5D4SA

Crystal structure of arar(dbd) in complex with operator orx1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arabinose metabolism transcriptional repressor
publication title Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
molecule tags Transcription/dna
total genus 21
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d4sA00
3VFZA 1I1GA 4LB6B 2OU2A 2ZKZA 5FD6A 1R1VA 3FX3A 1KA8A 1YFHA 3HHHA 1MD0A 3FXRA 3IKVA 1O7FA 3S2WA 1OYYA 4LFUA 4EQQA 2M87A 3TDUC 3FMSA 1LVAA 4ETSA 2PMHA 5D6FA 2X4HA 2ZBKA 4KIBA 4KYWA 1MDMB 1FPQA 4FHTA 2ZMEA 1JHHA 4KMUX 3WG9A 1WQ2A 2HYFA 2XASA 5D5VB 1SD4A 1YS6A 2G7UA 2XAHA 4LGWA 4EM0B 1B9NA 2NRAC 4RAYA 1WI9A 5A2QK 2GA1A 5LHGA 1FBQA 2IJLA 3C1DA 3F3XA 5DUKA 3D0SA 1IXSB 3J81K 4OIOF 4AIHA 1WKMA 1QZZA 2FNPA 4ZZLA 2KIMA 2HWVA 1V3FA 4O3MA 2DTRA 3M8EA 4HX8A 3WTWC 1FYKA 4ESBA 1XSXA 5L3FA 3DPTA 4M9XA 1SFUA 4LLGF 2M1BA 3HRTA 1LNWA 2XGXA 1XMAA 4A5NA 4ESFA 5CVRA 4M9SA 4Q5SF 1TQPA 3GLXA 4A6DA 4G7OF 1HKQA 2MLKA 3BY6A 4ENKA 1XGNA 3HRSA 1UHWA 1ONVA 2H94A 2P6TA 5JI6A 2KKOA 4TV7A 5CVIA 1Z05A 2D2WA 3C18A 1C0WA 2A61A 2VBYA 1FY7A 1Z9CA 1IXCA 2A5YB 4G9YA 2Q8KA 5FLXK 2P5LC 4IPAA 3SZTA 4U0VA 2D45A 2IA2A 4G7HF 3K2ZA 1S7OA 1XN7A 1HW1A 1BM9A 2HTSA 4A5MA 1Z7UA 3F8CA 3GUDA 4AIKA 1SAXA 3GFJA 3PFIA 1SMYF 2YR2A 4S05A 3QP6A 4IRGA 2EV5A 3GFMA 4HQEA 2F2EA 2IP2A 2ISZA 5FB2A 3FWEA 1TW3A 3M1EA 2LF7A 4L5JA 2K7LA 2VOOA 5AIPA 4R79A 5E8GA 4RB3C 5CYVA 3LQRA 1TBXA 3L7WA 4MQ9F 4BNCA 5H6RA 5BQTA 4G94A 5DUIA 1TTYA 4IRHA 2DO7A 1XCVA 1ZREA 2LF8A 4EJOA 1I6XA 2NYXA 4XSZF 3WTTC 1ULYA 3HYIA 2HQNA 2A07F 2XAQA 3E6MA 2Z33A 4GCVA 2FEZA 1BOAA 1FYMA 3HIFA 4HV5A 2CG4A 1B1BA 4YIFA 4FX0A 3KLNA 4R1HA 5BPDA 2HTJA 1P4XA 1O57A 5CVVA 3GYHX 3ML6A 3K1NA 4L9TA 2F5CA 1YTYA 3GFLA 1R36A 2ISYA 4Y15A 1SD5A 3IRQA 3RKWA 4OOIA 2A3SA 1R22A 1UFMA 4HQMA 5FFZA 5LEJA 2EFQA 3GWZA 2P5VA 3V7SA 1ODDA 3GEZA 2JRTA 5ICGA 2K02A 2MBFA 3SZPA 5K5OA 2DQRA 4L0YB 3O3KA 4FX4A 5J8CA 1UB9A 2PI0A 1L3LA 2W85A 4BAYA 3H92A 2OA4A 3R4KA 4CICA 4RB1A 3P9CA 1GXPA 2EJRA 3WE2A 4U88A 5L3BA 4HLXA 3JAMK 5IT9Z 4KA4A 3O2PE 4WXHA 2Q2EA 3KEQA 1LDDA 1XDSA 3KEOA 3V4GA 2BE5F 1O7LA 3WTVC 3WU1B 2RC4A 2KRFA 4ZZDA 4EJWA 5FGMA 4M72A 3HOSA 2HDCA 1U5TA 1P4WA 4RB0A 1QQIA 4U0WA 2OD5A 3F72A 4IXAA 3WGGA 3E6BA 3JTHA 2H09A 2J5OA 4IJAA 4M6XA 4HF0A 3NEUA 2HYGD 1ZGJA 4PZJA 5ILVA 1J75A 2VE8A 2RGVA 2QUFA 4P9FA 3RTRA 2STWA 3HRUA 3TOBA 3FM5A 4IHTA 4ZYHA 3V8KA 1G4DA 2DI3A 2LDUA 1KQ9A 2GZWA 5LGNA 2IPQX 4LJZF 2V1UA 2HKOA 3ZPLA 2PQ8A 4BHPA 5E8IA 1FC3A 1SMTA 3F8BA 2Z5UA 2P4WA 5LRRA 4RAZA 3EYYA 2W24A 5HLGA 3CUOA 2OQRA 3KLOA 4RB2C 4HDVA 3E6DA 3I59A 5DD4A 1TW2A 3Q5FA 1T6SA 1UHMA 1G3TA 1DDNA 4CDGA 5LBQA 4EVIA 3VODA 2EFNA 2V79A 3KZZA 4ENNA 3SFZA 4IRIA 2EB7A 1LDKB 3KP3A 1HW2A 2CWEA 1FNNA 3FMRA 3QP5A 2HZTA 4I0AA 1J0RA 1XGOA 5DDGA 2VBXA 1KU3A 3K0LA 4BH9A 1G3YA 1JGSA 1STZA 1T38A 1R5GA 2V6CA 4EV0A 3MCZA 2DPUA 1MKMA 1YG2A 2YSRA 4L18B 2Y0MA 5A2QZ 2D1HA 1ON1A 1S7AA 4GXOA 3T8TA 4HAMA 4CGZA 4BQAA 4KIGA 3WGIA 4Q47A 1NHAA 2FSWA 1FBSA 4RGSA 3IC7A 2V1DA 2UWMA 5ILSA 2O0YA 4PCQA 2Y75A 4HOBA 2M45A 1ZHFA 4G6QA 1Y0UA 3HTSB 3RPUA 1XGSA 1MGTA 1BI0A 3CTAA 2MD5A 2QVOA 3V7RA 4E70A 4XRFA 3R6SA 2C6YA 2HGCA 1EH7A 4FT8A 5D4RA 2QLZA 5CLSA 1K7AA 1U8RA 1JHFA 3E6CC 3U1DA 1P6RA 2Q0OA 4M73A 2JPBA 3MEXA 3ULQB 2VODA 3ROUA 4I0BA 4MQVA 3ABTA 4M9ZA 1OMIA 2E7XA 3I71A 3C3WA 3P7NA 4K2EA 3IKTA 1GVJA 3CJNA 4MEXF 2FE3A 1IN5A 2B0LA 1D8KA 2R7DA 1TQIA 2EK5A 3F8FA 4XSXF 1G3WA 4O5VA 1YW7A 2W25A 4D0PA 3J80K 5IT3A 2YX4A 5HS7A 3GXOA 1SD7A 1J5YA 2P8TA 2XV4S 2BEOA 3ZMSA 1WSUA 2FBIA 5FD5A 2TDXA 3WE3A 4ZYEA 4CYDA 3DV8A 1T98A 3ZN1A 2XHKA 5H6QA 4UHTA 4YIIA 2KJCA 1B9MA 4ENMA 5ICEA 2A68F 1S3JA 4KICA 3GFIA 2GA2A 4L9VA 1HSTA 3RJPA 3NRVA 1O3SA 1YIOA 3ZMDA 3F6VA 1VTNC 2VE9A 2M5WA 2MA3A 5E1WA 2QYOA 4ZH4F 2QZ8A 1ZLJA 5ILUA 3AAFA 2QQAA 2Y48A 3KP7A 5DCFA 2ZJ2A 1ZRFA 4B8XA 5D8LB 3DKWA 4A0YA 2NS0A 4Q48A 3B73A 4EM1A 1P92A 2P7CB 4B09A 2IRFG 2DLLA 2IT0A 1YW9A 4LK0F 1HXDA 2WV0A 2ZMEB 4P9UA 2G7HA 4BYYA 3RIRA 2WWYA 3P9IA 3V7CA 1F1ZA 1FZPB 5HLHA 2GXGA 1PDNC 4EJVA 5E18F 4HYEA 1KU9A 4KIFA 1O3QA 3L09A 2MC3A 3IRRA 2ESHA 1T39A 3DXJF 4A12A 2K86A 3WTUC 3WGHA 2EA4A 4AWXB 3ELKA 1IAWA 4MTEA 3F8NA 2P7VB 3J7AO 1WWXA 3FF5A 1B6AA 2GXBA 5L3CA 2RV8A 1I27A 2FMYA 4OINF 2OZ6A 3OOPA 1YQAA 5J6XA 5LEKA 1W7PA 2EFPA 1W4MA 5DD8A 2GIVA 5FO5A 3EDPA 4P96A 4WX9A 2VOPA 1GHCA 5D5UB 2STTA 3T0YA 4KFCA 4OIPF 2JZYA 4LMYA 6PAXA 1EV7A 2KIUA 2XROA 4EGYA 2KJBA 4WWCA 1BI1A 3RYPA 4M74A 4RGRA 3SHFA 2M30A 4HF2A 1KYZA 2HR3A 1J9IA 3TO6A 2XVCA 1DUXC 1QO0D 2PJPA 5AIQA 1JXSA 3ECHA 3MZYA 4ESJA 3G73A 1E17A 3CLOA 3HUGA 4KDPA 3LA3A 2L02A 3E97A 2FOKA 1LEBA 5F64A 5F6FA 3TO9A 2R3SA 1T2KA 4WF2A 2FNAA 3RPQA 2H6CA 2BGCA 1KYWA 2RNJA 3TDZC 3PQKA 3U2RA 5D6EA 2CSOA 2JTVA 3G3ZA 2QBYA 1IXRC 3E3VA 1IRFA 4ZYDA 3KCCA 3COAC 3K1PA 1SFXA 1FP2A 3CUQA 3WTXC 2GAUA 4ZYGA 3GX4X 2WTEA 2PG4A 4G6DA 5BPIA 1U3EM 2DK8A 2IVMA 3REOA 1G3SA 4EJTA 2QWWA 2LNBA 5HLIA 2VC0A 4UVAA 3HHGA 4LLNA 5D8KB 2EA2A 3H3ZA 4NQWA 5LHIA 2MLGA 4BXUA 1J59A 1S29A 5H20A 1Z1DA 1HBXG 1J2XA 1SD6A 3CO6C 2RN7A 4L0ZB 2CFXA 1KU7A 2EFWA 2H6BA 1Q1HA 5DCMA 4MHGA 3ZN0A 4AD9A 1FOKA 2E1NA 3IHUA 3QAHA 3F21A 1TNSA 2EFOA 2F5FA 4EM2A 5HDKA 2O61A 1RUOA 1IN6A 3SQNA 1RZ4A 3ZP5A 3GO5A 3T5XA 2K4JA 5JFRA 5DV5A 3TKYA 5HDNA 3WU0A 2JPCA 2UZKA 1OYWA 1YW8A 4G8XA 1Z6RA 1WRJA 5DYMA 2PMUA 3U9GA 2BV6A 1HQCA 5KVRA 1ZGAA 1KGSA 1O3TA 1AWCA 1V4RA 3LA7A 4JBAA 2COMA 3DFGA 2EWNA 4EMSA 4QLCU 2X0LA 2DU9A 1S6LA 2XAFA 2ZNZA 3SXYA 4MGRA 3RKYA 3MAJA 4H0EA 2WC2A 2QQ9A 4LD5A 1FLIA 1EH8A 4U0YA 3JSPA 4F7ZA 3IWZA 3IL2A 4QWQA 3QPTA 4U7DA 2BBYA 1KQ8A 4L5IA 1ZLKA 3RKXA 3BP8A 2ZXJA 3KETA 4Z2YA 1FSHA 4I7HA 2DT5A 3BWGA 4L9NA 3O6BB 2E7WA 2HEOA 2XAJA 3WTYC 1U5TB 2R7FA 3B02A 4HZFA 3BROA 4I98B 3OV8A 1MJBA 1MDMA 1U2WA 3BPXA 3WTZA 4N9IA 2Z3YA 2ZNYA 2D1VA 1Z91A 3HSRA 1XDUA 4BHBA 3TGNA 1XB4A 1BN5A 2L4MA 1KU2A 2F5EA 1R5HA 1XSVA 4PDKA 1H9TA 3HRMA 2VBWA 1TQMA 3J81Z 2O03A 4R8HA 5CVUA 4DNCA 3FM3A 1CGPA 3EETA 1OR7A 2OBPA 2FU4A 3LA2A 1ZG3A 4KNYA 3KP4A 2VONA 1ZRCA 2L54A 1B59A 2FMLA 1D3YA 5ERIA 1QZYA 4I2OA 3VEPA 5BMZA 1H0MA 1FSEA 2XIGA 5K1YA 2L3DA 4N9HA 3QPHA 3MFKA 3I59B 2JT1A 5E1XA 4KT5C 3RYRA 2HS5A 4WK8F 5J8FA 2BYVE 2MH9A 2QENA 4A0ZA 1YLFA 1U5TC 2FQ3A 5JVTA 2ACJA 1ON2A 3R61A 3F23A 1K78A 4CHUA 4N0BA 1AOYA 2H27A 3QU6A 5FLXZ 4GO1A 1JE8A 2W84A 5TRDA 4XLPF 5K5QA 2Z99A 3KZYA 3FXQA 5F1RA 5JHUA 3F22A 2HOEA 2CO5A 4BHCA 2ELHA 3N4MA 4Y13A 3LQQA 3LWFA 1HSJA 3ZMUA 2QM3A 2VC1A 1ZH5A 2K4BA 1HW5A 2FRHA 4ON0A 1R1UA 4MNUA 3L00A 5L3DA 2ZCWA 1ZN2A 3IWFA 5BOXA 1BI2A 1I5ZA 4CZZA 4I02A 1IW7F 2CGPA 2NNNA 3BJOA 1IRGA 1ZG1A 4XBFA 1ZG5A 4HA8A 2NNYA 2HQRA 2FBHA 2CW0F 2VT3A 3Q9VA 1IZ1A 5HS9A 1QPMA 3N97A 4P5OA 3QRFF 1FT9A 1ZAOA 3F6OA 1LDJA 3QU3A 4I09A 4YG2F 1YS7A 3MWMA 1P2FA 4ASNA 1TNTA 1R7JA 2XKOA 3I0TA 4HX7A 4PGHA 3BJAA 3HTUA 1FX7A 4NHJA 3E5QA 1W7PD 3FMQA 2PEXA 3KP6A 2DQLA 1R23A 1K79A 1DP7P 3KFWX 1O3RA 5E1ZB 1K78B 3DP7A 4G7ZF 4WXDA 4OMYA 5ICCA 2GWRA 5EEHA 2J5PA 3NQOA 1QGPA 3I64A 4UUVA 4KUMA 1R1TA 2QQBA 2EV6A 2G9WA 1RIOH 2FBKA 3QOPA 1TLHB 4MTDA 3LSTA 1R58A 3W6JB 4A0XA 5D4SA 3R0AA 2W57A 2DW4A 3GVAA 5L3EA 1L0OC 1QBJA 1XMKA 1I1SA 1YYVA 1OKRA 4WCGA 3GW2A 3ABUA 1B4AA 1BIAA 5FFXA 3CO7C 1MJ9A 4LLLA 3WODF 2UXNA 2A69F 3E5XA 5EEGA 1IN7A 5HDGA 3R60A 3ZQ7A 2E1CA 4OMZA 2PFBA 2VBZA 5AONA 3JAMZ 4KN7X 4HDUA 1FP1D 4HW0A 1FYLA 3K69A 4LB5A 1W5TA 3H3UA 3V8JA 3V8LA 1BC7C 1U78A 4A2UA 4RGXA 4PGGA 5LHHA 4UVBA 3LFKA 5TJJA 3JW4A 2DPDA 4KMFA 4JQFA 4RGUA 3L9FA 2P5KA 5LGUA 4MEYF 4LK1F 1A04A 3RDIA 4UV9A 5D5WB 3EQLF 4M6YA 2P6SA 2L01A 1PP8F 1K6OA 4YFKF 2MH2A 2CQKA 2A6EF 2PN6A 5K5RA 5ICFA 5CJ9A 1R00A 2RQPA 2PBIA 4YFXF 3KE2A 3ZMVA 3ZMTA 1FWZA 4EGZA 1BBYA 5HOOA 4CO8A 1MZBA 1MJAA 5HS8A 1E2XA 2RVCA 5KK1A 1BJAA 3MZHA 4HF1A 5LRSA 1LJ9A 2FXAA 4I01A 1P4AA 4AVPA 4HV6A 2V1XA 4KN4X 3ZMZA 2AS5F 1F9NA 1W5SA 3W6KB 3CDHA 3DQVC 1XSDA 5CVJA 1RI7A 2XKPA 4UNOA 3BDDA 1U6GA 3M7GA 2VT2A 2ESNA 1LEAA 3GZ5A 1DPUA 4O6JA 4IF4A 2IA0A 3GF2A 3I5UA 2EV0A 4Y17A 3BZ6A 1RNLA 2DFIA 4OIRF 1W7PB 4OIQF 3HSEA 2XAGA 2L4AA 2XRNA 4GYGA 3HOTA 4HLYA 1GXQA 3KP2A 3KP5A 1DPRA 2M8EA 5ED4A 3RI4A 2ADUA 4A6EA 2FA5A 3K1MA 3TOAA 4U7BA 2O3FA 4LG0A 1F4KA 1BI3A 1FBUA 3FHZA 3VOEA 3JTGA 4IHSA 1T0FA 3T1BA 3LAPA 4M71A 2KIFA 2XUBA 4RS8A 4DQ2A 3DPLC 2HKXA 3ISPA 1S8NA 2ETHA 2A6HF 1QNTA 4HBLA 3BJ6A 3P9KA 1EH6A 2IW5A 3I53A 3M9AA 4GGGA 1YO5C 1XGMA 4CXFA 1XD7A 2DAOA 3F8MA 3C7JA 1SFEA 2HFHA 4P55A 1PP7U 1ZARA 4OU0A 3I58A 5E20A 2O8XA 1CF7A 4HX4A 5D5XB 3ERED 1F5TA 5L3GA 2ZFWA 4ENJA 3BPVA 2K27A 2YX7A 1OYIA 2QBYB 3EYIA 3VB2A 3R0JA 2NAZA 1ZYRF 1J7KA 4JK1X 3CUQB 2O6GE 2F5DA 2OZUA 3WTSC 3TQNA 3I4PA 3HSFA 4S04A 3ECOA 5IT9K 1Z6TA 5E17F 1REPC 1USTA 4UVCA 4Q4ZF 2IA1A 1D5VA 3GZ6A 1BC8C 2AXLA 1IN4A 2VN2A 3DEUA 4AIJA 1X3UA 3I54A 1XCBA 3E5UA 1IN8A 2FF4A 3K9TA 2DK5A 3BOQA 1USSA 1D8JA 1IUYA 4GYIA 3Q9SA 1HKTA 1OPCA 3J80Z 3DF8A 4LG0B 2CYYA 4NB5A 1UCRA 3M8FA 4UXNA 3FXUA 4WXCA 1LB2A 1HKSA 2YPRA 5DCMB 1G6NA 3JSOA 5BS6A 4IVNA 2Z9OA 3L2CA 1BIBA 1ZRDA 2OAZA 4XLNF 2GQQA 5LGTA 2RDPA 2LSOA 2DBBA 2LKPA 1KQ0A 2VXZA 2V9VA 4UV8A 2RKHA 3EUHA 3MQ0A 5DEQA 1CF7B 3CUQC 4YFNF 3PQJA 3FZVA 4EJUA 2YU3A 3TO7A 1RUNA 3D5LA 1H9GA 2ZO4A 2PLYA 2UXXA 1IF1A 5HVQC 5JR3A 1PUEE 3T8RA 5LLQA 2JSCA 3LAJA 1LQ1A 4L9JA 2OQGA
chains in the Genus database with same CATH superfamily
1BR1A 3VFZA 5IY5H 1I1GA 3W2WA 1X1CA 1IV6A 5CKTA 4B4CA 2HVSA 3S16J 4LB6B 1WJDA 1A6QA 2OU2A 2ZFUA 2ZKZA 5FD6A 1R1VA 3FX3A 2KRCA 1KA8A 1YFHA 2TCTA 3HHHA 1MD0A 1WCMJ 3FXRA 3IKVA 1O7FA 3S2WA 1JJ8C 3KIOA 4N4NB 2L7KA 1OYYA 4MO7A 3ESWB 2MSYA 4LFUA 4EQQA 3KX2A 1V54H 1K83J 1UAAA 2M87A 3TDUC 1SAUA 5FKOA 1D0YA 3FMSA 4DOZA 2CW8A 4M3GA 4ANJA 1LVAA 2HU9A 4ETSA 2PMHA 1AKHB 3QPSA 1D0XA 5D6FA 1WJBA 3SJMA 4E7KA 2X4HA 2ZBKA 4KIBA 4KYWA 1JUSA 1MDMB 1FPQA 2ME0A 4FHTA 1MBFA 3SDGA 2ZMEA 2XPVA 2JA8J 1JHHA 4KMUX 3WG9A 2XGDA 2OCEA 1WQ2A 5GAHJ 2HYFA 4F93B 3EPZA 2XASA 4EEFG 5D5VB 2Y31A 5LD2C 1SD4A 4HEA2 1YS6A 3HBLA 4BS9A 2G7UA 2JA5J 5CQEA 1B8IA 2XAHA 4LGWA 4EM0B 1B9NA 1Z0XA 3QWLA 4RAYA 2NRAC 1WI9A 4D9JA 4AVZA 5A2QK 2XGCA 2GA1A 3CDLA 2JSPA 1OCTC 2BXYA 5LHGA 2VJJA 1FBQA 5J40A 1X3WB 2IJLA 5EGOA 4DZPA 3LSHA 3C1DA 3F3XA 4Z6YA 4BXFA 3DPUA 4BDZA 5DUKA 3D0SA 1IXSB 3J81K 3M07A 4G6TB 1ORKA 4OIOF 4YIRX 4AIHA 1JKQC 4OWRB 2WY8Q 1WKMA 1QZZA 2FNPA 2R7QA 2CV2A 2ECBA 3BTJA 4ZZLA 2KIMA 4XR6A 4UUSA 2HWVA 1V3FA 4O3MA 1A31A 3C2GA 3PSIA 2DTRA 3M8EA 3HPGA 4JP0A 1OCPA 2BXZA 4F3QA 4HX8A 3K10A 1VQNI 3CCQI 3WTWC 1FYKA 5C4JJ 3CJTB 4ITVA 4YEJA 2DTZA 3A01B 3FKJA 3HDDA 2K40A 4ESBA 3OSFA 1XSXA 5L3FA 3DPTA 1W0TA 4M9XA 3JR9A 1X2NA 3PFYA 1SFUA 1GV2A 4LLGF 2M1BA 2EPFA 3HRTA 3ASNH 1LNWA 3K2AA 4IKFA 2XGXA 1XMAA 2P81A 4A5NA 3VDXA 1YJ9I 4HNVA 5B66C 1WJFA 4ESFA 1QA6A 5CVRA 4M9SA 4Q5SF 1TQPA 4NDLA 3GLXA 3Q0VA 3AG4H 2VJ4A 1IUFA 4A6DA 4G7OF 3S3OA 5KAIC 1HKQA 1FMVA 3H9JA 3G1LA 2MLKA 3BY6A 4ENKA 1U8BA 1XGNA 1UG2A 3HRSA 1UHWA 1ONVA 2H94A 3JRFA 2P6TA 5JI6A 2KISA 1TT0A 2KKOA 2LOOA 4TV7A 3RCOA 5CVIA 1Z05A 4I99C 2HVQA 2ZXIA 2D2WA 3BQZA 3C18A 1C0WA 4C2UA 2R7WA 2A61A 2VBYA 2E1MB 1FY7A 1Z9CA 3OS1A 2K9QA 2DCEA 4RMNA 1IXCA 4P1WA 3AG3H 1BR2A 2R7RA 2A5YB 2R4GA 2VQHA 4G9YA 1E3HA 2Q8KA 5FLXK 2P5LC 4IPAA 1MNMC 4HNTA 3SZTA 3S1RJ 1XTAA 1UZCA 3S1NJ 4U0VA 3S17J 2D45A 3IV5A 2IA2A 4G7HF 3K2ZA 2LLKA 3BG7A 2KT0A 2X1CA 2HOSA 1OR7C 1VQLI 1S7OA 1XN7A 1HW1A 1BM9A 3K4JA 2HTSA 1ITYA 4A5MA 2EZHA 1Z7UA 3H1CA 3F8CA 2LVSA 2NS7A 1B8IB 3GUDA 2VUMJ 3K7AJ 1QZEA 4AIKA 1SAXA 3GFJA 3PFIA 2HYJA 4BJ6C 3K4CA 3EUAA 3A0BC 1SMYF 4BL0B 2YR2A 4S05A 3QP6A 1HCRA 4IRGA 2XC7A 5F1JA 2EV5A 5E79C 2V1NA 2F4IA 3GFMA 1PYVA 4HQEA 2F2EA 2IP2A 2ISZA 1YITI 5FB2A 3FWEA 1TW3A 