5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
2HFHA 2PQ8A 1UHWA 5AONA 1JHHA 4FX4A 1ZLJA 2XAHA 3R0JA 5E17F 2BBYA 4MQ9F 1XDUA 2BGCA 1HSJA 4KFCA 1G3YA 2HTSA 2XAQA 1O3QA 4I0AA 5JI6A 3AAFA 3WTTC 1U5TC 1LNWA 1OKRA 1KYWA 5KVRA 4RGSA 5L3DA 3MQ0A 2CWEA 3SXYA 1T39A 1LEBA 5F64A 1HXDA 1XGMA 1YYVA 3QU6A 4RB3C 5DCMA 4P55A 3C1DA 2F5CA 3M9AA 4BAYA 1J5YA 3MZHA 1Q1HA 4ZYHA 3BPXA 3MWMA 4BXUA 1WQ2A 5H6RA 2DO7A 1S6LA 3COAC 4MGRA 1RIOH 2BEOA 3GWZA 4PZJA 1FC3A 2AXLA 4A2UA 4U0WA 4L9NA 3TDUC 2V79A 2PBIA 4YFNF 2FXAA 3R0AA 3RKYA 3L7WA 1ZN2A 2Z9OA 3JSOA 3BOQA 5J8FA 3SFZA 1HKSA 2PMHA 3KZZA 4ENNA 1EH8A 1YFHA 3V4GA 4Z2YA 2PJPA 3FF5A 5FFZA 1TNTA 5EEGA 5E1ZB 3BPVA 3WE3A 2R7DA 1YW9A 1S3JA 3VODA 2FNAA 1SD4A 3PFIA 4CYDA 5BOXA 1XSVA 4PDKA 3O6BB 4OIPF 4GCVA 3F8BA 3GFMA 4WXDA 4K2EA 4PGHA 3SZPA 3EUHA 1TQPA 1W5SA 1GVJA 4S04A 5ED4A 2HR3A 1JE8A 1R23A 3ZMSA 3LWFA 1LDJA 1USSA 2OQGA 1ONVA 4HQEA 1FYKA 2JT1A 2BYVE 4OMYA 1JGSA 5H6QA 3KZYA 4M72A 3RPQA 2P6SA 1JXSA 1RUNA 3CLOA 2EV0A 4FT8A 3U2RA 1G3TA 3HRMA 4UUVA 4IVNA 4ZYDA 2VBYA 4BYYA 3BJ6A 1R00A 2MLGA 1VTNC 1Z7UA 2DTRA 1IN5A 3KP2A 4WXHA 4F7ZA 4LMYA 2XGXA 4KIFA 3RIRA 2QYOA 2VXZA 2G9WA 3WGIA 4L0YB 1MD0A 1I5ZA 1OYYA 4I7HA 1SMTA 3FZVA 4M74A 3I5UA 1U2WA 3F8MA 4GYGA 1FPQA 2W24A 2RDPA 3V7CA 2CGPA 2UXNA 2TDXA 1KQ8A 1E2XA 1ZARA 4KA4A 1U8RA 2E7XA 5CVUA 3J81K 2B0LA 1LDDA 3ML6A 1AOYA 3RJPA 2H27A 4UXNA 2MBFA 2C6YA 2DFIA 2JRTA 2LF8A 2KJBA 1ZYRF 4AIHA 4HBLA 2MH9A 4RGUA 3EETA 4MHGA 3N97A 3DEUA 1XD7A 1MKMA 4P96A 1SFUA 3HUGA 3I64A 2A3SA 1ZG1A 3M7GA 3FX3A 1DPUA 1QO0D 3E6MA 1HKQA 4GGGA 2Y48A 2ISZA 3G73A 5TJJA 1J59A 2EFPA 4ETSA 4NHJA 2O8XA 2Z3YA 1Z6RA 3KETA 3H92A 1XN7A 3RPUA 5DUIA 5ICEA 2XAFA 4A0ZA 1A04A 2ACJA 4Q48A 1KYZA 1ZH5A 1FBQA 3ZMUA 2D45A 2ADUA 1BC8C 3K1MA 4I0BA 3FMRA 2NS0A 3G3ZA 5JVTA 1BI2A 3ZMDA 5ILUA 2P8TA 3BROA 4LG0B 3RYRA 3ISPA 5IT9K 2Q2EA 5F1RA 5HLGA 3CO6C 3EYIA 4LB5A 2VT3A 5DYMA 5HDNA 4MNUA 2EB7A 4IXAA 3WTYC 2OAZA 4ENMA 2P7CB 1FNNA 1ZRDA 1FP1D 5L3GA 1R1UA 4M73A 2K02A 4M6YA 2COMA 2EJRA 3WU1B 1IUYA 1FYMA 1D5VA 2GZWA 3Q5FA 2KIFA 1MGTA 4L5JA 3F72A 1F5TA 3RYPA 1TQMA 2F5DA 4JBAA 2IW5A 5IT3A 3E6CC 3E97A 2XASA 1R1VA 5ICGA 4WF2A 1JHFA 3I4PA 4LK0F 5LGTA 4BHBA 3J80K 2H6CA 2YPRA 1ON1A 3H3ZA 4EGYA 2MC3A 3HTUA 5DCFA 2EFNA 2DK5A 2XUBA 4HF1A 3GW2A 2GQQA 1Z9CA 3ULQB 4Q47A 3MCZA 3NQOA 4KMUX 4RB2C 1YW7A 1FWZA 2P6TA 2X0LA 3H3UA 5HLIA 2L54A 2H09A 5ERIA 1IF1A 3DP7A 4KYWA 2P7VB 2L4AA 1ON2A 3SZTA 4LJZF 1O7FA 1TW2A 4A6EA 2O61A 1T2KA 5HOOA 4YG2F 5FLXK 2W25A 2HQNA 2EV6A 3L00A 4AWXB 3R60A 2OQRA 1Z05A 4GO1A 3ZP5A 4I01A 1QBJA 1WSUA 3L09A 4EQQA 2YX4A 4HAMA 4EM2A 4FX0A 1SMYF 3BWGA 3O3KA 3W6KB 3RKXA 1J75A 3VB2A 3IHUA 3DPLC 2K86A 2UZKA 4WXCA 1G3WA 1XCVA 2W57A 1LJ9A 3P7NA 5JHUA 5H20A 3LAPA 3F22A 3GX4X 2VE8A 1UFMA 3HHHA 2VBXA 1HW1A 3QAHA 1F9NA 1Y0UA 2HS5A 4IRHA 3KP6A 3J80Z 1B9MA 2J5OA 4ESBA 4B09A 2V1DA 2HQRA 4OINF 1R22A 3BJAA 2IVMA 1UB9A 1KA8A 2PG4A 4ZZLA 5DD8A 3ZMVA 2XHKA 2HKXA 3NRVA 3I59A 2IT0A 2IRFG 3LA2A 5D6EA 2Y0MA 4R1HA 5ICCA 2OZ6A 3E5XA 4LG0A 4Y13A 4EVIA 4MEXF 4DQ2A 1R58A 2HTJA 2K27A 3LA7A 3WTVC 4HLXA 4FHTA 3I71A 2HYGD 4BQAA 3M8EA 1BOAA 4HLYA 5D4SA 3WTXC 1ULYA 3LSTA 5BQTA 3T8TA 1BI3A 1ZG5A 4EJTA 1WI9A 1ZHFA 3KEOA 1UHMA 3RI4A 5FLXZ 4G8XA 3JSPA 2WC2A 5LHHA 2D1VA 3P9KA 4KUMA 2XRNA 4HYEA 2XKOA 5FFXA 3LQQA 4M9XA 3D0SA 4KICA 3F8FA 5DD4A 4ON0A 4HF2A 4CDGA 1IXSB 2PFBA 1HW2A 1W4MA 4UV9A 4IRGA 3CDHA 2P5VA 4A0YA 4G9YA 5D8KB 3R4KA 4Q5SF 2EWNA 4EGZA 3TQNA 3U1DA 1XSXA 2Y75A 4HDUA 2HWVA 2PEXA 3FHZA 1Z6TA 2WTEA 3KP7A 4KT5C 2YR2A 3IC7A 3T5XA 2KIUA 1HSTA 2QVOA 3IKTA 1EH6A 1PP7U 3MEXA 1MJ9A 2M8EA 2MD5A 3O2PE 1H9TA 4JQFA 3KE2A 4AD9A 2QQAA 1NHAA 2LF7A 2ZMEA 1O7LA 5DEQA 1UCRA 3TGNA 4QWQA 3W6JB 3E5UA 1H0MA 4XBFA 3ABTA 3DV8A 1TTYA 2ESHA 4EM1A 2ZKZA 4YFXF 4EJOA 1Z1DA 2RGVA 2OU2A 1QGPA 1BM9A 2X4HA 4XRFA 1S29A 1ZAOA 4L0ZB 3OOPA 2NYXA 1TLHB 3CUQB 3JTGA 4QLCU 4OIOF 5E8IA 2IA0A 2R3SA 1K7AA 2F5EA 3HIFA 5HS7A 1J9IA 3HSRA 3WGGA 1BJAA 2FSWA 1KGSA 1IN7A 2O0YA 3WGHA 1T0FA 1YS6A 1YLFA 3LA3A 3DXJF 2P5LC 4I2OA 1K78B 2OZUA 4U7DA 1O57A 5BPIA 3Q9SA 4LGWA 4D0PA 5BS6A 2VBWA 1QZYA 5D4RA 2VBZA 5LRRA 4LLLA 2KRFA 2FEZA 3LFKA 2W85A 2L4MA 2PN6A 2M30A 4ESJA 5K5RA 2FA5A 1PUEE 4LD5A 1B9NA 3R6SA 2L02A 3GUDA 4O6JA 5TRDA 1LVAA 4EJWA 2IA1A 2YSRA 3I58A 1HKTA 3K2ZA 3E5QA 2CO5A 4YIIA 3I54A 5AIQA 5BPDA 1T38A 5E8GA 5JR3A 3BDDA 4OIQF 1G4DA 4BNCA 3GFJA 2M45A 3JW4A 1LB2A 1MZBA 3RKWA 2E1NA 5LHGA 1V4RA 3QU3A 4U7BA 3I59B 4UV8A 2VOPA 1P4AA 2J5PA 2MLKA 4TV7A 3Q9VA 1ZGJA 1K79A 5JFRA 1DPRA 5CVIA 1AWCA 1U6GA 1TNSA 3VOEA 1FY7A 3C18A 1CF7B 5ICFA 3TKYA 1ZLKA 4L9JA 3V8JA 3WTUC 2PLYA 2PI0A 1ZREA 2W84A 3F8NA 4M9ZA 3FM5A 2QBYB 4WX9A 6PAXA 4GXOA 2NNNA 1REPC 3DQVC 4L5IA 2DPUA 5L3FA 4PGGA 3VEPA 2R7FA 1W5TA 4DNCA 2PMUA 3KP4A 1SD7A 5CYVA 4OIRF 1B59A 3SHFA 3B73A 3CUQC 3IWFA 5AIPA 2LSOA 3CJNA 2F2EA 2DW4A 3GZ6A 2V1XA 3EQLF 2DQLA 4NQWA 2EK5A 1R36A 3T8RA 4G7OF 4HF0A 2IP2A 3P9CA 5HDGA 2Z5UA 2GWRA 2EA2A 3T0YA 4OMZA 2F5FA 2A6EF 2FU4A 4M9SA 2VONA 2ZO4A 1QNTA 2XAGA 3DPTA 2RNJA 4CO8A 4A12A 5J6XA 2Q0OA 3HOSA 4CHUA 2EFWA 3SQNA 4N9IA 2A6HF 2ZMEB 1IXCA 3J7AO 1QPMA 2FRHA 3ECOA 4NB5A 4UVCA 3IKVA 1J7KA 4A6DA 1R1TA 1BC7C 1DP7P 3FXUA 1O3SA 1RUOA 1P2FA 2ZNZA 3ROUA 2A61A 2JZYA 2H6BA 1XDSA 4RB0A 2RVCA 2VN2A 5CVVA 1O3RA 2UXXA 3TOBA 4LLGF 3CUQA 4OU0A 3WTWC 2HEOA 3EDPA 3F23A 2QWWA 1IZ1A 1F1ZA 5DV5A 2JTVA 4XLPF 2HDCA 2QUFA 4UHTA 5L3CA 5FO5A 3QP5A 1STZA 3PQKA 1XCBA 4HA8A 1SAXA 4M71A 1P6RA 2LKPA 4HX8A 2QLZA 1K78A 4ENKA 4ESFA 2VE9A 1W7PB 1QQIA 3V8LA 3NEUA 4LLNA 3HHGA 3CUOA 3I0TA 4MTDA 4CGZA 1BIBA 2QQBA 3ELKA 2IJLA 1IRGA 5D5WB 1GXPA 4CZZA 1ODDA 4A5MA 1XSDA 1KU2A 1YG2A 3BP8A 3V7RA 4N9HA 4KIBA 1L3LA 3MZYA 2K7LA 3V8KA 2DT5A 4G7HF 2D1HA 1FBSA 1S7OA 2G7HA 2EV5A 4ENJA 3M8FA 4XSXF 4AIKA 4WCGA 4L9VA 3QRFF 2DBBA 2A5YB 5CVJA 2ISYA 1SFXA 2E7WA 5LGNA 4I09A 5LHIA 3ABUA 1P4WA 2O6GE 2DU9A 3QPHA 1KU7A 1KQ9A 2DLLA 4KDPA 3GEZA 2CYYA 1LEAA 2OA4A 5K1YA 2QENA 2XIGA 1FP2A 3CTAA 3E6DA 5CJ9A 4XSZF 5D5UB 3CO7C 2OD5A 3GO5A 3JAMK 3GXOA 3QPTA 1XB4A 2IPQX 3TDZC 4P5OA 1CF7A 4Q4ZF 4IF4A 2RKHA 3FM3A 2DAOA 1D3YA 3P9IA 4HW0A 2GAUA 2HZTA 1HQCA 4N0BA 4HV6A 2UWMA 1MJBA 4P9FA 5A2QK 2QBYA 3HRUA 1HW5A 1FX7A 4EMSA 2GXGA 3ECHA 4ZYEA 1R5GA 1CGPA 4KN7X 1T6SA 1S8NA 3F8CA 4AIJA 3REOA 3WU0A 4BH9A 2VOOA 4UVBA 1WWXA 2G7UA 5D5VB 2BE5F 2CFXA 3C7JA 3FMSA 3RTRA 5LBQA 3VFZA 2EFQA 4EJVA 2FE3A 1MDMB 3TO7A 3KP5A 3HSFA 3M1EA 3HOTA 1I6XA 2EA4A 5J8CA 2K4BA 2ELHA 1IN8A 1HBXG 2LDUA 3GVAA 2IA2A 1J2XA 4CXFA 2DPDA 1O3TA 4RGRA 3R61A 1B4AA 4WK8F 3ZN1A 4HV5A 1OR7A 3S2WA 2Z99A 3D5LA 4R8HA 4RAZA 2KJCA 5E20A 2GA2A 1U5TA 2Z33A 2EFOA 1I1SA 4PCQA 5CVRA 3GF2A 4KIGA 4LB6B 1PP8F 5LRSA 1ZGAA 4KNYA 5D6FA 2FMLA 3DKWA 4U0VA 4U88A 1BI0A 3I53A 2JPBA 2VT2A 4HOBA 4M6XA 5ILSA 3ERED 3E6BA 3K9TA 5FD6A 3GFIA 2L01A 1D8KA 5HS8A 2CSOA 1TBXA 4HQMA 3K1NA 4HZFA 1P92A 1QZZA 3K1PA 3JAMZ 2CW0F 4XLNF 2MH2A 1RNLA 4IHTA 3FMQA 1IN6A 3DFGA 3KLOA 4L9TA 2HYFA 5D5XB 1C0WA 1E17A 2HKOA 1U78A 1OYIA 4UNOA 5A2QZ 1IAWA 2FNPA 4CICA 2DI3A 4R79A 1W7PA 1RI7A 4MEYF 1KU3A 4HX4A 3HRTA 4EJUA 3GZ5A 2WWYA 3EYYA 1IXRC 2RN7A 4LFUA 4BHCA 1R5HA 2V9VA 1XMKA 2KIMA 2ZNYA 5LEKA 1FLIA 2OBPA 4IHSA 2ZFWA 2ZBKA 4U0YA 1F4KA 1V3FA 2NRAC 4P9UA 5LEJA 2M1BA 2DQRA 3HSEA 1K6OA 1RZ4A 2RV8A 1J0RA 4G6DA 4AVPA 4ZZDA 1EH7A 3K69A 3IL2A 5LGUA 2FBIA 4UVAA 4LK1F 3ZQ7A 3ZN0A 3MFKA 3BY6A 1FZPB 5DDGA 4Y15A 1LQ1A 2A07F 1XGSA 2HGCA 3KP3A 3DF8A 2Q8KA 1SFEA 1P4XA 3TO9A 2STTA 4IJAA 4BHPA 1FBUA 3LQRA 3IWZA 1OMIA 4I98B 1BIAA 3ZPLA 2QM3A 2A68F 3GLXA 4ASNA 1SD5A 4RGXA 1YW8A 1FT9A 4B8XA 1X3UA 1KU9A 1H9GA 4IPAA 2FBKA 3PQJA 5HDKA 3FXQA 1WKMA 2JPCA 4KN4X 4S05A 2H94A 2BV6A 5HVQC 2KKOA 4RS8A 2ZXJA 4L18B 2GIVA 4WWCA 5E1XA 2FBHA 2GA1A 5L3EA 4ZH4F 3F6VA 5BMZA 3GYHX 4EM0B 1EV7A 4E70A 4A0XA 3HYIA 5DCMB 1YO5C 1DDNA 2RQPA 1DUXC 2ZCWA 2VODA 4YFKF 2V1UA 2XVCA 1BBYA 5HS9A 2LNBA 1B1BA 2YX7A 1FOKA 1MJAA 2DK8A 4Y17A 1ZG3A 2L3DA 2E1CA 4GYIA 1MDMA 2M87A 4HDVA 2NAZA 5F6FA 4G94A 3WG9A 1R7JA 2XV4S 1XGOA 1S7AA 2VC1A 4EV0A 3E3VA 2HOEA 2K4JA 3J81Z 2ESNA 3TOAA 5K5OA 3QP6A 3RDIA 4HX7A 5E1WA 4I02A 2MA3A 2FMYA 2AS5F 1OPCA 3TO6A 2ETHA 2M5WA 1G3SA 2O3FA 5FB2A 1YS7A 2D2WA 2WV0A 3KEQA 1U5TB 1YTYA 3IRRA 1SD6A 4KMFA 2CG4A 1Z91A 1BN5A 3JTHA 2XAJA 4H0EA 3C3WA 3ZMTA 1XGNA 3FWEA 3F21A 5DUKA 2NNYA 1BI1A 3FXRA 5L3BA 1FSEA 3K0LA 3WTSC 2XROA 3B02A 4JK1X 4A5NA 1ZRFA 1YQAA 1L0OC 2ZJ2A 3L9FA 4MTEA 1IRFA 2V6CA 5FD5A 1TW3A 2A69F 3F3XA 1G6NA 1KQ0A 4MQVA 3HRSA 1USTA 2QQ9A 5IT9Z 5E18F 3N4MA 3GFLA 2RC4A 2VC0A 1ZRCA 1D8JA 1I27A 1PDNC 2FF4A 1XMAA 1FYLA 3WE2A 5EEHA 1W7PD 1OYWA 3MAJA 4OOIA 3LAJA 3WODF 5K5QA 1B6AA 4RAYA 1GXQA 2GXBA 2YU3A 2O03A 5FGMA 3KFWX 5LLQA 4IRIA 2P5KA 1IW7F 3KLNA 4O3MA 3ZMZA 5D8LB 1LDKB 2QZ8A 3HTSB 1U3EM 4RB1A 1T98A 2CQKA 3BZ6A 4G7ZF 1FSHA 2XKPA 5ILVA 5KK1A 2P4WA 5CLSA 2FOKA 4G6QA 1WRJA 2FQ3A 1GHCA 3OV8A 3KCCA 3QOPA 3T1BA 4ZYGA 1TQIA 2JSCA 3IRQA 3L2CA 1I1GA 3V7SA 5HLHA 4YIFA 3WTZA 1IN4A 1YIOA 3F6OA 2STWA 4O5VA 3U9GA 3BJOA
chains in the Genus database with same CATH superfamily
3BC8A 3W2VA 2HFHA 1Z0XA 5EZHA 2PQ8A 3S14J 4X6AJ 2DA5A 3MN2A 1UHWA 5AONA 5EG0B 1JHHA 2IGOA 4FX4A 1ZLJA 2XAHA 1AA7A 3R0JA 5E17F 4BY1J 1AKHA 4E7JA 1Z3YA 2BBYA 2CQ7A 2DT6A 2H1LA 4CZCA 2W48A 4MQ9F 1XDUA 2BGCA 1ZELA 3PNTA 2VKEA 1HSJA 1V5GA 4KFCA 1G3YA 2HTSA 2XAQA 1O3QA 1NK3P 4I0AA 5JI6A 3AAFA 1FMWA 1JTXA 1XMXA 3WTTC 1X1DA 2DFFA 1U5TC 1LNWA 1MBJA 1OKRA 1KYWA 5KVRA 2P0WA 4RGSA 3PIOF 5L3DA 3MQ0A 2CWEA 2CW8A 1X58A 3SXYA 1T39A 1LEBA 5F64A 1HXDA 1XGMA 1YYVA 3QU6A 4YEJA 4RB3C 4XIDA 5DCMA 2L9NA 1MMSA 1MBHA 4P55A 1VNDA 1X3WB 2R7OA 3C1DA 2F5CA 2EZIA 3FKIJ 3M9AA 4NNJA 4BAYA 1FJLA 1J5YA 3FHNA 3JCUC 3MZHA 1Q1HA 4H4KC 4L5EA 4ZYHA 3BPXA 1OCCH 3MWMA 4BXUA 3JRIA 1R49A 1WQ2A 4GDFA 5H6RA 2DO7A 3EUAA 1YRNB 4QPOA 1W0TA 4B1RA 3HEFA 1S6LA 3CCRI 4PUSA 2V26A 3COAC 4MGRA 3Q0VA 3IH4A 1RIOH 1WVRA 3AG2H 2BEOA 1IGNA 3GWZA 4LITA 2IGNA 4PZJA 1FC3A 2E1MB 2AXLA 4A2UA 4U0WA 4BU2A 4L9NA 3TDUC 2K40A 5FKKA 3O8GA 3Q0UA 2GOXB 2V79A 3K7AJ 4AYBN 1SVLA 2LTPA 1ETWA 3G71I 3U1KA 2PBIA 4YFNF 2FXAA 2I8DA 3R0AA 3RKYA 2L9RA 3L7WA 2BXZA 3E1SA 5M5YJ 1BR1A 2WAQA 3K4KA 4RLQA 5E3LA 1ZN2A 2GIZA 3SDBA 2Z9OA 4BQOA 5E3MA 3JSOA 4C2UA 3BOQA 5J8FA 3SFZA 2YUSA 1HKSA 2PMHA 3KZZA 4ENNA 3WHBA 1KZHA 3JREA 3S93A 1EH8A 1YFHA 3V4GA 2I5UA 1IG7A 3CMMA 4Z2YA 3CCJI 1R9TJ 2FJ1A 2LR8A 4S0HB 2PJPA 2GBYA 3FF5A 2A5WA 4CSWA 5FFZA 1TNTA 5EEGA 1ZTRA 4PJLA 3BPVA 5E1ZB 3WE3A 4HNTA 1JT0A 2CFOA 1WJEA 2WA0A 1Y8RB 2R7DA 1YW9A 1S3JA 3VODA 2FNAA 1SD4A 3PFIA 2E35A 1UZCA 1YITI 4CYDA 5BOXA 1XSVA 4PDKA 4ZDLA 1W0UA 2WY7Q 3A01A 3O6BB 4OIPF 2E36A 4GCVA 3F8BA 3GFMA 4WXDA 2HOAA 1HF0A 4K2EA 4PGHA 4ZTFA 3HOYJ 4IL6C 3SZPA 3EUHA 1TQPA 1W5SA 1GVJA 4S04A 1HA8A 5ED4A 1SC7A 2HR3A 1JE8A 1R23A 3QOEA 2KZGA 2VI6A 5KAFC 3ZMSA 3LWFA 2LOOA 2H1KA 1LDJA 1USSA 5FRNA 2OQGA 4II2A 3M4OJ 1ONVA 1MMDA 4HQEA 5HNHA 3BR1A 1FYKA 2JT1A 2BYVE 4HSRA 2UUZA 4OMYA 1LFBA 4EEFG 3LSGA 1JGSA 4XLAA 2ZB9A 5H6QA 2KP6A 4XKWA 3KZYA 4M72A 1AU7A 3RPQA 2P6SA 2ECCA 5J4YA 3M07A 2HOTA 2IS1A 1VQKI 2R4GA 4Z6YA 1JXSA 1MBGA 1RUNA 2XF7A 3S2HJ 3CLOA 2EV0A 4FT8A 3U2RA 1G3TA 2VQGA 3HRMA 4UUVA 1IDZA 3FBIB 3QWLA 4IVNA 4ZYDA 1A36A 2VBYA 2UV1A 4BYYA 1R5ID 5IY5H 4DW6A 2QSFX 3BJ6A 3DBRB 1R00A 2MLGA 1VTNC 1Z7UA 2ZXHA 1IV6A 2DTRA 2NVYJ 1IN5A 3KP2A 4WXHA 3BR5A 4F7ZA 4LMYA 5LFAA 2XGXA 4KIFA 3RIRA 2HVRA 2QYOA 3GTOJ 1W36C 2VXZA 2G9WA 4AC0A 4HNVA 5CKTA 3WGIA 4L0YB 4DIQA 1MD0A 1I5ZA 1OYYA 2VUMJ 3PFYA 1PUFB 1BOBA 2VL8A 4I7HA 3K6GA 1SMTA 3FZVA 4M74A 3K10A 3I5UA 2KMUA 5E3NA 1U2WA 1Q1VA 3H3VK 3F8MA 1PJRA 2AHQA 4GYGA 2KLOA 1FPQA 2W24A 4LOCA 4MLOA 2RDPA 3V7CA 2E5ZA 