5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PhoB family transcriptional regulator
molecule tags Signaling protein
source organism Streptococcus agalactiae
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
3CJNA 2ZNZA 1QZYA 1ZRDA 3WTVC 2CFXA 2RV8A 4G7HF 3TDZC 3FM3A 5E17F 4LFUA 1O3QA 1H9TA 2STWA 1J2XA 1FP2A 2XAFA 1XB4A 3RYPA 5HOOA 4LLNA 2M8EA 5FLXK 3IC7A 3SZTA 2GIVA 3ECHA 4OIQF 2VC1A 3IRRA 2LDUA 4WXCA 4H0EA 3QU6A 4CYDA 1FBQA 4GXOA 1ZGJA 2VONA 4I01A 1LDDA 3FXUA 2NYXA 5LHIA 2KIUA 2NRAC 1USSA 1GHCA 2YR2A 4LB5A 1JE8A 1SD4A 2K7LA 3GF2A 2VBWA 1YTYA 3B73A 1OKRA 3ELKA 3IWZA 5DEQA 4ZYHA 3AAFA 1S7AA 2PMHA 2A3SA 3G3ZA 2ESNA 1IN6A 1HSTA 4WCGA 3DPLC 1DPRA 2PG4A 3JTHA 3HRMA 2UWMA 2DBBA 3V8LA 3COAC 5HLHA 3W6JB 3LAJA 2A6EF 3FXQA 4BH9A 5BOXA 3M1EA 1VTNC 4EM0B 5CVVA 3GFJA 4LLLA 3KLOA 4M72A 2HS5A 2O0YA 4HBLA 1W7PA 2RNJA 2IA0A 1KA8A 2IPQX 1JHFA 3E6DA 2ETHA 3H3UA 4YIIA 3GFMA 2PN6A 1LDJA 2QBYB 2PLYA 3L00A 3CO7C 3GW2A 1HW5A 1QO0D 2F5CA 2BE5F 3VB2A 3R61A 4D0PA 1MJAA 3HUGA 2F5EA 3MAJA 5E1ZB 3CUQA 3HRUA 4QLCU 5LBQA 1HW1A 4XRFA 1T2KA 1FSEA 1I1SA 1I6XA 2VXZA 1OPCA 2YU3A 3K1MA 2QENA 4LK0F 4P5OA 5F6FA 1F4KA 1BI2A 2OZUA 2MH9A 4KN4X 5F1RA 1K7AA 1UHWA 2HR3A 4ZYEA 3REOA 2MLGA 3WU1B 4U0WA 2XAHA 3LQRA 4GGGA 2W24A 3LA3A 5D8KB 1KU7A 4F7ZA 3CUQB 2XAJA 2P5KA 4KIBA 2YX7A 5L3FA 3ZMZA 3ISPA 4AD9A 1DUXC 2FE3A 1O7FA 1D8JA 2P5LC 1SFUA 3EYYA 1R7JA 1E2XA 3O2PE 3E3VA 2QM3A 3GUDA 4BAYA 2RC4A 2P7VB 4KA4A 2MC3A 2FNPA 5AIQA 3I59A 4KN7X 1LEBA 4RB3C 1TW2A 3VODA 2E1CA 3QP6A 1LNWA 1HQCA 1J59A 3MFKA 2EWNA 5ERIA 1S8NA 1YIOA 1BC7C 4M9XA 2XIGA 1F9NA 4AIHA 2K02A 4LMYA 2QQBA 3OV8A 1GXPA 3SHFA 4HX4A 2IW5A 3GWZA 3TOBA 1ZHFA 4U7BA 4IJAA 4KYWA 6PAXA 3EDPA 3HTSB 3J81Z 4WF2A 3ZP5A 2Y48A 4A0YA 1R23A 4EJOA 1KU2A 2HDCA 4M9SA 2O8XA 4RAZA 1MZBA 1U78A 1HKSA 4IHSA 3ZMDA 2P7CB 1YW9A 3E6BA 3QP5A 2ZO4A 2Z9OA 3K0LA 2E7WA 1AOYA 2F5FA 2OBPA 2HQRA 4I7HA 4S05A 2W25A 4IPAA 5K1YA 3FWEA 3LA2A 3KZZA 3HOTA 4HF0A 5HS8A 2LSOA 1V4RA 4M6YA 3BP8A 1XD7A 3QPTA 3ZMSA 4FX4A 4LJZF 4M73A 4OMZA 5CJ9A 4KNYA 4QWQA 4UV9A 2NNNA 1WRJA 2G7HA 1XN7A 3SFZA 3FHZA 1B4AA 1OYYA 3F8BA 2HTSA 3LWFA 3HRTA 1JXSA 2EFQA 4S04A 5D6FA 2A07F 4EJUA 4AWXB 2RDPA 4KMUX 3WTXC 4KUMA 5AONA 1XGNA 4XLPF 3E6CC 4ESFA 2VBZA 1BJAA 3W6KB 4Z2YA 2QYOA 5HDNA 4MGRA 5D5UB 2YX4A 4GYIA 1Z7UA 4BHPA 1I5ZA 2ZXJA 5DCFA 1R22A 2VE8A 3NQOA 2K86A 2CWEA 1FBUA 1KQ8A 2LKPA 4OIRF 5DD8A 1B59A 4LK1F 1L0OC 3JAMK 5F64A 1HXDA 4HV6A 5ICGA 2HOEA 1FT9A 3CUOA 2DU9A 3RDIA 5ILSA 2FOKA 4IRIA 3TGNA 1IXSB 1I1GA 4M9ZA 1YG2A 5DYMA 3CTAA 2XROA 1ZN2A 2D2WA 1V3FA 3ZN1A 4RB1A 1FPQA 2OA4A 1MJ9A 2HYGD 4PGHA 4HQEA 1YFHA 5IT9K 3H92A 3IKTA 1REPC 1TQIA 2OQGA 3WODF 4KFCA 4MTEA 1EV7A 2K4JA 2LF7A 2O3FA 5FO5A 1PP8F 4WK8F 3FXRA 4HDUA 3RKXA 5DUIA 3KE2A 2XVCA 4OMYA 1S6LA 3I5UA 3KEQA 3WGIA 3DKWA 3T8RA 3HSRA 5E8IA 1GVJA 2DLLA 3F22A 3BJAA 3P9KA 3LSTA 2VBYA 1J5YA 4P96A 1KU9A 5JHUA 4A12A 3CLOA 2FF4A 2G7UA 4FHTA 3RTRA 3R4KA 3IL2A 2Z99A 3HTUA 5D5VB 3ABUA 4Y13A 3FM5A 5LHGA 1PUEE 2XKOA 5FB2A 4HV5A 2O6GE 2VT3A 4Q48A 3BROA 4ENMA 5DDGA 1YQAA 1TQPA 3B02A 1G3SA 2D1VA 3I71A 4RB2C 5ILVA 2FSWA 1ZRFA 1P4XA 2H27A 4UUVA 4WWCA 1J9IA 1X3UA 1XCVA 1R1VA 4ENJA 2RQPA 2A68F 2E1NA 2ELHA 1P2FA 1FWZA 3WGHA 4EJVA 1IN5A 2QWWA 4OINF 4A6EA 2CG4A 1XCBA 1FYMA 4B8XA 3E97A 5CVJA 3SQNA 2L4MA 5D5WB 5L3GA 4ENKA 5A2QK 3KETA 1RUNA 1SAXA 3ABTA 4KDPA 1BIAA 4WXDA 3FX3A 4XLNF 4FX0A 3MZHA 3WTYC 2PQ8A 2QQAA 5J8FA 1K78A 2ZKZA 3VEPA 2MA3A 3WTZA 2PJPA 2Y75A 1GXQA 4L9VA 3KFWX 1SD7A 5H6RA 3ROUA 4LG0A 1XMAA 4CHUA 5DUKA 5LRRA 4MHGA 5D5XB 3WGGA 4R8HA 3P9CA 3ERED 3GZ5A 2EA2A 5DD4A 1DP7P 1QZZA 4GO1A 1ZYRF 4MEYF 1R1TA 1Z9CA 2GQQA 1Q1HA 3V4GA 4UVCA 2HTJA 4UNOA 2VE9A 3CDHA 4UVAA 1HKQA 3J81K 4RS8A 2PBIA 1IW7F 4G6DA 4R1HA 2FXAA 4HX7A 2OZ6A 3M8EA 3P9IA 5BMZA 3R60A 4OOIA 1T0FA 3QOPA 3DQVC 3HOSA 3JAMZ 2CYYA 4YFKF 1IAWA 3J80Z 1Y0UA 1J75A 2HEOA 1SFXA 2KKOA 1P4AA 1FY7A 3GEZA 4YFNF 1UCRA 3ECOA 1RIOH 5L3BA 4BYYA 2R7DA 3WE3A 2JPBA 4FT8A 3BOQA 3Q9SA 3U2RA 2DPDA 2ZMEA 4P9UA 3BZ6A 2GZWA 2M5WA 5BPIA 2OD5A 3WTTC 1T39A 4GCVA 3U9GA 1MDMB 3P7NA 3GFLA 3C1DA 1ZG1A 5IT9Z 1O3TA 1WQ2A 2L3DA 1XSXA 3MEXA 2J5OA 4UXNA 1S29A 2W85A 3RKYA 4I09A 5E18F 1QNTA 2DK8A 1LB2A 5K5OA 4WX9A 5HDGA 3KCCA 3FMQA 2DFIA 5HLIA 3F23A 3GFIA 5D4RA 2DQRA 4IF4A 2M30A 5EEHA 2ZCWA 2D1HA 4KIFA 2VODA 1P4WA 4AIKA 4MEXF 2B0LA 4I98B 4KIGA 3ZPLA 3L2CA 1F5TA 3LAPA 2P6SA 2EJRA 2P4WA 3HHGA 3K69A 5JVTA 2V1XA 4LLGF 2XUBA 5LLQA 1EH8A 1EH6A 4RGRA 2MBFA 2Q2EA 2YSRA 4U0VA 5DCMB 1LQ1A 4P55A 5CLSA 4IRHA 4ZYGA 4CGZA 5L3EA 4ESJA 2FBIA 4A0ZA 2DPUA 3WTSC 1P92A 4Q4ZF 3GLXA 1R58A 4BHCA 1TTYA 1YO5C 2DT5A 3E6MA 3HYIA 1KU3A 2RGVA 2CSOA 2F2EA 2V9VA 4L9TA 2LF8A 2FA5A 2WTEA 2VBXA 3R0AA 1FYKA 1WWXA 3HRSA 1U5TA 3IHUA 2LNBA 2IA2A 1FYLA 3HSEA 2P5VA 4ZH4F 5D4SA 4M71A 2M87A 4BNCA 1R36A 2E7XA 1XSDA 3IKVA 3WTUC 1ZARA 4ETSA 2FNAA 2KIFA 2IA1A 1OYIA 2HFHA 1BI0A 2G9WA 3GXOA 2JRTA 2CGPA 4DQ2A 2RVCA 1QGPA 2RKHA 5CVRA 5E1XA 2XHKA 2W57A 2ZBKA 3C3WA 5KK1A 4U7DA 4IXAA 5H20A 2A69F 3BJ6A 2BV6A 5DV5A 3NRVA 1OMIA 3V7SA 3PQKA 4P9FA 3KP3A 4HYEA 1L3LA 1ONVA 2EA4A 4WXHA 1YLFA 5EEGA 1A04A 4E70A 5A2QZ 3F3XA 3ML6A 2FQ3A 1NHAA 3I58A 1FOKA 2L01A 4HX8A 2STTA 4CO8A 2PMUA 2EFOA 1J7KA 1KYZA 4RAYA 2DI3A 1XGSA 3L09A 4B09A 3RI4A 2H09A 3T0YA 3TO6A 1TNTA 2FBKA 5CVUA 1S7OA 2Y0MA 1OYWA 3MQ0A 4L5JA 4N9HA 2WC2A 2Q0OA 1G4DA 5D8LB 1E17A 3ZMTA 4U88A 2XAGA 3F6OA 2EK5A 2OAZA 1IRGA 1B6AA 3J80K 2AXLA 5ICEA 2FMYA 1FX7A 1ZH5A 2ZMEB 2C6YA 2MD5A 4G9YA 3EUHA 2K27A 1O3SA 4EJTA 1LDKB 2OQRA 3E5QA 1BI3A 4L0ZB 1ON2A 3MWMA 3DP7A 4K2EA 4EM1A 4EV0A 2BBYA 2GA1A 1C0WA 3DXJF 4MQ9F 2FU4A 2QUFA 2VT2A 2V79A 4HDVA 4XBFA 3Q5FA 1TW3A 1XGMA 3D0SA 5TRDA 1ZG3A 1USTA 2H94A 3JTGA 1D8KA 4TV7A 4RGSA 3JW4A 2EFWA 1KGSA 5CVIA 3JSOA 2H6BA 1MGTA 2FBHA 1Z91A 4EJWA 4RGUA 2ZNYA 2KJCA 3KP7A 1XDSA 4A5MA 5LHHA 1CF7A 4ENNA 5JR3A 2H6CA 3CUQC 2ISYA 2ADUA 2IT0A 1U5TC 3K1PA 1FBSA 1H0MA 5ICCA 1K78B 3G73A 1UHMA 4AIJA 1ZLJA 2EV5A 4KMFA 3IRQA 2BEOA 2HKOA 1FNNA 4CZZA 5E8GA 4L9JA 2V1DA 3S2WA 2JTVA 1HKTA 1G3WA 2Z33A 3M8FA 5IT3A 1IRFA 3ZQ7A 3LFKA 4OIPF 1PP7U 2RN7A 5DCMA 1TLHB 1DPUA 2FEZA 1Z1DA 2KIMA 3HIFA 1Z6TA 2DTRA 1KQ9A 5ILUA 3O6BB 4G94A 2V6CA 5LEJA 3M9AA 1IXRC 5L3CA 3I0TA 2GWRA 1ZRCA 1H9GA 3N97A 3TQNA 3WE2A 4HF2A 2MLKA 1R5GA 1B1BA 1ZREA 4PGGA 4YIFA 4M74A 4G6QA 3HHHA 3GO5A 5J8CA 2DAOA 5D6EA 3LQQA 4L9NA 1B9MA 1LEAA 4R79A 1RNLA 4U0YA 1SD6A 3RJPA 5E1WA 4LGWA 2VOPA 1MDMA 5K5QA 1Z05A 1MJBA 3OOPA 3BDDA 3L7WA 3TO9A 3BPVA 1STZA 2BYVE 1JGSA 3DPTA 3FMRA 2QLZA 3K1NA 2L54A 4RGXA 4UV8A 1RZ4A 2HKXA 4JK1X 4CICA 3KZYA 5KVRA 3FZVA 1EH7A 1BIBA 4UVBA 1IUYA 3BY6A 2EFPA 2NNYA 1G6NA 5HVQC 5JFRA 3MCZA 2GAUA 2X4HA 1U8RA 1DDNA 1LVAA 2QZ8A 4Q47A 2HQNA 2XRNA 3KP6A 4LD5A 4XSXF 1UFMA 4L18B 4EVIA 4A2UA 1R5HA 1QPMA 1MD0A 1U2WA 2D45A 4Y15A 4HW0A 4NB5A 3QAHA 1OR7A 1BI1A 5K5RA 5BQTA 2EB7A 3HSFA 3U1DA 3FMSA 2IRFG 1LJ9A 2JSCA 3C7JA 1IN7A 4O3MA 5FGMA 2AS5F 1R1UA 3T1BA 1MKMA 2JPCA 4A5NA 1FZPB 3WTWC 2CQKA 1U6GA 1RI7A 1HBXG 1ZGAA 1IZ1A 2J5PA 2W84A 3QPHA 2VC0A 1ODDA 3D5LA 1B9NA 3K2ZA 3V7RA 1W5TA 3CO6C 1AWCA 2QQ9A 1ULYA 4I02A 2IVMA 3VFZA 2M45A 4IVNA 3GVAA 2A6HF 1BC8C 2XGXA 3WG9A 4UHTA 2CW0F 1BOAA 5AIPA 1ZAOA 4HF1A 2GXGA 4KICA 4HOBA 5ICFA 2XKPA 4EGZA 2L02A 1IXCA 1J0RA 4HLXA 3R6SA 1IF1A 2O61A 2HGCA 1G3TA 3BPXA 3FF5A 2EV6A 2ACJA 1CGPA 3H3ZA 3I64A 3GYHX 1QQIA 2CO5A 2XASA 4XSZF 4L5IA 4EGYA 2DW4A 3GX4X 2XV4S 2KRFA 2NS0A 4G7OF 2F5DA 4LB6B 3GZ6A 2X0LA 4I0AA 3DEUA 2HZTA 1SMTA 1HSJA 5LRSA 1XMKA 2UXNA 2KJBA 2PFBA 4DNCA 3T8TA 1SMYF 4N9IA 1UB9A 3RPQA 2COMA 3F21A 3KLNA 4PZJA 1QBJA 2PI0A 3DFGA 4AVPA 3WU0A 3TDUC 4Y17A 3T5XA 3J7AO 2MH2A 3QRFF 1T98A 2R7FA 5J6XA 4BXUA 4ASNA 1T38A 1SD5A 4MQVA 3RKWA 1RUOA 3V7CA 1TNSA 1ZG5A 3DF8A 4GYGA 1YYVA 1XDUA 4N0BA 3I59B 5JI6A 3KEOA 4ZZLA 4YG2F 2PEXA 1T6SA 2IJLA 3C18A 2BGCA 4Q5SF 1D5VA 3ZMVA 4EMSA 1U5TB 2VOOA 2ISZA 4CDGA 3SXYA 4A6DA 3RYRA 1K6OA 1W5SA 4IRGA 2ESHA 4ESBA 2JT1A 3NEUA 5FLXZ 5TJJA 5E20A 3TO7A 3V8KA 3ZMUA 3EETA 1YW8A 1BM9A 1O57A 2UZKA 4HAMA 2UXXA 4JQFA 4G7ZF 4ZZDA 3BJOA 1U3EM 4NQWA 1TBXA 5HDKA 4EQQA 1O3RA 4I0BA 1SFEA 1TQMA 3KP5A 2DO7A 4KT5C 3PFIA 2XAQA 5FFZA 2EV0A 3E5XA 1JHHA 2VN2A 1W7PB 3N4MA 3V8JA 3EYIA 2ZJ2A 3MZYA 4HZFA 2A5YB 3ZN0A 2QBYA 4HA8A 3QU3A 2Z3YA 1FC3A 2DK5A 4ON0A 5ED4A 1BBYA 1FP1D 3O3KA 3PQJA 3IWFA 5CYVA 5LGTA 4O5VA 3F6VA 4JBAA 1WKMA 1D3YA 2YPRA 2ZFWA 1IN8A 2R3SA 1HW2A 2Q8KA 2HYFA 2HWVA 1YW7A 2WV0A 3F72A 5HS9A 2NAZA 2FMLA 1KYWA 2GXBA 3VOEA 5BPDA 2WWYA 3TOAA 4M6XA 1PDNC 1ON1A 1XSVA 1XGOA 2IP2A 3KP4A 2O03A 4I2OA 4MTDA 4PDKA 4MNUA 4G8XA 3RPUA 3L9FA 1FLIA 5FD6A 1W4MA 1ZLKA 2JZYA 1F1ZA 1O7LA 4YFXF 4CXFA 2L4AA 1IN4A 2M1BA 5FD5A 2P6TA 4A0XA 4IHTA 1BN5A 3F8FA 3JSPA 1WI9A 1KQ0A 4EM2A 3DV8A 1Z6RA 2K4BA 4PCQA 1WSUA 3K9TA 4ZYDA 2V1UA 3RIRA 2TDXA 3I4PA 3EQLF 2FRHA 1YS6A 5HLGA 3BWGA 4BQAA 3KP2A 1S3JA 4RB0A 1I27A 5FFXA 2A61A 4BHBA 5BS6A 4NHJA 1P6RA 5LEKA 4O6JA 3TKYA 4OIOF 3M7GA 2DQLA 4HLYA 3Q9VA 1G3YA 1CF7B 5HS7A 3LA7A 3R0JA 2GA2A 5L3DA 3I54A 4LG0B 4HQMA 4OU0A 1FSHA 1W7PD 5LGNA 2QVOA 3E5UA 3F8MA 1R00A 1K79A 4L0YB 1YS7A 3ULQB 5H6QA 3F8NA 2OU2A 2Z5UA 2EFNA 3I53A 2P8TA 5LGUA 3F8CA 3SZPA
chains in the Genus database with same CATH superfamily
3CJNA 2ZNZA 3DU5A 1QZYA 1ZRDA 1RPWA 1XPXA 4PK4A 3WTVC 2CFXA 2RV8A 4G7HF 4IHYA 3OL4A 3TDZC 3S16J 3FM3A 5E17F 3NARA 4LFUA 4IO9F 3PO2J 1O3QA 2MYSA 1H9TA 2STWA 3O8GA 3H9QA 1HA8A 2CJJA 2MSYA 1J2XA 1FP2A 2XAFA 3K70D 2ZJRF 1XB4A 3JRFA 2IS1A 3RYPA 5HOOA 1RR7A 4LLNA 2M8EA 5FLXK 3IC7A 3SZTA 2GIVA 3ECHA 3SDBA 1QPIA 4OIQF 2VC1A 3IRRA 2LDUA 2BHZA 4WXCA 3I56I 4H0EA 3QU6A 4DW6A 4CYDA 1FBQA 3K7AJ 3OS0A 3TP0A 4GXOA 1ZGJA 2HPMA 2VJ5A 3CCLI 3L2VA 1K61A 2VONA 4DZPA 2MG4A 5E3OA 4C30A 4ZDOA 4C3HJ 4I01A 1R9TJ 1LDDA 4CCJA 3FXUA 2ZSIB 2NYXA 5LHIA 4H4KC 3MKZA 2KIUA 3FDYA 3RQIA 2NRAC 1USSA 3G1OA 1GHCA 3BC8A 2YR2A 4LB5A 1JE8A 1SD4A 2K7LA 3GF2A 2V9KA 2VBWA 4XKCA 1B72B 1YTYA 5B66C 3B73A 1JTYA 2F6CA 3ABLH 3PIPF 3H0DA 1OQYA 1OKRA 3ELKA 3IWZA 5DEQA 3JRIA 4ZYHA 4BQQA 1YRNA 3AAFA 1ETOA 1S7AA 1Y6IA 2PMHA 2A3SA 2CH0A 3KEYA 3G3ZA 2ESNA 1W36C 1IN6A 2O5RA 2LY9A 1HSTA 4IL6C 4MO7A 5J4YA 2G0EA 1VQ7I 4WCGA 1MBHA 3CDIA 3DPLC 1DPRA 4RM3A 2PG4A 3JTHA 1IDYA 3AL0C 3HRMA 3H5RA 1I3QJ 5EZGA 1OCRH 2UWMA 3DLAA 2DBBA 3V8LA 3COAC 2HZDA 4XRSA 3VSLA 5HLHA 3W6JB 3LAJA 2A6EF 3FXQA 4BH9A 2XSDC 4X0GA 1A6IA 5BOXA 3M1EA 2ID6A 1VTNC 4EM0B 4BS9A 3NWSA 5CVVA 2QSGX 2DA5A 1PJRA 2K9LA 2BXYA 3GFJA 1YX5A 1WFXA 1AU7A 4LLLA 3ZQGA 3KLOA 4M72A 2HS5A 1YHQI 2O0YA 2ELJA 4HBLA 3DEWA 4NDLA 3OYKA 1W7PA 2PMZN 2RNJA 2IA0A 4AYBA 4F93B 1ETYA 1YOVB 1KA8A 2IPQX 1JHFA 5IYDJ 3E6DA 2ETHA 2JUGA 1HCRA 3H3UA 4YIIA 3GFMA 2PN6A 1GV5A 3KIOA 1YE9A 1FIAA 3RQ4A 1JGGA 1LDJA 3BCAA 2ID3A 1VQLI 4IHVA 2QBYB 2PLYA 5J4VA 1SAUA 1RKTA 3L00A 3BQZA 3CO7C 1ZKGA 4CCNA 5DTDA 2HVSA 3GW2A 1HW5A 1QO0D 2F5CA 2BE5F 4DYRA 3VB2A 1VQMI 3R61A 4D0PA 2W1OA 2XF6A 1FOYA 3CMEI 1MJAA 4BL0B 2PJRA 3HUGA 2ZXHA 4IZZA 2E60A 2F5EA 3MAJA 1ENHA 5E1ZB 1BA5A 1MMNA 1JUSA 3CUQA 3HRUA 1X1DA 3TBIA 4QLCU 5LBQA 1HW1A 2X6OA 4KJZA 1S7EA 2HQAA 2AO9A 4XRFA 4XKVA 1MBEA 1T2KA 1AKHA 4HNVA 1FSEA 1I1SA 1I6XA 1VZ0A 2VXZA 1OPCA 2YU3A 3K1MA 4D5FA 2NVXJ 1VNDA 2QENA 4LK0F 3J7YJ 4P5OA 4RLFA 4NC7A 5F6FA 1D1AA 1F4KA 1BI2A 2OZUA 2MH9A 4KN4X 2HPIA 5F1RA 1K7AA 1UHWA 2HR3A 4XK4A 4F91B 2HNHA 4ZYEA 4A3FJ 3REOA 2MLGA 3WU1B 4ZC3A 1VQOI 4BE1A 4U0WA 2XAHA 3G6EI 1WVRA 3LQRA 4GGGA 2W24A 1S72I 3WG7H 5CPRB 3LA3A 3PUFA 2OC6A 5D8KB 2RNGA 1AKHB 1M1EB 1KU7A 3BQYA 4F7ZA 3QYBA 1D1BA 2CV1A 1X1PA 3CUQB 3H1CA 1FMWA 2XAJA 4QTRA 2P5KA 4KIBA 2OTLI 2LP0A 2YX7A 1MH3A 5L3FA 1E3HA 3ZMZA 3ISPA 4AD9A 2RREA 1N75A 1DUXC 2L5QA 3N05A 2HXOA 