5HLHA

Crystal structure of the overoxidized abfr bound to dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
144
structure length
134
Chain Sequence
QEQMRLANQLFSAYNVSRLFAQFYEKKLKQFGITYSQYLVLLTLWEENPQTLNSIGRHLDLSSNTLTPMLKRLEQSGWVKRERQQSDKRQLIITLTDNGQQQQEAVFEAISSCYDETKYVFEELEQTLKHLIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator/dna
molecule keywords DNA (5'-D(*TP*AP*AP*CP*TP*CP*AP*AP*TP*CP*GP*CP*GP*CP*GP*CP*G
publication title Structural Insights into the Redox-Sensing Mechanism of MarR-Type Regulator AbfR.
pubmed doi rcsb
source organism Staphylococcus epidermidis
total genus 40
structure length 134
sequence length 144
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hlhA00
4ON0A 5K1YA 4YFNF 4Q48A 1J7KA 4BHPA 1R00A 2RGVA 4CXFA 1ZLJA 3GFIA 3GFLA 1FT9A 3VEPA 2FE3A 4M6XA 2NRAC 4WWCA 3WTWC 4N0BA 3WE2A 4LGWA 1K78A 3CJNA 4CO8A 4KMUX 3BPVA 1B6AA 1FYMA 1XSXA 2P7VB 3HRMA 4L9TA 2MA3A 1Z7UA 2M1BA 3V7CA 2RQPA 1A04A 2DBBA 4GYIA 3ERED 4GO1A 5JVTA 4UXNA 3HUGA 1S29A 4M74A 3IRRA 1S3JA 2PEXA 1JXSA 4XSZF 2D2WA 4EM0B 5D5UB 1YQAA 2O0YA 2XAQA 4HW0A 5CVIA 3OV8A 3MAJA 2ZKZA 3GF2A 3RYPA 1F1ZA 1O3SA 2A6HF 2OU2A 2F5CA 3HSEA 1QZYA 3E97A 1XGNA 1W4MA 2DT5A 1IW7F 4LG0A 2QENA 4OIOF 1H0MA 4EQQA 3WTTC 3QAHA 4R8HA 5DD4A 1SD6A 5L3BA 5LGUA 1YLFA 3MCZA 5DCFA 3LA2A 4AVPA 1FNNA 2HTJA 4M9XA 3T8TA 4I0AA 1FY7A 2DAOA 4HQMA 3CO7C 3ABTA 4CHUA 2DPUA 4L5IA 2WTEA 4UNOA 1KQ8A 3EYYA 4HA8A 4GCVA 2O6GE 3EETA 4NB5A 2FOKA 5DUKA 4MQ9F 3DPTA 3I54A 2ZNZA 2G7HA 2E1NA 2G7UA 1XN7A 2KIFA 2BBYA 5J8CA 4HDUA 4OMYA 1XMKA 3GFJA 3HRSA 1Y0UA 2EV5A 2VBWA 5HS9A 4I98B 2VC0A 1D8JA 2L3DA 1R1VA 2DPDA 4I2OA 4ESJA 4MQVA 3NRVA 3JTGA 2CQKA 1H9GA 2EFWA 1XCVA 5D5WB 4UVAA 2CYYA 1XDSA 2JT1A 1U2WA 2M30A 4HOBA 4BNCA 1V3FA 1KU9A 1U5TB 1OYYA 1TW3A 1W5SA 3ABUA 2DU9A 3F23A 1B9MA 1VTNC 2STTA 3I64A 4HZFA 5ICFA 4A5MA 1P4XA 2P8TA 2FRHA 2H6CA 3WGGA 3WG9A 2PI0A 2UZKA 4ENNA 4YG2F 1ODDA 3L2CA 1I5ZA 2EJRA 2DQLA 1IN6A 4HLXA 3MWMA 3WODF 4CYDA 3FXQA 4GXOA 3I59B 4A2UA 3BJ6A 1U8RA 4S04A 4LB5A 4U7BA 1TNSA 3GW2A 3RTRA 4NQWA 5ICCA 4O3MA 2R7FA 1B4AA 2KIUA 1YS6A 2ZBKA 2Q0OA 4MEYF 3QOPA 2VT2A 4HF2A 1U3EM 4RB3C 4EJOA 1HKSA 5J8FA 1BOAA 2FBKA 3ISPA 3GZ5A 4L9VA 2FSWA 2O03A 2NYXA 3P9CA 4LMYA 2JTVA 3LA7A 3RYRA 5DEQA 4O6JA 2A07F 3EUHA 4RAZA 2EWNA 4KIBA 3ECOA 1WSUA 3JTHA 1G3TA 3F8CA 5ICEA 1YYVA 4A0XA 1T0FA 3HRUA 5HDKA 2LF8A 4OOIA 3G3ZA 1ZGAA 5E8IA 2O61A 3BROA 3FF5A 3RIRA 2ZFWA 4WXCA 3Q9SA 5TJJA 1JGSA 4RGUA 1WQ2A 3T1BA 2FU4A 4L5JA 4ENMA 1LVAA 3L9FA 4N9HA 5HS7A 2WC2A 1ULYA 1ZN2A 3FMRA 4A6DA 4A12A 2KJBA 4EGYA 5CVUA 4Y17A 3QPTA 4XBFA 3BDDA 1HSJA 3E3VA 3TDZC 4CGZA 2HKXA 2O3FA 2VODA 2L4MA 3FHZA 2HKOA 2K02A 3QP5A 1SD7A 5LHGA 1FSEA 2F5FA 1L0OC 2F5EA 4EVIA 3HOTA 3TDUC 4RS8A 2XIGA 4LK1F 3HOSA 1ZHFA 3ROUA 2GAUA 3KP7A 1SMYF 2XUBA 2EB7A 4U0WA 1FP2A 2OZ6A 4Y15A 4KN7X 2XASA 1EV7A 4ZYEA 3U2RA 1KGSA 3MQ0A 2P5LC 4YFXF 3TO7A 3BZ6A 5HLHA 1IXCA 2W57A 4HX4A 2H94A 3C3WA 4MGRA 1R5GA 1YS7A 3DEUA 4G94A 4OU0A 4LJZF 3N4MA 2IP2A 5D4RA 1TBXA 4WK8F 3HRTA 1IN5A 2MH9A 5E1ZB 2L4AA 1IRFA 2QLZA 2J5OA 1P6RA 2OQGA 2F5DA 1T2KA 3D5LA 1BIAA 4R1HA 4HYEA 2XAHA 5BQTA 4MTDA 4M71A 5BPIA 4HF1A 4MNUA 3WTZA 3PQKA 2K86A 2ZJ2A 3DKWA 3IKVA 4G8XA 1B59A 3E5QA 1ZG5A 3LFKA 2CW0F 2D45A 3RJPA 1KQ0A 1FLIA 2BEOA 2RNJA 2LSOA 3M8EA 2FBHA 4KN4X 4OIPF 3M7GA 1O7FA 3B73A 1R58A 2FMLA 2MLGA 4K2EA 2ISZA 1T39A 2YX7A 2FEZA 1SD5A 1O3TA 2IRFG 3IKTA 1Z05A 2MLKA 3ML6A 6PAXA 3I0TA 5E20A 4IRIA 1HQCA 2A68F 3H3ZA 4XSXF 1W7PB 2QM3A 4I0BA 1ON1A 3R4KA 1J59A 3R6SA 2O8XA 4L0ZB 1H9TA 3CUOA 4KIGA 3O3KA 2V1UA 3F22A 2GA1A 3F8MA 2HEOA 3E5UA 4I7HA 1RNLA 2OBPA 3CUQB 3WU1B 1T98A 1P4AA 2ZNYA 2PMHA 2ETHA 1ZG3A 2LNBA 1R5HA 5D5VB 3LWFA 2NS0A 1MZBA 4WX9A 1ZARA 2P6TA 3I71A 3U1DA 1ZRDA 4RAYA 3TO9A 5FB2A 3CTAA 1PP7U 1U5TA 4HLYA 3SHFA 2JSCA 2H27A 2OA4A 3KP2A 3NEUA 3DF8A 3SFZA 4ZYHA 3GZ6A 1HBXG 2A69F 1LDKB 4RB2C 1K7AA 2FNPA 4KMFA 4P9UA 4KDPA 1P92A 4S05A 3GWZA 2HGCA 4A6EA 3I59A 5F6FA 1RUOA 4DQ2A 4B09A 2Z33A 1MJBA 3HTUA 1LNWA 1YW8A 1B1BA 1SFEA 2IA2A 2EFOA 2OAZA 1SFXA 3F72A 2HS5A 4LK0F 3QPHA 5FFZA 1P4WA 2XAFA 1MJ9A 3BOQA 1LDDA 1EH8A 3K2ZA 2VBZA 1ON2A 1WRJA 4HV5A 2HYFA 2A5YB 3WGHA 3K69A 4M6YA 2UXXA 5LGNA 5ILSA 5LRRA 2W85A 2VXZA 1R1UA 4AWXB 2OZUA 1S6LA 4UV8A 3WTSC 2VE8A 1HXDA 2MH2A 4O5VA 2RN7A 2YSRA 3K0LA 5FFXA 4L9JA 3K1MA 1FYKA 5LGTA 1WWXA 3TQNA 1EH6A 1S8NA 4G6DA 5IT9K 2V79A 3R0AA 2VE9A 1I27A 5JR3A 2WV0A 3FMQA 5F64A 2R7DA 2K7LA 1QNTA 4BHBA 1XCBA 1XD7A 2IA0A 1USSA 3E6BA 2ZXJA 1T38A 3IC7A 3N97A 3KLOA 3MFKA 2HDCA 3C18A 3BY6A 4M9ZA 4L0YB 4ZYDA 2GQQA 4ESBA 2Q8KA 2J5PA 5LLQA 3V8LA 2Q2EA 2MBFA 1XB4A 5AIPA 1MGTA 2M45A 1FSHA 2H6BA 3LAJA 2GXGA 3KP6A 2FXAA 4JBAA 4M9SA 4KFCA 3V8KA 3HHHA 5H20A 1TQPA 2DO7A 1FPQA 4RGRA 1TNTA 2BE5F 2V1DA 1SD4A 1U6GA 2ELHA 3DPLC 1U78A 5FLXK 2F2EA 1IAWA 3ZMSA 3GFMA 2G9WA 1CF7A 2PFBA 3MZHA 3B02A 4ENJA 1BC7C 4EM2A 3WE3A 2QQ9A 1BBYA 1Z6RA 1IRGA 2WWYA 3J80Z 2HQNA 3DV8A 3RPUA 3NQOA 1I1SA 1WKMA 4UHTA 1R23A 1IZ1A 2W24A 2CWEA 3KEOA 3GXOA 5BPDA 2VT3A 5ICGA 4KUMA 4WXDA 2A61A 5A2QK 4LLGF 1YG2A 2K27A 4ZZDA 1ZG1A 3FZVA 2P5KA 4BHCA 2PBIA 3RDIA 3TKYA 1BC8C 2IT0A 3ELKA 3F8NA 2RDPA 2YR2A 3D0SA 1REPC 1XGMA 1ZYRF 4Z2YA 3JW4A 5D8LB 1FZPB 1QBJA 2CGPA 3K1PA 5BMZA 1I6XA 2QVOA 2VOOA 3K9TA 3FM5A 5JI6A 3C1DA 3WTVC 2P5VA 3I53A 4IRGA 5DUIA 5D6FA 2CO5A 1W7PA 4HX7A 2EV6A 3P9KA 1XMAA 2QWWA 4Q5SF 5K5QA 1MDMB 5AONA 2LDUA 3F6VA 5D6EA 3L09A 4UUVA 1FOKA 3K1NA 5CVVA 4G7OF 4A0ZA 3CUQA 5E1WA 2ESHA 4TV7A 2D1VA 4EJUA 1LQ1A 2NNYA 1CGPA 3KP3A 5ED4A 2E7XA 3ZPLA 1G3SA 3GEZA 2RVCA 4KIFA 4MEXF 1GXPA 4AD9A 1SMTA 5E18F 1D8KA 2Z5UA 5ILVA 2PMUA 5H6RA 4YIFA 4QWQA 1G4DA 4FX0A 3RKXA 1V4RA 1QQIA 3SZPA 4KNYA 4IXAA 3TGNA 5DCMB 1F4KA 3KCCA 4BXUA 5BS6A 1KA8A 4PZJA 4EJVA 3ECHA 3S2WA 1CF7B 1TQIA 2E1CA 4B8XA 2PJPA 5E17F 4EGZA 1PP8F 5K5OA 3CLOA 3R0JA 2V1XA 1O57A 2DTRA 1FBQA 4LFUA 4IPAA 3JAMK 5D5XB 1UHMA 5CLSA 1FWZA 2ZMEB 1BIBA 2FA5A 3KZZA 3O6BB 1C0WA 3U9GA 1D3YA 1ZRFA 1LB2A 2EA2A 1IF1A 1J75A 5L3DA 5L3EA 1EH7A 2M87A 3J80K 1JE8A 1DP7P 4XRFA 2PQ8A 4NHJA 2HZTA 1KU2A 1LEAA 1OMIA 2QBYB 2KKOA 1J0RA 2BYVE 2VN2A 1MKMA 2YPRA 3QRFF 1DPRA 2HQRA 4IJAA 3O2PE 4WF2A 3FXUA 1O3QA 4HX8A 4G6QA 3VODA 3KFWX 5IT9Z 3QU3A 2XHKA 2QQAA 3J81K 1UB9A 1T6SA 3WU0A 3SXYA 2YX4A 3FM3A 1P2FA 2JZYA 4EJWA 1LEBA 1Z6TA 5LEJA 3IHUA 2XROA 5K5RA 4G7HF 1RIOH 3HSFA 2FNAA 4UV9A 3V4GA 4CICA 2FBIA 1WI9A 3PQJA 2W25A 3M1EA 4F7ZA 2VONA 1OPCA 2P4WA 1FBUA 1U5TC 3RPQA 2IPQX 2P6SA 1G3YA 4OIRF 4EV0A 3RKYA 3WTUC 3AAFA 3L7WA 3QP6A 5EEGA 2IW5A 4RGSA 4U88A 4H0EA 1RI7A 1QO0D 3F8FA 1J5YA 2DW4A 1R7JA 1ZAOA 2X4HA 1OYWA 1LJ9A 5FD5A 2EFPA 3V8JA 2X0LA 4FHTA 1TLHB 4IF4A 4ZZLA 2PG4A 4IRHA 2Y75A 3LA3A 2A6EF 2VOPA 1G6NA 4JK1X 5FLXZ 2JPBA 3HTSB 1XGSA 1TQMA 5HLGA 1STZA 1FYLA 3T5XA 1KQ9A 3F21A 3GLXA 3QU6A 3JSOA 2C6YA 2DFIA 5F1RA 2L54A 1HSTA 5HDNA 4WXHA 2RC4A 2OD5A 4D0PA 2CFXA 4LLLA 2GWRA 4CDGA 2DK8A 3GVAA 3TO6A 3BP8A 2EFQA 3T0YA 4PGGA 2UWMA 1O3RA 5DDGA 1XSVA 4CZZA 2VC1A 2HTSA 5DV5A 3E5XA 4WCGA 3J7AO 2ZO4A 3L00A 3KP5A 5BOXA 4HAMA 1NHAA 2V6CA 5A2QZ 4ETSA 2LKPA 2ADUA 4AIHA 3E6CC 2DQRA 1GHCA 1QGPA 1ZLKA 2GA2A 2JPCA 3FXRA 3ZN0A 5HVQC 3LQRA 2ACJA 3E6DA 1HKTA 1Z91A 4AIJA 5HLIA 3GX4X 1GXQA 1L3LA 1AOYA 1YW7A 1UHWA 3GUDA 2IVMA 4OMZA 5L3FA 4BH9A 3EDPA 4AIKA 4UVCA 2TDXA 1SAXA 1DPUA 3FWEA 5CYVA 2VBYA 3JSPA 5KK1A 5JFRA 3W6KB 5H6QA 1RZ4A 5E1XA 4HDVA 4G9YA 3HSRA 3R61A 1D5VA 3M9AA 4M72A 2FMYA 1E17A 4EMSA 1J9IA 2ISYA 1QPMA 5L3CA 4PDKA 1MD0A 1I1GA 5L3GA 2AXLA 4MTEA 1Z1DA 5LBQA 4P9FA 3WGIA 1MDMA 2KJCA 3HHGA 3H3UA 5DYMA 3KEQA 3ZMUA 1G3WA 2HYGD 2ESNA 2L02A 2PN6A 1KU7A 2XV4S 3E6MA 2XKOA 2STWA 1PDNC 2LF7A 2COMA 2XAJA 5CJ9A 1J2XA 1ONVA 1BI2A 2V9VA 5LEKA 3ZMZA 2HWVA 3I4PA 3SZTA 3V7RA 1X3UA 3IRQA 2A3SA 3TOBA 4M73A 1TTYA 4DNCA 4OIQF 4Q47A 1OR7A 5FD6A 3HYIA 4PGHA 1BJAA 2Y0MA 2HOEA 4Y13A 3G73A 4U7DA 5JHUA 2XVCA 1BI0A 1YW9A 5DD8A 5ILUA 1XGOA 1IXSB 2RV8A 5DCMA 5EEHA 4UVBA 5TRDA 1YO5C 3MEXA 3JAMZ 1K78B 2Z9OA 1OYIA 3I5UA 2Z3YA 2EFNA 3F3XA 1HKQA 2M8EA 1UCRA 1YFHA 3H92A 4I09A 4R79A 1DDNA 4HF0A 4Q4ZF 2XKPA 3WTYC 3KZYA 2ZMEA 3RKWA 4A0YA 5D8KB 2EK5A 1KU3A 4GYGA 4OINF 3P9IA 1BM9A 2R3SA 1HW5A 4N9IA 3KE2A 2D1HA 3VB2A 1YIOA 1R1TA 5CVRA 2QBYA 2GIVA 4FT8A 1F5TA 1S7OA 3P7NA 3J81Z 3DXJF 4JQFA 4ESFA 3ZP5A 3Q5FA 1HW2A 4I02A 2KRFA 4LG0B 4RB0A 5HS8A 4IHTA 3CUQC 2MD5A 2BV6A 3ZN1A 4ZH4F 2FF4A 2VBXA 4L9NA 1LDJA 4BAYA 2P7CB 1KYWA 2CSOA 3Q9VA 2IJLA 1W5TA 4HV6A 3BJAA 3FMSA 3BWGA 3LQQA 4HBLA 5FGMA 1RUNA 2JRTA 2GZWA 2NAZA 4FX4A 4IHSA 4XLPF 2K4JA 3CDHA 2MC3A 1BN5A 3I58A 4EJTA 2QQBA 2FQ3A 3ZMTA 1IXRC 2UXNA 3W6JB 2M5WA 3MZYA 3ZMVA 4U0YA 1K79A 2L01A 2H09A 4YIIA 3BPXA 3SQNA 2CG4A 3BJOA 3F6OA 4YFKF 2QUFA 2YU3A 2W84A 1K6OA 3R60A 3PFIA 2ZCWA 3RI4A 4EM1A 1R22A 2QZ8A 3OOPA 2EV0A 1XDUA 1BI3A 4KICA 1GVJA 2GXBA 3IWFA 4P5OA 2E7WA 3WTXC 4P96A 1USTA 4L18B 1Z9CA 3TOAA 3VOEA 3FX3A 3EQLF 1FP1D 4G7ZF 3LSTA 4HQEA 1SFUA 2PLYA 4LLNA 3VFZA 2IA1A 2XGXA 2DI3A 1Q1HA 5IT3A 1UFMA 3REOA 3IWZA 4KYWA 5FO5A 3ZQ7A 1OKRA 4XLNF 5LHIA 4QLCU 4ASNA 4LD5A 3KLNA 5ERIA 1JHFA 2K4BA 5E8GA 1IN8A 4RGXA 2XRNA 4KA4A 2DLLA 1FBSA 4PCQA 5HOOA 1E2XA 4BYYA 1FC3A 1B9NA 1IN7A 4ENKA 1ZRCA 2EA4A 5LHHA 2Y48A 4KT5C 3DP7A 3GYHX 4GGGA 1JHHA 5CVJA 2Z99A 2QYOA 3LAPA 3ULQB 1DUXC 3V7SA 5AIQA 2NNNA 1QZZA 1ZREA 3DFGA 5KVRA 4IVNA 4P55A 2HR3A 1W7PD 5D4SA 1KYZA 4MHGA 1IUYA 1MJAA 1ZGJA 1HW1A 4A5NA 2XAGA 1XSDA 1AWCA 3EYIA 1IN4A 3KP4A 4I01A 1TW2A 2KIMA 1FX7A 3F8BA 4BQAA 2B0LA 2OQRA 4RB1A 4LB6B 1YTYA 3IL2A 1O7LA 2RKHA 3C7JA 2DK5A 4U0VA 3COAC 1R36A 3HIFA 4ZYGA 3CO6C 5J6XA 2BGCA 3GO5A 3KETA 3ZMDA 3DQVC 1ZH5A 2AS5F 1F9NA 5HDGA 3M8FA 1BI1A 2HFHA 1PUEE 1S7AA 3T8RA 4E70A 5LRSA
chains in the Genus database with same CATH superfamily
3U21A 4ON0A 5FKMA 5K1YA 3HJEA 4YFNF 2WB1N 4Q48A 1J7KA 3GTQJ 4BHPA 1R00A 2RGVA 3E7LA 2MFZA 4XLHA 4CXFA 2M4KA 1ZLJA 3GFIA 1QU3A 3GFLA 2R93J 2PMZN 1FT9A 3AL0C 4JYKA 5IP6A 3VEPA 3DTIA 2FE3A 4M6XA 3IUOA 1N77A 2NRAC 4BY1J 4WWCA 2JA8J 3SDGA 3WTWC 4N0BA 4QPOA 3WE2A 2GXAA 4LGWA 1K78A 1PJRA 5IOYA 4JX4A 2ME0A 1MMGA 3RKQA 2HVRA 3SZGA 3CJNA 4CO8A 4KMUX 4F3QA 3BPVA 5DTDA 2CUEA 3A01A 1B6AA 5EEAA 5FKOA 1FYMA 2HQAA 2ME6A 1XSXA 3ZQGA 2P7VB 3HRMA 4X0GA 2Y69H 4L9TA 2MA3A 4DYQA 2R92J 1Z7UA 3ZQCA 2JQ7A 2KMUA 2M1BA 4DOZA 3V7CA 2RQPA 1A04A 2DBBA 4GYIA 3OYLA 3ERED 4GO1A 2EZLA 1N78A 5JVTA 4UXNA 3HUGA 5HNHA 1S29A 4M74A 3IRRA 1S3JA 1VZ0A 1Z77A 4ZJZA 3CLQA 2ELJA 3MKWB 2PEXA 2MD0A 2VQCA 1JXSA 3UNGC 4XSZF 2D2WA 4EM0B 5D5UB 1BOBA 2IS6A 2DA5A 1YQAA 4BJ5C 2O0YA 2DA4A 2HDWA 2XAQA 4HW0A 3OV8A 4MFDA 5CVIA 3GTPJ 9ANTA 2BXYA 3MAJA 5B66C 2ZKZA 3GF2A 3K70D 3RYPA 1F1ZA 5B5EC 1O3SA 2A6HF 3DLLF 2K9QA 2OU2A 2W1OA 4BL0B 2F5CA 3HSEA 4A3JJ 1X3WB 1QZYA 3E97A 1R4NB 1XGNA 1WHUA 1GDTA 1W4MA 3OS1A 2DT5A 1IW7F 4LG0A 2QENA 4IL6C 2V9PA 2V26A 4FTHA 4OIOF 2DJNA 4CZCA 1H0MA 4MIMA 4EQQA 3WTTC 5FLMJ 3TBIA 3QAHA 2KRCA 4R8HA 5DD4A 4BJ6C 1LUJB 1SD6A 3K2AA 5L3BA 5LGUA 1YLFA 3PUFA 3MCZA 1D1AA 5DCFA 3LA2A 2ID6A 4AVPA 3BR2A 1FNNA 2HTJA 4HEA2 4M9XA 3T8TA 3K6GA 3W2WA 3IH2A 4I0AA 1FY7A 4FASD 2DAOA 3CJQB 1HF0A 1U8BA 4PJNA 1DP3A 4HQMA 1OR7C 1ZELA 3CO7C 3ABTA 4CHUA 3LSHA 2DPUA 3DBHB 2XF5A 1BR1A 2WAFA 2H8WA 2E35A 2ZXWH 4L5IA 2WTEA 4UNOA 1KQ8A 3EYYA 4HA8A 4E7LA 3PIOF 3H9JA 3CDIA 4GCVA 5HNFA 5KAIC 3EETA 3EUAA 2MYSA 3HEFA 4NB5A 2FOKA 2O6GE 5DUKA 5M5XJ 4MQ9F 1U9OA 4I76A 1VQOI 3DPTA 3I54A 1HOMA 3CQZJ 2ZNZA 2W00A 3PJRA 2G7HA 1LE8A 2E1NA 2G7UA 5JHFA 5E3MA 1XN7A 3FHNA 2KIFA 2E19A 2BBYA 5J8CA 3PNTA 3OMYA 1ZK8A 4HDUA 4Y33A 4OMYA 2K5CA 1XMKA 1R49A 3PNVA 4HRIA 2FQ4A 2H1LA 3GFJA 4CYCA 3HRSA 1Y0UA 2EV5A 2VBWA 5HS9A 1A36A 4I98B 3AFHA 2VC0A 1D8JA 2L3DA 3Q0WA 1R1VA 2VJJA 1SFOJ 2DPDA 4I2OA 1D5YA 4BY7J 4CCMA 2LD5A 4ESJA 4I6ZA 