5DCMB

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
98
structure length
98
Chain Sequence
b'QELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQNDP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
total genus 30
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00072 Response_reg Response regulator receiver domain
B PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmB00
3RKXA 5HDGA 2H09A 4A5MA 2FSWA 3EYYA 2FXAA 3MCZA 2FF4A 2A6HF 2FA5A 3WU1B 3W6JB 2YR2A 4Q48A 2DPUA 1IXCA 2L01A 5K1YA 4AWXB 5LLQA 1FP2A 1ZGAA 3DV8A 1HSJA 4U7DA 3J80K 1G3YA 3T8TA 4DQ2A 3S2WA 4GYIA 4ASNA 3G3ZA 3ZMUA 2QM3A 3E6DA 1QZZA 2HTSA 2RNJA 4KIFA 1PP8F 4G7ZF 2OAZA 4BYYA 3BPXA 1BM9A 4BHBA 2NAZA 2LF7A 3MQ0A 1U3EM 1IN7A 5CVRA 3E6BA 2M30A 4M73A 2DPDA 4HV6A 2ZO4A 1ZGJA 2FEZA 2E1CA 3Q9SA 4LLNA 3F6VA 2DI3A 2RGVA 3I58A 4HOBA 4OIOF 5HOOA 4MNUA 2HKXA 1MDMA 4XLNF 2HYFA 4LD5A 4BXUA 3EUHA 2ZXJA 4PDKA 4MEYF 2VBWA 2VT2A 4LFUA 3V4GA 2W24A 4KUMA 4NHJA 1RUNA 2V79A 2BE5F 3TOAA 2EK5A 3I59A 4ESBA 3I0TA 2ACJA 1LDKB 3QP5A 4S05A 3ECHA 3ZMZA 2FBIA 3NRVA 2ZKZA 2IA1A 2HFHA 2EA4A 2V6CA 3REOA 3MZHA 4A0ZA 2HKOA 4EMSA 3FXQA 2DQRA 1O7LA 3ISPA 2Z3YA 5D8LB 1I1SA 4FX4A 2ETHA 4MTDA 2O61A 1E17A 2VOOA 3MWMA 1WWXA 2RC4A 4HLXA 4UHTA 1IN4A 1ZARA 2D45A 4UV9A 3O6BB 4OU0A 3E5XA 1ZN2A 4CICA 1KU3A 2FMLA 4L9JA 1MGTA 1JXSA 3SFZA 5FB2A 1XSXA 4L18B 5L3GA 3WGIA 2GQQA 2XHKA 2HGCA 4IHSA 2NYXA 2QQ9A 2GXGA 5CVIA 3FXRA 3RJPA 2DTRA 1KU2A 2VC0A 3F72A 4I0AA 3WTWC 3K0LA 4I01A 3E97A 2VOPA 4EM2A 1D8JA 1G4DA 1K79A 5L3FA 3IKTA 1ON2A 3EQLF 4NQWA 1FPQA 2FE3A 3FWEA 1KU9A 1FYLA 1OYYA 3L00A 3BROA 4OMZA 1ZRDA 4PCQA 5E8GA 1R36A 1Z9CA 3HSEA 3EYIA 1DPRA 4LK0F 2CYYA 2DK8A 3IL2A 4D0PA 5IT3A 3E3VA 3OOPA 5DCFA 3WTXC 1RI7A 1I5ZA 3K2ZA 2VONA 4EJUA 1B4AA 1W7PB 5KVRA 3GLXA 2EWNA 1YW9A 2XASA 2JSCA 1YO5C 1FOKA 2RKHA 1TW2A 1WRJA 2J5PA 1S7OA 2JZYA 1Q1HA 3ZP5A 3GO5A 4YFXF 4HF0A 1XN7A 1QPMA 3V7CA 1D8KA 4G7HF 2VBXA 2P4WA 2E7XA 1SMYF 3KZZA 1HKQA 2QQBA 4PGGA 3LAPA 2HQNA 1Z1DA 3WTUC 3HIFA 3LSTA 4MTEA 4BNCA 2MC3A 1S3JA 2V1XA 2STWA 1T39A 5D8KB 1WSUA 2RDPA 3GFMA 1R58A 1A04A 2DLLA 1I6XA 2QYOA 1KA8A 2GAUA 1GXQA 4HQMA 3HHGA 2ZFWA 2O3FA 2QLZA 5LEKA 3FZVA 3N4MA 5EEHA 2OQRA 2AS5F 1U6GA 2YX4A 2XVCA 3F6OA 1FWZA 2FBKA 4FX0A 3DPTA 3K1PA 5CJ9A 3KP7A 1BJAA 1SFXA 4IRHA 1OYWA 4F7ZA 4ZH4F 1MJ9A 5TJJA 4ESJA 2V9VA 1FC3A 5LGTA 1G3SA 4RB0A 1ZLKA 4AIJA 3KZYA 3KE2A 3WTZA 4RGUA 3ZMVA 2OA4A 4O3MA 5FGMA 3PQJA 3VEPA 5BMZA 1HKSA 2DU9A 2NS0A 1EV7A 4BHPA 1HW2A 2P5LC 5DD8A 3RKWA 1Z7UA 2CG4A 3TDUC 5D6FA 4XBFA 5ICGA 4Q5SF 2XAFA 1F5TA 4M74A 4BH9A 3WGGA 2D1HA 4A0XA 4CZZA 1STZA 1U8RA 3HUGA 2KIMA 2XAJA 2CGPA 5L3DA 1G6NA 3DEUA 1G3TA 2JRTA 1HQCA 2X4HA 3GZ5A 1LJ9A 2DQLA 1QGPA 4QWQA 4HX8A 2BV6A 2IA2A 1SFEA 3BJAA 4LLLA 4UNOA 5E1WA 3AAFA 2PG4A 3KLNA 2O03A 4K2EA 1SD5A 5HS9A 1XCBA 2XIGA 3WTSC 2Z5UA 2XROA 2O6GE 3WE3A 4KIBA 2P8TA 4LB6B 1MDMB 3R0JA 3RKYA 1J59A 2VBZA 2IP2A 4BAYA 5FFXA 1YW7A 4KMFA 1R22A 2F5FA 1IN5A 1FT9A 4LB5A 5H6QA 3I59B 4HLYA 4I0BA 3SXYA 3F8NA 1REPC 2W57A 1FYMA 2FRHA 5HVQC 4HZFA 4N0BA 2UZKA 3ML6A 5D5XB 4Z2YA 4EGYA 2GA2A 4RB1A 1XSDA 1XGOA 1R1TA 4UVBA 5HLIA 3R0AA 3GFIA 4KFCA 2OBPA 1V3FA 1MJBA 5LBQA 4OINF 2V1UA 2VXZA 1YYVA 4EM1A 2RN7A 5LGNA 5FD5A 4WCGA 5AIPA 4BQAA 4EM0B 1KU7A 3E6MA 3P9IA 2E7WA 2NRAC 4ZYDA 2JTVA 2XKOA 3ABTA 2NNNA 5CYVA 5D4RA 3R4KA 4ZYHA 2L4MA 1OR7A 2W84A 2LF8A 1YFHA 3IWFA 1KQ8A 1W4MA 2MH9A 3GYHX 4HF1A 2XAQA 2PQ8A 5F1RA 1LEBA 3TKYA 4RAYA 4WX9A 2Y0MA 4ENMA 3TO7A 2XV4S 2JPCA 4U88A 3IC7A 1T6SA 1Z05A 2CWEA 1L0OC 4GO1A 5ED4A 1SFUA 1C0WA 5HDKA 2Q2EA 3KLOA 2HOEA 1ZH5A 5DV5A 2CFXA 4XRFA 2AXLA 3BJ6A 1F1ZA 1TQPA 4YFKF 5JHUA 2EFOA 4U0VA 2UWMA 1TBXA 1IAWA 4GXOA 5CLSA 3JAMZ 3LQQA 4CHUA 1B9MA 3KP5A 5L3EA 5D5UB 4R8HA 4ZYGA 1BIBA 3HRUA 5A2QZ 2GZWA 2O0YA 2P7VB 5J6XA 1J5YA 2H6CA 4G6DA 3F3XA 3HRMA 4GYGA 4YFNF 4ENNA 4EJWA 2ISYA 4A12A 2EFQA 1SD7A 3HSFA 1SMTA 2G9WA 4G94A 2G7UA 3MEXA 5FLXK 4CDGA 1SAXA 1IXSB 1LEAA 2EFWA 1FSHA 1O3SA 5BPDA 2V1DA 2LNBA 1J75A 1DPUA 2HTJA 2L54A 3KEQA 4S04A 3ZMDA 3D5LA 2XRNA 5FO5A 1H0MA 5F64A 4U7BA 3WE2A 4RGXA 5LRSA 4EV0A 1IW7F 1J0RA 4AIKA 4M9XA 2EB7A 1R23A 4L5IA 1E2XA 2O8XA 4ZZLA 4HF2A 1B59A 1TQMA 2FQ3A 1XMAA 2K27A 1IF1A 1USSA 3P9KA 4TV7A 2BEOA 4EJOA 3L9FA 3CO7C 3C1DA 3ROUA 3DF8A 3WODF 4UVCA 3WTTC 2TDXA 1TLHB 3QRFF 3FMQA 3PQKA 1W5SA 2D1VA 2FOKA 1IN8A 3HHHA 1KYWA 2M87A 1IRFA 2VE8A 2G7HA 3E5UA 1J9IA 4LK1F 1LDJA 1CF7A 4I2OA 3DFGA 4IPAA 3KP2A 3IRRA 4IJAA 4IVNA 6PAXA 4M6XA 3BOQA 3RIRA 3L09A 3IHUA 1LQ1A 2VN2A 3I5UA 3SZTA 1JHHA 4IHTA 3ECOA 2ZJ2A 2MD5A 1ONVA 1DDNA 2OQGA 2M5WA 3KEOA 4MEXF 4MHGA 2WC2A 2OU2A 2J5OA 2CO5A 3LA2A 4KDPA 5E1ZB 1Z91A 3WTYC 4BHCA 4MQVA 3L2CA 4N9HA 4Y17A 3V7RA 1P2FA 4KICA 3I54A 3WTVC 4L0YB 1S8NA 2MA3A 4ENJA 2HEOA 2XKPA 1K78A 3I4PA 4ESFA 5ILSA 1HW5A 2PN6A 1MZBA 2X0LA 3J81Z 2MLKA 3CO6C 4EJTA 1FY7A 1FNNA 4B09A 1FSEA 1FLIA 3C18A 2XUBA 4CO8A 1DUXC 5E1XA 2YPRA 4LG0A 5AONA 2FMYA 4R79A 5LEJA 1FBSA 2EV6A 2PJPA 4MGRA 1D3YA 3B02A 4G7OF 1OMIA 5D5WB 1I1GA 3BZ6A 5JVTA 5BQTA 5ERIA 2A3SA 5CVUA 5H6RA 2IRFG 5FD6A 1NHAA 2K4BA 1YS7A 2QENA 4KN7X 2K86A 3CJNA 4PZJA 2PMHA 2WV0A 3JW4A 1DP7P 3EETA 1O3QA 3RI4A 3SZPA 1T38A 3TDZC 4HV5A 1BN5A 2RV8A 3C3WA 2WWYA 1O7FA 3TOBA 3QPHA 1PP7U 2ZNZA 1U2WA 3C7JA 2A07F 5E17F 4OMYA 3TO6A 4IRIA 1X3UA 4UVAA 1S6LA 4U0YA 2VC1A 4LGWA 2F5CA 3BJOA 1WQ2A 1FBQA 4DNCA 2HQRA 4P96A 3RYPA 3BY6A 3ZMTA 2A5YB 3ULQB 3W6KB 5HLGA 4WWCA 4R1HA 5CVJA 2CW0F 2EFPA 5LHGA 1I27A 1IRGA 2B0LA 5ICEA 3J7AO 5IT9K 4HYEA 4JBAA 2IPQX 4KN4X 2QQAA 3GFLA 4RS8A 1P4XA 1BC7C 4P5OA 1GHCA 3BDDA 3LWFA 2FNAA 2R7FA 3RTRA 1ZRCA 4A6DA 1UHWA 1U5TA 2PMUA 1YLFA 1RZ4A 3ERED 3FHZA 3IWZA 4L9TA 5BS6A 4JK1X 3JTHA 1QO0D 4HQEA 3F22A 4UV8A 5ILVA 1R7JA 2M45A 2A6EF 3BP8A 5AIQA 1TNTA 2A61A 4Y13A 5KK1A 1BI1A 1T2KA 2XAHA 4IRGA 3LA7A 1Z6TA 3R6SA 3K1MA 3VFZA 3TGNA 1XGMA 1ZHFA 5JI6A 3L7WA 4XLPF 3DXJF 1S29A 4XSZF 2KKOA 1UB9A 4I98B 2PEXA 4Q4ZF 1XDSA 1G3WA 5E8IA 2FBHA 1LDDA 2R7DA 4UUVA 4H0EA 3K69A 1D5VA 1BBYA 2ESNA 2GA1A 5HS8A 1XMKA 3B73A 2EV5A 2K02A 1ZG3A 3CUQC 4M72A 2EFNA 4ON0A 3F21A 2STTA 2KIFA 5D4SA 2OZUA 4RAZA 1ZG1A 1FZPB 4KA4A 4IXAA 2NNYA 2KRFA 2PFBA 3NQOA 2IT0A 2YSRA 2H94A 2DFIA 2W25A 3H3ZA 3JAMK 4N9IA 3LAJA 1S7AA 2DBBA 2Q0OA 2QZ8A 4EVIA 1O3TA 3TO9A 1FYKA 5DDGA 1XGSA 3H92A 2COMA 4L0ZB 1CF7B 3GXOA 2F5DA 1AOYA 5E18F 2XGXA 3RPQA 1KGSA 1TTYA 3V8LA 5D5VB 2L02A 4NB5A 2M8EA 5LGUA 4I09A 1XSVA 1SD6A 4OIQF 3E6CC 2EV0A 4KMUX 3QOPA 3ZPLA 4ZZDA 1J2XA 1ZRFA 2ZBKA 1RIOH 2L4AA 2H6BA 4A6EA 4CGZA 3ZN0A 2VE9A 1FP1D 1IZ1A 1JHFA 1O3RA 1P92A 1ON1A 5HDNA 2A68F 2FU4A 3WGHA 4KT5C 2IJLA 1K78B 1BC8C 1H9GA 2QBYA 5J8FA 2P5VA 4WF2A 4JQFA 2YU3A 1XD7A 1K6OA 1LB2A 4O6JA 1ZLJA 3HYIA 5BPIA 5DCMA 3HTSB 1OYIA 3COAC 5ICFA 4LG0B 3F8FA 3K1NA 3CUQA 2D2WA 3T0YA 3QU3A 3JSPA 4I02A 4AD9A 3V8KA 4PGHA 5K5RA 2WTEA 2HS5A 1HKTA 1RNLA 3JTGA 4Y15A 3J80Z 1BI0A 4AVPA 4RGSA 2K7LA 4RGRA 1EH6A 1ZAOA 3O2PE 5LHIA 1QZYA 3FX3A 2IVMA 3EDPA 1ZREA 2ADUA 4OOIA 3I71A 3VOEA 5DUIA 2MH2A 3MZYA 3CDHA 3ELKA 2H27A 2EJRA 2E1NA 1F4KA 1IN6A 1P6RA 4GGGA 2FNPA 2M1BA 4MQ9F 3BWGA 1K7AA 5FLXZ 2ZCWA 2R3SA 5DD4A 4P9FA 2Z33A 3F8CA 3RPUA 1VTNC 4EGZA 4KNYA 5L3BA 3GFJA 3MFKA 4RB3C 2BBYA 2ISZA 2XAGA 1KYZA 2RQPA 3J81K 1V4RA 3ZQ7A 1J7KA 4M71A 4P55A 2Y48A 4HDUA 3HTUA 3GX4X 1QQIA 2DT5A 2Y75A 2ZMEA 3H3UA 3E5QA 1BOAA 3ZN1A 2ELHA 3Q9VA 3NEUA 2LDUA 3M8EA 3O3KA 1MD0A 3HSRA 1TNSA 1R1UA 1YQAA 4M6YA 4ENKA 1KQ9A 2GIVA 1TW3A 3QPTA 1TQIA 5BOXA 3QP6A 1OKRA 3I64A 3R60A 1U5TB 3VODA 2Z99A 5H20A 4ZYEA 2Z9OA 4QLCU 2A69F 2ESHA 3BPVA 3LA3A 4KYWA 4YIIA 3FMSA 3U9GA 5LHHA 1FX7A 1UFMA 1B6AA 4CYDA 2PI0A 3RYRA 3F8MA 1BI3A 4I7HA 4HW0A 3V7SA 3QU6A 1R1VA 1YG2A 4HX4A 5CVVA 2VBYA 4A2UA 3OV8A 4EQQA 1BI2A 2DO7A 2F2EA 3T8RA 4WXCA 1ZG5A 5EEGA 3FF5A 3PFIA 1U5TC 3DP7A 1JE8A 4YIFA 4M9ZA 5DYMA 4HA8A 2HWVA 1B1BA 4HAMA 4E70A 2DK5A 3KCCA 3GF2A 4G6QA 2P7CB 3KP3A 4WK8F 4EJVA 3D0SA 3TQNA 3ABUA 1P4WA 2IW5A 1H9TA 4WXHA 3LQRA 3HRTA 5ILUA 1B9NA 3N97A 1IXRC 5HLHA 5HS7A 3T5XA 1MJAA 3M7GA 1EH7A 2JT1A 3K9TA 2CSOA 2MBFA 2VT3A 4HX7A 1ODDA 4AIHA 3FXUA 5DUKA 2GXBA 1HXDA 1Y0UA 1U78A 2K4JA 3V8JA 1XB4A 1ZYRF 2QUFA 1P4AA 4OIRF 2P5KA 1Z6RA 5K5QA 5ICCA 2PLYA 1UHMA 3DQVC 4LMYA 2HR3A 2DW4A 4HBLA 2P6TA 2CQKA 2LSOA 2F5EA 1WI9A 3I53A 2HDCA 4IF4A 3LFKA 3KP4A 5JFRA 1YS6A 4GCVA 1XDUA 1HBXG 1WKMA 2KJCA 1R00A 5J8CA 2YX7A 1XGNA 4WXDA 3CLOA 1O57A 1USTA 3RDIA 3F23A 5JR3A 2LKPA 3M9AA 5LRRA 2VODA 3ZMSA 5TRDA 1OPCA 1PDNC 2HZTA 1AWCA 4O5VA 4A5NA 4L9NA 4FT8A 1IUYA 3P7NA 4L5JA 3IKVA 2QBYB 2KJBA 4FHTA 1T0FA 3HRSA 2P6SA 4KIGA 2PBIA 5DCMB 1HSTA 1KQ0A 3GVAA 5E20A 3VB2A 3T1BA 4CXFA 3R61A 1W7PA 4YG2F 3QAHA 1SD4A 4LLGF 3CUQB 2GWRA 5DEQA 1QNTA 5FFZA 4OIPF 3GUDA 3G73A 3P9CA 2MLGA 3GWZA 1R5GA 3WG9A 1FBUA 4ETSA 5K5OA 3GEZA 2OZ6A 2IA0A 3KFWX 3HOTA 1F9NA 2W85A 4Q47A 3MAJA 1YW8A 1YTYA 1UCRA 5IT9Z 3DKWA 3FMRA 1ULYA 2UXXA 3SQNA 3IRQA 4HDVA 1EH8A 1R5HA 4XSXF 1JGSA 2EA2A 5D6EA 5L3CA 2UXNA 1GXPA 3KETA 1MKMA 4G8XA 3HOSA 4P9UA 1T98A 1YIOA 4LJZF 1BIAA 3FM5A 1LVAA 3U2RA 3SHFA 3M8FA 3CTAA 3GZ6A 4L9VA 5F6FA 4B8XA 1QBJA 3GW2A 2ZNYA 1L3LA 4G9YA 2HYGD 2L3DA 5A2QK 4UXNA 3JSOA 3WU0A 1RUOA 2JPBA 2QWWA 4M9SA 1PUEE 4RB2C 4A0YA 3DPLC 3CUOA 3FM3A 3Q5FA 3M1EA 3U1DA 2Q8KA 1CGPA 2QVOA 1HW1A 1XCVA 1W5TA 2KIUA 2DAOA 4U0WA 2ZMEB 2OD5A 2BYVE 3KP6A 1GVJA 3F8BA 2BGCA 2C6YA 1LNWA 2RVCA 1W7PD
chains in the Genus database with same CATH superfamily
2DN0A 3RKXA 1MW7A 5HDGA 1P9QC 2H09A 4A5MA 4GDFA 3BG3A 2FSWA 3EYYA 2FXAA 4DZPA 3UR3C 4HEA2 3MCZA 2FF4A 2A6HF 2FA5A 3WU1B 3W6JB 2YR2A 4Q48A 2DPUA 1IXCA 2L01A 1BA5A 4B3AA 5K1YA 2IS4A 4AWXB 1LKXA 5LLQA 3LSJA 4CYCA 4NNJA 4A3GJ 1FP2A 1ZGAA 1HOMA 2DOAA 2DCEA 4BS9A 1ETXA 2BVMA 3DV8A 1WJBA 2M4KA 4HG2A 1ITYA 1HSJA 4U7DA 1FMVA 3J80K 1G3YA 1YE9A 2E34A 5M5YJ 2CQNA 4JP0A 2JN6A 3T8TA 1WJCA 4DQ2A 3S2WA 5KNLA 1SANA 4GYIA 1FOWA 4ASNA 2M0MA 3G3ZA 3HZJA 3ZMUA 2LG4A 2Z2SB 2QM3A 3E6DA 2Z1DA 1QZZA 2HTSA 2HYJA 4BBRJ 2RNJA 3Q0WA 4KIFA 1D0XA 1PP8F 4G7ZF 2OAZA 1MNDA 3OYFA 4BYYA 2QCOA 2HVQA 3Q3SA 2H8RA 3GTGJ 3BPXA 4HSTA 1BM9A 2BW3B 1YX3A 3ZCOA 2VXDA 2NAZA 2LF7A 3DCFA 4BHBA 2IAIA 3MQ0A 1U3EM 1IN7A 5CVRA 5H2FC 2XPUA 3A2KA 1ZELA 2QGUA 3E6BA 4A3BJ 4E7LA 3OYEA 4DOZA 2M30A 1PJRA 3W2AA 3HKZN 4M73A 2DPDA 2DXIA 4HV6A 2ZC2A 2ZO4A 5IP6A 1ZGJA 1JKPC 3CMEI 1OCZH 4BQNA 4M3BA 2JUGA 1A31A 5KAFC 3RZDJ 1TWCJ 2FEZA 1JUPA 2E1CA 4PJMA 4RM2A 4D9JA 3BCBA 3Q9SA 4LLNA 3F6VA 2DI3A 2RGVA 3I58A 4HOBA 2W1OA 2K40A 4OIOF 5HOOA 1WZ2A 2IGMA 2DJNA 4MNUA 2LMDA 4X6AJ 2JWTA 3A02A 4HRIA 2HKXA 1MDMA 3DLLF 4XLNF 1D5YA 2HYFA 1BR4A 4LD5A 2R5ZB 2V4JC 4BXUA 3I4NJ 3G1LA 3EUHA 2ZXJA 4PDKA 1T33A 4MEYF 2VBWA 2VT2A 4LFUA 5FJ8J 3V4GA 2W24A 4KUMA 4XN0A 4E7ZA 4NHJA 1RUNA 5F1JA 3OYBA 2V79A 2BE5F 3DU5A 3TOAA 2EK5A 3I59A 4ESBA 3I0TA 2ACJA 3PIPF 3E1SA 1LDKB 3QP5A 4KISA 4S05A 4XONA 3CMYA 3ECHA 1YX5A 3ZMZA 1VFCA 2CUZA 2FBIA 3NRVA 3ASOH 2ZKZA 2IA1A 3RQIA 2HFHA 2EA4A 2V6CA 3REOA 3MZHA 2OC6A 3AG2H 2HKOA 4A0ZA 4EMSA 1ZR2A 3FXQA 2DQRA 2X6OA 1O7LA 3FISA 3ISPA 2Z3YA 4IKFA 5D8LB 1I1SA 4FX4A 2KLOA 2ETHA 4MTDA 2O61A 1E17A 2VOOA 3MWMA 1WWXA 2RC4A 4HLXA 2JA8J 4BJTA 4UHTA 1IN4A 1ZARA 1V5GA 3G71I 2D45A 2R7ZJ 4UV9A 3O6BB 2X1EA 3HOZJ 1JKRC 2A5WA 4OU0A 3E5XA 3DBRB 1ZN2A 4CICA 1KU3A 2FMLA 4L9JA 2R7RA 3M8JA 1MGTA 4XKWA 4A3MJ 1YJWI 1JXSA 3SFZA 5FB2A 1XSXA 4XLHA 3BQZA 3HEFA 3H9QA 3IH2A 2GLOA 4L18B 2V6EA 5L3GA 3WGIA 2GQQA 3CCMI 2NVXJ 3VPRA 2XHKA 3OIQA 4RA2A 2KP6A 3PSIA 4ZDLA 2HGCA 1N25A 3NARA 4D1QA 1V55H 4IHSA 1Y1WJ 2NYXA 2ELJA 5FLVA 2QQ9A 2GXGA 4XKBA 3J7AY 4I6ZA 1G8XA 2CW7A 3K4MA 3VYTB 3LSGA 5CVIA 3FXRA 3RJPA 2DTRA 4Y3OA 1KU2A 1JJ8C 3HB9A 2VC0A 2KT0A 3F72A 3IAM2 4I0AA 1OCTC 2IS2A 3WTWC 3K0LA 1I39A 