2FE3A 1O7FA 2X6YA 1ACIA 3OOUA 1JKPC 1D8JA 3H5NA 2UV1A 4ANJA 1MNMC 2ZXWH 2LLKA 2K9NA 2P5LC 3LMMA 1SFUA 1HC8A 3EYYA 5EF6A 1R7JA 3HKZN 2IGNA 1E2XA 3O2PE 5FKNA 1KONA 4A3MJ 2DYRH 2VQHA 3E3VA 2QM3A 1RRJA 3GUDA 2ZC2A 4BAYA 2RC4A 2P7VB 4KA4A 1N77A 2MC3A 2FNPA 5AIQA 3I59A 4RAGA 5JVGF 4KN7X 4DYCA 3AG3H 1LEBA 2VKVA 2JVHA 2DN0A 4RB3C 3OYHA 1TW2A 3U21A 1G59A 3VODA 2E1CA 3QP6A 1LNWA 2VASA 1HQCA 1J59A 3OYIA 3MFKA 2EWNA 5ERIA 1FTTA 1S8NA 3GLLA 1YIOA 1BC7C 4M9XA 1WHUA 2R7RA 4IQJA 2GOXB 2XIGA 2GIZA 2HI3A 2M0MA 1NG7A 3H36A 1F9NA 4AIHA 1ITYA 2AXTC 4BUPA 2K02A 2DOFA 2WB1N 2XGDA 4LMYA 4A3CJ 2QQBA 3OV8A 1GXPA 4XRMA 5FLVA 3SHFA 4HX4A 4UUSB 4B48A 2IW5A 3GWZA 3TOBA 1ZHFA 2LREA 4U7BA 4IJAA 4W97A 4KYWA 1A35A 6PAXA 2ECBA 3EDPA 3HTSB 3J81Z 4WF2A 1S9HA 3ZP5A 3LSPA 4Y3OA 2Y48A 4A0YA 1GLNA 2I8DA 1RC9A 3GTGJ 4QPQA 1R23A 3UNGC 1YRNB 2IAIA 4EJOA 1KU2A 5GAEJ 2WBMA 4HSRA 2HDCA 4M9SA 2O8XA 3OYJA 4RAZA 1MZBA 1U78A 1HKSA 4IHSA 1OCZH 3ZMDA 3H35A 3LOCA 1YW9A 2P7CB 4AVZA 3GTLJ 1QVTA 3E6BA 3ZQFA 3QP5A 2HDWA 2L7MP 3I3LA 2ZO4A 1W0TA 2Z9OA 3K0LA 3DPUA 3K4NA 4II3A 2E7WA 3SFIA 3OSFA 1B8IB 3DCFA 1AOYA 2F5FA 4N4OB 2OBPA 2R7SA 2HQRA 2LR8A 4RM2A 4I7HA 4S05A 2W25A 2CS3A 4IPAA 5K1YA 3JCUC 1F43A 2Y0SA 3DTKA 2W00A 3W6VA 3FWEA 3LA2A 3KZZA 5IP9J 3UR3C 3HOTA 1SFKA 3H9GA 4HF0A 3MKLA 5HS8A 3LSRA 5F0HA 2LSOA 1V4RA 4M6YA 1TL8A 3BP8A 1TP4A 2E2HJ 1XD7A 4FASD 2LYCA 3QPTA 4Y33A 4S0HB 3ZMSA 2DA1A 4FX4A 4C2TA 1Q1VA 4LJZF 2FUG2 2XPUA 4M73A 4XKBA 4OMZA 5CJ9A 4KNYA 2XSJC 4QWQA 3IUOA 4XMYA 4UV9A 2NNNA 3EPZA 1WRJA 2QKLB 2G7HA 3ZOBA 1IGNA 4BDZA 1XN7A 2P0WA 2FX0A 3FXKA 3SFZA 2EINH 1B4AA 3FHZA 1OYYA 3F8BA 4JOMA 4XN0A 2HTSA 4A3BJ 2X1EA 3CJQB 3LWFA 3HRTA 5B3SH 4RMNA 1JXSA 1T0FC 2EFQA 4S04A 3FKIJ 3QYEA 3C2HA 2LH9A 2HYJA 5D6FA 1WJBA 2A07F 4EJUA 4AWXB 2RDPA 4HEA2 1FMVA 4KMUX 3WTXC 4KUMA 5AONA 1XGNA 4Y4RA 4XORA 1IG7A 2WADA 4F52A 4XLPF 2VUMJ 3E6CC 4ESFA 2VBZA 1BJAA 2M7BA 4IOCF 3W6KB 4Z2YA 2QYOA 3K4LA 5HDNA 1WJ5A 1IUFA 4MGRA 5D5UB 5F0CA 1OR7C 4JX5A 2YX4A 4GYIA 1Z7UA 1CQTA 3HM5A 3CCQI 2X9DA 3CC4I 4BHPA 1I5ZA 2R7OA 3PM1A 3BR2A 2ZXJA 3AL0B 2R7UA 2M3AA 2AQFA 4BEHB 1R22A 5DCFA 1LFUP 2VE8A 3NQOA 4HNTA 4BBSJ 2K86A 4NC6A 2CWEA 1FBUA 1KQ8A 2LKPA 3CDLA 4OIRF 5DD8A 1B59A 4LK1F 1L0OC 3JAMK 5F64A 2KRCA 1HXDA 4HV6A 1SVOA 1K83J 2HOEA 5ICGA 2JVGA 4BY7J 2V7FA 1FT9A 3CUOA 3JRDA 3VDXA 2DU9A 4FQGA 3RDIA 3MD2A 5ILSA 2FOKA 1V54H 4IRIA 5FROA 2DOEA 3TGNA 2AHQA 1IXSB 1I1GA 2DTZA 3ASNH 4M9ZA 1YG2A 3BG5A 2M9HA 4AM3A 5GAHJ 5DYMA 3CTAA 2XROA 1ZN2A 2D2WA 3OYNA 4IQ4A 5CQEA 1V3FA 3ZN1A 3HOWJ 1I39A 4RB1A 1FPQA 3AKZA 2OA4A 5CKTA 1MJ9A 2HYGD 4PGHA 4HQEA 1YFHA 1KZHA 5IT9K 3H92A 5J3LA 3IKTA 5C44J 1REPC 1TQIA 2FJ1A 2OQGA 4FTHA 3WODF 4XICA 4KFCA 4MTEA 1EV7A 2K4JA 2LF7A 2O3FA 4XNFA 5FO5A 1PP8F 3QQAA 4WK8F 3FXRA 4HDUA 3DKYA 3RKXA 5DUIA 2E35A 3KE2A 2R7VA 2XVCA 4OMYA 1S6LA 3I5UA 3KEQA 3WGIA 3DKWA 3T8RA 3HSRA 2ECCA 5TGTA 1A5JA 2Z16A 5E8IA 4ZJZA 1GVJA 2DLLA 3F22A 4F55A 3AG4H 3BJAA 3HPHA 2LFBA 3LSTA 3P9KA 4QPOA 2VBYA 5M5XJ 2W4SA 1BR1A 1FTZA 2IS6A 3HPGA 1J5YA 1Y8RB 2HOAA 2VQGA 4P96A 1UG2A 2LVSA 2YS9A 2E2IJ 1KU9A 4XLEA 5JHUA 3FXOA 3FXJA 4A12A 4BJ6C 2JA6J 2FQ4A 3CLOA 4C2MJ 2FF4A 2G7UA 4FHTA 2K3PA 3CC7I 3RTRA 3GTJJ 1Y39A 3R4KA 3IL2A 4CYCA 2Z99A 3HTUA 4HG2A 5D5VB 3ABUA 4Y13A 3FM5A 5LHGA 2L2OA 3H5AA 2TCTA 5FKLA 1PUEE 2XKOA 5TISC 5FB2A 3NWTA 1IJWC 4HV5A 2O6GE 2R0QC 2VT3A 4Q48A 1U9OA 3BROA 4ENMA 5DDGA 4PSXA 2WAQN 1YQAA 1MMGA 1TQPA 2DMNA 3B02A 3OIQA 4F92B 4FETA 2LKXA 4D9JA 2B9SA 2DFHA 2M7AA 2EQRA 1G3SA 2D1VA 3CMYA 3I71A 4RB2C 2KQRA 2EIKH 5ILVA 1R6RA 3FXLA 2FSWA 2V26A 1ZRFA 1R71A 1P4XA 3SZGA 2H27A 4UUVA 5F27A 4IKFA 4WWCA 3KYLA 1J9IA 1X3UA 4E7HA 3OIPA 1XCVA 5F04A 5JHFA 4JX6A 1R1VA 4PFPA 4ENJA 1SANA 4XN3A 2RQPA 4XKWA 1OCOH 4B1RA 2HVRA 2A68F 2E1NA 2ELHA 2B63J 1P2FA 2HU9A 3IP4B 3DLLF 1FWZA 3WGHA 3CCRI 4EJVA 1IN5A 1O4XA 1NK3P 2QWWA 2XPWA 4OINF 2CG4A 4A6EA 1XCBA 2YUSA 1FYMA 4B8XA 3E97A 5CVJA 3BG6A 4AUXA 3SQNA 2L4MA 5D5WB 3RPUD 5L3GA 1UJ8A 5A2QK 4ENKA 4A3JJ 3KETA 1RUNA 1SAXA 3RKQA 3ABTA 2X85A 3G4SI 4KDPA 1BIAA 4WXDA 3FX3A 2DFEA 1Z3XA 2JA5J 4XLNF 2LY1A 1T95A 2X1DA 4FX0A 2CW7A 3MZHA 2ZXIA 1JT6A 3WTYC 2PQ8A 4UUTA 1RKWA 2QQAA 5J8FA 1K78A 1ZQ3P 2ZKZA 1HOMA 3VEPA 3DEEA 3FISA 2MA3A 3WTZA 2PJPA 3HEFA 2Y75A 1GXQA 5GPCA 2KL4A 4L9VA 1ETXA 3KFWX 3CCMI 4BEHA 1SD7A 5H6RA 3ROUA 4LG0A 1XMAA 3TL4X 4CHUA 2DA4A 2MFZA 2NVUB 5DUKA 3A0BC 5EGOA 2EZLA 5LRRA 1UG0A 1WPKA 2BW3A 3K4MA 4MHGA 5D5XB 3S1MJ 1SC7A 3WGGA 4R8HA 3P9CA 5K7HA 3LNQA 5BNGA 3ERED 3GZ5A 2R92J 2EA2A 5J1UA 5DD4A 2VL8A 3CMAI 2WAQA 4E7JA 1DP7P 3HOZJ 2KFDA 2IS2A 1QZZA 4GO1A 1ZYRF 4MEYF 1R1TA 1Z9CA 5GTIC 2GQQA 1Q1HA 3V4GA 4UVCA 2HTJA 3TEDA 4UNOA 2VE9A 3CDHA 4UVAA 3DTEA 1HKQA 2O7OA 5KAFC 2QCOA 3J81K 4RS8A 2QQ8A 2PBIA 1E3OC 3D5SC 2K3FA 1IW7F 4G6DA 4R1HA 2FXAA 4HX7A 4RAFA 2OZ6A 1IO2A 2VPRA 3M8EA 3P9IA 5BMZA 4L5EA 2IGMA 3LSHA 3R60A 1WH5A 4OOIA 3CP8A 1T0FA 1HDDC 2LKSA 3QOPA 1T8IA 1Z0XA 3DQVC 3HOSA 3WU2C 1I3AA 3JAMZ 2BVLA 2CMPA 2CYYA 4YFKF 1IAWA 3J80Z 1Y0UA 2E1OA 5EG0B 1J75A 5B5EC 2HEOA 3BZCA 1SFXA 1D0ZA 1K6YA 2KKOA 2MGQA 1P4AA 1FY7A 1RESA 3GEZA 2LBFB 1UCRA 4YFNF 3ESWB 3OYBA 3ECOA 1A31A 1RIOH 5L3BA 4BYYA 1DU0A 2R7DA 3WE3A 2JPBA 4FT8A 3BOQA 3ZQQA 3Q9SA 4D7NA 2COBA 3U2RA 1DP3A 2DPDA 1G2HA 1PVEA 2ZMEA 4P9UA 2DA3A 1N25A 3BZ6A 1EKEA 3S1NJ 2GZWA 2M5WA 5BPIA 2OD5A 3VYRB 3HJEA 4E7KA 3WTTC 4XRSG 1V5FA 1T39A 4GCVA 4A3DJ 3U9GA 1MDMB 3VYSB 3P7NA 3GFLA 3C1DA 4XM3A 2VQCA 1ZG1A 5IT9Z 3PL8A 5EEAA 1RR8C 1HLVA 1O3TA 1WQ2A 2L3DA 1MH4A 3B6AA 1XSXA 3MEXA 2E34A 2EIJH 4II2A 2J5OA 4BXXJ 1MMAA 1VQPI 1E3PA 4YRVA 1GUUA 2CU7A 4UXNA 1S29A 2W85A 3RKYA 4BQOA 4I09A 5E18F 1QNTA 2DK8A 1LB2A 1MSEC 5K5OA 4WX9A 1LVKA 5HDGA 1Z7LA 3KCCA 3FMQA 4KT6A 3OR2C 1I50J 2DFIA 2WAEA 5HLIA 3F23A 1ERDA 3H9JA 3G2BA 3GFIA 5D4RA 3JRAA 2DQRA 3HGYA 4IF4A 4CYCB 2F4MB 5IPAA 2VPLA 3CQZJ 2M30A 4BDYA 3M07A 5EEHA 4GDFA 2ZCWA 2D1HA 5EZHA 4DGWB 4KIFA 4YELA 1X2NA 1WGXA 4X1EA 2VODA 1P4WA 3ZQIA 4AIKA 3SEZA 4V2FA 2DMTA 4MEXF 2V6EA 3S2DJ 5K7FA 2B0LA 4I98B 4X6AJ 1Y56A 3WHCA 4KIGA 4J19A 3ZPLA 3L2CA 1F5TA 3K70C 1WH7A 1IC8A 3LAPA 2P6SA 1GT0C 2EJRA 2M4KA 1MNEA 4MFDA 3CP2A 2L9VA 2P4WA 3HHGA 2RAEA 3K69A 3FHNA 3FK6A 2JSPA 5JVTA 2KMUA 2ICWG 2V1XA 2Y30A 4LLGF 2XUBA 5LLQA 1EH8A 1EH6A 2H8WA 4RGRA 1ZGWA 4P1WA 3BT9A 2MBFA 2Q2EA 3BR6A 2YSRA 4U0VA 5DCMB 1LQ1A 4P55A 3OYEA 5CLSA 4GFBA 1UMQA 4QSHA 2EZIA 1JKQC 2CV0A 5IOYA 4IRHA 4ZYGA 1NH3A 4CGZA 2BOLA 5L3EA 4OAZA 4ESJA 3GTQJ 3MKYB 2FBIA 2IBDA 4A0ZA 1OCTC 5EJCA 3CF2A 5IOZA 2DPUA 4ZDLA 3WTSC 1P92A 4Q4ZF 3GLXA 1R58A 4BHCA 4M3GA 1TTYA 1YO5C 2VB6A 2OCCH 4YIRX 2DT5A 3E6MA 3VSKA 3HYIA 3M3YJ 1KU3A 2KZVA 2RGVA 2DDAA 2EPFA 2CSOA 2F2EA 2V9VA 4L9TA 2LF8A 2FA5A 2WTEA 2VBXA 3IH4A 3R0AA 1FYKA 1WWXA 1VI0A 2R5ZB 2XPVA 5J1RA 3HRSA 4OAYA 1U5TA 3IHUA 2LNBA 2IA2A 2JN6A 4HPQA 4CCLA 3D5RC 2KDZA 1FYLA 3HSEA 2P5VA 4ZH4F 2CQQA 5D4SA 1AHDP 4F3QA 1IRXA 4C3JJ 3CCYA 2E5ZA 1U9NA 1X3ZB 4M71A 1GDTA 2M87A 4HSTA 1VF9A 2KZGA 4BNCA 3OIOA 3BLYA 1OISA 1R36A 2E7XA 2NXNB 1XSDA 3LSKA 3IKVA 3WTUC 3E7LA 1ZARA 4ETSA 4ZTFA 2FNAA 2PJRB 1MBGA 4PJ0C 2EZHA 3BG9A 3L2QA 2KIFA 2IA1A 1OYIA 3MKWB 2HFHA 1BI0A 2G9WA 3GXOA 2JRTA 2KDOA 2CGPA 4DQ2A 2E1MC 2IGKA 2RVCA 1OCCH 4JX4A 1QHGA 1QGPA 2BY1A 2RKHA 5CVRA 2XF7A 3ZR8X 1VQNI 5E1XA 2MW8A 2W57A 2XHKA 2ZBKA 3OYLA 3C3WA 1X1CA 2X1CA 1YJNI 1BL0A 1OLTA 5KK1A 1XG1A 4U7DA 4IXAA 1IV6A 2Y2ZA 5H20A 1ETKA 2DFFA 4B44A 2A69F 3BJ6A 2BV6A 3EUHC 5DV5A 3NRVA 1OMIA 3V7SA 2BVMA 4MLOA 1LE8B 3PQKA 4P9FA 1QA6A 4G12A 4A93J 3KP3A 4HYEA 3A02A 1L3LA 1ONVA 2EA4A 2JWTA 4WXHA 4XLHA 3JRCA 1YLFA 4KITB 5EEGA 1A04A 4B43A 2PX9A 4E70A 5DM7F 5E79C 2W7NA 5A2QZ 3F3XA 3ML6A 2FQ3A 1PYVA 3FKJA 1JUMA 1NHAA 3OMYA 3L2WA 3I58A 2KLOA 1FOKA 2L01A 2DJIA 4HX8A 2STTA 4XOPA 5FKMA 2PMUA 4CO8A 4CUGA 2WAFA 3LSIA 3HOVJ 2CFOA 2EFOA 1J7KA 1KYZA 2YU9J 2GBYA 4RAYA 1WJAA 2DI3A 1A36A 1XGSA 3L09A 4PJJA 2K9QA 1ZR4A 2IEKA 4XOTA 3DBLB 4E7ZA 4B09A 3RI4A 2H09A 1POGA 5C4JJ 3T0YA 3TO6A 1TNTA 2FBKA 5CVUA 3J7ZI 1S7OA 3HOXJ 4JYKA 2Y0MA 1OYWA 2DT6A 3MQ0A 3S3OA 4BJTA 4L5JA 2XDVA 2OCEA 4N9HA 2WC2A 2Q0OA 5FJ8J 1G4DA 5D8LB 3CMMA 1B72A 1E17A 2MD0A 5EDNA 3ZMTA 1YITI 2R7TA 4M3EA 4U88A 1X2MA 2KP6A 1Y1VJ 2XAGA 5HNFA 3KYDB 4I76A 3LSMA 3F6OA 2EK5A 2OTJI 2OAZA 2R7XA 1IRGA 2ZMEC 2RQQA 2EH3A 1B6AA 3J80K 3BTJA 1TWHJ 2AXLA 5ICEA 2FMYA 1FX7A 1ZH5A 1MBFA 2ZMEB 2C6YA 3WHBA 2MD5A 5GADJ 2BXZA 3RZDJ 5GTHC 2NVYJ 4G9YA 3CCSI 3EUHA 3BCBA 2B7EA 2K27A 3BG3A 4UUSA 4DJAA 1O3SA 2ZFUA 4EJTA 1LDKB 2OQRA 5KAIC 1Z21A 1IRZA 3E5QA 3LL7A 2V1NA 2VXDA 2L9NA 1LKXA 4B4CA 4A69C 1BI3A 2KIQA 4L0ZB 1ON2A 3MWMA 4LOCA 1BOBA 3DU6A 3DP7A 4K2EA 3E1SA 3PNTA 4EM1A 4CH7A 2BBYA 4EV0A 2GA1A 1Z3YA 1YJ9I 2E2JJ 2BW3B 2OJED 3HOUJ 4MIMA 1C0WA 3DXJF 5C4XJ 4MQ9F 3HZJA 2FU4A 2QUFA 4ZYAA 3L2UA 1ETVA 2CUEA 1XMXA 2VT2A 2V79A 4HDVA 3O8HA 4XBFA 3Q5FA 1TW3A 1XGMA 3BG7A 3D0SA 4XL9A 3Q3SA 2ME0A 5TRDA 2VJ4A 4DYQA 3VYTB 3QODA 1ZG3A 1USTA 2H94A 1W1WE 3VYUB 3JTGA 3AG1H 1D8KA 2JQ7A 4TV7A 4RGSA 1JKRC 3JW4A 1QZEA 3D1NI 3K4BA 3OSGA 2EFWA 1KGSA 5CVIA 3JSOA 1MGTA 2H6BA 2NS7A 2FBHA 1Z91A 1D0XA 5EYRA 2EIMH 5KCMA 3OS1A 1UZCA 2XAUA 5HNHA 4EJWA 5HLTA 4RGUA 4BXFA 2ZNYA 4IEJA 3ZQCA 2KJCA 2V9PA 3KP7A 1XDSA 3NAUA 4OWRB 2Y9ZA 4A5MA 4B3XA 2LMDA 5LHHA 1CF7A 4ABZA 4CCKA 4ENNA 4NUBA 5JR3A 2H6CA 3CUQC 1BW6A 2ISYA 1WJEA 2ADUA 2JUCA 3E0JB 1W36D 4UB8C 1X4OA 4CZCA 2IT0A 1U5TC 3K1PA 4NNJA 5M5YJ 1VQ6I 3DBHB 4CA0A 3J7AY 1FBSA 2VQLA 4E7IA 2VJIA 1H0MA 5ICCA 1MIJA 1K78B 2NVTJ 2KHMA 3G73A 3OYCA 1UHMA 1XX5A 4AIJA 2R5ZA 2M0CA 1ZLJA 3GMEA 2EV5A 4C2UA 4KMFA 1YX3A 3IRQA 2BEOA 2I5UA 4AC0A 2HKOA 1FNNA 4CZZA 4BE2A 1ZR2A 5E8GA 4L9JA 2V1DA 3S2WA 2JTVA 2R7QA 1HKTA 1MW7A 1LUJB 3K10A 2R5YA 1G3WA 1LPQA 2Z33A 2F48A 3M8FA 5FRNA 2LRDA 1XC5A 1UELB 4B3AA 3IH3A 5IT3A 1IRFA 5E3MA 2XGEA 5JLWA 3ZQ7A 1VFCA 3LFKA 4OIPF 1Y0NA 1U0JA 4GRIA 1PP7U 2AQEA 2RN7A 3A1YA 3PFYA 2VJJA 4IOAF 3PNYA 5DCMA 1TLHB 2XB5A 3EUAA 1DU6A 1DPUA 2FEZA 1Z1DA 3M8JA 4Z6YA 3TP3A 4D7MA 3CCUI 4M3FA 2E19A 2KIMA 1PUFA 1XS9A 3HIFA 1F36A 5C3EJ 2H8RA 1Z6TA 4BGDA 2WB1A 1H89C 2WA0A 2XB0X 3A01A 2DYSH 4M3DA 4M3BA 2DTRA 1KQ9A 3BR1A 4FCYA 5ILUA 3O6BB 4G94A 2DJNA 5DS9A 2A6TA 2V6CA 4EEFG 3M9AA 5LEJA 1S5LC 4ITVA 3W3CA 1IXRC 3HL2A 2L7ZA 5L3CA 3I0TA 3EUKL 3KPHA 5J40A 2DMPA 2GWRA 3FXMA 1H9GA 1ZRCA 3H3VK 4XIDA 4IHXA 1LFBA 2OF7A 3HBLA 3N97A 3TQNA 3WE2A 4HF2A 2MLKA 1APLC 1R5GA 3QPSA 1B1BA 4E7LA 1ZREA 3S15J 4PGGA 1LE8A 4YIFA 3ZQLA 4V2GA 4M74A 4G6QA 1R4NB 1W0UA 3HHHA 3GTOJ 3GO5A 1NG6A 1LFPA 2DA6A 1GV2A 1ORKA 1XTAA 5J8CA 4UB6C 2DAOA 4XR6A 5D6EA 1OCPA 2M2EA 3LQQA 5F1JA 4L9NA 1B9MA 1LEAA 4R79A 2Y0SN 1QHHD 2IXSA 1RNLA 4U0YA 4D1QA 1SD6A 2BY2A 3A03A 3RJPA 4RLQA 5E1WA 4LGWA 4A3EJ 2VOPA 1QVUA 1MDMA 1D5YA 5K5QA 2QKMB 3CF5F 1MSFC 1Z05A 1MJBA 2R5YB 3OOPA 3BDDA 3L7WA 1QRYA 3BPVA 3TO9A 2DXIA 1STZA 2BYVE 2F4OB 2GM4A 1JGSA 3DPTA 3M4OJ 3W2VA 1WJDA 2QLZA 3FMRA 3U1KA 2HXIA 3K1NA 2L54A 3OWTA 4RGXA 4UV8A 3RZOJ 1RZ4A 2P81A 2LOOA 2HKXA 4JK1X 4CICA 2R93J 3MVPA 3KZYA 5KVRA 2LBFA 1H88C 3FZVA 2JK3A 2R4GA 1EH7A 1BIBA 1IV8A 4UVBA 1IUYA 3X2QH 2MABA 2NVQJ 3BY6A 2EFPA 2ZSHB 2NNYA 1G6NA 5HVQC 5JFRA 2W48A 3MCZA 4NQWB 2GAUA 2X4HA 1U8RA 1DDNA 4PSWA 3BR0A 4M6VA 1LVAA 3HKZA 3ZGKA 1WI3A 2QZ8A 4Q47A 2HQNA 2XRNA 3OR1C 3KP6A 4LD5A 4XSXF 3CC2I 1VQKI 1UFMA 4L18B 4CCOA 4EVIA 4DZJA 3GTMJ 4A2UA 2ELKA 1R5HA 3JREA 3TW6A 1QPMA 1DQUA 3S2HJ 1MD0A 4A3IJ 2JMWA 2MC4A 1U2WA 2D45A 3DWLE 4HW0A 4Y15A 4NB5A 3QAHA 1OR7A 1SVMA 4A3GJ 1BI1A 4LIUA 5K5RA 5BQTA 2VLAA 3CJRB 2EB7A 3IAS2 5H2FC 3HSFA 3U1DA 3PJRA 3FMSA 3K2AA 2IRFG 1BJZA 3OYDA 4LIVA 4J01A 2O8KA 1LJ9A 2H1KA 2JSCA 3C7JA 1TWGJ 3RCOA 1IN7A 4O3MA 2HQ5A 3CJTB 5FGMA 3G1MA 2AS5F 