5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
molecule keywords PhoB family transcriptional regulator
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
2FXAA 3WGHA 1UCRA 2MA3A 1T2KA 5E1XA 5LBQA 4HBLA 5AIQA 5DCMB 3RYRA 2R7FA 3FMRA 2PMHA 3E97A 4I7HA 3ABUA 4A5NA 5BPDA 3GFMA 1IN5A 2FNAA 1B1BA 3BJOA 1XGOA 4G9YA 1BOAA 4HV5A 1J2XA 3O2PE 1IF1A 3F22A 1ON1A 3DV8A 2VC1A 3V7RA 1WI9A 3BJAA 1EV7A 4HV6A 5FLXZ 3DPTA 1QBJA 3HRMA 2GQQA 3CUOA 1ZAOA 4UVBA 1ZGAA 4AIJA 3RJPA 3PQKA 3WTZA 3WTTC 3LA3A 3E6CC 3FXUA 2ESNA 3FMQA 3WTXC 1FBQA 3R61A 2DW4A 1PUEE 4UHTA 2DU9A 1IW7F 2EFQA 3L2CA 1P92A 2FE3A 1BC8C 2QQBA 3MCZA 3MZYA 2WTEA 2XGXA 5FLXK 2DQLA 1OYYA 5EEHA 3L7WA 1R7JA 2FBKA 1RNLA 1W7PA 5BS6A 2OA4A 4R79A 2L4MA 1R23A 1G3WA 4M74A 4ASNA 2LKPA 4L9VA 5CVJA 2PN6A 4DNCA 4RB2C 2K4BA 1R5HA 3I53A 4HYEA 3CDHA 3V8JA 4A0YA 2G7UA 3LWFA 1OYWA 2FRHA 1QZZA 4ZYGA 1CF7B 3IKVA 1XN7A 3SZTA 1K78B 4N0BA 1FSEA 5D6FA 3GO5A 2Z33A 4IRHA 4OIRF 4XSZF 2IP2A 1LEAA 3F72A 4N9IA 1J59A 1MKMA 3J81K 3DP7A 4CGZA 1YO5C 4M72A 5DEQA 1MD0A 2P5KA 2CO5A 1R1VA 1MJ9A 4P96A 1DDNA 3QPHA 4YFNF 1Z6RA 4Z2YA 1H0MA 3KP6A 5KVRA 2CYYA 2A69F 2XVCA 5BMZA 3SFZA 3I59B 3WTVC 3K9TA 3O6BB 3E3VA 2VT2A 3PQJA 3R0JA 1WSUA 4LLLA 2RKHA 2QZ8A 3KP5A 2FNPA 2IA1A 3GFJA 2V1UA 3CTAA 1J0RA 2FMYA 3ELKA 4I02A 3F23A 1G3SA 3QAHA 4RAZA 1W5SA 1G6NA 4B09A 2FU4A 3LFKA 4L5IA 3K1NA 3Q9SA 3H3UA 2NS0A 2BV6A 5IT9Z 1LDJA 1FBUA 1OYIA 2YPRA 3E6MA 4EV0A 4M73A 2PBIA 2F5CA 1U2WA 4LB5A 2R7DA 1XSVA 3R0AA 2JPCA 3R6SA 2FMLA 2P7VB 4YFXF 3I64A 3L09A 1BM9A 4RGSA 4ZYHA 2EFOA 1XDUA 4LK1F 4GO1A 5HS7A 4PCQA 1KGSA 2B0LA 2ISZA 1FY7A 5K5OA 5D8KB 2EB7A 3HRTA 3MAJA 2ELHA 4AVPA 1U78A 2F5EA 5CVUA 3EETA 5LHIA 1YTYA 1SD4A 1DPRA 2QWWA 4KFCA 1F4KA 2DLLA 4HX8A 2K7LA 5TJJA 4GGGA 4MGRA 1REPC 3IWFA 2VE9A 4HZFA 3GVAA 2PFBA 3ZMDA 3C18A 3ZN0A 2IPQX 5LHHA 5HS8A 1TQMA 3ZMTA 4KDPA 1SAXA 2FA5A 2OQRA 3IRQA 1FSHA 2E7WA 1YG2A 1J9IA 3KEQA 3FHZA 4HX4A 3V7SA 2OZ6A 4YG2F 5HDGA 4U88A 5D5XB 4MQVA 5ICGA 4ENJA 3O3KA 4PGHA 5H6QA 2NAZA 3LQRA 2HS5A 3HTSB 4P9FA 4F7ZA 4AWXB 1U8RA 3GXOA 1Z05A 2IT0A 4FT8A 1YFHA 2J5OA 1Y0UA 4WCGA 1WWXA 2Q0OA 2H6CA 3P7NA 2XUBA 3RTRA 1KU2A 1HKTA 1LDDA 2ZCWA 5BPIA 4L9NA 5JVTA 2ZXJA 1YW8A 4A0ZA 1UFMA 3SZPA 5EEGA 1BJAA 5D4SA 5DV5A 4HQMA 3S2WA 5HDNA 2XAFA 4O3MA 2GWRA 1Z7UA 2P5VA 3VEPA 5E8GA 3I71A 4ETSA 4RB1A 4RB0A 4CDGA 3GZ6A 2A6HF 3RI4A 3GF2A 1B9MA 1YLFA 3IKTA 1ZARA 1BIBA 3DEUA 3Q9VA 3TDZC 2L01A 3NEUA 1IRGA 3F8FA 2F5DA 5F64A 2DBBA 2LNBA 4S05A 2K86A 3KETA 4AIKA 3ZMZA 2P6SA 3WODF 5HDKA 1KYWA 4HDVA 3F6VA 1Z91A 2ZKZA 4OMYA 1KQ9A 4GCVA 2QLZA 2O61A 2ZBKA 1PDNC 4WX9A 1T38A 1W5TA 4OMZA 3M9AA 2JT1A 3ECOA 4ZYEA 3EUHA 3IC7A 2EA2A 6PAXA 1B59A 4OIQF 4GYIA 3HRSA 5IT3A 4LG0B 2YX4A 4M9XA 3TOBA 1KU9A 4E70A 4A12A 1H9GA 2HYFA 1E2XA 3JTGA 2PQ8A 2HR3A 1S29A 3GFIA 2F5FA 3JW4A 3V8LA 2PLYA 4PZJA 3IWZA 1ZLKA 4KIFA 5HS9A 2BE5F 2QVOA 3GWZA 1R1UA 3QP5A 1HKSA 2X4HA 3GUDA 3Q5FA 3KEOA 2GZWA 2V1XA 5HLGA 1TNSA 2HYGD 2LDUA 4JBAA 5ICEA 2ZFWA 4ESFA 4HF1A 4JQFA 3HSEA 5L3CA 2DK5A 3TGNA 2OAZA 2YR2A 4RAYA 2KJBA 5FFXA 1HW1A 3QU3A 1QO0D 4EVIA 4LFUA 5FGMA 3E5QA 5ED4A 4QLCU 3BDDA 4RGXA 3K69A 2MLKA 2M1BA 2VBZA 5LGTA 3F6OA 3HHGA 3T8RA 4LLGF 2STTA 3ZQ7A 2V1DA 1YYVA 1HXDA 5FD5A 1UB9A 3BZ6A 5DD8A 4UVCA 1R00A 3FXRA 2DO7A 1ZG3A 2O3FA 3ZPLA 1YS6A 2A68F 3C1DA 5DUIA 1UHMA 1WRJA 4KN7X 4BHCA 3FMSA 3EQLF 1LEBA 2QYOA 3F21A 3J80Z 4Y13A 2FBIA 1QPMA 5DCMA 2FEZA 3LA7A 4WF2A 2D1VA 1STZA 3R4KA 1L3LA 3TO9A 5CVRA 1J7KA 1OMIA 2PG4A 1QNTA 4U7BA 2BYVE 3ECHA 3LA2A 1XDSA 1AOYA 4S04A 5DUKA 4XBFA 1ZLJA 2MH2A 5K5QA 1TNTA 4R8HA 3WTSC 3P9KA 4N9HA 3V7CA 1XSDA 4HF0A 2VBXA 4M9SA 3RKYA 4ZZLA 1ZRCA 2D45A 5HLHA 2CQKA 4KUMA 2HDCA 2NNNA 3CUQA 4A2UA 5J8CA 5E8IA 1FP1D 2UXXA 1R1TA 2Y0MA 5D5UB 2IA2A 5F6FA 4I09A 3F3XA 4FX0A 2A07F 3ULQB 2BEOA 1HW5A 1B4AA 1J5YA 4IHTA 3J7AO 4A6EA 1F9NA 4JK1X 4MEXF 5JR3A 3WU0A 4HLYA 4RGRA 2M8EA 1WQ2A 1HBXG 4Y15A 5ILSA 2DQRA 1OPCA 1ZHFA 3J81Z 2YX7A 3GYHX 5JI6A 4ENMA 3HTUA 3M8EA 5KK1A 1IXSB 3IRRA 1Z9CA 2UWMA 3W6JB 1TLHB 5DYMA 3B73A 5J8FA 1CF7A 1GXQA 3BP8A 1ZGJA 3P9IA 5HOOA 2R3SA 3M1EA 1HKQA 4NHJA 1ZRDA 1V3FA 1I27A 4XLNF 4BAYA 3RYPA 3VFZA 3H92A 1MGTA 1JGSA 4IRIA 3ROUA 5DDGA 1IRFA 4Y17A 1KU3A 1B6AA 2EV6A 4ENKA 1ZRFA 4MEYF 3IL2A 5L3BA 1QGPA 2FF4A 2IA0A 5L3FA 2VOOA 4YIFA 3GFLA 2UXNA 2HGCA 5K1YA 2M30A 3WGGA 4EGYA 2ZNZA 3C7JA 5FFZA 4WK8F 3ZN1A 2HTJA 3TO7A 2K4JA 2CG4A 4UNOA 3MQ0A 2DPUA 2FOKA 1O3RA 2ADUA 5L3DA 5DCFA 2JZYA 4L18B 1P4WA 1R58A 3BWGA 1XMKA 3KLOA 2ZMEB 4RGUA 2QQ9A 2HFHA 1GXPA 4IHSA 3MFKA 3E5XA 4QWQA 3BJ6A 5IT9K 4IPAA 1T6SA 2FQ3A 2Z9OA 2YU3A 4AIHA 5E17F 3BROA 4B8XA 3SHFA 3LAPA 3I4PA 3DPLC 3RKXA 3ZMVA 1BI2A 1MJBA 1FYKA 4ON0A 1DPUA 2GXGA 2DTRA 3M7GA 4MNUA 3VODA 2JPBA 2LSOA 3QP6A 1I6XA 2Z99A 4ESBA 2Y48A 3KCCA 5CVIA 4XSXF 2HQRA 1FOKA 1W7PB 4GXOA 1SFXA 2CGPA 1T98A 3TO6A 1QQIA 3CUQB 4UVAA 1P6RA 1IXRC 5HLIA 4EQQA 2E1CA 3SXYA 1HQCA 4Q47A 1YS7A 2L54A 2DK8A 3IHUA 3KZYA 4IJAA 2TDXA 2XASA 1RZ4A 2W57A 4P55A 2RN7A 4TV7A 2H27A 2DFIA 3WG9A 2V6CA 2M45A 3BY6A 5LEKA 2XIGA 4MHGA 2KIFA 1IN8A 2GXBA 4O6JA 1F1ZA 5LRSA 2Q8KA 2MH9A 1XGSA 2FBHA 3CO6C 2EWNA 3HSRA 1O7LA 3D0SA 5D6EA 2HWVA 2IJLA 4UXNA 3GW2A 5FB2A 2UZKA 3QRFF 2XV4S 1FPQA 4L5JA 3TQNA 2HQNA 1HSTA 5E1WA 4EJTA 2J5PA 4H0EA 1ZYRF 1FX7A 2EA4A 2H94A 2Y75A 1FBSA 4CYDA 2DAOA 1FLIA 4L0YB 2GA1A 3KP2A 2EFPA 2STWA 1TBXA 2F2EA 2XROA 4OIOF 2X0LA 2EV5A 2ETHA 4K2EA 2VN2A 4WXDA 1JXSA 4OOIA 2CSOA 3FF5A 1LNWA 4OIPF 3EYYA 3W6KB 2HOEA 3HHHA 3T1BA 1SD7A 1IZ1A 2GIVA 4KMFA 3ABTA 2OU2A 5TRDA 4L9TA 4CICA 4KYWA 3LQQA 3K1PA 1USSA 2HZTA 3E5UA 2WC2A 4IVNA 4EGZA 3T5XA 4ESJA 1YW9A 3KZZA 3MZHA 3I0TA 2KIUA 1S7OA 4G6QA 1KU7A 4KMUX 3SQNA 3E6DA 4NQWA 1YW7A 2E1NA 3B02A 3DXJF 2COMA 2M5WA 1SD6A 4MTEA 4LK0F 4IF4A 4CHUA 2W24A 2GAUA 5L3EA 3I5UA 4XRFA 2XAQA 1IN6A 1D3YA 1KQ8A 1XCBA 3TKYA 2MD5A 5L3GA 3COAC 1O57A 1LQ1A 1K78A 3DF8A 3N4MA 5LGNA 3DQVC 3QPTA 4M9ZA 3ZMUA 4HOBA 1D8JA 4LMYA 1ZREA 1UHWA 3L00A 3NRVA 5H6RA 3FXQA 1FT9A 2A6EF 2O6GE 1OKRA 4KN4X 1IN7A 4LG0A 1AWCA 2JTVA 4I0AA 2DI3A 4M71A 5E1ZB 3QOPA 1Z1DA 4G94A 1NHAA 3JSOA 4A6DA 1SD5A 3KP3A 4BHBA 4M6XA 1LVAA 1TQPA 1U5TA 1TQIA 4KICA 2VE8A 2CW0F 2RVCA 2NYXA 1MZBA 1XGMA 1XGNA 2QENA 1V4RA 1G3TA 1PP7U 3WGIA 4OU0A 2CFXA 2RV8A 2KKOA 4LD5A 1G4DA 2H09A 3CJNA 1W7PD 2JRTA 3TOAA 2NNYA 3I54A 4BXUA 1BIAA 4IRGA 3M8FA 1G3YA 4YFKF 4OINF 2QBYB 4EM2A 3FX3A 2MLGA 1FWZA 4BNCA 4ZH4F 1MDMB 2RQPA 4HX7A 1C0WA 2ESHA 3OV8A 1USTA 4G6DA 4PDKA 2EV0A 1Q1HA 2P5LC 2Z5UA 5LGUA 5HVQC 5LHGA 2EFNA 3T8TA 1HSJA 2WV0A 4KNYA 3BOQA 2XHKA 4Q48A 4U7DA 5ERIA 2IW5A 3F8MA 1W4MA 2QBYA 1RI7A 2ACJA 4BHPA 1BN5A 1LB2A 2LF8A 4R1HA 3HOTA 4NB5A 1I1GA 2P7CB 3KE2A 1K7AA 2VXZA 1MDMA 3HIFA 2L4AA 4FHTA 4PGGA 2KIMA 5K5RA 1BBYA 2YSRA 1R5GA 3DFGA 2DT5A 5AIPA 4KIGA 3ERED 2VONA 3GEZA 3K0LA 1T0FA 1GVJA 3FM5A 3VOEA 1S7AA 1A04A 1IN4A 4G7ZF 1IXCA 2W85A 3U2RA 5H20A 1RUOA 1JHFA 1S8NA 3KLNA 1H9TA 3JTHA 4UUVA 3K1MA 3D5LA 3CO7C 3K2ZA 5CYVA 4KA4A 1O3TA 1EH6A 4DQ2A 1RIOH 3GLXA 2Q2EA 1FC3A 2OD5A 1SMYF 4A5MA 2VC0A 2A61A 2XKOA 2AS5F 1TW3A 1FZPB 1GHCA 1ULYA 4GYGA 1IAWA 3MEXA 2RC4A 2OZUA 5D5WB 2EK5A 1S6LA 2M87A 1I1SA 4EM0B 2EFWA 1IUYA 1VTNC 2A3SA 1KYZA 1YQAA 2O03A 1U5TC 4A0XA 3HYIA 5FO5A 3WTWC 4HDUA 2XRNA 1KA8A 4I2OA 3PFIA 3VB2A 3V8KA 1EH7A 1LJ9A 3G3ZA 2L02A 4AD9A 5BQTA 5A2QZ 2W84A 1L0OC 4LLNA 4G8XA 2PEXA 2G7HA 3F8BA 1XCVA 2ZJ2A 2FSWA 1R22A 1FYLA 1JHHA 2ZO4A 4WWCA 5ICCA 3HSFA 3BPVA 4HW0A 1XMAA 2PI0A 1ZH5A 4CZZA 5J6XA 2P8TA 3WE2A 1XB4A 4MTDA 1X3UA 1FYMA 3ML6A 1OR7A 3WE3A 2H6BA 4HQEA 3P9CA 3R60A 1LDKB 3REOA 4BH9A 4HF2A 2D2WA 3HUGA 3EDPA 2GA2A 1TTYA 2HKOA 5JHUA 4L9JA 2L3DA 3C3WA 1CGPA 1DUXC 3KP4A 4KIBA 4EJUA 3E6BA 4UV8A 5D5VB 3ZP5A 1O7FA 1SMTA 2XAJA 2K27A 1EH8A 1BI3A 3WTYC 1U3EM 2Z3YA 5D4RA 2NRAC 5D8LB 1I5ZA 4LGWA 5ILUA 5A2QK 5CLSA 4EJWA 2CWEA 3RPUA 2G9WA 4Q4ZF 4I01A 3FM3A 3L9FA 1K6OA 1R36A 3BPXA 2XKPA 3F8NA 2D1HA 1T39A 1J75A 2ZNYA 2OBPA 4I98B 3I58A 3T0YA 1P4XA 2P6TA 3N97A 5LEJA 2DPDA 2IRFG 1BI1A 4CXFA 3AAFA 1RUNA 4EM1A 4ENNA 4BQAA 4M6YA 2OQGA 1FNNA 3JAMK 3OOPA 4CO8A 1QZYA 4U0YA 1DP7P 3NQOA 2HTSA 4MQ9F 1BC7C 4BYYA 3LSTA 5F1RA 2RDPA 2MBFA 1Z6TA 3QU6A 4EMSA 1B9NA 3V4GA 3ISPA 4YIIA 2BGCA 2W25A 1TW2A 1O3SA 3GZ5A 1F5TA 3I59A 5FD6A 4WXCA 4EJVA 1BI0A 3CLOA 1ON2A 3JAMZ 5LRRA 2LF7A 5LLQA 4ZZDA 1S3JA 1U5TB 5ICFA 5CJ9A 4LB6B 3TDUC 3JSPA 2P4WA 1D8KA 2ISYA 4HAMA 4L0ZB 4UV9A 3WU1B 5BOXA 1P4AA 5E18F 2RGVA 1U6GA 4P5OA 3KFWX 4EJOA 3G73A 2XAHA 1ONVA 2HEOA 4U0VA 3U1DA 4P9UA 1YIOA 3FWEA 4O5VA 1KQ0A 4LJZF 3RKWA 1HW2A 5CVVA 2QUFA 1ZN2A 4G7HF 1ZG1A 4HA8A 3EYIA 1O3QA 2BBYA 3KP7A 4U0WA 1SFEA 1WKMA 1MJAA 4I0BA 4IXAA 2QQAA 2KJCA 1SFUA 3RPQA 3FZVA 5JFRA 1XSXA 3J80K 2HKXA 2VBYA 3HOSA 2JSCA 1E17A 2VT3A 1JE8A 2QM3A 2K02A 4D0PA 5E20A 4XLPF 1K79A 3CUQC 2XAGA 4RB3C 1PP8F 2PJPA 2A5YB 1XD7A 2PMUA 3HRUA 3WTUC 2E7XA 2AXLA 4RS8A 2O0YA 1ODDA 2ZMEA 5AONA 2VOPA 1P2FA 2RNJA 4G7OF 4Q5SF 5ILVA 2V79A 4WXHA 2KRFA 3ZMSA 2EJRA 2O8XA 1ZG5A 3F8CA 4HLXA 3H3ZA 2VBWA 3U9GA 3RIRA 4ZYDA 1D5VA 3LAJA 2WWYA 3GX4X 5DD4A 2MC3A 1FP2A 3DKWA 2VODA 4FX4A 2C6YA 3MWMA 2IVMA 2V9VA 4KT5C 3RDIA
chains in the Genus database with same CATH superfamily
2FXAA 3G1LA 3RZDJ 2KDZA 3OR2C 5B1BH 3WGHA 1IV6A 1UCRA 2MA3A 4ZDLA 4XLCA 5E1XA 1T2KA 5LBQA 4HBLA 5AIQA 3CMEI 2HZDA 5DCMB 3RYRA 4BEHB 2R7FA 3LSKA 3FMRA 2PMHA 2HXIA 3E97A 4I7HA 3ABUA 4A5NA 3OR1C 5BPDA 1RESA 1GDTA 3GFMA 5KAFC 1AKHB 2BXYA 5FKMA 2JK3A 2K85A 1IN5A 2FNAA 1B1BA 2EZIA 2Y0SA 3HOWJ 3BJOA 1XGOA 4G9YA 3AFHA 3SJMA 4V19K 1BOAA 4HV5A 1J2XA 3LFUA 4PSWA 3O2PE 1R71A 2M0CA 1IF1A 2F6CA 5J3LA 3F22A 1ON1A 3DV8A 2VC1A 2V6EA 1VF9A 3V7RA 2JUCA 1WI9A 2E1MC 3FDYA 4ZTFA 1D0ZA 1YX5A 3BJAA 2IEKA 1EV7A 4HV6A 4XLHA 5FLXZ 1M1EB 3DPTA 4L5EA 1QBJA 5LD2C 1G59A 3HRMA 2I5UA 2GQQA 3CUOA 1ZAOA 4UVBA 3OYEA 1IV8A 1ZGAA 4XKCA 4AIJA 2L9RA 3RJPA 3PQKA 2HOTA 3WTZA 5K7FA 3WG7H 5GP9A 1IRZA 3WTTC 3BR1A 3OYBA 2KIQA 3LA3A 3E6CC 3FXUA 2ESNA 3HPHA 3FMQA 3WTXC 3TW6A 1FBQA 2V9PA 4BE1A 3UKGA 2DFFA 3R61A 3QYBA 2DW4A 1ETKA 1PUEE 4UHTA 2DU9A 1IW7F 2EFQA 1U0JA 3UR3C 3L2CA 1TT0A 4F52A 4GFBA 1K4SA 1P92A 1T08B 2FE3A 5FKLA 3AL0C 1BC8C 1UZCA 2R7TA 2OCEA 4M3FA 2JA5J 2QQBA 3MCZA 2ZXWH 1BL0A 1Q1VA 3MZYA 1ZR2A 2WTEA 2VQCA 3EUHC 3Q0VA 2L7FP 2XGXA 5FLXK 5EGOA 2DQLA 2VB6A 2HI3A 4HNTA 1OYYA 1A35A 3S1QJ 5EEHA 3L7WA 1R7JA 2FBKA 3SEZA 3G71I 2K9LA 1RNLA 2NVTJ 1W7PA 4XL9A 5E3MA 1TL8A 5BS6A 2OA4A 4R79A 2L4MA 1R23A 1G3WA 2XDVA 3OL4A 4M74A 2VJJA 3EUKL 4ASNA 1R4MB 2LKPA 5IOYA 1SAUA 4L9VA 5CVJA 3HGGA 2PN6A 3HM5A 4DNCA 2XF5A 4RB2C 2K4BA 3DU6A 4RMNA 1R5HA 3I53A 4HYEA 3OY9A 3CDHA 3V8JA 2LD5A 4M3BA 4A0YA 3JCUC 2G7UA 3LWFA 2Y9ZA 1OYWA 2ZXIA 2PMZN 2FRHA 4XONA 3L2VA 4XK4A 2VJIA 3BZKA 3PO2J 3C2GA 1QZZA 3WU2C 4CYCB 1Y0NA 4D1QA 1Z7LA 4IHYA 4ZYGA 1CF7B 3IKVA 2M34A 2VQLA 2R5YB 1XN7A 1S7EA 3OWTA 3SZTA 2GXAA 1K78B 2JN6A 3CC4I 1CQTA 4N0BA 1FSEA 3CCMI 5D6FA 3GO5A 1VQOI 2Z33A 2I10A 4IRHA 4OIRF 1JTYA 3OIPA 4XSZF 1PYVA 4MFEA 2DJNA 2IP2A 3KYDB 2DDAA 1LEAA 1TWHJ 3F72A 3RQIA 2GIZA 3OIOA 2LKXA 3HKZA 4N9IA 1J59A 1MKMA 1FJLA 3J81K 1HDPA 3G1MA 3PNVA 2XB5A 5EDNA 3DP7A 4CGZA 1JKPC 3K70D 1YO5C 1MMNA 4M72A 3U21A 4D5FA 1QZEA 5DEQA 1MD0A 2P5KA 1Z0XA 2CO5A 1R1VA 3K2AA 1MJ9A 4P96A 2CUEA 1R49A 1DDNA 1BA5A 3BG7A 4X1EA 5IOZA 1B8IB 3QPHA 1YRNA 3LL7A 5FROA 4YFNF 3GTJJ 2ZSHB 2OTLI 2NVUB 1Z6RA 4QPOA 4Z2YA 3HOZJ 1X58A 2DOFA 1H0MA 2VJ5A 3KP6A 5CKTA 2ECBA 2KL4A 2JUGA 2I8DA 3BC8A 2QSGX 4CCMA 5KVRA 2CYYA 4QSHA 2BY0A 3H0GJ 2A69F 2XVCA 1ETXA 1RPWA 5BMZA 3SFZA 3M07A 3I59B 2AQFA 3WTVC 2WBMA 4Z6YA 3K9TA 3O6BB 3E3VA 2VT2A 2DA6A 2ME0A 3PQJA 4G6TB 3R0JA 4DGWB 3PJRA 3G4SI 1MBHA 1WSUA 3HPGA 5JLWA 3H5NA 4LLLA 1SVOA 