4MQVA 3JRAA 3NRVA 5F0CA 1Y8RB 2DMQA 3JTGA 2CQKA 1H9GA 3VYUB 2EFWA 1TWFJ 1XCVA 5D5WB 4UVAA 3AG1H 2EIMH 1DQUA 1RR8C 2CYYA 1XDSA 3A0BC 5F08A 1KONA 2JT1A 1U2WA 2X9DA 2M30A 4HOBA 1H88C 5F0HA 3JRCA 4BE0A 1RKWA 4BNCA 4II3A 3S14J 1GUUA 1IO2A 2CRGA 4IHVA 4RBOA 4V19K 1V3FA 1KU9A 1RPWA 1U5TB 2MSYA 1OYYA 1TW3A 1B8IA 1W5SA 3ABUA 2DU9A 4A3DJ 3F23A 1B9MA 1VTNC 2STTA 3I64A 1MBFA 1X19A 4HZFA 5ICFA 3G6EI 3HG9A 4A5MA 1P4XA 4XRSG 5J1UA 3IH4A 4IQJA 1V54H 2P8TA 3BTJA 3K10A 2FRHA 1MNDA 2H6CA 3WGGA 3WG9A 4C3HJ 1JT0A 2UZKA 4ENNA 2O9LA 2PI0A 4IHYA 5FLVA 3IAM2 4B4CA 4YG2F 1ODDA 3L2CA 1I5ZA 2EJRA 2DQLA 2OPTA 1IN6A 2IS4A 4HLXA 2O8KA 3MWMA 3WODF 4IOAF 1A6QA 4CYDA 3FXQA 2ICWG 4GXOA 2VJ4A 3I59B 2VPRA 3HUGB 4A2UA 3BJ6A 3BTCA 3FXOA 4ANJA 1A35A 1U8RA 4S04A 5EGOB 2L9SA 4LB5A 3CMMA 1NTCA 1YHQI 2VUMJ 4U7BA 4BS9A 1VF9A 4E7SA 3BG5A 4MLOA 1TNSA 3M07A 4NNJA 3GW2A 3JR9A 3RTRA 4NQWA 5ICCA 4O3MA 4RAFA 2R7WA 2B63J 2R7FA 2H1KA 1B4AA 2KIUA 1YS6A 3K7AJ 5GAHJ 2ZBKA 2Q0OA 4MEYF 3QOPA 2QKLB 2X51A 2M8GX 2V4JC 2VT2A 2LK2A 2MW8A 4HF2A 1U3EM 1XC5A 3E0JB 4RB3C 4EJOA 1HKSA 5J8FA 1WI3A 1R71A 1BOAA 2FBKA 4D5CA 3ISPA 4BEHB 3GZ5A 4L9VA 2FSWA 5B3SH 2O03A 4DZPA 2NYXA 3VSLA 2E5NA 2M7AA 3BR0A 3P9CA 3I4MJ 4LMYA 2DFHA 2JTVA 2E1MB 1J09A 3GBGA 3LA7A 3KYLA 3RYRA 3JRIA 5DEQA 4O6JA 2A07F 3EUHA 2ZXHA 1AHDP 2E2JJ 4RAZA 4XKBA 2EWNA 4KIBA 2Z1DA 3ECOA 1WSUA 1FOWA 3JTHA 1G3TA 5TGTA 4B48A 3F8CA 5J47A 2M34A 4XOTA 5ICEA 3CCJI 2E2HJ 4BKXA 4W97A 3WHBA 1YYVA 3CP8A 3I9V2 1BR2A 1VQKI 4IHXA 4A0XA 3HKZA 1T8IA 2OCCH 2F4MB 1T0FA 3HRUA 3TP0A 5HDKA 2LF8A 3CCYA 4OOIA 2HQ5A 3G3ZA 1ZGAA 5E8IA 4BGDA 1MMNA 2YUSA 2O61A 3BROA 3FF5A 3RIRA 2ZFWA 1TL8A 2JMWA 3OYJA 4UUTA 4WXCA 3Q9SA 5TJJA 3VPRA 1JGSA 4BDYA 3I4NJ 4RGUA 1WQ2A 3T1BA 2LTPA 2FU4A 4L5JA 4XNFA 4ENMA 1LVAA 3L9FA 4N9HA 2VJIA 2E60A 5HS7A 2WC2A 3L2RA 4IO9F 1ULYA 1ZN2A 5TISC 3FMRA 1YOVB 5CQGA 4A6DA 2K85A 4A12A 2KJBA 4EGYA 2FD5A 2LFBA 4PJMA 5CVUA 4Y17A 3QPTA 3DKXA 4XL9A 4XBFA 4FETA 1MH4A 3BDDA 3ZQHA 1R5ID 1HSJA 1MIJA 2Y31A 1D1CA 1WJ5A 3E3VA 3TDZC 2HKXA 2O3FA 3TW6A 4CGZA 4B3XA 2VODA 3OYGA 2L4MA 3FHZA 2HKOA 2K02A 3QP5A 4Y7NJ 1SD7A 5GP9A 5LHGA 1FSEA 2F5FA 4LIUA 1L0OC 4ZYAA 2MC4A 2F5EA 2VXDA 4EVIA 3TDUC 4RS8A 3HOTA 2XIGA 4LK1F 1ETXA 3HOSA 1ZHFA 5IY5H 3ROUA 2GAUA 2WBMA 3HXLA 3KP7A 1SMYF 2K3FA 2XUBA 3SFIA 5LD2C 2EB7A 1OJLA 2Q2EB 4U0WA 1FP2A 3H5NA 2OZ6A 2ZSIB 4QPQA 3GTOJ 4Y15A 4XR6A 1MMDA 1SAUA 4KN7X 2XASA 3ASNH 1EV7A 3S32A 4ZYEA 2NS7A 3U2RA 1KGSA 1X1PA 3MQ0A 4B3AA 1IDYA 2P5LC 4IKFA 3F9KA 3QPSA 2LVSA 4YFXF 3H0DA 3TO7A 3OYHA 3BZ6A 5HLHA 1IXCA 2W57A 1MBKA 4HX4A 2H94A 2DCEA 4CCNA 2MGQA 3C3WA 4MGRA 3J7YJ 2HZDA 3G1MA 1F36A 1HC8A 3X2QH 1R5GA 1YS7A 3DEUA 4G94A 4OU0A 4LJZF 4QSHA 3N4MA 1T08B 2IP2A 5D4RA 1HDPA 1TBXA 3HRTA 1IN5A 4WK8F 2MH9A 2TCTA 3LFUA 5J40A 2Y9YA 1QHGA 1TC3C 5E1ZB 2L4AA 2KDZA 1GT0C 2DMNA 2HU9A 3I3LA 2JUCA 4X6AJ 1IRFA 2QLZA 2J5OA 2BW3B 3HBLA 2WY8Q 1P6RA 2OQGA 3PNYA 1WJEA 2F5DA 3U1KA 1T2KA 3D5LA 1BIAA 2L2OA 4R1HA 2L5QA 3QODA 4HYEA 2JK3A 3L1PA 2XAHA 2ID3A 3GLLA 5BQTA 4PJLA 4MTDA 4A3EJ 1APLC 4M71A 5BPIA 4HF1A 4MNUA 4M3BA 3WTZA 1BL0A 1R6RA 3OSFA 3PQKA 3AKZA 2W7NA 1UMQA 4RA2A 2K86A 2ZJ2A 3DKWA 2VKDA 4J01A 2MG4A 3MKYB 1F43A 2IGNA 3FDYA 3IKVA 4G8XA 1B59A 1ETWA 3E5QA 5M5WJ 2LREA 1ZG5A 3LFKA 3GTLJ 2CW0F 2D45A 3RJPA 1WZ2A 1KQ0A 2KZGA 1IRZA 3HB9A 1FLIA 2KRHA 2BEOA 2RNJA 2LSOA 3K4CA 4A3LJ 3QYBA 3JCUC 5LFAA 1YX3A 2QEXI 2A6TA 2RNGA 5KAFC 1RETA 2FBHA 3M8EA 4CCJA 4KN4X 4OIPF 4YEJA 3M7GA 3G1LA 2WAQA 1O7FA 3B73A 1R58A 1XMXA 1E3HA 4DIQA 2FMLA 4GDFA 2IEKA 2MLGA 2UV1A 2X85A 2EBIA 4K2EA 2ISZA 4BDZA 4S0HB 1T39A 3PL8A 2DFEA 3L2WA 3H5RA 2QA4I 2YX7A 2FEZA 1SD5A 1O3TA 2IRFG 3KZIC 3IKTA 1Z05A 2MLKA 3S1QJ 2KIQA 4BJTA 3ML6A 4IEJA 2CU7A 5J3LA 5IP7J 2CUFA 6PAXA 3I0TA 1I3AA 3ZQLA 5E20A 2W48A 4RM2A 4E7IA 4IRIA 1HQCA 1XPXA 4XICA 1YRNA 2A68F 4QIWN 3H3ZA 2DMUA 5K7ZA 4XSXF 1W7PB 2QM3A 1NH3A 4I0BA 3JRHA 1ON1A 2VKVA 3OR1C 3R4KA 1BW5A 1Y8QB 2V7FA 3QWLA 1J59A 3R6SA 1Z7LA 2O8XA 1WH5A 4L0ZB 4XN3A 2EZHA 1H9TA 2EQRA 3CUOA 4KIGA 1MMSA 3HOXJ 3O3KA 2V1UA 3OY9A 3F22A 2GA1A 3F8MA 4A3BJ 3DWLE 2HEOA 3E5UA 4I7HA 2LC2A 3JRBA 1RNLA 2OBPA 3CUQB 3WU1B 3OYCA 1T98A 2E34A 4A93J 2ECBA 2VKHA 3ABLH 4E7HA 2LMDA 2IS1A 1P4AA 2NS8A 1B72B 2ZNYA 3FBIB 1VNDA 2PMHA 2DDAA 1JJ8C 2BHYA 2ETHA 3OIQA 5JVGF 2Y30A 1ZG3A 2LNBA 1LPQA 5E3NA 1R5HA 3F0CA 1YJ9I 2EPFA 5BNGA 5D5VB 1WPKA 3LWFA 5GTHC 2NS0A 4EATA 1MZBA 2I5UA 1ZARA 2P6TA 4WX9A 3I71A 1BJZA 2ZXIA 3HZJA 3U1DA 1ZRDA 4RAYA 3TO9A 1VQ5I 5FB2A 2COBA 2BY0A 3OL4A 4A69C 4AVZA 3CTAA 4CUGA 1PP7U 1VQ7I 3BR1A 2VL8A 1PVEA 1U5TA 3KEYA 4HLYA 4NDLA 2OC6A 3SHFA 1VQLI 2JSCA 2H27A 4LOCA 3CF5F 2OA4A 3RQIA 1RC9A 4C3JJ 2NVTJ 2IAIA 2FUG2 3KP2A 3NEUA 4OWRB 3DF8A 3SFZA 4ZYHA 3GZ6A 1IGNA 3H5AA 2DOEA 4J19A 1HBXG 3A2KA 2FX0A 3OS2A 2A69F 1LDKB 4RB2C 1MMAA 2WB1A 1K7AA 4RAGA 2FNPA 4KMFA 4P9UA 2BHZA 4KDPA 4CCKA 1P92A 2PMZA 3PUBA 2L7FP 2HGCA 3GWZA 1WFXA 3WU2C 4A6EA 4S05A 1JKOC 3CCLI 2CV2A 3VDXA 5IYBJ 4C2UA 1IDZA 2RQQA 3I59A 5F6FA 2E1MC 1RUOA 4DQ2A 3CCVI 5J1YA 4B09A 2Z33A 3PO2J 1MJBA 1YX5A 3HTUA 5C4XJ 1LNWA 1YW8A 1B1BA 2O7OA 3HDDA 3Q0VA 1TWAJ 5EGOA 1SFEA 2OUMA 2IA2A 2EFOA 3K4LA 2OAZA 1SFXA 3F72A 4D7MA 3FXMA 3W2AA 2HS5A 4LK0F 3QPHA 5FFZA 2KLOA 5CPRB 1Y0NA 3S8PA 3ZXSA 1P4WA 2W4SA 2XAFA 3OYFA 1OCTC 3BZKA 1MJ9A 1BW6A 3DEWA 4KT6A 1JGGA 5K7FA 3OYMA 1G2HA 2XAUA 3BOQA 4UB8C 1LDDA 4NUBA 1I39A 1EH8A 3K2ZA 1X2MA 3B6CA 2L7MP 3TW7A 5IP9J 2VBZA 1ON2A 1WRJA 4DGWB 4HV5A 2HYFA 5J1RA 2A5YB 2F4OB 3WGHA 3K69A 4BEHA 4M6YA 2R7RA 2UXXA 5LGNA 5ILSA 2IGMA 5LRRA 5IOZA 2JSPA 2W85A 2VQHA 2VXZA 3FXJA 1R1UA 4AWXB 2OZUA 1S6LA 4UV8A 1WJFA 5CQEA 5GPCA 5DM6F 3WTSC 2YU9J 2DA3A 2NOJB 2VE8A 2P81A 3HGGA 1HXDA 3CCRI 2MH2A 4O5VA 3BQZA 2Y0SN 1OQYA 2RN7A 3J7AY 2CQNA 2LKXA 2YSRA 2ZJPF 2K40A 2CW7A 3K0LA 5FFXA 4BQNA 2JUGA 4L9JA 2CQ7A 3K1MA 1FYKA 5LGTA 3FK6A 2O5RA 3WHCA 1WWXA 3TQNA 1EH6A 2GIZA 2VLAA 1S8NA 4G6DA 5IT9K 3MKLA 1YRNB 4JP0A 1TWGJ 3JRGA 2HYJA 2V79A 3R0AA 3K4BA 2VE9A 1I27A 4ZTFA 5JR3A 3CP2A 3ZRGA 1BR4A 2WV0A 3BC8A 3FMQA 5F64A 5KCMA 2R7DA 2K7LA 1JKPC 1QNTA 2HI3A 4JX6A 4BHBA 2LY2A 1XCBA 1XD7A 2HPMA 4HSRA 1YE9A 3A02A 2IA0A 3ASOH 1USSA 5E79C 3KPHA 1MW7A 3E6BA 2ZXJA 1T38A 3DBLB 1A31A 3IC7A 3N97A 3KLOA 2HOAA 2HDDA 3LSRA 3L2QA 3CDLA 3MFKA 2HDCA 2R7VA 3C18A 1OISA 3BY6A 4E7KA 4M9ZA 3FBNB 2HXIA 4PFPA 3BTLA 2M7BA 5EZGA 4L0YB 1X1AA 3O8HA 4ZYDA 4NC8A 5B1BH 2GQQA 4ESBA 2XDVA 2Q8KA 2J5PA 4BE2A 5LLQA 1BA5A 2IGOA 2HOTA 3OS0A 1E0EA 3V8LA 2Q2EA 2R7TA 2MBFA 2N8GA 4II2A 1XB4A 5AIPA 1MGTA 2M45A 1FSHA 2R5YB 2H6BA 3LAJA 2GXGA 3KP6A 3FIWA 2FXAA 3Q3SA 3DKYA 4JBAA 4M9SA 4KFCA 4G6TB 3V8KA 3HHHA 5H20A 1JUPA 3LSGA 2OTJI 1TQPA 1QZEA 2DO7A 3N05A 5C44J 2LBFB 4ITVA 1FPQA 3Q0UA 4RGRA 3SYTA 2V6EA 4PFOA 1TNTA 1IRXA 3A1YA 4D9JA 4W1UA 2BE5F 1S9HA 2V1DA 4A3GJ 1SD4A 3MMYB 3H36A 4V2FA 1U6GA 4ZTJA 2ELHA 1VQMI 4FQGA 3DPLC 1U78A 5FLXK 3W2VA 2F2EA 3DEEA 1IAWA 4LIVA 3ZMSA 3GFMA 5M5YJ 3LSJA 5DM7F 1EKEA 2G9WA 4L5EA 4A3FJ 1CF7A 2PFBA 3MZHA 4RLFA 5FROA 2ECCA 3B02A 4ENJA 2Y9ZA 1BC7C 3KYCB 3H3VK 1TP4A 4EM2A 2XB5A 1FIPA 4EEFG 3OYBA 4BQOA 3CD6I 3EUHC 3BCBA 2DODA 4PJJA 3ZQQA 3WE3A 2BW3A 2QQ9A 3ESWB 3G1OA 2EZIA 1BBYA 1Z6RA 1VQNI 1IRGA 2WWYA 3J80Z 2HQNA 3DV8A 3RPUA 3NQOA 1OCCH 4XLCA 1I1SA 1LKXA 1WKMA 2AHQA 4UHTA 4Y52J 1LFPA 1D1BA 1R23A 5GAGJ 2GLOA 2E36A 1IZ1A 3HM5A 3CC4I 2BZTA 2W24A 2XPWA 1T0FC 1JTXA 3QOEA 3ZCOA 3M1CA 3DBRB 4HNTA 1DU0A 2CWEA 1K61A 1EF4A 3KEOA 3GXOA 4Z6YA 5BPDA 2CUJA 2M2EA 1Z3XA 2VT3A 5ICGA 1T95A 4KUMA 4WXDA 2A61A 3DU6A 2ELKA 5A2QK 4LLGF 3VSKA 1YG2A 2K27A 4ZZDA 1ZG1A 3M4OJ 2AQFA 3FZVA 2P5KA 1EA3A 1ETYA 4BHCA 4BXXJ 2NXNB 2PBIA 3H35A 3RDIA 3QQAA 3TKYA 1BC8C 2IT0A 1U9NA 1GLNA 1TWCJ 2NVQJ 1MSFC 3ELKA 3F8NA 2XPUA 1W36C 2RDPA 2YR2A 1FOXA 3D0SA 5EF6A 3S3NA 1REPC 3D5RC 1XGMA 2E2IJ 3OIPA 4HNUA 1AA7A 1ZYRF 4Z2YA 3JW4A 2X1EA 5D8LB 1FZPB 1QBJA 2CGPA 1G8XA 4AIDA 3K1PA 4KITB 5BMZA 3IAS2 5E3LA 1I6XA 1A5JA 2L7ZA 2QVOA 2VOOA 2R7SA 1Y56A 3K9TA 3FM5A 4F91B 2ZSHB 3BLYA 4Y3OA 5JI6A 2CQQA 2DOAA 3C1DA 1VI0A 2EINH 2HXOA 3WTVC 2CH0A 2P5VA 3I53A 4AC0A 3GCMA 4IRGA 5DUIA 1Y39A 5D6FA 1VQ6I 2CO5A 1W7PA 1UHSA 2HVQA 2DYSH 4HX7A 4RLQA 3OYDA 2EV6A 2Q1ZB 3P9KA 1XMAA 2QWWA 4Q5SF 5K5QA 1MDMB 3HL2A 2XGDA 5AONA 1MBJA 5F1JA 1XTAA 2LDUA 3F6VA 5D6EA 3BR5A 3L09A 2NVUB 2M0CA 4UUVA 2VB6A 2JJ7A 1FOKA 3G4SI 3E1SA 3K1NA 5CVVA 4A3MJ 2VJ5A 2QSHX 4U87A 2VPLA 4NC7A 4A0ZA 3JRFA 4G7OF 3LSPA 3CUQA 1ZQ3P 3LMMA 5E1WA 2ESHA 2Z2SB 4TV7A 4OAYA 3CESA 2Z16A 3CCQI 1IJWC 1B72A 2DDBA 2D1VA 2QKMB 1NK3P 4EJUA 3NWSA 3L2UA 2NNYA 1LQ1A 1I6HJ 2BY1A 1CGPA 3KP3A 4DW6A 1IC8A 1MSEC 5ED4A 2E7XA 3ZPLA 1G3SA 2OTLI 3GEZA 2RVCA 4KIFA 4MEXF 1LFBA 1Y6IA 1GXPA 5HLTA 4AD9A 2K9NA 2KPMA 1SMTA 4UB6C 2L7KA 5E18F 5FJ8J 2EIJH 1D8KA 2Z5UA 2PJRB 4FISA 5ILVA 2PMUA 4B44A 1ITYA 5H6RA 4CH7A 1P7IA 4YIFA 2BVMA 4QWQA 1S72I 3PFYA 4FX0A 3RKXA 1G4DA 1V4RA 3BTIA 4ZDOA 1QQIA 3SZPA 2D5VA 5EZHA 1A6IA 4XRSA 1JT6A 4KNYA 2XC7A 4KISA 3MZ8A 1FTZA 2LLKA 3B6AA 4IXAA 3HOWJ 3CF2A 3TGNA 5DCMB 4UUSB 3KCCA 4BXUA 5BS6A 1F4KA 5LEKA 1OCOH 1KA8A 4PZJA 4EJVA 3ECHA 5FKNA 2E1OA 3S2WA 4PJ0C 1CF7B 1TQIA 4E6KG 2E1CA 4B8XA 2PJPA 4AYBN 5E17F 4EGZA 1PP8F 5K5OA 2V1NA 3CLOA 1FOYA 3R0JA 3RPUD 3OL3A 2V1XA 1O57A 2R5ZB 2BY2A 2DTRA 1FBQA 3OIOA 4LFUA 2ZJQF 1NK2P 4IPAA 3JAMK 4FCYA 1UZCA 5D5XB 1UHMA 4PSXA 5CLSA 2F4IA 1FMVA 3OSGA 5DS9A 1FWZA 2ZMEB 1BIBA 2FA5A 3KZZA 3O6BB 1C0WA 3U9GA 1SVLA 1D3YA 1X1CA 3FISA 1ZRFA 1LB2A 3GTGJ 4D1QA 2EA2A 3EUKL 4M3DA 1J75A 1IF1A 5L3DA 4I99C 5L3EA 1EH7A 1ETKA 2GOMA 2M87A 3RQ4A 3H0GJ 2LG4A 3J80K 1JE8A 2KFDA 1DP7P 4XRFA 2PQ8A 4NBQA 4NHJA 2HZTA 2I10A 1OFCX 1WCMJ 1KU2A 1LEAA 1I50J 4BACA 1OMIA 2JA7J 4A3CJ 4N4OB 3S1NJ 3CCSI 2QBYB 2KKOA 1J0RA 2BYVE 2VN2A 1MKMA 3G71I 4E4HA 3LL7A 2YPRA 2VQGA 3QRFF 1DPRA 2WA0A 2HQRA 5IYCJ 5J4VA 4IJAA 3S1RJ 1V55H 3O2PE 4WF2A 2F48A 4RM3A 3FXUA 1O3QA 4HX8A 3H9QA 4G6QA 2CV0A 1V5GA 3VODA 4A3IJ 3KFWX 5IT9Z 3QU3A 2XHKA 3MN2A 4XN0A 1N25A 1Q1VA 2QQAA 3J81K 1UB9A 4BE1A 1T6SA 4BQQA 3WU0A 3SXYA 2YX4A 5LRSA 3FM3A 3S16J 4HSTA 3P5JA 3QPLA 1P2FA 2JZYA 4EJWA 1MNMC 1LEBA 1Z6TA 3BG9A 3FKJA 5LEJA 2CV1A 3IHUA 2XROA 1W36D 5K5RA 4G7HF 2DT7B 1RIOH 3HSFA 4RDUA 3BR3A 3AG2H 1PYVA 2FNAA 4XKCA 2LKSA 2X1DA 3BR6A 4UV9A 1MBHA 3V4GA 4CICA 2FBIA 1WI9A 3PQJA 2W25A 1Z67A 2X48A 2ZFUA 3M1EA 4F7ZA 2VONA 1OPCA 3ABMH 4J00A 2P4WA 4XQFA 1FBUA 3PO3J 2GM4A 1U5TC 3RPQA 2IPQX 2P6SA 1G3YA 4OIRF 4EV0A 1E3PA 3RKYA 1LFUP 1FTTA 4XLAA 4FE7A 1UG2A 3WTUC 4XONA 3AAFA 1VQ4I 3L7WA 3QP6A 2CFOA 2I8DA 3ONQA 4KJZA 2IW5A 5EEGA 4DZJA 4RGSA 4U88A 3OYNA 4H0EA 3FXKA 3AG4H 2WADA 5EDNA 1RI7A 1QO0D 1FEXA 3F8FA 1J5YA 2DW4A 3PIPF 1K83J 1R7JA 1ZAOA 2X4HA 1OYWA 4XKVA 1LJ9A 5FD5A 2EFPA 3V8JA 1QVTA 2X0LA 4FHTA 1JKQC 3K4MA 1TLHB 4IF4A 4ZZLA 2PG4A 4IRHA 2Y75A 3LA3A 2A6EF 2VOPA 2AXTC 1G6NA 4JK1X 2R5YA 1PUFB 3ZR8X 1JKRC 2X1CA 5FLXZ 2JPBA 3HTSB 1XGSA 4M3GA 1TQMA 5HLGA 1P7JA 1STZA 3NARA 1FYLA 1WJBA 3T5XA 1KQ9A 2CQXA 3IH3A 2LOOA 3F21A 2LBFA 1M1EB 1X58A 3GLXA 3C2GA 2DJIA 3QU6A 3JSOA 3NWTA 2DFIA 2C6YA 3GTKJ 5F1RA 2L54A 1AKHB 3SDBA 5EJCA 3C2BA 1HSTA 5HDNA 4WXHA 2RC4A 2OD5A 4D0PA 2CFXA 4LLLA 3LOCA 2OF7A 3OWTA 2GWRA 2CJJA 4CDGA 2DK8A 3DLAA 2LH9A 3BP8A 3GVAA 2EFQA 4Y4RA 1ZTRA 3RSNA 3T0YA 3TO6A 5HODA 5JLWA 2DMTA 3QYEA 5E3OA 4PGGA 1VFCA 2UWMA 1O3RA 3VYSB 3S3OA 4V2GA 4M3FA 5DDGA 1XSVA 2DA1A 4CZZA 4HG2A 1DU6A 1TZLA 2H8RA 2VC1A 3TMOA 2HTSA 5DV5A 2R0QC 3E5XA 4DBQA 3HPHA 4WCGA 4XLFA 3J7AO 3G2BA 2ZO4A 3MD2A 4XMYA 3L00A 3KP5A 5BOXA 4HAMA 2JVGA 2WY7Q 3JREA 1NHAA 2V6CA 5A2QZ 4LITA 4ETSA 2LKPA 1FMWA 2ADUA 4AIHA 2BVLA 4QTRA 3E6CC 2DQRA 3ZQFA 5EYRA 4F92B 4CA0A 4A3KJ 1X1BA 1QGPA 1WJCA 1ZLKA 1GHCA 2GA2A 2JPCA 3FXRA 3FK7A 3ZN0A 5HVQC 3VYRB 1S5LC 3LQRA 2ACJA 2XF7A 1OLTA 3E6DA 4XOPA 