5HLHA

Crystal structure of the overoxidized abfr bound to dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
134
Chain Sequence
QEQMRLANQLFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCYDETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*AP*AP*CP*TP*CP*AP*AP*TP*CP*GP*CP*GP*CP*GP*CP*G
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
molecule tags Transcription regulator/dna
total genus 40
structure length 134
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hlhA00
2R7FA 1B9MA 2GA1A 5CVJA 1LQ1A 1AOYA 2ISYA 2ZO4A 1O7LA 2Q2EA 1HKTA 1A04A 1O3QA 1J7KA 1XSDA 2XV4S 1Z05A 2JSCA 4QLCU 4NQWA 3I71A 1MDMB 5K5OA 3H3ZA 1FNNA 1LB2A 2EB7A 3CO6C 5ILVA 1JGSA 4M6YA 4HA8A 3WTUC 4PGGA 1BC8C 2DK5A 4L9TA 3GO5A 2FNPA 1Z91A 3GEZA 1ZLKA 1P6RA 5E1ZB 1U6GA 3V8LA 3JW4A 1IN6A 3FMRA 5JFRA 4IF4A 1STZA 1K79A 1FX7A 4HYEA 5E8GA 2W57A 5JHUA 4U0WA 5LHHA 3KP2A 3J80K 5ICGA 4D0PA 1TTYA 3NEUA 4RS8A 3NRVA 2QENA 2DT5A 1XGNA 2B0LA 1RUNA 4YG2F 2E7XA 3DPTA 1FWZA 3HYIA 2NYXA 1XGMA 3IL2A 1LNWA 2Z33A 1FSEA 1FSHA 3M8EA 2MBFA 2RGVA 4KUMA 3GX4X 5H20A 3E6MA 3H92A 2A07F 2DFIA 2XAGA 3WG9A 1V3FA 2NS0A 4HF1A 3E6CC 4KMFA 4RGXA 1SD4A 1TNTA 2VOOA 5L3GA 6PAXA 2CQKA 1GXQA 3BOQA 1R22A 1HW2A 4KIBA 1IAWA 5DDGA 4A12A 5F64A 1HW1A 3FF5A 2A6EF 3WE2A 2XIGA 2M30A 1BIBA 3KP4A 2QVOA 1FYKA 3U2RA 3CDHA 1FLIA 3M9AA 5L3FA 1L3LA 1KU7A 1XDSA 1ZAOA 2BGCA 1UB9A 3COAC 4KA4A 3LA2A 4KDPA 3FMSA 3C18A 3TDZC 3GFLA 4B09A 5JVTA 3KETA 1U8RA 4M6XA 2W25A 1CF7B 2A3SA 2FMLA 1R7JA 2VOPA 2J5PA 4RB2C 4P9UA 3BDDA 3H3UA 2XAQA 3C3WA 2A6HF 3DV8A 3L09A 4OIRF 5D6FA 1YG2A 3O3KA 3K2ZA 2VC0A 4UNOA 5A2QK 5DCMB 3N97A 4ZZLA 2P4WA 2QWWA 4CDGA 2D45A 4LMYA 4G8XA 4F7ZA 5EEGA 1IW7F 2CW0F 1RUOA 2FMYA 3FZVA 2VONA 2O0YA 4M73A 3RIRA 2PJPA 5DV5A 2CO5A 4I01A 4H0EA 5HDKA 3M8FA 2EA4A 1HW5A 1IXRC 3WU1B 1EH6A 3N4MA 3BWGA 2GQQA 1P92A 5HDNA 5CLSA 4YFXF 4Y15A 1V4RA 3G3ZA 2IA2A 2QM3A 3VOEA 1UHMA 2PFBA 4G7OF 3TKYA 3U1DA 3F8CA 4ESBA 2RC4A 2HOEA 4RAYA 4R79A 3FM3A 5ILSA 1SD6A 3REOA 4CZZA 4G94A 3BPXA 1Z9CA 2ADUA 5LBQA 4LB6B 2EFWA 3F21A 4XLPF 4A2UA 5CJ9A 1SAXA 1QZZA 2MC3A 3RYRA 1DDNA 3DQVC 3T8TA 5FB2A 5D8LB 5CYVA 3EYYA 1HQCA 2QLZA 4ENMA 1ZARA 1PUEE 3HTSB 4PGHA 3RJPA 5HLIA 5DUIA 2J5OA 4CHUA 4EJUA 1W7PD 2P6TA 2FOKA 4PCQA 2P5KA 4LGWA 3K1NA 1D8KA 1ZLJA 1U78A 3WGIA 4UVCA 1FBSA 1SFEA 4HQEA 5D5VB 4N9HA 1KQ8A 4HOBA 3MWMA 3IKVA 3J81K 1T2KA 1ZREA 4WWCA 3TO6A 3GFMA 5LHIA 1YW7A 2CGPA 1OYWA 4IJAA 2O3FA 1LVAA 1BM9A 1ZYRF 4UHTA 4EVIA 5IT9K 2XUBA 1S8NA 2M8EA 3DKWA 5F1RA 3RKXA 1YFHA 1P4AA 1S3JA 3V8JA 2GIVA 1FBQA 2P7CB 2HQNA 4G9YA 1ZRCA 3JAMK 1KU2A 1QBJA 1T0FA 4CXFA 1P4XA 3E5QA 4ETSA 4Z2YA 4A5NA 4UV9A 1D8JA 2ZMEA 2NNYA 1BOAA 1TQMA 3K1PA 2CSOA 5K5RA 2QYOA 1WKMA 4CGZA 4L5IA 3ABUA 2G7UA 2LSOA 3TDUC 1RIOH 3D0SA 3HRTA 3DF8A 3I59A 3SZTA 3GUDA 5L3BA 2Z3YA 4Q47A 1O3RA 3WTSC 5HVQC 3QOPA 2W85A 4ASNA 3ECHA 5BMZA 2VBYA 1MZBA 2KIMA 3QPTA 2K02A 1NHAA 3P9CA 2IA1A 1QQIA 1ULYA 3S2WA 4WX9A 4FX4A 2FE3A 4HLYA 3O6BB 2A61A 4B8XA 3KFWX 4CYDA 3M7GA 3VFZA 2FEZA 2MD5A 3R0AA 1ZH5A 3HSRA 5DEQA 2F5FA 3GVAA 2Z5UA 5FD5A 1IN4A 4IRHA 2TDXA 5CVRA 2VE9A 3KE2A 1PP8F 3R61A 4IPAA 4G6QA 2VT3A 2DLLA 1KYZA 2QZ8A 3HTUA 5FGMA 2R3SA 3WTZA 3KP3A 3B73A 2L02A 2GA2A 1KYWA 1Z1DA 3L7WA 4AVPA 3FWEA 3K9TA 4QWQA 1BN5A 3JTGA 3K1MA 4FHTA 4P5OA 4K2EA 1K78A 1H9GA 1ODDA 1R5GA 5HOOA 4DNCA 3ERED 5JI6A 4MEYF 2K4BA 3ABTA 2VBZA 2OU2A 1BI1A 5EEHA 2PBIA 2A5YB 1QGPA 5HS7A 1E2XA 1I5ZA 3SFZA 1LEAA 4HLXA 1R1UA 2HGCA 3TQNA 3FHZA 4A5MA 1U2WA 5D5UB 1AWCA 3P7NA 3BPVA 2GZWA 1GVJA 2Y0MA 3I53A 3T1BA 2XRNA 4ZYEA 4JBAA 4M71A 3M1EA 4AWXB 4OMYA 2PEXA 4R1HA 2K27A 2O6GE 4MHGA 2VODA 5FD6A 4KN7X 4M9ZA 3F8BA 1XN7A 2H09A 4I2OA 1SD7A 3V7SA 2W24A 1G3SA 4XSXF 5ICCA 2HFHA 4I98B 4YFNF 2EK5A 3F8NA 1J5YA 1T39A 5D5WB 3GWZA 1TNSA 1BBYA 3QAHA 3FX3A 1ON1A 1QO0D 1TQIA 5F6FA 4OMZA 3OOPA 4U0YA 4PDKA 4HF0A 2Z9OA 5ILUA 2WC2A 5E8IA 2Q0OA 1BJAA 1OKRA 3BROA 5H6QA 1FP2A 1G6NA 3MEXA 1SFUA 2P7VB 3R6SA 2XKPA 4KNYA 2EJRA 4MTDA 4KT5C 2H6BA 1XGOA 1ZG1A 1OYIA 1T6SA 2UWMA 5CVVA 2EV6A 2BYVE 2OA4A 2GXGA 5L3EA 2ISZA 1F1ZA 3L2CA 3HHGA 3QU6A 2PLYA 2HTJA 3LAJA 1YO5C 3ZMTA 1X3UA 1DP7P 4LD5A 1Z6RA 1EH7A 3KZYA 4TV7A 3IRQA 4R8HA 2VBXA 2JRTA 3R4KA 3HUGA 3ISPA 2KRFA 3QRFF 2OQRA 2O03A 4EM2A 3P9IA 1KQ0A 3F6OA 1I6XA 2UXXA 1R36A 1R1VA 2ZNYA 4BHBA 1O7FA 2X4HA 1SMTA 2V6CA 5FFZA 1I1GA 3LAPA 3TO7A 2V1DA 3E97A 3VODA 1QPMA 3R0JA 4ZYHA 3K69A 2AS5F 4GCVA 4KN4X 1JXSA 1IRFA 2JPCA 1XSXA 4O6JA 1G3TA 4HF2A 4JK1X 2OD5A 3PQJA 2ZMEB 4MGRA 4L0ZB 2CG4A 2DK8A 3W6JB 3ML6A 3F22A 3WTWC 5BS6A 1JHHA 2GAUA 2L4AA 2ZKZA 3I4PA 3KLNA 3DP7A 2H27A 2VC1A 3RPQA 1O3TA 1YLFA 2QQ9A 3T0YA 3I59B 3TGNA 2DI3A 4AD9A 3J7AO 1OMIA 3DPLC 4AIKA 4HW0A 2QBYA 3F23A 2PQ8A 4Y17A 3E5UA 1U3EM 2XAHA 3BZ6A 3HSEA 2MLGA 3VEPA 3PQKA 3Q5FA 3E6DA 3WODF 2RN7A 3IWZA 1ZG3A 3GXOA 2RVCA 1DPUA 5CVUA 1ZRDA 4G7HF 3ZMZA 3GLXA 1MGTA 5FLXZ 3CO7C 2OBPA 2VT2A 3I64A 3K0LA 3SXYA 2IPQX 1R23A 1FY7A 5FO5A 2L3DA 1XB4A 2HKOA 3L00A 4CICA 3SQNA 3HSFA 3CTAA 1RZ4A 2Z99A 4XRFA 2UXNA 5DD8A 3KZZA 4IXAA 2KJCA 5AIPA 3Q9VA 1U5TC 2D1VA 1J75A 2P6SA 4ZZDA 5E1WA 3GFJA 1K78B 1Z6TA 1WSUA 2FA5A 2MA3A 1FYMA 4MNUA 2PI0A 3QP6A 1G3WA 4E70A 2FF4A 1BI0A 3EUHA 1Z7UA 3CLOA 2P5VA 5ICEA 1L0OC 4UV8A 2D1HA 2RDPA 3KP7A 2YPRA 4ESJA 2A68F 4Y13A 3FM5A 1U5TA 4LFUA 4U7DA 2M1BA 4PZJA 4GXOA 4I0BA 1XSVA 2KIFA 2F5CA 4I02A 1ZGJA 4Q5SF 2RKHA 2IP2A 3DFGA 4EMSA 1FT9A 2VXZA 3QP5A 2HTSA 4IHSA 2VBWA 5TJJA 1WQ2A 3JSOA 5E17F 3CUQC 5HDGA 1R58A 1FOKA 2COMA 2A69F 2ZBKA 2ESHA 2UZKA 5BPIA 2ZFWA 3LWFA 4YIFA 2BEOA 3V4GA 1XMKA 3HOTA 2XGXA 2DQLA 1BI2A 3ZP5A 5LHGA 3RPUA 2QUFA 3F6VA 1J59A 1FC3A 3ECOA 2CYYA 2V79A 2FU4A 4EJVA 1TLHB 4HX7A 1F5TA 4BH9A 3ZN0A 5J8FA 1YQAA 2OAZA 3AAFA 3CJNA 1IXCA 3LFKA 2NRAC 4JQFA 3V8KA 1YIOA 3T5XA 1UFMA 4A0ZA 4LLLA 5E1XA 1S6LA 3LA3A 2KKOA 3CUQA 1ZN2A 1MD0A 3EDPA 3KLOA 4OIQF 4DQ2A 2E1NA 3PFIA 2HYFA 5BQTA 1C0WA 3J80Z 1Y0UA 2HYGD 2KIUA 1QZYA 5D5XB 1B59A 4RB0A 5D4RA 4FT8A 5AONA 3BJAA 2K7LA 1KU9A 2XAFA 3BY6A 2PMUA 3KEQA 1H9TA 2F2EA 2M45A 1K6OA 1IZ1A 1JE8A 5BOXA 4MQVA 4ENJA 5K5QA 1SFXA 2Y75A 3CUOA 3E6BA 4BHPA 2O8XA 1FYLA 1W7PB 3ELKA 3F8MA 3ZMUA 1T98A 4KIGA 2YR2A 5LRSA 2ACJA 4OINF 3ZN1A 2RNJA 1HXDA 2M87A 3ZPLA 4IHTA 4HX8A 3WTXC 1EH8A 4XSZF 2EFOA 4CO8A 5DD4A 3HIFA 2EWNA 2V1XA 4GYIA 4WCGA 2L4MA 5FFXA 4HAMA 3KEOA 2DPUA 3EQLF 1LDKB 1BC7C 1OPCA 3C7JA 2ZCWA 1MJAA 4XBFA 3I0TA 1FZPB 3FXQA 5D8KB 5HS8A 1HKQA 2DBBA 4RAZA 4EM1A 2AXLA 5J6XA 2HEOA 2HKXA 2V9VA 4ZYDA 5A2QZ 4WK8F 1IXSB 4EM0B 4P55A 4UXNA 2MLKA 5D6EA 2QBYB 3ZQ7A 4AIJA 2JPBA 2BBYA 1FP1D 3HOSA 2FRHA 4WXDA 2PG4A 2E1CA 1LDDA 4HZFA 2GXBA 2IT0A 2ZJ2A 4ZH4F 1H0MA 1IRGA 1MJBA 3T8RA 3F72A 5LLQA 4N9IA 4GO1A 4MQ9F 1K7AA 3IWFA 3GW2A 3SZPA 5TRDA 3I5UA 1CGPA 2X0LA 2KJBA 3WE3A 4LG0A 2DU9A 1PP7U 3JSPA 3ULQB 1HBXG 2JTVA 4IVNA 4NHJA 1IUYA 2DO7A 3ZMDA 4NB5A 5AIQA 1E17A 4AIHA 2JZYA 4BQAA 3WU0A 1RI7A 4A0YA 2RQPA 2O61A 3O2PE 4N0BA 2DTRA 3GF2A 4UUVA 4RGSA 1BI3A 2VN2A 3NQOA 1GXPA 3KP6A 2H94A 5CVIA 5ICFA 4MTEA 1XDUA 2BV6A 5K1YA 1W7PA 3FMQA 4EQQA 1YW8A 3ZMSA 2LKPA 1LJ9A 3TO9A 2EV5A 1KGSA 4IRIA 4LLGF 1HKSA 3QPHA 1O57A 2EFNA 1P2FA 2ZNZA 1USTA 2OQGA 3ZMVA 1B6AA 1FPQA 3V7RA 4EJOA 1R00A 4L18B 1IN5A 2EFQA 1XCBA 4P96A 2MH9A 4M9XA 4HV6A 1J0RA 3TOAA 1GHCA 4KYWA 3J81Z 1MDMA 4Q48A 5JR3A 2Q8KA 2OZUA 5DCFA 4HV5A 2YSRA 2M5WA 2XHKA 3JTHA 3RDIA 1U5TB 1G4DA 1ZRFA 3F3XA 1LDJA 2D2WA 1S29A 2STTA 5IT9Z 5ED4A 1EV7A 4A0XA 1TQPA 2LF8A 4HQMA 3EETA 3LA7A 4RB3C 2F5EA 3WTTC 4ENNA 3EYIA 4L9VA 3ROUA 2EA2A 3JAMZ 1I27A 4EV0A 2FBKA 2P8TA 1S7AA 2FNAA 4M74A 5DUKA 1HSJA 4YIIA 2FSWA 2XVCA 3D5LA 4MEXF 4O5VA 1W5SA 1R1TA 2PMHA 3C1DA 5LEKA 4YFKF 2XROA 2STWA 2FQ3A 1D3YA 2IRFG 2DPDA 3MAJA 1F9NA 3G73A 2G9WA 1IF1A 5DYMA 4BHCA 4S04A 3BJOA 1YS7A 2ZXJA 2JT1A 1MJ9A 2Y48A 4A6DA 4L0YB 1XD7A 4OU0A 4LK0F 5LGTA 2FBHA 3U9GA 4Q4ZF 4RGUA 1ZG5A 4M72A 4S05A 2IW5A 3GZ6A 3VB2A 1ZHFA 4WF2A 2EV0A 1B9NA 5L3DA 3CUQB 4LK1F 3RI4A 5LGNA 4L9NA 4WXHA 4BNCA 1UHWA 4KFCA 1W4MA 5HS9A 3I54A 3IC7A 3Q9SA 2W84A 5E18F 4ENKA 3WGGA 3HHHA 1FBUA 4BXUA 2YX4A 3LSTA 2P5LC 4LJZF 1B1BA 3GYHX 3P9KA 1YS6A 2ELHA 4UVBA 3B02A 4ESFA 3IRRA 4G6DA 1TBXA 3GFIA 4OOIA 2CWEA 4EJWA 5HLHA 5KK1A 3IHUA 2L54A 1ZGAA 5IT3A 3HRSA 2XAJA 4A6EA 1OYYA 2GWRA 2CFXA 1DPRA 2NNNA 2HZTA 1PDNC 1CF7A 5BPDA 1G3YA 4M9SA 1YW9A 4WXCA 5L3CA 2FBIA 1P4WA 1RNLA 2ESNA 4OIOF 2ETHA 2K86A 2V1UA 4ON0A 1ONVA 1O3SA 2IA0A 3MZYA 1YYVA 3FXUA 4IRGA 3MFKA 3WTVC 4GGGA 1TW3A 5DCMA 1BIAA 4U7BA 1I1SA 4HDUA 3KP5A 3MQ0A 4HDVA 2QQAA 2WWYA 3WTYC 5HLGA 4LLNA 2QQBA 3FXRA 1T38A 5H6RA 2E7WA 4UVAA 5J8CA 4RB1A 4BYYA 2EFPA 1D5VA 5ERIA 1B4AA 3HRMA 4G7ZF 1J2XA 4GYGA 3LQQA 3RYPA 2HS5A 3RKWA 1YTYA 5LRRA 2BE5F 2G7HA 2PN6A 1LEBA 2HQRA 2IVMA 2LDUA 3W6KB 3WGHA 2WTEA 4O3MA 4EGYA 2RV8A 1WI9A 3DXJF 2L01A 3QU3A 1F4KA 3R60A 5FLXK 3I58A 2FXAA 1SD5A 2NAZA 4L5JA 4I09A 2IJLA 1ON2A 3IKTA 3BJ6A 2HWVA 1VTNC 1WWXA 4HBLA 3SHFA 3RTRA 3OV8A 4LB5A 3E5XA 1R5HA 4ZYGA 3GZ5A 1HSTA 5KVRA 1XCVA 4FX0A 4L9JA 1KQ9A 2XKOA 1KA8A 5LEJA 4LG0B 1QNTA 3HRUA 1S7OA 4OIPF 2K4JA 4P9FA 1MKMA 1IN8A 2YU3A 4U88A 4RGRA 1JHFA 1IN7A 2MH2A 4U0VA 1TW2A 2DAOA 3MZHA 2XASA 1DUXC 1W5TA 1KU3A 1SMYF 2LNBA 1XMAA 2F5DA 2HR3A 2DQRA 4KICA 1Q1HA 2YX7A 5LGUA 3MCZA 3V7CA 4I7HA 2R7DA 2OZ6A 2HDCA 5E20A 3RKYA 2VE8A 3L9FA 3DEUA 2DW4A 4EJTA 4HX4A 1UCRA 1XGSA 4I0AA 1J9IA 3KCCA 2C6YA 2LF7A 5D4SA 4KIFA 2WV0A 1REPC 3BP8A 4KMUX 2H6CA 4BAYA 3TOBA 3F8FA 1USSA 1WRJA 4XLNF 3LQRA 3E3VA 4EGZA 1OR7A
chains in the Genus database with same CATH superfamily
2R7FA 1SVMA 1B9MA 2GA1A 5DS9A 2IGOA 5CVJA 1V5FA 4XLAA 1LQ1A 1AOYA 3A03A 4LIVA 2ISYA 1BR4A 2EIMH 1A6IA 3CCRI 1AHDP 2ZO4A 3IH2A 5F0HA 2HDDA 1O7LA 2Q2EA 1MW7A 1HKTA 3LFUA 1A04A 2R7XA 1O3QA 1J7KA 1XSDA 1BOBA 2XV4S 1Z05A 4V19K 2JSCA 4QLCU 4NQWA 3I71A 1MDMB 5M5YJ 3K4LA 5TISC 2O9LA 5K5OA 1QPIA 2Y9YA 3H3ZA 1FNNA 3I3LA 1LB2A 2DOAA 2EB7A 3CO6C 5ILVA 5FKKA 1V5GA 4CCNA 1JGSA 4M6YA 2PMZA 4HA8A 3WTUC 4PGGA 2KRHA 1BC8C 3S15J 2DK5A 3G1LA 4L9TA 3GO5A 3SDBA 2DA2A 2FNPA 2CQQA 1BW5A 2IAIA 4W1UA 1FMVA 1Z91A 3GEZA 1ZLKA 1P6RA 5E1ZB 3S14J 3K7AJ 1U6GA 1OCZH 2F5VA 3SFIA 1QZEA 3BR1A 1IN6A 3JW4A 3FMRA 3V8LA 4CYCB 3HOXJ 5JFRA 4IF4A 3ABKH 3BTLA 2MG4A 1STZA 2HQAA 1JTXA 1TP4A 2JJ7A 1QHHD 1K79A 1FX7A 4HYEA 3VDXA 5E8GA 5KNLA 4PFOA 2W57A 2X6OA 2X9DA 5JHUA 4RBOA 4U0WA 2BHYA 1KONA 2F4OB 3E1SA 2V9PA 5LHHA 3KP2A 3J80K 5ICGA 3BR3A 4D0PA 4E6KG 4BKXA 1TTYA 3NEUA 4RS8A 1A31A 3IAS2 3NRVA 2QENA 2DT5A 4HRIA 1XGNA 1YIJI 2B0LA 1RUNA 4UB8C 5C4JJ 4YG2F 1I6HJ 3ZRGA 1U9NA 1OCCH 5J4YA 3S8PA 2E7XA 2ZB9A 3DPTA 1SFOJ 2W4SA 1FWZA 3HYIA 2NYXA 3VYSB 1XGMA 3IL2A 1LNWA 2K5CA 2NVXJ 2VQHA 2LY9A 2Z33A 1XS9A 1VQNI 2O5RA 1FSEA 1LVKA 1FSHA 3M8EA 4FETA 1D1BA 2MBFA 2RGVA 4FE7A 4C30A 4KUMA 3GX4X 2W82A 3LMMA 2R5YA 5IOYA 5H20A 3E6MA 3H92A 4IZZA 2A07F 4RLQA 5DTDA 2DFIA 2XAGA 3I56I 3WG9A 1V3FA 2NS0A 4HF1A 3E6CC 4KMFA 3S1QJ 2VL8A 4RGXA 2MD0A 1U9OA 5H2FC 1SD4A 2E71A 3HL2A 1Z7LA 2JUCA 1TNTA 2VOOA 5L3GA 6PAXA 2CQKA 1GXQA 3BOQA 3A2KA 2NOJB 1R22A 1HW2A 3PUFA 4KIBA 3WHCA 1HCRA 1IAWA 5DDGA 4A12A 5F64A 4XM3A 2EQRA 2R7ZJ 1HW1A 3CCVI 3HPGA 3W2VA 3FF5A 1MH4A 4YRVA 2A6EF 3WE2A 4ZTFA 2XIGA 2M30A 1BIBA 3D5SC 3KP4A 2CV1A 2QVOA 3BTJA 3K4JA 1FYKA 2XPUA 3U2RA 1ZK8A 3CDHA 1FLIA 4LG3A 2M3AA 3M8JA 4A3DJ 4UY8I 2XGDA 1POGA 1A35A 3M9AA 5L3FA 1L3LA 3MD2A 1RRJA 1KU7A 3LSJA 3I9V2 1XDSA 1ZAOA 2KDZA 1ZGWA 2BGCA 2I8DA 1UB9A 3COAC 2MYSA 2Z2SB 4KA4A 3DBRB 4AVZA 3LA2A 4KDPA 3FMSA 3C18A 3TDZC 2LFBA 3GFLA 2HYJA 4B09A 5JVTA 3I4NJ 3KETA 1U8RA 4A3CJ 4I76A 3S32A 1TL8A 3DCFA 2W25A 1I3QJ 4M6XA 1CF7B 1IO2A 2A3SA 2LG4A 2FMLA 1MBHA 3H9GA 1R7JA 2VOPA 2Y0SA 2IS1A 3L2VA 2J5PA 1LFBA 1QRYA 4L5EA 4RB2C 2CUFA 5E3MA 3CC7I 2WBMA 2M7AA 