5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
molecule keywords PhoB family transcriptional regulator
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
5ILSA 3V4GA 4JBAA 2FXAA 2VT2A 4OIPF 3I58A 3CUQB 1ZG1A 3C18A 3IRQA 3G73A 3I59A 1XN7A 4RAZA 4G8XA 5ERIA 4G9YA 4U7BA 2DLLA 4Y13A 3BZ6A 2HQNA 3I59B 4RB3C 1HKQA 3O2PE 4Q4ZF 4B8XA 3K2ZA 2JT1A 2DT5A 3FXRA 4A5NA 1RZ4A 1IN8A 3E6MA 2RV8A 2RC4A 2EA4A 3ZMUA 3WGGA 3TDZC 2M45A 4EQQA 1YO5C 3ZQ7A 4I0AA 2K4JA 1WKMA 1J0RA 2VOPA 1QQIA 5F6FA 4P9FA 4OMZA 2V9VA 3LSTA 3IKTA 5F64A 5D5UB 3E97A 3ECHA 2ZO4A 3B73A 4O3MA 1OYWA 4M9ZA 4XSZF 2HKOA 2DPDA 3KCCA 1IXRC 1ZHFA 4PZJA 4EM0B 3ISPA 4Z2YA 2GA1A 1Z7UA 4HLXA 1XSDA 1REPC 3S2WA 3BROA 5AONA 5HDNA 4LMYA 4O6JA 3E5UA 3CUOA 2Z33A 2EV6A 2XV4S 3CO6C 5DDGA 3I71A 1YS6A 1WI9A 1XSVA 2PQ8A 3KP7A 4YG2F 1BIBA 2UXNA 5L3EA 4PGHA 3HRUA 4RB1A 4ENKA 4A2UA 2OQRA 4HW0A 1EH7A 5HLGA 2HTJA 4RGUA 4GYGA 2DAOA 5E8IA 3C3WA 1S7OA 4G7HF 2V1XA 1ON2A 3ZPLA 5IT9K 1TW3A 1CF7B 3WGHA 3MFKA 3DKWA 3FMRA 2VOOA 2HQRA 5E18F 4I7HA 1IN7A 3WTZA 3J80K 2HS5A 3PQJA 2RQPA 4LB6B 1FSHA 4L0YB 3F8CA 1FLIA 1R1TA 4I0BA 4WXHA 4YFKF 4HV6A 5EEHA 3KETA 2XAQA 3FXUA 4PGGA 4XBFA 3TQNA 3BDDA 2STWA 4F7ZA 2CSOA 1FYMA 3GFLA 5FB2A 4EMSA 1LNWA 2ZMEB 2VONA 4L9TA 1KQ8A 3WU1B 1KYZA 3RPQA 4M6YA 3ZN1A 2DU9A 1XB4A 4ZYHA 1U3EM 4L18B 5DYMA 2EWNA 4DQ2A 4ESJA 1F9NA 3H92A 3TO6A 4IXAA 1YS7A 2CYYA 1SFEA 2ZBKA 3D5LA 5TJJA 4OU0A 2M1BA 5LGUA 3FXQA 5KVRA 2IP2A 2QVOA 3HRMA 4AD9A 1BI1A 1P4WA 4HF1A 4BHBA 4MQVA 1O3SA 3MQ0A 1ZGJA 5H6QA 3FZVA 4NQWA 1BJAA 1BIAA 4KMFA 4HX8A 3M7GA 2OBPA 2IT0A 1FYKA 4U0VA 1ZLKA 1SMTA 1MJBA 1BI0A 2LF8A 4A0YA 1IN5A 1DDNA 2ESNA 4I2OA 4N9IA 3ABUA 1W4MA 1J9IA 1S7AA 5CVIA 2FNPA 4EJVA 3EYYA 1ZGAA 1QPMA 1GXPA 1R1UA 1Z91A 4EJWA 3GXOA 4AIKA 4UNOA 2RVCA 3KP4A 4K2EA 4KN7X 3COAC 3E6CC 4BQAA 3TDUC 5A2QK 5E1XA 4CICA 3RTRA 4KIBA 4UV8A 4UV9A 2D1HA 4UVBA 4EJTA 3KP6A 1OYYA 3BP8A 1S3JA 2FRHA 1R58A 5ICFA 2ZKZA 4MNUA 3NQOA 1IRFA 2EV0A 3WU0A 4BH9A 2BBYA 4Q47A 3M1EA 2O03A 2EFWA 1TQIA 2DI3A 1DP7P 1TQPA 3FM3A 3QPHA 1I1SA 1KA8A 4BYYA 3F3XA 3DF8A 3WTWC 4L9JA 3GO5A 5BPIA 4FHTA 3QP6A 2XUBA 2VBYA 4A6EA 4LB5A 1R5HA 1TLHB 5DCFA 4Q48A 2R7FA 5D6EA 5EEGA 3WTTC 1R23A 2VC0A 1J2XA 2DW4A 5HDKA 2J5PA 2IPQX 3T8TA 2E1NA 4E70A 3WTUC 4EGZA 3WTVC 2AXLA 1BC7C 4HAMA 3SQNA 1XGOA 2MA3A 1XGSA 4AIJA 2UWMA 1YTYA 3T1BA 5H6RA 1K78A 4EJOA 3JTGA 1XD7A 2W57A 1IF1A 1XGMA 4RS8A 3HRTA 3BJ6A 3J7AO 3GF2A 5HS9A 1Y0UA 2OA4A 5KK1A 2XAHA 2D2WA 2ZFWA 1EV7A 1PP7U 5K5QA 1OYIA 3ECOA 5HDGA 2D45A 4L5JA 1ONVA 2MH2A 3MCZA 2QQ9A 1FZPB 4CDGA 1XCBA 2BGCA 5L3CA 1S29A 3BOQA 1ZRFA 3I64A 3GLXA 1IUYA 3I54A 3BPVA 1STZA 4BNCA 3T0YA 2QENA 2KIUA 2LKPA 2XAFA 2P5LC 1U2WA 4KDPA 3BWGA 2MH9A 4B09A 2OZ6A 1RUNA 2ETHA 1MZBA 2RKHA 4HF0A 2F5FA 2PJPA 4PCQA 5D6FA 1LDDA 1Z1DA 4EVIA 2L02A 4S04A 2MLGA 2VE9A 3VEPA 1H0MA 4KYWA 4A5MA 4HDUA 2PN6A 4HV5A 1XSXA 1KYWA 4FT8A 2QBYB 5E17F 2OQGA 2Q2EA 3FHZA 5DUIA 3K0LA 1XMAA 2ZMEA 4QWQA 2FBIA 1I1GA 3NEUA 3TOBA 1LQ1A 3V8KA 5L3BA 4TV7A 5CVRA 5LRSA 3ZMTA 4HQEA 1FNNA 3H3ZA 3GX4X 1FP1D 2O61A 4UVAA 1D3YA 1MJAA 2OU2A 1D5VA 2LNBA 4IRHA 5D5WB 2YPRA 5ICGA 3WE3A 1X3UA 5FLXZ 2LF7A 2A6EF 2XAGA 2JSCA 4S05A 4KA4A 5DUKA 1LDKB 3R60A 4WX9A 2LDUA 1J5YA 2VE8A 2QLZA 1HKTA 4PDKA 3PQKA 4FX0A 4HBLA 2HOEA 1OR7A 2V1DA 2NAZA 2FMLA 1L3LA 4L9VA 4NB5A 5AIQA 1G4DA 4A12A 1IZ1A 3G3ZA 1S8NA 1H9TA 3LA2A 4G6QA 2RNJA 5AIPA 3FM5A 4BHPA 2XKPA 4G7ZF 3TO9A 4RGXA 4JQFA 1KU3A 4CYDA 3F72A 2XIGA 1KQ9A 2PMHA 1T6SA 5CYVA 1Z6RA 2M8EA 1QBJA 2QQBA 2E7WA 2L4MA 1USTA 3HHHA 1F1ZA 3B02A 4M72A 3LQQA 4ZZDA 2O6GE 4H0EA 2GZWA 5E1WA 4GXOA 4YIIA 1T39A 2GA2A 3V7CA 3HSFA 5D8KB 1TNSA 2P5KA 5J8FA 1XDUA 1MD0A 2CWEA 2L01A 2XGXA 1HW1A 4FX4A 2FU4A 4CO8A 2A69F 3IWFA 2FQ3A 5TRDA 2HGCA 4XLPF 5HS7A 2W25A 5FD5A 1G3SA 4IHSA 2DTRA 4RB2C 2Q8KA 1KQ0A 1SMYF 4IJAA 4KNYA 4M71A 4DNCA 1K6OA 3EYIA 1DUXC 1LVAA 2O0YA 5H20A 1AOYA 2FSWA 3RJPA 1FC3A 4HLYA 5LBQA 3O3KA 1B1BA 3M9AA 3RKWA 2P8TA 2M87A 2ISYA 3HRSA 2Z3YA 2IJLA 2ESHA 2IW5A 2WWYA 3QAHA 4U0WA 3CO7C 1WSUA 2GWRA 4WF2A 2EFPA 2EJRA 2STTA 1OMIA 2OD5A 1T38A 4LG0B 3RDIA 2EA2A 2FOKA 1GXQA 1D8KA 1U6GA 2W85A 2FEZA 1ZG5A 2V79A 3KZZA 2CW0F 5LGTA 2PEXA 2F5EA 4M74A 2ZNZA 1UB9A 1B9NA 3TGNA 2ACJA 2A5YB 2XHKA 4IRGA 3CDHA 3HSRA 4ON0A 1MJ9A 2JTVA 1ZYRF 2A68F 3HTUA 3HTSB 1G3WA 2IA2A 3HIFA 4UXNA 3J81K 3VFZA 3DXJF 2VODA 4CHUA 1G6NA 3Q9VA 5D4RA 1B59A 2KKOA 5IT9Z 1T98A 3KP5A 4G6DA 3V7RA 1TQMA 3OOPA 2DK5A 2YR2A 5LEKA 1UCRA 1HSJA 4BHCA 1FPQA 2EV5A 3HSEA 3LA7A 3KEQA 5D5XB 4I09A 1SD6A 4HX4A 3JAMZ 2W24A 3U1DA 3Q9SA 4M9XA 1UFMA 2ZJ2A 2HFHA 4AIHA 3KP2A 4KICA 4HZFA 2FE3A 1SD7A 2KIFA 5BOXA 5LHHA 1BBYA 4N0BA 1O3RA 1LJ9A 2CFXA 1EH6A 1LB2A 2B0LA 3RI4A 1FY7A 1YW8A 2PFBA 3GFJA 1I5ZA 5FFXA 2Z5UA 3ULQB 3HUGA 1MGTA 2BYVE 1J75A 4BAYA 2NNYA 1R5GA 3WTYC 4KIFA 4WXDA 2JZYA 5CJ9A 5FO5A 2XAJA 3IKVA 3F21A 1R1VA 2NRAC 1SD5A 5E20A 1OKRA 5CVVA 3VB2A 1BI3A 4GGGA 1O7FA 3J80Z 3F23A 2EB7A 1W7PA 2GAUA 2KJBA 3I5UA 1K79A 2DQRA 3DPTA 3QP5A 1SFXA 1EH8A 3KFWX 3HOTA 2VBWA 3O6BB 1K78B 3EQLF 1SD4A 1R7JA 1JE8A 4IVNA 2Y0MA 2KIMA 1USSA 4LLGF 4IHTA 2BV6A 2DFIA 3T5XA 2ZNYA 3L7WA 3ZP5A 3U9GA 4MTEA 3RYRA 2H27A 4MEXF 5JHUA 3GZ6A 4ZZLA 2CO5A 3ZMZA 2P4WA 3N97A 1JXSA 1UHWA 3JAMK 1L0OC 4U7DA 4L9NA 3GFIA 2Y75A 4GCVA 4MQ9F 1P2FA 4AVPA 3R6SA 1DPRA 2G7UA 3E6DA 5L3GA 1Z9CA 1W5SA 3DP7A 1IXCA 2PG4A 3KE2A 2JRTA 4KUMA 1NHAA 3C1DA 5IT3A 2DK8A 1KU2A 3LA3A 3MZYA 1PP8F 5DCMA 5DEQA 3HYIA 4HA8A 3EUHA 4UVCA 3W6KB 5HLHA 3DFGA 4ASNA 2K7LA 5BQTA 3RPUA 2FA5A 2Z9OA 3WTXC 2QBYA 1XCVA 1O57A 3JW4A 2L54A 2RN7A 1RI7A 1TW2A 1I27A 1IRGA 1R00A 2PLYA 1ON1A 1R36A 1BN5A 2E7XA 1FT9A 3F8FA 1FOKA 1O7LA 4LD5A 1ZRCA 3KZYA 5CVJA 1U5TB 1FBQA 3P7NA 1BI2A 3M8EA 4IF4A 1W7PB 2OAZA 5A2QZ 1QNTA 2AS5F 2L4AA 4KT5C 1ZREA 1ZAOA 2WC2A 4M73A 3GYHX 5JVTA 2CQKA 2COMA 3RKYA 4IPAA 1LDJA 2CG4A 2O3FA 2H94A 4LK0F 3P9CA 5K1YA 4AWXB 4A0XA 2RDPA 2DQLA 3SXYA 3ROUA 3BY6A 4WWCA 4RGRA 3ZMVA 1G3TA 3WODF 2F5CA 4I02A 4Q5SF 2A3SA 5CVUA 2HKXA 4A6DA 3GVAA 4YFNF 4HYEA 4HF2A 1P6RA 1CGPA 4EJUA 2MC3A 2K4BA 2IA0A 3GWZA 3IL2A 3E5QA 3WE2A 4WCGA 3ML6A 5ED4A 1KU7A 3P9IA 1ZARA 3L9FA 2HYFA 2XRNA 1T2KA 4ESFA 1U8RA 3K1NA 2Y48A 1BC8C 1H9GA 2RGVA 2KRFA 3BJAA 3IRRA 3LFKA 3ZN0A 4CZZA 1D8JA 1TBXA 1B4AA 3ZMSA 1P4AA 3GW2A 2YU3A 2W84A 2P6SA 2VBXA 1JGSA 1YG2A 3H3UA 5FFZA 2CGPA 2Z99A 5LLQA 1C0WA 1G3YA 5D5VB 5FGMA 2O8XA 3IWZA 4L0ZB 2R3SA 2NNNA 3IC7A 4BXUA 1U5TA 2R7DA 3E5XA 2GXBA 2L3DA 2VN2A 1KGSA 2GQQA 3L09A 1U5TC 5F1RA 2MLKA 3K1MA 2C6YA 1FBSA 3JTHA 4ZYEA 1MKMA 2HZTA 3W6JB 3J81Z 2EFQA 5LHGA 4OIOF 3I53A 3KLNA 4LJZF 2DPUA 2WV0A 3DV8A 3L00A 1B6AA 4CXFA 3ABTA 5JI6A 1QGPA 2ZCWA 5HLIA 3ERED 3E3VA 1JHFA 1FSEA 1TTYA 1YIOA 2A61A 2X4HA 5ILUA 3DPLC 2E1CA 2PI0A 3V8LA 4LK1F 1LEAA 2XKOA 2J5OA 4LG0A 1YYVA 1T0FA 3F6VA 1BOAA 4QLCU 4I98B 2GXGA 1ZG3A 3QU6A 1HSTA 2YX4A 3KEOA 3FWEA 4R79A 5FD6A 4GO1A 2P7CB 2H6BA 4WK8F 2DO7A 1RIOH 2IA1A 1FBUA 5J6XA 1ZN2A 4RGSA 1W5TA 2KJCA 3SZPA 3QPTA 2F2EA 1HBXG 4OIQF 4M6XA 4A0ZA 3C7JA 2QYOA 3I4PA 2M30A 1Z6TA 3K9TA 1O3QA 2HYGD 2IVMA 2P6TA 4R1HA 1HQCA 3WGIA 1ULYA 1ODDA 1HXDA 4HDVA 5ILVA 3CTAA 3TKYA 2XVCA 5BMZA 3FX3A 5CLSA 3RKXA 3TOAA 2NS0A 4N9HA 3LQRA 5BS6A 1IAWA 3F8MA 1GHCA 2BE5F 3CUQC 4EV0A 2K02A 1XDSA 3SHFA 2A6HF 3NRVA 5ICEA 3L2CA 3E6BA 5DCMB 3QU3A 5FLXK 3EETA 2QQAA 1VTNC 2FMYA 4ETSA 4P96A 4KFCA 4XLNF 1YFHA 1E17A 2FNAA 2ADUA 5HVQC 2QUFA 3HHGA 5ICCA 2XROA 5LGNA 1R22A 4ENJA 4ENMA 4U88A 1IW7F 3T8RA 4D0PA 1ZLJA 4MTDA 3MEXA 1E2XA 1QZYA 5HS8A 3MAJA 2H09A 2VT3A 1KU9A 2EFOA 3R0JA 4YFXF 4IRIA 2VC1A 3JSPA 2NYXA 4XSXF 5HOOA 4NHJA 2P5VA 2OZUA 1FP2A 1JHHA 3RYPA 3D0SA 2EFNA 3CJNA 2K27A 1B9MA 1XMKA 2JPCA 1SAXA 3I0TA 3V7SA 4YIFA 3M8FA 2XASA 1BM9A 4LFUA 4OIRF 1CF7A 4UUVA 2X0LA 2HTSA 2UXXA 2QZ8A 1K7AA 3BPXA 3GUDA 3JSOA 1HW2A 2ZXJA 2VBZA 1XGNA 1V4RA 5BPDA 4Y17A 4ESBA 4WXCA 3QRFF 1S6LA 2HEOA 4LLNA 5E1ZB 3GZ5A 1PDNC 2GIVA 3FMQA 6PAXA 2UZKA 4RAYA 3PFIA 3DQVC 4ZYGA 3MZHA 2HR3A 1WWXA 3VODA 3GEZA 1YW9A 5J8CA 3LAJA 2G9WA 3OV8A 1WQ2A 4KN4X 2FBKA 3R4KA 4MEYF 2FBHA 3FMSA 3MWMA 4JK1X 2EK5A 4EGYA 2HDCA 4Y15A 2PMUA 1YW7A 2A07F 3BJOA 5L3DA 2F5DA 2QM3A 3LWFA 5K5OA 1F4KA 1QO0D 4OINF 3QOPA 3F6OA 2P7VB 3RIRA 3SFZA 1Z05A 4ZH4F 4HX7A 5D8LB 2LSOA 4HQMA 2DBBA 5D4SA 1ZH5A 4EM2A 3CLOA 4LGWA 3KP3A 5L3FA 1RUOA 3R61A 1IXSB 3P9KA 1GVJA 4M9SA 3VOEA 2K86A 1LEBA 4P5OA 5LHIA 3Q5FA 2IRFG 4G94A 1IN4A 1AWCA 1O3TA 4OMYA 1WRJA 4ENNA 1J59A 1P4XA 1UHMA 3CUQA 3DEUA 1FYLA 2JPBA 4HOBA 4G7OF 2M5WA 3GFMA 2WTEA 3K1PA 5E8GA 3AAFA 5K5RA 3KLOA 2D1VA 4UHTA 3WTSC 1YQAA 1QZZA 4MGRA 3F8NA 3SZTA 3F22A 1F5TA 3TO7A 2VXZA 4R8HA 4EM1A 3WG9A 1ZRDA 4I01A 1PUEE 2HWVA 2H6CA 1V3FA 1W7PD 3K69A 3REOA 2YX7A 2Q0OA 1YLFA 2TDXA 4ZYDA 2FF4A 3F8BA 3R0AA 4GYIA 1P92A 3ZMDA 4O5VA 2ELHA 1J7KA 3N4MA 4XRFA 4KIGA 2YSRA 1DPUA 2MBFA 5DD4A 5LRRA 2BEOA 1FWZA 4MHGA 1HW5A 1FX7A 5JFRA 3LAPA 1A04A 1Q1HA 1MDMB 1SFUA 3FF5A 3V8JA 2PBIA 3U2RA 2MD5A 4RB0A 5DD8A 2ISZA 4L5IA 5LEJA 3EDPA 1RNLA 1MDMA 5JR3A 2G7HA 4KMUX 2V1UA 1TNTA 1HKSA 1U78A 3IHUA 3ELKA 4P9UA 4U0YA 5DV5A 4P55A 1IN6A 4CGZA 4LLLA 4OOIA 1I6XA 2QWWA 3HOSA 2V6CA 1OPCA
chains in the Genus database with same CATH superfamily
5ILSA 3V4GA 3OS1A 4JBAA 1UHSA 2FXAA 2VT2A 4OIPF 3I58A 1ZK8A 3CUQB 1G8XA 1ZG1A 2JK3A 3C18A 2O7OA 3CF2A 3IRQA 3G73A 5FRMA 3I59A 4A3IJ 1FOWA 1XN7A 4W97A 4RAZA 4G8XA 1SAUA 3G1LA 5ERIA 3BT9A 1WZ2A 3S17J 4X0GA 4G9YA 4AC0A 1JKQC 4U7BA 3HPHA 2DLLA 4Y13A 2HXIA 3BZ6A 2HQNA 3I59B 4RB3C 1HKQA 5E79C 3K6GA 3O2PE 4Q4ZF 4JOMA 2K9NA 1WGXA 4B8XA 3K2ZA 2JT1A 2DT5A 4F55A 2GIZA 3FXRA 4A5NA 1RZ4A 1IN8A 3E6MA 3G2BA 2RV8A 2EBIA 2RC4A 2EA4A 3ZMUA 1X19A 4ABZA 3WGGA 2LBFA 3C2HA 3TDZC 2Y9ZA 2M45A 3GTLJ 3CJTB 3HOVJ 5EG0B 4EQQA 1YO5C 3ZQ7A 4BJ5C 4I99C 1P7JA 4I0AA 1WH5A 2K4JA 3QQAA 1WKMA 1J0RA 2VOPA 3K2AA 3OIPA 1QQIA 1IRXA 3SZGA 5HNFA 3GTOJ 5F6FA 4P9FA 2JUCA 1ETKA 4OMZA 2V9VA 4E7ZA 4W1UA 2RQQA 4JX4A 2G0EA 2AXTC 3LSTA 1QHGA 5IYDJ 3KX2A 3IKTA 4A3EJ 4XLEA 1VI0A 5F64A 5D5UB 3E97A 3ECHA 3U1KA 2ZO4A 4BDZA 1HC8A 2W00A 3H35A 3B73A 2DA3A 2HDDA 5IOYA 2FJ1A 2L5QA 4CCKA 3GTKJ 4O3MA 3D5RC 3SJMA 4BEHA 3JRFA 1OYWA 2VKVA 4M9ZA 3FDYA 4XSZF 2HKOA 3B6AA 2DPDA 3KCCA 4IL6C 1IXRC 1Y8RB 5CKTA 1ZHFA 3NAUA 4PJ0C 1XTAA 4PZJA 2LK2A 2QGUA 1X1PA 2Y0SA 4BXFA 4EM0B 3ISPA 1RESA 4Z2YA 4XK4A 1A31A 2GA1A 2M9HA 2DJNA 1Z7UA 3OYMA 4XRMA 4HLXA 1MNMC 1I39A 1XSDA 2H8WA 3CCSI 1REPC 3M07A 3S2WA 3BROA 1XG1A 5AONA 4NQWB 5HDNA 1WJAA 5JLXA 4LMYA 4O6JA 3BCAA 3E5UA 2ME6A 1ETOA 3BR5A 3CUOA 2Z33A 4HSTA 2EV6A 3BLYA 1TWFJ 2XV4S 4YIRX 2RAEA 3CO6C 3MD2A 2P81A 1R6RA 5DDGA 3I71A 3JREA 1WJDA 1YS6A 2OC6A 1YIJI 1WI9A 4CCNA 1E3OC 1XSVA 2PQ8A 3VYUB 2MG4A 1PJRA 3KP7A 5EGOA 4YG2F 4CUGA 1BIBA 2UXNA 5L3EA 2IS2A 4PGHA 2CH0A 3HRUA 2CFOA 4CYCB 3OS0A 4RB1A 2LRDA 3HC7A 4A2UA 4ENKA 2OTJI 2OQRA 4HW0A 1EH7A 2B63J 5HLGA 2WBMA 3BG7A 1AA7A 2HTJA 3BG3A 4XKWA 4RGUA 3OYKA 2V7FA 4GYGA 2HNHA 1A36A 2DAOA 5E8IA 1NH3A 2LY1A 3C3WA 1S7OA 4G7HF 2R7QA 2V1XA 3IH3A 1ON2A 2F5VA 3TEDA 2LOOA 3JRAA 1H8AC 1SVLA 3ZPLA 2DXIA 5IT9K 1TW3A 2MW8A 3BC8A 4NC8A 3JR9A 2DA5A 4X1EA 1CF7B 3WGHA 3JCUC 3KIOA 3MFKA 3DKWA 3FMRA 2VOOA 2HQRA 2M7BA 5E18F 2AHQA 4I7HA 1IN7A 3WTZA 3J80K 2E60A 2F6CA 4HNVA 4UUSB 1NK2P 2HS5A 3PQJA 2WV1A 2RQPA 4LB6B 1FSHA 1WJEA 4L0YB 2DFHA 4P1WA 2QQ8A 3F8CA 5FKLA 4ZTFA 1FLIA 5IYCJ 1R1TA 4I0BA 4WXHA 4YFKF 4HV6A 3QYFA 1ETWA 5EEHA 2VQHA 3PFYA 3KETA 2XAQA 2RREA 3FXUA 1VF9A 2P0WA 4PGGA 3TQNA 4XBFA 1OCOH 3D5SC 3BDDA 2STWA 4F7ZA 2CSOA 1JT6A 4BBSJ 1FYMA 1HDDC 1MMGA 4BACA 3GFLA 5FB2A 1XPXA 4EMSA 1LNWA 2ZMEB 2VL8A 2VONA 5GAGJ 3SEQA 4CCJA 4L9TA 2EZHA 1KQ8A 4PSWA 4BXXJ 1KYZA 1WPKA 3RPQA 3WU1B 4M6YA 3GTQJ 1X1BA 1RRJA 3EUHC 