4BXFA 2L9NA 1MH3A 2QGUA 5GTIC 1VQ8I 1HKTA 3CCUI 1Z91A 4AIJA 2DOFA 1YJWI 5HLIA 2X6XA 3GX4X 1GXQA 1L3LA 1AOYA 3O8GA 1YW7A 4IOCF 1UHWA 3BZCA 3GUDA 2IVMA 3BG7A 4OMZA 4AU7A 1X4OA 4NC6A 5L3FA 4BH9A 3EDPA 4AIKA 4UVCA 2TDXA 1SAXA 1DPUA 3FWEA 2JN6A 3ABKH 4B43A 2BXZA 5CYVA 1K4TA 2VBYA 3JSPA 2KDOA 5KK1A 5JFRA 3KIOA 3W6KB 3S2HJ 5H6QA 2DXIA 1RZ4A 2HPIA 5C4JJ 5E1XA 4HDVA 4G9YA 1TT0A 2KL4A 3HSRA 3R61A 1D5VA 3VWBA 3M9AA 4M72A 2VQLA 3DCFA 4XK4A 2FMYA 3BG3A 1E17A 4EMSA 2L0KA 3M3YJ 1J9IA 2ISYA 1QPMA 5L3CA 1W1WE 1MD0A 4PDKA 1I1GA 5L3GA 1RKTA 2AXLA 4MTEA 1Z1DA 5LBQA 1VQ9I 4P9FA 3CCEI 3KX2A 2Y0SA 1Z3YA 3WGIA 2AQEA 2DT6A 1MBGA 1MDMA 2KJCA 2QCOA 3NAUA 3HHGA 2K9MA 2DA7A 3H1CA 3H3UA 1ZR4A 5DYMA 3EPZA 2OCEA 4M6VA 4IHWA 3KEQA 3ZMUA 3ZGKA 3CCMI 1WGXA 2EZKA 5FKKA 1G3WA 2XPVA 1P9QC 2ESNA 2HYGD 2K3PA 2L02A 2PN6A 4C2MJ 2JWTA 1KU7A 2XV4S 3E6MA 2XKOA 4N4NB 4IX7A 3SEQA 2STWA 1PDNC 2JVHA 2LF7A 2COMA 3HGYA 2XAJA 5CJ9A 2HVSA 5EG0B 1J2XA 1ONVA 2MABA 5M3MJ 2K9LA 1ERDA 1CQTA 1BI2A 1SFKA 2A05A 2AO9A 2L9RA 2V9VA 2CS3A 3K4NA 1SANA 2HWVA 3ZMZA 3I4PA 4BUPA 3SZTA 1WH7A 2IBDA 3V7RA 3TEDA 1X3UA 3IRQA 1JUMA 2A3SA 2CMPA 3TOBA 4M73A 1TTYA 4DNCA 1MBEA 4OIQF 4Q47A 4CCLA 1OR7A 4ZDPA 2IXSA 3HOYJ 4MO7A 2B7EA 3HYIA 5FD6A 4PGHA 1BJAA 2Y0MA 2DN0A 2HOEA 2PJRA 2G0EA 1QRYA 2R7XA 4Y13A 3G73A 3RZOJ 2KP6A 3FXLA 1FJLA 4U7DA 1ZGWA 2ZMEC 5JHUA 2XVCA 1BI0A 3C2HA 1YW9A 2OJED 5DD8A 1X4PA 3CMYA 5ILUA 3K4KA 4AM3A 5IYDJ 1XGOA 3KYDB 2EILH 1IXSB 1NG6A 4DJAA 2W82A 2RV8A 3AG3H 2RAEA 3LSMA 5DCMA 4UUSA 5EEHA 2R7ZJ 4UVBA 4ZDLA 2XRLA 5TRDA 1YO5C 3MEXA 3JAMZ 2WAEA 1K78B 1E3OC 2Z9OA 3GZNB 1OYIA 3I5UA 5IPAA 4BBSJ 2Z3YA 3W6VA 3ZQIA 1YITI 3S93A 2EFNA 3A01B 3H9GA 3K4JA 5CKTA 2LRDA 3F3XA 5FRMA 3VYTB 1D0XA 1HKQA 1UCRA 2M8EA 1YFHA 4D7NA 2BOLA 3OYEA 3H92A 2R5ZA 1ENHA 3DTKA 3OYIA 4E7JA 2LY1A 4GRIA 4BBRJ 1LVKA 1DGWY 1SVOA 1ZKGA 4I09A 4R79A 3CMAI 1VQPI 1DDNA 3ERMA 1D0YA 4HF0A 4Q4ZF 2XKPA 2CW8A 3KZYA 3WTYC 2ZMEA 3RKWA 3S2DJ 1RR7A 4A0YA 5D8KB 3S3MA 4DBRA 2EK5A 1KU3A 1RESA 2DMPA 4GYGA 4OINF 1HA8A 3AL0B 1ETOA 3P9IA 1BM9A 2E5ZA 2R3SA 1HW5A 4FE4A 2VI6A 4N9IA 2DA2A 3IV5A 3IP4B 3KE2A 2D1HA 2UUZA 1KZHA 3V42A 3HPGA 3VB2A 4RMNA 1YIOA 1Z0XA 1QPIA 1WJAA 1R1TA 2IGKA 5CVRA 4B47A 4HPQA 2M3AA 2QBYA 2GIVA 4FT8A 1F5TA 1S7OA 3P7NA 4C3IJ 2VIXA 4F52A 3J81Z 4IZZA 3DXJF 3HC7A 4JQFA 4ESFA 3ZP5A 3BQYA 3Q5FA 3L2VA 3HKZN 3OOUA 1HW2A 3PM1A 4XKWA 4I02A 2KRFA 5KHDA 4LG0B 4YRVA 5JLXA 4RB0A 1OCRH 5HS8A 4IHTA 3CUQC 2DA6A 2FJ1A 5K7HA 4YIRX 1HLVA 2XSDC 2MD5A 2BV6A 1X1DA 3WG7H 3ZN1A 4ZH4F 2FF4A 2VBXA 4L9NA 1LDJA 4BAYA 4E7ZA 2QSFX 2P7CB 1Z21A 2L9VA 1KYWA 2CSOA 3Q9VA 1R4MB 1T33A 2IJLA 5FRNA 1H8AC 1W5TA 3FKIJ 4HV6A 4ABZA 2HOSA 3BJAA 4PUSA 3FMSA 3W3CA 3BWGA 3LQQA 4HBLA 3LSKA 5FGMA 1RUNA 2JRTA 2Y2ZA 1WJDA 2GZWA 2NAZA 4FX4A 4IHSA 3J7ZI 1GVDA 1QVUA 1HCRA 4XLPF 2K4JA 2OV7A 3CDHA 3S15J 3QYFA 3RCOA 2MC3A 1BN5A 1XS9A 3I58A 1GV2A 1LE8B 1RRJA 1AU7A 4C2TA 3BCAA 2QQBA 4EJTA 4GFBA 4JOMA 1JI8A 4AUXA 3TP3A 2FQ3A 2ZC2A 3ZMTA 3GTMJ 4YELA 2NOGA 1X2NA 2JA5J 1IXRC 2P0WA 2UXNA 1ORKA 2DFFA 5FKLA 4CYCB 4XM3A 3W6JB 2M5WA 3A4CA 5GPAA 1OCZH 3MZYA 3ZMVA 4U0YA 1K79A 2L01A 3BG6A 2H09A 2QF7A 4YIIA 3OR2C 3BT9A 3BPXA 1ETQA 3SQNA 2E71A 2CG4A 2JRMA 3BJOA 3F6OA 2KZVA 4YFKF 2QUFA 2YU3A 2W84A 1K6OA 3R60A 2F5VA 3PFIA 4DYCA 2ZCWA 2YS9A 3RI4A 2R7QA 1SVMA 4CSWA 3PSFA 2KQRA 4EM1A 1R22A 2QZ8A 1PUFA 2PX9A 3OOPA 1JTYA 1XX5A 2EV0A 1XDUA 1BI3A 1UJ8A 1POGA 4KICA 1ACIA 1S7EA 1GVJA 2F6CA 3DTEA 2GXBA 2FOWA 1Y1VJ 2LR8A 3MVPA 1O4XA 3IWFA 4P5OA 2E7WA 3WTXC 4P96A 1USTA 4OAZA 4L18B 3S1MJ 2V9KA 1Z9CA 3TOAA 1W0TA 1AKHA 1B8IB 4C9YA 3VOEA 3FX3A 1Y1WJ 4PSWA 1D0ZA 3EQLF 1IV8A 4UY8I 5H2FC 1SC7A 1FP1D 1V5FA 1TT5B 4G7ZF 3LSTA 4HQEA 1SFUA 1EJ9A 5GAEJ 2PLYA 4LLNA 3VFZA 2IA1A 2XGXA 2DI3A 4C30A 3I55I 3GMEA 1Q1HA 2BY3A 3D5SC 5IT3A 1UFMA 3REOA 3IWZA 1K4SA 4KYWA 1K6YA 5FO5A 3ZQ7A 1UG0A 1WVRA 2EH3A 2M4GA 5B1AH 5F0FA 1OKRA 4XLNF 5LHIA 1GV5A 3K70C 2ZJRF 4QLCU 4ASNA 4LD5A 3A0HC 3KLNA 5ERIA 1JHFA 2K4BA 5E8GA 1IN8A 2XF6A 4RGXA 2XRNA 2EIKH 1FIAA 4KA4A 1JJ6C 4H4KC 4AYBA 2DLLA 4F55A 2VKEA 1FBSA 4PCQA 4LG3A 4B1RA 3JRDA 1ETVA 3CC7I 3HOUJ 2XGEA 4NQWB 4HNVA 1IV6A 5HOOA 1DGRM 3D1NI 5F27A 5F04A 2R7UA 1NG7A 1E2XA 4BYYA 2WAQN 1FC3A 1B9NA 1MNEA 1YI2I 1X3ZB 1IN7A 3DPUA 2XB0X 3UR3C 4MFEA 1QHHD 4ENKA 1ZRCA 2EA4A 5LHHA 2Y48A 1JUSA 5KNLA 4KT5C 3DP7A 3GYHX 4GGGA 3MKZA 1JHHA 1ZR2A 5CVJA 2Z99A 5J4YA 2NVYJ 2QYOA 1XG1A 3CJTB 3LAPA 1YJNI 2A5WA 4XLEA 3ULQB 1DUXC 2RREA 2WV1A 3V7SA 3ZOBA 5AIQA 2NNNA 4XORA 3DU5A 5C3EJ 1QZZA 2X6YA 2XSJC 1W0UA 3I56I 2LY9A 4XIDA 4XRMA 1ZREA 2LP0A 3DFGA 4M3EA 4ZC3A 5KVRA 1W5CC 4JX5A 1G59A 4IVNA 1R9TJ 1HDDC 4P55A 2HR3A 3HOZJ 1W7PD 3RZDJ 4D5FA 1TWHJ 3TL4X 3HOVJ 2TRTA 1UAAA 5D4SA 1H89C 3M8JA 2R4GA 1N75A 2ZB9A 1KYZA 4X1EA 4MHGA 2X6WA 1IUYA 3LSIA 3SEZA 1MJAA 3CC2I 2NVXJ 1ZGJA 2DTZA 3LNQA 3CMEI 1HW1A 1IG7A 2CUZA 4PK4A 4A5NA 2XAGA 1XSDA 1AWCA 3EYIA 1IN4A 3OYKA 3KP4A 4BU2A 1T56A 4I01A 3UKGA 1V5EA 1TW2A 3SJMA 2KIMA 1FX7A 1IUFA 2KISA 2K9SA 2DYRH 3OYAA 3F8BA 2QSGX 4BQAA 2R7OA 1UELB 2B0LA 2OQRA 4RB1A 2JA6J 2B9SA 4LB6B 3S17J 1YTYA 3IL2A 1O7LA 2RKHA 3C7JA 3PSIA 2KT0A 2M0MA 1YIJI 2GOXB 3A03A 2DK5A 4U0VA 5EG0A 3COAC 1I3QJ 1R36A 4G12A 4IQ4A 2QQ8A 3HIFA 4ZYGA 1U0JA 2X6OA 2KHMA 1OCPA 2HNHA 4F93B 3CO6C 5J6XA 2BGCA 3GO5A 4P1WA 3KETA 1SEUA 2LYCA 3ZMDA 3DQVC 1QA6A 1ZH5A 2AS5F 2JA2A 3GTJJ 5M3FJ 1F9NA 2IS2A 3CZ6A 5HDGA 3CJRB 3M8FA 2GBYA 1BI1A 2HFHA 2XGCA 1PUEE 4DYRA 2M9HA 1S7AA 5GADJ 3T8RA 4E70A 4CCOA 2VASA
chains in the Genus database with same CATH topology
4ON0A 5K1YA 4YFNF 4Q48A 1J7KA 4BHPA 1R00A 2RGVA 4CXFA 1ZLJA 3GFIA 3GFLA 1FT9A 3VEPA 2FE3A 4M6XA 2NRAC 4WWCA 3WTWC 4N0BA 3WE2A 4LGWA 1K78A 3CJNA 4CO8A 4KMUX 3BPVA 1B6AA 1FYMA 1XSXA 2P7VB 3HRMA 4L9TA 2MA3A 1Z7UA 2M1BA 3V7CA 2RQPA 1A04A 2DBBA 4GYIA 3ERED 4GO1A 5JVTA 4UXNA 3HUGA 1S29A 4M74A 3IRRA 1S3JA 2PEXA 1JXSA 4XSZF 2D2WA 4EM0B 5D5UB 1YQAA 2O0YA 2XAQA 4HW0A 5CVIA 3OV8A 3MAJA 2ZKZA 3GF2A 3RYPA 1F1ZA 1O3SA 2A6HF 2OU2A 2F5CA 3HSEA 1QZYA 3E97A 1XGNA 1W4MA 2DT5A 1IW7F 4LG0A 2QENA 4OIOF 1H0MA 4EQQA 3WTTC 3QAHA 4R8HA 5DD4A 1SD6A 5L3BA 5LGUA 1YLFA 3MCZA 5DCFA 3LA2A 4AVPA 1FNNA 2HTJA 4M9XA 3T8TA 4I0AA 1FY7A 2DAOA 4HQMA 3CO7C 3ABTA 4CHUA 2DPUA 4L5IA 2WTEA 4UNOA 1KQ8A 3EYYA 4HA8A 4GCVA 2O6GE 3EETA 4NB5A 2FOKA 5DUKA 4MQ9F 3DPTA 3I54A 2ZNZA 2G7HA 2E1NA 2G7UA 1XN7A 2KIFA 2BBYA 5J8CA 4HDUA 4OMYA 1XMKA 3GFJA 3HRSA 1Y0UA 2EV5A 2VBWA 5HS9A 4I98B 2VC0A 1D8JA 2L3DA 1R1VA 2DPDA 4I2OA 4ESJA 4MQVA 3NRVA 3JTGA 2CQKA 1H9GA 2EFWA 1XCVA 5D5WB 4UVAA 2CYYA 1XDSA 2JT1A 1U2WA 2M30A 4HOBA 4BNCA 1V3FA 1KU9A 1U5TB 1OYYA 1TW3A 1W5SA 3ABUA 2DU9A 3F23A 1B9MA 1VTNC 2STTA 3I64A 4HZFA 5ICFA 4A5MA 1P4XA 2P8TA 2FRHA 2H6CA 3WGGA 3WG9A 2PI0A 2UZKA 4ENNA 4YG2F 1ODDA 3L2CA 1I5ZA 2EJRA 2DQLA 1IN6A 4HLXA 3MWMA 3WODF 4CYDA 3FXQA 4GXOA 3I59B 4A2UA 3BJ6A 1U8RA 4S04A 4LB5A 4U7BA 1TNSA 3GW2A 3RTRA 4NQWA 5ICCA 4O3MA 2R7FA 1B4AA 2KIUA 1YS6A 2ZBKA 2Q0OA 4MEYF 3QOPA 2VT2A 4HF2A 1U3EM 4RB3C 4EJOA 1HKSA 5J8FA 1BOAA 2FBKA 3ISPA 3GZ5A 4L9VA 2FSWA 2O03A 2NYXA 3P9CA 4LMYA 2JTVA 3LA7A 3RYRA 5DEQA 4O6JA 2A07F 3EUHA 4RAZA 2EWNA 4KIBA 3ECOA 1WSUA 3JTHA 1G3TA 3F8CA 5ICEA 1YYVA 4A0XA 1T0FA 3HRUA 5HDKA 2LF8A 4OOIA 3G3ZA 1ZGAA 5E8IA 2O61A 3BROA 3FF5A 3RIRA 2ZFWA 4WXCA 3Q9SA 5TJJA 1JGSA 4RGUA 1WQ2A 3T1BA 2FU4A 4L5JA 4ENMA 1LVAA 3L9FA 4N9HA 5HS7A 2WC2A 1ULYA 1ZN2A 3FMRA 4A6DA 4A12A 2KJBA 4EGYA 5CVUA 4Y17A 3QPTA 4XBFA 3BDDA 1HSJA 3E3VA 3TDZC 4CGZA 2HKXA 2O3FA 2VODA 2L4MA 3FHZA 2HKOA 2K02A 3QP5A 1SD7A 5LHGA 1FSEA 2F5FA 1L0OC 2F5EA 4EVIA 3HOTA 3TDUC 4RS8A 2XIGA 4LK1F 3HOSA 1ZHFA 3ROUA 2GAUA 3KP7A 1SMYF 2XUBA 2EB7A 4U0WA 1FP2A 2OZ6A 4Y15A 4KN7X 2XASA 1EV7A 4ZYEA 3U2RA 1KGSA 3MQ0A 2P5LC 4YFXF 3TO7A 3BZ6A 5HLHA 1IXCA 2W57A 4HX4A 2H94A 3C3WA 4MGRA 1R5GA 1YS7A 3DEUA 4G94A 4OU0A 4LJZF 3N4MA 2IP2A 5D4RA 1TBXA 4WK8F 3HRTA 1IN5A 2MH9A 5E1ZB 2L4AA 1IRFA 2QLZA 2J5OA 1P6RA 2OQGA 2F5DA 1T2KA 3D5LA 1BIAA 4R1HA 4HYEA 2XAHA 5BQTA 4MTDA 4M71A 5BPIA 4HF1A 4MNUA 3WTZA 3PQKA 2K86A 2ZJ2A 3DKWA 3IKVA 4G8XA 1B59A 3E5QA 1ZG5A 3LFKA 2CW0F 2D45A 3RJPA 1KQ0A 1FLIA 2BEOA 2RNJA 2LSOA 3M8EA 2FBHA 4KN4X 4OIPF 3M7GA 1O7FA 3B73A 1R58A 2FMLA 2MLGA 4K2EA 2ISZA 1T39A 2YX7A 2FEZA 1SD5A 1O3TA 2IRFG 3IKTA 1Z05A 2MLKA 3ML6A 6PAXA 3I0TA 5E20A 4IRIA 1HQCA 2A68F 3H3ZA 4XSXF 1W7PB 2QM3A 4I0BA 1ON1A 3R4KA 1J59A 3R6SA 2O8XA 4L0ZB 1H9TA 3CUOA 4KIGA 3O3KA 2V1UA 3F22A 2GA1A 3F8MA 2HEOA 3E5UA 4I7HA 1RNLA 2OBPA 3CUQB 3WU1B 1T98A 1P4AA 2ZNYA 2PMHA 2ETHA 1ZG3A 2LNBA 1R5HA 5D5VB 3LWFA 2NS0A 1MZBA 4WX9A 1ZARA 2P6TA 3I71A 3U1DA 1ZRDA 4RAYA 3TO9A 5FB2A 3CTAA 1PP7U 1U5TA 4HLYA 3SHFA 2JSCA 2H27A 2OA4A 3KP2A 3NEUA 3DF8A 3SFZA 4ZYHA 3GZ6A 1HBXG 2A69F 1LDKB 4RB2C 1K7AA 2FNPA 4KMFA 4P9UA 4KDPA 1P92A 4S05A 3GWZA 2HGCA 4A6EA 3I59A 5F6FA 1RUOA 4DQ2A 4B09A 2Z33A 1MJBA 3HTUA 1LNWA 1YW8A 1B1BA 1SFEA 2IA2A 2EFOA 2OAZA 1SFXA 3F72A 2HS5A 4LK0F 3QPHA 5FFZA 1P4WA 2XAFA 1MJ9A 3BOQA 1LDDA 1EH8A 3K2ZA 2VBZA 1ON2A 1WRJA 4HV5A 2HYFA 2A5YB 3WGHA 3K69A 4M6YA 2UXXA 5LGNA 5ILSA 5LRRA 2W85A 2VXZA 1R1UA 4AWXB 2OZUA 1S6LA 4UV8A 3WTSC 2VE8A 1HXDA 2MH2A 4O5VA 2RN7A 2YSRA 3K0LA 5FFXA 4L9JA 3K1MA 1FYKA 5LGTA 1WWXA 3TQNA 1EH6A 1S8NA 4G6DA 5IT9K 2V79A 3R0AA 2VE9A 1I27A 5JR3A 2WV0A 3FMQA 5F64A 2R7DA 2K7LA 1QNTA 4BHBA 1XCBA 1XD7A 2IA0A 1USSA 3E6BA 2ZXJA 1T38A 3IC7A 3N97A 3KLOA 3MFKA 2HDCA 3C18A 3BY6A 4M9ZA 4L0YB 4ZYDA 2GQQA 4ESBA 2Q8KA 2J5PA 5LLQA 3V8LA 2Q2EA 2MBFA 1XB4A 5AIPA 1MGTA 2M45A 1FSHA 2H6BA 3LAJA 2GXGA 3KP6A 2FXAA 4JBAA 4M9SA 4KFCA 3V8KA 3HHHA 5H20A 1TQPA 2DO7A 1FPQA 4RGRA 1TNTA 2BE5F 2V1DA 1SD4A 1U6GA 2ELHA 3DPLC 1U78A 5FLXK 2F2EA 1IAWA 3ZMSA 3GFMA 2G9WA 1CF7A 2PFBA 3MZHA 3B02A 4ENJA 1BC7C 4EM2A 3WE3A 2QQ9A 1BBYA 1Z6RA 1IRGA 2WWYA 3J80Z 2HQNA 3DV8A 3RPUA 3NQOA 1I1SA 1WKMA 4UHTA 1R23A 1IZ1A 2W24A 2CWEA 3KEOA 3GXOA 5BPDA 2VT3A 5ICGA 4KUMA 4WXDA 2A61A 5A2QK 4LLGF 1YG2A 2K27A 4ZZDA 1ZG1A 3FZVA 2P5KA 4BHCA 2PBIA 3RDIA 3TKYA 1BC8C 2IT0A 3ELKA 3F8NA 2RDPA 2YR2A 3D0SA 1REPC 1XGMA 1ZYRF 4Z2YA 3JW4A 5D8LB 1FZPB 1QBJA 2CGPA 3K1PA 5BMZA 1I6XA 2QVOA 2VOOA 3K9TA 3FM5A 5JI6A 3C1DA 3WTVC 2P5VA 3I53A 4IRGA 5DUIA 5D6FA 2CO5A 1W7PA 4HX7A 2EV6A 3P9KA 1XMAA 2QWWA 4Q5SF 5K5QA 1MDMB 5AONA 2LDUA 3F6VA 5D6EA 3L09A 4UUVA 1FOKA 3K1NA 5CVVA 4G7OF 4A0ZA 3CUQA 5E1WA 2ESHA 4TV7A 2D1VA 4EJUA 1LQ1A 2NNYA 1CGPA 3KP3A 5ED4A 2E7XA 3ZPLA 1G3SA 3GEZA 2RVCA 4KIFA 4MEXF 1GXPA 4AD9A 1SMTA 5E18F 1D8KA 2Z5UA 5ILVA 2PMUA 5H6RA 4YIFA 4QWQA 1G4DA 4FX0A 3RKXA 1V4RA 1QQIA 3SZPA 4KNYA 4IXAA 3TGNA 5DCMB 1F4KA 3KCCA 4BXUA 5BS6A 1KA8A 4PZJA 4EJVA 3ECHA 3S2WA 1CF7B 1TQIA 2E1CA 4B8XA 2PJPA 5E17F 4EGZA 1PP8F 5K5OA 3CLOA 3R0JA 2V1XA 1O57A 2DTRA 1FBQA 4LFUA 4IPAA 3JAMK 5D5XB 1UHMA 5CLSA 1FWZA 2ZMEB 1BIBA 2FA5A 3KZZA 3O6BB 1C0WA 3U9GA 1D3YA 1ZRFA 1LB2A 2EA2A 1IF1A 1J75A 5L3DA 5L3EA 1EH7A 2M87A 3J80K 1JE8A 1DP7P 4XRFA 2PQ8A 4NHJA 2HZTA 1KU2A 1LEAA 1OMIA 2QBYB 2KKOA 1J0RA 2BYVE 2VN2A 1MKMA 2YPRA 3QRFF 1DPRA 2HQRA 4IJAA 3O2PE 4WF2A 3FXUA 1O3QA 4HX8A 4G6QA 3VODA 3KFWX 5IT9Z 3QU3A 2XHKA 2QQAA 3J81K 1UB9A 1T6SA 3WU0A 3SXYA 2YX4A 3FM3A 1P2FA 2JZYA 4EJWA 1LEBA 1Z6TA 5LEJA 3IHUA 2XROA 5K5RA 4G7HF 1RIOH 3HSFA 2FNAA 4UV9A 3V4GA 4CICA 2FBIA 1WI9A 3PQJA 2W25A 3M1EA 4F7ZA 2VONA 1OPCA 2P4WA 1FBUA 1U5TC 3RPQA 2IPQX 2P6SA 1G3YA 4OIRF 4EV0A 3RKYA 3WTUC 3AAFA 3L7WA 3QP6A 5EEGA 2IW5A 4RGSA 4U88A 4H0EA 1RI7A 1QO0D 3F8FA 1J5YA 2DW4A 1R7JA 1ZAOA 2X4HA 1OYWA 1LJ9A 5FD5A 2EFPA 3V8JA 2X0LA 4FHTA 1TLHB 4IF4A 4ZZLA 2PG4A 4IRHA 2Y75A 3LA3A 2A6EF 2VOPA 1G6NA 4JK1X 5FLXZ 2JPBA 3HTSB 1XGSA 1TQMA 5HLGA 1STZA 1FYLA 3T5XA 1KQ9A 3F21A 3GLXA 3QU6A 3JSOA 2C6YA 2DFIA 5F1RA 2L54A 1HSTA 5HDNA 4WXHA 2RC4A 2OD5A 4D0PA 2CFXA 4LLLA 2GWRA 