2BY1A 3OYKA 4P9UA 2OCEA 3HOUJ 3BDDA 3H3UA 1Z0XA 2XAQA 1T95A 3C3WA 3MMYB 4B44A 2A6HF 1D5YA 1P9QC 3DV8A 3L09A 2AO9A 2DMUA 4OIRF 2X85A 3JRGA 1VQMI 5D6FA 1YG2A 3O3KA 3K2ZA 2D5VA 3WG7H 3S1RJ 2VC0A 3VPRA 1A36A 4UNOA 5A2QK 3DTEA 5DCMB 3S1MJ 3N97A 4ZZLA 3OYHA 3QYEA 3ASNH 2P4WA 2QWWA 5B1BH 2XDVA 4CDGA 4LMYA 2D45A 3AL0C 4G8XA 4GDFA 4F7ZA 2VQLA 3BLYA 3QPSA 3OSGA 5EEGA 1IW7F 3ZOBA 3TP0A 2CW0F 1RUOA 2FMYA 2X48A 4B48A 3FZVA 2ELJA 2VONA 2HPMA 2DOFA 2O0YA 1APLC 4M73A 3RIRA 1K61A 2PJPA 2WB1A 2OUMA 5DV5A 2A05A 4CYCA 2CO5A 1TT0A 4RLFA 4I01A 1TWGJ 4PK4A 4H0EA 3S3OA 5HDKA 3M8FA 2EA4A 3S1NJ 2K3FA 2M4KA 1IXRC 1HW5A 4IO9F 5EG0B 4PJ0C 1R4MB 3WU1B 4IHVA 1EH6A 5F0CA 3BWGA 3N4MA 1RKTA 2GQQA 4DW6A 2V26A 2PJRA 2ZJRF 3C2HA 1A6QA 1P92A 1ZKGA 4M3FA 3ZQQA 4E7SA 1PUFB 3HDDA 2L9NA 5HDNA 1ETVA 5CLSA 4YFXF 2W7NA 4Y15A 1V4RA 1VQ8I 3G3ZA 2IA2A 1R6RA 1X4PA 1H8AC 1FIAA 1JUMA 2QM3A 3WHBA 3VOEA 1UHMA 1N77A 3DBHB 4DJAA 5M3FJ 2PFBA 4BXFA 1GVDA 4G7OF 1N78A 3TKYA 3U1DA 3A4CA 1FOWA 2XGEA 3F8CA 2W48A 2RC4A 4ESBA 1N25A 4E7KA 1VQKI 2HOEA 3NAUA 4RAYA 4R79A 3FM3A 5ILSA 1VQPI 4XOPA 1SD6A 3REOA 4CZZA 2LYCA 1BW6A 2CRGA 3KYCB 3PNTA 4G94A 3BPXA 1SVLA 5CQGA 4DBQA 5EGOB 4J01A 3TW7A 2JUGA 3QODA 2ADUA 5LBQA 1Z9CA 4LB6B 1VQ4I 4J19A 1IGNA 2IS4A 2QSFX 3EPZA 1Y1VJ 3J7AY 3SJMA 2XGCA 2EFWA 3F21A 4XLPF 4QPQA 4A2UA 1SVOA 3ZQLA 3K70C 5CJ9A 1SAXA 1QZZA 4HEA2 1E0EA 2VJIA 2H1KA 2LREA 3VYRB 4I99C 4BJTA 2MC3A 3JRAA 4PUSA 3RYRA 1X2MA 3S2DJ 1H88C 3DQVC 1DDNA 3T8TA 5FB2A 5D8LB 5CYVA 3OYJA 3EYYA 3VSLA 2KPMA 1HQCA 2OJED 2QLZA 4DGWB 4ENMA 3MVPA 1ZARA 1PUEE 3HTSB 4PGHA 3RJPA 5HLIA 4Y7NJ 5DUIA 4PSXA 2J5OA 4CHUA 4EJUA 1W7PD 3F0CA 2P6TA 2FOKA 4PCQA 2P5KA 4LGWA 3C2GA 3K1NA 3FXMA 3UKGA 1D8KA 1ZLJA 3CCLI 1LFPA 1U78A 2B63J 3WGIA 4UVCA 4XR6A 1FBSA 1SFEA 3EUHC 4XL9A 4HQEA 2B9SA 5D5VB 1R4NB 1T0FC 4IX7A 4N9HA 4B1RA 4FQGA 2XF7A 1KQ8A 2NS8A 4HOBA 3MWMA 4E7IA 2E5ZA 3IKVA 2MC4A 2WAQA 3J81K 1I3AA 3D5RC 4D5CA 1T2KA 1ZREA 4WWCA 1V54H 3TO6A 2ZMEC 3GFMA 5LHIA 1YW7A 2JQ7A 2RREA 2CGPA 1OYWA 1MBKA 2ME0A 1ETQA 4IJAA 3BG9A 2JMWA 3K2AA 2RNGA 2ZFUA 1XG1A 2O3FA 2DA7A 1LVAA 1BM9A 1WJ5A 1ZYRF 2DA6A 4UHTA 5GAGJ 4EVIA 2DCEA 2XC7A 5IT9K 2XUBA 1S8NA 2M8EA 2ME6A 3DKWA 1DGWY 5F1RA 3B6AA 1Y6IA 3BZKA 3RKXA 1YFHA 1HF0A 1P4AA 1S3JA 5IYBJ 2JWTA 4FASD 1GDTA 2GIVA 4JX5A 3V8JA 2XF6A 1FBQA 1X1BA 2XB0X 2P7CB 2HQNA 1HA8A 4G9YA 4DYRA 1ZRCA 2E2IJ 3JAMK 3KEYA 1KU2A 2R5ZB 4LOCA 1QBJA 5CPRB 4F55A 1WH7A 1T0FA 3D1NI 1ORKA 4CXFA 1JKOC 1LE8A 1Z3YA 1P4XA 1IDYA 2LD5A 3E5QA 4ETSA 5HNHA 2Q2EB 3K4MA 2EINH 4Z2YA 2VKDA 4A5NA 4UV9A 1IJWC 1D8JA 2ZMEA 1X2NA 2NNYA 1ENHA 1N75A 1BOAA 2JRMA 4RDUA 1TQMA 5E79C 2G0EA 3CJTB 2CSOA 3K1PA 2QYOA 5GTIC 1WKMA 5K5RA 1JKPC 1OCTC 1NH3A 4L5IA 4CGZA 1TT5B 3ABUA 2G7UA 4BQOA 5EG0A 3PUBA 2LSOA 2Y31A 3TDUC 4CCOA 2CS3A 1X1AA 1RIOH 2M4GA 3D0SA 3HRTA 2GOXB 3DF8A 3I59A 3SZTA 3GUDA 4ZDLA 5L3BA 3SEZA 2NXNB 2Z3YA 4Q47A 2VIXA 1O3RA 3WTSC 4E7ZA 2K9QA 5HVQC 3QOPA 1JJ6C 2W85A 4ASNA 3ECHA 1S7EA 5BMZA 5CKTA 1PVEA 5EEAA 2VBYA 2Z16A 1MZBA 1BR1A 2KIMA 3BTCA 3QPTA 2K02A 1NHAA 1DGRM 3P9CA 4UUSA 1VQ9I 2IA1A 1QQIA 1ULYA 3LOCA 3G6EI 3S2WA 2K40A 1IG7A 1HLVA 4V2FA 4WX9A 5IYCJ 2F6CA 2DA5A 4U87A 1VI0A 4FX4A 4HSRA 2FE3A 4HLYA 3O6BB 2A61A 4B8XA 4BQQA 3KFWX 2CW7A 4CYDA 2JN6A 3M7GA 2MW8A 3VFZA 2FEZA 2R7OA 2MD5A 2E2HJ 2KMUA 3R0AA 1ZH5A 4H4KC 1VNDA 3HSRA 5DEQA 2F5FA 3GVAA 2Z5UA 1R49A 3A0BC 3GCMA 5FD5A 2BY3A 1IN4A 4CUGA 4NDLA 4IRHA 2R5YB 2TDXA 5CVRA 5KCMA 2VE9A 3KE2A 1PP8F 1OFCX 3R61A 3S3MA 4IPAA 4KT6A 1WZ2A 3HKZN 4G6QA 3ABMH 1NTCA 3OYLA 2IBDA 4XIDA 3CCEI 2VT3A 2DLLA 2R7QA 3H9QA 3OS1A 1KYZA 2QZ8A 3HTUA 1VQOI 5IP7J 2L9SA 2LP0A 5FGMA 1YE9A 5GAHJ 2R3SA 3WTZA 3HB9A 3TEDA 3KP3A 3B73A 4BY7J 2R7RA 2L02A 2EZHA 2GA2A 2VKVA 1KYWA 3FK7A 3S93A 1Z1DA 5EJCA 3L7WA 2XPVA 3MKWB 2NVQJ 4AVPA 3FWEA 3ZCOA 3K9TA 4XKVA 2P81A 4CA0A 3K4KA 2CUEA 3GLLA 4QWQA 1BN5A 3JTGA 2R93J 4BACA 2LRDA 5KHDA 3BTIA 4F91B 3K1MA 4FHTA 5IOZA 2QA4I 5GADJ 4P5OA 1GT0C 2LLKA 4K2EA 3LNQA 1K78A 3OR2C 1H9GA 1ODDA 1R5GA 2X6XA 5HOOA 2DT6A 4DNCA 4ITVA 4BUPA 5JI6A 3ERED 1MBGA 4MEYF 1IRXA 1ZELA 1SANA 2HVRA 2K4BA 3ABTA 2DMQA 2VBZA 3CCMI 2OU2A 1BI1A 5EEHA 2PBIA 3FXJA 1YJWI 2VQCA 2CW8A 3BG6A 1XMXA 2A5YB 1QGPA 4B43A 2WADA 2R5ZA 2F48A 5HS7A 3OYCA 1E2XA 1Z67A 3CCYA 4MFEA 1I5ZA 3SFZA 1LEAA 3VYTB 4HLXA 3W2AA 1Y1WJ 5FLMJ 5EZGA 4XRSA 1J09A 1R1UA 2BVMA 2HGCA 3MN2A 1P7JA 5M5WJ 3TQNA 3DLLF 2Y2ZA 3FHZA 4A5MA 1U2WA 3VWBA 3HEFA 5D5UB 4QTRA 3AG4H 5JHFA 2DN0A 4C2MJ 3QQAA 1JJ8C 1AWCA 3P7NA 4B3AA 3BPVA 3G1OA 2GZWA 4XNFA 2DTZA 3CP2A 1GVJA 2Y0MA 3I53A 3T1BA 2LKXA 2XRNA 3OYBA 1MMNA 3RKQA 5CQEA 4ZYEA 4JBAA 1KZHA 4F92B 5F0FA 4M71A 3OYDA 1UELB 3CDIA 3M1EA 1MSFC 4AWXB 4OMYA 3PIPF 3DEEA 3HXLA 5IPAA 2PEXA 4R1HA 2K27A 2O6GE 4MHGA 3CLQA 2VODA 5FD6A 4KN7X 4ZJZA 1RKWA 4M9ZA 3L2RA 2KLOA 3F8BA 1D0XA 1XN7A 2H09A 4I2OA 1SD7A 3V7SA 2W24A 3RPUD 4B4CA 4JX6A 1YX5A 4X1EA 3H3VK 1G3SA 5B3SH 4M3DA 3I4MJ 4XSXF 3DTIA 4OWRB 5ICCA 1TWCJ 3UR3C 2HFHA 2XAUA 4I98B 2PJRB 4YFNF 4E4HA 2EK5A 3F8NA 4C3HJ 2DT7B 1J5YA 1T39A 4A69C 5D5WB 3JRBA 3GWZA 2AXTC 3I55I 3TP3A 1TNSA 2KRCA 3TMOA 3UNGC 4AYBN 3OYGA 4RMNA 1BBYA 3AL0B 2M34A 3QAHA 4CSWA 2IGNA 3SYTA 3FX3A 3K4BA 1YHQI 1ON1A 1QO0D 5GPAA 3OIPA 1TQIA 5F6FA 4OMZA 2R92J 2IGKA 3BC8A 3NARA 3OOPA 4HPQA 4PDKA 4C3JJ 4U0YA 4HF0A 2Z9OA 4A3BJ 5ILUA 2I10A 4YEJA 3Q0VA 4A93J 2WC2A 5M3MJ 5E8IA 2Q0OA 1BJAA 3X2QH 1OKRA 2ELKA 3L2QA 1PYVA 3BROA 5H6QA 1FP2A 2CMPA 2JVHA 1G6NA 4Z6YA 2ZXHA 3MEXA 5F1JA 4EEFG 3GZNB 5DM6F 1SFUA 2VUMJ 1LFUP 1MBFA 2JSPA 1Y8QB 2P7VB 3R6SA 3JCUC 2XKPA 2CU7A 2LVSA 4KNYA 3FHNA 1Q1VA 5E3NA 2EJRA 3DLAA 3ZQFA 4MTDA 4KT5C 2CV0A 2H6BA 1XGOA 1QHGA 3WU2C 1ZG1A 1IDZA 2V9KA 1OYIA 1T6SA 2UWMA 5CVVA 4P1WA 5IYDJ 4BDZA 3GTOJ 2H1LA 2EV6A 1JT0A 2BYVE 1FJLA 2OA4A 3S17J 2GXGA 1UG0A 1RETA 3CCUI 5L3EA 1YRNA 2ISZA 4X0GA 1F1ZA 3L2CA 3HHGA 3QU6A 2PLYA 2HTJA 2X1CA 3LAJA 1YO5C 3ZMTA 1X3UA 2PX9A 1K4TA 4LD5A 3V42A 1DP7P 4E7HA 4XN3A 3H5NA 1X1CA 1Z6RA 5JLWA 1EH7A 1BL0A 2E1MC 3KZYA 2WAFA 2OTJI 4TV7A 2A6TA 3IRQA 3PO3J 4BQNA 4R8HA 3U21A 2VBXA 2JRTA 3R4KA 3HUGA 3ISPA 2KRFA 3P5JA 3QRFF 2M8GX 3BCBA 2OQRA 2O03A 1RPWA 2IEKA 3PJRA 4EM2A 3PO2J 1IRZA 4UB6C 3J7ZI 4A3EJ 2R7VA 3BQYA 2HPIA 2QKMB 3FISA 1ETKA 3DTKA 3P9IA 5JLXA 1KQ0A 3F6OA 1I6XA 2UXXA 1ETXA 1R36A 1R1VA 1TWAJ 2CQXA 2KL4A 2ZNYA 4BHBA 5HNFA 1O7FA 2X4HA 3U1KA 1SMTA 4AC0A 2V6CA 3SZGA 3FK6A 5FFZA 4DBRA 3RZOJ 1I1GA 1MIJA 4MLOA 1WJFA 3LAPA 4Y33A 3TO7A 2GBYA 1D0YA 1W36D 2V1DA 5DM7F 5B1AH 3E97A 3VODA 1QPMA 3R0JA 5F08A 4AU7A 4ZYHA 1TZLA 3K69A 4PJNA 4CZCA 2JA2A 3PNVA 1G59A 2AS5F 4BJ6C 4G6TB 4GCVA 2YUSA 1NK3P 4KN4X 2VPLA 1JXSA 1IRFA 2JPCA 2IGMA 1LE8B 1XSXA 3PM1A 2VLAA 3CDLA 4O6JA 1G3TA 1IV8A 3G1MA 4HF2A 3LSPA 2XF5A 3IAM2 4JK1X 1SFKA 1X1DA 2OD5A 3PQJA 2ZMEB 4MGRA 4L0ZB 2CJJA 3TBIA 2CG4A 4RAGA 2DK8A 3W6JB 3HPHA 2DA4A 3ML6A 3F22A 2WAEA 3WTWC 1MMGA 1RR7A 5BS6A 1JHHA 2GAUA 4MFDA 2L4AA 2ZKZA 3I4PA 3BQZA 4YIRX 3KLNA 3DP7A 2H27A 2VC1A 3RPQA 1O3TA 1YLFA 2QQ9A 3T0YA 4D7NA 2IXSA 3I59B 5F04A 4KISA 3TGNA 4CCJA 2DI3A 4AD9A 1T8IA 2GIZA 2R7UA 5J3LA 3J7AO 1ETYA 2E1OA 1OMIA 3DPLC 2XB5A 4AIKA 4HW0A 4C2TA 3E0JB 2QBYA 3F23A 2BY2A 2PQ8A 1E3PA 4Y17A 2E19A 3RSNA 3E5UA 1U3EM 2XAHA 3BZ6A 4UUSB 3HSEA 2MLGA 2E34A 3VEPA 1V5EA 2ZJPF 3PQKA 4DZPA 3Q5FA 3E6DA 3WODF 1GLNA 4BBRJ 2RN7A 3IWZA 1VQ7I 4D1QA 1ZG3A 2CUJA 3GXOA 3CCJI 2RVCA 1DPUA 5CVUA 1ZRDA 4E7LA 2TRTA 1LKXA 4A3KJ 4G7HF 3ZMZA 4XKBA 3GLXA 4M3BA 5J1RA 1MGTA 4BE2A 3B6CA 3Q3SA 1K4SA 1MMSA 1YJ9I 1VQ6I 1X3WB 5FLXZ 5E3LA 3CO7C 2ZXWH 2VJJA 2OBPA 3CF2A 3SEQA 2VT2A 3PSFA 3I64A 3K0LA 4NBQA 3AKZA 1IUFA 3SXYA 3OL3A 2IPQX 2HOTA 1R23A 1FY7A 5FO5A 1SC7A 2L3DA 2EIKH 1XB4A 3OR1C 2HKOA 5JVGF 2M2EA 3L00A 2BVLA 1ZQ3P 2BY0A 3DU5A 1E3OC 4CICA 3C2BA 3SQNA 2FUG2 3FXKA 3HSFA 3CTAA 1MMAA 2ID6A 3HKZA 3GTMJ 3BR5A 2VKEA 2KT0A 1RZ4A 2Z99A 4BS9A 4W97A 3QOEA 3E7LA 3LSKA 3SDGA 4XRFA 2UXNA 3HBLA 4KITB 1WFXA 4DIQA 1W5CC 5DD8A 2N8GA 3LSGA 1W0TA 3KZZA 2GXAA 4IXAA 3A01B 4HNUA 4A3LJ 2KJCA 3IP4B 3W2WA 2B7EA 2AQEA 5AIPA 3Q9VA 1JUSA 2XSDC 1U5TC 1OJLA 1UMQA 4AIDA 2D1VA 3NWTA 1J75A 2P6SA 4D7MA 5E1WA 4ZZDA 1Z77A 5E3OA 3GFJA 1MSEC 1K78B 4A3GJ 4LIUA 2DOEA 2K85A 1Z6TA 3K6GA 5KAFC 1V55H 1WSUA 3JRFA 2FA5A 3OL4A 3CMMA 2MA3A 1FYMA 3HOZJ 4MNUA 3AG1H 2PI0A 3QP6A 4F52A 1G3WA 4X6AJ 3ASOH 4E70A 4XKCA 2KIQA 1F43A 2FF4A 1BI0A 2ZJQF 3EUHA 3HZJA 1MNMC 1Z7UA 1R5ID 2NS7A 2P5VA 3CLOA 5ICEA 2FD5A 4FISA 4MO7A 3MKYB 1L0OC 4M3GA 4UV8A 2FQ4A 2D1HA 2RDPA 2DXIA 3KP7A 2YPRA 2BXZA 3OMYA 4ESJA 5FKOA 3O8HA 2A68F 2NVUB 4Y13A 3FM5A 1ZR2A 1U5TA 4LFUA 3HGYA 4U7DA 2M1BA 3H36A 4PZJA 2V7FA 4RAFA 4GXOA 1Z3XA 3CJRB 4I0BA 1XSVA 2ECCA 1W0UA 2KIFA 2F5CA 4I02A 3M4OJ 1ZGJA 2UV1A 4Q5SF 4JX4A 2RKHA 3BT9A 2IP2A 3BR6A 2LR8A 2DFHA 1VZ0A 3DFGA 3BR2A 4EMSA 2VPRA 2K9LA 1FT9A 2VXZA 2BXYA 1XX5A 4XLFA 1UAAA 1WJBA 3QP5A 3JRDA 2HTSA 4IHSA 2VBWA 5TJJA 1WQ2A 1JKRC 4A3MJ 4HNVA 3JSOA 5E17F 2GOMA 2KP6A 1D1AA 3CUQC 4ZC3A 1R58A 5HDGA 1FOKA 2JA6J 2COMA 2A69F 2ZBKA 2ESHA 2UZKA 5BPIA 4ZDPA 2ZFWA 2E60A 3LWFA 4YIFA 3OYFA 2BEOA 3V4GA 4IHWA 1XMKA 1ETOA 1T08B 2HDWA 2XGXA 3HOTA 2X1DA 4BU2A 4I6ZA 2HVSA 2DQLA 1XPXA 4DZJA 2K9NA 1YJNI 1JI8A 1BI2A 3ZP5A 5IY5H 3RPUA 2QUFA 5LHGA 3F6VA 1J59A 1FTTA 1FC3A 2DYRH 3ECOA 2AQFA 2CYYA 2F4IA 4HG2A 5J47A 1JGGA 2V79A 2FU4A 3LL7A 4EJVA 1TLHB 4HX7A 1F5TA 4BH9A 5IP6A 3ZN0A 5J8FA 1YQAA 2OAZA 4UUTA 3AAFA 1JUPA 3CJNA 1IXCA 3FKJA 3LFKA 2NRAC 4JQFA 3V8KA 1YIOA 3T5XA 3A0HC 1UFMA 3ONQA 4AYBA 4FE4A 4A0ZA 5C3EJ 3ZR8X 4LLLA 1DU0A 4IKFA 5E1XA 4IHYA 1S6LA 3LA3A 1SAUA 2KKOA 1OISA 2F4MB 3CUQA 1ZN2A 4IQJA 1MD0A 2EH3A 3EDPA 2LC2A 3KLOA 4OIQF 4DQ2A 2E1NA 4XN0A 3PFIA 1U8BA 2HYFA 3QYBA 3FXOA 3AG3H 5BQTA 3J80Z 1EKEA 1Y0UA 5EYRA 2HYGD 2KIUA 1QZYA 3VSKA 1C0WA 2ID3A 5D5XB 1B59A 4RB0A 2ZXIA 5D4RA 1WJAA 3IH3A 4FT8A 4BY1J 5AONA 3HG9A 3BJAA 1B72A 2K7LA 2QF7A 2E36A 3ABLH 3OYIA 1KU9A 2XAFA 2Y9ZA 2VXDA 4AUXA 3A01A 3BY6A 2DFEA 2PMUA 1MNEA 3KEQA 1YRNB 4XRMA 1ACIA 1OCRH 1H9TA 5J40A 2F2EA 2M45A 1K6OA 1IZ1A 1JE8A 3CC2I 5BOXA 4MQVA 1EA3A 4ENJA 2BOLA 3A02A 1ZTRA 3FDYA 5K5QA 3DU6A 1SFXA 1ERDA 3H1CA 2I5UA 4EATA 3BG7A 2Y75A 3CUOA 3E6BA 3KX2A 4BHPA 2O8XA 5M5XJ 3QWLA 1FYLA 1W7PB 1W36C 1Y8RB 3HUGB 2CFOA 2HQ5A 3ELKA 1DU6A 1WGXA 3W3CA 1HC8A 1VQLI 3F8MA 3OWTA 2EILH 3ZMUA 1T98A 3RCOA 2EZKA 4KIGA 2VASA 2YR2A 2OF7A 4OINF 5J1YA 5LRSA 2ACJA 2DDBA 1R71A 3H9JA 3TW6A 4RM2A 3GTJJ 2L9VA 2H8RA 3H0DA 2DMPA 2FOWA 2P0WA 3ZN1A 2RNJA 5KAIC 1HXDA 4C3IJ 2M87A 2X6WA 3ZPLA 5K7HA 4IHTA 1BJZA 4HX8A 3WTXC 1EH8A 1U0JA 4BDYA 4XSZF 4Y3OA 2EFOA 1ZR4A 4BGDA 4CO8A 5DD4A 3HIFA 2EWNA 3H5RA 2V1XA 1WHUA 4MIMA 5J1UA 4GYIA 2E35A 1YI2I 2Q1ZB 4WCGA 2L4MA 1GUUA 1DQUA 5FFXA 3FIWA 4F3QA 2E1MB 4HAMA 3KEOA 2DPUA 2VB6A 3EQLF 1MNDA 1AKHA 3DKYA 4XKWA 1LDKB 3AG2H 1BC7C 3KYDB 1OPCA 3C7JA 2ZCWA 3PFYA 1MJAA 5GTHC 1FOXA 4XBFA 2QGUA 2Z1DA 2V6EA 3I0TA 1FZPB 2QSGX 1K83J 5FRNA 3KZIC 3FXQA 1OCOH 1ETWA 3QPLA 2DA1A 4M6VA 5D8KB 5HS8A 3PNYA 1HKQA 2DBBA 4RAZA 2YS9A 3HOWJ 4ZTJA 4N4NB 3Q0WA 4EM1A 1RR8C 3CESA 2MABA 2AXLA 5GPCA 1T56A 4JP0A 4BE1A 4C2UA 5J6XA 1IV6A 2HEOA 2HKXA 2V9VA 4KJZA 3FBNB 4ZYDA 4II2A 3CJQB 5A2QZ 4WK8F 2O8KA 1IXSB 4EM0B 3ERMA 4P55A 4UXNA 2MLKA 2VI6A 9ANTA 5D6EA 2QBYB 3HJEA 3ZQ7A 4AIJA 2JPBA 2WA0A 3OYEA 2BBYA 1FP1D 1S72I 3HOSA 2QQ8A 2FRHA 4WXDA 3ZQIA 2V4JC 2PG4A 2LMDA 1UZCA 1P7IA 2E1CA 1LDDA 3TL4X 4HZFA 1FTZA 4LITA 2GXBA 1NK2P 2IT0A 2ZJ2A 4ZH4F 1H0MA 1MBEA 2HU9A 2MSYA 1IRGA 2W1OA 1MJBA 3T8RA 1WVRA 4IQ4A 2OPTA 3F72A 2VJ4A 5K7ZA 4C9YA 5LLQA 2JVGA 4N9IA 4GO1A 3QYFA 4CCLA 4MQ9F 3OIQA 3F9KA 3M07A 1K7AA 3IWFA 3GW2A 3SZPA 3OYAA 4DYCA 5TRDA 3I5UA 1F36A 1CGPA 2X0LA 2BW3A 2KJBA 2KZVA 2LBFB 3WE3A 4LG0A 3CD6I 2R7TA 2Y30A 4BEHA 2DU9A 3CMYA 1PP7U 3JSPA 