 J;  3SZT A;  2CYY A;  2IEK A;  2V6C A;  3ZMV A;  1WJB A;  5HNF A;  3JRD A;  3LFK A;  4NNJ A;  2CV2 A;  2JN6 A;  2R7X A;  2IA0 A;  4BH9 A;  2NNY A;  1FEX A;  1GUU A;  3ABU A; 
#chains in the Genus database with same CATH homology
 5TRD A;  1ZRD A;  5E20 A;  5E17 F;  5AIQ A;  3WE2 A;  4WX9 A;  5D4R A;  4HV6 A;  5JFR A;  3M8F A;  5A2Q Z;  5D8L B;  2ZME B;  6PAX A;  2NS0 A;  3P9I A;  4DQ2 A;  1J7K A;  2LNB A;  4CHU A;  2D1H A;  2QQ9 A;  1FT9 A;  4U7B A;  2HDC A;  3T1B A;  2EA4 A;  3M9A A;  1YIO A;  2A5Y B;  1CF7 B;  5F64 A;  3HRM A;  4LFU A;  3IHU A;  4CXF A;  4PGH A;  4LMY A;  4Q5S F;  5DUI A;  3LA3 A;  2KRF A;  3ROU A;  1XGM A;  4PDK A;  4XRF A;  1LB2 A;  3JW4 A;  2VBZ A;  4UUV A;  2R7D A;  4S05 A;  4UVC A;  1D8J A;  5IT9 K;  3E6D A;  3RJP A;  2STT A;  4ZZD A;  1Z05 A;  3K0L A;  4MQV A;  5BPD A;  1F4K A;  2QYO A;  5D8K B;  4ZYD A;  5HLI A;  1TQM A;  3BPV A;  3T8T A;  2Y48 A;  1FP2 A;  1FBS A;  2VBW A;  1ZG1 A;  3GW2 A;  1I27 A;  1YS6 A;  4P9U A;  1UHW A;  3BJA A;  1K79 A;  2H27 A;  1S3J A;  1O7L A;  5E8I A;  1BC7 C;  3CLO A;  5HS7 A;  1XSD A;  5DUK A;  4XLN F;  3GO5 A;  2XAG A;  1HXD A;  2IA2 A;  3VEP A;  5LHH A;  3V8K A;  2XVC A;  4AIH A;  1AWC A;  2OAZ A;  3K9T A;  4HZF A;  2DQR A;  4I09 A;  5HOO A;  5L3C A;  2IW5 A;  3PQJ A;  3I59 A;  3ZMD A;  1JE8 A;  2FOK A;  2BV6 A;  1W4M A;  5JI6 A;  5E1X A;  4RB0 A;  1UST A;  2P5K A;  2JT1 A;  4BHP A;  3E6C C;  3H3U A;  2PFB A;  4A6D A;  2EFQ A;  2WC2 A;  4OIO F;  1WKM A;  2RGV A;  3LA2 A;  4G7O F;  4A5M A;  4U0V A;  1KU7 A;  1J0R A;  1RUN A;  5HDK A;  1SD7 A;  1STZ A;  2KKO A;  3KE2 A;  4OU0 A;  1LVA A;  1O57 A;  2LDU A;  2D2W A;  5EEG A;  2A3S A;  3C1D A;  4EM2 A;  1U78 A;  2O6G E;  2CWE A;  2IA1 A;  3ZQ7 A;  4I7H A;  1YYV A;  2F5E A;  2EV5 A;  1P6R A;  4KIC A;  1S7O A;  4OIN F;  3L9F A;  1GXP A;  4LG0 B;  5HLH A;  1G3Y A;  2K4J A;  2CQK A;  1F9N A;  2ZNZ A;  1QBJ A;  4P9F A;  1S29 A;  5FGM A;  3O2P E;  3WU0 A;  5DCF A;  3IWF A;  4KFC A;  1ZH5 A;  1L0O C;  2VXZ A;  2P4W A;  4ENN A;  1P92 A;  2VBX A;  2TDX A;  2PBI A;  3F72 A;  1KU9 A;  2G7U A;  5CVJ A;  4CYD A;  1FZP B;  3GFI A;  5J6X A;  3F8M A;  3QRF F;  1B9N A;  2RNJ A;  2ZKZ A;  2HEO A;  2FMY A;  5DD8 A;  4UHT