2CGPA 3BZKA 1U9NA 2UXNA 3OS1A 2TDXA 1KQ8A 4A3IJ 1E2XA 1ZARA 1BR2A 1XG1A 4KA4A 1U8RA 2E7XA 3MZ8A 1Y6IA 5CVUA 3J81K 2B0LA 1LDDA 3ML6A 2LKSA 3UKGA 5CQGA 3FK7A 1AOYA 5FKNA 1HOMA 3RJPA 2H27A 1A31A 4UXNA 3O8HA 1G8XA 2X1DA 4P1WA 1IUFA 2MBFA 2OUMA 2C6YA 2E5NA 2DFIA 1Z7LA 3AFHA 3S16J 2JRTA 2LF8A 2KJBA 1ZYRF 4AIHA 3W2AA 4HBLA 2MH9A 1K6YA 2WBMA 4RGUA 3EETA 3OYLA 3QYFA 3ZQCA 4MHGA 1FOYA 3N97A 3DEUA 1XD7A 4BJ5C 1MKMA 4P96A 1SFUA 1LFPA 3HUGA 3I64A 2A3SA 1ZG1A 4ANJA 3M7GA 2JQ7A 3FX3A 3ASNH 1DPUA 2MD0A 1QO0D 5B1BH 3E6MA 1HKQA 4JOMA 3GTLJ 2QCOA 4GGGA 1MBEA 2Y48A 2CV2A 2ISZA 4F93B 1QU3A 2O9LA 3ONQA 3D5SC 5K7ZA 5EG0A 1I3QJ 4HNUA 5TJJA 3G73A 4GFBA 1J59A 2ZSHB 2EFPA 3LSMA 1V55H 3D1NI 3OMYA 3W2WA 4KJZA 4ETSA 1ZKGA 4NHJA 2O8XA 2Z3YA 1Z6RA 3ZQQA 4EATA 3KETA 3H92A 1XN7A 3RPUA 1QVTA 1DGRM 5DUIA 2W7NA 4MIMA 5ICEA 2XAFA 2LBFB 4A0ZA 5IP9J 4ZYAA 1A04A 3F0CA 2ACJA 4Q48A 2BY1A 1WH7A 1KYZA 1A6QA 1FBQA 1ZH5A 3ZMUA 3PNVA 2D45A 2ADUA 1I50J 1BC8C 3K1MA 4I0BA 2VB6A 2Q1ZB 3OR2C 3FMRA 1SFOJ 2CU7A 2NS0A 3G3ZA 3TW6A 5JVTA 5B1AH 1BI2A 3ZMDA 3W6VA 5ILUA 2P8TA 3BROA 2M4KA 4RDUA 4LG0B 3RYRA 3ISPA 2H8WA 5IT9K 4XOTA 4YIRX 2DMUA 2Q2EA 1YRNA 3MKZA 2R7VA 3LSJA 5F1RA 4C3HJ 5HLGA 1WH5A 2EQRA 3CO6C 3EYIA 4LB5A 2VT3A 5DYMA 5HDNA 4MNUA 2EB7A 2BY2A 4IXAA 3WTYC 2OAZA 4C3IJ 2EINH 3GLLA 2DODA 4D7NA 4DJAA 2AXTC 4ENMA 4YELA 2WY8Q 3CMAI 1FNNA 2P7CB 4BXXJ 1ZRDA 2CUJA 3M8JA 4V2FA 3H35A 3SDGA 1FP1D 3H0DA 1X3ZB 5L3GA 3S1RJ 1R1UA 4PSXA 5IYBJ 3OYNA 1TT5B 4IQJA 4XR6A 4NUBA 4BXFA 4QTRA 4M73A 2K02A 2KT0A 4M6YA 2MFZA 2COMA 2EJRA 4AVZA 3WU1B 3KEYA 5FRMA 5K7FA 3NWTA 1I6HJ 1IUYA 1LVKA 4CCLA 4CH7A 1FYMA 1TWHJ 3D5RC 4JX6A 3OYHA 2GZWA 2LY9A 4E7KA 3NARA 3Q5FA 1D5VA 1RESA 4DYQA 2KIFA 1MGTA 4L5JA 3F72A 3UNGC 2O5RA 3ZQLA 3H9QA 5IOYA 1LFUP 3W3CA 3BG5A 1F5TA 4XM3A 4C2MJ 3RYPA 2V6EA 3VDXA 1TQMA 2F5DA 2LREA 2IW5A 4JBAA 4BQQA 4IOCF 5IT3A 3QPLA 3E6CC 3OYCA 3E97A 2XASA 4N4OB 1R1VA 4CA0A 3PSFA 5ICGA 4WF2A 1JHFA 4AIDA 3I4PA 2IAIA 2XRLA 1DU6A 2HU9A 4LK0F 5EF6A 3CCUI 5LGTA 4BHBA 2HNHA 3J80K 2H6CA 2YPRA 2CUFA 1S72I 1ON1A 1X1BA 3PM1A 3MKYB 3H3ZA 1DGWY 2VQCA 4EGYA 3PNYA 2MC3A 3ERMA 3HTUA 5DCFA 2EFNA 4XICA 2DK5A 2XUBA 5IOZA 4HF1A 3GW2A 2GQQA 1Z9CA 3ULQB 3FXOA 4MO7A 2M0CA 4Q47A 1X1PA 2OC6A 2L7KA 1IDYA 4XL9A 1OCOH 3MCZA 1UG0A 3NQOA 1YE9A 4KMUX 2QSGX 4RB2C 1MNEA 1YW7A 3WHCA 1MW7A 1FWZA 3LSIA 4Y7NJ 2P6TA 5HNFA 2X0LA 3H3UA 2DA6A 5HLIA 2LYCA 4RAGA 1YX3A 1VI0A 2L54A 5F1JA 1BJZA 2H09A 5ERIA 5HLTA 1IF1A 4LIUA 4DBQA 1T08B 5EGOA 3DP7A 4A3BJ 2IEKA 4BE2A 3S1MJ 2IS6A 4KYWA 4DYRA 1MMGA 2CUEA 4FASD 1BW5A 2KHMA 2L4AA 2P7VB 3BCAA 4B4CA 1ON2A 3SZTA 1MSEC 3BT9A 4LJZF 3JRGA 2LY1A 5IPAA 1O7FA 1TW2A 5EEAA 3E7LA 3N05A 4A6EA 2O61A 3CF5F 3ZQIA 2NOGA 2JA7J 2HZDA 1OLTA 1T2KA 4XQFA 5HOOA 1HCRA 3S15J 4YG2F 5FLXK 2W25A 2HQNA 5EDNA 3RZOJ 2X6OA 3IP4B 2EV6A 3L00A 3RKQA 3LL7A 2L5QA 4AWXB 1PUFA 2JMWA 1ZR4A 3R60A 2OQRA 4F3QA 3G1MA 1Z05A 2HOSA 4GO1A 3LFUA 5B5EC 1V5FA 3ZP5A 2R7TA 1Z77A 1FIPA 2JA6J 1E3OC 1POGA 4I01A 3S1QJ 3B6AA 1WSUA 1QBJA 4E7HA 1XTAA 3L09A 3KYLA 3BCBA 4EQQA 2EZKA 3ABLH 4MFDA 1SFKA 2YX4A 3S2DJ 3J7AY 3DKXA 3RQIA 2R7SA 4HAMA 4EM2A 4FX0A 1ZGWA 1SMYF 1GVDA 3BWGA 3O3KA 1WFXA 3W6KB 1OCRH 2NXNB 3RKXA 1J75A 1MH4A 4XLFA 5F08A 3ZOBA 4C3JJ 3VB2A 3CMYA 2ZXWH 2KDZA 3OYEA 5E3OA 3TMOA 1H89C 3IHUA 3DPLC 1YJ9I 2HQ5A 2X48A 4Y3OA 5LD2C 2ZJPF 2K86A 2UZKA 4BY7J 2XC7A 4WXCA 2PMZA 1UJ8A 1G3WA 1XCVA 2W57A 1LJ9A 2XF5A 3CQZJ 3P7NA 5JHUA 1E0EA 5H20A 3LAPA 2RREA 1G59A 3F22A 3GX4X 2VE8A 4CUGA 4A93J 2NOJB 1UFMA 4XNFA 3HHHA 2VBXA 3HKZA 1HW1A 3QAHA 1F9NA 1Y0UA 2HS5A 2MSYA 1E3PA 4IRHA 3KP6A 3HDDA 3IV5A 1TZLA 5J1YA 3J80Z 1Z21A 1B9MA 3IAM2 1WHUA 2J5OA 2MG4A 4ESBA 4B09A 1EA3A 2V1DA 2DA4A 2HQRA 2ZSIB 3K4JA 4OINF 1R22A 4UUSA 4XRSA 4ITVA 3BJAA 3KPHA 2IVMA 1GUUA 2XSDC 1UB9A 1KA8A 3K4NA 4A3KJ 2CMPA 2PG4A 4ZZLA 1SEUA 4BL0B 4FCYA 5DD8A 2LBFA 3OIOA 3ZMVA 3FXMA 2KIQA 2JK3A 3A03A 3BR3A 3Q0WA 5M3MJ 1T56A 2OV7A 2XHKA 2HKXA 3NRVA 5GPCA 1X4OA 3H1CA 3KIOA 2HDWA 3I59A 2IT0A 2DN0A 1EF4A 2IRFG 1W36D 1JUSA 4CCKA 3LA2A 5D6EA 1I39A 2Y0MA 4R1HA 3RPUD 2PJRB 5ICCA 2OZ6A 2VQHA 3BTIA 3G6EI 3E5XA 4LG0A 4Y13A 5CPRB 4EVIA 1Y1WJ 4MEXF 2M2EA 1R58A 2HTJA 4DQ2A 3OYMA 2CW7A 2K27A 3LA7A 3BG3A 2HVSA 3WTVC 4HLXA 4FHTA 3I71A 2HYGD 3JRHA 2QQ8A 4BQAA 3CC2I 3M8EA 1BOAA 4HLYA 3OSGA 5D4SA 3WTXC 4LIVA 1ULYA 2EZHA 3LSTA 5BQTA 2F4IA 3T8TA 2LD5A 1BI3A 1ZG5A 2Q2EB 4EJTA 1WI9A 2VIXA 2ZMEC 2F48A 3HOWJ 1ZHFA 3KEOA 5DS9A 1UHMA 4XN3A 3RI4A 3H36A 4XORA 5FLXZ 4G8XA 3JSPA 3EUHC 2WC2A 1VQNI 5LHHA 2D1VA 3H9JA 5IP7J 3P9KA 4B44A 4CYCA 2COBA 4KUMA 2GOMA 2K9LA 2XRNA 2L0KA 1JUPA 4HYEA 2XKOA 5FFXA 3LQQA 4M9XA 3D0SA 1T8IA 4KICA 1JKRC 3F8FA 2HXOA 1YOVB 5DD4A 4ON0A 4HF2A 4CDGA 1IXSB 2PFBA 1HW2A 1W4MA 3PO3J 4UV9A 4IRGA 3DKYA 5GADJ 3CDHA 4V19K 4X1EA 2P5VA 2V7FA 4A0YA 4G9YA 5D8KB 3R4KA 4BACA 3TBIA 1PYVA 4Q5SF 2EWNA 4EGZA 3TQNA 3U1DA 1XSXA 2Y75A 2VKDA 4HDUA 2HWVA 2PEXA 3FHZA 1Z6TA 1ERDA 2K9SA 4BDYA 2XB5A 1N75A 2WTEA 3KP7A 4KT5C 3IUOA 2YR2A 3C2GA 3IC7A 1VQ7I 3T5XA 3L2QA 1FOXA 2ECBA 4M3EA 2KIUA 3HB9A 4XLHA 1HSTA 5C4JJ 2QVOA 2WB1A 3PUBA 3IKTA 1JT6A 1ACIA 1EH6A 1OFCX 2DDBA 1U8BA 1PP7U 1T0FC 2LVSA 4ABZA 3I9V2 1MJ9A 3MEXA 2XAUA 4E4HA 3OS0A 2M8EA 5J3LA 1R4MB 2MD5A 1D0XA 3O2PE 4M3DA 4IX7A 3QYEA 1H9TA 2CH0A 4JQFA 4XKCA 1W1WE 3KE2A 4AD9A 4CCJA 4IKFA 2WV1A 1OCPA 1YIJI 2QQAA 1NHAA 1MMNA 2LF7A 4OAZA 2ZMEA 3CDIA 1NTCA 2Y0SA 1O7LA 5DEQA 1YHQI 1UCRA 3Q3SA 3TGNA 2KDOA 4QWQA 3W6JB 1V5EA 3E5UA 3FXKA 4XBFA 1H0MA 3ABTA 4JYKA 3DV8A 1TTYA 1VF9A 3CCYA 2JJ7A 2ESHA 2DMTA 4EM1A 2ZKZA 3L2RA 4YFXF 4EJOA 1Z1DA 2RGVA 1IJWC 2OU2A 1QGPA 3EPZA 1BM9A 4LG3A 1H8AC 3BR2A 3ZQHA 4HRIA 5KNLA 3B6CA 4BUPA 2X4HA 4XRFA 2NVUB 1B8IB 1XS9A 3BTCA 1Y8QB 2WADA 5EGOB 3SEQA 1S29A 1ZAOA 3TP3A 3PIPF 4L0ZB 1SVOA 3OOPA 2NYXA 1TLHB 2EH3A 3CUQB 3JTGA 4QLCU 3E0JB 2MW8A 4NC6A 3VYSB 5TGTA 5E8IA 3KX2A 4OIOF 2IA0A 2R3SA 1K7AA 3G1OA 4MFEA 2VPLA 2F5EA 4BKXA 3AG1H 1TL8A 1HC8A 3HIFA 5HS7A 1J9IA 4XRSG 3CDLA 4B3AA 3HSRA 4QSHA 3WGGA 2OCEA 3A1YA 1BJAA 2FSWA 3M1CA 1KGSA 1IN7A 3HC7A 1SANA 2VPRA 2O0YA 3WGHA 1T0FA 1YS6A 2K9MA 3GCMA 2HYJA 2NS8A 5F04A 4A3GJ 1YLFA 2LG4A 3LA3A 2R7QA 3DXJF 5K7HA 1BW6A 2P5LC 1K78B 4I2OA 2HQAA 5JHFA 1FTZA 5GP9A 3CJQB 2IXSA 5KCMA 4DOZA 1D1BA 2ZJQF 1MH3A 2KISA 3GZNB 2OZUA 4U7DA 5DM6F 3JRAA 1O57A 1FTTA 2DA3A 4E7IA 5BPIA 3HGGA 3OY9A 4HPQA 3CESA 3RZDJ 2LP0A 4B43A 2HDDA 3Q9SA 3DEWA 4LGWA 4D0PA 5BS6A 2VBWA 1QZYA 4B3XA 5D4RA 2VBZA 2R7WA 5LRRA 2HI3A 4LLLA 1R4NB 2FEZA 2KRFA 2HPIA 4RBOA 2TCTA 3LFKA 1U0JA 3V42A 2W85A 2L4MA 2PN6A 2M30A 3IAS2 4ESJA 5K5RA 2FA5A 1PUEE 1OISA 4LD5A 1B9NA 2ID6A 3R6SA 2L02A 3GUDA 4O6JA 5TRDA 1RC9A 1VQOI 1J09A 2XGCA 1Y0NA 1LVAA 2DCEA 2KZVA 4EJWA 2IA1A 3CCQI 5F0HA 2YSRA 3I58A 3ZQGA 1HKTA 4XRMA 4PJNA 1IRZA 4QPQA 3K2ZA 3OYJA 2EPFA 3E5QA 2CO5A 3CF2A 4YIIA 3I54A 5AIQA 5BPDA 1ZR2A 1T38A 2FQ4A 5E8GA 3HZJA 3IH3A 5JR3A 4RLFA 3GBGA 2XDVA 3BDDA 3AG3H 4UUSB 4PJ0C 4OIQF 3HPGA 4PFPA 1G4DA 1RR7A 5IYCJ 4BNCA 5GAGJ 3GFJA 4F55A 2M45A 3JW4A 3HOVJ 1Y56A 1LB2A 1MZBA 3RKWA 2E1NA 1MMAA 5LHGA 4XN0A 1V4RA 3QU3A 1WZ2A 4U7BA 2PJRA 4FISA 3I59B 4UV8A 2VOPA 1P4AA 2J5PA 3CZ6A 2K9NA 2MLKA 4TV7A 3Q9VA 1ZGJA 2MC4A 4BDZA 2M7BA 1K79A 5JFRA 1DPRA 5CVIA 1AWCA 1U6GA 1TNSA 3VOEA 1FY7A 3C18A 5F0FA 1CF7B 3GTJJ 3BQZA 5B3SH 3BTJA 5ICFA 1QRYA 2F4OB 3TKYA 4RMNA 2MYSA 2X1CA 3I56I 4XMYA 2QF7A 3SJMA 1ZLKA 2FUG2 1DU0A 2E1OA 4BE0A 4L9JA 3V8JA 3WTUC 2PLYA 2DXIA 2PI0A 3LSKA 2W84A 1ZREA 2ME6A 3F8NA 1EJ9A 2LY2A 4M9ZA 1IC8A 3FM5A 4G6TB 2QBYB 4WX9A 6PAXA 4GXOA 2DJNA 2NNNA 1XX5A 3VSKA 2CRGA 1REPC 3DQVC 2OTLI 5J40A 3X2QH 3VYTB 2Y30A 4L5IA 1YI2I 4CYCB 4Y4RA 2DTZA 2DPUA 5L3FA 4A3LJ 4PGGA 3VEPA 2R7FA 3MVPA 1W5TA 4DNCA 2PMUA 2HXIA 3KP4A 3ASOH 1SD7A 5CYVA 4OIRF 1B59A 3MKWB 3SHFA 3B73A 3CUQC 3CCLI 3IWFA 5AIPA 2LSOA 2JA2A 2V1NA 4ZJZA 3CJNA 2L2OA 2F2EA 2DW4A 3GZ6A 2V1XA 1APLC 2VASA 3EQLF 2BHYA 2DQLA 4J01A 2A05A 2W1OA 4NQWA 3OL4A 2EK5A 1R36A 3T8RA 3CLQA 4G7OF 4HF0A 2IP2A 3P9CA 5HDGA 2EIJH 2Z5UA 2GWRA 1IO2A 2EA2A 2D5VA 3T0YA 4OMZA 3DU5A 2L7MP 4JX5A 5EYRA 2F5FA 2A6EF 2PMZN 2FU4A 3OYAA 4M9SA 2VONA 2ZO4A 2M3AA 3NAUA 3CCMI 2AQEA 2DOAA 1QNTA 2KFDA 2E34A 2XAGA 3DPTA 2R7ZJ 1TWCJ 2IS4A 1VQ4I 2LC2A 3HKZN 5FLMJ 2RNJA 1LKXA 4B47A 4CO8A 4A12A 3LSRA 2P81A 3H5NA 3NWSA 2K3PA 2R7XA 1P7JA 1JKPC 5J6XA 3A02A 2R5ZB 3CCEI 1NH3A 2Q0OA 3HOSA 4CHUA 2EFWA 3SQNA 4N9IA 2A6HF 2ZMEB 1IXCA 4UUTA 3J7AO 1QPMA 2FRHA 4XK4A 3ECOA 4NB5A 2V9PA 4UVCA 4E7SA 2YS9A 1J7KA 3IKVA 1R1TA 4A6DA 1BC7C 1DP7P 3FXUA 4A3JJ 2E19A 2B9SA 1O3SA 1RUOA 2CQXA 1P2FA 2ZNZA 3ROUA 5E79C 2X51A 2A61A 1B8IA 2JZYA 4A3MJ 1QZEA 2ELJA 1N77A 2H6BA 1XDSA 2K85A 4RB0A 1G2HA 2RVCA 4D9JA 3I4NJ 2LMDA 2VN2A 5CVVA 9ANTA 2EIMH 1E3HA 2UXXA 1O3RA 3TOBA 4LLGF 3CUQA 4OU0A 3WTWC 3TEDA 2HEOA 3EDPA 3F23A 2QWWA 1Y39A 3HXLA 2MABA 3H5AA 1IZ1A 1F1ZA 5DV5A 2DMQA 2VKHA 1CQTA 2JTVA 4C9YA 2QKLB 4XLPF 2HDCA 1ENHA 4HG2A 1MNDA 2QUFA 2DMNA 4UHTA 5L3CA 4FE7A 5FO5A 3QP5A 4C30A 2MGQA 5JLXA 4AUXA 4D5CA 1A6IA 1STZA 1ETXA 1JKQC 3PQKA 1XCBA 4HA8A 1SAXA 4M71A 1P6RA 4XLCA 3SFIA 1JKOC 2LKPA 3OOUA 4I76A 2W82A 5KHDA 4HX8A 2QLZA 3BZCA 3UR3C 1K78A 2NVQJ 1ZK8A 3DPUA 2GLOA 4ENKA 2KRCA 1ETQA 4ZC3A 4ESFA 2VE9A 3OR1C 1W7PB 1QQIA 2OJED 3A4CA 4BQNA 3GTKJ 3V8LA 3NEUA 4J19A 4LLNA 3HHGA 3CUOA 3K4MA 3I0TA 1YJWI 4MTDA 5C44J 4CGZA 3EUKL 1BIBA 5F0CA 3DU6A 3PSIA 2X85A 2QQBA 3OYBA 3ELKA 4NC8A 2IJLA 4RM3A 2OPTA 2WAQN 1IRGA 3ZCOA 5D5WB 1GXPA 4CZZA 3CD6I 1ODDA 4A5MA 2PX9A 1XSDA 5FLVA 3ABKH 4IHWA 1KU2A 2CQQA 1YG2A 3BP8A 2HPMA 2H8RA 3V7RA 3SZGA 2ZFUA 1KONA 4BJ6C 1HLVA 3KZIC 3I55I 1WJBA 4PJJA 3QPSA 1GV2A 4NBQA 2V9KA 2DJIA 2XPWA 4N9HA 4KIBA 4BJTA 1L3LA 3MZYA 2K7LA 4BEHB 3M3YJ 3V8KA 2F6CA 3CC4I 3S17J 2DT5A 4G7HF 1N25A 2JA5J 2WB1N 2D1HA 2IGKA 1FBSA 1S7OA 2G7HA 2K5CA 3DTKA 3VPRA 1X2MA 2M0MA 3FKJA 3GTGJ 2EV5A 4ENJA 2KPMA 3M8FA 2N8GA 4XSXF 4AIKA 4E6KG 4WCGA 3A0BC 2K9QA 1OCZH 4L9VA 3QRFF 2DBBA 2A5YB 5CVJA 4OWRB 2ISYA 3BG6A 4XKBA 1SFXA 2E7WA 4HEA2 5LGNA 4I09A 1WI3A 3S3NA 4BE1A 3HOZJ 5LHIA 3G2BA 3ABUA 1S5LC 2Y0SN 1P4WA 2O6GE 2DU9A 3QPHA 1KU7A 1UG2A 4M3BA 1KQ9A 3LOCA 1OCTC 2DLLA 4KDPA 3GEZA 3K4BA 2CYYA 1LEAA 2OA4A 5K1YA 2FX0A 2QENA 4DBRA 2XIGA 3CMEI 1FP2A 1H88C 3CTAA 3G4SI 4D5FA 3E6DA 2X9DA 5CJ9A 4XSZF 1RKWA 5M3FJ 3K2AA 5F27A 5D5UB 3CO7C 2OD5A 3GO5A 3JAMK 3GXOA 3QPTA 1XB4A 2IPQX 2LH9A 3TDZC 2CJJA 4P5OA 1CF7A 4Q4ZF 4D7MA 2M4GA 4IF4A 4F52A 1BL0A 2VJ5A 1YJNI 4JX4A 4KT6A 2RKHA 1OR7C 3FM3A 2V4JC 2DAOA 5FKLA 1D3YA 3HG9A 3K70C 3P9IA 2CUZA 1XPXA 1UELB 3GTQJ 3S1NJ 4B48A 4HW0A 3JRBA 2GAUA 2HZTA 3G1LA 1RR8C 1HQCA 2JUCA 4N0BA 4HV6A 2UWMA 1MJBA 4P9FA 5A2QK 3ZXSA 2CS3A 2DA2A 5FROA 3S32A 2FOWA 4IHVA 2QBYA 3HRUA 1HW5A 4J00A 4E7ZA 1TC3C 1FX7A 4EMSA 1P7IA 3HOUJ 2GXGA 3ECHA 4ZYEA 1R5GA 3OYGA 1CGPA 2JRMA 4W1UA 1LPQA 2W4SA 4KN7X 1D5YA 3JR9A 1T6SA 2JUGA 3FXLA 3DLAA 1S8NA 3F8CA 4AIJA 3AL0B 5JVGF 3REOA 2NVTJ 3OYIA 4IO9F 2M8GX 2VQLA 3WU0A 4BH9A 2G0EA 2VOOA 3PL8A 4UVBA 1WWXA 4KITB 2G7UA 3C2HA 5D5VB 2BE5F 2CFXA 2VJIA 3CCVI 3C7JA 3FMSA 3BR0A 3RTRA 5LBQA 1A5JA 5J1UA 2Y69H 2EFQA 3VFZA 4EJVA 2FE3A 3FXJA 1F36A 1V54H 3FBNB 1MDMB 1QPIA 3S8PA 3TO7A 3KP5A 3P5JA 3HSFA 5H2FC 3M1EA 3HOTA 2ME0A 1I6XA 3GTMJ 2EA4A 4DZPA 5J8CA 2BHZA 2K4BA 4NQWB 2ELHA 1IN8A 1HBXG 2LDUA 3GVAA 2IA2A 1J2XA 4G12A 4M6VA 4CXFA 2DPDA 2VJ4A 2LKXA 1O3TA 4RGRA 3FDYA 1B4AA 2L9VA 3H9GA 3R61A 2W00A 4WK8F 3ZN1A 5B66C 4HV5A 5EJCA 4XKVA 1OR7A 3S2WA 2Z99A 3D5LA 4R8HA 2LRDA 4RAZA 4IHYA 2R5YB 1MNMC 2KJCA 4M3GA 3OIPA 1K83J 5E20A 2GA2A 1U5TA 2R5ZA 2XSJC 4CCOA 2Y2ZA 2EFOA 2Z33A 1I1SA 4PCQA 5CVRA 1QA6A 3GF2A 3TL4X 1GV5A 4KIGA 3I4MJ 2KRHA 2BOLA 4V2GA 4LB6B 1PP8F 4A69C 5LRSA 