5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
5CVRA 1MZBA 3K0LA 4U7BA 2OQRA 4I0BA 2YR2A 4P9UA 3I53A 4A2UA 4GO1A 4G94A 4G9YA 1EH7A 1R5GA 2HS5A 4JK1X 6PAXA 3FX3A 2XUBA 3U9GA 4MTDA 4IJAA 4KICA 1R1TA 2UWMA 3CO6C 3CLOA 5LLQA 4ZZLA 5D5XB 2FXAA 1QO0D 4M71A 5D4RA 4GXOA 1BJAA 1J0RA 4I01A 1HSTA 2L4MA 4KMUX 4A0YA 1LQ1A 1U5TA 5BOXA 5CVVA 2FOKA 2FF4A 5DCMA 5D8KB 5IT9K 1YYVA 4EJOA 5DUIA 1P92A 5KVRA 3RJPA 2DO7A 4KDPA 3I59B 1T39A 4LJZF 3HSRA 2OZ6A 3GW2A 1R58A 2FBIA 2P5VA 2FE3A 2YX4A 3GYHX 4OMZA 4YIIA 3KFWX 1ZG5A 4O6JA 4B09A 4L18B 3K2ZA 3GZ5A 3RPQA 2V9VA 2H6BA 2VXZA 2STTA 4EV0A 3FF5A 2P7VB 5BMZA 5K5QA 4KIFA 3REOA 3ABUA 2FA5A 2ZMEA 1EV7A 1SD7A 2P4WA 5HS7A 4OIPF 4EQQA 3CDHA 1R5HA 5D5VB 2HWVA 1IW7F 1ZN2A 4LGWA 2Q2EA 3RKWA 2HTSA 2RV8A 5J6XA 3LAPA 3PFIA 2EFQA 2FBHA 4Y15A 4RS8A 4XRFA 2M8EA 2R3SA 2IA2A 5HVQC 3MZYA 1XMKA 1OYWA 2QM3A 4PDKA 1FYLA 3BPVA 3KCCA 3LAJA 1XGSA 2KJBA 3L09A 1FBQA 3RDIA 2FMYA 2Z99A 4Z2YA 4CGZA 4AIHA 2IPQX 1FBSA 4I09A 1WRJA 3ECOA 5LHIA 2ACJA 1R1UA 3VOEA 2V1XA 1H0MA 2VBYA 3F8FA 3Q9SA 1YW7A 3R61A 1OPCA 2M45A 4RB2C 3QRFF 4KA4A 5E1WA 3HOTA 1IRFA 3IKTA 2OBPA 3GFIA 3V8JA 1MJAA 1XSXA 5LGTA 2MBFA 1J9IA 2FU4A 2FBKA 1W7PA 1TW2A 2IA0A 3HTUA 4RGSA 1YW8A 3TKYA 3WTSC 5DUKA 5CVIA 1PP8F 3GO5A 3DKWA 3COAC 5KK1A 1G3TA 3WTZA 1IXRC 4AVPA 1IN8A 2L54A 1PUEE 1T0FA 1FSEA 1FC3A 3WE2A 1ZH5A 1S7AA 1TW3A 4MQVA 4O5VA 2JT1A 2IVMA 2IA1A 1KU2A 3ZPLA 1K78B 1STZA 2XAGA 5IT3A 3SZTA 3WODF 3V8LA 1U8RA 4BAYA 1XN7A 5LBQA 4ENJA 2BE5F 4HLYA 1MJ9A 4CHUA 3J80K 3GWZA 2KIMA 2A61A 3FM3A 1FNNA 4WXCA 5D6EA 1B6AA 4IF4A 2A6HF 2DQLA 2DT5A 1ZLKA 2Y48A 2GXBA 2Y0MA 3BWGA 1BI3A 3HHGA 3C7JA 4M9XA 1KYZA 4OOIA 3G73A 4R8HA 1YFHA 4LLGF 2AXLA 3E5XA 2RNJA 1EH8A 2K4BA 3TDUC 4M74A 5CYVA 3G3ZA 2ISYA 2K86A 3E3VA 1D8KA 3LA3A 2J5OA 2LNBA 5JVTA 1PP7U 1R7JA 3CUOA 3O6BB 2DK5A 3GFMA 3N4MA 3WGIA 1FY7A 2F5DA 1O3TA 2H94A 5HS8A 3ABTA 2G7HA 1IRGA 1U5TC 2NS0A 5CLSA 2PI0A 1O3QA 1Z9CA 4MNUA 2K4JA 1AWCA 1CGPA 5DDGA 4HF2A 2XROA 1MJBA 2VC1A 3LFKA 2F2EA 3C1DA 1RUNA 5DV5A 2QLZA 4ZZDA 3GF2A 3KP6A 2EB7A 1K78A 3F8BA 1J75A 1BOAA 3TOAA 4WCGA 3KLOA 4G7OF 4A12A 1WQ2A 2B0LA 2WV0A 2HOEA 3BY6A 3FXRA 3GZ6A 2ESHA 2HTJA 1ZARA 2V6CA 3B02A 1REPC 3L00A 2V1UA 3HOSA 1E2XA 2K02A 3K1PA 2L3DA 1IAWA 2QQBA 3ZMZA 3WTVC 1S6LA 2Z9OA 1DPUA 4A6EA 5ILSA 5H6QA 4EM2A 4M6YA 1U2WA 2O03A 2HQNA 1Z7UA 2XIGA 5D5WB 3I5UA 4JBAA 5HDKA 4H0EA 2CWEA 3HHHA 1QGPA 2KIFA 5E17F 3LA2A 1QZYA 1KGSA 3ZMUA 4IXAA 3JSPA 2HR3A 1TBXA 3BROA 3KETA 4UUVA 3QP6A 5A2QZ 2E7WA 4XBFA 4U88A 3K1MA 3KP7A 3MAJA 5L3BA 4U0VA 2M30A 4MGRA 3ML6A 3T8RA 2H27A 2JSCA 3E97A 3WE3A 1XGNA 2L02A 1LB2A 4BHPA 3MEXA 1B1BA 5BPDA 1LVAA 1P6RA 3JW4A 3ECHA 3M8FA 4QLCU 3ZMSA 4FX4A 2R7DA 1OR7A 5E8IA 5FGMA 2NRAC 4ZYGA 5FFXA 2PJPA 4ENMA 2WC2A 3EYYA 1QQIA 4OIQF 1HSJA 4BH9A 5ILVA 1OMIA 1RIOH 3HSEA 4ZYDA 1QBJA 3N97A 1KU9A 3HRTA 1P4WA 3FMSA 2DBBA 2OQGA 1ZRCA 2HDCA 2GXGA 1CF7B 4ASNA 5F1RA 1XGMA 1C0WA 2Y75A 2IP2A 5HDGA 4CDGA 2O3FA 4L5IA 5AIPA 3LQQA 1R36A 5E18F 1TQMA 4LK1F 2ZJ2A 5CJ9A 5HLHA 1LJ9A 3I71A 4LFUA 4PGHA 5ICCA 2D2WA 1UHMA 3KP3A 5F6FA 2F5CA 4KNYA 4MTEA 4HDVA 3H3ZA 5ICGA 2QBYB 2G7UA 4WXHA 4IVNA 2JZYA 2VBXA 4AD9A 1K7AA 2ISZA 1F1ZA 2JTVA 1FSHA 1NHAA 3P7NA 4CYDA 3FXQA 2VT2A 2HQRA 1L3LA 2PMUA 3RYRA 2P8TA 3DXJF 4MHGA 1KU7A 4A5MA 3QPHA 3ZP5A 3HRUA 4G7ZF 1KA8A 2D1VA 3F21A 1IN5A 3VB2A 3SXYA 5F64A 2RGVA 3V7RA 1RZ4A 2MH9A 3OOPA 3B73A 2VBWA 4TV7A 5FLXK 1F9NA 2NNNA 2RDPA 1T2KA 3NQOA 2BBYA 1B9NA 5E20A 4UV9A 2ETHA 1H9TA 1K6OA 4M9SA 4B8XA 1I27A 1JHHA 4N9IA 1ON2A 3D0SA 4WX9A 2EFPA 3J7AO 2MA3A 2EV6A 3CO7C 4IHTA 1HW5A 2PEXA 3L7WA 3RKYA 4L0ZB 3JAMZ 2EJRA 4HYEA 1S29A 3I58A 4RB0A 2ZO4A 2QVOA 1Q1HA 3QU3A 2WWYA 3SZPA 5JHUA 2GA2A 2VT3A 3DEUA 4HF0A 3QAHA 5H6RA 4XLNF 3ZMTA 2A3SA 1BI2A 1PDNC 1LDKB 1CF7A 1BIAA 1JHFA 4HW0A 4L0YB 5BS6A 2HFHA 2Z3YA 1HW1A 1OKRA 2ZXJA 2KKOA 1KYWA 1GXQA 1MDMB 4OIRF 2DLLA 4FX0A 3HTSB 3M7GA 2GIVA 2CSOA 4FT8A 4WF2A 2FSWA 2A68F 5FD6A 2QENA 2W25A 4LG0B 5D8LB 2HYFA 1V4RA 3VODA 2EV0A 3EYIA 2YU3A 3P9IA 5L3DA 2GAUA 3P9KA 2ZFWA 1XB4A 4KT5C 4KN7X 2RQPA 2J5PA 2EFWA 4AIJA 5D6FA 1XDUA 3I4PA 1BC8C 5LRSA 3CJNA 3GFLA 3O2PE 4M9ZA 5LGUA 2QWWA 2STWA 2E7XA 5HS9A 2V79A 2CO5A 3R4KA 1UHWA 2DTRA 2MD5A 1ODDA 4EGYA 1IUYA 1IN7A 5A2QK 5ED4A 4GCVA 4RGUA 4WWCA 2COMA 2EFOA 2P5KA 1Y0UA 3CUQB 3I59A 3MZHA 2LF8A 5J8CA 1MKMA 2Q0OA 2O0YA 1AOYA 2W24A 1MD0A 1LEAA 4Y13A 4HLXA 3GFJA 1W7PD 2PBIA 2O8XA 3F8NA 1HXDA 4XLPF 5H20A 3BDDA 1VTNC 1HKQA 3U1DA 3NRVA 4HV5A 2HKXA 4HQEA 1BI1A 4GGGA 2W85A 4M72A 1G6NA 2UXXA 2XHKA 3SHFA 5FB2A 4RGRA 2EA4A 4UNOA 1IN4A 1FYMA 5L3CA 3J81K 1IZ1A 1O7FA 3MCZA 1XCVA 5DCFA 3QOPA 2VC0A 3M8EA 3WG9A 3ZMDA 4GYIA 3BZ6A 1IXSB 5JR3A 2MH2A 1QZZA 5ICFA 2GQQA 1O7LA 1HW2A 3WTTC 2IJLA 4O3MA 3ZN1A 1DPRA 1Z6TA 1SD6A 3MFKA 4UHTA 4ENKA 4ZH4F 1YTYA 1SMTA 2RC4A 1TQPA 4UVBA 4P96A 4R1HA 2Z5UA 1D3YA 2QYOA 3KE2A 2PMHA 3E6CC 2NNYA 4ESBA 2EFNA 2A69F 1L0OC 1J7KA 1BBYA 1I1SA 5FLXZ 3I0TA 3F72A 1ZG3A 2K27A 1K79A 2XAHA 3FWEA 1V3FA 2DU9A 1OYYA 1LDDA 3TGNA 1KQ8A 5K1YA 2UZKA 4RGXA 1J5YA 2DPUA 3WU1B 3DPLC 2BV6A 2OD5A 3JTHA 1Z05A 2IRFG 1FWZA 3WTXC 4PGGA 2QQAA 3FM5A 2HEOA 3GEZA 3IRQA 1TLHB 2ESNA 3ULQB 4HBLA 5L3EA 3JAMK 3IRRA 1R22A 2C6YA 3RPUA 3SFZA 3R0JA 4YFKF 4L9VA 4N0BA 4HQMA 1T38A 3HSFA 3FMRA 4RB1A 3RYPA 3HYIA 3ELKA 1JE8A 1SFXA 4OU0A 1USSA 3F8CA 4ESFA 4KN4X 2Q8KA 4ON0A 3R60A 1IXCA 1ZG1A 3RTRA 3TDZC 1ZGJA 1YQAA 4QWQA 2V1DA 3R6SA 3JSOA 1Z91A 4UV8A 2ZBKA 4OIOF 5LEKA 3F23A 2NYXA 1D8JA 3BJ6A 1GXPA 2VONA 3WU0A 2XV4S 4Q48A 2QQ9A 3V7SA 4P55A 2LSOA 1WSUA 2F5EA 4IRGA 3U2RA 2DI3A 4UXNA 4GYGA 3GVAA 3T0YA 4KMFA 1P4XA 4UVCA 2CG4A 3QP5A 4EGZA 2XKOA 5FFZA 2UXNA 1LNWA 2FMLA 1QNTA 3M9AA 2QZ8A 5D5UB 1GVJA 2LDUA 5J8FA 3C3WA 4ESJA 4U0YA 1W5TA 5HOOA 2DAOA 5ICEA 3I54A 1HQCA 5LHHA 1WI9A 3LQRA 3ISPA 1T6SA 1HBXG 4YFXF 4I0AA 4EM1A 2PG4A 1U5TB 1FPQA 4D0PA 2ADUA 1ZRFA 2EWNA 1HKTA 2XAJA 2H6CA 5K5RA 2MLGA 2JPCA 4R79A 2H09A 2LF7A 4ZYHA 2M1BA 1I5ZA 2VOPA 2VBZA 3TO6A 1G4DA 2W84A 1SD5A 3SQNA 5FD5A 4WK8F 3E5UA 5DYMA 3J81Z 1UCRA 5ILUA 3L2CA 1FYKA 2FRHA 2HGCA 3W6JB 2XRNA 3PQJA 2YX7A 2CFXA 2EV5A 2XKPA 2RKHA 4HOBA 2GZWA 5HLIA 3EETA 4MQ9F 4MEYF 3EQLF 3VEPA 2QUFA 4WXDA 5E1XA 5LEJA 5DD8A 4P9FA 1FT9A 5CVUA 2ZMEB 3S2WA 2L4AA 5HLGA 1D5VA 2P6TA 1IN6A 4LK0F 3KP2A 4RAZA 1LDJA 3IKVA 4YFNF 3GX4X 4HX8A 1S3JA 1RI7A 1FBUA 3K1NA 1UB9A 1YIOA 4A0ZA 3O3KA 4Q47A 4BQAA 2R7FA 4L9TA 4HA8A 1FX7A 1SMYF 3KLNA 2IW5A 4HDUA 2A07F 4JQFA 1DUXC 2CW0F 5AIQA 3QPTA 2VOOA 5DEQA 4RB3C 1G3SA 1TTYA 4BHBA 2VN2A 3IWFA 4I98B 3CUQC 1ZHFA 2OA4A 3TO9A 2VODA 5ERIA 2E1CA 2OU2A 2VE8A 1A04A 2P7CB 1J2XA 3JTGA 5JFRA 3WTYC 1U3EM 3PQKA 1T98A 4EJVA 1SFUA 3VFZA 4K2EA 4LMYA 4NQWA 4EVIA 2ZNYA 1TNSA 1SD4A 1YW9A 1W7PB 2W57A 1TNTA 4DQ2A 1E17A 1O57A 1GHCA 4EMSA 4E70A 3V4GA 1FLIA 4L9NA 3NEUA 3IWZA 4XSXF 5L3GA 4A5NA 1XMAA 4KIBA 1USTA 4Q5SF 1X3UA 1KQ0A 2M87A 2G9WA 1ZRDA 1WWXA 3FHZA 2BGCA 3F6OA 3ZMVA 4P5OA 4EJTA 3DQVC 3FMQA 4KUMA 4G8XA 1I6XA 3F8MA 4MEXF 3OV8A 2QBYA 3V7CA 1R00A 2XVCA 4EJUA 1R1VA 1BI0A 4IHSA 2PFBA 5FO5A 4LLNA 2D45A 5JI6A 2DFIA 3KEQA 4U0WA 4I02A 5BPIA 1XCBA 4N9HA 3TO7A 2BEOA 3T8TA 4EJWA 1FP1D 3P9CA 1ZGAA 3BOQA 1SAXA 4BXUA 2DPDA 2X4HA 4CICA 5EEHA 3IC7A 3DV8A 4NB5A 2FNPA 4YG2F 3GUDA 4CZZA 3I64A 2KIUA 2PQ8A 2XAQA 1YG2A 3F3XA 3GXOA 3K69A 4AWXB 2PLYA 1Z6RA 2IT0A 1S7OA 3R0AA 1KU3A 4G7HF 1QPMA 5LHGA 2KJCA 4Y17A 4I2OA 4ZYEA 3RIRA 2HZTA 3GLXA 4AIKA 1P2FA 1ZLJA 2HYGD 3EDPA 1W5SA 1DP7P 4HAMA 3CTAA 4U7DA 3BPXA 4IRIA 1FZPB 4LLLA 2CYYA 1ONVA 1BC7C 4BNCA 4LB6B 1MDMA 3WGHA 4LB5A 4LD5A 2XAFA 2OZUA 4UVAA 3RKXA 3HRSA 2YSRA 1F4KA 4EM0B 3HUGA 1ZREA 1ULYA 1FP2A 4NHJA 1XSVA 2FEZA 4LG0A 2HKOA 4A6DA 5TJJA 2MC3A 2DQRA 3ROUA 3WTUC 4XSZF 2A5YB 3KP5A 3TQNA 3AAFA 1RUOA 2ZKZA 2GA1A 1R23A 5BQTA 1P4AA 3TOBA 2EK5A 2K7LA 2TDXA 3W6KB 3V8KA 3Q9VA 4HF1A 2YPRA 1H9GA 2A6EF 3MWMA 3L9FA 2RN7A 4HZFA 4DNCA 1O3RA 2O6GE 4A0XA 1B59A 3CUQA 4CXFA 1U78A 3FXUA 1WKMA 4IRHA 1YLFA 1UFMA 3E6BA 1O3SA 4HX4A 1FOKA 2AS5F 5IT9Z 2NAZA 4KIGA 1EH6A 2X0LA 3IL2A 1TQIA 2XASA 1JGSA 3DPTA 5LGNA 3LWFA 2VE9A 5DD4A 1HKSA 4BYYA 2XGXA 3KP4A 1XDSA 2ZNZA 4OINF 5L3FA 5TRDA 5LRRA 1XD7A 2O61A 1ON1A 3E5QA 3WGGA 4HV6A 2F5FA 3E6DA 1BN5A 1ZYRF 3KZYA 4PZJA 2PN6A 3F6VA 4I7HA 1I1GA 4YIFA 3ZQ7A 2KRFA 1KQ9A 3LSTA 3MQ0A 1MGTA 5K5OA 4KFCA 5D4SA 4HX7A 4M73A 2CQKA 1SFEA 1G3WA 1B9MA 3DF8A 4CO8A 2OAZA 3KZZA 3FZVA 4G6DA 2EA2A 1IF1A 2JPBA 1XGOA 2JRTA 3BP8A 1F5TA 1YS6A 3T1BA 5E8GA 3ZN0A 3DP7A 4OMYA 2WTEA 5E1ZB 3BJAA 4RAYA 1Z1DA 2M5WA 3M1EA 2DW4A 1J59A 1YO5C 1U6GA 2CGPA 1G3YA 4BHCA 1W4MA 1DDNA 2RVCA 3LA7A 5HDNA 4G6QA 3D5LA 2MLKA 3E6MA 3HRMA 3H3UA 3WTWC 4IPAA 2D1HA 4ETSA 1YS7A 3KEOA 4FHTA 1OYIA 2FQ3A 2DK8A 4L9JA 1B4AA 2ELHA 1BM9A 3DFGA 3T5XA 2E1NA 4S04A 2LKPA 3HIFA 1RNLA 5DCMB 4M6XA 4Q4ZF 2ZCWA 4S05A 3C18A 3H92A 2FNAA 3IHUA 5CVJA 4F7ZA 2BYVE 3RI4A 3F22A 2GWRA 2L01A 1JXSA 3K9TA 5AONA 1S8NA 3ERED 1XSDA 3QU6A 1BIBA 4PCQA 2Z33A 4ENNA 5EEGA 4L5JA 3J80Z 2P6SA 3EUHA 1LEBA 2P5LC 3Q5FA 4KYWA 1ZAOA 3BJOA
chains in the Genus database with same CATH superfamily
5CVRA 1MZBA 2IS1A 2AXTC 3K0LA 4U7BA 2JQ7A 1H89C 1OCOH 2OQRA 1JT6A 4I0BA 3BZCA 2WAQA 2YR2A 1ETVA 3I53A 4P9UA 3G4SI 4A2UA 4BEHA 4A93J 3K4NA 4FASD 2D5VA 4GO1A 1NTCA 3PFYA 4G94A 4M6VA 4G9YA 1TT5B 1EH7A 2KHMA 1R5GA 2HS5A 4JK1X 6PAXA 3FX3A 2OTJI 4XN3A 1JUSA 2XUBA 3U9GA 1UG0A 4MTDA 2OPTA 4IJAA 3RKQA 1HDPA 4KICA 4AUXA 1R1TA 4FTHA 5B1AH 1DP3A 1YX3A 1HLVA 2UWMA 3CO6C 2HOAA 3CLOA 2DOFA 5LLQA 4J01A 4DZPA 4ZZLA 2M4KA 1I50J 5D5XB 2FXAA 2A5WA 1Q1VA 3U1KA 2XRLA 2Y0SN 4E7SA 2JA7J 4FETA 4ZDLA 1QO0D 4M71A 1R49A 2HDDA 5D4RA 3PO2J 4GXOA 1BJAA 2I8DA 1J0RA 1WJAA 4I01A 3PM1A 1HSTA 3RQIA 3EUKL 2L2OA 2L4MA 1OCTC 4KMUX 4A0YA 1LQ1A 1U5TA 3H9GA 3M07A 5BOXA 5CVVA 2FOKA 2FF4A 5DCMA 5D8KB 5IT9K 2Z2SB 2DMUA 5E3LA 1YYVA 4EJOA 1T95A 4YEJA 4XOPA 4B44A 4NBQA 5DUIA 1P92A 1FOYA 5KVRA 3RJPA 2DO7A 2K5CA 1JKQC 2BZTA 2HVSA 2OCEA 4KDPA 2LLKA 3I59B 4PJJA 3SDBA 3JRDA 4FQGA 3HGYA 1T39A 1K4TA 2M7AA 2TCTA 4LJZF 3HSRA 2W7NA 2OZ6A 3GW2A 1R58A 3BG7A 1W0TA 1MNMC 2FBIA 2HXOA 1NH3A 2P5VA 3M3YJ 2FE3A 2YX4A 3GYHX 2JWTA 3BR1A 4OMZA 1JJ6C 4YIIA 3KFWX 1SC7A 2X1CA 1E3OC 1ZG5A 2R93J 4O6JA 1SVLA 4B09A 4L18B 2DMPA 2BOLA 3K2ZA 3GZ5A 3V42A 1I3QJ 3RPQA 2V9VA 4D9JA 1GUUA 2H6BA 5EZHA 2VXZA 2E2IJ 2STTA 1JI8A 2KMUA 2E60A 4EV0A 3FF5A 2MSYA 2P7VB 5BMZA 5K5QA 5B5EC 1VQMI 4W1UA 4B3XA 1Y39A 3S15J 4KIFA 3REOA 3ABUA 2FA5A 1LPQA 2ZMEA 1EV7A 1SD7A 2P4WA 5HS7A 4OIPF 4EQQA 3CDHA 1R5HA 3G71I 4E7HA 5D5VB 2HWVA 3K4BA 1B72A 5FKLA 1IW7F 3OYJA 1ZN2A 2V7FA 4LGWA 5LFAA 4PJMA 2Q2EA 3RKWA 1LFPA 2HTSA 2RV8A 5J6XA 3LAPA 1PUFA 1X1BA 2HYJA 3PFIA 2EFQA 3K10A 2FBHA 2W82A 1VQ9I 4Y15A 2YS9A 3A03A 4XRMA 1BR1A 4RS8A 4XRFA 2M8EA 4A3KJ 2R3SA 3GZNB 2M4GA 2IA2A 5HVQC 3MZYA 3W2VA 1XMKA 1P7IA 1OYWA 2QM3A 2AHQA 4AVZA 4PDKA 1FYLA 3JREA 3BPVA 2L9VA 4IZZA 3KCCA 3LAJA 1XGSA 2R7QA 2KJBA 2LVSA 3L09A 1FBQA 1ETWA 3RDIA 2FMYA 2LYCA 2Z99A 4PSXA 4Z2YA 4CGZA 4XLCA 4AIHA 4OWRB 2MW8A 4NC6A 4FE7A 2IPQX 3BZKA 3G6EI 1FBSA 1DGRM 2HXIA 4I09A 4XMYA 3MMYB 2O7OA 1WRJA 3ECOA 3CP2A 5LHIA 2ACJA 2OTLI 1R1UA 3VOEA 2DFFA 2V1XA 1H0MA 2VBYA 3HOUJ 1WZ2A 3F8FA 3Q9SA 1YW7A 3R61A 1OPCA 2M45A 4RMNA 4ZYAA 1OCCH 5IP9J 4RB2C 3QRFF 1AA7A 4X1EA 5CQEA 2VXDA 4KA4A 2X6WA 5E1WA 3HOTA 1IRFA 1MBKA 5BNGA 4NDLA 3A01A 3IKTA 3GTGJ 2VPRA 2M0MA 2OBPA 4DGWB 3GFIA 2R7VA 3V8JA 1MJAA 3OS0A 1XSXA 1VQNI 3OYBA 5LGTA 1V54H 2CH0A 1FTTA 2FUG2 2MBFA 3DBHB 1D5YA 2FU4A 2FBKA 1J9IA 1W7PA 1TW2A 2IA0A 4XLEA 3HTUA 4RGSA 1X1AA 1YW8A 4X0GA 3TKYA 3WTSC 5DUKA 5CVIA 1PP8F 2E5ZA 1GT0C 3GO5A 3DKWA 2CQ7A 3COAC 2ELKA 2XGDA 5KK1A 1TWCJ 2R7RA 1WPKA 3FHNA 2R5ZB 1G3TA 3D5RC 