3K6GA 2KPMA 3DU5A 2VB6A 3M1EA 5DTDA 2LF7A 4L5JA 2K7LA 4DYCA 4OAYA 4A3BJ 3I56I 1RKTA 2VOOA 5AIPA 4R79A 5E8GA 4RB3C 5CYVA 3PL8A 5IP9J 3LQRA 1TBXA 3L7WA 3RKQA 4BY1J 4MQ9F 4UUSB 4YELA 4UUTA 4BNCA 2CQ7A 5H6RA 5BQTA 4G94A 5DUIA 1TTYA 3VYSB 1MNEA 4IRHA 2DO7A 1XCVA 2DOEA 1WJEA 3M1CA 3OY9A 1NTCA 3Q0WA 2LFBA 2LYCA 3HGYA 1IDZA 4AC0A 1ZREA 2LF8A 4EJOA 2LD5A 1I6XA 2NYXA 4XSZF 3WTTC 1ULYA 1N78A 3MKWB 2XDVA 3HYIA 2N8GA 2XSDC 1V55H 1M1EB 2HQNA 3X2QH 2E1MC 3IH3A 2A07F 3OYIA 4AM3A 3TW7A 2XAQA 3E6MA 2Z33A 4M6VA 2CUZA 1WGXA 5M5YJ 2G0EA 4GCVA 4XRMA 2FEZA 1BOAA 3WHCA 2FUG2 4CCOA 1JTXA 5CQGA 1FYMA 2LRDA 2KQRA 3HIFA 4BQOA 4HV5A 1BW5A 2CG4A 3MN2A 2JMWA 1B1BA 4YIFA 4FX0A 3KLNA 4R1HA 3ZQLA 1BJZA 2NXNB 2JUGA 5BPDA 2HTJA 1P4XA 1O57A 2DODA 5CVVA 4F55A 4XRSG 3GYHX 2DA2A 1HA8A 3F0CA 1YI2I 3ML6A 1R6RA 2JVGA 1D0ZA 3FHNA 3K1NA 4IEJA 4A3EJ 3HOZJ 4L9TA 1X1PA 1V5FA 2F5CA 1YTYA 3GFLA 2KZGA 1R36A 1OISA 2DT7B 2ISYA 4Y15A 1SD5A 3OIOA 3IRQA 4PFOA 3RKWA 2Y0SA 2VASA 4HPQA 4OOIA 4V2GA 2A3SA 1GDTA 1R22A 1UFMA 1LFPA 1MMSA 2Y0SN 1WHUA 4HQMA 5FFZA 4BE1A 3PNTA 5LEJA 1ZKGA 2EFQA 2HPIA 3GWZA 2AQEA 4A3GJ 2P5VA 3IAM2 2E2IJ 1YRNA 3V7SA 3IUOA 1ODDA 3GEZA 2JRTA 5ICGA 2K02A 3IAS2 2MBFA 3SZPA 1POGA 2MGQA 5K5OA 2DQRA 3SZGA 4L0YB 3O3KA 4FX4A 3QODA 5J8CA 1UB9A 4PK4A 2PI0A 1L3LA 3CC2I 4IHYA 9ANTA 2W85A 2LR8A 1Z7LA 4BAYA 3H92A 1JUPA 2OA4A 3R4KA 4CICA 4RB1A 3P9CA 4XLAA 1GXPA 3FK7A 2EJRA 2O5RA 3SFIA 1BR4A 3WE2A 4U88A 5L3BA 4HLXA 5JHFA 2HQAA 3JAMK 4FETA 3GTJJ 1VQ7I 5IT9Z 4KA4A 4XORA 1SVOA 2R7TA 3O2PE 4WXHA 2Q2EA 3KEQA 1LDDA 1XDSA 3KEOA 5J4YA 3V4GA 1R9TJ 1VI0A 5M3MJ 2XSJC 1DP3A 2BE5F 2X51A 5HNFA 1O7LA 3WTVC 3WU1B 5FKMA 1YX5A 3H5AA 2M4KA 1R49A 2RC4A 2KRFA 4ZZDA 4BKXA 2VL8A 4EJWA 5FGMA 4M72A 2K9NA 5CPRB 2DMNA 4KITB 1F43A 3HOSA 2JVHA 1N77A 2M0CA 4PSXA 2HDCA 3DWLE 2VQLA 2KHMA 1U5TA 1RR7A 3DKXA 2MABA 1P4WA 3JRGA 5FLVA 4RB0A 2LMDA 1QQIA 4BEHA 2DA7A 4U0WA 3A03A 1MBJA 2OD5A 1F36A 2LY1A 3F72A 4IXAA 3WGGA 1BW6A 4DIQA 3E6BA 4NC8A 4IQ4A 2LK2A 2EZIA 1K4SA 3JTHA 2H09A 5E3NA 2NVQJ 2O8KA 5B3SH 2J5OA 4I6ZA 4IJAA 4M6XA 4HF0A 5FRMA 3NEUA 1RKWA 2RQQA 3FIWA 4II3A 2HYGD 1ZGJA 4PZJA 5ILVA 1QVTA 2W7NA 1J75A 1MNDA 3S1QJ 5C44J 2VE8A 2GOMA 3NARA 2RGVA 3JRCA 2CQNA 2QUFA 4P9FA 4RA2A 3RTRA 2STWA 3HRUA 4IQJA 3TOBA 3FM5A 4IHWA 4C3IJ 4IHTA 2BY3A 4ZYHA 3V8KA 2IAIA 3FBIB 1G4DA 2BW3A 4CYCA 2I5UA 1GT0C 2DI3A 2I8DA 2LDUA 5FKKA 1KQ9A 1IV8A 1N25A 2GZWA 5LGNA 2IPQX 2M34A 1X2MA 4LJZF 1D1BA 2GXAA 2V1UA 2HKOA 3IH2A 2ZJQF 3ZPLA 2PQ8A 1RC9A 2KP6A 4BHPA 5E8IA 1FC3A 1SMTA 1SFKA 3F8BA 2Z5UA 1UELB 4Y33A 4A93J 2P4WA 5LRRA 4MIMA 2HOTA 1H89C 4RAZA 3EYYA 2HPMA 2W24A 5EZHA 3CUOA 3SYTA 2OQRA 3KLOA 5HLGA 4RB2C 3A2KA 4HDVA 4Y4RA 2XB5A 3E6DA 3CCYA 3L2WA 3BR6A 3I59A 5DD4A 1TW2A 3Q5FA 3RSNA 4A3IJ 1T6SA 1UHMA 1G3TA 2LH9A 1WH5A 1DDNA 4M3BA 4CDGA 1JKPC 2A6TA 5LBQA 4EVIA 3ZQHA 2EBIA 3VODA 2EFNA 3S93A 5E3LA 2V79A 3LMMA 3KZZA 2JUCA 2KDOA 4ENNA 1R4MB 1SVMA 5DM7F 2WB1A 3SFZA 4IRIA 3QPLA 1KZHA 2EB7A 1DU0A 1K6YA 1LDKB 2ID6A 3KP3A 4A69C 5FKLA 2F5VA 2KLOA 1HW2A 2CWEA 3J7YJ 2WAEA 3GTQJ 3NWSA 2R7XA 1FNNA 1K61A 2A5WA 3FMRA 3QP5A 2HZTA 4CCMA 4I0AA 3BG9A 1J0RA 1XGOA 1PUFA 3FXKA 5DDGA 2VBXA 2R5ZA 1KU3A 1RRJA 3TP0A 3K0LA 1LPQA 4BH9A 3LSPA 1WJ5A 2Z16A 2XAUA 4AU7A 1G3YA 4CZCA 3HZJA 1HDDC 3OIPA 1A6IA 1JGSA 1STZA 1T38A 2K3FA 3BCBA 1R5GA 4BEHB 1QPIA 2V6CA 4EV0A 3MCZA 1UMQA 1E3PA 2DPUA 2H8WA 3ABMH 1MKMA 1YG2A 2YSRA 1ETXA 4L18B 2Y0MA 3PUFA 5A2QZ 2D1HA 3ABKH 1ON1A 1S7AA 3HEFA 4GXOA 5B1AH 1A36A 3T8TA 2DFHA 4HAMA 4CGZA 4BQAA 1ERDA 2WAQN 1DGWY 1ACIA 2BZTA 2F6CA 4IHVA 3BT9A 3K4MA 2OC6A 3HOWJ 2R5YA 2QKMB 4D5FA 4KIGA 4E6KG 3WGIA 4Q47A 4BE0A 2E2HJ 3H9GA 5J1RA 1NHAA 2VPLA 2FSWA 1FBSA 4RGSA 2KIQA 3IC7A 5J4VA 1WJAA 3DTEA 1FEXA 2V1DA 2UWMA 5ILSA 2O0YA 1OCCH 4PCQA 2Y75A 1IG7A 4HOBA 2O7OA 4LIUA 2M45A 1ZHFA 4G6QA 1Y0UA 3H9QA 4A3FJ 3HTSB 3RPUA 3UKGA 1XGSA 1MGTA 2DT6A 1BI0A 2YUSA 3CTAA 3LSRA 3S3NA 2MD5A 2QVOA 5LFAA 3V7RA 4E70A 2ZXWH 4XRFA 1LFBA 4LOCA 3R6SA 2JK3A 2C6YA 1HDPA 2HGCA 3HOYJ 1EH7A 5M5XJ 3AFHA 4FT8A 5D4RA 3AG2H 2K9LA 2QLZA 5CLSA 1U8RA 5GADJ 2LC2A 1K7AA 1ETYA 4BJ5C 1JHFA 3E6CC 3A4CA 3U1DA 5E3MA 1W1WE 2V7FA 1P6RA 2COBA 3GLLA 2X1DA 3B6CA 3TP3A 1RESA 4MFDA 4E4HA 1OCZH 4ZDPA 2Q0OA 5EG0A 4M73A 1S5LC 2JPBA 3MEXA 3ULQB 1T0FC 2Y9ZA 2K3PA 3OYEA 2FJ1A 2VODA 4S0HB 3ROUA 3RQ4A 4I0BA 4MQVA 3ABTA 4M9ZA 4XLEA 1OMIA 3DTIA 1ZELA 1ZK8A 2E7XA 2F48A 3I71A 3OS2A 3C3WA 3P7NA 4K2EA 2DYSH 5IP7J 3IKTA 1GVJA 1MW7A 3D5RC 1ETVA 3CJNA 4MEXF 2FE3A 1IN5A 2B0LA 1YX3A 1D8KA 2R7DA 1TQIA 2DA4A 2EK5A 2ZXHA 3F8FA 4XSXF 2X48A 2R5ZB 1XPXA 1HLVA 1G3WA 4B43A 4O5VA 3K4LA 2E1OA 1YW7A 1HC8A 1QRYA 2W25A 3LSKA 1JI8A 4A3MJ 2F4MB 4D0PA 2M7AA 3J80K 5IT3A 2YX4A 5HS7A 1TWCJ 3GMEA 3GXOA 4HNUA 1SD7A 1EJ9A 1J5YA 2P8TA 2XV4S 1Y0NA 2BEOA 3ZMSA 1WSUA 2FBIA 5FD5A 2TDXA 3DBLB 1WPKA 3H0DA 1N75A 3WE3A 4CSWA 4E7SA 1TWFJ 4ZYEA 4CYDA 2LG4A 3DV8A 1T98A 3ZN1A 2XHKA 5E3OA 5H6QA 4UHTA 4YIIA 4D7NA 2DMQA 2KJCA 1B9MA 2X6YA 4ENMA 2CV1A 2DMUA 4XLCA 3CCJI 4XKBA 2CU7A 2A68F 5ICEA 1S3JA 3RQIA 4A3DJ 2DN0A 3C2HA 3OOUA 4KICA 4PJNA 2JA2A 2GA2A 4L9VA 3GFIA 3GTKJ 3OYNA 1O4XA 1HSTA 4RLQA 5F08A 3RJPA 3NRVA 3CC7I 3BCAA 1O3SA 1YIOA 1ZR4A 1G59A 3S2DJ 3ZMDA 4UB8C 3TBIA 2V26A 4XL9A 2BY1A 3F6VA 1VTNC 5EJCA 2VE9A 3QOEA 3BR0A 2Y30A 2M5WA 2MA3A 3I55I 3F9KA 2IS2A 2HOAA 3BZKA 3OYAA 5E1WA 2QYOA 2Y9YA 1MBGA 4BBSJ 4ZH4F 2QZ8A 4CCJA 1ZLJA 2WADA 5ILUA 3AAFA 2QQAA 2Y48A 1QU3A 1PVEA 3KP7A 2VKVA 5IYBJ 2UUZA 4MLOA 4BDYA 5DCFA 2ZJ2A 1ZRFA 4B8XA 5D8LB 1Y6IA 3DKWA 4A0YA 5EG0B 2L9RA 2NS0A 2XF7A 2DMPA 1Y1WJ 4C30A 1FOXA 4Q48A 2IGKA 3B73A 5J1UA 4EM1A 1P92A 2MW8A 2P7CB 1DU6A 4B09A 3EUKL 3D1NI 1T95A 2IRFG 5EZGA 1SANA 2DLLA 2L9VA 2DOFA 1AA7A 1U9NA 2IT0A 1YW9A 1Z3XA 1IJWC 4LK0F 1HXDA 2WV0A 2ZMEB 4P9UA 1WH7A 2GLOA 1XS9A 2G7HA 4BYYA 2EIMH 2E60A 1RR8C 3RIRA 2WWYA 3P9IA 3V7CA 1F1ZA 1FZPB 5HLHA 4KJZA 2GXGA 2MC4A 1PDNC 4EJVA 3TW6A 4HYEA 5E18F 2R93J 2NOJB 1H8AC 3G1MA 1ETQA 1KU9A 3EUHC 4KIFA 2IGOA 2DA3A 2Y69H 2X9DA 4RAGA 3L09A 1O3QA 3UR3C 2MC3A 3BR5A 3IRRA 2ESHA 2GIZA 4X0GA 1T39A 3BC8A 3DXJF 2CW7A 5EGOB 2KFDA 1BA5A 2QF7A 2DFFA 4A12A 3BG5A 2K86A 3WTUC 3WGHA 2EA4A 4AWXB 3G1OA 1U0JA 2K5CA 3ELKA 3MKLA 1IAWA 1LFUP 2EILH 4MTEA 1X58A 2LY9A 2W48A 3F8NA 3QYBA 2P7VB 5KHDA 3J7AO 4BBRJ 2R7UA 3L2UA 2IBDA 1WWXA 3FF5A 2H1LA 3MMYB 1B6AA 1MH3A 2GXBA 5L3CA 2R7SA 2RV8A 1V5EA 1XG1A 4XM3A 1I27A 2FMYA 4OINF 3VWBA 2OZ6A 2ZJPF 1UJ8A 3BZCA 4BUPA 4BACA 3OOPA 5IP6A 4L5EA 4BXXJ 1YQAA 1U9OA 2R92J 5J6XA 2OTLI 1ETOA 5LEKA 4JX4A 5F0HA 1W7PA 1OCOH 2EFPA 1W4MA 5DD8A 2OF7A 3PO2J 2GIVA 5FO5A 4N4OB 3EDPA 3LNQA 4P96A 1RETA 4WX9A 4XMYA 2VOPA 1GHCA 4H4KC 5D5UB 2VJIA 3DLAA 3T0YA 2STTA 4KFCA 1JUMA 1VQ8I 1MMAA 2QKLB 4C9YA 4OIPF 2JZYA 2M7BA 1YJNI 4LMYA 6PAXA 1EV7A 2KIUA 3HL2A 3KYCB 4IX7A 3BG6A 2XROA 3GTGJ 2ZMEC 5C4XJ 4EGYA 2KJBA 4WWCA 1BI1A 3RYPA 5M5WJ 1BL0A 4M74A 4RGRA 2LKXA 2K9SA 3SHFA 2M30A 5FRNA 2DDAA 4HF2A 5J1YA 3CF5F 4G12A 3U1KA 2L0KA 1KYZA 3VYUB 4D5CA 4XONA 2HR3A 4BJTA 3TO6A 1J9IA 2XVCA 1DUXC 1QO0D 2LY2A 3PIPF 2PJPA 2IS4A 4KISA 1LQ1A 4E7LA 2VI6A 3QYFA 2X6OA 3SEQA 5AIQA 1JT0A 1JXSA 4ZC3A 3ECHA 4X6AJ 3MZYA 4ZDOA 3ZXSA 4ESJA 3G73A 1E17A 3CLOA 3C2BA 2E71A 2HI3A 3OYLA 3HUGA 2BHZA 4CCNA 4KDPA 3LA3A 2I10A 1JT6A 2L02A 2FOKA 3E97A 5BNGA 1LEBA 2K85A 2M8GX 1YJWI 5F64A 5F6FA 4XIDA 3WHBA 3TO9A 5FJ8J 2R3SA 1SVLA 2CJJA 1T2KA 3I4NJ 4WF2A 2FNAA 3RPQA 1YE9A 2H6CA 4B3AA 1TT5B 1XX5A 2BGCA 1KYWA 4GFBA 2DA5A 2RNJA 4FQGA 4AIDA 3TDZC 3PQKA 1VQ4I 3U2RA 5D6EA 4OAZA 2CSOA 2JTVA 3G3ZA 5KCMA 2QBYA 2FQ4A 3HJEA 1IXRC 3E3VA 3RZOJ 1IRFA 4ZYDA 3KCCA 4XLFA 2PMZN 3JRBA 3COAC 4NBQA 3K1PA 1SFXA 1VQ6I 1FP2A 3CUQA 1SEUA 2XF6A 4F52A 3ASOH 3WTXC 3FKIJ 4F92B 4M3FA 5B1BH 2GAUA 4ZYGA 3CJRB 4ZJZA 2WTEA 2PG4A 4G6DA 3GX4X 5BPIA 1U3EM 2DK8A 2IVMA 3REOA 1G3SA 4EJTA 2QWWA 3HGGA 2LNBA 4NC7A 5HLIA 2VC0A 3HG9A 3ZQQA 2ICWG 4JX5A 4UVAA 3HHGA 4LLNA 5D8KB 2EA2A 3H3ZA 3Q0UA 3PO3J 2QCOA 2QSFX 2OV7A 1S72I 4NQWA 4I76A 3LSGA 1IGNA 4XKVA 3NWTA 2MLGA 3CDIA 5LHIA 4BXUA 1J59A 1S29A 1T56A 4BQNA 2W1OA 1FJLA 5H20A 1Z1DA 1HBXG 5F27A 1J2XA 2WY7Q 3BQYA 1ETKA 3ZQIA 1SD6A 3CO6C 1HOMA 1YIJI 3KEYA 4JOMA 2RN7A 1TC3C 4RM3A 4XOTA 3VSKA 4L0ZB 1WJCA 2CFXA 2M3AA 1KU7A 2EFWA 2EH3A 2H6BA 1Q1HA 5DCMA 3CCEI 4MHGA 3ZN0A 4AD9A 3OS0A 1FOKA 1B72A 4IOAF 2E1NA 3IHUA 3QAHA 3F21A 3K70C 4NUBA 2CMPA 3BR2A 1TNSA 2EFOA 2F5FA 4EM2A 5HDKA 2O61A 1X19A 4LIVA 4XICA 1RUOA 2DFEA 3HXLA 2IS6A 1IN6A 3A02A 3SQNA 1RZ4A 4HSTA 3I3LA 4QTRA 3ZP5A 3GO5A 2JWTA 3HUGB 2XPUA 3ONQA 2K4JA 3T5XA 2L5QA 4A3LJ 1NG6A 5JFRA 1ZQ3P 5DV5A 2JRMA 3K4KA 1YRNB 3TKYA 2XB0X 5HDNA 3HKZN 2HXIA 3WU0A 2JPCA 3Q3SA 2UZKA 1OYWA 1YW8A 4G8XA 1P7IA 1Z6RA 1WRJA 5HLTA 4CCKA 5DYMA 5C3EJ 1EF4A 2PMUA 3U9GA 2BV6A 3CMMA 3FXMA 1HQCA 5KVRA 1ZGAA 1KGSA 1O3TA 1Y1VJ 1AWCA 1V4RA 3LA7A 4JBAA 2COMA 3DFGA 1MBKA 2EWNA 2V4JC 5IPAA 3N05A 4EMSA 2VKDA 1WI3A 3DEWA 2CUFA 2X0LA 2DU9A 1S6LA 2XAFA 2ZNZA 3FXOA 3V42A 1S9HA 2R0QC 1FIPA 3RPUD 4MGRA 3SXYA 2WV1A 3AG1H 2Q2EB 4CCLA 3RKYA 3MAJA 4H0EA 2WC2A 2QQ9A 4LD5A 1FLIA 1EH8A 4U0YA 3JSPA 3KZIC 1D1CA 4F7ZA 3IWZA 3IL2A 2XGEA 4QWQA 1JGGA 2M0MA 3QPTA 4U7DA 2BBYA 1KQ8A 4L5IA 3CMYA 1ZLKA 3FK6A 3RKXA 3BP8A 5B5EC 1DQUA 2ZXJA 3KETA 4Z2YA 3DTKA 1FSHA 4I7HA 4XNFA 2W82A 3GBGA 2B63J 2DT5A 3BWGA 4L9NA 2FOWA 1IDYA 3O6BB 2D5VA 2E7WA 4UB6C 2HEOA 1H88C 2XAJA 3WTYC 2ELKA 1U5TB 2R7FA 3B02A 4HZFA 3BROA 1LUJB 4I98B 3OYDA 1HF0A 2VPRA 3OV8A 1R4NB 4ZTJA 5GPAA 1MJBA 2YU9J 2NS8A 1MDMA 1U2WA 2RNGA 3DCFA 3HPHA 3KYLA 3BPXA 3S8PA 3OSGA 3WTZA 4N9IA 2Z3YA 2HVRA 2M2EA 5TGTA 2ZNYA 1MBHA 2RAEA 2D1VA 1IRZA 2WAQA 1Z91A 4FASD 3HSRA 4RBOA 1XDUA 4BHBA 3TGNA 1QVUA 1XB4A 1BN5A 3ZGKA 1QHHD 4XRSA 3H5NA 2L4MA 1ZGWA 1Y8QB 2PX9A 2FX0A 4LITA 1B72B 1MSFC 1KU2A 2F5EA 1R5HA 4A3CJ 1XSVA 4PDKA 1H9TA 3HRMA 2VBWA 1TQMA 3J81Z 3CCSI 2LP0A 2O03A 1TZLA 4R8HA 1TL8A 1Q1VA 5CVUA 4DNCA 3CQZJ 3HOUJ 3FM3A 2BW3B 4DZJA 3SEZA 4CYCB 1CGPA 3EETA 1OR7A 1UG0A 2OBPA 3HOVJ 3BTIA 2FU4A 1LKXA 1VQPI 3GTOJ 2KRHA 2M4GA 4UY8I 3LA2A 4DW6A 1X4OA 3MVPA 1BOBA 1ZG3A 3ZQFA 3HC7A 5K7ZA 2QGUA 3GZNB 4LG3A 4KNYA 3KP4A 2VONA 1ZRCA 2L54A 1B59A 1VNDA 2FMLA 1D3YA 5ERIA 1QZYA 4Y3OA 4I2OA 3VEPA 5BMZA 1PJRA 1H0MA 5GPCA 1FSEA 4W1UA 2XIGA 5K1YA 2L3DA 4N9HA 3QPHA 3MFKA 3I59B 2JT1A 5E1XA 4KT5C 3G71I 1KONA 2IGNA 1MH4A 2CS3A 4X1EA 3RYRA 3M8JA 5F04A 2HS5A 1VQOI 4WK8F 5FKNA 3CD6I 2X6WA 4HG2A 4J00A 5J8FA 4PJLA 2FD5A 5GP9A 5J47A 2BOLA 2Y2ZA 3CLQA 3J7ZI 2BYVE 2MH9A 1YHQI 2QENA 3E1SA 4A0ZA 2P0WA 1YLFA 1U5TC 1Z77A 2FQ3A 5JVTA 5GTHC 2ACJA 1ON2A 4B47A 3R61A 2JQ7A 3H3VK 1FIAA 3F23A 4IOCF 1K78A 4CHUA 3E7LA 4N0BA 4CUGA 2BHYA 2MYSA 1AOYA 2H27A 3FBNB 3QU6A 3ZCOA 4QPOA 5FLXZ 4GO1A 3W2AA 1JE8A 2V6EA 2W84A 3GCMA 5TRDA 4XLPF 5K5QA 1PUFB 2Z99A 1CQTA 2X1EA 2BVMA 3FXQA 3KZYA 5F1RA 2DJIA 5JHUA 3F22A 1ETWA 3PSFA 3ZRGA 2HOEA 2KMUA 2CO5A 4BHCA 3J7AY 2ELHA 3PUBA 3N4MA 4Y13A 1P7JA 3LQQA 3LWFA 1HSJA 3ZMUA 3PJRA 2QM3A 4ABZA 1IC8A 1NK2P 2VC1A 1ZH5A 2K4BA 1HW5A 3BTLA 3JRIA 3CMAI 2CQXA 2FRHA 4ON0A 3K4BA 3ERMA 3CP8A 1R1UA 4MNUA 3L00A 5L3DA 3G6EI 1T33A 3DLLF 1Z67A 1ZN2A 2ZCWA 5H2FC 3IWFA 1EA3A 5BOXA 1BI2A 1I5ZA 1SC7A 3LSIA 4CZZA 4I02A 1IW7F 4U87A 2R5YB 3ZQGA 2CGPA 3BTCA 3PNYA 3W3CA 1UHSA 3L2VA 1FTTA 2NNNA 4KT6A 3K70D 4XQFA 3BJOA 1IRGA 1ZG1A 4XBFA 3JCUC 1ZG5A 4BQQA 4HA8A 2NNYA 2HQRA 2FBHA 2CW0F 2VT3A 2EIKH 3O8HA 3Q9VA 1IZ1A 3E0JB 5HS9A 3OR2C 1QPMA 2RREA 3N97A 4P5OA 1D5YA 3QRFF 4C3HJ 1FT9A 2VXDA 5JVGF 3FXLA 1ZAOA 2WA0A 2W4SA 3H36A 1FOWA 3F6OA 1LDJA 3QU3A 5KNLA 4I09A 4QSHA 4YG2F 1YS7A 2DMTA 2E36A 3MWMA 3IP4B 1P2FA 4ASNA 1TNTA 1R7JA 4FCYA 3VYTB 1OQYA 2XKOA 4XLHA 2IS1A 3I0TA 4A3KJ 1VQKI 4QPQA 2JN6A 4HX7A 4PGHA 4DBQA 3BJAA 3HTUA 1TWGJ 3TEDA 