4CDGA 2DK8A 3GVAA 3TO6A 3BP8A 2EFQA 3T0YA 4PGGA 2UWMA 1O3RA 5DDGA 1XSVA 4CZZA 2VC1A 2HTSA 5DV5A 3E5XA 4WCGA 3J7AO 2ZO4A 3L00A 3KP5A 5BOXA 4HAMA 1NHAA 2V6CA 5A2QZ 4ETSA 2LKPA 2ADUA 4AIHA 3E6CC 2DQRA 1GHCA 1QGPA 1ZLKA 2GA2A 2JPCA 3FXRA 3ZN0A 5HVQC 3LQRA 2ACJA 3E6DA 1HKTA 1Z91A 4AIJA 5HLIA 3GX4X 1GXQA 1L3LA 1AOYA 1YW7A 1UHWA 3GUDA 2IVMA 4OMZA 5L3FA 4BH9A 3EDPA 4AIKA 4UVCA 2TDXA 1SAXA 1DPUA 3FWEA 5CYVA 2VBYA 3JSPA 5KK1A 5JFRA 3W6KB 5H6QA 1RZ4A 5E1XA 4HDVA 4G9YA 3HSRA 3R61A 1D5VA 3M9AA 4M72A 2FMYA 1E17A 4EMSA 1J9IA 2ISYA 1QPMA 5L3CA 4PDKA 1MD0A 1I1GA 5L3GA 2AXLA 4MTEA 1Z1DA 5LBQA 4P9FA 3WGIA 1MDMA 2KJCA 3HHGA 3H3UA 5DYMA 3KEQA 3ZMUA 1G3WA 2HYGD 2ESNA 2L02A 2PN6A 1KU7A 2XV4S 3E6MA 2XKOA 2STWA 1PDNC 2LF7A 2COMA 2XAJA 5CJ9A 1J2XA 1ONVA 1BI2A 2V9VA 5LEKA 3ZMZA 2HWVA 3I4PA 3SZTA 3V7RA 1X3UA 3IRQA 2A3SA 3TOBA 4M73A 1TTYA 4DNCA 4OIQF 4Q47A 1OR7A 5FD6A 3HYIA 4PGHA 1BJAA 2Y0MA 2HOEA 4Y13A 3G73A 4U7DA 5JHUA 2XVCA 1BI0A 1YW9A 5DD8A 5ILUA 1XGOA 1IXSB 2RV8A 5DCMA 5EEHA 4UVBA 5TRDA 1YO5C 3MEXA 3JAMZ 1K78B 2Z9OA 1OYIA 3I5UA 2Z3YA 2EFNA 3F3XA 1HKQA 2M8EA 1UCRA 1YFHA 3H92A 4I09A 4R79A 1DDNA 4HF0A 4Q4ZF 2XKPA 3WTYC 3KZYA 2ZMEA 3RKWA 4A0YA 5D8KB 2EK5A 1KU3A 4GYGA 4OINF 3P9IA 1BM9A 2R3SA 1HW5A 4N9IA 3KE2A 2D1HA 3VB2A 1YIOA 1R1TA 5CVRA 2QBYA 2GIVA 4FT8A 1F5TA 1S7OA 3P7NA 3J81Z 3DXJF 4JQFA 4ESFA 3ZP5A 3Q5FA 1HW2A 4I02A 2KRFA 4LG0B 4RB0A 5HS8A 4IHTA 3CUQC 2MD5A 2BV6A 3ZN1A 4ZH4F 2FF4A 2VBXA 4L9NA 1LDJA 4BAYA 2P7CB 1KYWA 2CSOA 3Q9VA 2IJLA 1W5TA 4HV6A 3BJAA 3FMSA 3BWGA 3LQQA 4HBLA 5FGMA 1RUNA 2JRTA 2GZWA 2NAZA 4FX4A 4IHSA 4XLPF 2K4JA 3CDHA 2MC3A 1BN5A 3I58A 4EJTA 2QQBA 2FQ3A 3ZMTA 1IXRC 2UXNA 3W6JB 2M5WA 3MZYA 3ZMVA 4U0YA 1K79A 2L01A 2H09A 4YIIA 3BPXA 3SQNA 2CG4A 3BJOA 3F6OA 4YFKF 2QUFA 2YU3A 2W84A 1K6OA 3R60A 3PFIA 2ZCWA 3RI4A 4EM1A 1R22A 2QZ8A 3OOPA 2EV0A 1XDUA 1BI3A 4KICA 1GVJA 2GXBA 3IWFA 4P5OA 2E7WA 3WTXC 4P96A 1USTA 4L18B 1Z9CA 3TOAA 3VOEA 3FX3A 3EQLF 1FP1D 4G7ZF 3LSTA 4HQEA 1SFUA 2PLYA 4LLNA 3VFZA 2IA1A 2XGXA 2DI3A 1Q1HA 5IT3A 1UFMA 3REOA 3IWZA 4KYWA 5FO5A 3ZQ7A 1OKRA 4XLNF 5LHIA 4QLCU 4ASNA 4LD5A 3KLNA 5ERIA 1JHFA 2K4BA 5E8GA 1IN8A 4RGXA 2XRNA 4KA4A 2DLLA 1FBSA 4PCQA 5HOOA 1E2XA 4BYYA 1FC3A 1B9NA 1IN7A 4ENKA 1ZRCA 2EA4A 5LHHA 2Y48A 4KT5C 3DP7A 3GYHX 4GGGA 1JHHA 5CVJA 2Z99A 2QYOA 3LAPA 3ULQB 1DUXC 3V7SA 5AIQA 2NNNA 1QZZA 1ZREA 3DFGA 5KVRA 4IVNA 4P55A 2HR3A 1W7PD 5D4SA 1KYZA 4MHGA 1IUYA 1MJAA 1ZGJA 1HW1A 4A5NA 2XAGA 1XSDA 1AWCA 3EYIA 1IN4A 3KP4A 4I01A 1TW2A 2KIMA 1FX7A 3F8BA 4BQAA 2B0LA 2OQRA 4RB1A 4LB6B 1YTYA 3IL2A 1O7LA 2RKHA 3C7JA 2DK5A 4U0VA 3COAC 1R36A 3HIFA 4ZYGA 3CO6C 5J6XA 2BGCA 3GO5A 3KETA 3ZMDA 3DQVC 1ZH5A 2AS5F 1F9NA 5HDGA 3M8FA 1BI1A 2HFHA 1PUEE 1S7AA 3T8RA 4E70A 5LRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ON0 A;  5K1Y A;  4YFN F;  4Q48 A;  1J7K A;  4BHP A;  1R00 A;  2RGV A;  4CXF A;  1ZLJ A;  3GFI A;  3GFL A;  1FT9 A;  3VEP A;  2FE3 A;  4M6X A;  2NRA C;  4WWC A;  3WTW C;  4N0B A;  3WE2 A;  4LGW A;  1K78 A;  3CJN A;  4CO8 A;  4KMU X;  3BPV A;  1B6A A;  1FYM A;  1XSX A;  2P7V B;  3HRM A;  4L9T A;  2MA3 A;  1Z7U A;  2M1B A;  3V7C A;  2RQP A;  1A04 A;  2DBB A;  4GYI A;  3ERE D;  4GO1 A;  5JVT A;  4UXN A;  3HUG A;  1S29 A;  4M74 A;  3IRR A;  1S3J A;  2PEX A;  1JXS A;  4XSZ F;  2D2W A;  4EM0 B;  5D5U B;  1YQA A;  2O0Y A;  2XAQ A;  4HW0 A;  5CVI A;  3OV8 A;  3MAJ A;  2ZKZ A;  3GF2 A;  3RYP A;  1F1Z A;  1O3S A;  2A6H F;  2OU2 A;  2F5C A;  3HSE A;  1QZY A;  3E97 A;  1XGN A;  1W4M A;  2DT5 A;  1IW7 F;  4LG0 A;  2QEN A;  4OIO F;  1H0M A;  4EQQ A;  3WTT C;  3QAH A;  4R8H A;  5DD4 A;  1SD6 A;  5L3B A;  5LGU A;  1YLF A;  3MCZ A;  5DCF A;  3LA2 A;  4AVP A;  1FNN A;  2HTJ A;  4M9X A;  3T8T A;  4I0A A;  1FY7 A;  2DAO A;  4HQM A;  3CO7 C;  3ABT A;  4CHU A;  2DPU A;  4L5I A;  2WTE A;  4UNO A;  1KQ8 A;  3EYY A;  4HA8 A;  4GCV A;  2O6G E;  3EET A;  4NB5 A;  2FOK A;  5DUK A;  4MQ9 F;  3DPT A;  3I54 A;  2ZNZ A;  2G7H A;  2E1N A;  2G7U A;  1XN7 A;  2KIF A;  2BBY A;  5J8C A;  4HDU A;  4OMY A;  1XMK A;  3GFJ A;  3HRS A;  1Y0U A;  2EV5 A;  2VBW A;  5HS9 A;  4I98 B;  2VC0 A;  1D8J A;  2L3D A;  1R1V A;  2DPD A;  4I2O A;  4ESJ A;  4MQV A;  3NRV A;  3JTG A;  2CQK A;  1H9G A;  2EFW A;  1XCV A;  5D5W B;  4UVA A;  2CYY A;  1XDS A;  2JT1 A;  1U2W A;  2M30 A;  4HOB A;  4BNC A;  1V3F A;  1KU9 A;  1U5T B;  1OYY A;  1TW3 A;  1W5S A;  3ABU A;  2DU9 A;  3F23 A;  1B9M A;  1VTN C;  2STT A;  3I64 A;  4HZF A;  5ICF A;  4A5M A;  1P4X A;  2P8T A;  2FRH A;  2H6C A;  3WGG A;  3WG9 A;  2PI0 A;  2UZK A;  4ENN A;  4YG2 F;  1ODD A;  3L2C A;  1I5Z A;  2EJR A;  2DQL A;  1IN6 A;  4HLX A;  3MWM A;  3WOD F;  4CYD A;  3FXQ A;  4GXO A;  3I59 B;  4A2U A;  3BJ6 A;  1U8R A;  4S04 A;  4LB5 A;  4U7B A;  1TNS A;  3GW2 A;  3RTR A;  4NQW A;  5ICC A;  4O3M A;  2R7F A;  1B4A A;  2KIU A;  1YS6 A;  2ZBK A;  2Q0O A;  4MEY F;  3QOP A;  2VT2 A;  4HF2 A;  1U3E M;  4RB3 C;  4EJO A;  1HKS A;  5J8F A;  1BOA A;  2FBK A;  3ISP A;  3GZ5 A;  4L9V A;  2FSW A;  2O03 A;  2NYX A;  3P9C A;  4LMY A;  2JTV A;  3LA7 A;  3RYR A;  5DEQ A;  4O6J A;  2A07 F;  3EUH A;  4RAZ A;  2EWN A;  4KIB A;  3ECO A;  1WSU A;  3JTH A;  1G3T A;  3F8C A;  5ICE A;  1YYV A;  4A0X A;  1T0F A;  3HRU A;  5HDK A;  2LF8 A;  4OOI A;  3G3Z A;  1ZGA A;  5E8I A;  2O61 A;  3BRO A;  3FF5 A;  3RIR A;  2ZFW A;  4WXC A;  3Q9S A;  5TJJ A;  1JGS A;  4RGU A;  1WQ2 A;  3T1B A;  2FU4 A;  4L5J A;  4ENM A;  1LVA A;  3L9F A;  4N9H A;  5HS7 A;  2WC2 A;  1ULY A;  1ZN2 A;  3FMR A;  4A6D A;  4A12 A;  2KJB A;  4EGY A;  5CVU A;  4Y17 A;  3QPT A;  4XBF A;  3BDD A;  1HSJ A;  3E3V A;  3TDZ C;  4CGZ A;  2HKX A;  2O3F A;  2VOD A;  2L4M A;  3FHZ A;  2HKO A;  2K02 A;  3QP5 A;  1SD7 A;  5LHG A;  1FSE A;  2F5F A;  1L0O C;  2F5E A;  4EVI A;  3HOT A;  3TDU C;  4RS8 A;  2XIG A;  4LK1 F;  3HOS A;  1ZHF A;  3ROU A;  2GAU A;  3KP7 A;  1SMY F;  2XUB A;  2EB7 A;  4U0W A;  1FP2 A;  2OZ6 A;  4Y15 A;  4KN7 X;  2XAS A;  1EV7 A;  4ZYE A;  3U2R A;  1KGS A;  3MQ0 A;  2P5L C;  4YFX F;  3TO7 A;  3BZ6 A;  5HLH A;  1IXC A;  2W57 A;  4HX4 A;  2H94 A;  3C3W A;  4MGR A;  1R5G A;  1YS7 A;  3DEU A;  4G94 A;  4OU0 A;  4LJZ F;  3N4M A;  2IP2 A;  5D4R A;  1TBX A;  4WK8 F;  3HRT A;  1IN5 A;  2MH9 A;  5E1Z B;  2L4A A;  1IRF A;  2QLZ A;  2J5O A;  1P6R A;  2OQG A;  2F5D A;  1T2K A;  3D5L A;  1BIA A;  4R1H A;  4HYE A;  2XAH A;  5BQT A;  4MTD A;  4M71 A;  5BPI A;  4HF1 A;  4MNU A;  3WTZ A;  3PQK A;  2K86 A;  2ZJ2 A;  3DKW A;  3IKV A;  4G8X A;  1B59 A;  3E5Q A;  1ZG5 A;  3LFK A;  2CW0 F;  2D45 A;  3RJP A;  1KQ0 A;  1FLI A;  2BEO A;  2RNJ A;  2LSO A;  3M8E A;  2FBH A;  4KN4 X;  4OIP F;  3M7G A;  1O7F A;  3B73 A;  1R58 A;  2FML A;  2MLG A;  4K2E A;  2ISZ A;  1T39 A;  2YX7 A;  2FEZ A;  1SD5 A;  1O3T A;  2IRF G;  3IKT A;  1Z05 A;  2MLK A;  3ML6 A;  6PAX A;  3I0T A;  5E20 A;  4IRI A;  1HQC A;  2A68 F;  3H3Z A;  4XSX F;  1W7P B;  2QM3 A;  4I0B A;  1ON1 A;  3R4K A;  1J59 A;  3R6S A;  2O8X A;  4L0Z B;  1H9T A;  3CUO A;  4KIG A;  3O3K A;  2V1U A;  3F22 A;  2GA1 A;  3F8M A;  2HEO A;  3E5U A;  4I7H A;  1RNL A;  2OBP A;  3CUQ B;  3WU1 B;  1T98 A;  1P4A A;  2ZNY A;  2PMH A;  2ETH A;  1ZG3 A;  2LNB A;  1R5H A;  5D5V B;  3LWF A;  2NS0 A;  1MZB A;  4WX9 A;  1ZAR A;  2P6T A;  3I71 A;  3U1D A;  1ZRD A;  4RAY A;  3TO9 A;  5FB2 A;  3CTA A;  1PP7 U;  1U5T A;  4HLY A;  3SHF A;  2JSC A;  2H27 A;  2OA4 A;  3KP2 A;  3NEU A;  3DF8 A;  3SFZ A;  4ZYH A;  3GZ6 A;  1HBX G;  2A69 F;  1LDK B;  4RB2 C;  1K7A A;  2FNP A;  4KMF A;  4P9U A;  4KDP A;  1P92 A;  4S05 A;  3GWZ A;  2HGC A;  4A6E A;  3I59 A;  5F6F A;  1RUO A;  4DQ2 A;  4B09 A;  2Z33 A;  1MJB A;  3HTU A;  1LNW A;  1YW8 A;  1B1B A;  1SFE A;  2IA2 A;  2EFO A;  2OAZ A;  1SFX A;  3F72 A;  2HS5 A;  4LK0 F;  3QPH A;  5FFZ A;  1P4W A;  2XAF A;  1MJ9 A;  3BOQ A;  1LDD A;  1EH8 A;  3K2Z A;  2VBZ A;  1ON2 A;  1WRJ A;  4HV5 A;  2HYF A;  2A5Y B;  3WGH A;  3K69 A;  4M6Y A;  2UXX A;  5LGN A;  5ILS A;  5LRR A;  2W85 A;  2VXZ A;  1R1U A;  4AWX B;  2OZU A;  1S6L A;  4UV8 A;  3WTS C;  2VE8 A;  1HXD A;  2MH2 A;  4O5V A;  2RN7 A;  2YSR A;  3K0L A;  5FFX A;  4L9J A;  3K1M A;  1FYK A;  5LGT A;  1WWX A;  3TQN A;  1EH6 A;  1S8N A;  4G6D A;  5IT9 K;  2V79 A;  3R0A A;  2VE9 A;  1I27 A;  5JR3 A;  2WV0 A;  3FMQ A;  5F64 A;  2R7D A;  2K7L A;  1QNT A;  4BHB A;  1XCB A;  1XD7 A;  2IA0 A;  1USS A;  3E6B A;  2ZXJ A;  1T38 A;  3IC7 A;  3N97 A;  3KLO A;  3MFK A;  2HDC A;  3C18 A;  3BY6 A;  4M9Z A;  4L0Y B;  4ZYD A;  2GQQ A;  4ESB A;  2Q8K A;  2J5P A;  5LLQ A;  3V8L A;  2Q2E A;  2MBF A;  1XB4 A;  5AIP A;  1MGT A;  2M45 A;  1FSH A;  2H6B A;  3LAJ A;  2GXG A;  3KP6 A;  2FXA A;  4JBA A;  4M9S A;  4KFC A;  3V8K A;  3HHH A;  5H20 A;  1TQP A;  2DO7 A;  1FPQ A;  4RGR A;  1TNT A;  2BE5 F;  2V1D A;  1SD4 A;  1U6G A;  2ELH A;  3DPL C;  1U78 A;  5FLX K;  2F2E A;  1IAW A;  3ZMS A;  3GFM A;  2G9W A;  1CF7 A;  2PFB A;  3MZH A;  3B02 A;  4ENJ A;  1BC7 C;  4EM2 A;  3WE3 A;  2QQ9 A;  1BBY A;  1Z6R A;  1IRG A;  2WWY A;  3J80 Z;  2HQN A;  3DV8 A;  3RPU A;  3NQO A;  1I1S A;  1WKM A;  4UHT A;  1R23 A;  1IZ1 A;  2W24 A;  2CWE A;  3KEO A;  3GXO A;  5BPD A;  2VT3 A;  5ICG A;  4KUM A;  4WXD A;  2A61 A;  5A2Q K;  4LLG F;  1YG2 A;  2K27 A;  4ZZD A;  1ZG1 A;  3FZV A;  2P5K A;  4BHC A;  2PBI A;  3RDI A;  3TKY A;  1BC8 C;  2IT0 A;  3ELK A;  3F8N A;  2RDP A;  2YR2 A;  3D0S A;  1REP C;  1XGM A;  1ZYR F;  4Z2Y A;  3JW4 A;  5D8L B;  1FZP B;  1QBJ A;  2CGP A;  3K1P A;  5BMZ A;  1I6X A;  2QVO A;  2VOO A;  3K9T A;  3FM5 A;  5JI6 A;  3C1D A;  3WTV C;  2P5V A;  3I53 A;  4IRG A;  5DUI A;  5D6F A;  2CO5 A;  1W7P A;  4HX7 A;  2EV6 A;  3P9K A;  1XMA A;  2QWW A;  4Q5S F;  5K5Q A;  1MDM B;  5AON A;  2LDU A;  3F6V A;  5D6E A;  3L09 A;  4UUV A;  1FOK A;  3K1N A;  5CVV A;  4G7O F;  4A0Z A;  3CUQ A;  5E1W A;  2ESH A;  4TV7 A;  2D1V A;  4EJU A;  1LQ1 A;  2NNY A;  1CGP A;  3KP3 A;  5ED4 A;  2E7X A;  3ZPL A;  1G3S A;  3GEZ A;  2RVC A;  4KIF A;  4MEX F;  1GXP A;  4AD9 A;  1SMT A;  5E18 F;  1D8K A;  2Z5U A;  5ILV A;  2PMU A;  5H6R A;  4YIF A;  4QWQ A;  1G4D A;  4FX0 A;  3RKX A;  1V4R A;  1QQI A;  3SZP A;  4KNY A;  4IXA A;  3TGN A;  5DCM B;  1F4K A;  3KCC A;  4BXU A;  5BS6 A;  1KA8 A;  4PZJ A;  4EJV A;  3ECH A;  3S2W A;  1CF7 B;  1TQI A;  2E1C A;  4B8X A;  2PJP A;  5E17 F;  4EGZ A;  1PP8 F;  5K5O A;  3CLO A;  3R0J A;  2V1X A;  1O57 A;  2DTR A;  1FBQ A;  4LFU A;  4IPA A;  3JAM K;  5D5X B;  1UHM A;  5CLS A;  1FWZ A;  2ZME B;  1BIB A;  2FA5 A;  3KZZ A;  3O6B B;  1C0W A;  3U9G A;  1D3Y A;  1ZRF A;  1LB2 A;  2EA2 A;  1IF1 A;  1J75 A;  5L3D A;  5L3E A;  1EH7 A;  2M87 A;  3J80 K;  1JE8 A;  1DP7 P;  4XRF A;  2PQ8 A;  4NHJ A;  2HZT A;  1KU2 A;  1LEA A;  1OMI A;  2QBY B;  2KKO A;  1J0R A;  2BYV E;  2VN2 A;  1MKM A;  2YPR A;  3QRF F;  1DPR A;  2HQR A;  4IJA A;  3O2P E;  4WF2 A;  3FXU A;  1O3Q A;  4HX8 A;  4G6Q A;  3VOD A;  3KFW X;  5IT9 Z;  3QU3 A;  2XHK A;  2QQA A;  3J81 K;  1UB9 A;  1T6S A;  3WU0 A;  3SXY A;  2YX4 A;  3FM3 A;  1P2F A;  2JZY A;  4EJW A;  1LEB A;  1Z6T A;  5LEJ A;  3IHU A;  2XRO A;  5K5R A;  4G7H F;  1RIO H;  3HSF A;  2FNA A;  4UV9 A;  3V4G A;  4CIC A;  2FBI A;  1WI9 A;  3PQJ A;  2W25 A;  3M1E A;  4F7Z A;  2VON A;  1OPC A;  2P4W A;  1FBU A;  1U5T C;  3RPQ A;  2IPQ X;  2P6S A;  1G3Y A;  4OIR F;  4EV0 A;  3RKY A;  3WTU C;  3AAF A;  3L7W A;  3QP6 A;  5EEG A;  2IW5 A;  4RGS A;  4U88 A;  4H0E A;  1RI7 A;  1QO0 D;  3F8F A;  1J5Y A;  2DW4 A;  1R7J A;  1ZAO A;  2X4H A;  1OYW A;  1LJ9 A;  5FD5 A;  2EFP A;  3V8J A;  2X0L A;  4FHT A;  1TLH B;  4IF4 A;  