1ZGAA 4KNYA 5D6FA 2FMLA 3DKWA 4U0VA 4U88A 1BI0A 3I53A 5KAIC 2JPBA 2VT2A 2JSPA 4HOBA 4M6XA 5ILSA 1T33A 3ERED 2DT7B 3K4CA 2JWTA 3E6BA 3K9TA 5FD6A 3GFIA 5FKMA 2BVMA 1TWGJ 2L01A 1D8KA 3H0GJ 5HS8A 1FMVA 3AKZA 4IEJA 3LSPA 2CSOA 1TBXA 4HQMA 4HSTA 3K1NA 4HZFA 3VSLA 2LK2A 1P92A 3TP0A 1JJ8C 2ICWG 2ZXIA 4CCNA 1B72B 1QZZA 3K1PA 3I3LA 3JAMZ 2CW0F 3ESWB 4XLNF 1IV8A 2MH2A 1RNLA 3GTPJ 1Z3XA 1X19A 2XB0X 3OYDA 4IHTA 5GTHC 1VZ0A 3FMQA 2E60A 1IN6A 3DLLF 3DFGA 3CC7I 3KLOA 3BG9A 4C2TA 3PJRA 3LNQA 4L9TA 2HYFA 1VQPI 5D5XB 1A35A 3S3MA 2DDAA 3BTLA 3U9GA 1C0WA 5C3EJ 1E17A 1T95A 2HKOA 3HL2A 1OYIA 3J7YJ 1U78A 4UNOA 1AHDP 4PK4A 1TP4A 2Z2SB 2IBDA 2Y9YA 3IH2A 3MMYB 5A2QZ 4QIWN 2CQNA 2DA7A 2FNPA 2Y9ZA 1IAWA 4CICA 2GM4A 2DI3A 4R79A 1W7PA 1RI7A 1FOWA 3RCOA 2JN6A 4MEYF 3QODA 3PUFA 2Z1DA 3F9KA 1KU3A 4HX4A 4BBSJ 3HRTA 4EJUA 3GZ5A 4I99C 2WWYA 2RNGA 4AU7A 2TRTA 3EYYA 1NK2P 2DFHA 1IXRC 3FIWA 2RN7A 3ABMH 3KYCB 4LFUA 1S9HA 1WJDA 4W97A 1TWAJ 4BHCA 1TT0A 3QQAA 5EZGA 4M3FA 2CV0A 1R5HA 1QHHD 2V9VA 2VXDA 1XMKA 2KIMA 2ZNYA 5LEKA 2JVGA 4AYBA 1FLIA 2OBPA 5GPAA 1XC5A 4IHSA 1F43A 2ZFWA 5GAEJ 2ZBKA 4U0YA 1HDPA 1F4KA 1V3FA 1MIJA 5GTIC 3DEEA 2NRAC 2F5VA 4P9UA 2EZLA 5LEJA 2M1BA 2DQRA 3HSEA 4ZDPA 4BEHA 1K6OA 3JRCA 2DYSH 1RZ4A 2RV8A 1J0RA 4G6DA 4AVPA 4ZZDA 3HJEA 4UY8I 4JP0A 1ZQ3P 2A6TA 1EH7A 3K69A 5GAHJ 3IL2A 3DTEA 4U87A 1MBFA 3ZQFA 5LGUA 2FBIA 4UVAA 2ELKA 3VYUB 1LE8B 2L9SA 2DFEA 3AL0C 4LK1F 1WCMJ 3ZQ7A 3ZN0A 3MFKA 3BY6A 1FZPB 1R71A 5DDGA 3CP2A 4Y15A 3ZRGA 1LQ1A 4IQ4A 4OAYA 1ETOA 4N4NB 1DP3A 2A07F 3L2UA 1XGSA 2HGCA 3KP3A 2E1MC 2RAEA 1P9QC 3DF8A 3HBLA 1RETA 2HVQA 3CP8A 1SFEA 2Q8KA 1P4XA 3TO9A 2STTA 2DA1A 4IJAA 4BHPA 2E2JJ 2OTJI 1FBUA 1WJCA 2X1EA 2JVHA 2BW3B 4BS9A 3LQRA 3IWZA 1OMIA 4I98B 4UB6C 4Y33A 1WPKA 2AQFA 3OS2A 1DQUA 1BIAA 3ZPLA 2QM3A 2A68F 3GLXA 4ASNA 1SD5A 4RGXA 5C4XJ 1N78A 1FT9A 4B8XA 1X3UA 1KU9A 1JUMA 4DZJA 5FKOA 1H9GA 4I6ZA 4IPAA 1WJFA 4F92B 1FEXA 5J4VA 2FBKA 3PQJA 5HDKA 3FK6A 1K4TA 3FXQA 1WKMA 2JPCA 1RRJA 4KN4X 4S05A 2H94A 4IOAF 2BV6A 2E71A 2KL4A 4PJMA 5HVQC 2KKOA 4NDLA 3DCFA 4IHXA 3MD2A 4RS8A 2ZXJA 3BG7A 2WAFA 4II3A 1Y1VJ 2F4MB 1AKHB 2GIVA 2NVXJ 4L18B 5CQEA 4WWCA 3H5RA 5E1XA 2BY0A 1MSFC 4XONA 2FBHA 2EILH 2GA1A 1SAUA 2VLAA 4BGDA 3L2WA 1NG7A 3K4LA 1VQMI 4UB8C 3SEZA 5L3EA 4ZH4F 3F6VA 5BMZA 2X6WA 3GYHX 1GT0C 2OCCH 4EM0B 1EV7A 1X1CA 3U21A 4PSWA 2QEXI 3CCSI 4E70A 1HDDC 1NG6A 4A0XA 3QYBA 4XOPA 1QVUA 1X2NA 3HYIA 5DCMB 3CJTB 1S7EA 2FD5A 1YO5C 1DDNA 2RQPA 3BQYA 1DUXC 2ZCWA 2RQQA 2VODA 4YFKF 2XPUA 2V1UA 3OYFA 2XVCA 1BBYA 5HS9A 1GDTA 4BBRJ 3A0HC 2LNBA 1B1BA 2YX7A 4DGWB 1FOKA 1MJAA 2DK8A 2R7RA 1PVEA 3L2VA 4Y17A 3S3OA 4ZTJA 1ZG3A 2L3DA 3L1PA 1R6RA 2E1CA 3JRDA 4GYIA 1MDMA 1JJ6C 2BXYA 3HGYA 2CV1A 1FIAA 2DMPA 2M87A 3OSFA 2Z16A 4HDVA 2NAZA 3DWLE 5F6FA 2KQRA 4G94A 3WG9A 1R7JA 5DM7F 2XV4S 1XGOA 1JGGA 1S7AA 1RPWA 2VC1A 5TISC 4EV0A 1YX5A 3E3VA 2XPVA 1JTYA 4IZZA 2HOEA 3MKLA 2K4JA 3J81Z 1OJLA 5M5WJ 2ESNA 2B63J 2R5YA 2BY3A 4FETA 4NC7A 3TOAA 5BNGA 5K5OA 3QP6A 1VQLI 3DBHB 3RDIA 4HX7A 5E1WA 4PFOA 4I02A 2MA3A 3OIQA 2FMYA 2AS5F 2IS2A 1OPCA 2EBIA 3TO6A 1VQ6I 2ETHA 2M5WA 2R7UA 1EKEA 2BVLA 3C2BA 4GRIA 1BA5A 3VWBA 1G3SA 1UHSA 2L7ZA 2NS7A 2O3FA 5FB2A 1Z67A 1YS7A 3DBLB 2D2WA 2WV0A 3J7ZI 3KEQA 5M5XJ 1U5TB 3PO2J 1YTYA 2QSHX 2IGMA 3IRRA 3K70D 2DOFA 1SD6A 2R92J 2M9HA 5DTDA 1D1AA 4KMFA 3SYTA 2CG4A 1VFCA 2BZTA 1Z91A 1BN5A 2QKMB 3LMMA 1X1AA 4CCMA 3JTHA 2AO9A 4XLEA 2ID3A 2XAJA 1K4SA 4H0EA 3C3WA 2E2HJ 3ZMTA 5HODA 2M7AA 1VQ8I 1XGNA 3ZR8X 3FWEA 3F21A 1VQ9I 5DUKA 5JLWA 5IP6A 1B72A 3A01B 2NNYA 2DOEA 1BI1A 3FXRA 3HPHA 2L7FP 2XGEA 5L3BA 1ORKA 1FSEA 2JA8J 3K0LA 4RAFA 1OQYA 1SVMA 3AG4H 3B02A 3WTSC 2XROA 2ZJRF 4JK1X 3HOXJ 4A5NA 1ZRFA 3BR6A 1YQAA 1L0OC 2ZJ2A 3L9FA 4FQGA 5FJ8J 4MTEA 3VYRB 4D1QA 4AM3A 2K3FA 1MBKA 2QA4I 3WU2C 2R0QC 1IRFA 1JI8A 1X4PA 2V6CA 5FD5A 1U9OA 1TW3A 2XF6A 4KISA 3GMEA 1M1EB 2A69F 3F3XA 1D1CA 1G6NA 1KQ0A 1ETVA 4MQVA 3RSNA 3HRSA 3A2KA 1USTA 2Y31A 2QQ9A 4RA2A 3LSHA 2DYRH 2O8KA 4X0GA 3FISA 5IT9Z 2VKVA 5E18F 3N4MA 5IYDJ 3GFLA 2RC4A 1BR4A 2VC0A 1ZRCA 1I27A 1PDNC 1D8JA 5J1RA 2FF4A 1XMAA 3OL3A 2QGUA 1FYLA 4A3DJ 2I10A 3WE2A 5EEHA 4DYCA 2O7OA 1W7PD 1OYWA 2ZC2A 1TWFJ 3MAJA 2EIKH 4OOIA 3BLYA 3OYKA 2LLKA 2X6XA 3LAJA 4FTHA 2OF7A 3WODF 5K5QA 1B6AA 4RAYA 2R93J 1GXQA 3WG7H 2GXBA 2YU3A 4A3CJ 1VQ5I 1UMQA 2O03A 2WAEA 2X6YA 3CJRB 3KFWX 5FGMA 1I3AA 5LLQA 4IRIA 2VJJA 2P5KA 2M34A 3OWTA 1IW7F 3KLNA 2LFBA 4ZDOA 4O3MA 3ZMZA 4A3FJ 5D8LB 1LDKB 1O4XA 1ETKA 2QZ8A 3ZGKA 2GXAA 3HTSB 1GLNA 1U3EM 2B7EA 2XGDA 4RB1A 1T98A 2CQKA 3BZ6A 4G7ZF 1FSHA 1LE8A 5J47A 3TW7A 1ETYA 4A3EJ 3RQ4A 3DTIA 2XKPA 4FE4A 2E2IJ 1QHGA 1K61A 3HM5A 5ILVA 1WJ5A 4F91B 1WGXA 5KK1A 4RM2A 1UAAA 2P4WA 5CLSA 1W5CC 2FOKA 1RKTA 4E7LA 4G6QA 1WRJA 2FQ3A 1IRXA 4YRVA 1GHCA 3OV8A 3KYDB 1LUJB 3JRFA 3KCCA 3QOPA 3T1BA 4ZYGA 1TQIA 2JSCA 3IRQA 3L2CA 2BW3A 1I1GA 3V7SA 5HLHA 4YIFA 1ITYA 1D0YA 3WTZA 1IN4A 1YIOA 3F6OA 1WJAA 2STWA 2YU9J 4O5VA 4Y52J 3HUGB 1D0ZA 1YW8A 3BJOA
chains in the Genus database with same CATH topology
2HFHA 2PQ8A 1UHWA 5AONA 1JHHA 4FX4A 1ZLJA 2XAHA 3R0JA 5E17F 2BBYA 4MQ9F 1XDUA 2BGCA 1HSJA 4KFCA 1G3YA 2HTSA 2XAQA 1O3QA 4I0AA 5JI6A 3AAFA 3WTTC 1U5TC 1LNWA 1OKRA 1KYWA 5KVRA 4RGSA 5L3DA 3MQ0A 2CWEA 3SXYA 1T39A 1LEBA 5F64A 1HXDA 1XGMA 1YYVA 3QU6A 4RB3C 5DCMA 4P55A 3C1DA 2F5CA 3M9AA 4BAYA 1J5YA 3MZHA 1Q1HA 4ZYHA 3BPXA 3MWMA 4BXUA 1WQ2A 5H6RA 2DO7A 1S6LA 3COAC 4MGRA 1RIOH 2BEOA 3GWZA 4PZJA 1FC3A 2AXLA 4A2UA 4U0WA 4L9NA 3TDUC 2V79A 2PBIA 4YFNF 2FXAA 3R0AA 3RKYA 3L7WA 1ZN2A 2Z9OA 3JSOA 3BOQA 5J8FA 3SFZA 1HKSA 2PMHA 3KZZA 4ENNA 1EH8A 1YFHA 3V4GA 4Z2YA 2PJPA 3FF5A 5FFZA 1TNTA 5EEGA 5E1ZB 3BPVA 3WE3A 2R7DA 1YW9A 1S3JA 3VODA 2FNAA 1SD4A 3PFIA 4CYDA 5BOXA 1XSVA 4PDKA 3O6BB 4OIPF 4GCVA 3F8BA 3GFMA 4WXDA 4K2EA 4PGHA 3SZPA 3EUHA 1TQPA 1W5SA 1GVJA 4S04A 5ED4A 2HR3A 1JE8A 1R23A 3ZMSA 3LWFA 1LDJA 1USSA 2OQGA 1ONVA 4HQEA 1FYKA 2JT1A 2BYVE 4OMYA 1JGSA 5H6QA 3KZYA 4M72A 3RPQA 2P6SA 1JXSA 1RUNA 3CLOA 2EV0A 4FT8A 3U2RA 1G3TA 3HRMA 4UUVA 4IVNA 4ZYDA 2VBYA 4BYYA 3BJ6A 1R00A 2MLGA 1VTNC 1Z7UA 2DTRA 1IN5A 3KP2A 4WXHA 4F7ZA 4LMYA 2XGXA 4KIFA 3RIRA 2QYOA 2VXZA 2G9WA 3WGIA 4L0YB 1MD0A 1I5ZA 1OYYA 4I7HA 1SMTA 3FZVA 4M74A 3I5UA 1U2WA 3F8MA 4GYGA 1FPQA 2W24A 2RDPA 3V7CA 2CGPA 2UXNA 2TDXA 1KQ8A 1E2XA 1ZARA 4KA4A 1U8RA 2E7XA 5CVUA 3J81K 2B0LA 1LDDA 3ML6A 1AOYA 3RJPA 2H27A 4UXNA 2MBFA 2C6YA 2DFIA 2JRTA 2LF8A 2KJBA 1ZYRF 4AIHA 4HBLA 2MH9A 4RGUA 3EETA 4MHGA 3N97A 3DEUA 1XD7A 1MKMA 4P96A 1SFUA 3HUGA 3I64A 2A3SA 1ZG1A 3M7GA 3FX3A 1DPUA 1QO0D 3E6MA 1HKQA 4GGGA 2Y48A 2ISZA 3G73A 5TJJA 1J59A 2EFPA 4ETSA 4NHJA 2O8XA 2Z3YA 1Z6RA 3KETA 3H92A 1XN7A 3RPUA 5DUIA 5ICEA 2XAFA 4A0ZA 1A04A 2ACJA 4Q48A 1KYZA 1ZH5A 1FBQA 3ZMUA 2D45A 2ADUA 1BC8C 3K1MA 4I0BA 3FMRA 2NS0A 3G3ZA 5JVTA 1BI2A 3ZMDA 5ILUA 2P8TA 3BROA 4LG0B 3RYRA 3ISPA 5IT9K 2Q2EA 5F1RA 5HLGA 3CO6C 3EYIA 4LB5A 2VT3A 5DYMA 5HDNA 4MNUA 2EB7A 4IXAA 3WTYC 2OAZA 4ENMA 2P7CB 1FNNA 1ZRDA 1FP1D 5L3GA 1R1UA 4M73A 2K02A 4M6YA 2COMA 2EJRA 3WU1B 1IUYA 1FYMA 1D5VA 2GZWA 3Q5FA 2KIFA 1MGTA 4L5JA 3F72A 1F5TA 3RYPA 1TQMA 2F5DA 4JBAA 2IW5A 5IT3A 3E6CC 3E97A 2XASA 1R1VA 5ICGA 4WF2A 1JHFA 3I4PA 4LK0F 5LGTA 4BHBA 3J80K 2H6CA 2YPRA 1ON1A 3H3ZA 4EGYA 2MC3A 3HTUA 5DCFA 2EFNA 2DK5A 2XUBA 4HF1A 3GW2A 2GQQA 1Z9CA 3ULQB 4Q47A 3MCZA 3NQOA 4KMUX 4RB2C 1YW7A 1FWZA 2P6TA 2X0LA 3H3UA 5HLIA 2L54A 2H09A 5ERIA 1IF1A 3DP7A 4KYWA 2P7VB 2L4AA 1ON2A 3SZTA 4LJZF 1O7FA 1TW2A 4A6EA 2O61A 1T2KA 5HOOA 4YG2F 5FLXK 2W25A 2HQNA 2EV6A 3L00A 4AWXB 3R60A 2OQRA 1Z05A 4GO1A 3ZP5A 4I01A 1QBJA 1WSUA 3L09A 4EQQA 2YX4A 4HAMA 4EM2A 4FX0A 1SMYF 3BWGA 3O3KA 3W6KB 3RKXA 1J75A 3VB2A 3IHUA 3DPLC 2K86A 2UZKA 4WXCA 1G3WA 1XCVA 2W57A 1LJ9A 3P7NA 5JHUA 5H20A 3LAPA 3F22A 3GX4X 2VE8A 1UFMA 3HHHA 2VBXA 1HW1A 3QAHA 1F9NA 1Y0UA 2HS5A 4IRHA 3KP6A 3J80Z 1B9MA 2J5OA 4ESBA 4B09A 2V1DA 2HQRA 4OINF 1R22A 3BJAA 2IVMA 1UB9A 1KA8A 2PG4A 4ZZLA 5DD8A 3ZMVA 2XHKA 2HKXA 3NRVA 3I59A 2IT0A 2IRFG 3LA2A 5D6EA 2Y0MA 4R1HA 5ICCA 2OZ6A 3E5XA 4LG0A 4Y13A 4EVIA 4MEXF 4DQ2A 1R58A 2HTJA 2K27A 3LA7A 3WTVC 4HLXA 4FHTA 3I71A 2HYGD 4BQAA 3M8EA 1BOAA 4HLYA 5D4SA 3WTXC 1ULYA 3LSTA 5BQTA 3T8TA 1BI3A 1ZG5A 4EJTA 1WI9A 1ZHFA 3KEOA 1UHMA 3RI4A 5FLXZ 4G8XA 3JSPA 2WC2A 5LHHA 2D1VA 3P9KA 4KUMA 2XRNA 4HYEA 2XKOA 5FFXA 3LQQA 4M9XA 3D0SA 4KICA 3F8FA 5DD4A 4ON0A 4HF2A 4CDGA 1IXSB 2PFBA 1HW2A 1W4MA 4UV9A 4IRGA 3CDHA 2P5VA 4A0YA 4G9YA 5D8KB 3R4KA 4Q5SF 2EWNA 4EGZA 3TQNA 3U1DA 1XSXA 2Y75A 4HDUA 2HWVA 2PEXA 3FHZA 1Z6TA 2WTEA 3KP7A 4KT5C 2YR2A 3IC7A 3T5XA 2KIUA 1HSTA 2QVOA 3IKTA 1EH6A 1PP7U 3MEXA 1MJ9A 2M8EA 2MD5A 3O2PE 1H9TA 4JQFA 3KE2A 4AD9A 2QQAA 1NHAA 2LF7A 2ZMEA 1O7LA 5DEQA 1UCRA 3TGNA 4QWQA 3W6JB 3E5UA 1H0MA 4XBFA 3ABTA 3DV8A 1TTYA 2ESHA 4EM1A 2ZKZA 4YFXF 4EJOA 1Z1DA 2RGVA 2OU2A 1QGPA 1BM9A 2X4HA 4XRFA 1S29A 1ZAOA 4L0ZB 3OOPA 2NYXA 1TLHB 3CUQB 3JTGA 4QLCU 4OIOF 5E8IA 2IA0A 2R3SA 1K7AA 2F5EA 3HIFA 5HS7A 1J9IA 3HSRA 3WGGA 1BJAA 2FSWA 1KGSA 1IN7A 2O0YA 3WGHA 1T0FA 1YS6A 1YLFA 3LA3A 3DXJF 2P5LC 4I2OA 1K78B 2OZUA 4U7DA 1O57A 5BPIA 3Q9SA 4LGWA 4D0PA 5BS6A 2VBWA 1QZYA 5D4RA 2VBZA 5LRRA 4LLLA 2KRFA 2FEZA 3LFKA 2W85A 2L4MA 2PN6A 2M30A 4ESJA 5K5RA 2FA5A 1PUEE 4LD5A 1B9NA 3R6SA 2L02A 3GUDA 4O6JA 5TRDA 1LVAA 4EJWA 2IA1A 2YSRA 3I58A 1HKTA 3K2ZA 3E5QA 2CO5A 4YIIA 3I54A 5AIQA 5BPDA 1T38A 5E8GA 5JR3A 3BDDA 4OIQF 1G4DA 4BNCA 3GFJA 2M45A 3JW4A 1LB2A 1MZBA 3RKWA 2E1NA 5LHGA 1V4RA 3QU3A 4U7BA 3I59B 4UV8A 2VOPA 1P4AA 2J5PA 2MLKA 4TV7A 3Q9VA 1ZGJA 1K79A 5JFRA 1DPRA 5CVIA 1AWCA 1U6GA 1TNSA 3VOEA 1FY7A 3C18A 1CF7B 5ICFA 3TKYA 1ZLKA 4L9JA 3V8JA 3WTUC 2PLYA 2PI0A 1ZREA 2W84A 3F8NA 4M9ZA 3FM5A 2QBYB 4WX9A 6PAXA 4GXOA 2NNNA 1REPC 3DQVC 4L5IA 2DPUA 5L3FA 4PGGA 3VEPA 2R7FA 1W5TA 4DNCA 2PMUA 3KP4A 1SD7A 5CYVA 4OIRF 1B59A 3SHFA 3B73A 3CUQC 3IWFA 5AIPA 2LSOA 3CJNA 2F2EA 2DW4A 3GZ6A 2V1XA 3EQLF 2DQLA 4NQWA 2EK5A 1R36A 3T8RA 4G7OF 4HF0A 2IP2A 3P9CA 5HDGA 2Z5UA 2GWRA 2EA2A 3T0YA 4OMZA 2F5FA 2A6EF 2FU4A 4M9SA 2VONA 2ZO4A 1QNTA 2XAGA 3DPTA 2RNJA 4CO8A 4A12A 5J6XA 2Q0OA 3HOSA 4CHUA 2EFWA 3SQNA 4N9IA 2A6HF 2ZMEB 1IXCA 3J7AO 1QPMA 2FRHA 3ECOA 4NB5A 4UVCA 3IKVA 1J7KA 4A6DA 1R1TA 1BC7C 1DP7P 3FXUA 1O3SA 1RUOA 1P2FA 2ZNZA 3ROUA 2A61A 2JZYA 2H6BA 1XDSA 4RB0A 2RVCA 2VN2A 5CVVA 1O3RA 2UXXA 3TOBA 4LLGF 3CUQA 4OU0A 3WTWC 2HEOA 3EDPA 3F23A 2QWWA 1IZ1A 1F1ZA 5DV5A 2JTVA 4XLPF 2HDCA 2QUFA 4UHTA 5L3CA 5FO5A 3QP5A 1STZA 3PQKA 1XCBA 4HA8A 1SAXA 4M71A 1P6RA 2LKPA 4HX8A 2QLZA 1K78A 4ENKA 4ESFA 2VE9A 1W7PB 1QQIA 3V8LA 3NEUA 4LLNA 3HHGA 3CUOA 3I0TA 4MTDA 4CGZA 1BIBA 2QQBA 3ELKA 2IJLA 1IRGA 5D5WB 1GXPA 4CZZA 1ODDA 4A5MA 1XSDA 1KU2A 1YG2A 3BP8A 3V7RA 4N9HA 4KIBA 1L3LA 3MZYA 2K7LA 3V8KA 2DT5A 4G7HF 2D1HA 1FBSA 1S7OA 2G7HA 2EV5A 4ENJA 3M8FA 4XSXF 4AIKA 4WCGA 4L9VA 3QRFF 2DBBA 2A5YB 5CVJA 2ISYA 1SFXA 2E7WA 5LGNA 4I09A 5LHIA 3ABUA 1P4WA 2O6GE 2DU9A 3QPHA 1KU7A 1KQ9A 2DLLA 4KDPA 3GEZA 2CYYA 1LEAA 2OA4A 5K1YA 2QENA 2XIGA 1FP2A 3CTAA 3E6DA 5CJ9A 4XSZF 5D5UB 3CO7C 2OD5A 3GO5A 3JAMK 3GXOA 3QPTA 1XB4A 2IPQX 3TDZC 4P5OA 1CF7A 4Q4ZF 4IF4A 2RKHA 3FM3A 2DAOA 1D3YA 3P9IA 4HW0A 2GAUA 2HZTA 1HQCA 4N0BA 4HV6A 2UWMA 1MJBA 4P9FA 5A2QK 2QBYA 3HRUA 1HW5A 1FX7A 4EMSA 2GXGA 3ECHA 4ZYEA 1R5GA 1CGPA 4KN7X 1T6SA 1S8NA 3F8CA 4AIJA 3REOA 3WU0A 4BH9A 2VOOA 4UVBA 1WWXA 2G7UA 5D5VB 2BE5F 2CFXA 3C7JA 3FMSA 3RTRA 5LBQA 3VFZA 2EFQA 4EJVA 2FE3A 1MDMB 3TO7A 3KP5A 3HSFA 3M1EA 3HOTA 1I6XA 2EA4A 5J8CA 2K4BA 2ELHA 1IN8A 1HBXG 2LDUA 3GVAA 2IA2A 1J2XA 4CXFA 2DPDA 1O3TA 4RGRA 3R61A 1B4AA 4WK8F 3ZN1A 4HV5A 1OR7A 3S2WA 2Z99A 3D5LA 4R8HA 4RAZA 2KJCA 5E20A 2GA2A 1U5TA 2Z33A 2EFOA 1I1SA 