1FX7A 4RM2A 4FISA 3MD2A 4NHJA 3E5QA 3VSLA 2PJRA 2NVTJ 2KL4A 5IOZA 1W7PD 3FMQA 2PEXA 3KP6A 2V9KA 2E35A 2DQLA 5FLMJ 3P5JA 3H0GJ 1R23A 1T8IA 1K79A 1DP7P 3KFWX 3LSJA 1O3RA 5E1ZB 3I4MJ 3DKYA 1K78B 3DP7A 4G7ZF 4WXDA 4OMYA 1DGRM 5ICCA 2GWRA 2ME6A 4CA0A 1YOVB 5EEHA 3OYFA 2EQRA 3H35A 2J5PA 4PFPA 3NQOA 1QGPA 3I64A 4UUVA 1MBEA 1R1TA 4KUMA 2QQBA 3AL0B 2EV6A 2G9WA 1RIOH 1SFOJ 2FBKA 3QQAA 3QOPA 1TLHB 3DBHB 4XKCA 2LBFA 4MTDA 3LSTA 1R58A 3W6JB 3S3MA 4A0XA 5D4SA 3R0AA 2W57A 3LSMA 2DW4A 3U21A 2R7OA 2ID3A 5EYRA 5GTIC 3GVAA 3KPHA 2CRGA 5IYDJ 5DS9A 2AHQA 5L3EA 2VKEA 5GAEJ 1L0OC 3O8GA 1QHGA 1XMKA 1QBJA 1I1SA 1YYVA 1OKRA 4WCGA 2OPTA 3GW2A 1XC5A 5JLWA 3ABUA 1B4AA 1BIAA 3PIOF 5FFXA 3CO7C 2KZVA 1R71A 4Y52J 1MJ9A 4IL6C 1X3ZB 2E19A 2CV0A 4LLLA 1OCRH 4PJJA 3WODF 2UXNA 1A5JA 2A69F 4M3EA 5F0FA 4QLCU 4JX6A 2E2JJ 2AXTC 3TL4X 3E5XA 5EEGA 1IN7A 4PJ0C 5HDGA 3R60A 3ZQ7A 2E1CA 4OMZA 2PFBA 4QIWN 2VBZA 5AONA 3JAMZ 2JJ7A 1X1AA 4KN7X 3GTPJ 4HDUA 1FP1D 3FDYA 1W36C 2JA7J 4HW0A 1NG7A 3CP2A 1AHDP 1FYLA 2R7VA 3K69A 1AU7A 1W5TA 4LB5A 3K4NA 2L7ZA 3H3UA 3V8JA 3V8LA 3TMOA 1BC7C 3WU2C 4YRVA 2EINH 1JTYA 1U78A 1E0EA 4A2UA 4RGXA 4XKWA 4DYRA 4PGGA 4IZZA 2VIXA 5LHHA 2YS9A 4UVBA 3CMEI 2Z1DA 3LFKA 3BR1A 3OYHA 2NVYJ 5TJJA 1I6HJ 2E34A 3JW4A 3MKYB 2DPDA 4JQFA 5TISC 1S7EA 4RGUA 4KMFA 3L9FA 1W0UA 2P5KA 5HODA 5EF6A 1K4TA 2GOXB 1IO2A 2ECCA 2R7ZJ 5LGUA 4MEYF 4LK1F 1J09A 2L9SA 1XMXA 1A04A 2V9PA 3RDIA 4UV9A 1MMDA 5D5WB 3EQLF 3AL0C 3I9V2 4M6YA 2P6SA 2GBYA 2L01A 1PP8F 1K6OA 5EEAA 4YFKF 2PJRB 1X1DA 3L2QA 2H8RA 2MH2A 4ZTFA 2CQKA 3W6VA 4FE4A 2CUJA 3HB9A 3S14J 3JREA 2A6EF 3CCLI 2PN6A 2CUEA 5K5RA 5ICFA 1IRXA 5CJ9A 1VQMI 1R00A 2HZDA 2RQPA 1JKRC 5HNHA 1RPWA 2PBIA 3BR3A 5K7FA 1GV5A 4YFXF 1EKEA 3L1PA 5K7HA 2UV1A 2OCCH 2H1KA 3KE2A 3ZMVA 3ZMTA 4B48A 1P9QC 3RZDJ 1FWZA 2DXIA 4EGZA 2W00A 4BE2A 1BBYA 1FTZA 5HOOA 1VQ9I 2VQCA 4XN0A 1WZ2A 3NAUA 4CO8A 2LBFB 1MZBA 1MJAA 5HS8A 1G8XA 3LOCA 4FE7A 1E2XA 3DEEA 3OR1C 3S1MJ 2OJED 2RVCA 2WAFA 4RAFA 2M9HA 5KK1A 1BJAA 4PJMA 3MZHA 1VZ0A 1TWHJ 4HF1A 5LRSA 1LJ9A 3ZOBA 4E7JA 2FXAA 4J19A 4I01A 1TWAJ 1P4AA 2DYRH 4AVPA 4BGDA 2L7MP 4GRIA 4HV6A 3CZ6A 2V1XA 1ENHA 4KN4X 3ZMZA 2DOAA 2AS5F 1F9NA 1W5SA 2QA4I 3W6KB 4IHXA 3CDHA 2PMZA 3OL3A 2NVXJ 3DQVC 2VJ5A 4MFEA 1XSDA 3OMYA 5CVJA 1RI7A 3QYEA 3PM1A 2XKPA 4UNOA 4F91B 1I3QJ 5M3FJ 3BDDA 1NK3P 1U6GA 2CFOA 3M7GA 5EDNA 2VT2A 3BLYA 4C2TA 2QQ8A 2DJNA 2ESNA 1LEAA 3GZ5A 2XPWA 1DPUA 1OFCX 3G2BA 3CCUI 4O6JA 3HM5A 4IF4A 2IA0A 3GF2A 3I5UA 4C2MJ 2BVLA 2EV0A 4Y17A 3BZ6A 1RNLA 2DFIA 4OIRF 1W7PB 4GDFA 4OIQF 3HOXJ 3HSEA 2DA6A 2XAGA 2L4AA 4ZDLA 2XRNA 4GYGA 3HOTA 4HLYA 2L7FP 1GXQA 4JYKA 4D7MA 3KP2A 1ZR2A 1LVKA 5IYCJ 2EZKA 2L9NA 3KP5A 1DPRA 3CCVI 1Y39A 1VF9A 2M8EA 5ED4A 3RI4A 3S2HJ 2ADUA 4A6EA 2FA5A 3K1MA 3TOAA 3JRHA 4U7BA 1Y8RB 2O3FA 4LG0A 3WG7H 1BI3A 1F4KA 1FBUA 1MMNA 3FHZA 3OYKA 3VOEA 4BY7J 3JTGA 1APLC 4IHSA 1T0FA 2Q1ZB 5GAGJ 4V19K 3T1BA 1OLTA 1WVRA 3LAPA 4M71A 2KIFA 2XUBA 2LREA 4RS8A 4DQ2A 3DPLC 4DBRA 2QEXI 1ZTRA 3ZR8X 2HKXA 3ISPA 3OL4A 3M3YJ 1S8NA 2DDBA 3CCRI 2ETHA 2B7EA 2IEKA 3DU6A 3LFUA 2NVUB 2A6HF 4AYBA 2Z2SB 2E5NA 1QNTA 3JRAA 3OYMA 2XF5A 4HBLA 3CC4I 4AYBN 3BJ6A 3P9KA 1EH6A 2ZJRF 2IW5A 3I53A 3M9AA 4DJAA 3BG3A 3PNVA 3OIQA 2MD0A 4GGGA 3OWTA 4PUSA 4D1QA 4V2FA 1YO5C 1XGMA 1I39A 3S15J 4CXFA 1XD7A 2MG4A 2QSHX 1V5GA 2DAOA 3F8MA 1VFCA 3C7JA 4B1RA 1SFEA 2HFHA 4P55A 1PP7U 3HKZA 1ZARA 2AQFA 2ELJA 2EZLA 4OU0A 4DGWB 3I58A 5E20A 2O8XA 3DBRB 1CF7A 1GVDA 4HX4A 5JLXA 5D5XB 3ERED 1F5TA 4RLFA 2LTPA 2IXSA 4EATA 2X6XA 3IH4A 1GUUA 5L3GA 2ZFWA 2KDZA 4ENJA 1I50J 3BPVA 1MIJA 2K27A 2YX7A 2NOGA 3A1YA 1LE8A 2QSGX 2XRLA 2HDDA 1OYIA 2QBYB 3EYIA 3VB2A 3R0JA 3CCMI 2NAZA 1I3AA 1FMWA 1ZYRF 5IOYA 1J7KA 1T08B 2VQGA 4XOPA 2JA6J 1VQ5I 4JK1X 3CUQB 3MZ8A 2O6GE 4E7ZA 2IGMA 2F5DA 2OZUA 3WTSC 2MFZA 2ZSIB 3I4PA 3HSFA 3TQNA 4S04A 1WFXA 3ECOA 3MKZA 1Z21A 5IT9K 1Z6TA 5E17F 4B3XA 1REPC 1USTA 4UVCA 1W36D 3LL7A 4Q4ZF 2IA1A 1Y56A 3GZ6A 1D5VA 4BU2A 1D1AA 1BC8C 1MSEC 1GLNA 5F0CA 2AXLA 1IN4A 4PSWA 2K9MA 3KYDB 3SDBA 1JJ6C 2VN2A 3DEUA 2AO9A 4AIJA 1X1BA 1X3UA 3I54A 1XCBA 2B9SA 3CJQB 3E5UA 3H5RA 1IN8A 2FF4A 3K9TA 2DK5A 4NQWB 2WBMA 3BOQA 3CF2A 4NNJA 4CH7A 1AKHA 2CH0A 1USSA 2WB1N 3GTMJ 3M4OJ 1D8JA 2F4OB 1IUYA 4GYIA 2O9LA 3Q9SA 1HKTA 2A05A 1X4PA 1OPCA 2BY2A 3J80Z 3DF8A 4LG0B 3CESA 2CYYA 4HRIA 4NB5A 3OYCA 1E3OC 1UCRA 5DM6F 2OTJI 2CQQA 4DYQA 4RDUA 4IO9F 3M8FA 4UXNA 3OYJA 5KAFC 3FXUA 4HSRA 2E5ZA 4WXCA 1LB2A 2ZC2A 3D5SC 1HKSA 4E7HA 3S32A 2YPRA 5DCMB 2HQ5A 1G6NA 3JSOA 5BS6A 2OUMA 4IVNA 3L2RA 2Z9OA 2DA1A 3L2CA 2X85A 2EIJH 1BIBA 1ZRDA 2OAZA 3ABLH 4B44A 1JKOC 4XLNF 4FTHA 2GQQA 5LGTA 2RDPA 1OJLA 3A0HC 4II2A 1G2HA 1FOYA 3AKZA 2LSOA 4NC6A 3W2VA 4M3DA 2TRTA 4ZYAA 2DBBA 1TP4A 2HDWA 1A35A 4XN3A 4A3JJ 4XK4A 2LKPA 2ZSHB 3OYBA 1KQ0A 2BY0A 2VXZA 4E7IA 2V9VA 4UV8A 3JRDA 3G4SI 3B6AA 3GTLJ 2HXOA 2RKHA 3EUHA 2VKHA 4C3JJ 1NH3A 3MQ0A 5DEQA 3VYRB 1CF7B 3CUQC 3FISA 4YFNF 3PQJA 3FZVA 4EJUA 1MMGA 4J01A 2YU3A 3TO7A 1Z3YA 2LKSA 1RUNA 3A01A 3D5LA 1W5CC 1H9GA 5J3LA 2ZO4A 2PLYA 1R5ID 2UXXA 3UNGC 3OYGA 2VLAA 2GM4A 1IF1A 5HVQC 2HNHA 3ZQCA 1LE8B 5JR3A 1PUEE 3T8RA 5LLQA 4W97A 2JSCA 3VPRA 5FROA 3FXJA 4AUXA 3LAJA 4Y7NJ 2ZB9A 2L2OA 4L9JA 2OQGA
chains in the Genus database with same CATH topology
3VFZA 1I1GA 4LB6B 2OU2A 2ZKZA 5FD6A 1R1VA 3FX3A 1KA8A 1YFHA 3HHHA 1MD0A 3FXRA 3IKVA 1O7FA 3S2WA 1OYYA 4LFUA 4EQQA 2M87A 3TDUC 3FMSA 1LVAA 4ETSA 2PMHA 5D6FA 2X4HA 2ZBKA 4KIBA 4KYWA 1MDMB 1FPQA 4FHTA 2ZMEA 1JHHA 4KMUX 3WG9A 1WQ2A 2HYFA 2XASA 5D5VB 1SD4A 1YS6A 2G7UA 2XAHA 4LGWA 4EM0B 1B9NA 2NRAC 4RAYA 1WI9A 5A2QK 2GA1A 5LHGA 1FBQA 2IJLA 3C1DA 3F3XA 5DUKA 3D0SA 1IXSB 3J81K 4OIOF 4AIHA 1WKMA 1QZZA 2FNPA 4ZZLA 2KIMA 2HWVA 1V3FA 4O3MA 2DTRA 3M8EA 4HX8A 3WTWC 1FYKA 4ESBA 1XSXA 5L3FA 3DPTA 4M9XA 1SFUA 4LLGF 2M1BA 3HRTA 1LNWA 2XGXA 1XMAA 4A5NA 4ESFA 5CVRA 4M9SA 4Q5SF 1TQPA 3GLXA 4A6DA 4G7OF 1HKQA 2MLKA 3BY6A 4ENKA 1XGNA 3HRSA 1UHWA 1ONVA 2H94A 2P6TA 5JI6A 2KKOA 4TV7A 5CVIA 1Z05A 2D2WA 3C18A 1C0WA 2A61A 2VBYA 1FY7A 1Z9CA 1IXCA 2A5YB 4G9YA 2Q8KA 5FLXK 2P5LC 4IPAA 3SZTA 4U0VA 2D45A 2IA2A 4G7HF 3K2ZA 1S7OA 1XN7A 1HW1A 1BM9A 2HTSA 4A5MA 1Z7UA 3F8CA 3GUDA 4AIKA 1SAXA 3GFJA 3PFIA 1SMYF 2YR2A 4S05A 3QP6A 4IRGA 2EV5A 3GFMA 4HQEA 2F2EA 2IP2A 2ISZA 5FB2A 3FWEA 1TW3A 3M1EA 2LF7A 4L5JA 2K7LA 2VOOA 5AIPA 4R79A 5E8GA 4RB3C 5CYVA 3LQRA 1TBXA 3L7WA 4MQ9F 4BNCA 5H6RA 5BQTA 4G94A 5DUIA 1TTYA 4IRHA 2DO7A 1XCVA 1ZREA 2LF8A 4EJOA 1I6XA 2NYXA 4XSZF 3WTTC 1ULYA 3HYIA 2HQNA 2A07F 2XAQA 3E6MA 2Z33A 4GCVA 2FEZA 1BOAA 1FYMA 3HIFA 4HV5A 2CG4A 1B1BA 4YIFA 4FX0A 3KLNA 4R1HA 5BPDA 2HTJA 1P4XA 1O57A 5CVVA 3GYHX 3ML6A 3K1NA 4L9TA 2F5CA 1YTYA 3GFLA 1R36A 2ISYA 4Y15A 1SD5A 3IRQA 3RKWA 4OOIA 2A3SA 1R22A 1UFMA 4HQMA 5FFZA 5LEJA 2EFQA 3GWZA 2P5VA 3V7SA 1ODDA 3GEZA 2JRTA 5ICGA 2K02A 2MBFA 3SZPA 5K5OA 2DQRA 4L0YB 3O3KA 4FX4A 5J8CA 1UB9A 2PI0A 1L3LA 2W85A 4BAYA 3H92A 2OA4A 3R4KA 4CICA 4RB1A 3P9CA 1GXPA 2EJRA 3WE2A 4U88A 5L3BA 4HLXA 3JAMK 5IT9Z 4KA4A 3O2PE 4WXHA 2Q2EA 3KEQA 1LDDA 1XDSA 3KEOA 3V4GA 2BE5F 1O7LA 3WTVC 3WU1B 2RC4A 2KRFA 4ZZDA 4EJWA 5FGMA 4M72A 3HOSA 2HDCA 1U5TA 1P4WA 4RB0A 1QQIA 4U0WA 2OD5A 3F72A 4IXAA 3WGGA 3E6BA 3JTHA 2H09A 2J5OA 4IJAA 4M6XA 4HF0A 3NEUA 2HYGD 1ZGJA 4PZJA 5ILVA 1J75A 2VE8A 2RGVA 2QUFA 4P9FA 3RTRA 2STWA 3HRUA 3TOBA 3FM5A 4IHTA 4ZYHA 3V8KA 1G4DA 2DI3A 2LDUA 1KQ9A 2GZWA 5LGNA 2IPQX 4LJZF 2V1UA 2HKOA 3ZPLA 2PQ8A 4BHPA 5E8IA 1FC3A 1SMTA 3F8BA 2Z5UA 2P4WA 5LRRA 4RAZA 3EYYA 2W24A 5HLGA 3CUOA 2OQRA 3KLOA 4RB2C 4HDVA 3E6DA 3I59A 5DD4A 1TW2A 3Q5FA 1T6SA 1UHMA 1G3TA 1DDNA 4CDGA 5LBQA 4EVIA 3VODA 2EFNA 2V79A 3KZZA 4ENNA 3SFZA 4IRIA 2EB7A 1LDKB 3KP3A 1HW2A 2CWEA 1FNNA 3FMRA 3QP5A 2HZTA 4I0AA 1J0RA 1XGOA 5DDGA 2VBXA 1KU3A 3K0LA 4BH9A 1G3YA 1JGSA 1STZA 1T38A 1R5GA 2V6CA 4EV0A 3MCZA 2DPUA 1MKMA 1YG2A 2YSRA 4L18B 2Y0MA 5A2QZ 2D1HA 1ON1A 1S7AA 4GXOA 3T8TA 4HAMA 4CGZA 4BQAA 4KIGA 3WGIA 4Q47A 1NHAA 2FSWA 1FBSA 4RGSA 3IC7A 2V1DA 2UWMA 5ILSA 2O0YA 4PCQA 2Y75A 4HOBA 2M45A 1ZHFA 4G6QA 1Y0UA 3HTSB 3RPUA 1XGSA 1MGTA 1BI0A 3CTAA 2MD5A 2QVOA 3V7RA 4E70A 4XRFA 3R6SA 2C6YA 2HGCA 1EH7A 4FT8A 5D4RA 2QLZA 5CLSA 1K7AA 1U8RA 1JHFA 3E6CC 3U1DA 1P6RA 2Q0OA 4M73A 2JPBA 3MEXA 3ULQB 2VODA 3ROUA 4I0BA 4MQVA 3ABTA 4M9ZA 1OMIA 2E7XA 3I71A 3C3WA 3P7NA 4K2EA 3IKTA 1GVJA 3CJNA 4MEXF 2FE3A 1IN5A 2B0LA 1D8KA 2R7DA 1TQIA 2EK5A 3F8FA 4XSXF 1G3WA 4O5VA 1YW7A 2W25A 4D0PA 3J80K 5IT3A 2YX4A 5HS7A 3GXOA 1SD7A 1J5YA 2P8TA 2XV4S 2BEOA 3ZMSA 1WSUA 2FBIA 5FD5A 2TDXA 3WE3A 4ZYEA 4CYDA 3DV8A 1T98A 3ZN1A 2XHKA 5H6QA 4UHTA 4YIIA 2KJCA 1B9MA 4ENMA 5ICEA 2A68F 1S3JA 4KICA 3GFIA 2GA2A 4L9VA 1HSTA 3RJPA 3NRVA 1O3SA 1YIOA 3ZMDA 3F6VA 1VTNC 2VE9A 2M5WA 2MA3A 5E1WA 2QYOA 4ZH4F 2QZ8A 1ZLJA 5ILUA 3AAFA 2QQAA 2Y48A 3KP7A 5DCFA 2ZJ2A 1ZRFA 4B8XA 5D8LB 3DKWA 4A0YA 2NS0A 4Q48A 3B73A 4EM1A 1P92A 2P7CB 4B09A 2IRFG 2DLLA 2IT0A 1YW9A 4LK0F 1HXDA 2WV0A 2ZMEB 4P9UA 2G7HA 4BYYA 3RIRA 2WWYA 3P9IA 3V7CA 1F1ZA 1FZPB 5HLHA 2GXGA 1PDNC 4EJVA 5E18F 4HYEA 1KU9A 4KIFA 1O3QA 3L09A 2MC3A 3IRRA 2ESHA 1T39A 3DXJF 4A12A 2K86A 3WTUC 3WGHA 2EA4A 4AWXB 3ELKA 1IAWA 4MTEA 3F8NA 2P7VB 3J7AO 1WWXA 3FF5A 1B6AA 2GXBA 5L3CA 2RV8A 1I27A 2FMYA 4OINF 2OZ6A 3OOPA 1YQAA 5J6XA 5LEKA 1W7PA 2EFPA 1W4MA 5DD8A 2GIVA 5FO5A 3EDPA 4P96A 4WX9A 2VOPA 1GHCA 5D5UB 2STTA 3T0YA 4KFCA 4OIPF 2JZYA 4LMYA 6PAXA 1EV7A 2KIUA 2XROA 4EGYA 2KJBA 4WWCA 1BI1A 3RYPA 4M74A 4RGRA 3SHFA 2M30A 4HF2A 1KYZA 2HR3A 1J9IA 3TO6A 2XVCA 1DUXC 1QO0D 2PJPA 5AIQA 1JXSA 3ECHA 3MZYA 4ESJA 3G73A 1E17A 3CLOA 3HUGA 4KDPA 3LA3A 2L02A 3E97A 2FOKA 1LEBA 5F64A 5F6FA 3TO9A 2R3SA 1T2KA 4WF2A 2FNAA 3RPQA 2H6CA 2BGCA 1KYWA 2RNJA 3TDZC 3PQKA 3U2RA 5D6EA 2CSOA 2JTVA 3G3ZA 2QBYA 1IXRC 3E3VA 1IRFA 4ZYDA 3KCCA 3COAC 3K1PA 1SFXA 1FP2A 3CUQA 3WTXC 2GAUA 4ZYGA 3GX4X 2WTEA 2PG4A 4G6DA 5BPIA 1U3EM 2DK8A 2IVMA 3REOA 1G3SA 4EJTA 2QWWA 2LNBA 5HLIA 2VC0A 4UVAA 3HHGA 4LLNA 5D8KB 2EA2A 3H3ZA 4NQWA 5LHIA 2MLGA 4BXUA 1J59A 1S29A 5H20A 1Z1DA 1HBXG 1J2XA 1SD6A 3CO6C 2RN7A 4L0ZB 2CFXA 1KU7A 2EFWA 2H6BA 1Q1HA 5DCMA 4MHGA 3ZN0A 4AD9A 1FOKA 2E1NA 3IHUA 3QAHA 3F21A 1TNSA 2EFOA 2F5FA 4EM2A 5HDKA 2O61A 1RUOA 1IN6A 3SQNA 1RZ4A 3ZP5A 3GO5A 3T5XA 2K4JA 5JFRA 5DV5A 3TKYA 5HDNA 3WU0A 2JPCA 2UZKA 1OYWA 1YW8A 4G8XA 1Z6RA 1WRJA 5DYMA 2PMUA 3U9GA 2BV6A 1HQCA 5KVRA 1ZGAA 1KGSA 1O3TA 1AWCA 1V4RA 3LA7A 4JBAA 2COMA 3DFGA 2EWNA 4EMSA 4QLCU 2X0LA 2DU9A 1S6LA 2XAFA 2ZNZA 3SXYA 4MGRA 3RKYA 3MAJA 4H0EA 2WC2A 2QQ9A 4LD5A 1FLIA 1EH8A 4U0YA 3JSPA 4F7ZA 3IWZA 3IL2A 4QWQA 3QPTA 4U7DA 2BBYA 1KQ8A 4L5IA 1ZLKA 3RKXA 3BP8A 2ZXJA 3KETA 4Z2YA 1FSHA 4I7HA 2DT5A 3BWGA 4L9NA 3O6BB 2E7WA 2HEOA 2XAJA 3WTYC 1U5TB 2R7FA 3B02A 4HZFA 3BROA 4I98B 3OV8A 1MJBA 1MDMA 1U2WA 3BPXA 3WTZA 4N9IA 2Z3YA 2ZNYA 2D1VA 1Z91A 3HSRA 1XDUA 4BHBA 3TGNA 1XB4A 1BN5A 2L4MA 1KU2A 2F5EA 1R5HA 1XSVA 4PDKA 1H9TA 3HRMA 2VBWA 1TQMA 3J81Z 2O03A 4R8HA 5CVUA 4DNCA 3FM3A 1CGPA 3EETA 1OR7A 2OBPA 2FU4A 3LA2A 1ZG3A 4KNYA 3KP4A 2VONA 1ZRCA 2L54A 1B59A 2FMLA 1D3YA 5ERIA 1QZYA 4I2OA 3VEPA 5BMZA 1H0MA 1FSEA 2XIGA 5K1YA 2L3DA 4N9HA 3QPHA 3MFKA 3I59B 2JT1A 5E1XA 4KT5C 3RYRA 2HS5A 4WK8F 5J8FA 2BYVE 2MH9A 2QENA 4A0ZA 1YLFA 1U5TC 2FQ3A 5JVTA 2ACJA 1ON2A 3R61A 3F23A 1K78A 4CHUA 4N0BA 1AOYA 2H27A 3QU6A 5FLXZ 4GO1A 1JE8A 2W84A 5TRDA 4XLPF 5K5QA 2Z99A 3KZYA 3FXQA 5F1RA 5JHUA 3F22A 2HOEA 2CO5A 4BHCA 2ELHA 3N4MA 4Y13A 3LQQA 3LWFA 1HSJA 3ZMUA 2QM3A 2VC1A 1ZH5A 2K4BA 1HW5A 2FRHA 4ON0A 1R1UA 4MNUA 3L00A 5L3DA 2ZCWA 1ZN2A 3IWFA 5BOXA 1BI2A 1I5ZA 4CZZA 4I02A 1IW7F 2CGPA 2NNNA 3BJOA 1IRGA 1ZG1A 4XBFA 1ZG5A 4HA8A 2NNYA 2HQRA 2FBHA 2CW0F 2VT3A 3Q9VA 1IZ1A 5HS9A 1QPMA 3N97A 4P5OA 3QRFF 1FT9A 1ZAOA 3F6OA 