A;  4KMU X;  1MJA A;  2RN7 A;  4L5I A;  2KIU A;  2WWY A;  4IRI A;  1TQI A;  3F22 A;  2XKO A;  3V7C A;  2A6H F;  2D45 A;  2VT2 A;  1FSE A;  3U2R A;  4HQM A;  1Z1D A;  2FNA A;  4O6J A;  4IXA A;  2FSW A;  1XDS A;  2EJR A;  5ICF A;  4OMZ A;  4L9N A;  2ZME A;  4OOI A;  1L3L A;  2MD5 A;  3V8L A;  2F5F A;  1YS7 A;  1GVJ A;  4P55 A;  4PCQ A;  3FX3 A;  4RGU A;  3TO7 A;  4MEX F;  4QWQ A;  4GCV A;  1CF7 A;  2HWV A;  5L3D A;  4HDU A;  2AXL A;  1BC8 C;  1IN5 A;  3ZMU A;  1EH7 A;  3DP7 A;  5F1R A;  3QAH A;  4M9X A;  2Y0M A;  1FWZ A;  1IN4 A;  2E7X A;  4E70 A;  3QP5 A;  4HF1 A;  2M1B A;  4CO8 A;  1T0F A;  4EJV A;  3M1E A;  2KJC A;  5JVT A;  2GA2 A;  5DCM B;  2M87 A;  2OA4 A;  2EV6 A;  4M6Y A;  5E8G A;  4MTE A;  5FO5 A;  3K1N A;  3QOP A;  3DFG A;  1IRG A;  3P9C A;  3KCC A;  4EVI A;  3N4M A;  4A6E A;  4GGG A;  2O8X A;  3KET A;  4I98 B;  4KMF A;  4FX0 A;  3KP7 A;  4RGR A;  5LGN A;  2RVC A;  1UFM A;  3I0T A;  1I1G A;  2HS5 A;  2ISY A;  2K02 A;  1XCB A;  1YLF A;  3L00 A;  1QQI A;  3HSF A;  5EEH A;  4R8H A;  5D6E A;  2GZW A;  1TNT A;  2IVM A;  3H3Z A;  4GXO A;  1ZG3 A;  1SD4 A;  5J8F A;  3DQV C;  1XSV A;  3K2Z A;  3EDP A;  2Q8K A;  4QLC U;  4L9V A;  2L3D A;  1SMT A;  1ON2 A;  2L54 A;  1J75 A;  3ELK A;  1XGS A;  4RB3 C;  2B0L A;  4BQA A;  3EYY A;  2YU3 A;  2HKO A;  5BOX A;  2K86 A;  4KA4 A;  1A04 A;  3I59 B;  5ILV A;  4U0W A;  1ONV A;  1XB4 A;  1WWX A;  1KYZ A;  1LEB A;  1YTY A;  2VOP A;  1U8R A;  2EWN A;  3HTU A;  5ILU A;  3HRT A;  3KLN A;  1RUO A;  3LQR A;  3W6J B;  1R1V A;  3VOE A;  1PP7 U;  4ZYG A;  3I64 A;  2GXB A;  4YFN F;  3DPL C;  1FBU A;  5LHI A;  1DUX C;  3KP3 A;  1BIA A;  2XGX A;  3K1P A;  3KEO A;  5L3G A;  3C18 A;  4MQ9 F;  2PG4 A;  1O7F A;  2MLG A;  3LAJ A;  4ZH4 F;  3G3Z A;  1SFU A;  2BBY A;  4M6X A;  4XBF A;  3ERE D;  1T2K A;  2CGP A;  1ZYR F;  4LLN A;  3LWF A;  3JSP A;  4EJT A;  3M8E A;  4TV7 A;  2H6B A;  5L3E A;  1MGT A;  3GZ5 A;  2LSO A;  2HR3 A;  4HV5 A;  5HS8 A;  3VOD A;  3EYI A;  5KK1 A;  1ZG5 A;  3DV8 A;  2FXA A;  2E7W A;  2CW0 F;  3COA C;  3WTY C;  1FY7 A;  3BZ6 A;  5HDN A;  4CDG A;  3L7W A;  4L0Y B;  2OQG A;  4LB6 B;  2AS5 F;  1IXS B;  5LRS A;  2JZY A;  4Y15 A;  1SFX A;  3ECH A;  2EFW A;  3ML6 A;  2XUB A;  