3DLAA 3WTZA 2M0CA 2KL4A 1IXRC 3IH4A 3TBIA 4AVPA 1IN8A 2L54A 4QTRA 1AKHB 1T0FA 1PUEE 1FSEA 1M1EB 1FC3A 2HDWA 2M2EA 3WE2A 1ZH5A 2DFEA 1S7AA 1TW3A 4MQVA 4C3JJ 4O5VA 4BGDA 5HNFA 2JT1A 2IVMA 4HSRA 1WI3A 3CCJI 2DOAA 2IA1A 3C2GA 1KU2A 3ZPLA 2KIQA 1DQUA 4JX6A 1STZA 1K78B 4F91B 2XAGA 5IT3A 3SZTA 1K61A 2Y2ZA 1VQ6I 2IGMA 5M3FJ 4V19K 3WODF 2E71A 3V8LA 1U8RA 4BAYA 3CCQI 1XN7A 5LBQA 2IBDA 2IGKA 4ENJA 1VQOI 1SANA 2BE5F 4KJZA 2W48A 4HLYA 2VL8A 4H4KC 1MJ9A 4CHUA 4XKWA 3J80K 4XRSA 3F9KA 1E3HA 3GWZA 2KIMA 2WY7Q 1GVDA 3S93A 2CV2A 3CCLI 2A61A 3SFIA 2VKEA 3EUHC 1IV8A 3FM3A 3A2KA 1FNNA 4WXCA 3L2QA 5D6EA 1YE9A 1Z21A 1B6AA 2KLOA 4IF4A 2A6HF 1YRNB 3K4KA 2HOTA 2DQLA 5C3EJ 3ZQCA 5F04A 2DT5A 1ZLKA 2Y48A 2GXBA 1T33A 2CW7A 3H36A 1W5CC 2Y0MA 3BWGA 5DM6F 1BI3A 3HHGA 1X19A 3C7JA 2KRCA 4M9XA 4MO7A 1IG7A 4A3EJ 1KYZA 4OOIA 3G73A 2L5QA 1W1WE 2Y31A 2NVUB 5E3OA 3BR2A 3FKJA 4R8HA 4DZJA 2QEXI 1NG6A 1Z0XA 2KP6A 4LLGF 1YFHA 2AXLA 1TWGJ 5GAEJ 3OR2C 3E5XA 2RNJA 1EH8A 2K4BA 3F0CA 3TDUC 4M74A 5CYVA 2CQNA 3G3ZA 2ISYA 2K86A 3W6VA 3E3VA 1D8KA 3LA3A 2J5OA 2LNBA 4HPQA 5JVTA 4I76A 2QA4I 1NK2P 1UAAA 4CCMA 2BXYA 1PP7U 2HPIA 2DYSH 1R7JA 1T56A 3CUOA 2BHZA 3QOEA 5DS9A 1ENHA 3O6BB 2DK5A 3GFMA 3N4MA 4D5CA 3WGIA 1FY7A 1TC3C 1WFXA 2F5DA 4BBRJ 4DW6A 1E3PA 1O3TA 2H94A 4DIQA 5HS8A 1YITI 3ABTA 2E35A 4M3GA 1P9QC 2G7HA 2H1KA 2VUMJ 1IRGA 2BW3A 3DTIA 1U5TC 3KYLA 2NS0A 5CLSA 2L9RA 2PI0A 1U9NA 1FMVA 1O3QA 1XG1A 1Z9CA 1XPXA 1CQTA 4MNUA 5FLVA 2K4JA 1AWCA 1CGPA 3GCMA 4B3AA 2MYSA 2OJED 5DDGA 3JRIA 4HF2A 2XSJC 1RKTA 3I4NJ 1RPWA 2XROA 3IV5A 1WH5A 1MJBA 2VC1A 3LFKA 2F2EA 3VSLA 3C1DA 3LSHA 5DM7F 4E7IA 1RUNA 4IQJA 5DV5A 2QLZA 1QHGA 4ZZDA 3GF2A 4E4HA 3G1LA 3KP6A 2EB7A 3OIQA 1K78A 2XPUA 3F8BA 4DJAA 2L0KA 1J75A 1BOAA 3RCOA 3TOAA 4WCGA 2NS8A 3KLOA 3OYGA 4A12A 1ZR4A 1WQ2A 4B43A 4G7OF 1MBGA 2B0LA 2WV0A 3E1SA 4M3BA 2H8RA 2HOEA 3BY6A 3FXRA 3GZ6A 1XMXA 3M4OJ 2ESHA 2HTJA 1ZARA 2JA5J 1UZCA 2V6CA 3ABKH 2QKLB 3OL4A 3B02A 1REPC 3L00A 2V1UA 3HOSA 3CC7I 1E2XA 2K02A 3K1PA 5EF6A 2WBMA 2X1DA 4BL0B 4V2FA 3Q3SA 2L3DA 4BQQA 9ANTA 1IAWA 4BXFA 2QQBA 1S9HA 4OAYA 3ZMZA 2M8GX 3PNVA 5M5XJ 2V9KA 2MC4A 3WTVC 2EBIA 2ZMEC 2VI6A 1S6LA 2Z9OA 1X1DA 2DDAA 1E0EA 1DPUA 2ZFUA 3I3LA 5ILSA 4A6EA 1MMAA 3OYIA 3HL2A 2ID3A 2M34A 4I99C 2K3FA 4P1WA 1ETXA 2LY9A 5H6QA 1QVUA 3CLQA 4IEJA 4EM2A 4M6YA 1MSEC 4IQ4A 2VJ5A 1U2WA 4II3A 2Y9ZA 2NVTJ 3CMEI 2VKDA 1IGNA 1FMWA 4AC0A 2O03A 2HQNA 2Y0SA 3RQ4A 1Z7UA 2XGEA 1G8XA 2XIGA 5D5WB 3I5UA 5F1JA 5K7FA 3D5SC 1MBHA 3OYLA 3JRAA 4JBAA 5HDKA 1D0XA 4H0EA 3EPZA 2CWEA 2VJJA 3HHHA 1VQLI 3JR9A 2QKMB 3QPLA 2GLOA 1QGPA 4BE1A 2KIFA 5E17F 3CJRB 2VKHA 3LA2A 3CMYA 3RZDJ 1QZYA 1KGSA 3ZMUA 1SFOJ 4IXAA 1DU0A 3VPRA 2HR3A 3JSPA 1TBXA 3BROA 3SEZA 3KETA 4A3LJ 4UUVA 3QP6A 5A2QZ 5KAFC 4ZDOA 1MH3A 2E7WA 3FBIB 4XBFA 1FEXA 5J4YA 3S32A 4U88A 1ETQA 3K1MA 3KP7A 3MAJA 5GPCA 5L3BA 2O9LA 4U0VA 2M30A 4MGRA 1VQ8I 1SEUA 3ML6A 2WADA 3HOXJ 2X85A 3OS2A 1WJDA 3T8RA 2H27A 2JSCA 2JVHA 3E97A 3WE3A 5HNHA 1XGNA 1T08B 2L02A 1D0YA 2GM4A 2KZVA 1LB2A 4BHPA 3MEXA 3HC7A 4CA0A 3S1RJ 1B1BA 1YI2I 5BPDA 2YU9J 1LVAA 1P6RA 2BVLA 4AIDA 1JJ8C 3JW4A 3ECHA 3M8FA 4QLCU 3ZMSA 2HU9A 1Z77A 4XIDA 2LD5A 4FX4A 2CV1A 3HEFA 2ID6A 2R7DA 4EEFG 2PJRB 4CCLA 1OR7A 5E8IA 1GV2A 5EEAA 5FGMA 2NRAC 4ZYGA 3VYUB 5FFXA 4PJLA 2PJPA 3CF2A 4ENMA 2WC2A 2UV1A 3EYYA 1QQIA 3C2BA 4OIQF 1IDZA 1HSJA 4BH9A 5ILVA 4NQWB 1OMIA 1RIOH 3HSEA 4ZYDA 3MKZA 1QBJA 2P0WA 1TZLA 1VF9A 3N97A 1KU9A 3HRTA 3CMAI 2COBA 1P4WA 3MKYB 3FMSA 2DBBA 1D0ZA 5M5WJ 4DYRA 2OQGA 4FCYA 1ZRCA 4E7JA 1R4MB 1T0FC 4C2UA 4CYCB 2HDCA 3Q0WA 4NNJA 2GXGA 2LY2A 4GFBA 2KDZA 1AU7A 1WJFA 1CF7B 4ASNA 2R5YB 5F1RA 2BY1A 2VLAA 3DEEA 1XGMA 4XNFA 1YJWI 1C0WA 2QBYB 2Y75A 2IP2A 4XLFA 5HDGA 4KISA 4CDGA 2O3FA 4L5IA 5AIPA 3I55I 3LQQA 1R36A 1X1PA 2HQAA 4CCJA 1MBEA 5E18F 4EATA 1TQMA 4LK1F 2ZJ2A 4UB6C 5CJ9A 4A3MJ 5HLHA 1LJ9A 3I71A 2FOWA 2KRHA 2NOGA 3OMYA 3PNYA 4LFUA 4PGHA 1ZGWA 2R7TA 3BQYA 2XGCA 4XRSG 5ICCA 3W2AA 2D2WA 1UHMA 3KP3A 5F6FA 2CU7A 4DOZA 4MIMA 2F5CA 2HI3A 4KNYA 3L1PA 2W1OA 4MTEA 4HDVA 1SFKA 3H3ZA 2QQ8A 1X1CA 4V2GA 5ICGA 3SDGA 3PIOF 2G7UA 2HNHA 2EZKA 4IVNA 2JZYA 2VBXA 4WXHA 4AD9A 4BU2A 1F1ZA 1K7AA 2ISZA 2VQCA 3NWTA 2JTVA 1MNEA 3H9QA 1FSHA 3BR5A 1NHAA 1VZ0A 4XKCA 2DOEA 3P7NA 4CYDA 3FXQA 2VT2A 5J47A 1A6IA 2HQRA 1FOWA 2PMUA 1L3LA 2NVXJ 3RYRA 2P8TA 1TWAJ 1IO2A 3DXJF 4G12A 5EYRA 4FISA 5FRNA 4MHGA 3GTJJ 3FXJA 4A5MA 2BHYA 3KZIC 1KU7A 3BG5A 2W4SA 3K4MA 4F52A 2LG4A 3QPHA 4AYBN 3ZP5A 3HRUA 2WA0A 4C3IJ 2HPMA 4UB8C 4BS9A 4G7ZF 1UELB 4XKBA 1KA8A 2D1VA 2F4OB 3BR6A 3F21A 1IN5A 3VB2A 3SXYA 5F64A 2RGVA 2MABA 1D1CA 4ZTJA 3V7RA 1QRYA 1RZ4A 1Y0NA 2MH9A 3B73A 3OOPA 2VBWA 3HG9A 3CCVI 4TV7A 5FLXK 2O8KA 1F9NA 2NNNA 2RDPA 1D1BA 1Y56A 3OYCA 1T2KA 3NQOA 1B9NA 2BBYA 5E20A 4JOMA 4UV9A 2ETHA 4F55A 1H9TA 1K6OA 2BXZA 4M9SA 2IAIA 4B8XA 1I27A 1JHHA 4N9IA 3W2WA 3G1OA 1ON2A 3D0SA 1XC5A 3ABLH 3SEQA 4WX9A 2EFPA 3J7AO 1ZQ3P 3GTLJ 2MA3A 2EV6A 3CO7C 5B1BH 3S17J 3OS1A 3W3CA 1QZEA 3IH3A 4IHTA 3LSPA 5FKKA 4HRIA 1HW5A 3I9V2 1S5LC 1X3WB 2PEXA 3L7WA 3RKYA 2CS3A 3LNQA 4L0ZB 3JAMZ 2EJRA 4HYEA 4RLQA 1S29A 3I58A 4RB0A 3QYFA 2ZO4A 2QVOA 1TWHJ 1Q1HA 4A3DJ 4XK4A 5HLTA 3QU3A 3SZPA 5JHUA 2WWYA 2GA2A 2VT3A 3DEUA 4HF0A 3QAHA 5H6RA 4XLNF 4J19A 3ZMTA 4I6ZA 2A3SA 2LY1A 1BI2A 3GTOJ 1PDNC 3DU6A 1LDKB 1WVRA 2CQXA 3OYDA 1BIAA 1JHFA 2R5YA 1CF7A 1JTYA 4HW0A 4L0YB 5BS6A 2HFHA 2Z3YA 1HW1A 1OKRA 2L7MP 3H3VK 2ZXJA 2KKOA 1KYWA 2ZXIA 1AHDP 1JUPA 1GXQA 1MDMB 4OIRF 2K9LA 1PYVA 2DLLA 3HKZA 3LMMA 2OF7A 3K4LA 4FX0A 3HTSB 3M7GA 2GIVA 3FISA 2CSOA 3UR3C 4IHVA 1JKRC 3NWSA 4FT8A 4WF2A 4X6AJ 1WJBA 3AKZA 2FSWA 5B66C 2A68F 5FD6A 1POGA 1MNDA 5EZGA 4BXXJ 3KEYA 1Z3XA 2QENA 2W25A 1ETKA 2FJ1A 2NVYJ 4LG0B 5D8LB 2HYFA 2QSHX 1V4RA 3VODA 1YJNI 2EV0A 1G59A 3EYIA 2YU3A 3S14J 2HOSA 2JJ7A 3P9IA 2IS4A 1ORKA 4E7ZA 2R7WA 2XDVA 4NC7A 5L3DA 3U21A 3BG9A 3RZOJ 4PJNA 2CRGA 3CQZJ 2GAUA 3P9KA 2ZFWA 1XB4A 2VQLA 3KIOA 4KT5C 4KN7X 2RQPA 5FJ8J 1JKOC 3PNTA 3CF5F 3H35A 2J5PA 2EFWA 4AIJA 5D6FA 1VQPI 1JGGA 1XDUA 3I4PA 2DA3A 1BC8C 4UUSB 1RRJA 3HJEA 4BJTA 5LRSA 1P7JA 5EGOB 2EZHA 5DTDA 2DTZA 3CJNA 3GFLA 5JVGF 3O2PE 4M9ZA 5LGUA 1K6YA 5EG0B 1TWFJ 1PVEA 4BE2A 1X4PA 1LVKA 2QWWA 2STWA 1RC9A 2E7XA 3ZQHA 2ZJQF 5HS9A 2V79A 2CO5A 2DA5A 2DYRH 3R4KA 1UHWA 2X6XA 4LIVA 2DTRA 2MD5A 3L2UA 3ZQLA 1FTZA 1ODDA 4EGYA 4G6TB 1IUYA 1NG7A 3J7AY 1IN7A 1IV6A 5A2QK 5ED4A 4GCVA 4HEA2 4RGUA 3BR0A 4PJ0C 4WWCA 1MMDA 2COMA 2EFOA 2P5KA 1QU3A 1Y0UA 3CUQB 2YUSA 2A05A 3I59A 3MZHA 2LF8A 3G2BA 1JTXA 5J8CA 1MKMA 3CESA 1JUMA 3UKGA 2UUZA 4A69C 3S1QJ 2H1LA 4L5EA 4A3FJ 2Q0OA 2O0YA 1AOYA 1R5ID 2W24A 4BKXA 1LKXA 1MD0A 1LEAA 4Y13A 4HLXA 3GFJA 1YX5A 1OCZH 1W7PD 2PBIA 3KPHA 2V9PA 2AO9A 1Y8QB 2O8XA 1RR8C 3F8NA 1Y1WJ 1HXDA 3SYTA 2RREA 4XLPF 4RLFA 5H20A 3BDDA 1VTNC 1WJCA 4JX4A 1HKQA 2L7KA 3U1DA 2E1OA 3K70C 4BY7J 3NRVA 4HV5A 2HKXA 1OR7C 5J1RA 2PMZA 1MBFA 4HQEA 4XL9A 2LK2A 1UMQA 1Z7LA 1BI1A 2GOXB 1R71A 4GGGA 2DT7B 2RAEA 2W85A 1G6NA 3FIWA 4M72A 3OY9A 1YJ9I 2UXXA 2XHKA 4PK4A 3SHFA 5FB2A 2MD0A 4RGRA 2IS2A 2E1MB 1BW5A 2EA4A 1VFCA 3E7LA 4UNOA 2NVQJ 4E7LA 3HOVJ 4A3CJ 2ZSIB 1Y6IA 4QIWN 3N05A 4XLHA 1IN4A 1W0UA 4XOTA 1FYMA 3OWTA 1HC8A 3ZOBA 5L3CA 3J81K 1IZ1A 1O7FA 2E5NA 5GPAA 3MCZA 2XPVA 5F0HA 1XCVA 1SVOA 5F27A 4NUBA 2R7OA 3ASNH 5DCFA 3QOPA 1H88C 2VC0A 3JRHA 3M8EA 3WG9A 1ZR2A 4IHYA 2XAUA 3H0GJ 4GYIA 3ZMDA 4XICA 1ACIA 4CSWA 3WU2C 3BC8A 3BZ6A 1IXSB 3AG3H 1G2HA 3G1MA 5JR3A 4LITA 2MH2A 5JLXA 3OYHA 1QZZA 5ICFA 4ZDPA 2GQQA 4D7MA 2LKSA 2EIJH 3PSFA 1O7LA 1HW2A 3WTTC 1Z3YA 2IJLA 3QQAA 5C4XJ 4O3MA 3ZN1A 1DPRA 1Z6TA 1SD6A 3L2WA 2ZC2A 3MFKA 4UHTA 4ENKA 4ZH4F 1YTYA 1SMTA 2RC4A 1TQPA 5EG0A 1DGWY 3OIPA 2WAFA 4UVBA 4P96A 4R1HA 2Z5UA 1D3YA 2QYOA 3CCMI 3KE2A 2PMHA 3E6CC 2NNYA 4ESBA 2EPFA 1IC8A 1BR2A 2EFNA 4MFDA 2GXAA 2A69F 1L0OC 1J7KA 1BBYA 2L7ZA 4IKFA 2L9NA 1I1SA 5FLXZ 3OSFA 3I0TA 3BTJA 3F72A 3Q0UA 3DU5A 3ZQIA 1ZG3A 2K27A 3OOUA 4BQNA 4C9YA 5KNLA 2XAHA 1K79A 3AG4H 5K7ZA 3KX2A 3JCUC 2AQFA 3FWEA 1V3FA 2DU9A 3HDDA 1OYYA 1YOVB 1LDDA 3TGNA 3CCRI 3VDXA 1KQ8A 5K1YA 2UZKA 2Y69H 4RGXA 4ITVA 2K40A 1J5YA 4IOCF 2DPUA 3OYFA 3WU1B 1U9OA 3DPLC 2WB1N 2JMWA 2R5ZA 2BV6A 2OD5A 3JTHA 5FKOA 1Z05A 2A6TA 3CMMA 2IRFG 1AKHA 1FWZA 3DKYA 3WTXC 5HODA 4PGGA 1BL0A 3NARA 2QQAA 3FM5A 4HNVA 2HEOA 3OYAA 3GEZA 3IRQA 2L7FP 4NC8A 2OC6A 1TLHB 2ESNA 3GBGA 2NXNB 3ULQB 4HBLA 1U0JA 1W36C 5L3EA 3JAMK 1RESA 3IRRA 1R22A 3A02A 2C6YA 3IAS2 3RPUA 1J09A 3SFZA 5J3LA 2DDBA 4MFEA 3R0JA 4YFKF 4L9VA 4N0BA 4HQMA 1T38A 3HSFA 3FMRA 2DMQA 4RB1A 2HZDA 3RYPA 3HYIA 3BG6A 3ELKA 1JE8A 1SFXA 4OU0A 1USSA 3F8CA 4ESFA 4RAGA 4KN4X 2Q8KA 4ON0A 4CCNA 3R60A 2CUFA 2ME6A 3LSKA 4F92B 1V5EA 1ZKGA 4XLAA 1IXCA 3MZ8A 3K6GA 2EIMH 4Y7NJ 1ZG1A 2X6OA 2Y30A 3RTRA 3TDZC 1ZGJA 3I4MJ 1YQAA 4QWQA 3CCYA 2DODA 2F4IA 4B47A 1YRNA 2V1DA 3R6SA 3JSOA 1ITYA 3AL0B 1Z91A 1LFBA 1MH4A 2L9SA 3KYDB 3DPUA 3S16J 1N77A 3BTCA 4UV8A 2LREA 2ZBKA 4OIOF 5LEKA 1ETOA 2OUMA 3F23A 3PSIA 2NYXA 1D8JA 3BJ6A 4RA2A 1GXPA 2VONA 3WU0A 2X6YA 2XV4S 3A1YA 4Q48A 2QQ9A 3V7SA 4P55A 3CZ6A 4F93B 4ZTFA 2KISA 2LSOA 4IX7A 4AYBA 1WSUA 4E6KG 2F5EA 2VB6A 3S1MJ 4RM3A 4IRGA 2LKXA 3U2RA 2Z1DA 2XB5A 3M1CA 5IOYA 3S2HJ 5IP6A 2LOOA 1XX5A 2F48A 4BEHB 3CJQB 2DI3A 4PSWA 1QA6A 3BG3A 3LSJA 4UXNA 4GYGA 2X48A 3X2QH 3S3MA 3DTEA 3GVAA 2FD5A 2ICWG 3T0YA 4KMFA 4BY1J 1P4XA 2EZLA 4UVCA 2CG4A 3HM5A 4GRIA 3QP5A 2QF7A 4EGZA 2XKOA 5FFZA 2UXNA 1LNWA 2FMLA 5C44J 1QNTA 3M9AA 4DYCA 2QZ8A 4KT6A 5D5UB 1GVJA 2LDUA 3M8JA 3J7YJ 3O8GA 2HVRA 5J8FA 1I39A 3C3WA 4LOCA 3QYEA 3L2VA 2FX0A 3IAM2 4ESJA 4U0YA 4ANJA 1W5TA 1KZHA 5HOOA 2DAOA 1X2MA 2LTPA 4BDYA 5ICEA 4RDUA 3I54A 1HQCA 5LHHA 1Y1VJ 3MD2A 1DU6A 1UG2A 2BY0A 3BT9A 2KZGA 3LSRA 2X9DA 1WI9A 3LQRA 4C3HJ 5GAHJ 3ISPA 1T6SA 1HBXG 3MN2A 4Y3OA 4YFXF 5H2FC 4I0AA 4EM1A 2PG4A 3DLLF 2DN0A 2KQRA 1U5TB 1OCPA 1FPQA 4D0PA 1LFUP 3CCSI 3DBRB 2ADUA 1ZRFA 3PUBA 2EWNA 1HKTA 2XAJA 2H6CA 5K5RA 2MLGA 2B63J 2JPCA 1FJLA 2JUGA 2XF6A 1VQ4I 4R79A 2H09A 2K3PA 2WAEA 2LF7A 4ZYHA 4A3JJ 2DA7A 5IYCJ 1OLTA 2M1BA 2M9HA 3PUFA 1I5ZA 2VOPA 1R9TJ 2VBZA 1MIJA 3TO6A 2GOMA 1G4DA 2W84A 1SD5A 5GADJ 5IOZA 3SQNA 2R7SA 5FD5A 1MSFC 1OFCX 4RBOA 4D5FA 3MVPA 4PFOA 4WK8F 3E5UA 1A35A 3OR1C 3WHCA 5DYMA 1X4OA 3J81Z 1TL8A 1UCRA 4BJ6C 5ILUA 3I56I 2LH9A 3L2CA 1FYKA 2FRHA 1TT0A 2HGCA 3W6JB 5FRMA 2XRNA 1O4XA 1IJWC 3ASOH 3PQJA 2YX7A 3A0BC 2CFXA 2EV5A 1FIAA 2W00A 4IHWA 2XKPA 2RKHA 4HOBA 3S3OA 2GZWA 5HLIA 3EETA 4MQ9F 4MEYF 2OV7A 3EQLF 3ONQA 3VEPA 2QUFA 3BTLA 4WXDA 5E1XA 4RM2A 4C2TA 5LEJA 3S2DJ 5DD8A 3K4CA 4P9FA 1FT9A 5CVUA 2XSDC 2ZMEB 3S2WA 2L4AA 5J4VA 1B72B 3LSIA 5HLGA 1D5VA 2P6TA 1IN6A 1WGXA 4LK0F 2VJIA 3KP2A 5JLWA 4RAZA 2K9NA 2Q2EB 1LDJA 2ZB9A 3IKVA 4YFNF 3KYCB 2VASA 3GX4X 4HX8A 1S3JA 1RI7A 1PUFB 1FBUA 3K1NA 1X58A 2DJNA 1UB9A 3RSNA 3ZQFA 3OYKA 1YIOA 4A0ZA 5IY5H 2IGOA 1MMSA 4A3BJ 2B9SA 1APLC 1UJ8A 4Z6YA 5EDNA 3O3KA 4Q47A 4BQAA 2LR8A 2R7FA 4L9TA 2QSGX 1I6HJ 4HA8A 4CCKA 1FX7A 1SMYF 3KLNA 2IW5A 4HDUA 2A07F 4JQFA 3J7ZI 1D1AA 1DUXC 2CW0F 2EIKH 2MFZA 2G0EA 3BR3A 4D7NA 3TW7A 1F43A 5AIQA 2JK3A 2HQ5A 3QPTA 1N25A 2VOOA 1V5GA 5DEQA 4RB3C 1G3SA 1TTYA 3HOYJ 4BHBA 1I3AA 1RKWA 2VN2A 1N78A 3IWFA 4I98B 1OQYA 3CUQC 5LD2C 2RQQA 2GIZA 3UNGC 1ZHFA 2OA4A 3TO9A 2VODA 1Z67A 1U8BA 4Y4RA 5ERIA 2PJRA 2E1CA 1ZELA 2LBFB 2OU2A 2VE8A 1A04A 2MGQA 2P7CB 1S7EA 4U87A 1J2XA 2BY2A 3JTGA 1LUJB 1HOMA 4B48A 5JFRA 3WTYC 5K7HA 1U3EM 3FBNB 3PQKA 1A5JA 1T98A 1OISA 4EJVA 1SFUA 4CH7A 4BBSJ 1LE8B 3BLYA 3VFZA 3A01B 4K2EA 1KONA 3IH2A 3ABMH 4LMYA 4NQWA 2ZJPF 4EVIA 2ZNYA 3A4CA 1TNSA 3A0HC 1SD4A 4B1RA 1YW9A 1W7PB 2W57A 2E19A 1TNTA 1W36D 2V6EA 2BY3A 4CYCA 1R6RA 4DQ2A 3B6AA 2H8WA 1E17A 