3ZN1A 2GOXB 2DU9A 4RLQA 1XB4A 4ZYHA 1U8BA 1U3EM 4L18B 5DYMA 2EWNA 4DQ2A 1QRYA 4ESJA 2NVXJ 3LSHA 3HOUJ 4UY8I 1F9NA 3PIOF 2DMUA 3H92A 2IS4A 3TO6A 3G1OA 3IUOA 3OWTA 4IXAA 2ID6A 4IEJA 1YS7A 2ZBKA 3D5LA 2CYYA 1SFEA 1TZLA 5TJJA 4DBQA 4OU0A 5CQEA 2M1BA 4F92B 5LGUA 2R0QC 3FXQA 5KVRA 1B72B 2IP2A 2QVOA 3HRMA 4AD9A 1BI1A 1P4WA 2ME0A 4HF1A 4BHBA 2VI6A 4MQVA 1O3SA 2WAQN 1MBKA 4IHWA 1BR4A 3MQ0A 3TP3A 1WJBA 1ZGJA 3FZVA 4NQWA 5H6QA 1BJAA 1BIAA 4KMFA 4HX8A 2MD0A 3M7GA 4BY1J 1IGNA 5B5EC 1W0UA 1JKPC 2OBPA 2IT0A 3SDGA 3PL8A 4LIUA 2BY1A 1FYKA 4U0VA 1ZLKA 2L9VA 1SMTA 1MJBA 1BI0A 2LF8A 4XN0A 4A0YA 1WCMJ 1IN5A 4XLHA 4F52A 5IP6A 1DDNA 1Z21A 2ESNA 4I2OA 4N9IA 3ABUA 1ACIA 1W4MA 1J9IA 1S7AA 2XGCA 5CVIA 2FNPA 4EJVA 1RPWA 1ZGAA 3EYYA 4EATA 1QPMA 1U0JA 1R1UA 1Z91A 1GXPA 4EJWA 3GXOA 4AIKA 4UNOA 3S32A 4IHXA 2RVCA 1EA3A 3DLLF 3KP4A 4K2EA 4KN7X 3COAC 3E6CC 4BQAA 3M8JA 1V5EA 3TDUC 5A2QK 2HXOA 2F48A 4YELA 5E1XA 2L7FP 2Z16A 2DYSH 4CICA 3A4CA 1S7EA 2VQGA 3RTRA 1ETQA 4KIBA 4CCOA 2VUMJ 3RKQA 1VQPI 1FJLA 4DJAA 4UV8A 4UV9A 2D1HA 4UVBA 4EJTA 3KP6A 1OYYA 3BP8A 2PMZN 2V4JC 3K4MA 5K7FA 4OAYA 2Y31A 1S3JA 2EH3A 2FRHA 1YRNA 1R58A 4XKBA 3OL4A 5ICFA 2WY7Q 3QOEA 4RDUA 2ZKZA 3HDDA 4MNUA 3NQOA 1IRFA 2EV0A 3CCYA 1WH7A 1DP3A 3WU0A 1OCPA 1V5GA 3AL0B 1N25A 1W5CC 1MBFA 3TMOA 4E6KG 3DPUA 1X1CA 4BH9A 2WADA 3H0GJ 2LLKA 2BBYA 1VQ9I 2LKSA 3ABLH 5M3MJ 4Q47A 3M1EA 3L2QA 4EEFG 2EZKA 2O03A 4M3BA 1PVEA 4XICA 3HXLA 2HOSA 2EFWA 3ERMA 1TQIA 2DI3A 2FD5A 3HB9A 1D1AA 1BJZA 2XGDA 4CH7A 2LP0A 1DP7P 1M1EB 2EIMH 1TQPA 1WI3A 3QPLA 1AHDP 3OSFA 3X2QH 3DWLE 2QSHX 3A03A 3FM3A 3QPHA 1I1SA 4IO9F 1KA8A 4E7JA 2E1MB 3PNVA 4QPQA 4BYYA 3F3XA 5GPAA 5TISC 4G12A 3DF8A 3CLQA 3BTIA 3WTWC 4L9JA 3GO5A 5BPIA 4FHTA 3S1QJ 3FBIB 3QP6A 2XUBA 4NC7A 2VBYA 2DT7B 2GM4A 4A6EA 4LB5A 1R5HA 1TLHB 3RSNA 5DCFA 4E4HA 4N4OB 5E3OA 4Q48A 5FROA 2JA7J 2R7FA 2LREA 5D6EA 5EEGA 5GTIC 3WTTC 1RC9A 3GTMJ 4DYCA 1R23A 3S1MJ 3CP2A 2VC0A 1J2XA 2BHYA 1OR7C 3WHBA 4PFOA 2DW4A 1MMNA 3HKZA 5HDKA 2HU9A 2J5PA 1GT0C 1A6QA 2IPQX 2CQXA 3T8TA 2E1NA 2Q2EB 4E70A 3WTUC 4EGZA 1X2NA 1JKOC 3WTVC 2AXLA 1BC7C 2R7OA 4HAMA 3SQNA 3W2VA 3DTEA 1OJLA 1XGOA 1D1BA 1I3AA 5B1BH 2MA3A 3JRHA 4C2TA 1YJWI 1W36D 1JTYA 1XGSA 4AIJA 2UWMA 3DKYA 1YTYA 3T1BA 2JRMA 1TWAJ 5H6RA 4FQGA 2X6YA 5B66C 1MIJA 5H2FC 4EJOA 3JTGA 1K78A 4ZDPA 1CQTA 1XD7A 1IJWC 4BU2A 2W57A 1IF1A 1XGMA 1GLNA 4HNUA 5E3MA 2DOAA 4JYKA 2VJIA 3CZ6A 1IV8A 4RS8A 3HRTA 3BJ6A 3J7AO 5DS9A 1LVKA 3GF2A 5J47A 5HS9A 1Y0UA 2OA4A 5KK1A 1X1DA 3DEEA 2XAHA 4A3JJ 2D2WA 2Y30A 1EV7A 2ZFWA 1PP7U 5K5QA 1JGGA 2A6TA 1OYIA 2OPTA 2XB0X 3ECOA 5HDGA 1FIPA 2D45A 2HOAA 4L5JA 4AUXA 2ZFUA 1ONVA 5BNGA 2MH2A 3CCUI 4B3AA 2VLAA 2ELJA 3MCZA 2QQ9A 2K5CA 1FZPB 4CDGA 1V55H 1XCBA 5FJ8J 2BGCA 3JRDA 5L3CA 1S29A 3BOQA 4NC6A 1VFCA 4XKCA 1R71A 1Z3YA 1ZRFA 2KZGA 3A02A 3GLXA 3I64A 1IUYA 3I54A 3OYGA 2QSFX 2CV0A 2PMZA 1LFPA 2L9SA 1YRNB 3BPVA 1STZA 4BNCA 2EPFA 3T0YA 2QENA 2KIUA 2LKPA 2XAFA 5KAIC 1E3PA 3DTKA 2P5LC 1U2WA 3I55I 4KDPA 5FLVA 2CS3A 3BWGA 3PUBA 1ETYA 3AG1H 3BTJA 1DU0A 2MH9A 4B09A 2OZ6A 2XF7A 1RUNA 2K9LA 2ETHA 1MZBA 2RKHA 2YU9J 4HF0A 5IP7J 2F5FA 3K4CA 4F93B 3K4KA 2DA1A 3B6CA 1WJCA 2PJPA 2NOGA 4A3LJ 1JI8A 4PCQA 5D6FA 1QPIA 1LDDA 1Z1DA 4EVIA 2L02A 4S04A 2VXDA 2MLGA 2VE9A 3VEPA 1H0MA 2KRCA 4KYWA 4XQFA 4A5MA 4HDUA 1R9TJ 2PN6A 1NTCA 4HV5A 1XSXA 1KYWA 2L7MP 4FT8A 2QBYB 5E17F 4XIDA 2R92J 3H5RA 3OY9A 3CQZJ 5KAFC 1LKXA 3QYBA 2YUSA 2OQGA 2Q2EA 2HVRA 3WU2C 3PUFA 3PIPF 4B48A 2DMQA 3A0BC 5DUIA 3FHZA 3K0LA 2L9NA 1TC3C 3S1NJ 1VNDA 1XMAA 2ZMEA 4QWQA 2XC7A 2FBIA 1I1GA 2DTZA 2CW8A 1Z3XA 3NEUA 3TOBA 1LQ1A 3KZIC 3V8KA 5F0FA 5JLWA 2XAUA 3VSLA 5L3BA 4TV7A 5CVRA 5LRSA 1OFCX 3ZMTA 3ESWB 4HQEA 4FTHA 2DYRH 3K4BA 1FNNA 3H3ZA 1VQNI 3GX4X 2E5NA 1FP1D 2HYJA 3G4SI 3HPGA 2O61A 4BQNA 1O4XA 2DDAA 3E0JB 4UVAA 1D3YA 1MJAA 2X6XA 2OU2A 1D5VA 2LNBA 4YRVA 1MBHA 3MN2A 4IRHA 5C3EJ 3L2UA 3D1NI 5K7HA 2W1OA 4FASD 5D5WB 2YPRA 1S72I 5ICGA 3WE3A 3CESA 1MH3A 1YITI 2V9KA 4C30A 1X3UA 5FLXZ 2LF7A 3ZQIA 1WVRA 2A6EF 2DA2A 2XAGA 4J01A 3HOWJ 3S14J 3QODA 4A3FJ 2JSCA 3BR6A 1Y6IA 4S05A 4KA4A 5DUKA 1LDKB 3SDBA 3R60A 4WX9A 3W2AA 2LDUA 1EKEA 1J5YA 1K6YA 3EUKL 4DGWB 5HNHA 1ZR4A 2VE8A 2DN0A 2QLZA 1HKTA 2Y69H 4PDKA 3OYEA 1XS9A 2K40A 3PQKA 4FX0A 4HBLA 3GTPJ 2HOEA 4PUSA 2GLOA 2X85A 2BOLA 2CRGA 1OR7A 2V1DA 2NAZA 2BY0A 2FMLA 2DT6A 1L3LA 4XOTA 4L9VA 4NB5A 1B72A 5AIQA 1G4DA 4A12A 1B8IA 1PUFB 1IZ1A 3G3ZA 2IS1A 3ZR8X 1S8NA 1H9TA 2H1KA 3LA2A 4G6QA 1Z77A 5EYRA 2RNJA 1YOVB 2AQEA 5AIPA 1IO2A 4A69C 1Y1VJ 3FM5A 1EJ9A 1GUUA 4BHPA 1HDPA 3PO3J 2XKPA 4G7ZF 3TO9A 4RGXA 3OSGA 4JQFA 2WY8Q 5JVGF 1KU3A 1DGWY 4PK4A 2M34A 5EZHA 4CYDA 4A3MJ 3F72A 4IHVA 4CZCA 2XIGA 1KQ9A 2PMHA 1T6SA 2HQAA 5CYVA 1Z6RA 2M8EA 3HGYA 1QBJA 2QQBA 2E7WA 1FMVA 2L4MA 1USTA 3HHHA 3H5NA 1F1ZA 3B02A 4M72A 3LQQA 5C44J 3OIQA 1QHHD 4ZZDA 2O6GE 4H0EA 3A01A 4B44A 3H3VK 5FKNA 2GZWA 5E1WA 2PX9A 2K9SA 5FRNA 4GXOA 2M8GX 4YIIA 1T39A 4AVZA 5FKOA 3MKYB 2GA2A 3V7CA 3HSFA 1MSFC 2EIJH 5D8KB 4BE2A 1TNSA 2EINH 2P5KA 3FK7A 1XDUA 5J8FA 1MD0A 2CWEA 2L01A 2XGXA 2Y0SN 4RBOA 1IC8A 1HW1A 3CC2I 4FX4A 1APLC 2FU4A 2NVUB 2XSJC 4CO8A 1G2HA 2A69F 3IWFA 2FQ3A 5TRDA 2CV1A 2QSGX 4BQQA 4M3EA 2HGCA 2DA6A 1JKRC 4XLPF 2HVSA 1WFXA 3S1RJ 5HS7A 2W25A 2ID3A 2OTLI 5FD5A 3PNYA 2E35A 4S0HB 1G3SA 3LNQA 4IHSA 2GBYA 3KPHA 3OYNA 2DTRA 2JMWA 2R4GA 1X1AA 3MKLA 4RB2C 1YX5A 2Q8KA 1KQ0A 2TCTA 1SMYF 2DFEA 4IJAA 4KNYA 4M71A 3OYDA 2M0CA 2JWTA 4DNCA 1AKHA 3BR1A 1TP4A 1K6OA 3EYIA 1D0ZA 5GAHJ 5M5XJ 2E2IJ 1DUXC 1P7IA 1LVAA 2O0YA 5H20A 1AOYA 3OYAA 2FSWA 2X6OA 3RJPA 4CCLA 1FC3A 2H8RA 2XRLA 5EF6A 4XNFA 4HLYA 1LFBA 3CMAI 3DEWA 5LBQA 1IDZA 1GV5A 3O3KA 2PJRB 1JUPA 1B1BA 1FOXA 3M9AA 3RKWA 2P8TA 2M87A 3K70C 2ISYA 3HRSA 1PUFA 2KZVA 2Z3YA 3UNGC 2GXAA 2ZMEC 2IJLA 2OJED 2ESHA 2IW5A 2K85A 2WWYA 3QAHA 4U0WA 4DZPA 1N78A 2DFFA 3CO7C 1WSUA 3WHCA 3OYIA 2GWRA 5J3LA 3TW6A 4WF2A 2COBA 4HSRA 1MH4A 1TT5B 2EFPA 2EJRA 3HUGB 1R49A 5B3SH 2STTA 1OMIA 2R7TA 2UUZA 1DGRM 2OCEA 2OD5A 1T38A 5EGOB 4KJZA 2CV2A 3RQIA 4LG0B 3DBRB 3RDIA 2EA2A 2FOKA 3F0CA 1U9OA 5EZGA 1K4TA 2R5YB 1GXQA 2VIXA 1D8KA 1U6GA 2W85A 5GTHC 3SFIA 2FEZA 1Q1VA 1ZG5A 2V79A 3KZZA 1B8IB 2CW0F 5LGTA 2ZSHB 2F4MB 4XR6A 1SVOA 2PEXA 2F5EA 2M0MA 1LE8A 4M74A 2ZNZA 4BKXA 1UB9A 1B9NA 5LFAA 3TGNA 5FLMJ 3HEFA 2XPVA 2ACJA 2A5YB 2XHKA 4IRGA 4IKFA 3CDHA 5KCMA 1K83J 3OYBA 3HSRA 2MSYA 1W0TA 3TP0A 3BG6A 2R7RA 4ON0A 1MJ9A 3S3MA 2JTVA 1KONA 3NARA 1ZYRF 5F0CA 3VSKA 4J19A 2A68F 3HTUA 4A3BJ 3HTSB 2LH9A 2X1CA 2CJJA 2VKHA 3KYDB 2VJJA 1G3WA 2IA2A 2QF7A 3HIFA 4UXNA 2K3FA 2FX0A 3J81K 2XF6A 3U21A 2IGKA 3VFZA 3S8PA 3DXJF 2B9SA 3DBHB 3H1CA 2VODA 4CHUA 3EUAA 3FXJA 1G6NA 2Y2ZA 3Q9VA 5D4RA 1B59A 1MW7A 2KKOA 5IT9Z 1T98A 1FIAA 2KDOA 1D5YA 3KP5A 2LFBA 1MMDA 4G6DA 3FK6A 3V7RA 1TQMA 3OOPA 2DK5A 2YR2A 1AKHB 2DMNA 2M3AA 5LEKA 2KPMA 1UCRA 1WJ5A 1HSJA 4BHCA 1Y39A 1FPQA 1TWCJ 2EV5A 1MBJA 3HSEA 3W6VA 2LBFB 1BR2A 3LA7A 3KEQA 2DOFA 5D5XB 1DQUA 4I09A 1SD6A 2AO9A 4NNJA 1Z7LA 4ZJZA 2DJIA 3S2DJ 2E19A 4HX4A 3JAMZ 2W24A 3U1DA 1HF0A 3OYCA 2WAQA 3Q9SA 4M9XA 2MC4A 2X9DA 4DIQA 1UFMA 2ZJ2A 2HFHA 5M5WJ 4AIHA 3KP2A 1X2MA 4KICA 4HZFA 2FE3A 3J7ZI 1QVTA 1ETVA 1SD7A 2KIFA 5BOXA 4A3CJ 1R4MB 3AG3H 2K9MA 5LHHA 2L9RA 1BBYA 2KISA 3FHNA 4N0BA 1O3RA 1GVDA 3HKZN 1P9QC 1LJ9A 2CFXA 3OYJA 3RZDJ 1EH6A 3DU6A 1LB2A 1K61A 2O8KA 3GLLA 2LD5A 1POGA 1LPQA 3CJRB 2B0LA 1T8IA 3RI4A 1FY7A 1YW8A 4OWRB 2EQRA 2PFBA 2R5YA 3GFJA 4XRSG 4G6TB 1I5ZA 3V42A 2E1MC 2FOWA 5FFXA 1HCRA 5LD2C 4D7MA 3IAM2 2Z5UA 1OCRH 3RPUD 3A0HC 3MKZA 3MKWB 3ULQB 2M7AA 1Y56A 4NUBA 3HUGA 1JJ8C 3ASNH 2JN6A 2NS8A 4L5EA 1MGTA 2BYVE 1J75A 1X4OA 4BAYA 2NNYA 1MNDA 2FUG2 1R5GA 2E34A 3WTYC 2CQQA 4XM3A 4KIFA 3OS2A 4RM3A 4WXDA 5GADJ 2JZYA 1JT0A 2L7ZA 3CDLA 5CJ9A 5FO5A 2XAJA 3IKVA 3F21A 3IV5A 3OR2C 3ZRGA 1R1VA 1SC7A 3A1YA 1FTTA 2NRAC 4HEA2 1SD5A 5E20A 3M3YJ 2DDBA 1OKRA 1NG6A 5CVVA 3VB2A 1BI3A 4CYCA 4GGGA 1O7FA 4RA2A 4Y7NJ 3JRIA 3J80Z 3F23A 2EB7A 1W7PA 1HA8A 2BW3A 2GAUA 2KJBA 3I5UA 1K79A 2DQRA 3DPTA 2HPIA 3GCMA 1SFXA 3QP5A 1EH8A 3GBGA 3KFWX 3HOTA 4XOPA 2DCEA 2VBWA 3O6BB 3BQYA 3IP4B 3VDXA 2LVSA 1VQ8I 1QA6A 2X6WA 2BW3B 4ZYAA 1UG2A 2IGMA 3UR3C 3I3LA 3CD6I 1K78B 3EQLF 1SD4A 1R7JA 1JE8A 3MZ8A 3TL4X 4IVNA 4BQOA 2Y0MA 3BCBA 2KIMA 1USSA 4NBQA 4OAZA 4LLGF 2BV6A 2DFIA 4XLCA 3T5XA 4IHTA 2ZNYA 2NS7A 4XONA 3L7WA 3FBNB 5C4JJ 3ZP5A 3U9GA 4MTEA 5HLTA 3RYRA 2H27A 4MEXF 2WB1N 3OYLA 4DBRA 5JHUA 1NG7A 3GZ6A 4A3GJ 4DZJA 4ZZLA 3ZCOA 5B1AH 4D5FA 2CO5A 1FTZA 2WA0A 3ZMZA 2P4WA 5DM6F 3N97A 1JXSA 1UHWA 3JAMK 2QEXI 4XL9A 2I5UA 4Z6YA 1L0OC 4U7DA 4HPQA 3Q3SA 5J1YA 4L9NA 5E3LA 3GFIA 2Y75A 4GCVA 4MQ9F 1P2FA 1UZCA 2X48A 3R6SA 4AVPA 1DPRA 2G7UA 3E6DA 3DTIA 5EG0A 4IHYA 4CA0A 5L3GA 1FMWA 1Z9CA 1W5SA 2V9PA 3DP7A 4U87A 1ZGWA 3E7LA 2D5VA 1IXCA 2PG4A 3KE2A 4A3DJ 2JRTA 1QU3A 4KUMA 2LMDA 2ZJRF 1NHAA 3C1DA 5GP9A 1LUJB 1X4PA 5K7ZA 2MABA 5IT3A 1KU2A 2DK8A 3LA3A 3MZYA 1D1CA 5DCMA 5DEQA 5E3NA 1PP8F 3HYIA 4HA8A 3JRGA 3EUHA 4UVCA 4XN3A 3W6KB 3DFGA 5HLHA 4ASNA 2K7LA 2CUJA 4M6VA 3AL0C 5BQTA 1KZHA 3RPUA 4BY7J 2Z2SB 2FA5A 3FKJA 2Z9OA 1UJ8A 2QA4I 3WTXC 2QBYA 1XCVA 1OLTA 1O57A 2H1LA 3K10A 4PJJA 2JA6J 3JW4A 4IOAF 2L54A 1F43A 2RN7A 3CC7I 1RI7A 1TW2A 2LY2A 3KYLA 1I27A 2JA2A 2IXSA 1SANA 1IRGA 1BW5A 2KL4A 3ZQHA 1R00A 2PLYA 3ZQCA 2R7VA 1ON1A 1R36A 1SEUA 1BN5A 2E7XA 1FT9A 3F8FA 4RMNA 1FOKA 1O7LA 4LD5A 4M3GA 3I4NJ 2KMUA 5CPRB 9ANTA 4Y33A 1ZRCA 4HRIA 3KZYA 1Y8QB 1D0XA 5CVJA 4AU7A 2DMPA 1ORKA 1U5TB 1FBQA 3P7NA 3DKXA 1BI2A 1UMQA 3M8EA 4ZDLA 3CCQI 4IF4A 3OIOA 1W7PB 2Z1DA 2OAZA 5A2QZ 4AM3A 4AYBA 1QNTA 2AS5F 5J4VA 2LTPA 1TWGJ 2L4AA 4KT5C 5J1RA 1ZAOA 2WC2A 4M73A 1ZREA 3GYHX 2L7KA 5JVTA 1N75A 2CQKA 4QPOA 4ANJA 4DYRA 2COMA 3RKYA 4IPAA 1LDJA 1PYVA 2CG4A 3BR3A 2O3FA 3JRCA 1GDTA 3AG2H 2H94A 3H9QA 4LOCA 3PNTA 4LK0F 2W4SA 3P9CA 5K1YA 1YHQI 4AWXB 4LIVA 4A0XA 2Q1ZB 1QVUA 2RDPA 2A5WA 1RKTA 2DQLA 3SXYA 4ZDOA 1EF4A 3ROUA 3BY6A 2NVQJ 4WWCA 4RGRA 3H0DA 3ZMVA 2F4IA 2XF5A 3M4OJ 1G3TA 3WODF 1BR1A 3LSKA 2F5CA 4X6AJ 4I02A 2E36A 2A3SA 1IG7A 5DTDA 4Q5SF 4C2MJ 5CVUA 2HKXA 3HZJA 2XSDC 4A6DA 4XLFA 3GVAA 3DBLB 4YFNF 4HYEA 4QTRA 3L2VA 4HF2A 1P6RA 3ABMH 1WHUA 4XRSA 2ZXHA 4DOZA 2DODA 2VQLA 1CGPA 4EJUA 2MC3A 1VQOI 2K4BA 3H9GA 2LG4A 2XB5A 3F9KA 2IA0A 4F91B 3GWZA 4BJ6C 5F1JA 3IL2A 3HOZJ 3E5QA 3WE2A 2IBDA 4WCGA 1TWHJ 4B4CA 2L2OA 3MVPA 3DLAA 3ML6A 1ETXA 4XLAA 5ED4A 3K4JA 1KU7A 3P9IA 3ZQFA 3RZOJ 1ZARA 3AKZA 2JSPA 2EIKH 3L9FA 2HYFA 2X51A 2XRNA 1T2KA 3UKGA 2A05A 2OV7A 4ESFA 2OF7A 1U8RA 3K1NA 3CCJI 2KHMA 2Y48A 5F04A 3OOUA 4BEHB 5J1UA 1BC8C 1H9GA 2RGVA 2KRFA 2VPRA 4KITB 4JP0A 2IGNA 2R7WA 3BJAA 2VASA 3IRRA 2WB1A 3IAS2 3Q0UA 1DU6A 3LFKA 3ZN0A 4CZZA 1SVMA 2K9QA 1D8JA 1IDYA 3W2WA 3JRBA 5F27A 2ELKA 2KDZA 1TBXA 1B4AA 4HNTA 3ZMSA 3BTLA 3GW2A 1P4AA 2VKDA 1U9NA 3KYCB 4PJNA 3HL2A 2YU3A 4XORA 3PSFA 2W84A 2P6SA 2VBXA 1JGSA 1YG2A 3H3UA 2QKMB 2IS6A 5FFZA 2CGPA 1XX5A 2ZSIB 2Z99A 3S93A 5LLQA 1C0WA 1G3YA 5D5VB 3LL7A 3QYEA 3OYHA 2EILH 3FXLA 5FGMA 3VYRB 3K70D 2O8XA 2R7ZJ 2CQNA 1OCZH 3IWZA 4V2FA 3CF5F 5M3FJ 3VWBA 4L0ZB 4RLFA 2R3SA 1Z0XA 2NNNA 3IC7A 2LKXA 4B43A 3AG4H 1JJ6C 1RR7A 2AQFA 4BXUA 1VQ5I 1U5TA 2R7DA 2X1DA 3BR2A 3E5XA 2GXBA 2L3DA 2VN2A 1KGSA 2GQQA 3L09A 1NK3P 2DOEA 1U5TC 2HOTA 3OR1C 5F1RA 3O8HA 1VQKI 2BVLA 2MLKA 3K1MA 2C6YA 3CCRI 4I6ZA 1FBSA 3JTHA 4UB6C 4ZYEA 4V19K 3I4MJ 4FCYA 1ZQ3P 4BE1A 1MKMA 2HZTA 3W6JB 1QZEA 3BG5A 3J81Z 3OMYA 2JVGA 2EFQA 5LHGA 3KEYA 3S3OA 4OIOF 5IY5H 3I53A 3KLNA 4LJZF 2DPUA 1YX3A 2NOJB 2WV0A 3DV8A 1T56A 4PJLA 5J40A 3L00A 3SEZA 1ERDA 1B6AA 4CXFA 4D5CA 3ABTA 5JI6A 1QGPA 3L1PA 2ZCWA 2LYCA 4JX6A 3ZOBA 4PJMA 3K7AJ 1T08B 1W36C 4FE4A 5HLIA 1UELB 5GAEJ 3E3VA 4NDLA 