4I01A 3E97A 2VOPA 2I10A 4XQFA 4EM2A 1D8JA 1G4DA 1K79A 2IBDA 2VPRA 5L3FA 3IKTA 1ON2A 1FTZA 2MSYA 1R9TJ 3EQLF 3HOWJ 1BOBA 1X1AA 1W7PD 3FDYA 3C2HA 3HPGA 4NQWA 2VJ4A 1FPQA 2FE3A 3FWEA 3VSKA 2ID6A 3PIOF 4YEJA 3L2VA 2HVSA 1LFUP 1KU9A 2XPWA 2LBFB 1FYLA 1OYYA 3L00A 3VYSB 4EEFG 3BROA 1MBFA 4OMZA 1ZRDA 1WI3A 2KL4A 4PCQA 3BG7A 4XOPA 1YJ9I 3H0GJ 1R36A 5E8GA 3O8HA 2KISA 1Z9CA 3HSEA 3EYIA 1DPRA 1TP4A 1HCRA 4BUPA 4MIMA 4LK0F 2O9LA 2CYYA 2DK8A 3IL2A 4D0PA 5IT3A 2NVUB 3E3VA 3OOPA 5DCFA 3WTXC 1RI7A 1I5ZA 3K2ZA 2VONA 4ZC3A 4EJUA 1B4AA 1W7PB 4BEHA 5KVRA 3GLXA 1ZGWA 2EWNA 1WH5A 1YW9A 1ETQA 2JRMA 2XASA 1KZHA 2JSCA 1YO5C 2DDBA 4Y4RA 3TW7A 3K4CA 3PUBA 1IG7A 1V5EA 2RKHA 1TW2A 1FOKA 1WRJA 2ELKA 5CQEA 2J5PA 1S7OA 2JZYA 1Y56A 1Q1HA 1H89C 3AG4H 3ZP5A 3GO5A 1I3QJ 4YFXF 4HF0A 1XN7A 3ZXSA 1QPMA 3C2GA 1OCOH 2FOWA 4A3FJ 1YI2I 3V7CA 1YITI 2KDOA 3BG9A 2AQFA 3ABLH 4IQ4A 2L7FP 1D8KA 4G7HF 2VBXA 4CUGA 3BTCA 3A4CA 2P4WA 2E7XA 1SMYF 2E2HJ 3KZZA 1HKQA 2QQBA 2QKLB 2K85A 4CH7A 5M5WJ 3QYBA 4PGGA 3LAPA 3MKYB 2HQNA 1Z1DA 3WTUC 2LD5A 4MFDA 1DGWY 3HIFA 3LSTA 4MTEA 2EZLA 4DBQA 4RDUA 4DZJA 4BNCA 2MC3A 2X9DA 1S3JA 2COBA 2V1XA 3CQZJ 2STWA 1T39A 1SVMA 2X6WA 3KPHA 5D8KB 2VL8A 2PJRA 2G0EA 3KX2A 3FBNB 2O5RA 2RDPA 1WSUA 3C2BA 3H5RA 1UAAA 2MFZA 3GFMA 1R58A 1A04A 3OMYA 2DLLA 2WA0A 1I6XA 2QYOA 1KA8A 2GAUA 1GXQA 4HQMA 4E7IA 3HC7A 3HHGA 3RZOJ 1K4TA 2CFOA 3LSKA 2ZFWA 2O3FA 3PFYA 1MBKA 2QLZA 5LEKA 3FZVA 3N4MA 5EEHA 2ID3A 2EH3A 3OIPA 2OQRA 2ZJQF 2AS5F 1U6GA 2BVLA 4A3EJ 4U87A 2XB0X 2YX4A 2DMUA 2XVCA 3K4KA 3F6OA 1IGNA 1FWZA 5F27A 1Z67A 5EGOB 2FBKA 4FX0A 3DPTA 4NC6A 1A36A 3K1PA 5CJ9A 3KP7A 3SFIA 1NK3P 1BJAA 1UJ8A 1SFXA 3ABMH 3H5AA 4IRHA 1OYWA 4F7ZA 3CC4I 1TT0A 2VJJA 4ZH4F 3DKYA 1MJ9A 1A5JA 3QYEA 2LREA 1UMQA 2TCTA 5TJJA 4CCLA 4ESJA 2V9VA 4ITVA 1FC3A 5LGTA 5EYRA 1NH3A 1G3SA 2JK3A 4RB0A 4J19A 1ZLKA 4AIJA 3KZYA 3KE2A 3WTZA 4RGUA 1K4SA 3ZMVA 3ZOBA 3H36A 4B48A 2M0CA 2OA4A 5TISC 3GTJJ 1IV8A 3CCRI 3ZRGA 1LPQA 4P1WA 4O3MA 4CYCB 1HDPA 1TT5B 2LY1A 3IUOA 5GP9A 5FGMA 3CCJI 3PQJA 3VEPA 5BMZA 2K3FA 4CCJA 1HKSA 2DU9A 2NS0A 3E0JB 1EV7A 4BHPA 1HC8A 4Y7NJ 4V2GA 1HW2A 2K3PA 3S16J 1BJZA 2L9NA 4RLFA 1W0UA 2P5LC 5FKLA 5DD8A 3RKWA 1Z7UA 1UELB 2CG4A 2XB5A 3NWTA 5D6FA 3TDUC 4XBFA 5ICGA 1VQ5I 4Q5SF 1KONA 2XAFA 1F5TA 4M74A 3MKZA 3BLYA 4BH9A 3WGGA 2D1HA 4A0XA 1TWGJ 2DA7A 4CZZA 5J1YA 1STZA 1U8RA 3HUGA 2KIMA 2XAJA 2K9NA 2WY8Q 5E3OA 4ZDOA 2CGPA 5J4YA 5L3DA 2L7MP 1W1WE 1G6NA 2V9PA 3B6CA 3DEUA 1G3TA 1S5LC 2JRTA 1HQCA 4BE0A 2X4HA 3WHCA 3GZ5A 1LJ9A 4YIRX 1TZLA 2DQLA 5J40A 1X4OA 1QGPA 5B1BH 4QWQA 4HX8A 9ANTA 3MMYB 2BV6A 2IA2A 1SFEA 3BJAA 4LLLA 4UNOA 5E1WA 3AAFA 2HDWA 3BG6A 1D1AA 3TP3A 1WGXA 1ETYA 1RKTA 1YJNI 3JRAA 1ETWA 2PG4A 4HSRA 4C9YA 3K6GA 4RBOA 3KLNA 2O03A 4K2EA 3S93A 2RQQA 1PUFA 1U9NA 4BQOA 5B5EC 4NC8A 1SD5A 5HS9A 2VQGA 2LC2A 1XCBA 2XIGA 3WTSC 2Z5UA 1AKHA 2XROA 2O6GE 1M1EB 3WE3A 3PO3J 4KIBA 2P8TA 4LB6B 1MDMB 3R0JA 3RKYA 1J59A 2VBZA 2HDDA 3MN2A 2IP2A 2VQCA 3H35A 4BAYA 5FFXA 4M3GA 1YW7A 2A6TA 4KMFA 1R22A 2F5FA 1IN5A 1FT9A 4LB5A 2HXIA 2CH0A 5H6QA 3I59B 5E3LA 4HLYA 1SEUA 1MMNA 4A69C 4ZTJA 5JVGF 4I0BA 2E35A 2L7ZA 3SXYA 3F8NA 1REPC 2W57A 5J3LA 1FYMA 2FRHA 5HVQC 1X3ZB 4HZFA 3J7ZI 4N0BA 2UZKA 2JVGA 3ML6A 5D5XB 4BDZA 4Z2YA 1XMXA 4D7MA 2GA2A 4RB1A 4EGYA 1XSDA 1BW6A 1XGOA 1R1TA 4UVBA 5IPAA 2DMQA 1IDYA 2XPVA 3VDXA 5HLIA 3R0AA 5F0HA 3GFIA 4KFCA 3QQAA 1V54H 2OBPA 4XR6A 1V3FA 1MJBA 5LBQA 4OINF 2V1UA 2VXZA 1SC7A 1YYVA 3OS2A 2LY9A 4EM1A 5EDNA 1R49A 1RR8C 2GXAA 1OJLA 3HKZA 1SFKA 2RN7A 2BHZA 1EF4A 5LGNA 5K7ZA 3E7LA 3LOCA 5FD5A 2M9HA 4WCGA 5AIPA 1Z3XA 4BQAA 4EM0B 2DMNA 2JUCA 4L5EA 4BKXA 5CPRB 1V5FA 1XPXA 1KU7A 2QEXI 2VJ5A 2IEKA 3E6MA 3P9IA 4E4HA 2E7WA 2NRAC 4FE4A 4ZYDA 2OCCH 2JTVA 2XKOA 1IUFA 2NNNA 3ABTA 5CYVA 3R4KA 5GPAA 4ZYHA 5D4RA 4BE2A 4ANJA 4MO7A 2L4MA 4A93J 4IHYA 1OR7A 2W84A 2LF8A 1VQKI 5IP9J 3DU6A 2MABA 1X2NA 3W2WA 2MYSA 1YFHA 2VKVA 3IWFA 1KQ8A 3G4SI 2DMPA 1MSFC 1W4MA 2MH9A 4PJ0C 1B72A 1UZCA 3K7AJ 5F04A 3GYHX 3CCLI 3I55I 2NS8A 4HF1A 3U1KA 2LRDA 3OYKA 2B63J 3H9JA 2XAQA 2PQ8A 5F1RA 1LEBA 3TKYA 2B7EA 4PJJA 4RAYA 4WX9A 2Y0MA 5IYCJ 3EUAA 4ENMA 3TO7A 2XV4S 1OCCH 2JPCA 4U88A 4XLAA 3AG1H 3IC7A 2GBYA 4NQWB 1T6SA 1Z05A 2CWEA 3PSFA 1L0OC 4GO1A 3OR1C 5ED4A 1SFUA 1C0WA 5HDKA 1VQMI 2Q2EA 2KZVA 2HOEA 3KLOA 1VQPI 1ZH5A 3KYLA 5DV5A 2CFXA 4XRFA 2OTLI 2AXLA 3BJ6A 1XG1A 3CD6I 2QSGX 2BZTA 3FBIB 1QHHD 3CCEI 2O7OA 1F1ZA 1TQPA 2HZDA 2WAEA 4YFKF 1K61A 5JHUA 2EFOA 3BR0A 4U0VA 2UWMA 1TBXA 1IAWA 4GXOA 3OSGA 2DFFA 5CLSA 3JAMZ 3LQQA 4JX5A 4CHUA 1B9MA 3KP5A 5L3EA 3BTJA 5D5UB 4R8HA 4ZYGA 1ORKA 1BIBA 2R7OA 3HRUA 1W0TA 4Y52J 5A2QZ 2GZWA 2O0YA 2P7VB 3JR9A 4I99C 4BEHB 5J6XA 1J5YA 3DLAA 4DGWB 4A3JJ 1JUMA 2V1NA 2H6CA 4G6DA 4PJNA 2BY1A 3F3XA 2JMWA 3HRMA 4GYGA 3TP0A 4BU2A 2HOSA 4YFNF 4ENNA 4EJWA 1W36C 2ISYA 4IL6C 4A12A 2EFQA 3CCVI 1X1DA 1SD7A 3JCUC 3AKZA 2L5QA 3HSFA 5HODA 1SMTA 2G9WA 3DWLE 4G94A 2R5YA 4A3IJ 1R6RA 2G7UA 3MEXA 3WG7H 5FLXK 1ETVA 3EUKL 5EG0A 2HNHA 2DA4A 4CCOA 2VASA 4CDGA 3UNGC 3LSPA 1RPWA 1SAXA 4ZDPA 1IXSB 2LKSA 4II2A 1YHQI 3CC2I 1LEAA 2OCEA 4BE1A 2EFWA 1JKQC 1FSHA 2DT7B 4IX7A 1F43A 1O3SA 2EIJH 4W97A 2HVRA 5BPDA 2XGCA 2V1DA 2LNBA 1J75A 4PJLA 4Z6YA 4FETA 4BACA 1MMGA 3CJQB 1DPUA 2HTJA 1E3OC 2L54A 3KEQA 3DKXA 4S04A 1JUSA 3ZMDA 1A35A 2WAFA 3FK7A 1R4MB 3D5LA 2GOXB 2XRNA 5IOZA 2R7WA 2HQ5A 5FO5A 3L2RA 3H9GA 1H0MA 2ZJPF 5F64A 4PK4A 4U7BA 2EQRA 3WE2A 4RGXA 2PJRB 5LRSA 1H8AC 1I3AA 4EV0A 2XF5A 3GBGA 1TL8A 1IW7F 1J0RA 4M9XA 5HNFA 4AIKA 2EB7A 3KYDB 1R23A 1IJWC 4L5IA 5C4JJ 2KRHA 2IGOA 1E2XA 2O8XA 3ZGKA 4ZZLA 5E3NA 4X0GA 2KPMA 2OJED 4HF2A 1B59A 4XL9A 1TQMA 2FQ3A 1XMAA 2K27A 2MD0A 4D5FA 1IF1A 1USSA 2DYRH 1F36A 3P9KA 4TV7A 1ACIA 2XF7A 3BR2A 3LSRA 3OYIA 1Y39A 3X2QH 2BEOA 4EJOA 3L9FA 3CO7C 3C1DA 3QPLA 3ROUA 4AUXA 3DF8A 3BT9A 3WODF 1Z7LA 2QQ8A 4UVCA 3WTTC 4QTRA 2TDXA 2W82A 1TLHB 2F4IA 1MBJA 1WCMJ 3KEYA 3LFUA 3FMQA 3A0HC 2E36A 3PQKA 4JX6A 3QRFF 1DP3A 1W5SA 2D1VA 2L9RA 2FOKA 1J09A 1IN8A 3HHHA 2X48A 4BXXJ 1KYWA 2M87A 1IRFA 2VE8A 2JQ7A 2G7HA 2V7FA 3E5UA 5B66C 2V9KA 1J9IA 5F08A 1JT6A 4LK1F 1LDJA 1G2HA 3PNVA 4LITA 1RR7A 4BGDA 1CF7A 4I2OA 2PX9A 2CQQA 3DFGA 4IPAA 3NWSA 3PUFA 3KP2A 1FMWA 1VQNI 3IRRA 4IJAA 3CDLA 1JT0A 5FKOA 2I5UA 4IVNA 1PYVA 1ENHA 3BR3A 1RETA 2MW8A 3AFHA 6PAXA 4M6XA 3ESWB 3BOQA 3RIRA 2H1LA 3L09A 3IHUA 5CKTA 1LQ1A 2VN2A 3I5UA 5EF6A 3SZTA 1JHHA 3L1PA 1AA7A 4IHTA 3ECOA 2ZJ2A 2MD5A 2EINH 1X3WB 4FTHA 1ONVA 1FEXA 1DDNA 2OQGA 2BXYA 2M5WA 5B1AH 4E7KA 1VQ7I 3KEOA 4CCNA 4MEXF 2OPTA 3S32A 4QPQA 2CQ7A 2ZXHA 2WC2A 4MHGA 2OU2A 3KYCB 2L7KA 2J5OA 2W00A 4B44A 4BJ5C 2CO5A 1ETOA 2L9VA 3W3CA 3LA2A 1IV6A 4KDPA 5E79C 4XRMA 4S0HB 4DW6A 3HUGB 4RLQA 1Y8QB 1IC8A 5E1ZB 1Z91A 3WTYC 3QPSA 4BHCA 4MQVA 3L2CA 3JRFA 3D5SC 3CF2A 3SYTA 5KAIC 2X85A 4N9HA 3BTIA 4Y17A 4LIVA 2WB1N 3V7RA 4AM3A 2QSFX 2CUEA 3GTQJ 1P2FA 4KICA 3I54A 2LVSA 2E5NA 2CUFA 3WTVC 4L0YB 1S8NA 2MA3A 4ENJA 2DTZA 3S3NA 2HEOA 3S15J 2P81A 3ABKH 2XKPA 4KJZA 1K78A 5HNHA 3I4PA 1UG0A 4ESFA 4PFPA 5ILSA 1HW5A 2PN6A 2GIZA 1MZBA 2KQRA 2X0LA 3J81Z 2MLKA 2L2OA 3CO6C 4EJTA 1FY7A 1FNNA 1X2MA 4B09A 1FSEA 3IAS2 3L2WA 1NK2P 2DA3A 4M3FA 1PUFB 1U9OA 1VNDA 1FLIA 2KZGA 3C18A 2XUBA 4CO8A 1DUXC 4FASD 5K7FA 2OV7A 4BJ6C 3M1CA 5E1XA 3JRHA 2YPRA 3G1OA 4LG0A 1AKHB 5AONA 2FMYA 2NXNB 4R79A 2DYSH 3U21A 1EKEA 2FUG2 3OS0A 1A6IA 1WJEA 2IGKA 4M6VA 4IEJA 5LEJA 2R92J 2XRLA 4XIDA 2KIQA 2K9SA 1FBSA 2JSPA 3DPUA 2EV6A 3B6AA 1ZQ3P 1T95A 2PJPA 1I50J 4MGRA 2LP0A 1D3YA 3SDGA 4OWRB 3GCMA 3B02A 3N05A 4G7OF 1OMIA 1P7JA 4BL0B 3OYMA 5LD2C 3L2QA 2DFEA 4FISA 1GV2A 3H5NA 5D5WB 1I1GA 3BZ6A 1VQLI 5JVTA 3FIWA 5BQTA 3FXJA 5ERIA 1DGRM 2E19A 2A3SA 5CVUA 1TWFJ 5H6RA 4IHVA 3TBIA 2IRFG 5FD6A 4M3DA 1ERDA 4E7SA 4AYBN 1NHAA 2K4BA 4B1RA 1YS7A 3OS1A 2QENA 4KN7X 4LIUA 2K86A 3CJNA 4PZJA 2CV0A 2PMHA 2DMTA 2WV0A 4BY7J 5IYDJ 1W36D 2VIXA 3JW4A 5FKMA 1DP7P 3EETA 1O3QA 2R93J 3WHBA 3RI4A 4UB8C 3SZPA 3OYHA 1VQ8I 1T38A 3TDZC 1MH4A 3BZKA 4HV5A 1GDTA 1BN5A 2RV8A 3C3WA 2WWYA 2QSHX 1O7FA 3TOBA 4XMYA 1DQUA 3ERMA 3QPHA 1PP7U 4MLOA 1S72I 3HOXJ 1SVOA 1O4XA 3GTMJ 2ZNZA 1U2WA 2ZSIB 3FXLA 3C7JA 2A07F 5E17F 2LKXA 4OMYA 3TO6A 5JLXA 2ECCA 4IRIA 1GT0C 1JGGA 1VI0A 1X3UA 4UVAA 1S6LA 4U0YA 2EIKH 3H0DA 4HPQA 4E6KG 2VC1A 4LGWA 1HA8A 1B72B 2F5CA 3BJOA 3CESA 1I6HJ 1WQ2A 1FBQA 4KT6A 2HQRA 1WJAA 4DNCA 4P96A 3RYPA 3BY6A 2AHQA 5GTIC 2E1OA 4N4NB 4XM3A 2IS1A 3ZMTA 1GV5A 4QIWN 2A5YB 3ULQB 3W6KB 5HLGA 4PSXA 2R4GA 4WWCA 4R1HA 1MH3A 5CVJA 2CW0F 1BL0A 3CMMA 2WADA 2EFPA 2HPIA 5LHGA 1I27A 2M8GX 4JYKA 1X1PA 1IRGA 2B0LA 1T8IA 5JHFA 3OYCA 5ICEA 5DS9A 2NS7A 3J7AO 1RKWA 5IT9K 2Q2EB 2HPMA 4HYEA 4JBAA 2DFHA 1TC3C 1VQ9I 5GPCA 2IPQX 4KN4X 2QQAA 1OR7C 3GFLA 1R5ID 3AG3H 2X1CA 2AQEA 4RS8A 1P4XA 1WFXA 2ECBA 1BC7C 5C4XJ 4P5OA 1GHCA 3FXOA 3BDDA 1UHSA 1OISA 3LWFA 2FNAA 2R7FA 2LOOA 3RTRA 1ZRCA 4A6DA 4HNTA 1UHWA 1U5TA 2PMUA 3HGYA 1YLFA 2QA4I 1RZ4A 3ERED 3FHZA 3IWZA 5BNGA 2XAUA 3W2VA 4L9TA 1R71A 2FJ1A 5BS6A 4JK1X 3JTHA 3FKJA 2QF7A 1QO0D 2BHYA 3CCQI 2R0QC 4E7JA 3ZQCA 4II3A 5LFAA 3OYDA 4HQEA 3F22A 2KHMA 3BTLA 4UV8A 1R7JA 5ILVA 2R5YB 2E2IJ 2GM4A 3OYNA 2M45A 4NC7A 4MFEA 3ZQHA 1AU7A 2R7VA 5EG0B 2R7TA 2A6EF 3BP8A 3PM1A 2P0WA 5AIQA 1TNTA 1ZTRA 4ZTFA 4OAYA 2A61A 2X51A 1VF9A 4Y13A 2Z16A 4CSWA 2LR8A 5KK1A 1BI1A 1PVEA 5JLWA 1T2KA 4LG3A 4UUTA 2XAHA 2CMPA 4IRGA 3WU2C 3LA7A 1Z6TA 2DJIA 4EATA 3GTKJ 3R6SA 3K1MA 2DOFA 2EIMH 2F48A 5FROA 3VFZA 1JTXA 3FK6A 3TGNA 1XGMA 1ZHFA 5M3MJ 1Z77A 3BZCA 2WAQN 5JI6A 3L7WA 1MBEA 4XLPF 2XGEA 2CW8A 2XSJC 3BC8A 1SVLA 3DXJF 1S29A 4XSZF 1QPIA 3A01A 2KKOA 4F52A 1UB9A 2F4MB 4I98B 2PEXA 4Q4ZF 1XDSA 1G3WA 2Y0SN 5E8IA 2FBHA 4A3LJ 1LDDA 2R7DA 3CJRB 4UUVA 4H0EA 1MMDA 3K69A 1D5VA 1BBYA 2ESNA 2GA1A 1XX5A 3F9KA 1VZ0A 1IDZA 3GTPJ 5HS8A 3SJMA 1XMKA 2ME0A 3B73A 2EV5A 2XGDA 2DDAA 2K02A 2CQXA 3S3OA 1ZG3A 3CUQC 4M72A 2EFNA 4UY8I 4ON0A 4IOCF 1W5CC 3F21A 2STTA 2KIFA 5D4SA 4CA0A 1HF0A 2OZUA 4RAZA 1ZG1A 1FZPB 2E71A 3MKWB 3JREA 3CF5F 4KA4A 4IXAA 1G59A 2JJ7A 3LL7A 1OCPA 2NNYA 2KRFA 4AVZA 2PFBA 3NQOA 2IT0A 2HI3A 2YSRA 2H94A 2JA7J 3G1MA 2EBIA 5F0FA 2DFIA 2W25A 4AU7A 3DEWA 3H3ZA 4ZJZA 3JAMK 3CC7I 4N9IA 3LAJA 3OYJA 1ZKGA 4BY1J 3DBLB 1S7AA 1BR2A 2BY2A 2DBBA 2Q0OA 4YELA 1QA6A 2R7UA 2QZ8A 1LFBA 4M3EA 4EVIA 2VLAA 1O3TA 2JA6J 3TO9A 1FYKA 3HGGA 1DU6A 5DDGA 1XGSA 2M4GA 1S9HA 2CS3A 2DOEA 3H92A 3ZQIA 3ZQGA 2COMA 3J7YJ 2PMZN 4L0ZB 2I8DA 1CF7B 3GXOA 2M3AA 2F5DA 2F5VA 2ME6A 1AOYA 1QHGA 1YIJI 5E18F 2XGXA 3HG9A 1XC5A 3DTIA 4HNUA 3RPQA 3JRGA 1KGSA 4KITB 4CCKA 1TTYA 3V8LA 3K70D 5D5VB 4FQGA 1Y8RB 4NUBA 2L02A 4NB5A 2M8EA 3LSIA 5LGUA 4I09A 1XSVA 4G12A 4XK4A 1RC9A 1SD6A 2XDVA 3VSLA 3BR1A 4XORA 4OIQF 3OR2C 3E6CC 2EV0A 4KMUX 3QOPA 3ZPLA 4ZZDA 1J2XA 2LTPA 1ZRFA 2ZBKA 3SZGA 2XSDC 1RIOH 1YRNA 2L4AA 2B9SA 2H6BA 3ONQA 4A6EA 4CGZA 3ZN0A 1DU0A 2VE9A 1FP1D 1IZ1A 5J47A 1JHFA 1O3RA 2DA5A 4C3JJ 5C44J 4IO9F 3OYAA 1XS9A 5FKKA 2WBMA 1P92A 1ON1A 5HDNA 2WV1A 3BR6A 3PJRA 2A68F 2FU4A 3HOYJ 4N4OB 2ZMEC 1OLTA 3WGHA 2H1KA 4KT5C 2IJLA 3TW6A 2JVHA 3S14J 2RAEA 2YUSA 4I76A 2Y2ZA 3DEEA 1B8IA 2EZIA 1K78B 1BC8C 1H9GA 3F0CA 5J8FA 2QBYA 2P5VA 4WF2A 4JQFA 4XLEA 2YU3A 3V42A 1MNMC 1XD7A 3CCUI 1K6OA 1LB2A 4O6JA 3PO2J 1ZLJA 3HYIA 5BPIA 5DCMA 1D0YA 1K6YA 3HTSB 1OYIA 2ZXIA 5FLMJ 3CDIA 4IOAF 3COAC 1Z21A 3Q0VA 2Y9ZA 3CP8A 5ICFA 1BW5A 5IOYA 4CCMA 2Y30A 1GUUA 4LG0B 1OCRH 3F8FA 3ZQQA 3JRIA 3K1NA 2AO9A 2QKMB 3CUQA 2D2WA 1GLNA 3T0YA 3QU3A 3JSPA 3I9V2 1EJ9A 3OSFA 4I02A 4AD9A 2GOMA 2FX0A 2E5ZA 3OL4A 3V8KA 3CCSI 5FRNA 1OQYA 4PGHA 1MMSA 2E60A 4D5CA 5K5RA 2CV1A 2WTEA 1LVKA 4UUSA 1WJDA 2HS5A 1X19A 4G6TB 1HKTA 1RNLA 3MD2A 3HM5A 4PSWA 3JTGA 4Y15A 1ETKA 5IP7J 3LNQA 4RAFA 2E2JJ 3ZQLA 5C3EJ 3J80Z 4BBSJ 1POGA 