5FRMA 3ULQB 3BZCA 3HOVJ 1HBXG 2JTVA 4IVNA 4NHJA 1IUYA 2DO7A 4OAZA 3ZMDA 1JTYA 4NB5A 5AIQA 1GV2A 1E17A 4AIHA 2JZYA 3M3YJ 4JYKA 3G4SI 3MKZA 2KHMA 4BQAA 3WU0A 1RI7A 4A0YA 4BJ5C 2RQPA 2O61A 3O2PE 4IL6C 4YELA 4N0BA 2DTRA 3GF2A 2L7MP 3JRIA 4UUVA 4RGSA 5LD2C 2UUZA 3S3NA 1BI3A 2VN2A 3NQOA 1GXPA 2HZDA 3KP6A 4ZDOA 2H94A 5CVIA 1YITI 3CMAI 3LSIA 1AU7A 5ICFA 4MTEA 1XDUA 4AM3A 1B8IA 2DYSH 2BV6A 5K1YA 1W7PA 3FMQA 4EQQA 1YW8A 2MGQA 3ZMSA 2LKPA 1LJ9A 2NVYJ 5EZHA 3TO9A 3NWSA 5K7FA 1FEXA 2EV5A 1KGSA 4IRIA 4LLGF 1HKSA 1LUJB 2HNHA 4XICA 3QPHA 2K9MA 1G2HA 4BL0B 2HXIA 1O57A 2EFNA 1P2FA 2ZNZA 1USTA 2OQGA 3M1CA 1B6AA 3ZMVA 4DYQA 3GTGJ 1FPQA 3V7RA 4EJOA 1Y0NA 1R00A 4L18B 3JREA 2GM4A 1IN5A 4II3A 5FROA 2EFQA 1XCBA 3BG3A 1MH3A 4P96A 2MH9A 4RA2A 2KDOA 5EF6A 4M9XA 4HV6A 3DWLE 1J0RA 5FKLA 3TOAA 1GHCA 4KYWA 2L2OA 3AFHA 3J81Z 4CCMA 5LFAA 2PMZN 1MDMA 3DPUA 1NG6A 3ZQGA 3N05A 2EIJH 4Q48A 5JR3A 2Q8KA 3HC7A 2OZUA 5DCFA 1WCMJ 2YSRA 4HV5A 2M5WA 2XHKA 3JTHA 3RDIA 1U5TB 1G4DA 1ZRFA 3S2HJ 3F3XA 1LDJA 2M0CA 2D2WA 2L5QA 3KPHA 2KZGA 4IHXA 3BR0A 1PJRA 1S29A 2R7WA 2R7SA 2STTA 5IT9Z 2QEXI 5ED4A 1EV7A 4XRSG 1MBJA 4A0XA 3KIOA 1TQPA 2LF8A 4HQMA 3EETA 3LA7A 5GP9A 4RB3C 2F5EA 4FCYA 2JA5J 2OTLI 2M0MA 3WTTC 4ENNA 4OAYA 4ANJA 3EYIA 1YX3A 2OV7A 3K4NA 4L9VA 1FOYA 4GRIA 2EA2A 3ROUA 3JAMZ 2GLOA 4BBSJ 1I27A 3GMEA 4EV0A 1HDDC 4A3JJ 2FBKA 2E2JJ 4A3FJ 2P8TA 2LK2A 2XRLA 1S7AA 1E3HA 1UHSA 4JOMA 2FNAA 2YU9J 3VYUB 4M74A 4XLEA 5DUKA 1OCPA 1HSJA 1WI3A 4YIIA 2FSWA 2XVCA 3D5LA 1X58A 4O5VA 5GAEJ 4DOZA 4MEXF 1GV5A 1W5SA 4V2GA 1R1TA 3CC4I 2PMHA 3C1DA 3BG5A 5LEKA 4YFKF 4J00A 2ZC2A 2CV2A 2XROA 4FTHA 2JA7J 3Q0UA 1TC3C 4CCKA 2STWA 2FQ3A 2CQ7A 5B66C 1D3YA 2Y69H 5TGTA 2IRFG 1DP3A 1WJEA 2DPDA 3MAJA 3MZ8A 4D5FA 3H0GJ 1F9NA 3GTLJ 2JK3A 3G73A 2G9WA 2JA8J 4PJJA 5C4XJ 1IF1A 3OY9A 2NOGA 5DYMA 4BHCA 4S04A 3BJOA 1I50J 4XLHA 1YS7A 2LBFA 3FKIJ 2ZXJA 2JT1A 1MJ9A 2Y48A 4A6DA 4F93B 4L0YB 1XD7A 4OU0A 4LK0F 5LGTA 2FBHA 2M9HA 1T33A 3EUKL 3H5AA 3U9GA 4Q4ZF 2EPFA 4RGUA 2DMNA 3EUAA 4NUBA 1JKQC 2IS6A 1ZG5A 4M72A 3L1PA 3L2UA 1VQ5I 4S05A 2IW5A 3GZ6A 2DDAA 1HOMA 3CQZJ 3VB2A 2XPWA 1ZHFA 1FMWA 4WF2A 2EV0A 4N4OB 2X6YA 1B9NA 5L3DA 2LY1A 2IS2A 3CUQB 4LK1F 3KYLA 3RI4A 5LGNA 4L9NA 4WXHA 4BNCA 1UHWA 4KFCA 1W4MA 5HS9A 4RM3A 5J4VA 2O7OA 4GFBA 4XONA 2ZSHB 3OOUA 4D9JA 3I54A 3IC7A 3Q9SA 2W84A 5E18F 2CUZA 3FXLA 4ENKA 3WGGA 2L7KA 3HHHA 1FBUA 4BXUA 1JT6A 2YX4A 3LSTA 2P5LC 4LJZF 1B1BA 3GYHX 3P9KA 1YS6A 2ELHA 1B72B 2DODA 4UVBA 2VQGA 3B02A 4ESFA 3IRRA 1D1CA 1D0ZA 4G6DA 4HNTA 2RAEA 3DBLB 1TBXA 3GFIA 3GTKJ 4OOIA 4QIWN 4XMYA 4E7JA 3GTPJ 1IC8A 2CWEA 2QSHX 4EJWA 5HLHA 5KK1A 5HODA 3CMEI 3IHUA 5EDNA 2L54A 4CH7A 2V1NA 4NC8A 2NVTJ 3PIOF 1ZGAA 1G8XA 2KFDA 5IT3A 2HVQA 2Y0SN 3HRSA 1BA5A 1EF4A 2CH0A 2LY2A 2XAJA 4A6EA 1X4OA 2H8WA 1OYYA 2GWRA 1Y56A 2CFXA 5FKNA 2HXOA 1Y39A 1DPRA 2NNNA 3J7YJ 2HZTA 3LSRA 3RQIA 1PDNC 2EZLA 2DFFA 1CF7A 5BPDA 1G3YA 4M9SA 1YW9A 4WXCA 5L3CA 2FBIA 1P4WA 4IOCF 2TCTA 4PJLA 2L0KA 3JRHA 3RZDJ 4A3IJ 1RNLA 2ESNA 4OIOF 3FBIB 3MKLA 2ETHA 2K86A 2V1UA 2HI3A 2QCOA 4ON0A 1O4XA 1ONVA 2W00A 1O3SA 2IA0A 3MZYA 3A1YA 2E5NA 1YYVA 3FXUA 2LH9A 2VJ5A 4IRGA 2FX0A 3CF5F 3ZQCA 3MFKA 3WTVC 2A5WA 4GGGA 2XSJC 1TW3A 1H89C 5FKMA 4PFPA 5DCMA 1CQTA 2ICWG 1BIAA 3OS2A 4U7BA 3ZQHA 4S0HB 3ESWB 2WB1N 4IEJA 2WY7Q 4HDUA 1A5JA 3KP5A 3MQ0A 4HDVA 1I1SA 2QQAA 1QA6A 2EBIA 2WWYA 1UG2A 4B3XA 3WTYC 1X1PA 5HLGA 4LLNA 3H35A 1EJ9A 2QQBA 1UJ8A 3FXRA 1T38A 5H6RA 2E7WA 4UVAA 3LSMA 4HSTA 5J8CA 4RB1A 2ZSIB 3ZGKA 4BYYA 1TWFJ 1AKHB 1ITYA 4NQWB 2EFPA 1D5VA 5ERIA 1B4AA 3HRMA 1MMDA 4G7ZF 1J2XA 4GYGA 3LQQA 3RYPA 2HS5A 3RKWA 5B5EC 1M1EB 2HOAA 1YTYA 1QVTA 5LRRA 3O8GA 2BE5F 2KQRA 3PSIA 2G7HA 2PN6A 1LEBA 2HQRA 3IV5A 2DJNA 2IVMA 2LDUA 1LPQA 3W6KB 3WGHA 2WTEA 1X19A 3W6VA 4O3MA 4NC7A 1PUFA 3CCSI 4EGYA 2RV8A 1WI9A 3DXJF 2CQNA 2L01A 3QU3A 1F4KA 1W1WE 3OIOA 3R60A 5FLXK 3I58A 2KISA 2FXAA 1YOVB 1SD5A 4XK4A 3IUOA 1RESA 5BNGA 2NAZA 1FIPA 4XORA 4L5JA 4I09A 5C44J 2IJLA 1WH5A 1ON2A 5IP9J 1XTAA 4NC6A 3IKTA 2DJIA 3BJ6A 3K4CA 3PL8A 2HWVA 1BR2A 4XLCA 4PSWA 4QPOA 1VTNC 3CZ6A 1WWXA 2X1EA 2BZTA 3DKXA 3DEWA 4HBLA 3IH4A 3SHFA 2LOOA 3OV8A 3RTRA 5EGOA 1WJCA 4LB5A 2OCCH 3E5XA 2QKLB 1R5HA 4ZYGA 2M7BA 1HSTA 3GZ5A 4QSHA 5KVRA 1XCVA 4FX0A 2L7ZA 3HM5A 4M3EA 4XOTA 5FJ8J 4L9JA 1KQ9A 4XQFA 2XKOA 1KA8A 1TWHJ 1QU3A 5LEJA 4Y4RA 2BW3B 4IOAF 1X3ZB 4LG0B 1Z21A 1AA7A 2LTPA 1QNTA 3HRUA 4BEHB 1S7OA 4NNJA 4OIPF 5F27A 2ECBA 2K4JA 4P9FA 1VFCA 1MKMA 1IN8A 2FJ1A 2YU3A 3HGGA 4U88A 1S9HA 2R0QC 2K3PA 3CP8A 2MFZA 4RGRA 1JHFA 4BE0A 1OQYA 1R9TJ 1IN7A 2MH2A 4U0VA 1TW2A 2DAOA 2OC6A 2X51A 2R4GA 2AHQA 1OLTA 2WAQN 2XASA 3MZHA 1DUXC 1W5TA 1KU3A 1SMYF 1OR7C 1K6YA 2LNBA 1XMAA 2F5DA 2HR3A 3JRCA 3K70D 2DQRA 4KICA 1Q1HA 2YX7A 4B47A 4ABZA 4Y52J 2K9SA 5LGUA 5HLTA 1WPKA 3MCZA 3OYNA 3V7CA 3OSFA 4I7HA 3BCAA 3ZXSA 2R7DA 2OZ6A 2HDCA 5E20A 1B8IB 3K10A 1HDPA 3L2WA 2LKSA 1VF9A 2EZIA 3RKYA 1RC9A 1I39A 2VE8A 1QVUA 2L7FP 4ZYAA 3L9FA 5FLVA 3DEUA 2HOSA 2DW4A 3CCQI 4EJTA 4PJMA 2VKHA 4HX4A 1SEUA 3S16J 2WV1A 1UCRA 1XGSA 1S5LC 2L9RA 3G2BA 3KCCA 3LSHA 4I0AA 1J9IA 2C6YA 1XC5A 2LF7A 5D4SA 4KIFA 3JR9A 1WJDA 2WV0A 2BHZA 2RQQA 1REPC 4BXXJ 3BP8A 3RQ4A 4KMUX 2COBA 2H6CA 4BAYA 3TOBA 3GTQJ 3F8FA 1USSA 2DMTA 1NG7A 2DA3A 3GBGA 1WRJA 2WY8Q 4XLNF 4G12A 3OS0A 3LQRA 3E3VA 3G71I 4EGZA 3HOYJ 3OYMA 1OR7A
chains in the Genus database with same CATH topology
2R7FA 1B9MA 2GA1A 5CVJA 1LQ1A 1AOYA 2ISYA 2ZO4A 1O7LA 2Q2EA 1HKTA 1A04A 1O3QA 1J7KA 1XSDA 2XV4S 1Z05A 2JSCA 4QLCU 4NQWA 3I71A 1MDMB 5K5OA 3H3ZA 1FNNA 1LB2A 2EB7A 3CO6C 5ILVA 1JGSA 4M6YA 4HA8A 3WTUC 4PGGA 1BC8C 2DK5A 4L9TA 3GO5A 2FNPA 1Z91A 3GEZA 1ZLKA 1P6RA 5E1ZB 1U6GA 3V8LA 3JW4A 1IN6A 3FMRA 5JFRA 4IF4A 1STZA 1K79A 1FX7A 4HYEA 5E8GA 2W57A 5JHUA 4U0WA 5LHHA 3KP2A 3J80K 5ICGA 4D0PA 1TTYA 3NEUA 4RS8A 3NRVA 2QENA 2DT5A 1XGNA 2B0LA 1RUNA 4YG2F 2E7XA 3DPTA 1FWZA 3HYIA 2NYXA 1XGMA 3IL2A 1LNWA 2Z33A 1FSEA 1FSHA 3M8EA 2MBFA 2RGVA 4KUMA 3GX4X 5H20A 3E6MA 3H92A 2A07F 2DFIA 2XAGA 3WG9A 1V3FA 2NS0A 4HF1A 3E6CC 4KMFA 4RGXA 1SD4A 1TNTA 2VOOA 5L3GA 6PAXA 2CQKA 1GXQA 3BOQA 1R22A 1HW2A 4KIBA 1IAWA 5DDGA 4A12A 5F64A 1HW1A 3FF5A 2A6EF 3WE2A 2XIGA 2M30A 1BIBA 3KP4A 2QVOA 1FYKA 3U2RA 3CDHA 1FLIA 3M9AA 5L3FA 1L3LA 1KU7A 1XDSA 1ZAOA 2BGCA 1UB9A 3COAC 4KA4A 3LA2A 4KDPA 3FMSA 3C18A 3TDZC 3GFLA 4B09A 5JVTA 3KETA 1U8RA 4M6XA 2W25A 1CF7B 2A3SA 2FMLA 1R7JA 2VOPA 2J5PA 4RB2C 4P9UA 3BDDA 3H3UA 2XAQA 3C3WA 2A6HF 3DV8A 3L09A 4OIRF 5D6FA 1YG2A 3O3KA 3K2ZA 2VC0A 4UNOA 5A2QK 5DCMB 3N97A 4ZZLA 2P4WA 2QWWA 4CDGA 2D45A 4LMYA 4G8XA 4F7ZA 5EEGA 1IW7F 2CW0F 1RUOA 2FMYA 3FZVA 2VONA 2O0YA 4M73A 3RIRA 2PJPA 5DV5A 2CO5A 4I01A 4H0EA 5HDKA 3M8FA 2EA4A 1HW5A 1IXRC 3WU1B 1EH6A 3N4MA 3BWGA 2GQQA 1P92A 5HDNA 5CLSA 4YFXF 4Y15A 1V4RA 3G3ZA 2IA2A 2QM3A 3VOEA 1UHMA 2PFBA 4G7OF 3TKYA 3U1DA 3F8CA 4ESBA 2RC4A 2HOEA 4RAYA 4R79A 3FM3A 5ILSA 1SD6A 3REOA 4CZZA 4G94A 3BPXA 1Z9CA 2ADUA 5LBQA 4LB6B 2EFWA 3F21A 4XLPF 4A2UA 5CJ9A 1SAXA 1QZZA 2MC3A 3RYRA 1DDNA 3DQVC 3T8TA 5FB2A 5D8LB 5CYVA 3EYYA 1HQCA 2QLZA 4ENMA 1ZARA 1PUEE 3HTSB 4PGHA 3RJPA 5HLIA 5DUIA 2J5OA 4CHUA 4EJUA 1W7PD 2P6TA 2FOKA 4PCQA 2P5KA 4LGWA 3K1NA 1D8KA 1ZLJA 1U78A 3WGIA 4UVCA 1FBSA 1SFEA 4HQEA 5D5VB 4N9HA 1KQ8A 4HOBA 3MWMA 3IKVA 3J81K 1T2KA 1ZREA 4WWCA 3TO6A 3GFMA 5LHIA 1YW7A 2CGPA 1OYWA 4IJAA 2O3FA 1LVAA 1BM9A 1ZYRF 4UHTA 4EVIA 5IT9K 2XUBA 1S8NA 2M8EA 3DKWA 5F1RA 3RKXA 1YFHA 1P4AA 1S3JA 3V8JA 2GIVA 1FBQA 2P7CB 2HQNA 4G9YA 1ZRCA 3JAMK 1KU2A 1QBJA 1T0FA 4CXFA 1P4XA 3E5QA 4ETSA 4Z2YA 4A5NA 4UV9A 1D8JA 2ZMEA 2NNYA 1BOAA 1TQMA 3K1PA 2CSOA 5K5RA 2QYOA 1WKMA 4CGZA 4L5IA 3ABUA 2G7UA 2LSOA 3TDUC 1RIOH 3D0SA 3HRTA 3DF8A 3I59A 3SZTA 3GUDA 5L3BA 2Z3YA 4Q47A 1O3RA 3WTSC 5HVQC 3QOPA 2W85A 4ASNA 3ECHA 5BMZA 2VBYA 1MZBA 2KIMA 3QPTA 2K02A 1NHAA 3P9CA 2IA1A 1QQIA 1ULYA 3S2WA 4WX9A 4FX4A 2FE3A 4HLYA 3O6BB 2A61A 4B8XA 3KFWX 4CYDA 3M7GA 3VFZA 2FEZA 2MD5A 3R0AA 1ZH5A 3HSRA 5DEQA 2F5FA 3GVAA 2Z5UA 5FD5A 1IN4A 4IRHA 2TDXA 5CVRA 2VE9A 3KE2A 1PP8F 3R61A 4IPAA 4G6QA 2VT3A 2DLLA 1KYZA 2QZ8A 3HTUA 5FGMA 2R3SA 3WTZA 3KP3A 3B73A 2L02A 2GA2A 1KYWA 1Z1DA 3L7WA 4AVPA 3FWEA 3K9TA 4QWQA 1BN5A 3JTGA 3K1MA 4FHTA 4P5OA 4K2EA 1K78A 1H9GA 1ODDA 1R5GA 5HOOA 4DNCA 3ERED 5JI6A 4MEYF 2K4BA 3ABTA 2VBZA 2OU2A 1BI1A 5EEHA 2PBIA 2A5YB 1QGPA 5HS7A 1E2XA 1I5ZA 3SFZA 1LEAA 4HLXA 1R1UA 2HGCA 3TQNA 3FHZA 4A5MA 1U2WA 5D5UB 1AWCA 3P7NA 3BPVA 2GZWA 1GVJA 2Y0MA 3I53A 3T1BA 2XRNA 4ZYEA 4JBAA 4M71A 3M1EA 4AWXB 4OMYA 2PEXA 4R1HA 2K27A 2O6GE 4MHGA 2VODA 5FD6A 4KN7X 4M9ZA 3F8BA 1XN7A 2H09A 4I2OA 1SD7A 3V7SA 2W24A 1G3SA 4XSXF 5ICCA 2HFHA 4I98B 4YFNF 2EK5A 3F8NA 1J5YA 1T39A 5D5WB 3GWZA 1TNSA 1BBYA 3QAHA 3FX3A 1ON1A 1QO0D 1TQIA 5F6FA 4OMZA 3OOPA 4U0YA 4PDKA 4HF0A 2Z9OA 5ILUA 2WC2A 5E8IA 2Q0OA 1BJAA 1OKRA 3BROA 5H6QA 1FP2A 1G6NA 3MEXA 1SFUA 2P7VB 3R6SA 2XKPA 4KNYA 2EJRA 4MTDA 4KT5C 2H6BA 1XGOA 1ZG1A 1OYIA 1T6SA 2UWMA 5CVVA 2EV6A 2BYVE 2OA4A 2GXGA 5L3EA 2ISZA 1F1ZA 3L2CA 3HHGA 3QU6A 2PLYA 2HTJA 3LAJA 1YO5C 3ZMTA 1X3UA 1DP7P 4LD5A 1Z6RA 1EH7A 3KZYA 4TV7A 3IRQA 4R8HA 2VBXA 2JRTA 3R4KA 3HUGA 3ISPA 2KRFA 3QRFF 2OQRA 2O03A 4EM2A 3P9IA 1KQ0A 3F6OA 1I6XA 2UXXA 1R36A 1R1VA 2ZNYA 4BHBA 1O7FA 2X4HA 1SMTA 2V6CA 5FFZA 1I1GA 3LAPA 3TO7A 2V1DA 3E97A 3VODA 1QPMA 3R0JA 4ZYHA 3K69A 2AS5F 4GCVA 4KN4X 1JXSA 1IRFA 2JPCA 1XSXA 4O6JA 1G3TA 4HF2A 4JK1X 2OD5A 3PQJA 2ZMEB 4MGRA 4L0ZB 2CG4A 2DK8A 3W6JB 3ML6A 3F22A 3WTWC 5BS6A 1JHHA 2GAUA 2L4AA 2ZKZA 3I4PA 3KLNA 3DP7A 2H27A 2VC1A 3RPQA 1O3TA 1YLFA 2QQ9A 3T0YA 3I59B 3TGNA 2DI3A 4AD9A 3J7AO 1OMIA 3DPLC 4AIKA 4HW0A 2QBYA 3F23A 2PQ8A 4Y17A 3E5UA 1U3EM 2XAHA 3BZ6A 3HSEA 2MLGA 3VEPA 3PQKA 3Q5FA 3E6DA 3WODF 2RN7A 3IWZA 1ZG3A 3GXOA 2RVCA 1DPUA 5CVUA 1ZRDA 4G7HF 3ZMZA 3GLXA 1MGTA 5FLXZ 3CO7C 2OBPA 2VT2A 3I64A 3K0LA 3SXYA 2IPQX 1R23A 1FY7A 5FO5A 2L3DA 1XB4A 2HKOA 3L00A 4CICA 3SQNA 3HSFA 3CTAA 1RZ4A 2Z99A 4XRFA 2UXNA 5DD8A 3KZZA 4IXAA 2KJCA 5AIPA 3Q9VA 1U5TC 2D1VA 1J75A 2P6SA 4ZZDA 5E1WA 3GFJA 1K78B 1Z6TA 1WSUA 2FA5A 2MA3A 1FYMA 4MNUA 2PI0A 3QP6A 1G3WA 4E70A 2FF4A 1BI0A 3EUHA 1Z7UA 3CLOA 2P5VA 5ICEA 1L0OC 4UV8A 2D1HA 2RDPA 3KP7A 2YPRA 4ESJA 2A68F 4Y13A 3FM5A 1U5TA 4LFUA 4U7DA 2M1BA 4PZJA 4GXOA 4I0BA 1XSVA 2KIFA 2F5CA 4I02A 1ZGJA 4Q5SF 2RKHA 2IP2A 3DFGA 4EMSA 1FT9A 2VXZA 3QP5A 2HTSA 4IHSA 2VBWA 5TJJA 1WQ2A 3JSOA 5E17F 3CUQC 5HDGA 1R58A 1FOKA 2COMA 2A69F 2ZBKA 2ESHA 2UZKA 5BPIA 2ZFWA 3LWFA 4YIFA 2BEOA 3V4GA 1XMKA 3HOTA 2XGXA 2DQLA 1BI2A 3ZP5A 5LHGA 3RPUA 2QUFA 3F6VA 1J59A 1FC3A 3ECOA 2CYYA 2V79A 2FU4A 4EJVA 1TLHB 4HX7A 1F5TA 4BH9A 3ZN0A 5J8FA 1YQAA 2OAZA 3AAFA 3CJNA 1IXCA 3LFKA 2NRAC 4JQFA 3V8KA 1YIOA 3T5XA 1UFMA 4A0ZA 4LLLA 5E1XA 1S6LA 3LA3A 2KKOA 3CUQA 1ZN2A 1MD0A 3EDPA 3KLOA 4OIQF 4DQ2A 2E1NA 3PFIA 2HYFA 5BQTA 1C0WA 3J80Z 1Y0UA 2HYGD 2KIUA 1QZYA 5D5XB 1B59A 4RB0A 5D4RA 4FT8A 5AONA 3BJAA 2K7LA 1KU9A 2XAFA 3BY6A 2PMUA 3KEQA 1H9TA 2F2EA 2M45A 1K6OA 1IZ1A 1JE8A 5BOXA 4MQVA 4ENJA 5K5QA 1SFXA 2Y75A 3CUOA 3E6BA 4BHPA 2O8XA 1FYLA 1W7PB 3ELKA 3F8MA 3ZMUA 1T98A 4KIGA 2YR2A 5LRSA 2ACJA 4OINF 3ZN1A 2RNJA 1HXDA 2M87A 3ZPLA 4IHTA 4HX8A 3WTXC 1EH8A 4XSZF 2EFOA 4CO8A 5DD4A 3HIFA 2EWNA 2V1XA 4GYIA 4WCGA 2L4MA 5FFXA 4HAMA 3KEOA 2DPUA 3EQLF 1LDKB 1BC7C 1OPCA 3C7JA 2ZCWA 1MJAA 4XBFA 3I0TA 1FZPB 3FXQA 5D8KB 5HS8A 1HKQA 2DBBA 4RAZA 4EM1A 2AXLA 5J6XA 2HEOA 2HKXA 2V9VA 4ZYDA 5A2QZ 4WK8F 1IXSB 4EM0B 4P55A 4UXNA 2MLKA 5D6EA 2QBYB 3ZQ7A 4AIJA 2JPBA 2BBYA 1FP1D 3HOSA 2FRHA 4WXDA 2PG4A 2E1CA 1LDDA 4HZFA 2GXBA 2IT0A 2ZJ2A 4ZH4F 1H0MA 1IRGA 1MJBA 3T8RA 3F72A 5LLQA 4N9IA 4GO1A 4MQ9F 1K7AA 3IWFA 3GW2A 3SZPA 5TRDA 3I5UA 1CGPA 2X0LA 2KJBA 3WE3A 4LG0A 2DU9A 1PP7U 3JSPA 3ULQB 1HBXG 2JTVA 4IVNA 