1R1UA 2VKDA 4DIQA 2LD5A 3BZKA 3M1CA 4XONA 2O9LA 3T1BA 1MKMA 2Y31A 5EGOB 3I55I 2JPCA 4A5NA 1FZPB 1R5ID 2CW8A 3WTWC 5FLMJ 2CQKA 1U6GA 2BHYA 1TC3C 4XLFA 3S14J 1RI7A 5LFAA 1HBXG 1ZGAA 4HRIA 1IZ1A 2CUZA 3IV5A 3OYFA 1BW5A 2NOGA 3CESA 1ZTRA 4BE0A 3PIOF 2J5PA 1P7IA 2W84A 3QPHA 2K40A 2VC0A 4NBQA 3HGGA 4V19K 4PJMA 1ODDA 3D5LA 4XLAA 1B9NA 3K2ZA 3QPLA 1W5TA 3V7RA 3CO6C 1AWCA 2DODA 2QQ9A 3IAM2 2LC2A 1A6QA 4BU2A 1ULYA 4I02A 2IVMA 3VFZA 2M45A 2FD5A 4IVNA 3GVAA 4AYBN 3G1LA 5J1YA 2A6HF 1BC8C 4MFEA 4FE7A 1VQ4I 2L7FP 2XGXA 4JP0A 3WG9A 3BTCA 1X19A 4UHTA 1AA7A 2CW0F 5B1AH 1MBJA 2DCEA 1BOAA 5AIPA 4PFOA 1ZAOA 3GBGA 3H0GJ 4HF1A 2GXGA 4KICA 3JRBA 2D5VA 2JA2A 3TMOA 4HOBA 5ICFA 2XKPA 4EGZA 2R7WA 2L02A 1IXCA 1N78A 1J0RA 4HLXA 2OUMA 3R6SA 1IF1A 2E1MB 2O61A 4ZDPA 3I4MJ 2L7KA 1JI8A 2XF5A 2HGCA 1G3TA 3BPXA 3CZ6A 3S3MA 3FF5A 2EV6A 4AU7A 2WV1A 2ACJA 1CGPA 3H3ZA 3I64A 3GYHX 1QQIA 2EILH 2CO5A 3A4CA 2XASA 4XSZF 1NTCA 1HF0A 4L5IA 4EGYA 2DW4A 3JR9A 2KPMA 3HXLA 3GX4X 2XV4S 3PUBA 2CQNA 4NC8A 3SJMA 4Y7NJ 2KRFA 2NS0A 4C3IJ 4G7OF 4LITA 4U87A 5M3MJ 2W82A 2F5DA 1EJ9A 4LB6B 3V42A 3GZ6A 1WJCA 3OL3A 1B8IA 2X0LA 4I0AA 2IGOA 3DEUA 5KHDA 2HZTA 2JA8J 3I4NJ 1SMTA 2EZKA 2QGUA 5F08A 3UKGA 2GLOA 3A2KA 1HSJA 3KYCB 2L9RA 1U8BA 9ANTA 5LRSA 1XMKA 1FJLA 2X48A 2X6XA 3IH2A 3JRHA 2ZB9A 2R7ZJ 5IP7J 2UXNA 3Q0UA 2KJBA 5M3FJ 2PFBA 1BR4A 1EF4A 4DNCA 3SYTA 1SMYF 4N9IA 3T8TA 5HODA 1ETQA 2VKHA 1K4SA 3OYAA 3QOEA 3AFHA 1UB9A 3RPQA 2BY0A 2E5NA 5GPAA 5DM6F 2COMA 4XLCA 5GAGJ 2VIXA 3F21A 2E36A 3KLNA 3LSGA 2HOSA 2QF7A 3GTPJ 4PZJA 4YEJA 3SEQA 2QA4I 1QBJA 2PI0A 4FE4A 3DFGA 2OV7A 4AVPA 3OS2A 3WU0A 2K9SA 2ZJPF 4KISA 3TDUC 5KNLA 4Y17A 3T5XA 3J7AO 3GZNB 3HC7A 1X58A 2MH2A 3SDGA 3QRFF 1MMSA 1UAAA 3ERMA 1T98A 2R7FA 3LSJA 5J6XA 4BXUA 1E0EA 4ASNA 1SD5A 4MQVA 3RKWA 3V7CA 1T38A 1RUOA 2CV2A 3K4CA 1TNSA 1ZG5A 3DF8A 1TWAJ 3C2GA 4GYGA 1YYVA 1MMDA 2F4IA 5F0FA 4DOZA 5FKKA 2JA7J 1XDUA 5B1BH 2Q1ZB 4N0BA 1YIJI 3I59B 3FK7A 5M5WJ 1V5GA 1Y1WJ 1GVDA 4IX7A 4PJLA 5JI6A 5IY5H 2HVQA 3KEOA 4ZZLA 4YG2F 2PEXA 1T6SA 2IJLA 3C18A 3FBIB 2CRGA 2QEXI 3Q0WA 2BGCA 4Q5SF 1D5VA 2DOAA 2JRMA 3ZMVA 4EMSA 1U5TB 2VOOA 2A05A 2I10A 1X4PA 2CUFA 4W1UA 2ISZA 3P5JA 1P7JA 2NOJB 1X1AA 4CDGA 3SXYA 4B47A 4A6DA 3RYRA 1K6OA 1W5SA 4IRGA 3PO3J 1TT0A 2DDBA 2ESHA 4ESBA 2JT1A 3C2BA 5E3NA 3NEUA 5FLXZ 1ZK8A 2F5VA 5TJJA 5E20A 3TO7A 3V8KA 2XGCA 1T56A 3EETA 3ZMUA 2K85A 3MMYB 1YW8A 1R4MB 2FOWA 2Z1DA 1BM9A 1MBKA 1ETWA 2K9MA 1T33A 1O57A 1I6HJ 3Q0VA 2CQ7A 2M8GX 2UZKA 4HAMA 2UXXA 4JQFA 4G7ZF 4ZZDA 3F0CA 1P9QC 3BJOA 1U3EM 4NQWA 1BR2A 1TBXA 3L1PA 5HDKA 4EQQA 3ZCOA 3GCMA 1O3RA 2HOTA 4I0BA 2WY7Q 3OY9A 3ASOH 5IYBJ 2VI6A 5IYCJ 4CSWA 1SFEA 1TQMA 2X51A 2DT7B 2DO7A 3KP5A 1YJWI 4RDUA 2KT0A 2ME6A 1FEXA 3I9V2 2Q2EB 4KT5C 3HDDA 2EBIA 3PFIA 2XAQA 2IS4A 5FFZA 1D0YA 2XC7A 4PJNA 2EV0A 3E5XA 3A0HC 1JHHA 2L0KA 2QSHX 2VN2A 1W7PB 3S32A 5CQGA 3N4MA 3PNVA 3V8JA 3DKXA 3HOYJ 4N4NB 3EYIA 2ZJ2A 3HUGB 3MZYA 4HZFA 3GTKJ 4BQNA 1DGRM 3MZ8A 2L9SA 2LY2A 3S8PA 2A5YB 3ZN0A 1WJFA 1SVLA 1WCMJ 3BR3A 3CCJI 2LG4A 3ZRGA 2QBYA 5E3LA 4HA8A 1DGWY 2Y69H 2Z3YA 1FC3A 3BTLA 2UUZA 2DK5A 3ONQA 3HG9A 3QU3A 4ON0A 3HB9A 1WZ2A 2HDDA 5ED4A 2BZTA 2WY8Q 1BBYA 1FP1D 4I6ZA 3O3KA 2KRHA 3PQJA 1H8AC 2KISA 4HNUA 3IWFA 3CCEI 1D1CA 1Y8QB 1TWFJ 1JJ6C 1FIPA 2DMUA 5CYVA 5LGTA 2A5WA 3CLQA 1JKOC 4O5VA 4RBOA 2GOMA 3F6VA 2JJ7A 4JBAA 1WKMA 1D3YA 2OPTA 2N8GA 1JT0A 1JUPA 3ABMH 3DTIA 5IP6A 5JLXA 3CCVI 2H1LA 2YPRA 2ZFWA 1IN8A 2R3SA 1Z77A 1ZELA 4Y52J 1HW2A 2Q8KA 3S1QJ 3F9KA 3QYFA 1SEUA 3W2WA 2HYFA 2HWVA 1YW7A 2WV0A 3F72A 3QWLA 5HS9A 3PSIA 1R49A 4IHWA 2NAZA 3B6CA 2FMLA 1KYWA 2GXBA 3VOEA 3ZQHA 3TW7A 5BPDA 1TWCJ 2WWYA 5LD2C 3DBRB 4E4HA 3TOAA 4M6XA 1PDNC 1ON1A 1XSVA 1XGOA 1VQ8I 4A3LJ 3S1RJ 3BTIA 2IP2A 3KP4A 1Z67A 4E6KG 1QU3A 3A01B 1W5CC 2X6WA 2O03A 4QIWN 3VWBA 4UY8I 2DA2A 1VQ9I 4I2OA 4MTDA 4D5CA 4PDKA 4XQFA 4CCMA 1PUFB 2NS8A 4MNUA 4DBQA 4G8XA 3RPUA 2LK2A 2M4GA 3G71I 3L9FA 3FIWA 4LG3A 3K4KA 3RSNA 1FLIA 5FD6A 1W4MA 1JJ8C 1G8XA 3S3NA 3S93A 1X1BA 1NK2P 1ZLKA 2JZYA 1RETA 5EG0A 1F1ZA 2QSFX 1VQ5I 1T08B 4FISA 1O7LA 4YFXF 4CXFA 4EATA 2L4AA 4I99C 3PSFA 3W2AA 2ZJQF 1UHSA 1IN4A 2DA7A 2M1BA 2PMZA 5FD5A 3FBNB 2P6TA 4BKXA 4BY1J 1OJLA 4A0XA 4IHTA 1BN5A 3F8FA 3JSPA 1WI9A 2CQXA 2TRTA 1KQ0A 4EM2A 1JTXA 3DV8A 1Z6RA 1V55H 2K4BA 4PCQA 1WSUA 3K4JA 3K9TA 4G6TB 4ZYDA 2V1UA 3RIRA 1IDZA 4BACA 1OFCX 1FOXA 2TDXA 3I4PA 3EQLF 2FRHA 1YS6A 1V5EA 3ZXSA 5HLGA 3BWGA 3KP2A 4BQAA 1S3JA 4BJ5C 1J09A 1I27A 4RB0A 2A61A 5FFXA 4BHBA 5BS6A 4ZTJA 4NHJA 2DMQA 1P6RA 4C9YA 5LEKA 4A3KJ 4O6JA 3TKYA 4DBRA 5J47A 2GXAA 2E71A 2V4JC 3AG2H 5FRMA 3S17J 1YI2I 5FKOA 4OIOF 3M7GA 2DQLA 4HLYA 1HDPA 1SFOJ 3Q9VA 3BR5A 5K7ZA 1G3YA 2K5CA 1CF7B 1EA3A 5HS7A 3LA7A 3R0JA 2GA2A 3MN2A 5L3DA 3OYMA 4PUSA 3I54A 4LG0B 4HQMA 4OU0A 1FSHA 3KX2A 1W7PD 2XRLA 3JRGA 5LGNA 2QVOA 3E5UA 3F8MA 2LTPA 3K6GA 3CD6I 2CUJA 1R00A 1K79A 4L0YB 1K4TA 1YS7A 3ULQB 5H6QA 3VPRA 4AIDA 3F8NA 2OU2A 1TZLA 4E7SA 3LFUA 1FOWA 1MNDA 2Z5UA 3KZIC 5GP9A 4RA2A 3OYGA 1X3WB 2EFNA 3I53A 2BY3A 4J00A 2Z2SB 2P8TA 1TT5B 2VKEA 2Y9YA 2M34A 4BBRJ 3L2RA 5LGUA 3ABKH 3F8CA 3SZPA
chains in the Genus database with same CATH topology
3CJNA 2ZNZA 1QZYA 1ZRDA 3WTVC 2CFXA 2RV8A 4G7HF 3TDZC 3FM3A 5E17F 4LFUA 1O3QA 1H9TA 2STWA 1J2XA 1FP2A 2XAFA 1XB4A 3RYPA 5HOOA 4LLNA 2M8EA 5FLXK 3IC7A 3SZTA 2GIVA 3ECHA 4OIQF 2VC1A 3IRRA 2LDUA 4WXCA 4H0EA 3QU6A 4CYDA 1FBQA 4GXOA 1ZGJA 2VONA 4I01A 1LDDA 3FXUA 2NYXA 5LHIA 2KIUA 2NRAC 1USSA 1GHCA 2YR2A 4LB5A 1JE8A 1SD4A 2K7LA 3GF2A 2VBWA 1YTYA 3B73A 1OKRA 3ELKA 3IWZA 5DEQA 4ZYHA 3AAFA 1S7AA 2PMHA 2A3SA 3G3ZA 2ESNA 1IN6A 1HSTA 4WCGA 3DPLC 1DPRA 2PG4A 3JTHA 3HRMA 2UWMA 2DBBA 3V8LA 3COAC 5HLHA 3W6JB 3LAJA 2A6EF 3FXQA 4BH9A 5BOXA 3M1EA 1VTNC 4EM0B 5CVVA 3GFJA 4LLLA 3KLOA 4M72A 2HS5A 2O0YA 4HBLA 1W7PA 2RNJA 2IA0A 1KA8A 2IPQX 1JHFA 3E6DA 2ETHA 3H3UA 4YIIA 3GFMA 2PN6A 1LDJA 2QBYB 2PLYA 3L00A 3CO7C 3GW2A 1HW5A 1QO0D 2F5CA 2BE5F 3VB2A 3R61A 4D0PA 1MJAA 3HUGA 2F5EA 3MAJA 5E1ZB 3CUQA 3HRUA 4QLCU 5LBQA 1HW1A 4XRFA 1T2KA 1FSEA 1I1SA 1I6XA 2VXZA 1OPCA 2YU3A 3K1MA 2QENA 4LK0F 4P5OA 5F6FA 1F4KA 1BI2A 2OZUA 2MH9A 4KN4X 5F1RA 1K7AA 1UHWA 2HR3A 4ZYEA 3REOA 2MLGA 3WU1B 4U0WA 2XAHA 3LQRA 4GGGA 2W24A 3LA3A 5D8KB 1KU7A 4F7ZA 3CUQB 2XAJA 2P5KA 4KIBA 2YX7A 5L3FA 3ZMZA 3ISPA 4AD9A 1DUXC 2FE3A 1O7FA 1D8JA 2P5LC 1SFUA 3EYYA 1R7JA 1E2XA 3O2PE 3E3VA 2QM3A 3GUDA 4BAYA 2RC4A 2P7VB 4KA4A 2MC3A 2FNPA 5AIQA 3I59A 4KN7X 1LEBA 4RB3C 1TW2A 3VODA 2E1CA 3QP6A 1LNWA 1HQCA 1J59A 3MFKA 2EWNA 5ERIA 1S8NA 1YIOA 1BC7C 4M9XA 2XIGA 1F9NA 4AIHA 2K02A 4LMYA 2QQBA 3OV8A 1GXPA 3SHFA 4HX4A 2IW5A 3GWZA 3TOBA 1ZHFA 4U7BA 4IJAA 4KYWA 6PAXA 3EDPA 3HTSB 3J81Z 4WF2A 3ZP5A 2Y48A 4A0YA 1R23A 4EJOA 1KU2A 2HDCA 4M9SA 2O8XA 4RAZA 1MZBA 1U78A 1HKSA 4IHSA 3ZMDA 2P7CB 1YW9A 3E6BA 3QP5A 2ZO4A 2Z9OA 3K0LA 2E7WA 1AOYA 2F5FA 2OBPA 2HQRA 4I7HA 4S05A 2W25A 4IPAA 5K1YA 3FWEA 3LA2A 3KZZA 3HOTA 4HF0A 5HS8A 2LSOA 1V4RA 4M6YA 3BP8A 1XD7A 3QPTA 3ZMSA 4FX4A 4LJZF 4M73A 4OMZA 5CJ9A 4KNYA 4QWQA 4UV9A 2NNNA 1WRJA 2G7HA 1XN7A 3SFZA 3FHZA 1B4AA 1OYYA 3F8BA 2HTSA 3LWFA 3HRTA 1JXSA 2EFQA 4S04A 5D6FA 2A07F 4EJUA 4AWXB 2RDPA 4KMUX 3WTXC 4KUMA 5AONA 1XGNA 4XLPF 3E6CC 4ESFA 2VBZA 1BJAA 3W6KB 4Z2YA 2QYOA 5HDNA 4MGRA 5D5UB 2YX4A 4GYIA 1Z7UA 4BHPA 1I5ZA 2ZXJA 5DCFA 1R22A 2VE8A 3NQOA 2K86A 2CWEA 1FBUA 1KQ8A 2LKPA 4OIRF 5DD8A 1B59A 4LK1F 1L0OC 3JAMK 5F64A 1HXDA 4HV6A 5ICGA 2HOEA 1FT9A 3CUOA 2DU9A 3RDIA 5ILSA 2FOKA 4IRIA 3TGNA 1IXSB 1I1GA 4M9ZA 1YG2A 5DYMA 3CTAA 2XROA 1ZN2A 2D2WA 1V3FA 3ZN1A 4RB1A 1FPQA 2OA4A 1MJ9A 2HYGD 4PGHA 4HQEA 1YFHA 5IT9K 3H92A 3IKTA 1REPC 1TQIA 2OQGA 3WODF 4KFCA 4MTEA 1EV7A 2K4JA 2LF7A 2O3FA 5FO5A 1PP8F 4WK8F 3FXRA 4HDUA 3RKXA 5DUIA 3KE2A 2XVCA 4OMYA 1S6LA 3I5UA 3KEQA 3WGIA 3DKWA 3T8RA 3HSRA 5E8IA 1GVJA 2DLLA 3F22A 3BJAA 3P9KA 3LSTA 2VBYA 1J5YA 4P96A 1KU9A 5JHUA 4A12A 3CLOA 2FF4A 2G7UA 4FHTA 3RTRA 3R4KA 3IL2A 2Z99A 3HTUA 5D5VB 3ABUA 4Y13A 3FM5A 5LHGA 1PUEE 2XKOA 5FB2A 4HV5A 2O6GE 2VT3A 4Q48A 3BROA 4ENMA 5DDGA 1YQAA 1TQPA 3B02A 1G3SA 2D1VA 3I71A 4RB2C 5ILVA 2FSWA 1ZRFA 1P4XA 2H27A 4UUVA 4WWCA 1J9IA 1X3UA 1XCVA 1R1VA 4ENJA 2RQPA 2A68F 2E1NA 2ELHA 1P2FA 1FWZA 3WGHA 4EJVA 1IN5A 2QWWA 4OINF 4A6EA 2CG4A 1XCBA 1FYMA 4B8XA 3E97A 5CVJA 3SQNA 2L4MA 5D5WB 5L3GA 4ENKA 5A2QK 3KETA 1RUNA 1SAXA 3ABTA 4KDPA 1BIAA 4WXDA 3FX3A 4XLNF 4FX0A 3MZHA 3WTYC 2PQ8A 2QQAA 5J8FA 1K78A 2ZKZA 3VEPA 2MA3A 3WTZA 2PJPA 2Y75A 1GXQA 4L9VA 3KFWX 1SD7A 5H6RA 3ROUA 4LG0A 1XMAA 4CHUA 5DUKA 5LRRA 4MHGA 5D5XB 3WGGA 4R8HA 3P9CA 3ERED 3GZ5A 2EA2A 5DD4A 1DP7P 1QZZA 4GO1A 1ZYRF 4MEYF 1R1TA 1Z9CA 2GQQA 1Q1HA 3V4GA 4UVCA 2HTJA 4UNOA 2VE9A 3CDHA 4UVAA 1HKQA 3J81K 4RS8A 2PBIA 1IW7F 4G6DA 4R1HA 2FXAA 4HX7A 2OZ6A 3M8EA 3P9IA 5BMZA 3R60A 4OOIA 1T0FA 3QOPA 3DQVC 3HOSA 3JAMZ 2CYYA 4YFKF 1IAWA 3J80Z 1Y0UA 1J75A 2HEOA 1SFXA 2KKOA 1P4AA 1FY7A 3GEZA 4YFNF 1UCRA 3ECOA 1RIOH 5L3BA 4BYYA 2R7DA 3WE3A 2JPBA 4FT8A 3BOQA 3Q9SA 3U2RA 2DPDA 2ZMEA 4P9UA 3BZ6A 2GZWA 2M5WA 5BPIA 2OD5A 3WTTC 1T39A 4GCVA 3U9GA 1MDMB 3P7NA 3GFLA 3C1DA 1ZG1A 5IT9Z 1O3TA 1WQ2A 2L3DA 1XSXA 3MEXA 2J5OA 4UXNA 1S29A 2W85A 3RKYA 4I09A 5E18F 1QNTA 2DK8A 1LB2A 5K5OA 4WX9A 5HDGA 3KCCA 3FMQA 2DFIA 5HLIA 3F23A 3GFIA 5D4RA 2DQRA 4IF4A 2M30A 5EEHA 2ZCWA 2D1HA 4KIFA 2VODA 1P4WA 4AIKA 4MEXF 2B0LA 4I98B 4KIGA 3ZPLA 3L2CA 1F5TA 3LAPA 2P6SA 2EJRA 2P4WA 3HHGA 3K69A 5JVTA 2V1XA 4LLGF 2XUBA 5LLQA 1EH8A 1EH6A 4RGRA 2MBFA 2Q2EA 2YSRA 4U0VA 5DCMB 1LQ1A 4P55A 5CLSA 4IRHA 4ZYGA 4CGZA 5L3EA 4ESJA 2FBIA 4A0ZA 2DPUA 3WTSC 1P92A 4Q4ZF 3GLXA 1R58A 4BHCA 1TTYA 1YO5C 2DT5A 3E6MA 3HYIA 1KU3A 2RGVA 2CSOA 2F2EA 2V9VA 4L9TA 2LF8A 2FA5A 2WTEA 2VBXA 3R0AA 1FYKA 1WWXA 3HRSA 1U5TA 3IHUA 2LNBA 2IA2A 1FYLA 3HSEA 2P5VA 4ZH4F 5D4SA 4M71A 2M87A 4BNCA 1R36A 2E7XA 1XSDA 3IKVA 3WTUC 1ZARA 4ETSA 2FNAA 2KIFA 2IA1A 1OYIA 2HFHA 1BI0A 2G9WA 3GXOA 2JRTA 2CGPA 4DQ2A 2RVCA 1QGPA 2RKHA 5CVRA 5E1XA 2XHKA 2W57A 2ZBKA 3C3WA 5KK1A 4U7DA 4IXAA 5H20A 2A69F 3BJ6A 2BV6A 5DV5A 3NRVA 1OMIA 3V7SA 3PQKA 4P9FA 3KP3A 4HYEA 1L3LA 1ONVA 2EA4A 4WXHA 1YLFA 5EEGA 1A04A 4E70A 5A2QZ 3F3XA 3ML6A 2FQ3A 1NHAA 3I58A 1FOKA 2L01A 4HX8A 2STTA 4CO8A 2PMUA 2EFOA 1J7KA 1KYZA 4RAYA 2DI3A 1XGSA 3L09A 4B09A 3RI4A 2H09A 3T0YA 3TO6A 1TNTA 2FBKA 5CVUA 1S7OA 2Y0MA 1OYWA 3MQ0A 4L5JA 4N9HA 2WC2A 2Q0OA 1G4DA 5D8LB 1E17A 3ZMTA 4U88A 2XAGA 3F6OA 2EK5A 2OAZA 1IRGA 1B6AA 3J80K 2AXLA 5ICEA 2FMYA 1FX7A 1ZH5A 2ZMEB 2C6YA 2MD5A 4G9YA 3EUHA 2K27A 1O3SA 4EJTA 1LDKB 2OQRA 3E5QA 1BI3A 4L0ZB 1ON2A 3MWMA 3DP7A 4K2EA 4EM1A 4EV0A 2BBYA 2GA1A 1C0WA 3DXJF 4MQ9F 2FU4A 2QUFA 2VT2A 2V79A 4HDVA 4XBFA 3Q5FA 1TW3A 1XGMA 3D0SA 5TRDA 1ZG3A 1USTA 2H94A 3JTGA 1D8KA 4TV7A 4RGSA 3JW4A 2EFWA 1KGSA 5CVIA 3JSOA 2H6BA 1MGTA 2FBHA 1Z91A 4EJWA 4RGUA 2ZNYA 2KJCA 3KP7A 1XDSA 4A5MA 5LHHA 1CF7A 4ENNA 5JR3A 2H6CA 3CUQC 2ISYA 2ADUA 2IT0A 1U5TC 3K1PA 1FBSA 1H0MA 5ICCA 1K78B 3G73A 1UHMA 4AIJA 1ZLJA 2EV5A 4KMFA 3IRQA 2BEOA 2HKOA 1FNNA 4CZZA 5E8GA 4L9JA 2V1DA 3S2WA 2JTVA 1HKTA 1G3WA 2Z33A 3M8FA 5IT3A 1IRFA 3ZQ7A 3LFKA 4OIPF 1PP7U 2RN7A 5DCMA 1TLHB 1DPUA 2FEZA 1Z1DA 2KIMA 3HIFA 1Z6TA 2DTRA 1KQ9A 5ILUA 3O6BB 4G94A 2V6CA 5LEJA 3M9AA 1IXRC 5L3CA 3I0TA 2GWRA 1ZRCA 1H9GA 3N97A 3TQNA 3WE2A 4HF2A 2MLKA 1R5GA 1B1BA 1ZREA 4PGGA 4YIFA 4M74A 4G6QA 3HHHA 3GO5A 5J8CA 2DAOA 5D6EA 3LQQA 4L9NA 1B9MA 1LEAA 4R79A 1RNLA 4U0YA 1SD6A 3RJPA 5E1WA 4LGWA 2VOPA 1MDMA 5K5QA 1Z05A 1MJBA 3OOPA 3BDDA 3L7WA 3TO9A 3BPVA 1STZA 2BYVE 1JGSA 3DPTA 3FMRA 2QLZA 3K1NA 2L54A 4RGXA 4UV8A 1RZ4A 2HKXA 4JK1X 4CICA 3KZYA 5KVRA 3FZVA 1EH7A 1BIBA 4UVBA 1IUYA 3BY6A 2EFPA 2NNYA 1G6NA 5HVQC 5JFRA 3MCZA 2GAUA 2X4HA 1U8RA 1DDNA 1LVAA 