5D4SA

Crystal structure of arar(dbd) in complex with operator orx1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
70
structure length
70
Chain Sequence
EFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
publication title Plasticity in Repressor-DNA Interactions Neutralizes Loss of Symmetry in Bipartite Operators.
pubmed doi rcsb
source organism Bacillus subtilis (strain 168)
total genus 21
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5d4sA00
3CTAA 4HF1A 2VONA 3FWEA 2M45A 3MZYA 2P5LC 4RAZA 2DK8A 4Q47A 1EH8A 4LG0A 1OYWA 1FP1D 2L4AA 5L3GA 1QQIA 1J9IA 3COAC 1B9NA 4HZFA 1NHAA 3ZMVA 2FF4A 4ZZLA 1O3QA 5IT9K 4EJTA 3OOPA 3GO5A 4OINF 2VT2A 2UXXA 2L02A 2XAJA 2QVOA 2H27A 3FXRA 2ZKZA 5JHUA 2XAQA 3RKWA 4KA4A 3D5LA 3I64A 4L9NA 3TGNA 3E5UA 2HR3A 1MGTA 2JPBA 1ZG1A 5BS6A 3J80Z 3WGIA 2DQRA 1DDNA 2ESHA 3GW2A 2RNJA 5H6RA 1G3SA 3WTZA 1F5TA 3F6VA 4L0ZB 1DP7P 1KGSA 4M74A 2R3SA 4I02A 2GA2A 1TNTA 2IP2A 4LMYA 2BBYA 1BC8C 1J75A 2WC2A 3KP5A 5K5QA 2A61A 4LJZF 5HLIA 4MHGA 5LHIA 3W6JB 1J5YA 4PCQA 1R1TA 1RUOA 2OQRA 2M8EA 2LF8A 3I59B 4KUMA 5E18F 3QPHA 2GXBA 1FBSA 3E6DA 3JAMK 2P8TA 3EDPA 1HBXG 2KIMA 3U1DA 5D5VB 3HTUA 1XDSA 3FXQA 2OZ6A 3BPXA 1OKRA 3IKVA 4L0YB 1LDKB 3C18A 5LRSA 3RDIA 1G3WA 1S29A 2JRTA 5CVUA 1FLIA 1ZGAA 3M7GA 4BH9A 3GXOA 4YFXF 3TOBA 1TBXA 1B1BA 3WTSC 1K78B 2JPCA 2P6SA 4LG0B 1BI1A 4HLYA 2STTA 3B73A 3SHFA 4B8XA 2Z99A 4AIHA 1BI2A 3HHGA 1YQAA 2ISZA 1BN5A 1ZAOA 3E97A 3HHHA 4GCVA 2DQLA 1H9GA 3SQNA 2PEXA 4YFNF 2DW4A 3WU0A 5J6XA 5ERIA 3N4MA 4LLGF 2DPDA 4WWCA 2KJCA 5DD4A 1BM9A 4LK1F 3L9FA 1T98A 2FBIA 5AIQA 2E7WA 2V1UA 2YX4A 1R36A 4L5JA 3U2RA 4CHUA 4OU0A 1G4DA 4O5VA 3T0YA 2A6EF 3F22A 4NHJA 3GFJA 4EJVA 1S8NA 2IPQX 5BOXA 1QZYA 3VOEA 1OYYA 4L18B 3DKWA 3G3ZA 2XAGA 5IT3A 1DUXC 2EJRA 2FBKA 2RV8A 3HRUA 1Z9CA 3REOA 1ON1A 1KQ9A 2KRFA 2EWNA 4EVIA 1KYZA 5D6FA 3ZN0A 3QP5A 2ISYA 2HKOA 1IRFA 4OIQF 4CDGA 4ZH4F 1LB2A 2VE9A 1YTYA 4HA8A 3KETA 5LGUA 2EFQA 3V8KA 4MQVA 4OIRF 1U5TC 5DV5A 1JHHA 1ZHFA 2DPUA 2QZ8A 4JK1X 5K5RA 4DNCA 4UV9A 2FXAA 2K4BA 4ETSA 2X0LA 1I1SA 3M1EA 3KP7A 4HF2A 5HDGA 1TQMA 4N9HA 3RTRA 3F8BA 4ASNA 4E70A 1GHCA 2PFBA 4S04A 1RNLA 1TTYA 2O3FA 3ECHA 1HW5A 5KVRA 4IHSA 4K2EA 1XCVA 1U5TB 3V4GA 4EV0A 4M72A 4PZJA 3LA7A 2Q2EA 3KP3A 2BEOA 3KE2A 1QGPA 5CVJA 3JW4A 1YLFA 1Z1DA 5E20A 4MEYF 2IVMA 4WXCA 4BHCA 2FE3A 1BOAA 2IJLA 1FYLA 2W25A 1ON2A 2QBYB 4I2OA 4GGGA 4KNYA 2PMHA 4BQAA 3T1BA 3FMQA 4RS8A 2MA3A 4MGRA 3N97A 3R0AA 2VBYA 1YIOA 1P4XA 4UV8A 2NNYA 5LRRA 4ZZDA 4RB2C 1KU2A 1BI0A 1P92A 1T38A 3WTUC 1WWXA 5ILSA 1FWZA 4RGRA 1Y0UA 1Z05A 4A5NA 2CWEA 1OMIA 3O6BB 2E1CA 2EFNA 2DU9A 2G7UA 4ENJA 1FOKA 1SFXA 1XCBA 4RGSA 2F5DA 2HYGD 4YIFA 1ZG3A 3E6MA 3F8FA 3F8MA 3FF5A 2O61A 1G3TA 1TQIA 4KN4X 2YR2A 5A2QK 3WTTC 2IT0A 2O03A 4A0XA 3K0LA 5H20A 3JSOA 2Z3YA 2EFOA 1FSHA 1WRJA 3Q5FA 2P7VB 5HVQC 3IWFA 3LFKA 1YW8A 2GQQA 3HRTA 3MQ0A 3ZMSA 2RQPA 4HDUA 2PLYA 3QU6A 1V3FA 3CDHA 4G7OF 2BE5F 5D4RA 1S3JA 4CYDA 1YYVA 2J5OA 3F8CA 1G3YA 5HDNA 3C7JA 3M8FA 3I0TA 2ADUA 5D5XB 4ZYDA 3DQVC 1FC3A 2CGPA 2H6BA 2V6CA 1W7PD 3TO7A 4H0EA 2MLKA 4LFUA 3ABUA 4AD9A 1LQ1A 1C0WA 1O57A 2YSRA 5LHGA 2UXNA 2HDCA 1U3EM 3V7SA 1T6SA 3IHUA 2DO7A 2VOOA 2ZMEA 5CVRA 3CO6C 2MC3A 4BYYA 1LJ9A 4RGUA 1BI3A 3H3UA 4M6YA 3F23A 1BIBA 4ZYGA 5ILUA 5ILVA 5FB2A 3RIRA 5HLGA 1RIOH 4HX8A 1K79A 2QLZA 1STZA 3DF8A 1R1VA 4RB0A 1J0RA 5F1RA 2WV0A 2A68F 4KN7X 1FSEA 2EV5A 3WTVC 4ENKA 4OMYA 1JHFA 4EJOA 1FBUA 1VTNC 1W5TA 5EEGA 3KEQA 2HQRA 4Y17A 2QQBA 2RDPA 3T5XA 2A69F 2VC0A 3E5QA 2XV4S 4ON0A 4ESFA 4G9YA 1SFUA 3WGGA 4P9UA 1U8RA 4HX4A 3QOPA 1JXSA 3JTGA 1SAXA 3DV8A 4GYIA 1R22A 2XRNA 4BXUA 2XKOA 1XGOA 1UB9A 3DFGA 4MQ9F 3JTHA 5TRDA 3WE3A 1HXDA 1TW3A 1E17A 1T39A 3BY6A 2R7DA 1IN4A 3EQLF 1SMTA 5LGTA 4UNOA 2XAHA 2G7HA 3L00A 4RAYA 4A12A 4Q48A 4FT8A 3ZP5A 1ZYRF 3SXYA 2KIUA 1LEBA 2F5FA 1UFMA 2V1DA 5HS9A 1FYMA 2OBPA 1DPRA 1OYIA 1IUYA 2YX7A 1T2KA 3ZMDA 4N0BA 3F8NA 4GXOA 3EUHA 5LHHA 3LAPA 2VOPA 1S7AA 1ZREA 3HYIA 5JI6A 2NS0A 5FLXK 3KEOA 1U6GA 2XUBA 4WXHA 1EH6A 1F4KA 3WTWC 4G6DA 4A0ZA 2A6HF 5FGMA 3J81K 2Z33A 1XGMA 1IF1A 5FO5A 4FX0A 2FRHA 2WTEA 3GZ5A 1KQ8A 2M5WA 5J8FA 1L3LA 1FPQA 5JVTA 2L4MA 3QRFF 4A5MA 1MJ9A 1V4RA 3LAJA 3HRSA 2K27A 3CUQA 3CLOA 5CJ9A 3IRQA 2W84A 2ZBKA 3HTSB 4CGZA 4A6EA 1I5ZA 2HQNA 2V1XA 1O7LA 1HW1A 2XROA 3K69A 3DPLC 3EYIA 4GO1A 2LKPA 3FXUA 2IW5A 4WXDA 2Y75A 1AWCA 2PG4A 4G7HF 1PUEE 2HS5A 2QM3A 2UZKA 5ICCA 3DP7A 4MTEA 5FFXA 2TDXA 3FM5A 4LD5A 1R7JA 4U88A 3D0SA 4EMSA 5LEJA 1Z6RA 2XIGA 3T8TA 5D8LB 5E1XA 3M9AA 2CW0F 5EEHA 3P9IA 6PAXA 3ERED 2XASA 2V79A 4F7ZA 2UWMA 3IKTA 2BYVE 4EGZA 2HWVA 1HKQA 4KMFA 3MFKA 1Z7UA 4MTDA 2NNNA 4R79A 1FX7A 1PP8F 5LBQA 2XAFA 4PGGA 2VT3A 2EV6A 1P4AA 1R1UA 4OMZA 4R1HA 4HDVA 3PQKA 3V7CA 5L3BA 1X3UA 3K9TA 2MH9A 3M8EA 2EV0A 4XSXF 4AIJA 4JQFA 2VC1A 3QU3A 1D8JA 2ELHA 4XSZF 4IJAA 4U0WA 3GUDA 1W5SA 1U78A 4HW0A 2EK5A 2PJPA 4M71A 1O3RA 3E6CC 5CLSA 3LSTA 1CF7A 1W7PA 2Y0MA 3V7RA 5K5OA 4OIOF 3KFWX 5DCFA 4R8HA 2LDUA 4RGXA 3F21A 1MDMA 4ZYHA 3R6SA 5ICEA 2Z9OA 3GYHX 2DFIA 2O8XA 1LEAA 4U0YA 1FZPB 5ED4A 3J80K 2HTSA 3K2ZA 3WODF 1IN8A 2HZTA 1HSJA 2QUFA 3L7WA 3PFIA 3BPVA 2FQ3A 1RUNA 2OQGA 1K7AA 2D2WA 3GVAA 1MZBA 4G7ZF 3FMRA 2A5YB 2QENA 1XMKA 1USTA 5IT9Z 1R23A 1I1GA 1AOYA 3C3WA 2KJBA 1YS6A 2JSCA 2QQ9A 4KFCA 1HKSA 1IXSB 2ZNYA 3K1NA 1R58A 3GF2A 4HYEA 3T8RA 3HIFA 2VBWA 2EFPA 2NRAC 3KZYA 1FP2A 1ZN2A 2DAOA 3BROA 1KA8A 1O3SA 1CGPA 2ZCWA 3KP6A 3S2WA 1WKMA 3IRRA 1IN6A 2HTJA 4CXFA 1FT9A 1ODDA 5E1WA 3OV8A 2A07F 5CVVA 2HOEA 2FOKA 3RJPA 3GZ6A 3EETA 4HV5A 4MNUA 3FZVA 3JAMZ 1KU3A 5FD5A 1HQCA 2X4HA 1D8KA 3FM3A 3CJNA 1DPUA 5L3CA 4Y13A 1O7FA 3MAJA 4KDPA 4L9VA 2RGVA 2CG4A 3H3ZA 1WI9A 5L3FA 4IHTA 3MCZA 2LF7A 1BJAA 1O3TA 4P9FA 3K1PA 1IXCA 4CZZA 1BIAA 3WTYC 3KLNA 4CO8A 4M9ZA 1SD6A 1LDDA 2XGXA 4BNCA 3WTXC 2ZNZA 3RKYA 5HLHA 2F2EA 1R00A 5F6FA 1SD4A 4HBLA 3QAHA 5LGNA 2K7LA 2V9VA 2EA4A 4IXAA 2K02A 4LLNA 5LEKA 3P9CA 2W24A 2ZO4A 3NQOA 3E5XA 2YPRA 2COMA 5BPIA 1J59A 4HQMA 2D1VA 2VBZA 1B59A 3HSFA 4LLLA 1TNSA 1QBJA 1D3YA 1REPC 1UCRA 2PN6A 1H0MA 2ETHA 3R60A 2DT5A 2DBBA 1BC7C 5DDGA 2O6GE 1YFHA 3NRVA 1B6AA 1XGNA 4WF2A 2GIVA 3F6OA 4IRIA 1P2FA 3VEPA 2K4JA 4UHTA 3BJ6A 3TO9A 5BPDA 1MJBA 3RI4A 3I59A 3HUGA 4LK0F 1HW2A 2D1HA 3IL2A 2HFHA 1IAWA 3IC7A 4GYGA 2LNBA 2GXGA 2P5KA 5AONA 2XHKA 4U0VA 4UXNA 2VODA 1SD7A 3W6KB 2E7XA 4FX4A 1TW2A 2EFWA 3RKXA 1HKTA 3Q9VA 2W57A 5FD6A 1XSXA 4KYWA 5DEQA 3KLOA 2PBIA 2HGCA 2J5PA 4HAMA 1MKMA 3TDZC 4EM1A 5E8GA 3TDUC 2P5VA 2HKXA 2CQKA 3F3XA 4I98B 2L54A 1K78A 1IZ1A 5BMZA 3I4PA 4HV6A 2CSOA 4LB5A 3PQJA 4XBFA 3LA2A 4U7BA 3TKYA 2ZJ2A 1TQPA 4Q4ZF 1XB4A 5L3DA 1FYKA 1U2WA 3ROUA 2L01A 1LNWA 4TV7A 5HS8A 2H6CA 3ZQ7A 2LSOA 2Q8KA 4WCGA 1XD7A 1FBQA 3HRMA 4HQEA 2Z5UA 1EV7A 4EQQA 3K1MA 3LWFA 4IVNA 1UHWA 2NAZA 4QLCU 2L3DA 5KK1A 4BAYA 4LB6B 2IA2A 3SZPA 5CVIA 4A2UA 5ICFA 4IRGA 5DYMA 5BQTA 2KKOA 2YU3A 2ZMEB 3TOAA 1YO5C 3DXJF 2FMYA 1YW9A 3HOSA 5LLQA 3FMSA 2STWA 2K86A 3H92A 3ISPA 3E3VA 4KMUX 1F9NA 4RB3C 2P6TA 1ZGJA 3I5UA 4HLXA 1JE8A 1QO0D 2FEZA 4O3MA 4EM0B 1Q1HA 2ZXJA 3CO7C 3ULQB 3V8LA 2EA2A 4P96A 4UUVA 2F5EA 2M87A 2CFXA 2IA1A 3TQNA 2RKHA 1B9MA 2P7CB 1IN7A 2JTVA 4AIKA 3BP8A 3G73A 3B02A 4HOBA 3L2CA 4D0PA 2PQ8A 4FHTA 3MZHA 1YW7A 2OD5A 1L0OC 3ZPLA 3BDDA 2VXZA 2OAZA 1ZRDA 1ZLJA 2OU2A 1BBYA 1J2XA 2WWYA 4ESJA 4M73A 4A0YA 2CYYA 4I01A 4LGWA 4XRFA 5A2QZ 1IW7F 4S05A 3BJOA 3NEUA 3SZTA 5K1YA 1U5TA 5HDKA 2HYFA 4RB1A 5D5WB 2FU4A 2PMUA 2FNAA 5J8CA 2H09A 5D6EA 2FNPA 3E6BA 4P55A 1KQ0A 3GLXA 4O6JA 3RYPA 2RVCA 4A6DA 5H6QA 2G9WA 3GWZA 5D8KB 1XDUA 1PDNC 1QPMA 3TO6A 2E1NA 3ZMTA 2A3SA 2AS5F 4QWQA 2QBYA 1RZ4A 4ZYEA 3I58A 2DTRA 2HEOA 4UVAA 3WE2A 2GA1A 1D5VA 3BOQA 1YG2A 3FX3A 5ICGA 3AAFA 3GFLA 3CUQC 4AVPA 1S6LA 4XLNF 4ENNA 1FY7A 1I6XA 5AIPA 2MLGA 3Q9SA 1HSTA 3BJAA 1SD5A 3ECOA 4KIBA 5JR3A 3SFZA 1RI7A 1MJAA 2JZYA 1B4AA 1WQ2A 2MD5A 2FBHA 2XKPA 4HF0A 2PI0A 5DCMA 2GWRA 2JT1A 4OOIA 3L09A 4YFKF 2W85A 1J7KA 5L3EA 3GFIA 1R5GA 3MEXA 1F1ZA 3O3KA 1IN5A 3CUQB 4G6QA 3BWGA 4Q5SF 3IWZA 3I71A 1E2XA 3KZZA 3R61A 2RC4A 2BGCA 2ESNA 3LQRA 4EJUA 5TJJA 1LDJA 3ZMZA 3EYYA 1EH7A 1JGSA 3C1DA 4P5OA 1KYWA 2VE8A 5D4SA 2F5CA 3VODA 2FA5A 2IRFG 4IF4A 3R0JA 1ZARA 3RYRA 3QPTA 4HX7A 4MEXF 1ZH5A 2AXLA 1QNTA 2Q0OA 1GXPA 4CICA 2DLLA 1FNNA 1LVAA 4U7DA 4YG2F 1ZRFA 1XN7A 5DD8A 4I09A 1Z91A 2VBXA 4KT5C 2H94A 4M9SA 2QWWA 5D5UB 4WX9A 4M6XA 1ONVA 1ZG5A 2QYOA 5E1ZB 3KCCA 1XMAA 2NYXA 1P6RA 3WG9A 3LA3A 2P4WA 1WSUA 4EJWA 1XSDA 4JBAA 4L9TA 2MBFA 3FHZA 3HOTA 2M30A 1Z6TA 1SMYF 1R5HA 1OPCA 1ZRCA 3WGHA 4IPAA 5E8IA 2D45A 2XVCA 1W4MA 2OZUA 3HSEA 4KIFA 2DI3A 4NQWA 5E17F 3P7NA 4OIPF 2GZWA 3DEUA 4AWXB 4G94A 3ELKA 1XSVA 3HSRA 4YIIA 1ZLKA 3ABTA 5CYVA 5FLXZ 3RPUA 3GX4X 2R7FA 3RPQA 3DPTA 2VN2A 5DCMB 3J81Z 2BV6A 4XLPF 3MWMA 5HOOA 3WU1B 1CF7B 3GFMA 1W7PB 4M9XA 3KP4A 4EM2A 4I7HA 1K6OA 1OR7A 3F72A 3JSPA 4KICA 4IRHA 1PP7U 1UHMA 3R4KA 4ESBA 1MDMB 5FFZA 3ML6A 4N9IA 4BHPA 1P4WA 4UVBA 3U9GA 4Y15A 2B0LA 1MD0A 1S7OA 1KU7A 4UVCA 2FSWA 4KIGA 2RN7A 3V8JA 1YS7A 2GAUA 2C6YA 1QZZA 2KIFA 4L9JA 3LQQA 1SFEA 4I0BA 4L5IA 1GXQA 4I0AA 4NB5A 1USSA 4Z2YA 5F64A 3QP6A 4DQ2A 2M1BA 4PDKA 3GEZA 5DUIA 2ZFWA 1TLHB 1I27A 3J7AO 1XGSA 2O0YA 5DUKA 2Y48A 1T0FA 4BHBA 3O2PE 4WK8F 3ZMUA 2IA0A 3P9KA 1IXRC 3CUOA 3I54A 4PGHA 3KP2A 1IRGA 4B09A 1ULYA 3VFZA 4EGYA 1KU9A 2QQAA 3ZN1A 4ENMA 1GVJA 2EB7A 3I53A 3BZ6A 1G6NA 2DK5A 1A04A 2OA4A 4G8XA 2FMLA 2ACJA 2CO5A 3VB2A 5JFRA 1H9TA 5HS7A 2MH2A
chains in the Genus database with same CATH superfamily
5FKLA 3CTAA 4C3JJ 4PFOA 4HF1A 4A3BJ 3FBIB 1RKWA 1Z3YA 3FWEA 2UUZA 4XMYA 3CF5F 2VONA 2M45A 3G1OA 2BXZA 3MZYA 2P5LC 1WH7A 4RAZA 2DK8A 3K4BA 3G71I 4Q47A 1EH8A 4LG0A 1VF9A 1P9QC 1OYWA 1FP1D 2L4AA 5L3GA 1CQTA 1QQIA 2ZXIA 4ZDOA 1J9IA 3COAC 1A35A 3W2WA 2MYSA 1B9NA 1JT6A 4HZFA 1NHAA 3ZMVA 2FF4A 4ZZLA 1O3QA 4FISA 1F36A 1XG1A 1LFUP 4A3MJ 5IT9K 4EJTA 3OOPA 3GO5A 4OINF 1IO2A 3HKZN 4PFPA 3BT9A 2VT2A 2UXXA 2WB1N 2L02A 2XAJA 3ESWB 1TWHJ 4IOCF 2EINH 4A93J 2QVOA 2H27A 2KT0A 3FXRA 3S15J 2ZKZA 2LH9A 5JHUA 2XAQA 5JHFA 3RKWA 4KA4A 4FE4A 1VQMI 4F52A 4RLQA 3Q3SA 1FTTA 2BZTA 3D5LA 3I64A 4L9NA 3TGNA 3E5UA 2HR3A 1X58A 3QODA 3U1KA 1MGTA 3SJMA 3GTOJ 2JPBA 1ZG1A 4D7NA 5BS6A 3J80Z 3WGIA 4DBQA 2DQRA 2IS2A 1DDNA 1OFCX 2ESHA 3GW2A 2RNJA 3HBLA 2AO9A 2WV1A 2CU7A 3PNVA 5H6RA 1G3SA 3WTZA 3RQ4A 1F5TA 5KAFC 5B3SH 2DA7A 3F6VA 4L0ZB 3HKZA 3IAS2 1DP7P 1KGSA 2ME0A 2WB1A 5FJ8J 1V5FA 4M74A 2R3SA 4I02A 3DKYA 2GA2A 1JUMA 2AQFA 1TNTA 3CD6I 2IP2A 4LMYA 3VYSB 3A02A 2BBYA 4N4NB 1BC8C 1J75A 2OTJI 2WC2A 1QPIA 3KP5A 5K7HA 5K5QA 2A61A 4LJZF 1IC8A 2ZJPF 5HLIA 1R4MB 2L9SA 4MHGA 5LHIA 2X6XA 3W6JB 1J5YA 4PCQA 5EYRA 4B48A 1DU6A 3G2BA 1R1TA 1RUOA 1H88C 2OQRA 2M8EA 3P5JA 1H89C 2LF8A 3I59B 2N8GA 4KUMA 4XOTA 5M5WJ 5E18F 4J00A 3PO3J 3QPHA 2W1OA 2E5ZA 1B72B 2GXBA 1FBSA 3E6DA 3JAMK 3LSIA 1VQKI 2LG4A 2P8TA 3EDPA 1XPXA 3CC4I 1HBXG 2KIMA 5J4VA 1UG2A 3U1DA 5D5VB 1VFCA 3HTUA 3BR1A 1V5GA 5FRMA 1E3PA 2VKVA 2O5RA 1XDSA 3FXQA 2OZ6A 1K6YA 3BPXA 3S2HJ 1OKRA 2PX9A 2JUCA 5CPRB 3OIQA 1FOWA 2IGKA 3IKVA 4L0YB 3OYMA 1LDKB 3C18A 3NWSA 1OCOH 1TZLA 5LRSA 3RDIA 3KPHA 1G3WA 1OISA 1S29A 1FIPA 2JRTA 1PUFB 5CVUA 4CUGA 4CYCA 3PSIA 1FLIA 1ZGAA 3M7GA 1NK2P 4D5CA 4BH9A 2F48A 3GXOA 4J19A 2ZXWH 4YFXF 3TOBA 1TBXA 1B1BA 4E7SA 3BZCA 3WTSC 3J7ZI 2W48A 3S1QJ 1K78B 2JPCA 2JUGA 2P6SA 3HJEA 4XNFA 1BI1A 4LG0B 1X1CA 2M4KA 2W00A 4HLYA 1GDTA 2STTA 2HPIA 3B73A 9ANTA 3K70C 3SHFA 1MNMC 2FQ4A 4B8XA 2Z99A 3FKIJ 4DYCA 4AIHA 1BI2A 3SFIA 3HHGA 3HOWJ 1YQAA 1OCPA 2A5WA 3GLLA 2ISZA 1BN5A 1ZAOA 1MSEC 3AFHA 1OCCH 3E97A 2DXIA 3HHHA 4FETA 2K9QA 2XDVA 4GCVA 1SANA 3G1LA 2DQLA 2V6EA 1H9GA 1WJ5A 3SQNA 4XICA 1HF0A 3OYEA 3KYLA 2PEXA 4YFNF 5F27A 4XN0A 1DQUA 2K85A 