5GADJ 1BI0A 4AVPA 1NTCA 3LSHA 2NVTJ 5B3SH 4RGSA 3CMAI 2K7LA 4RGRA 1EH6A 1ZAOA 2V26A 3O2PE 5LHIA 1QZYA 3FX3A 2IVMA 2EILH 3EDPA 3MZ8A 5GAGJ 2ADUA 4XKCA 1A6QA 4OOIA 1ZREA 3I71A 3VOEA 5DUIA 2MH2A 2VKDA 3MZYA 3CDHA 2EZKA 3ELKA 2H27A 4CZCA 2F4OB 3FXKA 1QVTA 2W7NA 2CU7A 2WB1A 3G2BA 4X1EA 2EJRA 1QVUA 3VYRB 3TL4X 4XRSA 2E1NA 1F4KA 5HLTA 2VKEA 4C2MJ 1IN6A 5J1RA 2R7QA 2CJJA 1P6RA 4GGGA 4GRIA 1FIAA 2FNPA 3D1NI 2M1BA 5TGTA 2ICWG 2Y9YA 4MQ9F 3BWGA 1K7AA 2ZJRF 1K83J 4RM3A 5FLXZ 2ZCWA 2R3SA 2W4SA 2ZXWH 3MKLA 5DD4A 3DTKA 2VPLA 4P9FA 3OOUA 2OF7A 2Z33A 3S1QJ 3F8CA 3CCYA 3RPUA 1NG6A 1VTNC 4BQQA 4EGZA 1XTAA 4KNYA 3PNYA 5L3BA 1D1BA 3GFJA 4UB6C 3MFKA 3QODA 4RB3C 5EZGA 3K4LA 3H3VK 2BBYA 2ISZA 3MVPA 2XAGA 3S8PA 1KYZA 1Y1VJ 1BR1A 2JA2A 2RQPA 3J81K 1V4RA 3ZQ7A 1J7KA 4M71A 3QOEA 3P5JA 3QYFA 4XNFA 5KCMA 1S7EA 4P55A 2BY3A 3M07A 2AXTC 1ZR4A 2Y48A 4V19K 4HDUA 2FQ4A 3HTUA 3JRDA 3GX4X 1LE8A 1QQIA 2DT5A 2Y75A 2ZMEA 4IHWA 3SEZA 2WY7Q 3H3UA 3E5QA 1BOAA 1YOVB 2A05A 3ZN1A 1WJFA 2N8GA 3FKIJ 3IP4B 2ELHA 3Q9VA 2HQAA 4H4KC 1JTYA 3NEUA 3TMOA 2LDUA 2M34A 4E7HA 2UV1A 3VWBA 3M3YJ 3FHNA 3M8EA 4OAZA 3O3KA 1MD0A 3HSRA 1TNSA 1R1UA 1YQAA 4M6YA 4ENKA 1EA3A 2K5CA 2L9SA 3K4BA 1KQ9A 2GIVA 1X1BA 1TW3A 3QPTA 5F0CA 1HDDC 3ZQFA 1WJ5A 2O8KA 2VI6A 2OTJI 1TQIA 5BOXA 3QP6A 4AYBA 1OKRA 3IV5A 1SFOJ 3I64A 3OWTA 3R60A 3GLLA 1RRJA 1U5TB 3VODA 2Z99A 1MNEA 5H20A 4ZYEA 2OUMA 2Z9OA 4QLCU 2A69F 3S1MJ 2ESHA 3BPVA 3LA3A 4KYWA 4YIIA 3FMSA 3U9GA 5LHHA 1FX7A 2Y31A 1UFMA 2DA6A 1MBHA 1B6AA 3NAUA 4CYDA 2PI0A 3ASNH 3BG5A 3RYRA 3F8MA 4RMNA 3OY9A 1BI3A 1P7IA 4I7HA 5J4VA 1JKOC 2BW3A 4HW0A 2BOLA 4IQJA 3DBHB 1QU3A 3V7SA 3QU6A 1R1VA 1YG2A 3PNTA 4F55A 2VJIA 4J00A 2XF6A 4HX4A 3GMEA 5CVVA 2VBYA 4A2UA 3OV8A 4EQQA 3K2AA 4F93B 1WHUA 2IS6A 1BI2A 2DO7A 2F2EA 3T8RA 3HOUJ 2NOGA 4BDYA 4WXCA 4XOTA 1ZG5A 1JI8A 1N77A 5EEGA 3FF5A 3K4JA 4NDLA 3HOVJ 3PFIA 1U5TC 3DP7A 1JE8A 4YIFA 3W6VA 4M9ZA 5DYMA 1Y0NA 2KMUA 4HA8A 3RCOA 3BQYA 2HWVA 4F91B 4A3DJ 1B1BA 2Y69H 4HAMA 3LSMA 2VQHA 1GVDA 4E70A 1FJLA 2MG4A 2DK5A 4XLFA 4JOMA 3KCCA 1IRZA 3GF2A 4G6QA 3RPUD 3L2UA 2P7CB 3GTLJ 2R7XA 1T0FC 4PFOA 3A01B 2CV2A 3KP3A 2KDZA 1CQTA 1VQ6I 4WK8F 1OFCX 2VB6A 3D0SA 2K9MA 4EJVA 3K70C 3TQNA 2R5ZA 1N75A 4Y33A 3ABUA 3KZIC 2MC4A 4C2TA 2BY0A 1P4WA 2K9QA 3M4OJ 5CQGA 2IW5A 5DTDA 1H9TA 4A3CJ 4F92B 4WXHA 4B3XA 4J01A 3LQRA 3HRTA 5EZHA 2LFBA 5ILUA 1B9NA 3N97A 1IXRC 3UKGA 3BCAA 3G6EI 2VUMJ 1D0ZA 5HLHA 1E3PA 5HS7A 3T5XA 3JRBA 1MJAA 1R4NB 2LYCA 3M7GA 1QZEA 1EH7A 3GTOJ 2FD5A 5J1UA 1FOYA 1ZK8A 2HOAA 2LLKA 2CRGA 2JT1A 3K9TA 2CSOA 1MIJA 2NOJB 2MBFA 2VT3A 4DBRA 4F3QA 1Z3YA 3RQ4A 4HX7A 1IO2A 1ODDA 4AIHA 3FXUA 4DYRA 2UUZA 5DUKA 2LK2A 2ZSHB 1N78A 4C3IJ 3TEDA 1HXDA 4B4CA 2GXBA 1Y0UA 2VKHA 2HU9A 3I56I 1U78A 3GZNB 3S2HJ 1H88C 2K4JA 3V8JA 1XB4A 1ZYRF 3FXMA 4FCYA 2KRCA 3S3MA 3OL3A 3HL2A 3A1YA 2QUFA 1P4AA 4XICA 4OIRF 2P5KA 1Z6RA 5K5QA 2KFDA 5ICCA 2PLYA 1UHMA 3DQVC 2WAQA 4LMYA 5DM6F 2HR3A 3S2DJ 2K9LA 1VQOI 2DW4A 4HBLA 2P6TA 4LOCA 4YRVA 2CQKA 2H8WA 2F5EA 2LSOA 3CP2A 1WI9A 3I53A 2HDCA 3OYLA 2IXSA 4IF4A 3A0BC 4D7NA 3CZ6A 3LFKA 3KP4A 5GTHC 5JFRA 2RNGA 4RAGA 1YS6A 2Y0SA 1IRXA 1YRNB 2R7SA 1Q1VA 4GCVA 1XDUA 3OIOA 1HBXG 1WKMA 1QRYA 2KJCA 1APLC 1VQ4I 4GFBA 1R00A 3K10A 4DIQA 5J8CA 3H1CA 2YX7A 1WH7A 3CJTB 1XGNA 4XN3A 4WXDA 3CLOA 4ABZA 4XRSG 1O57A 1USTA 4JX4A 3RDIA 5LRRA 2LKPA 3M9AA 5JR3A 3F23A 1AHDP 2VODA 3ZMSA 5DM7F 5TRDA 1OPCA 1PDNC 1TWAJ 2HXOA 1MMAA 3ZR8X 1FOXA 2HZTA 2F6CA 1AWCA 4O5VA 2RREA 5E3MA 4FE7A 2HOTA 2LBFA 2EPFA 4A5NA 4L9NA 4FT8A 3KIOA 2IGNA 1X58A 1IUYA 3P7NA 5EEAA 4L5JA 1B8IB 3IKVA 1LFPA 2MGQA 1D1CA 2DA2A 5GAEJ 2QBYB 2KJBA 3S1RJ 4FHTA 4DYCA 1T0FA 3HRSA 4BXFA 2P6SA 4KIGA 2PBIA 5DCMB 1HSTA 1KQ0A 3GVAA 5E20A 1Z0XA 3VB2A 2D5VA 3HDDA 3LMMA 3T1BA 4CXFA 5M3FJ 1T56A 3R61A 1W7PA 4YG2F 3QAHA 4AIDA 4XLCA 3HBLA 1SD4A 3RSNA 4LLGF 3CUQB 2GWRA 5GAHJ 5DEQA 2PMZA 3HPHA 1QNTA 5FFZA 3AL0B 1HLVA 1MBGA 4OIPF 1X4PA 3GUDA 3G73A 1UG2A 2LY2A 1NG7A 3P9CA 2MLGA 3S1NJ 4NBQA 3GWZA 5FRMA 1R5GA 3WG9A 1FBUA 3QWLA 1TWHJ 4ETSA 5K5OA 4UUSB 3HJEA 3GEZA 3VYUB 1MSEC 3CLQA 3D5RC 2OZ6A 3I3LA 2M7AA 5M5XJ 2IA0A 3KFWX 4AC0A 2X1DA 2EZHA 3HOTA 1JJ6C 1F9NA 3PL8A 5IY5H 2E1MB 3I4MJ 3EPZA 2W85A 4Q47A 3MAJA 1YW8A 1FTTA 1YTYA 1UCRA 2BXZA 5IT9Z 3JRCA 3DKWA 3FMRA 1LUJB 1FIPA 4W1UA 2NVQJ 1T08B 1ULYA 2UXXA 3SQNA 1RESA 3IRQA 1E0EA 4HDVA 1Y6IA 3IH4A 1EH8A 1R5HA 4XSXF 1X1CA 3Q0UA 5IYBJ 3IH3A 1U0JA 1JGSA 2EA2A 2LH9A 5D6EA 3O8GA 3AL0C 2Q1ZB 3SEQA 5L3CA 2UXNA 1GXPA 3KETA 1MKMA 4G8XA 3HOSA 4IZZA 2CUJA 2M7BA 1E3HA 4P9UA 1T98A 1YIOA 4LJZF 1WVRA 1SAUA 1BIAA 3FM5A 1LVAA 4PUSA 3U2RA 3A03A 3BR5A 2M2EA 2NVYJ 3SHFA 3M8FA 3S17J 4IHXA 5K7HA 3CTAA 3GZ6A 2X6YA 4L9VA 2ZB9A 4C3HJ 4B43A 2XC7A 5F6FA 2E1MC 4B8XA 1QBJA 3GW2A 4XKVA 2ZNYA 1L3LA 4ZYAA 4C30A 4G9YA 2DT6A 2W48A 2HYGD 2L3DA 5A2QK 5EJCA 4UXNA 3JSOA 2TRTA 3EUHC 3WU0A 2JPBA 3OYGA 1RUOA 2QWWA 4M9SA 2VQLA 5KHDA 1PUEE 4QSHA 4DYQA 4RB2C 4A0YA 4DJAA 1U8BA 5EGOA 3DPLC 2JA5J 2YU9J 3CUOA 3FM3A 3Q5FA 3K4NA 3M1EA 4QPOA 3U1DA 4C2UA 2Q8KA 1CGPA 2DA1A 5FKNA 4B47A 3DTEA 2QVOA 3RKQA 1HW1A 1XCVA 1W5TA 4A3KJ 2KIUA 2DAOA 4V2FA 4U0WA 2ZMEB 2OD5A 2BYVE 2ZFUA 1LE8B 2YS9A 3KP6A 3HXLA 1GVJA 3F8BA 2DODA 1WPKA 4HNVA 2BGCA 3SDBA 2C6YA 1LNWA 2X6XA 2RVCA 2L0KA
chains in the Genus database with same CATH topology
3RKXA 5HDGA 2H09A 4A5MA 2FSWA 3EYYA 2FXAA 3MCZA 2FF4A 2A6HF 2FA5A 3WU1B 3W6JB 2YR2A 4Q48A 2DPUA 1IXCA 2L01A 5K1YA 4AWXB 5LLQA 1FP2A 1ZGAA 3DV8A 1HSJA 4U7DA 3J80K 1G3YA 3T8TA 4DQ2A 3S2WA 4GYIA 4ASNA 3G3ZA 3ZMUA 2QM3A 3E6DA 1QZZA 2HTSA 2RNJA 4KIFA 1PP8F 4G7ZF 2OAZA 4BYYA 3BPXA 1BM9A 4BHBA 2NAZA 2LF7A 3MQ0A 1U3EM 1IN7A 5CVRA 3E6BA 2M30A 4M73A 2DPDA 4HV6A 2ZO4A 1ZGJA 2FEZA 2E1CA 3Q9SA 4LLNA 3F6VA 2DI3A 2RGVA 3I58A 4HOBA 4OIOF 5HOOA 4MNUA 2HKXA 1MDMA 4XLNF 2HYFA 4LD5A 4BXUA 3EUHA 2ZXJA 4PDKA 4MEYF 2VBWA 2VT2A 4LFUA 3V4GA 2W24A 4KUMA 4NHJA 1RUNA 2V79A 2BE5F 3TOAA 2EK5A 3I59A 4ESBA 3I0TA 2ACJA 1LDKB 3QP5A 4S05A 3ECHA 3ZMZA 2FBIA 3NRVA 2ZKZA 2IA1A 2HFHA 2EA4A 2V6CA 3REOA 3MZHA 4A0ZA 2HKOA 4EMSA 3FXQA 2DQRA 1O7LA 3ISPA 2Z3YA 5D8LB 1I1SA 4FX4A 2ETHA 4MTDA 2O61A 1E17A 2VOOA 3MWMA 1WWXA 2RC4A 4HLXA 4UHTA 1IN4A 1ZARA 2D45A 4UV9A 3O6BB 4OU0A 3E5XA 1ZN2A 4CICA 1KU3A 2FMLA 4L9JA 1MGTA 1JXSA 3SFZA 5FB2A 1XSXA 4L18B 5L3GA 3WGIA 2GQQA 2XHKA 2HGCA 4IHSA 2NYXA 2QQ9A 2GXGA 5CVIA 3FXRA 3RJPA 2DTRA 1KU2A 2VC0A 3F72A 4I0AA 3WTWC 3K0LA 4I01A 3E97A 2VOPA 4EM2A 1D8JA 1G4DA 1K79A 5L3FA 3IKTA 1ON2A 3EQLF 4NQWA 1FPQA 2FE3A 3FWEA 1KU9A 1FYLA 1OYYA 3L00A 3BROA 4OMZA 1ZRDA 4PCQA 5E8GA 1R36A 1Z9CA 3HSEA 3EYIA 1DPRA 4LK0F 2CYYA 2DK8A 3IL2A 4D0PA 5IT3A 3E3VA 3OOPA 5DCFA 3WTXC 1RI7A 1I5ZA 3K2ZA 2VONA 4EJUA 1B4AA 1W7PB 5KVRA 3GLXA 2EWNA 1YW9A 2XASA 2JSCA 1YO5C 1FOKA 2RKHA 1TW2A 1WRJA 2J5PA 1S7OA 2JZYA 1Q1HA 3ZP5A 3GO5A 4YFXF 4HF0A 1XN7A 1QPMA 3V7CA 1D8KA 4G7HF 2VBXA 2P4WA 2E7XA 1SMYF 3KZZA 1HKQA 2QQBA 4PGGA 3LAPA 2HQNA 1Z1DA 3WTUC 3HIFA 3LSTA 4MTEA 4BNCA 2MC3A 1S3JA 2V1XA 2STWA 1T39A 5D8KB 1WSUA 2RDPA 3GFMA 1R58A 1A04A 2DLLA 1I6XA 2QYOA 1KA8A 2GAUA 1GXQA 4HQMA 3HHGA 2ZFWA 2O3FA 2QLZA 5LEKA 3FZVA 3N4MA 5EEHA 2OQRA 2AS5F 1U6GA 2YX4A 2XVCA 3F6OA 1FWZA 2FBKA 4FX0A 3DPTA 3K1PA 5CJ9A 3KP7A 1BJAA 1SFXA 4IRHA 1OYWA 4F7ZA 4ZH4F 1MJ9A 5TJJA 4ESJA 2V9VA 1FC3A 5LGTA 1G3SA 4RB0A 1ZLKA 4AIJA 3KZYA 3KE2A 3WTZA 4RGUA 3ZMVA 2OA4A 4O3MA 5FGMA 3PQJA 3VEPA 5BMZA 1HKSA 2DU9A 2NS0A 1EV7A 4BHPA 1HW2A 2P5LC 5DD8A 3RKWA 1Z7UA 2CG4A 3TDUC 5D6FA 4XBFA 5ICGA 4Q5SF 2XAFA 1F5TA 4M74A 4BH9A 3WGGA 2D1HA 4A0XA 4CZZA 1STZA 1U8RA 3HUGA 2KIMA 2XAJA 2CGPA 5L3DA 1G6NA 3DEUA 1G3TA 2JRTA 1HQCA 2X4HA 3GZ5A 1LJ9A 2DQLA 1QGPA 4QWQA 4HX8A 2BV6A 2IA2A 1SFEA 3BJAA 4LLLA 4UNOA 5E1WA 3AAFA 2PG4A 3KLNA 2O03A 4K2EA 1SD5A 5HS9A 1XCBA 2XIGA 3WTSC 2Z5UA 2XROA 2O6GE 3WE3A 4KIBA 2P8TA 4LB6B 1MDMB 3R0JA 3RKYA 1J59A 2VBZA 2IP2A 4BAYA 5FFXA 1YW7A 4KMFA 1R22A 2F5FA 1IN5A 1FT9A 4LB5A 5H6QA 3I59B 4HLYA 4I0BA 3SXYA 3F8NA 1REPC 2W57A 1FYMA 2FRHA 5HVQC 4HZFA 4N0BA 2UZKA 3ML6A 5D5XB 4Z2YA 4EGYA 2GA2A 4RB1A 1XSDA 1XGOA 1R1TA 4UVBA 5HLIA 3R0AA 3GFIA 4KFCA 2OBPA 1V3FA 1MJBA 5LBQA 4OINF 2V1UA 2VXZA 1YYVA 4EM1A 2RN7A 5LGNA 5FD5A 4WCGA 5AIPA 4BQAA 4EM0B 1KU7A 3E6MA 3P9IA 2E7WA 2NRAC 4ZYDA 2JTVA 2XKOA 3ABTA 2NNNA 5CYVA 5D4RA 3R4KA 4ZYHA 2L4MA 1OR7A 2W84A 2LF8A 1YFHA 3IWFA 1KQ8A 1W4MA 2MH9A 3GYHX 4HF1A 2XAQA 2PQ8A 5F1RA 1LEBA 3TKYA 4RAYA 4WX9A 2Y0MA 4ENMA 3TO7A 2XV4S 2JPCA 4U88A 3IC7A 1T6SA 1Z05A 2CWEA 1L0OC 4GO1A 5ED4A 1SFUA 1C0WA 5HDKA 2Q2EA 3KLOA 2HOEA 1ZH5A 5DV5A 2CFXA 4XRFA 2AXLA 3BJ6A 1F1ZA 1TQPA 4YFKF 5JHUA 2EFOA 4U0VA 2UWMA 1TBXA 1IAWA 4GXOA 5CLSA 3JAMZ 3LQQA 4CHUA 1B9MA 3KP5A 5L3EA 5D5UB 4R8HA 4ZYGA 1BIBA 3HRUA 5A2QZ 2GZWA 2O0YA 2P7VB 5J6XA 1J5YA 2H6CA 4G6DA 3F3XA 3HRMA 4GYGA 4YFNF 4ENNA 4EJWA 2ISYA 4A12A 2EFQA 1SD7A 3HSFA 1SMTA 2G9WA 4G94A 2G7UA 3MEXA 5FLXK 4CDGA 1SAXA 1IXSB 1LEAA 2EFWA 1FSHA 1O3SA 5BPDA 2V1DA 2LNBA 1J75A 1DPUA 2HTJA 2L54A 3KEQA 4S04A 3ZMDA 3D5LA 2XRNA 5FO5A 1H0MA 5F64A 4U7BA 3WE2A 4RGXA 5LRSA 4EV0A 1IW7F 1J0RA 4AIKA 4M9XA 2EB7A 1R23A 4L5IA 1E2XA 2O8XA 4ZZLA 4HF2A 1B59A 1TQMA 2FQ3A 1XMAA 2K27A 1IF1A 1USSA 3P9KA 4TV7A 2BEOA 4EJOA 3L9FA 3CO7C 3C1DA 3ROUA 3DF8A 3WODF 4UVCA 3WTTC 2TDXA 1TLHB 3QRFF 3FMQA 3PQKA 1W5SA 2D1VA 2FOKA 1IN8A 3HHHA 1KYWA 2M87A 1IRFA 2VE8A 2G7HA 3E5UA 1J9IA 4LK1F 1LDJA 1CF7A 4I2OA 3DFGA 4IPAA 3KP2A 3IRRA 4IJAA 4IVNA 6PAXA 4M6XA 3BOQA 3RIRA 3L09A 3IHUA 1LQ1A 2VN2A 3I5UA 3SZTA 1JHHA 4IHTA 3ECOA 2ZJ2A 2MD5A 1ONVA 1DDNA 2OQGA 2M5WA 3KEOA 4MEXF 4MHGA 2WC2A 2OU2A 2J5OA 2CO5A 3LA2A 4KDPA 5E1ZB 1Z91A 3WTYC 4BHCA 4MQVA 3L2CA 4N9HA 4Y17A 3V7RA 1P2FA 4KICA 3I54A 3WTVC 4L0YB 1S8NA 2MA3A 4ENJA 2HEOA 2XKPA 1K78A 3I4PA 4ESFA 5ILSA 1HW5A 2PN6A 1MZBA 2X0LA 3J81Z 2MLKA 3CO6C 4EJTA 1FY7A 1FNNA 4B09A 1FSEA 1FLIA 3C18A 2XUBA 4CO8A 1DUXC 5E1XA 2YPRA 4LG0A 5AONA 2FMYA 4R79A 5LEJA 1FBSA 2EV6A 2PJPA 4MGRA 1D3YA 3B02A 4G7OF 1OMIA 5D5WB 1I1GA 3BZ6A 5JVTA 5BQTA 5ERIA 2A3SA 5CVUA 5H6RA 2IRFG 5FD6A 1NHAA 2K4BA 1YS7A 2QENA 4KN7X 2K86A 3CJNA 4PZJA 2PMHA 2WV0A 3JW4A 1DP7P 3EETA 1O3QA 3RI4A 3SZPA 1T38A 3TDZC 4HV5A 1BN5A 2RV8A 3C3WA 2WWYA 1O7FA 3TOBA 3QPHA 1PP7U 2ZNZA 1U2WA 3C7JA 2A07F 5E17F 4OMYA 3TO6A 4IRIA 1X3UA 4UVAA 1S6LA 4U0YA 2VC1A 4LGWA 2F5CA 3BJOA 1WQ2A 1FBQA 4DNCA 2HQRA 4P96A 3RYPA 3BY6A 3ZMTA 2A5YB 3ULQB 3W6KB 5HLGA 4WWCA 4R1HA 5CVJA 2CW0F 2EFPA 5LHGA 1I27A 1IRGA 2B0LA 5ICEA 3J7AO 5IT9K 4HYEA 4JBAA 2IPQX 4KN4X 2QQAA 3GFLA 4RS8A 1P4XA 1BC7C 4P5OA 1GHCA 3BDDA 3LWFA 2FNAA 2R7FA 3RTRA 1ZRCA 4A6DA 1UHWA 1U5TA 2PMUA 1YLFA 1RZ4A 3ERED 3FHZA 3IWZA 4L9TA 5BS6A 4JK1X 3JTHA 1QO0D 4HQEA 3F22A 4UV8A 5ILVA 1R7JA 2M45A 2A6EF 3BP8A 5AIQA 1TNTA 2A61A 4Y13A 5KK1A 1BI1A 1T2KA 2XAHA 4IRGA 3LA7A 1Z6TA 3R6SA 3K1MA 3VFZA 3TGNA 1XGMA 1ZHFA 5JI6A 3L7WA 4XLPF 3DXJF 1S29A 4XSZF 2KKOA 1UB9A 4I98B 2PEXA 4Q4ZF 1XDSA 1G3WA 5E8IA 2FBHA 1LDDA 2R7DA 4UUVA 4H0EA 3K69A 1D5VA 1BBYA 2ESNA 2GA1A 5HS8A 1XMKA 3B73A 2EV5A 2K02A 1ZG3A 3CUQC 4M72A 2EFNA 4ON0A 3F21A 2STTA 2KIFA 5D4SA 2OZUA 4RAZA 1ZG1A 1FZPB 4KA4A 4IXAA 2NNYA 2KRFA 2PFBA 3NQOA 2IT0A 2YSRA 2H94A 2DFIA 2W25A 3H3ZA 3JAMK 4N9IA 3LAJA 1S7AA 2DBBA 2Q0OA 2QZ8A 4EVIA 1O3TA 3TO9A 1FYKA 5DDGA 1XGSA 3H92A 2COMA 4L0ZB 1CF7B 3GXOA 2F5DA 1AOYA 5E18F 2XGXA 3RPQA 1KGSA 1TTYA 3V8LA 5D5VB 2L02A 4NB5A 2M8EA 5LGUA 4I09A 1XSVA 1SD6A 4OIQF 3E6CC 2EV0A 4KMUX 3QOPA 3ZPLA 4ZZDA 1J2XA 1ZRFA 2ZBKA 1RIOH 2L4AA 2H6BA 4A6EA 4CGZA 3ZN0A 2VE9A 1FP1D 1IZ1A 1JHFA 1O3RA 1P92A 1ON1A 5HDNA 2A68F 2FU4A 3WGHA 4KT5C 2IJLA 1K78B 1BC8C 1H9GA 2QBYA 5J8FA 2P5VA 4WF2A 4JQFA 2YU3A 1XD7A 1K6OA 1LB2A 4O6JA 1ZLJA 3HYIA 5BPIA 5DCMA 3HTSB 1OYIA 3COAC 5ICFA 4LG0B 3F8FA 3K1NA 3CUQA 2D2WA 