3ERED 1ITYA 1JHFA 1FSEA 1TTYA 1YIOA 2A61A 4DW6A 2X4HA 5ILUA 4E7HA 3DPLC 2E1CA 2I8DA 2PI0A 4PSXA 3V8LA 2GOMA 4LK1F 3ZGKA 3BZKA 1TL8A 1LEAA 2XKOA 5EEAA 2J5OA 4LG0A 1YYVA 2DA4A 2M4KA 1T0FA 3ASOH 3F6VA 2E2HJ 1BOAA 4QLCU 4E7SA 2VJ4A 3RCOA 3GTGJ 4I98B 2GXGA 1ZG3A 3QU6A 3S3NA 1HSTA 2YX4A 3KEOA 3NWSA 2EZLA 1R5ID 2M4GA 1LE8B 2CW7A 3FWEA 1N77A 2BY3A 3ZQGA 4R79A 4FETA 4YEJA 2WAFA 1MMSA 5FD6A 4GO1A 4UB8C 4UUTA 3HJEA 3K4NA 4C2UA 4KISA 1K4SA 2P7CB 5GPCA 5IYBJ 2H6BA 2KLOA 1MBEA 4WK8F 2DO7A 3E1SA 1AU7A 1RIOH 1MSEC 4FISA 5IOZA 2IAIA 2IA1A 1SFOJ 2JQ7A 1F36A 3PO2J 2V1NA 4A3KJ 1FBUA 3H9JA 1E0EA 5J6XA 1ZN2A 4RGSA 1W5TA 2KJCA 3SZPA 3QPTA 2F2EA 3LSIA 1HBXG 4OIQF 1BA5A 1WJFA 4M6XA 4A0ZA 2E71A 3C7JA 2QYOA 3ABKH 2HVQA 2NVYJ 3I4PA 2M30A 2M2EA 2KT0A 4GDFA 2HI3A 3CDIA 3LSPA 4BL0B 2R93J 1MMAA 1Z6TA 3G6EI 1T95A 4JX5A 3K9TA 5F0HA 1ENHA 4V2GA 1O3QA 1RETA 2HYGD 2IEKA 4MFDA 3S2HJ 2IVMA 2P6TA 3O8GA 4R1HA 4D1QA 1HQCA 3WGIA 1ULYA 4D7NA 2JA5J 1ODDA 1HXDA 4DYQA 4Y4RA 4HDVA 2Y9YA 2OCCH 3ZXSA 5ILVA 3CTAA 3HBLA 3TKYA 3H36A 2XVCA 3C2BA 5BMZA 1UG0A 1BW6A 2NVTJ 1FOYA 2L0KA 3FX3A 1HLVA 1W1WE 5CLSA 3RKXA 2ZJQF 3TOAA 2NS0A 3LSJA 4N9HA 5C4XJ 3LQRA 5J4YA 5BS6A 2CUEA 3F8MA 3WG7H 1BOBA 1IAWA 3C2GA 2JA8J 3PSIA 1GHCA 2BE5F 3CUQC 4EV0A 1S9HA 4QIWN 2K02A 1XDSA 2V26A 3LSRA 3SHFA 1J09A 2A6HF 3NRVA 5ICEA 3L2CA 3E6BA 2BXYA 3QU3A 5DCMB 5FLXK 2ZXIA 3IH4A 2V6EA 3EETA 3GMEA 2QQAA 1VTNC 2FMYA 2KQRA 3FIWA 1MNEA 4ETSA 4P96A 4KFCA 1I3QJ 2CU7A 4XLNF 4ITVA 4N4NB 1YFHA 1E17A 1X58A 2FNAA 4PFPA 3A2KA 2ADUA 2KRHA 5HVQC 2QUFA 1RKWA 1OCCH 3P5JA 4M3DA 2LY9A 3TBIA 3HHGA 4II3A 5ICCA 2XROA 2EZIA 1R22A 2UV1A 3DCFA 3FXOA 5LGNA 4ENJA 4ENMA 4U88A 3FKIJ 1Y1WJ 1IW7F 3T8RA 4D0PA 1ZLJA 4MTDA 3MEXA 1E2XA 4BE0A 1QZYA 5HS8A 2R7XA 3MAJA 3HG9A 2H09A 2VJ5A 2VT3A 1KU9A 2EFOA 3R0JA 4YFXF 1TT0A 2B7EA 4IRIA 2VC1A 5CQGA 2ICWG 3JSPA 1ZTRA 3FXKA 4FE7A 2NYXA 4QSHA 4XSXF 5HOOA 4NHJA 2DA7A 2P5VA 3DU5A 2OZUA 3LSGA 1FP2A 3MMYB 1JHHA 1HOMA 3RYPA 2QKLB 2XDVA 3D0SA 2ECBA 2NXNB 2EFNA 4Y3OA 3CJNA 3GZNB 2K27A 3K4LA 1B9MA 1XMKA 2CMPA 3GTJJ 3QWLA 2JPCA 3I56I 3IH2A 2IGOA 5KHDA 1SAXA 2DMTA 4RAFA 3I0TA 2BY2A 3V7SA 4YIFA 3M8FA 4CCMA 3BR0A 4BUPA 3VYTB 1OQYA 4C3IJ 2VKEA 3RQ4A 2XASA 3PM1A 3G71I 2O9LA 4CSWA 5EDNA 1BM9A 1JUMA 1D0YA 4LFUA 4OIRF 3CCVI 3CMMA 1CF7A 4RAGA 5TGTA 3ZQQA 4BGDA 4Y52J 2MGQA 4LG3A 2KFDA 3I9V2 4UUVA 2X0LA 2HTSA 1I6HJ 2UXXA 1YJ9I 2ZC2A 2E1OA 2QZ8A 3EPZA 1K7AA 4C3JJ 3BPXA 1I50J 3GUDA 3JSOA 1HW2A 2VB6A 4BDYA 2ZXJA 2VBZA 1XGNA 3CP8A 4XMYA 1V4RA 5BPDA 4Y17A 4ESBA 4WXCA 4J00A 3QRFF 1E3HA 2XPUA 5M5YJ 1LFUP 3CC4I 2K3PA 1S6LA 3BTCA 2HEOA 1T0FC 5E1ZB 4LLNA 2X1EA 3GZ5A 1PDNC 2GIVA 3FMQA 6PAXA 5FKMA 5JHFA 2UZKA 4RAYA 3HGGA 3J7YJ 3L2WA 2BHZA 3PFIA 1XC5A 2HDWA 3BZCA 2R5ZB 4IQ4A 2O5RA 3DQVC 4ZYGA 3LMMA 3ONQA 4GFBA 3MZHA 1IV6A 3OL3A 2HZDA 2HR3A 1WWXA 3VODA 5HODA 1VQ6I 3GEZA 1YW9A 3LOCA 5J8CA 3LAJA 1RR8C 4E7IA 2G9WA 3OV8A 4BJTA 2BXZA 1WQ2A 4IOCF 4KN4X 2FBKA 3CCLI 3R4KA 2E5ZA 2KIQA 3VPRA 4MEYF 3NWTA 4UUSA 1A35A 2FBHA 3FMSA 1OISA 1ZR2A 3MWMA 4JK1X 2EK5A 3BQZA 2VPLA 4EGYA 1S5LC 4Y15A 2HDCA 2JJ7A 1YW7A 2PMUA 2A07F 3BJOA 5L3DA 1ZKGA 4LITA 1V54H 1VQMI 2F5DA 2QM3A 3LWFA 5K5OA 3L2RA 1F4KA 1QO0D 5EJCA 4OINF 3QOPA 3F6OA 2P7VB 3RIRA 1ZELA 1A5JA 4II2A 3SFZA 1Z05A 2OUMA 1VQLI 4ZH4F 4HX7A 2JUGA 1JTXA 3SYTA 1X3WB 5D8LB 2LSOA 4HQMA 4B3XA 2DBBA 5D4SA 2XGEA 3LSMA 1ZH5A 4EM2A 3CLOA 1A6IA 4LGWA 3M1CA 3KP3A 5F08A 5L3FA 1RUOA 4E7LA 3R61A 1IXSB 3P9KA 1GVJA 4M9SA 3A01B 4MLOA 3VOEA 1FEXA 3Q0WA 2K86A 1BL0A 1LEBA 4P5OA 5LHIA 3CMEI 3Q5FA 2IRFG 4G94A 1IN4A 2MFZA 4B47A 2MYSA 2E2JJ 1AWCA 1O3TA 4OMYA 1WRJA 4ENNA 2VQCA 3PJRA 1J59A 1Y0NA 2KP6A 4HG2A 1P4XA 1UHMA 1VZ0A 1X3ZB 3CUQA 3DEUA 1FYLA 3S16J 2JPBA 1VQ4I 2QCOA 4HOBA 3J7AY 2TRTA 4G7OF 2LR8A 3Q0VA 2M5WA 3GFMA 2WTEA 2W7NA 3VYSB 3K1PA 5E8GA 3AAFA 2BVMA 4RM2A 5K5RA 2F4OB 4F3QA 3G1MA 3KLOA 4KT6A 2D1VA 4H4KC 4UHTA 3WTSC 4C3HJ 2BZTA 4IQJA 1YQAA 1QZZA 3OYFA 4MGRA 3F8NA 3SZTA 3F22A 2FQ4A 1F5TA 3TO7A 2VXZA 1YJNI 4M3FA 4R8HA 4EM1A 1VQ7I 5FKKA 3WG9A 1R4NB 4I01A 1ZRDA 2JVHA 2HWVA 1PUEE 2H6CA 1V3FA 3FXMA 1W7PD 3K69A 3REOA 2YX7A 2Q0OA 1YLFA 3AFHA 2TDXA 2ECCA 4ZYDA 2N8GA 4AYBN 2FF4A 3F8BA 2WAEA 3R0AA 4GYIA 4MIMA 3ZQLA 2ZJPF 1P92A 3CCEI 1YE9A 4B1RA 3ZMDA 2R5ZA 4I76A 4O5VA 4E7KA 3QPSA 4MO7A 3S15J 2ELHA 1H88C 1J7KA 1Z67A 3N4MA 4XKVA 4XRFA 4KIGA 2YSRA 1DPUA 2MBFA 4ZC3A 1XMXA 3TW7A 2XPWA 5DD4A 5LRRA 2BEOA 1FWZA 2YS9A 4MHGA 3LFUA 1JUSA 1SFKA 1HW5A 1G59A 1FX7A 5JFRA 3LAPA 1T33A 3FISA 4D9JA 1A04A 1Q1HA 1MDMB 2W48A 4BS9A 1V5FA 1MBGA 2ZXWH 3CCMI 2LC2A 2R7UA 3CMYA 3FF5A 3V8JA 1SFUA 2PBIA 2HQ5A 4GRIA 3U2RA 2I10A 4IX7A 2CUFA 2W82A 2CQ7A 2HPMA 2MD5A 5DM7F 3HOYJ 4IZZA 4RB0A 5DD8A 3HM5A 4L5IA 2ISZA 1IUFA 5LEJA 2PJRA 3EDPA 1RNLA 4AIDA 1OCTC 2ZB9A 1MDMA 5JR3A 2G7HA 5IP9J 3CJQB 3HOXJ 4C9YA 4KMUX 2V1UA 1TNTA 1HKSA 3H5AA 1U78A 3IHUA 3ELKA 3N05A 2CUZA 4P9UA 1UAAA 3BG9A 5IPAA 5KNLA 4U0YA 5DV5A 1GV2A 4P55A 4ZTJA 1IRZA 1IN6A 1YI2I 4CGZA 4LLLA 4OOIA 1I6XA 2RNGA 4BBRJ 4MFEA 2QWWA 3HOSA 3W3CA 1H89C 2V6CA 2R7SA 4A93J 1OPCA
chains in the Genus database with same CATH topology
5ILSA 3V4GA 4JBAA 2FXAA 2VT2A 4OIPF 3I58A 3CUQB 1ZG1A 3C18A 3IRQA 3G73A 3I59A 1XN7A 4RAZA 4G8XA 5ERIA 4G9YA 4U7BA 2DLLA 4Y13A 3BZ6A 2HQNA 3I59B 4RB3C 1HKQA 3O2PE 4Q4ZF 4B8XA 3K2ZA 2JT1A 2DT5A 3FXRA 4A5NA 1RZ4A 1IN8A 3E6MA 2RV8A 2RC4A 2EA4A 3ZMUA 3WGGA 3TDZC 2M45A 4EQQA 1YO5C 3ZQ7A 4I0AA 2K4JA 1WKMA 1J0RA 2VOPA 1QQIA 5F6FA 4P9FA 4OMZA 2V9VA 3LSTA 3IKTA 5F64A 5D5UB 3E97A 3ECHA 2ZO4A 3B73A 4O3MA 1OYWA 4M9ZA 4XSZF 2HKOA 2DPDA 3KCCA 1IXRC 1ZHFA 4PZJA 4EM0B 3ISPA 4Z2YA 2GA1A 1Z7UA 4HLXA 1XSDA 1REPC 3S2WA 3BROA 5AONA 5HDNA 4LMYA 4O6JA 3E5UA 3CUOA 2Z33A 2EV6A 2XV4S 3CO6C 5DDGA 3I71A 1YS6A 1WI9A 1XSVA 2PQ8A 3KP7A 4YG2F 1BIBA 2UXNA 5L3EA 4PGHA 3HRUA 4RB1A 4ENKA 4A2UA 2OQRA 4HW0A 1EH7A 5HLGA 2HTJA 4RGUA 4GYGA 2DAOA 5E8IA 3C3WA 1S7OA 4G7HF 2V1XA 1ON2A 3ZPLA 5IT9K 1TW3A 1CF7B 3WGHA 3MFKA 3DKWA 3FMRA 2VOOA 2HQRA 5E18F 4I7HA 1IN7A 3WTZA 3J80K 2HS5A 3PQJA 2RQPA 4LB6B 1FSHA 4L0YB 3F8CA 1FLIA 1R1TA 4I0BA 4WXHA 4YFKF 4HV6A 5EEHA 3KETA 2XAQA 3FXUA 4PGGA 4XBFA 3TQNA 3BDDA 2STWA 4F7ZA 2CSOA 1FYMA 3GFLA 5FB2A 4EMSA 1LNWA 2ZMEB 2VONA 4L9TA 1KQ8A 3WU1B 1KYZA 3RPQA 4M6YA 3ZN1A 2DU9A 1XB4A 4ZYHA 1U3EM 4L18B 5DYMA 2EWNA 4DQ2A 4ESJA 1F9NA 3H92A 3TO6A 4IXAA 1YS7A 2CYYA 1SFEA 2ZBKA 3D5LA 5TJJA 4OU0A 2M1BA 5LGUA 3FXQA 5KVRA 2IP2A 2QVOA 3HRMA 4AD9A 1BI1A 1P4WA 4HF1A 4BHBA 4MQVA 1O3SA 3MQ0A 1ZGJA 5H6QA 3FZVA 4NQWA 1BJAA 1BIAA 4KMFA 4HX8A 3M7GA 2OBPA 2IT0A 1FYKA 4U0VA 1ZLKA 1SMTA 1MJBA 1BI0A 2LF8A 4A0YA 1IN5A 1DDNA 2ESNA 4I2OA 4N9IA 3ABUA 1W4MA 1J9IA 1S7AA 5CVIA 2FNPA 4EJVA 3EYYA 1ZGAA 1QPMA 1GXPA 1R1UA 1Z91A 4EJWA 3GXOA 4AIKA 4UNOA 2RVCA 3KP4A 4K2EA 4KN7X 3COAC 3E6CC 4BQAA 3TDUC 5A2QK 5E1XA 4CICA 3RTRA 4KIBA 4UV8A 4UV9A 2D1HA 4UVBA 4EJTA 3KP6A 1OYYA 3BP8A 1S3JA 2FRHA 1R58A 5ICFA 2ZKZA 4MNUA 3NQOA 1IRFA 2EV0A 3WU0A 4BH9A 2BBYA 4Q47A 3M1EA 2O03A 2EFWA 1TQIA 2DI3A 1DP7P 1TQPA 3FM3A 3QPHA 1I1SA 1KA8A 4BYYA 3F3XA 3DF8A 3WTWC 4L9JA 3GO5A 5BPIA 4FHTA 3QP6A 2XUBA 2VBYA 4A6EA 4LB5A 1R5HA 1TLHB 5DCFA 4Q48A 2R7FA 5D6EA 5EEGA 3WTTC 1R23A 2VC0A 1J2XA 2DW4A 5HDKA 2J5PA 2IPQX 3T8TA 2E1NA 4E70A 3WTUC 4EGZA 3WTVC 2AXLA 1BC7C 4HAMA 3SQNA 1XGOA 2MA3A 1XGSA 4AIJA 2UWMA 1YTYA 3T1BA 5H6RA 1K78A 4EJOA 3JTGA 1XD7A 2W57A 1IF1A 1XGMA 4RS8A 3HRTA 3BJ6A 3J7AO 3GF2A 5HS9A 1Y0UA 2OA4A 5KK1A 2XAHA 2D2WA 2ZFWA 1EV7A 1PP7U 5K5QA 1OYIA 3ECOA 5HDGA 2D45A 4L5JA 1ONVA 2MH2A 3MCZA 2QQ9A 1FZPB 4CDGA 1XCBA 2BGCA 5L3CA 1S29A 3BOQA 1ZRFA 3I64A 3GLXA 1IUYA 3I54A 3BPVA 1STZA 4BNCA 3T0YA 2QENA 2KIUA 2LKPA 2XAFA 2P5LC 1U2WA 4KDPA 3BWGA 2MH9A 4B09A 2OZ6A 1RUNA 2ETHA 1MZBA 2RKHA 4HF0A 2F5FA 2PJPA 4PCQA 5D6FA 1LDDA 1Z1DA 4EVIA 2L02A 4S04A 2MLGA 2VE9A 3VEPA 1H0MA 4KYWA 4A5MA 4HDUA 2PN6A 4HV5A 1XSXA 1KYWA 4FT8A 2QBYB 5E17F 2OQGA 2Q2EA 3FHZA 5DUIA 3K0LA 1XMAA 2ZMEA 4QWQA 2FBIA 1I1GA 3NEUA 3TOBA 1LQ1A 3V8KA 5L3BA 4TV7A 5CVRA 5LRSA 3ZMTA 4HQEA 1FNNA 3H3ZA 3GX4X 1FP1D 2O61A 4UVAA 1D3YA 1MJAA 2OU2A 1D5VA 2LNBA 4IRHA 5D5WB 2YPRA 5ICGA 3WE3A 1X3UA 5FLXZ 2LF7A 2A6EF 2XAGA 2JSCA 4S05A 4KA4A 5DUKA 1LDKB 3R60A 4WX9A 2LDUA 1J5YA 2VE8A 2QLZA 1HKTA 4PDKA 3PQKA 4FX0A 4HBLA 2HOEA 1OR7A 2V1DA 2NAZA 2FMLA 1L3LA 4L9VA 4NB5A 5AIQA 1G4DA 4A12A 1IZ1A 3G3ZA 1S8NA 1H9TA 3LA2A 4G6QA 2RNJA 5AIPA 3FM5A 4BHPA 2XKPA 4G7ZF 3TO9A 4RGXA 4JQFA 1KU3A 4CYDA 3F72A 2XIGA 1KQ9A 2PMHA 1T6SA 5CYVA 1Z6RA 2M8EA 1QBJA 2QQBA 2E7WA 2L4MA 1USTA 3HHHA 1F1ZA 3B02A 4M72A 3LQQA 4ZZDA 2O6GE 4H0EA 2GZWA 5E1WA 4GXOA 4YIIA 1T39A 2GA2A 3V7CA 3HSFA 5D8KB 1TNSA 2P5KA 5J8FA 1XDUA 1MD0A 2CWEA 2L01A 2XGXA 1HW1A 4FX4A 2FU4A 4CO8A 2A69F 3IWFA 2FQ3A 5TRDA 2HGCA 4XLPF 5HS7A 2W25A 5FD5A 1G3SA 4IHSA 2DTRA 4RB2C 2Q8KA 1KQ0A 1SMYF 4IJAA 4KNYA 4M71A 4DNCA 1K6OA 3EYIA 1DUXC 1LVAA 2O0YA 5H20A 1AOYA 2FSWA 3RJPA 1FC3A 4HLYA 5LBQA 3O3KA 1B1BA 3M9AA 3RKWA 2P8TA 2M87A 2ISYA 3HRSA 2Z3YA 2IJLA 2ESHA 2IW5A 2WWYA 3QAHA 4U0WA 3CO7C 1WSUA 2GWRA 4WF2A 2EFPA 2EJRA 2STTA 1OMIA 2OD5A 1T38A 4LG0B 3RDIA 2EA2A 2FOKA 1GXQA 1D8KA 1U6GA 2W85A 2FEZA 1ZG5A 2V79A 3KZZA 2CW0F 5LGTA 2PEXA 2F5EA 4M74A 2ZNZA 1UB9A 1B9NA 3TGNA 2ACJA 2A5YB 2XHKA 4IRGA 3CDHA 3HSRA 4ON0A 1MJ9A 2JTVA 1ZYRF 2A68F 3HTUA 3HTSB 1G3WA 2IA2A 3HIFA 4UXNA 3J81K 3VFZA 3DXJF 2VODA 4CHUA 1G6NA 3Q9VA 5D4RA 1B59A 2KKOA 5IT9Z 1T98A 3KP5A 4G6DA 3V7RA 1TQMA 3OOPA 2DK5A 2YR2A 5LEKA 1UCRA 1HSJA 4BHCA 1FPQA 2EV5A 3HSEA 3LA7A 3KEQA 5D5XB 4I09A 1SD6A 4HX4A 3JAMZ 2W24A 3U1DA 3Q9SA 4M9XA 1UFMA 2ZJ2A 2HFHA 4AIHA 3KP2A 4KICA 4HZFA 2FE3A 1SD7A 2KIFA 5BOXA 5LHHA 1BBYA 4N0BA 1O3RA 1LJ9A 2CFXA 1EH6A 1LB2A 2B0LA 3RI4A 1FY7A 1YW8A 2PFBA 3GFJA 1I5ZA 5FFXA 2Z5UA 3ULQB 3HUGA 1MGTA 2BYVE 1J75A 4BAYA 2NNYA 1R5GA 3WTYC 4KIFA 4WXDA 2JZYA 5CJ9A 5FO5A 2XAJA 3IKVA 3F21A 1R1VA 2NRAC 1SD5A 5E20A 1OKRA 5CVVA 3VB2A 1BI3A 4GGGA 1O7FA 3J80Z 3F23A 2EB7A 1W7PA 2GAUA 2KJBA 3I5UA 1K79A 2DQRA 3DPTA 3QP5A 1SFXA 1EH8A 3KFWX 3HOTA 2VBWA 3O6BB 1K78B 3EQLF 1SD4A 1R7JA 1JE8A 4IVNA 2Y0MA 2KIMA 1USSA 4LLGF 4IHTA 2BV6A 2DFIA 3T5XA 2ZNYA 3L7WA 3ZP5A 3U9GA 4MTEA 3RYRA 2H27A 4MEXF 5JHUA 3GZ6A 4ZZLA 2CO5A 3ZMZA 2P4WA 3N97A 1JXSA 1UHWA 3JAMK 1L0OC 4U7DA 4L9NA 3GFIA 2Y75A 4GCVA 4MQ9F 1P2FA 4AVPA 3R6SA 1DPRA 2G7UA 3E6DA 5L3GA 1Z9CA 1W5SA 3DP7A 1IXCA 2PG4A 3KE2A 2JRTA 4KUMA 1NHAA 3C1DA 5IT3A 2DK8A 1KU2A 3LA3A 3MZYA 1PP8F 5DCMA 5DEQA 3HYIA 4HA8A 3EUHA 4UVCA 3W6KB 5HLHA 3DFGA 4ASNA 2K7LA 5BQTA 3RPUA 2FA5A 2Z9OA 3WTXC 2QBYA 1XCVA 1O57A 3JW4A 2L54A 2RN7A 1RI7A 1TW2A 1I27A 1IRGA 1R00A 2PLYA 1ON1A 1R36A 1BN5A 2E7XA 1FT9A 3F8FA 1FOKA 1O7LA 4LD5A 1ZRCA 3KZYA 5CVJA 1U5TB 1FBQA 3P7NA 1BI2A 3M8EA 4IF4A 1W7PB 2OAZA 5A2QZ 1QNTA 2AS5F 2L4AA 4KT5C 1ZREA 1ZAOA 2WC2A 4M73A 3GYHX 5JVTA 2CQKA 2COMA 3RKYA 4IPAA 1LDJA 2CG4A 2O3FA 2H94A 4LK0F 3P9CA 5K1YA 4AWXB 4A0XA 2RDPA 2DQLA 3SXYA 3ROUA 3BY6A 4WWCA 4RGRA 3ZMVA 1G3TA 3WODF 2F5CA 4I02A 4Q5SF 2A3SA 5CVUA 2HKXA 4A6DA 3GVAA 4YFNF 4HYEA 4HF2A 1P6RA 1CGPA 4EJUA 2MC3A 2K4BA 2IA0A 3GWZA 3IL2A 3E5QA 3WE2A 4WCGA 3ML6A 5ED4A 1KU7A 3P9IA 1ZARA 3L9FA 2HYFA 2XRNA 1T2KA 4ESFA 1U8RA 3K1NA 2Y48A 1BC8C 1H9GA 2RGVA 2KRFA 3BJAA 3IRRA 3LFKA 3ZN0A 4CZZA 1D8JA 1TBXA 1B4AA 3ZMSA 1P4AA 3GW2A 2YU3A 2W84A 2P6SA 2VBXA 1JGSA 1YG2A 3H3UA 5FFZA 2CGPA 2Z99A 5LLQA 1C0WA 1G3YA 5D5VB 5FGMA 2O8XA 3IWZA 4L0ZB 2R3SA 2NNNA 3IC7A 4BXUA 1U5TA 2R7DA 3E5XA 2GXBA 2L3DA 2VN2A 1KGSA 2GQQA 3L09A 1U5TC 5F1RA 2MLKA 3K1MA 2C6YA 1FBSA 3JTHA 4ZYEA 1MKMA 2HZTA 3W6JB 3J81Z 2EFQA 5LHGA 4OIOF 3I53A 3KLNA 4LJZF 2DPUA 2WV0A 3DV8A 3L00A 1B6AA 4CXFA 3ABTA 5JI6A 1QGPA 2ZCWA 5HLIA 3ERED 3E3VA 1JHFA 1FSEA 1TTYA 