2QZ8A 4Q47A 2HQNA 2XRNA 3KP6A 4LD5A 4XSXF 1UFMA 4L18B 4EVIA 4A2UA 1R5HA 1QPMA 1MD0A 1U2WA 2D45A 4Y15A 4HW0A 4NB5A 3QAHA 1OR7A 1BI1A 5K5RA 5BQTA 2EB7A 3HSFA 3U1DA 3FMSA 2IRFG 1LJ9A 2JSCA 3C7JA 1IN7A 4O3MA 5FGMA 2AS5F 1R1UA 3T1BA 1MKMA 2JPCA 4A5NA 1FZPB 3WTWC 2CQKA 1U6GA 1RI7A 1HBXG 1ZGAA 1IZ1A 2J5PA 2W84A 3QPHA 2VC0A 1ODDA 3D5LA 1B9NA 3K2ZA 3V7RA 1W5TA 3CO6C 1AWCA 2QQ9A 1ULYA 4I02A 2IVMA 3VFZA 2M45A 4IVNA 3GVAA 2A6HF 1BC8C 2XGXA 3WG9A 4UHTA 2CW0F 1BOAA 5AIPA 1ZAOA 4HF1A 2GXGA 4KICA 4HOBA 5ICFA 2XKPA 4EGZA 2L02A 1IXCA 1J0RA 4HLXA 3R6SA 1IF1A 2O61A 2HGCA 1G3TA 3BPXA 3FF5A 2EV6A 2ACJA 1CGPA 3H3ZA 3I64A 3GYHX 1QQIA 2CO5A 2XASA 4XSZF 4L5IA 4EGYA 2DW4A 3GX4X 2XV4S 2KRFA 2NS0A 4G7OF 2F5DA 4LB6B 3GZ6A 2X0LA 4I0AA 3DEUA 2HZTA 1SMTA 1HSJA 5LRSA 1XMKA 2UXNA 2KJBA 2PFBA 4DNCA 3T8TA 1SMYF 4N9IA 1UB9A 3RPQA 2COMA 3F21A 3KLNA 4PZJA 1QBJA 2PI0A 3DFGA 4AVPA 3WU0A 3TDUC 4Y17A 3T5XA 3J7AO 2MH2A 3QRFF 1T98A 2R7FA 5J6XA 4BXUA 4ASNA 1T38A 1SD5A 4MQVA 3RKWA 1RUOA 3V7CA 1TNSA 1ZG5A 3DF8A 4GYGA 1YYVA 1XDUA 4N0BA 3I59B 5JI6A 3KEOA 4ZZLA 4YG2F 2PEXA 1T6SA 2IJLA 3C18A 2BGCA 4Q5SF 1D5VA 3ZMVA 4EMSA 1U5TB 2VOOA 2ISZA 4CDGA 3SXYA 4A6DA 3RYRA 1K6OA 1W5SA 4IRGA 2ESHA 4ESBA 2JT1A 3NEUA 5FLXZ 5TJJA 5E20A 3TO7A 3V8KA 3ZMUA 3EETA 1YW8A 1BM9A 1O57A 2UZKA 4HAMA 2UXXA 4JQFA 4G7ZF 4ZZDA 3BJOA 1U3EM 4NQWA 1TBXA 5HDKA 4EQQA 1O3RA 4I0BA 1SFEA 1TQMA 3KP5A 2DO7A 4KT5C 3PFIA 2XAQA 5FFZA 2EV0A 3E5XA 1JHHA 2VN2A 1W7PB 3N4MA 3V8JA 3EYIA 2ZJ2A 3MZYA 4HZFA 2A5YB 3ZN0A 2QBYA 4HA8A 3QU3A 2Z3YA 1FC3A 2DK5A 4ON0A 5ED4A 1BBYA 1FP1D 3O3KA 3PQJA 3IWFA 5CYVA 5LGTA 4O5VA 3F6VA 4JBAA 1WKMA 1D3YA 2YPRA 2ZFWA 1IN8A 2R3SA 1HW2A 2Q8KA 2HYFA 2HWVA 1YW7A 2WV0A 3F72A 5HS9A 2NAZA 2FMLA 1KYWA 2GXBA 3VOEA 5BPDA 2WWYA 3TOAA 4M6XA 1PDNC 1ON1A 1XSVA 1XGOA 2IP2A 3KP4A 2O03A 4I2OA 4MTDA 4PDKA 4MNUA 4G8XA 3RPUA 3L9FA 1FLIA 5FD6A 1W4MA 1ZLKA 2JZYA 1F1ZA 1O7LA 4YFXF 4CXFA 2L4AA 1IN4A 2M1BA 5FD5A 2P6TA 4A0XA 4IHTA 1BN5A 3F8FA 3JSPA 1WI9A 1KQ0A 4EM2A 3DV8A 1Z6RA 2K4BA 4PCQA 1WSUA 3K9TA 4ZYDA 2V1UA 3RIRA 2TDXA 3I4PA 3EQLF 2FRHA 1YS6A 5HLGA 3BWGA 4BQAA 3KP2A 1S3JA 4RB0A 1I27A 5FFXA 2A61A 4BHBA 5BS6A 4NHJA 1P6RA 5LEKA 4O6JA 3TKYA 4OIOF 3M7GA 2DQLA 4HLYA 3Q9VA 1G3YA 1CF7B 5HS7A 3LA7A 3R0JA 2GA2A 5L3DA 3I54A 4LG0B 4HQMA 4OU0A 1FSHA 1W7PD 5LGNA 2QVOA 3E5UA 3F8MA 1R00A 1K79A 4L0YB 1YS7A 3ULQB 5H6QA 3F8NA 2OU2A 2Z5UA 2EFNA 3I53A 2P8TA 5LGUA 3F8CA 3SZPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CJN A;  2ZNZ A;  1QZY A;  1ZRD A;  3WTV C;  2CFX A;  2RV8 A;  4G7H F;  3TDZ C;  3FM3 A;  5E17 F;  4LFU A;  1O3Q A;  1H9T A;  2STW A;  1J2X A;  1FP2 A;  2XAF A;  1XB4 A;  3RYP A;  5HOO A;  4LLN A;  2M8E A;  5FLX K;  3IC7 A;  3SZT A;  2GIV A;  3ECH A;  4OIQ F;  2VC1 A;  3IRR A;  2LDU A;  4WXC A;  4H0E A;  3QU6 A;  4CYD A;  1FBQ A;  4GXO A;  1ZGJ A;  2VON A;  4I01 A;  1LDD A;  3FXU A;  2NYX A;  5LHI A;  2KIU A;  2NRA C;  1USS A;  1GHC A;  2YR2 A;  4LB5 A;  1JE8 A;  1SD4 A;  2K7L A;  3GF2 A;  2VBW A;  1YTY A;  3B73 A;  1OKR A;  3ELK A;  3IWZ A;  5DEQ A;  4ZYH A;  3AAF A;  1S7A A;  2PMH A;  2A3S A;  3G3Z A;  2ESN A;  1IN6 A;  1HST A;  4WCG A;  3DPL C;  1DPR A;  2PG4 A;  3JTH A;  3HRM A;  2UWM A;  2DBB A;  3V8L A;  3COA C;  5HLH A;  3W6J B;  3LAJ A;  2A6E F;  3FXQ A;  4BH9 A;  5BOX A;  3M1E A;  1VTN C;  4EM0 B;  5CVV A;  3GFJ A;  4LLL A;  3KLO A;  4M72 A;  2HS5 A;  2O0Y A;  4HBL A;  1W7P A;  2RNJ A;  2IA0 A;  1KA8 A;  2IPQ X;  1JHF A;  3E6D A;  2ETH A;  3H3U A;  4YII A;  3GFM A;  2PN6 A;  1LDJ A;  2QBY B;  2PLY A;  3L00 A;  3CO7 C;  3GW2 A;  1HW5 A;  1QO0 D;  2F5C A;  2BE5 F;  3VB2 A;  3R61 A;  4D0P A;  1MJA A;  3HUG A;  2F5E A;  3MAJ A;  5E1Z B;  3CUQ A;  3HRU A;  4QLC U;  5LBQ A;  1HW1 A;  4XRF A;  1T2K A;  1FSE A;  1I1S A;  1I6X A;  2VXZ A;  1OPC A;  2YU3 A;  3K1M A;  2QEN A;  4LK0 F;  4P5O A;  5F6F A;  1F4K A;  1BI2 A;  2OZU A;  2MH9 A;  4KN4 X;  5F1R A;  1K7A A;  1UHW A;  2HR3 A;  4ZYE A;  3REO A;  2MLG A;  3WU1 B;  4U0W A;  2XAH A;  3LQR A;  4GGG A;  2W24 A;  3LA3 A;  5D8K B;  1KU7 A;  4F7Z A;  3CUQ B;  2XAJ A;  2P5K A;  4KIB A;  2YX7 A;  5L3F A;  3ZMZ A;  3ISP A;  4AD9 A;  1DUX C;  2FE3 A;  1O7F A;  1D8J A;  2P5L C;  1SFU A;  3EYY A;  1R7J A;  1E2X A;  3O2P E;  3E3V A;  2QM3 A;  3GUD A;  4BAY A;  2RC4 A;  2P7V B;  4KA4 A;  2MC3 A;  2FNP A;  5AIQ A;  3I59 A;  4KN7 X;  1LEB A;  4RB3 C;  1TW2 A;  3VOD A;  2E1C A;  3QP6 A;  1LNW A;  1HQC A;  1J59 A;  3MFK A;  2EWN A;  5ERI A;  1S8N A;  1YIO A;  1BC7 C;  4M9X A;  2XIG A;  1F9N A;  4AIH A;  2K02 A;  4LMY A;  2QQB A;  3OV8 A;  1GXP A;  3SHF A;  4HX4 A;  2IW5 A;  3GWZ A;  3TOB A;  1ZHF A;  4U7B A;  4IJA A;  4KYW A;  6PAX A;  3EDP A;  3HTS B;  3J81 Z;  4WF2 A;  3ZP5 A;  2Y48 A;  4A0Y A;  1R23 A;  4EJO A;  1KU2 A;  2HDC A;  4M9S A;  2O8X A;  4RAZ A;  1MZB A;  1U78 A;  1HKS A;  4IHS A;  3ZMD A;  2P7C B;  1YW9 A;  3E6B A;  3QP5 A;  2ZO4 A;  2Z9O A;  3K0L A;  2E7W A;  1AOY A;  2F5F A;  2OBP A;  2HQR A;  4I7H A;  4S05 A;  2W25 A;  4IPA A;  5K1Y A;  3FWE A;  3LA2 A;  3KZZ A;  3HOT A;  4HF0 A;  5HS8 A;  2LSO A;  1V4R A;  4M6Y A;  3BP8 A;  1XD7 A;  3QPT A;  3ZMS A;  4FX4 A;  4LJZ F;  4M73 A;  4OMZ A;  5CJ9 A;  4KNY A;  4QWQ A;  4UV9 A;  2NNN A;  1WRJ A;  2G7H A;  1XN7 A;  3SFZ A;  3FHZ A;  1B4A A;  1OYY A;  3F8B A;  2HTS A;  3LWF A;  3HRT A;  1JXS A;  2EFQ A;  4S04 A;  5D6F A;  2A07 F;  4EJU A;  4AWX B;  2RDP A;  4KMU X;  3WTX C;  4KUM A;  5AON A;  1XGN A;  4XLP F;  3E6C C;  4ESF A;  2VBZ A;  1BJA A;  3W6K B;  4Z2Y A;  2QYO A;  5HDN A;  4MGR A;  5D5U B;  2YX4 A;  4GYI A;  1Z7U A;  4BHP A;  1I5Z A;  2ZXJ A;  5DCF A;  1R22 A;  2VE8 A;  3NQO A;  2K86 A;  2CWE A;  1FBU A;  1KQ8 A;  2LKP A;  4OIR F;  5DD8 A;  1B59 A;  4LK1 F;  1L0O C;  3JAM K;  5F64 A;  1HXD A;  4HV6 A;  5ICG A;  2HOE A;  1FT9 A;  3CUO A;  2DU9 A;  3RDI A;  5ILS A;  2FOK A;  4IRI A;  3TGN A;  1IXS B;  1I1G A;  4M9Z A;  1YG2 A;  5DYM A;  3CTA A;  2XRO A;  1ZN2 A;  2D2W A;  1V3F A;  3ZN1 A;  4RB1 A;  1FPQ A;  2OA4 A;  1MJ9 A;  2HYG D;  4PGH A;  4HQE A;  1YFH A;  5IT9 K;  3H92 A;  3IKT A;  1REP C;  1TQI A;  2OQG A;  3WOD F;  4KFC A;  4MTE A;  1EV7 A;  2K4J A;  2LF7 A;  2O3F A;  5FO5 A;  1PP8 F;  4WK8 F;  3FXR A;  4HDU A;  3RKX A;  5DUI A;  3KE2 A;  2XVC A;  4OMY A;  1S6L A;  3I5U A;  3KEQ A;  3WGI A;  3DKW A;  3T8R A;  3HSR A;  5E8I A;  1GVJ A;  2DLL A;  3F22 A;  3BJA A;  3P9K A;  3LST A;  2VBY A;  1J5Y A;  4P96 A;  1KU9 A;  5JHU A;  4A12 A;  3CLO A;  2FF4 A;  2G7U A;  4FHT A;  3RTR A;  3R4K A;  3IL2 A;  2Z99 A;  3HTU A;  5D5V B;  3ABU A;  4Y13 A;  3FM5 A;  5LHG A;  1PUE E;  2XKO A;  5FB2 A;  4HV5 A;  2O6G E;  2VT3 A;  4Q48 A;  3BRO A;  4ENM A;  5DDG A;  1YQA A;  1TQP A;  3B02 A;  1G3S A;  2D1V A;  3I71 A;  4RB2 C;  5ILV A;  2FSW A;  1ZRF A;  1P4X A;  2H27 A;  4UUV A;  4WWC A;  1J9I A;  1X3U A;  1XCV A;  1R1V A;  4ENJ A;  2RQP A;  2A68 F;  2E1N A;  2ELH A;  1P2F A;  1FWZ A;  3WGH A;  4EJV A;  1IN5 A;  2QWW A;  4OIN F;  4A6E A;  2CG4 A;  1XCB A;  1FYM A;  4B8X A;  3E97 A;  5CVJ A;  3SQN A;  2L4M A;  5D5W B;  5L3G A;  4ENK A;  5A2Q K;  3KET A;  1RUN A;  1SAX A;  3ABT A;  4KDP A;  1BIA A;  4WXD A;  3FX3 A;  4XLN F;  4FX0 A;  3MZH A;  3WTY C;  2PQ8 A;  2QQA A;  5J8F A;  1K78 A;  2ZKZ A;  3VEP A;  2MA3 A;  3WTZ A;  2PJP A;  2Y75 A;  1GXQ A;  4L9V A;  3KFW X;  1SD7 A;  5H6R A;  3ROU A;  4LG0 A;  1XMA A;  4CHU A;  5DUK A;  5LRR A;  4MHG A;  5D5X B;  3WGG A;  4R8H A;  3P9C A;  3ERE D;  3GZ5 A;  2EA2 A;  5DD4 A;  1DP7 P;  1QZZ A;  4GO1 A;  1ZYR F;  4MEY F;  1R1T A;  1Z9C A;  2GQQ A;  1Q1H A;  3V4G A;  4UVC A;  2HTJ A;  4UNO A;  2VE9 A;  3CDH A;  4UVA A;  1HKQ A;  3J81 K;  4RS8 A;  2PBI A;  1IW7 F;  4G6D A;  4R1H A;  2FXA A;  4HX7 A;  2OZ6 A;  3M8E A;  3P9I A;  5BMZ A;  3R60 A;  4OOI A;  1T0F A;  3QOP A;  3DQV C;  3HOS A;  3JAM Z;  2CYY A;  4YFK F;  1IAW A;  3J80 Z;  1Y0U A;  1J75 A;  2HEO A;  1SFX A;  2KKO A;  1P4A A;  1FY7 A;  3GEZ A;  4YFN F;  1UCR A;  3ECO A;  1RIO H;  5L3B A;  4BYY A;  2R7D A;  3WE3 A;  2JPB A;  4FT8 A;  3BOQ A;  3Q9S A;  3U2R A;  2DPD A;  2ZME A;  4P9U A;  3BZ6 A;  2GZW A;  2M5W A;  5BPI A;  2OD5 A;  3WTT C;  1T39 A;  4GCV A;  3U9G A;  1MDM B;  3P7N A;  3GFL A;  3C1D A;  1ZG1 A;  5IT9 Z;  1O3T A;  1WQ2 A;  2L3D A;  1XSX A;  3MEX A;  2J5O A;  4UXN A;  1S29 A;  2W85 A;  3RKY A;  4I09 A;  5E18 F;  1QNT A;  2DK8 A;  1LB2 A;  5K5O A;  4WX9 A;  5HDG A;  3KCC A;  3FMQ A;  2DFI A;  5HLI A;  3F23 A;  3GFI A;  5D4R A;  2DQR A;  4IF4 A;  2M30 A;  5EEH A;  2ZCW A;  2D1H A;  4KIF A;  2VOD A;  1P4W A;  4AIK A;  4MEX F;  2B0L A;  4I98 B;  4KIG A;  3ZPL A;  3L2C A;  1F5T A;  3LAP A;  2P6S A;  2EJR A;  2P4W A;  3HHG A;  3K69 A;  5JVT A;  2V1X A;  4LLG F;  2XUB A;  5LLQ A;  1EH8 A;  1EH6 A;  4RGR A;  2MBF A;  2Q2E A;  2YSR A;  4U0V A;  5DCM B;  1LQ1 A;  4P55 A;  5CLS A;  4IRH A;  4ZYG A;  4CGZ A;  5L3E A;  4ESJ A;  2FBI A;  4A0Z A;  2DPU A;  3WTS C;  1P92 A;  4Q4Z F;  3GLX A;  1R58 A;  4BHC A;  1TTY A;  1YO5 C;  2DT5 A;  3E6M A;  3HYI A;  1KU3 A;  2RGV A;  2CSO A;  2F2E A;  2V9V A;  4L9T A;  2LF8 A;  2FA5 A;  2WTE A;  2VBX A;  3R0A A;  1FYK A;  1WWX A;  3HRS A;  1U5T A;  3IHU A;  2LNB A;  2IA2 A;  1FYL A;  3HSE A;  2P5V A;  4ZH4 F;  5D4S A;  4M71 A;  2M87 A;  4BNC A;  1R36 A;  2E7X A;  1XSD A;  3IKV A;  3WTU C;  1ZAR A;  4ETS A;  2FNA A;  2KIF A;  2IA1 A;  1OYI A;  2HFH A;  1BI0 A;  2G9W A;  3GXO A;  2JRT A;  2CGP A;  4DQ2 A;  2RVC A;  1QGP A;  2RKH A;  5CVR A;  5E1X A;  2XHK A;  2W57 A;  2ZBK A;  3C3W A;  5KK1 A;  4U7D A;  4IXA A;  5H20 A;  2A69 F;  3BJ6 A;  2BV6 A;  5DV5 A;  3NRV A;  1OMI A;  3V7S A;  3PQK A;  4P9F A;  3KP3 A;  4HYE A;  1L3L A;  1ONV A;  2EA4 A;  4WXH A;  1YLF A;  5EEG A;  1A04 A;  4E70 A;  5A2Q Z;  3F3X A;  3ML6 A;  2FQ3 A;  1NHA A;  3I58 A;  1FOK A;  2L01 A;  4HX8 A;  2STT A;  4CO8 A;  2PMU A;  2EFO A;  1J7K A;  1KYZ A;  4RAY A;  2DI3 A;  1XGS A;  3L09 A;  4B09 A;  3RI4 A;  2H09 A;  3T0Y A;  3TO6 A;  1TNT A;  2FBK A;  5CVU A;  1S7O A;  2Y0M A;  1OYW A;  3MQ0 A;  4L5J A;  4N9H A;  2WC2 A;  2Q0O A;  1G4D A;  5D8L B;  1E17 A;  3ZMT A;  4U88 A;  2XAG A;  3F6O A;  2EK5 A;  2OAZ A;  1IRG A;  1B6A A;  3J80 K;  2AXL A;  5ICE A;  2FMY A;  1FX7 A;  1ZH5 A;  2ZME B;  2C6Y A;  2MD5 A;  4G9Y A;  3EUH A;  2K27 A;  1O3S A;  4EJT A;  1LDK B;  2OQR A;  3E5Q A;  1BI3 A;  4L0Z B;  1ON2 A;  3MWM A;  3DP7 A;  4K2E A;  4EM1 A;  4EV0 A;  2BBY A;  2GA1 A;  1C0W A;  3DXJ F;  4MQ9 F;  2FU4 A;  2QUF A;  2VT2 A;  2V79 A;  4HDV A;  4XBF A;  3Q5F A;  1TW3 A;  1XGM A;  3D0S A;  5TRD A;  1ZG3 A;  1UST A;  2H94 A;  3JTG A;  1D8K A;  4TV7 A;  4RGS A;  3JW4 A;  2EFW A;  1KGS A;  5CVI A;  3JSO A;  2H6B A;  1MGT A;  2FBH A;  1Z91 A;  4EJW A;  4RGU A;  2ZNY A;  2KJC A;  3KP7 A;  1XDS A;  4A5M A;  5LHH A;  1CF7 A;  4ENN A;  5JR3 A;  2H6C A;  3CUQ C;  2ISY A;  2ADU A;  2IT0 A;  1U5T C;  3K1P A;  1FBS A;  1H0M A;  5ICC A;  1K78 B;  3G73 A;  1UHM A;  4AIJ A;  1ZLJ A;  2EV5 A;  4KMF A;  3IRQ A;  2BEO A;  2HKO A;  1FNN A;  4CZZ A;  5E8G A;  4L9J A;  2V1D A;  3S2W A;  2JTV A;  1HKT A;  1G3W A;  2Z33 A;  3M8F A;  5IT3 A;  1IRF A;  3ZQ7 A;  3LFK A;  4OIP F;  1PP7 U;  2RN7 A;  5DCM A;  1TLH B;  1DPU A;  2FEZ A;  1Z1D A;  2KIM A;  3HIF A;  1Z6T A;  2DTR A;  1KQ9 A;  5ILU A;  3O6B B;  4G94 A;  2V6C A;  5LEJ A;  3M9A A;  1IXR C;  5L3C A;  3I0T A;  2GWR A;  1ZRC A;  1H9G A;  3N97 A;  3TQN A;  3WE2 A;  4HF2 A;  2MLK A;  1R5G A;  1B1B A;  1ZRE A;  4PGG A;  4YIF A;  4M74 A;  4G6Q