2AHQA 2QZ8A 2RKHA 2FQ4A 3BTJA 3KP5A 4YIRX 2FNPA 2IA1A 1HC8A 3BZCA 3GFJA 4PSXA 2V1UA 3CTAA 2IGMA 1WH7A 1ETWA 1J0RA 2FMYA 3ELKA 4I02A 1LPQA 3ZR8X 3F23A 2O7OA 2LYCA 3PUBA 3LSPA 1G3SA 3QAHA 4RAZA 1W5SA 2ZMEC 4XORA 1G6NA 4B09A 2FU4A 3LFKA 4L5IA 4M3DA 3K1NA 3MKWB 2DMPA 3Q9SA 1A36A 5HLTA 3H3UA 3DTIA 2NS0A 1J09A 1AA7A 2BV6A 4FE7A 2X6YA 4AYBN 5IT9Z 1LDJA 1FBUA 2BHYA 1I39A 1E0EA 1TT5B 1OYIA 2DT6A 3CDIA 2YPRA 3E6MA 3VSKA 4EV0A 4M73A 2PBIA 2F5CA 1U2WA 4BE2A 2ECCA 4RM3A 2M8GX 2R7DA 2R7RA 4LB5A 5HNHA 2VLAA 2KP6A 1XSVA 3R0AA 2JPCA 4XKWA 3R6SA 3H3VK 2LR8A 4DZJA 1WGXA 2BXZA 2FMLA 2P7VB 4YFXF 3I64A 2IS2A 3L09A 1BM9A 4B48A 4RGSA 4ZYHA 4M3EA 2EFOA 2DA1A 1ETYA 1XDUA 1IDYA 4LK1F 1F43A 3JRAA 2QSHX 4GO1A 1MNEA 2Q1ZB 5M5XJ 2PJRB 4HG2A 3TP3A 5HS7A 4PCQA 1ZGWA 3OMYA 2G0EA 2E2JJ 1KGSA 2B0LA 2ISZA 4A3BJ 4GRIA 1FY7A 2HVQA 3PSFA 4A3JJ 5K5OA 4C2UA 2WAQN 2CV1A 5GPAA 5D8KB 2EB7A 2K9SA 3HGYA 3HRTA 3MAJA 1X4OA 2ELHA 4AVPA 4G12A 4DW6A 1U78A 3ESWB 2L5QA 4E7ZA 2F5EA 5CVUA 3EETA 5LHIA 4ZDOA 2M3AA 1YTYA 3MVPA 1SD4A 5IY5H 3LOCA 1X4PA 2CRGA 2LKSA 3ERMA 2VL8A 3QOEA 1DPRA 2QWWA 4XKBA 3W2WA 5GTHC 4KFCA 1F4KA 2DLLA 4HX8A 2K7LA 5TJJA 1XC5A 4GGGA 4MGRA 1K61A 3L1PA 2CUJA 1REPC 2W48A 3IWFA 2VE9A 5B5EC 3NARA 4C3IJ 4HZFA 3BG6A 3GVAA 1D0YA 2PFBA 1I3AA 2DMQA 2PX9A 3ZMDA 3OIQA 4RA2A 3OYGA 3C18A 2E1MB 3ONQA 3ZN0A 1W36D 2EILH 3ASNH 2IPQX 5LHHA 5HS8A 1TQMA 4XRSA 2WB1A 4NDLA 4XOPA 1T8IA 1IJWC 3ZMTA 4UB8C 4AIDA 2R7ZJ 4KDPA 4CCLA 1SAXA 2FA5A 2OQRA 2MD0A 3IRQA 1FSHA 3KYCB 2E7WA 3TP0A 1YG2A 1J9IA 3KEQA 3AG3H 1V5GA 3FHZA 1HCRA 5CQGA 4HX4A 3V7SA 5EG0B 2DA7A 2OZ6A 2LBFA 3B6AA 2LH9A 4YG2F 1FMVA 4U88A 5HDGA 5D5XB 3CCQI 3DBLB 4MQVA 2EINH 2JSPA 5ICGA 1VQKI 3S93A 2HQAA 4ENJA 3O3KA 4PGHA 4QIWN 2X1EA 1A6IA 4JX4A 5H6QA 4XM3A 4A3DJ 4W1UA 4Y4RA 1LUJB 2NAZA 2M4KA 2CUZA 3LQRA 4BEHA 2HS5A 2WA0A 3HTSB 1WJCA 2E5ZA 4F3QA 4P9FA 4F7ZA 4AWXB 5IPAA 1PJRA 1U8RA 3GXOA 4A69C 3E0JB 1Z05A 2VKEA 1ZTRA 2IT0A 4FT8A 1YFHA 4PJMA 3AKZA 2J5OA 4A3LJ 2ZJQF 1Y0UA 2EZKA 3DLAA 4B43A 4WCGA 1EA3A 3D5SC 1YIJI 4QTRA 3CJQB 3CP2A 1WWXA 3IUOA 2Q0OA 2H6CA 2CFOA 2XUBA 3P7NA 3RTRA 1KU2A 1HKTA 1MMGA 1LDDA 1IGNA 2ZCWA 2KDOA 1R6RA 4RLFA 5GAGJ 3K7AJ 1UHSA 4L9NA 5BPIA 5JVTA 2JA6J 1MBGA 2ZXJA 3A01B 2BVLA 1YW8A 4A0ZA 1UFMA 3W6VA 2JWTA 1EKEA 3SZPA 2XRLA 1BJAA 5EEGA 3GTMJ 5D4SA 3GCMA 5DV5A 4HQMA 3S2WA 5HDNA 1LFUP 2XAFA 4Y7NJ 4O3MA 1JT6A 2GWRA 1Z7UA 2P5VA 3VEPA 5E8GA 5IYBJ 2XPVA 3I71A 2V7FA 4ETSA 4Y3OA 1N78A 1Y8QB 2DMTA 4RB1A 5DM7F 3NAUA 4RB0A 4CDGA 3GZ6A 2A6HF 1VQ7I 1VQMI 3RI4A 1OCPA 1WI3A 1W36C 1X1CA 3GF2A 4XRMA 1B9MA 3PNTA 1YLFA 2MSYA 3IKTA 2HPIA 4II2A 1ZARA 1ZK8A 4DOZA 1BIBA 3DEUA 2R0QC 3Q9VA 2NVYJ 3TDZC 1LKXA 4PJJA 4XICA 2EIKH 2HNHA 3AG2H 2L01A 3NEUA 2F48A 3F8FA 1JUPA 3JRHA 1IRGA 2F5DA 1SEUA 2LY2A 1I3QJ 3HJEA 1MSFC 5F64A 2DBBA 2LNBA 3OSFA 1AKHA 2K9QA 2LC2A 5GTIC 4S05A 2K86A 2WB1N 3KETA 1VQ4I 3L2QA 4AIKA 3ZMZA 2P6SA 3WODF 5HDKA 1OJLA 4BXFA 1KYWA 2QKMB 4HDVA 3F6VA 1Z91A 2ZKZA 4OMYA 1I50J 1KQ9A 1B8IA 4GCVA 2QLZA 1W0TA 5DTDA 2O61A 1ZQ3P 3ABLH 2ZBKA 4MFDA 1BR4A 2XB0X 1PDNC 4WX9A 2HVSA 2TRTA 4DYQA 4XQFA 1T38A 1WZ2A 1W5TA 4OMZA 3S2DJ 3BR6A 1RETA 2IXSA 1K6YA 1T56A 2IAIA 4NNJA 3M9AA 1YJWI 2JT1A 2WAFA 3ECOA 4ZYEA 5DM6F 3EUHA 3IC7A 4PFOA 2EA2A 3DEWA 6PAXA 1B59A 3H5AA 4OIQF 3O8HA 4GYIA 3HRSA 5IT3A 1GUUA 4LG0B 3HOUJ 3RZOJ 4B3XA 2WAQA 1FIAA 2YX4A 4M9XA 3TOBA 2F4OB 3RQ4A 1KU9A 3IAS2 4E70A 3FXOA 1H9GA 4A12A 2HYFA 5J4VA 4BGDA 1DQUA 1E2XA 3CQZJ 1A31A 3JTGA 2PQ8A 1PUFB 2BY1A 2HR3A 1S29A 2DFEA 3DPUA 2EH3A 3GFIA 2Z2SB 2NS7A 2F5FA 2ZSIB 3JW4A 3V8LA 2PLYA 3VYTB 4PZJA 4YELA 3IWZA 1ZLKA 1BOBA 2CW8A 2WADA 4KIFA 5HS9A 2LFBA 2BE5F 2QVOA 3GWZA 1R1UA 2YUSA 2EIMH 1X2MA 3QP5A 3VWBA 1HKSA 2X4HA 3GUDA 3CJTB 2NOGA 1NG7A 4PJLA 5B1AH 5FKOA 3Q5FA 3BR2A 3KEOA 2GZWA 2V1XA 1U9OA 5HLGA 1TNSA 2HYGD 2LDUA 2NXNB 4A3MJ 4JBAA 3IV5A 1YRNB 5ICEA 3ZQIA 1MNMC 2ZFWA 2IBDA 3QYEA 4ESFA 2R7WA 4HF1A 4FTHA 3K6GA 4JQFA 3HSEA 2CV2A 5L3CA 2DK5A 3TGNA 2OAZA 1Y6IA 2YR2A 4OAZA 2KJBA 4RAYA 4F92B 1ERDA 4MIMA 5FFXA 1HW1A 2OF7A 2X1DA 1QO0D 3QU3A 4B3AA 4LFUA 4EVIA 5FGMA 3E5QA 2ELJA 4QLCU 5ED4A 2DA2A 3BDDA 4RGXA 3K69A 3ZQLA 5JHFA 2MLKA 5FLMJ 2M1BA 2VBZA 4CZCA 5LGTA 3F6OA 2DMUA 1MMSA 3HHGA 1VQ5I 4LIVA 2DA4A 2ELKA 3VPRA 2FD5A 2OJED 3T8RA 4FE4A 1TWAJ 4LLGF 2STTA 3ZQ7A 3PNYA 3GZNB 1IC8A 2V1DA 1YYVA 1HXDA 2W1OA 5FD5A 1UB9A 3BZ6A 5DD8A 1BR2A 5DS9A 3KIOA 1D1CA 3I4MJ 4UVCA 4XLFA 1OCTC 3CCLI 3J7AY 1SC7A 1R00A 3FXRA 5F1JA 2DO7A 1ZG3A 3K4NA 3BQYA 2O3FA 3FXLA 3PM1A 3ZPLA 1YS6A 1YOVB 2A68F 4BXXJ 3C1DA 5DUIA 1UHMA 1WRJA 4KN7X 2BW3B 3O8GA 3FMSA 4BHCA 3EQLF 1T0FC 3FBIB 4BL0B 1LEBA 2QYOA 2X51A 5FKNA 3F21A 2LK2A 5FRNA 4CA0A 3J80Z 4Y13A 3SDGA 3G6EI 1MBEA 3CCRI 2NOJB 2FBIA 4YRVA 1QPMA 5DCMA 2FEZA 3LA7A 4WF2A 3E1SA 2BY2A 4ANJA 1MBJA 4RM2A 2D1VA 3JRIA 1WJFA 1STZA 2YU9J 3R4KA 1L3LA 4J00A 3TO9A 5CVRA 1J7KA 1OMIA 1Y1VJ 2O5RA 2PG4A 1QNTA 2X48A 3HKZN 4U7BA 1SANA 2BZTA 3HDDA 4LIUA 1ENHA 1RKWA 3IH3A 3MKYB 2VKDA 2BYVE 3ASOH 3ECHA 5H2FC 3CCJI 1E3HA 1WVRA 1MMDA 3I3LA 3LA2A 2BY3A 1XDSA 1AOYA 4S04A 2OV7A 4ZYAA 5DUKA 4XBFA 4I6ZA 1ZLJA 3S17J 3S15J 2MH2A 1U9NA 5K5QA 1TNTA 4R8HA 2L2OA 3KX2A 2XSJC 1VQ9I 1JTXA 1HDDC 3HC7A 3WTSC 3VYSB 1A5JA 3P9KA 4N9HA 1D5YA 3V7CA 1XSDA 4HF0A 2R7XA 2VBXA 4M9SA 3JRFA 3RKYA 1QRYA 4ZZLA 1VQ6I 2Z16A 3EPZA 1ZRCA 2D45A 5HLHA 2CQKA 4KUMA 2HDCA 3FK6A 2NNNA 4ZC3A 3CUQA 2K3FA 4A2UA 2JVHA 5J8CA 2LRDA 5E8IA 1FP1D 2CV0A 3ZQFA 4F91B 2L0KA 2UXXA 1WJ5A 3Q0WA 1R1TA 2Y0MA 5D5UB 3B6CA 2IA2A 2WV1A 1TWCJ 5F6FA 1Y8RB 4I09A 5IP9J 3F3XA 4D7MA 2KZVA 4M6VA 3E7LA 2R5ZB 4HSTA 4FX0A 2A07F 4YEJA 3ULQB 1D0XA 1BW6A 1SVMA 2BEOA 1HW5A 1K83J 1B4AA 4OWRB 1J5YA 4IHTA 3J7AO 4A6EA 5GAHJ 1F9NA 4JK1X 4MEXF 5JR3A 2R4GA 3WU0A 4HLYA 4RGRA 2M8EA 1WQ2A 1HBXG 2VI6A 5J47A 1IO2A 3PSIA 2ME6A 3GTPJ 1F36A 3FBNB 4Y15A 1QVUA 5ILSA 2DQRA 1OPCA 4C3JJ 3LSRA 1ZHFA 3J81Z 2YX7A 4XN0A 3GYHX 2AQEA 5JI6A 1JT0A 3A4CA 4ENMA 3BLYA 3HTUA 3M8EA 5KK1A 1GT0C 3W3CA 1IXSB 3IRRA 1Z9CA 2L9NA 1WJAA 3FK7A 4DZPA 2B9SA 2UWMA 4E7JA 2DA5A 5E79C 5IP7J 3W6JB 1TLHB 2XPUA 5DYMA 3B73A 5J8FA 1CF7A 1GXQA 4CUGA 3BP8A 1ZGJA 3P9IA 1JJ6C 3GTGJ 5HOOA 3HOXJ 5KNLA 2R3SA 3LMMA 4RAGA 2DA3A 3M1EA 4JP0A 2XGEA 3J7YJ 2OUMA 2XGCA 1HKQA 4NHJA 5IYCJ 1ZRDA 1V3FA 1I27A 4XLNF 4BAYA 1LE8A 3RYPA 4B44A 3VFZA 4BS9A 1HOMA 3HXLA 2QF7A 3H92A 1MGTA 2HXOA 2LMDA 1JGSA 3J7ZI 5JVGF 3GTQJ 3HUGB 2DMNA 4IRIA 1MBKA 3ROUA 3OYNA 2VKHA 5DDGA 3DKYA 2VKVA 4NC7A 3H9JA 1IRFA 4XRSG 4Y17A 1KU3A 1B6AA 1GLNA 1RKTA 1MH3A 2EV6A 4ENKA 1W0UA 1ZRFA 3S14J 4NC6A 4MEYF 1NG6A 3IL2A 5L3BA 1QGPA 1VQNI 5KAIC 3S1NJ 2XGDA 2FF4A 5J1UA 2IA0A 5KCMA 1S72I 3S3MA 5L3FA 1FOWA 2VOOA 2X85A 1P9QC 2CQQA 2VASA 3S3NA 4YIFA 4ITVA 1MH4A 3GFLA 2UXNA 2HGCA 3AG1H 3F0CA 5K1YA 3OS0A 2M30A 3WGGA 4EGYA 2BHZA 2ZNZA 3C7JA 1MBFA 5B3SH 5FFZA 2CMPA 4WK8F 2VPLA 2M9HA 2VXDA 3ZN1A 2HTJA 2V1NA 3TO7A 1YE9A 3FXKA 3BR3A 4B4CA 1DU0A 2K4JA 2DOEA 2L7KA 2CG4A 3LNQA 4UNOA 3MQ0A 1QPIA 1TC3C 2DPUA 2FOKA 2CW7A 1O3RA 2ADUA 5J4YA 5L3DA 3TW7A 5DCFA 2JZYA 3PIPF 4L18B 1P4WA 1R58A 2AO9A 5M5YJ 2LVSA 1TWFJ 2Q2EB 2B7EA 1TP4A 2DJIA 3BWGA 1XMKA 4A3KJ 3KLOA 2ZMEB 3LSGA 3SEQA 1Z67A 4RGUA 2QQ9A 1HLVA 2HFHA 1AHDP 1GXPA 3VDXA 4IHSA 3MFKA 3E5XA 2E35A 4LITA 2KQRA 4QWQA 3BJ6A 5IT9K 2CQXA 3CCEI 4IPAA 1XS9A 4DBQA 1T6SA 2FQ3A 3QPLA 1MW7A 2Z9OA 2YU3A 1HF0A 4DJAA 2DTZA 4AIHA 2KHMA 4FCYA 1AU7A 5E17F 3HOVJ 3BROA 4B8XA 1ORKA 3SHFA 5E3LA 3LAPA 3I4PA 3DPLC 3RKXA 3ZMVA 3GTOJ 3PIOF 1BI2A 1MJBA 1FYKA 4ON0A 1B72A 3K4BA 5EZHA 1E3OC 4BQQA 4JOMA 3SYTA 4DBRA 1DPUA 2GXGA 1E3PA 3S8PA 1YITI 2DTRA 3M7GA 3OYLA 4MNUA 3VODA 2JPBA 3CMMA 2LSOA 1VZ0A 2KPMA 3FXMA 3VYRB 5EF6A 3QP6A 4NUBA 1I6XA 2Z99A 4ESBA 2Y48A 3DBRB 2JA8J 3KCCA 4BBRJ 3IAM2 4EEFG 5CVIA 3CZ6A 4XSXF 3P5JA 5EGOB 3M3YJ 2L7MP 4MO7A 4MLOA 2HQRA 2AXTC 1D1AA 2H8RA 3LSMA 2PMZA 1FOKA 4RLQA 4ZTJA 3AL0B 3DEEA 2QCOA 4ABZA 1W7PB 4A3EJ 1QA6A 2R5ZA 4GXOA 1SFXA 1FIPA 2CGPA 1T98A 3TO6A 1YJ9I 1QQIA 3CUQB 4UVAA 1FMWA 1P6RA 1MSEC 1WH5A 2UUZA 1IXRC 5HLIA 4EQQA 2E1CA 3SDBA 3SXYA 1HQCA 2CUFA 3LSJA 4Q47A 1YS7A 3S32A 4FQGA 2L54A 2LY9A 4BJ5C 2DK8A 3IHUA 3CDLA 3KZYA 4IJAA 2TDXA 5C44J 2XASA 3MN2A 1RZ4A 2W57A 4P55A 5J40A 1G8XA 2RN7A 2F4MB 1N77A 4LOCA 3D1NI 4TV7A 3A0BC 2R5YA 3MZ8A 2H27A 2DFIA 1H8AC 3WG9A 4IZZA 2V6CA 3CMAI 2M45A 2JVGA 1W1WE 2L9SA 3BY6A 5LEKA 2XIGA 2QEXI 4MHGA 2KIFA 1IN8A 3OS2A 2GXBA 4O6JA 2CS3A 1R4NB 3NWSA 2CJJA 2D5VA 2XF6A 1F1ZA 5LRSA 3H9GA 2X9DA 4BY1J 2Q8KA 2MH9A 3A01A 3HB9A 1XGSA 1GV2A 2M2EA 2FBHA 1MMAA 1BR1A 4RAFA 3CO6C 3NWTA 4JX6A 5JLXA 4ZDPA 2EWNA 3HSRA 1H88C 2E1OA 4IQ4A 1O7LA 3D0SA 3H1CA 4W97A 3DU5A 4B1RA 5D6EA 2HWVA 2KZGA 3FHNA 2VQGA 2IJLA 2QGUA 2X6WA 4UXNA 4F93B 4I99C 3GW2A 2EZLA 5FB2A 2UZKA 2LP0A 3QRFF 4CH7A 2XV4S 3RCOA 4RBOA 3ZQCA 4HPQA 2XC7A 1FPQA 2RNGA 3IH4A 2FOWA 4E7LA 4L5JA 1BW5A 3TQNA 2MGQA 2HQNA 2E71A 1HSTA 5E1WA 4EJTA 2H8WA 2J5PA 4N4OB 3GTKJ 1OISA 4CCOA 4H0EA 1ZYRF 1FX7A 2EA4A 2H94A 3H35A 1FOXA 1WJBA 2Y75A 1FBSA 4IO9F 3CCVI 4CYDA 2DAOA 1FLIA 3OYDA 1UG0A 4L0YB 2KRHA 2GA1A 3KP2A 2EFPA 4QPQA 2STWA 1TBXA 2F2EA 2XROA 2E2HJ 4OIOF 2X0LA 2EV5A 2ETHA 4K2EA 3W2AA 1Y1WJ 5BNGA 2VN2A 5F27A 1SFOJ 4E7KA 2EZHA 4WXDA 1IG7A 1JXSA 4OOIA 1LVKA 2CSOA 2LREA 2EIJH 3FF5A 1LNWA 4OIPF 3EYYA 3W6KB 1V5FA 3QODA 1DGRM 2HOEA 3K70C 3HHHA 4IX7A 2DN0A 3ZQQA 3T1BA 2QQ8A 3DCFA 1TWGJ 1SD7A 1IZ1A 2GIVA 2ZFUA 2ZJRF 4KMFA 3ABTA 2OU2A 3OYJA 5TRDA 4L9TA 4CICA 4AU7A 4KYWA 3LQQA 3K1PA 1USSA 2HZTA 4J19A 1POGA 4BBSJ 4BU2A 3E5UA 2WC2A 4IVNA 3ABKH 4ZJZA 3CF2A 4EGZA 3T5XA 4ESJA 1YW9A 1SVLA 3KZZA 1TZLA 3MZHA 3I0TA 4D5CA 2KIUA 2Y9YA 1PUFA 2R7UA 4J01A 1T95A 3S3OA 1S7OA 2K9MA 1JKQC 4G6QA 1KU7A 4KMUX 5F08A 3SQNA 3E6DA 4NQWA 1YW7A 2IS1A 2E1NA 3B02A 3DXJF 4XIDA 4C9YA 1W5CC 2COMA 2JJ7A 1DU6A 2M5WA 2M4GA 2K3PA 1SD6A 2A5WA 1QVTA 4MTEA 4LK0F 1R5ID 4IF4A 4CHUA 2W24A 3H0DA 2DDBA 2GAUA 3DTKA 3TL4X 5FJ8J 1VQLI 5L3EA 3I5UA 4XRFA 2XAQA 3F9KA 1IN6A 1D3YA 1KQ8A 1XCBA 2QSFX 1LFPA 5M3FJ 3KYLA 3TKYA 4HNVA 2HPMA 2MD5A 2R7QA 1OLTA 2JRMA 2LY1A 5L3GA 1JUMA 2X1CA 3COAC 2K5CA 1O57A 1UELB 1VQ8I 1LQ1A 1K78A 4N4NB 3DF8A 3N4MA 5LGNA 3KZIC 3DQVC 3KPHA 3QPTA 2H1KA 5J1YA 4M9ZA 9ANTA 3I55I 2GOMA 3VYUB 3ZMUA 1OCZH 1WHUA 2X6XA 4HOBA 2Y2ZA 1D8JA 4LMYA 1ZREA 5M5WJ 1ETOA 1UHWA 3L00A 2GBYA 1Z3YA 3NRVA 2M0MA 5H6RA 1P7IA 1DP3A 4KISA 1X19A 3FXQA 1FT9A 2A6EF 2O6GE 1OKRA 4KN4X 4IHXA 2LG4A 4C30A 1IN7A 3FIWA 3CF5F 3FISA 4LG0A 1AWCA 3VSLA 2JTVA 4I0AA 2DI3A 2HQ5A 4M71A 5E1ZB 3QOPA 2QKLB 4M3GA 2HVRA 1Z1DA 4G94A 1NHAA 2V4JC 4XOTA 2JA7J 1FOYA 3JSOA 1FEXA 4PK4A 4A6DA 4C2MJ 1S5LC 1SD5A 3HZJA 4NC8A 3KP3A 4BHBA 1ACIA 4M6XA 3OYIA 3JRGA 1LVAA 1TQPA 1U5TA 2W4SA 4A3CJ 1TQIA 2FJ1A 4HNUA 1Z3XA 1XX5A 4KICA 2VE8A 2CW0F 2KT0A 1LE8B 2DYSH 2RVCA 4X6AJ 2NYXA 1JJ8C 2OC6A 1MZBA 1MNDA 2IGNA 4DYRA 5C4XJ 2W00A 3DBHB 3ZCOA 3FKIJ 1XGMA 1XGNA 1ZKGA 2GM4A 2QENA 1APLC 2OPTA 1V4RA 1G3TA 3MKLA 1PP7U 1JI8A 3WGIA 3ZGKA 4KT6A 3C2HA 4OU0A 3RPUD 2XPWA 2DT7B 3S16J 2TCTA 1IUFA 4CYCA 3DLLF 2CQ7A 4E7HA 2CFXA 2RV8A 2KMUA 1OQYA 2KKOA 4LD5A 5GAEJ 2H09A 3CJNA 1W7PD 2JRTA 3TOAA 1G4DA 2NNYA 3I54A 1WPKA 4BXUA 1BIAA 4IRGA 3M8FA 3BCAA 2KISA 3OSGA 1G3YA 4YFKF 4OINF 2QBYB 4X0GA 4EM2A 3FX3A 2MLGA 4IHVA 2VQHA 5IP6A 1FWZA 4D7NA 5FKKA 4AUXA 4BNCA 4BQOA 4ZH4F 1MDMB 2RQPA 4HX7A 1C0WA 2ESHA 3OV8A 1USTA 3OYFA 4G6DA 1HA8A 2FX0A 3K4CA 4PDKA 2EV0A 4IHWA 1Q1HA 3GMEA 1V54H 1WJDA 2P5LC 2Z5UA 5LGUA 2ZC2A 5HVQC 1ITYA 1N25A 5LHGA 2X6OA 3I4NJ 2EFNA 5F0FA 3T8TA 1HSJA 2WV0A 1Y39A 4KNYA 3BOQA 4BE0A 2O9LA 2XHKA 4Q48A 4GDFA 4U7DA 2VPRA 5ERIA 2V9KA 4E6KG 2IGKA 1XG1A 1ETVA 2IW5A 3F8MA 1UAAA 1W4MA 2QBYA 4XNFA 2M7BA 1RI7A 4FISA 2ACJA 1BN5A 4BHPA 4R1HA 2LF8A 2N8GA 1LB2A 