4PCQA 5CVRA 3GF2A 4KIGA 4LB6B 1PP8F 5LRSA 1ZGAA 4KNYA 5D6FA 2FMLA 3DKWA 4U0VA 4U88A 1BI0A 3I53A 2JPBA 2VT2A 4HOBA 4M6XA 5ILSA 3ERED 3E6BA 3K9TA 5FD6A 3GFIA 2L01A 1D8KA 5HS8A 2CSOA 1TBXA 4HQMA 3K1NA 4HZFA 1P92A 1QZZA 3K1PA 3JAMZ 2CW0F 4XLNF 2MH2A 1RNLA 4IHTA 3FMQA 1IN6A 3DFGA 3KLOA 4L9TA 2HYFA 5D5XB 1C0WA 1E17A 2HKOA 1U78A 1OYIA 4UNOA 5A2QZ 1IAWA 2FNPA 4CICA 2DI3A 4R79A 1W7PA 1RI7A 4MEYF 1KU3A 4HX4A 3HRTA 4EJUA 3GZ5A 2WWYA 3EYYA 1IXRC 2RN7A 4LFUA 4BHCA 1R5HA 2V9VA 1XMKA 2KIMA 2ZNYA 5LEKA 1FLIA 2OBPA 4IHSA 2ZFWA 2ZBKA 4U0YA 1F4KA 1V3FA 2NRAC 4P9UA 5LEJA 2M1BA 2DQRA 3HSEA 1K6OA 1RZ4A 2RV8A 1J0RA 4G6DA 4AVPA 4ZZDA 1EH7A 3K69A 3IL2A 5LGUA 2FBIA 4UVAA 4LK1F 3ZQ7A 3ZN0A 3MFKA 3BY6A 1FZPB 5DDGA 4Y15A 1LQ1A 2A07F 1XGSA 2HGCA 3KP3A 3DF8A 2Q8KA 1SFEA 1P4XA 3TO9A 2STTA 4IJAA 4BHPA 1FBUA 3LQRA 3IWZA 1OMIA 4I98B 1BIAA 3ZPLA 2QM3A 2A68F 3GLXA 4ASNA 1SD5A 4RGXA 1YW8A 1FT9A 4B8XA 1X3UA 1KU9A 1H9GA 4IPAA 2FBKA 3PQJA 5HDKA 3FXQA 1WKMA 2JPCA 4KN4X 4S05A 2H94A 2BV6A 5HVQC 2KKOA 4RS8A 2ZXJA 4L18B 2GIVA 4WWCA 5E1XA 2FBHA 2GA1A 5L3EA 4ZH4F 3F6VA 5BMZA 3GYHX 4EM0B 1EV7A 4E70A 4A0XA 3HYIA 5DCMB 1YO5C 1DDNA 2RQPA 1DUXC 2ZCWA 2VODA 4YFKF 2V1UA 2XVCA 1BBYA 5HS9A 2LNBA 1B1BA 2YX7A 1FOKA 1MJAA 2DK8A 4Y17A 1ZG3A 2L3DA 2E1CA 4GYIA 1MDMA 2M87A 4HDVA 2NAZA 5F6FA 4G94A 3WG9A 1R7JA 2XV4S 1XGOA 1S7AA 2VC1A 4EV0A 3E3VA 2HOEA 2K4JA 3J81Z 2ESNA 3TOAA 5K5OA 3QP6A 3RDIA 4HX7A 5E1WA 4I02A 2MA3A 2FMYA 2AS5F 1OPCA 3TO6A 2ETHA 2M5WA 1G3SA 2O3FA 5FB2A 1YS7A 2D2WA 2WV0A 3KEQA 1U5TB 1YTYA 3IRRA 1SD6A 4KMFA 2CG4A 1Z91A 1BN5A 3JTHA 2XAJA 4H0EA 3C3WA 3ZMTA 1XGNA 3FWEA 3F21A 5DUKA 2NNYA 1BI1A 3FXRA 5L3BA 1FSEA 3K0LA 3WTSC 2XROA 3B02A 4JK1X 4A5NA 1ZRFA 1YQAA 1L0OC 2ZJ2A 3L9FA 4MTEA 1IRFA 2V6CA 5FD5A 1TW3A 2A69F 3F3XA 1G6NA 1KQ0A 4MQVA 3HRSA 1USTA 2QQ9A 5IT9Z 5E18F 3N4MA 3GFLA 2RC4A 2VC0A 1ZRCA 1D8JA 1I27A 1PDNC 2FF4A 1XMAA 1FYLA 3WE2A 5EEHA 1W7PD 1OYWA 3MAJA 4OOIA 3LAJA 3WODF 5K5QA 1B6AA 4RAYA 1GXQA 2GXBA 2YU3A 2O03A 5FGMA 3KFWX 5LLQA 4IRIA 2P5KA 1IW7F 3KLNA 4O3MA 3ZMZA 5D8LB 1LDKB 2QZ8A 3HTSB 1U3EM 4RB1A 1T98A 2CQKA 3BZ6A 4G7ZF 1FSHA 2XKPA 5ILVA 5KK1A 2P4WA 5CLSA 2FOKA 4G6QA 1WRJA 2FQ3A 1GHCA 3OV8A 3KCCA 3QOPA 3T1BA 4ZYGA 1TQIA 2JSCA 3IRQA 3L2CA 1I1GA 3V7SA 5HLHA 4YIFA 3WTZA 1IN4A 1YIOA 3F6OA 2STWA 4O5VA 3U9GA 3BJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HFH A;  2PQ8 A;  1UHW A;  5AON A;  1JHH A;  4FX4 A;  1ZLJ A;  2XAH A;  3R0J A;  5E17 F;  2BBY A;  4MQ9 F;  1XDU A;  2BGC A;  1HSJ A;  4KFC A;  1G3Y A;  2HTS A;  2XAQ A;  1O3Q A;  4I0A A;  5JI6 A;  3AAF A;  3WTT C;  1U5T C;  1LNW A;  1OKR A;  1KYW A;  5KVR A;  4RGS A;  5L3D A;  3MQ0 A;  2CWE A;  3SXY A;  1T39 A;  1LEB A;  5F64 A;  1HXD A;  1XGM A;  1YYV A;  3QU6 A;  4RB3 C;  5DCM A;  4P55 A;  3C1D A;  2F5C A;  3M9A A;  4BAY A;  1J5Y A;  3MZH A;  1Q1H A;  4ZYH A;  3BPX A;  3MWM A;  4BXU A;  1WQ2 A;  5H6R A;  2DO7 A;  1S6L A;  3COA C;  4MGR A;  1RIO H;  2BEO A;  3GWZ A;  4PZJ A;  1FC3 A;  2AXL A;  4A2U A;  4U0W A;  4L9N A;  3TDU C;  2V79 A;  2PBI A;  4YFN F;  2FXA A;  3R0A A;  3RKY A;  3L7W A;  1ZN2 A;  2Z9O A;  3JSO A;  3BOQ A;  5J8F A;  3SFZ A;  1HKS A;  2PMH A;  3KZZ A;  4ENN A;  1EH8 A;  1YFH A;  3V4G A;  4Z2Y A;  2PJP A;  3FF5 A;  5FFZ A;  1TNT A;  5EEG A;  5E1Z B;  3BPV A;  3WE3 A;  2R7D A;  1YW9 A;  1S3J A;  3VOD A;  2FNA A;  1SD4 A;  3PFI A;  4CYD A;  5BOX A;  1XSV A;  4PDK A;  3O6B B;  4OIP F;  4GCV A;  3F8B A;  3GFM A;  4WXD A;  4K2E A;  4PGH A;  3SZP A;  3EUH A;  1TQP A;  1W5S A;  1GVJ A;  4S04 A;  5ED4 A;  2HR3 A;  1JE8 A;  1R23 A;  3ZMS A;  3LWF A;  1LDJ A;  1USS A;  2OQG A;  1ONV A;  4HQE A;  1FYK A;  2JT1 A;  2BYV E;  4OMY A;  1JGS A;  5H6Q A;  3KZY A;  4M72 A;  3RPQ A;  2P6S A;  1JXS A;  1RUN A;  3CLO A;  2EV0 A;  4FT8 A;  3U2R A;  1G3T A;  3HRM A;  4UUV A;  4IVN A;  4ZYD A;  2VBY A;  4BYY A;  3BJ6 A;  1R00 A;  2MLG A;  1VTN C;  1Z7U A;  2DTR A;  1IN5 A;  3KP2 A;  4WXH A;  4F7Z A;  4LMY A;  2XGX A;  4KIF A;  3RIR A;  2QYO A;  2VXZ A;  2G9W A;  3WGI A;  4L0Y B;  1MD0 A;  1I5Z A;  1OYY A;  4I7H A;  1SMT A;  3FZV A;  4M74 A;  3I5U A;  1U2W A;  3F8M A;  4GYG A;  1FPQ A;  2W24 A;  2RDP A;  3V7C A;  2CGP A;  2UXN A;  2TDX A;  1KQ8 A;  1E2X A;  1ZAR A;  4KA4 A;  1U8R A;  2E7X A;  5CVU A;  3J81 K;  2B0L A;  1LDD A;  3ML6 A;  1AOY A;  3RJP A;  2H27 A;  4UXN A;  2MBF A;  2C6Y A;  2DFI A;  2JRT A;  2LF8 A;  2KJB A;  1ZYR F;  4AIH A;  4HBL A;  2MH9 A;  4RGU A;  3EET A;  4MHG A;  3N97 A;  3DEU A;  1XD7 A;  1MKM A;  4P96 A;  1SFU A;  3HUG A;  3I64 A;  2A3S A;  1ZG1 A;  3M7G A;  3FX3 A;  1DPU A;  1QO0 D;  3E6M A;  1HKQ A;  4GGG A;  2Y48 A;  2ISZ A;  3G73 A;  5TJJ A;  1J59 A;  2EFP A;  4ETS A;  4NHJ A;  2O8X A;  2Z3Y A;  1Z6R A;  3KET A;  3H92 A;  1XN7 A;  3RPU A;  5DUI A;  5ICE A;  2XAF A;  4A0Z A;  1A04 A;  2ACJ A;  4Q48 A;  1KYZ A;  1ZH5 A;  1FBQ A;  3ZMU A;  2D45 A;  2ADU A;  1BC8 C;  3K1M A;  4I0B A;  3FMR A;  2NS0 A;  3G3Z A;  5JVT A;  1BI2 A;  3ZMD A;  5ILU A;  2P8T A;  3BRO A;  4LG0 B;  3RYR A;  3ISP A;  5IT9 K;  2Q2E A;  5F1R A;  5HLG A;  3CO6 C;  3EYI A;  4LB5 A;  2VT3 A;  5DYM A;  5HDN A;  4MNU A;  2EB7 A;  4IXA A;  3WTY C;  2OAZ A;  4ENM A;  2P7C B;  1FNN A;  1ZRD A;  1FP1 D;  5L3G A;  1R1U A;  4M73 A;  2K02 A;  4M6Y A;  2COM A;  2EJR A;  3WU1 B;  1IUY A;  1FYM A;  1D5V A;  2GZW A;  3Q5F A;  2KIF A;  1MGT A;  4L5J A;  3F72 A;  1F5T A;  3RYP A;  1TQM A;  2F5D A;  4JBA A;  2IW5 A;  5IT3 A;  3E6C C;  3E97 A;  2XAS A;  1R1V A;  5ICG A;  4WF2 A;  1JHF A;  3I4P A;  4LK0 F;  5LGT A;  4BHB A;  3J80 K;  2H6C A;  2YPR A;  1ON1 A;  3H3Z A;  4EGY A;  2MC3 A;  3HTU A;  5DCF A;  2EFN A;  2DK5 A;  2XUB A;  4HF1 A;  3GW2 A;  2GQQ A;  1Z9C A;  3ULQ B;  4Q47 A;  3MCZ A;  3NQO A;  4KMU X;  4RB2 C;  1YW7 A;  1FWZ A;  2P6T A;  2X0L A;  3H3U A;  5HLI A;  2L54 A;  2H09 A;  5ERI A;  1IF1 A;  3DP7 A;  4KYW A;  2P7V B;  2L4A A;  1ON2 A;  3SZT A;  4LJZ F;  1O7F A;  1TW2 A;  4A6E A;  2O61 A;  1T2K A;  5HOO A;  4YG2 F;  5FLX K;  2W25 A;  2HQN A;  2EV6 A;  3L00 A;  4AWX B;  3R60 A;  2OQR A;  1Z05 A;  4GO1 A;  3ZP5 A;  4I01 A;  1QBJ A;  1WSU A;  3L09 A;  4EQQ A;  2YX4 A;  4HAM A;  4EM2 A;  4FX0 A;  1SMY F;  3BWG A;  3O3K A;  3W6K B;  3RKX A;  1J75 A;  3VB2 A;  3IHU A;  3DPL C;  2K86 A;  2UZK A;  4WXC A;  1G3W A;  1XCV A;  2W57 A;  1LJ9 A;  3P7N A;  5JHU A;  5H20 A;  3LAP A;  3F22 A;  3GX4 X;  2VE8 A;  1UFM A;  3HHH A;  2VBX A;  1HW1 A;  3QAH A;  1F9N A;  1Y0U A;  2HS5 A;  4IRH A;  3KP6 A;  3J80 Z;  1B9M A;  2J5O A;  4ESB A;  4B09 A;  2V1D A;  2HQR A;  4OIN F;  1R22 A;  3BJA A;  2IVM A;  1UB9 A;  1KA8 A;  2PG4 A;  4ZZL A;  5DD8 A;  3ZMV A;  2XHK A;  2HKX A;  3NRV A;  3I59 A;  2IT0 A;  2IRF G;  3LA2 A;  5D6E A;  2Y0M A;  4R1H A;  5ICC A;  2OZ6 A;  3E5X A;  4LG0 A;  4Y13 A;  4EVI A;  4MEX F;  4DQ2 A;  1R58 A;  2HTJ A;  2K27 A;  3LA7 A;  3WTV C;  4HLX A;  4FHT A;  3I71 A;  2HYG D;  4BQA A;  3M8E A;  1BOA A;  4HLY A;  5D4S A;  3WTX C;  1ULY A;  3LST A;  5BQT A;  3T8T A;  1BI3 A;  1ZG5 A;  4EJT A;  1WI9 A;  1ZHF A;  3KEO A;  1UHM A;  3RI4 A;  5FLX Z;  4G8X A;  3JSP A;  2WC2 A;  5LHH A;  2D1V A;  3P9K A;  4KUM A;  2XRN A;  4HYE A;  2XKO A;  5FFX A;  3LQQ A;  4M9X A;  3D0S A;  4KIC A;  3F8F A;  5DD4 A;  4ON0 A;  4HF2 A;  4CDG A;  1IXS B;  2PFB A;  1HW2 A;  1W4M A;  4UV9 A;  4IRG A;  3CDH A;  2P5V A;  4A0Y A;  4G9Y A;  5D8K B;  3R4K A;  4Q5S F;  2EWN A;  4EGZ A;  3TQN A;  3U1D A;  1XSX A;  2Y75 A;  4HDU A;  2HWV A;  2PEX A;  3FHZ A;  1Z6T A;  2WTE A;  3KP7 A;  4KT5 C;  2YR2 A;  3IC7 A;  3T5X A;  2KIU A;  1HST A;  2QVO A;  3IKT A;  1EH6 A;  1PP7 U;  3MEX A;  1MJ9 A;  2M8E A;  2MD5 A;  3O2P E;  1H9T A;  4JQF A;  3KE2 A;  4AD9 A;  2QQA A;  1NHA A;  2LF7 A;  2ZME A;  1O7L A;  5DEQ A;  1UCR A;  3TGN A;  4QWQ A;  3W6J B;  3E5U A;  1H0M A;  4XBF A;  3ABT A;  3DV8 A;  1TTY A;  2ESH A;  4EM1 A;  2ZKZ A;  4YFX F;  4EJO A;  1Z1D A;  2RGV A;  2OU2 A;  1QGP A;  1BM9 A;  2X4H A;  4XRF A;  1S29 A;  1ZAO A;  4L0Z B;  3OOP A;  2NYX A;  1TLH B;  3CUQ B;  3JTG A;  4QLC U;  4OIO F;  5E8I A;  2IA0 A;  2R3S A;  1K7A A;  2F5E A;  3HIF A;  5HS7 A;  1J9I A;  3HSR A;  3WGG A;  1BJA A;  2FSW A;  1KGS A;  1IN7 A;  2O0Y A;  3WGH A;  1T0F A;  1YS6 A;  1YLF A;  3LA3 A;  3DXJ F;  2P5L C;  4I2O A;  1K78 B;  2OZU A;  4U7D A;  1O57 A;  5BPI A;  3Q9S A;  4LGW A;  4D0P A;  5BS6 A;  2VBW A;  1QZY A;  5D4R A;  2VBZ A;  5LRR A;  4LLL A;  2KRF A;  2FEZ A;  3LFK A;  2W85 A;  2L4M A;  2PN6 A;  2M30 A;  4ESJ A;  5K5R A;  2FA5 A;  1PUE E;  4LD5 A;  1B9N A;  3R6S A;  2L02 A;  3GUD A;  4O6J A;  5TRD A;  1LVA A;  4EJW A;  2IA1 A;  2YSR A;  3I58 A;  1HKT A;  3K2Z A;  3E5Q A;  2CO5 A;  4YII A;  3I54 A;  5AIQ A;  5BPD A;  1T38 A;  5E8G A;  5JR3 A;  3BDD A;  4OIQ F;  1G4D A;  4BNC A;  3GFJ A;  2M45 A;  3JW4 A;  1LB2 A;  1MZB A;  3RKW A;  2E1N A;  5LHG A;  1V4R A;  3QU3 A;  4U7B A;  3I59 B;  4UV8 A;  2VOP A;  1P4A A;  2J5P A;  2MLK A;  4TV7 A;  3Q9V A;  1ZGJ A;  1K79 A;  5JFR A;  1DPR A;  5CVI A;  1AWC A;  1U6G A;  1TNS A;  3VOE A;  1FY7 A;  3C18 A;  1CF7 B;  5ICF A;  3TKY A;  1ZLK A;  4L9J A;  3V8J A;  3WTU C;  2PLY A;  2PI0 A;  1ZRE A;  2W84 A;  3F8N A;  4M9Z A;  3FM5 A;  2QBY B;  4WX9 A;  6PAX A;  4GXO A;  2NNN A;  1REP C;  3DQV C;  4L5I A;  2DPU A;  5L3F A;  4PGG A;  3VEP A;  2R7F A;  1W5T A;  4DNC A;  2PMU A;  3KP4 A;  1SD7 A;  5CYV A;  4OIR F;  1B59 A;  3SHF A;  3B73 A;  3CUQ C;  3IWF A;  5AIP A;  2LSO A;  3CJN A;  2F2E A;  2DW4 A;  3GZ6 A;  2V1X A;  3EQL F;  2DQL A;  4NQW A;  2EK5 A;  1R36 A;  3T8R A;  4G7O F;  4HF0 A;  2IP2 A;  3P9C A;  5HDG A;  2Z5U A;  2GWR A;  2EA2 A;  3T0Y A;  4OMZ A;  2F5F A;  2A6E F;  2FU4 A;  4M9S A;  2VON A;  2ZO4 A;  1QNT A;  2XAG A;  3DPT A;  2RNJ A;  4CO8 A;  4A12 A;  5J6X A;  2Q0O A;  3HOS A;  4CHU A;  2EFW A;  3SQN A;  4N9I A;  2A6H F;  2ZME B;  1IXC A;  3J7A O;  1QPM A;  2FRH A;  3ECO A;  4NB5 A;  4UVC A;  3IKV A;  1J7K A;  4A6D A;  1R1T A;  1BC7 C;  1DP7 P;  3FXU A;  1O3S A;  1RUO A;  1P2F A;  2ZNZ A;  3ROU A;  2A61 A;  2JZY A;  2H6B A;  1XDS A;  4RB0 A;  2RVC A;  2VN2 A;  5CVV A;  1O3R A;  2UXX A;  3TOB A;  4LLG F;  3CUQ A;  4OU0 A;  3WTW C;  2HEO A;  3EDP A;  3F23 A;  2QWW A;  1IZ1 A;  1F1Z A;  5DV5 A;  2JTV A;  4XLP F;  2HDC A;  2QUF A;  4UHT A;  5L3C A;  5FO5 A;  3QP5 A;  1STZ A;  3PQK A;  1XCB A;  4HA8 A;  1SAX A;  4M71 A;  1P6R A;  2LKP A;  4HX8 A;  2QLZ A;  1K78 A;  4ENK A;  4ESF A;  2VE9 A;  1W7P B;  1QQI A;  3V8L A;  3NEU A;  4LLN A;  3HHG A;  3CUO A;  3I0T A;  4MTD A;  4CGZ A;  1BIB A;  2QQB A;  3ELK A;  2IJL A;  1IRG A;  5D5W B;  1GXP A;  4CZZ A;  1ODD A;  4A5M A;  1XSD A;  1KU2 A;  1YG2 A;  3BP8 A;  3V7R A;  4N9H A;  4KIB A;  1L3L A;  3MZY A;  2K7L A;  3V8K A;  2DT5 A;  4G7H F;  2D1H A;  1FBS A;  1S7O A;  2G7H A;  2EV5 A;  4ENJ A;  3M8F A;  4XSX F;  4AIK A;  4WCG A;  4L9V A;  3QRF F;  2DBB A;  2A5Y B;  5CVJ A;  2ISY A;  1SFX A;  2E7W A;  5LGN A;  4I09 A;  5LHI A;  3ABU A;  1P4W A;  2O6G E;  2DU9 A;  3QPH A;  1KU7 A;  1KQ9 A;  2DLL A;  4KDP A;  3GEZ A;  2CYY A;  1LEA A;  2OA4 A;  5K1Y A;  2QEN A;  2XIG A;  1FP2 A;  3CTA A;  3E6D A;  5CJ9 A;  4XSZ F;  5D5U B;  3CO7 C;  2OD5 A;  3GO5 A;  3JAM K;  3GXO A;  3QPT A;  1XB4 A;  2IPQ X;  3TDZ C;  4P5O A;  1CF7 A;  4Q4Z F;  4IF4 A;  2RKH A;  3FM3 A;  2DAO A;  1D3Y A;  3P9I A;  4HW0 A;  2GAU A;  2HZT A;  1HQC A;  4N0B A;  4HV6 A;  2UWM A;  1MJB A;  4P9F A;  5A2Q K;  2QBY A;  3HRU A;  1HW5 A;  1FX7 A;  4EMS A;  