1LDJA 3QU3A 4I09A 4YG2F 1YS7A 3MWMA 1P2FA 4ASNA 1TNTA 1R7JA 2XKOA 3I0TA 4HX7A 4PGHA 3BJAA 3HTUA 1FX7A 4NHJA 3E5QA 1W7PD 3FMQA 2PEXA 3KP6A 2DQLA 1R23A 1K79A 1DP7P 3KFWX 1O3RA 5E1ZB 1K78B 3DP7A 4G7ZF 4WXDA 4OMYA 5ICCA 2GWRA 5EEHA 2J5PA 3NQOA 1QGPA 3I64A 4UUVA 4KUMA 1R1TA 2QQBA 2EV6A 2G9WA 1RIOH 2FBKA 3QOPA 1TLHB 4MTDA 3LSTA 1R58A 3W6JB 4A0XA 5D4SA 3R0AA 2W57A 2DW4A 3GVAA 5L3EA 1L0OC 1QBJA 1XMKA 1I1SA 1YYVA 1OKRA 4WCGA 3GW2A 3ABUA 1B4AA 1BIAA 5FFXA 3CO7C 1MJ9A 4LLLA 3WODF 2UXNA 2A69F 3E5XA 5EEGA 1IN7A 5HDGA 3R60A 3ZQ7A 2E1CA 4OMZA 2PFBA 2VBZA 5AONA 3JAMZ 4KN7X 4HDUA 1FP1D 4HW0A 1FYLA 3K69A 4LB5A 1W5TA 3H3UA 3V8JA 3V8LA 1BC7C 1U78A 4A2UA 4RGXA 4PGGA 5LHHA 4UVBA 3LFKA 5TJJA 3JW4A 2DPDA 4KMFA 4JQFA 4RGUA 3L9FA 2P5KA 5LGUA 4MEYF 4LK1F 1A04A 3RDIA 4UV9A 5D5WB 3EQLF 4M6YA 2P6SA 2L01A 1PP8F 1K6OA 4YFKF 2MH2A 2CQKA 2A6EF 2PN6A 5K5RA 5ICFA 5CJ9A 1R00A 2RQPA 2PBIA 4YFXF 3KE2A 3ZMVA 3ZMTA 1FWZA 4EGZA 1BBYA 5HOOA 4CO8A 1MZBA 1MJAA 5HS8A 1E2XA 2RVCA 5KK1A 1BJAA 3MZHA 4HF1A 5LRSA 1LJ9A 2FXAA 4I01A 1P4AA 4AVPA 4HV6A 2V1XA 4KN4X 3ZMZA 2AS5F 1F9NA 1W5SA 3W6KB 3CDHA 3DQVC 1XSDA 5CVJA 1RI7A 2XKPA 4UNOA 3BDDA 1U6GA 3M7GA 2VT2A 2ESNA 1LEAA 3GZ5A 1DPUA 4O6JA 4IF4A 2IA0A 3GF2A 3I5UA 2EV0A 4Y17A 3BZ6A 1RNLA 2DFIA 4OIRF 1W7PB 4OIQF 3HSEA 2XAGA 2L4AA 2XRNA 4GYGA 3HOTA 4HLYA 1GXQA 3KP2A 3KP5A 1DPRA 2M8EA 5ED4A 3RI4A 2ADUA 4A6EA 2FA5A 3K1MA 3TOAA 4U7BA 2O3FA 4LG0A 1F4KA 1BI3A 1FBUA 3FHZA 3VOEA 3JTGA 4IHSA 1T0FA 3T1BA 3LAPA 4M71A 2KIFA 2XUBA 4RS8A 4DQ2A 3DPLC 2HKXA 3ISPA 1S8NA 2ETHA 2A6HF 1QNTA 4HBLA 3BJ6A 3P9KA 1EH6A 2IW5A 3I53A 3M9AA 4GGGA 1YO5C 1XGMA 4CXFA 1XD7A 2DAOA 3F8MA 3C7JA 1SFEA 2HFHA 4P55A 1PP7U 1ZARA 4OU0A 3I58A 5E20A 2O8XA 1CF7A 4HX4A 5D5XB 3ERED 1F5TA 5L3GA 2ZFWA 4ENJA 3BPVA 2K27A 2YX7A 1OYIA 2QBYB 3EYIA 3VB2A 3R0JA 2NAZA 1ZYRF 1J7KA 4JK1X 3CUQB 2O6GE 2F5DA 2OZUA 3WTSC 3TQNA 3I4PA 3HSFA 4S04A 3ECOA 5IT9K 1Z6TA 5E17F 1REPC 1USTA 4UVCA 4Q4ZF 2IA1A 1D5VA 3GZ6A 1BC8C 2AXLA 1IN4A 2VN2A 3DEUA 4AIJA 1X3UA 3I54A 1XCBA 3E5UA 1IN8A 2FF4A 3K9TA 2DK5A 3BOQA 1USSA 1D8JA 1IUYA 4GYIA 3Q9SA 1HKTA 1OPCA 3J80Z 3DF8A 4LG0B 2CYYA 4NB5A 1UCRA 3M8FA 4UXNA 3FXUA 4WXCA 1LB2A 1HKSA 2YPRA 5DCMB 1G6NA 3JSOA 5BS6A 4IVNA 2Z9OA 3L2CA 1BIBA 1ZRDA 2OAZA 4XLNF 2GQQA 5LGTA 2RDPA 2LSOA 2DBBA 2LKPA 1KQ0A 2VXZA 2V9VA 4UV8A 2RKHA 3EUHA 3MQ0A 5DEQA 1CF7B 3CUQC 4YFNF 3PQJA 3FZVA 4EJUA 2YU3A 3TO7A 1RUNA 3D5LA 1H9GA 2ZO4A 2PLYA 2UXXA 1IF1A 5HVQC 5JR3A 1PUEE 3T8RA 5LLQA 2JSCA 3LAJA 1LQ1A 4L9JA 2OQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VFZ A;  1I1G A;  4LB6 B;  2OU2 A;  2ZKZ A;  5FD6 A;  1R1V A;  3FX3 A;  1KA8 A;  1YFH A;  3HHH A;  1MD0 A;  3FXR A;  3IKV A;  1O7F A;  3S2W A;  1OYY A;  4LFU A;  4EQQ A;  2M87 A;  3TDU C;  3FMS A;  1LVA A;  4ETS A;  2PMH A;  5D6F A;  2X4H A;  2ZBK A;  4KIB A;  4KYW A;  1MDM B;  1FPQ A;  4FHT A;  2ZME A;  1JHH A;  4KMU X;  3WG9 A;  1WQ2 A;  2HYF A;  2XAS A;  5D5V B;  1SD4 A;  1YS6 A;  2G7U A;  2XAH A;  4LGW A;  4EM0 B;  1B9N A;  2NRA C;  4RAY A;  1WI9 A;  5A2Q K;  2GA1 A;  5LHG A;  1FBQ A;  2IJL A;  3C1D A;  3F3X A;  5DUK A;  3D0S A;  1IXS B;  3J81 K;  4OIO F;  4AIH A;  1WKM A;  1QZZ A;  2FNP A;  4ZZL A;  2KIM A;  2HWV A;  1V3F A;  4O3M A;  2DTR A;  3M8E A;  4HX8 A;  3WTW C;  1FYK A;  4ESB A;  1XSX A;  5L3F A;  3DPT A;  4M9X A;  1SFU A;  4LLG F;  2M1B A;  3HRT A;  1LNW A;  2XGX A;  1XMA A;  4A5N A;  4ESF A;  5CVR A;  4M9S A;  4Q5S F;  1TQP A;  3GLX A;  4A6D A;  4G7O F;  1HKQ A;  2MLK A;  3BY6 A;  4ENK A;  1XGN A;  3HRS A;  1UHW A;  1ONV A;  2H94 A;  2P6T A;  5JI6 A;  2KKO A;  4TV7 A;  5CVI A;  1Z05 A;  2D2W A;  3C18 A;  1C0W A;  2A61 A;  2VBY A;  1FY7 A;  1Z9C A;  1IXC A;  2A5Y B;  4G9Y A;  2Q8K A;  5FLX K;  2P5L C;  4IPA A;  3SZT A;  4U0V A;  2D45 A;  2IA2 A;  4G7H F;  3K2Z A;  1S7O A;  1XN7 A;  1HW1 A;  1BM9 A;  2HTS A;  4A5M A;  1Z7U A;  3F8C A;  3GUD A;  4AIK A;  1SAX A;  3GFJ A;  3PFI A;  1SMY F;  2YR2 A;  4S05 A;  3QP6 A;  4IRG A;  2EV5 A;  3GFM A;  4HQE A;  2F2E A;  2IP2 A;  2ISZ A;  5FB2 A;  3FWE A;  1TW3 A;  3M1E A;  2LF7 A;  4L5J A;  2K7L A;  2VOO A;  5AIP A;  4R79 A;  5E8G A;  4RB3 C;  5CYV A;  3LQR A;  1TBX A;  3L7W A;  4MQ9 F;  4BNC A;  5H6R A;  5BQT A;  4G94 A;  5DUI A;  1TTY A;  4IRH A;  2DO7 A;  1XCV A;  1ZRE A;  2LF8 A;  4EJO A;  1I6X A;  2NYX A;  4XSZ F;  3WTT C;  1ULY A;  3HYI A;  2HQN A;  2A07 F;  2XAQ A;  3E6M A;  2Z33 A;  4GCV A;  2FEZ A;  1BOA A;  1FYM A;  3HIF A;  4HV5 A;  2CG4 A;  1B1B A;  4YIF A;  4FX0 A;  3KLN A;  4R1H A;  5BPD A;  2HTJ A;  1P4X A;  1O57 A;  5CVV A;  3GYH X;  3ML6 A;  3K1N A;  4L9T A;  2F5C A;  1YTY A;  3GFL A;  1R36 A;  2ISY A;  4Y15 A;  1SD5 A;  3IRQ A;  3RKW A;  4OOI A;  2A3S A;  1R22 A;  1UFM A;  4HQM A;  5FFZ A;  5LEJ A;  2EFQ A;  3GWZ A;  2P5V A;  3V7S A;  1ODD A;  3GEZ A;  2JRT A;  5ICG A;  2K02 A;  2MBF A;  3SZP A;  5K5O A;  2DQR A;  4L0Y B;  3O3K A;  4FX4 A;  5J8C A;  1UB9 A;  2PI0 A;  1L3L A;  2W85 A;  4BAY A;  3H92 A;  2OA4 A;  3R4K A;  4CIC A;  4RB1 A;  3P9C A;  1GXP A;  2EJR A;  3WE2 A;  4U88 A;  5L3B A;  4HLX A;  3JAM K;  5IT9 Z;  4KA4 A;  3O2P E;  4WXH A;  2Q2E A;  3KEQ A;  1LDD A;  1XDS A;  3KEO A;  3V4G A;  2BE5 F;  1O7L A;  3WTV C;  3WU1 B;  2RC4 A;  2KRF A;  4ZZD A;  4EJW A;  5FGM A;  4M72 A;  3HOS A;  2HDC A;  1U5T A;  1P4W A;  4RB0 A;  1QQI A;  4U0W A;  2OD5 A;  3F72 A;  4IXA A;  3WGG A;  3E6B A;  3JTH A;  2H09 A;  2J5O A;  4IJA A;  4M6X A;  4HF0 A;  3NEU A;  2HYG D;  1ZGJ A;  4PZJ A;  5ILV A;  1J75 A;  2VE8 A;  2RGV A;  2QUF A;  4P9F A;  3RTR A;  2STW A;  3HRU A;  3TOB A;  3FM5 A;  4IHT A;  4ZYH A;  3V8K A;  1G4D A;  2DI3 A;  2LDU A;  1KQ9 A;  2GZW A;  5LGN A;  2IPQ X;  4LJZ F;  2V1U A;  2HKO A;  3ZPL A;  2PQ8 A;  4BHP A;  5E8I A;  1FC3 A;  1SMT A;  3F8B A;  2Z5U A;  2P4W A;  5LRR A;  4RAZ A;  3EYY A;  2W24 A;  5HLG A;  3CUO A;  2OQR A;  3KLO A;  4RB2 C;  4HDV A;  3E6D A;  3I59 A;  5DD4 A;  1TW2 A;  3Q5F A;  1T6S A;  1UHM A;  1G3T A;  1DDN A;  4CDG A;  5LBQ A;  4EVI A;  3VOD A;  2EFN A;  2V79 A;  3KZZ A;  4ENN A;  3SFZ A;  4IRI A;  2EB7 A;  1LDK B;  3KP3 A;  1HW2 A;  2CWE A;  1FNN A;  3FMR A;  3QP5 A;  2HZT A;  4I0A A;  1J0R A;  1XGO A;  5DDG A;  2VBX A;  1KU3 A;  3K0L A;  4BH9 A;  1G3Y A;  1JGS A;  1STZ A;  1T38 A;  1R5G A;  2V6C A;  4EV0 A;  3MCZ A;  2DPU A;  1MKM A;  1YG2 A;  2YSR A;  4L18 B;  2Y0M A;  5A2Q Z;  2D1H A;  1ON1 A;  1S7A A;  4GXO A;  3T8T A;  4HAM A;  4CGZ A;  4BQA A;  4KIG A;  3WGI A;  4Q47 A;  1NHA A;  2FSW A;  1FBS A;  4RGS A;  3IC7 A;  2V1D A;  2UWM A;  5ILS A;  2O0Y A;  4PCQ A;  2Y75 A;  4HOB A;  2M45 A;  1ZHF A;  4G6Q A;  1Y0U A;  3HTS B;  3RPU A;  1XGS A;  1MGT A;  1BI0 A;  3CTA A;  2MD5 A;  2QVO A;  3V7R A;  4E70 A;  4XRF A;  3R6S A;  2C6Y A;  2HGC A;  1EH7 A;  4FT8 A;  5D4R A;  2QLZ A;  5CLS A;  1K7A A;  1U8R A;  1JHF A;  3E6C C;  3U1D A;  1P6R A;  2Q0O A;  4M73 A;  2JPB A;  3MEX A;  3ULQ B;  2VOD A;  3ROU A;  4I0B A;  4MQV A;  3ABT A;  4M9Z A;  1OMI A;  2E7X A;  3I71 A;  3C3W A;  3P7N A;  4K2E A;  3IKT A;  1GVJ A;  3CJN A;  4MEX F;  2FE3 A;  1IN5 A;  2B0L A;  1D8K A;  2R7D A;  1TQI A;  2EK5 A;  3F8F A;  4XSX F;  1G3W A;  4O5V A;  1YW7 A;  2W25 A;  4D0P A;  3J80 K;  5IT3 A;  2YX4 A;  5HS7 A;  3GXO A;  1SD7 A;  1J5Y A;  2P8T A;  2XV4 S;  2BEO A;  3ZMS A;  1WSU A;  2FBI A;  5FD5 A;  2TDX A;  3WE3 A;  4ZYE A;  4CYD A;  3DV8 A;  1T98 A;  3ZN1 A;  2XHK A;  5H6Q A;  4UHT A;  4YII A;  2KJC A;  1B9M A;  4ENM A;  5ICE A;  2A68 F;  1S3J A;  4KIC A;  3GFI A;  2GA2 A;  4L9V A;  1HST A;  3RJP A;  3NRV A;  1O3S A;  1YIO A;  3ZMD A;  3F6V A;  1VTN C;  2VE9 A;  2M5W A;  2MA3 A;  5E1W A;  2QYO A;  4ZH4 F;  2QZ8 A;  1ZLJ A;  5ILU A;  3AAF A;  2QQA A;  2Y48 A;  3KP7 A;  5DCF A;  2ZJ2 A;  1ZRF A;  4B8X A;  5D8L B;  3DKW A;  4A0Y A;  2NS0 A;  4Q48 A;  3B73 A;  4EM1 A;  1P92 A;  2P7C B;  4B09 A;  2IRF G;  2DLL A;  2IT0 A;  1YW9 A;  4LK0 F;  1HXD A;  2WV0 A;  2ZME B;  4P9U A;  2G7H A;  4BYY A;  3RIR A;  2WWY A;  3P9I A;  3V7C A;  1F1Z A;  1FZP B;  5HLH A;  2GXG A;  1PDN C;  4EJV A;  5E18 F;  4HYE A;  1KU9 A;  4KIF A;  1O3Q A;  3L09 A;  2MC3 A;  3IRR A;  2ESH A;  1T39 A;  3DXJ F;  4A12 A;  2K86 A;  3WTU C;  3WGH A;  2EA4 A;  4AWX B;  3ELK A;  1IAW A;  4MTE A;  3F8N A;  2P7V B;  3J7A O;  1WWX A;  3FF5 A;  1B6A A;  2GXB A;  5L3C A;  2RV8 A;  1I27 A;  2FMY A;  4OIN F;  2OZ6 A;  3OOP A;  1YQA A;  5J6X A;  5LEK A;  1W7P A;  2EFP A;  1W4M A;  5DD8 A;  2GIV A;  5FO5 A;  3EDP A;  4P96 A;  4WX9 A;  2VOP A;  1GHC A;  5D5U B;  2STT A;  3T0Y A;  4KFC A;  4OIP F;  2JZY A;  4LMY A;  6PAX A;  1EV7 A;  2KIU A;  2XRO A;  4EGY A;  2KJB A;  4WWC A;  1BI1 A;  3RYP A;  4M74 A;  4RGR A;  3SHF A;  2M30 A;  4HF2 A;  1KYZ A;  2HR3 A;  1J9I A;  3TO6 A;  2XVC A;  1DUX C;  1QO0 D;  2PJP A;  5AIQ A;  1JXS A;  3ECH A;  3MZY A;  4ESJ A;  3G73 A;  1E17 A;  3CLO A;  3HUG A;  4KDP A;  3LA3 A;  2L02 A;  3E97 A;  2FOK A;  1LEB A;  5F64 A;  5F6F A;  3TO9 A;  2R3S A;  1T2K A;  4WF2 A;  2FNA A;  3RPQ A;  2H6C A;  2BGC A;  1KYW A;  2RNJ A;  3TDZ C;  3PQK A;  3U2R A;  5D6E A;  2CSO A;  2JTV A;  3G3Z A;  2QBY A;  1IXR C;  3E3V A;  1IRF A;  4ZYD A;  3KCC A;  3COA C;  3K1P A;  1SFX A;  1FP2 A;  3CUQ A;  3WTX C;  2GAU A;  4ZYG A;  3GX4 X;  2WTE A;  2PG4 A;  4G6D A;  5BPI A;  1U3E M;  2DK8 A;  2IVM A;  3REO A;  1G3S A;  4EJT A;  2QWW A;  2LNB A;  5HLI A;  2VC0 A;  4UVA A;  3HHG A;  4LLN A;  5D8K B;  2EA2 A;  3H3Z A;  4NQW A;  5LHI A;  2MLG A;  4BXU A;  1J59 A;  1S29 A;  5H20 A;  1Z1D A;  1HBX G;  1J2X A;  1SD6 A;  3CO6 C;  2RN7 A;  4L0Z B;  2CFX A;  1KU7 A;  2EFW A;  2H6B A;  1Q1H A;  5DCM A;  4MHG A;  3ZN0 A;  4AD9 A;  1FOK A;  2E1N A;  3IHU A;  3QAH A;  3F21 A;  1TNS A;  2EFO A;  2F5F A;  4EM2 A;  5HDK A;  2O61 A;  1RUO A;  1IN6 A;  3SQN A;  1RZ4 A;  3ZP5 A;  3GO5 A;  3T5X A;  2K4J A;  5JFR A;  5DV5 A;  3TKY A;  5HDN A;  3WU0 A;  2JPC A;  2UZK A;  1OYW A;  1YW8 A;  4G8X A;  1Z6R A;  1WRJ A;  5DYM A;  2PMU A;  3U9G A;  2BV6 A;  1HQC A;  5KVR A;  1ZGA A;  1KGS A;  1O3T A;  1AWC A;  1V4R A;  3LA7 A;  4JBA A;  2COM A;  3DFG A;  2EWN A;  4EMS A;  4QLC U;  2X0L A;  2DU9 A;  1S6L A;  2XAF A;  2ZNZ A;  3SXY A;  4MGR A;  3RKY A;  3MAJ A;  4H0E A;  2WC2 A;  2QQ9 A;  4LD5 A;  1FLI A;  1EH8 A;  4U0Y A;  3JSP A;  4F7Z A;  3IWZ A;  3IL2 A;  4QWQ A;  3QPT A;  4U7D A;  2BBY A;  1KQ8 A;  4L5I A;  1ZLK A;  3RKX A;  3BP8 A;  2ZXJ A;  3KET A;  4Z2Y A;  1FSH A;  4I7H A;  2DT5 A;  3BWG A;  4L9N A;  3O6B B;  2E7W A;  2HEO A;  2XAJ A;  3WTY C;  1U5T B;  2R7F A;  3B02 A;  4HZF A;  3BRO A;  4I98 B;  3OV8 A;  1MJB A;  1MDM A;  1U2W A;  3BPX A;  3WTZ A;  4N9I A;  2Z3Y A;  2ZNY A;  2D1V A;  1Z91 A;  3HSR A;  1XDU A;  4BHB A;  3TGN A;  1XB4 A;  1BN5 A;  2L4M A;  1KU2 A;  2F5E A;  1R5H A;  1XSV A;  4PDK A;  1H9T A;  3HRM A;  2VBW A;  1TQM A;  3J81 Z;  2O03 A;  4R8H A;  5CVU A;  4DNC A;  3FM3 A;  1CGP A;  3EET A;  1OR7 A;  2OBP A;  2FU4 A;  3LA2 A;  1ZG3 A;  4KNY A;  3KP4 A;  2VON A;  1ZRC A;  2L54 A;  1B59 A;  2FML A;  1D3Y A;  5ERI A;  1QZY A;  4I2O A;  3VEP A;  5BMZ A;  1H0M A;  1FSE A;  2XIG A;  5K1Y A;  2L3D A;  4N9H A;  3QPH A;  3MFK A;  3I59 B;  2JT1 A;  5E1X A;  4KT5 C;  3RYR A;  2HS5 A;  4WK8 F;  5J8F A;  2BYV E;  2MH9 A;  2QEN A;  4A0Z A;  1YLF A;  1U5T C;  2FQ3 A;  5JVT A;  2ACJ A;  1ON2 A;  3R61 A;  3F23 A;  1K78 A;  4CHU A;  4N0B A;  1AOY A;  2H27 A;  3QU6 A;  5FLX Z;  4GO1 A;  1JE8 A;  2W84 A;  5TRD A;  4XLP F;  5K5Q A;  2Z99 A;  3KZY A;  3FXQ A;  5F1R A;  5JHU A;  3F22 