5D5U B;  1W7P B;  4R1H A;  1J2X A;  2V1U A;  3MZY A;  2HQR A;  4L9T A;  3I58 A;  2V79 A;  1HW1 A;  3CJN A;  2COM A;  5DEQ A;  3AAF A;  3V7S A;  4KN7 X;  3B02 A;  3FWE A;  3I54 A;  3BRO A;  2XRO A;  2FEZ A;  1S7A A;  3WTV C;  4NB5 A;  2UXN A;  3LQQ A;  5DCM A;  3DPT A;  3GUD A;  3T5X A;  4G6D A;  4EV0 A;  1QGP A;  3T8R A;  2OZ6 A;  5IT3 A;  3TQN A;  2VOO A;  1BN5 A;  1OMI A;  4HX8 A;  1X3U A;  3I4P A;  1UCR A;  4A2U A;  2K4B A;  1KGS A;  4L18 B;  4G6Q A;  2ESH A;  2PMH A;  5IT9 Z;  2YPR A;  4RAZ A;  1EH6 A;  3GWZ A;  3D5L A;  1GHC A;  1XGN A;  4G9Y A;  3S2W A;  3CUQ B;  5LHG A;  4EGY A;  2FA5 A;  2QQB A;  2UZK A;  2KJB A;  3F8B A;  4O3M A;  2X0L A;  2HZT A;  1IZ1 A;  2FQ3 A;  2NYX A;  3LST A;  2RDP A;  4M72 A;  3KEQ A;  3T0Y A;  4IPA A;  1OYI A;  3Q5F A;  2CSO A;  1B59 A;  3CO6 C;  2IP2 A;  1ZAR A;  4I02 A;  1HBX G;  4HAM A;  2DU9 A;  1ZLJ A;  3R4K A;  1JXS A;  4RGX A;  1YO5 C;  2H6C A;  1PUE E;  2BE5 F;  3ZN0 A;  1FP1 D;  1OYW A;  4LGW A;  1IXC A;  4UV9 A;  1P4X A;  3CUO A;  3FXU A;  1TBX A;  3NEU A;  5HDG A;  1IRF A;  4OMY A;  1J59 A;  3RDI A;  1ZLK A;  3CUQ C;  3QU6 A;  1KA8 A;  3WTS C;  3DXJ F;  3ZMS A;  5DD4 A;  3C7J A;  3SZP A;  3E5U A;  4A0Z A;  4GYG A;  4R79 A;  3CDH A;  4Y13 A;  3V7R A;  5E1Z B;  4BHC A;  3WTX C;  4LLG F;  2DI3 A;  3LA7 A;  3PQK A;  4UXN A;  4LK0 F;  2FBH A;  5E18 F;  2A07 F;  1FPQ A;  1SMY F;  1XMA A;  1P4A A;  2Q2E A;  3HYI A;  4LJZ F;  2XHK A;  4G7Z F;  2KIM A;  2A69 F;  2VN2 A;  1W5S A;  5BMZ A;  3BWG A;  1DDN A;  1MKM A;  1NHA A;  1I1S A;  1KU3 A;  3F21 A;  1REP C;  3MCZ A;  2Z3Y A;  4XLP F;  5DV5 A;  1O3S A;  1BOA A;  1BBY A;  2XAS A;  4HX7 A;  3WTT C;  4ZYE A;  1SAX A;  3J7A O;  2C6Y A;  1R22 A;  2OBP A;  4IJA A;  5LGT A;  2M8E A;  2RKH A;  2DAO A;  2K7L A;  3KZY A;  3FZV A;  2DLL A;  2PJP A;  3WG9 A;  3SFZ A;  1FYM A;  1IN7 A;  2MA3 A;  2XRN A;  2ESN A;  4A5N A;  3MZH A;  1B6A A;  4WXH A;  3IWZ A;  3SXY A;  1IAW A;  3E3V A;  3H92 A;  3U1D A;  2E1C A;  5LRR A;  4ETS A;  4ESB A;  3HOS A;  2XAJ A;  1YG2 A;  3TKY A;  3OOP A;  2FBK A;  3TOB A;  2PQ8 A;  4JK1 X;  1P2F A;  3QU3 A;  4N0B A;  2F5D A;  1W7P A;  2GQQ A;  3GYH X;  1LEA A;  2DPD A;  2DO7 A;  2QLZ A;  5FLX K;  3L2C A;  1XCV