1O57A 2KT0A 4CCOA 1H8AC 1GHCA 4EMSA 4E70A 3V4GA 1FLIA 4L9NA 2F4MB 3NEUA 1Y8RB 5IP7J 3IWZA 4XSXF 2TRTA 5L3GA 4XQFA 4N4OB 4A5NA 1XMAA 4KIBA 3IUOA 4M3EA 1USTA 3SZGA 4Q5SF 4QSHA 2E1MC 1X3UA 1KQ0A 2M87A 4F3QA 2G9WA 1ZRDA 3TEDA 1PJRA 1WWXA 4OAZA 1EA3A 3FHZA 2BGCA 3F6OA 3HUGB 3ZMVA 4P5OA 1EJ9A 3AG2H 4EJTA 3IP4B 2DA2A 3DQVC 4UY8I 3Q0VA 2E2HJ 3FMQA 4KUMA 2XB0X 4G8XA 1I6XA 3F8MA 4MEXF 3OV8A 4J00A 3P5JA 3ZXSA 2QBYA 2DFHA 2V4JC 3V7CA 1R00A 2XVCA 4EJUA 1R1VA 1BI0A 3DEWA 4IHSA 2CUJA 1VQ7I 2N8GA 2PFBA 2OCCH 5FO5A 2WV1A 4M3FA 4LLNA 2D45A 3FDYA 5JI6A 2DFIA 3DWLE 3KEQA 4U0WA 2P81A 4PFPA 4I02A 5BPIA 1XCBA 3H9JA 2CUZA 4N9HA 3TO7A 2XC7A 3GTPJ 2BEOA 4HSTA 3T8TA 4EJWA 1FP1D 3S8PA 2ZXHA 3P9CA 1B8IB 1ZGAA 3BOQA 3GTKJ 1SAXA 4BXUA 5GTIC 2WAQN 2DPDA 2EQRA 2R7XA 2ZSHB 2X4HA 4CICA 3D1NI 5EEHA 2QSFX 3DV8A 3IC7A 4XONA 4NB5A 4DYQA 2FNPA 4YG2F 3HPGA 3K2AA 5CKTA 3CDIA 3GUDA 4W97A 4CZZA 3HPHA 4C30A 3I64A 3ESWB 2XPWA 1YHQI 2JRMA 2KIUA 2JA2A 2WB1A 4BE0A 5GTHC 1A6QA 2LC2A 2PQ8A 2XAQA 1YG2A 3F3XA 3GXOA 3K69A 3HXLA 3LOCA 2CJJA 2LBFA 2LMDA 4AWXB 5E3NA 2PLYA 1Z6RA 4AU7A 3QYBA 2IT0A 2EILH 1EF4A 5FKMA 4IHXA 1S7OA 1LE8A 3CCUI 3R0AA 2I5UA 1KU3A 3JRFA 4MLOA 4BUPA 4G7HF 5TISC 4CUGA 1QPMA 5LHGA 2KJCA 4Y17A 2X51A 1A36A 4I2OA 4ZYEA 3RIRA 3ZGKA 2HZTA 3GLXA 5B3SH 4AIKA 3GMEA 2NS7A 2IGNA 2DXIA 1P2FA 1ZLJA 2BW3B 2HYGD 3EDPA 1W5SA 1DP7P 4HAMA 3CTAA 4U7DA 3BPXA 3ERMA 1OCRH 4IRIA 1FZPB 4LLLA 1IUFA 5M5YJ 2CYYA 3H5AA 1ONVA 4II2A 2DA6A 1BC7C 4BNCA 3GTMJ 3TMOA 4LB6B 1MW7A 4A3IJ 5GAGJ 1MDMA 5E3MA 3CC2I 3WGHA 4B4CA 4LB5A 4LD5A 1HA8A 3L2RA 2XAFA 2OZUA 4UVAA 2XF7A 3RKXA 3HRSA 2YSRA 2M3AA 1F4KA 4EM0B 3HUGA 1ZREA 1ULYA 2DA1A 2E36A 1XTAA 2Z16A 4BQOA 4IOAF 1FP2A 1WJEA 4NHJA 3PJRA 1XSVA 2FEZA 4LG0A 2HKOA 4A6DA 5TJJA 2R7ZJ 2QGUA 4ABZA 2MC3A 2DQRA 2DT6A 2R0QC 3ROUA 4A3GJ 2GBYA 1WJ5A 3WTUC 4XSZF 2A5YB 3AL0C 3KP5A 3TQNA 4XR6A 2I10A 2FQ4A 3AAFA 1RUOA 4D1QA 3CCEI 2VIXA 2ZKZA 2GA1A 1HDDC 3MKWB 1R23A 5BQTA 2JA8J 3ZCOA 2QCOA 4XORA 2E2JJ 2DMTA 3PIPF 4LIUA 1P4AA 2EH3A 4UUSA 3TOBA 3HB9A 2EK5A 2K7LA 2TDXA 5KAIC 3H5RA 5EGOA 2EZIA 4UUTA 3HKZN 1B8IA 3W6KB 1TP4A 3TL4X 4DBQA 3WG7H 3V8KA 3Q9VA 4HF1A 3HGGA 5J40A 5F0FA 1ZTRA 3HOZJ 2YPRA 1H9GA 2A6EF 3MWMA 3L9FA 2RN7A 4HZFA 1WH7A 4DNCA 4PUSA 1X3ZB 4LG3A 1O3RA 1SAUA 2O6GE 4A0XA 1QHHD 2B7EA 1B59A 3CUQA 5TGTA 4CXFA 3O8HA 1XS9A 1U78A 3HZJA 3H0DA 3GTQJ 3FXUA 5CQGA 1WKMA 4IRHA 3AFHA 1YLFA 5E79C 1UFMA 1T8IA 3E6BA 1IRXA 1O3SA 4HX4A 3BCAA 3EUAA 1VNDA 3K7AJ 1FOKA 2AS5F 1V55H 2JA6J 2CW8A 2Y9YA 1YIJI 5IT9Z 2JVGA 2NAZA 4KIGA 4GDFA 2F6CA 3BTIA 3PO3J 1EH6A 2X0LA 3K4JA 2F5VA 1A31A 3IL2A 5M3MJ 1TQIA 2CV0A 4BDZA 1BW6A 2DA4A 2XASA 2MG4A 5CPRB 1JGSA 4RAFA 1GV5A 3DPTA 5F08A 5LGNA 3LWFA 2NOJB 3DKXA 2VE9A 4BJ5C 4HNUA 5DD4A 1HKSA 3DTKA 1ZK8A 4BYYA 2EINH 2BVMA 2XGXA 3KP4A 2E34A 2ZNZA 1XDSA 2VJ4A 4OINF 3OYEA 1MBJA 3OIOA 2KDOA 3ZR8X 5L3FA 5TRDA 5LRRA 3HBLA 2LP0A 1BOBA 2R4GA 2M7BA 4FE4A 1XD7A 2O61A 3OSGA 1ON1A 3E5QA 1FOXA 2VQGA 3WGGA 1HCRA 4JX5A 4HV6A 2F5FA 1EKEA 3E6DA 1BN5A 1ZYRF 3KZYA 4PZJA 2K9SA 2PN6A 3F6VA 1JT0A 4I7HA 2HVQA 4JYKA 4CZCA 1I1GA 4QPQA 4YIFA 4XKVA 1NK3P 3RPUD 3NAUA 2IEKA 3ZQ7A 1GDTA 3FXOA 1N75A 2ELJA 2KRFA 1KQ9A 3LSTA 2CUEA 3MQ0A 1WHUA 1IDYA 1MGTA 5K5OA 1JKPC 5D4SA 4KFCA 2XF5A 2Q1ZB 3C2HA 4HX7A 2DJIA 4M73A 5F0CA 2CQKA 4ZC3A 3HOWJ 2RNGA 2K9QA 1BJZA 1SFEA 5IYBJ 1G3WA 3TW6A 1VQ5I 2PMZN 1B9MA 2R7UA 3DF8A 4CO8A 2OAZA 5FROA 3JRGA 3KZZA 2K9MA 2JN6A 2EA2A 3AG1H 3FZVA 4G6DA 1S72I 2JPBA 1IF1A 1XGOA 2JRTA 2ECCA 5GP9A 3BP8A 5KHDA 4HNTA 1F5TA 1YS6A 3TP0A 3DBLB 3T1BA 3SJMA 3FK6A 3VSKA 5E8GA 3ZN0A 4YRVA 3H1CA 2IXSA 3DP7A 4OMYA 2WTEA 4YELA 3VYRB 2IS6A 3CD6I 2VPLA 5E1ZB 3BJAA 1BR4A 4RAYA 2KFDA 1QVTA 1Z1DA 3JRCA 2M5WA 3M1EA 2LFBA 2DW4A 1J59A 1VI0A 1ERDA 1YO5C 2LRDA 1U6GA 1FIPA 2CGPA 4S0HB 1G3YA 4DBRA 4BHCA 3FK7A 2VQHA 1W4MA 3DCFA 1DDNA 3CJTB 2RVCA 3LA7A 1K83J 2DMNA 5HDNA 4G6QA 2V26A 3D5LA 5C4JJ 4IL6C 2MLKA 3E6MA 3HRMA 1X2NA 3LFUA 3CP8A 1R4NB 3H3UA 5FLMJ 3WTWC 4IPAA 2D1HA 3QODA 1HF0A 2ZXWH 4ETSA 2ZJRF 1YS7A 3KEOA 1QPIA 1WCMJ 3ZQGA 4FHTA 1OYIA 2FQ3A 2DK8A 3OYNA 2AQEA 3E0JB 4L9JA 3FXKA 3S1NJ 1UHSA 3PL8A 1B4AA 3LSMA 2ELHA 1BM9A 4Y33A 4M3DA 3DFGA 3T5XA 1K4SA 2E1NA 3OYMA 4S04A 1RR7A 4QPOA 4BACA 2LKPA 2VKVA 3HIFA 3LSGA 1RNLA 5DCMB 1MMGA 3GLLA 2KPMA 3FXMA 4M6XA 4Q4ZF 4E7KA 2CMPA 2ZCWA 3MKLA 3BCBA 4S05A 3K70D 3FKIJ 3C18A 3H92A 3FXLA 2JUCA 3VWBA 2FNAA 3LL7A 2JSPA 3IHUA 3QPSA 5CVJA 1VQKI 4F7ZA 2BYVE 4YIRX 2K85A 1BA5A 5JHFA 3OL3A 2CFOA 3RI4A 2V1NA 3F22A 1IRZA 4HG2A 2GWRA 2L01A 1JXSA 3K9TA 3VYSB 3BQZA 3JRBA 5AONA 2ME0A 1S8NA 3ERED 1MMNA 3H5NA 5KCMA 1XSDA 3B6CA 5J1UA 3WHBA 1V5FA 3QU6A 4C2MJ 3QWLA 4IO9F 1BIBA 1F36A 2O5RA 1OJLA 4PCQA 3VYTB 4JP0A 1ETYA 4N4NB 2Z33A 4ENNA 1RETA 3CDLA 1SVMA 5EEGA 4AM3A 4L5JA 4KITB 5IPAA 2X1EA 4XM3A 5IYDJ 4ZJZA 4XN0A 5EJCA 3J80Z 2WY8Q 2DCEA 3CC4I 2P6SA 3ZRGA 3EUHA 1LEBA 1GLNA 5FKNA 4Y52J 2P5LC 2CQQA 5J1YA 3S3NA 3Q5FA 4KYWA 2ECBA 2PX9A 1ZAOA 3BJOA 3TP3A 2R92J 3ZQQA
chains in the Genus database with same CATH topology
5CVRA 1MZBA 3K0LA 4U7BA 2OQRA 4I0BA 2YR2A 4P9UA 3I53A 4A2UA 4GO1A 4G94A 4G9YA 1EH7A 1R5GA 2HS5A 4JK1X 6PAXA 3FX3A 2XUBA 3U9GA 4MTDA 4IJAA 4KICA 1R1TA 2UWMA 3CO6C 3CLOA 5LLQA 4ZZLA 5D5XB 2FXAA 1QO0D 4M71A 5D4RA 4GXOA 1BJAA 1J0RA 4I01A 1HSTA 2L4MA 4KMUX 4A0YA 1LQ1A 1U5TA 5BOXA 5CVVA 2FOKA 2FF4A 5DCMA 5D8KB 5IT9K 1YYVA 4EJOA 5DUIA 1P92A 5KVRA 3RJPA 2DO7A 4KDPA 3I59B 1T39A 4LJZF 3HSRA 2OZ6A 3GW2A 1R58A 2FBIA 2P5VA 2FE3A 2YX4A 3GYHX 4OMZA 4YIIA 3KFWX 1ZG5A 4O6JA 4B09A 4L18B 3K2ZA 3GZ5A 3RPQA 2V9VA 2H6BA 2VXZA 2STTA 4EV0A 3FF5A 2P7VB 5BMZA 5K5QA 4KIFA 3REOA 3ABUA 2FA5A 2ZMEA 1EV7A 1SD7A 2P4WA 5HS7A 4OIPF 4EQQA 3CDHA 1R5HA 5D5VB 2HWVA 1IW7F 1ZN2A 4LGWA 2Q2EA 3RKWA 2HTSA 2RV8A 5J6XA 3LAPA 3PFIA 2EFQA 2FBHA 4Y15A 4RS8A 4XRFA 2M8EA 2R3SA 2IA2A 5HVQC 3MZYA 1XMKA 1OYWA 2QM3A 4PDKA 1FYLA 3BPVA 3KCCA 3LAJA 1XGSA 2KJBA 3L09A 1FBQA 3RDIA 2FMYA 2Z99A 4Z2YA 4CGZA 4AIHA 2IPQX 1FBSA 4I09A 1WRJA 3ECOA 5LHIA 2ACJA 1R1UA 3VOEA 2V1XA 1H0MA 2VBYA 3F8FA 3Q9SA 1YW7A 3R61A 1OPCA 2M45A 4RB2C 3QRFF 4KA4A 5E1WA 3HOTA 1IRFA 3IKTA 2OBPA 3GFIA 3V8JA 1MJAA 1XSXA 5LGTA 2MBFA 1J9IA 2FU4A 2FBKA 1W7PA 1TW2A 2IA0A 3HTUA 4RGSA 1YW8A 3TKYA 3WTSC 5DUKA 5CVIA 1PP8F 3GO5A 3DKWA 3COAC 5KK1A 1G3TA 3WTZA 1IXRC 4AVPA 1IN8A 2L54A 1PUEE 1T0FA 1FSEA 1FC3A 3WE2A 1ZH5A 1S7AA 1TW3A 4MQVA 4O5VA 2JT1A 2IVMA 2IA1A 1KU2A 3ZPLA 1K78B 1STZA 2XAGA 5IT3A 3SZTA 3WODF 3V8LA 1U8RA 4BAYA 1XN7A 5LBQA 4ENJA 2BE5F 4HLYA 1MJ9A 4CHUA 3J80K 3GWZA 2KIMA 2A61A 3FM3A 1FNNA 4WXCA 5D6EA 1B6AA 4IF4A 2A6HF 2DQLA 2DT5A 1ZLKA 2Y48A 2GXBA 2Y0MA 3BWGA 1BI3A 3HHGA 3C7JA 4M9XA 1KYZA 4OOIA 3G73A 4R8HA 1YFHA 4LLGF 2AXLA 3E5XA 2RNJA 1EH8A 2K4BA 3TDUC 4M74A 5CYVA 3G3ZA 2ISYA 2K86A 3E3VA 1D8KA 3LA3A 2J5OA 2LNBA 5JVTA 1PP7U 1R7JA 3CUOA 3O6BB 2DK5A 3GFMA 3N4MA 3WGIA 1FY7A 2F5DA 1O3TA 2H94A 5HS8A 3ABTA 2G7HA 1IRGA 1U5TC 2NS0A 5CLSA 2PI0A 1O3QA 1Z9CA 4MNUA 2K4JA 1AWCA 1CGPA 5DDGA 4HF2A 2XROA 1MJBA 2VC1A 3LFKA 2F2EA 3C1DA 1RUNA 5DV5A 2QLZA 4ZZDA 3GF2A 3KP6A 2EB7A 1K78A 3F8BA 1J75A 1BOAA 3TOAA 4WCGA 3KLOA 4G7OF 4A12A 1WQ2A 2B0LA 2WV0A 2HOEA 3BY6A 3FXRA 3GZ6A 2ESHA 2HTJA 1ZARA 2V6CA 3B02A 1REPC 3L00A 2V1UA 3HOSA 1E2XA 2K02A 3K1PA 2L3DA 1IAWA 2QQBA 3ZMZA 3WTVC 1S6LA 2Z9OA 1DPUA 4A6EA 5ILSA 5H6QA 4EM2A 4M6YA 1U2WA 2O03A 2HQNA 1Z7UA 2XIGA 5D5WB 3I5UA 4JBAA 5HDKA 4H0EA 2CWEA 3HHHA 1QGPA 2KIFA 5E17F 3LA2A 1QZYA 1KGSA 3ZMUA 4IXAA 3JSPA 2HR3A 1TBXA 3BROA 3KETA 4UUVA 3QP6A 5A2QZ 2E7WA 4XBFA 4U88A 3K1MA 3KP7A 3MAJA 5L3BA 4U0VA 2M30A 4MGRA 3ML6A 3T8RA 2H27A 2JSCA 3E97A 3WE3A 1XGNA 2L02A 1LB2A 4BHPA 3MEXA 1B1BA 5BPDA 1LVAA 1P6RA 3JW4A 3ECHA 3M8FA 4QLCU 3ZMSA 4FX4A 2R7DA 1OR7A 5E8IA 5FGMA 2NRAC 4ZYGA 5FFXA 2PJPA 4ENMA 2WC2A 3EYYA 1QQIA 4OIQF 1HSJA 4BH9A 5ILVA 1OMIA 1RIOH 3HSEA 4ZYDA 1QBJA 3N97A 1KU9A 3HRTA 1P4WA 3FMSA 2DBBA 2OQGA 1ZRCA 2HDCA 2GXGA 1CF7B 4ASNA 5F1RA 1XGMA 1C0WA 2Y75A 2IP2A 5HDGA 4CDGA 2O3FA 4L5IA 5AIPA 3LQQA 1R36A 5E18F 1TQMA 4LK1F 2ZJ2A 5CJ9A 5HLHA 1LJ9A 3I71A 4LFUA 4PGHA 5ICCA 2D2WA 1UHMA 3KP3A 5F6FA 2F5CA 4KNYA 4MTEA 4HDVA 3H3ZA 5ICGA 2QBYB 2G7UA 4WXHA 4IVNA 2JZYA 2VBXA 4AD9A 1K7AA 2ISZA 1F1ZA 2JTVA 1FSHA 1NHAA 3P7NA 4CYDA 3FXQA 2VT2A 2HQRA 1L3LA 2PMUA 3RYRA 2P8TA 3DXJF 4MHGA 1KU7A 4A5MA 3QPHA 3ZP5A 3HRUA 4G7ZF 1KA8A 2D1VA 3F21A 1IN5A 3VB2A 3SXYA 5F64A 2RGVA 3V7RA 1RZ4A 2MH9A 3OOPA 3B73A 2VBWA 4TV7A 5FLXK 1F9NA 2NNNA 2RDPA 1T2KA 3NQOA 2BBYA 1B9NA 5E20A 4UV9A 2ETHA 1H9TA 1K6OA 4M9SA 4B8XA 1I27A 1JHHA 4N9IA 1ON2A 3D0SA 4WX9A 2EFPA 3J7AO 2MA3A 2EV6A 3CO7C 4IHTA 1HW5A 2PEXA 3L7WA 3RKYA 4L0ZB 3JAMZ 2EJRA 4HYEA 1S29A 3I58A 4RB0A 2ZO4A 2QVOA 1Q1HA 3QU3A 2WWYA 3SZPA 5JHUA 2GA2A 2VT3A 3DEUA 4HF0A 3QAHA 5H6RA 4XLNF 3ZMTA 2A3SA 1BI2A 1PDNC 1LDKB 1CF7A 1BIAA 1JHFA 4HW0A 4L0YB 5BS6A 2HFHA 2Z3YA 1HW1A 1OKRA 2ZXJA 2KKOA 1KYWA 1GXQA 1MDMB 4OIRF 2DLLA 4FX0A 3HTSB 3M7GA 2GIVA 2CSOA 4FT8A 4WF2A 2FSWA 2A68F 5FD6A 2QENA 2W25A 4LG0B 5D8LB 2HYFA 1V4RA 3VODA 2EV0A 3EYIA 2YU3A 3P9IA 5L3DA 2GAUA 3P9KA 2ZFWA 1XB4A 4KT5C 4KN7X 2RQPA 2J5PA 2EFWA 4AIJA 5D6FA 1XDUA 3I4PA 1BC8C 5LRSA 3CJNA 3GFLA 3O2PE 4M9ZA 5LGUA 2QWWA 2STWA 2E7XA 5HS9A 2V79A 2CO5A 3R4KA 1UHWA 2DTRA 2MD5A 1ODDA 4EGYA 1IUYA 1IN7A 5A2QK 5ED4A 4GCVA 4RGUA 4WWCA 2COMA 2EFOA 2P5KA 1Y0UA 3CUQB 3I59A 3MZHA 2LF8A 5J8CA 1MKMA 2Q0OA 2O0YA 1AOYA 2W24A 1MD0A 1LEAA 4Y13A 4HLXA 3GFJA 1W7PD 2PBIA 2O8XA 3F8NA 1HXDA 4XLPF 5H20A 3BDDA 1VTNC 1HKQA 3U1DA 3NRVA 4HV5A 2HKXA 4HQEA 1BI1A 4GGGA 2W85A 4M72A 1G6NA 2UXXA 2XHKA 3SHFA 5FB2A 4RGRA 2EA4A 4UNOA 1IN4A 1FYMA 5L3CA 3J81K 1IZ1A 1O7FA 3MCZA 1XCVA 5DCFA 3QOPA 2VC0A 3M8EA 3WG9A 3ZMDA 4GYIA 3BZ6A 1IXSB 5JR3A 2MH2A 1QZZA 5ICFA 2GQQA 1O7LA 1HW2A 3WTTC 2IJLA 4O3MA 3ZN1A 1DPRA 1Z6TA 1SD6A 3MFKA 4UHTA 4ENKA 4ZH4F 1YTYA 1SMTA 2RC4A 1TQPA 4UVBA 4P96A 4R1HA 2Z5UA 1D3YA 2QYOA 3KE2A 2PMHA 3E6CC 2NNYA 4ESBA 2EFNA 2A69F 1L0OC 1J7KA 1BBYA 1I1SA 5FLXZ 3I0TA 3F72A 1ZG3A 2K27A 1K79A 2XAHA 3FWEA 1V3FA 2DU9A 1OYYA 1LDDA 3TGNA 1KQ8A 5K1YA 2UZKA 4RGXA 1J5YA 2DPUA 3WU1B 3DPLC 2BV6A 2OD5A 3JTHA 1Z05A 2IRFG 1FWZA 3WTXC 4PGGA 2QQAA 3FM5A 2HEOA 3GEZA 3IRQA 1TLHB 2ESNA 3ULQB 4HBLA 5L3EA 3JAMK 3IRRA 1R22A 2C6YA 3RPUA 3SFZA 3R0JA 4YFKF 4L9VA 4N0BA 4HQMA 1T38A 3HSFA 3FMRA 4RB1A 3RYPA 3HYIA 3ELKA 1JE8A 1SFXA 4OU0A 1USSA 3F8CA 4ESFA 4KN4X 2Q8KA 4ON0A 3R60A 1IXCA 1ZG1A 3RTRA 3TDZC 1ZGJA 1YQAA 4QWQA 2V1DA 3R6SA 3JSOA 1Z91A 4UV8A 2ZBKA 4OIOF 5LEKA 3F23A 2NYXA 1D8JA 3BJ6A 1GXPA 2VONA 3WU0A 2XV4S 4Q48A 2QQ9A 3V7SA 4P55A 2LSOA 1WSUA 2F5EA 4IRGA 3U2RA 2DI3A 4UXNA 4GYGA 3GVAA 3T0YA 4KMFA 1P4XA 4UVCA 2CG4A 3QP5A 4EGZA 2XKOA 5FFZA 2UXNA 1LNWA 2FMLA 1QNTA 3M9AA 2QZ8A 5D5UB 1GVJA 2LDUA 5J8FA 3C3WA 4ESJA 4U0YA 1W5TA 5HOOA 2DAOA 5ICEA 3I54A 1HQCA 5LHHA 1WI9A 3LQRA 3ISPA 1T6SA 1HBXG 4YFXF 4I0AA 4EM1A 2PG4A 1U5TB 1FPQA 4D0PA 2ADUA 1ZRFA 2EWNA 1HKTA 2XAJA 2H6CA 5K5RA 2MLGA 2JPCA 4R79A 2H09A 2LF7A 4ZYHA 2M1BA 1I5ZA 2VOPA 2VBZA 3TO6A 1G4DA 2W84A 1SD5A 3SQNA 5FD5A 4WK8F 3E5UA 5DYMA 3J81Z 1UCRA 5ILUA 3L2CA 1FYKA 2FRHA 2HGCA 3W6JB 2XRNA 3PQJA 2YX7A 2CFXA 2EV5A 2XKPA 2RKHA 4HOBA 2GZWA 5HLIA 3EETA 4MQ9F 4MEYF 3EQLF 3VEPA 2QUFA 4WXDA 5E1XA 5LEJA 5DD8A 4P9FA 1FT9A 5CVUA 2ZMEB 3S2WA 2L4AA 5HLGA 1D5VA 2P6TA 1IN6A 4LK0F 3KP2A 4RAZA 1LDJA 3IKVA 4YFNF 3GX4X 4HX8A 1S3JA 1RI7A 1FBUA 3K1NA 1UB9A 1YIOA 4A0ZA 3O3KA 4Q47A 4BQAA 2R7FA 4L9TA 4HA8A 1FX7A 1SMYF 3KLNA 2IW5A 4HDUA 2A07F 4JQFA 1DUXC 2CW0F 5AIQA 3QPTA 2VOOA 5DEQA 4RB3C 1G3SA 1TTYA 4BHBA 2VN2A 3IWFA 4I98B 3CUQC 1ZHFA 2OA4A 3TO9A 2VODA 5ERIA 2E1CA 2OU2A 2VE8A 1A04A 2P7CB 1J2XA 3JTGA 5JFRA 3WTYC 1U3EM 3PQKA 1T98A 