4NHJA 1IUYA 2DO7A 3ZMDA 4NB5A 5AIQA 1E17A 4AIHA 2JZYA 4BQAA 3WU0A 1RI7A 4A0YA 2RQPA 2O61A 3O2PE 4N0BA 2DTRA 3GF2A 4UUVA 4RGSA 1BI3A 2VN2A 3NQOA 1GXPA 3KP6A 2H94A 5CVIA 5ICFA 4MTEA 1XDUA 2BV6A 5K1YA 1W7PA 3FMQA 4EQQA 1YW8A 3ZMSA 2LKPA 1LJ9A 3TO9A 2EV5A 1KGSA 4IRIA 4LLGF 1HKSA 3QPHA 1O57A 2EFNA 1P2FA 2ZNZA 1USTA 2OQGA 3ZMVA 1B6AA 1FPQA 3V7RA 4EJOA 1R00A 4L18B 1IN5A 2EFQA 1XCBA 4P96A 2MH9A 4M9XA 4HV6A 1J0RA 3TOAA 1GHCA 4KYWA 3J81Z 1MDMA 4Q48A 5JR3A 2Q8KA 2OZUA 5DCFA 4HV5A 2YSRA 2M5WA 2XHKA 3JTHA 3RDIA 1U5TB 1G4DA 1ZRFA 3F3XA 1LDJA 2D2WA 1S29A 2STTA 5IT9Z 5ED4A 1EV7A 4A0XA 1TQPA 2LF8A 4HQMA 3EETA 3LA7A 4RB3C 2F5EA 3WTTC 4ENNA 3EYIA 4L9VA 3ROUA 2EA2A 3JAMZ 1I27A 4EV0A 2FBKA 2P8TA 1S7AA 2FNAA 4M74A 5DUKA 1HSJA 4YIIA 2FSWA 2XVCA 3D5LA 4MEXF 4O5VA 1W5SA 1R1TA 2PMHA 3C1DA 5LEKA 4YFKF 2XROA 2STWA 2FQ3A 1D3YA 2IRFG 2DPDA 3MAJA 1F9NA 3G73A 2G9WA 1IF1A 5DYMA 4BHCA 4S04A 3BJOA 1YS7A 2ZXJA 2JT1A 1MJ9A 2Y48A 4A6DA 4L0YB 1XD7A 4OU0A 4LK0F 5LGTA 2FBHA 3U9GA 4Q4ZF 4RGUA 1ZG5A 4M72A 4S05A 2IW5A 3GZ6A 3VB2A 1ZHFA 4WF2A 2EV0A 1B9NA 5L3DA 3CUQB 4LK1F 3RI4A 5LGNA 4L9NA 4WXHA 4BNCA 1UHWA 4KFCA 1W4MA 5HS9A 3I54A 3IC7A 3Q9SA 2W84A 5E18F 4ENKA 3WGGA 3HHHA 1FBUA 4BXUA 2YX4A 3LSTA 2P5LC 4LJZF 1B1BA 3GYHX 3P9KA 1YS6A 2ELHA 4UVBA 3B02A 4ESFA 3IRRA 4G6DA 1TBXA 3GFIA 4OOIA 2CWEA 4EJWA 5HLHA 5KK1A 3IHUA 2L54A 1ZGAA 5IT3A 3HRSA 2XAJA 4A6EA 1OYYA 2GWRA 2CFXA 1DPRA 2NNNA 2HZTA 1PDNC 1CF7A 5BPDA 1G3YA 4M9SA 1YW9A 4WXCA 5L3CA 2FBIA 1P4WA 1RNLA 2ESNA 4OIOF 2ETHA 2K86A 2V1UA 4ON0A 1ONVA 1O3SA 2IA0A 3MZYA 1YYVA 3FXUA 4IRGA 3MFKA 3WTVC 4GGGA 1TW3A 5DCMA 1BIAA 4U7BA 1I1SA 4HDUA 3KP5A 3MQ0A 4HDVA 2QQAA 2WWYA 3WTYC 5HLGA 4LLNA 2QQBA 3FXRA 1T38A 5H6RA 2E7WA 4UVAA 5J8CA 4RB1A 4BYYA 2EFPA 1D5VA 5ERIA 1B4AA 3HRMA 4G7ZF 1J2XA 4GYGA 3LQQA 3RYPA 2HS5A 3RKWA 1YTYA 5LRRA 2BE5F 2G7HA 2PN6A 1LEBA 2HQRA 2IVMA 2LDUA 3W6KB 3WGHA 2WTEA 4O3MA 4EGYA 2RV8A 1WI9A 3DXJF 2L01A 3QU3A 1F4KA 3R60A 5FLXK 3I58A 2FXAA 1SD5A 2NAZA 4L5JA 4I09A 2IJLA 1ON2A 3IKTA 3BJ6A 2HWVA 1VTNC 1WWXA 4HBLA 3SHFA 3RTRA 3OV8A 4LB5A 3E5XA 1R5HA 4ZYGA 3GZ5A 1HSTA 5KVRA 1XCVA 4FX0A 4L9JA 1KQ9A 2XKOA 1KA8A 5LEJA 4LG0B 1QNTA 3HRUA 1S7OA 4OIPF 2K4JA 4P9FA 1MKMA 1IN8A 2YU3A 4U88A 4RGRA 1JHFA 1IN7A 2MH2A 4U0VA 1TW2A 2DAOA 3MZHA 2XASA 1DUXC 1W5TA 1KU3A 1SMYF 2LNBA 1XMAA 2F5DA 2HR3A 2DQRA 4KICA 1Q1HA 2YX7A 5LGUA 3MCZA 3V7CA 4I7HA 2R7DA 2OZ6A 2HDCA 5E20A 3RKYA 2VE8A 3L9FA 3DEUA 2DW4A 4EJTA 4HX4A 1UCRA 1XGSA 4I0AA 1J9IA 3KCCA 2C6YA 2LF7A 5D4SA 4KIFA 2WV0A 1REPC 3BP8A 4KMUX 2H6CA 4BAYA 3TOBA 3F8FA 1USSA 1WRJA 4XLNF 3LQRA 3E3VA 4EGZA 1OR7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7F A;  1B9M A;  2GA1 A;  5CVJ A;  1LQ1 A;  1AOY A;  2ISY A;  2ZO4 A;  1O7L A;  2Q2E A;  1HKT A;  1A04 A;  1O3Q A;  1J7K A;  1XSD A;  2XV4 S;  1Z05 A;  2JSC A;  4QLC U;  4NQW A;  3I71 A;  1MDM B;  5K5O A;  3H3Z A;  1FNN A;  1LB2 A;  2EB7 A;  3CO6 C;  5ILV A;  1JGS A;  4M6Y A;  4HA8 A;  3WTU C;  4PGG A;  1BC8 C;  2DK5 A;  4L9T A;  3GO5 A;  2FNP A;  1Z91 A;  3GEZ A;  1ZLK A;  1P6R A;  5E1Z B;  1U6G A;  3V8L A;  3JW4 A;  1IN6 A;  3FMR A;  5JFR A;  4IF4 A;  1STZ A;  1K79 A;  1FX7 A;  4HYE A;  5E8G A;  2W57 A;  5JHU A;  4U0W A;  5LHH A;  3KP2 A;  3J80 K;  5ICG A;  4D0P A;  1TTY A;  3NEU A;  4RS8 A;  3NRV A;  2QEN A;  2DT5 A;  1XGN A;  2B0L A;  1RUN A;  4YG2 F;  2E7X A;  3DPT A;  1FWZ A;  3HYI A;  2NYX A;  1XGM A;  3IL2 A;  1LNW A;  2Z33 A;  1FSE A;  1FSH A;  3M8E A;  2MBF A;  2RGV A;  4KUM A;  3GX4 X;  5H20 A;  3E6M A;  3H92 A;  2A07 F;  2DFI A;  2XAG A;  3WG9 A;  1V3F A;  2NS0 A;  4HF1 A;  3E6C C;  4KMF A;  4RGX A;  1SD4 A;  1TNT A;  2VOO A;  5L3G A;  6PAX A;  2CQK A;  1GXQ A;  3BOQ A;  1R22 A;  1HW2 A;  4KIB A;  1IAW A;  5DDG A;  4A12 A;  5F64 A;  1HW1 A;  3FF5 A;  2A6E F;  3WE2 A;  2XIG A;  2M30 A;  1BIB A;  3KP4 A;  2QVO A;  1FYK A;  3U2R A;  3CDH A;  1FLI A;  3M9A A;  5L3F A;  1L3L A;  1KU7 A;  1XDS A;  1ZAO A;  2BGC A;  1UB9 A;  3COA C;  4KA4 A;  3LA2 A;  4KDP A;  3FMS A;  3C18 A;  3TDZ C;  3GFL A;  4B09 A;  5JVT A;  3KET A;  1U8R A;  4M6X A;  2W25 A;  1CF7 B;  2A3S A;  2FML A;  1R7J A;  2VOP A;  2J5P A;  4RB2 C;  4P9U A;  3BDD A;  3H3U A;  2XAQ A;  3C3W A;  2A6H F;  3DV8 A;  3L09 A;  4OIR F;  5D6F A;  1YG2 A;  3O3K A;  3K2Z A;  2VC0 A;  4UNO A;  5A2Q K;  5DCM B;  3N97 A;  4ZZL A;  2P4W A;  2QWW A;  4CDG A;  2D45 A;  4LMY A;  4G8X A;  4F7Z A;  5EEG A;  1IW7 F;  2CW0 F;  1RUO A;  2FMY A;  3FZV A;  2VON A;  2O0Y A;  4M73 A;  3RIR A;  2PJP A;  5DV5 A;  2CO5 A;  4I01 A;  4H0E A;  5HDK A;  3M8F A;  2EA4 A;  1HW5 A;  1IXR C;  3WU1 B;  1EH6 A;  3N4M A;  3BWG A;  2GQQ A;  1P92 A;  5HDN A;  5CLS A;  4YFX F;  4Y15 A;  1V4R A;  3G3Z A;  2IA2 A;  2QM3 A;  3VOE A;  1UHM A;  2PFB A;  4G7O F;  3TKY A;  3U1D A;  3F8C A;  4ESB A;  2RC4 A;  2HOE A;  4RAY A;  4R79 A;  3FM3 A;  5ILS A;  1SD6 A;  3REO A;  4CZZ A;  4G94 A;  3BPX A;  1Z9C A;  2ADU A;  5LBQ A;  4LB6 B;  2EFW A;  3F21 A;  4XLP F;  4A2U A;  5CJ9 A;  1SAX A;  1QZZ A;  2MC3 A;  3RYR A;  1DDN A;  3DQV C;  3T8T A;  5FB2 A;  5D8L B;  5CYV A;  3EYY A;  1HQC A;  2QLZ A;  4ENM A;  1ZAR A;  1PUE E;  3HTS B;  4PGH A;  3RJP A;  5HLI A;  5DUI A;  2J5O A;  4CHU A;  4EJU A;  1W7P D;  2P6T A;  2FOK A;  4PCQ A;  2P5K A;  4LGW A;  3K1N A;  1D8K A;  1ZLJ A;  1U78 A;  3WGI A;  4UVC A;  1FBS A;  1SFE A;  4HQE A;  5D5V B;  4N9H A;  1KQ8 A;  4HOB A;  3MWM A;  3IKV A;  3J81 K;  1T2K A;  1ZRE A;  4WWC A;  3TO6 A;  3GFM A;  5LHI A;  1YW7 A;  2CGP A;  1OYW A;  4IJA A;  2O3F A;  1LVA A;  1BM9 A;  1ZYR F;  4UHT A;  4EVI A;  5IT9 K;  2XUB A;  1S8N A;  2M8E A;  3DKW A;  5F1R A;  3RKX A;  1YFH A;  1P4A A;  1S3J A;  3V8J A;  2GIV A;  1FBQ A;  2P7C B;  2HQN A;  4G9Y A;  1ZRC A;  3JAM K;  1KU2 A;  1QBJ A;  1T0F A;  4CXF A;  1P4X A;  3E5Q A;  4ETS A;  4Z2Y A;  4A5N A;  4UV9 A;  1D8J A;  2ZME A;  2NNY A;  1BOA A;  1TQM A;  3K1P A;  2CSO A;  5K5R A;  2QYO A;  1WKM A;  4CGZ A;  4L5I A;  3ABU A;  2G7U A;  2LSO A;  3TDU C;  1RIO H;  3D0S A;  3HRT A;  3DF8 A;  3I59 A;  3SZT A;  3GUD A;  5L3B A;  2Z3Y A;  4Q47 A;  1O3R A;  3WTS C;  5HVQ C;  3QOP A;  2W85 A;  4ASN A;  3ECH A;  5BMZ A;  2VBY A;  1MZB A;  2KIM A;  3QPT A;  2K02 A;  1NHA A;  3P9C A;  2IA1 A;  1QQI A;  1ULY A;  3S2W A;  4WX9 A;  4FX4 A;  2FE3 A;  4HLY A;  3O6B B;  2A61 A;  4B8X A;  3KFW X;  4CYD A;  3M7G A;  3VFZ A;  2FEZ A;  2MD5 A;  3R0A A;  1ZH5 A;  3HSR A;  5DEQ A;  2F5F A;  3GVA A;  2Z5U A;  5FD5 A;  1IN4 A;  4IRH A;  2TDX A;  5CVR A;  2VE9 A;  3KE2 A;  1PP8 F;  3R61 A;  4IPA A;  4G6Q A;  2VT3 A;  2DLL A;  1KYZ A;  2QZ8 A;  3HTU A;  5FGM A;  2R3S A;  3WTZ A;  3KP3 A;  3B73 A;  2L02 A;  2GA2 A;  1KYW A;  1Z1D A;  3L7W A;  4AVP A;  3FWE A;  3K9T A;  4QWQ A;  1BN5 A;  3JTG A;  3K1M A;  4FHT A;  4P5O A;  4K2E A;  1K78 A;  1H9G A;  1ODD A;  1R5G A;  5HOO A;  4DNC A;  3ERE D;  5JI6 A;  4MEY F;  2K4B A;  3ABT A;  2VBZ A;  2OU2 A;  1BI1 A;  5EEH A;  2PBI A;  2A5Y B;  1QGP A;  5HS7 A;  1E2X A;  1I5Z A;  3SFZ A;  1LEA A;  4HLX A;  1R1U A;  2HGC A;  3TQN A;  3FHZ A;  4A5M A;  1U2W A;  5D5U B;  1AWC A;  3P7N A;  3BPV A;  2GZW A;  1GVJ A;  2Y0M A;  3I53 A;  3T1B A;  2XRN A;  4ZYE A;  4JBA A;  4M71 A;  3M1E A;  4AWX B;  4OMY A;  2PEX A;  4R1H A;  2K27 A;  2O6G E;  4MHG A;  2VOD A;  5FD6 A;  4KN7 X;  4M9Z A;  3F8B A;  1XN7 A;  2H09 A;  4I2O A;  1SD7 A;  3V7S A;  2W24 A;  1G3S A;  4XSX F;  5ICC A;  2HFH A;  4I98 B;  4YFN F;  2EK5 A;  3F8N A;  1J5Y A;  1T39 A;  5D5W B;  3GWZ A;  1TNS A;  1BBY A;  3QAH A;  3FX3 A;  1ON1 A;  1QO0 D;  1TQI A;  5F6F A;  4OMZ A;  3OOP A;  4U0Y A;  4PDK A;  4HF0 A;  2Z9O A;  5ILU A;  2WC2 A;  5E8I A;  2Q0O A;  1BJA A;  1OKR A;  3BRO A;  5H6Q A;  1FP2 A;  1G6N A;  3MEX A;  1SFU A;  2P7V B;  3R6S A;  2XKP A;  4KNY A;  2EJR A;  4MTD A;  4KT5 C;  2H6B A;  1XGO A;  1ZG1 A;  1OYI A;  1T6S A;  2UWM A;  5CVV A;  2EV6 A;  2BYV E;  2OA4 A;  2GXG A;  5L3E A;  2ISZ A;  1F1Z A;  3L2C A;  3HHG A;  3QU6 A;  2PLY A;  2HTJ A;  3LAJ A;  1YO5 C;  3ZMT A;  1X3U A;  1DP7 P;  4LD5 A;  1Z6R A;  1EH7 A;  3KZY A;  4TV7 A;  3IRQ A;  4R8H A;  2VBX A;  2JRT A;  3R4K A;  3HUG A;  3ISP A;  2KRF A;  3QRF F;  2OQR A;  2O03 A;  4EM2 A;  3P9I A;  1KQ0 A;  3F6O A;  1I6X A;  2UXX A;  1R36 A;  1R1V A;  2ZNY A;  4BHB A;  1O7F A;  2X4H A;  1SMT A;  2V6C A;  5FFZ A;  1I1G A;  3LAP A;  3TO7 A;  2V1D A;  3E97 A;  3VOD A;  1QPM A;  3R0J A;  4ZYH A;  3K69 A;  2AS5 F;  4GCV A;  4KN4 X;  1JXS A;  1IRF A;  2JPC A;  1XSX A;  4O6J A;  1G3T A;  4HF2 A;  4JK1 X;  2OD5 A;  3PQJ A;  2ZME B;  4MGR A;  4L0Z B;  2CG4 A;  2DK8 A;  3W6J B;  3ML6 A;  3F22 A;  3WTW C;  5BS6 A;  1JHH A;  2GAU A;  2L4A A;  2ZKZ A;  3I4P A;  3KLN A;  3DP7 A;  2H27 A;  2VC1 A;  3RPQ A;  1O3T A;  1YLF A;  2QQ9 A;  3T0Y A;  3I59 B;  3TGN A;  2DI3 A;  4AD9 A;  3J7A O;  1OMI A;  3DPL C;  4AIK A;  4HW0 A;  2QBY A;  3F23 A;  2PQ8 A;  4Y17 A;  3E5U A;  1U3E M;  2XAH A;  3BZ6 A;  3HSE A;  2MLG A;  3VEP A;  3PQK A;  3Q5F A;  3E6D A;  3WOD F;  2RN7 A;  3IWZ A;  1ZG3 A;  3GXO A;  2RVC A;  1DPU A;  5CVU A;  1ZRD A;  4G7H F;  3ZMZ A;  3GLX A;  1MGT A;  5FLX Z;  3CO7 C;  2OBP A;  2VT2 A;  3I64 A;  3K0L A;  3SXY A;  2IPQ X;  1R23 A;  1FY7 A;  5FO5 A;  2L3D A;  1XB4 A;  2HKO A;  3L00 A;  4CIC A;  3SQN A;  3HSF A;  3CTA A;  1RZ4 A;  2Z99 A;  4XRF A;  2UXN A;  5DD8 A;  3KZZ A;  4IXA A;  2KJC A;  5AIP A;  3Q9V A;  1U5T C;  2D1V A;  1J75 A;  2P6S A;  4ZZD A;  5E1W A;  3GFJ A;  1K78 B;  1Z6T A;  1WSU A;  2FA5 A;  2MA3 A;  1FYM A;  4MNU A;  2PI0 A;  3QP6 A;  1G3W A;  4E70 A;  2FF4 A;  1BI0 A;  3EUH A;  1Z7U A;  3CLO A;  2P5V A;  5ICE A;  1L0O C;  4UV8 A;  2D1H A;  2RDP A;  3KP7 A;  2YPR A;  4ESJ A;  2A68 F;  4Y13 A;  3FM5 A;  1U5T A;  4LFU A;  4U7D A;  2M1B A;  4PZJ A;  4GXO A;  4I0B A;  1XSV A;  2KIF A;  2F5C A;  4I02 A;  1ZGJ A;  4Q5S F;  2RKH A;  2IP2 A;  3DFG A;  4EMS A;  1FT9 A;  2VXZ A;  3QP5 A;  2HTS A;  4IHS A;  2VBW A;  5TJJ A;  1WQ2 A;  3JSO A;  5E17 F;  3CUQ C;  5HDG A;  1R58 A;  1FOK A;  2COM A;  2A69 F;  2ZBK A;  2ESH A;  2UZK A;  5BPI A;  2ZFW A;  3LWF A;  4YIF A;  2BEO A;  3V4G A;  1XMK A;  3HOT A;  2XGX A;  2DQL A;  1BI2 A;  3ZP5 A;  5LHG A;  3RPU A;  2QUF A;  3F6V A;  1J59 A;  1FC3 A;  3ECO A;  2CYY A;  2V79 A;  2FU4 A;  4EJV A;  1TLH B;  4HX7 A;  1F5T A;  4BH9 A;  3ZN0 A;  5J8F A;  1YQA A;  2OAZ A;  3AAF A;  3CJN A;  1IXC A;  3LFK A;  2NRA C;  4JQF A;  3V8K A;  1YIO A;  3T5X A;  1UFM A;  4A0Z A;  4LLL A;  5E1X A;  1S6L A;  3LA3 A;  2KKO A;  3CUQ A;  1ZN2 A;  1MD0 A;  3EDP A;  3KLO A;  4OIQ F;  4DQ2 A;  2E1N A;  3PFI A;  2HYF A;  5BQT A;  1C0W A;  3J80 Z;  1Y0U A;  2HYG D;  2KIU A;  1QZY A;  5D5X B;  1B59 A;  4RB0 A;  5D4R A;  4FT8 A;  5AON A;  3BJA A;  2K7L A;  1KU9 A;  2XAF A;  3BY6 A;  2PMU A;  3KEQ A;  1H9T A;  2F2E A;  2M45 A;  1K6O A;  1IZ1 A;  1JE8 A;  5BOX A;  4MQV A;  4ENJ A;  5K5Q A;  1SFX A;  2Y75 A;  3CUO A;  3E6B A;  4BHP A;  2O8X A;  1FYL A;  1W7P B;  3ELK A;  3F8M A;  3ZMU A;  1T98 A;  4KIG A;  2YR2 A;  5LRS A;  2ACJ A;  4OIN F;  3ZN1 A;  2RNJ A;  1HXD A;  2M87 A;  3ZPL A;  4IHT A;  4HX8 A;  3WTX C;  1EH8 A;  4XSZ F;  2EFO A;  4CO8 A;  5DD4 A;  3HIF A;  2EWN A;  2V1X A;  4GYI A;  4WCG A;  2L4M A;  5FFX A;  4HAM A;  3KEO A;  2DPU A;  3EQL F;  1LDK B;  1BC7 C;  1OPC A;  3C7J A;  2ZCW A;  1MJA A;  4XBF A;  3I0T A;  1FZP B;  3FXQ A;  5D8K B;  5HS8 A;  1HKQ A;  2DBB A;  4RAZ A;  4EM1 A;  2AXL A;  5J6X A;  2HEO A;  2HKX A;  2V9V A;  4ZYD A;  5A2Q Z;  4WK8 F;  1IXS B;  4EM0 B;  4P55 A;  4UXN A;  2MLK