3T0YA 3QU3A 3JSPA 4I02A 4AD9A 3V8KA 4PGHA 5K5RA 2WTEA 2HS5A 1HKTA 1RNLA 3JTGA 4Y15A 3J80Z 1BI0A 4AVPA 4RGSA 2K7LA 4RGRA 1EH6A 1ZAOA 3O2PE 5LHIA 1QZYA 3FX3A 2IVMA 3EDPA 1ZREA 2ADUA 4OOIA 3I71A 3VOEA 5DUIA 2MH2A 3MZYA 3CDHA 3ELKA 2H27A 2EJRA 2E1NA 1F4KA 1IN6A 1P6RA 4GGGA 2FNPA 2M1BA 4MQ9F 3BWGA 1K7AA 5FLXZ 2ZCWA 2R3SA 5DD4A 4P9FA 2Z33A 3F8CA 3RPUA 1VTNC 4EGZA 4KNYA 5L3BA 3GFJA 3MFKA 4RB3C 2BBYA 2ISZA 2XAGA 1KYZA 2RQPA 3J81K 1V4RA 3ZQ7A 1J7KA 4M71A 4P55A 2Y48A 4HDUA 3HTUA 3GX4X 1QQIA 2DT5A 2Y75A 2ZMEA 3H3UA 3E5QA 1BOAA 3ZN1A 2ELHA 3Q9VA 3NEUA 2LDUA 3M8EA 3O3KA 1MD0A 3HSRA 1TNSA 1R1UA 1YQAA 4M6YA 4ENKA 1KQ9A 2GIVA 1TW3A 3QPTA 1TQIA 5BOXA 3QP6A 1OKRA 3I64A 3R60A 1U5TB 3VODA 2Z99A 5H20A 4ZYEA 2Z9OA 4QLCU 2A69F 2ESHA 3BPVA 3LA3A 4KYWA 4YIIA 3FMSA 3U9GA 5LHHA 1FX7A 1UFMA 1B6AA 4CYDA 2PI0A 3RYRA 3F8MA 1BI3A 4I7HA 4HW0A 3V7SA 3QU6A 1R1VA 1YG2A 4HX4A 5CVVA 2VBYA 4A2UA 3OV8A 4EQQA 1BI2A 2DO7A 2F2EA 3T8RA 4WXCA 1ZG5A 5EEGA 3FF5A 3PFIA 1U5TC 3DP7A 1JE8A 4YIFA 4M9ZA 5DYMA 4HA8A 2HWVA 1B1BA 4HAMA 4E70A 2DK5A 3KCCA 3GF2A 4G6QA 2P7CB 3KP3A 4WK8F 4EJVA 3D0SA 3TQNA 3ABUA 1P4WA 2IW5A 1H9TA 4WXHA 3LQRA 3HRTA 5ILUA 1B9NA 3N97A 1IXRC 5HLHA 5HS7A 3T5XA 1MJAA 3M7GA 1EH7A 2JT1A 3K9TA 2CSOA 2MBFA 2VT3A 4HX7A 1ODDA 4AIHA 3FXUA 5DUKA 2GXBA 1HXDA 1Y0UA 1U78A 2K4JA 3V8JA 1XB4A 1ZYRF 2QUFA 1P4AA 4OIRF 2P5KA 1Z6RA 5K5QA 5ICCA 2PLYA 1UHMA 3DQVC 4LMYA 2HR3A 2DW4A 4HBLA 2P6TA 2CQKA 2LSOA 2F5EA 1WI9A 3I53A 2HDCA 4IF4A 3LFKA 3KP4A 5JFRA 1YS6A 4GCVA 1XDUA 1HBXG 1WKMA 2KJCA 1R00A 5J8CA 2YX7A 1XGNA 4WXDA 3CLOA 1O57A 1USTA 3RDIA 3F23A 5JR3A 2LKPA 3M9AA 5LRRA 2VODA 3ZMSA 5TRDA 1OPCA 1PDNC 2HZTA 1AWCA 4O5VA 4A5NA 4L9NA 4FT8A 1IUYA 3P7NA 4L5JA 3IKVA 2QBYB 2KJBA 4FHTA 1T0FA 3HRSA 2P6SA 4KIGA 2PBIA 5DCMB 1HSTA 1KQ0A 3GVAA 5E20A 3VB2A 3T1BA 4CXFA 3R61A 1W7PA 4YG2F 3QAHA 1SD4A 4LLGF 3CUQB 2GWRA 5DEQA 1QNTA 5FFZA 4OIPF 3GUDA 3G73A 3P9CA 2MLGA 3GWZA 1R5GA 3WG9A 1FBUA 4ETSA 5K5OA 3GEZA 2OZ6A 2IA0A 3KFWX 3HOTA 1F9NA 2W85A 4Q47A 3MAJA 1YW8A 1YTYA 1UCRA 5IT9Z 3DKWA 3FMRA 1ULYA 2UXXA 3SQNA 3IRQA 4HDVA 1EH8A 1R5HA 4XSXF 1JGSA 2EA2A 5D6EA 5L3CA 2UXNA 1GXPA 3KETA 1MKMA 4G8XA 3HOSA 4P9UA 1T98A 1YIOA 4LJZF 1BIAA 3FM5A 1LVAA 3U2RA 3SHFA 3M8FA 3CTAA 3GZ6A 4L9VA 5F6FA 4B8XA 1QBJA 3GW2A 2ZNYA 1L3LA 4G9YA 2HYGD 2L3DA 5A2QK 4UXNA 3JSOA 3WU0A 1RUOA 2JPBA 2QWWA 4M9SA 1PUEE 4RB2C 4A0YA 3DPLC 3CUOA 3FM3A 3Q5FA 3M1EA 3U1DA 2Q8KA 1CGPA 2QVOA 1HW1A 1XCVA 1W5TA 2KIUA 2DAOA 4U0WA 2ZMEB 2OD5A 2BYVE 3KP6A 1GVJA 3F8BA 2BGCA 2C6YA 1LNWA 2RVCA 1W7PD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RKX A;  5HDG A;  2H09 A;  4A5M A;  2FSW A;  3EYY A;  2FXA A;  3MCZ A;  2FF4 A;  2A6H F;  2FA5 A;  3WU1 B;  3W6J B;  2YR2 A;  4Q48 A;  2DPU A;  1IXC A;  2L01 A;  5K1Y A;  4AWX B;  5LLQ A;  1FP2 A;  1ZGA A;  3DV8 A;  1HSJ A;  4U7D A;  3J80 K;  1G3Y A;  3T8T A;  4DQ2 A;  3S2W A;  4GYI A;  4ASN A;  3G3Z A;  3ZMU A;  2QM3 A;  3E6D A;  1QZZ A;  2HTS A;  2RNJ A;  4KIF A;  1PP8 F;  4G7Z F;  2OAZ A;  4BYY A;  3BPX A;  1BM9 A;  4BHB A;  2NAZ A;  2LF7 A;  3MQ0 A;  1U3E M;  1IN7 A;  5CVR A;  3E6B A;  2M30 A;  4M73 A;  2DPD A;  4HV6 A;  2ZO4 A;  1ZGJ A;  2FEZ A;  2E1C A;  3Q9S A;  4LLN A;  3F6V A;  2DI3 A;  2RGV A;  3I58 A;  4HOB A;  4OIO F;  5HOO A;  4MNU A;  2HKX A;  1MDM A;  4XLN F;  2HYF A;  4LD5 A;  4BXU A;  3EUH A;  2ZXJ A;  4PDK A;  4MEY F;  2VBW A;  2VT2 A;  4LFU A;  3V4G A;  2W24 A;  4KUM A;  4NHJ A;  1RUN A;  2V79 A;  2BE5 F;  3TOA A;  2EK5 A;  3I59 A;  4ESB A;  3I0T A;  2ACJ A;  1LDK B;  3QP5 A;  4S05 A;  3ECH A;  3ZMZ A;  2FBI A;  3NRV A;  2ZKZ A;  2IA1 A;  2HFH A;  2EA4 A;  2V6C A;  3REO A;  3MZH A;  4A0Z A;  2HKO A;  4EMS A;  3FXQ A;  2DQR A;  1O7L A;  3ISP A;  2Z3Y A;  5D8L B;  1I1S A;  4FX4 A;  2ETH A;  4MTD A;  2O61 A;  1E17 A;  2VOO A;  3MWM A;  1WWX A;  2RC4 A;  4HLX A;  4UHT A;  1IN4 A;  1ZAR A;  2D45 A;  4UV9 A;  3O6B B;  4OU0 A;  3E5X A;  1ZN2 A;  4CIC A;  1KU3 A;  2FML A;  4L9J A;  1MGT A;  1JXS A;  3SFZ A;  5FB2 A;  1XSX A;  4L18 B;  5L3G A;  3WGI A;  2GQQ A;  2XHK A;  2HGC A;  4IHS A;  2NYX A;  2QQ9 A;  2GXG A;  5CVI A;  3FXR A;  3RJP A;  2DTR A;  1KU2 A;  2VC0 A;  3F72 A;  4I0A A;  3WTW C;  3K0L A;  4I01 A;  3E97 A;  2VOP A;  4EM2 A;  1D8J A;  1G4D A;  1K79 A;  5L3F A;  3IKT A;  1ON2 A;  3EQL F;  4NQW A;  1FPQ A;  2FE3 A;  3FWE A;  1KU9 A;  1FYL A;  1OYY A;  3L00 A;  3BRO A;  4OMZ A;  1ZRD A;  4PCQ A;  5E8G A;  1R36 A;  1Z9C A;  3HSE A;  3EYI A;  1DPR A;  4LK0 F;  2CYY A;  2DK8 A;  3IL2 A;  4D0P A;  5IT3 A;  3E3V A;  3OOP A;  5DCF A;  3WTX C;  1RI7 A;  1I5Z A;  3K2Z A;  2VON A;  4EJU A;  1B4A A;  1W7P B;  5KVR A;  3GLX A;  2EWN A;  1YW9 A;  2XAS A;  2JSC A;  1YO5 C;  1FOK A;  2RKH A;  1TW2 A;  1WRJ A;  2J5P A;  1S7O A;  2JZY A;  1Q1H A;  3ZP5 A;  3GO5 A;  4YFX F;  4HF0 A;  1XN7 A;  1QPM A;  3V7C A;  1D8K A;  4G7H F;  2VBX A;  2P4W A;  2E7X A;  1SMY F;  3KZZ A;  1HKQ A;  2QQB A;  4PGG A;  3LAP A;  2HQN A;  1Z1D A;  3WTU C;  3HIF A;  3LST A;  4MTE A;  4BNC A;  2MC3 A;  1S3J A;  2V1X A;  2STW A;  1T39 A;  5D8K B;  1WSU A;  2RDP A;  3GFM A;  1R58 A;  1A04 A;  2DLL A;  1I6X A;  2QYO A;  1KA8 A;  2GAU A;  1GXQ A;  4HQM A;  3HHG A;  2ZFW A;  2O3F A;  2QLZ A;  5LEK A;  3FZV A;  3N4M A;  5EEH A;  2OQR A;  2AS5 F;  1U6G A;  2YX4 A;  2XVC A;  3F6O A;  1FWZ A;  2FBK A;  4FX0 A;  3DPT A;  3K1P A;  5CJ9 A;  3KP7 A;  1BJA A;  1SFX A;  4IRH A;  1OYW A;  4F7Z A;  4ZH4 F;  1MJ9 A;  5TJJ A;  4ESJ A;  2V9V A;  1FC3 A;  5LGT A;  1G3S A;  4RB0 A;  1ZLK A;  4AIJ A;  3KZY A;  3KE2 A;  3WTZ A;  4RGU A;  3ZMV A;  2OA4 A;  4O3M A;  5FGM A;  3PQJ A;  3VEP A;  5BMZ A;  1HKS A;  2DU9 A;  2NS0 A;  1EV7 A;  4BHP A;  1HW2 A;  2P5L C;  5DD8 A;  3RKW A;  1Z7U A;  2CG4 A;  3TDU C;  5D6F A;  4XBF A;  5ICG A;  4Q5S F;  2XAF A;  1F5T A;  4M74 A;  4BH9 A;  3WGG A;  2D1H A;  4A0X A;  4CZZ A;  1STZ A;  1U8R A;  3HUG A;  2KIM A;  2XAJ A;  2CGP A;  5L3D A;  1G6N A;  3DEU A;  1G3T A;  2JRT A;  1HQC A;  2X4H A;  3GZ5 A;  1LJ9 A;  2DQL A;  1QGP A;  4QWQ A;  4HX8 A;  2BV6 A;  2IA2 A;  1SFE A;  3BJA A;  4LLL A;  4UNO A;  5E1W A;  3AAF A;  2PG4 A;  3KLN A;  2O03 A;  4K2E A;  1SD5 A;  5HS9 A;  1XCB A;  2XIG A;  3WTS C;  2Z5U A;  2XRO A;  2O6G E;  3WE3 A;  4KIB A;  2P8T A;  4LB6 B;  1MDM B;  3R0J A;  3RKY A;  1J59 A;  2VBZ A;  2IP2 A;  4BAY A;  5FFX A;  1YW7 A;  4KMF A;  1R22 A;  2F5F A;  1IN5 A;  1FT9 A;  4LB5 A;  5H6Q A;  3I59 B;  4HLY A;  4I0B A;  3SXY A;  3F8N A;  1REP C;  2W57 A;  1FYM A;  2FRH A;  5HVQ C;  4HZF A;  4N0B A;  2UZK A;  3ML6 A;  5D5X B;  4Z2Y A;  4EGY A;  2GA2 A;  4RB1 A;  1XSD A;  1XGO A;  1R1T A;  4UVB A;  5HLI A;  3R0A A;  3GFI A;  4KFC A;  2OBP A;  1V3F A;  1MJB A;  5LBQ A;  4OIN F;  2V1U A;  2VXZ A;  1YYV A;  4EM1 A;  2RN7 A;  5LGN A;  5FD5 A;  4WCG A;  5AIP A;  4BQA A;  4EM0 B;  1KU7 A;  3E6M A;  3P9I A;  2E7W A;  2NRA C;  4ZYD A;  2JTV A;  2XKO A;  3ABT A;  2NNN A;  5CYV A;  5D4R A;  3R4K A;  4ZYH A;  2L4M A;  1OR7 A;  2W84 A;  2LF8 A;  1YFH A;  3IWF A;  1KQ8 A;  1W4M A;  2MH9 A;  3GYH X;  4HF1 A;  2XAQ A;  2PQ8 A;  5F1R A;  1LEB A;  3TKY A;  4RAY A;  4WX9 A;  2Y0M A;  4ENM A;  3TO7 A;  2XV4 S;  2JPC A;  4U88 A;  3IC7 A;  1T6S A;  1Z05 A;  2CWE A;  1L0O C;  4GO1 A;  5ED4 A;  1SFU A;  1C0W A;  5HDK A;  2Q2E A;  3KLO A;  2HOE A;  1ZH5 A;  5DV5 A;  2CFX A;  4XRF A;  2AXL A;  3BJ6 A;  1F1Z A;  1TQP A;  4YFK F;  5JHU A;  2EFO A;  4U0V A;  2UWM A;  1TBX A;  1IAW A;  4GXO A;  5CLS A;  3JAM Z;  3LQQ A;  4CHU A;  1B9M A;  3KP5 A;  5L3E A;  5D5U B;  4R8H A;  4ZYG A;  1BIB A;  3HRU A;  5A2Q Z;  2GZW A;  2O0Y A;  2P7V B;  5J6X A;  1J5Y A;  2H6C A;  4G6D A;  3F3X A;  3HRM A;  4GYG A;  4YFN F;  4ENN A;  4EJW A;  2ISY A;  4A12 A;  2EFQ A;  1SD7 A;  3HSF A;  1SMT A;  2G9W A;  4G94 A;  2G7U A;  3MEX A;  5FLX K;  4CDG A;  1SAX A;  1IXS B;  1LEA A;  2EFW A;  1FSH A;  1O3S A;  5BPD A;  2V1D A;  2LNB A;  1J75 A;  1DPU A;  2HTJ A;  2L54 A;  3KEQ A;  4S04 A;  3ZMD A;  3D5L A;  2XRN A;  5FO5 A;  1H0M A;  5F64 A;  4U7B A;  3WE2 A;  4RGX A;  5LRS A;  4EV0 A;  1IW7 F;  1J0R A;  4AIK A;  4M9X A;  2EB7 A;  1R23 A;  4L5I A;  1E2X A;  2O8X A;  4ZZL A;  4HF2 A;  1B59 A;  1TQM A;  2FQ3 A;  1XMA A;  2K27 A;  1IF1 A;  1USS A;  3P9K A;  4TV7 A;  2BEO A;  4EJO A;  3L9F A;  3CO7 C;  3C1D A;  3ROU A;  3DF8 A;  3WOD F;  4UVC A;  3WTT C;  2TDX A;  1TLH B;  3QRF F;  3FMQ A;  3PQK A;  1W5S A;  2D1V A;  2FOK A;  1IN8 A;  3HHH A;  1KYW A;  2M87 A;  1IRF A;  2VE8 A;  2G7H A;  3E5U A;  1J9I A;  4LK1 F;  1LDJ A;  1CF7 A;  4I2O A;  3DFG A;  4IPA A;  3KP2 A;  3IRR A;  4IJA A;  4IVN A;  6PAX A;  4M6X A;  3BOQ A;  3RIR A;  3L09 A;  3IHU A;  1LQ1 A;  2VN2 A;  3I5U A;  3SZT A;  1JHH A;  4IHT A;  3ECO A;  2ZJ2 A;  2MD5 A;  1ONV A;  1DDN A;  2OQG A;  2M5W A;  3KEO A;  4MEX F;  4MHG A;  2WC2 A;  2OU2 A;  2J5O A;  2CO5 A;  3LA2 A;  4KDP A;  5E1Z B;  1Z91 A;  3WTY C;  4BHC A;  4MQV A;  3L2C A;  4N9H A;  4Y17 A;  3V7R A;  1P2F A;  4KIC A;  3I54 A;  3WTV C;  4L0Y B;  1S8N A;  2MA3 A;  4ENJ A;  2HEO A;  2XKP A;  1K78 A;  3I4P A;  4ESF A;  5ILS A;  1HW5 A;  2PN6 A;  1MZB A;  2X0L A;  3J81 Z;  2MLK A;  3CO6 C;  4EJT A;  1FY7 A;  1FNN A;  4B09 A;  1FSE A;  1FLI A;  3C18 A;  2XUB A;  4CO8 A;  1DUX C;  5E1X A;  2YPR A;  4LG0 A;  5AON A;  2FMY A;  4R79 A;  5LEJ A;  1FBS A;  2EV6 A;  2PJP A;  4MGR A;  1D3Y A;  3B02 A;  4G7O F;  1OMI A;  5D5W B;  1I1G A;  3BZ6 A;  5JVT A;  5BQT A;  5ERI A;  2A3S A;  5CVU A;  5H6R A;  2IRF G;  5FD6 A;  1NHA A;  2K4B A;  1YS7 A;  2QEN A;  4KN7 X;  2K86 A;  3CJN A;  4PZJ A;  2PMH A;  2WV0 A;  3JW4 A;  1DP7 P;  3EET A;  1O3Q A;  3RI4 A;  3SZP A;  1T38 A;  3TDZ C;  4HV5 A;  1BN5 A;  2RV8 A;  3C3W A;  2WWY A;  1O7F A;  3TOB A;  3QPH A;  1PP7 U;  2ZNZ A;  1U2W A;  3C7J A;  2A07 F;  5E17 F;  4OMY A;  3TO6 A;  4IRI A;  1X3U A;  4UVA A;  1S6L A;  4U0Y A;  2VC1 A;  4LGW A;  2F5C A;  3BJO A;  1WQ2 A;  1FBQ A;  4DNC A;  2HQR A;  4P96 A;  3RYP A;  3BY6 A;  3ZMT A;  2A5Y B;  3ULQ B;  3W6K B;  5HLG A;  4WWC A;  4R1H A;  5CVJ A;  2CW0 F;  2EFP A;  5LHG A;  1I27 A;  1IRG A;  2B0L A;  5ICE A;  3J7A O;  5IT9 K;  4HYE A;  4JBA A;  2IPQ X;  4KN4 X;  2QQA A;  3GFL A;  4RS8 A;  1P4X A;  1BC7 C;  4P5O A;  1GHC A;  3BDD A;  3LWF A;  2FNA A;  2R7F A;  3RTR A;  1ZRC A;  4A6D A;  1UHW A;  1U5T A;  2PMU A;  1YLF A;  1RZ4 A;  3ERE D;  3FHZ A;  3IWZ A;  4L9T A;  5BS6 A;  4JK1 X;  3JTH A;  1QO0 D;  4HQE A;  3F22 A;  4UV8 A;  5ILV A;  1R7J A;  2M45 A;  2A6E F;  3BP8 A;  5AIQ A;  1TNT A;  2A61 A;  4Y13 A;  5KK1 A;  1BI1 A;  1T2K A;  2XAH A;  4IRG A;  3LA7 A;  1Z6T A;  3R6S A;  3K1M A;  3VFZ A;  3TGN A;  1XGM A;  1ZHF A;  5JI6 A;  3L7W A;  4XLP F;  3DXJ F;  1S29 A;  4XSZ F;  2KKO A;  1UB9 A;  4I98 B;  2PEX A;  4Q4Z F;  1XDS A;  1G3W A;  5E8I A;  2FBH A;  1LDD A;  2R7D A;  4UUV A;  4H0E A;  3K69 A;  1D5V A;  1BBY A;  2ESN A;  2GA1 A;  5HS8 A;  1XMK A;  3B73 A;  2EV5 A;  2K02 A;  1ZG3 A;  3CUQ C;  4M72 A;  2EFN A;  4ON0 A;  3F21 A;  2STT A;  2KIF A;  5D4S A;  2OZU A;  4RAZ A;  1ZG1 A;  1FZP B;  4KA4 A;  4IXA A;  2NNY A;  2KRF A;  2PFB A;  3NQO A;  2IT0 A;  2YSR A;  2H94 A;  2DFI A;  2W25 A;  3H3Z A;  3JAM K;  4N9I A;  3LAJ A;  1S7A A;  2DBB A;  2Q0O A;  2QZ8 A;  4EVI A;  1O3T A;  3TO9 A;  1FYK A;  5DDG A;  1XGS A;  3H92 A;  2COM A;  4L0Z B;  1CF7 B;  3GXO A;  2F5D A;  1AOY A;  5E18 F;  2XGX A;  3RPQ A;  1KGS A;  1TTY A;  3V8L A;  5D5V B;  2L02 A;  4NB5 A;  2M8E A;  5LGU A;  4I09 A;  1XSV A;  1SD6 A;  4OIQ F;  3E6C C;  2EV0 A;  4KMU X;  