4ZZL A;  2PG4 A;  4IRH A;  2Y75 A;  3LA3 A;  2A6E F;  2VOP A;  1G6N A;  4JK1 X;  5FLX Z;  2JPB A;  3HTS B;  1XGS A;  1TQM A;  5HLG A;  1STZ A;  1FYL A;  3T5X A;  1KQ9 A;  3F21 A;  3GLX A;  3QU6 A;  3JSO A;  2C6Y A;  2DFI A;  5F1R A;  2L54 A;  1HST A;  5HDN A;  4WXH A;  2RC4 A;  2OD5 A;  4D0P A;  2CFX A;  4LLL A;  2GWR A;  4CDG A;  2DK8 A;  3GVA A;  3TO6 A;  3BP8 A;  2EFQ A;  3T0Y A;  4PGG A;  2UWM A;  1O3R A;  5DDG A;  1XSV A;  4CZZ A;  2VC1 A;  2HTS A;  5DV5 A;  3E5X A;  4WCG A;  3J7A O;  2ZO4 A;  3L00 A;  3KP5 A;  5BOX A;  4HAM A;  1NHA A;  2V6C A;  5A2Q Z;  4ETS A;  2LKP A;  2ADU A;  4AIH A;  3E6C C;  2DQR A;  1GHC A;  1QGP A;  1ZLK A;  2GA2 A;  2JPC A;  3FXR A;  3ZN0 A;  5HVQ C;  3LQR A;  2ACJ A;  3E6D A;  1HKT A;  1Z91 A;  4AIJ A;  5HLI A;  3GX4 X;  1GXQ A;  1L3L A;  1AOY A;  1YW7 A;  1UHW A;  3GUD A;  2IVM A;  4OMZ A;  5L3F A;  4BH9 A;  3EDP A;  4AIK A;  4UVC A;  2TDX A;  1SAX A;  1DPU A;  3FWE A;  5CYV A;  2VBY A;  3JSP A;  5KK1 A;  5JFR A;  3W6K B;  5H6Q A;  1RZ4 A;  5E1X A;  4HDV A;  4G9Y A;  3HSR A;  3R61 A;  1D5V A;  3M9A A;  4M72 A;  2FMY A;  1E17 A;  4EMS A;  1J9I A;  2ISY A;  1QPM A;  5L3C A;  4PDK A;  1MD0 A;  1I1G A;  5L3G A;  2AXL A;  4MTE A;  1Z1D A;  5LBQ A;  4P9F A;  3WGI A;  1MDM A;  2KJC A;  3HHG A;  3H3U A;  5DYM A;  3KEQ A;  3ZMU A;  1G3W A;  2HYG D;  2ESN A;  2L02 A;  2PN6 A;  1KU7 A;  2XV4 S;  3E6M A;  2XKO A;  2STW A;  1PDN C;  2LF7 A;  2COM A;  2XAJ A;  5CJ9 A;  1J2X A;  1ONV A;  1BI2 A;  2V9V A;  5LEK A;  3ZMZ A;  2HWV A;  3I4P A;  3SZT A;  3V7R A;  1X3U A;  3IRQ A;  2A3S A;  3TOB A;  4M73 A;  1TTY A;  4DNC A;  4OIQ F;  4Q47 A;  1OR7 A;  5FD6 A;  3HYI A;  4PGH A;  1BJA A;  2Y0M A;  2HOE A;  4Y13 A;  3G73 A;  4U7D A;  5JHU A;  2XVC A;  1BI0 A;  1YW9 A;  5DD8 A;  5ILU A;  1XGO A;  1IXS B;  2RV8 A;  5DCM A;  5EEH A;  4UVB A;  5TRD A;  1YO5 C;  3MEX A;  3JAM Z;  1K78 B;  2Z9O A;  1OYI A;  3I5U A;  2Z3Y A;  2EFN A;  3F3X A;  1HKQ A;  2M8E A;  1UCR A;  1YFH A;  3H92 A;  4I09 A;  4R79 A;  1DDN A;  4HF0 A;  4Q4Z F;  2XKP A;  3WTY C;  3KZY A;  2ZME A;  3RKW A;  4A0Y A;  5D8K B;  2EK5 A;  1KU3 A;  4GYG A;  4OIN F;  3P9I A;  1BM9 A;  2R3S A;  1HW5 A;  4N9I A;  3KE2 A;  2D1H A;  3VB2 A;  1YIO A;  1R1T A;  5CVR A;  2QBY A;  2GIV A;  4FT8 A;  1F5T A;  1S7O A;  3P7N A;  3J81 Z;  3DXJ F;  4JQF A;  4ESF A;  3ZP5 A;  3Q5F A;  1HW2 A;  4I02 A;  2KRF A;  4LG0 B;  4RB0 A;  5HS8 A;  4IHT A;  3CUQ C;  2MD5 A;  2BV6 A;  3ZN1 A;  4ZH4 F;  2FF4 A;  2VBX A;  4L9N A;  1LDJ A;  4BAY A;  2P7C B;  1KYW A;  2CSO A;  3Q9V A;  2IJL A;  1W5T A;  4HV6 A;  3BJA A;  3FMS A;  3BWG A;  3LQQ A;  4HBL A;  5FGM A;  1RUN A;  2JRT A;  2GZW A;  2NAZ A;  4FX4 A;  4IHS A;  4XLP F;  2K4J A;  3CDH A;  2MC3 A;  1BN5 A;  3I58 A;  4EJT A;  2QQB A;  2FQ3 A;  3ZMT A;  1IXR C;  2UXN A;  3W6J B;  2M5W A;  3MZY A;  3ZMV A;  4U0Y A;  1K79 A;  2L01 A;  2H09 A;  4YII A;  3BPX A;  3SQN A;  2CG4 A;  3BJO A;  3F6O A;  4YFK F;  2QUF A;  2YU3 A;  2W84 A;  1K6O A;  3R60 A;  3PFI A;  2ZCW A;  3RI4 A;  4EM1 A;  1R22 A;  2QZ8 A;  3OOP A;  2EV0 A;  1XDU A;  1BI3 A;  4KIC A;  1GVJ A;  2GXB A;  3IWF A;  4P5O A;  2E7W A;  3WTX C;  4P96 A;  1UST A;  4L18 B;  1Z9C A;  3TOA A;  3VOE A;  3FX3 A;  3EQL F;  1FP1 D;  4G7Z F;  3LST A;  4HQE A;  1SFU A;  2PLY A;  4LLN A;  3VFZ A;  2IA1 A;  2XGX A;  2DI3 A;  1Q1H A;  5IT3 A;  1UFM A;  3REO A;  3IWZ A;  4KYW A;  5FO5 A;  3ZQ7 A;  1OKR A;  4XLN F;  5LHI A;  4QLC U;  4ASN A;  4LD5 A;  3KLN A;  5ERI A;  1JHF A;  2K4B A;  5E8G A;  1IN8 A;  4RGX A;  2XRN A;  4KA4 A;  2DLL A;  1FBS A;  4PCQ A;  5HOO A;  1E2X A;  4BYY A;  1FC3 A;  1B9N A;  1IN7 A;  4ENK A;  1ZRC A;  2EA4 A;  5LHH A;  2Y48 A;  4KT5 C;  3DP7 A;  3GYH X;  4GGG A;  1JHH A;  5CVJ A;  2Z99 A;  2QYO A;  3LAP A;  3ULQ B;  1DUX C;  3V7S A;  5AIQ A;  2NNN A;  1QZZ A;  1ZRE A;  3DFG A;  5KVR A;  4IVN A;  4P55 A;  2HR3 A;  1W7P D;  5D4S A;  1KYZ A;  4MHG A;  1IUY A;  1MJA A;  1ZGJ A;  1HW1 A;  4A5N A;  2XAG A;  1XSD A;  1AWC A;  3EYI A;  1IN4 A;  3KP4 A;  4I01 A;  1TW2 A;  2KIM A;  1FX7 A;  3F8B A;  4BQA A;  2B0L A;  2OQR A;  4RB1 A;  4LB6 B;  1YTY A;  3IL2 A;  1O7L A;  2RKH A;  3C7J A;  2DK5 A;  4U0V A;  3COA C;  1R36 A;  3HIF A;  4ZYG A;  3CO6 C;  5J6X A;  2BGC A;  3GO5 A;  3KET A;  3ZMD A;  3DQV C;  1ZH5 A;  2AS5 F;  1F9N A;  5HDG A;  3M8F A;  1BI1 A;  2HFH A;  1PUE E;  1S7A A;  3T8R A;  4E70 A;  5LRS A; 
#chains in the Genus database with same CATH topology
 3U21 A;  4ON0 A;  5FKM A;  5K1Y A;  3HJE A;  4YFN F;  2WB1 N;  4Q48 A;  1J7K A;  3GTQ J;  4BHP A;  1R00 A;  2RGV A;  3E7L A;  2MFZ A;  4XLH A;  4CXF A;  2M4K A;  1ZLJ A;  3GFI A;  1QU3 A;  3GFL A;  2R93 J;  2PMZ N;  1FT9 A;  3AL0 C;  4JYK A;  5IP6 A;  3VEP A;  3DTI A;  2FE3 A;  4M6X A;  3IUO A;  1N77 A;  2NRA C;  4BY1 J;  4WWC A;  2JA8 J;  3SDG A;  3WTW C;  4N0B A;  4QPO A;  3WE2 A;  2GXA A;  4LGW A;  1K78 A;  1PJR A;  5IOY A;  4JX4 A;  2ME0 A;  1MMG A;  3RKQ A;  2HVR A;  3SZG A;  3CJN A;  4CO8 A;  4KMU X;  4F3Q A;  3BPV A;  5DTD A;  2CUE A;  3A01 A;  1B6A A;  5EEA A;  5FKO A;  1FYM A;  2HQA A;  2ME6 A;  1XSX A;  3ZQG A;  2P7V B;  3HRM A;  4X0G A;  2Y69 H;  4L9T A;  2MA3 A;  4DYQ A;  2R92 J;  1Z7U A;  3ZQC A;  2JQ7 A;  2KMU A;  2M1B A;  4DOZ A;  3V7C A;  2RQP A;  1A04 A;  2DBB A;  4GYI A;  3OYL A;  3ERE D;  4GO1 A;  2EZL A;  1N78 A;  5JVT A;  4UXN A;  3HUG A;  5HNH A;  1S29 A;  4M74 A;  3IRR A;  1S3J A;  1VZ0 A;  1Z77 A;  4ZJZ A;  3CLQ A;  2ELJ A;  3MKW B;  2PEX A;  2MD0 A;  2VQC A;  1JXS A;  3UNG C;  4XSZ F;  2D2W A;  4EM0 B;  5D5U B;  1BOB A;  2IS6 A;  2DA5 A;  1YQA A;  4BJ5 C;  2O0Y A;  2DA4 A;  2HDW A;  2XAQ A;  4HW0 A;  3OV8 A;  4MFD A;  5CVI A;  3GTP J;  9ANT A;  2BXY A;  3MAJ A;  5B66 C;  2ZKZ A;  3GF2 A;  3K70 D;  3RYP A;  1F1Z A;  5B5E C;  1O3S A;  2A6H F;  3DLL F;  2K9Q A;  2OU2 A;  2W1O A;  4BL0 B;  2F5C A;  3HSE A;  4A3J J;  1X3W B;  1QZY A;  3E97 A;  1R4N B;  1XGN A;  1WHU A;  1GDT A;  1W4M A;  3OS1 A;  2DT5 A;  1IW7 F;  4LG0 A;  2QEN A;  4IL6 C;  2V9P A;  2V26 A;  4FTH A;  4OIO F;  2DJN A;  4CZC A;  1H0M A;  4MIM A;  4EQQ A;  3WTT C;  5FLM J;  3TBI A;  3QAH A;  2KRC A;  4R8H A;  5DD4 A;  4BJ6 C;  1LUJ B;  1SD6 A;  3K2A A;  5L3B A;  5LGU A;  1YLF A;  3PUF A;  3MCZ A;  1D1A A;  5DCF A;  3LA2 A;  2ID6 A;  4AVP A;  3BR2 A;  1FNN A;  2HTJ A;  4HEA 2;  4M9X A;  3T8T A;  3K6G A;  3W2W A;  3IH2 A;  4I0A A;  1FY7 A;  4FAS D;  2DAO A;  3CJQ B;  1HF0 A;  1U8B A;  4PJN A;  1DP3 A;  4HQM A;  1OR7 C;  1ZEL A;  3CO7 C;  3ABT A;  4CHU A;  3LSH A;  2DPU A;  3DBH B;  2XF5 A;  1BR1 A;  2WAF A;  2H8W A;  2E35 A;  2ZXW H;  4L5I A;  2WTE A;  4UNO A;  1KQ8 A;  3EYY A;  4HA8 A;  4E7L A;  3PIO F;  3H9J A;  3CDI A;  4GCV A;  5HNF A;  5KAI C;  3EET A;  3EUA A;  2MYS A;  3HEF A;  4NB5 A;  2FOK A;  2O6G E;  5DUK A;  5M5X J;  4MQ9 F;  1U9O A;  4I76 A;  1VQO I;  3DPT A;  3I54 A;  1HOM A;  3CQZ J;  2ZNZ A;  2W00 A;  3PJR A;  2G7H A;  1LE8 A;  2E1N A;  2G7U A;  5JHF A;  5E3M A;  1XN7 A;  3FHN A;  2KIF A;  2E19 A;  2BBY A;  5J8C A;  3PNT A;  3OMY A;  1ZK8 A;  4HDU A;  4Y33 A;  4OMY A;  2K5C A;  1XMK A;  1R49 A;  3PNV A;  4HRI A;  2FQ4 A;  2H1L A;  3GFJ A;  4CYC A;  3HRS A;  1Y0U A;  2EV5 A;  2VBW A;  5HS9 A;  1A36 A;  4I98 B;  3AFH A;  2VC0 A;  1D8J A;  2L3D A;  3Q0W A;  1R1V A;  2VJJ A;  1SFO J;  2DPD A;  4I2O A;  1D5Y A;  4BY7 J;  4CCM A;  2LD5 A;  4ESJ A;  4I6Z A;  4MQV A;  3JRA A;  3NRV A;  5F0C A;  1Y8R B;  2DMQ A;  3JTG A;  2CQK A;  1H9G A;  3VYU B;  2EFW A;  1TWF J;  1XCV A;  5D5W B;  4UVA A;  3AG1 H;  2EIM H;  1DQU A;  1RR8 C;  2CYY A;  1XDS A;  3A0B C;  5F08 A;  1KON A;  2JT1 A;  1U2W A;  2X9D A;  2M30 A;  4HOB A;  1H88 C;  5F0H A;  3JRC A;  4BE0 A;  1RKW A;  4BNC A;  4II3 A;  3S14 J;  1GUU A;  1IO2 A;  2CRG A;  4IHV A;  4RBO A;  4V19 K;  1V3F A;  1KU9 A;  1RPW A;  1U5T B;  2MSY A;  1OYY A;  1TW3 A;  1B8I A;  1W5S A;  3ABU A;  2DU9 A;  4A3D J;  3F23 A;  1B9M A;  1VTN C;  2STT A;  3I64 A;  1MBF A;  1X19 A;  4HZF A;  5ICF A;  3G6E I;  3HG9 A;  4A5M A;  1P4X A;  4XRS G;  5J1U A;  3IH4 A;  4IQJ A;  1V54 H;  2P8T A;  3BTJ A;  3K10 A;  2FRH A;  1MND A;  2H6C A;  3WGG A;  3WG9 A;  4C3H J;  1JT0 A;  2UZK A;  4ENN A;  2O9L A;  2PI0 A;  4IHY A;  5FLV A;  3IAM 2;  4B4C A;  4YG2 F;  1ODD A;  3L2C A;  1I5Z A;  2EJR A;  2DQL A;  2OPT A;  1IN6 A;  2IS4 A;  4HLX A;  2O8K A;  3MWM A;  3WOD F;  4IOA F;  1A6Q A;  4CYD A;  3FXQ A;  2ICW G;  4GXO A;  2VJ4 A;  3I59 B;  2VPR A;  3HUG B;  4A2U A;  3BJ6 A;  3BTC A;  3FXO A;  4ANJ A;  1A35 A;  1U8R A;  4S04 A;  5EGO B;  2L9S A;  4LB5 A;  3CMM A;  1NTC A;  1YHQ I;  2VUM J;  4U7B A;  4BS9 A;  1VF9 A;  4E7S A;  3BG5 A;  4MLO A;  1TNS A;  3M07 A;  4NNJ A;  3GW2 A;  3JR9 A;  3RTR A;  4NQW A;  5ICC A;  4O3M A;  4RAF A;  2R7W A;  2B63 J;  2R7F A;  2H1K A;  1B4A A;  2KIU A;  1YS6 A;  3K7A J;  5GAH J;  2ZBK A;  2Q0O A;  4MEY F;  3QOP A;  2QKL B;  2X51 A;  2M8G X;  2V4J C;  2VT2 A;  2LK2 A;  2MW8 A;  4HF2 A;  1U3E M;  1XC5 A;  3E0J B;  4RB3 C;  4EJO A;  1HKS A;  5J8F A;  1WI3 A;  1R71 A;  1BOA A;  2FBK A;  4D5C A;  3ISP A;  4BEH B;  3GZ5 A;  4L9V A;  2FSW A;  5B3S H;  2O03 A;  4DZP A;  2NYX A;  3VSL A;  2E5N A;  2M7A A;  3BR0 A;  3P9C A;  3I4M J;  4LMY A;  2DFH A;  2JTV A;  2E1M B;  1J09 A;  3GBG A;  3LA7 A;  3KYL A;  3RYR A;  3JRI A;  5DEQ A;  4O6J A;  2A07 F;  3EUH A;  2ZXH A;  1AHD P;  2E2J J;  4RAZ A;  4XKB A;  2EWN A;  4KIB A;  2Z1D A;  3ECO A;  1WSU A;  1FOW A;  3JTH A;  1G3T A;  5TGT A;  4B48 A;  3F8C A;  5J47 A;  2M34 A;  4XOT A;  5ICE A;  3CCJ I;  2E2H J;  4BKX A;  4W97 A;  3WHB A;  1YYV A;  3CP8 A;  3I9V 2;  1BR2 A;  1VQK I;  4IHX A;  4A0X A;  3HKZ A;  1T8I A;  2OCC H;  2F4M B;  1T0F A;  3HRU A;  3TP0 A;  5HDK A;  2LF8 A;  3CCY A;  4OOI A;  2HQ5 A;  3G3Z A;  1ZGA A;  5E8I A;  4BGD A;  1MMN A;  2YUS A;  2O61 A;  3BRO A;  3FF5 A;  3RIR A;  2ZFW A;  1TL8 A;  2JMW A;  3OYJ A;  4UUT A;  4WXC A;  3Q9S A;  5TJJ A;  3VPR A;  1JGS A;  4BDY A;  3I4N J;  4RGU A;  1WQ2 A;  3T1B A;  2LTP A;  2FU4 A;  4L5J A;  4XNF A;  4ENM A;  1LVA A;  3L9F A;  4N9H A;  2VJI A;  2E60 A;  5HS7 A;  2WC2 A;  3L2R A;  4IO9 F;  1ULY A;  1ZN2 A;  5TIS C;  3FMR A;  1YOV B;  5CQG A;  4A6D A;  2K85 A;  4A12 A;  2KJB A;  4EGY A;  2FD5 A;  2LFB A;  4PJM A;  5CVU A;  4Y17 A;  3QPT A;  3DKX A;  4XL9 A;  4XBF A;  4FET A;  1MH4 A;  3BDD A;  3ZQH A;  1R5I D;  1HSJ A;  1MIJ A;  2Y31 A;  1D1C A;  1WJ5 A;  3E3V A;  3TDZ C;  2HKX A;  2O3F A;  3TW6 A;  4CGZ A;  4B3X A;  2VOD A;  3OYG A;  2L4M A;  3FHZ A;  2HKO A;  2K02 A;  3QP5 A;  4Y7N J;  1SD7 A;  5GP9 A;  5LHG A;  1FSE A;  2F5F A;  4LIU A;  1L0O C;  4ZYA A;  2MC4 A;  2F5E A;  2VXD A;  4EVI A;  3TDU C;  4RS8 A;  3HOT A;  2XIG A;  4LK1 F;  1ETX A;  3HOS A;  1ZHF A;  5IY5 H;  3ROU A;  2GAU A;  2WBM A;  3HXL A;  3KP7 A;  1SMY F;  2K3F A;  2XUB A;  3SFI A;  5LD2 C;  2EB7 A;  1OJL A;  2Q2E B;  4U0W A;  1FP2 A;  3H5N A;  2OZ6 A;  2ZSI B;  4QPQ A;  3GTO J;  4Y15 A;  4XR6 A;  1MMD A;  1SAU A;  4KN7 X;  2XAS A;  3ASN H;  1EV7 A;  3S32 A;  4ZYE A;  2NS7 A;  3U2R A;  1KGS A;  1X1P A;  3MQ0 A;  4B3A A;  1IDY A;  2P5L C;  4IKF A;  3F9K A;  3QPS A;  2LVS A;  4YFX F;  3H0D A;  3TO7 A;  3OYH A;  3BZ6 A;  5HLH A;  1IXC A;  2W57 A;  1MBK A;  4HX4 A;  2H94 A;  2DCE A;  4CCN A;  2MGQ A;  3C3W A;  4MGR A;  3J7Y J;  2HZD A;  3G1M A;  1F36 A;  1HC8 A;  3X2Q H;  1R5G A;  1YS7 A;  3DEU A;  4G94 A;  4OU0 A;  4LJZ F;  4QSH A;  3N4M A;  1T08 B;  2IP2 A;  5D4R A;  1HDP A;  1TBX A;  3HRT A;  1IN5 A;  4WK8 F;  2MH9 A;  