A;  5D6E A;  2QBY B;  3ZQ7 A;  4AIJ A;  2JPB A;  2BBY A;  1FP1 D;  3HOS A;  2FRH A;  4WXD A;  2PG4 A;  2E1C A;  1LDD A;  4HZF A;  2GXB A;  2IT0 A;  2ZJ2 A;  4ZH4 F;  1H0M A;  1IRG A;  1MJB A;  3T8R A;  3F72 A;  5LLQ A;  4N9I A;  4GO1 A;  4MQ9 F;  1K7A A;  3IWF A;  3GW2 A;  3SZP A;  5TRD A;  3I5U A;  1CGP A;  2X0L A;  2KJB A;  3WE3 A;  4LG0 A;  2DU9 A;  1PP7 U;  3JSP A;  3ULQ B;  1HBX G;  2JTV A;  4IVN A;  4NHJ A;  1IUY A;  2DO7 A;  3ZMD A;  4NB5 A;  5AIQ A;  1E17 A;  4AIH A;  2JZY A;  4BQA A;  3WU0 A;  1RI7 A;  4A0Y A;  2RQP A;  2O61 A;  3O2P E;  4N0B A;  2DTR A;  3GF2 A;  4UUV A;  4RGS A;  1BI3 A;  2VN2 A;  3NQO A;  1GXP A;  3KP6 A;  2H94 A;  5CVI A;  5ICF A;  4MTE A;  1XDU A;  2BV6 A;  5K1Y A;  1W7P A;  3FMQ A;  4EQQ A;  1YW8 A;  3ZMS A;  2LKP A;  1LJ9 A;  3TO9 A;  2EV5 A;  1KGS A;  4IRI A;  4LLG F;  1HKS A;  3QPH A;  1O57 A;  2EFN A;  1P2F A;  2ZNZ A;  1UST A;  2OQG A;  3ZMV A;  1B6A A;  1FPQ A;  3V7R A;  4EJO A;  1R00 A;  4L18 B;  1IN5 A;  2EFQ A;  1XCB A;  4P96 A;  2MH9 A;  4M9X A;  4HV6 A;  1J0R A;  3TOA A;  1GHC A;  4KYW A;  3J81 Z;  1MDM A;  4Q48 A;  5JR3 A;  2Q8K A;  2OZU A;  5DCF A;  4HV5 A;  2YSR A;  2M5W A;  2XHK A;  3JTH A;  3RDI A;  1U5T B;  1G4D A;  1ZRF A;  3F3X A;  1LDJ A;  2D2W A;  1S29 A;  2STT A;  5IT9 Z;  5ED4 A;  1EV7 A;  4A0X A;  1TQP A;  2LF8 A;  4HQM A;  3EET A;  3LA7 A;  4RB3 C;  2F5E A;  3WTT C;  4ENN A;  3EYI A;  4L9V A;  3ROU A;  2EA2 A;  3JAM Z;  1I27 A;  4EV0 A;  2FBK A;  2P8T A;  1S7A A;  2FNA A;  4M74 A;  5DUK A;  1HSJ A;  4YII A;  2FSW A;  2XVC A;  3D5L A;  4MEX F;  4O5V A;  1W5S A;  1R1T A;  2PMH A;  3C1D A;  5LEK A;  4YFK F;  2XRO A;  2STW A;  2FQ3 A;  1D3Y A;  2IRF G;  2DPD A;  3MAJ A;  1F9N A;  3G73 A;  2G9W A;  1IF1 A;  5DYM A;  4BHC A;  4S04 A;  3BJO A;  1YS7 A;  2ZXJ A;  2JT1 A;  1MJ9 A;  2Y48 A;  4A6D A;  4L0Y B;  1XD7 A;  4OU0 A;  4LK0 F;  5LGT A;  2FBH A;  3U9G A;  4Q4Z F;  4RGU A;  1ZG5 A;  4M72 A;  4S05 A;  2IW5 A;  3GZ6 A;  3VB2 A;  1ZHF A;  4WF2 A;  2EV0 A;  1B9N A;  5L3D A;  3CUQ B;  4LK1 F;  3RI4 A;  5LGN A;  4L9N A;  4WXH A;  4BNC A;  1UHW A;  4KFC A;  1W4M A;  5HS9 A;  3I54 A;  3IC7 A;  3Q9S A;  2W84 A;  5E18 F;  4ENK A;  3WGG A;  3HHH A;  1FBU A;  4BXU A;  2YX4 A;  3LST A;  2P5L C;  4LJZ F;  1B1B A;  3GYH X;  3P9K A;  1YS6 A;  2ELH A;  4UVB A;  3B02 A;  4ESF A;  3IRR A;  4G6D A;  1TBX A;  3GFI A;  4OOI A;  2CWE A;  4EJW A;  5HLH A;  5KK1 A;  3IHU A;  2L54 A;  1ZGA A;  5IT3 A;  3HRS A;  2XAJ A;  4A6E A;  1OYY A;  2GWR A;  2CFX A;  1DPR A;  2NNN A;  2HZT A;  1PDN C;  1CF7 A;  5BPD A;  1G3Y A;  4M9S A;  1YW9 A;  4WXC A;  5L3C A;  2FBI A;  1P4W A;  1RNL A;  2ESN A;  4OIO F;  2ETH A;  2K86 A;  2V1U A;  4ON0 A;  1ONV A;  1O3S A;  2IA0 A;  3MZY A;  1YYV A;  3FXU A;  4IRG A;  3MFK A;  3WTV C;  4GGG A;  1TW3 A;  5DCM A;  1BIA A;  4U7B A;  1I1S A;  4HDU A;  3KP5 A;  3MQ0 A;  4HDV A;  2QQA A;  2WWY A;  3WTY C;  5HLG A;  4LLN A;  2QQB A;  3FXR A;  1T38 A;  5H6R A;  2E7W A;  4UVA A;  5J8C A;  4RB1 A;  4BYY A;  2EFP A;  1D5V A;  5ERI A;  1B4A A;  3HRM A;  4G7Z F;  1J2X A;  4GYG A;  3LQQ A;  3RYP A;  2HS5 A;  3RKW A;  1YTY A;  5LRR A;  2BE5 F;  2G7H A;  2PN6 A;  1LEB A;  2HQR A;  2IVM A;  2LDU A;  3W6K B;  3WGH A;  2WTE A;  4O3M A;  4EGY A;  2RV8 A;  1WI9 A;  3DXJ F;  2L01 A;  3QU3 A;  1F4K A;  3R60 A;  5FLX K;  3I58 A;  2FXA A;  1SD5 A;  2NAZ A;  4L5J A;  4I09 A;  2IJL A;  1ON2 A;  3IKT A;  3BJ6 A;  2HWV A;  1VTN C;  1WWX A;  4HBL A;  3SHF A;  3RTR A;  3OV8 A;  4LB5 A;  3E5X A;  1R5H A;  4ZYG A;  3GZ5 A;  1HST A;  5KVR A;  1XCV A;  4FX0 A;  4L9J A;  1KQ9 A;  2XKO A;  1KA8 A;  5LEJ A;  4LG0 B;  1QNT A;  3HRU A;  1S7O A;  4OIP F;  2K4J A;  4P9F A;  1MKM A;  1IN8 A;  2YU3 A;  4U88 A;  4RGR A;  1JHF A;  1IN7 A;  2MH2 A;  4U0V A;  1TW2 A;  2DAO A;  3MZH A;  2XAS A;  1DUX C;  1W5T A;  1KU3 A;  1SMY F;  2LNB A;  1XMA A;  2F5D A;  2HR3 A;  2DQR A;  4KIC A;  1Q1H A;  2YX7 A;  5LGU A;  3MCZ A;  3V7C A;  4I7H A;  2R7D A;  2OZ6 A;  2HDC A;  5E20 A;  3RKY A;  2VE8 A;  3L9F A;  3DEU A;  2DW4 A;  4EJT A;  4HX4 A;  1UCR A;  1XGS A;  4I0A A;  1J9I A;  3KCC A;  2C6Y A;  2LF7 A;  5D4S A;  4KIF A;  2WV0 A;  1REP C;  3BP8 A;  4KMU X;  2H6C A;  4BAY A;  3TOB A;  3F8F A;  1USS A;  1WRJ A;  4XLN F;  3LQR A;  3E3V A;  4EGZ A;  1OR7 A; 
#chains in the Genus database with same CATH topology
 2R7F A;  1SVM A;  1B9M A;  2GA1 A;  5DS9 A;  2IGO A;  5CVJ A;  1V5F A;  4XLA A;  1LQ1 A;  1AOY A;  3A03 A;  4LIV A;  2ISY A;  1BR4 A;  2EIM H;  1A6I A;  3CCR I;  1AHD P;  2ZO4 A;  3IH2 A;  5F0H A;  2HDD A;  1O7L A;  2Q2E A;  1MW7 A;  1HKT A;  3LFU A;  1A04 A;  2R7X A;  1O3Q A;  1J7K A;  1XSD A;  1BOB A;  2XV4 S;  1Z05 A;  4V19 K;  2JSC A;  4QLC U;  4NQW A;  3I71 A;  1MDM B;  5M5Y J;  3K4L A;  5TIS C;  2O9L A;  5K5O A;  1QPI A;  2Y9Y A;  3H3Z A;  1FNN A;  3I3L A;  1LB2 A;  2DOA A;  2EB7 A;  3CO6 C;  5ILV A;  5FKK A;  1V5G A;  4CCN A;  1JGS A;  4M6Y A;  2PMZ A;  4HA8 A;  3WTU C;  4PGG A;  2KRH A;  1BC8 C;  3S15 J;  2DK5 A;  3G1L A;  4L9T A;  3GO5 A;  3SDB A;  2DA2 A;  2FNP A;  2CQQ A;  1BW5 A;  2IAI A;  4W1U A;  1FMV A;  1Z91 A;  3GEZ A;  1ZLK A;  1P6R A;  5E1Z B;  3S14 J;  3K7A J;  1U6G A;  1OCZ H;  2F5V A;  3SFI A;  1QZE A;  3BR1 A;  1IN6 A;  3JW4 A;  3FMR A;  3V8L A;  4CYC B;  3HOX J;  5JFR A;  4IF4 A;  3ABK H;  3BTL A;  2MG4 A;  1STZ A;  2HQA A;  1JTX A;  1TP4 A;  2JJ7 A;  1QHH D;  1K79 A;  1FX7 A;  4HYE A;  3VDX A;  5E8G A;  5KNL A;  4PFO A;  2W57 A;  2X6O A;  2X9D A;  5JHU A;  4RBO A;  4U0W A;  2BHY A;  1KON A;  2F4O B;  3E1S A;  2V9P A;  5LHH A;  3KP2 A;  3J80 K;  5ICG A;  3BR3 A;  4D0P A;  4E6K G;  4BKX A;  1TTY A;  3NEU A;  4RS8 A;  1A31 A;  3IAS 2;  3NRV A;  2QEN A;  2DT5 A;  4HRI A;  1XGN A;  1YIJ I;  2B0L A;  1RUN A;  4UB8 C;  5C4J J;  4YG2 F;  1I6H J;  3ZRG A;  1U9N A;  1OCC H;  5J4Y A;  3S8P A;  2E7X A;  2ZB9 A;  3DPT A;  1SFO J;  2W4S A;  1FWZ A;  3HYI A;  2NYX A;  3VYS B;  1XGM A;  3IL2 A;  1LNW A;  2K5C A;  2NVX J;  2VQH A;  2LY9 A;  2Z33 A;  1XS9 A;  1VQN I;  2O5R A;  1FSE A;  1LVK A;  1FSH A;  3M8E A;  4FET A;  1D1B A;  2MBF A;  2RGV A;  4FE7 A;  4C30 A;  4KUM A;  3GX4 X;  2W82 A;  3LMM A;  2R5Y A;  5IOY A;  5H20 A;  3E6M A;  3H92 A;  4IZZ A;  2A07 F;  4RLQ A;  5DTD A;  2DFI A;  2XAG A;  3I56 I;  3WG9 A;  1V3F A;  2NS0 A;  4HF1 A;  3E6C C;  4KMF A;  3S1Q J;  2VL8 A;  4RGX A;  2MD0 A;  1U9O A;  5H2F C;  1SD4 A;  2E71 A;  3HL2 A;  1Z7L A;  2JUC A;  1TNT A;  2VOO A;  5L3G A;  6PAX A;  2CQK A;  1GXQ A;  3BOQ A;  3A2K A;  2NOJ B;  1R22 A;  1HW2 A;  3PUF A;  4KIB A;  3WHC A;  1HCR A;  1IAW A;  5DDG A;  4A12 A;  5F64 A;  4XM3 A;  2EQR A;  2R7Z J;  1HW1 A;  3CCV I;  3HPG A;  3W2V A;  3FF5 A;  1MH4 A;  4YRV A;  2A6E F;  3WE2 A;  4ZTF A;  2XIG A;  2M30 A;  1BIB A;  3D5S C;  3KP4 A;  2CV1 A;  2QVO A;  3BTJ A;  3K4J A;  1FYK A;  2XPU A;  3U2R A;  1ZK8 A;  3CDH A;  1FLI A;  4LG3 A;  2M3A A;  3M8J A;  4A3D J;  4UY8 I;  2XGD A;  1POG A;  1A35 A;  3M9A A;  5L3F A;  1L3L A;  3MD2 A;  1RRJ A;  1KU7 A;  3LSJ A;  3I9V 2;  1XDS A;  1ZAO A;  2KDZ A;  1ZGW A;  2BGC A;  2I8D A;  1UB9 A;  3COA C;  2MYS A;  2Z2S B;  4KA4 A;  3DBR B;  4AVZ A;  3LA2 A;  4KDP A;  3FMS A;  3C18 A;  3TDZ C;  2LFB A;  3GFL A;  2HYJ A;  4B09 A;  5JVT A;  3I4N J;  3KET A;  1U8R A;  4A3C J;  4I76 A;  3S32 A;  1TL8 A;  3DCF A;  2W25 A;  1I3Q J;  4M6X A;  1CF7 B;  1IO2 A;  2A3S A;  2LG4 A;  2FML A;  1MBH A;  3H9G A;  1R7J A;  2VOP A;  2Y0S A;  2IS1 A;  3L2V A;  2J5P A;  1LFB A;  1QRY A;  4L5E A;  4RB2 C;  2CUF A;  5E3M A;  3CC7 I;  2WBM A;  2M7A A;  2BY1 A;  3OYK A;  4P9U A;  2OCE A;  3HOU J;  3BDD A;  3H3U A;  1Z0X A;  2XAQ A;  1T95 A;  3C3W A;  3MMY B;  4B44 A;  2A6H F;  1D5Y A;  1P9Q C;  3DV8 A;  3L09 A;  2AO9 A;  2DMU A;  4OIR F;  2X85 A;  3JRG A;  1VQM I;  5D6F A;  1YG2 A;  3O3K A;  3K2Z A;  2D5V A;  3WG7 H;  3S1R J;  2VC0 A;  3VPR A;  1A36 A;  4UNO A;  5A2Q K;  3DTE A;  5DCM B;  3S1M J;  3N97 A;  4ZZL A;  3OYH A;  3QYE A;  3ASN H;  2P4W A;  2QWW A;  5B1B H;  2XDV A;  4CDG A;  4LMY A;  2D45 A;  3AL0 C;  4G8X A;  4GDF A;  4F7Z A;  2VQL A;  3BLY A;  3QPS A;  3OSG A;  5EEG A;  1IW7 F;  3ZOB A;  3TP0 A;  2CW0 F;  1RUO A;  2FMY A;  2X48 A;  4B48 A;  3FZV A;  2ELJ A;  2VON A;  2HPM A;  2DOF A;  2O0Y A;  1APL C;  4M73 A;  3RIR A;  1K61 A;  2PJP A;  2WB1 A;  2OUM A;  5DV5 A;  2A05 A;  4CYC A;  2CO5 A;  1TT0 A;  4RLF A;  4I01 A;  1TWG J;  4PK4 A;  4H0E A;  3S3O A;  5HDK A;  3M8F A;  2EA4 A;  3S1N J;  2K3F A;  2M4K A;  1IXR C;  1HW5 A;  4IO9 F;  5EG0 B;  4PJ0 C;  1R4M B;  3WU1 B;  4IHV A;  1EH6 A;  5F0C A;  3BWG A;  3N4M A;  1RKT A;  2GQQ A;  4DW6 A;  2V26 A;  2PJR A;  2ZJR F;  3C2H A;  1A6Q A;  1P92 A;  1ZKG A;  4M3F A;  3ZQQ A;  4E7S A;  1PUF B;  3HDD A;  2L9N A;  5HDN A;  1ETV A;  5CLS A;  4YFX F;  2W7N A;  4Y15 A;  1V4R A;  1VQ8 I;  3G3Z A;  2IA2 A;  1R6R A;  1X4P A;  1H8A C;  1FIA A;  1JUM A;  2QM3 A;  3WHB A;  3VOE A;  1UHM A;  1N77 A;  3DBH B;  4DJA A;  5M3F J;  2PFB A;  4BXF A;  1GVD A;  4G7O F;  1N78 A;  3TKY A;  3U1D A;  3A4C A;  1FOW A;  2XGE A;  3F8C A;  2W48 A;  2RC4 A;  4ESB A;  1N25 A;  4E7K A;  1VQK I;  2HOE A;  3NAU A;  4RAY A;  4R79 A;  3FM3 A;  5ILS A;  1VQP I;  4XOP A;  1SD6 A;  3REO A;  4CZZ A;  2LYC A;  1BW6 A;  2CRG A;  3KYC B;  3PNT A;  4G94 A;  3BPX A;  1SVL A;  5CQG A;  4DBQ A;  5EGO B;  4J01 A;  3TW7 A;  2JUG A;  3QOD A;  2ADU A;  5LBQ A;  1Z9C A;  4LB6 B;  1VQ4 I;  4J19 A;  1IGN A;  2IS4 A;  2QSF X;  3EPZ A;  1Y1V J;  3J7A Y;  3SJM A;  2XGC A;  2EFW A;  3F21 A;  4XLP F;  4QPQ A;  4A2U A;  1SVO A;  3ZQL A;  3K70 C;  5CJ9 A;  1SAX A;  1QZZ A;  4HEA 2;  1E0E A;  2VJI A;  2H1K A;  2LRE A;  3VYR B;  4I99 C;  4BJT A;  2MC3 A;  3JRA A;  4PUS A;  3RYR A;  1X2M A;  3S2D J;  1H88 C;  3DQV C;  1DDN A;  3T8T A;  5FB2 A;  5D8L B;  5CYV A;  3OYJ A;  3EYY A;  3VSL A;  2KPM A;  1HQC A;  2OJE D;  2QLZ A;  4DGW B;  4ENM A;  3MVP A;  1ZAR A;  1PUE E;  3HTS B;  4PGH A;  3RJP A;  5HLI A;  4Y7N J;  5DUI A;  4PSX A;  2J5O A;  4CHU A;  4EJU A;  1W7P D;  3F0C A;  2P6T A;  2FOK A;  4PCQ A;  2P5K A;  4LGW A;  3C2G A;  3K1N A;  3FXM A;  3UKG A;  1D8K A;  1ZLJ A;  3CCL I;  1LFP A;  1U78 A;  2B63 J;  3WGI A;  4UVC A;  4XR6 A;  1FBS A;  1SFE A;  3EUH C;  4XL9 A;  4HQE A;  2B9S A;  5D5V B;  1R4N B;  1T0F C;  4IX7 A;  4N9H A;  4B1R A;  4FQG A;  2XF7 A;  1KQ8 A;  2NS8 A;  4HOB A;  3MWM A;  4E7I A;  2E5Z A;  3IKV A;  2MC4 A;  2WAQ A;  3J81 K;  1I3A A;  3D5R C;  4D5C A;  1T2K A;  1ZRE A;  4WWC A;  1V54 H;  3TO6 A;  2ZME C;  3GFM A;  5LHI A;  1YW7 A;  2JQ7 A;  2RRE A;  2CGP A;  1OYW A;  1MBK A;  2ME0 A;  1ETQ A;  4IJA A;  3BG9 A;  2JMW A;  3K2A A;  2RNG A;  2ZFU A;  1XG1 A;  2O3F A;  2DA7 A;  1LVA A;  1BM9 A;  1WJ5 A;  1ZYR F;  2DA6 A;  4UHT A;  5GAG J;  4EVI A;  2DCE A;  2XC7 A;  5IT9 K;  2XUB A;  1S8N A;  2M8E A;  2ME6 A;  3DKW A;  1DGW Y;  5F1R A;  3B6A A;  1Y6I A;  3BZK A;  3RKX A;  1YFH A;  1HF0 A;  1P4A A;  1S3J A;  5IYB J;  2JWT A;  4FAS D;  1GDT A;  2GIV A;  4JX5 A;  3V8J A;  2XF6 A;  1FBQ A;  1X1B A;  2XB0 X;  2P7C B;  2HQN A;  1HA8 A;  4G9Y A;  4DYR A;  1ZRC A;  2E2I J;  3JAM K;  3KEY A;  1KU2 A;  2R5Z B;  4LOC A;  1QBJ A;  5CPR B;  4F55 A;  1WH7 A;  1T0F A;  3D1N I;  1ORK A;  4CXF A;  1JKO C;  1LE8 A;  1Z3Y A;  1P4X A;  1IDY A;  2LD5 A;  3E5Q A;  4ETS A;  5HNH A;  2Q2E B;  3K4M A;  2EIN H;  4Z2Y A;  2VKD A;  4A5N A;  4UV9 A;  1IJW C;  1D8J A;  2ZME A;  1X2N A;  2NNY A;  1ENH A;  1N75 A;  1BOA A;  2JRM A;  4RDU A;  1TQM