3GLLA 3CCYA 2OTJI 3ZRGA 3HOTA 4NB5A 3S1RJ 1I1GA 2P7CB 1VFCA 3KE2A 1K7AA 2VXZA 2W82A 1MDMA 4Y33A 2O8KA 3A03A 3HIFA 3W2VA 2L4AA 3ABMH 4FHTA 4PGGA 3OS1A 2KIMA 4XLAA 5K5RA 1BBYA 1UJ8A 1RRJA 2YSRA 1QU3A 5GPCA 2WY7Q 1R5GA 3DFGA 2DT5A 5AIPA 4HRIA 4KIGA 3ERED 3C2BA 2VONA 3EUAA 1B72B 3GEZA 3K0LA 1T0FA 1GVJA 3FM5A 3VOEA 2F5VA 3SZGA 3HOYJ 3DTEA 1S7AA 1A04A 3CLQA 1IN4A 2H1LA 4IQJA 4G7ZF 1IXCA 4BJ6C 2W85A 3U2RA 4S0HB 5H20A 4C3HJ 1RUOA 4JX5A 1JHFA 1QHGA 1S8NA 5C3EJ 3BG5A 1MIJA 2QA4I 3OOUA 4Y52J 2F4IA 3KLNA 1H9TA 1V55H 3JTHA 4UUVA 4XN3A 2E36A 3K1MA 3QQAA 2YS9A 3D5LA 2EPFA 4BKXA 4LG3A 3K2ZA 3CO7C 5CQEA 2R7VA 1GVDA 5CYVA 4KA4A 1O3TA 1EH6A 4PJNA 2Z1DA 4DQ2A 1RIOH 2Y31A 3GLXA 5CPRB 4F55A 3LSIA 2Q2EA 3CCSI 1FC3A 2OD5A 1SMYF 2K9NA 4A5MA 2VC0A 5EEAA 2WY8Q 1I6HJ 2Y69H 2A61A 1Y56A 3MD2A 1XTAA 1IRXA 2MABA 2XKOA 2HOSA 4KJZA 1P7JA 1TW3A 2E19A 1FZPB 2AS5F 3BCBA 2CQNA 1GHCA 1ULYA 4GYGA 1IAWA 3MEXA 2L9VA 2RC4A 2OZUA 1X1PA 4I76A 1T33A 5D5WB 2EK5A 1S6LA 2M87A 3DWLE 3LSHA 1I1SA 4EM0B 1XPXA 2EFWA 2KLOA 1OFCX 1QHHD 2IS6A 2ICWG 1IUYA 4CCJA 1NH3A 3K4KA 1VTNC 4PUSA 5TISC 3AG4H 2A3SA 2XF7A 4C2TA 1KYZA 4P1WA 3RSNA 4XMYA 4B47A 1RC9A 1YJNI 1YQAA 2O03A 4AYBA 1ETQA 2L7ZA 2JQ7A 3BTCA 4IKFA 1G2HA 1OCRH 3K4JA 1U5TC 4A0XA 3A02A 4IEJA 3HYIA 5FO5A 3WTWC 4HDUA 1OCOH 3I56I 3CMYA 3CCUI 2XRNA 2NVXJ 1KA8A 5HNFA 4OAYA 4I2OA 3PFIA 3VB2A 3V8KA 3M4OJ 4NBQA 1EH7A 3OYAA 1D1BA 1LJ9A 3G3ZA 2L02A 1OCCH 3OL3A 4AD9A 5BQTA 3K4MA 5A2QZ 1NK2P 2W84A 1L0OC 4LLNA 4AC0A 1K4TA 5B66C 4G8XA 1EF4A 2PEXA 2G7HA 4AVZA 2R7SA 1VQPI 3F8BA 1XCVA 3H36A 2ZJ2A 1DGWY 2FSWA 1R22A 2NS8A 1FYLA 5F04A 3HL2A 1JHHA 4A3IJ 2ZO4A 4WWCA 5ICCA 3HSFA 3BPVA 4HW0A 4A3FJ 1XMAA 2PI0A 3ZXSA 2Y30A 2Y0SN 1ZH5A 4CZZA 5J6XA 2P8TA 3QYFA 4BDZA 4CSWA 3WE2A 1XB4A 1EJ9A 4MTDA 4HEA2 1X3UA 3HG9A 1FYMA 3ML6A 1IDZA 1OR7A 3CJRB 3WE3A 2E5NA 3BT9A 5FRMA 1Z77A 2E34A 2H6BA 4HQEA 3P9CA 3R60A 4CCKA 3FKJA 2HU9A 1S9HA 1R9TJ 1LDKB 3REOA 2W7NA 5EJCA 4BH9A 4HF2A 1X3ZB 2R92J 2LOOA 4BQNA 2D2WA 1PVEA 3HUGA 2ID6A 3CESA 3I9V2 3Q0UA 3EDPA 3JRCA 1X3WB 2GA2A 2E2IJ 3X2QH 1TTYA 2HKOA 5JHUA 3JR9A 1KONA 3L2UA 2CU7A 4L9JA 2L3DA 1ZR4A 4E4HA 3C3WA 1CGPA 4IOCF 2BVMA 3JRBA 3TBIA 2RAEA 3ZOBA 3KP4A 1DUXC 4KIBA 2EQRA 3M8JA 4EJUA 3E6BA 4UV8A 5K7HA 5D5VB 2MC4A 1Z21A 3ZP5A 1O7FA 1SMTA 2XAJA 1OR7C 3GBGA 4JYKA 2K27A 1EH8A 1BI3A 1YX3A 3WTYC 1U3EM 3KEYA 2Z3YA 5D4RA 2NRAC 5D8LB 2M7AA 1I5ZA 2DCEA 4LGWA 5ILUA 2PJRA 5A2QK 5CLSA 4EJWA 2ZJPF 4BJTA 2CWEA 1RR7A 3RPUA 2G9WA 5LFAA 4Q4ZF 4I01A 5K7ZA 3FM3A 3L9FA 4DIQA 1H89C 1JKOC 4E7SA 1K6OA 4UUSB 1R36A 3BPXA 2HDWA 4CCNA 3OYCA 2XKPA 3OYHA 4BY7J 5J1RA 3F8NA 2D1HA 1T39A 2XAUA 1J75A 2ZNYA 1A6QA 2OBPA 4I98B 3I58A 3T0YA 2DYRH 4BUPA 1JKRC 1P4XA 2P6TA 1NK3P 2MYSA 4XLEA 3N97A 5LEJA 3BG9A 2DPDA 2EBIA 2IRFG 1LFBA 1BI1A 4CXFA 3AAFA 1RUNA 4EM1A 1N75A 2JA2A 3WHBA 3PL8A 4ENNA 5F0CA 4BQAA 4M6YA 2OQGA 1FNNA 4U87A 3JAMK 4UUSA 4BACA 1FTTA 3OOPA 4FETA 4CO8A 1QZYA 4U0YA 1JUSA 3SFIA 4RDUA 1DP7P 3NQOA 3N05A 2HTSA 3FXJA 4MQ9F 2NVQJ 1BC7C 3S1MJ 4BYYA 1RR8C 2MFZA 1WCMJ 3LSTA 1VI0A 5F1RA 2RDPA 4EATA 1BJZA 2MBFA 1Z6TA 3QU6A 4EMSA 1B9NA 3V4GA 3ISPA 5IYDJ 5TGTA 4YIIA 3CP8A 2BGCA 2W25A 1TW2A 3TEDA 3HBLA 3A1YA 3CD6I 3BTLA 1UMQA 1O3SA 2BW3A 3GZ5A 2XSDC 4PJ0C 1F5TA 1VNDA 3QWLA 2ZXHA 3I59A 4E7IA 4DYCA 2LTPA 2LLKA 3H5RA 5FD6A 4WXCA 4EJVA 2GLOA 1BI0A 2E60A 3CLOA 1ON2A 5KHDA 3JAMZ 4II3A 5LRRA 2IS4A 3D5RC 2LF7A 5LLQA 4ZZDA 2RREA 3WHCA 1S3JA 2DODA 1U5TB 5ICFA 5CJ9A 4LB6B 4BDYA 3CC7I 5F0HA 3TDUC 2HDDA 3JSPA 3CC2I 2P4WA 2JMWA 4NQWB 2FUG2 1V5EA 1D8KA 3UNGC 1X1DA 2ISYA 4HAMA 4L0ZB 4UV9A 3A0HC 3WU1B 2P81A 4A93J 3TMOA 5BOXA 3ZQHA 1YHQI 2R7OA 3BTIA 3M1CA 1P4AA 3A2KA 5E18F 1XMXA 2HOAA 1X2NA 5EZGA 2RGVA 1U6GA 4HSRA 3K4LA 4P5OA 2MG4A 2ID3A 3KFWX 4EJOA 3G73A 3IP4B 1X1BA 3S2HJ 2XAHA 3Q3SA 1ONVA 2DXIA 2HEOA 1GV5A 4U0VA 3U1DA 3DKXA 4D9JA 4P9UA 1YIOA 3OYMA 3FWEA 4O5VA 1KQ0A 4LJZF 5E3OA 3RKWA 3GTLJ 1HW2A 5CVVA 2QUFA 4KITB 1ZN2A 3MKZA 4G7HF 4HA8A 1ZG1A 5C4JJ 3EYIA 1O3QA 2BBYA 3KP7A 4U0WA 2BOLA 1SFEA 1O4XA 1WKMA 1UG2A 2LBFB 2DOAA 4PFPA 5EG0A 3K10A 4FASD 3G2BA 1MJAA 4I0BA 4IXAA 3IH2A 2GOXB 2QQAA 2CH0A 2KJCA 2A6TA 3BR0A 4UB6C 1SFUA 5E3NA 3HEFA 3RPQA 5EYRA 3BR5A 3FZVA 3H9QA 5JFRA 1XSXA 4V2GA 3V42A 2IGOA 1KZHA 2VIXA 2OCCH 3J80K 2HKXA 3ZQGA 1SFKA 2ZB9A 4AM3A 1YI2I 1WFXA 2VBYA 3HOSA 2VJ4A 3BG3A 2JSCA 1X1AA 3PO3J 2KRCA 3QPSA 1E17A 3RKQA 2VT3A 2VUMJ 1JE8A 2QM3A 1JGGA 2K02A 5HODA 2COBA 4D0PA 2DFHA 4XR6A 5E20A 4XLPF 1K79A 3CUQC 2XAGA 3PUFA 4RB3C 3BQZA 1PP8F 2PJPA 1WJEA 2KFDA 2K40A 2A5YB 1XD7A 2PMUA 3MMYB 3HRUA 2RQQA 3WTUC 2E7XA 3L2RA 3U1KA 1FTZA 2AXLA 4RS8A 3OYKA 5GADJ 2O0YA 2V26A 1ODDA 2B63J 3PFYA 2ZMEA 5AONA 2VOPA 5FLVA 4XKVA 1P2FA 2R93J 2RNJA 4A3GJ 2MW8A 4G7OF 4Q5SF 4IL6C 5ILVA 2V79A 2P0WA 4WXHA 2KRFA 2WAEA 5M3MJ 3ZMSA 1U8BA 2EJRA 2O8XA 2A05A 3F8CA 4HLXA 1ZG5A 3H3ZA 3JRDA 2VBWA 4IOAF 3U9GA 4V2FA 3RIRA 4ZYDA 2UV1A 3G1OA 1D5VA 3LAJA 2HYJA 4UY8I 2WWYA 4H4KC 3GX4X 5DD4A 2MC3A 3JREA 1FP2A 1NTCA 1ZELA 3DKWA 2VODA 3L2WA 4FX4A 4UUTA 3MWMA 2C6YA 2IVMA 2V9VA 4KT5C 3RDIA
chains in the Genus database with same CATH topology
2FXAA 3WGHA 1UCRA 2MA3A 1T2KA 5E1XA 5LBQA 4HBLA 5AIQA 5DCMB 3RYRA 2R7FA 3FMRA 2PMHA 3E97A 4I7HA 3ABUA 4A5NA 5BPDA 3GFMA 1IN5A 2FNAA 1B1BA 3BJOA 1XGOA 4G9YA 1BOAA 4HV5A 1J2XA 3O2PE 1IF1A 3F22A 1ON1A 3DV8A 2VC1A 3V7RA 1WI9A 3BJAA 1EV7A 4HV6A 5FLXZ 3DPTA 1QBJA 3HRMA 2GQQA 3CUOA 1ZAOA 4UVBA 1ZGAA 4AIJA 3RJPA 3PQKA 3WTZA 3WTTC 3LA3A 3E6CC 3FXUA 2ESNA 3FMQA 3WTXC 1FBQA 3R61A 2DW4A 1PUEE 4UHTA 2DU9A 1IW7F 2EFQA 3L2CA 1P92A 2FE3A 1BC8C 2QQBA 3MCZA 3MZYA 2WTEA 2XGXA 5FLXK 2DQLA 1OYYA 5EEHA 3L7WA 1R7JA 2FBKA 1RNLA 1W7PA 5BS6A 2OA4A 4R79A 2L4MA 1R23A 1G3WA 4M74A 4ASNA 2LKPA 4L9VA 5CVJA 2PN6A 4DNCA 4RB2C 2K4BA 1R5HA 3I53A 4HYEA 3CDHA 3V8JA 4A0YA 2G7UA 3LWFA 1OYWA 2FRHA 1QZZA 4ZYGA 1CF7B 3IKVA 1XN7A 3SZTA 1K78B 4N0BA 1FSEA 5D6FA 3GO5A 2Z33A 4IRHA 4OIRF 4XSZF 2IP2A 1LEAA 3F72A 4N9IA 1J59A 1MKMA 3J81K 3DP7A 4CGZA 1YO5C 4M72A 5DEQA 1MD0A 2P5KA 2CO5A 1R1VA 1MJ9A 4P96A 1DDNA 3QPHA 4YFNF 1Z6RA 4Z2YA 1H0MA 3KP6A 5KVRA 2CYYA 2A69F 2XVCA 5BMZA 3SFZA 3I59B 3WTVC 3K9TA 3O6BB 3E3VA 2VT2A 3PQJA 3R0JA 1WSUA 4LLLA 2RKHA 2QZ8A 3KP5A 2FNPA 2IA1A 3GFJA 2V1UA 3CTAA 1J0RA 2FMYA 3ELKA 4I02A 3F23A 1G3SA 3QAHA 4RAZA 1W5SA 1G6NA 4B09A 2FU4A 3LFKA 4L5IA 3K1NA 3Q9SA 3H3UA 2NS0A 2BV6A 5IT9Z 1LDJA 1FBUA 1OYIA 2YPRA 3E6MA 4EV0A 4M73A 2PBIA 2F5CA 1U2WA 4LB5A 2R7DA 1XSVA 3R0AA 2JPCA 3R6SA 2FMLA 2P7VB 4YFXF 3I64A 3L09A 1BM9A 4RGSA 4ZYHA 2EFOA 1XDUA 4LK1F 4GO1A 5HS7A 4PCQA 1KGSA 2B0LA 2ISZA 1FY7A 5K5OA 5D8KB 2EB7A 3HRTA 3MAJA 2ELHA 4AVPA 1U78A 2F5EA 5CVUA 3EETA 5LHIA 1YTYA 1SD4A 1DPRA 2QWWA 4KFCA 1F4KA 2DLLA 4HX8A 2K7LA 5TJJA 4GGGA 4MGRA 1REPC 3IWFA 2VE9A 4HZFA 3GVAA 2PFBA 3ZMDA 3C18A 3ZN0A 2IPQX 5LHHA 5HS8A 1TQMA 3ZMTA 4KDPA 1SAXA 2FA5A 2OQRA 3IRQA 1FSHA 2E7WA 1YG2A 1J9IA 3KEQA 3FHZA 4HX4A 3V7SA 2OZ6A 4YG2F 5HDGA 4U88A 5D5XB 4MQVA 5ICGA 4ENJA 3O3KA 4PGHA 5H6QA 2NAZA 3LQRA 2HS5A 3HTSB 4P9FA 4F7ZA 4AWXB 1U8RA 3GXOA 1Z05A 2IT0A 4FT8A 1YFHA 2J5OA 1Y0UA 4WCGA 1WWXA 2Q0OA 2H6CA 3P7NA 2XUBA 3RTRA 1KU2A 1HKTA 1LDDA 2ZCWA 5BPIA 4L9NA 5JVTA 2ZXJA 1YW8A 4A0ZA 1UFMA 3SZPA 5EEGA 1BJAA 5D4SA 5DV5A 4HQMA 3S2WA 5HDNA 2XAFA 4O3MA 2GWRA 1Z7UA 2P5VA 3VEPA 5E8GA 3I71A 4ETSA 4RB1A 4RB0A 4CDGA 3GZ6A 2A6HF 3RI4A 3GF2A 1B9MA 1YLFA 3IKTA 1ZARA 1BIBA 3DEUA 3Q9VA 3TDZC 2L01A 3NEUA 1IRGA 3F8FA 2F5DA 5F64A 2DBBA 2LNBA 4S05A 2K86A 3KETA 4AIKA 3ZMZA 2P6SA 3WODF 5HDKA 1KYWA 4HDVA 3F6VA 1Z91A 2ZKZA 4OMYA 1KQ9A 4GCVA 2QLZA 2O61A 2ZBKA 1PDNC 4WX9A 1T38A 1W5TA 4OMZA 3M9AA 2JT1A 3ECOA 4ZYEA 3EUHA 3IC7A 2EA2A 6PAXA 1B59A 4OIQF 4GYIA 3HRSA 5IT3A 4LG0B 2YX4A 4M9XA 3TOBA 1KU9A 4E70A 4A12A 1H9GA 2HYFA 1E2XA 3JTGA 2PQ8A 2HR3A 1S29A 3GFIA 2F5FA 3JW4A 3V8LA 2PLYA 4PZJA 3IWZA 1ZLKA 4KIFA 5HS9A 2BE5F 2QVOA 3GWZA 1R1UA 3QP5A 1HKSA 2X4HA 3GUDA 3Q5FA 3KEOA 2GZWA 2V1XA 5HLGA 1TNSA 2HYGD 2LDUA 4JBAA 5ICEA 2ZFWA 4ESFA 4HF1A 4JQFA 3HSEA 5L3CA 2DK5A 3TGNA 2OAZA 2YR2A 4RAYA 2KJBA 5FFXA 1HW1A 3QU3A 1QO0D 4EVIA 4LFUA 5FGMA 3E5QA 5ED4A 4QLCU 3BDDA 4RGXA 3K69A 2MLKA 2M1BA 2VBZA 5LGTA 3F6OA 3HHGA 3T8RA 4LLGF 2STTA 3ZQ7A 2V1DA 1YYVA 1HXDA 5FD5A 1UB9A 3BZ6A 5DD8A 4UVCA 1R00A 3FXRA 2DO7A 1ZG3A 2O3FA 3ZPLA 1YS6A 2A68F 3C1DA 5DUIA 1UHMA 1WRJA 4KN7X 4BHCA 3FMSA 3EQLF 1LEBA 2QYOA 3F21A 3J80Z 4Y13A 2FBIA 1QPMA 5DCMA 2FEZA 3LA7A 4WF2A 2D1VA 1STZA 3R4KA 1L3LA 3TO9A 5CVRA 1J7KA 1OMIA 2PG4A 1QNTA 4U7BA 2BYVE 3ECHA 3LA2A 1XDSA 1AOYA 4S04A 5DUKA 4XBFA 1ZLJA 2MH2A 5K5QA 1TNTA 4R8HA 3WTSC 3P9KA 4N9HA 3V7CA 1XSDA 4HF0A 2VBXA 4M9SA 3RKYA 4ZZLA 1ZRCA 2D45A 5HLHA 2CQKA 4KUMA 2HDCA 2NNNA 3CUQA 4A2UA 5J8CA 5E8IA 1FP1D 2UXXA 1R1TA 2Y0MA 5D5UB 2IA2A 5F6FA 4I09A 3F3XA 4FX0A 2A07F 3ULQB 2BEOA 1HW5A 1B4AA 1J5YA 4IHTA 3J7AO 4A6EA 1F9NA 4JK1X 4MEXF 5JR3A 3WU0A 4HLYA 4RGRA 2M8EA 1WQ2A 1HBXG 4Y15A 5ILSA 2DQRA 1OPCA 1ZHFA 3J81Z 2YX7A 3GYHX 5JI6A 4ENMA 3HTUA 3M8EA 5KK1A 1IXSB 3IRRA 1Z9CA 2UWMA 3W6JB 1TLHB 5DYMA 3B73A 5J8FA 1CF7A 1GXQA 3BP8A 1ZGJA 3P9IA 5HOOA 2R3SA 3M1EA 1HKQA 4NHJA 1ZRDA 1V3FA 1I27A 4XLNF 4BAYA 3RYPA 3VFZA 3H92A 1MGTA 1JGSA 4IRIA 3ROUA 5DDGA 1IRFA 4Y17A 1KU3A 1B6AA 2EV6A 4ENKA 1ZRFA 4MEYF 3IL2A 5L3BA 1QGPA 2FF4A 2IA0A 5L3FA 2VOOA 4YIFA 3GFLA 2UXNA 2HGCA 5K1YA 2M30A 3WGGA 4EGYA 2ZNZA 3C7JA 5FFZA 4WK8F 3ZN1A 2HTJA 3TO7A 2K4JA 2CG4A 4UNOA 3MQ0A 2DPUA 2FOKA 1O3RA 2ADUA 5L3DA 5DCFA 2JZYA 4L18B 1P4WA 1R58A 3BWGA 1XMKA 3KLOA 2ZMEB 4RGUA 2QQ9A 2HFHA 1GXPA 4IHSA 3MFKA 3E5XA 4QWQA 3BJ6A 5IT9K 4IPAA 1T6SA 2FQ3A 2Z9OA 2YU3A 4AIHA 5E17F 3BROA 4B8XA 3SHFA 3LAPA 3I4PA 3DPLC 3RKXA 3ZMVA 1BI2A 1MJBA 1FYKA 4ON0A 1DPUA 2GXGA 2DTRA 3M7GA 4MNUA 3VODA 2JPBA 2LSOA 3QP6A 1I6XA 2Z99A 4ESBA 2Y48A 3KCCA 5CVIA 4XSXF 2HQRA 1FOKA 1W7PB 4GXOA 1SFXA 2CGPA 1T98A 3TO6A 1QQIA 3CUQB 4UVAA 1P6RA 1IXRC 5HLIA 4EQQA 2E1CA 3SXYA 1HQCA 4Q47A 1YS7A 2L54A 2DK8A 3IHUA 3KZYA 4IJAA 2TDXA 2XASA 1RZ4A 2W57A 4P55A 2RN7A 4TV7A 2H27A 2DFIA 3WG9A 2V6CA 2M45A 3BY6A 5LEKA 2XIGA 4MHGA 2KIFA 1IN8A 2GXBA 4O6JA 1F1ZA 5LRSA 2Q8KA 2MH9A 1XGSA 2FBHA 3CO6C 2EWNA 3HSRA 1O7LA 3D0SA 5D6EA 2HWVA 2IJLA 4UXNA 3GW2A 5FB2A 2UZKA 3QRFF 2XV4S 1FPQA 4L5JA 3TQNA 2HQNA 1HSTA 5E1WA 4EJTA 2J5PA 4H0EA 1ZYRF 1FX7A 2EA4A 2H94A 2Y75A 1FBSA 4CYDA 2DAOA 1FLIA 4L0YB 2GA1A 3KP2A 2EFPA 2STWA 1TBXA 2F2EA 2XROA 4OIOF 2X0LA 2EV5A 2ETHA 4K2EA 2VN2A 4WXDA 1JXSA 4OOIA 2CSOA 3FF5A 1LNWA 4OIPF 3EYYA 3W6KB 2HOEA 3HHHA 3T1BA 1SD7A 1IZ1A 2GIVA 4KMFA 3ABTA 2OU2A 5TRDA 4L9TA 4CICA 4KYWA 3LQQA 3K1PA 1USSA 2HZTA 3E5UA 2WC2A 4IVNA 4EGZA 3T5XA 4ESJA 1YW9A 3KZZA 3MZHA 3I0TA 2KIUA 1S7OA 4G6QA 1KU7A 4KMUX 3SQNA 3E6DA 4NQWA 1YW7A 2E1NA 3B02A 3DXJF 2COMA 2M5WA 1SD6A 4MTEA 4LK0F 4IF4A 4CHUA 2W24A 2GAUA 5L3EA 3I5UA 4XRFA 2XAQA 1IN6A 1D3YA 1KQ8A 1XCBA 3TKYA 2MD5A 5L3GA 3COAC 1O57A 1LQ1A 1K78A 3DF8A 3N4MA 5LGNA 3DQVC 3QPTA 4M9ZA 3ZMUA 4HOBA 1D8JA 4LMYA 1ZREA 1UHWA 3L00A 3NRVA 5H6RA 3FXQA 1FT9A 2A6EF 2O6GE 1OKRA 4KN4X 1IN7A 4LG0A 1AWCA 2JTVA 4I0AA 2DI3A 4M71A 5E1ZB 3QOPA 1Z1DA 4G94A 1NHAA 3JSOA 4A6DA 1SD5A 3KP3A 4BHBA 4M6XA 1LVAA 1TQPA 1U5TA 1TQIA 4KICA 2VE8A 2CW0F 2RVCA 2NYXA 1MZBA 1XGMA 1XGNA 2QENA 1V4RA 1G3TA 1PP7U 3WGIA 4OU0A 2CFXA 2RV8A 2KKOA 4LD5A 1G4DA 2H09A 3CJNA 1W7PD 2JRTA 3TOAA 2NNYA 3I54A 4BXUA 1BIAA 4IRGA 3M8FA 1G3YA 4YFKF 4OINF 2QBYB 4EM2A 3FX3A 2MLGA 1FWZA 4BNCA 4ZH4F 1MDMB 2RQPA 4HX7A 1C0WA 2ESHA 3OV8A 1USTA 4G6DA 4PDKA 2EV0A 1Q1HA 2P5LC 2Z5UA 5LGUA 5HVQC 5LHGA 2EFNA 3T8TA 1HSJA 2WV0A 4KNYA 3BOQA 2XHKA 4Q48A 4U7DA 5ERIA 2IW5A 3F8MA 1W4MA 2QBYA 1RI7A 2ACJA 4BHPA 1BN5A 1LB2A 2LF8A 4R1HA 3HOTA 4NB5A 1I1GA 2P7CB 3KE2A 1K7AA 2VXZA 