2TCT A;  3LFU A;  5J40 A;  2Y9Y A;  1QHG A;  1TC3 C;  5E1Z B;  2L4A A;  2KDZ A;  1GT0 C;  2DMN A;  2HU9 A;  3I3L A;  2JUC A;  4X6A J;  1IRF A;  2QLZ A;  2J5O A;  2BW3 B;  3HBL A;  2WY8 Q;  1P6R A;  2OQG A;  3PNY A;  1WJE A;  2F5D A;  3U1K A;  1T2K A;  3D5L A;  1BIA A;  2L2O A;  4R1H A;  2L5Q A;  3QOD A;  4HYE A;  2JK3 A;  3L1P A;  2XAH A;  2ID3 A;  3GLL A;  5BQT A;  4PJL A;  4MTD A;  4A3E J;  1APL C;  4M71 A;  5BPI A;  4HF1 A;  4MNU A;  4M3B A;  3WTZ A;  1BL0 A;  1R6R A;  3OSF A;  3PQK A;  3AKZ A;  2W7N A;  1UMQ A;  4RA2 A;  2K86 A;  2ZJ2 A;  3DKW A;  2VKD A;  4J01 A;  2MG4 A;  3MKY B;  1F43 A;  2IGN A;  3FDY A;  3IKV A;  4G8X A;  1B59 A;  1ETW A;  3E5Q A;  5M5W J;  2LRE A;  1ZG5 A;  3LFK A;  3GTL J;  2CW0 F;  2D45 A;  3RJP A;  1WZ2 A;  1KQ0 A;  2KZG A;  1IRZ A;  3HB9 A;  1FLI A;  2KRH A;  2BEO A;  2RNJ A;  2LSO A;  3K4C A;  4A3L J;  3QYB A;  3JCU C;  5LFA A;  1YX3 A;  2QEX I;  2A6T A;  2RNG A;  5KAF C;  1RET A;  2FBH A;  3M8E A;  4CCJ A;  4KN4 X;  4OIP F;  4YEJ A;  3M7G A;  3G1L A;  2WAQ A;  1O7F A;  3B73 A;  1R58 A;  1XMX A;  1E3H A;  4DIQ A;  2FML A;  4GDF A;  2IEK A;  2MLG A;  2UV1 A;  2X85 A;  2EBI A;  4K2E A;  2ISZ A;  4BDZ A;  4S0H B;  1T39 A;  3PL8 A;  2DFE A;  3L2W A;  3H5R A;  2QA4 I;  2YX7 A;  2FEZ A;  1SD5 A;  1O3T A;  2IRF G;  3KZI C;  3IKT A;  1Z05 A;  2MLK A;  3S1Q J;  2KIQ A;  4BJT A;  3ML6 A;  4IEJ A;  2CU7 A;  5J3L A;  5IP7 J;  2CUF A;  6PAX A;  3I0T A;  1I3A A;  3ZQL A;  5E20 A;  2W48 A;  4RM2 A;  4E7I A;  4IRI A;  1HQC A;  1XPX A;  4XIC A;  1YRN A;  2A68 F;  4QIW N;  3H3Z A;  2DMU A;  5K7Z A;  4XSX F;  1W7P B;  2QM3 A;  1NH3 A;  4I0B A;  3JRH A;  1ON1 A;  2VKV A;  3OR1 C;  3R4K A;  1BW5 A;  1Y8Q B;  2V7F A;  3QWL A;  1J59 A;  3R6S A;  1Z7L A;  2O8X A;  1WH5 A;  4L0Z B;  4XN3 A;  2EZH A;  1H9T A;  2EQR A;  3CUO A;  4KIG A;  1MMS A;  3HOX J;  3O3K A;  2V1U A;  3OY9 A;  3F22 A;  2GA1 A;  3F8M A;  4A3B J;  3DWL E;  2HEO A;  3E5U A;  4I7H A;  2LC2 A;  3JRB A;  1RNL A;  2OBP A;  3CUQ B;  3WU1 B;  3OYC A;  1T98 A;  2E34 A;  4A93 J;  2ECB A;  2VKH A;  3ABL H;  4E7H A;  2LMD A;  2IS1 A;  1P4A A;  2NS8 A;  1B72 B;  2ZNY A;  3FBI B;  1VND A;  2PMH A;  2DDA A;  1JJ8 C;  2BHY A;  2ETH A;  3OIQ A;  5JVG F;  2Y30 A;  1ZG3 A;  2LNB A;  1LPQ A;  5E3N A;  1R5H A;  3F0C A;  1YJ9 I;  2EPF A;  5BNG A;  5D5V B;  1WPK A;  3LWF A;  5GTH C;  2NS0 A;  4EAT A;  1MZB A;  2I5U A;  1ZAR A;  2P6T A;  4WX9 A;  3I71 A;  1BJZ A;  2ZXI A;  3HZJ A;  3U1D A;  1ZRD A;  4RAY A;  3TO9 A;  1VQ5 I;  5FB2 A;  2COB A;  2BY0 A;  3OL4 A;  4A69 C;  4AVZ A;  3CTA A;  4CUG A;  1PP7 U;  1VQ7 I;  3BR1 A;  2VL8 A;  1PVE A;  1U5T A;  3KEY A;  4HLY A;  4NDL A;  2OC6 A;  3SHF A;  1VQL I;  2JSC A;  2H27 A;  4LOC A;  3CF5 F;  2OA4 A;  3RQI A;  1RC9 A;  4C3J J;  2NVT J;  2IAI A;  2FUG 2;  3KP2 A;  3NEU A;  4OWR B;  3DF8 A;  3SFZ A;  4ZYH A;  3GZ6 A;  1IGN A;  3H5A A;  2DOE A;  4J19 A;  1HBX G;  3A2K A;  2FX0 A;  3OS2 A;  2A69 F;  1LDK B;  4RB2 C;  1MMA A;  2WB1 A;  1K7A A;  4RAG A;  2FNP A;  4KMF A;  4P9U A;  2BHZ A;  4KDP A;  4CCK A;  1P92 A;  2PMZ A;  3PUB A;  2L7F P;  2HGC A;  3GWZ A;  1WFX A;  3WU2 C;  4A6E A;  4S05 A;  1JKO C;  3CCL I;  2CV2 A;  3VDX A;  5IYB J;  4C2U A;  1IDZ A;  2RQQ A;  3I59 A;  5F6F A;  2E1M C;  1RUO A;  4DQ2 A;  3CCV I;  5J1Y A;  4B09 A;  2Z33 A;  3PO2 J;  1MJB A;  1YX5 A;  3HTU A;  5C4X J;  1LNW A;  1YW8 A;  1B1B A;  2O7O A;  3HDD A;  3Q0V A;  1TWA J;  5EGO A;  1SFE A;  2OUM A;  2IA2 A;  2EFO A;  3K4L A;  2OAZ A;  1SFX A;  3F72 A;  4D7M A;  3FXM A;  3W2A A;  2HS5 A;  4LK0 F;  3QPH A;  5FFZ A;  2KLO A;  5CPR B;  1Y0N A;  3S8P A;  3ZXS A;  1P4W A;  2W4S A;  2XAF A;  3OYF A;  1OCT C;  3BZK A;  1MJ9 A;  1BW6 A;  3DEW A;  4KT6 A;  1JGG A;  5K7F A;  3OYM A;  1G2H A;  2XAU A;  3BOQ A;  4UB8 C;  1LDD A;  4NUB A;  1I39 A;  1EH8 A;  3K2Z A;  1X2M A;  3B6C A;  2L7M P;  3TW7 A;  5IP9 J;  2VBZ A;  1ON2 A;  1WRJ A;  4DGW B;  4HV5 A;  2HYF A;  5J1R A;  2A5Y B;  2F4O B;  3WGH A;  3K69 A;  4BEH A;  4M6Y A;  2R7R A;  2UXX A;  5LGN A;  5ILS A;  2IGM A;  5LRR A;  5IOZ A;  2JSP A;  2W85 A;  2VQH A;  2VXZ A;  3FXJ A;  1R1U A;  4AWX B;  2OZU A;  1S6L A;  4UV8 A;  1WJF A;  5CQE A;  5GPC A;  5DM6 F;  3WTS C;  2YU9 J;  2DA3 A;  2NOJ B;  2VE8 A;  2P81 A;  3HGG A;  1HXD A;  3CCR I;  2MH2 A;  4O5V A;  3BQZ A;  2Y0S N;  1OQY A;  2RN7 A;  3J7A Y;  2CQN A;  2LKX A;  2YSR A;  2ZJP F;  2K40 A;  2CW7 A;  3K0L A;  5FFX A;  4BQN A;  2JUG A;  4L9J A;  2CQ7 A;  3K1M A;  1FYK A;  5LGT A;  3FK6 A;  2O5R A;  3WHC A;  1WWX A;  3TQN A;  1EH6 A;  2GIZ A;  2VLA A;  1S8N A;  4G6D A;  5IT9 K;  3MKL A;  1YRN B;  4JP0 A;  1TWG J;  3JRG A;  2HYJ A;  2V79 A;  3R0A A;  3K4B A;  2VE9 A;  1I27 A;  4ZTF A;  5JR3 A;  3CP2 A;  3ZRG A;  1BR4 A;  2WV0 A;  3BC8 A;  3FMQ A;  5F64 A;  5KCM A;  2R7D A;  2K7L A;  1JKP C;  1QNT A;  2HI3 A;  4JX6 A;  4BHB A;  2LY2 A;  1XCB A;  1XD7 A;  2HPM A;  4HSR A;  1YE9 A;  3A02 A;  2IA0 A;  3ASO H;  1USS A;  5E79 C;  3KPH A;  1MW7 A;  3E6B A;  2ZXJ A;  1T38 A;  3DBL B;  1A31 A;  3IC7 A;  3N97 A;  3KLO A;  2HOA A;  2HDD A;  3LSR A;  3L2Q A;  3CDL A;  3MFK A;  2HDC A;  2R7V A;  3C18 A;  1OIS A;  3BY6 A;  4E7K A;  4M9Z A;  3FBN B;  2HXI A;  4PFP A;  3BTL A;  2M7B A;  5EZG A;  4L0Y B;  1X1A A;  3O8H A;  4ZYD A;  4NC8 A;  5B1B H;  2GQQ A;  4ESB A;  2XDV A;  2Q8K A;  2J5P A;  4BE2 A;  5LLQ A;  1BA5 A;  2IGO A;  2HOT A;  3OS0 A;  1E0E A;  3V8L A;  2Q2E A;  2R7T A;  2MBF A;  2N8G A;  4II2 A;  1XB4 A;  5AIP A;  1MGT A;  2M45 A;  1FSH A;  2R5Y B;  2H6B A;  3LAJ A;  2GXG A;  3KP6 A;  3FIW A;  2FXA A;  3Q3S A;  3DKY A;  4JBA A;  4M9S A;  4KFC A;  4G6T B;  3V8K A;  3HHH A;  5H20 A;  1JUP A;  3LSG A;  2OTJ I;  1TQP A;  1QZE A;  2DO7 A;  3N05 A;  5C44 J;  2LBF B;  4ITV A;  1FPQ A;  3Q0U A;  4RGR A;  3SYT A;  2V6E A;  4PFO A;  1TNT A;  1IRX A;  3A1Y A;  4D9J A;  4W1U A;  2BE5 F;  1S9H A;  2V1D A;  4A3G J;  1SD4 A;  3MMY B;  3H36 A;  4V2F A;  1U6G A;  4ZTJ A;  2ELH A;  1VQM I;  4FQG A;  3DPL C;  1U78 A;  5FLX K;  3W2V A;  2F2E A;  3DEE A;  1IAW A;  4LIV A;  3ZMS A;  3GFM A;  5M5Y J;  3LSJ A;  5DM7 F;  1EKE A;  2G9W A;  4L5E A;  4A3F J;  1CF7 A;  2PFB A;  3MZH A;  4RLF A;  5FRO A;  2ECC A;  3B02 A;  4ENJ A;  2Y9Z A;  1BC7 C;  3KYC B;  3H3V K;  1TP4 A;  4EM2 A;  2XB5 A;  1FIP A;  4EEF G;  3OYB A;  4BQO A;  3CD6 I;  3EUH C;  3BCB A;  2DOD A;  4PJJ A;  3ZQQ A;  3WE3 A;  2BW3 A;  2QQ9 A;  3ESW B;  3G1O A;  2EZI A;  1BBY A;  1Z6R A;  1VQN I;  1IRG A;  2WWY A;  3J80 Z;  2HQN A;  3DV8 A;  3RPU A;  3NQO A;  1OCC H;  4XLC A;  1I1S A;  1LKX A;  1WKM A;  2AHQ A;  4UHT A;  4Y52 J;  1LFP A;  1D1B A;  1R23 A;  5GAG J;  2GLO A;  2E36 A;  1IZ1 A;  3HM5 A;  3CC4 I;  2BZT A;  2W24 A;  2XPW A;  1T0F C;  1JTX A;  3QOE A;  3ZCO A;  3M1C A;  3DBR B;  4HNT A;  1DU0 A;  2CWE A;  1K61 A;  1EF4 A;  3KEO A;  3GXO A;  4Z6Y A;  5BPD A;  2CUJ A;  2M2E A;  1Z3X A;  2VT3 A;  5ICG A;  1T95 A;  4KUM A;  4WXD A;  2A61 A;  3DU6 A;  2ELK A;  5A2Q K;  4LLG F;  3VSK A;  1YG2 A;  2K27 A;  4ZZD A;  1ZG1 A;  3M4O J;  2AQF A;  3FZV A;  2P5K A;  1EA3 A;  1ETY A;  4BHC A;  4BXX J;  2NXN B;  2PBI A;  3H35 A;  3RDI A;  3QQA A;  3TKY A;  1BC8 C;  2IT0 A;  1U9N A;  1GLN A;  1TWC J;  2NVQ J;  1MSF C;  3ELK A;  3F8N A;  2XPU A;  1W36 C;  2RDP A;  2YR2 A;  1FOX A;  3D0S A;  5EF6 A;  3S3N A;  1REP C;  3D5R C;  1XGM A;  2E2I J;  3OIP A;  4HNU A;  1AA7 A;  1ZYR F;  4Z2Y A;  3JW4 A;  2X1E A;  5D8L B;  1FZP B;  1QBJ A;  2CGP A;  1G8X A;  4AID A;  3K1P A;  4KIT B;  5BMZ A;  3IAS 2;  5E3L A;  1I6X A;  1A5J A;  2L7Z A;  2QVO A;  2VOO A;  2R7S A;  1Y56 A;  3K9T A;  3FM5 A;  4F91 B;  2ZSH B;  3BLY A;  4Y3O A;  5JI6 A;  2CQQ A;  2DOA A;  3C1D A;  1VI0 A;  2EIN H;  2HXO A;  3WTV C;  2CH0 A;  2P5V A;  3I53 A;  4AC0 A;  3GCM A;  4IRG A;  5DUI A;  1Y39 A;  5D6F A;  1VQ6 I;  2CO5 A;  1W7P A;  1UHS A;  2HVQ A;  2DYS H;  4HX7 A;  4RLQ A;  3OYD A;  2EV6 A;  2Q1Z B;  3P9K A;  1XMA A;  2QWW A;  4Q5S F;  5K5Q A;  1MDM B;  3HL2 A;  2XGD A;  5AON A;  1MBJ A;  5F1J A;  1XTA A;  2LDU A;  3F6V A;  5D6E A;  3BR5 A;  3L09 A;  2NVU B;  2M0C A;  4UUV A;  2VB6 A;  2JJ7 A;  1FOK A;  3G4S I;  3E1S A;  3K1N A;  5CVV A;  4A3M J;  2VJ5 A;  2QSH X;  4U87 A;  2VPL A;  4NC7 A;  4A0Z A;  3JRF A;  4G7O F;  3LSP A;  3CUQ A;  1ZQ3 P;  3LMM A;  5E1W A;  2ESH A;  2Z2S B;  4TV7 A;  4OAY A;  3CES A;  2Z16 A;  3CCQ I;  1IJW C;  1B72 A;  2DDB A;  2D1V A;  2QKM B;  1NK3 P;  4EJU A;  3NWS A;  3L2U A;  2NNY A;  1LQ1 A;  1I6H J;  2BY1 A;  1CGP A;  3KP3 A;  4DW6 A;  1IC8 A;  1MSE C;  5ED4 A;  2E7X A;  3ZPL A;  1G3S A;  2OTL I;  3GEZ A;  2RVC A;  4KIF A;  4MEX F;  1LFB A;  1Y6I A;  1GXP A;  5HLT A;  4AD9 A;  2K9N A;  2KPM A;  1SMT A;  4UB6 C;  2L7K A;  5E18 F;  5FJ8 J;  2EIJ H;  1D8K A;  2Z5U A;  2PJR B;  4FIS A;  5ILV A;  2PMU A;  4B44 A;  1ITY A;  5H6R A;  4CH7 A;  1P7I A;  4YIF A;  2BVM A;  4QWQ A;  1S72 I;  3PFY A;  4FX0 A;  3RKX A;  1G4D A;  1V4R A;  3BTI A;  4ZDO A;  1QQI A;  3SZP A;  2D5V A;  5EZH A;  1A6I A;  4XRS A;  1JT6 A;  4KNY A;  2XC7 A;  4KIS A;  3MZ8 A;  1FTZ A;  2LLK A;  3B6A A;  4IXA A;  3HOW J;  3CF2 A;  3TGN A;  5DCM B;  4UUS B;  3KCC A;  4BXU A;  5BS6 A;  1F4K A;  5LEK A;  1OCO H;  1KA8 A;  4PZJ A;  4EJV A;  3ECH A;  5FKN A;  2E1O A;  3S2W A;  4PJ0 C;  1CF7 B;  1TQI A;  4E6K G;  2E1C A;  4B8X A;  2PJP A;  4AYB N;  5E17 F;  4EGZ A;  1PP8 F;  5K5O A;  2V1N A;  3CLO A;  1FOY A;  3R0J A;  3RPU D;  3OL3 A;  2V1X A;  1O57 A;  2R5Z B;  2BY2 A;  2DTR A;  1FBQ A;  3OIO A;  4LFU A;  2ZJQ F;  1NK2 P;  4IPA A;  3JAM K;  4FCY A;  1UZC A;  5D5X B;  1UHM A;  4PSX A;  5CLS A;  2F4I A;  1FMV A;  3OSG A;  5DS9 A;  1FWZ A;  2ZME B;  1BIB A;  2FA5 A;  3KZZ A;  3O6B B;  1C0W A;  3U9G A;  1SVL A;  1D3Y A;  1X1C A;  3FIS A;  1ZRF A;  1LB2 A;  3GTG J;  4D1Q A;  2EA2 A;  3EUK L;  4M3D A;  1J75 A;  1IF1 A;  5L3D A;  4I99 C;  5L3E A;  1EH7 A;  1ETK A;  2GOM A;  2M87 A;  3RQ4 A;  3H0G J;  2LG4 A;  3J80 K;  1JE8 A;  2KFD A;  1DP7 P;  4XRF A;  2PQ8 A;  4NBQ A;  4NHJ A;  2HZT A;  2I10 A;  1OFC X;  1WCM J;  1KU2 A;  1LEA A;  1I50 J;  4BAC A;  1OMI A;  2JA7 J;  4A3C J;  4N4O B;  3S1N J;  3CCS I;  2QBY B;  2KKO A;  1J0R A;  2BYV E;  2VN2 A;  1MKM A;  3G71 I;  4E4H A;  3LL7 A;  2YPR A;  2VQG A;  3QRF F;  1DPR A;  2WA0 A;  2HQR A;  5IYC J;  5J4V A;  4IJA A;  3S1R J;  1V55 H;  3O2P E;  4WF2 A;  2F48 A;  4RM3 A;  3FXU A;  1O3Q A;  4HX8 A;  3H9Q A;  4G6Q A;  2CV0 A;  1V5G A;  3VOD A;  4A3I J;  3KFW X;  5IT9 Z;  3QU3 A;  2XHK A;  3MN2 A;  4XN0 A;  1N25 A;  1Q1V A;  2QQA A;  3J81 K;  1UB9 A;  4BE1 A;  1T6S A;  4BQQ A;  3WU0 A;  3SXY A;  2YX4 A;  5LRS A;  3FM3 A;  3S16 J;  4HST A;  3P5J A;  3QPL A;  1P2F A;  2JZY A;  4EJW A;  1MNM C;  1LEB A;  1Z6T A;  3BG9 A;  3FKJ A;  5LEJ A;  2CV1 A;  3IHU A;  2XRO A;  1W36 D;  5K5R A;  4G7H F;  2DT7 B;  1RIO H;  3HSF A;  4RDU A;  3BR3 A;  3AG2 H;  1PYV A;  2FNA A;  4XKC A;  2LKS A;  2X1D A;  3BR6 A;  4UV9 A;  1MBH A;  3V4G A;  4CIC A;  2FBI A;  1WI9 A;  3PQJ A;  2W25 A;  1Z67 A;  2X48 A;  2ZFU A;  3M1E A;  4F7Z A;  2VON A;  1OPC A;  3ABM H;  4J00 A;  2P4W A;  4XQF A;  1FBU A;  3PO3 J;  2GM4 A;  1U5T C;  3RPQ A;  2IPQ X;  2P6S A;  1G3Y A;  4OIR F;  4EV0 A;  1E3P A;  3RKY A;  1LFU P;  1FTT A;  4XLA A;  4FE7 A;  1UG2 A;  3WTU C;  4XON A;  3AAF A;  1VQ4 I;  3L7W A;  3QP6 A;  2CFO A;  2I8D A;  3ONQ A;  4KJZ A;  2IW5 A;  5EEG A;  4DZJ A;  4RGS A;  4U88 A;  3OYN A;  4H0E A;  3FXK A;  3AG4 H;  2WAD A;  5EDN A;  1RI7 A;  1QO0 D;  1FEX A;  3F8F A;  1J5Y