A;  2HOE A;  2CO5 A;  4BHC A;  2ELH A;  3N4M A;  4Y13 A;  3LQQ A;  3LWF A;  1HSJ A;  3ZMU A;  2QM3 A;  2VC1 A;  1ZH5 A;  2K4B A;  1HW5 A;  2FRH A;  4ON0 A;  1R1U A;  4MNU A;  3L00 A;  5L3D A;  2ZCW A;  1ZN2 A;  3IWF A;  5BOX A;  1BI2 A;  1I5Z A;  4CZZ A;  4I02 A;  1IW7 F;  2CGP A;  2NNN A;  3BJO A;  1IRG A;  1ZG1 A;  4XBF A;  1ZG5 A;  4HA8 A;  2NNY A;  2HQR A;  2FBH A;  2CW0 F;  2VT3 A;  3Q9V A;  1IZ1 A;  5HS9 A;  1QPM A;  3N97 A;  4P5O A;  3QRF F;  1FT9 A;  1ZAO A;  3F6O A;  1LDJ A;  3QU3 A;  4I09 A;  4YG2 F;  1YS7 A;  3MWM A;  1P2F A;  4ASN A;  1TNT A;  1R7J A;  2XKO A;  3I0T A;  4HX7 A;  4PGH A;  3BJA A;  3HTU A;  1FX7 A;  4NHJ A;  3E5Q A;  1W7P D;  3FMQ A;  2PEX A;  3KP6 A;  2DQL A;  1R23 A;  1K79 A;  1DP7 P;  3KFW X;  1O3R A;  5E1Z B;  1K78 B;  3DP7 A;  4G7Z F;  4WXD A;  4OMY A;  5ICC A;  2GWR A;  5EEH A;  2J5P A;  3NQO A;  1QGP A;  3I64 A;  4UUV A;  4KUM A;  1R1T A;  2QQB A;  2EV6 A;  2G9W A;  1RIO H;  2FBK A;  3QOP A;  1TLH B;  4MTD A;  3LST A;  1R58 A;  3W6J B;  4A0X A;  5D4S A;  3R0A A;  2W57 A;  2DW4 A;  3GVA A;  5L3E A;  1L0O C;  1QBJ A;  1XMK A;  1I1S A;  1YYV A;  1OKR A;  4WCG A;  3GW2 A;  3ABU A;  1B4A A;  1BIA A;  5FFX A;  3CO7 C;  1MJ9 A;  4LLL A;  3WOD F;  2UXN A;  2A69 F;  3E5X A;  5EEG A;  1IN7 A;  5HDG A;  3R60 A;  3ZQ7 A;  2E1C A;  4OMZ A;  2PFB A;  2VBZ A;  5AON A;  3JAM Z;  4KN7 X;  4HDU A;  1FP1 D;  4HW0 A;  1FYL A;  3K69 A;  4LB5 A;  1W5T A;  3H3U A;  3V8J A;  3V8L A;  1BC7 C;  1U78 A;  4A2U A;  4RGX A;  4PGG A;  5LHH A;  4UVB A;  3LFK A;  5TJJ A;  3JW4 A;  2DPD A;  4KMF A;  4JQF A;  4RGU A;  3L9F A;  2P5K A;  5LGU A;  4MEY F;  4LK1 F;  1A04 A;  3RDI A;  4UV9 A;  5D5W B;  3EQL F;  4M6Y A;  2P6S A;  2L01 A;  1PP8 F;  1K6O A;  4YFK F;  2MH2 A;  2CQK A;  2A6E F;  2PN6 A;  5K5R A;  5ICF A;  5CJ9 A;  1R00 A;  2RQP A;  2PBI A;  4YFX F;  3KE2 A;  3ZMV A;  3ZMT A;  1FWZ A;  4EGZ A;  1BBY A;  5HOO A;  4CO8 A;  1MZB A;  1MJA A;  5HS8 A;  1E2X A;  2RVC A;  5KK1 A;  1BJA A;  3MZH A;  4HF1 A;  5LRS A;  1LJ9 A;  2FXA A;  4I01 A;  1P4A A;  4AVP A;  4HV6 A;  2V1X A;  4KN4 X;  3ZMZ A;  2AS5 F;  1F9N A;  1W5S A;  3W6K B;  3CDH A;  3DQV C;  1XSD A;  5CVJ A;  1RI7 A;  2XKP A;  4UNO A;  3BDD A;  1U6G A;  3M7G A;  2VT2 A;  2ESN A;  1LEA A;  3GZ5 A;  1DPU A;  4O6J A;  4IF4 A;  2IA0 A;  3GF2 A;  3I5U A;  2EV0 A;  4Y17 A;  3BZ6 A;  1RNL A;  2DFI A;  4OIR F;  1W7P B;  4OIQ F;  3HSE A;  2XAG A;  2L4A A;  2XRN A;  4GYG A;  3HOT A;  4HLY A;  1GXQ A;  3KP2 A;  3KP5 A;  1DPR A;  2M8E A;  5ED4 A;  3RI4 A;  2ADU A;  4A6E A;  2FA5 A;  3K1M A;  3TOA A;  4U7B A;  2O3F A;  4LG0 A;  1F4K A;  1BI3 A;  1FBU A;  3FHZ A;  3VOE A;  3JTG A;  4IHS A;  1T0F A;  3T1B A;  3LAP A;  4M71 A;  2KIF A;  2XUB A;  4RS8 A;  4DQ2 A;  3DPL C;  2HKX A;  3ISP A;  1S8N A;  2ETH A;  2A6H F;  1QNT A;  4HBL A;  3BJ6 A;  3P9K A;  1EH6 A;  2IW5 A;  3I53 A;  3M9A A;  4GGG A;  1YO5 C;  1XGM A;  4CXF A;  1XD7 A;  2DAO A;  3F8M A;  3C7J A;  1SFE A;  2HFH A;  4P55 A;  1PP7 U;  1ZAR A;  4OU0 A;  3I58 A;  5E20 A;  2O8X A;  1CF7 A;  4HX4 A;  5D5X B;  3ERE D;  1F5T A;  5L3G A;  2ZFW A;  4ENJ A;  3BPV A;  2K27 A;  2YX7 A;  1OYI A;  2QBY B;  3EYI A;  3VB2 A;  3R0J A;  2NAZ A;  1ZYR F;  1J7K A;  4JK1 X;  3CUQ B;  2O6G E;  2F5D A;  2OZU A;  3WTS C;  3TQN A;  3I4P A;  3HSF A;  4S04 A;  3ECO A;  5IT9 K;  1Z6T A;  5E17 F;  1REP C;  1UST A;  4UVC A;  4Q4Z F;  2IA1 A;  1D5V A;  3GZ6 A;  1BC8 C;  2AXL A;  1IN4 A;  2VN2 A;  3DEU A;  4AIJ A;  1X3U A;  3I54 A;  1XCB A;  3E5U A;  1IN8 A;  2FF4 A;  3K9T A;  2DK5 A;  3BOQ A;  1USS A;  1D8J A;  1IUY A;  4GYI A;  3Q9S A;  1HKT A;  1OPC A;  3J80 Z;  3DF8 A;  4LG0 B;  2CYY A;  4NB5 A;  1UCR A;  3M8F A;  4UXN A;  3FXU A;  4WXC A;  1LB2 A;  1HKS A;  2YPR A;  5DCM B;  1G6N A;  3JSO A;  5BS6 A;  4IVN A;  2Z9O A;  3L2C A;  1BIB A;  1ZRD A;  2OAZ A;  4XLN F;  2GQQ A;  5LGT A;  2RDP A;  2LSO A;  2DBB A;  2LKP A;  1KQ0 A;  2VXZ A;  2V9V A;  4UV8 A;  2RKH A;  3EUH A;  3MQ0 A;  5DEQ A;  1CF7 B;  3CUQ C;  4YFN F;  3PQJ A;  3FZV A;  4EJU A;  2YU3 A;  3TO7 A;  1RUN A;  3D5L A;  1H9G A;  2ZO4 A;  2PLY A;  2UXX A;  1IF1 A;  5HVQ C;  5JR3 A;  1PUE E;  3T8R A;  5LLQ A;  2JSC A;  3LAJ A;  1LQ1 A;  4L9J A;  2OQG A; 
#chains in the Genus database with same CATH topology
 1BR1 A;  3VFZ A;  5IY5 H;  1I1G A;  3W2W A;  1X1C A;  1IV6 A;  5CKT A;  4B4C A;  2HVS A;  3S16 J;  4LB6 B;  1WJD A;  1A6Q A;  2OU2 A;  2ZFU A;  2ZKZ A;  5FD6 A;  1R1V A;  3FX3 A;  2KRC A;  1KA8 A;  1YFH A;  2TCT A;  3HHH A;  1MD0 A;  1WCM J;  3FXR A;  3IKV A;  1O7F A;  3S2W A;  1JJ8 C;  3KIO A;  4N4N B;  2L7K A;  1OYY A;  4MO7 A;  3ESW B;  2MSY A;  4LFU A;  4EQQ A;  3KX2 A;  1V54 H;  1K83 J;  1UAA A;  2M87 A;  3TDU C;  1SAU A;  5FKO A;  1D0Y A;  3FMS A;  4DOZ A;  2CW8 A;  4M3G A;  4ANJ A;  1LVA A;  2HU9 A;  4ETS A;  2PMH A;  1AKH B;  3QPS A;  1D0X A;  5D6F A;  1WJB A;  3SJM A;  4E7K A;  2X4H A;  2ZBK A;  4KIB A;  4KYW A;  1JUS A;  1MDM B;  1FPQ A;  2ME0 A;  4FHT A;  1MBF A;  3SDG A;  2ZME A;  2XPV A;  2JA8 J;  1JHH A;  4KMU X;  3WG9 A;  2XGD A;  2OCE A;  1WQ2 A;  5GAH J;  2HYF A;  4F93 B;  3EPZ A;  2XAS A;  4EEF G;  5D5V B;  2Y31 A;  5LD2 C;  1SD4 A;  4HEA 2;  1YS6 A;  3HBL A;  4BS9 A;  2G7U A;  2JA5 J;  5CQE A;  1B8I A;  2XAH A;  4LGW A;  4EM0 B;  1B9N A;  1Z0X A;  3QWL A;  4RAY A;  2NRA C;  1WI9 A;  4D9J A;  4AVZ A;  5A2Q K;  2XGC A;  2GA1 A;  3CDL A;  2JSP A;  1OCT C;  2BXY A;  5LHG A;  2VJJ A;  1FBQ A;  5J40 A;  1X3W B;  2IJL A;  5EGO A;  4DZP A;  3LSH A;  3C1D A;  3F3X A;  4Z6Y A;  4BXF A;  3DPU A;  4BDZ A;  5DUK A;  3D0S A;  1IXS B;  3J81 K;  3M07 A;  4G6T B;  1ORK A;  4OIO F;  4YIR X;  4AIH A;  1JKQ C;  4OWR B;  2WY8 Q;  1WKM A;  1QZZ A;  2FNP A;  2R7Q A;  2CV2 A;  2ECB A;  3BTJ A;  4ZZL A;  2KIM A;  4XR6 A;  4UUS A;  2HWV A;  1V3F A;  4O3M A;  1A31 A;  3C2G A;  3PSI A;  2DTR A;  3M8E A;  3HPG A;  4JP0 A;  1OCP A;  2BXZ A;  4F3Q A;  4HX8 A;  3K10 A;  1VQN I;  3CCQ I;  3WTW C;  1FYK A;  5C4J J;  3CJT B;  4ITV A;  4YEJ A;  2DTZ A;  3A01 B;  3FKJ A;  3HDD A;  2K40 A;  4ESB A;  3OSF A;  1XSX A;  5L3F A;  3DPT A;  1W0T A;  4M9X A;  3JR9 A;  1X2N A;  3PFY A;  1SFU A;  1GV2 A;  4LLG F;  2M1B A;  2EPF A;  3HRT A;  3ASN H;  1LNW A;  3K2A A;  4IKF A;  2XGX A;  1XMA A;  2P81 A;  4A5N A;  3VDX A;  1YJ9 I;  4HNV A;  5B66 C;  1WJF A;  4ESF A;  1QA6 A;  5CVR A;  4M9S A;  4Q5S F;  1TQP A;  4NDL A;  3GLX A;  3Q0V A;  3AG4 H;  2VJ4 A;  1IUF A;  4A6D A;  4G7O F;  3S3O A;  5KAI C;  1HKQ A;  1FMV A;  3H9J A;  3G1L A;  2MLK A;  3BY6 A;  4ENK A;  1U8B A;  1XGN A;  1UG2 A;  3HRS A;  1UHW A;  1ONV A;  2H94 A;  3JRF A;  2P6T A;  5JI6 A;  2KIS A;  1TT0 A;  2KKO A;  2LOO A;  4TV7 A;  3RCO A;  5CVI A;  1Z05 A;  4I99 C;  2HVQ A;  2ZXI A;  2D2W A;  3BQZ A;  3C18 A;  1C0W A;  4C2U A;  2R7W A;  2A61 A;  2VBY A;  2E1M B;  1FY7 A;  1Z9C A;  3OS1 A;  2K9Q A;  2DCE A;  4RMN A;  1IXC A;  4P1W A;  3AG3 H;  1BR2 A;  2R7R A;  2A5Y B;  2R4G A;  2VQH A;  4G9Y A;  1E3H A;  2Q8K A;  5FLX K;  2P5L C;  4IPA A;  1MNM C;  4HNT A;  3SZT A;  3S1R J;  1XTA A;  1UZC A;  3S1N J;  4U0V A;  3S17 J;  2D45 A;  3IV5 A;  2IA2 A;  4G7H F;  3K2Z A;  2LLK A;  3BG7 A;  2KT0 A;  2X1C A;  2HOS A;  1OR7 C;  1VQL I;  1S7O A;  1XN7 A;  1HW1 A;  1BM9 A;  3K4J A;  2HTS A;  1ITY A;  4A5M A;  2EZH A;  1Z7U A;  3H1C A;  3F8C A;  2LVS A;  2NS7 A;  1B8I B;  3GUD A;  2VUM J;  3K7A J;  1QZE A;  4AIK A;  1SAX A;  3GFJ A;  3PFI A;  2HYJ A;  4BJ6 C;  3K4C A;  3EUA A;  3A0B C;  1SMY F;  4BL0 B;  2YR2 A;  4S05 A;  3QP6 A;  1HCR A;  4IRG A;  2XC7 A;  5F1J A;  2EV5 A;  5E79 C;  2V1N A;  2F4I A;  3GFM A;  1PYV A;  4HQE A;  2F2E A;  2IP2 A;  2ISZ A;  1YIT I;  5FB2 A;  3FWE A;  1TW3 A;  3K6G A;  2KPM A;  3DU5 A;  2VB6 A;  3M1E A;  5DTD A;  2LF7 A;  4L5J A;  2K7L A;  4DYC A;  4OAY A;  4A3B J;  3I56 I;  1RKT A;  2VOO A;  5AIP A;  4R79 A;  5E8G A;  4RB3 C;  5CYV A;  3PL8 A;  5IP9 J;  3LQR A;  1TBX A;  3L7W A;  3RKQ A;  4BY1 J;  4MQ9 F;  4UUS B;  4YEL A;  4UUT A;  4BNC A;  2CQ7 A;  5H6R A;  5BQT A;  4G94 A;  5DUI A;  1TTY A;  3VYS B;  1MNE A;  4IRH A;  2DO7 A;  1XCV A;  2DOE A;  1WJE A;  3M1C A;  3OY9 A;  1NTC A;  3Q0W A;  2LFB A;  2LYC A;  3HGY A;  1IDZ A;  4AC0 A;  1ZRE A;  2LF8 A;  4EJO A;  2LD5 A;  1I6X A;  2NYX A;  4XSZ F;  3WTT C;  1ULY A;  1N78 A;  3MKW B;  2XDV A;  3HYI A;  2N8G A;  2XSD C;  1V55 H;  1M1E B;  2HQN A;  3X2Q H;  2E1M C;  3IH3 A;  2A07 F;  3OYI A;  4AM3 A;  3TW7 A;  2XAQ A;  3E6M A;  2Z33 A;  4M6V A;  2CUZ A;  1WGX A;  5M5Y J;  2G0E A;  4GCV A;  4XRM A;  2FEZ A;  1BOA A;  3WHC A;  2FUG 2;  4CCO A;  1JTX A;  5CQG A;  1FYM A;  2LRD A;  2KQR A;  3HIF A;  4BQO A;  4HV5 A;  1BW5 A;  2CG4 A;  3MN2 A;  2JMW A;  1B1B A;  4YIF A;  4FX0 A;  3KLN A;  4R1H A;  3ZQL A;  1BJZ A;  2NXN B;  2JUG A;  5BPD A;  2HTJ A;  1P4X A;  1O57 A;  2DOD A;  5CVV A;  4F55 A;  4XRS G;  3GYH X;  2DA2 A;  1HA8 A;  3F0C A;  1YI2 I;  3ML6 A;  1R6R A;  2JVG A;  1D0Z A;  3FHN A;  3K1N A;  4IEJ A;  4A3E J;  3HOZ J;  4L9T A;  1X1P A;  1V5F A;  2F5C A;  1YTY A;  3GFL A;  2KZG A;  1R36 A;  1OIS A;  2DT7 B;  2ISY A;  4Y15 A;  1SD5 A;  3OIO A;  3IRQ A;  4PFO A;  3RKW A;  2Y0S A;  2VAS A;  4HPQ A;  4OOI A;  4V2G A;  2A3S A;  1GDT A;  1R22 A;  1UFM A;  1LFP A;  1MMS A;  2Y0S N;  1WHU A;  4HQM A;  5FFZ A;  4BE1 A;  3PNT A;  5LEJ A;  1ZKG A;  2EFQ A;  2HPI A;  3GWZ A;  2AQE A;  4A3G J;  2P5V A;  3IAM 2;  2E2I J;  1YRN A;  3V7S A;  3IUO A;  1ODD A;  3GEZ A;  2JRT A;  5ICG A;  2K02 A;  3IAS 2;  2MBF A;  3SZP A;  1POG A;  2MGQ A;  5K5O A;  2DQR A;  3SZG A;  4L0Y B;  3O3K A;  4FX4 A;  3QOD A;  5J8C A;  1UB9 A;  4PK4 A;  2PI0 A;  1L3L A;  3CC2 I;  4IHY A;  9ANT A;  2W85 A;  2LR8 A;  1Z7L A;  4BAY A;  3H92 A;  1JUP A;  2OA4 A;  3R4K A;  4CIC A;  4RB1 A;  3P9C A;  4XLA A;  1GXP A;  3FK7 A;  2EJR A;  2O5R A;  3SFI A;  1BR4 A;  3WE2 A;  4U88 A;  5L3B A;  4HLX A;  5JHF A;  2HQA A;  3JAM K;  4FET A;  3GTJ J;  1VQ7 I;  5IT9 Z;  4KA4 A;  4XOR A;  1SVO A;  2R7T A;  3O2P E;  4WXH A;  2Q2E A;  3KEQ A;  1LDD A;  1XDS A;  3KEO A;  5J4Y A;  3V4G A;  1R9T J;  1VI0 A;  5M3M J;  2XSJ C;  1DP3 A;  2BE5 F;  2X51 A;  5HNF A;  1O7L A;  3WTV C;  3WU1 B;  5FKM A;  1YX5 A;  3H5A A;  2M4K A;  1R49 A;  2RC4 A;  2KRF A;  4ZZD A;  4BKX A;  2VL8 A;  4EJW A;  5FGM A;  4M72 A;  2K9N A;  5CPR B;  2DMN A;  4KIT B;  1F43 A;  3HOS A;  2JVH A;  1N77 A;  2M0C A;  4PSX A;  2HDC A;  3DWL E;  2VQL A;  2KHM A;  1U5T A;  1RR7 A;  3DKX A;  2MAB A;  1P4W A;  3JRG A;  5FLV A;  4RB0 A;  2LMD A;  1QQI A;  4BEH A;  2DA7 A;  4U0W A;  3A03 A;  1MBJ A;  2OD5 A;  1F36 A;  2LY1 A;  3F72 A;  4IXA A;  3WGG A;  1BW6 A;  4DIQ A;  3E6B A;  4NC8 A;  4IQ4 A;  2LK2 A;  2EZI A;  1K4S A;  3JTH A;  2H09 A;  5E3N A;  2NVQ J;  2O8K A;  5B3S H;  2J5O A;  4I6Z A;  4IJA A;  4M6X A;  4HF0 A;  5FRM A;  3NEU A;  1RKW A;  2RQQ A;  3FIW A;  4II3 A;  2HYG D;  1ZGJ A;  4PZJ A;  5ILV A;  1QVT A;  2W7N A;  1J75 A;  1MND A;  3S1Q J;  5C44 J;  2VE8 A;  2GOM A;  3NAR A;  2RGV A;  3JRC A;  2CQN A;  2QUF A;  4P9F A;  4RA2 A;  3RTR A;  2STW A;  3HRU A;  4IQJ A;  3TOB A;  3FM5 A;  4IHW A;  4C3I J;  4IHT A;  2BY3 A;  4ZYH A;  3V8K A;  2IAI A;  3FBI B;  1G4D A;  2BW3 A;  4CYC A;  2I5U A;  1GT0 C;  2DI3 A;  2I8D A;  2LDU A;  5FKK A;  1KQ9 A;  1IV8 A;  1N25 A;  2GZW A;  5LGN A;  2IPQ X;  2M34 A;  1X2M A;  4LJZ F;  1D1B A;  2GXA A;  2V1U A;  2HKO A;  3IH2 A;  2ZJQ F;  3ZPL A;  2PQ8 A;  1RC9 A;  2KP6 A;  4BHP A;  5E8I A;  1FC3 A;  1SMT