1MDMA 3HIFA 2L4AA 4FHTA 4PGGA 2KIMA 5K5RA 1BBYA 2YSRA 1R5GA 3DFGA 2DT5A 5AIPA 4KIGA 3ERED 2VONA 3GEZA 3K0LA 1T0FA 1GVJA 3FM5A 3VOEA 1S7AA 1A04A 1IN4A 4G7ZF 1IXCA 2W85A 3U2RA 5H20A 1RUOA 1JHFA 1S8NA 3KLNA 1H9TA 3JTHA 4UUVA 3K1MA 3D5LA 3CO7C 3K2ZA 5CYVA 4KA4A 1O3TA 1EH6A 4DQ2A 1RIOH 3GLXA 2Q2EA 1FC3A 2OD5A 1SMYF 4A5MA 2VC0A 2A61A 2XKOA 2AS5F 1TW3A 1FZPB 1GHCA 1ULYA 4GYGA 1IAWA 3MEXA 2RC4A 2OZUA 5D5WB 2EK5A 1S6LA 2M87A 1I1SA 4EM0B 2EFWA 1IUYA 1VTNC 2A3SA 1KYZA 1YQAA 2O03A 1U5TC 4A0XA 3HYIA 5FO5A 3WTWC 4HDUA 2XRNA 1KA8A 4I2OA 3PFIA 3VB2A 3V8KA 1EH7A 1LJ9A 3G3ZA 2L02A 4AD9A 5BQTA 5A2QZ 2W84A 1L0OC 4LLNA 4G8XA 2PEXA 2G7HA 3F8BA 1XCVA 2ZJ2A 2FSWA 1R22A 1FYLA 1JHHA 2ZO4A 4WWCA 5ICCA 3HSFA 3BPVA 4HW0A 1XMAA 2PI0A 1ZH5A 4CZZA 5J6XA 2P8TA 3WE2A 1XB4A 4MTDA 1X3UA 1FYMA 3ML6A 1OR7A 3WE3A 2H6BA 4HQEA 3P9CA 3R60A 1LDKB 3REOA 4BH9A 4HF2A 2D2WA 3HUGA 3EDPA 2GA2A 1TTYA 2HKOA 5JHUA 4L9JA 2L3DA 3C3WA 1CGPA 1DUXC 3KP4A 4KIBA 4EJUA 3E6BA 4UV8A 5D5VB 3ZP5A 1O7FA 1SMTA 2XAJA 2K27A 1EH8A 1BI3A 3WTYC 1U3EM 2Z3YA 5D4RA 2NRAC 5D8LB 1I5ZA 4LGWA 5ILUA 5A2QK 5CLSA 4EJWA 2CWEA 3RPUA 2G9WA 4Q4ZF 4I01A 3FM3A 3L9FA 1K6OA 1R36A 3BPXA 2XKPA 3F8NA 2D1HA 1T39A 1J75A 2ZNYA 2OBPA 4I98B 3I58A 3T0YA 1P4XA 2P6TA 3N97A 5LEJA 2DPDA 2IRFG 1BI1A 4CXFA 3AAFA 1RUNA 4EM1A 4ENNA 4BQAA 4M6YA 2OQGA 1FNNA 3JAMK 3OOPA 4CO8A 1QZYA 4U0YA 1DP7P 3NQOA 2HTSA 4MQ9F 1BC7C 4BYYA 3LSTA 5F1RA 2RDPA 2MBFA 1Z6TA 3QU6A 4EMSA 1B9NA 3V4GA 3ISPA 4YIIA 2BGCA 2W25A 1TW2A 1O3SA 3GZ5A 1F5TA 3I59A 5FD6A 4WXCA 4EJVA 1BI0A 3CLOA 1ON2A 3JAMZ 5LRRA 2LF7A 5LLQA 4ZZDA 1S3JA 1U5TB 5ICFA 5CJ9A 4LB6B 3TDUC 3JSPA 2P4WA 1D8KA 2ISYA 4HAMA 4L0ZB 4UV9A 3WU1B 5BOXA 1P4AA 5E18F 2RGVA 1U6GA 4P5OA 3KFWX 4EJOA 3G73A 2XAHA 1ONVA 2HEOA 4U0VA 3U1DA 4P9UA 1YIOA 3FWEA 4O5VA 1KQ0A 4LJZF 3RKWA 1HW2A 5CVVA 2QUFA 1ZN2A 4G7HF 1ZG1A 4HA8A 3EYIA 1O3QA 2BBYA 3KP7A 4U0WA 1SFEA 1WKMA 1MJAA 4I0BA 4IXAA 2QQAA 2KJCA 1SFUA 3RPQA 3FZVA 5JFRA 1XSXA 3J80K 2HKXA 2VBYA 3HOSA 2JSCA 1E17A 2VT3A 1JE8A 2QM3A 2K02A 4D0PA 5E20A 4XLPF 1K79A 3CUQC 2XAGA 4RB3C 1PP8F 2PJPA 2A5YB 1XD7A 2PMUA 3HRUA 3WTUC 2E7XA 2AXLA 4RS8A 2O0YA 1ODDA 2ZMEA 5AONA 2VOPA 1P2FA 2RNJA 4G7OF 4Q5SF 5ILVA 2V79A 4WXHA 2KRFA 3ZMSA 2EJRA 2O8XA 1ZG5A 3F8CA 4HLXA 3H3ZA 2VBWA 3U9GA 3RIRA 4ZYDA 1D5VA 3LAJA 2WWYA 3GX4X 5DD4A 2MC3A 1FP2A 3DKWA 2VODA 4FX4A 2C6YA 3MWMA 2IVMA 2V9VA 4KT5C 3RDIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXA A;  3WGH A;  1UCR A;  2MA3 A;  1T2K A;  5E1X A;  5LBQ A;  4HBL A;  5AIQ A;  5DCM B;  3RYR A;  2R7F A;  3FMR A;  2PMH A;  3E97 A;  4I7H A;  3ABU A;  4A5N A;  5BPD A;  3GFM A;  1IN5 A;  2FNA A;  1B1B A;  3BJO A;  1XGO A;  4G9Y A;  1BOA A;  4HV5 A;  1J2X A;  3O2P E;  1IF1 A;  3F22 A;  1ON1 A;  3DV8 A;  2VC1 A;  3V7R A;  1WI9 A;  3BJA A;  1EV7 A;  4HV6 A;  5FLX Z;  3DPT A;  1QBJ A;  3HRM A;  2GQQ A;  3CUO A;  1ZAO A;  4UVB A;  1ZGA A;  4AIJ A;  3RJP A;  3PQK A;  3WTZ A;  3WTT C;  3LA3 A;  3E6C C;  3FXU A;  2ESN A;  3FMQ A;  3WTX C;  1FBQ A;  3R61 A;  2DW4 A;  1PUE E;  4UHT A;  2DU9 A;  1IW7 F;  2EFQ A;  3L2C A;  1P92 A;  2FE3 A;  1BC8 C;  2QQB A;  3MCZ A;  3MZY A;  2WTE A;  2XGX A;  5FLX K;  2DQL A;  1OYY A;  5EEH A;  3L7W A;  1R7J A;  2FBK A;  1RNL A;  1W7P A;  5BS6 A;  2OA4 A;  4R79 A;  2L4M A;  1R23 A;  1G3W A;  4M74 A;  4ASN A;  2LKP A;  4L9V A;  5CVJ A;  2PN6 A;  4DNC A;  4RB2 C;  2K4B A;  1R5H A;  3I53 A;  4HYE A;  3CDH A;  3V8J A;  4A0Y A;  2G7U A;  3LWF A;  1OYW A;  2FRH A;  1QZZ A;  4ZYG A;  1CF7 B;  3IKV A;  1XN7 A;  3SZT A;  1K78 B;  4N0B A;  1FSE A;  5D6F A;  3GO5 A;  2Z33 A;  4IRH A;  4OIR F;  4XSZ F;  2IP2 A;  1LEA A;  3F72 A;  4N9I A;  1J59 A;  1MKM A;  3J81 K;  3DP7 A;  4CGZ A;  1YO5 C;  4M72 A;  5DEQ A;  1MD0 A;  2P5K A;  2CO5 A;  1R1V A;  1MJ9 A;  4P96 A;  1DDN A;  3QPH A;  4YFN F;  1Z6R A;  4Z2Y A;  1H0M A;  3KP6 A;  5KVR A;  2CYY A;  2A69 F;  2XVC A;  5BMZ A;  3SFZ A;  3I59 B;  3WTV C;  3K9T A;  3O6B B;  3E3V A;  2VT2 A;  3PQJ A;  3R0J A;  1WSU A;  4LLL A;  2RKH A;  2QZ8 A;  3KP5 A;  2FNP A;  2IA1 A;  3GFJ A;  2V1U A;  3CTA A;  1J0R A;  2FMY A;  3ELK A;  4I02 A;  3F23 A;  1G3S A;  3QAH A;  4RAZ A;  1W5S A;  1G6N A;  4B09 A;  2FU4 A;  3LFK A;  4L5I A;  3K1N A;  3Q9S A;  3H3U A;  2NS0 A;  2BV6 A;  5IT9 Z;  1LDJ A;  1FBU A;  1OYI A;  2YPR A;  3E6M A;  4EV0 A;  4M73 A;  2PBI A;  2F5C A;  1U2W A;  4LB5 A;  2R7D A;  1XSV A;  3R0A A;  2JPC A;  3R6S A;  2FML A;  2P7V B;  4YFX F;  3I64 A;  3L09 A;  1BM9 A;  4RGS A;  4ZYH A;  2EFO A;  1XDU A;  4LK1 F;  4GO1 A;  5HS7 A;  4PCQ A;  1KGS A;  2B0L A;  2ISZ A;  1FY7 A;  5K5O A;  5D8K B;  2EB7 A;  3HRT A;  3MAJ A;  2ELH A;  4AVP A;  1U78 A;  2F5E A;  5CVU A;  3EET A;  5LHI A;  1YTY A;  1SD4 A;  1DPR A;  2QWW A;  4KFC A;  1F4K A;  2DLL A;  4HX8 A;  2K7L A;  5TJJ A;  4GGG A;  4MGR A;  1REP C;  3IWF A;  2VE9 A;  4HZF A;  3GVA A;  2PFB A;  3ZMD A;  3C18 A;  3ZN0 A;  2IPQ X;  5LHH A;  5HS8 A;  1TQM A;  3ZMT A;  4KDP A;  1SAX A;  2FA5 A;  2OQR A;  3IRQ A;  1FSH A;  2E7W A;  1YG2 A;  1J9I A;  3KEQ A;  3FHZ A;  4HX4 A;  3V7S A;  2OZ6 A;  4YG2 F;  5HDG A;  4U88 A;  5D5X B;  4MQV A;  5ICG A;  4ENJ A;  3O3K A;  4PGH A;  5H6Q A;  2NAZ A;  3LQR A;  2HS5 A;  3HTS B;  4P9F A;  4F7Z A;  4AWX B;  1U8R A;  3GXO A;  1Z05 A;  2IT0 A;  4FT8 A;  1YFH A;  2J5O A;  1Y0U A;  4WCG A;  1WWX A;  2Q0O A;  2H6C A;  3P7N A;  2XUB A;  3RTR A;  1KU2 A;  1HKT A;  1LDD A;  2ZCW A;  5BPI A;  4L9N A;  5JVT A;  2ZXJ A;  1YW8 A;  4A0Z A;  1UFM A;  3SZP A;  5EEG A;  1BJA A;  5D4S A;  5DV5 A;  4HQM A;  3S2W A;  5HDN A;  2XAF A;  4O3M A;  2GWR A;  1Z7U A;  2P5V A;  3VEP A;  5E8G A;  3I71 A;  4ETS A;  4RB1 A;  4RB0 A;  4CDG A;  3GZ6 A;  2A6H F;  3RI4 A;  3GF2 A;  1B9M A;  1YLF A;  3IKT A;  1ZAR A;  1BIB A;  3DEU A;  3Q9V A;  3TDZ C;  2L01 A;  3NEU A;  1IRG A;  3F8F A;  2F5D A;  5F64 A;  2DBB A;  2LNB A;  4S05 A;  2K86 A;  3KET A;  4AIK A;  3ZMZ A;  2P6S A;  3WOD F;  5HDK A;  1KYW A;  4HDV A;  3F6V A;  1Z91 A;  2ZKZ A;  4OMY A;  1KQ9 A;  4GCV A;  2QLZ A;  2O61 A;  2ZBK A;  1PDN C;  4WX9 A;  1T38 A;  1W5T A;  4OMZ A;  3M9A A;  2JT1 A;  3ECO A;  4ZYE A;  3EUH A;  3IC7 A;  2EA2 A;  6PAX A;  1B59 A;  4OIQ F;  4GYI A;  3HRS A;  5IT3 A;  4LG0 B;  2YX4 A;  4M9X A;  3TOB A;  1KU9 A;  4E70 A;  4A12 A;  1H9G A;  2HYF A;  1E2X A;  3JTG A;  2PQ8 A;  2HR3 A;  1S29 A;  3GFI A;  2F5F A;  3JW4 A;  3V8L A;  2PLY A;  4PZJ A;  3IWZ A;  1ZLK A;  4KIF A;  5HS9 A;  2BE5 F;  2QVO A;  3GWZ A;  1R1U A;  3QP5 A;  1HKS A;  2X4H A;  3GUD A;  3Q5F A;  3KEO A;  2GZW A;  2V1X A;  5HLG A;  1TNS A;  2HYG D;  2LDU A;  4JBA A;  5ICE A;  2ZFW A;  4ESF A;  4HF1 A;  4JQF A;  3HSE A;  5L3C A;  2DK5 A;  3TGN A;  2OAZ A;  2YR2 A;  4RAY A;  2KJB A;  5FFX A;  1HW1 A;  3QU3 A;  1QO0 D;  4EVI A;  4LFU A;  5FGM A;  3E5Q A;  5ED4 A;  4QLC U;  3BDD A;  4RGX A;  3K69 A;  2MLK A;  2M1B A;  2VBZ A;  5LGT A;  3F6O A;  3HHG A;  3T8R A;  4LLG F;  2STT A;  3ZQ7 A;  2V1D A;  1YYV A;  1HXD A;  5FD5 A;  1UB9 A;  3BZ6 A;  5DD8 A;  4UVC A;  1R00 A;  3FXR A;  2DO7 A;  1ZG3 A;  2O3F A;  3ZPL A;  1YS6 A;  2A68 F;  3C1D A;  5DUI A;  1UHM A;  1WRJ A;  4KN7 X;  4BHC A;  3FMS A;  3EQL F;  1LEB A;  2QYO A;  3F21 A;  3J80 Z;  4Y13 A;  2FBI A;  1QPM A;  5DCM A;  2FEZ A;  3LA7 A;  4WF2 A;  2D1V A;  1STZ A;  3R4K A;  1L3L A;  3TO9 A;  5CVR A;  1J7K A;  1OMI A;  2PG4 A;  1QNT A;  4U7B A;  2BYV E;  3ECH A;  3LA2 A;  1XDS A;  1AOY A;  4S04 A;  5DUK A;  4XBF A;  1ZLJ A;  2MH2 A;  5K5Q A;  1TNT A;  4R8H A;  3WTS C;  3P9K A;  4N9H A;  3V7C A;  1XSD A;  4HF0 A;  2VBX A;  4M9S A;  3RKY A;  4ZZL A;  1ZRC A;  2D45 A;  5HLH A;  2CQK A;  4KUM A;  2HDC A;  2NNN A;  3CUQ A;  4A2U A;  5J8C A;  5E8I A;  1FP1 D;  2UXX A;  1R1T A;  2Y0M A;  5D5U B;  2IA2 A;  5F6F A;  4I09 A;  3F3X A;  4FX0 A;  2A07 F;  3ULQ B;  2BEO A;  1HW5 A;  1B4A A;  1J5Y A;  4IHT A;  3J7A O;  4A6E A;  1F9N A;  4JK1 X;  4MEX F;  5JR3 A;  3WU0 A;  4HLY A;  4RGR A;  2M8E A;  1WQ2 A;  1HBX G;  4Y15 A;  5ILS A;  2DQR A;  1OPC A;  1ZHF A;  3J81 Z;  2YX7 A;  3GYH X;  5JI6 A;  4ENM A;  3HTU A;  3M8E A;  5KK1 A;  1IXS B;  3IRR A;  1Z9C A;  2UWM A;  3W6J B;  1TLH B;  5DYM A;  3B73 A;  5J8F A;  1CF7 A;  1GXQ A;  3BP8 A;  1ZGJ A;  3P9I A;  5HOO A;  2R3S A;  3M1E A;  1HKQ A;  4NHJ A;  1ZRD A;  1V3F A;  1I27 A;  4XLN F;  4BAY A;  3RYP A;  3VFZ A;  3H92 A;  1MGT A;  1JGS A;  4IRI A;  3ROU A;  5DDG A;  1IRF A;  4Y17 A;  1KU3 A;  1B6A A;  2EV6 A;  4ENK A;  1ZRF A;  4MEY F;  3IL2 A;  5L3B A;  1QGP A;  2FF4 A;  2IA0 A;  5L3F A;  2VOO A;  4YIF A;  3GFL A;  2UXN A;  2HGC A;  5K1Y A;  2M30 A;  3WGG A;  4EGY A;  2ZNZ A;  3C7J A;  5FFZ A;  4WK8 F;  3ZN1 A;  2HTJ A;  3TO7 A;  2K4J A;  2CG4 A;  4UNO A;  3MQ0 A;  2DPU A;  2FOK A;  1O3R A;  2ADU A;  5L3D A;  5DCF A;  2JZY A;  4L18 B;  1P4W A;  1R58 A;  3BWG A;  1XMK A;  3KLO A;  2ZME B;  4RGU A;  2QQ9 A;  2HFH A;  1GXP A;  4IHS A;  3MFK A;  3E5X A;  4QWQ A;  3BJ6 A;  5IT9 K;  4IPA A;  1T6S A;  2FQ3 A;  2Z9O A;  2YU3 A;  4AIH A;  5E17 F;  3BRO A;  4B8X A;  3SHF A;  3LAP A;  3I4P A;  3DPL C;  3RKX A;  3ZMV A;  1BI2 A;  1MJB A;  1FYK A;  4ON0 A;  1DPU A;  2GXG A;  2DTR A;  3M7G A;  4MNU A;  3VOD A;  2JPB A;  2LSO A;  3QP6 A;  1I6X A;  2Z99 A;  4ESB A;  2Y48 A;  3KCC A;  5CVI A;  4XSX F;  2HQR A;  1FOK A;  1W7P B;  4GXO A;  1SFX A;  2CGP A;  1T98 A;  3TO6 A;  1QQI A;  3CUQ B;  4UVA A;  1P6R A;  1IXR C;  5HLI A;  4EQQ A;  2E1C A;  3SXY A;  1HQC A;  4Q47 A;  1YS7 A;  2L54 A;  2DK8 A;  3IHU A;  3KZY A;  4IJA A;  2TDX A;  2XAS A;  1RZ4 A;  2W57 A;  4P55 A;  2RN7 A;  4TV7 A;  2H27 A;  2DFI A;  3WG9 A;  2V6C A;  2M45 A;  3BY6 A;  5LEK A;  2XIG A;  4MHG A;  2KIF A;  1IN8 A;  2GXB A;  4O6J A;  1F1Z A;  5LRS A;  2Q8K A;  2MH9 A;  1XGS A;  2FBH A;  3CO6 C;  2EWN A;  3HSR A;  1O7L A;  3D0S A;  5D6E A;  2HWV A;  2IJL A;  4UXN A;  3GW2 A;  5FB2 A;  2UZK A;  3QRF F;  2XV4 S;  1FPQ A;  4L5J A;  3TQN A;  2HQN A;  1HST A;  5E1W A;  4EJT A;  2J5P A;  4H0E A;  1ZYR F;  1FX7 A;  2EA4 A;  2H94 A;  2Y75 A;  1FBS A;  4CYD A;  2DAO A;  1FLI A;  4L0Y B;  2GA1 A;  3KP2 A;  2EFP A;  2STW A;  1TBX A;  2F2E A;  2XRO A;  4OIO F;  2X0L A;  2EV5 A;  2ETH A;  4K2E A;  2VN2 A;  4WXD A;  1JXS A;  4OOI A;  2CSO A;  3FF5 A;  1LNW A;  4OIP F;  3EYY A;  3W6K B;  2HOE A;  3HHH A;  3T1B A;  1SD7 A;  1IZ1 A;  2GIV A;  4KMF A;  3ABT A;  2OU2 A;  5TRD A;  4L9T A;  4CIC A;  4KYW A;  3LQQ A;  3K1P A;  1USS A;  2HZT A;  3E5U A;  2WC2 A;  4IVN A;  4EGZ A;  3T5X A;  4ESJ A;  1YW9 A;  3KZZ A;  3MZH A;  3I0T A;  2KIU A;  1S7O A;  4G6Q A;  1KU7 A;  4KMU X;  3SQN A;  3E6D A;  4NQW A;  1YW7 A;  2E1N A;  3B02 A;  3DXJ F;  2COM A;  2M5W A;  1SD6 A;  4MTE A;  4LK0 F;  4IF4 A;  4CHU A;  2W24 A;  2GAU A;  5L3E A;  3I5U A;  4XRF A;  2XAQ A;  1IN6 A;  1D3Y A;  1KQ8 A;  1XCB A;  3TKY A;  2MD5 A;  5L3G A;  3COA C;  1O57 A;  1LQ1 A;  1K78 A;  3DF8 A;  3N4M A;  5LGN A;  3DQV C;  3QPT A;  4M9Z A;  3ZMU A;  4HOB A;  1D8J A;  4LMY A;  1ZRE A;  1UHW A;  3L00 A;  3NRV A;  5H6R A;  3FXQ A;  1FT9 A;  2A6E F;  2O6G E;  1OKR A;  4KN4 X;  1IN7 A;  4LG0 A;  1AWC A;  2JTV A;  4I0A A;  2DI3 A;  4M71 A;  5E1Z B;  3QOP A;  1Z1D A;  4G94 A;  1NHA A;  3JSO A;  4A6D A;  1SD5 A;  3KP3 A;  4BHB A;  4M6X A;  1LVA A;  1TQP A;  1U5T A;  1TQI A;  4KIC A;  2VE8 A;  2CW0 F;  2RVC A;  2NYX A;  1MZB A;  1XGM A;  1XGN A;  2QEN A;  1V4R A;  1G3T A;  1PP7 U;  3WGI A;  4OU0 A;  2CFX A;  2RV8 A;  2KKO A;  4LD5 A;  1G4D A;  2H09 A;  3CJN A;  1W7P D;  