A;  2DW4 A;  3PIP F;  1K83 J;  1R7J A;  1ZAO A;  2X4H A;  1OYW A;  4XKV A;  1LJ9 A;  5FD5 A;  2EFP A;  3V8J A;  1QVT A;  2X0L A;  4FHT A;  1JKQ C;  3K4M A;  1TLH B;  4IF4 A;  4ZZL A;  2PG4 A;  4IRH A;  2Y75 A;  3LA3 A;  2A6E F;  2VOP A;  2AXT C;  1G6N A;  4JK1 X;  2R5Y A;  1PUF B;  3ZR8 X;  1JKR C;  2X1C A;  5FLX Z;  2JPB A;  3HTS B;  1XGS A;  4M3G A;  1TQM A;  5HLG A;  1P7J A;  1STZ A;  3NAR A;  1FYL A;  1WJB A;  3T5X A;  1KQ9 A;  2CQX A;  3IH3 A;  2LOO A;  3F21 A;  2LBF A;  1M1E B;  1X58 A;  3GLX A;  3C2G A;  2DJI A;  3QU6 A;  3JSO A;  3NWT A;  2DFI A;  2C6Y A;  3GTK J;  5F1R A;  2L54 A;  1AKH B;  3SDB A;  5EJC A;  3C2B A;  1HST A;  5HDN A;  4WXH A;  2RC4 A;  2OD5 A;  4D0P A;  2CFX A;  4LLL A;  3LOC A;  2OF7 A;  3OWT A;  2GWR A;  2CJJ A;  4CDG A;  2DK8 A;  3DLA A;  2LH9 A;  3BP8 A;  3GVA A;  2EFQ A;  4Y4R A;  1ZTR A;  3RSN A;  3T0Y A;  3TO6 A;  5HOD A;  5JLW A;  2DMT A;  3QYE A;  5E3O A;  4PGG A;  1VFC A;  2UWM A;  1O3R A;  3VYS B;  3S3O A;  4V2G A;  4M3F A;  5DDG A;  1XSV A;  2DA1 A;  4CZZ A;  4HG2 A;  1DU6 A;  1TZL A;  2H8R A;  2VC1 A;  3TMO A;  2HTS A;  5DV5 A;  2R0Q C;  3E5X A;  4DBQ A;  3HPH A;  4WCG A;  4XLF A;  3J7A O;  3G2B A;  2ZO4 A;  3MD2 A;  4XMY A;  3L00 A;  3KP5 A;  5BOX A;  4HAM A;  2JVG A;  2WY7 Q;  3JRE A;  1NHA A;  2V6C A;  5A2Q Z;  4LIT A;  4ETS A;  2LKP A;  1FMW A;  2ADU A;  4AIH A;  2BVL A;  4QTR A;  3E6C C;  2DQR A;  3ZQF A;  5EYR A;  4F92 B;  4CA0 A;  4A3K J;  1X1B A;  1QGP A;  1WJC A;  1ZLK A;  1GHC A;  2GA2 A;  2JPC A;  3FXR A;  3FK7 A;  3ZN0 A;  5HVQ C;  3VYR B;  1S5L C;  3LQR A;  2ACJ A;  2XF7 A;  1OLT A;  3E6D A;  4XOP A;  4BXF A;  2L9N A;  1MH3 A;  2QGU A;  5GTI C;  1VQ8 I;  1HKT A;  3CCU I;  1Z91 A;  4AIJ A;  2DOF A;  1YJW I;  5HLI A;  2X6X A;  3GX4 X;  1GXQ A;  1L3L A;  1AOY A;  3O8G A;  1YW7 A;  4IOC F;  1UHW A;  3BZC A;  3GUD A;  2IVM A;  3BG7 A;  4OMZ A;  4AU7 A;  1X4O A;  4NC6 A;  5L3F A;  4BH9 A;  3EDP A;  4AIK A;  4UVC A;  2TDX A;  1SAX A;  1DPU A;  3FWE A;  2JN6 A;  3ABK H;  4B43 A;  2BXZ A;  5CYV A;  1K4T A;  2VBY A;  3JSP A;  2KDO A;  5KK1 A;  5JFR A;  3KIO A;  3W6K B;  3S2H J;  5H6Q A;  2DXI A;  1RZ4 A;  2HPI A;  5C4J J;  5E1X A;  4HDV A;  4G9Y A;  1TT0 A;  2KL4 A;  3HSR A;  3R61 A;  1D5V A;  3VWB A;  3M9A A;  4M72 A;  2VQL A;  3DCF A;  4XK4 A;  2FMY A;  3BG3 A;  1E17 A;  4EMS A;  2L0K A;  3M3Y J;  1J9I A;  2ISY A;  1QPM A;  5L3C A;  1W1W E;  1MD0 A;  4PDK A;  1I1G A;  5L3G A;  1RKT A;  2AXL A;  4MTE A;  1Z1D A;  5LBQ A;  1VQ9 I;  4P9F A;  3CCE I;  3KX2 A;  2Y0S A;  1Z3Y A;  3WGI A;  2AQE A;  2DT6 A;  1MBG A;  1MDM A;  2KJC A;  2QCO A;  3NAU A;  3HHG A;  2K9M A;  2DA7 A;  3H1C A;  3H3U A;  1ZR4 A;  5DYM A;  3EPZ A;  2OCE A;  4M6V A;  4IHW A;  3KEQ A;  3ZMU A;  3ZGK A;  3CCM I;  1WGX A;  2EZK A;  5FKK A;  1G3W A;  2XPV A;  1P9Q C;  2ESN A;  2HYG D;  2K3P A;  2L02 A;  2PN6 A;  4C2M J;  2JWT A;  1KU7 A;  2XV4 S;  3E6M A;  2XKO A;  4N4N B;  4IX7 A;  3SEQ A;  2STW A;  1PDN C;  2JVH A;  2LF7 A;  2COM A;  3HGY A;  2XAJ A;  5CJ9 A;  2HVS A;  5EG0 B;  1J2X A;  1ONV A;  2MAB A;  5M3M J;  2K9L A;  1ERD A;  1CQT A;  1BI2 A;  1SFK A;  2A05 A;  2AO9 A;  2L9R A;  2V9V A;  2CS3 A;  3K4N A;  1SAN A;  2HWV A;  3ZMZ A;  3I4P A;  4BUP A;  3SZT A;  1WH7 A;  2IBD A;  3V7R A;  3TED A;  1X3U A;  3IRQ A;  1JUM A;  2A3S A;  2CMP A;  3TOB A;  4M73 A;  1TTY A;  4DNC A;  1MBE A;  4OIQ F;  4Q47 A;  4CCL A;  1OR7 A;  4ZDP A;  2IXS A;  3HOY J;  4MO7 A;  2B7E A;  3HYI A;  5FD6 A;  4PGH A;  1BJA A;  2Y0M A;  2DN0 A;  2HOE A;  2PJR A;  2G0E A;  1QRY A;  2R7X A;  4Y13 A;  3G73 A;  3RZO J;  2KP6 A;  3FXL A;  1FJL A;  4U7D A;  1ZGW A;  2ZME C;  5JHU A;  2XVC A;  1BI0 A;  3C2H A;  1YW9 A;  2OJE D;  5DD8 A;  1X4P A;  3CMY A;  5ILU A;  3K4K A;  4AM3 A;  5IYD J;  1XGO A;  3KYD B;  2EIL H;  1IXS B;  1NG6 A;  4DJA A;  2W82 A;  2RV8 A;  3AG3 H;  2RAE A;  3LSM A;  5DCM A;  4UUS A;  5EEH A;  2R7Z J;  4UVB A;  4ZDL A;  2XRL A;  5TRD A;  1YO5 C;  3MEX A;  3JAM Z;  2WAE A;  1K78 B;  1E3O C;  2Z9O A;  3GZN B;  1OYI A;  3I5U A;  5IPA A;  4BBS J;  2Z3Y A;  3W6V A;  3ZQI A;  1YIT I;  3S93 A;  2EFN A;  3A01 B;  3H9G A;  3K4J A;  5CKT A;  2LRD A;  3F3X A;  5FRM A;  3VYT B;  1D0X A;  1HKQ A;  1UCR A;  2M8E A;  1YFH A;  4D7N A;  2BOL A;  3OYE A;  3H92 A;  2R5Z A;  1ENH A;  3DTK A;  3OYI A;  4E7J A;  2LY1 A;  4GRI A;  4BBR J;  1LVK A;  1DGW Y;  1SVO A;  1ZKG A;  4I09 A;  4R79 A;  3CMA I;  1VQP I;  1DDN A;  3ERM A;  1D0Y A;  4HF0 A;  4Q4Z F;  2XKP A;  2CW8 A;  3KZY A;  3WTY C;  2ZME A;  3RKW A;  3S2D J;  1RR7 A;  4A0Y A;  5D8K B;  3S3M A;  4DBR A;  2EK5 A;  1KU3 A;  1RES A;  2DMP A;  4GYG A;  4OIN F;  1HA8 A;  3AL0 B;  1ETO A;  3P9I A;  1BM9 A;  2E5Z A;  2R3S A;  1HW5 A;  4FE4 A;  2VI6 A;  4N9I A;  2DA2 A;  3IV5 A;  3IP4 B;  3KE2 A;  2D1H A;  2UUZ A;  1KZH A;  3V42 A;  3HPG A;  3VB2 A;  4RMN A;  1YIO A;  1Z0X A;  1QPI A;  1WJA A;  1R1T A;  2IGK A;  5CVR A;  4B47 A;  4HPQ A;  2M3A A;  2QBY A;  2GIV A;  4FT8 A;  1F5T A;  1S7O A;  3P7N A;  4C3I J;  2VIX A;  4F52 A;  3J81 Z;  4IZZ A;  3DXJ F;  3HC7 A;  4JQF A;  4ESF A;  3ZP5 A;  3BQY A;  3Q5F A;  3L2V A;  3HKZ N;  3OOU A;  1HW2 A;  3PM1 A;  4XKW A;  4I02 A;  2KRF A;  5KHD A;  4LG0 B;  4YRV A;  5JLX A;  4RB0 A;  1OCR H;  5HS8 A;  4IHT A;  3CUQ C;  2DA6 A;  2FJ1 A;  5K7H A;  4YIR X;  1HLV A;  2XSD C;  2MD5 A;  2BV6 A;  1X1D A;  3WG7 H;  3ZN1 A;  4ZH4 F;  2FF4 A;  2VBX A;  4L9N A;  1LDJ A;  4BAY A;  4E7Z A;  2QSF X;  2P7C B;  1Z21 A;  2L9V A;  1KYW A;  2CSO A;  3Q9V A;  1R4M B;  1T33 A;  2IJL A;  5FRN A;  1H8A C;  1W5T A;  3FKI J;  4HV6 A;  4ABZ A;  2HOS A;  3BJA A;  4PUS A;  3FMS A;  3W3C A;  3BWG A;  3LQQ A;  4HBL A;  3LSK A;  5FGM A;  1RUN A;  2JRT A;  2Y2Z A;  1WJD A;  2GZW A;  2NAZ A;  4FX4 A;  4IHS A;  3J7Z I;  1GVD A;  1QVU A;  1HCR A;  4XLP F;  2K4J A;  2OV7 A;  3CDH A;  3S15 J;  3QYF A;  3RCO A;  2MC3 A;  1BN5 A;  1XS9 A;  3I58 A;  1GV2 A;  1LE8 B;  1RRJ A;  1AU7 A;  4C2T A;  3BCA A;  2QQB A;  4EJT A;  4GFB A;  4JOM A;  1JI8 A;  4AUX A;  3TP3 A;  2FQ3 A;  2ZC2 A;  3ZMT A;  3GTM J;  4YEL A;  2NOG A;  1X2N A;  2JA5 J;  1IXR C;  2P0W A;  2UXN A;  1ORK A;  2DFF A;  5FKL A;  4CYC B;  4XM3 A;  3W6J B;  2M5W A;  3A4C A;  5GPA A;  1OCZ H;  3MZY A;  3ZMV A;  4U0Y A;  1K79 A;  2L01 A;  3BG6 A;  2H09 A;  2QF7 A;  4YII A;  3OR2 C;  3BT9 A;  3BPX A;  1ETQ A;  3SQN A;  2E71 A;  2CG4 A;  2JRM A;  3BJO A;  3F6O A;  2KZV A;  4YFK F;  2QUF A;  2YU3 A;  2W84 A;  1K6O A;  3R60 A;  2F5V A;  3PFI A;  4DYC A;  2ZCW A;  2YS9 A;  3RI4 A;  2R7Q A;  1SVM A;  4CSW A;  3PSF A;  2KQR A;  4EM1 A;  1R22 A;  2QZ8 A;  1PUF A;  2PX9 A;  3OOP A;  1JTY A;  1XX5 A;  2EV0 A;  1XDU A;  1BI3 A;  1UJ8 A;  1POG A;  4KIC A;  1ACI A;  1S7E A;  1GVJ A;  2F6C A;  3DTE A;  2GXB A;  2FOW A;  1Y1V J;  2LR8 A;  3MVP A;  1O4X A;  3IWF A;  4P5O A;  2E7W A;  3WTX C;  4P96 A;  1UST A;  4OAZ A;  4L18 B;  3S1M J;  2V9K A;  1Z9C A;  3TOA A;  1W0T A;  1AKH A;  1B8I B;  4C9Y A;  3VOE A;  3FX3 A;  1Y1W J;  4PSW A;  1D0Z A;  3EQL F;  1IV8 A;  4UY8 I;  5H2F C;  1SC7 A;  1FP1 D;  1V5F A;  1TT5 B;  4G7Z F;  3LST A;  4HQE A;  1SFU A;  1EJ9 A;  5GAE J;  2PLY A;  4LLN A;  3VFZ A;  2IA1 A;  2XGX A;  2DI3 A;  4C30 A;  3I55 I;  3GME A;  1Q1H A;  2BY3 A;  3D5S C;  5IT3 A;  1UFM A;  3REO A;  3IWZ A;  1K4S A;  4KYW A;  1K6Y A;  5FO5 A;  3ZQ7 A;  1UG0 A;  1WVR A;  2EH3 A;  2M4G A;  5B1A H;  5F0F A;  1OKR A;  4XLN F;  5LHI A;  1GV5 A;  3K70 C;  2ZJR F;  4QLC U;  4ASN A;  4LD5 A;  3A0H C;  3KLN A;  5ERI A;  1JHF A;  2K4B A;  5E8G A;  1IN8 A;  2XF6 A;  4RGX A;  2XRN A;  2EIK H;  1FIA A;  4KA4 A;  1JJ6 C;  4H4K C;  4AYB A;  2DLL A;  4F55 A;  2VKE A;  1FBS A;  4PCQ A;  4LG3 A;  4B1R A;  3JRD A;  1ETV A;  3CC7 I;  3HOU J;  2XGE A;  4NQW B;  4HNV A;  1IV6 A;  5HOO A;  1DGR M;  3D1N I;  5F27 A;  5F04 A;  2R7U A;  1NG7 A;  1E2X A;  4BYY A;  2WAQ N;  1FC3 A;  1B9N A;  1MNE A;  1YI2 I;  1X3Z B;  1IN7 A;  3DPU A;  2XB0 X;  3UR3 C;  4MFE A;  1QHH D;  4ENK A;  1ZRC A;  2EA4 A;  5LHH A;  2Y48 A;  1JUS A;  5KNL A;  4KT5 C;  3DP7 A;  3GYH X;  4GGG A;  3MKZ A;  1JHH A;  1ZR2 A;  5CVJ A;  2Z99 A;  5J4Y A;  2NVY J;  2QYO A;  1XG1 A;  3CJT B;  3LAP A;  1YJN I;  2A5W A;  4XLE A;  3ULQ B;  1DUX C;  2RRE A;  2WV1 A;  3V7S A;  3ZOB A;  5AIQ A;  2NNN A;  4XOR A;  3DU5 A;  5C3E J;  1QZZ A;  2X6Y A;  2XSJ C;  1W0U A;  3I56 I;  2LY9 A;  4XID A;  4XRM A;  1ZRE A;  2LP0 A;  3DFG A;  4M3E A;  4ZC3 A;  5KVR A;  1W5C C;  4JX5 A;  1G59 A;  4IVN A;  1R9T J;  1HDD C;  4P55 A;  2HR3 A;  3HOZ J;  1W7P D;  3RZD J;  4D5F A;  1TWH J;  3TL4 X;  3HOV J;  2TRT A;  1UAA A;  5D4S A;  1H89 C;  3M8J A;  2R4G A;  1N75 A;  2ZB9 A;  1KYZ A;  4X1E A;  4MHG A;  2X6W A;  1IUY A;  3LSI A;  3SEZ A;  1MJA A;  3CC2 I;  2NVX J;  1ZGJ A;  2DTZ A;  3LNQ A;  3CME I;  1HW1 A;  1IG7 A;  2CUZ A;  4PK4 A;  4A5N A;  2XAG A;  1XSD A;  1AWC A;  3EYI A;  1IN4 A;  3OYK A;  3KP4 A;  4BU2 A;  1T56 A;  4I01 A;  3UKG A;  1V5E A;  1TW2 A;  3SJM A;  2KIM A;  1FX7 A;  1IUF A;  2KIS A;  2K9S A;  2DYR H;  3OYA A;  3F8B A;  2QSG X;  4BQA A;  2R7O A;  1UEL B;  2B0L A;  2OQR A;  4RB1 A;  2JA6 J;  2B9S A;  4LB6 B;  3S17 J;  1YTY A;  3IL2 A;  1O7L A;  2RKH A;  3C7J A;  3PSI A;  2KT0 A;  2M0M A;  1YIJ I;  2GOX B;  3A03 A;  2DK5 A;  4U0V A;  5EG0 A;  3COA C;  1I3Q J;  1R36 A;  4G12 A;  4IQ4 A;  2QQ8 A;  3HIF A;  4ZYG A;  1U0J A;  2X6O A;  2KHM A;  1OCP A;  2HNH A;  4F93 B;  3CO6 C;  5J6X A;  2BGC A;  3GO5 A;  4P1W A;  3KET A;  1SEU A;  2LYC A;  3ZMD A;  3DQV C;  1QA6 A;  1ZH5 A;  2AS5 F;  2JA2 A;  3GTJ J;  5M3F J;  1F9N A;  2IS2 A;  3CZ6 A;  5HDG A;  3CJR B;  3M8F A;  2GBY A;  1BI1 A;  2HFH A;  2XGC A;  1PUE E;  4DYR A;  2M9H A;  1S7A A;  5GAD J;  3T8R A;  4E70 A;  4CCO A;  2VAS A; 
#chains in the Genus database with same CATH homology