4EJVA 1SFUA 3VFZA 4K2EA 4LMYA 4NQWA 4EVIA 2ZNYA 1TNSA 1SD4A 1YW9A 1W7PB 2W57A 1TNTA 4DQ2A 1E17A 1O57A 1GHCA 4EMSA 4E70A 3V4GA 1FLIA 4L9NA 3NEUA 3IWZA 4XSXF 5L3GA 4A5NA 1XMAA 4KIBA 1USTA 4Q5SF 1X3UA 1KQ0A 2M87A 2G9WA 1ZRDA 1WWXA 3FHZA 2BGCA 3F6OA 3ZMVA 4P5OA 4EJTA 3DQVC 3FMQA 4KUMA 4G8XA 1I6XA 3F8MA 4MEXF 3OV8A 2QBYA 3V7CA 1R00A 2XVCA 4EJUA 1R1VA 1BI0A 4IHSA 2PFBA 5FO5A 4LLNA 2D45A 5JI6A 2DFIA 3KEQA 4U0WA 4I02A 5BPIA 1XCBA 4N9HA 3TO7A 2BEOA 3T8TA 4EJWA 1FP1D 3P9CA 1ZGAA 3BOQA 1SAXA 4BXUA 2DPDA 2X4HA 4CICA 5EEHA 3IC7A 3DV8A 4NB5A 2FNPA 4YG2F 3GUDA 4CZZA 3I64A 2KIUA 2PQ8A 2XAQA 1YG2A 3F3XA 3GXOA 3K69A 4AWXB 2PLYA 1Z6RA 2IT0A 1S7OA 3R0AA 1KU3A 4G7HF 1QPMA 5LHGA 2KJCA 4Y17A 4I2OA 4ZYEA 3RIRA 2HZTA 3GLXA 4AIKA 1P2FA 1ZLJA 2HYGD 3EDPA 1W5SA 1DP7P 4HAMA 3CTAA 4U7DA 3BPXA 4IRIA 1FZPB 4LLLA 2CYYA 1ONVA 1BC7C 4BNCA 4LB6B 1MDMA 3WGHA 4LB5A 4LD5A 2XAFA 2OZUA 4UVAA 3RKXA 3HRSA 2YSRA 1F4KA 4EM0B 3HUGA 1ZREA 1ULYA 1FP2A 4NHJA 1XSVA 2FEZA 4LG0A 2HKOA 4A6DA 5TJJA 2MC3A 2DQRA 3ROUA 3WTUC 4XSZF 2A5YB 3KP5A 3TQNA 3AAFA 1RUOA 2ZKZA 2GA1A 1R23A 5BQTA 1P4AA 3TOBA 2EK5A 2K7LA 2TDXA 3W6KB 3V8KA 3Q9VA 4HF1A 2YPRA 1H9GA 2A6EF 3MWMA 3L9FA 2RN7A 4HZFA 4DNCA 1O3RA 2O6GE 4A0XA 1B59A 3CUQA 4CXFA 1U78A 3FXUA 1WKMA 4IRHA 1YLFA 1UFMA 3E6BA 1O3SA 4HX4A 1FOKA 2AS5F 5IT9Z 2NAZA 4KIGA 1EH6A 2X0LA 3IL2A 1TQIA 2XASA 1JGSA 3DPTA 5LGNA 3LWFA 2VE9A 5DD4A 1HKSA 4BYYA 2XGXA 3KP4A 1XDSA 2ZNZA 4OINF 5L3FA 5TRDA 5LRRA 1XD7A 2O61A 1ON1A 3E5QA 3WGGA 4HV6A 2F5FA 3E6DA 1BN5A 1ZYRF 3KZYA 4PZJA 2PN6A 3F6VA 4I7HA 1I1GA 4YIFA 3ZQ7A 2KRFA 1KQ9A 3LSTA 3MQ0A 1MGTA 5K5OA 4KFCA 5D4SA 4HX7A 4M73A 2CQKA 1SFEA 1G3WA 1B9MA 3DF8A 4CO8A 2OAZA 3KZZA 3FZVA 4G6DA 2EA2A 1IF1A 2JPBA 1XGOA 2JRTA 3BP8A 1F5TA 1YS6A 3T1BA 5E8GA 3ZN0A 3DP7A 4OMYA 2WTEA 5E1ZB 3BJAA 4RAYA 1Z1DA 2M5WA 3M1EA 2DW4A 1J59A 1YO5C 1U6GA 2CGPA 1G3YA 4BHCA 1W4MA 1DDNA 2RVCA 3LA7A 5HDNA 4G6QA 3D5LA 2MLKA 3E6MA 3HRMA 3H3UA 3WTWC 4IPAA 2D1HA 4ETSA 1YS7A 3KEOA 4FHTA 1OYIA 2FQ3A 2DK8A 4L9JA 1B4AA 2ELHA 1BM9A 3DFGA 3T5XA 2E1NA 4S04A 2LKPA 3HIFA 1RNLA 5DCMB 4M6XA 4Q4ZF 2ZCWA 4S05A 3C18A 3H92A 2FNAA 3IHUA 5CVJA 4F7ZA 2BYVE 3RI4A 3F22A 2GWRA 2L01A 1JXSA 3K9TA 5AONA 1S8NA 3ERED 1XSDA 3QU6A 1BIBA 4PCQA 2Z33A 4ENNA 5EEGA 4L5JA 3J80Z 2P6SA 3EUHA 1LEBA 2P5LC 3Q5FA 4KYWA 1ZAOA 3BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CVR A;  1MZB A;  3K0L A;  4U7B A;  2OQR A;  4I0B A;  2YR2 A;  4P9U A;  3I53 A;  4A2U A;  4GO1 A;  4G94 A;  4G9Y A;  1EH7 A;  1R5G A;  2HS5 A;  4JK1 X;  6PAX A;  3FX3 A;  2XUB A;  3U9G A;  4MTD A;  4IJA A;  4KIC A;  1R1T A;  2UWM A;  3CO6 C;  3CLO A;  5LLQ A;  4ZZL A;  5D5X B;  2FXA A;  1QO0 D;  4M71 A;  5D4R A;  4GXO A;  1BJA A;  1J0R A;  4I01 A;  1HST A;  2L4M A;  4KMU X;  4A0Y A;  1LQ1 A;  1U5T A;  5BOX A;  5CVV A;  2FOK A;  2FF4 A;  5DCM A;  5D8K B;  5IT9 K;  1YYV A;  4EJO A;  5DUI A;  1P92 A;  5KVR A;  3RJP A;  2DO7 A;  4KDP A;  3I59 B;  1T39 A;  4LJZ F;  3HSR A;  2OZ6 A;  3GW2 A;  1R58 A;  2FBI A;  2P5V A;  2FE3 A;  2YX4 A;  3GYH X;  4OMZ A;  4YII A;  3KFW X;  1ZG5 A;  4O6J A;  4B09 A;  4L18 B;  3K2Z A;  3GZ5 A;  3RPQ A;  2V9V A;  2H6B A;  2VXZ A;  2STT A;  4EV0 A;  3FF5 A;  2P7V B;  5BMZ A;  5K5Q A;  4KIF A;  3REO A;  3ABU A;  2FA5 A;  2ZME A;  1EV7 A;  1SD7 A;  2P4W A;  5HS7 A;  4OIP F;  4EQQ A;  3CDH A;  1R5H A;  5D5V B;  2HWV A;  1IW7 F;  1ZN2 A;  4LGW A;  2Q2E A;  3RKW A;  2HTS A;  2RV8 A;  5J6X A;  3LAP A;  3PFI A;  2EFQ A;  2FBH A;  4Y15 A;  4RS8 A;  4XRF A;  2M8E A;  2R3S A;  2IA2 A;  5HVQ C;  3MZY A;  1XMK A;  1OYW A;  2QM3 A;  4PDK A;  1FYL A;  3BPV A;  3KCC A;  3LAJ A;  1XGS A;  2KJB A;  3L09 A;  1FBQ A;  3RDI A;  2FMY A;  2Z99 A;  4Z2Y A;  4CGZ A;  4AIH A;  2IPQ X;  1FBS A;  4I09 A;  1WRJ A;  3ECO A;  5LHI A;  2ACJ A;  1R1U A;  3VOE A;  2V1X A;  1H0M A;  2VBY A;  3F8F A;  3Q9S A;  1YW7 A;  3R61 A;  1OPC A;  2M45 A;  4RB2 C;  3QRF F;  4KA4 A;  5E1W A;  3HOT A;  1IRF A;  3IKT A;  2OBP A;  3GFI A;  3V8J A;  1MJA A;  1XSX A;  5LGT A;  2MBF A;  1J9I A;  2FU4 A;  2FBK A;  1W7P A;  1TW2 A;  2IA0 A;  3HTU A;  4RGS A;  1YW8 A;  3TKY A;  3WTS C;  5DUK A;  5CVI A;  1PP8 F;  3GO5 A;  3DKW A;  3COA C;  5KK1 A;  1G3T A;  3WTZ A;  1IXR C;  4AVP A;  1IN8 A;  2L54 A;  1PUE E;  1T0F A;  1FSE A;  1FC3 A;  3WE2 A;  1ZH5 A;  1S7A A;  1TW3 A;  4MQV A;  4O5V A;  2JT1 A;  2IVM A;  2IA1 A;  1KU2 A;  3ZPL A;  1K78 B;  1STZ A;  2XAG A;  5IT3 A;  3SZT A;  3WOD F;  3V8L A;  1U8R A;  4BAY A;  1XN7 A;  5LBQ A;  4ENJ A;  2BE5 F;  4HLY A;  1MJ9 A;  4CHU A;  3J80 K;  3GWZ A;  2KIM A;  2A61 A;  3FM3 A;  1FNN A;  4WXC A;  5D6E A;  1B6A A;  4IF4 A;  2A6H F;  2DQL A;  2DT5 A;  1ZLK A;  2Y48 A;  2GXB A;  2Y0M A;  3BWG A;  1BI3 A;  3HHG A;  3C7J A;  4M9X A;  1KYZ A;  4OOI A;  3G73 A;  4R8H A;  1YFH A;  4LLG F;  2AXL A;  3E5X A;  2RNJ A;  1EH8 A;  2K4B A;  3TDU C;  4M74 A;  5CYV A;  3G3Z A;  2ISY A;  2K86 A;  3E3V A;  1D8K A;  3LA3 A;  2J5O A;  2LNB A;  5JVT A;  1PP7 U;  1R7J A;  3CUO A;  3O6B B;  2DK5 A;  3GFM A;  3N4M A;  3WGI A;  1FY7 A;  2F5D A;  1O3T A;  2H94 A;  5HS8 A;  3ABT A;  2G7H A;  1IRG A;  1U5T C;  2NS0 A;  5CLS A;  2PI0 A;  1O3Q A;  1Z9C A;  4MNU A;  2K4J A;  1AWC A;  1CGP A;  5DDG A;  4HF2 A;  2XRO A;  1MJB A;  2VC1 A;  3LFK A;  2F2E A;  3C1D A;  1RUN A;  5DV5 A;  2QLZ A;  4ZZD A;  3GF2 A;  3KP6 A;  2EB7 A;  1K78 A;  3F8B A;  1J75 A;  1BOA A;  3TOA A;  4WCG A;  3KLO A;  4G7O F;  4A12 A;  1WQ2 A;  2B0L A;  2WV0 A;  2HOE A;  3BY6 A;  3FXR A;  3GZ6 A;  2ESH A;  2HTJ A;  1ZAR A;  2V6C A;  3B02 A;  1REP C;  3L00 A;  2V1U A;  3HOS A;  1E2X A;  2K02 A;  3K1P A;  2L3D A;  1IAW A;  2QQB A;  3ZMZ A;  3WTV C;  1S6L A;  2Z9O A;  1DPU A;  4A6E A;  5ILS A;  5H6Q A;  4EM2 A;  4M6Y A;  1U2W A;  2O03 A;  2HQN A;  1Z7U A;  2XIG A;  5D5W B;  3I5U A;  4JBA A;  5HDK A;  4H0E A;  2CWE A;  3HHH A;  1QGP A;  2KIF A;  5E17 F;  3LA2 A;  1QZY A;  1KGS A;  3ZMU A;  4IXA A;  3JSP A;  2HR3 A;  1TBX A;  3BRO A;  3KET A;  4UUV A;  3QP6 A;  5A2Q Z;  2E7W A;  4XBF A;  4U88 A;  3K1M A;  3KP7 A;  3MAJ A;  5L3B A;  4U0V A;  2M30 A;  4MGR A;  3ML6 A;  3T8R A;  2H27 A;  2JSC A;  3E97 A;  3WE3 A;  1XGN A;  2L02 A;  1LB2 A;  4BHP A;  3MEX A;  1B1B A;  5BPD A;  1LVA A;  1P6R A;  3JW4 A;  3ECH A;  3M8F A;  4QLC U;  3ZMS A;  4FX4 A;  2R7D A;  1OR7 A;  5E8I A;  5FGM A;  2NRA C;  4ZYG A;  5FFX A;  2PJP A;  4ENM A;  2WC2 A;  3EYY A;  1QQI A;  4OIQ F;  1HSJ A;  4BH9 A;  5ILV A;  1OMI A;  1RIO H;  3HSE A;  4ZYD A;  1QBJ A;  3N97 A;  1KU9 A;  3HRT A;  1P4W A;  3FMS A;  2DBB A;  2OQG A;  1ZRC A;  2HDC A;  2GXG A;  1CF7 B;  4ASN A;  5F1R A;  1XGM A;  1C0W A;  2Y75 A;  2IP2 A;  5HDG A;  4CDG A;  2O3F A;  4L5I A;  5AIP A;  3LQQ A;  1R36 A;  5E18 F;  1TQM A;  4LK1 F;  2ZJ2 A;  5CJ9 A;  5HLH A;  1LJ9 A;  3I71 A;  4LFU A;  4PGH A;  5ICC A;  2D2W A;  1UHM A;  3KP3 A;  5F6F A;  2F5C A;  4KNY A;  4MTE A;  4HDV A;  3H3Z A;  5ICG A;  2QBY B;  2G7U A;  4WXH A;  4IVN A;  2JZY A;  2VBX A;  4AD9 A;  1K7A A;  2ISZ A;  1F1Z A;  2JTV A;  1FSH A;  1NHA A;  3P7N A;  4CYD A;  3FXQ A;  2VT2 A;  2HQR A;  1L3L A;  2PMU A;  3RYR A;  2P8T A;  3DXJ F;  4MHG A;  1KU7 A;  4A5M A;  3QPH A;  3ZP5 A;  3HRU A;  4G7Z F;  1KA8 A;  2D1V A;  3F21 A;  1IN5 A;  3VB2 A;  3SXY A;  5F64 A;  2RGV A;  3V7R A;  1RZ4 A;  2MH9 A;  3OOP A;  3B73 A;  2VBW A;  4TV7 A;  5FLX K;  1F9N A;  2NNN A;  2RDP A;  1T2K A;  3NQO A;  2BBY A;  1B9N A;  5E20 A;  4UV9 A;  2ETH A;  1H9T A;  1K6O A;  4M9S A;  4B8X A;  1I27 A;  1JHH A;  4N9I A;  1ON2 A;  3D0S A;  4WX9 A;  2EFP A;  3J7A O;  2MA3 A;  2EV6 A;  3CO7 C;  4IHT A;  1HW5 A;  2PEX A;  3L7W A;  3RKY A;  4L0Z B;  3JAM Z;  2EJR A;  4HYE A;  1S29 A;  3I58 A;  4RB0 A;  2ZO4 A;  2QVO A;  1Q1H A;  3QU3 A;  2WWY A;  3SZP A;  5JHU A;  2GA2 A;  2VT3 A;  3DEU A;  4HF0 A;  3QAH A;  5H6R A;  4XLN F;  3ZMT A;  2A3S A;  1BI2 A;  1PDN C;  1LDK B;  1CF7 A;  1BIA A;  1JHF A;  4HW0 A;  4L0Y B;  5BS6 A;  2HFH A;  2Z3Y A;  1HW1 A;  1OKR A;  2ZXJ A;  2KKO A;  1KYW A;  1GXQ A;  1MDM B;  4OIR F;  2DLL A;  4FX0 A;  3HTS B;  3M7G A;  2GIV A;  2CSO A;  4FT8 A;  4WF2 A;  2FSW A;  2A68 F;  5FD6 A;  2QEN A;  2W25 A;  4LG0 B;  5D8L B;  2HYF A;  1V4R A;  3VOD A;  2EV0 A;  3EYI A;  2YU3 A;  3P9I A;  5L3D A;  2GAU A;  3P9K A;  2ZFW A;  1XB4 A;  4KT5 C;  4KN7 X;  2RQP A;  2J5P A;  2EFW A;  4AIJ A;  5D6F A;  1XDU A;  3I4P A;  1BC8 C;  5LRS A;  3CJN A;  3GFL A;  3O2P E;  4M9Z A;  5LGU A;  2QWW A;  2STW A;  2E7X A;  5HS9 A;  2V79 A;  2CO5 A;  3R4K A;  1UHW A;  2DTR A;  2MD5 A;  1ODD A;  4EGY A;  1IUY A;  1IN7 A;  5A2Q K;  5ED4 A;  4GCV A;  4RGU A;  4WWC A;  2COM A;  2EFO A;  2P5K A;  1Y0U A;  3CUQ B;  3I59 A;  3MZH A;  2LF8 A;  5J8C A;  1MKM A;  2Q0O A;  2O0Y A;  1AOY A;  2W24 A;  1MD0 A;  1LEA A;  4Y13 A;  4HLX A;  3GFJ A;  1W7P D;  2PBI A;  2O8X A;  3F8N A;  1HXD A;  4XLP F;  5H20 A;  3BDD A;  1VTN C;  1HKQ A;  3U1D A;  3NRV A;  4HV5 A;  2HKX A;  4HQE A;  1BI1 A;  4GGG A;  2W85 A;  4M72 A;  1G6N A;  2UXX A;  2XHK A;  3SHF A;  5FB2 A;  4RGR A;  2EA4 A;  4UNO A;  1IN4 A;  1FYM A;  5L3C A;  3J81 K;  1IZ1 A;  1O7F A;  3MCZ A;  1XCV A;  5DCF A;  3QOP A;  2VC0 A;  3M8E A;  3WG9 A;  3ZMD A;  4GYI A;  3BZ6 A;  1IXS B;  5JR3 A;  2MH2 A;  1QZZ A;  5ICF A;  2GQQ A;  1O7L A;  1HW2 A;  3WTT C;  2IJL A;  4O3M A;  3ZN1 A;  1DPR A;  1Z6T A;  1SD6 A;  3MFK A;  4UHT A;  4ENK A;  4ZH4 F;  1YTY A;  1SMT A;  2RC4 A;  1TQP A;  4UVB A;  4P96 A;  4R1H A;  2Z5U A;  1D3Y A;  2QYO A;  3KE2 A;  2PMH A;  3E6C C;  2NNY A;  4ESB A;  2EFN A;  2A69 F;  1L0O C;  1J7K A;  1BBY A;  1I1S A;  5FLX Z;  3I0T A;  3F72 A;  1ZG3 A;  2K27 A;  1K79 A;  2XAH A;  3FWE A;  1V3F A;  2DU9 A;  1OYY A;  1LDD A;  3TGN A;  1KQ8 A;  5K1Y A;  2UZK A;  4RGX A;  1J5Y A;  2DPU A;  3WU1 B;  3DPL C;  2BV6 A;  2OD5 A;  3JTH A;  1Z05 A;  2IRF G;  1FWZ A;  3WTX C;  4PGG A;  2QQA A;  3FM5 A;  2HEO A;  3GEZ A;  3IRQ A;  1TLH B;  2ESN A;  3ULQ B;  4HBL A;  5L3E A;  3JAM K;  3IRR A;  1R22 A;  2C6Y A;  3RPU A;  3SFZ A;  3R0J A;  4YFK F;  4L9V A;  4N0B A;  4HQM A;  1T38 A;  3HSF A;  3FMR A;  4RB1 A;  3RYP A;  3HYI A;  3ELK A;  1JE8 A;  1SFX A;  4OU0 A;  1USS A;  3F8C A;  4ESF A;  4KN4 X;  2Q8K A;  4ON0 A;  3R60 A;  1IXC A;  1ZG1 A;  3RTR A;  3TDZ C;  1ZGJ A;  1YQA A;  4QWQ A;  2V1D A;  3R6S A;  3JSO A;  1Z91 A;  4UV8 A;  2ZBK A;  4OIO F;  5LEK A;  3F23 A;  2NYX A;  1D8J A;  3BJ6 A;  1GXP A;  2VON A;  3WU0 A;  2XV4 S;  4Q48 A;  2QQ9 A;  3V7S A;  4P55 A;  2LSO A;  1WSU A;  2F5E A;  4IRG A;  3U2R A;  2DI3 A;  4UXN A;  4GYG A;  3GVA A;  3T0Y A;  4KMF A;  1P4X A;  4UVC A;  2CG4 A;  3QP5 A;  4EGZ A;  2XKO A;  5FFZ A;  2UXN A;  1LNW A;  2FML A;  1QNT A;  3M9A A;  2QZ8 A;  5D5U B;  1GVJ A;  2LDU A;  5J8F A;  3C3W A;  4ESJ A;  4U0Y A;  1W5T A;  5HOO A;  2DAO A;  5ICE A;  3I54 A;  1HQC A;  5LHH A;  1WI9 A;  3LQR A;  3ISP A;  1T6S A;  1HBX G;  4YFX F;  4I0A A;  4EM1 A;  2PG4 A;  1U5T B;  1FPQ A;  4D0P A;  2ADU A;  1ZRF A;  2EWN A;  1HKT A;  2XAJ A;  2H6C A;  5K5R A;  2MLG A;  2JPC A;  4R79 A;  2H09 A;  2LF7 A;  4ZYH A;  2M1B A;  1I5Z A;  2VOP A;  2VBZ A;  3TO6 A;  1G4D A;  2W84 A;  1SD5 A;  3SQN A;  5FD5 A;  4WK8 F;  3E5U A;  5DYM A;  3J81 Z;  1UCR A;  5ILU A;  3L2C A;  1FYK A;  2FRH A;  2HGC A;  3W6J B;  2XRN A;  3PQJ A;  2YX7 A;  2CFX A;  2EV5 A;  2XKP A;  2RKH A;  4HOB A;  2GZW A;  5HLI A;  3EET A;  4MQ9 F;  4MEY F;  3EQL F;  3VEP A;  2QUF A;  4WXD A;  5E1X A;  5LEJ A;  5DD8 A;  4P9F A;  1FT9 A;  