A;  5E79 C;  2G0E A;  3CJT B;  2CSO A;  3K1P A;  2QYO A;  5GTI C;  1WKM A;  5K5R A;  1JKP C;  1OCT C;  1NH3 A;  4L5I A;  4CGZ A;  1TT5 B;  3ABU A;  2G7U A;  4BQO A;  5EG0 A;  3PUB A;  2LSO A;  2Y31 A;  3TDU C;  4CCO A;  2CS3 A;  1X1A A;  1RIO H;  2M4G A;  3D0S A;  3HRT A;  2GOX B;  3DF8 A;  3I59 A;  3SZT A;  3GUD A;  4ZDL A;  5L3B A;  3SEZ A;  2NXN B;  2Z3Y A;  4Q47 A;  2VIX A;  1O3R A;  3WTS C;  4E7Z A;  2K9Q A;  5HVQ C;  3QOP A;  1JJ6 C;  2W85 A;  4ASN A;  3ECH A;  1S7E A;  5BMZ A;  5CKT A;  1PVE A;  5EEA A;  2VBY A;  2Z16 A;  1MZB A;  1BR1 A;  2KIM A;  3BTC A;  3QPT A;  2K02 A;  1NHA A;  1DGR M;  3P9C A;  4UUS A;  1VQ9 I;  2IA1 A;  1QQI A;  1ULY A;  3LOC A;  3G6E I;  3S2W A;  2K40 A;  1IG7 A;  1HLV A;  4V2F A;  4WX9 A;  5IYC J;  2F6C A;  2DA5 A;  4U87 A;  1VI0 A;  4FX4 A;  4HSR A;  2FE3 A;  4HLY A;  3O6B B;  2A61 A;  4B8X A;  4BQQ A;  3KFW X;  2CW7 A;  4CYD A;  2JN6 A;  3M7G A;  2MW8 A;  3VFZ A;  2FEZ A;  2R7O A;  2MD5 A;  2E2H J;  2KMU A;  3R0A A;  1ZH5 A;  4H4K C;  1VND A;  3HSR A;  5DEQ A;  2F5F A;  3GVA A;  2Z5U A;  1R49 A;  3A0B C;  3GCM A;  5FD5 A;  2BY3 A;  1IN4 A;  4CUG A;  4NDL A;  4IRH A;  2R5Y B;  2TDX A;  5CVR A;  5KCM A;  2VE9 A;  3KE2 A;  1PP8 F;  1OFC X;  3R61 A;  3S3M A;  4IPA A;  4KT6 A;  1WZ2 A;  3HKZ N;  4G6Q A;  3ABM H;  1NTC A;  3OYL A;  2IBD A;  4XID A;  3CCE I;  2VT3 A;  2DLL A;  2R7Q A;  3H9Q A;  3OS1 A;  1KYZ A;  2QZ8 A;  3HTU A;  1VQO I;  5IP7 J;  2L9S A;  2LP0 A;  5FGM A;  1YE9 A;  5GAH J;  2R3S A;  3WTZ A;  3HB9 A;  3TED A;  3KP3 A;  3B73 A;  4BY7 J;  2R7R A;  2L02 A;  2EZH A;  2GA2 A;  2VKV A;  1KYW A;  3FK7 A;  3S93 A;  1Z1D A;  5EJC A;  3L7W A;  2XPV A;  3MKW B;  2NVQ J;  4AVP A;  3FWE A;  3ZCO A;  3K9T A;  4XKV A;  2P81 A;  4CA0 A;  3K4K A;  2CUE A;  3GLL A;  4QWQ A;  1BN5 A;  3JTG A;  2R93 J;  4BAC A;  2LRD A;  5KHD A;  3BTI A;  4F91 B;  3K1M A;  4FHT A;  5IOZ A;  2QA4 I;  5GAD J;  4P5O A;  1GT0 C;  2LLK A;  4K2E A;  3LNQ A;  1K78 A;  3OR2 C;  1H9G A;  1ODD A;  1R5G A;  2X6X A;  5HOO A;  2DT6 A;  4DNC A;  4ITV A;  4BUP A;  5JI6 A;  3ERE D;  1MBG A;  4MEY F;  1IRX A;  1ZEL A;  1SAN A;  2HVR A;  2K4B A;  3ABT A;  2DMQ A;  2VBZ A;  3CCM I;  2OU2 A;  1BI1 A;  5EEH A;  2PBI A;  3FXJ A;  1YJW I;  2VQC A;  2CW8 A;  3BG6 A;  1XMX A;  2A5Y B;  1QGP A;  4B43 A;  2WAD A;  2R5Z A;  2F48 A;  5HS7 A;  3OYC A;  1E2X A;  1Z67 A;  3CCY A;  4MFE A;  1I5Z A;  3SFZ A;  1LEA A;  3VYT B;  4HLX A;  3W2A A;  1Y1W J;  5FLM J;  5EZG A;  4XRS A;  1J09 A;  1R1U A;  2BVM A;  2HGC A;  3MN2 A;  1P7J A;  5M5W J;  3TQN A;  3DLL F;  2Y2Z A;  3FHZ A;  4A5M A;  1U2W A;  3VWB A;  3HEF A;  5D5U B;  4QTR A;  3AG4 H;  5JHF A;  2DN0 A;  4C2M J;  3QQA A;  1JJ8 C;  1AWC A;  3P7N A;  4B3A A;  3BPV A;  3G1O A;  2GZW A;  4XNF A;  2DTZ A;  3CP2 A;  1GVJ A;  2Y0M A;  3I53 A;  3T1B A;  2LKX A;  2XRN A;  3OYB A;  1MMN A;  3RKQ A;  5CQE A;  4ZYE A;  4JBA A;  1KZH A;  4F92 B;  5F0F A;  4M71 A;  3OYD A;  1UEL B;  3CDI A;  3M1E A;  1MSF C;  4AWX B;  4OMY A;  3PIP F;  3DEE A;  3HXL A;  5IPA A;  2PEX A;  4R1H A;  2K27 A;  2O6G E;  4MHG A;  3CLQ A;  2VOD A;  5FD6 A;  4KN7 X;  4ZJZ A;  1RKW A;  4M9Z A;  3L2R A;  2KLO A;  3F8B A;  1D0X A;  1XN7 A;  2H09 A;  4I2O A;  1SD7 A;  3V7S A;  2W24 A;  3RPU D;  4B4C A;  4JX6 A;  1YX5 A;  4X1E A;  3H3V K;  1G3S A;  5B3S H;  4M3D A;  3I4M J;  4XSX F;  3DTI A;  4OWR B;  5ICC A;  1TWC J;  3UR3 C;  2HFH A;  2XAU A;  4I98 B;  2PJR B;  4YFN F;  4E4H A;  2EK5 A;  3F8N A;  4C3H J;  2DT7 B;  1J5Y A;  1T39 A;  4A69 C;  5D5W B;  3JRB A;  3GWZ A;  2AXT C;  3I55 I;  3TP3 A;  1TNS A;  2KRC A;  3TMO A;  3UNG C;  4AYB N;  3OYG A;  4RMN A;  1BBY A;  3AL0 B;  2M34 A;  3QAH A;  4CSW A;  2IGN A;  3SYT A;  3FX3 A;  3K4B A;  1YHQ I;  1ON1 A;  1QO0 D;  5GPA A;  3OIP A;  1TQI A;  5F6F A;  4OMZ A;  2R92 J;  2IGK A;  3BC8 A;  3NAR A;  3OOP A;  4HPQ A;  4PDK A;  4C3J J;  4U0Y A;  4HF0 A;  2Z9O A;  4A3B J;  5ILU A;  2I10 A;  4YEJ A;  3Q0V A;  4A93 J;  2WC2 A;  5M3M J;  5E8I A;  2Q0O A;  1BJA A;  3X2Q H;  1OKR A;  2ELK A;  3L2Q A;  1PYV A;  3BRO A;  5H6Q A;  1FP2 A;  2CMP A;  2JVH A;  1G6N A;  4Z6Y A;  2ZXH A;  3MEX A;  5F1J A;  4EEF G;  3GZN B;  5DM6 F;  1SFU A;  2VUM J;  1LFU P;  1MBF A;  2JSP A;  1Y8Q B;  2P7V B;  3R6S A;  3JCU C;  2XKP A;  2CU7 A;  2LVS A;  4KNY A;  3FHN A;  1Q1V A;  5E3N A;  2EJR A;  3DLA A;  3ZQF A;  4MTD A;  4KT5 C;  2CV0 A;  2H6B A;  1XGO A;  1QHG A;  3WU2 C;  1ZG1 A;  1IDZ A;  2V9K A;  1OYI A;  1T6S A;  2UWM A;  5CVV A;  4P1W A;  5IYD J;  4BDZ A;  3GTO J;  2H1L A;  2EV6 A;  1JT0 A;  2BYV E;  1FJL A;  2OA4 A;  3S17 J;  2GXG A;  1UG0 A;  1RET A;  3CCU I;  5L3E A;  1YRN A;  2ISZ A;  4X0G A;  1F1Z A;  3L2C A;  3HHG A;  3QU6 A;  2PLY A;  2HTJ A;  2X1C A;  3LAJ A;  1YO5 C;  3ZMT A;  1X3U A;  2PX9 A;  1K4T A;  4LD5 A;  3V42 A;  1DP7 P;  4E7H A;  4XN3 A;  3H5N A;  1X1C A;  1Z6R A;  5JLW A;  1EH7 A;  1BL0 A;  2E1M C;  3KZY A;  2WAF A;  2OTJ I;  4TV7 A;  2A6T A;  3IRQ A;  3PO3 J;  4BQN A;  4R8H A;  3U21 A;  2VBX A;  2JRT A;  3R4K A;  3HUG A;  3ISP A;  2KRF A;  3P5J A;  3QRF F;  2M8G X;  3BCB A;  2OQR A;  2O03 A;  1RPW A;  2IEK A;  3PJR A;  4EM2 A;  3PO2 J;  1IRZ A;  4UB6 C;  3J7Z I;  4A3E J;  2R7V A;  3BQY A;  2HPI A;  2QKM B;  3FIS A;  1ETK A;  3DTK A;  3P9I A;  5JLX A;  1KQ0 A;  3F6O A;  1I6X A;  2UXX A;  1ETX A;  1R36 A;  1R1V A;  1TWA J;  2CQX A;  2KL4 A;  2ZNY A;  4BHB A;  5HNF A;  1O7F A;  2X4H A;  3U1K A;  1SMT A;  4AC0 A;  2V6C A;  3SZG A;  3FK6 A;  5FFZ A;  4DBR A;  3RZO J;  1I1G A;  1MIJ A;  4MLO A;  1WJF A;  3LAP A;  4Y33 A;  3TO7 A;  2GBY A;  1D0Y A;  1W36 D;  2V1D A;  5DM7 F;  5B1A H;  3E97 A;  3VOD A;  1QPM A;  3R0J A;  5F08 A;  4AU7 A;  4ZYH A;  1TZL A;  3K69 A;  4PJN A;  4CZC A;  2JA2 A;  3PNV A;  1G59 A;  2AS5 F;  4BJ6 C;  4G6T B;  4GCV A;  2YUS A;  1NK3 P;  4KN4 X;  2VPL A;  1JXS A;  1IRF A;  2JPC A;  2IGM A;  1LE8 B;  1XSX A;  3PM1 A;  2VLA A;  3CDL A;  4O6J A;  1G3T A;  1IV8 A;  3G1M A;  4HF2 A;  3LSP A;  2XF5 A;  3IAM 2;  4JK1 X;  1SFK A;  1X1D A;  2OD5 A;  3PQJ A;  2ZME B;  4MGR A;  4L0Z B;  2CJJ A;  3TBI A;  2CG4 A;  4RAG A;  2DK8 A;  3W6J B;  3HPH A;  2DA4 A;  3ML6 A;  3F22 A;  2WAE A;  3WTW C;  1MMG A;  1RR7 A;  5BS6 A;  1JHH A;  2GAU A;  4MFD A;  2L4A A;  2ZKZ A;  3I4P A;  3BQZ A;  4YIR X;  3KLN A;  3DP7 A;  2H27 A;  2VC1 A;  3RPQ A;  1O3T A;  1YLF A;  2QQ9 A;  3T0Y A;  4D7N A;  2IXS A;  3I59 B;  5F04 A;  4KIS A;  3TGN A;  4CCJ A;  2DI3 A;  4AD9 A;  1T8I A;  2GIZ A;  2R7U A;  5J3L A;  3J7A O;  1ETY A;  2E1O A;  1OMI A;  3DPL C;  2XB5 A;  4AIK A;  4HW0 A;  4C2T A;  3E0J B;  2QBY A;  3F23 A;  2BY2 A;  2PQ8 A;  1E3P A;  4Y17 A;  2E19 A;  3RSN A;  3E5U A;  1U3E M;  2XAH A;  3BZ6 A;  4UUS B;  3HSE A;  2MLG A;  2E34 A;  3VEP A;  1V5E A;  2ZJP F;  3PQK A;  4DZP A;  3Q5F A;  3E6D A;  3WOD F;  1GLN A;  4BBR J;  2RN7 A;  3IWZ A;  1VQ7 I;  4D1Q A;  1ZG3 A;  2CUJ A;  3GXO A;  3CCJ I;  2RVC A;  1DPU A;  5CVU A;  1ZRD A;  4E7L A;  2TRT A;  1LKX A;  4A3K J;  4G7H F;  3ZMZ A;  4XKB A;  3GLX A;  4M3B A;  5J1R A;  1MGT A;  4BE2 A;  3B6C A;  3Q3S A;  1K4S A;  1MMS A;  1YJ9 I;  1VQ6 I;  1X3W B;  5FLX Z;  5E3L A;  3CO7 C;  2ZXW H;  2VJJ A;  2OBP A;  3CF2 A;  3SEQ A;  2VT2 A;  3PSF A;  3I64 A;  3K0L A;  4NBQ A;  3AKZ A;  1IUF A;  3SXY A;  3OL3 A;  2IPQ X;  2HOT A;  1R23 A;  1FY7 A;  5FO5 A;  1SC7 A;  2L3D A;  2EIK H;  1XB4 A;  3OR1 C;  2HKO A;  5JVG F;  2M2E A;  3L00 A;  2BVL A;  1ZQ3 P;  2BY0 A;  3DU5 A;  1E3O C;  4CIC A;  3C2B A;  3SQN A;  2FUG 2;  3FXK A;  3HSF A;  3CTA A;  1MMA A;  2ID6 A;  3HKZ A;  3GTM J;  3BR5 A;  2VKE A;  2KT0 A;  1RZ4 A;  2Z99 A;  4BS9 A;  4W97 A;  3QOE A;  3E7L A;  3LSK A;  3SDG A;  4XRF A;  2UXN A;  3HBL A;  4KIT B;  1WFX A;  4DIQ A;  1W5C C;  5DD8 A;  2N8G A;  3LSG A;  1W0T A;  3KZZ A;  2GXA A;  4IXA A;  3A01 B;  4HNU A;  4A3L J;  2KJC A;  3IP4 B;  3W2W A;  2B7E A;  2AQE A;  5AIP A;  3Q9V A;  1JUS A;  2XSD C;  1U5T C;  1OJL A;  1UMQ A;  4AID A;  2D1V A;  3NWT A;  1J75 A;  2P6S A;  4D7M A;  5E1W A;  4ZZD A;  1Z77 A;  5E3O A;  3GFJ A;  1MSE C;  1K78 B;  4A3G J;  4LIU A;  2DOE A;  2K85 A;  1Z6T A;  3K6G A;  5KAF C;  1V55 H;  1WSU A;  3JRF A;  2FA5 A;  3OL4 A;  3CMM A;  2MA3 A;  1FYM A;  3HOZ J;  4MNU A;  3AG1 H;  2PI0 A;  3QP6 A;  4F52 A;  1G3W A;  4X6A J;  3ASO H;  4E70 A;  4XKC A;  2KIQ A;  1F43 A;  2FF4 A;  1BI0 A;  2ZJQ F;  3EUH A;  3HZJ A;  1MNM C;  1Z7U A;  1R5I D;  2NS7 A;  2P5V A;  3CLO A;  5ICE A;  2FD5 A;  4FIS A;  4MO7 A;  3MKY B;  1L0O C;  4M3G A;  4UV8 A;  2FQ4 A;  2D1H A;  2RDP A;  2DXI A;  3KP7 A;  2YPR A;  2BXZ A;  3OMY A;  4ESJ A;  5FKO A;  3O8H A;  2A68 F;  2NVU B;  4Y13 A;  3FM5 A;  1ZR2 A;  1U5T A;  4LFU A;  3HGY A;  4U7D A;  2M1B A;  3H36 A;  4PZJ A;  2V7F A;  4RAF A;  4GXO A;  1Z3X A;  3CJR B;  4I0B A;  1XSV A;  2ECC A;  1W0U A;  2KIF A;  2F5C A;  4I02 A;  3M4O J;  1ZGJ A;  2UV1 A;  4Q5S F;  4JX4 A;  2RKH A;  3BT9 A;  2IP2 A;  3BR6 A;  2LR8 A;  2DFH A;  1VZ0 A;  3DFG A;  3BR2 A;  4EMS A;  2VPR A;  2K9L A;  1FT9 A;  2VXZ A;  2BXY A;  1XX5 A;  4XLF A;  1UAA A;  1WJB A;  3QP5 A;  3JRD A;  2HTS A;  4IHS A;  2VBW A;  5TJJ A;  1WQ2 A;  1JKR C;  4A3M J;  4HNV A;  3JSO A;  5E17 F;  2GOM A;  2KP6 A;  1D1A A;  3CUQ C;  4ZC3 A;  1R58 A;  5HDG A;  1FOK A;  2JA6 J;  2COM A;  2A69 F;  2ZBK A;  2ESH A;  2UZK A;  5BPI A;  4ZDP A;  2ZFW A;  2E60 A;  3LWF A;  4YIF A;  3OYF A;  2BEO A;  3V4G A;  4IHW A;  1XMK A;  1ETO A;  1T08 B;  2HDW A;  2XGX A;  3HOT A;  2X1D A;  4BU2 A;  4I6Z A;  2HVS A;  2DQL A;  1XPX A;  4DZJ A;  2K9N A;  1YJN I;  1JI8 A;  1BI2 A;  3ZP5 A;  5IY5 H;  3RPU A;  2QUF A;  5LHG A;  3F6V A;  1J59 A;  1FTT A;  1FC3 A;  2DYR H;  3ECO A;  2AQF A;  2CYY A;  2F4I A;  4HG2 A;  5J47 A;  1JGG A;  2V79 A;  2FU4 A;  3LL7 A;  4EJV A;  1TLH B;  4HX7 A;  1F5T A;  4BH9 A;  5IP6 A;  3ZN0 A;  5J8F A;  1YQA A;  2OAZ A;  4UUT A;  3AAF A;  1JUP A;  3CJN A;  1IXC A;  3FKJ A;  3LFK A;  2NRA C;  4JQF A;  3V8K A;  1YIO A;  3T5X A;  3A0H C;  1UFM A;  3ONQ A;  4AYB A;  4FE4 A;  4A0Z A;  5C3E J;  3ZR8 X;  4LLL A;  1DU0 A;  4IKF A;  5E1X A;  4IHY A;  1S6L A;  3LA3 A;  1SAU A;  2KKO A;  1OIS A;  2F4M B;  3CUQ A;  1ZN2 A;  4IQJ A;  1MD0 A;  2EH3 A;  3EDP A;  2LC2 A;  3KLO A;  4OIQ F;  4DQ2 A;  2E1N A;  4XN0 A;  3PFI A;  1U8B A;  2HYF A;  3QYB A;  3FXO A;  3AG3 H;  5BQT A;  3J80 Z;  1EKE A;  1Y0U A;  5EYR A;  2HYG D;  2KIU A;  1QZY A;  3VSK A;  1C0W A;  2ID3 A;  5D5X B;  1B59 A;  4RB0 A;  2ZXI A;  5D4R A;  1WJA A;  3IH3 A;  4FT8 A;  4BY1 J;  5AON A;  3HG9 A;  3BJA A;  1B72 A;  2K7L A;  2QF7 A;  2E36 A;  3ABL H;  3OYI A;  1KU9 A;  2XAF A;  2Y9Z A;  2VXD A;  4AUX A;  3A01 A;  3BY6 A;  2DFE A;  2PMU A;  1MNE A;  3KEQ A;  1YRN B;  4XRM A;  1ACI A;  1OCR H;  1H9T A;  5J40 A;  2F2E A;  2M45 A;  1K6O A;  1IZ1 A;  1JE8 A;  3CC2 I;  5BOX A;  4MQV A;  1EA3 A;  4ENJ A;  2BOL A;  3A02 A;  1ZTR A;  3FDY A;  5K5Q A;  3DU6 A;  1SFX A;  1ERD A;  3H1C A;  2I5U A;  4EAT A;  3BG7 A;  2Y75 A;  3CUO A;  3E6B A;  3KX2 A;  4BHP A;  2O8X A;  5M5X J;  3QWL A;  1FYL A;  1W7P B;  1W36 C;  1Y8R B;  3HUG B;  2CFO A;  2HQ5 A;  3ELK A;  1DU6 A;  1WGX A;  3W3C A;  1HC8 A;  1VQL I;  3F8M A;  3OWT A;  2EIL H;  3ZMU A;  1T98 A;  3RCO A;  2EZK A;  4KIG A;  2VAS A;  2YR2 A;  2OF7 A;  4OIN F;  5J1Y A;  5LRS A;  2ACJ A;  2DDB A;  1R71 A;  3H9J A;  3TW6 A;  4RM2 A;  3GTJ J;  2L9V A;  2H8R A;  3H0D A;  2DMP A;  2FOW A;  2P0W A;  3ZN1 A;  2RNJ A;  5KAI C;  1HXD A;  4C3I J;  2M87 A;  2X6W A;  3ZPL