2JRT A;  3TOA A;  2NNY A;  3I54 A;  4BXU A;  1BIA A;  4IRG A;  3M8F A;  1G3Y A;  4YFK F;  4OIN F;  2QBY B;  4EM2 A;  3FX3 A;  2MLG A;  1FWZ A;  4BNC A;  4ZH4 F;  1MDM B;  2RQP A;  4HX7 A;  1C0W A;  2ESH A;  3OV8 A;  1UST A;  4G6D A;  4PDK A;  2EV0 A;  1Q1H A;  2P5L C;  2Z5U A;  5LGU A;  5HVQ C;  5LHG A;  2EFN A;  3T8T A;  1HSJ A;  2WV0 A;  4KNY A;  3BOQ A;  2XHK A;  4Q48 A;  4U7D A;  5ERI A;  2IW5 A;  3F8M A;  1W4M A;  2QBY A;  1RI7 A;  2ACJ A;  4BHP A;  1BN5 A;  1LB2 A;  2LF8 A;  4R1H A;  3HOT A;  4NB5 A;  1I1G A;  2P7C B;  3KE2 A;  1K7A A;  2VXZ A;  1MDM A;  3HIF A;  2L4A A;  4FHT A;  4PGG A;  2KIM A;  5K5R A;  1BBY A;  2YSR A;  1R5G A;  3DFG A;  2DT5 A;  5AIP A;  4KIG A;  3ERE D;  2VON A;  3GEZ A;  3K0L A;  1T0F A;  1GVJ A;  3FM5 A;  3VOE A;  1S7A A;  1A04 A;  1IN4 A;  4G7Z F;  1IXC A;  2W85 A;  3U2R A;  5H20 A;  1RUO A;  1JHF A;  1S8N A;  3KLN A;  1H9T A;  3JTH A;  4UUV A;  3K1M A;  3D5L A;  3CO7 C;  3K2Z A;  5CYV A;  4KA4 A;  1O3T A;  1EH6 A;  4DQ2 A;  1RIO H;  3GLX A;  2Q2E A;  1FC3 A;  2OD5 A;  1SMY F;  4A5M A;  2VC0 A;  2A61 A;  2XKO A;  2AS5 F;  1TW3 A;  1FZP B;  1GHC A;  1ULY A;  4GYG A;  1IAW A;  3MEX A;  2RC4 A;  2OZU A;  5D5W B;  2EK5 A;  1S6L A;  2M87 A;  1I1S A;  4EM0 B;  2EFW A;  1IUY A;  1VTN C;  2A3S A;  1KYZ A;  1YQA A;  2O03 A;  1U5T C;  4A0X A;  3HYI A;  5FO5 A;  3WTW C;  4HDU A;  2XRN A;  1KA8 A;  4I2O A;  3PFI A;  3VB2 A;  3V8K A;  1EH7 A;  1LJ9 A;  3G3Z A;  2L02 A;  4AD9 A;  5BQT A;  5A2Q Z;  2W84 A;  1L0O C;  4LLN A;  4G8X A;  2PEX A;  2G7H A;  3F8B A;  1XCV A;  2ZJ2 A;  2FSW A;  1R22 A;  1FYL A;  1JHH A;  2ZO4 A;  4WWC A;  5ICC A;  3HSF A;  3BPV A;  4HW0 A;  1XMA A;  2PI0 A;  1ZH5 A;  4CZZ A;  5J6X A;  2P8T A;  3WE2 A;  1XB4 A;  4MTD A;  1X3U A;  1FYM A;  3ML6 A;  1OR7 A;  3WE3 A;  2H6B A;  4HQE A;  3P9C A;  3R60 A;  1LDK B;  3REO A;  4BH9 A;  4HF2 A;  2D2W A;  3HUG A;  3EDP A;  2GA2 A;  1TTY A;  2HKO A;  5JHU A;  4L9J A;  2L3D A;  3C3W A;  1CGP A;  1DUX C;  3KP4 A;  4KIB A;  4EJU A;  3E6B A;  4UV8 A;  5D5V B;  3ZP5 A;  1O7F A;  1SMT A;  2XAJ A;  2K27 A;  1EH8 A;  1BI3 A;  3WTY C;  1U3E M;  2Z3Y A;  5D4R A;  2NRA C;  5D8L B;  1I5Z A;  4LGW A;  5ILU A;  5A2Q K;  5CLS A;  4EJW A;  2CWE A;  3RPU A;  2G9W A;  4Q4Z F;  4I01 A;  3FM3 A;  3L9F A;  1K6O A;  1R36 A;  3BPX A;  2XKP A;  3F8N A;  2D1H A;  1T39 A;  1J75 A;  2ZNY A;  2OBP A;  4I98 B;  3I58 A;  3T0Y A;  1P4X A;  2P6T A;  3N97 A;  5LEJ A;  2DPD A;  2IRF G;  1BI1 A;  4CXF A;  3AAF A;  1RUN A;  4EM1 A;  4ENN A;  4BQA A;  4M6Y A;  2OQG A;  1FNN A;  3JAM K;  3OOP A;  4CO8 A;  1QZY A;  4U0Y A;  1DP7 P;  3NQO A;  2HTS A;  4MQ9 F;  1BC7 C;  4BYY A;  3LST A;  5F1R A;  2RDP A;  2MBF A;  1Z6T A;  3QU6 A;  4EMS A;  1B9N A;  3V4G A;  3ISP A;  4YII A;  2BGC A;  2W25 A;  1TW2 A;  1O3S A;  3GZ5 A;  1F5T A;  3I59 A;  5FD6 A;  4WXC A;  4EJV A;  1BI0 A;  3CLO A;  1ON2 A;  3JAM Z;  5LRR A;  2LF7 A;  5LLQ A;  4ZZD A;  1S3J A;  1U5T B;  5ICF A;  5CJ9 A;  4LB6 B;  3TDU C;  3JSP A;  2P4W A;  1D8K A;  2ISY A;  4HAM A;  4L0Z B;  4UV9 A;  3WU1 B;  5BOX A;  1P4A A;  5E18 F;  2RGV A;  1U6G A;  4P5O A;  3KFW X;  4EJO A;  3G73 A;  2XAH A;  1ONV A;  2HEO A;  4U0V A;  3U1D A;  4P9U A;  1YIO A;  3FWE A;  4O5V A;  1KQ0 A;  4LJZ F;  3RKW A;  1HW2 A;  5CVV A;  2QUF A;  1ZN2 A;  4G7H F;  1ZG1 A;  4HA8 A;  3EYI A;  1O3Q A;  2BBY A;  3KP7 A;  4U0W A;  1SFE A;  1WKM A;  1MJA A;  4I0B A;  4IXA A;  2QQA A;  2KJC A;  1SFU A;  3RPQ A;  3FZV A;  5JFR A;  1XSX A;  3J80 K;  2HKX A;  2VBY A;  3HOS A;  2JSC A;  1E17 A;  2VT3 A;  1JE8 A;  2QM3 A;  2K02 A;  4D0P A;  5E20 A;  4XLP F;  1K79 A;  3CUQ C;  2XAG A;  4RB3 C;  1PP8 F;  2PJP A;  2A5Y B;  1XD7 A;  2PMU A;  3HRU A;  3WTU C;  2E7X A;  2AXL A;  4RS8 A;  2O0Y A;  1ODD A;  2ZME A;  5AON A;  2VOP A;  1P2F A;  2RNJ A;  4G7O F;  4Q5S F;  5ILV A;  2V79 A;  4WXH A;  2KRF A;  3ZMS A;  2EJR A;  2O8X A;  1ZG5 A;  3F8C A;  4HLX A;  3H3Z A;  2VBW A;  3U9G A;  3RIR A;  4ZYD A;  1D5V A;  3LAJ A;  2WWY A;  3GX4 X;  5DD4 A;  2MC3 A;  1FP2 A;  3DKW A;  2VOD A;  4FX4 A;  2C6Y A;  3MWM A;  2IVM A;  2V9V A;  4KT5 C;  3RDI A; 
#chains in the Genus database with same CATH topology
 2FXA A;  3G1L A;  3RZD J;  2KDZ A;  3OR2 C;  5B1B H;  3WGH A;  1IV6 A;  1UCR A;  2MA3 A;  4ZDL A;  4XLC A;  5E1X A;  1T2K A;  5LBQ A;  4HBL A;  5AIQ A;  3CME I;  2HZD A;  5DCM B;  3RYR A;  4BEH B;  2R7F A;  3LSK A;  3FMR A;  2PMH A;  2HXI A;  3E97 A;  4I7H A;  3ABU A;  4A5N A;  3OR1 C;  5BPD A;  1RES A;  1GDT A;  3GFM A;  5KAF C;  1AKH B;  2BXY A;  5FKM A;  2JK3 A;  2K85 A;  1IN5 A;  2FNA A;  1B1B A;  2EZI A;  2Y0S A;  3HOW J;  3BJO A;  1XGO A;  4G9Y A;  3AFH A;  3SJM A;  4V19 K;  1BOA A;  4HV5 A;  1J2X A;  3LFU A;  4PSW A;  3O2P E;  1R71 A;  2M0C A;  1IF1 A;  2F6C A;  5J3L A;  3F22 A;  1ON1 A;  3DV8 A;  2VC1 A;  2V6E A;  1VF9 A;  3V7R A;  2JUC A;  1WI9 A;  2E1M C;  3FDY A;  4ZTF A;  1D0Z A;  1YX5 A;  3BJA A;  2IEK A;  1EV7 A;  4HV6 A;  4XLH A;  5FLX Z;  1M1E B;  3DPT A;  4L5E A;  1QBJ A;  5LD2 C;  1G59 A;  3HRM A;  2I5U A;  2GQQ A;  3CUO A;  1ZAO A;  4UVB A;  3OYE A;  1IV8 A;  1ZGA A;  4XKC A;  4AIJ A;  2L9R A;  3RJP A;  3PQK A;  2HOT A;  3WTZ A;  5K7F A;  3WG7 H;  5GP9 A;  1IRZ A;  3WTT C;  3BR1 A;  3OYB A;  2KIQ A;  3LA3 A;  3E6C C;  3FXU A;  2ESN A;  3HPH A;  3FMQ A;  3WTX C;  3TW6 A;  1FBQ A;  2V9P A;  4BE1 A;  3UKG A;  2DFF A;  3R61 A;  3QYB A;  2DW4 A;  1ETK A;  1PUE E;  4UHT A;  2DU9 A;  1IW7 F;  2EFQ A;  1U0J A;  3UR3 C;  3L2C A;  1TT0 A;  4F52 A;  4GFB A;  1K4S A;  1P92 A;  1T08 B;  2FE3 A;  5FKL A;  3AL0 C;  1BC8 C;  1UZC A;  2R7T A;  2OCE A;  4M3F A;  2JA5 J;  2QQB A;  3MCZ A;  2ZXW H;  1BL0 A;  1Q1V A;  3MZY A;  1ZR2 A;  2WTE A;  2VQC A;  3EUH C;  3Q0V A;  2L7F P;  2XGX A;  5FLX K;  5EGO A;  2DQL A;  2VB6 A;  2HI3 A;  4HNT A;  1OYY A;  1A35 A;  3S1Q J;  5EEH A;  3L7W A;  1R7J A;  2FBK A;  3SEZ A;  3G71 I;  2K9L A;  1RNL A;  2NVT J;  1W7P A;  4XL9 A;  5E3M A;  1TL8 A;  5BS6 A;  2OA4 A;  4R79 A;  2L4M A;  1R23 A;  1G3W A;  2XDV A;  3OL4 A;  4M74 A;  2VJJ A;  3EUK L;  4ASN A;  1R4M B;  2LKP A;  5IOY A;  1SAU A;  4L9V A;  5CVJ A;  3HGG A;  2PN6 A;  3HM5 A;  4DNC A;  2XF5 A;  4RB2 C;  2K4B A;  3DU6 A;  4RMN A;  1R5H A;  3I53 A;  4HYE A;  3OY9 A;  3CDH A;  3V8J A;  2LD5 A;  4M3B A;  4A0Y A;  3JCU C;  2G7U A;  3LWF A;  2Y9Z A;  1OYW A;  2ZXI A;  2PMZ N;  2FRH A;  4XON A;  3L2V A;  4XK4 A;  2VJI A;  3BZK A;  3PO2 J;  3C2G A;  1QZZ A;  3WU2 C;  4CYC B;  1Y0N A;  4D1Q A;  1Z7L A;  4IHY A;  4ZYG A;  1CF7 B;  3IKV A;  2M34 A;  2VQL A;  2R5Y B;  1XN7 A;  1S7E A;  3OWT A;  3SZT A;  2GXA A;  1K78 B;  2JN6 A;  3CC4 I;  1CQT A;  4N0B A;  1FSE A;  3CCM I;  5D6F A;  3GO5 A;  1VQO I;  2Z33 A;  2I10 A;  4IRH A;  4OIR F;  1JTY A;  3OIP A;  4XSZ F;  1PYV A;  4MFE A;  2DJN A;  2IP2 A;  3KYD B;  2DDA A;  1LEA A;  1TWH J;  3F72 A;  3RQI A;  2GIZ A;  3OIO A;  2LKX A;  3HKZ A;  4N9I A;  1J59 A;  1MKM A;  1FJL A;  3J81 K;  1HDP A;  3G1M A;  3PNV A;  2XB5 A;  5EDN A;  3DP7 A;  4CGZ A;  1JKP C;  3K70 D;  1YO5 C;  1MMN A;  4M72 A;  3U21 A;  4D5F A;  1QZE A;  5DEQ A;  1MD0 A;  2P5K A;  1Z0X A;  2CO5 A;  1R1V A;  3K2A A;  1MJ9 A;  4P96 A;  2CUE A;  1R49 A;  1DDN A;  1BA5 A;  3BG7 A;  4X1E A;  5IOZ A;  1B8I B;  3QPH A;  1YRN A;  3LL7 A;  5FRO A;  4YFN F;  3GTJ J;  2ZSH B;  2OTL I;  2NVU B;  1Z6R A;  4QPO A;  4Z2Y A;  3HOZ J;  1X58 A;  2DOF A;  1H0M A;  2VJ5 A;  3KP6 A;  5CKT A;  2ECB A;  2KL4 A;  2JUG A;  2I8D A;  3BC8 A;  2QSG X;  4CCM A;  5KVR A;  2CYY A;  4QSH A;  2BY0 A;  3H0G J;  2A69 F;  2XVC A;  1ETX A;  1RPW A;  5BMZ A;  3SFZ A;  3M07 A;  3I59 B;  2AQF A;  3WTV C;  2WBM A;  4Z6Y A;  3K9T A;  3O6B B;  3E3V A;  2VT2 A;  2DA6 A;  2ME0 A;  3PQJ A;  4G6T B;  3R0J A;  4DGW B;  3PJR A;  3G4S I;  1MBH A;  1WSU A;  3HPG A;  5JLW A;  3H5N A;  4LLL A;  1SVO A;  2AHQ A;  2QZ8 A;  2RKH A;  2FQ4 A;  3BTJ A;  3KP5 A;  4YIR X;  2FNP A;  2IA1 A;  1HC8 A;  3BZC A;  3GFJ A;  4PSX A;  2V1U A;  3CTA A;  2IGM A;  1WH7 A;  1ETW A;  1J0R A;  2FMY A;  3ELK A;  4I02 A;  1LPQ A;  3ZR8 X;  3F23 A;  2O7O A;  2LYC A;  3PUB A;  3LSP A;  1G3S A;  3QAH A;  4RAZ A;  1W5S A;  2ZME C;  4XOR A;  1G6N A;  4B09 A;  2FU4 A;  3LFK A;  4L5I A;  4M3D A;  3K1N A;  3MKW B;  2DMP A;  3Q9S A;  1A36 A;  5HLT A;  3H3U A;  3DTI A;  2NS0 A;  1J09 A;  1AA7 A;  2BV6 A;  4FE7 A;  2X6Y A;  4AYB N;  5IT9 Z;  1LDJ A;  1FBU A;  2BHY A;  1I39 A;  1E0E A;  1TT5 B;  1OYI A;  2DT6 A;  3CDI A;  2YPR A;  3E6M A;  3VSK A;  4EV0 A;  4M73 A;  2PBI A;  2F5C A;  1U2W A;  4BE2 A;  2ECC A;  4RM3 A;  2M8G X;  2R7D A;  2R7R A;  4LB5 A;  5HNH A;  2VLA A;  2KP6 A;  1XSV A;  3R0A A;  2JPC A;  4XKW A;  3R6S A;  3H3V K;  2LR8 A;  4DZJ A;  1WGX A;  2BXZ A;  2FML A;  2P7V B;  4YFX F;  3I64 A;  2IS2 A;  3L09 A;  1BM9 A;  4B48 A;  4RGS A;  4ZYH A;  4M3E A;  2EFO A;  2DA1 A;  1ETY A;  1XDU A;  1IDY A;  4LK1 F;  1F43 A;  3JRA A;  2QSH X;  4GO1 A;  1MNE A;  2Q1Z B;  5M5X J;  2PJR B;  4HG2 A;  3TP3 A;  5HS7 A;  4PCQ A;  1ZGW A;  3OMY A;  2G0E A;  2E2J J;  1KGS A;  2B0L A;  2ISZ A;  4A3B J;  4GRI A;  1FY7 A;  2HVQ A;  3PSF A;  4A3J J;  5K5O A;  4C2U A;  2WAQ N;  2CV1 A;  5GPA A;  5D8K B;  2EB7 A;  2K9S A;  3HGY A;  3HRT A;  3MAJ A;  1X4O A;  2ELH A;  4AVP A;  4G12 A;  4DW6 A;  1U78 A;  3ESW B;  2L5Q A;  4E7Z A;  2F5E A;  5CVU A;  3EET A;  5LHI A;  4ZDO A;  2M3A A;  1YTY A;  3MVP A;  1SD4 A;  5IY5 H;  3LOC A;  1X4P A;  2CRG A;  2LKS A;  3ERM A;  2VL8 A;  3QOE A;  1DPR A;  2QWW A;  4XKB A;  3W2W A;  5GTH C;  4KFC A;  1F4K A;  2DLL A;  4HX8 A;  2K7L A;  5TJJ A;  1XC5 A;  4GGG A;  4MGR A;  1K61 A;  3L1P A;  2CUJ A;  1REP C;  2W48 A;  3IWF A;  2VE9 A;  5B5E C;  3NAR A;  4C3I J;  4HZF A;  3BG6 A;  3GVA A;  1D0Y A;  2PFB A;  1I3A A;  2DMQ A;  2PX9 A;  3ZMD A;  3OIQ A;  4RA2 A;  3OYG A;  3C18 A;  2E1M B;  3ONQ A;  3ZN0 A;  1W36 D;  2EIL H;  3ASN H;  2IPQ X;  5LHH A;  5HS8 A;  1TQM A;  4XRS A;  2WB1 A;  4NDL A;  4XOP A;  1T8I A;  1IJW C;  3ZMT A;  4UB8 C;  4AID A;  2R7Z J;  4KDP A;  4CCL A;  1SAX A;  2FA5 A;  2OQR A;  2MD0 A;  3IRQ A;  1FSH A;  3KYC B;  2E7W A;  3TP0 A;  1YG2 A;  1J9I A;  3KEQ A;  3AG3 H;  1V5G A;  3FHZ A;  1HCR A;  5CQG A;  4HX4 A;  3V7S A;  5EG0 B;  2DA7 A;  2OZ6 A;  2LBF A;  3B6A A;  2LH9 A;  4YG2 F;  1FMV A;  4U88 A;  5HDG A;  5D5X B;  3CCQ I;  3DBL B;  4MQV A;  2EIN H;  2JSP A;  5ICG A;  1VQK I;  3S93 A;  2HQA A;  4ENJ A;  3O3K A;  4PGH A;  4QIW N;  2X1E A;  1A6I A;  4JX4 A;  5H6Q A;  4XM3 A;  4A3D J;  4W1U A;  4Y4R A;  1LUJ B;  2NAZ A;  2M4K A;  2CUZ A;  3LQR A;  4BEH A;  2HS5 A;  2WA0 A;  3HTS B;  1WJC A;  2E5Z A;  4F3Q A;  4P9F A;  4F7Z A;  4AWX B;  5IPA A;  1PJR A;  1U8R A;  3GXO A;  4A69 C;  3E0J B;  1Z05 A;  2VKE A;  1ZTR A;  2IT0 A;  4FT8 A;  1YFH A;  4PJM A;  3AKZ A;  2J5O A;  4A3L J;  2ZJQ F;  1Y0U A;  2EZK A;  3DLA A;  4B43 A;  4WCG A;  1EA3 A;  3D5S C;  1YIJ I;  4QTR A;  3CJQ B;  3CP2 A;  1WWX A;  3IUO A;  2Q0O A;  2H6C A;  2CFO A;  2XUB A;  3P7N A;  3RTR A;  1KU2 A;  1HKT A;  1MMG A;  1LDD A;  1IGN A;  2ZCW A;  2KDO A;  1R6R A;  4RLF A;  5GAG J;  3K7A J;  1UHS A;  4L9N A;  5BPI A;  5JVT A;  2JA6 J;  1MBG A;  2ZXJ A;  3A01 B;  2BVL A;  1YW8 A;  4A0Z A;  1UFM A;  3W6V A;  2JWT A;  1EKE A;  3SZP A;  2XRL A;  1BJA A;  5EEG A;  3GTM J;  5D4S A;  3GCM A;  5DV5 A;  4HQM A;  3S2W A;  5HDN A;  1LFU P;  2XAF A;  4Y7N J;  4O3M A;  1JT6 A;  2GWR A;  1Z7U A;  2P5V A;  3VEP A;  5E8G A;  