A;  2P6T A;  2W84 A;  3FF5 A;  2MH2 A;  2EV0 A;  4M9S A;  2DTR A;  2HQN A;  1BI0 A;  3ULQ B;  5BQT A;  1PDN C;  2RV8 A;  4IHT A;  1F1Z A;  1ZRC A;  3KFW X;  3RKW A;  1BJA A;  2F5C A;  3OV8 A;  2L4A A;  2O61 A;  5DYM A;  4KNY A;  1YW7 A;  2RC4 A;  1W7P D;  1C0W A;  3U9G A;  4BXU A;  4KIF A;  2L02 A;  3IRQ A;  2OZU A;  1G3W A;  2PI0 A;  3WTU C;  1V4R A;  1BI2 A;  2O0Y A;  3CUQ A;  4KYW A;  4ZYH A;  3JTG A;  4I0B A;  4B09 A;  2YR2 A;  1T6S A;  4UNO A;  2ADU A;  3CTA A;  1FYK A;  3F8F A;  1TW3 A;  4IF4 A;  1YQA A;  2ACJ A;  1XSX A;  5CYV A;  1ON1 A;  3E97 A;  2ELH A;  3IKT A;  3WTW C;  3I5U A;  5K5O A;  1MJB A;  1R1U A;  2P5V A;  1HKS A;  3ZMT A;  2ZXJ A;  4ENK A;  2O03 A;  2VC1 A;  1WI9 A;  4IRH A;  2EA2 A;  3KP2 A;  4NQW A;  2JPB A;  2FE3 A;  2P7C B;  1IUY A;  2V9V A;  1EV7 A;  2DT5 A;  1Q1H A;  1D8K A;  3RPQ A;  1IN8 A;  4BNC A;  4FT8 A;  3HSE A;  3FXQ A;  2CFX A;  1CGP A;  4FHT A;  1J5Y A;  3J81 K;  5L3B A;  1O3Q A;  2D1V A;  1DPR A;  3FMR A;  2ISZ A;  3RI4 A;  3MEX A;  1MDM B;  3F3X A;  3HRS A;  2JRT A;  3GX4 X;  2NRA C;  4CGZ A;  4JBA A;  2LF7 A;  1IF1 A;  3GEZ A;  3EQL F;  1Z91 A;  1Z9C A;  1R5H A;  1ZRF A;  2MBF A;  1G3S A;  1YFH A;  5CVU A;  4ON0 A;  3NQO A;  5D5W B;  4HLY A;  3BDD A;  1Z6T A;  3HSR A;  1U2W A;  4HA8 A;  1V3F A;  1B1B A;  1QZY A;  4HYE A;  4WK8 F;  3GFL A;  2VBY A;  4ESJ A;  3QPH A;  4FX4 A;  2E1N A;  2Q0O A;  4NHJ A;  3WTZ A;  3QPT A;  2ZNY A;  4N9H A;  1HSJ A;  1HW5 A;  2EFP A;  3F8N A;  4UVA A;  2EK5 A;  2QBY B;  2R3S A;  1JHH A;  4B8X A;  3WGH A;  4OIR F;  2L01 A;  4EJU A;  2XAF A;  4M73 A;  3F23 A;  2PN6 A;  4I2O A;  1FNN A;  3D0S A;  1OYY A;  1QNT A;  4DNC A;  5H6Q A;  3RYP A;  3RPU A;  3P7N A;  1G6N A;  3R0A A;  1T38 A;  5ICC A;  4G8X A;  5K1Y A;  2A6E F;  1GXQ A;  3I53 A;  1Z6R A;  1E17 A;  1EH8 A;  1OKR A;  3MFK A;  2VOD A;  3F8C A;  2HYF A;  1B9M A;  4O5V A;  2PMU A;  2M5W A;  3N97 A;  4YIF A;  2W57 A;  4HBL A;  4KIG A;  5TJJ A;  1G3T A;  1XDU A;  3GXO A;  1OR7 A;  2DPU A;  2M30 A;  3WOD F;  2W85 A;  3JAM K;  3J80 K;  4YFX F;  4EGZ A;  4M74 A;  4KUM A;  3V4G A;  1K78 B;  1KYW A;  2DQL A;  1YW8 A;  4Y17 A;  4L9J A;  4A0X A;  4A12 A;  3B73 A;  2QVO A;  3RKY A;  1R23 A;  2GIV A;  