A;  5K7H A;  4IHT A;  1BJZ A;  4HX8 A;  3WTX C;  1EH8 A;  1U0J A;  4BDY A;  4XSZ F;  4Y3O A;  2EFO A;  1ZR4 A;  4BGD A;  4CO8 A;  5DD4 A;  3HIF A;  2EWN A;  3H5R A;  2V1X A;  1WHU A;  4MIM A;  5J1U A;  4GYI A;  2E35 A;  1YI2 I;  2Q1Z B;  4WCG A;  2L4M A;  1GUU A;  1DQU A;  5FFX A;  3FIW A;  4F3Q A;  2E1M B;  4HAM A;  3KEO A;  2DPU A;  2VB6 A;  3EQL F;  1MND A;  1AKH A;  3DKY A;  4XKW A;  1LDK B;  3AG2 H;  1BC7 C;  3KYD B;  1OPC A;  3C7J A;  2ZCW A;  3PFY A;  1MJA A;  5GTH C;  1FOX A;  4XBF A;  2QGU A;  2Z1D A;  2V6E A;  3I0T A;  1FZP B;  2QSG X;  1K83 J;  5FRN A;  3KZI C;  3FXQ A;  1OCO H;  1ETW A;  3QPL A;  2DA1 A;  4M6V A;  5D8K B;  5HS8 A;  3PNY A;  1HKQ A;  2DBB A;  4RAZ A;  2YS9 A;  3HOW J;  4ZTJ A;  4N4N B;  3Q0W A;  4EM1 A;  1RR8 C;  3CES A;  2MAB A;  2AXL A;  5GPC A;  1T56 A;  4JP0 A;  4BE1 A;  4C2U A;  5J6X A;  1IV6 A;  2HEO A;  2HKX A;  2V9V A;  4KJZ A;  3FBN B;  4ZYD A;  4II2 A;  3CJQ B;  5A2Q Z;  4WK8 F;  2O8K A;  1IXS B;  4EM0 B;  3ERM A;  4P55 A;  4UXN A;  2MLK A;  2VI6 A;  9ANT A;  5D6E A;  2QBY B;  3HJE A;  3ZQ7 A;  4AIJ A;  2JPB A;  2WA0 A;  3OYE A;  2BBY A;  1FP1 D;  1S72 I;  3HOS A;  2QQ8 A;  2FRH A;  4WXD A;  3ZQI A;  2V4J C;  2PG4 A;  2LMD A;  1UZC A;  1P7I A;  2E1C A;  1LDD A;  3TL4 X;  4HZF A;  1FTZ A;  4LIT A;  2GXB A;  1NK2 P;  2IT0 A;  2ZJ2 A;  4ZH4 F;  1H0M A;  1MBE A;  2HU9 A;  2MSY A;  1IRG A;  2W1O A;  1MJB A;  3T8R A;  1WVR A;  4IQ4 A;  2OPT A;  3F72 A;  2VJ4 A;  5K7Z A;  4C9Y A;  5LLQ A;  2JVG A;  4N9I A;  4GO1 A;  3QYF A;  4CCL A;  4MQ9 F;  3OIQ A;  3F9K A;  3M07 A;  1K7A A;  3IWF A;  3GW2 A;  3SZP A;  3OYA A;  4DYC A;  5TRD A;  3I5U A;  1F36 A;  1CGP A;  2X0L A;  2BW3 A;  2KJB A;  2KZV A;  2LBF B;  3WE3 A;  4LG0 A;  3CD6 I;  2R7T A;  2Y30 A;  4BEH A;  2DU9 A;  3CMY A;  1PP7 U;  3JSP A;  5FRM A;  3ULQ B;  3BZC A;  3HOV J;  1HBX G;  2JTV A;  4IVN A;  4NHJ A;  1IUY A;  2DO7 A;  4OAZ A;  3ZMD A;  1JTY A;  4NB5 A;  5AIQ A;  1GV2 A;  1E17 A;  4AIH A;  2JZY A;  3M3Y J;  4JYK A;  3G4S I;  3MKZ A;  2KHM A;  4BQA A;  3WU0 A;  1RI7 A;  4A0Y A;  4BJ5 C;  2RQP A;  2O61 A;  3O2P E;  4IL6 C;  4YEL A;  4N0B A;  2DTR A;  3GF2 A;  2L7M P;  3JRI A;  4UUV A;  4RGS A;  5LD2 C;  2UUZ A;  3S3N A;  1BI3 A;  2VN2 A;  3NQO A;  1GXP A;  2HZD A;  3KP6 A;  4ZDO A;  2H94 A;  5CVI A;  1YIT I;  3CMA I;  3LSI A;  1AU7 A;  5ICF A;  4MTE A;  1XDU A;  4AM3 A;  1B8I A;  2DYS H;  2BV6 A;  5K1Y A;  1W7P A;  3FMQ A;  4EQQ A;  1YW8 A;  2MGQ A;  3ZMS A;  2LKP A;  1LJ9 A;  2NVY J;  5EZH A;  3TO9 A;  3NWS A;  5K7F A;  1FEX A;  2EV5 A;  1KGS A;  4IRI A;  4LLG F;  1HKS A;  1LUJ B;  2HNH A;  4XIC A;  3QPH A;  2K9M A;  1G2H A;  4BL0 B;  2HXI A;  1O57 A;  2EFN A;  1P2F A;  2ZNZ A;  1UST A;  2OQG A;  3M1C A;  1B6A A;  3ZMV A;  4DYQ A;  3GTG J;  1FPQ A;  3V7R A;  4EJO A;  1Y0N A;  1R00 A;  4L18 B;  3JRE A;  2GM4 A;  1IN5 A;  4II3 A;  5FRO A;  2EFQ A;  1XCB A;  3BG3 A;  1MH3 A;  4P96 A;  2MH9 A;  4RA2 A;  2KDO A;  5EF6 A;  4M9X A;  4HV6 A;  3DWL E;  1J0R A;  5FKL A;  3TOA A;  1GHC A;  4KYW A;  2L2O A;  3AFH A;  3J81 Z;  4CCM A;  5LFA A;  2PMZ N;  1MDM A;  3DPU A;  1NG6 A;  3ZQG A;  3N05 A;  2EIJ H;  4Q48 A;  5JR3 A;  2Q8K A;  3HC7 A;  2OZU A;  5DCF A;  1WCM J;  2YSR A;  4HV5 A;  2M5W A;  2XHK A;  3JTH A;  3RDI A;  1U5T B;  1G4D A;  1ZRF A;  3S2H J;  3F3X A;  1LDJ A;  2M0C A;  2D2W A;  2L5Q A;  3KPH A;  2KZG A;  4IHX A;  3BR0 A;  1PJR A;  1S29 A;  2R7W A;  2R7S A;  2STT A;  5IT9 Z;  2QEX I;  5ED4 A;  1EV7 A;  4XRS G;  1MBJ A;  4A0X A;  3KIO A;  1TQP A;  2LF8 A;  4HQM A;  3EET A;  3LA7 A;  5GP9 A;  4RB3 C;  2F5E A;  4FCY A;  2JA5 J;  2OTL I;  2M0M A;  3WTT C;  4ENN A;  4OAY A;  4ANJ A;  3EYI A;  1YX3 A;  2OV7 A;  3K4N A;  4L9V A;  1FOY A;  4GRI A;  2EA2 A;  3ROU A;  3JAM Z;  2GLO A;  4BBS J;  1I27 A;  3GME A;  4EV0 A;  1HDD C;  4A3J J;  2FBK A;  2E2J J;  4A3F J;  2P8T A;  2LK2 A;  2XRL A;  1S7A A;  1E3H A;  1UHS A;  4JOM A;  2FNA A;  2YU9 J;  3VYU B;  4M74 A;  4XLE A;  5DUK A;  1OCP A;  1HSJ A;  1WI3 A;  4YII A;  2FSW A;  2XVC A;  3D5L A;  1X58 A;  4O5V A;  5GAE J;  4DOZ A;  4MEX F;  1GV5 A;  1W5S A;  4V2G A;  1R1T A;  3CC4 I;  2PMH A;  3C1D A;  3BG5 A;  5LEK A;  4YFK F;  4J00 A;  2ZC2 A;  2CV2 A;  2XRO A;  4FTH A;  2JA7 J;  3Q0U A;  1TC3 C;  4CCK A;  2STW A;  2FQ3 A;  2CQ7 A;  5B66 C;  1D3Y A;  2Y69 H;  5TGT A;  2IRF G;  1DP3 A;  1WJE A;  2DPD A;  3MAJ A;  3MZ8 A;  4D5F A;  3H0G J;  1F9N A;  3GTL J;  2JK3 A;  3G73 A;  2G9W A;  2JA8 J;  4PJJ A;  5C4X J;  1IF1 A;  3OY9 A;  2NOG A;  5DYM A;  4BHC A;  4S04 A;  3BJO A;  1I50 J;  4XLH A;  1YS7 A;  2LBF A;  3FKI J;  2ZXJ A;  2JT1 A;  1MJ9 A;  2Y48 A;  4A6D A;  4F93 B;  4L0Y B;  1XD7 A;  4OU0 A;  4LK0 F;  5LGT A;  2FBH A;  2M9H A;  1T33 A;  3EUK L;  3H5A A;  3U9G A;  4Q4Z F;  2EPF A;  4RGU A;  2DMN A;  3EUA A;  4NUB A;  1JKQ C;  2IS6 A;  1ZG5 A;  4M72 A;  3L1P A;  3L2U A;  1VQ5 I;  4S05 A;  2IW5 A;  3GZ6 A;  2DDA A;  1HOM A;  3CQZ J;  3VB2 A;  2XPW A;  1ZHF A;  1FMW A;  4WF2 A;  2EV0 A;  4N4O B;  2X6Y A;  1B9N A;  5L3D A;  2LY1 A;  2IS2 A;  3CUQ B;  4LK1 F;  3KYL A;  3RI4 A;  5LGN A;  4L9N A;  4WXH A;  4BNC A;  1UHW A;  4KFC A;  1W4M A;  5HS9 A;  4RM3 A;  5J4V A;  2O7O A;  4GFB A;  4XON A;  2ZSH B;  3OOU A;  4D9J A;  3I54 A;  3IC7 A;  3Q9S A;  2W84 A;  5E18 F;  2CUZ A;  3FXL A;  4ENK A;  3WGG A;  2L7K A;  3HHH A;  1FBU A;  4BXU A;  1JT6 A;  2YX4 A;  3LST A;  2P5L C;  4LJZ F;  1B1B A;  3GYH X;  3P9K A;  1YS6 A;  2ELH A;  1B72 B;  2DOD A;  4UVB A;  2VQG A;  3B02 A;  4ESF A;  3IRR A;  1D1C A;  1D0Z A;  4G6D A;  4HNT A;  2RAE A;  3DBL B;  1TBX A;  3GFI A;  3GTK J;  4OOI A;  4QIW N;  4XMY A;  4E7J A;  3GTP J;  1IC8 A;  2CWE A;  2QSH X;  4EJW A;  5HLH A;  5KK1 A;  5HOD A;  3CME I;  3IHU A;  5EDN A;  2L54 A;  4CH7 A;  2V1N A;  4NC8 A;  2NVT J;  3PIO F;  1ZGA A;  1G8X A;  2KFD A;  5IT3 A;  2HVQ A;  2Y0S N;  3HRS A;  1BA5 A;  1EF4 A;  2CH0 A;  2LY2 A;  2XAJ A;  4A6E A;  1X4O A;  2H8W A;  1OYY A;  2GWR A;  1Y56 A;  2CFX A;  5FKN A;  2HXO A;  1Y39 A;  1DPR A;  2NNN A;  3J7Y J;  2HZT A;  3LSR A;  3RQI A;  1PDN C;  2EZL A;  2DFF A;  1CF7 A;  5BPD A;  1G3Y A;  4M9S A;  1YW9 A;  4WXC A;  5L3C A;  2FBI A;  1P4W A;  4IOC F;  2TCT A;  4PJL A;  2L0K A;  3JRH A;  3RZD J;  4A3I J;  1RNL A;  2ESN A;  4OIO F;  3FBI B;  3MKL A;  2ETH A;  2K86 A;  2V1U A;  2HI3 A;  2QCO A;  4ON0 A;  1O4X A;  1ONV A;  2W00 A;  1O3S A;  2IA0 A;  3MZY A;  3A1Y A;  2E5N A;  1YYV A;  3FXU A;  2LH9 A;  2VJ5 A;  4IRG A;  2FX0 A;  3CF5 F;  3ZQC A;  3MFK A;  3WTV C;  2A5W A;  4GGG A;  2XSJ C;  1TW3 A;  1H89 C;  5FKM A;  4PFP A;  5DCM A;  1CQT A;  2ICW G;  1BIA A;  3OS2 A;  4U7B A;  3ZQH A;  4S0H B;  3ESW B;  2WB1 N;  4IEJ A;  2WY7 Q;  4HDU A;  1A5J A;  3KP5 A;  3MQ0 A;  4HDV A;  1I1S A;  2QQA A;  1QA6 A;  2EBI A;  2WWY A;  1UG2 A;  4B3X A;  3WTY C;  1X1P A;  5HLG A;  4LLN A;  3H35 A;  1EJ9 A;  2QQB A;  1UJ8 A;  3FXR A;  1T38 A;  5H6R A;  2E7W A;  4UVA A;  3LSM A;  4HST A;  5J8C A;  4RB1 A;  2ZSI B;  3ZGK A;  4BYY A;  1TWF J;  1AKH B;  1ITY A;  4NQW B;  2EFP A;  1D5V A;  5ERI A;  1B4A A;  3HRM A;  1MMD A;  4G7Z F;  1J2X A;  4GYG A;  3LQQ A;  3RYP A;  2HS5 A;  3RKW A;  5B5E C;  1M1E B;  2HOA A;  1YTY A;  1QVT A;  5LRR A;  3O8G A;  2BE5 F;  2KQR A;  3PSI A;  2G7H A;  2PN6 A;  1LEB A;  2HQR A;  3IV5 A;  2DJN A;  2IVM A;  2LDU A;  1LPQ A;  3W6K B;  3WGH A;  2WTE A;  1X19 A;  3W6V A;  4O3M A;  4NC7 A;  1PUF A;  3CCS I;  4EGY A;  2RV8 A;  1WI9 A;  3DXJ F;  2CQN A;  2L01 A;  3QU3 A;  1F4K A;  1W1W E;  3OIO A;  3R60 A;  5FLX K;  3I58 A;  2KIS A;  2FXA A;  1YOV B;  1SD5 A;  4XK4 A;  3IUO A;  1RES A;  5BNG A;  2NAZ A;  1FIP A;  4XOR A;  4L5J A;  4I09 A;  5C44 J;  2IJL A;  1WH5 A;  1ON2 A;  5IP9 J;  1XTA A;  4NC6 A;  3IKT A;  2DJI A;  3BJ6 A;  3K4C A;  3PL8 A;  2HWV A;  1BR2 A;  4XLC A;  4PSW A;  4QPO A;  1VTN C;  3CZ6 A;  1WWX A;  2X1E A;  2BZT A;  3DKX A;  3DEW A;  4HBL A;  3IH4 A;  3SHF A;  2LOO A;  3OV8 A;  3RTR A;  5EGO A;  1WJC A;  4LB5 A;  2OCC H;  3E5X A;  2QKL B;  1R5H A;  4ZYG A;  2M7B A;  1HST A;  3GZ5 A;  4QSH A;  5KVR A;  1XCV A;  4FX0 A;  2L7Z A;  3HM5 A;  4M3E A;  4XOT A;  5FJ8 J;  4L9J A;  1KQ9 A;  4XQF A;  2XKO A;  1KA8 A;  1TWH J;  1QU3 A;  5LEJ A;  4Y4R A;  2BW3 B;  4IOA F;  1X3Z B;  4LG0 B;  1Z21 A;  1AA7 A;  2LTP A;  1QNT A;  3HRU A;  4BEH B;  1S7O A;  4NNJ A;  4OIP F;  5F27 A;  2ECB A;  2K4J A;  4P9F A;  1VFC A;  1MKM A;  1IN8 A;  2FJ1 A;  2YU3 A;  3HGG A;  4U88 A;  1S9H A;  2R0Q C;  2K3P A;  3CP8 A;  2MFZ A;  4RGR A;  1JHF A;  4BE0 A;  1OQY A;  1R9T J;  1IN7 A;  2MH2 A;  4U0V A;  1TW2 A;  2DAO A;  2OC6 A;  2X51 A;  2R4G A;  2AHQ A;  1OLT A;  2WAQ N;  2XAS A;  3MZH A;  1DUX C;  1W5T A;  1KU3 A;  1SMY F;  1OR7 C;  1K6Y A;  2LNB A;  1XMA A;  2F5D A;  2HR3 A;  3JRC A;  3K70 D;  2DQR A;  4KIC A;  1Q1H A;  2YX7 A;  4B47 A;  4ABZ A;  4Y52 J;  2K9S A;  5LGU A;  5HLT A;  1WPK A;  3MCZ A;  3OYN A;  3V7C A;  3OSF A;  4I7H A;  3BCA A;  3ZXS A;  2R7D A;  2OZ6 A;  2HDC A;  5E20 A;  1B8I B;  3K10 A;  1HDP A;  3L2W A;  2LKS A;  1VF9 A;  2EZI A;  3RKY A;  1RC9 A;  1I39 A;  2VE8 A;  1QVU A;  2L7F P;  4ZYA A;  3L9F A;  5FLV A;  3DEU A;  2HOS A;  2DW4 A;  3CCQ I;  4EJT A;  4PJM A;  2VKH A;  4HX4 A;  1SEU A;  3S16 J;  2WV1 A;  1UCR A;  1XGS A;  1S5L C;  2L9R A;  3G2B A;  3KCC A;  3LSH A;  4I0A A;  1J9I A;  2C6Y A;  1XC5 A;  2LF7 A;  5D4S A;  4KIF A;  3JR9 A;  1WJD A;  2WV0 A;  2BHZ A;  2RQQ A;  1REP C;  4BXX J;  3BP8 A;  3RQ4 A;  4KMU X;  2COB A;  2H6C A;  4BAY A;  3TOB A;  3GTQ J;  3F8F A;  1USS A;  2DMT A;  1NG7 A;  2DA3 A;  3GBG A;  1WRJ A;  2WY8 Q;  4XLN F;  4G12 A;  3OS0 A;  3LQR A;  3E3V A;  3G71 I;  4EGZ A;  3HOY J;  3OYM A;  1OR7 A; 
#chains in the Genus database with same CATH homology
 2R7F A;  1B9M A;  2GA1 A;  5CVJ A;  1LQ1 A;  1AOY A;  2ISY A;  2ZO4 A;  1O7L A;  2Q2E A;  1HKT A;  1A04 A;  1O3Q A;  1J7K A;  1XSD A;  2XV4 S;  1Z05 A;  2JSC A;  4QLC U;  4NQW A;  3I71 A;  1MDM B;  5K5O A;  3H3Z A;  1FNN A;  1LB2 A;  2EB7 A;  3CO6 C;  5ILV A;  1JGS A;  4M6Y A;  4HA8 A;  3WTU C;  4PGG A;  1BC8 C;  2DK5 A;  4L9T A;  3GO5 A;  2FNP A;  1Z91 A;  3GEZ A;  1ZLK A;  1P6R A;  5E1Z B;  1U6G A;  3V8L A;  3JW4 A;  1IN6 A;  3FMR A;  5JFR A;  4IF4 A;  1STZ A;  1K79 A;  1FX7 A;  4HYE A;  5E8G A;  2W57 A;  5JHU A;  4U0W A;  5LHH A;  3KP2 A;  3J80 K;  5ICG A;  4D0P A;  1TTY A;  3NEU A;  4RS8 A;  3NRV A;  2QEN A;  2DT5 A;  1XGN A;  2B0L A;  1RUN A;  4YG2 F;  2E7X A;  3DPT A;  1FWZ A;  3HYI A;  2NYX A;  1XGM A;  3IL2 A;  1LNW A;  2Z33 A;  1FSE A;  1FSH A;  3M8E A;  2MBF A;  2RGV A;  4KUM A;  3GX4 X;  5H20 A;  3E6M A;  3H92 A;  2A07 F;  2DFI A;  2XAG A;  3WG9 A;  1V3F A;  2NS0 A;  4HF1 A;  3E6C C;  4KMF A;  4RGX A;  1SD4 A;  1TNT A;  2VOO A;  5L3G A;  6PAX A;  2CQK A;  1GXQ A;  3BOQ A;  1R22 A;  1HW2 A;  4KIB A;  1IAW A;  5DDG A;  4A12 A;  5F64 A;  1HW1 A;  3FF5 A;  2A6E F;  3WE2 A;  2XIG A;  2M30 A;  1BIB A;  3KP4 A;  2QVO A;  1FYK A;  3U2R A;  3CDH A;  1FLI A;  3M9A A;  5L3F A;  1L3L A;  1KU7 A;  1XDS A;  1ZAO A;  2BGC A;  1UB9 A;  3COA C;  4KA4 A;  3LA2 A;  4KDP A;  3FMS A;  3C18 A;  3TDZ C;  3GFL A;  4B09 A;  5JVT A;  3KET A;  1U8R A;  4M6X A;  2W25 A;  1CF7 B;  2A3S A;  2FML A;  1R7J A;  2VOP A;  2J5P A;  4RB2 C;  4P9U A;  3BDD A;  3H3U A;  2XAQ A;  3C3W A;  2A6H F;  3DV8 A;  3L09 A;  4OIR F;  5D6F A;  1YG2 A;  3O3K A;  3K2Z A;  2VC0 A;  4UNO A;  5A2Q K;  5DCM B;  3N97 A;  4ZZL A;  2P4W A;  2QWW A;  4CDG A;  2D45 A;  4LMY