5IYB J;  2XPV A;  3I71 A;  2V7F A;  4ETS A;  4Y3O A;  1N78 A;  1Y8Q B;  2DMT A;  4RB1 A;  5DM7 F;  3NAU A;  4RB0 A;  4CDG A;  3GZ6 A;  2A6H F;  1VQ7 I;  1VQM I;  3RI4 A;  1OCP A;  1WI3 A;  1W36 C;  1X1C A;  3GF2 A;  4XRM A;  1B9M A;  3PNT A;  1YLF A;  2MSY A;  3IKT A;  2HPI A;  4II2 A;  1ZAR A;  1ZK8 A;  4DOZ A;  1BIB A;  3DEU A;  2R0Q C;  3Q9V A;  2NVY J;  3TDZ C;  1LKX A;  4PJJ A;  4XIC A;  2EIK H;  2HNH A;  3AG2 H;  2L01 A;  3NEU A;  2F48 A;  3F8F A;  1JUP A;  3JRH A;  1IRG A;  2F5D A;  1SEU A;  2LY2 A;  1I3Q J;  3HJE A;  1MSF C;  5F64 A;  2DBB A;  2LNB A;  3OSF A;  1AKH A;  2K9Q A;  2LC2 A;  5GTI C;  4S05 A;  2K86 A;  2WB1 N;  3KET A;  1VQ4 I;  3L2Q A;  4AIK A;  3ZMZ A;  2P6S A;  3WOD F;  5HDK A;  1OJL A;  4BXF A;  1KYW A;  2QKM B;  4HDV A;  3F6V A;  1Z91 A;  2ZKZ A;  4OMY A;  1I50 J;  1KQ9 A;  1B8I A;  4GCV A;  2QLZ A;  1W0T A;  5DTD A;  2O61 A;  1ZQ3 P;  3ABL H;  2ZBK A;  4MFD A;  1BR4 A;  2XB0 X;  1PDN C;  4WX9 A;  2HVS A;  2TRT A;  4DYQ A;  4XQF A;  1T38 A;  1WZ2 A;  1W5T A;  4OMZ A;  3S2D J;  3BR6 A;  1RET A;  2IXS A;  1K6Y A;  1T56 A;  2IAI A;  4NNJ A;  3M9A A;  1YJW I;  2JT1 A;  2WAF A;  3ECO A;  4ZYE A;  5DM6 F;  3EUH A;  3IC7 A;  4PFO A;  2EA2 A;  3DEW A;  6PAX A;  1B59 A;  3H5A A;  4OIQ F;  3O8H A;  4GYI A;  3HRS A;  5IT3 A;  1GUU A;  4LG0 B;  3HOU J;  3RZO J;  4B3X A;  2WAQ A;  1FIA A;  2YX4 A;  4M9X A;  3TOB A;  2F4O B;  3RQ4 A;  1KU9 A;  3IAS 2;  4E70 A;  3FXO A;  1H9G A;  4A12 A;  2HYF A;  5J4V A;  4BGD A;  1DQU A;  1E2X A;  3CQZ J;  1A31 A;  3JTG A;  2PQ8 A;  1PUF B;  2BY1 A;  2HR3 A;  1S29 A;  2DFE A;  3DPU A;  2EH3 A;  3GFI A;  2Z2S B;  2NS7 A;  2F5F A;  2ZSI B;  3JW4 A;  3V8L A;  2PLY A;  3VYT B;  4PZJ A;  4YEL A;  3IWZ A;  1ZLK A;  1BOB A;  2CW8 A;  2WAD A;  4KIF A;  5HS9 A;  2LFB A;  2BE5 F;  2QVO A;  3GWZ A;  1R1U A;  2YUS A;  2EIM H;  1X2M A;  3QP5 A;  3VWB A;  1HKS A;  2X4H A;  3GUD A;  3CJT B;  2NOG A;  1NG7 A;  4PJL A;  5B1A H;  5FKO A;  3Q5F A;  3BR2 A;  3KEO A;  2GZW A;  2V1X A;  1U9O A;  5HLG A;  1TNS A;  2HYG D;  2LDU A;  2NXN B;  4A3M J;  4JBA A;  3IV5 A;  1YRN B;  5ICE A;  3ZQI A;  1MNM C;  2ZFW A;  2IBD A;  3QYE A;  4ESF A;  2R7W A;  4HF1 A;  4FTH A;  3K6G A;  4JQF A;  3HSE A;  2CV2 A;  5L3C A;  2DK5 A;  3TGN A;  2OAZ A;  1Y6I A;  2YR2 A;  4OAZ A;  2KJB A;  4RAY A;  4F92 B;  1ERD A;  4MIM A;  5FFX A;  1HW1 A;  2OF7 A;  2X1D A;  1QO0 D;  3QU3 A;  4B3A A;  4LFU A;  4EVI A;  5FGM A;  3E5Q A;  2ELJ A;  4QLC U;  5ED4 A;  2DA2 A;  3BDD A;  4RGX A;  3K69 A;  3ZQL A;  5JHF A;  2MLK A;  5FLM J;  2M1B A;  2VBZ A;  4CZC A;  5LGT A;  3F6O A;  2DMU A;  1MMS A;  3HHG A;  1VQ5 I;  4LIV A;  2DA4 A;  2ELK A;  3VPR A;  2FD5 A;  2OJE D;  3T8R A;  4FE4 A;  1TWA J;  4LLG F;  2STT A;  3ZQ7 A;  3PNY A;  3GZN B;  1IC8 A;  2V1D A;  1YYV A;  1HXD A;  2W1O A;  5FD5 A;  1UB9 A;  3BZ6 A;  5DD8 A;  1BR2 A;  5DS9 A;  3KIO A;  1D1C A;  3I4M J;  4UVC A;  4XLF A;  1OCT C;  3CCL I;  3J7A Y;  1SC7 A;  1R00 A;  3FXR A;  5F1J A;  2DO7 A;  1ZG3 A;  3K4N A;  3BQY A;  2O3F A;  3FXL A;  3PM1 A;  3ZPL A;  1YS6 A;  1YOV B;  2A68 F;  4BXX J;  3C1D A;  5DUI A;  1UHM A;  1WRJ A;  4KN7 X;  2BW3 B;  3O8G A;  3FMS A;  4BHC A;  3EQL F;  1T0F C;  3FBI B;  4BL0 B;  1LEB A;  2QYO A;  2X51 A;  5FKN A;  3F21 A;  2LK2 A;  5FRN A;  4CA0 A;  3J80 Z;  4Y13 A;  3SDG A;  3G6E I;  1MBE A;  3CCR I;  2NOJ B;  2FBI A;  4YRV A;  1QPM A;  5DCM A;  2FEZ A;  3LA7 A;  4WF2 A;  3E1S A;  2BY2 A;  4ANJ A;  1MBJ A;  4RM2 A;  2D1V A;  3JRI A;  1WJF A;  1STZ A;  2YU9 J;  3R4K A;  1L3L A;  4J00 A;  3TO9 A;  5CVR A;  1J7K A;  1OMI A;  1Y1V J;  2O5R A;  2PG4 A;  1QNT A;  2X48 A;  3HKZ N;  4U7B A;  1SAN A;  2BZT A;  3HDD A;  4LIU A;  1ENH A;  1RKW A;  3IH3 A;  3MKY B;  2VKD A;  2BYV E;  3ASO H;  3ECH A;  5H2F C;  3CCJ I;  1E3H A;  1WVR A;  1MMD A;  3I3L A;  3LA2 A;  2BY3 A;  1XDS A;  1AOY A;  4S04 A;  2OV7 A;  4ZYA A;  5DUK A;  4XBF A;  4I6Z A;  1ZLJ A;  3S17 J;  3S15 J;  2MH2 A;  1U9N A;  5K5Q A;  1TNT A;  4R8H A;  2L2O A;  3KX2 A;  2XSJ C;  1VQ9 I;  1JTX A;  1HDD C;  3HC7 A;  3WTS C;  3VYS B;  1A5J A;  3P9K A;  4N9H A;  1D5Y A;  3V7C A;  1XSD A;  4HF0 A;  2R7X A;  2VBX A;  4M9S A;  3JRF A;  3RKY A;  1QRY A;  4ZZL A;  1VQ6 I;  2Z16 A;  3EPZ A;  1ZRC A;  2D45 A;  5HLH A;  2CQK A;  4KUM A;  2HDC A;  3FK6 A;  2NNN A;  4ZC3 A;  3CUQ A;  2K3F A;  4A2U A;  2JVH A;  5J8C A;  2LRD A;  5E8I A;  1FP1 D;  2CV0 A;  3ZQF A;  4F91 B;  2L0K A;  2UXX A;  1WJ5 A;  3Q0W A;  1R1T A;  2Y0M A;  5D5U B;  3B6C A;  2IA2 A;  2WV1 A;  1TWC J;  5F6F A;  1Y8R B;  4I09 A;  5IP9 J;  3F3X A;  4D7M A;  2KZV A;  4M6V A;  3E7L A;  2R5Z B;  4HST A;  4FX0 A;  2A07 F;  4YEJ A;  3ULQ B;  1D0X A;  1BW6 A;  1SVM A;  2BEO A;  1HW5 A;  1K83 J;  1B4A A;  4OWR B;  1J5Y A;  4IHT A;  3J7A O;  4A6E A;  5GAH J;  1F9N A;  4JK1 X;  4MEX F;  5JR3 A;  2R4G A;  3WU0 A;  4HLY A;  4RGR A;  2M8E A;  1WQ2 A;  1HBX G;  2VI6 A;  5J47 A;  1IO2 A;  3PSI A;  2ME6 A;  3GTP J;  1F36 A;  3FBN B;  4Y15 A;  1QVU A;  5ILS A;  2DQR A;  1OPC A;  4C3J J;  3LSR A;  1ZHF A;  3J81 Z;  2YX7 A;  4XN0 A;  3GYH X;  2AQE A;  5JI6 A;  1JT0 A;  3A4C A;  4ENM A;  3BLY A;  3HTU A;  3M8E A;  5KK1 A;  1GT0 C;  3W3C A;  1IXS B;  3IRR A;  1Z9C A;  2L9N A;  1WJA A;  3FK7 A;  4DZP A;  2B9S A;  2UWM A;  4E7J A;  2DA5 A;  5E79 C;  5IP7 J;  3W6J B;  1TLH B;  2XPU A;  5DYM A;  3B73 A;  5J8F A;  1CF7 A;  1GXQ A;  4CUG A;  3BP8 A;  1ZGJ A;  3P9I A;  1JJ6 C;  3GTG J;  5HOO A;  3HOX J;  5KNL A;  2R3S A;  3LMM A;  4RAG A;  2DA3 A;  3M1E A;  4JP0 A;  2XGE A;  3J7Y J;  2OUM A;  2XGC A;  1HKQ A;  4NHJ A;  5IYC J;  1ZRD A;  1V3F A;  1I27 A;  4XLN F;  4BAY A;  1LE8 A;  3RYP A;  4B44 A;  3VFZ A;  4BS9 A;  1HOM A;  3HXL A;  2QF7 A;  3H92 A;  1MGT A;  2HXO A;  2LMD A;  1JGS A;  3J7Z I;  5JVG F;  3GTQ J;  3HUG B;  2DMN A;  4IRI A;  1MBK A;  3ROU A;  3OYN A;  2VKH A;  5DDG A;  3DKY A;  2VKV A;  4NC7 A;  3H9J A;  1IRF A;  4XRS G;  4Y17 A;  1KU3 A;  1B6A A;  1GLN A;  1RKT A;  1MH3 A;  2EV6 A;  4ENK A;  1W0U A;  1ZRF A;  3S14 J;  4NC6 A;  4MEY F;  1NG6 A;  3IL2 A;  5L3B A;  1QGP A;  1VQN I;  5KAI C;  3S1N J;  2XGD A;  2FF4 A;  5J1U A;  2IA0 A;  5KCM A;  1S72 I;  3S3M A;  5L3F A;  1FOW A;  2VOO A;  2X85 A;  1P9Q C;  2CQQ A;  2VAS A;  3S3N A;  4YIF A;  4ITV A;  1MH4 A;  3GFL A;  2UXN A;  2HGC A;  3AG1 H;  3F0C A;  5K1Y A;  3OS0 A;  2M30 A;  3WGG A;  4EGY A;  2BHZ A;  2ZNZ A;  3C7J A;  1MBF A;  5B3S H;  5FFZ A;  2CMP A;  4WK8 F;  2VPL A;  2M9H A;  2VXD A;  3ZN1 A;  2HTJ A;  2V1N A;  3TO7 A;  1YE9 A;  3FXK A;  3BR3 A;  4B4C A;  1DU0 A;  2K4J A;  2DOE A;  2L7K A;  2CG4 A;  3LNQ A;  4UNO A;  3MQ0 A;  1QPI A;  1TC3 C;  2DPU A;  2FOK A;  2CW7 A;  1O3R A;  2ADU A;  5J4Y A;  5L3D A;  3TW7 A;  5DCF A;  2JZY A;  3PIP F;  4L18 B;  1P4W A;  1R58 A;  2AO9 A;  5M5Y J;  2LVS A;  1TWF J;  2Q2E B;  2B7E A;  1TP4 A;  2DJI A;  3BWG A;  1XMK A;  4A3K J;  3KLO A;  2ZME B;  3LSG A;  3SEQ A;  1Z67 A;  4RGU A;  2QQ9 A;  1HLV A;  2HFH A;  1AHD P;  1GXP A;  3VDX A;  4IHS A;  3MFK A;  3E5X A;  2E35 A;  4LIT A;  2KQR A;  4QWQ A;  3BJ6 A;  5IT9 K;  2CQX A;  3CCE I;  4IPA A;  1XS9 A;  4DBQ A;  1T6S A;  2FQ3 A;  3QPL A;  1MW7 A;  2Z9O A;  2YU3 A;  1HF0 A;  4DJA A;  2DTZ A;  4AIH A;  2KHM A;  4FCY A;  1AU7 A;  5E17 F;  3HOV J;  3BRO A;  4B8X A;  1ORK A;  3SHF A;  5E3L A;  3LAP A;  3I4P A;  3DPL C;  3RKX A;  3ZMV A;  3GTO J;  3PIO F;  1BI2 A;  1MJB A;  1FYK A;  4ON0 A;  1B72 A;  3K4B A;  5EZH A;  1E3O C;  4BQQ A;  4JOM A;  3SYT A;  4DBR A;  1DPU A;  2GXG A;  1E3P A;  3S8P A;  1YIT I;  2DTR A;  3M7G A;  3OYL A;  4MNU A;  3VOD A;  2JPB A;  3CMM A;  2LSO A;  1VZ0 A;  2KPM A;  3FXM A;  3VYR B;  5EF6 A;  3QP6 A;  4NUB A;  1I6X A;  2Z99 A;  4ESB A;  2Y48 A;  3DBR B;  2JA8 J;  3KCC A;  4BBR J;  3IAM 2;  4EEF G;  5CVI A;  3CZ6 A;  4XSX F;  3P5J A;  5EGO B;  3M3Y J;  2L7M P;  4MO7 A;  4MLO A;  2HQR A;  2AXT C;  1D1A A;  2H8R A;  3LSM A;  2PMZ A;  1FOK A;  4RLQ A;  4ZTJ A;  3AL0 B;  3DEE A;  2QCO A;  4ABZ A;  1W7P B;  4A3E J;  1QA6 A;  2R5Z A;  4GXO A;  1SFX A;  1FIP A;  2CGP A;  1T98 A;  3TO6 A;  1YJ9 I;  1QQI A;  3CUQ B;  4UVA A;  1FMW A;  1P6R A;  1MSE C;  1WH5 A;  2UUZ A;  1IXR C;  5HLI A;  4EQQ A;  2E1C A;  3SDB A;  3SXY A;  1HQC A;  2CUF A;  3LSJ A;  4Q47 A;  1YS7 A;  3S32 A;  4FQG A;  2L54 A;  2LY9 A;  4BJ5 C;  2DK8 A;  3IHU A;  3CDL A;  3KZY A;  4IJA A;  2TDX A;  5C44 J;  2XAS A;  3MN2 A;  1RZ4 A;  2W57 A;  4P55 A;  5J40 A;  1G8X A;  2RN7 A;  2F4M B;  1N77 A;  4LOC A;  3D1N I;  4TV7 A;  3A0B C;  2R5Y A;  3MZ8 A;  2H27 A;  2DFI A;  1H8A C;  3WG9 A;  4IZZ A;  2V6C A;  3CMA I;  2M45 A;  2JVG A;  1W1W E;  2L9S A;  3BY6 A;  5LEK A;  2XIG A;  2QEX I;  4MHG A;  2KIF A;  1IN8 A;  3OS2 A;  2GXB A;  4O6J A;  2CS3 A;  1R4N B;  3NWS A;  2CJJ A;  2D5V A;  2XF6 A;  1F1Z A;  5LRS A;  3H9G A;  2X9D A;  4BY1 J;  2Q8K A;  2MH9 A;  3A01 A;  3HB9 A;  1XGS A;  1GV2 A;  2M2E A;  2FBH A;  1MMA A;  1BR1 A;  4RAF A;  3CO6 C;  3NWT A;  4JX6 A;  5JLX A;  4ZDP A;  2EWN A;  3HSR A;  1H88 C;  2E1O A;  4IQ4 A;  1O7L A;  3D0S A;  3H1C A;  4W97 A;  3DU5 A;  4B1R A;  5D6E A;  2HWV A;  2KZG A;  3FHN A;  2VQG A;  2IJL A;  2QGU A;  2X6W A;  4UXN A;  4F93 B;  4I99 C;  3GW2 A;  2EZL A;  5FB2 A;  2UZK A;  2LP0 A;  3QRF F;  4CH7 A;  2XV4 S;  3RCO A;  4RBO A;  3ZQC A;  4HPQ A;  2XC7 A;  1FPQ A;  2RNG A;  3IH4 A;  2FOW A;  4E7L A;  4L5J A;  1BW5 A;  3TQN A;  2MGQ A;  2HQN A;  2E71 A;  1HST A;  5E1W A;  4EJT A;  2H8W A;  2J5P A;  4N4O B;  3GTK J;  1OIS A;  4CCO A;  4H0E A;  1ZYR F;  1FX7 A;  2EA4 A;  2H94 A;  3H35 A;  1FOX A;  1WJB A;  2Y75 A;  1FBS A;  4IO9 F;  3CCV I;  4CYD A;  2DAO A;  1FLI A;  3OYD A;  1UG0 A;  4L0Y B;  2KRH A;  2GA1 A;  3KP2 A;  2EFP A;  4QPQ A;  2STW A;  1TBX A;  2F2E A;  2XRO A;  2E2H J;  4OIO F;  2X0L A;  2EV5 A;  2ETH A;  4K2E A;  3W2A A;  1Y1W J;  5BNG A;  2VN2 A;  5F27 A;  1SFO J;  4E7K A;  2EZH A;  4WXD A;  1IG7 A;  1JXS A;  4OOI A;  1LVK A;  2CSO A;  2LRE A;  2EIJ H;  3FF5 A;  1LNW A;  4OIP F;  3EYY A;  3W6K B;  1V5F A;  3QOD A;  1DGR M;  2HOE A;  3K70 C;  3HHH A;  4IX7 A;  2DN0 A;  3ZQQ A;  3T1B A;  2QQ8 A;  3DCF A;  1TWG J;  1SD7 A;  1IZ1 A;  2GIV A;  2ZFU A;  2ZJR F;  4KMF A;  3ABT A;  2OU2 A;  3OYJ A;  5TRD A;  4L9T A;  4CIC A;  4AU7 A;  4KYW A;  3LQQ A;  3K1P A;  1USS A;  2HZT A;  4J19 A;  1POG A;  4BBS J;  4BU2 A;  3E5U A;  2WC2 A;  4IVN A;  3ABK H;  4ZJZ A;  3CF2 A;  4EGZ A;  3T5X A;  4ESJ A;  1YW9 A;  1SVL A;  3KZZ A;  1TZL A;  3MZH A;  3I0T A;  4D5C A;  2KIU A;  2Y9Y A;  1PUF A;  2R7U A;  4J01 A;  1T95 A;  3S3O A;  1S7O A;  2K9M A;  1JKQ C;  4G6Q A;  1KU7 A;  4KMU X;  5F08 A;  3SQN A;  3E6D A;  4NQW A;  1YW7 A;  2IS1 A;  2E1N A;  3B02 A;  3DXJ F;  4XID A;  4C9Y A;  1W5C C;  2COM A;  2JJ7 A;  1DU6 A;  2M5W A;  2M4G A;  2K3P A;  1SD6 A;  2A5W A;  1QVT A;  4MTE A;  4LK0 F;  1R5I D;  4IF4 A;  4CHU A;  2W24 A;  3H0D A;  2DDB A;  2GAU A;  3DTK A;  3TL4 X;  5FJ8 J;  1VQL I;  5L3E A;  3I5U A;  4XRF A;  2XAQ A;  3F9K A;  1IN6 A;  1D3Y A;  1KQ8 A;  1XCB A;  2QSF X;  1LFP A;  5M3F J;  3KYL A;  3TKY A;  4HNV A;  2HPM A;  2MD5 A;  2R7Q A;  1OLT A;  2JRM A;  2LY1 A;  5L3G A;  1JUM A;  2X1C A;  3COA C;  2K5C A;  1O57 A;  1UEL B;  1VQ8 I;  1LQ1 A;  1K78 A;  4N4N B;  3DF8 A;  3N4M A;  5LGN A;  3KZI C;  3DQV C;  3KPH A;  3QPT A;  2H1K A;  5J1Y A;  4M9Z A;  9ANT A;  3I55 I;  2GOM A;  3VYU B;  3ZMU A;  1OCZ H;  1WHU A;  2X6X A;  4HOB A;  2Y2Z A;  1D8J