2GXG A;  3ECH A;  4ZYE A;  1R5G A;  1CGP A;  4KN7 X;  1T6S A;  1S8N A;  3F8C A;  4AIJ A;  3REO A;  3WU0 A;  4BH9 A;  2VOO A;  4UVB A;  1WWX A;  2G7U A;  5D5V B;  2BE5 F;  2CFX A;  3C7J A;  3FMS A;  3RTR A;  5LBQ A;  3VFZ A;  2EFQ A;  4EJV A;  2FE3 A;  1MDM B;  3TO7 A;  3KP5 A;  3HSF A;  3M1E A;  3HOT A;  1I6X A;  2EA4 A;  5J8C A;  2K4B A;  2ELH A;  1IN8 A;  1HBX G;  2LDU A;  3GVA A;  2IA2 A;  1J2X A;  4CXF A;  2DPD A;  1O3T A;  4RGR A;  3R61 A;  1B4A A;  4WK8 F;  3ZN1 A;  4HV5 A;  1OR7 A;  3S2W A;  2Z99 A;  3D5L A;  4R8H A;  4RAZ A;  2KJC A;  5E20 A;  2GA2 A;  1U5T A;  2Z33 A;  2EFO A;  1I1S A;  4PCQ A;  5CVR A;  3GF2 A;  4KIG A;  4LB6 B;  1PP8 F;  5LRS A;  1ZGA A;  4KNY A;  5D6F A;  2FML A;  3DKW A;  4U0V A;  4U88 A;  1BI0 A;  3I53 A;  2JPB A;  2VT2 A;  4HOB A;  4M6X A;  5ILS A;  3ERE D;  3E6B A;  3K9T A;  5FD6 A;  3GFI A;  2L01 A;  1D8K A;  5HS8 A;  2CSO A;  1TBX A;  4HQM A;  3K1N A;  4HZF A;  1P92 A;  1QZZ A;  3K1P A;  3JAM Z;  2CW0 F;  4XLN F;  2MH2 A;  1RNL A;  4IHT A;  3FMQ A;  1IN6 A;  3DFG A;  3KLO A;  4L9T A;  2HYF A;  5D5X B;  1C0W A;  1E17 A;  2HKO A;  1U78 A;  1OYI A;  4UNO A;  5A2Q Z;  1IAW A;  2FNP A;  4CIC A;  2DI3 A;  4R79 A;  1W7P A;  1RI7 A;  4MEY F;  1KU3 A;  4HX4 A;  3HRT A;  4EJU A;  3GZ5 A;  2WWY A;  3EYY A;  1IXR C;  2RN7 A;  4LFU A;  4BHC A;  1R5H A;  2V9V A;  1XMK A;  2KIM A;  2ZNY A;  5LEK A;  1FLI A;  2OBP A;  4IHS A;  2ZFW A;  2ZBK A;  4U0Y A;  1F4K A;  1V3F A;  2NRA C;  4P9U A;  5LEJ A;  2M1B A;  2DQR A;  3HSE A;  1K6O A;  1RZ4 A;  2RV8 A;  1J0R A;  4G6D A;  4AVP A;  4ZZD A;  1EH7 A;  3K69 A;  3IL2 A;  5LGU A;  2FBI A;  4UVA A;  4LK1 F;  3ZQ7 A;  3ZN0 A;  3MFK A;  3BY6 A;  1FZP B;  5DDG A;  4Y15 A;  1LQ1 A;  2A07 F;  1XGS A;  2HGC A;  3KP3 A;  3DF8 A;  2Q8K A;  1SFE A;  1P4X A;  3TO9 A;  2STT A;  4IJA A;  4BHP A;  1FBU A;  3LQR A;  3IWZ A;  1OMI A;  4I98 B;  1BIA A;  3ZPL A;  2QM3 A;  2A68 F;  3GLX A;  4ASN A;  1SD5 A;  4RGX A;  1YW8 A;  1FT9 A;  4B8X A;  1X3U A;  1KU9 A;  1H9G A;  4IPA A;  2FBK A;  3PQJ A;  5HDK A;  3FXQ A;  1WKM A;  2JPC A;  4KN4 X;  4S05 A;  2H94 A;  2BV6 A;  5HVQ C;  2KKO A;  4RS8 A;  2ZXJ A;  4L18 B;  2GIV A;  4WWC A;  5E1X A;  2FBH A;  2GA1 A;  5L3E A;  4ZH4 F;  3F6V A;  5BMZ A;  3GYH X;  4EM0 B;  1EV7 A;  4E70 A;  4A0X A;  3HYI A;  5DCM B;  1YO5 C;  1DDN A;  2RQP A;  1DUX C;  2ZCW A;  2VOD A;  4YFK F;  2V1U A;  2XVC A;  1BBY A;  5HS9 A;  2LNB A;  1B1B A;  2YX7 A;  1FOK A;  1MJA A;  2DK8 A;  4Y17 A;  1ZG3 A;  2L3D A;  2E1C A;  4GYI A;  1MDM A;  2M87 A;  4HDV A;  2NAZ A;  5F6F A;  4G94 A;  3WG9 A;  1R7J A;  2XV4 S;  1XGO A;  1S7A A;  2VC1 A;  4EV0 A;  3E3V A;  2HOE A;  2K4J A;  3J81 Z;  2ESN A;  3TOA A;  5K5O A;  3QP6 A;  3RDI A;  4HX7 A;  5E1W A;  4I02 A;  2MA3 A;  2FMY A;  2AS5 F;  1OPC A;  3TO6 A;  2ETH A;  2M5W A;  1G3S A;  2O3F A;  5FB2 A;  1YS7 A;  2D2W A;  2WV0 A;  3KEQ A;  1U5T B;  1YTY A;  3IRR A;  1SD6 A;  4KMF A;  2CG4 A;  1Z91 A;  1BN5 A;  3JTH A;  2XAJ A;  4H0E A;  3C3W A;  3ZMT A;  1XGN A;  3FWE A;  3F21 A;  5DUK A;  2NNY A;  1BI1 A;  3FXR A;  5L3B A;  1FSE A;  3K0L A;  3WTS C;  2XRO A;  3B02 A;  4JK1 X;  4A5N A;  1ZRF A;  1YQA A;  1L0O C;  2ZJ2 A;  3L9F A;  4MTE A;  1IRF A;  2V6C A;  5FD5 A;  1TW3 A;  2A69 F;  3F3X A;  1G6N A;  1KQ0 A;  4MQV A;  3HRS A;  1UST A;  2QQ9 A;  5IT9 Z;  5E18 F;  3N4M A;  3GFL A;  2RC4 A;  2VC0 A;  1ZRC A;  1D8J A;  1I27 A;  1PDN C;  2FF4 A;  1XMA A;  1FYL A;  3WE2 A;  5EEH A;  1W7P D;  1OYW A;  3MAJ A;  4OOI A;  3LAJ A;  3WOD F;  5K5Q A;  1B6A A;  4RAY A;  1GXQ A;  2GXB A;  2YU3 A;  2O03 A;  5FGM A;  3KFW X;  5LLQ A;  4IRI A;  2P5K A;  1IW7 F;  3KLN A;  4O3M A;  3ZMZ A;  5D8L B;  1LDK B;  2QZ8 A;  3HTS B;  1U3E M;  4RB1 A;  1T98 A;  2CQK A;  3BZ6 A;  4G7Z F;  1FSH A;  2XKP A;  5ILV A;  5KK1 A;  2P4W A;  5CLS A;  2FOK A;  4G6Q A;  1WRJ A;  2FQ3 A;  1GHC A;  3OV8 A;  3KCC A;  3QOP A;  3T1B A;  4ZYG A;  1TQI A;  2JSC A;  3IRQ A;  3L2C A;  1I1G A;  3V7S A;  5HLH A;  4YIF A;  3WTZ A;  1IN4 A;  1YIO A;  3F6O A;  2STW A;  4O5V A;  3U9G A;  3BJO A; 
#chains in the Genus database with same CATH topology
 3BC8 A;  3W2V A;  2HFH A;  1Z0X A;  5EZH A;  2PQ8 A;  3S14 J;  4X6A J;  2DA5 A;  3MN2 A;  1UHW A;  5AON A;  5EG0 B;  1JHH A;  2IGO A;  4FX4 A;  1ZLJ A;  2XAH A;  1AA7 A;  3R0J A;  5E17 F;  4BY1 J;  1AKH A;  4E7J A;  1Z3Y A;  2BBY A;  2CQ7 A;  2DT6 A;  2H1L A;  4CZC A;  2W48 A;  4MQ9 F;  1XDU A;  2BGC A;  1ZEL A;  3PNT A;  2VKE A;  1HSJ A;  1V5G A;  4KFC A;  1G3Y A;  2HTS A;  2XAQ A;  1O3Q A;  1NK3 P;  4I0A A;  5JI6 A;  3AAF A;  1FMW A;  1JTX A;  1XMX A;  3WTT C;  1X1D A;  2DFF A;  1U5T C;  1LNW A;  1MBJ A;  1OKR A;  1KYW A;  5KVR A;  2P0W A;  4RGS A;  3PIO F;  5L3D A;  3MQ0 A;  2CWE A;  2CW8 A;  1X58 A;  3SXY A;  1T39 A;  1LEB A;  5F64 A;  1HXD A;  1XGM A;  1YYV A;  3QU6 A;  4YEJ A;  4RB3 C;  4XID A;  5DCM A;  2L9N A;  1MMS A;  1MBH A;  4P55 A;  1VND A;  1X3W B;  2R7O A;  3C1D A;  2F5C A;  2EZI A;  3FKI J;  3M9A A;  4NNJ A;  4BAY A;  1FJL A;  1J5Y A;  3FHN A;  3JCU C;  3MZH A;  1Q1H A;  4H4K C;  4L5E A;  4ZYH A;  3BPX A;  1OCC H;  3MWM A;  4BXU A;  3JRI A;  1R49 A;  1WQ2 A;  4GDF A;  5H6R A;  2DO7 A;  3EUA A;  1YRN B;  4QPO A;  1W0T A;  4B1R A;  3HEF A;  1S6L A;  3CCR I;  4PUS A;  2V26 A;  3COA C;  4MGR A;  3Q0V A;  3IH4 A;  1RIO H;  1WVR A;  3AG2 H;  2BEO A;  1IGN A;  3GWZ A;  4LIT A;  2IGN A;  4PZJ A;  1FC3 A;  2E1M B;  2AXL A;  4A2U A;  4U0W A;  4BU2 A;  4L9N A;  3TDU C;  2K40 A;  5FKK A;  3O8G A;  3Q0U A;  2GOX B;  2V79 A;  3K7A J;  4AYB N;  1SVL A;  2LTP A;  1ETW A;  3G71 I;  3U1K A;  2PBI A;  4YFN F;  2FXA A;  2I8D A;  3R0A A;  3RKY A;  2L9R A;  3L7W A;  2BXZ A;  3E1S A;  5M5Y J;  1BR1 A;  2WAQ A;  3K4K A;  4RLQ A;  5E3L A;  1ZN2 A;  2GIZ A;  3SDB A;  2Z9O A;  4BQO A;  5E3M A;  3JSO A;  4C2U A;  3BOQ A;  5J8F A;  3SFZ A;  2YUS A;  1HKS A;  2PMH A;  3KZZ A;  4ENN A;  3WHB A;  1KZH A;  3JRE A;  3S93 A;  1EH8 A;  1YFH A;  3V4G A;  2I5U A;  1IG7 A;  3CMM A;  4Z2Y A;  3CCJ I;  1R9T J;  2FJ1 A;  2LR8 A;  4S0H B;  2PJP A;  2GBY A;  3FF5 A;  2A5W A;  4CSW A;  5FFZ A;  1TNT A;  5EEG A;  1ZTR A;  4PJL A;  3BPV A;  5E1Z B;  3WE3 A;  4HNT A;  1JT0 A;  2CFO A;  1WJE A;  2WA0 A;  1Y8R B;  2R7D A;  1YW9 A;  1S3J A;  3VOD A;  2FNA A;  1SD4 A;  3PFI A;  2E35 A;  1UZC A;  1YIT I;  4CYD A;  5BOX A;  1XSV A;  4PDK A;  4ZDL A;  1W0U A;  2WY7 Q;  3A01 A;  3O6B B;  4OIP F;  2E36 A;  4GCV A;  3F8B A;  3GFM A;  4WXD A;  2HOA A;  1HF0 A;  4K2E A;  4PGH A;  4ZTF A;  3HOY J;  4IL6 C;  3SZP A;  3EUH A;  1TQP A;  1W5S A;  1GVJ A;  4S04 A;  1HA8 A;  5ED4 A;  1SC7 A;  2HR3 A;  1JE8 A;  1R23 A;  3QOE A;  2KZG A;  2VI6 A;  5KAF C;  3ZMS A;  3LWF A;  2LOO A;  2H1K A;  1LDJ A;  1USS A;  5FRN A;  2OQG A;  4II2 A;  3M4O J;  1ONV A;  1MMD A;  4HQE A;  5HNH A;  3BR1 A;  1FYK A;  2JT1 A;  2BYV E;  4HSR A;  2UUZ A;  4OMY A;  1LFB A;  4EEF G;  3LSG A;  1JGS A;  4XLA A;  2ZB9 A;  5H6Q A;  2KP6 A;  4XKW A;  3KZY A;  4M72 A;  1AU7 A;  3RPQ A;  2P6S A;  2ECC A;  5J4Y A;  3M07 A;  2HOT A;  2IS1 A;  1VQK I;  2R4G A;  4Z6Y A;  1JXS A;  1MBG A;  1RUN A;  2XF7 A;  3S2H J;  3CLO A;  2EV0 A;  4FT8 A;  3U2R A;  1G3T A;  2VQG A;  3HRM A;  4UUV A;  1IDZ A;  3FBI B;  3QWL A;  4IVN A;  4ZYD A;  1A36 A;  2VBY A;  2UV1 A;  4BYY A;  1R5I D;  5IY5 H;  4DW6 A;  2QSF X;  3BJ6 A;  3DBR B;  1R00 A;  2MLG A;  1VTN C;  1Z7U A;  2ZXH A;  1IV6 A;  2DTR A;  2NVY J;  1IN5 A;  3KP2 A;  4WXH A;  3BR5 A;  4F7Z A;  4LMY A;  5LFA A;  2XGX A;  4KIF A;  3RIR A;  2HVR A;  2QYO A;  3GTO J;  1W36 C;  2VXZ A;  2G9W A;  4AC0 A;  4HNV A;  5CKT A;  3WGI A;  4L0Y B;  4DIQ A;  1MD0 A;  1I5Z A;  1OYY A;  2VUM J;  3PFY A;  1PUF B;  1BOB A;  2VL8 A;  4I7H A;  3K6G A;  1SMT A;  3FZV A;  4M74 A;  3K10 A;  3I5U A;  2KMU A;  5E3N A;  1U2W A;  1Q1V A;  3H3V K;  3F8M A;  1PJR A;  2AHQ A;  4GYG A;  2KLO A;  1FPQ A;  2W24 A;  4LOC A;  4MLO A;  2RDP A;  3V7C A;  2E5Z A;  2CGP A;  3BZK A;  1U9N A;  2UXN A;  3OS1 A;  2TDX A;  1KQ8 A;  4A3I J;  1E2X A;  1ZAR A;  1BR2 A;  1XG1 A;  4KA4 A;  1U8R A;  2E7X A;  3MZ8 A;  1Y6I A;  5CVU A;  3J81 K;  2B0L A;  1LDD A;  3ML6 A;  2LKS A;  3UKG A;  5CQG A;  3FK7 A;  1AOY A;  5FKN A;  1HOM A;  3RJP A;  2H27 A;  1A31 A;  4UXN A;  3O8H A;  1G8X A;  2X1D A;  4P1W A;  1IUF A;  2MBF A;  2OUM A;  2C6Y A;  2E5N A;  2DFI A;  1Z7L A;  3AFH A;  3S16 J;  2JRT A;  2LF8 A;  2KJB A;  1ZYR F;  4AIH A;  3W2A A;  4HBL A;  2MH9 A;  1K6Y A;  2WBM A;  4RGU A;  3EET A;  3OYL A;  3QYF A;  3ZQC A;  4MHG A;  1FOY A;  3N97 A;  3DEU A;  1XD7 A;  4BJ5 C;  1MKM A;  4P96 A;  1SFU A;  1LFP A;  3HUG A;  3I64 A;  2A3S A;  1ZG1 A;  4ANJ A;  3M7G A;  2JQ7 A;  3FX3 A;  3ASN H;  1DPU A;  2MD0 A;  1QO0 D;  5B1B H;  3E6M A;  1HKQ A;  4JOM A;  3GTL J;  2QCO A;  4GGG A;  1MBE A;  2Y48 A;  2CV2 A;  2ISZ A;  4F93 B;  1QU3 A;  2O9L A;  3ONQ A;  3D5S C;  5K7Z A;  5EG0 A;  1I3Q J;  4HNU A;  5TJJ A;  3G73 A;  4GFB A;  1J59 A;  2ZSH B;  2EFP A;  3LSM A;  1V55 H;  3D1N I;  3OMY A;  3W2W A;  4KJZ A;  4ETS A;  1ZKG A;  4NHJ A;  2O8X A;  2Z3Y A;  1Z6R A;  3ZQQ A;  4EAT A;  3KET A;  3H92 A;  1XN7 A;  3RPU A;  1QVT A;  1DGR M;  5DUI A;  2W7N A;  4MIM A;  5ICE A;  2XAF A;  2LBF B;  4A0Z A;  5IP9 J;  4ZYA A;  1A04 A;  3F0C A;  2ACJ A;  4Q48 A;  2BY1 A;  1WH7 A;  1KYZ A;  1A6Q A;  1FBQ A;  1ZH5 A;  3ZMU A;  3PNV A;  2D45 A;  2ADU A;  1I50 J;  1BC8 C;  3K1M A;  4I0B A;  2VB6 A;  2Q1Z B;  3OR2 C;  3FMR A;  1SFO J;  2CU7 A;  2NS0 A;  3G3Z A;  3TW6 A;  5JVT A;  5B1A H;  1BI2 A;  3ZMD A;  3W6V A;  5ILU A;  2P8T A;  3BRO A;  2M4K A;  4RDU A;  4LG0 B;  3RYR A;  3ISP A;  2H8W A;  5IT9 K;  4XOT A;  4YIR X;  2DMU A;  2Q2E A;  1YRN A;  3MKZ A;  2R7V A;  3LSJ A;  5F1R A;  4C3H J;  5HLG A;  1WH5 A;  2EQR A;  3CO6 C;  3EYI A;  4LB5 A;  2VT3 A;  5DYM A;  5HDN A;  4MNU A;  2EB7 A;  2BY2 A;  4IXA A;  3WTY C;  2OAZ A;  4C3I J;  2EIN H;  3GLL A;  2DOD A;  4D7N A;  4DJA A;  2AXT C;  4ENM A;  4YEL A;  2WY8 Q;  3CMA I;  1FNN A;  2P7C B;  4BXX J;  1ZRD A;  2CUJ A;  3M8J A;  4V2F A;  3H35 A;  3SDG A;  1FP1 D;  3H0D A;  1X3Z B;  5L3G A;  3S1R J;  1R1U A;  4PSX A;  5IYB J;  3OYN A;  1TT5 B;  4IQJ A;  4XR6 A;  4NUB A;  4BXF A;  4QTR A;  4M73 A;  2K02 A;  2KT0 A;  4M6Y A;  2MFZ A;  2COM A;  2EJR A;  4AVZ A;  3WU1 B;  3KEY A;  5FRM A;  5K7F A;  3NWT A;  1I6H J;  1IUY A;  1LVK A;  4CCL A;  4CH7 A;  1FYM A;  1TWH J;  3D5R C;  4JX6 A;  3OYH A;  2GZW A;  2LY9 A;  4E7K A;  3NAR A;  3Q5F A;  1D5V A;  1RES A;  4DYQ A;  2KIF A;  1MGT A;  4L5J A;  3F72 A;  3UNG C;  2O5R A;  3ZQL A;  3H9Q A;  5IOY A;  1LFU P;  3W3C A;  3BG5 A;  1F5T A;  4XM3 A;  4C2M J;  3RYP A;  2V6E A;  3VDX A;  1TQM A;  2F5D A;  2LRE A;  2IW5 A;  4JBA A;  4BQQ A;  4IOC F;  5IT3 A;  3QPL A;  3E6C C;  3OYC A;  3E97 A;  2XAS A;  4N4O B;  1R1V A;  4CA0 A;  3PSF A;  5ICG A;  4WF2 A;  1JHF A;  4AID A;  3I4P A;  2IAI A;  2XRL A;  1DU6 A;  2HU9 A;  4LK0 F;  5EF6 A;  3CCU I;  5LGT A;  4BHB A;  2HNH A;  3J80 K;  2H6C A;  2YPR A;  2CUF A;  1S72 I;  1ON1 A;  1X1B A;  3PM1 A;  3MKY B;  3H3Z A;  1DGW Y;  2VQC A;  4EGY A;  3PNY A;  2MC3 A;  3ERM A;  3HTU A;  5DCF A;  2EFN A;  4XIC A;  2DK5 A;  2XUB A;  5IOZ A;  4HF1 A;  3GW2 A;  2GQQ A;  1Z9C A;  3ULQ B;  3FXO A;  4MO7 A;  2M0C A;  4Q47 A;  1X1P A;  2OC6 A;  2L7K A;  1IDY A;  4XL9 A;  1OCO H;  3MCZ A;  1UG0 A;  3NQO A;  1YE9 A;  4KMU X;  2QSG X;  4RB2 C;  1MNE A;  1YW7 A;  3WHC A;  1MW7 