1YIOA 2A61A 2X4HA 5ILUA 3DPLC 2E1CA 2PI0A 3V8LA 4LK1F 1LEAA 2XKOA 2J5OA 4LG0A 1YYVA 1T0FA 3F6VA 1BOAA 4QLCU 4I98B 2GXGA 1ZG3A 3QU6A 1HSTA 2YX4A 3KEOA 3FWEA 4R79A 5FD6A 4GO1A 2P7CB 2H6BA 4WK8F 2DO7A 1RIOH 2IA1A 1FBUA 5J6XA 1ZN2A 4RGSA 1W5TA 2KJCA 3SZPA 3QPTA 2F2EA 1HBXG 4OIQF 4M6XA 4A0ZA 3C7JA 2QYOA 3I4PA 2M30A 1Z6TA 3K9TA 1O3QA 2HYGD 2IVMA 2P6TA 4R1HA 1HQCA 3WGIA 1ULYA 1ODDA 1HXDA 4HDVA 5ILVA 3CTAA 3TKYA 2XVCA 5BMZA 3FX3A 5CLSA 3RKXA 3TOAA 2NS0A 4N9HA 3LQRA 5BS6A 1IAWA 3F8MA 1GHCA 2BE5F 3CUQC 4EV0A 2K02A 1XDSA 3SHFA 2A6HF 3NRVA 5ICEA 3L2CA 3E6BA 5DCMB 3QU3A 5FLXK 3EETA 2QQAA 1VTNC 2FMYA 4ETSA 4P96A 4KFCA 4XLNF 1YFHA 1E17A 2FNAA 2ADUA 5HVQC 2QUFA 3HHGA 5ICCA 2XROA 5LGNA 1R22A 4ENJA 4ENMA 4U88A 1IW7F 3T8RA 4D0PA 1ZLJA 4MTDA 3MEXA 1E2XA 1QZYA 5HS8A 3MAJA 2H09A 2VT3A 1KU9A 2EFOA 3R0JA 4YFXF 4IRIA 2VC1A 3JSPA 2NYXA 4XSXF 5HOOA 4NHJA 2P5VA 2OZUA 1FP2A 1JHHA 3RYPA 3D0SA 2EFNA 3CJNA 2K27A 1B9MA 1XMKA 2JPCA 1SAXA 3I0TA 3V7SA 4YIFA 3M8FA 2XASA 1BM9A 4LFUA 4OIRF 1CF7A 4UUVA 2X0LA 2HTSA 2UXXA 2QZ8A 1K7AA 3BPXA 3GUDA 3JSOA 1HW2A 2ZXJA 2VBZA 1XGNA 1V4RA 5BPDA 4Y17A 4ESBA 4WXCA 3QRFF 1S6LA 2HEOA 4LLNA 5E1ZB 3GZ5A 1PDNC 2GIVA 3FMQA 6PAXA 2UZKA 4RAYA 3PFIA 3DQVC 4ZYGA 3MZHA 2HR3A 1WWXA 3VODA 3GEZA 1YW9A 5J8CA 3LAJA 2G9WA 3OV8A 1WQ2A 4KN4X 2FBKA 3R4KA 4MEYF 2FBHA 3FMSA 3MWMA 4JK1X 2EK5A 4EGYA 2HDCA 4Y15A 2PMUA 1YW7A 2A07F 3BJOA 5L3DA 2F5DA 2QM3A 3LWFA 5K5OA 1F4KA 1QO0D 4OINF 3QOPA 3F6OA 2P7VB 3RIRA 3SFZA 1Z05A 4ZH4F 4HX7A 5D8LB 2LSOA 4HQMA 2DBBA 5D4SA 1ZH5A 4EM2A 3CLOA 4LGWA 3KP3A 5L3FA 1RUOA 3R61A 1IXSB 3P9KA 1GVJA 4M9SA 3VOEA 2K86A 1LEBA 4P5OA 5LHIA 3Q5FA 2IRFG 4G94A 1IN4A 1AWCA 1O3TA 4OMYA 1WRJA 4ENNA 1J59A 1P4XA 1UHMA 3CUQA 3DEUA 1FYLA 2JPBA 4HOBA 4G7OF 2M5WA 3GFMA 2WTEA 3K1PA 5E8GA 3AAFA 5K5RA 3KLOA 2D1VA 4UHTA 3WTSC 1YQAA 1QZZA 4MGRA 3F8NA 3SZTA 3F22A 1F5TA 3TO7A 2VXZA 4R8HA 4EM1A 3WG9A 1ZRDA 4I01A 1PUEE 2HWVA 2H6CA 1V3FA 1W7PD 3K69A 3REOA 2YX7A 2Q0OA 1YLFA 2TDXA 4ZYDA 2FF4A 3F8BA 3R0AA 4GYIA 1P92A 3ZMDA 4O5VA 2ELHA 1J7KA 3N4MA 4XRFA 4KIGA 2YSRA 1DPUA 2MBFA 5DD4A 5LRRA 2BEOA 1FWZA 4MHGA 1HW5A 1FX7A 5JFRA 3LAPA 1A04A 1Q1HA 1MDMB 1SFUA 3FF5A 3V8JA 2PBIA 3U2RA 2MD5A 4RB0A 5DD8A 2ISZA 4L5IA 5LEJA 3EDPA 1RNLA 1MDMA 5JR3A 2G7HA 4KMUX 2V1UA 1TNTA 1HKSA 1U78A 3IHUA 3ELKA 4P9UA 4U0YA 5DV5A 4P55A 1IN6A 4CGZA 4LLLA 4OOIA 1I6XA 2QWWA 3HOSA 2V6CA 1OPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ILS A;  3V4G A;  4JBA A;  2FXA A;  2VT2 A;  4OIP F;  3I58 A;  3CUQ B;  1ZG1 A;  3C18 A;  3IRQ A;  3G73 A;  3I59 A;  1XN7 A;  4RAZ A;  4G8X A;  5ERI A;  4G9Y A;  4U7B A;  2DLL A;  4Y13 A;  3BZ6 A;  2HQN A;  3I59 B;  4RB3 C;  1HKQ A;  3O2P E;  4Q4Z F;  4B8X A;  3K2Z A;  2JT1 A;  2DT5 A;  3FXR A;  4A5N A;  1RZ4 A;  1IN8 A;  3E6M A;  2RV8 A;  2RC4 A;  2EA4 A;  3ZMU A;  3WGG A;  3TDZ C;  2M45 A;  4EQQ A;  1YO5 C;  3ZQ7 A;  4I0A A;  2K4J A;  1WKM A;  1J0R A;  2VOP A;  1QQI A;  5F6F A;  4P9F A;  4OMZ A;  2V9V A;  3LST A;  3IKT A;  5F64 A;  5D5U B;  3E97 A;  3ECH A;  2ZO4 A;  3B73 A;  4O3M A;  1OYW A;  4M9Z A;  4XSZ F;  2HKO A;  2DPD A;  3KCC A;  1IXR C;  1ZHF A;  4PZJ A;  4EM0 B;  3ISP A;  4Z2Y A;  2GA1 A;  1Z7U A;  4HLX A;  1XSD A;  1REP C;  3S2W A;  3BRO A;  5AON A;  5HDN A;  4LMY A;  4O6J A;  3E5U A;  3CUO A;  2Z33 A;  2EV6 A;  2XV4 S;  3CO6 C;  5DDG A;  3I71 A;  1YS6 A;  1WI9 A;  1XSV A;  2PQ8 A;  3KP7 A;  4YG2 F;  1BIB A;  2UXN A;  5L3E A;  4PGH A;  3HRU A;  4RB1 A;  4ENK A;  4A2U A;  2OQR A;  4HW0 A;  1EH7 A;  5HLG A;  2HTJ A;  4RGU A;  4GYG A;  2DAO A;  5E8I A;  3C3W A;  1S7O A;  4G7H F;  2V1X A;  1ON2 A;  3ZPL A;  5IT9 K;  1TW3 A;  1CF7 B;  3WGH A;  3MFK A;  3DKW A;  3FMR A;  2VOO A;  2HQR A;  5E18 F;  4I7H A;  1IN7 A;  3WTZ A;  3J80 K;  2HS5 A;  3PQJ A;  2RQP A;  4LB6 B;  1FSH A;  4L0Y B;  3F8C A;  1FLI A;  1R1T A;  4I0B A;  4WXH A;  4YFK F;  4HV6 A;  5EEH A;  3KET A;  2XAQ A;  3FXU A;  4PGG A;  4XBF A;  3TQN A;  3BDD A;  2STW A;  4F7Z A;  2CSO A;  1FYM A;  3GFL A;  5FB2 A;  4EMS A;  1LNW A;  2ZME B;  2VON A;  4L9T A;  1KQ8 A;  3WU1 B;  1KYZ A;  3RPQ A;  4M6Y A;  3ZN1 A;  2DU9 A;  1XB4 A;  4ZYH A;  1U3E M;  4L18 B;  5DYM A;  2EWN A;  4DQ2 A;  4ESJ A;  1F9N A;  3H92 A;  3TO6 A;  4IXA A;  1YS7 A;  2CYY A;  1SFE A;  2ZBK A;  3D5L A;  5TJJ A;  4OU0 A;  2M1B A;  5LGU A;  3FXQ A;  5KVR A;  2IP2 A;  2QVO A;  3HRM A;  4AD9 A;  1BI1 A;  1P4W A;  4HF1 A;  4BHB A;  4MQV A;  1O3S A;  3MQ0 A;  1ZGJ A;  5H6Q A;  3FZV A;  4NQW A;  1BJA A;  1BIA A;  4KMF A;  4HX8 A;  3M7G A;  2OBP A;  2IT0 A;  1FYK A;  4U0V A;  1ZLK A;  1SMT A;  1MJB A;  1BI0 A;  2LF8 A;  4A0Y A;  1IN5 A;  1DDN A;  2ESN A;  4I2O A;  4N9I A;  3ABU A;  1W4M A;  1J9I A;  1S7A A;  5CVI A;  2FNP A;  4EJV A;  3EYY A;  1ZGA A;  1QPM A;  1GXP A;  1R1U A;  1Z91 A;  4EJW A;  3GXO A;  4AIK A;  4UNO A;  2RVC A;  3KP4 A;  4K2E A;  4KN7 X;  3COA C;  3E6C C;  4BQA A;  3TDU C;  5A2Q K;  5E1X A;  4CIC A;  3RTR A;  4KIB A;  4UV8 A;  4UV9 A;  2D1H A;  4UVB A;  4EJT A;  3KP6 A;  1OYY A;  3BP8 A;  1S3J A;  2FRH A;  1R58 A;  5ICF A;  2ZKZ A;  4MNU A;  3NQO A;  1IRF A;  2EV0 A;  3WU0 A;  4BH9 A;  2BBY A;  4Q47 A;  3M1E A;  2O03 A;  2EFW A;  1TQI A;  2DI3 A;  1DP7 P;  1TQP A;  3FM3 A;  3QPH A;  1I1S A;  1KA8 A;  4BYY A;  3F3X A;  3DF8 A;  3WTW C;  4L9J A;  3GO5 A;  5BPI A;  4FHT A;  3QP6 A;  2XUB A;  2VBY A;  4A6E A;  4LB5 A;  1R5H A;  1TLH B;  5DCF A;  4Q48 A;  2R7F A;  5D6E A;  5EEG A;  3WTT C;  1R23 A;  2VC0 A;  1J2X A;  2DW4 A;  5HDK A;  2J5P A;  2IPQ X;  3T8T A;  2E1N A;  4E70 A;  3WTU C;  4EGZ A;  3WTV C;  2AXL A;  1BC7 C;  4HAM A;  3SQN A;  1XGO A;  2MA3 A;  1XGS A;  4AIJ A;  2UWM A;  1YTY A;  3T1B A;  5H6R A;  1K78 A;  4EJO A;  3JTG A;  1XD7 A;  2W57 A;  1IF1 A;  1XGM A;  4RS8 A;  3HRT A;  3BJ6 A;  3J7A O;  3GF2 A;  5HS9 A;  1Y0U A;  2OA4 A;  5KK1 A;  2XAH A;  2D2W A;  2ZFW A;  1EV7 A;  1PP7 U;  5K5Q A;  1OYI A;  3ECO A;  5HDG A;  2D45 A;  4L5J A;  1ONV A;  2MH2 A;  3MCZ A;  2QQ9 A;  1FZP B;  4CDG A;  1XCB A;  2BGC A;  5L3C A;  1S29 A;  3BOQ A;  1ZRF A;  3I64 A;  3GLX A;  1IUY A;  3I54 A;  3BPV A;  1STZ A;  4BNC A;  3T0Y A;  2QEN A;  2KIU A;  2LKP A;  2XAF A;  2P5L C;  1U2W A;  4KDP A;  3BWG A;  2MH9 A;  4B09 A;  2OZ6 A;  1RUN A;  2ETH A;  1MZB A;  2RKH A;  4HF0 A;  2F5F A;  2PJP A;  4PCQ A;  5D6F A;  1LDD A;  1Z1D A;  4EVI A;  2L02 A;  4S04 A;  2MLG A;  2VE9 A;  3VEP A;  1H0M A;  4KYW A;  4A5M A;  4HDU A;  2PN6 A;  4HV5 A;  1XSX A;  1KYW A;  4FT8 A;  2QBY B;  5E17 F;  2OQG A;  2Q2E A;  3FHZ A;  5DUI A;  3K0L A;  1XMA A;  2ZME A;  4QWQ A;  2FBI A;  1I1G A;  3NEU A;  3TOB A;  1LQ1 A;  3V8K A;  5L3B A;  4TV7 A;  5CVR A;  5LRS A;  3ZMT A;  4HQE A;  1FNN A;  3H3Z A;  3GX4 X;  1FP1 D;  2O61 A;  4UVA A;  1D3Y A;  1MJA A;  2OU2 A;  1D5V A;  2LNB A;  4IRH A;  5D5W B;  2YPR A;  5ICG A;  3WE3 A;  1X3U A;  5FLX Z;  2LF7 A;  2A6E F;  2XAG A;  2JSC A;  4S05 A;  4KA4 A;  5DUK A;  1LDK B;  3R60 A;  4WX9 A;  2LDU A;  1J5Y A;  2VE8 A;  2QLZ A;  1HKT A;  4PDK A;  3PQK A;  4FX0 A;  4HBL A;  2HOE A;  1OR7 A;  2V1D A;  2NAZ A;  2FML A;  1L3L A;  4L9V A;  4NB5 A;  5AIQ A;  1G4D A;  4A12 A;  1IZ1 A;  3G3Z A;  1S8N A;  1H9T A;  3LA2 A;  4G6Q A;  2RNJ A;  5AIP A;  3FM5 A;  4BHP A;  2XKP A;  4G7Z F;  3TO9 A;  4RGX A;  4JQF A;  1KU3 A;  4CYD A;  3F72 A;  2XIG A;  1KQ9 A;  2PMH A;  1T6S A;  5CYV A;  1Z6R A;  2M8E A;  1QBJ A;  2QQB A;  2E7W A;  2L4M A;  1UST A;  3HHH A;  1F1Z A;  3B02 A;  4M72 A;  3LQQ A;  4ZZD A;  2O6G E;  4H0E A;  2GZW A;  5E1W A;  4GXO A;  4YII A;  1T39 A;  2GA2 A;  3V7C A;  3HSF A;  5D8K B;  1TNS A;  2P5K A;  5J8F A;  1XDU A;  1MD0 A;  2CWE A;  2L01 A;  2XGX A;  1HW1 A;  4FX4 A;  2FU4 A;  4CO8 A;  2A69 F;  3IWF A;  2FQ3 A;  5TRD A;  2HGC A;  4XLP F;  5HS7 A;  2W25 A;  5FD5 A;  1G3S A;  4IHS A;  2DTR A;  4RB2 C;  2Q8K A;  1KQ0 A;  1SMY F;  4IJA A;  4KNY A;  4M71 A;  4DNC A;  1K6O A;  3EYI A;  1DUX C;  1LVA A;  2O0Y A;  5H20 A;  1AOY A;  2FSW A;  3RJP A;  1FC3 A;  4HLY A;  5LBQ A;  3O3K A;  1B1B A;  3M9A A;  3RKW A;  2P8T A;  2M87 A;  2ISY A;  3HRS A;  2Z3Y A;  2IJL A;  2ESH A;  2IW5 A;  2WWY A;  3QAH A;  4U0W A;  3CO7 C;  1WSU A;  2GWR A;  4WF2 A;  2EFP A;  2EJR A;  2STT A;  1OMI A;  2OD5 A;  1T38 A;  4LG0 B;  3RDI A;  2EA2 A;  2FOK A;  1GXQ A;  1D8K A;  1U6G A;  2W85 A;  2FEZ A;  1ZG5 A;  2V79 A;  3KZZ A;  2CW0 F;  5LGT A;  2PEX A;  2F5E A;  4M74 A;  2ZNZ A;  1UB9 A;  1B9N A;  3TGN A;  2ACJ A;  2A5Y B;  2XHK A;  4IRG A;  3CDH A;  3HSR A;  4ON0 A;  1MJ9 A;  2JTV A;  1ZYR F;  2A68 F;  3HTU A;  3HTS B;  1G3W A;  2IA2 A;  3HIF A;  4UXN A;  3J81 K;  3VFZ A;  3DXJ F;  2VOD A;  4CHU A;  1G6N A;  3Q9V A;  5D4R A;  1B59 A;  2KKO A;  5IT9 Z;  1T98 A;  3KP5 A;  4G6D A;  3V7R A;  1TQM A;  3OOP A;  2DK5 A;  2YR2 A;  5LEK A;  1UCR A;  1HSJ A;  4BHC A;  1FPQ A;  2EV5 A;  3HSE A;  3LA7 A;  3KEQ A;  5D5X B;  4I09 A;  1SD6 A;  4HX4 A;  3JAM Z;  2W24 A;  3U1D A;  3Q9S A;  4M9X A;  1UFM A;  2ZJ2 A;  2HFH A;  4AIH A;  3KP2 A;  4KIC A;  4HZF A;  2FE3 A;  1SD7 A;  2KIF A;  5BOX A;  5LHH A;  1BBY A;  4N0B A;  1O3R A;  1LJ9 A;  2CFX A;  1EH6 A;  1LB2 A;  2B0L A;  3RI4 A;  1FY7 A;  1YW8 A;  2PFB A;  3GFJ A;  1I5Z A;  5FFX A;  2Z5U A;  3ULQ B;  3HUG A;  1MGT A;  2BYV E;  1J75 A;  4BAY A;  2NNY A;  1R5G A;  3WTY C;  4KIF A;  4WXD A;  2JZY A;  5CJ9 A;  5FO5 A;  2XAJ A;  3IKV A;  3F21 A;  1R1V A;  2NRA C;  1SD5 A;  5E20 A;  1OKR A;  5CVV A;  3VB2 A;  1BI3 A;  4GGG A;  1O7F A;  3J80 Z;  3F23 A;  2EB7 A;  1W7P A;  2GAU A;  2KJB A;  3I5U A;  1K79 A;  2DQR A;  3DPT A;  3QP5 A;  1SFX A;  1EH8 A;  3KFW X;  3HOT A;  2VBW A;  3O6B B;  1K78 B;  3EQL F;  1SD4 A;  1R7J A;  1JE8 A;  4IVN A;  2Y0M A;  2KIM A;  1USS A;  4LLG F;  4IHT A;  2BV6 A;  2DFI A;  3T5X A;  2ZNY A;  3L7W A;  3ZP5 A;  3U9G A;  4MTE A;  3RYR A;  2H27 A;  4MEX F;  5JHU A;  3GZ6 A;  4ZZL A;  2CO5 A;  3ZMZ A;  2P4W A;  3N97 A;  1JXS A;  1UHW A;  3JAM K;  1L0O C;  4U7D A;  4L9N A;  3GFI A;  2Y75 A;  4GCV A;  4MQ9 F;  1P2F A;  4AVP A;  3R6S A;  1DPR A;  2G7U A;  3E6D A;  5L3G A;  1Z9C A;  1W5S A;  3DP7 A;  1IXC A;  2PG4 A;  3KE2 A;  2JRT A;  4KUM A;  1NHA A;  3C1D A;  5IT3 A;  2DK8 A;  1KU2 A;  3LA3 A;  3MZY A;  1PP8 F;  5DCM A;  5DEQ A;  3HYI A;  4HA8 A;  3EUH A;  4UVC A;  3W6K B;  5HLH A;  3DFG A;  4ASN A;  2K7L A;  5BQT A;  3RPU A;  2FA5 A;  2Z9O A;  3WTX C;  2QBY A;  1XCV A;  1O57 A;  3JW4 A;  2L54 A;  2RN7 A;  1RI7 A;  1TW2 A;  1I27 A;  1IRG A;  1R00 A;  2PLY A;  1ON1 A;  1R36 A;  1BN5 A;  2E7X A;  1FT9 A;  3F8F A;  1FOK A;  1O7L A;  4LD5 A;  1ZRC A;  3KZY A;  5CVJ A;  1U5T B;  1FBQ A;  3P7N A;  1BI2 A;  3M8E A;  4IF4 A;  1W7P B;  2OAZ A;  5A2Q Z;  1QNT A;  2AS5 F;  2L4A A;  4KT5 C;  1ZRE A;  1ZAO A;  2WC2 A;  4M73 A;  3GYH X;  5JVT A;  2CQK A;  2COM A;  3RKY A;  4IPA A;  1LDJ A;  2CG4 A;  2O3F A;  2H94 A;  4LK0 F;  3P9C A;  5K1Y A;  4AWX B;  4A0X A;  2RDP A;  2DQL A;  3SXY A;  3ROU A;  3BY6 A;  4WWC A;  4RGR A;  3ZMV A;  1G3T A;  3WOD F;  2F5C A;  4I02 A;  4Q5S F;  2A3S A;  5CVU A;  2HKX A;  4A6D A;  3GVA A;  4YFN F;  4HYE A;  4HF2 A;  1P6R A;  1CGP A;  4EJU A;  2MC3 A;  2K4B A;  2IA0 A;  3GWZ A;  3IL2 A;  3E5Q A;  3WE2 A;  4WCG A;  3ML6 A;  5ED4 A;  1KU7 A;  3P9I A;  1ZAR A;  3L9F A;  2HYF A;  2XRN A;  1T2K A;  4ESF A;  1U8R A;  3K1N A;  2Y48 A;  1BC8 C;  1H9G A;  2RGV A;  2KRF A;  3BJA A;  3IRR A;  3LFK A;  3ZN0 A;  4CZZ A;  1D8J A;  1TBX A;  1B4A A;  3ZMS A;  1P4A A;  3GW2 A;  2YU3 A;  2W84 A;  2P6S