A;  4LMY A;  1ZRE A;  5M5W J;  1ETO A;  1UHW A;  3L00 A;  2GBY A;  1Z3Y A;  3NRV A;  2M0M A;  5H6R A;  1P7I A;  1DP3 A;  4KIS A;  1X19 A;  3FXQ A;  1FT9 A;  2A6E F;  2O6G E;  1OKR A;  4KN4 X;  4IHX A;  2LG4 A;  4C30 A;  1IN7 A;  3FIW A;  3CF5 F;  3FIS A;  4LG0 A;  1AWC A;  3VSL A;  2JTV A;  4I0A A;  2DI3 A;  2HQ5 A;  4M71 A;  5E1Z B;  3QOP A;  2QKL B;  4M3G A;  2HVR A;  1Z1D A;  4G94 A;  1NHA A;  2V4J C;  4XOT A;  2JA7 J;  1FOY A;  3JSO A;  1FEX A;  4PK4 A;  4A6D A;  4C2M J;  1S5L C;  1SD5 A;  3HZJ A;  4NC8 A;  3KP3 A;  4BHB A;  1ACI A;  4M6X A;  3OYI A;  3JRG A;  1LVA A;  1TQP A;  1U5T A;  2W4S A;  4A3C J;  1TQI A;  2FJ1 A;  4HNU A;  1Z3X A;  1XX5 A;  4KIC A;  2VE8 A;  2CW0 F;  2KT0 A;  1LE8 B;  2DYS H;  2RVC A;  4X6A J;  2NYX A;  1JJ8 C;  2OC6 A;  1MZB A;  1MND A;  2IGN A;  4DYR A;  5C4X J;  2W00 A;  3DBH B;  3ZCO A;  3FKI J;  1XGM A;  1XGN A;  1ZKG A;  2GM4 A;  2QEN A;  1APL C;  2OPT A;  1V4R A;  1G3T A;  3MKL A;  1PP7 U;  1JI8 A;  3WGI A;  3ZGK A;  4KT6 A;  3C2H A;  4OU0 A;  3RPU D;  2XPW A;  2DT7 B;  3S16 J;  2TCT A;  1IUF A;  4CYC A;  3DLL F;  2CQ7 A;  4E7H A;  2CFX A;  2RV8 A;  2KMU A;  1OQY A;  2KKO A;  4LD5 A;  5GAE J;  2H09 A;  3CJN A;  1W7P D;  2JRT A;  3TOA A;  1G4D A;  2NNY A;  3I54 A;  1WPK A;  4BXU A;  1BIA A;  4IRG A;  3M8F A;  3BCA A;  2KIS A;  3OSG A;  1G3Y A;  4YFK F;  4OIN F;  2QBY B;  4X0G A;  4EM2 A;  3FX3 A;  2MLG A;  4IHV A;  2VQH A;  5IP6 A;  1FWZ A;  4D7N A;  5FKK A;  4AUX A;  4BNC A;  4BQO A;  4ZH4 F;  1MDM B;  2RQP A;  4HX7 A;  1C0W A;  2ESH A;  3OV8 A;  1UST A;  3OYF A;  4G6D A;  1HA8 A;  2FX0 A;  3K4C A;  4PDK A;  2EV0 A;  4IHW A;  1Q1H A;  3GME A;  1V54 H;  1WJD A;  2P5L C;  2Z5U A;  5LGU A;  2ZC2 A;  5HVQ C;  1ITY A;  1N25 A;  5LHG A;  2X6O A;  3I4N J;  2EFN A;  5F0F A;  3T8T A;  1HSJ A;  2WV0 A;  1Y39 A;  4KNY A;  3BOQ A;  4BE0 A;  2O9L A;  2XHK A;  4Q48 A;  4GDF A;  4U7D A;  2VPR A;  5ERI A;  2V9K A;  4E6K G;  2IGK A;  1XG1 A;  1ETV A;  2IW5 A;  3F8M A;  1UAA A;  1W4M A;  2QBY A;  4XNF A;  2M7B A;  1RI7 A;  4FIS A;  2ACJ A;  1BN5 A;  4BHP A;  4R1H A;  2LF8 A;  2N8G A;  1LB2 A;  3GLL A;  3CCY A;  2OTJ I;  3ZRG A;  3HOT A;  4NB5 A;  3S1R J;  1I1G A;  2P7C B;  1VFC A;  3KE2 A;  1K7A A;  2VXZ A;  2W82 A;  1MDM A;  4Y33 A;  2O8K A;  3A03 A;  3HIF A;  3W2V A;  2L4A A;  3ABM H;  4FHT A;  4PGG A;  3OS1 A;  2KIM A;  4XLA A;  5K5R A;  1BBY A;  1UJ8 A;  1RRJ A;  2YSR A;  1QU3 A;  5GPC A;  2WY7 Q;  1R5G A;  3DFG A;  2DT5 A;  5AIP A;  4HRI A;  4KIG A;  3ERE D;  3C2B A;  2VON A;  3EUA A;  1B72 B;  3GEZ A;  3K0L A;  1T0F A;  1GVJ A;  3FM5 A;  3VOE A;  2F5V A;  3SZG A;  3HOY J;  3DTE A;  1S7A A;  1A04 A;  3CLQ A;  1IN4 A;  2H1L A;  4IQJ A;  4G7Z F;  1IXC A;  4BJ6 C;  2W85 A;  3U2R A;  4S0H B;  5H20 A;  4C3H J;  1RUO A;  4JX5 A;  1JHF A;  1QHG A;  1S8N A;  5C3E J;  3BG5 A;  1MIJ A;  2QA4 I;  3OOU A;  4Y52 J;  2F4I A;  3KLN A;  1H9T A;  1V55 H;  3JTH A;  4UUV A;  4XN3 A;  2E36 A;  3K1M A;  3QQA A;  2YS9 A;  3D5L A;  2EPF A;  4BKX A;  4LG3 A;  3K2Z A;  3CO7 C;  5CQE A;  2R7V A;  1GVD A;  5CYV A;  4KA4 A;  1O3T A;  1EH6 A;  4PJN A;  2Z1D A;  4DQ2 A;  1RIO H;  2Y31 A;  3GLX A;  5CPR B;  4F55 A;  3LSI A;  2Q2E A;  3CCS I;  1FC3 A;  2OD5 A;  1SMY F;  2K9N A;  4A5M A;  2VC0 A;  5EEA A;  2WY8 Q;  1I6H J;  2Y69 H;  2A61 A;  1Y56 A;  3MD2 A;  1XTA A;  1IRX A;  2MAB A;  2XKO A;  2HOS A;  4KJZ A;  1P7J A;  1TW3 A;  2E19 A;  1FZP B;  2AS5 F;  3BCB A;  2CQN A;  1GHC A;  1ULY A;  4GYG A;  1IAW A;  3MEX A;  2L9V A;  2RC4 A;  2OZU A;  1X1P A;  4I76 A;  1T33 A;  5D5W B;  2EK5 A;  1S6L A;  2M87 A;  3DWL E;  3LSH A;  1I1S A;  4EM0 B;  1XPX A;  2EFW A;  2KLO A;  1OFC X;  1QHH D;  2IS6 A;  2ICW G;  1IUY A;  4CCJ A;  1NH3 A;  3K4K A;  1VTN C;  4PUS A;  5TIS C;  3AG4 H;  2A3S A;  2XF7 A;  4C2T A;  1KYZ A;  4P1W A;  3RSN A;  4XMY A;  4B47 A;  1RC9 A;  1YJN I;  1YQA A;  2O03 A;  4AYB A;  1ETQ A;  2L7Z A;  2JQ7 A;  3BTC A;  4IKF A;  1G2H A;  1OCR H;  3K4J A;  1U5T C;  4A0X A;  3A02 A;  4IEJ A;  3HYI A;  5FO5 A;  3WTW C;  4HDU A;  1OCO H;  3I56 I;  3CMY A;  3CCU I;  2XRN A;  2NVX J;  1KA8 A;  5HNF A;  4OAY A;  4I2O A;  3PFI A;  3VB2 A;  3V8K A;  3M4O J;  4NBQ A;  1EH7 A;  3OYA A;  1D1B A;  1LJ9 A;  3G3Z A;  2L02 A;  1OCC H;  3OL3 A;  4AD9 A;  5BQT A;  3K4M A;  5A2Q Z;  1NK2 P;  2W84 A;  1L0O C;  4LLN A;  4AC0 A;  1K4T A;  5B66 C;  4G8X A;  1EF4 A;  2PEX A;  2G7H A;  4AVZ A;  2R7S A;  1VQP I;  3F8B A;  1XCV A;  3H36 A;  2ZJ2 A;  1DGW Y;  2FSW A;  1R22 A;  2NS8 A;  1FYL A;  5F04 A;  3HL2 A;  1JHH A;  4A3I J;  2ZO4 A;  4WWC A;  5ICC A;  3HSF A;  3BPV A;  4HW0 A;  4A3F J;  1XMA A;  2PI0 A;  3ZXS A;  2Y30 A;  2Y0S N;  1ZH5 A;  4CZZ A;  5J6X A;  2P8T A;  3QYF A;  4BDZ A;  4CSW A;  3WE2 A;  1XB4 A;  1EJ9 A;  4MTD A;  4HEA 2;  1X3U A;  3HG9 A;  1FYM A;  3ML6 A;  1IDZ A;  1OR7 A;  3CJR B;  3WE3 A;  2E5N A;  3BT9 A;  5FRM A;  1Z77 A;  2E34 A;  2H6B A;  4HQE A;  3P9C A;  3R60 A;  4CCK A;  3FKJ A;  2HU9 A;  1S9H A;  1R9T J;  1LDK B;  3REO A;  2W7N A;  5EJC A;  4BH9 A;  4HF2 A;  1X3Z B;  2R92 J;  2LOO A;  4BQN A;  2D2W A;  1PVE A;  3HUG A;  2ID6 A;  3CES A;  3I9V 2;  3Q0U A;  3EDP A;  3JRC A;  1X3W B;  2GA2 A;  2E2I J;  3X2Q H;  1TTY A;  2HKO A;  5JHU A;  3JR9 A;  1KON A;  3L2U A;  2CU7 A;  4L9J A;  2L3D A;  1ZR4 A;  4E4H A;  3C3W A;  1CGP A;  4IOC F;  2BVM A;  3JRB A;  3TBI A;  2RAE A;  3ZOB A;  3KP4 A;  1DUX C;  4KIB A;  2EQR A;  3M8J A;  4EJU A;  3E6B A;  4UV8 A;  5K7H A;  5D5V B;  2MC4 A;  1Z21 A;  3ZP5 A;  1O7F A;  1SMT A;  2XAJ A;  1OR7 C;  3GBG A;  4JYK A;  2K27 A;  1EH8 A;  1BI3 A;  1YX3 A;  3WTY C;  1U3E M;  3KEY A;  2Z3Y A;  5D4R A;  2NRA C;  5D8L B;  2M7A A;  1I5Z A;  2DCE A;  4LGW A;  5ILU A;  2PJR A;  5A2Q K;  5CLS A;  4EJW A;  2ZJP F;  4BJT A;  2CWE A;  1RR7 A;  3RPU A;  2G9W A;  5LFA A;  4Q4Z F;  4I01 A;  5K7Z A;  3FM3 A;  3L9F A;  4DIQ A;  1H89 C;  1JKO C;  4E7S A;  1K6O A;  4UUS B;  1R36 A;  3BPX A;  2HDW A;  4CCN A;  3OYC A;  2XKP A;  3OYH A;  4BY7 J;  5J1R A;  3F8N A;  2D1H A;  1T39 A;  2XAU A;  1J75 A;  2ZNY A;  1A6Q A;  2OBP A;  4I98 B;  3I58 A;  3T0Y A;  2DYR H;  4BUP A;  1JKR C;  1P4X A;  2P6T A;  1NK3 P;  2MYS A;  4XLE A;  3N97 A;  5LEJ A;  3BG9 A;  2DPD A;  2EBI A;  2IRF G;  1LFB A;  1BI1 A;  4CXF A;  3AAF A;  1RUN A;  4EM1 A;  1N75 A;  2JA2 A;  3WHB A;  3PL8 A;  4ENN A;  5F0C A;  4BQA A;  4M6Y A;  2OQG A;  1FNN A;  4U87 A;  3JAM K;  4UUS A;  4BAC A;  1FTT A;  3OOP A;  4FET A;  4CO8 A;  1QZY A;  4U0Y A;  1JUS A;  3SFI A;  4RDU A;  1DP7 P;  3NQO A;  3N05 A;  2HTS A;  3FXJ A;  4MQ9 F;  2NVQ J;  1BC7 C;  3S1M J;  4BYY A;  1RR8 C;  2MFZ A;  1WCM J;  3LST A;  1VI0 A;  5F1R A;  2RDP A;  4EAT A;  1BJZ A;  2MBF A;  1Z6T A;  3QU6 A;  4EMS A;  1B9N A;  3V4G A;  3ISP A;  5IYD J;  5TGT A;  4YII A;  3CP8 A;  2BGC A;  2W25 A;  1TW2 A;  3TED A;  3HBL A;  3A1Y A;  3CD6 I;  3BTL A;  1UMQ A;  1O3S A;  2BW3 A;  3GZ5 A;  2XSD C;  4PJ0 C;  1F5T A;  1VND A;  3QWL A;  2ZXH A;  3I59 A;  4E7I A;  4DYC A;  2LTP A;  2LLK A;  3H5R A;  5FD6 A;  4WXC A;  4EJV A;  2GLO A;  1BI0 A;  2E60 A;  3CLO A;  1ON2 A;  5KHD A;  3JAM Z;  4II3 A;  5LRR A;  2IS4 A;  3D5R C;  2LF7 A;  5LLQ A;  4ZZD A;  2RRE A;  3WHC A;  1S3J A;  2DOD A;  1U5T B;  5ICF A;  5CJ9 A;  4LB6 B;  4BDY A;  3CC7 I;  5F0H A;  3TDU C;  2HDD A;  3JSP A;  3CC2 I;  2P4W A;  2JMW A;  4NQW B;  2FUG 2;  1V5E A;  1D8K A;  3UNG C;  1X1D A;  2ISY A;  4HAM A;  4L0Z B;  4UV9 A;  3A0H C;  3WU1 B;  2P81 A;  4A93 J;  3TMO A;  5BOX A;  3ZQH A;  1YHQ I;  2R7O A;  3BTI A;  3M1C A;  1P4A A;  3A2K A;  5E18 F;  1XMX A;  2HOA A;  1X2N A;  5EZG A;  2RGV A;  1U6G A;  4HSR A;  3K4L A;  4P5O A;  2MG4 A;  2ID3 A;  3KFW X;  4EJO A;  3G73 A;  3IP4 B;  1X1B A;  3S2H J;  2XAH A;  3Q3S A;  1ONV A;  2DXI A;  2HEO A;  1GV5 A;  4U0V A;  3U1D A;  3DKX A;  4D9J A;  4P9U A;  1YIO A;  3OYM A;  3FWE A;  4O5V A;  1KQ0 A;  4LJZ F;  5E3O A;  3RKW A;  3GTL J;  1HW2 A;  5CVV A;  2QUF A;  4KIT B;  1ZN2 A;  3MKZ A;  4G7H F;  4HA8 A;  1ZG1 A;  5C4J J;  3EYI A;  1O3Q A;  2BBY A;  3KP7 A;  4U0W A;  2BOL A;  1SFE A;  1O4X A;  1WKM A;  1UG2 A;  2LBF B;  2DOA A;  4PFP A;  5EG0 A;  3K10 A;  4FAS D;  3G2B A;  1MJA A;  4I0B A;  4IXA A;  3IH2 A;  2GOX B;  2QQA A;  2CH0 A;  2KJC A;  2A6T A;  3BR0 A;  4UB6 C;  1SFU A;  5E3N A;  3HEF A;  3RPQ A;  5EYR A;  3BR5 A;  3FZV A;  3H9Q A;  5JFR A;  1XSX A;  4V2G A;  3V42 A;  2IGO A;  1KZH A;  2VIX A;  2OCC H;  3J80 K;  2HKX A;  3ZQG A;  1SFK A;  2ZB9 A;  4AM3 A;  1YI2 I;  1WFX A;  2VBY A;  3HOS A;  2VJ4 A;  3BG3 A;  2JSC A;  1X1A A;  3PO3 J;  2KRC A;  3QPS A;  1E17 A;  3RKQ A;  2VT3 A;  2VUM J;  1JE8 A;  2QM3 A;  1JGG A;  2K02 A;  5HOD A;  2COB A;  4D0P A;  2DFH A;  4XR6 A;  5E20 A;  4XLP F;  1K79 A;  3CUQ C;  2XAG A;  3PUF A;  4RB3 C;  3BQZ A;  1PP8 F;  2PJP A;  1WJE A;  2KFD A;  2K40 A;  2A5Y B;  1XD7 A;  2PMU A;  3MMY B;  3HRU A;  2RQQ A;  3WTU C;  2E7X A;  3L2R A;  3U1K A;  1FTZ A;  2AXL A;  4RS8 A;  3OYK A;  5GAD J;  2O0Y A;  2V26 A;  1ODD A;  2B63 J;  3PFY A;  2ZME A;  5AON A;  2VOP A;  5FLV A;  4XKV A;  1P2F A;  2R93 J;  2RNJ A;  4A3G J;  2MW8 A;  4G7O F;  4Q5S F;  4IL6 C;  5ILV A;  2V79 A;  2P0W A;  4WXH A;  2KRF A;  2WAE A;  5M3M J;  3ZMS A;  1U8B A;  2EJR A;  2O8X A;  2A05 A;  3F8C A;  4HLX A;  1ZG5 A;  3H3Z A;  3JRD A;  2VBW A;  4IOA F;  3U9G A;  4V2F A;  3RIR A;  4ZYD A;  2UV1 A;  3G1O A;  1D5V A;  3LAJ A;  2HYJ A;  4UY8 I;  2WWY A;  4H4K C;  3GX4 X;  5DD4 A;  2MC3 A;  3JRE A;  1FP2 A;  1NTC A;  1ZEL A;  3DKW A;  2VOD A;  3L2W A;  4FX4 A;  4UUT A;  3MWM A;  2C6Y A;  2IVM A;  2V9V A;  4KT5 C;  3RDI A; 
#chains in the Genus database with same CATH homology
 2FXA A;  3WGH A;  1UCR A;  2MA3 A;  1T2K A;  5E1X A;  5LBQ A;  4HBL A;  5AIQ A;  5DCM B;  3RYR A;  2R7F A;  3FMR A;  2PMH A;  3E97 A;  4I7H A;  3ABU A;  4A5N A;  5BPD A;  3GFM A;  1IN5 A;  2FNA A;  1B1B A;  3BJO A;  1XGO A;  4G9Y A;  1BOA A;  4HV5 A;  1J2X A;  3O2P E;  1IF1 A;  3F22 A;  1ON1 A;  3DV8 A;  2VC1 A;  3V7R A;  1WI9 A;  3BJA A;  1EV7 A;  4HV6 A;  5FLX Z;  3DPT A;  1QBJ A;  3HRM A;  2GQQ A;  3CUO A;  1ZAO A;  4UVB A;  1ZGA A;  4AIJ A;  3RJP A;  3PQK A;  3WTZ A;  3WTT C;  3LA3 A;  3E6C C;  3FXU A;  2ESN A;  3FMQ A;  3WTX C;  1FBQ A;  3R61 A;  2DW4 A;  1PUE E;  4UHT A;  2DU9 A;  1IW7 F;  2EFQ A;  3L2C A;  1P92 A;  2FE3 A;  1BC8 C;  2QQB A;  3MCZ A;  3MZY A;  2WTE A;  2XGX A;  5FLX K;  2DQL A;  1OYY A;  5EEH A;  3L7W A;  1R7J A;  2FBK A;  1RNL A;  1W7P A;  5BS6 A;  2OA4 A;  4R79 A;  2L4M A;  1R23 A;  1G3W A;  4M74 A;  4ASN A;  2LKP A;  4L9V A;  5CVJ A;  2PN6 A;  4DNC A;  4RB2 C;  2K4B A;  1R5H A;  3I53 A;  4HYE A;  3CDH A;  3V8J A;  4A0Y A;  2G7U A;  3LWF A;  1OYW A;  2FRH A;  1QZZ A;  4ZYG A;  1CF7 B;  3IKV A;  1XN7 A;  3SZT A;  1K78 B;  4N0B A;  1FSE A;  5D6F A;  3GO5 A;  2Z33 A;  4IRH A;  4OIR F;  4XSZ F;  2IP2 A;  1LEA A;  3F72 A;  4N9I A;  1J59 A;  1MKM A;  3J81 K;  3DP7 A;  4CGZ A;  1YO5 C;  4M72 A;  5DEQ A;  1MD0 A;  2P5K A;  2CO5 A;  1R1V A;  1MJ9 A;  4P96 A;  1DDN A;  3QPH A;  4YFN F;  1Z6R A;  4Z2Y A;  1H0M A;  3KP6 A;  5KVR A;  2CYY A;  2A69 F;  2XVC A;  5BMZ A;  3SFZ A;  3I59 B;  3WTV C;  3K9T A;  3O6B B;  3E3V A;  2VT2 A;  3PQJ A;  3R0J A;  1WSU A;  4LLL A;  2RKH A;  2QZ8 A;  3KP5 A;  2FNP A;  2IA1 A;  3GFJ A;  2V1U A;  3CTA A;  1J0R A;  2FMY A;  3ELK A;  4I02 A;  3F23 A;  1G3S A;  3QAH A;  4RAZ A;  1W5S A;  1G6N A;  4B09 A;  2FU4 A;  3LFK A;  