A;  3HHH A;  3GO5 A;  5J8C A;  2DAO A;  5D6E A;  3LQQ A;  4L9N A;  1B9M A;  1LEA A;  4R79 A;  1RNL A;  4U0Y A;  1SD6 A;  3RJP A;  5E1W A;  4LGW A;  2VOP A;  1MDM A;  5K5Q A;  1Z05 A;  1MJB A;  3OOP A;  3BDD A;  3L7W A;  3TO9 A;  3BPV A;  1STZ A;  2BYV E;  1JGS A;  3DPT A;  3FMR A;  2QLZ A;  3K1N A;  2L54 A;  4RGX A;  4UV8 A;  1RZ4 A;  2HKX A;  4JK1 X;  4CIC A;  3KZY A;  5KVR A;  3FZV A;  1EH7 A;  1BIB A;  4UVB A;  1IUY A;  3BY6 A;  2EFP A;  2NNY A;  1G6N A;  5HVQ C;  5JFR A;  3MCZ A;  2GAU A;  2X4H A;  1U8R A;  1DDN A;  1LVA A;  2QZ8 A;  4Q47 A;  2HQN A;  2XRN A;  3KP6 A;  4LD5 A;  4XSX F;  1UFM A;  4L18 B;  4EVI A;  4A2U A;  1R5H A;  1QPM A;  1MD0 A;  1U2W A;  2D45 A;  4Y15 A;  4HW0 A;  4NB5 A;  3QAH A;  1OR7 A;  1BI1 A;  5K5R A;  5BQT A;  2EB7 A;  3HSF A;  3U1D A;  3FMS A;  2IRF G;  1LJ9 A;  2JSC A;  3C7J A;  1IN7 A;  4O3M A;  5FGM A;  2AS5 F;  1R1U A;  3T1B A;  1MKM A;  2JPC A;  4A5N A;  1FZP B;  3WTW C;  2CQK A;  1U6G A;  1RI7 A;  1HBX G;  1ZGA A;  1IZ1 A;  2J5P A;  2W84 A;  3QPH A;  2VC0 A;  1ODD A;  3D5L A;  1B9N A;  3K2Z A;  3V7R A;  1W5T A;  3CO6 C;  1AWC A;  2QQ9 A;  1ULY A;  4I02 A;  2IVM A;  3VFZ A;  2M45 A;  4IVN A;  3GVA A;  2A6H F;  1BC8 C;  2XGX A;  3WG9 A;  4UHT A;  2CW0 F;  1BOA A;  5AIP A;  1ZAO A;  4HF1 A;  2GXG A;  4KIC A;  4HOB A;  5ICF A;  2XKP A;  4EGZ A;  2L02 A;  1IXC A;  1J0R A;  4HLX A;  3R6S A;  1IF1 A;  2O61 A;  2HGC A;  1G3T A;  3BPX A;  3FF5 A;  2EV6 A;  2ACJ A;  1CGP A;  3H3Z A;  3I64 A;  3GYH X;  1QQI A;  2CO5 A;  2XAS A;  4XSZ F;  4L5I A;  4EGY A;  2DW4 A;  3GX4 X;  2XV4 S;  2KRF A;  2NS0 A;  4G7O F;  2F5D A;  4LB6 B;  3GZ6 A;  2X0L A;  4I0A A;  3DEU A;  2HZT A;  1SMT A;  1HSJ A;  5LRS A;  1XMK A;  2UXN A;  2KJB A;  2PFB A;  4DNC A;  3T8T A;  1SMY F;  4N9I A;  1UB9 A;  3RPQ A;  2COM A;  3F21 A;  3KLN A;  4PZJ A;  1QBJ A;  2PI0 A;  3DFG A;  4AVP A;  3WU0 A;  3TDU C;  4Y17 A;  3T5X A;  3J7A O;  2MH2 A;  3QRF F;  1T98 A;  2R7F A;  5J6X A;  4BXU A;  4ASN A;  1T38 A;  1SD5 A;  4MQV A;  3RKW A;  1RUO A;  3V7C A;  1TNS A;  1ZG5 A;  3DF8 A;  4GYG A;  1YYV A;  1XDU A;  4N0B A;  3I59 B;  5JI6 A;  3KEO A;  4ZZL A;  4YG2 F;  2PEX A;  1T6S A;  2IJL A;  3C18 A;  2BGC A;  4Q5S F;  1D5V A;  3ZMV A;  4EMS A;  1U5T B;  2VOO A;  2ISZ A;  4CDG A;  3SXY A;  4A6D A;  3RYR A;  1K6O A;  1W5S A;  4IRG A;  2ESH A;  4ESB A;  2JT1 A;  3NEU A;  5FLX Z;  5TJJ A;  5E20 A;  3TO7 A;  3V8K A;  3ZMU A;  3EET A;  1YW8 A;  1BM9 A;  1O57 A;  2UZK A;  4HAM A;  2UXX A;  4JQF A;  4G7Z F;  4ZZD A;  3BJO A;  1U3E M;  4NQW A;  1TBX A;  5HDK A;  4EQQ A;  1O3R A;  4I0B A;  1SFE A;  1TQM A;  3KP5 A;  2DO7 A;  4KT5 C;  3PFI A;  2XAQ A;  5FFZ A;  2EV0 A;  3E5X A;  1JHH A;  2VN2 A;  1W7P B;  3N4M A;  3V8J A;  3EYI A;  2ZJ2 A;  3MZY A;  4HZF A;  2A5Y B;  3ZN0 A;  2QBY A;  4HA8 A;  3QU3 A;  2Z3Y A;  1FC3 A;  2DK5 A;  4ON0 A;  5ED4 A;  1BBY A;  1FP1 D;  3O3K A;  3PQJ A;  3IWF A;  5CYV A;  5LGT A;  4O5V A;  3F6V A;  4JBA A;  1WKM A;  1D3Y A;  2YPR A;  2ZFW A;  1IN8 A;  2R3S A;  1HW2 A;  2Q8K A;  2HYF A;  2HWV A;  1YW7 A;  2WV0 A;  3F72 A;  5HS9 A;  2NAZ A;  2FML A;  1KYW A;  2GXB A;  3VOE A;  5BPD A;  2WWY A;  3TOA A;  4M6X A;  1PDN C;  1ON1 A;  1XSV A;  1XGO A;  2IP2 A;  3KP4 A;  2O03 A;  4I2O A;  4MTD A;  4PDK A;  4MNU A;  4G8X A;  3RPU A;  3L9F A;  1FLI A;  5FD6 A;  1W4M A;  1ZLK A;  2JZY A;  1F1Z A;  1O7L A;  4YFX F;  4CXF A;  2L4A A;  1IN4 A;  2M1B A;  5FD5 A;  2P6T A;  4A0X A;  4IHT A;  1BN5 A;  3F8F A;  3JSP A;  1WI9 A;  1KQ0 A;  4EM2 A;  3DV8 A;  1Z6R A;  2K4B A;  4PCQ A;  1WSU A;  3K9T A;  4ZYD A;  2V1U A;  3RIR A;  2TDX A;  3I4P A;  3EQL F;  2FRH A;  1YS6 A;  5HLG A;  3BWG A;  4BQA A;  3KP2 A;  1S3J A;  4RB0 A;  1I27 A;  5FFX A;  2A61 A;  4BHB A;  5BS6 A;  4NHJ A;  1P6R A;  5LEK A;  4O6J A;  3TKY A;  4OIO F;  3M7G A;  2DQL A;  4HLY A;  3Q9V A;  1G3Y A;  1CF7 B;  5HS7 A;  3LA7 A;  3R0J A;  2GA2 A;  5L3D A;  3I54 A;  4LG0 B;  4HQM A;  4OU0 A;  1FSH A;  1W7P D;  5LGN A;  2QVO A;  3E5U A;  3F8M A;  1R00 A;  1K79 A;  4L0Y B;  1YS7 A;  3ULQ B;  5H6Q A;  3F8N A;  2OU2 A;  2Z5U A;  2EFN A;  3I53 A;  2P8T A;  5LGU A;  3F8C A;  3SZP A; 
#chains in the Genus database with same CATH topology
 3CJN A;  2ZNZ A;  3DU5 A;  1QZY A;  1ZRD A;  1RPW A;  1XPX A;  4PK4 A;  3WTV C;  2CFX A;  2RV8 A;  4G7H F;  4IHY A;  3OL4 A;  3TDZ C;  3S16 J;  3FM3 A;  5E17 F;  3NAR A;  4LFU A;  4IO9 F;  3PO2 J;  1O3Q A;  2MYS A;  1H9T A;  2STW A;  3O8G A;  3H9Q A;  1HA8 A;  2CJJ A;  2MSY A;  1J2X A;  1FP2 A;  2XAF A;  3K70 D;  2ZJR F;  1XB4 A;  3JRF A;  2IS1 A;  3RYP A;  5HOO A;  1RR7 A;  4LLN A;  2M8E A;  5FLX K;  3IC7 A;  3SZT A;  2GIV A;  3ECH A;  3SDB A;  1QPI A;  4OIQ F;  2VC1 A;  3IRR A;  2LDU A;  2BHZ A;  4WXC A;  3I56 I;  4H0E A;  3QU6 A;  4DW6 A;  4CYD A;  1FBQ A;  3K7A J;  3OS0 A;  3TP0 A;  4GXO A;  1ZGJ A;  2HPM A;  2VJ5 A;  3CCL I;  3L2V A;  1K61 A;  2VON A;  4DZP A;  2MG4 A;  5E3O A;  4C30 A;  4ZDO A;  4C3H J;  4I01 A;  1R9T J;  1LDD A;  4CCJ A;  3FXU A;  2ZSI B;  2NYX A;  5LHI A;  4H4K C;  3MKZ A;  2KIU A;  3FDY A;  3RQI A;  2NRA C;  1USS A;  3G1O A;  1GHC A;  3BC8 A;  2YR2 A;  4LB5 A;  1JE8 A;  1SD4 A;  2K7L A;  3GF2 A;  2V9K A;  2VBW A;  4XKC A;  1B72 B;  1YTY A;  5B66 C;  3B73 A;  1JTY A;  2F6C A;  3ABL H;  3PIP F;  3H0D A;  1OQY A;  1OKR A;  3ELK A;  3IWZ A;  5DEQ A;  3JRI A;  4ZYH A;  4BQQ A;  1YRN A;  3AAF A;  1ETO A;  1S7A A;  1Y6I A;  2PMH A;  2A3S A;  2CH0 A;  3KEY A;  3G3Z A;  2ESN A;  1W36 C;  1IN6 A;  2O5R A;  2LY9 A;  1HST A;  4IL6 C;  4MO7 A;  5J4Y A;  2G0E A;  1VQ7 I;  4WCG A;  1MBH A;  3CDI A;  3DPL C;  1DPR A;  4RM3 A;  2PG4 A;  3JTH A;  1IDY A;  3AL0 C;  3HRM A;  3H5R A;  1I3Q J;  5EZG A;  1OCR H;  2UWM A;  3DLA A;  2DBB A;  3V8L A;  3COA C;  2HZD A;  4XRS A;  3VSL A;  5HLH A;  3W6J B;  3LAJ A;  2A6E F;  3FXQ A;  4BH9 A;  2XSD C;  4X0G A;  1A6I A;  5BOX A;  3M1E A;  2ID6 A;  1VTN C;  4EM0 B;  4BS9 A;  3NWS A;  5CVV A;  2QSG X;  2DA5 A;  1PJR A;  2K9L A;  2BXY A;  3GFJ A;  1YX5 A;  1WFX A;  1AU7 A;  4LLL A;  3ZQG A;  3KLO A;  4M72 A;  2HS5 A;  1YHQ I;  2O0Y A;  2ELJ A;  4HBL A;  3DEW A;  4NDL A;  3OYK A;  1W7P A;  2PMZ N;  2RNJ A;  2IA0 A;  4AYB A;  4F93 B;  1ETY A;  1YOV B;  1KA8 A;  2IPQ X;  1JHF A;  5IYD J;  3E6D A;  2ETH A;  2JUG A;  1HCR A;  3H3U A;  4YII A;  3GFM A;  2PN6 A;  1GV5 A;  3KIO A;  1YE9 A;  1FIA A;  3RQ4 A;  1JGG A;  1LDJ A;  3BCA A;  2ID3 A;  1VQL I;  4IHV A;  2QBY B;  2PLY A;  5J4V A;  1SAU A;  1RKT A;  3L00 A;  3BQZ A;  3CO7 C;  1ZKG A;  4CCN A;  5DTD A;  2HVS A;  3GW2 A;  1HW5 A;  1QO0 D;  2F5C A;  2BE5 F;  4DYR A;  3VB2 A;  1VQM I;  3R61 A;  4D0P A;  2W1O A;  2XF6 A;  1FOY A;  3CME I;  1MJA A;  4BL0 B;  2PJR A;  3HUG A;  2ZXH A;  4IZZ A;  2E60 A;  2F5E A;  3MAJ A;  1ENH A;  5E1Z B;  1BA5 A;  1MMN A;  1JUS A;  3CUQ A;  3HRU A;  1X1D A;  3TBI A;  4QLC U;  5LBQ A;  1HW1 A;  2X6O A;  4KJZ A;  1S7E A;  2HQA A;  2AO9 A;  4XRF A;  4XKV A;  1MBE A;  1T2K A;  1AKH A;  4HNV A;  1FSE A;  1I1S A;  1I6X A;  1VZ0 A;  2VXZ A;  1OPC A;  2YU3 A;  3K1M A;  4D5F A;  2NVX J;  1VND A;  2QEN A;  4LK0 F;  3J7Y J;  4P5O A;  4RLF A;  4NC7 A;  5F6F A;  1D1A A;  1F4K A;  1BI2 A;  2OZU A;  2MH9 A;  4KN4 X;  2HPI A;  5F1R A;  1K7A A;  1UHW A;  2HR3 A;  4XK4 A;  4F91 B;  2HNH A;  4ZYE A;  4A3F J;  3REO A;  2MLG A;  3WU1 B;  4ZC3 A;  1VQO I;  4BE1 A;  4U0W A;  2XAH A;  3G6E I;  1WVR A;  3LQR A;  4GGG A;  2W24 A;  1S72 I;  3WG7 H;  5CPR B;  3LA3 A;  3PUF A;  2OC6 A;  5D8K B;  2RNG A;  1AKH B;  1M1E B;  1KU7 A;  3BQY A;  4F7Z A;  3QYB A;  1D1B A;  2CV1 A;  1X1P A;  3CUQ B;  3H1C A;  1FMW A;  2XAJ A;  4QTR A;  2P5K A;  4KIB A;  2OTL I;  2LP0 A;  2YX7 A;  1MH3 A;  5L3F A;  1E3H A;  3ZMZ A;  3ISP A;  4AD9 A;  2RRE A;  1N75 A;  1DUX C;  2L5Q A;  3N05 A;  2HXO A;  2FE3 A;  1O7F A;  2X6Y A;  1ACI A;  3OOU A;  1JKP C;  1D8J A;  3H5N A;  2UV1 A;  4ANJ A;  1MNM C;  2ZXW H;  2LLK A;  2K9N A;  2P5L C;  3LMM A;  1SFU A;  1HC8 A;  3EYY A;  5EF6 A;  1R7J A;  3HKZ N;  2IGN A;  1E2X A;  3O2P E;  5FKN A;  1KON A;  4A3M J;  2DYR H;  2VQH A;  3E3V A;  2QM3 A;  1RRJ A;  3GUD A;  2ZC2 A;  4BAY A;  2RC4 A;  2P7V B;  4KA4 A;  1N77 A;  2MC3 A;  2FNP A;  5AIQ A;  3I59 A;  4RAG A;  5JVG F;  4KN7 X;  4DYC A;  3AG3 H;  1LEB A;  2VKV A;  2JVH A;  2DN0 A;  4RB3 C;  3OYH A;  1TW2 A;  3U21 A;  1G59 A;  3VOD A;  2E1C A;  3QP6 A;  1LNW A;  2VAS A;  1HQC A;  1J59 A;  3OYI A;  3MFK A;  2EWN A;  5ERI A;  1FTT A;  1S8N A;  3GLL A;  1YIO A;  1BC7 C;  4M9X A;  1WHU A;  2R7R A;  4IQJ A;  2GOX B;  2XIG A;  2GIZ A;  2HI3 A;  2M0M A;  1NG7 A;  3H36 A;  1F9N A;  4AIH A;  1ITY A;  2AXT C;  4BUP A;  2K02 A;  2DOF A;  2WB1 N;  2XGD A;  4LMY A;  4A3C J;  2QQB A;  3OV8 A;  1GXP A;  4XRM A;  5FLV A;  3SHF A;  4HX4 A;  4UUS B;  4B48 A;  2IW5 A;  3GWZ A;  3TOB A;  1ZHF A;  2LRE A;  4U7B A;  4IJA A;  4W97 A;  4KYW A;  1A35 A;  6PAX A;  2ECB A;  3EDP A;  3HTS B;  3J81 Z;  4WF2 A;  1S9H A;  3ZP5 A;  3LSP A;  4Y3O A;  2Y48 A;  4A0Y A;  1GLN A;  2I8D A;  1RC9 A;  3GTG J;  4QPQ A;  1R23 A;  3UNG C;  1YRN B;  2IAI A;  4EJO A;  1KU2 A;  5GAE J;  2WBM A;  4HSR A;  2HDC A;  4M9S A;  2O8X A;  3OYJ A;  4RAZ A;  1MZB A;  1U78 A;  1HKS A;  4IHS A;  1OCZ H;  3ZMD A;  3H35 A;  3LOC A;  1YW9 A;  2P7C B;  4AVZ A;  3GTL J;  1QVT A;  3E6B A;  3ZQF A;  3QP5 A;  2HDW A;  2L7M P;  3I3L A;  2ZO4 A;  1W0T A;  2Z9O A;  3K0L A;  3DPU A;  3K4N A;  4II3 A;  2E7W A;  3SFI A;  3OSF A;  1B8I B;  3DCF A;  1AOY A;  2F5F A;  4N4O B;  2OBP A;  2R7S A;  2HQR A;  2LR8 A;  4RM2 A;  4I7H A;  4S05 A;  2W25 A;  2CS3 A;  4IPA A;  5K1Y A;  3JCU C;  1F43 A;  2Y0S A;  3DTK A;  2W00 A;  3W6V A;  3FWE A;  3LA2 A;  3KZZ A;  5IP9 J;  3UR3 C;  3HOT A;  1SFK A;  3H9G A;  4HF0 A;  3MKL A;  5HS8 A;  3LSR A;  5F0H A;  2LSO A;  1V4R A;  4M6Y A;  1TL8 A;  3BP8 A;  1TP4 A;  2E2H J;  1XD7 A;  4FAS D;  2LYC A;  3QPT A;  4Y33 A;  4S0H B;  3ZMS A;  2DA1 A;  4FX4 A;  4C2T A;  1Q1V A;  4LJZ F;  2FUG 2;  2XPU A;  4M73 A;  4XKB A;  4OMZ A;  5CJ9 A;  4KNY A;  2XSJ C;  4QWQ A;  3IUO A;  4XMY A;  4UV9 A;  2NNN A;  3EPZ A;  1WRJ A;  2QKL B;  2G7H A;  3ZOB A;  1IGN A;  4BDZ A;  1XN7 A;  2P0W A;  2FX0 A;  3FXK A;  3SFZ A;  2EIN H;  1B4A A;  3FHZ A;  1OYY A;  3F8B A;  4JOM A;  4XN0 A;  2HTS A;  4A3B J;  2X1E A;  3CJQ B;  3LWF A;  3HRT A;  5B3S H;  4RMN A;  1JXS A;  1T0F C;  2EFQ A;  4S04 A;  3FKI J;  3QYE A;  3C2H A;  2LH9 A;  2HYJ A;  5D6F A;  1WJB A;  2A07 F;  4EJU A;  4AWX B;  2RDP A;  4HEA 2;  1FMV A;  4KMU X;  3WTX C;  4KUM A;  5AON A;  1XGN A;  4Y4R A;  4XOR A;  1IG7 A;  2WAD A;  4F52 A;  4XLP F;  2VUM J;  3E6C C;  4ESF A;  2VBZ A;  1BJA A;  2M7B A;  4IOC F;  3W6K B;  4Z2Y A;  2QYO A;  3K4L A;  5HDN A;  1WJ5 A;  1IUF A;  4MGR A;  5D5U B;  5F0C A;  1OR7 C;  4JX5 A;  2YX4 A;  4GYI A;  1Z7U A;  1CQT A;  3HM5 A;  3CCQ I;  2X9D A;  3CC4 I;  4BHP A;  1I5Z A;  2R7O A;  3PM1 A;  3BR2 A;  2ZXJ A;  3AL0 B;  2R7U A;  2M3A A;  2AQF A;  4BEH B;  1R22 A;  5DCF A;  1LFU P;  2VE8 A;  3NQO A;  4HNT A;  4BBS J;  2K86 A;  4NC6 A;  2CWE A;  1FBU A;  1KQ8 A;  2LKP A;  3CDL A;  4OIR F;  5DD8 A;  1B59 A;  4LK1 F;  1L0O C;  3JAM K;  5F64 A;  2KRC A;  1HXD A;  4HV6 A;  1SVO A;  1K83 J;  2HOE A;  5ICG A;  2JVG A;  4BY7 J;  2V7F A;  1FT9 A;  3CUO A;  3JRD A;  3VDX A;  2DU9 A;  4FQG A;  3RDI A;  3MD2 A;  5ILS A;  2FOK A;  1V54 H;  4IRI A;  5FRO A;  2DOE A;  3TGN A;  2AHQ A;  1IXS B;  1I1G A;  2DTZ A;  3ASN H;  4M9Z A;  