A;  2VBX A;  1JGS A;  1YG2 A;  3H3U A;  5FFZ A;  2CGP A;  2Z99 A;  5LLQ A;  1C0W A;  1G3Y A;  5D5V B;  5FGM A;  2O8X A;  3IWZ A;  4L0Z B;  2R3S A;  2NNN A;  3IC7 A;  4BXU A;  1U5T A;  2R7D A;  3E5X A;  2GXB A;  2L3D A;  2VN2 A;  1KGS A;  2GQQ A;  3L09 A;  1U5T C;  5F1R A;  2MLK A;  3K1M A;  2C6Y A;  1FBS A;  3JTH A;  4ZYE A;  1MKM A;  2HZT A;  3W6J B;  3J81 Z;  2EFQ A;  5LHG A;  4OIO F;  3I53 A;  3KLN A;  4LJZ F;  2DPU A;  2WV0 A;  3DV8 A;  3L00 A;  1B6A A;  4CXF A;  3ABT A;  5JI6 A;  1QGP A;  2ZCW A;  5HLI A;  3ERE D;  3E3V A;  1JHF A;  1FSE A;  1TTY A;  1YIO A;  2A61 A;  2X4H A;  5ILU A;  3DPL C;  2E1C A;  2PI0 A;  3V8L A;  4LK1 F;  1LEA A;  2XKO A;  2J5O A;  4LG0 A;  1YYV A;  1T0F A;  3F6V A;  1BOA A;  4QLC U;  4I98 B;  2GXG A;  1ZG3 A;  3QU6 A;  1HST A;  2YX4 A;  3KEO A;  3FWE A;  4R79 A;  5FD6 A;  4GO1 A;  2P7C B;  2H6B A;  4WK8 F;  2DO7 A;  1RIO H;  2IA1 A;  1FBU A;  5J6X A;  1ZN2 A;  4RGS A;  1W5T A;  2KJC A;  3SZP A;  3QPT A;  2F2E A;  1HBX G;  4OIQ F;  4M6X A;  4A0Z A;  3C7J A;  2QYO A;  3I4P A;  2M30 A;  1Z6T A;  3K9T A;  1O3Q A;  2HYG D;  2IVM A;  2P6T A;  4R1H A;  1HQC A;  3WGI A;  1ULY A;  1ODD A;  1HXD A;  4HDV A;  5ILV A;  3CTA A;  3TKY A;  2XVC A;  5BMZ A;  3FX3 A;  5CLS A;  3RKX A;  3TOA A;  2NS0 A;  4N9H A;  3LQR A;  5BS6 A;  1IAW A;  3F8M A;  1GHC A;  2BE5 F;  3CUQ C;  4EV0 A;  2K02 A;  1XDS A;  3SHF A;  2A6H F;  3NRV A;  5ICE A;  3L2C A;  3E6B A;  5DCM B;  3QU3 A;  5FLX K;  3EET A;  2QQA A;  1VTN C;  2FMY A;  4ETS A;  4P96 A;  4KFC A;  4XLN F;  1YFH A;  1E17 A;  2FNA A;  2ADU A;  5HVQ C;  2QUF A;  3HHG A;  5ICC A;  2XRO A;  5LGN A;  1R22 A;  4ENJ A;  4ENM A;  4U88 A;  1IW7 F;  3T8R A;  4D0P A;  1ZLJ A;  4MTD A;  3MEX A;  1E2X A;  1QZY A;  5HS8 A;  3MAJ A;  2H09 A;  2VT3 A;  1KU9 A;  2EFO A;  3R0J A;  4YFX F;  4IRI A;  2VC1 A;  3JSP A;  2NYX A;  4XSX F;  5HOO A;  4NHJ A;  2P5V A;  2OZU A;  1FP2 A;  1JHH A;  3RYP A;  3D0S A;  2EFN A;  3CJN A;  2K27 A;  1B9M A;  1XMK A;  2JPC A;  1SAX A;  3I0T A;  3V7S A;  4YIF A;  3M8F A;  2XAS A;  1BM9 A;  4LFU A;  4OIR F;  1CF7 A;  4UUV A;  2X0L A;  2HTS A;  2UXX A;  2QZ8 A;  1K7A A;  3BPX A;  3GUD A;  3JSO A;  1HW2 A;  2ZXJ A;  2VBZ A;  1XGN A;  1V4R A;  5BPD A;  4Y17 A;  4ESB A;  4WXC A;  3QRF F;  1S6L A;  2HEO A;  4LLN A;  5E1Z B;  3GZ5 A;  1PDN C;  2GIV A;  3FMQ A;  6PAX A;  2UZK A;  4RAY A;  3PFI A;  3DQV C;  4ZYG A;  3MZH A;  2HR3 A;  1WWX A;  3VOD A;  3GEZ A;  1YW9 A;  5J8C A;  3LAJ A;  2G9W A;  3OV8 A;  1WQ2 A;  4KN4 X;  2FBK A;  3R4K A;  4MEY F;  2FBH A;  3FMS A;  3MWM A;  4JK1 X;  2EK5 A;  4EGY A;  2HDC A;  4Y15 A;  2PMU A;  1YW7 A;  2A07 F;  3BJO A;  5L3D A;  2F5D A;  2QM3 A;  3LWF A;  5K5O A;  1F4K A;  1QO0 D;  4OIN F;  3QOP A;  3F6O A;  2P7V B;  3RIR A;  3SFZ A;  1Z05 A;  4ZH4 F;  4HX7 A;  5D8L B;  2LSO A;  4HQM A;  2DBB A;  5D4S A;  1ZH5 A;  4EM2 A;  3CLO A;  4LGW A;  3KP3 A;  5L3F A;  1RUO A;  3R61 A;  1IXS B;  3P9K A;  1GVJ A;  4M9S A;  3VOE A;  2K86 A;  1LEB A;  4P5O A;  5LHI A;  3Q5F A;  2IRF G;  4G94 A;  1IN4 A;  1AWC A;  1O3T A;  4OMY A;  1WRJ A;  4ENN A;  1J59 A;  1P4X A;  1UHM A;  3CUQ A;  3DEU A;  1FYL A;  2JPB A;  4HOB A;  4G7O F;  2M5W A;  3GFM A;  2WTE A;  3K1P A;  5E8G A;  3AAF A;  5K5R A;  3KLO A;  2D1V A;  4UHT A;  3WTS C;  1YQA A;  1QZZ A;  4MGR A;  3F8N A;  3SZT A;  3F22 A;  1F5T A;  3TO7 A;  2VXZ A;  4R8H A;  4EM1 A;  3WG9 A;  1ZRD A;  4I01 A;  1PUE E;  2HWV A;  2H6C A;  1V3F A;  1W7P D;  3K69 A;  3REO A;  2YX7 A;  2Q0O A;  1YLF A;  2TDX A;  4ZYD A;  2FF4 A;  3F8B A;  3R0A A;  4GYI A;  1P92 A;  3ZMD A;  4O5V A;  2ELH A;  1J7K A;  3N4M A;  4XRF A;  4KIG A;  2YSR A;  1DPU A;  2MBF A;  5DD4 A;  5LRR A;  2BEO A;  1FWZ A;  4MHG A;  1HW5 A;  1FX7 A;  5JFR A;  3LAP A;  1A04 A;  1Q1H A;  1MDM B;  1SFU A;  3FF5 A;  3V8J A;  2PBI A;  3U2R A;  2MD5 A;  4RB0 A;  5DD8 A;  2ISZ A;  4L5I A;  5LEJ A;  3EDP A;  1RNL A;  1MDM A;  5JR3 A;  2G7H A;  4KMU X;  2V1U A;  1TNT A;  1HKS A;  1U78 A;  3IHU A;  3ELK A;  4P9U A;  4U0Y A;  5DV5 A;  4P55 A;  1IN6 A;  4CGZ A;  4LLL A;  4OOI A;  1I6X A;  2QWW A;  3HOS A;  2V6C A;  1OPC A; 
#chains in the Genus database with same CATH topology
 5ILS A;  3V4G A;  3OS1 A;  4JBA A;  1UHS A;  2FXA A;  2VT2 A;  4OIP F;  3I58 A;  1ZK8 A;  3CUQ B;  1G8X A;  1ZG1 A;  2JK3 A;  3C18 A;  2O7O A;  3CF2 A;  3IRQ A;  3G73 A;  5FRM A;  3I59 A;  4A3I J;  1FOW A;  1XN7 A;  4W97 A;  4RAZ A;  4G8X A;  1SAU A;  3G1L A;  5ERI A;  3BT9 A;  1WZ2 A;  3S17 J;  4X0G A;  4G9Y A;  4AC0 A;  1JKQ C;  4U7B A;  3HPH A;  2DLL A;  4Y13 A;  2HXI A;  3BZ6 A;  2HQN A;  3I59 B;  4RB3 C;  1HKQ A;  5E79 C;  3K6G A;  3O2P E;  4Q4Z F;  4JOM A;  2K9N A;  1WGX A;  4B8X A;  3K2Z A;  2JT1 A;  2DT5 A;  4F55 A;  2GIZ A;  3FXR A;  4A5N A;  1RZ4 A;  1IN8 A;  3E6M A;  3G2B A;  2RV8 A;  2EBI A;  2RC4 A;  2EA4 A;  3ZMU A;  1X19 A;  4ABZ A;  3WGG A;  2LBF A;  3C2H A;  3TDZ C;  2Y9Z A;  2M45 A;  3GTL J;  3CJT B;  3HOV J;  5EG0 B;  4EQQ A;  1YO5 C;  3ZQ7 A;  4BJ5 C;  4I99 C;  1P7J A;  4I0A A;  1WH5 A;  2K4J A;  3QQA A;  1WKM A;  1J0R A;  2VOP A;  3K2A A;  3OIP A;  1QQI A;  1IRX A;  3SZG A;  5HNF A;  3GTO J;  5F6F A;  4P9F A;  2JUC A;  1ETK A;  4OMZ A;  2V9V A;  4E7Z A;  4W1U A;  2RQQ A;  4JX4 A;  2G0E A;  2AXT C;  3LST A;  1QHG A;  5IYD J;  3KX2 A;  3IKT A;  4A3E J;  4XLE A;  1VI0 A;  5F64 A;  5D5U B;  3E97 A;  3ECH A;  3U1K A;  2ZO4 A;  4BDZ A;  1HC8 A;  2W00 A;  3H35 A;  3B73 A;  2DA3 A;  2HDD A;  5IOY A;  2FJ1 A;  2L5Q A;  4CCK A;  3GTK J;  4O3M A;  3D5R C;  3SJM A;  4BEH A;  3JRF A;  1OYW A;  2VKV A;  4M9Z A;  3FDY A;  4XSZ F;  2HKO A;  3B6A A;  2DPD A;  3KCC A;  4IL6 C;  1IXR C;  1Y8R B;  5CKT A;  1ZHF A;  3NAU A;  4PJ0 C;  1XTA A;  4PZJ A;  2LK2 A;  2QGU A;  1X1P A;  2Y0S A;  4BXF A;  4EM0 B;  3ISP A;  1RES A;  4Z2Y A;  4XK4 A;  1A31 A;  2GA1 A;  2M9H A;  2DJN A;  1Z7U A;  3OYM A;  4XRM A;  4HLX A;  1MNM C;  1I39 A;  1XSD A;  2H8W A;  3CCS I;  1REP C;  3M07 A;  3S2W A;  3BRO A;  1XG1 A;  5AON A;  4NQW B;  5HDN A;  1WJA A;  5JLX A;  4LMY A;  4O6J A;  3BCA A;  3E5U A;  2ME6 A;  1ETO A;  3BR5 A;  3CUO A;  2Z33 A;  4HST A;  2EV6 A;  3BLY A;  1TWF J;  2XV4 S;  4YIR X;  2RAE A;  3CO6 C;  3MD2 A;  2P81 A;  1R6R A;  5DDG A;  3I71 A;  3JRE A;  1WJD A;  1YS6 A;  2OC6 A;  1YIJ I;  1WI9 A;  4CCN A;  1E3O C;  1XSV A;  2PQ8 A;  3VYU B;  2MG4 A;  1PJR A;  3KP7 A;  5EGO A;  4YG2 F;  4CUG A;  1BIB A;  2UXN A;  5L3E A;  2IS2 A;  4PGH A;  2CH0 A;  3HRU A;  2CFO A;  4CYC B;  3OS0 A;  4RB1 A;  2LRD A;  3HC7 A;  4A2U A;  4ENK A;  2OTJ I;  2OQR A;  4HW0 A;  1EH7 A;  2B63 J;  5HLG A;  2WBM A;  3BG7 A;  1AA7 A;  2HTJ A;  3BG3 A;  4XKW A;  4RGU A;  3OYK A;  2V7F A;  4GYG A;  2HNH A;  1A36 A;  2DAO A;  5E8I A;  1NH3 A;  2LY1 A;  3C3W A;  1S7O A;  4G7H F;  2R7Q A;  2V1X A;  3IH3 A;  1ON2 A;  2F5V A;  3TED A;  2LOO A;  3JRA A;  1H8A C;  1SVL A;  3ZPL A;  2DXI A;  5IT9 K;  1TW3 A;  2MW8 A;  3BC8 A;  4NC8 A;  3JR9 A;  2DA5 A;  4X1E A;  1CF7 B;  3WGH A;  3JCU C;  3KIO A;  3MFK A;  3DKW A;  3FMR A;  2VOO A;  2HQR A;  2M7B A;  5E18 F;  2AHQ A;  4I7H A;  1IN7 A;  3WTZ A;  3J80 K;  2E60 A;  2F6C A;  4HNV A;  4UUS B;  1NK2 P;  2HS5 A;  3PQJ A;  2WV1 A;  2RQP A;  4LB6 B;  1FSH A;  1WJE A;  4L0Y B;  2DFH A;  4P1W A;  2QQ8 A;  3F8C A;  5FKL A;  4ZTF A;  1FLI A;  5IYC J;  1R1T A;  4I0B A;  4WXH A;  4YFK F;  4HV6 A;  3QYF A;  1ETW A;  5EEH A;  2VQH A;  3PFY A;  3KET A;  2XAQ A;  2RRE A;  3FXU A;  1VF9 A;  2P0W A;  4PGG A;  3TQN A;  4XBF A;  1OCO H;  3D5S C;  3BDD A;  2STW A;  4F7Z A;  2CSO A;  1JT6 A;  4BBS J;  1FYM A;  1HDD C;  1MMG A;  4BAC A;  3GFL A;  5FB2 A;  1XPX A;  4EMS A;  1LNW A;  2ZME B;  2VL8 A;  2VON A;  5GAG J;  3SEQ A;  4CCJ A;  4L9T A;  2EZH A;  1KQ8 A;  4PSW A;  4BXX J;  1KYZ A;  1WPK A;  3RPQ A;  3WU1 B;  4M6Y A;  3GTQ J;  1X1B A;  1RRJ A;  3EUH C;  3ZN1 A;  2GOX B;  2DU9 A;  4RLQ A;  1XB4 A;  4ZYH A;  1U8B A;  1U3E M;  4L18 B;  5DYM A;  2EWN A;  4DQ2 A;  1QRY A;  4ESJ A;  2NVX J;  3LSH A;  3HOU J;  4UY8 I;  1F9N A;  3PIO F;  2DMU A;  3H92 A;  2IS4 A;  3TO6 A;  3G1O A;  3IUO A;  3OWT A;  4IXA A;  2ID6 A;  4IEJ A;  1YS7 A;  2ZBK A;  3D5L A;  2CYY A;  1SFE A;  1TZL A;  5TJJ A;  4DBQ A;  4OU0 A;  5CQE A;  2M1B A;  4F92 B;  5LGU A;  2R0Q C;  3FXQ A;  5KVR A;  1B72 B;  2IP2 A;  2QVO A;  3HRM A;  4AD9 A;  1BI1 A;  1P4W A;  2ME0 A;  4HF1 A;  4BHB A;  2VI6 A;  4MQV A;  1O3S A;  2WAQ N;  1MBK A;  4IHW A;  1BR4 A;  3MQ0 A;  3TP3 A;  1WJB A;  1ZGJ A;  3FZV A;  4NQW A;  5H6Q A;  1BJA A;  1BIA A;  4KMF A;  4HX8 A;  2MD0 A;  3M7G A;  4BY1 J;  1IGN A;  5B5E C;  1W0U A;  1JKP C;  2OBP A;  2IT0 A;  3SDG A;  3PL8 A;  4LIU A;  2BY1 A;  1FYK A;  4U0V A;  1ZLK A;  2L9V A;  1SMT A;  1MJB A;  1BI0 A;  2LF8 A;  4XN0 A;  4A0Y A;  1WCM J;  1IN5 A;  4XLH A;  4F52 A;  5IP6 A;  1DDN A;  1Z21 A;  2ESN A;  4I2O A;  4N9I A;  3ABU A;  1ACI A;  1W4M A;  1J9I A;  1S7A A;  2XGC A;  5CVI A;  2FNP A;  4EJV A;  1RPW A;  1ZGA A;  3EYY A;  4EAT A;  1QPM A;  1U0J A;  1R1U A;  1Z91 A;  1GXP A;  4EJW A;  3GXO A;  4AIK A;  4UNO A;  3S32 A;  4IHX A;  2RVC A;  1EA3 A;  3DLL F;  3KP4 A;  4K2E A;  4KN7 X;  3COA C;  3E6C C;  4BQA A;  3M8J A;  1V5E A;  3TDU C;  5A2Q K;  2HXO A;  2F48 A;  4YEL A;  5E1X A;  2L7F P;  2Z16 A;  2DYS H;  4CIC A;  3A4C A;  1S7E A;  2VQG A;  3RTR A;  1ETQ A;  4KIB A;  4CCO A;  2VUM J;  3RKQ A;  1VQP I;  1FJL A;  4DJA A;  4UV8 A;  4UV9 A;  2D1H A;  4UVB A;  4EJT A;  3KP6 A;  1OYY A;  3BP8 A;  2PMZ N;  2V4J C;  3K4M A;  5K7F A;  4OAY A;  2Y31 A;  1S3J A;  2EH3 A;  2FRH A;  1YRN A;  1R58 A;  4XKB A;  3OL4 A;  5ICF A;  2WY7 Q;  3QOE A;  4RDU A;  2ZKZ A;  3HDD A;  4MNU A;  3NQO A;  1IRF A;  2EV0 A;  3CCY A;  1WH7 A;  1DP3 A;  3WU0 A;  1OCP A;  1V5G A;  3AL0 B;  1N25 A;  1W5C C;  1MBF A;  3TMO A;  4E6K G;  3DPU A;  1X1C A;  4BH9 A;  2WAD A;  3H0G J;  2LLK A;  2BBY A;  1VQ9 I;  2LKS A;  3ABL H;  5M3M J;  4Q47 A;  3M1E A;  3L2Q A;  4EEF G;  2EZK A;  2O03 A;  4M3B A;  1PVE A;  4XIC A;  3HXL A;  2HOS A;  2EFW A;  3ERM A;  1TQI A;  2DI3 A;  2FD5 A;  3HB9 A;  1D1A A;  1BJZ A;  2XGD A;  4CH7 A;  2LP0 A;  1DP7 P;  1M1E B;  2EIM H;  1TQP A;  1WI3 A;  3QPL A;  1AHD P;  3OSF A;  3X2Q H;  3DWL E;  2QSH X;  3A03 A;  3FM3 A;  3QPH A;  1I1S A;  4IO9 F;  1KA8 A;  4E7J A;  2E1M B;  3PNV A;  4QPQ A;  4BYY A;  3F3X A;  5GPA A;  5TIS C;  4G12 A;  3DF8 A;  3CLQ A;  3BTI A;  3WTW C;  4L9J A;  3GO5 A;  5BPI A;  4FHT A;  3S1Q J;  3FBI B;  3QP6 A;  2XUB A;  4NC7 A;  2VBY A;  2DT7 B;  2GM4 A;  4A6E A;  4LB5 A;  1R5H A;  1TLH B;  3RSN A;  5DCF A;  4E4H A;  4N4O B;  5E3O A;  4Q48 A;  5FRO A;  2JA7 J;  2R7F A;  2LRE A;  5D6E A;  5EEG A;  5GTI C;  3WTT C;  1RC9 A;  3GTM J;  4DYC A;  1R23 A;  3S1M J;  3CP2 A;  2VC0 A;  1J2X A;  2BHY A;  1OR7 C;  3WHB A;  4PFO A;  2DW4 A;  1MMN A;  3HKZ A;  5HDK A;  2HU9 A;  2J5P A;  1GT0 C;  1A6Q A;  2IPQ X;  2CQX A;  3T8T A;  2E1N A;  2Q2E B;  4E70 A;  3WTU C;  4EGZ A;  1X2N A;  1JKO C;  3WTV C;  2AXL A;  1BC7 C;  2R7O A;  4HAM A;  3SQN A;  3W2V A;  3DTE A;  1OJL A;  1XGO A;  1D1B A;  1I3A A;  5B1B H;  2MA3 A;  3JRH A;  4C2T A;  1YJW I;  1W36 D;  1JTY A;  1XGS A;  4AIJ A;  2UWM A;  3DKY A;  1YTY A;  3T1B A;  2JRM A;  1TWA J;  5H6R A;  4FQG A;  2X6Y A;  5B66 C;  1MIJ A;  5H2F C;  4EJO A;  3JTG A;  1K78 A;  4ZDP A;  1CQT A;  1XD7 A;  1IJW C;  4BU2 A;  2W57 A;  1IF1 A;  1XGM A;  1GLN A;  4HNU A;  5E3M A;  2DOA A;  4JYK A;  2VJI A;  3CZ6 A;  