4L5I A;  3K1N A;  3Q9S A;  3H3U A;  2NS0 A;  2BV6 A;  5IT9 Z;  1LDJ A;  1FBU A;  1OYI A;  2YPR A;  3E6M A;  4EV0 A;  4M73 A;  2PBI A;  2F5C A;  1U2W A;  4LB5 A;  2R7D A;  1XSV A;  3R0A A;  2JPC A;  3R6S A;  2FML A;  2P7V B;  4YFX F;  3I64 A;  3L09 A;  1BM9 A;  4RGS A;  4ZYH A;  2EFO A;  1XDU A;  4LK1 F;  4GO1 A;  5HS7 A;  4PCQ A;  1KGS A;  2B0L A;  2ISZ A;  1FY7 A;  5K5O A;  5D8K B;  2EB7 A;  3HRT A;  3MAJ A;  2ELH A;  4AVP A;  1U78 A;  2F5E A;  5CVU A;  3EET A;  5LHI A;  1YTY A;  1SD4 A;  1DPR A;  2QWW A;  4KFC A;  1F4K A;  2DLL A;  4HX8 A;  2K7L A;  5TJJ A;  4GGG A;  4MGR A;  1REP C;  3IWF A;  2VE9 A;  4HZF A;  3GVA A;  2PFB A;  3ZMD A;  3C18 A;  3ZN0 A;  2IPQ X;  5LHH A;  5HS8 A;  1TQM A;  3ZMT A;  4KDP A;  1SAX A;  2FA5 A;  2OQR A;  3IRQ A;  1FSH A;  2E7W A;  1YG2 A;  1J9I A;  3KEQ A;  3FHZ A;  4HX4 A;  3V7S A;  2OZ6 A;  4YG2 F;  5HDG A;  4U88 A;  5D5X B;  4MQV A;  5ICG A;  4ENJ A;  3O3K A;  4PGH A;  5H6Q A;  2NAZ A;  3LQR A;  2HS5 A;  3HTS B;  4P9F A;  4F7Z A;  4AWX B;  1U8R A;  3GXO A;  1Z05 A;  2IT0 A;  4FT8 A;  1YFH A;  2J5O A;  1Y0U A;  4WCG A;  1WWX A;  2Q0O A;  2H6C A;  3P7N A;  2XUB A;  3RTR A;  1KU2 A;  1HKT A;  1LDD A;  2ZCW A;  5BPI A;  4L9N A;  5JVT A;  2ZXJ A;  1YW8 A;  4A0Z A;  1UFM A;  3SZP A;  5EEG A;  1BJA A;  5D4S A;  5DV5 A;  4HQM A;  3S2W A;  5HDN A;  2XAF A;  4O3M A;  2GWR A;  1Z7U A;  2P5V A;  3VEP A;  5E8G A;  3I71 A;  4ETS A;  4RB1 A;  4RB0 A;  4CDG A;  3GZ6 A;  2A6H F;  3RI4 A;  3GF2 A;  1B9M A;  1YLF A;  3IKT A;  1ZAR A;  1BIB A;  3DEU A;  3Q9V A;  3TDZ C;  2L01 A;  3NEU A;  1IRG A;  3F8F A;  2F5D A;  5F64 A;  2DBB A;  2LNB A;  4S05 A;  2K86 A;  3KET A;  4AIK A;  3ZMZ A;  2P6S A;  3WOD F;  5HDK A;  1KYW A;  4HDV A;  3F6V A;  1Z91 A;  2ZKZ A;  4OMY A;  1KQ9 A;  4GCV A;  2QLZ A;  2O61 A;  2ZBK A;  1PDN C;  4WX9 A;  1T38 A;  1W5T A;  4OMZ A;  3M9A A;  2JT1 A;  3ECO A;  4ZYE A;  3EUH A;  3IC7 A;  2EA2 A;  6PAX A;  1B59 A;  4OIQ F;  4GYI A;  3HRS A;  5IT3 A;  4LG0 B;  2YX4 A;  4M9X A;  3TOB A;  1KU9 A;  4E70 A;  4A12 A;  1H9G A;  2HYF A;  1E2X A;  3JTG A;  2PQ8 A;  2HR3 A;  1S29 A;  3GFI A;  2F5F A;  3JW4 A;  3V8L A;  2PLY A;  4PZJ A;  3IWZ A;  1ZLK A;  4KIF A;  5HS9 A;  2BE5 F;  2QVO A;  3GWZ A;  1R1U A;  3QP5 A;  1HKS A;  2X4H A;  3GUD A;  3Q5F A;  3KEO A;  2GZW A;  2V1X A;  5HLG A;  1TNS A;  2HYG D;  2LDU A;  4JBA A;  5ICE A;  2ZFW A;  4ESF A;  4HF1 A;  4JQF A;  3HSE A;  5L3C A;  2DK5 A;  3TGN A;  2OAZ A;  2YR2 A;  4RAY A;  2KJB A;  5FFX A;  1HW1 A;  3QU3 A;  1QO0 D;  4EVI A;  4LFU A;  5FGM A;  3E5Q A;  5ED4 A;  4QLC U;  3BDD A;  4RGX A;  3K69 A;  2MLK A;  2M1B A;  2VBZ A;  5LGT A;  3F6O A;  3HHG A;  3T8R A;  4LLG F;  2STT A;  3ZQ7 A;  2V1D A;  1YYV A;  1HXD A;  5FD5 A;  1UB9 A;  3BZ6 A;  5DD8 A;  4UVC A;  1R00 A;  3FXR A;  2DO7 A;  1ZG3 A;  2O3F A;  3ZPL A;  1YS6 A;  2A68 F;  3C1D A;  5DUI A;  1UHM A;  1WRJ A;  4KN7 X;  4BHC A;  3FMS A;  3EQL F;  1LEB A;  2QYO A;  3F21 A;  3J80 Z;  4Y13 A;  2FBI A;  1QPM A;  5DCM A;  2FEZ A;  3LA7 A;  4WF2 A;  2D1V A;  1STZ A;  3R4K A;  1L3L A;  3TO9 A;  5CVR A;  1J7K A;  1OMI A;  2PG4 A;  1QNT A;  4U7B A;  2BYV E;  3ECH A;  3LA2 A;  1XDS A;  1AOY A;  4S04 A;  5DUK A;  4XBF A;  1ZLJ A;  2MH2 A;  5K5Q A;  1TNT A;  4R8H A;  3WTS C;  3P9K A;  4N9H A;  3V7C A;  1XSD A;  4HF0 A;  2VBX A;  4M9S A;  3RKY A;  4ZZL A;  1ZRC A;  2D45 A;  5HLH A;  2CQK A;  4KUM A;  2HDC A;  2NNN A;  3CUQ A;  4A2U A;  5J8C A;  5E8I A;  1FP1 D;  2UXX A;  1R1T A;  2Y0M A;  5D5U B;  2IA2 A;  5F6F A;  4I09 A;  3F3X A;  4FX0 A;  2A07 F;  3ULQ B;  2BEO A;  1HW5 A;  1B4A A;  1J5Y A;  4IHT A;  3J7A O;  4A6E A;  1F9N A;  4JK1 X;  4MEX F;  5JR3 A;  3WU0 A;  4HLY A;  4RGR A;  2M8E A;  1WQ2 A;  1HBX G;  4Y15 A;  5ILS A;  2DQR A;  1OPC A;  1ZHF A;  3J81 Z;  2YX7 A;  3GYH X;  5JI6 A;  4ENM A;  3HTU A;  3M8E A;  5KK1 A;  1IXS B;  3IRR A;  1Z9C A;  2UWM A;  3W6J B;  1TLH B;  5DYM A;  3B73 A;  5J8F A;  1CF7 A;  1GXQ A;  3BP8 A;  1ZGJ A;  3P9I A;  5HOO A;  2R3S A;  3M1E A;  1HKQ A;  4NHJ A;  1ZRD A;  1V3F A;  1I27 A;  4XLN F;  4BAY A;  3RYP A;  3VFZ A;  3H92 A;  1MGT A;  1JGS A;  4IRI A;  3ROU A;  5DDG A;  1IRF A;  4Y17 A;  1KU3 A;  1B6A A;  2EV6 A;  4ENK A;  1ZRF A;  4MEY F;  3IL2 A;  5L3B A;  1QGP A;  2FF4 A;  2IA0 A;  5L3F A;  2VOO A;  4YIF A;  3GFL A;  2UXN A;  2HGC A;  5K1Y A;  2M30 A;  3WGG A;  4EGY A;  2ZNZ A;  3C7J A;  5FFZ A;  4WK8 F;  3ZN1 A;  2HTJ A;  3TO7 A;  2K4J A;  2CG4 A;  4UNO A;  3MQ0 A;  2DPU A;  2FOK A;  1O3R A;  2ADU A;  5L3D A;  5DCF A;  2JZY A;  4L18 B;  1P4W A;  1R58 A;  3BWG A;  1XMK A;  3KLO A;  2ZME B;  4RGU A;  2QQ9 A;  2HFH A;  1GXP A;  4IHS A;  3MFK A;  3E5X A;  4QWQ A;  3BJ6 A;  5IT9 K;  4IPA A;  1T6S A;  2FQ3 A;  2Z9O A;  2YU3 A;  4AIH A;  5E17 F;  3BRO A;  4B8X A;  3SHF A;  3LAP A;  3I4P A;  3DPL C;  3RKX A;  3ZMV A;  1BI2 A;  1MJB A;  1FYK A;  4ON0 A;  1DPU A;  2GXG A;  2DTR A;  3M7G A;  4MNU A;  3VOD A;  2JPB A;  2LSO A;  3QP6 A;  1I6X A;  2Z99 A;  4ESB A;  2Y48 A;  3KCC A;  5CVI A;  4XSX F;  2HQR A;  1FOK A;  1W7P B;  4GXO A;  1SFX A;  2CGP A;  1T98 A;  3TO6 A;  1QQI A;  3CUQ B;  4UVA A;  1P6R A;  1IXR C;  5HLI A;  4EQQ A;  2E1C A;  3SXY A;  1HQC A;  4Q47 A;  1YS7 A;  2L54 A;  2DK8 A;  3IHU A;  3KZY A;  4IJA A;  2TDX A;  2XAS A;  1RZ4 A;  2W57 A;  4P55 A;  2RN7 A;  4TV7 A;  2H27 A;  2DFI A;  3WG9 A;  2V6C A;  2M45 A;  3BY6 A;  5LEK A;  2XIG A;  4MHG A;  2KIF A;  1IN8 A;  2GXB A;  4O6J A;  1F1Z A;  5LRS A;  2Q8K A;  2MH9 A;  1XGS A;  2FBH A;  3CO6 C;  2EWN A;  3HSR A;  1O7L A;  3D0S A;  5D6E A;  2HWV A;  2IJL A;  4UXN A;  3GW2 A;  5FB2 A;  2UZK A;  3QRF F;  2XV4 S;  1FPQ A;  4L5J A;  3TQN A;  2HQN A;  1HST A;  5E1W A;  4EJT A;  2J5P A;  4H0E A;  1ZYR F;  1FX7 A;  2EA4 A;  2H94 A;  2Y75 A;  1FBS A;  4CYD A;  2DAO A;  1FLI A;  4L0Y B;  2GA1 A;  3KP2 A;  2EFP A;  2STW A;  1TBX A;  2F2E A;  2XRO A;  4OIO F;  2X0L A;  2EV5 A;  2ETH A;  4K2E A;  2VN2 A;  4WXD A;  1JXS A;  4OOI A;  2CSO A;  3FF5 A;  1LNW A;  4OIP F;  3EYY A;  3W6K B;  2HOE A;  3HHH A;  3T1B A;  1SD7 A;  1IZ1 A;  2GIV A;  4KMF A;  3ABT A;  2OU2 A;  5TRD A;  4L9T A;  4CIC A;  4KYW A;  3LQQ A;  3K1P A;  1USS A;  2HZT A;  3E5U A;  2WC2 A;  4IVN A;  4EGZ A;  3T5X A;  4ESJ A;  1YW9 A;  3KZZ A;  3MZH A;  3I0T A;  2KIU A;  1S7O A;  4G6Q A;  1KU7 A;  4KMU X;  3SQN A;  3E6D A;  4NQW A;  1YW7 A;  2E1N A;  3B02 A;  3DXJ F;  2COM A;  2M5W A;  1SD6 A;  4MTE A;  4LK0 F;  4IF4 A;  4CHU A;  2W24 A;  2GAU A;  5L3E A;  3I5U A;  4XRF A;  2XAQ A;  1IN6 A;  1D3Y A;  1KQ8 A;  1XCB A;  3TKY A;  2MD5 A;  5L3G A;  3COA C;  1O57 A;  1LQ1 A;  1K78 A;  3DF8 A;  3N4M A;  5LGN A;  3DQV C;  3QPT A;  4M9Z A;  3ZMU A;  4HOB A;  1D8J A;  4LMY A;  1ZRE A;  1UHW A;  3L00 A;  3NRV A;  5H6R A;  3FXQ A;  1FT9 A;  2A6E F;  2O6G E;  1OKR A;  4KN4 X;  1IN7 A;  4LG0 A;  1AWC A;  2JTV A;  4I0A A;  2DI3 A;  4M71 A;  5E1Z B;  3QOP A;  1Z1D A;  4G94 A;  1NHA A;  3JSO A;  4A6D A;  1SD5 A;  3KP3 A;  4BHB A;  4M6X A;  1LVA A;  1TQP A;  1U5T A;  1TQI A;  4KIC A;  2VE8 A;  2CW0 F;  2RVC A;  2NYX A;  1MZB A;  1XGM A;  1XGN A;  2QEN A;  1V4R A;  1G3T A;  1PP7 U;  3WGI A;  4OU0 A;  2CFX A;  2RV8 A;  2KKO A;  4LD5 A;  1G4D A;  2H09 A;  3CJN A;  1W7P D;  2JRT A;  3TOA A;  2NNY A;  3I54 A;  4BXU A;  1BIA A;  4IRG A;  3M8F A;  1G3Y A;  4YFK F;  4OIN F;  2QBY B;  4EM2 A;  3FX3 A;  2MLG A;  1FWZ A;  4BNC A;  4ZH4 F;  1MDM B;  2RQP A;  4HX7 A;  1C0W A;  2ESH A;  3OV8 A;  1UST A;  4G6D A;  4PDK A;  2EV0 A;  1Q1H A;  2P5L C;  2Z5U A;  5LGU A;  5HVQ C;  5LHG A;  2EFN A;  3T8T A;  1HSJ A;  2WV0 A;  4KNY A;  3BOQ A;  2XHK A;  4Q48 A;  4U7D A;  5ERI A;  2IW5 A;  3F8M A;  1W4M A;  2QBY A;  1RI7 A;  2ACJ A;  4BHP A;  1BN5 A;  1LB2 A;  2LF8 A;  4R1H A;  3HOT A;  4NB5 A;  1I1G A;  2P7C B;  3KE2 A;  1K7A A;  2VXZ A;  1MDM A;  3HIF A;  2L4A A;  4FHT A;  4PGG A;  2KIM A;  5K5R A;  1BBY A;  2YSR A;  1R5G A;  3DFG A;  2DT5 A;  5AIP A;  4KIG A;  3ERE D;  2VON A;  3GEZ A;  3K0L A;  1T0F A;  1GVJ A;  3FM5 A;  3VOE A;  1S7A A;  1A04 A;  1IN4 A;  4G7Z F;  1IXC A;  2W85 A;  3U2R A;  5H20 A;  1RUO A;  1JHF A;  1S8N A;  3KLN A;  1H9T A;  3JTH A;  4UUV A;  3K1M A;  3D5L A;  3CO7 C;  3K2Z A;  5CYV A;  4KA4 A;  1O3T A;  1EH6 A;  4DQ2 A;  1RIO H;  3GLX A;  2Q2E A;  1FC3 A;  2OD5 A;  1SMY F;  4A5M A;  2VC0 A;  2A61 A;  2XKO A;  2AS5 F;  1TW3 A;  1FZP B;  1GHC A;  1ULY A;  4GYG A;  1IAW A;  3MEX A;  2RC4 A;  2OZU A;  5D5W B;  2EK5 A;  1S6L A;  2M87 A;  1I1S A;  4EM0 B;  2EFW A;  1IUY A;  1VTN C;  2A3S A;  1KYZ A;  1YQA A;  2O03 A;  1U5T C;  4A0X A;  3HYI A;  5FO5 A;  3WTW C;  4HDU A;  2XRN A;  1KA8 A;  4I2O A;  3PFI A;  3VB2 A;  3V8K A;  1EH7 A;  1LJ9 A;  3G3Z A;  2L02 A;  4AD9 A;  5BQT A;  5A2Q Z;  2W84 A;  1L0O C;  4LLN A;  4G8X A;  2PEX A;  2G7H A;  3F8B A;  1XCV A;  2ZJ2 A;  2FSW A;  1R22 A;  1FYL A;  1JHH A;  2ZO4 A;  4WWC A;  5ICC A;  3HSF A;  3BPV A;  4HW0 A;  1XMA A;  2PI0 A;  1ZH5 A;  4CZZ A;  5J6X A;  2P8T A;  3WE2 A;  1XB4 A;  4MTD A;  1X3U A;  1FYM A;  3ML6 A;  1OR7 A;  3WE3 A;  2H6B A;  4HQE A;  3P9C A;  3R60 A;  1LDK B;  3REO A;  4BH9 A;  4HF2 A;  2D2W A;  3HUG A;  3EDP A;  2GA2 A;  1TTY A;  2HKO A;  5JHU A;  4L9J A;  2L3D A;  3C3W A;  1CGP A;  1DUX C;  3KP4 A;  4KIB A;  4EJU A;  3E6B A;  4UV8 A;  5D5V B;  3ZP5 A;  1O7F A;  1SMT A;  2XAJ A;  2K27 A;  1EH8 A;  1BI3 A;  3WTY C;  1U3E M;  2Z3Y A;  5D4R A;  2NRA C;  5D8L B;  1I5Z A;  4LGW A;  5ILU A;  5A2Q K;  5CLS A;  4EJW A;  2CWE A;  3RPU A;  2G9W A;  4Q4Z F;  4I01 A;  3FM3 A;  3L9F A;  1K6O A;  1R36 A;  3BPX A;  2XKP A;  3F8N A;  2D1H A;  1T39 A;  1J75 A;  2ZNY A;  2OBP A;  4I98 B;  3I58 A;  3T0Y A;  1P4X A;  2P6T A;  3N97 A;  5LEJ A;  2DPD A;  2IRF G;  1BI1 A;  4CXF A;  3AAF A;  1RUN A;  4EM1 A;  4ENN A;  4BQA A;  4M6Y A;  2OQG A;  1FNN A;  3JAM K;  3OOP A;  4CO8 A;  1QZY A;  4U0Y A;  1DP7 P;  3NQO A;  2HTS A;  4MQ9 F;  1BC7 C;  4BYY A;  3LST A;  5F1R A;  2RDP A;  2MBF A;  1Z6T A;  3QU6 A;  4EMS A;  1B9N A;  3V4G A;  3ISP A;  4YII A;  2BGC A;  2W25 A;  1TW2 A;  1O3S A;  3GZ5 A;  1F5T A;  3I59 A;  5FD6 A;  4WXC A;  4EJV A;  1BI0 A;  3CLO A;  1ON2 A;  3JAM Z;  5LRR A;  2LF7 A;  5LLQ A;  4ZZD A;  1S3J A;  1U5T B;  5ICF A;  5CJ9 A;  4LB6 B;  3TDU C;  3JSP A;  2P4W A;  1D8K A;  2ISY A;  4HAM A;  4L0Z B;  4UV9 A;  3WU1 B;  5BOX A;  1P4A A;  5E18 F;  2RGV A;  1U6G A;  4P5O A;  3KFW X;  4EJO A;  3G73 A;  2XAH A;  1ONV A;  2HEO A;  4U0V A;  3U1D A;  4P9U A;  1YIO A;  3FWE A;  4O5V A;  1KQ0 A;  4LJZ F;  3RKW A;  1HW2 A;  5CVV A;  2QUF A;  1ZN2 A;  4G7H F;  1ZG1 A;  4HA8 A;  3EYI A;  1O3Q A;  2BBY A;  3KP7 A;  4U0W A;  1SFE A;  1WKM A;  1MJA A;  4I0B A;  4IXA A;  2QQA A;  2KJC A;  1SFU A;  3RPQ A;  3FZV A;  5JFR A;  1XSX A;  3J80 K;  2HKX A;  2VBY A;  3HOS A;  2JSC A;  1E17 A;  2VT3 A;  1JE8 A;  2QM3 A;  2K02 A;  4D0P A;  5E20 A;  4XLP F;  1K79 A;  3CUQ C;  2XAG A;  4RB3 C;  1PP8 F;  2PJP A;  2A5Y B;  1XD7 A;  2PMU A;  3HRU A;  3WTU C;  2E7X A;  2AXL A;  4RS8 A;  2O0Y A;  1ODD A;  2ZME A;  5AON A;  2VOP A;  1P2F A;  2RNJ A;  4G7O F;  4Q5S F;  5ILV A;  2V79 A;  4WXH A;  2KRF A;  3ZMS A;  2EJR A;  2O8X A;  1ZG5 A;  3F8C A;  4HLX A;  3H3Z A;  2VBW A;  3U9G A;  3RIR A;  4ZYD A;  1D5V A;  3LAJ A;  2WWY A;  3GX4 X;  5DD4 A;  2MC3 A;  1FP2 A;  3DKW A;  2VOD A;  4FX4 A;  2C6Y A;  3MWM A;  2IVM A;  2V9V A;  4KT5 C;  3RDI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...