A;  1SFK A;  3F8B A;  2Z5U A;  1UEL B;  4Y33 A;  4A93 J;  2P4W A;  5LRR A;  4MIM A;  2HOT A;  1H89 C;  4RAZ A;  3EYY A;  2HPM A;  2W24 A;  5EZH A;  3CUO A;  3SYT A;  2OQR A;  3KLO A;  5HLG A;  4RB2 C;  3A2K A;  4HDV A;  4Y4R A;  2XB5 A;  3E6D A;  3CCY A;  3L2W A;  3BR6 A;  3I59 A;  5DD4 A;  1TW2 A;  3Q5F A;  3RSN A;  4A3I J;  1T6S A;  1UHM A;  1G3T A;  2LH9 A;  1WH5 A;  1DDN A;  4M3B A;  4CDG A;  1JKP C;  2A6T A;  5LBQ A;  4EVI A;  3ZQH A;  2EBI A;  3VOD A;  2EFN A;  3S93 A;  5E3L A;  2V79 A;  3LMM A;  3KZZ A;  2JUC A;  2KDO A;  4ENN A;  1R4M B;  1SVM A;  5DM7 F;  2WB1 A;  3SFZ A;  4IRI A;  3QPL A;  1KZH A;  2EB7 A;  1DU0 A;  1K6Y A;  1LDK B;  2ID6 A;  3KP3 A;  4A69 C;  5FKL A;  2F5V A;  2KLO A;  1HW2 A;  2CWE A;  3J7Y J;  2WAE A;  3GTQ J;  3NWS A;  2R7X A;  1FNN A;  1K61 A;  2A5W A;  3FMR A;  3QP5 A;  2HZT A;  4CCM A;  4I0A A;  3BG9 A;  1J0R A;  1XGO A;  1PUF A;  3FXK A;  5DDG A;  2VBX A;  2R5Z A;  1KU3 A;  1RRJ A;  3TP0 A;  3K0L A;  1LPQ A;  4BH9 A;  3LSP A;  1WJ5 A;  2Z16 A;  2XAU A;  4AU7 A;  1G3Y A;  4CZC A;  3HZJ A;  1HDD C;  3OIP A;  1A6I A;  1JGS A;  1STZ A;  1T38 A;  2K3F A;  3BCB A;  1R5G A;  4BEH B;  1QPI A;  2V6C A;  4EV0 A;  3MCZ A;  1UMQ A;  1E3P A;  2DPU A;  2H8W A;  3ABM H;  1MKM A;  1YG2 A;  2YSR A;  1ETX A;  4L18 B;  2Y0M A;  3PUF A;  5A2Q Z;  2D1H A;  3ABK H;  1ON1 A;  1S7A A;  3HEF A;  4GXO A;  5B1A H;  1A36 A;  3T8T A;  2DFH A;  4HAM A;  4CGZ A;  4BQA A;  1ERD A;  2WAQ N;  1DGW Y;  1ACI A;  2BZT A;  2F6C A;  4IHV A;  3BT9 A;  3K4M A;  2OC6 A;  3HOW J;  2R5Y A;  2QKM B;  4D5F A;  4KIG A;  4E6K G;  3WGI A;  4Q47 A;  4BE0 A;  2E2H J;  3H9G A;  5J1R A;  1NHA A;  2VPL A;  2FSW A;  1FBS A;  4RGS A;  2KIQ A;  3IC7 A;  5J4V A;  1WJA A;  3DTE A;  1FEX A;  2V1D A;  2UWM A;  5ILS A;  2O0Y A;  1OCC H;  4PCQ A;  2Y75 A;  1IG7 A;  4HOB A;  2O7O A;  4LIU A;  2M45 A;  1ZHF A;  4G6Q A;  1Y0U A;  3H9Q A;  4A3F J;  3HTS B;  3RPU A;  3UKG A;  1XGS A;  1MGT A;  2DT6 A;  1BI0 A;  2YUS A;  3CTA A;  3LSR A;  3S3N A;  2MD5 A;  2QVO A;  5LFA A;  3V7R A;  4E70 A;  2ZXW H;  4XRF A;  1LFB A;  4LOC A;  3R6S A;  2JK3 A;  2C6Y A;  1HDP A;  2HGC A;  3HOY J;  1EH7 A;  5M5X J;  3AFH A;  4FT8 A;  5D4R A;  3AG2 H;  2K9L A;  2QLZ A;  5CLS A;  1U8R A;  5GAD J;  2LC2 A;  1K7A A;  1ETY A;  4BJ5 C;  1JHF A;  3E6C C;  3A4C A;  3U1D A;  5E3M A;  1W1W E;  2V7F A;  1P6R A;  2COB A;  3GLL A;  2X1D A;  3B6C A;  3TP3 A;  1RES A;  4MFD A;  4E4H A;  1OCZ H;  4ZDP A;  2Q0O A;  5EG0 A;  4M73 A;  1S5L C;  2JPB A;  3MEX A;  3ULQ B;  1T0F C;  2Y9Z A;  2K3P A;  3OYE A;  2FJ1 A;  2VOD A;  4S0H B;  3ROU A;  3RQ4 A;  4I0B A;  4MQV A;  3ABT A;  4M9Z A;  4XLE A;  1OMI A;  3DTI A;  1ZEL A;  1ZK8 A;  2E7X A;  2F48 A;  3I71 A;  3OS2 A;  3C3W A;  3P7N A;  4K2E A;  2DYS H;  5IP7 J;  3IKT A;  1GVJ A;  1MW7 A;  3D5R C;  1ETV A;  3CJN A;  4MEX F;  2FE3 A;  1IN5 A;  2B0L A;  1YX3 A;  1D8K A;  2R7D A;  1TQI A;  2DA4 A;  2EK5 A;  2ZXH A;  3F8F A;  4XSX F;  2X48 A;  2R5Z B;  1XPX A;  1HLV A;  1G3W A;  4B43 A;  4O5V A;  3K4L A;  2E1O A;  1YW7 A;  1HC8 A;  1QRY A;  2W25 A;  3LSK A;  1JI8 A;  4A3M J;  2F4M B;  4D0P A;  2M7A A;  3J80 K;  5IT3 A;  2YX4 A;  5HS7 A;  1TWC J;  3GME A;  3GXO A;  4HNU A;  1SD7 A;  1EJ9 A;  1J5Y A;  2P8T A;  2XV4 S;  1Y0N A;  2BEO A;  3ZMS A;  1WSU A;  2FBI A;  5FD5 A;  2TDX A;  3DBL B;  1WPK A;  3H0D A;  1N75 A;  3WE3 A;  4CSW A;  4E7S A;  1TWF J;  4ZYE A;  4CYD A;  2LG4 A;  3DV8 A;  1T98 A;  3ZN1 A;  2XHK A;  5E3O A;  5H6Q A;  4UHT A;  4YII A;  4D7N A;  2DMQ A;  2KJC A;  1B9M A;  2X6Y A;  4ENM A;  2CV1 A;  2DMU A;  4XLC A;  3CCJ I;  4XKB A;  2CU7 A;  2A68 F;  5ICE A;  1S3J A;  3RQI A;  4A3D J;  2DN0 A;  3C2H A;  3OOU A;  4KIC A;  4PJN A;  2JA2 A;  2GA2 A;  4L9V A;  3GFI A;  3GTK J;  3OYN A;  1O4X A;  1HST A;  4RLQ A;  5F08 A;  3RJP A;  3NRV A;  3CC7 I;  3BCA A;  1O3S A;  1YIO A;  1ZR4 A;  1G59 A;  3S2D J;  3ZMD A;  4UB8 C;  3TBI A;  2V26 A;  4XL9 A;  2BY1 A;  3F6V A;  1VTN C;  5EJC A;  2VE9 A;  3QOE A;  3BR0 A;  2Y30 A;  2M5W A;  2MA3 A;  3I55 I;  3F9K A;  2IS2 A;  2HOA A;  3BZK A;  3OYA A;  5E1W A;  2QYO A;  2Y9Y A;  1MBG A;  4BBS J;  4ZH4 F;  2QZ8 A;  4CCJ A;  1ZLJ A;  2WAD A;  5ILU A;  3AAF A;  2QQA A;  2Y48 A;  1QU3 A;  1PVE A;  3KP7 A;  2VKV A;  5IYB J;  2UUZ A;  4MLO A;  4BDY A;  5DCF A;  2ZJ2 A;  1ZRF A;  4B8X A;  5D8L B;  1Y6I A;  3DKW A;  4A0Y A;  5EG0 B;  2L9R A;  2NS0 A;  2XF7 A;  2DMP A;  1Y1W J;  4C30 A;  1FOX A;  4Q48 A;  2IGK A;  3B73 A;  5J1U A;  4EM1 A;  1P92 A;  2MW8 A;  2P7C B;  1DU6 A;  4B09 A;  3EUK L;  3D1N I;  1T95 A;  2IRF G;  5EZG A;  1SAN A;  2DLL A;  2L9V A;  2DOF A;  1AA7 A;  1U9N A;  2IT0 A;  1YW9 A;  1Z3X A;  1IJW C;  4LK0 F;  1HXD A;  2WV0 A;  2ZME B;  4P9U A;  1WH7 A;  2GLO A;  1XS9 A;  2G7H A;  4BYY A;  2EIM H;  2E60 A;  1RR8 C;  3RIR A;  2WWY A;  3P9I A;  3V7C A;  1F1Z A;  1FZP B;  5HLH A;  4KJZ A;  2GXG A;  2MC4 A;  1PDN C;  4EJV A;  3TW6 A;  4HYE A;  5E18 F;  2R93 J;  2NOJ B;  1H8A C;  3G1M A;  1ETQ A;  1KU9 A;  3EUH C;  4KIF A;  2IGO A;  2DA3 A;  2Y69 H;  2X9D A;  4RAG A;  3L09 A;  1O3Q A;  3UR3 C;  2MC3 A;  3BR5 A;  3IRR A;  2ESH A;  2GIZ A;  4X0G A;  1T39 A;  3BC8 A;  3DXJ F;  2CW7 A;  5EGO B;  2KFD A;  1BA5 A;  2QF7 A;  2DFF A;  4A12 A;  3BG5 A;  2K86 A;  3WTU C;  3WGH A;  2EA4 A;  4AWX B;  3G1O A;  1U0J A;  2K5C A;  3ELK A;  3MKL A;  1IAW A;  1LFU P;  2EIL H;  4MTE A;  1X58 A;  2LY9 A;  2W48 A;  3F8N A;  3QYB A;  2P7V B;  5KHD A;  3J7A O;  4BBR J;  2R7U A;  3L2U A;  2IBD A;  1WWX A;  3FF5 A;  2H1L A;  3MMY B;  1B6A A;  1MH3 A;  2GXB A;  5L3C A;  2R7S A;  2RV8 A;  1V5E A;  1XG1 A;  4XM3 A;  1I27 A;  2FMY A;  4OIN F;  3VWB A;  2OZ6 A;  2ZJP F;  1UJ8 A;  3BZC A;  4BUP A;  4BAC A;  3OOP A;  5IP6 A;  4L5E A;  4BXX J;  1YQA A;  1U9O A;  2R92 J;  5J6X A;  2OTL I;  1ETO A;  5LEK A;  4JX4 A;  5F0H A;  1W7P A;  1OCO H;  2EFP A;  1W4M A;  5DD8 A;  2OF7 A;  3PO2 J;  2GIV A;  5FO5 A;  4N4O B;  3EDP A;  3LNQ A;  4P96 A;  1RET A;  4WX9 A;  4XMY A;  2VOP A;  1GHC A;  4H4K C;  5D5U B;  2VJI A;  3DLA A;  3T0Y A;  2STT A;  4KFC A;  1JUM A;  1VQ8 I;  1MMA A;  2QKL B;  4C9Y A;  4OIP F;  2JZY A;  2M7B A;  1YJN I;  4LMY A;  6PAX A;  1EV7 A;  2KIU A;  3HL2 A;  3KYC B;  4IX7 A;  3BG6 A;  2XRO A;  3GTG J;  2ZME C;  5C4X J;  4EGY A;  2KJB A;  4WWC A;  1BI1 A;  3RYP A;  5M5W J;  1BL0 A;  4M74 A;  4RGR A;  2LKX A;  2K9S A;  3SHF A;  2M30 A;  5FRN A;  2DDA A;  4HF2 A;  5J1Y A;  3CF5 F;  4G12 A;  3U1K A;  2L0K A;  1KYZ A;  3VYU B;  4D5C A;  4XON A;  2HR3 A;  4BJT A;  3TO6 A;  1J9I A;  2XVC A;  1DUX C;  1QO0 D;  2LY2 A;  3PIP F;  2PJP A;  2IS4 A;  4KIS A;  1LQ1 A;  4E7L A;  2VI6 A;  3QYF A;  2X6O A;  3SEQ A;  5AIQ A;  1JT0 A;  1JXS A;  4ZC3 A;  3ECH A;  4X6A J;  3MZY A;  4ZDO A;  3ZXS A;  4ESJ A;  3G73 A;  1E17 A;  3CLO A;  3C2B A;  2E71 A;  2HI3 A;  3OYL A;  3HUG A;  2BHZ A;  4CCN A;  4KDP A;  3LA3 A;  2I10 A;  1JT6 A;  2L02 A;  2FOK A;  3E97 A;  5BNG A;  1LEB A;  2K85 A;  2M8G X;  1YJW I;  5F64 A;  5F6F A;  4XID A;  3WHB A;  3TO9 A;  5FJ8 J;  2R3S A;  1SVL A;  2CJJ A;  1T2K A;  3I4N J;  4WF2 A;  2FNA A;  3RPQ A;  1YE9 A;  2H6C A;  4B3A A;  1TT5 B;  1XX5 A;  2BGC A;  1KYW A;  4GFB A;  2DA5 A;  2RNJ A;  4FQG A;  4AID A;  3TDZ C;  3PQK A;  1VQ4 I;  3U2R A;  5D6E A;  4OAZ A;  2CSO A;  2JTV A;  3G3Z A;  5KCM A;  2QBY A;  2FQ4 A;  3HJE A;  1IXR C;  3E3V A;  3RZO J;  1IRF A;  4ZYD A;  3KCC A;  4XLF A;  2PMZ N;  3JRB A;  3COA C;  4NBQ A;  3K1P A;  1SFX A;  1VQ6 I;  1FP2 A;  3CUQ A;  1SEU A;  2XF6 A;  4F52 A;  3ASO H;  3WTX C;  3FKI J;  4F92 B;  4M3F A;  5B1B H;  2GAU A;  4ZYG A;  3CJR B;  4ZJZ A;  2WTE A;  2PG4 A;  4G6D A;  3GX4 X;  5BPI A;  1U3E M;  2DK8 A;  2IVM A;  3REO A;  1G3S A;  4EJT A;  2QWW A;  3HGG A;  2LNB A;  4NC7 A;  5HLI A;  2VC0 A;  3HG9 A;  3ZQQ A;  2ICW G;  4JX5 A;  4UVA A;  3HHG A;  4LLN A;  5D8K B;  2EA2 A;  3H3Z A;  3Q0U A;  3PO3 J;  2QCO A;  2QSF X;  2OV7 A;  1S72 I;  4NQW A;  4I76 A;  3LSG A;  1IGN A;  4XKV A;  3NWT A;  2MLG A;  3CDI A;  5LHI A;  4BXU A;  1J59 A;  1S29 A;  1T56 A;  4BQN A;  2W1O A;  1FJL A;  5H20 A;  1Z1D A;  1HBX G;  5F27 A;  1J2X A;  2WY7 Q;  3BQY A;  1ETK A;  3ZQI A;  1SD6 A;  3CO6 C;  1HOM A;  1YIJ I;  3KEY A;  4JOM A;  2RN7 A;  1TC3 C;  4RM3 A;  4XOT A;  3VSK A;  4L0Z B;  1WJC A;  2CFX A;  2M3A A;  1KU7 A;  2EFW A;  2EH3 A;  2H6B A;  1Q1H A;  5DCM A;  3CCE I;  4MHG A;  3ZN0 A;  4AD9 A;  3OS0 A;  1FOK A;  1B72 A;  4IOA F;  2E1N A;  3IHU A;  3QAH A;  3F21 A;  3K70 C;  4NUB A;  2CMP A;  3BR2 A;  1TNS A;  2EFO A;  2F5F A;  4EM2 A;  5HDK A;  2O61 A;  1X19 A;  4LIV A;  4XIC A;  1RUO A;  2DFE A;  3HXL A;  2IS6 A;  1IN6 A;  3A02 A;  3SQN A;  1RZ4 A;  4HST A;  3I3L A;  4QTR A;  3ZP5 A;  3GO5 A;  2JWT A;  3HUG B;  2XPU A;  3ONQ A;  2K4J A;  3T5X A;  2L5Q A;  4A3L J;  1NG6 A;  5JFR A;  1ZQ3 P;  5DV5 A;  2JRM A;  3K4K A;  1YRN B;  3TKY A;  2XB0 X;  5HDN A;  3HKZ N;  2HXI A;  3WU0 A;  2JPC A;  3Q3S A;  2UZK A;  1OYW A;  1YW8 A;  4G8X A;  1P7I A;  1Z6R A;  1WRJ A;  5HLT A;  4CCK A;  5DYM A;  5C3E J;  1EF4 A;  2PMU A;  3U9G A;  2BV6 A;  3CMM A;  3FXM A;  1HQC A;  5KVR A;  1ZGA A;  1KGS A;  1O3T A;  1Y1V J;  1AWC A;  1V4R A;  3LA7 A;  4JBA A;  2COM A;  3DFG A;  1MBK A;  2EWN A;  2V4J C;  5IPA A;  3N05 A;  4EMS A;  2VKD A;  1WI3 A;  3DEW A;  2CUF A;  2X0L A;  2DU9 A;  1S6L A;  2XAF A;  2ZNZ A;  3FXO A;  3V42 A;  1S9H A;  2R0Q C;  1FIP A;  3RPU D;  4MGR A;  3SXY A;  2WV1 A;  3AG1 H;  2Q2E B;  4CCL A;  3RKY A;  3MAJ A;  4H0E A;  2WC2 A;  2QQ9 A;  4LD5 A;  1FLI A;  1EH8 A;  4U0Y A;  3JSP A;  3KZI C;  1D1C A;  4F7Z A;  3IWZ A;  3IL2 A;  2XGE A;  4QWQ A;  1JGG A;  2M0M A;  3QPT A;  4U7D A;  2BBY A;  1KQ8 A;  4L5I A;  3CMY A;  1ZLK A;  3FK6 A;  3RKX A;  3BP8 A;  5B5E C;  1DQU A;  2ZXJ A;  3KET A;  4Z2Y A;  3DTK A;  1FSH A;  4I7H A;  4XNF A;  2W82 A;  3GBG A;  2B63 J;  2DT5 A;  3BWG A;  4L9N A;  2FOW A;  1IDY A;  3O6B B;  2D5V A;  2E7W A;  4UB6 C;  2HEO A;  1H88 C;  2XAJ A;  3WTY C;  2ELK A;  1U5T B;  2R7F A;  3B02 A;  4HZF A;  3BRO A;  1LUJ B;  4I98 B;  3OYD A;  1HF0 A;  2VPR A;  3OV8 A;  1R4N B;  4ZTJ A;  5GPA A;  1MJB A;  2YU9 J;  2NS8 A;  1MDM A;  1U2W A;  2RNG A;  3DCF A;  3HPH A;  3KYL A;  3BPX A;  3S8P A;  3OSG A;  3WTZ A;  4N9I A;  2Z3Y A;  2HVR A;  2M2E A;  5TGT A;  2ZNY A;  1MBH A;  2RAE A;  2D1V A;  1IRZ A;  2WAQ A;  1Z91 A;  4FAS D;  3HSR A;  4RBO A;  1XDU A;  4BHB A;  3TGN A;  1QVU A;  1XB4 A;  1BN5 A;  3ZGK A;  1QHH D;  4XRS A;  3H5N A;  2L4M A;  1ZGW A;  1Y8Q B;  2PX9 A;  2FX0 A;  4LIT A;  1B72 B;  1MSF C;  1KU2 A;  2F5E A;  1R5H A;  4A3C J;  1XSV A;  4PDK A;  1H9T A;  3HRM A;  2VBW A;  1TQM A;  3J81 Z;  3CCS I;  2LP0 A;  2O03 A;  1TZL A;  4R8H A;  1TL8 A;  1Q1V A;  5CVU A;  4DNC A;  3CQZ J;  3HOU J;  3FM3 A;  2BW3 B;  4DZJ A;  3SEZ A;  4CYC B;  1CGP A;  3EET A;  1OR7 A;  1UG0 A;  2OBP A;  3HOV J;  3BTI A;  2FU4 A;  1LKX A;  1VQP I;  3GTO J;  2KRH A;  2M4G A;  4UY8 I;  3LA2 A;  4DW6 A;  1X4O A;  3MVP A;  1BOB A;  1ZG3 A;  3ZQF A;  3HC7 A;  5K7Z A;  2QGU A;  3GZN B;  4LG3 A;  4KNY A;  3KP4 A;  2VON A;  1ZRC A;  2L54 A;  1B59 A;  1VND A;  2FML A;  1D3Y A;  5ERI A;  1QZY A;  4Y3O A;  4I2O A;  3VEP A;  5BMZ A;  1PJR A;  1H0M A;  5GPC A;  1FSE A;  4W1U A;  2XIG A;  5K1Y A;  2L3D A;  4N9H A;  3QPH A;  3MFK A;  3I59 B;  2JT1 A;  5E1X A;  4KT5 C;  3G71 I;  1KON A;  2IGN A;  1MH4 A;  2CS3 A;  4X1E A;  3RYR A;  3M8J A;  5F04 A;  2HS5 A;  1VQO I;  4WK8 F;  5FKN