1IGNA 1TT0A 4MO7A 2DW4A 3WU0A 3IP4B 5J6XA 5ERIA 5E3NA 3N4MA 2VPLA 4LLGF 1K4TA 2DPDA 4E4HA 4WWCA 2HXIA 2KJCA 5DD4A 2JA6J 1BM9A 1TT5B 3OYHA 4LK1F 3NAUA 3L9FA 2HDWA 2NVQJ 5IYDJ 1T98A 2FBIA 5AIQA 3ZQHA 2E7WA 2V1UA 3FXMA 2YX4A 4HEA2 1R36A 3L2VA 2K9NA 4L5JA 3U2RA 1SVLA 4CHUA 3GTJJ 4OU0A 1G4DA 4O5VA 2FUG2 1UJ8A 4L5EA 1W36C 3T0YA 1SAUA 3S3NA 2HQ5A 2A6EF 4XM3A 3ZGKA 3F22A 4HG2A 2M7BA 3W2VA 4A3EJ 3HXLA 4NHJA 3GFJA 4EJVA 1S8NA 2IPQX 3SZGA 3BR0A 1SEUA 5BOXA 3OSGA 2GOXB 3OIPA 1QZYA 4A3CJ 3VOEA 2QGUA 3RCOA 1OYYA 4L18B 1ACIA 5JLXA 3DKWA 3G3ZA 4DYRA 3SDBA 1Y8QB 2XAGA 5IT3A 1O4XA 1DUXC 2GOMA 4NC7A 5H2FC 2EJRA 2FBKA 2RV8A 3HRUA 1ZR4A 5HODA 2NVXJ 1Z9CA 2ID6A 3K4NA 3REOA 4B47A 5J4YA 2KDZA 1ON1A 1HLVA 1KQ9A 2KRFA 5F0HA 4GFBA 1ETVA 2EWNA 4EVIA 2HQAA 1KYZA 3KYCB 5D6FA 2Y30A 3ZN0A 3QP5A 3HOVJ 5M5XJ 2ISYA 2LY2A 2HKOA 5GTHC 1IRFA 5LD2C 3PUBA 4OIQF 4CDGA 5F0FA 4ZH4F 3DBHB 2K40A 1LB2A 1JKOC 1QHGA 2VE9A 1Y8RB 3DWLE 4HA8A 4D5FA 3OYCA 1YTYA 4UB6C 3CCUI 3KETA 4XRSG 2VLAA 3H9GA 5FKKA 3WG7H 5LGUA 3L2QA 1A5JA 2EFQA 4D9JA 3V8KA 2E36A 4MQVA 4OIRF 1BW5A 1U5TC 3KIOA 3CP8A 3OWTA 3VSLA 5DV5A 1JHHA 1ZHFA 4IL6C 3HB9A 2DPUA 2K5CA 2QZ8A 4JK1X 5K5RA 1VQNI 2R5ZB 2VI6A 3VSKA 2CMPA 4UV9A 4DNCA 2FXAA 2COBA 2K4BA 2W4SA 4ETSA 2X0LA 1I1SA 3M1EA 3KP7A 4HF2A 5GP9A 4MFEA 1QVTA 5HDGA 1TQMA 2Y0SN 4N9HA 2NS7A 3AG2H 1ENHA 4CA0A 3RTRA 3F8BA 4ASNA 4DYQA 1VQPI 1A31A 4E70A 1N77A 2I8DA 3ZQGA 1GHCA 2PFBA 1FOXA 1V54H 4S04A 2E1MC 1RNLA 1TTYA 2O3FA 3ECHA 1HW5A 5KVRA 2P81A 4IHSA 2R92J 4K2EA 4Y4RA 1XCVA 1U5TB 2IGNA 2UV1A 3V4GA 4EV0A 3LSMA 4M72A 2YS9A 4CCNA 4PZJA 3LA7A 1J09A 1I3AA 2Q2EA 3KP3A 2R5YB 2RREA 2BEOA 2CQ7A 4BJ6C 3TEDA 2DA6A 3KE2A 2ELJA 1QGPA 1XMXA 5CVJA 3JW4A 4IHXA 1YLFA 1ZTRA 1Z1DA 5E20A 4M3EA 1VQ9I 2Y0SA 3VDXA 4MEYF 5F08A 4I6ZA 2IVMA 4WXCA 3VWBA 4BHCA 2R7UA 2FE3A 3BR2A 3SEQA 1BOAA 2IJLA 2G0EA 1WH5A 2DMUA 1FYLA 2W25A 1ON2A 1V5EA 2LY1A 3QPLA 2QBYB 4I2OA 2XF6A 4DIQA 4BQNA 4Z6YA 1IRZA 1P7JA 1RC9A 3MD2A 3GTPJ 4GGGA 4KNYA 2PMHA 4BQAA 5IOYA 3K2AA 3EUKL 3T1BA 3FMQA 4RS8A 3ZXSA 2MA3A 3BTIA 4MGRA 3N97A 3HDDA 3R0AA 4HNUA 2VBYA 1YIOA 1P4XA 4UV8A 5LRRA 4ZZDA 2NNYA 4RB2C 1KU2A 2HVSA 1BI0A 1JGGA 1P92A 1T38A 3WTUC 1WWXA 5ILSA 1FWZA 4XRMA 4X1EA 4RGRA 5K7FA 1X4PA 1Y56A 1Y0UA 1Z05A 2VL8A 4A5NA 3UNGC 1WPKA 2CWEA 4LOCA 1OMIA 1D1BA 3O6BB 2E1CA 2QSFX 2EFNA 3LL7A 2WY7Q 2DU9A 1HOMA 2G7UA 5KAIC 4ENJA 1FOKA 2GXAA 3H5AA 1SFXA 1XCBA 1T56A 2F5DA 4RGSA 1RPWA 5FKOA 3H1CA 2HYGD 4YIFA 4XOPA 5DS9A 2WY8Q 1ZG3A 3E6MA 2M0CA 2LR8A 3F8FA 3F8MA 4UUTA 3BG7A 4F92B 3FF5A 1E3OC 1DP3A 2O61A 1G3TA 3PIOF 1KONA 1K61A 2CUZA 2L9NA 1TQIA 4KN4X 1YIJI 1AKHB 2YR2A 3QOEA 5A2QK 3WTTC 2IT0A 2LRDA 2O03A 4A0XA 2F6CA 3K0LA 1X4OA 1A36A 5H20A 3JSOA 4J01A 4PSWA 2DMNA 2Z3YA 2EFOA 1BR4A 2LD5A 1FSHA 1WRJA 5IP7J 3Q5FA 2P7VB 3BG9A 3K4KA 2BHZA 3K7AJ 5E3MA 3ZQIA 5HVQC 1D1AA 3IWFA 4HSRA 4B1RA 1W0TA 3LFKA 4W1UA 1YW8A 2GQQA 3HRTA 2TCTA 2X1EA 1VQ8I 3E7LA 2BW3A 3H9QA 3MQ0A 2X9DA 1A6IA 2DCEA 3ZMSA 2M4GA 2RQPA 3W3CA 1WVRA 4HDUA 4IX7A 2PLYA 3QU6A 1V3FA 4NDLA 3CDHA 2E34A 4G7OF 1T33A 2BE5F 5FLVA 5D4RA 3S93A 1S3JA 4CYDA 1YYVA 2J5OA 2IEKA 3F8CA 5E3LA 1G3YA 2IBDA 4QSHA 5HDNA 3C2BA 4A3GJ 3C7JA 3M8FA 5FKNA 3TBIA 3I0TA 2ADUA 5D5XB 5K7ZA 4ZYDA 2XF5A 3CCLI 3DQVC 1EKEA 1FC3A 2JSPA 2CGPA 5GAHJ 2H6BA 2V6CA 1IV8A 1W7PD 3TO7A 3OYIA 4H0EA 2EPFA 2MLKA 4LIVA 4V2FA 4LFUA 3ABUA 4AD9A 3CCEI 2OCEA 1LQ1A 1C0WA 3MKYB 5CQEA 4DW6A 1O57A 1JUSA 3S3OA 2JMWA 3JRBA 3CP2A 4BE1A 1HCRA 2CQNA 3AG1H 2YSRA 3DU6A 1AU7A 2XF7A 3BR6A 2OUMA 1YRNB 5EZHA 2XAUA 4RAFA 5LHGA 5IYCJ 2MFZA 2KIQA 2UXNA 3FK6A 2HDCA 1U3EM 2V4JC 3V7SA 1T6SA 1Z3XA 3IHUA 2DO7A 3DEWA 1S9HA 2B9SA 2VOOA 2ZMEA 4YEJA 1VQOI 3FXKA 1SFOJ 5CVRA 3CO6C 2MC3A 3BCBA 2MSYA 4BYYA 3L1PA 2M9HA 3S1MJ 5IOZA 2DJNA 1LJ9A 2KL4A 4RGUA 1BI3A 4QTRA 3BTJA 3CDLA 5KNLA 2DT7B 2V1NA 1GV5A 3H3UA 4M6YA 2OTLI 3F23A 4HRIA 1BIBA 4ZYGA 5ILUA 5ILVA 1HDPA 1OCTC 2QQ8A 3M3YJ 5FB2A 2WAFA 3RIRA 1W1WE 3A4CA 5HLGA 1N78A 1OR7C 2EZHA 3H36A 4KJZA 1RIOH 2JVHA 4HX8A 2QSGX 4EATA 4YRVA 2OV7A 1K79A 5FKMA 2NVUB 3ONQA 3JRDA 2QLZA 1STZA 3DF8A 1R1VA 4RB0A 3JRCA 1MW7A 2Y2ZA 1J0RA 1ORKA 5F1RA 2WV0A 5C4XJ 2A68F 4KN7X 4B44A 4ZJZA 1FSEA 2EV5A 2KRHA 2XGEA 3WTVC 3Q0VA 3LOCA 5J47A 4ENKA 1ZKGA 4OMYA 1JHFA 2WAEA 4EJOA 1YJ9I 3FIWA 1FBUA 1VTNC 1JTXA 1W5TA 5EEGA 3KEQA 2LP0A 2DA4A 1U0JA 3IAM2 2HQRA 2DA2A 2L7KA 2XC7A 4Y17A 2QQBA 1MMGA 2RDPA 2A69F 3T5XA 2VC0A 4IHVA 3H35A 1VQ6I 3E5QA 2XV4S 4ON0A 4G12A 2QSHX 3BC8A 2E19A 4ESFA 4G9YA 2R7XA 5TGTA 1SFUA 4V19K 1WI3A 3K4MA 2JVGA 1LKXA 4PJMA 3WGGA 1UG0A 3I9V2 4P9UA 4RMNA 1U8RA 1IDYA 4HX4A 1OJLA 3QOPA 3WHCA 3JTGA 1JXSA 2LY9A 1SAXA 1FMVA 4DZJA 4XONA 3DV8A 4GYIA 1R22A 2XRNA 1T0FC 4BXUA 2XKOA 1XGOA 1UB9A 3DFGA 2BY3A 3D1NI 4MQ9F 3JTHA 5TRDA 2BW3B 3WE3A 1HXDA 2P0WA 1TW3A 2PJRA 2E2IJ 1X1AA 1E17A 1T39A 4ZC3A 3BY6A 1ZGWA 2R7DA 1IN4A 3EQLF 1ZQ3P 1SMTA 5LGTA 2EBIA 4BY1J 4IKFA 4UNOA 2X1CA 3MZ8A 2XAHA 2G7HA 2ZJQF 2X6OA 4RM2A 3L00A 4RAYA 4QPOA 4A12A 5CKTA 1JJ8C 4Q48A 4FT8A 2CW8A 3ZP5A 3ZQLA 1ZYRF 3SXYA 2KIUA 1LE8B 1LEBA 1AA7A 1LUJB 1VI0A 2F5FA 1UFMA 3FXJA 2V1DA 5HS9A 4BUPA 1X1BA 2OBPA 1FYMA 2XGCA 3PSFA 4B3XA 1DPRA 1OYIA 1DU0A 1IUYA 3J7AY 2YX7A 3C2HA 3OL3A 3ZCOA 4PJNA 1T2KA 2R7SA 2KLOA 3ZMDA 4N0BA 3LSKA 3F8NA 3O8GA 3UKGA 3CMEI 3J7YJ 2Z1DA 1QVUA 2FD5A 3S8PA 1SVMA 4GXOA 4EEFG 2H8RA 3EUHA 1YI2I 5LHHA 2BVLA 4NC8A 2ZXHA 3LAPA 4XN3A 3NARA 3TMOA 2VOPA 1S7AA 1ZREA 2NVTJ 3HYIA 5EG0B 3AKZA 4DGWB 5JI6A 2NS0A 2XB5A 5FLXK 3KEOA 1U6GA 3PO2J 2XUBA 2EZIA 4WXHA 1EH6A 1F4KA 2IGOA 3WTWC 4G6DA 4A0ZA 2A6HF 5FGMA 3J81K 2Z33A 1XGMA 4GDFA 4AVZA 4M3DA 3JCUC 4PJ0C 1HA8A 1IF1A 5FO5A 2LMDA 4FX0A 2FRHA 2WTEA 3GZ5A 1KQ8A 2M5WA 4NC6A 2K3PA 5J8FA 3OYJA 1L3LA 4BGDA 4W97A 1FPQA 5JVTA 2L4MA 3A03A 1WJBA 3QRFF 1VQ7I 4A5MA 1MJ9A 1ZK8A 2BY1A 1V4RA 3LAJA 3HRSA 3TW6A 4M3FA 4I76A 2K27A 1D0ZA 3CUQA 3CLOA 3FXLA 5CJ9A 4A69C 2W84A 2ZBKA 4AC0A 4F3QA 3IRQA 3HOXJ 3HTSB 5F04A 2HZDA 4CGZA 4A6EA 1I5ZA 2HQNA 2V1XA 1O7LA 1HW1A 2XROA 3K69A 1S7EA 4PJJA 1JT0A 3DPLC 1R49A 3EYIA 2R4GA 4GO1A 2LKPA 2R7ZJ 3BTLA 2IW5A 3FXUA 2DA1A 4JP0A 4BS9A 4WXDA 2Y75A 1AWCA 2PG4A 3CCMI 2CUEA 2JA2A 4E7ZA 3HL2A 5M5YJ 4G7HF 4CCOA 1PUEE 2R7WA 5B1AH 1MNDA 2HS5A 2QM3A 2UZKA 5BNGA 3DP7A 5ICCA 4UUSA 3LSJA 4MTEA 2CUJA 5F1JA 2BY0A 5FFXA 2TDXA 2DDBA 3FM5A 4LD5A 4E7HA 1WJDA 1R7JA 4U88A 3D0SA 3ZRGA 1APLC 4EMSA 5LEJA 1Z6RA 2XIGA 3T8TA 4BDYA 1TWGJ 5D8LB 2PJRB 2GLOA 4A3FJ 3I56I 3M8JA 5E1XA 1LVKA 3M9AA 3MMYB 2CW0F 5EEHA 3P9IA 2KZGA 6PAXA 3ERED 1U9OA 2XASA 2V79A 3KYDB 1QHHD 4F7ZA 1VQLI 2UWMA 3IKTA 2BYVE 4EGZA 2HWVA 1XX5A 1HKQA 1WJAA 3HC7A 4XIDA 4KMFA 3MFKA 1Z7UA 3CCSI 1D5YA 4MTDA 2NNNA 4R79A 4ZDPA 1G2HA 1QU3A 4G6TB 5IP6A 1FX7A 4YIRX 1PP8F 3G4SI 1LPQA 3DEEA 2DYSH 5LBQA 2QKLB 2XAFA 4JOMA 4E7LA 4PGGA 2VT3A 2EV6A 1TWFJ 3CJTB 2F5VA 1R5ID 2OC6A 1HC8A 1P4AA 1R1UA 5GTIC 1YX3A 2DN0A 2CH0A 3A0HC 4OMZA 1MMDA 4R1HA 4HDVA 3BCAA 3PQKA 3V7CA 2KP6A 2DDAA 1Y1WJ 2OPTA 1KZHA 1QZEA 5L3BA 3CCRI 1X3UA 3PL8A 4C30A 3VPRA 4E7IA 3K9TA 2MH9A 3M8EA 5DM7F 3JREA 3D5SC 2EV0A 4XSXF 4AIJA 1JJ6C 2LBFA 3BR5A 4JQFA 3K70D 1K4SA 3CF2A 2VC1A 5GAGJ 3QU3A 1D8JA 2ELHA 4XSZF 4IJAA 1TWAJ 3A1YA 4U0WA 2NVYJ 1YX5A 3GUDA 2O8KA 5EZGA 1I3QJ 1OQYA 1W5SA 2E60A 3RSNA 2K9MA 1U78A 1BR1A 2L0KA 5C44J 2L5QA 4HW0A 4CYCB 2EK5A 2PJPA 4M71A 1O3RA 3E6CC 1XTAA 5CLSA 3LSTA 1CF7A 1W7PA 2LOOA 2Y0MA 3RQIA 3V7RA 2R7VA 4RA2A 5K5OA 1Z67A 4OIOF 2RAEA 3KFWX 5DCFA 3F0CA 1ETKA 1YE9A 4R8HA 2LDUA 4ANJA 4RGXA 3F21A 1GT0C 5GPCA 3CCJI 1MDMA 4ZYHA 4MLOA 3GMEA 1ETQA 3R6SA 1X1PA 2KQRA 5ICEA 2Z9OA 3GYHX 4XRSA 2DFIA 2O8XA 4QPQA 1LEAA 3V42A 4U0YA 5ED4A 1FZPB 3OYFA 3J80K 4GRIA 1NG6A 3E1SA 3MKWB 2HTSA 3K2ZA 4JX4A 3WODF 1IN8A 1GUUA 1PYVA 2KPMA 1MH4A 2HZTA 1HSJA 1W36D 2QUFA 1FEXA 3L7WA 3PFIA 3BPVA 2FQ3A 1RUNA 2OQGA 1K7AA 2D2WA 2R7OA 2DTZA 3GVAA 3LSGA 1WJEA 3HG9A 1MZBA 3QPSA 4G7ZF 2FX0A 4ITVA 1OCRH 3FMRA 2A5YB 2QENA 1XMKA 3CC2I 2Y9YA 4A3KJ 1TP4A 3L2UA 2MABA 1U9NA 1USTA 2JQ7A 1PJRA 5IT9Z 1R23A 1I1GA 2KRCA 1Y1VJ 5M3FJ 1AOYA 2E71A 3C3WA 2KJBA 2HVQA 3LSPA 1TC3C 3JRFA 1YS6A 2I5UA 2JSCA 3GBGA 4UY8I 4BXXJ 2R7QA 4FCYA 1G8XA 1MBKA 5EDNA 2QQ9A 4B4CA 4KFCA 5M3MJ 1IXSB 1HKSA 2ZNYA 3K1NA 1JI8A 1R58A 4BXFA 3GF2A 4HNTA 3IUOA 4C2MJ 1NH3A 4HYEA 3T8RA 3HIFA 2ZSHB 2VBWA 1Y0NA 2EFPA 2NRAC 3KZYA 1FP2A 1ZN2A 2DAOA 4CCJA 3IV5A 2GM4A 2VJ5A 2DA3A 3BROA 2L9VA 2CV1A 4PK4A 4BJ5C 1NK3P 1KA8A 1PVEA 1O3SA 1CGPA 4LITA 2ZCWA 3KP6A 5E3OA 4XLHA 1JKPC 4LIUA 1W5CC 2MG4A 3M1CA 3S2WA 4C2UA 1WKMA 3IRRA 1IN6A 2HTJA 4CXFA 1FT9A 1RKTA 4U87A 1ODDA 4BQQA 5E1WA 3OV8A 5B66C 4IQ4A 2A07F 2VPRA 4S0HB 2VB6A 2BOLA 5CVVA 2HOEA 2VJ4A 2ZSIB 1SFKA 2DOFA 2FOKA 3RJPA 3GZ6A 1YITI 3EETA 2ECBA 4HV5A 2DODA 4CCLA 3GCMA 4MNUA 2LBFB 1VNDA 2QEXI 1X2NA 3H0DA 3FZVA 4B43A 1EA3A 3JAMZ 2DMQA 2CQQA 1KU3A 4F93B 4X0GA 5FD5A 3OYKA 1HQCA 2X4HA 1OLTA 2XRLA 1D8KA 3GZNB 2ICWG 3FM3A 2LKSA 3CJNA 1DPUA 3VYTB 1WGXA 3B6CA 3OS2A 1N75A 2NOGA 4Y13A 5L3CA 5DM6F 4XLAA 1O7FA 2CS3A 3MAJA 1JKQC 4KDPA 4E7JA 3KX2A 4L9VA 2RGVA 4A3DJ 3MKLA 4XKVA 2CG4A 5B5EC 5HNHA 3DBLB 3H3ZA 1WI9A 5L3FA 4IHTA 2LTPA 3MCZA 2LLKA 1S5LC 1RR7A 2OCCH 4BDZA 2LF7A 1BJAA 3PNYA 1O3TA 4P9FA 1K83J 3H0GJ 4OAYA 3K1PA 1IXCA 4CZZA 2OF7A 4F91B 1BIAA 3WTYC 4NNJA 3KLNA 4CO8A 4M9ZA 1SD6A 1LDDA 2XGXA 2ECCA 1IG7A 4BNCA 3BQYA 2CFOA 3U21A 3I4NJ 2Y69H 3WTXC 3LSRA 2ZNZA 3RKYA 5HLHA 2F2EA 1R00A 3BZKA 3HOZJ 1E3HA 2DJIA 1ERDA 1D1CA 5F6FA 1RETA 2O9LA 1SD4A 2IAIA 4HNVA 1I50J 4HBLA 2TRTA 3JRIA 2LYCA 3CC7I 3QAHA 3CESA 5LGNA 2E2HJ 2K7LA 1MNEA 2V9VA 4AU7A 2EA4A 4IXAA 2K02A 4LLNA 2ZJRF 5LEKA 3GTQJ 3P9CA 2W24A 2ZO4A 3NQOA 5KCMA 3E5XA 2YPRA 2COMA 2Q2EB 5BPIA 1J59A 4CSWA 2X48A 4HQMA 2D1VA 2VBZA 2M7AA 4YELA 2O7OA 5TISC 1B59A 3HSFA 4LLLA 1MBJA 1TNSA 1QBJA 4BBRJ 4JYKA 4V2GA 1N25A 1D3YA 1MBEA 1REPC 1UCRA 4C9YA 2Y9ZA 2ZFUA 2PN6A 3CJRB 1H0MA 2ETHA 3R60A 1P7IA 2CW7A 1WHUA 2LK2A 1XS9A 2I10A 2DT5A 2DBBA 1BC7C 2HI3A 5DDGA 1YFHA 2O6GE 3NRVA 1B6AA 3DBRB 2RNGA 1XGNA 4WF2A 4BBSJ 2GIVA 5J1RA 1Z0XA 3F6OA 4BL0B 4IRIA 1P2FA 3BG6A 3VEPA 1FOYA 3H9JA 2CQXA 2K4JA 4II2A 1YOVB 4UHTA 3ZQFA 3BJ6A 3TO9A 5J40A 4C3IJ 5BPDA 2ELKA 1MJBA 3RI4A 3I59A 2VIXA 4C3HJ 1LFPA 3G6EI 3HUGA 4OWRB 4LK0F 1B72A 3S3MA 2D1HA 1POGA 1HW2A 3M07A 4QIWN 3CCQI 1Z21A 3IL2A 3DCFA 3JRAA 2HFHA 4HSTA 3MKZA 3IC7A 1IAWA 4GYGA 2EQRA 3TW7A 4XKWA 2LNBA 2GXGA 2EZKA 3O8HA 2V7FA 2P5KA 5AONA 3CCVI 2KHMA 2W82A 2XHKA 3TL4X 2A6TA 2IS1A 4U0VA 4UXNA 2VODA 1SD7A 2BXYA 3W6KB 2E7XA 4FX4A 1TW2A 3QWLA 2EFWA 3RKXA 1HKTA 3Q9VA 2W57A 5FD6A 1XSXA 4KYWA 4IHWA 5DEQA 3KLOA 2PBIA 2HGCA 3CMYA 5GAEJ 3OMYA 2J5PA 3HPGA 4HAMA 1MKMA 3TDZC 4IO9F 1PUFA 3ASNH 3DLAA 1ETWA 4EM1A 1MSFC 5E8GA 2DA5A 3TDUC 2P5VA 2MC4A 2HKXA 2RQQA 4ZTJA 2D5VA 3CCYA 2CQKA 2FOWA 3A0BC 2KDOA 4M3BA 3F3XA 5GADJ 4I98B 2L54A 1K78A 1IZ1A 5BMZA 3I4PA 3DPUA 5J1UA 1MH3A 4HV6A 3A01A 3N05A 2CSOA 4LB5A 3PQJA 4XBFA 1MBFA 4OAZA 3LA2A 1ITYA 4U7BA 4D7MA 3TKYA 2VJIA 1LFBA 2ZJ2A 2HOSA 1TQPA 5F0CA 4Q4ZF 4BE0A 1XB4A 5L3DA 1FYKA 1U2WA 3ROUA 2JA8J 3DTEA 2L01A 1LNWA 1H8AC 2BY2A 2HU9A 3ABMH 1T8IA 4TV7A 1R6RA 2H6CA 5HS8A 1T08B 3ZQ7A 2LSOA 2HXOA 2Q8KA 3RKQA 4WCGA 2AXTC 1XD7A 3GTMJ 4FE7A 3PUFA 1FBQA 2ZMEC 1WJFA 3HRMA 3RPUD 4HQEA 1HDDC 1GLNA 4XLEA 2Z5UA 3VYRB 4BQOA 2KFDA 2VXDA 3VYUB 2OJED 4CCMA 1EV7A 2V26A 4EQQA 3K1MA 3LWFA 3F9KA 2E35A 4IVNA 1BOBA 1UHWA 2H1KA 1UMQA 3AL0C 2VJJA 2JN6A 4D1QA 2NAZA 2MD0A 4QLCU 2L3DA 3WHBA 5KK1A 3ASOH 2X85A 4E6KG 3OSFA 4MFDA 4BAYA 1X19A 4LB6B 2IA2A 3SZPA 1GVDA 5CVIA 4NUBA 2VQLA 3NWTA 4A2UA 5ICFA 4NBQA 2JA7J 4IRGA 4X6AJ 2M34A 3QYFA 5DYMA 5BQTA 2L7ZA 2KKOA 2VASA 2QKMB 2YU3A 2H8WA 2L2OA 2ZMEB 3TOAA 1D0XA 2VQCA 3OYNA 1YO5C 3DXJF 2FMYA 3DU5A 3JR9A 1YW9A 3HOSA 2K9SA 5LLQA 3FMSA 2STWA 