A;  4G8X A;  4F7Z A;  5EEG A;  1IW7 F;  2CW0 F;  1RUO A;  2FMY A;  3FZV A;  2VON A;  2O0Y A;  4M73 A;  3RIR A;  2PJP A;  5DV5 A;  2CO5 A;  4I01 A;  4H0E A;  5HDK A;  3M8F A;  2EA4 A;  1HW5 A;  1IXR C;  3WU1 B;  1EH6 A;  3N4M A;  3BWG A;  2GQQ A;  1P92 A;  5HDN A;  5CLS A;  4YFX F;  4Y15 A;  1V4R A;  3G3Z A;  2IA2 A;  2QM3 A;  3VOE A;  1UHM A;  2PFB A;  4G7O F;  3TKY A;  3U1D A;  3F8C A;  4ESB A;  2RC4 A;  2HOE A;  4RAY A;  4R79 A;  3FM3 A;  5ILS A;  1SD6 A;  3REO A;  4CZZ A;  4G94 A;  3BPX A;  1Z9C A;  2ADU A;  5LBQ A;  4LB6 B;  2EFW A;  3F21 A;  4XLP F;  4A2U A;  5CJ9 A;  1SAX A;  1QZZ A;  2MC3 A;  3RYR A;  1DDN A;  3DQV C;  3T8T A;  5FB2 A;  5D8L B;  5CYV A;  3EYY A;  1HQC A;  2QLZ A;  4ENM A;  1ZAR A;  1PUE E;  3HTS B;  4PGH A;  3RJP A;  5HLI A;  5DUI A;  2J5O A;  4CHU A;  4EJU A;  1W7P D;  2P6T A;  2FOK A;  4PCQ A;  2P5K A;  4LGW A;  3K1N A;  1D8K A;  1ZLJ A;  1U78 A;  3WGI A;  4UVC A;  1FBS A;  1SFE A;  4HQE A;  5D5V B;  4N9H A;  1KQ8 A;  4HOB A;  3MWM A;  3IKV A;  3J81 K;  1T2K A;  1ZRE A;  4WWC A;  3TO6 A;  3GFM A;  5LHI A;  1YW7 A;  2CGP A;  1OYW A;  4IJA A;  2O3F A;  1LVA A;  1BM9 A;  1ZYR F;  4UHT A;  4EVI A;  5IT9 K;  2XUB A;  1S8N A;  2M8E A;  3DKW A;  5F1R A;  3RKX A;  1YFH A;  1P4A A;  1S3J A;  3V8J A;  2GIV A;  1FBQ A;  2P7C B;  2HQN A;  4G9Y A;  1ZRC A;  3JAM K;  1KU2 A;  1QBJ A;  1T0F A;  4CXF A;  1P4X A;  3E5Q A;  4ETS A;  4Z2Y A;  4A5N A;  4UV9 A;  1D8J A;  2ZME A;  2NNY A;  1BOA A;  1TQM A;  3K1P A;  2CSO A;  5K5R A;  2QYO A;  1WKM A;  4CGZ A;  4L5I A;  3ABU A;  2G7U A;  2LSO A;  3TDU C;  1RIO H;  3D0S A;  3HRT A;  3DF8 A;  3I59 A;  3SZT A;  3GUD A;  5L3B A;  2Z3Y A;  4Q47 A;  1O3R A;  3WTS C;  5HVQ C;  3QOP A;  2W85 A;  4ASN A;  3ECH A;  5BMZ A;  2VBY A;  1MZB A;  2KIM A;  3QPT A;  2K02 A;  1NHA A;  3P9C A;  2IA1 A;  1QQI A;  1ULY A;  3S2W A;  4WX9 A;  4FX4 A;  2FE3 A;  4HLY A;  3O6B B;  2A61 A;  4B8X A;  3KFW X;  4CYD A;  3M7G A;  3VFZ A;  2FEZ A;  2MD5 A;  3R0A A;  1ZH5 A;  3HSR A;  5DEQ A;  2F5F A;  3GVA A;  2Z5U A;  5FD5 A;  1IN4 A;  4IRH A;  2TDX A;  5CVR A;  2VE9 A;  3KE2 A;  1PP8 F;  3R61 A;  4IPA A;  4G6Q A;  2VT3 A;  2DLL A;  1KYZ A;  2QZ8 A;  3HTU A;  5FGM A;  2R3S A;  3WTZ A;  3KP3 A;  3B73 A;  2L02 A;  2GA2 A;  1KYW A;  1Z1D A;  3L7W A;  4AVP A;  3FWE A;  3K9T A;  4QWQ A;  1BN5 A;  3JTG A;  3K1M A;  4FHT A;  4P5O A;  4K2E A;  1K78 A;  1H9G A;  1ODD A;  1R5G A;  5HOO A;  4DNC A;  3ERE D;  5JI6 A;  4MEY F;  2K4B A;  3ABT A;  2VBZ A;  2OU2 A;  1BI1 A;  5EEH A;  2PBI A;  2A5Y B;  1QGP A;  5HS7 A;  1E2X A;  1I5Z A;  3SFZ A;  1LEA A;  4HLX A;  1R1U A;  2HGC A;  3TQN A;  3FHZ A;  4A5M A;  1U2W A;  5D5U B;  1AWC A;  3P7N A;  3BPV A;  2GZW A;  1GVJ A;  2Y0M A;  3I53 A;  3T1B A;  2XRN A;  4ZYE A;  4JBA A;  4M71 A;  3M1E A;  4AWX B;  4OMY A;  2PEX A;  4R1H A;  2K27 A;  2O6G E;  4MHG A;  2VOD A;  5FD6 A;  4KN7 X;  4M9Z A;  3F8B A;  1XN7 A;  2H09 A;  4I2O A;  1SD7 A;  3V7S A;  2W24 A;  1G3S A;  4XSX F;  5ICC A;  2HFH A;  4I98 B;  4YFN F;  2EK5 A;  3F8N A;  1J5Y A;  1T39 A;  5D5W B;  3GWZ A;  1TNS A;  1BBY A;  3QAH A;  3FX3 A;  1ON1 A;  1QO0 D;  1TQI A;  5F6F A;  4OMZ A;  3OOP A;  4U0Y A;  4PDK A;  4HF0 A;  2Z9O A;  5ILU A;  2WC2 A;  5E8I A;  2Q0O A;  1BJA A;  1OKR A;  3BRO A;  5H6Q A;  1FP2 A;  1G6N A;  3MEX A;  1SFU A;  2P7V B;  3R6S A;  2XKP A;  4KNY A;  2EJR A;  4MTD A;  4KT5 C;  2H6B A;  1XGO A;  1ZG1 A;  1OYI A;  1T6S A;  2UWM A;  5CVV A;  2EV6 A;  2BYV E;  2OA4 A;  2GXG A;  5L3E A;  2ISZ A;  1F1Z A;  3L2C A;  3HHG A;  3QU6 A;  2PLY A;  2HTJ A;  3LAJ A;  1YO5 C;  3ZMT A;  1X3U A;  1DP7 P;  4LD5 A;  1Z6R A;  1EH7 A;  3KZY A;  4TV7 A;  3IRQ A;  4R8H A;  2VBX A;  2JRT A;  3R4K A;  3HUG A;  3ISP A;  2KRF A;  3QRF F;  2OQR A;  2O03 A;  4EM2 A;  3P9I A;  1KQ0 A;  3F6O A;  1I6X A;  2UXX A;  1R36 A;  1R1V A;  2ZNY A;  4BHB A;  1O7F A;  2X4H A;  1SMT A;  2V6C A;  5FFZ A;  1I1G A;  3LAP A;  3TO7 A;  2V1D A;  3E97 A;  3VOD A;  1QPM A;  3R0J A;  4ZYH A;  3K69 A;  2AS5 F;  4GCV A;  4KN4 X;  1JXS A;  1IRF A;  2JPC A;  1XSX A;  4O6J A;  1G3T A;  4HF2 A;  4JK1 X;  2OD5 A;  3PQJ A;  2ZME B;  4MGR A;  4L0Z B;  2CG4 A;  2DK8 A;  3W6J B;  3ML6 A;  3F22 A;  3WTW C;  5BS6 A;  1JHH A;  2GAU A;  2L4A A;  2ZKZ A;  3I4P A;  3KLN A;  3DP7 A;  2H27 A;  2VC1 A;  3RPQ A;  1O3T A;  1YLF A;  2QQ9 A;  3T0Y A;  3I59 B;  3TGN A;  2DI3 A;  4AD9 A;  3J7A O;  1OMI A;  3DPL C;  4AIK A;  4HW0 A;  2QBY A;  3F23 A;  2PQ8 A;  4Y17 A;  3E5U A;  1U3E M;  2XAH A;  3BZ6 A;  3HSE A;  2MLG A;  3VEP A;  3PQK A;  3Q5F A;  3E6D A;  3WOD F;  2RN7 A;  3IWZ A;  1ZG3 A;  3GXO A;  2RVC A;  1DPU A;  5CVU A;  1ZRD A;  4G7H F;  3ZMZ A;  3GLX A;  1MGT A;  5FLX Z;  3CO7 C;  2OBP A;  2VT2 A;  3I64 A;  3K0L A;  3SXY A;  2IPQ X;  1R23 A;  1FY7 A;  5FO5 A;  2L3D A;  1XB4 A;  2HKO A;  3L00 A;  4CIC A;  3SQN A;  3HSF A;  3CTA A;  1RZ4 A;  2Z99 A;  4XRF A;  2UXN A;  5DD8 A;  3KZZ A;  4IXA A;  2KJC A;  5AIP A;  3Q9V A;  1U5T C;  2D1V A;  1J75 A;  2P6S A;  4ZZD A;  5E1W A;  3GFJ A;  1K78 B;  1Z6T A;  1WSU A;  2FA5 A;  2MA3 A;  1FYM A;  4MNU A;  2PI0 A;  3QP6 A;  1G3W A;  4E70 A;  2FF4 A;  1BI0 A;  3EUH A;  1Z7U A;  3CLO A;  2P5V A;  5ICE A;  1L0O C;  4UV8 A;  2D1H A;  2RDP A;  3KP7 A;  2YPR A;  4ESJ A;  2A68 F;  4Y13 A;  3FM5 A;  1U5T A;  4LFU A;  4U7D A;  2M1B A;  4PZJ A;  4GXO A;  4I0B A;  1XSV A;  2KIF A;  2F5C A;  4I02 A;  1ZGJ A;  4Q5S F;  2RKH A;  2IP2 A;  3DFG A;  4EMS A;  1FT9 A;  2VXZ A;  3QP5 A;  2HTS A;  4IHS A;  2VBW A;  5TJJ A;  1WQ2 A;  3JSO A;  5E17 F;  3CUQ C;  5HDG A;  1R58 A;  1FOK A;  2COM A;  2A69 F;  2ZBK A;  2ESH A;  2UZK A;  5BPI A;  2ZFW A;  3LWF A;  4YIF A;  2BEO A;  3V4G A;  1XMK A;  3HOT A;  2XGX A;  2DQL A;  1BI2 A;  3ZP5 A;  5LHG A;  3RPU A;  2QUF A;  3F6V A;  1J59 A;  1FC3 A;  3ECO A;  2CYY A;  2V79 A;  2FU4 A;  4EJV A;  1TLH B;  4HX7 A;  1F5T A;  4BH9 A;  3ZN0 A;  5J8F A;  1YQA A;  2OAZ A;  3AAF A;  3CJN A;  1IXC A;  3LFK A;  2NRA C;  4JQF A;  3V8K A;  1YIO A;  3T5X A;  1UFM A;  4A0Z A;  4LLL A;  5E1X A;  1S6L A;  3LA3 A;  2KKO A;  3CUQ A;  1ZN2 A;  1MD0 A;  3EDP A;  3KLO A;  4OIQ F;  4DQ2 A;  2E1N A;  3PFI A;  2HYF A;  5BQT A;  1C0W A;  3J80 Z;  1Y0U A;  2HYG D;  2KIU A;  1QZY A;  5D5X B;  1B59 A;  4RB0 A;  5D4R A;  4FT8 A;  5AON A;  3BJA A;  2K7L A;  1KU9 A;  2XAF A;  3BY6 A;  2PMU A;  3KEQ A;  1H9T A;  2F2E A;  2M45 A;  1K6O A;  1IZ1 A;  1JE8 A;  5BOX A;  4MQV A;  4ENJ A;  5K5Q A;  1SFX A;  2Y75 A;  3CUO A;  3E6B A;  4BHP A;  2O8X A;  1FYL A;  1W7P B;  3ELK A;  3F8M A;  3ZMU A;  1T98 A;  4KIG A;  2YR2 A;  5LRS A;  2ACJ A;  4OIN F;  3ZN1 A;  2RNJ A;  1HXD A;  2M87 A;  3ZPL A;  4IHT A;  4HX8 A;  3WTX C;  1EH8 A;  4XSZ F;  2EFO A;  4CO8 A;  5DD4 A;  3HIF A;  2EWN A;  2V1X A;  4GYI A;  4WCG A;  2L4M A;  5FFX A;  4HAM A;  3KEO A;  2DPU A;  3EQL F;  1LDK B;  1BC7 C;  1OPC A;  3C7J A;  2ZCW A;  1MJA A;  4XBF A;  3I0T A;  1FZP B;  3FXQ A;  5D8K B;  5HS8 A;  1HKQ A;  2DBB A;  4RAZ A;  4EM1 A;  2AXL A;  5J6X A;  2HEO A;  2HKX A;  2V9V A;  4ZYD A;  5A2Q Z;  4WK8 F;  1IXS B;  4EM0 B;  4P55 A;  4UXN A;  2MLK A;  5D6E A;  2QBY B;  3ZQ7 A;  4AIJ A;  2JPB A;  2BBY A;  1FP1 D;  3HOS A;  2FRH A;  4WXD A;  2PG4 A;  2E1C A;  1LDD A;  4HZF A;  2GXB A;  2IT0 A;  2ZJ2 A;  4ZH4 F;  1H0M A;  1IRG A;  1MJB A;  3T8R A;  3F72 A;  5LLQ A;  4N9I A;  4GO1 A;  4MQ9 F;  1K7A A;  3IWF A;  3GW2 A;  3SZP A;  5TRD A;  3I5U A;  1CGP A;  2X0L A;  2KJB A;  3WE3 A;  4LG0 A;  2DU9 A;  1PP7 U;  3JSP A;  3ULQ B;  1HBX G;  2JTV A;  4IVN A;  4NHJ A;  1IUY A;  2DO7 A;  3ZMD A;  4NB5 A;  5AIQ A;  1E17 A;  4AIH A;  2JZY A;  4BQA A;  3WU0 A;  1RI7 A;  4A0Y A;  2RQP A;  2O61 A;  3O2P E;  4N0B A;  2DTR A;  3GF2 A;  4UUV A;  4RGS A;  1BI3 A;  2VN2 A;  3NQO A;  1GXP A;  3KP6 A;  2H94 A;  5CVI A;  5ICF A;  4MTE A;  1XDU A;  2BV6 A;  5K1Y A;  1W7P A;  3FMQ A;  4EQQ A;  1YW8 A;  3ZMS A;  2LKP A;  1LJ9 A;  3TO9 A;  2EV5 A;  1KGS A;  4IRI A;  4LLG F;  1HKS A;  3QPH A;  1O57 A;  2EFN A;  1P2F A;  2ZNZ A;  1UST A;  2OQG A;  3ZMV A;  1B6A A;  1FPQ A;  3V7R A;  4EJO A;  1R00 A;  4L18 B;  1IN5 A;  2EFQ A;  1XCB A;  4P96 A;  2MH9 A;  4M9X A;  4HV6 A;  1J0R A;  3TOA A;  1GHC A;  4KYW A;  3J81 Z;  1MDM A;  4Q48 A;  5JR3 A;  2Q8K A;  2OZU A;  5DCF A;  4HV5 A;  2YSR A;  2M5W A;  2XHK A;  3JTH A;  3RDI A;  1U5T B;  1G4D A;  1ZRF A;  3F3X A;  1LDJ A;  2D2W A;  1S29 A;  2STT A;  5IT9 Z;  5ED4 A;  1EV7 A;  4A0X A;  1TQP A;  2LF8 A;  4HQM A;  3EET A;  3LA7 A;  4RB3 C;  2F5E A;  3WTT C;  4ENN A;  3EYI A;  4L9V A;  3ROU A;  2EA2 A;  3JAM Z;  1I27 A;  4EV0 A;  2FBK A;  2P8T A;  1S7A A;  2FNA A;  4M74 A;  5DUK A;  1HSJ A;  4YII A;  2FSW A;  2XVC A;  3D5L A;  4MEX F;  4O5V A;  1W5S A;  1R1T A;  2PMH A;  3C1D A;  5LEK A;  4YFK F;  2XRO A;  2STW A;  2FQ3 A;  1D3Y A;  2IRF G;  2DPD A;  3MAJ A;  1F9N A;  3G73 A;  2G9W A;  1IF1 A;  5DYM A;  4BHC A;  4S04 A;  3BJO A;  1YS7 A;  2ZXJ A;  2JT1 A;  1MJ9 A;  2Y48 A;  4A6D A;  4L0Y B;  1XD7 A;  4OU0 A;  4LK0 F;  5LGT A;  2FBH A;  3U9G A;  4Q4Z F;  4RGU A;  1ZG5 A;  4M72 A;  4S05 A;  2IW5 A;  3GZ6 A;  3VB2 A;  1ZHF A;  4WF2 A;  2EV0 A;  1B9N A;  5L3D A;  3CUQ B;  4LK1 F;  3RI4 A;  5LGN A;  4L9N A;  4WXH A;  4BNC A;  1UHW A;  4KFC A;  1W4M A;  5HS9 A;  3I54 A;  3IC7 A;  3Q9S A;  2W84 A;  5E18 F;  4ENK A;  3WGG A;  3HHH A;  1FBU A;  4BXU A;  2YX4 A;  3LST A;  2P5L C;  4LJZ F;  1B1B A;  3GYH X;  3P9K A;  1YS6 A;  2ELH A;  4UVB A;  3B02 A;  4ESF A;  3IRR A;  4G6D A;  1TBX A;  3GFI A;  4OOI A;  2CWE A;  4EJW A;  5HLH A;  5KK1 A;  3IHU A;  2L54 A;  1ZGA A;  5IT3 A;  3HRS A;  2XAJ A;  4A6E A;  1OYY A;  2GWR A;  2CFX A;  1DPR A;  2NNN A;  2HZT A;  1PDN C;  1CF7 A;  5BPD A;  1G3Y A;  4M9S A;  1YW9 A;  4WXC A;  5L3C A;  2FBI A;  1P4W A;  1RNL A;  2ESN A;  4OIO F;  2ETH A;  2K86 A;  2V1U A;  4ON0 A;  1ONV A;  1O3S A;  2IA0 A;  3MZY A;  1YYV A;  3FXU A;  4IRG A;  3MFK A;  3WTV C;  4GGG A;  1TW3 A;  5DCM A;  1BIA A;  4U7B A;  1I1S A;  4HDU A;  3KP5 A;  3MQ0 A;  4HDV A;  2QQA A;  2WWY A;  3WTY C;  5HLG A;  4LLN A;  2QQB A;  3FXR A;  1T38 A;  5H6R A;  2E7W A;  4UVA A;  5J8C A;  4RB1 A;  4BYY A;  2EFP A;  1D5V A;  5ERI A;  1B4A A;  3HRM A;  4G7Z F;  1J2X A;  4GYG A;  3LQQ A;  3RYP A;  2HS5 A;  3RKW A;  1YTY A;  5LRR A;  2BE5 F;  2G7H A;  2PN6 A;  1LEB A;  2HQR A;  2IVM A;  2LDU A;  3W6K B;  3WGH A;  2WTE A;  4O3M A;  4EGY A;  2RV8 A;  1WI9 A;  3DXJ F;  2L01 A;  3QU3 A;  1F4K A;  3R60 A;  5FLX K;  3I58 A;  2FXA A;  1SD5 A;  2NAZ A;  4L5J A;  4I09 A;  2IJL A;  1ON2 A;  3IKT A;  3BJ6 A;  2HWV A;  1VTN C;  1WWX A;  4HBL A;  3SHF A;  3RTR A;  3OV8 A;  4LB5 A;  3E5X A;  1R5H A;  4ZYG A;  3GZ5 A;  1HST A;  5KVR A;  1XCV A;  4FX0 A;  4L9J A;  1KQ9 A;  2XKO A;  1KA8 A;  5LEJ A;  4LG0 B;  1QNT A;  3HRU A;  1S7O A;  4OIP F;  2K4J A;  4P9F A;  1MKM A;  1IN8 A;  2YU3 A;  4U88 A;  4RGR A;  1JHF A;  1IN7 A;  2MH2 A;  4U0V A;  1TW2 A;  2DAO A;  3MZH A;  2XAS A;  1DUX C;  1W5T A;  1KU3 A;  1SMY F;  2LNB A;  1XMA A;  2F5D A;  2HR3 A;  2DQR A;  4KIC A;  1Q1H A;  2YX7 A;  5LGU A;  3MCZ A;  3V7C A;  4I7H A;  2R7D A;  2OZ6 A;  2HDC A;  5E20 A;  3RKY A;  2VE8 A;  3L9F A;  3DEU A;  2DW4 A;  4EJT A;  4HX4 A;  1UCR A;  1XGS A;  4I0A A;  1J9I A;  3KCC A;  2C6Y A;  2LF7 A;  5D4S A;  4KIF A;  2WV0 A;  1REP C;  3BP8 A;  4KMU X;  2H6C A;  4BAY A;  3TOB A;  3F8F A;  1USS A;  1WRJ A;  4XLN F;  3LQR A;  3E3V A;  4EGZ A;  1OR7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...