A;  3CD6 I;  2X6W A;  4HG2 A;  4J00 A;  5J8F A;  4PJL A;  2FD5 A;  5GP9 A;  5J47 A;  2BOL A;  2Y2Z A;  3CLQ A;  3J7Z I;  2BYV E;  2MH9 A;  1YHQ I;  2QEN A;  3E1S A;  4A0Z A;  2P0W A;  1YLF A;  1U5T C;  1Z77 A;  2FQ3 A;  5JVT A;  5GTH C;  2ACJ A;  1ON2 A;  4B47 A;  3R61 A;  2JQ7 A;  3H3V K;  1FIA A;  3F23 A;  4IOC F;  1K78 A;  4CHU A;  3E7L A;  4N0B A;  4CUG A;  2BHY A;  2MYS A;  1AOY A;  2H27 A;  3FBN B;  3QU6 A;  3ZCO A;  4QPO A;  5FLX Z;  4GO1 A;  3W2A A;  1JE8 A;  2V6E A;  2W84 A;  3GCM A;  5TRD A;  4XLP F;  5K5Q A;  1PUF B;  2Z99 A;  1CQT A;  2X1E A;  2BVM A;  3FXQ A;  3KZY A;  5F1R A;  2DJI A;  5JHU A;  3F22 A;  1ETW A;  3PSF A;  3ZRG A;  2HOE A;  2KMU A;  2CO5 A;  4BHC A;  3J7A Y;  2ELH A;  3PUB A;  3N4M A;  4Y13 A;  1P7J A;  3LQQ A;  3LWF A;  1HSJ A;  3ZMU A;  3PJR A;  2QM3 A;  4ABZ A;  1IC8 A;  1NK2 P;  2VC1 A;  1ZH5 A;  2K4B A;  1HW5 A;  3BTL A;  3JRI A;  3CMA I;  2CQX A;  2FRH A;  4ON0 A;  3K4B A;  3ERM A;  3CP8 A;  1R1U A;  4MNU A;  3L00 A;  5L3D A;  3G6E I;  1T33 A;  3DLL F;  1Z67 A;  1ZN2 A;  2ZCW A;  5H2F C;  3IWF A;  1EA3 A;  5BOX A;  1BI2 A;  1I5Z A;  1SC7 A;  3LSI A;  4CZZ A;  4I02 A;  1IW7 F;  4U87 A;  2R5Y B;  3ZQG A;  2CGP A;  3BTC A;  3PNY A;  3W3C A;  1UHS A;  3L2V A;  1FTT A;  2NNN A;  4KT6 A;  3K70 D;  4XQF A;  3BJO A;  1IRG A;  1ZG1 A;  4XBF A;  3JCU C;  1ZG5 A;  4BQQ A;  4HA8 A;  2NNY A;  2HQR A;  2FBH A;  2CW0 F;  2VT3 A;  2EIK H;  3O8H A;  3Q9V A;  1IZ1 A;  3E0J B;  5HS9 A;  3OR2 C;  1QPM A;  2RRE A;  3N97 A;  4P5O A;  1D5Y A;  3QRF F;  4C3H J;  1FT9 A;  2VXD A;  5JVG F;  3FXL A;  1ZAO A;  2WA0 A;  2W4S A;  3H36 A;  1FOW A;  3F6O A;  1LDJ A;  3QU3 A;  5KNL A;  4I09 A;  4QSH A;  4YG2 F;  1YS7 A;  2DMT A;  2E36 A;  3MWM A;  3IP4 B;  1P2F A;  4ASN A;  1TNT A;  1R7J A;  4FCY A;  3VYT B;  1OQY A;  2XKO A;  4XLH A;  2IS1 A;  3I0T A;  4A3K J;  1VQK I;  4QPQ A;  2JN6 A;  4HX7 A;  4PGH A;  4DBQ A;  3BJA A;  3HTU A;  1TWG J;  3TED A;  1FX7 A;  4RM2 A;  4FIS A;  3MD2 A;  4NHJ A;  3E5Q A;  3VSL A;  2PJR A;  2NVT J;  2KL4 A;  5IOZ A;  1W7P D;  3FMQ A;  2PEX A;  3KP6 A;  2V9K A;  2E35 A;  2DQL A;  5FLM J;  3P5J A;  3H0G J;  1R23 A;  1T8I A;  1K79 A;  1DP7 P;  3KFW X;  3LSJ A;  1O3R A;  5E1Z B;  3I4M J;  3DKY A;  1K78 B;  3DP7 A;  4G7Z F;  4WXD A;  4OMY A;  1DGR M;  5ICC A;  2GWR A;  2ME6 A;  4CA0 A;  1YOV B;  5EEH A;  3OYF A;  2EQR A;  3H35 A;  2J5P A;  4PFP A;  3NQO A;  1QGP A;  3I64 A;  4UUV A;  1MBE A;  1R1T A;  4KUM A;  2QQB A;  3AL0 B;  2EV6 A;  2G9W A;  1RIO H;  1SFO J;  2FBK A;  3QQA A;  3QOP A;  1TLH B;  3DBH B;  4XKC A;  2LBF A;  4MTD A;  3LST A;  1R58 A;  3W6J B;  3S3M A;  4A0X A;  5D4S A;  3R0A A;  2W57 A;  3LSM A;  2DW4 A;  3U21 A;  2R7O A;  2ID3 A;  5EYR A;  5GTI C;  3GVA A;  3KPH A;  2CRG A;  5IYD J;  5DS9 A;  2AHQ A;  5L3E A;  2VKE A;  5GAE J;  1L0O C;  3O8G A;  1QHG A;  1XMK A;  1QBJ A;  1I1S A;  1YYV A;  1OKR A;  4WCG A;  2OPT A;  3GW2 A;  1XC5 A;  5JLW A;  3ABU A;  1B4A A;  1BIA A;  3PIO F;  5FFX A;  3CO7 C;  2KZV A;  1R71 A;  4Y52 J;  1MJ9 A;  4IL6 C;  1X3Z B;  2E19 A;  2CV0 A;  4LLL A;  1OCR H;  4PJJ A;  3WOD F;  2UXN A;  1A5J A;  2A69 F;  4M3E A;  5F0F A;  4QLC U;  4JX6 A;  2E2J J;  2AXT C;  3TL4 X;  3E5X A;  5EEG A;  1IN7 A;  4PJ0 C;  5HDG A;  3R60 A;  3ZQ7 A;  2E1C A;  4OMZ A;  2PFB A;  4QIW N;  2VBZ A;  5AON A;  3JAM Z;  2JJ7 A;  1X1A A;  4KN7 X;  3GTP J;  4HDU A;  1FP1 D;  3FDY A;  1W36 C;  2JA7 J;  4HW0 A;  1NG7 A;  3CP2 A;  1AHD P;  1FYL A;  2R7V A;  3K69 A;  1AU7 A;  1W5T A;  4LB5 A;  3K4N A;  2L7Z A;  3H3U A;  3V8J A;  3V8L A;  3TMO A;  1BC7 C;  3WU2 C;  4YRV A;  2EIN H;  1JTY A;  1U78 A;  1E0E A;  4A2U A;  4RGX A;  4XKW A;  4DYR A;  4PGG A;  4IZZ A;  2VIX A;  5LHH A;  2YS9 A;  4UVB A;  3CME I;  2Z1D A;  3LFK A;  3BR1 A;  3OYH A;  2NVY J;  5TJJ A;  1I6H J;  2E34 A;  3JW4 A;  3MKY B;  2DPD A;  4JQF A;  5TIS C;  1S7E A;  4RGU A;  4KMF A;  3L9F A;  1W0U A;  2P5K A;  5HOD A;  5EF6 A;  1K4T A;  2GOX B;  1IO2 A;  2ECC A;  2R7Z J;  5LGU A;  4MEY F;  4LK1 F;  1J09 A;  2L9S A;  1XMX A;  1A04 A;  2V9P A;  3RDI A;  4UV9 A;  1MMD A;  5D5W B;  3EQL F;  3AL0 C;  3I9V 2;  4M6Y A;  2P6S A;  2GBY A;  2L01 A;  1PP8 F;  1K6O A;  5EEA A;  4YFK F;  2PJR B;  1X1D A;  3L2Q A;  2H8R A;  2MH2 A;  4ZTF A;  2CQK A;  3W6V A;  4FE4 A;  2CUJ A;  3HB9 A;  3S14 J;  3JRE A;  2A6E F;  3CCL I;  2PN6 A;  2CUE A;  5K5R A;  5ICF A;  1IRX A;  5CJ9 A;  1VQM I;  1R00 A;  2HZD A;  2RQP A;  1JKR C;  5HNH A;  1RPW A;  2PBI A;  3BR3 A;  5K7F A;  1GV5 A;  4YFX F;  1EKE A;  3L1P A;  5K7H A;  2UV1 A;  2OCC H;  2H1K A;  3KE2 A;  3ZMV A;  3ZMT A;  4B48 A;  1P9Q C;  3RZD J;  1FWZ A;  2DXI A;  4EGZ A;  2W00 A;  4BE2 A;  1BBY A;  1FTZ A;  5HOO A;  1VQ9 I;  2VQC A;  4XN0 A;  1WZ2 A;  3NAU A;  4CO8 A;  2LBF B;  1MZB A;  1MJA A;  5HS8 A;  1G8X A;  3LOC A;  4FE7 A;  1E2X A;  3DEE A;  3OR1 C;  3S1M J;  2OJE D;  2RVC A;  2WAF A;  4RAF A;  2M9H A;  5KK1 A;  1BJA A;  4PJM A;  3MZH A;  1VZ0 A;  1TWH J;  4HF1 A;  5LRS A;  1LJ9 A;  3ZOB A;  4E7J A;  2FXA A;  4J19 A;  4I01 A;  1TWA J;  1P4A A;  2DYR H;  4AVP A;  4BGD A;  2L7M P;  4GRI A;  4HV6 A;  3CZ6 A;  2V1X A;  1ENH A;  4KN4 X;  3ZMZ A;  2DOA A;  2AS5 F;  1F9N A;  1W5S A;  2QA4 I;  3W6K B;  4IHX A;  3CDH A;  2PMZ A;  3OL3 A;  2NVX J;  3DQV C;  2VJ5 A;  4MFE A;  1XSD A;  3OMY A;  5CVJ A;  1RI7 A;  3QYE A;  3PM1 A;  2XKP A;  4UNO A;  4F91 B;  1I3Q J;  5M3F J;  3BDD A;  1NK3 P;  1U6G A;  2CFO A;  3M7G A;  5EDN A;  2VT2 A;  3BLY A;  4C2T A;  2QQ8 A;  2DJN A;  2ESN A;  1LEA A;  3GZ5 A;  2XPW A;  1DPU A;  1OFC X;  3G2B A;  3CCU I;  4O6J A;  3HM5 A;  4IF4 A;  2IA0 A;  3GF2 A;  3I5U A;  4C2M J;  2BVL A;  2EV0 A;  4Y17 A;  3BZ6 A;  1RNL A;  2DFI A;  4OIR F;  1W7P B;  4GDF A;  4OIQ F;  3HOX J;  3HSE A;  2DA6 A;  2XAG A;  2L4A A;  4ZDL A;  2XRN A;  4GYG A;  3HOT A;  4HLY A;  2L7F P;  1GXQ A;  4JYK A;  4D7M A;  3KP2 A;  1ZR2 A;  1LVK A;  5IYC J;  2EZK A;  2L9N A;  3KP5 A;  1DPR A;  3CCV I;  1Y39 A;  1VF9 A;  2M8E A;  5ED4 A;  3RI4 A;  3S2H J;  2ADU A;  4A6E A;  2FA5 A;  3K1M A;  3TOA A;  3JRH A;  4U7B A;  1Y8R B;  2O3F A;  4LG0 A;  3WG7 H;  1BI3 A;  1F4K A;  1FBU A;  1MMN A;  3FHZ A;  3OYK A;  3VOE A;  4BY7 J;  3JTG A;  1APL C;  4IHS A;  1T0F A;  2Q1Z B;  5GAG J;  4V19 K;  3T1B A;  1OLT A;  1WVR A;  3LAP A;  4M71 A;  2KIF A;  2XUB A;  2LRE A;  4RS8 A;  4DQ2 A;  3DPL C;  4DBR A;  2QEX I;  1ZTR A;  3ZR8 X;  2HKX A;  3ISP A;  3OL4 A;  3M3Y J;  1S8N A;  2DDB A;  3CCR I;  2ETH A;  2B7E A;  2IEK A;  3DU6 A;  3LFU A;  2NVU B;  2A6H F;  4AYB A;  2Z2S B;  2E5N A;  1QNT A;  3JRA A;  3OYM A;  2XF5 A;  4HBL A;  3CC4 I;  4AYB N;  3BJ6 A;  3P9K A;  1EH6 A;  2ZJR F;  2IW5 A;  3I53 A;  3M9A A;  4DJA A;  3BG3 A;  3PNV A;  3OIQ A;  2MD0 A;  4GGG A;  3OWT A;  4PUS A;  4D1Q A;  4V2F A;  1YO5 C;  1XGM A;  1I39 A;  3S15 J;  4CXF A;  1XD7 A;  2MG4 A;  2QSH X;  1V5G A;  2DAO A;  3F8M A;  1VFC A;  3C7J A;  4B1R A;  1SFE A;  2HFH A;  4P55 A;  1PP7 U;  3HKZ A;  1ZAR A;  2AQF A;  2ELJ A;  2EZL A;  4OU0 A;  4DGW B;  3I58 A;  5E20 A;  2O8X A;  3DBR B;  1CF7 A;  1GVD A;  4HX4 A;  5JLX A;  5D5X B;  3ERE D;  1F5T A;  4RLF A;  2LTP A;  2IXS A;  4EAT A;  2X6X A;  3IH4 A;  1GUU A;  5L3G A;  2ZFW A;  2KDZ A;  4ENJ A;  1I50 J;  3BPV A;  1MIJ A;  2K27 A;  2YX7 A;  2NOG A;  3A1Y A;  1LE8 A;  2QSG X;  2XRL A;  2HDD A;  1OYI A;  2QBY B;  3EYI A;  3VB2 A;  3R0J A;  3CCM I;  2NAZ A;  1I3A A;  1FMW A;  1ZYR F;  5IOY A;  1J7K A;  1T08 B;  2VQG A;  4XOP A;  2JA6 J;  1VQ5 I;  4JK1 X;  3CUQ B;  3MZ8 A;  2O6G E;  4E7Z A;  2IGM A;  2F5D A;  2OZU A;  3WTS C;  2MFZ A;  2ZSI B;  3I4P A;  3HSF A;  3TQN A;  4S04 A;  1WFX A;  3ECO A;  3MKZ A;  1Z21 A;  5IT9 K;  1Z6T A;  5E17 F;  4B3X A;  1REP C;  1UST A;  4UVC A;  1W36 D;  3LL7 A;  4Q4Z F;  2IA1 A;  1Y56 A;  3GZ6 A;  1D5V A;  4BU2 A;  1D1A A;  1BC8 C;  1MSE C;  1GLN A;  5F0C A;  2AXL A;  1IN4 A;  4PSW A;  2K9M A;  3KYD B;  3SDB A;  1JJ6 C;  2VN2 A;  3DEU A;  2AO9 A;  4AIJ A;  1X1B A;  1X3U A;  3I54 A;  1XCB A;  2B9S A;  3CJQ B;  3E5U A;  3H5R A;  1IN8 A;  2FF4 A;  3K9T A;  2DK5 A;  4NQW B;  2WBM A;  3BOQ A;  3CF2 A;  4NNJ A;  4CH7 A;  1AKH A;  2CH0 A;  1USS A;  2WB1 N;  3GTM J;  3M4O J;  1D8J A;  2F4O B;  1IUY A;  4GYI A;  2O9L A;  3Q9S A;  1HKT A;  2A05 A;  1X4P A;  1OPC A;  2BY2 A;  3J80 Z;  3DF8 A;  4LG0 B;  3CES A;  2CYY A;  4HRI A;  4NB5 A;  3OYC A;  1E3O C;  1UCR A;  5DM6 F;  2OTJ I;  2CQQ A;  4DYQ A;  4RDU A;  4IO9 F;  3M8F A;  4UXN A;  3OYJ A;  5KAF C;  3FXU A;  4HSR A;  2E5Z A;  4WXC A;  1LB2 A;  2ZC2 A;  3D5S C;  1HKS A;  4E7H A;  3S32 A;  2YPR A;  5DCM B;  2HQ5 A;  1G6N A;  3JSO A;  5BS6 A;  2OUM A;  4IVN A;  3L2R A;  2Z9O A;  2DA1 A;  3L2C A;  2X85 A;  2EIJ H;  1BIB A;  1ZRD A;  2OAZ A;  3ABL H;  4B44 A;  1JKO C;  4XLN F;  4FTH A;  2GQQ A;  5LGT A;  2RDP A;  1OJL A;  3A0H C;  4II2 A;  1G2H A;  1FOY A;  3AKZ A;  2LSO A;  4NC6 A;  3W2V A;  4M3D A;  2TRT A;  4ZYA A;  2DBB A;  1TP4 A;  2HDW A;  1A35 A;  4XN3 A;  4A3J J;  4XK4 A;  2LKP A;  2ZSH B;  3OYB A;  1KQ0 A;  2BY0 A;  2VXZ A;  4E7I A;  2V9V A;  4UV8 A;  3JRD A;  3G4S I;  3B6A A;  3GTL J;  2HXO A;  2RKH A;  3EUH A;  2VKH A;  4C3J J;  1NH3 A;  3MQ0 A;  5DEQ A;  3VYR B;  1CF7 B;  3CUQ C;  3FIS A;  4YFN F;  3PQJ A;  3FZV A;  4EJU A;  1MMG A;  4J01 A;  2YU3 A;  3TO7 A;  1Z3Y A;  2LKS A;  1RUN A;  3A01 A;  3D5L A;  1W5C C;  1H9G A;  5J3L A;  2ZO4 A;  2PLY A;  1R5I D;  2UXX A;  3UNG C;  3OYG A;  2VLA A;  2GM4 A;  1IF1 A;  5HVQ C;  2HNH A;  3ZQC A;  1LE8 B;  5JR3 A;  1PUE E;  3T8R A;  5LLQ A;  4W97 A;  2JSC A;  3VPR A;  5FRO A;  3FXJ A;  4AUX A;  3LAJ A;  4Y7N J;  2ZB9 A;  2L2O A;  4L9J A;  2OQG A; 
#chains in the Genus database with same CATH homology
 3VFZ A;  1I1G A;  4LB6 B;  2OU2 A;  2ZKZ A;  5FD6 A;  1R1V A;  3FX3 A;  1KA8 A;  1YFH A;  3HHH A;  1MD0 A;  3FXR A;  3IKV A;  1O7F A;  3S2W A;  1OYY A;  4LFU A;  4EQQ A;  2M87 A;  3TDU C;  3FMS A;  1LVA A;  4ETS A;  2PMH A;  5D6F A;  2X4H A;  2ZBK A;  4KIB A;  4KYW A;  1MDM B;  1FPQ A;  4FHT A;  2ZME A;  1JHH A;  4KMU X;  3WG9 A;  1WQ2 A;  2HYF A;  2XAS A;  5D5V B;  1SD4 A;  1YS6 A;  2G7U A;  2XAH A;  4LGW A;  4EM0 B;  1B9N A;  2NRA C;  4RAY A;  1WI9 A;  5A2Q K;  2GA1 A;  5LHG A;  1FBQ A;  2IJL A;  3C1D A;  3F3X A;  5DUK A;  3D0S A;  1IXS B;  3J81 K;  4OIO F;  4AIH A;  1WKM A;  1QZZ A;  2FNP A;  4ZZL A;  2KIM A;  2HWV A;  1V3F A;  4O3M A;  2DTR A;  3M8E A;  4HX8 A;  3WTW C;  1FYK A;  4ESB A;  1XSX A;  5L3F A;  3DPT A;  4M9X A;  1SFU A;  4LLG F;  2M1B A;  3HRT A;  1LNW A;  2XGX A;  1XMA A;  4A5N A;  4ESF A;  5CVR A;  4M9S A;  4Q5S F;  1TQP A;  3GLX A;  4A6D A;  4G7O F;  1HKQ A;  2MLK A;  3BY6 A;  4ENK A;  1XGN A;  3HRS A;  1UHW A;  1ONV A;  2H94 A;  2P6T A;  5JI6 A;  2KKO A;  4TV7 A;  5CVI A;  1Z05 A;  2D2W A;  3C18 A;  1C0W A;  2A61 A;  2VBY A;  1FY7 A;  1Z9C A;  1IXC A;  2A5Y B;  4G9Y A;  2Q8K A;  5FLX K;  2P5L C;  4IPA A;  3SZT A;  4U0V A;  2D45 A;  2IA2 A;  4G7H F;  3K2Z A;  1S7O A;  1XN7 A;  1HW1 A;  1BM9 A;  2HTS A;  4A5M A;  1Z7U A;  3F8C A;  3GUD A;  4AIK A;  1SAX A;  3GFJ A;  3PFI A;  1SMY F;  2YR2 A;  4S05 A;  3QP6 A;  4IRG A;  2EV5 A;  3GFM A;  4HQE A;  2F2E A;  2IP2 A;  2ISZ A;  5FB2 A;  3FWE A;  1TW3 A;  3M1E A;  2LF7 A;  4L5J A;  2K7L A;  2VOO A;  5AIP A;  4R79 A;  5E8G A;  4RB3 C;  5CYV A;  3LQR A;  1TBX A;  3L7W A;  4MQ9 F;  4BNC A;  5H6R A;  5BQT A;  4G94 A;  5DUI A;  1TTY A;  4IRH A;  2DO7 A;  1XCV A;  1ZRE A;  2LF8 A;  4EJO