5EEAA 2K86A 3H92A 3ISPA 3E3VA 4KMUX 2HDDA 2JK3A 1DGWY 1F9NA 4RB3C 1F43A 2P6TA 1ZGJA 2E5NA 3FHNA 3I5UA 3IH3A 4HLXA 1JE8A 1IV6A 4AM3A 1QO0D 3AL0B 3HUGB 2QF7A 3HGGA 2FEZA 3FISA 4O3MA 2HPMA 4EM0B 1Q1HA 1IJWC 2ZXJA 2NS8A 2V9PA 4HPQA 4BU2A 2JRMA 4CZCA 3CO7C 2CV2A 2E1OA 3ULQB 3DLLF 3V8LA 2EA2A 4P96A 4UUVA 2F5EA 3CMAI 2M87A 2CFXA 4IQJA 3FK7A 2IA1A 3TQNA 2NXNB 2RKHA 4BACA 1T95A 1B9MA 5B1BH 2P7CB 2DMTA 4AYBN 1IN7A 3HZJA 1UELB 1VQ5I 3HPHA 1Y6IA 3L2RA 3OS1A 2HYJA 1X2MA 2R7TA 2NOJB 3QQAA 2JTVA 4AIKA 3GTKJ 3BP8A 3G73A 4FASD 2R5ZA 3B02A 5J1YA 4HOBA 3L2CA 3OS0A 3QYBA 4D0PA 1WZ2A 2PQ8A 4FHTA 4PUSA 1YW7A 2OD5A 3MZHA 2H1LA 1L0OC 3ZPLA 1BW6A 2QCOA 2Z16A 3BDDA 1SVOA 2VXZA 2OAZA 2DOAA 1ZRDA 1ZLJA 2KISA 2OU2A 4RDUA 4F55A 3A01B 1BBYA 1J2XA 2WWYA 4ESJA 2VKHA 4M73A 4A0YA 2DFFA 3WU2C 2CYYA 3FKJA 4I01A 3DKXA 4LGWA 4XRFA 1A6QA 5A2QZ 2ZB9A 2ZC2A 3SEZA 4ZYAA 1BR2A 3AG3H 1IW7F 4S05A 3JRGA 2WADA 3CDIA 5HNFA 3BJOA 1NTCA 3HOYJ 3NEUA 3SZTA 1D0YA 5K1YA 1V55H 4AYBA 4M6VA 2EZLA 1U5TA 3CZ6A 5HDKA 2QA4I 1BJZA 2HYFA 4RB1A 3ZR8X 5D5WB 2FU4A 2PMUA 2R5YA 1QRYA 2FNAA 3EUHC 5J8CA 3OYBA 2DFEA 2H09A 2XPVA 5D6EA 2FNPA 1I6HJ 4DJAA 1JKRC 3A2KA 4P1WA 3E6BA 4P55A 1KQ0A 3GLXA 4O6JA 1MBGA 3RYPA 2RVCA 3E0JB 3PFYA 4A6DA 5H6QA 2G9WA 2KZVA 3GWZA 1E0EA 5D8KB 1XDUA 1PDNC 1QPMA 3PNTA 3TO6A 1EJ9A 3ERMA 2E1NA 1Z77A 3ZMTA 2MGQA 2A3SA 2AS5F 4QWQA 2QBYA 2WA0A 1RZ4A 4ZYEA 2M2EA 3I58A 2DTRA 2Y31A 2BHYA 3PIPF 1QA6A 2HEOA 2K9LA 4UVAA 3WE2A 2R7RA 2M0MA 2GA1A 2EIMH 1D5VA 3I3LA 2F4IA 1TL8A 3MN2A 3BOQA 1YG2A 3M4OJ 1YJNI 4KITB 2LFBA 3FX3A 5C4JJ 5ICGA 3AAFA 1FJLA 3GFLA 5FRNA 1ETXA 3CUQC 4AVPA 1S6LA 2LREA 2AQEA 4LG3A 3DTKA 2YU9J 2IS6A 4XLNF 4ENNA 1FY7A 1I6XA 2DOEA 5EGOA 5AIPA 2EILH 2VKEA 3TP3A 2MLGA 3ABKH 3Q9SA 1HSTA 3BJAA 1SD5A 1R9TJ 4JX5A 3MVPA 4AIDA 3H3VK 3ECOA 1G59A 2IGMA 1MIJA 3CMMA 4KIBA 4I99C 3SFZA 5JR3A 1RI7A 1MJAA 1SC7A 4N4OB 2JZYA 1B4AA 1WQ2A 2B63J 2MD5A 3GTGJ 2FBHA 5C3EJ 2XKPA 4HF0A 2PI0A 1MBHA 3AG4H 3OOUA 5DCMA 4A3IJ 2GWRA 2JT1A 1IRXA 3S1NJ 3I55I 4KISA 3OYAA 1U8BA 1AKHA 4OOIA 1X1DA 3L09A 4YFKF 2W85A 1J7KA 5L3EA 3GFIA 2DMPA 1R5GA 2CUFA 5E79C 3MEXA 1F1ZA 3O3KA 1IN5A 3CUQB 4G6QA 3BWGA 1UAAA 4Q5SF 1DGRM 2VKDA 3IWZA 4PJLA 3I71A 5J3LA 3LFUA 3PM1A 1E2XA 3EUAA 2BVMA 5JVGF 3ABLH 1YJWI 3BTCA 3KZZA 1UZCA 3K6GA 4ZTFA 3R61A 2XGDA 3OR2C 1Q1VA 2RC4A 2LKXA 2BGCA 2ESNA 3LQRA 2X1DA 4EJUA 1R71A 4ABZA 5TJJA 1LDJA 3ZMZA 3D5RC 1MMAA 3EYYA 1EH7A 5FLMJ 1JUPA 1JGSA 4BKXA 3C1DA 3GTLJ 4P5OA 1KYWA 2VE8A 5D4SA 2F5CA 3VODA 1S72I 3LSHA 4FTHA 3FXOA 2Z2SB 3ZQQA 2W7NA 2FA5A 5EF6A 2IRFG 4IF4A 1BL0A 3R0JA 2DFHA 4UUSB 3K10A 4RM3A 3SDGA 1ZARA 3RYRA 2B7EA 2CJJA 3QPTA 2R93J 4HX7A 4MEXF 1ZH5A 2AXLA 1QNTA 2EIKH 2Q0OA 4CICA 2DLLA 1FNNA 4H4KC 1GXPA 3JRHA 2WBMA 2PMZN 1LVAA 4U7DA 2ME6A 2E2JJ 4YG2F 4C2TA 1ZRFA 1XN7A 5DD8A 1FMWA 1Z91A 2VBXA 4I09A 4KT5C 2H94A 4M9SA 2QWWA 5D5UB 4WX9A 3EPZA 4M6XA 1ONVA 3IH4A 2IXSA 2XSJC 1YRNA 3ZQCA 1ZG5A 1TWCJ 3RZOJ 2QYOA 2XSDC 3OY9A 5E1ZB 4IOAF 3KCCA 1XMAA 3LNQA 3FBNB 2L7FP 2NYXA 5FROA 3KEYA 2LVSA 1P6RA 1WCMJ 3WG9A 4BEHA 3B6AA 2P4WA 3LA3A 1BA5A 1XC5A 3ZOBA 2E1MB 4B3AA 2K3FA 4E7KA 4EJWA 1YHQI 1WSUA 4BY7J 1WFXA 1XSDA 2PMZA 4JBAA 3DTIA 4Y3OA 4L9TA 2WAQN 2MBFA 5HLTA 2CRGA 3FHZA 4RAGA 3S2DJ 3HOTA 3C2GA 1M1EB 4DOZA 2M30A 3RZDJ 1Z6TA 1B8IA 3BQZA 1MMSA 1SMYF 1R5HA 1OPCA 2L7MP 1ZRCA 4XLFA 3OIOA 3WGHA 2M3AA 4IPAA 5EGOB 5E8IA 1UHSA 2D45A 2VUMJ 4Y7NJ 2XVCA 1W4MA 2OZUA 3HSEA 4KIFA 2DI3A 4NQWA 1Y39A 5E17F 3P7NA 4OIPF 2LC2A 2GZWA 4MIMA 3Q0UA 3DEUA 4AWXB 3I4MJ 4G94A 3ELKA 2VQHA 1XSVA 4Y52J 4DZPA 2EIJH 2KMUA 3OYGA 3HSRA 4YIIA 2XPUA 2IS4A 2Q1ZB 1ZLKA 2HVRA 3ABTA 5CYVA 5FLXZ 2DYRH 2L9RA 5IY5H 3RPUA 3H5NA 2R7FA 3RPQA 3GX4X 3DPTA 1AHDP 2VN2A 2WAQA 1W0UA 1X3WB 5IPAA 5DCMB 4PSXA 3OYLA 3J81Z 2BV6A 4XLPF 3HGYA 2JA5J 3MWMA 4AUXA 5HOOA 3WU1B 1CF7B 2XPWA 2HNHA 3GFMA 1W7PB 2X51A 3X2QH 4M9XA 3BLYA 3KP4A 4EM2A 5JLWA 2XB0X 4I7HA 1K6OA 3L2WA 2R0QC 1OR7A 3F72A 3HM5A 3JSPA 1GV2A 4RLFA 3UR3C 4KICA 4IRHA 1PP7U 4CCKA 1UHMA 3R4KA 4ESBA 4DBRA 1MMNA 3W2AA 1MDMB 2F4MB 3H5RA 2GBYA 3PJRA 2HOAA 4ZDLA 5FFZA 3OYDA 2DT6A 3ML6A 4XK4A 4N9IA 3S16J 4BHPA 1P4WA 4XR6A 3OR1C 4XQFA 4UVBA 3CLQA 3U9GA 4Y15A 3S14J 2B0LA 1MD0A 1S7OA 3QYEA 4KT6A 2MW8A 1KU7A 4UVCA 2FSWA 4KIGA 4XL9A 2RN7A 2FJ1A 3V8JA 3BG5A 1YS7A 1WJCA 3G1MA 2GAUA 3S1RJ 2C6YA 1VQ4I 1QZZA 2KIFA 3TP0A 4BJTA 2M8GX 3KZIC 4L9JA 2F4OB 3LQQA 1SFEA 1VZ0A 5LFAA 4I0BA 4FQGA 4L5IA 1GXQA 4I0AA 2HOTA 2A05A 4XKBA 1RESA 4NB5A 1USSA 4Z2YA 5F64A 4RBOA 1I39A 5KHDA 3QP6A 4DQ2A 1ZR2A 2JJ7A 2M1BA 5EJCA 1LE8A 4PDKA 3GEZA 3BG3A 5DUIA 1RRJA 2ZFWA 1RR8C 4IZZA 1TLHB 1I27A 4XORA 3J7AO 1EF4A 1XGSA 2O0YA 1Z7LA 3SYTA 1FTZA 3CQZJ 5DUKA 2CV0A 2Y48A 1T0FA 4UB8C 4A3JJ 2JWTA 5IYBJ 4CH7A 3BR3A 4BHBA 4A3LJ 4II3A 4Y33A 3O2PE 4WK8F 1ETOA 3ZMUA 2IA0A 3P9KA 5DTDA 1FIAA 1OCZH 2VQGA 2X6WA 3K4LA 3IH2A 1IXRC 4BE2A 3CUOA 3I54A 2GIZA 3OL4A 5IP9J 4IHYA 4PGHA 4IEJA 3KP2A 3K4JA 4XKCA 3S17J 4BEHB 1JTYA 1IRGA 1ETYA 3LMMA 3CJQB 4M3GA 2EH3A 4B09A 4XLCA 5EG0A 1ULYA 2AHQA 3VFZA 4EGYA 1KU9A 2QQAA 3HOUJ 2X6YA 1X3ZB 3ZN1A 4ENMA 1GVJA 2ID3A 2EB7A 3FDYA 1ZELA 3I53A 3BZ6A 1G6NA 5CQGA 1R4NB 3Q0WA 2DK5A 5GPAA 1A04A 2OA4A 4G8XA 3S32A 2FMLA 1B8IB 3W6VA 3HEFA 2ACJA 2CO5A 2YUSA 1NG7A 2V9KA 3VB2A 5JFRA 1H9TA 4JX6A 5HS7A 4NQWB 3K4CA 1IDZA 2MH2A 1IUFA
chains in the Genus database with same CATH topology
3CTAA 4HF1A 2VONA 3FWEA 2M45A 3MZYA 2P5LC 4RAZA 2DK8A 4Q47A 1EH8A 4LG0A 1OYWA 1FP1D 2L4AA 5L3GA 1QQIA 1J9IA 3COAC 1B9NA 4HZFA 1NHAA 3ZMVA 2FF4A 4ZZLA 1O3QA 5IT9K 4EJTA 3OOPA 3GO5A 4OINF 2VT2A 2UXXA 2L02A 2XAJA 2QVOA 2H27A 3FXRA 2ZKZA 5JHUA 2XAQA 3RKWA 4KA4A 3D5LA 3I64A 4L9NA 3TGNA 3E5UA 2HR3A 1MGTA 2JPBA 1ZG1A 5BS6A 3J80Z 3WGIA 2DQRA 1DDNA 2ESHA 3GW2A 2RNJA 5H6RA 1G3SA 3WTZA 1F5TA 3F6VA 4L0ZB 1DP7P 1KGSA 4M74A 2R3SA 4I02A 2GA2A 1TNTA 2IP2A 4LMYA 2BBYA 1BC8C 1J75A 2WC2A 3KP5A 5K5QA 2A61A 4LJZF 5HLIA 4MHGA 5LHIA 3W6JB 1J5YA 4PCQA 1R1TA 1RUOA 2OQRA 2M8EA 2LF8A 3I59B 4KUMA 5E18F 3QPHA 2GXBA 1FBSA 3E6DA 3JAMK 2P8TA 3EDPA 1HBXG 2KIMA 3U1DA 5D5VB 3HTUA 1XDSA 3FXQA 2OZ6A 3BPXA 1OKRA 3IKVA 4L0YB 1LDKB 3C18A 5LRSA 3RDIA 1G3WA 1S29A 2JRTA 5CVUA 1FLIA 1ZGAA 3M7GA 4BH9A 3GXOA 4YFXF 3TOBA 1TBXA 1B1BA 3WTSC 1K78B 2JPCA 2P6SA 4LG0B 1BI1A 4HLYA 2STTA 3B73A 3SHFA 4B8XA 2Z99A 4AIHA 1BI2A 3HHGA 1YQAA 2ISZA 1BN5A 1ZAOA 3E97A 3HHHA 4GCVA 2DQLA 1H9GA 3SQNA 2PEXA 4YFNF 2DW4A 3WU0A 5J6XA 5ERIA 3N4MA 4LLGF 2DPDA 4WWCA 2KJCA 5DD4A 1BM9A 4LK1F 3L9FA 1T98A 2FBIA 5AIQA 2E7WA 2V1UA 2YX4A 1R36A 4L5JA 3U2RA 4CHUA 4OU0A 1G4DA 4O5VA 3T0YA 2A6EF 3F22A 4NHJA 3GFJA 4EJVA 1S8NA 2IPQX 5BOXA 1QZYA 3VOEA 1OYYA 4L18B 3DKWA 3G3ZA 2XAGA 5IT3A 1DUXC 2EJRA 2FBKA 2RV8A 3HRUA 1Z9CA 3REOA 1ON1A 1KQ9A 2KRFA 2EWNA 4EVIA 1KYZA 5D6FA 3ZN0A 3QP5A 2ISYA 2HKOA 1IRFA 4OIQF 4CDGA 4ZH4F 1LB2A 2VE9A 1YTYA 4HA8A 3KETA 5LGUA 2EFQA 3V8KA 4MQVA 4OIRF 1U5TC 5DV5A 1JHHA 1ZHFA 2DPUA 2QZ8A 4JK1X 5K5RA 4DNCA 4UV9A 2FXAA 2K4BA 4ETSA 2X0LA 1I1SA 3M1EA 3KP7A 4HF2A 5HDGA 1TQMA 4N9HA 3RTRA 3F8BA 4ASNA 4E70A 1GHCA 2PFBA 4S04A 1RNLA 1TTYA 2O3FA 3ECHA 1HW5A 5KVRA 4IHSA 4K2EA 1XCVA 1U5TB 3V4GA 4EV0A 4M72A 4PZJA 3LA7A 2Q2EA 3KP3A 2BEOA 3KE2A 1QGPA 5CVJA 3JW4A 1YLFA 1Z1DA 5E20A 4MEYF 2IVMA 4WXCA 4BHCA 2FE3A 1BOAA 2IJLA 1FYLA 2W25A 1ON2A 2QBYB 4I2OA 4GGGA 4KNYA 2PMHA 4BQAA 3T1BA 3FMQA 4RS8A 2MA3A 4MGRA 3N97A 3R0AA 2VBYA 1YIOA 1P4XA 4UV8A 2NNYA 5LRRA 4ZZDA 4RB2C 1KU2A 1BI0A 1P92A 1T38A 3WTUC 1WWXA 5ILSA 1FWZA 4RGRA 1Y0UA 1Z05A 4A5NA 2CWEA 1OMIA 3O6BB 2E1CA 2EFNA 2DU9A 2G7UA 4ENJA 1FOKA 1SFXA 1XCBA 4RGSA 2F5DA 2HYGD 4YIFA 1ZG3A 3E6MA 3F8FA 3F8MA 3FF5A 2O61A 1G3TA 1TQIA 4KN4X 2YR2A 5A2QK 3WTTC 2IT0A 2O03A 4A0XA 3K0LA 5H20A 3JSOA 2Z3YA 2EFOA 1FSHA 1WRJA 3Q5FA 2P7VB 5HVQC 3IWFA 3LFKA 1YW8A 2GQQA 3HRTA 3MQ0A 3ZMSA 2RQPA 4HDUA 2PLYA 3QU6A 1V3FA 3CDHA 4G7OF 2BE5F 5D4RA 1S3JA 4CYDA 1YYVA 2J5OA 3F8CA 1G3YA 5HDNA 3C7JA 3M8FA 3I0TA 2ADUA 5D5XB 4ZYDA 3DQVC 1FC3A 2CGPA 2H6BA 2V6CA 1W7PD 3TO7A 4H0EA 2MLKA 4LFUA 3ABUA 4AD9A 1LQ1A 1C0WA 1O57A 2YSRA 5LHGA 2UXNA 2HDCA 1U3EM 3V7SA 1T6SA 3IHUA 2DO7A 2VOOA 2ZMEA 5CVRA 3CO6C 2MC3A 4BYYA 1LJ9A 4RGUA 1BI3A 3H3UA 4M6YA 3F23A 1BIBA 4ZYGA 5ILUA 5ILVA 5FB2A 3RIRA 5HLGA 1RIOH 4HX8A 1K79A 2QLZA 1STZA 3DF8A 1R1VA 4RB0A 1J0RA 5F1RA 2WV0A 2A68F 4KN7X 1FSEA 2EV5A 3WTVC 4ENKA 4OMYA 1JHFA 4EJOA 1FBUA 1VTNC 1W5TA 5EEGA 3KEQA 2HQRA 4Y17A 2QQBA 2RDPA 3T5XA 2A69F 2VC0A 3E5QA 2XV4S 4ON0A 4ESFA 4G9YA 1SFUA 3WGGA 4P9UA 1U8RA 4HX4A 3QOPA 1JXSA 3JTGA 1SAXA 3DV8A 4GYIA 1R22A 2XRNA 4BXUA 2XKOA 1XGOA 1UB9A 3DFGA 4MQ9F 3JTHA 5TRDA 3WE3A 1HXDA 1TW3A 1E17A 1T39A 3BY6A 2R7DA 1IN4A 3EQLF 1SMTA 5LGTA 4UNOA 2XAHA 2G7HA 3L00A 4RAYA 4A12A 4Q48A 4FT8A 3ZP5A 1ZYRF 3SXYA 2KIUA 1LEBA 2F5FA 1UFMA 2V1DA 5HS9A 1FYMA 2OBPA 1DPRA 1OYIA 1IUYA 2YX7A 1T2KA 3ZMDA 4N0BA 3F8NA 4GXOA 3EUHA 5LHHA 3LAPA 2VOPA 1S7AA 1ZREA 3HYIA 5JI6A 2NS0A 5FLXK 3KEOA 1U6GA 2XUBA 4WXHA 1EH6A 1F4KA 3WTWC 4G6DA 4A0ZA 2A6HF 5FGMA 3J81K 2Z33A 1XGMA 1IF1A 5FO5A 4FX0A 2FRHA 2WTEA 3GZ5A 1KQ8A 2M5WA 5J8FA 1L3LA 1FPQA 5JVTA 2L4MA 3QRFF 4A5MA 1MJ9A 1V4RA 3LAJA 3HRSA 2K27A 3CUQA 3CLOA 5CJ9A 3IRQA 2W84A 2ZBKA 3HTSB 4CGZA 4A6EA 1I5ZA 2HQNA 2V1XA 1O7LA 1HW1A 2XROA 3K69A 3DPLC 3EYIA 4GO1A 2LKPA 3FXUA 2IW5A 4WXDA 2Y75A 1AWCA 2PG4A 4G7HF 1PUEE 2HS5A 2QM3A 2UZKA 5ICCA 3DP7A 4MTEA 5FFXA 2TDXA 3FM5A 4LD5A 1R7JA 4U88A 3D0SA 4EMSA 5LEJA 1Z6RA 2XIGA 3T8TA 5D8LB 5E1XA 3M9AA 2CW0F 5EEHA 3P9IA 6PAXA 3ERED 2XASA 2V79A 4F7ZA 2UWMA 3IKTA 2BYVE 4EGZA 2HWVA 1HKQA 4KMFA 3MFKA 1Z7UA 4MTDA 2NNNA 4R79A 1FX7A 1PP8F 5LBQA 2XAFA 4PGGA 2VT3A 2EV6A 1P4AA 1R1UA 4OMZA 4R1HA 4HDVA 3PQKA 3V7CA 5L3BA 1X3UA 3K9TA 2MH9A 3M8EA 2EV0A 4XSXF 4AIJA 4JQFA 2VC1A 3QU3A 1D8JA 2ELHA 4XSZF 4IJAA 4U0WA 3GUDA 1W5SA 1U78A 4HW0A 2EK5A 2PJPA 4M71A 1O3RA 3E6CC 5CLSA 3LSTA 1CF7A 1W7PA 2Y0MA 3V7RA 5K5OA 4OIOF 3KFWX 5DCFA 4R8HA 2LDUA 4RGXA 3F21A 1MDMA 4ZYHA 3R6SA 5ICEA 2Z9OA 3GYHX 2DFIA 2O8XA 1LEAA 4U0YA 1FZPB 5ED4A 3J80K 2HTSA 3K2ZA 3WODF 1IN8A 2HZTA 1HSJA 2QUFA 3L7WA 3PFIA 3BPVA 2FQ3A 1RUNA 2OQGA 1K7AA 2D2WA 3GVAA 1MZBA 4G7ZF 3FMRA 2A5YB 2QENA 1XMKA 1USTA 5IT9Z 1R23A 1I1GA 1AOYA 3C3WA 2KJBA 1YS6A 2JSCA 2QQ9A 4KFCA 1HKSA 1IXSB 2ZNYA 3K1NA 1R58A 3GF2A 4HYEA 3T8RA 3HIFA 2VBWA 2EFPA 2NRAC 3KZYA 1FP2A 1ZN2A 2DAOA 3BROA 1KA8A 1O3SA 1CGPA 2ZCWA 3KP6A 3S2WA 1WKMA 3IRRA 1IN6A 2HTJA 4CXFA 1FT9A 1ODDA 5E1WA 3OV8A 2A07F 5CVVA 2HOEA 2FOKA 3RJPA 3GZ6A 3EETA 4HV5A 4MNUA 3FZVA 3JAMZ 1KU3A 5FD5A 1HQCA 2X4HA 1D8KA 3FM3A 3CJNA 1DPUA 5L3CA 4Y13A 1O7FA 3MAJA 4KDPA 4L9VA 2RGVA 2CG4A 3H3ZA 1WI9A 5L3FA 4IHTA 3MCZA 2LF7A 1BJAA 1O3TA 4P9FA 3K1PA 1IXCA 4CZZA 1BIAA 3WTYC 3KLNA 4CO8A 4M9ZA 1SD6A 1LDDA 2XGXA 4BNCA 3WTXC 2ZNZA 3RKYA 5HLHA 2F2EA 1R00A 5F6FA 1SD4A 4HBLA 3QAHA 5LGNA 2K7LA 2V9VA 2EA4A 4IXAA 2K02A 4LLNA 5LEKA 3P9CA 2W24A 2ZO4A 3NQOA 3E5XA 2YPRA 2COMA 5BPIA 1J59A 4HQMA 2D1VA 2VBZA 1B59A 3HSFA 4LLLA 1TNSA 1QBJA 1D3YA 1REPC 1UCRA 2PN6A 1H0MA 2ETHA 3R60A 2DT5A 2DBBA 1BC7C 5DDGA 2O6GE 1YFHA 3NRVA 1B6AA 1XGNA 4WF2A 2GIVA 3F6OA 4IRIA 1P2FA 3VEPA 2K4JA 4UHTA 3BJ6A 3TO9A 5BPDA 1MJBA 3RI4A 3I59A 3HUGA 4LK0F 1HW2A 2D1HA 3IL2A 2HFHA 1IAWA 3IC7A 4GYGA 2LNBA 2GXGA 2P5KA 5AONA 2XHKA 4U0VA 4UXNA 2VODA 1SD7A 3W6KB 2E7XA 4FX4A 1TW2A 2EFWA 3RKXA 1HKTA 3Q9VA 2W57A 5FD6A 1XSXA 4KYWA 5DEQA 3KLOA 2PBIA 2HGCA 2J5PA 4HAMA 1MKMA 3TDZC 4EM1A 5E8GA 3TDUC 2P5VA 2HKXA 2CQKA 3F3XA 4I98B 2L54A 1K78A 1IZ1A 5BMZA 3I4PA 4HV6A 2CSOA 4LB5A 3PQJA 4XBFA 3LA2A 4U7BA 3TKYA 2ZJ2A 1TQPA 4Q4ZF 1XB4A 5L3DA 1FYKA 1U2WA 3ROUA 2L01A 1LNWA 4TV7A 5HS8A 2H6CA 3ZQ7A 2LSOA 2Q8KA 4WCGA 1XD7A 1FBQA 3HRMA 4HQEA 2Z5UA 1EV7A 4EQQA 3K1MA 3LWFA 4IVNA 1UHWA 2NAZA 4QLCU 2L3DA 5KK1A 4BAYA 