4KDP A;  1MD0 A;  4LK1 F;  4K2E A;  4S04 A;  4ESF A;  1I5Z A;  1FOK A;  2KIF A;  1QZZ A;  1ZAO A;  1AOY A;  5H6R A;  3NRV A;  3O6B B;  1ZRE A;  4LD5 A;  3MAJ A;  3HTS B;  4P5O A;  4Z2Y A;  3ZMZ A;  3F6O A;  2F2E A;  4U7D A;  1ODD A;  2G7H A;  3M7G A;  2OD5 A;  4YG2 F;  5A2Q K;  2JSC A;  1XN7 A;  4XSZ F;  5ERI A;  1RIO H;  2HOE A;  3ISP A;  1KQ9 A;  2M45 A;  1FX7 A;  2UXX A;  2Z33 A;  3HOT A;  1ULY A;  2FU4 A;  4HDV A;  3TOA A;  1U5T C;  1UB9 A;  3PFI A;  4L0Z B;  1ZGJ A;  3E5X A;  3MWM A;  4L5J A;  3VB2 A;  2QEN A;  2ZFW A;  4U88 A;  2PEX A;  3GVA A;  1O3R A;  5K5Q A;  3EUH A;  2H09 A;  1D5V A;  2XIG A;  1E2X A;  5FB2 A;  4XSX F;  1FYL A;  2ZO4 A;  3HIF A;  1MDM A;  1R00 A;  2DFI A;  2HYG D;  3GFM A;  3FM5 A;  1FLI A;  5BS6 A;  1USS A;  4LB5 A;  3RKX A;  1HKT A;  3HHG A;  1LDJ A;  3P9K A;  4BAY A;  1LDK B;  1HW2 A;  2STW A;  4OIQ F;  2V1X A;  4AVP A;  5H20 A;  2UWM A;  5ICG A;  3BJ6 A;  4UVB A;  3BOQ A;  3Q9V A;  2IJL A;  1DPU A;  1TQP A;  4KN4 X;  3TDZ C;  1LNW A;  1XD7 A;  3KZZ A;  5LEJ A;  5D5V B;  4ENJ A;  2GA1 A;  1FC3 A;  3W6K B;  3ZN1 A;  3GF2 A;  1K7A A;  5CVR A;  5FFX A;  4KT5 C;  2YX7 A;  1IN6 A;  3IRR A;  4Q47 A;  1ZHF A;  1WRJ A;  4H0E A;  2VC0 A;  4A0Y A;  3LAP A;  4HF2 A;  1XGO A;  1T39 A;  1KU2 A;  2ZBK A;  2QBY A;  3FHZ A;  3BPX A;  4GO1 A;  1RZ4 A;  2K27 A;  1OPC A;  3V8J A;  4ZZL A;  2L4M A;  2QWW A;  2MH9 A;  4HW0 A;  4UV8 A;  1TTY A;  2Z5U A;  1K6O A;  2FNP A;  3TO6 A;  1JHF A;  4Q48 A;  4EQQ A;  5HS9 A;  2QQA A;  3R0J A;  1HST A;  4YFK F;  2XAQ A;  2HKX A;  2FF4 A;  3KP6 A;  1MZB A;  2JTV A;  2HTJ A;  3IC7 A;  2PLY A;  3REO A;  4OIP F;  4I0A A;  1ZGA A;  2HGC A;  2Z99 A;  2IT0 A;  1SFE A;  2GWR A;  1BIB A;  2CG4 A;  1K78 A;  4MHG A;  1W5T A;  3R61 A;  1F5T A;  4IVN A;  3DKW A;  4MGR A;  5CJ9 A;  4HF0 A;  1IW7 F;  3KP4 A;  5ICE A;  2VON A;  3EET A;  5FLX Z;  1J9I A;  2G9W A;  3GZ6 A;  3WGG A;  4AIK A;  2Z9O A;  4G7H F;  1Z7U A;  2VE8 A;  2WV0 A;  4WWC A;  1U5T A;  4JQF A;  2P5L C;  2HFH A;  2XAH A;  4ASN A;  1JGS A;  4WF2 A;  4WCG A;  4F7Z A;  2VE9 A;  4N9I A;  4GYI A;  2RQP A;  3RYR A;  3DF8 A;  1VTN C;  5KVR A;  5D5X B;  2YSR A;  3FXR A;  3SQN A;  2R7F A;  1U3E M;  2J5O A;  3ZPL A;  