5CVU A;  2ZME B;  3S2W A;  2L4A A;  5HLG A;  1D5V A;  2P6T A;  1IN6 A;  4LK0 F;  3KP2 A;  4RAZ A;  1LDJ A;  3IKV A;  4YFN F;  3GX4 X;  4HX8 A;  1S3J A;  1RI7 A;  1FBU A;  3K1N A;  1UB9 A;  1YIO A;  4A0Z A;  3O3K A;  4Q47 A;  4BQA A;  2R7F A;  4L9T A;  4HA8 A;  1FX7 A;  1SMY F;  3KLN A;  2IW5 A;  4HDU A;  2A07 F;  4JQF A;  1DUX C;  2CW0 F;  5AIQ A;  3QPT A;  2VOO A;  5DEQ A;  4RB3 C;  1G3S A;  1TTY A;  4BHB A;  2VN2 A;  3IWF A;  4I98 B;  3CUQ C;  1ZHF A;  2OA4 A;  3TO9 A;  2VOD A;  5ERI A;  2E1C A;  2OU2 A;  2VE8 A;  1A04 A;  2P7C B;  1J2X A;  3JTG A;  5JFR A;  3WTY C;  1U3E M;  3PQK A;  1T98 A;  4EJV A;  1SFU A;  3VFZ A;  4K2E A;  4LMY A;  4NQW A;  4EVI A;  2ZNY A;  1TNS A;  1SD4 A;  1YW9 A;  1W7P B;  2W57 A;  1TNT A;  4DQ2 A;  1E17 A;  1O57 A;  1GHC A;  4EMS A;  4E70 A;  3V4G A;  1FLI A;  4L9N A;  3NEU A;  3IWZ A;  4XSX F;  5L3G A;  4A5N A;  1XMA A;  4KIB A;  1UST A;  4Q5S F;  1X3U A;  1KQ0 A;  2M87 A;  2G9W A;  1ZRD A;  1WWX A;  3FHZ A;  2BGC A;  3F6O A;  3ZMV A;  4P5O A;  4EJT A;  3DQV C;  3FMQ A;  4KUM A;  4G8X A;  1I6X A;  3F8M A;  4MEX F;  3OV8 A;  2QBY A;  3V7C A;  1R00 A;  2XVC A;  4EJU A;  1R1V A;  1BI0 A;  4IHS A;  2PFB A;  5FO5 A;  4LLN A;  2D45 A;  5JI6 A;  2DFI A;  3KEQ A;  4U0W A;  4I02 A;  5BPI A;  1XCB A;  4N9H A;  3TO7 A;  2BEO A;  3T8T A;  4EJW A;  1FP1 D;  3P9C A;  1ZGA A;  3BOQ A;  1SAX A;  4BXU A;  2DPD A;  2X4H A;  4CIC A;  5EEH A;  3IC7 A;  3DV8 A;  4NB5 A;  2FNP A;  4YG2 F;  3GUD A;  4CZZ A;  3I64 A;  2KIU A;  2PQ8 A;  2XAQ A;  1YG2 A;  3F3X A;  3GXO A;  3K69 A;  4AWX B;  2PLY A;  1Z6R A;  2IT0 A;  1S7O A;  3R0A A;  1KU3 A;  4G7H F;  1QPM A;  5LHG A;  2KJC A;  4Y17 A;  4I2O A;  4ZYE A;  3RIR A;  2HZT A;  3GLX A;  4AIK A;  1P2F A;  1ZLJ A;  2HYG D;  3EDP A;  1W5S A;  1DP7 P;  4HAM A;  3CTA A;  4U7D A;  3BPX A;  4IRI A;  1FZP B;  4LLL A;  2CYY A;  1ONV A;  1BC7 C;  4BNC A;  4LB6 B;  1MDM A;  3WGH A;  4LB5 A;  4LD5 A;  2XAF A;  2OZU A;  4UVA A;  3RKX A;  3HRS A;  2YSR A;  1F4K A;  4EM0 B;  3HUG A;  1ZRE A;  1ULY A;  1FP2 A;  4NHJ A;  1XSV A;  2FEZ A;  4LG0 A;  2HKO A;  4A6D A;  5TJJ A;  2MC3 A;  2DQR A;  3ROU A;  3WTU C;  4XSZ F;  2A5Y B;  3KP5 A;  3TQN A;  3AAF A;  1RUO A;  2ZKZ A;  2GA1 A;  1R23 A;  5BQT A;  1P4A A;  3TOB A;  2EK5 A;  2K7L A;  2TDX A;  3W6K B;  3V8K A;  3Q9V A;  4HF1 A;  2YPR A;  1H9G A;  2A6E F;  3MWM A;  3L9F A;  2RN7 A;  4HZF A;  4DNC A;  1O3R A;  2O6G E;  4A0X A;  1B59 A;  3CUQ A;  4CXF A;  1U78 A;  3FXU A;  1WKM A;  4IRH A;  1YLF A;  1UFM A;  3E6B A;  1O3S A;  4HX4 A;  1FOK A;  2AS5 F;  5IT9 Z;  2NAZ A;  4KIG A;  1EH6 A;  2X0L A;  3IL2 A;  1TQI A;  2XAS A;  1JGS A;  3DPT A;  5LGN A;  3LWF A;  2VE9 A;  5DD4 A;  1HKS A;  4BYY A;  2XGX A;  3KP4 A;  1XDS A;  2ZNZ A;  4OIN F;  5L3F A;  5TRD A;  5LRR A;  1XD7 A;  2O61 A;  1ON1 A;  3E5Q A;  3WGG A;  4HV6 A;  2F5F A;  3E6D A;  1BN5 A;  1ZYR F;  3KZY A;  4PZJ A;  2PN6 A;  3F6V A;  4I7H A;  1I1G A;  4YIF A;  3ZQ7 A;  2KRF A;  1KQ9 A;  3LST A;  3MQ0 A;  1MGT A;  5K5O A;  4KFC A;  5D4S A;  4HX7 A;  4M73 A;  2CQK A;  1SFE A;  1G3W A;  1B9M A;  3DF8 A;  4CO8 A;  2OAZ A;  3KZZ A;  3FZV A;  4G6D A;  2EA2 A;  1IF1 A;  2JPB A;  1XGO A;  2JRT A;  3BP8 A;  1F5T A;  1YS6 A;  3T1B A;  5E8G A;  3ZN0 A;  3DP7 A;  4OMY A;  2WTE A;  5E1Z B;  3BJA A;  4RAY A;  1Z1D A;  2M5W A;  3M1E A;  2DW4 A;  1J59 A;  1YO5 C;  1U6G A;  2CGP A;  1G3Y A;  4BHC A;  1W4M A;  1DDN A;  2RVC A;  3LA7 A;  5HDN A;  4G6Q A;  3D5L A;  2MLK A;  3E6M A;  3HRM A;  3H3U A;  3WTW C;  4IPA A;  2D1H A;  4ETS A;  1YS7 A;  3KEO A;  4FHT A;  1OYI A;  2FQ3 A;  2DK8 A;  4L9J A;  1B4A A;  2ELH A;  1BM9 A;  3DFG A;  3T5X A;  2E1N A;  4S04 A;  2LKP A;  3HIF A;  1RNL A;  5DCM B;  4M6X A;  4Q4Z F;  2ZCW A;  4S05 A;  3C18 A;  3H92 A;  2FNA A;  3IHU A;  5CVJ A;  4F7Z A;  2BYV E;  3RI4 A;  3F22 A;  2GWR A;  2L01 A;  1JXS A;  3K9T A;  5AON A;  1S8N A;  3ERE D;  1XSD A;  3QU6 A;  1BIB A;  4PCQ A;  2Z33 A;  4ENN A;  5EEG A;  4L5J A;  3J80 Z;  2P6S A;  3EUH A;  1LEB A;  2P5L C;  3Q5F A;  4KYW A;  1ZAO A;  3BJO A; 
#chains in the Genus database with same CATH topology
 5CVR A;  1MZB A;  2IS1 A;  2AXT C;  3K0L A;  4U7B A;  2JQ7 A;  1H89 C;  1OCO H;  2OQR A;  1JT6 A;  4I0B A;  3BZC A;  2WAQ A;  2YR2 A;  1ETV A;  3I53 A;  4P9U A;  3G4S I;  4A2U A;  4BEH A;  4A93 J;  3K4N A;  4FAS D;  2D5V A;  4GO1 A;  1NTC A;  3PFY A;  4G94 A;  4M6V A;  4G9Y A;  1TT5 B;  1EH7 A;  2KHM A;  1R5G A;  2HS5 A;  4JK1 X;  6PAX A;  3FX3 A;  2OTJ I;  4XN3 A;  1JUS A;  2XUB A;  3U9G A;  1UG0 A;  4MTD A;  2OPT A;  4IJA A;  3RKQ A;  1HDP A;  4KIC A;  4AUX A;  1R1T A;  4FTH A;  5B1A H;  1DP3 A;  1YX3 A;  1HLV A;  2UWM A;  3CO6 C;  2HOA A;  3CLO A;  2DOF A;  5LLQ A;  4J01 A;  4DZP A;  4ZZL A;  2M4K A;  1I50 J;  5D5X B;  2FXA A;  2A5W A;  1Q1V A;  3U1K A;  2XRL A;  2Y0S N;  4E7S A;  2JA7 J;  4FET A;  4ZDL A;  1QO0 D;  4M71 A;  1R49 A;  2HDD A;  5D4R A;  3PO2 J;  4GXO A;  1BJA A;  2I8D A;  1J0R A;  1WJA A;  4I01 A;  3PM1 A;  1HST A;  3RQI A;  3EUK L;  2L2O A;  2L4M A;  1OCT C;  4KMU X;  4A0Y A;  1LQ1 A;  1U5T A;  3H9G A;  3M07 A;  5BOX A;  5CVV A;  2FOK A;  2FF4 A;  5DCM A;  5D8K B;  5IT9 K;  2Z2S B;  2DMU A;  5E3L A;  1YYV A;  4EJO A;  1T95 A;  4YEJ A;  4XOP A;  4B44 A;  4NBQ A;  5DUI A;  1P92 A;  1FOY A;  5KVR A;  3RJP A;  2DO7 A;  2K5C A;  1JKQ C;  2BZT A;  2HVS A;  2OCE A;  4KDP A;  2LLK A;  3I59 B;  4PJJ A;  3SDB A;  3JRD A;  4FQG A;  3HGY A;  1T39 A;  1K4T A;  2M7A A;  2TCT A;  4LJZ F;  3HSR A;  2W7N A;  2OZ6 A;  3GW2 A;  1R58 A;  3BG7 A;  1W0T A;  1MNM C;  2FBI A;  2HXO A;  1NH3 A;  2P5V A;  3M3Y J;  2FE3 A;  2YX4 A;  3GYH X;  2JWT A;  3BR1 A;  4OMZ A;  1JJ6 C;  4YII A;  3KFW X;  1SC7 A;  2X1C A;  1E3O C;  1ZG5 A;  2R93 J;  4O6J A;  1SVL A;  4B09 A;  4L18 B;  2DMP A;  2BOL A;  3K2Z A;  3GZ5 A;  3V42 A;  1I3Q J;  3RPQ A;  2V9V A;  4D9J A;  1GUU A;  2H6B A;  5EZH A;  2VXZ A;  2E2I J;  2STT A;  1JI8 A;  2KMU A;  2E60 A;  4EV0 A;  3FF5 A;  2MSY A;  2P7V B;  5BMZ A;  5K5Q A;  5B5E C;  1VQM I;  4W1U A;  4B3X A;  1Y39 A;  3S15 J;  4KIF A;  3REO A;  3ABU A;  2FA5 A;  1LPQ A;  2ZME A;  1EV7 A;  1SD7 A;  2P4W A;  5HS7 A;  4OIP F;  4EQQ A;  3CDH A;  1R5H A;  3G71 I;  4E7H A;  5D5V B;  2HWV A;  3K4B A;  1B72 A;  5FKL A;  1IW7 F;  3OYJ A;  1ZN2 A;  2V7F A;  4LGW A;  5LFA A;  4PJM A;  2Q2E A;  3RKW A;  1LFP A;  2HTS A;  2RV8 A;  5J6X A;  3LAP A;  1PUF A;  1X1B A;  2HYJ A;  3PFI A;  2EFQ A;  3K10 A;  2FBH A;  2W82 A;  1VQ9 I;  4Y15 A;  2YS9 A;  3A03 A;  4XRM A;  1BR1 A;  4RS8 A;  4XRF A;  2M8E A;  4A3K J;  2R3S A;  3GZN B;  2M4G A;  2IA2 A;  5HVQ C;  3MZY A;  3W2V A;  1XMK A;  1P7I A;  1OYW A;  2QM3 A;  2AHQ A;  4AVZ A;  4PDK A;  1FYL A;  3JRE A;  3BPV A;  2L9V A;  4IZZ A;  3KCC A;  3LAJ A;  1XGS A;  2R7Q A;  2KJB A;  2LVS A;  3L09 A;  1FBQ A;  1ETW A;  3RDI A;  2FMY A;  2LYC A;  2Z99 A;  4PSX A;  4Z2Y A;  4CGZ A;  4XLC A;  4AIH A;  4OWR B;  2MW8 A;  4NC6 A;  4FE7 A;  2IPQ X;  3BZK A;  3G6E I;  1FBS A;  1DGR M;  2HXI A;  4I09 A;  4XMY A;  3MMY B;  2O7O A;  1WRJ A;  3ECO A;  3CP2 A;  5LHI A;  2ACJ A;  2OTL I;  1R1U A;  3VOE A;  2DFF A;  2V1X A;  1H0M A;  2VBY A;  3HOU J;  1WZ2 A;  3F8F A;  3Q9S A;  1YW7 A;  3R61 A;  1OPC A;  2M45 A;  4RMN A;  4ZYA A;  1OCC H;  5IP9 J;  4RB2 C;  3QRF F;  1AA7 A;  4X1E A;  5CQE A;  2VXD A;  4KA4 A;  2X6W A;  5E1W A;  3HOT A;  1IRF A;  1MBK A;  5BNG A;  4NDL A;  3A01 A;  3IKT A;  3GTG J;  2VPR A;  2M0M A;  2OBP A;  4DGW B;  3GFI A;  2R7V A;  3V8J A;  1MJA A;  3OS0 A;  1XSX A;  1VQN I;  3OYB A;  5LGT A;  1V54 H;  2CH0 A;  1FTT A;  2FUG 2;  2MBF A;  3DBH B;  1D5Y A;  2FU4 A;  2FBK A;  1J9I A;  1W7P A;  1TW2 A;  2IA0 A;  4XLE A;  3HTU A;  4RGS A;  1X1A A;  1YW8 A;  4X0G A;  3TKY A;  3WTS C;  5DUK A;  5CVI A;  1PP8 F;  2E5Z A;  1GT0 C;  3GO5 A;  3DKW A;  2CQ7 A;  3COA C;  2ELK A;  2XGD A;  5KK1 A;  1TWC J;  2R7R A;  1WPK A;  3FHN A;  2R5Z B;  1G3T A;  3D5R C;  3DLA A;  3WTZ A;  2M0C A;  2KL4 A;  1IXR C;  3IH4 A;  3TBI A;  4AVP A;  1IN8 A;  2L54 A;  4QTR A;  1AKH B;  1T0F A;  1PUE E;  1FSE A;  1M1E B;  1FC3 A;  2HDW A;  2M2E A;  3WE2 A;  1ZH5 A;  2DFE A;  1S7A A;  1TW3 A;  4MQV A;  4C3J J;  4O5V A;  4BGD A;  5HNF A;  2JT1 A;  2IVM A;  4HSR A;  1WI3 A;  3CCJ I;  2DOA A;  2IA1 A;  3C2G A;  1KU2 A;  3ZPL A;  2KIQ A;  1DQU A;  4JX6 A;  1STZ A;  1K78 B;  4F91 B;  2XAG A;  5IT3 A;  3SZT A;  1K61 A;  2Y2Z A;  1VQ6 I;  2IGM A;  5M3F J;  4V19 K;  3WOD F;  2E71 A;  3V8L A;  1U8R A;  4BAY A;  3CCQ I;  1XN7 A;  5LBQ A;  2IBD A;  2IGK A;  4ENJ A;  1VQO I;  1SAN A;  2BE5 F;  4KJZ A;  2W48 A;  4HLY A;  2VL8 A;  4H4K C;  1MJ9 A;  4CHU A;  4XKW A;  3J80 K;  4XRS A;  3F9K A;  1E3H A;  3GWZ A;  2KIM A;  2WY7 Q;  1GVD A;  3S93 A;  2CV2 A;  3CCL I;  2A61 A;  3SFI A;  2VKE A;  3EUH C;  1IV8 A;  3FM3 A;  3A2K A;  1FNN A;  4WXC A;  3L2Q A;  5D6E A;  1YE9 A;  1Z21 A;  1B6A A;  2KLO A;  4IF4 A;  2A6H F;  1YRN B;  3K4K A;  2HOT A;  2DQL A;  5C3E J;  3ZQC A;  5F04 A;  2DT5 A;  1ZLK A;  2Y48 A;  2GXB A;  1T33 A;  2CW7 A;  3H36 A;  1W5C C;  2Y0M A;  3BWG A;  5DM6 F;  1BI3 A;  3HHG A;  1X19 A;  3C7J A;  2KRC A;  4M9X A;  4MO7 A;  1IG7 A;  4A3E J;  1KYZ A;  4OOI A;  3G73 A;  2L5Q A;  1W1W E;  2Y31 A;  2NVU B;  5E3O A;  3BR2 A;  3FKJ A;  4R8H A;  4DZJ A;  2QEX I;  1NG6 A;  1Z0X A;  2KP6 A;  4LLG F;  1YFH A;  2AXL A;  1TWG J;  5GAE J;  3OR2 C;  3E5X A;  2RNJ A;  1EH8 A;  2K4B A;  3F0C A;  3TDU C;  4M74 A;  5CYV A;  2CQN A;  3G3Z A;  2ISY A;  2K86 A;  3W6V A;  3E3V A;  1D8K A;  3LA3 A;  2J5O A;  2LNB A;  4HPQ A;  5JVT A;  4I76 A;  2QA4 I;  1NK2 P;  1UAA A;  4CCM A;  2BXY A;  1PP7 U;  2HPI A;  2DYS H;  1R7J A;  1T56 A;  3CUO A;  2BHZ A;  3QOE A;  5DS9 A;  1ENH A;  3O6B B;  2DK5 A;  3GFM A;  3N4M A;  4D5C A;  3WGI A;  1FY7 A;  1TC3 C;  1WFX A;  2F5D A;  4BBR J;  4DW6 A;  1E3P A;  1O3T A;  2H94 A;  4DIQ A;  5HS8 A;  1YIT I;  3ABT A;  2E35 A;  4M3G A;  1P9Q C;  2G7H A;  2H1K A;  2VUM J;  1IRG A;  2BW3 A;  3DTI A;  1U5T C;  3KYL A;  2NS0 A;  5CLS A;  2L9R A;  2PI0 A;  1U9N A;  1FMV A;  1O3Q A;  1XG1 A;  1Z9C A;  1XPX A;  1CQT A;  4MNU A;  5FLV A;  2K4J A;  1AWC A;  1CGP A;  3GCM A;  4B3A A;  2MYS A;  2OJE D;  5DDG A;  3JRI A;  4HF2 A;  2XSJ C;  1RKT A;  3I4N J;  1RPW A;  2XRO A;  3IV5 A;  1WH5 A;  1MJB A;  2VC1 A;  3LFK A;  2F2E A;  3VSL A;  3C1D A;  3LSH A;  5DM7 F;  4E7I A;  1RUN A;  4IQJ A;  5DV5 A;  2QLZ A;  1QHG A;  4ZZD A;  3GF2 A;  4E4H A;  3G1L A;  3KP6 A;  2EB7 A;  3OIQ A;  1K78 A;  2XPU A;  3F8B A;  4DJA A;  2L0K A;  1J75 A;  1BOA A;  3RCO A;  3TOA A;  4WCG A;  2NS8 A;  3KLO A;  3OYG A;  4A12 A;  1ZR4 A;  1WQ2 A;  4B43 A;  4G7O F;  1MBG A;  2B0L A;  2WV0 A;  3E1S A;  4M3B A;  2H8R A;  2HOE A;  3BY6 A;  3FXR A;  3GZ6 A;  1XMX A;  3M4O J;  2ESH A;  2HTJ A;  1ZAR A;  2JA5 J;  1UZC A;  2V6C A;  3ABK H;  2QKL B;  3OL4 A;  3B02 A;  1REP C;  3L00 A;  2V1U A;  3HOS A;  3CC7 I;  1E2X A;  2K02 A;  3K1P A;  5EF6 A;  2WBM A;  2X1D A;  4BL0 B;  4V2F A;  3Q3S A;  2L3D A;  4BQQ A;  9ANT A;  1IAW A;  4BXF A;  2QQB A;  1S9H A;  4OAY A;  3ZMZ A;  2M8G X;  3PNV A;  5M5X J;  2V9K A;  2MC4 A;  3WTV C;  2EBI A;  2ZME C;  2VI6 A;  1S6L A;  2Z9O A;  1X1D A;  2DDA A;  1E0E A;  1DPU A;  2ZFU A;  3I3L A;  5ILS A;  4A6E A;  1MMA A;  3OYI A;  3HL2 A;  2ID3 A;  2M34 A;  4I99 C;  2K3F A;  4P1W A;  1ETX A;  2LY9 A;  5H6Q A;  1QVU A;  3CLQ A;  4IEJ A;  4EM2 A;  4M6Y A;  1MSE C;  4IQ4 