 4ON0 A;  5K1Y A;  4YFN F;  4Q48 A;  1J7K A;  4BHP A;  1R00 A;  2RGV A;  4CXF A;  1ZLJ A;  3GFI A;  3GFL A;  1FT9 A;  3VEP A;  2FE3 A;  4M6X A;  2NRA C;  4WWC A;  3WTW C;  4N0B A;  3WE2 A;  4LGW A;  1K78 A;  3CJN A;  4CO8 A;  4KMU X;  3BPV A;  1B6A A;  1FYM A;  1XSX A;  2P7V B;  3HRM A;  4L9T A;  2MA3 A;  1Z7U A;  2M1B A;  3V7C A;  2RQP A;  1A04 A;  2DBB A;  4GYI A;  3ERE D;  4GO1 A;  5JVT A;  4UXN A;  3HUG A;  1S29 A;  4M74 A;  3IRR A;  1S3J A;  2PEX A;  1JXS A;  4XSZ F;  2D2W A;  4EM0 B;  5D5U B;  1YQA A;  2O0Y A;  2XAQ A;  4HW0 A;  5CVI A;  3OV8 A;  3MAJ A;  2ZKZ A;  3GF2 A;  3RYP A;  1F1Z A;  1O3S A;  2A6H F;  2OU2 A;  2F5C A;  3HSE A;  1QZY A;  3E97 A;  1XGN A;  1W4M A;  2DT5 A;  1IW7 F;  4LG0 A;  2QEN A;  4OIO F;  1H0M A;  4EQQ A;  3WTT C;  3QAH A;  4R8H A;  5DD4 A;  1SD6 A;  5L3B A;  5LGU A;  1YLF A;  3MCZ A;  5DCF A;  3LA2 A;  4AVP A;  1FNN A;  2HTJ A;  4M9X A;  3T8T A;  4I0A A;  1FY7 A;  2DAO A;  4HQM A;  3CO7 C;  3ABT A;  4CHU A;  2DPU A;  4L5I A;  2WTE A;  4UNO A;  1KQ8 A;  3EYY A;  4HA8 A;  4GCV A;  2O6G E;  3EET A;  4NB5 A;  2FOK A;  5DUK A;  4MQ9 F;  3DPT A;  3I54 A;  2ZNZ A;  2G7H A;  2E1N A;  2G7U A;  1XN7 A;  2KIF A;  2BBY A;  5J8C A;  4HDU A;  4OMY A;  1XMK A;  3GFJ A;  3HRS A;  1Y0U A;  2EV5 A;  2VBW A;  5HS9 A;  4I98 B;  2VC0 A;  1D8J A;  2L3D A;  1R1V A;  2DPD A;  4I2O A;  4ESJ A;  4MQV A;  3NRV A;  3JTG A;  2CQK A;  1H9G A;  2EFW A;  1XCV A;  5D5W B;  4UVA A;  2CYY A;  1XDS A;  2JT1 A;  1U2W A;  2M30 A;  4HOB A;  4BNC A;  1V3F A;  1KU9 A;  1U5T B;  1OYY A;  1TW3 A;  1W5S A;  3ABU A;  2DU9 A;  3F23 A;  1B9M A;  1VTN C;  2STT A;  3I64 A;  4HZF A;  5ICF A;  4A5M A;  1P4X A;  2P8T A;  2FRH A;  2H6C A;  3WGG A;  3WG9 A;  2PI0 A;  2UZK A;  4ENN A;  4YG2 F;  1ODD A;  3L2C A;  1I5Z A;  2EJR A;  2DQL A;  1IN6 A;  4HLX A;  3MWM A;  3WOD F;  4CYD A;  3FXQ A;  4GXO A;  3I59 B;  4A2U A;  3BJ6 A;  1U8R A;  4S04 A;  4LB5 A;  4U7B A;  1TNS A;  3GW2 A;  3RTR A;  4NQW A;  5ICC A;  4O3M A;  2R7F A;  1B4A A;  2KIU A;  1YS6 A;  2ZBK A;  2Q0O A;  4MEY F;  3QOP A;  2VT2 A;  4HF2 A;  1U3E M;  4RB3 C;  4EJO A;  1HKS A;  5J8F A;  1BOA A;  2FBK A;  3ISP A;  3GZ5 A;  4L9V A;  2FSW A;  2O03 A;  2NYX A;  3P9C A;  4LMY A;  2JTV A;  3LA7 A;  3RYR A;  5DEQ A;  4O6J A;  2A07 F;  3EUH A;  4RAZ A;  2EWN A;  4KIB A;  3ECO A;  1WSU A;  3JTH A;  1G3T A;  3F8C A;  5ICE A;  1YYV A;  4A0X A;  1T0F A;  3HRU A;  5HDK A;  2LF8 A;  4OOI A;  3G3Z A;  1ZGA A;  5E8I A;  2O61 A;  3BRO A;  3FF5 A;  3RIR A;  2ZFW A;  4WXC A;  3Q9S A;  5TJJ A;  1JGS A;  4RGU A;  1WQ2 A;  3T1B A;  2FU4 A;  4L5J A;  4ENM A;  1LVA A;  3L9F A;  4N9H A;  5HS7 A;  2WC2 A;  1ULY A;  1ZN2 A;  3FMR A;  4A6D A;  4A12 A;  2KJB A;  4EGY A;  5CVU A;  4Y17 A;  3QPT A;  4XBF A;  3BDD A;  1HSJ A;  3E3V A;  3TDZ C;  4CGZ A;  2HKX A;  2O3F A;  2VOD A;  2L4M A;  3FHZ A;  2HKO A;  2K02 A;  3QP5 A;  1SD7 A;  5LHG A;  1FSE A;  2F5F A;  1L0O C;  2F5E A;  4EVI A;  3HOT A;  3TDU C;  4RS8 A;  2XIG A;  4LK1 F;  3HOS A;  1ZHF A;  3ROU A;  2GAU A;  3KP7 A;  1SMY F;  2XUB A;  2EB7 A;  4U0W A;  1FP2 A;  2OZ6 A;  4Y15 A;  4KN7 X;  2XAS A;  1EV7 A;  4ZYE A;  3U2R A;  1KGS A;  3MQ0 A;  2P5L C;  4YFX F;  3TO7 A;  3BZ6 A;  5HLH A;  1IXC A;  2W57 A;  4HX4 A;  2H94 A;  3C3W A;  4MGR A;  1R5G A;  1YS7 A;  3DEU A;  4G94 A;  4OU0 A;  4LJZ F;  3N4M A;  2IP2 A;  5D4R A;  1TBX A;  4WK8 F;  3HRT A;  1IN5 A;  2MH9 A;  5E1Z B;  2L4A A;  1IRF A;  2QLZ A;  2J5O A;  1P6R A;  2OQG A;  2F5D A;  1T2K A;  3D5L A;  1BIA A;  4R1H A;  4HYE A;  2XAH A;  5BQT A;  4MTD A;  4M71 A;  5BPI A;  4HF1 A;  4MNU A;  3WTZ A;  3PQK A;  2K86 A;  2ZJ2 A;  3DKW A;  3IKV A;  4G8X A;  1B59 A;  3E5Q A;  1ZG5 A;  3LFK A;  2CW0 F;  2D45 A;  3RJP A;  1KQ0 A;  1FLI A;  2BEO A;  2RNJ A;  2LSO A;  3M8E A;  2FBH A;  4KN4 X;  4OIP F;  3M7G A;  1O7F A;  3B73 A;  1R58 A;  2FML A;  2MLG A;  4K2E A;  2ISZ A;  1T39 A;  2YX7 A;  2FEZ A;  1SD5 A;  1O3T A;  2IRF G;  3IKT A;  1Z05 A;  2MLK A;  3ML6 A;  6PAX A;  3I0T A;  5E20 A;  4IRI A;  1HQC A;  2A68 F;  3H3Z A;  4XSX F;  1W7P B;  2QM3 A;  4I0B A;  1ON1 A;  3R4K A;  1J59 A;  3R6S A;  2O8X A;  4L0Z B;  1H9T A;  3CUO A;  4KIG A;  3O3K A;  2V1U A;  3F22 A;  2GA1 A;  3F8M A;  2HEO A;  3E5U A;  4I7H A;  1RNL A;  2OBP A;  3CUQ B;  3WU1 B;  1T98 A;  1P4A A;  2ZNY A;  2PMH A;  2ETH A;  1ZG3 A;  2LNB A;  1R5H A;  5D5V B;  3LWF A;  2NS0 A;  1MZB A;  4WX9 A;  1ZAR A;  2P6T A;  3I71 A;  3U1D A;  1ZRD A;  4RAY A;  3TO9 A;  5FB2 A;  3CTA A;  1PP7 U;  1U5T A;  4HLY A;  3SHF A;  2JSC A;  2H27 A;  2OA4 A;  3KP2 A;  3NEU A;  3DF8 A;  3SFZ A;  4ZYH A;  3GZ6 A;  1HBX G;  2A69 F;  1LDK B;  4RB2 C;  1K7A A;  2FNP A;  4KMF A;  4P9U A;  4KDP A;  1P92 A;  4S05 A;  3GWZ A;  2HGC A;  4A6E A;  3I59 A;  5F6F A;  1RUO A;  4DQ2 A;  4B09 A;  2Z33 A;  1MJB A;  3HTU A;  1LNW A;  1YW8 A;  1B1B A;  1SFE A;  2IA2 A;  2EFO A;  2OAZ A;  1SFX A;  3F72 A;  2HS5 A;  4LK0 F;  3QPH A;  5FFZ A;  1P4W A;  2XAF A;  1MJ9 A;  3BOQ A;  1LDD A;  1EH8 A;  3K2Z A;  2VBZ A;  1ON2 A;  1WRJ A;  4HV5 A;  2HYF A;  2A5Y B;  3WGH A;  3K69 A;  4M6Y A;  2UXX A;  5LGN A;  5ILS A;  5LRR A;  2W85 A;  2VXZ A;  1R1U A;  4AWX B;  2OZU A;  1S6L A;  4UV8 A;  3WTS C;  2VE8 A;  1HXD A;  2MH2 A;  4O5V A;  2RN7 A;  2YSR A;  3K0L A;  5FFX A;  4L9J A;  3K1M A;  1FYK A;  5LGT A;  1WWX A;  3TQN A;  1EH6 A;  1S8N A;  4G6D A;  5IT9 K;  2V79 A;  3R0A A;  2VE9 A;  1I27 A;  5JR3 A;  2WV0 A;  3FMQ A;  5F64 A;  2R7D A;  2K7L A;  1QNT A;  4BHB A;  1XCB A;  1XD7 A;  2IA0 A;  1USS A;  3E6B A;  2ZXJ A;  1T38 A;  3IC7 A;  3N97 A;  3KLO A;  3MFK A;  2HDC A;  3C18 A;  3BY6 A;  4M9Z A;  4L0Y B;  4ZYD A;  2GQQ A;  4ESB A;  2Q8K A;  2J5P A;  5LLQ A;  3V8L A;  2Q2E A;  2MBF A;  1XB4 A;  5AIP A;  1MGT A;  2M45 A;  1FSH A;  2H6B A;  3LAJ A;  2GXG A;  3KP6 A;  2FXA A;  4JBA A;  4M9S A;  4KFC A;  3V8K A;  3HHH A;  5H20 A;  1TQP A;  2DO7 A;  1FPQ A;  4RGR A;  1TNT A;  2BE5 F;  2V1D A;  1SD4 A;  1U6G A;  2ELH A;  3DPL C;  1U78 A;  5FLX K;  2F2E A;  1IAW A;  3ZMS A;  3GFM A;  2G9W A;  1CF7 A;  2PFB A;  3MZH A;  3B02 A;  4ENJ A;  1BC7 C;  4EM2 A;  3WE3 A;  2QQ9 A;  1BBY A;  1Z6R A;  1IRG A;  2WWY A;  3J80 Z;  2HQN A;  3DV8 A;  3RPU A;  3NQO A;  1I1S A;  1WKM A;  4UHT A;  1R23 A;  1IZ1 A;  2W24 A;  2CWE A;  3KEO A;  3GXO A;  5BPD A;  2VT3 A;  5ICG A;  4KUM A;  4WXD A;  2A61 A;  5A2Q K;  4LLG F;  1YG2 A;  2K27 A;  4ZZD A;  1ZG1 A;  3FZV A;  2P5K A;  4BHC A;  2PBI A;  3RDI A;  3TKY A;  1BC8 C;  2IT0 A;  3ELK A;  3F8N A;  2RDP A;  2YR2 A;  3D0S A;  1REP C;  1XGM A;  1ZYR F;  4Z2Y A;  3JW4 A;  5D8L B;  1FZP B;  1QBJ A;  2CGP A;  3K1P A;  5BMZ A;  1I6X A;  2QVO A;  2VOO A;  3K9T A;  3FM5 A;  5JI6 A;  3C1D A;  3WTV C;  2P5V A;  3I53 A;  4IRG A;  5DUI A;  5D6F A;  2CO5 A;  1W7P A;  4HX7 A;  2EV6 A;  3P9K A;  1XMA A;  2QWW A;  4Q5S F;  5K5Q A;  1MDM B;  5AON A;  2LDU A;  3F6V A;  5D6E A;  3L09 A;  4UUV A;  1FOK A;  3K1N A;  5CVV A;  4G7O F;  4A0Z A;  3CUQ A;  5E1W A;  2ESH A;  4TV7 A;  2D1V A;  4EJU A;  1LQ1 A;  2NNY A;  1CGP A;  3KP3 A;  5ED4 A;  2E7X A;  3ZPL A;  1G3S A;  3GEZ A;  2RVC A;  4KIF A;  4MEX F;  1GXP A;  4AD9 A;  1SMT A;  5E18 F;  1D8K A;  2Z5U A;  5ILV A;  2PMU A;  5H6R A;  4YIF A;  4QWQ A;  1G4D A;  4FX0 A;  3RKX A;  1V4R A;  1QQI A;  3SZP A;  4KNY A;  4IXA A;  3TGN A;  5DCM B;  1F4K A;  3KCC A;  4BXU A;  5BS6 A;  1KA8 A;  4PZJ A;  4EJV A;  3ECH A;  3S2W A;  1CF7 B;  1TQI A;  2E1C A;  4B8X A;  2PJP A;  5E17 F;  4EGZ A;  1PP8 F;  5K5O A;  3CLO A;  3R0J A;  2V1X A;  1O57 A;  2DTR A;  1FBQ A;  4LFU A;  4IPA A;  3JAM K;  5D5X B;  1UHM A;  5CLS A;  1FWZ A;  2ZME B;  1BIB A;  2FA5 A;  3KZZ A;  3O6B B;  1C0W A;  3U9G A;  1D3Y A;  1ZRF A;  1LB2 A;  2EA2 A;  1IF1 A;  1J75 A;  5L3D A;  5L3E A;  1EH7 A;  2M87 A;  3J80 K;  1JE8 A;  1DP7 P;  4XRF A;  2PQ8 A;  4NHJ A;  2HZT A;  1KU2 A;  1LEA A;  1OMI A;  2QBY B;  2KKO A;  1J0R A;  2BYV E;  2VN2 A;  1MKM A;  2YPR A;  3QRF F;  1DPR A;  2HQR A;  4IJA A;  3O2P E;  4WF2 A;  3FXU A;  1O3Q A;  4HX8 A;  4G6Q A;  3VOD A;  3KFW X;  5IT9 Z;  3QU3 A;  2XHK A;  2QQA A;  3J81 K;  1UB9 A;  1T6S A;  3WU0 A;  3SXY A;  2YX4 A;  3FM3 A;  1P2F A;  2JZY A;  4EJW A;  1LEB A;  1Z6T A;  5LEJ A;  3IHU A;  2XRO A;  5K5R A;  4G7H F;  1RIO H;  3HSF A;  2FNA A;  4UV9 A;  3V4G A;  4CIC A;  2FBI A;  1WI9 A;  3PQJ A;  2W25 A;  3M1E A;  4F7Z A;  2VON A;  1OPC A;  2P4W A;  1FBU A;  1U5T C;  3RPQ A;  2IPQ X;  2P6S A;  1G3Y A;  4OIR F;  4EV0 A;  3RKY A;  3WTU C;  3AAF A;  3L7W A;  3QP6 A;  5EEG A;  2IW5 A;  4RGS A;  4U88 A;  4H0E A;  1RI7 A;  1QO0 D;  3F8F A;  1J5Y A;  2DW4 A;  1R7J A;  1ZAO A;  2X4H A;  1OYW A;  1LJ9 A;  5FD5 A;  2EFP A;  3V8J A;  2X0L A;  4FHT A;  1TLH B;  4IF4 A;  4ZZL A;  2PG4 A;  4IRH A;  2Y75 A;  3LA3 A;  2A6E F;  2VOP A;  1G6N A;  4JK1 X;  5FLX Z;  2JPB A;  3HTS B;  1XGS A;  1TQM A;  5HLG A;  1STZ A;  1FYL A;  3T5X A;  1KQ9 A;  3F21 A;  3GLX A;  3QU6 A;  3JSO A;  2C6Y A;  2DFI A;  5F1R A;  2L54 A;  1HST A;  5HDN A;  4WXH A;  2RC4 A;  2OD5 A;  4D0P A;  2CFX A;  4LLL A;  2GWR A;  4CDG A;  2DK8 A;  3GVA A;  3TO6 A;  3BP8 A;  2EFQ A;  3T0Y A;  4PGG A;  2UWM A;  1O3R A;  5DDG A;  1XSV A;  4CZZ A;  2VC1 A;  2HTS A;  5DV5 A;  3E5X A;  4WCG A;  3J7A O;  2ZO4 A;  3L00 A;  3KP5 A;  5BOX A;  4HAM A;  1NHA A;  2V6C A;  5A2Q Z;  4ETS A;  2LKP A;  2ADU A;  4AIH A;  3E6C C;  2DQR A;  1GHC A;  1QGP A;  1ZLK A;  2GA2 A;  2JPC A;  3FXR A;  3ZN0 A;  5HVQ C;  3LQR A;  2ACJ A;  3E6D A;  1HKT A;  1Z91 A;  4AIJ A;  5HLI A;  3GX4 X;  1GXQ A;  1L3L A;  1AOY A;  1YW7 A;  1UHW A;  3GUD A;  2IVM A;  4OMZ A;  5L3F A;  4BH9 A;  3EDP A;  4AIK A;  4UVC A;  2TDX A;  1SAX A;  1DPU A;  3FWE A;  5CYV A;  2VBY A;  3JSP A;  5KK1 A;  5JFR A;  3W6K B;  5H6Q A;  1RZ4 A;  5E1X A;  4HDV A;  4G9Y A;  3HSR A;  3R61 A;  1D5V A;  3M9A A;  4M72 A;  2FMY A;  1E17 A;  4EMS A;  1J9I A;  2ISY A;  1QPM A;  5L3C A;  4PDK A;  1MD0 A;  1I1G A;  5L3G A;  2AXL A;  4MTE A;  1Z1D A;  5LBQ A;  4P9F A;  3WGI A;  1MDM A;  2KJC A;  3HHG A;  3H3U A;  5DYM A;  3KEQ A;  3ZMU A;  1G3W A;  2HYG D;  2ESN A;  2L02 A;  2PN6 A;  1KU7 A;  2XV4 S;  3E6M A;  2XKO A;  2STW A;  1PDN C;  2LF7 A;  2COM A;  2XAJ A;  5CJ9 A;  1J2X A;  1ONV A;  1BI2 A;  2V9V A;  5LEK A;  3ZMZ A;  2HWV A;  3I4P A;  3SZT A;  3V7R A;  1X3U A;  3IRQ A;  2A3S A;  3TOB A;  4M73 A;  1TTY A;  4DNC A;  4OIQ F;  4Q47 A;  1OR7 A;  5FD6 A;  3HYI A;  4PGH A;  1BJA A;  2Y0M A;  2HOE A;  4Y13 A;  3G73 A;  4U7D A;  5JHU A;  2XVC A;  1BI0 A;  1YW9 A;  5DD8 A;  5ILU A;  1XGO A;  1IXS B;  2RV8 A;  5DCM A;  5EEH A;  4UVB A;  5TRD A;  1YO5 C;  3MEX A;  3JAM Z;  1K78 B;  2Z9O A;  1OYI A;  3I5U A;  2Z3Y A;  2EFN A;  3F3X A;  1HKQ A;  2M8E A;  1UCR A;  1YFH A;  3H92 A;  4I09 A;  4R79 A;  1DDN A;  4HF0 A;  4Q4Z F;  2XKP A;  3WTY C;  3KZY A;  2ZME A;  3RKW A;  4A0Y A;  5D8K B;  2EK5 A;  1KU3 A;  4GYG A;  4OIN F;  3P9I A;  1BM9 A;  2R3S A;  1HW5 A;  4N9I A;  3KE2 A;  2D1H A;  3VB2 A;  1YIO A;  1R1T A;  5CVR A;  2QBY A;  2GIV A;  4FT8 A;  1F5T A;  1S7O A;  3P7N A;  3J81 Z;  3DXJ F;  4JQF A;  4ESF A;  3ZP5 A;  3Q5F A;  1HW2 A;  4I02 A;  2KRF A;  4LG0 B;  4RB0 A;  5HS8 A;  4IHT A;  3CUQ C;  2MD5 A;  2BV6 A;  3ZN1 A;  4ZH4 F;  2FF4 A;  2VBX A;  4L9N A;  1LDJ A;  4BAY A;  2P7C B;  1KYW A;  2CSO A;  3Q9V A;  2IJL A;  1W5T A;  4HV6 A;  3BJA A;  3FMS A;  3BWG A;  3LQQ A;  4HBL A;  5FGM A;  1RUN A;  2JRT A;  2GZW A;  2NAZ A;  4FX4 A;  4IHS A;  4XLP F;  2K4J A;  3CDH A;  2MC3 A;  1BN5 A;  3I58 A;  4EJT A;  2QQB A;  2FQ3 A;  3ZMT A;  1IXR C;  2UXN A;  3W6J B;  2M5W A;  3MZY A;  3ZMV A;  4U0Y A;  1K79 A;  2L01 A;  2H09 A;  4YII A;  3BPX A;  3SQN A;  2CG4 A;  3BJO A;  3F6O A;  4YFK F;  2QUF A;  2YU3 A;  2W84 A;  1K6O A;  3R60 A;  3PFI A;  2ZCW A;  3RI4 A;  4EM1 A;  1R22 A;  2QZ8 A;  3OOP A;  2EV0 A;  1XDU A;  1BI3 A;  4KIC A;  1GVJ A;  2GXB A;  3IWF A;  4P5O A;  2E7W A;  3WTX C;  4P96 A;  1UST A;  4L18 B;  1Z9C A;  3TOA A;  3VOE A;  3FX3 A;  3EQL F;  1FP1 D;  4G7Z F;  3LST A;  4HQE A;  1SFU A;  2PLY A;  4LLN A;  3VFZ A;  2IA1 A;  2XGX A;  2DI3 A;  1Q1H A;  5IT3 A;  1UFM A;  3REO A;  3IWZ A;  4KYW A;  5FO5 A;  3ZQ7 A;  1OKR A;  4XLN F;  5LHI A;  4QLC U;  4ASN A;  4LD5 A;  3KLN A;  5ERI A;  1JHF A;  2K4B A;  5E8G A;  1IN8 A;  4RGX A;  2XRN A;  4KA4 A;  2DLL A;  1FBS A;  4PCQ A;  5HOO A;  1E2X A;  4BYY A;  1FC3 A;  1B9N A;  1IN7 A;  4ENK A;  1ZRC A;  2EA4 A;  5LHH A;  2Y48 A;  4KT5 C;  3DP7 A;  3GYH X;  4GGG A;  1JHH A;  5CVJ A;  2Z99 A;  2QYO A;  3LAP A;  3ULQ B;  1DUX C;  3V7S A;  5AIQ A;  2NNN A;  1QZZ A;  1ZRE A;  3DFG A;  5KVR A;  4IVN A;  4P55 A;  2HR3 A;  1W7P D;  5D4S A;  1KYZ A;  4MHG A;  1IUY A;  1MJA A;  1ZGJ A;  1HW1 A;  4A5N A;  2XAG A;  1XSD A;  1AWC A;  3EYI A;  1IN4 A;  3KP4 A;  4I01 A;  1TW2 A;  2KIM A;  1FX7 A;  3F8B A;  4BQA A;  2B0L A;  2OQR A;  4RB1 A;  4LB6 B;  1YTY A;  3IL2 A;  1O7L A;  2RKH A;  3C7J A;  2DK5 A;  4U0V A;  3COA C;  1R36 A;  3HIF A;  4ZYG A;  3CO6 C;  5J6X A;  2BGC A;  3GO5 A;  3KET A;  3ZMD A;  3DQV C;  1ZH5 A;  2AS5 F;  1F9N A;  5HDG A;  3M8F A;  1BI1 A;  2HFH A;  1PUE E;  1S7A A;  3T8R A;  4E70 A;  5LRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...