A;  1I6X A;  2NYX A;  4XSZ F;  3WTT C;  1ULY A;  3HYI A;  2HQN A;  2A07 F;  2XAQ A;  3E6M A;  2Z33 A;  4GCV A;  2FEZ A;  1BOA A;  1FYM A;  3HIF A;  4HV5 A;  2CG4 A;  1B1B A;  4YIF A;  4FX0 A;  3KLN A;  4R1H A;  5BPD A;  2HTJ A;  1P4X A;  1O57 A;  5CVV A;  3GYH X;  3ML6 A;  3K1N A;  4L9T A;  2F5C A;  1YTY A;  3GFL A;  1R36 A;  2ISY A;  4Y15 A;  1SD5 A;  3IRQ A;  3RKW A;  4OOI A;  2A3S A;  1R22 A;  1UFM A;  4HQM A;  5FFZ A;  5LEJ A;  2EFQ A;  3GWZ A;  2P5V A;  3V7S A;  1ODD A;  3GEZ A;  2JRT A;  5ICG A;  2K02 A;  2MBF A;  3SZP A;  5K5O A;  2DQR A;  4L0Y B;  3O3K A;  4FX4 A;  5J8C A;  1UB9 A;  2PI0 A;  1L3L A;  2W85 A;  4BAY A;  3H92 A;  2OA4 A;  3R4K A;  4CIC A;  4RB1 A;  3P9C A;  1GXP A;  2EJR A;  3WE2 A;  4U88 A;  5L3B A;  4HLX A;  3JAM K;  5IT9 Z;  4KA4 A;  3O2P E;  4WXH A;  2Q2E A;  3KEQ A;  1LDD A;  1XDS A;  3KEO A;  3V4G A;  2BE5 F;  1O7L A;  3WTV C;  3WU1 B;  2RC4 A;  2KRF A;  4ZZD A;  4EJW A;  5FGM A;  4M72 A;  3HOS A;  2HDC A;  1U5T A;  1P4W A;  4RB0 A;  1QQI A;  4U0W A;  2OD5 A;  3F72 A;  4IXA A;  3WGG A;  3E6B A;  3JTH A;  2H09 A;  2J5O A;  4IJA A;  4M6X A;  4HF0 A;  3NEU A;  2HYG D;  1ZGJ A;  4PZJ A;  5ILV A;  1J75 A;  2VE8 A;  2RGV A;  2QUF A;  4P9F A;  3RTR A;  2STW A;  3HRU A;  3TOB A;  3FM5 A;  4IHT A;  4ZYH A;  3V8K A;  1G4D A;  2DI3 A;  2LDU A;  1KQ9 A;  2GZW A;  5LGN A;  2IPQ X;  4LJZ F;  2V1U A;  2HKO A;  3ZPL A;  2PQ8 A;  4BHP A;  5E8I A;  1FC3 A;  1SMT A;  3F8B A;  2Z5U A;  2P4W A;  5LRR A;  4RAZ A;  3EYY A;  2W24 A;  5HLG A;  3CUO A;  2OQR A;  3KLO A;  4RB2 C;  4HDV A;  3E6D A;  3I59 A;  5DD4 A;  1TW2 A;  3Q5F A;  1T6S A;  1UHM A;  1G3T A;  1DDN A;  4CDG A;  5LBQ A;  4EVI A;  3VOD A;  2EFN A;  2V79 A;  3KZZ A;  4ENN A;  3SFZ A;  4IRI A;  2EB7 A;  1LDK B;  3KP3 A;  1HW2 A;  2CWE A;  1FNN A;  3FMR A;  3QP5 A;  2HZT A;  4I0A A;  1J0R A;  1XGO A;  5DDG A;  2VBX A;  1KU3 A;  3K0L A;  4BH9 A;  1G3Y A;  1JGS A;  1STZ A;  1T38 A;  1R5G A;  2V6C A;  4EV0 A;  3MCZ A;  2DPU A;  1MKM A;  1YG2 A;  2YSR A;  4L18 B;  2Y0M A;  5A2Q Z;  2D1H A;  1ON1 A;  1S7A A;  4GXO A;  3T8T A;  4HAM A;  4CGZ A;  4BQA A;  4KIG A;  3WGI A;  4Q47 A;  1NHA A;  2FSW A;  1FBS A;  4RGS A;  3IC7 A;  2V1D A;  2UWM A;  5ILS A;  2O0Y A;  4PCQ A;  2Y75 A;  4HOB A;  2M45 A;  1ZHF A;  4G6Q A;  1Y0U A;  3HTS B;  3RPU A;  1XGS A;  1MGT A;  1BI0 A;  3CTA A;  2MD5 A;  2QVO A;  3V7R A;  4E70 A;  4XRF A;  3R6S A;  2C6Y A;  2HGC A;  1EH7 A;  4FT8 A;  5D4R A;  2QLZ A;  5CLS A;  1K7A A;  1U8R A;  1JHF A;  3E6C C;  3U1D A;  1P6R A;  2Q0O A;  4M73 A;  2JPB A;  3MEX A;  3ULQ B;  2VOD A;  3ROU A;  4I0B A;  4MQV A;  3ABT A;  4M9Z A;  1OMI A;  2E7X A;  3I71 A;  3C3W A;  3P7N A;  4K2E A;  3IKT A;  1GVJ A;  3CJN A;  4MEX F;  2FE3 A;  1IN5 A;  2B0L A;  1D8K A;  2R7D A;  1TQI A;  2EK5 A;  3F8F A;  4XSX F;  1G3W A;  4O5V A;  1YW7 A;  2W25 A;  4D0P A;  3J80 K;  5IT3 A;  2YX4 A;  5HS7 A;  3GXO A;  1SD7 A;  1J5Y A;  2P8T A;  2XV4 S;  2BEO A;  3ZMS A;  1WSU A;  2FBI A;  5FD5 A;  2TDX A;  3WE3 A;  4ZYE A;  4CYD A;  3DV8 A;  1T98 A;  3ZN1 A;  2XHK A;  5H6Q A;  4UHT A;  4YII A;  2KJC A;  1B9M A;  4ENM A;  5ICE A;  2A68 F;  1S3J A;  4KIC A;  3GFI A;  2GA2 A;  4L9V A;  1HST A;  3RJP A;  3NRV A;  1O3S A;  1YIO A;  3ZMD A;  3F6V A;  1VTN C;  2VE9 A;  2M5W A;  2MA3 A;  5E1W A;  2QYO A;  4ZH4 F;  2QZ8 A;  1ZLJ A;  5ILU A;  3AAF A;  2QQA A;  2Y48 A;  3KP7 A;  5DCF A;  2ZJ2 A;  1ZRF A;  4B8X A;  5D8L B;  3DKW A;  4A0Y A;  2NS0 A;  4Q48 A;  3B73 A;  4EM1 A;  1P92 A;  2P7C B;  4B09 A;  2IRF G;  2DLL A;  2IT0 A;  1YW9 A;  4LK0 F;  1HXD A;  2WV0 A;  2ZME B;  4P9U A;  2G7H A;  4BYY A;  3RIR A;  2WWY A;  3P9I A;  3V7C A;  1F1Z A;  1FZP B;  5HLH A;  2GXG A;  1PDN C;  4EJV A;  5E18 F;  4HYE A;  1KU9 A;  4KIF A;  1O3Q A;  3L09 A;  2MC3 A;  3IRR A;  2ESH A;  1T39 A;  3DXJ F;  4A12 A;  2K86 A;  3WTU C;  3WGH A;  2EA4 A;  4AWX B;  3ELK A;  1IAW A;  4MTE A;  3F8N A;  2P7V B;  3J7A O;  1WWX A;  3FF5 A;  1B6A A;  2GXB A;  5L3C A;  2RV8 A;  1I27 A;  2FMY A;  4OIN F;  2OZ6 A;  3OOP A;  1YQA A;  5J6X A;  5LEK A;  1W7P A;  2EFP A;  1W4M A;  5DD8 A;  2GIV A;  5FO5 A;  3EDP A;  4P96 A;  4WX9 A;  2VOP A;  1GHC A;  5D5U B;  2STT A;  3T0Y A;  4KFC A;  4OIP F;  2JZY A;  4LMY A;  6PAX A;  1EV7 A;  2KIU A;  2XRO A;  4EGY A;  2KJB A;  4WWC A;  1BI1 A;  3RYP A;  4M74 A;  4RGR A;  3SHF A;  2M30 A;  4HF2 A;  1KYZ A;  2HR3 A;  1J9I A;  3TO6 A;  2XVC A;  1DUX C;  1QO0 D;  2PJP A;  5AIQ A;  1JXS A;  3ECH A;  3MZY A;  4ESJ A;  3G73 A;  1E17 A;  3CLO A;  3HUG A;  4KDP A;  3LA3 A;  2L02 A;  3E97 A;  2FOK A;  1LEB A;  5F64 A;  5F6F A;  3TO9 A;  2R3S A;  1T2K A;  4WF2 A;  2FNA A;  3RPQ A;  2H6C A;  2BGC A;  1KYW A;  2RNJ A;  3TDZ C;  3PQK A;  3U2R A;  5D6E A;  2CSO A;  2JTV A;  3G3Z A;  2QBY A;  1IXR C;  3E3V A;  1IRF A;  4ZYD A;  3KCC A;  3COA C;  3K1P A;  1SFX A;  1FP2 A;  3CUQ A;  3WTX C;  2GAU A;  4ZYG A;  3GX4 X;  2WTE A;  2PG4 A;  4G6D A;  5BPI A;  1U3E M;  2DK8 A;  2IVM A;  3REO A;  1G3S A;  4EJT A;  2QWW A;  2LNB A;  5HLI A;  2VC0 A;  4UVA A;  3HHG A;  4LLN A;  5D8K B;  2EA2 A;  3H3Z A;  4NQW A;  5LHI A;  2MLG A;  4BXU A;  1J59 A;  1S29 A;  5H20 A;  1Z1D A;  1HBX G;  1J2X A;  1SD6 A;  3CO6 C;  2RN7 A;  4L0Z B;  2CFX A;  1KU7 A;  2EFW A;  2H6B A;  1Q1H A;  5DCM A;  4MHG A;  3ZN0 A;  4AD9 A;  1FOK A;  2E1N A;  3IHU A;  3QAH A;  3F21 A;  1TNS A;  2EFO A;  2F5F A;  4EM2 A;  5HDK A;  2O61 A;  1RUO A;  1IN6 A;  3SQN A;  1RZ4 A;  3ZP5 A;  3GO5 A;  3T5X A;  2K4J A;  5JFR A;  5DV5 A;  3TKY A;  5HDN A;  3WU0 A;  2JPC A;  2UZK A;  1OYW A;  1YW8 A;  4G8X A;  1Z6R A;  1WRJ A;  5DYM A;  2PMU A;  3U9G A;  2BV6 A;  1HQC A;  5KVR A;  1ZGA A;  1KGS A;  1O3T A;  1AWC A;  1V4R A;  3LA7 A;  4JBA A;  2COM A;  3DFG A;  2EWN A;  4EMS A;  4QLC U;  2X0L A;  2DU9 A;  1S6L A;  2XAF A;  2ZNZ A;  3SXY A;  4MGR A;  3RKY A;  3MAJ A;  4H0E A;  2WC2 A;  2QQ9 A;  4LD5 A;  1FLI A;  1EH8 A;  4U0Y A;  3JSP A;  4F7Z A;  3IWZ A;  3IL2 A;  4QWQ A;  3QPT A;  4U7D A;  2BBY A;  1KQ8 A;  4L5I A;  1ZLK A;  3RKX A;  3BP8 A;  2ZXJ A;  3KET A;  4Z2Y A;  1FSH A;  4I7H A;  2DT5 A;  3BWG A;  4L9N A;  3O6B B;  2E7W A;  2HEO A;  2XAJ A;  3WTY C;  1U5T B;  2R7F A;  3B02 A;  4HZF A;  3BRO A;  4I98 B;  3OV8 A;  1MJB A;  1MDM A;  1U2W A;  3BPX A;  3WTZ A;  4N9I A;  2Z3Y A;  2ZNY A;  2D1V A;  1Z91 A;  3HSR A;  1XDU A;  4BHB A;  3TGN A;  1XB4 A;  1BN5 A;  2L4M A;  1KU2 A;  2F5E A;  1R5H A;  1XSV A;  4PDK A;  1H9T A;  3HRM A;  2VBW A;  1TQM A;  3J81 Z;  2O03 A;  4R8H A;  5CVU A;  4DNC A;  3FM3 A;  1CGP A;  3EET A;  1OR7 A;  2OBP A;  2FU4 A;  3LA2 A;  1ZG3 A;  4KNY A;  3KP4 A;  2VON A;  1ZRC A;  2L54 A;  1B59 A;  2FML A;  1D3Y A;  5ERI A;  1QZY A;  4I2O A;  3VEP A;  5BMZ A;  1H0M A;  1FSE A;  2XIG A;  5K1Y A;  2L3D A;  4N9H A;  3QPH A;  3MFK A;  3I59 B;  2JT1 A;  5E1X A;  4KT5 C;  3RYR A;  2HS5 A;  4WK8 F;  5J8F A;  2BYV E;  2MH9 A;  2QEN A;  4A0Z A;  1YLF A;  1U5T C;  2FQ3 A;  5JVT A;  2ACJ A;  1ON2 A;  3R61 A;  3F23 A;  1K78 A;  4CHU A;  4N0B A;  1AOY A;  2H27 A;  3QU6 A;  5FLX Z;  4GO1 A;  1JE8 A;  2W84 A;  5TRD A;  4XLP F;  5K5Q A;  2Z99 A;  3KZY A;  3FXQ A;  5F1R A;  5JHU A;  3F22 A;  2HOE A;  2CO5 A;  4BHC A;  2ELH A;  3N4M A;  4Y13 A;  3LQQ A;  3LWF A;  1HSJ A;  3ZMU A;  2QM3 A;  2VC1 A;  1ZH5 A;  2K4B A;  1HW5 A;  2FRH A;  4ON0 A;  1R1U A;  4MNU A;  3L00 A;  5L3D A;  2ZCW A;  1ZN2 A;  3IWF A;  5BOX A;  1BI2 A;  1I5Z A;  4CZZ A;  4I02 A;  1IW7 F;  2CGP A;  2NNN A;  3BJO A;  1IRG A;  1ZG1 A;  4XBF A;  1ZG5 A;  4HA8 A;  2NNY A;  2HQR A;  2FBH A;  2CW0 F;  2VT3 A;  3Q9V A;  1IZ1 A;  5HS9 A;  1QPM A;  3N97 A;  4P5O A;  3QRF F;  1FT9 A;  1ZAO A;  3F6O A;  1LDJ A;  3QU3 A;  4I09 A;  4YG2 F;  1YS7 A;  3MWM A;  1P2F A;  4ASN A;  1TNT A;  1R7J A;  2XKO A;  3I0T A;  4HX7 A;  4PGH A;  3BJA A;  3HTU A;  1FX7 A;  4NHJ A;  3E5Q A;  1W7P D;  3FMQ A;  2PEX A;  3KP6 A;  2DQL A;  1R23 A;  1K79 A;  1DP7 P;  3KFW X;  1O3R A;  5E1Z B;  1K78 B;  3DP7 A;  4G7Z F;  4WXD A;  4OMY A;  5ICC A;  2GWR A;  5EEH A;  2J5P A;  3NQO A;  1QGP A;  3I64 A;  4UUV A;  4KUM A;  1R1T A;  2QQB A;  2EV6 A;  2G9W A;  1RIO H;  2FBK A;  3QOP A;  1TLH B;  4MTD A;  3LST A;  1R58 A;  3W6J B;  4A0X A;  5D4S A;  3R0A A;  2W57 A;  2DW4 A;  3GVA A;  5L3E A;  1L0O C;  1QBJ A;  1XMK A;  1I1S A;  1YYV A;  1OKR A;  4WCG A;  3GW2 A;  3ABU A;  1B4A A;  1BIA A;  5FFX A;  3CO7 C;  1MJ9 A;  4LLL A;  3WOD F;  2UXN A;  2A69 F;  3E5X A;  5EEG A;  1IN7 A;  5HDG A;  3R60 A;  3ZQ7 A;  2E1C A;  4OMZ A;  2PFB A;  2VBZ A;  5AON A;  3JAM Z;  4KN7 X;  4HDU A;  1FP1 D;  4HW0 A;  1FYL A;  3K69 A;  4LB5 A;  1W5T A;  3H3U A;  3V8J A;  3V8L A;  1BC7 C;  1U78 A;  4A2U A;  4RGX A;  4PGG A;  5LHH A;  4UVB A;  3LFK A;  5TJJ A;  3JW4 A;  2DPD A;  4KMF A;  4JQF A;  4RGU A;  3L9F A;  2P5K A;  5LGU A;  4MEY F;  4LK1 F;  1A04 A;  3RDI A;  4UV9 A;  5D5W B;  3EQL F;  4M6Y A;  2P6S A;  2L01 A;  1PP8 F;  1K6O A;  4YFK F;  2MH2 A;  2CQK A;  2A6E F;  2PN6 A;  5K5R A;  5ICF A;  5CJ9 A;  1R00 A;  2RQP A;  2PBI A;  4YFX F;  3KE2 A;  3ZMV A;  3ZMT A;  1FWZ A;  4EGZ A;  1BBY A;  5HOO A;  4CO8 A;  1MZB A;  1MJA A;  5HS8 A;  1E2X A;  2RVC A;  5KK1 A;  1BJA A;  3MZH A;  4HF1 A;  5LRS A;  1LJ9 A;  2FXA A;  4I01 A;  1P4A A;  4AVP A;  4HV6 A;  2V1X A;  4KN4 X;  3ZMZ A;  2AS5 F;  1F9N A;  1W5S A;  3W6K B;  3CDH A;  3DQV C;  1XSD A;  5CVJ A;  1RI7 A;  2XKP A;  4UNO A;  3BDD A;  1U6G A;  3M7G A;  2VT2 A;  2ESN A;  1LEA A;  3GZ5 A;  1DPU A;  4O6J A;  4IF4 A;  2IA0 A;  3GF2 A;  3I5U A;  2EV0 A;  4Y17 A;  3BZ6 A;  1RNL A;  2DFI A;  4OIR F;  1W7P B;  4OIQ F;  3HSE A;  2XAG A;  2L4A A;  2XRN A;  4GYG A;  3HOT A;  4HLY A;  1GXQ A;  3KP2 A;  3KP5 A;  1DPR A;  2M8E A;  5ED4 A;  3RI4 A;  2ADU A;  4A6E A;  2FA5 A;  3K1M A;  3TOA A;  4U7B A;  2O3F A;  4LG0 A;  1F4K A;  1BI3 A;  1FBU A;  3FHZ A;  3VOE A;  3JTG A;  4IHS A;  1T0F A;  3T1B A;  3LAP A;  4M71 A;  2KIF A;  2XUB A;  4RS8 A;  4DQ2 A;  3DPL C;  2HKX A;  3ISP A;  1S8N A;  2ETH A;  2A6H F;  1QNT A;  4HBL A;  3BJ6 A;  3P9K A;  1EH6 A;  2IW5 A;  3I53 A;  3M9A A;  4GGG A;  1YO5 C;  1XGM A;  4CXF A;  1XD7 A;  2DAO A;  3F8M A;  3C7J A;  1SFE A;  2HFH A;  4P55 A;  1PP7 U;  1ZAR A;  4OU0 A;  3I58 A;  5E20 A;  2O8X A;  1CF7 A;  4HX4 A;  5D5X B;  3ERE D;  1F5T A;  5L3G A;  2ZFW A;  4ENJ A;  3BPV A;  2K27 A;  2YX7 A;  1OYI A;  2QBY B;  3EYI A;  3VB2 A;  3R0J A;  2NAZ A;  1ZYR F;  1J7K A;  4JK1 X;  3CUQ B;  2O6G E;  2F5D A;  2OZU A;  3WTS C;  3TQN A;  3I4P A;  3HSF A;  4S04 A;  3ECO A;  5IT9 K;  1Z6T A;  5E17 F;  1REP C;  1UST A;  4UVC A;  4Q4Z F;  2IA1 A;  1D5V A;  3GZ6 A;  1BC8 C;  2AXL A;  1IN4 A;  2VN2 A;  3DEU A;  4AIJ A;  1X3U A;  3I54 A;  1XCB A;  3E5U A;  1IN8 A;  2FF4 A;  3K9T A;  2DK5 A;  3BOQ A;  1USS A;  1D8J A;  1IUY A;  4GYI A;  3Q9S A;  1HKT A;  1OPC A;  3J80 Z;  3DF8 A;  4LG0 B;  2CYY A;  4NB5 A;  1UCR A;  3M8F A;  4UXN A;  3FXU A;  4WXC A;  1LB2 A;  1HKS A;  2YPR A;  5DCM B;  1G6N A;  3JSO A;  5BS6 A;  4IVN A;  2Z9O A;  3L2C A;  1BIB A;  1ZRD A;  2OAZ A;  4XLN F;  2GQQ A;  5LGT A;  2RDP A;  2LSO A;  2DBB A;  2LKP A;  1KQ0 A;  2VXZ A;  2V9V A;  4UV8 A;  2RKH A;  3EUH A;  3MQ0 A;  5DEQ A;  1CF7 B;  3CUQ C;  4YFN F;  3PQJ A;  3FZV A;  4EJU A;  2YU3 A;  3TO7 A;  1RUN A;  3D5L A;  1H9G A;  2ZO4 A;  2PLY A;  2UXX A;  1IF1 A;  5HVQ C;  5JR3 A;  1PUE E;  3T8R A;  5LLQ A;  2JSC A;  3LAJ A;  1LQ1 A;  4L9J A;  2OQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...