4LB6B 2IA2A 3SZPA 5CVIA 4A2UA 5ICFA 4IRGA 5DYMA 5BQTA 2KKOA 2YU3A 2ZMEB 3TOAA 1YO5C 3DXJF 2FMYA 1YW9A 3HOSA 5LLQA 3FMSA 2STWA 2K86A 3H92A 3ISPA 3E3VA 4KMUX 1F9NA 4RB3C 2P6TA 1ZGJA 3I5UA 4HLXA 1JE8A 1QO0D 2FEZA 4O3MA 4EM0B 1Q1HA 2ZXJA 3CO7C 3ULQB 3V8LA 2EA2A 4P96A 4UUVA 2F5EA 2M87A 2CFXA 2IA1A 3TQNA 2RKHA 1B9MA 2P7CB 1IN7A 2JTVA 4AIKA 3BP8A 3G73A 3B02A 4HOBA 3L2CA 4D0PA 2PQ8A 4FHTA 3MZHA 1YW7A 2OD5A 1L0OC 3ZPLA 3BDDA 2VXZA 2OAZA 1ZRDA 1ZLJA 2OU2A 1BBYA 1J2XA 2WWYA 4ESJA 4M73A 4A0YA 2CYYA 4I01A 4LGWA 4XRFA 5A2QZ 1IW7F 4S05A 3BJOA 3NEUA 3SZTA 5K1YA 1U5TA 5HDKA 2HYFA 4RB1A 5D5WB 2FU4A 2PMUA 2FNAA 5J8CA 2H09A 5D6EA 2FNPA 3E6BA 4P55A 1KQ0A 3GLXA 4O6JA 3RYPA 2RVCA 4A6DA 5H6QA 2G9WA 3GWZA 5D8KB 1XDUA 1PDNC 1QPMA 3TO6A 2E1NA 3ZMTA 2A3SA 2AS5F 4QWQA 2QBYA 1RZ4A 4ZYEA 3I58A 2DTRA 2HEOA 4UVAA 3WE2A 2GA1A 1D5VA 3BOQA 1YG2A 3FX3A 5ICGA 3AAFA 3GFLA 3CUQC 4AVPA 1S6LA 4XLNF 4ENNA 1FY7A 1I6XA 5AIPA 2MLGA 3Q9SA 1HSTA 3BJAA 1SD5A 3ECOA 4KIBA 5JR3A 3SFZA 1RI7A 1MJAA 2JZYA 1B4AA 1WQ2A 2MD5A 2FBHA 2XKPA 4HF0A 2PI0A 5DCMA 2GWRA 2JT1A 4OOIA 3L09A 4YFKF 2W85A 1J7KA 5L3EA 3GFIA 1R5GA 3MEXA 1F1ZA 3O3KA 1IN5A 3CUQB 4G6QA 3BWGA 4Q5SF 3IWZA 3I71A 1E2XA 3KZZA 3R61A 2RC4A 2BGCA 2ESNA 3LQRA 4EJUA 5TJJA 1LDJA 3ZMZA 3EYYA 1EH7A 1JGSA 3C1DA 4P5OA 1KYWA 2VE8A 5D4SA 2F5CA 3VODA 2FA5A 2IRFG 4IF4A 3R0JA 1ZARA 3RYRA 3QPTA 4HX7A 4MEXF 1ZH5A 2AXLA 1QNTA 2Q0OA 1GXPA 4CICA 2DLLA 1FNNA 1LVAA 4U7DA 4YG2F 1ZRFA 1XN7A 5DD8A 4I09A 1Z91A 2VBXA 4KT5C 2H94A 4M9SA 2QWWA 5D5UB 4WX9A 4M6XA 1ONVA 1ZG5A 2QYOA 5E1ZB 3KCCA 1XMAA 2NYXA 1P6RA 3WG9A 3LA3A 2P4WA 1WSUA 4EJWA 1XSDA 4JBAA 4L9TA 2MBFA 3FHZA 3HOTA 2M30A 1Z6TA 1SMYF 1R5HA 1OPCA 1ZRCA 3WGHA 4IPAA 5E8IA 2D45A 2XVCA 1W4MA 2OZUA 3HSEA 4KIFA 2DI3A 4NQWA 5E17F 3P7NA 4OIPF 2GZWA 3DEUA 4AWXB 4G94A 3ELKA 1XSVA 3HSRA 4YIIA 1ZLKA 3ABTA 5CYVA 5FLXZ 3RPUA 3GX4X 2R7FA 3RPQA 3DPTA 2VN2A 5DCMB 3J81Z 2BV6A 4XLPF 3MWMA 5HOOA 3WU1B 1CF7B 3GFMA 1W7PB 4M9XA 3KP4A 4EM2A 4I7HA 1K6OA 1OR7A 3F72A 3JSPA 4KICA 4IRHA 1PP7U 1UHMA 3R4KA 4ESBA 1MDMB 5FFZA 3ML6A 4N9IA 4BHPA 1P4WA 4UVBA 3U9GA 4Y15A 2B0LA 1MD0A 1S7OA 1KU7A 4UVCA 2FSWA 4KIGA 2RN7A 3V8JA 1YS7A 2GAUA 2C6YA 1QZZA 2KIFA 4L9JA 3LQQA 1SFEA 4I0BA 4L5IA 1GXQA 4I0AA 4NB5A 1USSA 4Z2YA 5F64A 3QP6A 4DQ2A 2M1BA 4PDKA 3GEZA 5DUIA 2ZFWA 1TLHB 1I27A 3J7AO 1XGSA 2O0YA 5DUKA 2Y48A 1T0FA 4BHBA 3O2PE 4WK8F 3ZMUA 2IA0A 3P9KA 1IXRC 3CUOA 3I54A 4PGHA 3KP2A 1IRGA 4B09A 1ULYA 3VFZA 4EGYA 1KU9A 2QQAA 3ZN1A 4ENMA 1GVJA 2EB7A 3I53A 3BZ6A 1G6NA 2DK5A 1A04A 2OA4A 4G8XA 2FMLA 2ACJA 2CO5A 3VB2A 5JFRA 1H9TA 5HS7A 2MH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CTA A;  4HF1 A;  2VON A;  3FWE A;  2M45 A;  3MZY A;  2P5L C;  4RAZ A;  2DK8 A;  4Q47 A;  1EH8 A;  4LG0 A;  1OYW A;  1FP1 D;  2L4A A;  5L3G A;  1QQI A;  1J9I A;  3COA C;  1B9N A;  4HZF A;  1NHA A;  3ZMV A;  2FF4 A;  4ZZL A;  1O3Q A;  5IT9 K;  4EJT A;  3OOP A;  3GO5 A;  4OIN F;  2VT2 A;  2UXX A;  2L02 A;  2XAJ A;  2QVO A;  2H27 A;  3FXR A;  2ZKZ A;  5JHU A;  2XAQ A;  3RKW A;  4KA4 A;  3D5L A;  3I64 A;  4L9N A;  3TGN A;  3E5U A;  2HR3 A;  1MGT A;  2JPB A;  1ZG1 A;  5BS6 A;  3J80 Z;  3WGI A;  2DQR A;  1DDN A;  2ESH A;  3GW2 A;  2RNJ A;  5H6R A;  1G3S A;  3WTZ A;  1F5T A;  3F6V A;  4L0Z B;  1DP7 P;  1KGS A;  4M74 A;  2R3S A;  4I02 A;  2GA2 A;  1TNT A;  2IP2 A;  4LMY A;  2BBY A;  1BC8 C;  1J75 A;  2WC2 A;  3KP5 A;  5K5Q A;  2A61 A;  4LJZ F;  5HLI A;  4MHG A;  5LHI A;  3W6J B;  1J5Y A;  4PCQ A;  1R1T A;  1RUO A;  2OQR A;  2M8E A;  2LF8 A;  3I59 B;  4KUM A;  5E18 F;  3QPH A;  2GXB A;  1FBS A;  3E6D A;  3JAM K;  2P8T A;  3EDP A;  1HBX G;  2KIM A;  3U1D A;  5D5V B;  3HTU A;  1XDS A;  3FXQ A;  2OZ6 A;  3BPX A;  1OKR A;  3IKV A;  4L0Y B;  1LDK B;  3C18 A;  5LRS A;  3RDI A;  1G3W A;  1S29 A;  2JRT A;  5CVU A;  1FLI A;  1ZGA A;  3M7G A;  4BH9 A;  3GXO A;  4YFX F;  3TOB A;  1TBX A;  1B1B A;  3WTS C;  1K78 B;  2JPC A;  2P6S A;  4LG0 B;  1BI1 A;  4HLY A;  2STT A;  3B73 A;  3SHF A;  4B8X A;  2Z99 A;  4AIH A;  1BI2 A;  3HHG A;  1YQA A;  2ISZ A;  1BN5 A;  1ZAO A;  3E97 A;  3HHH A;  4GCV A;  2DQL A;  1H9G A;  3SQN A;  2PEX A;  4YFN F;  2DW4 A;  3WU0 A;  5J6X A;  5ERI A;  3N4M A;  4LLG F;  2DPD A;  4WWC A;  2KJC A;  5DD4 A;  1BM9 A;  4LK1 F;  3L9F A;  1T98 A;  2FBI A;  5AIQ A;  2E7W A;  2V1U A;  2YX4 A;  1R36 A;  4L5J A;  3U2R A;  4CHU A;  4OU0 A;  1G4D A;  4O5V A;  3T0Y A;  2A6E F;  3F22 A;  4NHJ A;  3GFJ A;  4EJV A;  1S8N A;  2IPQ X;  5BOX A;  1QZY A;  3VOE A;  1OYY A;  4L18 B;  3DKW A;  3G3Z A;  2XAG A;  5IT3 A;  1DUX C;  2EJR A;  2FBK A;  2RV8 A;  3HRU A;  1Z9C A;  3REO A;  1ON1 A;  1KQ9 A;  2KRF A;  2EWN A;  4EVI A;  1KYZ A;  5D6F A;  3ZN0 A;  3QP5 A;  2ISY A;  2HKO A;  1IRF A;  4OIQ F;  4CDG A;  4ZH4 F;  1LB2 A;  2VE9 A;  1YTY A;  4HA8 A;  3KET A;  5LGU A;  2EFQ A;  3V8K A;  4MQV A;  4OIR F;  1U5T C;  5DV5 A;  1JHH A;  1ZHF A;  2DPU A;  2QZ8 A;  4JK1 X;  5K5R A;  4DNC A;  4UV9 A;  2FXA A;  2K4B A;  4ETS A;  2X0L A;  1I1S A;  3M1E A;  3KP7 A;  4HF2 A;  5HDG A;  1TQM A;  4N9H A;  3RTR A;  3F8B A;  4ASN A;  4E70 A;  1GHC A;  2PFB A;  4S04 A;  1RNL A;  1TTY A;  2O3F A;  3ECH A;  1HW5 A;  5KVR A;  4IHS A;  4K2E A;  1XCV A;  1U5T B;  3V4G A;  4EV0 A;  4M72 A;  4PZJ A;  3LA7 A;  2Q2E A;  3KP3 A;  2BEO A;  3KE2 A;  1QGP A;  5CVJ A;  3JW4 A;  1YLF A;  1Z1D A;  5E20 A;  4MEY F;  2IVM A;  4WXC A;  4BHC A;  2FE3 A;  1BOA A;  2IJL A;  1FYL A;  2W25 A;  1ON2 A;  2QBY B;  4I2O A;  4GGG A;  4KNY A;  2PMH A;  4BQA A;  3T1B A;  3FMQ A;  4RS8 A;  2MA3 A;  4MGR A;  3N97 A;  3R0A A;  2VBY A;  1YIO A;  1P4X A;  4UV8 A;  2NNY A;  5LRR A;  4ZZD A;  4RB2 C;  1KU2 A;  1BI0 A;  1P92 A;  1T38 A;  3WTU C;  1WWX A;  5ILS A;  1FWZ A;  4RGR A;  1Y0U A;  1Z05 A;  4A5N A;  2CWE A;  1OMI A;  3O6B B;  2E1C A;  2EFN A;  2DU9 A;  2G7U A;  4ENJ A;  1FOK A;  1SFX A;  1XCB A;  4RGS A;  2F5D A;  2HYG D;  4YIF A;  1ZG3 A;  3E6M A;  3F8F A;  3F8M A;  3FF5 A;  2O61 A;  1G3T A;  1TQI A;  4KN4 X;  2YR2 A;  5A2Q K;  3WTT C;  2IT0 A;  2O03 A;  4A0X A;  3K0L A;  5H20 A;  3JSO A;  2Z3Y A;  2EFO A;  1FSH A;  1WRJ A;  3Q5F A;  2P7V B;  5HVQ C;  3IWF A;  3LFK A;  1YW8 A;  2GQQ A;  3HRT A;  3MQ0 A;  3ZMS A;  2RQP A;  4HDU A;  2PLY A;  3QU6 A;  1V3F A;  3CDH A;  4G7O F;  2BE5 F;  5D4R A;  1S3J A;  4CYD A;  1YYV A;  2J5O A;  3F8C A;  1G3Y A;  5HDN A;  3C7J A;  3M8F A;  3I0T A;  2ADU A;  5D5X B;  4ZYD A;  3DQV C;  1FC3 A;  2CGP A;  2H6B A;  2V6C A;  1W7P D;  3TO7 A;  4H0E A;  2MLK A;  4LFU A;  3ABU A;  4AD9 A;  1LQ1 A;  1C0W A;  1O57 A;  2YSR A;  5LHG A;  2UXN A;  2HDC A;  1U3E M;  3V7S A;  1T6S A;  3IHU A;  2DO7 A;  2VOO A;  2ZME A;  5CVR A;  3CO6 C;  2MC3 A;  4BYY A;  1LJ9 A;  4RGU A;  1BI3 A;  3H3U A;  4M6Y A;  3F23 A;  1BIB A;  4ZYG A;  5ILU A;  5ILV A;  5FB2 A;  3RIR A;  5HLG A;  1RIO H;  4HX8 A;  1K79 A;  2QLZ A;  1STZ A;  3DF8 A;  1R1V A;  4RB0 A;  1J0R A;  5F1R A;  2WV0 A;  2A68 F;  4KN7 X;  1FSE A;  2EV5 A;  3WTV C;  4ENK A;  4OMY A;  1JHF A;  4EJO A;  1FBU A;  1VTN C;  1W5T A;  5EEG A;  3KEQ A;  2HQR A;  4Y17 A;  2QQB A;  2RDP A;  3T5X A;  2A69 F;  2VC0 A;  3E5Q A;  2XV4 S;  4ON0 A;  4ESF A;  4G9Y A;  1SFU A;  3WGG A;  4P9U A;  1U8R A;  4HX4 A;  3QOP A;  1JXS A;  3JTG A;  1SAX A;  3DV8 A;  4GYI A;  1R22 A;  2XRN A;  4BXU A;  2XKO A;  1XGO A;  1UB9 A;  3DFG A;  4MQ9 F;  3JTH A;  5TRD A;  3WE3 A;  1HXD A;  1TW3 A;  1E17 A;  1T39 A;  3BY6 A;  2R7D A;  1IN4 A;  3EQL F;  1SMT A;  5LGT A;  4UNO A;  2XAH A;  2G7H A;  3L00 A;  4RAY A;  4A12 A;  4Q48 A;  4FT8 A;  3ZP5 A;  1ZYR F;  3SXY A;  2KIU A;  1LEB A;  2F5F A;  1UFM A;  2V1D A;  5HS9 A;  1FYM A;  2OBP A;  1DPR A;  1OYI A;  1IUY A;  2YX7 A;  1T2K A;  3ZMD A;  4N0B A;  3F8N A;  4GXO A;  3EUH A;  5LHH A;  3LAP A;  2VOP A;  1S7A A;  1ZRE A;  3HYI A;  5JI6 A;  2NS0 A;  5FLX K;  3KEO A;  1U6G A;  2XUB A;  4WXH A;  1EH6 A;  1F4K A;  3WTW C;  4G6D A;  4A0Z A;  2A6H F;  5FGM A;  3J81 K;  2Z33 A;  1XGM A;  1IF1 A;  5FO5 A;  4FX0 A;  2FRH A;  2WTE A;  3GZ5 A;  1KQ8 A;  2M5W A;  5J8F A;  1L3L A;  1FPQ A;  5JVT A;  2L4M A;  3QRF F;  4A5M A;  1MJ9 A;  1V4R A;  3LAJ A;  3HRS A;  2K27 A;  3CUQ A;  3CLO A;  5CJ9 A;  3IRQ A;  2W84 A;  2ZBK A;  3HTS B;  4CGZ A;  4A6E A;  1I5Z A;  2HQN A;  2V1X A;  1O7L A;  1HW1 A;  2XRO A;  3K69 A;  3DPL C;  3EYI A;  4GO1 A;  2LKP A;  3FXU A;  2IW5 A;  4WXD A;  2Y75 A;  1AWC A;  2PG4 A;  4G7H F;  1PUE E;  2HS5 A;  2QM3 A;  2UZK A;  5ICC A;  3DP7 A;  4MTE A;  5FFX A;  2TDX A;  3FM5 A;  4LD5 A;  1R7J A;  4U88 A;  3D0S A;  4EMS A;  5LEJ A;  1Z6R A;  2XIG A;  3T8T A;  5D8L B;  5E1X A;  3M9A A;  2CW0 F;  5EEH A;  3P9I A;  6PAX A;  3ERE D;  2XAS A;  2V79 A;  4F7Z A;  2UWM A;  3IKT A;  2BYV E;  4EGZ A;  2HWV A;  1HKQ A;  4KMF A;  3MFK A;  1Z7U A;  4MTD A;  2NNN A;  4R79 A;  1FX7 A;  1PP8 F;  5LBQ A;  2XAF A;  4PGG A;  2VT3 A;  2EV6 A;  1P4A A;  1R1U A;  4OMZ A;  4R1H A;  4HDV A;  3PQK A;  3V7C A;  5L3B A;  1X3U A;  3K9T A;  2MH9 A;  3M8E A;  2EV0 A;  4XSX F;  4AIJ A;  4JQF A;  2VC1 A;  3QU3 A;  1D8J A;  2ELH A;  4XSZ F;  4IJA A;  4U0W A;  3GUD A;  1W5S A;  1U78 A;  4HW0 A;  2EK5 A;  2PJP A;  4M71 A;  1O3R A;  3E6C C;  5CLS A;  3LST A;  1CF7 A;  1W7P A;  2Y0M A;  3V7R A;  5K5O A;  4OIO F;  3KFW X;  5DCF A;  4R8H A;  2LDU A;  4RGX A;  3F21 A;  1MDM A;  4ZYH A;  3R6S A;  5ICE A;  2Z9O A;  3GYH X;  2DFI A;  2O8X A;  1LEA A;  4U0Y A;  1FZP B;  5ED4 A;  3J80 K;  2HTS A;  3K2Z A;  3WOD F;  1IN8 A;  2HZT A;  1HSJ A;  2QUF A;  3L7W A;  3PFI A;  3BPV A;  2FQ3 A;  1RUN A;  2OQG A;  1K7A A;  2D2W A;  3GVA A;  1MZB A;  4G7Z F;  3FMR A;  2A5Y B;  2QEN A;  1XMK A;  1UST A;  5IT9 Z;  1R23 A;  1I1G A;  1AOY A;  3C3W A;  2KJB A;  1YS6 A;  2JSC A;  2QQ9 A;  4KFC A;  1HKS A;  1IXS B;  2ZNY A;  3K1N A;  1R58 A;  3GF2 A;  4HYE A;  3T8R A;  3HIF A;  2VBW A;  2EFP A;  2NRA C;  3KZY A;  1FP2 A;  1ZN2 A;  2DAO A;  3BRO A;  1KA8 A;  1O3S A;  1CGP A;  2ZCW A;  3KP6 A;  3S2W A;  1WKM A;  3IRR A;  1IN6 A;  2HTJ A;  4CXF A;  1FT9 A;  1ODD A;  5E1W A;  3OV8 A;  2A07 F;  5CVV A;  2HOE A;  2FOK A;  3RJP A;  3GZ6 A;  3EET A;  4HV5 A;  4MNU A;  3FZV A;  3JAM Z;  1KU3 A;  5FD5 A;  1HQC A;  2X4H A;  1D8K A;  3FM3 A;  3CJN A;  1DPU A;  5L3C A;  4Y13 A;  1O7F A;  3MAJ A;  4KDP A;  4L9V A;  2RGV A;  2CG4 A;  3H3Z A;  1WI9 A;  5L3F A;  4IHT A;  3MCZ A;  2LF7 A;  1BJA A;  1O3T A;  4P9F A;  3K1P A;  1IXC A;  4CZZ A;  1BIA A;  3WTY C;  3KLN A;  4CO8 A;  4M9Z A;  1SD6 A;  1LDD A;  2XGX A;  4BNC A;  3WTX C;  2ZNZ A;  3RKY A;  5HLH A;  2F2E A;  1R00 A;  5F6F A;  1SD4 A;  4HBL A;  3QAH A;  5LGN A;  2K7L A;  2V9V A;  2EA4 A;  4IXA A;  2K02 A;  4LLN A;  5LEK A;  3P9C A;  2W24 A;  2ZO4 A;  3NQO A;  3E5X A;  2YPR A;  2COM A;  5BPI A;  1J59 A;  4HQM A;  2D1V A;  2VBZ A;  1B59 A;  3HSF A;  4LLL A;  1TNS A;  1QBJ A;  1D3Y A;  1REP C;  1UCR A;  2PN6 A;  1H0M A;  2ETH A;  3R60 A;  2DT5 A;  2DBB A;  1BC7 C;  5DDG A;  2O6G E;  1YFH A;  3NRV A;  1B6A A;  1XGN A;  4WF2 A;  2GIV A;  3F6O A;  4IRI A;  1P2F A;  3VEP A;  2K4J A;  4UHT A;  3BJ6 A;  3TO9 A;  5BPD A;  1MJB A;  3RI4 A;  3I59 A;  3HUG A;  4LK0 F;  1HW2 A;  2D1H A;  3IL2 A;  2HFH A;  1IAW A;  3IC7 A;  4GYG A;  2LNB A;  2GXG A;  2P5K A;  5AON A;  2XHK A;  4U0V A;  4UXN A;  2VOD A;  1SD7 A;  3W6K B;  2E7X A;  4FX4 A;  1TW2 A;  2EFW A;  3RKX A;  1HKT A;  3Q9V A;  2W57 A;  5FD6 A;  1XSX A;  4KYW A;  5DEQ A;  3KLO A;  2PBI A;  2HGC A;  2J5P A;  4HAM A;  1MKM A;  3TDZ C;  4EM1 A;  5E8G A;  3TDU C;  2P5V A;  2HKX A;  2CQK A;  3F3X A;  