1YG2 A;  3BG5 A;  2M9H A;  4AM3 A;  5GAH J;  5DYM A;  3CTA A;  2XRO A;  1ZN2 A;  2D2W A;  3OYN A;  4IQ4 A;  5CQE A;  1V3F A;  3ZN1 A;  3HOW J;  1I39 A;  4RB1 A;  1FPQ A;  3AKZ A;  2OA4 A;  5CKT A;  1MJ9 A;  2HYG D;  4PGH A;  4HQE A;  1YFH A;  1KZH A;  5IT9 K;  3H92 A;  5J3L A;  3IKT A;  5C44 J;  1REP C;  1TQI A;  2FJ1 A;  2OQG A;  4FTH A;  3WOD F;  4XIC A;  4KFC A;  4MTE A;  1EV7 A;  2K4J A;  2LF7 A;  2O3F A;  4XNF A;  5FO5 A;  1PP8 F;  3QQA A;  4WK8 F;  3FXR A;  4HDU A;  3DKY A;  3RKX A;  5DUI A;  2E35 A;  3KE2 A;  2R7V A;  2XVC A;  4OMY A;  1S6L A;  3I5U A;  3KEQ A;  3WGI A;  3DKW A;  3T8R A;  3HSR A;  2ECC A;  5TGT A;  1A5J A;  2Z16 A;  5E8I A;  4ZJZ A;  1GVJ A;  2DLL A;  3F22 A;  4F55 A;  3AG4 H;  3BJA A;  3HPH A;  2LFB A;  3LST A;  3P9K A;  4QPO A;  2VBY A;  5M5X J;  2W4S A;  1BR1 A;  1FTZ A;  2IS6 A;  3HPG A;  1J5Y A;  1Y8R B;  2HOA A;  2VQG A;  4P96 A;  1UG2 A;  2LVS A;  2YS9 A;  2E2I J;  1KU9 A;  4XLE A;  5JHU A;  3FXO A;  3FXJ A;  4A12 A;  4BJ6 C;  2JA6 J;  2FQ4 A;  3CLO A;  4C2M J;  2FF4 A;  2G7U A;  4FHT A;  2K3P A;  3CC7 I;  3RTR A;  3GTJ J;  1Y39 A;  3R4K A;  3IL2 A;  4CYC A;  2Z99 A;  3HTU A;  4HG2 A;  5D5V B;  3ABU A;  4Y13 A;  3FM5 A;  5LHG A;  2L2O A;  3H5A A;  2TCT A;  5FKL A;  1PUE E;  2XKO A;  5TIS C;  5FB2 A;  3NWT A;  1IJW C;  4HV5 A;  2O6G E;  2R0Q C;  2VT3 A;  4Q48 A;  1U9O A;  3BRO A;  4ENM A;  5DDG A;  4PSX A;  2WAQ N;  1YQA A;  1MMG A;  1TQP A;  2DMN A;  3B02 A;  3OIQ A;  4F92 B;  4FET A;  2LKX A;  4D9J A;  2B9S A;  2DFH A;  2M7A A;  2EQR A;  1G3S A;  2D1V A;  3CMY A;  3I71 A;  4RB2 C;  2KQR A;  2EIK H;  5ILV A;  1R6R A;  3FXL A;  2FSW A;  2V26 A;  1ZRF A;  1R71 A;  1P4X A;  3SZG A;  2H27 A;  4UUV A;  5F27 A;  4IKF A;  4WWC A;  3KYL A;  1J9I A;  1X3U A;  4E7H A;  3OIP A;  1XCV A;  5F04 A;  5JHF A;  4JX6 A;  1R1V A;  4PFP A;  4ENJ A;  1SAN A;  4XN3 A;  2RQP A;  4XKW A;  1OCO H;  4B1R A;  2HVR A;  2A68 F;  2E1N A;  2ELH A;  2B63 J;  1P2F A;  2HU9 A;  3IP4 B;  3DLL F;  1FWZ A;  3WGH A;  3CCR I;  4EJV A;  1IN5 A;  1O4X A;  1NK3 P;  2QWW A;  2XPW A;  4OIN F;  2CG4 A;  4A6E A;  1XCB A;  2YUS A;  1FYM A;  4B8X A;  3E97 A;  5CVJ A;  3BG6 A;  4AUX A;  3SQN A;  2L4M A;  5D5W B;  3RPU D;  5L3G A;  1UJ8 A;  5A2Q K;  4ENK A;  4A3J J;  3KET A;  1RUN A;  1SAX A;  3RKQ A;  3ABT A;  2X85 A;  3G4S I;  4KDP A;  1BIA A;  4WXD A;  3FX3 A;  2DFE A;  1Z3X A;  2JA5 J;  4XLN F;  2LY1 A;  1T95 A;  2X1D A;  4FX0 A;  2CW7 A;  3MZH A;  2ZXI A;  1JT6 A;  3WTY C;  2PQ8 A;  4UUT A;  1RKW A;  2QQA A;  5J8F A;  1K78 A;  1ZQ3 P;  2ZKZ A;  1HOM A;  3VEP A;  3DEE A;  3FIS A;  2MA3 A;  3WTZ A;  2PJP A;  3HEF A;  2Y75 A;  1GXQ A;  5GPC A;  2KL4 A;  4L9V A;  1ETX A;  3KFW X;  3CCM I;  4BEH A;  1SD7 A;  5H6R A;  3ROU A;  4LG0 A;  1XMA A;  3TL4 X;  4CHU A;  2DA4 A;  2MFZ A;  2NVU B;  5DUK A;  3A0B C;  5EGO A;  2EZL A;  5LRR A;  1UG0 A;  1WPK A;  2BW3 A;  3K4M A;  4MHG A;  5D5X B;  3S1M J;  1SC7 A;  3WGG A;  4R8H A;  3P9C A;  5K7H A;  3LNQ A;  5BNG A;  3ERE D;  3GZ5 A;  2R92 J;  2EA2 A;  5J1U A;  5DD4 A;  2VL8 A;  3CMA I;  2WAQ A;  4E7J A;  1DP7 P;  3HOZ J;  2KFD A;  2IS2 A;  1QZZ A;  4GO1 A;  1ZYR F;  4MEY F;  1R1T A;  1Z9C A;  5GTI C;  2GQQ A;  1Q1H A;  3V4G A;  4UVC A;  2HTJ A;  3TED A;  4UNO A;  2VE9 A;  3CDH A;  4UVA A;  3DTE A;  1HKQ A;  2O7O A;  5KAF C;  2QCO A;  3J81 K;  4RS8 A;  2QQ8 A;  2PBI A;  1E3O C;  3D5S C;  2K3F A;  1IW7 F;  4G6D A;  4R1H A;  2FXA A;  4HX7 A;  4RAF A;  2OZ6 A;  1IO2 A;  2VPR A;  3M8E A;  3P9I A;  5BMZ A;  4L5E A;  2IGM A;  3LSH A;  3R60 A;  1WH5 A;  4OOI A;  3CP8 A;  1T0F A;  1HDD C;  2LKS A;  3QOP A;  1T8I A;  1Z0X A;  3DQV C;  3HOS A;  3WU2 C;  1I3A A;  3JAM Z;  2BVL A;  2CMP A;  2CYY A;  4YFK F;  1IAW A;  3J80 Z;  1Y0U A;  2E1O A;  5EG0 B;  1J75 A;  5B5E C;  2HEO A;  3BZC A;  1SFX A;  1D0Z A;  1K6Y A;  2KKO A;  2MGQ A;  1P4A A;  1FY7 A;  1RES A;  3GEZ A;  2LBF B;  1UCR A;  4YFN F;  3ESW B;  3OYB A;  3ECO A;  1A31 A;  1RIO H;  5L3B A;  4BYY A;  1DU0 A;  2R7D A;  3WE3 A;  2JPB A;  4FT8 A;  3BOQ A;  3ZQQ A;  3Q9S A;  4D7N A;  2COB A;  3U2R A;  1DP3 A;  2DPD A;  1G2H A;  1PVE A;  2ZME A;  4P9U A;  2DA3 A;  1N25 A;  3BZ6 A;  1EKE A;  3S1N J;  2GZW A;  2M5W A;  5BPI A;  2OD5 A;  3VYR B;  3HJE A;  4E7K A;  3WTT C;  4XRS G;  1V5F A;  1T39 A;  4GCV A;  4A3D J;  3U9G A;  1MDM B;  3VYS B;  3P7N A;  3GFL A;  3C1D A;  4XM3 A;  2VQC A;  1ZG1 A;  5IT9 Z;  3PL8 A;  5EEA A;  1RR8 C;  1HLV A;  1O3T A;  1WQ2 A;  2L3D A;  1MH4 A;  3B6A A;  1XSX A;  3MEX A;  2E34 A;  2EIJ H;  4II2 A;  2J5O A;  4BXX J;  1MMA A;  1VQP I;  1E3P A;  4YRV A;  1GUU A;  2CU7 A;  4UXN A;  1S29 A;  2W85 A;  3RKY A;  4BQO A;  4I09 A;  5E18 F;  1QNT A;  2DK8 A;  1LB2 A;  1MSE C;  5K5O A;  4WX9 A;  1LVK A;  5HDG A;  1Z7L A;  3KCC A;  3FMQ A;  4KT6 A;  3OR2 C;  1I50 J;  2DFI A;  2WAE A;  5HLI A;  3F23 A;  1ERD A;  3H9J A;  3G2B A;  3GFI A;  5D4R A;  3JRA A;  2DQR A;  3HGY A;  4IF4 A;  4CYC B;  2F4M B;  5IPA A;  2VPL A;  3CQZ J;  2M30 A;  4BDY A;  3M07 A;  5EEH A;  4GDF A;  2ZCW A;  2D1H A;  5EZH A;  4DGW B;  4KIF A;  4YEL A;  1X2N A;  1WGX A;  4X1E A;  2VOD A;  1P4W A;  3ZQI A;  4AIK A;  3SEZ A;  4V2F A;  2DMT A;  4MEX F;  2V6E A;  3S2D J;  5K7F A;  2B0L A;  4I98 B;  4X6A J;  1Y56 A;  3WHC A;  4KIG A;  4J19 A;  3ZPL A;  3L2C A;  1F5T A;  3K70 C;  1WH7 A;  1IC8 A;  3LAP A;  2P6S A;  1GT0 C;  2EJR A;  2M4K A;  1MNE A;  4MFD A;  3CP2 A;  2L9V A;  2P4W A;  3HHG A;  2RAE A;  3K69 A;  3FHN A;  3FK6 A;  2JSP A;  5JVT A;  2KMU A;  2ICW G;  2V1X A;  2Y30 A;  4LLG F;  2XUB A;  5LLQ A;  1EH8 A;  1EH6 A;  2H8W A;  4RGR A;  1ZGW A;  4P1W A;  3BT9 A;  2MBF A;  2Q2E A;  3BR6 A;  2YSR A;  4U0V A;  5DCM B;  1LQ1 A;  4P55 A;  3OYE A;  5CLS A;  4GFB A;  1UMQ A;  4QSH A;  2EZI A;  1JKQ C;  2CV0 A;  5IOY A;  4IRH A;  4ZYG A;  1NH3 A;  4CGZ A;  2BOL A;  5L3E A;  4OAZ A;  4ESJ A;  3GTQ J;  3MKY B;  2FBI A;  2IBD A;  4A0Z A;  1OCT C;  5EJC A;  3CF2 A;  5IOZ A;  2DPU A;  4ZDL A;  3WTS C;  1P92 A;  4Q4Z F;  3GLX A;  1R58 A;  4BHC A;  4M3G A;  1TTY A;  1YO5 C;  2VB6 A;  2OCC H;  4YIR X;  2DT5 A;  3E6M A;  3VSK A;  3HYI A;  3M3Y J;  1KU3 A;  2KZV A;  2RGV A;  2DDA A;  2EPF A;  2CSO A;  2F2E A;  2V9V A;  4L9T A;  2LF8 A;  2FA5 A;  2WTE A;  2VBX A;  3IH4 A;  3R0A A;  1FYK A;  1WWX A;  1VI0 A;  2R5Z B;  2XPV A;  5J1R A;  3HRS A;  4OAY A;  1U5T A;  3IHU A;  2LNB A;  2IA2 A;  2JN6 A;  4HPQ A;  4CCL A;  3D5R C;  2KDZ A;  1FYL A;  3HSE A;  2P5V A;  4ZH4 F;  2CQQ A;  5D4S A;  1AHD P;  4F3Q A;  1IRX A;  4C3J J;  3CCY A;  2E5Z A;  1U9N A;  1X3Z B;  4M71 A;  1GDT A;  2M87 A;  4HST A;  1VF9 A;  2KZG A;  4BNC A;  3OIO A;  3BLY A;  1OIS A;  1R36 A;  2E7X A;  2NXN B;  1XSD A;  3LSK A;  3IKV A;  3WTU C;  3E7L A;  1ZAR A;  4ETS A;  4ZTF A;  2FNA A;  2PJR B;  1MBG A;  4PJ0 C;  2EZH A;  3BG9 A;  3L2Q A;  2KIF A;  2IA1 A;  1OYI A;  3MKW B;  2HFH A;  1BI0 A;  2G9W A;  3GXO A;  2JRT A;  2KDO A;  2CGP A;  4DQ2 A;  2E1M C;  2IGK A;  2RVC A;  1OCC H;  4JX4 A;  1QHG A;  1QGP A;  2BY1 A;  2RKH A;  5CVR A;  2XF7 A;  3ZR8 X;  1VQN I;  5E1X A;  2MW8 A;  2W57 A;  2XHK A;  2ZBK A;  3OYL A;  3C3W A;  1X1C A;  2X1C A;  1YJN I;  1BL0 A;  1OLT A;  5KK1 A;  1XG1 A;  4U7D A;  4IXA A;  1IV6 A;  2Y2Z A;  5H20 A;  1ETK A;  2DFF A;  4B44 A;  2A69 F;  3BJ6 A;  2BV6 A;  3EUH C;  5DV5 A;  3NRV A;  1OMI A;  3V7S A;  2BVM A;  4MLO A;  1LE8 B;  3PQK A;  4P9F A;  1QA6 A;  4G12 A;  4A93 J;  3KP3 A;  4HYE A;  3A02 A;  1L3L A;  1ONV A;  2EA4 A;  2JWT A;  4WXH A;  4XLH A;  3JRC A;  1YLF A;  4KIT B;  5EEG A;  1A04 A;  4B43 A;  2PX9 A;  4E70 A;  5DM7 F;  5E79 C;  2W7N A;  5A2Q Z;  3F3X A;  3ML6 A;  2FQ3 A;  1PYV A;  3FKJ A;  1JUM A;  1NHA A;  3OMY A;  3L2W A;  3I58 A;  2KLO A;  1FOK A;  2L01 A;  2DJI A;  4HX8 A;  2STT A;  4XOP A;  5FKM A;  2PMU A;  4CO8 A;  4CUG A;  2WAF A;  3LSI A;  3HOV J;  2CFO A;  2EFO A;  1J7K A;  1KYZ A;  2YU9 J;  2GBY A;  4RAY A;  1WJA A;  2DI3 A;  1A36 A;  1XGS A;  3L09 A;  4PJJ A;  2K9Q A;  1ZR4 A;  2IEK A;  4XOT A;  3DBL B;  4E7Z A;  4B09 A;  3RI4 A;  2H09 A;  1POG A;  5C4J J;  3T0Y A;  3TO6 A;  1TNT A;  2FBK A;  5CVU A;  3J7Z I;  1S7O A;  3HOX J;  4JYK A;  2Y0M A;  1OYW A;  2DT6 A;  3MQ0 A;  3S3O A;  4BJT A;  4L5J A;  2XDV A;  2OCE A;  4N9H A;  2WC2 A;  2Q0O A;  5FJ8 J;  1G4D A;  5D8L B;  3CMM A;  1B72 A;  1E17 A;  2MD0 A;  5EDN A;  3ZMT A;  1YIT I;  2R7T A;  4M3E A;  4U88 A;  1X2M A;  2KP6 A;  1Y1V J;  2XAG A;  5HNF A;  3KYD B;  4I76 A;  3LSM A;  3F6O A;  2EK5 A;  2OTJ I;  2OAZ A;  2R7X A;  1IRG A;  2ZME C;  2RQQ A;  2EH3 A;  1B6A A;  3J80 K;  3BTJ A;  1TWH J;  2AXL A;  5ICE A;  2FMY A;  1FX7 A;  1ZH5 A;  1MBF A;  2ZME B;  2C6Y A;  3WHB A;  2MD5 A;  5GAD J;  2BXZ A;  3RZD J;  5GTH C;  2NVY J;  4G9Y A;  3CCS I;  3EUH A;  3BCB A;  2B7E A;  2K27 A;  3BG3 A;  4UUS A;  4DJA A;  1O3S A;  2ZFU A;  4EJT A;  1LDK B;  2OQR A;  5KAI C;  1Z21 A;  1IRZ A;  3E5Q A;  3LL7 A;  2V1N A;  2VXD A;  2L9N A;  1LKX A;  4B4C A;  4A69 C;  1BI3 A;  2KIQ A;  4L0Z B;  1ON2 A;  3MWM A;  4LOC A;  1BOB A;  3DU6 A;  3DP7 A;  4K2E A;  3E1S A;  3PNT A;  4EM1 A;  4CH7 A;  2BBY A;  4EV0 A;  2GA1 A;  1Z3Y A;  1YJ9 I;  2E2J J;  2BW3 B;  2OJE D;  3HOU J;  4MIM A;  1C0W A;  3DXJ F;  5C4X J;  4MQ9 F;  3HZJ A;  2FU4 A;  2QUF A;  4ZYA A;  3L2U A;  1ETV A;  2CUE A;  1XMX A;  2VT2 A;  2V79 A;  4HDV A;  3O8H A;  4XBF A;  3Q5F A;  1TW3 A;  1XGM A;  3BG7 A;  3D0S A;  4XL9 A;  3Q3S A;  2ME0 A;  5TRD A;  2VJ4 A;  4DYQ A;  3VYT B;  3QOD A;  1ZG3 A;  1UST A;  2H94 A;  1W1W E;  3VYU B;  3JTG A;  3AG1 H;  1D8K A;  2JQ7 A;  4TV7 A;  4RGS A;  1JKR C;  3JW4 A;  1QZE A;  3D1N I;  3K4B A;  3OSG A;  2EFW A;  1KGS A;  5CVI A;  3JSO A;  1MGT A;  2H6B A;  2NS7 A;  2FBH A;  1Z91 A;  1D0X A;  5EYR A;  2EIM H;  5KCM A;  3OS1 A;  1UZC A;  2XAU A;  5HNH A;  4EJW A;  5HLT A;  4RGU A;  4BXF A;  2ZNY A;  4IEJ A;  3ZQC A;  2KJC A;  2V9P A;  3KP7 A;  1XDS A;  3NAU A;  4OWR B;  2Y9Z A;  4A5M A;  4B3X A;  2LMD A;  5LHH A;  1CF7 A;  4ABZ A;  4CCK A;  4ENN A;  4NUB A;  5JR3 A;  2H6C A;  3CUQ C;  1BW6 A;  2ISY A;  1WJE A;  2ADU A;  2JUC A;  3E0J B;  1W36 D;  4UB8 C;  1X4O A;  4CZC A;  2IT0 A;  1U5T C;  3K1P A;  4NNJ A;  5M5Y J;  1VQ6 I;  3DBH B;  4CA0 A;  3J7A Y;  1FBS A;  2VQL A;  4E7I A;  2VJI A;  1H0M A;  5ICC A;  1MIJ A;  1K78 B;  2NVT J;  2KHM A;  3G73 A;  3OYC A;  1UHM A;  1XX5 A;  4AIJ A;  2R5Z A;  2M0C A;  1ZLJ A;  3GME A;  2EV5 A;  4C2U A;  4KMF A;  1YX3 A;  3IRQ A;  2BEO A;  2I5U A;  4AC0 A;  2HKO A;  1FNN A;  4CZZ A;  4BE2 A;  1ZR2 A;  5E8G A;  4L9J A;  2V1D A;  3S2W A;  2JTV A;  2R7Q A;  1HKT A;  1MW7 A;  1LUJ B;  3K10 A;  2R5Y A;  1G3W A;  1LPQ A;  2Z33 A;  2F48 A;  3M8F A;  5FRN A;  2LRD A;  1XC5 A;  1UEL B;  4B3A A;  3IH3 A;  5IT3 A;  1IRF A;  5E3M A;  2XGE A;  5JLW A;  3ZQ7 A;  1VFC A;  3LFK A;  4OIP F;  1Y0N A;  1U0J A;  4GRI A;  1PP7 U;  2AQE A;  2RN7 A;  3A1Y A;  3PFY A;  2VJJ A;  4IOA F;  3PNY A;  5DCM A;  1TLH B;  2XB5 A;  3EUA A;  1DU6 A;  1DPU A;  2FEZ A;  1Z1D A;  3M8J A;  4Z6Y A;  3TP3 A;  4D7M A;  3CCU I;  4M3F A;  2E19 A;  2KIM A;  1PUF A;  1XS9 A;  3HIF A;  1F36 A;  5C3E J;  2H8R A;  1Z6T A;  4BGD A;  2WB1 A;  1H89 C;  2WA0 A;  2XB0 X;  3A01 A;  2DYS H;  4M3D A;  4M3B A;  2DTR A;  1KQ9 A;  3BR1 A;  4FCY A;  5ILU A;  3O6B B;  4G94 A;  2DJN A;  5DS9 A;  2A6T A;  2V6C A;  4EEF G;  3M9A A;  5LEJ A;  1S5L C;  4ITV A;  3W3C A;  1IXR C;  3HL2 A;  2L7Z A;  5L3C A;  3I0T A;  3EUK L;  