A;  1FWZ A;  3LSI A;  4Y7N J;  2P6T A;  5HNF A;  2X0L A;  3H3U A;  2DA6 A;  5HLI A;  2LYC A;  4RAG A;  1YX3 A;  1VI0 A;  2L54 A;  5F1J A;  1BJZ A;  2H09 A;  5ERI A;  5HLT A;  1IF1 A;  4LIU A;  4DBQ A;  1T08 B;  5EGO A;  3DP7 A;  4A3B J;  2IEK A;  4BE2 A;  3S1M J;  2IS6 A;  4KYW A;  4DYR A;  1MMG A;  2CUE A;  4FAS D;  1BW5 A;  2KHM A;  2L4A A;  2P7V B;  3BCA A;  4B4C A;  1ON2 A;  3SZT A;  1MSE C;  3BT9 A;  4LJZ F;  3JRG A;  2LY1 A;  5IPA A;  1O7F A;  1TW2 A;  5EEA A;  3E7L A;  3N05 A;  4A6E A;  2O61 A;  3CF5 F;  3ZQI A;  2NOG A;  2JA7 J;  2HZD A;  1OLT A;  1T2K A;  4XQF A;  5HOO A;  1HCR A;  3S15 J;  4YG2 F;  5FLX K;  2W25 A;  2HQN A;  5EDN A;  3RZO J;  2X6O A;  3IP4 B;  2EV6 A;  3L00 A;  3RKQ A;  3LL7 A;  2L5Q A;  4AWX B;  1PUF A;  2JMW A;  1ZR4 A;  3R60 A;  2OQR A;  4F3Q A;  3G1M A;  1Z05 A;  2HOS A;  4GO1 A;  3LFU A;  5B5E C;  1V5F A;  3ZP5 A;  2R7T A;  1Z77 A;  1FIP A;  2JA6 J;  1E3O C;  1POG A;  4I01 A;  3S1Q J;  3B6A A;  1WSU A;  1QBJ A;  4E7H A;  1XTA A;  3L09 A;  3KYL A;  3BCB A;  4EQQ A;  2EZK A;  3ABL H;  4MFD A;  1SFK A;  2YX4 A;  3S2D J;  3J7A Y;  3DKX A;  3RQI A;  2R7S A;  4HAM A;  4EM2 A;  4FX0 A;  1ZGW A;  1SMY F;  1GVD A;  3BWG A;  3O3K A;  1WFX A;  3W6K B;  1OCR H;  2NXN B;  3RKX A;  1J75 A;  1MH4 A;  4XLF A;  5F08 A;  3ZOB A;  4C3J J;  3VB2 A;  3CMY A;  2ZXW H;  2KDZ A;  3OYE A;  5E3O A;  3TMO A;  1H89 C;  3IHU A;  3DPL C;  1YJ9 I;  2HQ5 A;  2X48 A;  4Y3O A;  5LD2 C;  2ZJP F;  2K86 A;  2UZK A;  4BY7 J;  2XC7 A;  4WXC A;  2PMZ A;  1UJ8 A;  1G3W A;  1XCV A;  2W57 A;  1LJ9 A;  2XF5 A;  3CQZ J;  3P7N A;  5JHU A;  1E0E A;  5H20 A;  3LAP A;  2RRE A;  1G59 A;  3F22 A;  3GX4 X;  2VE8 A;  4CUG A;  4A93 J;  2NOJ B;  1UFM A;  4XNF A;  3HHH A;  2VBX A;  3HKZ A;  1HW1 A;  3QAH A;  1F9N A;  1Y0U A;  2HS5 A;  2MSY A;  1E3P A;  4IRH A;  3KP6 A;  3HDD A;  3IV5 A;  1TZL A;  5J1Y A;  3J80 Z;  1Z21 A;  1B9M A;  3IAM 2;  1WHU A;  2J5O A;  2MG4 A;  4ESB A;  4B09 A;  1EA3 A;  2V1D A;  2DA4 A;  2HQR A;  2ZSI B;  3K4J A;  4OIN F;  1R22 A;  4UUS A;  4XRS A;  4ITV A;  3BJA A;  3KPH A;  2IVM A;  1GUU A;  2XSD C;  1UB9 A;  1KA8 A;  3K4N A;  4A3K J;  2CMP A;  2PG4 A;  4ZZL A;  1SEU A;  4BL0 B;  4FCY A;  5DD8 A;  2LBF A;  3OIO A;  3ZMV A;  3FXM A;  2KIQ A;  2JK3 A;  3A03 A;  3BR3 A;  3Q0W A;  5M3M J;  1T56 A;  2OV7 A;  2XHK A;  2HKX A;  3NRV A;  5GPC A;  1X4O A;  3H1C A;  3KIO A;  2HDW A;  3I59 A;  2IT0 A;  2DN0 A;  1EF4 A;  2IRF G;  1W36 D;  1JUS A;  4CCK A;  3LA2 A;  5D6E A;  1I39 A;  2Y0M A;  4R1H A;  3RPU D;  2PJR B;  5ICC A;  2OZ6 A;  2VQH A;  3BTI A;  3G6E I;  3E5X A;  4LG0 A;  4Y13 A;  5CPR B;  4EVI A;  1Y1W J;  4MEX F;  2M2E A;  1R58 A;  2HTJ A;  4DQ2 A;  3OYM A;  2CW7 A;  2K27 A;  3LA7 A;  3BG3 A;  2HVS A;  3WTV C;  4HLX A;  4FHT A;  3I71 A;  2HYG D;  3JRH A;  2QQ8 A;  4BQA A;  3CC2 I;  3M8E A;  1BOA A;  4HLY A;  3OSG A;  5D4S A;  3WTX C;  4LIV A;  1ULY A;  2EZH A;  3LST A;  5BQT A;  2F4I A;  3T8T A;  2LD5 A;  1BI3 A;  1ZG5 A;  2Q2E B;  4EJT A;  1WI9 A;  2VIX A;  2ZME C;  2F48 A;  3HOW J;  1ZHF A;  3KEO A;  5DS9 A;  1UHM A;  4XN3 A;  3RI4 A;  3H36 A;  4XOR A;  5FLX Z;  4G8X A;  3JSP A;  3EUH C;  2WC2 A;  1VQN I;  5LHH A;  2D1V A;  3H9J A;  5IP7 J;  3P9K A;  4B44 A;  4CYC A;  2COB A;  4KUM A;  2GOM A;  2K9L A;  2XRN A;  2L0K A;  1JUP A;  4HYE A;  2XKO A;  5FFX A;  3LQQ A;  4M9X A;  3D0S A;  1T8I A;  4KIC A;  1JKR C;  3F8F A;  2HXO A;  1YOV B;  5DD4 A;  4ON0 A;  4HF2 A;  4CDG A;  1IXS B;  2PFB A;  1HW2 A;  1W4M A;  3PO3 J;  4UV9 A;  4IRG A;  3DKY A;  5GAD J;  3CDH A;  4V19 K;  4X1E A;  2P5V A;  2V7F A;  4A0Y A;  4G9Y A;  5D8K B;  3R4K A;  4BAC A;  3TBI A;  1PYV A;  4Q5S F;  2EWN A;  4EGZ A;  3TQN A;  3U1D A;  1XSX A;  2Y75 A;  2VKD A;  4HDU A;  2HWV A;  2PEX A;  3FHZ A;  1Z6T A;  1ERD A;  2K9S A;  4BDY A;  2XB5 A;  1N75 A;  2WTE A;  3KP7 A;  4KT5 C;  3IUO A;  2YR2 A;  3C2G A;  3IC7 A;  1VQ7 I;  3T5X A;  3L2Q A;  1FOX A;  2ECB A;  4M3E A;  2KIU A;  3HB9 A;  4XLH A;  1HST A;  5C4J J;  2QVO A;  2WB1 A;  3PUB A;  3IKT A;  1JT6 A;  1ACI A;  1EH6 A;  1OFC X;  2DDB A;  1U8B A;  1PP7 U;  1T0F C;  2LVS A;  4ABZ A;  3I9V 2;  1MJ9 A;  3MEX A;  2XAU A;  4E4H A;  3OS0 A;  2M8E A;  5J3L A;  1R4M B;  2MD5 A;  1D0X A;  3O2P E;  4M3D A;  4IX7 A;  3QYE A;  1H9T A;  2CH0 A;  4JQF A;  4XKC A;  1W1W E;  3KE2 A;  4AD9 A;  4CCJ A;  4IKF A;  2WV1 A;  1OCP A;  1YIJ I;  2QQA A;  1NHA A;  1MMN A;  2LF7 A;  4OAZ A;  2ZME A;  3CDI A;  1NTC A;  2Y0S A;  1O7L A;  5DEQ A;  1YHQ I;  1UCR A;  3Q3S A;  3TGN A;  2KDO A;  4QWQ A;  3W6J B;  1V5E A;  3E5U A;  3FXK A;  4XBF A;  1H0M A;  3ABT A;  4JYK A;  3DV8 A;  1TTY A;  1VF9 A;  3CCY A;  2JJ7 A;  2ESH A;  2DMT A;  4EM1 A;  2ZKZ A;  3L2R A;  4YFX F;  4EJO A;  1Z1D A;  2RGV A;  1IJW C;  2OU2 A;  1QGP A;  3EPZ A;  1BM9 A;  4LG3 A;  1H8A C;  3BR2 A;  3ZQH A;  4HRI A;  5KNL A;  3B6C A;  4BUP A;  2X4H A;  4XRF A;  2NVU B;  1B8I B;  1XS9 A;  3BTC A;  1Y8Q B;  2WAD A;  5EGO B;  3SEQ A;  1S29 A;  1ZAO A;  3TP3 A;  3PIP F;  4L0Z B;  1SVO A;  3OOP A;  2NYX A;  1TLH B;  2EH3 A;  3CUQ B;  3JTG A;  4QLC U;  3E0J B;  2MW8 A;  4NC6 A;  3VYS B;  5TGT A;  5E8I A;  3KX2 A;  4OIO F;  2IA0 A;  2R3S A;  1K7A A;  3G1O A;  4MFE A;  2VPL A;  2F5E A;  4BKX A;  3AG1 H;  1TL8 A;  1HC8 A;  3HIF A;  5HS7 A;  1J9I A;  4XRS G;  3CDL A;  4B3A A;  3HSR A;  4QSH A;  3WGG A;  2OCE A;  3A1Y A;  1BJA A;  2FSW A;  3M1C A;  1KGS A;  1IN7 A;  3HC7 A;  1SAN A;  2VPR A;  2O0Y A;  3WGH A;  1T0F A;  1YS6 A;  2K9M A;  3GCM A;  2HYJ A;  2NS8 A;  5F04 A;  4A3G J;  1YLF A;  2LG4 A;  3LA3 A;  2R7Q A;  3DXJ F;  5K7H A;  1BW6 A;  2P5L C;  1K78 B;  4I2O A;  2HQA A;  5JHF A;  1FTZ A;  5GP9 A;  3CJQ B;  2IXS A;  5KCM A;  4DOZ A;  1D1B A;  2ZJQ F;  1MH3 A;  2KIS A;  3GZN B;  2OZU A;  4U7D A;  5DM6 F;  3JRA A;  1O57 A;  1FTT A;  2DA3 A;  4E7I A;  5BPI A;  3HGG A;  3OY9 A;  4HPQ A;  3CES A;  3RZD J;  2LP0 A;  4B43 A;  2HDD A;  3Q9S A;  3DEW A;  4LGW A;  4D0P A;  5BS6 A;  2VBW A;  1QZY A;  4B3X A;  5D4R A;  2VBZ A;  2R7W A;  5LRR A;  2HI3 A;  4LLL A;  1R4N B;  2FEZ A;  2KRF A;  2HPI A;  4RBO A;  2TCT A;  3LFK A;  1U0J A;  3V42 A;  2W85 A;  2L4M A;  2PN6 A;  2M30 A;  3IAS 2;  4ESJ A;  5K5R A;  2FA5 A;  1PUE E;  1OIS A;  4LD5 A;  1B9N A;  2ID6 A;  3R6S A;  2L02 A;  3GUD A;  4O6J A;  5TRD A;  1RC9 A;  1VQO I;  1J09 A;  2XGC A;  1Y0N A;  1LVA A;  2DCE A;  2KZV A;  4EJW A;  2IA1 A;  3CCQ I;  5F0H A;  2YSR A;  3I58 A;  3ZQG A;  1HKT A;  4XRM A;  4PJN A;  1IRZ A;  4QPQ A;  3K2Z A;  3OYJ A;  2EPF A;  3E5Q A;  2CO5 A;  3CF2 A;  4YII A;  3I54 A;  5AIQ A;  5BPD A;  1ZR2 A;  1T38 A;  2FQ4 A;  5E8G A;  3HZJ A;  3IH3 A;  5JR3 A;  4RLF A;  3GBG A;  2XDV A;  3BDD A;  3AG3 H;  4UUS B;  4PJ0 C;  4OIQ F;  3HPG A;  4PFP A;  1G4D A;  1RR7 A;  5IYC J;  4BNC A;  5GAG J;  3GFJ A;  4F55 A;  2M45 A;  3JW4 A;  3HOV J;  1Y56 A;  1LB2 A;  1MZB A;  3RKW A;  2E1N A;  1MMA A;  5LHG A;  4XN0 A;  1V4R A;  3QU3 A;  1WZ2 A;  4U7B A;  2PJR A;  4FIS A;  3I59 B;  4UV8 A;  2VOP A;  1P4A A;  2J5P A;  3CZ6 A;  2K9N A;  2MLK A;  4TV7 A;  3Q9V A;  1ZGJ A;  2MC4 A;  4BDZ A;  2M7B A;  1K79 A;  5JFR A;  1DPR A;  5CVI A;  1AWC A;  1U6G A;  1TNS A;  3VOE A;  1FY7 A;  3C18 A;  5F0F A;  1CF7 B;  3GTJ J;  3BQZ A;  5B3S H;  3BTJ A;  5ICF A;  1QRY A;  2F4O B;  3TKY A;  4RMN A;  2MYS A;  2X1C A;  3I56 I;  4XMY A;  2QF7 A;  3SJM A;  1ZLK A;  2FUG 2;  1DU0 A;  2E1O A;  4BE0 A;  4L9J A;  3V8J A;  3WTU C;  2PLY A;  2DXI A;  2PI0 A;  3LSK A;  2W84 A;  1ZRE A;  2ME6 A;  3F8N A;  1EJ9 A;  2LY2 A;  4M9Z A;  1IC8 A;  3FM5 A;  4G6T B;  2QBY B;  4WX9 A;  6PAX A;  4GXO A;  2DJN A;  2NNN A;  1XX5 A;  3VSK A;  2CRG A;  1REP C;  3DQV C;  2OTL I;  5J40 A;  3X2Q H;  3VYT B;  2Y30 A;  4L5I A;  1YI2 I;  4CYC B;  4Y4R A;  2DTZ A;  2DPU A;  5L3F A;  4A3L J;  4PGG A;  3VEP A;  2R7F A;  3MVP A;  1W5T A;  4DNC A;  2PMU A;  2HXI A;  3KP4 A;  3ASO H;  1SD7 A;  5CYV A;  4OIR F;  1B59 A;  3MKW B;  3SHF A;  3B73 A;  3CUQ C;  3CCL I;  3IWF A;  5AIP A;  2LSO A;  2JA2 A;  2V1N A;  4ZJZ A;  3CJN A;  2L2O A;  2F2E A;  2DW4 A;  3GZ6 A;  2V1X A;  1APL C;  2VAS A;  3EQL F;  2BHY A;  2DQL A;  4J01 A;  2A05 A;  2W1O A;  4NQW A;  3OL4 A;  2EK5 A;  1R36 A;  3T8R A;  3CLQ A;  4G7O F;  4HF0 A;  2IP2 A;  3P9C A;  5HDG A;  2EIJ H;  2Z5U A;  2GWR A;  1IO2 A;  2EA2 A;  2D5V A;  3T0Y A;  4OMZ A;  3DU5 A;  2L7M P;  4JX5 A;  5EYR A;  2F5F A;  2A6E F;  2PMZ N;  2FU4 A;  3OYA A;  4M9S A;  2VON A;  2ZO4 A;  2M3A A;  3NAU A;  3CCM I;  2AQE A;  2DOA A;  1QNT A;  2KFD A;  2E34 A;  2XAG A;  3DPT A;  2R7Z J;  1TWC J;  2IS4 A;  1VQ4 I;  2LC2 A;  3HKZ N;  5FLM J;  2RNJ A;  1LKX A;  4B47 A;  4CO8 A;  4A12 A;  3LSR A;  2P81 A;  3H5N A;  3NWS A;  2K3P A;  2R7X A;  1P7J A;  1JKP C;  5J6X A;  3A02 A;  2R5Z B;  3CCE I;  1NH3 A;  2Q0O A;  3HOS A;  4CHU A;  2EFW A;  3SQN A;  4N9I A;  2A6H F;  2ZME B;  1IXC A;  4UUT A;  3J7A O;  1QPM A;  2FRH A;  4XK4 A;  3ECO A;  4NB5 A;  2V9P A;  4UVC A;  4E7S A;  2YS9 A;  1J7K A;  3IKV A;  1R1T A;  4A6D A;  1BC7 C;  1DP7 P;  3FXU A;  4A3J J;  2E19 A;  2B9S A;  1O3S A;  1RUO A;  2CQX A;  1P2F A;  2ZNZ A;  3ROU A;  5E79 C;  2X51 A;  2A61 A;  1B8I A;  2JZY A;  4A3M J;  1QZE A;  2ELJ A;  1N77 A;  2H6B A;  1XDS A;  2K85 A;  4RB0 A;  1G2H A;  2RVC A;  4D9J A;  3I4N J;  2LMD A;  2VN2 A;  5CVV A;  9ANT A;  2EIM H;  1E3H A;  2UXX A;  1O3R A;  3TOB A;  4LLG F;  3CUQ A;  4OU0 A;  3WTW C;  3TED A;  2HEO A;  3EDP A;  3F23 A;  2QWW A;  1Y39 A;  3HXL A;  2MAB A;  3H5A A;  1IZ1 A;  1F1Z A;  5DV5 A;  2DMQ A;  2VKH A;  1CQT A;  2JTV A;  4C9Y A;  2QKL B;  4XLP F;  2HDC A;  1ENH A;  4HG2 A;  1MND A;  2QUF A;  2DMN A;  4UHT A;  5L3C A;  4FE7 A;  5FO5 A;  3QP5 A;  4C30 A;  2MGQ A;  5JLX A;  4AUX A;  4D5C A;  1A6I A;  1STZ A;  1ETX A;  1JKQ C;  3PQK A;  1XCB A;  4HA8 A;  1SAX A;  4M71 A;  1P6R A;  4XLC A;  3SFI A;  1JKO C;  2LKP A;  3OOU A;  4I76 A;  2W82 A;  5KHD A;  4HX8 A;  2QLZ A;  3BZC A;  3UR3 C;  1K78 A;  2NVQ J;  1ZK8 A;  3DPU A;  2GLO A;  4ENK A;  2KRC A;  1ETQ A;  4ZC3 A;  4ESF A;  2VE9 A;  3OR1 C;  1W7P B;  1QQI A;  2OJE D;  3A4C A;  4BQN A;  3GTK J;  3V8L A;  3NEU A;  4J19 A;  4LLN A;  3HHG A;  3CUO A;  3K4M A;  3I0T A;  1YJW I;  4MTD A;  5C44 J;  4CGZ A;  3EUK L;  1BIB A;  5F0C A;  3DU6 A;  3PSI A;  2X85 A;  2QQB A;  3OYB A;  3ELK A;  4NC8 A;  2IJL A;  4RM3 A;  2OPT A;  2WAQ N;  1IRG A;  3ZCO A;  5D5W B;  1GXP A;  4CZZ A;  3CD6 I;  1ODD A;  4A5M A;  2PX9 A;  1XSD A;  5FLV A;  3ABK H;  4IHW A;  1KU2 A;  2CQQ A;  1YG2 A;  3BP8 A;  2HPM A;  2H8R A;  3V7R A;  3SZG A;  2ZFU A;  1KON A;  4BJ6 C;  1HLV A;  3KZI C;  3I55 I;  1WJB A;  4PJJ A;  3QPS A;  1GV2 A;  4NBQ A;  2V9K A;  2DJI A;  2XPW A;  4N9H A;  4KIB A;  4BJT A;  1L3L A;  3MZY A;  2K7L A;  4BEH B;  3M3Y J;  3V8K A;  2F6C A;  3CC4 I;  3S17 J;  2DT5 A;  4G7H F;  1N25 A;  2JA5 J;  2WB1 N;  2D1H A;  2IGK A;  1FBS A;  1S7O A;  2G7H A;  2K5C A;  3DTK A;  3VPR A;  1X2M A;  2M0M A;  3FKJ A;  3GTG J;  2EV5 A;  4ENJ A;  2KPM A;  3M8F A;  2N8G A;  4XSX F;  4AIK A;  4E6K G;  4WCG A;  3A0B C;  2K9Q A;  1OCZ H;  4L9V A;  3QRF F;  2DBB A;  2A5Y B;  5CVJ A;  4OWR B;  2ISY A;  3BG6 A;  4XKB A;  1SFX A;  2E7W A;  4HEA 2;  5LGN A;  4I09 A;  1WI3 A;  3S3N A;  4BE1 A;  3HOZ J;  5LHI A;  3G2B A;  3ABU A;  1S5L C;  2Y0S N;  1P4W A;  2O6G E;  2DU9 A;  3QPH A;  1KU7 A;  1UG2 A;  4M3B A;  1KQ9 A;  3LOC A;  1OCT C;  2DLL A;  4KDP A;  3GEZ A;  3K4B