4I98 B;  2L54 A;  1K78 A;  1IZ1 A;  5BMZ A;  3I4P A;  4HV6 A;  2CSO A;  4LB5 A;  3PQJ A;  4XBF A;  3LA2 A;  4U7B A;  3TKY A;  2ZJ2 A;  1TQP A;  4Q4Z F;  1XB4 A;  5L3D A;  1FYK A;  1U2W A;  3ROU A;  2L01 A;  1LNW A;  4TV7 A;  5HS8 A;  2H6C A;  3ZQ7 A;  2LSO A;  2Q8K A;  4WCG A;  1XD7 A;  1FBQ A;  3HRM A;  4HQE A;  2Z5U A;  1EV7 A;  4EQQ A;  3K1M A;  3LWF A;  4IVN A;  1UHW A;  2NAZ A;  4QLC U;  2L3D A;  5KK1 A;  4BAY A;  4LB6 B;  2IA2 A;  3SZP A;  5CVI A;  4A2U A;  5ICF A;  4IRG A;  5DYM A;  5BQT A;  2KKO A;  2YU3 A;  2ZME B;  3TOA A;  1YO5 C;  3DXJ F;  2FMY A;  1YW9 A;  3HOS A;  5LLQ A;  3FMS A;  2STW A;  2K86 A;  3H92 A;  3ISP A;  3E3V A;  4KMU X;  1F9N A;  4RB3 C;  2P6T A;  1ZGJ A;  3I5U A;  4HLX A;  1JE8 A;  1QO0 D;  2FEZ A;  4O3M A;  4EM0 B;  1Q1H A;  2ZXJ A;  3CO7 C;  3ULQ B;  3V8L A;  2EA2 A;  4P96 A;  4UUV A;  2F5E A;  2M87 A;  2CFX A;  2IA1 A;  3TQN A;  2RKH A;  1B9M A;  2P7C B;  1IN7 A;  2JTV A;  4AIK A;  3BP8 A;  3G73 A;  3B02 A;  4HOB A;  3L2C A;  4D0P A;  2PQ8 A;  4FHT A;  3MZH A;  1YW7 A;  2OD5 A;  1L0O C;  3ZPL A;  3BDD A;  2VXZ A;  2OAZ A;  1ZRD A;  1ZLJ A;  2OU2 A;  1BBY A;  1J2X A;  2WWY A;  4ESJ A;  4M73 A;  4A0Y A;  2CYY A;  4I01 A;  4LGW A;  4XRF A;  5A2Q Z;  1IW7 F;  4S05 A;  3BJO A;  3NEU A;  3SZT A;  5K1Y A;  1U5T A;  5HDK A;  2HYF A;  4RB1 A;  5D5W B;  2FU4 A;  2PMU A;  2FNA A;  5J8C A;  2H09 A;  5D6E A;  2FNP A;  3E6B A;  4P55 A;  1KQ0 A;  3GLX A;  4O6J A;  3RYP A;  2RVC A;  4A6D A;  5H6Q A;  2G9W A;  3GWZ A;  5D8K B;  1XDU A;  1PDN C;  1QPM A;  3TO6 A;  2E1N A;  3ZMT A;  2A3S A;  2AS5 F;  4QWQ A;  2QBY A;  1RZ4 A;  4ZYE A;  3I58 A;  2DTR A;  2HEO A;  4UVA A;  3WE2 A;  2GA1 A;  1D5V A;  3BOQ A;  1YG2 A;  3FX3 A;  5ICG A;  3AAF A;  3GFL A;  3CUQ C;  4AVP A;  1S6L A;  4XLN F;  4ENN A;  1FY7 A;  1I6X A;  5AIP A;  2MLG A;  3Q9S A;  1HST A;  3BJA A;  1SD5 A;  3ECO A;  4KIB A;  5JR3 A;  3SFZ A;  1RI7 A;  1MJA A;  2JZY A;  1B4A A;  1WQ2 A;  2MD5 A;  2FBH A;  2XKP A;  4HF0 A;  2PI0 A;  5DCM A;  2GWR A;  2JT1 A;  4OOI A;  3L09 A;  4YFK F;  2W85 A;  1J7K A;  5L3E A;  3GFI A;  1R5G A;  3MEX A;  1F1Z A;  3O3K A;  1IN5 A;  3CUQ B;  4G6Q A;  3BWG A;  4Q5S F;  3IWZ A;  3I71 A;  1E2X A;  3KZZ A;  3R61 A;  2RC4 A;  2BGC A;  2ESN A;  3LQR A;  4EJU A;  5TJJ A;  1LDJ A;  3ZMZ A;  3EYY A;  1EH7 A;  1JGS A;  3C1D A;  4P5O A;  1KYW A;  2VE8 A;  5D4S A;  2F5C A;  3VOD A;  2FA5 A;  2IRF G;  4IF4 A;  3R0J A;  1ZAR A;  3RYR A;  3QPT A;  4HX7 A;  4MEX F;  1ZH5 A;  2AXL A;  1QNT A;  2Q0O A;  1GXP A;  4CIC A;  2DLL A;  1FNN A;  1LVA A;  4U7D A;  4YG2 F;  1ZRF A;  1XN7 A;  5DD8 A;  4I09 A;  1Z91 A;  2VBX A;  4KT5 C;  2H94 A;  4M9S A;  2QWW A;  5D5U B;  4WX9 A;  4M6X A;  1ONV A;  1ZG5 A;  2QYO A;  5E1Z B;  3KCC A;  1XMA A;  2NYX A;  1P6R A;  3WG9 A;  3LA3 A;  2P4W A;  1WSU A;  4EJW A;  1XSD A;  4JBA A;  4L9T A;  2MBF A;  3FHZ A;  3HOT A;  2M30 A;  1Z6T A;  1SMY F;  1R5H A;  1OPC A;  1ZRC A;  3WGH A;  4IPA A;  5E8I A;  2D45 A;  2XVC A;  1W4M A;  2OZU A;  3HSE A;  4KIF A;  2DI3 A;  4NQW A;  5E17 F;  3P7N A;  4OIP F;  2GZW A;  3DEU A;  4AWX B;  4G94 A;  3ELK A;  1XSV A;  3HSR A;  4YII A;  1ZLK A;  3ABT A;  5CYV A;  5FLX Z;  3RPU A;  3GX4 X;  2R7F A;  3RPQ A;  3DPT A;  2VN2 A;  5DCM B;  3J81 Z;  2BV6 A;  4XLP F;  3MWM A;  5HOO A;  3WU1 B;  1CF7 B;  3GFM A;  1W7P B;  4M9X A;  3KP4 A;  4EM2 A;  4I7H A;  1K6O A;  1OR7 A;  3F72 A;  3JSP A;  4KIC A;  4IRH A;  1PP7 U;  1UHM A;  3R4K A;  4ESB A;  1MDM B;  5FFZ A;  3ML6 A;  4N9I A;  4BHP A;  1P4W A;  4UVB A;  3U9G A;  4Y15 A;  2B0L A;  1MD0 A;  1S7O A;  1KU7 A;  4UVC A;  2FSW A;  4KIG A;  2RN7 A;  3V8J A;  1YS7 A;  2GAU A;  2C6Y A;  1QZZ A;  2KIF A;  4L9J A;  3LQQ A;  1SFE A;  4I0B A;  4L5I A;  1GXQ A;  4I0A A;  4NB5 A;  1USS A;  4Z2Y A;  5F64 A;  3QP6 A;  4DQ2 A;  2M1B A;  4PDK A;  3GEZ A;  5DUI A;  2ZFW A;  1TLH B;  1I27 A;  3J7A O;  1XGS A;  2O0Y A;  5DUK A;  2Y48 A;  1T0F A;  4BHB A;  3O2P E;  4WK8 F;  3ZMU A;  2IA0 A;  3P9K A;  1IXR C;  3CUO A;  3I54 A;  4PGH A;  3KP2 A;  1IRG A;  4B09 A;  1ULY A;  3VFZ A;  4EGY A;  1KU9 A;  2QQA A;  3ZN1 A;  4ENM A;  1GVJ A;  2EB7 A;  3I53 A;  3BZ6 A;  1G6N A;  2DK5 A;  1A04 A;  2OA4 A;  4G8X A;  2FML A;  2ACJ A;  2CO5 A;  3VB2 A;  5JFR A;  1H9T A;  5HS7 A;  2MH2 A; 
#chains in the Genus database with same CATH topology
 5FKL A;  3CTA A;  4C3J J;  4PFO A;  4HF1 A;  4A3B J;  3FBI B;  1RKW A;  1Z3Y A;  3FWE A;  2UUZ A;  4XMY A;  3CF5 F;  2VON A;  2M45 A;  3G1O A;  2BXZ A;  3MZY A;  2P5L C;  1WH7 A;  4RAZ A;  2DK8 A;  3K4B A;  3G71 I;  4Q47 A;  1EH8 A;  4LG0 A;  1VF9 A;  1P9Q C;  1OYW A;  1FP1 D;  2L4A A;  5L3G A;  1CQT A;  1QQI A;  2ZXI A;  4ZDO A;  1J9I A;  3COA C;  1A35 A;  3W2W A;  2MYS A;  1B9N A;  1JT6 A;  4HZF A;  1NHA A;  3ZMV A;  2FF4 A;  4ZZL A;  1O3Q A;  4FIS A;  1F36 A;  1XG1 A;  1LFU P;  4A3M J;  5IT9 K;  4EJT A;  3OOP A;  3GO5 A;  4OIN F;  1IO2 A;  3HKZ N;  4PFP A;  3BT9 A;  2VT2 A;  2UXX A;  2WB1 N;  2L02 A;  2XAJ A;  3ESW B;  1TWH J;  4IOC F;  2EIN H;  4A93 J;  2QVO A;  2H27 A;  2KT0 A;  3FXR A;  3S15 J;  2ZKZ A;  2LH9 A;  5JHU A;  2XAQ A;  5JHF A;  3RKW A;  4KA4 A;  4FE4 A;  1VQM I;  4F52 A;  4RLQ A;  3Q3S A;  1FTT A;  2BZT A;  3D5L A;  3I64 A;  4L9N A;  3TGN A;  3E5U A;  2HR3 A;  1X58 A;  3QOD A;  3U1K A;  1MGT A;  3SJM A;  3GTO J;  2JPB A;  1ZG1 A;  4D7N A;  5BS6 A;  3J80 Z;  3WGI A;  4DBQ A;  2DQR A;  2IS2 A;  1DDN A;  1OFC X;  2ESH A;  3GW2 A;  2RNJ A;  3HBL A;  2AO9 A;  2WV1 A;  2CU7 A;  3PNV A;  5H6R A;  1G3S A;  3WTZ A;  3RQ4 A;  1F5T A;  5KAF C;  5B3S H;  2DA7 A;  3F6V A;  4L0Z B;  3HKZ A;  3IAS 2;  1DP7 P;  1KGS A;  2ME0 A;  2WB1 A;  5FJ8 J;  1V5F A;  4M74 A;  2R3S A;  4I02 A;  3DKY A;  2GA2 A;  1JUM A;  2AQF A;  1TNT A;  3CD6 I;  2IP2 A;  4LMY A;  3VYS B;  3A02 A;  2BBY A;  4N4N B;  1BC8 C;  1J75 A;  2OTJ I;  2WC2 A;  1QPI A;  3KP5 A;  5K7H A;  5K5Q A;  2A61 A;  4LJZ F;  1IC8 A;  2ZJP F;  5HLI A;  1R4M B;  2L9S A;  4MHG A;  5LHI A;  2X6X A;  3W6J B;  1J5Y A;  4PCQ A;  5EYR A;  4B48 A;  1DU6 A;  3G2B A;  1R1T A;  1RUO A;  1H88 C;  2OQR A;  2M8E A;  3P5J A;  1H89 C;  2LF8 A;  3I59 B;  2N8G A;  4KUM A;  4XOT A;  5M5W J;  5E18 F;  4J00 A;  3PO3 J;  3QPH A;  2W1O A;  2E5Z A;  1B72 B;  2GXB A;  1FBS A;  3E6D A;  3JAM K;  3LSI A;  1VQK I;  2LG4 A;  2P8T A;  3EDP A;  1XPX A;  3CC4 I;  1HBX G;  2KIM A;  5J4V A;  1UG2 A;  3U1D A;  5D5V B;  1VFC A;  3HTU A;  3BR1 A;  1V5G A;  5FRM A;  1E3P A;  2VKV A;  2O5R A;  1XDS A;  3FXQ A;  2OZ6 A;  1K6Y A;  3BPX A;  3S2H J;  1OKR A;  2PX9 A;  2JUC A;  5CPR B;  3OIQ A;  1FOW A;  2IGK A;  3IKV A;  4L0Y B;  3OYM A;  1LDK B;  3C18 A;  3NWS A;  1OCO H;  1TZL A;  5LRS A;  3RDI A;  3KPH A;  1G3W A;  1OIS A;  1S29 A;  1FIP A;  2JRT A;  1PUF B;  5CVU A;  4CUG A;  4CYC A;  3PSI A;  1FLI A;  1ZGA A;  3M7G A;  1NK2 P;  4D5C A;  4BH9 A;  2F48 A;  3GXO A;  4J19 A;  2ZXW H;  4YFX F;  3TOB A;  1TBX A;  1B1B A;  4E7S A;  3BZC A;  3WTS C;  3J7Z I;  2W48 A;  3S1Q J;  1K78 B;  2JPC A;  2JUG A;  2P6S A;  3HJE A;  4XNF A;  1BI1 A;  4LG0 B;  1X1C A;  2M4K A;  2W00 A;  4HLY A;  1GDT A;  2STT A;  2HPI A;  3B73 A;  9ANT A;  3K70 C;  3SHF A;  1MNM C;  2FQ4 A;  4B8X A;  2Z99 A;  3FKI J;  4DYC A;  4AIH A;  1BI2 A;  3SFI A;  3HHG A;  3HOW J;  1YQA A;  1OCP A;  2A5W A;  3GLL A;  2ISZ A;  1BN5 A;  1ZAO A;  1MSE C;  3AFH A;  1OCC H;  3E97 A;  2DXI A;  3HHH A;  4FET A;  2K9Q A;  2XDV A;  4GCV A;  1SAN A;  3G1L A;  2DQL A;  2V6E A;  1H9G A;  1WJ5 A;  3SQN A;  4XIC A;  1HF0 A;  3OYE A;  3KYL A;  2PEX A;  4YFN F;  5F27 A;  4XN0 A;  1DQU A;  2K85 A;  1IGN A;  1TT0 A;  4MO7 A;  2DW4 A;  3WU0 A;  3IP4 B;  5J6X A;  5ERI A;  5E3N A;  3N4M A;  2VPL A;  4LLG F;  1K4T A;  2DPD A;  4E4H A;  4WWC A;  2HXI A;  2KJC A;  5DD4 A;  2JA6 J;  1BM9 A;  1TT5 B;  3OYH A;  4LK1 F;  3NAU A;  3L9F A;  2HDW A;  2NVQ J;  5IYD J;  1T98 A;  2FBI A;  5AIQ A;  3ZQH A;  2E7W A;  2V1U A;  3FXM A;  2YX4 A;  4HEA 2;  1R36 A;  3L2V A;  2K9N A;  4L5J A;  3U2R A;  1SVL A;  4CHU A;  3GTJ J;  4OU0 A;  1G4D A;  4O5V A;  2FUG 2;  1UJ8 A;  4L5E A;  1W36 C;  3T0Y A;  1SAU A;  3S3N A;  2HQ5 A;  2A6E F;  4XM3 A;  3ZGK A;  3F22 A;  4HG2 A;  2M7B A;  3W2V A;  4A3E J;  3HXL A;  4NHJ A;  3GFJ A;  4EJV A;  1S8N A;  2IPQ X;  3SZG A;  3BR0 A;  1SEU A;  5BOX A;  3OSG A;  2GOX B;  3OIP A;  1QZY A;  4A3C J;  3VOE A;  2QGU A;  3RCO A;  1OYY A;  4L18 B;  1ACI A;  5JLX A;  3DKW A;  3G3Z A;  4DYR A;  3SDB A;  1Y8Q B;  2XAG A;  5IT3 A;  1O4X A;  1DUX C;  2GOM A;  4NC7 A;  5H2F C;  2EJR A;  2FBK A;  2RV8 A;  3HRU A;  1ZR4 A;  5HOD A;  2NVX J;  1Z9C A;  2ID6 A;  3K4N A;  3REO A;  4B47 A;  5J4Y A;  2KDZ A;  1ON1 A;  1HLV A;  1KQ9 A;  2KRF A;  5F0H A;  4GFB A;  1ETV A;  2EWN A;  4EVI A;  2HQA A;  1KYZ A;  3KYC B;  5D6F A;  2Y30 A;  3ZN0 A;  3QP5 A;  3HOV J;  5M5X J;  2ISY A;  2LY2 A;  2HKO A;  5GTH C;  1IRF A;  5LD2 C;  3PUB A;  4OIQ F;  4CDG A;  5F0F A;  4ZH4 F;  3DBH B;  2K40 A;  1LB2 A;  1JKO C;  1QHG A;  2VE9 A;  1Y8R B;  3DWL E;  4HA8 A;  4D5F A;  3OYC A;  1YTY A;  4UB6 C;  3CCU I;  3KET A;  4XRS G;  2VLA A;  3H9G A;  5FKK A;  3WG7 H;  5LGU A;  3L2Q A;  1A5J A;  2EFQ A;  4D9J A;  3V8K A;  2E36 A;  4MQV A;  4OIR F;  1BW5 A;  1U5T C;  3KIO A;  3CP8 A;  3OWT A;  3VSL A;  5DV5 A;  1JHH A;  1ZHF A;  4IL6 C;  3HB9 A;  2DPU A;  2K5C A;  2QZ8 A;  4JK1 X;  5K5R A;  1VQN I;  2R5Z B;  2VI6 A;  3VSK A;  2CMP A;  4UV9 A;  4DNC A;  2FXA A;  2COB A;  2K4B A;  2W4S A;  4ETS A;  2X0L A;  1I1S A;  3M1E A;  3KP7 A;  4HF2 A;  5GP9 A;  4MFE A;  1QVT A;  5HDG A;  1TQM A;  2Y0S N;  4N9H A;  2NS7 A;  3AG2 H;  1ENH A;  4CA0 A;  3RTR A;  3F8B A;  4ASN A;  4DYQ A;  1VQP I;  1A31 A;  4E70 A;  1N77 A;  2I8D A;  3ZQG A;  1GHC A;  2PFB A;  1FOX A;  1V54 H;  4S04 A;  2E1M C;  1RNL A;  1TTY A;  2O3F A;  3ECH A;  1HW5 A;  5KVR A;  2P81 A;  4IHS A;  2R92 J;  4K2E A;  4Y4R A;  1XCV A;  1U5T B;  2IGN A;  2UV1 A;  3V4G A;  4EV0 A;  3LSM A;  4M72 A;  2YS9 A;  4CCN A;  4PZJ A;  3LA7 A;  1J09 A;  1I3A A;  2Q2E A;  3KP3 A;  2R5Y B;  2RRE A;  2BEO A;  2CQ7 A;  4BJ6 C;  3TED A;  2DA6 A;  3KE2 A;  2ELJ A;  1QGP A;  1XMX A;  5CVJ A;  3JW4 A;  4IHX A;  1YLF A;  1ZTR A;  1Z1D A;  5E20 A;  4M3E A;  1VQ9 I;  2Y0S A;  3VDX A;  4MEY F;  5F08 A;  4I6Z A;  2IVM A;  4WXC A;  3VWB A;  4BHC A;  2R7U A;  2FE3 A;  3BR2 A;  3SEQ A;  1BOA A;  2IJL A;  2G0E A;  1WH5 A;  2DMU A;  1FYL A;  2W25 A;  1ON2 A;  1V5E A;  2LY1 A;  3QPL A;  2QBY B;  4I2O A;  2XF6 A;  4DIQ A;  4BQN A;  4Z6Y A;  1IRZ A;  1P7J A;  1RC9 A;  3MD2 A;  3GTP J;  4GGG A;  4KNY A;  2PMH A;  4BQA A;  5IOY A;  3K2A A;  3EUK L;  3T1B A;  3FMQ A;  4RS8 A;  3ZXS A;  2MA3 A;  3BTI A;  4MGR A;  3N97 A;  3HDD A;  3R0A A;  4HNU A;  2VBY A;  1YIO A;  1P4X A;  4UV8 A;  5LRR A;  4ZZD A;  2NNY A;  4RB2 C;  1KU2 A;  2HVS A;  1BI0 A;  1JGG A;  1P92 A;  1T38 A;  3WTU C;  1WWX A;  5ILS A;  1FWZ A;  4XRM A;  4X1E A;  4RGR A;  5K7F A;  1X4P A;  1Y56 A;  1Y0U A;  1Z05 A;  2VL8 A;  4A5N A;  3UNG C;  1WPK A;  2CWE A;  4LOC A;  1OMI A;  1D1B A;  3O6B B;  2E1C A;  2QSF X;  2EFN A;  3LL7 A;  2WY7 Q;  2DU9 A;  1HOM A;  2G7U A;  5KAI C;  4ENJ A;  1FOK A;  2GXA A;  3H5A A;  1SFX A;  1XCB A;  1T56 A;  2F5D A;  4RGS A;  1RPW A;  5FKO A;  3H1C A;  2HYG D;  4YIF A;  4XOP A;  5DS9 A;  2WY8 Q;  1ZG3 A;  3E6M A;  2M0C A;  2LR8 A;  3F8F A;  3F8M A;  4UUT A;  3BG7 A;  4F92 B;  3FF5 A;  1E3O C;  1DP3 A;  2O61 A;  1G3T A;  3PIO F;  1KON A;  1K61 A;  2CUZ A;  2L9N A;  1TQI A;  4KN4 X;  1YIJ I;  1AKH B;  2YR2 A;  3QOE A;  5A2Q K;  3WTT C;  2IT0 A;  2LRD A;  2O03 A;  4A0X A;  2F6C A;  3K0L A;  1X4O A;  1A36 A;  5H20 A;  3JSO A;  4J01 A;  4PSW A;  2DMN A;  2Z3Y A;  2EFO A;  1BR4 A;  2LD5 A;  1FSH A;  1WRJ A;  5IP7 J;  3Q5F A;  2P7V B;  3BG9 A;  3K4K A;  2BHZ A;  3K7A J;  5E3M A;  3ZQI A;  5HVQ C;  1D1A A;  3IWF A;  4HSR A;  4B1R A;  1W0T A;  3LFK A;  4W1U A;  1YW8 A;  2GQQ A;  3HRT A;  2TCT A;  2X1E A;  1VQ8 I;  3E7L A;  2BW3 A;  3H9Q A;  3MQ0 A;  2X9D A;  1A6I A;  2DCE A;  3ZMS A;  2M4G A;  2RQP A;  3W3C A;  1WVR A;  4HDU A;  4IX7 A;  2PLY A;  3QU6 A;  1V3F A;  4NDL A;  3CDH A;  2E34 A;  4G7O F;  1T33 A;  2BE5 F;  5FLV A;  5D4R A;  3S93 A;  1S3J A;  4CYD A;  1YYV A;  2J5O A;  2IEK A;  3F8C A;  5E3L A;  1G3Y A;  2IBD A;  4QSH A;  5HDN A;  3C2B A;  4A3G J;  3C7J A;  3M8F A;  5FKN A;  3TBI A;  3I0T A;  2ADU A;  5D5X B;  5K7Z A;  4ZYD A;  2XF5 A;  3CCL I;  3DQV C;  1EKE A;  1FC3 A;  2JSP A;  2CGP A;  5GAH J;  2H6B A;  2V6C A;  1IV8 A;  1W7P D;  3TO7 A;  3OYI A;  4H0E A;  2EPF A;  2MLK A;  4LIV A;  4V2F A;  4LFU A;  3ABU A;  4AD9 A;  3CCE I;  2OCE A;  1LQ1 A;  1C0W A;  3MKY B;  5CQE A;  4DW6 A;  1O57 A;  1JUS A;  3S3O A;  2JMW A;  3JRB A;  3CP2 A;  4BE1 A;  1HCR A;  2CQN A;  3AG1 H;  2YSR A;  3DU6 A;  1AU7 A;  2XF7 A;  3BR6 A;  2OUM A;  1YRN B;  5EZH A;  2XAU A;  4RAF A;  5LHG A;  5IYC J;  2MFZ A;  2KIQ A;  2UXN A;  3FK6 A;  2HDC A;  1U3E M;  2V4J C;  3V7S A;  1T6S A;  1Z3X A;  3IHU A;  2DO7 A;  3DEW A;  1S9H A;  2B9S A;  2VOO A;  2ZME A;  4YEJ A;  1VQO I;  3FXK A;  1SFO J;  5CVR A;  3CO6 C;  2MC3 A;  3BCB A;  2MSY A;  4BYY A;  3L1P A;  2M9H A;  3S1M J;  5IOZ A;  2DJN A;  1LJ9 A;  2KL4 A;  4RGU A;  1BI3 A;  4QTR A;  3BTJ A;  3CDL A;  5KNL A;  2DT7 B;  2V1N A;  1GV5 A;  3H3U A;  4M6Y A;  2OTL I;  3F23 A;  4HRI A;  1BIB A;  4ZYG A;  5ILU A;  5ILV A;  1HDP A;  1OCT C;  2QQ8 A;  3M3Y J;  5FB2 A;  2WAF A;  3RIR A;  1W1W E;  3A4C A;  5HLG A;  1N78 A;  1OR7 C;  2EZH A;  3H36 A;  4KJZ A;  1RIO H;  2JVH A;  4HX8 A;  2QSG X;  4EAT A;  4YRV A;  2OV7 A;  1K79 A;  5FKM A;  2NVU B;  3ONQ A;  3JRD A;  2QLZ A;  1STZ A;  3DF8 A;  1R1V A;  4RB0 A;  3JRC A;  1MW7 A;  2Y2Z A;  1J0R A;  1ORK A;  5F1R A;  2WV0 A;  5C4X J;  2A68 F;  4KN7 X;  4B44 A;  4ZJZ A;  1FSE A;  2EV5 A;  2KRH A;  2XGE A;  3WTV C;  3Q0V A;  3LOC A;  5J47 A;  4ENK A;  1ZKG A;  4OMY A;  1JHF A;  2WAE A;  4EJO A;  1YJ9 I;  3FIW A;  1FBU A;  1VTN C;  1JTX A;  1W5T A;  5EEG A;  3KEQ A;  2LP0 A;  2DA4 A;  1U0J A;  3IAM 2;  2HQR A;  2DA2 A;  2L7K A;  2XC7 A;  4Y17 A;  2QQB A;  1MMG A;  2RDP A;  2A69 F;  3T5X A;  2VC0 A;  4IHV A;  3H35 A;  1VQ6 I;  3E5Q A;  2XV4 S;  4ON0 A;  4G12 A;  2QSH X;  3BC8 A;  2E19 A;  4ESF A;  4G9Y A;  2R7X A;  5TGT A;  1SFU A;  4V19 K;  1WI3 A;  3K4M A;  2JVG A;  1LKX A;  4PJM A;  3WGG A;  1UG0 A;  3I9V 2;  4P9U A;  4RMN A;  1U8R A;  1IDY A;  4HX4 A;  1OJL A;  3QOP A;  3WHC A;  3JTG A;  1JXS A;  2LY9 A;  1SAX A;  1FMV A;  4DZJ A;  4XON A;  3DV8 A;  4GYI A;  1R22 A;  2XRN A;  1T0F C;  4BXU A;  2XKO A;  1XGO A;  1UB9 A;  3DFG A;  2BY3 A;  3D1N I;  4MQ9 F;  3JTH A;  5TRD A;  2BW3 B;  3WE3 A;  1HXD A;  2P0W A;  1TW3 A;  2PJR A;  2E2I J;  1X1A A;  1E17 A;  1T39 A;  4ZC3 A;  3BY6 A;  1ZGW A;  2R7D A;  1IN4 A;  3EQL F;  1ZQ3 P;  1SMT A;  5LGT A;  2EBI A;  4BY1 J;  4IKF A;  4UNO A;  2X1C A;  3MZ8 A;  2XAH A;  2G7H A;  2ZJQ F;  2X6O A;  4RM2 A;  3L00 A;  4RAY A;  4QPO A;  4A12 A;  5CKT A;  1JJ8 C;  4Q48 A;  4FT8 A;  2CW8 A;  3ZP5 A;  3ZQL A;  1ZYR F;  3SXY A;  2KIU A;  1LE8 B;  1LEB A;  1AA7 A;  1LUJ B;  1VI0 A;  2F5F A;  1UFM A;  3FXJ A;  2V1D A;  5HS9 A;  4BUP A;  1X1B A;  2OBP A;  1FYM A;  2XGC A;  3PSF A;  4B3X A;  1DPR A;  1OYI A;  1DU0 A;  1IUY A;  3J7A Y;  2YX7 A;  3C2H A;  3OL3 A;  3ZCO A;  4PJN A;  1T2K A;  2R7S A;  2KLO A;  3ZMD A;  4N0B A;  3LSK A;  3F8N A;  3O8G A;  3UKG A;  3CME I;  3J7Y J;  2Z1D A;  1QVU A;  2FD5 A;  3S8P A;  1SVM A;  4GXO A;  4EEF G;  2H8R A;  3EUH A;  1YI2 I;  5LHH A;  2BVL A;  4NC8 A;  2ZXH A;  3LAP A;  4XN3 A;  3NAR A;  3TMO A;  2VOP A;  1S7A A;  1ZRE A;  2NVT J;  3HYI A;  5EG0 B;  3AKZ A;  4DGW B;  5JI6 A;  2NS0 A;  2XB5 A;  5FLX K;  3KEO A;  1U6G A;  3PO2 J;  2XUB A;  2EZI A;  4WXH A;  1EH6 A;  1F4K A;  2IGO A;  3WTW C;  4G6D A;  4A0Z A;  2A6H F;  5FGM A;  3J81 K;  2Z33 A;  1XGM A;  4GDF A;  4AVZ A;  4M3D A;  3JCU C;  4PJ0 C;  1HA8 A;  1IF1 A;  5FO5 A;  2LMD A;  4FX0 A;  2FRH A;  2WTE A;  3GZ5 A;  1KQ8 A;  2M5W A;  4NC6 A;  2K3P A;  5J8F A;  3OYJ A;  1L3L A;  4BGD A;  4W97 A;  1FPQ A;  5JVT A;  2L4M A;  3A03 A;  1WJB A;  3QRF F;  1VQ7 I;  4A5M A;  1MJ9 A;  1ZK8 A;  2BY1 A;  1V4R A;  3LAJ A;  3HRS A;  3TW6 A;  4M3F A;  4I76 A;  2K27 A;  1D0Z A;  3CUQ A;  3CLO A;  3FXL A;  5CJ9 A;  4A69 C;  2W84 A;  2ZBK A;  4AC0 A;  4F3Q A;  3IRQ A;  3HOX J;  3HTS B;  5F04 A;  2HZD A;  4CGZ A;  4A6E A;  1I5Z A;  2HQN A;  2V1X A;  1O7L A;  1HW1 A;  2XRO A;  3K69 A;  1S7E A;  4PJJ A;  1JT0 A;  3DPL C;  1R49 A;  3EYI A;  2R4G A;  4GO1 A;  2LKP A;  2R7Z J;  3BTL A;  2IW5 A;  3FXU A;  2DA1 A;  4JP0 A;  4BS9 A;  4WXD A;  2Y75 A;  1AWC A;  2PG4 A;  3CCM I;  2CUE A;  2JA2 A;  4E7Z A;  3HL2 A;  5M5Y J;  4G7H F;  4CCO A;  1PUE E;  2R7W A;  5B1A H;  1MND A;  2HS5 A;  2QM3 A;  2UZK A;  5BNG A;  3DP7 A;  5ICC A;  4UUS A;  3LSJ A;  4MTE A;  2CUJ A;  5F1J A;  2BY0 A;  5FFX A;  2TDX A;  2DDB A;  3FM5 A;  4LD5 A;  4E7H A;  1WJD A;  1R7J A;  4U88 A;  3D0S A;  3ZRG A;  1APL C;  4EMS A;  5LEJ A;  1Z6R A;  2XIG A;  3T8T A;  4BDY A;  1TWG J;  5D8L B;  2PJR B;  2GLO A;  4A3F J;  3I56 I;  3M8J A;  5E1X A;  1LVK A;  3M9A A;  3MMY B;  2CW0 F;  5EEH A;  3P9I A;  2KZG A;  6PAX A;  3ERE D;  1U9O A;  2XAS A;  2V79 A;  3KYD B;  1QHH D;  4F7Z A;  1VQL I;  2UWM A;  3IKT A;  2BYV E;  4EGZ A;  2HWV A;  1XX5 A;  1HKQ A;  1WJA A;  3HC7 A;  4XID A;  4KMF A;  3MFK A;  1Z7U A;  3CCS I;  1D5Y A;  4MTD A;  2NNN A;  4R79 A;  4ZDP A;  1G2H A;  1QU3 A;  4G6T B;  5IP6 A;  1FX7 A;  4YIR X;  1PP8 F;  3G4S I;  1LPQ A;  3DEE A;  2DYS H;  5LBQ A;  2QKL B;  2XAF A;  4JOM A;  4E7L A;  4PGG A;  2VT3 A;  2EV6 A;  1TWF J;  3CJT B;  2F5V A;  1R5I D;  2OC6 A;  1HC8 A;  1P4A A;  1R1U A;  5GTI C;  1YX3 A;  2DN0 A;  2CH0 A;  3A0H C;  4OMZ A;  1MMD A;  4R1H A;  4HDV A;  3BCA A;  3PQK A;  3V7C A;  2KP6 A;  2DDA A;  1Y1W J;  2OPT A;  1KZH A;  1QZE A;  5L3B A;  3CCR I;  1X3U A;  3PL8 A;  4C30 A;  3VPR A;  4E7I A;  3K9T A;  2MH9 A;  3M8E A;  5DM7 F;  3JRE A;  3D5S C;  2EV0 A;  4XSX F;  4AIJ A;  1JJ6 C;  2LBF A;  3BR5 A;  4JQF A;  3K70 D;  1K4S A;  3CF2 A;  2VC1 A;  5GAG J;  3QU3 A;  1D8J A;  2ELH A;  4XSZ F;  4IJA A;  1TWA J;  3A1Y A;  4U0W A;  2NVY J;  1YX5 A;  3GUD A;  2O8K A;  5EZG A;  1I3Q J;  1OQY A;  1W5S A;  2E60 A;  3RSN A;  2K9M A;  1U78 A;  1BR1 A;  2L0K A;  5C44 J;  2L5Q A;  4HW0 A;  4CYC B;  2EK5 A;  2PJP A;  4M71 A;  1O3R A;  3E6C C;  1XTA A;  5CLS A;  3LST A;  1CF7 A;  1W7P A;  2LOO A;  2Y0M A;  3RQI A;  3V7R A;  2R7V A;  4RA2 A;  5K5O A;  1Z67 A;  4OIO F;  2RAE A;  3KFW X;  5DCF A;  3F0C A;  1ETK A;  1YE9 A;  4R8H A;  2LDU A;  4ANJ A;  4RGX A;  3F21 A;  1GT0 C;  5GPC A;  3CCJ I;  1MDM A;  4ZYH A;  4MLO A;  3GME A;  1ETQ A;  3R6S A;  1X1P A;  2KQR A;  5ICE A;  2Z9O A;  3GYH X;  4XRS A;  2DFI A;  2O8X A;  4QPQ A;  1LEA A;  3V42 A;  4U0Y A;  5ED4 A;  1FZP B;  3OYF A;  3J80 K;  4GRI A;  1NG6 A;  3E1S A;  3MKW B;  2HTS A;  3K2Z A;  4JX4 A;  3WOD F;  1IN8 A;  1GUU A;  1PYV A;  2KPM A;  1MH4 A;  2HZT A;  1HSJ A;  1W36 D;  2QUF A;  1FEX A;  3L7W A;  3PFI A;  3BPV A;  2FQ3 A;  1RUN A;  2OQG A;  1K7A A;  2D2W A;  2R7O A;  2DTZ A;  3GVA A;  3LSG A;  1WJE A;  3HG9 A;  1MZB A;  3QPS A;  4G7Z F;  2FX0 A;  4ITV A;  1OCR H;  3FMR A;  2A5Y B;  2QEN A;  1XMK A;  3CC2 I;  2Y9Y A;  4A3K J;  1TP4 A;  3L2U A;  2MAB A;  1U9N A;  1UST A;  2JQ7 A;  1PJR A;  5IT9 Z;  1R23 A;  1I1G A;  2KRC A;  1Y1V J;  5M3F J;  1AOY A;  2E71 A;  3C3W A;  2KJB A;  2HVQ A;  3LSP A;  1TC3 C;  3JRF A;  1YS6 A;  2I5U A;  2JSC A;  3GBG A;  4UY8 I;  4BXX J;  2R7Q A;  4FCY A;  1G8X A;  1MBK A;  5EDN A;  2QQ9 A;  4B4C A;  4KFC A;  5M3M J;  1IXS B;  1HKS A;  2ZNY A;  3K1N A;  1JI8 A;  1R58 A;  4BXF A;  3GF2 A;  4HNT A;  3IUO A;  4C2M J;  1NH3 A;  4HYE A;  3T8R A;  3HIF A;  2ZSH B;  2VBW A;  1Y0N A;  2EFP A;  2NRA C;  3KZY A;  1FP2 A;  1ZN2 A;  2DAO A;  4CCJ A;  3IV5 A;  2GM4 A;  2VJ5 A;  2DA3 A;  3BRO A;  2L9V A;  2CV1 A;  4PK4 A;  4BJ5 C;  1NK3 P;  1KA8 A;  1PVE A;  1O3S A;  1CGP A;  4LIT A;  2ZCW A;  3KP6 A;  5E3O A;  4XLH A;  1JKP C;  4LIU A;  1W5C C;  2MG4 A;  3M1C A;  3S2W A;  4C2U A;  1WKM A;  3IRR A;  1IN6 A;  2HTJ A;  4CXF A;  1FT9 A;  1RKT A;  4U87 A;  1ODD A;  4BQQ A;  5E1W A;  3OV8 A;  5B66 C;  4IQ4 A;  2A07 F;  2VPR A;  4S0H B;  2VB6 A;  2BOL A;  5CVV A;  2HOE A;  2VJ4 A;  2ZSI B;  1SFK A;  2DOF A;  2FOK A;  3RJP A;  3GZ6 A;  1YIT I;  3EET A;  2ECB A;  4HV5 A;  2DOD A;  4CCL A;  3GCM A;  4MNU A;  2LBF B;  1VND A;  2QEX I;  1X2N A;  3H0D A;  3FZV A;  4B43 A;  1EA3 A;  3JAM Z;  2DMQ A;  2CQQ A;  1KU3 A;  4F93 B;  4X0G A;  5FD5 A;  3OYK A;  1HQC A;  2X4H A;  1OLT A;  2XRL A;  1D8K A;  3GZN B;  2ICW G;  3FM3 A;  2LKS A;  3CJN A;  1DPU A;  3VYT B;  1WGX A;  3B6C A;  3OS2 A;  1N75 A;  2NOG A;  4Y13 A;  5L3C A;  5DM6 F;  4XLA A;  1O7F A;  2CS3 A;  3MAJ A;  1JKQ C;  4KDP A;  4E7J A;  3KX2 A;  4L9V A;  2RGV A;  4A3D J;  3MKL A;  4XKV A;  2CG4 A;  5B5E C;  5HNH A;  3DBL B;  3H3Z A;  1WI9 A;  5L3F A;  4IHT A;  2LTP A;  3MCZ A;  2LLK A;  1S5L C;  1RR7 A;  2OCC H;  4BDZ A;  2LF7 A;  1BJA A;  3PNY A;  1O3T A;  4P9F A;  1K83 J;  3H0G J;  4OAY A;  3K1P A;  1IXC A;  4CZZ A;  2OF7 A;  4F91 B;  1BIA A;  3WTY C;  4NNJ A;  3KLN A;  4CO8 A;  4M9Z A;  1SD6 A;  1LDD A;  2XGX A;  2ECC A;  1IG7 A;  4BNC A;  3BQY A;  2CFO A;  3U21 A;  3I4N J;  2Y69 H;  3WTX C;  3LSR A;  2ZNZ A;  3RKY A;  5HLH A;  2F2E A;  1R00 A;  3BZK A;  3HOZ J;  1E3H A;  2DJI A;  1ERD A;  1D1C A;  5F6F A;  1RET A;  2O9L A;  1SD4 A;  2IAI A;  4HNV A;  1I50 J;  4HBL A;  2TRT A;  3JRI A;  2LYC A;  3CC7 I;  3QAH A;  3CES A;  5LGN A;  2E2H J;  2K7L A;  1MNE A;  2V9V A;  4AU7 A;  2EA4 A;  4IXA A;  2K02 A;  4LLN A;  2ZJR F;  5LEK A;  3GTQ J;  3P9C A;  2W24 A;  2ZO4 A;  3NQO A;  5KCM A;  3E5X A;  2YPR A;  2COM A;  2Q2E B;  5BPI A;  1J59 A;  4CSW A;  2X48 A;  4HQM A;  2D1V A;  2VBZ A;  2M7A A;  4YEL A;  2O7O A;  5TIS C;  1B59 A;  3HSF A;  4LLL A;  1MBJ A;  1TNS A;  1QBJ A;  4BBR J;  4JYK A;  4V2G A;  1N25 A;  1D3Y A;  1MBE A;  1REP C;  1UCR A;  4C9Y A;  2Y9Z A;  2ZFU A;  2PN6 A;  3CJR B;  1H0M A;  2ETH A;  3R60 A;  1P7I A;  2CW7 A;  1WHU A;  2LK2 A;  1XS9 A;  2I10 A;  2DT5 A;  2DBB A;  1BC7 C;  2HI3 A;  5DDG A;  1YFH A;  2O6G E;  3NRV A;  1B6A A;  3DBR B;  2RNG A;  1XGN A;  4WF2 A;  4BBS J;  2GIV A;  5J1R A;  1Z0X A;  3F6O A;  4BL0 B;  4IRI A;  1P2F A;  3BG6 A;  3VEP A;  1FOY A;  3H9J A;  2CQX A;  2K4J A;  4II2 A;  1YOV B;  4UHT A;  3ZQF A;  3BJ6 A;  3TO9 A;  5J40 A;  4C3I J;  5BPD A;  2ELK A;  1MJB A;  3RI4 A;  3I59 A;  2VIX A;  4C3H J;  1LFP A;  3G6E I;  3HUG A;  4OWR B;  4LK0 F;  1B72 A;  3S3M A;  2D1H A;  1POG A;  1HW2 A;  3M07 A;  4QIW N;  3CCQ I;  1Z21 A;  3IL2 A;  3DCF A;  3JRA A;  2HFH A;  4HST A;  3MKZ A;  3IC7 A;  1IAW A;  4GYG A;  2EQR A;  3TW7 A;  4XKW A;  2LNB A;  2GXG A;  2EZK A;  3O8H A;  2V7F A;  2P5K A;  5AON A;  3CCV I;  2KHM A;  2W82 A;  2XHK A;  3TL4 X;  2A6T A;  2IS1 A;  4U0V A;  4UXN A;  2VOD A;  1SD7 A;  2BXY A;  3W6K