A;  2VJ5 A;  1U2W A;  4II3 A;  2Y9Z A;  2NVT J;  3CME I;  2VKD A;  1IGN A;  1FMW A;  4AC0 A;  2O03 A;  2HQN A;  2Y0S A;  3RQ4 A;  1Z7U A;  2XGE A;  1G8X A;  2XIG A;  5D5W B;  3I5U A;  5F1J A;  5K7F A;  3D5S C;  1MBH A;  3OYL A;  3JRA A;  4JBA A;  5HDK A;  1D0X A;  4H0E A;  3EPZ A;  2CWE A;  2VJJ A;  3HHH A;  1VQL I;  3JR9 A;  2QKM B;  3QPL A;  2GLO A;  1QGP A;  4BE1 A;  2KIF A;  5E17 F;  3CJR B;  2VKH A;  3LA2 A;  3CMY A;  3RZD J;  1QZY A;  1KGS A;  3ZMU A;  1SFO J;  4IXA A;  1DU0 A;  3VPR A;  2HR3 A;  3JSP A;  1TBX A;  3BRO A;  3SEZ A;  3KET A;  4A3L J;  4UUV A;  3QP6 A;  5A2Q Z;  5KAF C;  4ZDO A;  1MH3 A;  2E7W A;  3FBI B;  4XBF A;  1FEX A;  5J4Y A;  3S32 A;  4U88 A;  1ETQ A;  3K1M A;  3KP7 A;  3MAJ A;  5GPC A;  5L3B A;  2O9L A;  4U0V A;  2M30 A;  4MGR A;  1VQ8 I;  1SEU A;  3ML6 A;  2WAD A;  3HOX J;  2X85 A;  3OS2 A;  1WJD A;  3T8R A;  2H27 A;  2JSC A;  2JVH A;  3E97 A;  3WE3 A;  5HNH A;  1XGN A;  1T08 B;  2L02 A;  1D0Y A;  2GM4 A;  2KZV A;  1LB2 A;  4BHP A;  3MEX A;  3HC7 A;  4CA0 A;  3S1R J;  1B1B A;  1YI2 I;  5BPD A;  2YU9 J;  1LVA A;  1P6R A;  2BVL A;  4AID A;  1JJ8 C;  3JW4 A;  3ECH A;  3M8F A;  4QLC U;  3ZMS A;  2HU9 A;  1Z77 A;  4XID A;  2LD5 A;  4FX4 A;  2CV1 A;  3HEF A;  2ID6 A;  2R7D A;  4EEF G;  2PJR B;  4CCL A;  1OR7 A;  5E8I A;  1GV2 A;  5EEA A;  5FGM A;  2NRA C;  4ZYG A;  3VYU B;  5FFX A;  4PJL A;  2PJP A;  3CF2 A;  4ENM A;  2WC2 A;  2UV1 A;  3EYY A;  1QQI A;  3C2B A;  4OIQ F;  1IDZ A;  1HSJ A;  4BH9 A;  5ILV A;  4NQW B;  1OMI A;  1RIO H;  3HSE A;  4ZYD A;  3MKZ A;  1QBJ A;  2P0W A;  1TZL A;  1VF9 A;  3N97 A;  1KU9 A;  3HRT A;  3CMA I;  2COB A;  1P4W A;  3MKY B;  3FMS A;  2DBB A;  1D0Z A;  5M5W J;  4DYR A;  2OQG A;  4FCY A;  1ZRC A;  4E7J A;  1R4M B;  1T0F C;  4C2U A;  4CYC B;  2HDC A;  3Q0W A;  4NNJ A;  2GXG A;  2LY2 A;  4GFB A;  2KDZ A;  1AU7 A;  1WJF A;  1CF7 B;  4ASN A;  2R5Y B;  5F1R A;  2BY1 A;  2VLA A;  3DEE A;  1XGM A;  4XNF A;  1YJW I;  1C0W A;  2QBY B;  2Y75 A;  2IP2 A;  4XLF A;  5HDG A;  4KIS A;  4CDG A;  2O3F A;  4L5I A;  5AIP A;  3I55 I;  3LQQ A;  1R36 A;  1X1P A;  2HQA A;  4CCJ A;  1MBE A;  5E18 F;  4EAT A;  1TQM A;  4LK1 F;  2ZJ2 A;  4UB6 C;  5CJ9 A;  4A3M J;  5HLH A;  1LJ9 A;  3I71 A;  2FOW A;  2KRH A;  2NOG A;  3OMY A;  3PNY A;  4LFU A;  4PGH A;  1ZGW A;  2R7T A;  3BQY A;  2XGC A;  4XRS G;  5ICC A;  3W2A A;  2D2W A;  1UHM A;  3KP3 A;  5F6F A;  2CU7 A;  4DOZ A;  4MIM A;  2F5C A;  2HI3 A;  4KNY A;  3L1P A;  2W1O A;  4MTE A;  4HDV A;  1SFK A;  3H3Z A;  2QQ8 A;  1X1C A;  4V2G A;  5ICG A;  3SDG A;  3PIO F;  2G7U A;  2HNH A;  2EZK A;  4IVN A;  2JZY A;  2VBX A;  4WXH A;  4AD9 A;  4BU2 A;  1F1Z A;  1K7A A;  2ISZ A;  2VQC A;  3NWT A;  2JTV A;  1MNE A;  3H9Q A;  1FSH A;  3BR5 A;  1NHA A;  1VZ0 A;  4XKC A;  2DOE A;  3P7N A;  4CYD A;  3FXQ A;  2VT2 A;  5J47 A;  1A6I A;  2HQR A;  1FOW A;  2PMU A;  1L3L A;  2NVX J;  3RYR A;  2P8T A;  1TWA J;  1IO2 A;  3DXJ F;  4G12 A;  5EYR A;  4FIS A;  5FRN A;  4MHG A;  3GTJ J;  3FXJ A;  4A5M A;  2BHY A;  3KZI C;  1KU7 A;  3BG5 A;  2W4S A;  3K4M A;  4F52 A;  2LG4 A;  3QPH A;  4AYB N;  3ZP5 A;  3HRU A;  2WA0 A;  4C3I J;  2HPM A;  4UB8 C;  4BS9 A;  4G7Z F;  1UEL B;  4XKB A;  1KA8 A;  2D1V A;  2F4O B;  3BR6 A;  3F21 A;  1IN5 A;  3VB2 A;  3SXY A;  5F64 A;  2RGV A;  2MAB A;  1D1C A;  4ZTJ A;  3V7R A;  1QRY A;  1RZ4 A;  1Y0N A;  2MH9 A;  3B73 A;  3OOP A;  2VBW A;  3HG9 A;  3CCV I;  4TV7 A;  5FLX K;  2O8K A;  1F9N A;  2NNN A;  2RDP A;  1D1B A;  1Y56 A;  3OYC A;  1T2K A;  3NQO A;  1B9N A;  2BBY A;  5E20 A;  4JOM A;  4UV9 A;  2ETH A;  4F55 A;  1H9T A;  1K6O A;  2BXZ A;  4M9S A;  2IAI A;  4B8X A;  1I27 A;  1JHH A;  4N9I A;  3W2W A;  3G1O A;  1ON2 A;  3D0S A;  1XC5 A;  3ABL H;  3SEQ A;  4WX9 A;  2EFP A;  3J7A O;  1ZQ3 P;  3GTL J;  2MA3 A;  2EV6 A;  3CO7 C;  5B1B H;  3S17 J;  3OS1 A;  3W3C A;  1QZE A;  3IH3 A;  4IHT A;  3LSP A;  5FKK A;  4HRI A;  1HW5 A;  3I9V 2;  1S5L C;  1X3W B;  2PEX A;  3L7W A;  3RKY A;  2CS3 A;  3LNQ A;  4L0Z B;  3JAM Z;  2EJR A;  4HYE A;  4RLQ A;  1S29 A;  3I58 A;  4RB0 A;  3QYF A;  2ZO4 A;  2QVO A;  1TWH J;  1Q1H A;  4A3D J;  4XK4 A;  5HLT A;  3QU3 A;  3SZP A;  5JHU A;  2WWY A;  2GA2 A;  2VT3 A;  3DEU A;  4HF0 A;  3QAH A;  5H6R A;  4XLN F;  4J19 A;  3ZMT A;  4I6Z A;  2A3S A;  2LY1 A;  1BI2 A;  3GTO J;  1PDN C;  3DU6 A;  1LDK B;  1WVR A;  2CQX A;  3OYD A;  1BIA A;  1JHF A;  2R5Y A;  1CF7 A;  1JTY A;  4HW0 A;  4L0Y B;  5BS6 A;  2HFH A;  2Z3Y A;  1HW1 A;  1OKR A;  2L7M P;  3H3V K;  2ZXJ A;  2KKO A;  1KYW A;  2ZXI A;  1AHD P;  1JUP A;  1GXQ A;  1MDM B;  4OIR F;  2K9L A;  1PYV A;  2DLL A;  3HKZ A;  3LMM A;  2OF7 A;  3K4L A;  4FX0 A;  3HTS B;  3M7G A;  2GIV A;  3FIS A;  2CSO A;  3UR3 C;  4IHV A;  1JKR C;  3NWS A;  4FT8 A;  4WF2 A;  4X6A J;  1WJB A;  3AKZ A;  2FSW A;  5B66 C;  2A68 F;  5FD6 A;  1POG A;  1MND A;  5EZG A;  4BXX J;  3KEY A;  1Z3X A;  2QEN A;  2W25 A;  1ETK A;  2FJ1 A;  2NVY J;  4LG0 B;  5D8L B;  2HYF A;  2QSH X;  1V4R A;  3VOD A;  1YJN I;  2EV0 A;  1G59 A;  3EYI A;  2YU3 A;  3S14 J;  2HOS A;  2JJ7 A;  3P9I A;  2IS4 A;  1ORK A;  4E7Z A;  2R7W A;  2XDV A;  4NC7 A;  5L3D A;  3U21 A;  3BG9 A;  3RZO J;  4PJN A;  2CRG A;  3CQZ J;  2GAU A;  3P9K A;  2ZFW A;  1XB4 A;  2VQL A;  3KIO A;  4KT5 C;  4KN7 X;  2RQP A;  5FJ8 J;  1JKO C;  3PNT A;  3CF5 F;  3H35 A;  2J5P A;  2EFW A;  4AIJ A;  5D6F A;  1VQP I;  1JGG A;  1XDU A;  3I4P A;  2DA3 A;  1BC8 C;  4UUS B;  1RRJ A;  3HJE A;  4BJT A;  5LRS A;  1P7J A;  5EGO B;  2EZH A;  5DTD A;  2DTZ A;  3CJN A;  3GFL A;  5JVG F;  3O2P E;  4M9Z A;  5LGU A;  1K6Y A;  5EG0 B;  1TWF J;  1PVE A;  4BE2 A;  1X4P A;  1LVK A;  2QWW A;  2STW A;  1RC9 A;  2E7X A;  3ZQH A;  2ZJQ F;  5HS9 A;  2V79 A;  2CO5 A;  2DA5 A;  2DYR H;  3R4K A;  1UHW A;  2X6X A;  4LIV A;  2DTR A;  2MD5 A;  3L2U A;  3ZQL A;  1FTZ A;  1ODD A;  4EGY A;  4G6T B;  1IUY A;  1NG7 A;  3J7A Y;  1IN7 A;  1IV6 A;  5A2Q K;  5ED4 A;  4GCV A;  4HEA 2;  4RGU A;  3BR0 A;  4PJ0 C;  4WWC A;  1MMD A;  2COM A;  2EFO A;  2P5K A;  1QU3 A;  1Y0U A;  3CUQ B;  2YUS A;  2A05 A;  3I59 A;  3MZH A;  2LF8 A;  3G2B A;  1JTX A;  5J8C A;  1MKM A;  3CES A;  1JUM A;  3UKG A;  2UUZ A;  4A69 C;  3S1Q J;  2H1L A;  4L5E A;  4A3F J;  2Q0O A;  2O0Y A;  1AOY A;  1R5I D;  2W24 A;  4BKX A;  1LKX A;  1MD0 A;  1LEA A;  4Y13 A;  4HLX A;  3GFJ A;  1YX5 A;  1OCZ H;  1W7P D;  2PBI A;  3KPH A;  2V9P A;  2AO9 A;  1Y8Q B;  2O8X A;  1RR8 C;  3F8N A;  1Y1W J;  1HXD A;  3SYT A;  2RRE A;  4XLP F;  4RLF A;  5H20 A;  3BDD A;  1VTN C;  1WJC A;  4JX4 A;  1HKQ A;  2L7K A;  3U1D A;  2E1O A;  3K70 C;  4BY7 J;  3NRV A;  4HV5 A;  2HKX A;  1OR7 C;  5J1R A;  2PMZ A;  1MBF A;  4HQE A;  4XL9 A;  2LK2 A;  1UMQ A;  1Z7L A;  1BI1 A;  2GOX B;  1R71 A;  4GGG A;  2DT7 B;  2RAE A;  2W85 A;  1G6N A;  3FIW A;  4M72 A;  3OY9 A;  1YJ9 I;  2UXX A;  2XHK A;  4PK4 A;  3SHF A;  5FB2 A;  2MD0 A;  4RGR A;  2IS2 A;  2E1M B;  1BW5 A;  2EA4 A;  1VFC A;  3E7L A;  4UNO A;  2NVQ J;  4E7L A;  3HOV J;  4A3C J;  2ZSI B;  1Y6I A;  4QIW N;  3N05 A;  4XLH A;  1IN4 A;  1W0U A;  4XOT A;  1FYM A;  3OWT A;  1HC8 A;  3ZOB A;  5L3C A;  3J81 K;  1IZ1 A;  1O7F A;  2E5N A;  5GPA A;  3MCZ A;  2XPV A;  5F0H A;  1XCV A;  1SVO A;  5F27 A;  4NUB A;  2R7O A;  3ASN H;  5DCF A;  3QOP A;  1H88 C;  2VC0 A;  3JRH A;  3M8E A;  3WG9 A;  1ZR2 A;  4IHY A;  2XAU A;  3H0G J;  4GYI A;  3ZMD A;  4XIC A;  1ACI A;  4CSW A;  3WU2 C;  3BC8 A;  3BZ6 A;  1IXS B;  3AG3 H;  1G2H A;  3G1M A;  5JR3 A;  4LIT A;  2MH2 A;  5JLX A;  3OYH A;  1QZZ A;  5ICF A;  4ZDP A;  2GQQ A;  4D7M A;  2LKS A;  2EIJ H;  3PSF A;  1O7L A;  1HW2 A;  3WTT C;  1Z3Y A;  2IJL A;  3QQA A;  5C4X J;  4O3M A;  3ZN1 A;  1DPR A;  1Z6T A;  1SD6 A;  3L2W A;  2ZC2 A;  3MFK A;  4UHT A;  4ENK A;  4ZH4 F;  1YTY A;  1SMT A;  2RC4 A;  1TQP A;  5EG0 A;  1DGW Y;  3OIP A;  2WAF A;  4UVB A;  4P96 A;  4R1H A;  2Z5U A;  1D3Y A;  2QYO A;  3CCM I;  3KE2 A;  2PMH A;  3E6C C;  2NNY A;  4ESB A;  2EPF A;  1IC8 A;  1BR2 A;  2EFN A;  4MFD A;  2GXA A;  2A69 F;  1L0O C;  1J7K A;  1BBY A;  2L7Z A;  4IKF A;  2L9N A;  1I1S A;  5FLX Z;  3OSF A;  3I0T A;  3BTJ A;  3F72 A;  3Q0U A;  3DU5 A;  3ZQI A;  1ZG3 A;  2K27 A;  3OOU A;  4BQN A;  4C9Y A;  5KNL A;  2XAH A;  1K79 A;  3AG4 H;  5K7Z A;  3KX2 A;  3JCU C;  2AQF A;  3FWE A;  1V3F A;  2DU9 A;  3HDD A;  1OYY A;  1YOV B;  1LDD A;  3TGN A;  3CCR I;  3VDX A;  1KQ8 A;  5K1Y A;  2UZK A;  2Y69 H;  4RGX A;  4ITV A;  2K40 A;  1J5Y A;  4IOC F;  2DPU A;  3OYF A;  3WU1 B;  1U9O A;  3DPL C;  2WB1 N;  2JMW A;  2R5Z A;  2BV6 A;  2OD5 A;  3JTH A;  5FKO A;  1Z05 A;  2A6T A;  3CMM A;  2IRF G;  1AKH A;  1FWZ A;  3DKY A;  3WTX C;  5HOD A;  4PGG A;  1BL0 A;  3NAR A;  2QQA A;  3FM5 A;  4HNV A;  2HEO A;  3OYA A;  3GEZ A;  3IRQ A;  2L7F P;  4NC8 A;  2OC6 A;  1TLH B;  2ESN A;  3GBG A;  2NXN B;  3ULQ B;  4HBL A;  1U0J A;  1W36 C;  5L3E A;  3JAM K;  1RES A;  3IRR A;  1R22 A;  3A02 A;  2C6Y A;  3IAS 2;  3RPU A;  1J09 A;  3SFZ A;  5J3L A;  2DDB A;  4MFE A;  3R0J A;  4YFK F;  4L9V A;  4N0B A;  4HQM A;  1T38 A;  3HSF A;  3FMR A;  2DMQ A;  4RB1 A;  2HZD A;  3RYP A;  3HYI A;  3BG6 A;  3ELK A;  1JE8 A;  1SFX A;  4OU0 A;  1USS A;  3F8C A;  4ESF A;  4RAG A;  4KN4 X;  2Q8K A;  4ON0 A;  4CCN A;  3R60 A;  2CUF A;  2ME6 A;  3LSK A;  4F92 B;  1V5E A;  1ZKG A;  4XLA A;  1IXC A;  3MZ8 A;  3K6G A;  2EIM H;  4Y7N J;  1ZG1 A;  2X6O A;  2Y30 A;  3RTR A;  3TDZ C;  1ZGJ A;  3I4M J;  1YQA A;  4QWQ A;  3CCY A;  2DOD A;  2F4I A;  4B47 A;  1YRN A;  2V1D A;  3R6S A;  3JSO A;  1ITY A;  3AL0 B;  1Z91 A;  1LFB A;  1MH4 A;  2L9S A;  3KYD B;  3DPU A;  3S16 J;  1N77 A;  3BTC A;  4UV8 A;  2LRE A;  2ZBK A;  4OIO F;  5LEK A;  1ETO A;  2OUM A;  3F23 A;  3PSI A;  2NYX A;  1D8J A;  3BJ6 A;  4RA2 A;  1GXP A;  2VON A;  3WU0 A;  2X6Y A;  2XV4 S;  3A1Y A;  4Q48 A;  2QQ9 A;  3V7S A;  4P55 A;  3CZ6 A;  4F93 B;  4ZTF A;  2KIS A;  2LSO A;  4IX7 A;  4AYB A;  1WSU A;  4E6K G;  2F5E A;  2VB6 A;  3S1M J;  4RM3 A;  4IRG A;  2LKX A;  3U2R A;  2Z1D A;  2XB5 A;  3M1C A;  5IOY A;  3S2H J;  5IP6 A;  2LOO A;  1XX5 A;  2F48 A;  4BEH B;  3CJQ B;  2DI3 A;  4PSW A;  1QA6 A;  3BG3 A;  3LSJ A;  4UXN A;  4GYG A;  2X48 A;  3X2Q H;  3S3M A;  3DTE A;  3GVA A;  2FD5 A;  2ICW G;  3T0Y A;  4KMF A;  4BY1 J;  1P4X A;  2EZL A;  4UVC A;  2CG4 A;  3HM5 A;  4GRI A;  3QP5 A;  2QF7 A;  4EGZ A;  2XKO A;  5FFZ A;  2UXN A;  1LNW A;  2FML A;  5C44 J;  1QNT A;  3M9A A;  4DYC A;  2QZ8 A;  4KT6 A;  5D5U B;  1GVJ A;  2LDU A;  3M8J A;  3J7Y J;  3O8G A;  2HVR A;  5J8F A;  1I39 A;  3C3W A;  4LOC A;  3QYE A;  3L2V A;  2FX0 A;  3IAM 2;  4ESJ A;  4U0Y A;  4ANJ A;  1W5T A;  1KZH A;  5HOO A;  2DAO A;  1X2M A;  2LTP A;  4BDY A;  5ICE A;  4RDU A;  3I54 A;  1HQC A;  5LHH A;  1Y1V J;  3MD2 A;  1DU6 A;  1UG2 A;  2BY0 A;  3BT9 A;  2KZG A;  3LSR A;  2X9D A;  1WI9 A;  3LQR A;  4C3H J;  5GAH J;  3ISP A;  1T6S A;  1HBX G;  3MN2 A;  4Y3O A;  4YFX F;  5H2F C;  4I0A A;  4EM1 A;  2PG4 A;  3DLL F;  2DN0 A;  2KQR A;  1U5T B;  1OCP A;  1FPQ A;  4D0P A;  1LFU P;  3CCS I;  3DBR B;  2ADU A;  1ZRF A;  3PUB A;  2EWN A;  1HKT A;  2XAJ A;  2H6C A;  5K5R A;  2MLG A;  2B63 J;  2JPC A;  1FJL A;  2JUG A;  2XF6 A;  1VQ4 I;  4R79 A;  2H09 A;  2K3P A;  2WAE A;  2LF7 A;  4ZYH A;  4A3J J;  2DA7 A;  5IYC J;  1OLT A;  2M1B A;  2M9H A;  3PUF A;  1I5Z A;  2VOP A;  1R9T J;  2VBZ A;  1MIJ A;  3TO6 A;  2GOM A;  1G4D A;  2W84 A;  1SD5 A;  5GAD J;  5IOZ A;  3SQN A;  2R7S A;  5FD5 A;  1MSF C;  1OFC X;  4RBO A;  4D5F A;  3MVP A;  4PFO A;  4WK8 F;  3E5U A;  1A35 A;  3OR1 C;  3WHC A;  5DYM A;  1X4O A;  3J81 Z;  1TL8 A;  1UCR A;  4BJ6 C;  5ILU A;  3I56 I;  2LH9 A;  3L2C A;  1FYK A;  2FRH A;  1TT0 A;  2HGC A;  3W6J B;  5FRM A;  2XRN A;  1O4X A;  1IJW C;  3ASO H;  3PQJ A;  2YX7 A;  3A0B C;  2CFX A;  2EV5 A;  1FIA A;  2W00 A;  4IHW A;  2XKP A;  2RKH A;  4HOB A;  3S3O A;  2GZW A;  5HLI A;  3EET A;  4MQ9 F;  4MEY F;  2OV7 A;  3EQL F;  3ONQ A;  3VEP A;  2QUF A;  3BTL A;  4WXD A;  5E1X A;  4RM2 A;  4C2T A;  5LEJ A;  3S2D J;  5DD8 A;  3K4C A;  4P9F A;  1FT9 A;  5CVU A;  2XSD C;  2ZME B;  3S2W A;  2L4A A;  5J4V A;  1B72 B;  3LSI A;  5HLG A;  1D5V A;  2P6T A;  1IN6 A;  1WGX A;  4LK0 F;  2VJI A;  3KP2 A;  5JLW A;  4RAZ A;  2K9N A;  2Q2E B;  1LDJ A;  2ZB9 A;  3IKV A;  4YFN F;  3KYC B;  2VAS A;  3GX4 X;  4HX8 A;  1S3J A;  1RI7 A;  1PUF B;  1FBU A;  3K1N A;  1X58 A;  2DJN A;  1UB9 A;  3RSN A;  3ZQF A;  3OYK A;  1YIO A;  4A0Z A;  5IY5 H;  2IGO A;  1MMS A;  4A3B J;  2B9S A;  1APL C;  1UJ8 A;  4Z6Y A;  5EDN A;  3O3K A;  4Q47 A;  4BQA A;  2LR8 A;  2R7F A;  4L9T A;  2QSG X;  1I6H J;  4HA8 A;  4CCK A;  1FX7 A;  1SMY F;  3KLN A;  2IW5 A;  4HDU A;  2A07 F;  4JQF A;  3J7Z I;  1D1A A;  1DUX C;  2CW0 F;  2EIK H;  2MFZ A;  2G0E A;  3BR3 A;  4D7N A;  3TW7 A;  1F43 A;  5AIQ A;  2JK3 A;  2HQ5 A;  3QPT A;  1N25 A;  2VOO A;  1V5G A;  5DEQ A;  4RB3 C;  1G3S A;  1TTY A;  3HOY J;  4BHB A;  1I3A A;  1RKW A;  2VN2 A;  1N78 A;  3IWF A;  4I98 B;  1OQY A;  3CUQ C;  5LD2 C;  2RQQ A;  2GIZ A;  3UNG C;  1ZHF A;  2OA4 A;  3TO9 A;  2VOD A;  1Z67 A;  1U8B A;  4Y4R A;  5ERI A;  2PJR A;  2E1C A;  1ZEL A;  2LBF B;  2OU2 A;  2VE8 A;  1A04 A;  2MGQ A;  2P7C B;  1S7E A;  4U87 A;  1J2X A;  2BY2 A;  3JTG A;  1LUJ B;  1HOM A;  4B48 A;  5JFR A;  3WTY C;  5K7H A;  1U3E M;  3FBN B;  3PQK A;  1A5J A;  1T98 A;  1OIS A;  4EJV A;  1SFU A;  4CH7 A;  4BBS J;  1LE8 B;  3BLY A;  3VFZ A;  3A01 B;  4K2E A;  1KON A;  3IH2 A;  3ABM H;  4LMY A;  4NQW A;  2ZJP F;  4EVI A;  2ZNY A;  3A4C A;  1TNS A;  3A0H C;  1SD4 A;  4B1R A;  1YW9 A;  1W7P B;  2W57 A;  2E19 A;  1TNT A;  1W36 D;  2V6E A;  2BY3 A;  4CYC A;  1R6R A;  4DQ2 A;  3B6A A;  2H8W A;  1E17 A;  1O57 A;  2KT0 A;  4CCO A;  1H8A C;  1GHC A;  4EMS A;  4E70 A;  3V4G A;  1FLI A;  4L9N A;  2F4M B;  3NEU A;  1Y8R B;  5IP7 J;  3IWZ A;  4XSX F;  2TRT A;  5L3G A;  4XQF A;  4N4O B;  4A5N A;  1XMA A;  4KIB A;  3IUO A;  4M3E A;  1UST A;  3SZG A;  4Q5S F;  4QSH A;  2E1M C;  1X3U A;  1KQ0 A;  2M87 A;  4F3Q A;  2G9W A;  1ZRD A;  3TED A;  1PJR A;  1WWX A;  4OAZ A;  1EA3 A;  3FHZ A;  2BGC A;  3F6O A;  3HUG B;  3ZMV A;  4P5O A;  1EJ9 A;  3AG2 H;  4EJT A;  3IP4 B;  2DA2 A;  3DQV C;  4UY8 I;  3Q0V A;  2E2H J;  3FMQ A;  4KUM A;  2XB0 X;  4G8X A;  1I6X A;  3F8M A;  4MEX F;  3OV8 A;  4J00 A;  3P5J A;  3ZXS A;  2QBY A;  2DFH A;  2V4J C;  3V7C A;  1R00 A;  2XVC A;  4EJU A;  1R1V A;  1BI0 A;  3DEW A;  4IHS A;  2CUJ A;  1VQ7 I;  2N8G A;  2PFB A;  2OCC H;  5FO5 A;  2WV1 A;  4M3F A;  4LLN A;  2D45 A;  3FDY A;  5JI6 A;  2DFI A;  3DWL E;  3KEQ A;  4U0W A;  2P81 A;  4PFP A;  4I02 A;  5BPI A;  1XCB A;  3H9J A;  2CUZ A;  4N9H A;  3TO7 A;  2XC7 A;  3GTP J;  2BEO A;  4HST A;  3T8T A;  4EJW A;  1FP1 D;  3S8P A;  2ZXH A;  3P9C A;  1B8I B;  1ZGA A;  3BOQ A;  3GTK J;  1SAX A;  4BXU A;  5GTI C;  2WAQ N;  2DPD A;  2EQR A;  2R7X A;  2ZSH B;  2X4H A;  4CIC A;  3D1N I;  5EEH A;  2QSF X;  3DV8 A;  3IC7 A;  4XON A;  4NB5 A;  4DYQ A;  2FNP A;  4YG2 F;  3HPG A;  3K2A A;  5CKT A;  3CDI A;  3GUD A;  4W97 A;  4CZZ A;  3HPH A;  4C30 A;  3I64 A;  3ESW B;  2XPW A;  1YHQ I;  2JRM A;  2KIU A;  2JA2 A;  2WB1 A;  4BE0 A;  5GTH C;  1A6Q A;  2LC2 A;  2PQ8 A;  2XAQ A;  1YG2 A;  3F3X A;  3GXO A;  3K69 A;  3HXL A;  3LOC A;  2CJJ A;  2LBF A;  2LMD A;  4AWX B;  5E3N A;  2PLY A;  1Z6R A;  4AU7 A;  3QYB A;  2IT0 A;  2EIL H;  1EF4 A;  5FKM A;  4IHX A;  1S7O A;  1LE8 A;  3CCU I;  3R0A A;  2I5U A;  1KU3 A;  3JRF A;  4MLO A;  4BUP A;  4G7H F;  5TIS C;  4CUG A;  1QPM A;  5LHG A;  2KJC A;  4Y17 A;  2X51 A;  1A36 A;  4I2O A;  4ZYE A;  3RIR A;  3ZGK A;  2HZT A;  3GLX A;  5B3S H;  4AIK A;  3GME A;  2NS7 A;  2IGN A;  2DXI A;  1P2F A;  1ZLJ A;  2BW3 B;  2HYG D;  3EDP A;  1W5S A;  1DP7 P;  4HAM A;  3CTA A;  4U7D A;  3BPX A;  3ERM A;  1OCR H;  4IRI A;  1FZP B;  4LLL A;  1IUF A;  5M5Y J;  2CYY A;  3H5A A;  1ONV A;  4II2 A;  2DA6 A;  1BC7 C;  4BNC A;  3GTM J;  3TMO A;  4LB6 B;  1MW7 A;  4A3I J;  5GAG J;  1MDM A;  5E3M A;  3CC2 I;  3WGH A;  4B4C A;  4LB5 A;  4LD5 A;  1HA8 A;  3L2R A;  2XAF A;  2OZU A;  4UVA A;  2XF7 A;  3RKX A;  3HRS A;  2YSR A;  2M3A A;  1F4K A;  4EM0 B;  3HUG A;  1ZRE A;  1ULY A;  2DA1 A;  2E36 A;  1XTA A;  2Z16 A;  4BQO A;  4IOA F;  1FP2 A;  1WJE A;  4NHJ A;  3PJR A;  1XSV A;  2FEZ A;  4LG0 A;  2HKO A;  4A6D A;  5TJJ A;  2R7Z J;  2QGU A;  4ABZ A;  2MC3 A;  2DQR A;  2DT6 A;  2R0Q C;  3ROU A;  4A3G J;  2GBY A;  1WJ5 A;  3WTU C;  4XSZ F;  2A5Y B;  3AL0 C;  3KP5 A;  3TQN A;  4XR6 A;  2I10 A;  2FQ4 A;  3AAF A;  1RUO A;  4D1Q A;  3CCE I;  2VIX A;  2ZKZ A;  2GA1 A;  1HDD C;  3MKW B;  1R23 A;  5BQT A;  2JA8 J;  3ZCO A;  2QCO A;  4XOR A;  2E2J J;  2DMT A;  3PIP F;  4LIU A;  1P4A A;  2EH3 A;  4UUS A;  3TOB A;  3HB9 A;  2EK5 A;  2K7L A;  2TDX A;  5KAI C;  3H5R A;  5EGO A;  2EZI A;  4UUT A;  3HKZ N;  1B8I A;  3W6K B;  1TP4 A;  3TL4 X;  4DBQ A;  3WG7 H;  3V8K A;  3Q9V A;  4HF1 A;  3HGG A;  5J40 A;  5F0F A;  1ZTR A;  3HOZ J;  2YPR A;  1H9G A;  2A6E F;  3MWM A;  3L9F A;  2RN7 A;  4HZF A;  1WH7 A;  4DNC A;  4PUS A;  1X3Z B;  4LG3 A;  1O3R A;  1SAU A;  2O6G E;  4A0X A;  1QHH D;  2B7E A;  1B59 A;  3CUQ A;  5TGT A;  4CXF A;  3O8H A;  1XS9 A;  1U78 A;  3HZJ A;  3H0D A;  3GTQ J;  3FXU A;  5CQG A;  1WKM A;  4IRH A;  3AFH A;  1YLF A;  5E79 C;  1UFM A;  1T8I A;  3E6B A;  1IRX A;  1O3S A;  4HX4 A;  3BCA A;  3EUA A;  1VND A;  3K7A J;  1FOK A;  2AS5 F;  1V55 H;  2JA6 J;  2CW8 A;  2Y9Y A;  1YIJ I;  5IT9 Z;  2JVG A;  2NAZ A;  4KIG A;  4GDF A;  2F6C A;  3BTI A;  3PO3 J;  1EH6 A;  2X0L A;  3K4J A;  2F5V A;  1A31 A;  3IL2 A;  5M3M J;  1TQI A;  2CV0 A;  4BDZ A;  1BW6 A;  2DA4 A;  2XAS A;  2MG4 A;  5CPR B;  1JGS A;  4RAF A;  1GV5 A;  3DPT A;  5F08 A;  5LGN A;  3LWF A;  2NOJ B;  3DKX A;  2VE9 A;  4BJ5 C;  4HNU A;  5DD4 A;  1HKS A;  3DTK A;  1ZK8 A;  4BYY A;  2EIN H;  2BVM A;  2XGX A;  3KP4 A;  2E34 A;  2ZNZ A;  1XDS A;  2VJ4 A;  4OIN F;  3OYE A;  1MBJ A;  3OIO A;  2KDO A;  3ZR8 X;  5L3F A;  5TRD A;  5LRR A;  3HBL A;  2LP0 A;  1BOB A;  2R4G A;  2M7B A;  4FE4 A;  1XD7 A;  2O61 A;  3OSG A;  1ON1 A;  3E5Q A;  1FOX A;  2VQG A;  3WGG A;  1HCR A;  4JX5 A;  4HV6 A;  2F5F A;  1EKE A;  3E6D A;  1BN5 A;  1ZYR F;  3KZY A;  4PZJ A;  2K9S A;  2PN6 A;  3F6V A;  1JT0 A;  4I7H A;  2HVQ A;  4JYK A;  4CZC A;  1I1G A;  4QPQ A;  4YIF A;  4XKV A;  1NK3 P;  3RPU D;  3NAU A;  2IEK A;  3ZQ7 A;  1GDT A;  3FXO A;  1N75 A;  2ELJ A;  2KRF A;  1KQ9 A;  3LST A;  2CUE A;  3MQ0 A;  1WHU A;  1IDY A;  1MGT A;  5K5O A;  1JKP C;  5D4S A;  4KFC A;  2XF5 A;  2Q1Z B;  3C2H A;  4HX7 A;  2DJI A;  4M73 A;  5F0C A;  2CQK A;  4ZC3 A;  3HOW J;  2RNG A;  2K9Q A;  1BJZ A;  1SFE A;  5IYB J;  1G3W A;  3TW6 A;  1VQ5 I;  2PMZ N;  1B9M A;  2R7U A;  3DF8 A;  4CO8 A;  2OAZ A;  5FRO A;  3JRG A;  3KZZ A;  2K9M A;  2JN6 A;  2EA2 A;  3AG1 H;  3FZV A;  4G6D A;  1S72 I;  2JPB A;  1IF1 A;  1XGO A;  2JRT A;  2ECC A;  5GP9 A;  3BP8 A;  5KHD A;  4HNT A;  1F5T A;  1YS6 A;  3TP0 A;  3DBL B;  3T1B A;  3SJM A;  3FK6 A;  3VSK A;  5E8G A;  3ZN0 A;  4YRV A;  3H1C A;  2IXS A;  3DP7 A;  4OMY A;  2WTE A;  4YEL A;  3VYR B;  2IS6 A;  3CD6 I;  2VPL A;  5E1Z B;  3BJA A;  1BR4 A;  4RAY A;  2KFD A;  1QVT A;  1Z1D A;  3JRC A;  2M5W A;  3M1E A;  2LFB A;  2DW4 A;  1J59 A;  1VI0 A;  1ERD A;  1YO5 C;  2LRD A;  1U6G A;  1FIP A;  2CGP A;  4S0H B;  1G3Y A;  4DBR A;  4BHC A;  3FK7 A;  2VQH A;  1W4M A;  3DCF A;  1DDN A;  3CJT B;  2RVC A;  3LA7 A;  1K83 J;  2DMN A;  5HDN A;  4G6Q A;  2V26 A;  3D5L A;  5C4J J;  4IL6 C;  2MLK A;  3E6M A;  3HRM A;  1X2N A;  3LFU A;  3CP8 A;  1R4N B;  3H3U A;  5FLM J;  3WTW C;  4IPA A;  2D1H A;  3QOD A;  1HF0 A;  2ZXW H;  4ETS A;  2ZJR F;  1YS7 A;  3KEO A;  1QPI A;  1WCM J;  3ZQG A;  4FHT A;  1OYI A;  2FQ3 A;  2DK8 A;  3OYN A;  2AQE A;  3E0J B;  4L9J A;  3FXK A;  3S1N J;  1UHS A;  3PL8 A;  1B4A A;  3LSM A;  2ELH A;  1BM9 A;  4Y33 A;  4M3D A;  3DFG A;  3T5X A;  1K4S A;  2E1N A;  3OYM A;  4S04 A;  1RR7 A;  4QPO A;  4BAC A;  2LKP A;  2VKV A;  3HIF A;  3LSG A;  1RNL A;  5DCM B;  1MMG A;  3GLL A;  2KPM A;  3FXM A;  4M6X A;  4Q4Z F;  4E7K A;  2CMP A;  2ZCW A;  3MKL A;  3BCB A;  4S05 A;  3K70 D;  3FKI J;  3C18 A;  3H92 A;  3FXL A;  2JUC A;  3VWB A;  2FNA A;  3LL7 A;  2JSP A;  3IHU A;  3QPS A;  5CVJ A;  1VQK I;  4F7Z A;  2BYV E;  4YIR X;  2K85 A;  1BA5 A;  5JHF A;  3OL3 A;  2CFO A;  3RI4 A;  2V1N A;  3F22 A;  1IRZ A;  4HG2 A;  2GWR A;  2L01 A;  1JXS A;  3K9T A;  3VYS B;  3BQZ A;  3JRB A;  5AON A;  2ME0 A;  1S8N A;  3ERE D;  1MMN A;  3H5N A;  5KCM A;  1XSD A;  3B6C A;  5J1U A;  3WHB A;  1V5F A;  3QU6 A;  4C2M J;  3QWL A;  4IO9 F;  1BIB A;  1F36 A;  2O5R A;  1OJL A;  4PCQ A;  3VYT B;  4JP0 A;  1ETY A;  4N4N B;  2Z33 A;  4ENN A;  1RET A;  3CDL A;  1SVM A;  5EEG A;  4AM3 A;  4L5J A;  4KIT B;  5IPA A;  2X1E A;  4XM3 A;  5IYD J;  4ZJZ A;  4XN0 A;  5EJC A;  3J80 Z;  2WY8 Q;  2DCE A;  3CC4 I;  2P6S A;  3ZRG A;  3EUH A;  1LEB A;  1GLN A;  5FKN A;  4Y52 J;  2P5L C;  2CQQ A;  5J1Y A;  3S3N A;  3Q5F A;  4KYW A;  2ECB A;  2PX9 A;  1ZAO A;  3BJO A;  3TP3 A;  2R92 J;  3ZQQ A; 
#chains in the Genus database with same CATH homology
 5CVR A;  1MZB A;  3K0L A;  4U7B A;  2OQR A;  4I0B A;  2YR2 A;  4P9U A;  3I53 A;  4A2U A;  4GO1 A;  4G94 A;  4G9Y A;  1EH7 A;  1R5G A;  2HS5 A;  4JK1 X;  6PAX A;  3FX3 A;  2XUB A;  3U9G A;  4MTD A;  4IJA A;  4KIC A;  1R1T A;  2UWM A;  3CO6 C;  3CLO A;  5LLQ A;  4ZZL A;  5D5X B;  2FXA A;  1QO0 D;  4M71 A;  5D4R A;  4GXO A;  1BJA A;  1J0R A;  4I01 A;  1HST A;  2L4M A;  4KMU X;  4A0Y A;  1LQ1 A;  1U5T A;  5BOX A;  5CVV A;  2FOK A;  2FF4 A;  5DCM A;  5D8K B;  5IT9 K;  1YYV A;  4EJO A;  5DUI A;  1P92 A;  5KVR A;  3RJP A;  2DO7 A;  4KDP A;  3I59 B;  1T39 A;  4LJZ F;  3HSR A;  2OZ6 A;  3GW2 A;  1R58 A;  2FBI A;  2P5V A;  2FE3 A;  2YX4 A;  3GYH X;  4OMZ A;  4YII A;  3KFW X;  1ZG5 A;  4O6J A;  4B09 A;  4L18 B;  3K2Z A;  3GZ5 A;  3RPQ A;  2V9V A;  2H6B A;  2VXZ A;  2STT A;  4EV0 A;  3FF5 A;  2P7V B;  5BMZ A;  5K5Q A;  4KIF A;  3REO A;  3ABU A;  2FA5 A;  2ZME A;  1EV7 A;  1SD7 A;  2P4W A;  5HS7 A;  4OIP F;  4EQQ A;  3CDH A;  1R5H A;  5D5V B;  2HWV A;  1IW7 F;  1ZN2 A;  4LGW A;  2Q2E A;  3RKW A;  2HTS A;  2RV8 A;  5J6X A;  3LAP A;  3PFI A;  2EFQ A;  2FBH A;  4Y15 A;  4RS8 A;  4XRF A;  2M8E A;  2R3S A;  2IA2 A;  5HVQ C;  3MZY A;  1XMK A;  1OYW A;  2QM3 A;  4PDK A;  1FYL A;  3BPV A;  3KCC A;  3LAJ A;  1XGS A;  2KJB A;  3L09 A;  1FBQ A;  3RDI A;  2FMY A;  2Z99 A;  4Z2Y A;  4CGZ A;  4AIH A;  2IPQ X;  1FBS A;  4I09 A;  1WRJ A;  3ECO A;  5LHI A;  2ACJ A;  1R1U A;  3VOE A;  2V1X A;  1H0M A;  2VBY A;  3F8F A;  3Q9S A;  1YW7 A;  3R61 A;  1OPC A;  2M45 A;  4RB2 C;  3QRF F;  4KA4 A;  5E1W A;  3HOT A;  1IRF A;  3IKT A;  2OBP A;  3GFI A;  3V8J A;  1MJA A;  1XSX A;  5LGT A;  2MBF A;  1J9I A;  2FU4 A;  2FBK A;  1W7P A;  1TW2 A;  2IA0 A;  3HTU A;  4RGS A;  1YW8 A;  3TKY A;  3WTS C;  5DUK A;  5CVI A;  1PP8 