A;  2CYY A;  1LEA A;  2OA4 A;  5K1Y A;  2FX0 A;  2QEN A;  4DBR A;  2XIG A;  3CME I;  1FP2 A;  1H88 C;  3CTA A;  3G4S I;  4D5F A;  3E6D A;  2X9D A;  5CJ9 A;  4XSZ F;  1RKW A;  5M3F J;  3K2A A;  5F27 A;  5D5U B;  3CO7 C;  2OD5 A;  3GO5 A;  3JAM K;  3GXO A;  3QPT A;  1XB4 A;  2IPQ X;  2LH9 A;  3TDZ C;  2CJJ A;  4P5O A;  1CF7 A;  4Q4Z F;  4D7M A;  2M4G A;  4IF4 A;  4F52 A;  1BL0 A;  2VJ5 A;  1YJN I;  4JX4 A;  4KT6 A;  2RKH A;  1OR7 C;  3FM3 A;  2V4J C;  2DAO A;  5FKL A;  1D3Y A;  3HG9 A;  3K70 C;  3P9I A;  2CUZ A;  1XPX A;  1UEL B;  3GTQ J;  3S1N J;  4B48 A;  4HW0 A;  3JRB A;  2GAU A;  2HZT A;  3G1L A;  1RR8 C;  1HQC A;  2JUC A;  4N0B A;  4HV6 A;  2UWM A;  1MJB A;  4P9F A;  5A2Q K;  3ZXS A;  2CS3 A;  2DA2 A;  5FRO A;  3S32 A;  2FOW A;  4IHV A;  2QBY A;  3HRU A;  1HW5 A;  4J00 A;  4E7Z A;  1TC3 C;  1FX7 A;  4EMS A;  1P7I A;  3HOU J;  2GXG A;  3ECH A;  4ZYE A;  1R5G A;  3OYG A;  1CGP A;  2JRM A;  4W1U A;  1LPQ A;  2W4S A;  4KN7 X;  1D5Y A;  3JR9 A;  1T6S A;  2JUG A;  3FXL A;  3DLA A;  1S8N A;  3F8C A;  4AIJ A;  3AL0 B;  5JVG F;  3REO A;  2NVT J;  3OYI A;  4IO9 F;  2M8G X;  2VQL A;  3WU0 A;  4BH9 A;  2G0E A;  2VOO A;  3PL8 A;  4UVB A;  1WWX A;  4KIT B;  2G7U A;  3C2H A;  5D5V B;  2BE5 F;  2CFX A;  2VJI A;  3CCV I;  3C7J A;  3FMS A;  3BR0 A;  3RTR A;  5LBQ A;  1A5J A;  5J1U A;  2Y69 H;  2EFQ A;  3VFZ A;  4EJV A;  2FE3 A;  3FXJ A;  1F36 A;  1V54 H;  3FBN B;  1MDM B;  1QPI A;  3S8P A;  3TO7 A;  3KP5 A;  3P5J A;  3HSF A;  5H2F C;  3M1E A;  3HOT A;  2ME0 A;  1I6X A;  3GTM J;  2EA4 A;  4DZP A;  5J8C A;  2BHZ A;  2K4B A;  4NQW B;  2ELH A;  1IN8 A;  1HBX G;  2LDU A;  3GVA A;  2IA2 A;  1J2X A;  4G12 A;  4M6V A;  4CXF A;  2DPD A;  2VJ4 A;  2LKX A;  1O3T A;  4RGR A;  3FDY A;  1B4A A;  2L9V A;  3H9G A;  3R61 A;  2W00 A;  4WK8 F;  3ZN1 A;  5B66 C;  4HV5 A;  5EJC A;  4XKV A;  1OR7 A;  3S2W A;  2Z99 A;  3D5L A;  4R8H A;  2LRD A;  4RAZ A;  4IHY A;  2R5Y B;  1MNM C;  2KJC A;  4M3G A;  3OIP A;  1K83 J;  5E20 A;  2GA2 A;  1U5T A;  2R5Z A;  2XSJ C;  4CCO A;  2Y2Z A;  2EFO A;  2Z33 A;  1I1S A;  4PCQ A;  5CVR A;  1QA6 A;  3GF2 A;  3TL4 X;  1GV5 A;  4KIG A;  3I4M J;  2KRH A;  2BOL A;  4V2G A;  4LB6 B;  1PP8 F;  4A69 C;  5LRS A;  1ZGA A;  4KNY A;  5D6F A;  2FML A;  3DKW A;  4U0V A;  4U88 A;  1BI0 A;  3I53 A;  5KAI C;  2JPB A;  2VT2 A;  2JSP A;  4HOB A;  4M6X A;  5ILS A;  1T33 A;  3ERE D;  2DT7 B;  3K4C A;  2JWT A;  3E6B A;  3K9T A;  5FD6 A;  3GFI A;  5FKM A;  2BVM A;  1TWG J;  2L01 A;  1D8K A;  3H0G J;  5HS8 A;  1FMV A;  3AKZ A;  4IEJ A;  3LSP A;  2CSO A;  1TBX A;  4HQM A;  4HST A;  3K1N A;  4HZF A;  3VSL A;  2LK2 A;  1P92 A;  3TP0 A;  1JJ8 C;  2ICW G;  2ZXI A;  4CCN A;  1B72 B;  1QZZ A;  3K1P A;  3I3L A;  3JAM Z;  2CW0 F;  3ESW B;  4XLN F;  1IV8 A;  2MH2 A;  1RNL A;  3GTP J;  1Z3X A;  1X19 A;  2XB0 X;  3OYD A;  4IHT A;  5GTH C;  1VZ0 A;  3FMQ A;  2E60 A;  1IN6 A;  3DLL F;  3DFG A;  3CC7 I;  3KLO A;  3BG9 A;  4C2T A;  3PJR A;  3LNQ A;  4L9T A;  2HYF A;  1VQP I;  5D5X B;  1A35 A;  3S3M A;  2DDA A;  3BTL A;  3U9G A;  1C0W A;  5C3E J;  1E17 A;  1T95 A;  2HKO A;  3HL2 A;  1OYI A;  3J7Y J;  1U78 A;  4UNO A;  1AHD P;  4PK4 A;  1TP4 A;  2Z2S B;  2IBD A;  2Y9Y A;  3IH2 A;  3MMY B;  5A2Q Z;  4QIW N;  2CQN A;  2DA7 A;  2FNP A;  2Y9Z A;  1IAW A;  4CIC A;  2GM4 A;  2DI3 A;  4R79 A;  1W7P A;  1RI7 A;  1FOW A;  3RCO A;  2JN6 A;  4MEY F;  3QOD A;  3PUF A;  2Z1D A;  3F9K A;  1KU3 A;  4HX4 A;  4BBS J;  3HRT A;  4EJU A;  3GZ5 A;  4I99 C;  2WWY A;  2RNG A;  4AU7 A;  2TRT A;  3EYY A;  1NK2 P;  2DFH A;  1IXR C;  3FIW A;  2RN7 A;  3ABM H;  3KYC B;  4LFU A;  1S9H A;  1WJD A;  4W97 A;  1TWA J;  4BHC A;  1TT0 A;  3QQA A;  5EZG A;  4M3F A;  2CV0 A;  1R5H A;  1QHH D;  2V9V A;  2VXD A;  1XMK A;  2KIM A;  2ZNY A;  5LEK A;  2JVG A;  4AYB A;  1FLI A;  2OBP A;  5GPA A;  1XC5 A;  4IHS A;  1F43 A;  2ZFW A;  5GAE J;  2ZBK A;  4U0Y A;  1HDP A;  1F4K A;  1V3F A;  1MIJ A;  5GTI C;  3DEE A;  2NRA C;  2F5V A;  4P9U A;  2EZL A;  5LEJ A;  2M1B A;  2DQR A;  3HSE A;  4ZDP A;  4BEH A;  1K6O A;  3JRC A;  2DYS H;  1RZ4 A;  2RV8 A;  1J0R A;  4G6D A;  4AVP A;  4ZZD A;  3HJE A;  4UY8 I;  4JP0 A;  1ZQ3 P;  2A6T A;  1EH7 A;  3K69 A;  5GAH J;  3IL2 A;  3DTE A;  4U87 A;  1MBF A;  3ZQF A;  5LGU A;  2FBI A;  4UVA A;  2ELK A;  3VYU B;  1LE8 B;  2L9S A;  2DFE A;  3AL0 C;  4LK1 F;  1WCM J;  3ZQ7 A;  3ZN0 A;  3MFK A;  3BY6 A;  1FZP B;  1R71 A;  5DDG A;  3CP2 A;  4Y15 A;  3ZRG A;  1LQ1 A;  4IQ4 A;  4OAY A;  1ETO A;  4N4N B;  1DP3 A;  2A07 F;  3L2U A;  1XGS A;  2HGC A;  3KP3 A;  2E1M C;  2RAE A;  1P9Q C;  3DF8 A;  3HBL A;  1RET A;  2HVQ A;  3CP8 A;  1SFE A;  2Q8K A;  1P4X A;  3TO9 A;  2STT A;  2DA1 A;  4IJA A;  4BHP A;  2E2J J;  2OTJ I;  1FBU A;  1WJC A;  2X1E A;  2JVH A;  2BW3 B;  4BS9 A;  3LQR A;  3IWZ A;  1OMI A;  4I98 B;  4UB6 C;  4Y33 A;  1WPK A;  2AQF A;  3OS2 A;  1DQU A;  1BIA A;  3ZPL A;  2QM3 A;  2A68 F;  3GLX A;  4ASN A;  1SD5 A;  4RGX A;  5C4X J;  1N78 A;  1FT9 A;  4B8X A;  1X3U A;  1KU9 A;  1JUM A;  4DZJ A;  5FKO A;  1H9G A;  4I6Z A;  4IPA A;  1WJF A;  4F92 B;  1FEX A;  5J4V A;  2FBK A;  3PQJ A;  5HDK A;  3FK6 A;  1K4T A;  3FXQ A;  1WKM A;  2JPC A;  1RRJ A;  4KN4 X;  4S05 A;  2H94 A;  4IOA F;  2BV6 A;  2E71 A;  2KL4 A;  4PJM A;  5HVQ C;  2KKO A;  4NDL A;  3DCF A;  4IHX A;  3MD2 A;  4RS8 A;  2ZXJ A;  3BG7 A;  2WAF A;  4II3 A;  1Y1V J;  2F4M B;  1AKH B;  2GIV A;  2NVX J;  4L18 B;  5CQE A;  4WWC A;  3H5R A;  5E1X A;  2BY0 A;  1MSF C;  4XON A;  2FBH A;  2EIL H;  2GA1 A;  1SAU A;  2VLA A;  4BGD A;  3L2W A;  1NG7 A;  3K4L A;  1VQM I;  4UB8 C;  3SEZ A;  5L3E A;  4ZH4 F;  3F6V A;  5BMZ A;  2X6W A;  3GYH X;  1GT0 C;  2OCC H;  4EM0 B;  1EV7 A;  1X1C A;  3U21 A;  4PSW A;  2QEX I;  3CCS I;  4E70 A;  1HDD C;  1NG6 A;  4A0X A;  3QYB A;  4XOP A;  1QVU A;  1X2N A;  3HYI A;  5DCM B;  3CJT B;  1S7E A;  2FD5 A;  1YO5 C;  1DDN A;  2RQP A;  3BQY A;  1DUX C;  2ZCW A;  2RQQ A;  2VOD A;  4YFK F;  2XPU A;  2V1U A;  3OYF A;  2XVC A;  1BBY A;  5HS9 A;  1GDT A;  4BBR J;  3A0H C;  2LNB A;  1B1B A;  2YX7 A;  4DGW B;  1FOK A;  1MJA A;  2DK8 A;  2R7R A;  1PVE A;  3L2V A;  4Y17 A;  3S3O A;  4ZTJ A;  1ZG3 A;  2L3D A;  3L1P A;  1R6R A;  2E1C A;  3JRD A;  4GYI A;  1MDM A;  1JJ6 C;  2BXY A;  3HGY A;  2CV1 A;  1FIA A;  2DMP A;  2M87 A;  3OSF A;  2Z16 A;  4HDV A;  2NAZ A;  3DWL E;  5F6F A;  2KQR A;  4G94 A;  3WG9 A;  1R7J A;  5DM7 F;  2XV4 S;  1XGO A;  1JGG A;  1S7A A;  1RPW A;  2VC1 A;  5TIS C;  4EV0 A;  1YX5 A;  3E3V A;  2XPV A;  1JTY A;  4IZZ A;  2HOE A;  3MKL A;  2K4J A;  3J81 Z;  1OJL A;  5M5W J;  2ESN A;  2B63 J;  2R5Y A;  2BY3 A;  4FET A;  4NC7 A;  3TOA A;  5BNG A;  5K5O A;  3QP6 A;  1VQL I;  3DBH B;  3RDI A;  4HX7 A;  5E1W A;  4PFO A;  4I02 A;  2MA3 A;  3OIQ A;  2FMY A;  2AS5 F;  2IS2 A;  1OPC A;  2EBI A;  3TO6 A;  1VQ6 I;  2ETH A;  2M5W A;  2R7U A;  1EKE A;  2BVL A;  3C2B A;  4GRI A;  1BA5 A;  3VWB A;  1G3S A;  1UHS A;  2L7Z A;  2NS7 A;  2O3F A;  5FB2 A;  1Z67 A;  1YS7 A;  3DBL B;  2D2W A;  2WV0 A;  3J7Z I;  3KEQ A;  5M5X J;  1U5T B;  3PO2 J;  1YTY A;  2QSH X;  2IGM A;  3IRR A;  3K70 D;  2DOF A;  1SD6 A;  2R92 J;  2M9H A;  5DTD A;  1D1A A;  4KMF A;  3SYT A;  2CG4 A;  1VFC A;  2BZT A;  1Z91 A;  1BN5 A;  2QKM B;  3LMM A;  1X1A A;  4CCM A;  3JTH A;  2AO9 A;  4XLE A;  2ID3 A;  2XAJ A;  1K4S A;  4H0E A;  3C3W A;  2E2H J;  3ZMT A;  5HOD A;  2M7A A;  1VQ8 I;  1XGN A;  3ZR8 X;  3FWE A;  3F21 A;  1VQ9 I;  5DUK A;  5JLW A;  5IP6 A;  1B72 A;  3A01 B;  2NNY A;  2DOE A;  1BI1 A;  3FXR A;  3HPH A;  2L7F P;  2XGE A;  5L3B A;  1ORK A;  1FSE A;  2JA8 J;  3K0L A;  4RAF A;  1OQY A;  1SVM A;  3AG4 H;  3B02 A;  3WTS C;  2XRO A;  2ZJR F;  4JK1 X;  3HOX J;  4A5N A;  1ZRF A;  3BR6 A;  1YQA A;  1L0O C;  2ZJ2 A;  3L9F A;  4FQG A;  5FJ8 J;  4MTE A;  3VYR B;  4D1Q A;  4AM3 A;  2K3F A;  1MBK A;  2QA4 I;  3WU2 C;  2R0Q C;  1IRF A;  1JI8 A;  1X4P A;  2V6C A;  5FD5 A;  1U9O A;  1TW3 A;  2XF6 A;  4KIS A;  3GME A;  1M1E B;  2A69 F;  3F3X A;  1D1C A;  1G6N A;  1KQ0 A;  1ETV A;  4MQV A;  3RSN A;  3HRS A;  3A2K A;  1UST A;  2Y31 A;  2QQ9 A;  4RA2 A;  3LSH A;  2DYR H;  2O8K A;  4X0G A;  3FIS A;  5IT9 Z;  2VKV A;  5E18 F;  3N4M A;  5IYD J;  3GFL A;  2RC4 A;  1BR4 A;  2VC0 A;  1ZRC A;  1I27 A;  1PDN C;  1D8J A;  5J1R A;  2FF4 A;  1XMA A;  3OL3 A;  2QGU A;  1FYL A;  4A3D J;  2I10 A;  3WE2 A;  5EEH A;  4DYC A;  2O7O A;  1W7P D;  1OYW A;  2ZC2 A;  1TWF J;  3MAJ A;  2EIK H;  4OOI A;  3BLY A;  3OYK A;  2LLK A;  2X6X A;  3LAJ A;  4FTH A;  2OF7 A;  3WOD F;  5K5Q A;  1B6A A;  4RAY A;  2R93 J;  1GXQ A;  3WG7 H;  2GXB A;  2YU3 A;  4A3C J;  1VQ5 I;  1UMQ A;  2O03 A;  2WAE A;  2X6Y A;  3CJR B;  3KFW X;  5FGM A;  1I3A A;  5LLQ A;  4IRI A;  2VJJ A;  2P5K A;  2M34 A;  3OWT A;  1IW7 F;  3KLN A;  2LFB A;  4ZDO A;  4O3M A;  3ZMZ A;  4A3F J;  5D8L B;  1LDK B;  1O4X A;  1ETK A;  2QZ8 A;  3ZGK A;  2GXA A;  3HTS B;  1GLN A;  1U3E M;  2B7E A;  2XGD A;  4RB1 A;  1T98 A;  2CQK A;  3BZ6 A;  4G7Z F;  1FSH A;  1LE8 A;  5J47 A;  3TW7 A;  1ETY A;  4A3E J;  3RQ4 A;  3DTI A;  2XKP A;  4FE4 A;  2E2I J;  1QHG A;  1K61 A;  3HM5 A;  5ILV A;  1WJ5 A;  4F91 B;  1WGX A;  5KK1 A;  4RM2 A;  1UAA A;  2P4W A;  5CLS A;  1W5C C;  2FOK A;  1RKT A;  4E7L A;  4G6Q A;  1WRJ A;  2FQ3 A;  1IRX A;  4YRV A;  1GHC A;  3OV8 A;  3KYD B;  1LUJ B;  3JRF A;  3KCC A;  3QOP A;  3T1B A;  4ZYG A;  1TQI A;  2JSC A;  3IRQ A;  3L2C A;  2BW3 A;  1I1G A;  3V7S A;  5HLH A;  4YIF A;  1ITY A;  1D0Y A;  3WTZ A;  1IN4 A;  1YIO A;  3F6O A;  1WJA A;  2STW A;  2YU9 J;  4O5V A;  4Y52 J;  3HUG B;  1D0Z A;  1YW8 A;  3BJO A; 
#chains in the Genus database with same CATH homology
 2HFH A;  2PQ8 A;  1UHW A;  5AON A;  1JHH A;  4FX4 A;  1ZLJ A;  2XAH A;  3R0J A;  5E17 F;  2BBY A;  4MQ9 F;  1XDU A;  2BGC A;  1HSJ A;  4KFC A;  1G3Y A;  2HTS A;  2XAQ A;  1O3Q A;  4I0A A;  5JI6 A;  3AAF A;  3WTT C;  1U5T C;  1LNW A;  1OKR A;  1KYW A;  5KVR A;  4RGS A;  5L3D A;  3MQ0 A;  2CWE A;  3SXY A;  1T39 A;  1LEB A;  5F64 A;  1HXD A;  1XGM A;  1YYV A;  3QU6 A;  4RB3 C;  5DCM A;  4P55 A;  3C1D A;  2F5C A;  3M9A A;  4BAY A;  1J5Y A;  3MZH A;  1Q1H A;  4ZYH A;  3BPX A;  3MWM A;  4BXU A;  1WQ2 A;  5H6R A;  2DO7 A;  1S6L A;  3COA C;  4MGR A;  1RIO H;  2BEO A;  3GWZ A;  4PZJ A;  1FC3 A;  2AXL A;  4A2U A;  4U0W A;  4L9N A;  3TDU C;  2V79 A;  2PBI A;  4YFN F;  2FXA A;  3R0A A;  3RKY A;  3L7W A;  1ZN2 A;  2Z9O A;  3JSO A;  3BOQ A;  5J8F A;  3SFZ A;  1HKS A;  2PMH A;  3KZZ A;  4ENN A;  1EH8 A;  1YFH A;  3V4G A;  4Z2Y A;  2PJP A;  3FF5 A;  5FFZ A;  1TNT A;  5EEG A;  5E1Z B;  3BPV A;  3WE3 A;  2R7D A;  1YW9 A;  1S3J A;  3VOD A;  2FNA A;  1SD4 A;  3PFI A;  4CYD A;  5BOX A;  1XSV A;  4PDK A;  3O6B B;  4OIP F;  4GCV A;  3F8B A;  3GFM A;  4WXD A;  4K2E A;  4PGH A;  3SZP A;  3EUH A;  1TQP A;  1W5S A;  1GVJ A;  4S04 A;  5ED4 A;  2HR3 A;  1JE8 A;  1R23 A;  3ZMS A;  3LWF A;  1LDJ A;  1USS A;  2OQG A;  1ONV A;  4HQE A;  1FYK A;  2JT1 A;  2BYV E;  4OMY A;  1JGS A;  5H6Q A;  3KZY A;  4M72 A;  3RPQ A;  2P6S A;  1JXS A;  1RUN A;  3CLO A;  2EV0 A;  4FT8 A;  3U2R A;  1G3T A;  3HRM A;  4UUV A;  4IVN A;  4ZYD A;  2VBY A;  4BYY A;  3BJ6 A;  1R00 A;  2MLG A;  1VTN C;  1Z7U A;  2DTR A;  1IN5 A;  3KP2 A;  4WXH A;  4F7Z A;  4LMY A;  2XGX A;  4KIF A;  3RIR A;  2QYO A;  2VXZ A;  2G9W A;  3WGI A;  4L0Y B;  1MD0 A;  1I5Z A;  1OYY A;  4I7H A;  1SMT A;  3FZV A;  4M74 A;  3I5U A;  1U2W A;  3F8M A;  4GYG A;  1FPQ A;  2W24 A;  2RDP A;  3V7C A;  2CGP A;  2UXN A;  2TDX A;  1KQ8 A;  1E2X A;  1ZAR A;  4KA4 A;  1U8R A;  2E7X A;  5CVU A;  3J81 K;  2B0L A;  1LDD A;  3ML6 A;  1AOY A;  3RJP A;  2H27 A;  4UXN A;  2MBF A;  2C6Y A;  2DFI A;  2JRT A;  2LF8 A;  2KJB A;  1ZYR F;  4AIH A;  4HBL A;  2MH9 A;  4RGU A;  3EET A;  4MHG A;  3N97 A;  3DEU A;  1XD7 A;  1MKM A;  4P96 A;  1SFU A;  3HUG A;  3I64 A;  2A3S A;  1ZG1 A;  3M7G A;  3FX3 A;  1DPU A;  1QO0 D;  3E6M A;  1HKQ A;  4GGG A;  2Y48 A;  2ISZ A;  3G73 A;  5TJJ A;  1J59 A;  2EFP A;  4ETS A;  4NHJ A;  2O8X A;  2Z3Y A;  1Z6R A;  3KET A;  3H92 A;  1XN7 A;  3RPU A;  5DUI A;  5ICE A;  2XAF A;  4A0Z A;  1A04 A;  2ACJ A;  4Q48 A;  1KYZ A;  1ZH5 A;  1FBQ A;  3ZMU A;  2D45 A;  2ADU A;  1BC8 C;  3K1M A;  4I0B A;  3FMR A;  2NS0 A;  3G3Z A;  5JVT A;  1BI2 A;  3ZMD A;  5ILU A;  2P8T A;  3BRO A;  4LG0 B;  3RYR A;  3ISP A;  5IT9 K;  2Q2E A;  5F1R A;  5HLG A;  3CO6 C;  3EYI A;  4LB5 A;  2VT3 A;  5DYM A;  5HDN A;  4MNU A;  2EB7 A;  4IXA A;  3WTY C;  2OAZ A;  4ENM A;  2P7C B;  1FNN A;  1ZRD A;  1FP1 D;  5L3G A;  1R1U A;  4M73 A;  2K02 A;  4M6Y A;  2COM A;  2EJR A;  3WU1 B;  1IUY A;  1FYM A;  1D5V A;  2GZW A;  3Q5F A;  2KIF A;  1MGT A;  4L5J A;  3F72 A;  1F5T A;  3RYP A;  1TQM A;  2F5D A;  4JBA A;  2IW5 A;  5IT3 A;  3E6C C;  3E97 A;  2XAS A;  1R1V A;  5ICG A;  4WF2 A;  1JHF A;  3I4P A;  4LK0 F;  5LGT A;  4BHB A;  3J80 K;  2H6C A;  2YPR A;  1ON1 A;  3H3Z A;  4EGY A;  2MC3 A;  3HTU A;  5DCF A;  2EFN A;  2DK5 A;  2XUB A;  4HF1 A;  3GW2 A;  2GQQ A;  1Z9C A;  3ULQ B;  4Q47 A;  3MCZ A;  3NQO A;  4KMU X;  4RB2 C;  1YW7 A;  1FWZ A;  2P6T A;  2X0L A;  3H3U A;  5HLI A;  2L54 A;  2H09 A;  5ERI A;  1IF1 A;  3DP7 A;  4KYW A;  2P7V B;  2L4A A;  1ON2 A;  3SZT A;  4LJZ F;  1O7F A;  1TW2 A;  4A6E A;  2O61 A;  1T2K A;  5HOO A;  4YG2 F;  5FLX K;  2W25 A;  2HQN A;  2EV6 A;  3L00 A;  4AWX B;  3R60 A;  2OQR A;  1Z05 A;  4GO1 A;  3ZP5 A;  4I01 A;  1QBJ A;  1WSU A;  3L09 A;  4EQQ A;  2YX4 A;  4HAM A;  4EM2 A;  4FX0 A;  1SMY F;  3BWG A;  3O3K A;  3W6K B;  3RKX A;  1J75 A;  3VB2 A;  3IHU A;  3DPL C;  2K86 A;  2UZK A;  4WXC A;  1G3W A;  1XCV A;  2W57 A;  1LJ9 A;  3P7N A;  5JHU A;  5H20 A;  3LAP A;  3F22 A;  3GX4 X;  2VE8 A;  1UFM A;  3HHH A;  2VBX A;  1HW1 A;  3QAH A;  1F9N A;  1Y0U A;  2HS5 A;  4IRH A;  3KP6 A;  3J80 Z;  1B9M A;  2J5O A;  4ESB A;  4B09 A;  2V1D A;  2HQR A;  4OIN F;  1R22 A;  3BJA A;  2IVM A;  1UB9 A;  1KA8 A;  2PG4 A;  4ZZL A;  5DD8 A;  3ZMV A;  2XHK A;  2HKX A;  3NRV A;  3I59 A;  2IT0 A;  2IRF G;  3LA2 A;  5D6E A;  2Y0M A;  4R1H A;  5ICC A;  2OZ6 A;  3E5X A;  4LG0 A;  4Y13 A;  4EVI A;  4MEX F;  4DQ2 A;  1R58 A;  2HTJ A;  2K27 A;  3LA7 A;  3WTV C;  4HLX A;  4FHT A;  3I71 A;  2HYG D;  4BQA A;  3M8E A;  1BOA A;  4HLY A;  5D4S A;  3WTX C;  1ULY A;  3LST A;  5BQT A;  3T8T A;  1BI3 A;  1ZG5 A;  4EJT A;  1WI9 A;  1ZHF A;  3KEO A;  1UHM A;  3RI4 A;  5FLX Z;  4G8X A;  3JSP A;  2WC2 A;  5LHH A;  2D1V A;  3P9K A;  4KUM A;  2XRN A;  4HYE A;  2XKO A;  5FFX A;  3LQQ A;  4M9X A;  3D0S A;  4KIC A;  3F8F A;  5DD4 A;  4ON0 A;  4HF2 A;  4CDG A;  1IXS B;  2PFB A;  1HW2 A;  1W4M A;  4UV9 A;  4IRG A;  3CDH A;  2P5V A;  4A0Y A;  4G9Y A;  5D8K B;  3R4K A;  4Q5S F;  2EWN A;  4EGZ A;  3TQN A;  3U1D A;  1XSX A;  2Y75 A;  4HDU A;  2HWV A;  2PEX A;  3FHZ A;  1Z6T A;  2WTE A;  3KP7 A;  4KT5 C;  2YR2 A;  3IC7 A;  3T5X A;  2KIU A;  1HST A;  2QVO A;  3IKT A;  1EH6 A;  1PP7 U;  3MEX A;  1MJ9 A;  2M8E A;  2MD5 A;  3O2P E;  1H9T A;  4JQF A;  3KE2 A;  4AD9 A;  2QQA A;  1NHA A;  2LF7 A;  2ZME A;  1O7L A;  5DEQ A;  1UCR A;  3TGN A;  4QWQ A;  3W6J B;  3E5U A;  1H0M A;  4XBF A;  3ABT A;  3DV8 A;  1TTY A;  2ESH A;  4EM1 A;  2ZKZ A;  4YFX F;  4EJO A;  1Z1D A;  2RGV A;  2OU2 A;  1QGP A;  1BM9 A;  2X4H A;  4XRF A;  1S29 A;  1ZAO A;  4L0Z B;  3OOP A;  2NYX A;  1TLH B;  3CUQ B;  3JTG A;  4QLC U;  4OIO F;  5E8I A;  2IA0 A;  2R3S A;  1K7A A;  2F5E A;  3HIF A;  5HS7 A;  1J9I A;  3HSR A;  3WGG A;  1BJA A;  2FSW A;  1KGS A;  1IN7 A;  2O0Y A;  3WGH A;  1T0F A;  1YS6 A;  1YLF A;  3LA3 A;  3DXJ F;  2P5L C;  4I2O A;  1K78 B;  2OZU A;  4U7D A;  1O57 A;  5BPI A;  3Q9S A;  4LGW A;  4D0P A;  5BS6 A;  2VBW A;  1QZY A;  5D4R A;  2VBZ A;  5LRR A;  4LLL A;  2KRF A;  2FEZ A;  3LFK A;  2W85 A;  2L4M A;  2PN6 A;  2M30 A;  4ESJ A;  5K5R A;  2FA5 A;  1PUE E;  4LD5 A;  1B9N A;  3R6S A;  2L02 A;  3GUD A;  4O6J A;  5TRD A;  1LVA A;  4EJW A;  2IA1 A;  2YSR A;  3I58 A;  1HKT A;  3K2Z A;  3E5Q A;  2CO5 A;  4YII A;  3I54 A;  5AIQ A;  5BPD A;  1T38 A;  5E8G A;  5JR3 A;  3BDD A;  4OIQ F;  1G4D A;  4BNC A;  3GFJ A;  2M45 A;  3JW4 A;  1LB2 A;  1MZB A;  3RKW A;  2E1N A;  5LHG A;  1V4R A;  3QU3 A;  4U7B A;  3I59 B;  4UV8 A;  2VOP A;  1P4A A;  2J5P A;  2MLK A;  4TV7 A;  3Q9V A;  1ZGJ A;  1K79 A;  5JFR A;  1DPR A;  5CVI A;  1AWC A;  1U6G A;  1TNS A;  3VOE A;  1FY7 A;  3C18 A;  1CF7 B;  5ICF A;  3TKY A;  1ZLK A;  4L9J A;  3V8J A;  3WTU C;  2PLY A;  2PI0 A;  1ZRE A;  2W84 A;  3F8N A;  4M9Z A;  3FM5 A;  2QBY B;  4WX9 A;  6PAX A;  4GXO A;  2NNN A;  1REP C;  3DQV C;  4L5I A;  2DPU A;  5L3F A;  4PGG A;  3VEP A;  2R7F A;  1W5T A;  4DNC A;  2PMU A;  3KP4 A;  1SD7 A;  5CYV A;  4OIR F;  1B59 A;  3SHF A;  3B73 A;  3CUQ C;  3IWF A;  5AIP A;  2LSO A;  3CJN A;  2F2E A;  2DW4 A;  3GZ6 A;  2V1X A;  3EQL F;  2DQL A;  4NQW A;  2EK5 A;  1R36 A;  3T8R A;  4G7O F;  4HF0 A;  2IP2 A;  3P9C A;  5HDG A;  2Z5U A;  2GWR A;  2EA2 A;  3T0Y A;  4OMZ A;  2F5F A;  2A6E F;  2FU4 A;  4M9S A;  2VON A;  2ZO4 A;  1QNT A;  2XAG A;  3DPT A;  2RNJ A;  4CO8 A;  4A12 A;  5J6X A;  2Q0O A;  3HOS A;  4CHU A;  2EFW A;  3SQN A;  4N9I A;  2A6H F;  2ZME B;  1IXC A;  3J7A O;  1QPM A;  2FRH A;  3ECO A;  4NB5 A;  4UVC A;  3IKV A;  1J7K A;  4A6D A;  1R1T A;  1BC7 C;  1DP7 P;  3FXU A;  1O3S A;  1RUO A;  1P2F A;  2ZNZ A;  3ROU A;  2A61 A;  2JZY A;  2H6B A;  1XDS A;  4RB0 A;  2RVC A;  2VN2 A;  5CVV A;  1O3R A;  2UXX A;  3TOB A;  4LLG F;  3CUQ A;  4OU0 A;  3WTW C;  2HEO A;  3EDP A;  3F23 A;  2QWW A;  1IZ1 A;  1F1Z A;  5DV5 A;  2JTV A;  4XLP F;  2HDC A;  2QUF A;  4UHT A;  5L3C A;  5FO5 A;  3QP5 A;  1STZ A;  3PQK A;  1XCB A;  4HA8 A;  1SAX A;  4M71 A;  1P6R A;  2LKP A;  4HX8 A;  2QLZ A;  1K78 A;  4ENK A;  4ESF A;  2VE9 A;  1W7P B;  1QQI A;  3V8L A;  3NEU A;  4LLN A;  3HHG A;  3CUO A;  3I0T A;  4MTD A;  4CGZ A;  1BIB A;  2QQB A;  3ELK A;  2IJL A;  1IRG A;  5D5W B;  1GXP A;  4CZZ A;  1ODD A;  4A5M A;  1XSD A;  1KU2 A;  1YG2 A;  3BP8 A;  3V7R A;  4N9H A;  4KIB A;  1L3L A;  3MZY A;  2K7L A;  3V8K A;  2DT5 A;  4G7H F;  2D1H A;  1FBS A;  1S7O A;  2G7H A;  2EV5 A;  4ENJ A;  3M8F A;  4XSX F;  4AIK A;  4WCG A;  4L9V A;  3QRF F;  2DBB A;  2A5Y B;  5CVJ A;  2ISY A;  1SFX A;  2E7W A;  5LGN A;  4I09 A;  5LHI A;  3ABU A;  1P4W A;  2O6G E;  2DU9 A;  3QPH A;  1KU7 A;  1KQ9 A;  2DLL A;  4KDP A;  3GEZ A;  2CYY A;  1LEA A;  2OA4 A;  5K1Y A;  2QEN A;  2XIG A;  1FP2 A;  3CTA A;  3E6D A;  5CJ9 A;  4XSZ F;  5D5U B;  3CO7 C;  2OD5 A;  3GO5 A;  3JAM K;  3GXO A;  3QPT A;  1XB4 A;  2IPQ X;  3TDZ C;  4P5O A;  1CF7 A;  4Q4Z F;  4IF4 A;  2RKH A;  3FM3 A;  2DAO A;  1D3Y A;  3P9I A;  4HW0 A;  2GAU A;  2HZT A;  1HQC A;  4N0B A;  4HV6 A;  2UWM A;  1MJB A;  4P9F A;  5A2Q K;  2QBY A;  3HRU A;  1HW5 A;  1FX7 A;  4EMS A;  2GXG A;  3ECH A;  4ZYE A;  1R5G A;  1CGP A;  4KN7 X;  1T6S A;  1S8N A;  3F8C A;  4AIJ A;  3REO A;  3WU0 A;  4BH9 A;  2VOO A;  4UVB A;  1WWX A;  2G7U A;  5D5V B;  2BE5 F;  2CFX A;  3C7J A;  3FMS A;  3RTR A;  5LBQ A;  3VFZ A;  2EFQ A;  4EJV A;  2FE3 A;  1MDM B;  3TO7 A;  3KP5 A;  3HSF A;  3M1E A;  3HOT A;  1I6X A;  2EA4 A;  5J8C A;  2K4B A;  2ELH A;  1IN8 A;  1HBX G;  2LDU A;  3GVA A;  2IA2 A;  1J2X A;  4CXF A;  2DPD A;  1O3T A;  4RGR A;  3R61 A;  1B4A A;  4WK8 F;  3ZN1 A;  4HV5 A;  1OR7 A;  3S2W A;  2Z99 A;  3D5L A;  4R8H A;  4RAZ A;  2KJC A;  5E20 A;  2GA2 A;  1U5T A;  2Z33 A;  2EFO A;  1I1S A;  4PCQ A;  5CVR A;  3GF2 A;  4KIG A;  4LB6 B;  1PP8 F;  5LRS A;  1ZGA A;  4KNY A;  5D6F A;  2FML A;  3DKW A;  4U0V A;  4U88 A;  1BI0 A;  3I53 A;  2JPB A;  2VT2 A;  4HOB A;  4M6X A;  5ILS A;  3ERE D;  3E6B A;  3K9T A;  5FD6 A;  3GFI A;  2L01 A;  1D8K A;  5HS8 A;  2CSO A;  1TBX A;  4HQM A;  3K1N A;  4HZF A;  1P92 A;  1QZZ A;  3K1P A;  3JAM Z;  2CW0 F;  4XLN F;  2MH2 A;  1RNL A;  4IHT A;  3FMQ A;  1IN6 A;  3DFG A;  3KLO A;  4L9T A;  2HYF A;  5D5X B;  1C0W A;  1E17 A;  2HKO A;  1U78 A;  1OYI A;  4UNO A;  5A2Q Z;  1IAW A;  2FNP A;  4CIC A;  2DI3 A;  4R79 A;  1W7P A;  1RI7 A;  4MEY F;  1KU3 A;  4HX4 A;  3HRT A;  4EJU A;  3GZ5 A;  2WWY A;  3EYY A;  1IXR C;  2RN7 A;  4LFU A;  4BHC A;  1R5H A;  2V9V A;  1XMK A;  2KIM A;  2ZNY A;  5LEK A;  1FLI A;  2OBP A;  4IHS A;  2ZFW A;  2ZBK A;  4U0Y A;  1F4K A;  1V3F A;  2NRA C;  4P9U A;  5LEJ A;  2M1B A;  2DQR A;  3HSE A;  1K6O A;  1RZ4 A;  2RV8 A;  1J0R A;  4G6D A;  4AVP A;  4ZZD A;  1EH7 A;  3K69 A;  3IL2 A;  5LGU A;  2FBI A;  4UVA A;  4LK1 F;  3ZQ7 A;  3ZN0 A;  3MFK A;  3BY6 A;  1FZP B;  5DDG A;  4Y15 A;  1LQ1 A;  2A07 F;  1XGS A;  2HGC A;  3KP3 A;  3DF8 A;  2Q8K A;  1SFE A;  1P4X A;  3TO9 A;  2STT A;  4IJA A;  4BHP A;  1FBU A;  3LQR A;  3IWZ A;  1OMI A;  4I98 B;  1BIA A;  3ZPL A;  2QM3 A;  2A68 F;  3GLX A;  4ASN A;  1SD5 A;  4RGX A;  1YW8 A;  1FT9 A;  4B8X A;  1X3U A;  1KU9 A;  1H9G A;  4IPA A;  2FBK A;  3PQJ A;  5HDK A;  3FXQ A;  1WKM A;  2JPC A;  4KN4 X;  4S05 A;  2H94 A;  2BV6 A;  5HVQ C;  2KKO A;  4RS8 A;  2ZXJ A;  4L18 B;  2GIV A;  4WWC A;  5E1X A;  2FBH A;  2GA1 A;  5L3E A;  4ZH4 F;  3F6V A;  5BMZ A;  3GYH X;  4EM0 B;  1EV7 A;  4E70 A;  4A0X A;  3HYI A;  5DCM B;  1YO5 C;  1DDN A;  2RQP A;  1DUX C;  2ZCW A;  2VOD A;  4YFK F;  2V1U A;  2XVC A;  1BBY A;  5HS9 A;  2LNB A;  1B1B A;  2YX7 A;  1FOK A;  1MJA A;  2DK8 A;  4Y17 A;  1ZG3 A;  2L3D A;  2E1C A;  4GYI A;  1MDM A;  2M87 A;  4HDV A;  2NAZ A;  5F6F A;  4G94 A;  3WG9 A;  1R7J A;  2XV4 S;  1XGO A;  1S7A A;  2VC1 A;  4EV0 A;  3E3V A;  2HOE A;  2K4J A;  3J81 Z;  2ESN A;  3TOA A;  5K5O A;  3QP6 A;  3RDI A;  4HX7 A;  5E1W A;  4I02 A;  2MA3 A;  2FMY A;  2AS5 F;  1OPC A;  3TO6 A;  2ETH A;  2M5W A;  1G3S A;  2O3F A;  5FB2 A;  1YS7 A;  2D2W A;  2WV0 A;  3KEQ A;  1U5T B;  1YTY A;  3IRR A;  1SD6 A;  4KMF A;  2CG4 A;  1Z91 A;  1BN5 A;  3JTH A;  2XAJ A;  4H0E A;  3C3W A;  3ZMT A;  1XGN A;  3FWE A;  3F21 A;  5DUK A;  2NNY A;  1BI1 A;  3FXR A;  5L3B A;  1FSE A;  3K0L A;  3WTS C;  2XRO A;  3B02 A;  4JK1 X;  4A5N A;  1ZRF A;  1YQA A;  1L0O C;  2ZJ2 A;  3L9F A;  4MTE A;  1IRF A;  2V6C A;  5FD5 A;  1TW3 A;  2A69 F;  3F3X A;  1G6N A;  1KQ0 A;  4MQV A;  3HRS A;  1UST A;  2QQ9 A;  5IT9 Z;  5E18 F;  3N4M A;  3GFL A;  2RC4 A;  2VC0 A;  1ZRC A;  1D8J A;  1I27 A;  1PDN C;  2FF4 A;  1XMA A;  1FYL A;  3WE2 A;  5EEH A;  1W7P D;  1OYW A;  3MAJ A;  4OOI A;  3LAJ A;  3WOD F;  5K5Q A;  1B6A A;  4RAY A;  1GXQ A;  2GXB A;  2YU3 A;  2O03 A;  5FGM A;  3KFW X;  5LLQ A;  4IRI A;  2P5K A;  1IW7 F;  3KLN A;  4O3M A;  3ZMZ A;  5D8L B;  1LDK B;  2QZ8 A;  3HTS B;  1U3E M;  4RB1 A;  1T98 A;  2CQK A;  3BZ6 A;  4G7Z F;  1FSH A;  2XKP A;  5ILV A;  5KK1 A;  2P4W A;  5CLS A;  2FOK A;  4G6Q A;  1WRJ A;  2FQ3 A;  1GHC A;  3OV8 A;  3KCC A;  3QOP A;  3T1B A;  4ZYG A;  1TQI A;  2JSC A;  3IRQ A;  3L2C A;  1I1G A;  3V7S A;  5HLH A;  4YIF A;  3WTZ A;  1IN4 A;  1YIO A;  3F6O A;  2STW A;  4O5V A;  3U9G A;  3BJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...