B;  2E7X A;  4FX4 A;  1TW2 A;  3QWL A;  2EFW A;  3RKX A;  1HKT A;  3Q9V A;  2W57 A;  5FD6 A;  1XSX A;  4KYW A;  4IHW A;  5DEQ A;  3KLO A;  2PBI A;  2HGC A;  3CMY A;  5GAE J;  3OMY A;  2J5P A;  3HPG A;  4HAM A;  1MKM A;  3TDZ C;  4IO9 F;  1PUF A;  3ASN H;  3DLA A;  1ETW A;  4EM1 A;  1MSF C;  5E8G A;  2DA5 A;  3TDU C;  2P5V A;  2MC4 A;  2HKX A;  2RQQ A;  4ZTJ A;  2D5V A;  3CCY A;  2CQK A;  2FOW A;  3A0B C;  2KDO A;  4M3B A;  3F3X A;  5GAD J;  4I98 B;  2L54 A;  1K78 A;  1IZ1 A;  5BMZ A;  3I4P A;  3DPU A;  5J1U A;  1MH3 A;  4HV6 A;  3A01 A;  3N05 A;  2CSO A;  4LB5 A;  3PQJ A;  4XBF A;  1MBF A;  4OAZ A;  3LA2 A;  1ITY A;  4U7B A;  4D7M A;  3TKY A;  2VJI A;  1LFB A;  2ZJ2 A;  2HOS A;  1TQP A;  5F0C A;  4Q4Z F;  4BE0 A;  1XB4 A;  5L3D A;  1FYK A;  1U2W A;  3ROU A;  2JA8 J;  3DTE A;  2L01 A;  1LNW A;  1H8A C;  2BY2 A;  2HU9 A;  3ABM H;  1T8I A;  4TV7 A;  1R6R A;  2H6C A;  5HS8 A;  1T08 B;  3ZQ7 A;  2LSO A;  2HXO A;  2Q8K A;  3RKQ A;  4WCG A;  2AXT C;  1XD7 A;  3GTM J;  4FE7 A;  3PUF A;  1FBQ A;  2ZME C;  1WJF A;  3HRM A;  3RPU D;  4HQE A;  1HDD C;  1GLN A;  4XLE A;  2Z5U A;  3VYR B;  4BQO A;  2KFD A;  2VXD A;  3VYU B;  2OJE D;  4CCM A;  1EV7 A;  2V26 A;  4EQQ A;  3K1M A;  3LWF A;  3F9K A;  2E35 A;  4IVN A;  1BOB A;  1UHW A;  2H1K A;  1UMQ A;  3AL0 C;  2VJJ A;  2JN6 A;  4D1Q A;  2NAZ A;  2MD0 A;  4QLC U;  2L3D A;  3WHB A;  5KK1 A;  3ASO H;  2X85 A;  4E6K G;  3OSF A;  4MFD A;  4BAY A;  1X19 A;  4LB6 B;  2IA2 A;  3SZP A;  1GVD A;  5CVI A;  4NUB A;  2VQL A;  3NWT A;  4A2U A;  5ICF A;  4NBQ A;  2JA7 J;  4IRG A;  4X6A J;  2M34 A;  3QYF A;  5DYM A;  5BQT A;  2L7Z A;  2KKO A;  2VAS A;  2QKM B;  2YU3 A;  2H8W A;  2L2O A;  2ZME B;  3TOA A;  1D0X A;  2VQC A;  3OYN A;  1YO5 C;  3DXJ F;  2FMY A;  3DU5 A;  3JR9 A;  1YW9 A;  3HOS A;  2K9S A;  5LLQ A;  3FMS A;  2STW A;  5EEA A;  2K86 A;  3H92 A;  3ISP A;  3E3V A;  4KMU X;  2HDD A;  2JK3 A;  1DGW Y;  1F9N A;  4RB3 C;  1F43 A;  2P6T A;  1ZGJ A;  2E5N A;  3FHN A;  3I5U A;  3IH3 A;  4HLX A;  1JE8 A;  1IV6 A;  4AM3 A;  1QO0 D;  3AL0 B;  3HUG B;  2QF7 A;  3HGG A;  2FEZ A;  3FIS A;  4O3M A;  2HPM A;  4EM0 B;  1Q1H A;  1IJW C;  2ZXJ A;  2NS8 A;  2V9P A;  4HPQ A;  4BU2 A;  2JRM A;  4CZC A;  3CO7 C;  2CV2 A;  2E1O A;  3ULQ B;  3DLL F;  3V8L A;  2EA2 A;  4P96 A;  4UUV A;  2F5E A;  3CMA I;  2M87 A;  2CFX A;  4IQJ A;  3FK7 A;  2IA1 A;  3TQN A;  2NXN B;  2RKH A;  4BAC A;  1T95 A;  1B9M A;  5B1B H;  2P7C B;  2DMT A;  4AYB N;  1IN7 A;  3HZJ A;  1UEL B;  1VQ5 I;  3HPH A;  1Y6I A;  3L2R A;  3OS1 A;  2HYJ A;  1X2M A;  2R7T A;  2NOJ B;  3QQA A;  2JTV A;  4AIK A;  3GTK J;  3BP8 A;  3G73 A;  4FAS D;  2R5Z A;  3B02 A;  5J1Y A;  4HOB A;  3L2C A;  3OS0 A;  3QYB A;  4D0P A;  1WZ2 A;  2PQ8 A;  4FHT A;  4PUS A;  1YW7 A;  2OD5 A;  3MZH A;  2H1L A;  1L0O C;  3ZPL A;  1BW6 A;  2QCO A;  2Z16 A;  3BDD A;  1SVO A;  2VXZ A;  2OAZ A;  2DOA A;  1ZRD A;  1ZLJ A;  2KIS A;  2OU2 A;  4RDU A;  4F55 A;  3A01 B;  1BBY A;  1J2X A;  2WWY A;  4ESJ A;  2VKH A;  4M73 A;  4A0Y A;  2DFF A;  3WU2 C;  2CYY A;  3FKJ A;  4I01 A;  3DKX A;  4LGW A;  4XRF A;  1A6Q A;  5A2Q Z;  2ZB9 A;  2ZC2 A;  3SEZ A;  4ZYA A;  1BR2 A;  3AG3 H;  1IW7 F;  4S05 A;  3JRG A;  2WAD A;  3CDI A;  5HNF A;  3BJO A;  1NTC A;  3HOY J;  3NEU A;  3SZT A;  1D0Y A;  5K1Y A;  1V55 H;  4AYB A;  4M6V A;  2EZL A;  1U5T A;  3CZ6 A;  5HDK A;  2QA4 I;  1BJZ A;  2HYF A;  4RB1 A;  3ZR8 X;  5D5W B;  2FU4 A;  2PMU A;  2R5Y A;  1QRY A;  2FNA A;  3EUH C;  5J8C A;  3OYB A;  2DFE A;  2H09 A;  2XPV A;  5D6E A;  2FNP A;  1I6H J;  4DJA A;  1JKR C;  3A2K A;  4P1W A;  3E6B A;  4P55 A;  1KQ0 A;  3GLX A;  4O6J A;  1MBG A;  3RYP A;  2RVC A;  3E0J B;  3PFY A;  4A6D A;  5H6Q A;  2G9W A;  2KZV A;  3GWZ A;  1E0E A;  5D8K B;  1XDU A;  1PDN C;  1QPM A;  3PNT A;  3TO6 A;  1EJ9 A;  3ERM A;  2E1N A;  1Z77 A;  3ZMT A;  2MGQ A;  2A3S A;  2AS5 F;  4QWQ A;  2QBY A;  2WA0 A;  1RZ4 A;  4ZYE A;  2M2E A;  3I58 A;  2DTR A;  2Y31 A;  2BHY A;  3PIP F;  1QA6 A;  2HEO A;  2K9L A;  4UVA A;  3WE2 A;  2R7R A;  2M0M A;  2GA1 A;  2EIM H;  1D5V A;  3I3L A;  2F4I A;  1TL8 A;  3MN2 A;  3BOQ A;  1YG2 A;  3M4O J;  1YJN I;  4KIT B;  2LFB A;  3FX3 A;  5C4J J;  5ICG A;  3AAF A;  1FJL A;  3GFL A;  5FRN A;  1ETX A;  3CUQ C;  4AVP A;  1S6L A;  2LRE A;  2AQE A;  4LG3 A;  3DTK A;  2YU9 J;  2IS6 A;  4XLN F;  4ENN A;  1FY7 A;  1I6X A;  2DOE A;  5EGO A;  5AIP A;  2EIL H;  2VKE A;  3TP3 A;  2MLG A;  3ABK H;  3Q9S A;  1HST A;  3BJA A;  1SD5 A;  1R9T J;  4JX5 A;  3MVP A;  4AID A;  3H3V K;  3ECO A;  1G59 A;  2IGM A;  1MIJ A;  3CMM A;  4KIB A;  4I99 C;  3SFZ A;  5JR3 A;  1RI7 A;  1MJA A;  1SC7 A;  4N4O B;  2JZY A;  1B4A A;  1WQ2 A;  2B63 J;  2MD5 A;  3GTG J;  2FBH A;  5C3E J;  2XKP A;  4HF0 A;  2PI0 A;  1MBH A;  3AG4 H;  3OOU A;  5DCM A;  4A3I J;  2GWR A;  2JT1 A;  1IRX A;  3S1N J;  3I55 I;  4KIS A;  3OYA A;  1U8B A;  1AKH A;  4OOI A;  1X1D A;  3L09 A;  4YFK F;  2W85 A;  1J7K A;  5L3E A;  3GFI A;  2DMP A;  1R5G A;  2CUF A;  5E79 C;  3MEX A;  1F1Z A;  3O3K A;  1IN5 A;  3CUQ B;  4G6Q A;  3BWG A;  1UAA A;  4Q5S F;  1DGR M;  2VKD A;  3IWZ A;  4PJL A;  3I71 A;  5J3L A;  3LFU A;  3PM1 A;  1E2X A;  3EUA A;  2BVM A;  5JVG F;  3ABL H;  1YJW I;  3BTC A;  3KZZ A;  1UZC A;  3K6G A;  4ZTF A;  3R61 A;  2XGD A;  3OR2 C;  1Q1V A;  2RC4 A;  2LKX A;  2BGC A;  2ESN A;  3LQR A;  2X1D A;  4EJU A;  1R71 A;  4ABZ A;  5TJJ A;  1LDJ A;  3ZMZ A;  3D5R C;  1MMA A;  3EYY A;  1EH7 A;  5FLM J;  1JUP A;  1JGS A;  4BKX A;  3C1D A;  3GTL J;  4P5O A;  1KYW A;  2VE8 A;  5D4S A;  2F5C A;  3VOD A;  1S72 I;  3LSH A;  4FTH A;  3FXO A;  2Z2S B;  3ZQQ A;  2W7N A;  2FA5 A;  5EF6 A;  2IRF G;  4IF4 A;  1BL0 A;  3R0J A;  2DFH A;  4UUS B;  3K10 A;  4RM3 A;  3SDG A;  1ZAR A;  3RYR A;  2B7E A;  2CJJ A;  3QPT A;  2R93 J;  4HX7 A;  4MEX F;  1ZH5 A;  2AXL A;  1QNT A;  2EIK H;  2Q0O A;  4CIC A;  2DLL A;  1FNN A;  4H4K C;  1GXP A;  3JRH A;  2WBM A;  2PMZ N;  1LVA A;  4U7D A;  2ME6 A;  2E2J J;  4YG2 F;  4C2T A;  1ZRF A;  1XN7 A;  5DD8 A;  1FMW A;  1Z91 A;  2VBX A;  4I09 A;  4KT5 C;  2H94 A;  4M9S A;  2QWW A;  5D5U B;  4WX9 A;  3EPZ A;  4M6X A;  1ONV A;  3IH4 A;  2IXS A;  2XSJ C;  1YRN A;  3ZQC A;  1ZG5 A;  1TWC J;  3RZO J;  2QYO A;  2XSD C;  3OY9 A;  5E1Z B;  4IOA F;  3KCC A;  1XMA A;  3LNQ A;  3FBN B;  2L7F P;  2NYX A;  5FRO A;  3KEY A;  2LVS A;  1P6R A;  1WCM J;  3WG9 A;  4BEH A;  3B6A A;  2P4W A;  3LA3 A;  1BA5 A;  1XC5 A;  3ZOB A;  2E1M B;  4B3A A;  2K3F A;  4E7K A;  4EJW A;  1YHQ I;  1WSU A;  4BY7 J;  1WFX A;  1XSD A;  2PMZ A;  4JBA A;  3DTI A;  4Y3O A;  4L9T A;  2WAQ N;  2MBF A;  5HLT A;  2CRG A;  3FHZ A;  4RAG A;  3S2D J;  3HOT A;  3C2G A;  1M1E B;  4DOZ A;  2M30 A;  3RZD J;  1Z6T A;  1B8I A;  3BQZ A;  1MMS A;  1SMY F;  1R5H A;  1OPC A;  2L7M P;  1ZRC A;  4XLF A;  3OIO A;  3WGH A;  2M3A A;  4IPA A;  5EGO B;  5E8I A;  1UHS A;  2D45 A;  2VUM J;  4Y7N J;  2XVC A;  1W4M A;  2OZU A;  3HSE A;  4KIF A;  2DI3 A;  4NQW A;  1Y39 A;  5E17 F;  3P7N A;  4OIP F;  2LC2 A;  2GZW A;  4MIM A;  3Q0U A;  3DEU A;  4AWX B;  3I4M J;  4G94 A;  3ELK A;  2VQH A;  1XSV A;  4Y52 J;  4DZP A;  2EIJ H;  2KMU A;  3OYG A;  3HSR A;  4YII A;  2XPU A;  2IS4 A;  2Q1Z B;  1ZLK A;  2HVR A;  3ABT A;  5CYV A;  5FLX Z;  2DYR H;  2L9R A;  5IY5 H;  3RPU A;  3H5N A;  2R7F A;  3RPQ A;  3GX4 X;  3DPT A;  1AHD P;  2VN2 A;  2WAQ A;  1W0U A;  1X3W B;  5IPA A;  5DCM B;  4PSX A;  3OYL A;  3J81 Z;  2BV6 A;  4XLP F;  3HGY A;  2JA5 J;  3MWM A;  4AUX A;  5HOO A;  3WU1 B;  1CF7 B;  2XPW A;  2HNH A;  3GFM A;  1W7P B;  2X51 A;  3X2Q H;  4M9X A;  3BLY A;  3KP4 A;  4EM2 A;  5JLW A;  2XB0 X;  4I7H A;  1K6O A;  3L2W A;  2R0Q C;  1OR7 A;  3F72 A;  3HM5 A;  3JSP A;  1GV2 A;  4RLF A;  3UR3 C;  4KIC A;  4IRH A;  1PP7 U;  4CCK A;  1UHM A;  3R4K A;  4ESB A;  4DBR A;  1MMN A;  3W2A A;  1MDM B;  2F4M B;  3H5R A;  2GBY A;  3PJR A;  2HOA A;  4ZDL A;  5FFZ A;  3OYD A;  2DT6 A;  3ML6 A;  4XK4 A;  4N9I A;  3S16 J;  4BHP A;  1P4W A;  4XR6 A;  3OR1 C;  4XQF A;  4UVB A;  3CLQ A;  3U9G A;  4Y15 A;  3S14 J;  2B0L A;  1MD0 A;  1S7O A;  3QYE A;  4KT6 A;  2MW8 A;  1KU7 A;  4UVC A;  2FSW A;  4KIG A;  4XL9 A;  2RN7 A;  2FJ1 A;  3V8J A;  3BG5 A;  1YS7 A;  1WJC A;  3G1M A;  2GAU A;  3S1R J;  2C6Y A;  1VQ4 I;  1QZZ A;  2KIF A;  3TP0 A;  4BJT A;  2M8G X;  3KZI C;  4L9J A;  2F4O B;  3LQQ A;  1SFE A;  1VZ0 A;  5LFA A;  4I0B A;  4FQG A;  4L5I A;  1GXQ A;  4I0A A;  2HOT A;  2A05 A;  4XKB A;  1RES A;  4NB5 A;  1USS A;  4Z2Y A;  5F64 A;  4RBO A;  1I39 A;  5KHD A;  3QP6 A;  4DQ2 A;  1ZR2 A;  2JJ7 A;  2M1B A;  5EJC A;  1LE8 A;  4PDK A;  3GEZ A;  3BG3 A;  5DUI A;  1RRJ A;  2ZFW A;  1RR8 C;  4IZZ A;  1TLH B;  1I27 A;  4XOR A;  3J7A O;  1EF4 A;  1XGS A;  2O0Y A;  1Z7L A;  3SYT A;  1FTZ A;  3CQZ J;  5DUK A;  2CV0 A;  2Y48 A;  1T0F A;  4UB8 C;  4A3J J;  2JWT A;  5IYB J;  4CH7 A;  3BR3 A;  4BHB A;  4A3L J;  4II3 A;  4Y33 A;  3O2P E;  4WK8 F;  1ETO A;  3ZMU A;  2IA0 A;  3P9K A;  5DTD A;  1FIA A;  1OCZ H;  2VQG A;  2X6W A;  3K4L A;  3IH2 A;  1IXR C;  4BE2 A;  3CUO A;  3I54 A;  2GIZ A;  3OL4 A;  5IP9 J;  4IHY A;  4PGH A;  4IEJ A;  3KP2 A;  3K4J A;  4XKC A;  3S17 J;  4BEH B;  1JTY A;  1IRG A;  1ETY A;  3LMM A;  3CJQ B;  4M3G A;  2EH3 A;  4B09 A;  4XLC A;  5EG0 A;  1ULY A;  2AHQ A;  3VFZ A;  4EGY A;  1KU9 A;  2QQA A;  3HOU J;  2X6Y A;  1X3Z B;  3ZN1 A;  4ENM A;  1GVJ A;  2ID3 A;  2EB7 A;  3FDY A;  1ZEL A;  3I53 A;  3BZ6 A;  1G6N A;  5CQG A;  1R4N B;  3Q0W A;  2DK5 A;  5GPA A;  1A04 A;  2OA4 A;  4G8X A;  3S32 A;  2FML A;  1B8I B;  3W6V A;  3HEF A;  2ACJ A;  2CO5 A;  2YUS A;  1NG7 A;  2V9K A;  3VB2 A;  5JFR A;  1H9T A;  4JX6 A;  5HS7 A;  4NQW B;  3K4C A;  1IDZ A;  2MH2 A;  1IUF A; 
#chains in the Genus database with same CATH homology
 3CTA A;  4HF1 A;  2VON A;  3FWE A;  2M45 A;  3MZY A;  2P5L C;  4RAZ A;  2DK8 A;  4Q47 A;  1EH8 A;  4LG0 A;  1OYW A;  1FP1 D;  2L4A A;  5L3G A;  1QQI A;  1J9I A;  3COA C;  1B9N A;  4HZF A;  1NHA A;  3ZMV A;  2FF4 A;  4ZZL A;  1O3Q A;  5IT9 K;  4EJT A;  3OOP A;  3GO5 A;  4OIN F;  2VT2 A;  2UXX A;  2L02 A;  2XAJ A;  2QVO A;  2H27 A;  3FXR A;  2ZKZ A;  5JHU A;  2XAQ A;  3RKW A;  4KA4 A;  3D5L A;  3I64 A;  4L9N A;  3TGN A;  3E5U A;  2HR3 A;  1MGT A;  2JPB A;  1ZG1 A;  5BS6 A;  3J80 Z;  3WGI A;  2DQR A;  1DDN A;  2ESH A;  3GW2 A;  2RNJ A;  5H6R A;  1G3S A;  3WTZ A;  1F5T A;  3F6V A;  4L0Z B;  1DP7 P;  1KGS A;  4M74 A;  2R3S A;  4I02 A;  2GA2 A;  1TNT A;  2IP2 A;  4LMY A;  2BBY A;  1BC8 C;  1J75 A;  2WC2 A;  3KP5 A;  5K5Q A;  2A61 A;  4LJZ F;  5HLI A;  4MHG A;  5LHI A;  3W6J B;  1J5Y A;  4PCQ A;  1R1T A;  1RUO A;  2OQR A;  2M8E A;  2LF8 A;  3I59 B;  4KUM A;  5E18 F;  3QPH A;  2GXB A;  1FBS A;  3E6D A;  3JAM K;  2P8T A;  3EDP A;  1HBX G;  2KIM A;  3U1D A;  5D5V B;  3HTU A;  1XDS A;  3FXQ A;  2OZ6 A;  3BPX A;  1OKR A;  3IKV A;  4L0Y B;  1LDK B;  3C18 A;  5LRS A;  3RDI A;  1G3W A;  1S29 A;  2JRT A;  5CVU A;  1FLI A;  1ZGA A;  3M7G A;  4BH9 A;  3GXO A;  4YFX F;  3TOB A;  1TBX A;  1B1B A;  3WTS C;  1K78 B;  2JPC A;  2P6S A;  4LG0 B;  1BI1 A;  4HLY A;  2STT A;  3B73 A;  3SHF A;  4B8X A;  2Z99 A;  4AIH A;  1BI2 A;  3HHG A;  1YQA A;  2ISZ A;  1BN5 A;  1ZAO A;  3E97 A;  3HHH A;  4GCV A;  2DQL A;  1H9G A;  3SQN A;  2PEX A;  4YFN F;  2DW4 A;  3WU0 A;  5J6X A;  5ERI A;  3N4M A;  4LLG F;  2DPD A;  4WWC A;  2KJC A;  5DD4 A;  1BM9 A;  4LK1 F;  3L9F A;  1T98 A;  2FBI A;  5AIQ A;  2E7W A;  2V1U A;  2YX4 A;  1R36 A;  4L5J A;  3U2R A;  4CHU A;  4OU0 A;  