1IV8 A;  4RS8 A;  3HRT A;  3BJ6 A;  3J7A O;  5DS9 A;  1LVK A;  3GF2 A;  5J47 A;  5HS9 A;  1Y0U A;  2OA4 A;  5KK1 A;  1X1D A;  3DEE A;  2XAH A;  4A3J J;  2D2W A;  2Y30 A;  1EV7 A;  2ZFW A;  1PP7 U;  5K5Q A;  1JGG A;  2A6T A;  1OYI A;  2OPT A;  2XB0 X;  3ECO A;  5HDG A;  1FIP A;  2D45 A;  2HOA A;  4L5J A;  4AUX A;  2ZFU A;  1ONV A;  5BNG A;  2MH2 A;  3CCU I;  4B3A A;  2VLA A;  2ELJ A;  3MCZ A;  2QQ9 A;  2K5C A;  1FZP B;  4CDG A;  1V55 H;  1XCB A;  5FJ8 J;  2BGC A;  3JRD A;  5L3C A;  1S29 A;  3BOQ A;  4NC6 A;  1VFC A;  4XKC A;  1R71 A;  1Z3Y A;  1ZRF A;  2KZG A;  3A02 A;  3GLX A;  3I64 A;  1IUY A;  3I54 A;  3OYG A;  2QSF X;  2CV0 A;  2PMZ A;  1LFP A;  2L9S A;  1YRN B;  3BPV A;  1STZ A;  4BNC A;  2EPF A;  3T0Y A;  2QEN A;  2KIU A;  2LKP A;  2XAF A;  5KAI C;  1E3P A;  3DTK A;  2P5L C;  1U2W A;  3I55 I;  4KDP A;  5FLV A;  2CS3 A;  3BWG A;  3PUB A;  1ETY A;  3AG1 H;  3BTJ A;  1DU0 A;  2MH9 A;  4B09 A;  2OZ6 A;  2XF7 A;  1RUN A;  2K9L A;  2ETH A;  1MZB A;  2RKH A;  2YU9 J;  4HF0 A;  5IP7 J;  2F5F A;  3K4C A;  4F93 B;  3K4K A;  2DA1 A;  3B6C A;  1WJC A;  2PJP A;  2NOG A;  4A3L J;  1JI8 A;  4PCQ A;  5D6F A;  1QPI A;  1LDD A;  1Z1D A;  4EVI A;  2L02 A;  4S04 A;  2VXD A;  2MLG A;  2VE9 A;  3VEP A;  1H0M A;  2KRC A;  4KYW A;  4XQF A;  4A5M A;  4HDU A;  1R9T J;  2PN6 A;  1NTC A;  4HV5 A;  1XSX A;  1KYW A;  2L7M P;  4FT8 A;  2QBY B;  5E17 F;  4XID A;  2R92 J;  3H5R A;  3OY9 A;  3CQZ J;  5KAF C;  1LKX A;  3QYB A;  2YUS A;  2OQG A;  2Q2E A;  2HVR A;  3WU2 C;  3PUF A;  3PIP F;  4B48 A;  2DMQ A;  3A0B C;  5DUI A;  3FHZ A;  3K0L A;  2L9N A;  1TC3 C;  3S1N J;  1VND A;  1XMA A;  2ZME A;  4QWQ A;  2XC7 A;  2FBI A;  1I1G A;  2DTZ A;  2CW8 A;  1Z3X A;  3NEU A;  3TOB A;  1LQ1 A;  3KZI C;  3V8K A;  5F0F A;  5JLW A;  2XAU A;  3VSL A;  5L3B A;  4TV7 A;  5CVR A;  5LRS A;  1OFC X;  3ZMT A;  3ESW B;  4HQE A;  4FTH A;  2DYR H;  3K4B A;  1FNN A;  3H3Z A;  1VQN I;  3GX4 X;  2E5N A;  1FP1 D;  2HYJ A;  3G4S I;  3HPG A;  2O61 A;  4BQN A;  1O4X A;  2DDA A;  3E0J B;  4UVA A;  1D3Y A;  1MJA A;  2X6X A;  2OU2 A;  1D5V A;  2LNB A;  4YRV A;  1MBH A;  3MN2 A;  4IRH A;  5C3E J;  3L2U A;  3D1N I;  5K7H A;  2W1O A;  4FAS D;  5D5W B;  2YPR A;  1S72 I;  5ICG A;  3WE3 A;  3CES A;  1MH3 A;  1YIT I;  2V9K A;  4C30 A;  1X3U A;  5FLX Z;  2LF7 A;  3ZQI A;  1WVR A;  2A6E F;  2DA2 A;  2XAG A;  4J01 A;  3HOW J;  3S14 J;  3QOD A;  4A3F J;  2JSC A;  3BR6 A;  1Y6I A;  4S05 A;  4KA4 A;  5DUK A;  1LDK B;  3SDB A;  3R60 A;  4WX9 A;  3W2A A;  2LDU A;  1EKE A;  1J5Y A;  1K6Y A;  3EUK L;  4DGW B;  5HNH A;  1ZR4 A;  2VE8 A;  2DN0 A;  2QLZ A;  1HKT A;  2Y69 H;  4PDK A;  3OYE A;  1XS9 A;  2K40 A;  3PQK A;  4FX0 A;  4HBL A;  3GTP J;  2HOE A;  4PUS A;  2GLO A;  2X85 A;  2BOL A;  2CRG A;  1OR7 A;  2V1D A;  2NAZ A;  2BY0 A;  2FML A;  2DT6 A;  1L3L A;  4XOT A;  4L9V A;  4NB5 A;  1B72 A;  5AIQ A;  1G4D A;  4A12 A;  1B8I A;  1PUF B;  1IZ1 A;  3G3Z A;  2IS1 A;  3ZR8 X;  1S8N A;  1H9T A;  2H1K A;  3LA2 A;  4G6Q A;  1Z77 A;  5EYR A;  2RNJ A;  1YOV B;  2AQE A;  5AIP A;  1IO2 A;  4A69 C;  1Y1V J;  3FM5 A;  1EJ9 A;  1GUU A;  4BHP A;  1HDP A;  3PO3 J;  2XKP A;  4G7Z F;  3TO9 A;  4RGX A;  3OSG A;  4JQF A;  2WY8 Q;  5JVG F;  1KU3 A;  1DGW Y;  4PK4 A;  2M34 A;  5EZH A;  4CYD A;  4A3M J;  3F72 A;  4IHV A;  4CZC A;  2XIG A;  1KQ9 A;  2PMH A;  1T6S A;  2HQA A;  5CYV A;  1Z6R A;  2M8E A;  3HGY A;  1QBJ A;  2QQB A;  2E7W A;  1FMV A;  2L4M A;  1UST A;  3HHH A;  3H5N A;  1F1Z A;  3B02 A;  4M72 A;  3LQQ A;  5C44 J;  3OIQ A;  1QHH D;  4ZZD A;  2O6G E;  4H0E A;  3A01 A;  4B44 A;  3H3V K;  5FKN A;  2GZW A;  5E1W A;  2PX9 A;  2K9S A;  5FRN A;  4GXO A;  2M8G X;  4YII A;  1T39 A;  4AVZ A;  5FKO A;  3MKY B;  2GA2 A;  3V7C A;  3HSF A;  1MSF C;  2EIJ H;  5D8K B;  4BE2 A;  1TNS A;  2EIN H;  2P5K A;  3FK7 A;  1XDU A;  5J8F A;  1MD0 A;  2CWE A;  2L01 A;  2XGX A;  2Y0S N;  4RBO A;  1IC8 A;  1HW1 A;  3CC2 I;  4FX4 A;  1APL C;  2FU4 A;  2NVU B;  2XSJ C;  4CO8 A;  1G2H A;  2A69 F;  3IWF A;  2FQ3 A;  5TRD A;  2CV1 A;  2QSG X;  4BQQ A;  4M3E A;  2HGC A;  2DA6 A;  1JKR C;  4XLP F;  2HVS A;  1WFX A;  3S1R J;  5HS7 A;  2W25 A;  2ID3 A;  2OTL I;  5FD5 A;  3PNY A;  2E35 A;  4S0H B;  1G3S A;  3LNQ A;  4IHS A;  2GBY A;  3KPH A;  3OYN A;  2DTR A;  2JMW A;  2R4G A;  1X1A A;  3MKL A;  4RB2 C;  1YX5 A;  2Q8K A;  1KQ0 A;  2TCT A;  1SMY F;  2DFE A;  4IJA A;  4KNY A;  4M71 A;  3OYD A;  2M0C A;  2JWT A;  4DNC A;  1AKH A;  3BR1 A;  1TP4 A;  1K6O A;  3EYI A;  1D0Z A;  5GAH J;  5M5X J;  2E2I J;  1DUX C;  1P7I A;  1LVA A;  2O0Y A;  5H20 A;  1AOY A;  3OYA A;  2FSW A;  2X6O A;  3RJP A;  4CCL A;  1FC3 A;  2H8R A;  2XRL A;  5EF6 A;  4XNF A;  4HLY A;  1LFB A;  3CMA I;  3DEW A;  5LBQ A;  1IDZ A;  1GV5 A;  3O3K A;  2PJR B;  1JUP A;  1B1B A;  1FOX A;  3M9A A;  3RKW A;  2P8T A;  2M87 A;  3K70 C;  2ISY A;  3HRS A;  1PUF A;  2KZV A;  2Z3Y A;  3UNG C;  2GXA A;  2ZME C;  2IJL A;  2OJE D;  2ESH A;  2IW5 A;  2K85 A;  2WWY A;  3QAH A;  4U0W A;  4DZP A;  1N78 A;  2DFF A;  3CO7 C;  1WSU A;  3WHC A;  3OYI A;  2GWR A;  5J3L A;  3TW6 A;  4WF2 A;  2COB A;  4HSR A;  1MH4 A;  1TT5 B;  2EFP A;  2EJR A;  3HUG B;  1R49 A;  5B3S H;  2STT A;  1OMI A;  2R7T A;  2UUZ A;  1DGR M;  2OCE A;  2OD5 A;  1T38 A;  5EGO B;  4KJZ A;  2CV2 A;  3RQI A;  4LG0 B;  3DBR B;  3RDI A;  2EA2 A;  2FOK A;  3F0C A;  1U9O A;  5EZG A;  1K4T A;  2R5Y B;  1GXQ A;  2VIX A;  1D8K A;  1U6G A;  2W85 A;  5GTH C;  3SFI A;  2FEZ A;  1Q1V A;  1ZG5 A;  2V79 A;  3KZZ A;  1B8I B;  2CW0 F;  5LGT A;  2ZSH B;  2F4M B;  4XR6 A;  1SVO A;  2PEX A;  2F5E A;  2M0M A;  1LE8 A;  4M74 A;  2ZNZ A;  4BKX A;  1UB9 A;  1B9N A;  5LFA A;  3TGN A;  5FLM J;  3HEF A;  2XPV A;  2ACJ A;  2A5Y B;  2XHK A;  4IRG A;  4IKF A;  3CDH A;  5KCM A;  1K83 J;  3OYB A;  3HSR A;  2MSY A;  1W0T A;  3TP0 A;  3BG6 A;  2R7R A;  4ON0 A;  1MJ9 A;  3S3M A;  2JTV A;  1KON A;  3NAR A;  1ZYR F;  5F0C A;  3VSK A;  4J19 A;  2A68 F;  3HTU A;  4A3B J;  3HTS B;  2LH9 A;  2X1C A;  2CJJ A;  2VKH A;  3KYD B;  2VJJ A;  1G3W A;  2IA2 A;  2QF7 A;  3HIF A;  4UXN A;  2K3F A;  2FX0 A;  3J81 K;  2XF6 A;  3U21 A;  2IGK A;  3VFZ A;  3S8P A;  3DXJ F;  2B9S A;  3DBH B;  3H1C A;  2VOD A;  4CHU A;  3EUA A;  3FXJ A;  1G6N A;  2Y2Z A;  3Q9V A;  5D4R A;  1B59 A;  1MW7 A;  2KKO A;  5IT9 Z;  1T98 A;  1FIA A;  2KDO A;  1D5Y A;  3KP5 A;  2LFB A;  1MMD A;  4G6D A;  3FK6 A;  3V7R A;  1TQM A;  3OOP A;  2DK5 A;  2YR2 A;  1AKH B;  2DMN A;  2M3A A;  5LEK A;  2KPM A;  1UCR A;  1WJ5 A;  1HSJ A;  4BHC A;  1Y39 A;  1FPQ A;  1TWC J;  2EV5 A;  1MBJ A;  3HSE A;  3W6V A;  2LBF B;  1BR2 A;  3LA7 A;  3KEQ A;  2DOF A;  5D5X B;  1DQU A;  4I09 A;  1SD6 A;  2AO9 A;  4NNJ A;  1Z7L A;  4ZJZ A;  2DJI A;  3S2D J;  2E19 A;  4HX4 A;  3JAM Z;  2W24 A;  3U1D A;  1HF0 A;  3OYC A;  2WAQ A;  3Q9S A;  4M9X A;  2MC4 A;  2X9D A;  4DIQ A;  1UFM A;  2ZJ2 A;  2HFH A;  5M5W J;  4AIH A;  3KP2 A;  1X2M A;  4KIC A;  4HZF A;  2FE3 A;  3J7Z I;  1QVT A;  1ETV A;  1SD7 A;  2KIF A;  5BOX A;  4A3C J;  1R4M B;  3AG3 H;  2K9M A;  5LHH A;  2L9R A;  1BBY A;  2KIS A;  3FHN A;  4N0B A;  1O3R A;  1GVD A;  3HKZ N;  1P9Q C;  1LJ9 A;  2CFX A;  3OYJ A;  3RZD J;  1EH6 A;  3DU6 A;  1LB2 A;  1K61 A;  2O8K A;  3GLL A;  2LD5 A;  1POG A;  1LPQ A;  3CJR B;  2B0L A;  1T8I A;  3RI4 A;  1FY7 A;  1YW8 A;  4OWR B;  2EQR A;  2PFB A;  2R5Y A;  3GFJ A;  4XRS G;  4G6T B;  1I5Z A;  3V42 A;  2E1M C;  2FOW A;  5FFX A;  1HCR A;  5LD2 C;  4D7M A;  3IAM 2;  2Z5U A;  1OCR H;  3RPU D;  3A0H C;  3MKZ A;  3MKW B;  3ULQ B;  2M7A A;  1Y56 A;  4NUB A;  3HUG A;  1JJ8 C;  3ASN H;  2JN6 A;  2NS8 A;  4L5E A;  1MGT A;  2BYV E;  1J75 A;  1X4O A;  4BAY A;  2NNY A;  1MND A;  2FUG 2;  1R5G A;  2E34 A;  3WTY C;  2CQQ A;  4XM3 A;  4KIF A;  3OS2 A;  4RM3 A;  4WXD A;  5GAD J;  2JZY A;  1JT0 A;  2L7Z A;  3CDL A;  5CJ9 A;  5FO5 A;  2XAJ A;  3IKV A;  3F21 A;  3IV5 A;  3OR2 C;  3ZRG A;  1R1V A;  1SC7 A;  3A1Y A;  1FTT A;  2NRA C;  4HEA 2;  1SD5 A;  5E20 A;  3M3Y J;  2DDB A;  1OKR A;  1NG6 A;  5CVV A;  3VB2 A;  1BI3 A;  4CYC A;  4GGG A;  1O7F A;  4RA2 A;  4Y7N J;  3JRI A;  3J80 Z;  3F23 A;  2EB7 A;  1W7P A;  1HA8 A;  2BW3 A;  2GAU A;  2KJB A;  3I5U A;  1K79 A;  2DQR A;  3DPT A;  2HPI A;  3GCM A;  1SFX A;  3QP5 A;  1EH8 A;  3GBG A;  3KFW X;  3HOT A;  4XOP A;  2DCE A;  2VBW A;  3O6B B;  3BQY A;  3IP4 B;  3VDX A;  2LVS A;  1VQ8 I;  1QA6 A;  2X6W A;  2BW3 B;  4ZYA A;  1UG2 A;  2IGM A;  3UR3 C;  3I3L A;  3CD6 I;  1K78 B;  3EQL F;  1SD4 A;  1R7J A;  1JE8 A;  3MZ8 A;  3TL4 X;  4IVN A;  4BQO A;  2Y0M A;  3BCB A;  2KIM A;  1USS A;  4NBQ A;  4OAZ A;  4LLG F;  2BV6 A;  2DFI A;  4XLC A;  3T5X A;  4IHT A;  2ZNY A;  2NS7 A;  4XON A;  3L7W A;  3FBN B;  5C4J J;  3ZP5 A;  3U9G A;  4MTE A;  5HLT A;  3RYR A;  2H27 A;  4MEX F;  2WB1 N;  3OYL A;  4DBR A;  5JHU A;  1NG7 A;  3GZ6 A;  4A3G J;  4DZJ A;  4ZZL A;  3ZCO A;  5B1A H;  4D5F A;  2CO5 A;  1FTZ A;  2WA0 A;  3ZMZ A;  2P4W A;  5DM6 F;  3N97 A;  1JXS A;  1UHW A;  3JAM K;  2QEX I;  4XL9 A;  2I5U A;  4Z6Y A;  1L0O C;  4U7D A;  4HPQ A;  3Q3S A;  5J1Y A;  4L9N A;  5E3L A;  3GFI A;  2Y75 A;  4GCV A;  4MQ9 F;  1P2F A;  1UZC A;  2X48 A;  3R6S A;  4AVP A;  1DPR A;  2G7U A;  3E6D A;  3DTI A;  5EG0 A;  4IHY A;  4CA0 A;  5L3G A;  1FMW A;  1Z9C A;  1W5S A;  2V9P A;  3DP7 A;  4U87 A;  1ZGW A;  3E7L A;  2D5V A;  1IXC A;  2PG4 A;  3KE2 A;  4A3D J;  2JRT A;  1QU3 A;  4KUM A;  2LMD A;  2ZJR F;  1NHA A;  3C1D A;  5GP9 A;  1LUJ B;  1X4P A;  5K7Z A;  2MAB A;  5IT3 A;  1KU2 A;  2DK8 A;  3LA3 A;  3MZY A;  1D1C A;  5DCM A;  5DEQ A;  5E3N A;  1PP8 F;  3HYI A;  4HA8 A;  3JRG A;  3EUH A;  4UVC A;  4XN3 A;  3W6K B;  3DFG A;  5HLH A;  4ASN A;  2K7L A;  2CUJ A;  4M6V A;  3AL0 C;  5BQT A;  1KZH A;  3RPU A;  4BY7 J;  2Z2S B;  2FA5 A;  3FKJ A;  2Z9O A;  1UJ8 A;  2QA4 I;  3WTX C;  2QBY A;  1XCV A;  1OLT A;  1O57 A;  2H1L A;  3K10 A;  4PJJ A;  2JA6 J;  3JW4 A;  4IOA F;  2L54 A;  1F43 A;  2RN7 A;  3CC7 I;  1RI7 A;  1TW2 A;  2LY2 A;  3KYL A;  1I27 A;  2JA2 A;  2IXS A;  1SAN A;  1IRG A;  1BW5 A;  2KL4 A;  3ZQH A;  1R00 A;  2PLY A;  3ZQC A;  2R7V A;  1ON1 A;  1R36 A;  1SEU A;  1BN5 A;  2E7X A;  1FT9 A;  3F8F A;  4RMN A;  1FOK A;  1O7L A;  4LD5 A;  4M3G A;  3I4N J;  2KMU A;  5CPR B;  9ANT A;  4Y33 A;  1ZRC A;  4HRI A;  3KZY A;  1Y8Q B;  1D0X A;  5CVJ A;  4AU7 A;  2DMP A;  1ORK A;  1U5T B;  1FBQ A;  3P7N A;  3DKX A;  1BI2 A;  1UMQ A;  3M8E A;  4ZDL A;  3CCQ I;  4IF4 A;  3OIO A;  1W7P B;  2Z1D A;  2OAZ A;  5A2Q Z;  4AM3 A;  4AYB A;  1QNT A;  2AS5 F;  5J4V A;  2LTP A;  1TWG J;  2L4A A;  4KT5 C;  5J1R A;  1ZAO A;  2WC2 A;  4M73 A;  1ZRE A;  3GYH X;  2L7K A;  5JVT A;  1N75 A;  2CQK A;  4QPO A;  4ANJ A;  4DYR A;  2COM A;  3RKY A;  4IPA A;  1LDJ A;  1PYV A;  2CG4 A;  3BR3 A;  2O3F A;  3JRC A;  1GDT A;  3AG2 H;  2H94 A;  3H9Q A;  4LOC A;  3PNT A;  4LK0 F;  2W4S A;  3P9C A;  5K1Y A;  1YHQ I;  4AWX B;  4LIV A;  4A0X A;  2Q1Z B;  1QVU A;  2RDP A;  2A5W A;  1RKT A;  2DQL A;  3SXY A;  4ZDO A;  1EF4 A;  3ROU A;  3BY6 A;  2NVQ J;  4WWC A;  4RGR A;  3H0D A;  3ZMV A;  2F4I A;  2XF5 A;  3M4O J;  1G3T A;  3WOD F;  1BR1 A;  3LSK A;  2F5C A;  4X6A J;  4I02 A;  2E36 A;  2A3S A;  1IG7 A;  5DTD A;  4Q5S F;  4C2M J;  5CVU A;  2HKX A;  3HZJ A;  2XSD C;  4A6D A;  4XLF A;  3GVA A;  3DBL B;  4YFN F;  4HYE A;  4QTR A;  3L2V A;  4HF2 A;  1P6R A;  3ABM H;  1WHU A;  4XRS A;  2ZXH A;  4DOZ A;  2DOD A;  2VQL A;  1CGP A;  4EJU A;  2MC3 A;  1VQO I;  2K4B