F;  3GO5 A;  3DKW A;  3COA C;  5KK1 A;  1G3T A;  3WTZ A;  1IXR C;  4AVP A;  1IN8 A;  2L54 A;  1PUE E;  1T0F A;  1FSE A;  1FC3 A;  3WE2 A;  1ZH5 A;  1S7A A;  1TW3 A;  4MQV A;  4O5V A;  2JT1 A;  2IVM A;  2IA1 A;  1KU2 A;  3ZPL A;  1K78 B;  1STZ A;  2XAG A;  5IT3 A;  3SZT A;  3WOD F;  3V8L A;  1U8R A;  4BAY A;  1XN7 A;  5LBQ A;  4ENJ A;  2BE5 F;  4HLY A;  1MJ9 A;  4CHU A;  3J80 K;  3GWZ A;  2KIM A;  2A61 A;  3FM3 A;  1FNN A;  4WXC A;  5D6E A;  1B6A A;  4IF4 A;  2A6H F;  2DQL A;  2DT5 A;  1ZLK A;  2Y48 A;  2GXB A;  2Y0M A;  3BWG A;  1BI3 A;  3HHG A;  3C7J A;  4M9X A;  1KYZ A;  4OOI A;  3G73 A;  4R8H A;  1YFH A;  4LLG F;  2AXL A;  3E5X A;  2RNJ A;  1EH8 A;  2K4B A;  3TDU C;  4M74 A;  5CYV A;  3G3Z A;  2ISY A;  2K86 A;  3E3V A;  1D8K A;  3LA3 A;  2J5O A;  2LNB A;  5JVT A;  1PP7 U;  1R7J A;  3CUO A;  3O6B B;  2DK5 A;  3GFM A;  3N4M A;  3WGI A;  1FY7 A;  2F5D A;  1O3T A;  2H94 A;  5HS8 A;  3ABT A;  2G7H A;  1IRG A;  1U5T C;  2NS0 A;  5CLS A;  2PI0 A;  1O3Q A;  1Z9C A;  4MNU A;  2K4J A;  1AWC A;  1CGP A;  5DDG A;  4HF2 A;  2XRO A;  1MJB A;  2VC1 A;  3LFK A;  2F2E A;  3C1D A;  1RUN A;  5DV5 A;  2QLZ A;  4ZZD A;  3GF2 A;  3KP6 A;  2EB7 A;  1K78 A;  3F8B A;  1J75 A;  1BOA A;  3TOA A;  4WCG A;  3KLO A;  4G7O F;  4A12 A;  1WQ2 A;  2B0L A;  2WV0 A;  2HOE A;  3BY6 A;  3FXR A;  3GZ6 A;  2ESH A;  2HTJ A;  1ZAR A;  2V6C A;  3B02 A;  1REP C;  3L00 A;  2V1U A;  3HOS A;  1E2X A;  2K02 A;  3K1P A;  2L3D A;  1IAW A;  2QQB A;  3ZMZ A;  3WTV C;  1S6L A;  2Z9O A;  1DPU A;  4A6E A;  5ILS A;  5H6Q A;  4EM2 A;  4M6Y A;  1U2W A;  2O03 A;  2HQN A;  1Z7U A;  2XIG A;  5D5W B;  3I5U A;  4JBA A;  5HDK A;  4H0E A;  2CWE A;  3HHH A;  1QGP A;  2KIF A;  5E17 F;  3LA2 A;  1QZY A;  1KGS A;  3ZMU A;  4IXA A;  3JSP A;  2HR3 A;  1TBX A;  3BRO A;  3KET A;  4UUV A;  3QP6 A;  5A2Q Z;  2E7W A;  4XBF A;  4U88 A;  3K1M A;  3KP7 A;  3MAJ A;  5L3B A;  4U0V A;  2M30 A;  4MGR A;  3ML6 A;  3T8R A;  2H27 A;  2JSC A;  3E97 A;  3WE3 A;  1XGN A;  2L02 A;  1LB2 A;  4BHP A;  3MEX A;  1B1B A;  5BPD A;  1LVA A;  1P6R A;  3JW4 A;  3ECH A;  3M8F A;  4QLC U;  3ZMS A;  4FX4 A;  2R7D A;  1OR7 A;  5E8I A;  5FGM A;  2NRA C;  4ZYG A;  5FFX A;  2PJP A;  4ENM A;  2WC2 A;  3EYY A;  1QQI A;  4OIQ F;  1HSJ A;  4BH9 A;  5ILV A;  1OMI A;  1RIO H;  3HSE A;  4ZYD A;  1QBJ A;  3N97 A;  1KU9 A;  3HRT A;  1P4W A;  3FMS A;  2DBB A;  2OQG A;  1ZRC A;  2HDC A;  2GXG A;  1CF7 B;  4ASN A;  5F1R A;  1XGM A;  1C0W A;  2Y75 A;  2IP2 A;  5HDG A;  4CDG A;  2O3F A;  4L5I A;  5AIP A;  3LQQ A;  1R36 A;  5E18 F;  1TQM A;  4LK1 F;  2ZJ2 A;  5CJ9 A;  5HLH A;  1LJ9 A;  3I71 A;  4LFU A;  4PGH A;  5ICC A;  2D2W A;  1UHM A;  3KP3 A;  5F6F A;  2F5C A;  4KNY A;  4MTE A;  4HDV A;  3H3Z A;  5ICG A;  2QBY B;  2G7U A;  4WXH A;  4IVN A;  2JZY A;  2VBX A;  4AD9 A;  1K7A A;  2ISZ A;  1F1Z A;  2JTV A;  1FSH A;  1NHA A;  3P7N A;  4CYD A;  3FXQ A;  2VT2 A;  2HQR A;  1L3L A;  2PMU A;  3RYR A;  2P8T A;  3DXJ F;  4MHG A;  1KU7 A;  4A5M A;  3QPH A;  3ZP5 A;  3HRU A;  4G7Z F;  1KA8 A;  2D1V A;  3F21 A;  1IN5 A;  3VB2 A;  3SXY A;  5F64 A;  2RGV A;  3V7R A;  1RZ4 A;  2MH9 A;  3OOP A;  3B73 A;  2VBW A;  4TV7 A;  5FLX K;  1F9N A;  2NNN A;  2RDP A;  1T2K A;  3NQO A;  2BBY A;  1B9N A;  5E20 A;  4UV9 A;  2ETH A;  1H9T A;  1K6O A;  4M9S A;  4B8X A;  1I27 A;  1JHH A;  4N9I A;  1ON2 A;  3D0S A;  4WX9 A;  2EFP A;  3J7A O;  2MA3 A;  2EV6 A;  3CO7 C;  4IHT A;  1HW5 A;  2PEX A;  3L7W A;  3RKY A;  4L0Z B;  3JAM Z;  2EJR A;  4HYE A;  1S29 A;  3I58 A;  4RB0 A;  2ZO4 A;  2QVO A;  1Q1H A;  3QU3 A;  2WWY A;  3SZP A;  5JHU A;  2GA2 A;  2VT3 A;  3DEU A;  4HF0 A;  3QAH A;  5H6R A;  4XLN F;  3ZMT A;  2A3S A;  1BI2 A;  1PDN C;  1LDK B;  1CF7 A;  1BIA A;  1JHF A;  4HW0 A;  4L0Y B;  5BS6 A;  2HFH A;  2Z3Y A;  1HW1 A;  1OKR A;  2ZXJ A;  2KKO A;  1KYW A;  1GXQ A;  1MDM B;  4OIR F;  2DLL A;  4FX0 A;  3HTS B;  3M7G A;  2GIV A;  2CSO A;  4FT8 A;  4WF2 A;  2FSW A;  2A68 F;  5FD6 A;  2QEN A;  2W25 A;  4LG0 B;  5D8L B;  2HYF A;  1V4R A;  3VOD A;  2EV0 A;  3EYI A;  2YU3 A;  3P9I A;  5L3D A;  2GAU A;  3P9K A;  2ZFW A;  1XB4 A;  4KT5 C;  4KN7 X;  2RQP A;  2J5P A;  2EFW A;  4AIJ A;  5D6F A;  1XDU A;  3I4P A;  1BC8 C;  5LRS A;  3CJN A;  3GFL A;  3O2P E;  4M9Z A;  5LGU A;  2QWW A;  2STW A;  2E7X A;  5HS9 A;  2V79 A;  2CO5 A;  3R4K A;  1UHW A;  2DTR A;  2MD5 A;  1ODD A;  4EGY A;  1IUY A;  1IN7 A;  5A2Q K;  5ED4 A;  4GCV A;  4RGU A;  4WWC A;  2COM A;  2EFO A;  2P5K A;  1Y0U A;  3CUQ B;  3I59 A;  3MZH A;  2LF8 A;  5J8C A;  1MKM A;  2Q0O A;  2O0Y A;  1AOY A;  2W24 A;  1MD0 A;  1LEA A;  4Y13 A;  4HLX A;  3GFJ A;  1W7P D;  2PBI A;  2O8X A;  3F8N A;  1HXD A;  4XLP F;  5H20 A;  3BDD A;  1VTN C;  1HKQ A;  3U1D A;  3NRV A;  4HV5 A;  2HKX A;  4HQE A;  1BI1 A;  4GGG A;  2W85 A;  4M72 A;  1G6N A;  2UXX A;  2XHK A;  3SHF A;  5FB2 A;  4RGR A;  2EA4 A;  4UNO A;  1IN4 A;  1FYM A;  5L3C A;  3J81 K;  1IZ1 A;  1O7F A;  3MCZ A;  1XCV A;  5DCF A;  3QOP A;  2VC0 A;  3M8E A;  3WG9 A;  3ZMD A;  4GYI A;  3BZ6 A;  1IXS B;  5JR3 A;  2MH2 A;  1QZZ A;  5ICF A;  2GQQ A;  1O7L A;  1HW2 A;  3WTT C;  2IJL A;  4O3M A;  3ZN1 A;  1DPR A;  1Z6T A;  1SD6 A;  3MFK A;  4UHT A;  4ENK A;  4ZH4 F;  1YTY A;  1SMT A;  2RC4 A;  1TQP A;  4UVB A;  4P96 A;  4R1H A;  2Z5U A;  1D3Y A;  2QYO A;  3KE2 A;  2PMH A;  3E6C C;  2NNY A;  4ESB A;  2EFN A;  2A69 F;  1L0O C;  1J7K A;  1BBY A;  1I1S A;  5FLX Z;  3I0T A;  3F72 A;  1ZG3 A;  2K27 A;  1K79 A;  2XAH A;  3FWE A;  1V3F A;  2DU9 A;  1OYY A;  1LDD A;  3TGN A;  1KQ8 A;  5K1Y A;  2UZK A;  4RGX A;  1J5Y A;  2DPU A;  3WU1 B;  3DPL C;  2BV6 A;  2OD5 A;  3JTH A;  1Z05 A;  2IRF G;  1FWZ A;  3WTX C;  4PGG A;  2QQA A;  3FM5 A;  2HEO A;  3GEZ A;  3IRQ A;  1TLH B;  2ESN A;  3ULQ B;  4HBL A;  5L3E A;  3JAM K;  3IRR A;  1R22 A;  2C6Y A;  3RPU A;  3SFZ A;  3R0J A;  4YFK F;  4L9V A;  4N0B A;  4HQM A;  1T38 A;  3HSF A;  3FMR A;  4RB1 A;  3RYP A;  3HYI A;  3ELK A;  1JE8 A;  1SFX A;  4OU0 A;  1USS A;  3F8C A;  4ESF A;  4KN4 X;  2Q8K A;  4ON0 A;  3R60 A;  1IXC A;  1ZG1 A;  3RTR A;  3TDZ C;  1ZGJ A;  1YQA A;  4QWQ A;  2V1D A;  3R6S A;  3JSO A;  1Z91 A;  4UV8 A;  2ZBK A;  4OIO F;  5LEK A;  3F23 A;  2NYX A;  1D8J A;  3BJ6 A;  1GXP A;  2VON A;  3WU0 A;  2XV4 S;  4Q48 A;  2QQ9 A;  3V7S A;  4P55 A;  2LSO A;  1WSU A;  2F5E A;  4IRG A;  3U2R A;  2DI3 A;  4UXN A;  4GYG A;  3GVA A;  3T0Y A;  4KMF A;  1P4X A;  4UVC A;  2CG4 A;  3QP5 A;  4EGZ A;  2XKO A;  5FFZ A;  2UXN A;  1LNW A;  2FML A;  1QNT A;  3M9A A;  2QZ8 A;  5D5U B;  1GVJ A;  2LDU A;  5J8F A;  3C3W A;  4ESJ A;  4U0Y A;  1W5T A;  5HOO A;  2DAO A;  5ICE A;  3I54 A;  1HQC A;  5LHH A;  1WI9 A;  3LQR A;  3ISP A;  1T6S A;  1HBX G;  4YFX F;  4I0A A;  4EM1 A;  2PG4 A;  1U5T B;  1FPQ A;  4D0P A;  2ADU A;  1ZRF A;  2EWN A;  1HKT A;  2XAJ A;  2H6C A;  5K5R A;  2MLG A;  2JPC A;  4R79 A;  2H09 A;  2LF7 A;  4ZYH A;  2M1B A;  1I5Z A;  2VOP A;  2VBZ A;  3TO6 A;  1G4D A;  2W84 A;  1SD5 A;  3SQN A;  5FD5 A;  4WK8 F;  3E5U A;  5DYM A;  3J81 Z;  1UCR A;  5ILU A;  3L2C A;  1FYK A;  2FRH A;  2HGC A;  3W6J B;  2XRN A;  3PQJ A;  2YX7 A;  2CFX A;  2EV5 A;  2XKP A;  2RKH A;  4HOB A;  2GZW A;  5HLI A;  3EET A;  4MQ9 F;  4MEY F;  3EQL F;  3VEP A;  2QUF A;  4WXD A;  5E1X A;  5LEJ A;  5DD8 A;  4P9F A;  1FT9 A;  5CVU A;  2ZME B;  3S2W A;  2L4A A;  5HLG A;  1D5V A;  2P6T A;  1IN6 A;  4LK0 F;  3KP2 A;  4RAZ A;  1LDJ A;  3IKV A;  4YFN F;  3GX4 X;  4HX8 A;  1S3J A;  1RI7 A;  1FBU A;  3K1N A;  1UB9 A;  1YIO A;  4A0Z A;  3O3K A;  4Q47 A;  4BQA A;  2R7F A;  4L9T A;  4HA8 A;  1FX7 A;  1SMY F;  3KLN A;  2IW5 A;  4HDU A;  2A07 F;  4JQF A;  1DUX C;  2CW0 F;  5AIQ A;  3QPT A;  2VOO A;  5DEQ A;  4RB3 C;  1G3S A;  1TTY A;  4BHB A;  2VN2 A;  3IWF A;  4I98 B;  3CUQ C;  1ZHF A;  2OA4 A;  3TO9 A;  2VOD A;  5ERI A;  2E1C A;  2OU2 A;  2VE8 A;  1A04 A;  2P7C B;  1J2X A;  3JTG A;  5JFR A;  3WTY C;  1U3E M;  3PQK A;  1T98 A;  4EJV A;  1SFU A;  3VFZ A;  4K2E A;  4LMY A;  4NQW A;  4EVI A;  2ZNY A;  1TNS A;  1SD4 A;  1YW9 A;  1W7P B;  2W57 A;  1TNT A;  4DQ2 A;  1E17 A;  1O57 A;  1GHC A;  4EMS A;  4E70 A;  3V4G A;  1FLI A;  4L9N A;  3NEU A;  3IWZ A;  4XSX F;  5L3G A;  4A5N A;  1XMA A;  4KIB A;  1UST A;  4Q5S F;  1X3U A;  1KQ0 A;  2M87 A;  2G9W A;  1ZRD A;  1WWX A;  3FHZ A;  2BGC A;  3F6O A;  3ZMV A;  4P5O A;  4EJT A;  3DQV C;  3FMQ A;  4KUM A;  4G8X A;  1I6X A;  3F8M A;  4MEX F;  3OV8 A;  2QBY A;  3V7C A;  1R00 A;  2XVC A;  4EJU A;  1R1V A;  1BI0 A;  4IHS A;  2PFB A;  5FO5 A;  4LLN A;  2D45 A;  5JI6 A;  2DFI A;  3KEQ A;  4U0W A;  4I02 A;  5BPI A;  1XCB A;  4N9H A;  3TO7 A;  2BEO A;  3T8T A;  4EJW A;  1FP1 D;  3P9C A;  1ZGA A;  3BOQ A;  1SAX A;  4BXU A;  2DPD A;  2X4H A;  4CIC A;  5EEH A;  3IC7 A;  3DV8 A;  4NB5 A;  2FNP A;  4YG2 F;  3GUD A;  4CZZ A;  3I64 A;  2KIU A;  2PQ8 A;  2XAQ A;  1YG2 A;  3F3X A;  3GXO A;  3K69 A;  4AWX B;  2PLY A;  1Z6R A;  2IT0 A;  1S7O A;  3R0A A;  1KU3 A;  4G7H F;  1QPM A;  5LHG A;  2KJC A;  4Y17 A;  4I2O A;  4ZYE A;  3RIR A;  2HZT A;  3GLX A;  4AIK A;  1P2F A;  1ZLJ A;  2HYG D;  3EDP A;  1W5S A;  1DP7 P;  4HAM A;  3CTA A;  4U7D A;  3BPX A;  4IRI A;  1FZP B;  4LLL A;  2CYY A;  1ONV A;  1BC7 C;  4BNC A;  4LB6 B;  1MDM A;  3WGH A;  4LB5 A;  4LD5 A;  2XAF A;  2OZU A;  4UVA A;  3RKX A;  3HRS A;  2YSR A;  1F4K A;  4EM0 B;  3HUG A;  1ZRE A;  1ULY A;  1FP2 A;  4NHJ A;  1XSV A;  2FEZ A;  4LG0 A;  2HKO A;  4A6D A;  5TJJ A;  2MC3 A;  2DQR A;  3ROU A;  3WTU C;  4XSZ F;  2A5Y B;  3KP5 A;  3TQN A;  3AAF A;  1RUO A;  2ZKZ A;  2GA1 A;  1R23 A;  5BQT A;  1P4A A;  3TOB A;  2EK5 A;  2K7L A;  2TDX A;  3W6K B;  3V8K A;  3Q9V A;  4HF1 A;  2YPR A;  1H9G A;  2A6E F;  3MWM A;  3L9F A;  2RN7 A;  4HZF A;  4DNC A;  1O3R A;  2O6G E;  4A0X A;  1B59 A;  3CUQ A;  4CXF A;  1U78 A;  3FXU A;  1WKM A;  4IRH A;  1YLF A;  1UFM A;  3E6B A;  1O3S A;  4HX4 A;  1FOK A;  2AS5 F;  5IT9 Z;  2NAZ A;  4KIG A;  1EH6 A;  2X0L A;  3IL2 A;  1TQI A;  2XAS A;  1JGS A;  3DPT A;  5LGN A;  3LWF A;  2VE9 A;  5DD4 A;  1HKS A;  4BYY A;  2XGX A;  3KP4 A;  1XDS A;  2ZNZ A;  4OIN F;  5L3F A;  5TRD A;  5LRR A;  1XD7 A;  2O61 A;  1ON1 A;  3E5Q A;  3WGG A;  4HV6 A;  2F5F A;  3E6D A;  1BN5 A;  1ZYR F;  3KZY A;  4PZJ A;  2PN6 A;  3F6V A;  4I7H A;  1I1G A;  4YIF A;  3ZQ7 A;  2KRF A;  1KQ9 A;  3LST A;  3MQ0 A;  1MGT A;  5K5O A;  4KFC A;  5D4S A;  4HX7 A;  4M73 A;  2CQK A;  1SFE A;  1G3W A;  1B9M A;  3DF8 A;  4CO8 A;  2OAZ A;  3KZZ A;  3FZV A;  4G6D A;  2EA2 A;  1IF1 A;  2JPB A;  1XGO A;  2JRT A;  3BP8 A;  1F5T A;  1YS6 A;  3T1B A;  5E8G A;  3ZN0 A;  3DP7 A;  4OMY A;  2WTE A;  5E1Z B;  3BJA A;  4RAY A;  1Z1D A;  2M5W A;  3M1E A;  2DW4 A;  1J59 A;  1YO5 C;  1U6G A;  2CGP A;  1G3Y A;  4BHC A;  1W4M A;  1DDN A;  2RVC A;  3LA7 A;  5HDN A;  4G6Q A;  3D5L A;  2MLK A;  3E6M A;  3HRM A;  3H3U A;  3WTW C;  4IPA A;  2D1H A;  4ETS A;  1YS7 A;  3KEO A;  4FHT A;  1OYI A;  2FQ3 A;  2DK8 A;  4L9J A;  1B4A A;  2ELH A;  1BM9 A;  3DFG A;  3T5X A;  2E1N A;  4S04 A;  2LKP A;  3HIF A;  1RNL A;  5DCM B;  4M6X A;  4Q4Z F;  2ZCW A;  4S05 A;  3C18 A;  3H92 A;  2FNA A;  3IHU A;  5CVJ A;  4F7Z A;  2BYV E;  3RI4 A;  3F22 A;  2GWR A;  2L01 A;  1JXS A;  3K9T A;  5AON A;  1S8N A;  3ERE D;  1XSD A;  3QU6 A;  1BIB A;  4PCQ A;  2Z33 A;  4ENN A;  5EEG A;  4L5J A;  3J80 Z;  2P6S A;  3EUH A;  1LEB A;  2P5L C;  3Q5F A;  4KYW A;  1ZAO A;  3BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...