3QOP A;  3ZPL A;  4ZZD A;  1J2X A;  1ZRF A;  2ZBK A;  1RIO H;  2L4A A;  2H6B A;  4A6E A;  4CGZ A;  3ZN0 A;  2VE9 A;  1FP1 D;  1IZ1 A;  1JHF A;  1O3R A;  1P92 A;  1ON1 A;  5HDN A;  2A68 F;  2FU4 A;  3WGH A;  4KT5 C;  2IJL A;  1K78 B;  1BC8 C;  1H9G A;  2QBY A;  5J8F A;  2P5V A;  4WF2 A;  4JQF A;  2YU3 A;  1XD7 A;  1K6O A;  1LB2 A;  4O6J A;  1ZLJ A;  3HYI A;  5BPI A;  5DCM A;  3HTS B;  1OYI A;  3COA C;  5ICF A;  4LG0 B;  3F8F A;  3K1N A;  3CUQ A;  2D2W A;  3T0Y A;  3QU3 A;  3JSP A;  4I02 A;  4AD9 A;  3V8K A;  4PGH A;  5K5R A;  2WTE A;  2HS5 A;  1HKT A;  1RNL A;  3JTG A;  4Y15 A;  3J80 Z;  1BI0 A;  4AVP A;  4RGS A;  2K7L A;  4RGR A;  1EH6 A;  1ZAO A;  3O2P E;  5LHI A;  1QZY A;  3FX3 A;  2IVM A;  3EDP A;  1ZRE A;  2ADU A;  4OOI A;  3I71 A;  3VOE A;  5DUI A;  2MH2 A;  3MZY A;  3CDH A;  3ELK A;  2H27 A;  2EJR A;  2E1N A;  1F4K A;  1IN6 A;  1P6R A;  4GGG A;  2FNP A;  2M1B A;  4MQ9 F;  3BWG A;  1K7A A;  5FLX Z;  2ZCW A;  2R3S A;  5DD4 A;  4P9F A;  2Z33 A;  3F8C A;  3RPU A;  1VTN C;  4EGZ A;  4KNY A;  5L3B A;  3GFJ A;  3MFK A;  4RB3 C;  2BBY A;  2ISZ A;  2XAG A;  1KYZ A;  2RQP A;  3J81 K;  1V4R A;  3ZQ7 A;  1J7K A;  4M71 A;  4P55 A;  2Y48 A;  4HDU A;  3HTU A;  3GX4 X;  1QQI A;  2DT5 A;  2Y75 A;  2ZME A;  3H3U A;  3E5Q A;  1BOA A;  3ZN1 A;  2ELH A;  3Q9V A;  3NEU A;  2LDU A;  3M8E A;  3O3K A;  1MD0 A;  3HSR A;  1TNS A;  1R1U A;  1YQA A;  4M6Y A;  4ENK A;  1KQ9 A;  2GIV A;  1TW3 A;  3QPT A;  1TQI A;  5BOX A;  3QP6 A;  1OKR A;  3I64 A;  3R60 A;  1U5T B;  3VOD A;  2Z99 A;  5H20 A;  4ZYE A;  2Z9O A;  4QLC U;  2A69 F;  2ESH A;  3BPV A;  3LA3 A;  4KYW A;  4YII A;  3FMS A;  3U9G A;  5LHH A;  1FX7 A;  1UFM A;  1B6A A;  4CYD A;  2PI0 A;  3RYR A;  3F8M A;  1BI3 A;  4I7H A;  4HW0 A;  3V7S A;  3QU6 A;  1R1V A;  1YG2 A;  4HX4 A;  5CVV A;  2VBY A;  4A2U A;  3OV8 A;  4EQQ A;  1BI2 A;  2DO7 A;  2F2E A;  3T8R A;  4WXC A;  1ZG5 A;  5EEG A;  3FF5 A;  3PFI A;  1U5T C;  3DP7 A;  1JE8 A;  4YIF A;  4M9Z A;  5DYM A;  4HA8 A;  2HWV A;  1B1B A;  4HAM A;  4E70 A;  2DK5 A;  3KCC A;  3GF2 A;  4G6Q A;  2P7C B;  3KP3 A;  4WK8 F;  4EJV A;  3D0S A;  3TQN A;  3ABU A;  1P4W A;  2IW5 A;  1H9T A;  4WXH A;  3LQR A;  3HRT A;  5ILU A;  1B9N A;  3N97 A;  1IXR C;  5HLH A;  5HS7 A;  3T5X A;  1MJA A;  3M7G A;  1EH7 A;  2JT1 A;  3K9T A;  2CSO A;  2MBF A;  2VT3 A;  4HX7 A;  1ODD A;  4AIH A;  3FXU A;  5DUK A;  2GXB A;  1HXD A;  1Y0U A;  1U78 A;  2K4J A;  3V8J A;  1XB4 A;  1ZYR F;  2QUF A;  1P4A A;  4OIR F;  2P5K A;  1Z6R A;  5K5Q A;  5ICC A;  2PLY A;  1UHM A;  3DQV C;  4LMY A;  2HR3 A;  2DW4 A;  4HBL A;  2P6T A;  2CQK A;  2LSO A;  2F5E A;  1WI9 A;  3I53 A;  2HDC A;  4IF4 A;  3LFK A;  3KP4 A;  5JFR A;  1YS6 A;  4GCV A;  1XDU A;  1HBX G;  1WKM A;  2KJC A;  1R00 A;  5J8C A;  2YX7 A;  1XGN A;  4WXD A;  3CLO A;  1O57 A;  1UST A;  3RDI A;  3F23 A;  5JR3 A;  2LKP A;  3M9A A;  5LRR A;  2VOD A;  3ZMS A;  5TRD A;  1OPC A;  1PDN C;  2HZT A;  1AWC A;  4O5V A;  4A5N A;  4L9N A;  4FT8 A;  1IUY A;  3P7N A;  4L5J A;  3IKV A;  2QBY B;  2KJB A;  4FHT A;  1T0F A;  3HRS A;  2P6S A;  4KIG A;  2PBI A;  5DCM B;  1HST A;  1KQ0 A;  3GVA A;  5E20 A;  3VB2 A;  3T1B A;  4CXF A;  3R61 A;  1W7P A;  4YG2 F;  3QAH A;  1SD4 A;  4LLG F;  3CUQ B;  2GWR A;  5DEQ A;  1QNT A;  5FFZ A;  4OIP F;  3GUD A;  3G73 A;  3P9C A;  2MLG A;  3GWZ A;  1R5G A;  3WG9 A;  1FBU A;  4ETS A;  5K5O A;  3GEZ A;  2OZ6 A;  2IA0 A;  3KFW X;  3HOT A;  1F9N A;  2W85 A;  4Q47 A;  3MAJ A;  1YW8 A;  1YTY A;  1UCR A;  5IT9 Z;  3DKW A;  3FMR A;  1ULY A;  2UXX A;  3SQN A;  3IRQ A;  4HDV A;  1EH8 A;  1R5H A;  4XSX F;  1JGS A;  2EA2 A;  5D6E A;  5L3C A;  2UXN A;  1GXP A;  3KET A;  1MKM A;  4G8X A;  3HOS A;  4P9U A;  1T98 A;  1YIO A;  4LJZ F;  1BIA A;  3FM5 A;  1LVA A;  3U2R A;  3SHF A;  3M8F A;  3CTA A;  3GZ6 A;  4L9V A;  5F6F A;  4B8X A;  1QBJ A;  3GW2 A;  2ZNY A;  1L3L A;  4G9Y A;  2HYG D;  2L3D A;  5A2Q K;  4UXN A;  3JSO A;  3WU0 A;  1RUO A;  2JPB A;  2QWW A;  4M9S A;  1PUE E;  4RB2 C;  4A0Y A;  3DPL C;  3CUO A;  3FM3 A;  3Q5F A;  3M1E A;  3U1D A;  2Q8K A;  1CGP A;  2QVO A;  1HW1 A;  1XCV A;  1W5T A;  2KIU A;  2DAO A;  4U0W A;  2ZME B;  2OD5 A;  2BYV E;  3KP6 A;  1GVJ A;  3F8B A;  2BGC A;  2C6Y A;  1LNW A;  2RVC A;  1W7P D; 
#chains in the Genus database with same CATH topology
 2DN0 A;  3RKX A;  1MW7 A;  5HDG A;  1P9Q C;  2H09 A;  4A5M A;  4GDF A;  3BG3 A;  2FSW A;  3EYY A;  2FXA A;  4DZP A;  3UR3 C;  4HEA 2;  3MCZ A;  2FF4 A;  2A6H F;  2FA5 A;  3WU1 B;  3W6J B;  2YR2 A;  4Q48 A;  2DPU A;  1IXC A;  2L01 A;  1BA5 A;  4B3A A;  5K1Y A;  2IS4 A;  4AWX B;  1LKX A;  5LLQ A;  3LSJ A;  4CYC A;  4NNJ A;  4A3G J;  1FP2 A;  1ZGA A;  1HOM A;  2DOA A;  2DCE A;  4BS9 A;  1ETX A;  2BVM A;  3DV8 A;  1WJB A;  2M4K A;  4HG2 A;  1ITY A;  1HSJ A;  4U7D A;  1FMV A;  3J80 K;  1G3Y A;  1YE9 A;  2E34 A;  5M5Y J;  2CQN A;  4JP0 A;  2JN6 A;  3T8T A;  1WJC A;  4DQ2 A;  3S2W A;  5KNL A;  1SAN A;  4GYI A;  1FOW A;  4ASN A;  2M0M A;  3G3Z A;  3HZJ A;  3ZMU A;  2LG4 A;  2Z2S B;  2QM3 A;  3E6D A;  2Z1D A;  1QZZ A;  2HTS A;  2HYJ A;  4BBR J;  2RNJ A;  3Q0W A;  4KIF A;  1D0X A;  1PP8 F;  4G7Z F;  2OAZ A;  1MND A;  3OYF A;  4BYY A;  2QCO A;  2HVQ A;  3Q3S A;  2H8R A;  3GTG J;  3BPX A;  4HST A;  1BM9 A;  2BW3 B;  1YX3 A;  3ZCO A;  2VXD A;  2NAZ A;  2LF7 A;  3DCF A;  4BHB A;  2IAI A;  3MQ0 A;  1U3E M;  1IN7 A;  5CVR A;  5H2F C;  2XPU A;  3A2K A;  1ZEL A;  2QGU A;  3E6B A;  4A3B J;  4E7L A;  3OYE A;  4DOZ A;  2M30 A;  1PJR A;  3W2A A;  3HKZ N;  4M73 A;  2DPD A;  2DXI A;  4HV6 A;  2ZC2 A;  2ZO4 A;  5IP6 A;  1ZGJ A;  1JKP C;  3CME I;  1OCZ H;  4BQN A;  4M3B A;  2JUG A;  1A31 A;  5KAF C;  3RZD J;  1TWC J;  2FEZ A;  1JUP A;  2E1C A;  4PJM A;  4RM2 A;  4D9J A;  3BCB A;  3Q9S A;  4LLN A;  3F6V A;  2DI3 A;  2RGV A;  3I58 A;  4HOB A;  2W1O A;  2K40 A;  4OIO F;  5HOO A;  1WZ2 A;  2IGM A;  2DJN A;  4MNU A;  2LMD A;  4X6A J;  2JWT A;  3A02 A;  4HRI A;  2HKX A;  1MDM A;  3DLL F;  4XLN F;  1D5Y A;  2HYF A;  1BR4 A;  4LD5 A;  2R5Z B;  2V4J C;  4BXU A;  3I4N J;  3G1L A;  3EUH A;  2ZXJ A;  4PDK A;  1T33 A;  4MEY F;  2VBW A;  2VT2 A;  4LFU A;  5FJ8 J;  3V4G A;  2W24 A;  4KUM A;  4XN0 A;  4E7Z A;  4NHJ A;  1RUN A;  5F1J A;  3OYB A;  2V79 A;  2BE5 F;  3DU5 A;  3TOA A;  2EK5 A;  3I59 A;  4ESB A;  3I0T A;  2ACJ A;  3PIP F;  3E1S A;  1LDK B;  3QP5 A;  4KIS A;  4S05 A;  4XON A;  3CMY A;  3ECH A;  1YX5 A;  3ZMZ A;  1VFC A;  2CUZ A;  2FBI A;  3NRV A;  3ASO H;  2ZKZ A;  2IA1 A;  3RQI A;  2HFH A;  2EA4 A;  2V6C A;  3REO A;  3MZH A;  2OC6 A;  3AG2 H;  2HKO A;  4A0Z A;  4EMS A;  1ZR2 A;  3FXQ A;  2DQR A;  2X6O A;  1O7L A;  3FIS A;  3ISP A;  2Z3Y A;  4IKF A;  5D8L B;  1I1S A;  4FX4 A;  2KLO A;  2ETH A;  4MTD A;  2O61 A;  1E17 A;  2VOO A;  3MWM A;  1WWX A;  2RC4 A;  4HLX A;  2JA8 J;  4BJT A;  4UHT A;  1IN4 A;  1ZAR A;  1V5G A;  3G71 I;  2D45 A;  2R7Z J;  4UV9 A;  3O6B B;  2X1E A;  3HOZ J;  1JKR C;  2A5W A;  4OU0 A;  3E5X A;  3DBR B;  1ZN2 A;  4CIC A;  1KU3 A;  2FML A;  4L9J A;  2R7R A;  3M8J A;  1MGT A;  4XKW A;  4A3M J;  1YJW I;  1JXS A;  3SFZ A;  5FB2 A;  1XSX A;  4XLH A;  3BQZ A;  3HEF A;  3H9Q A;  3IH2 A;  2GLO A;  4L18 B;  2V6E A;  5L3G A;  3WGI A;  2GQQ A;  3CCM I;  2NVX J;  3VPR A;  2XHK A;  3OIQ A;  4RA2 A;  2KP6 A;  3PSI A;  4ZDL A;  2HGC A;  1N25 A;  3NAR A;  4D1Q A;  1V55 H;  4IHS A;  1Y1W J;  2NYX A;  2ELJ A;  5FLV A;  2QQ9 A;  2GXG A;  4XKB A;  3J7A Y;  4I6Z A;  1G8X A;  2CW7 A;  3K4M A;  3VYT B;  3LSG A;  5CVI A;  3FXR A;  3RJP A;  2DTR A;  4Y3O A;  1KU2 A;  1JJ8 C;  3HB9 A;  2VC0 A;  2KT0 A;  3F72 A;  3IAM 2;  4I0A A;  1OCT C;  2IS2 A;  3WTW C;  3K0L A;  1I39 A;  4I01 A;  3E97 A;  2VOP A;  2I10 A;  4XQF A;  4EM2 A;  1D8J A;  1G4D A;  1K79 A;  2IBD A;  2VPR A;  5L3F A;  3IKT A;  1ON2 A;  1FTZ A;  2MSY A;  1R9T J;  3EQL F;  3HOW J;  1BOB A;  1X1A A;  1W7P D;  3FDY A;  3C2H A;  3HPG A;  4NQW A;  2VJ4 A;  1FPQ A;  2FE3 A;  3FWE A;  3VSK A;  2ID6 A;  3PIO F;  4YEJ A;  3L2V A;  2HVS A;  1LFU P;  1KU9 A;  2XPW A;  2LBF B;  1FYL A;  1OYY A;  3L00 A;  3VYS B;  4EEF G;  3BRO A;  1MBF A;  4OMZ A;  1ZRD A;  1WI3 A;  2KL4 A;  4PCQ A;  3BG7 A;  4XOP A;  1YJ9 I;  3H0G J;  1R36 A;  5E8G A;  3O8H A;  2KIS A;  1Z9C A;  3HSE A;  3EYI A;  1DPR A;  1TP4 A;  1HCR A;  4BUP A;  4MIM A;  4LK0 F;  2O9L A;  2CYY A;  2DK8 A;  3IL2 A;  4D0P A;  5IT3 A;  2NVU B;  3E3V A;  3OOP A;  5DCF A;  3WTX C;  1RI7 A;  1I5Z A;  3K2Z A;  2VON A;  4ZC3 A;  4EJU A;  1B4A A;  1W7P B;  4BEH A;  5KVR A;  3GLX A;  1ZGW A;  2EWN A;  1WH5 A;  1YW9 A;  1ETQ A;  2JRM A;  2XAS A;  1KZH A;  2JSC A;  1YO5 C;  2DDB A;  4Y4R A;  3TW7 A;  3K4C A;  3PUB A;  1IG7 A;  1V5E A;  2RKH A;  1TW2 A;  1FOK A;  1WRJ A;  2ELK A;  5CQE A;  2J5P A;  1S7O A;  2JZY A;  1Y56 A;  1Q1H A;  1H89 C;  3AG4 H;  3ZP5 A;  3GO5 A;  1I3Q J;  4YFX F;  4HF0 A;  1XN7 A;  3ZXS A;  1QPM A;  3C2G A;  1OCO H;  2FOW A;  4A3F J;  1YI2 I;  3V7C A;  1YIT I;  2KDO A;  3BG9 A;  2AQF A;  3ABL H;  4IQ4 A;  2L7F P;  1D8K A;  4G7H F;  2VBX A;  4CUG A;  3BTC A;  3A4C A;  2P4W A;  2E7X A;  1SMY F;  2E2H J;  3KZZ A;  1HKQ A;  2QQB A;  2QKL B;  2K85 A;  4CH7 A;  5M5W J;  3QYB A;  4PGG A;  3LAP A;  3MKY B;  2HQN A;  1Z1D A;  3WTU C;  2LD5 A;  4MFD A;  1DGW Y;  3HIF A;  3LST A;  4MTE A;  2EZL A;  4DBQ A;  4RDU A;  4DZJ A;  4BNC A;  2MC3 A;  2X9D A;  1S3J A;  2COB A;  2V1X A;  3CQZ J;  2STW A;  1T39 A;  1SVM A;  2X6W A;  3KPH A;  5D8K B;  2VL8 A;  2PJR A;  2G0E A;  3KX2 A;  3FBN B;  2O5R A;  2RDP A;  1WSU A;  3C2B A;  3H5R A;  1UAA A;  2MFZ A;  3GFM A;  1R58 A;  1A04 A;  3OMY A;  2DLL A;  2WA0 A;  1I6X A;  2QYO A;  1KA8 A;  2GAU A;  1GXQ A;  4HQM A;  4E7I A;  3HC7 A;  3HHG A;  3RZO J;  1K4T A;  2CFO A;  3LSK A;  2ZFW A;  2O3F A;  3PFY A;  1MBK A;  2QLZ A;  5LEK A;  3FZV A;  3N4M A;  5EEH A;  2ID3 A;  2EH3 A;  3OIP A;  2OQR A;  2ZJQ F;  2AS5 F;  1U6G A;  2BVL A;  4A3E J;  4U87 A;  2XB0 X;  2YX4 A;  2DMU A;  2XVC A;  3K4K A;  3F6O A;  1IGN A;  1FWZ A;  5F27 A;  1Z67 A;  5EGO B;  2FBK A;  4FX0 A;  3DPT A;  4NC6 A;  1A36 A;  3K1P A;  5CJ9 A;  3KP7 A;  3SFI A;  1NK3 P;  1BJA A;  1UJ8 A;  1SFX A;  3ABM H;  3H5A A;  4IRH A;  1OYW A;  4F7Z A;  3CC4 I;  1TT0 A;  2VJJ A;  4ZH4 F;  3DKY A;  1MJ9 A;  1A5J A;  3QYE A;  2LRE A;  1UMQ A;  2TCT A;  5TJJ A;  4CCL A;  4ESJ A;  2V9V A;  4ITV A;  1FC3 A;  5LGT A;  5EYR A;  1NH3 A;  1G3S A;  2JK3 A;  4RB0 A;  4J19 A;  1ZLK A;  4AIJ A;  3KZY A;  3KE2 A;  3WTZ A;  4RGU A;  1K4S A;  3ZMV A;  3ZOB A;  3H36 A;  4B48 A;  2M0C A;  2OA4 A;  5TIS C;  3GTJ J;  1IV8 A;  3CCR I;  3ZRG A;  1LPQ A;  4P1W A;  4O3M A;  4CYC B;  1HDP A;  1TT5 B;  2LY1 A;  3IUO A;  5GP9 A;  5FGM A;  3CCJ I;  3PQJ A;  3VEP A;  5BMZ A;  2K3F A;  4CCJ A;  1HKS A;  2DU9 A;  2NS0 A;  3E0J B;  1EV7 A;  4BHP A;  1HC8 A;  4Y7N J;  4V2G A;  1HW2 A;  2K3P A;  3S16 J;  1BJZ A;  2L9N A;  4RLF A;  1W0U A;  2P5L C;  5FKL A;  5DD8 A;  3RKW A;  1Z7U A;  1UEL B;  2CG4 A;  2XB5 A;  3NWT A;  5D6F A;  3TDU C;  4XBF A;  5ICG A;  1VQ5 I;  4Q5S F;  1KON A;  2XAF A;  1F5T A;  4M74 A;  3MKZ A;  3BLY A;  4BH9 A;  3WGG A;  2D1H A;  4A0X A;  1TWG J;  2DA7 A;  4CZZ A;  5J1Y A;  1STZ A;  1U8R A;  3HUG A;  2KIM A;  2XAJ A;  2K9N A;  2WY8 Q;  5E3O A;  4ZDO A;  2CGP A;  5J4Y A;  5L3D A;  2L7M P;  1W1W E;  1G6N A;  2V9P A;  3B6C A;  3DEU A;  1G3T A;  1S5L C;  2JRT A;  1HQC A;  4BE0 A;  2X4H A;  3WHC A;  3GZ5 A;  1LJ9 A;  4YIR X;  1TZL A;  2DQL A;  5J40 A;  1X4O A;  1QGP A;  5B1B H;  4QWQ A;  4HX8 A;  9ANT A;  3MMY B;  2BV6 A;  2IA2 A;  1SFE A;  3BJA A;  4LLL A;  4UNO A;  5E1W A;  3AAF A;  2HDW A;  3BG6 A;  1D1A A;  3TP3 A;  1WGX A;  1ETY A;  1RKT A;  1YJN I;  3JRA A;  1ETW A;  2PG4 A;  4HSR A;  4C9Y A;  3K6G A;  4RBO A;  3KLN A;  2O03 A;  4K2E A;  3S93 A;  2RQQ A;  1PUF A;  1U9N A;  4BQO A;  5B5E C;  4NC8 A;  1SD5 A;  5HS9 A;  2VQG A;  2LC2 A;  1XCB A;  2XIG A;  3WTS C;  2Z5U A;  1AKH A;  2XRO A;  2O6G E;  1M1E B;  3WE3 A;  3PO3 J;  4KIB A;  2P8T A;  4LB6 B;  1MDM B;  3R0J A;  3RKY A;  1J59 A;  2VBZ A;  2HDD A;  3MN2 A;  2IP2 A;  2VQC A;  3H35 A;  4BAY A;  5FFX A;  4M3G A;  1YW7 A;  2A6T A;  4KMF A;  1R22 A;  2F5F A;  1IN5 A;  1FT9 A;  4LB5 A;  2HXI A;  2CH0 A;  5H6Q A;  3I59 B;  5E3L A;  4HLY A;  1SEU A;  1MMN A;  4A69 C;  4ZTJ A;  5JVG F;  4I0B A;  2E35 A;  2L7Z A;  3SXY A;  3F8N A;  1REP C;  2W57 A;  5J3L A;  1FYM A;  2FRH A;  5HVQ C;  1X3Z B;  4HZF A;  3J7Z I;  4N0B A;  2UZK A;  2JVG A;  3ML6 A;  5D5X B;  4BDZ A;  4Z2Y A;  1XMX A;  4D7M A;  2GA2 A;  4RB1 A;  4EGY A;  1XSD A;  1BW6 A;  1XGO A;  1R1T A;  4UVB A;  5IPA A;  2DMQ A;  1IDY A;  2XPV A;  3VDX A;  5HLI A;  3R0A A;  5F0H A;  3GFI A;  4KFC A;  3QQA A;  1V54 H;  2OBP A;  4XR6 A;  1V3F A;  1MJB A;  5LBQ A;  4OIN F;  2V1U A;  2VXZ A;  1SC7 A;  1YYV A;  3OS2 A;  2LY9 A;  4EM1 A;  5EDN A;  1R49 A;  1RR8 C;  2GXA A;  1OJL A;  3HKZ A;  1SFK A;  2RN7 A;  2BHZ A;  1EF4 A;  5LGN A;  5K7Z A;  3E7L A;  3LOC A;  5FD5 A;  2M9H A;  4WCG A;  5AIP A;  1Z3X A;  4BQA A;  4EM0 B;  2DMN A;  2JUC A;  4L5E A;  4BKX A;  5CPR B;  1V5F A;  1XPX A;  1KU7 A;  2QEX I;  2VJ5 A;  2IEK A;  3E6M A;  3P9I A;  4E4H A;  2E7W A;  2NRA C;  4FE4 A;  4ZYD A;  2OCC H;  2JTV A;  2XKO A;  1IUF A;  2NNN A;  3ABT A;  5CYV A;  3R4K A;  5GPA A;  4ZYH A;  5D4R A;  4BE2 A;  4ANJ A;  4MO7 A;  2L4M A;  4A93 J;  4IHY A;  1OR7 A;  2W84 A;  2LF8 A;  1VQK I;  5IP9 J;  3DU6 A;  2MAB A;  1X2N A;  3W2W A;  2MYS A;  1YFH A;  2VKV A;  3IWF A;  1KQ8 A;  3G4S I;  2DMP A;  1MSF C;  1W4M A;  2MH9 A;  4PJ0 C;  1B72 A;  1UZC A;  3K7A J;  5F04 A;  3GYH X;  3CCL I;  3I55 I;  2NS8 A;  4HF1 A;  3U1K A;  2LRD A;  3OYK A;  2B63 J;  3H9J A;  2XAQ A;  2PQ8 A;  5F1R A;  1LEB A;  3TKY A;  2B7E A;  4PJJ A;  4RAY A;  4WX9 A;  2Y0M A;  5IYC J;  3EUA A;  4ENM A;  3TO7 A;  2XV4 S;  1OCC H;  2JPC A;  4U88 A;  4XLA A;  3AG1 H;  3IC7 A;  2GBY A;  4NQW B;  1T6S A;  1Z05 A;  2CWE A;  3PSF A;  1L0O C;  4GO1 A;  3OR1 C;  5ED4 A;  1SFU A;  1C0W A;  5HDK A;  1VQM I;  2Q2E A;  2KZV A;  2HOE A;  3KLO A;  1VQP I;  1ZH5 A;  3KYL A;  5DV5 A;  2CFX A;  4XRF A;  2OTL I;  2AXL A;  3BJ6 A;  1XG1 A;  3CD6 I;  2QSG X;  2BZT A;  3FBI B;  1QHH D;  3CCE I;  2O7O A;  1F1Z A;  1TQP A;  2HZD A;  2WAE A;  4YFK F;  1K61 A;  5JHU A;  2EFO A;  3BR0 A;  4U0V A;  2UWM A;  1TBX A;  1IAW A;  4GXO A;  3OSG A;  2DFF A;  5CLS A;  3JAM Z;  3LQQ A;  4JX5 A;  4CHU A;  1B9M A;  3KP5 A;  5L3E A;  3BTJ A;  5D5U B;  4R8H A;  4ZYG A;  1ORK A;  1BIB A;  2R7O A;  3HRU A;  1W0T A;  4Y52 J;  5A2Q Z;  2GZW A;  2O0Y A;  2P7V B;  3JR9 A;  4I99 C;  4BEH B;  5J6X A;  1J5Y A;  3DLA A;  4DGW B;  4A3J J;  1JUM A;  2V1N A;  2H6C A;  4G6D A;  4PJN A;  2BY1 A;  3F3X A;  2JMW A;  3HRM A;  4GYG A;  3TP0 A;  4BU2 A;  2HOS A;  4YFN F;  4ENN A;  4EJW A;  1W36 C;  2ISY A;  4IL6 C;  4A12 A;  2EFQ A;  3CCV I;  1X1D A;  1SD7 A;  3JCU C;  3AKZ A;  2L5Q A;  3HSF A;  5HOD A;  1SMT A;  2G9W A;  3DWL E;  4G94 A;  2R5Y A;  4A3I J;  1R6R A;  2G7U A;  3MEX A;  3WG7 H;  5FLX K;  1ETV A;  3EUK L;  5EG0 A;  2HNH A;  2DA4 A;  4CCO A;  2VAS A;  4CDG A;  3UNG C;  3LSP A;  1RPW A;  1SAX A;  4ZDP A;  1IXS B;  2LKS A;  4II2 A;  1YHQ I;  3CC2 I;  1LEA A;  2OCE A;  4BE1 A;  2EFW A;  1JKQ C;  1FSH A;  2DT7 B;  4IX7 A;  1F43 A;  1O3S A;  2EIJ H;  4W97 A;  2HVR A;  5BPD A;  2XGC A;  2V1D A;  2LNB A;  1J75 A;  4PJL A;  4Z6Y A;  4FET A;  4BAC A;  1MMG A;  3CJQ B;  1DPU A;  2HTJ A;  1E3O C;  2L54 A;  3KEQ A;  3DKX A;  4S04 A;  1JUS A;  3ZMD A;  1A35 A;  2WAF A;  3FK7 A;  1R4M B;  3D5L A;  2GOX B;  2XRN A;  5IOZ A;  2R7W A;  2HQ5 A;  5FO5 A;  3L2R A;  3H9G A;  1H0M A;  2ZJP F;  5F64 A;  4PK4 A;  4U7B A;  2EQR A;  3WE2 A;  4RGX A;  2PJR B;  5LRS A;  1H8A C;  1I3A A;  4EV0 A;  2XF5 A;  3GBG A;  1TL8 A;  1IW7 F;  1J0R A;  4M9X A;  5HNF A;  4AIK A;  2EB7 A;  3KYD B;  1R23 A;  1IJW C;  4L5I A;  5C4J J;  2KRH A;  2IGO A;  1E2X A;  2O8X A;  3ZGK A;  4ZZL A;  5E3N A;  4X0G A;  2KPM A;  2OJE D;  4HF2 A;  1B59 A;  4XL9 A;  1TQM A;  2FQ3 A;  1XMA A;  2K27 A;  2MD0 A;  4D5F A;  1IF1 A;  1USS A;  2DYR H;  1F36 A;  3P9K A;  4TV7 A;  1ACI A;  2XF7 A;  3BR2 A;  3LSR A;  3OYI A;  1Y39 A;  3X2Q H;  2BEO A;  4EJO A;  3L9F A;  3CO7 C;  3C1D A;  3QPL A;  3ROU A;  4AUX A;  3DF8 A;  3BT9 A;  3WOD F;  1Z7L A;  2QQ8 A;  4UVC A;  3WTT C;  4QTR A;  2TDX A;  2W82 A;  1TLH B;  2F4I A;  1MBJ A;  1WCM J;  3KEY A;  3LFU A;  3FMQ A;  3A0H C;  2E36 A;  3PQK A;  4JX6 A;  3QRF F;  1DP3 A;  1W5S A;  2D1V A;  2L9R A;  2FOK A;  1J09 A;  1IN8 A;  3HHH A;  2X48 A;  4BXX J;  1KYW A;  2M87 A;  1IRF A;  2VE8 A;  2JQ7 A;  2G7H A;  2V7F A;  3E5U A;  5B66 C;  2V9K A;  1J9I A;  5F08 A;  1JT6 A;  4LK1 F;  1LDJ A;  1G2H A;  3PNV A;  4LIT A;  1RR7 A;  4BGD A;  1CF7 A;  4I2O A;  2PX9 A;  2CQQ A;  3DFG A;  4IPA A;  3NWS A;  3PUF A;  3KP2 A;  1FMW A;  1VQN I;  3IRR A;  4IJA A;  3CDL A;  1JT0 A;  5FKO A;  2I5U A;  4IVN A;  1PYV A;  1ENH A;  3BR3 A;  1RET A;  2MW8 A;  3AFH A;  6PAX A;  4M6X A;  3ESW B;  3BOQ A;  3RIR A;  2H1L A;  3L09 A;  3IHU A;  5CKT A;  1LQ1 A;  2VN2 A;  3I5U A;  5EF6 A;  3SZT A;  1JHH A;  3L1P A;  1AA7 A;  4IHT A;  3ECO A;  2ZJ2 A;  2MD5 A;  2EIN H;  1X3W B;  4FTH A;  1ONV A;  1FEX A;  1DDN A;  2OQG A;  2BXY A;  2M5W A;  5B1A H;  4E7K A;  1VQ7 I;  3KEO A;  4CCN A;  4MEX F;  2OPT A;  3S32 A;  4QPQ A;  2CQ7 A;  2ZXH A;  2WC2 A;  4MHG A;  2OU2 A;  3KYC B;  2L7K A;  2J5O A;  2W00 A;  4B44 A;  4BJ5 C;  2CO5 A;  1ETO A;  2L9V A;  3W3C A;  3LA2 A;  1IV6 A;  4KDP A;  5E79 C;  4XRM A;  4S0H B;  4DW6 A;  3HUG B;  4RLQ A;  1Y8Q B;  1IC8 A;  5E1Z B;  1Z91 A;  3WTY C;  3QPS A;  4BHC A;  4MQV A;  3L2C A;  3JRF A;  3D5S C;  3CF2 A;  3SYT A;  5KAI C;  2X85 A;  4N9H A;  3BTI A;  4Y17 A;  4LIV A;  2WB1 N;  3V7R A;  4AM3 A;  2QSF X;  2CUE A;  3GTQ J;  1P2F A;  4KIC A;  3I54 A;  2LVS A;  2E5N A;  2CUF A;  3WTV C;  4L0Y B;  1S8N A;  2MA3 A;  4ENJ A;  2DTZ A;  3S3N A;  2HEO A;  3S15 J;  2P81 A;  3ABK H;  2XKP A;  4KJZ A;  1K78 A;  5HNH A;  3I4P A;  1UG0 A;  4ESF A;  4PFP A;  5ILS A;  1HW5 A;  2PN6 A;  2GIZ A;  1MZB A;  2KQR A;  2X0L A;  3J81 Z;  2MLK A;  2L2O A;  3CO6 C;  4EJT A;  1FY7 A;  1FNN A;  1X2M A;  4B09 A;  1FSE A;  3IAS 2;  3L2W A;  1NK2 P;  2DA3 A;  4M3F A;  1PUF B;  1U9O A;  1VND A;  1FLI A;  2KZG A;  3C18 A;  2XUB A;  4CO8 A;  1DUX C;  4FAS D;  5K7F A;  2OV7 A;  4BJ6 C;  3M1C A;  5E1X A;  3JRH A;  2YPR A;  3G1O A;  4LG0 A;  1AKH B;  5AON A;  2FMY A;  2NXN B;  4R79 A;  2DYS H;  3U21 A;  1EKE A;  2FUG 2;  3OS0 A;  1A6I A;  1WJE A;  2IGK A;  4M6V A;  4IEJ A;  5LEJ A;  2R92 J;  2XRL A;  4XID A;  2KIQ A;  2K9S A;  1FBS A;  2JSP A;  3DPU A;  2EV6 A;  3B6A A;  1ZQ3 P;  1T95 A;  2PJP A;  1I50 J;  4MGR A;  2LP0 A;  1D3Y A;  3SDG A;  4OWR B;  3GCM A;  3B02 A;  3N05 A;  4G7O F;  1OMI A;  1P7J A;  4BL0 B;  3OYM A;  5LD2 C;  3L2Q A;  2DFE A;  4FIS A;  1GV2 A;  3H5N A;  5D5W B;  1I1G A;  3BZ6 A;  1VQL I;  5JVT A;  3FIW A;  5BQT A;  3FXJ A;  5ERI A;  1DGR M;  2E19 A;  2A3S A;  5CVU A;  1TWF J;  5H6R A;  4IHV A;  3TBI A;  2IRF G;  5FD6 A;  4M3D A;  1ERD A;  4E7S A;  4AYB N;  1NHA A;  2K4B A;  4B1R A;  1YS7 A;  3OS1 A;  2QEN A;  4KN7 X;  4LIU A;  2K86 A;  3CJN A;  4PZJ A;  2CV0 A;  2PMH A;  2DMT A;  2WV0 A;  4BY7 J;  5IYD J;  1W36 D;  2VIX A;  3JW4 A;  5FKM A;  1DP7 P;  3EET A;  1O3Q A;  2R93 J;  3WHB A;  3RI4 A;  4UB8 C;  3SZP A;  3OYH A;  1VQ8 I;  1T38 A;  3TDZ C;  1MH4 A;  3BZK A;  4HV5 A;  1GDT A;  1BN5 A;  2RV8 A;  3C3W A;  2WWY A;  2QSH X;  1O7F A;  3TOB A;  4XMY A;  1DQU A;  3ERM A;  3QPH A;  1PP7 U;  4MLO A;  1S72 I;  3HOX J;  1SVO A;  1O4X A;  3GTM J;  2ZNZ A;  1U2W A;  2ZSI B;  3FXL A;  3C7J A;  2A07 F;  5E17 F;  2LKX A;  4OMY A;  3TO6 A;  5JLX A;  2ECC A;  4IRI A;  1GT0 C;  1JGG A;  1VI0 A;  1X3U A;  4UVA A;  1S6L A;  4U0Y A;  2EIK H;  3H0D A;  4HPQ A;  4E6K G;  2VC1 A;  4LGW A;  1HA8 A;  1B72 B;  2F5C A;  3BJO A;  3CES A;  1I6H J;  1WQ2 A;  1FBQ A;  4KT6 A;  2HQR A;  1WJA A;  4DNC A;  4P96 A;  3RYP A;  3BY6 A;  2AHQ A;  5GTI C;  2E1O A;  4N4N B;  4XM3 A;  2IS1 A;  3ZMT A;  1GV5 A;  4QIW N;  2A5Y B;  3ULQ B;  3W6K B;  5HLG A;  4PSX A;  2R4G A;  4WWC A;  4R1H A;  1MH3 A;  5CVJ A;  2CW0 F;  1BL0 A;  3CMM A;  2WAD A;  2EFP A;  2HPI A;  5LHG A;  1I27 A;  2M8G X;  4JYK A;  1X1P A;  1IRG A;  2B0L A;  1T8I A;  5JHF A;  3OYC A;  5ICE A;  5DS9 A;  2NS7 A;  3J7A O;  1RKW A;  5IT9 K;  2Q2E B;  2HPM A;  4HYE A;  4JBA A;  2DFH A;  1TC3 C;  1VQ9 I;  5GPC A;  2IPQ X;  4KN4 X;  2QQA A;  1OR7 C;  3GFL A;  1R5I D;  3AG3 H;  2X1C A;  2AQE A;  4RS8 A;  1P4X A;  1WFX A;  2ECB A;  1BC7 C;  5C4X J;  4P5O A;  1GHC A;  3FXO A;  3BDD A;  1UHS A;  1OIS A;  3LWF A;  2FNA A;  2R7F A;  2LOO A;  3RTR A;  1ZRC A;  4A6D A;  4HNT A;  1UHW A;  1U5T A;  2PMU A;  3HGY A;  1YLF A;  2QA4 I;  1RZ4 A;  3ERE D;  3FHZ A;  3IWZ A;  5BNG A;  2XAU A;  3W2V A;  4L9T A;  1R71 A;  2FJ1 A;  5BS6 A;  4JK1 X;  3JTH A;  3FKJ A;  2QF7 A;  1QO0 D;  2BHY A;  3CCQ I;  2R0Q C;  4E7J A;  3ZQC A;  4II3 A;  5LFA A;  3OYD A;  4HQE A;  3F22 A;  2KHM A;  3BTL A;  4UV8 A;  1R7J A;  5ILV A;  2R5Y B;  2E2I J;  2GM4 A;  3OYN A;  2M45 A;  4NC7 A;  4MFE A;  3ZQH A;  1AU7 A;  2R7V A;  5EG0 B;  2R7T A;  2A6E F;  3BP8 A;  3PM1 A;  2P0W A;  5AIQ A;  1TNT A;  1ZTR A;  4ZTF A;  4OAY A;  2A61 A;  2X51 A;  1VF9 A;  4Y13 A;  2Z16 A;  4CSW A;  2LR8 A;  5KK1 A;  1BI1 A;  1PVE A;  5JLW A;  1T2K A;  4LG3 A;  4UUT A;  2XAH A;  2CMP A;  4IRG A;  3WU2 C;  3LA7 A;  1Z6T A;  2DJI A;  4EAT A;  3GTK J;  3R6S A;  3K1M A;  2DOF A;  2EIM H;  2F48 A;  5FRO A;  3VFZ A;  1JTX A;  3FK6 A;  3TGN A;  1XGM A;  1ZHF A;  5M3M J;  1Z77 A;  3BZC A;  2WAQ N;  5JI6 A;  3L7W A;  1MBE A;  4XLP F;  2XGE A;  2CW8 A;  2XSJ C;  3BC8 A;  1SVL A;  3DXJ F;  1S29 A;  4XSZ F;  1QPI A;  3A01 A;  2KKO A;  4F52 A;  1UB9 A;  2F4M B;  4I98 B;  2PEX A;  4Q4Z F;  1XDS A;  1G3W A;  2Y0S N;  5E8I A;  2FBH A;  4A3L J;  1LDD A;  2R7D A;  3CJR B;  4UUV A;  4H0E A;  1MMD A;  3K69 A;  1D5V A;  1BBY A;  2ESN A;  2GA1 A;  1XX5 A;  3F9K A;  1VZ0 A;  1IDZ A;  3GTP J;  5HS8 A;  3SJM A;  1XMK A;  2ME0 A;  3B73 A;  2EV5 A;  2XGD A;  2DDA A;  2K02 A;  2CQX A;  3S3O A;  1ZG3 A;  3CUQ C;  4M72 A;  2EFN A;  4UY8 I;  4ON0 A;  4IOC F;  1W5C C;  3F21 A;  2STT A;  2KIF A;  5D4S A;  4CA0 A;  1HF0 A;  2OZU A;  4RAZ A;  1ZG1 A;  1FZP B;  2E71 A;  3MKW B;  3JRE A;  3CF5 F;  4KA4 A;  4IXA A;  1G59 A;  2JJ7 A;  3LL7 A;  1OCP A;  2NNY A;  2KRF A;  4AVZ A;  2PFB A;  3NQO A;  2IT0 A;  2HI3 A;  2YSR A;  2H94 A;  2JA7 J;  3G1M A;  2EBI A;  5F0F A;  2DFI A;  2W25 A;  4AU7 A;  3DEW A;  3H3Z A;  4ZJZ A;  3JAM K;  3CC7 I;  4N9I A;  3LAJ A;  3OYJ A;  1ZKG A;  4BY1 J;  3DBL B;  1S7A A;  1BR2 A;  2BY2 A;  2DBB A;  2Q0O A;  4YEL A;  1QA6 A;  2R7U A;  2QZ8 A;  1LFB A;  4M3E A;  4EVI A;  2VLA A;  1O3T A;  2JA6 J;  3TO9 A;  1FYK A;  3HGG A;  1DU6 A;  5DDG A;  1XGS A;  2M4G A;  1S9H A;  2CS3 A;  2DOE A;  3H92 A;  3ZQI A;  3ZQG A;  2COM A;  3J7Y J;  2PMZ N;  4L0Z B;  2I8D A;  1CF7 