A;  3H9G A;  2LG4 A;  2XB5 A;  3F9K A;  2IA0 A;  4F91 B;  3GWZ A;  4BJ6 C;  5F1J A;  3IL2 A;  3HOZ J;  3E5Q A;  3WE2 A;  2IBD A;  4WCG A;  1TWH J;  4B4C A;  2L2O A;  3MVP A;  3DLA A;  3ML6 A;  1ETX A;  4XLA A;  5ED4 A;  3K4J A;  1KU7 A;  3P9I A;  3ZQF A;  3RZO J;  1ZAR A;  3AKZ A;  2JSP A;  2EIK H;  3L9F A;  2HYF A;  2X51 A;  2XRN A;  1T2K A;  3UKG A;  2A05 A;  2OV7 A;  4ESF A;  2OF7 A;  1U8R A;  3K1N A;  3CCJ I;  2KHM A;  2Y48 A;  5F04 A;  3OOU A;  4BEH B;  5J1U A;  1BC8 C;  1H9G A;  2RGV A;  2KRF A;  2VPR A;  4KIT B;  4JP0 A;  2IGN A;  2R7W A;  3BJA A;  2VAS A;  3IRR A;  2WB1 A;  3IAS 2;  3Q0U A;  1DU6 A;  3LFK A;  3ZN0 A;  4CZZ A;  1SVM A;  2K9Q A;  1D8J A;  1IDY A;  3W2W A;  3JRB A;  5F27 A;  2ELK A;  2KDZ A;  1TBX A;  1B4A A;  4HNT A;  3ZMS A;  3BTL A;  3GW2 A;  1P4A A;  2VKD A;  1U9N A;  3KYC B;  4PJN A;  3HL2 A;  2YU3 A;  4XOR A;  3PSF A;  2W84 A;  2P6S A;  2VBX A;  1JGS A;  1YG2 A;  3H3U A;  2QKM B;  2IS6 A;  5FFZ A;  2CGP A;  1XX5 A;  2ZSI B;  2Z99 A;  3S93 A;  5LLQ A;  1C0W A;  1G3Y A;  5D5V B;  3LL7 A;  3QYE A;  3OYH A;  2EIL H;  3FXL A;  5FGM A;  3VYR B;  3K70 D;  2O8X A;  2R7Z J;  2CQN A;  1OCZ H;  3IWZ A;  4V2F A;  3CF5 F;  5M3F J;  3VWB A;  4L0Z B;  4RLF A;  2R3S A;  1Z0X A;  2NNN A;  3IC7 A;  2LKX A;  4B43 A;  3AG4 H;  1JJ6 C;  1RR7 A;  2AQF A;  4BXU A;  1VQ5 I;  1U5T A;  2R7D A;  2X1D A;  3BR2 A;  3E5X A;  2GXB A;  2L3D A;  2VN2 A;  1KGS A;  2GQQ A;  3L09 A;  1NK3 P;  2DOE A;  1U5T C;  2HOT A;  3OR1 C;  5F1R A;  3O8H A;  1VQK I;  2BVL A;  2MLK A;  3K1M A;  2C6Y A;  3CCR I;  4I6Z A;  1FBS A;  3JTH A;  4UB6 C;  4ZYE A;  4V19 K;  3I4M J;  4FCY A;  1ZQ3 P;  4BE1 A;  1MKM A;  2HZT A;  3W6J B;  1QZE A;  3BG5 A;  3J81 Z;  3OMY A;  2JVG A;  2EFQ A;  5LHG A;  3KEY A;  3S3O A;  4OIO F;  5IY5 H;  3I53 A;  3KLN A;  4LJZ F;  2DPU A;  1YX3 A;  2NOJ B;  2WV0 A;  3DV8 A;  1T56 A;  4PJL A;  5J40 A;  3L00 A;  3SEZ A;  1ERD A;  1B6A A;  4CXF A;  4D5C A;  3ABT A;  5JI6 A;  1QGP A;  3L1P A;  2ZCW A;  2LYC A;  4JX6 A;  3ZOB A;  4PJM A;  3K7A J;  1T08 B;  1W36 C;  4FE4 A;  5HLI A;  1UEL B;  5GAE J;  3E3V A;  4NDL A;  3ERE D;  1ITY A;  1JHF A;  1FSE A;  1TTY A;  1YIO A;  2A61 A;  4DW6 A;  2X4H A;  5ILU A;  4E7H A;  3DPL C;  2E1C A;  2I8D A;  2PI0 A;  4PSX A;  3V8L A;  2GOM A;  4LK1 F;  3ZGK A;  3BZK A;  1TL8 A;  1LEA A;  2XKO A;  5EEA A;  2J5O A;  4LG0 A;  1YYV A;  2DA4 A;  2M4K A;  1T0F A;  3ASO H;  3F6V A;  2E2H J;  1BOA A;  4QLC U;  4E7S A;  2VJ4 A;  3RCO A;  3GTG J;  4I98 B;  2GXG A;  1ZG3 A;  3QU6 A;  3S3N A;  1HST A;  2YX4 A;  3KEO A;  3NWS A;  2EZL A;  1R5I D;  2M4G A;  1LE8 B;  2CW7 A;  3FWE A;  1N77 A;  2BY3 A;  3ZQG A;  4R79 A;  4FET A;  4YEJ A;  2WAF A;  1MMS A;  5FD6 A;  4GO1 A;  4UB8 C;  4UUT A;  3HJE A;  3K4N A;  4C2U A;  4KIS A;  1K4S A;  2P7C B;  5GPC A;  5IYB J;  2H6B A;  2KLO A;  1MBE A;  4WK8 F;  2DO7 A;  3E1S A;  1AU7 A;  1RIO H;  1MSE C;  4FIS A;  5IOZ A;  2IAI A;  2IA1 A;  1SFO J;  2JQ7 A;  1F36 A;  3PO2 J;  2V1N A;  4A3K J;  1FBU A;  3H9J A;  1E0E A;  5J6X A;  1ZN2 A;  4RGS A;  1W5T A;  2KJC A;  3SZP A;  3QPT A;  2F2E A;  3LSI A;  1HBX G;  4OIQ F;  1BA5 A;  1WJF A;  4M6X A;  4A0Z A;  2E71 A;  3C7J A;  2QYO A;  3ABK H;  2HVQ A;  2NVY J;  3I4P A;  2M30 A;  2M2E A;  2KT0 A;  4GDF A;  2HI3 A;  3CDI A;  3LSP A;  4BL0 B;  2R93 J;  1MMA A;  1Z6T A;  3G6E I;  1T95 A;  4JX5 A;  3K9T A;  5F0H A;  1ENH A;  4V2G A;  1O3Q A;  1RET A;  2HYG D;  2IEK A;  4MFD A;  3S2H J;  2IVM A;  2P6T A;  3O8G A;  4R1H A;  4D1Q A;  1HQC A;  3WGI A;  1ULY A;  4D7N A;  2JA5 J;  1ODD A;  1HXD A;  4DYQ A;  4Y4R A;  4HDV A;  2Y9Y A;  2OCC H;  3ZXS A;  5ILV A;  3CTA A;  3HBL A;  3TKY A;  3H36 A;  2XVC A;  3C2B A;  5BMZ A;  1UG0 A;  1BW6 A;  2NVT J;  1FOY A;  2L0K A;  3FX3 A;  1HLV A;  1W1W E;  5CLS A;  3RKX A;  2ZJQ F;  3TOA A;  2NS0 A;  3LSJ A;  4N9H A;  5C4X J;  3LQR A;  5J4Y A;  5BS6 A;  2CUE A;  3F8M A;  3WG7 H;  1BOB A;  1IAW A;  3C2G A;  2JA8 J;  3PSI A;  1GHC A;  2BE5 F;  3CUQ C;  4EV0 A;  1S9H A;  4QIW N;  2K02 A;  1XDS A;  2V26 A;  3LSR A;  3SHF A;  1J09 A;  2A6H F;  3NRV A;  5ICE A;  3L2C A;  3E6B A;  2BXY A;  3QU3 A;  5DCM B;  5FLX K;  2ZXI A;  3IH4 A;  2V6E A;  3EET A;  3GME A;  2QQA A;  1VTN C;  2FMY A;  2KQR A;  3FIW A;  1MNE A;  4ETS A;  4P96 A;  4KFC A;  1I3Q J;  2CU7 A;  4XLN F;  4ITV A;  4N4N B;  1YFH A;  1E17 A;  1X58 A;  2FNA A;  4PFP A;  3A2K A;  2ADU A;  2KRH A;  5HVQ C;  2QUF A;  1RKW A;  1OCC H;  3P5J A;  4M3D A;  2LY9 A;  3TBI A;  3HHG A;  4II3 A;  5ICC A;  2XRO A;  2EZI A;  1R22 A;  2UV1 A;  3DCF A;  3FXO A;  5LGN A;  4ENJ A;  4ENM A;  4U88 A;  3FKI J;  1Y1W J;  1IW7 F;  3T8R A;  4D0P A;  1ZLJ A;  4MTD A;  3MEX A;  1E2X A;  4BE0 A;  1QZY A;  5HS8 A;  2R7X A;  3MAJ A;  3HG9 A;  2H09 A;  2VJ5 A;  2VT3 A;  1KU9 A;  2EFO A;  3R0J A;  4YFX F;  1TT0 A;  2B7E A;  4IRI A;  2VC1 A;  5CQG A;  2ICW G;  3JSP A;  1ZTR A;  3FXK A;  4FE7 A;  2NYX A;  4QSH A;  4XSX F;  5HOO A;  4NHJ A;  2DA7 A;  2P5V A;  3DU5 A;  2OZU A;  3LSG A;  1FP2 A;  3MMY B;  1JHH A;  1HOM A;  3RYP A;  2QKL B;  2XDV A;  3D0S A;  2ECB A;  2NXN B;  2EFN A;  4Y3O A;  3CJN A;  3GZN B;  2K27 A;  3K4L A;  1B9M A;  1XMK A;  2CMP A;  3GTJ J;  3QWL A;  2JPC A;  3I56 I;  3IH2 A;  2IGO A;  5KHD A;  1SAX A;  2DMT A;  4RAF A;  3I0T A;  2BY2 A;  3V7S A;  4YIF A;  3M8F A;  4CCM A;  3BR0 A;  4BUP A;  3VYT B;  1OQY A;  4C3I J;  2VKE A;  3RQ4 A;  2XAS A;  3PM1 A;  3G71 I;  2O9L A;  4CSW A;  5EDN A;  1BM9 A;  1JUM A;  1D0Y A;  4LFU A;  4OIR F;  3CCV I;  3CMM A;  1CF7 A;  4RAG A;  5TGT A;  3ZQQ A;  4BGD A;  4Y52 J;  2MGQ A;  4LG3 A;  2KFD A;  3I9V 2;  4UUV A;  2X0L A;  2HTS A;  1I6H J;  2UXX A;  1YJ9 I;  2ZC2 A;  2E1O A;  2QZ8 A;  3EPZ A;  1K7A A;  4C3J J;  3BPX A;  1I50 J;  3GUD A;  3JSO A;  1HW2 A;  2VB6 A;  4BDY A;  2ZXJ A;  2VBZ A;  1XGN A;  3CP8 A;  4XMY A;  1V4R A;  5BPD A;  4Y17 A;  4ESB A;  4WXC A;  4J00 A;  3QRF F;  1E3H A;  2XPU A;  5M5Y J;  1LFU P;  3CC4 I;  2K3P A;  1S6L A;  3BTC A;  2HEO A;  1T0F C;  5E1Z B;  4LLN A;  2X1E A;  3GZ5 A;  1PDN C;  2GIV A;  3FMQ A;  6PAX A;  5FKM A;  5JHF A;  2UZK A;  4RAY A;  3HGG A;  3J7Y J;  3L2W A;  2BHZ A;  3PFI A;  1XC5 A;  2HDW A;  3BZC A;  2R5Z B;  4IQ4 A;  2O5R A;  3DQV C;  4ZYG A;  3LMM A;  3ONQ A;  4GFB A;  3MZH A;  1IV6 A;  3OL3 A;  2HZD A;  2HR3 A;  1WWX A;  3VOD A;  5HOD A;  1VQ6 I;  3GEZ A;  1YW9 A;  3LOC A;  5J8C A;  3LAJ A;  1RR8 C;  4E7I A;  2G9W A;  3OV8 A;  4BJT A;  2BXZ A;  1WQ2 A;  4IOC F;  4KN4 X;  2FBK A;  3CCL I;  3R4K A;  2E5Z A;  2KIQ A;  3VPR A;  4MEY F;  3NWT A;  4UUS A;  1A35 A;  2FBH A;  3FMS A;  1OIS A;  1ZR2 A;  3MWM A;  4JK1 X;  2EK5 A;  3BQZ A;  2VPL A;  4EGY A;  1S5L C;  4Y15 A;  2HDC A;  2JJ7 A;  1YW7 A;  2PMU A;  2A07 F;  3BJO A;  5L3D A;  1ZKG A;  4LIT A;  1V54 H;  1VQM I;  2F5D A;  2QM3 A;  3LWF A;  5K5O A;  3L2R A;  1F4K A;  1QO0 D;  5EJC A;  4OIN F;  3QOP A;  3F6O A;  2P7V B;  3RIR A;  1ZEL A;  1A5J A;  4II2 A;  3SFZ A;  1Z05 A;  2OUM A;  1VQL I;  4ZH4 F;  4HX7 A;  2JUG A;  1JTX A;  3SYT A;  1X3W B;  5D8L B;  2LSO A;  4HQM A;  4B3X A;  2DBB A;  5D4S A;  2XGE A;  3LSM A;  1ZH5 A;  4EM2 A;  3CLO A;  1A6I A;  4LGW A;  3M1C A;  3KP3 A;  5F08 A;  5L3F A;  1RUO A;  4E7L A;  3R61 A;  1IXS B;  3P9K A;  1GVJ A;  4M9S A;  3A01 B;  4MLO A;  3VOE A;  1FEX A;  3Q0W A;  2K86 A;  1BL0 A;  1LEB A;  4P5O A;  5LHI A;  3CME I;  3Q5F A;  2IRF G;  4G94 A;  1IN4 A;  2MFZ A;  4B47 A;  2MYS A;  2E2J J;  1AWC A;  1O3T A;  4OMY A;  1WRJ A;  4ENN A;  2VQC A;  3PJR A;  1J59 A;  1Y0N A;  2KP6 A;  4HG2 A;  1P4X A;  1UHM A;  1VZ0 A;  1X3Z B;  3CUQ A;  3DEU A;  1FYL A;  3S16 J;  2JPB A;  1VQ4 I;  2QCO A;  4HOB A;  3J7A Y;  2TRT A;  4G7O F;  2LR8 A;  3Q0V A;  2M5W A;  3GFM A;  2WTE A;  2W7N A;  3VYS B;  3K1P A;  5E8G A;  3AAF A;  2BVM A;  4RM2 A;  5K5R A;  2F4O B;  4F3Q A;  3G1M A;  3KLO A;  4KT6 A;  2D1V A;  4H4K C;  4UHT A;  3WTS C;  4C3H J;  2BZT A;  4IQJ A;  1YQA A;  1QZZ A;  3OYF A;  4MGR A;  3F8N A;  3SZT A;  3F22 A;  2FQ4 A;  1F5T A;  3TO7 A;  2VXZ A;  1YJN I;  4M3F A;  4R8H A;  4EM1 A;  1VQ7 I;  5FKK A;  3WG9 A;  1R4N B;  4I01 A;  1ZRD A;  2JVH A;  2HWV A;  1PUE E;  2H6C A;  1V3F A;  3FXM A;  1W7P D;  3K69 A;  3REO A;  2YX7 A;  2Q0O A;  1YLF A;  3AFH A;  2TDX A;  2ECC A;  4ZYD A;  2N8G A;  4AYB N;  2FF4 A;  3F8B A;  2WAE A;  3R0A A;  4GYI A;  4MIM A;  3ZQL A;  2ZJP F;  1P92 A;  3CCE I;  1YE9 A;  4B1R A;  3ZMD A;  2R5Z A;  4I76 A;  4O5V A;  4E7K A;  3QPS A;  4MO7 A;  3S15 J;  2ELH A;  1H88 C;  1J7K A;  1Z67 A;  3N4M A;  4XKV A;  4XRF A;  4KIG A;  2YSR A;  1DPU A;  2MBF A;  4ZC3 A;  1XMX A;  3TW7 A;  2XPW A;  5DD4 A;  5LRR A;  2BEO A;  1FWZ A;  2YS9 A;  4MHG A;  3LFU A;  1JUS A;  1SFK A;  1HW5 A;  1G59 A;  1FX7 A;  5JFR A;  3LAP A;  1T33 A;  3FIS A;  4D9J A;  1A04 A;  1Q1H A;  1MDM B;  2W48 A;  4BS9 A;  1V5F A;  1MBG A;  2ZXW H;  3CCM I;  2LC2 A;  2R7U A;  3CMY A;  3FF5 A;  3V8J A;  1SFU A;  2PBI A;  2HQ5 A;  4GRI A;  3U2R A;  2I10 A;  4IX7 A;  2CUF A;  2W82 A;  2CQ7 A;  2HPM A;  2MD5 A;  5DM7 F;  3HOY J;  4IZZ A;  4RB0 A;  5DD8 A;  3HM5 A;  4L5I A;  2ISZ A;  1IUF A;  5LEJ A;  2PJR A;  3EDP A;  1RNL A;  4AID A;  1OCT C;  2ZB9 A;  1MDM A;  5JR3 A;  2G7H A;  5IP9 J;  3CJQ B;  3HOX J;  4C9Y A;  4KMU X;  2V1U A;  1TNT A;  1HKS A;  3H5A A;  1U78 A;  3IHU A;  3ELK A;  3N05 A;  2CUZ A;  4P9U A;  1UAA A;  3BG9 A;  5IPA A;  5KNL A;  4U0Y A;  5DV5 A;  1GV2 A;  4P55 A;  4ZTJ A;  1IRZ A;  1IN6 A;  1YI2 I;  4CGZ A;  4LLL A;  4OOI A;  1I6X A;  2RNG A;  4BBR J;  4MFE A;  2QWW A;  3HOS A;  3W3C A;  1H89 C;  2V6C A;  2R7S A;  4A93 J;  1OPC A; 
#chains in the Genus database with same CATH homology
 5ILS A;  3V4G A;  4JBA A;  2FXA A;  2VT2 A;  4OIP F;  3I58 A;  3CUQ B;  1ZG1 A;  3C18 A;  3IRQ A;  3G73 A;  3I59 A;  1XN7 A;  4RAZ A;  4G8X A;  5ERI A;  4G9Y A;  4U7B A;  2DLL A;  4Y13 A;  3BZ6 A;  2HQN A;  3I59 B;  4RB3 C;  1HKQ A;  3O2P E;  4Q4Z F;  4B8X A;  3K2Z A;  2JT1 A;  2DT5 A;  3FXR A;  4A5N A;  1RZ4 A;  1IN8 A;  3E6M A;  2RV8 A;  2RC4 A;  2EA4 A;  3ZMU A;  3WGG A;  3TDZ C;  2M45 A;  4EQQ A;  1YO5 C;  3ZQ7 A;  4I0A A;  2K4J A;  1WKM A;  1J0R A;  2VOP A;  1QQI A;  5F6F A;  4P9F A;  4OMZ A;  2V9V A;  3LST A;  3IKT A;  5F64 A;  5D5U B;  3E97 A;  3ECH A;  2ZO4 A;  3B73 A;  4O3M A;  1OYW A;  4M9Z A;  4XSZ F;  2HKO A;  2DPD A;  3KCC A;  1IXR C;  1ZHF A;  4PZJ A;  4EM0 B;  3ISP A;  4Z2Y A;  2GA1 A;  1Z7U A;  4HLX A;  1XSD A;  1REP C;  3S2W A;  3BRO A;  5AON A;  5HDN A;  4LMY A;  4O6J A;  3E5U A;  3CUO A;  2Z33 A;  2EV6 A;  2XV4 S;  3CO6 C;  5DDG A;  3I71 A;  1YS6 A;  1WI9 A;  1XSV A;  2PQ8 A;  3KP7 A;  4YG2 F;  1BIB A;  2UXN A;  5L3E A;  4PGH A;  3HRU A;  4RB1 A;  4ENK A;  4A2U A;  2OQR A;  4HW0 A;  1EH7 A;  5HLG A;  2HTJ A;  4RGU A;  4GYG A;  2DAO A;  5E8I A;  3C3W A;  1S7O A;  4G7H F;  2V1X A;  1ON2 A;  3ZPL A;  5IT9 K;  1TW3 A;  1CF7 B;  3WGH A;  3MFK A;  3DKW A;  3FMR A;  2VOO A;  2HQR A;  5E18 F;  4I7H A;  1IN7 A;  3WTZ A;  3J80 K;  2HS5 A;  3PQJ A;  2RQP A;  4LB6 B;  1FSH A;  4L0Y B;  3F8C A;  1FLI A;  1R1T A;  4I0B A;  4WXH A;  4YFK F;  4HV6 A;  5EEH A;  3KET A;  2XAQ A;  3FXU A;  4PGG A;  4XBF A;  3TQN A;  3BDD A;  2STW A;  4F7Z A;  2CSO A;  1FYM A;  3GFL A;  5FB2 A;  4EMS A;  1LNW A;  2ZME B;  2VON A;  4L9T A;  1KQ8 A;  3WU1 B;  1KYZ A;  3RPQ A;  4M6Y A;  3ZN1 A;  2DU9 A;  1XB4 A;  4ZYH A;  1U3E M;  4L18 B;  5DYM A;  2EWN A;  4DQ2 A;  4ESJ A;  1F9N A;  