3KPH A;  5J40 A;  2DMP A;  2GWR A;  3FXM A;  1H9G A;  1ZRC A;  3H3V K;  4XID A;  4IHX A;  1LFB A;  2OF7 A;  3HBL A;  3N97 A;  3TQN A;  3WE2 A;  4HF2 A;  2MLK A;  1APL C;  1R5G A;  3QPS A;  1B1B A;  4E7L A;  1ZRE A;  3S15 J;  4PGG A;  1LE8 A;  4YIF A;  3ZQL A;  4V2G A;  4M74 A;  4G6Q A;  1R4N B;  1W0U A;  3HHH A;  3GTO J;  3GO5 A;  1NG6 A;  1LFP A;  2DA6 A;  1GV2 A;  1ORK A;  1XTA A;  5J8C A;  4UB6 C;  2DAO A;  4XR6 A;  5D6E A;  1OCP A;  2M2E A;  3LQQ A;  5F1J A;  4L9N A;  1B9M A;  1LEA A;  4R79 A;  2Y0S N;  1QHH D;  2IXS A;  1RNL A;  4U0Y A;  4D1Q A;  1SD6 A;  2BY2 A;  3A03 A;  3RJP A;  4RLQ A;  5E1W A;  4LGW A;  4A3E J;  2VOP A;  1QVU A;  1MDM A;  1D5Y A;  5K5Q A;  2QKM B;  3CF5 F;  1MSF C;  1Z05 A;  1MJB A;  2R5Y B;  3OOP A;  3BDD A;  3L7W A;  1QRY A;  3BPV A;  3TO9 A;  2DXI A;  1STZ A;  2BYV E;  2F4O B;  2GM4 A;  1JGS A;  3DPT A;  3M4O J;  3W2V A;  1WJD A;  2QLZ A;  3FMR A;  3U1K A;  2HXI A;  3K1N A;  2L54 A;  3OWT A;  4RGX A;  4UV8 A;  3RZO J;  1RZ4 A;  2P81 A;  2LOO A;  2HKX A;  4JK1 X;  4CIC A;  2R93 J;  3MVP A;  3KZY A;  5KVR A;  2LBF A;  1H88 C;  3FZV A;  2JK3 A;  2R4G A;  1EH7 A;  1BIB A;  1IV8 A;  4UVB A;  1IUY A;  3X2Q H;  2MAB A;  2NVQ J;  3BY6 A;  2EFP A;  2ZSH B;  2NNY A;  1G6N A;  5HVQ C;  5JFR A;  2W48 A;  3MCZ A;  4NQW B;  2GAU A;  2X4H A;  1U8R A;  1DDN A;  4PSW A;  3BR0 A;  4M6V A;  1LVA A;  3HKZ A;  3ZGK A;  1WI3 A;  2QZ8 A;  4Q47 A;  2HQN A;  2XRN A;  3OR1 C;  3KP6 A;  4LD5 A;  4XSX F;  3CC2 I;  1VQK I;  1UFM A;  4L18 B;  4CCO A;  4EVI A;  4DZJ A;  3GTM J;  4A2U A;  2ELK A;  1R5H A;  3JRE A;  3TW6 A;  1QPM A;  1DQU A;  3S2H J;  1MD0 A;  4A3I J;  2JMW A;  2MC4 A;  1U2W A;  2D45 A;  3DWL E;  4HW0 A;  4Y15 A;  4NB5 A;  3QAH A;  1OR7 A;  1SVM A;  4A3G J;  1BI1 A;  4LIU A;  5K5R A;  5BQT A;  2VLA A;  3CJR B;  2EB7 A;  3IAS 2;  5H2F C;  3HSF A;  3U1D A;  3PJR A;  3FMS A;  3K2A A;  2IRF G;  1BJZ A;  3OYD A;  4LIV A;  4J01 A;  2O8K A;  1LJ9 A;  2H1K A;  2JSC A;  3C7J A;  1TWG J;  3RCO A;  1IN7 A;  4O3M A;  2HQ5 A;  3CJT B;  5FGM A;  3G1M A;  2AS5 F;  1R1U A;  2VKD A;  4DIQ A;  2LD5 A;  3BZK A;  3M1C A;  4XON A;  2O9L A;  3T1B A;  1MKM A;  2Y31 A;  5EGO B;  3I55 I;  2JPC A;  4A5N A;  1FZP B;  1R5I D;  2CW8 A;  3WTW C;  5FLM J;  2CQK A;  1U6G A;  2BHY A;  1TC3 C;  4XLF A;  3S14 J;  1RI7 A;  5LFA A;  1HBX G;  1ZGA A;  4HRI A;  1IZ1 A;  2CUZ A;  3IV5 A;  3OYF A;  1BW5 A;  2NOG A;  3CES A;  1ZTR A;  4BE0 A;  3PIO F;  2J5P A;  1P7I A;  2W84 A;  3QPH A;  2K40 A;  2VC0 A;  4NBQ A;  3HGG A;  4V19 K;  4PJM A;  1ODD A;  3D5L A;  4XLA A;  1B9N A;  3K2Z A;  3QPL A;  1W5T A;  3V7R A;  3CO6 C;  1AWC A;  2DOD A;  2QQ9 A;  3IAM 2;  2LC2 A;  1A6Q A;  4BU2 A;  1ULY A;  4I02 A;  2IVM A;  3VFZ A;  2M45 A;  2FD5 A;  4IVN A;  3GVA A;  4AYB N;  3G1L A;  5J1Y A;  2A6H F;  1BC8 C;  4MFE A;  4FE7 A;  1VQ4 I;  2L7F P;  2XGX A;  4JP0 A;  3WG9 A;  3BTC A;  1X19 A;  4UHT A;  1AA7 A;  2CW0 F;  5B1A H;  1MBJ A;  2DCE A;  1BOA A;  5AIP A;  4PFO A;  1ZAO A;  3GBG A;  3H0G J;  4HF1 A;  2GXG A;  4KIC A;  3JRB A;  2D5V A;  2JA2 A;  3TMO A;  4HOB A;  5ICF A;  2XKP A;  4EGZ A;  2R7W A;  2L02 A;  1IXC A;  1N78 A;  1J0R A;  4HLX A;  2OUM A;  3R6S A;  1IF1 A;  2E1M B;  2O61 A;  4ZDP A;  3I4M J;  2L7K A;  1JI8 A;  2XF5 A;  2HGC A;  1G3T A;  3BPX A;  3CZ6 A;  3S3M A;  3FF5 A;  2EV6 A;  4AU7 A;  2WV1 A;  2ACJ A;  1CGP A;  3H3Z A;  3I64 A;  3GYH X;  1QQI A;  2EIL H;  2CO5 A;  3A4C A;  2XAS A;  4XSZ F;  1NTC A;  1HF0 A;  4L5I A;  4EGY A;  2DW4 A;  3JR9 A;  2KPM A;  3HXL A;  3GX4 X;  2XV4 S;  3PUB A;  2CQN A;  4NC8 A;  3SJM A;  4Y7N J;  2KRF A;  2NS0 A;  4C3I J;  4G7O F;  4LIT A;  4U87 A;  5M3M J;  2W82 A;  2F5D A;  1EJ9 A;  4LB6 B;  3V42 A;  3GZ6 A;  1WJC A;  3OL3 A;  1B8I A;  2X0L A;  4I0A A;  2IGO A;  3DEU A;  5KHD A;  2HZT A;  2JA8 J;  3I4N J;  1SMT A;  2EZK A;  2QGU A;  5F08 A;  3UKG A;  2GLO A;  3A2K A;  1HSJ A;  3KYC B;  2L9R A;  1U8B A;  9ANT A;  5LRS A;  1XMK A;  1FJL A;  2X48 A;  2X6X A;  3IH2 A;  3JRH A;  2ZB9 A;  2R7Z J;  5IP7 J;  2UXN A;  3Q0U A;  2KJB A;  5M3F J;  2PFB A;  1BR4 A;  1EF4 A;  4DNC A;  3SYT A;  1SMY F;  4N9I A;  3T8T A;  5HOD A;  1ETQ A;  2VKH A;  1K4S A;  3OYA A;  3QOE A;  3AFH A;  1UB9 A;  3RPQ A;  2BY0 A;  2E5N A;  5GPA A;  5DM6 F;  2COM A;  4XLC A;  5GAG J;  2VIX A;  3F21 A;  2E36 A;  3KLN A;  3LSG A;  2HOS A;  2QF7 A;  3GTP J;  4PZJ A;  4YEJ A;  3SEQ A;  2QA4 I;  1QBJ A;  2PI0 A;  4FE4 A;  3DFG A;  2OV7 A;  4AVP A;  3OS2 A;  3WU0 A;  2K9S A;  2ZJP F;  4KIS A;  3TDU C;  5KNL A;  4Y17 A;  3T5X A;  3J7A O;  3GZN B;  3HC7 A;  1X58 A;  2MH2 A;  3SDG A;  3QRF F;  1MMS A;  1UAA A;  3ERM A;  1T98 A;  2R7F A;  3LSJ A;  5J6X A;  4BXU A;  1E0E A;  4ASN A;  1SD5 A;  4MQV A;  3RKW A;  3V7C A;  1T38 A;  1RUO A;  2CV2 A;  3K4C A;  1TNS A;  1ZG5 A;  3DF8 A;  1TWA J;  3C2G A;  4GYG A;  1YYV A;  1MMD A;  2F4I A;  5F0F A;  4DOZ A;  5FKK A;  2JA7 J;  1XDU A;  5B1B H;  2Q1Z B;  4N0B A;  1YIJ I;  3I59 B;  3FK7 A;  5M5W J;  1V5G A;  1Y1W J;  1GVD A;  4IX7 A;  4PJL A;  5JI6 A;  5IY5 H;  2HVQ A;  3KEO A;  4ZZL A;  4YG2 F;  2PEX A;  1T6S A;  2IJL A;  3C18 A;  3FBI B;  2CRG A;  2QEX I;  3Q0W A;  2BGC A;  4Q5S F;  1D5V A;  2DOA A;  2JRM A;  3ZMV A;  4EMS A;  1U5T B;  2VOO A;  2A05 A;  2I10 A;  1X4P A;  2CUF A;  4W1U A;  2ISZ A;  3P5J A;  1P7J A;  2NOJ B;  1X1A A;  4CDG A;  3SXY A;  4B47 A;  4A6D A;  3RYR A;  1K6O A;  1W5S A;  4IRG A;  3PO3 J;  1TT0 A;  2DDB A;  2ESH A;  4ESB A;  2JT1 A;  3C2B A;  5E3N A;  3NEU A;  5FLX Z;  1ZK8 A;  2F5V A;  5TJJ A;  5E20 A;  3TO7 A;  3V8K A;  2XGC A;  1T56 A;  3EET A;  3ZMU A;  2K85 A;  3MMY B;  1YW8 A;  1R4M B;  2FOW A;  2Z1D A;  1BM9 A;  1MBK A;  1ETW A;  2K9M A;  1T33 A;  1O57 A;  1I6H J;  3Q0V A;  2CQ7 A;  2M8G X;  2UZK A;  4HAM A;  2UXX A;  4JQF A;  4G7Z F;  4ZZD A;  3F0C A;  1P9Q C;  3BJO A;  1U3E M;  4NQW A;  1BR2 A;  1TBX A;  3L1P A;  5HDK A;  4EQQ A;  3ZCO A;  3GCM A;  1O3R A;  2HOT A;  4I0B A;  2WY7 Q;  3OY9 A;  3ASO H;  5IYB J;  2VI6 A;  5IYC J;  4CSW A;  1SFE A;  1TQM A;  2X51 A;  2DT7 B;  2DO7 A;  3KP5 A;  1YJW I;  4RDU A;  2KT0 A;  2ME6 A;  1FEX A;  3I9V 2;  2Q2E B;  4KT5 C;  3HDD A;  2EBI A;  3PFI A;  2XAQ A;  2IS4 A;  5FFZ A;  1D0Y A;  2XC7 A;  4PJN A;  2EV0 A;  3E5X A;  3A0H C;  1JHH A;  2L0K A;  2QSH X;  2VN2 A;  1W7P B;  3S32 A;  5CQG A;  3N4M A;  3PNV A;  3V8J A;  3DKX A;  3HOY J;  4N4N B;  3EYI A;  2ZJ2 A;  3HUG B;  3MZY A;  4HZF A;  3GTK J;  4BQN A;  1DGR M;  3MZ8 A;  2L9S A;  2LY2 A;  3S8P A;  2A5Y B;  3ZN0 A;  1WJF A;  1SVL A;  1WCM J;  3BR3 A;  3CCJ I;  2LG4 A;  3ZRG A;  2QBY A;  5E3L A;  4HA8 A;  1DGW Y;  2Y69 H;  2Z3Y A;  1FC3 A;  3BTL A;  2UUZ A;  2DK5 A;  3ONQ A;  3HG9 A;  3QU3 A;  4ON0 A;  3HB9 A;  1WZ2 A;  2HDD A;  5ED4 A;  2BZT A;  2WY8 Q;  1BBY A;  1FP1 D;  4I6Z A;  3O3K A;  2KRH A;  3PQJ A;  1H8A C;  2KIS A;  4HNU A;  3IWF A;  3CCE I;  1D1C A;  1Y8Q B;  1TWF J;  1JJ6 C;  1FIP A;  2DMU A;  5CYV A;  5LGT A;  2A5W A;  3CLQ A;  1JKO C;  4O5V A;  4RBO A;  2GOM A;  3F6V A;  2JJ7 A;  4JBA A;  1WKM A;  1D3Y A;  2OPT A;  2N8G A;  1JT0 A;  1JUP A;  3ABM H;  3DTI A;  5IP6 A;  5JLX A;  3CCV I;  2H1L A;  2YPR A;  2ZFW A;  1IN8 A;  2R3S A;  1Z77 A;  1ZEL A;  4Y52 J;  1HW2 A;  2Q8K A;  3S1Q J;  3F9K A;  3QYF A;  1SEU A;  3W2W A;  2HYF A;  2HWV A;  1YW7 A;  2WV0 A;  3F72 A;  3QWL A;  5HS9 A;  3PSI A;  1R49 A;  4IHW A;  2NAZ A;  3B6C A;  2FML A;  1KYW A;  2GXB A;  3VOE A;  3ZQH A;  3TW7 A;  5BPD A;  1TWC J;  2WWY A;  5LD2 C;  3DBR B;  4E4H A;  3TOA A;  4M6X A;  1PDN C;  1ON1 A;  1XSV A;  1XGO A;  1VQ8 I;  4A3L J;  3S1R J;  3BTI A;  2IP2 A;  3KP4 A;  1Z67 A;  4E6K G;  1QU3 A;  3A01 B;  1W5C C;  2X6W A;  2O03 A;  4QIW N;  3VWB A;  4UY8 I;  2DA2 A;  1VQ9 I;  4I2O A;  4MTD A;  4D5C A;  4PDK A;  4XQF A;  4CCM A;  1PUF B;  2NS8 A;  4MNU A;  4DBQ A;  4G8X A;  3RPU A;  2LK2 A;  2M4G A;  3G71 I;  3L9F A;  3FIW A;  4LG3 A;  3K4K A;  3RSN A;  1FLI A;  5FD6 A;  1W4M A;  1JJ8 C;  1G8X A;  3S3N A;  3S93 A;  1X1B A;  1NK2 P;  1ZLK A;  2JZY A;  1RET A;  5EG0 A;  1F1Z A;  2QSF X;  1VQ5 I;  1T08 B;  4FIS A;  1O7L A;  4YFX F;  4CXF A;  4EAT A;  2L4A A;  4I99 C;  3PSF A;  3W2A A;  2ZJQ F;  1UHS A;  1IN4 A;  2DA7 A;  2M1B A;  2PMZ A;  5FD5 A;  3FBN B;  2P6T A;  4BKX A;  4BY1 J;  1OJL A;  4A0X A;  4IHT A;  1BN5 A;  3F8F A;  3JSP A;  1WI9 A;  2CQX A;  2TRT A;  1KQ0 A;  4EM2 A;  1JTX A;  3DV8 A;  1Z6R A;  1V55 H;  2K4B A;  4PCQ A;  1WSU A;  3K4J A;  3K9T A;  4G6T B;  4ZYD A;  2V1U A;  3RIR A;  1IDZ A;  4BAC A;  1OFC X;  1FOX A;  2TDX A;  3I4P A;  3EQL F;  2FRH A;  1YS6 A;  1V5E A;  3ZXS A;  5HLG A;  3BWG A;  3KP2 A;  4BQA A;  1S3J A;  4BJ5 C;  1J09 A;  1I27 A;  4RB0 A;  2A61 A;  5FFX A;  4BHB A;  5BS6 A;  4ZTJ A;  4NHJ A;  2DMQ A;  1P6R A;  4C9Y A;  5LEK A;  4A3K J;  4O6J A;  3TKY A;  4DBR A;  5J47 A;  2GXA A;  2E71 A;  2V4J C;  3AG2 H;  5FRM A;  3S17 J;  1YI2 I;  5FKO A;  4OIO F;  3M7G A;  2DQL A;  4HLY A;  1HDP A;  1SFO J;  3Q9V A;  3BR5 A;  5K7Z A;  1G3Y A;  2K5C A;  1CF7 B;  1EA3 A;  5HS7 A;  3LA7 A;  3R0J A;  2GA2 A;  3MN2 A;  5L3D A;  3OYM A;  4PUS A;  3I54 A;  4LG0 B;  4HQM A;  4OU0 A;  1FSH A;  3KX2 A;  1W7P D;  2XRL A;  3JRG A;  5LGN A;  2QVO A;  3E5U A;  3F8M A;  2LTP A;  3K6G A;  3CD6 I;  2CUJ A;  1R00 A;  1K79 A;  4L0Y B;  1K4T A;  1YS7 A;  3ULQ B;  5H6Q A;  3VPR A;  4AID A;  3F8N A;  2OU2 A;  1TZL A;  4E7S A;  3LFU A;  1FOW A;  1MND A;  2Z5U A;  3KZI C;  5GP9 A;  4RA2 A;  3OYG A;  1X3W B;  2EFN A;  3I53 A;  2BY3 A;  4J00 A;  2Z2S B;  2P8T A;  1TT5 B;  2VKE A;  2Y9Y A;  2M34 A;  4BBR J;  3L2R A;  5LGU A;  3ABK H;  3F8C A;  3SZP A; 
#chains in the Genus database with same CATH homology
 3CJN A;  2ZNZ A;  1QZY A;  1ZRD A;  3WTV C;  2CFX A;  2RV8 A;  4G7H F;  3TDZ C;  3FM3 A;  5E17 F;  4LFU A;  1O3Q A;  1H9T A;  2STW A;  1J2X A;  1FP2 A;  2XAF A;  1XB4 A;  3RYP A;  5HOO A;  4LLN A;  2M8E A;  5FLX K;  3IC7 A;  3SZT A;  2GIV A;  3ECH A;  4OIQ F;  2VC1 A;  3IRR A;  2LDU A;  4WXC A;  4H0E A;  3QU6 A;  4CYD A;  1FBQ A;  4GXO A;  1ZGJ A;  2VON A;  4I01 A;  1LDD A;  3FXU A;  2NYX A;  5LHI A;  2KIU A;  2NRA C;  1USS A;  1GHC A;  2YR2 A;  4LB5 A;  1JE8 A;  1SD4 A;  2K7L A;  3GF2 A;  2VBW A;  1YTY A;  3B73 A;  1OKR A;  3ELK A;  3IWZ A;  5DEQ A;  4ZYH A;  3AAF A;  1S7A A;  2PMH A;  2A3S A;  3G3Z A;  2ESN A;  1IN6 A;  1HST A;  4WCG A;  3DPL C;  1DPR A;  2PG4 A;  3JTH A;  3HRM A;  2UWM A;  2DBB A;  3V8L A;  3COA C;  5HLH A;  3W6J B;  3LAJ A;  2A6E F;  3FXQ A;  4BH9 A;  5BOX A;  3M1E A;  1VTN C;  4EM0 B;  5CVV A;  3GFJ A;  4LLL A;  3KLO A;  4M72 A;  2HS5 A;  2O0Y A;  4HBL A;  1W7P A;  2RNJ A;  2IA0 A;  1KA8 A;  2IPQ X;  1JHF A;  3E6D A;  2ETH A;  3H3U A;  4YII A;  3GFM A;  2PN6 A;  1LDJ A;  2QBY B;  2PLY A;  3L00 A;  3CO7 C;  3GW2 A;  1HW5 A;  1QO0 D;  2F5C A;  2BE5 F;  3VB2 A;  3R61 A;  4D0P A;  1MJA A;  3HUG A;  2F5E A;  3MAJ A;  5E1Z B;  3CUQ A;  3HRU A;  4QLC U;  5LBQ A;  1HW1 A;  4XRF A;  1T2K A;  1FSE A;  1I1S A;  1I6X A;  2VXZ A;  1OPC A;  2YU3 A;  3K1M A;  2QEN A;  4LK0 F;  4P5O A;  5F6F A;  1F4K A;  1BI2 A;  2OZU A;  2MH9 A;  4KN4 X;  5F1R A;  1K7A A;  1UHW A;  2HR3 A;  4ZYE A;  3REO A;  2MLG A;  3WU1 B;  4U0W A;  2XAH A;  3LQR A;  4GGG A;  2W24 A;  3LA3 A;  5D8K B;  1KU7 A;  4F7Z A;  3CUQ B;  2XAJ A;  2P5K A;  4KIB A;  2YX7 A;  5L3F A;  3ZMZ A;  3ISP A;  4AD9 A;  1DUX C;  2FE3 A;  1O7F A;  1D8J A;  2P5L C;  1SFU A;  3EYY A;  1R7J A;  1E2X A;  3O2P