B;  3GXO A;  2M3A A;  2F5D A;  2F5V A;  2ME6 A;  1AOY A;  1QHG A;  1YIJ I;  5E18 F;  2XGX A;  3HG9 A;  1XC5 A;  3DTI A;  4HNU A;  3RPQ A;  3JRG A;  1KGS A;  4KIT B;  4CCK A;  1TTY A;  3V8L A;  3K70 D;  5D5V B;  4FQG A;  1Y8R B;  4NUB A;  2L02 A;  4NB5 A;  2M8E A;  3LSI A;  5LGU A;  4I09 A;  1XSV A;  4G12 A;  4XK4 A;  1RC9 A;  1SD6 A;  2XDV A;  3VSL A;  3BR1 A;  4XOR A;  4OIQ F;  3OR2 C;  3E6C C;  2EV0 A;  4KMU X;  3QOP A;  3ZPL A;  4ZZD A;  1J2X A;  2LTP A;  1ZRF A;  2ZBK A;  3SZG A;  2XSD C;  1RIO H;  1YRN A;  2L4A A;  2B9S A;  2H6B A;  3ONQ A;  4A6E A;  4CGZ A;  3ZN0 A;  1DU0 A;  2VE9 A;  1FP1 D;  1IZ1 A;  5J47 A;  1JHF A;  1O3R A;  2DA5 A;  4C3J J;  5C44 J;  4IO9 F;  3OYA A;  1XS9 A;  5FKK A;  2WBM A;  1P92 A;  1ON1 A;  5HDN A;  2WV1 A;  3BR6 A;  3PJR A;  2A68 F;  2FU4 A;  3HOY J;  4N4O B;  2ZME C;  1OLT A;  3WGH A;  2H1K A;  4KT5 C;  2IJL A;  3TW6 A;  2JVH A;  3S14 J;  2RAE A;  2YUS A;  4I76 A;  2Y2Z A;  3DEE A;  1B8I A;  2EZI A;  1K78 B;  1BC8 C;  1H9G A;  3F0C A;  5J8F A;  2QBY A;  2P5V A;  4WF2 A;  4JQF A;  4XLE A;  2YU3 A;  3V42 A;  1MNM C;  1XD7 A;  3CCU I;  1K6O A;  1LB2 A;  4O6J A;  3PO2 J;  1ZLJ A;  3HYI A;  5BPI A;  5DCM A;  1D0Y A;  1K6Y A;  3HTS B;  1OYI A;  2ZXI A;  5FLM J;  3CDI A;  4IOA F;  3COA C;  1Z21 A;  3Q0V A;  2Y9Z A;  3CP8 A;  5ICF A;  1BW5 A;  5IOY A;  4CCM A;  2Y30 A;  1GUU A;  4LG0 B;  1OCR H;  3F8F A;  3ZQQ A;  3JRI A;  3K1N A;  2AO9 A;  2QKM B;  3CUQ A;  2D2W A;  1GLN A;  3T0Y A;  3QU3 A;  3JSP A;  3I9V 2;  1EJ9 A;  3OSF A;  4I02 A;  4AD9 A;  2GOM A;  2FX0 A;  2E5Z A;  3OL4 A;  3V8K A;  3CCS I;  5FRN A;  1OQY A;  4PGH A;  1MMS A;  2E60 A;  4D5C A;  5K5R A;  2CV1 A;  2WTE A;  1LVK A;  4UUS A;  1WJD A;  2HS5 A;  1X19 A;  4G6T B;  1HKT A;  1RNL A;  3MD2 A;  3HM5 A;  4PSW A;  3JTG A;  4Y15 A;  1ETK A;  5IP7 J;  3LNQ A;  4RAF A;  2E2J J;  3ZQL A;  5C3E J;  3J80 Z;  4BBS J;  1POG A;  5GAD J;  1BI0 A;  4AVP A;  1NTC A;  3LSH A;  2NVT J;  5B3S H;  4RGS A;  3CMA I;  2K7L A;  4RGR A;  1EH6 A;  1ZAO A;  2V26 A;  3O2P E;  5LHI A;  1QZY A;  3FX3 A;  2IVM A;  2EIL H;  3EDP A;  3MZ8 A;  5GAG J;  2ADU A;  4XKC A;  1A6Q A;  4OOI A;  1ZRE A;  3I71 A;  3VOE A;  5DUI A;  2MH2 A;  2VKD A;  3MZY A;  3CDH A;  2EZK A;  3ELK A;  2H27 A;  4CZC A;  2F4O B;  3FXK A;  1QVT A;  2W7N A;  2CU7 A;  2WB1 A;  3G2B A;  4X1E A;  2EJR A;  1QVU A;  3VYR B;  3TL4 X;  4XRS A;  2E1N A;  1F4K A;  5HLT A;  2VKE A;  4C2M J;  1IN6 A;  5J1R A;  2R7Q A;  2CJJ A;  1P6R A;  4GGG A;  4GRI A;  1FIA A;  2FNP A;  3D1N I;  2M1B A;  5TGT A;  2ICW G;  2Y9Y A;  4MQ9 F;  3BWG A;  1K7A A;  2ZJR F;  1K83 J;  4RM3 A;  5FLX Z;  2ZCW A;  2R3S A;  2W4S A;  2ZXW H;  3MKL A;  5DD4 A;  3DTK A;  2VPL A;  4P9F A;  3OOU A;  2OF7 A;  2Z33 A;  3S1Q J;  3F8C A;  3CCY A;  3RPU A;  1NG6 A;  1VTN C;  4BQQ A;  4EGZ A;  1XTA A;  4KNY A;  3PNY A;  5L3B A;  1D1B A;  3GFJ A;  4UB6 C;  3MFK A;  3QOD A;  4RB3 C;  5EZG A;  3K4L A;  3H3V K;  2BBY A;  2ISZ A;  3MVP A;  2XAG A;  3S8P A;  1KYZ A;  1Y1V J;  1BR1 A;  2JA2 A;  2RQP A;  3J81 K;  1V4R A;  3ZQ7 A;  1J7K A;  4M71 A;  3QOE A;  3P5J A;  3QYF A;  4XNF A;  5KCM A;  1S7E A;  4P55 A;  2BY3 A;  3M07 A;  2AXT C;  1ZR4 A;  2Y48 A;  4V19 K;  4HDU A;  2FQ4 A;  3HTU A;  3JRD A;  3GX4 X;  1LE8 A;  1QQI A;  2DT5 A;  2Y75 A;  2ZME A;  4IHW A;  3SEZ A;  2WY7 Q;  3H3U A;  3E5Q A;  1BOA A;  1YOV B;  2A05 A;  3ZN1 A;  1WJF A;  2N8G A;  3FKI J;  3IP4 B;  2ELH A;  3Q9V A;  2HQA A;  4H4K C;  1JTY A;  3NEU A;  3TMO A;  2LDU A;  2M34 A;  4E7H A;  2UV1 A;  3VWB A;  3M3Y J;  3FHN A;  3M8E A;  4OAZ A;  3O3K A;  1MD0 A;  3HSR A;  1TNS A;  1R1U A;  1YQA A;  4M6Y A;  4ENK A;  1EA3 A;  2K5C A;  2L9S A;  3K4B A;  1KQ9 A;  2GIV A;  1X1B A;  1TW3 A;  3QPT A;  5F0C A;  1HDD C;  3ZQF A;  1WJ5 A;  2O8K A;  2VI6 A;  2OTJ I;  1TQI A;  5BOX A;  3QP6 A;  4AYB A;  1OKR A;  3IV5 A;  1SFO J;  3I64 A;  3OWT A;  3R60 A;  3GLL A;  1RRJ A;  1U5T B;  3VOD A;  2Z99 A;  1MNE A;  5H20 A;  4ZYE A;  2OUM A;  2Z9O A;  4QLC U;  2A69 F;  3S1M J;  2ESH A;  3BPV A;  3LA3 A;  4KYW A;  4YII A;  3FMS A;  3U9G A;  5LHH A;  1FX7 A;  2Y31 A;  1UFM A;  2DA6 A;  1MBH A;  1B6A A;  3NAU A;  4CYD A;  2PI0 A;  3ASN H;  3BG5 A;  3RYR A;  3F8M A;  4RMN A;  3OY9 A;  1BI3 A;  1P7I A;  4I7H A;  5J4V A;  1JKO C;  2BW3 A;  4HW0 A;  2BOL A;  4IQJ A;  3DBH B;  1QU3 A;  3V7S A;  3QU6 A;  1R1V A;  1YG2 A;  3PNT A;  4F55 A;  2VJI A;  4J00 A;  2XF6 A;  4HX4 A;  3GME A;  5CVV A;  2VBY A;  4A2U A;  3OV8 A;  4EQQ A;  3K2A A;  4F93 B;  1WHU A;  2IS6 A;  1BI2 A;  2DO7 A;  2F2E A;  3T8R A;  3HOU J;  2NOG A;  4BDY A;  4WXC A;  4XOT A;  1ZG5 A;  1JI8 A;  1N77 A;  5EEG A;  3FF5 A;  3K4J A;  4NDL A;  3HOV J;  3PFI A;  1U5T C;  3DP7 A;  1JE8 A;  4YIF A;  3W6V A;  4M9Z A;  5DYM A;  1Y0N A;  2KMU A;  4HA8 A;  3RCO A;  3BQY A;  2HWV A;  4F91 B;  4A3D J;  1B1B A;  2Y69 H;  4HAM A;  3LSM A;  2VQH A;  1GVD A;  4E70 A;  1FJL A;  2MG4 A;  2DK5 A;  4XLF A;  4JOM A;  3KCC A;  1IRZ A;  3GF2 A;  4G6Q A;  3RPU D;  3L2U A;  2P7C B;  3GTL J;  2R7X A;  1T0F C;  4PFO A;  3A01 B;  2CV2 A;  3KP3 A;  2KDZ A;  1CQT A;  1VQ6 I;  4WK8 F;  1OFC X;  2VB6 A;  3D0S A;  2K9M A;  4EJV A;  3K70 C;  3TQN A;  2R5Z A;  1N75 A;  4Y33 A;  3ABU A;  3KZI C;  2MC4 A;  4C2T A;  2BY0 A;  1P4W A;  2K9Q A;  3M4O J;  5CQG A;  2IW5 A;  5DTD A;  1H9T A;  4A3C J;  4F92 B;  4WXH A;  4B3X A;  4J01 A;  3LQR A;  3HRT A;  5EZH A;  2LFB A;  5ILU A;  1B9N A;  3N97 A;  1IXR C;  3UKG A;  3BCA A;  3G6E I;  2VUM J;  1D0Z A;  5HLH A;  1E3P A;  5HS7 A;  3T5X A;  3JRB A;  1MJA A;  1R4N B;  2LYC A;  3M7G A;  1QZE A;  1EH7 A;  3GTO J;  2FD5 A;  5J1U A;  1FOY A;  1ZK8 A;  2HOA A;  2LLK A;  2CRG A;  2JT1 A;  3K9T A;  2CSO A;  1MIJ A;  2NOJ B;  2MBF A;  2VT3 A;  4DBR A;  4F3Q A;  1Z3Y A;  3RQ4 A;  4HX7 A;  1IO2 A;  1ODD A;  4AIH A;  3FXU A;  4DYR A;  2UUZ A;  5DUK A;  2LK2 A;  2ZSH B;  1N78 A;  4C3I J;  3TED A;  1HXD A;  4B4C A;  2GXB A;  1Y0U A;  2VKH A;  2HU9 A;  3I56 I;  1U78 A;  3GZN B;  3S2H J;  1H88 C;  2K4J A;  3V8J A;  1XB4 A;  1ZYR F;  3FXM A;  4FCY A;  2KRC A;  3S3M A;  3OL3 A;  3HL2 A;  3A1Y A;  2QUF A;  1P4A A;  4XIC A;  4OIR F;  2P5K A;  1Z6R A;  5K5Q A;  2KFD A;  5ICC A;  2PLY A;  1UHM A;  3DQV C;  2WAQ A;  4LMY A;  5DM6 F;  2HR3 A;  3S2D J;  2K9L A;  1VQO I;  2DW4 A;  4HBL A;  2P6T A;  4LOC A;  4YRV A;  2CQK A;  2H8W A;  2F5E A;  2LSO A;  3CP2 A;  1WI9 A;  3I53 A;  2HDC A;  3OYL A;  2IXS A;  4IF4 A;  3A0B C;  4D7N A;  3CZ6 A;  3LFK A;  3KP4 A;  5GTH C;  5JFR A;  2RNG A;  4RAG A;  1YS6 A;  2Y0S A;  1IRX A;  1YRN B;  2R7S A;  1Q1V A;  4GCV A;  1XDU A;  3OIO A;  1HBX G;  1WKM A;  1QRY A;  2KJC A;  1APL C;  1VQ4 I;  4GFB A;  1R00 A;  3K10 A;  4DIQ A;  5J8C A;  3H1C A;  2YX7 A;  1WH7 A;  3CJT B;  1XGN A;  4XN3 A;  4WXD A;  3CLO A;  4ABZ A;  4XRS G;  1O57 A;  1UST A;  4JX4 A;  3RDI A;  5LRR A;  2LKP A;  3M9A A;  5JR3 A;  3F23 A;  1AHD P;  2VOD A;  3ZMS A;  5DM7 F;  5TRD A;  1OPC A;  1PDN C;  1TWA J;  2HXO A;  1MMA A;  3ZR8 X;  1FOX A;  2HZT A;  2F6C A;  1AWC A;  4O5V A;  2RRE A;  5E3M A;  4FE7 A;  2HOT A;  2LBF A;  2EPF A;  4A5N A;  4L9N A;  4FT8 A;  3KIO A;  2IGN A;  1X58 A;  1IUY A;  3P7N A;  5EEA A;  4L5J A;  1B8I B;  3IKV A;  1LFP A;  2MGQ A;  1D1C A;  2DA2 A;  5GAE J;  2QBY B;  2KJB A;  3S1R J;  4FHT A;  4DYC A;  1T0F A;  3HRS A;  4BXF A;  2P6S A;  4KIG A;  2PBI A;  5DCM B;  1HST A;  1KQ0 A;  3GVA A;  5E20 A;  1Z0X A;  3VB2 A;  2D5V A;  3HDD A;  3LMM A;  3T1B A;  4CXF A;  5M3F J;  1T56 A;  3R61 A;  1W7P A;  4YG2 F;  3QAH A;  4AID A;  4XLC A;  3HBL A;  1SD4 A;  3RSN A;  4LLG F;  3CUQ B;  2GWR A;  5GAH J;  5DEQ A;  2PMZ A;  3HPH A;  1QNT A;  5FFZ A;  3AL0 B;  1HLV A;  1MBG A;  4OIP F;  1X4P A;  3GUD A;  3G73 A;  1UG2 A;  2LY2 A;  1NG7 A;  3P9C A;  2MLG A;  3S1N J;  4NBQ A;  3GWZ A;  5FRM A;  1R5G A;  3WG9 A;  1FBU A;  3QWL A;  1TWH J;  4ETS A;  5K5O A;  4UUS B;  3HJE A;  3GEZ A;  3VYU B;  1MSE C;  3CLQ A;  3D5R C;  2OZ6 A;  3I3L A;  2M7A A;  5M5X J;  2IA0 A;  3KFW X;  4AC0 A;  2X1D A;  2EZH A;  3HOT A;  1JJ6 C;  1F9N A;  3PL8 A;  5IY5 H;  2E1M B;  3I4M J;  3EPZ A;  2W85 A;  4Q47 A;  3MAJ A;  1YW8 A;  1FTT A;  1YTY A;  1UCR A;  2BXZ A;  5IT9 Z;  3JRC A;  3DKW A;  3FMR A;  1LUJ B;  1FIP A;  4W1U A;  2NVQ J;  1T08 B;  1ULY A;  2UXX A;  3SQN A;  1RES A;  3IRQ A;  1E0E A;  4HDV A;  1Y6I A;  3IH4 A;  1EH8 A;  1R5H A;  4XSX F;  1X1C A;  3Q0U A;  5IYB J;  3IH3 A;  1U0J A;  1JGS A;  2EA2 A;  2LH9 A;  5D6E A;  3O8G A;  3AL0 C;  2Q1Z B;  3SEQ A;  5L3C A;  2UXN A;  1GXP A;  3KET A;  1MKM A;  4G8X A;  3HOS A;  4IZZ A;  2CUJ A;  2M7B A;  1E3H A;  4P9U A;  1T98 A;  1YIO A;  4LJZ F;  1WVR A;  1SAU A;  1BIA A;  3FM5 A;  1LVA A;  4PUS A;  3U2R A;  3A03 A;  3BR5 A;  2M2E A;  2NVY J;  3SHF A;  3M8F A;  3S17 J;  4IHX A;  5K7H A;  3CTA A;  3GZ6 A;  2X6Y A;  4L9V A;  2ZB9 A;  4C3H J;  4B43 A;  2XC7 A;  5F6F A;  2E1M C;  4B8X A;  1QBJ A;  3GW2 A;  4XKV A;  2ZNY A;  1L3L A;  4ZYA A;  4C30 A;  4G9Y A;  2DT6 A;  2W48 A;  2HYG D;  2L3D A;  5A2Q K;  5EJC A;  4UXN A;  3JSO A;  2TRT A;  3EUH C;  3WU0 A;  2JPB A;  3OYG A;  1RUO A;  2QWW A;  4M9S A;  2VQL A;  5KHD A;  1PUE E;  4QSH A;  4DYQ A;  4RB2 C;  4A0Y A;  4DJA A;  1U8B A;  5EGO A;  3DPL C;  2JA5 J;  2YU9 J;  3CUO A;  3FM3 A;  3Q5F A;  3K4N A;  3M1E A;  4QPO A;  3U1D A;  4C2U A;  2Q8K A;  1CGP A;  2DA1 A;  5FKN A;  4B47 A;  3DTE A;  2QVO A;  3RKQ A;  1HW1 A;  1XCV A;  1W5T A;  4A3K J;  2KIU A;  2DAO A;  4V2F A;  4U0W A;  2ZME B;  2OD5 A;  2BYV E;  2ZFU A;  1LE8 B;  2YS9 A;  3KP6 A;  3HXL A;  1GVJ A;  3F8B A;  2DOD A;  1WPK A;  4HNV A;  2BGC A;  3SDB A;  2C6Y A;  1LNW A;  2X6X A;  2RVC A;  2L0K A; 
#chains in the Genus database with same CATH homology
 3RKX A;  5HDG A;  2H09 A;  4A5M A;  2FSW A;  3EYY A;  2FXA A;  3MCZ A;  2FF4 A;  2A6H F;  2FA5 A;  3WU1 B;  3W6J B;  2YR2 A;  4Q48 A;  2DPU A;  1IXC A;  2L01 A;  5K1Y A;  4AWX B;  5LLQ A;  1FP2 A;  1ZGA A;  3DV8 A;  1HSJ A;  4U7D A;  3J80 K;  1G3Y A;  3T8T A;  4DQ2 A;  3S2W A;  4GYI A;  4ASN A;  3G3Z A;  3ZMU A;  2QM3 A;  3E6D A;  1QZZ A;  2HTS A;  2RNJ A;  4KIF A;  1PP8 F;  4G7Z F;  2OAZ A;  4BYY A;  3BPX A;  1BM9 A;  4BHB A;  2NAZ A;  2LF7 A;  3MQ0 A;  1U3E M;  1IN7 A;  5CVR A;  3E6B A;  2M30 A;  4M73 A;  2DPD A;  4HV6 A;  2ZO4 A;  1ZGJ A;  2FEZ A;  2E1C A;  3Q9S A;  4LLN A;  3F6V A;  2DI3 A;  2RGV A;  3I58 A;  4HOB A;  4OIO F;  5HOO A;  4MNU A;  2HKX A;  1MDM A;  4XLN F;  2HYF A;  4LD5 A;  4BXU A;  3EUH A;  2ZXJ A;  4PDK A;  4MEY F;  2VBW A;  2VT2 A;  4LFU A;  3V4G A;  2W24 A;  4KUM A;  4NHJ A;  1RUN A;  2V79 A;  2BE5 F;  3TOA A;  2EK5 A;  3I59 A;  4ESB A;  3I0T A;  2ACJ A;  1LDK B;  3QP5 A;  4S05 A;  3ECH A;  3ZMZ A;  2FBI A;  3NRV A;  2ZKZ A;  2IA1 A;  2HFH A;  2EA4 A;  2V6C A;  3REO A;  3MZH A;  4A0Z A;  2HKO A;  4EMS A;  3FXQ A;  2DQR A;  1O7L A;  3ISP A;  2Z3Y A;  5D8L B;  1I1S A;  4FX4 A;  2ETH A;  4MTD A;  2O61 A;  1E17 A;  2VOO A;  3MWM A;  1WWX A;  2RC4 A;  4HLX A;  4UHT A;  1IN4 A;  1ZAR A;  2D45 A;  4UV9 A;  3O6B B;  4OU0 A;  3E5X A;  1ZN2 A;  4CIC A;  1KU3 A;  2FML A;  4L9J A;  1MGT A;  1JXS A;  3SFZ A;  5FB2 A;  1XSX A;  4L18 B;  5L3G A;  3WGI A;  2GQQ A;  2XHK A;  2HGC A;  4IHS A;  2NYX A;  2QQ9 A;  2GXG A;  5CVI A;  3FXR A;  3RJP A;  2DTR A;  1KU2 A;  2VC0 A;  3F72 A;  4I0A A;  3WTW C;  3K0L A;  4I01 A;  3E97 A;  2VOP A;  4EM2 A;  1D8J A;  1G4D A;  1K79 A;  5L3F A;  3IKT A;  1ON2 A;  3EQL F;  4NQW A;  1FPQ A;  2FE3 A;  