3H92 A;  3TO6 A;  4IXA A;  1YS7 A;  2CYY A;  1SFE A;  2ZBK A;  3D5L A;  5TJJ A;  4OU0 A;  2M1B A;  5LGU A;  3FXQ A;  5KVR A;  2IP2 A;  2QVO A;  3HRM A;  4AD9 A;  1BI1 A;  1P4W A;  4HF1 A;  4BHB A;  4MQV A;  1O3S A;  3MQ0 A;  1ZGJ A;  5H6Q A;  3FZV A;  4NQW A;  1BJA A;  1BIA A;  4KMF A;  4HX8 A;  3M7G A;  2OBP A;  2IT0 A;  1FYK A;  4U0V A;  1ZLK A;  1SMT A;  1MJB A;  1BI0 A;  2LF8 A;  4A0Y A;  1IN5 A;  1DDN A;  2ESN A;  4I2O A;  4N9I A;  3ABU A;  1W4M A;  1J9I A;  1S7A A;  5CVI A;  2FNP A;  4EJV A;  3EYY A;  1ZGA A;  1QPM A;  1GXP A;  1R1U A;  1Z91 A;  4EJW A;  3GXO A;  4AIK A;  4UNO A;  2RVC A;  3KP4 A;  4K2E A;  4KN7 X;  3COA C;  3E6C C;  4BQA A;  3TDU C;  5A2Q K;  5E1X A;  4CIC A;  3RTR A;  4KIB A;  4UV8 A;  4UV9 A;  2D1H A;  4UVB A;  4EJT A;  3KP6 A;  1OYY A;  3BP8 A;  1S3J A;  2FRH A;  1R58 A;  5ICF A;  2ZKZ A;  4MNU A;  3NQO A;  1IRF A;  2EV0 A;  3WU0 A;  4BH9 A;  2BBY A;  4Q47 A;  3M1E A;  2O03 A;  2EFW A;  1TQI A;  2DI3 A;  1DP7 P;  1TQP A;  3FM3 A;  3QPH A;  1I1S A;  1KA8 A;  4BYY A;  3F3X A;  3DF8 A;  3WTW C;  4L9J A;  3GO5 A;  5BPI A;  4FHT A;  3QP6 A;  2XUB A;  2VBY A;  4A6E A;  4LB5 A;  1R5H A;  1TLH B;  5DCF A;  4Q48 A;  2R7F A;  5D6E A;  5EEG A;  3WTT C;  1R23 A;  2VC0 A;  1J2X A;  2DW4 A;  5HDK A;  2J5P A;  2IPQ X;  3T8T A;  2E1N A;  4E70 A;  3WTU C;  4EGZ A;  3WTV C;  2AXL A;  1BC7 C;  4HAM A;  3SQN A;  1XGO A;  2MA3 A;  1XGS A;  4AIJ A;  2UWM A;  1YTY A;  3T1B A;  5H6R A;  1K78 A;  4EJO A;  3JTG A;  1XD7 A;  2W57 A;  1IF1 A;  1XGM A;  4RS8 A;  3HRT A;  3BJ6 A;  3J7A O;  3GF2 A;  5HS9 A;  1Y0U A;  2OA4 A;  5KK1 A;  2XAH A;  2D2W A;  2ZFW A;  1EV7 A;  1PP7 U;  5K5Q A;  1OYI A;  3ECO A;  5HDG A;  2D45 A;  4L5J A;  1ONV A;  2MH2 A;  3MCZ A;  2QQ9 A;  1FZP B;  4CDG A;  1XCB A;  2BGC A;  5L3C A;  1S29 A;  3BOQ A;  1ZRF A;  3I64 A;  3GLX A;  1IUY A;  3I54 A;  3BPV A;  1STZ A;  4BNC A;  3T0Y A;  2QEN A;  2KIU A;  2LKP A;  2XAF A;  2P5L C;  1U2W A;  4KDP A;  3BWG A;  2MH9 A;  4B09 A;  2OZ6 A;  1RUN A;  2ETH A;  1MZB A;  2RKH A;  4HF0 A;  2F5F A;  2PJP A;  4PCQ A;  5D6F A;  1LDD A;  1Z1D A;  4EVI A;  2L02 A;  4S04 A;  2MLG A;  2VE9 A;  3VEP A;  1H0M A;  4KYW A;  4A5M A;  4HDU A;  2PN6 A;  4HV5 A;  1XSX A;  1KYW A;  4FT8 A;  2QBY B;  5E17 F;  2OQG A;  2Q2E A;  3FHZ A;  5DUI A;  3K0L A;  1XMA A;  2ZME A;  4QWQ A;  2FBI A;  1I1G A;  3NEU A;  3TOB A;  1LQ1 A;  3V8K A;  5L3B A;  4TV7 A;  5CVR A;  5LRS A;  3ZMT A;  4HQE A;  1FNN A;  3H3Z A;  3GX4 X;  1FP1 D;  2O61 A;  4UVA A;  1D3Y A;  1MJA A;  2OU2 A;  1D5V A;  2LNB A;  4IRH A;  5D5W B;  2YPR A;  5ICG A;  3WE3 A;  1X3U A;  5FLX Z;  2LF7 A;  2A6E F;  2XAG A;  2JSC A;  4S05 A;  4KA4 A;  5DUK A;  1LDK B;  3R60 A;  4WX9 A;  2LDU A;  1J5Y A;  2VE8 A;  2QLZ A;  1HKT A;  4PDK A;  3PQK A;  4FX0 A;  4HBL A;  2HOE A;  1OR7 A;  2V1D A;  2NAZ A;  2FML A;  1L3L A;  4L9V A;  4NB5 A;  5AIQ A;  1G4D A;  4A12 A;  1IZ1 A;  3G3Z A;  1S8N A;  1H9T A;  3LA2 A;  4G6Q A;  2RNJ A;  5AIP A;  3FM5 A;  4BHP A;  2XKP A;  4G7Z F;  3TO9 A;  4RGX A;  4JQF A;  1KU3 A;  4CYD A;  3F72 A;  2XIG A;  1KQ9 A;  2PMH A;  1T6S A;  5CYV A;  1Z6R A;  2M8E A;  1QBJ A;  2QQB A;  2E7W A;  2L4M A;  1UST A;  3HHH A;  1F1Z A;  3B02 A;  4M72 A;  3LQQ A;  4ZZD A;  2O6G E;  4H0E A;  2GZW A;  5E1W A;  4GXO A;  4YII A;  1T39 A;  2GA2 A;  3V7C A;  3HSF A;  5D8K B;  1TNS A;  2P5K A;  5J8F A;  1XDU A;  1MD0 A;  2CWE A;  2L01 A;  2XGX A;  1HW1 A;  4FX4 A;  2FU4 A;  4CO8 A;  2A69 F;  3IWF A;  2FQ3 A;  5TRD A;  2HGC A;  4XLP F;  5HS7 A;  2W25 A;  5FD5 A;  1G3S A;  4IHS A;  2DTR A;  4RB2 C;  2Q8K A;  1KQ0 A;  1SMY F;  4IJA A;  4KNY A;  4M71 A;  4DNC A;  1K6O A;  3EYI A;  1DUX C;  1LVA A;  2O0Y A;  5H20 A;  1AOY A;  2FSW A;  3RJP A;  1FC3 A;  4HLY A;  5LBQ A;  3O3K A;  1B1B A;  3M9A A;  3RKW A;  2P8T A;  2M87 A;  2ISY A;  3HRS A;  2Z3Y A;  2IJL A;  2ESH A;  2IW5 A;  2WWY A;  3QAH A;  4U0W A;  3CO7 C;  1WSU A;  2GWR A;  4WF2 A;  2EFP A;  2EJR A;  2STT A;  1OMI A;  2OD5 A;  1T38 A;  4LG0 B;  3RDI A;  2EA2 A;  2FOK A;  1GXQ A;  1D8K A;  1U6G A;  2W85 A;  2FEZ A;  1ZG5 A;  2V79 A;  3KZZ A;  2CW0 F;  5LGT A;  2PEX A;  2F5E A;  4M74 A;  2ZNZ A;  1UB9 A;  1B9N A;  3TGN A;  2ACJ A;  2A5Y B;  2XHK A;  4IRG A;  3CDH A;  3HSR A;  4ON0 A;  1MJ9 A;  2JTV A;  1ZYR F;  2A68 F;  3HTU A;  3HTS B;  1G3W A;  2IA2 A;  3HIF A;  4UXN A;  3J81 K;  3VFZ A;  3DXJ F;  2VOD A;  4CHU A;  1G6N A;  3Q9V A;  5D4R A;  1B59 A;  2KKO A;  5IT9 Z;  1T98 A;  3KP5 A;  4G6D A;  3V7R A;  1TQM A;  3OOP A;  2DK5 A;  2YR2 A;  5LEK A;  1UCR A;  1HSJ A;  4BHC A;  1FPQ A;  2EV5 A;  3HSE A;  3LA7 A;  3KEQ A;  5D5X B;  4I09 A;  1SD6 A;  4HX4 A;  3JAM Z;  2W24 A;  3U1D A;  3Q9S A;  4M9X A;  1UFM A;  2ZJ2 A;  2HFH A;  4AIH A;  3KP2 A;  4KIC A;  4HZF A;  2FE3 A;  1SD7 A;  2KIF A;  5BOX A;  5LHH A;  1BBY A;  4N0B A;  1O3R A;  1LJ9 A;  2CFX A;  1EH6 A;  1LB2 A;  2B0L A;  3RI4 A;  1FY7 A;  1YW8 A;  2PFB A;  3GFJ A;  1I5Z A;  5FFX A;  2Z5U A;  3ULQ B;  3HUG A;  1MGT A;  2BYV E;  1J75 A;  4BAY A;  2NNY A;  1R5G A;  3WTY C;  4KIF A;  4WXD A;  2JZY A;  5CJ9 A;  5FO5 A;  2XAJ A;  3IKV A;  3F21 A;  1R1V A;  2NRA C;  1SD5 A;  5E20 A;  1OKR A;  5CVV A;  3VB2 A;  1BI3 A;  4GGG A;  1O7F A;  3J80 Z;  3F23 A;  2EB7 A;  1W7P A;  2GAU A;  2KJB A;  3I5U A;  1K79 A;  2DQR A;  3DPT A;  3QP5 A;  1SFX A;  1EH8 A;  3KFW X;  3HOT A;  2VBW A;  3O6B B;  1K78 B;  3EQL F;  1SD4 A;  1R7J A;  1JE8 A;  4IVN A;  2Y0M A;  2KIM A;  1USS A;  4LLG F;  4IHT A;  2BV6 A;  2DFI A;  3T5X A;  2ZNY A;  3L7W A;  3ZP5 A;  3U9G A;  4MTE A;  3RYR A;  2H27 A;  4MEX F;  5JHU A;  3GZ6 A;  4ZZL A;  2CO5 A;  3ZMZ A;  2P4W A;  3N97 A;  1JXS A;  1UHW A;  3JAM K;  1L0O C;  4U7D A;  4L9N A;  3GFI A;  2Y75 A;  4GCV A;  4MQ9 F;  1P2F A;  4AVP A;  3R6S A;  1DPR A;  2G7U A;  3E6D A;  5L3G A;  1Z9C A;  1W5S A;  3DP7 A;  1IXC A;  2PG4 A;  3KE2 A;  2JRT A;  4KUM A;  1NHA A;  3C1D A;  5IT3 A;  2DK8 A;  1KU2 A;  3LA3 A;  3MZY A;  1PP8 F;  5DCM A;  5DEQ A;  3HYI A;  4HA8 A;  3EUH A;  4UVC A;  3W6K B;  5HLH A;  3DFG A;  4ASN A;  2K7L A;  5BQT A;  3RPU A;  2FA5 A;  2Z9O A;  3WTX C;  2QBY A;  1XCV A;  1O57 A;  3JW4 A;  2L54 A;  2RN7 A;  1RI7 A;  1TW2 A;  1I27 A;  1IRG A;  1R00 A;  2PLY A;  1ON1 A;  1R36 A;  1BN5 A;  2E7X A;  1FT9 A;  3F8F A;  1FOK A;  1O7L A;  4LD5 A;  1ZRC A;  3KZY A;  5CVJ A;  1U5T B;  1FBQ A;  3P7N A;  1BI2 A;  3M8E A;  4IF4 A;  1W7P B;  2OAZ A;  5A2Q Z;  1QNT A;  2AS5 F;  2L4A A;  4KT5 C;  1ZRE A;  1ZAO A;  2WC2 A;  4M73 A;  3GYH X;  5JVT A;  2CQK A;  2COM A;  3RKY A;  4IPA A;  1LDJ A;  2CG4 A;  2O3F A;  2H94 A;  4LK0 F;  3P9C A;  5K1Y A;  4AWX B;  4A0X A;  2RDP A;  2DQL A;  3SXY A;  3ROU A;  3BY6 A;  4WWC A;  4RGR A;  3ZMV A;  1G3T A;  3WOD F;  2F5C A;  4I02 A;  4Q5S F;  2A3S A;  5CVU A;  2HKX A;  4A6D A;  3GVA A;  4YFN F;  4HYE A;  4HF2 A;  1P6R A;  1CGP A;  4EJU A;  2MC3 A;  2K4B A;  2IA0 A;  3GWZ A;  3IL2 A;  3E5Q A;  3WE2 A;  4WCG A;  3ML6 A;  5ED4 A;  1KU7 A;  3P9I A;  1ZAR A;  3L9F A;  2HYF A;  2XRN A;  1T2K A;  4ESF A;  1U8R A;  3K1N A;  2Y48 A;  1BC8 C;  1H9G A;  2RGV A;  2KRF A;  3BJA A;  3IRR A;  3LFK A;  3ZN0 A;  4CZZ A;  1D8J A;  1TBX A;  1B4A A;  3ZMS A;  1P4A A;  3GW2 A;  2YU3 A;  2W84 A;  2P6S A;  2VBX A;  1JGS A;  1YG2 A;  3H3U A;  5FFZ A;  2CGP A;  2Z99 A;  5LLQ A;  1C0W A;  1G3Y A;  5D5V B;  5FGM A;  2O8X A;  3IWZ A;  4L0Z B;  2R3S A;  2NNN A;  3IC7 A;  4BXU A;  1U5T A;  2R7D A;  3E5X A;  2GXB A;  2L3D A;  2VN2 A;  1KGS A;  2GQQ A;  3L09 A;  1U5T C;  5F1R A;  2MLK A;  3K1M A;  2C6Y A;  1FBS A;  3JTH A;  4ZYE A;  1MKM A;  2HZT A;  3W6J B;  3J81 Z;  2EFQ A;  5LHG A;  4OIO F;  3I53 A;  3KLN A;  4LJZ F;  2DPU A;  2WV0 A;  3DV8 A;  3L00 A;  1B6A A;  4CXF A;  3ABT A;  5JI6 A;  1QGP A;  2ZCW A;  5HLI A;  3ERE D;  3E3V A;  1JHF A;  1FSE A;  1TTY A;  1YIO A;  2A61 A;  2X4H A;  5ILU A;  3DPL C;  2E1C A;  2PI0 A;  3V8L A;  4LK1 F;  1LEA A;  2XKO A;  2J5O A;  4LG0 A;  1YYV A;  1T0F A;  3F6V A;  1BOA A;  4QLC U;  4I98 B;  2GXG A;  1ZG3 A;  3QU6 A;  1HST A;  2YX4 A;  3KEO A;  3FWE A;  4R79 A;  5FD6 A;  4GO1 A;  2P7C B;  2H6B A;  4WK8 F;  2DO7 A;  1RIO H;  2IA1 A;  1FBU A;  5J6X A;  1ZN2 A;  4RGS A;  1W5T A;  2KJC A;  3SZP A;  3QPT A;  2F2E A;  1HBX G;  4OIQ F;  4M6X A;  4A0Z A;  3C7J A;  2QYO A;  3I4P A;  2M30 A;  1Z6T A;  3K9T A;  1O3Q A;  2HYG D;  2IVM A;  2P6T A;  4R1H A;  1HQC A;  3WGI A;  1ULY A;  1ODD A;  1HXD A;  4HDV A;  5ILV A;  3CTA A;  3TKY A;  2XVC A;  5BMZ A;  3FX3 A;  5CLS A;  3RKX A;  3TOA A;  2NS0 A;  4N9H A;  3LQR A;  5BS6 A;  1IAW A;  3F8M A;  1GHC A;  2BE5 F;  3CUQ C;  4EV0 A;  2K02 A;  1XDS A;  3SHF A;  2A6H F;  3NRV A;  5ICE A;  3L2C A;  3E6B A;  5DCM B;  3QU3 A;  5FLX K;  3EET A;  2QQA A;  1VTN C;  2FMY A;  4ETS A;  4P96 A;  4KFC A;  4XLN F;  1YFH A;  1E17 A;  2FNA A;  2ADU A;  5HVQ C;  2QUF A;  3HHG A;  5ICC A;  2XRO A;  5LGN A;  1R22 A;  4ENJ A;  4ENM A;  4U88 A;  1IW7 F;  3T8R A;  4D0P A;  1ZLJ A;  4MTD A;  3MEX A;  1E2X A;  1QZY A;  5HS8 A;  3MAJ A;  2H09 A;  2VT3 A;  1KU9 A;  2EFO A;  3R0J A;  4YFX F;  4IRI A;  2VC1 A;  3JSP A;  2NYX A;  4XSX F;  5HOO A;  4NHJ A;  2P5V A;  2OZU A;  1FP2 A;  1JHH A;  3RYP A;  3D0S A;  2EFN A;  3CJN A;  2K27 A;  1B9M A;  1XMK A;  2JPC A;  1SAX A;  3I0T A;  3V7S A;  4YIF A;  3M8F A;  2XAS A;  1BM9 A;  4LFU A;  4OIR F;  1CF7 A;  4UUV A;  2X0L A;  2HTS A;  2UXX A;  2QZ8 A;  1K7A A;  3BPX A;  3GUD A;  3JSO A;  1HW2 A;  2ZXJ A;  2VBZ A;  1XGN A;  1V4R A;  5BPD A;  4Y17 A;  4ESB A;  4WXC A;  3QRF F;  1S6L A;  2HEO A;  4LLN A;  5E1Z B;  3GZ5 A;  1PDN C;  2GIV A;  3FMQ A;  6PAX A;  2UZK A;  4RAY A;  3PFI A;  3DQV C;  4ZYG A;  3MZH A;  2HR3 A;  1WWX A;  3VOD A;  3GEZ A;  1YW9 A;  5J8C A;  3LAJ A;  2G9W A;  3OV8 A;  1WQ2 A;  4KN4 X;  2FBK A;  3R4K A;  4MEY F;  2FBH A;  3FMS A;  3MWM A;  4JK1 X;  2EK5 A;  4EGY A;  2HDC A;  4Y15 A;  2PMU A;  1YW7 A;  2A07 F;  3BJO A;  5L3D A;  2F5D A;  2QM3 A;  3LWF A;  5K5O A;  1F4K A;  1QO0 D;  4OIN F;  3QOP A;  3F6O A;  2P7V B;  3RIR A;  3SFZ A;  1Z05 A;  4ZH4 F;  4HX7 A;  5D8L B;  2LSO A;  4HQM A;  2DBB A;  5D4S A;  1ZH5 A;  4EM2 A;  3CLO A;  4LGW A;  3KP3 A;  5L3F A;  1RUO A;  3R61 A;  1IXS B;  3P9K A;  1GVJ A;  4M9S A;  3VOE A;  2K86 A;  1LEB A;  4P5O A;  5LHI A;  3Q5F A;  2IRF G;  4G94 A;  1IN4 A;  1AWC A;  1O3T A;  4OMY A;  1WRJ A;  4ENN A;  1J59 A;  1P4X A;  1UHM A;  3CUQ A;  3DEU A;  1FYL A;  2JPB A;  4HOB A;  4G7O F;  2M5W A;  3GFM A;  2WTE A;  3K1P A;  5E8G A;  3AAF A;  5K5R A;  3KLO A;  2D1V A;  4UHT A;  3WTS C;  1YQA A;  1QZZ A;  4MGR A;  3F8N A;  3SZT A;  3F22 A;  1F5T A;  3TO7 A;  2VXZ A;  4R8H A;  4EM1 A;  3WG9 A;  1ZRD A;  4I01 A;  1PUE E;  2HWV A;  2H6C A;  1V3F A;  1W7P D;  3K69 A;  3REO A;  2YX7 A;  2Q0O A;  1YLF A;  2TDX A;  4ZYD A;  2FF4 A;  3F8B A;  3R0A A;  4GYI A;  1P92 A;  3ZMD A;  4O5V A;  2ELH A;  1J7K A;  3N4M A;  4XRF A;  4KIG A;  2YSR A;  1DPU A;  2MBF A;  5DD4 A;  5LRR A;  2BEO A;  1FWZ A;  4MHG A;  1HW5 A;  1FX7 A;  5JFR A;  3LAP A;  1A04 A;  1Q1H A;  1MDM B;  1SFU A;  3FF5 A;  3V8J A;  2PBI A;  3U2R A;  2MD5 A;  4RB0 A;  5DD8 A;  2ISZ A;  4L5I A;  5LEJ A;  3EDP A;  1RNL A;  1MDM A;  5JR3 A;  2G7H A;  4KMU X;  2V1U A;  1TNT A;  1HKS A;  1U78 A;  3IHU A;  3ELK A;  4P9U A;  4U0Y A;  5DV5 A;  4P55 A;  1IN6 A;  4CGZ A;  4LLL A;  4OOI A;  1I6X A;  2QWW A;  3HOS A;  2V6C A;  1OPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...