E;  3E3V A;  2QM3 A;  3GUD A;  4BAY A;  2RC4 A;  2P7V B;  4KA4 A;  2MC3 A;  2FNP A;  5AIQ A;  3I59 A;  4KN7 X;  1LEB A;  4RB3 C;  1TW2 A;  3VOD A;  2E1C A;  3QP6 A;  1LNW A;  1HQC A;  1J59 A;  3MFK A;  2EWN A;  5ERI A;  1S8N A;  1YIO A;  1BC7 C;  4M9X A;  2XIG A;  1F9N A;  4AIH A;  2K02 A;  4LMY A;  2QQB A;  3OV8 A;  1GXP A;  3SHF A;  4HX4 A;  2IW5 A;  3GWZ A;  3TOB A;  1ZHF A;  4U7B A;  4IJA A;  4KYW A;  6PAX A;  3EDP A;  3HTS B;  3J81 Z;  4WF2 A;  3ZP5 A;  2Y48 A;  4A0Y A;  1R23 A;  4EJO A;  1KU2 A;  2HDC A;  4M9S A;  2O8X A;  4RAZ A;  1MZB A;  1U78 A;  1HKS A;  4IHS A;  3ZMD A;  2P7C B;  1YW9 A;  3E6B A;  3QP5 A;  2ZO4 A;  2Z9O A;  3K0L A;  2E7W A;  1AOY A;  2F5F A;  2OBP A;  2HQR A;  4I7H A;  4S05 A;  2W25 A;  4IPA A;  5K1Y A;  3FWE A;  3LA2 A;  3KZZ A;  3HOT A;  4HF0 A;  5HS8 A;  2LSO A;  1V4R A;  4M6Y A;  3BP8 A;  1XD7 A;  3QPT A;  3ZMS A;  4FX4 A;  4LJZ F;  4M73 A;  4OMZ A;  5CJ9 A;  4KNY A;  4QWQ A;  4UV9 A;  2NNN A;  1WRJ A;  2G7H A;  1XN7 A;  3SFZ A;  3FHZ A;  1B4A A;  1OYY A;  3F8B A;  2HTS A;  3LWF A;  3HRT A;  1JXS A;  2EFQ A;  4S04 A;  5D6F A;  2A07 F;  4EJU A;  4AWX B;  2RDP A;  4KMU X;  3WTX C;  4KUM A;  5AON A;  1XGN A;  4XLP F;  3E6C C;  4ESF A;  2VBZ A;  1BJA A;  3W6K B;  4Z2Y A;  2QYO A;  5HDN A;  4MGR A;  5D5U B;  2YX4 A;  4GYI A;  1Z7U A;  4BHP A;  1I5Z A;  2ZXJ A;  5DCF A;  1R22 A;  2VE8 A;  3NQO A;  2K86 A;  2CWE A;  1FBU A;  1KQ8 A;  2LKP A;  4OIR F;  5DD8 A;  1B59 A;  4LK1 F;  1L0O C;  3JAM K;  5F64 A;  1HXD A;  4HV6 A;  5ICG A;  2HOE A;  1FT9 A;  3CUO A;  2DU9 A;  3RDI A;  5ILS A;  2FOK A;  4IRI A;  3TGN A;  1IXS B;  1I1G A;  4M9Z A;  1YG2 A;  5DYM A;  3CTA A;  2XRO A;  1ZN2 A;  2D2W A;  1V3F A;  3ZN1 A;  4RB1 A;  1FPQ A;  2OA4 A;  1MJ9 A;  2HYG D;  4PGH A;  4HQE A;  1YFH A;  5IT9 K;  3H92 A;  3IKT A;  1REP C;  1TQI A;  2OQG A;  3WOD F;  4KFC A;  4MTE A;  1EV7 A;  2K4J A;  2LF7 A;  2O3F A;  5FO5 A;  1PP8 F;  4WK8 F;  3FXR A;  4HDU A;  3RKX A;  5DUI A;  3KE2 A;  2XVC A;  4OMY A;  1S6L A;  3I5U A;  3KEQ A;  3WGI A;  3DKW A;  3T8R A;  3HSR A;  5E8I A;  1GVJ A;  2DLL A;  3F22 A;  3BJA A;  3P9K A;  3LST A;  2VBY A;  1J5Y A;  4P96 A;  1KU9 A;  5JHU A;  4A12 A;  3CLO A;  2FF4 A;  2G7U A;  4FHT A;  3RTR A;  3R4K A;  3IL2 A;  2Z99 A;  3HTU A;  5D5V B;  3ABU A;  4Y13 A;  3FM5 A;  5LHG A;  1PUE E;  2XKO A;  5FB2 A;  4HV5 A;  2O6G E;  2VT3 A;  4Q48 A;  3BRO A;  4ENM A;  5DDG A;  1YQA A;  1TQP A;  3B02 A;  1G3S A;  2D1V A;  3I71 A;  4RB2 C;  5ILV A;  2FSW A;  1ZRF A;  1P4X A;  2H27 A;  4UUV A;  4WWC A;  1J9I A;  1X3U A;  1XCV A;  1R1V A;  4ENJ A;  2RQP A;  2A68 F;  2E1N A;  2ELH A;  1P2F A;  1FWZ A;  3WGH A;  4EJV A;  1IN5 A;  2QWW A;  4OIN F;  4A6E A;  2CG4 A;  1XCB A;  1FYM A;  4B8X A;  3E97 A;  5CVJ A;  3SQN A;  2L4M A;  5D5W B;  5L3G A;  4ENK A;  5A2Q K;  3KET A;  1RUN A;  1SAX A;  3ABT A;  4KDP A;  1BIA A;  4WXD A;  3FX3 A;  4XLN F;  4FX0 A;  3MZH A;  3WTY C;  2PQ8 A;  2QQA A;  5J8F A;  1K78 A;  2ZKZ A;  3VEP A;  2MA3 A;  3WTZ A;  2PJP A;  2Y75 A;  1GXQ A;  4L9V A;  3KFW X;  1SD7 A;  5H6R A;  3ROU A;  4LG0 A;  1XMA A;  4CHU A;  5DUK A;  5LRR A;  4MHG A;  5D5X B;  3WGG A;  4R8H A;  3P9C A;  3ERE D;  3GZ5 A;  2EA2 A;  5DD4 A;  1DP7 P;  1QZZ A;  4GO1 A;  1ZYR F;  4MEY F;  1R1T A;  1Z9C A;  2GQQ A;  1Q1H A;  3V4G A;  4UVC A;  2HTJ A;  4UNO A;  2VE9 A;  3CDH A;  4UVA A;  1HKQ A;  3J81 K;  4RS8 A;  2PBI A;  1IW7 F;  4G6D A;  4R1H A;  2FXA A;  4HX7 A;  2OZ6 A;  3M8E A;  3P9I A;  5BMZ A;  3R60 A;  4OOI A;  1T0F A;  3QOP A;  3DQV C;  3HOS A;  3JAM Z;  2CYY A;  4YFK F;  1IAW A;  3J80 Z;  1Y0U A;  1J75 A;  2HEO A;  1SFX A;  2KKO A;  1P4A A;  1FY7 A;  3GEZ A;  4YFN F;  1UCR A;  3ECO A;  1RIO H;  5L3B A;  4BYY A;  2R7D A;  3WE3 A;  2JPB A;  4FT8 A;  3BOQ A;  3Q9S A;  3U2R A;  2DPD A;  2ZME A;  4P9U A;  3BZ6 A;  2GZW A;  2M5W A;  5BPI A;  2OD5 A;  3WTT C;  1T39 A;  4GCV A;  3U9G A;  1MDM B;  3P7N A;  3GFL A;  3C1D A;  1ZG1 A;  5IT9 Z;  1O3T A;  1WQ2 A;  2L3D A;  1XSX A;  3MEX A;  2J5O A;  4UXN A;  1S29 A;  2W85 A;  3RKY A;  4I09 A;  5E18 F;  1QNT A;  2DK8 A;  1LB2 A;  5K5O A;  4WX9 A;  5HDG A;  3KCC A;  3FMQ A;  2DFI A;  5HLI A;  3F23 A;  3GFI A;  5D4R A;  2DQR A;  4IF4 A;  2M30 A;  5EEH A;  2ZCW A;  2D1H A;  4KIF A;  2VOD A;  1P4W A;  4AIK A;  4MEX F;  2B0L A;  4I98 B;  4KIG A;  3ZPL A;  3L2C A;  1F5T A;  3LAP A;  2P6S A;  2EJR A;  2P4W A;  3HHG A;  3K69 A;  5JVT A;  2V1X A;  4LLG F;  2XUB A;  5LLQ A;  1EH8 A;  1EH6 A;  4RGR A;  2MBF A;  2Q2E A;  2YSR A;  4U0V A;  5DCM B;  1LQ1 A;  4P55 A;  5CLS A;  4IRH A;  4ZYG A;  4CGZ A;  5L3E A;  4ESJ A;  2FBI A;  4A0Z A;  2DPU A;  3WTS C;  1P92 A;  4Q4Z F;  3GLX A;  1R58 A;  4BHC A;  1TTY A;  1YO5 C;  2DT5 A;  3E6M A;  3HYI A;  1KU3 A;  2RGV A;  2CSO A;  2F2E A;  2V9V A;  4L9T A;  2LF8 A;  2FA5 A;  2WTE A;  2VBX A;  3R0A A;  1FYK A;  1WWX A;  3HRS A;  1U5T A;  3IHU A;  2LNB A;  2IA2 A;  1FYL A;  3HSE A;  2P5V A;  4ZH4 F;  5D4S A;  4M71 A;  2M87 A;  4BNC A;  1R36 A;  2E7X A;  1XSD A;  3IKV A;  3WTU C;  1ZAR A;  4ETS A;  2FNA A;  2KIF A;  2IA1 A;  1OYI A;  2HFH A;  1BI0 A;  2G9W A;  3GXO A;  2JRT A;  2CGP A;  4DQ2 A;  2RVC A;  1QGP A;  2RKH A;  5CVR A;  5E1X A;  2XHK A;  2W57 A;  2ZBK A;  3C3W A;  5KK1 A;  4U7D A;  4IXA A;  5H20 A;  2A69 F;  3BJ6 A;  2BV6 A;  5DV5 A;  3NRV A;  1OMI A;  3V7S A;  3PQK A;  4P9F A;  3KP3 A;  4HYE A;  1L3L A;  1ONV A;  2EA4 A;  4WXH A;  1YLF A;  5EEG A;  1A04 A;  4E70 A;  5A2Q Z;  3F3X A;  3ML6 A;  2FQ3 A;  1NHA A;  3I58 A;  1FOK A;  2L01 A;  4HX8 A;  2STT A;  4CO8 A;  2PMU A;  2EFO A;  1J7K A;  1KYZ A;  4RAY A;  2DI3 A;  1XGS A;  3L09 A;  4B09 A;  3RI4 A;  2H09 A;  3T0Y A;  3TO6 A;  1TNT A;  2FBK A;  5CVU A;  1S7O A;  2Y0M A;  1OYW A;  3MQ0 A;  4L5J A;  4N9H A;  2WC2 A;  2Q0O A;  1G4D A;  5D8L B;  1E17 A;  3ZMT A;  4U88 A;  2XAG A;  3F6O A;  2EK5 A;  2OAZ A;  1IRG A;  1B6A A;  3J80 K;  2AXL A;  5ICE A;  2FMY A;  1FX7 A;  1ZH5 A;  2ZME B;  2C6Y A;  2MD5 A;  4G9Y A;  3EUH A;  2K27 A;  1O3S A;  4EJT A;  1LDK B;  2OQR A;  3E5Q A;  1BI3 A;  4L0Z B;  1ON2 A;  3MWM A;  3DP7 A;  4K2E A;  4EM1 A;  4EV0 A;  2BBY A;  2GA1 A;  1C0W A;  3DXJ F;  4MQ9 F;  2FU4 A;  2QUF A;  2VT2 A;  2V79 A;  4HDV A;  4XBF A;  3Q5F A;  1TW3 A;  1XGM A;  3D0S A;  5TRD A;  1ZG3 A;  1UST A;  2H94 A;  3JTG A;  1D8K A;  4TV7 A;  4RGS A;  3JW4 A;  2EFW A;  1KGS A;  5CVI A;  3JSO A;  2H6B A;  1MGT A;  2FBH A;  1Z91 A;  4EJW A;  4RGU A;  2ZNY A;  2KJC A;  3KP7 A;  1XDS A;  4A5M A;  5LHH A;  1CF7 A;  4ENN A;  5JR3 A;  2H6C A;  3CUQ C;  2ISY A;  2ADU A;  2IT0 A;  1U5T C;  3K1P A;  1FBS A;  1H0M A;  5ICC A;  1K78 B;  3G73 A;  1UHM A;  4AIJ A;  1ZLJ A;  2EV5 A;  4KMF A;  3IRQ A;  2BEO A;  2HKO A;  1FNN A;  4CZZ A;  5E8G A;  4L9J A;  2V1D A;  3S2W A;  2JTV A;  1HKT A;  1G3W A;  2Z33 A;  3M8F A;  5IT3 A;  1IRF A;  3ZQ7 A;  3LFK A;  4OIP F;  1PP7 U;  2RN7 A;  5DCM A;  1TLH B;  1DPU A;  2FEZ A;  1Z1D A;  2KIM A;  3HIF A;  1Z6T A;  2DTR A;  1KQ9 A;  5ILU A;  3O6B B;  4G94 A;  2V6C A;  5LEJ A;  3M9A A;  1IXR C;  5L3C A;  3I0T A;  2GWR A;  1ZRC A;  1H9G A;  3N97 A;  3TQN A;  3WE2 A;  4HF2 A;  2MLK A;  1R5G A;  1B1B A;  1ZRE A;  4PGG A;  4YIF A;  4M74 A;  4G6Q A;  3HHH A;  3GO5 A;  5J8C A;  2DAO A;  5D6E A;  3LQQ A;  4L9N A;  1B9M A;  1LEA A;  4R79 A;  1RNL A;  4U0Y A;  1SD6 A;  3RJP A;  5E1W A;  4LGW A;  2VOP A;  1MDM A;  5K5Q A;  1Z05 A;  1MJB A;  3OOP A;  3BDD A;  3L7W A;  3TO9 A;  3BPV A;  1STZ A;  2BYV E;  1JGS A;  3DPT A;  3FMR A;  2QLZ A;  3K1N A;  2L54 A;  4RGX A;  4UV8 A;  1RZ4 A;  2HKX A;  4JK1 X;  4CIC A;  3KZY A;  5KVR A;  3FZV A;  1EH7 A;  1BIB A;  4UVB A;  1IUY A;  3BY6 A;  2EFP A;  2NNY A;  1G6N A;  5HVQ C;  5JFR A;  3MCZ A;  2GAU A;  2X4H A;  1U8R A;  1DDN A;  1LVA A;  2QZ8 A;  4Q47 A;  2HQN A;  2XRN A;  3KP6 A;  4LD5 A;  4XSX F;  1UFM A;  4L18 B;  4EVI A;  4A2U A;  1R5H A;  1QPM A;  1MD0 A;  1U2W A;  2D45 A;  4Y15 A;  4HW0 A;  4NB5 A;  3QAH A;  1OR7 A;  1BI1 A;  5K5R A;  5BQT A;  2EB7 A;  3HSF A;  3U1D A;  3FMS A;  2IRF G;  1LJ9 A;  2JSC A;  3C7J A;  1IN7 A;  4O3M A;  5FGM A;  2AS5 F;  1R1U A;  3T1B A;  1MKM A;  2JPC A;  4A5N A;  1FZP B;  3WTW C;  2CQK A;  1U6G A;  1RI7 A;  1HBX G;  1ZGA A;  1IZ1 A;  2J5P A;  2W84 A;  3QPH A;  2VC0 A;  1ODD A;  3D5L A;  1B9N A;  3K2Z A;  3V7R A;  1W5T A;  3CO6 C;  1AWC A;  2QQ9 A;  1ULY A;  4I02 A;  2IVM A;  3VFZ A;  2M45 A;  4IVN A;  3GVA A;  2A6H F;  1BC8 C;  2XGX A;  3WG9 A;  4UHT A;  2CW0 F;  1BOA A;  5AIP A;  1ZAO A;  4HF1 A;  2GXG A;  4KIC A;  4HOB A;  5ICF A;  2XKP A;  4EGZ A;  2L02 A;  1IXC A;  1J0R A;  4HLX A;  3R6S A;  1IF1 A;  2O61 A;  2HGC A;  1G3T A;  3BPX A;  3FF5 A;  2EV6 A;  2ACJ A;  1CGP A;  3H3Z A;  3I64 A;  3GYH X;  1QQI A;  2CO5 A;  2XAS A;  4XSZ F;  4L5I A;  4EGY A;  2DW4 A;  3GX4 X;  2XV4 S;  2KRF A;  2NS0 A;  4G7O F;  2F5D A;  4LB6 B;  3GZ6 A;  2X0L A;  4I0A A;  3DEU A;  2HZT A;  1SMT A;  1HSJ A;  5LRS A;  1XMK A;  2UXN A;  2KJB A;  2PFB A;  4DNC A;  3T8T A;  1SMY F;  4N9I A;  1UB9 A;  3RPQ A;  2COM A;  3F21 A;  3KLN A;  4PZJ A;  1QBJ A;  2PI0 A;  3DFG A;  4AVP A;  3WU0 A;  3TDU C;  4Y17 A;  3T5X A;  3J7A O;  2MH2 A;  3QRF F;  1T98 A;  2R7F A;  5J6X A;  4BXU A;  4ASN A;  1T38 A;  1SD5 A;  4MQV A;  3RKW A;  1RUO A;  3V7C A;  1TNS A;  1ZG5 A;  3DF8 A;  4GYG A;  1YYV A;  1XDU A;  4N0B A;  3I59 B;  5JI6 A;  3KEO A;  4ZZL A;  4YG2 F;  2PEX A;  1T6S A;  2IJL A;  3C18 A;  2BGC A;  4Q5S F;  1D5V A;  3ZMV A;  4EMS A;  1U5T B;  2VOO A;  2ISZ A;  4CDG A;  3SXY A;  4A6D A;  3RYR A;  1K6O A;  1W5S A;  4IRG A;  2ESH A;  4ESB A;  2JT1 A;  3NEU A;  5FLX Z;  5TJJ A;  5E20 A;  3TO7 A;  3V8K A;  3ZMU A;  3EET A;  1YW8 A;  1BM9 A;  1O57 A;  2UZK A;  4HAM A;  2UXX A;  4JQF A;  4G7Z F;  4ZZD A;  3BJO A;  1U3E M;  4NQW A;  1TBX A;  5HDK A;  4EQQ A;  1O3R A;  4I0B A;  1SFE A;  1TQM A;  3KP5 A;  2DO7 A;  4KT5 C;  3PFI A;  2XAQ A;  5FFZ A;  2EV0 A;  3E5X A;  1JHH A;  2VN2 A;  1W7P B;  3N4M A;  3V8J A;  3EYI A;  2ZJ2 A;  3MZY A;  4HZF A;  2A5Y B;  3ZN0 A;  2QBY A;  4HA8 A;  3QU3 A;  2Z3Y A;  1FC3 A;  2DK5 A;  4ON0 A;  5ED4 A;  1BBY A;  1FP1 D;  3O3K A;  3PQJ A;  3IWF A;  5CYV A;  5LGT A;  4O5V A;  3F6V A;  4JBA A;  1WKM A;  1D3Y A;  2YPR A;  2ZFW A;  1IN8 A;  2R3S A;  1HW2 A;  2Q8K A;  2HYF A;  2HWV A;  1YW7 A;  2WV0 A;  3F72 A;  5HS9 A;  2NAZ A;  2FML A;  1KYW A;  2GXB A;  3VOE A;  5BPD A;  2WWY A;  3TOA A;  4M6X A;  1PDN C;  1ON1 A;  1XSV A;  1XGO A;  2IP2 A;  3KP4 A;  2O03 A;  4I2O A;  4MTD A;  4PDK A;  4MNU A;  4G8X A;  3RPU A;  3L9F A;  1FLI A;  5FD6 A;  1W4M A;  1ZLK A;  2JZY A;  1F1Z A;  1O7L A;  4YFX F;  4CXF A;  2L4A A;  1IN4 A;  2M1B A;  5FD5 A;  2P6T A;  4A0X A;  4IHT A;  1BN5 A;  3F8F A;  3JSP A;  1WI9 A;  1KQ0 A;  4EM2 A;  3DV8 A;  1Z6R A;  2K4B A;  4PCQ A;  1WSU A;  3K9T A;  4ZYD A;  2V1U A;  3RIR A;  2TDX A;  3I4P A;  3EQL F;  2FRH A;  1YS6 A;  5HLG A;  3BWG A;  4BQA A;  3KP2 A;  1S3J A;  4RB0 A;  1I27 A;  5FFX A;  2A61 A;  4BHB A;  5BS6 A;  4NHJ A;  1P6R A;  5LEK A;  4O6J A;  3TKY A;  4OIO F;  3M7G A;  2DQL A;  4HLY A;  3Q9V A;  1G3Y A;  1CF7 B;  5HS7 A;  3LA7 A;  3R0J A;  2GA2 A;  5L3D A;  3I54 A;  4LG0 B;  4HQM A;  4OU0 A;  1FSH A;  1W7P D;  5LGN A;  2QVO A;  3E5U A;  3F8M A;  1R00 A;  1K79 A;  4L0Y B;  1YS7 A;  3ULQ B;  5H6Q A;  3F8N A;  2OU2 A;  2Z5U A;  2EFN A;  3I53 A;  2P8T A;  5LGU A;  3F8C A;  3SZP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...