3FWE A;  1KU9 A;  1FYL A;  1OYY A;  3L00 A;  3BRO A;  4OMZ A;  1ZRD A;  4PCQ A;  5E8G A;  1R36 A;  1Z9C A;  3HSE A;  3EYI A;  1DPR A;  4LK0 F;  2CYY A;  2DK8 A;  3IL2 A;  4D0P A;  5IT3 A;  3E3V A;  3OOP A;  5DCF A;  3WTX C;  1RI7 A;  1I5Z A;  3K2Z A;  2VON A;  4EJU A;  1B4A A;  1W7P B;  5KVR A;  3GLX A;  2EWN A;  1YW9 A;  2XAS A;  2JSC A;  1YO5 C;  1FOK A;  2RKH A;  1TW2 A;  1WRJ A;  2J5P A;  1S7O A;  2JZY A;  1Q1H A;  3ZP5 A;  3GO5 A;  4YFX F;  4HF0 A;  1XN7 A;  1QPM A;  3V7C A;  1D8K A;  4G7H F;  2VBX A;  2P4W A;  2E7X A;  1SMY F;  3KZZ A;  1HKQ A;  2QQB A;  4PGG A;  3LAP A;  2HQN A;  1Z1D A;  3WTU C;  3HIF A;  3LST A;  4MTE A;  4BNC A;  2MC3 A;  1S3J A;  2V1X A;  2STW A;  1T39 A;  5D8K B;  1WSU A;  2RDP A;  3GFM A;  1R58 A;  1A04 A;  2DLL A;  1I6X A;  2QYO A;  1KA8 A;  2GAU A;  1GXQ A;  4HQM A;  3HHG A;  2ZFW A;  2O3F A;  2QLZ A;  5LEK A;  3FZV A;  3N4M A;  5EEH A;  2OQR A;  2AS5 F;  1U6G A;  2YX4 A;  2XVC A;  3F6O A;  1FWZ A;  2FBK A;  4FX0 A;  3DPT A;  3K1P A;  5CJ9 A;  3KP7 A;  1BJA A;  1SFX A;  4IRH A;  1OYW A;  4F7Z A;  4ZH4 F;  1MJ9 A;  5TJJ A;  4ESJ A;  2V9V A;  1FC3 A;  5LGT A;  1G3S A;  4RB0 A;  1ZLK A;  4AIJ A;  3KZY A;  3KE2 A;  3WTZ A;  4RGU A;  3ZMV A;  2OA4 A;  4O3M A;  5FGM A;  3PQJ A;  3VEP A;  5BMZ A;  1HKS A;  2DU9 A;  2NS0 A;  1EV7 A;  4BHP A;  1HW2 A;  2P5L C;  5DD8 A;  3RKW A;  1Z7U A;  2CG4 A;  3TDU C;  5D6F A;  4XBF A;  5ICG A;  4Q5S F;  2XAF A;  1F5T A;  4M74 A;  4BH9 A;  3WGG A;  2D1H A;  4A0X A;  4CZZ A;  1STZ A;  1U8R A;  3HUG A;  2KIM A;  2XAJ A;  2CGP A;  5L3D A;  1G6N A;  3DEU A;  1G3T A;  2JRT A;  1HQC A;  2X4H A;  3GZ5 A;  1LJ9 A;  2DQL A;  1QGP A;  4QWQ A;  4HX8 A;  2BV6 A;  2IA2 A;  1SFE A;  3BJA A;  4LLL A;  4UNO A;  5E1W A;  3AAF A;  2PG4 A;  3KLN A;  2O03 A;  4K2E A;  1SD5 A;  5HS9 A;  1XCB A;  2XIG A;  3WTS C;  2Z5U A;  2XRO A;  2O6G E;  3WE3 A;  4KIB A;  2P8T A;  4LB6 B;  1MDM B;  3R0J A;  3RKY A;  1J59 A;  2VBZ A;  2IP2 A;  4BAY A;  5FFX A;  1YW7 A;  4KMF A;  1R22 A;  2F5F A;  1IN5 A;  1FT9 A;  4LB5 A;  5H6Q A;  3I59 B;  4HLY A;  4I0B A;  3SXY A;  3F8N A;  1REP C;  2W57 A;  1FYM A;  2FRH A;  5HVQ C;  4HZF A;  4N0B A;  2UZK A;  3ML6 A;  5D5X B;  4Z2Y A;  4EGY A;  2GA2 A;  4RB1 A;  1XSD A;  1XGO A;  1R1T A;  4UVB A;  5HLI A;  3R0A A;  3GFI A;  4KFC A;  2OBP A;  1V3F A;  1MJB A;  5LBQ A;  4OIN F;  2V1U A;  2VXZ A;  1YYV A;  4EM1 A;  2RN7 A;  5LGN A;  5FD5 A;  4WCG A;  5AIP A;  4BQA A;  4EM0 B;  1KU7 A;  3E6M A;  3P9I A;  2E7W A;  2NRA C;  4ZYD A;  2JTV A;  2XKO A;  3ABT A;  2NNN A;  5CYV A;  5D4R A;  3R4K A;  4ZYH A;  2L4M A;  1OR7 A;  2W84 A;  2LF8 A;  1YFH A;  3IWF A;  1KQ8 A;  1W4M A;  2MH9 A;  3GYH X;  4HF1 A;  2XAQ A;  2PQ8 A;  5F1R A;  1LEB A;  3TKY A;  4RAY A;  4WX9 A;  2Y0M A;  4ENM A;  3TO7 A;  2XV4 S;  2JPC A;  4U88 A;  3IC7 A;  1T6S A;  1Z05 A;  2CWE A;  1L0O C;  4GO1 A;  5ED4 A;  1SFU A;  1C0W A;  5HDK A;  2Q2E A;  3KLO A;  2HOE A;  1ZH5 A;  5DV5 A;  2CFX A;  4XRF A;  2AXL A;  3BJ6 A;  1F1Z A;  1TQP A;  4YFK F;  5JHU A;  2EFO A;  4U0V A;  2UWM A;  1TBX A;  1IAW A;  4GXO A;  5CLS A;  3JAM Z;  3LQQ A;  4CHU A;  1B9M A;  3KP5 A;  5L3E A;  5D5U B;  4R8H A;  4ZYG A;  1BIB A;  3HRU A;  5A2Q Z;  2GZW A;  2O0Y A;  2P7V B;  5J6X A;  1J5Y A;  2H6C A;  4G6D A;  3F3X A;  3HRM A;  4GYG A;  4YFN F;  4ENN A;  4EJW A;  2ISY A;  4A12 A;  2EFQ A;  1SD7 A;  3HSF A;  1SMT A;  2G9W A;  4G94 A;  2G7U A;  3MEX A;  5FLX K;  4CDG A;  1SAX A;  1IXS B;  1LEA A;  2EFW A;  1FSH A;  1O3S A;  5BPD A;  2V1D A;  2LNB A;  1J75 A;  1DPU A;  2HTJ A;  2L54 A;  3KEQ A;  4S04 A;  3ZMD A;  3D5L A;  2XRN A;  5FO5 A;  1H0M A;  5F64 A;  4U7B A;  3WE2 A;  4RGX A;  5LRS A;  4EV0 A;  1IW7 F;  1J0R A;  4AIK A;  4M9X A;  2EB7 A;  1R23 A;  4L5I A;  1E2X A;  2O8X A;  4ZZL A;  4HF2 A;  1B59 A;  1TQM A;  2FQ3 A;  1XMA A;  2K27 A;  1IF1 A;  1USS A;  3P9K A;  4TV7 A;  2BEO A;  4EJO A;  3L9F A;  3CO7 C;  3C1D A;  3ROU A;  3DF8 A;  3WOD F;  4UVC A;  3WTT C;  2TDX A;  1TLH B;  3QRF F;  3FMQ A;  3PQK A;  1W5S A;  2D1V A;  2FOK A;  1IN8 A;  3HHH A;  1KYW A;  2M87 A;  1IRF A;  2VE8 A;  2G7H A;  3E5U A;  1J9I A;  4LK1 F;  1LDJ A;  1CF7 A;  4I2O A;  3DFG A;  4IPA A;  3KP2 A;  3IRR A;  4IJA A;  4IVN A;  6PAX A;  4M6X A;  3BOQ A;  3RIR A;  3L09 A;  3IHU A;  1LQ1 A;  2VN2 A;  3I5U A;  3SZT A;  1JHH A;  4IHT A;  3ECO A;  2ZJ2 A;  2MD5 A;  1ONV A;  1DDN A;  2OQG A;  2M5W A;  3KEO A;  4MEX F;  4MHG A;  2WC2 A;  2OU2 A;  2J5O A;  2CO5 A;  3LA2 A;  4KDP A;  5E1Z B;  1Z91 A;  3WTY C;  4BHC A;  4MQV A;  3L2C A;  4N9H A;  4Y17 A;  3V7R A;  1P2F A;  4KIC A;  3I54 A;  3WTV C;  4L0Y B;  1S8N A;  2MA3 A;  4ENJ A;  2HEO A;  2XKP A;  1K78 A;  3I4P A;  4ESF A;  5ILS A;  1HW5 A;  2PN6 A;  1MZB A;  2X0L A;  3J81 Z;  2MLK A;  3CO6 C;  4EJT A;  1FY7 A;  1FNN A;  4B09 A;  1FSE A;  1FLI A;  3C18 A;  2XUB A;  4CO8 A;  1DUX C;  5E1X A;  2YPR A;  4LG0 A;  5AON A;  2FMY A;  4R79 A;  5LEJ A;  1FBS A;  2EV6 A;  2PJP A;  4MGR A;  1D3Y A;  3B02 A;  4G7O F;  1OMI A;  5D5W B;  1I1G A;  3BZ6 A;  5JVT A;  5BQT A;  5ERI A;  2A3S A;  5CVU A;  5H6R A;  2IRF G;  5FD6 A;  1NHA A;  2K4B A;  1YS7 A;  2QEN A;  4KN7 X;  2K86 A;  3CJN A;  4PZJ A;  2PMH A;  2WV0 A;  3JW4 A;  1DP7 P;  3EET A;  1O3Q A;  3RI4 A;  3SZP A;  1T38 A;  3TDZ C;  4HV5 A;  1BN5 A;  2RV8 A;  3C3W A;  2WWY A;  1O7F A;  3TOB A;  3QPH A;  1PP7 U;  2ZNZ A;  1U2W A;  3C7J A;  2A07 F;  5E17 F;  4OMY A;  3TO6 A;  4IRI A;  1X3U A;  4UVA A;  1S6L A;  4U0Y A;  2VC1 A;  4LGW A;  2F5C A;  3BJO A;  1WQ2 A;  1FBQ A;  4DNC A;  2HQR A;  4P96 A;  3RYP A;  3BY6 A;  3ZMT A;  2A5Y B;  3ULQ B;  3W6K B;  5HLG A;  4WWC A;  4R1H A;  5CVJ A;  2CW0 F;  2EFP A;  5LHG A;  1I27 A;  1IRG A;  2B0L A;  5ICE A;  3J7A O;  5IT9 K;  4HYE A;  4JBA A;  2IPQ X;  4KN4 X;  2QQA A;  3GFL A;  4RS8 A;  1P4X A;  1BC7 C;  4P5O A;  1GHC A;  3BDD A;  3LWF A;  2FNA A;  2R7F A;  3RTR A;  1ZRC A;  4A6D A;  1UHW A;  1U5T A;  2PMU A;  1YLF A;  1RZ4 A;  3ERE D;  3FHZ A;  3IWZ A;  4L9T A;  5BS6 A;  4JK1 X;  3JTH A;  1QO0 D;  4HQE A;  3F22 A;  4UV8 A;  5ILV A;  1R7J A;  2M45 A;  2A6E F;  3BP8 A;  5AIQ A;  1TNT A;  2A61 A;  4Y13 A;  5KK1 A;  1BI1 A;  1T2K A;  2XAH A;  4IRG A;  3LA7 A;  1Z6T A;  3R6S A;  3K1M A;  3VFZ A;  3TGN A;  1XGM A;  1ZHF A;  5JI6 A;  3L7W A;  4XLP F;  3DXJ F;  1S29 A;  4XSZ F;  2KKO A;  1UB9 A;  4I98 B;  2PEX A;  4Q4Z F;  1XDS A;  1G3W A;  5E8I A;  2FBH A;  1LDD A;  2R7D A;  4UUV A;  4H0E A;  3K69 A;  1D5V A;  1BBY A;  2ESN A;  2GA1 A;  5HS8 A;  1XMK A;  3B73 A;  2EV5 A;  2K02 A;  1ZG3 A;  3CUQ C;  4M72 A;  2EFN A;  4ON0 A;  3F21 A;  2STT A;  2KIF A;  5D4S A;  2OZU A;  4RAZ A;  1ZG1 A;  1FZP B;  4KA4 A;  4IXA A;  2NNY A;  2KRF A;  2PFB A;  3NQO A;  2IT0 A;  2YSR A;  2H94 A;  2DFI A;  2W25 A;  3H3Z A;  3JAM K;  4N9I A;  3LAJ A;  1S7A A;  2DBB A;  2Q0O A;  2QZ8 A;  4EVI A;  1O3T A;  3TO9 A;  1FYK A;  5DDG A;  1XGS A;  3H92 A;  2COM A;  4L0Z B;  1CF7 B;  3GXO A;  2F5D A;  1AOY A;  5E18 F;  2XGX A;  3RPQ A;  1KGS A;  1TTY A;  3V8L A;  5D5V B;  2L02 A;  4NB5 A;  2M8E A;  5LGU A;  4I09 A;  1XSV A;  1SD6 A;  4OIQ F;  3E6C C;  2EV0 A;  4KMU X;  3QOP A;  3ZPL A;  4ZZD A;  1J2X A;  1ZRF A;  2ZBK A;  1RIO H;  2L4A A;  2H6B A;  4A6E A;  4CGZ A;  3ZN0 A;  2VE9 A;  1FP1 D;  1IZ1 A;  1JHF A;  1O3R A;  1P92 A;  1ON1 A;  5HDN A;  2A68 F;  2FU4 A;  3WGH A;  4KT5 C;  2IJL A;  1K78 B;  1BC8 C;  1H9G A;  2QBY A;  5J8F A;  2P5V A;  4WF2 A;  4JQF A;  2YU3 A;  1XD7 A;  1K6O A;  1LB2 A;  4O6J A;  1ZLJ A;  3HYI A;  5BPI A;  5DCM A;  3HTS B;  1OYI A;  3COA C;  5ICF A;  4LG0 B;  3F8F A;  3K1N A;  3CUQ A;  2D2W A;  3T0Y A;  3QU3 A;  3JSP A;  4I02 A;  4AD9 A;  3V8K A;  4PGH A;  5K5R A;  2WTE A;  2HS5 A;  1HKT A;  1RNL A;  3JTG A;  4Y15 A;  3J80 Z;  1BI0 A;  4AVP A;  4RGS A;  2K7L A;  4RGR A;  1EH6 A;  1ZAO A;  3O2P E;  5LHI A;  1QZY A;  3FX3 A;  2IVM A;  3EDP A;  1ZRE A;  2ADU A;  4OOI A;  3I71 A;  3VOE A;  5DUI A;  2MH2 A;  3MZY A;  3CDH A;  3ELK A;  2H27 A;  2EJR A;  2E1N A;  1F4K A;  1IN6 A;  1P6R A;  4GGG A;  2FNP A;  2M1B A;  4MQ9 F;  3BWG A;  1K7A A;  5FLX Z;  2ZCW A;  2R3S A;  5DD4 A;  4P9F A;  2Z33 A;  3F8C A;  3RPU A;  1VTN C;  4EGZ A;  4KNY A;  5L3B A;  3GFJ A;  3MFK A;  4RB3 C;  2BBY A;  2ISZ A;  2XAG A;  1KYZ A;  2RQP A;  3J81 K;  1V4R A;  3ZQ7 A;  1J7K A;  4M71 A;  4P55 A;  2Y48 A;  4HDU A;  3HTU A;  3GX4 X;  1QQI A;  2DT5 A;  2Y75 A;  2ZME A;  3H3U A;  3E5Q A;  1BOA A;  3ZN1 A;  2ELH A;  3Q9V A;  3NEU A;  2LDU A;  3M8E A;  3O3K A;  1MD0 A;  3HSR A;  1TNS A;  1R1U A;  1YQA A;  4M6Y A;  4ENK A;  1KQ9 A;  2GIV A;  1TW3 A;  3QPT A;  1TQI A;  5BOX A;  3QP6 A;  1OKR A;  3I64 A;  3R60 A;  1U5T B;  3VOD A;  2Z99 A;  5H20 A;  4ZYE A;  2Z9O A;  4QLC U;  2A69 F;  2ESH A;  3BPV A;  3LA3 A;  4KYW A;  4YII A;  3FMS A;  3U9G A;  5LHH A;  1FX7 A;  1UFM A;  1B6A A;  4CYD A;  2PI0 A;  3RYR A;  3F8M A;  1BI3 A;  4I7H A;  4HW0 A;  3V7S A;  3QU6 A;  1R1V A;  1YG2 A;  4HX4 A;  5CVV A;  2VBY A;  4A2U A;  3OV8 A;  4EQQ A;  1BI2 A;  2DO7 A;  2F2E A;  3T8R A;  4WXC A;  1ZG5 A;  5EEG A;  3FF5 A;  3PFI A;  1U5T C;  3DP7 A;  1JE8 A;  4YIF A;  4M9Z A;  5DYM A;  4HA8 A;  2HWV A;  1B1B A;  4HAM A;  4E70 A;  2DK5 A;  3KCC A;  3GF2 A;  4G6Q A;  2P7C B;  3KP3 A;  4WK8 F;  4EJV A;  3D0S A;  3TQN A;  3ABU A;  1P4W A;  2IW5 A;  1H9T A;  4WXH A;  3LQR A;  3HRT A;  5ILU A;  1B9N A;  3N97 A;  1IXR C;  5HLH A;  5HS7 A;  3T5X A;  1MJA A;  3M7G A;  1EH7 A;  2JT1 A;  3K9T A;  2CSO A;  2MBF A;  2VT3 A;  4HX7 A;  1ODD A;  4AIH A;  3FXU A;  5DUK A;  2GXB A;  1HXD A;  1Y0U A;  1U78 A;  2K4J A;  3V8J A;  1XB4 A;  1ZYR F;  2QUF A;  1P4A A;  4OIR F;  2P5K A;  1Z6R A;  5K5Q A;  5ICC A;  2PLY A;  1UHM A;  3DQV C;  4LMY A;  2HR3 A;  2DW4 A;  4HBL A;  2P6T A;  2CQK A;  2LSO A;  2F5E A;  1WI9 A;  3I53 A;  2HDC A;  4IF4 A;  3LFK A;  3KP4 A;  5JFR A;  1YS6 A;  4GCV A;  1XDU A;  1HBX G;  1WKM A;  2KJC A;  1R00 A;  5J8C A;  2YX7 A;  1XGN A;  4WXD A;  3CLO A;  1O57 A;  1UST A;  3RDI A;  3F23 A;  5JR3 A;  2LKP A;  3M9A A;  5LRR A;  2VOD A;  3ZMS A;  5TRD A;  1OPC A;  1PDN C;  2HZT A;  1AWC A;  4O5V A;  4A5N A;  4L9N A;  4FT8 A;  1IUY A;  3P7N A;  4L5J A;  3IKV A;  2QBY B;  2KJB A;  4FHT A;  1T0F A;  3HRS A;  2P6S A;  4KIG A;  2PBI A;  5DCM B;  1HST A;  1KQ0 A;  3GVA A;  5E20 A;  3VB2 A;  3T1B A;  4CXF A;  3R61 A;  1W7P A;  4YG2 F;  3QAH A;  1SD4 A;  4LLG F;  3CUQ B;  2GWR A;  5DEQ A;  1QNT A;  5FFZ A;  4OIP F;  3GUD A;  3G73 A;  3P9C A;  2MLG A;  3GWZ A;  1R5G A;  3WG9 A;  1FBU A;  4ETS A;  5K5O A;  3GEZ A;  2OZ6 A;  2IA0 A;  3KFW X;  3HOT A;  1F9N A;  2W85 A;  4Q47 A;  3MAJ A;  1YW8 A;  1YTY A;  1UCR A;  5IT9 Z;  3DKW A;  3FMR A;  1ULY A;  2UXX A;  3SQN A;  3IRQ A;  4HDV A;  1EH8 A;  1R5H A;  4XSX F;  1JGS A;  2EA2 A;  5D6E A;  5L3C A;  2UXN A;  1GXP A;  3KET A;  1MKM A;  4G8X A;  3HOS A;  4P9U A;  1T98 A;  1YIO A;  4LJZ F;  1BIA A;  3FM5 A;  1LVA A;  3U2R A;  3SHF A;  3M8F A;  3CTA A;  3GZ6 A;  4L9V A;  5F6F A;  4B8X A;  1QBJ A;  3GW2 A;  2ZNY A;  1L3L A;  4G9Y A;  2HYG D;  2L3D A;  5A2Q K;  4UXN A;  3JSO A;  3WU0 A;  1RUO A;  2JPB A;  2QWW A;  4M9S A;  1PUE E;  4RB2 C;  4A0Y A;  3DPL C;  3CUO A;  3FM3 A;  3Q5F A;  3M1E A;  3U1D A;  2Q8K A;  1CGP A;  2QVO A;  1HW1 A;  1XCV A;  1W5T A;  2KIU A;  2DAO A;  4U0W A;  2ZME B;  2OD5 A;  2BYV E;  3KP6 A;  1GVJ A;  3F8B A;  2BGC A;  2C6Y A;  1LNW A;  2RVC A;  1W7P D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...