1G4D A;  4O5V A;  3T0Y A;  2A6E F;  3F22 A;  4NHJ A;  3GFJ A;  4EJV A;  1S8N A;  2IPQ X;  5BOX A;  1QZY A;  3VOE A;  1OYY A;  4L18 B;  3DKW A;  3G3Z A;  2XAG A;  5IT3 A;  1DUX C;  2EJR A;  2FBK A;  2RV8 A;  3HRU A;  1Z9C A;  3REO A;  1ON1 A;  1KQ9 A;  2KRF A;  2EWN A;  4EVI A;  1KYZ A;  5D6F A;  3ZN0 A;  3QP5 A;  2ISY A;  2HKO A;  1IRF A;  4OIQ F;  4CDG A;  4ZH4 F;  1LB2 A;  2VE9 A;  1YTY A;  4HA8 A;  3KET A;  5LGU A;  2EFQ A;  3V8K A;  4MQV A;  4OIR F;  1U5T C;  5DV5 A;  1JHH A;  1ZHF A;  2DPU A;  2QZ8 A;  4JK1 X;  5K5R A;  4DNC A;  4UV9 A;  2FXA A;  2K4B A;  4ETS A;  2X0L A;  1I1S A;  3M1E A;  3KP7 A;  4HF2 A;  5HDG A;  1TQM A;  4N9H A;  3RTR A;  3F8B A;  4ASN A;  4E70 A;  1GHC A;  2PFB A;  4S04 A;  1RNL A;  1TTY A;  2O3F A;  3ECH A;  1HW5 A;  5KVR A;  4IHS A;  4K2E A;  1XCV A;  1U5T B;  3V4G A;  4EV0 A;  4M72 A;  4PZJ A;  3LA7 A;  2Q2E A;  3KP3 A;  2BEO A;  3KE2 A;  1QGP A;  5CVJ A;  3JW4 A;  1YLF A;  1Z1D A;  5E20 A;  4MEY F;  2IVM A;  4WXC A;  4BHC A;  2FE3 A;  1BOA A;  2IJL A;  1FYL A;  2W25 A;  1ON2 A;  2QBY B;  4I2O A;  4GGG A;  4KNY A;  2PMH A;  4BQA A;  3T1B A;  3FMQ A;  4RS8 A;  2MA3 A;  4MGR A;  3N97 A;  3R0A A;  2VBY A;  1YIO A;  1P4X A;  4UV8 A;  2NNY A;  5LRR A;  4ZZD A;  4RB2 C;  1KU2 A;  1BI0 A;  1P92 A;  1T38 A;  3WTU C;  1WWX A;  5ILS A;  1FWZ A;  4RGR A;  1Y0U A;  1Z05 A;  4A5N A;  2CWE A;  1OMI A;  3O6B B;  2E1C A;  2EFN A;  2DU9 A;  2G7U A;  4ENJ A;  1FOK A;  1SFX A;  1XCB A;  4RGS A;  2F5D A;  2HYG D;  4YIF A;  1ZG3 A;  3E6M A;  3F8F A;  3F8M A;  3FF5 A;  2O61 A;  1G3T A;  1TQI A;  4KN4 X;  2YR2 A;  5A2Q K;  3WTT C;  2IT0 A;  2O03 A;  4A0X A;  3K0L A;  5H20 A;  3JSO A;  2Z3Y A;  2EFO A;  1FSH A;  1WRJ A;  3Q5F A;  2P7V B;  5HVQ C;  3IWF A;  3LFK A;  1YW8 A;  2GQQ A;  3HRT A;  3MQ0 A;  3ZMS A;  2RQP A;  4HDU A;  2PLY A;  3QU6 A;  1V3F A;  3CDH A;  4G7O F;  2BE5 F;  5D4R A;  1S3J A;  4CYD A;  1YYV A;  2J5O A;  3F8C A;  1G3Y A;  5HDN A;  3C7J A;  3M8F A;  3I0T A;  2ADU A;  5D5X B;  4ZYD A;  3DQV C;  1FC3 A;  2CGP A;  2H6B A;  2V6C A;  1W7P D;  3TO7 A;  4H0E A;  2MLK A;  4LFU A;  3ABU A;  4AD9 A;  1LQ1 A;  1C0W A;  1O57 A;  2YSR A;  5LHG A;  2UXN A;  2HDC A;  1U3E M;  3V7S A;  1T6S A;  3IHU A;  2DO7 A;  2VOO A;  2ZME A;  5CVR A;  3CO6 C;  2MC3 A;  4BYY A;  1LJ9 A;  4RGU A;  1BI3 A;  3H3U A;  4M6Y A;  3F23 A;  1BIB A;  4ZYG A;  5ILU A;  5ILV A;  5FB2 A;  3RIR A;  5HLG A;  1RIO H;  4HX8 A;  1K79 A;  2QLZ A;  1STZ A;  3DF8 A;  1R1V A;  4RB0 A;  1J0R A;  5F1R A;  2WV0 A;  2A68 F;  4KN7 X;  1FSE A;  2EV5 A;  3WTV C;  4ENK A;  4OMY A;  1JHF A;  4EJO A;  1FBU A;  1VTN C;  1W5T A;  5EEG A;  3KEQ A;  2HQR A;  4Y17 A;  2QQB A;  2RDP A;  3T5X A;  2A69 F;  2VC0 A;  3E5Q A;  2XV4 S;  4ON0 A;  4ESF A;  4G9Y A;  1SFU A;  3WGG A;  4P9U A;  1U8R A;  4HX4 A;  3QOP A;  1JXS A;  3JTG A;  1SAX A;  3DV8 A;  4GYI A;  1R22 A;  2XRN A;  4BXU A;  2XKO A;  1XGO A;  1UB9 A;  3DFG A;  4MQ9 F;  3JTH A;  5TRD A;  3WE3 A;  1HXD A;  1TW3 A;  1E17 A;  1T39 A;  3BY6 A;  2R7D A;  1IN4 A;  3EQL F;  1SMT A;  5LGT A;  4UNO A;  2XAH A;  2G7H A;  3L00 A;  4RAY A;  4A12 A;  4Q48 A;  4FT8 A;  3ZP5 A;  1ZYR F;  3SXY A;  2KIU A;  1LEB A;  2F5F A;  1UFM A;  2V1D A;  5HS9 A;  1FYM A;  2OBP A;  1DPR A;  1OYI A;  1IUY A;  2YX7 A;  1T2K A;  3ZMD A;  4N0B A;  3F8N A;  4GXO A;  3EUH A;  5LHH A;  3LAP A;  2VOP A;  1S7A A;  1ZRE A;  3HYI A;  5JI6 A;  2NS0 A;  5FLX K;  3KEO A;  1U6G A;  2XUB A;  4WXH A;  1EH6 A;  1F4K A;  3WTW C;  4G6D A;  4A0Z A;  2A6H F;  5FGM A;  3J81 K;  2Z33 A;  1XGM A;  1IF1 A;  5FO5 A;  4FX0 A;  2FRH A;  2WTE A;  3GZ5 A;  1KQ8 A;  2M5W A;  5J8F A;  1L3L A;  1FPQ A;  5JVT A;  2L4M A;  3QRF F;  4A5M A;  1MJ9 A;  1V4R A;  3LAJ A;  3HRS A;  2K27 A;  3CUQ A;  3CLO A;  5CJ9 A;  3IRQ A;  2W84 A;  2ZBK A;  3HTS B;  4CGZ A;  4A6E A;  1I5Z A;  2HQN A;  2V1X A;  1O7L A;  1HW1 A;  2XRO A;  3K69 A;  3DPL C;  3EYI A;  4GO1 A;  2LKP A;  3FXU A;  2IW5 A;  4WXD A;  2Y75 A;  1AWC A;  2PG4 A;  4G7H F;  1PUE E;  2HS5 A;  2QM3 A;  2UZK A;  5ICC A;  3DP7 A;  4MTE A;  5FFX A;  2TDX A;  3FM5 A;  4LD5 A;  1R7J A;  4U88 A;  3D0S A;  4EMS A;  5LEJ A;  1Z6R A;  2XIG A;  3T8T A;  5D8L B;  5E1X A;  3M9A A;  2CW0 F;  5EEH A;  3P9I A;  6PAX A;  3ERE D;  2XAS A;  2V79 A;  4F7Z A;  2UWM A;  3IKT A;  2BYV E;  4EGZ A;  2HWV A;  1HKQ A;  4KMF A;  3MFK A;  1Z7U A;  4MTD A;  2NNN A;  4R79 A;  1FX7 A;  1PP8 F;  5LBQ A;  2XAF A;  4PGG A;  2VT3 A;  2EV6 A;  1P4A A;  1R1U A;  4OMZ A;  4R1H A;  4HDV A;  3PQK A;  3V7C A;  5L3B A;  1X3U A;  3K9T A;  2MH9 A;  3M8E A;  2EV0 A;  4XSX F;  4AIJ A;  4JQF A;  2VC1 A;  3QU3 A;  1D8J A;  2ELH A;  4XSZ F;  4IJA A;  4U0W A;  3GUD A;  1W5S A;  1U78 A;  4HW0 A;  2EK5 A;  2PJP A;  4M71 A;  1O3R A;  3E6C C;  5CLS A;  3LST A;  1CF7 A;  1W7P A;  2Y0M A;  3V7R A;  5K5O A;  4OIO F;  3KFW X;  5DCF A;  4R8H A;  2LDU A;  4RGX A;  3F21 A;  1MDM A;  4ZYH A;  3R6S A;  5ICE A;  2Z9O A;  3GYH X;  2DFI A;  2O8X A;  1LEA A;  4U0Y A;  1FZP B;  5ED4 A;  3J80 K;  2HTS A;  3K2Z A;  3WOD F;  1IN8 A;  2HZT A;  1HSJ A;  2QUF A;  3L7W A;  3PFI A;  3BPV A;  2FQ3 A;  1RUN A;  2OQG A;  1K7A A;  2D2W A;  3GVA A;  1MZB A;  4G7Z F;  3FMR A;  2A5Y B;  2QEN A;  1XMK A;  1UST A;  5IT9 Z;  1R23 A;  1I1G A;  1AOY A;  3C3W A;  2KJB A;  1YS6 A;  2JSC A;  2QQ9 A;  4KFC A;  1HKS A;  1IXS B;  2ZNY A;  3K1N A;  1R58 A;  3GF2 A;  4HYE A;  3T8R A;  3HIF A;  2VBW A;  2EFP A;  2NRA C;  3KZY A;  1FP2 A;  1ZN2 A;  2DAO A;  3BRO A;  1KA8 A;  1O3S A;  1CGP A;  2ZCW A;  3KP6 A;  3S2W A;  1WKM A;  3IRR A;  1IN6 A;  2HTJ A;  4CXF A;  1FT9 A;  1ODD A;  5E1W A;  3OV8 A;  2A07 F;  5CVV A;  2HOE A;  2FOK A;  3RJP A;  3GZ6 A;  3EET A;  4HV5 A;  4MNU A;  3FZV A;  3JAM Z;  1KU3 A;  5FD5 A;  1HQC A;  2X4H A;  1D8K A;  3FM3 A;  3CJN A;  1DPU A;  5L3C A;  4Y13 A;  1O7F A;  3MAJ A;  4KDP A;  4L9V A;  2RGV A;  2CG4 A;  3H3Z A;  1WI9 A;  5L3F A;  4IHT A;  3MCZ A;  2LF7 A;  1BJA A;  1O3T A;  4P9F A;  3K1P A;  1IXC A;  4CZZ A;  1BIA A;  3WTY C;  3KLN A;  4CO8 A;  4M9Z A;  1SD6 A;  1LDD A;  2XGX A;  4BNC A;  3WTX C;  2ZNZ A;  3RKY A;  5HLH A;  2F2E A;  1R00 A;  5F6F A;  1SD4 A;  4HBL A;  3QAH A;  5LGN A;  2K7L A;  2V9V A;  2EA4 A;  4IXA A;  2K02 A;  4LLN A;  5LEK A;  3P9C A;  2W24 A;  2ZO4 A;  3NQO A;  3E5X A;  2YPR A;  2COM A;  5BPI A;  1J59 A;  4HQM A;  2D1V A;  2VBZ A;  1B59 A;  3HSF A;  4LLL A;  1TNS A;  1QBJ A;  1D3Y A;  1REP C;  1UCR A;  2PN6 A;  1H0M A;  2ETH A;  3R60 A;  2DT5 A;  2DBB A;  1BC7 C;  5DDG A;  2O6G E;  1YFH A;  3NRV A;  1B6A A;  1XGN A;  4WF2 A;  2GIV A;  3F6O A;  4IRI A;  1P2F A;  3VEP A;  2K4J A;  4UHT A;  3BJ6 A;  3TO9 A;  5BPD A;  1MJB A;  3RI4 A;  3I59 A;  3HUG A;  4LK0 F;  1HW2 A;  2D1H A;  3IL2 A;  2HFH A;  1IAW A;  3IC7 A;  4GYG A;  2LNB A;  2GXG A;  2P5K A;  5AON A;  2XHK A;  4U0V A;  4UXN A;  2VOD A;  1SD7 A;  3W6K B;  2E7X A;  4FX4 A;  1TW2 A;  2EFW A;  3RKX A;  1HKT A;  3Q9V A;  2W57 A;  5FD6 A;  1XSX A;  4KYW A;  5DEQ A;  3KLO A;  2PBI A;  2HGC A;  2J5P A;  4HAM A;  1MKM A;  3TDZ C;  4EM1 A;  5E8G A;  3TDU C;  2P5V A;  2HKX A;  2CQK A;  3F3X A;  4I98 B;  2L54 A;  1K78 A;  1IZ1 A;  5BMZ A;  3I4P A;  4HV6 A;  2CSO A;  4LB5 A;  3PQJ A;  4XBF A;  3LA2 A;  4U7B A;  3TKY A;  2ZJ2 A;  1TQP A;  4Q4Z F;  1XB4 A;  5L3D A;  1FYK A;  1U2W A;  3ROU A;  2L01 A;  1LNW A;  4TV7 A;  5HS8 A;  2H6C A;  3ZQ7 A;  2LSO A;  2Q8K A;  4WCG A;  1XD7 A;  1FBQ A;  3HRM A;  4HQE A;  2Z5U A;  1EV7 A;  4EQQ A;  3K1M A;  3LWF A;  4IVN A;  1UHW A;  2NAZ A;  4QLC U;  2L3D A;  5KK1 A;  4BAY A;  4LB6 B;  2IA2 A;  3SZP A;  5CVI A;  4A2U A;  5ICF A;  4IRG A;  5DYM A;  5BQT A;  2KKO A;  2YU3 A;  2ZME B;  3TOA A;  1YO5 C;  3DXJ F;  2FMY A;  1YW9 A;  3HOS A;  5LLQ A;  3FMS A;  2STW A;  2K86 A;  3H92 A;  3ISP A;  3E3V A;  4KMU X;  1F9N A;  4RB3 C;  2P6T A;  1ZGJ A;  3I5U A;  4HLX A;  1JE8 A;  1QO0 D;  2FEZ A;  4O3M A;  4EM0 B;  1Q1H A;  2ZXJ A;  3CO7 C;  3ULQ B;  3V8L A;  2EA2 A;  4P96 A;  4UUV A;  2F5E A;  2M87 A;  2CFX A;  2IA1 A;  3TQN A;  2RKH A;  1B9M A;  2P7C B;  1IN7 A;  2JTV A;  4AIK A;  3BP8 A;  3G73 A;  3B02 A;  4HOB A;  3L2C A;  4D0P A;  2PQ8 A;  4FHT A;  3MZH A;  1YW7 A;  2OD5 A;  1L0O C;  3ZPL A;  3BDD A;  2VXZ A;  2OAZ A;  1ZRD A;  1ZLJ A;  2OU2 A;  1BBY A;  1J2X A;  2WWY A;  4ESJ A;  4M73 A;  4A0Y A;  2CYY A;  4I01 A;  4LGW A;  4XRF A;  5A2Q Z;  1IW7 F;  4S05 A;  3BJO A;  3NEU A;  3SZT A;  5K1Y A;  1U5T A;  5HDK A;  2HYF A;  4RB1 A;  5D5W B;  2FU4 A;  2PMU A;  2FNA A;  5J8C A;  2H09 A;  5D6E A;  2FNP A;  3E6B A;  4P55 A;  1KQ0 A;  3GLX A;  4O6J A;  3RYP A;  2RVC A;  4A6D A;  5H6Q A;  2G9W A;  3GWZ A;  5D8K B;  1XDU A;  1PDN C;  1QPM A;  3TO6 A;  2E1N A;  3ZMT A;  2A3S A;  2AS5 F;  4QWQ A;  2QBY A;  1RZ4 A;  4ZYE A;  3I58 A;  2DTR A;  2HEO A;  4UVA A;  3WE2 A;  2GA1 A;  1D5V A;  3BOQ A;  1YG2 A;  3FX3 A;  5ICG A;  3AAF A;  3GFL A;  3CUQ C;  4AVP A;  1S6L A;  4XLN F;  4ENN A;  1FY7 A;  1I6X A;  5AIP A;  2MLG A;  3Q9S A;  1HST A;  3BJA A;  1SD5 A;  3ECO A;  4KIB A;  5JR3 A;  3SFZ A;  1RI7 A;  1MJA A;  2JZY A;  1B4A A;  1WQ2 A;  2MD5 A;  2FBH A;  2XKP A;  4HF0 A;  2PI0 A;  5DCM A;  2GWR A;  2JT1 A;  4OOI A;  3L09 A;  4YFK F;  2W85 A;  1J7K A;  5L3E A;  3GFI A;  1R5G A;  3MEX A;  1F1Z A;  3O3K A;  1IN5 A;  3CUQ B;  4G6Q A;  3BWG A;  4Q5S F;  3IWZ A;  3I71 A;  1E2X A;  3KZZ A;  3R61 A;  2RC4 A;  2BGC A;  2ESN A;  3LQR A;  4EJU A;  5TJJ A;  1LDJ A;  3ZMZ A;  3EYY A;  1EH7 A;  1JGS A;  3C1D A;  4P5O A;  1KYW A;  2VE8 A;  5D4S A;  2F5C A;  3VOD A;  2FA5 A;  2IRF G;  4IF4 A;  3R0J A;  1ZAR A;  3RYR A;  3QPT A;  4HX7 A;  4MEX F;  1ZH5 A;  2AXL A;  1QNT A;  2Q0O A;  1GXP A;  4CIC A;  2DLL A;  1FNN A;  1LVA A;  4U7D A;  4YG2 F;  1ZRF A;  1XN7 A;  5DD8 A;  4I09 A;  1Z91 A;  2VBX A;  4KT5 C;  2H94 A;  4M9S A;  2QWW A;  5D5U B;  4WX9 A;  4M6X A;  1ONV A;  1ZG5 A;  2QYO A;  5E1Z B;  3KCC A;  1XMA A;  2NYX A;  1P6R A;  3WG9 A;  3LA3 A;  2P4W A;  1WSU A;  4EJW A;  1XSD A;  4JBA A;  4L9T A;  2MBF A;  3FHZ A;  3HOT A;  2M30 A;  1Z6T A;  1SMY F;  1R5H A;  1OPC A;  1ZRC A;  3WGH A;  4IPA A;  5E8I A;  2D45 A;  2XVC A;  1W4M A;  2OZU A;  3HSE A;  4KIF A;  2DI3 A;  4NQW A;  5E17 F;  3P7N A;  4OIP F;  2GZW A;  3DEU A;  4AWX B;  4G94 A;  3ELK A;  1XSV A;  3HSR A;  4YII A;  1ZLK A;  3ABT A;  5CYV A;  5FLX Z;  3RPU A;  3GX4 X;  2R7F A;  3RPQ A;  3DPT A;  2VN2 A;  5DCM B;  3J81 Z;  2BV6 A;  4XLP F;  3MWM A;  5HOO A;  3WU1 B;  1CF7 B;  3GFM A;  1W7P B;  4M9X A;  3KP4 A;  4EM2 A;  4I7H A;  1K6O A;  1OR7 A;  3F72 A;  3JSP A;  4KIC A;  4IRH A;  1PP7 U;  1UHM A;  3R4K A;  4ESB A;  1MDM B;  5FFZ A;  3ML6 A;  4N9I A;  4BHP A;  1P4W A;  4UVB A;  3U9G A;  4Y15 A;  2B0L A;  1MD0 A;  1S7O A;  1KU7 A;  4UVC A;  2FSW A;  4KIG A;  2RN7 A;  3V8J A;  1YS7 A;  2GAU A;  2C6Y A;  1QZZ A;  2KIF A;  4L9J A;  3LQQ A;  1SFE A;  4I0B A;  4L5I A;  1GXQ A;  4I0A A;  4NB5 A;  1USS A;  4Z2Y A;  5F64 A;  3QP6 A;  4DQ2 A;  2M1B A;  4PDK A;  3GEZ A;  5DUI A;  2ZFW A;  1TLH B;  1I27 A;  3J7A O;  1XGS A;  2O0Y A;  5DUK A;  2Y48 A;  1T0F A;  4BHB A;  3O2P E;  4WK8 F;  3ZMU A;  2IA0 A;  3P9K A;  1IXR C;  3CUO A;  3I54 A;  4PGH A;  3KP2 A;  1IRG A;  4B09 A;  1ULY A;  3VFZ A;  4EGY A;  1KU9 A;  2QQA A;  3ZN1 A;  4ENM A;  1GVJ A;  2EB7 A;  3I53 A;  3BZ6 A;  1G6N A;  2DK5 A;  1A04 A;  2OA4 A;  4G8X A;  2FML A;  2ACJ A;  2CO5 A;  3VB2 A;  5JFR A;  1H9T A;  5HS7 A;  2MH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...