2BEO A;  2JPC A;  2EFN A;  1PP8 F;  1DP7 P;  5D4S A;  5BPI A;  4AD9 A;  5J8C A;  2DK8 A;  4I01 A;  4RB1 A;  5JR3 A;  1P4W A;  1S6L A;  2BGC A;  2P8T A;  5FD6 A;  2NAZ A;  1R5G A;  1H9G A;  5AIP A;  1WSU A;  4AIJ A;  3WE3 A;  2IPQ X;  3E5Q A;  4BHB A;  4HQE A;  2VT3 A;  1O3T A;  1MJ9 A;  1UHM A;  3RTR A;  5DDG A;  4WXD A;  1Y0U A;  2FBI A;  5D6F A;  4YII A;  3L09 A;  4MTD A;  4HLX A;  4CZZ A;  3I71 A;  3BY6 A;  1R1T A;  2LKP A;  3JTH A;  4Q4Z F;  2Y75 A;  2DW4 A;  4BYY A;  2ZCW A;  2LF8 A;  2P6S A;  5ILS A;  1TW2 A;  4EMS A;  3CO7 C;  1S8N A;  5K5R A;  3WGI A;  5E1W A;  1I6X A;  3C3W A;  3E6M A;  5LBQ A;  1FBQ A;  1LQ1 A;  4EJW A;  3J81 Z;  3FMQ A;  1YW9 A;  3RIR A;  2ETH A;  2CO5 A;  1KQ0 A;  4RAY A;  1RI7 A;  4U0Y A;  2J5P A;  2FML A;  1R7J A;  3BJO A;  1T98 A;  1R36 A;  3KLO A;  1QPM A;  4IRG A;  3VFZ A;  1TNS A;  2WTE A;  2DBB A;  4WXC A;  3MQ0 A;  2YX4 A;  3HUG A;  1HKQ A;  1H0M A;  5L3F A;  1B4A A;  2P7V B;  2QUF A;  2OU2 A;  5HLG A;  1HQC A;  5FD5 A;  2O3F A;  2H94 A;  1R58 A;  4HOB A;  4IHS A;  2DK5 A;  5CLS A;  4RS8 A;  2QM3 A;  3G73 A;  2EB7 A;  5HVQ C;  2GAU A;  2HTS A;  1QO0 D;  2V1D A;  4M71 A;  2A61 A;  5LLQ A;  3K1M A;  3ABT A;  3DEU A;  1LDD A;  2X4H A;  2MLK A;  2IRF G;  1H9T A;  5JHU A;  1WQ2 A;  4KIB A;  3TDU C;  3JSO A;  4G94 A;  4P96 A;  4PGG A;  3O3K A;  1SD6 A;  1TLH B;  2GXG A;  4LG0 A;  1FSH A;  1BI3 A;  4EM1 A;  5CVV A;  1RNL A;  2FRH A;  3GLX A;  2EFO A;  4AWX B;  4RB2 C;  3BP8 A;  1BI1 A;  1U6G A;  3IL2 A;  3ZP5 A;  4ENM A;  3E6B A;  3FM3 A;  3Q9S A;  2OQR A;  5LEK A;  2W24 A;  1BM9 A;  1D3Y A;  4HX4 A;  4PZJ A;  1LJ9 A;  4EM0 B;  2ZJ2 A;  1ZN2 A;  2MC3 A;  3HHH A;  4RGS A;  4MNU A;  1IXR C;  2A68 F;  5CVI A;  3K69 A;  3JAM Z;  3J80 Z;  3QP6 A;  3GFJ A;  3TO9 A;  4EJO A;  4D0P A;  1SD5 A;  4M9Z A;  3KP5 A;  3TGN A;  3R60 A;  3SHF A;  2BYV E;  1KQ8 A;  2XKP A;  3R6S A;  3WU1 B;  3FMS A;  2NNN A;  3HRU A;  5LGU A;  5AON A;  2W25 A;  3IKV A;  5FFZ A;  4MEY F;  1XMK A;  1U5T B;  4CIC A;  3ECO A;  2XV4 S;  1G4D A;  2QZ8 A;  4LLL A;  5F6F A;  3F6V A;  5ED4 A;  3SZT A;  2CYY A;  2V6C A;  3ZMV A;  3LFK A;  2IA0 A;  4BH9 A;  2NNY A;  3ABU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...